3WU0A

Crystal structure of phosphorylated ets-1 dna binding and autoinhibitory domains (276-441)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein C-ets-1
total genus 45
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu0A00
2DU9A 3R60A 3DP7A 3ULQB 4HYEA 1FYKA 2O3FA 4IHSA 1J5YA 3GFIA 5F64A 3RTRA 2V6CA 1DPUA 5E8GA 4M73A 1HW1A 4I7HA 2GQQA 2LNBA 2DPDA 2XIGA 4OMYA 1YW9A 1IN5A 1W5TA 4R1HA 5JVTA 3U2RA 3Q5FA 5HS8A 1IAWA 3C3WA 4ZYDA 2J5PA 4LJZF 5IT3A 3JTHA 2O8XA 3SZPA 5D6FA 4XSZF 3WTSC 3QRFF 3LWFA 1YS6A 1RZ4A 2UWMA 1R7JA 1DP7P 1OYYA 1FYLA 2E1CA 1K6OA 2HTJA 1F1ZA 2W84A 4UVBA 3RKXA 5CVUA 2DK8A 2V9VA 5CVVA 4HV6A 4ESJA 2M45A 1MKMA 3P7NA 1MDMB 2CQKA 1F5TA 1WQ2A 2CYYA 4XRFA 2HQNA 1SD4A 2VOOA 3ZMUA 5FB2A 2DW4A 2H6CA 3GF2A 1AWCA 2DO7A 1JGSA 3HUGA 2HWVA 2JPCA 1YFHA 1I1GA 4KNYA 1P4XA 2A69F 4LB6B 1HXDA 2FF4A 3H3ZA 5H20A 5D5XB 1WWXA 3F3XA 4KA4A 2G7UA 2EK5A 4EJOA 2ESNA 4Y15A 1BM9A 1USSA 2O6GE 4MTEA 2F5EA 3S2WA 2A61A 4KICA 1UFMA 1Q1HA 3TDUC 2AXLA 3COAC 2OQGA 3BROA 1Z91A 3WTTC 3U9GA 5LGUA 1I5ZA 5ED4A 2CW0F 5E18F 1BC7C 3GVAA 2ISYA 1HQCA 2WV0A 3L00A 5F6FA 2VT2A 2EFWA 1R1UA 2ESHA 5D8LB 2ADUA 4YFNF 1G4DA 1QBJA 2XKOA 1JXSA 2JZYA 3HRMA 3LAJA 3MZHA 1ONVA 3V7CA 5DCMA 5EEGA 3IKTA 1K79A 2VT3A 3QP5A 3MFKA 2H27A 1YYVA 2HKXA 4L5JA 2A07F 2BGCA 3GUDA 1V4RA 1P2FA 3O2PE 1FX7A 2D1HA 5D4SA 4LB5A 4LG0B 4L9NA 1T6SA 4CYDA 1D8KA 1PP7U 2P5VA 4Y17A 2MBFA 2RN7A 3RKWA 3GW2A 3I59A 5BMZA 5CVJA 1FT9A 1QQIA 4ESFA 5L3CA 3K2ZA 3WTZA 1O3QA 3CO6C 2M30A 3QU6A 4CZZA 4KN7X 3V7RA 2XHKA 3VODA 5D5WB 2NYXA 4FHTA 2XAQA 2K27A 1FSHA 4M74A 1FC3A 1KQ9A 2FU4A 3BDDA 2P7VB 2RQPA 4UV9A 2W24A 3F22A 1QPMA 3F23A 1LEAA 3RJPA 4OIPF 5AONA 2EFQA 3KP7A 4UV8A 2KKOA 1Z05A 2P6SA 2M1BA 2RGVA 3LAPA 3CUQB 1ODDA 3IRRA 1FBUA 4RB0A 3F8CA 2EFOA 3GZ6A 1FP2A 2Y75A 5ILVA 4Q47A 3L09A 1ZN2A 2PEXA 3GZ5A 4M9XA 2D2WA 2NS0A 1J7KA 2HR3A 1CF7B 1YG2A 1QZYA 1S3JA 2ACJA 5LEKA 1UB9A 3DKWA 1ZRCA 2EJRA 3V8KA 1KU2A 3T0YA 3LA3A 4MHGA 4U88A 1XMAA 3BJAA 2IRFG 3QOPA 3M8EA 4HF1A 2ZFWA 2YX4A 4WF2A 3ELKA 1HSTA 3W6KB 4A6EA 3SHFA 2NAZA 2DPUA 3NEUA 5H6QA 4LLLA 5ILUA 3I0TA 5BOXA 2XUBA 5HDKA 2JTVA 2WC2A 5BQTA 5DDGA 4KFCA 1S6LA 3WU0A 1BBYA 1FLIA 4AIJA 5D4RA 4ZYHA 4M6YA 3V7SA 2GAUA 3WODF 1R1VA 5F1RA 3FXRA 3RYPA 3J7AO 1BJAA 1XDUA 3SXYA 1IN4A 3FX3A 3Q9SA 5LBQA 1XSVA 2A6HF 2IW5A 3ZMDA 4JQFA 4PGHA 4UHTA 2WTEA 4OIRF 4M9ZA 1UCRA 3KLOA 2Q0OA 5CLSA 2K4BA 1FNNA 5TRDA 2WWYA 5LLQA 1MDMA 4CHUA 2KIMA 1LJ9A 2M87A 3E6DA 1ZH5A 2QBYB 2RDPA 3E5XA 3CJNA 1FBQA 1Z9CA 3BP8A 3GEZA 5HVQC 2E1NA 2EA2A 1A04A 2GIVA 3MAJA 3I71A 1LNWA 4KUMA 4P55A 2RVCA 4CDGA 5BPIA 1KGSA 1OMIA 4BNCA 3WTWC 4KIFA 4G6QA 2H09A 2PMUA 3FMQA 2STWA 3JSPA 2DQRA 2UXNA 2MD5A 3RPQA 4H0EA 3EYYA 3T5XA 1ON1A 5TJJA 4MNUA 2M8EA 5CJ9A 2EA4A 4BAYA 3WG9A 2RV8A 3I54A 1IXSB 3TOAA 5JHUA 1NHAA 5E20A 2HYGD 3CO7C 5DEQA 5LGTA 1SD6A 4Q5SF 2NRAC 3I4PA 2PJPA 2VOPA 2CO5A 1TQMA 1FZPB 1XD7A 2FBKA 3B02A 2VBZA 2EFNA 1U3EM 1W4MA 1TQPA 1L0OC 2XAJA 3BWGA 5IT9K 4S04A 2PLYA 3IWFA 1S29A 3NQOA 4CO8A 1D5VA 1YS7A 4ENNA 1F9NA 1DDNA 3HRSA 4GO1A 3RDIA 5L3EA 4HV5A 2QQAA 1K7AA 3K1NA 1YW8A 3E3VA 3DXJF 1WKMA 2RC4A 3F8NA 1IW7F 4EGZA 4GCVA 1TW2A 2ZO4A 2K86A 4HAMA 4I2OA 4U0WA 1R00A 3FHZA 2VE9A 2QVOA 2QLZA 3J81Z 1R22A 4OU0A 3HSEA 2XGXA 4A2UA 1XGNA 1WSUA 1IRFA 1PUEE 3KP6A 2XROA 1OKRA 1ZRDA 1HW2A 1STZA 3V8JA 3WGIA 4B8XA 1XCBA 3IRQA 4ESBA 3KEOA 4G94A 2VXZA 2XAHA 1Z7UA 4EJTA 5ICEA 1L3LA 3I53A 4U7BA 5ILSA 2PQ8A 1KU3A 4M71A 4NQWA 4BXUA 2PBIA 1RI7A 5J6XA 3M7GA 2R7DA 2W85A 3N97A 1W5SA 2QWWA 3CUQA 3HYIA 4EMSA 4KN4X 3FF5A 3HSRA 1TW3A 1SFXA 4L9JA 4K2EA 4EJUA 2K4JA 4M6XA 2Y0MA 3MWMA 3PQJA 2G9WA 4LLGF 2HTSA 1PDNC 4ENKA 3EDPA 2MLGA 4P9UA 4IVNA 1FP1D 1SD7A 3JAMZ 3I59B 2P7CB 1VTNC 3KZZA 1G3YA 2MH2A 4M9SA 2Y48A 1UHWA 4RAZA 3I5UA 5FLXZ 1ZHFA 2F5CA 1XN7A 2JT1A 4CXFA 1S7AA 3DV8A 3GX4X 4HW0A 5AIQA 1IF1A 1XSXA 5FO5A 5FD6A 2HQRA 2PN6A 4A5NA 1R5HA 4S05A 4IJAA 4A0YA 2H6BA 1OR7A 2A5YB 2X0LA 4YIFA 3ZMSA 1O7FA 1ZG5A 1ZYRF 2A3SA 5HLGA 4P9FA 1E17A 3KFWX 1U5TA 2IP2A 3MZYA 1HKSA 2ISZA 4EM0B 2B0LA 1O57A 1S8NA 3TOBA 1RUNA 3E6BA 5AIPA 2DAOA 1R1TA 2HYFA 3TKYA 2FMYA 2FRHA 2L54A 4I0BA 3RIRA 2Z5UA 1BN5A 2CWEA 3SZTA 2LF7A 2KIUA 3BY6A 4PDKA 1QO0D 2VONA 2EV0A 5HLIA 1D8JA 3FM3A 2L01A 5ICCA 2KIFA 5ERIA 4NB5A 2HGCA 2P5KA 4OOIA 3O6BB 5A2QZ 3HRTA 4U0VA 1W7PA 1ZAOA 1GXQA 3ECHA 2OQRA 3T8RA 5HLHA 4Z2YA 2IA1A 4ZYGA 1EH6A 2MA3A 1S7OA 5D8KB 3C1DA 4OINF 3MEXA 4BYYA 2OBPA 1J75A 2XV4S 3G3ZA 3K69A 3ML6A 4WK8F 3HOSA 3BZ6A 2IA0A 4LK1F 1XB4A 4XSXF 1V3FA 1ZARA 3KLNA 3KP5A 2FQ3A 3ROUA 2OD5A 2FE3A 4LLNA 4LK0F 4QLCU 1U2WA 3F72A 5L3FA 3F21A 5HDGA 5E8IA 3JAMK 1C0WA 4ENJA 2EWNA 4WCGA 4I02A 5ICFA 3GFJA 5E1WA 5FLXK 3WTYC 2KJCA 3WTUC 2CSOA 5LGNA 4HQEA 1G3SA 1HSJA 2PMHA 1FSEA 5LHGA 1MJAA 2NNNA 4FX4A 4JBAA 3HRUA 2LDUA 2PI0A 2ZKZA 3HHGA 1IN6A 2JPBA 3GFMA 3GXOA 3E5UA 1XGOA 2X4HA 4KIGA 1KQ0A 2GXGA 3ZMZA 1X3UA 2ZJ2A 2ZXJA 1XCVA 1EH7A 4HLXA 5LHIA 1HKTA 1USTA 1JHFA 3LQRA 5J8CA 2D45A 3HSFA 4IRIA 5ICGA 4UUVA 5DCFA 3KE2A 4RS8A 4IRGA 5FGMA 4AIHA 2VN2A 3FXQA 2J5OA 3L9FA 1QNTA 2VE8A 3NRVA 2R7FA 1Z6RA 1RNLA 4HF0A 4P5OA 1BI1A 4A0XA 3V8LA 3L2CA 3TQNA 4M72A 3CDHA 3KP4A 3C18A 3JTGA 2O0YA 4G7HF 3C7JA 2XAFA 3TGNA 1LDDA 4BHPA 1KU9A 5LEJA 4BH9A 2MH9A 3OOPA 1DUXC 4OIQF 1O3RA 3P9IA 1ZG3A 4XLPF 4HOBA 2ZNYA 3KETA 3J80Z 4EVIA 4I98B 1GXPA 2OZUA 2Q2EA 4RGXA 4ZZLA 1FPQA 5LRSA 3RI4A 1J2XA 3DQVC 4EGYA 4HX7A 1WRJA 4KIBA 3G73A 2KJBA 1IN7A 1TLHB 2DLLA 5L3GA 1KQ8A 2Z99A 3RPUA 2OU2A 3LA7A 4ASNA 4BHCA 4P96A 2F5FA 2XKPA 1GVJA 1YQAA 2HFHA 2Z33A 1KU7A 4LMYA 1YTYA 1GHCA 3DPTA 1HKQA 1O3TA 3R0JA 3RKYA 2DK5A 1O3SA 3QU3A 1TNSA 3WE3A 3IWZA 2LSOA 4ZYEA 2L4MA 1BC8C 1WI9A 3IC7A 2IA2A 4DNCA 3FXUA 3LSTA 1Z6TA 4RB2C 1KYZA 2ZMEA 5LHHA 4XBFA 2VBXA 2FBIA 3CTAA 1KYWA 1ZGJA 1YO5C 1I1SA 3GWZA 3BOQA 5JI6A 5A2QK 1IRGA 1BIBA 2PG4A 1K78B 4L9TA 4YIIA 4NHJA 2CFXA 4AD9A 4R8HA 5CYVA 5EEHA 2K7LA 1IXCA 4RGRA 3GFLA 1R58A 5DD8A 4LD5A 1H0MA 2FNPA 4PCQA 3LQQA 1T0FA 3MQ0A 4BQAA 4GYGA 4HZFA 1REPC 4I01A 4A12A 2UZKA 1QGPA 1U5TB 2HZTA 4EV0A 1Y0UA 2C6YA 3P9CA 5HS9A 1UHMA 1MJBA 2ZMEB 3SQNA 1FWZA 2DBBA 4HF2A 2STTA 2O61A 3ZN0A 5K1YA 2QQBA 3ISPA 3J80K 5L3BA 1T2KA 1F4KA 3EUHA 4IF4A 2RNJA 4MEYF 3SFZA 2DFIA 2FNAA 3K0LA 4YFXF 4HDVA 1G3TA 1W7PD 2P6TA 1IN8A 4ENMA 4JK1X 2CG4A 5IT9Z 3ZPLA 5DCMB 4IPAA 1FYMA 2GWRA 1YW7A 3Q9VA 2YSRA 2FEZA 4G7ZF 1MZBA 2K02A 2TDXA 2IVMA 2DQLA 2D1VA 3VFZA 4HA8A 4UXNA 3F6VA 5E17F 4BHBA 3AAFA 3ZP5A 1XGMA 2BE5F 3GO5A 2W57A 1Z1DA 5FFZA 1E2XA 3U1DA 4N9IA 3F8FA 1K78A 4PGGA 2DT5A 4IRHA 4FX0A 2DTRA 2OAZA 1LDJA 2ETHA 4Q48A 2FA5A 1H9TA 3WGGA 5D5VB 2JRTA 3DFGA 2FBHA 4KMFA 2P8TA 1J59A 2VBWA 3HOTA 3K1PA 1JE8A 3LA2A 2ELHA 5JR3A 4UVCA 1TNTA 4MQ9F 3TO9A 4RGSA 1BI3A 4WXCA 2VC1A 5BS6A 2KRFA 1G6NA 1JHHA 1P92A 1RUOA 3VEPA 3VOEA 1J9IA 3R61A 2Q8KA 3WU1B 2CGPA 2L3DA 3PFIA 3E5QA 2ZBKA 2E7XA 1FOKA 3BJOA 4HDUA 2P5LC 3WTVC 4N0BA 2HKOA 1B6AA 2O03A 1U5TC 1ZLJA 2F5DA 1BOAA 4MQVA 1LVAA 3F8MA 2YX7A 3QAHA 4CICA 1LDKB 4IHTA 1LEBA 2L4AA 2QYOA 3VB2A 1EH8A 4AWXB 2QENA 2XAGA 5BPDA 3N4MA 2FOKA 3K1MA 4F7ZA 2EV6A 1ZLKA 3KP3A 4A5MA 4YFKF 3IHUA 2L02A 1SMTA 1SD5A 1TQIA 2JSCA 1I6XA 4I09A 1LB2A 2GZWA 3D5LA 1P6RA 1B4AA 2A6EF 2LKPA 3R4KA 4KT5C 3M9AA 3BPVA 3TO6A 1J0RA 2Z3YA 5DYMA 5D5UB 5E1XA 1XMKA 4G6DA 1O7LA 2EV5A 3D0SA 4D0PA 1XSDA 1D3YA 3EYIA 3E6MA 4IXAA 4EQQA 2QQ9A 3BPXA 2Z9OA 4HQMA 1TBXA 5KVRA 2NNYA 3EETA 3FZVA 2GA2A 3DEUA 1P4AA 3REOA 1T38A 4DQ2A 5H6RA 4UNOA 5D6EA 2G7HA 5K5QA 4O3MA 4I0AA 4O6JA 2QM3A 3B73A 1YIOA 3ECOA 4L0ZB 2LF8A 2V79A 4HX4A 2OZ6A 4ETSA 3CUOA 1HW5A 5HS7A 3FMSA 2VBYA 3FM5A 4L9VA 4TV7A 1R5GA 1W7PB 4L5IA 3QP6A 2PFBA 3I58A 3DPLC 3BJ6A 4WXDA 3IKVA 2F2EA 2XRNA 4KDPA 1ZRFA 1R23A 4AVPA 5CVRA 1RIOH 3EQLF 3HTUA 4Y13A 3R0AA 4WXHA 5JFRA 3V4GA 2IT0A 1KA8A 2QBYA 3GYHX 2FSWA 4HLYA 3P9KA 2HDCA 4WX9A 3CLOA 4U7DA 3F6OA 1QZZA 5FD5A 4EJVA 2GXBA 2H94A 3J81K 4RAYA 4PZJA 3ZQ7A 2V1UA 5HDNA 5CVIA 2P4WA 3M1EA 2V1XA 1TTYA 1P4WA 5DUIA 3LFKA 1AOYA 3ABUA 4A0ZA 4KYWA 1G3WA 4A6DA 3I64A 4LFUA 4LG0A 6PAXA 1YLFA 1SFUA 2R3SA 3CUQC 1ZGAA 5DUKA 2VODA 5E1ZB 1ZG1A 3WTXC 1IUYA 5HOOA 4L0YB 5L3DA 3T8TA 1SMYF 3TDZC 1FY7A 1PP8F 1SFEA 2COMA 4G9YA 3KCCA 2AS5F 3E6CC 2FXAA 3R6SA 4LGWA 4QWQA 1SAXA 4Q4ZF 1CF7A 3K9TA 2OA4A 3KZYA 2UXXA 1XGSA 3IL2A 5K5RA 1ULYA 4G8XA 4N9HA 3DF8A 4EJWA 3H3UA 3GLXA 2EB7A 3WGHA 4EM2A 1R36A 2ZNZA 4ON0A 1EV7A 1BI0A 2GA1A 3ABTA 4B09A 4E70A 2W25A 2MC3A 1ZREA 3HIFA 4GXOA 4RB1A 2YPRA 3O3KA 2IJLA 2QUFA 1I27A 4RGUA 4ZZDA 5K5OA 1LQ1A 1OPCA 1T98A 3T1BA 2VC0A 1XDSA 2YR2A 4RB3C 3TO7A 2E7WA 4OIOF 3ERED 2RKHA 1ON2A 2ZCWA 4KMUX 1MJ9A 1DPRA 3FWEA 5FFXA 4FT8A 4L18B 3ZMTA 2HEOA 5KK1A 2HS5A 2MLKA 1HBXG 4HX8A 3ZN1A 1OYWA 1U8RA 1H9GA 1BIAA 2XVCA 2V1DA 3KP2A 1CGPA 1IXRC 2BYVE 2IPQX 4O5VA 4U0YA 4R79A 1B59A 3RYRA 3F8BA 4EM1A 4YG2F 2BBYA 1U6GA 1B1BA 4G7OF 3W6JB 2A68F 3ZMVA 2BV6A 4XLNF 3OV8A 2XASA 4MTDA 4CGZA 4GYIA 3WE2A 4UVAA 4WWCA 4MGRA 3MCZA 4ZH4F 5J8FA 3JW4A 2M5WA 1B9NA 2DI3A 1BI2A 5DD4A 1MD0A 4MEXF 2HOEA 3QPTA 1IZ1A 3KEQA 2QZ8A 4OMZA 1U78A 3M8FA 3HTSB 3L7WA 4AIKA 3HHHA 5LRRA 3E97A 4HBLA 3H92A 4GGGA 2BEOA 1FBSA 1MGTA 3FMRA 3JSOA 1B9MA 3PQKA 1OYIA 2FMLA 2EFPA 2YU3A 1T39A 3QPHA 5DV5A
chains in the Genus database with same CATH superfamily
2DU9A 3R60A 1VQLI 2GLOA 2L7KA 3UNGC 3DP7A 3ULQB 2DTZA 4HYEA 2FJ1A 2O3FA 1FYKA 4IHSA 3F0CA 3SYTA 1J5YA 3GFIA 2BHZA 5F64A 1WH5A 3RTRA 3CZ6A 5F0HA 2V6CA 1DPUA 3GZNB 5E8GA 3S14J 4M73A 1HW1A 4BBRJ 4I7HA 1Z21A 5FJ8J 2GQQA 2LNBA 2DPDA 4BL0B 1NK2P 1OJLA 1I39A 2XIGA 4A93J 1V5FA 4OMYA 1YW9A 2CW8A 1IN5A 1W5TA 4R1HA 2RAEA 5JVTA 2DA3A 1FOXA 3U2RA 3Q5FA 5HS8A 1IAWA 3GTPJ 3A0BC 3C3WA 2ME6A 4AM3A 4ZYDA 2J5PA 4LJZF 4B47A 5IT3A 3JTHA 2O8XA 4QIWN 4GRIA 4X0GA 4A3MJ 2VQLA 2V4JC 3HPGA 3SZPA 3HL2A 5EJCA 5D6FA 3SEZA 4XSZF 3WTSC 3QRFF 3M07A 3I3LA 4ZC3A 4E6KG 1DGWY 3K4NA 3LWFA 2BXZA 5JVGF 3KIOA 1YS6A 1RZ4A 2UWMA 3H9JA 1R7JA 5GADJ 1OCRH 1DP7P 3K10A 4RLQA 3KYCB 2XAUA 1OYYA 1S5LC 1FYLA 2B63J 2E1CA 2Y2ZA 4BDZA 1K6OA 2DT7B 2HTJA 2DA2A 1F1ZA 1SC7A 2W84A 1SVLA 4UVBA 3RKXA 5CVUA 2BVLA 3GTOJ 2DK8A 2HXOA 2V9VA 2X6WA 1DQUA 5CVVA 3TW6A 1OCPA 4HV6A 4ESJA 2M45A 1MKMA 3SDBA 3P7NA 5GAGJ 1MDMB 2CQKA 2DYRH 5J3LA 2DOEA 2L9VA 1I3QJ 1WQ2A 1F5TA 2CYYA 4JOMA 4P1WA 4Y7NJ 4BS9A 3EUKL 2V1NA 4XRFA 5IOYA 3HOXJ 1Z7LA 1W36D 2HQNA 1SD4A 2VOOA 3ZMUA 5FB2A 2DW4A 4CZCA 2K3PA 4AC0A 2H6CA 3GF2A 2Y31A 1AWCA 3GTJJ 3RZDJ 1UZCA 5M3FJ 2R7RA 2DO7A 3VYUB 1JGSA 3HUGA 2NS7A 3ONQA 2F6CA 2JN6A 2VL8A 2HWVA 1UMQA 1JJ6C 3MKLA 2JPCA 1YFHA 3LMMA 2NOJB 1I1GA 3FXMA 4KNYA 1P4XA 1YI2I 2A69F 2ZB9A 3FBNB 4LB6B 1FMVA 1HXDA 4PUSA 2FF4A 3H3ZA 5H20A 4IOCF 3GMEA 2DJIA 5D5XB 2CU7A 1NK3P 3K70D 1OISA 1WWXA 3F3XA 4KA4A 2G7UA 2EK5A 4EJOA 2ESNA 2BOLA 1MIJA 4IQ4A 3MKZA 4Y15A 1FTTA 3DWLE 1BM9A 1USSA 2O6GE 1MBGA 4MTEA 4GFBA 2M0CA 2F5EA 3S2WA 4BY7J 2X6XA 4E7JA 2A61A 3ABLH 4KICA 4RAGA 1JKRC 2IEKA 1UFMA 1MMDA 2EZIA 1M1EB 1HA8A 1Q1HA 3TDUC 2ZSHB 3BTCA 2KRHA 1YHQI 2AXLA 3COAC 2OQGA 3BROA 1Z91A 3ZQCA 3WTTC 3U9GA 5LGUA 1I5ZA 3BTJA 2CW0F 5ED4A 3CCVI 5E18F 2R5ZA 2M2EA 1BC7C 3GVAA 1QPIA 5FRNA 3AG4H 2ISYA 3DBLB 1HQCA 2WV0A 1HDPA 1MNDA 3L00A 2IGNA 2DA5A 4D9JA 5F6FA 2VT2A 5CQEA 2EFWA 1R1UA 2ESHA 4FETA 1AKHA 3HOZJ 5D8LB 2ADUA 2VB6A 4YFNF 1G4DA 1QBJA 2XKOA 4NDLA 3FDYA 1JXSA 2OPTA 2KFDA 3K6GA 3QQAA 1VZ0A 5DS9A 1IC8A 1G59A 2JZYA 3HRMA 2XPVA 3RQIA 2E19A 3QOEA 3W3CA 3LAJA 3MZHA 2TRTA 1ONVA 3E0JB 4KT6A 1MSEC 3V7CA 5DCMA 5EEGA 3IKTA 1T08B 1POGA 1K79A 2I10A 2VT3A 3QP5A 2VQCA 1HOMA 2VLAA 1PUFA 4JX5A 3MFKA 1FIAA 3ABKH 3GTQJ 2H27A 3L2QA 1YYVA 2WB1A 2HKXA 1R6RA 4L5JA 2A07F 5IYDJ 3OYIA 2JA7J 3HEFA 4IEJA 1X1DA 2WY8Q 2EZLA 2BGCA 3GUDA 1V4RA 4OAYA 1BW5A 1PUFB 3ABMH 1P2FA 3O2PE 1MNEA 1FX7A 2D1HA 3PNYA 3K7AJ 5D4SA 4LB5A 4LG0B 4L9NA 1T6SA 4CYDA 4A3LJ 2M0MA 3RZOJ 1N75A 1D8KA 1WJ5A 1PP7U 2K5CA 2WB1N 2P5VA 4Y17A 2HDWA 3P5JA 2MBFA 2RN7A 3RKWA 3GW2A 3I59A 1XS9A 5CVJA 3DPUA 5BMZA 1FT9A 1QQIA 4XKVA 2ME0A 2LC2A 4CCJA 4ESFA 3CCUI 5L3CA 3VYRB 3ZRGA 3K2ZA 3OYEA 2K9SA 2R5YA 4H4KC 3WTZA 2AHQA 2WAEA 3IH4A 3LOCA 4M3FA 1O3QA 3CO6C 2M30A 4XKCA 4Y3OA 3QU6A 5B66C 4RM2A 3ZOBA 2NVUB 1IDZA 2F5VA 1ZR2A 1VQ7I 4CZZA 4KN7X 3V7RA 2XHKA 3VODA 3PSFA 1TWHJ 5D5WB 2IS2A 3IH3A 1OCOH 3HOVJ 3PM1A 1OFCX 2CQ7A 2NYXA 3QPHA 4FHTA 2Y9ZA 2XAQA 1GVDA 2K27A 4XLCA 4IO9F 1FSHA 4PSWA 4XMYA 4M74A 5C3EJ 4IL6C 2LRDA 1SFOJ 1FC3A 1KQ9A 4M3BA 4IKFA 4UB6C 3OYLA 4E7LA 3J7YJ 1WJBA 2R7OA 2FU4A 1ZGWA 3BDDA 1YJNI 2P7VB 5F0CA 2H1KA 2QCOA 4ZDPA 3OOUA 2VKVA 3SEQA 2RQPA 3IH2A 4DOZA 4V2GA 4UV9A 2W24A 4BE0A 3BLYA 3F22A 4ZJZA 2K3FA 1QPMA 1LFPA 2Y9YA 1LEAA 3HXLA 3RJPA 5AONA 3FIWA 3F23A 4OIPF 3A2KA 2EFQA 5F1JA 1PYVA 3KP7A 5JLWA 2HOAA 4UV8A 1WH7A 2KKOA 2M34A 1Z05A 2P6SA 2M1BA 2RGVA 2LREA 3LAPA 3CUQB 1ODDA 1Y1VJ 3IRRA 1FBUA 2R7TA 4RB0A 4HEA2 3F8CA 4AIDA 5EEAA 4DYRA 1VQ8I 5C44J 2EFOA 3GZ6A 1B72A 1FP2A 2Y75A 3DU6A 5ILVA 4Q47A 3L09A 2JSPA 1A5JA 1ZN2A 3MD2A 3M8JA 4D7MA 1JKOC 4J00A 2PEXA 3GZ5A 4M9XA 4BQQA 3ZQGA 2OTLI 1Z3YA 2D2WA 2NS0A 2R0QC 1J7KA 5F0FA 2HR3A 3S2DJ 2EINH 1CF7B 1YG2A 1QZYA 3OIQA 1S3JA 2ACJA 5LEKA 1RR8C 2HU9A 1UB9A 1TWAJ 5KNLA 3HBLA 3DKWA 1ZRCA 2EJRA 2L9NA 3V8KA 1KU2A 3T0YA 1AKHB 5IYCJ 3LA3A 4MHGA 5EZHA 2NXNB 4U88A 2DFHA 3GBGA 3CMYA 4YIRX 3ASOH 2LFBA 1XMAA 2HPMA 3BJAA 4ITVA 2IRFG 3QOPA 3M8EA 4BE1A 2BW3B 4HF1A 2ZFWA 2YX4A 4ZTJA 4WF2A 3ELKA 5E3MA 2V7FA 1HSTA 1W0TA 5K7ZA 4RMNA 3W6KB 4A6EA 2VJJA 3SHFA 2NAZA 2DPUA 2MFZA 3NEUA 5H6QA 4LLLA 5ILUA 3I0TA 5BOXA 2XUBA 5HDKA 4BDYA 2JTVA 2WC2A 4RM3A 2A05A 5DDGA 5BQTA 4FCYA 2E35A 4KFCA 1S6LA 3WU0A 1BBYA 1K4SA 1FLIA 4AIJA 5D4RA 5DM7F 4UUSB 3VWBA 5HODA 4ZYHA 4M6YA 2CS3A 3V7SA 2VIXA 2GAUA 3WODF 1R1VA 3KX2A 5F1RA 2PMZA 1X1CA 3FXRA 3RYPA 3J7AO 1BJAA 1XDUA 4QTRA 3UKGA 3TP0A 1Z77A 3SXYA 1F43A 2VKDA 1IN4A 3FX3A 2O8KA 2JA8J 4LOCA 3Q9SA 3MVPA 1XSVA 2A6HF 2IW5A 3SDGA 5LBQA 3ZMDA 4JQFA 4PGHA 3CCLI 4UHTA 1D0YA 4A3EJ 3CD6I 2MABA 2WTEA 2JUGA 3HJEA 4OIRF 5B1AH 1LE8A 1SEUA 1IG7A 1N25A 4LITA 3HGYA 2LOOA 3S93A 2GM4A 4M9ZA 1UCRA 3LSMA 1MSFC 3KLOA 3OYFA 2Q0OA 5CLSA 4C30A 2K4BA 1FNNA 2R5ZB 5TRDA 5E3LA 3DKYA 2WWYA 5F08A 5LLQA 1MDMA 3CCMI 1D5YA 4CHUA 2KIMA 1LJ9A 1IV8A 4C3HJ 3MKWB 2M3AA 2M87A 3E6DA 3OYDA 1ZH5A 2QBYB 4HRIA 2RDPA 3E5XA 3CJNA 1FBQA 4D5FA 2RQQA 3BP8A 1Z9CA 1ETVA 3GEZA 5HVQC 1MW7A 3O8HA 1JUPA 3VSKA 5JHFA 3DTIA 4XLAA 2LBFA 2W82A 2E1NA 3OIPA 1S72I 3CP8A 3S3MA 1ZKGA 3H5RA 2EA2A 1A04A 2GIVA 3MAJA 2KRCA 2W00A 2QA4I 4Y52J 3I71A 1LNWA 2E5NA 4KUMA 1APLC 2K85A 3GLLA 4P55A 2RVCA 4CDGA 5BPIA 4NNJA 3PO3J 1KGSA 2K40A 1EKEA 1OMIA 4BNCA 2DMPA 3WTWC 1P9QC 2K9LA 4KIFA 3OSFA 4G6QA 5J47A 3AL0C 3EUAA 2IAIA 2H09A 3CQZJ 2AQEA 2PMUA 3FMQA 2STWA 3JSPA 2CUJA 2DQRA 5M5XJ 3WHCA 1FIPA 1R4MB 2UXNA 2MD5A 3RPQA 4H0EA 3EYYA 5TISC 3T5XA 1ON1A 4E7KA 2LK2A 5TJJA 2NS8A 3BC8A 2LKSA 2VJ5A 4MNUA 4BJ6C 2M8EA 5CJ9A 2EA4A 3TBIA 2CMPA 3WG9A 4BAYA 1F36A 1D0ZA 2RV8A 3I54A 1IXSB 2OUMA 4MLOA 3TOAA 2ZJPF 2KMUA 1NHAA 5JHUA 5E20A 2HYGD 1RRJA 1GDTA 3ZQIA 5KAFC 4RAFA 3E1SA 4DBQA 3CO7C 4J19A 2HDDA 5DEQA 5LGTA 1QU3A 4OWRB 1SD6A 2E5ZA 3H0GJ 3PO2J 4Q5SF 2E2JJ 2NRAC 3I4PA 4IHYA 1YRNA 2DDBA 2PJPA 2VOPA 2CO5A 1TQMA 1FZPB 2E1MB 1XD7A 1QRYA 5FLVA 1MH3A 2FBKA 3IV5A 1VQOI 2XRLA 3B02A 2VBZA 2EFNA 1OLTA 1U3EM 1W4MA 1TQPA 3QODA 3CF2A 1L0OC 4AU7A 2XAJA 3BWGA 2JQ7A 3HM5A 3W2VA 5IT9K 4S04A 2PLYA 4G6TB 3BQZA 3H0DA 4JP0A 3IWFA 3DU5A 1U9NA 1S29A 3NQOA 4CO8A 4HNTA 2HXIA 3OYKA 1D5VA 5EG0B 1YS7A 4ENNA 1F9NA 1DDNA 3HRSA 4GO1A 3A02A 3RDIA 5L3EA 4HV5A 2QQAA 1K7AA 4XKWA 2BW3A 3K1NA 1YW8A 3B6CA 2R7XA 1IUFA 3E3VA 3DXJF 1RESA 1WKMA 2RC4A 3CJTB 2XSDC 2WA0A 3F8NA 2DYSH 2LBFB 2ID3A 1IW7F 4QSHA 3TW7A 2D5VA 2E71A 2XGEA 3GTGJ 4EGZA 4GCVA 2CV0A 1TW2A 2ZO4A 2K86A 4HAMA 2KT0A 3CLQA 4A3FJ 4I2OA 4U0WA 3E7LA 1R00A 4I76A 1X1AA 4ZYAA 2L7ZA 3CJQB 3FHZA 3AG3H 2VE9A 3M3YJ 4A3KJ 2QVOA 2QLZA 3J81Z 3CCJI 4XRSA 1R22A 2O5RA 4OU0A 4DW6A 3HSEA 4A3GJ 2XGXA 5FKOA 1LFUP 2M4GA 4A2UA 1XGNA 3BCBA 4DBRA 1WSUA 1IRFA 1V55H 1A35A 1PUEE 3KP6A 2XROA 2XSJC 1OKRA 1ZRDA 5J40A 3ZR8X 5EGOB 4BGDA 2QSFX 1XPXA 4CH7A 1HW2A 4XORA 2W1OA 1STZA 3V8JA 2K9NA 1Y56A 4B8XA 3WGIA 1JKPC 1XCBA 3IRQA 4ESBA 3KEOA 2AXTC 3QYEA 4G94A 1HF0A 2DA6A 2VXZA 2XAHA 2EZKA 5JLXA 1Z7UA 1VQ6I 3FKJA 3QWLA 2KPMA 2W4SA 1VQMI 4EJTA 3AL0B 5ICEA 1L3LA 3SJMA 1IV6A 4A3DJ 3I53A 4MIMA 4U7BA 2M7BA 3B6AA 5ILSA 2VI6A 3G2BA 2ZXIA 2PQ8A 4F91B 5LFAA 3RCOA 1HCRA 1KU3A 4M71A 4XR6A 4NQWA 4BXUA 2PBIA 2WAQA 1R9TJ 4FE4A 1RI7A 5J6XA 2DMTA 2DMUA 3M7GA 2OF7A 3PUFA 2R7DA 2W85A 3N97A 2HOTA 1W5SA 2QWWA 3H5AA 1V5EA 2ZSIB 3CUQA 3FISA 3HYIA 4EMSA 4BE2A 2E2HJ 3A1YA 3DBRB 3FF5A 4KN4X 3HSRA 1TW3A 3G6EI 1SFXA 4L9JA 4K2EA 3PUBA 2WY7Q 3NWTA 4EJUA 3S1QJ 2K4JA 4PFOA 3TL4X 3KYDB 3HKZA 4D5CA 3S17J 1H8AC 2R7UA 4UUTA 4M6XA 3ZXSA 2EQRA 1AA7A 3LSPA 2Y0MA 3MWMA 3S8PA 5C4XJ 2E1MC 2X1DA 3N05A 3PQJA 4XIDA 1ZQ3P 2CV1A 1WJEA 2G9WA 2H8RA 4LLGF 3GTLJ 1BR2A 4N4NB 2HTSA 2X1CA 1PDNC 4ENKA 1MMNA 3EDPA 2MLGA 2EBIA 4P9UA 2F48A 4IVNA 2BHYA 1X2NA 3C2BA 1H88C 2LG4A 1MNMC 1FP1D 1SD7A 3L2VA 3JAMZ 3I59B 2P7CB 1ETQA 1VTNC 1E3HA 3HKZN 3KZZA 1G3YA 2L0KA 2MH2A 4M9SA 3RSNA 2Y48A 1UHWA 1UHSA 3O8GA 1DGRM 3WG7H 2VPLA 3VDXA 4RAZA 4MO7A 3I5UA 5FLXZ 1ZHFA 2EIMH 2F5CA 1XN7A 2JT1A 3LL7A 2KIQA 1IRZA 4CXFA 3OS0A 2R7VA 1H89C 1S7AA 1WJAA 3DV8A 1FEXA 3GX4X 1BA5A 4HW0A 5AIQA 1IF1A 3I4NJ 4Y33A 4XKBA 4CYCA 1XSXA 5FO5A 5FD6A 1GV2A 2MD0A 2HQRA 2PN6A 4A5NA 2EIKH 1R5HA 4S05A 3S1MJ 2PJRB 3SZGA 4IJAA 4A0YA 1ZR4A 2JMWA 2H6BA 2ZJRF 1OR7A 2A5YB 4NC7A 3S2HJ 2KZVA 2EH3A 1D1AA 3ESWB 2X0LA 4YIFA 3ZMSA 1KONA 2F4MB 1O7FA 1ZG5A 2MW8A 1ZYRF 4J01A 4JX6A 3S15J 2A3SA 4C2UA 1FMWA 5IP9J 1S9HA 5HLGA 4P9FA 1E17A 4F93B 3BR1A 1IRXA 3KFWX 1U5TA 5FRMA 2IP2A 3MZYA 3VPRA 2LY9A 1HKSA 2ISZA 2GBYA 4EM0B 3IP4B 1WHUA 2B0LA 1O57A 1S8NA 4W1UA 2HQ5A 1IJWC 3TOBA 3BG9A 2QSHX 3J7AY 1WGXA 4FISA 3CCSI 3E6BA 1RUNA 4V19K 5AIPA 2DA7A 2DAOA 3L2RA 1R1TA 2HYFA 3TKYA 2FMYA 3M1CA 3OL4A 3OR1C 2FRHA 2L54A 4I0BA 3RIRA 1T56A 2Z5UA 3DKXA 1BN5A 2DN0A 2CWEA 3FXJA 1ETXA 3SZTA 4BKXA 5F04A 2LF7A 2KIUA 3BY6A 3PSIA 4PDKA 4B4CA 4CCNA 1RR7A 2JJ7A 3H35A 2KP6A 4BJ5C 1QO0D 1BW6A 2KZGA 2DA1A 1JKQC 2R7WA 3OS2A 2VUMJ 4A3CJ 2VONA 3OIOA 2EV0A 5HLIA 4DZPA 1D8JA 3FM3A 3GTKJ 1ETWA 3VYSB 1SANA 1MBFA 2L01A 4A3IJ 5ICCA 2KIFA 5ERIA 3CC7I 4NB5A 2VJ4A 3HGGA 2HGCA 1K6YA 2P5KA 2Z2SB 2LMDA 4OOIA 3S16J 3O6BB 1E3OC 4HSRA 5A2QZ 3HRTA 2WV1A 4U0VA 5FKLA 1W7PA 1A6QA 4PJ0C 1IGNA 3PJRA 1ZAOA 1GXQA 3ECHA 3M4OJ 2UV1A 2OQRA 2PMZN 3T8RA 2HVRA 5HLHA 4Z2YA 2IA1A 3LSKA 1EH6A 3ZQQA 2MA3A 4ZYGA 1S7OA 5D8KB 3C1DA 1X3WB 4OINF 2ELKA 2JWTA 3VSLA 2L2OA 3MEXA 4BYYA 2IS4A 2OBPA 1J75A 2OCEA 5J4VA 1FJLA 4F55A 4D1QA 2XV4S 4XOPA 3LNQA 3G3ZA 3K69A 3ML6A 4WK8F 2JRMA 3HOSA 3BR5A 3BZ6A 1MMGA 4XQFA 1VF9A 2Y69H 2MC4A 2IA0A 4LK1F 3MMYB 1XB4A 5GPCA 4XSXF 1V3FA 1R71A 1MBEA 1ZARA 3KLNA 3KP5A 5DM6F 2FQ3A 3ROUA 4D7NA 1JJ8C 2OD5A 2N8GA 3OYGA 5J1YA 2R7SA 3EPZA 2G0EA 3K4CA 3LFUA 4CA0A 5IPAA 2FE3A 3CESA 1RPWA 4CCMA 3PIPF 1K83J 5KCMA 4LLNA 2QQ8A 3G1LA 2LLKA 4LK0F 1G8XA 1XMXA 1R5ID 4QLCU 2R7ZJ 1U2WA 3F72A 5L3FA 2LVSA 1BR1A 2FUG2 1G2HA 2WAQN 1RETA 3F21A 5HDGA 1U8BA 5E8IA 3JRGA 2DCEA 3D5RC 2JK3A 3JAMK 4IX7A 1Y39A 1C0WA 4ENJA 4BY1J 1X4OA 1WJCA 2L5QA 2EWNA 4WCGA 3ASNH 4I02A 5ICFA 3GFJA 5E1WA 3OYNA 2L7MP 5FLXK 2P0WA 5IOZA 3TP3A 4S0HB 3WTYC 2KJCA 2OJED 2VPRA 2CSOA 4BQOA 5LGNA 3WTUC 3CC2I 3JRFA 4BBSJ 4HQEA 2VKEA 1G3SA 4G12A 1RC9A 4JX4A 1HSJA 2LH9A 1FSEA 2PMHA 2HI3A 1MJAA 2NNNA 5LHGA 5GTIC 2IGKA 1JT0A 4FX4A 4JBAA 3HRUA 2LDUA 2PI0A 2ZKZA 2RREA 3HHGA 1IN6A 2JPBA 1EJ9A 3GFMA 3GXOA 1ACIA 2DDAA 3L2UA 3G1MA 3E5UA 3HPHA 1UJ8A 2XPWA 1XGOA 4BUPA 5GTHC 1UAAA 4XN0A 2X4HA 4KIGA 2DA4A 3ZCOA 3A01B 1KQ0A 2GXGA 3ZMZA 1X3UA 2ZJ2A 2ZXJA 1QVUA 4XRMA 1XCVA 1EH7A 1SVMA 4HLXA 1P7IA 3OWTA 5LHIA 1HKTA 1USTA 1JHFA 3LQRA 4F92B 3ERMA 5J8CA 2D45A 2BVMA 3HSFA 4IRIA 2E60A 5ICGA 3HOWJ 4UUVA 2VQGA 5DCFA 3KE2A 1Z3XA 4RS8A 4IRGA 5FGMA 2HYJA 2WADA 2IGMA 4AIHA 2VN2A 3FXQA 4QPQA 3D1NI 2J5OA 3L9FA 5CPRB 1QNTA 2VE8A 3FK6A 3NRVA 5E3NA 2R7FA 1Z6RA 2NOGA 2YUSA 3CDIA 1RNLA 4HF0A 4P5OA 1BI1A 2DMQA 2K9QA 4E7SA 4A0XA 3FXKA 3V8LA 3L2CA 3DTKA 3TQNA 4M72A 2JA5J 3CDHA 1ETKA 3JRHA 3KP4A 3C18A 3JTGA 2O0YA 4G7HF 2X51A 3C7JA 3FK7A 2XAFA 3Q3SA 4NBQA 3TGNA 1LDDA 3JRBA 4BHPA 4YRVA 1KU9A 1OQYA 5LEJA 1FOYA 1YIJI 5IP7J 3BZCA 4BH9A 1N78A 2MH9A 3OOPA 4PJJA 1DUXC 3H1CA 4OIQF 2LY1A 2EZHA 1O3RA 3HC7A 4I6ZA 1B72B 3P9IA 1ZG3A 3S32A 4XLPF 4HOBA 2ZNYA 2HOSA 3KETA 2CUFA 3J80Z 4EVIA 4I98B 1GXPA 4C3IJ 3MN2A 3NWSA 4UB8C 2OZUA 4MFEA 2IGOA 1RKWA 1IDYA 2Q2EA 4RGXA 4W97A 4ZZLA 4U87A 5HLTA 1FPQA 5LRSA 3HOYJ 3G4SI 3RI4A 1U9OA 1J2XA 3DQVC 3BTIA 4EGYA 3AKZA 4HX7A 2E36A 4NC6A 1WRJA 5FLMJ 2KQRA 1NG7A 4OAZA 1EA3A 1TT5B 2OCCH 4KIBA 4XM3A 5DTDA 1MH4A 3G73A 2KJBA 2DFFA 2HZDA 1IN7A 3K70C 1TLHB 2DLLA 5L3GA 1KQ8A 4LIUA 2Z99A 3RPUA 2CUEA 1SVOA 4CSWA 1NG6A 2KDZA 2R92J 2OU2A 2L7FP 3SFIA 3S1RJ 3GTMJ 3LA7A 4ASNA 4BHCA 5EZGA 4P96A 1Z0XA 2WBMA 2F5FA 2XKPA 1X4PA 1GVJA 1YQAA 1VI0A 1SFKA 3ZGKA 3D5SC 2HFHA 2EPFA 2Z33A 2DODA 1KU7A 4LMYA 1YTYA 3DEEA 1CQTA 1LE8B 1GHCA 3DTEA 3DPTA 2H8WA 1HKQA 1O3TA 3R0JA 3RKYA 3JRDA 4HSTA 2COBA 1K4TA 2DK5A 1MMSA 1O3SA 3QU3A 1TNSA 3H3VK 1MMAA 1YITI 5FKMA 3WE3A 3IWZA 4HNUA 2LSOA 4ZYEA 4RA2A 1RKTA 1GLNA 1X1PA 2L4MA 1BC8C 1WI9A 3IC7A 1KZHA 1OCCH 4XONA 2CV2A 4L5EA 2IA2A 3FHNA 4DNCA 3CDLA 4EEFG 3FXUA 3LSTA 1Z6TA 4RB2C 1KYZA 3W2WA 2ZMEA 4XL9A 3PNVA 5LHHA 2I8DA 4KITB 3FKIJ 4XBFA 5FROA 2LP0A 4M3DA 5K7HA 2VBXA 1YJWI 2BY1A 1HC8A 2FBIA 3OS1A 1WFXA 3CTAA 1KYWA 2KL4A 4B3AA 5IY5H 4NUBA 3OYBA 2CQXA 3WU2C 1ZGJA 1T33A 1YO5C 3GWZA 1I1SA 3BOQA 5JI6A 5A2QK 4PJLA 1IO2A 1HLVA 1IRGA 4DJAA 2PX9A 2IBDA 3L1PA 1BIBA 2QF7A 4I99C 1YX5A 1TWFJ 3S3NA 3AG2H 2PG4A 2LR8A 2FQ4A 2DOFA 1K78B 4L9TA 3DEWA 2V26A 4YIIA 2CFXA 4NHJA 2MYSA 4AD9A 1MBHA 1ETYA 1ZTRA 1MBJA 4R8HA 3I9V2 5CYVA 5EEHA 3PIOF 2K7LA 1IXCA 3QPLA 1X3ZB 4RGRA 3QYFA 1VQPI 3GFLA 1R58A 2X6YA 5DD8A 4NC8A 4CCLA 4LD5A 1H0MA 3G1OA 2CH0A 2FNPA 2FD5A 2HVQA 4PCQA 3LQQA 1T0FA 3MQ0A 1VQ9I 4CUGA 4GYGA 4BQAA 1WPKA 2BY2A 4BJTA 2CW7A 4HZFA 5C4JJ 3BCAA 1REPC 4I01A 4A12A 2UZKA 1VQKI 1QGPA 1U5TB 2HZTA 1SAUA 3S1NJ 3BR3A 2QKMB 4DYCA 4EV0A 1Y0UA 2C6YA 3P9CA 5HS9A 1B8IA 1UHMA 1MJBA 2JUCA 1V5GA 2ZMEB 3CCEI 4B1RA 2X85A 3SQNA 4DZJA 4XLEA 1TC3C 1VQ5I 1GT0C 1FWZA 2DBBA 3OYMA 4HF2A 2W48A 3U21A 2STTA 2O61A 1I3AA 3ZN0A 5K1YA 1R49A 2QQBA 2K9MA 4RLFA 3ISPA 3J80K 4QPOA 5L3BA 1T2KA 4YELA 1F4KA 4ABZA 3EUHA 1FOWA 4IF4A 2RNJA 4MEYF 3SFZA 2DFIA 2FNAA 4M3EA 3K0LA 4YFXF 4HDVA 1G3TA 1GV5A 1W7PD 2P6TA 4FASD 5EF6A 1IN8A 3L2WA 4ENMA 4JK1X 2CG4A 2Y30A 5FKNA 1K61A 3JRCA 4Z6YA 5IT9Z 3ZPLA 1TZLA 2I5UA 5DCMB 4IPAA 1FYMA 2GWRA 1J09A 1YW7A 3V42A 3Q9VA 3FXLA 1A6IA 2YSRA 1E0EA 1PJRA 2XF6A 2FEZA 4G7ZF 2BZTA 1MZBA 2K02A 2TDXA 3K2AA 2IVMA 2DQLA 2D1VA 3VFZA 4HA8A 2DFEA 4B43A 3BG7A 4HPQA 4UXNA 3F6VA 5E17F 2MG4A 4BHBA 3AAFA 1O4XA 3ZP5A 1XGMA 4XLFA 2BE5F 2O7OA 2W57A 3GO5A 2Z1DA 1Z1DA 2X9DA 5GAHJ 5FFZA 1E2XA 3U1DA 4N9IA 3F8FA 5EGOA 1K78A 4PGGA 2P81A 3BG6A 5GPAA 2DT5A 4IRHA 4FX0A 2DTRA 2OAZA 2EILH 4Y4RA 1LDJA 3RQ4A 2ETHA 4Q48A 2FA5A 3OYAA 1H9TA 3WGGA 5D5VB 3BTLA 2JRTA 2XB5A 3DFGA 2FBHA 4KMFA 2P8TA 4RBOA 3DBHB 1J59A 1OR7C 2BXYA 4HNVA 2VBWA 1P7JA 3HG9A 3K1PA 3K4BA 3HOTA 1JE8A 1JUMA 1QHGA 3FXOA 3A4CA 3LA2A 5J1UA 2ZXWH 2JVHA 3KEYA 2ELHA 5JR3A 3H9QA 3IUOA 4UVCA 1TNTA 4MQ9F 3TO9A 1Y1WJ 2X1EA 2NVTJ 4RGSA 1BI3A 3K4MA 4X6AJ 4XRSG 1UG0A 3X2QH 4WXCA 1JGGA 2VC1A 5BS6A 2VKHA 2KRFA 1G6NA 1JHHA 1P92A 3LSJA 1RUOA 4E7ZA 2F4OB 3VEPA 3VOEA 1W0UA 1J9IA 3R61A 2Q8KA 1JI8A 5K7FA 3WU1B 2CGPA 2L3DA 2A6TA 1HDDC 2M4KA 3PFIA 4GDFA 3E5QA 2ZBKA 4PFPA 2E7XA 1FOKA 3BJOA 1ZK8A 4HDUA 2P5LC 3WTVC 4N0BA 2HKOA 2OV7A 1B6AA 2O03A 1U5TC 1ZLJA 4DIQA 3HUGB 3OYJA 3A03A 1NTCA 2YU9J 3QYBA 3A0HC 1T8IA 1FTZA 2F5DA 2ZMEC 1AU7A 4XLHA 1BOAA 2KHMA 2OC6A 2WAFA 3TMOA 4MQVA 1LVAA 3F8MA 2YX7A 3QAHA 1YRNB 4CICA 1LDKB 1QHHD 2ZJQF 1A36A 4IHTA 1LEBA 1TT0A 2L4AA 2QYOA 4F3QA 3VB2A 2FOWA 1EH8A 4AWXB 1VNDA 1LPQA 2L9SA 2QENA 2XAGA 4FTHA 5BPDA 3N4MA 5E79C 3DCFA 1EF4A 1U0JA 2FOKA 2F4IA 5CKTA 3K1MA 3OYHA 4F7ZA 2EV6A 1ZLKA 3KP3A 2ZXHA 4A5MA 1YJ9I 2ECCA 4PSXA 3IHUA 4YFKF 2L02A 1SMTA 2QGUA 2LKXA 3CJRB 1SD5A 2AO9A 3OYCA 1TQIA 2JSCA 4XK4A 3G71I 2QEXI 1I6XA 4I09A 4XNFA 1LB2A 2GZWA 3A01A 3KYLA 3D5LA 4C3JJ 1P6RA 1B4AA 2A6EF 2LKPA 3R4KA 4KT5C 4C9YA 5B3SH 4IZZA 2M7AA 3M9AA 3BPVA 1QVTA 2AQFA 1Z67A 2UUZA 3TO6A 1J0RA 2Z3YA 1Y0NA 5DYMA 2QKLB 5B5EC 5D5UB 5E1XA 1X2MA 1XMKA 1VQNI 4G6DA 1O7LA 2EV5A 1ENHA 3D0SA 4C2MJ 4D0PA 1XSDA 2XC7A 5EYRA 2GOXB 1D3YA 3BQYA 2H1LA 3EYIA 3E6MA 4IXAA 4IOAF 1QZEA 4BACA 3PNTA 1X19A 3VYTB 4EQQA 2HVSA 2QQ9A 2W7NA 3BPXA 2ICWG 5LD2C 2Z9OA 3BR6A 4HQMA 1TBXA 5KVRA 1D1BA 2NNYA 2X48A 3EETA 3F9KA 4BXFA 1YOVB 1XC5A 3FZVA 2GA2A 1DU0A 1D1CA 2BY0A 1P4AA 3DEUA 4IHWA 3CCQI 2RNGA 3K4JA 3AG1H 3REOA 1T38A 4DQ2A 5H6RA 4UNOA 5D6EA 5GP9A 2G7HA 5K5QA 4O3MA 4I0AA 4O6JA 3Q0UA 2XPUA 3CMEI 2QM3A 4M3GA 3B73A 2E34A 2EIJH 1ETOA 1YIOA 3ECOA 4L0ZB 4UUSA 2LF8A 4ZTFA 4EATA 2V79A 4HX4A 3OSGA 2OZ6A 3BZKA 3KPHA 4ETSA 3CUOA 4V2FA 2LY2A 5M5YJ 1HW5A 3BR0A 5HS7A 2BY3A 3FMSA 2KISA 2VBYA 3FM5A 1ZELA 4L9VA 3ZQHA 3JRAA 1AHDP 3EUHC 4TV7A 4ANJA 1R5GA 1W7PB 4L5IA 1Y8QB 4BXXJ 3QP6A 3H5NA 2PFBA 4BEHB 4X1EA 3I58A 3HDDA 3DPLC 2XF5A 1BR4A 4FQGA 3BJ6A 4WXDA 3IKVA 9ANTA 3BR2A 3KZIC 3C2GA 2F2EA 2XRNA 4KDPA 3JR9A 2DJNA 1ZRFA 1R23A 4AVPA 4PJNA 5CVRA 1RIOH 3EQLF 3HTUA 4Y13A 3R0AA 2DMNA 4WXHA 4YEJA 1N77A 5JFRA 1Y8RB 2CFOA 3V4GA 3PL8A 2IT0A 2E2IJ 1YE9A 1KA8A 2QBYA 1JTYA 3GYHX 1PVEA 4KISA 2GOMA 2FSWA 4HLYA 3P9KA 2HDCA 4WX9A 2LYCA 2VXDA 3CLOA 4U7DA 1W36C 3F6OA 1QZZA 1WVRA 4B44A 5FD5A 3LSIA 4EJVA 2GXBA 3IAS2 1WJFA 4FE7A 2DXIA 1YX3A 2H94A 2JVGA 4LIVA 3J81K 4RAYA 4PZJA 3ZQ7A 1VFCA 2KDOA 5E3OA 3RPUD 5HDNA 4N4OB 2V1UA 5CVIA 3K4LA 2P4WA 4DYQA 1LFBA 3M1EA 2HPIA 2V1XA 1T0FC 1TTYA 1QA6A 3OL3A 4C2TA 4M6VA 4JYKA 1X1BA 1P4WA 5DUIA 3LFKA 4HG2A 4CCOA 2TCTA 1AOYA 3ABUA 4A0ZA 4KYWA 2XDVA 2NVQJ 1G3WA 4A6DA 3FBIB 3I64A 4LFUA 4E4HA 4LG0A 1TP4A 1OCZH 6PAXA 1YLFA 1SFUA 2R3SA 2Y0SN 3CUQC 1WCMJ 2R4GA 4BU2A 3J7ZI 3MKYB 1JT6A 3WHBA 3HZJA 3MZ8A 1XG1A 1ZGAA 5DUKA 4LG3A 3HOUJ 5B1BH 2VODA 5BNGA 1Q1VA 2GXAA 2XGCA 5E1ZB 1ZG1A 2OTJI 5HNFA 3WTXC 1IUYA 5HOOA 4L0YB 5L3DA 3T8TA 2VJIA 3K4KA 1SMYF 1UG2A 2MGQA 3H9GA 3TDZC 1FY7A 1JTXA 4B48A 1PP8F 2Y0SA 1GUUA 1SFEA 2COMA 2VASA 1TWGJ 4G9YA 3KCCA 3LSHA 3E6CC 2AS5F 2XB0X 3CC4I 3RKQA 1Y6IA 2FXAA 3R6SA 4LGWA 4QWQA 1A31A 2R5YB 1SAXA 3CCYA 4Q4ZF 1CF7A 4IQJA 4A3BJ 2ID6A 3K9TA 2OA4A 2HNHA 3KZYA 1BL0A 2ZC2A 5J1RA 2UXXA 3CF5F 3QPSA 1XGSA 3JCUC 2R7QA 4XICA 3IL2A 5K5RA 4B3XA 1ULYA 4G8XA 5J4YA 3H36A 1XTAA 4N9HA 5KHDA 4MFDA 2JA2A 3BG5A 3OMYA 3DF8A 3OY9A 4XN3A 3NAUA 2LTPA 4PK4A 4EJWA 5M5WJ 2V9PA 1NH3A 2MSYA 2V9KA 3H3UA 1X58A 2EB7A 3GLXA 3WGHA 1R36A 2ZNZA 4ON0A 1EV7A 4EM2A 1BI0A 4RDUA 3CMAI 1S7EA 1T95A 2GA1A 5KAIC 1DU6A 2CUZA 3ABTA 4B09A 5HNHA 1I6HJ 4E70A 2W25A 1V54H 2MC3A 1LKXA 1ZREA 3HIFA 4NQWB 3IAM2 4GXOA 1W1WE 1TL8A 4RB1A 2YPRA 3O3KA 4E7HA 2IJLA 3ZQLA 2QUFA 2CJJA 1I27A 2Q1ZB 4RGUA 3ZQFA 2DT6A 4ZZDA 5K5OA 1LQ1A 1T98A 1OPCA 1UELB 3BT9A 3T1BA 2X6OA 2VC0A 1XDSA 1I50J 2YR2A 3GCMA 3TO7A 4BEHA 2XGDA 4RB3C 2PJRA 3U1KA 1DP3A 1B8IB 4DGWB 1WJDA 1W5CC 5TGTA 5EG0A 4IHVA 2E7WA 4OIOF 3ERED 2RKHA 4CYCB 1WZ2A 1ON2A 1LUJB 1TWCJ 2ZCWA 5FKKA 4IHXA 4KMUX 4ZDLA 1MJ9A 1DPRA 3FWEA 5FFXA 4FT8A 4L18B 3ZMTA 5F27A 2HEOA 3LSRA 1E3PA 5KK1A 2HS5A 2MLKA 1HBXG 4HX8A 2HQAA 1BOBA 1JUSA 3DLAA 2O9LA 2IS6A 2KLOA 2IS1A 1ORKA 3I55I 3ZN1A 1OYWA 2IXSA 3S3OA 1U8RA 1H9GA 1BIAA 2Z16A 3LSGA 2VQHA 3CMMA 4A69C 4AYBA 4E7IA 2XVCA 1WI3A 1VQ4I 2V1DA 3KP2A 2XF7A 1IXRC 2ECBA 2BYVE 1CGPA 2IPQX 2M9HA 3NARA 2B7EA 4O5VA 3AFHA 2FX0A 4U0YA 4R79A 3Q0VA 1B59A 3W6VA 3RYRA 3DLLF 3F8BA 1ERDA 4EM1A 2E1OA 4YG2F 3I56I 2V6EA 2BBYA 1U6GA 3OR2C 1B1BA 2Q2EB 4G7OF 2NVYJ 5IYBJ 4BQNA 3W6JB 2ELJA 4A3JJ 2ZFUA 2A68F 3ZMVA 5EDNA 4II2A 2BV6A 4XLNF 4AYBN 5M3MJ 4UY8I 3OV8A 1OCTC 2XASA 1MBKA 4MTDA 4CGZA 3UR3C 2GIZA 4GYIA 3WE2A 2R93J 2B9SA 1ITYA 1XX5A 4UVAA 5H2FC 5IP6A 4WWCA 4PJMA 3JRIA 4ZDOA 4MGRA 3W2AA 2DOAA 1D0XA 3MCZA 3CP2A 4ZH4F 4XOTA 5J8FA 4CCKA 4KJZA 2QSGX 3JW4A 5CQGA 3HB9A 3Q0WA 2M5WA 1B9NA 3PFYA 2DI3A 1BI2A 5DD4A 1MD0A 2L9RA 4F52A 4MEXF 2HOEA 3QPTA 1IZ1A 3KEQA 2QZ8A 4OMZA 1U78A 3C2HA 3M8FA 4II3A 2NVXJ 3HTSB 3L7WA 4AVZA 2YS9A 4AIKA 3HHHA 3TEDA 5LRRA 3E97A 4HBLA 2M8GX 3H92A 4GGGA 4AUXA 1BJZA 2CQNA 3JREA 3CCRI 2BEOA 1FBSA 1MGTA 3FMRA 3JSOA 1B9MA 2LD5A 5GAEJ 2JA6J 2CRGA 3PQKA 2A5WA 2CQQA 1OYIA 2FMLA 1LVKA 2EFPA 1R4NB 2YU3A 1T39A 3I4MJ 3BG3A 5DV5A
chains in the Genus database with same CATH topology
2DU9A 3R60A 3DP7A 3ULQB 4HYEA 1FYKA 2O3FA 4IHSA 1J5YA 3GFIA 5F64A 3RTRA 2V6CA 1DPUA 5E8GA 4M73A 1HW1A 4I7HA 2GQQA 2LNBA 2DPDA 2XIGA 4OMYA 1YW9A 1IN5A 1W5TA 4R1HA 5JVTA 3U2RA 3Q5FA 5HS8A 1IAWA 3C3WA 4ZYDA 2J5PA 4LJZF 5IT3A 3JTHA 2O8XA 3SZPA 5D6FA 4XSZF 3WTSC 3QRFF 3LWFA 1YS6A 1RZ4A 2UWMA 1R7JA 1DP7P 1OYYA 1FYLA 2E1CA 1K6OA 2HTJA 1F1ZA 2W84A 4UVBA 3RKXA 5CVUA 2DK8A 2V9VA 5CVVA 4HV6A 4ESJA 2M45A 1MKMA 3P7NA 1MDMB 2CQKA 1F5TA 1WQ2A 2CYYA 4XRFA 2HQNA 1SD4A 2VOOA 3ZMUA 5FB2A 2DW4A 2H6CA 3GF2A 1AWCA 2DO7A 1JGSA 3HUGA 2HWVA 2JPCA 1YFHA 1I1GA 4KNYA 1P4XA 2A69F 4LB6B 1HXDA 2FF4A 3H3ZA 5H20A 5D5XB 1WWXA 3F3XA 4KA4A 2G7UA 2EK5A 4EJOA 2ESNA 4Y15A 1BM9A 1USSA 2O6GE 4MTEA 2F5EA 3S2WA 2A61A 4KICA 1UFMA 1Q1HA 3TDUC 2AXLA 3COAC 2OQGA 3BROA 1Z91A 3WTTC 3U9GA 5LGUA 1I5ZA 5ED4A 2CW0F 5E18F 1BC7C 3GVAA 2ISYA 1HQCA 2WV0A 3L00A 5F6FA 2VT2A 2EFWA 1R1UA 2ESHA 5D8LB 2ADUA 4YFNF 1G4DA 1QBJA 2XKOA 1JXSA 2JZYA 3HRMA 3LAJA 3MZHA 1ONVA 3V7CA 5DCMA 5EEGA 3IKTA 1K79A 2VT3A 3QP5A 3MFKA 2H27A 1YYVA 2HKXA 4L5JA 2A07F 2BGCA 3GUDA 1V4RA 1P2FA 3O2PE 1FX7A 2D1HA 5D4SA 4LB5A 4LG0B 4L9NA 1T6SA 4CYDA 1D8KA 1PP7U 2P5VA 4Y17A 2MBFA 2RN7A 3RKWA 3GW2A 3I59A 5BMZA 5CVJA 1FT9A 1QQIA 4ESFA 5L3CA 3K2ZA 3WTZA 1O3QA 3CO6C 2M30A 3QU6A 4CZZA 4KN7X 3V7RA 2XHKA 3VODA 5D5WB 2NYXA 4FHTA 2XAQA 2K27A 1FSHA 4M74A 1FC3A 1KQ9A 2FU4A 3BDDA 2P7VB 2RQPA 4UV9A 2W24A 3F22A 1QPMA 3F23A 1LEAA 3RJPA 4OIPF 5AONA 2EFQA 3KP7A 4UV8A 2KKOA 1Z05A 2P6SA 2M1BA 2RGVA 3LAPA 3CUQB 1ODDA 3IRRA 1FBUA 4RB0A 3F8CA 2EFOA 3GZ6A 1FP2A 2Y75A 5ILVA 4Q47A 3L09A 1ZN2A 2PEXA 3GZ5A 4M9XA 2D2WA 2NS0A 1J7KA 2HR3A 1CF7B 1YG2A 1QZYA 1S3JA 2ACJA 5LEKA 1UB9A 3DKWA 1ZRCA 2EJRA 3V8KA 1KU2A 3T0YA 3LA3A 4MHGA 4U88A 1XMAA 3BJAA 2IRFG 3QOPA 3M8EA 4HF1A 2ZFWA 2YX4A 4WF2A 3ELKA 1HSTA 3W6KB 4A6EA 3SHFA 2NAZA 2DPUA 3NEUA 5H6QA 4LLLA 5ILUA 3I0TA 5BOXA 2XUBA 5HDKA 2JTVA 2WC2A 5BQTA 5DDGA 4KFCA 1S6LA 3WU0A 1BBYA 1FLIA 4AIJA 5D4RA 4ZYHA 4M6YA 3V7SA 2GAUA 3WODF 1R1VA 5F1RA 3FXRA 3RYPA 3J7AO 1BJAA 1XDUA 3SXYA 1IN4A 3FX3A 3Q9SA 5LBQA 1XSVA 2A6HF 2IW5A 3ZMDA 4JQFA 4PGHA 4UHTA 2WTEA 4OIRF 4M9ZA 1UCRA 3KLOA 2Q0OA 5CLSA 2K4BA 1FNNA 5TRDA 2WWYA 5LLQA 1MDMA 4CHUA 2KIMA 1LJ9A 2M87A 3E6DA 1ZH5A 2QBYB 2RDPA 3E5XA 3CJNA 1FBQA 1Z9CA 3BP8A 3GEZA 5HVQC 2E1NA 2EA2A 1A04A 2GIVA 3MAJA 3I71A 1LNWA 4KUMA 4P55A 2RVCA 4CDGA 5BPIA 1KGSA 1OMIA 4BNCA 3WTWC 4KIFA 4G6QA 2H09A 2PMUA 3FMQA 2STWA 3JSPA 2DQRA 2UXNA 2MD5A 3RPQA 4H0EA 3EYYA 3T5XA 1ON1A 5TJJA 4MNUA 2M8EA 5CJ9A 2EA4A 4BAYA 3WG9A 2RV8A 3I54A 1IXSB 3TOAA 5JHUA 1NHAA 5E20A 2HYGD 3CO7C 5DEQA 5LGTA 1SD6A 4Q5SF 2NRAC 3I4PA 2PJPA 2VOPA 2CO5A 1TQMA 1FZPB 1XD7A 2FBKA 3B02A 2VBZA 2EFNA 1U3EM 1W4MA 1TQPA 1L0OC 2XAJA 3BWGA 5IT9K 4S04A 2PLYA 3IWFA 1S29A 3NQOA 4CO8A 1D5VA 1YS7A 4ENNA 1F9NA 1DDNA 3HRSA 4GO1A 3RDIA 5L3EA 4HV5A 2QQAA 1K7AA 3K1NA 1YW8A 3E3VA 3DXJF 1WKMA 2RC4A 3F8NA 1IW7F 4EGZA 4GCVA 1TW2A 2ZO4A 2K86A 4HAMA 4I2OA 4U0WA 1R00A 3FHZA 2VE9A 2QVOA 2QLZA 3J81Z 1R22A 4OU0A 3HSEA 2XGXA 4A2UA 1XGNA 1WSUA 1IRFA 1PUEE 3KP6A 2XROA 1OKRA 1ZRDA 1HW2A 1STZA 3V8JA 3WGIA 4B8XA 1XCBA 3IRQA 4ESBA 3KEOA 4G94A 2VXZA 2XAHA 1Z7UA 4EJTA 5ICEA 1L3LA 3I53A 4U7BA 5ILSA 2PQ8A 1KU3A 4M71A 4NQWA 4BXUA 2PBIA 1RI7A 5J6XA 3M7GA 2R7DA 2W85A 3N97A 1W5SA 2QWWA 3CUQA 3HYIA 4EMSA 4KN4X 3FF5A 3HSRA 1TW3A 1SFXA 4L9JA 4K2EA 4EJUA 2K4JA 4M6XA 2Y0MA 3MWMA 3PQJA 2G9WA 4LLGF 2HTSA 1PDNC 4ENKA 3EDPA 2MLGA 4P9UA 4IVNA 1FP1D 1SD7A 3JAMZ 3I59B 2P7CB 1VTNC 3KZZA 1G3YA 2MH2A 4M9SA 2Y48A 1UHWA 4RAZA 3I5UA 5FLXZ 1ZHFA 2F5CA 1XN7A 2JT1A 4CXFA 1S7AA 3DV8A 3GX4X 4HW0A 5AIQA 1IF1A 1XSXA 5FO5A 5FD6A 2HQRA 2PN6A 4A5NA 1R5HA 4S05A 4IJAA 4A0YA 2H6BA 1OR7A 2A5YB 2X0LA 4YIFA 3ZMSA 1O7FA 1ZG5A 1ZYRF 2A3SA 5HLGA 4P9FA 1E17A 3KFWX 1U5TA 2IP2A 3MZYA 1HKSA 2ISZA 4EM0B 2B0LA 1O57A 1S8NA 3TOBA 1RUNA 3E6BA 5AIPA 2DAOA 1R1TA 2HYFA 3TKYA 2FMYA 2FRHA 2L54A 4I0BA 3RIRA 2Z5UA 1BN5A 2CWEA 3SZTA 2LF7A 2KIUA 3BY6A 4PDKA 1QO0D 2VONA 2EV0A 5HLIA 1D8JA 3FM3A 2L01A 5ICCA 2KIFA 5ERIA 4NB5A 2HGCA 2P5KA 4OOIA 3O6BB 5A2QZ 3HRTA 4U0VA 1W7PA 1ZAOA 1GXQA 3ECHA 2OQRA 3T8RA 5HLHA 4Z2YA 2IA1A 4ZYGA 1EH6A 2MA3A 1S7OA 5D8KB 3C1DA 4OINF 3MEXA 4BYYA 2OBPA 1J75A 2XV4S 3G3ZA 3K69A 3ML6A 4WK8F 3HOSA 3BZ6A 2IA0A 4LK1F 1XB4A 4XSXF 1V3FA 1ZARA 3KLNA 3KP5A 2FQ3A 3ROUA 2OD5A 2FE3A 4LLNA 4LK0F 4QLCU 1U2WA 3F72A 5L3FA 3F21A 5HDGA 5E8IA 3JAMK 1C0WA 4ENJA 2EWNA 4WCGA 4I02A 5ICFA 3GFJA 5E1WA 5FLXK 3WTYC 2KJCA 3WTUC 2CSOA 5LGNA 4HQEA 1G3SA 1HSJA 2PMHA 1FSEA 5LHGA 1MJAA 2NNNA 4FX4A 4JBAA 3HRUA 2LDUA 2PI0A 2ZKZA 3HHGA 1IN6A 2JPBA 3GFMA 3GXOA 3E5UA 1XGOA 2X4HA 4KIGA 1KQ0A 2GXGA 3ZMZA 1X3UA 2ZJ2A 2ZXJA 1XCVA 1EH7A 4HLXA 5LHIA 1HKTA 1USTA 1JHFA 3LQRA 5J8CA 2D45A 3HSFA 4IRIA 5ICGA 4UUVA 5DCFA 3KE2A 4RS8A 4IRGA 5FGMA 4AIHA 2VN2A 3FXQA 2J5OA 3L9FA 1QNTA 2VE8A 3NRVA 2R7FA 1Z6RA 1RNLA 4HF0A 4P5OA 1BI1A 4A0XA 3V8LA 3L2CA 3TQNA 4M72A 3CDHA 3KP4A 3C18A 3JTGA 2O0YA 4G7HF 3C7JA 2XAFA 3TGNA 1LDDA 4BHPA 1KU9A 5LEJA 4BH9A 2MH9A 3OOPA 1DUXC 4OIQF 1O3RA 3P9IA 1ZG3A 4XLPF 4HOBA 2ZNYA 3KETA 3J80Z 4EVIA 4I98B 1GXPA 2OZUA 2Q2EA 4RGXA 4ZZLA 1FPQA 5LRSA 3RI4A 1J2XA 3DQVC 4EGYA 4HX7A 1WRJA 4KIBA 3G73A 2KJBA 1IN7A 1TLHB 2DLLA 5L3GA 1KQ8A 2Z99A 3RPUA 2OU2A 3LA7A 4ASNA 4BHCA 4P96A 2F5FA 2XKPA 1GVJA 1YQAA 2HFHA 2Z33A 1KU7A 4LMYA 1YTYA 1GHCA 3DPTA 1HKQA 1O3TA 3R0JA 3RKYA 2DK5A 1O3SA 3QU3A 1TNSA 3WE3A 3IWZA 2LSOA 4ZYEA 2L4MA 1BC8C 1WI9A 3IC7A 2IA2A 4DNCA 3FXUA 3LSTA 1Z6TA 4RB2C 1KYZA 2ZMEA 5LHHA 4XBFA 2VBXA 2FBIA 3CTAA 1KYWA 1ZGJA 1YO5C 1I1SA 3GWZA 3BOQA 5JI6A 5A2QK 1IRGA 1BIBA 2PG4A 1K78B 4L9TA 4YIIA 4NHJA 2CFXA 4AD9A 4R8HA 5CYVA 5EEHA 2K7LA 1IXCA 4RGRA 3GFLA 1R58A 5DD8A 4LD5A 1H0MA 2FNPA 4PCQA 3LQQA 1T0FA 3MQ0A 4BQAA 4GYGA 4HZFA 1REPC 4I01A 4A12A 2UZKA 1QGPA 1U5TB 2HZTA 4EV0A 1Y0UA 2C6YA 3P9CA 5HS9A 1UHMA 1MJBA 2ZMEB 3SQNA 1FWZA 2DBBA 4HF2A 2STTA 2O61A 3ZN0A 5K1YA 2QQBA 3ISPA 3J80K 5L3BA 1T2KA 1F4KA 3EUHA 4IF4A 2RNJA 4MEYF 3SFZA 2DFIA 2FNAA 3K0LA 4YFXF 4HDVA 1G3TA 1W7PD 2P6TA 1IN8A 4ENMA 4JK1X 2CG4A 5IT9Z 3ZPLA 5DCMB 4IPAA 1FYMA 2GWRA 1YW7A 3Q9VA 2YSRA 2FEZA 4G7ZF 1MZBA 2K02A 2TDXA 2IVMA 2DQLA 2D1VA 3VFZA 4HA8A 4UXNA 3F6VA 5E17F 4BHBA 3AAFA 3ZP5A 1XGMA 2BE5F 3GO5A 2W57A 1Z1DA 5FFZA 1E2XA 3U1DA 4N9IA 3F8FA 1K78A 4PGGA 2DT5A 4IRHA 4FX0A 2DTRA 2OAZA 1LDJA 2ETHA 4Q48A 2FA5A 1H9TA 3WGGA 5D5VB 2JRTA 3DFGA 2FBHA 4KMFA 2P8TA 1J59A 2VBWA 3HOTA 3K1PA 1JE8A 3LA2A 2ELHA 5JR3A 4UVCA 1TNTA 4MQ9F 3TO9A 4RGSA 1BI3A 4WXCA 2VC1A 5BS6A 2KRFA 1G6NA 1JHHA 1P92A 1RUOA 3VEPA 3VOEA 1J9IA 3R61A 2Q8KA 3WU1B 2CGPA 2L3DA 3PFIA 3E5QA 2ZBKA 2E7XA 1FOKA 3BJOA 4HDUA 2P5LC 3WTVC 4N0BA 2HKOA 1B6AA 2O03A 1U5TC 1ZLJA 2F5DA 1BOAA 4MQVA 1LVAA 3F8MA 2YX7A 3QAHA 4CICA 1LDKB 4IHTA 1LEBA 2L4AA 2QYOA 3VB2A 1EH8A 4AWXB 2QENA 2XAGA 5BPDA 3N4MA 2FOKA 3K1MA 4F7ZA 2EV6A 1ZLKA 3KP3A 4A5MA 4YFKF 3IHUA 2L02A 1SMTA 1SD5A 1TQIA 2JSCA 1I6XA 4I09A 1LB2A 2GZWA 3D5LA 1P6RA 1B4AA 2A6EF 2LKPA 3R4KA 4KT5C 3M9AA 3BPVA 3TO6A 1J0RA 2Z3YA 5DYMA 5D5UB 5E1XA 1XMKA 4G6DA 1O7LA 2EV5A 3D0SA 4D0PA 1XSDA 1D3YA 3EYIA 3E6MA 4IXAA 4EQQA 2QQ9A 3BPXA 2Z9OA 4HQMA 1TBXA 5KVRA 2NNYA 3EETA 3FZVA 2GA2A 3DEUA 1P4AA 3REOA 1T38A 4DQ2A 5H6RA 4UNOA 5D6EA 2G7HA 5K5QA 4O3MA 4I0AA 4O6JA 2QM3A 3B73A 1YIOA 3ECOA 4L0ZB 2LF8A 2V79A 4HX4A 2OZ6A 4ETSA 3CUOA 1HW5A 5HS7A 3FMSA 2VBYA 3FM5A 4L9VA 4TV7A 1R5GA 1W7PB 4L5IA 3QP6A 2PFBA 3I58A 3DPLC 3BJ6A 4WXDA 3IKVA 2F2EA 2XRNA 4KDPA 1ZRFA 1R23A 4AVPA 5CVRA 1RIOH 3EQLF 3HTUA 4Y13A 3R0AA 4WXHA 5JFRA 3V4GA 2IT0A 1KA8A 2QBYA 3GYHX 2FSWA 4HLYA 3P9KA 2HDCA 4WX9A 3CLOA 4U7DA 3F6OA 1QZZA 5FD5A 4EJVA 2GXBA 2H94A 3J81K 4RAYA 4PZJA 3ZQ7A 2V1UA 5HDNA 5CVIA 2P4WA 3M1EA 2V1XA 1TTYA 1P4WA 5DUIA 3LFKA 1AOYA 3ABUA 4A0ZA 4KYWA 1G3WA 4A6DA 3I64A 4LFUA 4LG0A 6PAXA 1YLFA 1SFUA 2R3SA 3CUQC 1ZGAA 5DUKA 2VODA 5E1ZB 1ZG1A 3WTXC 1IUYA 5HOOA 4L0YB 5L3DA 3T8TA 1SMYF 3TDZC 1FY7A 1PP8F 1SFEA 2COMA 4G9YA 3KCCA 2AS5F 3E6CC 2FXAA 3R6SA 4LGWA 4QWQA 1SAXA 4Q4ZF 1CF7A 3K9TA 2OA4A 3KZYA 2UXXA 1XGSA 3IL2A 5K5RA 1ULYA 4G8XA 4N9HA 3DF8A 4EJWA 3H3UA 3GLXA 2EB7A 3WGHA 4EM2A 1R36A 2ZNZA 4ON0A 1EV7A 1BI0A 2GA1A 3ABTA 4B09A 4E70A 2W25A 2MC3A 1ZREA 3HIFA 4GXOA 4RB1A 2YPRA 3O3KA 2IJLA 2QUFA 1I27A 4RGUA 4ZZDA 5K5OA 1LQ1A 1OPCA 1T98A 3T1BA 2VC0A 1XDSA 2YR2A 4RB3C 3TO7A 2E7WA 4OIOF 3ERED 2RKHA 1ON2A 2ZCWA 4KMUX 1MJ9A 1DPRA 3FWEA 5FFXA 4FT8A 4L18B 3ZMTA 2HEOA 5KK1A 2HS5A 2MLKA 1HBXG 4HX8A 3ZN1A 1OYWA 1U8RA 1H9GA 1BIAA 2XVCA 2V1DA 3KP2A 1CGPA 1IXRC 2BYVE 2IPQX 4O5VA 4U0YA 4R79A 1B59A 3RYRA 3F8BA 4EM1A 4YG2F 2BBYA 1U6GA 1B1BA 4G7OF 3W6JB 2A68F 3ZMVA 2BV6A 4XLNF 3OV8A 2XASA 4MTDA 4CGZA 4GYIA 3WE2A 4UVAA 4WWCA 4MGRA 3MCZA 4ZH4F 5J8FA 3JW4A 2M5WA 1B9NA 2DI3A 1BI2A 5DD4A 1MD0A 4MEXF 2HOEA 3QPTA 1IZ1A 3KEQA 2QZ8A 4OMZA 1U78A 3M8FA 3HTSB 3L7WA 4AIKA 3HHHA 5LRRA 3E97A 4HBLA 3H92A 4GGGA 2BEOA 1FBSA 1MGTA 3FMRA 3JSOA 1B9MA 3PQKA 1OYIA 2FMLA 2EFPA 2YU3A 1T39A 3QPHA 5DV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DU9 A;  3R60 A;  3DP7 A;  3ULQ B;  4HYE A;  1FYK A;  2O3F A;  4IHS A;  1J5Y A;  3GFI A;  5F64 A;  3RTR A;  2V6C A;  1DPU A;  5E8G A;  4M73 A;  1HW1 A;  4I7H A;  2GQQ A;  2LNB A;  2DPD A;  2XIG A;  4OMY A;  1YW9 A;  1IN5 A;  1W5T A;  4R1H A;  5JVT A;  3U2R A;  3Q5F A;  5HS8 A;  1IAW A;  3C3W A;  4ZYD A;  2J5P A;  4LJZ F;  5IT3 A;  3JTH A;  2O8X A;  3SZP A;  5D6F A;  4XSZ F;  3WTS C;  3QRF F;  3LWF A;  1YS6 A;  1RZ4 A;  2UWM A;  1R7J A;  1DP7 P;  1OYY A;  1FYL A;  2E1C A;  1K6O A;  2HTJ A;  1F1Z A;  2W84 A;  4UVB A;  3RKX A;  5CVU A;  2DK8 A;  2V9V A;  5CVV A;  4HV6 A;  4ESJ A;  2M45 A;  1MKM A;  3P7N A;  1MDM B;  2CQK A;  1F5T A;  1WQ2 A;  2CYY A;  4XRF A;  2HQN A;  1SD4 A;  2VOO A;  3ZMU A;  5FB2 A;  2DW4 A;  2H6C A;  3GF2 A;  1AWC A;  2DO7 A;  1JGS A;  3HUG A;  2HWV A;  2JPC A;  1YFH A;  1I1G A;  4KNY A;  1P4X A;  2A69 F;  4LB6 B;  1HXD A;  2FF4 A;  3H3Z A;  5H20 A;  5D5X B;  1WWX A;  3F3X A;  4KA4 A;  2G7U A;  2EK5 A;  4EJO A;  2ESN A;  4Y15 A;  1BM9 A;  1USS A;  2O6G E;  4MTE A;  2F5E A;  3S2W A;  2A61 A;  4KIC A;  1UFM A;  1Q1H A;  3TDU C;  2AXL A;  3COA C;  2OQG A;  3BRO A;  1Z91 A;  3WTT C;  3U9G A;  5LGU A;  1I5Z A;  5ED4 A;  2CW0 F;  5E18 F;  1BC7 C;  3GVA A;  2ISY A;  1HQC A;  2WV0 A;  3L00 A;  5F6F A;  2VT2 A;  2EFW A;  1R1U A;  2ESH A;  5D8L B;  2ADU A;  4YFN F;  1G4D A;  1QBJ A;  2XKO A;  1JXS A;  2JZY A;  3HRM A;  3LAJ A;  3MZH A;  1ONV A;  3V7C A;  5DCM A;  5EEG A;  3IKT A;  1K79 A;  2VT3 A;  3QP5 A;  3MFK A;  2H27 A;  1YYV A;  2HKX A;  4L5J A;  2A07 F;  2BGC A;  3GUD A;  1V4R A;  1P2F A;  3O2P E;  1FX7 A;  2D1H A;  5D4S A;  4LB5 A;  4LG0 B;  4L9N A;  1T6S A;  4CYD A;  1D8K A;  1PP7 U;  2P5V A;  4Y17 A;  2MBF A;  2RN7 A;  3RKW A;  3GW2 A;  3I59 A;  5BMZ A;  5CVJ A;  1FT9 A;  1QQI A;  4ESF A;  5L3C A;  3K2Z A;  3WTZ A;  1O3Q A;  3CO6 C;  2M30 A;  3QU6 A;  4CZZ A;  4KN7 X;  3V7R A;  2XHK A;  3VOD A;  5D5W B;  2NYX A;  4FHT A;  2XAQ A;  2K27 A;  1FSH A;  4M74 A;  1FC3 A;  1KQ9 A;  2FU4 A;  3BDD A;  2P7V B;  2RQP A;  4UV9 A;  2W24 A;  3F22 A;  1QPM A;  3F23 A;  1LEA A;  3RJP A;  4OIP F;  5AON A;  2EFQ A;  3KP7 A;  4UV8 A;  2KKO A;  1Z05 A;  2P6S A;  2M1B A;  2RGV A;  3LAP A;  3CUQ B;  1ODD A;  3IRR A;  1FBU A;  4RB0 A;  3F8C A;  2EFO A;  3GZ6 A;  1FP2 A;  2Y75 A;  5ILV A;  4Q47 A;  3L09 A;  1ZN2 A;  2PEX A;  3GZ5 A;  4M9X A;  2D2W A;  2NS0 A;  1J7K A;  2HR3 A;  1CF7 B;  1YG2 A;  1QZY A;  1S3J A;  2ACJ A;  5LEK A;  1UB9 A;  3DKW A;  1ZRC A;  2EJR A;  3V8K A;  1KU2 A;  3T0Y A;  3LA3 A;  4MHG A;  4U88 A;  1XMA A;  3BJA A;  2IRF G;  3QOP A;  3M8E A;  4HF1 A;  2ZFW A;  2YX4 A;  4WF2 A;  3ELK A;  1HST A;  3W6K B;  4A6E A;  3SHF A;  2NAZ A;  2DPU A;  3NEU A;  5H6Q A;  4LLL A;  5ILU A;  3I0T A;  5BOX A;  2XUB A;  5HDK A;  2JTV A;  2WC2 A;  5BQT A;  5DDG A;  4KFC A;  1S6L A;  3WU0 A;  1BBY A;  1FLI A;  4AIJ A;  5D4R A;  4ZYH A;  4M6Y A;  3V7S A;  2GAU A;  3WOD F;  1R1V A;  5F1R A;  3FXR A;  3RYP A;  3J7A O;  1BJA A;  1XDU A;  3SXY A;  1IN4 A;  3FX3 A;  3Q9S A;  5LBQ A;  1XSV A;  2A6H F;  2IW5 A;  3ZMD A;  4JQF A;  4PGH A;  4UHT A;  2WTE A;  4OIR F;  4M9Z A;  1UCR A;  3KLO A;  2Q0O A;  5CLS A;  2K4B A;  1FNN A;  5TRD A;  2WWY A;  5LLQ A;  1MDM A;  4CHU A;  2KIM A;  1LJ9 A;  2M87 A;  3E6D A;  1ZH5 A;  2QBY B;  2RDP A;  3E5X A;  3CJN A;  1FBQ A;  1Z9C A;  3BP8 A;  3GEZ A;  5HVQ C;  2E1N A;  2EA2 A;  1A04 A;  2GIV A;  3MAJ A;  3I71 A;  1LNW A;  4KUM A;  4P55 A;  2RVC A;  4CDG A;  5BPI A;  1KGS A;  1OMI A;  4BNC A;  3WTW C;  4KIF A;  4G6Q A;  2H09 A;  2PMU A;  3FMQ A;  2STW A;  3JSP A;  2DQR A;  2UXN A;  2MD5 A;  3RPQ A;  4H0E A;  3EYY A;  3T5X A;  1ON1 A;  5TJJ A;  4MNU A;  2M8E A;  5CJ9 A;  2EA4 A;  4BAY A;  3WG9 A;  2RV8 A;  3I54 A;  1IXS B;  3TOA A;  5JHU A;  1NHA A;  5E20 A;  2HYG D;  3CO7 C;  5DEQ A;  5LGT A;  1SD6 A;  4Q5S F;  2NRA C;  3I4P A;  2PJP A;  2VOP A;  2CO5 A;  1TQM A;  1FZP B;  1XD7 A;  2FBK A;  3B02 A;  2VBZ A;  2EFN A;  1U3E M;  1W4M A;  1TQP A;  1L0O C;  2XAJ A;  3BWG A;  5IT9 K;  4S04 A;  2PLY A;  3IWF A;  1S29 A;  3NQO A;  4CO8 A;  1D5V A;  1YS7 A;  4ENN A;  1F9N A;  1DDN A;  3HRS A;  4GO1 A;  3RDI A;  5L3E A;  4HV5 A;  2QQA A;  1K7A A;  3K1N A;  1YW8 A;  3E3V A;  3DXJ F;  1WKM A;  2RC4 A;  3F8N A;  1IW7 F;  4EGZ A;  4GCV A;  1TW2 A;  2ZO4 A;  2K86 A;  4HAM A;  4I2O A;  4U0W A;  1R00 A;  3FHZ A;  2VE9 A;  2QVO A;  2QLZ A;  3J81 Z;  1R22 A;  4OU0 A;  3HSE A;  2XGX A;  4A2U A;  1XGN A;  1WSU A;  1IRF A;  1PUE E;  3KP6 A;  2XRO A;  1OKR A;  1ZRD A;  1HW2 A;  1STZ A;  3V8J A;  3WGI A;  4B8X A;  1XCB A;  3IRQ A;  4ESB A;  3KEO A;  4G94 A;  2VXZ A;  2XAH A;  1Z7U A;  4EJT A;  5ICE A;  1L3L A;  3I53 A;  4U7B A;  5ILS A;  2PQ8 A;  1KU3 A;  4M71 A;  4NQW A;  4BXU A;  2PBI A;  1RI7 A;  5J6X A;  3M7G A;  2R7D A;  2W85 A;  3N97 A;  1W5S A;  2QWW A;  3CUQ A;  3HYI A;  4EMS A;  4KN4 X;  3FF5 A;  3HSR A;  1TW3 A;  1SFX A;  4L9J A;  4K2E A;  4EJU A;  2K4J A;  4M6X A;  2Y0M A;  3MWM A;  3PQJ A;  2G9W A;  4LLG F;  2HTS A;  1PDN C;  4ENK A;  3EDP A;  2MLG A;  4P9U A;  4IVN A;  1FP1 D;  1SD7 A;  3JAM Z;  3I59 B;  2P7C B;  1VTN C;  3KZZ A;  1G3Y A;  2MH2 A;  4M9S A;  2Y48 A;  1UHW A;  4RAZ A;  3I5U A;  5FLX Z;  1ZHF A;  2F5C A;  1XN7 A;  2JT1 A;  4CXF A;  1S7A A;  3DV8 A;  3GX4 X;  4HW0 A;  5AIQ A;  1IF1 A;  1XSX A;  5FO5 A;  5FD6 A;  2HQR A;  2PN6 A;  4A5N A;  1R5H A;  4S05 A;  4IJA A;  4A0Y A;  2H6B A;  1OR7 A;  2A5Y B;  2X0L A;  4YIF A;  3ZMS A;  1O7F A;  1ZG5 A;  1ZYR F;  2A3S A;  5HLG A;  4P9F A;  1E17 A;  3KFW X;  1U5T A;  2IP2 A;  3MZY A;  1HKS A;  2ISZ A;  4EM0 B;  2B0L A;  1O57 A;  1S8N A;  3TOB A;  1RUN A;  3E6B A;  5AIP A;  2DAO A;  1R1T A;  2HYF A;  3TKY A;  2FMY A;  2FRH A;  2L54 A;  4I0B A;  3RIR A;  2Z5U A;  1BN5 A;  2CWE A;  3SZT A;  2LF7 A;  2KIU A;  3BY6 A;  4PDK A;  1QO0 D;  2VON A;  2EV0 A;  5HLI A;  1D8J A;  3FM3 A;  2L01 A;  5ICC A;  2KIF A;  5ERI A;  4NB5 A;  2HGC A;  2P5K A;  4OOI A;  3O6B B;  5A2Q Z;  3HRT A;  4U0V A;  1W7P A;  1ZAO A;  1GXQ A;  3ECH A;  2OQR A;  3T8R A;  5HLH A;  4Z2Y A;  2IA1 A;  4ZYG A;  1EH6 A;  2MA3 A;  1S7O A;  5D8K B;  3C1D A;  4OIN F;  3MEX A;  4BYY A;  2OBP A;  1J75 A;  2XV4 S;  3G3Z A;  3K69 A;  3ML6 A;  4WK8 F;  3HOS A;  3BZ6 A;  2IA0 A;  4LK1 F;  1XB4 A;  4XSX F;  1V3F A;  1ZAR A;  3KLN A;  3KP5 A;  2FQ3 A;  3ROU A;  2OD5 A;  2FE3 A;  4LLN A;  4LK0 F;  4QLC U;  1U2W A;  3F72 A;  5L3F A;  3F21 A;  5HDG A;  5E8I A;  3JAM K;  1C0W A;  4ENJ A;  2EWN A;  4WCG A;  4I02 A;  5ICF A;  3GFJ A;  5E1W A;  5FLX K;  3WTY C;  2KJC A;  3WTU C;  2CSO A;  5LGN A;  4HQE A;  1G3S A;  1HSJ A;  2PMH A;  1FSE A;  5LHG A;  1MJA A;  2NNN A;  4FX4 A;  4JBA A;  3HRU A;  2LDU A;  2PI0 A;  2ZKZ A;  3HHG A;  1IN6 A;  2JPB A;  3GFM A;  3GXO A;  3E5U A;  1XGO A;  2X4H A;  4KIG A;  1KQ0 A;  2GXG A;  3ZMZ A;  1X3U A;  2ZJ2 A;  2ZXJ A;  1XCV A;  1EH7 A;  4HLX A;  5LHI A;  1HKT A;  1UST A;  1JHF A;  3LQR A;  5J8C A;  2D45 A;  3HSF A;  4IRI A;  5ICG A;  4UUV A;  5DCF A;  3KE2 A;  4RS8 A;  4IRG A;  5FGM A;  4AIH A;  2VN2 A;  3FXQ A;  2J5O A;  3L9F A;  1QNT A;  2VE8 A;  3NRV A;  2R7F A;  1Z6R A;  1RNL A;  4HF0 A;  4P5O A;  1BI1 A;  4A0X A;  3V8L A;  3L2C A;  3TQN A;  4M72 A;  3CDH A;  3KP4 A;  3C18 A;  3JTG A;  2O0Y A;  4G7H F;  3C7J A;  2XAF A;  3TGN A;  1LDD A;  4BHP A;  1KU9 A;  5LEJ A;  4BH9 A;  2MH9 A;  3OOP A;  1DUX C;  4OIQ F;  1O3R A;  3P9I A;  1ZG3 A;  4XLP F;  4HOB A;  2ZNY A;  3KET A;  3J80 Z;  4EVI A;  4I98 B;  1GXP A;  2OZU A;  2Q2E A;  4RGX A;  4ZZL A;  1FPQ A;  5LRS A;  3RI4 A;  1J2X A;  3DQV C;  4EGY A;  4HX7 A;  1WRJ A;  4KIB A;  3G73 A;  2KJB A;  1IN7 A;  1TLH B;  2DLL A;  5L3G A;  1KQ8 A;  2Z99 A;  3RPU A;  2OU2 A;  3LA7 A;  4ASN A;  4BHC A;  4P96 A;  2F5F A;  2XKP A;  1GVJ A;  1YQA A;  2HFH A;  2Z33 A;  1KU7 A;  4LMY A;  1YTY A;  1GHC A;  3DPT A;  1HKQ A;  1O3T A;  3R0J A;  3RKY A;  2DK5 A;  1O3S A;  3QU3 A;  1TNS A;  3WE3 A;  3IWZ A;  2LSO A;  4ZYE A;  2L4M A;  1BC8 C;  1WI9 A;  3IC7 A;  2IA2 A;  4DNC A;  3FXU A;  3LST A;  1Z6T A;  4RB2 C;  1KYZ A;  2ZME A;  5LHH A;  4XBF A;  2VBX A;  2FBI A;  3CTA A;  1KYW A;  1ZGJ A;  1YO5 C;  1I1S A;  3GWZ A;  3BOQ A;  5JI6 A;  5A2Q K;  1IRG A;  1BIB A;  2PG4 A;  1K78 B;  4L9T A;  4YII A;  4NHJ A;  2CFX A;  4AD9 A;  4R8H A;  5CYV A;  5EEH A;  2K7L A;  1IXC A;  4RGR A;  3GFL A;  1R58 A;  5DD8 A;  4LD5 A;  1H0M A;  2FNP A;  4PCQ A;  3LQQ A;  1T0F A;  3MQ0 A;  4BQA A;  4GYG A;  4HZF A;  1REP C;  4I01 A;  4A12 A;  2UZK A;  1QGP A;  1U5T B;  2HZT A;  4EV0 A;  1Y0U A;  2C6Y A;  3P9C A;  5HS9 A;  1UHM A;  1MJB A;  2ZME B;  3SQN A;  1FWZ A;  2DBB A;  4HF2 A;  2STT A;  2O61 A;  3ZN0 A;  5K1Y A;  2QQB A;  3ISP A;  3J80 K;  5L3B A;  1T2K A;  1F4K A;  3EUH A;  4IF4 A;  2RNJ A;  4MEY F;  3SFZ A;  2DFI A;  2FNA A;  3K0L A;  4YFX F;  4HDV A;  1G3T A;  1W7P D;  2P6T A;  1IN8 A;  4ENM A;  4JK1 X;  2CG4 A;  5IT9 Z;  3ZPL A;  5DCM B;  4IPA A;  1FYM A;  2GWR A;  1YW7 A;  3Q9V A;  2YSR A;  2FEZ A;  4G7Z F;  1MZB A;  2K02 A;  2TDX A;  2IVM A;  2DQL A;  2D1V A;  3VFZ A;  4HA8 A;  4UXN A;  3F6V A;  5E17 F;  4BHB A;  3AAF A;  3ZP5 A;  1XGM A;  2BE5 F;  3GO5 A;  2W57 A;  1Z1D A;  5FFZ A;  1E2X A;  3U1D A;  4N9I A;  3F8F A;  1K78 A;  4PGG A;  2DT5 A;  4IRH A;  4FX0 A;  2DTR A;  2OAZ A;  1LDJ A;  2ETH A;  4Q48 A;  2FA5 A;  1H9T A;  3WGG A;  5D5V B;  2JRT A;  3DFG A;  2FBH A;  4KMF A;  2P8T A;  1J59 A;  2VBW A;  3HOT A;  3K1P A;  1JE8 A;  3LA2 A;  2ELH A;  5JR3 A;  4UVC A;  1TNT A;  4MQ9 F;  3TO9 A;  4RGS A;  1BI3 A;  4WXC A;  2VC1 A;  5BS6 A;  2KRF A;  1G6N A;  1JHH A;  1P92 A;  1RUO A;  3VEP A;  3VOE A;  1J9I A;  3R61 A;  2Q8K A;  3WU1 B;  2CGP A;  2L3D A;  3PFI A;  3E5Q A;  2ZBK A;  2E7X A;  1FOK A;  3BJO A;  4HDU A;  2P5L C;  3WTV C;  4N0B A;  2HKO A;  1B6A A;  2O03 A;  1U5T C;  1ZLJ A;  2F5D A;  1BOA A;  4MQV A;  1LVA A;  3F8M A;  2YX7 A;  3QAH A;  4CIC A;  1LDK B;  4IHT A;  1LEB A;  2L4A A;  2QYO A;  3VB2 A;  1EH8 A;  4AWX B;  2QEN A;  2XAG A;  5BPD A;  3N4M A;  2FOK A;  3K1M A;  4F7Z A;  2EV6 A;  1ZLK A;  3KP3 A;  4A5M A;  4YFK F;  3IHU A;  2L02 A;  1SMT A;  1SD5 A;  1TQI A;  2JSC A;  1I6X A;  4I09 A;  1LB2 A;  2GZW A;  3D5L A;  1P6R A;  1B4A A;  2A6E F;  2LKP A;  3R4K A;  4KT5 C;  3M9A A;  3BPV A;  3TO6 A;  1J0R A;  2Z3Y A;  5DYM A;  5D5U B;  5E1X A;  1XMK A;  4G6D A;  1O7L A;  2EV5 A;  3D0S A;  4D0P A;  1XSD A;  1D3Y A;  3EYI A;  3E6M A;  4IXA A;  4EQQ A;  2QQ9 A;  3BPX A;  2Z9O A;  4HQM A;  1TBX A;  5KVR A;  2NNY A;  3EET A;  3FZV A;  2GA2 A;  3DEU A;  1P4A A;  3REO A;  1T38 A;  4DQ2 A;  5H6R A;  4UNO A;  5D6E A;  2G7H A;  5K5Q A;  4O3M A;  4I0A A;  4O6J A;  2QM3 A;  3B73 A;  1YIO A;  3ECO A;  4L0Z B;  2LF8 A;  2V79 A;  4HX4 A;  2OZ6 A;  4ETS A;  3CUO A;  1HW5 A;  5HS7 A;  3FMS A;  2VBY A;  3FM5 A;  4L9V A;  4TV7 A;  1R5G A;  1W7P B;  4L5I A;  3QP6 A;  2PFB A;  3I58 A;  3DPL C;  3BJ6 A;  4WXD A;  3IKV A;  2F2E A;  2XRN A;  4KDP A;  1ZRF A;  1R23 A;  4AVP A;  5CVR A;  1RIO H;  3EQL F;  3HTU A;  4Y13 A;  3R0A A;  4WXH A;  5JFR A;  3V4G A;  2IT0 A;  1KA8 A;  2QBY A;  3GYH X;  2FSW A;  4HLY A;  3P9K A;  2HDC A;  4WX9 A;  3CLO A;  4U7D A;  3F6O A;  1QZZ A;  5FD5 A;  4EJV A;  2GXB A;  2H94 A;  3J81 K;  4RAY A;  4PZJ A;  3ZQ7 A;  2V1U A;  5HDN A;  5CVI A;  2P4W A;  3M1E A;  2V1X A;  1TTY A;  1P4W A;  5DUI A;  3LFK A;  1AOY A;  3ABU A;  4A0Z A;  4KYW A;  1G3W A;  4A6D A;  3I64 A;  4LFU A;  4LG0 A;  6PAX A;  1YLF A;  1SFU A;  2R3S A;  3CUQ C;  1ZGA A;  5DUK A;  2VOD A;  5E1Z B;  1ZG1 A;  3WTX C;  1IUY A;  5HOO A;  4L0Y B;  5L3D A;  3T8T A;  1SMY F;  3TDZ C;  1FY7 A;  1PP8 F;  1SFE A;  2COM A;  4G9Y A;  3KCC A;  2AS5 F;  3E6C C;  2FXA A;  3R6S A;  4LGW A;  4QWQ A;  1SAX A;  4Q4Z F;  1CF7 A;  3K9T A;  2OA4 A;  3KZY A;  2UXX A;  1XGS A;  3IL2 A;  5K5R A;  1ULY A;  4G8X A;  4N9H A;  3DF8 A;  4EJW A;  3H3U A;  3GLX A;  2EB7 A;  3WGH A;  4EM2 A;  1R36 A;  2ZNZ A;  4ON0 A;  1EV7 A;  1BI0 A;  2GA1 A;  3ABT A;  4B09 A;  4E70 A;  2W25 A;  2MC3 A;  1ZRE A;  3HIF A;  4GXO A;  4RB1 A;  2YPR A;  3O3K A;  2IJL A;  2QUF A;  1I27 A;  4RGU A;  4ZZD A;  5K5O A;  1LQ1 A;  1OPC A;  1T98 A;  3T1B A;  2VC0 A;  1XDS A;  2YR2 A;  4RB3 C;  3TO7 A;  2E7W A;  4OIO F;  3ERE D;  2RKH A;  1ON2 A;  2ZCW A;  4KMU X;  1MJ9 A;  1DPR A;  3FWE A;  5FFX A;  4FT8 A;  4L18 B;  3ZMT A;  2HEO A;  5KK1 A;  2HS5 A;  2MLK A;  1HBX G;  4HX8 A;  3ZN1 A;  1OYW A;  1U8R A;  1H9G A;  1BIA A;  2XVC A;  2V1D A;  3KP2 A;  1CGP A;  1IXR C;  2BYV E;  2IPQ X;  4O5V A;  4U0Y A;  4R79 A;  1B59 A;  3RYR A;  3F8B A;  4EM1 A;  4YG2 F;  2BBY A;  1U6G A;  1B1B A;  4G7O F;  3W6J B;  2A68 F;  3ZMV A;  2BV6 A;  4XLN F;  3OV8 A;  2XAS A;  4MTD A;  4CGZ A;  4GYI A;  3WE2 A;  4UVA A;  4WWC A;  4MGR A;  3MCZ A;  4ZH4 F;  5J8F A;  3JW4 A;  2M5W A;  1B9N A;  2DI3 A;  1BI2 A;  5DD4 A;  1MD0 A;  4MEX F;  2HOE A;  3QPT A;  1IZ1 A;  3KEQ A;  2QZ8 A;  4OMZ A;  1U78 A;  3M8F A;  3HTS B;  3L7W A;  4AIK A;  3HHH A;  5LRR A;  3E97 A;  4HBL A;  3H92 A;  4GGG A;  2BEO A;  1FBS A;  1MGT A;  3FMR A;  3JSO A;  1B9M A;  3PQK A;  1OYI A;  2FML A;  2EFP A;  2YU3 A;  1T39 A;  3QPH A;  5DV5 A; 
#chains in the Genus database with same CATH topology
 2DU9 A;  3R60 A;  1VQL I;  2GLO A;  2L7K A;  3UNG C;  3DP7 A;  3ULQ B;  2DTZ A;  4HYE A;  2FJ1 A;  2O3F A;  1FYK A;  4IHS A;  3F0C A;  3SYT A;  1J5Y A;  3GFI A;  2BHZ A;  5F64 A;  1WH5 A;  3RTR A;  3CZ6 A;  5F0H A;  2V6C A;  1DPU A;  3GZN B;  5E8G A;  3S14 J;  4M73 A;  1HW1 A;  4BBR J;  4I7H A;  1Z21 A;  5FJ8 J;  2GQQ A;  2LNB A;  2DPD A;  4BL0 B;  1NK2 P;  1OJL A;  1I39 A;  2XIG A;  4A93 J;  1V5F A;  4OMY A;  1YW9 A;  2CW8 A;  1IN5 A;  1W5T A;  4R1H A;  2RAE A;  5JVT A;  2DA3 A;  1FOX A;  3U2R A;  3Q5F A;  5HS8 A;  1IAW A;  3GTP J;  3A0B C;  3C3W A;  2ME6 A;  4AM3 A;  4ZYD A;  2J5P A;  4LJZ F;  4B47 A;  5IT3 A;  3JTH A;  2O8X A;  4QIW N;  4GRI A;  4X0G A;  4A3M J;  2VQL A;  2V4J C;  3HPG A;  3SZP A;  3HL2 A;  5EJC A;  5D6F A;  3SEZ A;  4XSZ F;  3WTS C;  3QRF F;  3M07 A;  3I3L A;  4ZC3 A;  4E6K G;  1DGW Y;  3K4N A;  3LWF A;  2BXZ A;  5JVG F;  3KIO A;  1YS6 A;  1RZ4 A;  2UWM A;  3H9J A;  1R7J A;  5GAD J;  1OCR H;  1DP7 P;  3K10 A;  4RLQ A;  3KYC B;  2XAU A;  1OYY A;  1S5L C;  1FYL A;  2B63 J;  2E1C A;  2Y2Z A;  4BDZ A;  1K6O A;  2DT7 B;  2HTJ A;  2DA2 A;  1F1Z A;  1SC7 A;  2W84 A;  1SVL A;  4UVB A;  3RKX A;  5CVU A;  2BVL A;  3GTO J;  2DK8 A;  2HXO A;  2V9V A;  2X6W A;  1DQU A;  5CVV A;  3TW6 A;  1OCP A;  4HV6 A;  4ESJ A;  2M45 A;  1MKM A;  3SDB A;  3P7N A;  5GAG J;  1MDM B;  2CQK A;  2DYR H;  5J3L A;  2DOE A;  2L9V A;  1I3Q J;  1WQ2 A;  1F5T A;  2CYY A;  4JOM A;  4P1W A;  4Y7N J;  4BS9 A;  3EUK L;  2V1N A;  4XRF A;  5IOY A;  3HOX J;  1Z7L A;  1W36 D;  2HQN A;  1SD4 A;  2VOO A;  3ZMU A;  5FB2 A;  2DW4 A;  4CZC A;  2K3P A;  4AC0 A;  2H6C A;  3GF2 A;  2Y31 A;  1AWC A;  3GTJ J;  3RZD J;  1UZC A;  5M3F J;  2R7R A;  2DO7 A;  3VYU B;  1JGS A;  3HUG A;  2NS7 A;  3ONQ A;  2F6C A;  2JN6 A;  2VL8 A;  2HWV A;  1UMQ A;  1JJ6 C;  3MKL A;  2JPC A;  1YFH A;  3LMM A;  2NOJ B;  1I1G A;  3FXM A;  4KNY A;  1P4X A;  1YI2 I;  2A69 F;  2ZB9 A;  3FBN B;  4LB6 B;  1FMV A;  1HXD A;  4PUS A;  2FF4 A;  3H3Z A;  5H20 A;  4IOC F;  3GME A;  2DJI A;  5D5X B;  2CU7 A;  1NK3 P;  3K70 D;  1OIS A;  1WWX A;  3F3X A;  4KA4 A;  2G7U A;  2EK5 A;  4EJO A;  2ESN A;  2BOL A;  1MIJ A;  4IQ4 A;  3MKZ A;  4Y15 A;  1FTT A;  3DWL E;  1BM9 A;  1USS A;  2O6G E;  1MBG A;  4MTE A;  4GFB A;  2M0C A;  2F5E A;  3S2W A;  4BY7 J;  2X6X A;  4E7J A;  2A61 A;  3ABL H;  4KIC A;  4RAG A;  1JKR C;  2IEK A;  1UFM A;  1MMD A;  2EZI A;  1M1E B;  1HA8 A;  1Q1H A;  3TDU C;  2ZSH B;  3BTC A;  2KRH A;  1YHQ I;  2AXL A;  3COA C;  2OQG A;  3BRO A;  1Z91 A;  3ZQC A;  3WTT C;  3U9G A;  5LGU A;  1I5Z A;  3BTJ A;  2CW0 F;  5ED4 A;  3CCV I;  5E18 F;  2R5Z A;  2M2E A;  1BC7 C;  3GVA A;  1QPI A;  5FRN A;  3AG4 H;  2ISY A;  3DBL B;  1HQC A;  2WV0 A;  1HDP A;  1MND A;  3L00 A;  2IGN A;  2DA5 A;  4D9J A;  5F6F A;  2VT2 A;  5CQE A;  2EFW A;  1R1U A;  2ESH A;  4FET A;  1AKH A;  3HOZ J;  5D8L B;  2ADU A;  2VB6 A;  4YFN F;  1G4D A;  1QBJ A;  2XKO A;  4NDL A;  3FDY A;  1JXS A;  2OPT A;  2KFD A;  3K6G A;  3QQA A;  1VZ0 A;  5DS9 A;  1IC8 A;  1G59 A;  2JZY A;  3HRM A;  2XPV A;  3RQI A;  2E19 A;  3QOE A;  3W3C A;  3LAJ A;  3MZH A;  2TRT A;  1ONV A;  3E0J B;  4KT6 A;  1MSE C;  3V7C A;  5DCM A;  5EEG A;  3IKT A;  1T08 B;  1POG A;  1K79 A;  2I10 A;  2VT3 A;  3QP5 A;  2VQC A;  1HOM A;  2VLA A;  1PUF A;  4JX5 A;  3MFK A;  1FIA A;  3ABK H;  3GTQ J;  2H27 A;  3L2Q A;  1YYV A;  2WB1 A;  2HKX A;  1R6R A;  4L5J A;  2A07 F;  5IYD J;  3OYI A;  2JA7 J;  3HEF A;  4IEJ A;  1X1D A;  2WY8 Q;  2EZL A;  2BGC A;  3GUD A;  1V4R A;  4OAY A;  1BW5 A;  1PUF B;  3ABM H;  1P2F A;  3O2P E;  1MNE A;  1FX7 A;  2D1H A;  3PNY A;  3K7A J;  5D4S A;  4LB5 A;  4LG0 B;  4L9N A;  1T6S A;  4CYD A;  4A3L J;  2M0M A;  3RZO J;  1N75 A;  1D8K A;  1WJ5 A;  1PP7 U;  2K5C A;  2WB1 N;  2P5V A;  4Y17 A;  2HDW A;  3P5J A;  2MBF A;  2RN7 A;  3RKW A;  3GW2 A;  3I59 A;  1XS9 A;  5CVJ A;  3DPU A;  5BMZ A;  1FT9 A;  1QQI A;  4XKV A;  2ME0 A;  2LC2 A;  4CCJ A;  4ESF A;  3CCU I;  5L3C A;  3VYR B;  3ZRG A;  3K2Z A;  3OYE A;  2K9S A;  2R5Y A;  4H4K C;  3WTZ A;  2AHQ A;  2WAE A;  3IH4 A;  3LOC A;  4M3F A;  1O3Q A;  3CO6 C;  2M30 A;  4XKC A;  4Y3O A;  3QU6 A;  5B66 C;  4RM2 A;  3ZOB A;  2NVU B;  1IDZ A;  2F5V A;  1ZR2 A;  1VQ7 I;  4CZZ A;  4KN7 X;  3V7R A;  2XHK A;  3VOD A;  3PSF A;  1TWH J;  5D5W B;  2IS2 A;  3IH3 A;  1OCO H;  3HOV J;  3PM1 A;  1OFC X;  2CQ7 A;  2NYX A;  3QPH A;  4FHT A;  2Y9Z A;  2XAQ A;  1GVD A;  2K27 A;  4XLC A;  4IO9 F;  1FSH A;  4PSW A;  4XMY A;  4M74 A;  5C3E J;  4IL6 C;  2LRD A;  1SFO J;  1FC3 A;  1KQ9 A;  4M3B A;  4IKF A;  4UB6 C;  3OYL A;  4E7L A;  3J7Y J;  1WJB A;  2R7O A;  2FU4 A;  1ZGW A;  3BDD A;  1YJN I;  2P7V B;  5F0C A;  2H1K A;  2QCO A;  4ZDP A;  3OOU A;  2VKV A;  3SEQ A;  2RQP A;  3IH2 A;  4DOZ A;  4V2G A;  4UV9 A;  2W24 A;  4BE0 A;  3BLY A;  3F22 A;  4ZJZ A;  2K3F A;  1QPM A;  1LFP A;  2Y9Y A;  1LEA A;  3HXL A;  3RJP A;  5AON A;  3FIW A;  3F23 A;  4OIP F;  3A2K A;  2EFQ A;  5F1J A;  1PYV A;  3KP7 A;  5JLW A;  2HOA A;  4UV8 A;  1WH7 A;  2KKO A;  2M34 A;  1Z05 A;  2P6S A;  2M1B A;  2RGV A;  2LRE A;  3LAP A;  3CUQ B;  1ODD A;  1Y1V J;  3IRR A;  1FBU A;  2R7T A;  4RB0 A;  4HEA 2;  3F8C A;  4AID A;  5EEA A;  4DYR A;  1VQ8 I;  5C44 J;  2EFO A;  3GZ6 A;  1B72 A;  1FP2 A;  2Y75 A;  3DU6 A;  5ILV A;  4Q47 A;  3L09 A;  2JSP A;  1A5J A;  1ZN2 A;  3MD2 A;  3M8J A;  4D7M A;  1JKO C;  4J00 A;  2PEX A;  3GZ5 A;  4M9X A;  4BQQ A;  3ZQG A;  2OTL I;  1Z3Y A;  2D2W A;  2NS0 A;  2R0Q C;  1J7K A;  5F0F A;  2HR3 A;  3S2D J;  2EIN H;  1CF7 B;  1YG2 A;  1QZY A;  3OIQ A;  1S3J A;  2ACJ A;  5LEK A;  1RR8 C;  2HU9 A;  1UB9 A;  1TWA J;  5KNL A;  3HBL A;  3DKW A;  1ZRC A;  2EJR A;  2L9N A;  3V8K A;  1KU2 A;  3T0Y A;  1AKH B;  5IYC J;  3LA3 A;  4MHG A;  5EZH A;  2NXN B;  4U88 A;  2DFH A;  3GBG A;  3CMY A;  4YIR X;  3ASO H;  2LFB A;  1XMA A;  2HPM A;  3BJA A;  4ITV A;  2IRF G;  3QOP A;  3M8E A;  4BE1 A;  2BW3 B;  4HF1 A;  2ZFW A;  2YX4 A;  4ZTJ A;  4WF2 A;  3ELK A;  5E3M A;  2V7F A;  1HST A;  1W0T A;  5K7Z A;  4RMN A;  3W6K B;  4A6E A;  2VJJ A;  3SHF A;  2NAZ A;  2DPU A;  2MFZ A;  3NEU A;  5H6Q A;  4LLL A;  5ILU A;  3I0T A;  5BOX A;  2XUB A;  5HDK A;  4BDY A;  2JTV A;  2WC2 A;  4RM3 A;  2A05 A;  5DDG A;  5BQT A;  4FCY A;  2E35 A;  4KFC A;  1S6L A;  3WU0 A;  1BBY A;  1K4S A;  1FLI A;  4AIJ A;  5D4R A;  5DM7 F;  4UUS B;  3VWB A;  5HOD A;  4ZYH A;  4M6Y A;  2CS3 A;  3V7S A;  2VIX A;  2GAU A;  3WOD F;  1R1V A;  3KX2 A;  5F1R A;  2PMZ A;  1X1C A;  3FXR A;  3RYP A;  3J7A O;  1BJA A;  1XDU A;  4QTR A;  3UKG A;  3TP0 A;  1Z77 A;  3SXY A;  1F43 A;  2VKD A;  1IN4 A;  3FX3 A;  2O8K A;  2JA8 J;  4LOC A;  3Q9S A;  3MVP A;  1XSV A;  2A6H F;  2IW5 A;  3SDG A;  5LBQ A;  3ZMD A;  4JQF A;  4PGH A;  3CCL I;  4UHT A;  1D0Y A;  4A3E J;  3CD6 I;  2MAB A;  2WTE A;  2JUG A;  3HJE A;  4OIR F;  5B1A H;  1LE8 A;  1SEU A;  1IG7 A;  1N25 A;  4LIT A;  3HGY A;  2LOO A;  3S93 A;  2GM4 A;  4M9Z A;  1UCR A;  3LSM A;  1MSF C;  3KLO A;  3OYF A;  2Q0O A;  5CLS A;  4C30 A;  2K4B A;  1FNN A;  2R5Z B;  5TRD A;  5E3L A;  3DKY A;  2WWY A;  5F08 A;  5LLQ A;  1MDM A;  3CCM I;  1D5Y A;  4CHU A;  2KIM A;  1LJ9 A;  1IV8 A;  4C3H J;  3MKW B;  2M3A A;  2M87 A;  3E6D A;  3OYD A;  1ZH5 A;  2QBY B;  4HRI A;  2RDP A;  3E5X A;  3CJN A;  1FBQ A;  4D5F A;  2RQQ A;  3BP8 A;  1Z9C A;  1ETV A;  3GEZ A;  5HVQ C;  1MW7 A;  3O8H A;  1JUP A;  3VSK A;  5JHF A;  3DTI A;  4XLA A;  2LBF A;  2W82 A;  2E1N A;  3OIP A;  1S72 I;  3CP8 A;  3S3M A;  1ZKG A;  3H5R A;  2EA2 A;  1A04 A;  2GIV A;  3MAJ A;  2KRC A;  2W00 A;  2QA4 I;  4Y52 J;  3I71 A;  1LNW A;  2E5N A;  4KUM A;  1APL C;  2K85 A;  3GLL A;  4P55 A;  2RVC A;  4CDG A;  5BPI A;  4NNJ A;  3PO3 J;  1KGS A;  2K40 A;  1EKE A;  1OMI A;  4BNC A;  2DMP A;  3WTW C;  1P9Q C;  2K9L A;  4KIF A;  3OSF A;  4G6Q A;  5J47 A;  3AL0 C;  3EUA A;  2IAI A;  2H09 A;  3CQZ J;  2AQE A;  2PMU A;  3FMQ A;  2STW A;  3JSP A;  2CUJ A;  2DQR A;  5M5X J;  3WHC A;  1FIP A;  1R4M B;  2UXN A;  2MD5 A;  3RPQ A;  4H0E A;  3EYY A;  5TIS C;  3T5X A;  1ON1 A;  4E7K A;  2LK2 A;  5TJJ A;  2NS8 A;  3BC8 A;  2LKS A;  2VJ5 A;  4MNU A;  4BJ6 C;  2M8E A;  5CJ9 A;  2EA4 A;  3TBI A;  2CMP A;  3WG9 A;  4BAY A;  1F36 A;  1D0Z A;  2RV8 A;  3I54 A;  1IXS B;  2OUM A;  4MLO A;  3TOA A;  2ZJP F;  2KMU A;  1NHA A;  5JHU A;  5E20 A;  2HYG D;  1RRJ A;  1GDT A;  3ZQI A;  5KAF C;  4RAF A;  3E1S A;  4DBQ A;  3CO7 C;  4J19 A;  2HDD A;  5DEQ A;  5LGT A;  1QU3 A;  4OWR B;  1SD6 A;  2E5Z A;  3H0G J;  3PO2 J;  4Q5S F;  2E2J J;  2NRA C;  3I4P A;  4IHY A;  1YRN A;  2DDB A;  2PJP A;  2VOP A;  2CO5 A;  1TQM A;  1FZP B;  2E1M B;  1XD7 A;  1QRY A;  5FLV A;  1MH3 A;  2FBK A;  3IV5 A;  1VQO I;  2XRL A;  3B02 A;  2VBZ A;  2EFN A;  1OLT A;  1U3E M;  1W4M A;  1TQP A;  3QOD A;  3CF2 A;  1L0O C;  4AU7 A;  2XAJ A;  3BWG A;  2JQ7 A;  3HM5 A;  3W2V A;  5IT9 K;  4S04 A;  2PLY A;  4G6T B;  3BQZ A;  3H0D A;  4JP0 A;  3IWF A;  3DU5 A;  1U9N A;  1S29 A;  3NQO A;  4CO8 A;  4HNT A;  2HXI A;  3OYK A;  1D5V A;  5EG0 B;  1YS7 A;  4ENN A;  1F9N A;  1DDN A;  3HRS A;  4GO1 A;  3A02 A;  3RDI A;  5L3E A;  4HV5 A;  2QQA A;  1K7A A;  4XKW A;  2BW3 A;  3K1N A;  1YW8 A;  3B6C A;  2R7X A;  1IUF A;  3E3V A;  3DXJ F;  1RES A;  1WKM A;  2RC4 A;  3CJT B;  2XSD C;  2WA0 A;  3F8N A;  2DYS H;  2LBF B;  2ID3 A;  1IW7 F;  4QSH A;  3TW7 A;  2D5V A;  2E71 A;  2XGE A;  3GTG J;  4EGZ A;  4GCV A;  2CV0 A;  1TW2 A;  2ZO4 A;  2K86 A;  4HAM A;  2KT0 A;  3CLQ A;  4A3F J;  4I2O A;  4U0W A;  3E7L A;  1R00 A;  4I76 A;  1X1A A;  4ZYA A;  2L7Z A;  3CJQ B;  3FHZ A;  3AG3 H;  2VE9 A;  3M3Y J;  4A3K J;  2QVO A;  2QLZ A;  3J81 Z;  3CCJ I;  4XRS A;  1R22 A;  2O5R A;  4OU0 A;  4DW6 A;  3HSE A;  4A3G J;  2XGX A;  5FKO A;  1LFU P;  2M4G A;  4A2U A;  1XGN A;  3BCB A;  4DBR A;  1WSU A;  1IRF A;  1V55 H;  1A35 A;  1PUE E;  3KP6 A;  2XRO A;  2XSJ C;  1OKR A;  1ZRD A;  5J40 A;  3ZR8 X;  5EGO B;  4BGD A;  2QSF X;  1XPX A;  4CH7 A;  1HW2 A;  4XOR A;  2W1O A;  1STZ A;  3V8J A;  2K9N A;  1Y56 A;  4B8X A;  3WGI A;  1JKP C;  1XCB A;  3IRQ A;  4ESB A;  3KEO A;  2AXT C;  3QYE A;  4G94 A;  1HF0 A;  2DA6 A;  2VXZ A;  2XAH A;  2EZK A;  5JLX A;  1Z7U A;  1VQ6 I;  3FKJ A;  3QWL A;  2KPM A;  2W4S A;  1VQM I;  4EJT A;  3AL0 B;  5ICE A;  1L3L A;  3SJM A;  1IV6 A;  4A3D J;  3I53 A;  4MIM A;  4U7B A;  2M7B A;  3B6A A;  5ILS A;  2VI6 A;  3G2B A;  2ZXI A;  2PQ8 A;  4F91 B;  5LFA A;  3RCO A;  1HCR A;  1KU3 A;  4M71 A;  4XR6 A;  4NQW A;  4BXU A;  2PBI A;  2WAQ A;  1R9T J;  4FE4 A;  1RI7 A;  5J6X A;  2DMT A;  2DMU A;  3M7G A;  2OF7 A;  3PUF A;  2R7D A;  2W85 A;  3N97 A;  2HOT A;  1W5S A;  2QWW A;  3H5A A;  1V5E A;  2ZSI B;  3CUQ A;  3FIS A;  3HYI A;  4EMS A;  4BE2 A;  2E2H J;  3A1Y A;  3DBR B;  3FF5 A;  4KN4 X;  3HSR A;  1TW3 A;  3G6E I;  1SFX A;  4L9J A;  4K2E A;  3PUB A;  2WY7 Q;  3NWT A;  4EJU A;  3S1Q J;  2K4J A;  4PFO A;  3TL4 X;  3KYD B;  3HKZ A;  4D5C A;  3S17 J;  1H8A C;  2R7U A;  4UUT A;  4M6X A;  3ZXS A;  2EQR A;  1AA7 A;  3LSP A;  2Y0M A;  3MWM A;  3S8P A;  5C4X J;  2E1M C;  2X1D A;  3N05 A;  3PQJ A;  4XID A;  1ZQ3 P;  2CV1 A;  1WJE A;  2G9W A;  2H8R A;  4LLG F;  3GTL J;  1BR2 A;  4N4N B;  2HTS A;  2X1C A;  1PDN C;  4ENK A;  1MMN A;  3EDP A;  2MLG A;  2EBI A;  4P9U A;  2F48 A;  4IVN A;  2BHY A;  1X2N A;  3C2B A;  1H88 C;  2LG4 A;  1MNM C;  1FP1 D;  1SD7 A;  3L2V A;  3JAM Z;  3I59 B;  2P7C B;  1ETQ A;  1VTN C;  1E3H A;  3HKZ N;  3KZZ A;  1G3Y A;  2L0K A;  2MH2 A;  4M9S A;  3RSN A;  2Y48 A;  1UHW A;  1UHS A;  3O8G A;  1DGR M;  3WG7 H;  2VPL A;  3VDX A;  4RAZ A;  4MO7 A;  3I5U A;  5FLX Z;  1ZHF A;  2EIM H;  2F5C A;  1XN7 A;  2JT1 A;  3LL7 A;  2KIQ A;  1IRZ A;  4CXF A;  3OS0 A;  2R7V A;  1H89 C;  1S7A A;  1WJA A;  3DV8 A;  1FEX A;  3GX4 X;  1BA5 A;  4HW0 A;  5AIQ A;  1IF1 A;  3I4N J;  4Y33 A;  4XKB A;  4CYC A;  1XSX A;  5FO5 A;  5FD6 A;  1GV2 A;  2MD0 A;  2HQR A;  2PN6 A;  4A5N A;  2EIK H;  1R5H A;  4S05 A;  3S1M J;  2PJR B;  3SZG A;  4IJA A;  4A0Y A;  1ZR4 A;  2JMW A;  2H6B A;  2ZJR F;  1OR7 A;  2A5Y B;  4NC7 A;  3S2H J;  2KZV A;  2EH3 A;  1D1A A;  3ESW B;  2X0L A;  4YIF A;  3ZMS A;  1KON A;  2F4M B;  1O7F A;  1ZG5 A;  2MW8 A;  1ZYR F;  4J01 A;  4JX6 A;  3S15 J;  2A3S A;  4C2U A;  1FMW A;  5IP9 J;  1S9H A;  5HLG A;  4P9F A;  1E17 A;  4F93 B;  3BR1 A;  1IRX A;  3KFW X;  1U5T A;  5FRM A;  2IP2 A;  3MZY A;  3VPR A;  2LY9 A;  1HKS A;  2ISZ A;  2GBY A;  4EM0 B;  3IP4 B;  1WHU A;  2B0L A;  1O57 A;  1S8N A;  4W1U A;  2HQ5 A;  1IJW C;  3TOB A;  3BG9 A;  2QSH X;  3J7A Y;  1WGX A;  4FIS A;  3CCS I;  3E6B A;  1RUN A;  4V19 K;  5AIP A;  2DA7 A;  2DAO A;  3L2R A;  1R1T A;  2HYF A;  3TKY A;  2FMY A;  3M1C A;  3OL4 A;  3OR1 C;  2FRH A;  2L54 A;  4I0B A;  3RIR A;  1T56 A;  2Z5U A;  3DKX A;  1BN5 A;  2DN0 A;  2CWE A;  3FXJ A;  1ETX A;  3SZT A;  4BKX A;  5F04 A;  2LF7 A;  2KIU A;  3BY6 A;  3PSI A;  4PDK A;  4B4C A;  4CCN A;  1RR7 A;  2JJ7 A;  3H35 A;  2KP6 A;  4BJ5 C;  1QO0 D;  1BW6 A;  2KZG A;  2DA1 A;  1JKQ C;  2R7W A;  3OS2 A;  2VUM J;  4A3C J;  2VON A;  3OIO A;  2EV0 A;  5HLI A;  4DZP A;  1D8J A;  3FM3 A;  3GTK J;  1ETW A;  3VYS B;  1SAN A;  1MBF A;  2L01 A;  4A3I J;  5ICC A;  2KIF A;  5ERI A;  3CC7 I;  4NB5 A;  2VJ4 A;  3HGG A;  2HGC A;  1K6Y A;  2P5K A;  2Z2S B;  2LMD A;  4OOI A;  3S16 J;  3O6B B;  1E3O C;  4HSR A;  5A2Q Z;  3HRT A;  2WV1 A;  4U0V A;  5FKL A;  1W7P A;  1A6Q A;  4PJ0 C;  1IGN A;  3PJR A;  1ZAO A;  1GXQ A;  3ECH A;  3M4O J;  2UV1 A;  2OQR A;  2PMZ N;  3T8R A;  2HVR A;  5HLH A;  4Z2Y A;  2IA1 A;  3LSK A;  1EH6 A;  3ZQQ A;  2MA3 A;  4ZYG A;  1S7O A;  5D8K B;  3C1D A;  1X3W B;  4OIN F;  2ELK A;  2JWT A;  3VSL A;  2L2O A;  3MEX A;  4BYY A;  2IS4 A;  2OBP A;  1J75 A;  2OCE A;  5J4V A;  1FJL A;  4F55 A;  4D1Q A;  2XV4 S;  4XOP A;  3LNQ A;  3G3Z A;  3K69 A;  3ML6 A;  4WK8 F;  2JRM A;  3HOS A;  3BR5 A;  3BZ6 A;  1MMG A;  4XQF A;  1VF9 A;  2Y69 H;  2MC4 A;  2IA0 A;  4LK1 F;  3MMY B;  1XB4 A;  5GPC A;  4XSX F;  1V3F A;  1R71 A;  1MBE A;  1ZAR A;  3KLN A;  3KP5 A;  5DM6 F;  2FQ3 A;  3ROU A;  4D7N A;  1JJ8 C;  2OD5 A;  2N8G A;  3OYG A;  5J1Y A;  2R7S A;  3EPZ A;  2G0E A;  3K4C A;  3LFU A;  4CA0 A;  5IPA A;  2FE3 A;  3CES A;  1RPW A;  4CCM A;  3PIP F;  1K83 J;  5KCM A;  4LLN A;  2QQ8 A;  3G1L A;  2LLK A;  4LK0 F;  1G8X A;  1XMX A;  1R5I D;  4QLC U;  2R7Z J;  1U2W A;  3F72 A;  5L3F A;  2LVS A;  1BR1 A;  2FUG 2;  1G2H A;  2WAQ N;  1RET A;  3F21 A;  5HDG A;  1U8B A;  5E8I A;  3JRG A;  2DCE A;  3D5R C;  2JK3 A;  3JAM K;  4IX7 A;  1Y39 A;  1C0W A;  4ENJ A;  4BY1 J;  1X4O A;  1WJC A;  2L5Q A;  2EWN A;  4WCG A;  3ASN H;  4I02 A;  5ICF A;  3GFJ A;  5E1W A;  3OYN A;  2L7M P;  5FLX K;  2P0W A;  5IOZ A;  3TP3 A;  4S0H B;  3WTY C;  2KJC A;  2OJE D;  2VPR A;  2CSO A;  4BQO A;  5LGN A;  3WTU C;  3CC2 I;  3JRF A;  4BBS J;  4HQE A;  2VKE A;  1G3S A;  4G12 A;  1RC9 A;  4JX4 A;  1HSJ A;  2LH9 A;  1FSE A;  2PMH A;  2HI3 A;  1MJA A;  2NNN A;  5LHG A;  5GTI C;  2IGK A;  1JT0 A;  4FX4 A;  4JBA A;  3HRU A;  2LDU A;  2PI0 A;  2ZKZ A;  2RRE A;  3HHG A;  1IN6 A;  2JPB A;  1EJ9 A;  3GFM A;  3GXO A;  1ACI A;  2DDA A;  3L2U A;  3G1M A;  3E5U A;  3HPH A;  1UJ8 A;  2XPW A;  1XGO A;  4BUP A;  5GTH C;  1UAA A;  4XN0 A;  2X4H A;  4KIG A;  2DA4 A;  3ZCO A;  3A01 B;  1KQ0 A;  2GXG A;  3ZMZ A;  1X3U A;  2ZJ2 A;  2ZXJ A;  1QVU A;  4XRM A;  1XCV A;  1EH7 A;  1SVM A;  4HLX A;  1P7I A;  3OWT A;  5LHI A;  1HKT A;  1UST A;  1JHF A;  3LQR A;  4F92 B;  3ERM A;  5J8C A;  2D45 A;  2BVM A;  3HSF A;  4IRI A;  2E60 A;  5ICG A;  3HOW J;  4UUV A;  2VQG A;  5DCF A;  3KE2 A;  1Z3X A;  4RS8 A;  4IRG A;  5FGM A;  2HYJ A;  2WAD A;  2IGM A;  4AIH A;  2VN2 A;  3FXQ A;  4QPQ A;  3D1N I;  2J5O A;  3L9F A;  5CPR B;  1QNT A;  2VE8 A;  3FK6 A;  3NRV A;  5E3N A;  2R7F A;  1Z6R A;  2NOG A;  2YUS A;  3CDI A;  1RNL A;  4HF0 A;  4P5O A;  1BI1 A;  2DMQ A;  2K9Q A;  4E7S A;  4A0X A;  3FXK A;  3V8L A;  3L2C A;  3DTK A;  3TQN A;  4M72 A;  2JA5 J;  3CDH A;  1ETK A;  3JRH A;  3KP4 A;  3C18 A;  3JTG A;  2O0Y A;  4G7H F;  2X51 A;  3C7J A;  3FK7 A;  2XAF A;  3Q3S A;  4NBQ A;  3TGN A;  1LDD A;  3JRB A;  4BHP A;  4YRV A;  1KU9 A;  1OQY A;  5LEJ A;  1FOY A;  1YIJ I;  5IP7 J;  3BZC A;  4BH9 A;  1N78 A;  2MH9 A;  3OOP A;  4PJJ A;  1DUX C;  3H1C A;  4OIQ F;  2LY1 A;  2EZH A;  1O3R A;  3HC7 A;  4I6Z A;  1B72 B;  3P9I A;  1ZG3 A;  3S32 A;  4XLP F;  4HOB A;  2ZNY A;  2HOS A;  3KET A;  2CUF A;  3J80 Z;  4EVI A;  4I98 B;  1GXP A;  4C3I J;  3MN2 A;  3NWS A;  4UB8 C;  2OZU A;  4MFE A;  2IGO A;  1RKW A;  1IDY A;  2Q2E A;  4RGX A;  4W97 A;  4ZZL A;  4U87 A;  5HLT A;  1FPQ A;  5LRS A;  3HOY J;  3G4S I;  3RI4 A;  1U9O A;  1J2X A;  3DQV C;  3BTI A;  4EGY A;  3AKZ A;  4HX7 A;  2E36 A;  4NC6 A;  1WRJ A;  5FLM J;  2KQR A;  1NG7 A;  4OAZ A;  1EA3 A;  1TT5 B;  2OCC H;  4KIB A;  4XM3 A;  5DTD A;  1MH4 A;  3G73 A;  2KJB A;  2DFF A;  2HZD A;  1IN7 A;  3K70 C;  1TLH B;  2DLL A;  5L3G A;  1KQ8 A;  4LIU A;  2Z99 A;  3RPU A;  2CUE A;  1SVO A;  4CSW A;  1NG6 A;  2KDZ A;  2R92 J;  2OU2 A;  2L7F P;  3SFI A;  3S1R J;  3GTM J;  3LA7 A;  4ASN A;  4BHC A;  5EZG A;  4P96 A;  1Z0X A;  2WBM A;  2F5F A;  2XKP A;  1X4P A;  1GVJ A;  1YQA A;  1VI0 A;  1SFK A;  3ZGK A;  3D5S C;  2HFH A;  2EPF A;  2Z33 A;  2DOD A;  1KU7 A;  4LMY A;  1YTY A;  3DEE A;  1CQT A;  1LE8 B;  1GHC A;  3DTE A;  3DPT A;  2H8W A;  1HKQ A;  1O3T A;  3R0J A;  3RKY A;  3JRD A;  4HST A;  2COB A;  1K4T A;  2DK5 A;  1MMS A;  1O3S A;  3QU3 A;  1TNS A;  3H3V K;  1MMA A;  1YIT I;  5FKM A;  3WE3 A;  3IWZ A;  4HNU A;  2LSO A;  4ZYE A;  4RA2 A;  1RKT A;  1GLN A;  1X1P A;  2L4M A;  1BC8 C;  1WI9 A;  3IC7 A;  1KZH A;  1OCC H;  4XON A;  2CV2 A;  4L5E A;  2IA2 A;  3FHN A;  4DNC A;  3CDL A;  4EEF G;  3FXU A;  3LST A;  1Z6T A;  4RB2 C;  1KYZ A;  3W2W A;  2ZME A;  4XL9 A;  3PNV A;  5LHH A;  2I8D A;  4KIT B;  3FKI J;  4XBF A;  5FRO A;  2LP0 A;  4M3D A;  5K7H A;  2VBX A;  1YJW I;  2BY1 A;  1HC8 A;  2FBI A;  3OS1 A;  1WFX A;  3CTA A;  1KYW A;  2KL4 A;  4B3A A;  5IY5 H;  4NUB A;  3OYB A;  2CQX A;  3WU2 C;  1ZGJ A;  1T33 A;  1YO5 C;  3GWZ A;  1I1S A;  3BOQ A;  5JI6 A;  5A2Q K;  4PJL A;  1IO2 A;  1HLV A;  1IRG A;  4DJA A;  2PX9 A;  2IBD A;  3L1P A;  1BIB A;  2QF7 A;  4I99 C;  1YX5 A;  1TWF J;  3S3N A;  3AG2 H;  2PG4 A;  2LR8 A;  2FQ4 A;  2DOF A;  1K78 B;  4L9T A;  3DEW A;  2V26 A;  4YII A;  2CFX A;  4NHJ A;  2MYS A;  4AD9 A;  1MBH A;  1ETY A;  1ZTR A;  1MBJ A;  4R8H A;  3I9V 2;  5CYV A;  5EEH A;  3PIO F;  2K7L A;  1IXC A;  3QPL A;  1X3Z B;  4RGR A;  3QYF A;  1VQP I;  3GFL A;  1R58 A;  2X6Y A;  5DD8 A;  4NC8 A;  4CCL A;  4LD5 A;  1H0M A;  3G1O A;  2CH0 A;  2FNP A;  2FD5 A;  2HVQ A;  4PCQ A;  3LQQ A;  1T0F A;  3MQ0 A;  1VQ9 I;  4CUG A;  4GYG A;  4BQA A;  1WPK A;  2BY2 A;  4BJT A;  2CW7 A;  4HZF A;  5C4J J;  3BCA A;  1REP C;  4I01 A;  4A12 A;  2UZK A;  1VQK I;  1QGP A;  1U5T B;  2HZT A;  1SAU A;  3S1N J;  3BR3 A;  2QKM B;  4DYC A;  4EV0 A;  1Y0U A;  2C6Y A;  3P9C A;  5HS9 A;  1B8I A;  1UHM A;  1MJB A;  2JUC A;  1V5G A;  2ZME B;  3CCE I;  4B1R A;  2X85 A;  3SQN A;  4DZJ A;  4XLE A;  1TC3 C;  1VQ5 I;  1GT0 C;  1FWZ A;  2DBB A;  3OYM A;  4HF2 A;  2W48 A;  3U21 A;  2STT A;  2O61 A;  1I3A A;  3ZN0 A;  5K1Y A;  1R49 A;  2QQB A;  2K9M A;  4RLF A;  3ISP A;  3J80 K;  4QPO A;  5L3B A;  1T2K A;  4YEL A;  1F4K A;  4ABZ A;  3EUH A;  1FOW A;  4IF4 A;  2RNJ A;  4MEY F;  3SFZ A;  2DFI A;  2FNA A;  4M3E A;  3K0L A;  4YFX F;  4HDV A;  1G3T A;  1GV5 A;  1W7P D;  2P6T A;  4FAS D;  5EF6 A;  1IN8 A;  3L2W A;  4ENM A;  4JK1 X;  2CG4 A;  2Y30 A;  5FKN A;  1K61 A;  3JRC A;  4Z6Y A;  5IT9 Z;  3ZPL A;  1TZL A;  2I5U A;  5DCM B;  4IPA A;  1FYM A;  2GWR A;  1J09 A;  1YW7 A;  3V42 A;  3Q9V A;  3FXL A;  1A6I A;  2YSR A;  1E0E A;  1PJR A;  2XF6 A;  2FEZ A;  4G7Z F;  2BZT A;  1MZB A;  2K02 A;  2TDX A;  3K2A A;  2IVM A;  2DQL A;  2D1V A;  3VFZ A;  4HA8 A;  2DFE A;  4B43 A;  3BG7 A;  4HPQ A;  4UXN A;  3F6V A;  5E17 F;  2MG4 A;  4BHB A;  3AAF A;  1O4X A;  3ZP5 A;  1XGM A;  4XLF A;  2BE5 F;  2O7O A;  2W57 A;  3GO5 A;  2Z1D A;  1Z1D A;  2X9D A;  5GAH J;  5FFZ A;  1E2X A;  3U1D A;  4N9I A;  3F8F A;  5EGO A;  1K78 A;  4PGG A;  2P81 A;  3BG6 A;  5GPA A;  2DT5 A;  4IRH A;  4FX0 A;  2DTR A;  2OAZ A;  2EIL H;  4Y4R A;  1LDJ A;  3RQ4 A;  2ETH A;  4Q48 A;  2FA5 A;  3OYA A;  1H9T A;  3WGG A;  5D5V B;  3BTL A;  2JRT A;  2XB5 A;  3DFG A;  2FBH A;  4KMF A;  2P8T A;  4RBO A;  3DBH B;  1J59 A;  1OR7 C;  2BXY A;  4HNV A;  2VBW A;  1P7J A;  3HG9 A;  3K1P A;  3K4B A;  3HOT A;  1JE8 A;  1JUM A;  1QHG A;  3FXO A;  3A4C A;  3LA2 A;  5J1U A;  2ZXW H;  2JVH A;  3KEY A;  2ELH A;  5JR3 A;  3H9Q A;  3IUO A;  4UVC A;  1TNT A;  4MQ9 F;  3TO9 A;  1Y1W J;  2X1E A;  2NVT J;  4RGS A;  1BI3 A;  3K4M A;  4X6A J;  4XRS G;  1UG0 A;  3X2Q H;  4WXC A;  1JGG A;  2VC1 A;  5BS6 A;  2VKH A;  2KRF A;  1G6N A;  1JHH A;  1P92 A;  3LSJ A;  1RUO A;  4E7Z A;  2F4O B;  3VEP A;  3VOE A;  1W0U A;  1J9I A;  3R61 A;  2Q8K A;  1JI8 A;  5K7F A;  3WU1 B;  2CGP A;  2L3D A;  2A6T A;  1HDD C;  2M4K A;  3PFI A;  4GDF A;  3E5Q A;  2ZBK A;  4PFP A;  2E7X A;  1FOK A;  3BJO A;  1ZK8 A;  4HDU A;  2P5L C;  3WTV C;  4N0B A;  2HKO A;  2OV7 A;  1B6A A;  2O03 A;  1U5T C;  1ZLJ A;  4DIQ A;  3HUG B;  3OYJ A;  3A03 A;  1NTC A;  2YU9 J;  3QYB A;  3A0H C;  1T8I A;  1FTZ A;  2F5D A;  2ZME C;  1AU7 A;  4XLH A;  1BOA A;  2KHM A;  2OC6 A;  2WAF A;  3TMO A;  4MQV A;  1LVA A;  3F8M A;  2YX7 A;  3QAH A;  1YRN B;  4CIC A;  1LDK B;  1QHH D;  2ZJQ F;  1A36 A;  4IHT A;  1LEB A;  1TT0 A;  2L4A A;  2QYO A;  4F3Q A;  3VB2 A;  2FOW A;  1EH8 A;  4AWX B;  1VND A;  1LPQ A;  2L9S A;  2QEN A;  2XAG A;  4FTH A;  5BPD A;  3N4M A;  5E79 C;  3DCF A;  1EF4 A;  1U0J A;  2FOK A;  2F4I A;  5CKT A;  3K1M A;  3OYH A;  4F7Z A;  2EV6 A;  1ZLK A;  3KP3 A;  2ZXH A;  4A5M A;  1YJ9 I;  2ECC A;  4PSX A;  3IHU A;  4YFK F;  2L02 A;  1SMT A;  2QGU A;  2LKX A;  3CJR B;  1SD5 A;  2AO9 A;  3OYC A;  1TQI A;  2JSC A;  4XK4 A;  3G71 I;  2QEX I;  1I6X A;  4I09 A;  4XNF A;  1LB2 A;  2GZW A;  3A01 A;  3KYL A;  3D5L A;  4C3J J;  1P6R A;  1B4A A;  2A6E F;  2LKP A;  3R4K A;  4KT5 C;  4C9Y A;  5B3S H;  4IZZ A;  2M7A A;  3M9A A;  3BPV A;  1QVT A;  2AQF A;  1Z67 A;  2UUZ A;  3TO6 A;  1J0R A;  2Z3Y A;  1Y0N A;  5DYM A;  2QKL B;  5B5E C;  5D5U B;  5E1X A;  1X2M A;  1XMK A;  1VQN I;  4G6D A;  1O7L A;  2EV5 A;  1ENH A;  3D0S A;  4C2M J;  4D0P A;  1XSD A;  2XC7 A;  5EYR A;  2GOX B;  1D3Y A;  3BQY A;  2H1L A;  3EYI A;  3E6M A;  4IXA A;  4IOA F;  1QZE A;  4BAC A;  3PNT A;  1X19 A;  3VYT B;  4EQQ A;  2HVS A;  2QQ9 A;  2W7N A;  3BPX A;  2ICW G;  5LD2 C;  2Z9O A;  3BR6 A;  4HQM A;  1TBX A;  5KVR A;  1D1B A;  2NNY A;  2X48 A;  3EET A;  3F9K A;  4BXF A;  1YOV B;  1XC5 A;  3FZV A;  2GA2 A;  1DU0 A;  1D1C A;  2BY0 A;  1P4A A;  3DEU A;  4IHW A;  3CCQ I;  2RNG A;  3K4J A;  3AG1 H;  3REO A;  1T38 A;  4DQ2 A;  5H6R A;  4UNO A;  5D6E A;  5GP9 A;  2G7H A;  5K5Q A;  4O3M A;  4I0A A;  4O6J A;  3Q0U A;  2XPU A;  3CME I;  2QM3 A;  4M3G A;  3B73 A;  2E34 A;  2EIJ H;  1ETO A;  1YIO A;  3ECO A;  4L0Z B;  4UUS A;  2LF8 A;  4ZTF A;  4EAT A;  2V79 A;  4HX4 A;  3OSG A;  2OZ6 A;  3BZK A;  3KPH A;  4ETS A;  3CUO A;  4V2F A;  2LY2 A;  5M5Y J;  1HW5 A;  3BR0 A;  5HS7 A;  2BY3 A;  3FMS A;  2KIS A;  2VBY A;  3FM5 A;  1ZEL A;  4L9V A;  3ZQH A;  3JRA A;  1AHD P;  3EUH C;  4TV7 A;  4ANJ A;  1R5G A;  1W7P B;  4L5I A;  1Y8Q B;  4BXX J;  3QP6 A;  3H5N A;  2PFB A;  4BEH B;  4X1E A;  3I58 A;  3HDD A;  3DPL C;  2XF5 A;  1BR4 A;  4FQG A;  3BJ6 A;  4WXD A;  3IKV A;  9ANT A;  3BR2 A;  3KZI C;  3C2G A;  2F2E A;  2XRN A;  4KDP A;  3JR9 A;  2DJN A;  1ZRF A;  1R23 A;  4AVP A;  4PJN A;  5CVR A;  1RIO H;  3EQL F;  3HTU A;  4Y13 A;  3R0A A;  2DMN A;  4WXH A;  4YEJ A;  1N77 A;  5JFR A;  1Y8R B;  2CFO A;  3V4G A;  3PL8 A;  2IT0 A;  2E2I J;  1YE9 A;  1KA8 A;  2QBY A;  1JTY A;  3GYH X;  1PVE A;  4KIS A;  2GOM A;  2FSW A;  4HLY A;  3P9K A;  2HDC A;  4WX9 A;  2LYC A;  2VXD A;  3CLO A;  4U7D A;  1W36 C;  3F6O A;  1QZZ A;  1WVR A;  4B44 A;  5FD5 A;  3LSI A;  4EJV A;  2GXB A;  3IAS 2;  1WJF A;  4FE7 A;  2DXI A;  1YX3 A;  2H94 A;  2JVG A;  4LIV A;  3J81 K;  4RAY A;  4PZJ A;  3ZQ7 A;  1VFC A;  2KDO A;  5E3O A;  3RPU D;  5HDN A;  4N4O B;  2V1U A;  5CVI A;  3K4L A;  2P4W A;  4DYQ A;  1LFB A;  3M1E A;  2HPI A;  2V1X A;  1T0F C;  1TTY A;  1QA6 A;  3OL3 A;  4C2T A;  4M6V A;  4JYK A;  1X1B A;  1P4W A;  5DUI A;  3LFK A;  4HG2 A;  4CCO A;  2TCT A;  1AOY A;  3ABU A;  4A0Z A;  4KYW A;  2XDV A;  2NVQ J;  1G3W A;  4A6D A;  3FBI B;  3I64 A;  4LFU A;  4E4H A;  4LG0 A;  1TP4 A;  1OCZ H;  6PAX A;  1YLF A;  1SFU A;  2R3S A;  2Y0S N;  3CUQ C;  1WCM J;  2R4G A;  4BU2 A;  3J7Z I;  3MKY B;  1JT6 A;  3WHB A;  3HZJ A;  3MZ8 A;  1XG1 A;  1ZGA A;  5DUK A;  4LG3 A;  3HOU J;  5B1B H;  2VOD A;  5BNG A;  1Q1V A;  2GXA A;  2XGC A;  5E1Z B;  1ZG1 A;  2OTJ I;  5HNF A;  3WTX C;  1IUY A;  5HOO A;  4L0Y B;  5L3D A;  3T8T A;  2VJI A;  3K4K A;  1SMY F;  1UG2 A;  2MGQ A;  3H9G A;  3TDZ C;  1FY7 A;  1JTX A;  4B48 A;  1PP8 F;  2Y0S A;  1GUU A;  1SFE A;  2COM A;  2VAS A;  1TWG J;  4G9Y A;  3KCC A;  3LSH A;  3E6C C;  2AS5 F;  2XB0 X;  3CC4 I;  3RKQ A;  1Y6I A;  2FXA A;  3R6S A;  4LGW A;  4QWQ A;  1A31 A;  2R5Y B;  1SAX A;  3CCY A;  4Q4Z F;  1CF7 A;  4IQJ A;  4A3B J;  2ID6 A;  3K9T A;  2OA4 A;  2HNH A;  3KZY A;  1BL0 A;  2ZC2 A;  5J1R A;  2UXX A;  3CF5 F;  3QPS A;  1XGS A;  3JCU C;  2R7Q A;  4XIC A;  3IL2 A;  5K5R A;  4B3X A;  1ULY A;  4G8X A;  5J4Y A;  3H36 A;  1XTA A;  4N9H A;  5KHD A;  4MFD A;  2JA2 A;  3BG5 A;  3OMY A;  3DF8 A;  3OY9 A;  4XN3 A;  3NAU A;  2LTP A;  4PK4 A;  4EJW A;  5M5W J;  2V9P A;  1NH3 A;  2MSY A;  2V9K A;  3H3U A;  1X58 A;  2EB7 A;  3GLX A;  3WGH A;  1R36 A;  2ZNZ A;  4ON0 A;  1EV7 A;  4EM2 A;  1BI0 A;  4RDU A;  3CMA I;  1S7E A;  1T95 A;  2GA1 A;  5KAI C;  1DU6 A;  2CUZ A;  3ABT A;  4B09 A;  5HNH A;  1I6H J;  4E70 A;  2W25 A;  1V54 H;  2MC3 A;  1LKX A;  1ZRE A;  3HIF A;  4NQW B;  3IAM 2;  4GXO A;  1W1W E;  1TL8 A;  4RB1 A;  2YPR A;  3O3K A;  4E7H A;  2IJL A;  3ZQL A;  2QUF A;  2CJJ A;  1I27 A;  2Q1Z B;  4RGU A;  3ZQF A;  2DT6 A;  4ZZD A;  5K5O A;  1LQ1 A;  1T98 A;  1OPC A;  1UEL B;  3BT9 A;  3T1B A;  2X6O A;  2VC0 A;  1XDS A;  1I50 J;  2YR2 A;  3GCM A;  3TO7 A;  4BEH A;  2XGD A;  4RB3 C;  2PJR A;  3U1K A;  1DP3 A;  1B8I B;  4DGW B;  1WJD A;  1W5C C;  5TGT A;  5EG0 A;  4IHV A;  2E7W A;  4OIO F;  3ERE D;  2RKH A;  4CYC B;  1WZ2 A;  1ON2 A;  1LUJ B;  1TWC J;  2ZCW A;  5FKK A;  4IHX A;  4KMU X;  4ZDL A;  1MJ9 A;  1DPR A;  3FWE A;  5FFX A;  4FT8 A;  4L18 B;  3ZMT A;  5F27 A;  2HEO A;  3LSR A;  1E3P A;  5KK1 A;  2HS5 A;  2MLK A;  1HBX G;  4HX8 A;  2HQA A;  1BOB A;  1JUS A;  3DLA A;  2O9L A;  2IS6 A;  2KLO A;  2IS1 A;  1ORK A;  3I55 I;  3ZN1 A;  1OYW A;  2IXS A;  3S3O A;  1U8R A;  1H9G A;  1BIA A;  2Z16 A;  3LSG A;  2VQH A;  3CMM A;  4A69 C;  4AYB A;  4E7I A;  2XVC A;  1WI3 A;  1VQ4 I;  2V1D A;  3KP2 A;  2XF7 A;  1IXR C;  2ECB A;  2BYV E;  1CGP A;  2IPQ X;  2M9H A;  3NAR A;  2B7E A;  4O5V A;  3AFH A;  2FX0 A;  4U0Y A;  4R79 A;  3Q0V A;  1B59 A;  3W6V A;  3RYR A;  3DLL F;  3F8B A;  1ERD A;  4EM1 A;  2E1O A;  4YG2 F;  3I56 I;  2V6E A;  2BBY A;  1U6G A;  3OR2 C;  1B1B A;  2Q2E B;  4G7O F;  2NVY J;  5IYB J;  4BQN A;  3W6J B;  2ELJ A;  4A3J J;  2ZFU A;  2A68 F;  3ZMV A;  5EDN A;  4II2 A;  2BV6 A;  4XLN F;  4AYB N;  5M3M J;  4UY8 I;  3OV8 A;  1OCT C;  2XAS A;  1MBK A;  4MTD A;  4CGZ A;  3UR3 C;  2GIZ A;  4GYI A;  3WE2 A;  2R93 J;  2B9S A;  1ITY A;  1XX5 A;  4UVA A;  5H2F C;  5IP6 A;  4WWC A;  4PJM A;  3JRI A;  4ZDO A;  4MGR A;  3W2A A;  2DOA A;  1D0X A;  3MCZ A;  3CP2 A;  4ZH4 F;  4XOT A;  5J8F A;  4CCK A;  4KJZ A;  2QSG X;  3JW4 A;  5CQG A;  3HB9 A;  3Q0W A;  2M5W A;  1B9N A;  3PFY A;  2DI3 A;  1BI2 A;  5DD4 A;  1MD0 A;  2L9R A;  4F52 A;  4MEX F;  2HOE A;  3QPT A;  1IZ1 A;  3KEQ A;  2QZ8 A;  4OMZ A;  1U78 A;  3C2H A;  3M8F A;  4II3 A;  2NVX J;  3HTS B;  3L7W A;  4AVZ A;  2YS9 A;  4AIK A;  3HHH A;  3TED A;  5LRR A;  3E97 A;  4HBL A;  2M8G X;  3H92 A;  4GGG A;  4AUX A;  1BJZ A;  2CQN A;  3JRE A;  3CCR I;  2BEO A;  1FBS A;  1MGT A;  3FMR A;  3JSO A;  1B9M A;  2LD5 A;  5GAE J;  2JA6 J;  2CRG A;  3PQK A;  2A5W A;  2CQQ A;  1OYI A;  2FML A;  1LVK A;  2EFP A;  1R4N B;  2YU3 A;  1T39 A;  3I4M J;  3BG3 A;  5DV5 A; 
#chains in the Genus database with same CATH homology
 2DU9 A;  3R60 A;  3DP7 A;  3ULQ B;  4HYE A;  1FYK A;  2O3F A;  4IHS A;  1J5Y A;  3GFI A;  5F64 A;  3RTR A;  2V6C A;  1DPU A;  5E8G A;  4M73 A;  1HW1 A;  4I7H A;  2GQQ A;  2LNB A;  2DPD A;  2XIG A;  4OMY A;  1YW9 A;  1IN5 A;  1W5T A;  4R1H A;  5JVT A;  3U2R A;  3Q5F A;  5HS8 A;  1IAW A;  3C3W A;  4ZYD A;  2J5P A;  4LJZ F;  5IT3 A;  3JTH A;  2O8X A;  3SZP A;  5D6F A;  4XSZ F;  3WTS C;  3QRF F;  3LWF A;  1YS6 A;  1RZ4 A;  2UWM A;  1R7J A;  1DP7 P;  1OYY A;  1FYL A;  2E1C A;  1K6O A;  2HTJ A;  1F1Z A;  2W84 A;  4UVB A;  3RKX A;  5CVU A;  2DK8 A;  2V9V A;  5CVV A;  4HV6 A;  4ESJ A;  2M45 A;  1MKM A;  3P7N A;  1MDM B;  2CQK A;  1F5T A;  1WQ2 A;  2CYY A;  4XRF A;  2HQN A;  1SD4 A;  2VOO A;  3ZMU A;  5FB2 A;  2DW4 A;  2H6C A;  3GF2 A;  1AWC A;  2DO7 A;  1JGS A;  3HUG A;  2HWV A;  2JPC A;  1YFH A;  1I1G A;  4KNY A;  1P4X A;  2A69 F;  4LB6 B;  1HXD A;  2FF4 A;  3H3Z A;  5H20 A;  5D5X B;  1WWX A;  3F3X A;  4KA4 A;  2G7U A;  2EK5 A;  4EJO A;  2ESN A;  4Y15 A;  1BM9 A;  1USS A;  2O6G E;  4MTE A;  2F5E A;  3S2W A;  2A61 A;  4KIC A;  1UFM A;  1Q1H A;  3TDU C;  2AXL A;  3COA C;  2OQG A;  3BRO A;  1Z91 A;  3WTT C;  3U9G A;  5LGU A;  1I5Z A;  5ED4 A;  2CW0 F;  5E18 F;  1BC7 C;  3GVA A;  2ISY A;  1HQC A;  2WV0 A;  3L00 A;  5F6F A;  2VT2 A;  2EFW A;  1R1U A;  2ESH A;  5D8L B;  2ADU A;  4YFN F;  1G4D A;  1QBJ A;  2XKO A;  1JXS A;  2JZY A;  3HRM A;  3LAJ A;  3MZH A;  1ONV A;  3V7C A;  5DCM A;  5EEG A;  3IKT A;  1K79 A;  2VT3 A;  3QP5 A;  3MFK A;  2H27 A;  1YYV A;  2HKX A;  4L5J A;  2A07 F;  2BGC A;  3GUD A;  1V4R A;  1P2F A;  3O2P E;  1FX7 A;  2D1H A;  5D4S A;  4LB5 A;  4LG0 B;  4L9N A;  1T6S A;  4CYD A;  1D8K A;  1PP7 U;  2P5V A;  4Y17 A;  2MBF A;  2RN7 A;  3RKW A;  3GW2 A;  3I59 A;  5BMZ A;  5CVJ A;  1FT9 A;  1QQI A;  4ESF A;  5L3C A;  3K2Z A;  3WTZ A;  1O3Q A;  3CO6 C;  2M30 A;  3QU6 A;  4CZZ A;  4KN7 X;  3V7R A;  2XHK A;  3VOD A;  5D5W B;  2NYX A;  4FHT A;  2XAQ A;  2K27 A;  1FSH A;  4M74 A;  1FC3 A;  1KQ9 A;  2FU4 A;  3BDD A;  2P7V B;  2RQP A;  4UV9 A;  2W24 A;  3F22 A;  1QPM A;  3F23 A;  1LEA A;  3RJP A;  4OIP F;  5AON A;  2EFQ A;  3KP7 A;  4UV8 A;  2KKO A;  1Z05 A;  2P6S A;  2M1B A;  2RGV A;  3LAP A;  3CUQ B;  1ODD A;  3IRR A;  1FBU A;  4RB0 A;  3F8C A;  2EFO A;  3GZ6 A;  1FP2 A;  2Y75 A;  5ILV A;  4Q47 A;  3L09 A;  1ZN2 A;  2PEX A;  3GZ5 A;  4M9X A;  2D2W A;  2NS0 A;  1J7K A;  2HR3 A;  1CF7 B;  1YG2 A;  1QZY A;  1S3J A;  2ACJ A;  5LEK A;  1UB9 A;  3DKW A;  1ZRC A;  2EJR A;  3V8K A;  1KU2 A;  3T0Y A;  3LA3 A;  4MHG A;  4U88 A;  1XMA A;  3BJA A;  2IRF G;  3QOP A;  3M8E A;  4HF1 A;  2ZFW A;  2YX4 A;  4WF2 A;  3ELK A;  1HST A;  3W6K B;  4A6E A;  3SHF A;  2NAZ A;  2DPU A;  3NEU A;  5H6Q A;  4LLL A;  5ILU A;  3I0T A;  5BOX A;  2XUB A;  5HDK A;  2JTV A;  2WC2 A;  5BQT A;  5DDG A;  4KFC A;  1S6L A;  3WU0 A;  1BBY A;  1FLI A;  4AIJ A;  5D4R A;  4ZYH A;  4M6Y A;  3V7S A;  2GAU A;  3WOD F;  1R1V A;  5F1R A;  3FXR A;  3RYP A;  3J7A O;  1BJA A;  1XDU A;  3SXY A;  1IN4 A;  3FX3 A;  3Q9S A;  5LBQ A;  1XSV A;  2A6H F;  2IW5 A;  3ZMD A;  4JQF A;  4PGH A;  4UHT A;  2WTE A;  4OIR F;  4M9Z A;  1UCR A;  3KLO A;  2Q0O A;  5CLS A;  2K4B A;  1FNN A;  5TRD A;  2WWY A;  5LLQ A;  1MDM A;  4CHU A;  2KIM A;  1LJ9 A;  2M87 A;  3E6D A;  1ZH5 A;  2QBY B;  2RDP A;  3E5X A;  3CJN A;  1FBQ A;  1Z9C A;  3BP8 A;  3GEZ A;  5HVQ C;  2E1N A;  2EA2 A;  1A04 A;  2GIV A;  3MAJ A;  3I71 A;  1LNW A;  4KUM A;  4P55 A;  2RVC A;  4CDG A;  5BPI A;  1KGS A;  1OMI A;  4BNC A;  3WTW C;  4KIF A;  4G6Q A;  2H09 A;  2PMU A;  3FMQ A;  2STW A;  3JSP A;  2DQR A;  2UXN A;  2MD5 A;  3RPQ A;  4H0E A;  3EYY A;  3T5X A;  1ON1 A;  5TJJ A;  4MNU A;  2M8E A;  5CJ9 A;  2EA4 A;  4BAY A;  3WG9 A;  2RV8 A;  3I54 A;  1IXS B;  3TOA A;  5JHU A;  1NHA A;  5E20 A;  2HYG D;  3CO7 C;  5DEQ A;  5LGT A;  1SD6 A;  4Q5S F;  2NRA C;  3I4P A;  2PJP A;  2VOP A;  2CO5 A;  1TQM A;  1FZP B;  1XD7 A;  2FBK A;  3B02 A;  2VBZ A;  2EFN A;  1U3E M;  1W4M A;  1TQP A;  1L0O C;  2XAJ A;  3BWG A;  5IT9 K;  4S04 A;  2PLY A;  3IWF A;  1S29 A;  3NQO A;  4CO8 A;  1D5V A;  1YS7 A;  4ENN A;  1F9N A;  1DDN A;  3HRS A;  4GO1 A;  3RDI A;  5L3E A;  4HV5 A;  2QQA A;  1K7A A;  3K1N A;  1YW8 A;  3E3V A;  3DXJ F;  1WKM A;  2RC4 A;  3F8N A;  1IW7 F;  4EGZ A;  4GCV A;  1TW2 A;  2ZO4 A;  2K86 A;  4HAM A;  4I2O A;  4U0W A;  1R00 A;  3FHZ A;  2VE9 A;  2QVO A;  2QLZ A;  3J81 Z;  1R22 A;  4OU0 A;  3HSE A;  2XGX A;  4A2U A;  1XGN A;  1WSU A;  1IRF A;  1PUE E;  3KP6 A;  2XRO A;  1OKR A;  1ZRD A;  1HW2 A;  1STZ A;  3V8J A;  3WGI A;  4B8X A;  1XCB A;  3IRQ A;  4ESB A;  3KEO A;  4G94 A;  2VXZ A;  2XAH A;  1Z7U A;  4EJT A;  5ICE A;  1L3L A;  3I53 A;  4U7B A;  5ILS A;  2PQ8 A;  1KU3 A;  4M71 A;  4NQW A;  4BXU A;  2PBI A;  1RI7 A;  5J6X A;  3M7G A;  2R7D A;  2W85 A;  3N97 A;  1W5S A;  2QWW A;  3CUQ A;  3HYI A;  4EMS A;  4KN4 X;  3FF5 A;  3HSR A;  1TW3 A;  1SFX A;  4L9J A;  4K2E A;  4EJU A;  2K4J A;  4M6X A;  2Y0M A;  3MWM A;  3PQJ A;  2G9W A;  4LLG F;  2HTS A;  1PDN C;  4ENK A;  3EDP A;  2MLG A;  4P9U A;  4IVN A;  1FP1 D;  1SD7 A;  3JAM Z;  3I59 B;  2P7C B;  1VTN C;  3KZZ A;  1G3Y A;  2MH2 A;  4M9S A;  2Y48 A;  1UHW A;  4RAZ A;  3I5U A;  5FLX Z;  1ZHF A;  2F5C A;  1XN7 A;  2JT1 A;  4CXF A;  1S7A A;  3DV8 A;  3GX4 X;  4HW0 A;  5AIQ A;  1IF1 A;  1XSX A;  5FO5 A;  5FD6 A;  2HQR A;  2PN6 A;  4A5N A;  1R5H A;  4S05 A;  4IJA A;  4A0Y A;  2H6B A;  1OR7 A;  2A5Y B;  2X0L A;  4YIF A;  3ZMS A;  1O7F A;  1ZG5 A;  1ZYR F;  2A3S A;  5HLG A;  4P9F A;  1E17 A;  3KFW X;  1U5T A;  2IP2 A;  3MZY A;  1HKS A;  2ISZ A;  4EM0 B;  2B0L A;  1O57 A;  1S8N A;  3TOB A;  1RUN A;  3E6B A;  5AIP A;  2DAO A;  1R1T A;  2HYF A;  3TKY A;  2FMY A;  2FRH A;  2L54 A;  4I0B A;  3RIR A;  2Z5U A;  1BN5 A;  2CWE A;  3SZT A;  2LF7 A;  2KIU A;  3BY6 A;  4PDK A;  1QO0 D;  2VON A;  2EV0 A;  5HLI A;  1D8J A;  3FM3 A;  2L01 A;  5ICC A;  2KIF A;  5ERI A;  4NB5 A;  2HGC A;  2P5K A;  4OOI A;  3O6B B;  5A2Q Z;  3HRT A;  4U0V A;  1W7P A;  1ZAO A;  1GXQ A;  3ECH A;  2OQR A;  3T8R A;  5HLH A;  4Z2Y A;  2IA1 A;  4ZYG A;  1EH6 A;  2MA3 A;  1S7O A;  5D8K B;  3C1D A;  4OIN F;  3MEX A;  4BYY A;  2OBP A;  1J75 A;  2XV4 S;  3G3Z A;  3K69 A;  3ML6 A;  4WK8 F;  3HOS A;  3BZ6 A;  2IA0 A;  4LK1 F;  1XB4 A;  4XSX F;  1V3F A;  1ZAR A;  3KLN A;  3KP5 A;  2FQ3 A;  3ROU A;  2OD5 A;  2FE3 A;  4LLN A;  4LK0 F;  4QLC U;  1U2W A;  3F72 A;  5L3F A;  3F21 A;  5HDG A;  5E8I A;  3JAM K;  1C0W A;  4ENJ A;  2EWN A;  4WCG A;  4I02 A;  5ICF A;  3GFJ A;  5E1W A;  5FLX K;  3WTY C;  2KJC A;  3WTU C;  2CSO A;  5LGN A;  4HQE A;  1G3S A;  1HSJ A;  2PMH A;  1FSE A;  5LHG A;  1MJA A;  2NNN A;  4FX4 A;  4JBA A;  3HRU A;  2LDU A;  2PI0 A;  2ZKZ A;  3HHG A;  1IN6 A;  2JPB A;  3GFM A;  3GXO A;  3E5U A;  1XGO A;  2X4H A;  4KIG A;  1KQ0 A;  2GXG A;  3ZMZ A;  1X3U A;  2ZJ2 A;  2ZXJ A;  1XCV A;  1EH7 A;  4HLX A;  5LHI A;  1HKT A;  1UST A;  1JHF A;  3LQR A;  5J8C A;  2D45 A;  3HSF A;  4IRI A;  5ICG A;  4UUV A;  5DCF A;  3KE2 A;  4RS8 A;  4IRG A;  5FGM A;  4AIH A;  2VN2 A;  3FXQ A;  2J5O A;  3L9F A;  1QNT A;  2VE8 A;  3NRV A;  2R7F A;  1Z6R A;  1RNL A;  4HF0 A;  4P5O A;  1BI1 A;  4A0X A;  3V8L A;  3L2C A;  3TQN A;  4M72 A;  3CDH A;  3KP4 A;  3C18 A;  3JTG A;  2O0Y A;  4G7H F;  3C7J A;  2XAF A;  3TGN A;  1LDD A;  4BHP A;  1KU9 A;  5LEJ A;  4BH9 A;  2MH9 A;  3OOP A;  1DUX C;  4OIQ F;  1O3R A;  3P9I A;  1ZG3 A;  4XLP F;  4HOB A;  2ZNY A;  3KET A;  3J80 Z;  4EVI A;  4I98 B;  1GXP A;  2OZU A;  2Q2E A;  4RGX A;  4ZZL A;  1FPQ A;  5LRS A;  3RI4 A;  1J2X A;  3DQV C;  4EGY A;  4HX7 A;  1WRJ A;  4KIB A;  3G73 A;  2KJB A;  1IN7 A;  1TLH B;  2DLL A;  5L3G A;  1KQ8 A;  2Z99 A;  3RPU A;  2OU2 A;  3LA7 A;  4ASN A;  4BHC A;  4P96 A;  2F5F A;  2XKP A;  1GVJ A;  1YQA A;  2HFH A;  2Z33 A;  1KU7 A;  4LMY A;  1YTY A;  1GHC A;  3DPT A;  1HKQ A;  1O3T A;  3R0J A;  3RKY A;  2DK5 A;  1O3S A;  3QU3 A;  1TNS A;  3WE3 A;  3IWZ A;  2LSO A;  4ZYE A;  2L4M A;  1BC8 C;  1WI9 A;  3IC7 A;  2IA2 A;  4DNC A;  3FXU A;  3LST A;  1Z6T A;  4RB2 C;  1KYZ A;  2ZME A;  5LHH A;  4XBF A;  2VBX A;  2FBI A;  3CTA A;  1KYW A;  1ZGJ A;  1YO5 C;  1I1S A;  3GWZ A;  3BOQ A;  5JI6 A;  5A2Q K;  1IRG A;  1BIB A;  2PG4 A;  1K78 B;  4L9T A;  4YII A;  4NHJ A;  2CFX A;  4AD9 A;  4R8H A;  5CYV A;  5EEH A;  2K7L A;  1IXC A;  4RGR A;  3GFL A;  1R58 A;  5DD8 A;  4LD5 A;  1H0M A;  2FNP A;  4PCQ A;  3LQQ A;  1T0F A;  3MQ0 A;  4BQA A;  4GYG A;  4HZF A;  1REP C;  4I01 A;  4A12 A;  2UZK A;  1QGP A;  1U5T B;  2HZT A;  4EV0 A;  1Y0U A;  2C6Y A;  3P9C A;  5HS9 A;  1UHM A;  1MJB A;  2ZME B;  3SQN A;  1FWZ A;  2DBB A;  4HF2 A;  2STT A;  2O61 A;  3ZN0 A;  5K1Y A;  2QQB A;  3ISP A;  3J80 K;  5L3B A;  1T2K A;  1F4K A;  3EUH A;  4IF4 A;  2RNJ A;  4MEY F;  3SFZ A;  2DFI A;  2FNA A;  3K0L A;  4YFX F;  4HDV A;  1G3T A;  1W7P D;  2P6T A;  1IN8 A;  4ENM A;  4JK1 X;  2CG4 A;  5IT9 Z;  3ZPL A;  5DCM B;  4IPA A;  1FYM A;  2GWR A;  1YW7 A;  3Q9V A;  2YSR A;  2FEZ A;  4G7Z F;  1MZB A;  2K02 A;  2TDX A;  2IVM A;  2DQL A;  2D1V A;  3VFZ A;  4HA8 A;  4UXN A;  3F6V A;  5E17 F;  4BHB A;  3AAF A;  3ZP5 A;  1XGM A;  2BE5 F;  3GO5 A;  2W57 A;  1Z1D A;  5FFZ A;  1E2X A;  3U1D A;  4N9I A;  3F8F A;  1K78 A;  4PGG A;  2DT5 A;  4IRH A;  4FX0 A;  2DTR A;  2OAZ A;  1LDJ A;  2ETH A;  4Q48 A;  2FA5 A;  1H9T A;  3WGG A;  5D5V B;  2JRT A;  3DFG A;  2FBH A;  4KMF A;  2P8T A;  1J59 A;  2VBW A;  3HOT A;  3K1P A;  1JE8 A;  3LA2 A;  2ELH A;  5JR3 A;  4UVC A;  1TNT A;  4MQ9 F;  3TO9 A;  4RGS A;  1BI3 A;  4WXC A;  2VC1 A;  5BS6 A;  2KRF A;  1G6N A;  1JHH A;  1P92 A;  1RUO A;  3VEP A;  3VOE A;  1J9I A;  3R61 A;  2Q8K A;  3WU1 B;  2CGP A;  2L3D A;  3PFI A;  3E5Q A;  2ZBK A;  2E7X A;  1FOK A;  3BJO A;  4HDU A;  2P5L C;  3WTV C;  4N0B A;  2HKO A;  1B6A A;  2O03 A;  1U5T C;  1ZLJ A;  2F5D A;  1BOA A;  4MQV A;  1LVA A;  3F8M A;  2YX7 A;  3QAH A;  4CIC A;  1LDK B;  4IHT A;  1LEB A;  2L4A A;  2QYO A;  3VB2 A;  1EH8 A;  4AWX B;  2QEN A;  2XAG A;  5BPD A;  3N4M A;  2FOK A;  3K1M A;  4F7Z A;  2EV6 A;  1ZLK A;  3KP3 A;  4A5M A;  4YFK F;  3IHU A;  2L02 A;  1SMT A;  1SD5 A;  1TQI A;  2JSC A;  1I6X A;  4I09 A;  1LB2 A;  2GZW A;  3D5L A;  1P6R A;  1B4A A;  2A6E F;  2LKP A;  3R4K A;  4KT5 C;  3M9A A;  3BPV A;  3TO6 A;  1J0R A;  2Z3Y A;  5DYM A;  5D5U B;  5E1X A;  1XMK A;  4G6D A;  1O7L A;  2EV5 A;  3D0S A;  4D0P A;  1XSD A;  1D3Y A;  3EYI A;  3E6M A;  4IXA A;  4EQQ A;  2QQ9 A;  3BPX A;  2Z9O A;  4HQM A;  1TBX A;  5KVR A;  2NNY A;  3EET A;  3FZV A;  2GA2 A;  3DEU A;  1P4A A;  3REO A;  1T38 A;  4DQ2 A;  5H6R A;  4UNO A;  5D6E A;  2G7H A;  5K5Q A;  4O3M A;  4I0A A;  4O6J A;  2QM3 A;  3B73 A;  1YIO A;  3ECO A;  4L0Z B;  2LF8 A;  2V79 A;  4HX4 A;  2OZ6 A;  4ETS A;  3CUO A;  1HW5 A;  5HS7 A;  3FMS A;  2VBY A;  3FM5 A;  4L9V A;  4TV7 A;  1R5G A;  1W7P B;  4L5I A;  3QP6 A;  2PFB A;  3I58 A;  3DPL C;  3BJ6 A;  4WXD A;  3IKV A;  2F2E A;  2XRN A;  4KDP A;  1ZRF A;  1R23 A;  4AVP A;  5CVR A;  1RIO H;  3EQL F;  3HTU A;  4Y13 A;  3R0A A;  4WXH A;  5JFR A;  3V4G A;  2IT0 A;  1KA8 A;  2QBY A;  3GYH X;  2FSW A;  4HLY A;  3P9K A;  2HDC A;  4WX9 A;  3CLO A;  4U7D A;  3F6O A;  1QZZ A;  5FD5 A;  4EJV A;  2GXB A;  2H94 A;  3J81 K;  4RAY A;  4PZJ A;  3ZQ7 A;  2V1U A;  5HDN A;  5CVI A;  2P4W A;  3M1E A;  2V1X A;  1TTY A;  1P4W A;  5DUI A;  3LFK A;  1AOY A;  3ABU A;  4A0Z A;  4KYW A;  1G3W A;  4A6D A;  3I64 A;  4LFU A;  4LG0 A;  6PAX A;  1YLF A;  1SFU A;  2R3S A;  3CUQ C;  1ZGA A;  5DUK A;  2VOD A;  5E1Z B;  1ZG1 A;  3WTX C;  1IUY A;  5HOO A;  4L0Y B;  5L3D A;  3T8T A;  1SMY F;  3TDZ C;  1FY7 A;  1PP8 F;  1SFE A;  2COM A;  4G9Y A;  3KCC A;  2AS5 F;  3E6C C;  2FXA A;  3R6S A;  4LGW A;  4QWQ A;  1SAX A;  4Q4Z F;  1CF7 A;  3K9T A;  2OA4 A;  3KZY A;  2UXX A;  1XGS A;  3IL2 A;  5K5R A;  1ULY A;  4G8X A;  4N9H A;  3DF8 A;  4EJW A;  3H3U A;  3GLX A;  2EB7 A;  3WGH A;  4EM2 A;  1R36 A;  2ZNZ A;  4ON0 A;  1EV7 A;  1BI0 A;  2GA1 A;  3ABT A;  4B09 A;  4E70 A;  2W25 A;  2MC3 A;  1ZRE A;  3HIF A;  4GXO A;  4RB1 A;  2YPR A;  3O3K A;  2IJL A;  2QUF A;  1I27 A;  4RGU A;  4ZZD A;  5K5O A;  1LQ1 A;  1OPC A;  1T98 A;  3T1B A;  2VC0 A;  1XDS A;  2YR2 A;  4RB3 C;  3TO7 A;  2E7W A;  4OIO F;  3ERE D;  2RKH A;  1ON2 A;  2ZCW A;  4KMU X;  1MJ9 A;  1DPR A;  3FWE A;  5FFX A;  4FT8 A;  4L18 B;  3ZMT A;  2HEO A;  5KK1 A;  2HS5 A;  2MLK A;  1HBX G;  4HX8 A;  3ZN1 A;  1OYW A;  1U8R A;  1H9G A;  1BIA A;  2XVC A;  2V1D A;  3KP2 A;  1CGP A;  1IXR C;  2BYV E;  2IPQ X;  4O5V A;  4U0Y A;  4R79 A;  1B59 A;  3RYR A;  3F8B A;  4EM1 A;  4YG2 F;  2BBY A;  1U6G A;  1B1B A;  4G7O F;  3W6J B;  2A68 F;  3ZMV A;  2BV6 A;  4XLN F;  3OV8 A;  2XAS A;  4MTD A;  4CGZ A;  4GYI A;  3WE2 A;  4UVA A;  4WWC A;  4MGR A;  3MCZ A;  4ZH4 F;  5J8F A;  3JW4 A;  2M5W A;  1B9N A;  2DI3 A;  1BI2 A;  5DD4 A;  1MD0 A;  4MEX F;  2HOE A;  3QPT A;  1IZ1 A;  3KEQ A;  2QZ8 A;  4OMZ A;  1U78 A;  3M8F A;  3HTS B;  3L7W A;  4AIK A;  3HHH A;  5LRR A;  3E97 A;  4HBL A;  3H92 A;  4GGG A;  2BEO A;  1FBS A;  1MGT A;  3FMR A;  3JSO A;  1B9M A;  3PQK A;  1OYI A;  2FML A;  2EFP A;  2YU3 A;  1T39 A;  3QPH A;  5DV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...