3WU0A

Crystal structure of phosphorylated ets-1 dna binding and autoinhibitory domains (276-441)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein C-ets-1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu0A00
1HW1A 3BY6A 1HW2A 2F5EA 2NRAC 3KEOA 4CO8A 2HQNA 4IPAA 1ON1A 2RVCA 2PBIA 5F64A 2MA3A 1KGSA 1SD7A 4R8HA 3E5QA 3I64A 4CHUA 4AIKA 4LG0B 3FMSA 4G94A 2GIVA 1IF1A 4OMYA 2E7WA 5JR3A 4MQVA 4ZYDA 2LF7A 3E6MA 2STWA 2MBFA 3W6KB 1Z1DA 2FOKA 2JTVA 1LDKB 4ETSA 4LB6B 4CDGA 3DKWA 1SFEA 2KIUA 4RGSA 1ZRCA 3K9TA 1R23A 4NB5A 2FF4A 3GVAA 2OAZA 5K1YA 1RZ4A 1G3SA 3E5XA 1ZRFA 3V7SA 3J81Z 3MZHA 4Q47A 4P9FA 3G3ZA 1XCBA 2XAFA 1VTNC 4EGZA 2A61A 5LGNA 4LLLA 4LJZF 1F9NA 4CICA 1MJAA 3M8EA 1S3JA 3I54A 1USTA 2MH9A 2HEOA 3FM5A 2MLGA 2VC1A 2Y75A 3R0JA 5E17F 3K1PA 1A04A 1BN5A 3H3ZA 1KU2A 1BM9A 4MEYF 2OU2A 3GUDA 3IWZA 1R1TA 3AAFA 2QUFA 2O03A 4ASNA 4OIPF 3ML6A 1OPCA 5E1WA 3WTSC 2IRFG 4M74A 3K0LA 5IT9K 3TO7A 1IXRC 2CWEA 1H9GA 4Y17A 5E8IA 1I1SA 1FYKA 4HX8A 4IHTA 2XKPA 2V1UA 1TBXA 1LJ9A 2EFWA 3F8BA 1H0MA 2DPDA 2QQAA 2C6YA 4I02A 2STTA 2EB7A 5L3GA 3CO7C 3E6BA 2WTEA 2AS5F 2RQPA 1TLHB 4UV9A 5ED4A 4LD5A 5L3CA 2PG4A 4WXCA 1IRFA 5D8LB 2O61A 2F5FA 2EK5A 2HZTA 4FX4A 4A5NA 1MJBA 2WWYA 1IN6A 5FGMA 1I1GA 1T6SA 1YTYA 2D1VA 4BQAA 1R36A 3HSEA 3O6BB 4RS8A 2LKPA 1EH6A 3SZPA 3HUGA 2P5VA 3V8KA 5CLSA 2A68F 3DEUA 2FU4A 1WKMA 5CVJA 3R4KA 3C3WA 4BNCA 2V6CA 2P5KA 3M7GA 4XLPF 2Y0MA 4UVAA 2Z3YA 3J80K 3T5XA 1I5ZA 3SXYA 4ZH4F 4KN7X 1JHHA 4LK0F 1YW8A 3QP6A 5DD4A 3COAC 1XGOA 1FBUA 2V79A 4HYEA 1HQCA 3ZN1A 3EDPA 4YFNF 2FQ3A 5HLHA 4A0XA 3FMQA 1TNTA 2MD5A 2TDXA 3CUOA 1IZ1A 3IL2A 2BEOA 4IF4A 1T38A 1EV7A 1PUEE 3WODF 4UV8A 5FLXK 5HDNA 1R00A 5DYMA 2GWRA 1F4KA 2K86A 4MHGA 3L09A 4KIGA 4O6JA 4U7DA 2OZ6A 2ZNZA 2VOOA 1Z9CA 4Y15A 1K78A 4M9ZA 4GGGA 2H6CA 5ILSA 2EWNA 4JBAA 3ZMTA 5LRRA 1YS7A 1F5TA 5LGUA 3RTRA 3QPTA 2ETHA 3KP6A 3P9KA 2KIFA 3HSFA 5K5OA 2XAJA 3I59A 1WQ2A 2ZCWA 4RGUA 4HV6A 4I0BA 5JI6A 1IN4A 2M5WA 3JW4A 2D2WA 4EM1A 4EJVA 3K1MA 4KYWA 3BOQA 1R22A 2ZMEB 4MTDA 2O6GE 3QPHA 1P4XA 2JSCA 3WTTC 1U6GA 1XMAA 3RI4A 1GHCA 5CYVA 2G7UA 5E18F 4KUMA 4G7HF 2K7LA 3C1DA 3FZVA 3KEQA 3FXUA 2XAQA 3SHFA 1ZG3A 1YO5C 4LLGF 3J81K 4HAMA 4RB0A 2M1BA 3CUQA 1S7OA 1TNSA 2UWMA 1P4WA 2EA2A 3N4MA 5CVUA 3EYYA 2P6TA 4B8XA 1J5YA 3RPUA 2P7VB 4KFCA 1FBSA 2Q2EA 3D5LA 4IJAA 4ESFA 3H92A 1QO0D 3CO6C 4EJTA 4GO1A 1YYVA 3GLXA 3RKXA 1QQIA 1K78B 5HS7A 1L3LA 3WU1B 4CYDA 4A5MA 5LHGA 2BV6A 3CUQC 4I09A 1TQMA 1Z6TA 3I4PA 4HQEA 5LEKA 4S04A 3WU0A 2L4MA 2EV6A 1NHAA 3ABUA 4XLNF 2GZWA 1FC3A 4ENJA 1S8NA 2DLLA 1ZH5A 3I59B 4M9SA 5HS8A 2EFNA 4ZZLA 4R1HA 5L3EA 3J7AO 1S7AA 1BJAA 1IW7F 1SAXA 2QWWA 2NNYA 4IXAA 4U88A 4EVIA 4FHTA 1FP2A 5J6XA 1ZYRF 4IRGA 3ZN0A 4G6QA 1OR7A 1JHFA 5ICCA 2ZNYA 2UXXA 3ISPA 3ZMVA 1FYMA 2OZUA 1D3YA 3I0TA 3R6SA 5H6RA 4EMSA 2ZXJA 1D8KA 4Z2YA 4YFXF 5ICFA 4BXUA 5ERIA 4U0VA 1BI3A 3DXJF 3CUQB 1J9IA 2QZ8A 4LG0A 1ZGJA 5DUIA 4WWCA 1TW3A 2CO5A 2O0YA 4KICA 2UXNA 2XASA 1LDJA 4P5OA 5LRSA 4I98B 4DQ2A 1KYZA 5DCMA 3LAPA 3JTHA 1BIBA 4RAYA 2HS5A 3QU3A 2V1XA 4EJUA 3EETA 5DDGA 3LA7A 4MGRA 2FRHA 1H9TA 3GWZA 3M1EA 2H94A 2YR2A 5LBQA 3IWFA 5HLIA 1UB9A 2ZBKA 4N9HA 3LA3A 3NEUA 1QBJA 4KIBA 5DUKA 2BGCA 2DT5A 4EJOA 1HSTA 3HRSA 1FOKA 2XUBA 3KLOA 3Q5FA 5ILUA 1XB4A 3C7JA 4L5JA 1KU3A 3H3UA 3KP3A 1O3RA 2ADUA 3RJPA 2K4BA 2WC2A 4EM0B 1KU7A 4MQ9F 2EA4A 4PDKA 5F1RA 1HKSA 3ROUA 2OA4A 1UHMA 3U2RA 4LGWA 1XGMA 4O5VA 1DP7P 1LB2A 1GXPA 1D5VA 2DI3A 3FX3A 4G9YA 2ISZA 1MGTA 2GXGA 2HFHA 3ECHA 1MJ9A 4F7ZA 1KQ0A 2M8EA 2OQRA 2PI0A 2OD5A 3ZMSA 3W6JB 2BBYA 2PLYA 1ODDA 4HQMA 5DCMB 2MH2A 1U78A 2FEZA 4D0PA 5DV5A 1DUXC 2IT0A 3KP7A 2D1HA 2NNNA 3HIFA 2BYVE 2DQLA 3VB2A 1YLFA 4IRHA 1Y0UA 3IKVA 4ZYGA 3P9CA 1RI7A 3QAHA 5LLQA 1IN5A 2OBPA 3F8FA 4HV5A 3CLOA 2FMLA 3RKYA 3HOTA 3TKYA 2RKHA 2YSRA 2DAOA 3IC7A 1Z91A 1FSHA 1PP8F 1XMKA 3WTZA 1BBYA 1WI9A 2DK5A 1HBXG 2HGCA 1R58A 1U8RA 4ZZDA 4I7HA 3MCZA 1QZZA 4R79A 2XV4S 4HF1A 2PJPA 3WGGA 2FXAA 5K5QA 2QENA 3JAMK 1SD6A 3TO6A 4KN4X 1K6OA 3TDUC 1CGPA 4A12A 3T1BA 2W84A 3K1NA 5AIQA 2JRTA 1ZN2A 3QU6A 3F22A 4L9VA 1SFUA 1ZRDA 1FWZA 2H09A 1DPUA 3DP7A 4S05A 1PP7U 1ZLJA 1REPC 2H6BA 2VT3A 4HDUA 2XHKA 3HYIA 2DO7A 1U5TC 4A6EA 5JHUA 2HWVA 1J59A 4K2EA 3N97A 4CXFA 3FWEA 1S6LA 1LQ1A 3NQOA 2EFQA 3WTVC 3T8TA 2KRFA 4GYIA 1FP1D 3ZMDA 2HOEA 2JPCA 2OQGA 3CDHA 3IRQA 1PDNC 3DPTA 4BYYA 5ICEA 2L02A 2YU3A 4HLYA 3KFWX 2VBZA 5LHIA 2ZMEA 4MEXF 2IW5A 4I01A 1BI2A 5FFZA 2FSWA 2GA2A 2RDPA 5BMZA 1OYWA 3S2WA 4QLCU 1B9MA 5BS6A 1O57A 3TQNA 4L9JA 1OKRA 3CJNA 1SMTA 1G3WA 2Z33A 4GXOA 2O3FA 1U5TB 5D5WB 4AD9A 2Q0OA 1GXQA 2RGVA 5DD8A 2NYXA 1B9NA 1Z05A 4P55A 4EJWA 3IHUA 3R61A 2IA1A 2LDUA 3BP8A 3ZQ7A 4O3MA 2RNJA 1SD5A 2VODA 2LSOA 1K79A 1E17A 2XVCA 2XGXA 4BHPA 2D45A 4ZYHA 1C0WA 2L01A 2FE3A 2FNAA 5CVVA 4WK8F 3REOA 3KETA 4ESJA 3LAJA 2L54A 4UVBA 2ELHA 1XSDA 1MZBA 2M30A 2JZYA 3F6OA 4A0YA 3WE3A 3E6DA 1LVAA 2QM3A 2Z9OA 3F23A 3ERED 1UHWA 5HVQC 1IXCA 2PMHA 3M9AA 4UNOA 1L0OC 5A2QZ 4NQWA 4LK1F 1LDDA 4XSXF 3HRMA 3ULQB 2DQRA 1F1ZA 4BHBA 3ZMZA 1IAWA 4HF2A 2O8XA 4AIJA 2Z99A 4UUVA 1YW7A 2QYOA 2VT2A 4RB2C 4LFUA 2VBXA 3B02A 2G9WA 3O2PE 1BIAA 3OOPA 2W85A 2PN6A 3MZYA 3F8MA 2Y48A 3VEPA 5D6EA 1FT9A 3GF2A 4BAYA 5HLGA 2VOPA 4OOIA 3GW2A 2QBYA 1QNTA 4M9XA 3TO9A 1O7LA 5FD5A 2CQKA 4MNUA 2V1DA 3F8CA 2A3SA 3JAMZ 2GXBA 2ESNA 2L3DA 2H27A 1J7KA 4L0YB 1YFHA 1I27A 2FA5A 1IN7A 3RDIA 4A6DA 2XAGA 3FMRA 4G7ZF 3QRFF 2ZJ2A 5D4SA 4FX0A 4L9NA 2PMUA 1WWXA 1AWCA 2E1CA 2M45A 2YX7A 1Q1HA 3Q9VA 2VONA 2EFOA 2CW0F 4UXNA 4AVPA 4L18B 3BJ6A 2LNBA 4M72A 4WF2A 4RB3C 3PQJA 2VXZA 3U9GA 2P8TA 1ZGAA 1O3QA 4G6DA 3K2ZA 2QQBA 4L9TA 4H0EA 1FBQA 1XCVA 2YX4A 5EEHA 3M8FA 4HA8A 3V8LA 1P2FA 3K69A 3GFJA 3FXRA 2DPUA 3BJAA 3MEXA 3KCCA 2QBYB 4U0YA 4M6YA 2PQ8A 2RV8A 1XSXA 1T98A 4L0ZB 2F2EA 2XAHA 2FBKA 2A5YB 4XSZF 3HRTA 1TW2A 4QWQA 4E70A 4Q5SF 5DEQA 5EEGA 1O7FA 1G4DA 3VFZA 5D6FA 4JQFA 1KA8A 1W5SA 2ACJA 1QZYA 3KP4A 3SFZA 1ZAOA 1HSJA 1FYLA 4OIOF 4YG2F 2K27A 3R60A 1BC7C 2KJCA 1GVJA 1SFXA 4ENNA 4LB5A 3HHHA 3TDZC 3VODA 5ICGA 4HOBA 1B1BA 3I53A 3KLNA 4HBLA 5LEJA 5H6QA 1EH7A 3JSPA 2W25A 2HDCA 1CF7A 2JPBA 3ZP5A 1BI0A 2A07F 3KZZA 1WSUA 3DF8A 4PZJA 4OU0A 3V4GA 5KK1A 3E97A 3CTAA 1MD0A 5HS9A 3OV8A 2K02A 1T39A 6PAXA 1FZPB 3QOPA 4U7BA 1LNWA 2P5LC 1ZARA 5D4RA 4EV0A 2R7DA 3C18A 4KDPA 4EQQA 1BOAA 2IP2A 4HDVA 1RUOA 4LMYA 1YQAA 5LGTA 4Y13A 2KIMA 3PFIA 2K4JA 2R3SA 1QGPA 4XRFA 5HOOA 3QP5A 3G73A 1Z7UA 5A2QK 3WE2A 1XDUA 3IRRA 2A6HF 3HSRA 4U0WA 3KP2A 2RN7A 3V7CA 4WXHA 3P9IA 3ZMUA 3BPVA 2G7HA 2ZKZA 5E1ZB 1XD7A 3HHGA 5H20A 3WTWC 2PFBA 5J8CA 4KMFA 1ONVA 2CSOA 2RC4A 1MKMA 3F21A 4KA4A 3FXQA 1U3EM 2HYGD 4HX4A 1DDNA 2GQQA 1UFMA 3DQVC 5ILVA 4P9UA 4AIHA 3P7NA 3ECOA 1KU9A 5BPIA 5D5VB 5FB2A 3LWFA 1ON2A 5AONA 1CF7B 2B0LA 2FMYA 3ZPLA 3E5UA 5CJ9A 1R7JA 2YPRA 2MLKA 1TQPA 2XIGA 3EUHA 2AXLA 1O3SA 1HKQA 3F6VA 4BH9A 4M6XA 2XROA 3T0YA 1U5TA 5FFXA 3WG9A 2IA0A 3L7WA 1OYYA 3ELKA 4CGZA 1JGSA 2W57A 3FM3A 2M87A 2XKOA 2J5PA 2CGPA 2VN2A 3TGNA 2NS0A 3U1DA 2HTSA 1XN7A 2EFPA 4HLXA 1G3TA 4KMUX 2F5DA 3JSOA 1RNLA 4UHTA 2IVMA 4YIFA 4RAZA 1HXDA 1BI1A 2VE9A 4CZZA 5HDKA 2FBIA 4HZFA 3HRUA 4P96A 3GEZA 3EYIA 2KJBA 1W5TA 1Z6RA 3GZ5A 3E6CC 2QLZA 1V3FA 1STZA 1FY7A 2QVOA 2L4AA 1KQ9A 1ZHFA 4BHCA 2R7FA 2P4WA 2GA1A 4KIFA 1P4AA 1XSVA 4Q48A 2A69F 4G8XA 3BROA 1K7AA 3HTUA 1YW9A 3MWMA 1DPRA 3IKTA 3WTUC 1W4MA 1G6NA 1TQIA 4B09A 2IPQX 5IT3A 5L3DA 4WX9A 1ZLKA 1SMYF 3LA2A 2CFXA 5BPDA 5K5RA 1USSA 1B59A 4A2UA 4GCVA 3L2CA 2DBBA 3I71A 4FT8A 4N0BA 3LQRA 2EV5A 1ULYA 3V7RA 3WTYC 1FPQA 1ZREA 4WCGA 3ABTA 4WXDA 5JFRA 2VBWA 2FBHA 5HDGA 2ZO4A 2DU9A 2JT1A 3SZTA 1ZG5A 4ZYEA 1FX7A 5J8FA 2EV0A 4KNYA 1JXSA 3HOSA 2FNPA 4JK1X 5L3BA 3MQ0A 4IRIA 2W24A 1HW5A 4PGHA 1AOYA 1OYIA 3T8RA 4YFKF 1MDMA 3BPXA 1SD4A 3R0AA 4Q4ZF 4TV7A 3LSTA 3E3VA 2QQ9A 2P7CB 4OIQF 2HQRA 5D5XB 5F6FA 3BWGA 2EJRA 3RPQA 2PEXA 3FF5A 1XGSA 1T2KA 1IUYA 4A0ZA 3TOAA 5TRDA 4HF0A 1W7PD 4I2OA 2VC0A 2J5OA 1TTYA 4XBFA 4OINF 3RKWA 2LF8A 2X0LA 3BZ6A 3SQNA 1S29A 3DPLC 1FNNA 3I5UA 2GAUA 1J2XA 5D5UB 4ON0A 1YG2A 3BJOA 1X3UA 1OMIA 3EQLF 2VBYA 3LQQA 2HKOA 2DTRA 2MC3A 4ENKA 1BC8C 1R1VA 1I6XA 4M73A 4KT5C 1G3YA 1KYWA 2KKOA 3B73A 3WTXC 3RIRA 4NHJA 3F72A 1D8JA 1XGNA 2HYFA 2ZFWA 4EGYA 1YS6A 4M71A 4OMZA 1LEAA 3HTSB 5E20A 3TOBA 2NAZA 4I0AA 4ENMA 1IXSB 3O3KA 3VOEA 5DCFA 2Q8KA 4RGXA 3KE2A 3LFKA 3GZ6A 1MDMB 3WGHA 5FO5A 4G7OF 2IJLA 5IT9Z 2VE8A 1V4RA 3FHZA 3RYRA 3NRVA 1J0RA 2P6SA 3GO5A 5LHHA 2F5CA 3BDDA 4UVCA 4N9IA 1EH8A 1JE8A 2BE5F 4IHSA 4RB1A 4L5IA 3D0SA 1IRGA 5L3FA 1R1UA 1W7PA 2HR3A 4EM2A 2CYYA 3KZYA 3GYHX 2IA2A 4YIIA 2ISYA 1B4AA 1R5GA 4ESBA 2ESHA 2E7XA 5D8KB 4HX7A 5BOXA 2E1NA 1E2XA 1YIOA 4LLNA 1J75A 3GX4X 1RUNA 5CVIA 2V9VA 1FLIA 3GFLA 2A6EF 1XDSA 1T0FA 2Z5UA 4GYGA 3GFMA 1FSEA 3GFIA 3MFKA 1P6RA 1QPMA 4MTEA 3DFGA 1IN8A 4DNCA 3PQKA 5BQTA 3JTGA 1UCRA 5E1XA 1ZG1A 2DW4A 1R5HA 3MAJA 2DK8A 3DV8A 3J80Z 2UZKA 4IVNA 4RGRA 1B6AA 5JVTA 4OIRF 3GXOA 1KQ8A 1HKTA 1RIOH 5AIPA 1O3TA 2HKXA 2X4HA 3L00A 3WGIA 5KVRA 3F8NA 1P92A 2HTJA 1WRJA 3F3XA 3RYPA 3Q9SA 1U2WA 4AWXB 5FLXZ 3I58A 2XRNA 5CVRA 3KP5A 5TJJA 2WV0A 5FD6A 3V8JA 1W7PB 4PCQA 2COMA 1LEBA 5E8GA 4HW0A 4PGGA 2DFIA 2CG4A 3L9FA
chains in the Genus database with same CATH superfamily
3BG9A 3S93A 2AHQA 4XN0A 2RAEA 2W4SA 1HW1A 3BY6A 1HW2A 2F5EA 2NRAC 3KEOA 4A3LJ 1X1PA 4CO8A 2HQNA 3PSFA 4IPAA 4IL6C 3OIPA 2MYSA 1ON1A 2RVCA 2PBIA 4MO7A 5F64A 1K4TA 2V9PA 4F52A 2XGDA 2MA3A 1KGSA 3AL0C 3HGGA 1SD7A 4R8HA 3E5QA 3I64A 4QTRA 1GVDA 3MD2A 1LE8A 4CHUA 4AIKA 4LG0B 5CPRB 1GLNA 3AG4H 3BTCA 3FMSA 4G94A 1P7JA 2L7KA 5BNGA 4NBQA 2GIVA 2K9LA 3L2QA 3BQZA 3A01B 4DIQA 4XOTA 1IF1A 2QSGX 4OMYA 2E7WA 3K4CA 3FKJA 1TWHJ 5JR3A 4MQVA 4ZYDA 4BJ5C 3OWTA 5IPAA 3PIPF 2HVSA 2N8GA 2LF7A 4HPQA 3E6MA 2STWA 1R9TJ 2MBFA 3FBNB 3W6KB 4XL9A 1T08B 1Z1DA 1QRYA 1LDKB 2FOKA 2JTVA 4E6KG 3QODA 4ETSA 2F4MB 4FE7A 4LB6B 4CDGA 2XSDC 3DKWA 1TWFJ 1SEUA 1SFEA 3TP0A 2KIUA 4RGSA 1ZRCA 3K9TA 1R23A 4NB5A 1RR8C 2FF4A 3GVAA 2OAZA 2K5CA 5K1YA 1RZ4A 3HKZN 2QEXI 3RKQA 1G3SA 2QF7A 1UG0A 5HODA 3E5XA 1P9QC 4FQGA 1OLTA 2VPLA 1H88C 1ZRFA 2EH3A 3V7SA 3J81Z 3MZHA 4Q47A 2M4KA 2CV0A 2M0CA 4AC0A 4P9FA 3G3ZA 1TT5B 1XCBA 4KITB 1XC5A 2XAFA 1VTNC 1GT0C 4EGZA 2A61A 1XS9A 4X1EA 4XM3A 2WAQN 5LGNA 4LLLA 4LJZF 3AL0B 1F9NA 1X4PA 2HOTA 4CICA 2XGCA 4C9YA 1MJAA 2V9KA 3M8EA 4XIDA 1S3JA 3I54A 1USTA 5FLMJ 2VKVA 3GZNB 2MH9A 1JTXA 4XK4A 2HEOA 2E2IJ 3FM5A 3QPLA 3O8HA 4YELA 3OYNA 4ZTJA 2MSYA 1X1CA 1IV8A 2W1OA 2DYSH 2MLGA 1YHQI 2VC1A 2Y75A 3R0JA 5E17F 4NNJA 3UR3C 3K1PA 4PJMA 1A04A 1BN5A 3H3ZA 1KU2A 1I6HJ 1BM9A 3OYLA 2F4IA 4MEYF 2OU2A 3F9KA 3GUDA 3IWZA 1R1TA 4F93B 3AAFA 3LFUA 2QUFA 2O03A 2VIXA 4D7NA 1OISA 4ASNA 2AO9A 4IZZA 4OIPF 3ML6A 5EG0A 1OPCA 5E1WA 3WTSC 2IRFG 4M74A 3K0LA 5IT9K 4X0GA 2DTZA 3TO7A 3ZCOA 2DA3A 1IXRC 2CWEA 3J7ZI 1H9GA 2EZKA 2NS7A 4Y17A 5E8IA 3VSKA 4A3MJ 2VL8A 1I1SA 1FYKA 1NG6A 4HX8A 4IHTA 3BG3A 2XKPA 4RDUA 2V1UA 1TBXA 3HOXJ 2P0WA 1LJ9A 2QA4I 2EFWA 3F8BA 4I99C 1H0MA 4UB6C 2DPDA 2QQAA 2C6YA 2JA5J 2DCEA 1RETA 4Y52J 4I02A 4LITA 1NK3P 2STTA 3PJRA 5J40A 2M9HA 2EB7A 3QQAA 5L3GA 3CO7C 4W97A 3E6BA 2WTEA 3GCMA 2LK2A 1WVRA 4CCLA 5J3LA 2AS5F 3DTEA 1W1WE 2WY7Q 1A6QA 2RQPA 1TLHB 1MBKA 4UV9A 5ED4A 4LD5A 1FMVA 3OYEA 5L3CA 2PG4A 4WXCA 1IRFA 5D8LB 4W1UA 2CJJA 4N4OB 4IOAF 3PNYA 2O61A 1VQKI 2F5FA 1OCZH 3H0DA 1QHGA 2EK5A 2HZTA 2QSFX 3BR1A 3S3OA 4FX4A 4A5NA 1X58A 1YOVB 2XF5A 1MJBA 2WWYA 1IN6A 2XB5A 3ASNH 5FGMA 1I1GA 1T6SA 3ESWB 1YTYA 2D1VA 4JP0A 4BQAA 1O4XA 1R36A 1VQOI 3HSEA 2KZVA 2EPFA 3O6BB 3LSRA 1HCRA 4RS8A 2LKPA 3U21A 2H8RA 3FXOA 3JRIA 1EH6A 2R7VA 3SZPA 2BY3A 3HUGA 1VQ8I 2P5VA 5CLSA 3V8KA 2MD0A 2H8WA 4NC8A 4B44A 2A68F 3DEUA 2FU4A 1WKMA 2IBDA 5CVJA 3R4KA 2GOXB 3C3WA 1ACIA 4BNCA 2V6CA 2L2OA 2P5KA 3TW6A 3X2QH 4XKCA 2I8DA 3M7GA 4XLPF 2Y0MA 2CUFA 4UVAA 2Z3YA 4OAYA 3T5XA 2CRGA 3J80K 3G71I 1I5ZA 3SXYA 3QYBA 4ZH4F 4KN7X 1JHHA 5EG0B 1Z7LA 4LK0F 1YW8A 3QP6A 5DD4A 2DMPA 2LFBA 2R7ZJ 2W00A 3COAC 3KYCB 2V79A 1XGOA 1FBUA 3DLAA 4HYEA 3S16J 1HQCA 3ZN1A 3EDPA 4YFNF 3K4NA 1XTAA 2FQ3A 1LVKA 5HLHA 4A0XA 2BY1A 3FMQA 1TNTA 2MD5A 2TDXA 3CUOA 3HEFA 4FASD 3MKWB 2KZGA 1ZQ3P 2R7TA 1IZ1A 3IL2A 3OS0A 3I4NJ 2BEOA 4IF4A 1T38A 4U87A 2ZMEC 3H5RA 3RPUD 1EV7A 1PUEE 3WODF 2GIZA 3F0CA 3CC7I 4UV8A 5FLXK 5HDNA 2OJED 2WA0A 3HOZJ 3CF2A 1R00A 5DYMA 1WHUA 1UZCA 2GWRA 3CCEI 1F4KA 2K86A 1FTZA 2FJ1A 3DWLE 4MHGA 1F36A 1WJAA 3L09A 4L5EA 1MMSA 2WY8Q 2LVSA 2M34A 2M8GX 1OCCH 4KIGA 3CMEI 3A4CA 4O6JA 4U7DA 1Z77A 2OZ6A 2ZNZA 1B8IA 2DN0A 2VOOA 1ZKGA 1Z9CA 3LSGA 4Y15A 1K78A 4M9ZA 2Z2SB 4GGGA 2H6CA 5ILSA 2EWNA 4AUXA 4JBAA 3ZMTA 4QPQA 2DT6A 4XLCA 5LRRA 1YS7A 1F5TA 5LGUA 1V55H 3TMOA 3RTRA 3QPTA 2BHYA 2ETHA 3L2WA 3KP6A 1UG2A 3P9KA 1RPWA 2KIFA 3HSFA 5K5OA 3M07A 2XAJA 3I59A 1WQ2A 2ZCWA 4RGUA 2OPTA 4HV6A 4I0BA 5JI6A 3IH4A 4HEA2 1IN4A 4LOCA 2M5WA 5JLWA 3JW4A 2GLOA 2D2WA 5K7HA 1WJ5A 4EM1A 4A3JJ 3HUGB 3HOUJ 2X6XA 4NC6A 4IOCF 4EJVA 3K1MA 4BKXA 3NWSA 4HNUA 4KYWA 3BOQA 1R22A 2ZMEB 4MTDA 5M5WJ 3QPHA 1P4XA 2E34A 2O6GE 5DM7F 2JSCA 2V7FA 3WTTC 1U6GA 5DM6F 2JN6A 3JRDA 1XMAA 3RI4A 1GHCA 5CYVA 1S72I 1JJ6C 3DBLB 4RAFA 2G7UA 2KQRA 4Y3OA 5E18F 4KUMA 1DU0A 4G7HF 2K7LA 1GUUA 3C1DA 3EUAA 3FZVA 3KEQA 4BGDA 1E0EA 3FXUA 1NG7A 2XAQA 3SHFA 3FKIJ 4B1RA 1ZG3A 4Y7NJ 1YO5C 2WB1A 2EIKH 1YIJI 1OCRH 5F04A 2DDAA 4LLGF 3J81K 1V5FA 4HAMA 4PSXA 1QHHD 4RB0A 2M1BA 3CUQA 1S7OA 1TNSA 1MBGA 2UWMA 1P4WA 2HPMA 2EA2A 3N4MA 5CVUA 3EYYA 1A6IA 2P6TA 4BBSJ 2WAQA 4B8XA 5EYRA 5FKKA 1J5YA 4XRSG 3RPUA 2P7VB 4KFCA 1FBSA 3I9V2 3Q0WA 2Q2EA 1WJCA 4MFEA 1APLC 3D5LA 3CMAI 5E3LA 4IJAA 4ESFA 3H92A 1QO0D 3CO6C 3S3MA 1VQ5I 3GTKJ 1B8IB 4XQFA 4D9JA 4EJTA 3KIOA 2DOEA 4GO1A 4XONA 1YYVA 3GLXA 3RKXA 1QQIA 4IX7A 1K78B 5HS7A 4E7SA 2CV1A 1L3LA 3WU1B 4A3DJ 4CYDA 3VDXA 1JJ8C 3QOEA 4A5MA 5LHGA 2BV6A 2VPRA 4BQQA 3K70D 3CUQC 2MFZA 4I09A 4CYCA 1TQMA 1Z6TA 1QA6A 3I4PA 4HQEA 5LEKA 4S04A 3WU0A 2L4MA 2E1OA 1LKXA 2EV6A 1NHAA 3ABUA 5IP7J 4XLNF 2OCEA 2GZWA 1FC3A 4ENJA 1S8NA 2DLLA 2NXNB 1ZH5A 2COBA 3I59B 4M9SA 1N25A 5HS8A 2EFNA 4ZZLA 4BJTA 4R1HA 5L3EA 3J7AO 1X1DA 1S7AA 1BJAA 1IW7F 1SAXA 2VKHA 4OAZA 2EQRA 2QWWA 2NNYA 3IAM2 2M7AA 4IXAA 4U88A 4EVIA 3O8GA 2DYRH 5E79C 4FHTA 2LOOA 1FP2A 3IH3A 1MBFA 2BY2A 5J6XA 1ZYRF 4IRGA 3DU6A 3ZN0A 3GTLJ 4G6QA 5TISC 1OR7A 1Y39A 3DEWA 1JHFA 5ICCA 2ZNYA 4XRMA 2RNGA 1TWGJ 2UXXA 3ISPA 4XLAA 3ZMVA 1FYMA 4IQJA 1IDZA 1EKEA 1D3YA 2OZUA 3I0TA 3R6SA 5H6RA 4EMSA 2ZXJA 1BA5A 1D8KA 2HOAA 4Z2YA 4NUBA 4YFXF 2KMUA 5ICFA 3M3YJ 4BXUA 5FKOA 5ERIA 4U0VA 1BI3A 3DXJF 3CUQB 1J9IA 2QZ8A 4LG0A 4B4CA 1K4SA 2NOGA 1ZGJA 5DUIA 3ZQCA 3I3LA 2K9NA 4WWCA 1TW3A 2E35A 3BZKA 2CO5A 2O0YA 3A01A 3L2VA 4KICA 1W5CC 2KLOA 1YI2I 4BY1J 3BLYA 2L7MP 1OR7C 2UXNA 3S2HJ 2EBIA 2XASA 1LDJA 2Q2EB 1K6YA 3LSJA 2HI3A 4P5OA 5LRSA 2Y31A 4I98B 4DQ2A 1KYZA 5DCMA 2XAUA 3H36A 3LAPA 3JTHA 1RRJA 3GTGJ 4DBQA 1BIBA 4FISA 1LPQA 2HOSA 5FROA 1U9NA 2IGKA 3MKLA 2X9DA 3QWLA 3GMEA 4RAYA 2HS5A 3QU3A 2V1XA 4EJUA 3EETA 5DDGA 2HNHA 3LA7A 4KJZA 4MGRA 1VNDA 2FRHA 2CUJA 1H9TA 1ETXA 3GWZA 4CYCB 2E19A 1FOXA 3M1EA 2H94A 3OYGA 1DU6A 4A3FJ 2YR2A 3S8PA 5LBQA 3IWFA 2CS3A 2LTPA 5HLIA 1UB9A 2ZBKA 1Y1VJ 1IGNA 3QPSA 4N9HA 1LUJB 3LA3A 3NEUA 1QBJA 2H1KA 3JRBA 4KIBA 5DUKA 4ZDOA 2BGCA 2DT5A 4EJOA 2VUMJ 2DFHA 1HSTA 5GPCA 5IYDJ 4BQNA 1E3HA 2VQHA 2ME0A 1D0ZA 3HRSA 1FOKA 2XUBA 3KLOA 4PUSA 5DTDA 5FRNA 3Q5FA 4BS9A 2RREA 3ABKH 2O9LA 5ILUA 1XB4A 3C7JA 4L5JA 2XPVA 3CCYA 3A03A 2A05A 3BZCA 1KU3A 3H3UA 4ZTFA 2ZC2A 3KP3A 1O3RA 2V6EA 3CMYA 1Y56A 4GDFA 9ANTA 2A6TA 2ADUA 3RJPA 2K4BA 1QVUA 1ETOA 2WC2A 4EM0B 1KU7A 4MQ9F 2DFEA 2EA4A 3K70C 4PDKA 5F1RA 1HKSA 3ROUA 2OA4A 1WGXA 1UHMA 3OIQA 2PX9A 3U2RA 4LGWA 1XGMA 3H5NA 4FETA 3ZQQA 4O5VA 1VQPI 1DP7P 1LB2A 2HDWA 1GXPA 3S1NJ 1D5VA 5IP9J 2DI3A 1ZGWA 4ABZA 3FX3A 4BU2A 3LSPA 4G9YA 2E2JJ 2ISZA 3VPRA 1MGTA 2QGUA 3LL7A 2FOWA 2GXGA 2HFHA 3A2KA 5CKTA 2DDBA 4MFDA 1IV6A 3ECHA 1MJ9A 4F7ZA 1KQ0A 2M8EA 2OQRA 4C30A 2G0EA 2PI0A 2OD5A 2JRMA 3Q3SA 3PO3J 3DCFA 4CCOA 2IGOA 1JUPA 1R4MB 3ZMSA 2K40A 3W6JB 2BBYA 2PLYA 3K4JA 1ODDA 4HQMA 5DCMB 2MH2A 4S0HB 1U78A 3CDLA 2DMTA 4F3QA 1LFPA 4G6TB 2FEZA 1AA7A 5DV5A 4D0PA 1DUXC 2IT0A 3KP7A 1N77A 2D1HA 2NNNA 5IOYA 1SAUA 2HYJA 3HIFA 1SVMA 3CJRB 3BG5A 5FJ8J 2BYVE 2DQLA 1LFBA 3VB2A 4A3BJ 1WPKA 2FX0A 3VYTB 3ABLH 4PJLA 4XRSA 1DGRM 1YLFA 2WB1N 1NH3A 4IRHA 2L9VA 3NAUA 5EEAA 1Y0UA 3IKVA 4ZYGA 4AM3A 3D5RC 1RI7A 3P9CA 2EIJH 1VFCA 3QAHA 5LLQA 1IN5A 2OBPA 3F8FA 4HV5A 4IHWA 4PSWA 3CLOA 3G1OA 2FMLA 3BCAA 3RKYA 3CD6I 2BHZA 4I6ZA 2CV2A 4GFBA 3HOTA 3TKYA 2RKHA 2YSRA 5IYCJ 1HF0A 1FOWA 4IQ4A 4BUPA 4RLQA 2DAOA 3IC7A 1AU7A 3BTJA 1Z91A 1JKRC 3HB9A 4RBOA 1FSHA 1R71A 1PP8F 2AQEA 5EZHA 4E7JA 1XMKA 1R6RA 2XRLA 2ME6A 3WTZA 1BBYA 1WI9A 2DK5A 2JWTA 1JGGA 4XMYA 2BW3A 1VQ6I 1JKOC 1HBXG 1ENHA 2OF7A 3FK6A 2HGCA 2KRHA 1R58A 3BR0A 4ZZDA 4I7HA 1PVEA 1U8RA 3MCZA 1QZZA 4R79A 2XV4S 2WADA 4HF1A 1MNEA 1ZELA 2AXTC 1PUFA 1R4NB 3TL4X 2PJPA 3VYRB 1KONA 3WGGA 5EZGA 2FXAA 2CMPA 2DMUA 5K5QA 2QENA 3JAMK 3CCLI 1SD6A 4IHXA 3TO6A 2R7RA 4KN4X 4PJ0C 2EIMH 2BZTA 2XB0X 3G4SI 1K6OA 3TDUC 1OQYA 2IGNA 1CGPA 4A12A 3SFIA 3T1BA 3LSMA 1JKQC 2W84A 1BL0A 3K1NA 4A3GJ 5AIQA 2JRTA 1GV5A 1ZN2A 1WJBA 1Z0XA 4CH7A 1MBHA 5GAEJ 3QU6A 2XC7A 2FUG2 2V4JC 3S1MJ 4HNTA 3BR6A 3F22A 1QZEA 4E7HA 4L9VA 1SFUA 2CQQA 4II3A 3GTMJ 4LIVA 1ZRDA 1FWZA 2H09A 1DPUA 3DP7A 3S17J 1ZTRA 4S05A 1PP7U 5EDNA 3E7LA 1ZLJA 1REPC 1J09A 4Y33A 2H6BA 2LKXA 4HLYA 2K3FA 2VT3A 3KEYA 3H9QA 4HDUA 3EUHC 2XHKA 1JUMA 1ERDA 3HYIA 1TC3C 2DO7A 4BY7J 4JX4A 1U5TC 1BW6A 1VZ0A 4A6EA 5CQGA 5JHUA 4RA2A 3S1RJ 2HWVA 1J59A 4K2EA 3N97A 3BR2A 4CXFA 3FWEA 1S6LA 1LQ1A 4J01A 3NQOA 1BOBA 2EFQA 3WTVC 4RM2A 4NDLA 2LRDA 3HOYJ 3T8TA 1VQMI 3HXLA 4PJNA 4XLHA 2KRFA 3K4MA 4GYIA 1FIAA 2H1LA 5GTIC 1FP1D 4UUTA 3ZMDA 2HOEA 2JPCA 2D5VA 2OQGA 2TRTA 3CDHA 3IRQA 1PDNC 2VLAA 1I39A 2JSPA 2Z1DA 3DPTA 4BYYA 1PJRA 2BW3B 5ICEA 2HDDA 2L02A 2DFFA 1AKHA 2YU3A 1X2NA 1DGWY 3KFWX 4UB8C 3SDBA 2VBZA 5F08A 5LHIA 2LY1A 3ZRGA 5E3OA 2ZMEA 4MEXF 2IW5A 4I01A 3DBHB 2X1EA 4C3HJ 1T8IA 2MC4A 1BI2A 5FFZA 2FSWA 2GA2A 2RDPA 1BR1A 3BG6A 4HSRA 1PUFB 2JA8J 3TEDA 3CP8A 3A1YA 5BMZA 1OYWA 3VWBA 3OYAA 3S2WA 4QLCU 1B9MA 5BS6A 2VQLA 4XOPA 3PNTA 1O57A 3LSHA 3TQNA 2CU7A 4L9JA 2QSHX 1RKTA 3QYFA 1OKRA 3CJNA 1SMTA 2XSJC 1G3WA 1YITI 2Z33A 2DA4A 4GXOA 2O3FA 3WHCA 1U5TB 1TL8A 5D5WB 3I55I 4AYBN 5B5EC 3AFHA 3RSNA 4AD9A 2Q0OA 1BW5A 1GXQA 3JRGA 3H5AA 2DA2A 1QVTA 2Z16A 2RGVA 2VJ4A 5DD8A 5J4VA 1MNMC 2NYXA 4RM3A 1B9NA 3SDGA 5J1RA 1Z05A 4P55A 4EJWA 3OYHA 2M2EA 4IKFA 2WBMA 3IHUA 3CLQA 3R61A 3OYFA 2IA1A 1B72A 3K2AA 2LDUA 2F6CA 1IRXA 3BP8A 3ZQ7A 4O3MA 4AVZA 2RNJA 3RQ4A 1SD5A 1A5JA 2VODA 2LSOA 3OYDA 2KRCA 1K79A 5GTHC 1E17A 2XVCA 5JVGF 2XGXA 4BHPA 4ZC3A 2D45A 1D5YA 1NTCA 4D5CA 2DJNA 4ZYHA 2DXIA 1C0WA 1T56A 2L01A 2FE3A 1ETQA 1UELB 2FNAA 5CVVA 4WK8F 5EJCA 2DT7B 1TWCJ 5HNFA 3REOA 1JT0A 3KETA 4DJAA 4ESJA 3LAJA 2L54A 3MZ8A 4UVBA 2ELKA 2ELHA 3TW7A 1XSDA 5FKMA 1OCTC 2F48A 2ZB9A 3BR3A 3DTKA 1MZBA 2M30A 2JZYA 3F6OA 2CQNA 4A0YA 2GM4A 1M1EB 4B3AA 3WE3A 1VQ7I 3E6DA 1LVAA 3IAS2 3PSIA 2QM3A 2Z9OA 4BXFA 3F23A 3ERED 2K9QA 5LD2C 1BJZA 2DA5A 2KL4A 1AKHB 5K7ZA 2CW7A 3CC2I 4JOMA 3ERMA 3C2GA 2NVYJ 3CF5F 1UHWA 4C2TA 2M0MA 4C3IJ 2ZJQF 1MMNA 1MW7A 1OCOH 2I10A 5HVQC 1Z3XA 1IXCA 1HDDC 2PMHA 3M9AA 4UNOA 1L0OC 5A2QZ 3JREA 3HOWJ 4F91B 4HSTA 5F0CA 4NQWA 3QYEA 4LK1F 1LDDA 5M3FJ 4XSXF 2VB6A 3HRMA 3ULQB 3S15J 1JT6A 4II2A 1JTYA 2DQRA 1F1ZA 3LSKA 1YJWI 3CDIA 4BHBA 3ZMZA 1IAWA 3HL2A 4HF2A 2O8XA 5C44J 1UMQA 4AIJA 2HQ5A 2Z99A 2ZXWH 4UUVA 1K83J 1YW7A 2QYOA 2L9RA 3FXMA 1TZLA 2QKMB 2VT2A 3V42A 4RB2C 5M5YJ 1WZ2A 2E2HJ 4LFUA 2KT0A 1ZR2A 4AIDA 2VBXA 3B02A 2G9WA 3O2PE 1BIAA 2X6WA 3OOPA 4BACA 2W85A 1W36D 2PN6A 3MZYA 3F8MA 2Y48A 1S9HA 4FTHA 3VEPA 2NVXJ 5D6EA 2HPIA 1SANA 2LH9A 3KYLA 1B72B 4DBRA 2X1DA 4QSHA 1FT9A 2M3AA 3GF2A 4BAYA 3ZGKA 5HLGA 3Q0VA 1JI8A 2VOPA 1I3AA 3HZJA 2JA7J 3HPGA 2ID6A 3WG7H 2QQ8A 1RKWA 3ABMH 4OOIA 3GW2A 2QBYA 4MIMA 1QNTA 1D0XA 4M9XA 1WJFA 3TO9A 3OYMA 1O7LA 2JK3A 5FD5A 2CQKA 1FJLA 4MNUA 2V1DA 3MKYB 3F8CA 2PMZN 3K10A 2P81A 2A3SA 3C2BA 1HLVA 3JAMZ 2GXBA 1GV2A 2ZJRF 2ESNA 4J19A 2L3DA 2H27A 1J7KA 4L0YB 1YFHA 1I27A 2FA5A 1IO2A 2L5QA 1IN7A 3I4MJ 2VQGA 3RDIA 3TBIA 3TP3A 1WCMJ 4A6DA 1FIPA 2XAGA 3CCRI 3FMRA 2XGEA 1WJEA 4G7ZF 4XORA 2KISA 3QRFF 2ZJ2A 5D4SA 4FX0A 4L9NA 3GTOJ 2PMUA 2X51A 4RMNA 2PJRA 1X4OA 1VQLI 1WWXA 2R7UA 2JJ7A 1AWCA 2E1CA 2IS6A 1BR4A 2M45A 2YX7A 5H2FC 5TGTA 2E60A 1Q1HA 5HNHA 3Q9VA 4BL0B 2VONA 5IOZA 2EFOA 4ITVA 2W48A 3FDYA 1G2HA 2CW0F 3AG1H 1ETWA 4UXNA 4AVPA 3OL4A 4L18B 3BJ6A 4XKBA 2LNBA 3DTIA 4M72A 4BJ6C 5C4JJ 4NQWB 1Y0NA 1MBEA 4WF2A 1I3QJ 1QPIA 3ZR8X 4RB3C 2OUMA 3DKXA 2XPUA 3PQJA 4DYRA 3DU5A 3PNVA 2VXZA 3U9GA 5KAIC 2P8TA 5K7FA 1VQ9I 2R7SA 2R4GA 1ZGAA 1D1BA 1O3QA 4B43A 3WHBA 2R93J 1Q1VA 4G6DA 3K2ZA 2QQBA 2X85A 4L9TA 1U9OA 5CQEA 4H0EA 3CCMI 3HM5A 2W7NA 1FBQA 4IO9F 2GXAA 3WU2C 4UY8I 1XCVA 1HDPA 2YX4A 2F4OB 5EEHA 3M8FA 4HA8A 5FKLA 3SYTA 2XF6A 4DYQA 4CCKA 3CQZJ 3V8LA 4QIWN 1P2FA 2AQFA 3K69A 3GFJA 2Y30A 2LLKA 4XR6A 5EF6A 2ZJPF 3HG9A 2KFDA 4C3JJ 3OMYA 5HLTA 4A93J 3FBIB 2IGMA 3FXRA 3H9JA 3G1MA 2DPUA 3FISA 3OR1C 4JX5A 5GADJ 3BJAA 2Y9YA 3MEXA 3KCCA 2BY0A 3JRCA 3CCVI 2R7XA 2QBYB 3BR5A 4U0YA 4M6YA 2PQ8A 1RC9A 2RV8A 1XSXA 1T98A 4L0ZB 2F2EA 4BBRJ 4FE4A 1H8AC 2XAHA 2FBKA 3S3NA 2A5YB 4XSZF 1X1BA 2YS9A 1IDYA 3HRTA 1TW2A 2LBFB 3G6EI 3W2AA 1OJLA 1Z67A 4QWQA 4E70A 2ELJA 4Q5SF 5DEQA 1PYVA 1CQTA 3H0GJ 5EEGA 1O7FA 3PUBA 1G4DA 3VFZA 2XF7A 1W36C 5D6FA 5FKNA 4JQFA 1KA8A 1W5SA 2ACJA 2PJRB 1QZYA 3S2DJ 2DOAA 3VYUB 4IHVA 3KP4A 3SFZA 4DYCA 1ZAOA 2MABA 3OS2A 1HSJA 1Y8QB 4E7LA 4RLFA 1FYLA 4OIOF 3VYSB 4AYBA 4CSWA 4YG2F 2K27A 4C2UA 2DJIA 3R60A 1BC7C 2KJCA 1GVJA 1SFXA 4ENNA 4LB5A 3J7YJ 4CZCA 3HHHA 3PFYA 3TDZC 1WI3A 1X3WB 3VODA 5ICGA 4HOBA 1D1CA 3E0JB 5M3MJ 1B1BA 3AKZA 3I53A 3KLNA 4HBLA 2I5UA 5LEJA 5H6QA 1EH7A 2X6YA 2NVQJ 3JSPA 3ZQLA 1YX5A 3ASOH 2W25A 2HDCA 1CF7A 2JPBA 3ZP5A 1BI0A 2A07F 3LOCA 1WH5A 3KZZA 1WSUA 4PK4A 1E3OC 4ZYAA 4DZJA 2VJ5A 3DF8A 4LG3A 4M3FA 4OU0A 4PZJA 3CESA 3V4GA 5KK1A 3E97A 2E5ZA 4B48A 3CTAA 5E3MA 2Y2ZA 2V26A 2IS1A 2MGQA 2E5NA 4E4HA 1MD0A 3M4OJ 3D1NI 3HBLA 1MMDA 5HS9A 5F0HA 3OV8A 2K02A 2L9SA 1T39A 2QKLB 4BE1A 1WH7A 6PAXA 2EZLA 1FZPB 1SVOA 3QOPA 1LNWA 2VQCA 1ZARA 5IY5H 4U7BA 3PIOF 2P5LC 2ZSIB 1I50J 2KIQA 5D4RA 4EV0A 2R7DA 2Y0SN 3C18A 4KDPA 3BCBA 1A35A 3H9GA 4EQQA 1BOAA 2OV7A 2BOLA 2IP2A 4HDVA 2O7OA 1RUOA 4LMYA 1Y1WJ 2KHMA 1YQAA 3BC8A 5LGTA 4Y13A 1D0YA 2KIMA 3P5JA 3PFIA 2K4JA 3L1PA 2R3SA 1QGPA 2KPMA 2Y9ZA 4XRFA 3H3VK 4DZPA 5HOOA 5B1AH 1ITYA 3QP5A 2DMQA 3G73A 2B63J 5C4XJ 1Z7UA 1R5ID 5A2QK 3GTJJ 3WE2A 1XDUA 1ETVA 1RR7A 3IRRA 2A6HF 3HSRA 5B1BH 2L7FP 4U0WA 3KP2A 2RN7A 2Y69H 3V7CA 4WXHA 3P9IA 5E3NA 3ZMUA 2LY2A 3BPVA 2G7HA 2KDOA 2ZKZA 5E1ZB 5J4YA 1XD7A 3HHGA 3GTPJ 5H20A 3WTWC 2PFBA 5J8CA 3H1CA 5KNLA 3AG3H 4KMFA 3CZ6A 1ONVA 2CSOA 1GDTA 3ZOBA 3KZIC 5KHDA 2LREA 4Z6YA 3DEEA 2RC4A 3BT9A 1MKMA 3F21A 2R0QC 4KA4A 1FTTA 1U0JA 3FXQA 4PFOA 1U3EM 5JHFA 3IUOA 5DS9A 2HYGD 4HX4A 4JX6A 1DDNA 2GQQA 3IP4B 4G12A 1UFMA 1JUSA 2CUEA 3DQVC 5ILVA 2JA2A 4P9UA 4AIHA 1IRZA 3P7NA 2X6OA 4N4NB 3ECOA 4Y4RA 2JQ7A 1IJWC 1KU9A 5BPIA 4YIRX 2E71A 4PFPA 3Q0UA 3A02A 2CW8A 1VQ4I 2ECBA 5D5VB 5KCMA 4CA0A 5FB2A 3LWFA 2YUSA 4CUGA 2HXOA 1ON2A 5AONA 1SFOJ 1CF7B 2IS4A 1LFUP 2B0LA 3J7AY 3A0HC 1F43A 1VQNI 2FMYA 3ZPLA 2IS2A 3E5UA 2VKDA 3HOVJ 3ZXSA 3ZQGA 2VASA 1MSEC 5CJ9A 2QCOA 4D1QA 1R7JA 2PMZA 2MLKA 2K9SA 2YPRA 1TQPA 4GRIA 2XIGA 1X19A 3EUHA 3A0BC 2AXLA 2NOJB 1O3SA 5J47A 1HKQA 3F6VA 1UAAA 2GOMA 4BH9A 4M6XA 4D5FA 4UUSA 2XROA 3T0YA 1U5TA 3CJTB 5FFXA 3WG9A 2IA0A 1VF9A 3L7WA 5GP9A 5C3EJ 1OYYA 2JA6J 3ELKA 4CGZA 3E1SA 1JGSA 2W57A 1KZHA 3FM3A 3BTIA 1LE8B 2XPWA 2HXIA 4V2GA 2M87A 2XKOA 2J5PA 3VSLA 2CGPA 2VN2A 2F5VA 1W0UA 2K9MA 3TGNA 2RQQA 2LYCA 2NS0A 3U1DA 4NC7A 2HTSA 2K3PA 3RQIA 1ZR4A 1XN7A 2EFPA 4HLXA 1G3TA 4KMUX 2F5DA 3JSOA 1RNLA 4B47A 2LY9A 4XLFA 4UHTA 2IVMA 2WAEA 3PM1A 3M1CA 4YIFA 4XN3A 3K4LA 4RAZA 1TP4A 2FQ4A 5F27A 1HXDA 1JKPC 1BI1A 4V2FA 4A3KJ 2HU9A 2VE9A 4A69C 4CZZA 5HDKA 3B6CA 1WJDA 2FBIA 3PUFA 2LP0A 4HZFA 3SJMA 3HRUA 4P96A 1YX3A 3GEZA 3EYIA 3K6GA 3HDDA 2KJBA 4A3CJ 1E3PA 1W5TA 1Z6RA 1H89C 4QPOA 3GZ5A 3E6CC 2QLZA 1V3FA 1STZA 3ZQHA 1FY7A 3CCQI 4CCJA 1ETKA 2QVOA 2L4AA 1KQ9A 1ZHFA 4BHCA 3EUKL 2R7FA 2P4WA 3FK7A 2GA1A 1MIJA 4KIFA 1P4AA 4YRVA 1XSVA 1YJNI 5B66C 4Q48A 2A69F 2NVTJ 1MH3A 3OOUA 5J1UA 4G8XA 2MG4A 3UNGC 3BROA 2R5YA 1K7AA 5KAFC 3HTUA 3LNQA 1YW9A 2ICWG 4HNVA 3HC7A 3MWMA 1NK2P 1N75A 5B3SH 1W0TA 1DPRA 3IKTA 5GAHJ 3WTUC 4BE2A 1W4MA 2HQAA 1G6NA 3CJQB 1TQIA 4B09A 2IPQX 5IT3A 5L3DA 4WX9A 3FXKA 2ZXHA 2LKSA 1ZLKA 1SMYF 3LA2A 2CFXA 2UUZA 3MVPA 1VI0A 5BPDA 1IUFA 1EF4A 3CCUI 2X48A 1MH4A 4UUSB 3BTLA 3KX2A 5K5RA 1USSA 2VKEA 1B59A 1ZK8A 3B6AA 2L9NA 3MMYB 3JRFA 2BVMA 4A2UA 4GCVA 3L2CA 2DBBA 4D7MA 2BXZA 3I71A 1Y6IA 3I56I 3CMMA 3SZGA 3CC4I 3DKYA 4FT8A 4A3EJ 4N0BA 2FD5A 3HPHA 2EV5A 3LQRA 4AU7A 3DLLF 1ULYA 3V7RA 3WTYC 3OYKA 2M4GA 3ONQA 2HVQA 1RESA 1X1AA 1FPQA 1ZREA 1ORKA 3C2HA 4WCGA 3ABTA 3KYDB 1DQUA 4WXDA 5GAGJ 2E1MC 3D5SC 2VBWA 5JFRA 1XPXA 2FBHA 1SFKA 1X2MA 3OSGA 5HDGA 2ZO4A 3W2VA 2DU9A 2JT1A 3SZTA 1ZG5A 4ZYEA 2KP6A 1R49A 3CCSI 4FCYA 5EGOA 1FX7A 5J8FA 2EV0A 4KNYA 3IV5A 3S14J 1MNDA 2HZDA 1JXSA 4ZDPA 1V54H 3HOSA 2FNPA 2BVLA 4M3GA 5GPAA 4C2MJ 4JK1X 5L3BA 3FXJA 3MQ0A 4IRIA 2W24A 1OCPA 1HW5A 4PGHA 3OIOA 1AOYA 2R92J 1OYIA 4M3DA 3T8RA 4YFKF 4E7KA 3ZQFA 1MDMA 3BPXA 2LD5A 1SD4A 3R0AA 4Q4ZF 4TV7A 3LSTA 4PJJA 3HJEA 3E3VA 2QQ9A 1MSFC 3L2UA 2P7CB 4OIQF 3GTQJ 2HQRA 2EINH 3OYJA 4BE0A 1IG7A 5D5XB 5F6FA 1S7EA 3BWGA 4DW6A 2XDVA 2GBYA 1P7IA 4X6AJ 4BEHA 2R5ZA 2EJRA 3RPQA 2PEXA 3FF5A 1XGSA 2TCTA 1T2KA 1IUYA 1FEXA 2R5YB 4A0ZA 3TOAA 3FIWA 2VI6A 1U8BA 5FRMA 2Y0SA 3H35A 4XNFA 5TRDA 4HF0A 3PO2J 3SEZA 1W7PD 1T95A 2OC6A 4I2OA 3S1QJ 1T33A 2VC0A 2YU9J 1OFCX 2ZXIA 1DP3A 3OY9A 2LMDA 3RZOJ 2J5OA 3DPUA 1TTYA 4XBFA 4OINF 4DGWB 3JRAA 2R7WA 2L7ZA 1XG1A 2E1MB 3MN2A 3PL8A 3RKWA 1HOMA 2DODA 3EPZA 2LF8A 3OSFA 3JCUC 2X0LA 2O5RA 3BZ6A 3SQNA 3L2RA 1S29A 1UJ8A 3GBGA 1G59A 3DPLC 3G2BA 1A36A 1UHSA 4ZJZA 1FNNA 1IC8A 3I5UA 2GAUA 1FOYA 3DBRB 1J2XA 2IAIA 5D5UB 4ON0A 3IH2A 1YG2A 3BJOA 1X3UA 3G1LA 1OMIA 2ECCA 5JLXA 5J1YA 3EQLF 2VBYA 3LQQA 1Y8RB 2WV1A 2HKOA 3CP2A 3HKZA 2UV1A 2DTRA 2MC3A 4ENKA 1BC8C 2ZSHB 1R1VA 1SC7A 1I6XA 4M73A 3SEQA 1EA3A 4KT5C 1G3YA 4E7IA 1KYWA 2VXDA 2KKOA 4V19K 3B73A 1A31A 1K61A 1TT0A 3HGYA 2IEKA 3WTXC 3RIRA 4P1WA 3CCJI 4NHJA 4EATA 3F72A 1D8JA 2R7OA 1XGNA 3S32A 5EGOB 2O8KA 2HYFA 2ZFWA 4EGYA 2DOFA 1XX5A 4XICA 1YS6A 2LR8A 4M71A 4OMZA 2LBFA 1LEAA 3HTSB 5E20A 3TOBA 1S5LC 2ZFUA 2NAZA 4I76A 3JRHA 3RZDJ 4I0AA 4J00A 3OS1A 3NWTA 2EZIA 2X1CA 3OYBA 2LG4A 4ENMA 3LMMA 3KPHA 1IXSB 3O3KA 3VOEA 5DCFA 2Q8KA 1D1AA 5LFAA 4RGXA 3KE2A 3LFKA 4KT6A 2VJJA 3WGHA 3GZ6A 1MDMB 2R7QA 5FO5A 4F55A 1Z3YA 3NARA 4B3XA 3U1KA 4G7OF 2IJLA 5IT9Z 2VE8A 2DA7A 1V4RA 3FHZA 3RYRA 3NRVA 1J0RA 1MMGA 2P6SA 5F0FA 4BEHB 5M5XJ 2R5ZB 1YRNA 3GO5A 4CCNA 5LHHA 1ETYA 2F5CA 2ID3A 3BDDA 2A5WA 4UVCA 2E36A 2CQ7A 4N9IA 1EH8A 1JE8A 3BG7A 4OWRB 2BE5F 2BXYA 4IHSA 4RB1A 3MKZA 4ZDLA 2JVHA 3UKGA 4L5IA 3D0SA 2M7BA 2V1NA 1IRGA 2B7EA 5L3FA 1R1UA 2OCCH 1W7PA 2NS8A 2HR3A 4EM2A 2CYYA 3KZYA 4RAGA 4JYKA 2JUGA 3GYHX 2IA2A 5IP6A 1WFXA 4YIIA 2ISYA 1B4AA 2CUZA 1R5GA 4M3BA 4XKVA 1XMXA 2JVGA 4ESBA 2JMWA 4IHYA 2ESHA 2E7XA 2CH0A 2B9SA 5D8KB 1N78A 4HX7A 1EJ9A 1MBJA 5BOXA 2E1NA 1E2XA 1X3ZB 4HRIA 1QU3A 1YIOA 2Q1ZB 4LLNA 1J75A 3LSIA 3GX4X 1RUNA 5CVIA 2V9VA 1FLIA 2OTJI 1TWAJ 3GFLA 4HG2A 3W6VA 2A6EF 1XDSA 3OL3A 1AHDP 3W3CA 2DMNA 1T0FA 2Z5UA 4GYGA 3GFMA 1FSEA 3FXLA 3MFKA 3GFIA 1P6RA 1YJ9I 1QPMA 4MTEA 2MW8A 3DFGA 1IN8A 4DNCA 4XKWA 2KDZA 5FLVA 3PQKA 5BQTA 1G8XA 2W82A 4BQOA 3JTGA 3JR9A 3W2WA 1UCRA 5E1XA 1ZG1A 3K4BA 4ANJA 2DA1A 2DW4A 5IYBJ 1R5HA 1YE9A 3MAJA 2DK8A 1HA8A 1HC8A 4BDYA 1SVLA 3DV8A 3K4KA 3J80Z 1T0FC 3OR2C 2UZKA 4KISA 4IVNA 4RGRA 1B6AA 4M3EA 1BR2A 4A3IJ 3AG2H 2HVRA 3FHNA 5JVTA 2K85A 4OIRF 3GXOA 1MMAA 4MLOA 2OTLI 1KQ8A 4YEJA 3RCOA 2LC2A 5AIPA 4F92B 2NVUB 1Z21A 1RIOH 1HKTA 1O3TA 2HKXA 4XLEA 2IXSA 2X4HA 1YRNB 3L00A 3WGIA 2EILH 1V5EA 4BDZA 5KVRA 3F8NA 1P92A 2HTJA 2JUCA 1V5GA 1WRJA 3OYIA 4M6VA 3F3XA 3OYCA 3RYPA 3Q9SA 1U2WA 4AWXB 5FLXZ 3GLLA 2XRNA 3BQYA 3I58A 3N05A 5CVRA 3KP5A 2VJIA 5TJJA 2WV0A 5FD6A 3V8JA 1W7PB 4BXXJ 2EZHA 4EEFG 3K7AJ 4PCQA 2COMA 4H4KC 5F1JA 1FMWA 1LEBA 5E8GA 3ZQIA 4LIUA 4CCMA 2CQXA 4IEJA 3M8JA 4HW0A 2L0KA 4PGGA 2DFIA 1POGA 2CG4A 2CFOA 3L9FA 4E7ZA 2DA6A 2WAFA 4DOZA
chains in the Genus database with same CATH topology
1HW1A 3BY6A 1HW2A 2F5EA 2NRAC 3KEOA 4CO8A 2HQNA 4IPAA 1ON1A 2RVCA 2PBIA 5F64A 2MA3A 1KGSA 1SD7A 4R8HA 3E5QA 3I64A 4CHUA 4AIKA 4LG0B 3FMSA 4G94A 2GIVA 1IF1A 4OMYA 2E7WA 5JR3A 4MQVA 4ZYDA 2LF7A 3E6MA 2STWA 2MBFA 3W6KB 1Z1DA 2FOKA 2JTVA 1LDKB 4ETSA 4LB6B 4CDGA 3DKWA 1SFEA 2KIUA 4RGSA 1ZRCA 3K9TA 1R23A 4NB5A 2FF4A 3GVAA 2OAZA 5K1YA 1RZ4A 1G3SA 3E5XA 1ZRFA 3V7SA 3J81Z 3MZHA 4Q47A 4P9FA 3G3ZA 1XCBA 2XAFA 1VTNC 4EGZA 2A61A 5LGNA 4LLLA 4LJZF 1F9NA 4CICA 1MJAA 3M8EA 1S3JA 3I54A 1USTA 2MH9A 2HEOA 3FM5A 2MLGA 2VC1A 2Y75A 3R0JA 5E17F 3K1PA 1A04A 1BN5A 3H3ZA 1KU2A 1BM9A 4MEYF 2OU2A 3GUDA 3IWZA 1R1TA 3AAFA 2QUFA 2O03A 4ASNA 4OIPF 3ML6A 1OPCA 5E1WA 3WTSC 2IRFG 4M74A 3K0LA 5IT9K 3TO7A 1IXRC 2CWEA 1H9GA 4Y17A 5E8IA 1I1SA 1FYKA 4HX8A 4IHTA 2XKPA 2V1UA 1TBXA 1LJ9A 2EFWA 3F8BA 1H0MA 2DPDA 2QQAA 2C6YA 4I02A 2STTA 2EB7A 5L3GA 3CO7C 3E6BA 2WTEA 2AS5F 2RQPA 1TLHB 4UV9A 5ED4A 4LD5A 5L3CA 2PG4A 4WXCA 1IRFA 5D8LB 2O61A 2F5FA 2EK5A 2HZTA 4FX4A 4A5NA 1MJBA 2WWYA 1IN6A 5FGMA 1I1GA 1T6SA 1YTYA 2D1VA 4BQAA 1R36A 3HSEA 3O6BB 4RS8A 2LKPA 1EH6A 3SZPA 3HUGA 2P5VA 3V8KA 5CLSA 2A68F 3DEUA 2FU4A 1WKMA 5CVJA 3R4KA 3C3WA 4BNCA 2V6CA 2P5KA 3M7GA 4XLPF 2Y0MA 4UVAA 2Z3YA 3J80K 3T5XA 1I5ZA 3SXYA 4ZH4F 4KN7X 1JHHA 4LK0F 1YW8A 3QP6A 5DD4A 3COAC 1XGOA 1FBUA 2V79A 4HYEA 1HQCA 3ZN1A 3EDPA 4YFNF 2FQ3A 5HLHA 4A0XA 3FMQA 1TNTA 2MD5A 2TDXA 3CUOA 1IZ1A 3IL2A 2BEOA 4IF4A 1T38A 1EV7A 1PUEE 3WODF 4UV8A 5FLXK 5HDNA 1R00A 5DYMA 2GWRA 1F4KA 2K86A 4MHGA 3L09A 4KIGA 4O6JA 4U7DA 2OZ6A 2ZNZA 2VOOA 1Z9CA 4Y15A 1K78A 4M9ZA 4GGGA 2H6CA 5ILSA 2EWNA 4JBAA 3ZMTA 5LRRA 1YS7A 1F5TA 5LGUA 3RTRA 3QPTA 2ETHA 3KP6A 3P9KA 2KIFA 3HSFA 5K5OA 2XAJA 3I59A 1WQ2A 2ZCWA 4RGUA 4HV6A 4I0BA 5JI6A 1IN4A 2M5WA 3JW4A 2D2WA 4EM1A 4EJVA 3K1MA 4KYWA 3BOQA 1R22A 2ZMEB 4MTDA 2O6GE 3QPHA 1P4XA 2JSCA 3WTTC 1U6GA 1XMAA 3RI4A 1GHCA 5CYVA 2G7UA 5E18F 4KUMA 4G7HF 2K7LA 3C1DA 3FZVA 3KEQA 3FXUA 2XAQA 3SHFA 1ZG3A 1YO5C 4LLGF 3J81K 4HAMA 4RB0A 2M1BA 3CUQA 1S7OA 1TNSA 2UWMA 1P4WA 2EA2A 3N4MA 5CVUA 3EYYA 2P6TA 4B8XA 1J5YA 3RPUA 2P7VB 4KFCA 1FBSA 2Q2EA 3D5LA 4IJAA 4ESFA 3H92A 1QO0D 3CO6C 4EJTA 4GO1A 1YYVA 3GLXA 3RKXA 1QQIA 1K78B 5HS7A 1L3LA 3WU1B 4CYDA 4A5MA 5LHGA 2BV6A 3CUQC 4I09A 1TQMA 1Z6TA 3I4PA 4HQEA 5LEKA 4S04A 3WU0A 2L4MA 2EV6A 1NHAA 3ABUA 4XLNF 2GZWA 1FC3A 4ENJA 1S8NA 2DLLA 1ZH5A 3I59B 4M9SA 5HS8A 2EFNA 4ZZLA 4R1HA 5L3EA 3J7AO 1S7AA 1BJAA 1IW7F 1SAXA 2QWWA 2NNYA 4IXAA 4U88A 4EVIA 4FHTA 1FP2A 5J6XA 1ZYRF 4IRGA 3ZN0A 4G6QA 1OR7A 1JHFA 5ICCA 2ZNYA 2UXXA 3ISPA 3ZMVA 1FYMA 2OZUA 1D3YA 3I0TA 3R6SA 5H6RA 4EMSA 2ZXJA 1D8KA 4Z2YA 4YFXF 5ICFA 4BXUA 5ERIA 4U0VA 1BI3A 3DXJF 3CUQB 1J9IA 2QZ8A 4LG0A 1ZGJA 5DUIA 4WWCA 1TW3A 2CO5A 2O0YA 4KICA 2UXNA 2XASA 1LDJA 4P5OA 5LRSA 4I98B 4DQ2A 1KYZA 5DCMA 3LAPA 3JTHA 1BIBA 4RAYA 2HS5A 3QU3A 2V1XA 4EJUA 3EETA 5DDGA 3LA7A 4MGRA 2FRHA 1H9TA 3GWZA 3M1EA 2H94A 2YR2A 5LBQA 3IWFA 5HLIA 1UB9A 2ZBKA 4N9HA 3LA3A 3NEUA 1QBJA 4KIBA 5DUKA 2BGCA 2DT5A 4EJOA 1HSTA 3HRSA 1FOKA 2XUBA 3KLOA 3Q5FA 5ILUA 1XB4A 3C7JA 4L5JA 1KU3A 3H3UA 3KP3A 1O3RA 2ADUA 3RJPA 2K4BA 2WC2A 4EM0B 1KU7A 4MQ9F 2EA4A 4PDKA 5F1RA 1HKSA 3ROUA 2OA4A 1UHMA 3U2RA 4LGWA 1XGMA 4O5VA 1DP7P 1LB2A 1GXPA 1D5VA 2DI3A 3FX3A 4G9YA 2ISZA 1MGTA 2GXGA 2HFHA 3ECHA 1MJ9A 4F7ZA 1KQ0A 2M8EA 2OQRA 2PI0A 2OD5A 3ZMSA 3W6JB 2BBYA 2PLYA 1ODDA 4HQMA 5DCMB 2MH2A 1U78A 2FEZA 4D0PA 5DV5A 1DUXC 2IT0A 3KP7A 2D1HA 2NNNA 3HIFA 2BYVE 2DQLA 3VB2A 1YLFA 4IRHA 1Y0UA 3IKVA 4ZYGA 3P9CA 1RI7A 3QAHA 5LLQA 1IN5A 2OBPA 3F8FA 4HV5A 3CLOA 2FMLA 3RKYA 3HOTA 3TKYA 2RKHA 2YSRA 2DAOA 3IC7A 1Z91A 1FSHA 1PP8F 1XMKA 3WTZA 1BBYA 1WI9A 2DK5A 1HBXG 2HGCA 1R58A 1U8RA 4ZZDA 4I7HA 3MCZA 1QZZA 4R79A 2XV4S 4HF1A 2PJPA 3WGGA 2FXAA 5K5QA 2QENA 3JAMK 1SD6A 3TO6A 4KN4X 1K6OA 3TDUC 1CGPA 4A12A 3T1BA 2W84A 3K1NA 5AIQA 2JRTA 1ZN2A 3QU6A 3F22A 4L9VA 1SFUA 1ZRDA 1FWZA 2H09A 1DPUA 3DP7A 4S05A 1PP7U 1ZLJA 1REPC 2H6BA 2VT3A 4HDUA 2XHKA 3HYIA 2DO7A 1U5TC 4A6EA 5JHUA 2HWVA 1J59A 4K2EA 3N97A 4CXFA 3FWEA 1S6LA 1LQ1A 3NQOA 2EFQA 3WTVC 3T8TA 2KRFA 4GYIA 1FP1D 3ZMDA 2HOEA 2JPCA 2OQGA 3CDHA 3IRQA 1PDNC 3DPTA 4BYYA 5ICEA 2L02A 2YU3A 4HLYA 3KFWX 2VBZA 5LHIA 2ZMEA 4MEXF 2IW5A 4I01A 1BI2A 5FFZA 2FSWA 2GA2A 2RDPA 5BMZA 1OYWA 3S2WA 4QLCU 1B9MA 5BS6A 1O57A 3TQNA 4L9JA 1OKRA 3CJNA 1SMTA 1G3WA 2Z33A 4GXOA 2O3FA 1U5TB 5D5WB 4AD9A 2Q0OA 1GXQA 2RGVA 5DD8A 2NYXA 1B9NA 1Z05A 4P55A 4EJWA 3IHUA 3R61A 2IA1A 2LDUA 3BP8A 3ZQ7A 4O3MA 2RNJA 1SD5A 2VODA 2LSOA 1K79A 1E17A 2XVCA 2XGXA 4BHPA 2D45A 4ZYHA 1C0WA 2L01A 2FE3A 2FNAA 5CVVA 4WK8F 3REOA 3KETA 4ESJA 3LAJA 2L54A 4UVBA 2ELHA 1XSDA 1MZBA 2M30A 2JZYA 3F6OA 4A0YA 3WE3A 3E6DA 1LVAA 2QM3A 2Z9OA 3F23A 3ERED 1UHWA 5HVQC 1IXCA 2PMHA 3M9AA 4UNOA 1L0OC 5A2QZ 4NQWA 4LK1F 1LDDA 4XSXF 3HRMA 3ULQB 2DQRA 1F1ZA 4BHBA 3ZMZA 1IAWA 4HF2A 2O8XA 4AIJA 2Z99A 4UUVA 1YW7A 2QYOA 2VT2A 4RB2C 4LFUA 2VBXA 3B02A 2G9WA 3O2PE 1BIAA 3OOPA 2W85A 2PN6A 3MZYA 3F8MA 2Y48A 3VEPA 5D6EA 1FT9A 3GF2A 4BAYA 5HLGA 2VOPA 4OOIA 3GW2A 2QBYA 1QNTA 4M9XA 3TO9A 1O7LA 5FD5A 2CQKA 4MNUA 2V1DA 3F8CA 2A3SA 3JAMZ 2GXBA 2ESNA 2L3DA 2H27A 1J7KA 4L0YB 1YFHA 1I27A 2FA5A 1IN7A 3RDIA 4A6DA 2XAGA 3FMRA 4G7ZF 3QRFF 2ZJ2A 5D4SA 4FX0A 4L9NA 2PMUA 1WWXA 1AWCA 2E1CA 2M45A 2YX7A 1Q1HA 3Q9VA 2VONA 2EFOA 2CW0F 4UXNA 4AVPA 4L18B 3BJ6A 2LNBA 4M72A 4WF2A 4RB3C 3PQJA 2VXZA 3U9GA 2P8TA 1ZGAA 1O3QA 4G6DA 3K2ZA 2QQBA 4L9TA 4H0EA 1FBQA 1XCVA 2YX4A 5EEHA 3M8FA 4HA8A 3V8LA 1P2FA 3K69A 3GFJA 3FXRA 2DPUA 3BJAA 3MEXA 3KCCA 2QBYB 4U0YA 4M6YA 2PQ8A 2RV8A 1XSXA 1T98A 4L0ZB 2F2EA 2XAHA 2FBKA 2A5YB 4XSZF 3HRTA 1TW2A 4QWQA 4E70A 4Q5SF 5DEQA 5EEGA 1O7FA 1G4DA 3VFZA 5D6FA 4JQFA 1KA8A 1W5SA 2ACJA 1QZYA 3KP4A 3SFZA 1ZAOA 1HSJA 1FYLA 4OIOF 4YG2F 2K27A 3R60A 1BC7C 2KJCA 1GVJA 1SFXA 4ENNA 4LB5A 3HHHA 3TDZC 3VODA 5ICGA 4HOBA 1B1BA 3I53A 3KLNA 4HBLA 5LEJA 5H6QA 1EH7A 3JSPA 2W25A 2HDCA 1CF7A 2JPBA 3ZP5A 1BI0A 2A07F 3KZZA 1WSUA 3DF8A 4PZJA 4OU0A 3V4GA 5KK1A 3E97A 3CTAA 1MD0A 5HS9A 3OV8A 2K02A 1T39A 6PAXA 1FZPB 3QOPA 4U7BA 1LNWA 2P5LC 1ZARA 5D4RA 4EV0A 2R7DA 3C18A 4KDPA 4EQQA 1BOAA 2IP2A 4HDVA 1RUOA 4LMYA 1YQAA 5LGTA 4Y13A 2KIMA 3PFIA 2K4JA 2R3SA 1QGPA 4XRFA 5HOOA 3QP5A 3G73A 1Z7UA 5A2QK 3WE2A 1XDUA 3IRRA 2A6HF 3HSRA 4U0WA 3KP2A 2RN7A 3V7CA 4WXHA 3P9IA 3ZMUA 3BPVA 2G7HA 2ZKZA 5E1ZB 1XD7A 3HHGA 5H20A 3WTWC 2PFBA 5J8CA 4KMFA 1ONVA 2CSOA 2RC4A 1MKMA 3F21A 4KA4A 3FXQA 1U3EM 2HYGD 4HX4A 1DDNA 2GQQA 1UFMA 3DQVC 5ILVA 4P9UA 4AIHA 3P7NA 3ECOA 1KU9A 5BPIA 5D5VB 5FB2A 3LWFA 1ON2A 5AONA 1CF7B 2B0LA 2FMYA 3ZPLA 3E5UA 5CJ9A 1R7JA 2YPRA 2MLKA 1TQPA 2XIGA 3EUHA 2AXLA 1O3SA 1HKQA 3F6VA 4BH9A 4M6XA 2XROA 3T0YA 1U5TA 5FFXA 3WG9A 2IA0A 3L7WA 1OYYA 3ELKA 4CGZA 1JGSA 2W57A 3FM3A 2M87A 2XKOA 2J5PA 2CGPA 2VN2A 3TGNA 2NS0A 3U1DA 2HTSA 1XN7A 2EFPA 4HLXA 1G3TA 4KMUX 2F5DA 3JSOA 1RNLA 4UHTA 2IVMA 4YIFA 4RAZA 1HXDA 1BI1A 2VE9A 4CZZA 5HDKA 2FBIA 4HZFA 3HRUA 4P96A 3GEZA 3EYIA 2KJBA 1W5TA 1Z6RA 3GZ5A 3E6CC 2QLZA 1V3FA 1STZA 1FY7A 2QVOA 2L4AA 1KQ9A 1ZHFA 4BHCA 2R7FA 2P4WA 2GA1A 4KIFA 1P4AA 1XSVA 4Q48A 2A69F 4G8XA 3BROA 1K7AA 3HTUA 1YW9A 3MWMA 1DPRA 3IKTA 3WTUC 1W4MA 1G6NA 1TQIA 4B09A 2IPQX 5IT3A 5L3DA 4WX9A 1ZLKA 1SMYF 3LA2A 2CFXA 5BPDA 5K5RA 1USSA 1B59A 4A2UA 4GCVA 3L2CA 2DBBA 3I71A 4FT8A 4N0BA 3LQRA 2EV5A 1ULYA 3V7RA 3WTYC 1FPQA 1ZREA 4WCGA 3ABTA 4WXDA 5JFRA 2VBWA 2FBHA 5HDGA 2ZO4A 2DU9A 2JT1A 3SZTA 1ZG5A 4ZYEA 1FX7A 5J8FA 2EV0A 4KNYA 1JXSA 3HOSA 2FNPA 4JK1X 5L3BA 3MQ0A 4IRIA 2W24A 1HW5A 4PGHA 1AOYA 1OYIA 3T8RA 4YFKF 1MDMA 3BPXA 1SD4A 3R0AA 4Q4ZF 4TV7A 3LSTA 3E3VA 2QQ9A 2P7CB 4OIQF 2HQRA 5D5XB 5F6FA 3BWGA 2EJRA 3RPQA 2PEXA 3FF5A 1XGSA 1T2KA 1IUYA 4A0ZA 3TOAA 5TRDA 4HF0A 1W7PD 4I2OA 2VC0A 2J5OA 1TTYA 4XBFA 4OINF 3RKWA 2LF8A 2X0LA 3BZ6A 3SQNA 1S29A 3DPLC 1FNNA 3I5UA 2GAUA 1J2XA 5D5UB 4ON0A 1YG2A 3BJOA 1X3UA 1OMIA 3EQLF 2VBYA 3LQQA 2HKOA 2DTRA 2MC3A 4ENKA 1BC8C 1R1VA 1I6XA 4M73A 4KT5C 1G3YA 1KYWA 2KKOA 3B73A 3WTXC 3RIRA 4NHJA 3F72A 1D8JA 1XGNA 2HYFA 2ZFWA 4EGYA 1YS6A 4M71A 4OMZA 1LEAA 3HTSB 5E20A 3TOBA 2NAZA 4I0AA 4ENMA 1IXSB 3O3KA 3VOEA 5DCFA 2Q8KA 4RGXA 3KE2A 3LFKA 3GZ6A 1MDMB 3WGHA 5FO5A 4G7OF 2IJLA 5IT9Z 2VE8A 1V4RA 3FHZA 3RYRA 3NRVA 1J0RA 2P6SA 3GO5A 5LHHA 2F5CA 3BDDA 4UVCA 4N9IA 1EH8A 1JE8A 2BE5F 4IHSA 4RB1A 4L5IA 3D0SA 1IRGA 5L3FA 1R1UA 1W7PA 2HR3A 4EM2A 2CYYA 3KZYA 3GYHX 2IA2A 4YIIA 2ISYA 1B4AA 1R5GA 4ESBA 2ESHA 2E7XA 5D8KB 4HX7A 5BOXA 2E1NA 1E2XA 1YIOA 4LLNA 1J75A 3GX4X 1RUNA 5CVIA 2V9VA 1FLIA 3GFLA 2A6EF 1XDSA 1T0FA 2Z5UA 4GYGA 3GFMA 1FSEA 3GFIA 3MFKA 1P6RA 1QPMA 4MTEA 3DFGA 1IN8A 4DNCA 3PQKA 5BQTA 3JTGA 1UCRA 5E1XA 1ZG1A 2DW4A 1R5HA 3MAJA 2DK8A 3DV8A 3J80Z 2UZKA 4IVNA 4RGRA 1B6AA 5JVTA 4OIRF 3GXOA 1KQ8A 1HKTA 1RIOH 5AIPA 1O3TA 2HKXA 2X4HA 3L00A 3WGIA 5KVRA 3F8NA 1P92A 2HTJA 1WRJA 3F3XA 3RYPA 3Q9SA 1U2WA 4AWXB 5FLXZ 3I58A 2XRNA 5CVRA 3KP5A 5TJJA 2WV0A 5FD6A 3V8JA 1W7PB 4PCQA 2COMA 1LEBA 5E8GA 4HW0A 4PGGA 2DFIA 2CG4A 3L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW1 A;  3BY6 A;  1HW2 A;  2F5E A;  2NRA C;  3KEO A;  4CO8 A;  2HQN A;  4IPA A;  1ON1 A;  2RVC A;  2PBI A;  5F64 A;  2MA3 A;  1KGS A;  1SD7 A;  4R8H A;  3E5Q A;  3I64 A;  4CHU A;  4AIK A;  4LG0 B;  3FMS A;  4G94 A;  2GIV A;  1IF1 A;  4OMY A;  2E7W A;  5JR3 A;  4MQV A;  4ZYD A;  2LF7 A;  3E6M A;  2STW A;  2MBF A;  3W6K B;  1Z1D A;  2FOK A;  2JTV A;  1LDK B;  4ETS A;  4LB6 B;  4CDG A;  3DKW A;  1SFE A;  2KIU A;  4RGS A;  1ZRC A;  3K9T A;  1R23 A;  4NB5 A;  2FF4 A;  3GVA A;  2OAZ A;  5K1Y A;  1RZ4 A;  1G3S A;  3E5X A;  1ZRF A;  3V7S A;  3J81 Z;  3MZH A;  4Q47 A;  4P9F A;  3G3Z A;  1XCB A;  2XAF A;  1VTN C;  4EGZ A;  2A61 A;  5LGN A;  4LLL A;  4LJZ F;  1F9N A;  4CIC A;  1MJA A;  3M8E A;  1S3J A;  3I54 A;  1UST A;  2MH9 A;  2HEO A;  3FM5 A;  2MLG A;  2VC1 A;  2Y75 A;  3R0J A;  5E17 F;  3K1P A;  1A04 A;  1BN5 A;  3H3Z A;  1KU2 A;  1BM9 A;  4MEY F;  2OU2 A;  3GUD A;  3IWZ A;  1R1T A;  3AAF A;  2QUF A;  2O03 A;  4ASN A;  4OIP F;  3ML6 A;  1OPC A;  5E1W A;  3WTS C;  2IRF G;  4M74 A;  3K0L A;  5IT9 K;  3TO7 A;  1IXR C;  2CWE A;  1H9G A;  4Y17 A;  5E8I A;  1I1S A;  1FYK A;  4HX8 A;  4IHT A;  2XKP A;  2V1U A;  1TBX A;  1LJ9 A;  2EFW A;  3F8B A;  1H0M A;  2DPD A;  2QQA A;  2C6Y A;  4I02 A;  2STT A;  2EB7 A;  5L3G A;  3CO7 C;  3E6B A;  2WTE A;  2AS5 F;  2RQP A;  1TLH B;  4UV9 A;  5ED4 A;  4LD5 A;  5L3C A;  2PG4 A;  4WXC A;  1IRF A;  5D8L B;  2O61 A;  2F5F A;  2EK5 A;  2HZT A;  4FX4 A;  4A5N A;  1MJB A;  2WWY A;  1IN6 A;  5FGM A;  1I1G A;  1T6S A;  1YTY A;  2D1V A;  4BQA A;  1R36 A;  3HSE A;  3O6B B;  4RS8 A;  2LKP A;  1EH6 A;  3SZP A;  3HUG A;  2P5V A;  3V8K A;  5CLS A;  2A68 F;  3DEU A;  2FU4 A;  1WKM A;  5CVJ A;  3R4K A;  3C3W A;  4BNC A;  2V6C A;  2P5K A;  3M7G A;  4XLP F;  2Y0M A;  4UVA A;  2Z3Y A;  3J80 K;  3T5X A;  1I5Z A;  3SXY A;  4ZH4 F;  4KN7 X;  1JHH A;  4LK0 F;  1YW8 A;  3QP6 A;  5DD4 A;  3COA C;  1XGO A;  1FBU A;  2V79 A;  4HYE A;  1HQC A;  3ZN1 A;  3EDP A;  4YFN F;  2FQ3 A;  5HLH A;  4A0X A;  3FMQ A;  1TNT A;  2MD5 A;  2TDX A;  3CUO A;  1IZ1 A;  3IL2 A;  2BEO A;  4IF4 A;  1T38 A;  1EV7 A;  1PUE E;  3WOD F;  4UV8 A;  5FLX K;  5HDN A;  1R00 A;  5DYM A;  2GWR A;  1F4K A;  2K86 A;  4MHG A;  3L09 A;  4KIG A;  4O6J A;  4U7D A;  2OZ6 A;  2ZNZ A;  2VOO A;  1Z9C A;  4Y15 A;  1K78 A;  4M9Z A;  4GGG A;  2H6C A;  5ILS A;  2EWN A;  4JBA A;  3ZMT A;  5LRR A;  1YS7 A;  1F5T A;  5LGU A;  3RTR A;  3QPT A;  2ETH A;  3KP6 A;  3P9K A;  2KIF A;  3HSF A;  5K5O A;  2XAJ A;  3I59 A;  1WQ2 A;  2ZCW A;  4RGU A;  4HV6 A;  4I0B A;  5JI6 A;  1IN4 A;  2M5W A;  3JW4 A;  2D2W A;  4EM1 A;  4EJV A;  3K1M A;  4KYW A;  3BOQ A;  1R22 A;  2ZME B;  4MTD A;  2O6G E;  3QPH A;  1P4X A;  2JSC A;  3WTT C;  1U6G A;  1XMA A;  3RI4 A;  1GHC A;  5CYV A;  2G7U A;  5E18 F;  4KUM A;  4G7H F;  2K7L A;  3C1D A;  3FZV A;  3KEQ A;  3FXU A;  2XAQ A;  3SHF A;  1ZG3 A;  1YO5 C;  4LLG F;  3J81 K;  4HAM A;  4RB0 A;  2M1B A;  3CUQ A;  1S7O A;  1TNS A;  2UWM A;  1P4W A;  2EA2 A;  3N4M A;  5CVU A;  3EYY A;  2P6T A;  4B8X A;  1J5Y A;  3RPU A;  2P7V B;  4KFC A;  1FBS A;  2Q2E A;  3D5L A;  4IJA A;  4ESF A;  3H92 A;  1QO0 D;  3CO6 C;  4EJT A;  4GO1 A;  1YYV A;  3GLX A;  3RKX A;  1QQI A;  1K78 B;  5HS7 A;  1L3L A;  3WU1 B;  4CYD A;  4A5M A;  5LHG A;  2BV6 A;  3CUQ C;  4I09 A;  1TQM A;  1Z6T A;  3I4P A;  4HQE A;  5LEK A;  4S04 A;  3WU0 A;  2L4M A;  2EV6 A;  1NHA A;  3ABU A;  4XLN F;  2GZW A;  1FC3 A;  4ENJ A;  1S8N A;  2DLL A;  1ZH5 A;  3I59 B;  4M9S A;  5HS8 A;  2EFN A;  4ZZL A;  4R1H A;  5L3E A;  3J7A O;  1S7A A;  1BJA A;  1IW7 F;  1SAX A;  2QWW A;  2NNY A;  4IXA A;  4U88 A;  4EVI A;  4FHT A;  1FP2 A;  5J6X A;  1ZYR F;  4IRG A;  3ZN0 A;  4G6Q A;  1OR7 A;  1JHF A;  5ICC A;  2ZNY A;  2UXX A;  3ISP A;  3ZMV A;  1FYM A;  2OZU A;  1D3Y A;  3I0T A;  3R6S A;  5H6R A;  4EMS A;  2ZXJ A;  1D8K A;  4Z2Y A;  4YFX F;  5ICF A;  4BXU A;  5ERI A;  4U0V A;  1BI3 A;  3DXJ F;  3CUQ B;  1J9I A;  2QZ8 A;  4LG0 A;  1ZGJ A;  5DUI A;  4WWC A;  1TW3 A;  2CO5 A;  2O0Y A;  4KIC A;  2UXN A;  2XAS A;  1LDJ A;  4P5O A;  5LRS A;  4I98 B;  4DQ2 A;  1KYZ A;  5DCM A;  3LAP A;  3JTH A;  1BIB A;  4RAY A;  2HS5 A;  3QU3 A;  2V1X A;  4EJU A;  3EET A;  5DDG A;  3LA7 A;  4MGR A;  2FRH A;  1H9T A;  3GWZ A;  3M1E A;  2H94 A;  2YR2 A;  5LBQ A;  3IWF A;  5HLI A;  1UB9 A;  2ZBK A;  4N9H A;  3LA3 A;  3NEU A;  1QBJ A;  4KIB A;  5DUK A;  2BGC A;  2DT5 A;  4EJO A;  1HST A;  3HRS A;  1FOK A;  2XUB A;  3KLO A;  3Q5F A;  5ILU A;  1XB4 A;  3C7J A;  4L5J A;  1KU3 A;  3H3U A;  3KP3 A;  1O3R A;  2ADU A;  3RJP A;  2K4B A;  2WC2 A;  4EM0 B;  1KU7 A;  4MQ9 F;  2EA4 A;  4PDK A;  5F1R A;  1HKS A;  3ROU A;  2OA4 A;  1UHM A;  3U2R A;  4LGW A;  1XGM A;  4O5V A;  1DP7 P;  1LB2 A;  1GXP A;  1D5V A;  2DI3 A;  3FX3 A;  4G9Y A;  2ISZ A;  1MGT A;  2GXG A;  2HFH A;  3ECH A;  1MJ9 A;  4F7Z A;  1KQ0 A;  2M8E A;  2OQR A;  2PI0 A;  2OD5 A;  3ZMS A;  3W6J B;  2BBY A;  2PLY A;  1ODD A;  4HQM A;  5DCM B;  2MH2 A;  1U78 A;  2FEZ A;  4D0P A;  5DV5 A;  1DUX C;  2IT0 A;  3KP7 A;  2D1H A;  2NNN A;  3HIF A;  2BYV E;  2DQL A;  3VB2 A;  1YLF A;  4IRH A;  1Y0U A;  3IKV A;  4ZYG A;  3P9C A;  1RI7 A;  3QAH A;  5LLQ A;  1IN5 A;  2OBP A;  3F8F A;  4HV5 A;  3CLO A;  2FML A;  3RKY A;  3HOT A;  3TKY A;  2RKH A;  2YSR A;  2DAO A;  3IC7 A;  1Z91 A;  1FSH A;  1PP8 F;  1XMK A;  3WTZ A;  1BBY A;  1WI9 A;  2DK5 A;  1HBX G;  2HGC A;  1R58 A;  1U8R A;  4ZZD A;  4I7H A;  3MCZ A;  1QZZ A;  4R79 A;  2XV4 S;  4HF1 A;  2PJP A;  3WGG A;  2FXA A;  5K5Q A;  2QEN A;  3JAM K;  1SD6 A;  3TO6 A;  4KN4 X;  1K6O A;  3TDU C;  1CGP A;  4A12 A;  3T1B A;  2W84 A;  3K1N A;  5AIQ A;  2JRT A;  1ZN2 A;  3QU6 A;  3F22 A;  4L9V A;  1SFU A;  1ZRD A;  1FWZ A;  2H09 A;  1DPU A;  3DP7 A;  4S05 A;  1PP7 U;  1ZLJ A;  1REP C;  2H6B A;  2VT3 A;  4HDU A;  2XHK A;  3HYI A;  2DO7 A;  1U5T C;  4A6E A;  5JHU A;  2HWV A;  1J59 A;  4K2E A;  3N97 A;  4CXF A;  3FWE A;  1S6L A;  1LQ1 A;  3NQO A;  2EFQ A;  3WTV C;  3T8T A;  2KRF A;  4GYI A;  1FP1 D;  3ZMD A;  2HOE A;  2JPC A;  2OQG A;  3CDH A;  3IRQ A;  1PDN C;  3DPT A;  4BYY A;  5ICE A;  2L02 A;  2YU3 A;  4HLY A;  3KFW X;  2VBZ A;  5LHI A;  2ZME A;  4MEX F;  2IW5 A;  4I01 A;  1BI2 A;  5FFZ A;  2FSW A;  2GA2 A;  2RDP A;  5BMZ A;  1OYW A;  3S2W A;  4QLC U;  1B9M A;  5BS6 A;  1O57 A;  3TQN A;  4L9J A;  1OKR A;  3CJN A;  1SMT A;  1G3W A;  2Z33 A;  4GXO A;  2O3F A;  1U5T B;  5D5W B;  4AD9 A;  2Q0O A;  1GXQ A;  2RGV A;  5DD8 A;  2NYX A;  1B9N A;  1Z05 A;  4P55 A;  4EJW A;  3IHU A;  3R61 A;  2IA1 A;  2LDU A;  3BP8 A;  3ZQ7 A;  4O3M A;  2RNJ A;  1SD5 A;  2VOD A;  2LSO A;  1K79 A;  1E17 A;  2XVC A;  2XGX A;  4BHP A;  2D45 A;  4ZYH A;  1C0W A;  2L01 A;  2FE3 A;  2FNA A;  5CVV A;  4WK8 F;  3REO A;  3KET A;  4ESJ A;  3LAJ A;  2L54 A;  4UVB A;  2ELH A;  1XSD A;  1MZB A;  2M30 A;  2JZY A;  3F6O A;  4A0Y A;  3WE3 A;  3E6D A;  1LVA A;  2QM3 A;  2Z9O A;  3F23 A;  3ERE D;  1UHW A;  5HVQ C;  1IXC A;  2PMH A;  3M9A A;  4UNO A;  1L0O C;  5A2Q Z;  4NQW A;  4LK1 F;  1LDD A;  4XSX F;  3HRM A;  3ULQ B;  2DQR A;  1F1Z A;  4BHB A;  3ZMZ A;  1IAW A;  4HF2 A;  2O8X A;  4AIJ A;  2Z99 A;  4UUV A;  1YW7 A;  2QYO A;  2VT2 A;  4RB2 C;  4LFU A;  2VBX A;  3B02 A;  2G9W A;  3O2P E;  1BIA A;  3OOP A;  2W85 A;  2PN6 A;  3MZY A;  3F8M A;  2Y48 A;  3VEP A;  5D6E A;  1FT9 A;  3GF2 A;  4BAY A;  5HLG A;  2VOP A;  4OOI A;  3GW2 A;  2QBY A;  1QNT A;  4M9X A;  3TO9 A;  1O7L A;  5FD5 A;  2CQK A;  4MNU A;  2V1D A;  3F8C A;  2A3S A;  3JAM Z;  2GXB A;  2ESN A;  2L3D A;  2H27 A;  1J7K A;  4L0Y B;  1YFH A;  1I27 A;  2FA5 A;  1IN7 A;  3RDI A;  4A6D A;  2XAG A;  3FMR A;  4G7Z F;  3QRF F;  2ZJ2 A;  5D4S A;  4FX0 A;  4L9N A;  2PMU A;  1WWX A;  1AWC A;  2E1C A;  2M45 A;  2YX7 A;  1Q1H A;  3Q9V A;  2VON A;  2EFO A;  2CW0 F;  4UXN A;  4AVP A;  4L18 B;  3BJ6 A;  2LNB A;  4M72 A;  4WF2 A;  4RB3 C;  3PQJ A;  2VXZ A;  3U9G A;  2P8T A;  1ZGA A;  1O3Q A;  4G6D A;  3K2Z A;  2QQB A;  4L9T A;  4H0E A;  1FBQ A;  1XCV A;  2YX4 A;  5EEH A;  3M8F A;  4HA8 A;  3V8L A;  1P2F A;  3K69 A;  3GFJ A;  3FXR A;  2DPU A;  3BJA A;  3MEX A;  3KCC A;  2QBY B;  4U0Y A;  4M6Y A;  2PQ8 A;  2RV8 A;  1XSX A;  1T98 A;  4L0Z B;  2F2E A;  2XAH A;  2FBK A;  2A5Y B;  4XSZ F;  3HRT A;  1TW2 A;  4QWQ A;  4E70 A;  4Q5S F;  5DEQ A;  5EEG A;  1O7F A;  1G4D A;  3VFZ A;  5D6F A;  4JQF A;  1KA8 A;  1W5S A;  2ACJ A;  1QZY A;  3KP4 A;  3SFZ A;  1ZAO A;  1HSJ A;  1FYL A;  4OIO F;  4YG2 F;  2K27 A;  3R60 A;  1BC7 C;  2KJC A;  1GVJ A;  1SFX A;  4ENN A;  4LB5 A;  3HHH A;  3TDZ C;  3VOD A;  5ICG A;  4HOB A;  1B1B A;  3I53 A;  3KLN A;  4HBL A;  5LEJ A;  5H6Q A;  1EH7 A;  3JSP A;  2W25 A;  2HDC A;  1CF7 A;  2JPB A;  3ZP5 A;  1BI0 A;  2A07 F;  3KZZ A;  1WSU A;  3DF8 A;  4PZJ A;  4OU0 A;  3V4G A;  5KK1 A;  3E97 A;  3CTA A;  1MD0 A;  5HS9 A;  3OV8 A;  2K02 A;  1T39 A;  6PAX A;  1FZP B;  3QOP A;  4U7B A;  1LNW A;  2P5L C;  1ZAR A;  5D4R A;  4EV0 A;  2R7D A;  3C18 A;  4KDP A;  4EQQ A;  1BOA A;  2IP2 A;  4HDV A;  1RUO A;  4LMY A;  1YQA A;  5LGT A;  4Y13 A;  2KIM A;  3PFI A;  2K4J A;  2R3S A;  1QGP A;  4XRF A;  5HOO A;  3QP5 A;  3G73 A;  1Z7U A;  5A2Q K;  3WE2 A;  1XDU A;  3IRR A;  2A6H F;  3HSR A;  4U0W A;  3KP2 A;  2RN7 A;  3V7C A;  4WXH A;  3P9I A;  3ZMU A;  3BPV A;  2G7H A;  2ZKZ A;  5E1Z B;  1XD7 A;  3HHG A;  5H20 A;  3WTW C;  2PFB A;  5J8C A;  4KMF A;  1ONV A;  2CSO A;  2RC4 A;  1MKM A;  3F21 A;  4KA4 A;  3FXQ A;  1U3E M;  2HYG D;  4HX4 A;  1DDN A;  2GQQ A;  1UFM A;  3DQV C;  5ILV A;  4P9U A;  4AIH A;  3P7N A;  3ECO A;  1KU9 A;  5BPI A;  5D5V B;  5FB2 A;  3LWF A;  1ON2 A;  5AON A;  1CF7 B;  2B0L A;  2FMY A;  3ZPL A;  3E5U A;  5CJ9 A;  1R7J A;  2YPR A;  2MLK A;  1TQP A;  2XIG A;  3EUH A;  2AXL A;  1O3S A;  1HKQ A;  3F6V A;  4BH9 A;  4M6X A;  2XRO A;  3T0Y A;  1U5T A;  5FFX A;  3WG9 A;  2IA0 A;  3L7W A;  1OYY A;  3ELK A;  4CGZ A;  1JGS A;  2W57 A;  3FM3 A;  2M87 A;  2XKO A;  2J5P A;  2CGP A;  2VN2 A;  3TGN A;  2NS0 A;  3U1D A;  2HTS A;  1XN7 A;  2EFP A;  4HLX A;  1G3T A;  4KMU X;  2F5D A;  3JSO A;  1RNL A;  4UHT A;  2IVM A;  4YIF A;  4RAZ A;  1HXD A;  1BI1 A;  2VE9 A;  4CZZ A;  5HDK A;  2FBI A;  4HZF A;  3HRU A;  4P96 A;  3GEZ A;  3EYI A;  2KJB A;  1W5T A;  1Z6R A;  3GZ5 A;  3E6C C;  2QLZ A;  1V3F A;  1STZ A;  1FY7 A;  2QVO A;  2L4A A;  1KQ9 A;  1ZHF A;  4BHC A;  2R7F A;  2P4W A;  2GA1 A;  4KIF A;  1P4A A;  1XSV A;  4Q48 A;  2A69 F;  4G8X A;  3BRO A;  1K7A A;  3HTU A;  1YW9 A;  3MWM A;  1DPR A;  3IKT A;  3WTU C;  1W4M A;  1G6N A;  1TQI A;  4B09 A;  2IPQ X;  5IT3 A;  5L3D A;  4WX9 A;  1ZLK A;  1SMY F;  3LA2 A;  2CFX A;  5BPD A;  5K5R A;  1USS A;  1B59 A;  4A2U A;  4GCV A;  3L2C A;  2DBB A;  3I71 A;  4FT8 A;  4N0B A;  3LQR A;  2EV5 A;  1ULY A;  3V7R A;  3WTY C;  1FPQ A;  1ZRE A;  4WCG A;  3ABT A;  4WXD A;  5JFR A;  2VBW A;  2FBH A;  5HDG A;  2ZO4 A;  2DU9 A;  2JT1 A;  3SZT A;  1ZG5 A;  4ZYE A;  1FX7 A;  5J8F A;  2EV0 A;  4KNY A;  1JXS A;  3HOS A;  2FNP A;  4JK1 X;  5L3B A;  3MQ0 A;  4IRI A;  2W24 A;  1HW5 A;  4PGH A;  1AOY A;  1OYI A;  3T8R A;  4YFK F;  1MDM A;  3BPX A;  1SD4 A;  3R0A A;  4Q4Z F;  4TV7 A;  3LST A;  3E3V A;  2QQ9 A;  2P7C B;  4OIQ F;  2HQR A;  5D5X B;  5F6F A;  3BWG A;  2EJR A;  3RPQ A;  2PEX A;  3FF5 A;  1XGS A;  1T2K A;  1IUY A;  4A0Z A;  3TOA A;  5TRD A;  4HF0 A;  1W7P D;  4I2O A;  2VC0 A;  2J5O A;  1TTY A;  4XBF A;  4OIN F;  3RKW A;  2LF8 A;  2X0L A;  3BZ6 A;  3SQN A;  1S29 A;  3DPL C;  1FNN A;  3I5U A;  2GAU A;  1J2X A;  5D5U B;  4ON0 A;  1YG2 A;  3BJO A;  1X3U A;  1OMI A;  3EQL F;  2VBY A;  3LQQ A;  2HKO A;  2DTR A;  2MC3 A;  4ENK A;  1BC8 C;  1R1V A;  1I6X A;  4M73 A;  4KT5 C;  1G3Y A;  1KYW A;  2KKO A;  3B73 A;  3WTX C;  3RIR A;  4NHJ A;  3F72 A;  1D8J A;  1XGN A;  2HYF A;  2ZFW A;  4EGY A;  1YS6 A;  4M71 A;  4OMZ A;  1LEA A;  3HTS B;  5E20 A;  3TOB A;  2NAZ A;  4I0A A;  4ENM A;  1IXS B;  3O3K A;  3VOE A;  5DCF A;  2Q8K A;  4RGX A;  3KE2 A;  3LFK A;  3GZ6 A;  1MDM B;  3WGH A;  5FO5 A;  4G7O F;  2IJL A;  5IT9 Z;  2VE8 A;  1V4R A;  3FHZ A;  3RYR A;  3NRV A;  1J0R A;  2P6S A;  3GO5 A;  5LHH A;  2F5C A;  3BDD A;  4UVC A;  4N9I A;  1EH8 A;  1JE8 A;  2BE5 F;  4IHS A;  4RB1 A;  4L5I A;  3D0S A;  1IRG A;  5L3F A;  1R1U A;  1W7P A;  2HR3 A;  4EM2 A;  2CYY A;  3KZY A;  3GYH X;  2IA2 A;  4YII A;  2ISY A;  1B4A A;  1R5G A;  4ESB A;  2ESH A;  2E7X A;  5D8K B;  4HX7 A;  5BOX A;  2E1N A;  1E2X A;  1YIO A;  4LLN A;  1J75 A;  3GX4 X;  1RUN A;  5CVI A;  2V9V A;  1FLI A;  3GFL A;  2A6E F;  1XDS A;  1T0F A;  2Z5U A;  4GYG A;  3GFM A;  1FSE A;  3GFI A;  3MFK A;  1P6R A;  1QPM A;  4MTE A;  3DFG A;  1IN8 A;  4DNC A;  3PQK A;  5BQT A;  3JTG A;  1UCR A;  5E1X A;  1ZG1 A;  2DW4 A;  1R5H A;  3MAJ A;  2DK8 A;  3DV8 A;  3J80 Z;  2UZK A;  4IVN A;  4RGR A;  1B6A A;  5JVT A;  4OIR F;  3GXO A;  1KQ8 A;  1HKT A;  1RIO H;  5AIP A;  1O3T A;  2HKX A;  2X4H A;  3L00 A;  3WGI A;  5KVR A;  3F8N A;  1P92 A;  2HTJ A;  1WRJ A;  3F3X A;  3RYP A;  3Q9S A;  1U2W A;  4AWX B;  5FLX Z;  3I58 A;  2XRN A;  5CVR A;  3KP5 A;  5TJJ A;  2WV0 A;  5FD6 A;  3V8J A;  1W7P B;  4PCQ A;  2COM A;  1LEB A;  5E8G A;  4HW0 A;  4PGG A;  2DFI A;  2CG4 A;  3L9F A; 
#chains in the Genus database with same CATH topology
 3BG9 A;  3S93 A;  2AHQ A;  4XN0 A;  2RAE A;  2W4S A;  1HW1 A;  3BY6 A;  1HW2 A;  2F5E A;  2NRA C;  3KEO A;  4A3L J;  1X1P A;  4CO8 A;  2HQN A;  3PSF A;  4IPA A;  4IL6 C;  3OIP A;  2MYS A;  1ON1 A;  2RVC A;  2PBI A;  4MO7 A;  5F64 A;  1K4T A;  2V9P A;  4F52 A;  2XGD A;  2MA3 A;  1KGS A;  3AL0 C;  3HGG A;  1SD7 A;  4R8H A;  3E5Q A;  3I64 A;  4QTR A;  1GVD A;  3MD2 A;  1LE8 A;  4CHU A;  4AIK A;  4LG0 B;  5CPR B;  1GLN A;  3AG4 H;  3BTC A;  3FMS A;  4G94 A;  1P7J A;  2L7K A;  5BNG A;  4NBQ A;  2GIV A;  2K9L A;  3L2Q A;  3BQZ A;  3A01 B;  4DIQ A;  4XOT A;  1IF1 A;  2QSG X;  4OMY A;  2E7W A;  3K4C A;  3FKJ A;  1TWH J;  5JR3 A;  4MQV A;  4ZYD A;  4BJ5 C;  3OWT A;  5IPA A;  3PIP F;  2HVS A;  2N8G A;  2LF7 A;  4HPQ A;  3E6M A;  2STW A;  1R9T J;  2MBF A;  3FBN B;  3W6K B;  4XL9 A;  1T08 B;  1Z1D A;  1QRY A;  1LDK B;  2FOK A;  2JTV A;  4E6K G;  3QOD A;  4ETS A;  2F4M B;  4FE7 A;  4LB6 B;  4CDG A;  2XSD C;  3DKW A;  1TWF J;  1SEU A;  1SFE A;  3TP0 A;  2KIU A;  4RGS A;  1ZRC A;  3K9T A;  1R23 A;  4NB5 A;  1RR8 C;  2FF4 A;  3GVA A;  2OAZ A;  2K5C A;  5K1Y A;  1RZ4 A;  3HKZ N;  2QEX I;  3RKQ A;  1G3S A;  2QF7 A;  1UG0 A;  5HOD A;  3E5X A;  1P9Q C;  4FQG A;  1OLT A;  2VPL A;  1H88 C;  1ZRF A;  2EH3 A;  3V7S A;  3J81 Z;  3MZH A;  4Q47 A;  2M4K A;  2CV0 A;  2M0C A;  4AC0 A;  4P9F A;  3G3Z A;  1TT5 B;  1XCB A;  4KIT B;  1XC5 A;  2XAF A;  1VTN C;  1GT0 C;  4EGZ A;  2A61 A;  1XS9 A;  4X1E A;  4XM3 A;  2WAQ N;  5LGN A;  4LLL A;  4LJZ F;  3AL0 B;  1F9N A;  1X4P A;  2HOT A;  4CIC A;  2XGC A;  4C9Y A;  1MJA A;  2V9K A;  3M8E A;  4XID A;  1S3J A;  3I54 A;  1UST A;  5FLM J;  2VKV A;  3GZN B;  2MH9 A;  1JTX A;  4XK4 A;  2HEO A;  2E2I J;  3FM5 A;  3QPL A;  3O8H A;  4YEL A;  3OYN A;  4ZTJ A;  2MSY A;  1X1C A;  1IV8 A;  2W1O A;  2DYS H;  2MLG A;  1YHQ I;  2VC1 A;  2Y75 A;  3R0J A;  5E17 F;  4NNJ A;  3UR3 C;  3K1P A;  4PJM A;  1A04 A;  1BN5 A;  3H3Z A;  1KU2 A;  1I6H J;  1BM9 A;  3OYL A;  2F4I A;  4MEY F;  2OU2 A;  3F9K A;  3GUD A;  3IWZ A;  1R1T A;  4F93 B;  3AAF A;  3LFU A;  2QUF A;  2O03 A;  2VIX A;  4D7N A;  1OIS A;  4ASN A;  2AO9 A;  4IZZ A;  4OIP F;  3ML6 A;  5EG0 A;  1OPC A;  5E1W A;  3WTS C;  2IRF G;  4M74 A;  3K0L A;  5IT9 K;  4X0G A;  2DTZ A;  3TO7 A;  3ZCO A;  2DA3 A;  1IXR C;  2CWE A;  3J7Z I;  1H9G A;  2EZK A;  2NS7 A;  4Y17 A;  5E8I A;  3VSK A;  4A3M J;  2VL8 A;  1I1S A;  1FYK A;  1NG6 A;  4HX8 A;  4IHT A;  3BG3 A;  2XKP A;  4RDU A;  2V1U A;  1TBX A;  3HOX J;  2P0W A;  1LJ9 A;  2QA4 I;  2EFW A;  3F8B A;  4I99 C;  1H0M A;  4UB6 C;  2DPD A;  2QQA A;  2C6Y A;  2JA5 J;  2DCE A;  1RET A;  4Y52 J;  4I02 A;  4LIT A;  1NK3 P;  2STT A;  3PJR A;  5J40 A;  2M9H A;  2EB7 A;  3QQA A;  5L3G A;  3CO7 C;  4W97 A;  3E6B A;  2WTE A;  3GCM A;  2LK2 A;  1WVR A;  4CCL A;  5J3L A;  2AS5 F;  3DTE A;  1W1W E;  2WY7 Q;  1A6Q A;  2RQP A;  1TLH B;  1MBK A;  4UV9 A;  5ED4 A;  4LD5 A;  1FMV A;  3OYE A;  5L3C A;  2PG4 A;  4WXC A;  1IRF A;  5D8L B;  4W1U A;  2CJJ A;  4N4O B;  4IOA F;  3PNY A;  2O61 A;  1VQK I;  2F5F A;  1OCZ H;  3H0D A;  1QHG A;  2EK5 A;  2HZT A;  2QSF X;  3BR1 A;  3S3O A;  4FX4 A;  4A5N A;  1X58 A;  1YOV B;  2XF5 A;  1MJB A;  2WWY A;  1IN6 A;  2XB5 A;  3ASN H;  5FGM A;  1I1G A;  1T6S A;  3ESW B;  1YTY A;  2D1V A;  4JP0 A;  4BQA A;  1O4X A;  1R36 A;  1VQO I;  3HSE A;  2KZV A;  2EPF A;  3O6B B;  3LSR A;  1HCR A;  4RS8 A;  2LKP A;  3U21 A;  2H8R A;  3FXO A;  3JRI A;  1EH6 A;  2R7V A;  3SZP A;  2BY3 A;  3HUG A;  1VQ8 I;  2P5V A;  5CLS A;  3V8K A;  2MD0 A;  2H8W A;  4NC8 A;  4B44 A;  2A68 F;  3DEU A;  2FU4 A;  1WKM A;  2IBD A;  5CVJ A;  3R4K A;  2GOX B;  3C3W A;  1ACI A;  4BNC A;  2V6C A;  2L2O A;  2P5K A;  3TW6 A;  3X2Q H;  4XKC A;  2I8D A;  3M7G A;  4XLP F;  2Y0M A;  2CUF A;  4UVA A;  2Z3Y A;  4OAY A;  3T5X A;  2CRG A;  3J80 K;  3G71 I;  1I5Z A;  3SXY A;  3QYB A;  4ZH4 F;  4KN7 X;  1JHH A;  5EG0 B;  1Z7L A;  4LK0 F;  1YW8 A;  3QP6 A;  5DD4 A;  2DMP A;  2LFB A;  2R7Z J;  2W00 A;  3COA C;  3KYC B;  2V79 A;  1XGO A;  1FBU A;  3DLA A;  4HYE A;  3S16 J;  1HQC A;  3ZN1 A;  3EDP A;  4YFN F;  3K4N A;  1XTA A;  2FQ3 A;  1LVK A;  5HLH A;  4A0X A;  2BY1 A;  3FMQ A;  1TNT A;  2MD5 A;  2TDX A;  3CUO A;  3HEF A;  4FAS D;  3MKW B;  2KZG A;  1ZQ3 P;  2R7T A;  1IZ1 A;  3IL2 A;  3OS0 A;  3I4N J;  2BEO A;  4IF4 A;  1T38 A;  4U87 A;  2ZME C;  3H5R A;  3RPU D;  1EV7 A;  1PUE E;  3WOD F;  2GIZ A;  3F0C A;  3CC7 I;  4UV8 A;  5FLX K;  5HDN A;  2OJE D;  2WA0 A;  3HOZ J;  3CF2 A;  1R00 A;  5DYM A;  1WHU A;  1UZC A;  2GWR A;  3CCE I;  1F4K A;  2K86 A;  1FTZ A;  2FJ1 A;  3DWL E;  4MHG A;  1F36 A;  1WJA A;  3L09 A;  4L5E A;  1MMS A;  2WY8 Q;  2LVS A;  2M34 A;  2M8G X;  1OCC H;  4KIG A;  3CME I;  3A4C A;  4O6J A;  4U7D A;  1Z77 A;  2OZ6 A;  2ZNZ A;  1B8I A;  2DN0 A;  2VOO A;  1ZKG A;  1Z9C A;  3LSG A;  4Y15 A;  1K78 A;  4M9Z A;  2Z2S B;  4GGG A;  2H6C A;  5ILS A;  2EWN A;  4AUX A;  4JBA A;  3ZMT A;  4QPQ A;  2DT6 A;  4XLC A;  5LRR A;  1YS7 A;  1F5T A;  5LGU A;  1V55 H;  3TMO A;  3RTR A;  3QPT A;  2BHY A;  2ETH A;  3L2W A;  3KP6 A;  1UG2 A;  3P9K A;  1RPW A;  2KIF A;  3HSF A;  5K5O A;  3M07 A;  2XAJ A;  3I59 A;  1WQ2 A;  2ZCW A;  4RGU A;  2OPT A;  4HV6 A;  4I0B A;  5JI6 A;  3IH4 A;  4HEA 2;  1IN4 A;  4LOC A;  2M5W A;  5JLW A;  3JW4 A;  2GLO A;  2D2W A;  5K7H A;  1WJ5 A;  4EM1 A;  4A3J J;  3HUG B;  3HOU J;  2X6X A;  4NC6 A;  4IOC F;  4EJV A;  3K1M A;  4BKX A;  3NWS A;  4HNU A;  4KYW A;  3BOQ A;  1R22 A;  2ZME B;  4MTD A;  5M5W J;  3QPH A;  1P4X A;  2E34 A;  2O6G E;  5DM7 F;  2JSC A;  2V7F A;  3WTT C;  1U6G A;  5DM6 F;  2JN6 A;  3JRD A;  1XMA A;  3RI4 A;  1GHC A;  5CYV A;  1S72 I;  1JJ6 C;  3DBL B;  4RAF A;  2G7U A;  2KQR A;  4Y3O A;  5E18 F;  4KUM A;  1DU0 A;  4G7H F;  2K7L A;  1GUU A;  3C1D A;  3EUA A;  3FZV A;  3KEQ A;  4BGD A;  1E0E A;  3FXU A;  1NG7 A;  2XAQ A;  3SHF A;  3FKI J;  4B1R A;  1ZG3 A;  4Y7N J;  1YO5 C;  2WB1 A;  2EIK H;  1YIJ I;  1OCR H;  5F04 A;  2DDA A;  4LLG F;  3J81 K;  1V5F A;  4HAM A;  4PSX A;  1QHH D;  4RB0 A;  2M1B A;  3CUQ A;  1S7O A;  1TNS A;  1MBG A;  2UWM A;  1P4W A;  2HPM A;  2EA2 A;  3N4M A;  5CVU A;  3EYY A;  1A6I A;  2P6T A;  4BBS J;  2WAQ A;  4B8X A;  5EYR A;  5FKK A;  1J5Y A;  4XRS G;  3RPU A;  2P7V B;  4KFC A;  1FBS A;  3I9V 2;  3Q0W A;  2Q2E A;  1WJC A;  4MFE A;  1APL C;  3D5L A;  3CMA I;  5E3L A;  4IJA A;  4ESF A;  3H92 A;  1QO0 D;  3CO6 C;  3S3M A;  1VQ5 I;  3GTK J;  1B8I B;  4XQF A;  4D9J A;  4EJT A;  3KIO A;  2DOE A;  4GO1 A;  4XON A;  1YYV A;  3GLX A;  3RKX A;  1QQI A;  4IX7 A;  1K78 B;  5HS7 A;  4E7S A;  2CV1 A;  1L3L A;  3WU1 B;  4A3D J;  4CYD A;  3VDX A;  1JJ8 C;  3QOE A;  4A5M A;  5LHG A;  2BV6 A;  2VPR A;  4BQQ A;  3K70 D;  3CUQ C;  2MFZ A;  4I09 A;  4CYC A;  1TQM A;  1Z6T A;  1QA6 A;  3I4P A;  4HQE A;  5LEK A;  4S04 A;  3WU0 A;  2L4M A;  2E1O A;  1LKX A;  2EV6 A;  1NHA A;  3ABU A;  5IP7 J;  4XLN F;  2OCE A;  2GZW A;  1FC3 A;  4ENJ A;  1S8N A;  2DLL A;  2NXN B;  1ZH5 A;  2COB A;  3I59 B;  4M9S A;  1N25 A;  5HS8 A;  2EFN A;  4ZZL A;  4BJT A;  4R1H A;  5L3E A;  3J7A O;  1X1D A;  1S7A A;  1BJA A;  1IW7 F;  1SAX A;  2VKH A;  4OAZ A;  2EQR A;  2QWW A;  2NNY A;  3IAM 2;  2M7A A;  4IXA A;  4U88 A;  4EVI A;  3O8G A;  2DYR H;  5E79 C;  4FHT A;  2LOO A;  1FP2 A;  3IH3 A;  1MBF A;  2BY2 A;  5J6X A;  1ZYR F;  4IRG A;  3DU6 A;  3ZN0 A;  3GTL J;  4G6Q A;  5TIS C;  1OR7 A;  1Y39 A;  3DEW A;  1JHF A;  5ICC A;  2ZNY A;  4XRM A;  2RNG A;  1TWG J;  2UXX A;  3ISP A;  4XLA A;  3ZMV A;  1FYM A;  4IQJ A;  1IDZ A;  1EKE A;  1D3Y A;  2OZU A;  3I0T A;  3R6S A;  5H6R A;  4EMS A;  2ZXJ A;  1BA5 A;  1D8K A;  2HOA A;  4Z2Y A;  4NUB A;  4YFX F;  2KMU A;  5ICF A;  3M3Y J;  4BXU A;  5FKO A;  5ERI A;  4U0V A;  1BI3 A;  3DXJ F;  3CUQ B;  1J9I A;  2QZ8 A;  4LG0 A;  4B4C A;  1K4S A;  2NOG A;  1ZGJ A;  5DUI A;  3ZQC A;  3I3L A;  2K9N A;  4WWC A;  1TW3 A;  2E35 A;  3BZK A;  2CO5 A;  2O0Y A;  3A01 A;  3L2V A;  4KIC A;  1W5C C;  2KLO A;  1YI2 I;  4BY1 J;  3BLY A;  2L7M P;  1OR7 C;  2UXN A;  3S2H J;  2EBI A;  2XAS A;  1LDJ A;  2Q2E B;  1K6Y A;  3LSJ A;  2HI3 A;  4P5O A;  5LRS A;  2Y31 A;  4I98 B;  4DQ2 A;  1KYZ A;  5DCM A;  2XAU A;  3H36 A;  3LAP A;  3JTH A;  1RRJ A;  3GTG J;  4DBQ A;  1BIB A;  4FIS A;  1LPQ A;  2HOS A;  5FRO A;  1U9N A;  2IGK A;  3MKL A;  2X9D A;  3QWL A;  3GME A;  4RAY A;  2HS5 A;  3QU3 A;  2V1X A;  4EJU A;  3EET A;  5DDG A;  2HNH A;  3LA7 A;  4KJZ A;  4MGR A;  1VND A;  2FRH A;  2CUJ A;  1H9T A;  1ETX A;  3GWZ A;  4CYC B;  2E19 A;  1FOX A;  3M1E A;  2H94 A;  3OYG A;  1DU6 A;  4A3F J;  2YR2 A;  3S8P A;  5LBQ A;  3IWF A;  2CS3 A;  2LTP A;  5HLI A;  1UB9 A;  2ZBK A;  1Y1V J;  1IGN A;  3QPS A;  4N9H A;  1LUJ B;  3LA3 A;  3NEU A;  1QBJ A;  2H1K A;  3JRB A;  4KIB A;  5DUK A;  4ZDO A;  2BGC A;  2DT5 A;  4EJO A;  2VUM J;  2DFH A;  1HST A;  5GPC A;  5IYD J;  4BQN A;  1E3H A;  2VQH A;  2ME0 A;  1D0Z A;  3HRS A;  1FOK A;  2XUB A;  3KLO A;  4PUS A;  5DTD A;  5FRN A;  3Q5F A;  4BS9 A;  2RRE A;  3ABK H;  2O9L A;  5ILU A;  1XB4 A;  3C7J A;  4L5J A;  2XPV A;  3CCY A;  3A03 A;  2A05 A;  3BZC A;  1KU3 A;  3H3U A;  4ZTF A;  2ZC2 A;  3KP3 A;  1O3R A;  2V6E A;  3CMY A;  1Y56 A;  4GDF A;  9ANT A;  2A6T A;  2ADU A;  3RJP A;  2K4B A;  1QVU A;  1ETO A;  2WC2 A;  4EM0 B;  1KU7 A;  4MQ9 F;  2DFE A;  2EA4 A;  3K70 C;  4PDK A;  5F1R A;  1HKS A;  3ROU A;  2OA4 A;  1WGX A;  1UHM A;  3OIQ A;  2PX9 A;  3U2R A;  4LGW A;  1XGM A;  3H5N A;  4FET A;  3ZQQ A;  4O5V A;  1VQP I;  1DP7 P;  1LB2 A;  2HDW A;  1GXP A;  3S1N J;  1D5V A;  5IP9 J;  2DI3 A;  1ZGW A;  4ABZ A;  3FX3 A;  4BU2 A;  3LSP A;  4G9Y A;  2E2J J;  2ISZ A;  3VPR A;  1MGT A;  2QGU A;  3LL7 A;  2FOW A;  2GXG A;  2HFH A;  3A2K A;  5CKT A;  2DDB A;  4MFD A;  1IV6 A;  3ECH A;  1MJ9 A;  4F7Z A;  1KQ0 A;  2M8E A;  2OQR A;  4C30 A;  2G0E A;  2PI0 A;  2OD5 A;  2JRM A;  3Q3S A;  3PO3 J;  3DCF A;  4CCO A;  2IGO A;  1JUP A;  1R4M B;  3ZMS A;  2K40 A;  3W6J B;  2BBY A;  2PLY A;  3K4J A;  1ODD A;  4HQM A;  5DCM B;  2MH2 A;  4S0H B;  1U78 A;  3CDL A;  2DMT A;  4F3Q A;  1LFP A;  4G6T B;  2FEZ A;  1AA7 A;  5DV5 A;  4D0P A;  1DUX C;  2IT0 A;  3KP7 A;  1N77 A;  2D1H A;  2NNN A;  5IOY A;  1SAU A;  2HYJ A;  3HIF A;  1SVM A;  3CJR B;  3BG5 A;  5FJ8 J;  2BYV E;  2DQL A;  1LFB A;  3VB2 A;  4A3B J;  1WPK A;  2FX0 A;  3VYT B;  3ABL H;  4PJL A;  4XRS A;  1DGR M;  1YLF A;  2WB1 N;  1NH3 A;  4IRH A;  2L9V A;  3NAU A;  5EEA A;  1Y0U A;  3IKV A;  4ZYG A;  4AM3 A;  3D5R C;  1RI7 A;  3P9C A;  2EIJ H;  1VFC A;  3QAH A;  5LLQ A;  1IN5 A;  2OBP A;  3F8F A;  4HV5 A;  4IHW A;  4PSW A;  3CLO A;  3G1O A;  2FML A;  3BCA A;  3RKY A;  3CD6 I;  2BHZ A;  4I6Z A;  2CV2 A;  4GFB A;  3HOT A;  3TKY A;  2RKH A;  2YSR A;  5IYC J;  1HF0 A;  1FOW A;  4IQ4 A;  4BUP A;  4RLQ A;  2DAO A;  3IC7 A;  1AU7 A;  3BTJ A;  1Z91 A;  1JKR C;  3HB9 A;  4RBO A;  1FSH A;  1R71 A;  1PP8 F;  2AQE A;  5EZH A;  4E7J A;  1XMK A;  1R6R A;  2XRL A;  2ME6 A;  3WTZ A;  1BBY A;  1WI9 A;  2DK5 A;  2JWT A;  1JGG A;  4XMY A;  2BW3 A;  1VQ6 I;  1JKO C;  1HBX G;  1ENH A;  2OF7 A;  3FK6 A;  2HGC A;  2KRH A;  1R58 A;  3BR0 A;  4ZZD A;  4I7H A;  1PVE A;  1U8R A;  3MCZ A;  1QZZ A;  4R79 A;  2XV4 S;  2WAD A;  4HF1 A;  1MNE A;  1ZEL A;  2AXT C;  1PUF A;  1R4N B;  3TL4 X;  2PJP A;  3VYR B;  1KON A;  3WGG A;  5EZG A;  2FXA A;  2CMP A;  2DMU A;  5K5Q A;  2QEN A;  3JAM K;  3CCL I;  1SD6 A;  4IHX A;  3TO6 A;  2R7R A;  4KN4 X;  4PJ0 C;  2EIM H;  2BZT A;  2XB0 X;  3G4S I;  1K6O A;  3TDU C;  1OQY A;  2IGN A;  1CGP A;  4A12 A;  3SFI A;  3T1B A;  3LSM A;  1JKQ C;  2W84 A;  1BL0 A;  3K1N A;  4A3G J;  5AIQ A;  2JRT A;  1GV5 A;  1ZN2 A;  1WJB A;  1Z0X A;  4CH7 A;  1MBH A;  5GAE J;  3QU6 A;  2XC7 A;  2FUG 2;  2V4J C;  3S1M J;  4HNT A;  3BR6 A;  3F22 A;  1QZE A;  4E7H A;  4L9V A;  1SFU A;  2CQQ A;  4II3 A;  3GTM J;  4LIV A;  1ZRD A;  1FWZ A;  2H09 A;  1DPU A;  3DP7 A;  3S17 J;  1ZTR A;  4S05 A;  1PP7 U;  5EDN A;  3E7L A;  1ZLJ A;  1REP C;  1J09 A;  4Y33 A;  2H6B A;  2LKX A;  4HLY A;  2K3F A;  2VT3 A;  3KEY A;  3H9Q A;  4HDU A;  3EUH C;  2XHK A;  1JUM A;  1ERD A;  3HYI A;  1TC3 C;  2DO7 A;  4BY7 J;  4JX4 A;  1U5T C;  1BW6 A;  1VZ0 A;  4A6E A;  5CQG A;  5JHU A;  4RA2 A;  3S1R J;  2HWV A;  1J59 A;  4K2E A;  3N97 A;  3BR2 A;  4CXF A;  3FWE A;  1S6L A;  1LQ1 A;  4J01 A;  3NQO A;  1BOB A;  2EFQ A;  3WTV C;  4RM2 A;  4NDL A;  2LRD A;  3HOY J;  3T8T A;  1VQM I;  3HXL A;  4PJN A;  4XLH A;  2KRF A;  3K4M A;  4GYI A;  1FIA A;  2H1L A;  5GTI C;  1FP1 D;  4UUT A;  3ZMD A;  2HOE A;  2JPC A;  2D5V A;  2OQG A;  2TRT A;  3CDH A;  3IRQ A;  1PDN C;  2VLA A;  1I39 A;  2JSP A;  2Z1D A;  3DPT A;  4BYY A;  1PJR A;  2BW3 B;  5ICE A;  2HDD A;  2L02 A;  2DFF A;  1AKH A;  2YU3 A;  1X2N A;  1DGW Y;  3KFW X;  4UB8 C;  3SDB A;  2VBZ A;  5F08 A;  5LHI A;  2LY1 A;  3ZRG A;  5E3O A;  2ZME A;  4MEX F;  2IW5 A;  4I01 A;  3DBH B;  2X1E A;  4C3H J;  1T8I A;  2MC4 A;  1BI2 A;  5FFZ A;  2FSW A;  2GA2 A;  2RDP A;  1BR1 A;  3BG6 A;  4HSR A;  1PUF B;  2JA8 J;  3TED A;  3CP8 A;  3A1Y A;  5BMZ A;  1OYW A;  3VWB A;  3OYA A;  3S2W A;  4QLC U;  1B9M A;  5BS6 A;  2VQL A;  4XOP A;  3PNT A;  1O57 A;  3LSH A;  3TQN A;  2CU7 A;  4L9J A;  2QSH X;  1RKT A;  3QYF A;  1OKR A;  3CJN A;  1SMT A;  2XSJ C;  1G3W A;  1YIT I;  2Z33 A;  2DA4 A;  4GXO A;  2O3F A;  3WHC A;  1U5T B;  1TL8 A;  5D5W B;  3I55 I;  4AYB N;  5B5E C;  3AFH A;  3RSN A;  4AD9 A;  2Q0O A;  1BW5 A;  1GXQ A;  3JRG A;  3H5A A;  2DA2 A;  1QVT A;  2Z16 A;  2RGV A;  2VJ4 A;  5DD8 A;  5J4V A;  1MNM C;  2NYX A;  4RM3 A;  1B9N A;  3SDG A;  5J1R A;  1Z05 A;  4P55 A;  4EJW A;  3OYH A;  2M2E A;  4IKF A;  2WBM A;  3IHU A;  3CLQ A;  3R61 A;  3OYF A;  2IA1 A;  1B72 A;  3K2A A;  2LDU A;  2F6C A;  1IRX A;  3BP8 A;  3ZQ7 A;  4O3M A;  4AVZ A;  2RNJ A;  3RQ4 A;  1SD5 A;  1A5J A;  2VOD A;  2LSO A;  3OYD A;  2KRC A;  1K79 A;  5GTH C;  1E17 A;  2XVC A;  5JVG F;  2XGX A;  4BHP A;  4ZC3 A;  2D45 A;  1D5Y A;  1NTC A;  4D5C A;  2DJN A;  4ZYH A;  2DXI A;  1C0W A;  1T56 A;  2L01 A;  2FE3 A;  1ETQ A;  1UEL B;  2FNA A;  5CVV A;  4WK8 F;  5EJC A;  2DT7 B;  1TWC J;  5HNF A;  3REO A;  1JT0 A;  3KET A;  4DJA A;  4ESJ A;  3LAJ A;  2L54 A;  3MZ8 A;  4UVB A;  2ELK A;  2ELH A;  3TW7 A;  1XSD A;  5FKM A;  1OCT C;  2F48 A;  2ZB9 A;  3BR3 A;  3DTK A;  1MZB A;  2M30 A;  2JZY A;  3F6O A;  2CQN A;  4A0Y A;  2GM4 A;  1M1E B;  4B3A A;  3WE3 A;  1VQ7 I;  3E6D A;  1LVA A;  3IAS 2;  3PSI A;  2QM3 A;  2Z9O A;  4BXF A;  3F23 A;  3ERE D;  2K9Q A;  5LD2 C;  1BJZ A;  2DA5 A;  2KL4 A;  1AKH B;  5K7Z A;  2CW7 A;  3CC2 I;  4JOM A;  3ERM A;  3C2G A;  2NVY J;  3CF5 F;  1UHW A;  4C2T A;  2M0M A;  4C3I J;  2ZJQ F;  1MMN A;  1MW7 A;  1OCO H;  2I10 A;  5HVQ C;  1Z3X A;  1IXC A;  1HDD C;  2PMH A;  3M9A A;  4UNO A;  1L0O C;  5A2Q Z;  3JRE A;  3HOW J;  4F91 B;  4HST A;  5F0C A;  4NQW A;  3QYE A;  4LK1 F;  1LDD A;  5M3F J;  4XSX F;  2VB6 A;  3HRM A;  3ULQ B;  3S15 J;  1JT6 A;  4II2 A;  1JTY A;  2DQR A;  1F1Z A;  3LSK A;  1YJW I;  3CDI A;  4BHB A;  3ZMZ A;  1IAW A;  3HL2 A;  4HF2 A;  2O8X A;  5C44 J;  1UMQ A;  4AIJ A;  2HQ5 A;  2Z99 A;  2ZXW H;  4UUV A;  1K83 J;  1YW7 A;  2QYO A;  2L9R A;  3FXM A;  1TZL A;  2QKM B;  2VT2 A;  3V42 A;  4RB2 C;  5M5Y J;  1WZ2 A;  2E2H J;  4LFU A;  2KT0 A;  1ZR2 A;  4AID A;  2VBX A;  3B02 A;  2G9W A;  3O2P E;  1BIA A;  2X6W A;  3OOP A;  4BAC A;  2W85 A;  1W36 D;  2PN6 A;  3MZY A;  3F8M A;  2Y48 A;  1S9H A;  4FTH A;  3VEP A;  2NVX J;  5D6E A;  2HPI A;  1SAN A;  2LH9 A;  3KYL A;  1B72 B;  4DBR A;  2X1D A;  4QSH A;  1FT9 A;  2M3A A;  3GF2 A;  4BAY A;  3ZGK A;  5HLG A;  3Q0V A;  1JI8 A;  2VOP A;  1I3A A;  3HZJ A;  2JA7 J;  3HPG A;  2ID6 A;  3WG7 H;  2QQ8 A;  1RKW A;  3ABM H;  4OOI A;  3GW2 A;  2QBY A;  4MIM A;  1QNT A;  1D0X A;  4M9X A;  1WJF A;  3TO9 A;  3OYM A;  1O7L A;  2JK3 A;  5FD5 A;  2CQK A;  1FJL A;  4MNU A;  2V1D A;  3MKY B;  3F8C A;  2PMZ N;  3K10 A;  2P81 A;  2A3S A;  3C2B A;  1HLV A;  3JAM Z;  2GXB A;  1GV2 A;  2ZJR F;  2ESN A;  4J19 A;  2L3D A;  2H27 A;  1J7K A;  4L0Y B;  1YFH A;  1I27 A;  2FA5 A;  1IO2 A;  2L5Q A;  1IN7 A;  3I4M J;  2VQG A;  3RDI A;  3TBI A;  3TP3 A;  1WCM J;  4A6D A;  1FIP A;  2XAG A;  3CCR I;  3FMR A;  2XGE A;  1WJE A;  4G7Z F;  4XOR A;  2KIS A;  3QRF F;  2ZJ2 A;  5D4S A;  4FX0 A;  4L9N A;  3GTO J;  2PMU A;  2X51 A;  4RMN A;  2PJR A;  1X4O A;  1VQL I;  1WWX A;  2R7U A;  2JJ7 A;  1AWC A;  2E1C A;  2IS6 A;  1BR4 A;  2M45 A;  2YX7 A;  5H2F C;  5TGT A;  2E60 A;  1Q1H A;  5HNH A;  3Q9V A;  4BL0 B;  2VON A;  5IOZ A;  2EFO A;  4ITV A;  2W48 A;  3FDY A;  1G2H A;  2CW0 F;  3AG1 H;  1ETW A;  4UXN A;  4AVP A;  3OL4 A;  4L18 B;  3BJ6 A;  4XKB A;  2LNB A;  3DTI A;  4M72 A;  4BJ6 C;  5C4J J;  4NQW B;  1Y0N A;  1MBE A;  4WF2 A;  1I3Q J;  1QPI A;  3ZR8 X;  4RB3 C;  2OUM A;  3DKX A;  2XPU A;  3PQJ A;  4DYR A;  3DU5 A;  3PNV A;  2VXZ A;  3U9G A;  5KAI C;  2P8T A;  5K7F A;  1VQ9 I;  2R7S A;  2R4G A;  1ZGA A;  1D1B A;  1O3Q A;  4B43 A;  3WHB A;  2R93 J;  1Q1V A;  4G6D A;  3K2Z A;  2QQB A;  2X85 A;  4L9T A;  1U9O A;  5CQE A;  4H0E A;  3CCM I;  3HM5 A;  2W7N A;  1FBQ A;  4IO9 F;  2GXA A;  3WU2 C;  4UY8 I;  1XCV A;  1HDP A;  2YX4 A;  2F4O B;  5EEH A;  3M8F A;  4HA8 A;  5FKL A;  3SYT A;  2XF6 A;  4DYQ A;  4CCK A;  3CQZ J;  3V8L A;  4QIW N;  1P2F A;  2AQF A;  3K69 A;  3GFJ A;  2Y30 A;  2LLK A;  4XR6 A;  5EF6 A;  2ZJP F;  3HG9 A;  2KFD A;  4C3J J;  3OMY A;  5HLT A;  4A93 J;  3FBI B;  2IGM A;  3FXR A;  3H9J A;  3G1M A;  2DPU A;  3FIS A;  3OR1 C;  4JX5 A;  5GAD J;  3BJA A;  2Y9Y A;  3MEX A;  3KCC A;  2BY0 A;  3JRC A;  3CCV I;  2R7X A;  2QBY B;  3BR5 A;  4U0Y A;  4M6Y A;  2PQ8 A;  1RC9 A;  2RV8 A;  1XSX A;  1T98 A;  4L0Z B;  2F2E A;  4BBR J;  4FE4 A;  1H8A C;  2XAH A;  2FBK A;  3S3N A;  2A5Y B;  4XSZ F;  1X1B A;  2YS9 A;  1IDY A;  3HRT A;  1TW2 A;  2LBF B;  3G6E I;  3W2A A;  1OJL A;  1Z67 A;  4QWQ A;  4E70 A;  2ELJ A;  4Q5S F;  5DEQ A;  1PYV A;  1CQT A;  3H0G J;  5EEG A;  1O7F A;  3PUB A;  1G4D A;  3VFZ A;  2XF7 A;  1W36 C;  5D6F A;  5FKN A;  4JQF A;  1KA8 A;  1W5S A;  2ACJ A;  2PJR B;  1QZY A;  3S2D J;  2DOA A;  3VYU B;  4IHV A;  3KP4 A;  3SFZ A;  4DYC A;  1ZAO A;  2MAB A;  3OS2 A;  1HSJ A;  1Y8Q B;  4E7L A;  4RLF A;  1FYL A;  4OIO F;  3VYS B;  4AYB A;  4CSW A;  4YG2 F;  2K27 A;  4C2U A;  2DJI A;  3R60 A;  1BC7 C;  2KJC A;  1GVJ A;  1SFX A;  4ENN A;  4LB5 A;  3J7Y J;  4CZC A;  3HHH A;  3PFY A;  3TDZ C;  1WI3 A;  1X3W B;  3VOD A;  5ICG A;  4HOB A;  1D1C A;  3E0J B;  5M3M J;  1B1B A;  3AKZ A;  3I53 A;  3KLN A;  4HBL A;  2I5U A;  5LEJ A;  5H6Q A;  1EH7 A;  2X6Y A;  2NVQ J;  3JSP A;  3ZQL A;  1YX5 A;  3ASO H;  2W25 A;  2HDC A;  1CF7 A;  2JPB A;  3ZP5 A;  1BI0 A;  2A07 F;  3LOC A;  1WH5 A;  3KZZ A;  1WSU A;  4PK4 A;  1E3O C;  4ZYA A;  4DZJ A;  2VJ5 A;  3DF8 A;  4LG3 A;  4M3F A;  4OU0 A;  4PZJ A;  3CES A;  3V4G A;  5KK1 A;  3E97 A;  2E5Z A;  4B48 A;  3CTA A;  5E3M A;  2Y2Z A;  2V26 A;  2IS1 A;  2MGQ A;  2E5N A;  4E4H A;  1MD0 A;  3M4O J;  3D1N I;  3HBL A;  1MMD A;  5HS9 A;  5F0H A;  3OV8 A;  2K02 A;  2L9S A;  1T39 A;  2QKL B;  4BE1 A;  1WH7 A;  6PAX A;  2EZL A;  1FZP B;  1SVO A;  3QOP A;  1LNW A;  2VQC A;  1ZAR A;  5IY5 H;  4U7B A;  3PIO F;  2P5L C;  2ZSI B;  1I50 J;  2KIQ A;  5D4R A;  4EV0 A;  2R7D A;  2Y0S N;  3C18 A;  4KDP A;  3BCB A;  1A35 A;  3H9G A;  4EQQ A;  1BOA A;  2OV7 A;  2BOL A;  2IP2 A;  4HDV A;  2O7O A;  1RUO A;  4LMY A;  1Y1W J;  2KHM A;  1YQA A;  3BC8 A;  5LGT A;  4Y13 A;  1D0Y A;  2KIM A;  3P5J A;  3PFI A;  2K4J A;  3L1P A;  2R3S A;  1QGP A;  2KPM A;  2Y9Z A;  4XRF A;  3H3V K;  4DZP A;  5HOO A;  5B1A H;  1ITY A;  3QP5 A;  2DMQ A;  3G73 A;  2B63 J;  5C4X J;  1Z7U A;  1R5I D;  5A2Q K;  3GTJ J;  3WE2 A;  1XDU A;  1ETV A;  1RR7 A;  3IRR A;  2A6H F;  3HSR A;  5B1B H;  2L7F P;  4U0W A;  3KP2 A;  2RN7 A;  2Y69 H;  3V7C A;  4WXH A;  3P9I A;  5E3N A;  3ZMU A;  2LY2 A;  3BPV A;  2G7H A;  2KDO A;  2ZKZ A;  5E1Z B;  5J4Y A;  1XD7 A;  3HHG A;  3GTP J;  5H20 A;  3WTW C;  2PFB A;  5J8C A;  3H1C A;  5KNL A;  3AG3 H;  4KMF A;  3CZ6 A;  1ONV A;  2CSO A;  1GDT A;  3ZOB A;  3KZI C;  5KHD A;  2LRE A;  4Z6Y A;  3DEE A;  2RC4 A;  3BT9 A;  1MKM A;  3F21 A;  2R0Q C;  4KA4 A;  1FTT A;  1U0J A;  3FXQ A;  4PFO A;  1U3E M;  5JHF A;  3IUO A;  5DS9 A;  2HYG D;  4HX4 A;  4JX6 A;  1DDN A;  2GQQ A;  3IP4 B;  4G12 A;  1UFM A;  1JUS A;  2CUE A;  3DQV C;  5ILV A;  2JA2 A;  4P9U A;  4AIH A;  1IRZ A;  3P7N A;  2X6O A;  4N4N B;  3ECO A;  4Y4R A;  2JQ7 A;  1IJW C;  1KU9 A;  5BPI A;  4YIR X;  2E71 A;  4PFP A;  3Q0U A;  3A02 A;  2CW8 A;  1VQ4 I;  2ECB A;  5D5V B;  5KCM A;  4CA0 A;  5FB2 A;  3LWF A;  2YUS A;  4CUG A;  2HXO A;  1ON2 A;  5AON A;  1SFO J;  1CF7 B;  2IS4 A;  1LFU P;  2B0L A;  3J7A Y;  3A0H C;  1F43 A;  1VQN I;  2FMY A;  3ZPL A;  2IS2 A;  3E5U A;  2VKD A;  3HOV J;  3ZXS A;  3ZQG A;  2VAS A;  1MSE C;  5CJ9 A;  2QCO A;  4D1Q A;  1R7J A;  2PMZ A;  2MLK A;  2K9S A;  2YPR A;  1TQP A;  4GRI A;  2XIG A;  1X19 A;  3EUH A;  3A0B C;  2AXL A;  2NOJ B;  1O3S A;  5J47 A;  1HKQ A;  3F6V A;  1UAA A;  2GOM A;  4BH9 A;  4M6X A;  4D5F A;  4UUS A;  2XRO A;  3T0Y A;  1U5T A;  3CJT B;  5FFX A;  3WG9 A;  2IA0 A;  1VF9 A;  3L7W A;  5GP9 A;  5C3E J;  1OYY A;  2JA6 J;  3ELK A;  4CGZ A;  3E1S A;  1JGS A;  2W57 A;  1KZH A;  3FM3 A;  3BTI A;  1LE8 B;  2XPW A;  2HXI A;  4V2G A;  2M87 A;  2XKO A;  2J5P A;  3VSL A;  2CGP A;  2VN2 A;  2F5V A;  1W0U A;  2K9M A;  3TGN A;  2RQQ A;  2LYC A;  2NS0 A;  3U1D A;  4NC7 A;  2HTS A;  2K3P A;  3RQI A;  1ZR4 A;  1XN7 A;  2EFP A;  4HLX A;  1G3T A;  4KMU X;  2F5D A;  3JSO A;  1RNL A;  4B47 A;  2LY9 A;  4XLF A;  4UHT A;  2IVM A;  2WAE A;  3PM1 A;  3M1C A;  4YIF A;  4XN3 A;  3K4L A;  4RAZ A;  1TP4 A;  2FQ4 A;  5F27 A;  1HXD A;  1JKP C;  1BI1 A;  4V2F A;  4A3K J;  2HU9 A;  2VE9 A;  4A69 C;  4CZZ A;  5HDK A;  3B6C A;  1WJD A;  2FBI A;  3PUF A;  2LP0 A;  4HZF A;  3SJM A;  3HRU A;  4P96 A;  1YX3 A;  3GEZ A;  3EYI A;  3K6G A;  3HDD A;  2KJB A;  4A3C J;  1E3P A;  1W5T A;  1Z6R A;  1H89 C;  4QPO A;  3GZ5 A;  3E6C C;  2QLZ A;  1V3F A;  1STZ A;  3ZQH A;  1FY7 A;  3CCQ I;  4CCJ A;  1ETK A;  2QVO A;  2L4A A;  1KQ9 A;  1ZHF A;  4BHC A;  3EUK L;  2R7F A;  2P4W A;  3FK7 A;  2GA1 A;  1MIJ A;  4KIF A;  1P4A A;  4YRV A;  1XSV A;  1YJN I;  5B66 C;  4Q48 A;  2A69 F;  2NVT J;  1MH3 A;  3OOU A;  5J1U A;  4G8X A;  2MG4 A;  3UNG C;  3BRO A;  2R5Y A;  1K7A A;  5KAF C;  3HTU A;  3LNQ A;  1YW9 A;  2ICW G;  4HNV A;  3HC7 A;  3MWM A;  1NK2 P;  1N75 A;  5B3S H;  1W0T A;  1DPR A;  3IKT A;  5GAH J;  3WTU C;  4BE2 A;  1W4M A;  2HQA A;  1G6N A;  3CJQ B;  1TQI A;  4B09 A;  2IPQ X;  5IT3 A;  5L3D A;  4WX9 A;  3FXK A;  2ZXH A;  2LKS A;  1ZLK A;  1SMY F;  3LA2 A;  2CFX A;  2UUZ A;  3MVP A;  1VI0 A;  5BPD A;  1IUF A;  1EF4 A;  3CCU I;  2X48 A;  1MH4 A;  4UUS B;  3BTL A;  3KX2 A;  5K5R A;  1USS A;  2VKE A;  1B59 A;  1ZK8 A;  3B6A A;  2L9N A;  3MMY B;  3JRF A;  2BVM A;  4A2U A;  4GCV A;  3L2C A;  2DBB A;  4D7M A;  2BXZ A;  3I71 A;  1Y6I A;  3I56 I;  3CMM A;  3SZG A;  3CC4 I;  3DKY A;  4FT8 A;  4A3E J;  4N0B A;  2FD5 A;  3HPH A;  2EV5 A;  3LQR A;  4AU7 A;  3DLL F;  1ULY A;  3V7R A;  3WTY C;  3OYK A;  2M4G A;  3ONQ A;  2HVQ A;  1RES A;  1X1A A;  1FPQ A;  1ZRE A;  1ORK A;  3C2H A;  4WCG A;  3ABT A;  3KYD B;  1DQU A;  4WXD A;  5GAG J;  2E1M C;  3D5S C;  2VBW A;  5JFR A;  1XPX A;  2FBH A;  1SFK A;  1X2M A;  3OSG A;  5HDG A;  2ZO4 A;  3W2V A;  2DU9 A;  2JT1 A;  3SZT A;  1ZG5 A;  4ZYE A;  2KP6 A;  1R49 A;  3CCS I;  4FCY A;  5EGO A;  1FX7 A;  5J8F A;  2EV0 A;  4KNY A;  3IV5 A;  3S14 J;  1MND A;  2HZD A;  1JXS A;  4ZDP A;  1V54 H;  3HOS A;  2FNP A;  2BVL A;  4M3G A;  5GPA A;  4C2M J;  4JK1 X;  5L3B A;  3FXJ A;  3MQ0 A;  4IRI A;  2W24 A;  1OCP A;  1HW5 A;  4PGH A;  3OIO A;  1AOY A;  2R92 J;  1OYI A;  4M3D A;  3T8R A;  4YFK F;  4E7K A;  3ZQF A;  1MDM A;  3BPX A;  2LD5 A;  1SD4 A;  3R0A A;  4Q4Z F;  4TV7 A;  3LST A;  4PJJ A;  3HJE A;  3E3V A;  2QQ9 A;  1MSF C;  3L2U A;  2P7C B;  4OIQ F;  3GTQ J;  2HQR A;  2EIN H;  3OYJ A;  4BE0 A;  1IG7 A;  5D5X B;  5F6F A;  1S7E A;  3BWG A;  4DW6 A;  2XDV A;  2GBY A;  1P7I A;  4X6A J;  4BEH A;  2R5Z A;  2EJR A;  3RPQ A;  2PEX A;  3FF5 A;  1XGS A;  2TCT A;  1T2K A;  1IUY A;  1FEX A;  2R5Y B;  4A0Z A;  3TOA A;  3FIW A;  2VI6 A;  1U8B A;  5FRM A;  2Y0S A;  3H35 A;  4XNF A;  5TRD A;  4HF0 A;  3PO2 J;  3SEZ A;  1W7P D;  1T95 A;  2OC6 A;  4I2O A;  3S1Q J;  1T33 A;  2VC0 A;  2YU9 J;  1OFC X;  2ZXI A;  1DP3 A;  3OY9 A;  2LMD A;  3RZO J;  2J5O A;  3DPU A;  1TTY A;  4XBF A;  4OIN F;  4DGW B;  3JRA A;  2R7W A;  2L7Z A;  1XG1 A;  2E1M B;  3MN2 A;  3PL8 A;  3RKW A;  1HOM A;  2DOD A;  3EPZ A;  2LF8 A;  3OSF A;  3JCU C;  2X0L A;  2O5R A;  3BZ6 A;  3SQN A;  3L2R A;  1S29 A;  1UJ8 A;  3GBG A;  1G59 A;  3DPL C;  3G2B A;  1A36 A;  1UHS A;  4ZJZ A;  1FNN A;  1IC8 A;  3I5U A;  2GAU A;  1FOY A;  3DBR B;  1J2X A;  2IAI A;  5D5U B;  4ON0 A;  3IH2 A;  1YG2 A;  3BJO A;  1X3U A;  3G1L A;  1OMI A;  2ECC A;  5JLX A;  5J1Y A;  3EQL F;  2VBY A;  3LQQ A;  1Y8R B;  2WV1 A;  2HKO A;  3CP2 A;  3HKZ A;  2UV1 A;  2DTR A;  2MC3 A;  4ENK A;  1BC8 C;  2ZSH B;  1R1V A;  1SC7 A;  1I6X A;  4M73 A;  3SEQ A;  1EA3 A;  4KT5 C;  1G3Y A;  4E7I A;  1KYW A;  2VXD A;  2KKO A;  4V19 K;  3B73 A;  1A31 A;  1K61 A;  1TT0 A;  3HGY A;  2IEK A;  3WTX C;  3RIR A;  4P1W A;  3CCJ I;  4NHJ A;  4EAT A;  3F72 A;  1D8J A;  2R7O A;  1XGN A;  3S32 A;  5EGO B;  2O8K A;  2HYF A;  2ZFW A;  4EGY A;  2DOF A;  1XX5 A;  4XIC A;  1YS6 A;  2LR8 A;  4M71 A;  4OMZ A;  2LBF A;  1LEA A;  3HTS B;  5E20 A;  3TOB A;  1S5L C;  2ZFU A;  2NAZ A;  4I76 A;  3JRH A;  3RZD J;  4I0A A;  4J00 A;  3OS1 A;  3NWT A;  2EZI A;  2X1C A;  3OYB A;  2LG4 A;  4ENM A;  3LMM A;  3KPH A;  1IXS B;  3O3K A;  3VOE A;  5DCF A;  2Q8K A;  1D1A A;  5LFA A;  4RGX A;  3KE2 A;  3LFK A;  4KT6 A;  2VJJ A;  3WGH A;  3GZ6 A;  1MDM B;  2R7Q A;  5FO5 A;  4F55 A;  1Z3Y A;  3NAR A;  4B3X A;  3U1K A;  4G7O F;  2IJL A;  5IT9 Z;  2VE8 A;  2DA7 A;  1V4R A;  3FHZ A;  3RYR A;  3NRV A;  1J0R A;  1MMG A;  2P6S A;  5F0F A;  4BEH B;  5M5X J;  2R5Z B;  1YRN A;  3GO5 A;  4CCN A;  5LHH A;  1ETY A;  2F5C A;  2ID3 A;  3BDD A;  2A5W A;  4UVC A;  2E36 A;  2CQ7 A;  4N9I A;  1EH8 A;  1JE8 A;  3BG7 A;  4OWR B;  2BE5 F;  2BXY A;  4IHS A;  4RB1 A;  3MKZ A;  4ZDL A;  2JVH A;  3UKG A;  4L5I A;  3D0S A;  2M7B A;  2V1N A;  1IRG A;  2B7E A;  5L3F A;  1R1U A;  2OCC H;  1W7P A;  2NS8 A;  2HR3 A;  4EM2 A;  2CYY A;  3KZY A;  4RAG A;  4JYK A;  2JUG A;  3GYH X;  2IA2 A;  5IP6 A;  1WFX A;  4YII A;  2ISY A;  1B4A A;  2CUZ A;  1R5G A;  4M3B A;  4XKV A;  1XMX A;  2JVG A;  4ESB A;  2JMW A;  4IHY A;  2ESH A;  2E7X A;  2CH0 A;  2B9S A;  5D8K B;  1N78 A;  4HX7 A;  1EJ9 A;  1MBJ A;  5BOX A;  2E1N A;  1E2X A;  1X3Z B;  4HRI A;  1QU3 A;  1YIO A;  2Q1Z B;  4LLN A;  1J75 A;  3LSI A;  3GX4 X;  1RUN A;  5CVI A;  2V9V A;  1FLI A;  2OTJ I;  1TWA J;  3GFL A;  4HG2 A;  3W6V A;  2A6E F;  1XDS A;  3OL3 A;  1AHD P;  3W3C A;  2DMN A;  1T0F A;  2Z5U A;  4GYG A;  3GFM A;  1FSE A;  3FXL A;  3MFK A;  3GFI A;  1P6R A;  1YJ9 I;  1QPM A;  4MTE A;  2MW8 A;  3DFG A;  1IN8 A;  4DNC A;  4XKW A;  2KDZ A;  5FLV A;  3PQK A;  5BQT A;  1G8X A;  2W82 A;  4BQO A;  3JTG A;  3JR9 A;  3W2W A;  1UCR A;  5E1X A;  1ZG1 A;  3K4B A;  4ANJ A;  2DA1 A;  2DW4 A;  5IYB J;  1R5H A;  1YE9 A;  3MAJ A;  2DK8 A;  1HA8 A;  1HC8 A;  4BDY A;  1SVL A;  3DV8 A;  3K4K A;  3J80 Z;  1T0F C;  3OR2 C;  2UZK A;  4KIS A;  4IVN A;  4RGR A;  1B6A A;  4M3E A;  1BR2 A;  4A3I J;  3AG2 H;  2HVR A;  3FHN A;  5JVT A;  2K85 A;  4OIR F;  3GXO A;  1MMA A;  4MLO A;  2OTL I;  1KQ8 A;  4YEJ A;  3RCO A;  2LC2 A;  5AIP A;  4F92 B;  2NVU B;  1Z21 A;  1RIO H;  1HKT A;  1O3T A;  2HKX A;  4XLE A;  2IXS A;  2X4H A;  1YRN B;  3L00 A;  3WGI A;  2EIL H;  1V5E A;  4BDZ A;  5KVR A;  3F8N A;  1P92 A;  2HTJ A;  2JUC A;  1V5G A;  1WRJ A;  3OYI A;  4M6V A;  3F3X A;  3OYC A;  3RYP A;  3Q9S A;  1U2W A;  4AWX B;  5FLX Z;  3GLL A;  2XRN A;  3BQY A;  3I58 A;  3N05 A;  5CVR A;  3KP5 A;  2VJI A;  5TJJ A;  2WV0 A;  5FD6 A;  3V8J A;  1W7P B;  4BXX J;  2EZH A;  4EEF G;  3K7A J;  4PCQ A;  2COM A;  4H4K C;  5F1J A;  1FMW A;  1LEB A;  5E8G A;  3ZQI A;  4LIU A;  4CCM A;  2CQX A;  4IEJ A;  3M8J A;  4HW0 A;  2L0K A;  4PGG A;  2DFI A;  1POG A;  2CG4 A;  2CFO A;  3L9F A;  4E7Z A;  2DA6 A;  2WAF A;  4DOZ A; 
#chains in the Genus database with same CATH homology
 1HW1 A;  3BY6 A;  1HW2 A;  2F5E A;  2NRA C;  3KEO A;  4CO8 A;  2HQN A;  4IPA A;  1ON1 A;  2RVC A;  2PBI A;  5F64 A;  2MA3 A;  1KGS A;  1SD7 A;  4R8H A;  3E5Q A;  3I64 A;  4CHU A;  4AIK A;  4LG0 B;  3FMS A;  4G94 A;  2GIV A;  1IF1 A;  4OMY A;  2E7W A;  5JR3 A;  4MQV A;  4ZYD A;  2LF7 A;  3E6M A;  2STW A;  2MBF A;  3W6K B;  1Z1D A;  2FOK A;  2JTV A;  1LDK B;  4ETS A;  4LB6 B;  4CDG A;  3DKW A;  1SFE A;  2KIU A;  4RGS A;  1ZRC A;  3K9T A;  1R23 A;  4NB5 A;  2FF4 A;  3GVA A;  2OAZ A;  5K1Y A;  1RZ4 A;  1G3S A;  3E5X A;  1ZRF A;  3V7S A;  3J81 Z;  3MZH A;  4Q47 A;  4P9F A;  3G3Z A;  1XCB A;  2XAF A;  1VTN C;  4EGZ A;  2A61 A;  5LGN A;  4LLL A;  4LJZ F;  1F9N A;  4CIC A;  1MJA A;  3M8E A;  1S3J A;  3I54 A;  1UST A;  2MH9 A;  2HEO A;  3FM5 A;  2MLG A;  2VC1 A;  2Y75 A;  3R0J A;  5E17 F;  3K1P A;  1A04 A;  1BN5 A;  3H3Z A;  1KU2 A;  1BM9 A;  4MEY F;  2OU2 A;  3GUD A;  3IWZ A;  1R1T A;  3AAF A;  2QUF A;  2O03 A;  4ASN A;  4OIP F;  3ML6 A;  1OPC A;  5E1W A;  3WTS C;  2IRF G;  4M74 A;  3K0L A;  5IT9 K;  3TO7 A;  1IXR C;  2CWE A;  1H9G A;  4Y17 A;  5E8I A;  1I1S A;  1FYK A;  4HX8 A;  4IHT A;  2XKP A;  2V1U A;  1TBX A;  1LJ9 A;  2EFW A;  3F8B A;  1H0M A;  2DPD A;  2QQA A;  2C6Y A;  4I02 A;  2STT A;  2EB7 A;  5L3G A;  3CO7 C;  3E6B A;  2WTE A;  2AS5 F;  2RQP A;  1TLH B;  4UV9 A;  5ED4 A;  4LD5 A;  5L3C A;  2PG4 A;  4WXC A;  1IRF A;  5D8L B;  2O61 A;  2F5F A;  2EK5 A;  2HZT A;  4FX4 A;  4A5N A;  1MJB A;  2WWY A;  1IN6 A;  5FGM A;  1I1G A;  1T6S A;  1YTY A;  2D1V A;  4BQA A;  1R36 A;  3HSE A;  3O6B B;  4RS8 A;  2LKP A;  1EH6 A;  3SZP A;  3HUG A;  2P5V A;  3V8K A;  5CLS A;  2A68 F;  3DEU A;  2FU4 A;  1WKM A;  5CVJ A;  3R4K A;  3C3W A;  4BNC A;  2V6C A;  2P5K A;  3M7G A;  4XLP F;  2Y0M A;  4UVA A;  2Z3Y A;  3J80 K;  3T5X A;  1I5Z A;  3SXY A;  4ZH4 F;  4KN7 X;  1JHH A;  4LK0 F;  1YW8 A;  3QP6 A;  5DD4 A;  3COA C;  1XGO A;  1FBU A;  2V79 A;  4HYE A;  1HQC A;  3ZN1 A;  3EDP A;  4YFN F;  2FQ3 A;  5HLH A;  4A0X A;  3FMQ A;  1TNT A;  2MD5 A;  2TDX A;  3CUO A;  1IZ1 A;  3IL2 A;  2BEO A;  4IF4 A;  1T38 A;  1EV7 A;  1PUE E;  3WOD F;  4UV8 A;  5FLX K;  5HDN A;  1R00 A;  5DYM A;  2GWR A;  1F4K A;  2K86 A;  4MHG A;  3L09 A;  4KIG A;  4O6J A;  4U7D A;  2OZ6 A;  2ZNZ A;  2VOO A;  1Z9C A;  4Y15 A;  1K78 A;  4M9Z A;  4GGG A;  2H6C A;  5ILS A;  2EWN A;  4JBA A;  3ZMT A;  5LRR A;  1YS7 A;  1F5T A;  5LGU A;  3RTR A;  3QPT A;  2ETH A;  3KP6 A;  3P9K A;  2KIF A;  3HSF A;  5K5O A;  2XAJ A;  3I59 A;  1WQ2 A;  2ZCW A;  4RGU A;  4HV6 A;  4I0B A;  5JI6 A;  1IN4 A;  2M5W A;  3JW4 A;  2D2W A;  4EM1 A;  4EJV A;  3K1M A;  4KYW A;  3BOQ A;  1R22 A;  2ZME B;  4MTD A;  2O6G E;  3QPH A;  1P4X A;  2JSC A;  3WTT C;  1U6G A;  1XMA A;  3RI4 A;  1GHC A;  5CYV A;  2G7U A;  5E18 F;  4KUM A;  4G7H F;  2K7L A;  3C1D A;  3FZV A;  3KEQ A;  3FXU A;  2XAQ A;  3SHF A;  1ZG3 A;  1YO5 C;  4LLG F;  3J81 K;  4HAM A;  4RB0 A;  2M1B A;  3CUQ A;  1S7O A;  1TNS A;  2UWM A;  1P4W A;  2EA2 A;  3N4M A;  5CVU A;  3EYY A;  2P6T A;  4B8X A;  1J5Y A;  3RPU A;  2P7V B;  4KFC A;  1FBS A;  2Q2E A;  3D5L A;  4IJA A;  4ESF A;  3H92 A;  1QO0 D;  3CO6 C;  4EJT A;  4GO1 A;  1YYV A;  3GLX A;  3RKX A;  1QQI A;  1K78 B;  5HS7 A;  1L3L A;  3WU1 B;  4CYD A;  4A5M A;  5LHG A;  2BV6 A;  3CUQ C;  4I09 A;  1TQM A;  1Z6T A;  3I4P A;  4HQE A;  5LEK A;  4S04 A;  3WU0 A;  2L4M A;  2EV6 A;  1NHA A;  3ABU A;  4XLN F;  2GZW A;  1FC3 A;  4ENJ A;  1S8N A;  2DLL A;  1ZH5 A;  3I59 B;  4M9S A;  5HS8 A;  2EFN A;  4ZZL A;  4R1H A;  5L3E A;  3J7A O;  1S7A A;  1BJA A;  1IW7 F;  1SAX A;  2QWW A;  2NNY A;  4IXA A;  4U88 A;  4EVI A;  4FHT A;  1FP2 A;  5J6X A;  1ZYR F;  4IRG A;  3ZN0 A;  4G6Q A;  1OR7 A;  1JHF A;  5ICC A;  2ZNY A;  2UXX A;  3ISP A;  3ZMV A;  1FYM A;  2OZU A;  1D3Y A;  3I0T A;  3R6S A;  5H6R A;  4EMS A;  2ZXJ A;  1D8K A;  4Z2Y A;  4YFX F;  5ICF A;  4BXU A;  5ERI A;  4U0V A;  1BI3 A;  3DXJ F;  3CUQ B;  1J9I A;  2QZ8 A;  4LG0 A;  1ZGJ A;  5DUI A;  4WWC A;  1TW3 A;  2CO5 A;  2O0Y A;  4KIC A;  2UXN A;  2XAS A;  1LDJ A;  4P5O A;  5LRS A;  4I98 B;  4DQ2 A;  1KYZ A;  5DCM A;  3LAP A;  3JTH A;  1BIB A;  4RAY A;  2HS5 A;  3QU3 A;  2V1X A;  4EJU A;  3EET A;  5DDG A;  3LA7 A;  4MGR A;  2FRH A;  1H9T A;  3GWZ A;  3M1E A;  2H94 A;  2YR2 A;  5LBQ A;  3IWF A;  5HLI A;  1UB9 A;  2ZBK A;  4N9H A;  3LA3 A;  3NEU A;  1QBJ A;  4KIB A;  5DUK A;  2BGC A;  2DT5 A;  4EJO A;  1HST A;  3HRS A;  1FOK A;  2XUB A;  3KLO A;  3Q5F A;  5ILU A;  1XB4 A;  3C7J A;  4L5J A;  1KU3 A;  3H3U A;  3KP3 A;  1O3R A;  2ADU A;  3RJP A;  2K4B A;  2WC2 A;  4EM0 B;  1KU7 A;  4MQ9 F;  2EA4 A;  4PDK A;  5F1R A;  1HKS A;  3ROU A;  2OA4 A;  1UHM A;  3U2R A;  4LGW A;  1XGM A;  4O5V A;  1DP7 P;  1LB2 A;  1GXP A;  1D5V A;  2DI3 A;  3FX3 A;  4G9Y A;  2ISZ A;  1MGT A;  2GXG A;  2HFH A;  3ECH A;  1MJ9 A;  4F7Z A;  1KQ0 A;  2M8E A;  2OQR A;  2PI0 A;  2OD5 A;  3ZMS A;  3W6J B;  2BBY A;  2PLY A;  1ODD A;  4HQM A;  5DCM B;  2MH2 A;  1U78 A;  2FEZ A;  4D0P A;  5DV5 A;  1DUX C;  2IT0 A;  3KP7 A;  2D1H A;  2NNN A;  3HIF A;  2BYV E;  2DQL A;  3VB2 A;  1YLF A;  4IRH A;  1Y0U A;  3IKV A;  4ZYG A;  3P9C A;  1RI7 A;  3QAH A;  5LLQ A;  1IN5 A;  2OBP A;  3F8F A;  4HV5 A;  3CLO A;  2FML A;  3RKY A;  3HOT A;  3TKY A;  2RKH A;  2YSR A;  2DAO A;  3IC7 A;  1Z91 A;  1FSH A;  1PP8 F;  1XMK A;  3WTZ A;  1BBY A;  1WI9 A;  2DK5 A;  1HBX G;  2HGC A;  1R58 A;  1U8R A;  4ZZD A;  4I7H A;  3MCZ A;  1QZZ A;  4R79 A;  2XV4 S;  4HF1 A;  2PJP A;  3WGG A;  2FXA A;  5K5Q A;  2QEN A;  3JAM K;  1SD6 A;  3TO6 A;  4KN4 X;  1K6O A;  3TDU C;  1CGP A;  4A12 A;  3T1B A;  2W84 A;  3K1N A;  5AIQ A;  2JRT A;  1ZN2 A;  3QU6 A;  3F22 A;  4L9V A;  1SFU A;  1ZRD A;  1FWZ A;  2H09 A;  1DPU A;  3DP7 A;  4S05 A;  1PP7 U;  1ZLJ A;  1REP C;  2H6B A;  2VT3 A;  4HDU A;  2XHK A;  3HYI A;  2DO7 A;  1U5T C;  4A6E A;  5JHU A;  2HWV A;  1J59 A;  4K2E A;  3N97 A;  4CXF A;  3FWE A;  1S6L A;  1LQ1 A;  3NQO A;  2EFQ A;  3WTV C;  3T8T A;  2KRF A;  4GYI A;  1FP1 D;  3ZMD A;  2HOE A;  2JPC A;  2OQG A;  3CDH A;  3IRQ A;  1PDN C;  3DPT A;  4BYY A;  5ICE A;  2L02 A;  2YU3 A;  4HLY A;  3KFW X;  2VBZ A;  5LHI A;  2ZME A;  4MEX F;  2IW5 A;  4I01 A;  1BI2 A;  5FFZ A;  2FSW A;  2GA2 A;  2RDP A;  5BMZ A;  1OYW A;  3S2W A;  4QLC U;  1B9M A;  5BS6 A;  1O57 A;  3TQN A;  4L9J A;  1OKR A;  3CJN A;  1SMT A;  1G3W A;  2Z33 A;  4GXO A;  2O3F A;  1U5T B;  5D5W B;  4AD9 A;  2Q0O A;  1GXQ A;  2RGV A;  5DD8 A;  2NYX A;  1B9N A;  1Z05 A;  4P55 A;  4EJW A;  3IHU A;  3R61 A;  2IA1 A;  2LDU A;  3BP8 A;  3ZQ7 A;  4O3M A;  2RNJ A;  1SD5 A;  2VOD A;  2LSO A;  1K79 A;  1E17 A;  2XVC A;  2XGX A;  4BHP A;  2D45 A;  4ZYH A;  1C0W A;  2L01 A;  2FE3 A;  2FNA A;  5CVV A;  4WK8 F;  3REO A;  3KET A;  4ESJ A;  3LAJ A;  2L54 A;  4UVB A;  2ELH A;  1XSD A;  1MZB A;  2M30 A;  2JZY A;  3F6O A;  4A0Y A;  3WE3 A;  3E6D A;  1LVA A;  2QM3 A;  2Z9O A;  3F23 A;  3ERE D;  1UHW A;  5HVQ C;  1IXC A;  2PMH A;  3M9A A;  4UNO A;  1L0O C;  5A2Q Z;  4NQW A;  4LK1 F;  1LDD A;  4XSX F;  3HRM A;  3ULQ B;  2DQR A;  1F1Z A;  4BHB A;  3ZMZ A;  1IAW A;  4HF2 A;  2O8X A;  4AIJ A;  2Z99 A;  4UUV A;  1YW7 A;  2QYO A;  2VT2 A;  4RB2 C;  4LFU A;  2VBX A;  3B02 A;  2G9W A;  3O2P E;  1BIA A;  3OOP A;  2W85 A;  2PN6 A;  3MZY A;  3F8M A;  2Y48 A;  3VEP A;  5D6E A;  1FT9 A;  3GF2 A;  4BAY A;  5HLG A;  2VOP A;  4OOI A;  3GW2 A;  2QBY A;  1QNT A;  4M9X A;  3TO9 A;  1O7L A;  5FD5 A;  2CQK A;  4MNU A;  2V1D A;  3F8C A;  2A3S A;  3JAM Z;  2GXB A;  2ESN A;  2L3D A;  2H27 A;  1J7K A;  4L0Y B;  1YFH A;  1I27 A;  2FA5 A;  1IN7 A;  3RDI A;  4A6D A;  2XAG A;  3FMR A;  4G7Z F;  3QRF F;  2ZJ2 A;  5D4S A;  4FX0 A;  4L9N A;  2PMU A;  1WWX A;  1AWC A;  2E1C A;  2M45 A;  2YX7 A;  1Q1H A;  3Q9V A;  2VON A;  2EFO A;  2CW0 F;  4UXN A;  4AVP A;  4L18 B;  3BJ6 A;  2LNB A;  4M72 A;  4WF2 A;  4RB3 C;  3PQJ A;  2VXZ A;  3U9G A;  2P8T A;  1ZGA A;  1O3Q A;  4G6D A;  3K2Z A;  2QQB A;  4L9T A;  4H0E A;  1FBQ A;  1XCV A;  2YX4 A;  5EEH A;  3M8F A;  4HA8 A;  3V8L A;  1P2F A;  3K69 A;  3GFJ A;  3FXR A;  2DPU A;  3BJA A;  3MEX A;  3KCC A;  2QBY B;  4U0Y A;  4M6Y A;  2PQ8 A;  2RV8 A;  1XSX A;  1T98 A;  4L0Z B;  2F2E A;  2XAH A;  2FBK A;  2A5Y B;  4XSZ F;  3HRT A;  1TW2 A;  4QWQ A;  4E70 A;  4Q5S F;  5DEQ A;  5EEG A;  1O7F A;  1G4D A;  3VFZ A;  5D6F A;  4JQF A;  1KA8 A;  1W5S A;  2ACJ A;  1QZY A;  3KP4 A;  3SFZ A;  1ZAO A;  1HSJ A;  1FYL A;  4OIO F;  4YG2 F;  2K27 A;  3R60 A;  1BC7 C;  2KJC A;  1GVJ A;  1SFX A;  4ENN A;  4LB5 A;  3HHH A;  3TDZ C;  3VOD A;  5ICG A;  4HOB A;  1B1B A;  3I53 A;  3KLN A;  4HBL A;  5LEJ A;  5H6Q A;  1EH7 A;  3JSP A;  2W25 A;  2HDC A;  1CF7 A;  2JPB A;  3ZP5 A;  1BI0 A;  2A07 F;  3KZZ A;  1WSU A;  3DF8 A;  4PZJ A;  4OU0 A;  3V4G A;  5KK1 A;  3E97 A;  3CTA A;  1MD0 A;  5HS9 A;  3OV8 A;  2K02 A;  1T39 A;  6PAX A;  1FZP B;  3QOP A;  4U7B A;  1LNW A;  2P5L C;  1ZAR A;  5D4R A;  4EV0 A;  2R7D A;  3C18 A;  4KDP A;  4EQQ A;  1BOA A;  2IP2 A;  4HDV A;  1RUO A;  4LMY A;  1YQA A;  5LGT A;  4Y13 A;  2KIM A;  3PFI A;  2K4J A;  2R3S A;  1QGP A;  4XRF A;  5HOO A;  3QP5 A;  3G73 A;  1Z7U A;  5A2Q K;  3WE2 A;  1XDU A;  3IRR A;  2A6H F;  3HSR A;  4U0W A;  3KP2 A;  2RN7 A;  3V7C A;  4WXH A;  3P9I A;  3ZMU A;  3BPV A;  2G7H A;  2ZKZ A;  5E1Z B;  1XD7 A;  3HHG A;  5H20 A;  3WTW C;  2PFB A;  5J8C A;  4KMF A;  1ONV A;  2CSO A;  2RC4 A;  1MKM A;  3F21 A;  4KA4 A;  3FXQ A;  1U3E M;  2HYG D;  4HX4 A;  1DDN A;  2GQQ A;  1UFM A;  3DQV C;  5ILV A;  4P9U A;  4AIH A;  3P7N A;  3ECO A;  1KU9 A;  5BPI A;  5D5V B;  5FB2 A;  3LWF A;  1ON2 A;  5AON A;  1CF7 B;  2B0L A;  2FMY A;  3ZPL A;  3E5U A;  5CJ9 A;  1R7J A;  2YPR A;  2MLK A;  1TQP A;  2XIG A;  3EUH A;  2AXL A;  1O3S A;  1HKQ A;  3F6V A;  4BH9 A;  4M6X A;  2XRO A;  3T0Y A;  1U5T A;  5FFX A;  3WG9 A;  2IA0 A;  3L7W A;  1OYY A;  3ELK A;  4CGZ A;  1JGS A;  2W57 A;  3FM3 A;  2M87 A;  2XKO A;  2J5P A;  2CGP A;  2VN2 A;  3TGN A;  2NS0 A;  3U1D A;  2HTS A;  1XN7 A;  2EFP A;  4HLX A;  1G3T A;  4KMU X;  2F5D A;  3JSO A;  1RNL A;  4UHT A;  2IVM A;  4YIF A;  4RAZ A;  1HXD A;  1BI1 A;  2VE9 A;  4CZZ A;  5HDK A;  2FBI A;  4HZF A;  3HRU A;  4P96 A;  3GEZ A;  3EYI A;  2KJB A;  1W5T A;  1Z6R A;  3GZ5 A;  3E6C C;  2QLZ A;  1V3F A;  1STZ A;  1FY7 A;  2QVO A;  2L4A A;  1KQ9 A;  1ZHF A;  4BHC A;  2R7F A;  2P4W A;  2GA1 A;  4KIF A;  1P4A A;  1XSV A;  4Q48 A;  2A69 F;  4G8X A;  3BRO A;  1K7A A;  3HTU A;  1YW9 A;  3MWM A;  1DPR A;  3IKT A;  3WTU C;  1W4M A;  1G6N A;  1TQI A;  4B09 A;  2IPQ X;  5IT3 A;  5L3D A;  4WX9 A;  1ZLK A;  1SMY F;  3LA2 A;  2CFX A;  5BPD A;  5K5R A;  1USS A;  1B59 A;  4A2U A;  4GCV A;  3L2C A;  2DBB A;  3I71 A;  4FT8 A;  4N0B A;  3LQR A;  2EV5 A;  1ULY A;  3V7R A;  3WTY C;  1FPQ A;  1ZRE A;  4WCG A;  3ABT A;  4WXD A;  5JFR A;  2VBW A;  2FBH A;  5HDG A;  2ZO4 A;  2DU9 A;  2JT1 A;  3SZT A;  1ZG5 A;  4ZYE A;  1FX7 A;  5J8F A;  2EV0 A;  4KNY A;  1JXS A;  3HOS A;  2FNP A;  4JK1 X;  5L3B A;  3MQ0 A;  4IRI A;  2W24 A;  1HW5 A;  4PGH A;  1AOY A;  1OYI A;  3T8R A;  4YFK F;  1MDM A;  3BPX A;  1SD4 A;  3R0A A;  4Q4Z F;  4TV7 A;  3LST A;  3E3V A;  2QQ9 A;  2P7C B;  4OIQ F;  2HQR A;  5D5X B;  5F6F A;  3BWG A;  2EJR A;  3RPQ A;  2PEX A;  3FF5 A;  1XGS A;  1T2K A;  1IUY A;  4A0Z A;  3TOA A;  5TRD A;  4HF0 A;  1W7P D;  4I2O A;  2VC0 A;  2J5O A;  1TTY A;  4XBF A;  4OIN F;  3RKW A;  2LF8 A;  2X0L A;  3BZ6 A;  3SQN A;  1S29 A;  3DPL C;  1FNN A;  3I5U A;  2GAU A;  1J2X A;  5D5U B;  4ON0 A;  1YG2 A;  3BJO A;  1X3U A;  1OMI A;  3EQL F;  2VBY A;  3LQQ A;  2HKO A;  2DTR A;  2MC3 A;  4ENK A;  1BC8 C;  1R1V A;  1I6X A;  4M73 A;  4KT5 C;  1G3Y A;  1KYW A;  2KKO A;  3B73 A;  3WTX C;  3RIR A;  4NHJ A;  3F72 A;  1D8J A;  1XGN A;  2HYF A;  2ZFW A;  4EGY A;  1YS6 A;  4M71 A;  4OMZ A;  1LEA A;  3HTS B;  5E20 A;  3TOB A;  2NAZ A;  4I0A A;  4ENM A;  1IXS B;  3O3K A;  3VOE A;  5DCF A;  2Q8K A;  4RGX A;  3KE2 A;  3LFK A;  3GZ6 A;  1MDM B;  3WGH A;  5FO5 A;  4G7O F;  2IJL A;  5IT9 Z;  2VE8 A;  1V4R A;  3FHZ A;  3RYR A;  3NRV A;  1J0R A;  2P6S A;  3GO5 A;  5LHH A;  2F5C A;  3BDD A;  4UVC A;  4N9I A;  1EH8 A;  1JE8 A;  2BE5 F;  4IHS A;  4RB1 A;  4L5I A;  3D0S A;  1IRG A;  5L3F A;  1R1U A;  1W7P A;  2HR3 A;  4EM2 A;  2CYY A;  3KZY A;  3GYH X;  2IA2 A;  4YII A;  2ISY A;  1B4A A;  1R5G A;  4ESB A;  2ESH A;  2E7X A;  5D8K B;  4HX7 A;  5BOX A;  2E1N A;  1E2X A;  1YIO A;  4LLN A;  1J75 A;  3GX4 X;  1RUN A;  5CVI A;  2V9V A;  1FLI A;  3GFL A;  2A6E F;  1XDS A;  1T0F A;  2Z5U A;  4GYG A;  3GFM A;  1FSE A;  3GFI A;  3MFK A;  1P6R A;  1QPM A;  4MTE A;  3DFG A;  1IN8 A;  4DNC A;  3PQK A;  5BQT A;  3JTG A;  1UCR A;  5E1X A;  1ZG1 A;  2DW4 A;  1R5H A;  3MAJ A;  2DK8 A;  3DV8 A;  3J80 Z;  2UZK A;  4IVN A;  4RGR A;  1B6A A;  5JVT A;  4OIR F;  3GXO A;  1KQ8 A;  1HKT A;  1RIO H;  5AIP A;  1O3T A;  2HKX A;  2X4H A;  3L00 A;  3WGI A;  5KVR A;  3F8N A;  1P92 A;  2HTJ A;  1WRJ A;  3F3X A;  3RYP A;  3Q9S A;  1U2W A;  4AWX B;  5FLX Z;  3I58 A;  2XRN A;  5CVR A;  3KP5 A;  5TJJ A;  2WV0 A;  5FD6 A;  3V8J A;  1W7P B;  4PCQ A;  2COM A;  1LEB A;  5E8G A;  4HW0 A;  4PGG A;  2DFI A;  2CG4 A;  3L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...