3WU0A

Crystal structure of phosphorylated ets-1 dna binding and autoinhibitory domains (276-441)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein C-ets-1
total genus 45
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu0A00
3WTWC 4Q4ZF 4GYGA 2Z3YA 1CGPA 4AWXB 2WWYA 1O3RA 4XBFA 2RVCA 5H20A 3O2PE 1LEAA 2EJRA 5HDKA 1B4AA 3W6KB 1UHMA 2OA4A 3H92A 5FFZA 4OMYA 2MA3A 3F8BA 2KJBA 5LEJA 3BJAA 3Q9SA 2CG4A 3HSFA 1ZLJA 3HTUA 2HWVA 5HLGA 4ESBA 4KNYA 3R61A 1J0RA 4EV0A 2RNJA 3ZMSA 3E6CC 1W7PA 1J2XA 2QENA 1R5GA 2UZKA 1HW2A 3KP5A 4M9SA 3WGHA 3F22A 4MHGA 3IWZA 3R0JA 5LHHA 3J81Z 3TDUC 4ZYEA 3TOBA 4ETSA 2IPQX 2QBYB 2J5PA 5DD4A 1XN7A 2ZNYA 2EA4A 4NB5A 4A0YA 5CLSA 3DF8A 1HKQA 4HW0A 4M9XA 1U8RA 4HX8A 5DV5A 3LAJA 1BI0A 4MQ9F 1ZG5A 1TW2A 1J7KA 3L9FA 1R1UA 5BQTA 3HSRA 2J5OA 3H3UA 4U0VA 2COMA 3DV8A 4QLCU 2P6SA 1BI3A 1FY7A 1QO0D 3DQVC 2MC3A 1T2KA 2VBXA 4G7OF 2D1HA 2Z99A 5CJ9A 2K4BA 2ZCWA 1WQ2A 5CVIA 3J80Z 1T6SA 3O6BB 2QQBA 3GFMA 4KIGA 2EV0A 3T5XA 1WWXA 1D5VA 1MDMA 4IRIA 2HTJA 5DCMB 1C0WA 2O61A 3JAMK 3I71A 4G94A 4M9ZA 1BC7C 3M8FA 3BPXA 3NQOA 2FBKA 2AXLA 4HQEA 1LNWA 1IXCA 2M45A 3VODA 1H9GA 5LLQA 3E97A 3KP4A 2AS5F 3ZMZA 2LF8A 2FA5A 3ROUA 3CJNA 1I1SA 5HDNA 2CFXA 5LEKA 1B6AA 4A0ZA 2PEXA 4ZZDA 5FGMA 4MTEA 2HR3A 3RTRA 3GFJA 2GZWA 4EM2A 1BM9A 3BJOA 4BHPA 3BDDA 2Z33A 3LAPA 1MKMA 5FD6A 2STWA 2BGCA 5KK1A 2FBIA 2A61A 1RNLA 2UXNA 3RI4A 1KU3A 4LG0B 1YW8A 2MH9A 1FLIA 3WGIA 1KQ0A 4EJVA 2DK8A 2MLKA 2FMYA 3L2CA 3IRQA 2VE8A 3GLXA 4BHBA 5DCFA 4HLXA 5K5RA 4YFNF 1BI2A 3E5XA 4HDVA 1BBYA 2F2EA 3F8FA 4IHTA 1W5SA 1FSHA 2KJCA 1CF7A 2XAQA 2HQNA 1YLFA 2D1VA 2KIFA 1YG2A 3IWFA 4YIIA 1Z05A 4KYWA 5ILVA 4HLYA 1ON1A 2EWNA 2XAJA 2P7CB 4LLLA 2O03A 1IXSB 3K0LA 3OV8A 3KP7A 2EA2A 3QP5A 3C18A 1SD6A 5L3GA 1P4WA 3V7RA 1G6NA 4N9IA 4UV8A 1YW9A 4PCQA 2MH2A 3J7AO 4F7ZA 2DU9A 4A12A 1TW3A 4A5NA 1XSDA 1LVAA 1SMTA 2JT1A 2A69F 4PDKA 3U1DA 4YFKF 5DCMA 1BOAA 2OAZA 2QVOA 2Z5UA 2ZMEB 1ZLKA 2E7XA 5CVUA 2ZKZA 4FHTA 5JHUA 1REPC 1FOKA 1YFHA 1KU9A 1SFXA 3BWGA 2ELHA 4CZZA 1OR7A 5FB2A 5J8FA 3I5UA 3V8LA 2NS0A 1KYWA 3LA7A 2O8XA 1IN4A 5JI6A 2V1UA 2VN2A 3QAHA 5DDGA 5LHGA 2D45A 1FBUA 3HTSB 3F72A 3K2ZA 2IRFG 5F1RA 4JQFA 4R8HA 4UXNA 4I0AA 5LGTA 4WXHA 5D6FA 3B73A 2V6CA 2ZJ2A 1FP2A 2L54A 1J9IA 3DPTA 4WF2A 1S29A 1SD5A 1YO5C 2OBPA 1U5TA 2F5DA 1PUEE 3J80K 2KKOA 1XMAA 4LGWA 1WI9A 3E6BA 3GO5A 2PN6A 3K9TA 4YIFA 1W4MA 5JR3A 4BNCA 3ZPLA 3P9IA 3I0TA 2NAZA 3CTAA 1IF1A 2W84A 1BC8C 4GO1A 3F8MA 2KRFA 2VXZA 4RAZA 1ZRCA 1W7PB 3N97A 3BP8A 2ESHA 3E6DA 3RYPA 1YYVA 3MEXA 3GUDA 4ENNA 2PFBA 1KA8A 2CQKA 3PQKA 4IVNA 1LDJA 1R00A 1P92A 3RIRA 3HRSA 2M5WA 1VTNC 1YS6A 2OZ6A 1R5HA 3JSOA 4JK1X 2A6EF 4LD5A 1S6LA 4LLGF 2VOOA 4B8XA 2XVCA 1EH7A 3CUQB 1MGTA 4OIQF 4UV9A 1HKTA 4HV5A 3ZMUA 3EYYA 1P6RA 3EYIA 3G73A 1E17A 2F5EA 4EM0B 3ABUA 3V7SA 4OMZA 1ZGAA 5K5QA 2M8EA 4JBAA 4HBLA 3DEUA 3SQNA 3QU3A 1ULYA 3FMSA 4BH9A 4RGUA 2YSRA 3P7NA 3HOTA 2BE5F 3KE2A 4GGGA 3BJ6A 2HKOA 5AIPA 1IN6A 2EV5A 2YPRA 4RGSA 3RDIA 3VB2A 3F23A 2XASA 5HLIA 2ADUA 3GEZA 5ICFA 2HGCA 2DPUA 2GWRA 2LKPA 2D2WA 3ISPA 5FLXZ 4CHUA 4I7HA 3C1DA 2Q8KA 5D5XB 2DPDA 3WTZA 3QPHA 2XIGA 4HX4A 5D6EA 3N4MA 4RB2C 4IRHA 3CLOA 2PMUA 4KA4A 1OPCA 2A3SA 3RKXA 1MJ9A 4MEYF 4MTDA 1RZ4A 1FYLA 5K1YA 4KDPA 2P8TA 4PGGA 2YX7A 1XGNA 1YW7A 4XLNF 1ZN2A 2W57A 3KCCA 5L3EA 3QP6A 1U5TB 3V4GA 1U3EM 2FNPA 3EQLF 1FC3A 1I6XA 3V8KA 2NNYA 2W25A 5L3FA 1K7AA 1A04A 3O3KA 1YS7A 3IL2A 3BOQA 2DBBA 4BAYA 1TNSA 4FX0A 5ED4A 1T98A 1RUNA 3F8NA 4AIHA 1HSJA 4H0EA 3WU1B 4L5JA 4HX7A 3JAMZ 1ZHFA 2LNBA 3BPVA 4D0PA 2UWMA 5CYVA 3F8CA 3TO6A 2H94A 4KIBA 3B02A 4G8XA 3SFZA 5DD8A 4O6JA 5J8CA 3DFGA 3IC7A 4GXOA 2QLZA 1O3SA 4HV6A 4EVIA 4FT8A 3JTGA 2DFIA 4BYYA 4IJAA 5KVRA 2XV4S 2RN7A 5A2QZ 1OMIA 2LSOA 3KP3A 4RGRA 1K6OA 1U2WA 1TQMA 3FM5A 2O3FA 2OZUA 3E5QA 2OQRA 3MWMA 3RPQA 3Q9VA 1R1VA 2R7DA 4Q48A 1GXPA 1DPRA 2RC4A 2FU4A 2OU2A 1V3FA 1F1ZA 4HZFA 5CVRA 2M1BA 5L3CA 2L3DA 4ZYDA 1USTA 3ELKA 3I64A 3KLOA 2XUBA 2PI0A 4R1HA 4M6XA 3FXRA 2PQ8A 3NEUA 1ZG3A 2DLLA 1OYWA 5ICGA 2QBYA 3ZMTA 4EM1A 4K2EA 1JHFA 1MZBA 1HKSA 3HSEA 5CVJA 1OYYA 2PLYA 5AIQA 1WKMA 5H6QA 3D0SA 4IRGA 4L0YB 1BJAA 1PP8F 1P2FA 2BEOA 5E1WA 3SXYA 3LQQA 2ISYA 1ZARA 1GVJA 4ZYHA 1OYIA 1HSTA 2A68F 1ZREA 1XB4A 3FM3A 1Z91A 5F6FA 2XROA 1FNNA 2QUFA 1RI7A 2YX4A 3WTTC 5ILSA 2HYGD 1SFEA 1U78A 2ACJA 2FOKA 5D4RA 3QPTA 4RB1A 1SAXA 3FZVA 4LK0F 4OU0A 5E17F 5ILUA 3K69A 2FSWA 2HOEA 4EGYA 2HZTA 1SMYF 1LB2A 3CUQC 5DYMA 3GFLA 1W5TA 2P6TA 3E5UA 2VBYA 1ZRDA 1FYMA 3HRUA 3CDHA 1FBQA 1QGPA 2XAHA 4UUVA 4A5MA 1TQIA 1V4RA 2EFQA 2CW0F 2V79A 2ZO4A 2JPBA 2HYFA 2VBWA 4HA8A 3TDZC 1RUOA 3ZN1A 2FE3A 3VEPA 1KQ8A 2JZYA 1G3TA 2O6GE 5ICCA 4L0ZB 2FNAA 2W24A 1U6GA 1JHHA 3LSTA 4R79A 1XDUA 2X4HA 3TO7A 2FEZA 4UHTA 4CICA 3GXOA 5BMZA 2NYXA 3FX3A 3MZHA 1Z6RA 3WTVC 4EJOA 2ZNZA 1R36A 2G7HA 1LDKB 3JW4A 2IP2A 3BZ6A 2G9WA 3GWZA 3Q5FA 3HOSA 2EB7A 2EFNA 1XDSA 3W6JB 4BQAA 2M30A 2L4MA 1ONVA 2JPCA 1O3QA 2H09A 4I98B 2ETHA 1SFUA 3MQ0A 4KIFA 5HS9A 1FYKA 1IN8A 1ZGJA 2M87A 4DNCA 4P9UA 1LEBA 1LJ9A 1O7LA 4I01A 4HF0A 2K02A 2LF7A 1HW5A 5D4SA 3WE2A 1UFMA 1SD7A 3L09A 5CVVA 1O7FA 4PGHA 3T0YA 1STZA 2RDPA 3WODF 2K86A 3KP6A 5HVQC 4RGXA 3ZQ7A 4WX9A 2BBYA 2JTVA 1J59A 1K78A 4Q47A 2FRHA 4RAYA 3ECOA 3OOPA 2GQQA 4RB3C 2L02A 1PP7U 1HQCA 1FX7A 4XRFA 1S7OA 1S3JA 2H6BA 3FXQA 3ABTA 1USSA 4Q5SF 1J75A 1IAWA 1Z1DA 4G9YA 3BY6A 1H0MA 1JGSA 1B1BA 4EJUA 4ZZLA 1EH8A 2ZMEA 1MJBA 3BROA 2QQAA 1XGMA 1I5ZA 4WXCA 2STTA 1FBSA 1I27A 2QQ9A 5K5OA 5LRRA 4ASNA 2IA2A 2RKHA 1KU2A 4A2UA 1OKRA 2A6HF 4WXDA 2GIVA 4DQ2A 1S7AA 1E2XA 4AD9A 4LJZF 1D3YA 2YR2A 2K7LA 3PFIA 3AAFA 2DO7A 4UVAA 3E3VA 2HDCA 4RS8A 4A0XA 4AIJA 2VOPA 2ZBKA 1ZAOA 2GA2A 3GYHX 5E1XA 2K4JA 3I59A 4XLPF 3TOAA 4LB5A 5E1ZB 2CO5A 4TV7A 1FPQA 4E70A 4WWCA 2B0LA 2CGPA 3KLNA 3GX4X 3LA3A 3KZZA 5BPIA 4ZYGA 2QM3A 2Y48A 2VBZA 4NQWA 2PBIA 5LRSA 3T1BA 4OOIA 1BI1A 3QOPA 5BPDA 4B09A 1KU7A 2XHKA 4FX4A 1DP7P 1WRJA 2VE9A 3HRTA 4WK8F 2IT0A 2IA0A 1Z6TA 1W7PD 3GZ5A 4EMSA 3TKYA 1YQAA 3S2WA 2CWEA 3WU0A 1LQ1A 2FF4A 1B59A 5A2QK 1EH6A 1IN7A 4BHCA 2F5CA 1P4AA 4PZJA 2EFWA 4ESFA 3MZYA 3FMQA 1QNTA 4KN4X 4IHSA 1IN5A 1AWCA 4Y17A 3F3XA 4YFXF 4ENMA 3SZPA 2E7WA 2H27A 4I09A 4A6EA 3FWEA 3IKVA 5L3DA 1D8KA 1XCVA 3GW2A 4ENKA 4EQQA 3CO7C 3L7WA 4HYEA 1QQIA 5HS8A 3VFZA 1BIAA 4LMYA 3ULQB 1KYZA 3H3ZA 2F5FA 1NHAA 5LGUA 2RQPA 2ISZA 5EEGA 3M9AA 4CO8A 2JRTA 4G6QA 1H9TA 4P5OA 1BN5A 3LFKA 4OINF 1G4DA 3HYIA 1QBJA 3HRMA 4WCGA 3I58A 4BXUA 3LWFA 1K78B 4P55A 2DQLA 1KGSA 2A07F 4L9VA 3T8TA 2XKPA 5J6XA 1HW1A 1MD0A 5E18F 4KT5C 3KFWX 5IT3A 4KUMA 5D5VB 1Z9CA 1JE8A 3K1MA 4Y13A 3WG9A 2KIUA 4S04A 2P5LC 4IXAA 3FF5A 4Y15A 2YU3A 4G7HF 4QWQA 5DEQA 2GXGA 3D5LA 5TRDA 3ZP5A 1HBXG 3DXJF 3EUHA 2IW5A 4I0BA 3WTYC 4M71A 5IT9K 2GA1A 3ERED 1O3TA 2EFOA 4U0WA 2VODA 3COAC 2FXAA 1MJAA 3V8JA 2VT3A 4U88A 3T8RA 3I59B 1G3YA 4P9FA 4U0YA 2FBHA 2RGVA 4KMFA 2MBFA 4M72A 4AIKA 5E8IA 3RPUA 5JVTA 2XRNA 2L01A 4EJTA 3I53A 5LBQA 2DAOA 2Y0MA 4M73A 4AVPA 2C6YA 3KP2A 1DUXC 1R7JA 2BYVE 3KEOA 4HAMA 4CGZA 4O5VA 1X3UA 3TO9A 4Z2YA 1BIBA 2CYYA 4KFCA 2V9VA 4HF2A 3TQNA 2P5KA 4OIPF 5HS7A 4ENJA 4LK1F 1FWZA 2XAFA 4G6DA 4KN7X 5L3BA 3FMRA 5HDGA 3IRRA 2VT2A 1TTYA 3MCZA 2PMHA 2V1XA 5F64A 3JSPA 5DUIA 1K79A 4OIRF 3DPLC 3ZMVA 1QZYA 3HIFA 1I1GA 5E20A 4EJWA 1DPUA 2HEOA 4L18B 1UB9A 1XMKA 2ESNA 2XKOA 3QU6A 4I02A 1F4KA 3U2RA 2LDUA 2Z9OA 2QYOA 4MGRA 3GVAA 1XGOA 2VONA 2RV8A 2BV6A 3P9CA 3WTUC 2IVMA 1Y0UA 4L9TA 2UXXA 1QPMA 4O3MA 2PG4A 3FHZA 4ESJA 1S8NA 2P4WA 2R3SA 1KQ9A 2L4AA 4UVBA 2XGXA 1B9MA 4YG2F 1B9NA 4CXFA 3WTSC 1TNTA 1IUYA 2CSOA 1DDNA 1G3WA 5JFRA 3I54A 3LQRA 1FSEA 4GYIA 3K1NA 4OIOF 3M8EA 1FZPB 1UHWA 1YIOA 5FD5A 1SD4A 2P7VB 3GF2A 4S05A 1R22A 4LG0A 1PDNC 3HHGA 3F6VA 4XSXF 2H6CA 1IRFA 1R23A 2Q0OA 1ZRFA 3REOA 1RIOH 2E1NA 4N9HA 2QZ8A 2P5VA 5HLHA 6PAXA 4EGZA 3CO6C 4UVCA 2DK5A 1IRGA 2IA1A 3TGNA 2A5YB 3G3ZA 1L3LA 1T0FA 5D8LB 5IT9Z 1ZG1A 4N0BA 5D8KB 4KMUX 2NRAC 2OQGA 1L0OC 1XCBA 5LHIA 5BS6A 3QRFF 4G7ZF 3RYRA 2DT5A 4MQVA 1JXSA 4NHJA 3SZTA 2HQRA 1D8JA 5D5UB 3DKWA 1ODDA 1P4XA 2OD5A 3PQJA 2PJPA 4MEXF 4I2OA 1XD7A 2EFPA 3VOEA 3R60A 1IW7F 1R1TA 2KIMA 4HOBA 2JSCA 3RJPA 3ZN0A 2Q2EA 4UNOA 4GCVA 3SHFA 2ZXJA 1GHCA 2R7FA 3P9KA 4L9NA 3ECHA 3CUQA 2FQ3A 1ZYRF 5FO5A 2WC2A 1WSUA 5LGNA 3JTHA 1F5TA 4LFUA 2GAUA 1MDMB 1XSXA 1GXQA 2QWWA 2W85A 2WTEA 4MNUA 4LLNA 1U5TC 2HS5A 2DW4A 2MLGA 3R0AA 5BOXA 1TQPA 2NNNA 5FFXA 3WE3A 1TBXA 5E8GA 1XGSA 1CF7B 4P96A 2MD5A 3C7JA 2X0LA 2HFHA 1EV7A 2G7UA 3IKTA 4ZH4F 5AONA 3C3WA 5TJJA 3WTXC 2DTRA 4XSZF 3F21A 2Y75A 1T39A 1O57A 3MAJA 4L9JA 3F6OA 3R6SA 3FXUA 1IXRC 2E1CA 2WV0A 1ZH5A 3EETA 4CDGA 3CUOA 5DUKA 3RKWA 2DQRA 3L00A 3WGGA 3I4PA 3RKYA 3E6MA 1YTYA 1F9NA 1FP1D 3M7GA 5HOOA 3GZ6A 2VC0A 4L5IA 5ICEA 3LA2A 1J5YA 2O0YA 4LB6B 3DP7A 4ON0A 1QZZA 2HTSA 5EEHA 5D5WB 2TDXA 2ZFWA 1UCRA 1TLHB 3HUGA 3R4KA 4A6DA 1T38A 4HDUA 3GFIA 4M74A 5ERIA 2FMLA 1Z7UA 3HHHA 2HKXA 4M6YA 1AOYA 4IPAA 1FT9A 2K27A 3V7CA 3MFKA 3NRVA 1LDDA 4KICA 4U7DA 4U7BA 1XSVA 1ON2A 5H6RA 3KZYA 4RB0A 3KETA 2EK5A 3U9GA 2XAGA 3IHUA 3EDPA 1HXDA 4HQMA 4IF4A 3ZMDA 3KEQA 2V1DA 4CYDA 2DI3A 2EV6A 1G3SA 2GXBA 5FLXK 1IZ1A 3K1PA 3J81K 2IJLA 2VC1A 4HF1A 3M1EA 1Q1HA 3ML6A 1R58A
chains in the Genus database with same CATH superfamily
3ABMH 3GBGA 3WTWC 4Q4ZF 2DFFA 5KNLA 4GYGA 4A3FJ 1ETYA 1T56A 2Z3YA 1CGPA 3F9KA 1T8IA 4AWXB 2WWYA 3A03A 1O3RA 2NVXJ 2QKMB 4XBFA 1HA8A 2RVCA 5H20A 3O2PE 2IGKA 3Q3SA 2HOSA 1LEAA 1YOVB 2EJRA 5HDKA 2XF5A 4ABZA 1B4AA 1OLTA 3PO2J 2EZHA 3W6KB 1UHMA 2OA4A 2M4KA 2LLKA 3H92A 5FFZA 3JRBA 2JA5J 2KLOA 4OMYA 3CF2A 2MA3A 3F8BA 1QHHD 2KJBA 3OOUA 4AUXA 3BG7A 4RLFA 5IOYA 4Y4RA 1A31A 1HDDC 5LEJA 5C44J 1D0ZA 2CUEA 3BJAA 3Q9SA 2CG4A 3HSFA 1ZLJA 3HTUA 2HWVA 5HLGA 4ESBA 4KNYA 3R61A 1J0RA 4BJTA 2OF7A 4EV0A 2RNJA 1GV2A 3ZMSA 5FKNA 3E6CC 1W7PA 1J2XA 3TEDA 2QENA 1R5GA 2UZKA 1HW2A 1ETOA 3KP5A 4M9SA 2DOFA 3WGHA 4MHGA 3F22A 3HM5A 1H88C 2VQGA 4DYRA 3K4MA 4I99C 3IWZA 3R0JA 5LHHA 3J81Z 3TDUC 4ZYEA 3TOBA 4ETSA 2LH9A 2IPQX 1VQ9I 2QBYB 1X1BA 2J5PA 3LL7A 1HF0A 3TW7A 5DD4A 2VKEA 1XN7A 2ME0A 2UUZA 1R4MB 2H1KA 2ZNYA 4A3MJ 2MGQA 1P9QC 2EA4A 2W1OA 1IGNA 4NB5A 4CSWA 4A0YA 3J7YJ 5CLSA 3I3LA 2VKHA 3DF8A 5K7ZA 1N77A 1HKQA 4HW0A 4M9XA 2WB1N 1U8RA 3AG3H 3HOWJ 4HSTA 3NAUA 3FKIJ 1P7JA 4HX8A 3DTIA 5DV5A 3A1YA 2CQQA 3LAJA 1BI0A 4MQ9F 3CCLI 1TL8A 5EF6A 1ZG5A 1TW2A 1J7KA 3L9FA 1R1UA 5BQTA 2Q1ZB 3HSRA 1JI8A 2CU7A 2J5OA 3H3UA 3UNGC 4U0VA 2COMA 3DV8A 3KX2A 3WG7H 5F0HA 4BXFA 4QLCU 2P6SA 1BI3A 1FY7A 1QO0D 3DQVC 1HCRA 4II2A 1FIAA 2MC3A 1T2KA 2VBXA 4G7OF 2A05A 2E35A 2D1HA 4C30A 3K4KA 1K83J 5J40A 2Z99A 5CJ9A 5DM6F 1B8IB 3H36A 2K4BA 2ZCWA 4M6VA 1BW5A 1WQ2A 3OR2C 5CVIA 4F52A 1RC9A 2Q2EB 3J80Z 2BY2A 1T6SA 4V2FA 2HZDA 3O6BB 4AU7A 2QQBA 3GFMA 3S1RJ 3GLLA 4KIGA 1WJBA 2JJ7A 2EV0A 3OYHA 2LKSA 2VB6A 4UB6C 3T5XA 1WWXA 1D5VA 1MDMA 4IRIA 3S2HJ 2HQAA 2HTJA 4HRIA 1VZ0A 5DCMB 2NXNB 2F4MB 1C0WA 1VQ7I 2VQCA 2O61A 3MKZA 1VQMI 2ZSHB 4BJ6C 3JAMK 4UB8C 1A35A 3I71A 4G94A 3VDXA 4ZDPA 3QQAA 1NG6A 1CQTA 4M9ZA 1BC7C 2DN0A 3M8FA 3C2GA 3FK6A 3MVPA 4F92B 1N25A 5LFAA 1IRXA 3BR6A 3BPXA 3NQOA 4G12A 1WH7A 2FBKA 2AXLA 2AQFA 4HQEA 4IEJA 1LNWA 1IXCA 2M45A 3VODA 1H9GA 5LLQA 1YITI 3E97A 3QYEA 4HEA2 3KP4A 2AS5F 3ZMZA 2LF8A 2FA5A 3ROUA 2OTLI 3K70D 3CJNA 2XC7A 2BW3B 5HDNA 1I1SA 3RZDJ 3BR0A 5FROA 5E3OA 2CFXA 5LEKA 1B6AA 4A0ZA 1JJ8C 2PEXA 2V7FA 2KDZA 1UG2A 4ZZDA 5FGMA 4MTEA 2HR3A 3JRCA 3RTRA 3DKXA 4X6AJ 3GFJA 5GADJ 2GZWA 1RESA 3B6AA 3JRGA 4EM2A 1BM9A 3H35A 1W1WE 3BJOA 4BHPA 3BDDA 2Z33A 5EZGA 3S32A 3LAPA 1MKMA 5FD6A 2HXIA 4IO9F 1GLNA 4MFDA 2X1CA 3EPZA 2STWA 4IQJA 2BGCA 5KK1A 2FQ4A 4HSRA 2FBIA 3OIPA 3J7ZI 1Y1VJ 2A61A 4HG2A 5GTIC 1RNLA 4BJ5C 2B63J 3AG2H 1PYVA 2R5ZB 2DMNA 2LTPA 2UXNA 3RSNA 3RI4A 1KU3A 2LC2A 4LG0B 2GM4A 4UY8I 4RDUA 3U1KA 1Y56A 1YW8A 2MH9A 4C9YA 1FLIA 2E36A 1U0JA 3WHBA 3WGIA 1KQ0A 4EJVA 3MMYB 2DK8A 4I76A 1UMQA 2MLKA 4ZDLA 1WCMJ 1Y8RB 2FMYA 3FK7A 3IRQA 1D1AA 1M1EB 2VE8A 3L2CA 3GLXA 4BHBA 2M7AA 5DCFA 4HLXA 4BQOA 2GIZA 2M2EA 5K5RA 3DU5A 4II3A 1UG0A 4YFNF 1BI2A 2DCEA 4X0GA 1MMNA 3E5XA 4HDVA 1BBYA 1F43A 2F2EA 3F8FA 4IHTA 1W5SA 4DW6A 1FSHA 2KJCA 1Z0XA 1CF7A 2XAQA 1X19A 4AIDA 2HQNA 1YLFA 2V26A 2WY7Q 2D1VA 2KIFA 1YG2A 3IWFA 1HDPA 4IX7A 2D5VA 4QPQA 2FOWA 4YIIA 1I3AA 4PJNA 1AU7A 1Z05A 4A3CJ 2M3AA 2PMZA 1QHGA 4KYWA 2EILH 5ILVA 4HLYA 5GPAA 2X1DA 2BY0A 2IS1A 1ON1A 2DDAA 2EWNA 1S72I 1YJWI 1EF4A 2NVQJ 1NTCA 2XAJA 1JKPC 2P7CB 4LLLA 1D1CA 2O03A 1IXSB 3FXKA 2DJNA 3K0LA 1FMWA 3OV8A 3KP7A 2EA2A 2Y30A 2HU9A 3QP5A 5IY5H 1UHSA 3C18A 1SD6A 5L3GA 1OR7C 1P4WA 3V7RA 4C2MJ 1G6NA 4N9IA 2AO9A 4UV8A 3OS0A 1YW9A 4PCQA 2MH2A 1W36C 3J7AO 3S1MJ 1RRJA 4F7ZA 4BQQA 4XM3A 3VYTB 1GDTA 2JA8J 1A6IA 2X6WA 2DU9A 4A12A 5J1RA 3L2QA 2LD5A 1TW3A 3DEWA 4A5NA 2E60A 4CCLA 1XSDA 1LVAA 3BLYA 1SMTA 1N75A 2BVMA 2JT1A 2A69F 3K7AJ 4PDKA 3U1DA 5DCMA 4YFKF 3IH2A 1BOAA 2CW8A 2OAZA 2QVOA 2Z5UA 2ZMEB 4GRIA 4XKCA 1ZLKA 2E7XA 4XLAA 5CVUA 1VQ8I 4JX4A 2ZKZA 2ID3A 4FHTA 5JHUA 1REPC 1FOKA 4IHXA 1YFHA 1KU9A 1SFXA 1ZR2A 3BWGA 2ELHA 5FJ8J 4CZZA 3MZ8A 1OCCH 3HG9A 1HLVA 1OR7A 3PNVA 5FB2A 5J8FA 3I5UA 2F4OB 2DFHA 3IH3A 3V8LA 1YRNB 2NS0A 1KYWA 3LA7A 2O8XA 2XPVA 1UZCA 1IN4A 1ZK8A 5JI6A 4M3DA 1E3OC 1N78A 3AKZA 2V1UA 2VN2A 4X1EA 5JLWA 1RETA 3QAHA 2K3FA 4XL9A 1BR4A 1FMVA 2R7TA 1T95A 4XK4A 2WAEA 4XLCA 5DDGA 5LHGA 3JRAA 2L0KA 4Y33A 2D45A 1V55H 1R6RA 4LIVA 1FBUA 3NWTA 3HTSB 1X2MA 1D1BA 2KP6A 3LSJA 3F72A 5KCMA 1X3ZB 3HGGA 3CLQA 2X9DA 3G6EI 3K2ZA 3OIOA 2IRFG 1A6QA 2L7ZA 5F1RA 4JQFA 4R8HA 2XB5A 2XGEA 4UXNA 3SEQA 2LVSA 4I0AA 5F0CA 5LGTA 4WXHA 5D6FA 3B73A 2JN6A 2V6CA 5EZHA 2HDWA 2ZJ2A 3CP8A 1FP2A 4C3JJ 2DT7B 2DJIA 2L54A 1OCPA 1SVLA 1J9IA 3X2QH 3DPTA 4WF2A 1S29A 1SD5A 1YO5C 2OBPA 2L7KA 1U5TA 3FXJA 5J47A 2F5DA 5IOZA 1PUEE 2K85A 2CUFA 3J80K 4XN3A 2KKOA 2LBFA 2ZJQF 1XMAA 4M3BA 1MIJA 5GAGJ 4LGWA 1WI9A 3E6BA 3GO5A 1PUFB 2PN6A 3K9TA 4YIFA 3W3CA 1W4MA 5JR3A 1WI3A 4BNCA 3ZPLA 3P9IA 2JSPA 3I0TA 4IHYA 2NAZA 3CTAA 3VYUB 1IF1A 2W84A 4GO1A 1BC8C 3F8MA 2OJED 3DBRB 2KRFA 1VQ4I 4FE4A 2VXZA 4RAZA 4LOCA 1ZRCA 3GCMA 1JUPA 1W7PB 3N97A 3BP8A 2ESHA 3E6DA 3RYPA 1MBEA 1YYVA 3MEXA 3GUDA 4ENNA 2PFBA 1KA8A 2CQKA 3PQKA 2EQRA 5JLXA 4IVNA 1LDJA 3BZKA 3H0DA 1YX3A 2E71A 1OCZH 1R00A 4KJZA 1P92A 1JTXA 3HRSA 3RIRA 2RNGA 1XMXA 2M5WA 1YHQI 2XGCA 1MNEA 4OAZA 1VTNC 2WB1A 3DCFA 1JUMA 1LFPA 3CC2I 1YS6A 2OZ6A 1R5HA 4RMNA 1VQ6I 3JSOA 4LITA 4JK1X 2VQLA 4B43A 1VQNI 2A6EF 4LD5A 4NC7A 1S6LA 5FLVA 3S15J 4LLGF 2VOOA 3AL0B 3CMYA 4B8XA 2QA4I 1RPWA 2XVCA 3OS2A 4IHVA 3H9JA 1EH7A 3CUQB 1MGTA 4OIQF 2X85A 2CV1A 4UV9A 1HKTA 2ELKA 4HV5A 1T0FC 4CCNA 1R4NB 2LREA 3ZMUA 3EYYA 1P6RA 3EYIA 1QPIA 3G73A 3K70C 1E17A 3DBHB 2F5EA 5CQEA 4EM0B 3OYEA 4E4HA 1TT5B 2X48A 3ABUA 3V7SA 1IO2A 3OYAA 1IJWC 4OMZA 1XC5A 1ZGAA 3LFUA 2M8EA 5K5QA 4IOAF 4JBAA 2RQQA 1X58A 3S3OA 4HBLA 3DEUA 3SQNA 3ZR8X 3QU3A 2HXOA 3L1PA 2WAQN 4JX6A 2V1NA 1ULYA 3FMSA 1YRNA 2X6XA 2MD0A 4BH9A 3OYCA 4RGUA 2JRMA 2YSRA 3KIOA 3LSMA 2DDBA 4IOCF 2HQ5A 2R7XA 3P7NA 1OCRH 2HNHA 1YE9A 3HOTA 1LE8B 2BE5F 2ZXHA 3KE2A 4V19K 4GGGA 4B3XA 5K7FA 2LY1A 1OJLA 3BJ6A 2HKOA 5AIPA 9ANTA 3GTJJ 3M8JA 1IN6A 3FISA 3OYDA 2NVUB 2EV5A 1LUJB 3HZJA 4ANJA 2YPRA 3H3VK 4RGSA 3RDIA 3VB2A 3F23A 2XASA 5H2FC 5F04A 2W00A 5HLIA 2ADUA 1AHDP 4XKBA 1B72A 3GEZA 5ICFA 2HGCA 2DPUA 1VNDA 2GWRA 3LSHA 2LKPA 2D2WA 2ID6A 3ISPA 5FLXZ 2ELJA 2KRCA 1J09A 4BKXA 2LG4A 4ZTJA 4CHUA 4I7HA 3C1DA 2Q8KA 5D5XB 2K9QA 2DPDA 3WTZA 2VL8A 2Z16A 4BDZA 2JA6J 4E7JA 3QPHA 2XIGA 4B47A 4HX4A 4QSHA 2W4SA 5D6EA 3N4MA 4RB2C 1KONA 4IRHA 3CLOA 4MLOA 2PMUA 1GVDA 4KA4A 2CV0A 1OPCA 2A3SA 3RKXA 3V42A 3MKYB 3ONQA 1MJ9A 3CCQI 5IYCJ 4MEYF 4MTDA 1RZ4A 1FYLA 5K1YA 2X51A 4KDPA 4XN0A 4A3JJ 2P8TA 4E7KA 3JRHA 1A5JA 3K4BA 3CESA 4PGGA 4E7ZA 2YX7A 2BOLA 1XGNA 1YW7A 4Y3OA 1DGWY 4XLNF 1ZN2A 2W57A 5BNGA 3KCCA 4CCOA 4A3BJ 2M0CA 2ECCA 5L3EA 3QP6A 1U5TB 3V4GA 4CCJA 2FNPA 1U3EM 3CDIA 3K4JA 1Z77A 3EQLF 2XF7A 1X3WB 2XB0X 1FC3A 1I6XA 2K9LA 3V8KA 2VKDA 2NNYA 2IGMA 2W25A 3ZQQA 5L3FA 1K7AA 4A3LJ 1A04A 1U9NA 2O9LA 2CQ7A 3O3KA 1E3PA 1QRYA 3ZQCA 1YS7A 1W36D 5FKMA 4RBOA 3A4CA 1X4OA 3IL2A 4CCKA 3CMAI 2LRDA 3BOQA 3H5AA 2DBBA 3H1CA 4BAYA 3HPHA 4B1RA 2WADA 1TNSA 4FX0A 2P81A 5ED4A 3WU2C 1T98A 1RUNA 2GBYA 4D1QA 3F8NA 3A01A 3QYFA 3H9QA 4AIHA 1HSJA 4H0EA 4F91B 4IZZA 1ETWA 3WU1B 1F36A 3ZOBA 4L5JA 4HX7A 2DODA 3JAMZ 1ZHFA 4P1WA 2M4GA 4CA0A 2LNBA 3BPVA 4D0PA 3RZOJ 2UWMA 4XLFA 5CYVA 3F8CA 3TO6A 2KDOA 3LSRA 1IV6A 2H94A 2GOMA 2COBA 3CDLA 4KIBA 2HVSA 1X2NA 1WVRA 3B02A 3KPHA 4G8XA 4DBQA 4PSWA 3SFZA 1HOMA 5DD8A 1SFOJ 4O6JA 4XQFA 5J8CA 4XONA 3DFGA 3IC7A 4GXOA 2QLZA 1O3SA 4HV6A 4NUBA 3IAS2 2KISA 4EVIA 2R7VA 1GUUA 4FT8A 4UUTA 4XNFA 1OQYA 1ITYA 3JTGA 2KPMA 2FJ1A 2DFIA 4BYYA 2O8KA 1V5EA 4IJAA 2K9SA 4YRVA 3E7LA 5KVRA 5HODA 2DMQA 2CMPA 2XV4S 2RN7A 1DU6A 5A2QZ 2FX0A 2AHQA 1OMIA 3PUBA 2LSOA 3KP3A 4RGRA 3VWBA 1K6OA 2OC6A 2QKLB 2L9RA 1U2WA 2HDDA 1TQMA 2ZMEC 2JA2A 3FM5A 4L5EA 2O3FA 1SANA 4BEHB 3GMEA 2OZUA 3E5QA 3AG1H 2H1LA 2OQRA 3MWMA 2L9NA 3RPQA 1A36A 4B4CA 2BY1A 3Q9VA 3CMEI 1Z3XA 2VLAA 1R1VA 2R7DA 4Q48A 3PL8A 2VASA 1WGXA 3DLLF 1GXPA 1X1DA 1DPRA 2RC4A 3RKQA 3OY9A 5IYDJ 2FU4A 2OU2A 2QSHX 1V3FA 1I3QJ 2JQ7A 4ZTFA 3C2HA 2OUMA 3OWTA 1F1ZA 4NC6A 4HZFA 2VJ4A 3TL4X 2E2IJ 2A5WA 3OL3A 5CVRA 2R7SA 2M1BA 3GTMJ 3M3YJ 5L3CA 2QF7A 2L3DA 4ZYDA 3OMYA 2VJIA 2R7QA 1USTA 3OYGA 3C2BA 2MC4A 2VQHA 5E3NA 4PJLA 1IRZA 3ELKA 3I64A 3K4NA 3KLOA 3LSKA 2QCOA 4JX5A 2Y69H 2XUBA 3P5JA 3H5RA 3HXLA 3QYBA 3IH4A 5JHFA 2PI0A 4R1HA 4M6XA 3FXRA 4BE2A 2PQ8A 3TW6A 3CQZJ 3NEUA 1ZG3A 2DLLA 1OYWA 5ICGA 2QBYA 3ZMTA 4EM1A 4K2EA 1JHFA 1MZBA 4RLQA 1HKSA 3HSEA 4H4KC 3A0HC 1FOYA 1NG7A 2JMWA 1MNDA 2AXTC 2IAIA 5CVJA 1U9OA 1OYYA 2PLYA 2L5QA 5AIQA 2HI3A 1WKMA 5H6QA 4A3DJ 3D0SA 2NVTJ 3EUHC 4IRGA 4DIQA 4L0YB 1BJAA 1PP8F 1W0UA 1WZ2A 1NK2P 4BGDA 1P2FA 2BEOA 3LSGA 2WV1A 1DQUA 5E1WA 1IG7A 3SXYA 1V5FA 2ZXWH 3LQQA 4KT6A 2ISYA 1TT0A 1ZARA 1GVJA 3OL4A 5B66C 3CCMI 4ZYHA 1OYIA 1ETXA 1HSTA 2A68F 1ZREA 2DA2A 2VPLA 5F0FA 1XB4A 1BR1A 3FM3A 1Z91A 4BE0A 3BCAA 3BR5A 3BTIA 3MD2A 5KAIC 5F6FA 2XROA 3HEFA 1FNNA 4XRSA 2QUFA 2IS4A 2OPTA 1RI7A 2IXSA 2YX4A 3WTTC 1I39A 5ILSA 2HYGD 2JVHA 4A3IJ 1SFEA 4C3HJ 1U78A 2ACJA 4U87A 1JKRC 2FOKA 4M3GA 5D4RA 3QPTA 4RB1A 3H0GJ 1NH3A 3AFHA 3WHCA 2F4IA 4DJAA 1SAXA 1XG1A 2E34A 4JYKA 3FZVA 4LK0F 4OU0A 4A3GJ 1MBJA 5E17F 2EZIA 5ILUA 3K69A 3ZQHA 2FSWA 4F55A 2HOEA 1WJCA 3S1NJ 4YIRX 4EGYA 2HZTA 4IHWA 1SMYF 3EUAA 5B5EC 1LB2A 3CUQC 5DYMA 4A3KJ 1QVUA 5M5WJ 3GFLA 1W5TA 2P6TA 2B7EA 2WBMA 3W2WA 3E5UA 2VBYA 3QOEA 1FYMA 5EJCA 2Y9YA 3HRUA 3CDHA 1ZRDA 1FBQA 1P7IA 1QGPA 2E2JJ 3BTLA 2XAHA 1K4SA 4UUVA 4A5MA 3DPUA 1TQIA 1V4RA 4HNTA 3I55I 2Y0SA 2EZLA 3CCUI 2EFQA 4RM2A 1ENHA 4XMYA 3GTLJ 2CW0F 2V79A 2ZO4A 1DU0A 2TRTA 1ZTRA 1BA5A 2JPBA 2HYFA 3W2VA 4XORA 2CV2A 4YELA 2VBWA 4HA8A 4ZYAA 3TDZC 5J4VA 1RUOA 4XLEA 3ZN1A 3A01B 2F6CA 1R5ID 2FE3A 3VEPA 1KQ8A 2JZYA 1G3TA 2O6GE 5ICCA 4L0ZB 1FTTA 2DA4A 2DT6A 1TP4A 2FNAA 4NNJA 1LFBA 2W24A 1U6GA 1LKXA 1JHHA 3LSTA 4R79A 2VI6A 1XDUA 3HKZA 4FTHA 2DTZA 3GTQJ 2Z2SB 3HKZN 5HLTA 1BR2A 2X4HA 3G1OA 1EKEA 3TO7A 2XAUA 2FEZA 4E7SA 4UHTA 2MG4A 1H8AC 4CICA 1RKTA 3GXOA 5BMZA 1MSEC 2NYXA 3FX3A 3M07A 3BQZA 4B3AA 1Z6RA 3WTVC 5KHDA 3MZHA 2PJRA 4ZDOA 4EJOA 3ZQIA 2ZNZA 2XSDC 3JRFA 4OAYA 1R36A 3K2AA 2G7HA 3OYMA 1LDKB 1DP3A 3JW4A 2IP2A 3G4SI 3TP0A 3BZ6A 4BUPA 2G9WA 3GWZA 1TWCJ 4LG3A 1Z3YA 3Q5FA 3HOSA 2EB7A 2BHYA 2EFNA 1XDSA 3W6JB 4BQAA 2M30A 2L4MA 4M3EA 3RQIA 1VQKI 3HUGB 3G1LA 3FIWA 1ONVA 3NWSA 4F3QA 2JPCA 2DFEA 3QODA 1O3QA 2H09A 2G0EA 4I98B 2ETHA 3JR9A 1SFUA 3E1SA 3MQ0A 4KIFA 2A6TA 3A0BC 4B48A 5B3SH 3OSFA 2I5UA 5HS9A 1FYKA 1IN8A 1ZGJA 2EINH 2KIQA 3CCSI 5HNHA 3DTKA 2W82A 2M87A 4DNCA 4MO7A 4P9UA 1LEBA 1LJ9A 1O7LA 4I01A 5HNFA 3FDYA 4GDFA 4CYCA 1OFCX 2NS7A 3JRDA 1XS9A 4HF0A 2VIXA 1SVMA 2K02A 2LF7A 1HW5A 2DYSH 5D4SA 1SC7A 1ZQ3P 1LE8A 3WE2A 1UFMA 2BHZA 3VYSB 4BU2A 3GTPJ 1SD7A 3L09A 2Y31A 3HOUJ 1Z67A 4BS9A 5CVVA 5CQGA 1O7FA 4PGHA 1Z21A 3T0YA 1STZA 3BR2A 4BACA 2RDPA 3WODF 1W0TA 1MMSA 4PFOA 2K86A 3KP6A 1Y0NA 4RGXA 1MMAA 3ZQ7A 5HVQC 5E3MA 4WX9A 5F27A 2BBYA 2JTVA 2E1OA 1J59A 1K78A 1B72B 3SEZA 4Q47A 4CUGA 3OYFA 4NC8A 2FRHA 4RAYA 3ECOA 3D5SC 2GQQA 3OOPA 1ZELA 4RB3C 2L02A 3OYJA 5F08A 1Y1WJ 3OSGA 3L2UA 1HQCA 1PP7U 1FX7A 5FLMJ 4XRFA 1S7OA 4FCYA 1S3JA 2KT0A 2H6BA 1EA3A 3ABTA 1USSA 3FXQA 3SZGA 4Q5SF 1X1CA 1TWAJ 1J75A 1IAWA 2HPMA 3OYBA 1BW6A 1Z1DA 1WH5A 1JKQC 1QU3A 4N4OB 2IEKA 4G9YA 4XKVA 3BY6A 1H0MA 3HOZJ 1QA6A 1JGSA 3I4MJ 1B1BA 4EJUA 2R7ZJ 2V9KA 4ZZLA 1OCTC 2BZTA 1WJEA 2ZJPF 2CH0A 2LP0A 1EH8A 2ZMEA 1Y39A 2I8DA 1MJBA 2K9NA 3BROA 5GAHJ 2QQAA 1XGMA 4W1UA 2Z1DA 2UV1A 2IS2A 1I5ZA 4WXCA 1MSFC 2STTA 1FEXA 1RR8C 1FBSA 1I27A 2QQ9A 2XDVA 3H5NA 5K5OA 2R5YB 5LRRA 4ASNA 2IA2A 2RKHA 3BG5A 1JJ6C 4QTRA 4BBRJ 1KU2A 5EG0A 3VPRA 4A2UA 5GAEJ 2HOTA 1OKRA 3FHNA 1QVTA 2H8RA 4Z6YA 2A6HF 3HL2A 1JKOC 4WXDA 2GIVA 2QSGX 3DKYA 4J01A 3QPLA 4JOMA 3FXLA 4QIWN 4DQ2A 3SFIA 1S7AA 1E2XA 1X1PA 2K40A 3ZCOA 4LJZF 4AD9A 1D3YA 4BY1J 2YR2A 3ZQGA 2X6OA 2K7LA 3PFIA 3AAFA 1SFKA 3CD6I 1ZGWA 2DO7A 2DOAA 4UVAA 2EH3A 2WY8Q 3E3VA 4D5CA 2LBFB 5IYBJ 2HDCA 4FQGA 4RS8A 2KZVA 1D0YA 3L2RA 1IDYA 2KRHA 4A0XA 4AIJA 3G1MA 2VOPA 2ZBKA 1ZAOA 2GA2A 1IC8A 3K6GA 3GYHX 5E1XA 2K4JA 4AM3A 4MFEA 3I59A 4XLPF 2JWTA 3TOAA 5IPAA 4LB5A 2H8WA 3SDBA 4NQWB 3ASNH 5E1ZB 4PUSA 2CO5A 4TV7A 5IP9J 1FPQA 4E70A 4WWCA 3HGYA 2B0LA 3J7AY 4BY7J 2CGPA 3KLNA 5C4XJ 3CC7I 1MBHA 4DYQA 2V4JC 3GX4X 3LA3A 5GP9A 3KZZA 5BPIA 4ZYGA 2GOXB 2QM3A 2Y48A 2VBZA 4NQWA 1PUFA 2PBIA 5LRSA 4LIUA 4W97A 3T1BA 2M7BA 4OOIA 4AVZA 1BI1A 3QOPA 5BPDA 4B09A 5M3MJ 1KU7A 2XHKA 4FX4A 2M34A 1DP7P 3D5RC 1WRJA 1WJ5A 2VE9A 1IDZA 1YJNI 2DA3A 3HRTA 1UELB 2LOOA 4XIDA 4WK8F 3ZXSA 2IT0A 2IA0A 1Z6TA 2O5RA 4AYBN 3EUKL 1W7PD 3GZ5A 4D5FA 2GLOA 4EMSA 3BR1A 3TKYA 1YQAA 3O8GA 3S2WA 1K6YA 2CWEA 3WU0A 1LQ1A 2FF4A 3O8HA 1VQOI 1B59A 5A2QK 3TMOA 1R49A 1EH6A 3BG3A 1IN7A 2CQXA 4BHCA 4D9JA 5EEAA 2BW3A 2F5CA 1P4AA 4PZJA 1RR7A 3L2VA 4ESFA 2LK2A 3MZYA 2EFWA 3FMQA 3CC4I 4A69C 5C4JJ 1QNTA 1ETKA 3N05A 4UUSA 2VPRA 2JVGA 1LVKA 4KN4X 4IHSA 2JUCA 1IN5A 2ICWG 5J4YA 1AWCA 3BTJA 2VUMJ 5J1YA 2N8GA 3BT9A 2R4GA 2XRLA 2Y2ZA 1TWGJ 4Y17A 3F3XA 4YFXF 4ENMA 3SZPA 3JREA 1SAUA 2E7WA 2H27A 3S8PA 3JRIA 4I09A 4A6EA 3FWEA 3IKVA 5EDNA 3VYRB 1WFXA 5L3DA 2W7NA 1D8KA 4AYBA 2CS3A 4G6TB 1XCVA 3GW2A 4ENKA 4EQQA 3PO3J 3CO7C 3L7WA 4M3FA 4HYEA 2KFDA 1QQIA 3BC8A 3ERMA 3PNTA 4V2GA 4XOTA 2ZSIB 3VFZA 5HS8A 2M0MA 3CZ6A 1XX5A 1BIAA 4YEJA 4XICA 4J00A 4LMYA 4RA2A 2WAQA 3CJRB 3ULQB 1KYZA 3H3ZA 2F5FA 1NHAA 5LGUA 2KZGA 2RQPA 2ISZA 5EEGA 3M9AA 3CCRI 1FOWA 3AL0C 1S7EA 5EGOA 3PIPF 4CO8A 2JRTA 3MN2A 2WAFA 4G6QA 1H9TA 4ZC3A 2HPIA 4P5OA 1BN5A 2DOEA 2ZC2A 3LFKA 5J1UA 1AA7A 4OINF 2BY3A 1G4DA 3KZIC 3HYIA 1QBJA 3HRMA 4WCGA 4BDYA 1OISA 3I58A 4BXUA 3W6VA 3LWFA 1K78B 4P55A 2R7RA 2DQLA 4A93J 1KGSA 3L2WA 5IP6A 2A07F 3Q0UA 4L9VA 3T8TA 3BR3A 1MH3A 3HPGA 2XKPA 5J6XA 1HW1A 1MD0A 3CF5F 2DMPA 5E18F 2I10A 3PUFA 1ETQA 4KT5C 3KFWX 5IT3A 4KUMA 5D5VB 1MMGA 1Z9CA 1S9HA 1JE8A 4NDLA 3K1MA 4Y13A 4OWRB 3WG9A 4KISA 3SDGA 1JTYA 2KIUA 4S04A 2DMTA 2P5LC 2CUZA 4IXAA 5DS9A 2R5ZA 3FF5A 1JT6A 4Y15A 1Y8QB 2YU3A 3FKJA 4JP0A 1TC3C 4G7HF 4QWQA 2LMDA 5DEQA 5M3FJ 2MFZA 2GXGA 3D5LA 3OS1A 2E5NA 5TRDA 1R9TJ 2L7FP 3ZP5A 1U8BA 1BJZA 1OCOH 1HBXG 3DXJF 2KL4A 3EUHA 2IW5A 4I0BA 3LNQA 3CCYA 4C2TA 3HC7A 3PNYA 4M71A 3WTYC 5IT9K 2GA1A 1WJFA 3ERED 1O3TA 2EFOA 2XF6A 1ORKA 4U0WA 2B9SA 1TZLA 3BG6A 3COAC 2VODA 2JUGA 1ERDA 2FXAA 1MJAA 4J19A 3V8JA 2EIMH 4D7MA 2VT3A 4U88A 3T8RA 3I59B 1SVOA 1K4TA 3FXMA 4I6ZA 2WA0A 2JA7J 1G3YA 1TWHJ 4BE1A 4P9FA 2ZB9A 4U0YA 2FBHA 2RGVA 2R5YA 2MBFA 4M72A 4KMFA 4AIKA 2EIKH 5E8IA 3RPUA 5JVTA 3DU6A 3HBLA 2BXZA 2XRNA 1ZKGA 4CH7A 2L01A 5M5YJ 1VQLI 3PFYA 2ZFUA 3ZRGA 1SEUA 4EJTA 3I53A 5LBQA 2DAOA 2Y0MA 4M73A 1H89C 3GTOJ 1E3HA 1BOBA 4AVPA 1WHUA 3K10A 2JK3A 3D1NI 2C6YA 4RAGA 3W2AA 3KP2A 3ASOH 1DUXC 2BXYA 1R7JA 2BYVE 4DYCA 3KEOA 4HAMA 4CGZA 4O5VA 1X3UA 3TO9A 3ZQLA 4Z2YA 1BIBA 2CYYA 4KFCA 2V9VA 1PJRA 3LOCA 5EGOB 4HF2A 3TQNA 3S3NA 2P5KA 4OIPF 3IV5A 1X4PA 5EG0B 5HS7A 2K3PA 4ENJA 1MMDA 3VSLA 4LK1F 4BL0B 1FWZA 2KMUA 2OV7A 2XAFA 4HNUA 2DMUA 4G6DA 2NOGA 4KN7X 5L3BA 3FMRA 5HDGA 5K7HA 1JGGA 1MNMC 3PM1A 3IRRA 2MYSA 3KEYA 2RREA 2F48A 2MABA 2VT2A 1TTYA 1D5YA 3MCZA 2PMHA 2V1XA 5F64A 3JSPA 2R0QC 5DUIA 1K79A 3F0CA 4RAFA 5CKTA 4OIRF 2V6EA 3DPLC 3ZMVA 3ESWB 1QZYA 4ITVA 4DZJA 3HIFA 1I1GA 5E20A 4EJWA 3DLAA 1PVEA 3AG4H 2M8GX 1VFCA 4IQ4A 1POGA 1XTAA 1DPUA 2HEOA 2FUG2 3A02A 4FE7A 3U21A 1APLC 2E5ZA 4L18B 1UB9A 1VF9A 1XMKA 2EZKA 1UJ8A 2ESNA 2XKOA 2LKXA 3Q0VA 1ZR4A 3QU6A 3OR1C 2ZXIA 4I02A 1F4KA 3U2RA 1WJDA 2LDUA 4UUSB 2Z9OA 2QYOA 3HOXJ 2Y0SN 1GV5A 2E19A 3MKWB 4MGRA 3GVAA 2VJ5A 1XGOA 2VONA 4CZCA 2RV8A 4B44A 2BV6A 2XPWA 3OIQA 3P9CA 2QEXI 3HB9A 4PJMA 3WTUC 2IVMA 2OCEA 4CYCB 1Y0UA 4E7LA 2OCCH 1B8IA 4L9TA 4PJJA 2XPUA 2VKVA 1HC8A 2UXXA 1QPMA 3LSIA 4O3MA 2PG4A 1LPQA 3FHZA 4ESJA 3HOYJ 1S8NA 5EYRA 2P4WA 3K4CA 2QSFX 2R3SA 1DGRM 1KQ9A 3VSKA 2L4AA 2DXIA 4UVBA 3ZQFA 2L7MP 2QQ8A 2R7UA 4E6KG 2XGXA 1B9MA 4YG2F 2RAEA 1B9NA 4CXFA 4HNVA 3WTSC 1TNTA 1YJ9I 5JVGF 4E7HA 4HPQA 5FRNA 3S1QJ 1IUYA 3RCOA 1QZEA 2CSOA 1DDNA 1G3WA 5JFRA 4QPOA 3I54A 3TBIA 3LQRA 5IP7J 3CJTB 4FETA 1YIJI 1FSEA 1I6HJ 2MSYA 4GYIA 3Q0WA 4N4NB 2DA6A 3BCBA 3B6CA 4GFBA 3K1NA 4OIOF 2PX9A 3M8EA 1FZPB 3MKLA 1UHWA 1YIOA 2CQNA 4PSXA 5FD5A 2E1MB 1SD4A 3PJRA 4XR6A 2VJJA 2P7VB 3GF2A 4S05A 3A2KA 3KYCB 1R22A 4LG0A 1PDNC 2X6YA 1IUFA 3HHGA 2E1MC 5LD2C 3UKGA 3F6VA 4XSXF 2MW8A 2H6CA 3GTKJ 1IRFA 1R23A 2Q0OA 4XOPA 1ZRFA 3REOA 1VI0A 1LFUP 2F5VA 2E1NA 1RIOH 4DZPA 4N9HA 4F93B 3M1CA 2QZ8A 2P5VA 2XSJC 5HLHA 6PAXA 4DBRA 5TGTA 4EGZA 3CO6C 5J3LA 4UVCA 2DK5A 4RM3A 1IRGA 2IA1A 3TGNA 5GTHC 2A5YB 2K9MA 3G3ZA 1L3LA 1T0FA 5TISC 5E3LA 4E7IA 5KAFC 3OYKA 2LFBA 4XLHA 5D8LB 5IT9Z 2KHMA 1ZG1A 4N0BA 5D8KB 2R7WA 1ETVA 4KMUX 2NRAC 2BVLA 3SYTA 2OQGA 2NOJB 4BBSJ 1MW7A 3H9GA 1L0OC 1XCBA 1KZHA 2FD5A 5BS6A 5LHIA 3QRFF 4DOZA 4G7ZF 3RYRA 2DT5A 4MQVA 1JXSA 4KITB 3SZTA 2HQRA 4NHJA 1D8JA 5D5UB 1JUSA 1JT0A 3DKWA 1ODDA 1P4XA 2OD5A 5C3EJ 4PFPA 3IAM2 3PQJA 2PJPA 4MEXF 4I2OA 3GZNB 3IP4B 1XD7A 3ZGKA 2IBDA 2EFPA 3VOEA 3I9V2 4XKWA 3PSFA 3R60A 2L2OA 1IW7F 1R1TA 4FASD 3CMMA 2R7OA 1YX5A 2ZJRF 2KIMA 4HOBA 2JSCA 3OYNA 3RJPA 3ZN0A 2OTJI 2Q2EA 1G59A 4UNOA 2DA1A 4GCVA 3SHFA 2ZXJA 1GHCA 2R7FA 2IS6A 3P9KA 4L9NA 3I4NJ 3ECHA 3CUQA 2FQ3A 1ZYRF 2LYCA 5FO5A 3HJEA 2WC2A 1WSUA 5LGNA 3JTHA 1F5TA 4LFUA 2GAUA 2VXDA 3BTCA 3KYLA 1MDMB 4Y7NJ 2TCTA 2NS8A 1XSXA 5CPRB 4BQNA 1GXQA 1O4XA 2IGNA 3FXOA 2QWWA 3OYLA 2W85A 1Q1VA 4FISA 3S2DJ 3QPSA 2WTEA 4MNUA 4A3EJ 2O7OA 2M9HA 4LLNA 1U5TC 2HS5A 2DW4A 3S17J 2MLGA 2HOAA 2EPFA 5FKKA 3R0AA 5F1JA 1MBGA 4DGWB 5BOXA 1TQPA 1G8XA 2L9SA 2NNNA 5FFXA 3RPUD 3WE3A 4IKFA 3HOVJ 1ACIA 1TBXA 5E8GA 1XGSA 1CF7B 3ABKH 4PJ0C 3GTGJ 4P96A 1TWFJ 2MD5A 1MBKA 3C7JA 2X0LA 2LR8A 1EV7A 2HFHA 2G7UA 4S0HB 4AC0A 5FRMA 1MBFA 2EBIA 3I56I 1G2HA 3IKTA 4ZH4F 5DM7F 5AONA 3C3WA 3BG9A 5TJJA 3WTXC 1R71A 2GXAA 2DTRA 1FOXA 4XSZF 3F21A 4IL6C 2Y75A 1T39A 1O57A 3MAJA 4L9JA 2YUSA 3F6OA 2EIJH 3R6SA 3FXUA 1NK3P 1IXRC 2E1CA 2NVYJ 3SJMA 1T33A 2WV0A 2HYJA 3S3MA 1ZH5A 3EETA 2LY2A 3K4LA 3BQYA 1Y6IA 4CDGA 1RKWA 2P0WA 3RQ4A 2CW7A 3CUOA 1T08B 3FBNB 4ZJZA 2HVQA 5DUKA 1AKHB 3RKWA 2DQRA 1S5LC 1W5CC 3L00A 1VQPI 3S14J 2IGOA 3WGGA 3JCUC 3I4PA 5DTDA 3M4OJ 3CCJI 3RKYA 3E6MA 3UR3C 4EATA 3NARA 1YTYA 1AKHA 1F9NA 1UAAA 3CCVI 2DA5A 2KQRA 1FP1D 2Y9ZA 1MH4A 3DTEA 3M7GA 5HOOA 2R93J 3CP2A 3GZ6A 2VC0A 3G71I 2DYRH 3FBIB 5M5XJ 4L5IA 5ICEA 3E0JB 3HDDA 3LA2A 1J5YA 1Z7LA 4BXXJ 2L9VA 2O0YA 4LB6B 2LY9A 3DP7A 4ON0A 3DBLB 1QZZA 4C3IJ 3IUOA 2HTSA 3LSPA 2ME6A 5EEHA 2ECBA 2DA7A 5D5WB 4C2UA 1IV8A 3LMMA 2TDXA 3TP3A 2ZFWA 3QWLA 1UCRA 1TLHB 4PK4A 3HUGA 1D0XA 3OYIA 3R4KA 4A6DA 1T38A 4HDUA 1XPXA 2K5CA 3GFIA 4M74A 5ERIA 3S16J 3DEEA 1FIPA 4D7NA 2CRGA 2HVRA 2V9PA 2FMLA 3DWLE 1Z7UA 3HHHA 1K61A 2HKXA 4M6YA 1V5GA 1AOYA 4IPAA 4Y52J 5E79C 1YI2I 1FT9A 2K27A 3V7CA 1VQ5I 3NRVA 4KICA 1LDDA 2CFOA 3MFKA 4U7DA 2XGDA 2PJRB 2R92J 1EJ9A 3ABLH 4U7BA 1WPKA 1BL0A 4EEFG 4NBQA 1XSVA 1ON2A 2CJJA 3KYDB 1WJAA 3KZYA 5H6RA 5B1BH 5FKLA 4RB0A 3S93A 3KETA 3PIOF 3CJQB 2E2HJ 2EK5A 1X1AA 2XAGA 3U9GA 3IHUA 4BEHA 3G2BA 3BZCA 3EDPA 1E0EA 3PSIA 4XRSG 2YS9A 1HXDA 2QGUA 4HQMA 4IF4A 3ZMDA 2AQEA 3CCEI 4CCMA 3KEQA 2V1DA 4CYDA 1GT0C 2DI3A 2EV6A 1G3SA 2W48A 2CUJA 2YU9J 2GXBA 5FLXK 1IZ1A 5FKOA 3K1PA 4MIMA 3J81K 2IJLA 1FJLA 1I50J 1FTZA 2VC1A 4XRMA 5B1AH 4HF1A 2PMZN 1V54H 3M1EA 1Q1HA 5GPCA 2X1EA 3ML6A 1R58A
chains in the Genus database with same CATH topology
3WTWC 4Q4ZF 4GYGA 2Z3YA 1CGPA 4AWXB 2WWYA 1O3RA 4XBFA 2RVCA 5H20A 3O2PE 1LEAA 2EJRA 5HDKA 1B4AA 3W6KB 1UHMA 2OA4A 3H92A 5FFZA 4OMYA 2MA3A 3F8BA 2KJBA 5LEJA 3BJAA 3Q9SA 2CG4A 3HSFA 1ZLJA 3HTUA 2HWVA 5HLGA 4ESBA 4KNYA 3R61A 1J0RA 4EV0A 2RNJA 3ZMSA 3E6CC 1W7PA 1J2XA 2QENA 1R5GA 2UZKA 1HW2A 3KP5A 4M9SA 3WGHA 3F22A 4MHGA 3IWZA 3R0JA 5LHHA 3J81Z 3TDUC 4ZYEA 3TOBA 4ETSA 2IPQX 2QBYB 2J5PA 5DD4A 1XN7A 2ZNYA 2EA4A 4NB5A 4A0YA 5CLSA 3DF8A 1HKQA 4HW0A 4M9XA 1U8RA 4HX8A 5DV5A 3LAJA 1BI0A 4MQ9F 1ZG5A 1TW2A 1J7KA 3L9FA 1R1UA 5BQTA 3HSRA 2J5OA 3H3UA 4U0VA 2COMA 3DV8A 4QLCU 2P6SA 1BI3A 1FY7A 1QO0D 3DQVC 2MC3A 1T2KA 2VBXA 4G7OF 2D1HA 2Z99A 5CJ9A 2K4BA 2ZCWA 1WQ2A 5CVIA 3J80Z 1T6SA 3O6BB 2QQBA 3GFMA 4KIGA 2EV0A 3T5XA 1WWXA 1D5VA 1MDMA 4IRIA 2HTJA 5DCMB 1C0WA 2O61A 3JAMK 3I71A 4G94A 4M9ZA 1BC7C 3M8FA 3BPXA 3NQOA 2FBKA 2AXLA 4HQEA 1LNWA 1IXCA 2M45A 3VODA 1H9GA 5LLQA 3E97A 3KP4A 2AS5F 3ZMZA 2LF8A 2FA5A 3ROUA 3CJNA 1I1SA 5HDNA 2CFXA 5LEKA 1B6AA 4A0ZA 2PEXA 4ZZDA 5FGMA 4MTEA 2HR3A 3RTRA 3GFJA 2GZWA 4EM2A 1BM9A 3BJOA 4BHPA 3BDDA 2Z33A 3LAPA 1MKMA 5FD6A 2STWA 2BGCA 5KK1A 2FBIA 2A61A 1RNLA 2UXNA 3RI4A 1KU3A 4LG0B 1YW8A 2MH9A 1FLIA 3WGIA 1KQ0A 4EJVA 2DK8A 2MLKA 2FMYA 3L2CA 3IRQA 2VE8A 3GLXA 4BHBA 5DCFA 4HLXA 5K5RA 4YFNF 1BI2A 3E5XA 4HDVA 1BBYA 2F2EA 3F8FA 4IHTA 1W5SA 1FSHA 2KJCA 1CF7A 2XAQA 2HQNA 1YLFA 2D1VA 2KIFA 1YG2A 3IWFA 4YIIA 1Z05A 4KYWA 5ILVA 4HLYA 1ON1A 2EWNA 2XAJA 2P7CB 4LLLA 2O03A 1IXSB 3K0LA 3OV8A 3KP7A 2EA2A 3QP5A 3C18A 1SD6A 5L3GA 1P4WA 3V7RA 1G6NA 4N9IA 4UV8A 1YW9A 4PCQA 2MH2A 3J7AO 4F7ZA 2DU9A 4A12A 1TW3A 4A5NA 1XSDA 1LVAA 1SMTA 2JT1A 2A69F 4PDKA 3U1DA 4YFKF 5DCMA 1BOAA 2OAZA 2QVOA 2Z5UA 2ZMEB 1ZLKA 2E7XA 5CVUA 2ZKZA 4FHTA 5JHUA 1REPC 1FOKA 1YFHA 1KU9A 1SFXA 3BWGA 2ELHA 4CZZA 1OR7A 5FB2A 5J8FA 3I5UA 3V8LA 2NS0A 1KYWA 3LA7A 2O8XA 1IN4A 5JI6A 2V1UA 2VN2A 3QAHA 5DDGA 5LHGA 2D45A 1FBUA 3HTSB 3F72A 3K2ZA 2IRFG 5F1RA 4JQFA 4R8HA 4UXNA 4I0AA 5LGTA 4WXHA 5D6FA 3B73A 2V6CA 2ZJ2A 1FP2A 2L54A 1J9IA 3DPTA 4WF2A 1S29A 1SD5A 1YO5C 2OBPA 1U5TA 2F5DA 1PUEE 3J80K 2KKOA 1XMAA 4LGWA 1WI9A 3E6BA 3GO5A 2PN6A 3K9TA 4YIFA 1W4MA 5JR3A 4BNCA 3ZPLA 3P9IA 3I0TA 2NAZA 3CTAA 1IF1A 2W84A 1BC8C 4GO1A 3F8MA 2KRFA 2VXZA 4RAZA 1ZRCA 1W7PB 3N97A 3BP8A 2ESHA 3E6DA 3RYPA 1YYVA 3MEXA 3GUDA 4ENNA 2PFBA 1KA8A 2CQKA 3PQKA 4IVNA 1LDJA 1R00A 1P92A 3RIRA 3HRSA 2M5WA 1VTNC 1YS6A 2OZ6A 1R5HA 3JSOA 4JK1X 2A6EF 4LD5A 1S6LA 4LLGF 2VOOA 4B8XA 2XVCA 1EH7A 3CUQB 1MGTA 4OIQF 4UV9A 1HKTA 4HV5A 3ZMUA 3EYYA 1P6RA 3EYIA 3G73A 1E17A 2F5EA 4EM0B 3ABUA 3V7SA 4OMZA 1ZGAA 5K5QA 2M8EA 4JBAA 4HBLA 3DEUA 3SQNA 3QU3A 1ULYA 3FMSA 4BH9A 4RGUA 2YSRA 3P7NA 3HOTA 2BE5F 3KE2A 4GGGA 3BJ6A 2HKOA 5AIPA 1IN6A 2EV5A 2YPRA 4RGSA 3RDIA 3VB2A 3F23A 2XASA 5HLIA 2ADUA 3GEZA 5ICFA 2HGCA 2DPUA 2GWRA 2LKPA 2D2WA 3ISPA 5FLXZ 4CHUA 4I7HA 3C1DA 2Q8KA 5D5XB 2DPDA 3WTZA 3QPHA 2XIGA 4HX4A 5D6EA 3N4MA 4RB2C 4IRHA 3CLOA 2PMUA 4KA4A 1OPCA 2A3SA 3RKXA 1MJ9A 4MEYF 4MTDA 1RZ4A 1FYLA 5K1YA 4KDPA 2P8TA 4PGGA 2YX7A 1XGNA 1YW7A 4XLNF 1ZN2A 2W57A 3KCCA 5L3EA 3QP6A 1U5TB 3V4GA 1U3EM 2FNPA 3EQLF 1FC3A 1I6XA 3V8KA 2NNYA 2W25A 5L3FA 1K7AA 1A04A 3O3KA 1YS7A 3IL2A 3BOQA 2DBBA 4BAYA 1TNSA 4FX0A 5ED4A 1T98A 1RUNA 3F8NA 4AIHA 1HSJA 4H0EA 3WU1B 4L5JA 4HX7A 3JAMZ 1ZHFA 2LNBA 3BPVA 4D0PA 2UWMA 5CYVA 3F8CA 3TO6A 2H94A 4KIBA 3B02A 4G8XA 3SFZA 5DD8A 4O6JA 5J8CA 3DFGA 3IC7A 4GXOA 2QLZA 1O3SA 4HV6A 4EVIA 4FT8A 3JTGA 2DFIA 4BYYA 4IJAA 5KVRA 2XV4S 2RN7A 5A2QZ 1OMIA 2LSOA 3KP3A 4RGRA 1K6OA 1U2WA 1TQMA 3FM5A 2O3FA 2OZUA 3E5QA 2OQRA 3MWMA 3RPQA 3Q9VA 1R1VA 2R7DA 4Q48A 1GXPA 1DPRA 2RC4A 2FU4A 2OU2A 1V3FA 1F1ZA 4HZFA 5CVRA 2M1BA 5L3CA 2L3DA 4ZYDA 1USTA 3ELKA 3I64A 3KLOA 2XUBA 2PI0A 4R1HA 4M6XA 3FXRA 2PQ8A 3NEUA 1ZG3A 2DLLA 1OYWA 5ICGA 2QBYA 3ZMTA 4EM1A 4K2EA 1JHFA 1MZBA 1HKSA 3HSEA 5CVJA 1OYYA 2PLYA 5AIQA 1WKMA 5H6QA 3D0SA 4IRGA 4L0YB 1BJAA 1PP8F 1P2FA 2BEOA 5E1WA 3SXYA 3LQQA 2ISYA 1ZARA 1GVJA 4ZYHA 1OYIA 1HSTA 2A68F 1ZREA 1XB4A 3FM3A 1Z91A 5F6FA 2XROA 1FNNA 2QUFA 1RI7A 2YX4A 3WTTC 5ILSA 2HYGD 1SFEA 1U78A 2ACJA 2FOKA 5D4RA 3QPTA 4RB1A 1SAXA 3FZVA 4LK0F 4OU0A 5E17F 5ILUA 3K69A 2FSWA 2HOEA 4EGYA 2HZTA 1SMYF 1LB2A 3CUQC 5DYMA 3GFLA 1W5TA 2P6TA 3E5UA 2VBYA 1ZRDA 1FYMA 3HRUA 3CDHA 1FBQA 1QGPA 2XAHA 4UUVA 4A5MA 1TQIA 1V4RA 2EFQA 2CW0F 2V79A 2ZO4A 2JPBA 2HYFA 2VBWA 4HA8A 3TDZC 1RUOA 3ZN1A 2FE3A 3VEPA 1KQ8A 2JZYA 1G3TA 2O6GE 5ICCA 4L0ZB 2FNAA 2W24A 1U6GA 1JHHA 3LSTA 4R79A 1XDUA 2X4HA 3TO7A 2FEZA 4UHTA 4CICA 3GXOA 5BMZA 2NYXA 3FX3A 3MZHA 1Z6RA 3WTVC 4EJOA 2ZNZA 1R36A 2G7HA 1LDKB 3JW4A 2IP2A 3BZ6A 2G9WA 3GWZA 3Q5FA 3HOSA 2EB7A 2EFNA 1XDSA 3W6JB 4BQAA 2M30A 2L4MA 1ONVA 2JPCA 1O3QA 2H09A 4I98B 2ETHA 1SFUA 3MQ0A 4KIFA 5HS9A 1FYKA 1IN8A 1ZGJA 2M87A 4DNCA 4P9UA 1LEBA 1LJ9A 1O7LA 4I01A 4HF0A 2K02A 2LF7A 1HW5A 5D4SA 3WE2A 1UFMA 1SD7A 3L09A 5CVVA 1O7FA 4PGHA 3T0YA 1STZA 2RDPA 3WODF 2K86A 3KP6A 5HVQC 4RGXA 3ZQ7A 4WX9A 2BBYA 2JTVA 1J59A 1K78A 4Q47A 2FRHA 4RAYA 3ECOA 3OOPA 2GQQA 4RB3C 2L02A 1PP7U 1HQCA 1FX7A 4XRFA 1S7OA 1S3JA 2H6BA 3FXQA 3ABTA 1USSA 4Q5SF 1J75A 1IAWA 1Z1DA 4G9YA 3BY6A 1H0MA 1JGSA 1B1BA 4EJUA 4ZZLA 1EH8A 2ZMEA 1MJBA 3BROA 2QQAA 1XGMA 1I5ZA 4WXCA 2STTA 1FBSA 1I27A 2QQ9A 5K5OA 5LRRA 4ASNA 2IA2A 2RKHA 1KU2A 4A2UA 1OKRA 2A6HF 4WXDA 2GIVA 4DQ2A 1S7AA 1E2XA 4AD9A 4LJZF 1D3YA 2YR2A 2K7LA 3PFIA 3AAFA 2DO7A 4UVAA 3E3VA 2HDCA 4RS8A 4A0XA 4AIJA 2VOPA 2ZBKA 1ZAOA 2GA2A 3GYHX 5E1XA 2K4JA 3I59A 4XLPF 3TOAA 4LB5A 5E1ZB 2CO5A 4TV7A 1FPQA 4E70A 4WWCA 2B0LA 2CGPA 3KLNA 3GX4X 3LA3A 3KZZA 5BPIA 4ZYGA 2QM3A 2Y48A 2VBZA 4NQWA 2PBIA 5LRSA 3T1BA 4OOIA 1BI1A 3QOPA 5BPDA 4B09A 1KU7A 2XHKA 4FX4A 1DP7P 1WRJA 2VE9A 3HRTA 4WK8F 2IT0A 2IA0A 1Z6TA 1W7PD 3GZ5A 4EMSA 3TKYA 1YQAA 3S2WA 2CWEA 3WU0A 1LQ1A 2FF4A 1B59A 5A2QK 1EH6A 1IN7A 4BHCA 2F5CA 1P4AA 4PZJA 2EFWA 4ESFA 3MZYA 3FMQA 1QNTA 4KN4X 4IHSA 1IN5A 1AWCA 4Y17A 3F3XA 4YFXF 4ENMA 3SZPA 2E7WA 2H27A 4I09A 4A6EA 3FWEA 3IKVA 5L3DA 1D8KA 1XCVA 3GW2A 4ENKA 4EQQA 3CO7C 3L7WA 4HYEA 1QQIA 5HS8A 3VFZA 1BIAA 4LMYA 3ULQB 1KYZA 3H3ZA 2F5FA 1NHAA 5LGUA 2RQPA 2ISZA 5EEGA 3M9AA 4CO8A 2JRTA 4G6QA 1H9TA 4P5OA 1BN5A 3LFKA 4OINF 1G4DA 3HYIA 1QBJA 3HRMA 4WCGA 3I58A 4BXUA 3LWFA 1K78B 4P55A 2DQLA 1KGSA 2A07F 4L9VA 3T8TA 2XKPA 5J6XA 1HW1A 1MD0A 5E18F 4KT5C 3KFWX 5IT3A 4KUMA 5D5VB 1Z9CA 1JE8A 3K1MA 4Y13A 3WG9A 2KIUA 4S04A 2P5LC 4IXAA 3FF5A 4Y15A 2YU3A 4G7HF 4QWQA 5DEQA 2GXGA 3D5LA 5TRDA 3ZP5A 1HBXG 3DXJF 3EUHA 2IW5A 4I0BA 3WTYC 4M71A 5IT9K 2GA1A 3ERED 1O3TA 2EFOA 4U0WA 2VODA 3COAC 2FXAA 1MJAA 3V8JA 2VT3A 4U88A 3T8RA 3I59B 1G3YA 4P9FA 4U0YA 2FBHA 2RGVA 4KMFA 2MBFA 4M72A 4AIKA 5E8IA 3RPUA 5JVTA 2XRNA 2L01A 4EJTA 3I53A 5LBQA 2DAOA 2Y0MA 4M73A 4AVPA 2C6YA 3KP2A 1DUXC 1R7JA 2BYVE 3KEOA 4HAMA 4CGZA 4O5VA 1X3UA 3TO9A 4Z2YA 1BIBA 2CYYA 4KFCA 2V9VA 4HF2A 3TQNA 2P5KA 4OIPF 5HS7A 4ENJA 4LK1F 1FWZA 2XAFA 4G6DA 4KN7X 5L3BA 3FMRA 5HDGA 3IRRA 2VT2A 1TTYA 3MCZA 2PMHA 2V1XA 5F64A 3JSPA 5DUIA 1K79A 4OIRF 3DPLC 3ZMVA 1QZYA 3HIFA 1I1GA 5E20A 4EJWA 1DPUA 2HEOA 4L18B 1UB9A 1XMKA 2ESNA 2XKOA 3QU6A 4I02A 1F4KA 3U2RA 2LDUA 2Z9OA 2QYOA 4MGRA 3GVAA 1XGOA 2VONA 2RV8A 2BV6A 3P9CA 3WTUC 2IVMA 1Y0UA 4L9TA 2UXXA 1QPMA 4O3MA 2PG4A 3FHZA 4ESJA 1S8NA 2P4WA 2R3SA 1KQ9A 2L4AA 4UVBA 2XGXA 1B9MA 4YG2F 1B9NA 4CXFA 3WTSC 1TNTA 1IUYA 2CSOA 1DDNA 1G3WA 5JFRA 3I54A 3LQRA 1FSEA 4GYIA 3K1NA 4OIOF 3M8EA 1FZPB 1UHWA 1YIOA 5FD5A 1SD4A 2P7VB 3GF2A 4S05A 1R22A 4LG0A 1PDNC 3HHGA 3F6VA 4XSXF 2H6CA 1IRFA 1R23A 2Q0OA 1ZRFA 3REOA 1RIOH 2E1NA 4N9HA 2QZ8A 2P5VA 5HLHA 6PAXA 4EGZA 3CO6C 4UVCA 2DK5A 1IRGA 2IA1A 3TGNA 2A5YB 3G3ZA 1L3LA 1T0FA 5D8LB 5IT9Z 1ZG1A 4N0BA 5D8KB 4KMUX 2NRAC 2OQGA 1L0OC 1XCBA 5LHIA 5BS6A 3QRFF 4G7ZF 3RYRA 2DT5A 4MQVA 1JXSA 4NHJA 3SZTA 2HQRA 1D8JA 5D5UB 3DKWA 1ODDA 1P4XA 2OD5A 3PQJA 2PJPA 4MEXF 4I2OA 1XD7A 2EFPA 3VOEA 3R60A 1IW7F 1R1TA 2KIMA 4HOBA 2JSCA 3RJPA 3ZN0A 2Q2EA 4UNOA 4GCVA 3SHFA 2ZXJA 1GHCA 2R7FA 3P9KA 4L9NA 3ECHA 3CUQA 2FQ3A 1ZYRF 5FO5A 2WC2A 1WSUA 5LGNA 3JTHA 1F5TA 4LFUA 2GAUA 1MDMB 1XSXA 1GXQA 2QWWA 2W85A 2WTEA 4MNUA 4LLNA 1U5TC 2HS5A 2DW4A 2MLGA 3R0AA 5BOXA 1TQPA 2NNNA 5FFXA 3WE3A 1TBXA 5E8GA 1XGSA 1CF7B 4P96A 2MD5A 3C7JA 2X0LA 2HFHA 1EV7A 2G7UA 3IKTA 4ZH4F 5AONA 3C3WA 5TJJA 3WTXC 2DTRA 4XSZF 3F21A 2Y75A 1T39A 1O57A 3MAJA 4L9JA 3F6OA 3R6SA 3FXUA 1IXRC 2E1CA 2WV0A 1ZH5A 3EETA 4CDGA 3CUOA 5DUKA 3RKWA 2DQRA 3L00A 3WGGA 3I4PA 3RKYA 3E6MA 1YTYA 1F9NA 1FP1D 3M7GA 5HOOA 3GZ6A 2VC0A 4L5IA 5ICEA 3LA2A 1J5YA 2O0YA 4LB6B 3DP7A 4ON0A 1QZZA 2HTSA 5EEHA 5D5WB 2TDXA 2ZFWA 1UCRA 1TLHB 3HUGA 3R4KA 4A6DA 1T38A 4HDUA 3GFIA 4M74A 5ERIA 2FMLA 1Z7UA 3HHHA 2HKXA 4M6YA 1AOYA 4IPAA 1FT9A 2K27A 3V7CA 3MFKA 3NRVA 1LDDA 4KICA 4U7DA 4U7BA 1XSVA 1ON2A 5H6RA 3KZYA 4RB0A 3KETA 2EK5A 3U9GA 2XAGA 3IHUA 3EDPA 1HXDA 4HQMA 4IF4A 3ZMDA 3KEQA 2V1DA 4CYDA 2DI3A 2EV6A 1G3SA 2GXBA 5FLXK 1IZ1A 3K1PA 3J81K 2IJLA 2VC1A 4HF1A 3M1EA 1Q1HA 3ML6A 1R58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTW C;  4Q4Z F;  4GYG A;  2Z3Y A;  1CGP A;  4AWX B;  2WWY A;  1O3R A;  4XBF A;  2RVC A;  5H20 A;  3O2P E;  1LEA A;  2EJR A;  5HDK A;  1B4A A;  3W6K B;  1UHM A;  2OA4 A;  3H92 A;  5FFZ A;  4OMY A;  2MA3 A;  3F8B A;  2KJB A;  5LEJ A;  3BJA A;  3Q9S A;  2CG4 A;  3HSF A;  1ZLJ A;  3HTU A;  2HWV A;  5HLG A;  4ESB A;  4KNY A;  3R61 A;  1J0R A;  4EV0 A;  2RNJ A;  3ZMS A;  3E6C C;  1W7P A;  1J2X A;  2QEN A;  1R5G A;  2UZK A;  1HW2 A;  3KP5 A;  4M9S A;  3WGH A;  3F22 A;  4MHG A;  3IWZ A;  3R0J A;  5LHH A;  3J81 Z;  3TDU C;  4ZYE A;  3TOB A;  4ETS A;  2IPQ X;  2QBY B;  2J5P A;  5DD4 A;  1XN7 A;  2ZNY A;  2EA4 A;  4NB5 A;  4A0Y A;  5CLS A;  3DF8 A;  1HKQ A;  4HW0 A;  4M9X A;  1U8R A;  4HX8 A;  5DV5 A;  3LAJ A;  1BI0 A;  4MQ9 F;  1ZG5 A;  1TW2 A;  1J7K A;  3L9F A;  1R1U A;  5BQT A;  3HSR A;  2J5O A;  3H3U A;  4U0V A;  2COM A;  3DV8 A;  4QLC U;  2P6S A;  1BI3 A;  1FY7 A;  1QO0 D;  3DQV C;  2MC3 A;  1T2K A;  2VBX A;  4G7O F;  2D1H A;  2Z99 A;  5CJ9 A;  2K4B A;  2ZCW A;  1WQ2 A;  5CVI A;  3J80 Z;  1T6S A;  3O6B B;  2QQB A;  3GFM A;  4KIG A;  2EV0 A;  3T5X A;  1WWX A;  1D5V A;  1MDM A;  4IRI A;  2HTJ A;  5DCM B;  1C0W A;  2O61 A;  3JAM K;  3I71 A;  4G94 A;  4M9Z A;  1BC7 C;  3M8F A;  3BPX A;  3NQO A;  2FBK A;  2AXL A;  4HQE A;  1LNW A;  1IXC A;  2M45 A;  3VOD A;  1H9G A;  5LLQ A;  3E97 A;  3KP4 A;  2AS5 F;  3ZMZ A;  2LF8 A;  2FA5 A;  3ROU A;  3CJN A;  1I1S A;  5HDN A;  2CFX A;  5LEK A;  1B6A A;  4A0Z A;  2PEX A;  4ZZD A;  5FGM A;  4MTE A;  2HR3 A;  3RTR A;  3GFJ A;  2GZW A;  4EM2 A;  1BM9 A;  3BJO A;  4BHP A;  3BDD A;  2Z33 A;  3LAP A;  1MKM A;  5FD6 A;  2STW A;  2BGC A;  5KK1 A;  2FBI A;  2A61 A;  1RNL A;  2UXN A;  3RI4 A;  1KU3 A;  4LG0 B;  1YW8 A;  2MH9 A;  1FLI A;  3WGI A;  1KQ0 A;  4EJV A;  2DK8 A;  2MLK A;  2FMY A;  3L2C A;  3IRQ A;  2VE8 A;  3GLX A;  4BHB A;  5DCF A;  4HLX A;  5K5R A;  4YFN F;  1BI2 A;  3E5X A;  4HDV A;  1BBY A;  2F2E A;  3F8F A;  4IHT A;  1W5S A;  1FSH A;  2KJC A;  1CF7 A;  2XAQ A;  2HQN A;  1YLF A;  2D1V A;  2KIF A;  1YG2 A;  3IWF A;  4YII A;  1Z05 A;  4KYW A;  5ILV A;  4HLY A;  1ON1 A;  2EWN A;  2XAJ A;  2P7C B;  4LLL A;  2O03 A;  1IXS B;  3K0L A;  3OV8 A;  3KP7 A;  2EA2 A;  3QP5 A;  3C18 A;  1SD6 A;  5L3G A;  1P4W A;  3V7R A;  1G6N A;  4N9I A;  4UV8 A;  1YW9 A;  4PCQ A;  2MH2 A;  3J7A O;  4F7Z A;  2DU9 A;  4A12 A;  1TW3 A;  4A5N A;  1XSD A;  1LVA A;  1SMT A;  2JT1 A;  2A69 F;  4PDK A;  3U1D A;  4YFK F;  5DCM A;  1BOA A;  2OAZ A;  2QVO A;  2Z5U A;  2ZME B;  1ZLK A;  2E7X A;  5CVU A;  2ZKZ A;  4FHT A;  5JHU A;  1REP C;  1FOK A;  1YFH A;  1KU9 A;  1SFX A;  3BWG A;  2ELH A;  4CZZ A;  1OR7 A;  5FB2 A;  5J8F A;  3I5U A;  3V8L A;  2NS0 A;  1KYW A;  3LA7 A;  2O8X A;  1IN4 A;  5JI6 A;  2V1U A;  2VN2 A;  3QAH A;  5DDG A;  5LHG A;  2D45 A;  1FBU A;  3HTS B;  3F72 A;  3K2Z A;  2IRF G;  5F1R A;  4JQF A;  4R8H A;  4UXN A;  4I0A A;  5LGT A;  4WXH A;  5D6F A;  3B73 A;  2V6C A;  2ZJ2 A;  1FP2 A;  2L54 A;  1J9I A;  3DPT A;  4WF2 A;  1S29 A;  1SD5 A;  1YO5 C;  2OBP A;  1U5T A;  2F5D A;  1PUE E;  3J80 K;  2KKO A;  1XMA A;  4LGW A;  1WI9 A;  3E6B A;  3GO5 A;  2PN6 A;  3K9T A;  4YIF A;  1W4M A;  5JR3 A;  4BNC A;  3ZPL A;  3P9I A;  3I0T A;  2NAZ A;  3CTA A;  1IF1 A;  2W84 A;  1BC8 C;  4GO1 A;  3F8M A;  2KRF A;  2VXZ A;  4RAZ A;  1ZRC A;  1W7P B;  3N97 A;  3BP8 A;  2ESH A;  3E6D A;  3RYP A;  1YYV A;  3MEX A;  3GUD A;  4ENN A;  2PFB A;  1KA8 A;  2CQK A;  3PQK A;  4IVN A;  1LDJ A;  1R00 A;  1P92 A;  3RIR A;  3HRS A;  2M5W A;  1VTN C;  1YS6 A;  2OZ6 A;  1R5H A;  3JSO A;  4JK1 X;  2A6E F;  4LD5 A;  1S6L A;  4LLG F;  2VOO A;  4B8X A;  2XVC A;  1EH7 A;  3CUQ B;  1MGT A;  4OIQ F;  4UV9 A;  1HKT A;  4HV5 A;  3ZMU A;  3EYY A;  1P6R A;  3EYI A;  3G73 A;  1E17 A;  2F5E A;  4EM0 B;  3ABU A;  3V7S A;  4OMZ A;  1ZGA A;  5K5Q A;  2M8E A;  4JBA A;  4HBL A;  3DEU A;  3SQN A;  3QU3 A;  1ULY A;  3FMS A;  4BH9 A;  4RGU A;  2YSR A;  3P7N A;  3HOT A;  2BE5 F;  3KE2 A;  4GGG A;  3BJ6 A;  2HKO A;  5AIP A;  1IN6 A;  2EV5 A;  2YPR A;  4RGS A;  3RDI A;  3VB2 A;  3F23 A;  2XAS A;  5HLI A;  2ADU A;  3GEZ A;  5ICF A;  2HGC A;  2DPU A;  2GWR A;  2LKP A;  2D2W A;  3ISP A;  5FLX Z;  4CHU A;  4I7H A;  3C1D A;  2Q8K A;  5D5X B;  2DPD A;  3WTZ A;  3QPH A;  2XIG A;  4HX4 A;  5D6E A;  3N4M A;  4RB2 C;  4IRH A;  3CLO A;  2PMU A;  4KA4 A;  1OPC A;  2A3S A;  3RKX A;  1MJ9 A;  4MEY F;  4MTD A;  1RZ4 A;  1FYL A;  5K1Y A;  4KDP A;  2P8T A;  4PGG A;  2YX7 A;  1XGN A;  1YW7 A;  4XLN F;  1ZN2 A;  2W57 A;  3KCC A;  5L3E A;  3QP6 A;  1U5T B;  3V4G A;  1U3E M;  2FNP A;  3EQL F;  1FC3 A;  1I6X A;  3V8K A;  2NNY A;  2W25 A;  5L3F A;  1K7A A;  1A04 A;  3O3K A;  1YS7 A;  3IL2 A;  3BOQ A;  2DBB A;  4BAY A;  1TNS A;  4FX0 A;  5ED4 A;  1T98 A;  1RUN A;  3F8N A;  4AIH A;  1HSJ A;  4H0E A;  3WU1 B;  4L5J A;  4HX7 A;  3JAM Z;  1ZHF A;  2LNB A;  3BPV A;  4D0P A;  2UWM A;  5CYV A;  3F8C A;  3TO6 A;  2H94 A;  4KIB A;  3B02 A;  4G8X A;  3SFZ A;  5DD8 A;  4O6J A;  5J8C A;  3DFG A;  3IC7 A;  4GXO A;  2QLZ A;  1O3S A;  4HV6 A;  4EVI A;  4FT8 A;  3JTG A;  2DFI A;  4BYY A;  4IJA A;  5KVR A;  2XV4 S;  2RN7 A;  5A2Q Z;  1OMI A;  2LSO A;  3KP3 A;  4RGR A;  1K6O A;  1U2W A;  1TQM A;  3FM5 A;  2O3F A;  2OZU A;  3E5Q A;  2OQR A;  3MWM A;  3RPQ A;  3Q9V A;  1R1V A;  2R7D A;  4Q48 A;  1GXP A;  1DPR A;  2RC4 A;  2FU4 A;  2OU2 A;  1V3F A;  1F1Z A;  4HZF A;  5CVR A;  2M1B A;  5L3C A;  2L3D A;  4ZYD A;  1UST A;  3ELK A;  3I64 A;  3KLO A;  2XUB A;  2PI0 A;  4R1H A;  4M6X A;  3FXR A;  2PQ8 A;  3NEU A;  1ZG3 A;  2DLL A;  1OYW A;  5ICG A;  2QBY A;  3ZMT A;  4EM1 A;  4K2E A;  1JHF A;  1MZB A;  1HKS A;  3HSE A;  5CVJ A;  1OYY A;  2PLY A;  5AIQ A;  1WKM A;  5H6Q A;  3D0S A;  4IRG A;  4L0Y B;  1BJA A;  1PP8 F;  1P2F A;  2BEO A;  5E1W A;  3SXY A;  3LQQ A;  2ISY A;  1ZAR A;  1GVJ A;  4ZYH A;  1OYI A;  1HST A;  2A68 F;  1ZRE A;  1XB4 A;  3FM3 A;  1Z91 A;  5F6F A;  2XRO A;  1FNN A;  2QUF A;  1RI7 A;  2YX4 A;  3WTT C;  5ILS A;  2HYG D;  1SFE A;  1U78 A;  2ACJ A;  2FOK A;  5D4R A;  3QPT A;  4RB1 A;  1SAX A;  3FZV A;  4LK0 F;  4OU0 A;  5E17 F;  5ILU A;  3K69 A;  2FSW A;  2HOE A;  4EGY A;  2HZT A;  1SMY F;  1LB2 A;  3CUQ C;  5DYM A;  3GFL A;  1W5T A;  2P6T A;  3E5U A;  2VBY A;  1ZRD A;  1FYM A;  3HRU A;  3CDH A;  1FBQ A;  1QGP A;  2XAH A;  4UUV A;  4A5M A;  1TQI A;  1V4R A;  2EFQ A;  2CW0 F;  2V79 A;  2ZO4 A;  2JPB A;  2HYF A;  2VBW A;  4HA8 A;  3TDZ C;  1RUO A;  3ZN1 A;  2FE3 A;  3VEP A;  1KQ8 A;  2JZY A;  1G3T A;  2O6G E;  5ICC A;  4L0Z B;  2FNA A;  2W24 A;  1U6G A;  1JHH A;  3LST A;  4R79 A;  1XDU A;  2X4H A;  3TO7 A;  2FEZ A;  4UHT A;  4CIC A;  3GXO A;  5BMZ A;  2NYX A;  3FX3 A;  3MZH A;  1Z6R A;  3WTV C;  4EJO A;  2ZNZ A;  1R36 A;  2G7H A;  1LDK B;  3JW4 A;  2IP2 A;  3BZ6 A;  2G9W A;  3GWZ A;  3Q5F A;  3HOS A;  2EB7 A;  2EFN A;  1XDS A;  3W6J B;  4BQA A;  2M30 A;  2L4M A;  1ONV A;  2JPC A;  1O3Q A;  2H09 A;  4I98 B;  2ETH A;  1SFU A;  3MQ0 A;  4KIF A;  5HS9 A;  1FYK A;  1IN8 A;  1ZGJ A;  2M87 A;  4DNC A;  4P9U A;  1LEB A;  1LJ9 A;  1O7L A;  4I01 A;  4HF0 A;  2K02 A;  2LF7 A;  1HW5 A;  5D4S A;  3WE2 A;  1UFM A;  1SD7 A;  3L09 A;  5CVV A;  1O7F A;  4PGH A;  3T0Y A;  1STZ A;  2RDP A;  3WOD F;  2K86 A;  3KP6 A;  5HVQ C;  4RGX A;  3ZQ7 A;  4WX9 A;  2BBY A;  2JTV A;  1J59 A;  1K78 A;  4Q47 A;  2FRH A;  4RAY A;  3ECO A;  3OOP A;  2GQQ A;  4RB3 C;  2L02 A;  1PP7 U;  1HQC A;  1FX7 A;  4XRF A;  1S7O A;  1S3J A;  2H6B A;  3FXQ A;  3ABT A;  1USS A;  4Q5S F;  1J75 A;  1IAW A;  1Z1D A;  4G9Y A;  3BY6 A;  1H0M A;  1JGS A;  1B1B A;  4EJU A;  4ZZL A;  1EH8 A;  2ZME A;  1MJB A;  3BRO A;  2QQA A;  1XGM A;  1I5Z A;  4WXC A;  2STT A;  1FBS A;  1I27 A;  2QQ9 A;  5K5O A;  5LRR A;  4ASN A;  2IA2 A;  2RKH A;  1KU2 A;  4A2U A;  1OKR A;  2A6H F;  4WXD A;  2GIV A;  4DQ2 A;  1S7A A;  1E2X A;  4AD9 A;  4LJZ F;  1D3Y A;  2YR2 A;  2K7L A;  3PFI A;  3AAF A;  2DO7 A;  4UVA A;  3E3V A;  2HDC A;  4RS8 A;  4A0X A;  4AIJ A;  2VOP A;  2ZBK A;  1ZAO A;  2GA2 A;  3GYH X;  5E1X A;  2K4J A;  3I59 A;  4XLP F;  3TOA A;  4LB5 A;  5E1Z B;  2CO5 A;  4TV7 A;  1FPQ A;  4E70 A;  4WWC A;  2B0L A;  2CGP A;  3KLN A;  3GX4 X;  3LA3 A;  3KZZ A;  5BPI A;  4ZYG A;  2QM3 A;  2Y48 A;  2VBZ A;  4NQW A;  2PBI A;  5LRS A;  3T1B A;  4OOI A;  1BI1 A;  3QOP A;  5BPD A;  4B09 A;  1KU7 A;  2XHK A;  4FX4 A;  1DP7 P;  1WRJ A;  2VE9 A;  3HRT A;  4WK8 F;  2IT0 A;  2IA0 A;  1Z6T A;  1W7P D;  3GZ5 A;  4EMS A;  3TKY A;  1YQA A;  3S2W A;  2CWE A;  3WU0 A;  1LQ1 A;  2FF4 A;  1B59 A;  5A2Q K;  1EH6 A;  1IN7 A;  4BHC A;  2F5C A;  1P4A A;  4PZJ A;  2EFW A;  4ESF A;  3MZY A;  3FMQ A;  1QNT A;  4KN4 X;  4IHS A;  1IN5 A;  1AWC A;  4Y17 A;  3F3X A;  4YFX F;  4ENM A;  3SZP A;  2E7W A;  2H27 A;  4I09 A;  4A6E A;  3FWE A;  3IKV A;  5L3D A;  1D8K A;  1XCV A;  3GW2 A;  4ENK A;  4EQQ A;  3CO7 C;  3L7W A;  4HYE A;  1QQI A;  5HS8 A;  3VFZ A;  1BIA A;  4LMY A;  3ULQ B;  1KYZ A;  3H3Z A;  2F5F A;  1NHA A;  5LGU A;  2RQP A;  2ISZ A;  5EEG A;  3M9A A;  4CO8 A;  2JRT A;  4G6Q A;  1H9T A;  4P5O A;  1BN5 A;  3LFK A;  4OIN F;  1G4D A;  3HYI A;  1QBJ A;  3HRM A;  4WCG A;  3I58 A;  4BXU A;  3LWF A;  1K78 B;  4P55 A;  2DQL A;  1KGS A;  2A07 F;  4L9V A;  3T8T A;  2XKP A;  5J6X A;  1HW1 A;  1MD0 A;  5E18 F;  4KT5 C;  3KFW X;  5IT3 A;  4KUM A;  5D5V B;  1Z9C A;  1JE8 A;  3K1M A;  4Y13 A;  3WG9 A;  2KIU A;  4S04 A;  2P5L C;  4IXA A;  3FF5 A;  4Y15 A;  2YU3 A;  4G7H F;  4QWQ A;  5DEQ A;  2GXG A;  3D5L A;  5TRD A;  3ZP5 A;  1HBX G;  3DXJ F;  3EUH A;  2IW5 A;  4I0B A;  3WTY C;  4M71 A;  5IT9 K;  2GA1 A;  3ERE D;  1O3T A;  2EFO A;  4U0W A;  2VOD A;  3COA C;  2FXA A;  1MJA A;  3V8J A;  2VT3 A;  4U88 A;  3T8R A;  3I59 B;  1G3Y A;  4P9F A;  4U0Y A;  2FBH A;  2RGV A;  4KMF A;  2MBF A;  4M72 A;  4AIK A;  5E8I A;  3RPU A;  5JVT A;  2XRN A;  2L01 A;  4EJT A;  3I53 A;  5LBQ A;  2DAO A;  2Y0M A;  4M73 A;  4AVP A;  2C6Y A;  3KP2 A;  1DUX C;  1R7J A;  2BYV E;  3KEO A;  4HAM A;  4CGZ A;  4O5V A;  1X3U A;  3TO9 A;  4Z2Y A;  1BIB A;  2CYY A;  4KFC A;  2V9V A;  4HF2 A;  3TQN A;  2P5K A;  4OIP F;  5HS7 A;  4ENJ A;  4LK1 F;  1FWZ A;  2XAF A;  4G6D A;  4KN7 X;  5L3B A;  3FMR A;  5HDG A;  3IRR A;  2VT2 A;  1TTY A;  3MCZ A;  2PMH A;  2V1X A;  5F64 A;  3JSP A;  5DUI A;  1K79 A;  4OIR F;  3DPL C;  3ZMV A;  1QZY A;  3HIF A;  1I1G A;  5E20 A;  4EJW A;  1DPU A;  2HEO A;  4L18 B;  1UB9 A;  1XMK A;  2ESN A;  2XKO A;  3QU6 A;  4I02 A;  1F4K A;  3U2R A;  2LDU A;  2Z9O A;  2QYO A;  4MGR A;  3GVA A;  1XGO A;  2VON A;  2RV8 A;  2BV6 A;  3P9C A;  3WTU C;  2IVM A;  1Y0U A;  4L9T A;  2UXX A;  1QPM A;  4O3M A;  2PG4 A;  3FHZ A;  4ESJ A;  1S8N A;  2P4W A;  2R3S A;  1KQ9 A;  2L4A A;  4UVB A;  2XGX A;  1B9M A;  4YG2 F;  1B9N A;  4CXF A;  3WTS C;  1TNT A;  1IUY A;  2CSO A;  1DDN A;  1G3W A;  5JFR A;  3I54 A;  3LQR A;  1FSE A;  4GYI A;  3K1N A;  4OIO F;  3M8E A;  1FZP B;  1UHW A;  1YIO A;  5FD5 A;  1SD4 A;  2P7V B;  3GF2 A;  4S05 A;  1R22 A;  4LG0 A;  1PDN C;  3HHG A;  3F6V A;  4XSX F;  2H6C A;  1IRF A;  1R23 A;  2Q0O A;  1ZRF A;  3REO A;  1RIO H;  2E1N A;  4N9H A;  2QZ8 A;  2P5V A;  5HLH A;  6PAX A;  4EGZ A;  3CO6 C;  4UVC A;  2DK5 A;  1IRG A;  2IA1 A;  3TGN A;  2A5Y B;  3G3Z A;  1L3L A;  1T0F A;  5D8L B;  5IT9 Z;  1ZG1 A;  4N0B A;  5D8K B;  4KMU X;  2NRA C;  2OQG A;  1L0O C;  1XCB A;  5LHI A;  5BS6 A;  3QRF F;  4G7Z F;  3RYR A;  2DT5 A;  4MQV A;  1JXS A;  4NHJ A;  3SZT A;  2HQR A;  1D8J A;  5D5U B;  3DKW A;  1ODD A;  1P4X A;  2OD5 A;  3PQJ A;  2PJP A;  4MEX F;  4I2O A;  1XD7 A;  2EFP A;  3VOE A;  3R60 A;  1IW7 F;  1R1T A;  2KIM A;  4HOB A;  2JSC A;  3RJP A;  3ZN0 A;  2Q2E A;  4UNO A;  4GCV A;  3SHF A;  2ZXJ A;  1GHC A;  2R7F A;  3P9K A;  4L9N A;  3ECH A;  3CUQ A;  2FQ3 A;  1ZYR F;  5FO5 A;  2WC2 A;  1WSU A;  5LGN A;  3JTH A;  1F5T A;  4LFU A;  2GAU A;  1MDM B;  1XSX A;  1GXQ A;  2QWW A;  2W85 A;  2WTE A;  4MNU A;  4LLN A;  1U5T C;  2HS5 A;  2DW4 A;  2MLG A;  3R0A A;  5BOX A;  1TQP A;  2NNN A;  5FFX A;  3WE3 A;  1TBX A;  5E8G A;  1XGS A;  1CF7 B;  4P96 A;  2MD5 A;  3C7J A;  2X0L A;  2HFH A;  1EV7 A;  2G7U A;  3IKT A;  4ZH4 F;  5AON A;  3C3W A;  5TJJ A;  3WTX C;  2DTR A;  4XSZ F;  3F21 A;  2Y75 A;  1T39 A;  1O57 A;  3MAJ A;  4L9J A;  3F6O A;  3R6S A;  3FXU A;  1IXR C;  2E1C A;  2WV0 A;  1ZH5 A;  3EET A;  4CDG A;  3CUO A;  5DUK A;  3RKW A;  2DQR A;  3L00 A;  3WGG A;  3I4P A;  3RKY A;  3E6M A;  1YTY A;  1F9N A;  1FP1 D;  3M7G A;  5HOO A;  3GZ6 A;  2VC0 A;  4L5I A;  5ICE A;  3LA2 A;  1J5Y A;  2O0Y A;  4LB6 B;  3DP7 A;  4ON0 A;  1QZZ A;  2HTS A;  5EEH A;  5D5W B;  2TDX A;  2ZFW A;  1UCR A;  1TLH B;  3HUG A;  3R4K A;  4A6D A;  1T38 A;  4HDU A;  3GFI A;  4M74 A;  5ERI A;  2FML A;  1Z7U A;  3HHH A;  2HKX A;  4M6Y A;  1AOY A;  4IPA A;  1FT9 A;  2K27 A;  3V7C A;  3MFK A;  3NRV A;  1LDD A;  4KIC A;  4U7D A;  4U7B A;  1XSV A;  1ON2 A;  5H6R A;  3KZY A;  4RB0 A;  3KET A;  2EK5 A;  3U9G A;  2XAG A;  3IHU A;  3EDP A;  1HXD A;  4HQM A;  4IF4 A;  3ZMD A;  3KEQ A;  2V1D A;  4CYD A;  2DI3 A;  2EV6 A;  1G3S A;  2GXB A;  5FLX K;  1IZ1 A;  3K1P A;  3J81 K;  2IJL A;  2VC1 A;  4HF1 A;  3M1E A;  1Q1H A;  3ML6 A;  1R58 A; 
#chains in the Genus database with same CATH topology
 3ABM H;  3GBG A;  3WTW C;  4Q4Z F;  2DFF A;  5KNL A;  4GYG A;  4A3F J;  1ETY A;  1T56 A;  2Z3Y A;  1CGP A;  3F9K A;  1T8I A;  4AWX B;  2WWY A;  3A03 A;  1O3R A;  2NVX J;  2QKM B;  4XBF A;  1HA8 A;  2RVC A;  5H20 A;  3O2P E;  2IGK A;  3Q3S A;  2HOS A;  1LEA A;  1YOV B;  2EJR A;  5HDK A;  2XF5 A;  4ABZ A;  1B4A A;  1OLT A;  3PO2 J;  2EZH A;  3W6K B;  1UHM A;  2OA4 A;  2M4K A;  2LLK A;  3H92 A;  5FFZ A;  3JRB A;  2JA5 J;  2KLO A;  4OMY A;  3CF2 A;  2MA3 A;  3F8B A;  1QHH D;  2KJB A;  3OOU A;  4AUX A;  3BG7 A;  4RLF A;  5IOY A;  4Y4R A;  1A31 A;  1HDD C;  5LEJ A;  5C44 J;  1D0Z A;  2CUE A;  3BJA A;  3Q9S A;  2CG4 A;  3HSF A;  1ZLJ A;  3HTU A;  2HWV A;  5HLG A;  4ESB A;  4KNY A;  3R61 A;  1J0R A;  4BJT A;  2OF7 A;  4EV0 A;  2RNJ A;  1GV2 A;  3ZMS A;  5FKN A;  3E6C C;  1W7P A;  1J2X A;  3TED A;  2QEN A;  1R5G A;  2UZK A;  1HW2 A;  1ETO A;  3KP5 A;  4M9S A;  2DOF A;  3WGH A;  4MHG A;  3F22 A;  3HM5 A;  1H88 C;  2VQG A;  4DYR A;  3K4M A;  4I99 C;  3IWZ A;  3R0J A;  5LHH A;  3J81 Z;  3TDU C;  4ZYE A;  3TOB A;  4ETS A;  2LH9 A;  2IPQ X;  1VQ9 I;  2QBY B;  1X1B A;  2J5P A;  3LL7 A;  1HF0 A;  3TW7 A;  5DD4 A;  2VKE A;  1XN7 A;  2ME0 A;  2UUZ A;  1R4M B;  2H1K A;  2ZNY A;  4A3M J;  2MGQ A;  1P9Q C;  2EA4 A;  2W1O A;  1IGN A;  4NB5 A;  4CSW A;  4A0Y A;  3J7Y J;  5CLS A;  3I3L A;  2VKH A;  3DF8 A;  5K7Z A;  1N77 A;  1HKQ A;  4HW0 A;  4M9X A;  2WB1 N;  1U8R A;  3AG3 H;  3HOW J;  4HST A;  3NAU A;  3FKI J;  1P7J A;  4HX8 A;  3DTI A;  5DV5 A;  3A1Y A;  2CQQ A;  3LAJ A;  1BI0 A;  4MQ9 F;  3CCL I;  1TL8 A;  5EF6 A;  1ZG5 A;  1TW2 A;  1J7K A;  3L9F A;  1R1U A;  5BQT A;  2Q1Z B;  3HSR A;  1JI8 A;  2CU7 A;  2J5O A;  3H3U A;  3UNG C;  4U0V A;  2COM A;  3DV8 A;  3KX2 A;  3WG7 H;  5F0H A;  4BXF A;  4QLC U;  2P6S A;  1BI3 A;  1FY7 A;  1QO0 D;  3DQV C;  1HCR A;  4II2 A;  1FIA A;  2MC3 A;  1T2K A;  2VBX A;  4G7O F;  2A05 A;  2E35 A;  2D1H A;  4C30 A;  3K4K A;  1K83 J;  5J40 A;  2Z99 A;  5CJ9 A;  5DM6 F;  1B8I B;  3H36 A;  2K4B A;  2ZCW A;  4M6V A;  1BW5 A;  1WQ2 A;  3OR2 C;  5CVI A;  4F52 A;  1RC9 A;  2Q2E B;  3J80 Z;  2BY2 A;  1T6S A;  4V2F A;  2HZD A;  3O6B B;  4AU7 A;  2QQB A;  3GFM A;  3S1R J;  3GLL A;  4KIG A;  1WJB A;  2JJ7 A;  2EV0 A;  3OYH A;  2LKS A;  2VB6 A;  4UB6 C;  3T5X A;  1WWX A;  1D5V A;  1MDM A;  4IRI A;  3S2H J;  2HQA A;  2HTJ A;  4HRI A;  1VZ0 A;  5DCM B;  2NXN B;  2F4M B;  1C0W A;  1VQ7 I;  2VQC A;  2O61 A;  3MKZ A;  1VQM I;  2ZSH B;  4BJ6 C;  3JAM K;  4UB8 C;  1A35 A;  3I71 A;  4G94 A;  3VDX A;  4ZDP A;  3QQA A;  1NG6 A;  1CQT A;  4M9Z A;  1BC7 C;  2DN0 A;  3M8F A;  3C2G A;  3FK6 A;  3MVP A;  4F92 B;  1N25 A;  5LFA A;  1IRX A;  3BR6 A;  3BPX A;  3NQO A;  4G12 A;  1WH7 A;  2FBK A;  2AXL A;  2AQF A;  4HQE A;  4IEJ A;  1LNW A;  1IXC A;  2M45 A;  3VOD A;  1H9G A;  5LLQ A;  1YIT I;  3E97 A;  3QYE A;  4HEA 2;  3KP4 A;  2AS5 F;  3ZMZ A;  2LF8 A;  2FA5 A;  3ROU A;  2OTL I;  3K70 D;  3CJN A;  2XC7 A;  2BW3 B;  5HDN A;  1I1S A;  3RZD J;  3BR0 A;  5FRO A;  5E3O A;  2CFX A;  5LEK A;  1B6A A;  4A0Z A;  1JJ8 C;  2PEX A;  2V7F A;  2KDZ A;  1UG2 A;  4ZZD A;  5FGM A;  4MTE A;  2HR3 A;  3JRC A;  3RTR A;  3DKX A;  4X6A J;  3GFJ A;  5GAD J;  2GZW A;  1RES A;  3B6A A;  3JRG A;  4EM2 A;  1BM9 A;  3H35 A;  1W1W E;  3BJO A;  4BHP A;  3BDD A;  2Z33 A;  5EZG A;  3S32 A;  3LAP A;  1MKM A;  5FD6 A;  2HXI A;  4IO9 F;  1GLN A;  4MFD A;  2X1C A;  3EPZ A;  2STW A;  4IQJ A;  2BGC A;  5KK1 A;  2FQ4 A;  4HSR A;  2FBI A;  3OIP A;  3J7Z I;  1Y1V J;  2A61 A;  4HG2 A;  5GTI C;  1RNL A;  4BJ5 C;  2B63 J;  3AG2 H;  1PYV A;  2R5Z B;  2DMN A;  2LTP A;  2UXN A;  3RSN A;  3RI4 A;  1KU3 A;  2LC2 A;  4LG0 B;  2GM4 A;  4UY8 I;  4RDU A;  3U1K A;  1Y56 A;  1YW8 A;  2MH9 A;  4C9Y A;  1FLI A;  2E36 A;  1U0J A;  3WHB A;  3WGI A;  1KQ0 A;  4EJV A;  3MMY B;  2DK8 A;  4I76 A;  1UMQ A;  2MLK A;  4ZDL A;  1WCM J;  1Y8R B;  2FMY A;  3FK7 A;  3IRQ A;  1D1A A;  1M1E B;  2VE8 A;  3L2C A;  3GLX A;  4BHB A;  2M7A A;  5DCF A;  4HLX A;  4BQO A;  2GIZ A;  2M2E A;  5K5R A;  3DU5 A;  4II3 A;  1UG0 A;  4YFN F;  1BI2 A;  2DCE A;  4X0G A;  1MMN A;  3E5X A;  4HDV A;  1BBY A;  1F43 A;  2F2E A;  3F8F A;  4IHT A;  1W5S A;  4DW6 A;  1FSH A;  2KJC A;  1Z0X A;  1CF7 A;  2XAQ A;  1X19 A;  4AID A;  2HQN A;  1YLF A;  2V26 A;  2WY7 Q;  2D1V A;  2KIF A;  1YG2 A;  3IWF A;  1HDP A;  4IX7 A;  2D5V A;  4QPQ A;  2FOW A;  4YII A;  1I3A A;  4PJN A;  1AU7 A;  1Z05 A;  4A3C J;  2M3A A;  2PMZ A;  1QHG A;  4KYW A;  2EIL H;  5ILV A;  4HLY A;  5GPA A;  2X1D A;  2BY0 A;  2IS1 A;  1ON1 A;  2DDA A;  2EWN A;  1S72 I;  1YJW I;  1EF4 A;  2NVQ J;  1NTC A;  2XAJ A;  1JKP C;  2P7C B;  4LLL A;  1D1C A;  2O03 A;  1IXS B;  3FXK A;  2DJN A;  3K0L A;  1FMW A;  3OV8 A;  3KP7 A;  2EA2 A;  2Y30 A;  2HU9 A;  3QP5 A;  5IY5 H;  1UHS A;  3C18 A;  1SD6 A;  5L3G A;  1OR7 C;  1P4W A;  3V7R A;  4C2M J;  1G6N A;  4N9I A;  2AO9 A;  4UV8 A;  3OS0 A;  1YW9 A;  4PCQ A;  2MH2 A;  1W36 C;  3J7A O;  3S1M J;  1RRJ A;  4F7Z A;  4BQQ A;  4XM3 A;  3VYT B;  1GDT A;  2JA8 J;  1A6I A;  2X6W A;  2DU9 A;  4A12 A;  5J1R A;  3L2Q A;  2LD5 A;  1TW3 A;  3DEW A;  4A5N A;  2E60 A;  4CCL A;  1XSD A;  1LVA A;  3BLY A;  1SMT A;  1N75 A;  2BVM A;  2JT1 A;  2A69 F;  3K7A J;  4PDK A;  3U1D A;  5DCM A;  4YFK F;  3IH2 A;  1BOA A;  2CW8 A;  2OAZ A;  2QVO A;  2Z5U A;  2ZME B;  4GRI A;  4XKC A;  1ZLK A;  2E7X A;  4XLA A;  5CVU A;  1VQ8 I;  4JX4 A;  2ZKZ A;  2ID3 A;  4FHT A;  5JHU A;  1REP C;  1FOK A;  4IHX A;  1YFH A;  1KU9 A;  1SFX A;  1ZR2 A;  3BWG A;  2ELH A;  5FJ8 J;  4CZZ A;  3MZ8 A;  1OCC H;  3HG9 A;  1HLV A;  1OR7 A;  3PNV A;  5FB2 A;  5J8F A;  3I5U A;  2F4O B;  2DFH A;  3IH3 A;  3V8L A;  1YRN B;  2NS0 A;  1KYW A;  3LA7 A;  2O8X A;  2XPV A;  1UZC A;  1IN4 A;  1ZK8 A;  5JI6 A;  4M3D A;  1E3O C;  1N78 A;  3AKZ A;  2V1U A;  2VN2 A;  4X1E A;  5JLW A;  1RET A;  3QAH A;  2K3F A;  4XL9 A;  1BR4 A;  1FMV A;  2R7T A;  1T95 A;  4XK4 A;  2WAE A;  4XLC A;  5DDG A;  5LHG A;  3JRA A;  2L0K A;  4Y33 A;  2D45 A;  1V55 H;  1R6R A;  4LIV A;  1FBU A;  3NWT A;  3HTS B;  1X2M A;  1D1B A;  2KP6 A;  3LSJ A;  3F72 A;  5KCM A;  1X3Z B;  3HGG A;  3CLQ A;  2X9D A;  3G6E I;  3K2Z A;  3OIO A;  2IRF G;  1A6Q A;  2L7Z A;  5F1R A;  4JQF A;  4R8H A;  2XB5 A;  2XGE A;  4UXN A;  3SEQ A;  2LVS A;  4I0A A;  5F0C A;  5LGT A;  4WXH A;  5D6F A;  3B73 A;  2JN6 A;  2V6C A;  5EZH A;  2HDW A;  2ZJ2 A;  3CP8 A;  1FP2 A;  4C3J J;  2DT7 B;  2DJI A;  2L54 A;  1OCP A;  1SVL A;  1J9I A;  3X2Q H;  3DPT A;  4WF2 A;  1S29 A;  1SD5 A;  1YO5 C;  2OBP A;  2L7K A;  1U5T A;  3FXJ A;  5J47 A;  2F5D A;  5IOZ A;  1PUE E;  2K85 A;  2CUF A;  3J80 K;  4XN3 A;  2KKO A;  2LBF A;  2ZJQ F;  1XMA A;  4M3B A;  1MIJ A;  5GAG J;  4LGW A;  1WI9 A;  3E6B A;  3GO5 A;  1PUF B;  2PN6 A;  3K9T A;  4YIF A;  3W3C A;  1W4M A;  5JR3 A;  1WI3 A;  4BNC A;  3ZPL A;  3P9I A;  2JSP A;  3I0T A;  4IHY A;  2NAZ A;  3CTA A;  3VYU B;  1IF1 A;  2W84 A;  4GO1 A;  1BC8 C;  3F8M A;  2OJE D;  3DBR B;  2KRF A;  1VQ4 I;  4FE4 A;  2VXZ A;  4RAZ A;  4LOC A;  1ZRC A;  3GCM A;  1JUP A;  1W7P B;  3N97 A;  3BP8 A;  2ESH A;  3E6D A;  3RYP A;  1MBE A;  1YYV A;  3MEX A;  3GUD A;  4ENN A;  2PFB A;  1KA8 A;  2CQK A;  3PQK A;  2EQR A;  5JLX A;  4IVN A;  1LDJ A;  3BZK A;  3H0D A;  1YX3 A;  2E71 A;  1OCZ H;  1R00 A;  4KJZ A;  1P92 A;  1JTX A;  3HRS A;  3RIR A;  2RNG A;  1XMX A;  2M5W A;  1YHQ I;  2XGC A;  1MNE A;  4OAZ A;  1VTN C;  2WB1 A;  3DCF A;  1JUM A;  1LFP A;  3CC2 I;  1YS6 A;  2OZ6 A;  1R5H A;  4RMN A;  1VQ6 I;  3JSO A;  4LIT A;  4JK1 X;  2VQL A;  4B43 A;  1VQN I;  2A6E F;  4LD5 A;  4NC7 A;  1S6L A;  5FLV A;  3S15 J;  4LLG F;  2VOO A;  3AL0 B;  3CMY A;  4B8X A;  2QA4 I;  1RPW A;  2XVC A;  3OS2 A;  4IHV A;  3H9J A;  1EH7 A;  3CUQ B;  1MGT A;  4OIQ F;  2X85 A;  2CV1 A;  4UV9 A;  1HKT A;  2ELK A;  4HV5 A;  1T0F C;  4CCN A;  1R4N B;  2LRE A;  3ZMU A;  3EYY A;  1P6R A;  3EYI A;  1QPI A;  3G73 A;  3K70 C;  1E17 A;  3DBH B;  2F5E A;  5CQE A;  4EM0 B;  3OYE A;  4E4H A;  1TT5 B;  2X48 A;  3ABU A;  3V7S A;  1IO2 A;  3OYA A;  1IJW C;  4OMZ A;  1XC5 A;  1ZGA A;  3LFU A;  2M8E A;  5K5Q A;  4IOA F;  4JBA A;  2RQQ A;  1X58 A;  3S3O A;  4HBL A;  3DEU A;  3SQN A;  3ZR8 X;  3QU3 A;  2HXO A;  3L1P A;  2WAQ N;  4JX6 A;  2V1N A;  1ULY A;  3FMS A;  1YRN A;  2X6X A;  2MD0 A;  4BH9 A;  3OYC A;  4RGU A;  2JRM A;  2YSR A;  3KIO A;  3LSM A;  2DDB A;  4IOC F;  2HQ5 A;  2R7X A;  3P7N A;  1OCR H;  2HNH A;  1YE9 A;  3HOT A;  1LE8 B;  2BE5 F;  2ZXH A;  3KE2 A;  4V19 K;  4GGG A;  4B3X A;  5K7F A;  2LY1 A;  1OJL A;  3BJ6 A;  2HKO A;  5AIP A;  9ANT A;  3GTJ J;  3M8J A;  1IN6 A;  3FIS A;  3OYD A;  2NVU B;  2EV5 A;  1LUJ B;  3HZJ A;  4ANJ A;  2YPR A;  3H3V K;  4RGS A;  3RDI A;  3VB2 A;  3F23 A;  2XAS A;  5H2F C;  5F04 A;  2W00 A;  5HLI A;  2ADU A;  1AHD P;  4XKB A;  1B72 A;  3GEZ A;  5ICF A;  2HGC A;  2DPU A;  1VND A;  2GWR A;  3LSH A;  2LKP A;  2D2W A;  2ID6 A;  3ISP A;  5FLX Z;  2ELJ A;  2KRC A;  1J09 A;  4BKX A;  2LG4 A;  4ZTJ A;  4CHU A;  4I7H A;  3C1D A;  2Q8K A;  5D5X B;  2K9Q A;  2DPD A;  3WTZ A;  2VL8 A;  2Z16 A;  4BDZ A;  2JA6 J;  4E7J A;  3QPH A;  2XIG A;  4B47 A;  4HX4 A;  4QSH A;  2W4S A;  5D6E A;  3N4M A;  4RB2 C;  1KON A;  4IRH A;  3CLO A;  4MLO A;  2PMU A;  1GVD A;  4KA4 A;  2CV0 A;  1OPC A;  2A3S A;  3RKX A;  3V42 A;  3MKY B;  3ONQ A;  1MJ9 A;  3CCQ I;  5IYC J;  4MEY F;  4MTD A;  1RZ4 A;  1FYL A;  5K1Y A;  2X51 A;  4KDP A;  4XN0 A;  4A3J J;  2P8T A;  4E7K A;  3JRH A;  1A5J A;  3K4B A;  3CES A;  4PGG A;  4E7Z A;  2YX7 A;  2BOL A;  1XGN A;  1YW7 A;  4Y3O A;  1DGW Y;  4XLN F;  1ZN2 A;  2W57 A;  5BNG A;  3KCC A;  4CCO A;  4A3B J;  2M0C A;  2ECC A;  5L3E A;  3QP6 A;  1U5T B;  3V4G A;  4CCJ A;  2FNP A;  1U3E M;  3CDI A;  3K4J A;  1Z77 A;  3EQL F;  2XF7 A;  1X3W B;  2XB0 X;  1FC3 A;  1I6X A;  2K9L A;  3V8K A;  2VKD A;  2NNY A;  2IGM A;  2W25 A;  3ZQQ A;  5L3F A;  1K7A A;  4A3L J;  1A04 A;  1U9N A;  2O9L A;  2CQ7 A;  3O3K A;  1E3P A;  1QRY A;  3ZQC A;  1YS7 A;  1W36 D;  5FKM A;  4RBO A;  3A4C A;  1X4O A;  3IL2 A;  4CCK A;  3CMA I;  2LRD A;  3BOQ A;  3H5A A;  2DBB A;  3H1C A;  4BAY A;  3HPH A;  4B1R A;  2WAD A;  1TNS A;  4FX0 A;  2P81 A;  5ED4 A;  3WU2 C;  1T98 A;  1RUN A;  2GBY A;  4D1Q A;  3F8N A;  3A01 A;  3QYF A;  3H9Q A;  4AIH A;  1HSJ A;  4H0E A;  4F91 B;  4IZZ A;  1ETW A;  3WU1 B;  1F36 A;  3ZOB A;  4L5J A;  4HX7 A;  2DOD A;  3JAM Z;  1ZHF A;  4P1W A;  2M4G A;  4CA0 A;  2LNB A;  3BPV A;  4D0P A;  3RZO J;  2UWM A;  4XLF A;  5CYV A;  3F8C A;  3TO6 A;  2KDO A;  3LSR A;  1IV6 A;  2H94 A;  2GOM A;  2COB A;  3CDL A;  4KIB A;  2HVS A;  1X2N A;  1WVR A;  3B02 A;  3KPH A;  4G8X A;  4DBQ A;  4PSW A;  3SFZ A;  1HOM A;  5DD8 A;  1SFO J;  4O6J A;  4XQF A;  5J8C A;  4XON A;  3DFG A;  3IC7 A;  4GXO A;  2QLZ A;  1O3S A;  4HV6 A;  4NUB A;  3IAS 2;  2KIS A;  4EVI A;  2R7V A;  1GUU A;  4FT8 A;  4UUT A;  4XNF A;  1OQY A;  1ITY A;  3JTG A;  2KPM A;  2FJ1 A;  2DFI A;  4BYY A;  2O8K A;  1V5E A;  4IJA A;  2K9S A;  4YRV A;  3E7L A;  5KVR A;  5HOD A;  2DMQ A;  2CMP A;  2XV4 S;  2RN7 A;  1DU6 A;  5A2Q Z;  2FX0 A;  2AHQ A;  1OMI A;  3PUB A;  2LSO A;  3KP3 A;  4RGR A;  3VWB A;  1K6O A;  2OC6 A;  2QKL B;  2L9R A;  1U2W A;  2HDD A;  1TQM A;  2ZME C;  2JA2 A;  3FM5 A;  4L5E A;  2O3F A;  1SAN A;  4BEH B;  3GME A;  2OZU A;  3E5Q A;  3AG1 H;  2H1L A;  2OQR A;  3MWM A;  2L9N A;  3RPQ A;  1A36 A;  4B4C A;  2BY1 A;  3Q9V A;  3CME I;  1Z3X A;  2VLA A;  1R1V A;  2R7D A;  4Q48 A;  3PL8 A;  2VAS A;  1WGX A;  3DLL F;  1GXP A;  1X1D A;  1DPR A;  2RC4 A;  3RKQ A;  3OY9 A;  5IYD J;  2FU4 A;  2OU2 A;  2QSH X;  1V3F A;  1I3Q J;  2JQ7 A;  4ZTF A;  3C2H A;  2OUM A;  3OWT A;  1F1Z A;  4NC6 A;  4HZF A;  2VJ4 A;  3TL4 X;  2E2I J;  2A5W A;  3OL3 A;  5CVR A;  2R7S A;  2M1B A;  3GTM J;  3M3Y J;  5L3C A;  2QF7 A;  2L3D A;  4ZYD A;  3OMY A;  2VJI A;  2R7Q A;  1UST A;  3OYG A;  3C2B A;  2MC4 A;  2VQH A;  5E3N A;  4PJL A;  1IRZ A;  3ELK A;  3I64 A;  3K4N A;  3KLO A;  3LSK A;  2QCO A;  4JX5 A;  2Y69 H;  2XUB A;  3P5J A;  3H5R A;  3HXL A;  3QYB A;  3IH4 A;  5JHF A;  2PI0 A;  4R1H A;  4M6X A;  3FXR A;  4BE2 A;  2PQ8 A;  3TW6 A;  3CQZ J;  3NEU A;  1ZG3 A;  2DLL A;  1OYW A;  5ICG A;  2QBY A;  3ZMT A;  4EM1 A;  4K2E A;  1JHF A;  1MZB A;  4RLQ A;  1HKS A;  3HSE A;  4H4K C;  3A0H C;  1FOY A;  1NG7 A;  2JMW A;  1MND A;  2AXT C;  2IAI A;  5CVJ A;  1U9O A;  1OYY A;  2PLY A;  2L5Q A;  5AIQ A;  2HI3 A;  1WKM A;  5H6Q A;  4A3D J;  3D0S A;  2NVT J;  3EUH C;  4IRG A;  4DIQ A;  4L0Y B;  1BJA A;  1PP8 F;  1W0U A;  1WZ2 A;  1NK2 P;  4BGD A;  1P2F A;  2BEO A;  3LSG A;  2WV1 A;  1DQU A;  5E1W A;  1IG7 A;  3SXY A;  1V5F A;  2ZXW H;  3LQQ A;  4KT6 A;  2ISY A;  1TT0 A;  1ZAR A;  1GVJ A;  3OL4 A;  5B66 C;  3CCM I;  4ZYH A;  1OYI A;  1ETX A;  1HST A;  2A68 F;  1ZRE A;  2DA2 A;  2VPL A;  5F0F A;  1XB4 A;  1BR1 A;  3FM3 A;  1Z91 A;  4BE0 A;  3BCA A;  3BR5 A;  3BTI A;  3MD2 A;  5KAI C;  5F6F A;  2XRO A;  3HEF A;  1FNN A;  4XRS A;  2QUF A;  2IS4 A;  2OPT A;  1RI7 A;  2IXS A;  2YX4 A;  3WTT C;  1I39 A;  5ILS A;  2HYG D;  2JVH A;  4A3I J;  1SFE A;  4C3H J;  1U78 A;  2ACJ A;  4U87 A;  1JKR C;  2FOK A;  4M3G A;  5D4R A;  3QPT A;  4RB1 A;  3H0G J;  1NH3 A;  3AFH A;  3WHC A;  2F4I A;  4DJA A;  1SAX A;  1XG1 A;  2E34 A;  4JYK A;  3FZV A;  4LK0 F;  4OU0 A;  4A3G J;  1MBJ A;  5E17 F;  2EZI A;  5ILU A;  3K69 A;  3ZQH A;  2FSW A;  4F55 A;  2HOE A;  1WJC A;  3S1N J;  4YIR X;  4EGY A;  2HZT A;  4IHW A;  1SMY F;  3EUA A;  5B5E C;  1LB2 A;  3CUQ C;  5DYM A;  4A3K J;  1QVU A;  5M5W J;  3GFL A;  1W5T A;  2P6T A;  2B7E A;  2WBM A;  3W2W A;  3E5U A;  2VBY A;  3QOE A;  1FYM A;  5EJC A;  2Y9Y A;  3HRU A;  3CDH A;  1ZRD A;  1FBQ A;  1P7I A;  1QGP A;  2E2J J;  3BTL A;  2XAH A;  1K4S A;  4UUV A;  4A5M A;  3DPU A;  1TQI A;  1V4R A;  4HNT A;  3I55 I;  2Y0S A;  2EZL A;  3CCU I;  2EFQ A;  4RM2 A;  1ENH A;  4XMY A;  3GTL J;  2CW0 F;  2V79 A;  2ZO4 A;  1DU0 A;  2TRT A;  1ZTR A;  1BA5 A;  2JPB A;  2HYF A;  3W2V A;  4XOR A;  2CV2 A;  4YEL A;  2VBW A;  4HA8 A;  4ZYA A;  3TDZ C;  5J4V A;  1RUO A;  4XLE A;  3ZN1 A;  3A01 B;  2F6C A;  1R5I D;  2FE3 A;  3VEP A;  1KQ8 A;  2JZY A;  1G3T A;  2O6G E;  5ICC A;  4L0Z B;  1FTT A;  2DA4 A;  2DT6 A;  1TP4 A;  2FNA A;  4NNJ A;  1LFB A;  2W24 A;  1U6G A;  1LKX A;  1JHH A;  3LST A;  4R79 A;  2VI6 A;  1XDU A;  3HKZ A;  4FTH A;  2DTZ A;  3GTQ J;  2Z2S B;  3HKZ N;  5HLT A;  1BR2 A;  2X4H A;  3G1O A;  1EKE A;  3TO7 A;  2XAU A;  2FEZ A;  4E7S A;  4UHT A;  2MG4 A;  1H8A C;  4CIC A;  1RKT A;  3GXO A;  5BMZ A;  1MSE C;  2NYX A;  3FX3 A;  3M07 A;  3BQZ A;  4B3A A;  1Z6R A;  3WTV C;  5KHD A;  3MZH A;  2PJR A;  4ZDO A;  4EJO A;  3ZQI A;  2ZNZ A;  2XSD C;  3JRF A;  4OAY A;  1R36 A;  3K2A A;  2G7H A;  3OYM A;  1LDK B;  1DP3 A;  3JW4 A;  2IP2 A;  3G4S I;  3TP0 A;  3BZ6 A;  4BUP A;  2G9W A;  3GWZ A;  1TWC J;  4LG3 A;  1Z3Y A;  3Q5F A;  3HOS A;  2EB7 A;  2BHY A;  2EFN A;  1XDS A;  3W6J B;  4BQA A;  2M30 A;  2L4M A;  4M3E A;  3RQI A;  1VQK I;  3HUG B;  3G1L A;  3FIW A;  1ONV A;  3NWS A;  4F3Q A;  2JPC A;  2DFE A;  3QOD A;  1O3Q A;  2H09 A;  2G0E A;  4I98 B;  2ETH A;  3JR9 A;  1SFU A;  3E1S A;  3MQ0 A;  4KIF A;  2A6T A;  3A0B C;  4B48 A;  5B3S H;  3OSF A;  2I5U A;  5HS9 A;  1FYK A;  1IN8 A;  1ZGJ A;  2EIN H;  2KIQ A;  3CCS I;  5HNH A;  3DTK A;  2W82 A;  2M87 A;  4DNC A;  4MO7 A;  4P9U A;  1LEB A;  1LJ9 A;  1O7L A;  4I01 A;  5HNF A;  3FDY A;  4GDF A;  4CYC A;  1OFC X;  2NS7 A;  3JRD A;  1XS9 A;  4HF0 A;  2VIX A;  1SVM A;  2K02 A;  2LF7 A;  1HW5 A;  2DYS H;  5D4S A;  1SC7 A;  1ZQ3 P;  1LE8 A;  3WE2 A;  1UFM A;  2BHZ A;  3VYS B;  4BU2 A;  3GTP J;  1SD7 A;  3L09 A;  2Y31 A;  3HOU J;  1Z67 A;  4BS9 A;  5CVV A;  5CQG A;  1O7F A;  4PGH A;  1Z21 A;  3T0Y A;  1STZ A;  3BR2 A;  4BAC A;  2RDP A;  3WOD F;  1W0T A;  1MMS A;  4PFO A;  2K86 A;  3KP6 A;  1Y0N A;  4RGX A;  1MMA A;  3ZQ7 A;  5HVQ C;  5E3M A;  4WX9 A;  5F27 A;  2BBY A;  2JTV A;  2E1O A;  1J59 A;  1K78 A;  1B72 B;  3SEZ A;  4Q47 A;  4CUG A;  3OYF A;  4NC8 A;  2FRH A;  4RAY A;  3ECO A;  3D5S C;  2GQQ A;  3OOP A;  1ZEL A;  4RB3 C;  2L02 A;  3OYJ A;  5F08 A;  1Y1W J;  3OSG A;  3L2U A;  1HQC A;  1PP7 U;  1FX7 A;  5FLM J;  4XRF A;  1S7O A;  4FCY A;  1S3J A;  2KT0 A;  2H6B A;  1EA3 A;  3ABT A;  1USS A;  3FXQ A;  3SZG A;  4Q5S F;  1X1C A;  1TWA J;  1J75 A;  1IAW A;  2HPM A;  3OYB A;  1BW6 A;  1Z1D A;  1WH5 A;  1JKQ C;  1QU3 A;  4N4O B;  2IEK A;  4G9Y A;  4XKV A;  3BY6 A;  1H0M A;  3HOZ J;  1QA6 A;  1JGS A;  3I4M J;  1B1B A;  4EJU A;  2R7Z J;  2V9K A;  4ZZL A;  1OCT C;  2BZT A;  1WJE A;  2ZJP F;  2CH0 A;  2LP0 A;  1EH8 A;  2ZME A;  1Y39 A;  2I8D A;  1MJB A;  2K9N A;  3BRO A;  5GAH J;  2QQA A;  1XGM A;  4W1U A;  2Z1D A;  2UV1 A;  2IS2 A;  1I5Z A;  4WXC A;  1MSF C;  2STT A;  1FEX A;  1RR8 C;  1FBS A;  1I27 A;  2QQ9 A;  2XDV A;  3H5N A;  5K5O A;  2R5Y B;  5LRR A;  4ASN A;  2IA2 A;  2RKH A;  3BG5 A;  1JJ6 C;  4QTR A;  4BBR J;  1KU2 A;  5EG0 A;  3VPR A;  4A2U A;  5GAE J;  2HOT A;  1OKR A;  3FHN A;  1QVT A;  2H8R A;  4Z6Y A;  2A6H F;  3HL2 A;  1JKO C;  4WXD A;  2GIV A;  2QSG X;  3DKY A;  4J01 A;  3QPL A;  4JOM A;  3FXL A;  4QIW N;  4DQ2 A;  3SFI A;  1S7A A;  1E2X A;  1X1P A;  2K40 A;  3ZCO A;  4LJZ F;  4AD9 A;  1D3Y A;  4BY1 J;  2YR2 A;  3ZQG A;  2X6O A;  2K7L A;  3PFI A;  3AAF A;  1SFK A;  3CD6 I;  1ZGW A;  2DO7 A;  2DOA A;  4UVA A;  2EH3 A;  2WY8 Q;  3E3V A;  4D5C A;  2LBF B;  5IYB J;  2HDC A;  4FQG A;  4RS8 A;  2KZV A;  1D0Y A;  3L2R A;  1IDY A;  2KRH A;  4A0X A;  4AIJ A;  3G1M A;  2VOP A;  2ZBK A;  1ZAO A;  2GA2 A;  1IC8 A;  3K6G A;  3GYH X;  5E1X A;  2K4J A;  4AM3 A;  4MFE A;  3I59 A;  4XLP F;  2JWT A;  3TOA A;  5IPA A;  4LB5 A;  2H8W A;  3SDB A;  4NQW B;  3ASN H;  5E1Z B;  4PUS A;  2CO5 A;  4TV7 A;  5IP9 J;  1FPQ A;  4E70 A;  4WWC A;  3HGY A;  2B0L A;  3J7A Y;  4BY7 J;  2CGP A;  3KLN A;  5C4X J;  3CC7 I;  1MBH A;  4DYQ A;  2V4J C;  3GX4 X;  3LA3 A;  5GP9 A;  3KZZ A;  5BPI A;  4ZYG A;  2GOX B;  2QM3 A;  2Y48 A;  2VBZ A;  4NQW A;  1PUF A;  2PBI A;  5LRS A;  4LIU A;  4W97 A;  3T1B A;  2M7B A;  4OOI A;  4AVZ A;  1BI1 A;  3QOP A;  5BPD A;  4B09 A;  5M3M J;  1KU7 A;  2XHK A;  4FX4 A;  2M34 A;  1DP7 P;  3D5R C;  1WRJ A;  1WJ5 A;  2VE9 A;  1IDZ A;  1YJN I;  2DA3 A;  3HRT A;  1UEL B;  2LOO A;  4XID A;  4WK8 F;  3ZXS A;  2IT0 A;  2IA0 A;  1Z6T A;  2O5R A;  4AYB N;  3EUK L;  1W7P D;  3GZ5 A;  4D5F A;  2GLO A;  4EMS A;  3BR1 A;  3TKY A;  1YQA A;  3O8G A;  3S2W A;  1K6Y A;  2CWE A;  3WU0 A;  1LQ1 A;  2FF4 A;  3O8H A;  1VQO I;  1B59 A;  5A2Q K;  3TMO A;  1R49 A;  1EH6 A;  3BG3 A;  1IN7 A;  2CQX A;  4BHC A;  4D9J A;  5EEA A;  2BW3 A;  2F5C A;  1P4A A;  4PZJ A;  1RR7 A;  3L2V A;  4ESF A;  2LK2 A;  3MZY A;  2EFW A;  3FMQ A;  3CC4 I;  4A69 C;  5C4J J;  1QNT A;  1ETK A;  3N05 A;  4UUS A;  2VPR A;  2JVG A;  1LVK A;  4KN4 X;  4IHS A;  2JUC A;  1IN5 A;  2ICW G;  5J4Y A;  1AWC A;  3BTJ A;  2VUM J;  5J1Y A;  2N8G A;  3BT9 A;  2R4G A;  2XRL A;  2Y2Z A;  1TWG J;  4Y17 A;  3F3X A;  4YFX F;  4ENM A;  3SZP A;  3JRE A;  1SAU A;  2E7W A;  2H27 A;  3S8P A;  3JRI A;  4I09 A;  4A6E A;  3FWE A;  3IKV A;  5EDN A;  3VYR B;  1WFX A;  5L3D A;  2W7N A;  1D8K A;  4AYB A;  2CS3 A;  4G6T B;  1XCV A;  3GW2 A;  4ENK A;  4EQQ A;  3PO3 J;  3CO7 C;  3L7W A;  4M3F A;  4HYE A;  2KFD A;  1QQI A;  3BC8 A;  3ERM A;  3PNT A;  4V2G A;  4XOT A;  2ZSI B;  3VFZ A;  5HS8 A;  2M0M A;  3CZ6 A;  1XX5 A;  1BIA A;  4YEJ A;  4XIC A;  4J00 A;  4LMY A;  4RA2 A;  2WAQ A;  3CJR B;  3ULQ B;  1KYZ A;  3H3Z A;  2F5F A;  1NHA A;  5LGU A;  2KZG A;  2RQP A;  2ISZ A;  5EEG A;  3M9A A;  3CCR I;  1FOW A;  3AL0 C;  1S7E A;  5EGO A;  3PIP F;  4CO8 A;  2JRT A;  3MN2 A;  2WAF A;  4G6Q A;  1H9T A;  4ZC3 A;  2HPI A;  4P5O A;  1BN5 A;  2DOE A;  2ZC2 A;  3LFK A;  5J1U A;  1AA7 A;  4OIN F;  2BY3 A;  1G4D A;  3KZI C;  3HYI A;  1QBJ A;  3HRM A;  4WCG A;  4BDY A;  1OIS A;  3I58 A;  4BXU A;  3W6V A;  3LWF A;  1K78 B;  4P55 A;  2R7R A;  2DQL A;  4A93 J;  1KGS A;  3L2W A;  5IP6 A;  2A07 F;  3Q0U A;  4L9V A;  3T8T A;  3BR3 A;  1MH3 A;  3HPG A;  2XKP A;  5J6X A;  1HW1 A;  1MD0 A;  3CF5 F;  2DMP A;  5E18 F;  2I10 A;  3PUF A;  1ETQ A;  4KT5 C;  3KFW X;  5IT3 A;  4KUM A;  5D5V B;  1MMG A;  1Z9C A;  1S9H A;  1JE8 A;  4NDL A;  3K1M A;  4Y13 A;  4OWR B;  3WG9 A;  4KIS A;  3SDG A;  1JTY A;  2KIU A;  4S04 A;  2DMT A;  2P5L C;  2CUZ A;  4IXA A;  5DS9 A;  2R5Z A;  3FF5 A;  1JT6 A;  4Y15 A;  1Y8Q B;  2YU3 A;  3FKJ A;  4JP0 A;  1TC3 C;  4G7H F;  4QWQ A;  2LMD A;  5DEQ A;  5M3F J;  2MFZ A;  2GXG A;  3D5L A;  3OS1 A;  2E5N A;  5TRD A;  1R9T J;  2L7F P;  3ZP5 A;  1U8B A;  1BJZ A;  1OCO H;  1HBX G;  3DXJ F;  2KL4 A;  3EUH A;  2IW5 A;  4I0B A;  3LNQ A;  3CCY A;  4C2T A;  3HC7 A;  3PNY A;  4M71 A;  3WTY C;  5IT9 K;  2GA1 A;  1WJF A;  3ERE D;  1O3T A;  2EFO A;  2XF6 A;  1ORK A;  4U0W A;  2B9S A;  1TZL A;  3BG6 A;  3COA C;  2VOD A;  2JUG A;  1ERD A;  2FXA A;  1MJA A;  4J19 A;  3V8J A;  2EIM H;  4D7M A;  2VT3 A;  4U88 A;  3T8R A;  3I59 B;  1SVO A;  1K4T A;  3FXM A;  4I6Z A;  2WA0 A;  2JA7 J;  1G3Y A;  1TWH J;  4BE1 A;  4P9F A;  2ZB9 A;  4U0Y A;  2FBH A;  2RGV A;  2R5Y A;  2MBF A;  4M72 A;  4KMF A;  4AIK A;  2EIK H;  5E8I A;  3RPU A;  5JVT A;  3DU6 A;  3HBL A;  2BXZ A;  2XRN A;  1ZKG A;  4CH7 A;  2L01 A;  5M5Y J;  1VQL I;  3PFY A;  2ZFU A;  3ZRG A;  1SEU A;  4EJT A;  3I53 A;  5LBQ A;  2DAO A;  2Y0M A;  4M73 A;  1H89 C;  3GTO J;  1E3H A;  1BOB A;  4AVP A;  1WHU A;  3K10 A;  2JK3 A;  3D1N I;  2C6Y A;  4RAG A;  3W2A A;  3KP2 A;  3ASO H;  1DUX C;  2BXY A;  1R7J A;  2BYV E;  4DYC A;  3KEO A;  4HAM A;  4CGZ A;  4O5V A;  1X3U A;  3TO9 A;  3ZQL A;  4Z2Y A;  1BIB A;  2CYY A;  4KFC A;  2V9V A;  1PJR A;  3LOC A;  5EGO B;  4HF2 A;  3TQN A;  3S3N A;  2P5K A;  4OIP F;  3IV5 A;  1X4P A;  5EG0 B;  5HS7 A;  2K3P A;  4ENJ A;  1MMD A;  3VSL A;  4LK1 F;  4BL0 B;  1FWZ A;  2KMU A;  2OV7 A;  2XAF A;  4HNU A;  2DMU A;  4G6D A;  2NOG A;  4KN7 X;  5L3B A;  3FMR A;  5HDG A;  5K7H A;  1JGG A;  1MNM C;  3PM1 A;  3IRR A;  2MYS A;  3KEY A;  2RRE A;  2F48 A;  2MAB A;  2VT2 A;  1TTY A;  1D5Y A;  3MCZ A;  2PMH A;  2V1X A;  5F64 A;  3JSP A;  2R0Q C;  5DUI A;  1K79 A;  3F0C A;  4RAF A;  5CKT A;  4OIR F;  2V6E A;  3DPL C;  3ZMV A;  3ESW B;  1QZY A;  4ITV A;  4DZJ A;  3HIF A;  1I1G A;  5E20 A;  4EJW A;  3DLA A;  1PVE A;  3AG4 H;  2M8G X;  1VFC A;  4IQ4 A;  1POG A;  1XTA A;  1DPU A;  2HEO A;  2FUG 2;  3A02 A;  4FE7 A;  3U21 A;  1APL C;  2E5Z A;  4L18 B;  1UB9 A;  1VF9 A;  1XMK A;  2EZK A;  1UJ8 A;  2ESN A;  2XKO A;  2LKX A;  3Q0V A;  1ZR4 A;  3QU6 A;  3OR1 C;  2ZXI A;  4I02 A;  1F4K A;  3U2R A;  1WJD A;  2LDU A;  4UUS B;  2Z9O A;  2QYO A;  3HOX J;  2Y0S N;  1GV5 A;  2E19 A;  3MKW B;  4MGR A;  3GVA A;  2VJ5 A;  1XGO A;  2VON A;  4CZC A;  2RV8 A;  4B44 A;  2BV6 A;  2XPW A;  3OIQ A;  3P9C A;  2QEX I;  3HB9 A;  4PJM A;  3WTU C;  2IVM A;  2OCE A;  4CYC B;  1Y0U A;  4E7L A;  2OCC H;  1B8I A;  4L9T A;  4PJJ A;  2XPU A;  2VKV A;  1HC8 A;  2UXX A;  1QPM A;  3LSI A;  4O3M A;  2PG4 A;  1LPQ A;  3FHZ A;  4ESJ A;  3HOY J;  1S8N A;  5EYR A;  2P4W A;  3K4C A;  2QSF X;  2R3S A;  1DGR M;  1KQ9 A;  3VSK A;  2L4A A;  2DXI A;  4UVB A;  3ZQF A;  2L7M P;  2QQ8 A;  2R7U A;  4E6K G;  2XGX A;  1B9M A;  4YG2 F;  2RAE A;  1B9N A;  4CXF A;  4HNV A;  3WTS C;  1TNT A;  1YJ9 I;  5JVG F;  4E7H A;  4HPQ A;  5FRN A;  3S1Q J;  1IUY A;  3RCO A;  1QZE A;  2CSO A;  1DDN A;  1G3W A;  5JFR A;  4QPO A;  3I54 A;  3TBI A;  3LQR A;  5IP7 J;  3CJT B;  4FET A;  1YIJ I;  1FSE A;  1I6H J;  2MSY A;  4GYI A;  3Q0W A;  4N4N B;  2DA6 A;  3BCB A;  3B6C A;  4GFB A;  3K1N A;  4OIO F;  2PX9 A;  3M8E A;  1FZP B;  3MKL A;  1UHW A;  1YIO A;  2CQN A;  4PSX A;  5FD5 A;  2E1M B;  1SD4 A;  3PJR A;  4XR6 A;  2VJJ A;  2P7V B;  3GF2 A;  4S05 A;  3A2K A;  3KYC B;  1R22 A;  4LG0 A;  1PDN C;  2X6Y A;  1IUF A;  3HHG A;  2E1M C;  5LD2 C;  3UKG A;  3F6V A;  4XSX F;  2MW8 A;  2H6C A;  3GTK J;  1IRF A;  1R23 A;  2Q0O A;  4XOP A;  1ZRF A;  3REO A;  1VI0 A;  1LFU P;  2F5V A;  2E1N A;  1RIO H;  4DZP A;  4N9H A;  4F93 B;  3M1C A;  2QZ8 A;  2P5V A;  2XSJ C;  5HLH A;  6PAX A;  4DBR A;  5TGT A;  4EGZ A;  3CO6 C;  5J3L A;  4UVC A;  2DK5 A;  4RM3 A;  1IRG A;  2IA1 A;  3TGN A;  5GTH C;  2A5Y B;  2K9M A;  3G3Z A;  1L3L A;  1T0F A;  5TIS C;  5E3L A;  4E7I A;  5KAF C;  3OYK A;  2LFB A;  4XLH A;  5D8L B;  5IT9 Z;  2KHM A;  1ZG1 A;  4N0B A;  5D8K B;  2R7W A;  1ETV A;  4KMU X;  2NRA C;  2BVL A;  3SYT A;  2OQG A;  2NOJ B;  4BBS J;  1MW7 A;  3H9G A;  1L0O C;  1XCB A;  1KZH A;  2FD5 A;  5BS6 A;  5LHI A;  3QRF F;  4DOZ A;  4G7Z F;  3RYR A;  2DT5 A;  4MQV A;  1JXS A;  4KIT B;  3SZT A;  2HQR A;  4NHJ A;  1D8J A;  5D5U B;  1JUS A;  1JT0 A;  3DKW A;  1ODD A;  1P4X A;  2OD5 A;  5C3E J;  4PFP A;  3IAM 2;  3PQJ A;  2PJP A;  4MEX F;  4I2O A;  3GZN B;  3IP4 B;  1XD7 A;  3ZGK A;  2IBD A;  2EFP A;  3VOE A;  3I9V 2;  4XKW A;  3PSF A;  3R60 A;  2L2O A;  1IW7 F;  1R1T A;  4FAS D;  3CMM A;  2R7O A;  1YX5 A;  2ZJR F;  2KIM A;  4HOB A;  2JSC A;  3OYN A;  3RJP A;  3ZN0 A;  2OTJ I;  2Q2E A;  1G59 A;  4UNO A;  2DA1 A;  4GCV A;  3SHF A;  2ZXJ A;  1GHC A;  2R7F A;  2IS6 A;  3P9K A;  4L9N A;  3I4N J;  3ECH A;  3CUQ A;  2FQ3 A;  1ZYR F;  2LYC A;  5FO5 A;  3HJE A;  2WC2 A;  1WSU A;  5LGN A;  3JTH A;  1F5T A;  4LFU A;  2GAU A;  2VXD A;  3BTC A;  3KYL A;  1MDM B;  4Y7N J;  2TCT A;  2NS8 A;  1XSX A;  5CPR B;  4BQN A;  1GXQ A;  1O4X A;  2IGN A;  3FXO A;  2QWW A;  3OYL A;  2W85 A;  1Q1V A;  4FIS A;  3S2D J;  3QPS A;  2WTE A;  4MNU A;  4A3E J;  2O7O A;  2M9H A;  4LLN A;  1U5T C;  2HS5 A;  2DW4 A;  3S17 J;  2MLG A;  2HOA A;  2EPF A;  5FKK A;  3R0A A;  5F1J A;  1MBG A;  4DGW B;  5BOX A;  1TQP A;  1G8X A;  2L9S A;  2NNN A;  5FFX A;  3RPU D;  3WE3 A;  4IKF A;  3HOV J;  1ACI A;  1TBX A;  5E8G A;  1XGS A;  1CF7 B;  3ABK H;  4PJ0 C;  3GTG J;  4P96 A;  1TWF J;  2MD5 A;  1MBK A;  3C7J A;  2X0L A;  2LR8 A;  1EV7 A;  2HFH A;  2G7U A;  4S0H B;  4AC0 A;  5FRM A;  1MBF A;  2EBI A;  3I56 I;  1G2H A;  3IKT A;  4ZH4 F;  5DM7 F;  5AON A;  3C3W A;  3BG9 A;  5TJJ A;  3WTX C;  1R71 A;  2GXA A;  2DTR A;  1FOX A;  4XSZ F;  3F21 A;  4IL6 C;  2Y75 A;  1T39 A;  1O57 A;  3MAJ A;  4L9J A;  2YUS A;  3F6O A;  2EIJ H;  3R6S A;  3FXU A;  1NK3 P;  1IXR C;  2E1C A;  2NVY J;  3SJM A;  1T33 A;  2WV0 A;  2HYJ A;  3S3M A;  1ZH5 A;  3EET A;  2LY2 A;  3K4L A;  3BQY A;  1Y6I A;  4CDG A;  1RKW A;  2P0W A;  3RQ4 A;  2CW7 A;  3CUO A;  1T08 B;  3FBN B;  4ZJZ A;  2HVQ A;  5DUK A;  1AKH B;  3RKW A;  2DQR A;  1S5L C;  1W5C C;  3L00 A;  1VQP I;  3S14 J;  2IGO A;  3WGG A;  3JCU C;  3I4P A;  5DTD A;  3M4O J;  3CCJ I;  3RKY A;  3E6M A;  3UR3 C;  4EAT A;  3NAR A;  1YTY A;  1AKH A;  1F9N A;  1UAA A;  3CCV I;  2DA5 A;  2KQR A;  1FP1 D;  2Y9Z A;  1MH4 A;  3DTE A;  3M7G A;  5HOO A;  2R93 J;  3CP2 A;  3GZ6 A;  2VC0 A;  3G71 I;  2DYR H;  3FBI B;  5M5X J;  4L5I A;  5ICE A;  3E0J B;  3HDD A;  3LA2 A;  1J5Y A;  1Z7L A;  4BXX J;  2L9V A;  2O0Y A;  4LB6 B;  2LY9 A;  3DP7 A;  4ON0 A;  3DBL B;  1QZZ A;  4C3I J;  3IUO A;  2HTS A;  3LSP A;  2ME6 A;  5EEH A;  2ECB A;  2DA7 A;  5D5W B;  4C2U A;  1IV8 A;  3LMM A;  2TDX A;  3TP3 A;  2ZFW A;  3QWL A;  1UCR A;  1TLH B;  4PK4 A;  3HUG A;  1D0X A;  3OYI A;  3R4K A;  4A6D A;  1T38 A;  4HDU A;  1XPX A;  2K5C A;  3GFI A;  4M74 A;  5ERI A;  3S16 J;  3DEE A;  1FIP A;  4D7N A;  2CRG A;  2HVR A;  2V9P A;  2FML A;  3DWL E;  1Z7U A;  3HHH A;  1K61 A;  2HKX A;  4M6Y A;  1V5G A;  1AOY A;  4IPA A;  4Y52 J;  5E79 C;  1YI2 I;  1FT9 A;  2K27 A;  3V7C A;  1VQ5 I;  3NRV A;  4KIC A;  1LDD A;  2CFO A;  3MFK A;  4U7D A;  2XGD A;  2PJR B;  2R92 J;  1EJ9 A;  3ABL H;  4U7B A;  1WPK A;  1BL0 A;  4EEF G;  4NBQ A;  1XSV A;  1ON2 A;  2CJJ A;  3KYD B;  1WJA A;  3KZY A;  5H6R A;  5B1B H;  5FKL A;  4RB0 A;  3S93 A;  3KET A;  3PIO F;  3CJQ B;  2E2H J;  2EK5 A;  1X1A A;  2XAG A;  3U9G A;  3IHU A;  4BEH A;  3G2B A;  3BZC A;  3EDP A;  1E0E A;  3PSI A;  4XRS G;  2YS9 A;  1HXD A;  2QGU A;  4HQM A;  4IF4 A;  3ZMD A;  2AQE A;  3CCE I;  4CCM A;  3KEQ A;  2V1D A;  4CYD A;  1GT0 C;  2DI3 A;  2EV6 A;  1G3S A;  2W48 A;  2CUJ A;  2YU9 J;  2GXB A;  5FLX K;  1IZ1 A;  5FKO A;  3K1P A;  4MIM A;  3J81 K;  2IJL A;  1FJL A;  1I50 J;  1FTZ A;  2VC1 A;  4XRM A;  5B1A H;  4HF1 A;  2PMZ N;  1V54 H;  3M1E A;  1Q1H A;  5GPC A;  2X1E A;  3ML6 A;  1R58 A; 
#chains in the Genus database with same CATH homology
 3WTW C;  4Q4Z F;  4GYG A;  2Z3Y A;  1CGP A;  4AWX B;  2WWY A;  1O3R A;  4XBF A;  2RVC A;  5H20 A;  3O2P E;  1LEA A;  2EJR A;  5HDK A;  1B4A A;  3W6K B;  1UHM A;  2OA4 A;  3H92 A;  5FFZ A;  4OMY A;  2MA3 A;  3F8B A;  2KJB A;  5LEJ A;  3BJA A;  3Q9S A;  2CG4 A;  3HSF A;  1ZLJ A;  3HTU A;  2HWV A;  5HLG A;  4ESB A;  4KNY A;  3R61 A;  1J0R A;  4EV0 A;  2RNJ A;  3ZMS A;  3E6C C;  1W7P A;  1J2X A;  2QEN A;  1R5G A;  2UZK A;  1HW2 A;  3KP5 A;  4M9S A;  3WGH A;  3F22 A;  4MHG A;  3IWZ A;  3R0J A;  5LHH A;  3J81 Z;  3TDU C;  4ZYE A;  3TOB A;  4ETS A;  2IPQ X;  2QBY B;  2J5P A;  5DD4 A;  1XN7 A;  2ZNY A;  2EA4 A;  4NB5 A;  4A0Y A;  5CLS A;  3DF8 A;  1HKQ A;  4HW0 A;  4M9X A;  1U8R A;  4HX8 A;  5DV5 A;  3LAJ A;  1BI0 A;  4MQ9 F;  1ZG5 A;  1TW2 A;  1J7K A;  3L9F A;  1R1U A;  5BQT A;  3HSR A;  2J5O A;  3H3U A;  4U0V A;  2COM A;  3DV8 A;  4QLC U;  2P6S A;  1BI3 A;  1FY7 A;  1QO0 D;  3DQV C;  2MC3 A;  1T2K A;  2VBX A;  4G7O F;  2D1H A;  2Z99 A;  5CJ9 A;  2K4B A;  2ZCW A;  1WQ2 A;  5CVI A;  3J80 Z;  1T6S A;  3O6B B;  2QQB A;  3GFM A;  4KIG A;  2EV0 A;  3T5X A;  1WWX A;  1D5V A;  1MDM A;  4IRI A;  2HTJ A;  5DCM B;  1C0W A;  2O61 A;  3JAM K;  3I71 A;  4G94 A;  4M9Z A;  1BC7 C;  3M8F A;  3BPX A;  3NQO A;  2FBK A;  2AXL A;  4HQE A;  1LNW A;  1IXC A;  2M45 A;  3VOD A;  1H9G A;  5LLQ A;  3E97 A;  3KP4 A;  2AS5 F;  3ZMZ A;  2LF8 A;  2FA5 A;  3ROU A;  3CJN A;  1I1S A;  5HDN A;  2CFX A;  5LEK A;  1B6A A;  4A0Z A;  2PEX A;  4ZZD A;  5FGM A;  4MTE A;  2HR3 A;  3RTR A;  3GFJ A;  2GZW A;  4EM2 A;  1BM9 A;  3BJO A;  4BHP A;  3BDD A;  2Z33 A;  3LAP A;  1MKM A;  5FD6 A;  2STW A;  2BGC A;  5KK1 A;  2FBI A;  2A61 A;  1RNL A;  2UXN A;  3RI4 A;  1KU3 A;  4LG0 B;  1YW8 A;  2MH9 A;  1FLI A;  3WGI A;  1KQ0 A;  4EJV A;  2DK8 A;  2MLK A;  2FMY A;  3L2C A;  3IRQ A;  2VE8 A;  3GLX A;  4BHB A;  5DCF A;  4HLX A;  5K5R A;  4YFN F;  1BI2 A;  3E5X A;  4HDV A;  1BBY A;  2F2E A;  3F8F A;  4IHT A;  1W5S A;  1FSH A;  2KJC A;  1CF7 A;  2XAQ A;  2HQN A;  1YLF A;  2D1V A;  2KIF A;  1YG2 A;  3IWF A;  4YII A;  1Z05 A;  4KYW A;  5ILV A;  4HLY A;  1ON1 A;  2EWN A;  2XAJ A;  2P7C B;  4LLL A;  2O03 A;  1IXS B;  3K0L A;  3OV8 A;  3KP7 A;  2EA2 A;  3QP5 A;  3C18 A;  1SD6 A;  5L3G A;  1P4W A;  3V7R A;  1G6N A;  4N9I A;  4UV8 A;  1YW9 A;  4PCQ A;  2MH2 A;  3J7A O;  4F7Z A;  2DU9 A;  4A12 A;  1TW3 A;  4A5N A;  1XSD A;  1LVA A;  1SMT A;  2JT1 A;  2A69 F;  4PDK A;  3U1D A;  4YFK F;  5DCM A;  1BOA A;  2OAZ A;  2QVO A;  2Z5U A;  2ZME B;  1ZLK A;  2E7X A;  5CVU A;  2ZKZ A;  4FHT A;  5JHU A;  1REP C;  1FOK A;  1YFH A;  1KU9 A;  1SFX A;  3BWG A;  2ELH A;  4CZZ A;  1OR7 A;  5FB2 A;  5J8F A;  3I5U A;  3V8L A;  2NS0 A;  1KYW A;  3LA7 A;  2O8X A;  1IN4 A;  5JI6 A;  2V1U A;  2VN2 A;  3QAH A;  5DDG A;  5LHG A;  2D45 A;  1FBU A;  3HTS B;  3F72 A;  3K2Z A;  2IRF G;  5F1R A;  4JQF A;  4R8H A;  4UXN A;  4I0A A;  5LGT A;  4WXH A;  5D6F A;  3B73 A;  2V6C A;  2ZJ2 A;  1FP2 A;  2L54 A;  1J9I A;  3DPT A;  4WF2 A;  1S29 A;  1SD5 A;  1YO5 C;  2OBP A;  1U5T A;  2F5D A;  1PUE E;  3J80 K;  2KKO A;  1XMA A;  4LGW A;  1WI9 A;  3E6B A;  3GO5 A;  2PN6 A;  3K9T A;  4YIF A;  1W4M A;  5JR3 A;  4BNC A;  3ZPL A;  3P9I A;  3I0T A;  2NAZ A;  3CTA A;  1IF1 A;  2W84 A;  1BC8 C;  4GO1 A;  3F8M A;  2KRF A;  2VXZ A;  4RAZ A;  1ZRC A;  1W7P B;  3N97 A;  3BP8 A;  2ESH A;  3E6D A;  3RYP A;  1YYV A;  3MEX A;  3GUD A;  4ENN A;  2PFB A;  1KA8 A;  2CQK A;  3PQK A;  4IVN A;  1LDJ A;  1R00 A;  1P92 A;  3RIR A;  3HRS A;  2M5W A;  1VTN C;  1YS6 A;  2OZ6 A;  1R5H A;  3JSO A;  4JK1 X;  2A6E F;  4LD5 A;  1S6L A;  4LLG F;  2VOO A;  4B8X A;  2XVC A;  1EH7 A;  3CUQ B;  1MGT A;  4OIQ F;  4UV9 A;  1HKT A;  4HV5 A;  3ZMU A;  3EYY A;  1P6R A;  3EYI A;  3G73 A;  1E17 A;  2F5E A;  4EM0 B;  3ABU A;  3V7S A;  4OMZ A;  1ZGA A;  5K5Q A;  2M8E A;  4JBA A;  4HBL A;  3DEU A;  3SQN A;  3QU3 A;  1ULY A;  3FMS A;  4BH9 A;  4RGU A;  2YSR A;  3P7N A;  3HOT A;  2BE5 F;  3KE2 A;  4GGG A;  3BJ6 A;  2HKO A;  5AIP A;  1IN6 A;  2EV5 A;  2YPR A;  4RGS A;  3RDI A;  3VB2 A;  3F23 A;  2XAS A;  5HLI A;  2ADU A;  3GEZ A;  5ICF A;  2HGC A;  2DPU A;  2GWR A;  2LKP A;  2D2W A;  3ISP A;  5FLX Z;  4CHU A;  4I7H A;  3C1D A;  2Q8K A;  5D5X B;  2DPD A;  3WTZ A;  3QPH A;  2XIG A;  4HX4 A;  5D6E A;  3N4M A;  4RB2 C;  4IRH A;  3CLO A;  2PMU A;  4KA4 A;  1OPC A;  2A3S A;  3RKX A;  1MJ9 A;  4MEY F;  4MTD A;  1RZ4 A;  1FYL A;  5K1Y A;  4KDP A;  2P8T A;  4PGG A;  2YX7 A;  1XGN A;  1YW7 A;  4XLN F;  1ZN2 A;  2W57 A;  3KCC A;  5L3E A;  3QP6 A;  1U5T B;  3V4G A;  1U3E M;  2FNP A;  3EQL F;  1FC3 A;  1I6X A;  3V8K A;  2NNY A;  2W25 A;  5L3F A;  1K7A A;  1A04 A;  3O3K A;  1YS7 A;  3IL2 A;  3BOQ A;  2DBB A;  4BAY A;  1TNS A;  4FX0 A;  5ED4 A;  1T98 A;  1RUN A;  3F8N A;  4AIH A;  1HSJ A;  4H0E A;  3WU1 B;  4L5J A;  4HX7 A;  3JAM Z;  1ZHF A;  2LNB A;  3BPV A;  4D0P A;  2UWM A;  5CYV A;  3F8C A;  3TO6 A;  2H94 A;  4KIB A;  3B02 A;  4G8X A;  3SFZ A;  5DD8 A;  4O6J A;  5J8C A;  3DFG A;  3IC7 A;  4GXO A;  2QLZ A;  1O3S A;  4HV6 A;  4EVI A;  4FT8 A;  3JTG A;  2DFI A;  4BYY A;  4IJA A;  5KVR A;  2XV4 S;  2RN7 A;  5A2Q Z;  1OMI A;  2LSO A;  3KP3 A;  4RGR A;  1K6O A;  1U2W A;  1TQM A;  3FM5 A;  2O3F A;  2OZU A;  3E5Q A;  2OQR A;  3MWM A;  3RPQ A;  3Q9V A;  1R1V A;  2R7D A;  4Q48 A;  1GXP A;  1DPR A;  2RC4 A;  2FU4 A;  2OU2 A;  1V3F A;  1F1Z A;  4HZF A;  5CVR A;  2M1B A;  5L3C A;  2L3D A;  4ZYD A;  1UST A;  3ELK A;  3I64 A;  3KLO A;  2XUB A;  2PI0 A;  4R1H A;  4M6X A;  3FXR A;  2PQ8 A;  3NEU A;  1ZG3 A;  2DLL A;  1OYW A;  5ICG A;  2QBY A;  3ZMT A;  4EM1 A;  4K2E A;  1JHF A;  1MZB A;  1HKS A;  3HSE A;  5CVJ A;  1OYY A;  2PLY A;  5AIQ A;  1WKM A;  5H6Q A;  3D0S A;  4IRG A;  4L0Y B;  1BJA A;  1PP8 F;  1P2F A;  2BEO A;  5E1W A;  3SXY A;  3LQQ A;  2ISY A;  1ZAR A;  1GVJ A;  4ZYH A;  1OYI A;  1HST A;  2A68 F;  1ZRE A;  1XB4 A;  3FM3 A;  1Z91 A;  5F6F A;  2XRO A;  1FNN A;  2QUF A;  1RI7 A;  2YX4 A;  3WTT C;  5ILS A;  2HYG D;  1SFE A;  1U78 A;  2ACJ A;  2FOK A;  5D4R A;  3QPT A;  4RB1 A;  1SAX A;  3FZV A;  4LK0 F;  4OU0 A;  5E17 F;  5ILU A;  3K69 A;  2FSW A;  2HOE A;  4EGY A;  2HZT A;  1SMY F;  1LB2 A;  3CUQ C;  5DYM A;  3GFL A;  1W5T A;  2P6T A;  3E5U A;  2VBY A;  1ZRD A;  1FYM A;  3HRU A;  3CDH A;  1FBQ A;  1QGP A;  2XAH A;  4UUV A;  4A5M A;  1TQI A;  1V4R A;  2EFQ A;  2CW0 F;  2V79 A;  2ZO4 A;  2JPB A;  2HYF A;  2VBW A;  4HA8 A;  3TDZ C;  1RUO A;  3ZN1 A;  2FE3 A;  3VEP A;  1KQ8 A;  2JZY A;  1G3T A;  2O6G E;  5ICC A;  4L0Z B;  2FNA A;  2W24 A;  1U6G A;  1JHH A;  3LST A;  4R79 A;  1XDU A;  2X4H A;  3TO7 A;  2FEZ A;  4UHT A;  4CIC A;  3GXO A;  5BMZ A;  2NYX A;  3FX3 A;  3MZH A;  1Z6R A;  3WTV C;  4EJO A;  2ZNZ A;  1R36 A;  2G7H A;  1LDK B;  3JW4 A;  2IP2 A;  3BZ6 A;  2G9W A;  3GWZ A;  3Q5F A;  3HOS A;  2EB7 A;  2EFN A;  1XDS A;  3W6J B;  4BQA A;  2M30 A;  2L4M A;  1ONV A;  2JPC A;  1O3Q A;  2H09 A;  4I98 B;  2ETH A;  1SFU A;  3MQ0 A;  4KIF A;  5HS9 A;  1FYK A;  1IN8 A;  1ZGJ A;  2M87 A;  4DNC A;  4P9U A;  1LEB A;  1LJ9 A;  1O7L A;  4I01 A;  4HF0 A;  2K02 A;  2LF7 A;  1HW5 A;  5D4S A;  3WE2 A;  1UFM A;  1SD7 A;  3L09 A;  5CVV A;  1O7F A;  4PGH A;  3T0Y A;  1STZ A;  2RDP A;  3WOD F;  2K86 A;  3KP6 A;  5HVQ C;  4RGX A;  3ZQ7 A;  4WX9 A;  2BBY A;  2JTV A;  1J59 A;  1K78 A;  4Q47 A;  2FRH A;  4RAY A;  3ECO A;  3OOP A;  2GQQ A;  4RB3 C;  2L02 A;  1PP7 U;  1HQC A;  1FX7 A;  4XRF A;  1S7O A;  1S3J A;  2H6B A;  3FXQ A;  3ABT A;  1USS A;  4Q5S F;  1J75 A;  1IAW A;  1Z1D A;  4G9Y A;  3BY6 A;  1H0M A;  1JGS A;  1B1B A;  4EJU A;  4ZZL A;  1EH8 A;  2ZME A;  1MJB A;  3BRO A;  2QQA A;  1XGM A;  1I5Z A;  4WXC A;  2STT A;  1FBS A;  1I27 A;  2QQ9 A;  5K5O A;  5LRR A;  4ASN A;  2IA2 A;  2RKH A;  1KU2 A;  4A2U A;  1OKR A;  2A6H F;  4WXD A;  2GIV A;  4DQ2 A;  1S7A A;  1E2X A;  4AD9 A;  4LJZ F;  1D3Y A;  2YR2 A;  2K7L A;  3PFI A;  3AAF A;  2DO7 A;  4UVA A;  3E3V A;  2HDC A;  4RS8 A;  4A0X A;  4AIJ A;  2VOP A;  2ZBK A;  1ZAO A;  2GA2 A;  3GYH X;  5E1X A;  2K4J A;  3I59 A;  4XLP F;  3TOA A;  4LB5 A;  5E1Z B;  2CO5 A;  4TV7 A;  1FPQ A;  4E70 A;  4WWC A;  2B0L A;  2CGP A;  3KLN A;  3GX4 X;  3LA3 A;  3KZZ A;  5BPI A;  4ZYG A;  2QM3 A;  2Y48 A;  2VBZ A;  4NQW A;  2PBI A;  5LRS A;  3T1B A;  4OOI A;  1BI1 A;  3QOP A;  5BPD A;  4B09 A;  1KU7 A;  2XHK A;  4FX4 A;  1DP7 P;  1WRJ A;  2VE9 A;  3HRT A;  4WK8 F;  2IT0 A;  2IA0 A;  1Z6T A;  1W7P D;  3GZ5 A;  4EMS A;  3TKY A;  1YQA A;  3S2W A;  2CWE A;  3WU0 A;  1LQ1 A;  2FF4 A;  1B59 A;  5A2Q K;  1EH6 A;  1IN7 A;  4BHC A;  2F5C A;  1P4A A;  4PZJ A;  2EFW A;  4ESF A;  3MZY A;  3FMQ A;  1QNT A;  4KN4 X;  4IHS A;  1IN5 A;  1AWC A;  4Y17 A;  3F3X A;  4YFX F;  4ENM A;  3SZP A;  2E7W A;  2H27 A;  4I09 A;  4A6E A;  3FWE A;  3IKV A;  5L3D A;  1D8K A;  1XCV A;  3GW2 A;  4ENK A;  4EQQ A;  3CO7 C;  3L7W A;  4HYE A;  1QQI A;  5HS8 A;  3VFZ A;  1BIA A;  4LMY A;  3ULQ B;  1KYZ A;  3H3Z A;  2F5F A;  1NHA A;  5LGU A;  2RQP A;  2ISZ A;  5EEG A;  3M9A A;  4CO8 A;  2JRT A;  4G6Q A;  1H9T A;  4P5O A;  1BN5 A;  3LFK A;  4OIN F;  1G4D A;  3HYI A;  1QBJ A;  3HRM A;  4WCG A;  3I58 A;  4BXU A;  3LWF A;  1K78 B;  4P55 A;  2DQL A;  1KGS A;  2A07 F;  4L9V A;  3T8T A;  2XKP A;  5J6X A;  1HW1 A;  1MD0 A;  5E18 F;  4KT5 C;  3KFW X;  5IT3 A;  4KUM A;  5D5V B;  1Z9C A;  1JE8 A;  3K1M A;  4Y13 A;  3WG9 A;  2KIU A;  4S04 A;  2P5L C;  4IXA A;  3FF5 A;  4Y15 A;  2YU3 A;  4G7H F;  4QWQ A;  5DEQ A;  2GXG A;  3D5L A;  5TRD A;  3ZP5 A;  1HBX G;  3DXJ F;  3EUH A;  2IW5 A;  4I0B A;  3WTY C;  4M71 A;  5IT9 K;  2GA1 A;  3ERE D;  1O3T A;  2EFO A;  4U0W A;  2VOD A;  3COA C;  2FXA A;  1MJA A;  3V8J A;  2VT3 A;  4U88 A;  3T8R A;  3I59 B;  1G3Y A;  4P9F A;  4U0Y A;  2FBH A;  2RGV A;  4KMF A;  2MBF A;  4M72 A;  4AIK A;  5E8I A;  3RPU A;  5JVT A;  2XRN A;  2L01 A;  4EJT A;  3I53 A;  5LBQ A;  2DAO A;  2Y0M A;  4M73 A;  4AVP A;  2C6Y A;  3KP2 A;  1DUX C;  1R7J A;  2BYV E;  3KEO A;  4HAM A;  4CGZ A;  4O5V A;  1X3U A;  3TO9 A;  4Z2Y A;  1BIB A;  2CYY A;  4KFC A;  2V9V A;  4HF2 A;  3TQN A;  2P5K A;  4OIP F;  5HS7 A;  4ENJ A;  4LK1 F;  1FWZ A;  2XAF A;  4G6D A;  4KN7 X;  5L3B A;  3FMR A;  5HDG A;  3IRR A;  2VT2 A;  1TTY A;  3MCZ A;  2PMH A;  2V1X A;  5F64 A;  3JSP A;  5DUI A;  1K79 A;  4OIR F;  3DPL C;  3ZMV A;  1QZY A;  3HIF A;  1I1G A;  5E20 A;  4EJW A;  1DPU A;  2HEO A;  4L18 B;  1UB9 A;  1XMK A;  2ESN A;  2XKO A;  3QU6 A;  4I02 A;  1F4K A;  3U2R A;  2LDU A;  2Z9O A;  2QYO A;  4MGR A;  3GVA A;  1XGO A;  2VON A;  2RV8 A;  2BV6 A;  3P9C A;  3WTU C;  2IVM A;  1Y0U A;  4L9T A;  2UXX A;  1QPM A;  4O3M A;  2PG4 A;  3FHZ A;  4ESJ A;  1S8N A;  2P4W A;  2R3S A;  1KQ9 A;  2L4A A;  4UVB A;  2XGX A;  1B9M A;  4YG2 F;  1B9N A;  4CXF A;  3WTS C;  1TNT A;  1IUY A;  2CSO A;  1DDN A;  1G3W A;  5JFR A;  3I54 A;  3LQR A;  1FSE A;  4GYI A;  3K1N A;  4OIO F;  3M8E A;  1FZP B;  1UHW A;  1YIO A;  5FD5 A;  1SD4 A;  2P7V B;  3GF2 A;  4S05 A;  1R22 A;  4LG0 A;  1PDN C;  3HHG A;  3F6V A;  4XSX F;  2H6C A;  1IRF A;  1R23 A;  2Q0O A;  1ZRF A;  3REO A;  1RIO H;  2E1N A;  4N9H A;  2QZ8 A;  2P5V A;  5HLH A;  6PAX A;  4EGZ A;  3CO6 C;  4UVC A;  2DK5 A;  1IRG A;  2IA1 A;  3TGN A;  2A5Y B;  3G3Z A;  1L3L A;  1T0F A;  5D8L B;  5IT9 Z;  1ZG1 A;  4N0B A;  5D8K B;  4KMU X;  2NRA C;  2OQG A;  1L0O C;  1XCB A;  5LHI A;  5BS6 A;  3QRF F;  4G7Z F;  3RYR A;  2DT5 A;  4MQV A;  1JXS A;  4NHJ A;  3SZT A;  2HQR A;  1D8J A;  5D5U B;  3DKW A;  1ODD A;  1P4X A;  2OD5 A;  3PQJ A;  2PJP A;  4MEX F;  4I2O A;  1XD7 A;  2EFP A;  3VOE A;  3R60 A;  1IW7 F;  1R1T A;  2KIM A;  4HOB A;  2JSC A;  3RJP A;  3ZN0 A;  2Q2E A;  4UNO A;  4GCV A;  3SHF A;  2ZXJ A;  1GHC A;  2R7F A;  3P9K A;  4L9N A;  3ECH A;  3CUQ A;  2FQ3 A;  1ZYR F;  5FO5 A;  2WC2 A;  1WSU A;  5LGN A;  3JTH A;  1F5T A;  4LFU A;  2GAU A;  1MDM B;  1XSX A;  1GXQ A;  2QWW A;  2W85 A;  2WTE A;  4MNU A;  4LLN A;  1U5T C;  2HS5 A;  2DW4 A;  2MLG A;  3R0A A;  5BOX A;  1TQP A;  2NNN A;  5FFX A;  3WE3 A;  1TBX A;  5E8G A;  1XGS A;  1CF7 B;  4P96 A;  2MD5 A;  3C7J A;  2X0L A;  2HFH A;  1EV7 A;  2G7U A;  3IKT A;  4ZH4 F;  5AON A;  3C3W A;  5TJJ A;  3WTX C;  2DTR A;  4XSZ F;  3F21 A;  2Y75 A;  1T39 A;  1O57 A;  3MAJ A;  4L9J A;  3F6O A;  3R6S A;  3FXU A;  1IXR C;  2E1C A;  2WV0 A;  1ZH5 A;  3EET A;  4CDG A;  3CUO A;  5DUK A;  3RKW A;  2DQR A;  3L00 A;  3WGG A;  3I4P A;  3RKY A;  3E6M A;  1YTY A;  1F9N A;  1FP1 D;  3M7G A;  5HOO A;  3GZ6 A;  2VC0 A;  4L5I A;  5ICE A;  3LA2 A;  1J5Y A;  2O0Y A;  4LB6 B;  3DP7 A;  4ON0 A;  1QZZ A;  2HTS A;  5EEH A;  5D5W B;  2TDX A;  2ZFW A;  1UCR A;  1TLH B;  3HUG A;  3R4K A;  4A6D A;  1T38 A;  4HDU A;  3GFI A;  4M74 A;  5ERI A;  2FML A;  1Z7U A;  3HHH A;  2HKX A;  4M6Y A;  1AOY A;  4IPA A;  1FT9 A;  2K27 A;  3V7C A;  3MFK A;  3NRV A;  1LDD A;  4KIC A;  4U7D A;  4U7B A;  1XSV A;  1ON2 A;  5H6R A;  3KZY A;  4RB0 A;  3KET A;  2EK5 A;  3U9G A;  2XAG A;  3IHU A;  3EDP A;  1HXD A;  4HQM A;  4IF4 A;  3ZMD A;  3KEQ A;  2V1D A;  4CYD A;  2DI3 A;  2EV6 A;  1G3S A;  2GXB A;  5FLX K;  1IZ1 A;  3K1P A;  3J81 K;  2IJL A;  2VC1 A;  4HF1 A;  3M1E A;  1Q1H A;  3ML6 A;  1R58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...