3WU0A

Crystal structure of phosphorylated ets-1 dna binding and autoinhibitory domains (276-441)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Protein C-ets-1
total genus 45
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu0A00
3CUQB 5E18F 1G3YA 1JGSA 1YG2A 2RGVA 5D5VB 3JAMZ 3K2ZA 4MQVA 1I1GA 4L18B 2YR2A 2P6TA 4HA8A 5FFXA 4EJTA 3BJAA 3L09A 3ECHA 3HSFA 4Y17A 4KMFA 4EVIA 4UVAA 4KA4A 3L9FA 5FLXZ 2WC2A 3WTZA 2TDXA 3WGHA 3V4GA 4RAYA 4KFCA 1FP1D 5HS9A 4IJAA 4ZYGA 1JE8A 1O3TA 4EM0B 3J7AO 1LDJA 4GO1A 3MFKA 1A04A 1LEAA 3IC7A 2EA4A 2ESNA 3GVAA 1HXDA 3ULQB 4U0VA 1SD7A 4L9VA 5BMZA 4A2UA 5L3EA 1LQ1A 2BV6A 1R1VA 4LG0A 1FBUA 2UXXA 2QBYA 3CJNA 2DU9A 4MTEA 1IXRC 3GUDA 1FZPB 4CHUA 3EDPA 5HDNA 3GFMA 4G9YA 1MGTA 4G7OF 3LA7A 4EM1A 3WTXC 2LKPA 3HUGA 4RB3C 3ZMUA 2DPUA 2CFXA 2GWRA 4YIFA 1Z05A 3CTAA 2EFOA 1B6AA 5D4RA 3EQLF 3OOPA 5H20A 1Z6TA 2A3SA 2Q2EA 3SQNA 4U0YA 4G7HF 3FX3A 5LHGA 2ETHA 3M8FA 4CZZA 1PP7U 3FMSA 3G3ZA 2NNYA 1AWCA 4HZFA 3ZMVA 1XSXA 2EWNA 2Z5UA 3QAHA 4FX0A 2MC3A 4MGRA 4A6DA 5A2QK 5AIPA 4FT8A 4EJOA 2RNJA 3U2RA 2WWYA 2KIMA 5HDGA 3RIRA 3LQRA 2XAQA 5L3BA 3BOQA 3GYHX 4JK1X 4YG2F 3TOBA 2JT1A 1OPCA 4M9SA 1ZREA 3QU3A 1MKMA 3F8FA 4R79A 3QPTA 2P5KA 4RGRA 4AIJA 1W5SA 2KIFA 1ZRDA 3TO7A 3F72A 2RN7A 5HVQC 3P9CA 1KYWA 4LLLA 4UV8A 2IVMA 1H9TA 4ZZLA 1J59A 2D1HA 4EM2A 3DXJF 5E1ZB 3SFZA 1DP7P 4L9JA 2ZNZA 2ELHA 1B4AA 2H94A 4IRGA 3FZVA 1BN5A 4DNCA 2A6HF 3V7CA 4G6DA 4KIGA 2JPCA 2M5WA 1WSUA 2HYGD 2J5PA 1ZGJA 1HW2A 4UHTA 4BAYA 5KVRA 1DUXC 5ILVA 4B8XA 4N9HA 3IRQA 3R4KA 4OIPF 1B1BA 1J9IA 3ZMDA 1P2FA 2FNAA 1SMTA 2CGPA 2MD5A 1FX7A 3E5XA 1TLHB 3LAJA 3VB2A 4UXNA 2Q0OA 1RUOA 1ZH5A 2V1UA 5BOXA 4Q4ZF 3KFWX 3DP7A 4PGHA 3LAPA 1EH8A 3I4PA 2FXAA 3HSRA 2NRAC 3FMQA 3KP3A 3RJPA 4HDUA 3I58A 3FXQA 4A0YA 2DK5A 1XGMA 2DK8A 1R7JA 2ZCWA 4DQ2A 3K0LA 3RKYA 4O6JA 1K79A 4LJZF 1D3YA 5IT9Z 2VT3A 1O57A 2IW5A 3FM5A 2IT0A 4HBLA 3WE2A 1ZG3A 2FU4A 4ESBA 2GZWA 4KYWA 2GA1A 2EB7A 1E17A 4E70A 4HV5A 5J6XA 4ESFA 4FX4A 1XD7A 5J8CA 3MZHA 2DQRA 1QPMA 3JSOA 3DPTA 5K1YA 3F6OA 2KJCA 3WE3A 4MNUA 3MQ0A 1QZYA 2M30A 4F7ZA 2W25A 2VN2A 5JFRA 5FD6A 3F21A 3F3XA 4LB6B 5J8FA 3WTSC 1YQAA 3MEXA 5D6FA 3C18A 2HQNA 2QQBA 3E3VA 2XKPA 3HYIA 2Z9OA 4CGZA 4P9UA 2VXZA 4HV6A 2Y75A 4O5VA 3VFZA 4RB1A 2L4AA 3NRVA 4EJWA 2RKHA 3CDHA 4P55A 1ON1A 2VONA 5HOOA 2EV6A 4OMZA 3ZMZA 5ED4A 1KU3A 2LF8A 4L0ZB 4WCGA 3NQOA 2DQLA 2DI3A 3W6JB 4BYYA 1YO5C 1I1SA 3RKWA 4U7BA 3IWFA 3IWZA 1XGOA 2QQAA 2B0LA 1LDKB 1CF7A 2FRHA 4ZYDA 1ZG5A 3RPUA 3CUOA 5BPDA 2HGCA 4OMYA 4M9ZA 3EETA 1MJAA 3MCZA 1BC7C 1KU2A 1BI2A 3FXRA 3GFIA 2YX4A 4P96A 3I71A 1QNTA 3R60A 1X3UA 2EFWA 2XUBA 1R5GA 1SAXA 2P7VB 3GF2A 3V8KA 2HKXA 1OMIA 4OINF 2V1DA 2W24A 3HHGA 4ZYEA 5CLSA 3TDZC 2Z99A 3COAC 3LA2A 1HSJA 3O2PE 5LBQA 4BHBA 3Q9VA 2XRNA 1U5TA 1BJAA 2P7CB 1XMAA 1JXSA 2EK5A 3CUQC 4I0AA 2YU3A 4LD5A 2JZYA 2XGXA 2HYFA 4A5NA 3I64A 2PBIA 2OQGA 3KETA 4KICA 4IHSA 1FY7A 2YX7A 1MJBA 1R58A 4WF2A 1LB2A 2VOPA 5CVRA 1FNNA 3BPXA 4M74A 1DPUA 1HW5A 1JHHA 3FMRA 1KU7A 2FNPA 2F5FA 3ISPA 1XSDA 4LK0F 2STTA 2DLLA 2QZ8A 4HDVA 2VBZA 2PJPA 2E1NA 1CF7B 5LHHA 2ZXJA 3KP5A 2IA2A 2ZNYA 1BI1A 3V7RA 1USSA 4KMUX 4KIBA 3HTUA 2PFBA 5TRDA 2RDPA 2D2WA 1DDNA 3BJ6A 4K2EA 2M8EA 3F22A 1O3RA 1K6OA 5D8LB 2P6SA 3I0TA 2A6EF 4EJVA 2J5OA 1SD6A 3LA3A 3AAFA 2V6CA 1BI3A 4ENNA 3H3ZA 4HOBA 2NAZA 2WV0A 2BEOA 3DKWA 1W4MA 1UB9A 4I2OA 2W57A 2VC0A 3E6MA 2BBYA 1USTA 3K69A 2L02A 2P4WA 1J75A 2BGCA 2AS5F 4WXHA 1XSVA 3QP5A 3R0AA 3M8EA 4KUMA 1QBJA 3RYRA 5D5XB 4EJUA 5D6EA 2GXGA 1F4KA 1Z91A 2XROA 1UFMA 5FGMA 4PCQA 1RNLA 2L54A 2VE9A 3GZ6A 4XSXF 3TGNA 1O3SA 5IT9K 3ERED 4PZJA 2QLZA 4Q47A 5EEHA 2Z33A 1ZLJA 3JAMK 1B9NA 2E7WA 3F8CA 5FFZA 1K7AA 3ABUA 2VBXA 1SMYF 1NHAA 4G94A 5HLGA 2W84A 4I01A 4IHTA 3B02A 2P5LC 3CO6C 4A0ZA 2W85A 1QGPA 2O03A 2CYYA 2ZJ2A 1Z9CA 3GX4X 1ZRCA 1XDSA 1QQIA 1TBXA 2ZMEA 2ADUA 1LVAA 5L3DA 1QO0D 3V8JA 2X0LA 3ZQ7A 1WWXA 1EV7A 2XASA 3C7JA 3E5UA 3GXOA 4UV9A 1KU9A 2VOOA 1FYMA 4UUVA 2BE5F 1HSTA 4WXCA 1SFEA 4CICA 1XCBA 2LSOA 5D4SA 4EV0A 2O61A 2MH9A 2RQPA 3KEQA 1P6RA 4MEYF 4Q48A 1R00A 5K5RA 2E7XA 1T38A 4BHPA 5DD8A 1U78A 4WK8F 2KRFA 2H27A 1KQ9A 2UXNA 3LFKA 3HRMA 3V8LA 5ILUA 4P5OA 3KP2A 1ZRFA 4ETSA 1ZHFA 4I02A 1PP8F 3IL2A 5ICCA 3GO5A 1EH7A 1I5ZA 3ZP5A 3F8MA 5EEGA 3KZZA 3HRUA 1ODDA 1YLFA 4U0WA 4M9XA 1E2XA 2L3DA 4OIOF 4Q5SF 1ZAOA 3M9AA 5E8GA 3GFLA 1FYKA 5HLHA 2KIUA 2FQ3A 1SD5A 2DW4A 3WTVC 3DQVC 2OZUA 5K5OA 3FM3A 1T6SA 3HRSA 3MZYA 4NB5A 1XDUA 4IF4A 2ZMEB 4EGYA 2JSCA 3TO9A 5DUIA 2HOEA 3RTRA 4YFXF 1OYIA 4HX4A 4M73A 2H6BA 3P9IA 1MD0A 1S6LA 3ECOA 4D0PA 4OIQF 1W7PB 1IXCA 4HQEA 3WTWC 3RPQA 5E17F 1FC3A 2F5CA 5CVJA 4M72A 1KGSA 4NHJA 2OZ6A 3KP7A 4CXFA 1D5VA 2D45A 3JTHA 2QENA 2RV8A 4P9FA 2HS5A 2M1BA 3TOAA 2QVOA 4PDKA 3WGGA 3P7NA 1OYYA 5DV5A 3PFIA 5HDKA 4G8XA 2ZFWA 5BQTA 1IAWA 2GQQA 2IA0A 2ISYA 4RAZA 3Q9SA 3EYYA 2PQ8A 3GWZA 1XB4A 5ICFA 4EGZA 2MH2A 3B73A 1HQCA 2QWWA 3DPLC 3IKTA 1J0RA 3L00A 2OBPA 3K1PA 4LK1F 2EFPA 4HF0A 4KN4X 1S7OA 2A07F 1D8KA 2Z3YA 2OU2A 1YFHA 2R7DA 2VBWA 3K1NA 2EV0A 5DDGA 2K7LA 1TW2A 1T39A 4AVPA 5IT3A 3QU6A 3VEPA 1J7KA 1DPRA 4A6EA 1F9NA 6PAXA 1JHFA 2GIVA 2XAFA 1P4AA 4KN7X 1J5YA 5E20A 2WTEA 2HWVA 5L3FA 1I6XA 4I0BA 4IVNA 1P4WA 1MJ9A 3E5QA 2DTRA 2EFQA 5JI6A 2KJBA 4QWQA 1YIOA 3GEZA 3QP6A 3RDIA 2R7FA 1LJ9A 2CW0F 1RI7A 4HW0A 2K4BA 1GHCA 2VODA 5CYVA 1TQPA 2O6GE 3BPVA 2XKOA 3MWMA 2OA4A 3REOA 1IN8A 4AD9A 5DCMB 2L4MA 2E1CA 1ULYA 2A69F 5H6QA 4JQFA 3S2WA 2DPDA 1Z1DA 3KP6A 4MEXF 1GXPA 2HFHA 2FMYA 4ENJA 1WQ2A 3VOEA 2D1VA 2FBKA 2NYXA 2K02A 3HSEA 1XN7A 2FEZA 2CG4A 2K4JA 3C3WA 4RB0A 5FB2A 1YS6A 3ZMSA 1SFUA 1TNSA 5LRSA 3FWEA 2GA2A 3F23A 5DCFA 1YYVA 4XBFA 1FPQA 5ERIA 4L9NA 5K5QA 1REPC 3FF5A 3EYIA 3BROA 3CLOA 3KLOA 3BWGA 3U9GA 1S3JA 1BIBA 4BQAA 2XHKA 1MZBA 1LDDA 3I59A 1IZ1A 3TKYA 4L5JA 4M6XA 5HS8A 1TNTA 3JW4A 4RS8A 1G3TA 3SXYA 3N4MA 3KEOA 2V1XA 3I53A 1HW1A 1FP2A 1P4XA 3E6BA 5LGTA 1BI0A 4BH9A 3ZN1A 4AWXB 5TJJA 1EH6A 1UHWA 1TQMA 1IN7A 4XRFA 2LDUA 1BC8C 2OAZA 1W7PD 1OKRA 2VE8A 3IRRA 3WGIA 1HBXG 2X4HA 4Z2YA 3K9TA 4YFNF 5LGUA 5BPIA 1IW7F 1V3FA 1G6NA 3VODA 2H6CA 3ABTA 3BP8A 2FE3A 5DD4A 1ZGAA 2VT2A 1K78A 2M45A 5BS6A 1O7LA 5CVVA 3BDDA 4AIKA 3HOSA 4QLCU 2O8XA 2M87A 1R23A 1P92A 2HKOA 1ZARA 1XGSA 4HX8A 5H6RA 2LNBA 4RGUA 2CO5A 2QQ9A 4YFKF 4JBAA 2G7HA 1YS7A 2HTSA 1IRFA 5D5WB 3QOPA 4BHCA 1FBSA 2H09A 4CDGA 1WI9A 3W6KB 4UVCA 4Y13A 3L2CA 4GCVA 3OV8A 4KT5C 3SZTA 2DT5A 2FBHA 2DBBA 5DUKA 3ZN0A 1FBQA 3RYPA 2EA2A 1WRJA 4HF1A 3LQQA 1I27A 4MTDA 2ZKZA 3N97A 4A12A 3F6VA 5AIQA 1Z6RA 1IN5A 4GYGA 4HLXA 3QPHA 4LGWA 3F8NA 3R61A 1W5TA 1HKQA 1PDNC 4U88A 4GXOA 3G73A 1FWZA 2CQKA 5A2QZ 3FXUA 4O3MA 4TV7A 4BNCA 3LSTA 4IRHA 2IP2A 1IN6A 3KE2A 1HKTA 2YSRA 1BIAA 2ESHA 3O3KA 1Q1HA 3T8TA 4LFUA 3DV8A 4I09A 2UZKA 2Y48A 3GZ5A 1IN4A 2PG4A 1V4RA 5HS7A 5LGNA 3I54A 3H3UA 2HZTA 5F6FA 4HAMA 5D8KB 1B9MA 2EV5A 2QYOA 3IHUA 4UNOA 5CJ9A 4OIRF 2IA1A 4XLPF 4R8HA 1T2KA 1D8JA 3O6BB 4ASNA 2AXLA 1UCRA 1STZA 2ISZA 1LEBA 3WU0A 1YW9A 3HIFA 3U1DA 3I59B 2BYVE 5D5UB 2HEOA 4L0YB 4OOIA 2EJRA 2PMUA 5DCMA 1H9GA 1KQ0A 5ICGA 4FHTA 1CGPA 4XLNF 3MAJA 4CO8A 1RIOH 2FF4A 2JRTA 5E1XA 4ZH4F 2Y0MA 1U5TB 5CVUA 1IUYA 4IPAA 5LLQA 1U5TC 5L3CA 2IPQX 3GW2A 1Z7UA 3RKXA 3ZPLA 2P8TA 3E6CC 4ENKA 1QZZA 1YW8A 4XSZF 1T0FA 4LMYA 3WTYC 5JHUA 4G6QA 3HHHA 5HLIA 4HF2A 2RVCA 1UHMA 1XMKA 4KIFA 5E8IA 1ZG1A 3RI4A 3I5UA 2DO7A 4Y15A 1ZLKA 4R1HA 1G3WA 2DFIA 2HDCA 3WODF 5AONA 4IXAA 1AOYA 3FHZA 4HX7A 4M6YA 3BY6A 1FSEA 4RGXA 2MLKA 2A61A 5DEQA 5JR3A 3JSPA 2KKOA 1YTYA 5FLXK 4N9IA 3KP4A 1WKMA 1PUEE 1IF1A 1ONVA 1TTYA 1MDMB 2OD5A 1Y0UA 4A0XA 4S04A 3L7WA 4LLGF 2CSOA 2MLGA 4PGGA 4EQQA 3ELKA 5ICEA 3BJOA 4L9TA 5L3GA 2JTVA 3HOTA 2FMLA 1HKSA 3P9KA 4GGGA 4BXUA 4AIHA 2XAGA 4WXDA 1U8RA 3PQKA 2XV4S 2MA3A 2QBYB 4ON0A 4S05A 3WTTC 2A68F 4H0EA 2UWMA 1IRGA 1GXQA 3BZ6A 3D0SA 2R3SA 2COMA 5F1RA 2DAOA 3JTGA 3J81Z 1L3LA 2PI0A 1R1TA 3J80Z 3T0YA 3WG9A 2PN6A 5CVIA 3T1BA 2HTJA 3ML6A 1S7AA 4M71A 2L01A 3KZYA 2QM3A 2PEXA 2PMHA 2Q8KA 1TW3A 1U6GA 1R22A 4OU0A 2LF7A 1MDMA 1KA8A 1S8NA 1KYZA 2FA5A 4ENMA 2FOKA 2F2EA 1F5TA 3CO7C 2IRFG 1T98A 2FSWA 1FYLA 2EFNA 2IJLA 4HQMA 5LEKA 3K1MA 1J2XA 1TQIA 3WU1B 3KLNA 3M7GA 5FO5A 5LHIA 4MHGA 2VBYA 1SD4A 1W7PA 2F5EA 4G7ZF 3TO6A 4GYIA 4LB5A 2JPBA 1XGNA 2GAUA 3D5LA 4KNYA 2O3FA 2G7UA 3EUHA 1VTNC 1OYWA 5DYMA 2K86A 1G4DA 4N0BA 1KQ8A 1K78B 2FBIA 2NS0A 3V7SA 1O3QA 3M1EA 1BM9A 3J81K 2ZBKA 1ZYRF 3ZMTA 1R1UA 1FOKA 2ACJA 3TDUC 5LRRA 1G3SA 1OR7A 2ZO4A 2K27A 1YW7A 5LEJA 2VC1A 2C6YA 3E97A 4B09A 2A5YB 1R5HA 2P5VA 1O7FA 4KDPA 4RB2C 5F64A 4L5IA 3HRTA 1SFXA 2YPRA 1BBYA 4I98B 3J80K 3T5XA 1L0OC 3Q5FA 4ESJA 4WWCA 1R36A 4MQ9F 3SHFA 2STWA 2RC4A 5ILSA 4A5MA 3GLXA 2V79A 5JVTA 2QUFA 4RGSA 3E6DA 1BOAA 4WX9A 3GFJA 3TQNA 3T8RA 4EMSA 2CWEA 1F1ZA 3WTUC 3DEUA 1U2WA 1GVJA 4UVBA 3DF8A 3IKVA 2XAJA 1ON2A 4LG0B 3CUQA 4ZZDA 1FSHA 2HQRA 5E1WA 3SZPA 1FT9A 4YIIA 2PLYA 2OQRA 2O0YA 1LNWA 2V9VA 4HLYA 3LWFA 2MBFA 1IXSB 1RUNA 1RZ4A 2NNNA 4HYEA 1ZN2A 4NQWA 2F5DA 3R0JA 3QRFF 3KCCA 2XAHA 1H0MA 2XVCA 3NEUA 1U3EM 4ZYHA 3HTSB 1B59A 4IRIA 2GXBA 4U7DA 4LLNA 3F8BA 1C0WA 3H92A 4I7HA 2HR3A 1S29A 3PQJA 2XIGA 3R6SA 3ROUA 1FLIA 1XCVA 3DFGA 5FD5A 5KK1A 4CYDA 3C1DA 2G9WA
chains in the Genus database with same CATH superfamily
4BJ6C 2E1MC 2WV1A 3CUQB 5E18F 1G3YA 4JX5A 4RM3A 1JGSA 1WJDA 1YG2A 2DMUA 2RGVA 3J7AY 4BXXJ 3OYJA 5K7HA 5D5VB 1YI2I 3JAMZ 3K2ZA 4MQVA 1EA3A 5GTHC 1I1GA 2CUJA 5E3MA 4L18B 2YR2A 1HDPA 3DTIA 1R71A 1NTCA 2P6TA 4W1UA 2FD5A 2BW3A 2CH0A 3CJQB 4HA8A 5FFXA 3CCMI 4EJTA 3BJAA 2AQEA 3L09A 3ECHA 4MLOA 2B7EA 3HSFA 4Y17A 1TT0A 4KMFA 4BJTA 4EVIA 4UVAA 4KA4A 1MW7A 3L9FA 2KL4A 3QODA 1D1CA 5FLXZ 2WC2A 1TWCJ 2HI3A 1AKHB 3PO3J 1EKEA 3WTZA 1UJ8A 2TDXA 4XKCA 2A6TA 4FE7A 3WGHA 3LSPA 3CC7I 2WY7Q 3V4GA 4RAYA 4KFCA 1YX3A 1FP1D 2X6YA 2M7BA 4A3BJ 3DTKA 5HS9A 4YIRX 3GTGJ 1MMNA 4IJAA 4ZYGA 1JE8A 2MSYA 1O3TA 4EM0B 2R7ZJ 3J7AO 1LDJA 4GO1A 3MFKA 3HB9A 1A04A 4XR6A 1LEAA 4ZDLA 3IC7A 2EA4A 4F92B 2ESNA 3GVAA 3GMEA 2EILH 3MD2A 3ZQIA 3MKYB 1HXDA 3ULQB 4I6ZA 2CMPA 4U0VA 1SD7A 4L9VA 1YE9A 5BMZA 4A2UA 5B5EC 1HCRA 5FRNA 5L3EA 1LQ1A 2BV6A 3BCBA 2LG4A 4HPQA 1FMWA 1R1VA 4LG0A 1NK3P 3G6EI 2VQLA 1FBUA 2UXXA 3H9JA 2QBYA 1RETA 1WCMJ 3CJNA 4D5FA 2DU9A 4MTEA 3OSFA 2X1DA 1IXRC 1V54H 4BKXA 5GADJ 3GUDA 2DA5A 1X3ZB 2DA7A 4E7JA 1FZPB 1YRNB 4CHUA 3HOWJ 3EDPA 3Q0UA 5HDNA 3GFMA 4G9YA 1MGTA 5EEAA 1TL8A 5FLVA 4G7OF 3LA7A 4EM1A 1K4TA 3WTXC 2LKPA 3HUGA 4RB3C 3ZMUA 2DPUA 2CFXA 1I6HJ 5TISC 2GWRA 4YIFA 4QTRA 1Z05A 3CTAA 5J1RA 2EFOA 3RKQA 1B6AA 2WAQA 4XN3A 5D4RA 2E35A 2IGNA 4M3GA 3EQLF 3OOPA 5H20A 1Z6TA 1RR8C 1MNEA 2A3SA 2Q2EA 3SQNA 4OAZA 4U0YA 1SVMA 4G7HF 3S1RJ 3FX3A 5LHGA 2ETHA 3FXMA 4B44A 3M8FA 4CZZA 1PP7U 3FMSA 3G3ZA 3UKGA 2NNYA 2W1OA 1AWCA 2DA6A 1Z3YA 4HZFA 4RM2A 3ZMVA 2LTPA 3V42A 1XSXA 4B48A 2EWNA 1X4PA 2Z5UA 3QAHA 4FX0A 1JT6A 1A36A 2MC3A 3VSLA 4MGRA 3SJMA 1SFOJ 4A6DA 4EEFG 1U9OA 5A2QK 3HC7A 5AIPA 3CCRI 2OV7A 2ZC2A 4FT8A 3OIPA 3ESWB 4EJOA 2W00A 1D0XA 2RNJA 1Y6IA 3U2RA 2WWYA 2AO9A 2KIMA 5HDGA 3RIRA 4XICA 3LQRA 1M1EB 2XAQA 5L3BA 2O8KA 2JQ7A 5DS9A 1NG6A 2R7XA 2IS4A 2EQRA 2ECCA 2MC4A 3BOQA 3H0GJ 3GYHX 4JK1X 4YG2F 2NS8A 1UG2A 3TOBA 4B1RA 2JT1A 1OPCA 4BBRJ 1RESA 4M9SA 4XLAA 2Y9ZA 1ZREA 3HG9A 1Y8RB 2W48A 3QU3A 1DU0A 4LIVA 1MKMA 3VDXA 3F8FA 2F5VA 2GOXB 4AUXA 4R79A 2KHMA 4FISA 4C2UA 3K7AJ 1IGNA 4AVZA 3QPTA 2P5KA 2M9HA 4E7SA 1R49A 2EH3A 4RGRA 4AIJA 4XK4A 3HGYA 1W5SA 2KIFA 3GBGA 1YJNI 1ZRDA 1TWGJ 3TO7A 4A69C 2JMWA 3F72A 2RN7A 5HVQC 3P9CA 1KYWA 3OR2C 4LLLA 4UV8A 1MNDA 2IVMA 1JKQC 1YX5A 1H9TA 4ZZLA 1MH4A 4NDLA 4DZPA 1J59A 1FOWA 2D1HA 4EM2A 2X9DA 2E34A 1WI3A 3DXJF 3NARA 1BR4A 2E2IJ 4HEA2 5EZHA 5E1ZB 3SFZA 2LRDA 4A3KJ 4L9JA 1DP7P 3K10A 2ZXIA 4HNVA 2DT7B 2ZNZA 4MO7A 3OSGA 2ELHA 1B4AA 1LFUP 2H94A 4IRGA 1WPKA 3FZVA 1BN5A 4DNCA 2A6HF 1R5ID 4OWRB 1OCTC 5IYDJ 2HU9A 3V7CA 4G6DA 4KIGA 5IOZA 2JPCA 2M5WA 2DJIA 3CCUI 1WSUA 4BBSJ 2Z2SB 4C3JJ 5JLXA 2HYGD 2J5PA 3QPLA 1ZGJA 2WAEA 1AHDP 1ZELA 1HW2A 4UHTA 4BAYA 5KVRA 4F52A 1DUXC 5ILVA 1QPIA 4B8XA 1X1BA 1VNDA 4N9HA 1FEXA 3IRQA 2CQXA 3R4KA 4G12A 4OIPF 1B1BA 1J9IA 2HVQA 3ZMDA 2ZSHB 3K2AA 1P2FA 4CCKA 2DMQA 3CD6I 2FNAA 2Z16A 1SMTA 2CGPA 2MD5A 2M7AA 2E2JJ 1FX7A 3E5XA 1TLHB 1UG0A 4F91B 3LAJA 3E7LA 3VB2A 4B3XA 4UXNA 2EZIA 2Q0OA 1RUOA 1ZH5A 2V1UA 1BR1A 2K9LA 2DN0A 5BOXA 4Q4ZF 2R5YB 5HODA 3KFWX 3DP7A 1DGWY 4PGHA 2I5UA 4Y3OA 4IZZA 3LAPA 1JI8A 1EH8A 1TT5B 3I4PA 1X2MA 2DYSH 1X1CA 2FXAA 3HSRA 1IC8A 2NRAC 3FMQA 1OQYA 3PSFA 4E4HA 3VWBA 3KP3A 3RJPA 1TC3C 4HDUA 3I58A 3FXQA 4A0YA 3A03A 2DK5A 1XGMA 2DK8A 4BQQA 1R7JA 3MN2A 3MKLA 4BE1A 2ZCWA 4DQ2A 1I50J 3K0LA 3RKYA 4O6JA 2VASA 4LJZF 1D3YA 4PFOA 2VT3A 1K79A 5IT9Z 3A2KA 1O57A 2IW5A 1RC9A 3FM5A 2IT0A 3K4LA 4HBLA 5CQEA 3WE2A 1ZG3A 2FU4A 4ESBA 2GZWA 3GCMA 4KYWA 2VL8A 2GA1A 2EB7A 5EG0B 2VXDA 3BG3A 1E17A 1XG1A 3BZCA 3DTEA 2W7NA 3P5JA 3A0HC 4E70A 2HDWA 4HV5A 4ESFA 5J6XA 1XD7A 4FX4A 1S5LC 4BY1J 5J8CA 3OYHA 3MZHA 2DQRA 4XIDA 1GDTA 4Y33A 3I56I 1IRXA 3BLYA 3K4BA 4M3DA 1QPMA 2X1EA 3L1PA 5JVGF 3U21A 3JSOA 3DPTA 2R5ZA 1I3QJ 5K1YA 3F6OA 2QEXI 3SZGA 3LSMA 3OL4A 2ELKA 2KJCA 3WE3A 4MNUA 4A3JJ 1RKTA 2WAQN 3MQ0A 1QZYA 2M30A 4F7ZA 2VKHA 2W25A 4N4OB 5CPRB 3ZQQA 4D1QA 3ABMH 2VN2A 4E7ZA 2LY2A 4PJMA 5JFRA 1ZTRA 2TCTA 5FD6A 3K4MA 3F21A 3F3XA 4LB6B 5J8FA 3WTSC 1YQAA 4NC7A 3MEXA 5D6FA 3C18A 2HQNA 3DKXA 2QQBA 3E3VA 2XKPA 3HYIA 2Z9OA 1S7EA 4P9UA 4CGZA 2VXZA 4HV6A 1LE8B 3FK6A 2Y75A 4O5VA 3VFZA 4RDUA 4RB1A 2P0WA 3B6AA 5IYCJ 2L4AA 3NRVA 2AQFA 4EJWA 2RKHA 1WZ2A 3CDHA 2E2HJ 5IY5H 1GVDA 4HG2A 4H4KC 4P55A 1ON1A 2ZXWH 2VONA 3BG7A 5HOOA 2R5YA 2EV6A 4OMZA 1MBKA 3ZMZA 5ED4A 2H1LA 2R7SA 2CFOA 2OPTA 1E0EA 1KU3A 2LF8A 4L0ZB 4WCGA 2ZSIB 3NQOA 2DQLA 2DI3A 3E1SA 3W6JB 4BYYA 4LOCA 4UUTA 1YO5C 2CV2A 1I1SA 1E3PA 3RKWA 4U7BA 2YUSA 2BOLA 3IWFA 4P1WA 3M3YJ 3IWZA 1XGOA 2QQAA 2B0LA 1LDKB 1ZR2A 1CF7A 2FRHA 4ZYDA 3JRCA 2KQRA 3FIWA 3HKZN 1ZG5A 3RPUA 3CUOA 2R92J 4AC0A 3OL3A 5BPDA 2HGCA 1ETYA 3MKZA 4OMYA 4M9ZA 1VQLI 2O9LA 4BS9A 4KITB 1JUPA 3EETA 3S1QJ 4X0GA 1JJ8C 1MJAA 1JKOC 3E0JB 1WHUA 4F3QA 1Z77A 3MCZA 5EYRA 2HOSA 1BC7C 3JRIA 2KT0A 1KU2A 1BI2A 3FXRA 3GFIA 5J1UA 2YX4A 1X1DA 4P96A 3I71A 1QNTA 3R60A 1ITYA 1X3UA 5F0FA 2EFWA 2XUBA 5FKOA 1R5GA 3I4NJ 1SAXA 2P7VB 3GF2A 4JX6A 2CS3A 2HKXA 3V8KA 4AYBN 2MFZA 5HNFA 4XNFA 1YHQI 4XLFA 1OMIA 3DBHB 4OINF 2V1DA 3BQYA 2W24A 2DJNA 3HHGA 4ZYEA 4W97A 5CLSA 3TDZC 2Y2ZA 1MMGA 2Z99A 2FX0A 2XDVA 3COAC 3LA2A 5JHFA 1HSJA 4GFBA 2BY1A 3O2PE 5LBQA 3SYTA 4BHBA 2WA0A 3A02A 3Q9VA 2XRNA 2Y0SA 1U5TA 1BJAA 2E19A 2R5ZB 2P7CB 3H1CA 1S72I 1XMAA 2DMTA 3OYFA 3M4OJ 2QA4I 1OCCH 3TP3A 3QYBA 1A31A 4M6VA 2ZJRF 1JXSA 3D5RC 1NH3A 4M3EA 2E1OA 3CUQC 2EK5A 4I0AA 3W2AA 1BOBA 1Y0NA 3KZIC 1VQ9I 2E1MB 3SDGA 2YU3A 3CJTB 4LD5A 2JZYA 2XGXA 3H35A 2HYFA 2HOTA 4A5NA 3I64A 2L2OA 2IGKA 3PSIA 4XLHA 2PBIA 5E3LA 2OQGA 3KETA 2WY8Q 4KICA 4PJLA 2VQGA 1VQOI 4IHSA 1FY7A 4DGWB 2YX7A 1MJBA 4A3LJ 3FISA 1WJBA 5FKLA 1R58A 4WF2A 2DT6A 1LB2A 3TEDA 2JRMA 3BG9A 2VOPA 5CVRA 1FNNA 1GLNA 3BPXA 4M74A 1DPUA 1HW5A 1JHHA 1VFCA 3FMRA 1KU7A 3BTLA 2FNPA 2GM4A 2F5FA 5E79C 3ISPA 1K83J 1QVUA 1XSDA 1HDDC 4IHYA 2KDOA 2CJJA 4LK0F 3U1KA 3OIQA 2STTA 2DLLA 2NVYJ 2QZ8A 3PJRA 3GTMJ 3S16J 4HDVA 2VBZA 3JREA 2PJPA 2E1NA 1CF7B 4S0HB 2RAEA 5J4VA 2ZXJA 5LHHA 1R9TJ 3KP5A 4BQNA 2IA2A 2ZNYA 3I55I 1AA7A 2BW3B 1S9HA 1BI1A 3IV5A 3V7RA 2QQ8A 1R6RA 2M3AA 1USSA 4KMUX 4KIBA 3HTUA 4C2MJ 1UHSA 1FIAA 2IS2A 1Y1VJ 1FMVA 2PFBA 2HQ5A 2UV1A 5TRDA 2L9SA 2RDPA 2D2WA 1DDNA 3BJ6A 4K2EA 2M8EA 5KHDA 3F22A 1O3RA 1K6OA 5GAEJ 3BR3A 1UZCA 5D8LB 2X48A 5GAGJ 1LKXA 2ZXHA 2HVSA 2P6SA 3I0TA 3Q3SA 2A6EF 4EJVA 5EF6A 2J5OA 2KDZA 1SD6A 3LA3A 4L5EA 4QSHA 2R7RA 3CDIA 4G6TB 2PX9A 3S1MJ 3AAFA 2XGDA 3PFYA 2V6CA 3L2RA 3OIOA 1BI3A 1JUSA 4ENNA 3H3ZA 4HOBA 2NAZA 3GTOJ 2M34A 2BEOA 2WV0A 3BR6A 3DKWA 1W4MA 3HPHA 1UB9A 1X3WB 1MBHA 4I2OA 2W57A 4MFEA 1N25A 2AXTC 2VC0A 5IP7J 3E6MA 1VQ5I 2BBYA 1ETWA 1USTA 4F55A 4AU7A 3IH4A 3K69A 2E5NA 1T56A 2L02A 2P4WA 1J75A 2BGCA 2HYJA 4C3HJ 2YS9A 3OYMA 2AS5F 4WXHA 1XSVA 3QP5A 2L7KA 3OYLA 3R0AA 2JN6A 3M8EA 3K6GA 4BDZA 3C2HA 3S15J 4KUMA 1QBJA 3G1OA 3L2UA 1HA8A 2HQAA 2BY3A 3DCFA 2E71A 3RYRA 1WJCA 2VKDA 5D5XB 1VQ4I 4EJUA 2DMNA 2JWTA 5D6EA 2GXGA 5F1JA 1F4KA 1Z91A 2XROA 3D5SC 4KISA 1UFMA 5FGMA 2K40A 1DQUA 2KPMA 4PCQA 1RNLA 2L54A 2LC2A 2VE9A 3JR9A 3GZ6A 4XSXF 3TGNA 1O3SA 3IH2A 4D7NA 4A3GJ 1BA5A 5IT9K 4B47A 3CCSI 3ERED 4PZJA 4GDFA 3FXKA 3D1NI 5FJ8J 2QLZA 3CLQA 1XTAA 3OS1A 1UELB 4Q47A 5EEHA 2Z33A 1ZLJA 3JAMK 1B9NA 1RR7A 2E7WA 3F8CA 2L7MP 5FFZA 2JSPA 1JTXA 2HVRA 1K7AA 3ABUA 2VBXA 1SMYF 1NHAA 3G71I 4G94A 5HLGA 2W84A 1ENHA 2NXNB 4I01A 2LH9A 1OCRH 2I8DA 3B02A 4XOPA 4IHTA 4KT6A 3RSNA 2P5LC 3CO6C 2FUG2 2UUZA 4A0ZA 1LPQA 1Z3XA 3JRHA 2W85A 2ZMEC 3O8HA 3S1NJ 4BACA 1QGPA 3S2DJ 2O03A 2JVHA 2ZJ2A 2XPUA 2CYYA 3GX4X 1Z9CA 1XDSA 1ZRCA 1ZK8A 1QQIA 1TBXA 2DA2A 2ZMEA 3H9QA 4DJAA 4FCYA 4UUSA 2N8GA 1G8XA 1SFKA 2ADUA 1OCZH 1MSEC 1LVAA 1WH7A 4JYKA 5L3DA 1QO0D 2DOAA 1T33A 4ZYAA 3J7YJ 3V8JA 2X0LA 4DYQA 4J01A 3ZQ7A 1WWXA 2BHZA 4A3EJ 3B6CA 1EV7A 2XASA 1MH3A 1ETXA 3C7JA 1W0UA 3GXOA 3E5UA 3QYFA 1BR2A 3CDLA 5F0CA 1HOMA 3A01B 2K9SA 2LBFA 4UV9A 3A0BC 1KU9A 2VOOA 1FYMA 4UUVA 3K70D 2BE5F 1HSTA 3L2QA 4WXCA 1SFEA 2XF5A 4AM3A 4CICA 2HDDA 3A1YA 3LSKA 3BTIA 1XCBA 3ZQHA 4BJ5C 2LSOA 5D4SA 4EV0A 2O61A 2MH9A 2RQPA 3KEQA 1OCOH 2LD5A 1P6RA 2R7QA 2LY1A 4IKFA 4MEYF 4QIWN 4Q48A 2DOEA 1B8IA 1R00A 4NNJA 3VSKA 3KYCB 5K5RA 1OR7C 2XPWA 3RZDJ 2E7XA 1ORKA 2KRHA 2L5QA 3PUFA 1N75A 4BHPA 5DD8A 1T38A 3I4MJ 3QOEA 2IBDA 1U78A 1B72B 4WK8F 2KRFA 3OWTA 2H27A 1KQ9A 2UXNA 4MIMA 3LFKA 3HRMA 1ACIA 3V8LA 3QQAA 4PSXA 2GLOA 5ILUA 4P5OA 2X85A 3KP2A 1ZRFA 1R4MB 4ETSA 1ZHFA 3QPSA 3FBIB 4I02A 2L7FP 4RMNA 1PP8F 3IL2A 5ICCA 1Y39A 1ETQA 3GO5A 1QRYA 1EH7A 1I5ZA 3ZP5A 3F8MA 5EEGA 1BW6A 3CZ6A 3ONQA 4D7MA 4DBQA 2A05A 3KZZA 3HRUA 1ODDA 3EUAA 1J09A 2H1KA 1YLFA 1T8IA 4U0WA 2VJ4A 4M9XA 2XSDC 1E2XA 4Y7NJ 2D5VA 2L3DA 4OIOF 1WGXA 4Q5SF 1WJEA 1ZAOA 3M9AA 5E8GA 3GFLA 5HLHA 1FYKA 3HM5A 2KIUA 2FQ3A 5FLMJ 3RCOA 1SD5A 5IYBJ 2DW4A 3A01A 2WBMA 2BY0A 1DGRM 3WTVC 3DQVC 2V9PA 2OZUA 4LITA 5K5OA 3AKZA 1LUJB 3K70C 2DCEA 5FRMA 4D5CA 2KP6A 3LL7A 2IS6A 3FM3A 4Y52J 1T6SA 3K4NA 1BW5A 5GAHJ 3HRSA 1QZEA 4II2A 3ZGKA 3MZYA 4NB5A 3H3VK 2LP0A 4CH7A 4ZTJA 5J40A 1XDUA 1IRZA 4LIUA 1LE8A 2M4KA 4IF4A 2ZMEB 3TO9A 2JSCA 5DUIA 4EGYA 4XL9A 2HOEA 3JCUC 3RTRA 4YFXF 1A6IA 1OYIA 4HX4A 2JK3A 2H6BA 4M73A 3ZQLA 2CQ7A 3P9IA 1MD0A 1K4SA 1NG7A 3MVPA 2VPLA 1PUFB 1S6LA 3ECOA 4D0PA 4OIQF 3F0CA 1IJWC 1W7PB 2ICWG 2F6CA 1IXCA 3WTWC 2V9KA 3RPQA 3CCYA 4HQEA 2GXAA 1FC3A 1V5EA 5E17F 2F5CA 5CVJA 2KMUA 4X1EA 2YU9J 1KZHA 4CYCB 4M72A 1QHGA 1KGSA 5EG0A 3DWLE 4NHJA 2OZ6A 3KP7A 4CXFA 1D5VA 3AFHA 1HF0A 4RLQA 2D45A 2RREA 1W36C 3JTHA 2QENA 2RV8A 4P9FA 4RAGA 4YELA 2XGCA 3K4KA 4V2GA 2HS5A 5E3NA 2M1BA 4EATA 3WHBA 1MBEA 3C2GA 3FKJA 3TOAA 3HBLA 1V5GA 2L7ZA 2OCCH 2QVOA 4XRSA 1G59A 4PDKA 2NOJB 5F04A 3WGGA 5IP9J 3OYKA 5F08A 3P7NA 1OYYA 5DV5A 3PFIA 5HDKA 2DXIA 4G8XA 2JA7J 2ZFWA 5BQTA 1IAWA 2FOWA 3SEQA 2GQQA 3S32A 1DU6A 3DBLB 2IA0A 2ISYA 4RAZA 3Q9SA 3HL2A 4XKWA 4CZCA 3EYYA 2PQ8A 3GWZA 1XB4A 5ICFA 3LNQA 3DU5A 4EGZA 2Y31A 2MH2A 2XPVA 4GRIA 2LREA 3PM1A 3B73A 4QPOA 1HQCA 2QWWA 3DPLC 3IKTA 1T08B 1J0RA 3L00A 2OBPA 2XAUA 2VI6A 3K1PA 4LK1F 4BL0B 3VYRB 2R7VA 9ANTA 2EFPA 1AKHA 4HF0A 3G2BA 1FIPA 4KN4X 2CV0A 4A93J 1S7OA 2A07F 1D8KA 2MW8A 2Z3YA 2OU2A 1YFHA 2R7DA 2VBWA 3K1NA 2Q1ZB 2GIZA 2EV0A 2JUCA 5DDGA 2OF7A 2K7LA 1TW2A 3LSJA 1T39A 3CESA 3QYEA 4AVPA 5IT3A 1E3OC 3Q0WA 1V5FA 3QU6A 3VEPA 1J7KA 1DPRA 3JRGA 4NUBA 4A6EA 1F9NA 3OOUA 6PAXA 1JHFA 3DLAA 2GIVA 1N78A 2XAFA 1P4AA 3KX2A 3CCVI 1RPWA 1J5YA 4KN7X 5E20A 2WTEA 2HWVA 5L3FA 1I6XA 2OC6A 4I0BA 4IVNA 3UR3C 1P4WA 2DDBA 1MJ9A 3E5QA 2DTRA 3TW6A 4B4CA 2EFQA 5JI6A 2K3FA 2KJBA 2W82A 4HRIA 4QWQA 1YIOA 1MBJA 2CQQA 3GEZA 3QP6A 3RDIA 2R7FA 1LJ9A 2CW0F 4XOTA 2NVUB 1RI7A 2JUGA 5M5WJ 2IS1A 1FOYA 3RQ4A 1Q1VA 4HW0A 1VI0A 4NBQA 2K4BA 1GHCA 2VODA 5CYVA 3HZJA 1TQPA 3O8GA 2O6GE 3BPVA 2XKOA 3MWMA 2OA4A 2F4OB 2V6EA 2ME6A 2DA1A 3REOA 1IN8A 3S93A 3ZRGA 4FQGA 4AD9A 5DCMB 4CA0A 2XRLA 2L4MA 5CQGA 5LD2C 2JA2A 1X1AA 4CCNA 2E1CA 1ULYA 4XRMA 1GT0C 2A69F 5H6QA 4JQFA 3VYTB 3S2WA 1JKPC 2DPDA 1Z1DA 3KP6A 2LBFB 2NVQJ 4MEXF 4BE2A 1GXPA 2HFHA 2LYCA 2FMYA 4ENJA 1WQ2A 2CU7A 2X1CA 3BG6A 3VOEA 1IUFA 2XSJC 4N4NB 2D1VA 2FBKA 3H9GA 2DA3A 3VPRA 2R7TA 1OJLA 2NYXA 4BDYA 2K02A 3HSEA 1XN7A 2BHYA 2FEZA 2CG4A 1G2HA 2K4JA 3C3WA 2HXOA 4M3FA 4RB0A 1V55H 3EUHC 5FB2A 4E7IA 2R7OA 4LG3A 1U8BA 1EF4A 2OJED 1YS6A 3ZMSA 1QA6A 1SFUA 1TNSA 3AG2H 4FETA 4DOZA 5LRSA 3FWEA 2GA2A 3F23A 5DCFA 3TP0A 1YYVA 2DOFA 1E3HA 2VJJA 4XBFA 1FPQA 5ERIA 5H2FC 3CMMA 4BY7J 3S3NA 4L9NA 1Z67A 3GTQJ 2CUEA 5CKTA 4BUPA 5K5QA 1REPC 3FF5A 2XGEA 1JKRC 3EYIA 3BROA 2GBYA 3FBNB 3CLOA 3KLOA 3BWGA 3U9GA 3ZCOA 1S3JA 2HXIA 4XLEA 1BIBA 2GOMA 1Y56A 2XHKA 5M5YJ 4BQAA 4A3DJ 1MZBA 1LDDA 4IHWA 3BTJA 5B3SH 1YITI 2CW8A 2CQNA 2XB0X 3I59A 4PK4A 1UMQA 4XKBA 1IZ1A 3TKYA 1W0TA 3DU6A 5B66C 2DODA 2G0EA 4L5JA 4XLCA 4M6XA 4RLFA 4I99C 3L2WA 1U9NA 1OFCX 1X19A 4HNTA 5HS8A 1TNTA 4A3CJ 3S14J 3JW4A 4RS8A 4B3AA 1G3TA 4IQJA 1HLVA 1XPXA 3RQIA 3SXYA 3N4MA 3ABKH 3KEOA 3LMMA 2V1XA 3I53A 3ABLH 2LKXA 4AYBA 3AL0C 2XF6A 3ZQCA 1LFBA 1WJAA 2JVGA 1HW1A 1FP2A 1P4XA 4XM3A 2K3PA 2VQCA 3HGGA 4IL6C 3E6BA 3A4CA 4M3BA 3DEWA 5LGTA 2ECBA 2JA8J 2CW7A 1BI0A 1QVTA 4BH9A 3ZN1A 2BVLA 3H5NA 4AWXB 5TJJA 1EH6A 1UHWA 1TQMA 4XQFA 1IN7A 1D1AA 1Y8QB 4XRFA 2LDUA 5B1AH 1BC8C 2EIKH 5M5XJ 4IOCF 2OAZA 1W7PD 2M4GA 2VE8A 1OKRA 3IRRA 2LLKA 3WGIA 1HBXG 4JP0A 2R0QC 2X4HA 4Z2YA 2DFEA 3K9TA 4YFNF 5LGUA 5BPIA 5TGTA 1IW7F 3MZ8A 2VB6A 4DBRA 3HPGA 3BG5A 1V3FA 3TW7A 1GV2A 1G6NA 3VODA 2H6CA 3OMYA 1YJ9I 4U87A 4DIQA 3ABTA 2LVSA 3BP8A 2FE3A 5DD4A 1ZGAA 2VT2A 1K78A 2M45A 5BS6A 3UNGC 1O7LA 4A3IJ 5CVVA 2OTLI 2O5RA 3HEFA 1BJZA 3HKZA 2CV1A 1XMXA 2E5ZA 2BY2A 3BDDA 2X6WA 4AIKA 4ANJA 3HOSA 3BZKA 3WG7H 1ZQ3P 1SC7A 3S3OA 4QLCU 2O8XA 2M87A 1TWAJ 1R23A 2WB1N 1P92A 2FJ1A 3CCLI 2HKOA 2M0MA 1ZGWA 1ZARA 1BL0A 2L9VA 1XGSA 4HX8A 5H6RA 3ZQFA 5KAFC 2LNBA 4Z6YA 5B1BH 3BR1A 2PJRB 4RGUA 2CO5A 2QQ9A 1K6YA 4YFKF 4JBAA 2G7HA 2K5CA 1YS7A 2HTSA 3PNVA 1IRFA 2MG4A 3QOPA 5D5WB 3HOZJ 3ERMA 5EJCA 2OCEA 4BHCA 1FBSA 2JA6J 3GTKJ 4KJZA 1PVEA 2QKLB 2H09A 2Y0SN 3S17J 4CDGA 1WI9A 3W6KB 4UVCA 1PJRA 2EZLA 4CCLA 4Y13A 3L2CA 3HOUJ 2LR8A 4GCVA 2L9RA 2K9NA 2K9QA 3OV8A 4KT5C 3SZTA 2DT5A 3HXLA 3I9V2 5EGOA 2KFDA 2FBHA 2DBBA 3K4JA 2OUMA 5DUKA 4ZC3A 3ZN0A 1FBQA 3RYPA 2EA2A 3OYEA 1ETVA 2HZDA 1WRJA 4HF1A 3LQQA 1I27A 3ZOBA 5M3FJ 4F93B 4MTDA 4BU2A 3L2VA 2ZKZA 3BR0A 2CUZA 3G1MA 3N97A 1FOXA 4BGDA 3CF2A 3S2HJ 1A5JA 5GTIC 4A12A 3F6VA 5FKMA 5AIQA 5FROA 1Z6RA 1IN5A 4GYGA 4HLXA 1ZKGA 3QPHA 2NOGA 4LGWA 2L0KA 4XRSG 1ZR4A 1N77A 1MBGA 3F8NA 3RZOJ 2PMZA 3R61A 1W36D 1D5YA 3CQZJ 4B43A 2TRTA 1W5TA 1HKQA 4C30A 1PDNC 4U88A 4GXOA 3G73A 1FWZA 1Z0XA 2CQKA 1H8AC 4CSWA 3SDBA 1H89C 1D0YA 5A2QZ 3FXUA 5GPCA 4O3MA 4NQWB 4TV7A 4BNCA 3LSTA 1ETOA 4IRHA 2IP2A 5IOYA 1IDZA 1IN6A 3KE2A 1HKTA 2RQQA 3N05A 2YSRA 2ZJQF 1BIAA 2ESHA 3O3KA 1Q1HA 3T8TA 4LFUA 3W6VA 3DV8A 4I09A 2JA5J 3NWSA 1JGGA 2XC7A 2OTJI 2H8RA 4YRVA 2UZKA 3KYLA 3GZ5A 2Y48A 1IN4A 3CJRB 4JOMA 2DFHA 1ERDA 2PG4A 1V4RA 1Z21A 5HS7A 5LGNA 3I54A 1MMAA 3WHCA 4DZJA 3H3UA 4QPQA 2HZTA 5HLTA 5F6FA 4HAMA 1JUMA 5EDNA 2M8GX 1T95A 3VYSB 2MABA 3DEEA 1QHHD 2IEKA 5D8KB 1B9MA 1POGA 4PSWA 2DFFA 4V2FA 5KNLA 3PNTA 2EV5A 2QYOA 2DDAA 2BXZA 3IHUA 1QU3A 4UNOA 5CJ9A 3CP2A 4A3FJ 3FKIJ 4OIRF 2F48A 4FE4A 3F9KA 2IA1A 4XLPF 3MKWB 1RKWA 4R8HA 5J1YA 3QWLA 3HOXJ 1SEUA 4BEHA 1T2KA 2WAFA 1D8JA 2IAIA 3O6BB 3CCJI 4ASNA 2AXLA 1OISA 1UCRA 1STZA 2ISZA 1LEBA 3WU0A 4JX4A 4C3IJ 2LOOA 1YW9A 4XN0A 3JRBA 3HIFA 2COBA 2WB1A 3Q0VA 3I59B 3U1DA 1H88C 3J7ZI 2BYVE 5D5UB 3JRAA 2HEOA 4L0YB 3HJEA 3MMYB 4OOIA 4PJ0C 2BXYA 3OYNA 2EJRA 2PMUA 1B72A 5DCMA 1H9GA 1I3AA 3IUOA 1KQ0A 3SFIA 5F27A 2F4MB 2VIXA 4FHTA 5ICGA 1CGPA 3IH3A 1FTZA 4XLNF 3MAJA 4CO8A 5K7ZA 1RIOH 4ZDOA 2CUFA 3ASOH 2FF4A 4E7HA 2JRTA 1VZ0A 5E1XA 4ZH4F 2Y0MA 1U5TB 5CVUA 3S3MA 1IUYA 4IPAA 2Y9YA 5LLQA 2Z1DA 1MMDA 1DP3A 1U5TC 5L3CA 2IPQX 2VKEA 2KLOA 3DPUA 3OYIA 4BXFA 1FJLA 1WVRA 3I3LA 3GW2A 2DMPA 1WJ5A 1Z7UA 2V4JC 2MD0A 3RKXA 3ZPLA 2P8TA 1GV5A 3E6CC 4ENKA 2R7UA 1QZZA 1YW8A 2EBIA 4XSZF 1T0FA 4LMYA 3WTYC 3CMYA 5JHUA 3GTLJ 4XONA 4IOAF 3OYDA 1IDYA 3G4SI 3FXLA 4G6QA 4RA2A 2B63J 1T0FC 2V26A 3HHHA 3RPUD 2PJRA 5HLIA 4HF2A 1VQKI 2KIQA 2RVCA 3JRFA 1UHMA 1XMKA 4KIFA 5E8IA 1ZG1A 5DM6F 3RI4A 4Y4RA 3I5UA 2DO7A 1KONA 2Q2EB 4Y15A 5KCMA 5C3EJ 4IHXA 1ZLKA 4R1HA 1G3WA 2IGOA 4CCOA 2DFIA 5FKNA 2V7FA 3OS2A 4HSTA 2R7WA 2HDCA 4E7KA 4YEJA 3WODF 5AONA 4IXAA 1AOYA 3FHZA 4HX7A 4M6YA 1VQMI 2M2EA 3NWTA 3IAM2 3BY6A 2QSGX 3SEZA 5J4YA 1PUFA 1FSEA 3TBIA 4RGXA 1XX5A 3BR2A 2MLKA 4XMYA 4CCMA 5C4JJ 2A61A 5DEQA 3PUBA 1W1WE 4ZDPA 4BE0A 5JR3A 4PFPA 3JSPA 2KKOA 1YTYA 1CQTA 2QGUA 2QSFX 5FLXK 2HNHA 4N9IA 3KP4A 2B9SA 1WKMA 5LFAA 1PUEE 1IF1A 1ONVA 1TTYA 1YRNA 1JT0A 1MDMB 1YOVB 2OD5A 1P7JA 1Y0UA 3TMOA 4A0XA 4S04A 2QSHX 3L7WA 4I76A 4LLGF 2CSOA 2MLGA 2VPRA 4PGGA 4EQQA 2F4IA 4MFDA 3ELKA 2Y69H 5ICEA 3BJOA 3LSHA 4L9TA 3BR5A 5L3GA 4BQOA 1R4NB 2R93J 2JTVA 2R4GA 3HOTA 2FMLA 1PYVA 3W2VA 1HKSA 3P9KA 4GGGA 4BXUA 4AIHA 5J47A 2MGQA 3KPHA 2XAGA 4ZJZA 4WXDA 4PUSA 1U8RA 4HSRA 1VQPI 3PQKA 2XV4S 2MA3A 2QBYB 1RRJA 4X6AJ 4ON0A 2HPIA 4S05A 4IX7A 2EIMH 2LFBA 5J3LA 3PIPF 4CYCA 3WTTC 1K61A 2A68F 4H0EA 2UWMA 1IRGA 3W3CA 1GXQA 3JRDA 3BZ6A 1WJFA 1WFXA 3D0SA 2R3SA 2COMA 1SAUA 2ME0A 5F1RA 2DAOA 3JTGA 3J81Z 1L3LA 3EUKL 2PI0A 1R1TA 3K4CA 3J80Z 1AU7A 1UAAA 1FTTA 2I10A 5EZGA 2E60A 3T0YA 2LMDA 3WG9A 3PIOF 1OCPA 2KZGA 2LKSA 3KYDB 3OYCA 1IV6A 2PN6A 3FHNA 5CVIA 3T1BA 2HTJA 3ML6A 1S7AA 4FTHA 4M71A 2L01A 3CMEI 3KZYA 1B8IB 2QM3A 3FXOA 2PEXA 3H5AA 1JJ6C 4XORA 1X2NA 3BT9A 1VF9A 2PMHA 2Q8KA 1LFPA 3W2WA 1TW3A 1U6GA 1VQ7I 5E3OA 1A6QA 1R22A 4OU0A 3GTJJ 2LF7A 1TWHJ 1MDMA 4DYCA 1KA8A 1X58A 2VQHA 3ZQGA 4DW6A 1S8NA 2ZJPF 3EPZA 1KYZA 2FA5A 3HOYJ 5M3MJ 3ASNH 4ENMA 2FOKA 2MYSA 2F2EA 1I39A 2XB5A 1A35A 1D0ZA 1F5TA 3CO7C 1D1BA 2IRFG 3WU2C 1T98A 2FSWA 5FKKA 1FYLA 2EFNA 3DKYA 3M07A 2IJLA 2LY9A 4HQMA 5LEKA 3K1MA 1J2XA 1TQIA 3WU1B 3KLNA 3X2QH 4BEHB 4XKVA 1SANA 1O4XA 4CCJA 3M7GA 5FO5A 5LHIA 4MHGA 2VBYA 1SD4A 1YJWI 1W7PA 2F5EA 2ZFUA 4ITVA 3IAS2 2E36A 1IG7A 2NS7A 4G7ZF 1MBFA 3TO6A 4E7LA 2X51A 4GYIA 4LB5A 1P9QC 5EGOB 2JPBA 2QKMB 1XGNA 3BC8A 5K7FA 2GAUA 3D5LA 4KNYA 1X4OA 1MMSA 5BNGA 2O3FA 5GPAA 2G7UA 3EUHA 1VTNC 1VQ8I 1OYWA 5DYMA 3C2BA 3LSGA 2K86A 1G4DA 4N0BA 1KQ8A 3CCQI 1K78B 1U0JA 2FBIA 4IHVA 2NS0A 3BTCA 5IP6A 3GZNB 3V7SA 3OY9A 2FQ4A 2KISA 2IXSA 2EIJH 5C44J 1O3QA 2K9MA 3HOVJ 3M1EA 1BM9A 2EZKA 1X1PA 3J81K 4E6KG 2ZBKA 1ZYRF 3AG4H 3BCAA 3G1LA 3ZMTA 1YIJI 1R1UA 1XS9A 1FOKA 3KEYA 2BZTA 1F36A 1OLTA 3PL8A 2ACJA 3TDUC 5LRRA 5JLWA 3OYBA 2K85A 1G3SA 1OR7A 4PJJA 3NAUA 2H8WA 5GP9A 2ZO4A 4UB6C 2K27A 5F0HA 1YW7A 3OYAA 1ETKA 5LEJA 3FXJA 2VC1A 3LOCA 3E97A 4B09A 2C6YA 2A5YB 1MIJA 2QF7A 1R5HA 3HUGB 2P5VA 3VYUB 2WADA 1O7FA 4KDPA 1MNMC 2HOAA 3CCEI 4HNUA 3AL0B 2KRCA 4RB2C 4RAFA 1TP4A 2EZHA 2AHQA 2ID3A 2VJ5A 5F64A 4UUSB 4L5IA 4IEJA 2W4SA 3HRTA 3TL4X 3GTPJ 2M0CA 3FK7A 1SFXA 2YPRA 3CC2I 2L9NA 2BVMA 1BBYA 4I98B 3J80K 2QCOA 3T5XA 1L0OC 4IQ4A 3Q5FA 2DYRH 1Z7LA 2ZB9A 3H36A 3CMAI 1SVLA 2LK2A 1IV8A 3KIOA 4ESJA 2EPFA 4WWCA 1R36A 4MQ9F 3SHFA 3LSIA 2Y30A 3ZXSA 2IGMA 3IP4B 2STWA 2RC4A 1HC8A 4C2TA 4J00A 5IPAA 2CRGA 5ILSA 4A5MA 5C4XJ 3GLXA 2V79A 3ZR8X 5JVTA 4NC8A 5DM7F 4UB8C 2QUFA 2O7OA 2NVTJ 4RGSA 3AG3H 3E6DA 2VKVA 1BOAA 4WX9A 3GFJA 3TQNA 3T8RA 3S8PA 4EMSA 1IO2A 2CWEA 2ELJA 4ABZA 3GLLA 2DA4A 1F1ZA 3WTUC 3DEUA 4PJNA 2JJ7A 3AG1H 1U2WA 1GVJA 2HPMA 4UVBA 3H0DA 4J19A 1APLC 3HDDA 3DF8A 3IKVA 2XAJA 3PNYA 1ON2A 4NC6A 4LG0B 3CUQA 1VQNI 4ZZDA 1FSHA 2P81A 2HQRA 2X6XA 5E1WA 3SZPA 4A3MJ 4V19K 1FT9A 1EJ9A 4ZTFA 4YIIA 2XF7A 1TZLA 4RBOA 2PLYA 2OQRA 2O0YA 1LNWA 3BQZA 4OAYA 2V9VA 1LVKA 1NK2P 4HLYA 1XC5A 3LWFA 1VQ6I 1WH5A 2MBFA 4DYRA 2VJIA 3DLLF 1IXSB 4AIDA 1RUNA 1RZ4A 2NNNA 4C9YA 4HYEA 1ZN2A 4NQWA 3LSRA 1F43A 2VLAA 2F5DA 3R0JA 3DBRB 1SVOA 3CF5F 3QRFF 2NVXJ 4FASD 2A5WA 3KCCA 4IO9F 3CP8A 2ID6A 1Y1WJ 2XAHA 1JTYA 1H0MA 1P7IA 2XVCA 3NEUA 1U3EM 4ZYHA 3HTSB 4D9JA 4UY8I 1B59A 4CUGA 4IRIA 1GUUA 2GXBA 3H5RA 4U7DA 4II3A 5HNHA 4LLNA 3F8BA 1C0WA 3H92A 2RNGA 4I7HA 3LFUA 3OS0A 2HR3A 1S29A 3M8JA 2XIGA 3FDYA 3PQJA 3R6SA 5DTDA 3ROUA 2VUMJ 1FLIA 2PMZN 1W5CC 2V1NA 2EINH 3OYGA 3OR1C 1TWFJ 3CC4I 1XCVA 3DFGA 5FD5A 2KZVA 5KK1A 2DTZA 2X6OA 1MSFC 4CYDA 3PO2J 3C1DA 3M1CA 2G9WA 5KAIC
chains in the Genus database with same CATH topology
3CUQB 5E18F 1G3YA 1JGSA 1YG2A 2RGVA 5D5VB 3JAMZ 3K2ZA 4MQVA 1I1GA 4L18B 2YR2A 2P6TA 4HA8A 5FFXA 4EJTA 3BJAA 3L09A 3ECHA 3HSFA 4Y17A 4KMFA 4EVIA 4UVAA 4KA4A 3L9FA 5FLXZ 2WC2A 3WTZA 2TDXA 3WGHA 3V4GA 4RAYA 4KFCA 1FP1D 5HS9A 4IJAA 4ZYGA 1JE8A 1O3TA 4EM0B 3J7AO 1LDJA 4GO1A 3MFKA 1A04A 1LEAA 3IC7A 2EA4A 2ESNA 3GVAA 1HXDA 3ULQB 4U0VA 1SD7A 4L9VA 5BMZA 4A2UA 5L3EA 1LQ1A 2BV6A 1R1VA 4LG0A 1FBUA 2UXXA 2QBYA 3CJNA 2DU9A 4MTEA 1IXRC 3GUDA 1FZPB 4CHUA 3EDPA 5HDNA 3GFMA 4G9YA 1MGTA 4G7OF 3LA7A 4EM1A 3WTXC 2LKPA 3HUGA 4RB3C 3ZMUA 2DPUA 2CFXA 2GWRA 4YIFA 1Z05A 3CTAA 2EFOA 1B6AA 5D4RA 3EQLF 3OOPA 5H20A 1Z6TA 2A3SA 2Q2EA 3SQNA 4U0YA 4G7HF 3FX3A 5LHGA 2ETHA 3M8FA 4CZZA 1PP7U 3FMSA 3G3ZA 2NNYA 1AWCA 4HZFA 3ZMVA 1XSXA 2EWNA 2Z5UA 3QAHA 4FX0A 2MC3A 4MGRA 4A6DA 5A2QK 5AIPA 4FT8A 4EJOA 2RNJA 3U2RA 2WWYA 2KIMA 5HDGA 3RIRA 3LQRA 2XAQA 5L3BA 3BOQA 3GYHX 4JK1X 4YG2F 3TOBA 2JT1A 1OPCA 4M9SA 1ZREA 3QU3A 1MKMA 3F8FA 4R79A 3QPTA 2P5KA 4RGRA 4AIJA 1W5SA 2KIFA 1ZRDA 3TO7A 3F72A 2RN7A 5HVQC 3P9CA 1KYWA 4LLLA 4UV8A 2IVMA 1H9TA 4ZZLA 1J59A 2D1HA 4EM2A 3DXJF 5E1ZB 3SFZA 1DP7P 4L9JA 2ZNZA 2ELHA 1B4AA 2H94A 4IRGA 3FZVA 1BN5A 4DNCA 2A6HF 3V7CA 4G6DA 4KIGA 2JPCA 2M5WA 1WSUA 2HYGD 2J5PA 1ZGJA 1HW2A 4UHTA 4BAYA 5KVRA 1DUXC 5ILVA 4B8XA 4N9HA 3IRQA 3R4KA 4OIPF 1B1BA 1J9IA 3ZMDA 1P2FA 2FNAA 1SMTA 2CGPA 2MD5A 1FX7A 3E5XA 1TLHB 3LAJA 3VB2A 4UXNA 2Q0OA 1RUOA 1ZH5A 2V1UA 5BOXA 4Q4ZF 3KFWX 3DP7A 4PGHA 3LAPA 1EH8A 3I4PA 2FXAA 3HSRA 2NRAC 3FMQA 3KP3A 3RJPA 4HDUA 3I58A 3FXQA 4A0YA 2DK5A 1XGMA 2DK8A 1R7JA 2ZCWA 4DQ2A 3K0LA 3RKYA 4O6JA 1K79A 4LJZF 1D3YA 5IT9Z 2VT3A 1O57A 2IW5A 3FM5A 2IT0A 4HBLA 3WE2A 1ZG3A 2FU4A 4ESBA 2GZWA 4KYWA 2GA1A 2EB7A 1E17A 4E70A 4HV5A 5J6XA 4ESFA 4FX4A 1XD7A 5J8CA 3MZHA 2DQRA 1QPMA 3JSOA 3DPTA 5K1YA 3F6OA 2KJCA 3WE3A 4MNUA 3MQ0A 1QZYA 2M30A 4F7ZA 2W25A 2VN2A 5JFRA 5FD6A 3F21A 3F3XA 4LB6B 5J8FA 3WTSC 1YQAA 3MEXA 5D6FA 3C18A 2HQNA 2QQBA 3E3VA 2XKPA 3HYIA 2Z9OA 4CGZA 4P9UA 2VXZA 4HV6A 2Y75A 4O5VA 3VFZA 4RB1A 2L4AA 3NRVA 4EJWA 2RKHA 3CDHA 4P55A 1ON1A 2VONA 5HOOA 2EV6A 4OMZA 3ZMZA 5ED4A 1KU3A 2LF8A 4L0ZB 4WCGA 3NQOA 2DQLA 2DI3A 3W6JB 4BYYA 1YO5C 1I1SA 3RKWA 4U7BA 3IWFA 3IWZA 1XGOA 2QQAA 2B0LA 1LDKB 1CF7A 2FRHA 4ZYDA 1ZG5A 3RPUA 3CUOA 5BPDA 2HGCA 4OMYA 4M9ZA 3EETA 1MJAA 3MCZA 1BC7C 1KU2A 1BI2A 3FXRA 3GFIA 2YX4A 4P96A 3I71A 1QNTA 3R60A 1X3UA 2EFWA 2XUBA 1R5GA 1SAXA 2P7VB 3GF2A 3V8KA 2HKXA 1OMIA 4OINF 2V1DA 2W24A 3HHGA 4ZYEA 5CLSA 3TDZC 2Z99A 3COAC 3LA2A 1HSJA 3O2PE 5LBQA 4BHBA 3Q9VA 2XRNA 1U5TA 1BJAA 2P7CB 1XMAA 1JXSA 2EK5A 3CUQC 4I0AA 2YU3A 4LD5A 2JZYA 2XGXA 2HYFA 4A5NA 3I64A 2PBIA 2OQGA 3KETA 4KICA 4IHSA 1FY7A 2YX7A 1MJBA 1R58A 4WF2A 1LB2A 2VOPA 5CVRA 1FNNA 3BPXA 4M74A 1DPUA 1HW5A 1JHHA 3FMRA 1KU7A 2FNPA 2F5FA 3ISPA 1XSDA 4LK0F 2STTA 2DLLA 2QZ8A 4HDVA 2VBZA 2PJPA 2E1NA 1CF7B 5LHHA 2ZXJA 3KP5A 2IA2A 2ZNYA 1BI1A 3V7RA 1USSA 4KMUX 4KIBA 3HTUA 2PFBA 5TRDA 2RDPA 2D2WA 1DDNA 3BJ6A 4K2EA 2M8EA 3F22A 1O3RA 1K6OA 5D8LB 2P6SA 3I0TA 2A6EF 4EJVA 2J5OA 1SD6A 3LA3A 3AAFA 2V6CA 1BI3A 4ENNA 3H3ZA 4HOBA 2NAZA 2WV0A 2BEOA 3DKWA 1W4MA 1UB9A 4I2OA 2W57A 2VC0A 3E6MA 2BBYA 1USTA 3K69A 2L02A 2P4WA 1J75A 2BGCA 2AS5F 4WXHA 1XSVA 3QP5A 3R0AA 3M8EA 4KUMA 1QBJA 3RYRA 5D5XB 4EJUA 5D6EA 2GXGA 1F4KA 1Z91A 2XROA 1UFMA 5FGMA 4PCQA 1RNLA 2L54A 2VE9A 3GZ6A 4XSXF 3TGNA 1O3SA 5IT9K 3ERED 4PZJA 2QLZA 4Q47A 5EEHA 2Z33A 1ZLJA 3JAMK 1B9NA 2E7WA 3F8CA 5FFZA 1K7AA 3ABUA 2VBXA 1SMYF 1NHAA 4G94A 5HLGA 2W84A 4I01A 4IHTA 3B02A 2P5LC 3CO6C 4A0ZA 2W85A 1QGPA 2O03A 2CYYA 2ZJ2A 1Z9CA 3GX4X 1ZRCA 1XDSA 1QQIA 1TBXA 2ZMEA 2ADUA 1LVAA 5L3DA 1QO0D 3V8JA 2X0LA 3ZQ7A 1WWXA 1EV7A 2XASA 3C7JA 3E5UA 3GXOA 4UV9A 1KU9A 2VOOA 1FYMA 4UUVA 2BE5F 1HSTA 4WXCA 1SFEA 4CICA 1XCBA 2LSOA 5D4SA 4EV0A 2O61A 2MH9A 2RQPA 3KEQA 1P6RA 4MEYF 4Q48A 1R00A 5K5RA 2E7XA 1T38A 4BHPA 5DD8A 1U78A 4WK8F 2KRFA 2H27A 1KQ9A 2UXNA 3LFKA 3HRMA 3V8LA 5ILUA 4P5OA 3KP2A 1ZRFA 4ETSA 1ZHFA 4I02A 1PP8F 3IL2A 5ICCA 3GO5A 1EH7A 1I5ZA 3ZP5A 3F8MA 5EEGA 3KZZA 3HRUA 1ODDA 1YLFA 4U0WA 4M9XA 1E2XA 2L3DA 4OIOF 4Q5SF 1ZAOA 3M9AA 5E8GA 3GFLA 1FYKA 5HLHA 2KIUA 2FQ3A 1SD5A 2DW4A 3WTVC 3DQVC 2OZUA 5K5OA 3FM3A 1T6SA 3HRSA 3MZYA 4NB5A 1XDUA 4IF4A 2ZMEB 4EGYA 2JSCA 3TO9A 5DUIA 2HOEA 3RTRA 4YFXF 1OYIA 4HX4A 4M73A 2H6BA 3P9IA 1MD0A 1S6LA 3ECOA 4D0PA 4OIQF 1W7PB 1IXCA 4HQEA 3WTWC 3RPQA 5E17F 1FC3A 2F5CA 5CVJA 4M72A 1KGSA 4NHJA 2OZ6A 3KP7A 4CXFA 1D5VA 2D45A 3JTHA 2QENA 2RV8A 4P9FA 2HS5A 2M1BA 3TOAA 2QVOA 4PDKA 3WGGA 3P7NA 1OYYA 5DV5A 3PFIA 5HDKA 4G8XA 2ZFWA 5BQTA 1IAWA 2GQQA 2IA0A 2ISYA 4RAZA 3Q9SA 3EYYA 2PQ8A 3GWZA 1XB4A 5ICFA 4EGZA 2MH2A 3B73A 1HQCA 2QWWA 3DPLC 3IKTA 1J0RA 3L00A 2OBPA 3K1PA 4LK1F 2EFPA 4HF0A 4KN4X 1S7OA 2A07F 1D8KA 2Z3YA 2OU2A 1YFHA 2R7DA 2VBWA 3K1NA 2EV0A 5DDGA 2K7LA 1TW2A 1T39A 4AVPA 5IT3A 3QU6A 3VEPA 1J7KA 1DPRA 4A6EA 1F9NA 6PAXA 1JHFA 2GIVA 2XAFA 1P4AA 4KN7X 1J5YA 5E20A 2WTEA 2HWVA 5L3FA 1I6XA 4I0BA 4IVNA 1P4WA 1MJ9A 3E5QA 2DTRA 2EFQA 5JI6A 2KJBA 4QWQA 1YIOA 3GEZA 3QP6A 3RDIA 2R7FA 1LJ9A 2CW0F 1RI7A 4HW0A 2K4BA 1GHCA 2VODA 5CYVA 1TQPA 2O6GE 3BPVA 2XKOA 3MWMA 2OA4A 3REOA 1IN8A 4AD9A 5DCMB 2L4MA 2E1CA 1ULYA 2A69F 5H6QA 4JQFA 3S2WA 2DPDA 1Z1DA 3KP6A 4MEXF 1GXPA 2HFHA 2FMYA 4ENJA 1WQ2A 3VOEA 2D1VA 2FBKA 2NYXA 2K02A 3HSEA 1XN7A 2FEZA 2CG4A 2K4JA 3C3WA 4RB0A 5FB2A 1YS6A 3ZMSA 1SFUA 1TNSA 5LRSA 3FWEA 2GA2A 3F23A 5DCFA 1YYVA 4XBFA 1FPQA 5ERIA 4L9NA 5K5QA 1REPC 3FF5A 3EYIA 3BROA 3CLOA 3KLOA 3BWGA 3U9GA 1S3JA 1BIBA 4BQAA 2XHKA 1MZBA 1LDDA 3I59A 1IZ1A 3TKYA 4L5JA 4M6XA 5HS8A 1TNTA 3JW4A 4RS8A 1G3TA 3SXYA 3N4MA 3KEOA 2V1XA 3I53A 1HW1A 1FP2A 1P4XA 3E6BA 5LGTA 1BI0A 4BH9A 3ZN1A 4AWXB 5TJJA 1EH6A 1UHWA 1TQMA 1IN7A 4XRFA 2LDUA 1BC8C 2OAZA 1W7PD 1OKRA 2VE8A 3IRRA 3WGIA 1HBXG 2X4HA 4Z2YA 3K9TA 4YFNF 5LGUA 5BPIA 1IW7F 1V3FA 1G6NA 3VODA 2H6CA 3ABTA 3BP8A 2FE3A 5DD4A 1ZGAA 2VT2A 1K78A 2M45A 5BS6A 1O7LA 5CVVA 3BDDA 4AIKA 3HOSA 4QLCU 2O8XA 2M87A 1R23A 1P92A 2HKOA 1ZARA 1XGSA 4HX8A 5H6RA 2LNBA 4RGUA 2CO5A 2QQ9A 4YFKF 4JBAA 2G7HA 1YS7A 2HTSA 1IRFA 5D5WB 3QOPA 4BHCA 1FBSA 2H09A 4CDGA 1WI9A 3W6KB 4UVCA 4Y13A 3L2CA 4GCVA 3OV8A 4KT5C 3SZTA 2DT5A 2FBHA 2DBBA 5DUKA 3ZN0A 1FBQA 3RYPA 2EA2A 1WRJA 4HF1A 3LQQA 1I27A 4MTDA 2ZKZA 3N97A 4A12A 3F6VA 5AIQA 1Z6RA 1IN5A 4GYGA 4HLXA 3QPHA 4LGWA 3F8NA 3R61A 1W5TA 1HKQA 1PDNC 4U88A 4GXOA 3G73A 1FWZA 2CQKA 5A2QZ 3FXUA 4O3MA 4TV7A 4BNCA 3LSTA 4IRHA 2IP2A 1IN6A 3KE2A 1HKTA 2YSRA 1BIAA 2ESHA 3O3KA 1Q1HA 3T8TA 4LFUA 3DV8A 4I09A 2UZKA 2Y48A 3GZ5A 1IN4A 2PG4A 1V4RA 5HS7A 5LGNA 3I54A 3H3UA 2HZTA 5F6FA 4HAMA 5D8KB 1B9MA 2EV5A 2QYOA 3IHUA 4UNOA 5CJ9A 4OIRF 2IA1A 4XLPF 4R8HA 1T2KA 1D8JA 3O6BB 4ASNA 2AXLA 1UCRA 1STZA 2ISZA 1LEBA 3WU0A 1YW9A 3HIFA 3U1DA 3I59B 2BYVE 5D5UB 2HEOA 4L0YB 4OOIA 2EJRA 2PMUA 5DCMA 1H9GA 1KQ0A 5ICGA 4FHTA 1CGPA 4XLNF 3MAJA 4CO8A 1RIOH 2FF4A 2JRTA 5E1XA 4ZH4F 2Y0MA 1U5TB 5CVUA 1IUYA 4IPAA 5LLQA 1U5TC 5L3CA 2IPQX 3GW2A 1Z7UA 3RKXA 3ZPLA 2P8TA 3E6CC 4ENKA 1QZZA 1YW8A 4XSZF 1T0FA 4LMYA 3WTYC 5JHUA 4G6QA 3HHHA 5HLIA 4HF2A 2RVCA 1UHMA 1XMKA 4KIFA 5E8IA 1ZG1A 3RI4A 3I5UA 2DO7A 4Y15A 1ZLKA 4R1HA 1G3WA 2DFIA 2HDCA 3WODF 5AONA 4IXAA 1AOYA 3FHZA 4HX7A 4M6YA 3BY6A 1FSEA 4RGXA 2MLKA 2A61A 5DEQA 5JR3A 3JSPA 2KKOA 1YTYA 5FLXK 4N9IA 3KP4A 1WKMA 1PUEE 1IF1A 1ONVA 1TTYA 1MDMB 2OD5A 1Y0UA 4A0XA 4S04A 3L7WA 4LLGF 2CSOA 2MLGA 4PGGA 4EQQA 3ELKA 5ICEA 3BJOA 4L9TA 5L3GA 2JTVA 3HOTA 2FMLA 1HKSA 3P9KA 4GGGA 4BXUA 4AIHA 2XAGA 4WXDA 1U8RA 3PQKA 2XV4S 2MA3A 2QBYB 4ON0A 4S05A 3WTTC 2A68F 4H0EA 2UWMA 1IRGA 1GXQA 3BZ6A 3D0SA 2R3SA 2COMA 5F1RA 2DAOA 3JTGA 3J81Z 1L3LA 2PI0A 1R1TA 3J80Z 3T0YA 3WG9A 2PN6A 5CVIA 3T1BA 2HTJA 3ML6A 1S7AA 4M71A 2L01A 3KZYA 2QM3A 2PEXA 2PMHA 2Q8KA 1TW3A 1U6GA 1R22A 4OU0A 2LF7A 1MDMA 1KA8A 1S8NA 1KYZA 2FA5A 4ENMA 2FOKA 2F2EA 1F5TA 3CO7C 2IRFG 1T98A 2FSWA 1FYLA 2EFNA 2IJLA 4HQMA 5LEKA 3K1MA 1J2XA 1TQIA 3WU1B 3KLNA 3M7GA 5FO5A 5LHIA 4MHGA 2VBYA 1SD4A 1W7PA 2F5EA 4G7ZF 3TO6A 4GYIA 4LB5A 2JPBA 1XGNA 2GAUA 3D5LA 4KNYA 2O3FA 2G7UA 3EUHA 1VTNC 1OYWA 5DYMA 2K86A 1G4DA 4N0BA 1KQ8A 1K78B 2FBIA 2NS0A 3V7SA 1O3QA 3M1EA 1BM9A 3J81K 2ZBKA 1ZYRF 3ZMTA 1R1UA 1FOKA 2ACJA 3TDUC 5LRRA 1G3SA 1OR7A 2ZO4A 2K27A 1YW7A 5LEJA 2VC1A 2C6YA 3E97A 4B09A 2A5YB 1R5HA 2P5VA 1O7FA 4KDPA 4RB2C 5F64A 4L5IA 3HRTA 1SFXA 2YPRA 1BBYA 4I98B 3J80K 3T5XA 1L0OC 3Q5FA 4ESJA 4WWCA 1R36A 4MQ9F 3SHFA 2STWA 2RC4A 5ILSA 4A5MA 3GLXA 2V79A 5JVTA 2QUFA 4RGSA 3E6DA 1BOAA 4WX9A 3GFJA 3TQNA 3T8RA 4EMSA 2CWEA 1F1ZA 3WTUC 3DEUA 1U2WA 1GVJA 4UVBA 3DF8A 3IKVA 2XAJA 1ON2A 4LG0B 3CUQA 4ZZDA 1FSHA 2HQRA 5E1WA 3SZPA 1FT9A 4YIIA 2PLYA 2OQRA 2O0YA 1LNWA 2V9VA 4HLYA 3LWFA 2MBFA 1IXSB 1RUNA 1RZ4A 2NNNA 4HYEA 1ZN2A 4NQWA 2F5DA 3R0JA 3QRFF 3KCCA 2XAHA 1H0MA 2XVCA 3NEUA 1U3EM 4ZYHA 3HTSB 1B59A 4IRIA 2GXBA 4U7DA 4LLNA 3F8BA 1C0WA 3H92A 4I7HA 2HR3A 1S29A 3PQJA 2XIGA 3R6SA 3ROUA 1FLIA 1XCVA 3DFGA 5FD5A 5KK1A 4CYDA 3C1DA 2G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ B;  5E18 F;  1G3Y A;  1JGS A;  1YG2 A;  2RGV A;  5D5V B;  3JAM Z;  3K2Z A;  4MQV A;  1I1G A;  4L18 B;  2YR2 A;  2P6T A;  4HA8 A;  5FFX A;  4EJT A;  3BJA A;  3L09 A;  3ECH A;  3HSF A;  4Y17 A;  4KMF A;  4EVI A;  4UVA A;  4KA4 A;  3L9F A;  5FLX Z;  2WC2 A;  3WTZ A;  2TDX A;  3WGH A;  3V4G A;  4RAY A;  4KFC A;  1FP1 D;  5HS9 A;  4IJA A;  4ZYG A;  1JE8 A;  1O3T A;  4EM0 B;  3J7A O;  1LDJ A;  4GO1 A;  3MFK A;  1A04 A;  1LEA A;  3IC7 A;  2EA4 A;  2ESN A;  3GVA A;  1HXD A;  3ULQ B;  4U0V A;  1SD7 A;  4L9V A;  5BMZ A;  4A2U A;  5L3E A;  1LQ1 A;  2BV6 A;  1R1V A;  4LG0 A;  1FBU A;  2UXX A;  2QBY A;  3CJN A;  2DU9 A;  4MTE A;  1IXR C;  3GUD A;  1FZP B;  4CHU A;  3EDP A;  5HDN A;  3GFM A;  4G9Y A;  1MGT A;  4G7O F;  3LA7 A;  4EM1 A;  3WTX C;  2LKP A;  3HUG A;  4RB3 C;  3ZMU A;  2DPU A;  2CFX A;  2GWR A;  4YIF A;  1Z05 A;  3CTA A;  2EFO A;  1B6A A;  5D4R A;  3EQL F;  3OOP A;  5H20 A;  1Z6T A;  2A3S A;  2Q2E A;  3SQN A;  4U0Y A;  4G7H F;  3FX3 A;  5LHG A;  2ETH A;  3M8F A;  4CZZ A;  1PP7 U;  3FMS A;  3G3Z A;  2NNY A;  1AWC A;  4HZF A;  3ZMV A;  1XSX A;  2EWN A;  2Z5U A;  3QAH A;  4FX0 A;  2MC3 A;  4MGR A;  4A6D A;  5A2Q K;  5AIP A;  4FT8 A;  4EJO A;  2RNJ A;  3U2R A;  2WWY A;  2KIM A;  5HDG A;  3RIR A;  3LQR A;  2XAQ A;  5L3B A;  3BOQ A;  3GYH X;  4JK1 X;  4YG2 F;  3TOB A;  2JT1 A;  1OPC A;  4M9S A;  1ZRE A;  3QU3 A;  1MKM A;  3F8F A;  4R79 A;  3QPT A;  2P5K A;  4RGR A;  4AIJ A;  1W5S A;  2KIF A;  1ZRD A;  3TO7 A;  3F72 A;  2RN7 A;  5HVQ C;  3P9C A;  1KYW A;  4LLL A;  4UV8 A;  2IVM A;  1H9T A;  4ZZL A;  1J59 A;  2D1H A;  4EM2 A;  3DXJ F;  5E1Z B;  3SFZ A;  1DP7 P;  4L9J A;  2ZNZ A;  2ELH A;  1B4A A;  2H94 A;  4IRG A;  3FZV A;  1BN5 A;  4DNC A;  2A6H F;  3V7C A;  4G6D A;  4KIG A;  2JPC A;  2M5W A;  1WSU A;  2HYG D;  2J5P A;  1ZGJ A;  1HW2 A;  4UHT A;  4BAY A;  5KVR A;  1DUX C;  5ILV A;  4B8X A;  4N9H A;  3IRQ A;  3R4K A;  4OIP F;  1B1B A;  1J9I A;  3ZMD A;  1P2F A;  2FNA A;  1SMT A;  2CGP A;  2MD5 A;  1FX7 A;  3E5X A;  1TLH B;  3LAJ A;  3VB2 A;  4UXN A;  2Q0O A;  1RUO A;  1ZH5 A;  2V1U A;  5BOX A;  4Q4Z F;  3KFW X;  3DP7 A;  4PGH A;  3LAP A;  1EH8 A;  3I4P A;  2FXA A;  3HSR A;  2NRA C;  3FMQ A;  3KP3 A;  3RJP A;  4HDU A;  3I58 A;  3FXQ A;  4A0Y A;  2DK5 A;  1XGM A;  2DK8 A;  1R7J A;  2ZCW A;  4DQ2 A;  3K0L A;  3RKY A;  4O6J A;  1K79 A;  4LJZ F;  1D3Y A;  5IT9 Z;  2VT3 A;  1O57 A;  2IW5 A;  3FM5 A;  2IT0 A;  4HBL A;  3WE2 A;  1ZG3 A;  2FU4 A;  4ESB A;  2GZW A;  4KYW A;  2GA1 A;  2EB7 A;  1E17 A;  4E70 A;  4HV5 A;  5J6X A;  4ESF A;  4FX4 A;  1XD7 A;  5J8C A;  3MZH A;  2DQR A;  1QPM A;  3JSO A;  3DPT A;  5K1Y A;  3F6O A;  2KJC A;  3WE3 A;  4MNU A;  3MQ0 A;  1QZY A;  2M30 A;  4F7Z A;  2W25 A;  2VN2 A;  5JFR A;  5FD6 A;  3F21 A;  3F3X A;  4LB6 B;  5J8F A;  3WTS C;  1YQA A;  3MEX A;  5D6F A;  3C18 A;  2HQN A;  2QQB A;  3E3V A;  2XKP A;  3HYI A;  2Z9O A;  4CGZ A;  4P9U A;  2VXZ A;  4HV6 A;  2Y75 A;  4O5V A;  3VFZ A;  4RB1 A;  2L4A A;  3NRV A;  4EJW A;  2RKH A;  3CDH A;  4P55 A;  1ON1 A;  2VON A;  5HOO A;  2EV6 A;  4OMZ A;  3ZMZ A;  5ED4 A;  1KU3 A;  2LF8 A;  4L0Z B;  4WCG A;  3NQO A;  2DQL A;  2DI3 A;  3W6J B;  4BYY A;  1YO5 C;  1I1S A;  3RKW A;  4U7B A;  3IWF A;  3IWZ A;  1XGO A;  2QQA A;  2B0L A;  1LDK B;  1CF7 A;  2FRH A;  4ZYD A;  1ZG5 A;  3RPU A;  3CUO A;  5BPD A;  2HGC A;  4OMY A;  4M9Z A;  3EET A;  1MJA A;  3MCZ A;  1BC7 C;  1KU2 A;  1BI2 A;  3FXR A;  3GFI A;  2YX4 A;  4P96 A;  3I71 A;  1QNT A;  3R60 A;  1X3U A;  2EFW A;  2XUB A;  1R5G A;  1SAX A;  2P7V B;  3GF2 A;  3V8K A;  2HKX A;  1OMI A;  4OIN F;  2V1D A;  2W24 A;  3HHG A;  4ZYE A;  5CLS A;  3TDZ C;  2Z99 A;  3COA C;  3LA2 A;  1HSJ A;  3O2P E;  5LBQ A;  4BHB A;  3Q9V A;  2XRN A;  1U5T A;  1BJA A;  2P7C B;  1XMA A;  1JXS A;  2EK5 A;  3CUQ C;  4I0A A;  2YU3 A;  4LD5 A;  2JZY A;  2XGX A;  2HYF A;  4A5N A;  3I64 A;  2PBI A;  2OQG A;  3KET A;  4KIC A;  4IHS A;  1FY7 A;  2YX7 A;  1MJB A;  1R58 A;  4WF2 A;  1LB2 A;  2VOP A;  5CVR A;  1FNN A;  3BPX A;  4M74 A;  1DPU A;  1HW5 A;  1JHH A;  3FMR A;  1KU7 A;  2FNP A;  2F5F A;  3ISP A;  1XSD A;  4LK0 F;  2STT A;  2DLL A;  2QZ8 A;  4HDV A;  2VBZ A;  2PJP A;  2E1N A;  1CF7 B;  5LHH A;  2ZXJ A;  3KP5 A;  2IA2 A;  2ZNY A;  1BI1 A;  3V7R A;  1USS A;  4KMU X;  4KIB A;  3HTU A;  2PFB A;  5TRD A;  2RDP A;  2D2W A;  1DDN A;  3BJ6 A;  4K2E A;  2M8E A;  3F22 A;  1O3R A;  1K6O A;  5D8L B;  2P6S A;  3I0T A;  2A6E F;  4EJV A;  2J5O A;  1SD6 A;  3LA3 A;  3AAF A;  2V6C A;  1BI3 A;  4ENN A;  3H3Z A;  4HOB A;  2NAZ A;  2WV0 A;  2BEO A;  3DKW A;  1W4M A;  1UB9 A;  4I2O A;  2W57 A;  2VC0 A;  3E6M A;  2BBY A;  1UST A;  3K69 A;  2L02 A;  2P4W A;  1J75 A;  2BGC A;  2AS5 F;  4WXH A;  1XSV A;  3QP5 A;  3R0A A;  3M8E A;  4KUM A;  1QBJ A;  3RYR A;  5D5X B;  4EJU A;  5D6E A;  2GXG A;  1F4K A;  1Z91 A;  2XRO A;  1UFM A;  5FGM A;  4PCQ A;  1RNL A;  2L54 A;  2VE9 A;  3GZ6 A;  4XSX F;  3TGN A;  1O3S A;  5IT9 K;  3ERE D;  4PZJ A;  2QLZ A;  4Q47 A;  5EEH A;  2Z33 A;  1ZLJ A;  3JAM K;  1B9N A;  2E7W A;  3F8C A;  5FFZ A;  1K7A A;  3ABU A;  2VBX A;  1SMY F;  1NHA A;  4G94 A;  5HLG A;  2W84 A;  4I01 A;  4IHT A;  3B02 A;  2P5L C;  3CO6 C;  4A0Z A;  2W85 A;  1QGP A;  2O03 A;  2CYY A;  2ZJ2 A;  1Z9C A;  3GX4 X;  1ZRC A;  1XDS A;  1QQI A;  1TBX A;  2ZME A;  2ADU A;  1LVA A;  5L3D A;  1QO0 D;  3V8J A;  2X0L A;  3ZQ7 A;  1WWX A;  1EV7 A;  2XAS A;  3C7J A;  3E5U A;  3GXO A;  4UV9 A;  1KU9 A;  2VOO A;  1FYM A;  4UUV A;  2BE5 F;  1HST A;  4WXC A;  1SFE A;  4CIC A;  1XCB A;  2LSO A;  5D4S A;  4EV0 A;  2O61 A;  2MH9 A;  2RQP A;  3KEQ A;  1P6R A;  4MEY F;  4Q48 A;  1R00 A;  5K5R A;  2E7X A;  1T38 A;  4BHP A;  5DD8 A;  1U78 A;  4WK8 F;  2KRF A;  2H27 A;  1KQ9 A;  2UXN A;  3LFK A;  3HRM A;  3V8L A;  5ILU A;  4P5O A;  3KP2 A;  1ZRF A;  4ETS A;  1ZHF A;  4I02 A;  1PP8 F;  3IL2 A;  5ICC A;  3GO5 A;  1EH7 A;  1I5Z A;  3ZP5 A;  3F8M A;  5EEG A;  3KZZ A;  3HRU A;  1ODD A;  1YLF A;  4U0W A;  4M9X A;  1E2X A;  2L3D A;  4OIO F;  4Q5S F;  1ZAO A;  3M9A A;  5E8G A;  3GFL A;  1FYK A;  5HLH A;  2KIU A;  2FQ3 A;  1SD5 A;  2DW4 A;  3WTV C;  3DQV C;  2OZU A;  5K5O A;  3FM3 A;  1T6S A;  3HRS A;  3MZY A;  4NB5 A;  1XDU A;  4IF4 A;  2ZME B;  4EGY A;  2JSC A;  3TO9 A;  5DUI A;  2HOE A;  3RTR A;  4YFX F;  1OYI A;  4HX4 A;  4M73 A;  2H6B A;  3P9I A;  1MD0 A;  1S6L A;  3ECO A;  4D0P A;  4OIQ F;  1W7P B;  1IXC A;  4HQE A;  3WTW C;  3RPQ A;  5E17 F;  1FC3 A;  2F5C A;  5CVJ A;  4M72 A;  1KGS A;  4NHJ A;  2OZ6 A;  3KP7 A;  4CXF A;  1D5V A;  2D45 A;  3JTH A;  2QEN A;  2RV8 A;  4P9F A;  2HS5 A;  2M1B A;  3TOA A;  2QVO A;  4PDK A;  3WGG A;  3P7N A;  1OYY A;  5DV5 A;  3PFI A;  5HDK A;  4G8X A;  2ZFW A;  5BQT A;  1IAW A;  2GQQ A;  2IA0 A;  2ISY A;  4RAZ A;  3Q9S A;  3EYY A;  2PQ8 A;  3GWZ A;  1XB4 A;  5ICF A;  4EGZ A;  2MH2 A;  3B73 A;  1HQC A;  2QWW A;  3DPL C;  3IKT A;  1J0R A;  3L00 A;  2OBP A;  3K1P A;  4LK1 F;  2EFP A;  4HF0 A;  4KN4 X;  1S7O A;  2A07 F;  1D8K A;  2Z3Y A;  2OU2 A;  1YFH A;  2R7D A;  2VBW A;  3K1N A;  2EV0 A;  5DDG A;  2K7L A;  1TW2 A;  1T39 A;  4AVP A;  5IT3 A;  3QU6 A;  3VEP A;  1J7K A;  1DPR A;  4A6E A;  1F9N A;  6PAX A;  1JHF A;  2GIV A;  2XAF A;  1P4A A;  4KN7 X;  1J5Y A;  5E20 A;  2WTE A;  2HWV A;  5L3F A;  1I6X A;  4I0B A;  4IVN A;  1P4W A;  1MJ9 A;  3E5Q A;  2DTR A;  2EFQ A;  5JI6 A;  2KJB A;  4QWQ A;  1YIO A;  3GEZ A;  3QP6 A;  3RDI A;  2R7F A;  1LJ9 A;  2CW0 F;  1RI7 A;  4HW0 A;  2K4B A;  1GHC A;  2VOD A;  5CYV A;  1TQP A;  2O6G E;  3BPV A;  2XKO A;  3MWM A;  2OA4 A;  3REO A;  1IN8 A;  4AD9 A;  5DCM B;  2L4M A;  2E1C A;  1ULY A;  2A69 F;  5H6Q A;  4JQF A;  3S2W A;  2DPD A;  1Z1D A;  3KP6 A;  4MEX F;  1GXP A;  2HFH A;  2FMY A;  4ENJ A;  1WQ2 A;  3VOE A;  2D1V A;  2FBK A;  2NYX A;  2K02 A;  3HSE A;  1XN7 A;  2FEZ A;  2CG4 A;  2K4J A;  3C3W A;  4RB0 A;  5FB2 A;  1YS6 A;  3ZMS A;  1SFU A;  1TNS A;  5LRS A;  3FWE A;  2GA2 A;  3F23 A;  5DCF A;  1YYV A;  4XBF A;  1FPQ A;  5ERI A;  4L9N A;  5K5Q A;  1REP C;  3FF5 A;  3EYI A;  3BRO A;  3CLO A;  3KLO A;  3BWG A;  3U9G A;  1S3J A;  1BIB A;  4BQA A;  2XHK A;  1MZB A;  1LDD A;  3I59 A;  1IZ1 A;  3TKY A;  4L5J A;  4M6X A;  5HS8 A;  1TNT A;  3JW4 A;  4RS8 A;  1G3T A;  3SXY A;  3N4M A;  3KEO A;  2V1X A;  3I53 A;  1HW1 A;  1FP2 A;  1P4X A;  3E6B A;  5LGT A;  1BI0 A;  4BH9 A;  3ZN1 A;  4AWX B;  5TJJ A;  1EH6 A;  1UHW A;  1TQM A;  1IN7 A;  4XRF A;  2LDU A;  1BC8 C;  2OAZ A;  1W7P D;  1OKR A;  2VE8 A;  3IRR A;  3WGI A;  1HBX G;  2X4H A;  4Z2Y A;  3K9T A;  4YFN F;  5LGU A;  5BPI A;  1IW7 F;  1V3F A;  1G6N A;  3VOD A;  2H6C A;  3ABT A;  3BP8 A;  2FE3 A;  5DD4 A;  1ZGA A;  2VT2 A;  1K78 A;  2M45 A;  5BS6 A;  1O7L A;  5CVV A;  3BDD A;  4AIK A;  3HOS A;  4QLC U;  2O8X A;  2M87 A;  1R23 A;  1P92 A;  2HKO A;  1ZAR A;  1XGS A;  4HX8 A;  5H6R A;  2LNB A;  4RGU A;  2CO5 A;  2QQ9 A;  4YFK F;  4JBA A;  2G7H A;  1YS7 A;  2HTS A;  1IRF A;  5D5W B;  3QOP A;  4BHC A;  1FBS A;  2H09 A;  4CDG A;  1WI9 A;  3W6K B;  4UVC A;  4Y13 A;  3L2C A;  4GCV A;  3OV8 A;  4KT5 C;  3SZT A;  2DT5 A;  2FBH A;  2DBB A;  5DUK A;  3ZN0 A;  1FBQ A;  3RYP A;  2EA2 A;  1WRJ A;  4HF1 A;  3LQQ A;  1I27 A;  4MTD A;  2ZKZ A;  3N97 A;  4A12 A;  3F6V A;  5AIQ A;  1Z6R A;  1IN5 A;  4GYG A;  4HLX A;  3QPH A;  4LGW A;  3F8N A;  3R61 A;  1W5T A;  1HKQ A;  1PDN C;  4U88 A;  4GXO A;  3G73 A;  1FWZ A;  2CQK A;  5A2Q Z;  3FXU A;  4O3M A;  4TV7 A;  4BNC A;  3LST A;  4IRH A;  2IP2 A;  1IN6 A;  3KE2 A;  1HKT A;  2YSR A;  1BIA A;  2ESH A;  3O3K A;  1Q1H A;  3T8T A;  4LFU A;  3DV8 A;  4I09 A;  2UZK A;  2Y48 A;  3GZ5 A;  1IN4 A;  2PG4 A;  1V4R A;  5HS7 A;  5LGN A;  3I54 A;  3H3U A;  2HZT A;  5F6F A;  4HAM A;  5D8K B;  1B9M A;  2EV5 A;  2QYO A;  3IHU A;  4UNO A;  5CJ9 A;  4OIR F;  2IA1 A;  4XLP F;  4R8H A;  1T2K A;  1D8J A;  3O6B B;  4ASN A;  2AXL A;  1UCR A;  1STZ A;  2ISZ A;  1LEB A;  3WU0 A;  1YW9 A;  3HIF A;  3U1D A;  3I59 B;  2BYV E;  5D5U B;  2HEO A;  4L0Y B;  4OOI A;  2EJR A;  2PMU A;  5DCM A;  1H9G A;  1KQ0 A;  5ICG A;  4FHT A;  1CGP A;  4XLN F;  3MAJ A;  4CO8 A;  1RIO H;  2FF4 A;  2JRT A;  5E1X A;  4ZH4 F;  2Y0M A;  1U5T B;  5CVU A;  1IUY A;  4IPA A;  5LLQ A;  1U5T C;  5L3C A;  2IPQ X;  3GW2 A;  1Z7U A;  3RKX A;  3ZPL A;  2P8T A;  3E6C C;  4ENK A;  1QZZ A;  1YW8 A;  4XSZ F;  1T0F A;  4LMY A;  3WTY C;  5JHU A;  4G6Q A;  3HHH A;  5HLI A;  4HF2 A;  2RVC A;  1UHM A;  1XMK A;  4KIF A;  5E8I A;  1ZG1 A;  3RI4 A;  3I5U A;  2DO7 A;  4Y15 A;  1ZLK A;  4R1H A;  1G3W A;  2DFI A;  2HDC A;  3WOD F;  5AON A;  4IXA A;  1AOY A;  3FHZ A;  4HX7 A;  4M6Y A;  3BY6 A;  1FSE A;  4RGX A;  2MLK A;  2A61 A;  5DEQ A;  5JR3 A;  3JSP A;  2KKO A;  1YTY A;  5FLX K;  4N9I A;  3KP4 A;  1WKM A;  1PUE E;  1IF1 A;  1ONV A;  1TTY A;  1MDM B;  2OD5 A;  1Y0U A;  4A0X A;  4S04 A;  3L7W A;  4LLG F;  2CSO A;  2MLG A;  4PGG A;  4EQQ A;  3ELK A;  5ICE A;  3BJO A;  4L9T A;  5L3G A;  2JTV A;  3HOT A;  2FML A;  1HKS A;  3P9K A;  4GGG A;  4BXU A;  4AIH A;  2XAG A;  4WXD A;  1U8R A;  3PQK A;  2XV4 S;  2MA3 A;  2QBY B;  4ON0 A;  4S05 A;  3WTT C;  2A68 F;  4H0E A;  2UWM A;  1IRG A;  1GXQ A;  3BZ6 A;  3D0S A;  2R3S A;  2COM A;  5F1R A;  2DAO A;  3JTG A;  3J81 Z;  1L3L A;  2PI0 A;  1R1T A;  3J80 Z;  3T0Y A;  3WG9 A;  2PN6 A;  5CVI A;  3T1B A;  2HTJ A;  3ML6 A;  1S7A A;  4M71 A;  2L01 A;  3KZY A;  2QM3 A;  2PEX A;  2PMH A;  2Q8K A;  1TW3 A;  1U6G A;  1R22 A;  4OU0 A;  2LF7 A;  1MDM A;  1KA8 A;  1S8N A;  1KYZ A;  2FA5 A;  4ENM A;  2FOK A;  2F2E A;  1F5T A;  3CO7 C;  2IRF G;  1T98 A;  2FSW A;  1FYL A;  2EFN A;  2IJL A;  4HQM A;  5LEK A;  3K1M A;  1J2X A;  1TQI A;  3WU1 B;  3KLN A;  3M7G A;  5FO5 A;  5LHI A;  4MHG A;  2VBY A;  1SD4 A;  1W7P A;  2F5E A;  4G7Z F;  3TO6 A;  4GYI A;  4LB5 A;  2JPB A;  1XGN A;  2GAU A;  3D5L A;  4KNY A;  2O3F A;  2G7U A;  3EUH A;  1VTN C;  1OYW A;  5DYM A;  2K86 A;  1G4D A;  4N0B A;  1KQ8 A;  1K78 B;  2FBI A;  2NS0 A;  3V7S A;  1O3Q A;  3M1E A;  1BM9 A;  3J81 K;  2ZBK A;  1ZYR F;  3ZMT A;  1R1U A;  1FOK A;  2ACJ A;  3TDU C;  5LRR A;  1G3S A;  1OR7 A;  2ZO4 A;  2K27 A;  1YW7 A;  5LEJ A;  2VC1 A;  2C6Y A;  3E97 A;  4B09 A;  2A5Y B;  1R5H A;  2P5V A;  1O7F A;  4KDP A;  4RB2 C;  5F64 A;  4L5I A;  3HRT A;  1SFX A;  2YPR A;  1BBY A;  4I98 B;  3J80 K;  3T5X A;  1L0O C;  3Q5F A;  4ESJ A;  4WWC A;  1R36 A;  4MQ9 F;  3SHF A;  2STW A;  2RC4 A;  5ILS A;  4A5M A;  3GLX A;  2V79 A;  5JVT A;  2QUF A;  4RGS A;  3E6D A;  1BOA A;  4WX9 A;  3GFJ A;  3TQN A;  3T8R A;  4EMS A;  2CWE A;  1F1Z A;  3WTU C;  3DEU A;  1U2W A;  1GVJ A;  4UVB A;  3DF8 A;  3IKV A;  2XAJ A;  1ON2 A;  4LG0 B;  3CUQ A;  4ZZD A;  1FSH A;  2HQR A;  5E1W A;  3SZP A;  1FT9 A;  4YII A;  2PLY A;  2OQR A;  2O0Y A;  1LNW A;  2V9V A;  4HLY A;  3LWF A;  2MBF A;  1IXS B;  1RUN A;  1RZ4 A;  2NNN A;  4HYE A;  1ZN2 A;  4NQW A;  2F5D A;  3R0J A;  3QRF F;  3KCC A;  2XAH A;  1H0M A;  2XVC A;  3NEU A;  1U3E M;  4ZYH A;  3HTS B;  1B59 A;  4IRI A;  2GXB A;  4U7D A;  4LLN A;  3F8B A;  1C0W A;  3H92 A;  4I7H A;  2HR3 A;  1S29 A;  3PQJ A;  2XIG A;  3R6S A;  3ROU A;  1FLI A;  1XCV A;  3DFG A;  5FD5 A;  5KK1 A;  4CYD A;  3C1D A;  2G9W A; 
#chains in the Genus database with same CATH topology
 4BJ6 C;  2E1M C;  2WV1 A;  3CUQ B;  5E18 F;  1G3Y A;  4JX5 A;  4RM3 A;  1JGS A;  1WJD A;  1YG2 A;  2DMU A;  2RGV A;  3J7A Y;  4BXX J;  3OYJ A;  5K7H A;  5D5V B;  1YI2 I;  3JAM Z;  3K2Z A;  4MQV A;  1EA3 A;  5GTH C;  1I1G A;  2CUJ A;  5E3M A;  4L18 B;  2YR2 A;  1HDP A;  3DTI A;  1R71 A;  1NTC A;  2P6T A;  4W1U A;  2FD5 A;  2BW3 A;  2CH0 A;  3CJQ B;  4HA8 A;  5FFX A;  3CCM I;  4EJT A;  3BJA A;  2AQE A;  3L09 A;  3ECH A;  4MLO A;  2B7E A;  3HSF A;  4Y17 A;  1TT0 A;  4KMF A;  4BJT A;  4EVI A;  4UVA A;  4KA4 A;  1MW7 A;  3L9F A;  2KL4 A;  3QOD A;  1D1C A;  5FLX Z;  2WC2 A;  1TWC J;  2HI3 A;  1AKH B;  3PO3 J;  1EKE A;  3WTZ A;  1UJ8 A;  2TDX A;  4XKC A;  2A6T A;  4FE7 A;  3WGH A;  3LSP A;  3CC7 I;  2WY7 Q;  3V4G A;  4RAY A;  4KFC A;  1YX3 A;  1FP1 D;  2X6Y A;  2M7B A;  4A3B J;  3DTK A;  5HS9 A;  4YIR X;  3GTG J;  1MMN A;  4IJA A;  4ZYG A;  1JE8 A;  2MSY A;  1O3T A;  4EM0 B;  2R7Z J;  3J7A O;  1LDJ A;  4GO1 A;  3MFK A;  3HB9 A;  1A04 A;  4XR6 A;  1LEA A;  4ZDL A;  3IC7 A;  2EA4 A;  4F92 B;  2ESN A;  3GVA A;  3GME A;  2EIL H;  3MD2 A;  3ZQI A;  3MKY B;  1HXD A;  3ULQ B;  4I6Z A;  2CMP A;  4U0V A;  1SD7 A;  4L9V A;  1YE9 A;  5BMZ A;  4A2U A;  5B5E C;  1HCR A;  5FRN A;  5L3E A;  1LQ1 A;  2BV6 A;  3BCB A;  2LG4 A;  4HPQ A;  1FMW A;  1R1V A;  4LG0 A;  1NK3 P;  3G6E I;  2VQL A;  1FBU A;  2UXX A;  3H9J A;  2QBY A;  1RET A;  1WCM J;  3CJN A;  4D5F A;  2DU9 A;  4MTE A;  3OSF A;  2X1D A;  1IXR C;  1V54 H;  4BKX A;  5GAD J;  3GUD A;  2DA5 A;  1X3Z B;  2DA7 A;  4E7J A;  1FZP B;  1YRN B;  4CHU A;  3HOW J;  3EDP A;  3Q0U A;  5HDN A;  3GFM A;  4G9Y A;  1MGT A;  5EEA A;  1TL8 A;  5FLV A;  4G7O F;  3LA7 A;  4EM1 A;  1K4T A;  3WTX C;  2LKP A;  3HUG A;  4RB3 C;  3ZMU A;  2DPU A;  2CFX A;  1I6H J;  5TIS C;  2GWR A;  4YIF A;  4QTR A;  1Z05 A;  3CTA A;  5J1R A;  2EFO A;  3RKQ A;  1B6A A;  2WAQ A;  4XN3 A;  5D4R A;  2E35 A;  2IGN A;  4M3G A;  3EQL F;  3OOP A;  5H20 A;  1Z6T A;  1RR8 C;  1MNE A;  2A3S A;  2Q2E A;  3SQN A;  4OAZ A;  4U0Y A;  1SVM A;  4G7H F;  3S1R J;  3FX3 A;  5LHG A;  2ETH A;  3FXM A;  4B44 A;  3M8F A;  4CZZ A;  1PP7 U;  3FMS A;  3G3Z A;  3UKG A;  2NNY A;  2W1O A;  1AWC A;  2DA6 A;  1Z3Y A;  4HZF A;  4RM2 A;  3ZMV A;  2LTP A;  3V42 A;  1XSX A;  4B48 A;  2EWN A;  1X4P A;  2Z5U A;  3QAH A;  4FX0 A;  1JT6 A;  1A36 A;  2MC3 A;  3VSL A;  4MGR A;  3SJM A;  1SFO J;  4A6D A;  4EEF G;  1U9O A;  5A2Q K;  3HC7 A;  5AIP A;  3CCR I;  2OV7 A;  2ZC2 A;  4FT8 A;  3OIP A;  3ESW B;  4EJO A;  2W00 A;  1D0X A;  2RNJ A;  1Y6I A;  3U2R A;  2WWY A;  2AO9 A;  2KIM A;  5HDG A;  3RIR A;  4XIC A;  3LQR A;  1M1E B;  2XAQ A;  5L3B A;  2O8K A;  2JQ7 A;  5DS9 A;  1NG6 A;  2R7X A;  2IS4 A;  2EQR A;  2ECC A;  2MC4 A;  3BOQ A;  3H0G J;  3GYH X;  4JK1 X;  4YG2 F;  2NS8 A;  1UG2 A;  3TOB A;  4B1R A;  2JT1 A;  1OPC A;  4BBR J;  1RES A;  4M9S A;  4XLA A;  2Y9Z A;  1ZRE A;  3HG9 A;  1Y8R B;  2W48 A;  3QU3 A;  1DU0 A;  4LIV A;  1MKM A;  3VDX A;  3F8F A;  2F5V A;  2GOX B;  4AUX A;  4R79 A;  2KHM A;  4FIS A;  4C2U A;  3K7A J;  1IGN A;  4AVZ A;  3QPT A;  2P5K A;  2M9H A;  4E7S A;  1R49 A;  2EH3 A;  4RGR A;  4AIJ A;  4XK4 A;  3HGY A;  1W5S A;  2KIF A;  3GBG A;  1YJN I;  1ZRD A;  1TWG J;  3TO7 A;  4A69 C;  2JMW A;  3F72 A;  2RN7 A;  5HVQ C;  3P9C A;  1KYW A;  3OR2 C;  4LLL A;  4UV8 A;  1MND A;  2IVM A;  1JKQ C;  1YX5 A;  1H9T A;  4ZZL A;  1MH4 A;  4NDL A;  4DZP A;  1J59 A;  1FOW A;  2D1H A;  4EM2 A;  2X9D A;  2E34 A;  1WI3 A;  3DXJ F;  3NAR A;  1BR4 A;  2E2I J;  4HEA 2;  5EZH A;  5E1Z B;  3SFZ A;  2LRD A;  4A3K J;  4L9J A;  1DP7 P;  3K10 A;  2ZXI A;  4HNV A;  2DT7 B;  2ZNZ A;  4MO7 A;  3OSG A;  2ELH A;  1B4A A;  1LFU P;  2H94 A;  4IRG A;  1WPK A;  3FZV A;  1BN5 A;  4DNC A;  2A6H F;  1R5I D;  4OWR B;  1OCT C;  5IYD J;  2HU9 A;  3V7C A;  4G6D A;  4KIG A;  5IOZ A;  2JPC A;  2M5W A;  2DJI A;  3CCU I;  1WSU A;  4BBS J;  2Z2S B;  4C3J J;  5JLX A;  2HYG D;  2J5P A;  3QPL A;  1ZGJ A;  2WAE A;  1AHD P;  1ZEL A;  1HW2 A;  4UHT A;  4BAY A;  5KVR A;  4F52 A;  1DUX C;  5ILV A;  1QPI A;  4B8X A;  1X1B A;  1VND A;  4N9H A;  1FEX A;  3IRQ A;  2CQX A;  3R4K A;  4G12 A;  4OIP F;  1B1B A;  1J9I A;  2HVQ A;  3ZMD A;  2ZSH B;  3K2A A;  1P2F A;  4CCK A;  2DMQ A;  3CD6 I;  2FNA A;  2Z16 A;  1SMT A;  2CGP A;  2MD5 A;  2M7A A;  2E2J J;  1FX7 A;  3E5X A;  1TLH B;  1UG0 A;  4F91 B;  3LAJ A;  3E7L A;  3VB2 A;  4B3X A;  4UXN A;  2EZI A;  2Q0O A;  1RUO A;  1ZH5 A;  2V1U A;  1BR1 A;  2K9L A;  2DN0 A;  5BOX A;  4Q4Z F;  2R5Y B;  5HOD A;  3KFW X;  3DP7 A;  1DGW Y;  4PGH A;  2I5U A;  4Y3O A;  4IZZ A;  3LAP A;  1JI8 A;  1EH8 A;  1TT5 B;  3I4P A;  1X2M A;  2DYS H;  1X1C A;  2FXA A;  3HSR A;  1IC8 A;  2NRA C;  3FMQ A;  1OQY A;  3PSF A;  4E4H A;  3VWB A;  3KP3 A;  3RJP A;  1TC3 C;  4HDU A;  3I58 A;  3FXQ A;  4A0Y A;  3A03 A;  2DK5 A;  1XGM A;  2DK8 A;  4BQQ A;  1R7J A;  3MN2 A;  3MKL A;  4BE1 A;  2ZCW A;  4DQ2 A;  1I50 J;  3K0L A;  3RKY A;  4O6J A;  2VAS A;  4LJZ F;  1D3Y A;  4PFO A;  2VT3 A;  1K79 A;  5IT9 Z;  3A2K A;  1O57 A;  2IW5 A;  1RC9 A;  3FM5 A;  2IT0 A;  3K4L A;  4HBL A;  5CQE A;  3WE2 A;  1ZG3 A;  2FU4 A;  4ESB A;  2GZW A;  3GCM A;  4KYW A;  2VL8 A;  2GA1 A;  2EB7 A;  5EG0 B;  2VXD A;  3BG3 A;  1E17 A;  1XG1 A;  3BZC A;  3DTE A;  2W7N A;  3P5J A;  3A0H C;  4E70 A;  2HDW A;  4HV5 A;  4ESF A;  5J6X A;  1XD7 A;  4FX4 A;  1S5L C;  4BY1 J;  5J8C A;  3OYH A;  3MZH A;  2DQR A;  4XID A;  1GDT A;  4Y33 A;  3I56 I;  1IRX A;  3BLY A;  3K4B A;  4M3D A;  1QPM A;  2X1E A;  3L1P A;  5JVG F;  3U21 A;  3JSO A;  3DPT A;  2R5Z A;  1I3Q J;  5K1Y A;  3F6O A;  2QEX I;  3SZG A;  3LSM A;  3OL4 A;  2ELK A;  2KJC A;  3WE3 A;  4MNU A;  4A3J J;  1RKT A;  2WAQ N;  3MQ0 A;  1QZY A;  2M30 A;  4F7Z A;  2VKH A;  2W25 A;  4N4O B;  5CPR B;  3ZQQ A;  4D1Q A;  3ABM H;  2VN2 A;  4E7Z A;  2LY2 A;  4PJM A;  5JFR A;  1ZTR A;  2TCT A;  5FD6 A;  3K4M A;  3F21 A;  3F3X A;  4LB6 B;  5J8F A;  3WTS C;  1YQA A;  4NC7 A;  3MEX A;  5D6F A;  3C18 A;  2HQN A;  3DKX A;  2QQB A;  3E3V A;  2XKP A;  3HYI A;  2Z9O A;  1S7E A;  4P9U A;  4CGZ A;  2VXZ A;  4HV6 A;  1LE8 B;  3FK6 A;  2Y75 A;  4O5V A;  3VFZ A;  4RDU A;  4RB1 A;  2P0W A;  3B6A A;  5IYC J;  2L4A A;  3NRV A;  2AQF A;  4EJW A;  2RKH A;  1WZ2 A;  3CDH A;  2E2H J;  5IY5 H;  1GVD A;  4HG2 A;  4H4K C;  4P55 A;  1ON1 A;  2ZXW H;  2VON A;  3BG7 A;  5HOO A;  2R5Y A;  2EV6 A;  4OMZ A;  1MBK A;  3ZMZ A;  5ED4 A;  2H1L A;  2R7S A;  2CFO A;  2OPT A;  1E0E A;  1KU3 A;  2LF8 A;  4L0Z B;  4WCG A;  2ZSI B;  3NQO A;  2DQL A;  2DI3 A;  3E1S A;  3W6J B;  4BYY A;  4LOC A;  4UUT A;  1YO5 C;  2CV2 A;  1I1S A;  1E3P A;  3RKW A;  4U7B A;  2YUS A;  2BOL A;  3IWF A;  4P1W A;  3M3Y J;  3IWZ A;  1XGO A;  2QQA A;  2B0L A;  1LDK B;  1ZR2 A;  1CF7 A;  2FRH A;  4ZYD A;  3JRC A;  2KQR A;  3FIW A;  3HKZ N;  1ZG5 A;  3RPU A;  3CUO A;  2R92 J;  4AC0 A;  3OL3 A;  5BPD A;  2HGC A;  1ETY A;  3MKZ A;  4OMY A;  4M9Z A;  1VQL I;  2O9L A;  4BS9 A;  4KIT B;  1JUP A;  3EET A;  3S1Q J;  4X0G A;  1JJ8 C;  1MJA A;  1JKO C;  3E0J B;  1WHU A;  4F3Q A;  1Z77 A;  3MCZ A;  5EYR A;  2HOS A;  1BC7 C;  3JRI A;  2KT0 A;  1KU2 A;  1BI2 A;  3FXR A;  3GFI A;  5J1U A;  2YX4 A;  1X1D A;  4P96 A;  3I71 A;  1QNT A;  3R60 A;  1ITY A;  1X3U A;  5F0F A;  2EFW A;  2XUB A;  5FKO A;  1R5G A;  3I4N J;  1SAX A;  2P7V B;  3GF2 A;  4JX6 A;  2CS3 A;  2HKX A;  3V8K A;  4AYB N;  2MFZ A;  5HNF A;  4XNF A;  1YHQ I;  4XLF A;  1OMI A;  3DBH B;  4OIN F;  2V1D A;  3BQY A;  2W24 A;  2DJN A;  3HHG A;  4ZYE A;  4W97 A;  5CLS A;  3TDZ C;  2Y2Z A;  1MMG A;  2Z99 A;  2FX0 A;  2XDV A;  3COA C;  3LA2 A;  5JHF A;  1HSJ A;  4GFB A;  2BY1 A;  3O2P E;  5LBQ A;  3SYT A;  4BHB A;  2WA0 A;  3A02 A;  3Q9V A;  2XRN A;  2Y0S A;  1U5T A;  1BJA A;  2E19 A;  2R5Z B;  2P7C B;  3H1C A;  1S72 I;  1XMA A;  2DMT A;  3OYF A;  3M4O J;  2QA4 I;  1OCC H;  3TP3 A;  3QYB A;  1A31 A;  4M6V A;  2ZJR F;  1JXS A;  3D5R C;  1NH3 A;  4M3E A;  2E1O A;  3CUQ C;  2EK5 A;  4I0A A;  3W2A A;  1BOB A;  1Y0N A;  3KZI C;  1VQ9 I;  2E1M B;  3SDG A;  2YU3 A;  3CJT B;  4LD5 A;  2JZY A;  2XGX A;  3H35 A;  2HYF A;  2HOT A;  4A5N A;  3I64 A;  2L2O A;  2IGK A;  3PSI A;  4XLH A;  2PBI A;  5E3L A;  2OQG A;  3KET A;  2WY8 Q;  4KIC A;  4PJL A;  2VQG A;  1VQO I;  4IHS A;  1FY7 A;  4DGW B;  2YX7 A;  1MJB A;  4A3L J;  3FIS A;  1WJB A;  5FKL A;  1R58 A;  4WF2 A;  2DT6 A;  1LB2 A;  3TED A;  2JRM A;  3BG9 A;  2VOP A;  5CVR A;  1FNN A;  1GLN A;  3BPX A;  4M74 A;  1DPU A;  1HW5 A;  1JHH A;  1VFC A;  3FMR A;  1KU7 A;  3BTL A;  2FNP A;  2GM4 A;  2F5F A;  5E79 C;  3ISP A;  1K83 J;  1QVU A;  1XSD A;  1HDD C;  4IHY A;  2KDO A;  2CJJ A;  4LK0 F;  3U1K A;  3OIQ A;  2STT A;  2DLL A;  2NVY J;  2QZ8 A;  3PJR A;  3GTM J;  3S16 J;  4HDV A;  2VBZ A;  3JRE A;  2PJP A;  2E1N A;  1CF7 B;  4S0H B;  2RAE A;  5J4V A;  2ZXJ A;  5LHH A;  1R9T J;  3KP5 A;  4BQN A;  2IA2 A;  2ZNY A;  3I55 I;  1AA7 A;  2BW3 B;  1S9H A;  1BI1 A;  3IV5 A;  3V7R A;  2QQ8 A;  1R6R A;  2M3A A;  1USS A;  4KMU X;  4KIB A;  3HTU A;  4C2M J;  1UHS A;  1FIA A;  2IS2 A;  1Y1V J;  1FMV A;  2PFB A;  2HQ5 A;  2UV1 A;  5TRD A;  2L9S A;  2RDP A;  2D2W A;  1DDN A;  3BJ6 A;  4K2E A;  2M8E A;  5KHD A;  3F22 A;  1O3R A;  1K6O A;  5GAE J;  3BR3 A;  1UZC A;  5D8L B;  2X48 A;  5GAG J;  1LKX A;  2ZXH A;  2HVS A;  2P6S A;  3I0T A;  3Q3S A;  2A6E F;  4EJV A;  5EF6 A;  2J5O A;  2KDZ A;  1SD6 A;  3LA3 A;  4L5E A;  4QSH A;  2R7R A;  3CDI A;  4G6T B;  2PX9 A;  3S1M J;  3AAF A;  2XGD A;  3PFY A;  2V6C A;  3L2R A;  3OIO A;  1BI3 A;  1JUS A;  4ENN A;  3H3Z A;  4HOB A;  2NAZ A;  3GTO J;  2M34 A;  2BEO A;  2WV0 A;  3BR6 A;  3DKW A;  1W4M A;  3HPH A;  1UB9 A;  1X3W B;  1MBH A;  4I2O A;  2W57 A;  4MFE A;  1N25 A;  2AXT C;  2VC0 A;  5IP7 J;  3E6M A;  1VQ5 I;  2BBY A;  1ETW A;  1UST A;  4F55 A;  4AU7 A;  3IH4 A;  3K69 A;  2E5N A;  1T56 A;  2L02 A;  2P4W A;  1J75 A;  2BGC A;  2HYJ A;  4C3H J;  2YS9 A;  3OYM A;  2AS5 F;  4WXH A;  1XSV A;  3QP5 A;  2L7K A;  3OYL A;  3R0A A;  2JN6 A;  3M8E A;  3K6G A;  4BDZ A;  3C2H A;  3S15 J;  4KUM A;  1QBJ A;  3G1O A;  3L2U A;  1HA8 A;  2HQA A;  2BY3 A;  3DCF A;  2E71 A;  3RYR A;  1WJC A;  2VKD A;  5D5X B;  1VQ4 I;  4EJU A;  2DMN A;  2JWT A;  5D6E A;  2GXG A;  5F1J A;  1F4K A;  1Z91 A;  2XRO A;  3D5S C;  4KIS A;  1UFM A;  5FGM A;  2K40 A;  1DQU A;  2KPM A;  4PCQ A;  1RNL A;  2L54 A;  2LC2 A;  2VE9 A;  3JR9 A;  3GZ6 A;  4XSX F;  3TGN A;  1O3S A;  3IH2 A;  4D7N A;  4A3G J;  1BA5 A;  5IT9 K;  4B47 A;  3CCS I;  3ERE D;  4PZJ A;  4GDF A;  3FXK A;  3D1N I;  5FJ8 J;  2QLZ A;  3CLQ A;  1XTA A;  3OS1 A;  1UEL B;  4Q47 A;  5EEH A;  2Z33 A;  1ZLJ A;  3JAM K;  1B9N A;  1RR7 A;  2E7W A;  3F8C A;  2L7M P;  5FFZ A;  2JSP A;  1JTX A;  2HVR A;  1K7A A;  3ABU A;  2VBX A;  1SMY F;  1NHA A;  3G71 I;  4G94 A;  5HLG A;  2W84 A;  1ENH A;  2NXN B;  4I01 A;  2LH9 A;  1OCR H;  2I8D A;  3B02 A;  4XOP A;  4IHT A;  4KT6 A;  3RSN A;  2P5L C;  3CO6 C;  2FUG 2;  2UUZ A;  4A0Z A;  1LPQ A;  1Z3X A;  3JRH A;  2W85 A;  2ZME C;  3O8H A;  3S1N J;  4BAC A;  1QGP A;  3S2D J;  2O03 A;  2JVH A;  2ZJ2 A;  2XPU A;  2CYY A;  3GX4 X;  1Z9C A;  1XDS A;  1ZRC A;  1ZK8 A;  1QQI A;  1TBX A;  2DA2 A;  2ZME A;  3H9Q A;  4DJA A;  4FCY A;  4UUS A;  2N8G A;  1G8X A;  1SFK A;  2ADU A;  1OCZ H;  1MSE C;  1LVA A;  1WH7 A;  4JYK A;  5L3D A;  1QO0 D;  2DOA A;  1T33 A;  4ZYA A;  3J7Y J;  3V8J A;  2X0L A;  4DYQ A;  4J01 A;  3ZQ7 A;  1WWX A;  2BHZ A;  4A3E J;  3B6C A;  1EV7 A;  2XAS A;  1MH3 A;  1ETX A;  3C7J A;  1W0U A;  3GXO A;  3E5U A;  3QYF A;  1BR2 A;  3CDL A;  5F0C A;  1HOM A;  3A01 B;  2K9S A;  2LBF A;  4UV9 A;  3A0B C;  1KU9 A;  2VOO A;  1FYM A;  4UUV A;  3K70 D;  2BE5 F;  1HST A;  3L2Q A;  4WXC A;  1SFE A;  2XF5 A;  4AM3 A;  4CIC A;  2HDD A;  3A1Y A;  3LSK A;  3BTI A;  1XCB A;  3ZQH A;  4BJ5 C;  2LSO A;  5D4S A;  4EV0 A;  2O61 A;  2MH9 A;  2RQP A;  3KEQ A;  1OCO H;  2LD5 A;  1P6R A;  2R7Q A;  2LY1 A;  4IKF A;  4MEY F;  4QIW N;  4Q48 A;  2DOE A;  1B8I A;  1R00 A;  4NNJ A;  3VSK A;  3KYC B;  5K5R A;  1OR7 C;  2XPW A;  3RZD J;  2E7X A;  1ORK A;  2KRH A;  2L5Q A;  3PUF A;  1N75 A;  4BHP A;  5DD8 A;  1T38 A;  3I4M J;  3QOE A;  2IBD A;  1U78 A;  1B72 B;  4WK8 F;  2KRF A;  3OWT A;  2H27 A;  1KQ9 A;  2UXN A;  4MIM A;  3LFK A;  3HRM A;  1ACI A;  3V8L A;  3QQA A;  4PSX A;  2GLO A;  5ILU A;  4P5O A;  2X85 A;  3KP2 A;  1ZRF A;  1R4M B;  4ETS A;  1ZHF A;  3QPS A;  3FBI B;  4I02 A;  2L7F P;  4RMN A;  1PP8 F;  3IL2 A;  5ICC A;  1Y39 A;  1ETQ A;  3GO5 A;  1QRY A;  1EH7 A;  1I5Z A;  3ZP5 A;  3F8M A;  5EEG A;  1BW6 A;  3CZ6 A;  3ONQ A;  4D7M A;  4DBQ A;  2A05 A;  3KZZ A;  3HRU A;  1ODD A;  3EUA A;  1J09 A;  2H1K A;  1YLF A;  1T8I A;  4U0W A;  2VJ4 A;  4M9X A;  2XSD C;  1E2X A;  4Y7N J;  2D5V A;  2L3D A;  4OIO F;  1WGX A;  4Q5S F;  1WJE A;  1ZAO A;  3M9A A;  5E8G A;  3GFL A;  5HLH A;  1FYK A;  3HM5 A;  2KIU A;  2FQ3 A;  5FLM J;  3RCO A;  1SD5 A;  5IYB J;  2DW4 A;  3A01 A;  2WBM A;  2BY0 A;  1DGR M;  3WTV C;  3DQV C;  2V9P A;  2OZU A;  4LIT A;  5K5O A;  3AKZ A;  1LUJ B;  3K70 C;  2DCE A;  5FRM A;  4D5C A;  2KP6 A;  3LL7 A;  2IS6 A;  3FM3 A;  4Y52 J;  1T6S A;  3K4N A;  1BW5 A;  5GAH J;  3HRS A;  1QZE A;  4II2 A;  3ZGK A;  3MZY A;  4NB5 A;  3H3V K;  2LP0 A;  4CH7 A;  4ZTJ A;  5J40 A;  1XDU A;  1IRZ A;  4LIU A;  1LE8 A;  2M4K A;  4IF4 A;  2ZME B;  3TO9 A;  2JSC A;  5DUI A;  4EGY A;  4XL9 A;  2HOE A;  3JCU C;  3RTR A;  4YFX F;  1A6I A;  1OYI A;  4HX4 A;  2JK3 A;  2H6B A;  4M73 A;  3ZQL A;  2CQ7 A;  3P9I A;  1MD0 A;  1K4S A;  1NG7 A;  3MVP A;  2VPL A;  1PUF B;  1S6L A;  3ECO A;  4D0P A;  4OIQ F;  3F0C A;  1IJW C;  1W7P B;  2ICW G;  2F6C A;  1IXC A;  3WTW C;  2V9K A;  3RPQ A;  3CCY A;  4HQE A;  2GXA A;  1FC3 A;  1V5E A;  5E17 F;  2F5C A;  5CVJ A;  2KMU A;  4X1E A;  2YU9 J;  1KZH A;  4CYC B;  4M72 A;  1QHG A;  1KGS A;  5EG0 A;  3DWL E;  4NHJ A;  2OZ6 A;  3KP7 A;  4CXF A;  1D5V A;  3AFH A;  1HF0 A;  4RLQ A;  2D45 A;  2RRE A;  1W36 C;  3JTH A;  2QEN A;  2RV8 A;  4P9F A;  4RAG A;  4YEL A;  2XGC A;  3K4K A;  4V2G A;  2HS5 A;  5E3N A;  2M1B A;  4EAT A;  3WHB A;  1MBE A;  3C2G A;  3FKJ A;  3TOA A;  3HBL A;  1V5G A;  2L7Z A;  2OCC H;  2QVO A;  4XRS A;  1G59 A;  4PDK A;  2NOJ B;  5F04 A;  3WGG A;  5IP9 J;  3OYK A;  5F08 A;  3P7N A;  1OYY A;  5DV5 A;  3PFI A;  5HDK A;  2DXI A;  4G8X A;  2JA7 J;  2ZFW A;  5BQT A;  1IAW A;  2FOW A;  3SEQ A;  2GQQ A;  3S32 A;  1DU6 A;  3DBL B;  2IA0 A;  2ISY A;  4RAZ A;  3Q9S A;  3HL2 A;  4XKW A;  4CZC A;  3EYY A;  2PQ8 A;  3GWZ A;  1XB4 A;  5ICF A;  3LNQ A;  3DU5 A;  4EGZ A;  2Y31 A;  2MH2 A;  2XPV A;  4GRI A;  2LRE A;  3PM1 A;  3B73 A;  4QPO A;  1HQC A;  2QWW A;  3DPL C;  3IKT A;  1T08 B;  1J0R A;  3L00 A;  2OBP A;  2XAU A;  2VI6 A;  3K1P A;  4LK1 F;  4BL0 B;  3VYR B;  2R7V A;  9ANT A;  2EFP A;  1AKH A;  4HF0 A;  3G2B A;  1FIP A;  4KN4 X;  2CV0 A;  4A93 J;  1S7O A;  2A07 F;  1D8K A;  2MW8 A;  2Z3Y A;  2OU2 A;  1YFH A;  2R7D A;  2VBW A;  3K1N A;  2Q1Z B;  2GIZ A;  2EV0 A;  2JUC A;  5DDG A;  2OF7 A;  2K7L A;  1TW2 A;  3LSJ A;  1T39 A;  3CES A;  3QYE A;  4AVP A;  5IT3 A;  1E3O C;  3Q0W A;  1V5F A;  3QU6 A;  3VEP A;  1J7K A;  1DPR A;  3JRG A;  4NUB A;  4A6E A;  1F9N A;  3OOU A;  6PAX A;  1JHF A;  3DLA A;  2GIV A;  1N78 A;  2XAF A;  1P4A A;  3KX2 A;  3CCV I;  1RPW A;  1J5Y A;  4KN7 X;  5E20 A;  2WTE A;  2HWV A;  5L3F A;  1I6X A;  2OC6 A;  4I0B A;  4IVN A;  3UR3 C;  1P4W A;  2DDB A;  1MJ9 A;  3E5Q A;  2DTR A;  3TW6 A;  4B4C A;  2EFQ A;  5JI6 A;  2K3F A;  2KJB A;  2W82 A;  4HRI A;  4QWQ A;  1YIO A;  1MBJ A;  2CQQ A;  3GEZ A;  3QP6 A;  3RDI A;  2R7F A;  1LJ9 A;  2CW0 F;  4XOT A;  2NVU B;  1RI7 A;  2JUG A;  5M5W J;  2IS1 A;  1FOY A;  3RQ4 A;  1Q1V A;  4HW0 A;  1VI0 A;  4NBQ A;  2K4B A;  1GHC A;  2VOD A;  5CYV A;  3HZJ A;  1TQP A;  3O8G A;  2O6G E;  3BPV A;  2XKO A;  3MWM A;  2OA4 A;  2F4O B;  2V6E A;  2ME6 A;  2DA1 A;  3REO A;  1IN8 A;  3S93 A;  3ZRG A;  4FQG A;  4AD9 A;  5DCM B;  4CA0 A;  2XRL A;  2L4M A;  5CQG A;  5LD2 C;  2JA2 A;  1X1A A;  4CCN A;  2E1C A;  1ULY A;  4XRM A;  1GT0 C;  2A69 F;  5H6Q A;  4JQF A;  3VYT B;  3S2W A;  1JKP C;  2DPD A;  1Z1D A;  3KP6 A;  2LBF B;  2NVQ J;  4MEX F;  4BE2 A;  1GXP A;  2HFH A;  2LYC A;  2FMY A;  4ENJ A;  1WQ2 A;  2CU7 A;  2X1C A;  3BG6 A;  3VOE A;  1IUF A;  2XSJ C;  4N4N B;  2D1V A;  2FBK A;  3H9G A;  2DA3 A;  3VPR A;  2R7T A;  1OJL A;  2NYX A;  4BDY A;  2K02 A;  3HSE A;  1XN7 A;  2BHY A;  2FEZ A;  2CG4 A;  1G2H A;  2K4J A;  3C3W A;  2HXO A;  4M3F A;  4RB0 A;  1V55 H;  3EUH C;  5FB2 A;  4E7I A;  2R7O A;  4LG3 A;  1U8B A;  1EF4 A;  2OJE D;  1YS6 A;  3ZMS A;  1QA6 A;  1SFU A;  1TNS A;  3AG2 H;  4FET A;  4DOZ A;  5LRS A;  3FWE A;  2GA2 A;  3F23 A;  5DCF A;  3TP0 A;  1YYV A;  2DOF A;  1E3H A;  2VJJ A;  4XBF A;  1FPQ A;  5ERI A;  5H2F C;  3CMM A;  4BY7 J;  3S3N A;  4L9N A;  1Z67 A;  3GTQ J;  2CUE A;  5CKT A;  4BUP A;  5K5Q A;  1REP C;  3FF5 A;  2XGE A;  1JKR C;  3EYI A;  3BRO A;  2GBY A;  3FBN B;  3CLO A;  3KLO A;  3BWG A;  3U9G A;  3ZCO A;  1S3J A;  2HXI A;  4XLE A;  1BIB A;  2GOM A;  1Y56 A;  2XHK A;  5M5Y J;  4BQA A;  4A3D J;  1MZB A;  1LDD A;  4IHW A;  3BTJ A;  5B3S H;  1YIT I;  2CW8 A;  2CQN A;  2XB0 X;  3I59 A;  4PK4 A;  1UMQ A;  4XKB A;  1IZ1 A;  3TKY A;  1W0T A;  3DU6 A;  5B66 C;  2DOD A;  2G0E A;  4L5J A;  4XLC A;  4M6X A;  4RLF A;  4I99 C;  3L2W A;  1U9N A;  1OFC X;  1X19 A;  4HNT A;  5HS8 A;  1TNT A;  4A3C J;  3S14 J;  3JW4 A;  4RS8 A;  4B3A A;  1G3T A;  4IQJ A;  1HLV A;  1XPX A;  3RQI A;  3SXY A;  3N4M A;  3ABK H;  3KEO A;  3LMM A;  2V1X A;  3I53 A;  3ABL H;  2LKX A;  4AYB A;  3AL0 C;  2XF6 A;  3ZQC A;  1LFB A;  1WJA A;  2JVG A;  1HW1 A;  1FP2 A;  1P4X A;  4XM3 A;  2K3P A;  2VQC A;  3HGG A;  4IL6 C;  3E6B A;  3A4C A;  4M3B A;  3DEW A;  5LGT A;  2ECB A;  2JA8 J;  2CW7 A;  1BI0 A;  1QVT A;  4BH9 A;  3ZN1 A;  2BVL A;  3H5N A;  4AWX B;  5TJJ A;  1EH6 A;  1UHW A;  1TQM A;  4XQF A;  1IN7 A;  1D1A A;  1Y8Q B;  4XRF A;  2LDU A;  5B1A H;  1BC8 C;  2EIK H;  5M5X J;  4IOC F;  2OAZ A;  1W7P D;  2M4G A;  2VE8 A;  1OKR A;  3IRR A;  2LLK A;  3WGI A;  1HBX G;  4JP0 A;  2R0Q C;  2X4H A;  4Z2Y A;  2DFE A;  3K9T A;  4YFN F;  5LGU A;  5BPI A;  5TGT A;  1IW7 F;  3MZ8 A;  2VB6 A;  4DBR A;  3HPG A;  3BG5 A;  1V3F A;  3TW7 A;  1GV2 A;  1G6N A;  3VOD A;  2H6C A;  3OMY A;  1YJ9 I;  4U87 A;  4DIQ A;  3ABT A;  2LVS A;  3BP8 A;  2FE3 A;  5DD4 A;  1ZGA A;  2VT2 A;  1K78 A;  2M45 A;  5BS6 A;  3UNG C;  1O7L A;  4A3I J;  5CVV A;  2OTL I;  2O5R A;  3HEF A;  1BJZ A;  3HKZ A;  2CV1 A;  1XMX A;  2E5Z A;  2BY2 A;  3BDD A;  2X6W A;  4AIK A;  4ANJ A;  3HOS A;  3BZK A;  3WG7 H;  1ZQ3 P;  1SC7 A;  3S3O A;  4QLC U;  2O8X A;  2M87 A;  1TWA J;  1R23 A;  2WB1 N;  1P92 A;  2FJ1 A;  3CCL I;  2HKO A;  2M0M A;  1ZGW A;  1ZAR A;  1BL0 A;  2L9V A;  1XGS A;  4HX8 A;  5H6R A;  3ZQF A;  5KAF C;  2LNB A;  4Z6Y A;  5B1B H;  3BR1 A;  2PJR B;  4RGU A;  2CO5 A;  2QQ9 A;  1K6Y A;  4YFK F;  4JBA A;  2G7H A;  2K5C A;  1YS7 A;  2HTS A;  3PNV A;  1IRF A;  2MG4 A;  3QOP A;  5D5W B;  3HOZ J;  3ERM A;  5EJC A;  2OCE A;  4BHC A;  1FBS A;  2JA6 J;  3GTK J;  4KJZ A;  1PVE A;  2QKL B;  2H09 A;  2Y0S N;  3S17 J;  4CDG A;  1WI9 A;  3W6K B;  4UVC A;  1PJR A;  2EZL A;  4CCL A;  4Y13 A;  3L2C A;  3HOU J;  2LR8 A;  4GCV A;  2L9R A;  2K9N A;  2K9Q A;  3OV8 A;  4KT5 C;  3SZT A;  2DT5 A;  3HXL A;  3I9V 2;  5EGO A;  2KFD A;  2FBH A;  2DBB A;  3K4J A;  2OUM A;  5DUK A;  4ZC3 A;  3ZN0 A;  1FBQ A;  3RYP A;  2EA2 A;  3OYE A;  1ETV A;  2HZD A;  1WRJ A;  4HF1 A;  3LQQ A;  1I27 A;  3ZOB A;  5M3F J;  4F93 B;  4MTD A;  4BU2 A;  3L2V A;  2ZKZ A;  3BR0 A;  2CUZ A;  3G1M A;  3N97 A;  1FOX A;  4BGD A;  3CF2 A;  3S2H J;  1A5J A;  5GTI C;  4A12 A;  3F6V A;  5FKM A;  5AIQ A;  5FRO A;  1Z6R A;  1IN5 A;  4GYG A;  4HLX A;  1ZKG A;  3QPH A;  2NOG A;  4LGW A;  2L0K A;  4XRS G;  1ZR4 A;  1N77 A;  1MBG A;  3F8N A;  3RZO J;  2PMZ A;  3R61 A;  1W36 D;  1D5Y A;  3CQZ J;  4B43 A;  2TRT A;  1W5T A;  1HKQ A;  4C30 A;  1PDN C;  4U88 A;  4GXO A;  3G73 A;  1FWZ A;  1Z0X A;  2CQK A;  1H8A C;  4CSW A;  3SDB A;  1H89 C;  1D0Y A;  5A2Q Z;  3FXU A;  5GPC A;  4O3M A;  4NQW B;  4TV7 A;  4BNC A;  3LST A;  1ETO A;  4IRH A;  2IP2 A;  5IOY A;  1IDZ A;  1IN6 A;  3KE2 A;  1HKT A;  2RQQ A;  3N05 A;  2YSR A;  2ZJQ F;  1BIA A;  2ESH A;  3O3K A;  1Q1H A;  3T8T A;  4LFU A;  3W6V A;  3DV8 A;  4I09 A;  2JA5 J;  3NWS A;  1JGG A;  2XC7 A;  2OTJ I;  2H8R A;  4YRV A;  2UZK A;  3KYL A;  3GZ5 A;  2Y48 A;  1IN4 A;  3CJR B;  4JOM A;  2DFH A;  1ERD A;  2PG4 A;  1V4R A;  1Z21 A;  5HS7 A;  5LGN A;  3I54 A;  1MMA A;  3WHC A;  4DZJ A;  3H3U A;  4QPQ A;  2HZT A;  5HLT A;  5F6F A;  4HAM A;  1JUM A;  5EDN A;  2M8G X;  1T95 A;  3VYS B;  2MAB A;  3DEE A;  1QHH D;  2IEK A;  5D8K B;  1B9M A;  1POG A;  4PSW A;  2DFF A;  4V2F A;  5KNL A;  3PNT A;  2EV5 A;  2QYO A;  2DDA A;  2BXZ A;  3IHU A;  1QU3 A;  4UNO A;  5CJ9 A;  3CP2 A;  4A3F J;  3FKI J;  4OIR F;  2F48 A;  4FE4 A;  3F9K A;  2IA1 A;  4XLP F;  3MKW B;  1RKW A;  4R8H A;  5J1Y A;  3QWL A;  3HOX J;  1SEU A;  4BEH A;  1T2K A;  2WAF A;  1D8J A;  2IAI A;  3O6B B;  3CCJ I;  4ASN A;  2AXL A;  1OIS A;  1UCR A;  1STZ A;  2ISZ A;  1LEB A;  3WU0 A;  4JX4 A;  4C3I J;  2LOO A;  1YW9 A;  4XN0 A;  3JRB A;  3HIF A;  2COB A;  2WB1 A;  3Q0V A;  3I59 B;  3U1D A;  1H88 C;  3J7Z I;  2BYV E;  5D5U B;  3JRA A;  2HEO A;  4L0Y B;  3HJE A;  3MMY B;  4OOI A;  4PJ0 C;  2BXY A;  3OYN A;  2EJR A;  2PMU A;  1B72 A;  5DCM A;  1H9G A;  1I3A A;  3IUO A;  1KQ0 A;  3SFI A;  5F27 A;  2F4M B;  2VIX A;  4FHT A;  5ICG A;  1CGP A;  3IH3 A;  1FTZ A;  4XLN F;  3MAJ A;  4CO8 A;  5K7Z A;  1RIO H;  4ZDO A;  2CUF A;  3ASO H;  2FF4 A;  4E7H A;  2JRT A;  1VZ0 A;  5E1X A;  4ZH4 F;  2Y0M A;  1U5T B;  5CVU A;  3S3M A;  1IUY A;  4IPA A;  2Y9Y A;  5LLQ A;  2Z1D A;  1MMD A;  1DP3 A;  1U5T C;  5L3C A;  2IPQ X;  2VKE A;  2KLO A;  3DPU A;  3OYI A;  4BXF A;  1FJL A;  1WVR A;  3I3L A;  3GW2 A;  2DMP A;  1WJ5 A;  1Z7U A;  2V4J C;  2MD0 A;  3RKX A;  3ZPL A;  2P8T A;  1GV5 A;  3E6C C;  4ENK A;  2R7U A;  1QZZ A;  1YW8 A;  2EBI A;  4XSZ F;  1T0F A;  4LMY A;  3WTY C;  3CMY A;  5JHU A;  3GTL J;  4XON A;  4IOA F;  3OYD A;  1IDY A;  3G4S I;  3FXL A;  4G6Q A;  4RA2 A;  2B63 J;  1T0F C;  2V26 A;  3HHH A;  3RPU D;  2PJR A;  5HLI A;  4HF2 A;  1VQK I;  2KIQ A;  2RVC A;  3JRF A;  1UHM A;  1XMK A;  4KIF A;  5E8I A;  1ZG1 A;  5DM6 F;  3RI4 A;  4Y4R A;  3I5U A;  2DO7 A;  1KON A;  2Q2E B;  4Y15 A;  5KCM A;  5C3E J;  4IHX A;  1ZLK A;  4R1H A;  1G3W A;  2IGO A;  4CCO A;  2DFI A;  5FKN A;  2V7F A;  3OS2 A;  4HST A;  2R7W A;  2HDC A;  4E7K A;  4YEJ A;  3WOD F;  5AON A;  4IXA A;  1AOY A;  3FHZ A;  4HX7 A;  4M6Y A;  1VQM I;  2M2E A;  3NWT A;  3IAM 2;  3BY6 A;  2QSG X;  3SEZ A;  5J4Y A;  1PUF A;  1FSE A;  3TBI A;  4RGX A;  1XX5 A;  3BR2 A;  2MLK A;  4XMY A;  4CCM A;  5C4J J;  2A61 A;  5DEQ A;  3PUB A;  1W1W E;  4ZDP A;  4BE0 A;  5JR3 A;  4PFP A;  3JSP A;  2KKO A;  1YTY A;  1CQT A;  2QGU A;  2QSF X;  5FLX K;  2HNH A;  4N9I A;  3KP4 A;  2B9S A;  1WKM A;  5LFA A;  1PUE E;  1IF1 A;  1ONV A;  1TTY A;  1YRN A;  1JT0 A;  1MDM B;  1YOV B;  2OD5 A;  1P7J A;  1Y0U A;  3TMO A;  4A0X A;  4S04 A;  2QSH X;  3L7W A;  4I76 A;  4LLG F;  2CSO A;  2MLG A;  2VPR A;  4PGG A;  4EQQ A;  2F4I A;  4MFD A;  3ELK A;  2Y69 H;  5ICE A;  3BJO A;  3LSH A;  4L9T A;  3BR5 A;  5L3G A;  4BQO A;  1R4N B;  2R93 J;  2JTV A;  2R4G A;  3HOT A;  2FML A;  1PYV A;  3W2V A;  1HKS A;  3P9K A;  4GGG A;  4BXU A;  4AIH A;  5J47 A;  2MGQ A;  3KPH A;  2XAG A;  4ZJZ A;  4WXD A;  4PUS A;  1U8R A;  4HSR A;  1VQP I;  3PQK A;  2XV4 S;  2MA3 A;  2QBY B;  1RRJ A;  4X6A J;  4ON0 A;  2HPI A;  4S05 A;  4IX7 A;  2EIM H;  2LFB A;  5J3L A;  3PIP F;  4CYC A;  3WTT C;  1K61 A;  2A68 F;  4H0E A;  2UWM A;  1IRG A;  3W3C A;  1GXQ A;  3JRD A;  3BZ6 A;  1WJF A;  1WFX A;  3D0S A;  2R3S A;  2COM A;  1SAU A;  2ME0 A;  5F1R A;  2DAO A;  3JTG A;  3J81 Z;  1L3L A;  3EUK L;  2PI0 A;  1R1T A;  3K4C A;  3J80 Z;  1AU7 A;  1UAA A;  1FTT A;  2I10 A;  5EZG A;  2E60 A;  3T0Y A;  2LMD A;  3WG9 A;  3PIO F;  1OCP A;  2KZG A;  2LKS A;  3KYD B;  3OYC A;  1IV6 A;  2PN6 A;  3FHN A;  5CVI A;  3T1B A;  2HTJ A;  3ML6 A;  1S7A A;  4FTH A;  4M71 A;  2L01 A;  3CME I;  3KZY A;  1B8I B;  2QM3 A;  3FXO A;  2PEX A;  3H5A A;  1JJ6 C;  4XOR A;  1X2N A;  3BT9 A;  1VF9 A;  2PMH A;  2Q8K A;  1LFP A;  3W2W A;  1TW3 A;  1U6G A;  1VQ7 I;  5E3O A;  1A6Q A;  1R22 A;  4OU0 A;  3GTJ J;  2LF7 A;  1TWH J;  1MDM A;  4DYC A;  1KA8 A;  1X58 A;  2VQH A;  3ZQG A;  4DW6 A;  1S8N A;  2ZJP F;  3EPZ A;  1KYZ A;  2FA5 A;  3HOY J;  5M3M J;  3ASN H;  4ENM A;  2FOK A;  2MYS A;  2F2E A;  1I39 A;  2XB5 A;  1A35 A;  1D0Z A;  1F5T A;  3CO7 C;  1D1B A;  2IRF G;  3WU2 C;  1T98 A;  2FSW A;  5FKK A;  1FYL A;  2EFN A;  3DKY A;  3M07 A;  2IJL A;  2LY9 A;  4HQM A;  5LEK A;  3K1M A;  1J2X A;  1TQI A;  3WU1 B;  3KLN A;  3X2Q H;  4BEH B;  4XKV A;  1SAN A;  1O4X A;  4CCJ A;  3M7G A;  5FO5 A;  5LHI A;  4MHG A;  2VBY A;  1SD4 A;  1YJW I;  1W7P A;  2F5E A;  2ZFU A;  4ITV A;  3IAS 2;  2E36 A;  1IG7 A;  2NS7 A;  4G7Z F;  1MBF A;  3TO6 A;  4E7L A;  2X51 A;  4GYI A;  4LB5 A;  1P9Q C;  5EGO B;  2JPB A;  2QKM B;  1XGN A;  3BC8 A;  5K7F A;  2GAU A;  3D5L A;  4KNY A;  1X4O A;  1MMS A;  5BNG A;  2O3F A;  5GPA A;  2G7U A;  3EUH A;  1VTN C;  1VQ8 I;  1OYW A;  5DYM A;  3C2B A;  3LSG A;  2K86 A;  1G4D A;  4N0B A;  1KQ8 A;  3CCQ I;  1K78 B;  1U0J A;  2FBI A;  4IHV A;  2NS0 A;  3BTC A;  5IP6 A;  3GZN B;  3V7S A;  3OY9 A;  2FQ4 A;  2KIS A;  2IXS A;  2EIJ H;  5C44 J;  1O3Q A;  2K9M A;  3HOV J;  3M1E A;  1BM9 A;  2EZK A;  1X1P A;  3J81 K;  4E6K G;  2ZBK A;  1ZYR F;  3AG4 H;  3BCA A;  3G1L A;  3ZMT A;  1YIJ I;  1R1U A;  1XS9 A;  1FOK A;  3KEY A;  2BZT A;  1F36 A;  1OLT A;  3PL8 A;  2ACJ A;  3TDU C;  5LRR A;  5JLW A;  3OYB A;  2K85 A;  1G3S A;  1OR7 A;  4PJJ A;  3NAU A;  2H8W A;  5GP9 A;  2ZO4 A;  4UB6 C;  2K27 A;  5F0H A;  1YW7 A;  3OYA A;  1ETK A;  5LEJ A;  3FXJ A;  2VC1 A;  3LOC A;  3E97 A;  4B09 A;  2C6Y A;  2A5Y B;  1MIJ A;  2QF7 A;  1R5H A;  3HUG B;  2P5V A;  3VYU B;  2WAD A;  1O7F A;  4KDP A;  1MNM C;  2HOA A;  3CCE I;  4HNU A;  3AL0 B;  2KRC A;  4RB2 C;  4RAF A;  1TP4 A;  2EZH A;  2AHQ A;  2ID3 A;  2VJ5 A;  5F64 A;  4UUS B;  4L5I A;  4IEJ A;  2W4S A;  3HRT A;  3TL4 X;  3GTP J;  2M0C A;  3FK7 A;  1SFX A;  2YPR A;  3CC2 I;  2L9N A;  2BVM A;  1BBY A;  4I98 B;  3J80 K;  2QCO A;  3T5X A;  1L0O C;  4IQ4 A;  3Q5F A;  2DYR H;  1Z7L A;  2ZB9 A;  3H36 A;  3CMA I;  1SVL A;  2LK2 A;  1IV8 A;  3KIO A;  4ESJ A;  2EPF A;  4WWC A;  1R36 A;  4MQ9 F;  3SHF A;  3LSI A;  2Y30 A;  3ZXS A;  2IGM A;  3IP4 B;  2STW A;  2RC4 A;  1HC8 A;  4C2T A;  4J00 A;  5IPA A;  2CRG A;  5ILS A;  4A5M A;  5C4X J;  3GLX A;  2V79 A;  3ZR8 X;  5JVT A;  4NC8 A;  5DM7 F;  4UB8 C;  2QUF A;  2O7O A;  2NVT J;  4RGS A;  3AG3 H;  3E6D A;  2VKV A;  1BOA A;  4WX9 A;  3GFJ A;  3TQN A;  3T8R A;  3S8P A;  4EMS A;  1IO2 A;  2CWE A;  2ELJ A;  4ABZ A;  3GLL A;  2DA4 A;  1F1Z A;  3WTU C;  3DEU A;  4PJN A;  2JJ7 A;  3AG1 H;  1U2W A;  1GVJ A;  2HPM A;  4UVB A;  3H0D A;  4J19 A;  1APL C;  3HDD A;  3DF8 A;  3IKV A;  2XAJ A;  3PNY A;  1ON2 A;  4NC6 A;  4LG0 B;  3CUQ A;  1VQN I;  4ZZD A;  1FSH A;  2P81 A;  2HQR A;  2X6X A;  5E1W A;  3SZP A;  4A3M J;  4V19 K;  1FT9 A;  1EJ9 A;  4ZTF A;  4YII A;  2XF7 A;  1TZL A;  4RBO A;  2PLY A;  2OQR A;  2O0Y A;  1LNW A;  3BQZ A;  4OAY A;  2V9V A;  1LVK A;  1NK2 P;  4HLY A;  1XC5 A;  3LWF A;  1VQ6 I;  1WH5 A;  2MBF A;  4DYR A;  2VJI A;  3DLL F;  1IXS B;  4AID A;  1RUN A;  1RZ4 A;  2NNN A;  4C9Y A;  4HYE A;  1ZN2 A;  4NQW A;  3LSR A;  1F43 A;  2VLA A;  2F5D A;  3R0J A;  3DBR B;  1SVO A;  3CF5 F;  3QRF F;  2NVX J;  4FAS D;  2A5W A;  3KCC A;  4IO9 F;  3CP8 A;  2ID6 A;  1Y1W J;  2XAH A;  1JTY A;  1H0M A;  1P7I A;  2XVC A;  3NEU A;  1U3E M;  4ZYH A;  3HTS B;  4D9J A;  4UY8 I;  1B59 A;  4CUG A;  4IRI A;  1GUU A;  2GXB A;  3H5R A;  4U7D A;  4II3 A;  5HNH A;  4LLN A;  3F8B A;  1C0W A;  3H92 A;  2RNG A;  4I7H A;  3LFU A;  3OS0 A;  2HR3 A;  1S29 A;  3M8J A;  2XIG A;  3FDY A;  3PQJ A;  3R6S A;  5DTD A;  3ROU A;  2VUM J;  1FLI A;  2PMZ N;  1W5C C;  2V1N A;  2EIN H;  3OYG A;  3OR1 C;  1TWF J;  3CC4 I;  1XCV A;  3DFG A;  5FD5 A;  2KZV A;  5KK1 A;  2DTZ A;  2X6O A;  1MSF C;  4CYD A;  3PO2 J;  3C1D A;  3M1C A;  2G9W A;  5KAI C; 
#chains in the Genus database with same CATH homology
 3CUQ B;  5E18 F;  1G3Y A;  1JGS A;  1YG2 A;  2RGV A;  5D5V B;  3JAM Z;  3K2Z A;  4MQV A;  1I1G A;  4L18 B;  2YR2 A;  2P6T A;  4HA8 A;  5FFX A;  4EJT A;  3BJA A;  3L09 A;  3ECH A;  3HSF A;  4Y17 A;  4KMF A;  4EVI A;  4UVA A;  4KA4 A;  3L9F A;  5FLX Z;  2WC2 A;  3WTZ A;  2TDX A;  3WGH A;  3V4G A;  4RAY A;  4KFC A;  1FP1 D;  5HS9 A;  4IJA A;  4ZYG A;  1JE8 A;  1O3T A;  4EM0 B;  3J7A O;  1LDJ A;  4GO1 A;  3MFK A;  1A04 A;  1LEA A;  3IC7 A;  2EA4 A;  2ESN A;  3GVA A;  1HXD A;  3ULQ B;  4U0V A;  1SD7 A;  4L9V A;  5BMZ A;  4A2U A;  5L3E A;  1LQ1 A;  2BV6 A;  1R1V A;  4LG0 A;  1FBU A;  2UXX A;  2QBY A;  3CJN A;  2DU9 A;  4MTE A;  1IXR C;  3GUD A;  1FZP B;  4CHU A;  3EDP A;  5HDN A;  3GFM A;  4G9Y A;  1MGT A;  4G7O F;  3LA7 A;  4EM1 A;  3WTX C;  2LKP A;  3HUG A;  4RB3 C;  3ZMU A;  2DPU A;  2CFX A;  2GWR A;  4YIF A;  1Z05 A;  3CTA A;  2EFO A;  1B6A A;  5D4R A;  3EQL F;  3OOP A;  5H20 A;  1Z6T A;  2A3S A;  2Q2E A;  3SQN A;  4U0Y A;  4G7H F;  3FX3 A;  5LHG A;  2ETH A;  3M8F A;  4CZZ A;  1PP7 U;  3FMS A;  3G3Z A;  2NNY A;  1AWC A;  4HZF A;  3ZMV A;  1XSX A;  2EWN A;  2Z5U A;  3QAH A;  4FX0 A;  2MC3 A;  4MGR A;  4A6D A;  5A2Q K;  5AIP A;  4FT8 A;  4EJO A;  2RNJ A;  3U2R A;  2WWY A;  2KIM A;  5HDG A;  3RIR A;  3LQR A;  2XAQ A;  5L3B A;  3BOQ A;  3GYH X;  4JK1 X;  4YG2 F;  3TOB A;  2JT1 A;  1OPC A;  4M9S A;  1ZRE A;  3QU3 A;  1MKM A;  3F8F A;  4R79 A;  3QPT A;  2P5K A;  4RGR A;  4AIJ A;  1W5S A;  2KIF A;  1ZRD A;  3TO7 A;  3F72 A;  2RN7 A;  5HVQ C;  3P9C A;  1KYW A;  4LLL A;  4UV8 A;  2IVM A;  1H9T A;  4ZZL A;  1J59 A;  2D1H A;  4EM2 A;  3DXJ F;  5E1Z B;  3SFZ A;  1DP7 P;  4L9J A;  2ZNZ A;  2ELH A;  1B4A A;  2H94 A;  4IRG A;  3FZV A;  1BN5 A;  4DNC A;  2A6H F;  3V7C A;  4G6D A;  4KIG A;  2JPC A;  2M5W A;  1WSU A;  2HYG D;  2J5P A;  1ZGJ A;  1HW2 A;  4UHT A;  4BAY A;  5KVR A;  1DUX C;  5ILV A;  4B8X A;  4N9H A;  3IRQ A;  3R4K A;  4OIP F;  1B1B A;  1J9I A;  3ZMD A;  1P2F A;  2FNA A;  1SMT A;  2CGP A;  2MD5 A;  1FX7 A;  3E5X A;  1TLH B;  3LAJ A;  3VB2 A;  4UXN A;  2Q0O A;  1RUO A;  1ZH5 A;  2V1U A;  5BOX A;  4Q4Z F;  3KFW X;  3DP7 A;  4PGH A;  3LAP A;  1EH8 A;  3I4P A;  2FXA A;  3HSR A;  2NRA C;  3FMQ A;  3KP3 A;  3RJP A;  4HDU A;  3I58 A;  3FXQ A;  4A0Y A;  2DK5 A;  1XGM A;  2DK8 A;  1R7J A;  2ZCW A;  4DQ2 A;  3K0L A;  3RKY A;  4O6J A;  1K79 A;  4LJZ F;  1D3Y A;  5IT9 Z;  2VT3 A;  1O57 A;  2IW5 A;  3FM5 A;  2IT0 A;  4HBL A;  3WE2 A;  1ZG3 A;  2FU4 A;  4ESB A;  2GZW A;  4KYW A;  2GA1 A;  2EB7 A;  1E17 A;  4E70 A;  4HV5 A;  5J6X A;  4ESF A;  4FX4 A;  1XD7 A;  5J8C A;  3MZH A;  2DQR A;  1QPM A;  3JSO A;  3DPT A;  5K1Y A;  3F6O A;  2KJC A;  3WE3 A;  4MNU A;  3MQ0 A;  1QZY A;  2M30 A;  4F7Z A;  2W25 A;  2VN2 A;  5JFR A;  5FD6 A;  3F21 A;  3F3X A;  4LB6 B;  5J8F A;  3WTS C;  1YQA A;  3MEX A;  5D6F A;  3C18 A;  2HQN A;  2QQB A;  3E3V A;  2XKP A;  3HYI A;  2Z9O A;  4CGZ A;  4P9U A;  2VXZ A;  4HV6 A;  2Y75 A;  4O5V A;  3VFZ A;  4RB1 A;  2L4A A;  3NRV A;  4EJW A;  2RKH A;  3CDH A;  4P55 A;  1ON1 A;  2VON A;  5HOO A;  2EV6 A;  4OMZ A;  3ZMZ A;  5ED4 A;  1KU3 A;  2LF8 A;  4L0Z B;  4WCG A;  3NQO A;  2DQL A;  2DI3 A;  3W6J B;  4BYY A;  1YO5 C;  1I1S A;  3RKW A;  4U7B A;  3IWF A;  3IWZ A;  1XGO A;  2QQA A;  2B0L A;  1LDK B;  1CF7 A;  2FRH A;  4ZYD A;  1ZG5 A;  3RPU A;  3CUO A;  5BPD A;  2HGC A;  4OMY A;  4M9Z A;  3EET A;  1MJA A;  3MCZ A;  1BC7 C;  1KU2 A;  1BI2 A;  3FXR A;  3GFI A;  2YX4 A;  4P96 A;  3I71 A;  1QNT A;  3R60 A;  1X3U A;  2EFW A;  2XUB A;  1R5G A;  1SAX A;  2P7V B;  3GF2 A;  3V8K A;  2HKX A;  1OMI A;  4OIN F;  2V1D A;  2W24 A;  3HHG A;  4ZYE A;  5CLS A;  3TDZ C;  2Z99 A;  3COA C;  3LA2 A;  1HSJ A;  3O2P E;  5LBQ A;  4BHB A;  3Q9V A;  2XRN A;  1U5T A;  1BJA A;  2P7C B;  1XMA A;  1JXS A;  2EK5 A;  3CUQ C;  4I0A A;  2YU3 A;  4LD5 A;  2JZY A;  2XGX A;  2HYF A;  4A5N A;  3I64 A;  2PBI A;  2OQG A;  3KET A;  4KIC A;  4IHS A;  1FY7 A;  2YX7 A;  1MJB A;  1R58 A;  4WF2 A;  1LB2 A;  2VOP A;  5CVR A;  1FNN A;  3BPX A;  4M74 A;  1DPU A;  1HW5 A;  1JHH A;  3FMR A;  1KU7 A;  2FNP A;  2F5F A;  3ISP A;  1XSD A;  4LK0 F;  2STT A;  2DLL A;  2QZ8 A;  4HDV A;  2VBZ A;  2PJP A;  2E1N A;  1CF7 B;  5LHH A;  2ZXJ A;  3KP5 A;  2IA2 A;  2ZNY A;  1BI1 A;  3V7R A;  1USS A;  4KMU X;  4KIB A;  3HTU A;  2PFB A;  5TRD A;  2RDP A;  2D2W A;  1DDN A;  3BJ6 A;  4K2E A;  2M8E A;  3F22 A;  1O3R A;  1K6O A;  5D8L B;  2P6S A;  3I0T A;  2A6E F;  4EJV A;  2J5O A;  1SD6 A;  3LA3 A;  3AAF A;  2V6C A;  1BI3 A;  4ENN A;  3H3Z A;  4HOB A;  2NAZ A;  2WV0 A;  2BEO A;  3DKW A;  1W4M A;  1UB9 A;  4I2O A;  2W57 A;  2VC0 A;  3E6M A;  2BBY A;  1UST A;  3K69 A;  2L02 A;  2P4W A;  1J75 A;  2BGC A;  2AS5 F;  4WXH A;  1XSV A;  3QP5 A;  3R0A A;  3M8E A;  4KUM A;  1QBJ A;  3RYR A;  5D5X B;  4EJU A;  5D6E A;  2GXG A;  1F4K A;  1Z91 A;  2XRO A;  1UFM A;  5FGM A;  4PCQ A;  1RNL A;  2L54 A;  2VE9 A;  3GZ6 A;  4XSX F;  3TGN A;  1O3S A;  5IT9 K;  3ERE D;  4PZJ A;  2QLZ A;  4Q47 A;  5EEH A;  2Z33 A;  1ZLJ A;  3JAM K;  1B9N A;  2E7W A;  3F8C A;  5FFZ A;  1K7A A;  3ABU A;  2VBX A;  1SMY F;  1NHA A;  4G94 A;  5HLG A;  2W84 A;  4I01 A;  4IHT A;  3B02 A;  2P5L C;  3CO6 C;  4A0Z A;  2W85 A;  1QGP A;  2O03 A;  2CYY A;  2ZJ2 A;  1Z9C A;  3GX4 X;  1ZRC A;  1XDS A;  1QQI A;  1TBX A;  2ZME A;  2ADU A;  1LVA A;  5L3D A;  1QO0 D;  3V8J A;  2X0L A;  3ZQ7 A;  1WWX A;  1EV7 A;  2XAS A;  3C7J A;  3E5U A;  3GXO A;  4UV9 A;  1KU9 A;  2VOO A;  1FYM A;  4UUV A;  2BE5 F;  1HST A;  4WXC A;  1SFE A;  4CIC A;  1XCB A;  2LSO A;  5D4S A;  4EV0 A;  2O61 A;  2MH9 A;  2RQP A;  3KEQ A;  1P6R A;  4MEY F;  4Q48 A;  1R00 A;  5K5R A;  2E7X A;  1T38 A;  4BHP A;  5DD8 A;  1U78 A;  4WK8 F;  2KRF A;  2H27 A;  1KQ9 A;  2UXN A;  3LFK A;  3HRM A;  3V8L A;  5ILU A;  4P5O A;  3KP2 A;  1ZRF A;  4ETS A;  1ZHF A;  4I02 A;  1PP8 F;  3IL2 A;  5ICC A;  3GO5 A;  1EH7 A;  1I5Z A;  3ZP5 A;  3F8M A;  5EEG A;  3KZZ A;  3HRU A;  1ODD A;  1YLF A;  4U0W A;  4M9X A;  1E2X A;  2L3D A;  4OIO F;  4Q5S F;  1ZAO A;  3M9A A;  5E8G A;  3GFL A;  1FYK A;  5HLH A;  2KIU A;  2FQ3 A;  1SD5 A;  2DW4 A;  3WTV C;  3DQV C;  2OZU A;  5K5O A;  3FM3 A;  1T6S A;  3HRS A;  3MZY A;  4NB5 A;  1XDU A;  4IF4 A;  2ZME B;  4EGY A;  2JSC A;  3TO9 A;  5DUI A;  2HOE A;  3RTR A;  4YFX F;  1OYI A;  4HX4 A;  4M73 A;  2H6B A;  3P9I A;  1MD0 A;  1S6L A;  3ECO A;  4D0P A;  4OIQ F;  1W7P B;  1IXC A;  4HQE A;  3WTW C;  3RPQ A;  5E17 F;  1FC3 A;  2F5C A;  5CVJ A;  4M72 A;  1KGS A;  4NHJ A;  2OZ6 A;  3KP7 A;  4CXF A;  1D5V A;  2D45 A;  3JTH A;  2QEN A;  2RV8 A;  4P9F A;  2HS5 A;  2M1B A;  3TOA A;  2QVO A;  4PDK A;  3WGG A;  3P7N A;  1OYY A;  5DV5 A;  3PFI A;  5HDK A;  4G8X A;  2ZFW A;  5BQT A;  1IAW A;  2GQQ A;  2IA0 A;  2ISY A;  4RAZ A;  3Q9S A;  3EYY A;  2PQ8 A;  3GWZ A;  1XB4 A;  5ICF A;  4EGZ A;  2MH2 A;  3B73 A;  1HQC A;  2QWW A;  3DPL C;  3IKT A;  1J0R A;  3L00 A;  2OBP A;  3K1P A;  4LK1 F;  2EFP A;  4HF0 A;  4KN4 X;  1S7O A;  2A07 F;  1D8K A;  2Z3Y A;  2OU2 A;  1YFH A;  2R7D A;  2VBW A;  3K1N A;  2EV0 A;  5DDG A;  2K7L A;  1TW2 A;  1T39 A;  4AVP A;  5IT3 A;  3QU6 A;  3VEP A;  1J7K A;  1DPR A;  4A6E A;  1F9N A;  6PAX A;  1JHF A;  2GIV A;  2XAF A;  1P4A A;  4KN7 X;  1J5Y A;  5E20 A;  2WTE A;  2HWV A;  5L3F A;  1I6X A;  4I0B A;  4IVN A;  1P4W A;  1MJ9 A;  3E5Q A;  2DTR A;  2EFQ A;  5JI6 A;  2KJB A;  4QWQ A;  1YIO A;  3GEZ A;  3QP6 A;  3RDI A;  2R7F A;  1LJ9 A;  2CW0 F;  1RI7 A;  4HW0 A;  2K4B A;  1GHC A;  2VOD A;  5CYV A;  1TQP A;  2O6G E;  3BPV A;  2XKO A;  3MWM A;  2OA4 A;  3REO A;  1IN8 A;  4AD9 A;  5DCM B;  2L4M A;  2E1C A;  1ULY A;  2A69 F;  5H6Q A;  4JQF A;  3S2W A;  2DPD A;  1Z1D A;  3KP6 A;  4MEX F;  1GXP A;  2HFH A;  2FMY A;  4ENJ A;  1WQ2 A;  3VOE A;  2D1V A;  2FBK A;  2NYX A;  2K02 A;  3HSE A;  1XN7 A;  2FEZ A;  2CG4 A;  2K4J A;  3C3W A;  4RB0 A;  5FB2 A;  1YS6 A;  3ZMS A;  1SFU A;  1TNS A;  5LRS A;  3FWE A;  2GA2 A;  3F23 A;  5DCF A;  1YYV A;  4XBF A;  1FPQ A;  5ERI A;  4L9N A;  5K5Q A;  1REP C;  3FF5 A;  3EYI A;  3BRO A;  3CLO A;  3KLO A;  3BWG A;  3U9G A;  1S3J A;  1BIB A;  4BQA A;  2XHK A;  1MZB A;  1LDD A;  3I59 A;  1IZ1 A;  3TKY A;  4L5J A;  4M6X A;  5HS8 A;  1TNT A;  3JW4 A;  4RS8 A;  1G3T A;  3SXY A;  3N4M A;  3KEO A;  2V1X A;  3I53 A;  1HW1 A;  1FP2 A;  1P4X A;  3E6B A;  5LGT A;  1BI0 A;  4BH9 A;  3ZN1 A;  4AWX B;  5TJJ A;  1EH6 A;  1UHW A;  1TQM A;  1IN7 A;  4XRF A;  2LDU A;  1BC8 C;  2OAZ A;  1W7P D;  1OKR A;  2VE8 A;  3IRR A;  3WGI A;  1HBX G;  2X4H A;  4Z2Y A;  3K9T A;  4YFN F;  5LGU A;  5BPI A;  1IW7 F;  1V3F A;  1G6N A;  3VOD A;  2H6C A;  3ABT A;  3BP8 A;  2FE3 A;  5DD4 A;  1ZGA A;  2VT2 A;  1K78 A;  2M45 A;  5BS6 A;  1O7L A;  5CVV A;  3BDD A;  4AIK A;  3HOS A;  4QLC U;  2O8X A;  2M87 A;  1R23 A;  1P92 A;  2HKO A;  1ZAR A;  1XGS A;  4HX8 A;  5H6R A;  2LNB A;  4RGU A;  2CO5 A;  2QQ9 A;  4YFK F;  4JBA A;  2G7H A;  1YS7 A;  2HTS A;  1IRF A;  5D5W B;  3QOP A;  4BHC A;  1FBS A;  2H09 A;  4CDG A;  1WI9 A;  3W6K B;  4UVC A;  4Y13 A;  3L2C A;  4GCV A;  3OV8 A;  4KT5 C;  3SZT A;  2DT5 A;  2FBH A;  2DBB A;  5DUK A;  3ZN0 A;  1FBQ A;  3RYP A;  2EA2 A;  1WRJ A;  4HF1 A;  3LQQ A;  1I27 A;  4MTD A;  2ZKZ A;  3N97 A;  4A12 A;  3F6V A;  5AIQ A;  1Z6R A;  1IN5 A;  4GYG A;  4HLX A;  3QPH A;  4LGW A;  3F8N A;  3R61 A;  1W5T A;  1HKQ A;  1PDN C;  4U88 A;  4GXO A;  3G73 A;  1FWZ A;  2CQK A;  5A2Q Z;  3FXU A;  4O3M A;  4TV7 A;  4BNC A;  3LST A;  4IRH A;  2IP2 A;  1IN6 A;  3KE2 A;  1HKT A;  2YSR A;  1BIA A;  2ESH A;  3O3K A;  1Q1H A;  3T8T A;  4LFU A;  3DV8 A;  4I09 A;  2UZK A;  2Y48 A;  3GZ5 A;  1IN4 A;  2PG4 A;  1V4R A;  5HS7 A;  5LGN A;  3I54 A;  3H3U A;  2HZT A;  5F6F A;  4HAM A;  5D8K B;  1B9M A;  2EV5 A;  2QYO A;  3IHU A;  4UNO A;  5CJ9 A;  4OIR F;  2IA1 A;  4XLP F;  4R8H A;  1T2K A;  1D8J A;  3O6B B;  4ASN A;  2AXL A;  1UCR A;  1STZ A;  2ISZ A;  1LEB A;  3WU0 A;  1YW9 A;  3HIF A;  3U1D A;  3I59 B;  2BYV E;  5D5U B;  2HEO A;  4L0Y B;  4OOI A;  2EJR A;  2PMU A;  5DCM A;  1H9G A;  1KQ0 A;  5ICG A;  4FHT A;  1CGP A;  4XLN F;  3MAJ A;  4CO8 A;  1RIO H;  2FF4 A;  2JRT A;  5E1X A;  4ZH4 F;  2Y0M A;  1U5T B;  5CVU A;  1IUY A;  4IPA A;  5LLQ A;  1U5T C;  5L3C A;  2IPQ X;  3GW2 A;  1Z7U A;  3RKX A;  3ZPL A;  2P8T A;  3E6C C;  4ENK A;  1QZZ A;  1YW8 A;  4XSZ F;  1T0F A;  4LMY A;  3WTY C;  5JHU A;  4G6Q A;  3HHH A;  5HLI A;  4HF2 A;  2RVC A;  1UHM A;  1XMK A;  4KIF A;  5E8I A;  1ZG1 A;  3RI4 A;  3I5U A;  2DO7 A;  4Y15 A;  1ZLK A;  4R1H A;  1G3W A;  2DFI A;  2HDC A;  3WOD F;  5AON A;  4IXA A;  1AOY A;  3FHZ A;  4HX7 A;  4M6Y A;  3BY6 A;  1FSE A;  4RGX A;  2MLK A;  2A61 A;  5DEQ A;  5JR3 A;  3JSP A;  2KKO A;  1YTY A;  5FLX K;  4N9I A;  3KP4 A;  1WKM A;  1PUE E;  1IF1 A;  1ONV A;  1TTY A;  1MDM B;  2OD5 A;  1Y0U A;  4A0X A;  4S04 A;  3L7W A;  4LLG F;  2CSO A;  2MLG A;  4PGG A;  4EQQ A;  3ELK A;  5ICE A;  3BJO A;  4L9T A;  5L3G A;  2JTV A;  3HOT A;  2FML A;  1HKS A;  3P9K A;  4GGG A;  4BXU A;  4AIH A;  2XAG A;  4WXD A;  1U8R A;  3PQK A;  2XV4 S;  2MA3 A;  2QBY B;  4ON0 A;  4S05 A;  3WTT C;  2A68 F;  4H0E A;  2UWM A;  1IRG A;  1GXQ A;  3BZ6 A;  3D0S A;  2R3S A;  2COM A;  5F1R A;  2DAO A;  3JTG A;  3J81 Z;  1L3L A;  2PI0 A;  1R1T A;  3J80 Z;  3T0Y A;  3WG9 A;  2PN6 A;  5CVI A;  3T1B A;  2HTJ A;  3ML6 A;  1S7A A;  4M71 A;  2L01 A;  3KZY A;  2QM3 A;  2PEX A;  2PMH A;  2Q8K A;  1TW3 A;  1U6G A;  1R22 A;  4OU0 A;  2LF7 A;  1MDM A;  1KA8 A;  1S8N A;  1KYZ A;  2FA5 A;  4ENM A;  2FOK A;  2F2E A;  1F5T A;  3CO7 C;  2IRF G;  1T98 A;  2FSW A;  1FYL A;  2EFN A;  2IJL A;  4HQM A;  5LEK A;  3K1M A;  1J2X A;  1TQI A;  3WU1 B;  3KLN A;  3M7G A;  5FO5 A;  5LHI A;  4MHG A;  2VBY A;  1SD4 A;  1W7P A;  2F5E A;  4G7Z F;  3TO6 A;  4GYI A;  4LB5 A;  2JPB A;  1XGN A;  2GAU A;  3D5L A;  4KNY A;  2O3F A;  2G7U A;  3EUH A;  1VTN C;  1OYW A;  5DYM A;  2K86 A;  1G4D A;  4N0B A;  1KQ8 A;  1K78 B;  2FBI A;  2NS0 A;  3V7S A;  1O3Q A;  3M1E A;  1BM9 A;  3J81 K;  2ZBK A;  1ZYR F;  3ZMT A;  1R1U A;  1FOK A;  2ACJ A;  3TDU C;  5LRR A;  1G3S A;  1OR7 A;  2ZO4 A;  2K27 A;  1YW7 A;  5LEJ A;  2VC1 A;  2C6Y A;  3E97 A;  4B09 A;  2A5Y B;  1R5H A;  2P5V A;  1O7F A;  4KDP A;  4RB2 C;  5F64 A;  4L5I A;  3HRT A;  1SFX A;  2YPR A;  1BBY A;  4I98 B;  3J80 K;  3T5X A;  1L0O C;  3Q5F A;  4ESJ A;  4WWC A;  1R36 A;  4MQ9 F;  3SHF A;  2STW A;  2RC4 A;  5ILS A;  4A5M A;  3GLX A;  2V79 A;  5JVT A;  2QUF A;  4RGS A;  3E6D A;  1BOA A;  4WX9 A;  3GFJ A;  3TQN A;  3T8R A;  4EMS A;  2CWE A;  1F1Z A;  3WTU C;  3DEU A;  1U2W A;  1GVJ A;  4UVB A;  3DF8 A;  3IKV A;  2XAJ A;  1ON2 A;  4LG0 B;  3CUQ A;  4ZZD A;  1FSH A;  2HQR A;  5E1W A;  3SZP A;  1FT9 A;  4YII A;  2PLY A;  2OQR A;  2O0Y A;  1LNW A;  2V9V A;  4HLY A;  3LWF A;  2MBF A;  1IXS B;  1RUN A;  1RZ4 A;  2NNN A;  4HYE A;  1ZN2 A;  4NQW A;  2F5D A;  3R0J A;  3QRF F;  3KCC A;  2XAH A;  1H0M A;  2XVC A;  3NEU A;  1U3E M;  4ZYH A;  3HTS B;  1B59 A;  4IRI A;  2GXB A;  4U7D A;  4LLN A;  3F8B A;  1C0W A;  3H92 A;  4I7H A;  2HR3 A;  1S29 A;  3PQJ A;  2XIG A;  3R6S A;  3ROU A;  1FLI A;  1XCV A;  3DFG A;  5FD5 A;  5KK1 A;  4CYD A;  3C1D A;  2G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...