3WU0A

Crystal structure of phosphorylated ets-1 dna binding and autoinhibitory domains (276-441)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein C-ets-1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu0A00
4IJAA 4MEYF 1QNTA 1D8JA 3WTUC 2EFQA 3D5LA 2A6HF 1XGOA 2BGCA 1IN6A 3ZN1A 1DP7P 5DYMA 3TGNA 4ESFA 2QVOA 4ZYHA 1LDJA 1YLFA 1FNNA 5KK1A 5E18F 5L3EA 3HTSB 5LHGA 5L3DA 5IT9K 2VODA 4BQAA 5FLXK 2IW5A 2EA4A 2DQLA 3I53A 4UVAA 4L5IA 4UHTA 2MC3A 2AXLA 3WODF 2XAQA 2KIUA 3M8FA 1YFHA 2VONA 2W84A 1U5TC 2HQNA 3DF8A 3COAC 4UVBA 4Q4ZF 4BAYA 2GAUA 1YO5C 3F23A 5CVRA 4A12A 1E17A 1W5TA 4EJOA 2DTRA 3P7NA 4XBFA 2VC0A 5D5XB 4RB0A 5ICFA 4WF2A 4FHTA 1HKQA 1Z1DA 4KIGA 2K86A 2IA2A 4IHTA 2BV6A 3QAHA 1D3YA 4PCQA 3IC7A 3VB2A 4L9TA 2LDUA 5D4RA 1LVAA 2A6EF 2P7CB 1FBQA 1O3TA 4M6YA 1G3YA 5J8FA 2OBPA 1XSVA 2OAZA 2PJPA 2DLLA 5AIPA 5K1YA 2HFHA 4ZYGA 4S04A 3K9TA 3WTVC 4HF2A 1V3FA 2GA2A 2XRNA 1XGMA 2XROA 1T38A 1IN5A 2YPRA 1QZZA 4O6JA 4N0BA 5KVRA 1FP1D 3KP6A 5D8LB 3MQ0A 2AS5F 3BWGA 3KLOA 4N9IA 3QRFF 2DAOA 3BZ6A 1FLIA 4HQEA 4M72A 3B02A 1IN7A 3ZMTA 2NRAC 2XHKA 2YSRA 3SZTA 1WI9A 3VOEA 3EYIA 3ML6A 4CYDA 3EETA 4XLPF 2E7XA 2GQQA 1Q1HA 1GVJA 2FNAA 1O7FA 3IHUA 3J81K 1KQ8A 2L54A 3RPUA 3GFLA 2P6TA 4OOIA 2YR2A 4EJTA 3HOSA 4OIRF 4UUVA 1ZLJA 2ZXJA 2XAHA 2P5VA 2RQPA 3ZPLA 2R7DA 1U78A 5FB2A 2XGXA 5CVVA 4A2UA 3ECOA 4WXHA 2Q2EA 1UHMA 2K4BA 5H6QA 3BJAA 3TQNA 2PQ8A 2VC1A 1WSUA 1U5TA 4Q47A 4RB3C 3QU6A 4WK8F 1EH6A 1G6NA 3V7SA 3H3ZA 4EV0A 3DQVC 3FZVA 2Q8KA 4L18B 4LLLA 1REPC 4HX8A 1JE8A 3RJPA 5DCMA 4Q48A 4I7HA 2CG4A 4FX0A 1I27A 1TNSA 2A07F 1WQ2A 1GHCA 1LEAA 2MLKA 3ISPA 5HS8A 3K1MA 3W6JB 1WRJA 3HRMA 1XSXA 2FXAA 1KU7A 1J2XA 1Z05A 4HLYA 1XD7A 3TDZC 5K5OA 1RIOH 3QP6A 2GWRA 2DU9A 2EFNA 3GXOA 1BI0A 3M7GA 5LRRA 4L0ZB 1TNTA 3T5XA 3RYRA 2DPUA 4RGXA 5LEKA 4L0YB 1UB9A 1RUOA 4PZJA 1R00A 3ZP5A 2CQKA 2LNBA 4BH9A 3PQKA 1I1GA 3IRRA 1K79A 4ETSA 5TRDA 4RGRA 1SFXA 1T0FA 3HUGA 1ZG3A 4LLGF 2DO7A 5ILUA 3LA3A 2X4HA 1F4KA 1YYVA 3MZYA 2O3FA 4ESJA 4HW0A 1R5HA 1SD5A 3I0TA 2HYGD 4M9SA 1FWZA 1S29A 4WXCA 1H9TA 5E8IA 5D5WB 3Q5FA 3LAPA 2PLYA 4M73A 1LJ9A 2O61A 2EV0A 3SZPA 2A69F 5ICEA 3NRVA 1TQPA 2B0LA 2ZJ2A 4MHGA 4LK0F 4R79A 2OQGA 4A6EA 5ILVA 3Q9VA 2R7FA 1TQMA 5E17F 5DEQA 2DT5A 5HS7A 1S7OA 2V6CA 4RAYA 2FBHA 3SXYA 3FWEA 1QO0D 5D6FA 3LFKA 1KQ0A 4R1HA 4BHCA 5L3FA 1BC7C 1J5YA 1HXDA 2VBWA 4BNCA 1KU9A 2HS5A 5HLHA 2NYXA 4HYEA 3ZQ7A 3RPQA 1BIBA 1SD4A 4BYYA 1UFMA 3IWZA 4LMYA 1L0OC 1SAXA 2XAJA 4U7BA 2KJCA 2FEZA 2X0LA 4I09A 2OD5A 4HF0A 3CUQA 4CGZA 4IPAA 2M1BA 3QU3A 2ZFWA 1U6GA 1IXSB 4AIJA 2ZMEA 2H27A 2HEOA 3C3WA 3KFWX 3FM5A 2FMLA 5TJJA 1W7PB 2O6GE 4I02A 2QBYB 3BPXA 3V4GA 2HWVA 3ERED 2RVCA 1TW2A 3VODA 1B9MA 2CSOA 3ELKA 3IKTA 4LLNA 1IN4A 4Z2YA 4A0XA 1HW2A 2A3SA 2ISYA 2M8EA 2ZO4A 2IJLA 3EDPA 5A2QZ 3V8LA 3REOA 2E1NA 2ACJA 3QPHA 4ENMA 1XCBA 3D0SA 4GYIA 3JW4A 4M9ZA 1IRGA 4BXUA 2DFIA 4RS8A 4YG2F 2O03A 3DXJF 4A5MA 1IW7F 4KUMA 1LDKB 2JZYA 4A6DA 1MZBA 2KJBA 1HQCA 1YS7A 1YW7A 4G7OF 3KP7A 1SFUA 1OMIA 1F5TA 4LB5A 2C6YA 1KU2A 4YFXF 3LQQA 5E1ZB 1USSA 2CW0F 2FOKA 5E20A 1Y0UA 3PQJA 1YW8A 1FX7A 1FPQA 1T39A 3WTTC 5D5UB 5FGMA 1OPCA 1BI3A 1T2KA 3WU1B 1IXRC 1K78B 1QGPA 4AIHA 1R7JA 1B9NA 1KYZA 3JSPA 2RKHA 3V7CA 3OOPA 4LD5A 3CO6C 5DD4A 2XIGA 1YG2A 1MD0A 1O3QA 5BOXA 5A2QK 3J80Z 4OIQF 2LF8A 4LK1F 3HRTA 1MKMA 2MH9A 2RGVA 2F2EA 3BDDA 1SD7A 1UCRA 1FSEA 4HQMA 4O5VA 5F64A 1ZRCA 3RKWA 2CGPA 4O3MA 4RB1A 3HSEA 1LB2A 4ON0A 2FU4A 2QM3A 2WV0A 2XASA 1G4DA 3DP7A 4UVCA 4KIBA 5CJ9A 3PFIA 1HKTA 1V4RA 2CO5A 5BMZA 5H6RA 2IT0A 5ILSA 1K6OA 3LSTA 4M9XA 3FHZA 4ESBA 1XMKA 2EB7A 1B4AA 5DCFA 1XDSA 3JTHA 1DDNA 2L4AA 4HV5A 3WU0A 1XSDA 2G7HA 4IF4A 4U88A 2P7VB 4MNUA 4D0PA 2YX4A 3ULQB 3O2PE 4P9FA 1IXCA 4LJZF 3T0YA 4ENNA 3GEZA 2VBYA 3C7JA 1JGSA 1BJAA 5CLSA 4HOBA 3RTRA 2H94A 5HDNA 1YTYA 3R0AA 5HOOA 3K2ZA 3E5QA 2D1VA 5HLIA 2PFBA 3KETA 3QPTA 3E6MA 3L00A 3IL2A 4I2OA 2F5EA 1ONVA 1PP7U 1P6RA 2IVMA 3LAJA 2ADUA 1R23A 4XLNF 6PAXA 1U3EM 1W4MA 3I58A 5DUKA 3GWZA 3NQOA 2DI3A 1BI2A 2MA3A 2XV4S 3BP8A 1FZPB 1FBSA 3GFMA 3U2RA 3CTAA 2QENA 4KMUX 3RIRA 3P9CA 4ENKA 4N9HA 2F5DA 3I64A 4KIFA 1Z7UA 1SMTA 2IPQX 2UXNA 2EFOA 3ABTA 2HKOA 2PEXA 3I4PA 4NQWA 1IZ1A 1AWCA 3L09A 3R4KA 4P9UA 3GW2A 3MWMA 2QUFA 2W85A 1R5GA 4ZYDA 3HHHA 5ICGA 2VOPA 1G3TA 5LBQA 4A0YA 1IAWA 1RI7A 5L3GA 2FBIA 2J5PA 1O7LA 1XDUA 5J6XA 3B73A 2VT3A 5FFXA 1ODDA 2BYVE 4A0ZA 5K5QA 2PN6A 2Z3YA 1HBXG 2MD5A 2RV8A 4AIKA 4KN4X 5LHIA 3JTGA 3P9KA 1G3WA 2DBBA 4UV9A 1ON2A 1RUNA 4GCVA 4IRIA 2F5FA 3ROUA 5JR3A 3BJ6A 4FT8A 4G8XA 1U5TB 4LG0A 2L3DA 2OU2A 5LLQA 2VOOA 4ZYEA 3T1BA 3K69A 4HF1A 2ISZA 3FX3A 4MQVA 1DUXC 1BN5A 2Y48A 2GXBA 1FSHA 1J75A 3AAFA 3CO7C 4OIOF 2R3SA 4U7DA 5D6EA 2G9WA 4ZZLA 5DCMB 2NNYA 3S2WA 1TTYA 1D8KA 1PP8F 2P5KA 5JI6A 1ZGJA 1ZYRF 3CJNA 1R1UA 1NHAA 3C1DA 3I71A 2JT1A 3EQLF 5CVUA 1WWXA 1BM9A 1K7AA 1Z6TA 3I59A 3DFGA 4B8XA 3HRSA 4ZH4F 2JSCA 2OA4A 2WC2A 4OIPF 3HRUA 4YFKF 2IA1A 1QBJA 5EEHA 4H0EA 5E1XA 4L9JA 2QYOA 2NAZA 4KT5C 1HSTA 2UZKA 3MCZA 3E97A 1FOKA 4NB5A 5ERIA 3ZMSA 5ED4A 3WGGA 5CVJA 4EVIA 3WTXC 2A68F 2A5YB 2QWWA 3G3ZA 4S05A 4IRGA 1ZHFA 1HW5A 3IKVA 2XKPA 5AIQA 4G9YA 3WTWC 3MFKA 2V1UA 2UWMA 1W7PD 2DK5A 1ZREA 2GA1A 5BPIA 2A61A 2K4JA 2OZ6A 4XSXF 1YIOA 3RDIA 2G7UA 4IRHA 4HDVA 1Z9CA 1P4WA 5JVTA 1XN7A 3WGIA 1S8NA 1XCVA 3GO5A 4QLCU 3EUHA 4ENJA 4Q5SF 4UNOA 1CF7B 4ASNA 3GZ6A 1I5ZA 1YS6A 1FP2A 1FC3A 2OZUA 4LFUA 5FFZA 4RB2C 1WKMA 3H3UA 4EGZA 3F6VA 2EV6A 2L02A 1MDMA 1Z6RA 2V1XA 4GXOA 4RGUA 3FMRA 5JFRA 3WTSC 2Z33A 1E2XA 5LHHA 1FT9A 1FY7A 5DUIA 2LF7A 3MZHA 1ZG5A 4DNCA 4EM1A 2GZWA 3CUQB 2MLGA 3TO7A 2BE5F 3GUDA 4OU0A 4EMSA 1OYWA 2ZMEB 4I01A 2HYFA 5AONA 5D8KB 3HHGA 1HSJA 4U0VA 3CLOA 4KNYA 4IHSA 2L01A 4OMZA 2PMUA 2LKPA 5IT9Z 2O0YA 5HVQC 4JBAA 1IRFA 2DQRA 2TDXA 4GO1A 3TO6A 3R60A 3ZMZA 3QP5A 2KKOA 1BC8C 3MAJA 1PUEE 5BS6A 4GGGA 3ZMVA 2MBFA 4KFCA 2DK8A 4L9NA 3C18A 1S6LA 1D5VA 5BPDA 4K2EA 3F3XA 5HDGA 2K02A 4LGWA 1ZARA 4OMYA 4JK1X 4MQ9F 1ZGAA 4UV8A 2YU3A 2QZ8A 5K5RA 1H0MA 4HA8A 3JAMZ 4I0BA 2Q0OA 4XSZF 3KE2A 2FNPA 2PBIA 1U8RA 2COMA 1JHFA 4RGSA 3CUOA 4EGYA 3F8NA 1USTA 3WE2A 2H6BA 1KGSA 3FXUA 3N97A 2W57A 2OQRA 1S3JA 2XKOA 1JXSA 3BJOA 1OKRA 2PMHA 3FXQA 1R36A 1RNLA 1AOYA 5F1RA 1ZH5A 3LQRA 2L4MA 3KZZA 2DPDA 3M1EA 1KA8A 3E5UA 4IVNA 1FYKA 4B09A 1T6SA 1J7KA 3WGHA 2UXXA 1LQ1A 1J9IA 4HX7A 5FO5A 3FMSA 3ECHA 3F8FA 1QQIA 4CXFA 1XB4A 3O3KA 2P6SA 3FXRA 2Y75A 2EJRA 2O8XA 2W25A 3FF5A 4M74A 3M9AA 2V1DA 5LGTA 1KU3A 4EM2A 5IT3A 4UXNA 2M30A 4EJUA 5FD6A 5H20A 1T98A 3TO9A 1EH8A 2K27A 1DPUA 1PDNC 4MEXF 2H09A 2RDPA 2Z9OA 5CVIA 3J81Z 3T8RA 4CICA 3JAMK 5HS9A 3F8CA 2HR3A 1I1SA 1FBUA 1G3SA 3HSFA 4JQFA 3V7RA 4RAZA 2M87A 5LRSA 2HDCA 1ULYA 2FA5A 2V9VA 2Z99A 1Z91A 2KRFA 5L3CA 3I5UA 2EFWA 3TDUC 2QQBA 3WTZA 1ZLKA 1JHHA 3KZYA 1P4AA 2FBKA 1ZRDA 1C0WA 3TOAA 4CZZA 2ZCWA 1X3UA 2YX7A 4HBLA 3J80K 2W24A 1SD6A 3KP5A 4Y17A 2H6CA 5E8GA 2ZNZA 3E6DA 1YW9A 1O3SA 3FM3A 4AD9A 4AVPA 2JTVA 1B1BA 1TLHB 2ESNA 5LGUA 4HAMA 4EM0B 1ZN2A 4WWCA 3HOTA 2Y0MA 3K0LA 2JPBA 3SHFA 1BIAA 2RC4A 3HIFA 3GX4X 2FQ3A 2HGCA 2EK5A 5CYVA 2BEOA 3O6BB 4MGRA 2J5OA 3DPTA 3LA2A 2JRTA 2EWNA 4G94A 4WXDA 2EV5A 3K1NA 3JSOA 4P5OA 3V8JA 4U0YA 4E70A 1KQ9A 3KP4A 2FE3A 3E6BA 2ZKZA 2D45A 3G73A 1HW1A 2CFXA 3HTUA 4L9VA 4G6DA 2RNJA 2XVCA 3KCCA 3VFZA 2ETHA 1IN8A 3BPVA 1MJ9A 2VXZA 3T8TA 1GXQA 2P4WA 2FMYA 1YQAA 1KYWA 3F8MA 2BBYA 1OR7A 5ICCA 1LDDA 1F9NA 4G7HF 1IUYA 3CUQC 2XAGA 1SFEA 3Q9SA 3R6SA 4P96A 3BROA 3IWFA 3LA7A 2P8TA 2ZNYA 1ON1A 1MJAA 2E7WA 2PG4A 5FD5A 1TBXA 1SMYF 4F7ZA 1R22A 4BHPA 3DPLC 4OINF 3L7WA 1ZAOA 1BBYA 4I0AA 4Y15A 4U0WA 2FSWA 3OV8A 1R58A 2XUBA 5DDGA 5EEGA 1S7AA 1R1TA 3GF2A 3KEQA 1FYMA 4KMFA 2QQ9A 4NHJA 1RZ4A 2FRHA 4EJWA 2MH2A 4YFNF 1H9GA 3ZMDA 1P2FA 2VE8A 3KEOA 3KP2A 4LG0B 2F5CA 1B59A 3TOBA 1EH7A 3MEXA 2HTSA 4I98B 2HKXA 3SQNA 1O3RA 4EQQA 1QPMA 2KIMA 2HTJA 1L3LA 2QLZA 2WTEA 1IF1A 3DKWA 4HZFA 2K7LA 1XMAA 2EFPA 4MTEA 1I6XA 4KA4A 2ZBKA 2STTA 3EYYA 4XRFA 1OYYA 2E1CA 2HOEA 2ESHA 3F21A 4P55A 2QQAA 3I59B 1TW3A 2M5WA 1XGSA 4LB6B 3TKYA 4HLXA 2VE9A 2GIVA 4A5NA 2JPCA 2IRFG 4HX4A 2HZTA 3GFJA 1FYLA 5LGNA 2VBZA 3GFIA 3NEUA 3BOQA 3WTYC 3P9IA 3F72A 3WG9A 1CF7A 2M45A 3GZ5A 4G6QA 4L5JA 5DD8A 5D5VB 3KLNA 4M6XA 3IRQA 4IXAA 3FMQA 1XGNA 3VEPA 3ZN0A 3J7AO 4HV6A 1W5SA 2XAFA 3ZMUA 2D2WA 3DV8A 3GLXA 3LWFA 3QOPA 4YIIA 3RYPA 1W7PA 2NNNA 1HKSA 1U2WA 3GYHX 2QBYA 2IA0A 3E6CC 5LEJA 5DV5A 4KICA 3F6OA 4GYGA 3RKYA 3E5XA 3L9FA 1P4XA 2STWA 5HDKA 3F8BA 3ABUA 1B6AA 3CDHA 2DW4A 4ZZDA 2CYYA 3U1DA 4G7ZF 5D4SA 2FF4A 1J59A 1QZYA 4AWXB 2PI0A 3BY6A 1UHWA 3E3VA 4MTDA 4WX9A 1DPRA 2KIFA 4KDPA 3GVAA 3I54A 3U9GA 3HYIA 3WE3A 4TV7A 2RN7A 4BHBA 1MJBA 3R0JA 4HDUA 1MDMB 5E1WA 5J8CA 4Y13A 4M71A 4R8HA 5BQTA 5L3BA 2GXGA 3DEUA 4YIFA 5FLXZ 1BI1A 1OYIA 1EV7A 2P5LC 1P92A 4CDGA 1VTNC 4PDKA 2EA2A 1R1VA 3RKXA 2IP2A 2VBXA 1ZG1A 3SFZA 1GXPA 3N4MA 1LEBA 2D1HA 4WCGA 1F1ZA 2HQRA 4KYWA 1BOAA 4CHUA 1STZA 3L2CA 2V79A 4DQ2A 4QWQA 4CO8A 1CGPA 3M8EA 1A04A 3F22A 5HLGA 2LSOA 2WWYA 4PGHA 1K78A 4EJVA 2Z5UA 1TQIA 1ZRFA 1O57A 1LNWA 2ELHA 3R61A 5F6FA 4KN7X 4PGGA 3W6KB 3RI4A 2CWEA 2VT2A 5JHUA 1J0RA 3V8KA 2VN2A 1MGTA 3KP3A 3HSRA 3H92A 2NS0A 4FX4A 3K1PA
chains in the Genus database with same CATH superfamily
4IJAA 1RKTA 4MEYF 1QNTA 4XLHA 2QEXI 1I3AA 3BTCA 3SEZA 1D8JA 3WTUC 2EFQA 3D5LA 2A6HF 1XGOA 2BGCA 3OYCA 1IN6A 3ZN1A 1JT0A 4IOAF 1DP7P 3CMAI 2EH3A 5DYMA 3TGNA 4ESFA 2QVOA 4ZYHA 1LDJA 1D1BA 1YLFA 1UHSA 1FNNA 5KK1A 5E18F 5L3EA 1Q1VA 3CP2A 4PJJA 3HTSB 5LHGA 1J09A 4PJLA 2WAFA 5L3DA 5IT9K 2VODA 2IBDA 4BQAA 5FLXK 3ZQCA 2IW5A 2VPLA 2EA4A 2DQLA 1EJ9A 3I53A 2MYSA 1YX5A 3CESA 3HXLA 5M3FJ 1D1CA 4UVAA 4L5IA 2M9HA 4UHTA 1XC5A 2BVMA 2MC3A 2AXLA 4BEHB 3JRAA 3WODF 1HCRA 2XAQA 2KIUA 3M8FA 2AQFA 1YFHA 2VONA 4C3IJ 1X19A 2W84A 1TC3C 1U5TC 3BQZA 3AFHA 2HQNA 3DF8A 3COAC 4YIRX 4F91B 4UVBA 4Q4ZF 4BAYA 2LRDA 5E79C 2GAUA 2EILH 4E7HA 1YO5C 5LFAA 3F23A 4BY7J 5CVRA 4A12A 2EINH 1E17A 1W5TA 2V26A 3RZOJ 4EJOA 1JJ6C 2DTRA 4Y3OA 1QA6A 3P7NA 4XBFA 1H8AC 2VC0A 5D5XB 4PJMA 4RB0A 1OCTC 2EZHA 5ICFA 4WF2A 2LBFA 4FHTA 1HKQA 1Z1DA 4KIGA 2JA2A 3ABMH 2K86A 3DTIA 1MNEA 2IA2A 2R7QA 4IHTA 2BV6A 3A4CA 4XR6A 5J1RA 2LD5A 4F93B 3QAHA 1D3YA 2L9RA 4PCQA 3IC7A 3OL4A 3VB2A 4KISA 4L9TA 2WAEA 2LDUA 5D4RA 1LVAA 3MKYB 2A6EF 2P7CB 1MBJA 1MMNA 5FJ8J 1FBQA 2DOEA 1O3TA 4M6YA 1G3YA 2E2JJ 3S1QJ 5J8FA 2OBPA 1XSVA 2OAZA 1VQ4I 2PJPA 2DLLA 4D1QA 3HEFA 5AIPA 4FE4A 3BT9A 5K1YA 2HFHA 4IHWA 2QKLB 1D0YA 4ZYGA 1OFCX 4S04A 3H9GA 2DFHA 3K9TA 3WTVC 4HF2A 4E4HA 3H0GJ 1V3FA 5F1JA 2GA2A 2XRNA 4XLEA 2KPMA 2QSGX 1XGMA 2XROA 2GIZA 1T38A 3FBNB 1IN5A 2YPRA 1QZZA 4O6JA 2FJ1A 4XLAA 4N0BA 3H35A 3LSRA 1ETQA 5KVRA 1FP1D 1RR7A 2P81A 3KP6A 4W1UA 4D5FA 4ABZA 5D8LB 3K4MA 3MQ0A 3HB9A 2AS5F 3BWGA 1AKHB 1IG7A 3G4SI 1JUMA 3G2BA 3KLOA 5LD2C 1X4PA 3A1YA 2A5WA 2CV0A 2RQQA 4N9IA 1N77A 3QRFF 2DAOA 3BZ6A 1FLIA 3DBHB 2CW7A 4HQEA 2BVLA 3HOVJ 3SDGA 4V19K 4M72A 5FKLA 3A03A 3B02A 1K4TA 1IN7A 4EATA 3CCJI 1IRZA 2DJIA 2XPVA 3ZMTA 1OCCH 1HA8A 2NRAC 3ONQA 3M8JA 2XHKA 3JRIA 4B43A 2YSRA 3SZTA 3G1OA 4BQOA 1RESA 3OY9A 2COBA 2HVQA 1WI9A 3VOEA 4HEA2 3JREA 3CJQB 3EYIA 4ZDLA 2KDZA 1MBHA 4XOTA 3NARA 2ZJPF 1W36C 3CC7I 3ML6A 3JR9A 4CYDA 3EETA 4XLPF 4C9YA 3FKIJ 2E7XA 3JRGA 2GQQA 5KNLA 1Q1HA 1GVJA 2VL8A 5IYCJ 2FNAA 1O7FA 3DBRB 3IHUA 3OYMA 2JA5J 3J81K 1KQ8A 1PYVA 2B7EA 2RAEA 3OIQA 2QGUA 2L54A 3RPUA 3FDYA 3P5JA 2H8WA 2L9VA 2IGOA 3GFLA 3QYBA 2P6TA 4OOIA 2YR2A 4EJTA 2WB1A 3HOSA 2IXSA 2WBMA 4UB6C 5K7FA 4OIRF 5F0HA 5EEAA 3CCVI 4UUVA 1ZLJA 1O4XA 2ZXJA 5IYBJ 2XAHA 2WAQA 3GTGJ 2X6YA 2GBYA 1B72A 4F52A 2P5VA 3HJEA 2RQPA 3ZPLA 4QTRA 2HU9A 1B8IA 2R7DA 3DCFA 5FB2A 1U78A 2XGXA 1CQTA 5CVVA 3AG2H 3DU5A 1VQ7I 4A2UA 4F3QA 1R49A 3ECOA 4WXHA 4PJNA 2Q2EA 2L7KA 1UHMA 2K4BA 3EUHC 1I39A 3ZOBA 2V7FA 5H6QA 5TGTA 3PUFA 3BJAA 2XDVA 2EZIA 3TQNA 1MBFA 2PQ8A 2VC1A 1DQUA 4RBOA 1U5TA 4Z6YA 1WSUA 4Q47A 2XSJC 1MNMC 3OMYA 4RB3C 3QU6A 3CMMA 4WK8F 1EH6A 1G6NA 3V7SA 3GTPJ 4HNVA 1WH7A 1E0EA 3H3ZA 5B66C 4EV0A 3DQVC 3FXKA 2DFFA 3FZVA 1WJ5A 2IS6A 2EQRA 2Q8KA 1SFOJ 4A3DJ 3VSKA 1FTZA 4L18B 4A69C 4LLLA 3CCMI 1OISA 3FXLA 3GBGA 1REPC 1JUSA 4HX8A 1JE8A 2B63J 3RJPA 1JTXA 5DCMA 4Q48A 4I7HA 2CG4A 4FX0A 1I27A 1TNSA 4XONA 2A07F 1WQ2A 1GHCA 4DZJA 2WY7Q 1LEAA 1QU3A 2MLKA 3ISPA 5HS8A 1IC8A 3AG1H 3K1MA 2R93J 3W6JB 1WRJA 3HRMA 1XSXA 4B4CA 2FXAA 1KU7A 1J2XA 2ID3A 1Z05A 4HLYA 2CQXA 1XD7A 2FOWA 3TDZC 4NC6A 4AVZA 5K5OA 1RIOH 2VKHA 3QP6A 2GWRA 1SVOA 2DU9A 2EFNA 2QCOA 3GXOA 1UAAA 4AIDA 1BI0A 3M7GA 5LRRA 4IX7A 4XICA 4L0ZB 2Z2SB 2HVRA 1TNTA 3T5XA 3AL0C 1GT0C 3HC7A 3RYRA 2VQLA 4RGXA 5LEKA 5B3SH 2DPUA 4L0YB 1UB9A 1IGNA 1RUOA 2ECCA 4QPQA 3OYJA 4J01A 4PZJA 1R00A 1JKQC 4CZCA 2W48A 3ZP5A 2CQKA 2DA3A 2LNBA 3BR2A 4BH9A 2FX0A 3OYDA 3PQKA 1I1GA 3IRRA 3U21A 1K79A 2NVQJ 4ETSA 5TRDA 4RGRA 1SFXA 1T0FA 4CA0A 4XNFA 4PJ0C 1QHHD 2VI6A 3HUGA 5EG0B 2JA7J 3OL3A 2R7TA 5IY5H 1ZG3A 3SEQA 3VWBA 5EDNA 4BJ6C 2XAUA 3ZQGA 4LLGF 1D1AA 1X1DA 2DO7A 5ILUA 3LA3A 4FASD 2X4HA 1F4KA 1YYVA 2DFEA 3DTEA 2YS9A 3VDXA 1JJ8C 3MZYA 2O3FA 3OYEA 1V55H 3EPZA 4ESJA 4HW0A 1VQLI 1R5HA 1SD5A 3I0TA 2HYGD 4M9SA 3S16J 1IO2A 2CJJA 2CV2A 1FWZA 1S29A 4WXCA 1YRNA 1H9TA 5E8IA 2DJNA 4FCYA 5D5WB 3Q5FA 2LK2A 3LAPA 2PLYA 2Y9YA 4M73A 4JX4A 1LJ9A 2O61A 2EV0A 3SZPA 1R4MB 2R5YB 3HOYJ 2A69F 5ICEA 3NRVA 1TQPA 2B0LA 3ZQIA 2ZJ2A 2HYJA 4MHGA 4LK0F 1ETXA 2M0CA 4R79A 2R5ZA 2OQGA 1ORKA 1ITYA 3RZDJ 1WGXA 4ZYAA 3LMMA 3SYTA 4A6EA 5ILVA 3HG9A 3VSLA 3Q9VA 2R7FA 3MZ8A 1TQMA 5E17F 3K1PA 1JI8A 5DEQA 3O8HA 2DT5A 3IUOA 1XG1A 5TISC 5HS7A 4E7LA 1S7OA 2V6CA 2W7NA 4XN3A 4RAYA 1P7JA 1V5EA 2E1MB 5IOYA 2FBHA 1PVEA 3SXYA 1VI0A 4I6ZA 1VQMI 3SZGA 2L5QA 3FWEA 3GTQJ 1QO0D 5D6FA 3LFKA 1KQ0A 2ZC2A 4R1HA 3G1LA 4BHCA 4BE1A 4V2FA 5M5WJ 1U9OA 5L3FA 1NG7A 4ZJZA 1BC7C 3KZIC 2E34A 1HC8A 4NUBA 1J5YA 1HXDA 1WFXA 2VBWA 5GPAA 4BNCA 1KU9A 2LR8A 2PX9A 3A0HC 2HS5A 1XTAA 5HLHA 2NYXA 4HYEA 3ZQ7A 3RPQA 4CYCA 1BIBA 1SD4A 2CH0A 2K5CA 1TWAJ 3TEDA 4BYYA 1UFMA 2DOAA 1Y1WJ 3IWZA 2XPWA 4LMYA 5DTDA 2GLOA 1L0OC 1V5GA 1SAXA 2XAJA 4YRVA 4U7BA 2KJCA 5CKTA 2XGEA 2KISA 1SAUA 2FEZA 3FBIB 5CQGA 2X0LA 2XPUA 4JX6A 2OD5A 4I09A 4I76A 5KAFC 4HF0A 3CUQA 4CGZA 2F5VA 2D5VA 4IPAA 1QHGA 4D7MA 2M1BA 2ME6A 3QU3A 2PJRB 2ZFWA 1U6GA 1IXSB 2GOMA 4AUXA 2JJ7A 3V42A 5HNHA 4AIJA 2ZMEA 4MFEA 2H27A 2LMDA 3FXJA 2HEOA 3PIPF 3C3WA 4C30A 1BOBA 4MIMA 3KFWX 3FM5A 1Z0XA 2FMLA 3VPRA 5TJJA 1QRYA 1W7PB 1WH5A 2CUJA 3ERMA 2O6GE 1Y39A 4I02A 2CW8A 3OS2A 2QBYB 3BR6A 4II3A 3BPXA 2V9KA 3V4GA 3OSGA 2HWVA 3ERED 2RVCA 4XK4A 2PMZN 3TL4X 1TW2A 3VODA 1WJEA 1B9MA 3DKYA 4BS9A 1ACIA 4CCKA 1MMGA 2BW3B 2CSOA 2HNHA 4B1RA 3ELKA 3IKTA 1FOXA 4FE7A 4LLNA 5KAIC 1IN4A 4Z2YA 3DPUA 4A0XA 3LSMA 3JRHA 3S3NA 2A3SA 3OYHA 1HW2A 2ISYA 2M8EA 1TP4A 2ZO4A 1Z77A 2IJLA 2E5ZA 3EDPA 5A2QZ 4NBQA 1SANA 3V8LA 4CCJA 3AG4H 3REOA 2E1NA 2ACJA 5F27A 3KYLA 3QPHA 4ENMA 2GXAA 3A01B 1XCBA 2P0WA 2DCEA 2BHZA 3D0SA 4M3EA 2BY3A 4GYIA 3JW4A 4M9ZA 1IRGA 4BXUA 1GV5A 2DFIA 4RS8A 4YG2F 2NOJB 4RAFA 3S1NJ 2O03A 2MG4A 3DXJF 4V2GA 3LFUA 5F0FA 4A5MA 2F48A 3OYIA 3BR3A 1IW7F 4KUMA 1LDKB 2JZYA 4A6DA 4B3AA 3A02A 4M3DA 2O9LA 1MZBA 2KJBA 1YI2I 1HQCA 1YS7A 1UJ8A 1YW7A 4G7OF 3KP7A 2TCTA 1OQYA 2VJJA 3ZCOA 2E5NA 2F4OB 1SFUA 2JMWA 1OMIA 4DYRA 1F5TA 2JSPA 4LB5A 2C6YA 1KU2A 4IHYA 2JRMA 4YFXF 3LQQA 1YIJI 3GTLJ 1K6YA 5E1ZB 3ESWB 1ZQ3P 2NVTJ 2A6TA 1A36A 4CH7A 4AYBN 1USSA 2CW0F 3CDLA 2FOKA 1X2NA 3K4CA 3PUBA 5E20A 4ZC3A 2HQAA 1Y0UA 3PQJA 3ZR8X 1YW8A 1FX7A 1DGWY 4BKXA 2M3AA 2BY0A 2OUMA 3HKZN 1FPQA 1T39A 1ETKA 1BJZA 4CCNA 1MMSA 3WTTC 1VQ5I 2AHQA 5D5UB 2KZGA 4A3JJ 3KX2A 5FGMA 1OPCA 2I10A 1BI3A 2WY8Q 1T2KA 3WU1B 1IXRC 1K78B 4BXXJ 1QGPA 2ZXHA 4AIHA 4DYQA 2XC7A 1R7JA 1B9NA 1KYZA 2DA1A 3JSPA 2RKHA 3V7CA 3OOPA 5GAHJ 4N4NB 4LD5A 5KCMA 3CO6C 1LE8B 1QVTA 2GOXB 3CC4I 5DD4A 2XIGA 2F6CA 1YG2A 1MD0A 1MH4A 1I3QJ 5CQEA 4ANJA 3DBLB 1O3QA 2EBIA 5BOXA 5A2QK 2JVHA 3J80Z 4XKBA 4OIQF 2LFBA 2LF8A 4LK1F 3HRTA 1MKMA 2MH9A 2RGVA 3BDDA 2F2EA 5M5XJ 5BNGA 1YJWI 3FXMA 3CCLI 1SD7A 1UCRA 1FSEA 4HQMA 4O5VA 5F64A 1ZRCA 3RKWA 1Y8RB 2EIMH 1WCMJ 3OR1C 2CGPA 4BJ5C 4O3MA 2DMQA 4RB1A 4RA2A 3OYAA 1X3ZB 3ASNH 3HSEA 3CJRB 2LKSA 1X3WB 4ON0A 1LB2A 2FU4A 2QM3A 3I9V2 2WV0A 1OR7C 2XASA 1G4DA 3DP7A 2QA4I 4UVCA 1ERDA 1SVMA 3OS0A 4KIBA 1RPWA 5GAGJ 5CJ9A 1H89C 2ZSIB 3PFIA 1HKTA 3GTMJ 1V4RA 2CO5A 3CF5F 5BMZA 5FRMA 1UMQA 4C2MJ 1W0UA 2KT0A 5H6RA 2IT0A 5ILSA 2K9QA 2K9SA 3L2UA 5EYRA 1K6OA 4E7ZA 1X1AA 2CUEA 3BR0A 1NK2P 2X1CA 2DXIA 3LSTA 4M9XA 3FHZA 4ESBA 2E2HJ 2Q1ZB 1ZK8A 1XMKA 1BW6A 2EB7A 1I6HJ 1VF9A 1B4AA 1FIAA 2L9NA 5DCFA 2NOGA 3B6CA 2IEKA 1XDSA 3JTHA 1DDNA 3JCUC 3QWLA 1TWCJ 2L4AA 2O7OA 4HV5A 4RAGA 2KHMA 3WU0A 1XSDA 2G7HA 2X9DA 2Y2ZA 1DP3A 4IF4A 4U88A 2P7VB 2W1OA 4MNUA 3CDIA 4IQ4A 3W3CA 5EGOA 3NWTA 4D0PA 3VYUB 2YX4A 3LNQA 4OWRB 1R4NB 3ULQB 3PNYA 3S3MA 3O2PE 2O8KA 4CCMA 4P9FA 1IXCA 4LJZF 3QQAA 3T0YA 3OYFA 4XRSG 4ENNA 3C2GA 1N25A 1T08B 4Y7NJ 5M5YJ 3GEZA 4QIWN 3K4NA 2VBYA 3C7JA 3M07A 3CCQI 1JGSA 2OTLI 1BJAA 5CLSA 4HOBA 4J19A 1MIJA 1XPXA 1K83J 1X4OA 3RTRA 2H94A 5HDNA 1YTYA 3CP8A 4IZZA 3R0AA 5HOOA 3IV5A 3K2ZA 3E5QA 2D1VA 5HLIA 2PFBA 4A3FJ 3KETA 3QPTA 3E6MA 2CUFA 3L00A 4J00A 1P9QC 3S8PA 3IL2A 4I2OA 2AXTC 4M6VA 2R0QC 2F5EA 2OC6A 4E6KG 4GRIA 5FKMA 1ONVA 3I4MJ 1PP7U 1P6RA 2IVMA 3OYGA 3LAJA 2RNGA 2ADUA 5EZHA 2K40A 1X1PA 1TWFJ 3RPUD 3S14J 1R23A 4XLNF 3C2BA 3VYRB 6PAXA 2X85A 1U3EM 2LG4A 1W4MA 3I58A 5DUKA 3GWZA 2Y30A 2DI3A 3NQOA 4G6TB 1BI2A 3TW6A 2MA3A 2XV4S 3BP8A 2E1MC 1FZPB 1FBSA 1IV8A 4YELA 3GFMA 3U2RA 3CCRI 3CTAA 2OTJI 2QENA 4BBSJ 1S5LC 4KMUX 3DEEA 3RIRA 3P9CA 3OYLA 4BACA 1HLVA 4ENKA 4N9HA 3G71I 2F5DA 1VQNI 3I64A 4KIFA 1Z7UA 4A3CJ 1SMTA 2CQQA 2IPQX 2UXNA 3HL2A 2EFOA 1G59A 3ABTA 2HKOA 2KDOA 2PEXA 5E3NA 3I4PA 1Y56A 4A93J 4NQWA 1IZ1A 1AWCA 3L09A 2DOFA 3CQZJ 3R4KA 3QYEA 4P9UA 1MW7A 3GW2A 3MWMA 2M4KA 3FIWA 4A3BJ 1YE9A 2QUFA 2W85A 1R5GA 4NC7A 3HPGA 4ZYDA 3HHHA 5ICGA 2VOPA 1K61A 1VQKI 1G3TA 2L7FP 5LBQA 1E3OC 4A0YA 1IAWA 1RI7A 5L3GA 2V4JC 3NWSA 1LFBA 1I50J 2FBIA 3BG3A 2K9MA 2J5PA 3CD6I 1O7LA 2L7ZA 1XDUA 2XGCA 3EUKL 5J6XA 2R7RA 4OAYA 3B73A 3GCMA 1T33A 1EF4A 2VT3A 5FFXA 1JGGA 4DBRA 3MVPA 1ODDA 2BYVE 4U87A 4A0ZA 2YUSA 1MNDA 1MBEA 3DU6A 5K5QA 2PN6A 3I4NJ 2DMNA 2Z3YA 3BCAA 1YITI 1HBXG 2BY2A 1IDZA 2MD5A 2E35A 3H9QA 2RV8A 4AIKA 3BG7A 1B72B 3RSNA 2QSHX 4KN4X 2HDWA 4XQFA 5FKOA 4LIVA 3KYCB 3J7ZI 5LHIA 2IS2A 2HDDA 1T56A 3JTGA 2CS3A 1G3WA 2WADA 2QKMB 2DBBA 3P9KA 3K4BA 4M3GA 4W97A 1YHQI 1AHDP 2BZTA 4UV9A 3K70D 1ON2A 1RUNA 4GCVA 4IRIA 2F5FA 3ROUA 5JR3A 1G2HA 3BJ6A 4FT8A 5C4XJ 3ZXSA 2OV7A 2XB0X 4IHVA 4D9JA 1N75A 3OWTA 4G8XA 2XF5A 1U5TB 4LG0A 2L3DA 2OU2A 2LY1A 5LLQA 4XKCA 2VOOA 4ZYEA 4A3LJ 3T1BA 5C4JJ 1ETVA 3E1SA 3K69A 1ENHA 4HF1A 2ISZA 3FX3A 4MQVA 1DUXC 4NDLA 4RM3A 1X58A 4L5EA 1BN5A 2Y48A 3K10A 4HNTA 2GXBA 2LY9A 3QPSA 1WJFA 2M34A 1J75A 1FSHA 3SJMA 3AAFA 2MFZA 3CO7C 4OIOF 2R3SA 4U7DA 1TWHJ 5D6EA 2OF7A 2G9WA 1FJLA 2VQHA 2CQ7A 4ZZLA 5DCMB 2NNYA 1A6IA 3S2WA 1BA5A 2MD0A 5K7HA 2HXOA 1TTYA 1H88C 1D8KA 4DGWB 2P5KA 1PP8F 2Y31A 4XORA 5JI6A 1ZGJA 3H5AA 3L2VA 1RRJA 2OJED 2ZXWH 3RQIA 1PUFA 1ZYRF 3CJNA 1R1UA 1NHAA 3C1DA 3I71A 2JT1A 1SC7A 3EQLF 5CVUA 1WWXA 1MH3A 1BM9A 3CMEI 1K7AA 1Z6TA 3I59A 3IAS2 4KJZA 5F0CA 3DFGA 4B8XA 3FISA 3HRSA 4ZH4F 1JUPA 2JSCA 2OA4A 2E1OA 3H36A 1APLC 4RMNA 3OYNA 2WC2A 5J3LA 2XSDC 3HRUA 4OIPF 4YFKF 1GDTA 2IA1A 1QBJA 4F92B 5EEHA 1OJLA 4E7JA 3MMYB 4H0EA 3GTOJ 4UUTA 2M2EA 2MW8A 2X1EA 5E1XA 4L9JA 2R7SA 2QYOA 2K85A 1ETWA 2NAZA 5K7ZA 4GDFA 2ECBA 5FLMJ 1NH3A 3HUGB 1FIPA 2PMZA 3KIOA 3CCEI 4KT5C 1HSTA 1HDDC 1A6QA 3X2QH 2UZKA 3LSPA 3MCZA 3B6AA 3E97A 2BXZA 3HGYA 4II2A 1FMWA 1MMDA 3BLYA 4NB5A 1FOKA 5ERIA 3ZMSA 5ED4A 3WGGA 4UUSA 5CVJA 2JN6A 4EVIA 3WTXC 9ANTA 4ZTJA 4ZDPA 2LY2A 2A68F 4JYKA 4M3BA 2A5YB 1YX3A 2QWWA 3G3ZA 3ZQHA 4S05A 4IRGA 1ZHFA 1HW5A 3IKVA 3MD2A 2LC2A 2VXDA 4CCOA 2XKPA 4G9YA 5AIQA 3WTWC 3MFKA 2V1UA 2UWMA 1W7PD 2OCEA 2MGQA 2DK5A 2MSYA 1ZREA 2N8GA 2GA1A 2JA6J 4DW6A 5BPIA 2A61A 2K4JA 2OZ6A 4XSXF 1ZR2A 3D5RC 1YIOA 3RDIA 2G7UA 4IRHA 4CUGA 3ZQLA 2G0EA 2R5ZB 4HDVA 1Z9CA 2IS4A 1P4WA 2QF7A 1X2MA 5JVTA 4DYCA 2CFOA 1XN7A 3BQYA 5EJCA 1Z67A 5J47A 3WG7H 3WGIA 1S8NA 4RLQA 3FXOA 1W1WE 1XCVA 3GO5A 4QLCU 3EUHA 2DT6A 2VPRA 4ENJA 4Q5SF 4N4OB 4UNOA 4E7KA 1CF7B 3JRBA 4ASNA 2K3PA 1ZGWA 3GZ6A 1I5ZA 1YS6A 2M8GX 1FP2A 1FC3A 3QODA 1A5JA 2OZUA 5GTIC 4LFUA 3L2RA 5FFZA 2LVSA 4AYBA 4RB2C 1WKMA 3H3UA 4EGZA 1FMVA 3H5NA 3ZQFA 3F6VA 1TWGJ 2EV6A 2K3FA 4BY1J 3BZKA 3HZJA 1U8BA 2L02A 1MDMA 1Z6RA 2V1XA 4GXOA 4RGUA 3FMRA 5JFRA 4CYCB 3WTSC 2Z33A 5E3OA 1ZTRA 1E2XA 4H4KC 4RLFA 1RR8C 4LOCA 5LHHA 1FT9A 1FY7A 2XGDA 2IGNA 5DUIA 1HOMA 2LF7A 3ASOH 1UELB 4LITA 3MZHA 1ZG5A 1OLTA 2X6WA 3K7AJ 4DNCA 4EM1A 2GZWA 3PNTA 3CUQB 1F43A 1M1EB 2MLGA 3J7AY 1ZKGA 3TO7A 2BE5F 1TT0A 3GUDA 4PFOA 5FKKA 4OU0A 4EMSA 4XIDA 1OYWA 2ZMEB 4I01A 2HYFA 2L9SA 1FEXA 5AONA 5D8KB 3HHGA 1HSJA 5C3EJ 2V1NA 1FTTA 4U0VA 1A31A 2KZVA 3CLOA 4KNYA 5DM6F 4BDZA 4IHSA 2L01A 4OMZA 4B3XA 2PMUA 3W6VA 2LKPA 2H1KA 2BHYA 5IT9Z 1WJBA 1D0ZA 2O0YA 5HVQC 2BXYA 2KFDA 5EF6A 2M0MA 4JBAA 4PFPA 1IRFA 2DQRA 2TDXA 2V9PA 4GO1A 3TO6A 3R60A 2DDBA 4A3GJ 3ZMZA 3QP5A 2KKOA 1TZLA 5J4YA 2VLAA 4A3EJ 1BC8C 3MAJA 1PUEE 3HPHA 5BS6A 4GGGA 1JKRC 2ZJRF 3ZMVA 3JRDA 2MBFA 4XMYA 4KFCA 2DK8A 3LSHA 4L9NA 2V6EA 3C18A 2E19A 3BZCA 1S6LA 1D5VA 4HG2A 5BPDA 4K2EA 3F3XA 5HDGA 1BL0A 3HDDA 2KQRA 2K02A 4LGWA 1ZARA 4OMYA 1Z3YA 4JK1X 4MQ9F 1VFCA 1ZGAA 4UV8A 3F0CA 5E3LA 5J1UA 1UZCA 3DEWA 3K4KA 2YU3A 3H9JA 2QZ8A 1DU0A 3OOUA 1UG0A 5K5RA 1H0MA 4HA8A 3JAMZ 3ZQQA 4I0BA 2Q0OA 4XSZF 5HLTA 3KE2A 3PFYA 1LKXA 2FNPA 2PBIA 3UNGC 1U8RA 2COMA 1VQ9I 1JHFA 3BG9A 4ZDOA 2LTPA 4RGSA 1GV2A 3DWLE 3H0DA 1AU7A 1Y1VJ 3LSJA 1U0JA 4BQQA 2VJIA 3CUOA 3MKLA 4EGYA 2E71A 4FTHA 3F8NA 2YU9J 1USTA 4C3JJ 1IUFA 2H1LA 1Y8QB 3WE2A 1VQPI 2H6BA 3NAUA 1KGSA 3W2WA 1G8XA 2VUMJ 3GLLA 2IGKA 3FHNA 1YJNI 2R7ZJ 2ZB9A 3FXUA 3N97A 2W57A 2OQRA 1LE8A 3H5RA 4BU2A 1S3JA 2EZKA 2XKOA 1JXSA 3BJOA 1OKRA 2A05A 3ABKH 2PMHA 3FXQA 1R36A 3HOZJ 4IL6C 1BR2A 1RNLA 1AOYA 2DT7B 1TL8A 5F1RA 1ZH5A 3VYTB 2XRLA 2DTZA 3LQRA 2L4MA 3DLAA 4BEHA 3PNVA 3KZZA 2DPDA 2HOSA 3M1EA 1KA8A 3E5UA 2LLKA 4KITB 4IVNA 1FYKA 4B09A 1T6SA 2X51A 1J7KA 2VJ4A 3HOXJ 2KMUA 4FQGA 3QOEA 2UUZA 3KEYA 4F55A 3WGHA 2UXXA 3DTKA 4ZTFA 1T8IA 2ELJA 3BTIA 2KIQA 1JKPC 1HF0A 2ID6A 3Q3SA 2VKDA 1D5YA 2Z1DA 5IP6A 1LQ1A 4XKVA 1J9IA 4HX7A 1SEUA 2H8RA 5FO5A 2TRTA 3FMSA 2KRCA 3TP0A 3LSKA 1VQ6I 3ECHA 3F8FA 1VZ0A 1QQIA 4CXFA 1WJDA 1XB4A 2WA0A 2P6SA 3O3KA 3H3VK 2X6OA 3FXRA 2Y75A 2VIXA 3OYBA 3S1MJ 2EJRA 2O8XA 2W25A 3FF5A 3E7LA 2E60A 4M74A 4A3IJ 3M9AA 5F08A 3E0JB 2V1DA 5LGTA 1FOWA 1KU3A 5IYDJ 4EM2A 5IT3A 4UXNA 2M30A 4EJUA 5FD6A 5H20A 1T98A 3TO9A 2HOAA 1EH8A 2K27A 2VQGA 3OSFA 2Y0SN 2Y9ZA 1DPUA 1PDNC 4MEXF 3C2HA 2H09A 2RDPA 2Z9OA 5CVIA 2QQ8A 3K4JA 4HRIA 3J81Z 2VKEA 3T8RA 4CICA 4LIUA 4Y33A 3JAMK 1MSFC 5JHFA 4C2TA 3DKXA 4UB8C 3CF2A 4XLFA 4A3MJ 5HS9A 2NVUB 4AC0A 3OYKA 2B9SA 3N05A 3F8CA 1MBGA 1KONA 2HR3A 1I1SA 5IOZA 2DMTA 4PUSA 5DS9A 1FBUA 1G3SA 3HSFA 3WHBA 4JQFA 1DGRM 2JUCA 3SFIA 3V7RA 4RAZA 2M87A 2LBFB 3MKWB 2ZSHB 3UKGA 5LRSA 3GMEA 3ZRGA 4JP0A 5M3MJ 2HDCA 1ULYA 2FA5A 2V9VA 2Z99A 1Z91A 1AKHA 3Q0VA 3D5SC 1LFPA 2KRFA 1LUJB 3BR5A 5L3CA 3K70C 3I5UA 1VQ8I 2EFWA 3TDUC 2QQBA 3WTZA 2BY1A 1ZLKA 2F4IA 3S32A 1JHHA 3KZYA 1P4AA 2R7WA 1XX5A 2F4MB 2FBKA 4HSTA 1ZRDA 1C0WA 3BG5A 3L2QA 4DIQA 3TOAA 4S0HB 2R7UA 4CZZA 1YJ9I 1T0FC 1WVRA 2ZCWA 1X3UA 4BUPA 4IO9F 2YX7A 4HBLA 2JVGA 3D1NI 1QVUA 4E7SA 3HOUJ 1X1BA 3J80K 2W24A 4IQJA 1OCOH 3I3LA 2DYRH 3TP3A 1IJWC 1SD6A 3JRCA 5EGOB 1FOYA 3BC8A 3KP5A 4Y17A 2H6CA 5E8GA 2ZNZA 1JT6A 3E6DA 1BR1A 1YW9A 4XLCA 1O3SA 2ZFUA 3FM3A 4AD9A 5GP9A 4AVPA 3Q0UA 2CU7A 5IPAA 2JTVA 3U1KA 4X0GA 1B1BA 2DA4A 2HOTA 1TLHB 2ESNA 4FISA 4X1EA 5LGUA 4HAMA 3UR3C 3M3YJ 3HBLA 4EM0B 2HPMA 1ZN2A 4WWCA 3HOTA 2Y0MA 3K0LA 2JPBA 3SHFA 1BIAA 2RC4A 3HIFA 3IP4B 1ZELA 3GX4X 2JK3A 3KYDB 2GM4A 2FQ3A 2HGCA 2EK5A 4QSHA 5CYVA 2BEOA 3O6BB 4MGRA 2J5OA 2R7VA 5EZGA 3DPTA 2CQNA 3LA2A 1JKOC 2JRTA 2EWNA 3CMYA 4G94A 4WXDA 2EV5A 3AG3H 3K1NA 4RDUA 3JSOA 4P5OA 2JA8J 4NNJA 3V8JA 2R7OA 4XL9A 3ABLH 4U0YA 4HPQA 4FETA 4E70A 2KLOA 1KQ9A 3BG6A 3KP4A 2FE3A 2X1DA 3L2WA 3CCUI 3E6BA 1MSEC 1R6RA 1GUUA 2ZKZA 4IOCF 5CPRB 2D45A 3G73A 3PIOF 3M4OJ 3OIPA 1HW1A 4B48A 2HI3A 2MC4A 2CFXA 2OCCH 3HTUA 2DA5A 4G6DA 2RNJA 2JWTA 2XVCA 3KCCA 4L9VA 3VFZA 1ZR4A 2ETHA 4BXFA 5JVGF 1IN8A 4AM3A 2O5RA 3BPVA 1NG6A 1MJ9A 2VXZA 4NQWB 2XF7A 3T8TA 1GXQA 2IAIA 2P4WA 2FMYA 1YQAA 1KYWA 3F8MA 2CUZA 2BBYA 1GLNA 1OR7A 2FD5A 5ICCA 3HM5A 4KT6A 1B8IB 1T95A 3SDBA 2FQ4A 1V54H 3W2VA 3PJRA 2OPTA 4BDYA 1EKEA 3TW7A 1LDDA 1UG2A 2HZDA 1F9NA 4G7HF 1IUYA 3CUQC 3CLQA 2Q2EB 1SFEA 2XAGA 3O8GA 3Q9SA 3R6SA 4P96A 2CRGA 3BROA 5FLVA 3IWFA 2MABA 3I56I 3LA7A 2P8TA 1DU6A 2ZNYA 1E3PA 2W82A 1ON1A 4BGDA 1MJAA 2E7WA 2PG4A 4D5CA 2W4SA 2ZMEC 4PK4A 4XM3A 2LREA 2VKVA 3IAM2 5FD5A 2ZJQF 4MFDA 1TBXA 2FUG2 1SMYF 4F7ZA 1R22A 4BHPA 3DPLC 1Z7LA 5B1BH 4OINF 3L7WA 1XS9A 1ZAOA 1BBYA 3M1CA 4I0AA 3K2AA 3LSGA 2E2IJ 4Y15A 1KZHA 5EG0A 4B44A 2R4GA 2LP0A 1WPKA 4U0WA 2FSWA 3OV8A 1RETA 1R58A 2XUBA 5E3MA 4XRSA 1D0XA 3OS1A 4PSXA 5DDGA 5EEGA 1S7AA 1P7IA 1R1TA 4IHXA 3GF2A 3KEQA 1FYMA 4KMFA 5B1AH 2QQ9A 4PSWA 4NHJA 1RZ4A 2FRHA 2KRHA 4DBQA 2XB5A 4EJWA 2DA7A 2MH2A 2Y69H 5FRNA 4YFNF 1AA7A 1H9GA 3ZMDA 1P2FA 2VE8A 3KEOA 3KP2A 4LG0B 2UV1A 2EPFA 2F5CA 1B59A 4AU7A 3TOBA 1EH7A 2KL4A 5FROA 3KPHA 3MEXA 2HTSA 1V5FA 3W2AA 3F9KA 4Y4RA 5F04A 4XKWA 4P1WA 3RQ4A 5GAEJ 4I98B 2HKXA 5IP7J 1PJRA 4M3FA 3SQNA 1A35A 1O3RA 4EQQA 2XF6A 4BE0A 1W36D 1Z21A 1QPMA 3PO2J 3S2HJ 2WB1N 2R5YA 3H1CA 2ICWG 1BR4A 1EA3A 2BOLA 2KIMA 2CV1A 4BBRJ 2X6XA 2HTJA 4G12A 4XN0A 1L3LA 2QLZA 4JX5A 2WTEA 2WAQN 3QYFA 1IF1A 3DKWA 4HZFA 2AO9A 3S93A 3I55I 2K7LA 1XMAA 2EFPA 4HNUA 4MTEA 2ME0A 1I6XA 2I5UA 1RKWA 4KA4A 2ZBKA 1TT5B 4EEFG 3S1RJ 2STTA 2L0KA 3EYYA 4XRFA 1OYYA 4I99C 1W5CC 1PUFB 1QPIA 2DYSH 3WU2C 4CSWA 2E1CA 2NVXJ 5J40A 2HVSA 2M4GA 3EUAA 3L1PA 2HOEA 2DDAA 3OIOA 3PSIA 2ESHA 3PM1A 3CZ6A 4P55A 3F21A 2QQAA 3I59B 2HXIA 1TW3A 2DA2A 3LOCA 2M5WA 1XGSA 1X1CA 4LB6B 3TKYA 3MN2A 3G1MA 3MKZA 5HNFA 4HLXA 2VE9A 2GIVA 2R7XA 4A5NA 5FKNA 1YRNB 1NK3P 2DMPA 2HQ5A 2JPCA 2IRFG 4HX4A 3S2DJ 3RCOA 4C2UA 4CCLA 2VJ5A 5GADJ 2HZTA 1XMXA 2DMUA 3S3OA 3GFJA 1POGA 4OAZA 2LH9A 1FYLA 5JLXA 4X6AJ 5LGNA 2NXNB 4BL0B 2VBZA 4E7IA 3GFIA 3NEUA 3BOQA 3WTYC 1IRXA 1W0TA 4QPOA 3P9IA 3F72A 3WG9A 5GTHC 3QPLA 3PO3J 1S9HA 1CF7A 1JTYA 3S15J 2M45A 2K9LA 3GZ5A 4G6QA 4BJTA 4L5JA 5DD8A 5D5VB 4UUSB 1WJCA 3BR1A 1ETYA 1Z3XA 2WV1A 3FK6A 1HDPA 3KLNA 4M6XA 4NC8A 3IRQA 2PJRA 4IXAA 2AQEA 3FMQA 2RREA 1XGNA 3VEPA 1SVLA 3RKQA 4XOPA 3ZN0A 3BTLA 4HSRA 2DA6A 3J7AO 3IH3A 1U9NA 4HV6A 1W5SA 2XAFA 3ZMUA 4D7NA 2D2WA 2L7MP 3DV8A 2NVYJ 3GLXA 2VB6A 3LWFA 3QOPA 4DZPA 4YIIA 3RYPA 1K4SA 2K9NA 1W7PA 3CJTB 3HOWJ 1QZEA 2NNNA 1HKSA 1U2WA 2ELKA 3GYHX 2QBYA 3CC2I 3PSFA 3VYSB 3TMOA 2NS7A 4IEJA 1ETOA 3AKZA 1WZ2A 2IA0A 2ZXIA 2L2OA 3HKZA 5LEJA 3E6CC 5DV5A 5J4VA 4DJAA 4KICA 3F6OA 2BW3A 2VASA 4GYGA 1WHUA 3RKYA 3S17J 3E5XA 4GFBA 3L9FA 5H2FC 1SFKA 1P4XA 2STWA 1LPQA 5HDKA 3F8BA 3ABUA 1VQOI 1B6AA 3CDHA 2DW4A 4ZZDA 4RM2A 2CYYA 2M7AA 2HPIA 2KP6A 3U1DA 4G7ZF 2DN0A 5D4SA 2FF4A 5J1YA 1J59A 1MBKA 1QZYA 4AWXB 2PI0A 3BY6A 1UHWA 4MO7A 3E3VA 4MTDA 3HGGA 4WX9A 1DPRA 2KIFA 4KDPA 1N78A 3GVAA 3I54A 3U9GA 4BQNA 3A01A 1OCZH 3HYIA 3WE3A 2R92J 4TV7A 2RN7A 4BHBA 3CCSI 1YOVB 1R71A 1MJBA 3R0JA 4HDUA 3A0BC 5IP9J 1MDMB 2LOOA 5E1WA 1VNDA 5J8CA 4Y13A 4M71A 3A2KA 2E36A 4R8HA 5BQTA 1MMAA 5L3BA 2GXGA 1R9TJ 3TBIA 1OCRH 1R5ID 3J7YJ 2QSFX 3DEUA 4YIFA 4JOMA 5FLXZ 2IGMA 3G6EI 1BI1A 1NTCA 1OYIA 4XRMA 1EV7A 2P5LC 5DM7F 3GTKJ 1P92A 4LG3A 3CCYA 3IH4A 3OR2C 4CDGA 1VTNC 3FK7A 4PDKA 3K4LA 2EZLA 2EA2A 1R1VA 3AL0B 4B47A 3RKXA 2IP2A 2VBXA 4BE2A 1ZG1A 3SFZA 1LVKA 1BW5A 1WI3A 1WJAA 3N4MA 1GXPA 1LEBA 2NS8A 5KHDA 2D1HA 1E3HA 5GPCA 4WCGA 1F1ZA 3LSIA 2HQRA 2CMPA 3BCBA 4KYWA 1IV6A 1BOAA 4DOZA 2VQCA 4CHUA 1STZA 2X48A 4Y52J 4IKFA 3L2CA 5JLWA 1OCPA 2Y0SA 2V79A 3ZGKA 2LYCA 5B5EC 2LKXA 3GTJJ 4DQ2A 1S7EA 4QWQA 4CO8A 2I8DA 3WHCA 3FKJA 3JRFA 3IH2A 1CGPA 3M8EA 1A04A 4C3HJ 2EIKH 5HODA 1IDYA 3F22A 5HLGA 2LSOA 3Q0WA 2WWYA 2JQ7A 4PGHA 2JUGA 3GZNB 1K78A 4EJVA 1S72I 2M7BA 2Z5UA 1TQIA 3K6GA 2DODA 1ZRFA 1GVDA 1O57A 1LNWA 2ELHA 4A3KJ 3PL8A 2EIJH 3LL7A 4MLOA 3R61A 5F6FA 4KN7X 4PGGA 3W6KB 2W00A 3BTJA 3RI4A 2CWEA 5C44J 2VT2A 4ITVA 2IS1A 5JHUA 1Y6IA 1J0RA 3V8KA 2VN2A 1MGTA 1LFUP 1Y0NA 2Z16A 3KP3A 3HSRA 3DLLF 4YEJA 4UY8I 3H92A 2NS0A 1RC9A 4FX4A 1F36A
chains in the Genus database with same CATH topology
4IJAA 4MEYF 1QNTA 1D8JA 3WTUC 2EFQA 3D5LA 2A6HF 1XGOA 2BGCA 1IN6A 3ZN1A 1DP7P 5DYMA 3TGNA 4ESFA 2QVOA 4ZYHA 1LDJA 1YLFA 1FNNA 5KK1A 5E18F 5L3EA 3HTSB 5LHGA 5L3DA 5IT9K 2VODA 4BQAA 5FLXK 2IW5A 2EA4A 2DQLA 3I53A 4UVAA 4L5IA 4UHTA 2MC3A 2AXLA 3WODF 2XAQA 2KIUA 3M8FA 1YFHA 2VONA 2W84A 1U5TC 2HQNA 3DF8A 3COAC 4UVBA 4Q4ZF 4BAYA 2GAUA 1YO5C 3F23A 5CVRA 4A12A 1E17A 1W5TA 4EJOA 2DTRA 3P7NA 4XBFA 2VC0A 5D5XB 4RB0A 5ICFA 4WF2A 4FHTA 1HKQA 1Z1DA 4KIGA 2K86A 2IA2A 4IHTA 2BV6A 3QAHA 1D3YA 4PCQA 3IC7A 3VB2A 4L9TA 2LDUA 5D4RA 1LVAA 2A6EF 2P7CB 1FBQA 1O3TA 4M6YA 1G3YA 5J8FA 2OBPA 1XSVA 2OAZA 2PJPA 2DLLA 5AIPA 5K1YA 2HFHA 4ZYGA 4S04A 3K9TA 3WTVC 4HF2A 1V3FA 2GA2A 2XRNA 1XGMA 2XROA 1T38A 1IN5A 2YPRA 1QZZA 4O6JA 4N0BA 5KVRA 1FP1D 3KP6A 5D8LB 3MQ0A 2AS5F 3BWGA 3KLOA 4N9IA 3QRFF 2DAOA 3BZ6A 1FLIA 4HQEA 4M72A 3B02A 1IN7A 3ZMTA 2NRAC 2XHKA 2YSRA 3SZTA 1WI9A 3VOEA 3EYIA 3ML6A 4CYDA 3EETA 4XLPF 2E7XA 2GQQA 1Q1HA 1GVJA 2FNAA 1O7FA 3IHUA 3J81K 1KQ8A 2L54A 3RPUA 3GFLA 2P6TA 4OOIA 2YR2A 4EJTA 3HOSA 4OIRF 4UUVA 1ZLJA 2ZXJA 2XAHA 2P5VA 2RQPA 3ZPLA 2R7DA 1U78A 5FB2A 2XGXA 5CVVA 4A2UA 3ECOA 4WXHA 2Q2EA 1UHMA 2K4BA 5H6QA 3BJAA 3TQNA 2PQ8A 2VC1A 1WSUA 1U5TA 4Q47A 4RB3C 3QU6A 4WK8F 1EH6A 1G6NA 3V7SA 3H3ZA 4EV0A 3DQVC 3FZVA 2Q8KA 4L18B 4LLLA 1REPC 4HX8A 1JE8A 3RJPA 5DCMA 4Q48A 4I7HA 2CG4A 4FX0A 1I27A 1TNSA 2A07F 1WQ2A 1GHCA 1LEAA 2MLKA 3ISPA 5HS8A 3K1MA 3W6JB 1WRJA 3HRMA 1XSXA 2FXAA 1KU7A 1J2XA 1Z05A 4HLYA 1XD7A 3TDZC 5K5OA 1RIOH 3QP6A 2GWRA 2DU9A 2EFNA 3GXOA 1BI0A 3M7GA 5LRRA 4L0ZB 1TNTA 3T5XA 3RYRA 2DPUA 4RGXA 5LEKA 4L0YB 1UB9A 1RUOA 4PZJA 1R00A 3ZP5A 2CQKA 2LNBA 4BH9A 3PQKA 1I1GA 3IRRA 1K79A 4ETSA 5TRDA 4RGRA 1SFXA 1T0FA 3HUGA 1ZG3A 4LLGF 2DO7A 5ILUA 3LA3A 2X4HA 1F4KA 1YYVA 3MZYA 2O3FA 4ESJA 4HW0A 1R5HA 1SD5A 3I0TA 2HYGD 4M9SA 1FWZA 1S29A 4WXCA 1H9TA 5E8IA 5D5WB 3Q5FA 3LAPA 2PLYA 4M73A 1LJ9A 2O61A 2EV0A 3SZPA 2A69F 5ICEA 3NRVA 1TQPA 2B0LA 2ZJ2A 4MHGA 4LK0F 4R79A 2OQGA 4A6EA 5ILVA 3Q9VA 2R7FA 1TQMA 5E17F 5DEQA 2DT5A 5HS7A 1S7OA 2V6CA 4RAYA 2FBHA 3SXYA 3FWEA 1QO0D 5D6FA 3LFKA 1KQ0A 4R1HA 4BHCA 5L3FA 1BC7C 1J5YA 1HXDA 2VBWA 4BNCA 1KU9A 2HS5A 5HLHA 2NYXA 4HYEA 3ZQ7A 3RPQA 1BIBA 1SD4A 4BYYA 1UFMA 3IWZA 4LMYA 1L0OC 1SAXA 2XAJA 4U7BA 2KJCA 2FEZA 2X0LA 4I09A 2OD5A 4HF0A 3CUQA 4CGZA 4IPAA 2M1BA 3QU3A 2ZFWA 1U6GA 1IXSB 4AIJA 2ZMEA 2H27A 2HEOA 3C3WA 3KFWX 3FM5A 2FMLA 5TJJA 1W7PB 2O6GE 4I02A 2QBYB 3BPXA 3V4GA 2HWVA 3ERED 2RVCA 1TW2A 3VODA 1B9MA 2CSOA 3ELKA 3IKTA 4LLNA 1IN4A 4Z2YA 4A0XA 1HW2A 2A3SA 2ISYA 2M8EA 2ZO4A 2IJLA 3EDPA 5A2QZ 3V8LA 3REOA 2E1NA 2ACJA 3QPHA 4ENMA 1XCBA 3D0SA 4GYIA 3JW4A 4M9ZA 1IRGA 4BXUA 2DFIA 4RS8A 4YG2F 2O03A 3DXJF 4A5MA 1IW7F 4KUMA 1LDKB 2JZYA 4A6DA 1MZBA 2KJBA 1HQCA 1YS7A 1YW7A 4G7OF 3KP7A 1SFUA 1OMIA 1F5TA 4LB5A 2C6YA 1KU2A 4YFXF 3LQQA 5E1ZB 1USSA 2CW0F 2FOKA 5E20A 1Y0UA 3PQJA 1YW8A 1FX7A 1FPQA 1T39A 3WTTC 5D5UB 5FGMA 1OPCA 1BI3A 1T2KA 3WU1B 1IXRC 1K78B 1QGPA 4AIHA 1R7JA 1B9NA 1KYZA 3JSPA 2RKHA 3V7CA 3OOPA 4LD5A 3CO6C 5DD4A 2XIGA 1YG2A 1MD0A 1O3QA 5BOXA 5A2QK 3J80Z 4OIQF 2LF8A 4LK1F 3HRTA 1MKMA 2MH9A 2RGVA 2F2EA 3BDDA 1SD7A 1UCRA 1FSEA 4HQMA 4O5VA 5F64A 1ZRCA 3RKWA 2CGPA 4O3MA 4RB1A 3HSEA 1LB2A 4ON0A 2FU4A 2QM3A 2WV0A 2XASA 1G4DA 3DP7A 4UVCA 4KIBA 5CJ9A 3PFIA 1HKTA 1V4RA 2CO5A 5BMZA 5H6RA 2IT0A 5ILSA 1K6OA 3LSTA 4M9XA 3FHZA 4ESBA 1XMKA 2EB7A 1B4AA 5DCFA 1XDSA 3JTHA 1DDNA 2L4AA 4HV5A 3WU0A 1XSDA 2G7HA 4IF4A 4U88A 2P7VB 4MNUA 4D0PA 2YX4A 3ULQB 3O2PE 4P9FA 1IXCA 4LJZF 3T0YA 4ENNA 3GEZA 2VBYA 3C7JA 1JGSA 1BJAA 5CLSA 4HOBA 3RTRA 2H94A 5HDNA 1YTYA 3R0AA 5HOOA 3K2ZA 3E5QA 2D1VA 5HLIA 2PFBA 3KETA 3QPTA 3E6MA 3L00A 3IL2A 4I2OA 2F5EA 1ONVA 1PP7U 1P6RA 2IVMA 3LAJA 2ADUA 1R23A 4XLNF 6PAXA 1U3EM 1W4MA 3I58A 5DUKA 3GWZA 3NQOA 2DI3A 1BI2A 2MA3A 2XV4S 3BP8A 1FZPB 1FBSA 3GFMA 3U2RA 3CTAA 2QENA 4KMUX 3RIRA 3P9CA 4ENKA 4N9HA 2F5DA 3I64A 4KIFA 1Z7UA 1SMTA 2IPQX 2UXNA 2EFOA 3ABTA 2HKOA 2PEXA 3I4PA 4NQWA 1IZ1A 1AWCA 3L09A 3R4KA 4P9UA 3GW2A 3MWMA 2QUFA 2W85A 1R5GA 4ZYDA 3HHHA 5ICGA 2VOPA 1G3TA 5LBQA 4A0YA 1IAWA 1RI7A 5L3GA 2FBIA 2J5PA 1O7LA 1XDUA 5J6XA 3B73A 2VT3A 5FFXA 1ODDA 2BYVE 4A0ZA 5K5QA 2PN6A 2Z3YA 1HBXG 2MD5A 2RV8A 4AIKA 4KN4X 5LHIA 3JTGA 3P9KA 1G3WA 2DBBA 4UV9A 1ON2A 1RUNA 4GCVA 4IRIA 2F5FA 3ROUA 5JR3A 3BJ6A 4FT8A 4G8XA 1U5TB 4LG0A 2L3DA 2OU2A 5LLQA 2VOOA 4ZYEA 3T1BA 3K69A 4HF1A 2ISZA 3FX3A 4MQVA 1DUXC 1BN5A 2Y48A 2GXBA 1FSHA 1J75A 3AAFA 3CO7C 4OIOF 2R3SA 4U7DA 5D6EA 2G9WA 4ZZLA 5DCMB 2NNYA 3S2WA 1TTYA 1D8KA 1PP8F 2P5KA 5JI6A 1ZGJA 1ZYRF 3CJNA 1R1UA 1NHAA 3C1DA 3I71A 2JT1A 3EQLF 5CVUA 1WWXA 1BM9A 1K7AA 1Z6TA 3I59A 3DFGA 4B8XA 3HRSA 4ZH4F 2JSCA 2OA4A 2WC2A 4OIPF 3HRUA 4YFKF 2IA1A 1QBJA 5EEHA 4H0EA 5E1XA 4L9JA 2QYOA 2NAZA 4KT5C 1HSTA 2UZKA 3MCZA 3E97A 1FOKA 4NB5A 5ERIA 3ZMSA 5ED4A 3WGGA 5CVJA 4EVIA 3WTXC 2A68F 2A5YB 2QWWA 3G3ZA 4S05A 4IRGA 1ZHFA 1HW5A 3IKVA 2XKPA 5AIQA 4G9YA 3WTWC 3MFKA 2V1UA 2UWMA 1W7PD 2DK5A 1ZREA 2GA1A 5BPIA 2A61A 2K4JA 2OZ6A 4XSXF 1YIOA 3RDIA 2G7UA 4IRHA 4HDVA 1Z9CA 1P4WA 5JVTA 1XN7A 3WGIA 1S8NA 1XCVA 3GO5A 4QLCU 3EUHA 4ENJA 4Q5SF 4UNOA 1CF7B 4ASNA 3GZ6A 1I5ZA 1YS6A 1FP2A 1FC3A 2OZUA 4LFUA 5FFZA 4RB2C 1WKMA 3H3UA 4EGZA 3F6VA 2EV6A 2L02A 1MDMA 1Z6RA 2V1XA 4GXOA 4RGUA 3FMRA 5JFRA 3WTSC 2Z33A 1E2XA 5LHHA 1FT9A 1FY7A 5DUIA 2LF7A 3MZHA 1ZG5A 4DNCA 4EM1A 2GZWA 3CUQB 2MLGA 3TO7A 2BE5F 3GUDA 4OU0A 4EMSA 1OYWA 2ZMEB 4I01A 2HYFA 5AONA 5D8KB 3HHGA 1HSJA 4U0VA 3CLOA 4KNYA 4IHSA 2L01A 4OMZA 2PMUA 2LKPA 5IT9Z 2O0YA 5HVQC 4JBAA 1IRFA 2DQRA 2TDXA 4GO1A 3TO6A 3R60A 3ZMZA 3QP5A 2KKOA 1BC8C 3MAJA 1PUEE 5BS6A 4GGGA 3ZMVA 2MBFA 4KFCA 2DK8A 4L9NA 3C18A 1S6LA 1D5VA 5BPDA 4K2EA 3F3XA 5HDGA 2K02A 4LGWA 1ZARA 4OMYA 4JK1X 4MQ9F 1ZGAA 4UV8A 2YU3A 2QZ8A 5K5RA 1H0MA 4HA8A 3JAMZ 4I0BA 2Q0OA 4XSZF 3KE2A 2FNPA 2PBIA 1U8RA 2COMA 1JHFA 4RGSA 3CUOA 4EGYA 3F8NA 1USTA 3WE2A 2H6BA 1KGSA 3FXUA 3N97A 2W57A 2OQRA 1S3JA 2XKOA 1JXSA 3BJOA 1OKRA 2PMHA 3FXQA 1R36A 1RNLA 1AOYA 5F1RA 1ZH5A 3LQRA 2L4MA 3KZZA 2DPDA 3M1EA 1KA8A 3E5UA 4IVNA 1FYKA 4B09A 1T6SA 1J7KA 3WGHA 2UXXA 1LQ1A 1J9IA 4HX7A 5FO5A 3FMSA 3ECHA 3F8FA 1QQIA 4CXFA 1XB4A 3O3KA 2P6SA 3FXRA 2Y75A 2EJRA 2O8XA 2W25A 3FF5A 4M74A 3M9AA 2V1DA 5LGTA 1KU3A 4EM2A 5IT3A 4UXNA 2M30A 4EJUA 5FD6A 5H20A 1T98A 3TO9A 1EH8A 2K27A 1DPUA 1PDNC 4MEXF 2H09A 2RDPA 2Z9OA 5CVIA 3J81Z 3T8RA 4CICA 3JAMK 5HS9A 3F8CA 2HR3A 1I1SA 1FBUA 1G3SA 3HSFA 4JQFA 3V7RA 4RAZA 2M87A 5LRSA 2HDCA 1ULYA 2FA5A 2V9VA 2Z99A 1Z91A 2KRFA 5L3CA 3I5UA 2EFWA 3TDUC 2QQBA 3WTZA 1ZLKA 1JHHA 3KZYA 1P4AA 2FBKA 1ZRDA 1C0WA 3TOAA 4CZZA 2ZCWA 1X3UA 2YX7A 4HBLA 3J80K 2W24A 1SD6A 3KP5A 4Y17A 2H6CA 5E8GA 2ZNZA 3E6DA 1YW9A 1O3SA 3FM3A 4AD9A 4AVPA 2JTVA 1B1BA 1TLHB 2ESNA 5LGUA 4HAMA 4EM0B 1ZN2A 4WWCA 3HOTA 2Y0MA 3K0LA 2JPBA 3SHFA 1BIAA 2RC4A 3HIFA 3GX4X 2FQ3A 2HGCA 2EK5A 5CYVA 2BEOA 3O6BB 4MGRA 2J5OA 3DPTA 3LA2A 2JRTA 2EWNA 4G94A 4WXDA 2EV5A 3K1NA 3JSOA 4P5OA 3V8JA 4U0YA 4E70A 1KQ9A 3KP4A 2FE3A 3E6BA 2ZKZA 2D45A 3G73A 1HW1A 2CFXA 3HTUA 4L9VA 4G6DA 2RNJA 2XVCA 3KCCA 3VFZA 2ETHA 1IN8A 3BPVA 1MJ9A 2VXZA 3T8TA 1GXQA 2P4WA 2FMYA 1YQAA 1KYWA 3F8MA 2BBYA 1OR7A 5ICCA 1LDDA 1F9NA 4G7HF 1IUYA 3CUQC 2XAGA 1SFEA 3Q9SA 3R6SA 4P96A 3BROA 3IWFA 3LA7A 2P8TA 2ZNYA 1ON1A 1MJAA 2E7WA 2PG4A 5FD5A 1TBXA 1SMYF 4F7ZA 1R22A 4BHPA 3DPLC 4OINF 3L7WA 1ZAOA 1BBYA 4I0AA 4Y15A 4U0WA 2FSWA 3OV8A 1R58A 2XUBA 5DDGA 5EEGA 1S7AA 1R1TA 3GF2A 3KEQA 1FYMA 4KMFA 2QQ9A 4NHJA 1RZ4A 2FRHA 4EJWA 2MH2A 4YFNF 1H9GA 3ZMDA 1P2FA 2VE8A 3KEOA 3KP2A 4LG0B 2F5CA 1B59A 3TOBA 1EH7A 3MEXA 2HTSA 4I98B 2HKXA 3SQNA 1O3RA 4EQQA 1QPMA 2KIMA 2HTJA 1L3LA 2QLZA 2WTEA 1IF1A 3DKWA 4HZFA 2K7LA 1XMAA 2EFPA 4MTEA 1I6XA 4KA4A 2ZBKA 2STTA 3EYYA 4XRFA 1OYYA 2E1CA 2HOEA 2ESHA 3F21A 4P55A 2QQAA 3I59B 1TW3A 2M5WA 1XGSA 4LB6B 3TKYA 4HLXA 2VE9A 2GIVA 4A5NA 2JPCA 2IRFG 4HX4A 2HZTA 3GFJA 1FYLA 5LGNA 2VBZA 3GFIA 3NEUA 3BOQA 3WTYC 3P9IA 3F72A 3WG9A 1CF7A 2M45A 3GZ5A 4G6QA 4L5JA 5DD8A 5D5VB 3KLNA 4M6XA 3IRQA 4IXAA 3FMQA 1XGNA 3VEPA 3ZN0A 3J7AO 4HV6A 1W5SA 2XAFA 3ZMUA 2D2WA 3DV8A 3GLXA 3LWFA 3QOPA 4YIIA 3RYPA 1W7PA 2NNNA 1HKSA 1U2WA 3GYHX 2QBYA 2IA0A 3E6CC 5LEJA 5DV5A 4KICA 3F6OA 4GYGA 3RKYA 3E5XA 3L9FA 1P4XA 2STWA 5HDKA 3F8BA 3ABUA 1B6AA 3CDHA 2DW4A 4ZZDA 2CYYA 3U1DA 4G7ZF 5D4SA 2FF4A 1J59A 1QZYA 4AWXB 2PI0A 3BY6A 1UHWA 3E3VA 4MTDA 4WX9A 1DPRA 2KIFA 4KDPA 3GVAA 3I54A 3U9GA 3HYIA 3WE3A 4TV7A 2RN7A 4BHBA 1MJBA 3R0JA 4HDUA 1MDMB 5E1WA 5J8CA 4Y13A 4M71A 4R8HA 5BQTA 5L3BA 2GXGA 3DEUA 4YIFA 5FLXZ 1BI1A 1OYIA 1EV7A 2P5LC 1P92A 4CDGA 1VTNC 4PDKA 2EA2A 1R1VA 3RKXA 2IP2A 2VBXA 1ZG1A 3SFZA 1GXPA 3N4MA 1LEBA 2D1HA 4WCGA 1F1ZA 2HQRA 4KYWA 1BOAA 4CHUA 1STZA 3L2CA 2V79A 4DQ2A 4QWQA 4CO8A 1CGPA 3M8EA 1A04A 3F22A 5HLGA 2LSOA 2WWYA 4PGHA 1K78A 4EJVA 2Z5UA 1TQIA 1ZRFA 1O57A 1LNWA 2ELHA 3R61A 5F6FA 4KN7X 4PGGA 3W6KB 3RI4A 2CWEA 2VT2A 5JHUA 1J0RA 3V8KA 2VN2A 1MGTA 3KP3A 3HSRA 3H92A 2NS0A 4FX4A 3K1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJA A;  4MEY F;  1QNT A;  1D8J A;  3WTU C;  2EFQ A;  3D5L A;  2A6H F;  1XGO A;  2BGC A;  1IN6 A;  3ZN1 A;  1DP7 P;  5DYM A;  3TGN A;  4ESF A;  2QVO A;  4ZYH A;  1LDJ A;  1YLF A;  1FNN A;  5KK1 A;  5E18 F;  5L3E A;  3HTS B;  5LHG A;  5L3D A;  5IT9 K;  2VOD A;  4BQA A;  5FLX K;  2IW5 A;  2EA4 A;  2DQL A;  3I53 A;  4UVA A;  4L5I A;  4UHT A;  2MC3 A;  2AXL A;  3WOD F;  2XAQ A;  2KIU A;  3M8F A;  1YFH A;  2VON A;  2W84 A;  1U5T C;  2HQN A;  3DF8 A;  3COA C;  4UVB A;  4Q4Z F;  4BAY A;  2GAU A;  1YO5 C;  3F23 A;  5CVR A;  4A12 A;  1E17 A;  1W5T A;  4EJO A;  2DTR A;  3P7N A;  4XBF A;  2VC0 A;  5D5X B;  4RB0 A;  5ICF A;  4WF2 A;  4FHT A;  1HKQ A;  1Z1D A;  4KIG A;  2K86 A;  2IA2 A;  4IHT A;  2BV6 A;  3QAH A;  1D3Y A;  4PCQ A;  3IC7 A;  3VB2 A;  4L9T A;  2LDU A;  5D4R A;  1LVA A;  2A6E F;  2P7C B;  1FBQ A;  1O3T A;  4M6Y A;  1G3Y A;  5J8F A;  2OBP A;  1XSV A;  2OAZ A;  2PJP A;  2DLL A;  5AIP A;  5K1Y A;  2HFH A;  4ZYG A;  4S04 A;  3K9T A;  3WTV C;  4HF2 A;  1V3F A;  2GA2 A;  2XRN A;  1XGM A;  2XRO A;  1T38 A;  1IN5 A;  2YPR A;  1QZZ A;  4O6J A;  4N0B A;  5KVR A;  1FP1 D;  3KP6 A;  5D8L B;  3MQ0 A;  2AS5 F;  3BWG A;  3KLO A;  4N9I A;  3QRF F;  2DAO A;  3BZ6 A;  1FLI A;  4HQE A;  4M72 A;  3B02 A;  1IN7 A;  3ZMT A;  2NRA C;  2XHK A;  2YSR A;  3SZT A;  1WI9 A;  3VOE A;  3EYI A;  3ML6 A;  4CYD A;  3EET A;  4XLP F;  2E7X A;  2GQQ A;  1Q1H A;  1GVJ A;  2FNA A;  1O7F A;  3IHU A;  3J81 K;  1KQ8 A;  2L54 A;  3RPU A;  3GFL A;  2P6T A;  4OOI A;  2YR2 A;  4EJT A;  3HOS A;  4OIR F;  4UUV A;  1ZLJ A;  2ZXJ A;  2XAH A;  2P5V A;  2RQP A;  3ZPL A;  2R7D A;  1U78 A;  5FB2 A;  2XGX A;  5CVV A;  4A2U A;  3ECO A;  4WXH A;  2Q2E A;  1UHM A;  2K4B A;  5H6Q A;  3BJA A;  3TQN A;  2PQ8 A;  2VC1 A;  1WSU A;  1U5T A;  4Q47 A;  4RB3 C;  3QU6 A;  4WK8 F;  1EH6 A;  1G6N A;  3V7S A;  3H3Z A;  4EV0 A;  3DQV C;  3FZV A;  2Q8K A;  4L18 B;  4LLL A;  1REP C;  4HX8 A;  1JE8 A;  3RJP A;  5DCM A;  4Q48 A;  4I7H A;  2CG4 A;  4FX0 A;  1I27 A;  1TNS A;  2A07 F;  1WQ2 A;  1GHC A;  1LEA A;  2MLK A;  3ISP A;  5HS8 A;  3K1M A;  3W6J B;  1WRJ A;  3HRM A;  1XSX A;  2FXA A;  1KU7 A;  1J2X A;  1Z05 A;  4HLY A;  1XD7 A;  3TDZ C;  5K5O A;  1RIO H;  3QP6 A;  2GWR A;  2DU9 A;  2EFN A;  3GXO A;  1BI0 A;  3M7G A;  5LRR A;  4L0Z B;  1TNT A;  3T5X A;  3RYR A;  2DPU A;  4RGX A;  5LEK A;  4L0Y B;  1UB9 A;  1RUO A;  4PZJ A;  1R00 A;  3ZP5 A;  2CQK A;  2LNB A;  4BH9 A;  3PQK A;  1I1G A;  3IRR A;  1K79 A;  4ETS A;  5TRD A;  4RGR A;  1SFX A;  1T0F A;  3HUG A;  1ZG3 A;  4LLG F;  2DO7 A;  5ILU A;  3LA3 A;  2X4H A;  1F4K A;  1YYV A;  3MZY A;  2O3F A;  4ESJ A;  4HW0 A;  1R5H A;  1SD5 A;  3I0T A;  2HYG D;  4M9S A;  1FWZ A;  1S29 A;  4WXC A;  1H9T A;  5E8I A;  5D5W B;  3Q5F A;  3LAP A;  2PLY A;  4M73 A;  1LJ9 A;  2O61 A;  2EV0 A;  3SZP A;  2A69 F;  5ICE A;  3NRV A;  1TQP A;  2B0L A;  2ZJ2 A;  4MHG A;  4LK0 F;  4R79 A;  2OQG A;  4A6E A;  5ILV A;  3Q9V A;  2R7F A;  1TQM A;  5E17 F;  5DEQ A;  2DT5 A;  5HS7 A;  1S7O A;  2V6C A;  4RAY A;  2FBH A;  3SXY A;  3FWE A;  1QO0 D;  5D6F A;  3LFK A;  1KQ0 A;  4R1H A;  4BHC A;  5L3F A;  1BC7 C;  1J5Y A;  1HXD A;  2VBW A;  4BNC A;  1KU9 A;  2HS5 A;  5HLH A;  2NYX A;  4HYE A;  3ZQ7 A;  3RPQ A;  1BIB A;  1SD4 A;  4BYY A;  1UFM A;  3IWZ A;  4LMY A;  1L0O C;  1SAX A;  2XAJ A;  4U7B A;  2KJC A;  2FEZ A;  2X0L A;  4I09 A;  2OD5 A;  4HF0 A;  3CUQ A;  4CGZ A;  4IPA A;  2M1B A;  3QU3 A;  2ZFW A;  1U6G A;  1IXS B;  4AIJ A;  2ZME A;  2H27 A;  2HEO A;  3C3W A;  3KFW X;  3FM5 A;  2FML A;  5TJJ A;  1W7P B;  2O6G E;  4I02 A;  2QBY B;  3BPX A;  3V4G A;  2HWV A;  3ERE D;  2RVC A;  1TW2 A;  3VOD A;  1B9M A;  2CSO A;  3ELK A;  3IKT A;  4LLN A;  1IN4 A;  4Z2Y A;  4A0X A;  1HW2 A;  2A3S A;  2ISY A;  2M8E A;  2ZO4 A;  2IJL A;  3EDP A;  5A2Q Z;  3V8L A;  3REO A;  2E1N A;  2ACJ A;  3QPH A;  4ENM A;  1XCB A;  3D0S A;  4GYI A;  3JW4 A;  4M9Z A;  1IRG A;  4BXU A;  2DFI A;  4RS8 A;  4YG2 F;  2O03 A;  3DXJ F;  4A5M A;  1IW7 F;  4KUM A;  1LDK B;  2JZY A;  4A6D A;  1MZB A;  2KJB A;  1HQC A;  1YS7 A;  1YW7 A;  4G7O F;  3KP7 A;  1SFU A;  1OMI A;  1F5T A;  4LB5 A;  2C6Y A;  1KU2 A;  4YFX F;  3LQQ A;  5E1Z B;  1USS A;  2CW0 F;  2FOK A;  5E20 A;  1Y0U A;  3PQJ A;  1YW8 A;  1FX7 A;  1FPQ A;  1T39 A;  3WTT C;  5D5U B;  5FGM A;  1OPC A;  1BI3 A;  1T2K A;  3WU1 B;  1IXR C;  1K78 B;  1QGP A;  4AIH A;  1R7J A;  1B9N A;  1KYZ A;  3JSP A;  2RKH A;  3V7C A;  3OOP A;  4LD5 A;  3CO6 C;  5DD4 A;  2XIG A;  1YG2 A;  1MD0 A;  1O3Q A;  5BOX A;  5A2Q K;  3J80 Z;  4OIQ F;  2LF8 A;  4LK1 F;  3HRT A;  1MKM A;  2MH9 A;  2RGV A;  2F2E A;  3BDD A;  1SD7 A;  1UCR A;  1FSE A;  4HQM A;  4O5V A;  5F64 A;  1ZRC A;  3RKW A;  2CGP A;  4O3M A;  4RB1 A;  3HSE A;  1LB2 A;  4ON0 A;  2FU4 A;  2QM3 A;  2WV0 A;  2XAS A;  1G4D A;  3DP7 A;  4UVC A;  4KIB A;  5CJ9 A;  3PFI A;  1HKT A;  1V4R A;  2CO5 A;  5BMZ A;  5H6R A;  2IT0 A;  5ILS A;  1K6O A;  3LST A;  4M9X A;  3FHZ A;  4ESB A;  1XMK A;  2EB7 A;  1B4A A;  5DCF A;  1XDS A;  3JTH A;  1DDN A;  2L4A A;  4HV5 A;  3WU0 A;  1XSD A;  2G7H A;  4IF4 A;  4U88 A;  2P7V B;  4MNU A;  4D0P A;  2YX4 A;  3ULQ B;  3O2P E;  4P9F A;  1IXC A;  4LJZ F;  3T0Y A;  4ENN A;  3GEZ A;  2VBY A;  3C7J A;  1JGS A;  1BJA A;  5CLS A;  4HOB A;  3RTR A;  2H94 A;  5HDN A;  1YTY A;  3R0A A;  5HOO A;  3K2Z A;  3E5Q A;  2D1V A;  5HLI A;  2PFB A;  3KET A;  3QPT A;  3E6M A;  3L00 A;  3IL2 A;  4I2O A;  2F5E A;  1ONV A;  1PP7 U;  1P6R A;  2IVM A;  3LAJ A;  2ADU A;  1R23 A;  4XLN F;  6PAX A;  1U3E M;  1W4M A;  3I58 A;  5DUK A;  3GWZ A;  3NQO A;  2DI3 A;  1BI2 A;  2MA3 A;  2XV4 S;  3BP8 A;  1FZP B;  1FBS A;  3GFM A;  3U2R A;  3CTA A;  2QEN A;  4KMU X;  3RIR A;  3P9C A;  4ENK A;  4N9H A;  2F5D A;  3I64 A;  4KIF A;  1Z7U A;  1SMT A;  2IPQ X;  2UXN A;  2EFO A;  3ABT A;  2HKO A;  2PEX A;  3I4P A;  4NQW A;  1IZ1 A;  1AWC A;  3L09 A;  3R4K A;  4P9U A;  3GW2 A;  3MWM A;  2QUF A;  2W85 A;  1R5G A;  4ZYD A;  3HHH A;  5ICG A;  2VOP A;  1G3T A;  5LBQ A;  4A0Y A;  1IAW A;  1RI7 A;  5L3G A;  2FBI A;  2J5P A;  1O7L A;  1XDU A;  5J6X A;  3B73 A;  2VT3 A;  5FFX A;  1ODD A;  2BYV E;  4A0Z A;  5K5Q A;  2PN6 A;  2Z3Y A;  1HBX G;  2MD5 A;  2RV8 A;  4AIK A;  4KN4 X;  5LHI A;  3JTG A;  3P9K A;  1G3W A;  2DBB A;  4UV9 A;  1ON2 A;  1RUN A;  4GCV A;  4IRI A;  2F5F A;  3ROU A;  5JR3 A;  3BJ6 A;  4FT8 A;  4G8X A;  1U5T B;  4LG0 A;  2L3D A;  2OU2 A;  5LLQ A;  2VOO A;  4ZYE A;  3T1B A;  3K69 A;  4HF1 A;  2ISZ A;  3FX3 A;  4MQV A;  1DUX C;  1BN5 A;  2Y48 A;  2GXB A;  1FSH A;  1J75 A;  3AAF A;  3CO7 C;  4OIO F;  2R3S A;  4U7D A;  5D6E A;  2G9W A;  4ZZL A;  5DCM B;  2NNY A;  3S2W A;  1TTY A;  1D8K A;  1PP8 F;  2P5K A;  5JI6 A;  1ZGJ A;  1ZYR F;  3CJN A;  1R1U A;  1NHA A;  3C1D A;  3I71 A;  2JT1 A;  3EQL F;  5CVU A;  1WWX A;  1BM9 A;  1K7A A;  1Z6T A;  3I59 A;  3DFG A;  4B8X A;  3HRS A;  4ZH4 F;  2JSC A;  2OA4 A;  2WC2 A;  4OIP F;  3HRU A;  4YFK F;  2IA1 A;  1QBJ A;  5EEH A;  4H0E A;  5E1X A;  4L9J A;  2QYO A;  2NAZ A;  4KT5 C;  1HST A;  2UZK A;  3MCZ A;  3E97 A;  1FOK A;  4NB5 A;  5ERI A;  3ZMS A;  5ED4 A;  3WGG A;  5CVJ A;  4EVI A;  3WTX C;  2A68 F;  2A5Y B;  2QWW A;  3G3Z A;  4S05 A;  4IRG A;  1ZHF A;  1HW5 A;  3IKV A;  2XKP A;  5AIQ A;  4G9Y A;  3WTW C;  3MFK A;  2V1U A;  2UWM A;  1W7P D;  2DK5 A;  1ZRE A;  2GA1 A;  5BPI A;  2A61 A;  2K4J A;  2OZ6 A;  4XSX F;  1YIO A;  3RDI A;  2G7U A;  4IRH A;  4HDV A;  1Z9C A;  1P4W A;  5JVT A;  1XN7 A;  3WGI A;  1S8N A;  1XCV A;  3GO5 A;  4QLC U;  3EUH A;  4ENJ A;  4Q5S F;  4UNO A;  1CF7 B;  4ASN A;  3GZ6 A;  1I5Z A;  1YS6 A;  1FP2 A;  1FC3 A;  2OZU A;  4LFU A;  5FFZ A;  4RB2 C;  1WKM A;  3H3U A;  4EGZ A;  3F6V A;  2EV6 A;  2L02 A;  1MDM A;  1Z6R A;  2V1X A;  4GXO A;  4RGU A;  3FMR A;  5JFR A;  3WTS C;  2Z33 A;  1E2X A;  5LHH A;  1FT9 A;  1FY7 A;  5DUI A;  2LF7 A;  3MZH A;  1ZG5 A;  4DNC A;  4EM1 A;  2GZW A;  3CUQ B;  2MLG A;  3TO7 A;  2BE5 F;  3GUD A;  4OU0 A;  4EMS A;  1OYW A;  2ZME B;  4I01 A;  2HYF A;  5AON A;  5D8K B;  3HHG A;  1HSJ A;  4U0V A;  3CLO A;  4KNY A;  4IHS A;  2L01 A;  4OMZ A;  2PMU A;  2LKP A;  5IT9 Z;  2O0Y A;  5HVQ C;  4JBA A;  1IRF A;  2DQR A;  2TDX A;  4GO1 A;  3TO6 A;  3R60 A;  3ZMZ A;  3QP5 A;  2KKO A;  1BC8 C;  3MAJ A;  1PUE E;  5BS6 A;  4GGG A;  3ZMV A;  2MBF A;  4KFC A;  2DK8 A;  4L9N A;  3C18 A;  1S6L A;  1D5V A;  5BPD A;  4K2E A;  3F3X A;  5HDG A;  2K02 A;  4LGW A;  1ZAR A;  4OMY A;  4JK1 X;  4MQ9 F;  1ZGA A;  4UV8 A;  2YU3 A;  2QZ8 A;  5K5R A;  1H0M A;  4HA8 A;  3JAM Z;  4I0B A;  2Q0O A;  4XSZ F;  3KE2 A;  2FNP A;  2PBI A;  1U8R A;  2COM A;  1JHF A;  4RGS A;  3CUO A;  4EGY A;  3F8N A;  1UST A;  3WE2 A;  2H6B A;  1KGS A;  3FXU A;  3N97 A;  2W57 A;  2OQR A;  1S3J A;  2XKO A;  1JXS A;  3BJO A;  1OKR A;  2PMH A;  3FXQ A;  1R36 A;  1RNL A;  1AOY A;  5F1R A;  1ZH5 A;  3LQR A;  2L4M A;  3KZZ A;  2DPD A;  3M1E A;  1KA8 A;  3E5U A;  4IVN A;  1FYK A;  4B09 A;  1T6S A;  1J7K A;  3WGH A;  2UXX A;  1LQ1 A;  1J9I A;  4HX7 A;  5FO5 A;  3FMS A;  3ECH A;  3F8F A;  1QQI A;  4CXF A;  1XB4 A;  3O3K A;  2P6S A;  3FXR A;  2Y75 A;  2EJR A;  2O8X A;  2W25 A;  3FF5 A;  4M74 A;  3M9A A;  2V1D A;  5LGT A;  1KU3 A;  4EM2 A;  5IT3 A;  4UXN A;  2M30 A;  4EJU A;  5FD6 A;  5H20 A;  1T98 A;  3TO9 A;  1EH8 A;  2K27 A;  1DPU A;  1PDN C;  4MEX F;  2H09 A;  2RDP A;  2Z9O A;  5CVI A;  3J81 Z;  3T8R A;  4CIC A;  3JAM K;  5HS9 A;  3F8C A;  2HR3 A;  1I1S A;  1FBU A;  1G3S A;  3HSF A;  4JQF A;  3V7R A;  4RAZ A;  2M87 A;  5LRS A;  2HDC A;  1ULY A;  2FA5 A;  2V9V A;  2Z99 A;  1Z91 A;  2KRF A;  5L3C A;  3I5U A;  2EFW A;  3TDU C;  2QQB A;  3WTZ A;  1ZLK A;  1JHH A;  3KZY A;  1P4A A;  2FBK A;  1ZRD A;  1C0W A;  3TOA A;  4CZZ A;  2ZCW A;  1X3U A;  2YX7 A;  4HBL A;  3J80 K;  2W24 A;  1SD6 A;  3KP5 A;  4Y17 A;  2H6C A;  5E8G A;  2ZNZ A;  3E6D A;  1YW9 A;  1O3S A;  3FM3 A;  4AD9 A;  4AVP A;  2JTV A;  1B1B A;  1TLH B;  2ESN A;  5LGU A;  4HAM A;  4EM0 B;  1ZN2 A;  4WWC A;  3HOT A;  2Y0M A;  3K0L A;  2JPB A;  3SHF A;  1BIA A;  2RC4 A;  3HIF A;  3GX4 X;  2FQ3 A;  2HGC A;  2EK5 A;  5CYV A;  2BEO A;  3O6B B;  4MGR A;  2J5O A;  3DPT A;  3LA2 A;  2JRT A;  2EWN A;  4G94 A;  4WXD A;  2EV5 A;  3K1N A;  3JSO A;  4P5O A;  3V8J A;  4U0Y A;  4E70 A;  1KQ9 A;  3KP4 A;  2FE3 A;  3E6B A;  2ZKZ A;  2D45 A;  3G73 A;  1HW1 A;  2CFX A;  3HTU A;  4L9V A;  4G6D A;  2RNJ A;  2XVC A;  3KCC A;  3VFZ A;  2ETH A;  1IN8 A;  3BPV A;  1MJ9 A;  2VXZ A;  3T8T A;  1GXQ A;  2P4W A;  2FMY A;  1YQA A;  1KYW A;  3F8M A;  2BBY A;  1OR7 A;  5ICC A;  1LDD A;  1F9N A;  4G7H F;  1IUY A;  3CUQ C;  2XAG A;  1SFE A;  3Q9S A;  3R6S A;  4P96 A;  3BRO A;  3IWF A;  3LA7 A;  2P8T A;  2ZNY A;  1ON1 A;  1MJA A;  2E7W A;  2PG4 A;  5FD5 A;  1TBX A;  1SMY F;  4F7Z A;  1R22 A;  4BHP A;  3DPL C;  4OIN F;  3L7W A;  1ZAO A;  1BBY A;  4I0A A;  4Y15 A;  4U0W A;  2FSW A;  3OV8 A;  1R58 A;  2XUB A;  5DDG A;  5EEG A;  1S7A A;  1R1T A;  3GF2 A;  3KEQ A;  1FYM A;  4KMF A;  2QQ9 A;  4NHJ A;  1RZ4 A;  2FRH A;  4EJW A;  2MH2 A;  4YFN F;  1H9G A;  3ZMD A;  1P2F A;  2VE8 A;  3KEO A;  3KP2 A;  4LG0 B;  2F5C A;  1B59 A;  3TOB A;  1EH7 A;  3MEX A;  2HTS A;  4I98 B;  2HKX A;  3SQN A;  1O3R A;  4EQQ A;  1QPM A;  2KIM A;  2HTJ A;  1L3L A;  2QLZ A;  2WTE A;  1IF1 A;  3DKW A;  4HZF A;  2K7L A;  1XMA A;  2EFP A;  4MTE A;  1I6X A;  4KA4 A;  2ZBK A;  2STT A;  3EYY A;  4XRF A;  1OYY A;  2E1C A;  2HOE A;  2ESH A;  3F21 A;  4P55 A;  2QQA A;  3I59 B;  1TW3 A;  2M5W A;  1XGS A;  4LB6 B;  3TKY A;  4HLX A;  2VE9 A;  2GIV A;  4A5N A;  2JPC A;  2IRF G;  4HX4 A;  2HZT A;  3GFJ A;  1FYL A;  5LGN A;  2VBZ A;  3GFI A;  3NEU A;  3BOQ A;  3WTY C;  3P9I A;  3F72 A;  3WG9 A;  1CF7 A;  2M45 A;  3GZ5 A;  4G6Q A;  4L5J A;  5DD8 A;  5D5V B;  3KLN A;  4M6X A;  3IRQ A;  4IXA A;  3FMQ A;  1XGN A;  3VEP A;  3ZN0 A;  3J7A O;  4HV6 A;  1W5S A;  2XAF A;  3ZMU A;  2D2W A;  3DV8 A;  3GLX A;  3LWF A;  3QOP A;  4YII A;  3RYP A;  1W7P A;  2NNN A;  1HKS A;  1U2W A;  3GYH X;  2QBY A;  2IA0 A;  3E6C C;  5LEJ A;  5DV5 A;  4KIC A;  3F6O A;  4GYG A;  3RKY A;  3E5X A;  3L9F A;  1P4X A;  2STW A;  5HDK A;  3F8B A;  3ABU A;  1B6A A;  3CDH A;  2DW4 A;  4ZZD A;  2CYY A;  3U1D A;  4G7Z F;  5D4S A;  2FF4 A;  1J59 A;  1QZY A;  4AWX B;  2PI0 A;  3BY6 A;  1UHW A;  3E3V A;  4MTD A;  4WX9 A;  1DPR A;  2KIF A;  4KDP A;  3GVA A;  3I54 A;  3U9G A;  3HYI A;  3WE3 A;  4TV7 A;  2RN7 A;  4BHB A;  1MJB A;  3R0J A;  4HDU A;  1MDM B;  5E1W A;  5J8C A;  4Y13 A;  4M71 A;  4R8H A;  5BQT A;  5L3B A;  2GXG A;  3DEU A;  4YIF A;  5FLX Z;  1BI1 A;  1OYI A;  1EV7 A;  2P5L C;  1P92 A;  4CDG A;  1VTN C;  4PDK A;  2EA2 A;  1R1V A;  3RKX A;  2IP2 A;  2VBX A;  1ZG1 A;  3SFZ A;  1GXP A;  3N4M A;  1LEB A;  2D1H A;  4WCG A;  1F1Z A;  2HQR A;  4KYW A;  1BOA A;  4CHU A;  1STZ A;  3L2C A;  2V79 A;  4DQ2 A;  4QWQ A;  4CO8 A;  1CGP A;  3M8E A;  1A04 A;  3F22 A;  5HLG A;  2LSO A;  2WWY A;  4PGH A;  1K78 A;  4EJV A;  2Z5U A;  1TQI A;  1ZRF A;  1O57 A;  1LNW A;  2ELH A;  3R61 A;  5F6F A;  4KN7 X;  4PGG A;  3W6K B;  3RI4 A;  2CWE A;  2VT2 A;  5JHU A;  1J0R A;  3V8K A;  2VN2 A;  1MGT A;  3KP3 A;  3HSR A;  3H92 A;  2NS0 A;  4FX4 A;  3K1P A; 
#chains in the Genus database with same CATH topology
 4IJA A;  1RKT A;  4MEY F;  1QNT A;  4XLH A;  2QEX I;  1I3A A;  3BTC A;  3SEZ A;  1D8J A;  3WTU C;  2EFQ A;  3D5L A;  2A6H F;  1XGO A;  2BGC A;  3OYC A;  1IN6 A;  3ZN1 A;  1JT0 A;  4IOA F;  1DP7 P;  3CMA I;  2EH3 A;  5DYM A;  3TGN A;  4ESF A;  2QVO A;  4ZYH A;  1LDJ A;  1D1B A;  1YLF A;  1UHS A;  1FNN A;  5KK1 A;  5E18 F;  5L3E A;  1Q1V A;  3CP2 A;  4PJJ A;  3HTS B;  5LHG A;  1J09 A;  4PJL A;  2WAF A;  5L3D A;  5IT9 K;  2VOD A;  2IBD A;  4BQA A;  5FLX K;  3ZQC A;  2IW5 A;  2VPL A;  2EA4 A;  2DQL A;  1EJ9 A;  3I53 A;  2MYS A;  1YX5 A;  3CES A;  3HXL A;  5M3F J;  1D1C A;  4UVA A;  4L5I A;  2M9H A;  4UHT A;  1XC5 A;  2BVM A;  2MC3 A;  2AXL A;  4BEH B;  3JRA A;  3WOD F;  1HCR A;  2XAQ A;  2KIU A;  3M8F A;  2AQF A;  1YFH A;  2VON A;  4C3I J;  1X19 A;  2W84 A;  1TC3 C;  1U5T C;  3BQZ A;  3AFH A;  2HQN A;  3DF8 A;  3COA C;  4YIR X;  4F91 B;  4UVB A;  4Q4Z F;  4BAY A;  2LRD A;  5E79 C;  2GAU A;  2EIL H;  4E7H A;  1YO5 C;  5LFA A;  3F23 A;  4BY7 J;  5CVR A;  4A12 A;  2EIN H;  1E17 A;  1W5T A;  2V26 A;  3RZO J;  4EJO A;  1JJ6 C;  2DTR A;  4Y3O A;  1QA6 A;  3P7N A;  4XBF A;  1H8A C;  2VC0 A;  5D5X B;  4PJM A;  4RB0 A;  1OCT C;  2EZH A;  5ICF A;  4WF2 A;  2LBF A;  4FHT A;  1HKQ A;  1Z1D A;  4KIG A;  2JA2 A;  3ABM H;  2K86 A;  3DTI A;  1MNE A;  2IA2 A;  2R7Q A;  4IHT A;  2BV6 A;  3A4C A;  4XR6 A;  5J1R A;  2LD5 A;  4F93 B;  3QAH A;  1D3Y A;  2L9R A;  4PCQ A;  3IC7 A;  3OL4 A;  3VB2 A;  4KIS A;  4L9T A;  2WAE A;  2LDU A;  5D4R A;  1LVA A;  3MKY B;  2A6E F;  2P7C B;  1MBJ A;  1MMN A;  5FJ8 J;  1FBQ A;  2DOE A;  1O3T A;  4M6Y A;  1G3Y A;  2E2J J;  3S1Q J;  5J8F A;  2OBP A;  1XSV A;  2OAZ A;  1VQ4 I;  2PJP A;  2DLL A;  4D1Q A;  3HEF A;  5AIP A;  4FE4 A;  3BT9 A;  5K1Y A;  2HFH A;  4IHW A;  2QKL B;  1D0Y A;  4ZYG A;  1OFC X;  4S04 A;  3H9G A;  2DFH A;  3K9T A;  3WTV C;  4HF2 A;  4E4H A;  3H0G J;  1V3F A;  5F1J A;  2GA2 A;  2XRN A;  4XLE A;  2KPM A;  2QSG X;  1XGM A;  2XRO A;  2GIZ A;  1T38 A;  3FBN B;  1IN5 A;  2YPR A;  1QZZ A;  4O6J A;  2FJ1 A;  4XLA A;  4N0B A;  3H35 A;  3LSR A;  1ETQ A;  5KVR A;  1FP1 D;  1RR7 A;  2P81 A;  3KP6 A;  4W1U A;  4D5F A;  4ABZ A;  5D8L B;  3K4M A;  3MQ0 A;  3HB9 A;  2AS5 F;  3BWG A;  1AKH B;  1IG7 A;  3G4S I;  1JUM A;  3G2B A;  3KLO A;  5LD2 C;  1X4P A;  3A1Y A;  2A5W A;  2CV0 A;  2RQQ A;  4N9I A;  1N77 A;  3QRF F;  2DAO A;  3BZ6 A;  1FLI A;  3DBH B;  2CW7 A;  4HQE A;  2BVL A;  3HOV J;  3SDG A;  4V19 K;  4M72 A;  5FKL A;  3A03 A;  3B02 A;  1K4T A;  1IN7 A;  4EAT A;  3CCJ I;  1IRZ A;  2DJI A;  2XPV A;  3ZMT A;  1OCC H;  1HA8 A;  2NRA C;  3ONQ A;  3M8J A;  2XHK A;  3JRI A;  4B43 A;  2YSR A;  3SZT A;  3G1O A;  4BQO A;  1RES A;  3OY9 A;  2COB A;  2HVQ A;  1WI9 A;  3VOE A;  4HEA 2;  3JRE A;  3CJQ B;  3EYI A;  4ZDL A;  2KDZ A;  1MBH A;  4XOT A;  3NAR A;  2ZJP F;  1W36 C;  3CC7 I;  3ML6 A;  3JR9 A;  4CYD A;  3EET A;  4XLP F;  4C9Y A;  3FKI J;  2E7X A;  3JRG A;  2GQQ A;  5KNL A;  1Q1H A;  1GVJ A;  2VL8 A;  5IYC J;  2FNA A;  1O7F A;  3DBR B;  3IHU A;  3OYM A;  2JA5 J;  3J81 K;  1KQ8 A;  1PYV A;  2B7E A;  2RAE A;  3OIQ A;  2QGU A;  2L54 A;  3RPU A;  3FDY A;  3P5J A;  2H8W A;  2L9V A;  2IGO A;  3GFL A;  3QYB A;  2P6T A;  4OOI A;  2YR2 A;  4EJT A;  2WB1 A;  3HOS A;  2IXS A;  2WBM A;  4UB6 C;  5K7F A;  4OIR F;  5F0H A;  5EEA A;  3CCV I;  4UUV A;  1ZLJ A;  1O4X A;  2ZXJ A;  5IYB J;  2XAH A;  2WAQ A;  3GTG J;  2X6Y A;  2GBY A;  1B72 A;  4F52 A;  2P5V A;  3HJE A;  2RQP A;  3ZPL A;  4QTR A;  2HU9 A;  1B8I A;  2R7D A;  3DCF A;  5FB2 A;  1U78 A;  2XGX A;  1CQT A;  5CVV A;  3AG2 H;  3DU5 A;  1VQ7 I;  4A2U A;  4F3Q A;  1R49 A;  3ECO A;  4WXH A;  4PJN A;  2Q2E A;  2L7K A;  1UHM A;  2K4B A;  3EUH C;  1I39 A;  3ZOB A;  2V7F A;  5H6Q A;  5TGT A;  3PUF A;  3BJA A;  2XDV A;  2EZI A;  3TQN A;  1MBF A;  2PQ8 A;  2VC1 A;  1DQU A;  4RBO A;  1U5T A;  4Z6Y A;  1WSU A;  4Q47 A;  2XSJ C;  1MNM C;  3OMY A;  4RB3 C;  3QU6 A;  3CMM A;  4WK8 F;  1EH6 A;  1G6N A;  3V7S A;  3GTP J;  4HNV A;  1WH7 A;  1E0E A;  3H3Z A;  5B66 C;  4EV0 A;  3DQV C;  3FXK A;  2DFF A;  3FZV A;  1WJ5 A;  2IS6 A;  2EQR A;  2Q8K A;  1SFO J;  4A3D J;  3VSK A;  1FTZ A;  4L18 B;  4A69 C;  4LLL A;  3CCM I;  1OIS A;  3FXL A;  3GBG A;  1REP C;  1JUS A;  4HX8 A;  1JE8 A;  2B63 J;  3RJP A;  1JTX A;  5DCM A;  4Q48 A;  4I7H A;  2CG4 A;  4FX0 A;  1I27 A;  1TNS A;  4XON A;  2A07 F;  1WQ2 A;  1GHC A;  4DZJ A;  2WY7 Q;  1LEA A;  1QU3 A;  2MLK A;  3ISP A;  5HS8 A;  1IC8 A;  3AG1 H;  3K1M A;  2R93 J;  3W6J B;  1WRJ A;  3HRM A;  1XSX A;  4B4C A;  2FXA A;  1KU7 A;  1J2X A;  2ID3 A;  1Z05 A;  4HLY A;  2CQX A;  1XD7 A;  2FOW A;  3TDZ C;  4NC6 A;  4AVZ A;  5K5O A;  1RIO H;  2VKH A;  3QP6 A;  2GWR A;  1SVO A;  2DU9 A;  2EFN A;  2QCO A;  3GXO A;  1UAA A;  4AID A;  1BI0 A;  3M7G A;  5LRR A;  4IX7 A;  4XIC A;  4L0Z B;  2Z2S B;  2HVR A;  1TNT A;  3T5X A;  3AL0 C;  1GT0 C;  3HC7 A;  3RYR A;  2VQL A;  4RGX A;  5LEK A;  5B3S H;  2DPU A;  4L0Y B;  1UB9 A;  1IGN A;  1RUO A;  2ECC A;  4QPQ A;  3OYJ A;  4J01 A;  4PZJ A;  1R00 A;  1JKQ C;  4CZC A;  2W48 A;  3ZP5 A;  2CQK A;  2DA3 A;  2LNB A;  3BR2 A;  4BH9 A;  2FX0 A;  3OYD A;  3PQK A;  1I1G A;  3IRR A;  3U21 A;  1K79 A;  2NVQ J;  4ETS A;  5TRD A;  4RGR A;  1SFX A;  1T0F A;  4CA0 A;  4XNF A;  4PJ0 C;  1QHH D;  2VI6 A;  3HUG A;  5EG0 B;  2JA7 J;  3OL3 A;  2R7T A;  5IY5 H;  1ZG3 A;  3SEQ A;  3VWB A;  5EDN A;  4BJ6 C;  2XAU A;  3ZQG A;  4LLG F;  1D1A A;  1X1D A;  2DO7 A;  5ILU A;  3LA3 A;  4FAS D;  2X4H A;  1F4K A;  1YYV A;  2DFE A;  3DTE A;  2YS9 A;  3VDX A;  1JJ8 C;  3MZY A;  2O3F A;  3OYE A;  1V55 H;  3EPZ A;  4ESJ A;  4HW0 A;  1VQL I;  1R5H A;  1SD5 A;  3I0T A;  2HYG D;  4M9S A;  3S16 J;  1IO2 A;  2CJJ A;  2CV2 A;  1FWZ A;  1S29 A;  4WXC A;  1YRN A;  1H9T A;  5E8I A;  2DJN A;  4FCY A;  5D5W B;  3Q5F A;  2LK2 A;  3LAP A;  2PLY A;  2Y9Y A;  4M73 A;  4JX4 A;  1LJ9 A;  2O61 A;  2EV0 A;  3SZP A;  1R4M B;  2R5Y B;  3HOY J;  2A69 F;  5ICE A;  3NRV A;  1TQP A;  2B0L A;  3ZQI A;  2ZJ2 A;  2HYJ A;  4MHG A;  4LK0 F;  1ETX A;  2M0C A;  4R79 A;  2R5Z A;  2OQG A;  1ORK A;  1ITY A;  3RZD J;  1WGX A;  4ZYA A;  3LMM A;  3SYT A;  4A6E A;  5ILV A;  3HG9 A;  3VSL A;  3Q9V A;  2R7F A;  3MZ8 A;  1TQM A;  5E17 F;  3K1P A;  1JI8 A;  5DEQ A;  3O8H A;  2DT5 A;  3IUO A;  1XG1 A;  5TIS C;  5HS7 A;  4E7L A;  1S7O A;  2V6C A;  2W7N A;  4XN3 A;  4RAY A;  1P7J A;  1V5E A;  2E1M B;  5IOY A;  2FBH A;  1PVE A;  3SXY A;  1VI0 A;  4I6Z A;  1VQM I;  3SZG A;  2L5Q A;  3FWE A;  3GTQ J;  1QO0 D;  5D6F A;  3LFK A;  1KQ0 A;  2ZC2 A;  4R1H A;  3G1L A;  4BHC A;  4BE1 A;  4V2F A;  5M5W J;  1U9O A;  5L3F A;  1NG7 A;  4ZJZ A;  1BC7 C;  3KZI C;  2E34 A;  1HC8 A;  4NUB A;  1J5Y A;  1HXD A;  1WFX A;  2VBW A;  5GPA A;  4BNC A;  1KU9 A;  2LR8 A;  2PX9 A;  3A0H C;  2HS5 A;  1XTA A;  5HLH A;  2NYX A;  4HYE A;  3ZQ7 A;  3RPQ A;  4CYC A;  1BIB A;  1SD4 A;  2CH0 A;  2K5C A;  1TWA J;  3TED A;  4BYY A;  1UFM A;  2DOA A;  1Y1W J;  3IWZ A;  2XPW A;  4LMY A;  5DTD A;  2GLO A;  1L0O C;  1V5G A;  1SAX A;  2XAJ A;  4YRV A;  4U7B A;  2KJC A;  5CKT A;  2XGE A;  2KIS A;  1SAU A;  2FEZ A;  3FBI B;  5CQG A;  2X0L A;  2XPU A;  4JX6 A;  2OD5 A;  4I09 A;  4I76 A;  5KAF C;  4HF0 A;  3CUQ A;  4CGZ A;  2F5V A;  2D5V A;  4IPA A;  1QHG A;  4D7M A;  2M1B A;  2ME6 A;  3QU3 A;  2PJR B;  2ZFW A;  1U6G A;  1IXS B;  2GOM A;  4AUX A;  2JJ7 A;  3V42 A;  5HNH A;  4AIJ A;  2ZME A;  4MFE A;  2H27 A;  2LMD A;  3FXJ A;  2HEO A;  3PIP F;  3C3W A;  4C30 A;  1BOB A;  4MIM A;  3KFW X;  3FM5 A;  1Z0X A;  2FML A;  3VPR A;  5TJJ A;  1QRY A;  1W7P B;  1WH5 A;  2CUJ A;  3ERM A;  2O6G E;  1Y39 A;  4I02 A;  2CW8 A;  3OS2 A;  2QBY B;  3BR6 A;  4II3 A;  3BPX A;  2V9K A;  3V4G A;  3OSG A;  2HWV A;  3ERE D;  2RVC A;  4XK4 A;  2PMZ N;  3TL4 X;  1TW2 A;  3VOD A;  1WJE A;  1B9M A;  3DKY A;  4BS9 A;  1ACI A;  4CCK A;  1MMG A;  2BW3 B;  2CSO A;  2HNH A;  4B1R A;  3ELK A;  3IKT A;  1FOX A;  4FE7 A;  4LLN A;  5KAI C;  1IN4 A;  4Z2Y A;  3DPU A;  4A0X A;  3LSM A;  3JRH A;  3S3N A;  2A3S A;  3OYH A;  1HW2 A;  2ISY A;  2M8E A;  1TP4 A;  2ZO4 A;  1Z77 A;  2IJL A;  2E5Z A;  3EDP A;  5A2Q Z;  4NBQ A;  1SAN A;  3V8L A;  4CCJ A;  3AG4 H;  3REO A;  2E1N A;  2ACJ A;  5F27 A;  3KYL A;  3QPH A;  4ENM A;  2GXA A;  3A01 B;  1XCB A;  2P0W A;  2DCE A;  2BHZ A;  3D0S A;  4M3E A;  2BY3 A;  4GYI A;  3JW4 A;  4M9Z A;  1IRG A;  4BXU A;  1GV5 A;  2DFI A;  4RS8 A;  4YG2 F;  2NOJ B;  4RAF A;  3S1N J;  2O03 A;  2MG4 A;  3DXJ F;  4V2G A;  3LFU A;  5F0F A;  4A5M A;  2F48 A;  3OYI A;  3BR3 A;  1IW7 F;  4KUM A;  1LDK B;  2JZY A;  4A6D A;  4B3A A;  3A02 A;  4M3D A;  2O9L A;  1MZB A;  2KJB A;  1YI2 I;  1HQC A;  1YS7 A;  1UJ8 A;  1YW7 A;  4G7O F;  3KP7 A;  2TCT A;  1OQY A;  2VJJ A;  3ZCO A;  2E5N A;  2F4O B;  1SFU A;  2JMW A;  1OMI A;  4DYR A;  1F5T A;  2JSP A;  4LB5 A;  2C6Y A;  1KU2 A;  4IHY A;  2JRM A;  4YFX F;  3LQQ A;  1YIJ I;  3GTL J;  1K6Y A;  5E1Z B;  3ESW B;  1ZQ3 P;  2NVT J;  2A6T A;  1A36 A;  4CH7 A;  4AYB N;  1USS A;  2CW0 F;  3CDL A;  2FOK A;  1X2N A;  3K4C A;  3PUB A;  5E20 A;  4ZC3 A;  2HQA A;  1Y0U A;  3PQJ A;  3ZR8 X;  1YW8 A;  1FX7 A;  1DGW Y;  4BKX A;  2M3A A;  2BY0 A;  2OUM A;  3HKZ N;  1FPQ A;  1T39 A;  1ETK A;  1BJZ A;  4CCN A;  1MMS A;  3WTT C;  1VQ5 I;  2AHQ A;  5D5U B;  2KZG A;  4A3J J;  3KX2 A;  5FGM A;  1OPC A;  2I10 A;  1BI3 A;  2WY8 Q;  1T2K A;  3WU1 B;  1IXR C;  1K78 B;  4BXX J;  1QGP A;  2ZXH A;  4AIH A;  4DYQ A;  2XC7 A;  1R7J A;  1B9N A;  1KYZ A;  2DA1 A;  3JSP A;  2RKH A;  3V7C A;  3OOP A;  5GAH J;  4N4N B;  4LD5 A;  5KCM A;  3CO6 C;  1LE8 B;  1QVT A;  2GOX B;  3CC4 I;  5DD4 A;  2XIG A;  2F6C A;  1YG2 A;  1MD0 A;  1MH4 A;  1I3Q J;  5CQE A;  4ANJ A;  3DBL B;  1O3Q A;  2EBI A;  5BOX A;  5A2Q K;  2JVH A;  3J80 Z;  4XKB A;  4OIQ F;  2LFB A;  2LF8 A;  4LK1 F;  3HRT A;  1MKM A;  2MH9 A;  2RGV A;  3BDD A;  2F2E A;  5M5X J;  5BNG A;  1YJW I;  3FXM A;  3CCL I;  1SD7 A;  1UCR A;  1FSE A;  4HQM A;  4O5V A;  5F64 A;  1ZRC A;  3RKW A;  1Y8R B;  2EIM H;  1WCM J;  3OR1 C;  2CGP A;  4BJ5 C;  4O3M A;  2DMQ A;  4RB1 A;  4RA2 A;  3OYA A;  1X3Z B;  3ASN H;  3HSE A;  3CJR B;  2LKS A;  1X3W B;  4ON0 A;  1LB2 A;  2FU4 A;  2QM3 A;  3I9V 2;  2WV0 A;  1OR7 C;  2XAS A;  1G4D A;  3DP7 A;  2QA4 I;  4UVC A;  1ERD A;  1SVM A;  3OS0 A;  4KIB A;  1RPW A;  5GAG J;  5CJ9 A;  1H89 C;  2ZSI B;  3PFI A;  1HKT A;  3GTM J;  1V4R A;  2CO5 A;  3CF5 F;  5BMZ A;  5FRM A;  1UMQ A;  4C2M J;  1W0U A;  2KT0 A;  5H6R A;  2IT0 A;  5ILS A;  2K9Q A;  2K9S A;  3L2U A;  5EYR A;  1K6O A;  4E7Z A;  1X1A A;  2CUE A;  3BR0 A;  1NK2 P;  2X1C A;  2DXI A;  3LST A;  4M9X A;  3FHZ A;  4ESB A;  2E2H J;  2Q1Z B;  1ZK8 A;  1XMK A;  1BW6 A;  2EB7 A;  1I6H J;  1VF9 A;  1B4A A;  1FIA A;  2L9N A;  5DCF A;  2NOG A;  3B6C A;  2IEK A;  1XDS A;  3JTH A;  1DDN A;  3JCU C;  3QWL A;  1TWC J;  2L4A A;  2O7O A;  4HV5 A;  4RAG A;  2KHM A;  3WU0 A;  1XSD A;  2G7H A;  2X9D A;  2Y2Z A;  1DP3 A;  4IF4 A;  4U88 A;  2P7V B;  2W1O A;  4MNU A;  3CDI A;  4IQ4 A;  3W3C A;  5EGO A;  3NWT A;  4D0P A;  3VYU B;  2YX4 A;  3LNQ A;  4OWR B;  1R4N B;  3ULQ B;  3PNY A;  3S3M A;  3O2P E;  2O8K A;  4CCM A;  4P9F A;  1IXC A;  4LJZ F;  3QQA A;  3T0Y A;  3OYF A;  4XRS G;  4ENN A;  3C2G A;  1N25 A;  1T08 B;  4Y7N J;  5M5Y J;  3GEZ A;  4QIW N;  3K4N A;  2VBY A;  3C7J A;  3M07 A;  3CCQ I;  1JGS A;  2OTL I;  1BJA A;  5CLS A;  4HOB A;  4J19 A;  1MIJ A;  1XPX A;  1K83 J;  1X4O A;  3RTR A;  2H94 A;  5HDN A;  1YTY A;  3CP8 A;  4IZZ A;  3R0A A;  5HOO A;  3IV5 A;  3K2Z A;  3E5Q A;  2D1V A;  5HLI A;  2PFB A;  4A3F J;  3KET A;  3QPT A;  3E6M A;  2CUF A;  3L00 A;  4J00 A;  1P9Q C;  3S8P A;  3IL2 A;  4I2O A;  2AXT C;  4M6V A;  2R0Q C;  2F5E A;  2OC6 A;  4E6K G;  4GRI A;  5FKM A;  1ONV A;  3I4M J;  1PP7 U;  1P6R A;  2IVM A;  3OYG A;  3LAJ A;  2RNG A;  2ADU A;  5EZH A;  2K40 A;  1X1P A;  1TWF J;  3RPU D;  3S14 J;  1R23 A;  4XLN F;  3C2B A;  3VYR B;  6PAX A;  2X85 A;  1U3E M;  2LG4 A;  1W4M A;  3I58 A;  5DUK A;  3GWZ A;  2Y30 A;  2DI3 A;  3NQO A;  4G6T B;  1BI2 A;  3TW6 A;  2MA3 A;  2XV4 S;  3BP8 A;  2E1M C;  1FZP B;  1FBS A;  1IV8 A;  4YEL A;  3GFM A;  3U2R A;  3CCR I;  3CTA A;  2OTJ I;  2QEN A;  4BBS J;  1S5L C;  4KMU X;  3DEE A;  3RIR A;  3P9C A;  3OYL A;  4BAC A;  1HLV A;  4ENK A;  4N9H A;  3G71 I;  2F5D A;  1VQN I;  3I64 A;  4KIF A;  1Z7U A;  4A3C J;  1SMT A;  2CQQ A;  2IPQ X;  2UXN A;  3HL2 A;  2EFO A;  1G59 A;  3ABT A;  2HKO A;  2KDO A;  2PEX A;  5E3N A;  3I4P A;  1Y56 A;  4A93 J;  4NQW A;  1IZ1 A;  1AWC A;  3L09 A;  2DOF A;  3CQZ J;  3R4K A;  3QYE A;  4P9U A;  1MW7 A;  3GW2 A;  3MWM A;  2M4K A;  3FIW A;  4A3B J;  1YE9 A;  2QUF A;  2W85 A;  1R5G A;  4NC7 A;  3HPG A;  4ZYD A;  3HHH A;  5ICG A;  2VOP A;  1K61 A;  1VQK I;  1G3T A;  2L7F P;  5LBQ A;  1E3O C;  4A0Y A;  1IAW A;  1RI7 A;  5L3G A;  2V4J C;  3NWS A;  1LFB A;  1I50 J;  2FBI A;  3BG3 A;  2K9M A;  2J5P A;  3CD6 I;  1O7L A;  2L7Z A;  1XDU A;  2XGC A;  3EUK L;  5J6X A;  2R7R A;  4OAY A;  3B73 A;  3GCM A;  1T33 A;  1EF4 A;  2VT3 A;  5FFX A;  1JGG A;  4DBR A;  3MVP A;  1ODD A;  2BYV E;  4U87 A;  4A0Z A;  2YUS A;  1MND A;  1MBE A;  3DU6 A;  5K5Q A;  2PN6 A;  3I4N J;  2DMN A;  2Z3Y A;  3BCA A;  1YIT I;  1HBX G;  2BY2 A;  1IDZ A;  2MD5 A;  2E35 A;  3H9Q A;  2RV8 A;  4AIK A;  3BG7 A;  1B72 B;  3RSN A;  2QSH X;  4KN4 X;  2HDW A;  4XQF A;  5FKO A;  4LIV A;  3KYC B;  3J7Z I;  5LHI A;  2IS2 A;  2HDD A;  1T56 A;  3JTG A;  2CS3 A;  1G3W A;  2WAD A;  2QKM B;  2DBB A;  3P9K A;  3K4B A;  4M3G A;  4W97 A;  1YHQ I;  1AHD P;  2BZT A;  4UV9 A;  3K70 D;  1ON2 A;  1RUN A;  4GCV A;  4IRI A;  2F5F A;  3ROU A;  5JR3 A;  1G2H A;  3BJ6 A;  4FT8 A;  5C4X J;  3ZXS A;  2OV7 A;  2XB0 X;  4IHV A;  4D9J A;  1N75 A;  3OWT A;  4G8X A;  2XF5 A;  1U5T B;  4LG0 A;  2L3D A;  2OU2 A;  2LY1 A;  5LLQ A;  4XKC A;  2VOO A;  4ZYE A;  4A3L J;  3T1B A;  5C4J J;  1ETV A;  3E1S A;  3K69 A;  1ENH A;  4HF1 A;  2ISZ A;  3FX3 A;  4MQV A;  1DUX C;  4NDL A;  4RM3 A;  1X58 A;  4L5E A;  1BN5 A;  2Y48 A;  3K10 A;  4HNT A;  2GXB A;  2LY9 A;  3QPS A;  1WJF A;  2M34 A;  1J75 A;  1FSH A;  3SJM A;  3AAF A;  2MFZ A;  3CO7 C;  4OIO F;  2R3S A;  4U7D A;  1TWH J;  5D6E A;  2OF7 A;  2G9W A;  1FJL A;  2VQH A;  2CQ7 A;  4ZZL A;  5DCM B;  2NNY A;  1A6I A;  3S2W A;  1BA5 A;  2MD0 A;  5K7H A;  2HXO A;  1TTY A;  1H88 C;  1D8K A;  4DGW B;  2P5K A;  1PP8 F;  2Y31 A;  4XOR A;  5JI6 A;  1ZGJ A;  3H5A A;  3L2V A;  1RRJ A;  2OJE D;  2ZXW H;  3RQI A;  1PUF A;  1ZYR F;  3CJN A;  1R1U A;  1NHA A;  3C1D A;  3I71 A;  2JT1 A;  1SC7 A;  3EQL F;  5CVU A;  1WWX A;  1MH3 A;  1BM9 A;  3CME I;  1K7A A;  1Z6T A;  3I59 A;  3IAS 2;  4KJZ A;  5F0C A;  3DFG A;  4B8X A;  3FIS A;  3HRS A;  4ZH4 F;  1JUP A;  2JSC A;  2OA4 A;  2E1O A;  3H36 A;  1APL C;  4RMN A;  3OYN A;  2WC2 A;  5J3L A;  2XSD C;  3HRU A;  4OIP F;  4YFK F;  1GDT A;  2IA1 A;  1QBJ A;  4F92 B;  5EEH A;  1OJL A;  4E7J A;  3MMY B;  4H0E A;  3GTO J;  4UUT A;  2M2E A;  2MW8 A;  2X1E A;  5E1X A;  4L9J A;  2R7S A;  2QYO A;  2K85 A;  1ETW A;  2NAZ A;  5K7Z A;  4GDF A;  2ECB A;  5FLM J;  1NH3 A;  3HUG B;  1FIP A;  2PMZ A;  3KIO A;  3CCE I;  4KT5 C;  1HST A;  1HDD C;  1A6Q A;  3X2Q H;  2UZK A;  3LSP A;  3MCZ A;  3B6A A;  3E97 A;  2BXZ A;  3HGY A;  4II2 A;  1FMW A;  1MMD A;  3BLY A;  4NB5 A;  1FOK A;  5ERI A;  3ZMS A;  5ED4 A;  3WGG A;  4UUS A;  5CVJ A;  2JN6 A;  4EVI A;  3WTX C;  9ANT A;  4ZTJ A;  4ZDP A;  2LY2 A;  2A68 F;  4JYK A;  4M3B A;  2A5Y B;  1YX3 A;  2QWW A;  3G3Z A;  3ZQH A;  4S05 A;  4IRG A;  1ZHF A;  1HW5 A;  3IKV A;  3MD2 A;  2LC2 A;  2VXD A;  4CCO A;  2XKP A;  4G9Y A;  5AIQ A;  3WTW C;  3MFK A;  2V1U A;  2UWM A;  1W7P D;  2OCE A;  2MGQ A;  2DK5 A;  2MSY A;  1ZRE A;  2N8G A;  2GA1 A;  2JA6 J;  4DW6 A;  5BPI A;  2A61 A;  2K4J A;  2OZ6 A;  4XSX F;  1ZR2 A;  3D5R C;  1YIO A;  3RDI A;  2G7U A;  4IRH A;  4CUG A;  3ZQL A;  2G0E A;  2R5Z B;  4HDV A;  1Z9C A;  2IS4 A;  1P4W A;  2QF7 A;  1X2M A;  5JVT A;  4DYC A;  2CFO A;  1XN7 A;  3BQY A;  5EJC A;  1Z67 A;  5J47 A;  3WG7 H;  3WGI A;  1S8N A;  4RLQ A;  3FXO A;  1W1W E;  1XCV A;  3GO5 A;  4QLC U;  3EUH A;  2DT6 A;  2VPR A;  4ENJ A;  4Q5S F;  4N4O B;  4UNO A;  4E7K A;  1CF7 B;  3JRB A;  4ASN A;  2K3P A;  1ZGW A;  3GZ6 A;  1I5Z A;  1YS6 A;  2M8G X;  1FP2 A;  1FC3 A;  3QOD A;  1A5J A;  2OZU A;  5GTI C;  4LFU A;  3L2R A;  5FFZ A;  2LVS A;  4AYB A;  4RB2 C;  1WKM A;  3H3U A;  4EGZ A;  1FMV A;  3H5N A;  3ZQF A;  3F6V A;  1TWG J;  2EV6 A;  2K3F A;  4BY1 J;  3BZK A;  3HZJ A;  1U8B A;  2L02 A;  1MDM A;  1Z6R A;  2V1X A;  4GXO A;  4RGU A;  3FMR A;  5JFR A;  4CYC B;  3WTS C;  2Z33 A;  5E3O A;  1ZTR A;  1E2X A;  4H4K C;  4RLF A;  1RR8 C;  4LOC A;  5LHH A;  1FT9 A;  1FY7 A;  2XGD A;  2IGN A;  5DUI A;  1HOM A;  2LF7 A;  3ASO H;  1UEL B;  4LIT A;  3MZH A;  1ZG5 A;  1OLT A;  2X6W A;  3K7A J;  4DNC A;  4EM1 A;  2GZW A;  3PNT A;  3CUQ B;  1F43 A;  1M1E B;  2MLG A;  3J7A Y;  1ZKG A;  3TO7 A;  2BE5 F;  1TT0 A;  3GUD A;  4PFO A;  5FKK A;  4OU0 A;  4EMS A;  4XID A;  1OYW A;  2ZME B;  4I01 A;  2HYF A;  2L9S A;  1FEX A;  5AON A;  5D8K B;  3HHG A;  1HSJ A;  5C3E J;  2V1N A;  1FTT A;  4U0V A;  1A31 A;  2KZV A;  3CLO A;  4KNY A;  5DM6 F;  4BDZ A;  4IHS A;  2L01 A;  4OMZ A;  4B3X A;  2PMU A;  3W6V A;  2LKP A;  2H1K A;  2BHY A;  5IT9 Z;  1WJB A;  1D0Z A;  2O0Y A;  5HVQ C;  2BXY A;  2KFD A;  5EF6 A;  2M0M A;  4JBA A;  4PFP A;  1IRF A;  2DQR A;  2TDX A;  2V9P A;  4GO1 A;  3TO6 A;  3R60 A;  2DDB A;  4A3G J;  3ZMZ A;  3QP5 A;  2KKO A;  1TZL A;  5J4Y A;  2VLA A;  4A3E J;  1BC8 C;  3MAJ A;  1PUE E;  3HPH A;  5BS6 A;  4GGG A;  1JKR C;  2ZJR F;  3ZMV A;  3JRD A;  2MBF A;  4XMY A;  4KFC A;  2DK8 A;  3LSH A;  4L9N A;  2V6E A;  3C18 A;  2E19 A;  3BZC A;  1S6L A;  1D5V A;  4HG2 A;  5BPD A;  4K2E A;  3F3X A;  5HDG A;  1BL0 A;  3HDD A;  2KQR A;  2K02 A;  4LGW A;  1ZAR A;  4OMY A;  1Z3Y A;  4JK1 X;  4MQ9 F;  1VFC A;  1ZGA A;  4UV8 A;  3F0C A;  5E3L A;  5J1U A;  1UZC A;  3DEW A;  3K4K A;  2YU3 A;  3H9J A;  2QZ8 A;  1DU0 A;  3OOU A;  1UG0 A;  5K5R A;  1H0M A;  4HA8 A;  3JAM Z;  3ZQQ A;  4I0B A;  2Q0O A;  4XSZ F;  5HLT A;  3KE2 A;  3PFY A;  1LKX A;  2FNP A;  2PBI A;  3UNG C;  1U8R A;  2COM A;  1VQ9 I;  1JHF A;  3BG9 A;  4ZDO A;  2LTP A;  4RGS A;  1GV2 A;  3DWL E;  3H0D A;  1AU7 A;  1Y1V J;  3LSJ A;  1U0J A;  4BQQ A;  2VJI A;  3CUO A;  3MKL A;  4EGY A;  2E71 A;  4FTH A;  3F8N A;  2YU9 J;  1UST A;  4C3J J;  1IUF A;  2H1L A;  1Y8Q B;  3WE2 A;  1VQP I;  2H6B A;  3NAU A;  1KGS A;  3W2W A;  1G8X A;  2VUM J;  3GLL A;  2IGK A;  3FHN A;  1YJN I;  2R7Z J;  2ZB9 A;  3FXU A;  3N97 A;  2W57 A;  2OQR A;  1LE8 A;  3H5R A;  4BU2 A;  1S3J A;  2EZK A;  2XKO A;  1JXS A;  3BJO A;  1OKR A;  2A05 A;  3ABK H;  2PMH A;  3FXQ A;  1R36 A;  3HOZ J;  4IL6 C;  1BR2 A;  1RNL A;  1AOY A;  2DT7 B;  1TL8 A;  5F1R A;  1ZH5 A;  3VYT B;  2XRL A;  2DTZ A;  3LQR A;  2L4M A;  3DLA A;  4BEH A;  3PNV A;  3KZZ A;  2DPD A;  2HOS A;  3M1E A;  1KA8 A;  3E5U A;  2LLK A;  4KIT B;  4IVN A;  1FYK A;  4B09 A;  1T6S A;  2X51 A;  1J7K A;  2VJ4 A;  3HOX J;  2KMU A;  4FQG A;  3QOE A;  2UUZ A;  3KEY A;  4F55 A;  3WGH A;  2UXX A;  3DTK A;  4ZTF A;  1T8I A;  2ELJ A;  3BTI A;  2KIQ A;  1JKP C;  1HF0 A;  2ID6 A;  3Q3S A;  2VKD A;  1D5Y A;  2Z1D A;  5IP6 A;  1LQ1 A;  4XKV A;  1J9I A;  4HX7 A;  1SEU A;  2H8R A;  5FO5 A;  2TRT A;  3FMS A;  2KRC A;  3TP0 A;  3LSK A;  1VQ6 I;  3ECH A;  3F8F A;  1VZ0 A;  1QQI A;  4CXF A;  1WJD A;  1XB4 A;  2WA0 A;  2P6S A;  3O3K A;  3H3V K;  2X6O A;  3FXR A;  2Y75 A;  2VIX A;  3OYB A;  3S1M J;  2EJR A;  2O8X A;  2W25 A;  3FF5 A;  3E7L A;  2E60 A;  4M74 A;  4A3I J;  3M9A A;  5F08 A;  3E0J B;  2V1D A;  5LGT A;  1FOW A;  1KU3 A;  5IYD J;  4EM2 A;  5IT3 A;  4UXN A;  2M30 A;  4EJU A;  5FD6 A;  5H20 A;  1T98 A;  3TO9 A;  2HOA A;  1EH8 A;  2K27 A;  2VQG A;  3OSF A;  2Y0S N;  2Y9Z A;  1DPU A;  1PDN C;  4MEX F;  3C2H A;  2H09 A;  2RDP A;  2Z9O A;  5CVI A;  2QQ8 A;  3K4J A;  4HRI A;  3J81 Z;  2VKE A;  3T8R A;  4CIC A;  4LIU A;  4Y33 A;  3JAM K;  1MSF C;  5JHF A;  4C2T A;  3DKX A;  4UB8 C;  3CF2 A;  4XLF A;  4A3M J;  5HS9 A;  2NVU B;  4AC0 A;  3OYK A;  2B9S A;  3N05 A;  3F8C A;  1MBG A;  1KON A;  2HR3 A;  1I1S A;  5IOZ A;  2DMT A;  4PUS A;  5DS9 A;  1FBU A;  1G3S A;  3HSF A;  3WHB A;  4JQF A;  1DGR M;  2JUC A;  3SFI A;  3V7R A;  4RAZ A;  2M87 A;  2LBF B;  3MKW B;  2ZSH B;  3UKG A;  5LRS A;  3GME A;  3ZRG A;  4JP0 A;  5M3M J;  2HDC A;  1ULY A;  2FA5 A;  2V9V A;  2Z99 A;  1Z91 A;  1AKH A;  3Q0V A;  3D5S C;  1LFP A;  2KRF A;  1LUJ B;  3BR5 A;  5L3C A;  3K70 C;  3I5U A;  1VQ8 I;  2EFW A;  3TDU C;  2QQB A;  3WTZ A;  2BY1 A;  1ZLK A;  2F4I A;  3S32 A;  1JHH A;  3KZY A;  1P4A A;  2R7W A;  1XX5 A;  2F4M B;  2FBK A;  4HST A;  1ZRD A;  1C0W A;  3BG5 A;  3L2Q A;  4DIQ A;  3TOA A;  4S0H B;  2R7U A;  4CZZ A;  1YJ9 I;  1T0F C;  1WVR A;  2ZCW A;  1X3U A;  4BUP A;  4IO9 F;  2YX7 A;  4HBL A;  2JVG A;  3D1N I;  1QVU A;  4E7S A;  3HOU J;  1X1B A;  3J80 K;  2W24 A;  4IQJ A;  1OCO H;  3I3L A;  2DYR H;  3TP3 A;  1IJW C;  1SD6 A;  3JRC A;  5EGO B;  1FOY A;  3BC8 A;  3KP5 A;  4Y17 A;  2H6C A;  5E8G A;  2ZNZ A;  1JT6 A;  3E6D A;  1BR1 A;  1YW9 A;  4XLC A;  1O3S A;  2ZFU A;  3FM3 A;  4AD9 A;  5GP9 A;  4AVP A;  3Q0U A;  2CU7 A;  5IPA A;  2JTV A;  3U1K A;  4X0G A;  1B1B A;  2DA4 A;  2HOT A;  1TLH B;  2ESN A;  4FIS A;  4X1E A;  5LGU A;  4HAM A;  3UR3 C;  3M3Y J;  3HBL A;  4EM0 B;  2HPM A;  1ZN2 A;  4WWC A;  3HOT A;  2Y0M A;  3K0L A;  2JPB A;  3SHF A;  1BIA A;  2RC4 A;  3HIF A;  3IP4 B;  1ZEL A;  3GX4 X;  2JK3 A;  3KYD B;  2GM4 A;  2FQ3 A;  2HGC A;  2EK5 A;  4QSH A;  5CYV A;  2BEO A;  3O6B B;  4MGR A;  2J5O A;  2R7V A;  5EZG A;  3DPT A;  2CQN A;  3LA2 A;  1JKO C;  2JRT A;  2EWN A;  3CMY A;  4G94 A;  4WXD A;  2EV5 A;  3AG3 H;  3K1N A;  4RDU A;  3JSO A;  4P5O A;  2JA8 J;  4NNJ A;  3V8J A;  2R7O A;  4XL9 A;  3ABL H;  4U0Y A;  4HPQ A;  4FET A;  4E70 A;  2KLO A;  1KQ9 A;  3BG6 A;  3KP4 A;  2FE3 A;  2X1D A;  3L2W A;  3CCU I;  3E6B A;  1MSE C;  1R6R A;  1GUU A;  2ZKZ A;  4IOC F;  5CPR B;  2D45 A;  3G73 A;  3PIO F;  3M4O J;  3OIP A;  1HW1 A;  4B48 A;  2HI3 A;  2MC4 A;  2CFX A;  2OCC H;  3HTU A;  2DA5 A;  4G6D A;  2RNJ A;  2JWT A;  2XVC A;  3KCC A;  4L9V A;  3VFZ A;  1ZR4 A;  2ETH A;  4BXF A;  5JVG F;  1IN8 A;  4AM3 A;  2O5R A;  3BPV A;  1NG6 A;  1MJ9 A;  2VXZ A;  4NQW B;  2XF7 A;  3T8T A;  1GXQ A;  2IAI A;  2P4W A;  2FMY A;  1YQA A;  1KYW A;  3F8M A;  2CUZ A;  2BBY A;  1GLN A;  1OR7 A;  2FD5 A;  5ICC A;  3HM5 A;  4KT6 A;  1B8I B;  1T95 A;  3SDB A;  2FQ4 A;  1V54 H;  3W2V A;  3PJR A;  2OPT A;  4BDY A;  1EKE A;  3TW7 A;  1LDD A;  1UG2 A;  2HZD A;  1F9N A;  4G7H F;  1IUY A;  3CUQ C;  3CLQ A;  2Q2E B;  1SFE A;  2XAG A;  3O8G A;  3Q9S A;  3R6S A;  4P96 A;  2CRG A;  3BRO A;  5FLV A;  3IWF A;  2MAB A;  3I56 I;  3LA7 A;  2P8T A;  1DU6 A;  2ZNY A;  1E3P A;  2W82 A;  1ON1 A;  4BGD A;  1MJA A;  2E7W A;  2PG4 A;  4D5C A;  2W4S A;  2ZME C;  4PK4 A;  4XM3 A;  2LRE A;  2VKV A;  3IAM 2;  5FD5 A;  2ZJQ F;  4MFD A;  1TBX A;  2FUG 2;  1SMY F;  4F7Z A;  1R22 A;  4BHP A;  3DPL C;  1Z7L A;  5B1B H;  4OIN F;  3L7W A;  1XS9 A;  1ZAO A;  1BBY A;  3M1C A;  4I0A A;  3K2A A;  3LSG A;  2E2I J;  4Y15 A;  1KZH A;  5EG0 A;  4B44 A;  2R4G A;  2LP0 A;  1WPK A;  4U0W A;  2FSW A;  3OV8 A;  1RET A;  1R58 A;  2XUB A;  5E3M A;  4XRS A;  1D0X A;  3OS1 A;  4PSX A;  5DDG A;  5EEG A;  1S7A A;  1P7I A;  1R1T A;  4IHX A;  3GF2 A;  3KEQ A;  1FYM A;  4KMF A;  5B1A H;  2QQ9 A;  4PSW A;  4NHJ A;  1RZ4 A;  2FRH A;  2KRH A;  4DBQ A;  2XB5 A;  4EJW A;  2DA7 A;  2MH2 A;  2Y69 H;  5FRN A;  4YFN F;  1AA7 A;  1H9G A;  3ZMD A;  1P2F A;  2VE8 A;  3KEO A;  3KP2 A;  4LG0 B;  2UV1 A;  2EPF A;  2F5C A;  1B59 A;  4AU7 A;  3TOB A;  1EH7 A;  2KL4 A;  5FRO A;  3KPH A;  3MEX A;  2HTS A;  1V5F A;  3W2A A;  3F9K A;  4Y4R A;  5F04 A;  4XKW A;  4P1W A;  3RQ4 A;  5GAE J;  4I98 B;  2HKX A;  5IP7 J;  1PJR A;  4M3F A;  3SQN A;  1A35 A;  1O3R A;  4EQQ A;  2XF6 A;  4BE0 A;  1W36 D;  1Z21 A;  1QPM A;  3PO2 J;  3S2H J;  2WB1 N;  2R5Y A;  3H1C A;  2ICW G;  1BR4 A;  1EA3 A;  2BOL A;  2KIM A;  2CV1 A;  4BBR J;  2X6X A;  2HTJ A;  4G12 A;  4XN0 A;  1L3L A;  2QLZ A;  4JX5 A;  2WTE A;  2WAQ N;  3QYF A;  1IF1 A;  3DKW A;  4HZF A;  2AO9 A;  3S93 A;  3I55 I;  2K7L A;  1XMA A;  2EFP A;  4HNU A;  4MTE A;  2ME0 A;  1I6X A;  2I5U A;  1RKW A;  4KA4 A;  2ZBK A;  1TT5 B;  4EEF G;  3S1R J;  2STT A;  2L0K A;  3EYY A;  4XRF A;  1OYY A;  4I99 C;  1W5C C;  1PUF B;  1QPI A;  2DYS H;  3WU2 C;  4CSW A;  2E1C A;  2NVX J;  5J40 A;  2HVS A;  2M4G A;  3EUA A;  3L1P A;  2HOE A;  2DDA A;  3OIO A;  3PSI A;  2ESH A;  3PM1 A;  3CZ6 A;  4P55 A;  3F21 A;  2QQA A;  3I59 B;  2HXI A;  1TW3 A;  2DA2 A;  3LOC A;  2M5W A;  1XGS A;  1X1C A;  4LB6 B;  3TKY A;  3MN2 A;  3G1M A;  3MKZ A;  5HNF A;  4HLX A;  2VE9 A;  2GIV A;  2R7X A;  4A5N A;  5FKN A;  1YRN B;  1NK3 P;  2DMP A;  2HQ5 A;  2JPC A;  2IRF G;  4HX4 A;  3S2D J;  3RCO A;  4C2U A;  4CCL A;  2VJ5 A;  5GAD J;  2HZT A;  1XMX A;  2DMU A;  3S3O A;  3GFJ A;  1POG A;  4OAZ A;  2LH9 A;  1FYL A;  5JLX A;  4X6A J;  5LGN A;  2NXN B;  4BL0 B;  2VBZ A;  4E7I A;  3GFI A;  3NEU A;  3BOQ A;  3WTY C;  1IRX A;  1W0T A;  4QPO A;  3P9I A;  3F72 A;  3WG9 A;  5GTH C;  3QPL A;  3PO3 J;  1S9H A;  1CF7 A;  1JTY A;  3S15 J;  2M45 A;  2K9L A;  3GZ5 A;  4G6Q A;  4BJT A;  4L5J A;  5DD8 A;  5D5V B;  4UUS B;  1WJC A;  3BR1 A;  1ETY A;  1Z3X A;  2WV1 A;  3FK6 A;  1HDP A;  3KLN A;  4M6X A;  4NC8 A;  3IRQ A;  2PJR A;  4IXA A;  2AQE A;  3FMQ A;  2RRE A;  1XGN A;  3VEP A;  1SVL A;  3RKQ A;  4XOP A;  3ZN0 A;  3BTL A;  4HSR A;  2DA6 A;  3J7A O;  3IH3 A;  1U9N A;  4HV6 A;  1W5S A;  2XAF A;  3ZMU A;  4D7N A;  2D2W A;  2L7M P;  3DV8 A;  2NVY J;  3GLX A;  2VB6 A;  3LWF A;  3QOP A;  4DZP A;  4YII A;  3RYP A;  1K4S A;  2K9N A;  1W7P A;  3CJT B;  3HOW J;  1QZE A;  2NNN A;  1HKS A;  1U2W A;  2ELK A;  3GYH X;  2QBY A;  3CC2 I;  3PSF A;  3VYS B;  3TMO A;  2NS7 A;  4IEJ A;  1ETO A;  3AKZ A;  1WZ2 A;  2IA0 A;  2ZXI A;  2L2O A;  3HKZ A;  5LEJ A;  3E6C C;  5DV5 A;  5J4V A;  4DJA A;  4KIC A;  3F6O A;  2BW3 A;  2VAS A;  4GYG A;  1WHU A;  3RKY A;  3S17 J;  3E5X A;  4GFB A;  3L9F A;  5H2F C;  1SFK A;  1P4X A;  2STW A;  1LPQ A;  5HDK A;  3F8B A;  3ABU A;  1VQO I;  1B6A A;  3CDH A;  2DW4 A;  4ZZD A;  4RM2 A;  2CYY A;  2M7A A;  2HPI A;  2KP6 A;  3U1D A;  4G7Z F;  2DN0 A;  5D4S A;  2FF4 A;  5J1Y A;  1J59 A;  1MBK A;  1QZY A;  4AWX B;  2PI0 A;  3BY6 A;  1UHW A;  4MO7 A;  3E3V A;  4MTD A;  3HGG A;  4WX9 A;  1DPR A;  2KIF A;  4KDP A;  1N78 A;  3GVA A;  3I54 A;  3U9G A;  4BQN A;  3A01 A;  1OCZ H;  3HYI A;  3WE3 A;  2R92 J;  4TV7 A;  2RN7 A;  4BHB A;  3CCS I;  1YOV B;  1R71 A;  1MJB A;  3R0J A;  4HDU A;  3A0B C;  5IP9 J;  1MDM B;  2LOO A;  5E1W A;  1VND A;  5J8C A;  4Y13 A;  4M71 A;  3A2K A;  2E36 A;  4R8H A;  5BQT A;  1MMA A;  5L3B A;  2GXG A;  1R9T J;  3TBI A;  1OCR H;  1R5I D;  3J7Y J;  2QSF X;  3DEU A;  4YIF A;  4JOM A;  5FLX Z;  2IGM A;  3G6E I;  1BI1 A;  1NTC A;  1OYI A;  4XRM A;  1EV7 A;  2P5L C;  5DM7 F;  3GTK J;  1P92 A;  4LG3 A;  3CCY A;  3IH4 A;  3OR2 C;  4CDG A;  1VTN C;  3FK7 A;  4PDK A;  3K4L A;  2EZL A;  2EA2 A;  1R1V A;  3AL0 B;  4B47 A;  3RKX A;  2IP2 A;  2VBX A;  4BE2 A;  1ZG1 A;  3SFZ A;  1LVK A;  1BW5 A;  1WI3 A;  1WJA A;  3N4M A;  1GXP A;  1LEB A;  2NS8 A;  5KHD A;  2D1H A;  1E3H A;  5GPC A;  4WCG A;  1F1Z A;  3LSI A;  2HQR A;  2CMP A;  3BCB A;  4KYW A;  1IV6 A;  1BOA A;  4DOZ A;  2VQC A;  4CHU A;  1STZ A;  2X48 A;  4Y52 J;  4IKF A;  3L2C A;  5JLW A;  1OCP A;  2Y0S A;  2V79 A;  3ZGK A;  2LYC A;  5B5E C;  2LKX A;  3GTJ J;  4DQ2 A;  1S7E A;  4QWQ A;  4CO8 A;  2I8D A;  3WHC A;  3FKJ A;  3JRF A;  3IH2 A;  1CGP A;  3M8E A;  1A04 A;  4C3H J;  2EIK H;  5HOD A;  1IDY A;  3F22 A;  5HLG A;  2LSO A;  3Q0W A;  2WWY A;  2JQ7 A;  4PGH A;  2JUG A;  3GZN B;  1K78 A;  4EJV A;  1S72 I;  2M7B A;  2Z5U A;  1TQI A;  3K6G A;  2DOD A;  1ZRF A;  1GVD A;  1O57 A;  1LNW A;  2ELH A;  4A3K J;  3PL8 A;  2EIJ H;  3LL7 A;  4MLO A;  3R61 A;  5F6F A;  4KN7 X;  4PGG A;  3W6K B;  2W00 A;  3BTJ A;  3RI4 A;  2CWE A;  5C44 J;  2VT2 A;  4ITV A;  2IS1 A;  5JHU A;  1Y6I A;  1J0R A;  3V8K A;  2VN2 A;  1MGT A;  1LFU P;  1Y0N A;  2Z16 A;  3KP3 A;  3HSR A;  3DLL F;  4YEJ A;  4UY8 I;  3H92 A;  2NS0 A;  1RC9 A;  4FX4 A;  1F36 A; 
#chains in the Genus database with same CATH homology
 4IJA A;  4MEY F;  1QNT A;  1D8J A;  3WTU C;  2EFQ A;  3D5L A;  2A6H F;  1XGO A;  2BGC A;  1IN6 A;  3ZN1 A;  1DP7 P;  5DYM A;  3TGN A;  4ESF A;  2QVO A;  4ZYH A;  1LDJ A;  1YLF A;  1FNN A;  5KK1 A;  5E18 F;  5L3E A;  3HTS B;  5LHG A;  5L3D A;  5IT9 K;  2VOD A;  4BQA A;  5FLX K;  2IW5 A;  2EA4 A;  2DQL A;  3I53 A;  4UVA A;  4L5I A;  4UHT A;  2MC3 A;  2AXL A;  3WOD F;  2XAQ A;  2KIU A;  3M8F A;  1YFH A;  2VON A;  2W84 A;  1U5T C;  2HQN A;  3DF8 A;  3COA C;  4UVB A;  4Q4Z F;  4BAY A;  2GAU A;  1YO5 C;  3F23 A;  5CVR A;  4A12 A;  1E17 A;  1W5T A;  4EJO A;  2DTR A;  3P7N A;  4XBF A;  2VC0 A;  5D5X B;  4RB0 A;  5ICF A;  4WF2 A;  4FHT A;  1HKQ A;  1Z1D A;  4KIG A;  2K86 A;  2IA2 A;  4IHT A;  2BV6 A;  3QAH A;  1D3Y A;  4PCQ A;  3IC7 A;  3VB2 A;  4L9T A;  2LDU A;  5D4R A;  1LVA A;  2A6E F;  2P7C B;  1FBQ A;  1O3T A;  4M6Y A;  1G3Y A;  5J8F A;  2OBP A;  1XSV A;  2OAZ A;  2PJP A;  2DLL A;  5AIP A;  5K1Y A;  2HFH A;  4ZYG A;  4S04 A;  3K9T A;  3WTV C;  4HF2 A;  1V3F A;  2GA2 A;  2XRN A;  1XGM A;  2XRO A;  1T38 A;  1IN5 A;  2YPR A;  1QZZ A;  4O6J A;  4N0B A;  5KVR A;  1FP1 D;  3KP6 A;  5D8L B;  3MQ0 A;  2AS5 F;  3BWG A;  3KLO A;  4N9I A;  3QRF F;  2DAO A;  3BZ6 A;  1FLI A;  4HQE A;  4M72 A;  3B02 A;  1IN7 A;  3ZMT A;  2NRA C;  2XHK A;  2YSR A;  3SZT A;  1WI9 A;  3VOE A;  3EYI A;  3ML6 A;  4CYD A;  3EET A;  4XLP F;  2E7X A;  2GQQ A;  1Q1H A;  1GVJ A;  2FNA A;  1O7F A;  3IHU A;  3J81 K;  1KQ8 A;  2L54 A;  3RPU A;  3GFL A;  2P6T A;  4OOI A;  2YR2 A;  4EJT A;  3HOS A;  4OIR F;  4UUV A;  1ZLJ A;  2ZXJ A;  2XAH A;  2P5V A;  2RQP A;  3ZPL A;  2R7D A;  1U78 A;  5FB2 A;  2XGX A;  5CVV A;  4A2U A;  3ECO A;  4WXH A;  2Q2E A;  1UHM A;  2K4B A;  5H6Q A;  3BJA A;  3TQN A;  2PQ8 A;  2VC1 A;  1WSU A;  1U5T A;  4Q47 A;  4RB3 C;  3QU6 A;  4WK8 F;  1EH6 A;  1G6N A;  3V7S A;  3H3Z A;  4EV0 A;  3DQV C;  3FZV A;  2Q8K A;  4L18 B;  4LLL A;  1REP C;  4HX8 A;  1JE8 A;  3RJP A;  5DCM A;  4Q48 A;  4I7H A;  2CG4 A;  4FX0 A;  1I27 A;  1TNS A;  2A07 F;  1WQ2 A;  1GHC A;  1LEA A;  2MLK A;  3ISP A;  5HS8 A;  3K1M A;  3W6J B;  1WRJ A;  3HRM A;  1XSX A;  2FXA A;  1KU7 A;  1J2X A;  1Z05 A;  4HLY A;  1XD7 A;  3TDZ C;  5K5O A;  1RIO H;  3QP6 A;  2GWR A;  2DU9 A;  2EFN A;  3GXO A;  1BI0 A;  3M7G A;  5LRR A;  4L0Z B;  1TNT A;  3T5X A;  3RYR A;  2DPU A;  4RGX A;  5LEK A;  4L0Y B;  1UB9 A;  1RUO A;  4PZJ A;  1R00 A;  3ZP5 A;  2CQK A;  2LNB A;  4BH9 A;  3PQK A;  1I1G A;  3IRR A;  1K79 A;  4ETS A;  5TRD A;  4RGR A;  1SFX A;  1T0F A;  3HUG A;  1ZG3 A;  4LLG F;  2DO7 A;  5ILU A;  3LA3 A;  2X4H A;  1F4K A;  1YYV A;  3MZY A;  2O3F A;  4ESJ A;  4HW0 A;  1R5H A;  1SD5 A;  3I0T A;  2HYG D;  4M9S A;  1FWZ A;  1S29 A;  4WXC A;  1H9T A;  5E8I A;  5D5W B;  3Q5F A;  3LAP A;  2PLY A;  4M73 A;  1LJ9 A;  2O61 A;  2EV0 A;  3SZP A;  2A69 F;  5ICE A;  3NRV A;  1TQP A;  2B0L A;  2ZJ2 A;  4MHG A;  4LK0 F;  4R79 A;  2OQG A;  4A6E A;  5ILV A;  3Q9V A;  2R7F A;  1TQM A;  5E17 F;  5DEQ A;  2DT5 A;  5HS7 A;  1S7O A;  2V6C A;  4RAY A;  2FBH A;  3SXY A;  3FWE A;  1QO0 D;  5D6F A;  3LFK A;  1KQ0 A;  4R1H A;  4BHC A;  5L3F A;  1BC7 C;  1J5Y A;  1HXD A;  2VBW A;  4BNC A;  1KU9 A;  2HS5 A;  5HLH A;  2NYX A;  4HYE A;  3ZQ7 A;  3RPQ A;  1BIB A;  1SD4 A;  4BYY A;  1UFM A;  3IWZ A;  4LMY A;  1L0O C;  1SAX A;  2XAJ A;  4U7B A;  2KJC A;  2FEZ A;  2X0L A;  4I09 A;  2OD5 A;  4HF0 A;  3CUQ A;  4CGZ A;  4IPA A;  2M1B A;  3QU3 A;  2ZFW A;  1U6G A;  1IXS B;  4AIJ A;  2ZME A;  2H27 A;  2HEO A;  3C3W A;  3KFW X;  3FM5 A;  2FML A;  5TJJ A;  1W7P B;  2O6G E;  4I02 A;  2QBY B;  3BPX A;  3V4G A;  2HWV A;  3ERE D;  2RVC A;  1TW2 A;  3VOD A;  1B9M A;  2CSO A;  3ELK A;  3IKT A;  4LLN A;  1IN4 A;  4Z2Y A;  4A0X A;  1HW2 A;  2A3S A;  2ISY A;  2M8E A;  2ZO4 A;  2IJL A;  3EDP A;  5A2Q Z;  3V8L A;  3REO A;  2E1N A;  2ACJ A;  3QPH A;  4ENM A;  1XCB A;  3D0S A;  4GYI A;  3JW4 A;  4M9Z A;  1IRG A;  4BXU A;  2DFI A;  4RS8 A;  4YG2 F;  2O03 A;  3DXJ F;  4A5M A;  1IW7 F;  4KUM A;  1LDK B;  2JZY A;  4A6D A;  1MZB A;  2KJB A;  1HQC A;  1YS7 A;  1YW7 A;  4G7O F;  3KP7 A;  1SFU A;  1OMI A;  1F5T A;  4LB5 A;  2C6Y A;  1KU2 A;  4YFX F;  3LQQ A;  5E1Z B;  1USS A;  2CW0 F;  2FOK A;  5E20 A;  1Y0U A;  3PQJ A;  1YW8 A;  1FX7 A;  1FPQ A;  1T39 A;  3WTT C;  5D5U B;  5FGM A;  1OPC A;  1BI3 A;  1T2K A;  3WU1 B;  1IXR C;  1K78 B;  1QGP A;  4AIH A;  1R7J A;  1B9N A;  1KYZ A;  3JSP A;  2RKH A;  3V7C A;  3OOP A;  4LD5 A;  3CO6 C;  5DD4 A;  2XIG A;  1YG2 A;  1MD0 A;  1O3Q A;  5BOX A;  5A2Q K;  3J80 Z;  4OIQ F;  2LF8 A;  4LK1 F;  3HRT A;  1MKM A;  2MH9 A;  2RGV A;  2F2E A;  3BDD A;  1SD7 A;  1UCR A;  1FSE A;  4HQM A;  4O5V A;  5F64 A;  1ZRC A;  3RKW A;  2CGP A;  4O3M A;  4RB1 A;  3HSE A;  1LB2 A;  4ON0 A;  2FU4 A;  2QM3 A;  2WV0 A;  2XAS A;  1G4D A;  3DP7 A;  4UVC A;  4KIB A;  5CJ9 A;  3PFI A;  1HKT A;  1V4R A;  2CO5 A;  5BMZ A;  5H6R A;  2IT0 A;  5ILS A;  1K6O A;  3LST A;  4M9X A;  3FHZ A;  4ESB A;  1XMK A;  2EB7 A;  1B4A A;  5DCF A;  1XDS A;  3JTH A;  1DDN A;  2L4A A;  4HV5 A;  3WU0 A;  1XSD A;  2G7H A;  4IF4 A;  4U88 A;  2P7V B;  4MNU A;  4D0P A;  2YX4 A;  3ULQ B;  3O2P E;  4P9F A;  1IXC A;  4LJZ F;  3T0Y A;  4ENN A;  3GEZ A;  2VBY A;  3C7J A;  1JGS A;  1BJA A;  5CLS A;  4HOB A;  3RTR A;  2H94 A;  5HDN A;  1YTY A;  3R0A A;  5HOO A;  3K2Z A;  3E5Q A;  2D1V A;  5HLI A;  2PFB A;  3KET A;  3QPT A;  3E6M A;  3L00 A;  3IL2 A;  4I2O A;  2F5E A;  1ONV A;  1PP7 U;  1P6R A;  2IVM A;  3LAJ A;  2ADU A;  1R23 A;  4XLN F;  6PAX A;  1U3E M;  1W4M A;  3I58 A;  5DUK A;  3GWZ A;  3NQO A;  2DI3 A;  1BI2 A;  2MA3 A;  2XV4 S;  3BP8 A;  1FZP B;  1FBS A;  3GFM A;  3U2R A;  3CTA A;  2QEN A;  4KMU X;  3RIR A;  3P9C A;  4ENK A;  4N9H A;  2F5D A;  3I64 A;  4KIF A;  1Z7U A;  1SMT A;  2IPQ X;  2UXN A;  2EFO A;  3ABT A;  2HKO A;  2PEX A;  3I4P A;  4NQW A;  1IZ1 A;  1AWC A;  3L09 A;  3R4K A;  4P9U A;  3GW2 A;  3MWM A;  2QUF A;  2W85 A;  1R5G A;  4ZYD A;  3HHH A;  5ICG A;  2VOP A;  1G3T A;  5LBQ A;  4A0Y A;  1IAW A;  1RI7 A;  5L3G A;  2FBI A;  2J5P A;  1O7L A;  1XDU A;  5J6X A;  3B73 A;  2VT3 A;  5FFX A;  1ODD A;  2BYV E;  4A0Z A;  5K5Q A;  2PN6 A;  2Z3Y A;  1HBX G;  2MD5 A;  2RV8 A;  4AIK A;  4KN4 X;  5LHI A;  3JTG A;  3P9K A;  1G3W A;  2DBB A;  4UV9 A;  1ON2 A;  1RUN A;  4GCV A;  4IRI A;  2F5F A;  3ROU A;  5JR3 A;  3BJ6 A;  4FT8 A;  4G8X A;  1U5T B;  4LG0 A;  2L3D A;  2OU2 A;  5LLQ A;  2VOO A;  4ZYE A;  3T1B A;  3K69 A;  4HF1 A;  2ISZ A;  3FX3 A;  4MQV A;  1DUX C;  1BN5 A;  2Y48 A;  2GXB A;  1FSH A;  1J75 A;  3AAF A;  3CO7 C;  4OIO F;  2R3S A;  4U7D A;  5D6E A;  2G9W A;  4ZZL A;  5DCM B;  2NNY A;  3S2W A;  1TTY A;  1D8K A;  1PP8 F;  2P5K A;  5JI6 A;  1ZGJ A;  1ZYR F;  3CJN A;  1R1U A;  1NHA A;  3C1D A;  3I71 A;  2JT1 A;  3EQL F;  5CVU A;  1WWX A;  1BM9 A;  1K7A A;  1Z6T A;  3I59 A;  3DFG A;  4B8X A;  3HRS A;  4ZH4 F;  2JSC A;  2OA4 A;  2WC2 A;  4OIP F;  3HRU A;  4YFK F;  2IA1 A;  1QBJ A;  5EEH A;  4H0E A;  5E1X A;  4L9J A;  2QYO A;  2NAZ A;  4KT5 C;  1HST A;  2UZK A;  3MCZ A;  3E97 A;  1FOK A;  4NB5 A;  5ERI A;  3ZMS A;  5ED4 A;  3WGG A;  5CVJ A;  4EVI A;  3WTX C;  2A68 F;  2A5Y B;  2QWW A;  3G3Z A;  4S05 A;  4IRG A;  1ZHF A;  1HW5 A;  3IKV A;  2XKP A;  5AIQ A;  4G9Y A;  3WTW C;  3MFK A;  2V1U A;  2UWM A;  1W7P D;  2DK5 A;  1ZRE A;  2GA1 A;  5BPI A;  2A61 A;  2K4J A;  2OZ6 A;  4XSX F;  1YIO A;  3RDI A;  2G7U A;  4IRH A;  4HDV A;  1Z9C A;  1P4W A;  5JVT A;  1XN7 A;  3WGI A;  1S8N A;  1XCV A;  3GO5 A;  4QLC U;  3EUH A;  4ENJ A;  4Q5S F;  4UNO A;  1CF7 B;  4ASN A;  3GZ6 A;  1I5Z A;  1YS6 A;  1FP2 A;  1FC3 A;  2OZU A;  4LFU A;  5FFZ A;  4RB2 C;  1WKM A;  3H3U A;  4EGZ A;  3F6V A;  2EV6 A;  2L02 A;  1MDM A;  1Z6R A;  2V1X A;  4GXO A;  4RGU A;  3FMR A;  5JFR A;  3WTS C;  2Z33 A;  1E2X A;  5LHH A;  1FT9 A;  1FY7 A;  5DUI A;  2LF7 A;  3MZH A;  1ZG5 A;  4DNC A;  4EM1 A;  2GZW A;  3CUQ B;  2MLG A;  3TO7 A;  2BE5 F;  3GUD A;  4OU0 A;  4EMS A;  1OYW A;  2ZME B;  4I01 A;  2HYF A;  5AON A;  5D8K B;  3HHG A;  1HSJ A;  4U0V A;  3CLO A;  4KNY A;  4IHS A;  2L01 A;  4OMZ A;  2PMU A;  2LKP A;  5IT9 Z;  2O0Y A;  5HVQ C;  4JBA A;  1IRF A;  2DQR A;  2TDX A;  4GO1 A;  3TO6 A;  3R60 A;  3ZMZ A;  3QP5 A;  2KKO A;  1BC8 C;  3MAJ A;  1PUE E;  5BS6 A;  4GGG A;  3ZMV A;  2MBF A;  4KFC A;  2DK8 A;  4L9N A;  3C18 A;  1S6L A;  1D5V A;  5BPD A;  4K2E A;  3F3X A;  5HDG A;  2K02 A;  4LGW A;  1ZAR A;  4OMY A;  4JK1 X;  4MQ9 F;  1ZGA A;  4UV8 A;  2YU3 A;  2QZ8 A;  5K5R A;  1H0M A;  4HA8 A;  3JAM Z;  4I0B A;  2Q0O A;  4XSZ F;  3KE2 A;  2FNP A;  2PBI A;  1U8R A;  2COM A;  1JHF A;  4RGS A;  3CUO A;  4EGY A;  3F8N A;  1UST A;  3WE2 A;  2H6B A;  1KGS A;  3FXU A;  3N97 A;  2W57 A;  2OQR A;  1S3J A;  2XKO A;  1JXS A;  3BJO A;  1OKR A;  2PMH A;  3FXQ A;  1R36 A;  1RNL A;  1AOY A;  5F1R A;  1ZH5 A;  3LQR A;  2L4M A;  3KZZ A;  2DPD A;  3M1E A;  1KA8 A;  3E5U A;  4IVN A;  1FYK A;  4B09 A;  1T6S A;  1J7K A;  3WGH A;  2UXX A;  1LQ1 A;  1J9I A;  4HX7 A;  5FO5 A;  3FMS A;  3ECH A;  3F8F A;  1QQI A;  4CXF A;  1XB4 A;  3O3K A;  2P6S A;  3FXR A;  2Y75 A;  2EJR A;  2O8X A;  2W25 A;  3FF5 A;  4M74 A;  3M9A A;  2V1D A;  5LGT A;  1KU3 A;  4EM2 A;  5IT3 A;  4UXN A;  2M30 A;  4EJU A;  5FD6 A;  5H20 A;  1T98 A;  3TO9 A;  1EH8 A;  2K27 A;  1DPU A;  1PDN C;  4MEX F;  2H09 A;  2RDP A;  2Z9O A;  5CVI A;  3J81 Z;  3T8R A;  4CIC A;  3JAM K;  5HS9 A;  3F8C A;  2HR3 A;  1I1S A;  1FBU A;  1G3S A;  3HSF A;  4JQF A;  3V7R A;  4RAZ A;  2M87 A;  5LRS A;  2HDC A;  1ULY A;  2FA5 A;  2V9V A;  2Z99 A;  1Z91 A;  2KRF A;  5L3C A;  3I5U A;  2EFW A;  3TDU C;  2QQB A;  3WTZ A;  1ZLK A;  1JHH A;  3KZY A;  1P4A A;  2FBK A;  1ZRD A;  1C0W A;  3TOA A;  4CZZ A;  2ZCW A;  1X3U A;  2YX7 A;  4HBL A;  3J80 K;  2W24 A;  1SD6 A;  3KP5 A;  4Y17 A;  2H6C A;  5E8G A;  2ZNZ A;  3E6D A;  1YW9 A;  1O3S A;  3FM3 A;  4AD9 A;  4AVP A;  2JTV A;  1B1B A;  1TLH B;  2ESN A;  5LGU A;  4HAM A;  4EM0 B;  1ZN2 A;  4WWC A;  3HOT A;  2Y0M A;  3K0L A;  2JPB A;  3SHF A;  1BIA A;  2RC4 A;  3HIF A;  3GX4 X;  2FQ3 A;  2HGC A;  2EK5 A;  5CYV A;  2BEO A;  3O6B B;  4MGR A;  2J5O A;  3DPT A;  3LA2 A;  2JRT A;  2EWN A;  4G94 A;  4WXD A;  2EV5 A;  3K1N A;  3JSO A;  4P5O A;  3V8J A;  4U0Y A;  4E70 A;  1KQ9 A;  3KP4 A;  2FE3 A;  3E6B A;  2ZKZ A;  2D45 A;  3G73 A;  1HW1 A;  2CFX A;  3HTU A;  4L9V A;  4G6D A;  2RNJ A;  2XVC A;  3KCC A;  3VFZ A;  2ETH A;  1IN8 A;  3BPV A;  1MJ9 A;  2VXZ A;  3T8T A;  1GXQ A;  2P4W A;  2FMY A;  1YQA A;  1KYW A;  3F8M A;  2BBY A;  1OR7 A;  5ICC A;  1LDD A;  1F9N A;  4G7H F;  1IUY A;  3CUQ C;  2XAG A;  1SFE A;  3Q9S A;  3R6S A;  4P96 A;  3BRO A;  3IWF A;  3LA7 A;  2P8T A;  2ZNY A;  1ON1 A;  1MJA A;  2E7W A;  2PG4 A;  5FD5 A;  1TBX A;  1SMY F;  4F7Z A;  1R22 A;  4BHP A;  3DPL C;  4OIN F;  3L7W A;  1ZAO A;  1BBY A;  4I0A A;  4Y15 A;  4U0W A;  2FSW A;  3OV8 A;  1R58 A;  2XUB A;  5DDG A;  5EEG A;  1S7A A;  1R1T A;  3GF2 A;  3KEQ A;  1FYM A;  4KMF A;  2QQ9 A;  4NHJ A;  1RZ4 A;  2FRH A;  4EJW A;  2MH2 A;  4YFN F;  1H9G A;  3ZMD A;  1P2F A;  2VE8 A;  3KEO A;  3KP2 A;  4LG0 B;  2F5C A;  1B59 A;  3TOB A;  1EH7 A;  3MEX A;  2HTS A;  4I98 B;  2HKX A;  3SQN A;  1O3R A;  4EQQ A;  1QPM A;  2KIM A;  2HTJ A;  1L3L A;  2QLZ A;  2WTE A;  1IF1 A;  3DKW A;  4HZF A;  2K7L A;  1XMA A;  2EFP A;  4MTE A;  1I6X A;  4KA4 A;  2ZBK A;  2STT A;  3EYY A;  4XRF A;  1OYY A;  2E1C A;  2HOE A;  2ESH A;  3F21 A;  4P55 A;  2QQA A;  3I59 B;  1TW3 A;  2M5W A;  1XGS A;  4LB6 B;  3TKY A;  4HLX A;  2VE9 A;  2GIV A;  4A5N A;  2JPC A;  2IRF G;  4HX4 A;  2HZT A;  3GFJ A;  1FYL A;  5LGN A;  2VBZ A;  3GFI A;  3NEU A;  3BOQ A;  3WTY C;  3P9I A;  3F72 A;  3WG9 A;  1CF7 A;  2M45 A;  3GZ5 A;  4G6Q A;  4L5J A;  5DD8 A;  5D5V B;  3KLN A;  4M6X A;  3IRQ A;  4IXA A;  3FMQ A;  1XGN A;  3VEP A;  3ZN0 A;  3J7A O;  4HV6 A;  1W5S A;  2XAF A;  3ZMU A;  2D2W A;  3DV8 A;  3GLX A;  3LWF A;  3QOP A;  4YII A;  3RYP A;  1W7P A;  2NNN A;  1HKS A;  1U2W A;  3GYH X;  2QBY A;  2IA0 A;  3E6C C;  5LEJ A;  5DV5 A;  4KIC A;  3F6O A;  4GYG A;  3RKY A;  3E5X A;  3L9F A;  1P4X A;  2STW A;  5HDK A;  3F8B A;  3ABU A;  1B6A A;  3CDH A;  2DW4 A;  4ZZD A;  2CYY A;  3U1D A;  4G7Z F;  5D4S A;  2FF4 A;  1J59 A;  1QZY A;  4AWX B;  2PI0 A;  3BY6 A;  1UHW A;  3E3V A;  4MTD A;  4WX9 A;  1DPR A;  2KIF A;  4KDP A;  3GVA A;  3I54 A;  3U9G A;  3HYI A;  3WE3 A;  4TV7 A;  2RN7 A;  4BHB A;  1MJB A;  3R0J A;  4HDU A;  1MDM B;  5E1W A;  5J8C A;  4Y13 A;  4M71 A;  4R8H A;  5BQT A;  5L3B A;  2GXG A;  3DEU A;  4YIF A;  5FLX Z;  1BI1 A;  1OYI A;  1EV7 A;  2P5L C;  1P92 A;  4CDG A;  1VTN C;  4PDK A;  2EA2 A;  1R1V A;  3RKX A;  2IP2 A;  2VBX A;  1ZG1 A;  3SFZ A;  1GXP A;  3N4M A;  1LEB A;  2D1H A;  4WCG A;  1F1Z A;  2HQR A;  4KYW A;  1BOA A;  4CHU A;  1STZ A;  3L2C A;  2V79 A;  4DQ2 A;  4QWQ A;  4CO8 A;  1CGP A;  3M8E A;  1A04 A;  3F22 A;  5HLG A;  2LSO A;  2WWY A;  4PGH A;  1K78 A;  4EJV A;  2Z5U A;  1TQI A;  1ZRF A;  1O57 A;  1LNW A;  2ELH A;  3R61 A;  5F6F A;  4KN7 X;  4PGG A;  3W6K B;  3RI4 A;  2CWE A;  2VT2 A;  5JHU A;  1J0R A;  3V8K A;  2VN2 A;  1MGT A;  3KP3 A;  3HSR A;  3H92 A;  2NS0 A;  4FX4 A;  3K1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...