2LYCA

Structure of c-terminal domain of ska1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
MNDIRIVPQITDEEFKTIPKYQLGRLTLEMMNEIVSKMDDFLMKKSKILGKTNKQLTRSDREVLDNWRELEMKARKRLPTTLFFIETDIRPMLQDRLRPSFAKAIPCLRHIRRIREERCGPLTFYYPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spindle and kinetochore-associated protein 1 homolog
publication title The kinetochore-bound ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 27
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lycA00
4CA0A 4C9YA 2LYCA
chains in the Genus database with same CATH superfamily
1V5FA 1EV7A 2M1BA 3GFIA 2XVCA 3V8LA 3A1YA 1ZREA 1NHAA 4LG3A 5L3EA 3RDIA 4XRMA 3DBLB 4MHGA 2P7CB 2WAQA 1I27A 1FMWA 3W6KB 2CRGA 2W7NA 1JHFA 2WAEA 2DT5A 4M72A 3JTGA 3S1MJ 1XMKA 4WXDA 3EUHA 2QA4I 1K78B 1ZG3A 4ZTFA 2ZNYA 3BJOA 3K6GA 4MNUA 4J01A 2GIVA 5LGUA 1O3SA 3IAS2 1VQMI 2OCCH 4D5FA 3ZRGA 3BWGA 3FKIJ 2KIQA 1F43A 2HOTA 4D0PA 2R7VA 3CCVI 5FKMA 2CUFA 2HTSA 2R7XA 1MSEC 1UHSA 2R7SA 1ODDA 1S29A 3FK6A 4BHCA 5BOXA 2VPRA 2R5ZA 2K02A 2P7VB 4MEYF 1TNTA 4I7HA 1IN8A 4XSXF 1MNDA 1YX3A 1UZCA 2CFXA 4CGZA 4A6EA 5L3GA 1FNNA 2HDCA 3OYIA 4J00A 1BC7C 3DU5A 3H1CA 4KA4A 2K5CA 3CMMA 1ZGJA 2X4HA 3PM1A 2OTJI 2K4BA 3GFLA 1B4AA 2XPVA 2L0KA 4G6QA 1PUFB 3EETA 1R49A 2FF4A 5LRRA 2YR2A 2V26A 1SD7A 4Q4ZF 2EILH 4B48A 4X0GA 2HWVA 3F8FA 1P4XA 3ZCOA 3OL4A 1TBXA 5GPAA 3KEYA 3VFZA 4IRHA 1UJ8A 4CCMA 2R5YB 2XGEA 2M34A 5FROA 5IP6A 4BXUA 4YG2F 3HOUJ 1BOBA 1ZYRF 2NRAC 4F91B 3PL8A 1O57A 2X6YA 5LBQA 1FPQA 5M5YJ 1XTAA 2VJ4A 1RETA 1U5TA 3ZPLA 1W7PA 4CYCA 4HW0A 3L2WA 2JK3A 1LKXA 1ZELA 2W82A 2HDDA 2L2OA 2FOWA 1K4SA 3SZPA 5GAHJ 2GA2A 4A3KJ 4XR6A 3MCZA 2JA5J 2EH3A 2QF7A 5J40A 2R7QA 5C4JJ 3DFGA 1DQUA 2R7OA 3I53A 2H6CA 2HI3A 3SFIA 4QIWN 4LMYA 4C2TA 1W5SA 1XMXA 3TOAA 4DQ2A 2QGUA 2YX7A 3ZMUA 2E2HJ 2E71A 4HLXA 3MWMA 2KRFA 2PMHA 3KEQA 5DV5A 2CUJA 3P9IA 3SHFA 2VJJA 5KK1A 3U1DA 5H20A 4MTEA 1JE8A 2HPIA 2E7XA 5BNGA 2DOEA 2OD5A 3MMYB 4P1WA 3WE2A 3PO2J 3FBNB 3GZ6A 1MMGA 1E0EA 2DMUA 4N9HA 1QA6A 2JZYA 2STTA 2M0MA 3KIOA 5HS9A 2ZFWA 2VOPA 4PZJA 2ME6A 3BQZA 4C3IJ 1GVDA 3DEUA 4XICA 3S1NJ 2IA2A 2Q8KA 4IVNA 3TO7A 3I3LA 2R7DA 4XQFA 4ANJA 3CF5F 4JX6A 4KIFA 5E8IA 1VQLI 1GV5A 4HG2A 4GGGA 2BHZA 1YX5A 3IC7A 3QPTA 4UVCA 2R7WA 4NC7A 1RKWA 1IAWA 2GXAA 3ZOBA 2DPDA 5E8GA 1EKEA 4AVPA 3CESA 1QHGA 4FX0A 5ILVA 3H5AA 5JHUA 5FKOA 4XLPF 1POGA 3ABKH 4XONA 3QQAA 4KMFA 1GUUA 3HTUA 5LEJA 1LNWA 5GAGJ 1IJWC 1LFUP 2EK5A 2O61A 2R7FA 3K69A 1IW7F 4KUMA 4IF4A 1IV8A 1Z21A 2D1HA 2FUG2 1SMTA 5FKKA 5B1BH 1Q1VA 1Z91A 2EQRA 3VYRB 1BA5A 5HDNA 2EPFA 3OS1A 1PP8F 4KMUX 4ZYHA 4BS9A 1FIAA 3LNQA 2DT6A 2CV1A 4IZZA 4OAYA 2IBDA 1ETWA 3GEZA 1J0RA 1Y6IA 3GZNB 2F48A 3GTQJ 1HQCA 1SVMA 2ZO4A 3E6CC 2A07F 1G4DA 3ABUA 1I1SA 5D6EA 3MN2A 3M8JA 1LE8A 3I71A 2L7FP 5D8KB 1VQNI 3KZIC 5FKNA 1I3AA 1JGGA 4O5VA 4DOZA 4DBQA 3ERMA 4C3JJ 1EJ9A 2MABA 2ECBA 2MGQA 2XHKA 1ZRFA 1GDTA 5CPRB 2MD0A 1NK2P 2Q2EA 1KU2A 5BMZA 3OYFA 1OCZH 3FK7A 1LVKA 3HGYA 4LOCA 2IW5A 1KU3A 2DFFA 3BR6A 4BQNA 4NDLA 4LLGF 4MEXF 2HGCA 2EV0A 4Z2YA 2OC6A 3RYRA 1SEUA 4UUVA 1WJCA 2VB6A 4AVZA 3DP7A 3QPSA 5DDGA 4UHTA 1VF9A 3E1SA 3H9QA 5EYRA 3Q0UA 1ERDA 3E0JB 1FSEA 2CQKA 2L9VA 3S8PA 4BQAA 1IRZA 2JUCA 2LD5A 1SD4A 5L3DA 5GPCA 2JWTA 2MH9A 3HSEA 5F27A 2DFEA 4M6VA 4HQMA 2K86A 1OCTC 4NNJA 4BACA 4CHUA 4BEHA 2F5EA 5HNFA 2A5YB 5L3BA 2EINH 3OYNA 5E79C 4C30A 1RUOA 3COAC 2UZKA 3HBLA 3WTVC 3RYPA 2A6TA 3GTOJ 3X2QH 3FX3A 3BR5A 2VE8A 3I59B 2DXIA 1B8IB 2Z2SB 2JTVA 3KLNA 4ENJA 1K6YA 1XB4A 2DDAA 2O3FA 3HIFA 2HTJA 1HCRA 1FBQA 2VT2A 2NS7A 3R6SA 3BQYA 2E36A 3V7CA 5GTIC 3FXLA 3KX2A 1WJBA 1QZZA 4G7HF 1TQMA 2HNHA 3RPUA 1JJ6C 5CYVA 1H0MA 2TRTA 4II2A 1T33A 5JVGF 2LF7A 3K1MA 3MKZA 2ISZA 5J1UA 2E5ZA 3LFUA 2DAOA 2F4OB 1Z9CA 1XGSA 3DLAA 3I0TA 2A5WA 2HVSA 1FY7A 5CVJA 3GBGA 2R92J 1SFEA 3QU3A 1B59A 3J7AY 2PEXA 3HEFA 4QWQA 4IRGA 4LITA 5DUIA 3FXJA 3T0YA 1HSTA 3D5SC 1Y0NA 2CQ7A 2E1MB 2JJ7A 1KGSA 3F8CA 3IV5A 2FA5A 1AA7A 3V4GA 4O6JA 3SZGA 4I6ZA 3BR0A 4UVBA 2J5OA 4HX4A 4BDZA 2LKSA 3ZP5A 4V19K 5J8FA 2ETHA 5HOOA 1P4WA 2VXZA 4HNUA 1KQ8A 1MBJA 4A3BJ 1Y8RB 4JX4A 2VBZA 5D5UB 3J80K 2ZMEC 4DZJA 5HLTA 2OF7A 1ZG5A 3CO6C 2QENA 3OWTA 4XLEA 5CJ9A 3K70D 4KICA 9ANTA 2GOXB 3H3ZA 5CVVA 3IWZA 3HHHA 3PUBA 1P92A 2UV1A 4XLHA 4ZH4F 1DPUA 4M3DA 3S1QJ 1H89C 3KP4A 3ZMDA 4BJ6C 4U0VA 2DO7A 1XX5A 2HKXA 3LQRA 2QBYB 5D4SA 3AL0C 4M9SA 1TLHB 2IAIA 1GXPA 3M4OJ 1GHCA 2O6GE 5FGMA 4HSTA 1W5TA 2DA4A 2K40A 3U1KA 1HKSA 3VEPA 2LG4A 1I50J 1OJLA 1H88C 2MLKA 2QYOA 4XLNF 2H94A 2LF8A 4BYYA 1ZGWA 3DWLE 3JTHA 1SVLA 4G8XA 1BBYA 3VWBA 3BP8A 4BUPA 2MYSA 3A0HC 5FFZA 3OYHA 3M1CA 4XM3A 3NWTA 5HDKA 3CUQC 4F93B 2DOFA 3H0DA 3MFKA 5IY5H 2ECCA 2V7FA 4L9TA 2R93J 4N0BA 3DPLC 4B3XA 1IN6A 1NTCA 3HOXJ 3M7GA 5LFAA 4ESJA 2QSGX 4KITB 1QVUA 4B1RA 4RMNA 3JCUC 4D7MA 2J5PA 3HJEA 1UMQA 3K4CA 2XRLA 4V2FA 3LSTA 3RKYA 4M3GA 1N78A 1XDUA 2KFDA 1ZLKA 2I10A 3OSGA 4PJLA 2WADA 3BTLA 2NOJB 4C9YA 3LAJA 1JKOC 1I1GA 1LQ1A 2WWYA 4XNFA 2W48A 2WA0A 2BVLA 2CWEA 3FXMA 3LFKA 1R5GA 5C4XJ 2DMPA 1XSDA 1V4RA 5E3OA 1TWCJ 1IG7A 5JFRA 1IXCA 1Z3YA 3K70C 3SXYA 1XGOA 3LSIA 3PFYA 2CMPA 2NXNB 4LIVA 4LB6B 1MBHA 3M07A 1R1UA 4EGYA 3ZQIA 1LB2A 4XIDA 1W5CC 3OYBA 2E2JJ 5LRSA 3AKZA 2KLOA 3ASOH 1S7AA 4KT6A 1ONVA 2ZXJA 3F8MA 1U0JA 1IV6A 3ZQFA 1FYMA 4E7LA 4XKWA 1Y56A 5LLQA 4L18B 2XAGA 3GUDA 3EPZA 3F9KA 4IRIA 4AIHA 1VQ4I 2R5ZB 3CJNA 4CO8A 1B9MA 3HPGA 1KZHA 5E3NA 3F23A 1RESA 4DZPA 1Z1DA 1VTNC 4B4CA 3ZMZA 1YRNA 2MC3A 5HLHA 2Y0SN 3TO6A 2MSYA 4ZJZA 2QSHX 4RGRA 2IS2A 2PX9A 3N05A 4UXNA 2BY1A 3B73A 4DIQA 2KZGA 4YFXF 2RVCA 2CUZA 4QPQA 2EFOA 5J6XA 3LSJA 2BHYA 1YJNI 3W6JB 3T1BA 2R0QC 3WTUC 4B09A 5M3MJ 3TDZC 4EM2A 2AQFA 1Y1WJ 2M4KA 2H1LA 4LK0F 1YE9A 2PQ8A 4A3LJ 5ERIA 4OMZA 4ZYEA 3GFJA 3HKZN 1ZLJA 3NARA 4UB6C 5B5EC 5FD6A 1IZ1A 2Z99A 5K5RA 1ZQ3P 1Z7UA 2VQLA 4NHJA 4OWRB 2HOAA 4ZTJA 2DMTA 3CCMI 3EYYA 2VBYA 1HSJA 4YELA 4HF1A 3DKYA 1NH3A 1U8BA 1DUXC 1MZBA 4JP0A 4EMSA 1TT5B 1U5TB 5F1RA 1W7PB 3IL2A 3OIOA 1MMAA 4CYCB 1WVRA 2W57A 3L2QA 4JK1X 3S2DJ 2P8TA 3HXLA 2VI6A 1ZKGA 4G6DA 2PJRA 1LUJB 4GYGA 5EG0A 3BG7A 2GBYA 1E3OC 3HHGA 2ZXIA 4OIQF 2L9SA 4ITVA 4NQWB 2JMWA 3CCRI 1GVJA 1I6HJ 4GCVA 4Y13A 1WGXA 1KU9A 3KLOA 2XROA 2EFWA 2EA4A 4BE0A 1S5LC 2X1DA 3DPUA 4Y7NJ 2A69F 3S93A 4U7DA 1XD7A 2L54A 1T08B 4GDFA 1FIPA 1SFXA 1D5YA 1BOAA 4D7NA 2BE5F 2V9VA 2WBMA 3WU0A 1C0WA 3BCBA 3OYDA 1XN7A 4FISA 2WTEA 1W1WE 2XAUA 3PNVA 3Q0WA 1ON2A 1WJFA 3HSFA 3L09A 1ITYA 3KFWX 3QP5A 3V8JA 1ZRCA 3C2GA 4XOTA 2EZHA 2PMZA 2QWWA 1ZK8A 4IHTA 3KE2A 3WTZA 1MJBA 2OQRA 4A3MJ 3M9AA 2XIGA 1YS7A 5TISC 3JRDA 1HKQA 4OINF 2NS0A 2W24A 2KDZA 3FMQA 1K6OA 1XS9A 4Y4RA 2X0LA 3PQKA 2AXTC 5DM6F 1VZ0A 2PI0A 5HDGA 3AG4H 1TP4A 4DJAA 2QZ8A 2Z3YA 5DEQA 2BYVE 2LY9A 1T38A 1S72I 3ZQHA 2IA0A 2NVXJ 4LG0B 4E7JA 4DYRA 2X9DA 2QQ9A 4P55A 3TL4X 3FXQA 4A3CJ 2M9HA 3JSOA 3R61A 1X1CA 1G6NA 4DYQA 4B44A 4PGGA 2LRDA 1T98A 1IUYA 5D5XB 1PVEA 4LLLA 1MBKA 1P7JA 2JRMA 2LNBA 1B9NA 3VYUB 1QNTA 3K9TA 1AKHA 4ZDLA 3B02A 1QHHD 2ME0A 2BW3A 3S3MA 3WTWC 2ZSHB 3BTCA 2BXYA 2OA4A 1PP7U 3NWSA 1BW6A 1D1CA 2V6CA 2BZTA 1AU7A 1ACIA 2XAHA 1OCPA 3K2ZA 4AYBN 4MFDA 2O0YA 4EM1A 1SAXA 2FOKA 4RB3C 2LMDA 3GFMA 3PSIA 3FHZA 4EGZA 2H8RA 2EIKH 3MZ8A 4P9FA 2VQCA 2F6CA 5IYDJ 2RNJA 2QQ8A 2VJIA 5DTDA 1X1PA 2LP0A 3WHBA 2Q2EB 3D5LA 3IUOA 2V9PA 1SAUA 2W25A 3JSPA 1E17A 1KYWA 2R7TA 3FMSA 1D8JA 1MNEA 4BDYA 3OOUA 1Y8QB 4PFPA 5BPIA 1WJEA 3WTSC 3F6OA 3G4SI 4AWXB 2E1OA 3KPHA 4IHSA 1GV2A 3FHNA 1HXDA 5ICEA 2Z5UA 4BGDA 5J1YA 4FASD 1R36A 3HGGA 3G73A 1JKQC 2A05A 3LSRA 5FLMJ 2VJ5A 2VONA 3DTIA 5HS8A 1IN7A 5B66C 2HFHA 1UB9A 4RAYA 2EV5A 1VFCA 3ZXSA 1KU7A 2PJPA 3GVAA 1FT9A 4BEHB 5F6FA 3HRTA 1XMAA 2XSDC 3L1PA 4FX4A 1GT0C 1K7AA 1EF4A 3LOCA 4FHTA 4XKCA 5DYMA 2K27A 2Y9YA 1IF1A 2CV2A 1SD5A 2ADUA 2KZVA 2X6OA 4ZC3A 4BBRJ 4CCNA 2O03A 3GTPJ 2E1CA 3S17J 4I09A 3TP0A 1LVAA 2DJNA 2LKPA 1J75A 4U87A 3DTEA 1WHUA 3FISA 1OYIA 1ZH5A 2LY2A 1WCMJ 3R4KA 3QYEA 3VSLA 2JRTA 4GYIA 3HRSA 3I9V2 4TV7A 4F52A 1OR7C 4C3HJ 5GAEJ 4RDUA 2Y9ZA 3H3UA 4HEA2 2K9SA 3H35A 2M0CA 3ONQA 2VODA 1ZN2A 1OMIA 2FJ1A 3JRBA 4AM3A 4XORA 2NAZA 2ZJQF 4ENKA 1MKMA 5D5WB 2E35A 4LIUA 4CCLA 2F4IA 3FM3A 4A6DA 2RGVA 4MLOA 2IS4A 2EFPA 3BZKA 3N97A 3H92A 5DCMA 2JPBA 2E2IJ 4A3JJ 4HNTA 1Z67A 3TKYA 5KVRA 1YO5C 1EH7A 2KIUA 1BN5A 2AXLA 2UXXA 3EQLF 1R71A 3M3YJ 1NG7A 5D5VB 4R8HA 3O2PE 5HLGA 1LDKB 2QSFX 2ZB9A 2XV4S 4Y52J 3M8EA 4PCQA 1JUPA 2A6EF 4BNCA 4IHVA 3LSHA 4DYCA 2KJCA 3WG9A 4AIDA 4EJOA 1K79A 4AYBA 2DW4A 5CQEA 3BG3A 2V4JC 3GWZA 2FNPA 2BXZA 2NS8A 5E20A 2Y48A 1FLIA 5TRDA 2DMQA 1H9GA 1UHWA 5EZGA 2O9LA 1SFKA 1J7KA 2MG4A 1SFOJ 2NNNA 2PMUA 4UUSA 4C2UA 5FD5A 2WB1N 2FD5A 1U2WA 2Z33A 3Q9VA 2TDXA 5F1JA 2PFBA 2XF6A 3KYDB 2B9SA 1TW2A 3J7ZI 1IDYA 4CXFA 2HVQA 1I5ZA 2ZMEA 4GRIA 3RKQA 2GIZA 1TQIA 4AD9A 3AFHA 2X1EA 3G2BA 4H4KC 2JSPA 2L3DA 3TO9A 1ULYA 3DTKA 3BPXA 3DBHB 3G1OA 1W36D 3ZQLA 1MGTA 3PUFA 3SQNA 1HA8A 3HM5A 1U3EM 3C3WA 3OYKA 2D45A 1GXQA 2EA2A 2RQPA 3CDHA 3TBIA 1AWCA 1D3YA 2BY3A 2Y0MA 4XLFA 2XASA 2EFQA 2P81A 3FM5A 1VQ7I 1UG0A 4EEFG 2YSRA 1XCVA 2KIFA 2K3PA 2LREA 1NG6A 1WI9A 2M45A 4ZYAA 3MKWB 3O6BB 2VXDA 5FRMA 1LDDA 1YITI 3F22A 4XK4A 2ELKA 3TOBA 2UXNA 3P9KA 4A0XA 1K83J 4RAFA 2HDWA 3LL7A 2QCOA 3ISPA 1FBSA 2HOSA 4E70A 2FBIA 2DLLA 2IGKA 2M8EA 1R4MB 5EZHA 3F3XA 3EUAA 5D6FA 1JTXA 3BC8A 3CUQA 4XBFA 1R58A 1O4XA 2FNAA 2IA1A 3E5UA 1BJZA 1WKMA 1ZAOA 1YTYA 1A35A 5JVTA 2O8KA 4M71A 4BU2A 2CSOA 3ERED 3K10A 3S15J 4ASNA 3H5NA 2FMLA 1J09A 2VBWA 2HQAA 3TW6A 1JUSA 4YFNF 4XKVA 2LYCA 2O7OA 2BY2A 4EJTA 5AIQA 3ZGKA 1VQPI 4ZZLA 2LKXA 4E7IA 4OIPF 3HRUA 4IQ4A 4I01A 4HF2A 1MJ9A 2JPCA 3O3KA 3RI4A 5F64A 4KFCA 2LY1A 1J59A 3FXUA 3KCCA 3CJRB 3MAJA 4S0HB 3MZHA 1MSFC 3F8BA 2DYRH 2N8GA 5CVRA 2QKMB 3CMAI 1YIOA 2QVOA 4M9ZA 3L2UA 2K4JA 1W36C 1JI8A 2XGCA 4YIIA 3E7LA 4EV0A 4BKXA 3HSRA 1RPWA 2FX0A 2M5WA 1J2XA 1MH3A 1BJAA 4XRSG 1QQIA 5E3LA 4PDKA 1ETYA 2WY8Q 3HL2A 3CCQI 4OMYA 1CF7B 4Q47A 3OSFA 2M7AA 1TL8A 4EJWA 2RV8A 1SANA 1IN5A 1QRYA 5HVQC 1OCOH 1N25A 3S3OA 2ELJA 5LHHA 4RA2A 2R5YA 4WWCA 3NAUA 4PGHA 5AONA 2IGMA 1YLFA 4F55A 1HBXG 1T0FA 5HNHA 2CGPA 3AG2H 2VOOA 4OU0A 3HUGB 5IPAA 3OYMA 2MLGA 2I8DA 1X1DA 2WV1A 4WXHA 4G6TB 4BXXJ 1IRFA 1X3WB 5CVUA 2RREA 2L7ZA 2JN6A 3K1NA 1Y1VJ 2QM3A 1R23A 1O3RA 3H9GA 4A3IJ 2HYGD 2ZJPF 4KNYA 1LFBA 2PG4A 2OUMA 1YJ9I 1IN4A 3CMYA 1F4KA 2DFHA 4EVIA 1JUMA 3K4LA 1D0YA 4L5IA 4BL0B 5HLIA 4IOAF 4AIJA 1ZGAA 2JA2A 5EG0B 2F4MB 1HW1A 4RBOA 2C6YA 2X6XA 2BEOA 5H6RA 3ZMSA 4ETSA 1TWGJ 4IHWA 5LGNA 2X1CA 3GO5A 1GLNA 2V9KA 3DKXA 3J7YJ 1P4AA 2COBA 3W2WA 1VI0A 2ZCWA 3QU6A 4CSWA 1BR2A 1A6QA 1I6XA 1Z0XA 4MQVA 3HOZJ 5KAFC 1YW9A 2DA7A 2NYXA 2M4GA 4CCJA 3A03A 3FZVA 2VQHA 4U7BA 3CC7I 4DNCA 1MJAA 1YIJI 1E3PA 4QPOA 2LTPA 1IRXA 3PNTA 3K4MA 1ETVA 1TNSA 2YX4A 1JHHA 3K7AJ 4RM3A 3KYLA 2EWNA 1WQ2A 3BR2A 1YJWI 4KN4X 2UWMA 4BHBA 4ZYGA 2L5QA 2GZWA 4IQJA 3V7SA 4NC8A 3M8FA 1ETKA 1XSXA 2MBFA 3R60A 3ASNH 3FXKA 4G9YA 1WI3A 4PSWA 4UV8A 1G2HA 3FXRA 3Q0VA 5J4YA 2KJBA 3GW2A 3QPLA 5J47A 4FE7A 2ESHA 2X48A 5ILSA 4BE1A 1IRGA 2NVUB 1MDMA 4BH9A 3JRIA 5L3CA 3U21A 1R6RA 5TGTA 1TTYA 2H1KA 4XN3A 4LK1F 1W4MA 1N75A 2E60A 3FKJA 2H09A 1CQTA 1ZTRA 3SEQA 5K7FA 1T39A 2OCEA 3GTMJ 1UG2A 1H9TA 3G3ZA 4S05A 4PJ0C 1G3YA 4UVAA 4CA0A 3SEZA 4E7HA 1TWHJ 4IJAA 1VQ8I 1DGWY 3EUKL 4FE4A 4MIMA 5B3SH 3WU2C 1X58A 3C18A 1P7IA 2B0LA 3G71I 2D2WA 1U6GA 4P9UA 2QUFA 1JGSA 2W1OA 4KN7X 3KP6A 1O7FA 4L0ZB 5EEGA 1YS6A 4H0EA 1X19A 4I76A 2V6EA 3I4MJ 1U9OA 1OCCH 1OQYA 3OS0A 3RPQA 3CCUI 3ELKA 2VIXA 3LQQA 2JA7J 1QO0D 1HDDC 4AC0A 3BG5A 1AKHB 2JUGA 1FTTA 3S1RJ 1E2XA 3MEXA 3TQNA 3ZQ7A 1Y0UA 3A01A 5DUKA 2Z9OA 3GTGJ 2KKOA 2FXAA 2L7MP 3ABLH 3BPVA 2B63J 1PJRA 4M9XA 1IO2A 2DOAA 3ZQQA 2FE3A 1X2NA 5BQTA 3KZZA 1RIOH 1O3QA 3DV8A 4HNVA 3TEDA 1EH8A 1OYWA 3DKWA 3E6DA 3GF2A 1RR8C 3D1NI 2Q1ZB 5CKTA 1LPQA 5KAIC 3BCAA 1J5YA 2NVYJ 3VPRA 2KISA 2Y75A 2OBPA 1I39A 3IH4A 4Y3OA 1T0FC 3S16J 5IT9K 1BI3A 2ISYA 2IGNA 2MW8A 3V8KA 2VPLA 5DCFA 2V1NA 1EA3A 1Z6RA 4ENNA 4D1QA 4NUBA 4DBRA 3QYFA 4UV9A 1HKTA 5F04A 1OKRA 1EH6A 3BT9A 3BJAA 3SDBA 1R4NB 3VOEA 4OIOF 3UR3C 1MD0A 1RZ4A 3T5XA 1Y39A 5EGOA 2K85A 2IS1A 5JLXA 1QGPA 5JHFA 2O8XA 1R22A 3O8GA 3QPHA 4YFKF 1FTZA 4E6KG 4L5JA 1P6RA 1R9TJ 4BJTA 1AHDP 2M7BA 1U78A 2Y31A 3JW4A 4XLCA 1VQ6I 2L7KA 5H2FC 3MD2A 3IP4B 3OYEA 5GADJ 2NNYA 1QZEA 1BIBA 3G6EI 4Q5SF 2JT1A 4LB5A 5ILUA 1T2KA 2HEOA 3CLOA 1RC9A 3OOPA 2VC1A 1QPIA 4XKBA 2V79A 3HOYJ 5DD4A 2FBHA 4N9IA 2PBIA 3AAFA 4J19A 1USTA 4M3BA 3H9JA 3W2VA 3ZQGA 2CO5A 4U88A 5L3FA 1DDNA 2CW7A 3KEOA 4D9JA 3JAMK 4IO9F 3ZQCA 4L5EA 3DU6A 1R5ID 4FT8A 4RGUA 1VQKI 3BROA 1ENHA 5E17F 4UUTA 1S7EA 1HDPA 2IVMA 3CP2A 3FMRA 1FZPB 1BR4A 3GX4X 2DK8A 5F0FA 3TP3A 2ELHA 3KP2A 2XPWA 2EIJH 4PSXA 5E1XA 2IRFG 2JSCA 1XSVA 1OR7A 3QP6A 3PIOF 1RRJA 1FOXA 4KYWA 1DU6A 3CUOA 5LD2C 3E97A 3U2RA 3QODA 2XSJC 1DGRM 2VE9A 1ZRDA 4E7KA 2BGCA 2XUBA 2LOOA 3D0SA 2DT7B 4A5NA 4X6AJ 1G3WA 1BI1A 4N4OB 4G7ZF 4A93J 2LK2A 1QPMA 2LDUA 3L7WA 2RDPA 3GZ5A 3BY6A 1SFUA 3CF2A 4AUXA 1UHMA 5FKLA 1MBEA 4N4NB 2R7ZJ 5ED4A 2QBYA 4O3MA 3WG7H 3JRGA 1VQ9I 4YIFA 1MBGA 1TW3A 2W4SA 2NVTJ 3B6CA 3RJPA 2ZKZA 1Z05A 2DQRA 2DJIA 3KP5A 4EQQA 2R7RA 1V55H 1V3FA 2G9WA 3ECHA 1ETOA 4OAZA 2DFIA 1V54H 5LHGA 3W3CA 1MMNA 2L9RA 4IL6C 2BY0A 5K7HA 1B1BA 3OS2A 1RKTA 3GTLJ 2Q0OA 3MVPA 5A2QK 2Y0SA 3GTJJ 4A12A 3IHUA 3OY9A 3BG6A 3ZR8X 2ZMEB 3FF5A 1Z7LA 4RS8A 3WTTC 1CGPA 2IP2A 3LA3A 4ESBA 3ROUA 1U8RA 2L4MA 3NEUA 2D5VA 4HOBA 3KETA 4KJZA 2M30A 1QVTA 4P96A 5H6QA 5KCMA 1X1AA 5JR3A 2IPQX 2KL4A 2WV0A 4YEJA 5D4RA 5F0HA 1YW7A 2K9MA 4HAMA 3VYTB 5C3EJ 1OYYA 1FX7A 2ZJRF 4RGSA 4EM0B 1SMYF 5KNLA 1LJ9A 2MFZA 4V2GA 4JBAA 5CVIA 1F1ZA 4CZZA 4HX8A 2CU7A 4QLCU 3HKZA 4X1EA 3AL0B 2GWRA 1ZARA 1I3QJ 5IT9Z 3I5UA 1JT0A 3TDUC 1USSA 3BTJA 1LE8B 2DA1A 2MD5A 1VNDA 1OPCA 2P6SA 2HQ5A 1A04A 1DPRA 4MO7A 1MIJA 5LEKA 2DQLA 5LGTA 3VYSB 2EIMH 4E4HA 2P6TA 1DP7P 2YU9J 3OYGA 1UCRA 3CUQB 1ZR2A 4B8XA 1VQ5I 1PYVA 1X3ZB 1M1EB 1S7OA 2K3FA 2XAQA 3OIQA 3OL3A 4R1HA 1T56A 1VQOI 2EJRA 2HPMA 1MMSA 3W6VA 4JX5A 1R1TA 1O7LA 2OV7A 2JVGA 3H0GJ 4M3FA 2F5DA 3S32A 1T8IA 2CH0A 2LH9A 1MMDA 3RCOA 3JRFA 2DTZA 3IWFA 5ICCA 5J3LA 3CD6I 3SYTA 2WAFA 3F8NA 4ESFA 5IYCJ 1WH7A 4XSZF 1P2FA 2LSOA 1F5TA 2DI3A 2P0WA 3CTAA 4G12A 3CDIA 4D5CA 1MBFA 2V1XA 3K2AA 3V42A 1OFCX 2V1DA 4ZYDA 3E5QA 4WF2A 3L9FA 4OIRF 3FXOA 3JAMZ 2F5FA 3OIPA 3K4BA 1T6SA 1TWFJ 4LGWA 2E1MC 3H36A 3OYCA 1JJ8C 1FEXA 2LR8A 2M8GX 4ON0A 4A3FJ 4CDGA 3R0AA 4U0WA 5M5XJ 3CZ6A 1TWAJ 4PUSA 2H27A 2HZTA 5TJJA 2P5LC 3OYAA 2HYJA 3NRVA 4BE2A 3WU1B 4ABZA 2BBYA 3QRFF 2ZSIB 4PJNA 4BHPA 1G59A 3RZOJ 4EJVA 2GM4A 1F36A 4MFEA 2BOLA 1MH4A 1WWXA 3LAPA 4C2MJ 2E19A 3LSPA 4BJ5C 5KHDA 4P5OA 3BLYA 5F08A 2B7EA 4BQOA 1B72A 3GTKJ 1JXSA 4DGWB 1REPC 3VB2A 2L01A 2E5NA 1SD6A 2MC4A 1D5VA 3GYHX 1HLVA 4IHYA 4HDUA 3I58A 3BZ6A 4PJJA 3RTRA 4JQFA 5D8LB 2K9LA 4ZDPA 1FYKA 4A0ZA 3A4CA 4HSRA 1QZYA 4NQWA 3Q5FA 2FU4A 3FBIB 2STWA 4F7ZA 1A6IA 1RR7A 2X6WA 5J1RA 2IEKA 1ETQA 3OR1C 4B47A 1MNMC 4JOMA 1LEBA 2HXIA 3FIWA 3V7RA 4KIBA 1WJDA 3CC2I 3LSMA 1S8NA 4A3EJ 1JKPC 2HVRA 4HA8A 3CJQB 1FMVA 3C1DA 1LDJA 2LBFA 2OU2A 3SDGA 4RB0A 2V1UA 5A2QZ 2K9QA 2DA5A 2YPRA 3JRCA 2XB0X 3RKWA 3SFZA 2Y2ZA 4CYDA 1BC8C 2LLKA 3QOEA 2ZBKA 3ZMVA 1X4OA 3MKYB 3K1PA 4JYKA 4CH7A 3QWLA 4HV6A 4A2UA 2D1VA 2MA3A 5FFXA 4WXCA 5ICGA 3ZN1A 2X51A 3HDDA 2AO9A 5JI6A 2CYYA 2XRNA 4RAGA 3G1MA 3FDYA 1WRJA 2DCEA 3Q3SA 1ZR4A 2ZNZA 2HS5A 2A6HF 2VKVA 3QAHA 2HYFA 2OPTA 4RB2C 5FLVA 3BDDA 5K5OA 2XF7A 4QSHA 1W7PD 3CCLI 3I64A 1U9NA 3ABMH 3SJMA 3BG9A 5EDNA 1FWZA 1YYVA 1MDMB 3EUHC 1DP3A 1D1AA 1S9HA 4LG0A 1JKRC 3WGGA 2A3SA 2YU3A 5EEHA 2AQEA 5IT3A 2BVMA 1YFHA 2I5UA 3CLQA 2Y69H 4CICA 3F6VA 2DA3A 5LHIA 3OYJA 3JRHA 1X3UA 2DDBA 2EB7A 4CZCA 3CCSI 1BW5A 1HW5A 4MQ9F 1FOWA 4IEJA 2E34A 1K78A 5E18F 1QBJA 3IKTA 2EZKA 2GAUA 1TT0A 5EEAA 4MGRA 3LMMA 3HOSA 3DLLF 4HDVA 2DYSH 2DK5A 4GXOA 3M1EA 1YW8A 2NOGA 2RN7A 5IOZA 3L2VA 3R0JA 3IAM2 3OV8A 2W85A 2IXSA 3E5XA 3WGHA 5DM7F 2ESNA 3HG9A 3A01B 1WH5A 4M74A 2X85A 2ZJ2A 4ZZDA 2KRHA 2DN0A 2OJED 3K4NA 1S3JA 1SVOA 1A36A 2L02A 4IHXA 1FBUA 2GA1A 5JLWA 1UAAA 3GMEA 4IX7A 2EZIA 1WSUA 1FOYA 2A61A 2E1NA 2HQNA 3MQ0A 3PJRA 3K0LA 3ESWB 2DMNA 3JRAA 2OTLI 1Z77A 2M2EA 4Z6YA 3RSNA 2ID3A 1SC7A 4EJUA 4L0YB 2IS6A 1PUFA 1TC3C 3H5RA 4Y33A 1D1BA 1U5TC 2VKEA 5F0CA 4WCGA 1YRNB 2H8WA 4FQGA 4I02A 2IJLA 3J7AO 4A3DJ 2AHQA 4RLQA 1OLTA 1KA8A 1DU0A 3JREA 4YRVA 3P9CA 3TMOA 4XL9A 3C7JA 3B6AA 5IOYA 2ACJA 2IT0A 1A31A 1ETXA 5EGOB 1B6AA 2WB1A 2DTRA 4XN0A 4AIKA 1MW7A 4RB1A 5M5WJ 1T95A 3OYLA 3E3VA 3PSFA 6PAXA 5E3MA 3VODA 2WC2A 3NQOA 3KYCB 3HOVJ 3J81K 1Q1HA 2W84A 3RIRA 2F5VA 4NBQA 1X1BA 4HRIA 2OAZA 1YHQI 1V5GA 4BAYA 1KQ9A 2XKOA 3IRRA 2PLYA 4U0YA 4HZFA 2FQ4A 3HZJA 1TZLA 4FETA 1L0OC 2CFOA 2KPMA 4CUGA 4RGXA 1IUFA 1FYLA 3CP8A 2DA6A 1KONA 3WTXC 2A68F 2RC4A 3F72A 2VLAA 5FJ8J 1K61A 1HW2A 4S04A 5J4VA 2HXOA 4EATA 2PJRB 2OZUA 4IPAA 4K2EA 5FLXK 3QYBA 5ICFA 1O3TA 3CCEI 2VQGA 2FEZA 2LFBA 5HS7A 4I2OA 3G1LA 3KZYA 2JA8J 2VC0A 3L2CA 4A0YA 1G3SA 2HZDA 2VBXA 5GTHC 3N4MA 2CUEA 2GLOA 1D0ZA 1X4PA 1IGNA 1ORKA 3RZDJ 3P5JA 4E7ZA 3ABTA 1R00A 2HOEA 1KQ0A 1RI7A 2DODA 2FBKA 4I0BA 2VN2A 4AU7A 2G7HA 1WZ2A 3Q9SA 2O5RA 3KP7A 4UY8I 1F9NA 3GCMA 2K7LA 1BL0A 4B43A 3GXOA 2HR3A 3F21A 4BQQA 1G3TA 3IRQA 2G0EA 2H6BA 3BZCA 5HODA 4FCYA 2NVQJ 2EV6A 2RNGA 4R79A 3CJTB 2XC7A 2G7UA 3CDLA 4KDPA 2CW0F 3HTSB 4CCKA 2CW8A 1BM9A 2ZXHA 3U9GA 2L4AA 3TW7A 2F5CA 2XGDA 2RQQA 5C44J 4A69C 1E3HA 2VT3A 5E1ZB 4CCOA 4IXAA 4F92B 5EF6A 3RPUD 3I56I 1BIAA 3C2BA 4UB8C 4XOPA 2R3SA 2R4GA 1V5EA 3CCYA 5BPDA 3KP3A 5IP7J 5EJCA 3LSKA 2KRCA 4HQEA 3S3NA 4F3QA 1APLC 3CC4I 4RAZA 1IXSB 2ZXWH 3DCFA 4BY1J 4KISA 1Z6TA 4XRSA 3A2KA 2L9NA 4M6YA 5DD8A 2EBIA 1PDNC 2DPUA 4RLFA 4WX9A 2VASA 5DS9A 1S6LA 4A5MA 4NB5A 2CG4A 1FSHA 4G94A 2ZFUA 4M6XA 3I55I 2FMYA 2OQGA 5CLSA 3DEWA 3T8TA 2YS9A 1YQAA 4E7SA 4A3GJ 2RAEA 1BR1A 4IKFA 4W1UA 1FC3A 4DW6A 3UKGA 2ID6A 4KT5C 2BW3B 3ZMTA 3EDPA 1AOYA 3I4PA 3CQZJ 4PFOA 2TCTA 3BJ6A 1JTYA 4M3EA 5IYBJ 3BTIA 3ZN0A 2BV6A 2XKPA 2QLZA 2Y30A 1L3LA 2F2EA 3EYIA 3HOWJ 1Z3XA 4Y15A 3HC7A 1HC8A 1N77A 2M87A 3OR2C 1WPKA 1XGMA 4OOIA 2VKDA 2OZ6A 3L2RA 2K9NA 3LA2A 3DF8A 1D8KA 3IH2A 3MKLA 1R7JA 5K1YA 2EZLA 1R5HA 2HKOA 4GO1A 5M3FJ 3DBRB 5AIPA 2CQQA 2GXBA 1QU3A 3DEEA 3TGNA 1TQPA 1XPXA 4G7OF 1G8XA 3J81Z 2PMZN 3WE3A 2HQRA 4HV5A 3IKVA 2GQQA 3BOQA 2JA6J 3PIPF 2RKHA 2WY7Q 3QOPA 3ECOA 3DXJF 4HLYA 3HRMA 1UELB 4PK4A 3HB9A 2QQBA 4HX7A 3O8HA 1FJLA 4ZDOA 5FO5A 3HYIA 1WJ5A 3RKXA 2LC2A 1RNLA 2PN6A 1XGNA 4LD5A 3S2WA 4Y17A 3I59A 1B8IA 1D0XA 3PQJA 4Q48A 5E1WA 1CF7A 2W00A 3CO7C 3FWEA 4BY7J 4LJZF 2KHMA 4HF0A 2YUSA 1IC8A 1XCBA 1YI2I 4YIRX 1RUNA 3WODF 3LA7A 5GP9A 5FLXZ 5IP9J 5FRNA 2FQ3A 4XMYA 1WJAA 2DBBA 3CCJI 3UNGC 3A02A 4LFUA 3E6BA 2P5KA 1ZHFA 2CV0A 1WFXA 1FP2A 2WAQN 1IDZA 3HUGA 2XDVA 2Z16A 3P7NA 3AG3H 1W0TA 3K4JA 3VSKA 3JR9A 3PFIA 4ENMA 1W0UA 2FRHA 3OMYA 2JVHA 4BBSJ 4HYEA 4NC6A 3WHCA 3J80Z 2ICWG 4RM2A 4QTRA 3ULQB 1FP1D 4HBLA 1HF0A 3WGIA 3RQIA 3C2HA 3DQVC 4M73A 1XDSA 2M3AA 2XB5A 1XG1A 4PJMA 1B72B 2VKHA 4I99C 3VDXA 5DCMB 5BS6A 1YG2A 4XRFA 2HU9A 1P9QC 1FOKA 3L00A 4L9NA 1UFMA 2QKLB 4IOCF 2MH2A 3A0BC 2AS5F 2CJJA 2KQRA 3LSGA 4W97A 2JQ7A 3DPTA 2IGOA 3H3VK 2XGXA 1YOVB 5J8CA 1NK3P 3MZYA 5K5QA 4I98B 3WTYC 4HPQA 1HOMA 1LEAA 3LWFA 4BXFA 4II3A 3T8RA 4I0AA 2LBFB 1PUEE 2E7WA 2CS3A 5CQGA 3ML6A 1XC5A 3SZTA 2KT0A 4L9VA 1OCRH 1R1VA 1H8AC 3S14J 1IXRC 3BR1A 4LLNA 1ON1A 3PO3J 1J9IA 2UUZA 1K4TA 1LFPA 3W2AA 4KIGA 2QQAA 3HPHA 4UUSB 1X2MA 3GLLA 3REOA 2CQXA 3F0CA 2XAJA 5B1AH 4UNOA 2KMUA 1BI0A 2FSWA 3HOTA 3I4NJ 2ZC2A 2CQNA 2XF5A 3AG1H 4FTHA 3D5RC 1A5JA 4L9JA 4GFBA 2DU9A 1STZA 4XLAA 2XAFA 2EFNA 5FB2A 2KDOA 2VL8A 2QEXI 3S2HJ 2P5VA 2COMA 2DA2A 2KP6A 1OISA 1JT6A 3CMEI 2LVSA 1ZG1A 4WK8F 2VUMJ 4B3AA 1BI2A 2R7UA 2KIMA 3GLXA 3K4KA 1KYZA 2XPUA 2P4WA 5K7ZA 4MTDA 3E6MA 2GOMA 2GXGA 2Z1DA 3PNYA 3I54A 3IH3A 3RQ4A 3BR3A
chains in the Genus database with same CATH topology
4XKWA 1Y56A 4G6TB 1V5FA 3EPZA 3F9KA 3QOEA 2RREA 1X4OA 3HPGA 3MKYB 3A1YA 4LG3A 4CH7A 2WAQA 3H9GA 2X51A 1FMWA 2W7NA 2OUMA 2WAEA 4ZJZA 3FDYA 2DCEA 2IS2A 3K4LA 1D0YA 3N05A 4BL0B 3K6GA 4ZTFA 4DIQA 4J01A 2CUZA 2JA2A 3IAS2 4QPQA 3ZRGA 2X6XA 2XF7A 2R7VA 2X1CA 1GLNA 2V9KA 3DKXA 2AQFA 3EUHC 2M4KA 3W2WA 1DP3A 2R7XA 1D1AA 1S9HA 1YE9A 4CSWA 1BR2A 2R7SA 2M4GA 4CCJA 4U7BA 2VQHA 2AQEA 2BVMA 2VQLA 4QPOA 4OWRB 4ZTJA 1IRXA 3OYJA 1MNDA 1YX3A 3PNTA 3K4MA 4YELA 3DKYA 4CZCA 3OYIA 4RM3A 4J00A 3KYLA 3DU5A 2K5CA 3CMMA 1MMAA 3L2QA 2UWMA 3HXLA 2L5QA 4IQJA 4NC8A 1TT0A 2PJRA 4PSWA 3BG7A 3LMMA 3HOSA 2ZXIA 2L9SA 4ITVA 4NQWB 2V26A 4BE1A 3L2VA 4B48A 4X0GA 4BE0A 3IAM2 3U21A 2X1DA 3DPUA 1R6RA 5TGTA 3ZCOA 2IXSA 3OL4A 4XN3A 3S93A 2E60A 1N75A 3HG9A 3KEYA 2X85A 3FKJA 4CCMA 2KRHA 3SEQA 3K4NA 5FROA 2WBMA 1BOBA 4CA0A 3BCBA 2X6YA 3PL8A 3SEZA 4F91B 3OYDA 4E7HA 1UAAA 1DGWY 3EUKL 2XAUA 3PNVA 2VJ4A 4IX7A 1WJFA 3L2WA 1LKXA 1ZELA 2W82A 3PJRA 2L2OA 2W1OA 3C2GA 3RSNA 1X19A 4XOTA 2V6EA 2IS6A 3H5RA 4XR6A 2PMZA 4Y33A 1D1BA 3OS0A 2VIXA 2R7QA 1DQUA 2R7OA 4RLQA 2JUGA 1OLTA 4E7LA 4YRVA 3TMOA 4XL9A 4C2TA 2WB1A 4XN0A 1MW7A 4Y4RA 1T95A 3OYLA 1PJRA 1VZ0A 3PSFA 2CUJA 2DOAA 3ZQQA 2VJJA 4DJAA 2HPIA 3MMYB 4P1WA 2F5VA 3FBNB 4E7JA 2Q1ZB 5CKTA 1X1BA 1MMGA 4HRIA 3BCAA 1E0EA 1V5GA 3TL4X 4Y3OA 1T0FC 2M0MA 2IGNA 1TZLA 4FETA 1X1CA 2VPLA 2V1NA 4B44A 2LRDA 1EA3A 2CFOA 2KPMA 4D1QA 4NUBA 4DBRA 3QYFA 4CUGA 3VYUB 3CP8A 4ZDLA 3I3LA 4XQFA 1QHHD 4ANJA 3SDBA 2BW3A 3S3MA 1KONA 2ZSHB 2VLAA 3UR3C 4HG2A 1YX5A 4EATA 2PJRB 2IS1A 2R7WA 3NWSA 4NC7A 1D1CA 3QYBA 5JHFA 2VQGA 3CESA 1QHGA 4E6KG 3H5AA 4BJTA 2M7BA 3PSIA 4XLCA 2L7KA 2HZDA 2VQCA 4XONA 3MD2A 3IP4B 3OYEA 2F6CA 1D0ZA 1X4PA 2VJIA 2Q2EB 3D5LA 3IUOA 4E7ZA 1Z21A 1SAUA 2FUG2 3VYRB 4AU7A 4XKBA 2O5RA 3OS1A 4BS9A 2R7TA 4B43A 1MNEA 2DT6A 4BDYA 3OOUA 2CV1A 4IZZA 4OAYA 4PFPA 1Y6IA 4BQQA 3H9JA 3W2VA 1WJEA 3FHNA 2RNGA 4R79A 4BGDA 4FASD 2CW7A 3M8JA 2XC7A 4D9JA 2VJ5A 3DTIA 3DU6A 4CCKA 2CW8A 4DOZA 4DBQA 2ZXHA 3ZXSA 2MABA 4BEHB 2RQQA 3CP2A 5CPRB 1BR4A 2MD0A 4CCOA 4F92B 4XKCA 3RPUD 3OYFA 4XOPA 2R4GA 2CV2A 1V5EA 2KZVA 4ZC3A 4CCNA 4PSXA 1LVKA 3LSKA 2KRCA 4BQNA 3S3NA 4F3QA 4KISA 2OC6A 3A2KA 4U87A 2L9NA 3DTEA 1WJCA 4RLFA 5LD2C 2VASA 2LY2A 2VB6A 4AVZA 3QODA 3QYEA 2XSJC 1DGRM 3VSLA 3E1SA 4E7KA 3H9QA 3I9V2 4F52A 2LOOA 2ZFUA 2DT7B 1OR7C 4N4OB 1ERDA 4HEA2 3E0JB 3H35A 3ONQA 3S8PA 4E7SA 3CF2A 1BR1A 4N4NB 4IKFA 4XORA 4NNJA 4BACA 2W4SA 2BW3B 4BEHA 5HNFA 4LIUA 4CCLA 2F4IA 2DJIA 4PFOA 2IS4A 4MLOA 3OYNA 4C30A 2R7RA 4OAZA 3W3CA 1MMNA 4HNTA 2A6TA 3OS2A 2DXIA 1Z3XA 3HC7A 2Y0SA 2Z2SB 1N77A 3OR2C 1K6YA 3OY9A 3BG6A 1NG7A 3ZR8X 1Z7LA 1LDKB 2VKDA 3L2RA 4KJZA 3KX2A 5KCMA 1X1AA 1WJBA 3LSHA 2KL4A 4YEJA 2HNHA 4AYBA 1QU3A 3DEEA 2K9MA 5CQEA 3VYTB 2V4JC 1G8XA 4II2A 5KNLA 2MFZA 3MKZA 2E5ZA 3LFUA 3HKZA 3AL0B 2WY7Q 1SFKA 3DLAA 1UELB 2A5WA 4PK4A 2HVSA 4C2UA 3GBGA 4ZDOA 3J7AY 1WJ5A 2LC2A 4LITA 2XF6A 1D0XA 3D5SC 2W00A 2HVQA 2E1MB 2KHMA 4GRIA 3VYSB 1AA7A 4E4HA 3SZGA 3AFHA 2X1EA 3G2BA 4H4KC 2JSPA 3OYGA 4BDZA 3DTKA 1W36D 5FRNA 1PYVA 4XMYA 1WJAA 5HOOA 1HA8A 3UNGC 2VXZA 3OIQA 3OL3A 4HNUA 2CV0A 3OYKA 3TBIA 2HPMA 1WFXA 5HLTA 4XLFA 2OV7A 2JVGA 2XDVA 2Z16A 3OWTA 4XLEA 3K70D 3S32A 2GOXB 1UG0A 2CH0A 3K4JA 3VSKA 2LH9A 3PUBA 1MMDA 2UV1A 3RCOA 4XLHA 2K3PA 2LREA 1NG6A 3OMYA 2JVHA 4ZYAA 3MKWB 3SYTA 2WAFA 2VXDA 5FRMA 4BJ6C 4RM2A 2P0WA 3AL0C 3C2HA 3DQVC 2HDWA 3LL7A 2M3AA 4PJMA 2VKHA 2IGKA 3VDXA 3V42A 4HSTA 3EUAA 2LG4A 3BC8A 2HU9A 1P9QC 3OIPA 3K4BA 3DWLE 2QKLB 2E1MC 4BU2A 3OYCA 3K10A 3VWBA 4BUPA 2MYSA 3OYHA 3H5NA 2KQRA 3LSGA 1J09A 3CZ6A 3M1CA 2HQAA 3NWTA 4XM3A 4PUSA 4XKVA 2LYCA 4F93B 3H0DA 3DPTA 3OYAA 2IGOA 2V7FA 4BE2A 3ZGKA 3DPLC 4B3XA 4E7IA 2ZSIB 4PJNA 4HPQA 5LFAA 4KITB 4IQ4A 1G59A 4BXFA 4II3A 4RMNA 2BOLA 2LBFB 2CS3A 5CQGA 2LY1A 3K4CA 4BJ5C 5KHDA 3CJRB 3BLYA 4P5OA 4BQOA 2UUZA 4DGWB 1N78A 1LFPA 3W2AA 2E5NA 2MC4A 2QKMB 4PJLA 3L2UA 3HPHA 2WADA 2NOJB 4C9YA 1W36C 4PJJA 1JI8A 3RTRA 4JQFA 2K9LA 4ZDPA 2KMUA 4XNFA 3HOTA 2WA0A 2BVLA 3A4CA 4HSRA 3HL2A 2WY8Q 2XF5A 3FBIB 3D5RC 2X6WA 2M7AA 4XLAA 3OR1C 4B47A 4JOMA 1Z3YA 5HVQC 3K70C 2KDOA 2VL8A 3S3OA 3LSIA 3PFYA 2CMPA 2ELJA 4LIVA 2KP6A 1WJDA 3LSMA 2HVRA 3CJQB 2IGMA 1FMVA 4F55A 2LBFA 2R7UA 3OYBA 3K4KA 5HNHA 3AKZA 2KLOA 3HUGB 4KT6A 3OYMA 2GOMA 2Z1DA 3PNYA 2I8DA 1U0JA 3RQ4A 1X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CA0 A;  4C9Y A;  2LYC A; 
#chains in the Genus database with same CATH topology
 1V5F A;  1EV7 A;  2M1B A;  3GFI A;  2XVC A;  3V8L A;  3A1Y A;  1ZRE A;  1NHA A;  4LG3 A;  5L3E A;  3RDI A;  4XRM A;  3DBL B;  4MHG A;  2P7C B;  2WAQ A;  1I27 A;  1FMW A;  3W6K B;  2CRG A;  2W7N A;  1JHF A;  2WAE A;  2DT5 A;  4M72 A;  3JTG A;  3S1M J;  1XMK A;  4WXD A;  3EUH A;  2QA4 I;  1K78 B;  1ZG3 A;  4ZTF A;  2ZNY A;  3BJO A;  3K6G A;  4MNU A;  4J01 A;  2GIV A;  5LGU A;  1O3S A;  3IAS 2;  1VQM I;  2OCC H;  4D5F A;  3ZRG A;  3BWG A;  3FKI J;  2KIQ A;  1F43 A;  2HOT A;  4D0P A;  2R7V A;  3CCV I;  5FKM A;  2CUF A;  2HTS A;  2R7X A;  1MSE C;  1UHS A;  2R7S A;  1ODD A;  1S29 A;  3FK6 A;  4BHC A;  5BOX A;  2VPR A;  2R5Z A;  2K02 A;  2P7V B;  4MEY F;  1TNT A;  4I7H A;  1IN8 A;  4XSX F;  1MND A;  1YX3 A;  1UZC A;  2CFX A;  4CGZ A;  4A6E A;  5L3G A;  1FNN A;  2HDC A;  3OYI A;  4J00 A;  1BC7 C;  3DU5 A;  3H1C A;  4KA4 A;  2K5C A;  3CMM A;  1ZGJ A;  2X4H A;  3PM1 A;  2OTJ I;  2K4B A;  3GFL A;  1B4A A;  2XPV A;  2L0K A;  4G6Q A;  1PUF B;  3EET A;  1R49 A;  2FF4 A;  5LRR A;  2YR2 A;  2V26 A;  1SD7 A;  4Q4Z F;  2EIL H;  4B48 A;  4X0G A;  2HWV A;  3F8F A;  1P4X A;  3ZCO A;  3OL4 A;  1TBX A;  5GPA A;  3KEY A;  3VFZ A;  4IRH A;  1UJ8 A;  4CCM A;  2R5Y B;  2XGE A;  2M34 A;  5FRO A;  5IP6 A;  4BXU A;  4YG2 F;  3HOU J;  1BOB A;  1ZYR F;  2NRA C;  4F91 B;  3PL8 A;  1O57 A;  2X6Y A;  5LBQ A;  1FPQ A;  5M5Y J;  1XTA A;  2VJ4 A;  1RET A;  1U5T A;  3ZPL A;  1W7P A;  4CYC A;  4HW0 A;  3L2W A;  2JK3 A;  1LKX A;  1ZEL A;  2W82 A;  2HDD A;  2L2O A;  2FOW A;  1K4S A;  3SZP A;  5GAH J;  2GA2 A;  4A3K J;  4XR6 A;  3MCZ A;  2JA5 J;  2EH3 A;  2QF7 A;  5J40 A;  2R7Q A;  5C4J J;  3DFG A;  1DQU A;  2R7O A;  3I53 A;  2H6C A;  2HI3 A;  3SFI A;  4QIW N;  4LMY A;  4C2T A;  1W5S A;  1XMX A;  3TOA A;  4DQ2 A;  2QGU A;  2YX7 A;  3ZMU A;  2E2H J;  2E71 A;  4HLX A;  3MWM A;  2KRF A;  2PMH A;  3KEQ A;  5DV5 A;  2CUJ A;  3P9I A;  3SHF A;  2VJJ A;  5KK1 A;  3U1D A;  5H20 A;  4MTE A;  1JE8 A;  2HPI A;  2E7X A;  5BNG A;  2DOE A;  2OD5 A;  3MMY B;  4P1W A;  3WE2 A;  3PO2 J;  3FBN B;  3GZ6 A;  1MMG A;  1E0E A;  2DMU A;  4N9H A;  1QA6 A;  2JZY A;  2STT A;  2M0M A;  3KIO A;  5HS9 A;  2ZFW A;  2VOP A;  4PZJ A;  2ME6 A;  3BQZ A;  4C3I J;  1GVD A;  3DEU A;  4XIC A;  3S1N J;  2IA2 A;  2Q8K A;  4IVN A;  3TO7 A;  3I3L A;  2R7D A;  4XQF A;  4ANJ A;  3CF5 F;  4JX6 A;  4KIF A;  5E8I A;  1VQL I;  1GV5 A;  4HG2 A;  4GGG A;  2BHZ A;  1YX5 A;  3IC7 A;  3QPT A;  4UVC A;  2R7W A;  4NC7 A;  1RKW A;  1IAW A;  2GXA A;  3ZOB A;  2DPD A;  5E8G A;  1EKE A;  4AVP A;  3CES A;  1QHG A;  4FX0 A;  5ILV A;  3H5A A;  5JHU A;  5FKO A;  4XLP F;  1POG A;  3ABK H;  4XON A;  3QQA A;  4KMF A;  1GUU A;  3HTU A;  5LEJ A;  1LNW A;  5GAG J;  1IJW C;  1LFU P;  2EK5 A;  2O61 A;  2R7F A;  3K69 A;  1IW7 F;  4KUM A;  4IF4 A;  1IV8 A;  1Z21 A;  2D1H A;  2FUG 2;  1SMT A;  5FKK A;  5B1B H;  1Q1V A;  1Z91 A;  2EQR A;  3VYR B;  1BA5 A;  5HDN A;  2EPF A;  3OS1 A;  1PP8 F;  4KMU X;  4ZYH A;  4BS9 A;  1FIA A;  3LNQ A;  2DT6 A;  2CV1 A;  4IZZ A;  4OAY A;  2IBD A;  1ETW A;  3GEZ A;  1J0R A;  1Y6I A;  3GZN B;  2F48 A;  3GTQ J;  1HQC A;  1SVM A;  2ZO4 A;  3E6C C;  2A07 F;  1G4D A;  3ABU A;  1I1S A;  5D6E A;  3MN2 A;  3M8J A;  1LE8 A;  3I71 A;  2L7F P;  5D8K B;  1VQN I;  3KZI C;  5FKN A;  1I3A A;  1JGG A;  4O5V A;  4DOZ A;  4DBQ A;  3ERM A;  4C3J J;  1EJ9 A;  2MAB A;  2ECB A;  2MGQ A;  2XHK A;  1ZRF A;  1GDT A;  5CPR B;  2MD0 A;  1NK2 P;  2Q2E A;  1KU2 A;  5BMZ A;  3OYF A;  1OCZ H;  3FK7 A;  1LVK A;  3HGY A;  4LOC A;  2IW5 A;  1KU3 A;  2DFF A;  3BR6 A;  4BQN A;  4NDL A;  4LLG F;  4MEX F;  2HGC A;  2EV0 A;  4Z2Y A;  2OC6 A;  3RYR A;  1SEU A;  4UUV A;  1WJC A;  2VB6 A;  4AVZ A;  3DP7 A;  3QPS A;  5DDG A;  4UHT A;  1VF9 A;  3E1S A;  3H9Q A;  5EYR A;  3Q0U A;  1ERD A;  3E0J B;  1FSE A;  2CQK A;  2L9V A;  3S8P A;  4BQA A;  1IRZ A;  2JUC A;  2LD5 A;  1SD4 A;  5L3D A;  5GPC A;  2JWT A;  2MH9 A;  3HSE A;  5F27 A;  2DFE A;  4M6V A;  4HQM A;  2K86 A;  1OCT C;  4NNJ A;  4BAC A;  4CHU A;  4BEH A;  2F5E A;  5HNF A;  2A5Y B;  5L3B A;  2EIN H;  3OYN A;  5E79 C;  4C30 A;  1RUO A;  3COA C;  2UZK A;  3HBL A;  3WTV C;  3RYP A;  2A6T A;  3GTO J;  3X2Q H;  3FX3 A;  3BR5 A;  2VE8 A;  3I59 B;  2DXI A;  1B8I B;  2Z2S B;  2JTV A;  3KLN A;  4ENJ A;  1K6Y A;  1XB4 A;  2DDA A;  2O3F A;  3HIF A;  2HTJ A;  1HCR A;  1FBQ A;  2VT2 A;  2NS7 A;  3R6S A;  3BQY A;  2E36 A;  3V7C A;  5GTI C;  3FXL A;  3KX2 A;  1WJB A;  1QZZ A;  4G7H F;  1TQM A;  2HNH A;  3RPU A;  1JJ6 C;  5CYV A;  1H0M A;  2TRT A;  4II2 A;  1T33 A;  5JVG F;  2LF7 A;  3K1M A;  3MKZ A;  2ISZ A;  5J1U A;  2E5Z A;  3LFU A;  2DAO A;  2F4O B;  1Z9C A;  1XGS A;  3DLA A;  3I0T A;  2A5W A;  2HVS A;  1FY7 A;  5CVJ A;  3GBG A;  2R92 J;  1SFE A;  3QU3 A;  1B59 A;  3J7A Y;  2PEX A;  3HEF A;  4QWQ A;  4IRG A;  4LIT A;  5DUI A;  3FXJ A;  3T0Y A;  1HST A;  3D5S C;  1Y0N A;  2CQ7 A;  2E1M B;  2JJ7 A;  1KGS A;  3F8C A;  3IV5 A;  2FA5 A;  1AA7 A;  3V4G A;  4O6J A;  3SZG A;  4I6Z A;  3BR0 A;  4UVB A;  2J5O A;  4HX4 A;  4BDZ A;  2LKS A;  3ZP5 A;  4V19 K;  5J8F A;  2ETH A;  5HOO A;  1P4W A;  2VXZ A;  4HNU A;  1KQ8 A;  1MBJ A;  4A3B J;  1Y8R B;  4JX4 A;  2VBZ A;  5D5U B;  3J80 K;  2ZME C;  4DZJ A;  5HLT A;  2OF7 A;  1ZG5 A;  3CO6 C;  2QEN A;  3OWT A;  4XLE A;  5CJ9 A;  3K70 D;  4KIC A;  9ANT A;  2GOX B;  3H3Z A;  5CVV A;  3IWZ A;  3HHH A;  3PUB A;  1P92 A;  2UV1 A;  4XLH A;  4ZH4 F;  1DPU A;  4M3D A;  3S1Q J;  1H89 C;  3KP4 A;  3ZMD A;  4BJ6 C;  4U0V A;  2DO7 A;  1XX5 A;  2HKX A;  3LQR A;  2QBY B;  5D4S A;  3AL0 C;  4M9S A;  1TLH B;  2IAI A;  1GXP A;  3M4O J;  1GHC A;  2O6G E;  5FGM A;  4HST A;  1W5T A;  2DA4 A;  2K40 A;  3U1K A;  1HKS A;  3VEP A;  2LG4 A;  1I50 J;  1OJL A;  1H88 C;  2MLK A;  2QYO A;  4XLN F;  2H94 A;  2LF8 A;  4BYY A;  1ZGW A;  3DWL E;  3JTH A;  1SVL A;  4G8X A;  1BBY A;  3VWB A;  3BP8 A;  4BUP A;  2MYS A;  3A0H C;  5FFZ A;  3OYH A;  3M1C A;  4XM3 A;  3NWT A;  5HDK A;  3CUQ C;  4F93 B;  2DOF A;  3H0D A;  3MFK A;  5IY5 H;  2ECC A;  2V7F A;  4L9T A;  2R93 J;  4N0B A;  3DPL C;  4B3X A;  1IN6 A;  1NTC A;  3HOX J;  3M7G A;  5LFA A;  4ESJ A;  2QSG X;  4KIT B;  1QVU A;  4B1R A;  4RMN A;  3JCU C;  4D7M A;  2J5P A;  3HJE A;  1UMQ A;  3K4C A;  2XRL A;  4V2F A;  3LST A;  3RKY A;  4M3G A;  1N78 A;  1XDU A;  2KFD A;  1ZLK A;  2I10 A;  3OSG A;  4PJL A;  2WAD A;  3BTL A;  2NOJ B;  4C9Y A;  3LAJ A;  1JKO C;  1I1G A;  1LQ1 A;  2WWY A;  4XNF A;  2W48 A;  2WA0 A;  2BVL A;  2CWE A;  3FXM A;  3LFK A;  1R5G A;  5C4X J;  2DMP A;  1XSD A;  1V4R A;  5E3O A;  1TWC J;  1IG7 A;  5JFR A;  1IXC A;  1Z3Y A;  3K70 C;  3SXY A;  1XGO A;  3LSI A;  3PFY A;  2CMP A;  2NXN B;  4LIV A;  4LB6 B;  1MBH A;  3M07 A;  1R1U A;  4EGY A;  3ZQI A;  1LB2 A;  4XID A;  1W5C C;  3OYB A;  2E2J J;  5LRS A;  3AKZ A;  2KLO A;  3ASO H;  1S7A A;  4KT6 A;  1ONV A;  2ZXJ A;  3F8M A;  1U0J A;  1IV6 A;  3ZQF A;  1FYM A;  4E7L A;  4XKW A;  1Y56 A;  5LLQ A;  4L18 B;  2XAG A;  3GUD A;  3EPZ A;  3F9K A;  4IRI A;  4AIH A;  1VQ4 I;  2R5Z B;  3CJN A;  4CO8 A;  1B9M A;  3HPG A;  1KZH A;  5E3N A;  3F23 A;  1RES A;  4DZP A;  1Z1D A;  1VTN C;  4B4C A;  3ZMZ A;  1YRN A;  2MC3 A;  5HLH A;  2Y0S N;  3TO6 A;  2MSY A;  4ZJZ A;  2QSH X;  4RGR A;  2IS2 A;  2PX9 A;  3N05 A;  4UXN A;  2BY1 A;  3B73 A;  4DIQ A;  2KZG A;  4YFX F;  2RVC A;  2CUZ A;  4QPQ A;  2EFO A;  5J6X A;  3LSJ A;  2BHY A;  1YJN I;  3W6J B;  3T1B A;  2R0Q C;  3WTU C;  4B09 A;  5M3M J;  3TDZ C;  4EM2 A;  2AQF A;  1Y1W J;  2M4K A;  2H1L A;  4LK0 F;  1YE9 A;  2PQ8 A;  4A3L J;  5ERI A;  4OMZ A;  4ZYE A;  3GFJ A;  3HKZ N;  1ZLJ A;  3NAR A;  4UB6 C;  5B5E C;  5FD6 A;  1IZ1 A;  2Z99 A;  5K5R A;  1ZQ3 P;  1Z7U A;  2VQL A;  4NHJ A;  4OWR B;  2HOA A;  4ZTJ A;  2DMT A;  3CCM I;  3EYY A;  2VBY A;  1HSJ A;  4YEL A;  4HF1 A;  3DKY A;  1NH3 A;  1U8B A;  1DUX C;  1MZB A;  4JP0 A;  4EMS A;  1TT5 B;  1U5T B;  5F1R A;  1W7P B;  3IL2 A;  3OIO A;  1MMA A;  4CYC B;  1WVR A;  2W57 A;  3L2Q A;  4JK1 X;  3S2D J;  2P8T A;  3HXL A;  2VI6 A;  1ZKG A;  4G6D A;  2PJR A;  1LUJ B;  4GYG A;  5EG0 A;  3BG7 A;  2GBY A;  1E3O C;  3HHG A;  2ZXI A;  4OIQ F;  2L9S A;  4ITV A;  4NQW B;  2JMW A;  3CCR I;  1GVJ A;  1I6H J;  4GCV A;  4Y13 A;  1WGX A;  1KU9 A;  3KLO A;  2XRO A;  2EFW A;  2EA4 A;  4BE0 A;  1S5L C;  2X1D A;  3DPU A;  4Y7N J;  2A69 F;  3S93 A;  4U7D A;  1XD7 A;  2L54 A;  1T08 B;  4GDF A;  1FIP A;  1SFX A;  1D5Y A;  1BOA A;  4D7N A;  2BE5 F;  2V9V A;  2WBM A;  3WU0 A;  1C0W A;  3BCB A;  3OYD A;  1XN7 A;  4FIS A;  2WTE A;  1W1W E;  2XAU A;  3PNV A;  3Q0W A;  1ON2 A;  1WJF A;  3HSF A;  3L09 A;  1ITY A;  3KFW X;  3QP5 A;  3V8J A;  1ZRC A;  3C2G A;  4XOT A;  2EZH A;  2PMZ A;  2QWW A;  1ZK8 A;  4IHT A;  3KE2 A;  3WTZ A;  1MJB A;  2OQR A;  4A3M J;  3M9A A;  2XIG A;  1YS7 A;  5TIS C;  3JRD A;  1HKQ A;  4OIN F;  2NS0 A;  2W24 A;  2KDZ A;  3FMQ A;  1K6O A;  1XS9 A;  4Y4R A;  2X0L A;  3PQK A;  2AXT C;  5DM6 F;  1VZ0 A;  2PI0 A;  5HDG A;  3AG4 H;  1TP4 A;  4DJA A;  2QZ8 A;  2Z3Y A;  5DEQ A;  2BYV E;  2LY9 A;  1T38 A;  1S72 I;  3ZQH A;  2IA0 A;  2NVX J;  4LG0 B;  4E7J A;  4DYR A;  2X9D A;  2QQ9 A;  4P55 A;  3TL4 X;  3FXQ A;  4A3C J;  2M9H A;  3JSO A;  3R61 A;  1X1C A;  1G6N A;  4DYQ A;  4B44 A;  4PGG A;  2LRD A;  1T98 A;  1IUY A;  5D5X B;  1PVE A;  4LLL A;  1MBK A;  1P7J A;  2JRM A;  2LNB A;  1B9N A;  3VYU B;  1QNT A;  3K9T A;  1AKH A;  4ZDL A;  3B02 A;  1QHH D;  2ME0 A;  2BW3 A;  3S3M A;  3WTW C;  2ZSH B;  3BTC A;  2BXY A;  2OA4 A;  1PP7 U;  3NWS A;  1BW6 A;  1D1C A;  2V6C A;  2BZT A;  1AU7 A;  1ACI A;  2XAH A;  1OCP A;  3K2Z A;  4AYB N;  4MFD A;  2O0Y A;  4EM1 A;  1SAX A;  2FOK A;  4RB3 C;  2LMD A;  3GFM A;  3PSI A;  3FHZ A;  4EGZ A;  2H8R A;  2EIK H;  3MZ8 A;  4P9F A;  2VQC A;  2F6C A;  5IYD J;  2RNJ A;  2QQ8 A;  2VJI A;  5DTD A;  1X1P A;  2LP0 A;  3WHB A;  2Q2E B;  3D5L A;  3IUO A;  2V9P A;  1SAU A;  2W25 A;  3JSP A;  1E17 A;  1KYW A;  2R7T A;  3FMS A;  1D8J A;  1MNE A;  4BDY A;  3OOU A;  1Y8Q B;  4PFP A;  5BPI A;  1WJE A;  3WTS C;  3F6O A;  3G4S I;  4AWX B;  2E1O A;  3KPH A;  4IHS A;  1GV2 A;  3FHN A;  1HXD A;  5ICE A;  2Z5U A;  4BGD A;  5J1Y A;  4FAS D;  1R36 A;  3HGG A;  3G73 A;  1JKQ C;  2A05 A;  3LSR A;  5FLM J;  2VJ5 A;  2VON A;  3DTI A;  5HS8 A;  1IN7 A;  5B66 C;  2HFH A;  1UB9 A;  4RAY A;  2EV5 A;  1VFC A;  3ZXS A;  1KU7 A;  2PJP A;  3GVA A;  1FT9 A;  4BEH B;  5F6F A;  3HRT A;  1XMA A;  2XSD C;  3L1P A;  4FX4 A;  1GT0 C;  1K7A A;  1EF4 A;  3LOC A;  4FHT A;  4XKC A;  5DYM A;  2K27 A;  2Y9Y A;  1IF1 A;  2CV2 A;  1SD5 A;  2ADU A;  2KZV A;  2X6O A;  4ZC3 A;  4BBR J;  4CCN A;  2O03 A;  3GTP J;  2E1C A;  3S17 J;  4I09 A;  3TP0 A;  1LVA A;  2DJN A;  2LKP A;  1J75 A;  4U87 A;  3DTE A;  1WHU A;  3FIS A;  1OYI A;  1ZH5 A;  2LY2 A;  1WCM J;  3R4K A;  3QYE A;  3VSL A;  2JRT A;  4GYI A;  3HRS A;  3I9V 2;  4TV7 A;  4F52 A;  1OR7 C;  4C3H J;  5GAE J;  4RDU A;  2Y9Z A;  3H3U A;  4HEA 2;  2K9S A;  3H35 A;  2M0C A;  3ONQ A;  2VOD A;  1ZN2 A;  1OMI A;  2FJ1 A;  3JRB A;  4AM3 A;  4XOR A;  2NAZ A;  2ZJQ F;  4ENK A;  1MKM A;  5D5W B;  2E35 A;  4LIU A;  4CCL A;  2F4I A;  3FM3 A;  4A6D A;  2RGV A;  4MLO A;  2IS4 A;  2EFP A;  3BZK A;  3N97 A;  3H92 A;  5DCM A;  2JPB A;  2E2I J;  4A3J J;  4HNT A;  1Z67 A;  3TKY A;  5KVR A;  1YO5 C;  1EH7 A;  2KIU A;  1BN5 A;  2AXL A;  2UXX A;  3EQL F;  1R71 A;  3M3Y J;  1NG7 A;  5D5V B;  4R8H A;  3O2P E;  5HLG A;  1LDK B;  2QSF X;  2ZB9 A;  2XV4 S;  4Y52 J;  3M8E A;  4PCQ A;  1JUP A;  2A6E F;  4BNC A;  4IHV A;  3LSH A;  4DYC A;  2KJC A;  3WG9 A;  4AID A;  4EJO A;  1K79 A;  4AYB A;  2DW4 A;  5CQE A;  3BG3 A;  2V4J C;  3GWZ A;  2FNP A;  2BXZ A;  2NS8 A;  5E20 A;  2Y48 A;  1FLI A;  5TRD A;  2DMQ A;  1H9G A;  1UHW A;  5EZG A;  2O9L A;  1SFK A;  1J7K A;  2MG4 A;  1SFO J;  2NNN A;  2PMU A;  4UUS A;  4C2U A;  5FD5 A;  2WB1 N;  2FD5 A;  1U2W A;  2Z33 A;  3Q9V A;  2TDX A;  5F1J A;  2PFB A;  2XF6 A;  3KYD B;  2B9S A;  1TW2 A;  3J7Z I;  1IDY A;  4CXF A;  2HVQ A;  1I5Z A;  2ZME A;  4GRI A;  3RKQ A;  2GIZ A;  1TQI A;  4AD9 A;  3AFH A;  2X1E A;  3G2B A;  4H4K C;  2JSP A;  2L3D A;  3TO9 A;  1ULY A;  3DTK A;  3BPX A;  3DBH B;  3G1O A;  1W36 D;  3ZQL A;  1MGT A;  3PUF A;  3SQN A;  1HA8 A;  3HM5 A;  1U3E M;  3C3W A;  3OYK A;  2D45 A;  1GXQ A;  2EA2 A;  2RQP A;  3CDH A;  3TBI A;  1AWC A;  1D3Y A;  2BY3 A;  2Y0M A;  4XLF A;  2XAS A;  2EFQ A;  2P81 A;  3FM5 A;  1VQ7 I;  1UG0 A;  4EEF G;  2YSR A;  1XCV A;  2KIF A;  2K3P A;  2LRE A;  1NG6 A;  1WI9 A;  2M45 A;  4ZYA A;  3MKW B;  3O6B B;  2VXD A;  5FRM A;  1LDD A;  1YIT I;  3F22 A;  4XK4 A;  2ELK A;  3TOB A;  2UXN A;  3P9K A;  4A0X A;  1K83 J;  4RAF A;  2HDW A;  3LL7 A;  2QCO A;  3ISP A;  1FBS A;  2HOS A;  4E70 A;  2FBI A;  2DLL A;  2IGK A;  2M8E A;  1R4M B;  5EZH A;  3F3X A;  3EUA A;  5D6F A;  1JTX A;  3BC8 A;  3CUQ A;  4XBF A;  1R58 A;  1O4X A;  2FNA A;  2IA1 A;  3E5U A;  1BJZ A;  1WKM A;  1ZAO A;  1YTY A;  1A35 A;  5JVT A;  2O8K A;  4M71 A;  4BU2 A;  2CSO A;  3ERE D;  3K10 A;  3S15 J;  4ASN A;  3H5N A;  2FML A;  1J09 A;  2VBW A;  2HQA A;  3TW6 A;  1JUS A;  4YFN F;  4XKV A;  2LYC A;  2O7O A;  2BY2 A;  4EJT A;  5AIQ A;  3ZGK A;  1VQP I;  4ZZL A;  2LKX A;  4E7I A;  4OIP F;  3HRU A;  4IQ4 A;  4I01 A;  4HF2 A;  1MJ9 A;  2JPC A;  3O3K A;  3RI4 A;  5F64 A;  4KFC A;  2LY1 A;  1J59 A;  3FXU A;  3KCC A;  3CJR B;  3MAJ A;  4S0H B;  3MZH A;  1MSF C;  3F8B A;  2DYR H;  2N8G A;  5CVR A;  2QKM B;  3CMA I;  1YIO A;  2QVO A;  4M9Z A;  3L2U A;  2K4J A;  1W36 C;  1JI8 A;  2XGC A;  4YII A;  3E7L A;  4EV0 A;  4BKX A;  3HSR A;  1RPW A;  2FX0 A;  2M5W A;  1J2X A;  1MH3 A;  1BJA A;  4XRS G;  1QQI A;  5E3L A;  4PDK A;  1ETY A;  2WY8 Q;  3HL2 A;  3CCQ I;  4OMY A;  1CF7 B;  4Q47 A;  3OSF A;  2M7A A;  1TL8 A;  4EJW A;  2RV8 A;  1SAN A;  1IN5 A;  1QRY A;  5HVQ C;  1OCO H;  1N25 A;  3S3O A;  2ELJ A;  5LHH A;  4RA2 A;  2R5Y A;  4WWC A;  3NAU A;  4PGH A;  5AON A;  2IGM A;  1YLF A;  4F55 A;  1HBX G;  1T0F A;  5HNH A;  2CGP A;  3AG2 H;  2VOO A;  4OU0 A;  3HUG B;  5IPA A;  3OYM A;  2MLG A;  2I8D A;  1X1D A;  2WV1 A;  4WXH A;  4G6T B;  4BXX J;  1IRF A;  1X3W B;  5CVU A;  2RRE A;  2L7Z A;  2JN6 A;  3K1N A;  1Y1V J;  2QM3 A;  1R23 A;  1O3R A;  3H9G A;  4A3I J;  2HYG D;  2ZJP F;  4KNY A;  1LFB A;  2PG4 A;  2OUM A;  1YJ9 I;  1IN4 A;  3CMY A;  1F4K A;  2DFH A;  4EVI A;  1JUM A;  3K4L A;  1D0Y A;  4L5I A;  4BL0 B;  5HLI A;  4IOA F;  4AIJ A;  1ZGA A;  2JA2 A;  5EG0 B;  2F4M B;  1HW1 A;  4RBO A;  2C6Y A;  2X6X A;  2BEO A;  5H6R A;  3ZMS A;  4ETS A;  1TWG J;  4IHW A;  5LGN A;  2X1C A;  3GO5 A;  1GLN A;  2V9K A;  3DKX A;  3J7Y J;  1P4A A;  2COB A;  3W2W A;  1VI0 A;  2ZCW A;  3QU6 A;  4CSW A;  1BR2 A;  1A6Q A;  1I6X A;  1Z0X A;  4MQV A;  3HOZ J;  5KAF C;  1YW9 A;  2DA7 A;  2NYX A;  2M4G A;  4CCJ A;  3A03 A;  3FZV A;  2VQH A;  4U7B A;  3CC7 I;  4DNC A;  1MJA A;  1YIJ I;  1E3P A;  4QPO A;  2LTP A;  1IRX A;  3PNT A;  3K4M A;  1ETV A;  1TNS A;  2YX4 A;  1JHH A;  3K7A J;  4RM3 A;  3KYL A;  2EWN A;  1WQ2 A;  3BR2 A;  1YJW I;  4KN4 X;  2UWM A;  4BHB A;  4ZYG A;  2L5Q A;  2GZW A;  4IQJ A;  3V7S A;  4NC8 A;  3M8F A;  1ETK A;  1XSX A;  2MBF A;  3R60 A;  3ASN H;  3FXK A;  4G9Y A;  1WI3 A;  4PSW A;  4UV8 A;  1G2H A;  3FXR A;  3Q0V A;  5J4Y A;  2KJB A;  3GW2 A;  3QPL A;  5J47 A;  4FE7 A;  2ESH A;  2X48 A;  5ILS A;  4BE1 A;  1IRG A;  2NVU B;  1MDM A;  4BH9 A;  3JRI A;  5L3C A;  3U21 A;  1R6R A;  5TGT A;  1TTY A;  2H1K A;  4XN3 A;  4LK1 F;  1W4M A;  1N75 A;  2E60 A;  3FKJ A;  2H09 A;  1CQT A;  1ZTR A;  3SEQ A;  5K7F A;  1T39 A;  2OCE A;  3GTM J;  1UG2 A;  1H9T A;  3G3Z A;  4S05 A;  4PJ0 C;  1G3Y A;  4UVA A;  4CA0 A;  3SEZ A;  4E7H A;  1TWH J;  4IJA A;  1VQ8 I;  1DGW Y;  3EUK L;  4FE4 A;  4MIM A;  5B3S H;  3WU2 C;  1X58 A;  3C18 A;  1P7I A;  2B0L A;  3G71 I;  2D2W A;  1U6G A;  4P9U A;  2QUF A;  1JGS A;  2W1O A;  4KN7 X;  3KP6 A;  1O7F A;  4L0Z B;  5EEG A;  1YS6 A;  4H0E A;  1X19 A;  4I76 A;  2V6E A;  3I4M J;  1U9O A;  1OCC H;  1OQY A;  3OS0 A;  3RPQ A;  3CCU I;  3ELK A;  2VIX A;  3LQQ A;  2JA7 J;  1QO0 D;  1HDD C;  4AC0 A;  3BG5 A;  1AKH B;  2JUG A;  1FTT A;  3S1R J;  1E2X A;  3MEX A;  3TQN A;  3ZQ7 A;  1Y0U A;  3A01 A;  5DUK A;  2Z9O A;  3GTG J;  2KKO A;  2FXA A;  2L7M P;  3ABL H;  3BPV A;  2B63 J;  1PJR A;  4M9X A;  1IO2 A;  2DOA A;  3ZQQ A;  2FE3 A;  1X2N A;  5BQT A;  3KZZ A;  1RIO H;  1O3Q A;  3DV8 A;  4HNV A;  3TED A;  1EH8 A;  1OYW A;  3DKW A;  3E6D A;  3GF2 A;  1RR8 C;  3D1N I;  2Q1Z B;  5CKT A;  1LPQ A;  5KAI C;  3BCA A;  1J5Y A;  2NVY J;  3VPR A;  2KIS A;  2Y75 A;  2OBP A;  1I39 A;  3IH4 A;  4Y3O A;  1T0F C;  3S16 J;  5IT9 K;  1BI3 A;  2ISY A;  2IGN A;  2MW8 A;  3V8K A;  2VPL A;  5DCF A;  2V1N A;  1EA3 A;  1Z6R A;  4ENN A;  4D1Q A;  4NUB A;  4DBR A;  3QYF A;  4UV9 A;  1HKT A;  5F04 A;  1OKR A;  1EH6 A;  3BT9 A;  3BJA A;  3SDB A;  1R4N B;  3VOE A;  4OIO F;  3UR3 C;  1MD0 A;  1RZ4 A;  3T5X A;  1Y39 A;  5EGO A;  2K85 A;  2IS1 A;  5JLX A;  1QGP A;  5JHF A;  2O8X A;  1R22 A;  3O8G A;  3QPH A;  4YFK F;  1FTZ A;  4E6K G;  4L5J A;  1P6R A;  1R9T J;  4BJT A;  1AHD P;  2M7B A;  1U78 A;  2Y31 A;  3JW4 A;  4XLC A;  1VQ6 I;  2L7K A;  5H2F C;  3MD2 A;  3IP4 B;  3OYE A;  5GAD J;  2NNY A;  1QZE A;  1BIB A;  3G6E I;  4Q5S F;  2JT1 A;  4LB5 A;  5ILU A;  1T2K A;  2HEO A;  3CLO A;  1RC9 A;  3OOP A;  2VC1 A;  1QPI A;  4XKB A;  2V79 A;  3HOY J;  5DD4 A;  2FBH A;  4N9I A;  2PBI A;  3AAF A;  4J19 A;  1UST A;  4M3B A;  3H9J A;  3W2V A;  3ZQG A;  2CO5 A;  4U88 A;  5L3F A;  1DDN A;  2CW7 A;  3KEO A;  4D9J A;  3JAM K;  4IO9 F;  3ZQC A;  4L5E A;  3DU6 A;  1R5I D;  4FT8 A;  4RGU A;  1VQK I;  3BRO A;  1ENH A;  5E17 F;  4UUT A;  1S7E A;  1HDP A;  2IVM A;  3CP2 A;  3FMR A;  1FZP B;  1BR4 A;  3GX4 X;  2DK8 A;  5F0F A;  3TP3 A;  2ELH A;  3KP2 A;  2XPW A;  2EIJ H;  4PSX A;  5E1X A;  2IRF G;  2JSC A;  1XSV A;  1OR7 A;  3QP6 A;  3PIO F;  1RRJ A;  1FOX A;  4KYW A;  1DU6 A;  3CUO A;  5LD2 C;  3E97 A;  3U2R A;  3QOD A;  2XSJ C;  1DGR M;  2VE9 A;  1ZRD A;  4E7K A;  2BGC A;  2XUB A;  2LOO A;  3D0S A;  2DT7 B;  4A5N A;  4X6A J;  1G3W A;  1BI1 A;  4N4O B;  4G7Z F;  4A93 J;  2LK2 A;  1QPM A;  2LDU A;  3L7W A;  2RDP A;  3GZ5 A;  3BY6 A;  1SFU A;  3CF2 A;  4AUX A;  1UHM A;  5FKL A;  1MBE A;  4N4N B;  2R7Z J;  5ED4 A;  2QBY A;  4O3M A;  3WG7 H;  3JRG A;  1VQ9 I;  4YIF A;  1MBG A;  1TW3 A;  2W4S A;  2NVT J;  3B6C A;  3RJP A;  2ZKZ A;  1Z05 A;  2DQR A;  2DJI A;  3KP5 A;  4EQQ A;  2R7R A;  1V55 H;  1V3F A;  2G9W A;  3ECH A;  1ETO A;  4OAZ A;  2DFI A;  1V54 H;  5LHG A;  3W3C A;  1MMN A;  2L9R A;  4IL6 C;  2BY0 A;  5K7H A;  1B1B A;  3OS2 A;  1RKT A;  3GTL J;  2Q0O A;  3MVP A;  5A2Q K;  2Y0S A;  3GTJ J;  4A12 A;  3IHU A;  3OY9 A;  3BG6 A;  3ZR8 X;  2ZME B;  3FF5 A;  1Z7L A;  4RS8 A;  3WTT C;  1CGP A;  2IP2 A;  3LA3 A;  4ESB A;  3ROU A;  1U8R A;  2L4M A;  3NEU A;  2D5V A;  4HOB A;  3KET A;  4KJZ A;  2M30 A;  1QVT A;  4P96 A;  5H6Q A;  5KCM A;  1X1A A;  5JR3 A;  2IPQ X;  2KL4 A;  2WV0 A;  4YEJ A;  5D4R A;  5F0H A;  1YW7 A;  2K9M A;  4HAM A;  3VYT B;  5C3E J;  1OYY A;  1FX7 A;  2ZJR F;  4RGS A;  4EM0 B;  1SMY F;  5KNL A;  1LJ9 A;  2MFZ A;  4V2G A;  4JBA A;  5CVI A;  1F1Z A;  4CZZ A;  4HX8 A;  2CU7 A;  4QLC U;  3HKZ A;  4X1E A;  3AL0 B;  2GWR A;  1ZAR A;  1I3Q J;  5IT9 Z;  3I5U A;  1JT0 A;  3TDU C;  1USS A;  3BTJ A;  1LE8 B;  2DA1 A;  2MD5 A;  1VND A;  1OPC A;  2P6S A;  2HQ5 A;  1A04 A;  1DPR A;  4MO7 A;  1MIJ A;  5LEK A;  2DQL A;  5LGT A;  3VYS B;  2EIM H;  4E4H A;  2P6T A;  1DP7 P;  2YU9 J;  3OYG A;  1UCR A;  3CUQ B;  1ZR2 A;  4B8X A;  1VQ5 I;  1PYV A;  1X3Z B;  1M1E B;  1S7O A;  2K3F A;  2XAQ A;  3OIQ A;  3OL3 A;  4R1H A;  1T56 A;  1VQO I;  2EJR A;  2HPM A;  1MMS A;  3W6V A;  4JX5 A;  1R1T A;  1O7L A;  2OV7 A;  2JVG A;  3H0G J;  4M3F A;  2F5D A;  3S32 A;  1T8I A;  2CH0 A;  2LH9 A;  1MMD A;  3RCO A;  3JRF A;  2DTZ A;  3IWF A;  5ICC A;  5J3L A;  3CD6 I;  3SYT A;  2WAF A;  3F8N A;  4ESF A;  5IYC J;  1WH7 A;  4XSZ F;  1P2F A;  2LSO A;  1F5T A;  2DI3 A;  2P0W A;  3CTA A;  4G12 A;  3CDI A;  4D5C A;  1MBF A;  2V1X A;  3K2A A;  3V42 A;  1OFC X;  2V1D A;  4ZYD A;  3E5Q A;  4WF2 A;  3L9F A;  4OIR F;  3FXO A;  3JAM Z;  2F5F A;  3OIP A;  3K4B A;  1T6S A;  1TWF J;  4LGW A;  2E1M C;  3H36 A;  3OYC A;  1JJ8 C;  1FEX A;  2LR8 A;  2M8G X;  4ON0 A;  4A3F J;  4CDG A;  3R0A A;  4U0W A;  5M5X J;  3CZ6 A;  1TWA J;  4PUS A;  2H27 A;  2HZT A;  5TJJ A;  2P5L C;  3OYA A;  2HYJ A;  3NRV A;  4BE2 A;  3WU1 B;  4ABZ A;  2BBY A;  3QRF F;  2ZSI B;  4PJN A;  4BHP A;  1G59 A;  3RZO J;  4EJV A;  2GM4 A;  1F36 A;  4MFE A;  2BOL A;  1MH4 A;  1WWX A;  3LAP A;  4C2M J;  2E19 A;  3LSP A;  4BJ5 C;  5KHD A;  4P5O A;  3BLY A;  5F08 A;  2B7E A;  4BQO A;  1B72 A;  3GTK J;  1JXS A;  4DGW B;  1REP C;  3VB2 A;  2L01 A;  2E5N A;  1SD6 A;  2MC4 A;  1D5V A;  3GYH X;  1HLV A;  4IHY A;  4HDU A;  3I58 A;  3BZ6 A;  4PJJ A;  3RTR A;  4JQF A;  5D8L B;  2K9L A;  4ZDP A;  1FYK A;  4A0Z A;  3A4C A;  4HSR A;  1QZY A;  4NQW A;  3Q5F A;  2FU4 A;  3FBI B;  2STW A;  4F7Z A;  1A6I A;  1RR7 A;  2X6W A;  5J1R A;  2IEK A;  1ETQ A;  3OR1 C;  4B47 A;  1MNM C;  4JOM A;  1LEB A;  2HXI A;  3FIW A;  3V7R A;  4KIB A;  1WJD A;  3CC2 I;  3LSM A;  1S8N A;  4A3E J;  1JKP C;  2HVR A;  4HA8 A;  3CJQ B;  1FMV A;  3C1D A;  1LDJ A;  2LBF A;  2OU2 A;  3SDG A;  4RB0 A;  2V1U A;  5A2Q Z;  2K9Q A;  2DA5 A;  2YPR A;  3JRC A;  2XB0 X;  3RKW A;  3SFZ A;  2Y2Z A;  4CYD A;  1BC8 C;  2LLK A;  3QOE A;  2ZBK A;  3ZMV A;  1X4O A;  3MKY B;  3K1P A;  4JYK A;  4CH7 A;  3QWL A;  4HV6 A;  4A2U A;  2D1V A;  2MA3 A;  5FFX A;  4WXC A;  5ICG A;  3ZN1 A;  2X51 A;  3HDD A;  2AO9 A;  5JI6 A;  2CYY A;  2XRN A;  4RAG A;  3G1M A;  3FDY A;  1WRJ A;  2DCE A;  3Q3S A;  1ZR4 A;  2ZNZ A;  2HS5 A;  2A6H F;  2VKV A;  3QAH A;  2HYF A;  2OPT A;  4RB2 C;  5FLV A;  3BDD A;  5K5O A;  2XF7 A;  4QSH A;  1W7P D;  3CCL I;  3I64 A;  1U9N A;  3ABM H;  3SJM A;  3BG9 A;  5EDN A;  1FWZ A;  1YYV A;  1MDM B;  3EUH C;  1DP3 A;  1D1A A;  1S9H A;  4LG0 A;  1JKR C;  3WGG A;  2A3S A;  2YU3 A;  5EEH A;  2AQE A;  5IT3 A;  2BVM A;  1YFH A;  2I5U A;  3CLQ A;  2Y69 H;  4CIC A;  3F6V A;  2DA3 A;  5LHI A;  3OYJ A;  3JRH A;  1X3U A;  2DDB A;  2EB7 A;  4CZC A;  3CCS I;  1BW5 A;  1HW5 A;  4MQ9 F;  1FOW A;  4IEJ A;  2E34 A;  1K78 A;  5E18 F;  1QBJ A;  3IKT A;  2EZK A;  2GAU A;  1TT0 A;  5EEA A;  4MGR A;  3LMM A;  3HOS A;  3DLL F;  4HDV A;  2DYS H;  2DK5 A;  4GXO A;  3M1E A;  1YW8 A;  2NOG A;  2RN7 A;  5IOZ A;  3L2V A;  3R0J A;  3IAM 2;  3OV8 A;  2W85 A;  2IXS A;  3E5X A;  3WGH A;  5DM7 F;  2ESN A;  3HG9 A;  3A01 B;  1WH5 A;  4M74 A;  2X85 A;  2ZJ2 A;  4ZZD A;  2KRH A;  2DN0 A;  2OJE D;  3K4N A;  1S3J A;  1SVO A;  1A36 A;  2L02 A;  4IHX A;  1FBU A;  2GA1 A;  5JLW A;  1UAA A;  3GME A;  4IX7 A;  2EZI A;  1WSU A;  1FOY A;  2A61 A;  2E1N A;  2HQN A;  3MQ0 A;  3PJR A;  3K0L A;  3ESW B;  2DMN A;  3JRA A;  2OTL I;  1Z77 A;  2M2E A;  4Z6Y A;  3RSN A;  2ID3 A;  1SC7 A;  4EJU A;  4L0Y B;  2IS6 A;  1PUF A;  1TC3 C;  3H5R A;  4Y33 A;  1D1B A;  1U5T C;  2VKE A;  5F0C A;  4WCG A;  1YRN B;  2H8W A;  4FQG A;  4I02 A;  2IJL A;  3J7A O;  4A3D J;  2AHQ A;  4RLQ A;  1OLT A;  1KA8 A;  1DU0 A;  3JRE A;  4YRV A;  3P9C A;  3TMO A;  4XL9 A;  3C7J A;  3B6A A;  5IOY A;  2ACJ A;  2IT0 A;  1A31 A;  1ETX A;  5EGO B;  1B6A A;  2WB1 A;  2DTR A;  4XN0 A;  4AIK A;  1MW7 A;  4RB1 A;  5M5W J;  1T95 A;  3OYL A;  3E3V A;  3PSF A;  6PAX A;  5E3M A;  3VOD A;  2WC2 A;  3NQO A;  3KYC B;  3HOV J;  3J81 K;  1Q1H A;  2W84 A;  3RIR A;  2F5V A;  4NBQ A;  1X1B A;  4HRI A;  2OAZ A;  1YHQ I;  1V5G A;  4BAY A;  1KQ9 A;  2XKO A;  3IRR A;  2PLY A;  4U0Y A;  4HZF A;  2FQ4 A;  3HZJ A;  1TZL A;  4FET A;  1L0O C;  2CFO A;  2KPM A;  4CUG A;  4RGX A;  1IUF A;  1FYL A;  3CP8 A;  2DA6 A;  1KON A;  3WTX C;  2A68 F;  2RC4 A;  3F72 A;  2VLA A;  5FJ8 J;  1K61 A;  1HW2 A;  4S04 A;  5J4V A;  2HXO A;  4EAT A;  2PJR B;  2OZU A;  4IPA A;  4K2E A;  5FLX K;  3QYB A;  5ICF A;  1O3T A;  3CCE I;  2VQG A;  2FEZ A;  2LFB A;  5HS7 A;  4I2O A;  3G1L A;  3KZY A;  2JA8 J;  2VC0 A;  3L2C A;  4A0Y A;  1G3S A;  2HZD A;  2VBX A;  5GTH C;  3N4M A;  2CUE A;  2GLO A;  1D0Z A;  1X4P A;  1IGN A;  1ORK A;  3RZD J;  3P5J A;  4E7Z A;  3ABT A;  1R00 A;  2HOE A;  1KQ0 A;  1RI7 A;  2DOD A;  2FBK A;  4I0B A;  2VN2 A;  4AU7 A;  2G7H A;  1WZ2 A;  3Q9S A;  2O5R A;  3KP7 A;  4UY8 I;  1F9N A;  3GCM A;  2K7L A;  1BL0 A;  4B43 A;  3GXO A;  2HR3 A;  3F21 A;  4BQQ A;  1G3T A;  3IRQ A;  2G0E A;  2H6B A;  3BZC A;  5HOD A;  4FCY A;  2NVQ J;  2EV6 A;  2RNG A;  4R79 A;  3CJT B;  2XC7 A;  2G7U A;  3CDL A;  4KDP A;  2CW0 F;  3HTS B;  4CCK A;  2CW8 A;  1BM9 A;  2ZXH A;  3U9G A;  2L4A A;  3TW7 A;  2F5C A;  2XGD A;  2RQQ A;  5C44 J;  4A69 C;  1E3H A;  2VT3 A;  5E1Z B;  4CCO A;  4IXA A;  4F92 B;  5EF6 A;  3RPU D;  3I56 I;  1BIA A;  3C2B A;  4UB8 C;  4XOP A;  2R3S A;  2R4G A;  1V5E A;  3CCY A;  5BPD A;  3KP3 A;  5IP7 J;  5EJC A;  3LSK A;  2KRC A;  4HQE A;  3S3N A;  4F3Q A;  1APL C;  3CC4 I;  4RAZ A;  1IXS B;  2ZXW H;  3DCF A;  4BY1 J;  4KIS A;  1Z6T A;  4XRS A;  3A2K A;  2L9N A;  4M6Y A;  5DD8 A;  2EBI A;  1PDN C;  2DPU A;  4RLF A;  4WX9 A;  2VAS A;  5DS9 A;  1S6L A;  4A5M A;  4NB5 A;  2CG4 A;  1FSH A;  4G94 A;  2ZFU A;  4M6X A;  3I55 I;  2FMY A;  2OQG A;  5CLS A;  3DEW A;  3T8T A;  2YS9 A;  1YQA A;  4E7S A;  4A3G J;  2RAE A;  1BR1 A;  4IKF A;  4W1U A;  1FC3 A;  4DW6 A;  3UKG A;  2ID6 A;  4KT5 C;  2BW3 B;  3ZMT A;  3EDP A;  1AOY A;  3I4P A;  3CQZ J;  4PFO A;  2TCT A;  3BJ6 A;  1JTY A;  4M3E A;  5IYB J;  3BTI A;  3ZN0 A;  2BV6 A;  2XKP A;  2QLZ A;  2Y30 A;  1L3L A;  2F2E A;  3EYI A;  3HOW J;  1Z3X A;  4Y15 A;  3HC7 A;  1HC8 A;  1N77 A;  2M87 A;  3OR2 C;  1WPK A;  1XGM A;  4OOI A;  2VKD A;  2OZ6 A;  3L2R A;  2K9N A;  3LA2 A;  3DF8 A;  1D8K A;  3IH2 A;  3MKL A;  1R7J A;  5K1Y A;  2EZL A;  1R5H A;  2HKO A;  4GO1 A;  5M3F J;  3DBR B;  5AIP A;  2CQQ A;  2GXB A;  1QU3 A;  3DEE A;  3TGN A;  1TQP A;  1XPX A;  4G7O F;  1G8X A;  3J81 Z;  2PMZ N;  3WE3 A;  2HQR A;  4HV5 A;  3IKV A;  2GQQ A;  3BOQ A;  2JA6 J;  3PIP F;  2RKH A;  2WY7 Q;  3QOP A;  3ECO A;  3DXJ F;  4HLY A;  3HRM A;  1UEL B;  4PK4 A;  3HB9 A;  2QQB A;  4HX7 A;  3O8H A;  1FJL A;  4ZDO A;  5FO5 A;  3HYI A;  1WJ5 A;  3RKX A;  2LC2 A;  1RNL A;  2PN6 A;  1XGN A;  4LD5 A;  3S2W A;  4Y17 A;  3I59 A;  1B8I A;  1D0X A;  3PQJ A;  4Q48 A;  5E1W A;  1CF7 A;  2W00 A;  3CO7 C;  3FWE A;  4BY7 J;  4LJZ F;  2KHM A;  4HF0 A;  2YUS A;  1IC8 A;  1XCB A;  1YI2 I;  4YIR X;  1RUN A;  3WOD F;  3LA7 A;  5GP9 A;  5FLX Z;  5IP9 J;  5FRN A;  2FQ3 A;  4XMY A;  1WJA A;  2DBB A;  3CCJ I;  3UNG C;  3A02 A;  4LFU A;  3E6B A;  2P5K A;  1ZHF A;  2CV0 A;  1WFX A;  1FP2 A;  2WAQ N;  1IDZ A;  3HUG A;  2XDV A;  2Z16 A;  3P7N A;  3AG3 H;  1W0T A;  3K4J A;  3VSK A;  3JR9 A;  3PFI A;  4ENM A;  1W0U A;  2FRH A;  3OMY A;  2JVH A;  4BBS J;  4HYE A;  4NC6 A;  3WHC A;  3J80 Z;  2ICW G;  4RM2 A;  4QTR A;  3ULQ B;  1FP1 D;  4HBL A;  1HF0 A;  3WGI A;  3RQI A;  3C2H A;  3DQV C;  4M73 A;  1XDS A;  2M3A A;  2XB5 A;  1XG1 A;  4PJM A;  1B72 B;  2VKH A;  4I99 C;  3VDX A;  5DCM B;  5BS6 A;  1YG2 A;  4XRF A;  2HU9 A;  1P9Q C;  1FOK A;  3L00 A;  4L9N A;  1UFM A;  2QKL B;  4IOC F;  2MH2 A;  3A0B C;  2AS5 F;  2CJJ A;  2KQR A;  3LSG A;  4W97 A;  2JQ7 A;  3DPT A;  2IGO A;  3H3V K;  2XGX A;  1YOV B;  5J8C A;  1NK3 P;  3MZY A;  5K5Q A;  4I98 B;  3WTY C;  4HPQ A;  1HOM A;  1LEA A;  3LWF A;  4BXF A;  4II3 A;  3T8R A;  4I0A A;  2LBF B;  1PUE E;  2E7W A;  2CS3 A;  5CQG A;  3ML6 A;  1XC5 A;  3SZT A;  2KT0 A;  4L9V A;  1OCR H;  1R1V A;  1H8A C;  3S14 J;  1IXR C;  3BR1 A;  4LLN A;  1ON1 A;  3PO3 J;  1J9I A;  2UUZ A;  1K4T A;  1LFP A;  3W2A A;  4KIG A;  2QQA A;  3HPH A;  4UUS B;  1X2M A;  3GLL A;  3REO A;  2CQX A;  3F0C A;  2XAJ A;  5B1A H;  4UNO A;  2KMU A;  1BI0 A;  2FSW A;  3HOT A;  3I4N J;  2ZC2 A;  2CQN A;  2XF5 A;  3AG1 H;  4FTH A;  3D5R C;  1A5J A;  4L9J A;  4GFB A;  2DU9 A;  1STZ A;  4XLA A;  2XAF A;  2EFN A;  5FB2 A;  2KDO A;  2VL8 A;  2QEX I;  3S2H J;  2P5V A;  2COM A;  2DA2 A;  2KP6 A;  1OIS A;  1JT6 A;  3CME I;  2LVS A;  1ZG1 A;  4WK8 F;  2VUM J;  4B3A A;  1BI2 A;  2R7U A;  2KIM A;  3GLX A;  3K4K A;  1KYZ A;  2XPU A;  2P4W A;  5K7Z A;  4MTD A;  3E6M A;  2GOM A;  2GXG A;  2Z1D A;  3PNY A;  3I54 A;  3IH3 A;  3RQ4 A;  3BR3 A; 
#chains in the Genus database with same CATH homology
 4XKW A;  1Y56 A;  4G6T B;  1V5F A;  3EPZ A;  3F9K A;  3QOE A;  2RRE A;  1X4O A;  3HPG A;  3MKY B;  3A1Y A;  4LG3 A;  4CH7 A;  2WAQ A;  3H9G A;  2X51 A;  1FMW A;  2W7N A;  2OUM A;  2WAE A;  4ZJZ A;  3FDY A;  2DCE A;  2IS2 A;  3K4L A;  1D0Y A;  3N05 A;  4BL0 B;  3K6G A;  4ZTF A;  4DIQ A;  4J01 A;  2CUZ A;  2JA2 A;  3IAS 2;  4QPQ A;  3ZRG A;  2X6X A;  2XF7 A;  2R7V A;  2X1C A;  1GLN A;  2V9K A;  3DKX A;  2AQF A;  3EUH C;  2M4K A;  3W2W A;  1DP3 A;  2R7X A;  1D1A A;  1S9H A;  1YE9 A;  4CSW A;  1BR2 A;  2R7S A;  2M4G A;  4CCJ A;  4U7B A;  2VQH A;  2AQE A;  2BVM A;  2VQL A;  4QPO A;  4OWR B;  4ZTJ A;  1IRX A;  3OYJ A;  1MND A;  1YX3 A;  3PNT A;  3K4M A;  4YEL A;  3DKY A;  4CZC A;  3OYI A;  4RM3 A;  4J00 A;  3KYL A;  3DU5 A;  2K5C A;  3CMM A;  1MMA A;  3L2Q A;  2UWM A;  3HXL A;  2L5Q A;  4IQJ A;  4NC8 A;  1TT0 A;  2PJR A;  4PSW A;  3BG7 A;  3LMM A;  3HOS A;  2ZXI A;  2L9S A;  4ITV A;  4NQW B;  2V26 A;  4BE1 A;  3L2V A;  4B48 A;  4X0G A;  4BE0 A;  3IAM 2;  3U21 A;  2X1D A;  3DPU A;  1R6R A;  5TGT A;  3ZCO A;  2IXS A;  3OL4 A;  4XN3 A;  3S93 A;  2E60 A;  1N75 A;  3HG9 A;  3KEY A;  2X85 A;  3FKJ A;  4CCM A;  2KRH A;  3SEQ A;  3K4N A;  5FRO A;  2WBM A;  1BOB A;  4CA0 A;  3BCB A;  2X6Y A;  3PL8 A;  3SEZ A;  4F91 B;  3OYD A;  4E7H A;  1UAA A;  1DGW Y;  3EUK L;  2XAU A;  3PNV A;  2VJ4 A;  4IX7 A;  1WJF A;  3L2W A;  1LKX A;  1ZEL A;  2W82 A;  3PJR A;  2L2O A;  2W1O A;  3C2G A;  3RSN A;  1X19 A;  4XOT A;  2V6E A;  2IS6 A;  3H5R A;  4XR6 A;  2PMZ A;  4Y33 A;  1D1B A;  3OS0 A;  2VIX A;  2R7Q A;  1DQU A;  2R7O A;  4RLQ A;  2JUG A;  1OLT A;  4E7L A;  4YRV A;  3TMO A;  4XL9 A;  4C2T A;  2WB1 A;  4XN0 A;  1MW7 A;  4Y4R A;  1T95 A;  3OYL A;  1PJR A;  1VZ0 A;  3PSF A;  2CUJ A;  2DOA A;  3ZQQ A;  2VJJ A;  4DJA A;  2HPI A;  3MMY B;  4P1W A;  2F5V A;  3FBN B;  4E7J A;  2Q1Z B;  5CKT A;  1X1B A;  1MMG A;  4HRI A;  3BCA A;  1E0E A;  1V5G A;  3TL4 X;  4Y3O A;  1T0F C;  2M0M A;  2IGN A;  1TZL A;  4FET A;  1X1C A;  2VPL A;  2V1N A;  4B44 A;  2LRD A;  1EA3 A;  2CFO A;  2KPM A;  4D1Q A;  4NUB A;  4DBR A;  3QYF A;  4CUG A;  3VYU B;  3CP8 A;  4ZDL A;  3I3L A;  4XQF A;  1QHH D;  4ANJ A;  3SDB A;  2BW3 A;  3S3M A;  1KON A;  2ZSH B;  2VLA A;  3UR3 C;  4HG2 A;  1YX5 A;  4EAT A;  2PJR B;  2IS1 A;  2R7W A;  3NWS A;  4NC7 A;  1D1C A;  3QYB A;  5JHF A;  2VQG A;  3CES A;  1QHG A;  4E6K G;  3H5A A;  4BJT A;  2M7B A;  3PSI A;  4XLC A;  2L7K A;  2HZD A;  2VQC A;  4XON A;  3MD2 A;  3IP4 B;  3OYE A;  2F6C A;  1D0Z A;  1X4P A;  2VJI A;  2Q2E B;  3D5L A;  3IUO A;  4E7Z A;  1Z21 A;  1SAU A;  2FUG 2;  3VYR B;  4AU7 A;  4XKB A;  2O5R A;  3OS1 A;  4BS9 A;  2R7T A;  4B43 A;  1MNE A;  2DT6 A;  4BDY A;  3OOU A;  2CV1 A;  4IZZ A;  4OAY A;  4PFP A;  1Y6I A;  4BQQ A;  3H9J A;  3W2V A;  1WJE A;  3FHN A;  2RNG A;  4R79 A;  4BGD A;  4FAS D;  2CW7 A;  3M8J A;  2XC7 A;  4D9J A;  2VJ5 A;  3DTI A;  3DU6 A;  4CCK A;  2CW8 A;  4DOZ A;  4DBQ A;  2ZXH A;  3ZXS A;  2MAB A;  4BEH B;  2RQQ A;  3CP2 A;  5CPR B;  1BR4 A;  2MD0 A;  4CCO A;  4F92 B;  4XKC A;  3RPU D;  3OYF A;  4XOP A;  2R4G A;  2CV2 A;  1V5E A;  2KZV A;  4ZC3 A;  4CCN A;  4PSX A;  1LVK A;  3LSK A;  2KRC A;  4BQN A;  3S3N A;  4F3Q A;  4KIS A;  2OC6 A;  3A2K A;  4U87 A;  2L9N A;  3DTE A;  1WJC A;  4RLF A;  5LD2 C;  2VAS A;  2LY2 A;  2VB6 A;  4AVZ A;  3QOD A;  3QYE A;  2XSJ C;  1DGR M;  3VSL A;  3E1S A;  4E7K A;  3H9Q A;  3I9V 2;  4F52 A;  2LOO A;  2ZFU A;  2DT7 B;  1OR7 C;  4N4O B;  1ERD A;  4HEA 2;  3E0J B;  3H35 A;  3ONQ A;  3S8P A;  4E7S A;  3CF2 A;  1BR1 A;  4N4N B;  4IKF A;  4XOR A;  4NNJ A;  4BAC A;  2W4S A;  2BW3 B;  4BEH A;  5HNF A;  4LIU A;  4CCL A;  2F4I A;  2DJI A;  4PFO A;  2IS4 A;  4MLO A;  3OYN A;  4C30 A;  2R7R A;  4OAZ A;  3W3C A;  1MMN A;  4HNT A;  2A6T A;  3OS2 A;  2DXI A;  1Z3X A;  3HC7 A;  2Y0S A;  2Z2S B;  1N77 A;  3OR2 C;  1K6Y A;  3OY9 A;  3BG6 A;  1NG7 A;  3ZR8 X;  1Z7L A;  1LDK B;  2VKD A;  3L2R A;  4KJZ A;  3KX2 A;  5KCM A;  1X1A A;  1WJB A;  3LSH A;  2KL4 A;  4YEJ A;  2HNH A;  4AYB A;  1QU3 A;  3DEE A;  2K9M A;  5CQE A;  3VYT B;  2V4J C;  1G8X A;  4II2 A;  5KNL A;  2MFZ A;  3MKZ A;  2E5Z A;  3LFU A;  3HKZ A;  3AL0 B;  2WY7 Q;  1SFK A;  3DLA A;  1UEL B;  2A5W A;  4PK4 A;  2HVS A;  4C2U A;  3GBG A;  4ZDO A;  3J7A Y;  1WJ5 A;  2LC2 A;  4LIT A;  2XF6 A;  1D0X A;  3D5S C;  2W00 A;  2HVQ A;  2E1M B;  2KHM A;  4GRI A;  3VYS B;  1AA7 A;  4E4H A;  3SZG A;  3AFH A;  2X1E A;  3G2B A;  4H4K C;  2JSP A;  3OYG A;  4BDZ A;  3DTK A;  1W36 D;  5FRN A;  1PYV A;  4XMY A;  1WJA A;  5HOO A;  1HA8 A;  3UNG C;  2VXZ A;  3OIQ A;  3OL3 A;  4HNU A;  2CV0 A;  3OYK A;  3TBI A;  2HPM A;  1WFX A;  5HLT A;  4XLF A;  2OV7 A;  2JVG A;  2XDV A;  2Z16 A;  3OWT A;  4XLE A;  3K70 D;  3S32 A;  2GOX B;  1UG0 A;  2CH0 A;  3K4J A;  3VSK A;  2LH9 A;  3PUB A;  1MMD A;  2UV1 A;  3RCO A;  4XLH A;  2K3P A;  2LRE A;  1NG6 A;  3OMY A;  2JVH A;  4ZYA A;  3MKW B;  3SYT A;  2WAF A;  2VXD A;  5FRM A;  4BJ6 C;  4RM2 A;  2P0W A;  3AL0 C;  3C2H A;  3DQV C;  2HDW A;  3LL7 A;  2M3A A;  4PJM A;  2VKH A;  2IGK A;  3VDX A;  3V42 A;  4HST A;  3EUA A;  2LG4 A;  3BC8 A;  2HU9 A;  1P9Q C;  3OIP A;  3K4B A;  3DWL E;  2QKL B;  2E1M C;  4BU2 A;  3OYC A;  3K10 A;  3VWB A;  4BUP A;  2MYS A;  3OYH A;  3H5N A;  2KQR A;  3LSG A;  1J09 A;  3CZ6 A;  3M1C A;  2HQA A;  3NWT A;  4XM3 A;  4PUS A;  4XKV A;  2LYC A;  4F93 B;  3H0D A;  3DPT A;  3OYA A;  2IGO A;  2V7F A;  4BE2 A;  3ZGK A;  3DPL C;  4B3X A;  4E7I A;  2ZSI B;  4PJN A;  4HPQ A;  5LFA A;  4KIT B;  4IQ4 A;  1G59 A;  4BXF A;  4II3 A;  4RMN A;  2BOL A;  2LBF B;  2CS3 A;  5CQG A;  2LY1 A;  3K4C A;  4BJ5 C;  5KHD A;  3CJR B;  3BLY A;  4P5O A;  4BQO A;  2UUZ A;  4DGW B;  1N78 A;  1LFP A;  3W2A A;  2E5N A;  2MC4 A;  2QKM B;  4PJL A;  3L2U A;  3HPH A;  2WAD A;  2NOJ B;  4C9Y A;  1W36 C;  4PJJ A;  1JI8 A;  3RTR A;  4JQF A;  2K9L A;  4ZDP A;  2KMU A;  4XNF A;  3HOT A;  2WA0 A;  2BVL A;  3A4C A;  4HSR A;  3HL2 A;  2WY8 Q;  2XF5 A;  3FBI B;  3D5R C;  2X6W A;  2M7A A;  4XLA A;  3OR1 C;  4B47 A;  4JOM A;  1Z3Y A;  5HVQ C;  3K70 C;  2KDO A;  2VL8 A;  3S3O A;  3LSI A;  3PFY A;  2CMP A;  2ELJ A;  4LIV A;  2KP6 A;  1WJD A;  3LSM A;  2HVR A;  3CJQ B;  2IGM A;  1FMV A;  4F55 A;  2LBF A;  2R7U A;  3OYB A;  3K4K A;  5HNH A;  3AKZ A;  2KLO A;  3HUG B;  4KT6 A;  3OYM A;  2GOM A;  2Z1D A;  3PNY A;  2I8D A;  1U0J A;  3RQ4 A;  1X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...