2LYCA

Structure of c-terminal domain of ska1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
b'MNDIRIVPQITDEEFKTIPKYQLGRLTLEMMNEIVSKMDDFLMKKSKILGKTNKQLTRSDREVLDNWRELEMKARKRLPTTLFFIETDIRPMLQDRLRPSFAKAIPCLRHIRRIREERCGPLTFYYPGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spindle and kinetochore-associated protein 1 homolog
publication title The kinetochore-bound ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 27
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1890 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lycA00
4C9YA 4CA0A 2LYCA
chains in the Genus database with same CATH superfamily
2VXDA 4MTDA 4U7DA 2H09A 2K4BA 5F08A 5IYBJ 1SFEA 4WX9A 3TMOA 4L18B 3FK7A 3MVPA 1IV8A 3MKZA 3L09A 1W0TA 5BQTA 4A5NA 4UHTA 5KK1A 1ZYRF 3HDDA 3OSGA 4HG2A 1B9NA 4CZCA 3BDDA 3DFGA 2K5CA 3JR9A 2BBYA 5EGOA 4XN0A 3V7SA 1P9QC 3SQNA 1YG2A 3ZN0A 3K4BA 4ESFA 4D5CA 1YITI 1YQAA 2EZHA 1V3FA 1GXPA 3RCOA 1WCMJ 3TL4X 1LDKB 2M4KA 2QKLB 3DBLB 1TT0A 2QQ8A 3CC7I 3TQNA 3RIRA 5HS7A 3TW6A 3CC2I 2Q2EA 3OYHA 1FSEA 1APLC 1MNEA 1E0EA 5JFRA 1CF7A 1OISA 3IUOA 4L9TA 1IN6A 3HM5A 1A36A 2HWVA 1Z67A 1VQOI 4RLQA 2DMQA 1TWFJ 2CW0F 3BT9A 3ZQLA 4A0XA 3H5AA 2ZXWH 3QOEA 1JXSA 3T1BA 2AHQA 2RQQA 5E3LA 1VF9A 1BL0A 1VTNC 5J8FA 1FOYA 3ZQIA 1I27A 1J5YA 1Z7LA 5HDGA 3FDYA 1MH4A 2HNHA 4UV8A 1JGGA 2R93J 2JK3A 3GX4X 2Y9YA 4F91B 1XDUA 3A01B 3BR0A 4WXCA 5CVJA 1MBFA 1RESA 2DA1A 3QPLA 3U1DA 1PUEE 2KJBA 2ZCWA 3C2BA 2RKHA 1ON2A 3T0YA 4BQAA 1T0FA 4QIWN 3I9V2 4MLOA 5GPCA 3HZJA 2TRTA 2H1KA 2V9PA 1D3YA 3H5NA 1CGPA 1YW9A 3IRRA 2DDAA 1ETYA 2E5NA 1PYVA 1LUJB 4AC0A 2R7XA 3HYIA 2KMUA 3DBHB 3QPHA 4UB6C 1WJBA 3C3WA 2R5YB 2CMPA 4H4KC 4BY7J 4I6ZA 2CH0A 1IRXA 2DMPA 2BV6A 2MD5A 1E3OC 1WQ2A 4KT5C 1UHWA 5LRRA 4OINF 3PJRA 4GRIA 2E5ZA 1HSJA 1HW2A 5DD8A 1WI3A 2CQXA 1W7PB 4KT6A 4U0VA 3LNQA 4XIDA 2OTJI 1E17A 1YS6A 5GAHJ 2XAHA 1M1EB 1DP3A 3MZ8A 3K4NA 4A3EJ 2W84A 1TW2A 3X2QH 1T39A 2K86A 1QPMA 4M3FA 2Y0SA 2D1HA 3VOEA 5LHHA 3WTTC 1RC9A 1T6SA 4JK1X 2NYXA 1HA8A 3LSKA 4ZTJA 1LVAA 4IHSA 2PJPA 1TWGJ 3HEFA 2ICWG 2LFBA 1STZA 4M9SA 1T08B 1X1DA 3WG9A 1O57A 5J4VA 3GFLA 3CCLI 2QA4I 4G6QA 3BTIA 4ZYEA 2E34A 2M45A 2CUJA 2JZYA 5CYVA 2Z33A 4WXDA 4PJLA 1W5TA 3OR2C 2PMZN 5H2FC 2O61A 3KLNA 1MMNA 2V1XA 4PGGA 1DPRA 2L02A 3F9KA 4FE7A 5KAIC 2ZJ2A 4LMYA 3B02A 4RAFA 4BS9A 3DQVC 1JUPA 5EG0A 4CCKA 4A2UA 2GXBA 2M7AA 2IRFG 4JBAA 1U3EM 1MJBA 4I01A 3ZQ7A 4LK1F 1BIAA 1UG0A 2F5FA 3A0BC 2OBPA 1DU0A 4HLYA 1DGRM 5D8LB 2ISYA 2R4GA 3QYFA 2Q8KA 3HXLA 2K9QA 4G7ZF 1A35A 4C9YA 4II3A 3GFIA 1PVEA 2VIXA 3F21A 1ZGAA 5JHFA 5K5RA 5HLHA 3HRUA 1SC7A 4DYRA 3H92A 1S29A 4DQ2A 4OMYA 4XNFA 4B09A 1WJAA 2ECCA 2FU4A 4C30A 1R9TJ 2IEKA 3H35A 2DU9A 3BWGA 1FY7A 3FHZA 1YX3A 3HHHA 5IPAA 3U2RA 1U5TA 2GOMA 2EV0A 3K4LA 3VYTB 3CC4I 1YJ9I 1Y6IA 2LC2A 2K9LA 2WADA 4EV0A 3DU5A 4UUVA 2OF7A 3H3VK 1DU6A 2CUFA 2FD5A 2L9RA 1R58A 5CPRB 2MG4A 1EV7A 3GYHX 4FETA 1PUFB 1LEAA 1XTAA 2DT5A 3LWFA 2JPCA 3CO7C 3RYPA 4OAZA 2V7FA 3M8FA 3FWEA 4ZDLA 4HX4A 3OSFA 2RN7A 5CLSA 3HOXJ 4NC6A 4HZFA 1A6IA 2QZ8A 1UB9A 2X48A 2X9DA 2K3PA 4JOMA 5FKKA 3LFKA 4HPQA 2VPRA 3I0TA 1J09A 3FISA 3QWLA 2EH3A 3NEUA 2VL8A 2QBYA 2M8EA 2KDOA 4KICA 3RKYA 2OAZA 3OIOA 2R7RA 1I39A 2HS5A 2DODA 3K4KA 1PDNC 1FTTA 4PGHA 5EEAA 3DKYA 1IG7A 3SZGA 4P1WA 1XB4A 3CCMI 4DYCA 3M7GA 1J7KA 3ZN1A 3WU1B 1IJWC 4CGZA 2E2HJ 3G3ZA 2M2EA 3HUGB 3B6CA 3FXKA 1TL8A 2VQGA 1B8IA 4MEXF 3OL4A 3MCZA 3VYSB 1P7JA 2YPRA 1Y0UA 1QNTA 1G59A 3EPZA 2V79A 3L2WA 1J59A 4IX7A 2M34A 1ZR4A 4GDFA 1V54H 5FGMA 2ISZA 3PO3J 2H27A 2P5KA 1FOKA 1S7EA 2FJ1A 3MD2A 3O8HA 3F8BA 1I6XA 2BY3A 3Q0WA 2K85A 1KYZA 4P9FA 2PG4A 3BQYA 3E5XA 2JT1A 3N97A 5J6XA 2N8GA 1F5TA 4EM2A 4HF1A 2CJJA 5J1UA 4XSXF 3GO5A 1FT9A 1G3WA 4BNCA 2FXAA 2MFZA 4UVCA 2HYJA 1H88C 3K10A 1W36D 2A69F 3I58A 1TLHB 2W00A 1IW7F 2XF6A 4P96A 5IOYA 5J8CA 3ABTA 2QWWA 3TDZC 3KLOA 4AU7A 3VFZA 5HLIA 1R23A 2JQ7A 2MGQA 4BJ6C 1FYMA 1IXRC 4R8HA 3ZXSA 3PFIA 4KN7X 4KJZA 2DK5A 4EMSA 2ZB9A 2E60A 2PN6A 3U1KA 1Q1HA 2QEXI 2IS1A 2EILH 5KNLA 1EH6A 5E20A 2PLYA 4LG0A 4B44A 3A2KA 1UCRA 1NK2P 3BC8A 4AWXB 5CVUA 4MHGA 2F5DA 1ETXA 2HVSA 1B6AA 3GFMA 3ONQA 9ANTA 5HNHA 1HSTA 1UMQA 3LSPA 3HOYJ 1ON1A 2NXNB 4CDGA 4XK4A 1F4KA 1IDZA 1EH8A 2BY1A 3HOSA 2HPIA 1D1CA 4A3DJ 2GXAA 1F43A 3MKYB 5H6QA 1FIAA 1H9TA 2BVLA 5DEQA 5DYMA 2RNJA 5A2QZ 5B5EC 4PJ0C 4ZDOA 2WAQN 3WHCA 1H9GA 3JRGA 4O6JA 2DJNA 2QSHX 1S9HA 3C2GA 2YR2A 3FZVA 3A1YA 4TV7A 4M6YA 3RTRA 3VB2A 2NNNA 1Z21A 2M0MA 3L2RA 1JHFA 1YJNI 4PJJA 3M1EA 2FOKA 2QF7A 5FJ8J 1XPXA 4F3QA 2RQPA 4FISA 2QCOA 2BY2A 2DQRA 3U21A 2BY0A 3JRCA 5M5YJ 2X1CA 2AO9A 1SFOJ 1EH7A 3RQ4A 4CSWA 1OCOH 1RI7A 2KHMA 1SEUA 2LBFA 2VN2A 4HNUA 1MDMA 1U9NA 3QPSA 3RZOJ 3OWTA 4O3MA 2EFPA 2ZSIB 3FX3A 2M7BA 1S72I 2KRFA 2JVHA 3GLLA 3OS2A 2WV1A 2LYCA 1QVUA 3CDLA 2HXOA 3HIFA 4HYEA 1T0FC 5AIPA 4AUXA 3B6AA 5B66C 3WTWC 1IAWA 2QGUA 2R7FA 3L2QA 1Y1WJ 2R92J 4YRVA 2NVQJ 1D0YA 1XGMA 4LLGF 5J4YA 3NWTA 5ED4A 4CYCA 3D5RC 1FBUA 2E1MC 3DBRB 1YO5C 1NTCA 2E1OA 1LFBA 4FE4A 3V42A 5D6EA 4ZDPA 3MFKA 1CQTA 3DPLC 3HGYA 2ELJA 3K7AJ 3J80Z 5L3GA 2BEOA 4K2EA 2F5EA 5DD4A 4KDPA 3RKWA 3W2WA 1VZ0A 2W25A 5H6RA 3I71A 2XGEA 3F6OA 1B72A 5LGTA 2DJIA 2E36A 2ID6A 2ZSHB 4B1RA 3NRVA 2KQRA 3J7YJ 1ZH5A 3A0HC 3L1PA 3TO7A 2DO7A 3F6VA 4EM0B 2A05A 3VPRA 1BJZA 2HOSA 4U0WA 3I4MJ 2NS8A 1T98A 2WAQA 2IGKA 2R3SA 3F72A 1EKEA 2A5YB 3VSLA 2C6YA 5HVQC 3LMMA 4B43A 4WF2A 3F8CA 4RMNA 4XL9A 1NH3A 1W36C 2P7VB 2MSYA 3G1MA 2BW3A 4XOTA 4JX5A 1UHMA 3FM3A 2HXIA 5EJCA 3GBGA 3M07A 3LSRA 1O3RA 3CDHA 4I0AA 3IP4B 5FFXA 5BS6A 1YRNA 1I3QJ 4E7JA 2MH9A 3PSFA 1P4AA 2YX7A 1SFKA 3EETA 2HDCA 3ESWB 3JTGA 1OCRH 4ENJA 3M3YJ 4Y17A 4S04A 2EJRA 3R61A 2DA6A 1JI8A 3CCQI 3C18A 1TW3A 1QHGA 1KYWA 3CD6I 2JN6A 4FQGA 1R5HA 3QU6A 1HLVA 2I5UA 2QENA 2V9KA 3BZKA 3DV8A 4KNYA 2RAEA 2ESNA 2VQHA 2Q0OA 3MEXA 3WG7H 4Q48A 3DEUA 1R36A 3N4MA 5KVRA 3IH3A 4CICA 4DJAA 2WC2A 3JRHA 4EJVA 1Y56A 2CS3A 3GW2A 1GLNA 3CF5F 4MO7A 2HI3A 2VKVA 2EB7A 2TCTA 1F9NA 3GWZA 3OYGA 2STTA 2Z9OA 3S16J 4B8XA 3TKYA 1U5TC 2R5ZB 1FMVA 5D5XB 4ZZLA 1BC7C 4GCVA 4KIBA 1FBSA 1BR2A 1OR7A 2GBYA 2XSDC 1ZREA 1MW7A 2M3AA 1MBHA 2FSWA 1Y8RB 4DBRA 4KA4A 5CQGA 2P7CB 4I98B 5L3DA 3BR5A 4AIKA 4RDUA 2F6CA 4W97A 3S2HJ 5DUIA 2XAGA 3ZP5A 1ZKGA 4IHVA 1BI2A 3WTSC 2VT2A 1JUMA 3PQKA 4EGYA 3ZQGA 4HQEA 1X1PA 2AS5F 1FSHA 3GEZA 3TW7A 4JYKA 2R7SA 2MABA 1KQ0A 2MW8A 5CVRA 4H0EA 1RRJA 4IHXA 1BI3A 3L00A 3DLAA 1K4SA 3CMAI 4XLHA 4Y15A 4RM3A 4BXFA 2A6TA 3CUOA 3V7CA 1D0ZA 4IQJA 3EUHA 3QU3A 3CO6C 3IRQA 3K2AA 2X0LA 4L0YB 3TGNA 4J19A 5ILSA 1VFCA 2CQQA 4HEA2 4OIRF 2L3DA 3ML6A 4N4OB 4PK4A 2LVSA 5E3OA 1MMSA 3K1NA 2K9SA 1SVLA 3S1NJ 1SANA 3I55I 2X1EA 5F64A 4R1HA 5LFAA 5IP6A 1EA3A 2QUFA 2MLGA 4PJMA 2WWYA 3ZMUA 2J5OA 3PSIA 4CO8A 2ZFUA 3U9GA 5JR3A 3JSOA 1R5ID 4F7ZA 4ZYHA 1T2KA 3I4PA 3OS1A 2M8GX 1EJ9A 4LB5A 2H1LA 5HDNA 3C1DA 2XV4S 2Y48A 4W1UA 1GVDA 1FMWA 2D2WA 2EFQA 2LLKA 2KLOA 4N9IA 2E1NA 5LHIA 3ABKH 3GCMA 2DOFA 4LFUA 5E3MA 2DLLA 4MTEA 3QP6A 4ZTFA 5KCMA 4ESBA 5JI6A 1R1TA 2L9SA 3CTAA 5GAGJ 5HDKA 4MQVA 2H8RA 4CUGA 2Y9ZA 1YFHA 1MIJA 1USSA 3ECOA 3CCRI 4Y3OA 4E7SA 2FMYA 2DFHA 2MA3A 1ULYA 5DDGA 3HOTA 4UUSB 1ZN2A 2IAIA 1N78A 2EZKA 3QYEA 2EA2A 2X6XA 2JRTA 4D5FA 2KIFA 4BHPA 1TT5B 1IZ1A 1JHHA 2FF4A 3BG7A 3PNYA 4RB0A 4UNOA 1Z05A 4AVPA 1P4WA 1TBXA 4HAMA 1A6QA 1RPWA 2P6TA 4BL0B 3DU6A 1LFPA 3HPHA 3RYRA 2XDVA 3S2WA 4ESJA 1BA5A 2FEZA 4RGRA 1FOXA 3BR6A 3FKIJ 2KZVA 1ZLJA 1U0JA 1OPCA 2Z99A 4UB8C 3W6JB 1JKPC 4L0ZB 2E2JJ 3G2BA 4MEYF 1P92A 2GXGA 5M3MJ 3CF2A 5L3CA 2DA4A 3JAMK 4JQFA 2WAEA 4PSXA 2PX9A 5CVIA 4B4CA 3S14J 1TQPA 4HDUA 3VYRB 1JKRC 2IA0A 2CQ7A 3KPHA 1VQ8I 2EV5A 3O8GA 2X6OA 4IO9F 1UELB 1RETA 5HS9A 4G94A 2W1OA 3BG5A 4IOCF 2QYOA 3FBIB 4LOCA 1WVRA 1TNTA 3LFUA 2KJCA 2CUEA 4BDYA 4BE1A 2JSCA 1VQKI 2V9VA 4BQNA 2M1BA 5GTIC 3P5JA 2IGOA 2J5PA 2Y0SN 3FIWA 1R22A 4M6XA 1O7LA 2LG4A 2XASA 3RPUA 4HX7A 2NOJB 3J81Z 3A01A 2ZJQF 4IHTA 2P5LC 2XGXA 4NB5A 1XMKA 2M30A 4XKVA 3HRMA 3GZ6A 2EFWA 2LNBA 2JA2A 1GXQA 3F0CA 3Q0UA 2MC3A 1IF1A 4OIPF 3J7AY 2Y69H 4DZJA 4ENKA 2CQKA 5DS9A 4E7IA 2H6CA 3Q0VA 4CYDA 2O7OA 1S7OA 2Z1DA 3VSKA 5ICCA 1XN7A 4M73A 1BW6A 2W4SA 1ODDA 5AONA 2NAZA 3PO2J 1BOBA 1MJ9A 1YLFA 2ZKZA 2ZJPF 2Q2EB 3RKXA 4EJTA 3H3UA 3JCUC 1DUXC 1ORKA 2ADUA 4A3JJ 1CF7B 3DPUA 4XKBA 2DMNA 3G1OA 2DFFA 2LOOA 3UNGC 1HKQA 3GTKJ 1W7PA 3ASNH 3ABLH 1XS9A 2VKDA 3DKXA 1TQMA 3H9QA 4PSWA 4C2TA 4CCJA 2DFEA 3E6DA 1G3SA 4A3KJ 4BJTA 2B9SA 2X1DA 2GAUA 3SHFA 2L2OA 2E1CA 4Q4ZF 2QKMB 4HX8A 1DGWY 2OUMA 4Y13A 3IHUA 2QQAA 3A03A 3PL8A 1WHUA 2R7WA 2DMUA 3WU0A 2JA5J 1G3YA 1LQ1A 4BBRJ 2Z3YA 1HDPA 2CQNA 6PAXA 2DMTA 1L0OC 2O0YA 2IP2A 3I64A 3PNTA 3HKZN 4XLCA 2UXNA 2GLOA 2ETHA 2GOXB 4BQOA 1MBKA 4RS8A 3F22A 4U0YA 3OL3A 1J75A 4IQ4A 4A69C 4HDVA 2K9NA 4A5MA 2XHKA 1KA8A 2O3FA 1ETOA 2K4JA 2IVMA 3WTXC 5J40A 2M9HA 5LRSA 2IS6A 5LGNA 1RUOA 1QHHD 3KE2A 1O7FA 1AU7A 2JUCA 4XBFA 2DA5A 3BTJA 5FKLA 3JAMZ 1WKMA 3AG4H 1KU9A 1LE8A 2G9WA 2KRCA 2HPMA 3PFYA 3BPXA 4RB3C 4NHJA 3SZTA 2A3SA 3MWMA 4F92B 3ZMDA 2O5RA 3DXJF 5BMZA 1V5FA 2XIGA 3AL0C 2B0LA 4IRHA 5FRNA 1C0WA 3KZYA 1RKTA 1N77A 1ONVA 1I1GA 4EATA 4HBLA 3CUQB 2E19A 3KEOA 5F1RA 2BE5F 4IF4A 1W5CC 3HPGA 2HZTA 2JUGA 4BY1J 2NVTJ 2KZGA 1FBQA 3O2PE 3L7WA 1WH7A 4GXOA 1O3TA 3R4KA 1TWAJ 3F8NA 3ERED 3GTMJ 4YFNF 3ZQCA 1MSFC 4FX0A 1T33A 3MKLA 2JPBA 2PJRA 2XVCA 4S05A 4QTRA 3HOVJ 3HTUA 4P9UA 4D7MA 2STWA 5DTDA 2JA8J 1FC3A 2RVCA 3HKZA 3WE2A 3FMRA 1P4XA 2P4WA 4DIQA 2CRGA 2ELKA 4E4HA 1T56A 2ZBKA 1OR7C 4GYIA 1BJAA 2K9MA 4B48A 3KYLA 4BQQA 3GTPJ 5F04A 5A2QK 2JJ7A 3HTSB 4XLAA 1OLTA 4LGWA 5GAEJ 3RPUD 1FP2A 5HLGA 3ABMH 3FXQA 2D45A 3KYCB 1ETWA 1O4XA 4HF0A 3LAJA 1IUFA 2R0QC 4MNUA 2FNAA 1HOMA 4F93B 4E7HA 2CWEA 5ILVA 2P5VA 4A93J 4YEJA 1HQCA 2WY8Q 2OCEA 3ZQHA 2L4MA 3HUGA 2HU9A 2VI6A 1XGSA 2D5VA 1A04A 3QAHA 4U87A 3CCUI 3FHNA 3EUHC 1Z77A 3JRDA 5IT9Z 2CW8A 1J9IA 2X4HA 1JE8A 3A4CA 5J1YA 3HOUJ 1LDDA 2OPTA 5F0HA 2DPUA 2Q1ZB 2VUMJ 1U6GA 5KAFC 3CMYA 2O9LA 4CH7A 3GTLJ 1DQUA 4YG2F 3R6SA 3JRIA 3OYAA 1W7PD 4IHYA 3OYLA 3JTHA 3SYTA 4IVNA 1XSDA 4Y33A 5F1JA 1I3AA 2ACJA 4BHCA 5DM7F 2HKXA 4BACA 1XCBA 3J80K 4KFCA 3OOUA 1MNDA 2LP0A 4ASNA 2QBYB 3ZPLA 3K9TA 4N0BA 2X51A 1T38A 5EDNA 3MKWB 2F4MB 1TC3C 4KIGA 1JKQC 2ZMEB 2YX4A 3DP7A 2LD5A 1ITYA 5E8IA 2VASA 1RUNA 3BG9A 2EQRA 5F6FA 1FYKA 3BR3A 3J7AO 3LA2A 5BPDA 2L7FP 4ENMA 5IT3A 2PMHA 3GTQJ 3H1CA 4PZJA 3W6KB 1B8IB 1R1UA 2YSRA 2V26A 2BXYA 3CQZJ 5FROA 5ICFA 3RZDJ 1DP7P 1D1BA 2O8KA 4XQFA 2CO5A 1BW5A 3M4OJ 4YFXF 5FKNA 4ZYAA 1FYLA 3EYIA 4GO1A 3S15J 5FB2A 2DW4A 4AD9A 1U2WA 1QA6A 5FKOA 2IGMA 2KT0A 3CZ6A 3GMEA 2V1NA 1QPIA 4XRMA 4A0ZA 1X58A 3S3NA 4U7BA 3I56I 3OYDA 4E7KA 2GM4A 1GHCA 1FOWA 3H36A 2XAQA 1ZLKA 2KRHA 3DCFA 3GTGJ 2EZIA 2YU9J 3NQOA 2KDZA 4UY8I 1V55H 4CXFA 3QOPA 1ZQ3P 4ANJA 4KN4X 1SD4A 3NAUA 2XROA 1Z6TA 1OQYA 5CKTA 2UUZA 3FXOA 2R7ZJ 4DW6A 4HOBA 4B3AA 1FTZA 1H8AC 2VBZA 3BP8A 3CJNA 1EF4A 4YIFA 4O5VA 2EA4A 4ZC3A 4CCLA 1IC8A 1R1VA 1LDJA 1WJCA 1SD6A 3DWLE 1G4DA 1BR4A 1VQ7I 3G71I 5LGUA 4F55A 1LFUP 3EDPA 2Z5UA 3OYBA 2NNYA 2G7HA 3LSIA 2VQLA 1SMYF 4RAYA 1RNLA 2CV1A 2HZDA 4LIUA 1Z3YA 2YU3A 5K7FA 5C44J 2OTLI 1WJEA 3L9FA 5GADJ 2E2IJ 2OU2A 3IWZA 4A3GJ 4ZYDA 1YOVB 3DEEA 4L5JA 2K40A 4XSZF 2HTJA 3G6EI 3FM5A 2GIVA 2XAFA 1V4RA 2HVRA 1VQNI 2PBIA 3E5QA 4NUBA 3SFIA 1A5JA 3S8PA 4A3FJ 1HF0A 2VJ5A 1RR8C 2OV7A 3CP2A 3KP2A 2BZTA 3P9KA 3E6BA 4RM2A 2WV0A 3DKWA 3ZMTA 2LMDA 4XLPF 2JA6J 3IAS2 3PUFA 3BJOA 1X1AA 2WTEA 3C2HA 3JRBA 5JVGF 3BTCA 3QYBA 5D5VB 2LREA 3SJMA 2PQ8A 1KU2A 4RA2A 4Y4RA 1ZRCA 4HNVA 1XMAA 5C3EJ 2PMUA 5L3EA 1ZARA 2A07F 4FCYA 4FTHA 3IH2A 2I10A 2HTSA 3D5LA 1ZGWA 1TP4A 5DCMB 4IEJA 4NQWB 4KYWA 3SFZA 2KPMA 3ELKA 3R60A 3TP3A 1POGA 2ZJRF 1HW5A 2RDPA 2DA3A 3PM1A 1OCTC 2A61A 2KL4A 1JT6A 2Y2ZA 2DXIA 1MZBA 4IPAA 4I2OA 2W82A 4EGZA 1MJAA 1FJLA 3K0LA 1K79A 4KMUX 1W1WE 4JX4A 4OMZA 3IWFA 1UG2A 3H9JA 2FBHA 4AYBN 1BIBA 5DM6F 5CQEA 1W0UA 3PUBA 1B9MA 1HBXG 3OR1C 3FMSA 1KONA 3ECHA 1Y8QB 1XSVA 1K6OA 1QVTA 1R49A 1SVMA 4YIIA 4CHUA 3SDGA 2W48A 3KP4A 3SZPA 3OIQA 3EYYA 4J01A 5E79C 1FP1D 2L9NA 4A12A 1I50J 2PFBA 3JW4A 4J00A 3HG9A 3TOAA 2L0KA 2IA2A 1MH3A 1VQPI 1HKTA 1YS7A 4HNTA 4M71A 3Q3SA 4WK8F 1X4OA 1MMDA 1K78B 5TGTA 2IW5A 2LH9A 3GLXA 2VJ4A 5FLVA 4G6TB 4UVAA 1LJ9A 1V5EA 2R5ZA 1F1ZA 4X1EA 3HHGA 2FBKA 2HQRA 1X1BA 2V1UA 3BR1A 1YYVA 5K1YA 2OD5A 3Q9VA 2A5WA 1R00A 4NDLA 4EJWA 1QZEA 1R4MB 4BEHB 3Q5FA 2LKXA 1SAUA 4WCGA 2HOTA 1WFXA 1KQ9A 2ELHA 2IXSA 3TBIA 1HKSA 2VBWA 3K70D 2Z16A 4V2FA 4RB1A 2LTPA 5ICGA 2JVGA 4FHTA 3W2AA 3KX2A 2VC1A 1BM9A 3KYDB 5K7ZA 4BH9A 2KKOA 1TNSA 4RGSA 4G12A 1X4PA 2DI3A 2LKPA 3IH4A 5BNGA 2QSFX 4EVIA 2YS9A 5FFZA 4IJAA 2LSOA 2NS7A 4QSHA 1Z1DA 4YELA 4AYBA 2GWRA 3K2ZA 1AA7A 3J81K 1WJDA 3M8EA 3HC7A 1ZAOA 1QRYA 4I02A 2EIMH 4LJZF 2BYVE 1SMTA 2IGNA 4D0PA 3RI4A 4EM1A 1GV5A 2R7QA 3ZQQA 3GTJJ 4A3CJ 2HGCA 1JTXA 1HCRA 2LY1A 2OC6A 2DTRA 2FQ3A 5FO5A 4LG3A 4UV9A 1LVKA 2CG4A 1RKWA 2HQ5A 4LLNA 3CCJI 3BG3A 5J3LA 4AIDA 4PJNA 3OYFA 2FBIA 1VQLI 3V8KA 4BJ5C 1W5SA 1JJ8C 1GV2A 2OZ6A 4E6KG 2FUG2 1WJ5A 1AKHB 5EYRA 1YHQI 4XRSG 1XG1A 3ABUA 2X85A 4S0HB 3IAM2 1TZLA 2CFOA 3B73A 2DT6A 4BE2A 2EIJH 3P9CA 5J47A 4YIRX 3OYMA 3EUAA 3CCVI 4BBSJ 1RR7A 3WHBA 1FNNA 1Z7UA 3I59A 4UUSA 2Y30A 4XLNF 2OA4A 4KISA 5E17F 2VJIA 3GTOJ 3K6GA 3ZCOA 1X3WB 2DK8A 1IN8A 3FXJA 1K7AA 2CU7A 3V8LA 3S17J 4ZJZA 3VEPA 5FD6A 1WPKA 2MBFA 1ZG1A 5L3BA 1G6NA 2VQCA 3TDUC 1ETVA 1G3TA 2EFOA 3DF8A 2F2EA 3DTEA 2M5WA 2L4AA 4IKFA 3R0AA 1IXSB 3GUDA 1ERDA 2A6HF 3S93A 2F4OB 1IO2A 3T8TA 3V7RA 4CCNA 5D4RA 2K3FA 4FX4A 2NVYJ 3E6MA 5C4JJ 4DOZA 3OYEA 3IV5A 3CDIA 2TDXA 2H94A 3KETA 1YIJI 1B4AA 4N9HA 1RIOH 2XKOA 1AOYA 3K4MA 1U9OA 1Y0NA 5E3NA 4P55A 2MC4A 2XF7A 4LITA 4CCMA 2V6CA 1MBEA 1I6HJ 2DT7B 3TO6A 3BTLA 3PNVA 2WB1A 1MNMC 4ZZDA 1IN7A 2DFIA 3G1LA 4BAYA 3ZOBA 3P7NA 2L54A 4Y52J 1R4NB 1KU3A 1H0MA 1LNWA 4OU0A 1ZGJA 4BGDA 4G7OF 2XUBA 2ZC2A 2CW7A 2WA0A 3FMQA 3WTZA 1VQ4I 3ISPA 3K70C 4XOPA 2GZWA 3HSEA 1IRGA 3RKQA 3AG2H 4C2MJ 3CMMA 2VB6A 4L5EA 1W4MA 2BGCA 1K6YA 3ZMZA 2OQGA 4I09A 2XGCA 3K4JA 3WE3A 5HOOA 1IN5A 2L7ZA 1OYWA 2XB5A 2F48A 3E3VA 3HSFA 3D1NI 3KZZA 1E2XA 3NWSA 2EINH 2IS4A 3AAFA 1BN5A 1E3PA 1K61A 4IOAF 2R7UA 3CJRB 2MD0A 2VBYA 2MLKA 3HRSA 5EGOB 1U8RA 3V4GA 3W6VA 3CCEI 1ZTRA 2R7VA 2HFHA 5E18F 2M87A 4G9YA 5HNFA 3OYCA 1IV6A 3JSPA 4HSTA 5F0CA 2FRHA 2R5YA 3CP8A 3WTYC 2DOEA 4AVZA 2G0EA 2XSJC 3DTIA 3MZYA 1YTYA 1NG7A 2DA7A 1XCVA 5CJ9A 3H3ZA 4RGXA 2DPDA 1X2NA 2DA2A 1ZRFA 1ZHFA 2O8XA 1Z9CA 4DYQA 4V19K 1XGNA 2DTZA 3OMYA 3QPTA 1ETQA 4GGGA 2F4IA 2FA5A 3AFHA 1N25A 5EF6A 2HVQA 4BDZA 4ZYGA 1Y1VJ 4HW0A 1K4TA 3RDIA 4OIOF 3FKJA 1AHDP 3S1MJ 1QU3A 3HBLA 4KITB 3I3LA 3DLLF 2EK5A 4AIJA 1MGTA 2KFDA 3FXMA 4NNJA 2B7EA 5DV5A 2VT3A 2E71A 1JGSA 3MAJA 3F23A 3HJEA 5IT9K 1UJ8A 2YUSA 2VJJA 1KZHA 1MD0A 5GTHC 1YW7A 2BHZA 4V2GA 2COMA 3E97A 2W57A 5M5XJ 3HL2A 3TEDA 1JJ6C 4BXUA 1JUSA 2F5CA 4EEFG 3LOCA 2UZKA 5L3FA 2E1MB 5FLXK 2FNPA 1MKMA 4I0BA 2NOGA 2OQRA 3BCBA 2RNGA 1O3SA 2H6BA 2LY2A 1SD7A 2WY7Q 3T5XA 1R71A 2XKPA 2ZO4A 1OCPA 2CYYA 2MYSA 1OFCX 2DAOA 2FOWA 4PDKA 2DN0A 4BHBA 2AQEA 4G6DA 2UWMA 4MQ9F 2HOAA 1UAAA 4M3EA 5FKMA 2Z2SB 4QWQA 5B1BH 2A6EF 5D4SA 3CUQA 3UR3C 1LKXA 3WGGA 4FT8A 1TQIA 3MN2A 5IP9J 4PFPA 2FE3A 2XRLA 3K1MA 4L9NA 1HC8A 4LD5A 2RC4A 1D5VA 2RV8A 5K5OA 3KP5A 2L9VA 1BI0A 1FWZA 3GVAA 1V5GA 2JTVA 4DBQA 4M3GA 2JA7J 4RB2C 3HOWJ 2P6SA 4C3JJ 1SAXA 1QQIA 4X0GA 3IC7A 1LPQA 2X6WA 4XKWA 2IBDA 4ETSA 2GIZA 2GA2A 3CJQB 3HGGA 1DPUA 3BQZA 4R79A 1XC5A 4AIHA 1PUFA 2DYRH 3BOQA 4B47A 4WWCA 1LE8B 2XPWA 4Q47A 5EG0B 3S1QJ 2XPUA 1P6RA 4XN3A 1FLIA 2OJED 4NBQA 3EQLF 2P0WA 2E7XA 1N75A 1JTYA 3FF5A 1F36A 2P8TA 3UKGA 2MH2A 4I7HA 3G4SI 2XAJA 3QP5A 1SFXA 2ID3A 3D0SA 3PQJA 4D7NA 3G73A 5B1AH 2DOAA 2VC0A 1VQ5I 2DQLA 4HRIA 5JLXA 2Y75A 2JWTA 2XRNA 4A6DA 2LF8A 4DZPA 4M72A 1U78A 2EIKH 4HF2A 5FLMJ 1D1AA 2R7DA 4II2A 4KUMA 1BR1A 2DYSH 5KHDA 1ZELA 1NG6A 4Z2YA 2PJRB 1U5TB 4EQQA 1HXDA 2DDBA 4HA8A 3BCAA 1MMAA 2F5VA 5E1XA 4LLLA 1Y39A 2CV0A 1I5ZA 1OJLA 2EPFA 3GF2A 4XICA 4A0YA 3ZRGA 4E70A 2M0CA 3MMYB 4UVBA 4A6EA 1Z0XA 3AKZA 3K69A 3F8MA 2PMZA 3K4CA 1GDTA 4DNCA 1OCCH 2P81A 2BXZA 2LK2A 3DTKA 3DEWA 3OYNA 5IY5H 5FLXZ 3OS0A 4FASD 4ZH4F 4C2UA 2VONA 3OOPA 1D5YA 4HV6A 3M9AA 1XSXA 3H0DA 5TRDA 3BR2A 2ZMEA 3WGHA 1T95A 2HQAA 1L3LA 2X6YA 5F27A 4CCOA 2AQFA 3FXUA 4BYYA 1ACIA 2W85A 2KIUA 2Y31A 5M5WJ 2M4GA 4PUSA 1H89C 2XPVA 4QPOA 1S8NA 2LR8A 5JLWA 1R7JA 1HDDC 2KISA 1VQ6I 3CMEI 4C3HJ 2CSOA 4MFDA 1WI9A 1X19A 3KEQA 4E7ZA 2FMLA 4XORA 4M9XA 1IXCA 4ITVA 5EZGA 2GA1A 3S1RJ 1QZZA 1J0RA 1E3HA 2AXTC 3LAPA 4LIVA 2H8WA 4QPQA 4KMFA 4M3DA 4DGWB 5BPIA 4RAGA 5ERIA 2V4JC 1USTA 3S3OA 3OIPA 3BROA 5B3SH 1YW8A 2KP6A 2VOOA 1UHSA 4L9JA 1VQ9I 5K7HA 2QLZA 3OYKA 1WSUA 2ZNYA 1VQMI 3KP6A 3GZNB 1ENHA 1FEXA 5HLTA 1S5LC 2GQQA 1ZR2A 4XR6A 3IKVA 3FBNB 2EV6A 1OYIA 4A3MJ 3L2VA 4E7LA 5IYDJ 2RGVA 2EZLA 5D8KB 2ZNZA 5ILUA 2IJLA 1XGOA 1ZRDA 1G2HA 4CZZA 3CCSI 4M3BA 2CUZA 3PIOF 1FIPA 1WJFA 5F0FA 1OMIA 3I4NJ 2L01A 2VE8A 3W3CA 4XRSA 3HOZJ 3JRAA 1IRZA 1T8IA 2UV1A 2CV2A 4X6AJ 1ZG5A 4RAZA 3I5UA 2D1VA 4P5OA 1X3ZB 2LF7A 2VXZA 4XLFA 3BPVA 2ESHA 2IT0A 2QQBA 4LG0B 3C7JA 2NVXJ 3WU2C 1YJWI 1GT0C 4XKCA 5DCFA 1FPQA 1QGPA 3AG3H 5E1ZB 3RPQA 1Q1VA 3DPTA 2XC7A 2B63J 3KFWX 1XD7A 1PJRA 1HW1A 3ZMSA 2OCCH 3L2CA 4I76A 2HDWA 3E5UA 4UXNA 2JSPA 1LEBA 2OZUA 2XF5A 1Z3XA 1NHAA 1S6LA 3BG6A 1MBJA 1J2XA 4ENNA 3OV8A 1IUYA 2HEOA 3KZIC 5H20A 3KP3A 3LSTA 4OOIA 3GFJA 4ABZA 2VE9A 3VODA 1LB2A 3ASOH 3H0GJ 4N4NB 4M9ZA 1ZG3A 2HDDA 3ZMVA 3NARA 2E35A 1WRJA 3S2DJ 2L5QA 2EFNA 3SEQA 3W2VA 2W7NA 3KCCA 1A31A 2JRMA 2HOEA 5DCMA 4BXXJ 4NQWA 1TTYA 2QQ9A 2QVOA 2ZXJA 2HQNA 3QRFF 1TWCJ 3SDBA 3KP7A 1YX5A 1S7AA 1BBYA 4HLXA 4IRGA 2VKEA 4HQMA 1R6RA 1WZ2A 2LBFB 1QZYA 3L2UA 1MDMB 1O3QA 3BJ6A 4PFOA 3ZGKA 4XLEA 3HB9A 2W24A 3ZQFA 2NRAC 1D8KA 2CGPA 4NC8A 3J7ZI 5ICEA 2XGDA 4JP0A 3SEZA 2O03A 1MBGA 4CA0A 1OKRA 4A3IJ 4Z6YA 2BOLA 1XX5A 1Z6RA 4XONA 2ME0A 3KEYA 1I1SA 3TP0A 3O3KA 4BKXA 3F8FA 4CYCB 2Y0MA 3OYJA 1BI1A 2BHYA 1K83J 5IYCJ 1OYYA 3REOA 2UXXA 5EEGA 3TO9A 5E8GA 4BU2A 2VODA 5D5WB 2O6GE 1KGSA 1ETKA 3I53A 3VYUB 4EJUA 1QO0D 2HKOA 4HV5A 5K5QA 1FX7A 3CLOA 3FK6A 1B72B 3RJPA 3CLQA 1ZK8A 4F52A 2DBBA 1K78A 1DDNA 3CUQC 4IL6C 4I99C 3QODA 3SXYA 4XMYA 2ME6A 5EEHA 2COBA 5LBQA 1YI2I 4L5IA 4IHWA 4LB6B 1X2MA 1GVJA 4KIFA 2KIQA 5TJJA 2KIMA 2R7OA 3K1PA 4BEHA 3F3XA 4XM3A 4Q5SF 1IRFA 4MGRA 5D5UB 2BW3B 3FXRA 4L9VA 5IOZA 3CJTB 5HODA 3O6BB 4A3LJ 4B3XA 2R7TA 3RQIA 4MFEA 2NS0A 1YRNB 3OY9A 3S32A 2VPLA 5LEJA 1S3JA 4HSRA 2EBIA 1SVOA 3FXLA 2HYGD 2HR3A 4IRIA 3JRFA 3LQRA 3AL0B 2HYFA 2I8DA 5AIQA 4Y7NJ 1U8BA 3BLYA 3EUKL 3VWBA 4AM3A 1P2FA 3N05A 2QM3A 1D0XA 3PIPF 1XDSA 2BVMA 1BOAA 3HRTA 3JREA 1IN4A 3BZ6A 4EJOA 2L7MP 3IKTA 4WXHA 1QBJA 1FZPB 2A68F 1XMXA 1UFMA 3Q9SA 3LA3A 4A3BJ 1IDYA 5DUKA 2LDUA 3GZ5A 5GPAA 4OIQF 2AXLA 2VOPA 3ZR8X 1KQ8A 2LY9A 1UZCA 4C3IJ 5HS8A 3LA7A 1WWXA 3OYIA 3ULQB 3LSJA 5CVVA 1YIOA 3M1CA 1AKHA 5IP7J 2XAUA 1JKOC 3D5SC 1SFUA 3I54A 1P7IA 3H5RA 3WGIA 1VI0A 4ON0A 1G8XA 2NVUB 3IL2A 3BZCA 4GYGA 3WODF 2WB1N 2FX0A 2K7LA 2RREA 5D6FA 3ERMA 2K27A 4LK0F 3E0JB 5J1RA 4IZZA 3H9GA 3LSGA 1R5GA 5GP9A 1OCZH 4D1QA 3CESA 3RSNA 3E6CC 3LQQA 2FQ4A 2EWNA 4D9JA 2L7KA 1KU7A 1X1CA 1GUUA 5BOXA 1PP7U 2CFXA 1VNDA 4XRFA 1BC8C 4M6VA 2PI0A 3E7LA 5LHGA 1NK3P 2ZMEC 5M3FJ 2XB0X 1WGXA 3BY6A 3QQAA 4JX6A 3LL7A 2LKSA 2K02A 3COAC 4OAYA 3MZHA 1X3UA 2VKHA 5LD2C 1JT0A 5TISC 2JMWA 2ZXIA 4BUPA 4PCQA 4BE0A 5LEKA 4OWRB 3CCYA 3E1SA 4QLCU 1TWHJ 1WH5A 3AG1H 3M8JA 3TOBA 1PP8F 3ROUA 2ECBA 2WAFA 4YFKF 1MMGA 5C4XJ 5JVTA 1B1BA 3KIOA 4U88A 5E1WA 4G7HF 4M74A 3P9IA 2G7UA 5FRMA 3A02A 2ZFWA 3LSMA 4G8XA 1SD5A 3MQ0A 2QSGX 4RBOA 3HSRA 2LRDA 3GXOA 4NC7A 1REPC 1B59A 5EZHA 2IS2A 3WTVC 2VLAA 3I59B 3V8JA 2IA1A 4IXAA 1RZ4A 3VDXA 2V6EA 1MSEC 5JHUA 2WBMA 4GFBA 3BJAA 3WTUC 2E7WA 2DCEA 2IPQX 4MIMA 4RGUA 1YE9A 3R0JA 3LSHA 2PEXA 4UUTA 3T8RA 5LLQA 1AWCA 1D8JA 3S3MA 1IGNA 2ZXHA 4RLFA 2V1DA 1Z91A 2VBXA 5FD5A
chains in the Genus database with same CATH topology
2VXDA 1QHGA 3TMOA 2IGMA 3CZ6A 4X0GA 2V1NA 3S3NA 4U7BA 3MKZA 2V9KA 2X6WA 3OYDA 4E7KA 4XKWA 3CJQB 2VQHA 4HG2A 2KRHA 4CZCA 2K5CA 4XN0A 4R79A 1P9QC 4ANJA 4B47A 3K4BA 4DJAA 1Y56A 2CS3A 5CKTA 2UUZA 1GLNA 3RCOA 3TL4X 4XN3A 1LDKB 2M4KA 2QKLB 2P0WA 1TT0A 3OYGA 1N75A 3OYHA 1MNEA 1E0EA 3IUOA 1FMVA 4ZC3A 4CCLA 1BR2A 4RLQA 2DOAA 1WJCA 3DWLE 1BR4A 1MW7A 2M3AA 4F55A 4DBRA 3H5AA 4HRIA 3QOEA 5CQGA 3OYBA 2RQQA 3LSIA 2VQLA 2F6CA 2CV1A 2HZDA 1D1AA 4LIUA 1Z3YA 1Z7LA 4II2A 3FDYA 1WJEA 2HNHA 1BR1A 5KHDA 1ZELA 1NG6A 2PJRB 4F91B 3DEEA 3BCAA 1MMAA 2F5VA 2CV0A 2R7SA 2MABA 2HVRA 4NUBA 3ZRGA 3S8PA 3DLAA 3MMYB 4XLHA 2VJ5A 2OV7A 3CP2A 4RM3A 4BXFA 3AKZA 4RM2A 2A6TA 3I9V2 2PMZA 3K4CA 3IAS2 4MLOA 1D0ZA 4IQJA 1X1AA 3C2HA 3H5NA 3DTKA 2E5NA 3OYNA 3OS0A 1PYVA 3QYBA 2LREA 4FASD 2R7XA 4C2UA 2KMUA 4HEA2 4Y4RA 1WJBA 2CMPA 4H4KC 4N4OB 4PK4A 2CH0A 1IRXA 3H0DA 1T95A 2X1EA 5LFAA 2HQAA 2X6YA 1EA3A 4CCOA 2AQFA 3PJRA 4PJMA 4GRIA 3D5LA 3PSIA 2E5ZA 2ZFUA 4NQWB 2KPMA 3OS1A 4KT6A 2M4GA 4PUSA 1FMWA 4QPOA 2KLOA 1DP3A 2KL4A 3K4NA 2DXIA 4ZTFA 5KCMA 1X19A 4E7ZA 2W82A 2L9SA 4XORA 2Y0SA 4ITVA 4CUGA 4Y3OA 4E7SA 3H9JA 5CQEA 1HA8A 3LSKA 3PUBA 4LIVA 4QPQA 3HOTA 4ZTJA 4DGWB 3OR1C 1N78A 3QYEA 2V4JC 2X6XA 1KONA 3S3OA 1X1DA 3BG7A 3PNYA 3OIPA 2KP6A 2CUJA 4PJLA 3OR2C 4BL0B 3OIQA 3OYKA 3DU6A 1LFPA 3HPHA 4J01A 1MMNA 2XDVA 2L9NA 3F9KA 5HLTA 4J00A 4BS9A 3HG9A 3DQVC 2KZVA 4XR6A 3FBNB 1U0JA 4CCKA 2M7AA 4HNTA 1X4OA 3G2BA 1MMDA 3L2VA 5TGTA 4E7LA 3CF2A 1UG0A 2LH9A 1DGRM 2VJ4A 4JQFA 4G6TB 2WAEA 2R4GA 4PSXA 1V5EA 3QYFA 3HXLA 2CUZA 1WJFA 4C9YA 4II3A 3VYRB 1X1BA 2VIXA 3W3CA 2A5WA 5JHFA 2CV2A 2UV1A 1UELB 3ZGKA 4BEHB 2W1OA 1SAUA 1WFXA 4P5OA 3FBIB 2VXZA 4XLFA 2IXSA 3TBIA 4XNFA 3LFUA 3K70D 1WJAA 4BDYA 2Z16A 4BE1A 4C30A 3H35A 4BQNA 2IGOA 1YX3A 2JVGA 3W2AA 2LG4A 3KX2A 4XKCA 2GOMA 2NOJB 2XC7A 3DPTA 1PJRA 3K4LA 3VYTB 4XKVA 1X4PA 1Y6IA 2HDWA 2LC2A 2K9LA 2WADA 2JA2A 3DU5A 2JSPA 2XF5A 1Z3XA 3J7AY 3BG6A 4YELA 5CPRB 4AYBA 1AA7A 4FETA 1WJDA 3HC7A 4E7IA 4OAZA 2IGNA 2V7FA 2Z1DA 3VSKA 4ZDLA 2R7QA 3ZQQA 2W4SA 2LY1A 4N4NB 2OC6A 1BOBA 2K3PA 2Q2EB 4JOMA 4LG3A 4HPQA 1LVKA 3DPUA 4XKBA 2L5QA 3SEQA 3W2VA 2W7NA 1J09A 4PJNA 3OYFA 2LOOA 3UNGC 2VL8A 4BJ5C 4E6KG 2FUG2 1WJ5A 2KDOA 2VKDA 3DKXA 3H9QA 4PSWA 3SDBA 1YX5A 4C2TA 4CCJA 2R7RA 3K4KA 1R6RA 2LBFB 4BJTA 2X1DA 2L2OA 3L2UA 2X85A 4PFOA 2QKMB 3DKYA 1DGWY 1TZLA 2CFOA 2OUMA 3IAM2 2DT6A 4P1WA 4XLEA 3SZGA 3PL8A 4BE2A 2R7WA 4NC8A 3OYMA 3EUAA 3SEZA 4CA0A 3HUGB 2VQGA 2BOLA 3OL4A 3VYSB 4KISA 2VJIA 4XONA 3K6GA 3KEYA 3ZCOA 3PNTA 3OYJA 1G59A 4XLCA 3EPZA 3L2WA 2GOXB 4IX7A 4BQOA 4ZJZA 3OL3A 4IQ4A 2VQCA 4BU2A 3MD2A 3DTEA 3VYUB 4IKFA 1ERDA 2IS6A 3S93A 4CCNA 1QHHD 4DOZA 4F52A 3OYEA 2MFZA 3QODA 4XMYA 3K10A 1W36D 2W00A 3K4MA 2XF6A 2MC4A 4AU7A 2KRCA 2HPMA 2XF7A 3PFYA 4LITA 4CCMA 2R7OA 4BJ6C 3ZXSA 4KJZA 4BEHA 4XM3A 4F92B 2DT7B 2O5RA 3PNVA 1V5FA 2WB1A 2E60A 3AL0C 2BW3B 5FRNA 2IS1A 1N77A 5KNLA 4B3XA 4EATA 2R7TA 4B44A 3A2KA 4BGDA 3BC8A 3HPGA 3OY9A 2HVSA 2JUGA 2CW7A 2WA0A 3K70C 3S32A 2VPLA 3ONQA 4XOPA 5HNHA 4HSRA 3HOSA 2HPIA 1D1CA 2VB6A 3CMMA 3MKYB 3AL0B 2I8DA 1K6YA 2BVLA 3BLYA 3EUKL 3VWBA 3N05A 2PJRA 1D0XA 2BVMA 4ZDOA 3HKZA 3K4JA 5HOOA 4DIQA 4E4HA 1S9HA 3C2GA 3NWSA 3A1YA 2IS4A 3RTRA 2R7UA 1OR7C 3CJRB 2K9MA 2MD0A 4B48A 1Z21A 2M0MA 3KYLA 3L2RA 3ZR8X 4BQQA 2R7VA 4PJJA 5HNFA 3OYCA 4XLAA 1OLTA 4F3QA 3RPUD 3U21A 3OYIA 4HSTA 2X1CA 3CP8A 3M1CA 4AVZA 2XAUA 3RQ4A 2XSJC 3D5SC 3DTIA 4CSWA 2KHMA 3H5RA 2LBFA 1NG7A 1G8XA 4F93B 4HNUA 4E7HA 3OWTA 2RREA 2ZSIB 2M7BA 2JVHA 3OS2A 2LYCA 3E0JB 4YEJA 2WY8Q 3OMYA 1T0FC 4IZZA 2HU9A 3H9GA 3LSGA 2F4IA 3AFHA 2HVQA 3L2QA 4BDZA 4D1QA 3CESA 3RSNA 4U87A 4YRVA 3FHNA 3EUHC 1D0YA 2CW8A 3NWTA 3A4CA 4D9JA 3D5RC 2E1MC 2L7KA 1X1CA 3FKJA 1QU3A 3V42A 2Q1ZB 4ZDPA 3DPLC 4KITB 2ELJA 3I3LA 4CH7A 4NNJA 1DQUA 3OYAA 3W2WA 1VZ0A 3LL7A 3SYTA 3OYLA 2VJJA 4Y33A 4OAYA 2DJIA 2VKHA 2ZSHB 3HL2A 5LD2C 4BACA 2KQRA 3OOUA 2ZXIA 1MNDA 2E1MB 4BUPA 4BE0A 2WAQA 4OWRB 2IGKA 2RNGA 3BCBA 3E1SA 3M8JA 2LY2A 3VSLA 2X51A 2WY7Q 3LMMA 5HVQC 3MKWB 2WAFA 4B43A 1MMGA 2MYSA 4RMNA 2VASA 4XL9A 1W36C 5FRMA 2AQEA 2UWMA 3LSMA 2BW3A 4XOTA 2LRDA 4NC7A 3GBGA 1UAAA 2Z2SB 2IS2A 2VLAA 3UR3C 1LKXA 3IP4B 2V26A 3VDXA 5FROA 2V6EA 2WBMA 4E7JA 4PFPA 3PSFA 2DCEA 1D1BA 1YE9A 4XQFA 3LSHA 1SFKA 4ZYAA 3S3MA 2ZXHA 4RLFA 1V5GA 4DBQA 1JI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9Y A;  4CA0 A;  2LYC A; 
#chains in the Genus database with same CATH topology
 2VXD A;  4MTD A;  4U7D A;  2H09 A;  2K4B A;  5F08 A;  5IYB J;  1SFE A;  4WX9 A;  3TMO A;  4L18 B;  3FK7 A;  3MVP A;  1IV8 A;  3MKZ A;  3L09 A;  1W0T A;  5BQT A;  4A5N A;  4UHT A;  5KK1 A;  1ZYR F;  3HDD A;  3OSG A;  4HG2 A;  1B9N A;  4CZC A;  3BDD A;  3DFG A;  2K5C A;  3JR9 A;  2BBY A;  5EGO A;  4XN0 A;  3V7S A;  1P9Q C;  3SQN A;  1YG2 A;  3ZN0 A;  3K4B A;  4ESF A;  4D5C A;  1YIT I;  1YQA A;  2EZH A;  1V3F A;  1GXP A;  3RCO A;  1WCM J;  3TL4 X;  1LDK B;  2M4K A;  2QKL B;  3DBL B;  1TT0 A;  2QQ8 A;  3CC7 I;  3TQN A;  3RIR A;  5HS7 A;  3TW6 A;  3CC2 I;  2Q2E A;  3OYH A;  1FSE A;  1APL C;  1MNE A;  1E0E A;  5JFR A;  1CF7 A;  1OIS A;  3IUO A;  4L9T A;  1IN6 A;  3HM5 A;  1A36 A;  2HWV A;  1Z67 A;  1VQO I;  4RLQ A;  2DMQ A;  1TWF J;  2CW0 F;  3BT9 A;  3ZQL A;  4A0X A;  3H5A A;  2ZXW H;  3QOE A;  1JXS A;  3T1B A;  2AHQ A;  2RQQ A;  5E3L A;  1VF9 A;  1BL0 A;  1VTN C;  5J8F A;  1FOY A;  3ZQI A;  1I27 A;  1J5Y A;  1Z7L A;  5HDG A;  3FDY A;  1MH4 A;  2HNH A;  4UV8 A;  1JGG A;  2R93 J;  2JK3 A;  3GX4 X;  2Y9Y A;  4F91 B;  1XDU A;  3A01 B;  3BR0 A;  4WXC A;  5CVJ A;  1MBF A;  1RES A;  2DA1 A;  3QPL A;  3U1D A;  1PUE E;  2KJB A;  2ZCW A;  3C2B A;  2RKH A;  1ON2 A;  3T0Y A;  4BQA A;  1T0F A;  4QIW N;  3I9V 2;  4MLO A;  5GPC A;  3HZJ A;  2TRT A;  2H1K A;  2V9P A;  1D3Y A;  3H5N A;  1CGP A;  1YW9 A;  3IRR A;  2DDA A;  1ETY A;  2E5N A;  1PYV A;  1LUJ B;  4AC0 A;  2R7X A;  3HYI A;  2KMU A;  3DBH B;  3QPH A;  4UB6 C;  1WJB A;  3C3W A;  2R5Y B;  2CMP A;  4H4K C;  4BY7 J;  4I6Z A;  2CH0 A;  1IRX A;  2DMP A;  2BV6 A;  2MD5 A;  1E3O C;  1WQ2 A;  4KT5 C;  1UHW A;  5LRR A;  4OIN F;  3PJR A;  4GRI A;  2E5Z A;  1HSJ A;  1HW2 A;  5DD8 A;  1WI3 A;  2CQX A;  1W7P B;  4KT6 A;  4U0V A;  3LNQ A;  4XID A;  2OTJ I;  1E17 A;  1YS6 A;  5GAH J;  2XAH A;  1M1E B;  1DP3 A;  3MZ8 A;  3K4N A;  4A3E J;  2W84 A;  1TW2 A;  3X2Q H;  1T39 A;  2K86 A;  1QPM A;  4M3F A;  2Y0S A;  2D1H A;  3VOE A;  5LHH A;  3WTT C;  1RC9 A;  1T6S A;  4JK1 X;  2NYX A;  1HA8 A;  3LSK A;  4ZTJ A;  1LVA A;  4IHS A;  2PJP A;  1TWG J;  3HEF A;  2ICW G;  2LFB A;  1STZ A;  4M9S A;  1T08 B;  1X1D A;  3WG9 A;  1O57 A;  5J4V A;  3GFL A;  3CCL I;  2QA4 I;  4G6Q A;  3BTI A;  4ZYE A;  2E34 A;  2M45 A;  2CUJ A;  2JZY A;  5CYV A;  2Z33 A;  4WXD A;  4PJL A;  1W5T A;  3OR2 C;  2PMZ N;  5H2F C;  2O61 A;  3KLN A;  1MMN A;  2V1X A;  4PGG A;  1DPR A;  2L02 A;  3F9K A;  4FE7 A;  5KAI C;  2ZJ2 A;  4LMY A;  3B02 A;  4RAF A;  4BS9 A;  3DQV C;  1JUP A;  5EG0 A;  4CCK A;  4A2U A;  2GXB A;  2M7A A;  2IRF G;  4JBA A;  1U3E M;  1MJB A;  4I01 A;  3ZQ7 A;  4LK1 F;  1BIA A;  1UG0 A;  2F5F A;  3A0B C;  2OBP A;  1DU0 A;  4HLY A;  1DGR M;  5D8L B;  2ISY A;  2R4G A;  3QYF A;  2Q8K A;  3HXL A;  2K9Q A;  4G7Z F;  1A35 A;  4C9Y A;  4II3 A;  3GFI A;  1PVE A;  2VIX A;  3F21 A;  1ZGA A;  5JHF A;  5K5R A;  5HLH A;  3HRU A;  1SC7 A;  4DYR A;  3H92 A;  1S29 A;  4DQ2 A;  4OMY A;  4XNF A;  4B09 A;  1WJA A;  2ECC A;  2FU4 A;  4C30 A;  1R9T J;  2IEK A;  3H35 A;  2DU9 A;  3BWG A;  1FY7 A;  3FHZ A;  1YX3 A;  3HHH A;  5IPA A;  3U2R A;  1U5T A;  2GOM A;  2EV0 A;  3K4L A;  3VYT B;  3CC4 I;  1YJ9 I;  1Y6I A;  2LC2 A;  2K9L A;  2WAD A;  4EV0 A;  3DU5 A;  4UUV A;  2OF7 A;  3H3V K;  1DU6 A;  2CUF A;  2FD5 A;  2L9R A;  1R58 A;  5CPR B;  2MG4 A;  1EV7 A;  3GYH X;  4FET A;  1PUF B;  1LEA A;  1XTA A;  2DT5 A;  3LWF A;  2JPC A;  3CO7 C;  3RYP A;  4OAZ A;  2V7F A;  3M8F A;  3FWE A;  4ZDL A;  4HX4 A;  3OSF A;  2RN7 A;  5CLS A;  3HOX J;  4NC6 A;  4HZF A;  1A6I A;  2QZ8 A;  1UB9 A;  2X48 A;  2X9D A;  2K3P A;  4JOM A;  5FKK A;  3LFK A;  4HPQ A;  2VPR A;  3I0T A;  1J09 A;  3FIS A;  3QWL A;  2EH3 A;  3NEU A;  2VL8 A;  2QBY A;  2M8E A;  2KDO A;  4KIC A;  3RKY A;  2OAZ A;  3OIO A;  2R7R A;  1I39 A;  2HS5 A;  2DOD A;  3K4K A;  1PDN C;  1FTT A;  4PGH A;  5EEA A;  3DKY A;  1IG7 A;  3SZG A;  4P1W A;  1XB4 A;  3CCM I;  4DYC A;  3M7G A;  1J7K A;  3ZN1 A;  3WU1 B;  1IJW C;  4CGZ A;  2E2H J;  3G3Z A;  2M2E A;  3HUG B;  3B6C A;  3FXK A;  1TL8 A;  2VQG A;  1B8I A;  4MEX F;  3OL4 A;  3MCZ A;  3VYS B;  1P7J A;  2YPR A;  1Y0U A;  1QNT A;  1G59 A;  3EPZ A;  2V79 A;  3L2W A;  1J59 A;  4IX7 A;  2M34 A;  1ZR4 A;  4GDF A;  1V54 H;  5FGM A;  2ISZ A;  3PO3 J;  2H27 A;  2P5K A;  1FOK A;  1S7E A;  2FJ1 A;  3MD2 A;  3O8H A;  3F8B A;  1I6X A;  2BY3 A;  3Q0W A;  2K85 A;  1KYZ A;  4P9F A;  2PG4 A;  3BQY A;  3E5X A;  2JT1 A;  3N97 A;  5J6X A;  2N8G A;  1F5T A;  4EM2 A;  4HF1 A;  2CJJ A;  5J1U A;  4XSX F;  3GO5 A;  1FT9 A;  1G3W A;  4BNC A;  2FXA A;  2MFZ A;  4UVC A;  2HYJ A;  1H88 C;  3K10 A;  1W36 D;  2A69 F;  3I58 A;  1TLH B;  2W00 A;  1IW7 F;  2XF6 A;  4P96 A;  5IOY A;  5J8C A;  3ABT A;  2QWW A;  3TDZ C;  3KLO A;  4AU7 A;  3VFZ A;  5HLI A;  1R23 A;  2JQ7 A;  2MGQ A;  4BJ6 C;  1FYM A;  1IXR C;  4R8H A;  3ZXS A;  3PFI A;  4KN7 X;  4KJZ A;  2DK5 A;  4EMS A;  2ZB9 A;  2E60 A;  2PN6 A;  3U1K A;  1Q1H A;  2QEX I;  2IS1 A;  2EIL H;  5KNL A;  1EH6 A;  5E20 A;  2PLY A;  4LG0 A;  4B44 A;  3A2K A;  1UCR A;  1NK2 P;  3BC8 A;  4AWX B;  5CVU A;  4MHG A;  2F5D A;  1ETX A;  2HVS A;  1B6A A;  3GFM A;  3ONQ A;  9ANT A;  5HNH A;  1HST A;  1UMQ A;  3LSP A;  3HOY J;  1ON1 A;  2NXN B;  4CDG A;  4XK4 A;  1F4K A;  1IDZ A;  1EH8 A;  2BY1 A;  3HOS A;  2HPI A;  1D1C A;  4A3D J;  2GXA A;  1F43 A;  3MKY B;  5H6Q A;  1FIA A;  1H9T A;  2BVL A;  5DEQ A;  5DYM A;  2RNJ A;  5A2Q Z;  5B5E C;  4PJ0 C;  4ZDO A;  2WAQ N;  3WHC A;  1H9G A;  3JRG A;  4O6J A;  2DJN A;  2QSH X;  1S9H A;  3C2G A;  2YR2 A;  3FZV A;  3A1Y A;  4TV7 A;  4M6Y A;  3RTR A;  3VB2 A;  2NNN A;  1Z21 A;  2M0M A;  3L2R A;  1JHF A;  1YJN I;  4PJJ A;  3M1E A;  2FOK A;  2QF7 A;  5FJ8 J;  1XPX A;  4F3Q A;  2RQP A;  4FIS A;  2QCO A;  2BY2 A;  2DQR A;  3U21 A;  2BY0 A;  3JRC A;  5M5Y J;  2X1C A;  2AO9 A;  1SFO J;  1EH7 A;  3RQ4 A;  4CSW A;  1OCO H;  1RI7 A;  2KHM A;  1SEU A;  2LBF A;  2VN2 A;  4HNU A;  1MDM A;  1U9N A;  3QPS A;  3RZO J;  3OWT A;  4O3M A;  2EFP A;  2ZSI B;  3FX3 A;  2M7B A;  1S72 I;  2KRF A;  2JVH A;  3GLL A;  3OS2 A;  2WV1 A;  2LYC A;  1QVU A;  3CDL A;  2HXO A;  3HIF A;  4HYE A;  1T0F C;  5AIP A;  4AUX A;  3B6A A;  5B66 C;  3WTW C;  1IAW A;  2QGU A;  2R7F A;  3L2Q A;  1Y1W J;  2R92 J;  4YRV A;  2NVQ J;  1D0Y A;  1XGM A;  4LLG F;  5J4Y A;  3NWT A;  5ED4 A;  4CYC A;  3D5R C;  1FBU A;  2E1M C;  3DBR B;  1YO5 C;  1NTC A;  2E1O A;  1LFB A;  4FE4 A;  3V42 A;  5D6E A;  4ZDP A;  3MFK A;  1CQT A;  3DPL C;  3HGY A;  2ELJ A;  3K7A J;  3J80 Z;  5L3G A;  2BEO A;  4K2E A;  2F5E A;  5DD4 A;  4KDP A;  3RKW A;  3W2W A;  1VZ0 A;  2W25 A;  5H6R A;  3I71 A;  2XGE A;  3F6O A;  1B72 A;  5LGT A;  2DJI A;  2E36 A;  2ID6 A;  2ZSH B;  4B1R A;  3NRV A;  2KQR A;  3J7Y J;  1ZH5 A;  3A0H C;  3L1P A;  3TO7 A;  2DO7 A;  3F6V A;  4EM0 B;  2A05 A;  3VPR A;  1BJZ A;  2HOS A;  4U0W A;  3I4M J;  2NS8 A;  1T98 A;  2WAQ A;  2IGK A;  2R3S A;  3F72 A;  1EKE A;  2A5Y B;  3VSL A;  2C6Y A;  5HVQ C;  3LMM A;  4B43 A;  4WF2 A;  3F8C A;  4RMN A;  4XL9 A;  1NH3 A;  1W36 C;  2P7V B;  2MSY A;  3G1M A;  2BW3 A;  4XOT A;  4JX5 A;  1UHM A;  3FM3 A;  2HXI A;  5EJC A;  3GBG A;  3M07 A;  3LSR A;  1O3R A;  3CDH A;  4I0A A;  3IP4 B;  5FFX A;  5BS6 A;  1YRN A;  1I3Q J;  4E7J A;  2MH9 A;  3PSF A;  1P4A A;  2YX7 A;  1SFK A;  3EET A;  2HDC A;  3ESW B;  3JTG A;  1OCR H;  4ENJ A;  3M3Y J;  4Y17 A;  4S04 A;  2EJR A;  3R61 A;  2DA6 A;  1JI8 A;  3CCQ I;  3C18 A;  1TW3 A;  1QHG A;  1KYW A;  3CD6 I;  2JN6 A;  4FQG A;  1R5H A;  3QU6 A;  1HLV A;  2I5U A;  2QEN A;  2V9K A;  3BZK A;  3DV8 A;  4KNY A;  2RAE A;  2ESN A;  2VQH A;  2Q0O A;  3MEX A;  3WG7 H;  4Q48 A;  3DEU A;  1R36 A;  3N4M A;  5KVR A;  3IH3 A;  4CIC A;  4DJA A;  2WC2 A;  3JRH A;  4EJV A;  1Y56 A;  2CS3 A;  3GW2 A;  1GLN A;  3CF5 F;  4MO7 A;  2HI3 A;  2VKV A;  2EB7 A;  2TCT A;  1F9N A;  3GWZ A;  3OYG A;  2STT A;  2Z9O A;  3S16 J;  4B8X A;  3TKY A;  1U5T C;  2R5Z B;  1FMV A;  5D5X B;  4ZZL A;  1BC7 C;  4GCV A;  4KIB A;  1FBS A;  1BR2 A;  1OR7 A;  2GBY A;  2XSD C;  1ZRE A;  1MW7 A;  2M3A A;  1MBH A;  2FSW A;  1Y8R B;  4DBR A;  4KA4 A;  5CQG A;  2P7C B;  4I98 B;  5L3D A;  3BR5 A;  4AIK A;  4RDU A;  2F6C A;  4W97 A;  3S2H J;  5DUI A;  2XAG A;  3ZP5 A;  1ZKG A;  4IHV A;  1BI2 A;  3WTS C;  2VT2 A;  1JUM A;  3PQK A;  4EGY A;  3ZQG A;  4HQE A;  1X1P A;  2AS5 F;  1FSH A;  3GEZ A;  3TW7 A;  4JYK A;  2R7S A;  2MAB A;  1KQ0 A;  2MW8 A;  5CVR A;  4H0E A;  1RRJ A;  4IHX A;  1BI3 A;  3L00 A;  3DLA A;  1K4S A;  3CMA I;  4XLH A;  4Y15 A;  4RM3 A;  4BXF A;  2A6T A;  3CUO A;  3V7C A;  1D0Z A;  4IQJ A;  3EUH A;  3QU3 A;  3CO6 C;  3IRQ A;  3K2A A;  2X0L A;  4L0Y B;  3TGN A;  4J19 A;  5ILS A;  1VFC A;  2CQQ A;  4HEA 2;  4OIR F;  2L3D A;  3ML6 A;  4N4O B;  4PK4 A;  2LVS A;  5E3O A;  1MMS A;  3K1N A;  2K9S A;  1SVL A;  3S1N J;  1SAN A;  3I55 I;  2X1E A;  5F64 A;  4R1H A;  5LFA A;  5IP6 A;  1EA3 A;  2QUF A;  2MLG A;  4PJM A;  2WWY A;  3ZMU A;  2J5O A;  3PSI A;  4CO8 A;  2ZFU A;  3U9G A;  5JR3 A;  3JSO A;  1R5I D;  4F7Z A;  4ZYH A;  1T2K A;  3I4P A;  3OS1 A;  2M8G X;  1EJ9 A;  4LB5 A;  2H1L A;  5HDN A;  3C1D A;  2XV4 S;  2Y48 A;  4W1U A;  1GVD A;  1FMW A;  2D2W A;  2EFQ A;  2LLK A;  2KLO A;  4N9I A;  2E1N A;  5LHI A;  3ABK H;  3GCM A;  2DOF A;  4LFU A;  5E3M A;  2DLL A;  4MTE A;  3QP6 A;  4ZTF A;  5KCM A;  4ESB A;  5JI6 A;  1R1T A;  2L9S A;  3CTA A;  5GAG J;  5HDK A;  4MQV A;  2H8R A;  4CUG A;  2Y9Z A;  1YFH A;  1MIJ A;  1USS A;  3ECO A;  3CCR I;  4Y3O A;  4E7S A;  2FMY A;  2DFH A;  2MA3 A;  1ULY A;  5DDG A;  3HOT A;  4UUS B;  1ZN2 A;  2IAI A;  1N78 A;  2EZK A;  3QYE A;  2EA2 A;  2X6X A;  2JRT A;  4D5F A;  2KIF A;  4BHP A;  1TT5 B;  1IZ1 A;  1JHH A;  2FF4 A;  3BG7 A;  3PNY A;  4RB0 A;  4UNO A;  1Z05 A;  4AVP A;  1P4W A;  1TBX A;  4HAM A;  1A6Q A;  1RPW A;  2P6T A;  4BL0 B;  3DU6 A;  1LFP A;  3HPH A;  3RYR A;  2XDV A;  3S2W A;  4ESJ A;  1BA5 A;  2FEZ A;  4RGR A;  1FOX A;  3BR6 A;  3FKI J;  2KZV A;  1ZLJ A;  1U0J A;  1OPC A;  2Z99 A;  4UB8 C;  3W6J B;  1JKP C;  4L0Z B;  2E2J J;  3G2B A;  4MEY F;  1P92 A;  2GXG A;  5M3M J;  3CF2 A;  5L3C A;  2DA4 A;  3JAM K;  4JQF A;  2WAE A;  4PSX A;  2PX9 A;  5CVI A;  4B4C A;  3S14 J;  1TQP A;  4HDU A;  3VYR B;  1JKR C;  2IA0 A;  2CQ7 A;  3KPH A;  1VQ8 I;  2EV5 A;  3O8G A;  2X6O A;  4IO9 F;  1UEL B;  1RET A;  5HS9 A;  4G94 A;  2W1O A;  3BG5 A;  4IOC F;  2QYO A;  3FBI B;  4LOC A;  1WVR A;  1TNT A;  3LFU A;  2KJC A;  2CUE A;  4BDY A;  4BE1 A;  2JSC A;  1VQK I;  2V9V A;  4BQN A;  2M1B A;  5GTI C;  3P5J A;  2IGO A;  2J5P A;  2Y0S N;  3FIW A;  1R22 A;  4M6X A;  1O7L A;  2LG4 A;  2XAS A;  3RPU A;  4HX7 A;  2NOJ B;  3J81 Z;  3A01 A;  2ZJQ F;  4IHT A;  2P5L C;  2XGX A;  4NB5 A;  1XMK A;  2M30 A;  4XKV A;  3HRM A;  3GZ6 A;  2EFW A;  2LNB A;  2JA2 A;  1GXQ A;  3F0C A;  3Q0U A;  2MC3 A;  1IF1 A;  4OIP F;  3J7A Y;  2Y69 H;  4DZJ A;  4ENK A;  2CQK A;  5DS9 A;  4E7I A;  2H6C A;  3Q0V A;  4CYD A;  2O7O A;  1S7O A;  2Z1D A;  3VSK A;  5ICC A;  1XN7 A;  4M73 A;  1BW6 A;  2W4S A;  1ODD A;  5AON A;  2NAZ A;  3PO2 J;  1BOB A;  1MJ9 A;  1YLF A;  2ZKZ A;  2ZJP F;  2Q2E B;  3RKX A;  4EJT A;  3H3U A;  3JCU C;  1DUX C;  1ORK A;  2ADU A;  4A3J J;  1CF7 B;  3DPU A;  4XKB A;  2DMN A;  3G1O A;  2DFF A;  2LOO A;  3UNG C;  1HKQ A;  3GTK J;  1W7P A;  3ASN H;  3ABL H;  1XS9 A;  2VKD A;  3DKX A;  1TQM A;  3H9Q A;  4PSW A;  4C2T A;  4CCJ A;  2DFE A;  3E6D A;  1G3S A;  4A3K J;  4BJT A;  2B9S A;  2X1D A;  2GAU A;  3SHF A;  2L2O A;  2E1C A;  4Q4Z F;  2QKM B;  4HX8 A;  1DGW Y;  2OUM A;  4Y13 A;  3IHU A;  2QQA A;  3A03 A;  3PL8 A;  1WHU A;  2R7W A;  2DMU A;  3WU0 A;  2JA5 J;  1G3Y A;  1LQ1 A;  4BBR J;  2Z3Y A;  1HDP A;  2CQN A;  6PAX A;  2DMT A;  1L0O C;  2O0Y A;  2IP2 A;  3I64 A;  3PNT A;  3HKZ N;  4XLC A;  2UXN A;  2GLO A;  2ETH A;  2GOX B;  4BQO A;  1MBK A;  4RS8 A;  3F22 A;  4U0Y A;  3OL3 A;  1J75 A;  4IQ4 A;  4A69 C;  4HDV A;  2K9N A;  4A5M A;  2XHK A;  1KA8 A;  2O3F A;  1ETO A;  2K4J A;  2IVM A;  3WTX C;  5J40 A;  2M9H A;  5LRS A;  2IS6 A;  5LGN A;  1RUO A;  1QHH D;  3KE2 A;  1O7F A;  1AU7 A;  2JUC A;  4XBF A;  2DA5 A;  3BTJ A;  5FKL A;  3JAM Z;  1WKM A;  3AG4 H;  1KU9 A;  1LE8 A;  2G9W A;  2KRC A;  2HPM A;  3PFY A;  3BPX A;  4RB3 C;  4NHJ A;  3SZT A;  2A3S A;  3MWM A;  4F92 B;  3ZMD A;  2O5R A;  3DXJ F;  5BMZ A;  1V5F A;  2XIG A;  3AL0 C;  2B0L A;  4IRH A;  5FRN A;  1C0W A;  3KZY A;  1RKT A;  1N77 A;  1ONV A;  1I1G A;  4EAT A;  4HBL A;  3CUQ B;  2E19 A;  3KEO A;  5F1R A;  2BE5 F;  4IF4 A;  1W5C C;  3HPG A;  2HZT A;  2JUG A;  4BY1 J;  2NVT J;  2KZG A;  1FBQ A;  3O2P E;  3L7W A;  1WH7 A;  4GXO A;  1O3T A;  3R4K A;  1TWA J;  3F8N A;  3ERE D;  3GTM J;  4YFN F;  3ZQC A;  1MSF C;  4FX0 A;  1T33 A;  3MKL A;  2JPB A;  2PJR A;  2XVC A;  4S05 A;  4QTR A;  3HOV J;  3HTU A;  4P9U A;  4D7M A;  2STW A;  5DTD A;  2JA8 J;  1FC3 A;  2RVC A;  3HKZ A;  3WE2 A;  3FMR A;  1P4X A;  2P4W A;  4DIQ A;  2CRG A;  2ELK A;  4E4H A;  1T56 A;  2ZBK A;  1OR7 C;  4GYI A;  1BJA A;  2K9M A;  4B48 A;  3KYL A;  4BQQ A;  3GTP J;  5F04 A;  5A2Q K;  2JJ7 A;  3HTS B;  4XLA A;  1OLT A;  4LGW A;  5GAE J;  3RPU D;  1FP2 A;  5HLG A;  3ABM H;  3FXQ A;  2D45 A;  3KYC B;  1ETW A;  1O4X A;  4HF0 A;  3LAJ A;  1IUF A;  2R0Q C;  4MNU A;  2FNA A;  1HOM A;  4F93 B;  4E7H A;  2CWE A;  5ILV A;  2P5V A;  4A93 J;  4YEJ A;  1HQC A;  2WY8 Q;  2OCE A;  3ZQH A;  2L4M A;  3HUG A;  2HU9 A;  2VI6 A;  1XGS A;  2D5V A;  1A04 A;  3QAH A;  4U87 A;  3CCU I;  3FHN A;  3EUH C;  1Z77 A;  3JRD A;  5IT9 Z;  2CW8 A;  1J9I A;  2X4H A;  1JE8 A;  3A4C A;  5J1Y A;  3HOU J;  1LDD A;  2OPT A;  5F0H A;  2DPU A;  2Q1Z B;  2VUM J;  1U6G A;  5KAF C;  3CMY A;  2O9L A;  4CH7 A;  3GTL J;  1DQU A;  4YG2 F;  3R6S A;  3JRI A;  3OYA A;  1W7P D;  4IHY A;  3OYL A;  3JTH A;  3SYT A;  4IVN A;  1XSD A;  4Y33 A;  5F1J A;  1I3A A;  2ACJ A;  4BHC A;  5DM7 F;  2HKX A;  4BAC A;  1XCB A;  3J80 K;  4KFC A;  3OOU A;  1MND A;  2LP0 A;  4ASN A;  2QBY B;  3ZPL A;  3K9T A;  4N0B A;  2X51 A;  1T38 A;  5EDN A;  3MKW B;  2F4M B;  1TC3 C;  4KIG A;  1JKQ C;  2ZME B;  2YX4 A;  3DP7 A;  2LD5 A;  1ITY A;  5E8I A;  2VAS A;  1RUN A;  3BG9 A;  2EQR A;  5F6F A;  1FYK A;  3BR3 A;  3J7A O;  3LA2 A;  5BPD A;  2L7F P;  4ENM A;  5IT3 A;  2PMH A;  3GTQ J;  3H1C A;  4PZJ A;  3W6K B;  1B8I B;  1R1U A;  2YSR A;  2V26 A;  2BXY A;  3CQZ J;  5FRO A;  5ICF A;  3RZD J;  1DP7 P;  1D1B A;  2O8K A;  4XQF A;  2CO5 A;  1BW5 A;  3M4O J;  4YFX F;  5FKN A;  4ZYA A;  1FYL A;  3EYI A;  4GO1 A;  3S15 J;  5FB2 A;  2DW4 A;  4AD9 A;  1U2W A;  1QA6 A;  5FKO A;  2IGM A;  2KT0 A;  3CZ6 A;  3GME A;  2V1N A;  1QPI A;  4XRM A;  4A0Z A;  1X58 A;  3S3N A;  4U7B A;  3I56 I;  3OYD A;  4E7K A;  2GM4 A;  1GHC A;  1FOW A;  3H36 A;  2XAQ A;  1ZLK A;  2KRH A;  3DCF A;  3GTG J;  2EZI A;  2YU9 J;  3NQO A;  2KDZ A;  4UY8 I;  1V55 H;  4CXF A;  3QOP A;  1ZQ3 P;  4ANJ A;  4KN4 X;  1SD4 A;  3NAU A;  2XRO A;  1Z6T A;  1OQY A;  5CKT A;  2UUZ A;  3FXO A;  2R7Z J;  4DW6 A;  4HOB A;  4B3A A;  1FTZ A;  1H8A C;  2VBZ A;  3BP8 A;  3CJN A;  1EF4 A;  4YIF A;  4O5V A;  2EA4 A;  4ZC3 A;  4CCL A;  1IC8 A;  1R1V A;  1LDJ A;  1WJC A;  1SD6 A;  3DWL E;  1G4D A;  1BR4 A;  1VQ7 I;  3G71 I;  5LGU A;  4F55 A;  1LFU P;  3EDP A;  2Z5U A;  3OYB A;  2NNY A;  2G7H A;  3LSI A;  2VQL A;  1SMY F;  4RAY A;  1RNL A;  2CV1 A;  2HZD A;  4LIU A;  1Z3Y A;  2YU3 A;  5K7F A;  5C44 J;  2OTL I;  1WJE A;  3L9F A;  5GAD J;  2E2I J;  2OU2 A;  3IWZ A;  4A3G J;  4ZYD A;  1YOV B;  3DEE A;  4L5J A;  2K40 A;  4XSZ F;  2HTJ A;  3G6E I;  3FM5 A;  2GIV A;  2XAF A;  1V4R A;  2HVR A;  1VQN I;  2PBI A;  3E5Q A;  4NUB A;  3SFI A;  1A5J A;  3S8P A;  4A3F J;  1HF0 A;  2VJ5 A;  1RR8 C;  2OV7 A;  3CP2 A;  3KP2 A;  2BZT A;  3P9K A;  3E6B A;  4RM2 A;  2WV0 A;  3DKW A;  3ZMT A;  2LMD A;  4XLP F;  2JA6 J;  3IAS 2;  3PUF A;  3BJO A;  1X1A A;  2WTE A;  3C2H A;  3JRB A;  5JVG F;  3BTC A;  3QYB A;  5D5V B;  2LRE A;  3SJM A;  2PQ8 A;  1KU2 A;  4RA2 A;  4Y4R A;  1ZRC A;  4HNV A;  1XMA A;  5C3E J;  2PMU A;  5L3E A;  1ZAR A;  2A07 F;  4FCY A;  4FTH A;  3IH2 A;  2I10 A;  2HTS A;  3D5L A;  1ZGW A;  1TP4 A;  5DCM B;  4IEJ A;  4NQW B;  4KYW A;  3SFZ A;  2KPM A;  3ELK A;  3R60 A;  3TP3 A;  1POG A;  2ZJR F;  1HW5 A;  2RDP A;  2DA3 A;  3PM1 A;  1OCT C;  2A61 A;  2KL4 A;  1JT6 A;  2Y2Z A;  2DXI A;  1MZB A;  4IPA A;  4I2O A;  2W82 A;  4EGZ A;  1MJA A;  1FJL A;  3K0L A;  1K79 A;  4KMU X;  1W1W E;  4JX4 A;  4OMZ A;  3IWF A;  1UG2 A;  3H9J A;  2FBH A;  4AYB N;  1BIB A;  5DM6 F;  5CQE A;  1W0U A;  3PUB A;  1B9M A;  1HBX G;  3OR1 C;  3FMS A;  1KON A;  3ECH A;  1Y8Q B;  1XSV A;  1K6O A;  1QVT A;  1R49 A;  1SVM A;  4YII A;  4CHU A;  3SDG A;  2W48 A;  3KP4 A;  3SZP A;  3OIQ A;  3EYY A;  4J01 A;  5E79 C;  1FP1 D;  2L9N A;  4A12 A;  1I50 J;  2PFB A;  3JW4 A;  4J00 A;  3HG9 A;  3TOA A;  2L0K A;  2IA2 A;  1MH3 A;  1VQP I;  1HKT A;  1YS7 A;  4HNT A;  4M71 A;  3Q3S A;  4WK8 F;  1X4O A;  1MMD A;  1K78 B;  5TGT A;  2IW5 A;  2LH9 A;  3GLX A;  2VJ4 A;  5FLV A;  4G6T B;  4UVA A;  1LJ9 A;  1V5E A;  2R5Z A;  1F1Z A;  4X1E A;  3HHG A;  2FBK A;  2HQR A;  1X1B A;  2V1U A;  3BR1 A;  1YYV A;  5K1Y A;  2OD5 A;  3Q9V A;  2A5W A;  1R00 A;  4NDL A;  4EJW A;  1QZE A;  1R4M B;  4BEH B;  3Q5F A;  2LKX A;  1SAU A;  4WCG A;  2HOT A;  1WFX A;  1KQ9 A;  2ELH A;  2IXS A;  3TBI A;  1HKS A;  2VBW A;  3K70 D;  2Z16 A;  4V2F A;  4RB1 A;  2LTP A;  5ICG A;  2JVG A;  4FHT A;  3W2A A;  3KX2 A;  2VC1 A;  1BM9 A;  3KYD B;  5K7Z A;  4BH9 A;  2KKO A;  1TNS A;  4RGS A;  4G12 A;  1X4P A;  2DI3 A;  2LKP A;  3IH4 A;  5BNG A;  2QSF X;  4EVI A;  2YS9 A;  5FFZ A;  4IJA A;  2LSO A;  2NS7 A;  4QSH A;  1Z1D A;  4YEL A;  4AYB A;  2GWR A;  3K2Z A;  1AA7 A;  3J81 K;  1WJD A;  3M8E A;  3HC7 A;  1ZAO A;  1QRY A;  4I02 A;  2EIM H;  4LJZ F;  2BYV E;  1SMT A;  2IGN A;  4D0P A;  3RI4 A;  4EM1 A;  1GV5 A;  2R7Q A;  3ZQQ A;  3GTJ J;  4A3C J;  2HGC A;  1JTX A;  1HCR A;  2LY1 A;  2OC6 A;  2DTR A;  2FQ3 A;  5FO5 A;  4LG3 A;  4UV9 A;  1LVK A;  2CG4 A;  1RKW A;  2HQ5 A;  4LLN A;  3CCJ I;  3BG3 A;  5J3L A;  4AID A;  4PJN A;  3OYF A;  2FBI A;  1VQL I;  3V8K A;  4BJ5 C;  1W5S A;  1JJ8 C;  1GV2 A;  2OZ6 A;  4E6K G;  2FUG 2;  1WJ5 A;  1AKH B;  5EYR A;  1YHQ I;  4XRS G;  1XG1 A;  3ABU A;  2X85 A;  4S0H B;  3IAM 2;  1TZL A;  2CFO A;  3B73 A;  2DT6 A;  4BE2 A;  2EIJ H;  3P9C A;  5J47 A;  4YIR X;  3OYM A;  3EUA A;  3CCV I;  4BBS J;  1RR7 A;  3WHB A;  1FNN A;  1Z7U A;  3I59 A;  4UUS A;  2Y30 A;  4XLN F;  2OA4 A;  4KIS A;  5E17 F;  2VJI A;  3GTO J;  3K6G A;  3ZCO A;  1X3W B;  2DK8 A;  1IN8 A;  3FXJ A;  1K7A A;  2CU7 A;  3V8L A;  3S17 J;  4ZJZ A;  3VEP A;  5FD6 A;  1WPK A;  2MBF A;  1ZG1 A;  5L3B A;  1G6N A;  2VQC A;  3TDU C;  1ETV A;  1G3T A;  2EFO A;  3DF8 A;  2F2E A;  3DTE A;  2M5W A;  2L4A A;  4IKF A;  3R0A A;  1IXS B;  3GUD A;  1ERD A;  2A6H F;  3S93 A;  2F4O B;  1IO2 A;  3T8T A;  3V7R A;  4CCN A;  5D4R A;  2K3F A;  4FX4 A;  2NVY J;  3E6M A;  5C4J J;  4DOZ A;  3OYE A;  3IV5 A;  3CDI A;  2TDX A;  2H94 A;  3KET A;  1YIJ I;  1B4A A;  4N9H A;  1RIO H;  2XKO A;  1AOY A;  3K4M A;  1U9O A;  1Y0N A;  5E3N A;  4P55 A;  2MC4 A;  2XF7 A;  4LIT A;  4CCM A;  2V6C A;  1MBE A;  1I6H J;  2DT7 B;  3TO6 A;  3BTL A;  3PNV A;  2WB1 A;  1MNM C;  4ZZD A;  1IN7 A;  2DFI A;  3G1L A;  4BAY A;  3ZOB A;  3P7N A;  2L54 A;  4Y52 J;  1R4N B;  1KU3 A;  1H0M A;  1LNW A;  4OU0 A;  1ZGJ A;  4BGD A;  4G7O F;  2XUB A;  2ZC2 A;  2CW7 A;  2WA0 A;  3FMQ A;  3WTZ A;  1VQ4 I;  3ISP A;  3K70 C;  4XOP A;  2GZW A;  3HSE A;  1IRG A;  3RKQ A;  3AG2 H;  4C2M J;  3CMM A;  2VB6 A;  4L5E A;  1W4M A;  2BGC A;  1K6Y A;  3ZMZ A;  2OQG A;  4I09 A;  2XGC A;  3K4J A;  3WE3 A;  5HOO A;  1IN5 A;  2L7Z A;  1OYW A;  2XB5 A;  2F48 A;  3E3V A;  3HSF A;  3D1N I;  3KZZ A;  1E2X A;  3NWS A;  2EIN H;  2IS4 A;  3AAF A;  1BN5 A;  1E3P A;  1K61 A;  4IOA F;  2R7U A;  3CJR B;  2MD0 A;  2VBY A;  2MLK A;  3HRS A;  5EGO B;  1U8R A;  3V4G A;  3W6V A;  3CCE I;  1ZTR A;  2R7V A;  2HFH A;  5E18 F;  2M87 A;  4G9Y A;  5HNF A;  3OYC A;  1IV6 A;  3JSP A;  4HST A;  5F0C A;  2FRH A;  2R5Y A;  3CP8 A;  3WTY C;  2DOE A;  4AVZ A;  2G0E A;  2XSJ C;  3DTI A;  3MZY A;  1YTY A;  1NG7 A;  2DA7 A;  1XCV A;  5CJ9 A;  3H3Z A;  4RGX A;  2DPD A;  1X2N A;  2DA2 A;  1ZRF A;  1ZHF A;  2O8X A;  1Z9C A;  4DYQ A;  4V19 K;  1XGN A;  2DTZ A;  3OMY A;  3QPT A;  1ETQ A;  4GGG A;  2F4I A;  2FA5 A;  3AFH A;  1N25 A;  5EF6 A;  2HVQ A;  4BDZ A;  4ZYG A;  1Y1V J;  4HW0 A;  1K4T A;  3RDI A;  4OIO F;  3FKJ A;  1AHD P;  3S1M J;  1QU3 A;  3HBL A;  4KIT B;  3I3L A;  3DLL F;  2EK5 A;  4AIJ A;  1MGT A;  2KFD A;  3FXM A;  4NNJ A;  2B7E A;  5DV5 A;  2VT3 A;  2E71 A;  1JGS A;  3MAJ A;  3F23 A;  3HJE A;  5IT9 K;  1UJ8 A;  2YUS A;  2VJJ A;  1KZH A;  1MD0 A;  5GTH C;  1YW7 A;  2BHZ A;  4V2G A;  2COM A;  3E97 A;  2W57 A;  5M5X J;  3HL2 A;  3TED A;  1JJ6 C;  4BXU A;  1JUS A;  2F5C A;  4EEF G;  3LOC A;  2UZK A;  5L3F A;  2E1M B;  5FLX K;  2FNP A;  1MKM A;  4I0B A;  2NOG A;  2OQR A;  3BCB A;  2RNG A;  1O3S A;  2H6B A;  2LY2 A;  1SD7 A;  2WY7 Q;  3T5X A;  1R71 A;  2XKP A;  2ZO4 A;  1OCP A;  2CYY A;  2MYS A;  1OFC X;  2DAO A;  2FOW A;  4PDK A;  2DN0 A;  4BHB A;  2AQE A;  4G6D A;  2UWM A;  4MQ9 F;  2HOA A;  1UAA A;  4M3E A;  5FKM A;  2Z2S B;  4QWQ A;  5B1B H;  2A6E F;  5D4S A;  3CUQ A;  3UR3 C;  1LKX A;  3WGG A;  4FT8 A;  1TQI A;  3MN2 A;  5IP9 J;  4PFP A;  2FE3 A;  2XRL A;  3K1M A;  4L9N A;  1HC8 A;  4LD5 A;  2RC4 A;  1D5V A;  2RV8 A;  5K5O A;  3KP5 A;  2L9V A;  1BI0 A;  1FWZ A;  3GVA A;  1V5G A;  2JTV A;  4DBQ A;  4M3G A;  2JA7 J;  4RB2 C;  3HOW J;  2P6S A;  4C3J J;  1SAX A;  1QQI A;  4X0G A;  3IC7 A;  1LPQ A;  2X6W A;  4XKW A;  2IBD A;  4ETS A;  2GIZ A;  2GA2 A;  3CJQ B;  3HGG A;  1DPU A;  3BQZ A;  4R79 A;  1XC5 A;  4AIH A;  1PUF A;  2DYR H;  3BOQ A;  4B47 A;  4WWC A;  1LE8 B;  2XPW A;  4Q47 A;  5EG0 B;  3S1Q J;  2XPU A;  1P6R A;  4XN3 A;  1FLI A;  2OJE D;  4NBQ A;  3EQL F;  2P0W A;  2E7X A;  1N75 A;  1JTY A;  3FF5 A;  1F36 A;  2P8T A;  3UKG A;  2MH2 A;  4I7H A;  3G4S I;  2XAJ A;  3QP5 A;  1SFX A;  2ID3 A;  3D0S A;  3PQJ A;  4D7N A;  3G73 A;  5B1A H;  2DOA A;  2VC0 A;  1VQ5 I;  2DQL A;  4HRI A;  5JLX A;  2Y75 A;  2JWT A;  2XRN A;  4A6D A;  2LF8 A;  4DZP A;  4M72 A;  1U78 A;  2EIK H;  4HF2 A;  5FLM J;  1D1A A;  2R7D A;  4II2 A;  4KUM A;  1BR1 A;  2DYS H;  5KHD A;  1ZEL A;  1NG6 A;  4Z2Y A;  2PJR B;  1U5T B;  4EQQ A;  1HXD A;  2DDB A;  4HA8 A;  3BCA A;  1MMA A;  2F5V A;  5E1X A;  4LLL A;  1Y39 A;  2CV0 A;  1I5Z A;  1OJL A;  2EPF A;  3GF2 A;  4XIC A;  4A0Y A;  3ZRG A;  4E70 A;  2M0C A;  3MMY B;  4UVB A;  4A6E A;  1Z0X A;  3AKZ A;  3K69 A;  3F8M A;  2PMZ A;  3K4C A;  1GDT A;  4DNC A;  1OCC H;  2P81 A;  2BXZ A;  2LK2 A;  3DTK A;  3DEW A;  3OYN A;  5IY5 H;  5FLX Z;  3OS0 A;  4FAS D;  4ZH4 F;  4C2U A;  2VON A;  3OOP A;  1D5Y A;  4HV6 A;  3M9A A;  1XSX A;  3H0D A;  5TRD A;  3BR2 A;  2ZME A;  3WGH A;  1T95 A;  2HQA A;  1L3L A;  2X6Y A;  5F27 A;  4CCO A;  2AQF A;  3FXU A;  4BYY A;  1ACI A;  2W85 A;  2KIU A;  2Y31 A;  5M5W J;  2M4G A;  4PUS A;  1H89 C;  2XPV A;  4QPO A;  1S8N A;  2LR8 A;  5JLW A;  1R7J A;  1HDD C;  2KIS A;  1VQ6 I;  3CME I;  4C3H J;  2CSO A;  4MFD A;  1WI9 A;  1X19 A;  3KEQ A;  4E7Z A;  2FML A;  4XOR A;  4M9X A;  1IXC A;  4ITV A;  5EZG A;  2GA1 A;  3S1R J;  1QZZ A;  1J0R A;  1E3H A;  2AXT C;  3LAP A;  4LIV A;  2H8W A;  4QPQ A;  4KMF A;  4M3D A;  4DGW B;  5BPI A;  4RAG A;  5ERI A;  2V4J C;  1UST A;  3S3O A;  3OIP A;  3BRO A;  5B3S H;  1YW8 A;  2KP6 A;  2VOO A;  1UHS A;  4L9J A;  1VQ9 I;  5K7H A;  2QLZ A;  3OYK A;  1WSU A;  2ZNY A;  1VQM I;  3KP6 A;  3GZN B;  1ENH A;  1FEX A;  5HLT A;  1S5L C;  2GQQ A;  1ZR2 A;  4XR6 A;  3IKV A;  3FBN B;  2EV6 A;  1OYI A;  4A3M J;  3L2V A;  4E7L A;  5IYD J;  2RGV A;  2EZL A;  5D8K B;  2ZNZ A;  5ILU A;  2IJL A;  1XGO A;  1ZRD A;  1G2H A;  4CZZ A;  3CCS I;  4M3B A;  2CUZ A;  3PIO F;  1FIP A;  1WJF A;  5F0F A;  1OMI A;  3I4N J;  2L01 A;  2VE8 A;  3W3C A;  4XRS A;  3HOZ J;  3JRA A;  1IRZ A;  1T8I A;  2UV1 A;  2CV2 A;  4X6A J;  1ZG5 A;  4RAZ A;  3I5U A;  2D1V A;  4P5O A;  1X3Z B;  2LF7 A;  2VXZ A;  4XLF A;  3BPV A;  2ESH A;  2IT0 A;  2QQB A;  4LG0 B;  3C7J A;  2NVX J;  3WU2 C;  1YJW I;  1GT0 C;  4XKC A;  5DCF A;  1FPQ A;  1QGP A;  3AG3 H;  5E1Z B;  3RPQ A;  1Q1V A;  3DPT A;  2XC7 A;  2B63 J;  3KFW X;  1XD7 A;  1PJR A;  1HW1 A;  3ZMS A;  2OCC H;  3L2C A;  4I76 A;  2HDW A;  3E5U A;  4UXN A;  2JSP A;  1LEB A;  2OZU A;  2XF5 A;  1Z3X A;  1NHA A;  1S6L A;  3BG6 A;  1MBJ A;  1J2X A;  4ENN A;  3OV8 A;  1IUY A;  2HEO A;  3KZI C;  5H20 A;  3KP3 A;  3LST A;  4OOI A;  3GFJ A;  4ABZ A;  2VE9 A;  3VOD A;  1LB2 A;  3ASO H;  3H0G J;  4N4N B;  4M9Z A;  1ZG3 A;  2HDD A;  3ZMV A;  3NAR A;  2E35 A;  1WRJ A;  3S2D J;  2L5Q A;  2EFN A;  3SEQ A;  3W2V A;  2W7N A;  3KCC A;  1A31 A;  2JRM A;  2HOE A;  5DCM A;  4BXX J;  4NQW A;  1TTY A;  2QQ9 A;  2QVO A;  2ZXJ A;  2HQN A;  3QRF F;  1TWC J;  3SDB A;  3KP7 A;  1YX5 A;  1S7A A;  1BBY A;  4HLX A;  4IRG A;  2VKE A;  4HQM A;  1R6R A;  1WZ2 A;  2LBF B;  1QZY A;  3L2U A;  1MDM B;  1O3Q A;  3BJ6 A;  4PFO A;  3ZGK A;  4XLE A;  3HB9 A;  2W24 A;  3ZQF A;  2NRA C;  1D8K A;  2CGP A;  4NC8 A;  3J7Z I;  5ICE A;  2XGD A;  4JP0 A;  3SEZ A;  2O03 A;  1MBG A;  4CA0 A;  1OKR A;  4A3I J;  4Z6Y A;  2BOL A;  1XX5 A;  1Z6R A;  4XON A;  2ME0 A;  3KEY A;  1I1S A;  3TP0 A;  3O3K A;  4BKX A;  3F8F A;  4CYC B;  2Y0M A;  3OYJ A;  1BI1 A;  2BHY A;  1K83 J;  5IYC J;  1OYY A;  3REO A;  2UXX A;  5EEG A;  3TO9 A;  5E8G A;  4BU2 A;  2VOD A;  5D5W B;  2O6G E;  1KGS A;  1ETK A;  3I53 A;  3VYU B;  4EJU A;  1QO0 D;  2HKO A;  4HV5 A;  5K5Q A;  1FX7 A;  3CLO A;  3FK6 A;  1B72 B;  3RJP A;  3CLQ A;  1ZK8 A;  4F52 A;  2DBB A;  1K78 A;  1DDN A;  3CUQ C;  4IL6 C;  4I99 C;  3QOD A;  3SXY A;  4XMY A;  2ME6 A;  5EEH A;  2COB A;  5LBQ A;  1YI2 I;  4L5I A;  4IHW A;  4LB6 B;  1X2M A;  1GVJ A;  4KIF A;  2KIQ A;  5TJJ A;  2KIM A;  2R7O A;  3K1P A;  4BEH A;  3F3X A;  4XM3 A;  4Q5S F;  1IRF A;  4MGR A;  5D5U B;  2BW3 B;  3FXR A;  4L9V A;  5IOZ A;  3CJT B;  5HOD A;  3O6B B;  4A3L J;  4B3X A;  2R7T A;  3RQI A;  4MFE A;  2NS0 A;  1YRN B;  3OY9 A;  3S32 A;  2VPL A;  5LEJ A;  1S3J A;  4HSR A;  2EBI A;  1SVO A;  3FXL A;  2HYG D;  2HR3 A;  4IRI A;  3JRF A;  3LQR A;  3AL0 B;  2HYF A;  2I8D A;  5AIQ A;  4Y7N J;  1U8B A;  3BLY A;  3EUK L;  3VWB A;  4AM3 A;  1P2F A;  3N05 A;  2QM3 A;  1D0X A;  3PIP F;  1XDS A;  2BVM A;  1BOA A;  3HRT A;  3JRE A;  1IN4 A;  3BZ6 A;  4EJO A;  2L7M P;  3IKT A;  4WXH A;  1QBJ A;  1FZP B;  2A68 F;  1XMX A;  1UFM A;  3Q9S A;  3LA3 A;  4A3B J;  1IDY A;  5DUK A;  2LDU A;  3GZ5 A;  5GPA A;  4OIQ F;  2AXL A;  2VOP A;  3ZR8 X;  1KQ8 A;  2LY9 A;  1UZC A;  4C3I J;  5HS8 A;  3LA7 A;  1WWX A;  3OYI A;  3ULQ B;  3LSJ A;  5CVV A;  1YIO A;  3M1C A;  1AKH A;  5IP7 J;  2XAU A;  1JKO C;  3D5S C;  1SFU A;  3I54 A;  1P7I A;  3H5R A;  3WGI A;  1VI0 A;  4ON0 A;  1G8X A;  2NVU B;  3IL2 A;  3BZC A;  4GYG A;  3WOD F;  2WB1 N;  2FX0 A;  2K7L A;  2RRE A;  5D6F A;  3ERM A;  2K27 A;  4LK0 F;  3E0J B;  5J1R A;  4IZZ A;  3H9G A;  3LSG A;  1R5G A;  5GP9 A;  1OCZ H;  4D1Q A;  3CES A;  3RSN A;  3E6C C;  3LQQ A;  2FQ4 A;  2EWN A;  4D9J A;  2L7K A;  1KU7 A;  1X1C A;  1GUU A;  5BOX A;  1PP7 U;  2CFX A;  1VND A;  4XRF A;  1BC8 C;  4M6V A;  2PI0 A;  3E7L A;  5LHG A;  1NK3 P;  2ZME C;  5M3F J;  2XB0 X;  1WGX A;  3BY6 A;  3QQA A;  4JX6 A;  3LL7 A;  2LKS A;  2K02 A;  3COA C;  4OAY A;  3MZH A;  1X3U A;  2VKH A;  5LD2 C;  1JT0 A;  5TIS C;  2JMW A;  2ZXI A;  4BUP A;  4PCQ A;  4BE0 A;  5LEK A;  4OWR B;  3CCY A;  3E1S A;  4QLC U;  1TWH J;  1WH5 A;  3AG1 H;  3M8J A;  3TOB A;  1PP8 F;  3ROU A;  2ECB A;  2WAF A;  4YFK F;  1MMG A;  5C4X J;  5JVT A;  1B1B A;  3KIO A;  4U88 A;  5E1W A;  4G7H F;  4M74 A;  3P9I A;  2G7U A;  5FRM A;  3A02 A;  2ZFW A;  3LSM A;  4G8X A;  1SD5 A;  3MQ0 A;  2QSG X;  4RBO A;  3HSR A;  2LRD A;  3GXO A;  4NC7 A;  1REP C;  1B59 A;  5EZH A;  2IS2 A;  3WTV C;  2VLA A;  3I59 B;  3V8J A;  2IA1 A;  4IXA A;  1RZ4 A;  3VDX A;  2V6E A;  1MSE C;  5JHU A;  2WBM A;  4GFB A;  3BJA A;  3WTU C;  2E7W A;  2DCE A;  2IPQ X;  4MIM A;  4RGU A;  1YE9 A;  3R0J A;  3LSH A;  2PEX A;  4UUT A;  3T8R A;  5LLQ A;  1AWC A;  1D8J A;  3S3M A;  1IGN A;  2ZXH A;  4RLF A;  2V1D A;  1Z91 A;  2VBX A;  5FD5 A; 
#chains in the Genus database with same CATH homology
 2VXD A;  1QHG A;  3TMO A;  2IGM A;  3CZ6 A;  4X0G A;  2V1N A;  3S3N A;  4U7B A;  3MKZ A;  2V9K A;  2X6W A;  3OYD A;  4E7K A;  4XKW A;  3CJQ B;  2VQH A;  4HG2 A;  2KRH A;  4CZC A;  2K5C A;  4XN0 A;  4R79 A;  1P9Q C;  4ANJ A;  4B47 A;  3K4B A;  4DJA A;  1Y56 A;  2CS3 A;  5CKT A;  2UUZ A;  1GLN A;  3RCO A;  3TL4 X;  4XN3 A;  1LDK B;  2M4K A;  2QKL B;  2P0W A;  1TT0 A;  3OYG A;  1N75 A;  3OYH A;  1MNE A;  1E0E A;  3IUO A;  1FMV A;  4ZC3 A;  4CCL A;  1BR2 A;  4RLQ A;  2DOA A;  1WJC A;  3DWL E;  1BR4 A;  1MW7 A;  2M3A A;  4F55 A;  4DBR A;  3H5A A;  4HRI A;  3QOE A;  5CQG A;  3OYB A;  2RQQ A;  3LSI A;  2VQL A;  2F6C A;  2CV1 A;  2HZD A;  1D1A A;  4LIU A;  1Z3Y A;  1Z7L A;  4II2 A;  3FDY A;  1WJE A;  2HNH A;  1BR1 A;  5KHD A;  1ZEL A;  1NG6 A;  2PJR B;  4F91 B;  3DEE A;  3BCA A;  1MMA A;  2F5V A;  2CV0 A;  2R7S A;  2MAB A;  2HVR A;  4NUB A;  3ZRG A;  3S8P A;  3DLA A;  3MMY B;  4XLH A;  2VJ5 A;  2OV7 A;  3CP2 A;  4RM3 A;  4BXF A;  3AKZ A;  4RM2 A;  2A6T A;  3I9V 2;  2PMZ A;  3K4C A;  3IAS 2;  4MLO A;  1D0Z A;  4IQJ A;  1X1A A;  3C2H A;  3H5N A;  3DTK A;  2E5N A;  3OYN A;  3OS0 A;  1PYV A;  3QYB A;  2LRE A;  4FAS D;  2R7X A;  4C2U A;  2KMU A;  4HEA 2;  4Y4R A;  1WJB A;  2CMP A;  4H4K C;  4N4O B;  4PK4 A;  2CH0 A;  1IRX A;  3H0D A;  1T95 A;  2X1E A;  5LFA A;  2HQA A;  2X6Y A;  1EA3 A;  4CCO A;  2AQF A;  3PJR A;  4PJM A;  4GRI A;  3D5L A;  3PSI A;  2E5Z A;  2ZFU A;  4NQW B;  2KPM A;  3OS1 A;  4KT6 A;  2M4G A;  4PUS A;  1FMW A;  4QPO A;  2KLO A;  1DP3 A;  2KL4 A;  3K4N A;  2DXI A;  4ZTF A;  5KCM A;  1X19 A;  4E7Z A;  2W82 A;  2L9S A;  4XOR A;  2Y0S A;  4ITV A;  4CUG A;  4Y3O A;  4E7S A;  3H9J A;  5CQE A;  1HA8 A;  3LSK A;  3PUB A;  4LIV A;  4QPQ A;  3HOT A;  4ZTJ A;  4DGW B;  3OR1 C;  1N78 A;  3QYE A;  2V4J C;  2X6X A;  1KON A;  3S3O A;  1X1D A;  3BG7 A;  3PNY A;  3OIP A;  2KP6 A;  2CUJ A;  4PJL A;  3OR2 C;  4BL0 B;  3OIQ A;  3OYK A;  3DU6 A;  1LFP A;  3HPH A;  4J01 A;  1MMN A;  2XDV A;  2L9N A;  3F9K A;  5HLT A;  4J00 A;  4BS9 A;  3HG9 A;  3DQV C;  2KZV A;  4XR6 A;  3FBN B;  1U0J A;  4CCK A;  2M7A A;  4HNT A;  1X4O A;  3G2B A;  1MMD A;  3L2V A;  5TGT A;  4E7L A;  3CF2 A;  1UG0 A;  2LH9 A;  1DGR M;  2VJ4 A;  4JQF A;  4G6T B;  2WAE A;  2R4G A;  4PSX A;  1V5E A;  3QYF A;  3HXL A;  2CUZ A;  1WJF A;  4C9Y A;  4II3 A;  3VYR B;  1X1B A;  2VIX A;  3W3C A;  2A5W A;  5JHF A;  2CV2 A;  2UV1 A;  1UEL B;  3ZGK A;  4BEH B;  2W1O A;  1SAU A;  1WFX A;  4P5O A;  3FBI B;  2VXZ A;  4XLF A;  2IXS A;  3TBI A;  4XNF A;  3LFU A;  3K70 D;  1WJA A;  4BDY A;  2Z16 A;  4BE1 A;  4C30 A;  3H35 A;  4BQN A;  2IGO A;  1YX3 A;  2JVG A;  3W2A A;  2LG4 A;  3KX2 A;  4XKC A;  2GOM A;  2NOJ B;  2XC7 A;  3DPT A;  1PJR A;  3K4L A;  3VYT B;  4XKV A;  1X4P A;  1Y6I A;  2HDW A;  2LC2 A;  2K9L A;  2WAD A;  2JA2 A;  3DU5 A;  2JSP A;  2XF5 A;  1Z3X A;  3J7A Y;  3BG6 A;  4YEL A;  5CPR B;  4AYB A;  1AA7 A;  4FET A;  1WJD A;  3HC7 A;  4E7I A;  4OAZ A;  2IGN A;  2V7F A;  2Z1D A;  3VSK A;  4ZDL A;  2R7Q A;  3ZQQ A;  2W4S A;  2LY1 A;  4N4N B;  2OC6 A;  1BOB A;  2K3P A;  2Q2E B;  4JOM A;  4LG3 A;  4HPQ A;  1LVK A;  3DPU A;  4XKB A;  2L5Q A;  3SEQ A;  3W2V A;  2W7N A;  1J09 A;  4PJN A;  3OYF A;  2LOO A;  3UNG C;  2VL8 A;  4BJ5 C;  4E6K G;  2FUG 2;  1WJ5 A;  2KDO A;  2VKD A;  3DKX A;  3H9Q A;  4PSW A;  3SDB A;  1YX5 A;  4C2T A;  4CCJ A;  2R7R A;  3K4K A;  1R6R A;  2LBF B;  4BJT A;  2X1D A;  2L2O A;  3L2U A;  2X85 A;  4PFO A;  2QKM B;  3DKY A;  1DGW Y;  1TZL A;  2CFO A;  2OUM A;  3IAM 2;  2DT6 A;  4P1W A;  4XLE A;  3SZG A;  3PL8 A;  4BE2 A;  2R7W A;  4NC8 A;  3OYM A;  3EUA A;  3SEZ A;  4CA0 A;  3HUG B;  2VQG A;  2BOL A;  3OL4 A;  3VYS B;  4KIS A;  2VJI A;  4XON A;  3K6G A;  3KEY A;  3ZCO A;  3PNT A;  3OYJ A;  1G59 A;  4XLC A;  3EPZ A;  3L2W A;  2GOX B;  4IX7 A;  4BQO A;  4ZJZ A;  3OL3 A;  4IQ4 A;  2VQC A;  4BU2 A;  3MD2 A;  3DTE A;  3VYU B;  4IKF A;  1ERD A;  2IS6 A;  3S93 A;  4CCN A;  1QHH D;  4DOZ A;  4F52 A;  3OYE A;  2MFZ A;  3QOD A;  4XMY A;  3K10 A;  1W36 D;  2W00 A;  3K4M A;  2XF6 A;  2MC4 A;  4AU7 A;  2KRC A;  2HPM A;  2XF7 A;  3PFY A;  4LIT A;  4CCM A;  2R7O A;  4BJ6 C;  3ZXS A;  4KJZ A;  4BEH A;  4XM3 A;  4F92 B;  2DT7 B;  2O5R A;  3PNV A;  1V5F A;  2WB1 A;  2E60 A;  3AL0 C;  2BW3 B;  5FRN A;  2IS1 A;  1N77 A;  5KNL A;  4B3X A;  4EAT A;  2R7T A;  4B44 A;  3A2K A;  4BGD A;  3BC8 A;  3HPG A;  3OY9 A;  2HVS A;  2JUG A;  2CW7 A;  2WA0 A;  3K70 C;  3S32 A;  2VPL A;  3ONQ A;  4XOP A;  5HNH A;  4HSR A;  3HOS A;  2HPI A;  1D1C A;  2VB6 A;  3CMM A;  3MKY B;  3AL0 B;  2I8D A;  1K6Y A;  2BVL A;  3BLY A;  3EUK L;  3VWB A;  3N05 A;  2PJR A;  1D0X A;  2BVM A;  4ZDO A;  3HKZ A;  3K4J A;  5HOO A;  4DIQ A;  4E4H A;  1S9H A;  3C2G A;  3NWS A;  3A1Y A;  2IS4 A;  3RTR A;  2R7U A;  1OR7 C;  3CJR B;  2K9M A;  2MD0 A;  4B48 A;  1Z21 A;  2M0M A;  3KYL A;  3L2R A;  3ZR8 X;  4BQQ A;  2R7V A;  4PJJ A;  5HNF A;  3OYC A;  4XLA A;  1OLT A;  4F3Q A;  3RPU D;  3U21 A;  3OYI A;  4HST A;  2X1C A;  3CP8 A;  3M1C A;  4AVZ A;  2XAU A;  3RQ4 A;  2XSJ C;  3D5S C;  3DTI A;  4CSW A;  2KHM A;  3H5R A;  2LBF A;  1NG7 A;  1G8X A;  4F93 B;  4HNU A;  4E7H A;  3OWT A;  2RRE A;  2ZSI B;  2M7B A;  2JVH A;  3OS2 A;  2LYC A;  3E0J B;  4YEJ A;  2WY8 Q;  3OMY A;  1T0F C;  4IZZ A;  2HU9 A;  3H9G A;  3LSG A;  2F4I A;  3AFH A;  2HVQ A;  3L2Q A;  4BDZ A;  4D1Q A;  3CES A;  3RSN A;  4U87 A;  4YRV A;  3FHN A;  3EUH C;  1D0Y A;  2CW8 A;  3NWT A;  3A4C A;  4D9J A;  3D5R C;  2E1M C;  2L7K A;  1X1C A;  3FKJ A;  1QU3 A;  3V42 A;  2Q1Z B;  4ZDP A;  3DPL C;  4KIT B;  2ELJ A;  3I3L A;  4CH7 A;  4NNJ A;  1DQU A;  3OYA A;  3W2W A;  1VZ0 A;  3LL7 A;  3SYT A;  3OYL A;  2VJJ A;  4Y33 A;  4OAY A;  2DJI A;  2VKH A;  2ZSH B;  3HL2 A;  5LD2 C;  4BAC A;  2KQR A;  3OOU A;  2ZXI A;  1MND A;  2E1M B;  4BUP A;  4BE0 A;  2WAQ A;  4OWR B;  2IGK A;  2RNG A;  3BCB A;  3E1S A;  3M8J A;  2LY2 A;  3VSL A;  2X51 A;  2WY7 Q;  3LMM A;  5HVQ C;  3MKW B;  2WAF A;  4B43 A;  1MMG A;  2MYS A;  4RMN A;  2VAS A;  4XL9 A;  1W36 C;  5FRM A;  2AQE A;  2UWM A;  3LSM A;  2BW3 A;  4XOT A;  2LRD A;  4NC7 A;  3GBG A;  1UAA A;  2Z2S B;  2IS2 A;  2VLA A;  3UR3 C;  1LKX A;  3IP4 B;  2V26 A;  3VDX A;  5FRO A;  2V6E A;  2WBM A;  4E7J A;  4PFP A;  3PSF A;  2DCE A;  1D1B A;  1YE9 A;  4XQF A;  3LSH A;  1SFK A;  4ZYA A;  3S3M A;  2ZXH A;  4RLF A;  1V5G A;  4DBQ A;  1JI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...