2AO9A

Structural genomics, the crystal structure of a phage protein (phbc6a51) from bacillus cereus atcc 14579
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
117
Chain Sequence
MMAKLDELKQKLTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
molecule keywords Phage protein
total genus 41
structure length 117
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13022 HTH_Tnp_1_2 Helix-turn-helix of insertion element transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ao9A01
1OCPA 3S2DJ 2CUFA 5IYCJ 5IYDJ 2DN0A 2CQQA 2IEKA 1JKPC 1AKHA 2M0CA 1AHDP 2HOSA 2YUSA 2O8KA 2GBYA 1MBKA 3IV5A 4X6AJ 1MH3A 3H0GJ 1A6IA 2QF7A 3A03A 5GPAA 3LSGA 5C3EJ 2NS8A 5EGOB 3VPRA 1GV5A 2GM4A 2LP0A 2MW8A 1XC5A 5J3LA 1G2HA 5J1UA 3QPSA 5IP9J 3HGYA 4B4CA 4RDUA 1Y1WJ 3HOYJ 5K7HA 4X1EA 1A5JA 5BNGA 4DYRA 3BQYA 1VI0A 2RAEA 4LOCA 1T33A 5GP9A 1EF4A 2EQRA 2OPTA 2E19A 2JK3A 5FKNA 1GVDA 5EYRA 1FTTA 1FTZA 3SFIA 4D5CA 5DS9A 1TWGJ 5IPAA 4MFEA 5F0FA 4JX4A 2NVXJ 2EZKA 1JT6A 2EZLA 4IEJA 3TEDA 2FD5A 5FKKA 2E2IJ 3ZQCA 4EEFG 3DEWA 1UHSA 3DCFA 3FK7A 2EH3A 3BR2A 2M8GX 3ZOBA 1TWAJ 1ETQA 4MO7A 4IHWA 3JRDA 1I6HJ 3O8GA 3D1NI 3TP3A 3S1NJ 3BTJA 2DMUA 5C4XJ 5HODA 4A3FJ 4FE4A 1VF9A 1B72A 2TCTA 1ZGWA 2MGQA 1HCRA 1ETXA 3BG3A 4MLOA 5FKLA 3IH4A 3S17J 3CDLA 2XPVA 3GTGJ 1ORKA 2X48A 2DMNA 2ECCA 4D7MA 5F0CA 4QTRA 5EZGA 1HDPA 2EBIA 2FQ4A 3O8HA 5DTDA 2YS9A 1R9TJ 3JRAA 2K40A 2DMQA 1BJZA 4A3CJ 1ETVA 1NTCA 3HKZN 1T56A 4M3BA 4M3GA 3TW6A 3LOCA 2DA4A 4IHXA 5IOZA 1IC8A 5FJ8J 3A02A 4QSHA 3RQIA 1B72B 2IAIA 2COBA 3C2BA 4BXXJ 1WH7A 1QPIA 4ABZA 3QQAA 3TW7A 1LE8A 3FISA 1ITYA 3FIWA 2L7FP 3FKIJ 2XPWA 1F43A 5EEAA 2WV1A 1ZK8A 1MBEA 2DA2A 3S1MJ 2KDZA 1TWCJ 1YRNA 1RPWA 4CYCA 1H8AC 4M6VA 3G1LA 3BTLA 4FTHA 3A01B 2LK2A 3G1OA 1JTXA 1VFCA 3Q0WA 1X2NA 1HLVA 3NAUA 3ZQLA 2L0KA 3GTMJ 2OF7A 1U9OA 2Y9YA 1HOMA 1WGXA 2LLKA 3HOUJ 1RR7A 2K9QA 2LVSA 1JUMA 1MBGA 4MFDA 3OIOA 1Q1VA 3S2HJ 5IOYA 1K83J 3GTQJ 2M9HA 5F27A 4QIWN 3BT9A 4I76A 4A3GJ 2VUMJ 2L7ZA 5GPCA 1NK2P 1WPKA 3JRGA 1YRNB 1MSEC 2R5YA 2H1KA 3BR1A 5M5YJ 1X58A 1IV6A 4XICA 3B6AA 1ETYA 2Y30A 2NVTJ 3I4MJ 1D5YA 1HF0A 4AC0A 5J1RA 2XB5A 3HBLA 5K7ZA 4I6ZA 5F04A 3RKQA 2LTPA 2XGCA 2LD5A 5C44J 1OCTC 2ECBA 2PMZN 4DYQA 3GTJJ 3K2AA 4FE7A 3S16J 3E7LA 4UUSA 1MNMC 1MH4A 1RKTA 1HDDC 4MIMA 3GTKJ 4B3AA 2X9DA 3W6VA 1IRZA 1POGA 2GLOA 3RZOJ 2YU9J 4A3JJ 2HQ5A 5JLWA 2CUEA 3I4NJ 4CYCB 3K7AJ 2CJJA 4C3JJ 1BW5A 3Q3SA 1ENHA 4A3IJ 4XRSG 1P7IA 1E3OC 3Q0VA 2E2HJ 2K9SA 1MBHA 2NVYJ 3SDGA 3BR0A 4Y7NJ 4A93J 1GV2A 1XS9A 3BR5A 2DA3A 2VI6A 2HI3A 1FJLA 1IUFA 3ZQHA 1ZR4A 4L5EA 1JUPA 2CRGA 3GTPJ 1XG1A 4A3LJ 3FK6A 1B8IA 3ZQIA 1RESA 5FKMA 1AU7A 2DTZA 5EG0A 3HOZJ 2R93J 3TP0A 2IBDA 3L1PA 2N8GA 1JJ6C 4W1UA 1JT0A 3RZDJ 1S7EA 2DA7A 2LKXA 3S15J 1RKWA 2VKVA 3MKLA 4BBRJ 2DA1A 2HDDA 4XK4A 3WHBA 4M3DA 1ETKA 2D5VA 1ETWA 4D7NA 3LNQA 1WH5A 1SANA 1MBFA 2ELKA 5F0HA 3HOXJ 2R5YB 1QVUA 2NS7A 1JKRC 3HM5A 3OOUA 3MN2A 1UG2A 3LSPA 2HYJA 2E2JJ 2O9LA 3NARA 3JRIA 2VKEA 3CQZJ 3CMYA 2JA7J 5IP7J 1BA5A 2LY9A 4M3EA 1GT0C 2ME0A 1RETA 3M3YJ 5E3NA 3G1MA 1TWFJ 1BL0A 2WB1N 4V2GA 4V2FA 2XGDA 1Y1VJ 4DYCA 1IJWC 3S1QJ 1U9NA 2EZIA 3PO2J 4Y52J 1JKQC 4AYBN 2HOTA 1SFOJ 4BY7J 4JYKA 5EF6A 2B63J 1IDZA 2LR8A 1JKOC 3PM1A 1I3QJ 2JA6J 2FX0A 3HOVJ 3Q0UA 4HNVA 2JMWA 1F36A 3QPLA 4C3HJ 2Y9ZA 5EGOA 4UUSB 5FLMJ 1MBJA 3JRBA 3BTIA 9ANTA 2K9NA 2DA5A 3IH3A 2HOAA 3F0CA 1QVTA 1U78A 2LFBA 3BTCA 4JX5A 1Z77A 2P81A 1AKHB 5M5WJ 2Y2ZA 2HXOA 2I10A 1GDTA 1JUSA 4DZJA 2ZB9A 1W0UA 1B8IB 5EZHA 2JA5J 3IH2A 3BQZA 4C3IJ 4RBOA 2G0EA 2FJ1A 2H8RA 3HOWJ 5EDNA 2XSDC 4BKXA 3JREA 2DMPA 2O7OA 1IG7A 2MG4A 1O4XA 1LFBA 3SJMA 4D5FA 3HB9A 5E3OA 3OSFA 5M5XJ 1ETOA 2R7ZJ 1ZKGA 5FLVA 1OFCX 3H3VK 5E3MA 1ZQ3P 3HGGA 2W48A 2Y31A 3ZQFA 1JJ8C 4NDLA 2R5ZA 4M3FA 1H89C 1APLC 1DU6A 1Z0XA 4A3DJ 3JRFA 1WCMJ 2AO9A 1DU0A 4XIDA 1U8BA 1PUFA 1JTYA 2DMTA 2JJ7A 1IDYA 1WI3A 5F08A 5J1YA 2Y0SN 2JN6A 1I50J 4A3KJ 1TWHJ 2JWTA 5E3LA 2M2EA 2R0QC 3BG5A 3JRCA 3GBGA 4A3BJ 2DJNA 1GUUA 4IHYA 4JP0A 5C4JJ 3JR9A 2R92J 2CQXA 5M3FJ 3PO3J 2DA6A 1FEXA 2L9RA 3S14J 1K61A 1OJLA 5JLXA 4DZPA 4A3MJ 1VNDA 4UUTA 5IYBJ 3LSJA 4JX6A 3UKGA 2JA8J 1LFUP 2WAQN 1ZR2A 4IHVA 3GTOJ 3M4OJ 4W97A 4GFBA 2XGEA 2NOGA 4DW6A 3OSGA 2ME6A 5EG0B 1MSFC 1TC3C 3CCYA 1X2MA 4XRSA 3HDDA 2AHQA 2M34A 1FIAA 4C2MJ 4AUXA 2KT0A 2NVQJ 5K7FA 2XPUA 4FISA 3HEFA 1PUFB 3A01A 2CU7A 1ZTRA 2E1OA 2X6OA 3JRHA 1CQTA 1UMQA 1NK3P 3S1RJ 2R5ZB 2HXIA 3LSRA 5FKOA 1IGNA 4BBSJ 3BG9A 2XB0X 2TRTA 3MVPA 2ID3A 3WHCA 4B1RA 1P7JA 1QRYA 5M3MJ 1FIPA 4A3EJ 3GTLJ 4BY1J 2QCOA 1LE8B 4G12A 5F1JA 2VPRA 2XRLA 3BR6A 3B6CA 4FCYA 4A69C 1W0TA 2L7MP 4XRMA 4J19A 1JGGA 1H88C 4S0HB 2MSYA 2ID6A 2EZHA 1BW6A 5IP6A 3BR3A 3ZQGA
chains in the Genus database with same CATH superfamily
2P4WA 1OCPA 1SEUA 2DN0A 1R7JA 4U0WA 4P9UA 1JKPC 5ICFA 2M0CA 2KIMA 2MFZA 1AHDP 2HOSA 2GBYA 3DPLC 3GVAA 1VQ4I 2O8KA 2V1DA 3IV5A 3QU6A 4DOZA 3A4CA 1MH3A 1A6IA 1A04A 4A0XA 3WTUC 4C2UA 1MMSA 2LDUA 4MTEA 5J3LA 2RDPA 2GA2A 1G2HA 2CUZA 3PUBA 1ZYRF 5ILSA 4XN3A 4Y3OA 3DPUA 1XDUA 2RVCA 1V3FA 3WG9A 5K7HA 2GWRA 2EFNA 2LY1A 4LLLA 2V9PA 2ZMEB 3BQYA 1X19A 4DYRA 4PUSA 2RAEA 5TISC 2LY2A 1V4RA 5DCMB 4BJ5C 3CLQA 1R6RA 1U6GA 3V4GA 3QODA 1VQ7I 5EJCA 2GOMA 2O0YA 1TWGJ 4U88A 5IPAA 2PJPA 4JX4A 2CV1A 3BJOA 4BAYA 3ABKH 1JT6A 3TEDA 1KGSA 2X1CA 4EJUA 2E2IJ 3ZQCA 4E7KA 4HX8A 1UHSA 2RQQA 3CMEI 3OYFA 1OCCH 4JK1X 3ZOBA 1FMWA 4PGGA 4IQ4A 3HRTA 4QWQA 5D4RA 2DQRA 1P4XA 5ICEA 2CSOA 3MFKA 4A0ZA 2R7QA 4DNCA 2DJIA 4BJ6C 2JPCA 3KYCB 3HHGA 2VJIA 2TCTA 1ETXA 3KZIC 4XKCA 2D45A 1JHHA 4YFXF 3S17J 2DFFA 5E17F 2FOWA 4OIRF 4YRVA 3GTGJ 2X48A 5H20A 3BJAA 1WJFA 4D7MA 3PSIA 4QTRA 3GWZA 2EV0A 2HTSA 2A69F 5DTDA 1IXCA 2QUFA 3ABTA 4L5JA 2OZ6A 4MEXF 4UB8C 3JRAA 2IXSA 3TDZC 3J7AO 1R36A 1S29A 2K5CA 1NTCA 2OUMA 3HKZN 5IY5H 3TW6A 2EIKH 1W5TA 3R6SA 1PP7U 5FD5A 2DA4A 1IUYA 3K6GA 4BHBA 3HPGA 3EUHC 4J01A 1XMAA 2A6EF 3J7ZI 4RA2A 3V42A 2IAIA 1P4WA 2PG4A 3L2RA 3OR2C 2GA1A 2ZXIA 2L54A 4XOTA 4ZYGA 1TW3A 2W7NA 1TLHB 3SEZA 3I0TA 3JTHA 2CQKA 3J80Z 2YX7A 2L7FP 3FIWA 3FKIJ 1F43A 1O3SA 3E3VA 3S1MJ 2K4BA 3RI4A 1YRNA 3CUQA 1KYZA 1LEAA 4M6VA 2P6TA 3G1LA 3BTLA 3OYEA 4ESFA 2XAGA 3A01B 4L9TA 4UV8A 4U0YA 1HLVA 3NAUA 3ZQLA 3H5RA 3DEUA 2L0KA 4HX7A 3GTMJ 2KRHA 2PMHA 4Q48A 2G7UA 1HOMA 3U1KA 1N75A 1T39A 1D0XA 2VJJA 1J9IA 3FXMA 2HKXA 2XROA 2J5PA 4G94A 4RM3A 4KA4A 4LG3A 2IVMA 3C1DA 2CQ7A 3NWSA 3P9KA 2VUMJ 3K2ZA 3CCQI 1V5EA 4A5MA 2VN2A 2R5YA 1RIOH 5GTIC 2V6EA 2BZTA 2DOFA 3W2VA 1VZ0A 4XICA 1BC8C 3K4CA 3ZMVA 4BE1A 3K4BA 1QZEA 4BXFA 2XB5A 1R23A 3HBLA 4PSXA 2M8EA 2O61A 4B3XA 2L7KA 5K7ZA 2DODA 3RKQA 2FU4A 1VQKI 2LTPA 2XGCA 3S3OA 2GOXB 4DYQA 2O6GE 3BJ6A 2DFHA 4FE7A 2CFOA 2BW3A 1IN6A 3GFJA 2XKPA 1MH4A 2PMUA 2ZO4A 4MQ9F 1T6SA 2HVRA 2UUZA 4B3AA 5IT9Z 2LH9A 1IRZA 1QA6A 1POGA 2F4MB 1IW7F 3RZOJ 2YU9J 2RNJA 4A3JJ 2HQ5A 1G3SA 2QQ8A 2CUEA 4YIFA 2IGOA 3I4NJ 4CYCB 2XF7A 4C3JJ 4M6XA 1ZELA 5LFAA 3IKVA 2MC3A 4FX4A 2ZKZA 1R5ID 1DUXC 3SDGA 3KP7A 1I3AA 2NVUB 1I5ZA 2DA3A 3JCUC 3T8RA 2AQFA 2VI6A 2HI3A 3ZQHA 2BXYA 1JUPA 3P7NA 3OYLA 3ASNH 1WJBA 2JSCA 1X3ZB 2LBFB 3NWTA 2VC1A 2RN7A 3T5XA 4G8XA 1WKMA 2K3FA 2WA0A 5D6EA 2P5KA 3H36A 2JVGA 2DDAA 5E1XA 3OYAA 2ZNZA 3GEZA 2GXBA 3COAC 2HPIA 1W1WE 3UR3C 3I4PA 3RCOA 3ECOA 3JW4A 5CQGA 1S5LC 3CJNA 2FXAA 1JJ6C 2V1XA 1JGSA 3H9QA 4W1UA 3O6BB 3FXJA 3H9GA 4AVPA 2DA7A 3ZRGA 4O6JA 4ITVA 4KITB 1NG7A 2R7FA 3SYTA 3WG7H 5CPRB 4IOCF 4I0AA 1N25A 2YPRA 1YHQI 3HUGB 2HDDA 3I5UA 5K5RA 5EEGA 1R5GA 2R7XA 2D5VA 3LNQA 2IS2A 2FOKA 3RTRA 2Y69H 4Y4RA 3HOXJ 4Q5SF 4IRHA 3WTWC 2R5YB 3FMQA 4HA8A 1J75A 1QVUA 2I8DA 2K27A 1YS7A 2HDWA 3HM5A 3MZ8A 4P96A 2D2WA 2Z3YA 1SFXA 1YTYA 3RKYA 2WB1A 3NARA 2ZBKA 4QPOA 3CMYA 2FNAA 3K1MA 4HLYA 4XKVA 1YO5C 1BA5A 2LY9A 3CCRI 2Y48A 4EATA 5H6RA 5FO5A 3DWLE 3M3YJ 4EM1A 5E3NA 3G1MA 1FT9A 4A6DA 2WTEA 2K86A 5F64A 4AM3A 1BOBA 3S3MA 1U5TC 3PO2J 3SZTA 4AYBN 1OR7C 3JTGA 4BY7J 1TL8A 2H6BA 1BR2A 1GHCA 2BY0A 1WJEA 2HU9A 3GMEA 1IDZA 1JKOC 2DW4A 5K1YA 5LHIA 3DLLF 4LG0B 3F8NA 4CICA 3OYIA 2DQLA 3E1SA 2FX0A 2STTA 4LMYA 5EEHA 1Y39A 3CJRB 2VONA 1BI2A 1SD5A 5EGOA 4I99C 4XLCA 4AIDA 1MBJA 4KICA 4RAZA 1XD7A 2X4HA 5HS9A 1EKEA 1FY7A 1S8NA 3K10A 1MMNA 1Z77A 4GXOA 1LVKA 5B66C 2EB7A 2M5WA 2GXGA 2Z33A 4RB2C 4XSZF 3I56I 3RQ4A 3CCMI 2Z16A 3T1BA 5CKTA 1W0UA 1IN5A 1HC8A 2LBFA 1BOAA 4G7HF 2VODA 3IH2A 4C3IJ 2CS3A 2OBPA 3FDYA 2F2EA 2G0EA 2E60A 3SZPA 2FJ1A 3GLXA 4RGSA 3JREA 2DMPA 1IG7A 1YS6A 1ERDA 1VQLI 1YE9A 2ZJPF 1L3LA 4D5FA 3HB9A 3PNVA 4RLQA 3TGNA 5M5XJ 2R7ZJ 5DV5A 4IXAA 1PUEE 1ZKGA 2QBYA 1OFCX 5E3MA 2OTJI 3HGGA 1FYLA 1IO2A 3KYLA 1RUOA 2Y31A 2Z9OA 4NDLA 1D5VA 3A2KA 2XAUA 3QOPA 2CV0A 2VXDA 1Z0XA 2YR2A 1HBXG 5JFRA 4Z6YA 4M9SA 3FHZA 1WZ2A 1U8BA 1F5TA 1U2WA 1JTYA 4HRIA 2JJ7A 3CUQC 4PJNA 1EA3A 2YX4A 1DDNA 2Y0SN 4QPQA 3K69A 4IHSA 3BG5A 3JRCA 5BMZA 4N9HA 4A3BJ 4CZZA 1GUUA 3QWLA 4AIKA 4JP0A 1OYWA 3JR9A 2CQXA 2HWVA 3ZMTA 3I59B 1K61A 2OC6A 1OJLA 4DZPA 1W36C 1WRJA 2KZVA 1J5YA 3DEEA 3DBHB 4HX4A 4ZH4F 1KU3A 2IP2A 5J4VA 2PJRB 3LSJA 3ONQA 3J7AY 3HHHA 2LSOA 3IRRA 2PMZA 1E2XA 4XLEA 2W82A 1EH8A 2CQNA 3BZCA 1YYVA 3K1PA 4BE0A 4HEA2 3BWGA 4DW6A 3FXOA 1XSVA 2R7VA 1MSFC 1X2MA 2DT5A 4GRIA 1Z91A 2M34A 2RV8A 3DKWA 1OPCA 4II3A 2DO7A 5CYVA 2LREA 2BVLA 3ISPA 3MWMA 2EIJH 3LA3A 3EYIA 4BEHA 2X6WA 3K0LA 3NQOA 3A01A 3OY9A 2CU7A 2V1UA 1R22A 1VQPI 3F9KA 3LSRA 1HA8A 1B9NA 2RNGA 1ZGAA 5FKOA 2VQCA 3UNGC 3HPHA 1HW2A 2BVMA 1IGNA 4RAFA 3S3NA 2STWA 1T38A 2OZUA 3MQ0A 1HKTA 1XB4A 4OIPF 2A6HF 4G12A 4RB3C 3U2RA 2VPRA 3I53A 2GQQA 2V9VA 4OU0A 1QGPA 1N77A 2KLOA 3KP6A 4S0HB 1X1AA 4I01A 3U21A 2M4GA 2FSWA 5IT3A 1FYMA 2F5EA 3K4MA 1TQMA 5C44J 2CUFA 4IRIA 2DK5A 2P7VB 2CQQA 4XR6A 3I9V2 3FM3A 4MTDA 1E0EA 2YUSA 5E79C 1YX5A 4BQOA 4G7ZF 1D1AA 2JQ7A 2EJRA 2KRFA 3G3ZA 3H3UA 1WJAA 1Y0NA 1I1GA 5C3EJ 3QPHA 1ZHFA 1A36A 4WCGA 2NS8A 3GX4X 4HLXA 2LP0A 3G6EI 3QYBA 1YJNI 2EINH 2WC2A 3F3XA 4UHTA 2W4SA 3HGYA 4L5IA 5IP9J 5B3SH 1Y1WJ 3NRVA 2MH2A 3HOYJ 2PQ8A 2P5VA 4ZZDA 1ONVA 3M07A 1A5JA 5E20A 2FNPA 2L9SA 2VB6A 4BHCA 5B5EC 1OQYA 1YLFA 2ZFUA 3HTSB 2E19A 4NC7A 3D5RC 5FKNA 1IAWA 1O7LA 1GVDA 1G3TA 4X0GA 4RB0A 2L5QA 4U0VA 1MGTA 4D5CA 5ILVA 1LPQA 4YFNF 1IZ1A 1XMXA 2QQAA 4M74A 1FNNA 5J8FA 1J7KA 3JAMZ 2JTVA 4IEJA 4DBRA 5FKKA 2BEOA 2FUG2 2ELHA 2E7WA 3FK7A 4RMNA 3LAJA 3BR2A 3OYBA 1KYWA 4MO7A 3GYHX 4IHWA 4HW0A 5HOOA 1I6HJ 1S72I 2F5FA 2WAQA 2D1VA 2F5VA 1KA8A 2H1LA 1ZG5A 2M0MA 1W4MA 3KZZA 4F93B 2DMUA 2WWYA 2KIFA 3PQKA 5BOXA 3CCJI 3BG3A 1G8XA 1Y8RB 2GZWA 1GXPA 1SAUA 2XPVA 2DMNA 3E97A 5ICGA 1Z6RA 2CV2A 5F0CA 2EBIA 3O8HA 2ZJQF 2BYVE 2K40A 4BQAA 4R8HA 4A2UA 5J6XA 2XDVA 1T95A 2VT3A 3KEYA 2VLAA 1T56A 3LOCA 2BY1A 2ZSIB 5L3FA 3ZP5A 1XSXA 3OYNA 3CP8A 2ADUA 2CFXA 4V19K 1B9MA 5D8KB 5K5OA 3FM5A 1B72B 2LG4A 1IN8A 3CD6I 4BQQA 2UWMA 1HW5A 3T0YA 4BXXJ 2L9NA 4ABZA 1QPIA 3JAMK 3TW7A 3DKYA 1XGOA 1VTNC 1YFHA 2XPWA 5HVQC 1U0JA 5EEAA 3E6MA 1W7PA 2WV1A 1MBEA 3PNYA 4CGZA 4ZDOA 3DPTA 1S3JA 1RPWA 1U5TB 4ZDPA 1AOYA 2ISYA 1STZA 1D0YA 3ASOH 2R7DA 2LF7A 3HTUA 5DYMA 2F4IA 3M9AA 4NB5A 1SD6A 4HG2A 1SVOA 1RRJA 1TNSA 2IGKA 1KQ9A 5KHDA 1U9OA 2DT7B 1FP2A 2NRAC 3F8FA 1FSHA 4WX9A 2EA4A 3RSNA 2WAFA 2LVSA 5BQTA 1H0MA 1JUMA 5JHFA 5J47A 4XONA 4MFDA 1UJ8A 1Q1VA 3CCLI 5IOYA 3FZVA 3RDIA 4CCMA 1L0OC 2VKDA 4QIWN 4CCOA 5IT9K 5F6FA 3RPUA 2L7ZA 4I2OA 3CUQB 3P9IA 1YRNB 4B43A 3ZQQA 2E36A 2XVCA 3RKXA 1W5CC 4HNTA 3B6AA 3D5SC 1ETYA 1EJ9A 1ZRDA 1MD0A 4AIJA 1D5YA 4KDPA 2EFOA 2DFEA 4AC0A 4F7ZA 4ASNA 3DXJF 3HOSA 2BY2A 1IXRC 2VQGA 4N4OB 5L3EA 3QP5A 5F04A 5ILUA 2LD5A 1CGPA 1OCTC 1MMGA 2PMZN 5LEKA 3GO5A 2Q2EB 3K2AA 3S16J 2JA2A 1ZRFA 4BDYA 3CZ6A 4UUSA 1RZ4A 1MMAA 2VPLA 1XPXA 4KN7X 2HNHA 3W6VA 3H1CA 4I0BA 5JLWA 3FBNB 3M7GA 3I71A 3K7AJ 4XLNF 4EMSA 1BW5A 4P1WA 4ZZLA 1BR4A 4LJZF 4NQWA 4PFOA 5CLSA 4XSXF 5J4YA 2CW0F 2Q8KA 4E7HA 1RI7A 3E5XA 3J7YJ 2E5ZA 3KYDB 1B6AA 4GGGA 3HSEA 4NQWB 5E1ZB 3CDHA 2XAQA 3BR0A 4Y7NJ 4CSWA 1GV2A 1FBQA 2E71A 3K4JA 2GXAA 3R60A 4OAZA 4L5EA 1OCRH 1LDJA 2VXZA 2BXZA 2X85A 1FSEA 1E17A 3K9TA 2LMDA 3JSPA 2FBHA 4BDZA 5CQEA 3CF5F 5KCMA 3CESA 2NXNB 2IS1A 5EG0A 2HQAA 3DV8A 1JHFA 4GYGA 2EV6A 2NOJB 5FFZA 3CMMA 2IBDA 1I6XA 3TOBA 1O3RA 4YEJA 4I98B 5JI6A 2ISZA 1JT0A 2XSJC 1RUNA 4BL0B 5HLHA 3GFIA 1LB2A 1Z7UA 3BPXA 3R4KA 3MKLA 5FGMA 3L09A 3KEQA 3WHBA 4ON0A 1XCBA 3QOEA 4M3DA 4E7JA 2Z99A 2VKHA 3OL3A 3TO9A 4XORA 2F4OB 1SFKA 1LJ9A 1Y56A 1JKRC 3GLLA 2YSRA 3LSPA 1UG2A 2XC7A 2HYJA 4E7ZA 4XKBA 3E6DA 2VKEA 4CCNA 4K2EA 1F9NA 4XLHA 2JA7J 5J8CA 4M3EA 4BUPA 3FXLA 1FZPB 1GT0C 2CWEA 1RETA 5H2FC 1TNTA 1TWFJ 5L3CA 1BL0A 3S1QJ 1UCRA 1IJWC 5KAIC 1U9NA 2EA2A 3HKZA 3KP4A 2ESNA 2HOTA 4U7DA 1FOWA 1FP1D 5BS6A 5EF6A 3QU3A 4ZTJA 2K9MA 2KQRA 3V8KA 1XTAA 3KCCA 1I3QJ 5FB2A 1I27A 4RGRA 3JSOA 1D8KA 1ON2A 4KYWA 5LHGA 3Q0UA 2QENA 4I09A 3J81Z 2WV0A 4M71A 5CVIA 5FLMJ 9ANTA 1B59A 2K9NA 2QWWA 3E6BA 4F91B 5HLTA 3MKYB 1U78A 3G71I 3HJEA 3BTCA 2HVQA 2QGUA 5FRNA 4F92B 4JX5A 2EFPA 1X3UA 1D8JA 2HXOA 2I10A 3E0JB 2ZMEC 4M73A 1QQIA 3A0HC 3LQRA 1MDMA 4S05A 4RBOA 2V1NA 4IPAA 4CUGA 3BG6A 5DEQA 5EDNA 2XSDC 1Z3YA 4BYYA 4YG2F 1O4XA 1LFBA 3U1DA 2FQ3A 2QQBA 4F3QA 1TT0A 1GVJA 3SJMA 2CUJA 3OSFA 1MMDA 3AG4H 2ZSHB 1Z3XA 3CCEI 4KMFA 1K7AA 2DAOA 1X3WB 3GF2A 5GAGJ 1OCZH 5FLVA 3H3VK 1ZQ3P 4G6TB 3K4NA 2KIQA 2WADA 1QO0D 2W48A 2M3AA 3PQJA 1JJ8C 1UB9A 3FHNA 4M3FA 4AIHA 2BBYA 1WJ5A 1FPQA 3GW2A 3C2HA 4LFUA 2EFWA 3CUOA 1LNWA 2VJ4A 3DKXA 3I54A 1K4SA 1WCMJ 1BIBA 2AO9A 1MNEA 1DU0A 1PJRA 3IWFA 4C2TA 2DMTA 2W1OA 3KP3A 3F8BA 1DGRM 5F08A 2JPBA 1KONA 3KFWX 2M2EA 5CVUA 1D1CA 3P5JA 3W3CA 3VEPA 4IHYA 4IKFA 2DA6A 3S14J 2JVHA 3IKTA 5JLXA 1VNDA 5CVJA 4HDVA 5IYBJ 4HZFA 1V5FA 2K7LA 3F22A 2MH9A 2QSFX 1W7PB 2WAQN 1UZCA 2TDXA 3OYJA 4WXDA 3H0DA 3DP7A 3HSFA 4GO1A 4CYDA 4HF1A 5HDKA 2VE8A 2E7XA 3OSGA 3RPQA 4OIQF 1RNLA 4EGZA 4KT6A 2CG4A 3V7SA 5AIPA 4U87A 4C2MJ 1UG0A 1C0WA 4AUXA 3ULQB 3OMYA 4WWCA 1HSJA 1OYIA 3J81K 2F5DA 4P5OA 4FASD 4OMYA 4FISA 5L3GA 1TTYA 1LVAA 1WQ2A 2X6OA 1IRXA 3AG2H 3VYSB 4E4HA 3G73A 1R5HA 1CQTA 1UMQA 1G4DA 1DP3A 3HYIA 1J2XA 2RC4A 3HG9A 4UV9A 3IWZA 5JR3A 2KISA 3BC8A 3BG9A 4BBSJ 2XB0X 2TRTA 4XQFA 3KETA 1P7JA 2MD5A 4BS9A 4E70A 3MKWB 3OS2A 1LE8B 2X1DA 5F1JA 1VQNI 2H6CA 3BR6A 4FCYA 1R4NB 1VQOI 5D6FA 2IRFG 4XRMA 4J19A 1WJCA 1V5GA 2ETHA 4FQGA 3K1NA 5HS8A 4KFCA 1UFMA 3TMOA 2ID6A 3MEXA 5HLIA 4RAGA 1VQMI 1MW7A 3GCMA 5DUKA 2QVOA 1BW6A 1U3EM 3CTAA 3BR3A 3ZQGA 4B8XA 4UUSB 3S2DJ 1EV7A 2LKSA 1EH7A 1J59A 1AKHA 1G3WA 2K3PA 1ULYA 1MBKA 1ACIA 3HRSA 2ACJA 2IT0A 4X6AJ 3H0GJ 2QF7A 1HKSA 3A03A 3L7WA 2R7TA 3LSGA 2DK8A 2FMLA 2GM4A 1GV5A 1XC5A 2V9KA 2L01A 4DJAA 3QPSA 4B4CA 1X1DA 4JOMA 3Q9SA 4ZYEA 2DT6A 4H0EA 1YW9A 2BGCA 4HSTA 2DYRH 5BNGA 5LGUA 3HSRA 2P7CB 4LOCA 1HW1A 1H9TA 1M1EB 3LSHA 3REOA 1K79A 5HLGA 4XLFA 3WU1B 1K6OA 1FTZA 3SFIA 3SDBA 5DS9A 3GUDA 1SAXA 4UVCA 5F0FA 2BV6A 2P6SA 3ZQ7A 5L3DA 2NVXJ 4II2A 4L0ZB 2EZLA 3LSMA 3HL2A 2FD5A 3CP2A 1BI3A 1OMIA 1O7FA 4ZTFA 3DEWA 1ZARA 2WY7Q 2Z5UA 1ZLKA 4IF4A 1HKQA 2OTLI 1IRFA 1ETQA 1ZG3A 3JRDA 4PZJA 1ZG1A 4I02A 3EETA 1ODDA 2EIMH 3ZN1A 4AWXB 3TP3A 3S1NJ 2EILH 3BTJA 5C4XJ 1TP4A 2MD0A 4FE4A 4ZYDA 2KL4A 1VF9A 4U7BA 4A3FJ 1B72A 4MNUA 3QYEA 2MGQA 1ZGWA 1A35A 3AL0B 1OR7A 4XRFA 1XGSA 2E1MB 2E1NA 2RGVA 4MQVA 2IGNA 2FMYA 4MLOA 3DU5A 3IH4A 5FKLA 3K70C 1IN4A 2EWNA 3DTKA 1ORKA 5EZGA 4KIGA 1HDPA 2FQ4A 1X4PA 2X6XA 3I55I 1USSA 2YS9A 2R7RA 1R4MB 1LQ1A 4FETA 2VQLA 3E6CC 4A3CJ 4RGXA 1CF7B 1LEBA 4G7OF 2PLYA 2QSHX 2B7EA 3WTXC 3LAPA 4XBFA 4B48A 2X0LA 2XV4S 4CCKA 2P0WA 5IOZA 1IC8A 4XM3A 3A02A 1YQAA 3BCBA 2HQNA 2XAHA 2HDCA 2UXXA 1S7OA 2WAEA 4E7LA 3R61A 1WH7A 4B09A 4P55A 1ITYA 1A31A 2FE3A 5L3BA 1QNTA 2W24A 1ZK8A 4UVAA 4HF2A 2Y0SA 2ESHA 2KDZA 3OYMA 3EUAA 1P4AA 2M30A 2VT2A 3VDXA 3W2AA 2V26A 2BHYA 2GIZA 3G1OA 4OOIA 3WODF 3OS0A 1VFCA 3D5LA 5B1BH 4A12A 4E6KG 2LKPA 2UZKA 1SVLA 2MC4A 2KFDA 2OQGA 4N9IA 2VIXA 2OF7A 3X2QH 2CW7A 3FXKA 2DDBA 4H4KC 4EJTA 4LB6B 2DBBA 2KHMA 1WGXA 4RM2A 1X1CA 4RLFA 3HOUJ 1RR7A 2PX9A 4OINF 5LD2C 1XX5A 5AONA 1K83J 1UELB 3ZXSA 2OU2A 4DIQA 4D0PA 3L2VA 4HDUA 3ZPLA 1Y8QB 1NK2P 5H6QA 1WPKA 4AVZA 2OA4A 1R1VA 5M5YJ 1X58A 1B1BA 1YIJI 3A0BC 2NVTJ 4ENNA 3I4MJ 1HF0A 3F23A 3RYRA 3CC7I 1A6QA 5J1RA 1USTA 1XN7A 3LA7A 3DTEA 2DI3A 4F52A 2HR3A 2XKOA 3D0SA 2QM3A 4I6ZA 3V8LA 3VSLA 1K78A 2DPUA 1QZZA 3GTJJ 3VYTB 3Q5FA 3I58A 2CH0A 2A6TA 1SD7A 3TOAA 1MNMC 1RKTA 4MIMA 5FD6A 3F21A 3W6JB 2IA2A 4A5NA 3BOQA 3OOPA 2X9DA 1HXDA 5GAHJ 1KQ8A 4R79A 3PIPF 1UHMA 2GLOA 3RPUD 1P92A 4UUVA 1MJBA 5KVRA 4JBAA 1XDSA 4XMYA 1PDNC 3HRUA 3Q3SA 2R3SA 2VL8A 3R0AA 3AG1H 4XRSG 1E3OC 3Q0VA 2E2HJ 2V4JC 2MLKA 1MBHA 2G9WA 2NVYJ 1OKRA 5HDGA 3TO7A 4D9JA 1XS9A 2QLZA 3FF5A 4GDFA 3BR5A 3B73A 1Z05A 2BY3A 4NNJA 3PFYA 1FJLA 3BLYA 1IUFA 1ZR4A 5FFXA 5DUIA 3GTPJ 2XASA 3LMMA 2JT1A 5B1AH 2HOEA 1XG1A 4A3LJ 1FC3A 1DQUA 5KNLA 2HYGD 1B8IA 3SEQA 3O3KA 3ZQIA 4BJTA 1W7PD 2XAJA 3IL2A 5FKMA 3OS1A 2K4JA 3HXLA 1YI2I 2QSGX 2AQEA 3TL4X 3TQNA 3BZ6A 4WXHA 2QA4I 2QKMB 3AG3H 2DCEA 1MIJA 3C2GA 5KK1A 5GAEJ 2ZXWH 4FX0A 1FX7A 2N8GA 4J00A 4BGDA 3L2CA 5K5QA 1S7EA 3WE3A 4EM0B 4AU7A 3M8FA 2LKXA 2E5NA 4LGWA 2PJRA 2GIVA 1K78B 2UV1A 4M9XA 4DQ2A 2ZC2A 1XGNA 2HVSA 3EDPA 4XN0A 1T08B 2COMA 1SFEA 1XSDA 1ETKA 1I39A 2EK5A 4WF2A 4CDGA 4D7NA 4AD9A 1E3PA 2LNBA 3DU6A 3GFLA 2ELKA 1REPC 5F0HA 4XKWA 4BHPA 2LF8A 3T8TA 2NS7A 4HQEA 4MEYF 4RGUA 3OOUA 3MN2A 5D8LB 1VQ5I 3I59A 5CVVA 2E2JJ 2O9LA 3R0JA 5BPIA 2FF4A 5IP7J 2HTJA 5A2QZ 3L2WA 2E1MC 2ME0A 2ICWG 4HAMA 1O3QA 3AL0C 2R7UA 1W5SA 2Q0OA 3AAFA 3BPVA 2QBYB 2IW5A 4E7SA 3FMRA 1K4TA 3PNTA 1IF1A 4HV6A 4LK0F 4A6EA 3H9JA 1Y0UA 2EV5A 2B63J 3VYUB 2LR8A 3QYFA 4PJJA 1Q1HA 3WTYC 4BXUA 1KU9A 1LKXA 4PJ0C 3LFKA 2QEXI 2UXNA 2B0LA 3ZMUA 3HOVJ 4HNVA 3K4LA 1QZYA 3QPLA 3GFMA 4C3HJ 3GZ6A 1ZREA 3OR1C 1AA7A 4G9YA 4ESBA 1I1SA 2DA5A 3IH3A 3LL7A 3CC4I 3VWBA 3ZCOA 4LK1F 4IQJA 1ZGJA 2NYXA 3HIFA 2P81A 1AKHB 1WWXA 5M5WJ 2Y2ZA 2GAUA 2WBMA 3EUHA 1GDTA 1G59A 1JUSA 4DZJA 1R00A 2L2OA 2ZB9A 3J80K 1B8IB 2IS6A 2JA5J 3PJRA 1T98A 2BW3B 3VSKA 2Q2EA 3TDUC 1YJWI 3HOWJ 3K70D 4IX7A 4EM2A 3MCZA 2VBWA 2O7OA 2OD5A 3IUOA 2NS0A 5F1RA 1Z67A 5E3OA 1JI8A 2H27A 1RC9A 1ETOA 3L9FA 4EVIA 2LRDA 3F72A 3LSKA 3ZQFA 3SHFA 3C18A 2DOEA 1APLC 1Z6TA 2H94A 3ABMH 1Y6IA 1FOXA 3DTIA 2K02A 2L3DA 2P5LC 3F8MA 2AXTC 2E1CA 2M7BA 5JVGF 1B4AA 5J1YA 2JN6A 2JWTA 5FLXZ 3OYDA 5GADJ 4Y15A 4NC6A 5E3LA 2W00A 3MD2A 3SXYA 2R0QC 1SVMA 3MAJA 3GBGA 1O57A 3ESWB 2DJNA 5FRMA 4L18B 2JUGA 5C4JJ 1FEXA 2R92J 5M3FJ 1FWZA 3FXRA 1SD4A 3ZMSA 2AXLA 1T0FC 4AYBA 2O3FA 4BE2A 2K9LA 1J09A 4UUTA 4PK4A 4JX6A 3UKGA 2LOOA 3HOTA 3RJPA 2D1HA 3SQNA 1ZAOA 2ZJ2A 1RR8C 1ZLJA 1FBSA 3TKYA 3EPZA 4IHVA 3GTOJ 3SFZA 4MGRA 3W6KB 4EJWA 1G3YA 3RIRA 4UY8I 4GFBA 2PI0A 2B9SA 5EG0B 1TC3C 5DM7F 4YIRX 1YW8A 1LUJB 3HDDA 1FIAA 4TV7A 1J0RA 4BU2A 2KT0A 3ROUA 5E8GA 5K7FA 4XLPF 2XPUA 2E35A 1KQ0A 4XNFA 3HEFA 3DLAA 4CO8A 2DFIA 3FKJA 3OIPA 3A1YA 4PGHA 1IRGA 4RS8A 2G7HA 3S1RJ 1VQ8I 2HXIA 1PYVA 2QKLB 2Y75A 2OV7A 3RYPA 1NHAA 3CJTB 2RREA 5DM6F 2FBIA 3F8CA 2X6YA 4UNOA 5M3MJ 1FIPA 3TBIA 2JZYA 3GTLJ 2NAZA 4Y17A 2M45A 2R4GA 4ENJA 1QU3A 4EV0A 2XRLA 2ZCWA 2MBFA 3OWTA 1R1UA 2HYFA 2L7MP 3ECHA 1JGGA 5DD4A 2CW8A 3PL8A 5LBQA 4ZJZA 4O3MA 2MSYA 5LRRA 2X1EA 1QBJA 1XGMA 2EZHA 2ZJRF 2IJLA 3N05A 4A0YA 1CF7A 1YIOA 3DBLB 2JUCA 2OJED 5IYCJ 5IYDJ 2IEKA 4G6DA 1U8RA 2KIUA 1IN7A 3M1EA 2IS4A 4UXNA 1FYKA 4OAYA 5TRDA 5GPAA 4HF0A 3CO7C 4G6QA 3I3LA 5EGOB 3VPRA 3LWFA 2MW8A 3KIOA 1YW7A 4UB6C 5J1UA 3MZHA 4S04A 4RDUA 3KP5A 3DQVC 5DD8A 3H5NA 3BDDA 4M9ZA 1X1PA 5HNFA 1BN5A 4X1EA 3BCAA 1R58A 1IV8A 1VI0A 4KNYA 5GP9A 1T33A 1Z7LA 3L2QA 1EF4A 2EQRA 2OPTA 4NUBA 2JK3A 2M1BA 3QRFF 4QLCU 2F5CA 5EYRA 1FTTA 4N4NB 2BOLA 2R7OA 4MFEA 3ERMA 4Q47A 2CYYA 2A07F 2CO5A 2EZKA 1P6RA 4OMZA 3ZMDA 4Q4ZF 4PFPA 3NEUA 4ENKA 2VE9A 2VOOA 5LLQA 3GZNB 4IOAF 4EEFG 3OYKA 1FLIA 3V7RA 1WI9A 2QQ9A 3DCFA 4LIVA 2EH3A 4KJZA 2M8GX 5A2QK 1TWAJ 1PP8F 3HZJA 3ZMZA 3LFUA 3O8GA 4FT8A 1YITI 4LLNA 2XHKA 1TT5B 3D1NI 2HS5A 3ML6A 5HODA 3HUGA 1JXSA 2VJ5A 3OIQA 4IHTA 1K6YA 1YOVB 3MMYB 1QPMA 1HCRA 2DTRA 3WGGA 4KN4X 3ZR8X 3CDLA 4CH7A 4PCQA 2IA0A 3V8JA 1T2KA 2ECCA 1KU7A 4XLAA 3DF8A 5E8IA 3CF2A 1BC7C 4MHGA 1R9TJ 3HRMA 3M8JA 3LA2A 2DMQA 5JHUA 4BEHB 2L02A 5D5UB 1BJZA 3L2UA 1ETVA 2A05A 3FXQA 4M3GA 4M3BA 2QYOA 2CMPA 2HFHA 2OCEA 3ERED 2DPDA 3FX3A 2HZTA 2RQPA 4JQFA 5TGTA 2HQRA 2HZDA 4IHXA 5FJ8J 2A68F 1MZBA 2KP6A 4QSHA 3RQIA 1NH3A 1ZN2A 3BG7A 3LSTA 2COBA 3G2BA 1BIAA 3PSFA 4ENMA 1VQ6I 3C2BA 2M4KA 1ZRCA 5HS7A 3QQAA 1LE8A 1NG6A 3FISA 1O3TA 2Y0MA 1MJAA 2MLGA 2HPMA 2XF6A 2DA2A 1T8IA 1WJDA 2YU3A 2O03A 1QHGA 2VBYA 1TWCJ 2KRCA 4CYCA 1H8AC 3WTVC 3ELKA 2KJBA 4FTHA 1MJ9A 1H9GA 2FRHA 3VFZA 2LK2A 4PSWA 1JTXA 2XF5A 3Q0WA 1X2NA 2L4MA 4BH9A 1TW2A 2EFQA 2VOPA 3S2WA 1WVRA 2Y9YA 2V6CA 4NC8A 1VQ9I 1S6LA 4GCVA 2LLKA 1OCOH 4WK8F 2K9QA 1MBGA 4CXFA 2OCCH 1LDDA 3OIOA 3S2HJ 3ZGKA 2JSPA 2W85A 1KZHA 3GTQJ 2M9HA 5F27A 3IAM2 4EJOA 3BT9A 4I76A 5JVTA 1R71A 4NHJA 4A3GJ 1F1ZA 3MZYA 5GPCA 3H3ZA 3OYGA 4UVBA 2XAFA 1UAAA 1U5TA 4KUMA 3JRGA 1R1TA 1MSEC 2H1KA 2C6YA 3BR1A 2PBIA 4ETSA 3N97A 1IV6A 4HOBA 1N78A 2Y30A 3QAHA 3VB2A 3IC7A 4ESJA 3KZYA 4IO9F 2ZMEA 1ZH5A 1BM9A 3KX2A 5ICCA 2ECBA 2FEZA 2O8XA 3E7LA 2Z1DA 2A5WA 1HDDC 2A5YB 4IVNA 4D1QA 4DGWB 1F4KA 3GTKJ 5LHHA 5ED4A 3H35A 3GZ5A 1FBUA 1YG2A 4RB1A 1TBXA 3CMAI 2ZNYA 2VBZA 3H92A 2CJJA 3OV8A 3W2WA 4IJAA 1W36D 1ENHA 4A3IJ 3S8PA 1R49A 1D0ZA 4OIOF 1P7IA 1HSTA 1SC7A 4BNCA 1P9QC 5KAFC 3E5QA 4IZZA 2K9SA 1HQCA 4ANJA 5LGNA 4E7IA 2A3SA 4A93J 3DBRB 1Z1DA 5ERIA 2XUBA 3OL4A 1TQPA 4O5VA 4B47A 4EGYA 2CRGA 5CVRA 3WGHA 1MDMB 3FK6A 2ZXHA 1RESA 3IAS2 2V79A 2HGCA 1YJ9I 3LSIA 2AS5F 1AU7A 2A61A 4Z2YA 3CCSI 2HEOA 2DTZA 3PIOF 3HOZJ 5LGTA 2R93J 3FBIB 4PJLA 3TP0A 2P8TA 2VASA 3L1PA 3HC7A 2CGPA 3FWEA 4RAYA 4XOPA 4DBQA 3RZDJ 4P9FA 3OYCA 4IRGA 4Y13A 2MABA 2ELJA 3CLOA 1OLTA 3KE2A 4LLGF 3S15J 3I64A 2Q1ZB 1UHWA 5FLXK 2KKOA 1RKWA 4ZC3A 2VKVA 5GTHC 4BBRJ 2DA1A 4CCLA 3VODA 3WTSC 3F6OA 4XK4A 4L9NA 4EJVA 4LITA 4CCJA 4B44A 1ETWA 1MKMA 2E34A 4YFKF 1WH5A 1SANA 1MBFA 2XIGA 4M6YA 5D5WB 4FHTA 4YELA 3BROA 5DCFA 4L9JA 1V55H 2M87A 1GXQA 4PDKA 2NNYA 2RKHA 3L00A 3JRIA 3CQZJ 1FMVA 1X1BA 2H09A 3N4MA 5AIQA 3H5AA 2LYCA 3EUKL 1DP7P 1S7AA 2KMUA 5TJJA 5D5VB 5DCMA 2WB1N 4V2GA 4V2FA 2XGDA 1Y1VJ 4DYCA 4HNUA 1D3YA 2EZIA 2XRNA 2EPFA 1OYYA 3QP6A 5HDNA 2VQHA 5E18F 1JKQC 3CCUI 1SFOJ 4Y52J 2LC2A 2MYSA 1BBYA 5CJ9A 4HPQA 4JYKA 4C30A 3CCVI 3RKWA 3BZKA 5J40A 3CDIA 3PM1A 4HSRA 4WXCA 3TO6A 2PEXA 5BPDA 3QPTA 4BACA 2JA6J 2JMWA 1E3HA 4OWRB 2BHZA 1F36A 2Y9ZA 3GXOA 3IP4B 3M1CA 1EH6A 3CJQB 3JRBA 3BTIA 3WGIA 2HOAA 3F0CA 1PVEA 1QVTA 1MNDA 1P2FA 2LFBA 3ABUA 1Z9CA 1BR1A 2OQRA 1GLNA 3VYRB 3ZN0A 1X4OA 3KLNA 5D4SA 1DPUA 3S93A 4NBQA 2I5UA 4XL9A 5E1WA 2DXIA 2MA3A 1KU2A 3VOEA 5EZHA 2X51A 3B02A 2QZ8A 3BQZA 4KIFA 2DU9A 1BJAA 3PUFA 4CA0A 2H8RA 1YX3A 1SMTA 5HNHA 4GYIA 3DFGA 4BKXA 3FXUA 4PJMA 2MG4A 3CC2I 4LIUA 3E5UA 1V54H 3BP8A 2VBXA 4LB5A 4F55A 2NNNA 3OYHA 1S9HA 3IHUA 3WTTC 4HQMA 1ON1A 3F6VA 2DOAA 1OISA 2R5ZA 2DLLA 1SFUA 3WE2A 4HV5A 1IXSB 4BQNA 1H89C 1DU6A 4A3DJ 1Z21A 2Z2SB 1TZLA 2KJCA 2W84A 3JRFA 4CZCA 2PN6A 3KPHA 5LEJA 3G4SI 2DYSH 3V7CA 4XIDA 1QHHD 1PUFA 1LDKB 3BY6A 1SMYF 4HBLA 3EQLF 1IDYA 1WI3A 2HKOA 3CO6C 1I50J 1FOYA 4A3KJ 1TWHJ 3O2PE 5DDGA 1G6NA 2O5RA 4N0BA 3EYYA 3K4KA 3MKZA 1JE8A 3PO3J 2K85A 2L9RA 2W57A 2R7WA 3KLOA 2M7AA 3WU2C 4A3MJ 2OAZA 4EQQA 1XCVA 4ZYHA 2JA8J 4YIIA 3SZGA 3LQQA 1LFUP 5FROA 1ZR2A 2FBKA 1BI1A 4ZYAA 4L9VA 3AFHA 2BE5F 4CHUA 2L4AA 4IL6C 4W97A 4Y33A 3M4OJ 4ZDLA 1BI0A 4M72A 2XGEA 2NOGA 3P9CA 2L9VA 3C7JA 4L0YB 1WSUA 3M8EA 2ME6A 4R1HA 4KT5C 3CCYA 3AKZA 1DGWY 4XRSA 3C3WA 1TQIA 2AHQA 4KMUX 2PFBA 2F48A 4HYEA 2ZFWA 2NVQJ 1WFXA 2ZXJA 2R7SA 2FA5A 1PUFB 3S32A 3U9GA 1ZTRA 2E1OA 2XGXA 1LFPA 2IA1A 2KPMA 3JRHA 1WHUA 4I7HA 1NK3P 1FOKA 4KISA 2R5ZB 3KEOA 2H8WA 2IGMA 3MVPA 1AWCA 2ID3A 3WHCA 3PFIA 4B1RA 1QRYA 4A3EJ 3WTZA 6PAXA 4BY1J 3KP2A 2QCOA 4KIBA 3Q9VA 2J5OA 2W25A 2VC0A 5D5XB 3B6CA 4A69C 1W0TA 3IRQA 1H88C 4C9YA 4LD5A 4LG0A 2F6CA 3WU0A 2IPQX 2KDOA 1D1BA 5LRSA 2KZGA 2WY8Q 2V7FA 3ABLH 2JRTA 3FMSA 1T0FA 1XMKA 2JRMA 1DPRA 5IP6A
chains in the Genus database with same CATH topology
1OCPA 3S2DJ 2CUFA 5IYCJ 5IYDJ 2DN0A 2CQQA 2IEKA 1JKPC 1AKHA 2M0CA 1AHDP 2HOSA 2YUSA 2O8KA 2GBYA 1MBKA 3IV5A 4X6AJ 1MH3A 3H0GJ 1A6IA 2QF7A 3A03A 5GPAA 3LSGA 5C3EJ 2NS8A 5EGOB 3VPRA 1GV5A 2GM4A 2LP0A 2MW8A 1XC5A 5J3LA 1G2HA 5J1UA 3QPSA 5IP9J 3HGYA 4B4CA 4RDUA 1Y1WJ 3HOYJ 5K7HA 4X1EA 1A5JA 5BNGA 4DYRA 3BQYA 1VI0A 2RAEA 4LOCA 1T33A 5GP9A 1EF4A 2EQRA 2OPTA 2E19A 2JK3A 5FKNA 1GVDA 5EYRA 1FTTA 1FTZA 3SFIA 4D5CA 5DS9A 1TWGJ 5IPAA 4MFEA 5F0FA 4JX4A 2NVXJ 2EZKA 1JT6A 2EZLA 4IEJA 3TEDA 2FD5A 5FKKA 2E2IJ 3ZQCA 4EEFG 3DEWA 1UHSA 3DCFA 3FK7A 2EH3A 3BR2A 2M8GX 3ZOBA 1TWAJ 1ETQA 4MO7A 4IHWA 3JRDA 1I6HJ 3O8GA 3D1NI 3TP3A 3S1NJ 3BTJA 2DMUA 5C4XJ 5HODA 4A3FJ 4FE4A 1VF9A 1B72A 2TCTA 1ZGWA 2MGQA 1HCRA 1ETXA 3BG3A 4MLOA 5FKLA 3IH4A 3S17J 3CDLA 2XPVA 3GTGJ 1ORKA 2X48A 2DMNA 2ECCA 4D7MA 5F0CA 4QTRA 5EZGA 1HDPA 2EBIA 2FQ4A 3O8HA 5DTDA 2YS9A 1R9TJ 3JRAA 2K40A 2DMQA 1BJZA 4A3CJ 1ETVA 1NTCA 3HKZN 1T56A 4M3BA 4M3GA 3TW6A 3LOCA 2DA4A 4IHXA 5IOZA 1IC8A 5FJ8J 3A02A 4QSHA 3RQIA 1B72B 2IAIA 2COBA 3C2BA 4BXXJ 1WH7A 1QPIA 4ABZA 3QQAA 3TW7A 1LE8A 3FISA 1ITYA 3FIWA 2L7FP 3FKIJ 2XPWA 1F43A 5EEAA 2WV1A 1ZK8A 1MBEA 2DA2A 3S1MJ 2KDZA 1TWCJ 1YRNA 1RPWA 4CYCA 1H8AC 4M6VA 3G1LA 3BTLA 4FTHA 3A01B 2LK2A 3G1OA 1JTXA 1VFCA 3Q0WA 1X2NA 1HLVA 3NAUA 3ZQLA 2L0KA 3GTMJ 2OF7A 1U9OA 2Y9YA 1HOMA 1WGXA 2LLKA 3HOUJ 1RR7A 2K9QA 2LVSA 1JUMA 1MBGA 4MFDA 3OIOA 1Q1VA 3S2HJ 5IOYA 1K83J 3GTQJ 2M9HA 5F27A 4QIWN 3BT9A 4I76A 4A3GJ 2VUMJ 2L7ZA 5GPCA 1NK2P 1WPKA 3JRGA 1YRNB 1MSEC 2R5YA 2H1KA 3BR1A 5M5YJ 1X58A 1IV6A 4XICA 3B6AA 1ETYA 2Y30A 2NVTJ 3I4MJ 1D5YA 1HF0A 4AC0A 5J1RA 2XB5A 3HBLA 5K7ZA 4I6ZA 5F04A 3RKQA 2LTPA 2XGCA 2LD5A 5C44J 1OCTC 2ECBA 2PMZN 4DYQA 3GTJJ 3K2AA 4FE7A 3S16J 3E7LA 4UUSA 1MNMC 1MH4A 1RKTA 1HDDC 4MIMA 3GTKJ 4B3AA 2X9DA 3W6VA 1IRZA 1POGA 2GLOA 3RZOJ 2YU9J 4A3JJ 2HQ5A 5JLWA 2CUEA 3I4NJ 4CYCB 3K7AJ 2CJJA 4C3JJ 1BW5A 3Q3SA 1ENHA 4A3IJ 4XRSG 1P7IA 1E3OC 3Q0VA 2E2HJ 2K9SA 1MBHA 2NVYJ 3SDGA 3BR0A 4Y7NJ 4A93J 1GV2A 1XS9A 3BR5A 2DA3A 2VI6A 2HI3A 1FJLA 1IUFA 3ZQHA 1ZR4A 4L5EA 1JUPA 2CRGA 3GTPJ 1XG1A 4A3LJ 3FK6A 1B8IA 3ZQIA 1RESA 5FKMA 1AU7A 2DTZA 5EG0A 3HOZJ 2R93J 3TP0A 2IBDA 3L1PA 2N8GA 1JJ6C 4W1UA 1JT0A 3RZDJ 1S7EA 2DA7A 2LKXA 3S15J 1RKWA 2VKVA 3MKLA 4BBRJ 2DA1A 2HDDA 4XK4A 3WHBA 4M3DA 1ETKA 2D5VA 1ETWA 4D7NA 3LNQA 1WH5A 1SANA 1MBFA 2ELKA 5F0HA 3HOXJ 2R5YB 1QVUA 2NS7A 1JKRC 3HM5A 3OOUA 3MN2A 1UG2A 3LSPA 2HYJA 2E2JJ 2O9LA 3NARA 3JRIA 2VKEA 3CQZJ 3CMYA 2JA7J 5IP7J 1BA5A 2LY9A 4M3EA 1GT0C 2ME0A 1RETA 3M3YJ 5E3NA 3G1MA 1TWFJ 1BL0A 2WB1N 4V2GA 4V2FA 2XGDA 1Y1VJ 4DYCA 1IJWC 3S1QJ 1U9NA 2EZIA 3PO2J 4Y52J 1JKQC 4AYBN 2HOTA 1SFOJ 4BY7J 4JYKA 5EF6A 2B63J 1IDZA 2LR8A 1JKOC 3PM1A 1I3QJ 2JA6J 2FX0A 3HOVJ 3Q0UA 4HNVA 2JMWA 1F36A 3QPLA 4C3HJ 2Y9ZA 5EGOA 4UUSB 5FLMJ 1MBJA 3JRBA 3BTIA 9ANTA 2K9NA 2DA5A 3IH3A 2HOAA 3F0CA 1QVTA 1U78A 2LFBA 3BTCA 4JX5A 1Z77A 2P81A 1AKHB 5M5WJ 2Y2ZA 2HXOA 2I10A 1GDTA 1JUSA 4DZJA 2ZB9A 1W0UA 1B8IB 5EZHA 2JA5J 3IH2A 3BQZA 4C3IJ 4RBOA 2G0EA 2FJ1A 2H8RA 3HOWJ 5EDNA 2XSDC 4BKXA 3JREA 2DMPA 2O7OA 1IG7A 2MG4A 1O4XA 1LFBA 3SJMA 4D5FA 3HB9A 5E3OA 3OSFA 5M5XJ 1ETOA 2R7ZJ 1ZKGA 5FLVA 1OFCX 3H3VK 5E3MA 1ZQ3P 3HGGA 2W48A 2Y31A 3ZQFA 1JJ8C 4NDLA 2R5ZA 4M3FA 1H89C 1APLC 1DU6A 1Z0XA 4A3DJ 3JRFA 1WCMJ 2AO9A 1DU0A 4XIDA 1U8BA 1PUFA 1JTYA 2DMTA 2JJ7A 1IDYA 1WI3A 5F08A 5J1YA 2Y0SN 2JN6A 1I50J 4A3KJ 1TWHJ 2JWTA 5E3LA 2M2EA 2R0QC 3BG5A 3JRCA 3GBGA 4A3BJ 2DJNA 1GUUA 4IHYA 4JP0A 5C4JJ 3JR9A 2R92J 2CQXA 5M3FJ 3PO3J 2DA6A 1FEXA 2L9RA 3S14J 1K61A 1OJLA 5JLXA 4DZPA 4A3MJ 1VNDA 4UUTA 5IYBJ 3LSJA 4JX6A 3UKGA 2JA8J 1LFUP 2WAQN 1ZR2A 4IHVA 3GTOJ 3M4OJ 4W97A 4GFBA 2XGEA 2NOGA 4DW6A 3OSGA 2ME6A 5EG0B 1MSFC 1TC3C 3CCYA 1X2MA 4XRSA 3HDDA 2AHQA 2M34A 1FIAA 4C2MJ 4AUXA 2KT0A 2NVQJ 5K7FA 2XPUA 4FISA 3HEFA 1PUFB 3A01A 2CU7A 1ZTRA 2E1OA 2X6OA 3JRHA 1CQTA 1UMQA 1NK3P 3S1RJ 2R5ZB 2HXIA 3LSRA 5FKOA 1IGNA 4BBSJ 3BG9A 2XB0X 2TRTA 3MVPA 2ID3A 3WHCA 4B1RA 1P7JA 1QRYA 5M3MJ 1FIPA 4A3EJ 3GTLJ 4BY1J 2QCOA 1LE8B 4G12A 5F1JA 2VPRA 2XRLA 3BR6A 3B6CA 4FCYA 4A69C 1W0TA 2L7MP 4XRMA 4J19A 1JGGA 1H88C 4S0HB 2MSYA 2ID6A 2EZHA 1BW6A 5IP6A 3BR3A 3ZQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCP A;  3S2D J;  2CUF A;  5IYC J;  5IYD J;  2DN0 A;  2CQQ A;  2IEK A;  1JKP C;  1AKH A;  2M0C A;  1AHD P;  2HOS A;  2YUS A;  2O8K A;  2GBY A;  1MBK A;  3IV5 A;  4X6A J;  1MH3 A;  3H0G J;  1A6I A;  2QF7 A;  3A03 A;  5GPA A;  3LSG A;  5C3E J;  2NS8 A;  5EGO B;  3VPR A;  1GV5 A;  2GM4 A;  2LP0 A;  2MW8 A;  1XC5 A;  5J3L A;  1G2H A;  5J1U A;  3QPS A;  5IP9 J;  3HGY A;  4B4C A;  4RDU A;  1Y1W J;  3HOY J;  5K7H A;  4X1E A;  1A5J A;  5BNG A;  4DYR A;  3BQY A;  1VI0 A;  2RAE A;  4LOC A;  1T33 A;  5GP9 A;  1EF4 A;  2EQR A;  2OPT A;  2E19 A;  2JK3 A;  5FKN A;  1GVD A;  5EYR A;  1FTT A;  1FTZ A;  3SFI A;  4D5C A;  5DS9 A;  1TWG J;  5IPA A;  4MFE A;  5F0F A;  4JX4 A;  2NVX J;  2EZK A;  1JT6 A;  2EZL A;  4IEJ A;  3TED A;  2FD5 A;  5FKK A;  2E2I J;  3ZQC A;  4EEF G;  3DEW A;  1UHS A;  3DCF A;  3FK7 A;  2EH3 A;  3BR2 A;  2M8G X;  3ZOB A;  1TWA J;  1ETQ A;  4MO7 A;  4IHW A;  3JRD A;  1I6H J;  3O8G A;  3D1N I;  3TP3 A;  3S1N J;  3BTJ A;  2DMU A;  5C4X J;  5HOD A;  4A3F J;  4FE4 A;  1VF9 A;  1B72 A;  2TCT A;  1ZGW A;  2MGQ A;  1HCR A;  1ETX A;  3BG3 A;  4MLO A;  5FKL A;  3IH4 A;  3S17 J;  3CDL A;  2XPV A;  3GTG J;  1ORK A;  2X48 A;  2DMN A;  2ECC A;  4D7M A;  5F0C A;  4QTR A;  5EZG A;  1HDP A;  2EBI A;  2FQ4 A;  3O8H A;  5DTD A;  2YS9 A;  1R9T J;  3JRA A;  2K40 A;  2DMQ A;  1BJZ A;  4A3C J;  1ETV A;  1NTC A;  3HKZ N;  1T56 A;  4M3B A;  4M3G A;  3TW6 A;  3LOC A;  2DA4 A;  4IHX A;  5IOZ A;  1IC8 A;  5FJ8 J;  3A02 A;  4QSH A;  3RQI A;  1B72 B;  2IAI A;  2COB A;  3C2B A;  4BXX J;  1WH7 A;  1QPI A;  4ABZ A;  3QQA A;  3TW7 A;  1LE8 A;  3FIS A;  1ITY A;  3FIW A;  2L7F P;  3FKI J;  2XPW A;  1F43 A;  5EEA A;  2WV1 A;  1ZK8 A;  1MBE A;  2DA2 A;  3S1M J;  2KDZ A;  1TWC J;  1YRN A;  1RPW A;  4CYC A;  1H8A C;  4M6V A;  3G1L A;  3BTL A;  4FTH A;  3A01 B;  2LK2 A;  3G1O A;  1JTX A;  1VFC A;  3Q0W A;  1X2N A;  1HLV A;  3NAU A;  3ZQL A;  2L0K A;  3GTM J;  2OF7 A;  1U9O A;  2Y9Y A;  1HOM A;  1WGX A;  2LLK A;  3HOU J;  1RR7 A;  2K9Q A;  2LVS A;  1JUM A;  1MBG A;  4MFD A;  3OIO A;  1Q1V A;  3S2H J;  5IOY A;  1K83 J;  3GTQ J;  2M9H A;  5F27 A;  4QIW N;  3BT9 A;  4I76 A;  4A3G J;  2VUM J;  2L7Z A;  5GPC A;  1NK2 P;  1WPK A;  3JRG A;  1YRN B;  1MSE C;  2R5Y A;  2H1K A;  3BR1 A;  5M5Y J;  1X58 A;  1IV6 A;  4XIC A;  3B6A A;  1ETY A;  2Y30 A;  2NVT J;  3I4M J;  1D5Y A;  1HF0 A;  4AC0 A;  5J1R A;  2XB5 A;  3HBL A;  5K7Z A;  4I6Z A;  5F04 A;  3RKQ A;  2LTP A;  2XGC A;  2LD5 A;  5C44 J;  1OCT C;  2ECB A;  2PMZ N;  4DYQ A;  3GTJ J;  3K2A A;  4FE7 A;  3S16 J;  3E7L A;  4UUS A;  1MNM C;  1MH4 A;  1RKT A;  1HDD C;  4MIM A;  3GTK J;  4B3A A;  2X9D A;  3W6V A;  1IRZ A;  1POG A;  2GLO A;  3RZO J;  2YU9 J;  4A3J J;  2HQ5 A;  5JLW A;  2CUE A;  3I4N J;  4CYC B;  3K7A J;  2CJJ A;  4C3J J;  1BW5 A;  3Q3S A;  1ENH A;  4A3I J;  4XRS G;  1P7I A;  1E3O C;  3Q0V A;  2E2H J;  2K9S A;  1MBH A;  2NVY J;  3SDG A;  3BR0 A;  4Y7N J;  4A93 J;  1GV2 A;  1XS9 A;  3BR5 A;  2DA3 A;  2VI6 A;  2HI3 A;  1FJL A;  1IUF A;  3ZQH A;  1ZR4 A;  4L5E A;  1JUP A;  2CRG A;  3GTP J;  1XG1 A;  4A3L J;  3FK6 A;  1B8I A;  3ZQI A;  1RES A;  5FKM A;  1AU7 A;  2DTZ A;  5EG0 A;  3HOZ J;  2R93 J;  3TP0 A;  2IBD A;  3L1P A;  2N8G A;  1JJ6 C;  4W1U A;  1JT0 A;  3RZD J;  1S7E A;  2DA7 A;  2LKX A;  3S15 J;  1RKW A;  2VKV A;  3MKL A;  4BBR J;  2DA1 A;  2HDD A;  4XK4 A;  3WHB A;  4M3D A;  1ETK A;  2D5V A;  1ETW A;  4D7N A;  3LNQ A;  1WH5 A;  1SAN A;  1MBF A;  2ELK A;  5F0H A;  3HOX J;  2R5Y B;  1QVU A;  2NS7 A;  1JKR C;  3HM5 A;  3OOU A;  3MN2 A;  1UG2 A;  3LSP A;  2HYJ A;  2E2J J;  2O9L A;  3NAR A;  3JRI A;  2VKE A;  3CQZ J;  3CMY A;  2JA7 J;  5IP7 J;  1BA5 A;  2LY9 A;  4M3E A;  1GT0 C;  2ME0 A;  1RET A;  3M3Y J;  5E3N A;  3G1M A;  1TWF J;  1BL0 A;  2WB1 N;  4V2G A;  4V2F A;  2XGD A;  1Y1V J;  4DYC A;  1IJW C;  3S1Q J;  1U9N A;  2EZI A;  3PO2 J;  4Y52 J;  1JKQ C;  4AYB N;  2HOT A;  1SFO J;  4BY7 J;  4JYK A;  5EF6 A;  2B63 J;  1IDZ A;  2LR8 A;  1JKO C;  3PM1 A;  1I3Q J;  2JA6 J;  2FX0 A;  3HOV J;  3Q0U A;  4HNV A;  2JMW A;  1F36 A;  3QPL A;  4C3H J;  2Y9Z A;  5EGO A;  4UUS B;  5FLM J;  1MBJ A;  3JRB A;  3BTI A;  9ANT A;  2K9N A;  2DA5 A;  3IH3 A;  2HOA A;  3F0C A;  1QVT A;  1U78 A;  2LFB A;  3BTC A;  4JX5 A;  1Z77 A;  2P81 A;  1AKH B;  5M5W J;  2Y2Z A;  2HXO A;  2I10 A;  1GDT A;  1JUS A;  4DZJ A;  2ZB9 A;  1W0U A;  1B8I B;  5EZH A;  2JA5 J;  3IH2 A;  3BQZ A;  4C3I J;  4RBO A;  2G0E A;  2FJ1 A;  2H8R A;  3HOW J;  5EDN A;  2XSD C;  4BKX A;  3JRE A;  2DMP A;  2O7O A;  1IG7 A;  2MG4 A;  1O4X A;  1LFB A;  3SJM A;  4D5F A;  3HB9 A;  5E3O A;  3OSF A;  5M5X J;  1ETO A;  2R7Z J;  1ZKG A;  5FLV A;  1OFC X;  3H3V K;  5E3M A;  1ZQ3 P;  3HGG A;  2W48 A;  2Y31 A;  3ZQF A;  1JJ8 C;  4NDL A;  2R5Z A;  4M3F A;  1H89 C;  1APL C;  1DU6 A;  1Z0X A;  4A3D J;  3JRF A;  1WCM J;  2AO9 A;  1DU0 A;  4XID A;  1U8B A;  1PUF A;  1JTY A;  2DMT A;  2JJ7 A;  1IDY A;  1WI3 A;  5F08 A;  5J1Y A;  2Y0S N;  2JN6 A;  1I50 J;  4A3K J;  1TWH J;  2JWT A;  5E3L A;  2M2E A;  2R0Q C;  3BG5 A;  3JRC A;  3GBG A;  4A3B J;  2DJN A;  1GUU A;  4IHY A;  4JP0 A;  5C4J J;  3JR9 A;  2R92 J;  2CQX A;  5M3F J;  3PO3 J;  2DA6 A;  1FEX A;  2L9R A;  3S14 J;  1K61 A;  1OJL A;  5JLX A;  4DZP A;  4A3M J;  1VND A;  4UUT A;  5IYB J;  3LSJ A;  4JX6 A;  3UKG A;  2JA8 J;  1LFU P;  2WAQ N;  1ZR2 A;  4IHV A;  3GTO J;  3M4O J;  4W97 A;  4GFB A;  2XGE A;  2NOG A;  4DW6 A;  3OSG A;  2ME6 A;  5EG0 B;  1MSF C;  1TC3 C;  3CCY A;  1X2M A;  4XRS A;  3HDD A;  2AHQ A;  2M34 A;  1FIA A;  4C2M J;  4AUX A;  2KT0 A;  2NVQ J;  5K7F A;  2XPU A;  4FIS A;  3HEF A;  1PUF B;  3A01 A;  2CU7 A;  1ZTR A;  2E1O A;  2X6O A;  3JRH A;  1CQT A;  1UMQ A;  1NK3 P;  3S1R J;  2R5Z B;  2HXI A;  3LSR A;  5FKO A;  1IGN A;  4BBS J;  3BG9 A;  2XB0 X;  2TRT A;  3MVP A;  2ID3 A;  3WHC A;  4B1R A;  1P7J A;  1QRY A;  5M3M J;  1FIP A;  4A3E J;  3GTL J;  4BY1 J;  2QCO A;  1LE8 B;  4G12 A;  5F1J A;  2VPR A;  2XRL A;  3BR6 A;  3B6C A;  4FCY A;  4A69 C;  1W0T A;  2L7M P;  4XRM A;  4J19 A;  1JGG A;  1H88 C;  4S0H B;  2MSY A;  2ID6 A;  2EZH A;  1BW6 A;  5IP6 A;  3BR3 A;  3ZQG A; 
#chains in the Genus database with same CATH topology
 2P4W A;  1OCP A;  1SEU A;  2DN0 A;  1R7J A;  4U0W A;  4P9U A;  1JKP C;  5ICF A;  2M0C A;  2KIM A;  2MFZ A;  1AHD P;  2HOS A;  2GBY A;  3DPL C;  3GVA A;  1VQ4 I;  2O8K A;  2V1D A;  3IV5 A;  3QU6 A;  4DOZ A;  3A4C A;  1MH3 A;  1A6I A;  1A04 A;  4A0X A;  3WTU C;  4C2U A;  1MMS A;  2LDU A;  4MTE A;  5J3L A;  2RDP A;  2GA2 A;  1G2H A;  2CUZ A;  3PUB A;  1ZYR F;  5ILS A;  4XN3 A;  4Y3O A;  3DPU A;  1XDU A;  2RVC A;  1V3F A;  3WG9 A;  5K7H A;  2GWR A;  2EFN A;  2LY1 A;  4LLL A;  2V9P A;  2ZME B;  3BQY A;  1X19 A;  4DYR A;  4PUS A;  2RAE A;  5TIS C;  2LY2 A;  1V4R A;  5DCM B;  4BJ5 C;  3CLQ A;  1R6R A;  1U6G A;  3V4G A;  3QOD A;  1VQ7 I;  5EJC A;  2GOM A;  2O0Y A;  1TWG J;  4U88 A;  5IPA A;  2PJP A;  4JX4 A;  2CV1 A;  3BJO A;  4BAY A;  3ABK H;  1JT6 A;  3TED A;  1KGS A;  2X1C A;  4EJU A;  2E2I J;  3ZQC A;  4E7K A;  4HX8 A;  1UHS A;  2RQQ A;  3CME I;  3OYF A;  1OCC H;  4JK1 X;  3ZOB A;  1FMW A;  4PGG A;  4IQ4 A;  3HRT A;  4QWQ A;  5D4R A;  2DQR A;  1P4X A;  5ICE A;  2CSO A;  3MFK A;  4A0Z A;  2R7Q A;  4DNC A;  2DJI A;  4BJ6 C;  2JPC A;  3KYC B;  3HHG A;  2VJI A;  2TCT A;  1ETX A;  3KZI C;  4XKC A;  2D45 A;  1JHH A;  4YFX F;  3S17 J;  2DFF A;  5E17 F;  2FOW A;  4OIR F;  4YRV A;  3GTG J;  2X48 A;  5H20 A;  3BJA A;  1WJF A;  4D7M A;  3PSI A;  4QTR A;  3GWZ A;  2EV0 A;  2HTS A;  2A69 F;  5DTD A;  1IXC A;  2QUF A;  3ABT A;  4L5J A;  2OZ6 A;  4MEX F;  4UB8 C;  3JRA A;  2IXS A;  3TDZ C;  3J7A O;  1R36 A;  1S29 A;  2K5C A;  1NTC A;  2OUM A;  3HKZ N;  5IY5 H;  3TW6 A;  2EIK H;  1W5T A;  3R6S A;  1PP7 U;  5FD5 A;  2DA4 A;  1IUY A;  3K6G A;  4BHB A;  3HPG A;  3EUH C;  4J01 A;  1XMA A;  2A6E F;  3J7Z I;  4RA2 A;  3V42 A;  2IAI A;  1P4W A;  2PG4 A;  3L2R A;  3OR2 C;  2GA1 A;  2ZXI A;  2L54 A;  4XOT A;  4ZYG A;  1TW3 A;  2W7N A;  1TLH B;  3SEZ A;  3I0T A;  3JTH A;  2CQK A;  3J80 Z;  2YX7 A;  2L7F P;  3FIW A;  3FKI J;  1F43 A;  1O3S A;  3E3V A;  3S1M J;  2K4B A;  3RI4 A;  1YRN A;  3CUQ A;  1KYZ A;  1LEA A;  4M6V A;  2P6T A;  3G1L A;  3BTL A;  3OYE A;  4ESF A;  2XAG A;  3A01 B;  4L9T A;  4UV8 A;  4U0Y A;  1HLV A;  3NAU A;  3ZQL A;  3H5R A;  3DEU A;  2L0K A;  4HX7 A;  3GTM J;  2KRH A;  2PMH A;  4Q48 A;  2G7U A;  1HOM A;  3U1K A;  1N75 A;  1T39 A;  1D0X A;  2VJJ A;  1J9I A;  3FXM A;  2HKX A;  2XRO A;  2J5P A;  4G94 A;  4RM3 A;  4KA4 A;  4LG3 A;  2IVM A;  3C1D A;  2CQ7 A;  3NWS A;  3P9K A;  2VUM J;  3K2Z A;  3CCQ I;  1V5E A;  4A5M A;  2VN2 A;  2R5Y A;  1RIO H;  5GTI C;  2V6E A;  2BZT A;  2DOF A;  3W2V A;  1VZ0 A;  4XIC A;  1BC8 C;  3K4C A;  3ZMV A;  4BE1 A;  3K4B A;  1QZE A;  4BXF A;  2XB5 A;  1R23 A;  3HBL A;  4PSX A;  2M8E A;  2O61 A;  4B3X A;  2L7K A;  5K7Z A;  2DOD A;  3RKQ A;  2FU4 A;  1VQK I;  2LTP A;  2XGC A;  3S3O A;  2GOX B;  4DYQ A;  2O6G E;  3BJ6 A;  2DFH A;  4FE7 A;  2CFO A;  2BW3 A;  1IN6 A;  3GFJ A;  2XKP A;  1MH4 A;  2PMU A;  2ZO4 A;  4MQ9 F;  1T6S A;  2HVR A;  2UUZ A;  4B3A A;  5IT9 Z;  2LH9 A;  1IRZ A;  1QA6 A;  1POG A;  2F4M B;  1IW7 F;  3RZO J;  2YU9 J;  2RNJ A;  4A3J J;  2HQ5 A;  1G3S A;  2QQ8 A;  2CUE A;  4YIF A;  2IGO A;  3I4N J;  4CYC B;  2XF7 A;  4C3J J;  4M6X A;  1ZEL A;  5LFA A;  3IKV A;  2MC3 A;  4FX4 A;  2ZKZ A;  1R5I D;  1DUX C;  3SDG A;  3KP7 A;  1I3A A;  2NVU B;  1I5Z A;  2DA3 A;  3JCU C;  3T8R A;  2AQF A;  2VI6 A;  2HI3 A;  3ZQH A;  2BXY A;  1JUP A;  3P7N A;  3OYL A;  3ASN H;  1WJB A;  2JSC A;  1X3Z B;  2LBF B;  3NWT A;  2VC1 A;  2RN7 A;  3T5X A;  4G8X A;  1WKM A;  2K3F A;  2WA0 A;  5D6E A;  2P5K A;  3H36 A;  2JVG A;  2DDA A;  5E1X A;  3OYA A;  2ZNZ A;  3GEZ A;  2GXB A;  3COA C;  2HPI A;  1W1W E;  3UR3 C;  3I4P A;  3RCO A;  3ECO A;  3JW4 A;  5CQG A;  1S5L C;  3CJN A;  2FXA A;  1JJ6 C;  2V1X A;  1JGS A;  3H9Q A;  4W1U A;  3O6B B;  3FXJ A;  3H9G A;  4AVP A;  2DA7 A;  3ZRG A;  4O6J A;  4ITV A;  4KIT B;  1NG7 A;  2R7F A;  3SYT A;  3WG7 H;  5CPR B;  4IOC F;  4I0A A;  1N25 A;  2YPR A;  1YHQ I;  3HUG B;  2HDD A;  3I5U A;  5K5R A;  5EEG A;  1R5G A;  2R7X A;  2D5V A;  3LNQ A;  2IS2 A;  2FOK A;  3RTR A;  2Y69 H;  4Y4R A;  3HOX J;  4Q5S F;  4IRH A;  3WTW C;  2R5Y B;  3FMQ A;  4HA8 A;  1J75 A;  1QVU A;  2I8D A;  2K27 A;  1YS7 A;  2HDW A;  3HM5 A;  3MZ8 A;  4P96 A;  2D2W A;  2Z3Y A;  1SFX A;  1YTY A;  3RKY A;  2WB1 A;  3NAR A;  2ZBK A;  4QPO A;  3CMY A;  2FNA A;  3K1M A;  4HLY A;  4XKV A;  1YO5 C;  1BA5 A;  2LY9 A;  3CCR I;  2Y48 A;  4EAT A;  5H6R A;  5FO5 A;  3DWL E;  3M3Y J;  4EM1 A;  5E3N A;  3G1M A;  1FT9 A;  4A6D A;  2WTE A;  2K86 A;  5F64 A;  4AM3 A;  1BOB A;  3S3M A;  1U5T C;  3PO2 J;  3SZT A;  4AYB N;  1OR7 C;  3JTG A;  4BY7 J;  1TL8 A;  2H6B A;  1BR2 A;  1GHC A;  2BY0 A;  1WJE A;  2HU9 A;  3GME A;  1IDZ A;  1JKO C;  2DW4 A;  5K1Y A;  5LHI A;  3DLL F;  4LG0 B;  3F8N A;  4CIC A;  3OYI A;  2DQL A;  3E1S A;  2FX0 A;  2STT A;  4LMY A;  5EEH A;  1Y39 A;  3CJR B;  2VON A;  1BI2 A;  1SD5 A;  5EGO A;  4I99 C;  4XLC A;  4AID A;  1MBJ A;  4KIC A;  4RAZ A;  1XD7 A;  2X4H A;  5HS9 A;  1EKE A;  1FY7 A;  1S8N A;  3K10 A;  1MMN A;  1Z77 A;  4GXO A;  1LVK A;  5B66 C;  2EB7 A;  2M5W A;  2GXG A;  2Z33 A;  4RB2 C;  4XSZ F;  3I56 I;  3RQ4 A;  3CCM I;  2Z16 A;  3T1B A;  5CKT A;  1W0U A;  1IN5 A;  1HC8 A;  2LBF A;  1BOA A;  4G7H F;  2VOD A;  3IH2 A;  4C3I J;  2CS3 A;  2OBP A;  3FDY A;  2F2E A;  2G0E A;  2E60 A;  3SZP A;  2FJ1 A;  3GLX A;  4RGS A;  3JRE A;  2DMP A;  1IG7 A;  1YS6 A;  1ERD A;  1VQL I;  1YE9 A;  2ZJP F;  1L3L A;  4D5F A;  3HB9 A;  3PNV A;  4RLQ A;  3TGN A;  5M5X J;  2R7Z J;  5DV5 A;  4IXA A;  1PUE E;  1ZKG A;  2QBY A;  1OFC X;  5E3M A;  2OTJ I;  3HGG A;  1FYL A;  1IO2 A;  3KYL A;  1RUO A;  2Y31 A;  2Z9O A;  4NDL A;  1D5V A;  3A2K A;  2XAU A;  3QOP A;  2CV0 A;  2VXD A;  1Z0X A;  2YR2 A;  1HBX G;  5JFR A;  4Z6Y A;  4M9S A;  3FHZ A;  1WZ2 A;  1U8B A;  1F5T A;  1U2W A;  1JTY A;  4HRI A;  2JJ7 A;  3CUQ C;  4PJN A;  1EA3 A;  2YX4 A;  1DDN A;  2Y0S N;  4QPQ A;  3K69 A;  4IHS A;  3BG5 A;  3JRC A;  5BMZ A;  4N9H A;  4A3B J;  4CZZ A;  1GUU A;  3QWL A;  4AIK A;  4JP0 A;  1OYW A;  3JR9 A;  2CQX A;  2HWV A;  3ZMT A;  3I59 B;  1K61 A;  2OC6 A;  1OJL A;  4DZP A;  1W36 C;  1WRJ A;  2KZV A;  1J5Y A;  3DEE A;  3DBH B;  4HX4 A;  4ZH4 F;  1KU3 A;  2IP2 A;  5J4V A;  2PJR B;  3LSJ A;  3ONQ A;  3J7A Y;  3HHH A;  2LSO A;  3IRR A;  2PMZ A;  1E2X A;  4XLE A;  2W82 A;  1EH8 A;  2CQN A;  3BZC A;  1YYV A;  3K1P A;  4BE0 A;  4HEA 2;  3BWG A;  4DW6 A;  3FXO A;  1XSV A;  2R7V A;  1MSF C;  1X2M A;  2DT5 A;  4GRI A;  1Z91 A;  2M34 A;  2RV8 A;  3DKW A;  1OPC A;  4II3 A;  2DO7 A;  5CYV A;  2LRE A;  2BVL A;  3ISP A;  3MWM A;  2EIJ H;  3LA3 A;  3EYI A;  4BEH A;  2X6W A;  3K0L A;  3NQO A;  3A01 A;  3OY9 A;  2CU7 A;  2V1U A;  1R22 A;  1VQP I;  3F9K A;  3LSR A;  1HA8 A;  1B9N A;  2RNG A;  1ZGA A;  5FKO A;  2VQC A;  3UNG C;  3HPH A;  1HW2 A;  2BVM A;  1IGN A;  4RAF A;  3S3N A;  2STW A;  1T38 A;  2OZU A;  3MQ0 A;  1HKT A;  1XB4 A;  4OIP F;  2A6H F;  4G12 A;  4RB3 C;  3U2R A;  2VPR A;  3I53 A;  2GQQ A;  2V9V A;  4OU0 A;  1QGP A;  1N77 A;  2KLO A;  3KP6 A;  4S0H B;  1X1A A;  4I01 A;  3U21 A;  2M4G A;  2FSW A;  5IT3 A;  1FYM A;  2F5E A;  3K4M A;  1TQM A;  5C44 J;  2CUF A;  4IRI A;  2DK5 A;  2P7V B;  2CQQ A;  4XR6 A;  3I9V 2;  3FM3 A;  4MTD A;  1E0E A;  2YUS A;  5E79 C;  1YX5 A;  4BQO A;  4G7Z F;  1D1A A;  2JQ7 A;  2EJR A;  2KRF A;  3G3Z A;  3H3U A;  1WJA A;  1Y0N A;  1I1G A;  5C3E J;  3QPH A;  1ZHF A;  1A36 A;  4WCG A;  2NS8 A;  3GX4 X;  4HLX A;  2LP0 A;  3G6E I;  3QYB A;  1YJN I;  2EIN H;  2WC2 A;  3F3X A;  4UHT A;  2W4S A;  3HGY A;  4L5I A;  5IP9 J;  5B3S H;  1Y1W J;  3NRV A;  2MH2 A;  3HOY J;  2PQ8 A;  2P5V A;  4ZZD A;  1ONV A;  3M07 A;  1A5J A;  5E20 A;  2FNP A;  2L9S A;  2VB6 A;  4BHC A;  5B5E C;  1OQY A;  1YLF A;  2ZFU A;  3HTS B;  2E19 A;  4NC7 A;  3D5R C;  5FKN A;  1IAW A;  1O7L A;  1GVD A;  1G3T A;  4X0G A;  4RB0 A;  2L5Q A;  4U0V A;  1MGT A;  4D5C A;  5ILV A;  1LPQ A;  4YFN F;  1IZ1 A;  1XMX A;  2QQA A;  4M74 A;  1FNN A;  5J8F A;  1J7K A;  3JAM Z;  2JTV A;  4IEJ A;  4DBR A;  5FKK A;  2BEO A;  2FUG 2;  2ELH A;  2E7W A;  3FK7 A;  4RMN A;  3LAJ A;  3BR2 A;  3OYB A;  1KYW A;  4MO7 A;  3GYH X;  4IHW A;  4HW0 A;  5HOO A;  1I6H J;  1S72 I;  2F5F A;  2WAQ A;  2D1V A;  2F5V A;  1KA8 A;  2H1L A;  1ZG5 A;  2M0M A;  1W4M A;  3KZZ A;  4F93 B;  2DMU A;  2WWY A;  2KIF A;  3PQK A;  5BOX A;  3CCJ I;  3BG3 A;  1G8X A;  1Y8R B;  2GZW A;  1GXP A;  1SAU A;  2XPV A;  2DMN A;  3E97 A;  5ICG A;  1Z6R A;  2CV2 A;  5F0C A;  2EBI A;  3O8H A;  2ZJQ F;  2BYV E;  2K40 A;  4BQA A;  4R8H A;  4A2U A;  5J6X A;  2XDV A;  1T95 A;  2VT3 A;  3KEY A;  2VLA A;  1T56 A;  3LOC A;  2BY1 A;  2ZSI B;  5L3F A;  3ZP5 A;  1XSX A;  3OYN A;  3CP8 A;  2ADU A;  2CFX A;  4V19 K;  1B9M A;  5D8K B;  5K5O A;  3FM5 A;  1B72 B;  2LG4 A;  1IN8 A;  3CD6 I;  4BQQ A;  2UWM A;  1HW5 A;  3T0Y A;  4BXX J;  2L9N A;  4ABZ A;  1QPI A;  3JAM K;  3TW7 A;  3DKY A;  1XGO A;  1VTN C;  1YFH A;  2XPW A;  5HVQ C;  1U0J A;  5EEA A;  3E6M A;  1W7P A;  2WV1 A;  1MBE A;  3PNY A;  4CGZ A;  4ZDO A;  3DPT A;  1S3J A;  1RPW A;  1U5T B;  4ZDP A;  1AOY A;  2ISY A;  1STZ A;  1D0Y A;  3ASO H;  2R7D A;  2LF7 A;  3HTU A;  5DYM A;  2F4I A;  3M9A A;  4NB5 A;  1SD6 A;  4HG2 A;  1SVO A;  1RRJ A;  1TNS A;  2IGK A;  1KQ9 A;  5KHD A;  1U9O A;  2DT7 B;  1FP2 A;  2NRA C;  3F8F A;  1FSH A;  4WX9 A;  2EA4 A;  3RSN A;  2WAF A;  2LVS A;  5BQT A;  1H0M A;  1JUM A;  5JHF A;  5J47 A;  4XON A;  4MFD A;  1UJ8 A;  1Q1V A;  3CCL I;  5IOY A;  3FZV A;  3RDI A;  4CCM A;  1L0O C;  2VKD A;  4QIW N;  4CCO A;  5IT9 K;  5F6F A;  3RPU A;  2L7Z A;  4I2O A;  3CUQ B;  3P9I A;  1YRN B;  4B43 A;  3ZQQ A;  2E36 A;  2XVC A;  3RKX A;  1W5C C;  4HNT A;  3B6A A;  3D5S C;  1ETY A;  1EJ9 A;  1ZRD A;  1MD0 A;  4AIJ A;  1D5Y A;  4KDP A;  2EFO A;  2DFE A;  4AC0 A;  4F7Z A;  4ASN A;  3DXJ F;  3HOS A;  2BY2 A;  1IXR C;  2VQG A;  4N4O B;  5L3E A;  3QP5 A;  5F04 A;  5ILU A;  2LD5 A;  1CGP A;  1OCT C;  1MMG A;  2PMZ N;  5LEK A;  3GO5 A;  2Q2E B;  3K2A A;  3S16 J;  2JA2 A;  1ZRF A;  4BDY A;  3CZ6 A;  4UUS A;  1RZ4 A;  1MMA A;  2VPL A;  1XPX A;  4KN7 X;  2HNH A;  3W6V A;  3H1C A;  4I0B A;  5JLW A;  3FBN B;  3M7G A;  3I71 A;  3K7A J;  4XLN F;  4EMS A;  1BW5 A;  4P1W A;  4ZZL A;  1BR4 A;  4LJZ F;  4NQW A;  4PFO A;  5CLS A;  4XSX F;  5J4Y A;  2CW0 F;  2Q8K A;  4E7H A;  1RI7 A;  3E5X A;  3J7Y J;  2E5Z A;  3KYD B;  1B6A A;  4GGG A;  3HSE A;  4NQW B;  5E1Z B;  3CDH A;  2XAQ A;  3BR0 A;  4Y7N J;  4CSW A;  1GV2 A;  1FBQ A;  2E71 A;  3K4J A;  2GXA A;  3R60 A;  4OAZ A;  4L5E A;  1OCR H;  1LDJ A;  2VXZ A;  2BXZ A;  2X85 A;  1FSE A;  1E17 A;  3K9T A;  2LMD A;  3JSP A;  2FBH A;  4BDZ A;  5CQE A;  3CF5 F;  5KCM A;  3CES A;  2NXN B;  2IS1 A;  5EG0 A;  2HQA A;  3DV8 A;  1JHF A;  4GYG A;  2EV6 A;  2NOJ B;  5FFZ A;  3CMM A;  2IBD A;  1I6X A;  3TOB A;  1O3R A;  4YEJ A;  4I98 B;  5JI6 A;  2ISZ A;  1JT0 A;  2XSJ C;  1RUN A;  4BL0 B;  5HLH A;  3GFI A;  1LB2 A;  1Z7U A;  3BPX A;  3R4K A;  3MKL A;  5FGM A;  3L09 A;  3KEQ A;  3WHB A;  4ON0 A;  1XCB A;  3QOE A;  4M3D A;  4E7J A;  2Z99 A;  2VKH A;  3OL3 A;  3TO9 A;  4XOR A;  2F4O B;  1SFK A;  1LJ9 A;  1Y56 A;  1JKR C;  3GLL A;  2YSR A;  3LSP A;  1UG2 A;  2XC7 A;  2HYJ A;  4E7Z A;  4XKB A;  3E6D A;  2VKE A;  4CCN A;  4K2E A;  1F9N A;  4XLH A;  2JA7 J;  5J8C A;  4M3E A;  4BUP A;  3FXL A;  1FZP B;  1GT0 C;  2CWE A;  1RET A;  5H2F C;  1TNT A;  1TWF J;  5L3C A;  1BL0 A;  3S1Q J;  1UCR A;  1IJW C;  5KAI C;  1U9N A;  2EA2 A;  3HKZ A;  3KP4 A;  2ESN A;  2HOT A;  4U7D A;  1FOW A;  1FP1 D;  5BS6 A;  5EF6 A;  3QU3 A;  4ZTJ A;  2K9M A;  2KQR A;  3V8K A;  1XTA A;  3KCC A;  1I3Q J;  5FB2 A;  1I27 A;  4RGR A;  3JSO A;  1D8K A;  1ON2 A;  4KYW A;  5LHG A;  3Q0U A;  2QEN A;  4I09 A;  3J81 Z;  2WV0 A;  4M71 A;  5CVI A;  5FLM J;  9ANT A;  1B59 A;  2K9N A;  2QWW A;  3E6B A;  4F91 B;  5HLT A;  3MKY B;  1U78 A;  3G71 I;  3HJE A;  3BTC A;  2HVQ A;  2QGU A;  5FRN A;  4F92 B;  4JX5 A;  2EFP A;  1X3U A;  1D8J A;  2HXO A;  2I10 A;  3E0J B;  2ZME C;  4M73 A;  1QQI A;  3A0H C;  3LQR A;  1MDM A;  4S05 A;  4RBO A;  2V1N A;  4IPA A;  4CUG A;  3BG6 A;  5DEQ A;  5EDN A;  2XSD C;  1Z3Y A;  4BYY A;  4YG2 F;  1O4X A;  1LFB A;  3U1D A;  2FQ3 A;  2QQB A;  4F3Q A;  1TT0 A;  1GVJ A;  3SJM A;  2CUJ A;  3OSF A;  1MMD A;  3AG4 H;  2ZSH B;  1Z3X A;  3CCE I;  4KMF A;  1K7A A;  2DAO A;  1X3W B;  3GF2 A;  5GAG J;  1OCZ H;  5FLV A;  3H3V K;  1ZQ3 P;  4G6T B;  3K4N A;  2KIQ A;  2WAD A;  1QO0 D;  2W48 A;  2M3A A;  3PQJ A;  1JJ8 C;  1UB9 A;  3FHN A;  4M3F A;  4AIH A;  2BBY A;  1WJ5 A;  1FPQ A;  3GW2 A;  3C2H A;  4LFU A;  2EFW A;  3CUO A;  1LNW A;  2VJ4 A;  3DKX A;  3I54 A;  1K4S A;  1WCM J;  1BIB A;  2AO9 A;  1MNE A;  1DU0 A;  1PJR A;  3IWF A;  4C2T A;  2DMT A;  2W1O A;  3KP3 A;  3F8B A;  1DGR M;  5F08 A;  2JPB A;  1KON A;  3KFW X;  2M2E A;  5CVU A;  1D1C A;  3P5J A;  3W3C A;  3VEP A;  4IHY A;  4IKF A;  2DA6 A;  3S14 J;  2JVH A;  3IKT A;  5JLX A;  1VND A;  5CVJ A;  4HDV A;  5IYB J;  4HZF A;  1V5F A;  2K7L A;  3F22 A;  2MH9 A;  2QSF X;  1W7P B;  2WAQ N;  1UZC A;  2TDX A;  3OYJ A;  4WXD A;  3H0D A;  3DP7 A;  3HSF A;  4GO1 A;  4CYD A;  4HF1 A;  5HDK A;  2VE8 A;  2E7X A;  3OSG A;  3RPQ A;  4OIQ F;  1RNL A;  4EGZ A;  4KT6 A;  2CG4 A;  3V7S A;  5AIP A;  4U87 A;  4C2M J;  1UG0 A;  1C0W A;  4AUX A;  3ULQ B;  3OMY A;  4WWC A;  1HSJ A;  1OYI A;  3J81 K;  2F5D A;  4P5O A;  4FAS D;  4OMY A;  4FIS A;  5L3G A;  1TTY A;  1LVA A;  1WQ2 A;  2X6O A;  1IRX A;  3AG2 H;  3VYS B;  4E4H A;  3G73 A;  1R5H A;  1CQT A;  1UMQ A;  1G4D A;  1DP3 A;  3HYI A;  1J2X A;  2RC4 A;  3HG9 A;  4UV9 A;  3IWZ A;  5JR3 A;  2KIS A;  3BC8 A;  3BG9 A;  4BBS J;  2XB0 X;  2TRT A;  4XQF A;  3KET A;  1P7J A;  2MD5 A;  4BS9 A;  4E70 A;  3MKW B;  3OS2 A;  1LE8 B;  2X1D A;  5F1J A;  1VQN I;  2H6C A;  3BR6 A;  4FCY A;  1R4N B;  1VQO I;  5D6F A;  2IRF G;  4XRM A;  4J19 A;  1WJC A;  1V5G A;  2ETH A;  4FQG A;  3K1N A;  5HS8 A;  4KFC A;  1UFM A;  3TMO A;  2ID6 A;  3MEX A;  5HLI A;  4RAG A;  1VQM I;  1MW7 A;  3GCM A;  5DUK A;  2QVO A;  1BW6 A;  1U3E M;  3CTA A;  3BR3 A;  3ZQG A;  4B8X A;  4UUS B;  3S2D J;  1EV7 A;  2LKS A;  1EH7 A;  1J59 A;  1AKH A;  1G3W A;  2K3P A;  1ULY A;  1MBK A;  1ACI A;  3HRS A;  2ACJ A;  2IT0 A;  4X6A J;  3H0G J;  2QF7 A;  1HKS A;  3A03 A;  3L7W A;  2R7T A;  3LSG A;  2DK8 A;  2FML A;  2GM4 A;  1GV5 A;  1XC5 A;  2V9K A;  2L01 A;  4DJA A;  3QPS A;  4B4C A;  1X1D A;  4JOM A;  3Q9S A;  4ZYE A;  2DT6 A;  4H0E A;  1YW9 A;  2BGC A;  4HST A;  2DYR H;  5BNG A;  5LGU A;  3HSR A;  2P7C B;  4LOC A;  1HW1 A;  1H9T A;  1M1E B;  3LSH A;  3REO A;  1K79 A;  5HLG A;  4XLF A;  3WU1 B;  1K6O A;  1FTZ A;  3SFI A;  3SDB A;  5DS9 A;  3GUD A;  1SAX A;  4UVC A;  5F0F A;  2BV6 A;  2P6S A;  3ZQ7 A;  5L3D A;  2NVX J;  4II2 A;  4L0Z B;  2EZL A;  3LSM A;  3HL2 A;  2FD5 A;  3CP2 A;  1BI3 A;  1OMI A;  1O7F A;  4ZTF A;  3DEW A;  1ZAR A;  2WY7 Q;  2Z5U A;  1ZLK A;  4IF4 A;  1HKQ A;  2OTL I;  1IRF A;  1ETQ A;  1ZG3 A;  3JRD A;  4PZJ A;  1ZG1 A;  4I02 A;  3EET A;  1ODD A;  2EIM H;  3ZN1 A;  4AWX B;  3TP3 A;  3S1N J;  2EIL H;  3BTJ A;  5C4X J;  1TP4 A;  2MD0 A;  4FE4 A;  4ZYD A;  2KL4 A;  1VF9 A;  4U7B A;  4A3F J;  1B72 A;  4MNU A;  3QYE A;  2MGQ A;  1ZGW A;  1A35 A;  3AL0 B;  1OR7 A;  4XRF A;  1XGS A;  2E1M B;  2E1N A;  2RGV A;  4MQV A;  2IGN A;  2FMY A;  4MLO A;  3DU5 A;  3IH4 A;  5FKL A;  3K70 C;  1IN4 A;  2EWN A;  3DTK A;  1ORK A;  5EZG A;  4KIG A;  1HDP A;  2FQ4 A;  1X4P A;  2X6X A;  3I55 I;  1USS A;  2YS9 A;  2R7R A;  1R4M B;  1LQ1 A;  4FET A;  2VQL A;  3E6C C;  4A3C J;  4RGX A;  1CF7 B;  1LEB A;  4G7O F;  2PLY A;  2QSH X;  2B7E A;  3WTX C;  3LAP A;  4XBF A;  4B48 A;  2X0L A;  2XV4 S;  4CCK A;  2P0W A;  5IOZ A;  1IC8 A;  4XM3 A;  3A02 A;  1YQA A;  3BCB A;  2HQN A;  2XAH A;  2HDC A;  2UXX A;  1S7O A;  2WAE A;  4E7L A;  3R61 A;  1WH7 A;  4B09 A;  4P55 A;  1ITY A;  1A31 A;  2FE3 A;  5L3B A;  1QNT A;  2W24 A;  1ZK8 A;  4UVA A;  4HF2 A;  2Y0S A;  2ESH A;  2KDZ A;  3OYM A;  3EUA A;  1P4A A;  2M30 A;  2VT2 A;  3VDX A;  3W2A A;  2V26 A;  2BHY A;  2GIZ A;  3G1O A;  4OOI A;  3WOD F;  3OS0 A;  1VFC A;  3D5L A;  5B1B H;  4A12 A;  4E6K G;  2LKP A;  2UZK A;  1SVL A;  2MC4 A;  2KFD A;  2OQG A;  4N9I A;  2VIX A;  2OF7 A;  3X2Q H;  2CW7 A;  3FXK A;  2DDB A;  4H4K C;  4EJT A;  4LB6 B;  2DBB A;  2KHM A;  1WGX A;  4RM2 A;  1X1C A;  4RLF A;  3HOU J;  1RR7 A;  2PX9 A;  4OIN F;  5LD2 C;  1XX5 A;  5AON A;  1K83 J;  1UEL B;  3ZXS A;  2OU2 A;  4DIQ A;  4D0P A;  3L2V A;  4HDU A;  3ZPL A;  1Y8Q B;  1NK2 P;  5H6Q A;  1WPK A;  4AVZ A;  2OA4 A;  1R1V A;  5M5Y J;  1X58 A;  1B1B A;  1YIJ I;  3A0B C;  2NVT J;  4ENN A;  3I4M J;  1HF0 A;  3F23 A;  3RYR A;  3CC7 I;  1A6Q A;  5J1R A;  1UST A;  1XN7 A;  3LA7 A;  3DTE A;  2DI3 A;  4F52 A;  2HR3 A;  2XKO A;  3D0S A;  2QM3 A;  4I6Z A;  3V8L A;  3VSL A;  1K78 A;  2DPU A;  1QZZ A;  3GTJ J;  3VYT B;  3Q5F A;  3I58 A;  2CH0 A;  2A6T A;  1SD7 A;  3TOA A;  1MNM C;  1RKT A;  4MIM A;  5FD6 A;  3F21 A;  3W6J B;  2IA2 A;  4A5N A;  3BOQ A;  3OOP A;  2X9D A;  1HXD A;  5GAH J;  1KQ8 A;  4R79 A;  3PIP F;  1UHM A;  2GLO A;  3RPU D;  1P92 A;  4UUV A;  1MJB A;  5KVR A;  4JBA A;  1XDS A;  4XMY A;  1PDN C;  3HRU A;  3Q3S A;  2R3S A;  2VL8 A;  3R0A A;  3AG1 H;  4XRS G;  1E3O C;  3Q0V A;  2E2H J;  2V4J C;  2MLK A;  1MBH A;  2G9W A;  2NVY J;  1OKR A;  5HDG A;  3TO7 A;  4D9J A;  1XS9 A;  2QLZ A;  3FF5 A;  4GDF A;  3BR5 A;  3B73 A;  1Z05 A;  2BY3 A;  4NNJ A;  3PFY A;  1FJL A;  3BLY A;  1IUF A;  1ZR4 A;  5FFX A;  5DUI A;  3GTP J;  2XAS A;  3LMM A;  2JT1 A;  5B1A H;  2HOE A;  1XG1 A;  4A3L J;  1FC3 A;  1DQU A;  5KNL A;  2HYG D;  1B8I A;  3SEQ A;  3O3K A;  3ZQI A;  4BJT A;  1W7P D;  2XAJ A;  3IL2 A;  5FKM A;  3OS1 A;  2K4J A;  3HXL A;  1YI2 I;  2QSG X;  2AQE A;  3TL4 X;  3TQN A;  3BZ6 A;  4WXH A;  2QA4 I;  2QKM B;  3AG3 H;  2DCE A;  1MIJ A;  3C2G A;  5KK1 A;  5GAE J;  2ZXW H;  4FX0 A;  1FX7 A;  2N8G A;  4J00 A;  4BGD A;  3L2C A;  5K5Q A;  1S7E A;  3WE3 A;  4EM0 B;  4AU7 A;  3M8F A;  2LKX A;  2E5N A;  4LGW A;  2PJR A;  2GIV A;  1K78 B;  2UV1 A;  4M9X A;  4DQ2 A;  2ZC2 A;  1XGN A;  2HVS A;  3EDP A;  4XN0 A;  1T08 B;  2COM A;  1SFE A;  1XSD A;  1ETK A;  1I39 A;  2EK5 A;  4WF2 A;  4CDG A;  4D7N A;  4AD9 A;  1E3P A;  2LNB A;  3DU6 A;  3GFL A;  2ELK A;  1REP C;  5F0H A;  4XKW A;  4BHP A;  2LF8 A;  3T8T A;  2NS7 A;  4HQE A;  4MEY F;  4RGU A;  3OOU A;  3MN2 A;  5D8L B;  1VQ5 I;  3I59 A;  5CVV A;  2E2J J;  2O9L A;  3R0J A;  5BPI A;  2FF4 A;  5IP7 J;  2HTJ A;  5A2Q Z;  3L2W A;  2E1M C;  2ME0 A;  2ICW G;  4HAM A;  1O3Q A;  3AL0 C;  2R7U A;  1W5S A;  2Q0O A;  3AAF A;  3BPV A;  2QBY B;  2IW5 A;  4E7S A;  3FMR A;  1K4T A;  3PNT A;  1IF1 A;  4HV6 A;  4LK0 F;  4A6E A;  3H9J A;  1Y0U A;  2EV5 A;  2B63 J;  3VYU B;  2LR8 A;  3QYF A;  4PJJ A;  1Q1H A;  3WTY C;  4BXU A;  1KU9 A;  1LKX A;  4PJ0 C;  3LFK A;  2QEX I;  2UXN A;  2B0L A;  3ZMU A;  3HOV J;  4HNV A;  3K4L A;  1QZY A;  3QPL A;  3GFM A;  4C3H J;  3GZ6 A;  1ZRE A;  3OR1 C;  1AA7 A;  4G9Y A;  4ESB A;  1I1S A;  2DA5 A;  3IH3 A;  3LL7 A;  3CC4 I;  3VWB A;  3ZCO A;  4LK1 F;  4IQJ A;  1ZGJ A;  2NYX A;  3HIF A;  2P81 A;  1AKH B;  1WWX A;  5M5W J;  2Y2Z A;  2GAU A;  2WBM A;  3EUH A;  1GDT A;  1G59 A;  1JUS A;  4DZJ A;  1R00 A;  2L2O A;  2ZB9 A;  3J80 K;  1B8I B;  2IS6 A;  2JA5 J;  3PJR A;  1T98 A;  2BW3 B;  3VSK A;  2Q2E A;  3TDU C;  1YJW I;  3HOW J;  3K70 D;  4IX7 A;  4EM2 A;  3MCZ A;  2VBW A;  2O7O A;  2OD5 A;  3IUO A;  2NS0 A;  5F1R A;  1Z67 A;  5E3O A;  1JI8 A;  2H27 A;  1RC9 A;  1ETO A;  3L9F A;  4EVI A;  2LRD A;  3F72 A;  3LSK A;  3ZQF A;  3SHF A;  3C18 A;  2DOE A;  1APL C;  1Z6T A;  2H94 A;  3ABM H;  1Y6I A;  1FOX A;  3DTI A;  2K02 A;  2L3D A;  2P5L C;  3F8M A;  2AXT C;  2E1C A;  2M7B A;  5JVG F;  1B4A A;  5J1Y A;  2JN6 A;  2JWT A;  5FLX Z;  3OYD A;  5GAD J;  4Y15 A;  4NC6 A;  5E3L A;  2W00 A;  3MD2 A;  3SXY A;  2R0Q C;  1SVM A;  3MAJ A;  3GBG A;  1O57 A;  3ESW B;  2DJN A;  5FRM A;  4L18 B;  2JUG A;  5C4J J;  1FEX A;  2R92 J;  5M3F J;  1FWZ A;  3FXR A;  1SD4 A;  3ZMS A;  2AXL A;  1T0F C;  4AYB A;  2O3F A;  4BE2 A;  2K9L A;  1J09 A;  4UUT A;  4PK4 A;  4JX6 A;  3UKG A;  2LOO A;  3HOT A;  3RJP A;  2D1H A;  3SQN A;  1ZAO A;  2ZJ2 A;  1RR8 C;  1ZLJ A;  1FBS A;  3TKY A;  3EPZ A;  4IHV A;  3GTO J;  3SFZ A;  4MGR A;  3W6K B;  4EJW A;  1G3Y A;  3RIR A;  4UY8 I;  4GFB A;  2PI0 A;  2B9S A;  5EG0 B;  1TC3 C;  5DM7 F;  4YIR X;  1YW8 A;  1LUJ B;  3HDD A;  1FIA A;  4TV7 A;  1J0R A;  4BU2 A;  2KT0 A;  3ROU A;  5E8G A;  5K7F A;  4XLP F;  2XPU A;  2E35 A;  1KQ0 A;  4XNF A;  3HEF A;  3DLA A;  4CO8 A;  2DFI A;  3FKJ A;  3OIP A;  3A1Y A;  4PGH A;  1IRG A;  4RS8 A;  2G7H A;  3S1R J;  1VQ8 I;  2HXI A;  1PYV A;  2QKL B;  2Y75 A;  2OV7 A;  3RYP A;  1NHA A;  3CJT B;  2RRE A;  5DM6 F;  2FBI A;  3F8C A;  2X6Y A;  4UNO A;  5M3M J;  1FIP A;  3TBI A;  2JZY A;  3GTL J;  2NAZ A;  4Y17 A;  2M45 A;  2R4G A;  4ENJ A;  1QU3 A;  4EV0 A;  2XRL A;  2ZCW A;  2MBF A;  3OWT A;  1R1U A;  2HYF A;  2L7M P;  3ECH A;  1JGG A;  5DD4 A;  2CW8 A;  3PL8 A;  5LBQ A;  4ZJZ A;  4O3M A;  2MSY A;  5LRR A;  2X1E A;  1QBJ A;  1XGM A;  2EZH A;  2ZJR F;  2IJL A;  3N05 A;  4A0Y A;  1CF7 A;  1YIO A;  3DBL B;  2JUC A;  2OJE D;  5IYC J;  5IYD J;  2IEK A;  4G6D A;  1U8R A;  2KIU A;  1IN7 A;  3M1E A;  2IS4 A;  4UXN A;  1FYK A;  4OAY A;  5TRD A;  5GPA A;  4HF0 A;  3CO7 C;  4G6Q A;  3I3L A;  5EGO B;  3VPR A;  3LWF A;  2MW8 A;  3KIO A;  1YW7 A;  4UB6 C;  5J1U A;  3MZH A;  4S04 A;  4RDU A;  3KP5 A;  3DQV C;  5DD8 A;  3H5N A;  3BDD A;  4M9Z A;  1X1P A;  5HNF A;  1BN5 A;  4X1E A;  3BCA A;  1R58 A;  1IV8 A;  1VI0 A;  4KNY A;  5GP9 A;  1T33 A;  1Z7L A;  3L2Q A;  1EF4 A;  2EQR A;  2OPT A;  4NUB A;  2JK3 A;  2M1B A;  3QRF F;  4QLC U;  2F5C A;  5EYR A;  1FTT A;  4N4N B;  2BOL A;  2R7O A;  4MFE A;  3ERM A;  4Q47 A;  2CYY A;  2A07 F;  2CO5 A;  2EZK A;  1P6R A;  4OMZ A;  3ZMD A;  4Q4Z F;  4PFP A;  3NEU A;  4ENK A;  2VE9 A;  2VOO A;  5LLQ A;  3GZN B;  4IOA F;  4EEF G;  3OYK A;  1FLI A;  3V7R A;  1WI9 A;  2QQ9 A;  3DCF A;  4LIV A;  2EH3 A;  4KJZ A;  2M8G X;  5A2Q K;  1TWA J;  1PP8 F;  3HZJ A;  3ZMZ A;  3LFU A;  3O8G A;  4FT8 A;  1YIT I;  4LLN A;  2XHK A;  1TT5 B;  3D1N I;  2HS5 A;  3ML6 A;  5HOD A;  3HUG A;  1JXS A;  2VJ5 A;  3OIQ A;  4IHT A;  1K6Y A;  1YOV B;  3MMY B;  1QPM A;  1HCR A;  2DTR A;  3WGG A;  4KN4 X;  3ZR8 X;  3CDL A;  4CH7 A;  4PCQ A;  2IA0 A;  3V8J A;  1T2K A;  2ECC A;  1KU7 A;  4XLA A;  3DF8 A;  5E8I A;  3CF2 A;  1BC7 C;  4MHG A;  1R9T J;  3HRM A;  3M8J A;  3LA2 A;  2DMQ A;  5JHU A;  4BEH B;  2L02 A;  5D5U B;  1BJZ A;  3L2U A;  1ETV A;  2A05 A;  3FXQ A;  4M3G A;  4M3B A;  2QYO A;  2CMP A;  2HFH A;  2OCE A;  3ERE D;  2DPD A;  3FX3 A;  2HZT A;  2RQP A;  4JQF A;  5TGT A;  2HQR A;  2HZD A;  4IHX A;  5FJ8 J;  2A68 F;  1MZB A;  2KP6 A;  4QSH A;  3RQI A;  1NH3 A;  1ZN2 A;  3BG7 A;  3LST A;  2COB A;  3G2B A;  1BIA A;  3PSF A;  4ENM A;  1VQ6 I;  3C2B A;  2M4K A;  1ZRC A;  5HS7 A;  3QQA A;  1LE8 A;  1NG6 A;  3FIS A;  1O3T A;  2Y0M A;  1MJA A;  2MLG A;  2HPM A;  2XF6 A;  2DA2 A;  1T8I A;  1WJD A;  2YU3 A;  2O03 A;  1QHG A;  2VBY A;  1TWC J;  2KRC A;  4CYC A;  1H8A C;  3WTV C;  3ELK A;  2KJB A;  4FTH A;  1MJ9 A;  1H9G A;  2FRH A;  3VFZ A;  2LK2 A;  4PSW A;  1JTX A;  2XF5 A;  3Q0W A;  1X2N A;  2L4M A;  4BH9 A;  1TW2 A;  2EFQ A;  2VOP A;  3S2W A;  1WVR A;  2Y9Y A;  2V6C A;  4NC8 A;  1VQ9 I;  1S6L A;  4GCV A;  2LLK A;  1OCO H;  4WK8 F;  2K9Q A;  1MBG A;  4CXF A;  2OCC H;  1LDD A;  3OIO A;  3S2H J;  3ZGK A;  2JSP A;  2W85 A;  1KZH A;  3GTQ J;  2M9H A;  5F27 A;  3IAM 2;  4EJO A;  3BT9 A;  4I76 A;  5JVT A;  1R71 A;  4NHJ A;  4A3G J;  1F1Z A;  3MZY A;  5GPC A;  3H3Z A;  3OYG A;  4UVB A;  2XAF A;  1UAA A;  1U5T A;  4KUM A;  3JRG A;  1R1T A;  1MSE C;  2H1K A;  2C6Y A;  3BR1 A;  2PBI A;  4ETS A;  3N97 A;  1IV6 A;  4HOB A;  1N78 A;  2Y30 A;  3QAH A;  3VB2 A;  3IC7 A;  4ESJ A;  3KZY A;  4IO9 F;  2ZME A;  1ZH5 A;  1BM9 A;  3KX2 A;  5ICC A;  2ECB A;  2FEZ A;  2O8X A;  3E7L A;  2Z1D A;  2A5W A;  1HDD C;  2A5Y B;  4IVN A;  4D1Q A;  4DGW B;  1F4K A;  3GTK J;  5LHH A;  5ED4 A;  3H35 A;  3GZ5 A;  1FBU A;  1YG2 A;  4RB1 A;  1TBX A;  3CMA I;  2ZNY A;  2VBZ A;  3H92 A;  2CJJ A;  3OV8 A;  3W2W A;  4IJA A;  1W36 D;  1ENH A;  4A3I J;  3S8P A;  1R49 A;  1D0Z A;  4OIO F;  1P7I A;  1HST A;  1SC7 A;  4BNC A;  1P9Q C;  5KAF C;  3E5Q A;  4IZZ A;  2K9S A;  1HQC A;  4ANJ A;  5LGN A;  4E7I A;  2A3S A;  4A93 J;  3DBR B;  1Z1D A;  5ERI A;  2XUB A;  3OL4 A;  1TQP A;  4O5V A;  4B47 A;  4EGY A;  2CRG A;  5CVR A;  3WGH A;  1MDM B;  3FK6 A;  2ZXH A;  1RES A;  3IAS 2;  2V79 A;  2HGC A;  1YJ9 I;  3LSI A;  2AS5 F;  1AU7 A;  2A61 A;  4Z2Y A;  3CCS I;  2HEO A;  2DTZ A;  3PIO F;  3HOZ J;  5LGT A;  2R93 J;  3FBI B;  4PJL A;  3TP0 A;  2P8T A;  2VAS A;  3L1P A;  3HC7 A;  2CGP A;  3FWE A;  4RAY A;  4XOP A;  4DBQ A;  3RZD J;  4P9F A;  3OYC A;  4IRG A;  4Y13 A;  2MAB A;  2ELJ A;  3CLO A;  1OLT A;  3KE2 A;  4LLG F;  3S15 J;  3I64 A;  2Q1Z B;  1UHW A;  5FLX K;  2KKO A;  1RKW A;  4ZC3 A;  2VKV A;  5GTH C;  4BBR J;  2DA1 A;  4CCL A;  3VOD A;  3WTS C;  3F6O A;  4XK4 A;  4L9N A;  4EJV A;  4LIT A;  4CCJ A;  4B44 A;  1ETW A;  1MKM A;  2E34 A;  4YFK F;  1WH5 A;  1SAN A;  1MBF A;  2XIG A;  4M6Y A;  5D5W B;  4FHT A;  4YEL A;  3BRO A;  5DCF A;  4L9J A;  1V55 H;  2M87 A;  1GXQ A;  4PDK A;  2NNY A;  2RKH A;  3L00 A;  3JRI A;  3CQZ J;  1FMV A;  1X1B A;  2H09 A;  3N4M A;  5AIQ A;  3H5A A;  2LYC A;  3EUK L;  1DP7 P;  1S7A A;  2KMU A;  5TJJ A;  5D5V B;  5DCM A;  2WB1 N;  4V2G A;  4V2F A;  2XGD A;  1Y1V J;  4DYC A;  4HNU A;  1D3Y A;  2EZI A;  2XRN A;  2EPF A;  1OYY A;  3QP6 A;  5HDN A;  2VQH A;  5E18 F;  1JKQ C;  3CCU I;  1SFO J;  4Y52 J;  2LC2 A;  2MYS A;  1BBY A;  5CJ9 A;  4HPQ A;  4JYK A;  4C30 A;  3CCV I;  3RKW A;  3BZK A;  5J40 A;  3CDI A;  3PM1 A;  4HSR A;  4WXC A;  3TO6 A;  2PEX A;  5BPD A;  3QPT A;  4BAC A;  2JA6 J;  2JMW A;  1E3H A;  4OWR B;  2BHZ A;  1F36 A;  2Y9Z A;  3GXO A;  3IP4 B;  3M1C A;  1EH6 A;  3CJQ B;  3JRB A;  3BTI A;  3WGI A;  2HOA A;  3F0C A;  1PVE A;  1QVT A;  1MND A;  1P2F A;  2LFB A;  3ABU A;  1Z9C A;  1BR1 A;  2OQR A;  1GLN A;  3VYR B;  3ZN0 A;  1X4O A;  3KLN A;  5D4S A;  1DPU A;  3S93 A;  4NBQ A;  2I5U A;  4XL9 A;  5E1W A;  2DXI A;  2MA3 A;  1KU2 A;  3VOE A;  5EZH A;  2X51 A;  3B02 A;  2QZ8 A;  3BQZ A;  4KIF A;  2DU9 A;  1BJA A;  3PUF A;  4CA0 A;  2H8R A;  1YX3 A;  1SMT A;  5HNH A;  4GYI A;  3DFG A;  4BKX A;  3FXU A;  4PJM A;  2MG4 A;  3CC2 I;  4LIU A;  3E5U A;  1V54 H;  3BP8 A;  2VBX A;  4LB5 A;  4F55 A;  2NNN A;  3OYH A;  1S9H A;  3IHU A;  3WTT C;  4HQM A;  1ON1 A;  3F6V A;  2DOA A;  1OIS A;  2R5Z A;  2DLL A;  1SFU A;  3WE2 A;  4HV5 A;  1IXS B;  4BQN A;  1H89 C;  1DU6 A;  4A3D J;  1Z21 A;  2Z2S B;  1TZL A;  2KJC A;  2W84 A;  3JRF A;  4CZC A;  2PN6 A;  3KPH A;  5LEJ A;  3G4S I;  2DYS H;  3V7C A;  4XID A;  1QHH D;  1PUF A;  1LDK B;  3BY6 A;  1SMY F;  4HBL A;  3EQL F;  1IDY A;  1WI3 A;  2HKO A;  3CO6 C;  1I50 J;  1FOY A;  4A3K J;  1TWH J;  3O2P E;  5DDG A;  1G6N A;  2O5R A;  4N0B A;  3EYY A;  3K4K A;  3MKZ A;  1JE8 A;  3PO3 J;  2K85 A;  2L9R A;  2W57 A;  2R7W A;  3KLO A;  2M7A A;  3WU2 C;  4A3M J;  2OAZ A;  4EQQ A;  1XCV A;  4ZYH A;  2JA8 J;  4YII A;  3SZG A;  3LQQ A;  1LFU P;  5FRO A;  1ZR2 A;  2FBK A;  1BI1 A;  4ZYA A;  4L9V A;  3AFH A;  2BE5 F;  4CHU A;  2L4A A;  4IL6 C;  4W97 A;  4Y33 A;  3M4O J;  4ZDL A;  1BI0 A;  4M72 A;  2XGE A;  2NOG A;  3P9C A;  2L9V A;  3C7J A;  4L0Y B;  1WSU A;  3M8E A;  2ME6 A;  4R1H A;  4KT5 C;  3CCY A;  3AKZ A;  1DGW Y;  4XRS A;  3C3W A;  1TQI A;  2AHQ A;  4KMU X;  2PFB A;  2F48 A;  4HYE A;  2ZFW A;  2NVQ J;  1WFX A;  2ZXJ A;  2R7S A;  2FA5 A;  1PUF B;  3S32 A;  3U9G A;  1ZTR A;  2E1O A;  2XGX A;  1LFP A;  2IA1 A;  2KPM A;  3JRH A;  1WHU A;  4I7H A;  1NK3 P;  1FOK A;  4KIS A;  2R5Z B;  3KEO A;  2H8W A;  2IGM A;  3MVP A;  1AWC A;  2ID3 A;  3WHC A;  3PFI A;  4B1R A;  1QRY A;  4A3E J;  3WTZ A;  6PAX A;  4BY1 J;  3KP2 A;  2QCO A;  4KIB A;  3Q9V A;  2J5O A;  2W25 A;  2VC0 A;  5D5X B;  3B6C A;  4A69 C;  1W0T A;  3IRQ A;  1H88 C;  4C9Y A;  4LD5 A;  4LG0 A;  2F6C A;  3WU0 A;  2IPQ X;  2KDO A;  1D1B A;  5LRS A;  2KZG A;  2WY8 Q;  2V7F A;  3ABL H;  2JRT A;  3FMS A;  1T0F A;  1XMK A;  2JRM A;  1DPR A;  5IP6 A; 
#chains in the Genus database with same CATH homology
 1OCP A;  3S2D J;  2CUF A;  5IYC J;  5IYD J;  2DN0 A;  2CQQ A;  2IEK A;  1JKP C;  1AKH A;  2M0C A;  1AHD P;  2HOS A;  2YUS A;  2O8K A;  2GBY A;  1MBK A;  3IV5 A;  4X6A J;  1MH3 A;  3H0G J;  1A6I A;  2QF7 A;  3A03 A;  5GPA A;  3LSG A;  5C3E J;  2NS8 A;  5EGO B;  3VPR A;  1GV5 A;  2GM4 A;  2LP0 A;  2MW8 A;  1XC5 A;  5J3L A;  1G2H A;  5J1U A;  3QPS A;  5IP9 J;  3HGY A;  4B4C A;  4RDU A;  1Y1W J;  3HOY J;  5K7H A;  4X1E A;  1A5J A;  5BNG A;  4DYR A;  3BQY A;  1VI0 A;  2RAE A;  4LOC A;  1T33 A;  5GP9 A;  1EF4 A;  2EQR A;  2OPT A;  2E19 A;  2JK3 A;  5FKN A;  1GVD A;  5EYR A;  1FTT A;  1FTZ A;  3SFI A;  4D5C A;  5DS9 A;  1TWG J;  5IPA A;  4MFE A;  5F0F A;  4JX4 A;  2NVX J;  2EZK A;  1JT6 A;  2EZL A;  4IEJ A;  3TED A;  2FD5 A;  5FKK A;  2E2I J;  3ZQC A;  4EEF G;  3DEW A;  1UHS A;  3DCF A;  3FK7 A;  2EH3 A;  3BR2 A;  2M8G X;  3ZOB A;  1TWA J;  1ETQ A;  4MO7 A;  4IHW A;  3JRD A;  1I6H J;  3O8G A;  3D1N I;  3TP3 A;  3S1N J;  3BTJ A;  2DMU A;  5C4X J;  5HOD A;  4A3F J;  4FE4 A;  1VF9 A;  1B72 A;  2TCT A;  1ZGW A;  2MGQ A;  1HCR A;  1ETX A;  3BG3 A;  4MLO A;  5FKL A;  3IH4 A;  3S17 J;  3CDL A;  2XPV A;  3GTG J;  1ORK A;  2X48 A;  2DMN A;  2ECC A;  4D7M A;  5F0C A;  4QTR A;  5EZG A;  1HDP A;  2EBI A;  2FQ4 A;  3O8H A;  5DTD A;  2YS9 A;  1R9T J;  3JRA A;  2K40 A;  2DMQ A;  1BJZ A;  4A3C J;  1ETV A;  1NTC A;  3HKZ N;  1T56 A;  4M3B A;  4M3G A;  3TW6 A;  3LOC A;  2DA4 A;  4IHX A;  5IOZ A;  1IC8 A;  5FJ8 J;  3A02 A;  4QSH A;  3RQI A;  1B72 B;  2IAI A;  2COB A;  3C2B A;  4BXX J;  1WH7 A;  1QPI A;  4ABZ A;  3QQA A;  3TW7 A;  1LE8 A;  3FIS A;  1ITY A;  3FIW A;  2L7F P;  3FKI J;  2XPW A;  1F43 A;  5EEA A;  2WV1 A;  1ZK8 A;  1MBE A;  2DA2 A;  3S1M J;  2KDZ A;  1TWC J;  1YRN A;  1RPW A;  4CYC A;  1H8A C;  4M6V A;  3G1L A;  3BTL A;  4FTH A;  3A01 B;  2LK2 A;  3G1O A;  1JTX A;  1VFC A;  3Q0W A;  1X2N A;  1HLV A;  3NAU A;  3ZQL A;  2L0K A;  3GTM J;  2OF7 A;  1U9O A;  2Y9Y A;  1HOM A;  1WGX A;  2LLK A;  3HOU J;  1RR7 A;  2K9Q A;  2LVS A;  1JUM A;  1MBG A;  4MFD A;  3OIO A;  1Q1V A;  3S2H J;  5IOY A;  1K83 J;  3GTQ J;  2M9H A;  5F27 A;  4QIW N;  3BT9 A;  4I76 A;  4A3G J;  2VUM J;  2L7Z A;  5GPC A;  1NK2 P;  1WPK A;  3JRG A;  1YRN B;  1MSE C;  2R5Y A;  2H1K A;  3BR1 A;  5M5Y J;  1X58 A;  1IV6 A;  4XIC A;  3B6A A;  1ETY A;  2Y30 A;  2NVT J;  3I4M J;  1D5Y A;  1HF0 A;  4AC0 A;  5J1R A;  2XB5 A;  3HBL A;  5K7Z A;  4I6Z A;  5F04 A;  3RKQ A;  2LTP A;  2XGC A;  2LD5 A;  5C44 J;  1OCT C;  2ECB A;  2PMZ N;  4DYQ A;  3GTJ J;  3K2A A;  4FE7 A;  3S16 J;  3E7L A;  4UUS A;  1MNM C;  1MH4 A;  1RKT A;  1HDD C;  4MIM A;  3GTK J;  4B3A A;  2X9D A;  3W6V A;  1IRZ A;  1POG A;  2GLO A;  3RZO J;  2YU9 J;  4A3J J;  2HQ5 A;  5JLW A;  2CUE A;  3I4N J;  4CYC B;  3K7A J;  2CJJ A;  4C3J J;  1BW5 A;  3Q3S A;  1ENH A;  4A3I J;  4XRS G;  1P7I A;  1E3O C;  3Q0V A;  2E2H J;  2K9S A;  1MBH A;  2NVY J;  3SDG A;  3BR0 A;  4Y7N J;  4A93 J;  1GV2 A;  1XS9 A;  3BR5 A;  2DA3 A;  2VI6 A;  2HI3 A;  1FJL A;  1IUF A;  3ZQH A;  1ZR4 A;  4L5E A;  1JUP A;  2CRG A;  3GTP J;  1XG1 A;  4A3L J;  3FK6 A;  1B8I A;  3ZQI A;  1RES A;  5FKM A;  1AU7 A;  2DTZ A;  5EG0 A;  3HOZ J;  2R93 J;  3TP0 A;  2IBD A;  3L1P A;  2N8G A;  1JJ6 C;  4W1U A;  1JT0 A;  3RZD J;  1S7E A;  2DA7 A;  2LKX A;  3S15 J;  1RKW A;  2VKV A;  3MKL A;  4BBR J;  2DA1 A;  2HDD A;  4XK4 A;  3WHB A;  4M3D A;  1ETK A;  2D5V A;  1ETW A;  4D7N A;  3LNQ A;  1WH5 A;  1SAN A;  1MBF A;  2ELK A;  5F0H A;  3HOX J;  2R5Y B;  1QVU A;  2NS7 A;  1JKR C;  3HM5 A;  3OOU A;  3MN2 A;  1UG2 A;  3LSP A;  2HYJ A;  2E2J J;  2O9L A;  3NAR A;  3JRI A;  2VKE A;  3CQZ J;  3CMY A;  2JA7 J;  5IP7 J;  1BA5 A;  2LY9 A;  4M3E A;  1GT0 C;  2ME0 A;  1RET A;  3M3Y J;  5E3N A;  3G1M A;  1TWF J;  1BL0 A;  2WB1 N;  4V2G A;  4V2F A;  2XGD A;  1Y1V J;  4DYC A;  1IJW C;  3S1Q J;  1U9N A;  2EZI A;  3PO2 J;  4Y52 J;  1JKQ C;  4AYB N;  2HOT A;  1SFO J;  4BY7 J;  4JYK A;  5EF6 A;  2B63 J;  1IDZ A;  2LR8 A;  1JKO C;  3PM1 A;  1I3Q J;  2JA6 J;  2FX0 A;  3HOV J;  3Q0U A;  4HNV A;  2JMW A;  1F36 A;  3QPL A;  4C3H J;  2Y9Z A;  5EGO A;  4UUS B;  5FLM J;  1MBJ A;  3JRB A;  3BTI A;  9ANT A;  2K9N A;  2DA5 A;  3IH3 A;  2HOA A;  3F0C A;  1QVT A;  1U78 A;  2LFB A;  3BTC A;  4JX5 A;  1Z77 A;  2P81 A;  1AKH B;  5M5W J;  2Y2Z A;  2HXO A;  2I10 A;  1GDT A;  1JUS A;  4DZJ A;  2ZB9 A;  1W0U A;  1B8I B;  5EZH A;  2JA5 J;  3IH2 A;  3BQZ A;  4C3I J;  4RBO A;  2G0E A;  2FJ1 A;  2H8R A;  3HOW J;  5EDN A;  2XSD C;  4BKX A;  3JRE A;  2DMP A;  2O7O A;  1IG7 A;  2MG4 A;  1O4X A;  1LFB A;  3SJM A;  4D5F A;  3HB9 A;  5E3O A;  3OSF A;  5M5X J;  1ETO A;  2R7Z J;  1ZKG A;  5FLV A;  1OFC X;  3H3V K;  5E3M A;  1ZQ3 P;  3HGG A;  2W48 A;  2Y31 A;  3ZQF A;  1JJ8 C;  4NDL A;  2R5Z A;  4M3F A;  1H89 C;  1APL C;  1DU6 A;  1Z0X A;  4A3D J;  3JRF A;  1WCM J;  2AO9 A;  1DU0 A;  4XID A;  1U8B A;  1PUF A;  1JTY A;  2DMT A;  2JJ7 A;  1IDY A;  1WI3 A;  5F08 A;  5J1Y A;  2Y0S N;  2JN6 A;  1I50 J;  4A3K J;  1TWH J;  2JWT A;  5E3L A;  2M2E A;  2R0Q C;  3BG5 A;  3JRC A;  3GBG A;  4A3B J;  2DJN A;  1GUU A;  4IHY A;  4JP0 A;  5C4J J;  3JR9 A;  2R92 J;  2CQX A;  5M3F J;  3PO3 J;  2DA6 A;  1FEX A;  2L9R A;  3S14 J;  1K61 A;  1OJL A;  5JLX A;  4DZP A;  4A3M J;  1VND A;  4UUT A;  5IYB J;  3LSJ A;  4JX6 A;  3UKG A;  2JA8 J;  1LFU P;  2WAQ N;  1ZR2 A;  4IHV A;  3GTO J;  3M4O J;  4W97 A;  4GFB A;  2XGE A;  2NOG A;  4DW6 A;  3OSG A;  2ME6 A;  5EG0 B;  1MSF C;  1TC3 C;  3CCY A;  1X2M A;  4XRS A;  3HDD A;  2AHQ A;  2M34 A;  1FIA A;  4C2M J;  4AUX A;  2KT0 A;  2NVQ J;  5K7F A;  2XPU A;  4FIS A;  3HEF A;  1PUF B;  3A01 A;  2CU7 A;  1ZTR A;  2E1O A;  2X6O A;  3JRH A;  1CQT A;  1UMQ A;  1NK3 P;  3S1R J;  2R5Z B;  2HXI A;  3LSR A;  5FKO A;  1IGN A;  4BBS J;  3BG9 A;  2XB0 X;  2TRT A;  3MVP A;  2ID3 A;  3WHC A;  4B1R A;  1P7J A;  1QRY A;  5M3M J;  1FIP A;  4A3E J;  3GTL J;  4BY1 J;  2QCO A;  1LE8 B;  4G12 A;  5F1J A;  2VPR A;  2XRL A;  3BR6 A;  3B6C A;  4FCY A;  4A69 C;  1W0T A;  2L7M P;  4XRM A;  4J19 A;  1JGG A;  1H88 C;  4S0H B;  2MSY A;  2ID6 A;  2EZH A;  1BW6 A;  5IP6 A;  3BR3 A;  3ZQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...