2AO9A

Structural genomics, the crystal structure of a phage protein (phbc6a51) from bacillus cereus atcc 14579
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
117
Chain Sequence
MMAKLDELKQKLTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Phage protein
publication title The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
total genus 41
structure length 117
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13022 HTH_Tnp_1_2 Helix-turn-helix of insertion element transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ao9A01
4JX6A 3CMYA 1GT0C 1ETVA 2OF7A 3E7LA 2R5ZB 3JR9A 4A3EJ 3BQYA 1D5YA 2DTZA 2OPTA 1MNMC 5M5WJ 2XPVA 3BG3A 5C3EJ 5EG0A 4BY7J 3HGGA 1U8BA 9ANTA 1FIPA 2EZKA 5J1UA 1APLC 2O9LA 2WAQN 4JX5A 2DN0A 4MO7A 2Y31A 4ABZA 1Z0XA 3GTQJ 2DMPA 1MH4A 3A02A 2JA7J 1K83J 3BG9A 4B3AA 5K7HA 1WCMJ 2HQ5A 1TWGJ 4A3GJ 2M2EA 4A3MJ 4D5CA 1HF0A 1Y1VJ 2HDDA 3D1NI 5JLWA 4JP0A 1BA5A 3RQIA 3ZQLA 3FK7A 4XRMA 1P7IA 2E2JJ 4IHWA 2H1KA 5GPCA 1MH3A 5EZGA 4DZJA 3A01B 1IC8A 3I4NJ 2ELKA 5JLXA 1B72B 1IJWC 4G12A 5HODA 2HI3A 2IEKA 3PM1A 4C3IJ 1IDYA 2HXOA 4XIDA 1IDZA 4CYCB 1QRYA 3RKQA 3JRGA 2JA8J 2NOGA 3O8HA 2H8RA 3RZDJ 3G1OA 3BTJA 3BR2A 5F0FA 4JYKA 3L1PA 5J1YA 5F08A 3IH2A 2ECBA 2LR8A 1AU7A 3PO3J 3IH4A 2XGEA 4DYQA 4M3GA 1MSEC 2LY9A 1ZQ3P 3GBGA 2D5VA 2COBA 3O8GA 3WHCA 1YRNA 4HNVA 1JKRC 1ETYA 1IV6A 2WB1N 2R5YA 1SANA 2ZB9A 3HOUJ 5IOZA 5IP9J 1VF9A 1PUFA 1ZGWA 3TEDA 1F43A 2X6OA 3CCYA 2L7MP 1BJZA 3BTLA 1B8IA 4A3LJ 4FTHA 1GV2A 2LLKA 3SDGA 4MFDA 1FTZA 5FKNA 3NAUA 3BG5A 1A5JA 2EBIA 2YU9J 2VKVA 1I6HJ 3MVPA 1WH7A 4B1RA 1OFCX 4C2MJ 3HOYJ 3GTLJ 5M3MJ 1U9NA 4MLOA 5F0HA 2Y2ZA 2XB5A 2M9HA 4W1UA 4J19A 1E3OC 2YUSA 2DMNA 3DEWA 2I10A 2DMQA 2QF7A 3S15J 4BBRJ 1DU6A 2ID3A 3ZQIA 3BQZA 1X58A 4A3IJ 4A3KJ 1AHDP 4LOCA 1OCTC 3ZQGA 3K2AA 1JT6A 1WI3A 4A3DJ 2Y9YA 3H3VK 1S7EA 5EYRA 3UKGA 3GTJJ 3BTCA 2TCTA 2L7ZA 3G1LA 4XRSA 3JRFA 2K9SA 5C4XJ 1JTYA 4A93J 2LTPA 2K40A 2WV1A 3VPRA 3DCFA 5M5XJ 4UUSB 2VI6A 4I76A 2B63J 2LD5A 3TW6A 5EZHA 1O4XA 2R7ZJ 3M4OJ 2VUMJ 1MSFC 2G0EA 4A3FJ 2IBDA 2P81A 2FQ4A 4D5FA 5IYBJ 3B6CA 2GBYA 1W0TA 1Q1VA 3S16J 4DZPA 1ZTRA 3W6VA 3FK6A 2LVSA 1R9TJ 3C2BA 2W48A 5M3FJ 1BW6A 3S1NJ 4C3JJ 2L0KA 4QTRA 1MBHA 1MBGA 2EZLA 1FIAA 3A01A 2EH3A 5K7FA 3JRHA 3JRAA 3GTPJ 4Y52J 3LSRA 4AYBN 1GV5A 1JUPA 1HCRA 1XS9A 3S2DJ 3HM5A 5IP7J 3HOXJ 1T33A 1JKPC 1RKWA 2JN6A 2JA6J 3S1RJ 4FE4A 5E3MA 4BKXA 2M34A 4FISA 4RDUA 3OIOA 4M3DA 1DU0A 3ZQFA 3RZOJ 3JRCA 3HDDA 2AO9A 4A3BJ 4AC0A 2XRLA 3QPSA 3TP0A 2MG4A 1LFBA 1POGA 2VPRA 5EG0B 2O8KA 1BW5A 3LOCA 1FJLA 2R93J 1LFUP 4BXXJ 3MN2A 5IP6A 1NK2P 3BR0A 1VFCA 2CJJA 2NS8A 2EZHA 2KT0A 3JRIA 4EEFG 4XRSG 5EGOA 1WH5A 3F0CA 4IEJA 5IYCJ 2EQRA 3BR3A 1BL0A 3TW7A 3CQZJ 2DMUA 3OSGA 5FKLA 2JA5J 2ME6A 4AUXA 3S1QJ 2DA4A 4XICA 2DA6A 2K9QA 1ETQA 2M0CA 4X6AJ 3S14J 2FD5A 1RR7A 1TWAJ 2RAEA 2IAIA 1I50J 1JJ6C 2NVYJ 1LE8A 5GPAA 2JWTA 2LKXA 1ETOA 4A3CJ 2DA3A 2NVQJ 4M3FA 3Q0VA 5DS9A 2HXIA 3OOUA 2NS7A 2HYJA 3A03A 1JGGA 1Y1WJ 1AKHA 5C4JJ 1VI0A 4M6VA 1H8AC 4BY1J 2R5ZA 2TRTA 5F27A 1ORKA 1GDTA 2L7FP 2HOSA 4RBOA 2R0QC 2DA7A 3QPLA 5EDNA 1MBKA 2CQXA 1OCPA 4M3EA 2HOAA 1JTXA 3LSGA 1NK3P 2E19A 1GVDA 1ZK8A 1UHSA 1A6IA 2O7OA 2R92J 5F04A 1YRNB 1X2MA 1OJLA 4X1EA 1U9OA 3QQAA 2GM4A 2R5YB 3OSFA 2MGQA 5DTDA 4NDLA 1PUFB 1XG1A 1H89C 4V2GA 2DMTA 1ENHA 4W97A 3LNQA 3Q0UA 2XSDC 1B8IB 1Z77A 2DJNA 1JJ8C 3K7AJ 2MSYA 2DA2A 2EZIA 1IGNA 3BT9A 5FKKA 5FLVA 2HOTA 4IHYA 4IHXA 3H0GJ 3NARA 5EF6A 3GTGJ 3ZQHA 1U78A 3S1MJ 2XB0X 5FKMA 3FKIJ 5IOYA 5K7ZA 1RETA 5C44J 1B72A 2QCOA 1X2NA 2M8GX 1WGXA 5M5YJ 2MW8A 2NVXJ 4FCYA 3FISA 4JX4A 1MBFA 1JKQC 1RKTA 1SFOJ 4CYCA 2VKEA 1JUMA 3HKZN 1TWCJ 2DA5A 2Y0SN 1MBEA 2ECCA 2PMZN 5BNGA 3M3YJ 1G2HA 3GTKJ 5E3OA 5F0CA 2FX0A 1CQTA 3LSJA 3B6AA 3HBLA 4D7MA 4DYRA 3ZQCA 4Y7NJ 1WPKA 2X9DA 3BTIA 3CDLA 2LFBA 1T56A 1ETWA 3IH3A 4GFBA 3PO2J 1TWHJ 5GP9A 2NVTJ 4DYCA 3JREA 4D7NA 2JK3A 3SFIA 4A69C 1UG2A 3Q3SA 1HDDC 1ETKA 1GUUA 3ZOBA 4C3HJ 4XK4A 2K9NA 1ZR2A 2DA1A 2ME0A 3HB9A 3TP3A 1JT0A 3WHBA 1IUFA 4QSHA 2CQQA 3BR6A 2GLOA 2JMWA 3FIWA 5J1RA 1ETXA 2AHQA 1IG7A 2Y30A 3SJMA 2ID6A 1NTCA 3BR5A 1FEXA 2YS9A 5F1JA 1QPIA 2CRGA 3S17J 3GTOJ 1ITYA 4MIMA 4UUTA 5E3LA 4MFEA 3GTMJ 5IPAA 1JKOC 1VNDA 1I3QJ 4I6ZA 3MKLA 2JJ7A 2X48A 1ZR4A 4L5EA 5E3NA 2CUFA 5J3LA 1FTTA 4S0HB 3JRDA 4UUSA 1TC3C 4QIWN 3JRBA 1EF4A 4DW6A 1IRZA 5FLMJ 5EGOB 3LSPA 3G1MA 1HDPA 1TWFJ 1RPWA 2XPUA 1QVTA 1H88C 3HOWJ 1K61A 3Q0WA 1P7JA 3BR1A 5FKOA 2L9RA 3HGYA 2FJ1A 1QVUA 1F36A 1XC5A 2CUEA 3S2HJ 2N8GA 2LK2A 5IYDJ 1HLVA 2LP0A 3HEFA 4IHVA 2CU7A 5EEAA 1MBJA 1LE8B 2KDZA 1W0UA 2E1OA 4M3BA 4BBSJ 2E2HJ 4V2FA 2XPWA 3HOZJ 2XGDA 5FJ8J 1ZKGA 1HOMA 1UMQA 3HOVJ 1RESA 4B4CA 2Y9ZA 4A3JJ 2XGCA 1JUSA 3I4MJ 1AKHB 4FE7A 3IV5A 2E2IJ
chains in the Genus database with same CATH superfamily
1FY7A 2DW4A 3DU6A 4JX6A 1GT0C 5D4RA 1FYLA 1ETVA 1UAAA 2XF6A 1RNLA 1F4KA 5FD5A 4M9ZA 1MMNA 4MNUA 1YW8A 2XPVA 4UV8A 1PP7U 5EG0A 3L2QA 5LHIA 9ANTA 4XN0A 2JRMA 1ZG5A 5J1UA 1APLC 4PSWA 3HRTA 3O3KA 5HLTA 2VJ4A 1EV7A 2Y31A 4ABZA 3E5UA 3QODA 2H94A 3FBIB 4S04A 5DUIA 4ENKA 1TTYA 1K83J 3CLOA 4WXDA 2VQCA 4FQGA 2JSCA 2M2EA 4D5CA 4LITA 5J1RA 2GIZA 4JP0A 1BA5A 3QOEA 4E6KG 4D1QA 2WA0A 4XBFA 1K6YA 3K0LA 4BE0A 2OTJI 4KMUX 1FWZA 3FXUA 1V4RA 1RR8C 2V7FA 3I4NJ 1IC8A 5HDKA 1SEUA 2AXLA 2X6WA 2E5ZA 3H3UA 1X1CA 4KN4X 2HI3A 2IEKA 3PM1A 4C3IJ 2HGCA 2Z33A 4KN7X 2Q8KA 1K79A 4DQ2A 1WVRA 3I54A 2JA8J 3O8HA 3L09A 5L3EA 3BTJA 5EJCA 5IT9Z 1YJWI 1YIJI 4NC8A 5LRRA 5F08A 3CO6C 2JPCA 2ECBA 2VONA 5CVRA 4M3GA 2L3DA 4BJ6C 1OYWA 3LFUA 2KISA 1XSVA 2R7QA 2DJIA 3WHCA 3ZRGA 4HPQA 2O0YA 3SDBA 1T98A 1Y8QB 5FB2A 1ETYA 3CMMA 4I0AA 3Q9SA 1V3FA 2QSGX 4RGXA 2ZB9A 4F7ZA 5IP9J 1VF9A 1WJFA 2JUCA 1ZGWA 1BC7C 2VE8A 2X6OA 4AU7A 1BJZA 1AA7A 5JHFA 4IF4A 2FOWA 5FLXZ 3CZ6A 1GV2A 2LLKA 4FTHA 3SDGA 4MFDA 2KP6A 4J01A 1K78A 4F52A 3ISPA 3BG5A 3NRVA 1LDKB 3TBIA 2EJRA 2UWMA 2EBIA 3E5XA 3TL4X 2CS3A 1QBJA 2BY0A 2XAFA 2PMHA 1OFCX 4JBAA 4C2MJ 3HOYJ 3GTLJ 2WAEA 5F0HA 3MQ0A 2A07F 4J19A 4J00A 4M6YA 2CFOA 2DMNA 2DMQA 2CW8A 2QF7A 3S15J 3HPGA 4BBRJ 3F23A 3DV8A 1BI2A 3A1YA 4L18B 1USTA 4A3KJ 1OCTC 1OCCH 4BU2A 1JT6A 2LY2A 2Y9YA 3BCBA 2L02A 1S7EA 5EYRA 3UKGA 3BTCA 4MTDA 3V4GA 3KP7A 1PP8F 3DBHB 4FHTA 1T0FA 3O6BB 4I76A 4NHJA 3TW6A 5EZHA 4E4HA 1G3YA 1MSFC 4L9JA 5DCFA 1RUNA 2M87A 1SFEA 1YJ9I 1BOBA 5F1RA 4DZPA 5BMZA 1ZTRA 4XKBA 2DOEA 3FK6A 3CTAA 3VOEA 2LVSA 2OUMA 2W48A 4GRIA 1YHQI 4IVNA 4YELA 4C3JJ 2VE9A 4G6DA 2DOAA 3A01A 5BS6A 1FBSA 4EM2A 3JRHA 3TDZC 3F72A 4PJ0C 4C9YA 2ZMEB 4F3QA 3NEUA 1I5ZA 1HKTA 2KRCA 4NUBA 3HIFA 3HOXJ 2X51A 3DBRB 2VJIA 2JN6A 2LF7A 4XLAA 2LYCA 4D9JA 2JA6J 3FDYA 3VSKA 3JAMK 1G8XA 1LDJA 4FISA 2DYSH 3R6SA 5EEHA 4RDUA 2M45A 5LRSA 5ICFA 3VWBA 4AIDA 2CQ7A 3S3NA 1KGSA 2KL4A 5TGTA 2XRLA 4Z2YA 2V26A 5GAGJ 2AS5F 5EG0B 3CO7C 3ZMUA 3ZMSA 3LOCA 3GCMA 4BXXJ 3HRSA 3KZIC 4U7DA 3QPHA 2BBYA 4FX4A 1NK2P 5L3BA 4IXAA 4LLNA 3WODF 2MA3A 1SAUA 5LHHA 1UZCA 4EATA 2NNYA 2CH0A 3T8TA 3DTKA 5HVQC 4IEJA 3CUQA 3TW7A 3N4MA 2IJLA 3OSGA 1D1CA 5FKLA 2ME6A 4AUXA 3S1QJ 4BJTA 4H4KC 2C6YA 2DQLA 1Z3XA 1V5GA 1VQ9I 2STTA 3IWZA 3FMSA 1ETQA 3DWLE 1P6RA 3KFWX 4M71A 4O3MA 1RR7A 1W4MA 3KEOA 2RAEA 3KEYA 4IOAF 2NVYJ 4U88A 5GPAA 4MTEA 3WTWC 2VBYA 1Y8RB 4ZYDA 3SHFA 1U8RA 3HUGA 3EETA 3FXKA 5A2QZ 3CCJI 1STZA 2R7UA 1SMYF 4M3FA 3Q0VA 1UCRA 3OOUA 2KRHA 3LA7A 4CYDA 2HYJA 5CVIA 1Y1WJ 2DCEA 3QU6A 2ZMEC 1VI0A 1X4OA 5IT3A 1PVEA 5CQEA 2ZFUA 5HS9A 2STWA 2ZJ2A 2EIMH 1GDTA 1IN6A 3IWFA 2L7FP 3E0JB 4RBOA 2OV7A 2NXNB 1I6XA 2CQXA 4PGHA 1EH8A 5E20A 1LEAA 2VN2A 5KCMA 1VQKI 2H6BA 3HJEA 5KHDA 3GFIA 1MW7A 4RS8A 1S7AA 4IQJA 2E36A 4H0EA 4DIQA 3BDDA 2ZNYA 1NK3P 4EJUA 3O2PE 5ILVA 4B44A 1X2MA 1OJLA 1E3HA 4XLPF 3R0AA 2HQNA 4ZYAA 2CQKA 3KP2A 1R5GA 1GXQA 3KYLA 1LKXA 2BE5F 1R00A 3QOPA 3VYUB 2KIFA 4Z6YA 3Q0UA 1J75A 3ZR8X 2DJNA 2G9WA 1K78B 2EZIA 1YIOA 3L2RA 4IHYA 3RJPA 4BE2A 3NARA 5KAIC 3PJRA 4Q5SF 3FWEA 3ZQHA 2HEOA 2CW7A 1WJBA 5J4VA 2EA4A 3NWTA 1ZRDA 3K4CA 2QLZA 2PX9A 1S7OA 3OYDA 1S8NA 4II2A 5M5YJ 3DKWA 2K27A 4FCYA 3PQJA 3KLNA 1IN7A 2JT1A 3J7AY 3V42A 3K70D 2M1BA 1S6LA 4CYCA 2GXBA 5E1ZB 1JUMA 1TWCJ 4MEXF 2E7XA 3WGIA 3L2UA 2X1EA 4HW0A 4RB1A 1U5TC 3HKZA 2L54A 2DO7A 2Y0SA 1OLTA 3LSJA 4KJZA 3B6AA 3ZQCA 3PUFA 3CDIA 3HZJA 2ZXIA 1KYZA 1WPKA 2QQAA 2X9DA 2Z3YA 3BTIA 4EJOA 1LJ9A 1L0OC 3DP7A 1T56A 1ETWA 3IH3A 3LQQA 1X1BA 3QP5A 4CCOA 3I71A 5GP9A 4RAGA 3E97A 4DYCA 2DI3A 3JREA 4EJWA 3EUAA 5DM6F 1TW2A 1UG2A 3K10A 1ZLJA 3G71I 2BW3A 4N9IA 1OCRH 4G8XA 3ZOBA 5BQTA 3WTVC 1SAXA 2B9SA 4BQAA 2F5VA 2M4KA 1FMWA 2DA1A 3TP3A 3VYTB 4QSHA 2FE3A 4XOPA 1X3UA 1KZHA 3FKJA 1JHHA 2VKHA 2JMWA 3FHNA 4RB0A 5E79C 4AIHA 2Y30A 3CDHA 2ID6A 1NTCA 4G7OF 1W7PA 3S17J 4WXHA 4UUTA 1V5FA 1FYMA 3GTMJ 4ENMA 2A61A 2W25A 4II3A 1I3QJ 1IRXA 3BOQA 2QWWA 2X48A 1ZR4A 1ACIA 4RGSA 4N4NB 2QYOA 5E3NA 3I5UA 2CUFA 3LA3A 3OL3A 5HNFA 2P5KA 1QGPA 4RLFA 3JRDA 2NOJB 3JRBA 4B43A 1EF4A 4KNYA 1UG0A 5K5QA 4LMYA 3IKVA 5FLMJ 1QHHD 2HKOA 1ZG1A 3T1BA 3LSPA 5L3FA 1RC9A 2BZTA 1HDPA 1TWFJ 2XPUA 2D1HA 4NQWA 1H88C 5LHGA 3CUQB 3A4CA 3U1DA 1IF1A 1RUOA 1XC5A 5H6QA 2CUEA 3RYRA 3KCCA 4PZJA 4UHTA 4QPOA 4UNOA 4B09A 4XKWA 4RLQA 2EV5A 2LK2A 2Y69H 1HLVA 5IYDJ 1BM9A 3HTSB 3F9KA 1VQ7I 3AG2H 4G6QA 2WTEA 1V55H 4M6XA 2JQ7A 2KDZA 2MD0A 1XMKA 3KZYA 3CP8A 2FOKA 1OR7A 3HUGB 4M3BA 1X1DA 4XLCA 3M1CA 1REPC 2UUZA 3HC7A 1A04A 4V2FA 2XPWA 3ZXSA 4KISA 3HOZJ 5FJ8J 3F3XA 2QKLB 1HOMA 1J9IA 3RPUA 2Y9ZA 4A3JJ 4G6TB 1B59A 4BGDA 3LSIA 1O57A 2P7VB 1Z9CA 4RM3A 3ERMA 5HOOA 2OTLI 4CGZA 3I4MJ 1FOXA 4FE7A 3KP3A 2DQRA 1A31A 3ZMZA 2OF7A 3JR9A 1D5YA 2ACJA 2RREA 1TW3A 2DTZA 3GFLA 3I0TA 1Y39A 3V8JA 3BG3A 3LFKA 4BY7J 1W5SA 3HGGA 3ESWB 4A2UA 2XAHA 3H92A 1FIPA 2EZKA 2VQGA 3OYBA 2O9LA 3HHGA 3ONQA 2EILH 2F4MB 5HDNA 4MO7A 4CHUA 2HYGD 5AONA 4B3XA 1T08B 2V9KA 4EJVA 1BN5A 2RN7A 1V54H 4HX8A 5J6XA 4HNTA 4WXCA 1MH4A 3BG9A 4B3AA 5LGUA 1WCMJ 3OYNA 4IHTA 4R79A 3K70C 2BY2A 4A3MJ 1HF0A 1Y1VJ 2V1DA 4MHGA 1PUEE 1U0JA 3MKWB 2M3AA 4BQQA 1USSA 2X6YA 3EDPA 3FK7A 4UUVA 2V79A 1FOYA 5H20A 2W57A 1MH3A 4CH7A 5E1WA 4IO9F 4G7ZF 3CUQC 1HA8A 2P6TA 1R22A 3J7AO 2K5CA 3ASNH 1GVJA 5H2FC 2ZJRF 1X4PA 4LLLA 4MQVA 4OWRB 1PDNC 1VQ8I 2L9NA 1Z21A 2LBFA 2VASA 3H1CA 3PNYA 4G12A 2GXAA 5HODA 2V6CA 2JZYA 1SVLA 4C2TA 4ITVA 2HXOA 4B47A 1FC3A 4XIDA 1IDZA 1WRJA 4CYCB 1QRYA 1O3SA 1E2XA 2V9PA 3QU3A 3JRGA 4LIVA 1KQ0A 4LK1F 2ELHA 3VDXA 3C3WA 2HDWA 4YIRX 5F0FA 3BR2A 3BCAA 2QUFA 5KNLA 3H35A 2X4HA 1TL8A 3MCZA 3IH2A 3OMYA 1AU7A 4LD5A 3PO3J 1T6SA 3LMMA 3BY6A 3R4KA 1MSEC 5E1XA 1ZQ3P 5B1AH 3FZVA 1IW7F 1A36A 1O3QA 3O8GA 2HPIA 3T8RA 3J7YJ 4OIOF 3OY9A 3SEZA 3HPHA 4LFUA 2K3FA 3RYPA 5BOXA 5IOZA 2ADUA 1IO2A 2K3PA 1F43A 1BIAA 1Y0NA 3U2RA 4BNCA 2V9VA 2L7MP 2HU9A 3BTLA 3H9JA 4ESFA 2HTSA 1LPQA 3G73A 2BW3B 4A3LJ 3N05A 4ZZLA 2NRAC 2MH2A 1FTZA 5FKNA 5HNHA 3VSLA 2FRHA 3J81Z 3RPUD 3FXMA 2VKVA 4D0PA 1WH7A 4B1RA 1CF7A 4GYGA 3BLYA 1KA8A 4HV5A 2Y2ZA 2Q0OA 4W1UA 3JTHA 5CVJA 4EMSA 2HPMA 1W7PB 2IT0A 3ZQIA 3BQZA 4HAMA 4U87A 3CJRB 3DFGA 3ZQGA 3K2AA 3U9GA 1JI8A 2H09A 2XASA 1HW1A 1HXDA 4PDKA 3H3VK 1OCZH 2OC6A 1IXRC 2CQNA 2UZKA 5ERIA 3G1LA 4PGGA 2K9SA 5C4XJ 3J80Z 1ZRFA 4A93J 2LTPA 2EFWA 3VPRA 4BXUA 1H9TA 1B1BA 2DYRH 2PJRA 2V1NA 2B63J 2LD5A 2R7ZJ 2V6EA 4PJMA 3WTTC 1W36D 2W85A 2VUMJ 4CCMA 4A5MA 1FBUA 3S8PA 5IYBJ 1D8KA 3B6CA 1W0TA 3A2KA 4AD9A 3S16J 4NB5A 3BROA 4RMNA 4NQWB 1FBQA 3HXLA 1PYVA 2Q2EA 1IRGA 4NC7A 3TQNA 1MBHA 4P9FA 3PQKA 4AYBN 3KETA 1HCRA 3A0HC 5F64A 2KKOA 1WJAA 1J5YA 1DGRM 4Q48A 4IRGA 1T33A 3GVAA 4EM0B 4CA0A 1AOYA 4HLXA 1VQLI 3CCSI 3BZCA 3S1RJ 2J5OA 5E3MA 3E6CC 2M34A 1IN5A 4DBQA 3PFYA 3EUHA 3OIOA 4BEHA 3HRUA 3CC7I 4R8HA 2Z16A 1TP4A 3ZQFA 3CF5F 1U5TA 3L00A 3JRCA 3C7JA 2QZ8A 3WE3A 2RGVA 4A3BJ 3QPSA 2E60A 3TP0A 3H36A 1OISA 3MD2A 2O8KA 3GZNB 1FJLA 4LB6B 1X3WB 4OIQF 1BR4A 4AWXB 4HYEA 2KRFA 2Y0MA 5FFZA 2M8EA 3KLOA 2K85A 3CP2A 1R5ID 3IP4B 4HQMA 1YW9A 2NS8A 3DTEA 2EZHA 1G4DA 5ICEA 3FXJA 2KT0A 4A0XA 5EGOA 2CWEA 2D1VA 4R1HA 2XAUA 4GXOA 3BR3A 1A35A 4S05A 4EGZA 3LAJA 2FNPA 3CCEI 1P2FA 3OYIA 1DP3A 3JCUC 2DA4A 1J7KA 4Y3OA 2K9QA 3VEPA 4XICA 2M0CA 3TDUC 2HVSA 3S14J 3QYEA 3KP4A 4HQEA 1I50J 3L7WA 5FRNA 1JJ6C 1HW5A 2XF7A 3DU5A 3C2HA 1LE8A 2GA2A 2JWTA 4U0VA 4HNUA 4KICA 1YO5C 1ETOA 2LRDA 2BOLA 2EV0A 1T8IA 2KPMA 3GF2A 3JTGA 3HOSA 1Z6RA 1IXSB 2LBFB 3ECOA 5GTIC 1G59A 4ZDOA 1YE9A 2VLAA 2W24A 5HLIA 5IT9K 4RM2A 4OIPF 2IXSA 1F1ZA 1AKHA 2FMLA 4B8XA 3WTSC 2GQQA 2R7OA 3SZGA 1H8AC 2DT6A 1G3TA 4BY1J 2TRTA 2HOSA 1OR7C 2DA7A 3A0BC 3QPLA 1IN4A 1MBKA 1YS6A 3GFMA 3HSEA 4I09A 4XORA 1K4SA 2GXGA 2K9MA 1W5CC 2HOAA 4G7HF 2RKHA 2EFNA 3MKZA 3LQRA 1GVDA 2VC1A 3IAM2 1A6IA 2R92J 3ABMH 1FPQA 4OAYA 1Q1HA 4X1EA 3WE2A 3QQAA 2G7HA 5TISC 2GM4A 5FLXK 3ZQQA 4HX7A 2VOOA 3WTYC 4P96A 4NDLA 4ESJA 1H89C 1XGOA 2DMTA 1ENHA 1WJ5A 4RAYA 4W97A 3LNQA 3ZN0A 1VQNI 1IRFA 2O61A 5BPIA 2TDXA 1JJ8C 1J2XA 4ZTJA 3K7AJ 2MSYA 4DBRA 2YU3A 4RB2C 3DPUA 3H9GA 1R4NB 3M8EA 4IHXA 2X6XA 2VPLA 5KAFC 5DD8A 2A69F 1UELB 2ZNZA 5EF6A 1F5TA 2LH9A 2OAZA 3S1MJ 2FXAA 5D4SA 5CVUA 1CF7B 1BI0A 2R7FA 2KHMA 3M7GA 4U0YA 1NG6A 5FKMA 1F9NA 2JVGA 5IOYA 1LVAA 1W36C 3HL2A 1B72A 5ED4A 2F5FA 2M8GX 2LOOA 5D5XB 5KK1A 5E17F 3ZP5A 3PSIA 2MFZA 1MJBA 2VXDA 1JKQC 1N78A 4HX4A 3CCLI 1SFOJ 4AVZA 2DA5A 4BS9A 4F91B 1HW2A 4DOZA 5B3SH 3CESA 1SD5A 3M3YJ 3LSMA 2HKXA 4QWQA 3GTKJ 3CCUI 1YITI 4WK8F 1W1WE 3JSPA 1MD0A 1SFKA 4LG3A 2EWNA 3GW2A 3ZMVA 4Y7NJ 2ZSIB 2PJRB 3CC4I 2KJBA 3CMAI 2F48A 1G6NA 2XDVA 4I0BA 3LSKA 4GFBA 1OYYA 3QP6A 4ZTFA 4GDFA 2OZUA 1YS7A 1TWHJ 3L9FA 3AL0B 1XSXA 2AQFA 2GOXB 4ZZDA 4A6EA 3P7NA 4GCVA 4OMYA 4OU0A 3MZ8A 3SFIA 4A69C 4AVPA 5TJJA 3Q3SA 2Q2EB 3ASOH 2WY7Q 3QWLA 2X85A 2I8DA 1ETKA 4YIFA 3ABKH 4I2OA 1ZR2A 1TQMA 5GADJ 2ME0A 2V4JC 3HB9A 1MDMA 3WHBA 1IUFA 3DKXA 1YQAA 3BR6A 2QQ9A 3WGGA 5DM7F 2GLOA 3ML6A 3M9AA 2BHYA 3FIWA 1EH7A 3K4LA 4JQFA 1WJCA 2MH9A 2NS0A 4MEYF 1NHAA 1FZPB 2PQ8A 4L0ZB 2FBKA 2YS9A 3KPHA 4BDZA 5F1JA 4NBQA 4BEHB 4L9VA 1SD7A 2JVHA 3GTOJ 2L4AA 3PNTA 4QPQA 1U5TB 3TO9A 5IPAA 1VNDA 3HG9A 4KUMA 3AKZA 3WU2C 1O7LA 2VJJA 2KIQA 5J47A 2X0LA 1XB4A 4BE1A 1ZARA 1NG7A 3V7RA 1SVOA 1I27A 1IV8A 1FT9A 2DBBA 2P4WA 3R60A 5FO5A 3U1KA 2WB1A 5JHUA 2DDBA 3U21A 2R7WA 4XLEA 1Y6IA 3OS2A 2LC2A 2QBYA 2HZTA 2VB6A 3KP6A 3PL8A 3K1NA 4XLFA 3MZHA 5EGOB 3G6EI 3G1MA 5J8CA 1PJRA 1RPWA 3C1DA 1D8JA 4ON0A 3HOWJ 3FBNB 3Q0WA 1P7JA 1XN7A 2HZDA 3C18A 4ANJA 4KA4A 2K86A 3I64A 2P0WA 4XMYA 2ISZA 3MFKA 2VQHA 2IGKA 2LP0A 3HEFA 1UB9A 5A2QK 4IHVA 1ZRCA 2DT7B 1XCBA 2YX4A 2BHZA 5EEAA 1LE8B 4BDYA 3AL0C 2CUZA 4P9UA 4XKCA 4BBSJ 2XGDA 3P5JA 3ROUA 1ZKGA 3DKYA 2DK5A 1FOKA 3ELKA 1RESA 3HOVJ 4O6JA 5D8LB 4YRVA 4BYYA 2P5LC 2L9VA 1LUJB 1W5TA 1JUSA 3IHUA 1O3RA 1AKHB 1ZLKA 3IV5A 3CMEI 1YX5A 3BJAA 5DEQA 3IKTA 4A3EJ 1WWXA 3E7LA 1FOWA 3BQYA 4RGUA 1UHWA 2WC2A 4UB6C 5LGNA 1R7JA 1MNMC 1LFPA 5M5WJ 2L7KA 1U8BA 1IUYA 1Z05A 2WAQN 3EUHC 1ZHFA 2R4GA 4LLGF 2V1UA 1KONA 3I55I 1X1PA 5AIQA 1S29A 2DXIA 1Z0XA 4I99C 3AG1H 4ZDLA 3MAJA 4HDUA 2NAZA 3SYTA 3K2ZA 3P9KA 3K1PA 4CUGA 1E3PA 1BJAA 4UVCA 3ZMTA 5E8IA 1TWGJ 2CGPA 1HKSA 4A3GJ 1MJ9A 3IRQA 3BJ6A 2JRTA 2XHKA 5CQGA 3D1NI 2J5PA 4I02A 4N4OB 5KVRA 3OYKA 4I98B 2CUJA 3RQIA 4ZYHA 3JSOA 3ZQLA 2QVOA 3CUOA 3FXQA 2L2OA 5D6FA 2IA0A 2E2JJ 2KMUA 2EB7A 3CJTB 1LB2A 3QAHA 4YIIA 2H1KA 3QYBA 4DZJA 3A01B 5DD4A 2W4SA 4GGGA 1TT5B 5JLXA 1B72B 1XCVA 4PJJA 3H5NA 3DF8A 5JFRA 3MZYA 1K7AA 1IDYA 1YFHA 4C30A 4CXFA 2VOPA 1LQ1A 2CFXA 3I59A 3RKQA 2BGCA 5F6FA 5JVTA 1TBXA 3M8JA 3RZDJ 1QPMA 3G1OA 2DK8A 3L1PA 2L5QA 5J1YA 3K4JA 1LDDA 1OPCA 2MBFA 2LR8A 2XGEA 2X1DA 2XROA 3OS0A 2LY9A 2LY1A 4BQNA 1T38A 1XD7A 2FMYA 1Y0UA 4OIRF 1H9GA 4HNVA 3TGNA 4P1WA 1IV6A 2WB1N 2BEOA 3HOUJ 1OKRA 2PBIA 1R49A 5AIPA 4Q4ZF 1B9MA 2L4MA 2BY3A 2CV1A 3CCYA 3LSTA 2KIMA 3FXRA 1B8IA 1LVKA 1ZGJA 3EYYA 3RCOA 2LNBA 2WAFA 3G3ZA 3NAUA 3K6GA 2KFDA 2E1NA 4XSXF 2FNAA 1TT0A 4UVBA 2ZXHA 3GMEA 2LDUA 1SFXA 1MDMB 1R4MB 3ECHA 5DV5A 2YU9J 1I6HJ 4OOIA 3I58A 5M3MJ 1YTYA 4MLOA 4JOMA 5D5WB 2M9HA 3DTIA 2YUSA 5GAEJ 4AM3A 1ODDA 1DDNA 3D0SA 3FXLA 1S72I 2IP2A 3GXOA 4HF2A 2XF5A 1DGWY 3OR1C 1MGTA 2M7AA 3L2CA 1DU6A 2EFPA 4XL9A 3FMQA 1BBYA 2BXYA 4PFOA 4KT6A 1AHDP 4LOCA 3OYAA 4UV9A 1WI3A 3GO5A 4A3DJ 2XAQA 2YSRA 3QYFA 4WX9A 2K4JA 5B1BH 2P8TA 2KQRA 6PAXA 4XRSA 1ZAOA 3CJQB 3RKYA 4NNJA 4XN3A 2W84A 2K40A 2HQAA 5M5XJ 2ELJA 2VI6A 1O4XA 1OYIA 1EA3A 2G0EA 1SD6A 4A3FJ 3Q9VA 1R58A 1L3LA 2QBYB 3EYIA 3WGHA 1VQ4I 2JTVA 4E7LA 1DUXC 2QENA 1XDUA 2A5YB 3W6VA 2A6TA 1KQ8A 2EFQA 1WHUA 1P9QC 3G2BA 1BW6A 5LEJA 3S1NJ 5BPDA 4OMZA 1TZLA 2L0KA 2F5DA 1MBGA 2EZLA 4I01A 1M1EB 3M1EA 3GTPJ 3JRAA 1ONVA 1I39A 4U0WA 4UXNA 3LSRA 4WF2A 1GV5A 1JUPA 3BZKA 2OU2A 1VQ5I 3S2DJ 5IP7J 4AYBA 2XVCA 1FSHA 4NC6A 3TO6A 4CZCA 4IHSA 4KDPA 3T0YA 2DTRA 1JKPC 2WV0A 3ZPLA 2BVLA 1RKWA 3KYCB 2MLKA 4E7ZA 3RIRA 4BKXA 3KYDB 2ZJPF 2VJ5A 4F92B 1R6RA 2PMZA 2A68F 4IRHA 3CCQI 4L0YB 4M3DA 1DU0A 4HV6A 5D5VB 5E18F 1P4XA 3OYHA 1HBXG 3RZOJ 4BACA 4BHBA 4ZYEA 3ABUA 2OD5A 3DEUA 2AO9A 3EQLF 3NQOA 4AC0A 3ERED 2E5NA 2MD5A 1LFBA 1POGA 2NYXA 2OQGA 4IQ4A 1IAWA 4XSZF 5GAHJ 4OINF 4KIFA 4XLNF 1LFUP 2EPFA 5FD6A 1T39A 2KIUA 2RNGA 2E71A 1JHFA 3BR0A 4MGRA 1VFCA 2GOMA 3IAS2 1AWCA 1IXCA 4BJ5C 3JRIA 4EEFG 2A6EF 4XRFA 4XRSG 1VTNC 3V7SA 2EQRA 1BL0A 4GYIA 4PJLA 2DMUA 3CQZJ 4IRIA 1YI2I 2B7EA 4RGRA 3HSRA 2FQ3A 2VQLA 1D1AA 2DA6A 4G94A 2F2EA 1T95A 2HQRA 4X6AJ 5K5OA 2IRFG 3P9CA 1MKMA 2PN6A 3RKXA 1OQYA 1QZYA 2OCEA 4IOCF 4HSRA 3I3LA 4KFCA 2P7CB 5ICCA 1WZ2A 2OA4A 4BAYA 2HS5A 3K1MA 2LSOA 2LKXA 2FUG2 4A3CJ 4FX0A 4BL0B 2R7XA 5DS9A 2LREA 3HYIA 2ESHA 1EKEA 5K1YA 1JGGA 1FNNA 2EA2A 3WG9A 4IPAA 1UFMA 5C4JJ 1ZH5A 3W2AA 1D0XA 1ON2A 3I59B 1LNWA 4BUPA 2R5ZA 5F27A 4AIJA 4HBLA 2MLGA 1ORKA 1FYKA 2CYYA 3KZZA 5K5RA 1OCPA 1BOAA 3PSFA 1JTXA 3GYHX 1MMGA 2H6CA 1TLHB 2R7DA 3FM5A 2A5WA 3RSNA 1RRJA 1JE8A 5D6EA 3LSGA 3AG3H 1E17A 1B4AA 4PSXA 4M73A 2O7OA 2RQQA 5F04A 3REOA 4WCGA 2PMUA 4JK1X 1ZGAA 4TV7A 4L5JA 2M7BA 3F6VA 1B9NA 2MGQA 5L3DA 1XG1A 4V2GA 2DAOA 2IPQX 2DLLA 3OYCA 2XSJC 3J81K 4HRIA 2XSDC 3BC8A 3RKWA 1B8IB 1Z77A 2IVMA 1GLNA 2BY1A 2DA2A 3BT9A 5FKKA 5FLVA 1R5HA 1HKQA 1D1BA 2A05A 1G3WA 2RV8A 4Y15A 3H0GJ 1U78A 2XB0X 5FROA 2JUGA 4P55A 2QA4I 3JW4A 3FKIJ 3R61A 3OR2C 3AAFA 1B6AA 2QCOA 1XGMA 2NVXJ 2KLOA 1XPXA 4JX4A 3EPZA 4IKFA 1MBFA 4LGWA 1RKTA 3F6OA 3D5SC 3J80K 1R1UA 3BG7A 1MBEA 2ECCA 2PMZN 5BNGA 2YX7A 2KZVA 3IUOA 5E3OA 2VXZA 5F0CA 1YYVA 4ZH4F 2FX0A 5LLQA 1CQTA 1VZ0A 2JPBA 4E7SA 3HBLA 3PFIA 2ZC2A 4ENNA 1MMDA 3FM3A 2Y75A 3CDLA 5LFAA 3ZGKA 1BC8C 2MABA 3DBLB 4E7HA 3PO2J 3I4PA 3OYJA 2RDPA 4YFNF 4D7NA 2ETHA 2JK3A 2RC4A 1WKMA 1D3YA 1GUUA 1KU2A 3UNGC 2XIGA 3E1SA 2K9NA 2OZ6A 1FMVA 3F22A 1R23A 1JT0A 3WTUC 1QA6A 2G7UA 4ZC3A 1ETXA 2RQPA 2V1XA 3K4NA 4P5OA 2OBPA 5HLHA 1IG7A 1FEXA 3CLQA 3L2VA 4E70A 2EFOA 1RIOH 2M0MA 3RDIA 2QEXI 4LG0A 1YJNI 2CRGA 1BI3A 2HVQA 1J09A 3LWFA 4M72A 2FBHA 3OYLA 1QU3A 3GZ5A 4MIMA 5B5EC 1VQMI 4MFEA 2EIJH 1JKOC 1MIJA 4I6ZA 2FA5A 3MKLA 3VYRB 3SZPA 3OIPA 3UR3C 2F4OB 2JJ7A 1FP2A 3WG7H 2OQRA 2VBWA 3P9IA 1D0ZA 1R1TA 4S0HB 1MJAA 4UUSA 2K7LA 4A12A 1IN8A 1S9HA 4DJAA 3FXOA 3KP5A 3G4SI 1FX7A 2P6SA 4A0YA 3ABTA 5J4YA 5LEKA 1IRZA 3W3CA 3Q5FA 1QVTA 3CF2A 1ULYA 5E8GA 3VODA 1SC7A 3NWSA 3BR1A 3K4MA 2M5WA 1F36A 1ON1A 4CZZA 3S2HJ 2Z99A 1HSTA 2PG4A 1QO0D 2KDOA 1YOVB 3K69A 3VFZA 3K9TA 1SFUA 4EV0A 1EH6A 3TO7A 2CU7A 2HYFA 2XAGA 5CKTA 3V8KA 2KZGA 5J40A 4LK0F 1IZ1A 2WBMA 4B4CA 1ZREA 2DFEA 2HR3A 2F5CA 2XGCA 3OIQA 4ZYGA 2D45A 2CV2A 2IS2A 1LEBA 3BG6A 3CMYA 2VODA 1I1SA 1P4AA 3JAMZ 2R5ZB 3H5AA 5L3CA 1WSUA 2PFBA 2XKOA 3FX3A 2OPTA 2O3FA 3PNVA 5C3EJ 1FP1D 1R1VA 2R7VA 2IS6A 3GUDA 3K4BA 2E1CA 3AG4H 4HSTA 1JGSA 2ZFWA 4JX5A 4RB3C 2DN0A 4XR6A 4EVIA 2WAQA 5ILSA 3ZN1A 3FMRA 1K6OA 2BVMA 2UV1A 1C0WA 4RAFA 3KX2A 4XONA 1BR2A 3GTQJ 2CG4A 2DMPA 2Z9OA 3RPQA 3RTRA 2IGNA 2JA7J 3A02A 1UHMA 4KIGA 3OYFA 5K7HA 2HQ5A 4L9NA 2BXZA 3DEEA 1SVMA 4X0GA 2YR2A 2HDDA 3F8FA 3ULQB 2L9SA 1QQIA 5JLWA 4BHPA 2NNNA 2XV4S 1Z3YA 2F4IA 4IL6C 4XRMA 1P7IA 4PJNA 4IHWA 3S32A 3LL7A 5GPCA 3MWMA 1J0RA 5EZGA 1DPRA 1Z7UA 2GA1A 3QPTA 2ELKA 4QLCU 1A6QA 1IJWC 2XRNA 3B73A 1OCOH 3I9V2 1ZN2A 2QSHX 5LGTA 3DLAA 3OYEA 1R36A 1HSJA 4M9XA 2R7TA 2NOGA 3CC2I 2H8RA 1E0EA 3DQVC 1XMXA 2W1OA 4A5NA 2DOFA 4JYKA 4O5VA 3PIPF 5JVGF 5CVVA 2ZCWA 1KU9A 2VL8A 3DPTA 3SEQA 4B48A 3MMYB 3IH4A 4DYQA 4ESBA 1EJ9A 2COMA 2DU9A 4MQ9F 3K4KA 3I53A 3D5RC 1XTAA 1G3SA 1O3TA 3GBGA 3HHHA 2D5VA 2COBA 1XDSA 2GAUA 2HOEA 5HDGA 1YRNA 3GZ6A 1JKRC 5ICGA 5CJ9A 2R5YA 3S3OA 1SANA 2XC7A 2O6GE 2FF4A 3KIOA 4PK4A 1PUFA 3IC7A 4N0BA 3TEDA 1NH3A 1U6GA 1QZEA 3F21A 2QGUA 2QM3A 2DFIA 2EINH 3F8NA 1CGPA 2A3SA 2FBIA 4HZFA 2Q1ZB 2CSOA 1VQ6I 2ZXWH 2XKPA 5ILUA 2HNHA 1Z6TA 1A5JA 2WY8Q 2O5RA 2FU4A 1KYWA 3MVPA 2IA1A 3HOTA 2DFHA 3D5LA 3H5RA 4CICA 2WWYA 2FSWA 1T2KA 1U9NA 2XB5A 1E3OC 1BIBA 1D5VA 5HLGA 1X19A 4Y17A 2W7NA 1ZELA 4ETSA 3DEWA 2I10A 4LG0B 3TOBA 4L9TA 4YFXF 2ID3A 2RVCA 1X58A 4HDVA 1Z7LA 5JR3A 4A3IJ 2PEXA 4FETA 4EQQA 2ESNA 1XMAA 2XUBA 3E6BA 4KITB 2E7WA 1K4TA 4XNFA 3FHZA 3V7CA 2ICWG 4DNCA 3GTJJ 2H1LA 2IGMA 1RZ4A 3WTXC 2TCTA 2L7ZA 3JRFA 4UY8I 1JTYA 4C2UA 2EK5A 2ZKZA 3BPXA 2WV1A 4HG2A 3DCFA 1YG2A 3E5QA 4I7HA 4XKVA 4UUSB 4WWCA 3M4OJ 4F93B 2IBDA 2Z5UA 2P81A 3COAC 2FQ4A 4D5FA 4HLYA 1MZBA 3N97A 2GBYA 4CDGA 1Q1VA 1SD4A 3CCMI 1DP7P 1ZG3A 4ASNA 1R9TJ 3GLXA 3C2BA 5M3FJ 1R71A 4QTRA 4AIKA 2MC4A 2Y48A 4LIUA 1ERDA 1FIAA 3OS1A 3TOAA 2EH3A 5K7FA 4Y52J 4EM1A 4L5IA 2PLYA 4LJZF 3CCVI 5HS8A 2M30A 1XS9A 2HDCA 3F8MA 3HM5A 3VB2A 2LF8A 4E7KA 4ZJZA 2RNJA 4UB8C 2YPRA 3E3VA 3W6KB 3BWGA 2EIKH 4E7IA 5L3GA 4FE4A 3SZTA 1KQ9A 4YFKF 2F6CA 3ZMDA 1D0YA 2PI0A 3RQ4A 5LD2C 3H3ZA 4PUSA 4CCKA 3HDDA 3H0DA 3PIOF 5CPRB 3J7ZI 4YEJA 2MG4A 2VPRA 1BW5A 2JSPA 4BH9A 2R93J 3OWTA 5DCMA 3MN2A 5IP6A 3WTZA 3BPVA 2XAJA 2IA2A 2GIVA 4DGWB 3CCRI 3V8LA 1XX5A 2CJJA 4PFPA 2VIXA 1WI9A 3SQNA 2AXTC 3GLLA 2HWVA 2UXNA 1WH5A 3F0CA 5IYCJ 3QRFF 3I56I 2JA5J 2ZJQF 2FEZA 5CYVA 1KU3A 1N25A 3LA2A 5D8KB 2IGOA 2EV6A 4KIBA 1I3AA 1TNSA 5FGMA 2O8XA 2FD5A 1MNDA 2QKMB 3BJOA 1TWAJ 4RA2A 2IAIA 4BQOA 4IJAA 1J59A 1UJ8A 2I5UA 1RI7A 4A6DA 4XM3A 1QHGA 3ABLH 4XLHA 2HFHA 3OYMA 1TNTA 2IS1A 2DA3A 3TMOA 1QNTA 1BI1A 1S5LC 4M9SA 2NVQJ 4CO8A 2HXIA 2JA2A 3MKYB 1N77A 2PJPA 2NS7A 3B02A 4IZZA 4XQFA 3A03A 1WJDA 1V5EA 1FSEA 3S2WA 4M6VA 2IS4A 3OV8A 5EEGA 3W2VA 2R0QC 1FLIA 5EDNA 1QZZA 4M3EA 1HQCA 4GO1A 3LAPA 4FASD 1XGNA 3HSFA 5HS7A 1JXSA 4F55A 1X3ZB 4RAZA 4UVAA 2E19A 4U7BA 1TQIA 1ZK8A 1UHSA 2NVUB 2O03A 3HRMA 1YRNB 2AQEA 4LB5A 1T0FC 2DODA 1U9OA 2VBZA 4ZDPA 5TRDA 3X2QH 2R5YB 1OMIA 5LBQA 3OSFA 5DTDA 1PUFB 2H8WA 5FRMA 2BYVE 2VT2A 3WU0A 4Y4RA 1YLFA 2VT3A 2DDAA 1IGNA 2LKPA 4M74A 5GTHC 2QQBA 2HOTA 4EGYA 3GWZA 2CV0A 2CMPA 3GTGJ 3EUKL 2E1MB 2WADA 4N9HA 3SFZA 2H27A 5FFXA 3CD6I 3M07A 2MYSA 3W2WA 3DPLC 4FT8A 4OAZA 3TKYA 3L2WA 5K7ZA 1RETA 4V19K 2DPDA 5H6RA 1WJEA 5C44J 1P4WA 1X2NA 1WGXA 2ISYA 2IW5A 1MNEA 2MW8A 2Z1DA 3FISA 2ZO4A 5DYMA 4Y13A 1VQOI 2LKSA 3CJNA 1H0MA 3BP8A 2LG4A 2VKEA 3HKZN 2Y0SN 2HVRA 1G2HA 3VYSB 3GEZA 3ZCOA 1YW7A 2P5VA 4KMFA 1Z1DA 1GHCA 4D7MA 1VQPI 4DYRA 3H9QA 1DQUA 1HC8A 1GXPA 1DPUA 4XOTA 4BHCA 3E6MA 2W82A 1BR1A 2VC0A 2LFBA 2CW0F 3BZ6A 2NVTJ 1O7FA 4HF1A 4HA8A 3DLLF 2E34A 4KT5C 5J8FA 2XGXA 4ENJA 2R7SA 1W7PD 1HDDC 4HF0A 3IRRA 4A0ZA 1SMTA 4C3HJ 1MMSA 2ZBKA 4XK4A 3HTUA 3E6DA 1U2WA 1I1GA 1MMAA 1KU7A 3GX4X 2CQQA 4PCQA 1N75A 1X1AA 3DXJF 2AHQA 2A6HF 3SJMA 3BR5A 4EJTA 4K2EA 1YX3A 4HOBA 1QPIA 2UXXA 3OYGA 1XSDA 2VKDA 1ITYA 2OCCH 2QQ8A 2LMDA 5E3LA 4BXFA 2CO5A 1TQPA 2VBXA 2E1MC 2KJCA 3SXYA 1Z67A 4L5EA 4YG2F 1S3JA 2HTJA 2B0LA 2F5EA 3S93A 5DCMB 2DT5A 2ZXJA 5J3LA 1FTTA 2K4BA 3AFHA 2DFFA 4HEA2 3IL2A 2Z2SB 3ZQ7A 3KE2A 3M8FA 3RI4A 1U3EM 1TC3C 4QIWN 1XGSA 3T5XA 1Y56A 2E35A 3W6JB 5DDGA 4DW6A 2R3SA 3MEXA 2GWRA 3F8CA 1WQ2A 4CCJA 2L01A 2OJED 1K61A 4CCLA 3OL4A 2D2WA 4IX7A 2ZSHB 5JI6A 5FKOA 3FF5A 2L9RA 3OOPA 3HGYA 2FJ1A 1QVUA 4CSWA 4Y33A 2N8GA 2GZWA 2ZMEA 3PUBA 2MC3A 4CCNA 1MBJA 3F8BA 2X1CA 5CLSA 2M4GA 2K9LA 5D5UB 1W0UA 2E1OA 5B66C 1P92A 2E2HJ 1WFXA 3R0JA 3WU1B 2BV6A 3S3MA 2R7RA 4KYWA 5DUKA 1UMQA 3LSHA 4Q47A 1Z91A 2W00A 2QSFX 4G9YA 1ZYRF 5IY5H 3C2GA 2DPUA 3GFJA 2K02A 3KEQA 2E2IJ 4E7JA
chains in the Genus database with same CATH topology
4JX6A 3CMYA 1GT0C 1ETVA 2OF7A 3E7LA 2R5ZB 3JR9A 4A3EJ 3BQYA 1D5YA 2DTZA 2OPTA 1MNMC 5M5WJ 2XPVA 3BG3A 5C3EJ 5EG0A 4BY7J 3HGGA 1U8BA 9ANTA 1FIPA 2EZKA 5J1UA 1APLC 2O9LA 2WAQN 4JX5A 2DN0A 4MO7A 2Y31A 4ABZA 1Z0XA 3GTQJ 2DMPA 1MH4A 3A02A 2JA7J 1K83J 3BG9A 4B3AA 5K7HA 1WCMJ 2HQ5A 1TWGJ 4A3GJ 2M2EA 4A3MJ 4D5CA 1HF0A 1Y1VJ 2HDDA 3D1NI 5JLWA 4JP0A 1BA5A 3RQIA 3ZQLA 3FK7A 4XRMA 1P7IA 2E2JJ 4IHWA 2H1KA 5GPCA 1MH3A 5EZGA 4DZJA 3A01B 1IC8A 3I4NJ 2ELKA 5JLXA 1B72B 1IJWC 4G12A 5HODA 2HI3A 2IEKA 3PM1A 4C3IJ 1IDYA 2HXOA 4XIDA 1IDZA 4CYCB 1QRYA 3RKQA 3JRGA 2JA8J 2NOGA 3O8HA 2H8RA 3RZDJ 3G1OA 3BTJA 3BR2A 5F0FA 4JYKA 3L1PA 5J1YA 5F08A 3IH2A 2ECBA 2LR8A 1AU7A 3PO3J 3IH4A 2XGEA 4DYQA 4M3GA 1MSEC 2LY9A 1ZQ3P 3GBGA 2D5VA 2COBA 3O8GA 3WHCA 1YRNA 4HNVA 1JKRC 1ETYA 1IV6A 2WB1N 2R5YA 1SANA 2ZB9A 3HOUJ 5IOZA 5IP9J 1VF9A 1PUFA 1ZGWA 3TEDA 1F43A 2X6OA 3CCYA 2L7MP 1BJZA 3BTLA 1B8IA 4A3LJ 4FTHA 1GV2A 2LLKA 3SDGA 4MFDA 1FTZA 5FKNA 3NAUA 3BG5A 1A5JA 2EBIA 2YU9J 2VKVA 1I6HJ 3MVPA 1WH7A 4B1RA 1OFCX 4C2MJ 3HOYJ 3GTLJ 5M3MJ 1U9NA 4MLOA 5F0HA 2Y2ZA 2XB5A 2M9HA 4W1UA 4J19A 1E3OC 2YUSA 2DMNA 3DEWA 2I10A 2DMQA 2QF7A 3S15J 4BBRJ 1DU6A 2ID3A 3ZQIA 3BQZA 1X58A 4A3IJ 4A3KJ 1AHDP 4LOCA 1OCTC 3ZQGA 3K2AA 1JT6A 1WI3A 4A3DJ 2Y9YA 3H3VK 1S7EA 5EYRA 3UKGA 3GTJJ 3BTCA 2TCTA 2L7ZA 3G1LA 4XRSA 3JRFA 2K9SA 5C4XJ 1JTYA 4A93J 2LTPA 2K40A 2WV1A 3VPRA 3DCFA 5M5XJ 4UUSB 2VI6A 4I76A 2B63J 2LD5A 3TW6A 5EZHA 1O4XA 2R7ZJ 3M4OJ 2VUMJ 1MSFC 2G0EA 4A3FJ 2IBDA 2P81A 2FQ4A 4D5FA 5IYBJ 3B6CA 2GBYA 1W0TA 1Q1VA 3S16J 4DZPA 1ZTRA 3W6VA 3FK6A 2LVSA 1R9TJ 3C2BA 2W48A 5M3FJ 1BW6A 3S1NJ 4C3JJ 2L0KA 4QTRA 1MBHA 1MBGA 2EZLA 1FIAA 3A01A 2EH3A 5K7FA 3JRHA 3JRAA 3GTPJ 4Y52J 3LSRA 4AYBN 1GV5A 1JUPA 1HCRA 1XS9A 3S2DJ 3HM5A 5IP7J 3HOXJ 1T33A 1JKPC 1RKWA 2JN6A 2JA6J 3S1RJ 4FE4A 5E3MA 4BKXA 2M34A 4FISA 4RDUA 3OIOA 4M3DA 1DU0A 3ZQFA 3RZOJ 3JRCA 3HDDA 2AO9A 4A3BJ 4AC0A 2XRLA 3QPSA 3TP0A 2MG4A 1LFBA 1POGA 2VPRA 5EG0B 2O8KA 1BW5A 3LOCA 1FJLA 2R93J 1LFUP 4BXXJ 3MN2A 5IP6A 1NK2P 3BR0A 1VFCA 2CJJA 2NS8A 2EZHA 2KT0A 3JRIA 4EEFG 4XRSG 5EGOA 1WH5A 3F0CA 4IEJA 5IYCJ 2EQRA 3BR3A 1BL0A 3TW7A 3CQZJ 2DMUA 3OSGA 5FKLA 2JA5J 2ME6A 4AUXA 3S1QJ 2DA4A 4XICA 2DA6A 2K9QA 1ETQA 2M0CA 4X6AJ 3S14J 2FD5A 1RR7A 1TWAJ 2RAEA 2IAIA 1I50J 1JJ6C 2NVYJ 1LE8A 5GPAA 2JWTA 2LKXA 1ETOA 4A3CJ 2DA3A 2NVQJ 4M3FA 3Q0VA 5DS9A 2HXIA 3OOUA 2NS7A 2HYJA 3A03A 1JGGA 1Y1WJ 1AKHA 5C4JJ 1VI0A 4M6VA 1H8AC 4BY1J 2R5ZA 2TRTA 5F27A 1ORKA 1GDTA 2L7FP 2HOSA 4RBOA 2R0QC 2DA7A 3QPLA 5EDNA 1MBKA 2CQXA 1OCPA 4M3EA 2HOAA 1JTXA 3LSGA 1NK3P 2E19A 1GVDA 1ZK8A 1UHSA 1A6IA 2O7OA 2R92J 5F04A 1YRNB 1X2MA 1OJLA 4X1EA 1U9OA 3QQAA 2GM4A 2R5YB 3OSFA 2MGQA 5DTDA 4NDLA 1PUFB 1XG1A 1H89C 4V2GA 2DMTA 1ENHA 4W97A 3LNQA 3Q0UA 2XSDC 1B8IB 1Z77A 2DJNA 1JJ8C 3K7AJ 2MSYA 2DA2A 2EZIA 1IGNA 3BT9A 5FKKA 5FLVA 2HOTA 4IHYA 4IHXA 3H0GJ 3NARA 5EF6A 3GTGJ 3ZQHA 1U78A 3S1MJ 2XB0X 5FKMA 3FKIJ 5IOYA 5K7ZA 1RETA 5C44J 1B72A 2QCOA 1X2NA 2M8GX 1WGXA 5M5YJ 2MW8A 2NVXJ 4FCYA 3FISA 4JX4A 1MBFA 1JKQC 1RKTA 1SFOJ 4CYCA 2VKEA 1JUMA 3HKZN 1TWCJ 2DA5A 2Y0SN 1MBEA 2ECCA 2PMZN 5BNGA 3M3YJ 1G2HA 3GTKJ 5E3OA 5F0CA 2FX0A 1CQTA 3LSJA 3B6AA 3HBLA 4D7MA 4DYRA 3ZQCA 4Y7NJ 1WPKA 2X9DA 3BTIA 3CDLA 2LFBA 1T56A 1ETWA 3IH3A 4GFBA 3PO2J 1TWHJ 5GP9A 2NVTJ 4DYCA 3JREA 4D7NA 2JK3A 3SFIA 4A69C 1UG2A 3Q3SA 1HDDC 1ETKA 1GUUA 3ZOBA 4C3HJ 4XK4A 2K9NA 1ZR2A 2DA1A 2ME0A 3HB9A 3TP3A 1JT0A 3WHBA 1IUFA 4QSHA 2CQQA 3BR6A 2GLOA 2JMWA 3FIWA 5J1RA 1ETXA 2AHQA 1IG7A 2Y30A 3SJMA 2ID6A 1NTCA 3BR5A 1FEXA 2YS9A 5F1JA 1QPIA 2CRGA 3S17J 3GTOJ 1ITYA 4MIMA 4UUTA 5E3LA 4MFEA 3GTMJ 5IPAA 1JKOC 1VNDA 1I3QJ 4I6ZA 3MKLA 2JJ7A 2X48A 1ZR4A 4L5EA 5E3NA 2CUFA 5J3LA 1FTTA 4S0HB 3JRDA 4UUSA 1TC3C 4QIWN 3JRBA 1EF4A 4DW6A 1IRZA 5FLMJ 5EGOB 3LSPA 3G1MA 1HDPA 1TWFJ 1RPWA 2XPUA 1QVTA 1H88C 3HOWJ 1K61A 3Q0WA 1P7JA 3BR1A 5FKOA 2L9RA 3HGYA 2FJ1A 1QVUA 1F36A 1XC5A 2CUEA 3S2HJ 2N8GA 2LK2A 5IYDJ 1HLVA 2LP0A 3HEFA 4IHVA 2CU7A 5EEAA 1MBJA 1LE8B 2KDZA 1W0UA 2E1OA 4M3BA 4BBSJ 2E2HJ 4V2FA 2XPWA 3HOZJ 2XGDA 5FJ8J 1ZKGA 1HOMA 1UMQA 3HOVJ 1RESA 4B4CA 2Y9ZA 4A3JJ 2XGCA 1JUSA 3I4MJ 1AKHB 4FE7A 3IV5A 2E2IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX6 A;  3CMY A;  1GT0 C;  1ETV A;  2OF7 A;  3E7L A;  2R5Z B;  3JR9 A;  4A3E J;  3BQY A;  1D5Y A;  2DTZ A;  2OPT A;  1MNM C;  5M5W J;  2XPV A;  3BG3 A;  5C3E J;  5EG0 A;  4BY7 J;  3HGG A;  1U8B A;  9ANT A;  1FIP A;  2EZK A;  5J1U A;  1APL C;  2O9L A;  2WAQ N;  4JX5 A;  2DN0 A;  4MO7 A;  2Y31 A;  4ABZ A;  1Z0X A;  3GTQ J;  2DMP A;  1MH4 A;  3A02 A;  2JA7 J;  1K83 J;  3BG9 A;  4B3A A;  5K7H A;  1WCM J;  2HQ5 A;  1TWG J;  4A3G J;  2M2E A;  4A3M J;  4D5C A;  1HF0 A;  1Y1V J;  2HDD A;  3D1N I;  5JLW A;  4JP0 A;  1BA5 A;  3RQI A;  3ZQL A;  3FK7 A;  4XRM A;  1P7I A;  2E2J J;  4IHW A;  2H1K A;  5GPC A;  1MH3 A;  5EZG A;  4DZJ A;  3A01 B;  1IC8 A;  3I4N J;  2ELK A;  5JLX A;  1B72 B;  1IJW C;  4G12 A;  5HOD A;  2HI3 A;  2IEK A;  3PM1 A;  4C3I J;  1IDY A;  2HXO A;  4XID A;  1IDZ A;  4CYC B;  1QRY A;  3RKQ A;  3JRG A;  2JA8 J;  2NOG A;  3O8H A;  2H8R A;  3RZD J;  3G1O A;  3BTJ A;  3BR2 A;  5F0F A;  4JYK A;  3L1P A;  5J1Y A;  5F08 A;  3IH2 A;  2ECB A;  2LR8 A;  1AU7 A;  3PO3 J;  3IH4 A;  2XGE A;  4DYQ A;  4M3G A;  1MSE C;  2LY9 A;  1ZQ3 P;  3GBG A;  2D5V A;  2COB A;  3O8G A;  3WHC A;  1YRN A;  4HNV A;  1JKR C;  1ETY A;  1IV6 A;  2WB1 N;  2R5Y A;  1SAN A;  2ZB9 A;  3HOU J;  5IOZ A;  5IP9 J;  1VF9 A;  1PUF A;  1ZGW A;  3TED A;  1F43 A;  2X6O A;  3CCY A;  2L7M P;  1BJZ A;  3BTL A;  1B8I A;  4A3L J;  4FTH A;  1GV2 A;  2LLK A;  3SDG A;  4MFD A;  1FTZ A;  5FKN A;  3NAU A;  3BG5 A;  1A5J A;  2EBI A;  2YU9 J;  2VKV A;  1I6H J;  3MVP A;  1WH7 A;  4B1R A;  1OFC X;  4C2M J;  3HOY J;  3GTL J;  5M3M J;  1U9N A;  4MLO A;  5F0H A;  2Y2Z A;  2XB5 A;  2M9H A;  4W1U A;  4J19 A;  1E3O C;  2YUS A;  2DMN A;  3DEW A;  2I10 A;  2DMQ A;  2QF7 A;  3S15 J;  4BBR J;  1DU6 A;  2ID3 A;  3ZQI A;  3BQZ A;  1X58 A;  4A3I J;  4A3K J;  1AHD P;  4LOC A;  1OCT C;  3ZQG A;  3K2A A;  1JT6 A;  1WI3 A;  4A3D J;  2Y9Y A;  3H3V K;  1S7E A;  5EYR A;  3UKG A;  3GTJ J;  3BTC A;  2TCT A;  2L7Z A;  3G1L A;  4XRS A;  3JRF A;  2K9S A;  5C4X J;  1JTY A;  4A93 J;  2LTP A;  2K40 A;  2WV1 A;  3VPR A;  3DCF A;  5M5X J;  4UUS B;  2VI6 A;  4I76 A;  2B63 J;  2LD5 A;  3TW6 A;  5EZH A;  1O4X A;  2R7Z J;  3M4O J;  2VUM J;  1MSF C;  2G0E A;  4A3F J;  2IBD A;  2P81 A;  2FQ4 A;  4D5F A;  5IYB J;  3B6C A;  2GBY A;  1W0T A;  1Q1V A;  3S16 J;  4DZP A;  1ZTR A;  3W6V A;  3FK6 A;  2LVS A;  1R9T J;  3C2B A;  2W48 A;  5M3F J;  1BW6 A;  3S1N J;  4C3J J;  2L0K A;  4QTR A;  1MBH A;  1MBG A;  2EZL A;  1FIA A;  3A01 A;  2EH3 A;  5K7F A;  3JRH A;  3JRA A;  3GTP J;  4Y52 J;  3LSR A;  4AYB N;  1GV5 A;  1JUP A;  1HCR A;  1XS9 A;  3S2D J;  3HM5 A;  5IP7 J;  3HOX J;  1T33 A;  1JKP C;  1RKW A;  2JN6 A;  2JA6 J;  3S1R J;  4FE4 A;  5E3M A;  4BKX A;  2M34 A;  4FIS A;  4RDU A;  3OIO A;  4M3D A;  1DU0 A;  3ZQF A;  3RZO J;  3JRC A;  3HDD A;  2AO9 A;  4A3B J;  4AC0 A;  2XRL A;  3QPS A;  3TP0 A;  2MG4 A;  1LFB A;  1POG A;  2VPR A;  5EG0 B;  2O8K A;  1BW5 A;  3LOC A;  1FJL A;  2R93 J;  1LFU P;  4BXX J;  3MN2 A;  5IP6 A;  1NK2 P;  3BR0 A;  1VFC A;  2CJJ A;  2NS8 A;  2EZH A;  2KT0 A;  3JRI A;  4EEF G;  4XRS G;  5EGO A;  1WH5 A;  3F0C A;  4IEJ A;  5IYC J;  2EQR A;  3BR3 A;  1BL0 A;  3TW7 A;  3CQZ J;  2DMU A;  3OSG A;  5FKL A;  2JA5 J;  2ME6 A;  4AUX A;  3S1Q J;  2DA4 A;  4XIC A;  2DA6 A;  2K9Q A;  1ETQ A;  2M0C A;  4X6A J;  3S14 J;  2FD5 A;  1RR7 A;  1TWA J;  2RAE A;  2IAI A;  1I50 J;  1JJ6 C;  2NVY J;  1LE8 A;  5GPA A;  2JWT A;  2LKX A;  1ETO A;  4A3C J;  2DA3 A;  2NVQ J;  4M3F A;  3Q0V A;  5DS9 A;  2HXI A;  3OOU A;  2NS7 A;  2HYJ A;  3A03 A;  1JGG A;  1Y1W J;  1AKH A;  5C4J J;  1VI0 A;  4M6V A;  1H8A C;  4BY1 J;  2R5Z A;  2TRT A;  5F27 A;  1ORK A;  1GDT A;  2L7F P;  2HOS A;  4RBO A;  2R0Q C;  2DA7 A;  3QPL A;  5EDN A;  1MBK A;  2CQX A;  1OCP A;  4M3E A;  2HOA A;  1JTX A;  3LSG A;  1NK3 P;  2E19 A;  1GVD A;  1ZK8 A;  1UHS A;  1A6I A;  2O7O A;  2R92 J;  5F04 A;  1YRN B;  1X2M A;  1OJL A;  4X1E A;  1U9O A;  3QQA A;  2GM4 A;  2R5Y B;  3OSF A;  2MGQ A;  5DTD A;  4NDL A;  1PUF B;  1XG1 A;  1H89 C;  4V2G A;  2DMT A;  1ENH A;  4W97 A;  3LNQ A;  3Q0U A;  2XSD C;  1B8I B;  1Z77 A;  2DJN A;  1JJ8 C;  3K7A J;  2MSY A;  2DA2 A;  2EZI A;  1IGN A;  3BT9 A;  5FKK A;  5FLV A;  2HOT A;  4IHY A;  4IHX A;  3H0G J;  3NAR A;  5EF6 A;  3GTG J;  3ZQH A;  1U78 A;  3S1M J;  2XB0 X;  5FKM A;  3FKI J;  5IOY A;  5K7Z A;  1RET A;  5C44 J;  1B72 A;  2QCO A;  1X2N A;  2M8G X;  1WGX A;  5M5Y J;  2MW8 A;  2NVX J;  4FCY A;  3FIS A;  4JX4 A;  1MBF A;  1JKQ C;  1RKT A;  1SFO J;  4CYC A;  2VKE A;  1JUM A;  3HKZ N;  1TWC J;  2DA5 A;  2Y0S N;  1MBE A;  2ECC A;  2PMZ N;  5BNG A;  3M3Y J;  1G2H A;  3GTK J;  5E3O A;  5F0C A;  2FX0 A;  1CQT A;  3LSJ A;  3B6A A;  3HBL A;  4D7M A;  4DYR A;  3ZQC A;  4Y7N J;  1WPK A;  2X9D A;  3BTI A;  3CDL A;  2LFB A;  1T56 A;  1ETW A;  3IH3 A;  4GFB A;  3PO2 J;  1TWH J;  5GP9 A;  2NVT J;  4DYC A;  3JRE A;  4D7N A;  2JK3 A;  3SFI A;  4A69 C;  1UG2 A;  3Q3S A;  1HDD C;  1ETK A;  1GUU A;  3ZOB A;  4C3H J;  4XK4 A;  2K9N A;  1ZR2 A;  2DA1 A;  2ME0 A;  3HB9 A;  3TP3 A;  1JT0 A;  3WHB A;  1IUF A;  4QSH A;  2CQQ A;  3BR6 A;  2GLO A;  2JMW A;  3FIW A;  5J1R A;  1ETX A;  2AHQ A;  1IG7 A;  2Y30 A;  3SJM A;  2ID6 A;  1NTC A;  3BR5 A;  1FEX A;  2YS9 A;  5F1J A;  1QPI A;  2CRG A;  3S17 J;  3GTO J;  1ITY A;  4MIM A;  4UUT A;  5E3L A;  4MFE A;  3GTM J;  5IPA A;  1JKO C;  1VND A;  1I3Q J;  4I6Z A;  3MKL A;  2JJ7 A;  2X48 A;  1ZR4 A;  4L5E A;  5E3N A;  2CUF A;  5J3L A;  1FTT A;  4S0H B;  3JRD A;  4UUS A;  1TC3 C;  4QIW N;  3JRB A;  1EF4 A;  4DW6 A;  1IRZ A;  5FLM J;  5EGO B;  3LSP A;  3G1M A;  1HDP A;  1TWF J;  1RPW A;  2XPU A;  1QVT A;  1H88 C;  3HOW J;  1K61 A;  3Q0W A;  1P7J A;  3BR1 A;  5FKO A;  2L9R A;  3HGY A;  2FJ1 A;  1QVU A;  1F36 A;  1XC5 A;  2CUE A;  3S2H J;  2N8G A;  2LK2 A;  5IYD J;  1HLV A;  2LP0 A;  3HEF A;  4IHV A;  2CU7 A;  5EEA A;  1MBJ A;  1LE8 B;  2KDZ A;  1W0U A;  2E1O A;  4M3B A;  4BBS J;  2E2H J;  4V2F A;  2XPW A;  3HOZ J;  2XGD A;  5FJ8 J;  1ZKG A;  1HOM A;  1UMQ A;  3HOV J;  1RES A;  4B4C A;  2Y9Z A;  4A3J J;  2XGC A;  1JUS A;  3I4M J;  1AKH B;  4FE7 A;  3IV5 A;  2E2I J; 
#chains in the Genus database with same CATH topology
 1FY7 A;  2DW4 A;  3DU6 A;  4JX6 A;  1GT0 C;  5D4R A;  1FYL A;  1ETV A;  1UAA A;  2XF6 A;  1RNL A;  1F4K A;  5FD5 A;  4M9Z A;  1MMN A;  4MNU A;  1YW8 A;  2XPV A;  4UV8 A;  1PP7 U;  5EG0 A;  3L2Q A;  5LHI A;  9ANT A;  4XN0 A;  2JRM A;  1ZG5 A;  5J1U A;  1APL C;  4PSW A;  3HRT A;  3O3K A;  5HLT A;  2VJ4 A;  1EV7 A;  2Y31 A;  4ABZ A;  3E5U A;  3QOD A;  2H94 A;  3FBI B;  4S04 A;  5DUI A;  4ENK A;  1TTY A;  1K83 J;  3CLO A;  4WXD A;  2VQC A;  4FQG A;  2JSC A;  2M2E A;  4D5C A;  4LIT A;  5J1R A;  2GIZ A;  4JP0 A;  1BA5 A;  3QOE A;  4E6K G;  4D1Q A;  2WA0 A;  4XBF A;  1K6Y A;  3K0L A;  4BE0 A;  2OTJ I;  4KMU X;  1FWZ A;  3FXU A;  1V4R A;  1RR8 C;  2V7F A;  3I4N J;  1IC8 A;  5HDK A;  1SEU A;  2AXL A;  2X6W A;  2E5Z A;  3H3U A;  1X1C A;  4KN4 X;  2HI3 A;  2IEK A;  3PM1 A;  4C3I J;  2HGC A;  2Z33 A;  4KN7 X;  2Q8K A;  1K79 A;  4DQ2 A;  1WVR A;  3I54 A;  2JA8 J;  3O8H A;  3L09 A;  5L3E A;  3BTJ A;  5EJC A;  5IT9 Z;  1YJW I;  1YIJ I;  4NC8 A;  5LRR A;  5F08 A;  3CO6 C;  2JPC A;  2ECB A;  2VON A;  5CVR A;  4M3G A;  2L3D A;  4BJ6 C;  1OYW A;  3LFU A;  2KIS A;  1XSV A;  2R7Q A;  2DJI A;  3WHC A;  3ZRG A;  4HPQ A;  2O0Y A;  3SDB A;  1T98 A;  1Y8Q B;  5FB2 A;  1ETY A;  3CMM A;  4I0A A;  3Q9S A;  1V3F A;  2QSG X;  4RGX A;  2ZB9 A;  4F7Z A;  5IP9 J;  1VF9 A;  1WJF A;  2JUC A;  1ZGW A;  1BC7 C;  2VE8 A;  2X6O A;  4AU7 A;  1BJZ A;  1AA7 A;  5JHF A;  4IF4 A;  2FOW A;  5FLX Z;  3CZ6 A;  1GV2 A;  2LLK A;  4FTH A;  3SDG A;  4MFD A;  2KP6 A;  4J01 A;  1K78 A;  4F52 A;  3ISP A;  3BG5 A;  3NRV A;  1LDK B;  3TBI A;  2EJR A;  2UWM A;  2EBI A;  3E5X A;  3TL4 X;  2CS3 A;  1QBJ A;  2BY0 A;  2XAF A;  2PMH A;  1OFC X;  4JBA A;  4C2M J;  3HOY J;  3GTL J;  2WAE A;  5F0H A;  3MQ0 A;  2A07 F;  4J19 A;  4J00 A;  4M6Y A;  2CFO A;  2DMN A;  2DMQ A;  2CW8 A;  2QF7 A;  3S15 J;  3HPG A;  4BBR J;  3F23 A;  3DV8 A;  1BI2 A;  3A1Y A;  4L18 B;  1UST A;  4A3K J;  1OCT C;  1OCC H;  4BU2 A;  1JT6 A;  2LY2 A;  2Y9Y A;  3BCB A;  2L02 A;  1S7E A;  5EYR A;  3UKG A;  3BTC A;  4MTD A;  3V4G A;  3KP7 A;  1PP8 F;  3DBH B;  4FHT A;  1T0F A;  3O6B B;  4I76 A;  4NHJ A;  3TW6 A;  5EZH A;  4E4H A;  1G3Y A;  1MSF C;  4L9J A;  5DCF A;  1RUN A;  2M87 A;  1SFE A;  1YJ9 I;  1BOB A;  5F1R A;  4DZP A;  5BMZ A;  1ZTR A;  4XKB A;  2DOE A;  3FK6 A;  3CTA A;  3VOE A;  2LVS A;  2OUM A;  2W48 A;  4GRI A;  1YHQ I;  4IVN A;  4YEL A;  4C3J J;  2VE9 A;  4G6D A;  2DOA A;  3A01 A;  5BS6 A;  1FBS A;  4EM2 A;  3JRH A;  3TDZ C;  3F72 A;  4PJ0 C;  4C9Y A;  2ZME B;  4F3Q A;  3NEU A;  1I5Z A;  1HKT A;  2KRC A;  4NUB A;  3HIF A;  3HOX J;  2X51 A;  3DBR B;  2VJI A;  2JN6 A;  2LF7 A;  4XLA A;  2LYC A;  4D9J A;  2JA6 J;  3FDY A;  3VSK A;  3JAM K;  1G8X A;  1LDJ A;  4FIS A;  2DYS H;  3R6S A;  5EEH A;  4RDU A;  2M45 A;  5LRS A;  5ICF A;  3VWB A;  4AID A;  2CQ7 A;  3S3N A;  1KGS A;  2KL4 A;  5TGT A;  2XRL A;  4Z2Y A;  2V26 A;  5GAG J;  2AS5 F;  5EG0 B;  3CO7 C;  3ZMU A;  3ZMS A;  3LOC A;  3GCM A;  4BXX J;  3HRS A;  3KZI C;  4U7D A;  3QPH A;  2BBY A;  4FX4 A;  1NK2 P;  5L3B A;  4IXA A;  4LLN A;  3WOD F;  2MA3 A;  1SAU A;  5LHH A;  1UZC A;  4EAT A;  2NNY A;  2CH0 A;  3T8T A;  3DTK A;  5HVQ C;  4IEJ A;  3CUQ A;  3TW7 A;  3N4M A;  2IJL A;  3OSG A;  1D1C A;  5FKL A;  2ME6 A;  4AUX A;  3S1Q J;  4BJT A;  4H4K C;  2C6Y A;  2DQL A;  1Z3X A;  1V5G A;  1VQ9 I;  2STT A;  3IWZ A;  3FMS A;  1ETQ A;  3DWL E;  1P6R A;  3KFW X;  4M71 A;  4O3M A;  1RR7 A;  1W4M A;  3KEO A;  2RAE A;  3KEY A;  4IOA F;  2NVY J;  4U88 A;  5GPA A;  4MTE A;  3WTW C;  2VBY A;  1Y8R B;  4ZYD A;  3SHF A;  1U8R A;  3HUG A;  3EET A;  3FXK A;  5A2Q Z;  3CCJ I;  1STZ A;  2R7U A;  1SMY F;  4M3F A;  3Q0V A;  1UCR A;  3OOU A;  2KRH A;  3LA7 A;  4CYD A;  2HYJ A;  5CVI A;  1Y1W J;  2DCE A;  3QU6 A;  2ZME C;  1VI0 A;  1X4O A;  5IT3 A;  1PVE A;  5CQE A;  2ZFU A;  5HS9 A;  2STW A;  2ZJ2 A;  2EIM H;  1GDT A;  1IN6 A;  3IWF A;  2L7F P;  3E0J B;  4RBO A;  2OV7 A;  2NXN B;  1I6X A;  2CQX A;  4PGH A;  1EH8 A;  5E20 A;  1LEA A;  2VN2 A;  5KCM A;  1VQK I;  2H6B A;  3HJE A;  5KHD A;  3GFI A;  1MW7 A;  4RS8 A;  1S7A A;  4IQJ A;  2E36 A;  4H0E A;  4DIQ A;  3BDD A;  2ZNY A;  1NK3 P;  4EJU A;  3O2P E;  5ILV A;  4B44 A;  1X2M A;  1OJL A;  1E3H A;  4XLP F;  3R0A A;  2HQN A;  4ZYA A;  2CQK A;  3KP2 A;  1R5G A;  1GXQ A;  3KYL A;  1LKX A;  2BE5 F;  1R00 A;  3QOP A;  3VYU B;  2KIF A;  4Z6Y A;  3Q0U A;  1J75 A;  3ZR8 X;  2DJN A;  2G9W A;  1K78 B;  2EZI A;  1YIO A;  3L2R A;  4IHY A;  3RJP A;  4BE2 A;  3NAR A;  5KAI C;  3PJR A;  4Q5S F;  3FWE A;  3ZQH A;  2HEO A;  2CW7 A;  1WJB A;  5J4V A;  2EA4 A;  3NWT A;  1ZRD A;  3K4C A;  2QLZ A;  2PX9 A;  1S7O A;  3OYD A;  1S8N A;  4II2 A;  5M5Y J;  3DKW A;  2K27 A;  4FCY A;  3PQJ A;  3KLN A;  1IN7 A;  2JT1 A;  3J7A Y;  3V42 A;  3K70 D;  2M1B A;  1S6L A;  4CYC A;  2GXB A;  5E1Z B;  1JUM A;  1TWC J;  4MEX F;  2E7X A;  3WGI A;  3L2U A;  2X1E A;  4HW0 A;  4RB1 A;  1U5T C;  3HKZ A;  2L54 A;  2DO7 A;  2Y0S A;  1OLT A;  3LSJ A;  4KJZ A;  3B6A A;  3ZQC A;  3PUF A;  3CDI A;  3HZJ A;  2ZXI A;  1KYZ A;  1WPK A;  2QQA A;  2X9D A;  2Z3Y A;  3BTI A;  4EJO A;  1LJ9 A;  1L0O C;  3DP7 A;  1T56 A;  1ETW A;  3IH3 A;  3LQQ A;  1X1B A;  3QP5 A;  4CCO A;  3I71 A;  5GP9 A;  4RAG A;  3E97 A;  4DYC A;  2DI3 A;  3JRE A;  4EJW A;  3EUA A;  5DM6 F;  1TW2 A;  1UG2 A;  3K10 A;  1ZLJ A;  3G71 I;  2BW3 A;  4N9I A;  1OCR H;  4G8X A;  3ZOB A;  5BQT A;  3WTV C;  1SAX A;  2B9S A;  4BQA A;  2F5V A;  2M4K A;  1FMW A;  2DA1 A;  3TP3 A;  3VYT B;  4QSH A;  2FE3 A;  4XOP A;  1X3U A;  1KZH A;  3FKJ A;  1JHH A;  2VKH A;  2JMW A;  3FHN A;  4RB0 A;  5E79 C;  4AIH A;  2Y30 A;  3CDH A;  2ID6 A;  1NTC A;  4G7O F;  1W7P A;  3S17 J;  4WXH A;  4UUT A;  1V5F A;  1FYM A;  3GTM J;  4ENM A;  2A61 A;  2W25 A;  4II3 A;  1I3Q J;  1IRX A;  3BOQ A;  2QWW A;  2X48 A;  1ZR4 A;  1ACI A;  4RGS A;  4N4N B;  2QYO A;  5E3N A;  3I5U A;  2CUF A;  3LA3 A;  3OL3 A;  5HNF A;  2P5K A;  1QGP A;  4RLF A;  3JRD A;  2NOJ B;  3JRB A;  4B43 A;  1EF4 A;  4KNY A;  1UG0 A;  5K5Q A;  4LMY A;  3IKV A;  5FLM J;  1QHH D;  2HKO A;  1ZG1 A;  3T1B A;  3LSP A;  5L3F A;  1RC9 A;  2BZT A;  1HDP A;  1TWF J;  2XPU A;  2D1H A;  4NQW A;  1H88 C;  5LHG A;  3CUQ B;  3A4C A;  3U1D A;  1IF1 A;  1RUO A;  1XC5 A;  5H6Q A;  2CUE A;  3RYR A;  3KCC A;  4PZJ A;  4UHT A;  4QPO A;  4UNO A;  4B09 A;  4XKW A;  4RLQ A;  2EV5 A;  2LK2 A;  2Y69 H;  1HLV A;  5IYD J;  1BM9 A;  3HTS B;  3F9K A;  1VQ7 I;  3AG2 H;  4G6Q A;  2WTE A;  1V55 H;  4M6X A;  2JQ7 A;  2KDZ A;  2MD0 A;  1XMK A;  3KZY A;  3CP8 A;  2FOK A;  1OR7 A;  3HUG B;  4M3B A;  1X1D A;  4XLC A;  3M1C A;  1REP C;  2UUZ A;  3HC7 A;  1A04 A;  4V2F A;  2XPW A;  3ZXS A;  4KIS A;  3HOZ J;  5FJ8 J;  3F3X A;  2QKL B;  1HOM A;  1J9I A;  3RPU A;  2Y9Z A;  4A3J J;  4G6T B;  1B59 A;  4BGD A;  3LSI A;  1O57 A;  2P7V B;  1Z9C A;  4RM3 A;  3ERM A;  5HOO A;  2OTL I;  4CGZ A;  3I4M J;  1FOX A;  4FE7 A;  3KP3 A;  2DQR A;  1A31 A;  3ZMZ A;  2OF7 A;  3JR9 A;  1D5Y A;  2ACJ A;  2RRE A;  1TW3 A;  2DTZ A;  3GFL A;  3I0T A;  1Y39 A;  3V8J A;  3BG3 A;  3LFK A;  4BY7 J;  1W5S A;  3HGG A;  3ESW B;  4A2U A;  2XAH A;  3H92 A;  1FIP A;  2EZK A;  2VQG A;  3OYB A;  2O9L A;  3HHG A;  3ONQ A;  2EIL H;  2F4M B;  5HDN A;  4MO7 A;  4CHU A;  2HYG D;  5AON A;  4B3X A;  1T08 B;  2V9K A;  4EJV A;  1BN5 A;  2RN7 A;  1V54 H;  4HX8 A;  5J6X A;  4HNT A;  4WXC A;  1MH4 A;  3BG9 A;  4B3A A;  5LGU A;  1WCM J;  3OYN A;  4IHT A;  4R79 A;  3K70 C;  2BY2 A;  4A3M J;  1HF0 A;  1Y1V J;  2V1D A;  4MHG A;  1PUE E;  1U0J A;  3MKW B;  2M3A A;  4BQQ A;  1USS A;  2X6Y A;  3EDP A;  3FK7 A;  4UUV A;  2V79 A;  1FOY A;  5H20 A;  2W57 A;  1MH3 A;  4CH7 A;  5E1W A;  4IO9 F;  4G7Z F;  3CUQ C;  1HA8 A;  2P6T A;  1R22 A;  3J7A O;  2K5C A;  3ASN H;  1GVJ A;  5H2F C;  2ZJR F;  1X4P A;  4LLL A;  4MQV A;  4OWR B;  1PDN C;  1VQ8 I;  2L9N A;  1Z21 A;  2LBF A;  2VAS A;  3H1C A;  3PNY A;  4G12 A;  2GXA A;  5HOD A;  2V6C A;  2JZY A;  1SVL A;  4C2T A;  4ITV A;  2HXO A;  4B47 A;  1FC3 A;  4XID A;  1IDZ A;  1WRJ A;  4CYC B;  1QRY A;  1O3S A;  1E2X A;  2V9P A;  3QU3 A;  3JRG A;  4LIV A;  1KQ0 A;  4LK1 F;  2ELH A;  3VDX A;  3C3W A;  2HDW A;  4YIR X;  5F0F A;  3BR2 A;  3BCA A;  2QUF A;  5KNL A;  3H35 A;  2X4H A;  1TL8 A;  3MCZ A;  3IH2 A;  3OMY A;  1AU7 A;  4LD5 A;  3PO3 J;  1T6S A;  3LMM A;  3BY6 A;  3R4K A;  1MSE C;  5E1X A;  1ZQ3 P;  5B1A H;  3FZV A;  1IW7 F;  1A36 A;  1O3Q A;  3O8G A;  2HPI A;  3T8R A;  3J7Y J;  4OIO F;  3OY9 A;  3SEZ A;  3HPH A;  4LFU A;  2K3F A;  3RYP A;  5BOX A;  5IOZ A;  2ADU A;  1IO2 A;  2K3P A;  1F43 A;  1BIA A;  1Y0N A;  3U2R A;  4BNC A;  2V9V A;  2L7M P;  2HU9 A;  3BTL A;  3H9J A;  4ESF A;  2HTS A;  1LPQ A;  3G73 A;  2BW3 B;  4A3L J;  3N05 A;  4ZZL A;  2NRA C;  2MH2 A;  1FTZ A;  5FKN A;  5HNH A;  3VSL A;  2FRH A;  3J81 Z;  3RPU D;  3FXM A;  2VKV A;  4D0P A;  1WH7 A;  4B1R A;  1CF7 A;  4GYG A;  3BLY A;  1KA8 A;  4HV5 A;  2Y2Z A;  2Q0O A;  4W1U A;  3JTH A;  5CVJ A;  4EMS A;  2HPM A;  1W7P B;  2IT0 A;  3ZQI A;  3BQZ A;  4HAM A;  4U87 A;  3CJR B;  3DFG A;  3ZQG A;  3K2A A;  3U9G A;  1JI8 A;  2H09 A;  2XAS A;  1HW1 A;  1HXD A;  4PDK A;  3H3V K;  1OCZ H;  2OC6 A;  1IXR C;  2CQN A;  2UZK A;  5ERI A;  3G1L A;  4PGG A;  2K9S A;  5C4X J;  3J80 Z;  1ZRF A;  4A93 J;  2LTP A;  2EFW A;  3VPR A;  4BXU A;  1H9T A;  1B1B A;  2DYR H;  2PJR A;  2V1N A;  2B63 J;  2LD5 A;  2R7Z J;  2V6E A;  4PJM A;  3WTT C;  1W36 D;  2W85 A;  2VUM J;  4CCM A;  4A5M A;  1FBU A;  3S8P A;  5IYB J;  1D8K A;  3B6C A;  1W0T A;  3A2K A;  4AD9 A;  3S16 J;  4NB5 A;  3BRO A;  4RMN A;  4NQW B;  1FBQ A;  3HXL A;  1PYV A;  2Q2E A;  1IRG A;  4NC7 A;  3TQN A;  1MBH A;  4P9F A;  3PQK A;  4AYB N;  3KET A;  1HCR A;  3A0H C;  5F64 A;  2KKO A;  1WJA A;  1J5Y A;  1DGR M;  4Q48 A;  4IRG A;  1T33 A;  3GVA A;  4EM0 B;  4CA0 A;  1AOY A;  4HLX A;  1VQL I;  3CCS I;  3BZC A;  3S1R J;  2J5O A;  5E3M A;  3E6C C;  2M34 A;  1IN5 A;  4DBQ A;  3PFY A;  3EUH A;  3OIO A;  4BEH A;  3HRU A;  3CC7 I;  4R8H A;  2Z16 A;  1TP4 A;  3ZQF A;  3CF5 F;  1U5T A;  3L00 A;  3JRC A;  3C7J A;  2QZ8 A;  3WE3 A;  2RGV A;  4A3B J;  3QPS A;  2E60 A;  3TP0 A;  3H36 A;  1OIS A;  3MD2 A;  2O8K A;  3GZN B;  1FJL A;  4LB6 B;  1X3W B;  4OIQ F;  1BR4 A;  4AWX B;  4HYE A;  2KRF A;  2Y0M A;  5FFZ A;  2M8E A;  3KLO A;  2K85 A;  3CP2 A;  1R5I D;  3IP4 B;  4HQM A;  1YW9 A;  2NS8 A;  3DTE A;  2EZH A;  1G4D A;  5ICE A;  3FXJ A;  2KT0 A;  4A0X A;  5EGO A;  2CWE A;  2D1V A;  4R1H A;  2XAU A;  4GXO A;  3BR3 A;  1A35 A;  4S05 A;  4EGZ A;  3LAJ A;  2FNP A;  3CCE I;  1P2F A;  3OYI A;  1DP3 A;  3JCU C;  2DA4 A;  1J7K A;  4Y3O A;  2K9Q A;  3VEP A;  4XIC A;  2M0C A;  3TDU C;  2HVS A;  3S14 J;  3QYE A;  3KP4 A;  4HQE A;  1I50 J;  3L7W A;  5FRN A;  1JJ6 C;  1HW5 A;  2XF7 A;  3DU5 A;  3C2H A;  1LE8 A;  2GA2 A;  2JWT A;  4U0V A;  4HNU A;  4KIC A;  1YO5 C;  1ETO A;  2LRD A;  2BOL A;  2EV0 A;  1T8I A;  2KPM A;  3GF2 A;  3JTG A;  3HOS A;  1Z6R A;  1IXS B;  2LBF B;  3ECO A;  5GTI C;  1G59 A;  4ZDO A;  1YE9 A;  2VLA A;  2W24 A;  5HLI A;  5IT9 K;  4RM2 A;  4OIP F;  2IXS A;  1F1Z A;  1AKH A;  2FML A;  4B8X A;  3WTS C;  2GQQ A;  2R7O A;  3SZG A;  1H8A C;  2DT6 A;  1G3T A;  4BY1 J;  2TRT A;  2HOS A;  1OR7 C;  2DA7 A;  3A0B C;  3QPL A;  1IN4 A;  1MBK A;  1YS6 A;  3GFM A;  3HSE A;  4I09 A;  4XOR A;  1K4S A;  2GXG A;  2K9M A;  1W5C C;  2HOA A;  4G7H F;  2RKH A;  2EFN A;  3MKZ A;  3LQR A;  1GVD A;  2VC1 A;  3IAM 2;  1A6I A;  2R92 J;  3ABM H;  1FPQ A;  4OAY A;  1Q1H A;  4X1E A;  3WE2 A;  3QQA A;  2G7H A;  5TIS C;  2GM4 A;  5FLX K;  3ZQQ A;  4HX7 A;  2VOO A;  3WTY C;  4P96 A;  4NDL A;  4ESJ A;  1H89 C;  1XGO A;  2DMT A;  1ENH A;  1WJ5 A;  4RAY A;  4W97 A;  3LNQ A;  3ZN0 A;  1VQN I;  1IRF A;  2O61 A;  5BPI A;  2TDX A;  1JJ8 C;  1J2X A;  4ZTJ A;  3K7A J;  2MSY A;  4DBR A;  2YU3 A;  4RB2 C;  3DPU A;  3H9G A;  1R4N B;  3M8E A;  4IHX A;  2X6X A;  2VPL A;  5KAF C;  5DD8 A;  2A69 F;  1UEL B;  2ZNZ A;  5EF6 A;  1F5T A;  2LH9 A;  2OAZ A;  3S1M J;  2FXA A;  5D4S A;  5CVU A;  1CF7 B;  1BI0 A;  2R7F A;  2KHM A;  3M7G A;  4U0Y A;  1NG6 A;  5FKM A;  1F9N A;  2JVG A;  5IOY A;  1LVA A;  1W36 C;  3HL2 A;  1B72 A;  5ED4 A;  2F5F A;  2M8G X;  2LOO A;  5D5X B;  5KK1 A;  5E17 F;  3ZP5 A;  3PSI A;  2MFZ A;  1MJB A;  2VXD A;  1JKQ C;  1N78 A;  4HX4 A;  3CCL I;  1SFO J;  4AVZ A;  2DA5 A;  4BS9 A;  4F91 B;  1HW2 A;  4DOZ A;  5B3S H;  3CES A;  1SD5 A;  3M3Y J;  3LSM A;  2HKX A;  4QWQ A;  3GTK J;  3CCU I;  1YIT I;  4WK8 F;  1W1W E;  3JSP A;  1MD0 A;  1SFK A;  4LG3 A;  2EWN A;  3GW2 A;  3ZMV A;  4Y7N J;  2ZSI B;  2PJR B;  3CC4 I;  2KJB A;  3CMA I;  2F48 A;  1G6N A;  2XDV A;  4I0B A;  3LSK A;  4GFB A;  1OYY A;  3QP6 A;  4ZTF A;  4GDF A;  2OZU A;  1YS7 A;  1TWH J;  3L9F A;  3AL0 B;  1XSX A;  2AQF A;  2GOX B;  4ZZD A;  4A6E A;  3P7N A;  4GCV A;  4OMY A;  4OU0 A;  3MZ8 A;  3SFI A;  4A69 C;  4AVP A;  5TJJ A;  3Q3S A;  2Q2E B;  3ASO H;  2WY7 Q;  3QWL A;  2X85 A;  2I8D A;  1ETK A;  4YIF A;  3ABK H;  4I2O A;  1ZR2 A;  1TQM A;  5GAD J;  2ME0 A;  2V4J C;  3HB9 A;  1MDM A;  3WHB A;  1IUF A;  3DKX A;  1YQA A;  3BR6 A;  2QQ9 A;  3WGG A;  5DM7 F;  2GLO A;  3ML6 A;  3M9A A;  2BHY A;  3FIW A;  1EH7 A;  3K4L A;  4JQF A;  1WJC A;  2MH9 A;  2NS0 A;  4MEY F;  1NHA A;  1FZP B;  2PQ8 A;  4L0Z B;  2FBK A;  2YS9 A;  3KPH A;  4BDZ A;  5F1J A;  4NBQ A;  4BEH B;  4L9V A;  1SD7 A;  2JVH A;  3GTO J;  2L4A A;  3PNT A;  4QPQ A;  1U5T B;  3TO9 A;  5IPA A;  1VND A;  3HG9 A;  4KUM A;  3AKZ A;  3WU2 C;  1O7L A;  2VJJ A;  2KIQ A;  5J47 A;  2X0L A;  1XB4 A;  4BE1 A;  1ZAR A;  1NG7 A;  3V7R A;  1SVO A;  1I27 A;  1IV8 A;  1FT9 A;  2DBB A;  2P4W A;  3R60 A;  5FO5 A;  3U1K A;  2WB1 A;  5JHU A;  2DDB A;  3U21 A;  2R7W A;  4XLE A;  1Y6I A;  3OS2 A;  2LC2 A;  2QBY A;  2HZT A;  2VB6 A;  3KP6 A;  3PL8 A;  3K1N A;  4XLF A;  3MZH A;  5EGO B;  3G6E I;  3G1M A;  5J8C A;  1PJR A;  1RPW A;  3C1D A;  1D8J A;  4ON0 A;  3HOW J;  3FBN B;  3Q0W A;  1P7J A;  1XN7 A;  2HZD A;  3C18 A;  4ANJ A;  4KA4 A;  2K86 A;  3I64 A;  2P0W A;  4XMY A;  2ISZ A;  3MFK A;  2VQH A;  2IGK A;  2LP0 A;  3HEF A;  1UB9 A;  5A2Q K;  4IHV A;  1ZRC A;  2DT7 B;  1XCB A;  2YX4 A;  2BHZ A;  5EEA A;  1LE8 B;  4BDY A;  3AL0 C;  2CUZ A;  4P9U A;  4XKC A;  4BBS J;  2XGD A;  3P5J A;  3ROU A;  1ZKG A;  3DKY A;  2DK5 A;  1FOK A;  3ELK A;  1RES A;  3HOV J;  4O6J A;  5D8L B;  4YRV A;  4BYY A;  2P5L C;  2L9V A;  1LUJ B;  1W5T A;  1JUS A;  3IHU A;  1O3R A;  1AKH B;  1ZLK A;  3IV5 A;  3CME I;  1YX5 A;  3BJA A;  5DEQ A;  3IKT A;  4A3E J;  1WWX A;  3E7L A;  1FOW A;  3BQY A;  4RGU A;  1UHW A;  2WC2 A;  4UB6 C;  5LGN A;  1R7J A;  1MNM C;  1LFP A;  5M5W J;  2L7K A;  1U8B A;  1IUY A;  1Z05 A;  2WAQ N;  3EUH C;  1ZHF A;  2R4G A;  4LLG F;  2V1U A;  1KON A;  3I55 I;  1X1P A;  5AIQ A;  1S29 A;  2DXI A;  1Z0X A;  4I99 C;  3AG1 H;  4ZDL A;  3MAJ A;  4HDU A;  2NAZ A;  3SYT A;  3K2Z A;  3P9K A;  3K1P A;  4CUG A;  1E3P A;  1BJA A;  4UVC A;  3ZMT A;  5E8I A;  1TWG J;  2CGP A;  1HKS A;  4A3G J;  1MJ9 A;  3IRQ A;  3BJ6 A;  2JRT A;  2XHK A;  5CQG A;  3D1N I;  2J5P A;  4I02 A;  4N4O B;  5KVR A;  3OYK A;  4I98 B;  2CUJ A;  3RQI A;  4ZYH A;  3JSO A;  3ZQL A;  2QVO A;  3CUO A;  3FXQ A;  2L2O A;  5D6F A;  2IA0 A;  2E2J J;  2KMU A;  2EB7 A;  3CJT B;  1LB2 A;  3QAH A;  4YII A;  2H1K A;  3QYB A;  4DZJ A;  3A01 B;  5DD4 A;  2W4S A;  4GGG A;  1TT5 B;  5JLX A;  1B72 B;  1XCV A;  4PJJ A;  3H5N A;  3DF8 A;  5JFR A;  3MZY A;  1K7A A;  1IDY A;  1YFH A;  4C30 A;  4CXF A;  2VOP A;  1LQ1 A;  2CFX A;  3I59 A;  3RKQ A;  2BGC A;  5F6F A;  5JVT A;  1TBX A;  3M8J A;  3RZD J;  1QPM A;  3G1O A;  2DK8 A;  3L1P A;  2L5Q A;  5J1Y A;  3K4J A;  1LDD A;  1OPC A;  2MBF A;  2LR8 A;  2XGE A;  2X1D A;  2XRO A;  3OS0 A;  2LY9 A;  2LY1 A;  4BQN A;  1T38 A;  1XD7 A;  2FMY A;  1Y0U A;  4OIR F;  1H9G A;  4HNV A;  3TGN A;  4P1W A;  1IV6 A;  2WB1 N;  2BEO A;  3HOU J;  1OKR A;  2PBI A;  1R49 A;  5AIP A;  4Q4Z F;  1B9M A;  2L4M A;  2BY3 A;  2CV1 A;  3CCY A;  3LST A;  2KIM A;  3FXR A;  1B8I A;  1LVK A;  1ZGJ A;  3EYY A;  3RCO A;  2LNB A;  2WAF A;  3G3Z A;  3NAU A;  3K6G A;  2KFD A;  2E1N A;  4XSX F;  2FNA A;  1TT0 A;  4UVB A;  2ZXH A;  3GME A;  2LDU A;  1SFX A;  1MDM B;  1R4M B;  3ECH A;  5DV5 A;  2YU9 J;  1I6H J;  4OOI A;  3I58 A;  5M3M J;  1YTY A;  4MLO A;  4JOM A;  5D5W B;  2M9H A;  3DTI A;  2YUS A;  5GAE J;  4AM3 A;  1ODD A;  1DDN A;  3D0S A;  3FXL A;  1S72 I;  2IP2 A;  3GXO A;  4HF2 A;  2XF5 A;  1DGW Y;  3OR1 C;  1MGT A;  2M7A A;  3L2C A;  1DU6 A;  2EFP A;  4XL9 A;  3FMQ A;  1BBY A;  2BXY A;  4PFO A;  4KT6 A;  1AHD P;  4LOC A;  3OYA A;  4UV9 A;  1WI3 A;  3GO5 A;  4A3D J;  2XAQ A;  2YSR A;  3QYF A;  4WX9 A;  2K4J A;  5B1B H;  2P8T A;  2KQR A;  6PAX A;  4XRS A;  1ZAO A;  3CJQ B;  3RKY A;  4NNJ A;  4XN3 A;  2W84 A;  2K40 A;  2HQA A;  5M5X J;  2ELJ A;  2VI6 A;  1O4X A;  1OYI A;  1EA3 A;  2G0E A;  1SD6 A;  4A3F J;  3Q9V A;  1R58 A;  1L3L A;  2QBY B;  3EYI A;  3WGH A;  1VQ4 I;  2JTV A;  4E7L A;  1DUX C;  2QEN A;  1XDU A;  2A5Y B;  3W6V A;  2A6T A;  1KQ8 A;  2EFQ A;  1WHU A;  1P9Q C;  3G2B A;  1BW6 A;  5LEJ A;  3S1N J;  5BPD A;  4OMZ A;  1TZL A;  2L0K A;  2F5D A;  1MBG A;  2EZL A;  4I01 A;  1M1E B;  3M1E A;  3GTP J;  3JRA A;  1ONV A;  1I39 A;  4U0W A;  4UXN A;  3LSR A;  4WF2 A;  1GV5 A;  1JUP A;  3BZK A;  2OU2 A;  1VQ5 I;  3S2D J;  5IP7 J;  4AYB A;  2XVC A;  1FSH A;  4NC6 A;  3TO6 A;  4CZC A;  4IHS A;  4KDP A;  3T0Y A;  2DTR A;  1JKP C;  2WV0 A;  3ZPL A;  2BVL A;  1RKW A;  3KYC B;  2MLK A;  4E7Z A;  3RIR A;  4BKX A;  3KYD B;  2ZJP F;  2VJ5 A;  4F92 B;  1R6R A;  2PMZ A;  2A68 F;  4IRH A;  3CCQ I;  4L0Y B;  4M3D A;  1DU0 A;  4HV6 A;  5D5V B;  5E18 F;  1P4X A;  3OYH A;  1HBX G;  3RZO J;  4BAC A;  4BHB A;  4ZYE A;  3ABU A;  2OD5 A;  3DEU A;  2AO9 A;  3EQL F;  3NQO A;  4AC0 A;  3ERE D;  2E5N A;  2MD5 A;  1LFB A;  1POG A;  2NYX A;  2OQG A;  4IQ4 A;  1IAW A;  4XSZ F;  5GAH J;  4OIN F;  4KIF A;  4XLN F;  1LFU P;  2EPF A;  5FD6 A;  1T39 A;  2KIU A;  2RNG A;  2E71 A;  1JHF A;  3BR0 A;  4MGR A;  1VFC A;  2GOM A;  3IAS 2;  1AWC A;  1IXC A;  4BJ5 C;  3JRI A;  4EEF G;  2A6E F;  4XRF A;  4XRS G;  1VTN C;  3V7S A;  2EQR A;  1BL0 A;  4GYI A;  4PJL A;  2DMU A;  3CQZ J;  4IRI A;  1YI2 I;  2B7E A;  4RGR A;  3HSR A;  2FQ3 A;  2VQL A;  1D1A A;  2DA6 A;  4G94 A;  2F2E A;  1T95 A;  2HQR A;  4X6A J;  5K5O A;  2IRF G;  3P9C A;  1MKM A;  2PN6 A;  3RKX A;  1OQY A;  1QZY A;  2OCE A;  4IOC F;  4HSR A;  3I3L A;  4KFC A;  2P7C B;  5ICC A;  1WZ2 A;  2OA4 A;  4BAY A;  2HS5 A;  3K1M A;  2LSO A;  2LKX A;  2FUG 2;  4A3C J;  4FX0 A;  4BL0 B;  2R7X A;  5DS9 A;  2LRE A;  3HYI A;  2ESH A;  1EKE A;  5K1Y A;  1JGG A;  1FNN A;  2EA2 A;  3WG9 A;  4IPA A;  1UFM A;  5C4J J;  1ZH5 A;  3W2A A;  1D0X A;  1ON2 A;  3I59 B;  1LNW A;  4BUP A;  2R5Z A;  5F27 A;  4AIJ A;  4HBL A;  2MLG A;  1ORK A;  1FYK A;  2CYY A;  3KZZ A;  5K5R A;  1OCP A;  1BOA A;  3PSF A;  1JTX A;  3GYH X;  1MMG A;  2H6C A;  1TLH B;  2R7D A;  3FM5 A;  2A5W A;  3RSN A;  1RRJ A;  1JE8 A;  5D6E A;  3LSG A;  3AG3 H;  1E17 A;  1B4A A;  4PSX A;  4M73 A;  2O7O A;  2RQQ A;  5F04 A;  3REO A;  4WCG A;  2PMU A;  4JK1 X;  1ZGA A;  4TV7 A;  4L5J A;  2M7B A;  3F6V A;  1B9N A;  2MGQ A;  5L3D A;  1XG1 A;  4V2G A;  2DAO A;  2IPQ X;  2DLL A;  3OYC A;  2XSJ C;  3J81 K;  4HRI A;  2XSD C;  3BC8 A;  3RKW A;  1B8I B;  1Z77 A;  2IVM A;  1GLN A;  2BY1 A;  2DA2 A;  3BT9 A;  5FKK A;  5FLV A;  1R5H A;  1HKQ A;  1D1B A;  2A05 A;  1G3W A;  2RV8 A;  4Y15 A;  3H0G J;  1U78 A;  2XB0 X;  5FRO A;  2JUG A;  4P55 A;  2QA4 I;  3JW4 A;  3FKI J;  3R61 A;  3OR2 C;  3AAF A;  1B6A A;  2QCO A;  1XGM A;  2NVX J;  2KLO A;  1XPX A;  4JX4 A;  3EPZ A;  4IKF A;  1MBF A;  4LGW A;  1RKT A;  3F6O A;  3D5S C;  3J80 K;  1R1U A;  3BG7 A;  1MBE A;  2ECC A;  2PMZ N;  5BNG A;  2YX7 A;  2KZV A;  3IUO A;  5E3O A;  2VXZ A;  5F0C A;  1YYV A;  4ZH4 F;  2FX0 A;  5LLQ A;  1CQT A;  1VZ0 A;  2JPB A;  4E7S A;  3HBL A;  3PFI A;  2ZC2 A;  4ENN A;  1MMD A;  3FM3 A;  2Y75 A;  3CDL A;  5LFA A;  3ZGK A;  1BC8 C;  2MAB A;  3DBL B;  4E7H A;  3PO2 J;  3I4P A;  3OYJ A;  2RDP A;  4YFN F;  4D7N A;  2ETH A;  2JK3 A;  2RC4 A;  1WKM A;  1D3Y A;  1GUU A;  1KU2 A;  3UNG C;  2XIG A;  3E1S A;  2K9N A;  2OZ6 A;  1FMV A;  3F22 A;  1R23 A;  1JT0 A;  3WTU C;  1QA6 A;  2G7U A;  4ZC3 A;  1ETX A;  2RQP A;  2V1X A;  3K4N A;  4P5O A;  2OBP A;  5HLH A;  1IG7 A;  1FEX A;  3CLQ A;  3L2V A;  4E70 A;  2EFO A;  1RIO H;  2M0M A;  3RDI A;  2QEX I;  4LG0 A;  1YJN I;  2CRG A;  1BI3 A;  2HVQ A;  1J09 A;  3LWF A;  4M72 A;  2FBH A;  3OYL A;  1QU3 A;  3GZ5 A;  4MIM A;  5B5E C;  1VQM I;  4MFE A;  2EIJ H;  1JKO C;  1MIJ A;  4I6Z A;  2FA5 A;  3MKL A;  3VYR B;  3SZP A;  3OIP A;  3UR3 C;  2F4O B;  2JJ7 A;  1FP2 A;  3WG7 H;  2OQR A;  2VBW A;  3P9I A;  1D0Z A;  1R1T A;  4S0H B;  1MJA A;  4UUS A;  2K7L A;  4A12 A;  1IN8 A;  1S9H A;  4DJA A;  3FXO A;  3KP5 A;  3G4S I;  1FX7 A;  2P6S A;  4A0Y A;  3ABT A;  5J4Y A;  5LEK A;  1IRZ A;  3W3C A;  3Q5F A;  1QVT A;  3CF2 A;  1ULY A;  5E8G A;  3VOD A;  1SC7 A;  3NWS A;  3BR1 A;  3K4M A;  2M5W A;  1F36 A;  1ON1 A;  4CZZ A;  3S2H J;  2Z99 A;  1HST A;  2PG4 A;  1QO0 D;  2KDO A;  1YOV B;  3K69 A;  3VFZ A;  3K9T A;  1SFU A;  4EV0 A;  1EH6 A;  3TO7 A;  2CU7 A;  2HYF A;  2XAG A;  5CKT A;  3V8K A;  2KZG A;  5J40 A;  4LK0 F;  1IZ1 A;  2WBM A;  4B4C A;  1ZRE A;  2DFE A;  2HR3 A;  2F5C A;  2XGC A;  3OIQ A;  4ZYG A;  2D45 A;  2CV2 A;  2IS2 A;  1LEB A;  3BG6 A;  3CMY A;  2VOD A;  1I1S A;  1P4A A;  3JAM Z;  2R5Z B;  3H5A A;  5L3C A;  1WSU A;  2PFB A;  2XKO A;  3FX3 A;  2OPT A;  2O3F A;  3PNV A;  5C3E J;  1FP1 D;  1R1V A;  2R7V A;  2IS6 A;  3GUD A;  3K4B A;  2E1C A;  3AG4 H;  4HST A;  1JGS A;  2ZFW A;  4JX5 A;  4RB3 C;  2DN0 A;  4XR6 A;  4EVI A;  2WAQ A;  5ILS A;  3ZN1 A;  3FMR A;  1K6O A;  2BVM A;  2UV1 A;  1C0W A;  4RAF A;  3KX2 A;  4XON A;  1BR2 A;  3GTQ J;  2CG4 A;  2DMP A;  2Z9O A;  3RPQ A;  3RTR A;  2IGN A;  2JA7 J;  3A02 A;  1UHM A;  4KIG A;  3OYF A;  5K7H A;  2HQ5 A;  4L9N A;  2BXZ A;  3DEE A;  1SVM A;  4X0G A;  2YR2 A;  2HDD A;  3F8F A;  3ULQ B;  2L9S A;  1QQI A;  5JLW A;  4BHP A;  2NNN A;  2XV4 S;  1Z3Y A;  2F4I A;  4IL6 C;  4XRM A;  1P7I A;  4PJN A;  4IHW A;  3S32 A;  3LL7 A;  5GPC A;  3MWM A;  1J0R A;  5EZG A;  1DPR A;  1Z7U A;  2GA1 A;  3QPT A;  2ELK A;  4QLC U;  1A6Q A;  1IJW C;  2XRN A;  3B73 A;  1OCO H;  3I9V 2;  1ZN2 A;  2QSH X;  5LGT A;  3DLA A;  3OYE A;  1R36 A;  1HSJ A;  4M9X A;  2R7T A;  2NOG A;  3CC2 I;  2H8R A;  1E0E A;  3DQV C;  1XMX A;  2W1O A;  4A5N A;  2DOF A;  4JYK A;  4O5V A;  3PIP F;  5JVG F;  5CVV A;  2ZCW A;  1KU9 A;  2VL8 A;  3DPT A;  3SEQ A;  4B48 A;  3MMY B;  3IH4 A;  4DYQ A;  4ESB A;  1EJ9 A;  2COM A;  2DU9 A;  4MQ9 F;  3K4K A;  3I53 A;  3D5R C;  1XTA A;  1G3S A;  1O3T A;  3GBG A;  3HHH A;  2D5V A;  2COB A;  1XDS A;  2GAU A;  2HOE A;  5HDG A;  1YRN A;  3GZ6 A;  1JKR C;  5ICG A;  5CJ9 A;  2R5Y A;  3S3O A;  1SAN A;  2XC7 A;  2O6G E;  2FF4 A;  3KIO A;  4PK4 A;  1PUF A;  3IC7 A;  4N0B A;  3TED A;  1NH3 A;  1U6G A;  1QZE A;  3F21 A;  2QGU A;  2QM3 A;  2DFI A;  2EIN H;  3F8N A;  1CGP A;  2A3S A;  2FBI A;  4HZF A;  2Q1Z B;  2CSO A;  1VQ6 I;  2ZXW H;  2XKP A;  5ILU A;  2HNH A;  1Z6T A;  1A5J A;  2WY8 Q;  2O5R A;  2FU4 A;  1KYW A;  3MVP A;  2IA1 A;  3HOT A;  2DFH A;  3D5L A;  3H5R A;  4CIC A;  2WWY A;  2FSW A;  1T2K A;  1U9N A;  2XB5 A;  1E3O C;  1BIB A;  1D5V A;  5HLG A;  1X19 A;  4Y17 A;  2W7N A;  1ZEL A;  4ETS A;  3DEW A;  2I10 A;  4LG0 B;  3TOB A;  4L9T A;  4YFX F;  2ID3 A;  2RVC A;  1X58 A;  4HDV A;  1Z7L A;  5JR3 A;  4A3I J;  2PEX A;  4FET A;  4EQQ A;  2ESN A;  1XMA A;  2XUB A;  3E6B A;  4KIT B;  2E7W A;  1K4T A;  4XNF A;  3FHZ A;  3V7C A;  2ICW G;  4DNC A;  3GTJ J;  2H1L A;  2IGM A;  1RZ4 A;  3WTX C;  2TCT A;  2L7Z A;  3JRF A;  4UY8 I;  1JTY A;  4C2U A;  2EK5 A;  2ZKZ A;  3BPX A;  2WV1 A;  4HG2 A;  3DCF A;  1YG2 A;  3E5Q A;  4I7H A;  4XKV A;  4UUS B;  4WWC A;  3M4O J;  4F93 B;  2IBD A;  2Z5U A;  2P81 A;  3COA C;  2FQ4 A;  4D5F A;  4HLY A;  1MZB A;  3N97 A;  2GBY A;  4CDG A;  1Q1V A;  1SD4 A;  3CCM I;  1DP7 P;  1ZG3 A;  4ASN A;  1R9T J;  3GLX A;  3C2B A;  5M3F J;  1R71 A;  4QTR A;  4AIK A;  2MC4 A;  2Y48 A;  4LIU A;  1ERD A;  1FIA A;  3OS1 A;  3TOA A;  2EH3 A;  5K7F A;  4Y52 J;  4EM1 A;  4L5I A;  2PLY A;  4LJZ F;  3CCV I;  5HS8 A;  2M30 A;  1XS9 A;  2HDC A;  3F8M A;  3HM5 A;  3VB2 A;  2LF8 A;  4E7K A;  4ZJZ A;  2RNJ A;  4UB8 C;  2YPR A;  3E3V A;  3W6K B;  3BWG A;  2EIK H;  4E7I A;  5L3G A;  4FE4 A;  3SZT A;  1KQ9 A;  4YFK F;  2F6C A;  3ZMD A;  1D0Y A;  2PI0 A;  3RQ4 A;  5LD2 C;  3H3Z A;  4PUS A;  4CCK A;  3HDD A;  3H0D A;  3PIO F;  5CPR B;  3J7Z I;  4YEJ A;  2MG4 A;  2VPR A;  1BW5 A;  2JSP A;  4BH9 A;  2R93 J;  3OWT A;  5DCM A;  3MN2 A;  5IP6 A;  3WTZ A;  3BPV A;  2XAJ A;  2IA2 A;  2GIV A;  4DGW B;  3CCR I;  3V8L A;  1XX5 A;  2CJJ A;  4PFP A;  2VIX A;  1WI9 A;  3SQN A;  2AXT C;  3GLL A;  2HWV A;  2UXN A;  1WH5 A;  3F0C A;  5IYC J;  3QRF F;  3I56 I;  2JA5 J;  2ZJQ F;  2FEZ A;  5CYV A;  1KU3 A;  1N25 A;  3LA2 A;  5D8K B;  2IGO A;  2EV6 A;  4KIB A;  1I3A A;  1TNS A;  5FGM A;  2O8X A;  2FD5 A;  1MND A;  2QKM B;  3BJO A;  1TWA J;  4RA2 A;  2IAI A;  4BQO A;  4IJA A;  1J59 A;  1UJ8 A;  2I5U A;  1RI7 A;  4A6D A;  4XM3 A;  1QHG A;  3ABL H;  4XLH A;  2HFH A;  3OYM A;  1TNT A;  2IS1 A;  2DA3 A;  3TMO A;  1QNT A;  1BI1 A;  1S5L C;  4M9S A;  2NVQ J;  4CO8 A;  2HXI A;  2JA2 A;  3MKY B;  1N77 A;  2PJP A;  2NS7 A;  3B02 A;  4IZZ A;  4XQF A;  3A03 A;  1WJD A;  1V5E A;  1FSE A;  3S2W A;  4M6V A;  2IS4 A;  3OV8 A;  5EEG A;  3W2V A;  2R0Q C;  1FLI A;  5EDN A;  1QZZ A;  4M3E A;  1HQC A;  4GO1 A;  3LAP A;  4FAS D;  1XGN A;  3HSF A;  5HS7 A;  1JXS A;  4F55 A;  1X3Z B;  4RAZ A;  4UVA A;  2E19 A;  4U7B A;  1TQI A;  1ZK8 A;  1UHS A;  2NVU B;  2O03 A;  3HRM A;  1YRN B;  2AQE A;  4LB5 A;  1T0F C;  2DOD A;  1U9O A;  2VBZ A;  4ZDP A;  5TRD A;  3X2Q H;  2R5Y B;  1OMI A;  5LBQ A;  3OSF A;  5DTD A;  1PUF B;  2H8W A;  5FRM A;  2BYV E;  2VT2 A;  3WU0 A;  4Y4R A;  1YLF A;  2VT3 A;  2DDA A;  1IGN A;  2LKP A;  4M74 A;  5GTH C;  2QQB A;  2HOT A;  4EGY A;  3GWZ A;  2CV0 A;  2CMP A;  3GTG J;  3EUK L;  2E1M B;  2WAD A;  4N9H A;  3SFZ A;  2H27 A;  5FFX A;  3CD6 I;  3M07 A;  2MYS A;  3W2W A;  3DPL C;  4FT8 A;  4OAZ A;  3TKY A;  3L2W A;  5K7Z A;  1RET A;  4V19 K;  2DPD A;  5H6R A;  1WJE A;  5C44 J;  1P4W A;  1X2N A;  1WGX A;  2ISY A;  2IW5 A;  1MNE A;  2MW8 A;  2Z1D A;  3FIS A;  2ZO4 A;  5DYM A;  4Y13 A;  1VQO I;  2LKS A;  3CJN A;  1H0M A;  3BP8 A;  2LG4 A;  2VKE A;  3HKZ N;  2Y0S N;  2HVR A;  1G2H A;  3VYS B;  3GEZ A;  3ZCO A;  1YW7 A;  2P5V A;  4KMF A;  1Z1D A;  1GHC A;  4D7M A;  1VQP I;  4DYR A;  3H9Q A;  1DQU A;  1HC8 A;  1GXP A;  1DPU A;  4XOT A;  4BHC A;  3E6M A;  2W82 A;  1BR1 A;  2VC0 A;  2LFB A;  2CW0 F;  3BZ6 A;  2NVT J;  1O7F A;  4HF1 A;  4HA8 A;  3DLL F;  2E34 A;  4KT5 C;  5J8F A;  2XGX A;  4ENJ A;  2R7S A;  1W7P D;  1HDD C;  4HF0 A;  3IRR A;  4A0Z A;  1SMT A;  4C3H J;  1MMS A;  2ZBK A;  4XK4 A;  3HTU A;  3E6D A;  1U2W A;  1I1G A;  1MMA A;  1KU7 A;  3GX4 X;  2CQQ A;  4PCQ A;  1N75 A;  1X1A A;  3DXJ F;  2AHQ A;  2A6H F;  3SJM A;  3BR5 A;  4EJT A;  4K2E A;  1YX3 A;  4HOB A;  1QPI A;  2UXX A;  3OYG A;  1XSD A;  2VKD A;  1ITY A;  2OCC H;  2QQ8 A;  2LMD A;  5E3L A;  4BXF A;  2CO5 A;  1TQP A;  2VBX A;  2E1M C;  2KJC A;  3SXY A;  1Z67 A;  4L5E A;  4YG2 F;  1S3J A;  2HTJ A;  2B0L A;  2F5E A;  3S93 A;  5DCM B;  2DT5 A;  2ZXJ A;  5J3L A;  1FTT A;  2K4B A;  3AFH A;  2DFF A;  4HEA 2;  3IL2 A;  2Z2S B;  3ZQ7 A;  3KE2 A;  3M8F A;  3RI4 A;  1U3E M;  1TC3 C;  4QIW N;  1XGS A;  3T5X A;  1Y56 A;  2E35 A;  3W6J B;  5DDG A;  4DW6 A;  2R3S A;  3MEX A;  2GWR A;  3F8C A;  1WQ2 A;  4CCJ A;  2L01 A;  2OJE D;  1K61 A;  4CCL A;  3OL4 A;  2D2W A;  4IX7 A;  2ZSH B;  5JI6 A;  5FKO A;  3FF5 A;  2L9R A;  3OOP A;  3HGY A;  2FJ1 A;  1QVU A;  4CSW A;  4Y33 A;  2N8G A;  2GZW A;  2ZME A;  3PUB A;  2MC3 A;  4CCN A;  1MBJ A;  3F8B A;  2X1C A;  5CLS A;  2M4G A;  2K9L A;  5D5U B;  1W0U A;  2E1O A;  5B66 C;  1P92 A;  2E2H J;  1WFX A;  3R0J A;  3WU1 B;  2BV6 A;  3S3M A;  2R7R A;  4KYW A;  5DUK A;  1UMQ A;  3LSH A;  4Q47 A;  1Z91 A;  2W00 A;  2QSF X;  4G9Y A;  1ZYR F;  5IY5 H;  3C2G A;  2DPU A;  3GFJ A;  2K02 A;  3KEQ A;  2E2I J;  4E7J A; 
#chains in the Genus database with same CATH homology
 4JX6 A;  3CMY A;  1GT0 C;  1ETV A;  2OF7 A;  3E7L A;  2R5Z B;  3JR9 A;  4A3E J;  3BQY A;  1D5Y A;  2DTZ A;  2OPT A;  1MNM C;  5M5W J;  2XPV A;  3BG3 A;  5C3E J;  5EG0 A;  4BY7 J;  3HGG A;  1U8B A;  9ANT A;  1FIP A;  2EZK A;  5J1U A;  1APL C;  2O9L A;  2WAQ N;  4JX5 A;  2DN0 A;  4MO7 A;  2Y31 A;  4ABZ A;  1Z0X A;  3GTQ J;  2DMP A;  1MH4 A;  3A02 A;  2JA7 J;  1K83 J;  3BG9 A;  4B3A A;  5K7H A;  1WCM J;  2HQ5 A;  1TWG J;  4A3G J;  2M2E A;  4A3M J;  4D5C A;  1HF0 A;  1Y1V J;  2HDD A;  3D1N I;  5JLW A;  4JP0 A;  1BA5 A;  3RQI A;  3ZQL A;  3FK7 A;  4XRM A;  1P7I A;  2E2J J;  4IHW A;  2H1K A;  5GPC A;  1MH3 A;  5EZG A;  4DZJ A;  3A01 B;  1IC8 A;  3I4N J;  2ELK A;  5JLX A;  1B72 B;  1IJW C;  4G12 A;  5HOD A;  2HI3 A;  2IEK A;  3PM1 A;  4C3I J;  1IDY A;  2HXO A;  4XID A;  1IDZ A;  4CYC B;  1QRY A;  3RKQ A;  3JRG A;  2JA8 J;  2NOG A;  3O8H A;  2H8R A;  3RZD J;  3G1O A;  3BTJ A;  3BR2 A;  5F0F A;  4JYK A;  3L1P A;  5J1Y A;  5F08 A;  3IH2 A;  2ECB A;  2LR8 A;  1AU7 A;  3PO3 J;  3IH4 A;  2XGE A;  4DYQ A;  4M3G A;  1MSE C;  2LY9 A;  1ZQ3 P;  3GBG A;  2D5V A;  2COB A;  3O8G A;  3WHC A;  1YRN A;  4HNV A;  1JKR C;  1ETY A;  1IV6 A;  2WB1 N;  2R5Y A;  1SAN A;  2ZB9 A;  3HOU J;  5IOZ A;  5IP9 J;  1VF9 A;  1PUF A;  1ZGW A;  3TED A;  1F43 A;  2X6O A;  3CCY A;  2L7M P;  1BJZ A;  3BTL A;  1B8I A;  4A3L J;  4FTH A;  1GV2 A;  2LLK A;  3SDG A;  4MFD A;  1FTZ A;  5FKN A;  3NAU A;  3BG5 A;  1A5J A;  2EBI A;  2YU9 J;  2VKV A;  1I6H J;  3MVP A;  1WH7 A;  4B1R A;  1OFC X;  4C2M J;  3HOY J;  3GTL J;  5M3M J;  1U9N A;  4MLO A;  5F0H A;  2Y2Z A;  2XB5 A;  2M9H A;  4W1U A;  4J19 A;  1E3O C;  2YUS A;  2DMN A;  3DEW A;  2I10 A;  2DMQ A;  2QF7 A;  3S15 J;  4BBR J;  1DU6 A;  2ID3 A;  3ZQI A;  3BQZ A;  1X58 A;  4A3I J;  4A3K J;  1AHD P;  4LOC A;  1OCT C;  3ZQG A;  3K2A A;  1JT6 A;  1WI3 A;  4A3D J;  2Y9Y A;  3H3V K;  1S7E A;  5EYR A;  3UKG A;  3GTJ J;  3BTC A;  2TCT A;  2L7Z A;  3G1L A;  4XRS A;  3JRF A;  2K9S A;  5C4X J;  1JTY A;  4A93 J;  2LTP A;  2K40 A;  2WV1 A;  3VPR A;  3DCF A;  5M5X J;  4UUS B;  2VI6 A;  4I76 A;  2B63 J;  2LD5 A;  3TW6 A;  5EZH A;  1O4X A;  2R7Z J;  3M4O J;  2VUM J;  1MSF C;  2G0E A;  4A3F J;  2IBD A;  2P81 A;  2FQ4 A;  4D5F A;  5IYB J;  3B6C A;  2GBY A;  1W0T A;  1Q1V A;  3S16 J;  4DZP A;  1ZTR A;  3W6V A;  3FK6 A;  2LVS A;  1R9T J;  3C2B A;  2W48 A;  5M3F J;  1BW6 A;  3S1N J;  4C3J J;  2L0K A;  4QTR A;  1MBH A;  1MBG A;  2EZL A;  1FIA A;  3A01 A;  2EH3 A;  5K7F A;  3JRH A;  3JRA A;  3GTP J;  4Y52 J;  3LSR A;  4AYB N;  1GV5 A;  1JUP A;  1HCR A;  1XS9 A;  3S2D J;  3HM5 A;  5IP7 J;  3HOX J;  1T33 A;  1JKP C;  1RKW A;  2JN6 A;  2JA6 J;  3S1R J;  4FE4 A;  5E3M A;  4BKX A;  2M34 A;  4FIS A;  4RDU A;  3OIO A;  4M3D A;  1DU0 A;  3ZQF A;  3RZO J;  3JRC A;  3HDD A;  2AO9 A;  4A3B J;  4AC0 A;  2XRL A;  3QPS A;  3TP0 A;  2MG4 A;  1LFB A;  1POG A;  2VPR A;  5EG0 B;  2O8K A;  1BW5 A;  3LOC A;  1FJL A;  2R93 J;  1LFU P;  4BXX J;  3MN2 A;  5IP6 A;  1NK2 P;  3BR0 A;  1VFC A;  2CJJ A;  2NS8 A;  2EZH A;  2KT0 A;  3JRI A;  4EEF G;  4XRS G;  5EGO A;  1WH5 A;  3F0C A;  4IEJ A;  5IYC J;  2EQR A;  3BR3 A;  1BL0 A;  3TW7 A;  3CQZ J;  2DMU A;  3OSG A;  5FKL A;  2JA5 J;  2ME6 A;  4AUX A;  3S1Q J;  2DA4 A;  4XIC A;  2DA6 A;  2K9Q A;  1ETQ A;  2M0C A;  4X6A J;  3S14 J;  2FD5 A;  1RR7 A;  1TWA J;  2RAE A;  2IAI A;  1I50 J;  1JJ6 C;  2NVY J;  1LE8 A;  5GPA A;  2JWT A;  2LKX A;  1ETO A;  4A3C J;  2DA3 A;  2NVQ J;  4M3F A;  3Q0V A;  5DS9 A;  2HXI A;  3OOU A;  2NS7 A;  2HYJ A;  3A03 A;  1JGG A;  1Y1W J;  1AKH A;  5C4J J;  1VI0 A;  4M6V A;  1H8A C;  4BY1 J;  2R5Z A;  2TRT A;  5F27 A;  1ORK A;  1GDT A;  2L7F P;  2HOS A;  4RBO A;  2R0Q C;  2DA7 A;  3QPL A;  5EDN A;  1MBK A;  2CQX A;  1OCP A;  4M3E A;  2HOA A;  1JTX A;  3LSG A;  1NK3 P;  2E19 A;  1GVD A;  1ZK8 A;  1UHS A;  1A6I A;  2O7O A;  2R92 J;  5F04 A;  1YRN B;  1X2M A;  1OJL A;  4X1E A;  1U9O A;  3QQA A;  2GM4 A;  2R5Y B;  3OSF A;  2MGQ A;  5DTD A;  4NDL A;  1PUF B;  1XG1 A;  1H89 C;  4V2G A;  2DMT A;  1ENH A;  4W97 A;  3LNQ A;  3Q0U A;  2XSD C;  1B8I B;  1Z77 A;  2DJN A;  1JJ8 C;  3K7A J;  2MSY A;  2DA2 A;  2EZI A;  1IGN A;  3BT9 A;  5FKK A;  5FLV A;  2HOT A;  4IHY A;  4IHX A;  3H0G J;  3NAR A;  5EF6 A;  3GTG J;  3ZQH A;  1U78 A;  3S1M J;  2XB0 X;  5FKM A;  3FKI J;  5IOY A;  5K7Z A;  1RET A;  5C44 J;  1B72 A;  2QCO A;  1X2N A;  2M8G X;  1WGX A;  5M5Y J;  2MW8 A;  2NVX J;  4FCY A;  3FIS A;  4JX4 A;  1MBF A;  1JKQ C;  1RKT A;  1SFO J;  4CYC A;  2VKE A;  1JUM A;  3HKZ N;  1TWC J;  2DA5 A;  2Y0S N;  1MBE A;  2ECC A;  2PMZ N;  5BNG A;  3M3Y J;  1G2H A;  3GTK J;  5E3O A;  5F0C A;  2FX0 A;  1CQT A;  3LSJ A;  3B6A A;  3HBL A;  4D7M A;  4DYR A;  3ZQC A;  4Y7N J;  1WPK A;  2X9D A;  3BTI A;  3CDL A;  2LFB A;  1T56 A;  1ETW A;  3IH3 A;  4GFB A;  3PO2 J;  1TWH J;  5GP9 A;  2NVT J;  4DYC A;  3JRE A;  4D7N A;  2JK3 A;  3SFI A;  4A69 C;  1UG2 A;  3Q3S A;  1HDD C;  1ETK A;  1GUU A;  3ZOB A;  4C3H J;  4XK4 A;  2K9N A;  1ZR2 A;  2DA1 A;  2ME0 A;  3HB9 A;  3TP3 A;  1JT0 A;  3WHB A;  1IUF A;  4QSH A;  2CQQ A;  3BR6 A;  2GLO A;  2JMW A;  3FIW A;  5J1R A;  1ETX A;  2AHQ A;  1IG7 A;  2Y30 A;  3SJM A;  2ID6 A;  1NTC A;  3BR5 A;  1FEX A;  2YS9 A;  5F1J A;  1QPI A;  2CRG A;  3S17 J;  3GTO J;  1ITY A;  4MIM A;  4UUT A;  5E3L A;  4MFE A;  3GTM J;  5IPA A;  1JKO C;  1VND A;  1I3Q J;  4I6Z A;  3MKL A;  2JJ7 A;  2X48 A;  1ZR4 A;  4L5E A;  5E3N A;  2CUF A;  5J3L A;  1FTT A;  4S0H B;  3JRD A;  4UUS A;  1TC3 C;  4QIW N;  3JRB A;  1EF4 A;  4DW6 A;  1IRZ A;  5FLM J;  5EGO B;  3LSP A;  3G1M A;  1HDP A;  1TWF J;  1RPW A;  2XPU A;  1QVT A;  1H88 C;  3HOW J;  1K61 A;  3Q0W A;  1P7J A;  3BR1 A;  5FKO A;  2L9R A;  3HGY A;  2FJ1 A;  1QVU A;  1F36 A;  1XC5 A;  2CUE A;  3S2H J;  2N8G A;  2LK2 A;  5IYD J;  1HLV A;  2LP0 A;  3HEF A;  4IHV A;  2CU7 A;  5EEA A;  1MBJ A;  1LE8 B;  2KDZ A;  1W0U A;  2E1O A;  4M3B A;  4BBS J;  2E2H J;  4V2F A;  2XPW A;  3HOZ J;  2XGD A;  5FJ8 J;  1ZKG A;  1HOM A;  1UMQ A;  3HOV J;  1RES A;  4B4C A;  2Y9Z A;  4A3J J;  2XGC A;  1JUS A;  3I4M J;  1AKH B;  4FE7 A;  3IV5 A;  2E2I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...