2AO9A

Structural genomics, the crystal structure of a phage protein (phbc6a51) from bacillus cereus atcc 14579
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
117
Chain Sequence
MMAKLDELKQKLTAKQIQAAYLLVENELMEEEKRTQDEMANELGINRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFGLLTDKKVIEGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage protein
publication title The crystal structure of a Phage protein (phBC6A51) from Bacillus cereus ATCC 14579
rcsb
source organism Bacillus cereus
molecule tags Structural genomics, unknown function
total genus 41
structure length 117
sequence length 120
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13022 HTH_Tnp_1_2 Helix-turn-helix of insertion element transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ao9A01
5EDNA 5EGOB 2R5ZB 2MW8A 1LE8A 2O9LA 2JWTA 1LFUP 1GUUA 2VKVA 5DTDA 3JRAA 1YRNA 3FISA 2O8KA 3TP0A 3S1NJ 2DA5A 3PO3J 2M9HA 2X6OA 4A3MJ 5F08A 1W0UA 2TCTA 3LSJA 4FCYA 2XRLA 1NTCA 5EZHA 2RAEA 3H0GJ 1APLC 2JA7J 1JKOC 1OJLA 3E7LA 4RBOA 5BNGA 4D5FA 2NVYJ 3BG9A 3IH3A 2R93J 4V2FA 5IYBJ 2LVSA 3HOUJ 1IDYA 1ETWA 5JLXA 5F04A 2WAQN 5HODA 3RKQA 3S15J 3OSFA 3G1OA 4XRSG 2HOSA 1TWCJ 1IRZA 4LOCA 3JRFA 3HDDA 3I4NJ 2DA1A 5J1YA 5E3MA 2GM4A 5M5WJ 1JTYA 1ENHA 1FEXA 3SFIA 1HDDC 1GDTA 1G2HA 2Y9ZA 2ZB9A 2K40A 3WHCA 3CCYA 3IH4A 1X2MA 4JYKA 2R0QC 5FLVA 3H3VK 5EZGA 1LE8B 2NVQJ 3JRBA 3QPSA 5M3MJ 1MNMC 1BL0A 3GTQJ 3PO2J 2JJ7A 1RPWA 3B6AA 1RR7A 5F0HA 5C3EJ 1YRNB 3HGGA 4IEJA 2DTZA 2K9NA 2FX0A 1DU6A 1O4XA 1LFBA 2CJJA 1JT0A 1MBFA 2M34A 2CQQA 3DCFA 2Y2ZA 5FKNA 3HKZN 2YUSA 5IOZA 1BW5A 2XB5A 1JGGA 5IOYA 4XRMA 2DMUA 5J3LA 2DJNA 2E19A 2L7FP 4BXXJ 3ZQLA 1Y1VJ 2AHQA 3ZOBA 2LTPA 4QTRA 4Y52J 4NDLA 2XGDA 2GLOA 1JKPC 2KT0A 2DMNA 4FE7A 2IBDA 2ME0A 1B72B 2E2JJ 3GTPJ 1Z77A 1U9NA 1IG7A 4UUSA 2R5YB 5EEAA 2JA5J 4JX5A 4IHXA 4JX6A 1RKTA 4BY7J 1HDPA 3HOYJ 1UG2A 1FJLA 1OCPA 3BG3A 1FIAA 3GTLJ 3TEDA 3NAUA 1H88C 2KDZA 2TRTA 2YU9J 3HOWJ 2OPTA 2X48A 2JA6J 4A3JJ 3OSGA 4IHYA 1JTXA 1POGA 2LFBA 1Z0XA 5C4JJ 1AKHA 3BR1A 1P7JA 5E3LA 3BTJA 1W0TA 5F27A 4IHVA 4S0HB 5FKMA 3B6CA 3LOCA 4B3AA 5J1RA 3I4MJ 1B8IA 2N8GA 3NARA 5C44J 2Y9YA 4A3CJ 1ETYA 2XPWA 1BJZA 2GBYA 1PUFA 2MSYA 3RZDJ 2VPRA 4A3EJ 1EF4A 1JKRC 2LKXA 2NS8A 2B63J 5EF6A 2HQ5A 4M3DA 4BBRJ 1JJ6C 1ZR2A 5FJ8J 4A3KJ 4I6ZA 1NK3P 1K61A 3HBLA 3BR5A 4DYCA 2CU7A 3S1MJ 1D5YA 4A3IJ 3DEWA 1E3OC 3BR2A 3L1PA 5GP9A 3FKIJ 4XRSA 2DN0A 1FIPA 4D7NA 2VUMJ 2HYJA 3QPLA 1MBEA 2OF7A 2COBA 2AO9A 2JK3A 3JRIA 2XB0X 3SJMA 2ECBA 3ZQFA 2L7ZA 4XICA 1WPKA 3A01A 3GBGA 3C2BA 3O8GA 3CMYA 2EZKA 5EG0A 5F0CA 2H1KA 2NVTJ 1AU7A 2JN6A 3LNQA 1F36A 2WB1N 5IP6A 1HOMA 1OFCX 2LLKA 4DYRA 1SFOJ 2W48A 2NS7A 2JA8J 3SDGA 1ORKA 3BR3A 4BY1J 2EQRA 3GTGJ 3QQAA 5J1UA 4M3EA 3JR9A 1MSFC 3HB9A 1UHSA 3TP3A 4MLOA 1FTTA 4X6AJ 1MBJA 1ZR4A 2ECCA 4C2MJ 1H89C 1MSEC 1ETOA 5IYCJ 2D5VA 1JKQC 2R92J 4UUTA 3ZQIA 1NK2P 1ETVA 5IP9J 5K7FA 3IV5A 2O7OA 1ETXA 5EGOA 1ETKA 4AUXA 1OCTC 2K9SA 2ME6A 4FISA 2NVXJ 1IDZA 2HI3A 2IEKA 3Q0WA 4DZJA 4QIWN 5K7HA 3HOVJ 1DU0A 2QCOA 3BT9A 2EZHA 2E2HJ 1TC3C 3LSPA 3S17J 4A93J 5F1JA 1ETQA 2HOTA 3A03A 1U78A 3RQIA 1H8AC 4A3DJ 4A69C 1QRYA 1MH4A 5C4XJ 1VFCA 3TW7A 2Y0SN 1QPIA 2P81A 1XC5A 2EBIA 5GPAA 2ELKA 2LR8A 2HXIA 5E3OA 1XS9A 4QSHA 2R7ZJ 3F0CA 2HOAA 2EZIA 3K2AA 5E3NA 3BR6A 4M3GA 4MFDA 1MBKA 3VPRA 4C3JJ 3FIWA 1WH7A 2WV1A 2E2IJ 3M4OJ 3GTMJ 1WI3A 2M0CA 4C3IJ 2M2EA 1MBHA 2XGEA 2CRGA 4X1EA 2XPVA 3S14J 2G0EA 3GTKJ 3JRDA 3HEFA 4A3LJ 1BA5A 3BG5A 1S7EA 3K7AJ 4MIMA 5EYRA 4V2GA 2L9RA 5FKKA 1AHDP 2XSDC 3G1LA 5DS9A 3D1NI 1X2NA 3GTOJ 1IC8A 1ZGWA 2K9QA 1QVTA 4GFBA 2XPUA 3TW6A 3JRHA 2X9DA 5FKLA 2JMWA 2L7MP 4DW6A 1P7IA 2E1OA 3OIOA 3G1MA 1JT6A 1GT0C 3MKLA 4UUSB 3HOZJ 1JUPA 1VI0A 3BR0A 4D7MA 1Q1VA 4CYCA 2NOGA 2DA4A 1QVUA 2CUEA 3HGYA 5M3FJ 3JRCA 4IHWA 3LSRA 2EZLA 2L0KA 1ZQ3P 1BW6A 1SANA 1IGNA 2Y30A 1GV5A 2DMQA 4G12A 1HF0A 3BQZA 3S1QJ 1U8BA 5FKOA 4M6VA 2MGQA 3Q0UA 4W1UA 3UKGA 3PM1A 1AKHB 2QF7A 1B72A 3OOUA 1WGXA 3ZQHA 3S2HJ 1JUSA 3S2DJ 5IP7J 2R5YA 3FK7A 2ID3A 4RDUA 4FTHA 1B8IB 1T33A 2LD5A 1VNDA 5JLWA 4JX4A 4DYQA 3GTJJ 3JRGA 3FK6A 1JJ8C 4B1RA 2DMPA 1U9OA 2MG4A 1PUFB 1RKWA 5GPCA 5M5YJ 3WHBA 4A3GJ 3MVPA 1ZK8A 4FE4A 4L5EA 4M3FA 2XGCA 5M5XJ 4BBSJ 2HXOA 2FD5A 2DA2A 2R5ZA 3BTCA 1MH3A 1I50J 5IYDJ 1Y1WJ 1X58A 3BTLA 1F43A 2Y31A 3BQYA 1I6HJ 1UMQA 1RESA 1TWHJ 2PMZN 3MN2A 3S16J 1K83J 1RETA 2ID6A 4DZPA 1GVDA 1CQTA 4ABZA 4A3BJ 2DA6A 1MBGA 2CQXA 2LK2A 1VF9A 1HLVA 4D5CA 2H8RA 4A3FJ 3CDLA 1TWAJ 4AYBN 3CQZJ 3S1RJ 1HCRA 3Q0VA 1ZTRA 1GV2A 4J19A 1R9TJ 1IV6A 1FTZA 2FJ1A 4XIDA 2DA7A 3JREA 4JP0A 1I3QJ 4CYCB 3RZOJ 1XG1A 9ANTA 4M3BA 2YS9A 1A6IA 2DMTA 3A01B 3Q3SA 2M8GX 3M3YJ 5EG0B 3A02A 1TWGJ 2VKEA 1ITYA 2CUFA 3LSGA 1T56A 4I76A 2DA3A 1ZKGA 3O8HA 2LP0A 2VI6A 3BTIA 3ZQGA 5K7ZA 2HDDA 4C3HJ 2EH3A 2FQ4A 5IPAA 4Y7NJ 3IH2A 1A5JA 3W6VA 1IJWC 1IUFA 4HNVA 5FLMJ 1TWFJ 2IAIA 4BKXA 4XK4A 4W97A 5F0FA 4EEFG 3HOXJ 4MO7A 3ZQCA 1WH5A 4AC0A 3HM5A 1JUMA 1WCMJ 4MFEA 2I10A 4B4CA 2LY9A
chains in the Genus database with same CATH superfamily
2BEOA 2IGNA 3O6BB 2UZKA 1AOYA 4NC6A 3SZTA 2PI0A 3MAJA 4FQGA 5HOOA 2CW8A 3L2CA 3WU1B 5B3SH 2HQNA 1IUYA 2ZXWH 4L0YB 2MH2A 4RM3A 1W1WE 1YRNA 4HYEA 3OYLA 3RCOA 1E2XA 1Y56A 2DA5A 4P96A 4FHTA 2VASA 4A3MJ 1FX7A 2IA2A 1DQUA 3IUOA 5K1YA 1MJAA 1X4PA 1LJ9A 1SD6A 2XRLA 1NTCA 1I39A 4OIPF 3H0GJ 1APLC 1WJ5A 2W7NA 2ZMEC 2H6BA 3VOEA 4LK0F 4LB6B 2FRHA 2F4OB 4RBOA 2UXXA 4L9TA 1UCRA 3DV8A 1TL8A 1WQ2A 5IYBJ 4A0ZA 3T1BA 2GA1A 4L9VA 5CQGA 1ETWA 4ZDLA 2EFPA 1G3WA 1RC9A 1IRFA 1WRJA 4KT5C 4XRSG 3Q9SA 3OYEA 1FLIA 2HZTA 2B0LA 3QPTA 4RAZA 1D0ZA 1ZRCA 3ASOH 2BVMA 4LOCA 3HDDA 3I4NJ 3HRTA 2VJ4A 4EV0A 2GM4A 1Z7LA 1Y0UA 2Y69H 2BZTA 2AQEA 3VYRB 1D1CA 5M5WJ 1SFKA 1ENHA 1HDDC 5DM6F 3CF5F 5CYVA 2EPFA 3MQ0A 1JE8A 2PFBA 1B6AA 2QLZA 3ZMTA 2A68F 3ASNH 1VQ4I 3HUGA 1ODDA 4DBRA 3MKZA 4RM2A 2LC2A 4J00A 2L5QA 2W25A 4HF0A 3F9KA 5FLVA 3FXJA 3H3VK 5EZGA 3KEQA 5M3MJ 3CUOA 1R36A 4IRHA 4IRGA 2FBKA 4M71A 1G6NA 1OCCH 2MLGA 4N9HA 5E18F 2VC0A 5J4YA 3BLYA 3LA2A 5J4VA 3CCSI 2K9NA 3SEQA 2EV0A 4LGWA 2CJJA 2XKPA 1JT0A 2L9SA 1MBFA 3DCFA 1XMXA 2BE5F 4I0AA 2YUSA 4Q48A 4BHCA 3H9QA 2ESHA 2JRMA 4I02A 3MZHA 5IOYA 2H6CA 5J3LA 1ERDA 3CTAA 2E19A 1ZG3A 2L7FP 4ANJA 4BXXJ 2QENA 1QPMA 2CFOA 1D3YA 1Z9CA 2XGDA 2GLOA 4BNCA 3GLXA 3JW4A 3BZ6A 1LEAA 4XRFA 5KHDA 2IBDA 2ME0A 2E2JJ 1LVAA 3RPUA 2VODA 2CW7A 2VIXA 4AU7A 4EGYA 2R5YB 2ZJRF 3V7CA 4WX9A 1IAWA 1V5EA 2P4WA 2EK5A 4UHTA 2DDBA 3QU3A 1MJBA 4KA4A 2GQQA 4BY7J 4E4HA 5D4SA 3OYJA 2HKXA 2W82A 2IS4A 3NAUA 4KN7X 2RGVA 1Z7UA 2YU9J 3L2QA 3KYDB 4ZYGA 1JTXA 1POGA 2W85A 3G2BA 3J7AO 1PP7U 1Z0XA 5C4JJ 5JVTA 1W36D 1O7LA 1AKHA 2M4GA 1NHAA 4O6JA 4I7HA 3QODA 4KMUX 5F27A 4S0HB 4IHVA 4B3AA 4Y13A 1B8IA 2M4KA 3FXMA 4HDVA 4A6DA 3OYHA 1BOAA 1KYWA 1EH7A 2Y9YA 4A3CJ 4P9FA 1ETYA 1BJZA 2MSYA 3GX4X 5AIQA 2NS8A 3KE2A 1OCZH 4M3DA 2ZJ2A 2FF4A 5BMZA 3DBHB 4LG0B 5L3EA 2PJRB 4O3MA 3C2GA 2PX9A 2ESNA 1USSA 3KZZA 3H1CA 2QGUA 2GXAA 2JSCA 1FNNA 4HF2A 3IWZA 1W5TA 3ERMA 3K10A 5D8LB 3GYHX 4BDYA 3N97A 2K02A 1SD7A 2K27A 3FWEA 4WWCA 4RGUA 5DV5A 1F9NA 5LLQA 3J80Z 2LY2A 4RMNA 2BXYA 4KT6A 1K78A 4BUPA 2E1MC 2XB0X 3ZQFA 2L7ZA 2ZFUA 2CYYA 5D5WB 3GBGA 4RAGA 4KIFA 1FBUA 2GIZA 3CMEI 2WY7Q 1WHUA 2R3SA 2H1KA 1BR4A 3HYIA 1AU7A 4M9SA 4UV8A 4BQOA 2VQHA 4XKBA 1V4RA 1OFCX 1UZCA 1XGOA 2LLKA 4EQQA 1XSVA 2F2EA 1KYZA 2EFQA 2LH9A 3RPQA 2R7TA 3DWLE 4EATA 2JA8J 2P6TA 3PQKA 3SDGA 1ORKA 1FMWA 2LF8A 3HJEA 2HU9A 3MKWB 3FHNA 1IV8A 2JUGA 3QQAA 3ABUA 3M8FA 3F8BA 4B09A 1PUEE 1ZLKA 4MLOA 3EYIA 2K3PA 3PIPF 1H89C 3RDIA 1MSEC 1KQ0A 5IYCJ 1K6YA 2A3SA 1OR7A 4RS8A 2A61A 2RQQA 3BG7A 4KICA 1ZG1A 5K7FA 2L4AA 3ELKA 5EGOA 3MD2A 1ETKA 4DQ2A 2R7DA 3ZQ7A 1J59A 2KLOA 2R7OA 3RYPA 2GOMA 2WB1A 3TL4X 4ON0A 1FZPB 3ECOA 2XVCA 5K7HA 2XKOA 4LG3A 2QCOA 1DU0A 2E2HJ 3SFZA 1FOKA 2X4HA 2Z1DA 3LSPA 1IXCA 4YRVA 2LBFA 5KCMA 2XF5A 1X4OA 5LHHA 1A31A 1U78A 3BOQA 1IW7F 4A3DJ 4IVNA 1QRYA 1D0YA 3KZYA 4R79A 4IRIA 5C4XJ 3TW7A 1T98A 2OCCH 2P81A 3BCBA 1OISA 4A12A 3I54A 2DT6A 2HXIA 4UNOA 2WV0A 4QSHA 2H1LA 1REPC 2HOAA 2LY9A 3I64A 5E3NA 2AQFA 4IZZA 2GXGA 3BCAA 1SAUA 5TGTA 5BS6A 1MBKA 3OR1C 1MMAA 3VPRA 1D1AA 1XCBA 1V55H 3KLOA 3FMSA 4DGWB 4BE1A 1IN5A 4QPOA 5J8CA 3WTVC 3K0LA 2M0CA 2VONA 4WK8F 5HLIA 2M2EA 2JPCA 1FYKA 2CRGA 1WI9A 4FX0A 1SVOA 4M74A 3HEFA 3FZVA 1FBQA 1D5VA 2XF6A 1N75A 3GF2A 3K7AJ 4MIMA 3KP6A 2CFXA 2O0YA 2HQAA 1SC7A 5ILVA 1AHDP 5HDKA 2XSDC 3U2RA 3D1NI 2G9WA 3A2KA 1N78A 4IHTA 2L9VA 4MTDA 4GFBA 3H92A 2VBYA 2B9SA 4I01A 3M9AA 4RGSA 5FKLA 2KISA 1SFEA 3V4GA 1R4NB 2ACJA 2L7MP 2FUG2 5IT9Z 1SFUA 5D5VB 1Q1HA 2E1OA 2K85A 2VLAA 3ZMVA 1X1CA 2HVRA 4LIUA 3W2VA 3MKLA 1V5GA 3T8RA 2P8TA 3CCVI 4D7MA 2QBYB 2EFOA 1XN7A 2OZUA 4CCKA 4YIRX 3LSRA 2BGCA 3S3MA 1IGNA 3KPHA 1LQ1A 3GZ6A 1HKSA 1GV5A 4BJ5C 4OIQF 1YYVA 3OIQA 5FKOA 1OPCA 4M6VA 2HGCA 1RI7A 1STZA 4UUVA 1AKHB 1KU2A 1WGXA 1FYMA 1ZGJA 2IXSA 1TLHB 3S2DJ 3H5AA 3TMOA 2X51A 2W57A 1DGRM 1B8IB 2K5CA 1NG7A 1VNDA 3KEYA 4YEJA 2YR2A 1X3ZB 2BY0A 4B1RA 1U9OA 1YG2A 5E8IA 5GPCA 1ZELA 5M5YJ 4P9UA 3MVPA 1ZK8A 4FE4A 2F5VA 4L5EA 2M87A 1VQKI 2PBIA 2WC2A 1V3FA 4YIFA 4PFOA 4XONA 2XAFA 4ESBA 2XDVA 3IAS2 4U0YA 2DA2A 3IL2A 3G73A 1X58A 1A6QA 2Y31A 3KETA 1F43A 4JOMA 5F6FA 2PJPA 2BOLA 5DYMA 3FXUA 4DZPA 1S29A 1CQTA 1FOXA 1MBGA 3E3VA 1HLVA 3CDLA 1TWAJ 1U2WA 3U9GA 2ADUA 1HW1A 3Q0VA 1HCRA 2UV1A 1W4MA 1IV6A 1S8NA 3W6JB 3COAC 4XIDA 2DA7A 3FDYA 3E6CC 2KQRA 1I3QJ 1K78B 1BC8C 1X3UA 5CVJA 3CDHA 5FD5A 1M1EB 2LYCA 4PJLA 4L5IA 3QRFF 2RREA 4CHUA 1YS6A 2XRNA 3P9KA 4MTEA 2DLLA 3W6KB 4LLGF 1W7PD 2KMUA 2FEZA 2FBHA 3HHHA 4I76A 1ZG5A 1XMAA 4CCNA 3IRQA 2O5RA 2QUFA 2Z33A 1BJAA 2BYVE 3FX3A 4LIVA 3ZQGA 4CZCA 1YHQI 2MABA 4A6EA 2HDWA 1HW2A 4BQAA 5IPAA 1YJ9I 4PSXA 4XLEA 5E8GA 1IJWC 3OYNA 3F3XA 2R7VA 3E1SA 4RGXA 1IN4A 2IAIA 5TISC 1G3TA 1T38A 4EEFG 1MW7A 4MO7A 2EV5A 3PUBA 4EMSA 4E7ZA 3ZQCA 3VDXA 3HM5A 2EIKH 3N4MA 1XGMA 5EGOB 2HOEA 3NWSA 3W2AA 5FROA 4G6TB 4YIIA 2O9LA 1LFUP 1HKQA 3SHFA 3KP7A 1ZARA 1GUUA 4PJJA 2XAUA 2VKVA 4ETSA 2O61A 3HRMA 3KLNA 3OYDA 3S1NJ 2NVUB 4V19K 1FT9A 4KITB 5B5EC 3FXOA 2M9HA 5CLSA 2Z99A 3V8JA 1HSTA 1K4TA 3LSJA 3LA7A 2ICWG 4XN3A 4HAMA 2E34A 1AA7A 1GLNA 2DOEA 1QO0D 4DBQA 1JKOC 5BQTA 3E7LA 3TO6A 3RI4A 3ABLH 2D45A 3IH3A 2JZYA 4LFUA 1TTYA 4B3XA 3LSIA 4CYDA 2WADA 3OYAA 3S15J 3OSFA 3G1OA 3ZQQA 4EGZA 4HX4A 5FFZA 3H35A 3HRSA 2IT0A 1DGWY 2E7XA 3IRRA 3JRFA 4KYWA 2WAFA 2NOJB 1XGSA 1BC7C 4HX7A 4UB8C 5E3MA 2HDCA 3JTGA 2CQ7A 4PUSA 2WWYA 1TT0A 2VQLA 3S32A 5KVRA 1YW7A 1G2HA 3DF8A 4PJMA 2Y9ZA 2E60A 2ZB9A 2KZGA 4FETA 4KDPA 4L0ZB 5HLHA 1QNTA 3H3UA 1XPXA 3CZ6A 3AG2H 1BI3A 1LFPA 2CG4A 5CKTA 2NVQJ 1ON2A 2NYXA 3VB2A 3G4SI 1MNMC 3BDDA 2JJ7A 1RPWA 1VQ8I 3P9IA 4MQ9F 2JVHA 3I9V2 3UR3C 3R4KA 3ZCOA 3V7RA 2CS3A 1DUXC 2FX0A 1O4XA 4HNUA 2HNHA 3L2UA 3DPTA 1T0FA 3VODA 3OYGA 2NRAC 2LMDA 3CLQA 3DLAA 3HKZN 4XOPA 3JSPA 1BW5A 1MMNA 2KP6A 2XB5A 1XGNA 1SAXA 1QZYA 1YW9A 3CCJI 1JGGA 3E6DA 4XRMA 3A0BC 4A2UA 3F23A 4YG2F 2LF7A 1HXDA 3ZQLA 4BYYA 3ZOBA 1O7FA 2JQ7A 4QTRA 4NDLA 4MNUA 4FX4A 2LREA 1JKPC 2VL8A 1F1ZA 3T5XA 2ETHA 2DMNA 1Z6TA 5LD2C 2L7KA 3IP4B 3HPGA 1IG7A 1ON1A 4UUSA 4XLNF 3KYCB 5EEAA 5D5UB 2JA5J 4IHXA 2M5WA 3GFIA 2G7HA 1R5ID 3KCCA 4OIOF 1RKTA 3H9GA 2CW0F 1UG2A 1FJLA 4CICA 1YIJI 1TQMA 5BOXA 2NAZA 1FIAA 2Y75A 1V54H 3GTLJ 4LJZF 2DT5A 2BY3A 3BG6A 3JSOA 1FPQA 3HOWJ 2X48A 2K9LA 3CMAI 2VE8A 3KP3A 2JT1A 3F6VA 4UB6C 3DKWA 2LFBA 3HPHA 2V9PA 2EILH 4EM2A 1X1AA 2X1DA 2E35A 2DBBA 3W2WA 4F52A 1Y8RB 1W0TA 2H27A 3LQQA 3I4MJ 1UG0A 2N8GA 4ZZLA 4RB2C 4GDFA 1FYLA 2LRDA 4PGGA 1Z21A 1L3LA 2HPIA 3SXYA 2XPWA 1PUFA 2VPRA 2VOPA 5B66C 3I3LA 2KFDA 2LKXA 5EF6A 3WTTC 1UHWA 1X19A 2IA0A 4F7ZA 1R22A 2ELJA 5LGNA 1I1GA 1TW3A 2VXZA 3NWTA 4Y15A 4Y3OA 4Z6YA 2DAOA 5FLXZ 3H5NA 3ONQA 4AVZA 2O6GE 3ML6A 4A3KJ 2P7VB 2G7UA 4ZTFA 1FP2A 1NK3P 5FB2A 5FRMA 3C3WA 3BR5A 5DUKA 3OYIA 2A69F 2QZ8A 1D5YA 4A3IJ 3DEWA 4MEXF 2QKLB 5HLTA 1TBXA 3MWMA 5AIPA 3FKIJ 2DN0A 3U21A 4ZJZA 2EB7A 5D5XB 3AG1H 1GHCA 3VFZA 5ICGA 3F21A 3QPLA 2OF7A 2KIFA 3PSIA 4EJUA 2KDOA 4ASNA 3SJMA 4XICA 3C2BA 3K70D 4HF1A 3CMYA 1WJFA 3WE2A 3HSEA 2KJCA 5GTIC 5EG0A 5KK1A 3CDIA 5JVGF 3I53A 2NVTJ 3S93A 3T8TA 1TNTA 1HOMA 2LKSA 3ZPLA 3I58A 4BACA 4HG2A 3WGHA 1SFOJ 1ZRDA 1D0XA 2W48A 1RRJA 3AL0C 3BR3A 4BY1J 1S7OA 2EQRA 3GW2A 4XSZF 3CCLI 2GZWA 3RKXA 3GTGJ 3K1NA 2KKOA 5J1UA 3I5UA 4X6AJ 2K4JA 2ECCA 3TDZC 1HW5A 5HS7A 2OD5A 2R92J 1U0JA 3ZQIA 1NK2P 1MZBA 3IV5A 4NNJA 2F5CA 4IQ4A 1ETXA 5IY5H 4AUXA 2C6YA 2HWVA 1OCTC 4M72A 2K9SA 3SQNA 3FM5A 2V79A 1IO2A 5ICEA 2CMPA 1E3PA 1QZZA 2YX7A 2M7AA 2WA0A 4QIWN 3S3OA 3F8NA 3HOVJ 2K3FA 2EZHA 2DK8A 4RGRA 2L2OA 5F1JA 3KP2A 3K2ZA 4S04A 2RKHA 1S7AA 1SD4A 1W5CC 3F72A 3RKYA 2X6YA 3HXLA 4A5NA 1RIOH 1LB2A 2BHZA 2QBYA 2Y0SN 3A0HC 3RYRA 2XUBA 3EUAA 3LL7A 3U1KA 1QPIA 2EBIA 2L4MA 2CV1A 5GPAA 4PZJA 2R7UA 2JRTA 3TBIA 2ELKA 2LY1A 4XQFA 1SVMA 2CQNA 2M0MA 4NC8A 1MD0A 1WJDA 2OV7A 1XSXA 2EZIA 3K2AA 2D1VA 3GVAA 3PIOF 4C3JJ 4X0GA 3ABTA 3IAM2 1HBXG 1Y6IA 4YELA 3DTEA 2WV1A 4OOIA 1O3TA 4XN0A 1ZAOA 2OTLI 3M4OJ 4BH9A 1WI3A 3J80K 1K7AA 2EA4A 3DU5A 4C3IJ 3K4MA 4EJOA 1PVEA 2AS5F 2HZDA 3O3KA 4GYIA 5L3DA 2KZVA 5E20A 2LDUA 1W5SA 4E7HA 3MCZA 2Y0MA 2VE9A 3AG4H 3WU2C 1OR7C 3CC2I 1X3WB 2L9RA 5FKKA 2E36A 5GAHJ 4BU2A 1X2NA 2O8XA 2YX4A 1ULYA 4OINF 1IC8A 4UY8I 1QVTA 4ZDPA 3TW6A 2STTA 2O3FA 2IS6A 2JMWA 1PDNC 1IRXA 2RC4A 2E7WA 1MNEA 1GT0C 4UUSB 3FXQA 3G6EI 1Q1VA 3QYBA 2DA4A 4OWRB 1YITI 1R1TA 5M3FJ 3UNGC 4BE0A 4EJVA 3EDPA 2H8WA 3ZR8X 1SANA 2KRFA 4LLNA 2DMQA 1HF0A 3BQZA 1U8BA 3CJRB 3BPXA 3H0DA 3Q0UA 2I8DA 3PM1A 2M3AA 2QF7A 1B72A 2EA2A 3ZQHA 3S2HJ 4CCLA 2ZJPF 1JUSA 2VOOA 2Q2EA 3R60A 3I0TA 2ID3A 3P9CA 4GRIA 3U1DA 2NNYA 2LD5A 4BEHB 3JRGA 2IPQX 3CESA 2V9VA 1PUFB 4ZYAA 3TGNA 1T2KA 3V8KA 1ZYRF 1FMVA 5M5XJ 3ROUA 5LBQA 3M8JA 1YOVB 3FBNB 2QQ8A 3PUFA 2QSHX 1MH3A 2X6XA 1I50J 5IYDJ 4H4KC 3K1MA 1LDJA 2JPBA 3QU6A 2PMZN 4XLPF 2VB6A 4E7LA 2VJJA 4XKWA 2DA6A 2M45A 4LD5A 1HA8A 2ZCWA 4CCMA 4A3FJ 4AYBN 3ERED 5CQEA 3S1RJ 1YX3A 3DPLC 5L3GA 2BVLA 2KIUA 4J19A 4E7IA 4QLCU 1TNSA 4B44A 4Q47A 1P4XA 4BL0B 1QHHD 3JREA 1XMKA 1FY7A 2ZO4A 4WF2A 1XX5A 1A6IA 2DK5A 2TDXA 3B02A 3NQOA 2RV8A 3Q3SA 2B7EA 3DTIA 3ECHA 3M3YJ 1FP1D 1LVKA 5EG0B 4I99C 1R1VA 3NEUA 3OYKA 5TJJA 2VBXA 2EFWA 2RDPA 1GXQA 2CUFA 3LSHA 1CGPA 2DA3A 3O8HA 1T8IA 3GEZA 3HC7A 2LP0A 1W7PA 2L02A 3PJRA 5IT9K 1E17A 2JA2A 4JK1X 2FQ4A 3M7GA 4MQVA 3JAMZ 1VQOI 4F91B 2QYOA 3HHGA 2Y48A 3CCEI 2HR3A 5CVIA 3CMMA 3WTSC 2QWWA 3G3ZA 1Z3YA 1WFXA 4UVBA 5FD6A 2P5KA 2Q0OA 3SZPA 1YI2I 1LKXA 1JHHA 1JUMA 4MFEA 1H88C 4B4CA 1BI1A 3J7YJ 5EDNA 4B43A 4CH7A 4XL9A 1SD5A 2MW8A 4KIGA 4HLYA 4A0YA 2DOAA 2XROA 2CV0A 2JWTA 3OS0A 1F5TA 3J7AY 2XGXA 3BJAA 3EPZA 1Z91A 2QKMB 3JRAA 5FRNA 1G59A 4XM3A 5A2QZ 5DCFA 2O8KA 1FC3A 3TP0A 3CO7C 3K4LA 4RA2A 2XAHA 3I59B 3IHUA 1X1BA 4CXFA 2X6OA 2A6TA 3HRUA 5DCMA 3OV8A 5HDNA 5J40A 4RB1A 5HVQC 1W0UA 1MDMA 1BBYA 4FCYA 4HBLA 1BR1A 3DLLF 2FXAA 3GO5A 2JA7J 1XDUA 1OJLA 4HA8A 5DD4A 2LOOA 4D5FA 2NVYJ 3BG9A 3C7JA 2HPMA 2R93J 4V2FA 2LVSA 1IDYA 2XF7A 4KN4X 4AVPA 3MZ8A 5JLXA 2WAQN 3PNTA 2HOSA 2JTVA 2VKHA 5K5QA 1TWCJ 2I5UA 4AIKA 1YS7A 2BXZA 1TT5B 1LUJB 4XOTA 2RNGA 3WU0A 2PLYA 1XB4A 2YSRA 3F8FA 2DA1A 4IL6C 2CH0A 2BBYA 5J1YA 2R7WA 2HVSA 1X1DA 5CVRA 1JTYA 3GXOA 2CO5A 3Q9VA 1GDTA 4BS9A 4G8XA 3VSLA 4EM1A 3I55I 2K40A 1OCOH 2JUCA 2KRHA 3CCYA 3IH4A 3R0AA 4AD9A 4JYKA 4NQWA 5DD8A 1YIOA 1T95A 1LE8B 1Z05A 4U88A 3QPSA 2V1DA 3SZGA 2DFEA 3GTQJ 4M6XA 3PO2J 1JHFA 3QOEA 1QHGA 3VYSB 4S05A 5F0HA 2ZSHB 1PP8F 2PEXA 3H9JA 4MEYF 2J5OA 2ZBKA 4IEJA 3ZRGA 1BOBA 1I3AA 2DTZA 4E7KA 1ZGAA 3ULQB 1HSJA 4HV5A 1J7KA 2MLKA 5H2FC 2ZFWA 2F48A 4XKCA 5ERIA 4PSWA 5FKNA 1IRGA 4L9JA 3MKYB 4BJTA 5IOZA 1MJ9A 4GCVA 1ZLJA 2VBZA 4CCJA 2IS2A 4BQQA 1T6SA 1H0MA 4G6QA 3A1YA 2FNPA 4XKVA 2DJNA 1TP4A 2AHQA 2LTPA 4NUBA 4Y52J 4QPQA 4Q5SF 2V6CA 3E5XA 3VEPA 3FF5A 4KUMA 4XLAA 3L2RA 4G7HF 3PSFA 2KT0A 2K4BA 1EV7A 1IXRC 1KA8A 1R5HA 1B72B 2VT3A 2Q2EB 2EINH 4JX5A 1F4KA 4M6YA 4U7BA 2W4SA 4ZYEA 3TKYA 2IP2A 3CC4I 2V26A 3TOAA 3BG3A 1JGSA 3QOPA 1SMYF 3HKZA 3TEDA 2XAGA 3K1PA 4HSRA 2QQ9A 4LLLA 2JA6J 3R61A 3WG7H 2CQKA 3X2QH 2W24A 1LNWA 3E6BA 2V1UA 4F3QA 4BQNA 2OU2A 3FHZA 3D5SC 5E3LA 1H9TA 3WG9A 5LGTA 5FKMA 3B6CA 3LOCA 3QP5A 5J1RA 3OS1A 1XCVA 2FA5A 3NARA 2IA1A 3DFGA 1FOWA 5LRSA 3KFWX 2GBYA 3J7ZI 5J47A 3LFKA 4A3EJ 1PYVA 5JI6A 2B63J 2VQCA 1N77A 2HQ5A 3MMYB 5EEGA 4HQMA 5BPIA 4BBRJ 1I6XA 1ZR2A 3SEZA 1R1UA 4OAYA 4KFCA 2F5DA 4XLCA 2DPDA 4L5JA 5J8FA 2AXTC 3MFKA 4NC7A 1K61A 2IJLA 3HBLA 3QPHA 1T0FC 2DTRA 4DYCA 4M9ZA 4YFNF 1TZLA 1CF7A 3S1MJ 1E3OC 3ZP5A 3L1PA 5GP9A 3SDBA 1FIPA 4D7NA 2VUMJ 3L9FA 4HDUA 2PG4A 2IVMA 3OR2C 2MC4A 3DKXA 4GYGA 3ABKH 3EETA 1W7PB 1J75A 2DJIA 2E5NA 2EIMH 1R23A 4EJWA 5F1RA 3AFHA 4LITA 1VQNI 2COBA 2AO9A 2JK3A 3JRIA 2ECBA 3OOPA 3MZYA 3O8GA 1LPQA 3BZCA 2EZKA 2MD0A 1J09A 1Z3XA 3PFYA 2X1CA 3V7SA 4ZC3A 5L3BA 2JN6A 2JSPA 3LNQA 1QBJA 1RR8C 3AKZA 1FSEA 4DYRA 2V6EA 2K86A 4U7DA 4G7ZF 4IOCF 3OY9A 1QA6A 1OCRH 4M3EA 3JR9A 4UVAA 3G71I 1MSFC 3HB9A 1A36A 1UAAA 1MBJA 1ZR4A 1MNDA 1TQIA 3WE3A 4XSXF 4C2MJ 1W36C 2D5VA 1JKQC 1I5ZA 4AWXB 5KNLA 4UUTA 5DCMB 5ICCA 1ETVA 1MDMB 2O7OA 3RJPA 4IJAA 2QM3A 2IGOA 5HNFA 1SMTA 3J81Z 2OA4A 1E3HA 3EYYA 2RN7A 5LHGA 5B1AH 4FISA 1Z67A 1IDZA 3BWGA 3ZMSA 1VQMI 3Q0WA 1O3RA 4DZJA 2DYSH 2UXNA 4G6DA 2VKDA 3BT9A 3GFMA 1TC3C 2DO7A 2FNAA 4A93J 5E1XA 1ETQA 2HVQA 3AAFA 2HOTA 2IW5A 4G7OF 1H8AC 4CGZA 3GZNB 2CV2A 2QQAA 1GVJA 4RAFA 5FGMA 5FLXK 4HOBA 1XC5A 2D2WA 4LMYA 1N25A 3S3NA 3I71A 4E7JA 3M07A 1XS9A 3FXKA 3LA3A 3E5QA 3OYBA 3F0CA 3BP8A 2V1XA 3LSMA 2W00A 3BR6A 4M3GA 4MFDA 4NQWB 4DIQA 3WTXC 1YLFA 3QP6A 3FMQA 3WTUC 2BW3A 1FSHA 4N0BA 1S72I 4RB0A 4O5VA 2E2IJ 1R6RA 3GTMJ 3FXLA 4GXOA 4ZTJA 2L9NA 3K4NA 4BEHA 4PJ0C 1MGTA 2WBMA 3H3ZA 1MBHA 2XGEA 3C2HA 4X1EA 2Y0SA 3K4CA 4C30A 2XPVA 3ZMDA 3S14J 2G0EA 5AONA 2IGKA 4XR6A 1XSDA 1X1PA 2KHMA 3GTKJ 3JRDA 4A3LJ 2R7QA 2CUJA 1BIAA 1S7EA 2V7FA 2A05A 2ZC2A 4IO9F 3A4CA 1LDKB 2ZSIB 3DTKA 4WXDA 4AIDA 2XHKA 4WCGA 2F5FA 3GTOJ 4MHGA 1ZGWA 2K9QA 1G3YA 3JTHA 3CJQB 2BV6A 4DNCA 2HEOA 3TO9A 1B9MA 4D9JA 3L00A 4XMYA 1VQPI 2Z9OA 3OWTA 4DW6A 3L2WA 1P7IA 2CSOA 4YFXF 1K79A 3OIOA 1JT6A 2FBIA 2VN2A 3HOZJ 1S3JA 1JUPA 2DFFA 1WSUA 2CGPA 2NOGA 3CJTB 2CUEA 3TOBA 3BJ6A 3JRCA 2EZLA 4OMYA 1ZHFA 4OMZA 4Q4ZF 4HRIA 2ZXIA 4G12A 5DDGA 3S1QJ 2MGQA 1OYIA 4GO1A 1EH6A 3BJOA 1R49A 3VSKA 2PMUA 3KX2A 5CPRB 5LEJA 5IP7J 3FK7A 4RAYA 4B48A 4RDUA 5BPDA 3CUQA 4FTHA 4M73A 4BAYA 1T33A 4E7SA 3M8EA 4JX4A 5ED4A 3GTJJ 2P0WA 1B4AA 4BGDA 1JJ8C 2R7XA 2DMPA 2MG4A 4L9NA 2KIQA 1RKWA 1I27A 3CCUI 3WHBA 2DT7B 3GZ5A 4A3GJ 2DODA 2XGCA 4BBSJ 4JQFA 3RQ4A 3CLOA 3FBIB 1U8RA 2FD5A 3PFIA 1KU7A 4II2A 3OMYA 3BTCA 1U5TB 3F22A 3BTLA 1EJ9A 2X1EA 3F8MA 3I4PA 2P6SA 1A35A 1VTNC 1TWHJ 4G9YA 3ZMZA 3C1DA 4KJZA 1K83J 4H0EA 2XAQA 1KGSA 2ID6A 3DBLB 4PDKA 2OQRA 2DDAA 3P5JA 1CF7B 2XSJC 4ABZA 2Q1ZB 2Z3YA 2P5LC 1VF9A 1RUOA 4D5CA 3I59A 4RLQA 4LK1F 2PQ8A 3HTUA 3N05A 4II3A 5D6EA 1ZTRA 1IXSB 2ZMEA 1FTZA 2E71A 4UV9A 4CZZA 4F93B 3HL2A 1YX5A 4CYCB 3RZOJ 1XG1A 1XTAA 2YS9A 1P92A 2A6EF 3DKYA 4XNFA 4Y4RA 3ZGKA 1OLTA 4BHPA 3GMEA 3KEOA 2K7LA 2IS1A 1TWGJ 2VKEA 1WVRA 1QZEA 1YFHA 1JI8A 3DP7A 2GA2A 4XORA 3TDUC 1T56A 2PMZA 5ICFA 1BM9A 5ILUA 2ZNYA 4HW0A 3BTIA 4Y33A 3LWFA 3W3CA 4C3HJ 2DYRH 1YJWI 4AYBA 5J6XA 2R7RA 4HX8A 1A5JA 1YTYA 1EKEA 1IUFA 3LFUA 4HNVA 5FLMJ 2DCEA 4D0PA 1BR2A 1TWFJ 4I0BA 1VQ7I 5E17F 4XK4A 4W97A 3HOXJ 3BZKA 5H6RA 3DPUA 4YFKF 4F92B 3KP5A 2VBWA 3REOA 4AC0A 1KU3A 1WCMJ 2X85A 2I10A 1KQ9A 4ENKA 2R5ZB 4ZYHA 3H36A 3PQJA 1LE8A 2FSWA 5K5OA 4N4OB 2E1NA 4ENJA 4A0XA 4A5MA 1KONA 3L7WA 2VC1A 5DTDA 1R71A 2DU9A 2ZJQF 1LEBA 3FISA 2ISYA 2CUZA 2KRCA 3OL4A 2ZXHA 5D8KB 2IRFG 1QU3A 3PL8A 3PO3J 2FMYA 1IN7A 3IKTA 5IT3A 5F08A 2COMA 5D4RA 4U0VA 1JXSA 2DPUA 2M1BA 1XDSA 2M30A 2TCTA 4LB5A 4J01A 4PFPA 3LAPA 5EZHA 1ZN2A 3QYEA 2RAEA 3GFLA 3R6SA 1ZREA 1YO5C 5E1WA 5BNGA 3LAJA 2Z5UA 3WTYC 5LFAA 3K4BA 3HOUJ 2ZNZA 2VJIA 2MA3A 4BDZA 1T39A 5F04A 2XASA 5HODA 2OTJI 3RKQA 3DQVC 5L3FA 3LMMA 3M1EA 2HQRA 1NH3A 1G4DA 2AXLA 4E6KG 5DM7F 1IRZA 4NBQA 2BY1A 1USTA 2BW3B 3ESWB 1V5FA 3CD6I 3S8PA 3GLLA 1Y39A 1FEXA 5CJ9A 3SFIA 2P5VA 3HTSB 4CA0A 4K2EA 2JVGA 4C9YA 3LSKA 1KZHA 4OU0A 2QA4I 3WHCA 1MMGA 1X2MA 4PJNA 4Y17A 4BHBA 3O2PE 3OYCA 4NB5A 2R0QC 3CJNA 4CCOA 3GFJA 3TQNA 3JRBA 4N9IA 2WAQA 4KIBA 1I1SA 1BL0A 1C0WA 3B6AA 5LGUA 5CVVA 3ZN1A 3OS2A 1RR7A 3IWFA 5C3EJ 2GAUA 1YRNB 3HGGA 2CWEA 1TQPA 2VJ5A 4ESFA 3JAMK 4IOAF 2FU4A 5JHUA 1LDDA 3DEUA 1KU9A 5GAEJ 1DU6A 1UB9A 5H20A 1LFBA 2PN6A 2M34A 5GADJ 2CQQA 2H94A 2Y2ZA 2ZKZA 5FFXA 5L3CA 1UHMA 3CF2A 3GWZA 1OYYA 2J5PA 1EH8A 2DMUA 1VZ0A 3DBRB 3LSTA 5HDGA 1KQ8A 1WJAA 3P7NA 1Y1VJ 3E0JB 3RPUD 4E70A 2GWRA 5A2QK 2WY8Q 2X0LA 2FMLA 2L54A 3K6GA 4FE7A 2STWA 3GTPJ 1Z77A 4HPQA 5H6QA 1U9NA 3B73A 3DU6A 1WJEA 1TW2A 3CUQB 2KJBA 2DFIA 2QVOA 1G3SA 4JX6A 1HDPA 1FBSA 4C2UA 3QYFA 3T0YA 2XC7A 3I56I 1OCPA 3HOYJ 2DXIA 2WTEA 2E1CA 2VPLA 2UWMA 3S2WA 3BY6A 2TRTA 2KDZA 5FO5A 1QGPA 2NXNB 2OPTA 2LKPA 4DJAA 4A3JJ 3OSGA 3HUGB 4IHYA 4CUGA 5HNHA 1HC8A 4OIRF 1B1BA 1ONVA 2EJRA 3CCRI 3BR1A 1P7JA 2V1NA 1MIJA 3BPVA 4P5OA 3BTJA 1P4AA 5ILSA 2L3DA 2EIJH 5C44J 4FASD 1FWZA 1HQCA 3RZDJ 1EF4A 1JKRC 2HTSA 2HKOA 3E5UA 2M7BA 1JJ6C 2W1OA 2ZMEB 4XBFA 2E5ZA 1EA3A 1VQLI 5FJ8J 4ZDOA 1BN5A 5GAGJ 4L18B 4I09A 2IGMA 4R8HA 3WGGA 4I6ZA 4XLFA 1P9QC 1A04A 2MFZA 4D1QA 2F4IA 1T08B 4BXUA 2CU7A 5HLGA 4HEA2 4IKFA 5GTHC 1RNLA 2HTJA 3BR2A 2HYGD 1MMDA 3WGIA 4XRSA 3EUHC 4P55A 3HIFA 4U87A 2HYJA 4FT8A 3DXJF 4PGHA 3L2VA 1MBEA 5B1BH 2OQGA 1RUNA 1J2XA 4PCQA 2OC6A 3BROA 3RIRA 3FKJA 1UELB 1WPKA 3A01A 4QWQA 1RZ4A 2R4GA 5F0CA 1S5LC 3AL0B 1P6RA 1WJCA 1BI2A 3CCMI 1GXPA 2XIGA 1F36A 2WB1N 5IP6A 2FOWA 1YE9A 3MEXA 3IC7A 3HOTA 1VQ5I 2NS7A 3C18A 2Q8KA 4N4NB 2XAJA 4ZYDA 1U6GA 4M9XA 2O03A 1S9HA 1AWCA 1UHSA 2FOKA 3TP3A 1FTTA 1FOYA 5EJCA 1E0EA 2K9MA 5CVUA 2Z2SB 3M1CA 3OYMA 3BC8A 1ETOA 5DEQA 4GGGA 1U3EM 5IP9J 3KYLA 2F4MB 4HV6A 1P4WA 3ZN0A 1ZRFA 2W84A 1J5YA 1Y0NA 2ME6A 3ZXSA 2NVXJ 4KMFA 1R00A 3EUHA 3OYFA 2VT2A 1U5TC 2HI3A 2IEKA 4RB3C 5TRDA 1UFMA 3K69A 3OL3A 3VWBA 2M8EA 5E79C 3D5RC 3VYTB 3S17J 2QSGX 1Y8QB 1O57A 4KNYA 2MH9A 1K4SA 3A03A 2ELHA 2XV4S 4HLXA 3RQIA 4A69C 2ISZA 1MH4A 4HZFA 5LRRA 1VFCA 4WXCA 3HZJA 5HS9A 2EV6A 3LQRA 2Z16A 4NHJA 2A5WA 1S6LA 4C2TA 5JFRA 6PAXA 4KISA 2OZ6A 3HG9A 4EVIA 1YQAA 3NRVA 2LR8A 5E3OA 4IX7A 3HSRA 2R7ZJ 4ESJA 3CP8A 2RQPA 2GIVA 3KIOA 1J0RA 3CO6C 1B9NA 1Z6RA 4IXAA 2FQ3A 1B59A 1J9IA 2A5YB 3K70C 2WAEA 2HYFA 3FIWA 2UUZA 2D1HA 1WH7A 5KAIC 2MD5A 1VQ9I 3D5LA 5DUIA 2FE3A 1WZ2A 1Z1DA 3FM3A 3E97A 2KPMA 5D6FA 4I98B 2VQGA 5E1ZB 4EJTA 2BY2A 3TO7A 3JCUC 2BHYA 2DQRA 2QQBA 3ISPA 2X6WA 2HS5A 1WJBA 3KP4A 3EQLF 3FXRA 4BJ6C 1BA5A 4B8XA 3BG5A 1IZ1A 2VXDA 3WTWC 5EYRA 1U5TA 4U0WA 4V2GA 2H09A 2DQLA 3G1LA 5DS9A 1IF1A 1YW8A 4CSWA 1SEUA 1SVLA 4AIHA 3EUKL 2V9KA 4I2OA 3F8CA 2XPUA 5EEHA 3JRHA 2X9DA 3E6MA 2ZXJA 2R7SA 1NG6A 2NS0A 4IPAA 5F64A 2OJED 2LBFB 3IKVA 2E1MB 1IN8A 3G1MA 3QAHA 1PJRA 1BIBA 1OKRA 1OMIA 2R7FA 4JBAA 3QWLA 4ITVA 1VI0A 3BR0A 4CYCA 1O3SA 5HS8A 1QVUA 1IN6A 3HGYA 3K4JA 1R58A 2F5EA 1ACIA 4IHWA 2KL4A 2L0KA 3J81K 1ZQ3P 1BW6A 2QSFX 2YPRA 2Y30A 3GUDA 1DPUA 2DOFA 4UXNA 2MC3A 2V4JC 2P7CB 4CDGA 4W1UA 3UKGA 2EFNA 1YJNI 4XLHA 3OOUA 2LSOA 5KAFC 2YU3A 3HOSA 2R5YA 3F6OA 4HSTA 1ZH5A 3ZMUA 4AM3A 3WODF 2A07F 5JLWA 3D0SA 4DYQA 1R5GA 2OBPA 3FK6A 4R1HA 4UVCA 4IQJA 4M3FA 3CP2A 4F55A 2HXOA 4PK4A 1MMSA 1R4MB 5LHIA 3FMRA 3VYUB 2R5ZA 4AIJA 4IF4A 2QEXI 1D1BA 1Y1WJ 4ENMA 3BQYA 2LG4A 1I6HJ 1UMQA 1HKTA 1RESA 3MN2A 4IHSA 3S16J 3K9TA 2DI3A 1RETA 2RVCA 3PNYA 1QQIA 1GVDA 2GXBA 4A3BJ 3GCMA 2CQXA 4G94A 3WTZA 3CC7I 2LK2A 3H5RA 3OIPA 2MYSA 5JR3A 1O3QA 2OCEA 2H8RA 3CQZJ 3CCQI 4TV7A 1GV2A 3R0JA 3V8LA 2NNNA 1R9TJ 3L09A 2FJ1A 3PNVA 3K4KA 2RNJA 4LG0A 2PJRA 1BI0A 3KZIC 4JP0A 1SFXA 2MBFA 1UJ8A 4ZZDA 2GOXB 4BE2A 3RKWA 9ANTA 4EM0B 1L0OC 4ENNA 2OAZA 4M3BA 4OAZA 1K6OA 2DW4A 2DMTA 2HFHA 1WWXA 1DP3A 3HSFA 3A01B 2A6HF 3V42A 2M8GX 1WKMA 4P1WA 4RLFA 4B47A 4CO8A 1VQ6I 3A02A 5JHFA 3SYTA 2DFHA 2PMHA 1ITYA 3LSGA 2KIMA 1G8XA 1P2FA 1ZKGA 3RTRA 1OQYA 4HNTA 3RSNA 1D8KA 2VI6A 4MGRA 5K7ZA 2LNBA 2HDDA 2EH3A 3ABMH 3Q5FA 1DPRA 1H9GA 1MKMA 4WXHA 4DOZA 3IH2A 4Y7NJ 1DP7P 2L01A 2EWNA 3W6VA 5K5RA 1OYWA 4HQEA 3CUQC 2OUMA 4ZH4F 1DDNA 4BKXA 4Z2YA 2F6CA 5F0FA 1R7JA 4BXFA 1XD7A 3AG3H 1D8JA 1WH5A 5LEKA 3DEEA
chains in the Genus database with same CATH topology
5EDNA 5EGOB 2R5ZB 2MW8A 1LE8A 2O9LA 2JWTA 1LFUP 1GUUA 2VKVA 5DTDA 3JRAA 1YRNA 3FISA 2O8KA 3TP0A 3S1NJ 2DA5A 3PO3J 2M9HA 2X6OA 4A3MJ 5F08A 1W0UA 2TCTA 3LSJA 4FCYA 2XRLA 1NTCA 5EZHA 2RAEA 3H0GJ 1APLC 2JA7J 1JKOC 1OJLA 3E7LA 4RBOA 5BNGA 4D5FA 2NVYJ 3BG9A 3IH3A 2R93J 4V2FA 5IYBJ 2LVSA 3HOUJ 1IDYA 1ETWA 5JLXA 5F04A 2WAQN 5HODA 3RKQA 3S15J 3OSFA 3G1OA 4XRSG 2HOSA 1TWCJ 1IRZA 4LOCA 3JRFA 3HDDA 3I4NJ 2DA1A 5J1YA 5E3MA 2GM4A 5M5WJ 1JTYA 1ENHA 1FEXA 3SFIA 1HDDC 1GDTA 1G2HA 2Y9ZA 2ZB9A 2K40A 3WHCA 3CCYA 3IH4A 1X2MA 4JYKA 2R0QC 5FLVA 3H3VK 5EZGA 1LE8B 2NVQJ 3JRBA 3QPSA 5M3MJ 1MNMC 1BL0A 3GTQJ 3PO2J 2JJ7A 1RPWA 3B6AA 1RR7A 5F0HA 5C3EJ 1YRNB 3HGGA 4IEJA 2DTZA 2K9NA 2FX0A 1DU6A 1O4XA 1LFBA 2CJJA 1JT0A 1MBFA 2M34A 2CQQA 3DCFA 2Y2ZA 5FKNA 3HKZN 2YUSA 5IOZA 1BW5A 2XB5A 1JGGA 5IOYA 4XRMA 2DMUA 5J3LA 2DJNA 2E19A 2L7FP 4BXXJ 3ZQLA 1Y1VJ 2AHQA 3ZOBA 2LTPA 4QTRA 4Y52J 4NDLA 2XGDA 2GLOA 1JKPC 2KT0A 2DMNA 4FE7A 2IBDA 2ME0A 1B72B 2E2JJ 3GTPJ 1Z77A 1U9NA 1IG7A 4UUSA 2R5YB 5EEAA 2JA5J 4JX5A 4IHXA 4JX6A 1RKTA 4BY7J 1HDPA 3HOYJ 1UG2A 1FJLA 1OCPA 3BG3A 1FIAA 3GTLJ 3TEDA 3NAUA 1H88C 2KDZA 2TRTA 2YU9J 3HOWJ 2OPTA 2X48A 2JA6J 4A3JJ 3OSGA 4IHYA 1JTXA 1POGA 2LFBA 1Z0XA 5C4JJ 1AKHA 3BR1A 1P7JA 5E3LA 3BTJA 1W0TA 5F27A 4IHVA 4S0HB 5FKMA 3B6CA 3LOCA 4B3AA 5J1RA 3I4MJ 1B8IA 2N8GA 3NARA 5C44J 2Y9YA 4A3CJ 1ETYA 2XPWA 1BJZA 2GBYA 1PUFA 2MSYA 3RZDJ 2VPRA 4A3EJ 1EF4A 1JKRC 2LKXA 2NS8A 2B63J 5EF6A 2HQ5A 4M3DA 4BBRJ 1JJ6C 1ZR2A 5FJ8J 4A3KJ 4I6ZA 1NK3P 1K61A 3HBLA 3BR5A 4DYCA 2CU7A 3S1MJ 1D5YA 4A3IJ 3DEWA 1E3OC 3BR2A 3L1PA 5GP9A 3FKIJ 4XRSA 2DN0A 1FIPA 4D7NA 2VUMJ 2HYJA 3QPLA 1MBEA 2OF7A 2COBA 2AO9A 2JK3A 3JRIA 2XB0X 3SJMA 2ECBA 3ZQFA 2L7ZA 4XICA 1WPKA 3A01A 3GBGA 3C2BA 3O8GA 3CMYA 2EZKA 5EG0A 5F0CA 2H1KA 2NVTJ 1AU7A 2JN6A 3LNQA 1F36A 2WB1N 5IP6A 1HOMA 1OFCX 2LLKA 4DYRA 1SFOJ 2W48A 2NS7A 2JA8J 3SDGA 1ORKA 3BR3A 4BY1J 2EQRA 3GTGJ 3QQAA 5J1UA 4M3EA 3JR9A 1MSFC 3HB9A 1UHSA 3TP3A 4MLOA 1FTTA 4X6AJ 1MBJA 1ZR4A 2ECCA 4C2MJ 1H89C 1MSEC 1ETOA 5IYCJ 2D5VA 1JKQC 2R92J 4UUTA 3ZQIA 1NK2P 1ETVA 5IP9J 5K7FA 3IV5A 2O7OA 1ETXA 5EGOA 1ETKA 4AUXA 1OCTC 2K9SA 2ME6A 4FISA 2NVXJ 1IDZA 2HI3A 2IEKA 3Q0WA 4DZJA 4QIWN 5K7HA 3HOVJ 1DU0A 2QCOA 3BT9A 2EZHA 2E2HJ 1TC3C 3LSPA 3S17J 4A93J 5F1JA 1ETQA 2HOTA 3A03A 1U78A 3RQIA 1H8AC 4A3DJ 4A69C 1QRYA 1MH4A 5C4XJ 1VFCA 3TW7A 2Y0SN 1QPIA 2P81A 1XC5A 2EBIA 5GPAA 2ELKA 2LR8A 2HXIA 5E3OA 1XS9A 4QSHA 2R7ZJ 3F0CA 2HOAA 2EZIA 3K2AA 5E3NA 3BR6A 4M3GA 4MFDA 1MBKA 3VPRA 4C3JJ 3FIWA 1WH7A 2WV1A 2E2IJ 3M4OJ 3GTMJ 1WI3A 2M0CA 4C3IJ 2M2EA 1MBHA 2XGEA 2CRGA 4X1EA 2XPVA 3S14J 2G0EA 3GTKJ 3JRDA 3HEFA 4A3LJ 1BA5A 3BG5A 1S7EA 3K7AJ 4MIMA 5EYRA 4V2GA 2L9RA 5FKKA 1AHDP 2XSDC 3G1LA 5DS9A 3D1NI 1X2NA 3GTOJ 1IC8A 1ZGWA 2K9QA 1QVTA 4GFBA 2XPUA 3TW6A 3JRHA 2X9DA 5FKLA 2JMWA 2L7MP 4DW6A 1P7IA 2E1OA 3OIOA 3G1MA 1JT6A 1GT0C 3MKLA 4UUSB 3HOZJ 1JUPA 1VI0A 3BR0A 4D7MA 1Q1VA 4CYCA 2NOGA 2DA4A 1QVUA 2CUEA 3HGYA 5M3FJ 3JRCA 4IHWA 3LSRA 2EZLA 2L0KA 1ZQ3P 1BW6A 1SANA 1IGNA 2Y30A 1GV5A 2DMQA 4G12A 1HF0A 3BQZA 3S1QJ 1U8BA 5FKOA 4M6VA 2MGQA 3Q0UA 4W1UA 3UKGA 3PM1A 1AKHB 2QF7A 1B72A 3OOUA 1WGXA 3ZQHA 3S2HJ 1JUSA 3S2DJ 5IP7J 2R5YA 3FK7A 2ID3A 4RDUA 4FTHA 1B8IB 1T33A 2LD5A 1VNDA 5JLWA 4JX4A 4DYQA 3GTJJ 3JRGA 3FK6A 1JJ8C 4B1RA 2DMPA 1U9OA 2MG4A 1PUFB 1RKWA 5GPCA 5M5YJ 3WHBA 4A3GJ 3MVPA 1ZK8A 4FE4A 4L5EA 4M3FA 2XGCA 5M5XJ 4BBSJ 2HXOA 2FD5A 2DA2A 2R5ZA 3BTCA 1MH3A 1I50J 5IYDJ 1Y1WJ 1X58A 3BTLA 1F43A 2Y31A 3BQYA 1I6HJ 1UMQA 1RESA 1TWHJ 2PMZN 3MN2A 3S16J 1K83J 1RETA 2ID6A 4DZPA 1GVDA 1CQTA 4ABZA 4A3BJ 2DA6A 1MBGA 2CQXA 2LK2A 1VF9A 1HLVA 4D5CA 2H8RA 4A3FJ 3CDLA 1TWAJ 4AYBN 3CQZJ 3S1RJ 1HCRA 3Q0VA 1ZTRA 1GV2A 4J19A 1R9TJ 1IV6A 1FTZA 2FJ1A 4XIDA 2DA7A 3JREA 4JP0A 1I3QJ 4CYCB 3RZOJ 1XG1A 9ANTA 4M3BA 2YS9A 1A6IA 2DMTA 3A01B 3Q3SA 2M8GX 3M3YJ 5EG0B 3A02A 1TWGJ 2VKEA 1ITYA 2CUFA 3LSGA 1T56A 4I76A 2DA3A 1ZKGA 3O8HA 2LP0A 2VI6A 3BTIA 3ZQGA 5K7ZA 2HDDA 4C3HJ 2EH3A 2FQ4A 5IPAA 4Y7NJ 3IH2A 1A5JA 3W6VA 1IJWC 1IUFA 4HNVA 5FLMJ 1TWFJ 2IAIA 4BKXA 4XK4A 4W97A 5F0FA 4EEFG 3HOXJ 4MO7A 3ZQCA 1WH5A 4AC0A 3HM5A 1JUMA 1WCMJ 4MFEA 2I10A 4B4CA 2LY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EDN A;  5EGO B;  2R5Z B;  2MW8 A;  1LE8 A;  2O9L A;  2JWT A;  1LFU P;  1GUU A;  2VKV A;  5DTD A;  3JRA A;  1YRN A;  3FIS A;  2O8K A;  3TP0 A;  3S1N J;  2DA5 A;  3PO3 J;  2M9H A;  2X6O A;  4A3M J;  5F08 A;  1W0U A;  2TCT A;  3LSJ A;  4FCY A;  2XRL A;  1NTC A;  5EZH A;  2RAE A;  3H0G J;  1APL C;  2JA7 J;  1JKO C;  1OJL A;  3E7L A;  4RBO A;  5BNG A;  4D5F A;  2NVY J;  3BG9 A;  3IH3 A;  2R93 J;  4V2F A;  5IYB J;  2LVS A;  3HOU J;  1IDY A;  1ETW A;  5JLX A;  5F04 A;  2WAQ N;  5HOD A;  3RKQ A;  3S15 J;  3OSF A;  3G1O A;  4XRS G;  2HOS A;  1TWC J;  1IRZ A;  4LOC A;  3JRF A;  3HDD A;  3I4N J;  2DA1 A;  5J1Y A;  5E3M A;  2GM4 A;  5M5W J;  1JTY A;  1ENH A;  1FEX A;  3SFI A;  1HDD C;  1GDT A;  1G2H A;  2Y9Z A;  2ZB9 A;  2K40 A;  3WHC A;  3CCY A;  3IH4 A;  1X2M A;  4JYK A;  2R0Q C;  5FLV A;  3H3V K;  5EZG A;  1LE8 B;  2NVQ J;  3JRB A;  3QPS A;  5M3M J;  1MNM C;  1BL0 A;  3GTQ J;  3PO2 J;  2JJ7 A;  1RPW A;  3B6A A;  1RR7 A;  5F0H A;  5C3E J;  1YRN B;  3HGG A;  4IEJ A;  2DTZ A;  2K9N A;  2FX0 A;  1DU6 A;  1O4X A;  1LFB A;  2CJJ A;  1JT0 A;  1MBF A;  2M34 A;  2CQQ A;  3DCF A;  2Y2Z A;  5FKN A;  3HKZ N;  2YUS A;  5IOZ A;  1BW5 A;  2XB5 A;  1JGG A;  5IOY A;  4XRM A;  2DMU A;  5J3L A;  2DJN A;  2E19 A;  2L7F P;  4BXX J;  3ZQL A;  1Y1V J;  2AHQ A;  3ZOB A;  2LTP A;  4QTR A;  4Y52 J;  4NDL A;  2XGD A;  2GLO A;  1JKP C;  2KT0 A;  2DMN A;  4FE7 A;  2IBD A;  2ME0 A;  1B72 B;  2E2J J;  3GTP J;  1Z77 A;  1U9N A;  1IG7 A;  4UUS A;  2R5Y B;  5EEA A;  2JA5 J;  4JX5 A;  4IHX A;  4JX6 A;  1RKT A;  4BY7 J;  1HDP A;  3HOY J;  1UG2 A;  1FJL A;  1OCP A;  3BG3 A;  1FIA A;  3GTL J;  3TED A;  3NAU A;  1H88 C;  2KDZ A;  2TRT A;  2YU9 J;  3HOW J;  2OPT A;  2X48 A;  2JA6 J;  4A3J J;  3OSG A;  4IHY A;  1JTX A;  1POG A;  2LFB A;  1Z0X A;  5C4J J;  1AKH A;  3BR1 A;  1P7J A;  5E3L A;  3BTJ A;  1W0T A;  5F27 A;  4IHV A;  4S0H B;  5FKM A;  3B6C A;  3LOC A;  4B3A A;  5J1R A;  3I4M J;  1B8I A;  2N8G A;  3NAR A;  5C44 J;  2Y9Y A;  4A3C J;  1ETY A;  2XPW A;  1BJZ A;  2GBY A;  1PUF A;  2MSY A;  3RZD J;  2VPR A;  4A3E J;  1EF4 A;  1JKR C;  2LKX A;  2NS8 A;  2B63 J;  5EF6 A;  2HQ5 A;  4M3D A;  4BBR J;  1JJ6 C;  1ZR2 A;  5FJ8 J;  4A3K J;  4I6Z A;  1NK3 P;  1K61 A;  3HBL A;  3BR5 A;  4DYC A;  2CU7 A;  3S1M J;  1D5Y A;  4A3I J;  3DEW A;  1E3O C;  3BR2 A;  3L1P A;  5GP9 A;  3FKI J;  4XRS A;  2DN0 A;  1FIP A;  4D7N A;  2VUM J;  2HYJ A;  3QPL A;  1MBE A;  2OF7 A;  2COB A;  2AO9 A;  2JK3 A;  3JRI A;  2XB0 X;  3SJM A;  2ECB A;  3ZQF A;  2L7Z A;  4XIC A;  1WPK A;  3A01 A;  3GBG A;  3C2B A;  3O8G A;  3CMY A;  2EZK A;  5EG0 A;  5F0C A;  2H1K A;  2NVT J;  1AU7 A;  2JN6 A;  3LNQ A;  1F36 A;  2WB1 N;  5IP6 A;  1HOM A;  1OFC X;  2LLK A;  4DYR A;  1SFO J;  2W48 A;  2NS7 A;  2JA8 J;  3SDG A;  1ORK A;  3BR3 A;  4BY1 J;  2EQR A;  3GTG J;  3QQA A;  5J1U A;  4M3E A;  3JR9 A;  1MSF C;  3HB9 A;  1UHS A;  3TP3 A;  4MLO A;  1FTT A;  4X6A J;  1MBJ A;  1ZR4 A;  2ECC A;  4C2M J;  1H89 C;  1MSE C;  1ETO A;  5IYC J;  2D5V A;  1JKQ C;  2R92 J;  4UUT A;  3ZQI A;  1NK2 P;  1ETV A;  5IP9 J;  5K7F A;  3IV5 A;  2O7O A;  1ETX A;  5EGO A;  1ETK A;  4AUX A;  1OCT C;  2K9S A;  2ME6 A;  4FIS A;  2NVX J;  1IDZ A;  2HI3 A;  2IEK A;  3Q0W A;  4DZJ A;  4QIW N;  5K7H A;  3HOV J;  1DU0 A;  2QCO A;  3BT9 A;  2EZH A;  2E2H J;  1TC3 C;  3LSP A;  3S17 J;  4A93 J;  5F1J A;  1ETQ A;  2HOT A;  3A03 A;  1U78 A;  3RQI A;  1H8A C;  4A3D J;  4A69 C;  1QRY A;  1MH4 A;  5C4X J;  1VFC A;  3TW7 A;  2Y0S N;  1QPI A;  2P81 A;  1XC5 A;  2EBI A;  5GPA A;  2ELK A;  2LR8 A;  2HXI A;  5E3O A;  1XS9 A;  4QSH A;  2R7Z J;  3F0C A;  2HOA A;  2EZI A;  3K2A A;  5E3N A;  3BR6 A;  4M3G A;  4MFD A;  1MBK A;  3VPR A;  4C3J J;  3FIW A;  1WH7 A;  2WV1 A;  2E2I J;  3M4O J;  3GTM J;  1WI3 A;  2M0C A;  4C3I J;  2M2E A;  1MBH A;  2XGE A;  2CRG A;  4X1E A;  2XPV A;  3S14 J;  2G0E A;  3GTK J;  3JRD A;  3HEF A;  4A3L J;  1BA5 A;  3BG5 A;  1S7E A;  3K7A J;  4MIM A;  5EYR A;  4V2G A;  2L9R A;  5FKK A;  1AHD P;  2XSD C;  3G1L A;  5DS9 A;  3D1N I;  1X2N A;  3GTO J;  1IC8 A;  1ZGW A;  2K9Q A;  1QVT A;  4GFB A;  2XPU A;  3TW6 A;  3JRH A;  2X9D A;  5FKL A;  2JMW A;  2L7M P;  4DW6 A;  1P7I A;  2E1O A;  3OIO A;  3G1M A;  1JT6 A;  1GT0 C;  3MKL A;  4UUS B;  3HOZ J;  1JUP A;  1VI0 A;  3BR0 A;  4D7M A;  1Q1V A;  4CYC A;  2NOG A;  2DA4 A;  1QVU A;  2CUE A;  3HGY A;  5M3F J;  3JRC A;  4IHW A;  3LSR A;  2EZL A;  2L0K A;  1ZQ3 P;  1BW6 A;  1SAN A;  1IGN A;  2Y30 A;  1GV5 A;  2DMQ A;  4G12 A;  1HF0 A;  3BQZ A;  3S1Q J;  1U8B A;  5FKO A;  4M6V A;  2MGQ A;  3Q0U A;  4W1U A;  3UKG A;  3PM1 A;  1AKH B;  2QF7 A;  1B72 A;  3OOU A;  1WGX A;  3ZQH A;  3S2H J;  1JUS A;  3S2D J;  5IP7 J;  2R5Y A;  3FK7 A;  2ID3 A;  4RDU A;  4FTH A;  1B8I B;  1T33 A;  2LD5 A;  1VND A;  5JLW A;  4JX4 A;  4DYQ A;  3GTJ J;  3JRG A;  3FK6 A;  1JJ8 C;  4B1R A;  2DMP A;  1U9O A;  2MG4 A;  1PUF B;  1RKW A;  5GPC A;  5M5Y J;  3WHB A;  4A3G J;  3MVP A;  1ZK8 A;  4FE4 A;  4L5E A;  4M3F A;  2XGC A;  5M5X J;  4BBS J;  2HXO A;  2FD5 A;  2DA2 A;  2R5Z A;  3BTC A;  1MH3 A;  1I50 J;  5IYD J;  1Y1W J;  1X58 A;  3BTL A;  1F43 A;  2Y31 A;  3BQY A;  1I6H J;  1UMQ A;  1RES A;  1TWH J;  2PMZ N;  3MN2 A;  3S16 J;  1K83 J;  1RET A;  2ID6 A;  4DZP A;  1GVD A;  1CQT A;  4ABZ A;  4A3B J;  2DA6 A;  1MBG A;  2CQX A;  2LK2 A;  1VF9 A;  1HLV A;  4D5C A;  2H8R A;  4A3F J;  3CDL A;  1TWA J;  4AYB N;  3CQZ J;  3S1R J;  1HCR A;  3Q0V A;  1ZTR A;  1GV2 A;  4J19 A;  1R9T J;  1IV6 A;  1FTZ A;  2FJ1 A;  4XID A;  2DA7 A;  3JRE A;  4JP0 A;  1I3Q J;  4CYC B;  3RZO J;  1XG1 A;  9ANT A;  4M3B A;  2YS9 A;  1A6I A;  2DMT A;  3A01 B;  3Q3S A;  2M8G X;  3M3Y J;  5EG0 B;  3A02 A;  1TWG J;  2VKE A;  1ITY A;  2CUF A;  3LSG A;  1T56 A;  4I76 A;  2DA3 A;  1ZKG A;  3O8H A;  2LP0 A;  2VI6 A;  3BTI A;  3ZQG A;  5K7Z A;  2HDD A;  4C3H J;  2EH3 A;  2FQ4 A;  5IPA A;  4Y7N J;  3IH2 A;  1A5J A;  3W6V A;  1IJW C;  1IUF A;  4HNV A;  5FLM J;  1TWF J;  2IAI A;  4BKX A;  4XK4 A;  4W97 A;  5F0F A;  4EEF G;  3HOX J;  4MO7 A;  3ZQC A;  1WH5 A;  4AC0 A;  3HM5 A;  1JUM A;  1WCM J;  4MFE A;  2I10 A;  4B4C A;  2LY9 A; 
#chains in the Genus database with same CATH topology
 2BEO A;  2IGN A;  3O6B B;  2UZK A;  1AOY A;  4NC6 A;  3SZT A;  2PI0 A;  3MAJ A;  4FQG A;  5HOO A;  2CW8 A;  3L2C A;  3WU1 B;  5B3S H;  2HQN A;  1IUY A;  2ZXW H;  4L0Y B;  2MH2 A;  4RM3 A;  1W1W E;  1YRN A;  4HYE A;  3OYL A;  3RCO A;  1E2X A;  1Y56 A;  2DA5 A;  4P96 A;  4FHT A;  2VAS A;  4A3M J;  1FX7 A;  2IA2 A;  1DQU A;  3IUO A;  5K1Y A;  1MJA A;  1X4P A;  1LJ9 A;  1SD6 A;  2XRL A;  1NTC A;  1I39 A;  4OIP F;  3H0G J;  1APL C;  1WJ5 A;  2W7N A;  2ZME C;  2H6B A;  3VOE A;  4LK0 F;  4LB6 B;  2FRH A;  2F4O B;  4RBO A;  2UXX A;  4L9T A;  1UCR A;  3DV8 A;  1TL8 A;  1WQ2 A;  5IYB J;  4A0Z A;  3T1B A;  2GA1 A;  4L9V A;  5CQG A;  1ETW A;  4ZDL A;  2EFP A;  1G3W A;  1RC9 A;  1IRF A;  1WRJ A;  4KT5 C;  4XRS G;  3Q9S A;  3OYE A;  1FLI A;  2HZT A;  2B0L A;  3QPT A;  4RAZ A;  1D0Z A;  1ZRC A;  3ASO H;  2BVM A;  4LOC A;  3HDD A;  3I4N J;  3HRT A;  2VJ4 A;  4EV0 A;  2GM4 A;  1Z7L A;  1Y0U A;  2Y69 H;  2BZT A;  2AQE A;  3VYR B;  1D1C A;  5M5W J;  1SFK A;  1ENH A;  1HDD C;  5DM6 F;  3CF5 F;  5CYV A;  2EPF A;  3MQ0 A;  1JE8 A;  2PFB A;  1B6A A;  2QLZ A;  3ZMT A;  2A68 F;  3ASN H;  1VQ4 I;  3HUG A;  1ODD A;  4DBR A;  3MKZ A;  4RM2 A;  2LC2 A;  4J00 A;  2L5Q A;  2W25 A;  4HF0 A;  3F9K A;  5FLV A;  3FXJ A;  3H3V K;  5EZG A;  3KEQ A;  5M3M J;  3CUO A;  1R36 A;  4IRH A;  4IRG A;  2FBK A;  4M71 A;  1G6N A;  1OCC H;  2MLG A;  4N9H A;  5E18 F;  2VC0 A;  5J4Y A;  3BLY A;  3LA2 A;  5J4V A;  3CCS I;  2K9N A;  3SEQ A;  2EV0 A;  4LGW A;  2CJJ A;  2XKP A;  1JT0 A;  2L9S A;  1MBF A;  3DCF A;  1XMX A;  2BE5 F;  4I0A A;  2YUS A;  4Q48 A;  4BHC A;  3H9Q A;  2ESH A;  2JRM A;  4I02 A;  3MZH A;  5IOY A;  2H6C A;  5J3L A;  1ERD A;  3CTA A;  2E19 A;  1ZG3 A;  2L7F P;  4ANJ A;  4BXX J;  2QEN A;  1QPM A;  2CFO A;  1D3Y A;  1Z9C A;  2XGD A;  2GLO A;  4BNC A;  3GLX A;  3JW4 A;  3BZ6 A;  1LEA A;  4XRF A;  5KHD A;  2IBD A;  2ME0 A;  2E2J J;  1LVA A;  3RPU A;  2VOD A;  2CW7 A;  2VIX A;  4AU7 A;  4EGY A;  2R5Y B;  2ZJR F;  3V7C A;  4WX9 A;  1IAW A;  1V5E A;  2P4W A;  2EK5 A;  4UHT A;  2DDB A;  3QU3 A;  1MJB A;  4KA4 A;  2GQQ A;  4BY7 J;  4E4H A;  5D4S A;  3OYJ A;  2HKX A;  2W82 A;  2IS4 A;  3NAU A;  4KN7 X;  2RGV A;  1Z7U A;  2YU9 J;  3L2Q A;  3KYD B;  4ZYG A;  1JTX A;  1POG A;  2W85 A;  3G2B A;  3J7A O;  1PP7 U;  1Z0X A;  5C4J J;  5JVT A;  1W36 D;  1O7L A;  1AKH A;  2M4G A;  1NHA A;  4O6J A;  4I7H A;  3QOD A;  4KMU X;  5F27 A;  4S0H B;  4IHV A;  4B3A A;  4Y13 A;  1B8I A;  2M4K A;  3FXM A;  4HDV A;  4A6D A;  3OYH A;  1BOA A;  1KYW A;  1EH7 A;  2Y9Y A;  4A3C J;  4P9F A;  1ETY A;  1BJZ A;  2MSY A;  3GX4 X;  5AIQ A;  2NS8 A;  3KE2 A;  1OCZ H;  4M3D A;  2ZJ2 A;  2FF4 A;  5BMZ A;  3DBH B;  4LG0 B;  5L3E A;  2PJR B;  4O3M A;  3C2G A;  2PX9 A;  2ESN A;  1USS A;  3KZZ A;  3H1C A;  2QGU A;  2GXA A;  2JSC A;  1FNN A;  4HF2 A;  3IWZ A;  1W5T A;  3ERM A;  3K10 A;  5D8L B;  3GYH X;  4BDY A;  3N97 A;  2K02 A;  1SD7 A;  2K27 A;  3FWE A;  4WWC A;  4RGU A;  5DV5 A;  1F9N A;  5LLQ A;  3J80 Z;  2LY2 A;  4RMN A;  2BXY A;  4KT6 A;  1K78 A;  4BUP A;  2E1M C;  2XB0 X;  3ZQF A;  2L7Z A;  2ZFU A;  2CYY A;  5D5W B;  3GBG A;  4RAG A;  4KIF A;  1FBU A;  2GIZ A;  3CME I;  2WY7 Q;  1WHU A;  2R3S A;  2H1K A;  1BR4 A;  3HYI A;  1AU7 A;  4M9S A;  4UV8 A;  4BQO A;  2VQH A;  4XKB A;  1V4R A;  1OFC X;  1UZC A;  1XGO A;  2LLK A;  4EQQ A;  1XSV A;  2F2E A;  1KYZ A;  2EFQ A;  2LH9 A;  3RPQ A;  2R7T A;  3DWL E;  4EAT A;  2JA8 J;  2P6T A;  3PQK A;  3SDG A;  1ORK A;  1FMW A;  2LF8 A;  3HJE A;  2HU9 A;  3MKW B;  3FHN A;  1IV8 A;  2JUG A;  3QQA A;  3ABU A;  3M8F A;  3F8B A;  4B09 A;  1PUE E;  1ZLK A;  4MLO A;  3EYI A;  2K3P A;  3PIP F;  1H89 C;  3RDI A;  1MSE C;  1KQ0 A;  5IYC J;  1K6Y A;  2A3S A;  1OR7 A;  4RS8 A;  2A61 A;  2RQQ A;  3BG7 A;  4KIC A;  1ZG1 A;  5K7F A;  2L4A A;  3ELK A;  5EGO A;  3MD2 A;  1ETK A;  4DQ2 A;  2R7D A;  3ZQ7 A;  1J59 A;  2KLO A;  2R7O A;  3RYP A;  2GOM A;  2WB1 A;  3TL4 X;  4ON0 A;  1FZP B;  3ECO A;  2XVC A;  5K7H A;  2XKO A;  4LG3 A;  2QCO A;  1DU0 A;  2E2H J;  3SFZ A;  1FOK A;  2X4H A;  2Z1D A;  3LSP A;  1IXC A;  4YRV A;  2LBF A;  5KCM A;  2XF5 A;  1X4O A;  5LHH A;  1A31 A;  1U78 A;  3BOQ A;  1IW7 F;  4A3D J;  4IVN A;  1QRY A;  1D0Y A;  3KZY A;  4R79 A;  4IRI A;  5C4X J;  3TW7 A;  1T98 A;  2OCC H;  2P81 A;  3BCB A;  1OIS A;  4A12 A;  3I54 A;  2DT6 A;  2HXI A;  4UNO A;  2WV0 A;  4QSH A;  2H1L A;  1REP C;  2HOA A;  2LY9 A;  3I64 A;  5E3N A;  2AQF A;  4IZZ A;  2GXG A;  3BCA A;  1SAU A;  5TGT A;  5BS6 A;  1MBK A;  3OR1 C;  1MMA A;  3VPR A;  1D1A A;  1XCB A;  1V55 H;  3KLO A;  3FMS A;  4DGW B;  4BE1 A;  1IN5 A;  4QPO A;  5J8C A;  3WTV C;  3K0L A;  2M0C A;  2VON A;  4WK8 F;  5HLI A;  2M2E A;  2JPC A;  1FYK A;  2CRG A;  1WI9 A;  4FX0 A;  1SVO A;  4M74 A;  3HEF A;  3FZV A;  1FBQ A;  1D5V A;  2XF6 A;  1N75 A;  3GF2 A;  3K7A J;  4MIM A;  3KP6 A;  2CFX A;  2O0Y A;  2HQA A;  1SC7 A;  5ILV A;  1AHD P;  5HDK A;  2XSD C;  3U2R A;  3D1N I;  2G9W A;  3A2K A;  1N78 A;  4IHT A;  2L9V A;  4MTD A;  4GFB A;  3H92 A;  2VBY A;  2B9S A;  4I01 A;  3M9A A;  4RGS A;  5FKL A;  2KIS A;  1SFE A;  3V4G A;  1R4N B;  2ACJ A;  2L7M P;  2FUG 2;  5IT9 Z;  1SFU A;  5D5V B;  1Q1H A;  2E1O A;  2K85 A;  2VLA A;  3ZMV A;  1X1C A;  2HVR A;  4LIU A;  3W2V A;  3MKL A;  1V5G A;  3T8R A;  2P8T A;  3CCV I;  4D7M A;  2QBY B;  2EFO A;  1XN7 A;  2OZU A;  4CCK A;  4YIR X;  3LSR A;  2BGC A;  3S3M A;  1IGN A;  3KPH A;  1LQ1 A;  3GZ6 A;  1HKS A;  1GV5 A;  4BJ5 C;  4OIQ F;  1YYV A;  3OIQ A;  5FKO A;  1OPC A;  4M6V A;  2HGC A;  1RI7 A;  1STZ A;  4UUV A;  1AKH B;  1KU2 A;  1WGX A;  1FYM A;  1ZGJ A;  2IXS A;  1TLH B;  3S2D J;  3H5A A;  3TMO A;  2X51 A;  2W57 A;  1DGR M;  1B8I B;  2K5C A;  1NG7 A;  1VND A;  3KEY A;  4YEJ A;  2YR2 A;  1X3Z B;  2BY0 A;  4B1R A;  1U9O A;  1YG2 A;  5E8I A;  5GPC A;  1ZEL A;  5M5Y J;  4P9U A;  3MVP A;  1ZK8 A;  4FE4 A;  2F5V A;  4L5E A;  2M87 A;  1VQK I;  2PBI A;  2WC2 A;  1V3F A;  4YIF A;  4PFO A;  4XON A;  2XAF A;  4ESB A;  2XDV A;  3IAS 2;  4U0Y A;  2DA2 A;  3IL2 A;  3G73 A;  1X58 A;  1A6Q A;  2Y31 A;  3KET A;  1F43 A;  4JOM A;  5F6F A;  2PJP A;  2BOL A;  5DYM A;  3FXU A;  4DZP A;  1S29 A;  1CQT A;  1FOX A;  1MBG A;  3E3V A;  1HLV A;  3CDL A;  1TWA J;  1U2W A;  3U9G A;  2ADU A;  1HW1 A;  3Q0V A;  1HCR A;  2UV1 A;  1W4M A;  1IV6 A;  1S8N A;  3W6J B;  3COA C;  4XID A;  2DA7 A;  3FDY A;  3E6C C;  2KQR A;  1I3Q J;  1K78 B;  1BC8 C;  1X3U A;  5CVJ A;  3CDH A;  5FD5 A;  1M1E B;  2LYC A;  4PJL A;  4L5I A;  3QRF F;  2RRE A;  4CHU A;  1YS6 A;  2XRN A;  3P9K A;  4MTE A;  2DLL A;  3W6K B;  4LLG F;  1W7P D;  2KMU A;  2FEZ A;  2FBH A;  3HHH A;  4I76 A;  1ZG5 A;  1XMA A;  4CCN A;  3IRQ A;  2O5R A;  2QUF A;  2Z33 A;  1BJA A;  2BYV E;  3FX3 A;  4LIV A;  3ZQG A;  4CZC A;  1YHQ I;  2MAB A;  4A6E A;  2HDW A;  1HW2 A;  4BQA A;  5IPA A;  1YJ9 I;  4PSX A;  4XLE A;  5E8G A;  1IJW C;  3OYN A;  3F3X A;  2R7V A;  3E1S A;  4RGX A;  1IN4 A;  2IAI A;  5TIS C;  1G3T A;  1T38 A;  4EEF G;  1MW7 A;  4MO7 A;  2EV5 A;  3PUB A;  4EMS A;  4E7Z A;  3ZQC A;  3VDX A;  3HM5 A;  2EIK H;  3N4M A;  1XGM A;  5EGO B;  2HOE A;  3NWS A;  3W2A A;  5FRO A;  4G6T B;  4YII A;  2O9L A;  1LFU P;  1HKQ A;  3SHF A;  3KP7 A;  1ZAR A;  1GUU A;  4PJJ A;  2XAU A;  2VKV A;  4ETS A;  2O61 A;  3HRM A;  3KLN A;  3OYD A;  3S1N J;  2NVU B;  4V19 K;  1FT9 A;  4KIT B;  5B5E C;  3FXO A;  2M9H A;  5CLS A;  2Z99 A;  3V8J A;  1HST A;  1K4T A;  3LSJ A;  3LA7 A;  2ICW G;  4XN3 A;  4HAM A;  2E34 A;  1AA7 A;  1GLN A;  2DOE A;  1QO0 D;  4DBQ A;  1JKO C;  5BQT A;  3E7L A;  3TO6 A;  3RI4 A;  3ABL H;  2D45 A;  3IH3 A;  2JZY A;  4LFU A;  1TTY A;  4B3X A;  3LSI A;  4CYD A;  2WAD A;  3OYA A;  3S15 J;  3OSF A;  3G1O A;  3ZQQ A;  4EGZ A;  4HX4 A;  5FFZ A;  3H35 A;  3HRS A;  2IT0 A;  1DGW Y;  2E7X A;  3IRR A;  3JRF A;  4KYW A;  2WAF A;  2NOJ B;  1XGS A;  1BC7 C;  4HX7 A;  4UB8 C;  5E3M A;  2HDC A;  3JTG A;  2CQ7 A;  4PUS A;  2WWY A;  1TT0 A;  2VQL A;  3S32 A;  5KVR A;  1YW7 A;  1G2H A;  3DF8 A;  4PJM A;  2Y9Z A;  2E60 A;  2ZB9 A;  2KZG A;  4FET A;  4KDP A;  4L0Z B;  5HLH A;  1QNT A;  3H3U A;  1XPX A;  3CZ6 A;  3AG2 H;  1BI3 A;  1LFP A;  2CG4 A;  5CKT A;  2NVQ J;  1ON2 A;  2NYX A;  3VB2 A;  3G4S I;  1MNM C;  3BDD A;  2JJ7 A;  1RPW A;  1VQ8 I;  3P9I A;  4MQ9 F;  2JVH A;  3I9V 2;  3UR3 C;  3R4K A;  3ZCO A;  3V7R A;  2CS3 A;  1DUX C;  2FX0 A;  1O4X A;  4HNU A;  2HNH A;  3L2U A;  3DPT A;  1T0F A;  3VOD A;  3OYG A;  2NRA C;  2LMD A;  3CLQ A;  3DLA A;  3HKZ N;  4XOP A;  3JSP A;  1BW5 A;  1MMN A;  2KP6 A;  2XB5 A;  1XGN A;  1SAX A;  1QZY A;  1YW9 A;  3CCJ I;  1JGG A;  3E6D A;  4XRM A;  3A0B C;  4A2U A;  3F23 A;  4YG2 F;  2LF7 A;  1HXD A;  3ZQL A;  4BYY A;  3ZOB A;  1O7F A;  2JQ7 A;  4QTR A;  4NDL A;  4MNU A;  4FX4 A;  2LRE A;  1JKP C;  2VL8 A;  1F1Z A;  3T5X A;  2ETH A;  2DMN A;  1Z6T A;  5LD2 C;  2L7K A;  3IP4 B;  3HPG A;  1IG7 A;  1ON1 A;  4UUS A;  4XLN F;  3KYC B;  5EEA A;  5D5U B;  2JA5 J;  4IHX A;  2M5W A;  3GFI A;  2G7H A;  1R5I D;  3KCC A;  4OIO F;  1RKT A;  3H9G A;  2CW0 F;  1UG2 A;  1FJL A;  4CIC A;  1YIJ I;  1TQM A;  5BOX A;  2NAZ A;  1FIA A;  2Y75 A;  1V54 H;  3GTL J;  4LJZ F;  2DT5 A;  2BY3 A;  3BG6 A;  3JSO A;  1FPQ A;  3HOW J;  2X48 A;  2K9L A;  3CMA I;  2VE8 A;  3KP3 A;  2JT1 A;  3F6V A;  4UB6 C;  3DKW A;  2LFB A;  3HPH A;  2V9P A;  2EIL H;  4EM2 A;  1X1A A;  2X1D A;  2E35 A;  2DBB A;  3W2W A;  4F52 A;  1Y8R B;  1W0T A;  2H27 A;  3LQQ A;  3I4M J;  1UG0 A;  2N8G A;  4ZZL A;  4RB2 C;  4GDF A;  1FYL A;  2LRD A;  4PGG A;  1Z21 A;  1L3L A;  2HPI A;  3SXY A;  2XPW A;  1PUF A;  2VPR A;  2VOP A;  5B66 C;  3I3L A;  2KFD A;  2LKX A;  5EF6 A;  3WTT C;  1UHW A;  1X19 A;  2IA0 A;  4F7Z A;  1R22 A;  2ELJ A;  5LGN A;  1I1G A;  1TW3 A;  2VXZ A;  3NWT A;  4Y15 A;  4Y3O A;  4Z6Y A;  2DAO A;  5FLX Z;  3H5N A;  3ONQ A;  4AVZ A;  2O6G E;  3ML6 A;  4A3K J;  2P7V B;  2G7U A;  4ZTF A;  1FP2 A;  1NK3 P;  5FB2 A;  5FRM A;  3C3W A;  3BR5 A;  5DUK A;  3OYI A;  2A69 F;  2QZ8 A;  1D5Y A;  4A3I J;  3DEW A;  4MEX F;  2QKL B;  5HLT A;  1TBX A;  3MWM A;  5AIP A;  3FKI J;  2DN0 A;  3U21 A;  4ZJZ A;  2EB7 A;  5D5X B;  3AG1 H;  1GHC A;  3VFZ A;  5ICG A;  3F21 A;  3QPL A;  2OF7 A;  2KIF A;  3PSI A;  4EJU A;  2KDO A;  4ASN A;  3SJM A;  4XIC A;  3C2B A;  3K70 D;  4HF1 A;  3CMY A;  1WJF A;  3WE2 A;  3HSE A;  2KJC A;  5GTI C;  5EG0 A;  5KK1 A;  3CDI A;  5JVG F;  3I53 A;  2NVT J;  3S93 A;  3T8T A;  1TNT A;  1HOM A;  2LKS A;  3ZPL A;  3I58 A;  4BAC A;  4HG2 A;  3WGH A;  1SFO J;  1ZRD A;  1D0X A;  2W48 A;  1RRJ A;  3AL0 C;  3BR3 A;  4BY1 J;  1S7O A;  2EQR A;  3GW2 A;  4XSZ F;  3CCL I;  2GZW A;  3RKX A;  3GTG J;  3K1N A;  2KKO A;  5J1U A;  3I5U A;  4X6A J;  2K4J A;  2ECC A;  3TDZ C;  1HW5 A;  5HS7 A;  2OD5 A;  2R92 J;  1U0J A;  3ZQI A;  1NK2 P;  1MZB A;  3IV5 A;  4NNJ A;  2F5C A;  4IQ4 A;  1ETX A;  5IY5 H;  4AUX A;  2C6Y A;  2HWV A;  1OCT C;  4M72 A;  2K9S A;  3SQN A;  3FM5 A;  2V79 A;  1IO2 A;  5ICE A;  2CMP A;  1E3P A;  1QZZ A;  2YX7 A;  2M7A A;  2WA0 A;  4QIW N;  3S3O A;  3F8N A;  3HOV J;  2K3F A;  2EZH A;  2DK8 A;  4RGR A;  2L2O A;  5F1J A;  3KP2 A;  3K2Z A;  4S04 A;  2RKH A;  1S7A A;  1SD4 A;  1W5C C;  3F72 A;  3RKY A;  2X6Y A;  3HXL A;  4A5N A;  1RIO H;  1LB2 A;  2BHZ A;  2QBY A;  2Y0S N;  3A0H C;  3RYR A;  2XUB A;  3EUA A;  3LL7 A;  3U1K A;  1QPI A;  2EBI A;  2L4M A;  2CV1 A;  5GPA A;  4PZJ A;  2R7U A;  2JRT A;  3TBI A;  2ELK A;  2LY1 A;  4XQF A;  1SVM A;  2CQN A;  2M0M A;  4NC8 A;  1MD0 A;  1WJD A;  2OV7 A;  1XSX A;  2EZI A;  3K2A A;  2D1V A;  3GVA A;  3PIO F;  4C3J J;  4X0G A;  3ABT A;  3IAM 2;  1HBX G;  1Y6I A;  4YEL A;  3DTE A;  2WV1 A;  4OOI A;  1O3T A;  4XN0 A;  1ZAO A;  2OTL I;  3M4O J;  4BH9 A;  1WI3 A;  3J80 K;  1K7A A;  2EA4 A;  3DU5 A;  4C3I J;  3K4M A;  4EJO A;  1PVE A;  2AS5 F;  2HZD A;  3O3K A;  4GYI A;  5L3D A;  2KZV A;  5E20 A;  2LDU A;  1W5S A;  4E7H A;  3MCZ A;  2Y0M A;  2VE9 A;  3AG4 H;  3WU2 C;  1OR7 C;  3CC2 I;  1X3W B;  2L9R A;  5FKK A;  2E36 A;  5GAH J;  4BU2 A;  1X2N A;  2O8X A;  2YX4 A;  1ULY A;  4OIN F;  1IC8 A;  4UY8 I;  1QVT A;  4ZDP A;  3TW6 A;  2STT A;  2O3F A;  2IS6 A;  2JMW A;  1PDN C;  1IRX A;  2RC4 A;  2E7W A;  1MNE A;  1GT0 C;  4UUS B;  3FXQ A;  3G6E I;  1Q1V A;  3QYB A;  2DA4 A;  4OWR B;  1YIT I;  1R1T A;  5M3F J;  3UNG C;  4BE0 A;  4EJV A;  3EDP A;  2H8W A;  3ZR8 X;  1SAN A;  2KRF A;  4LLN A;  2DMQ A;  1HF0 A;  3BQZ A;  1U8B A;  3CJR B;  3BPX A;  3H0D A;  3Q0U A;  2I8D A;  3PM1 A;  2M3A A;  2QF7 A;  1B72 A;  2EA2 A;  3ZQH A;  3S2H J;  4CCL A;  2ZJP F;  1JUS A;  2VOO A;  2Q2E A;  3R60 A;  3I0T A;  2ID3 A;  3P9C A;  4GRI A;  3U1D A;  2NNY A;  2LD5 A;  4BEH B;  3JRG A;  2IPQ X;  3CES A;  2V9V A;  1PUF B;  4ZYA A;  3TGN A;  1T2K A;  3V8K A;  1ZYR F;  1FMV A;  5M5X J;  3ROU A;  5LBQ A;  3M8J A;  1YOV B;  3FBN B;  2QQ8 A;  3PUF A;  2QSH X;  1MH3 A;  2X6X A;  1I50 J;  5IYD J;  4H4K C;  3K1M A;  1LDJ A;  2JPB A;  3QU6 A;  2PMZ N;  4XLP F;  2VB6 A;  4E7L A;  2VJJ A;  4XKW A;  2DA6 A;  2M45 A;  4LD5 A;  1HA8 A;  2ZCW A;  4CCM A;  4A3F J;  4AYB N;  3ERE D;  5CQE A;  3S1R J;  1YX3 A;  3DPL C;  5L3G A;  2BVL A;  2KIU A;  4J19 A;  4E7I A;  4QLC U;  1TNS A;  4B44 A;  4Q47 A;  1P4X A;  4BL0 B;  1QHH D;  3JRE A;  1XMK A;  1FY7 A;  2ZO4 A;  4WF2 A;  1XX5 A;  1A6I A;  2DK5 A;  2TDX A;  3B02 A;  3NQO A;  2RV8 A;  3Q3S A;  2B7E A;  3DTI A;  3ECH A;  3M3Y J;  1FP1 D;  1LVK A;  5EG0 B;  4I99 C;  1R1V A;  3NEU A;  3OYK A;  5TJJ A;  2VBX A;  2EFW A;  2RDP A;  1GXQ A;  2CUF A;  3LSH A;  1CGP A;  2DA3 A;  3O8H A;  1T8I A;  3GEZ A;  3HC7 A;  2LP0 A;  1W7P A;  2L02 A;  3PJR A;  5IT9 K;  1E17 A;  2JA2 A;  4JK1 X;  2FQ4 A;  3M7G A;  4MQV A;  3JAM Z;  1VQO I;  4F91 B;  2QYO A;  3HHG A;  2Y48 A;  3CCE I;  2HR3 A;  5CVI A;  3CMM A;  3WTS C;  2QWW A;  3G3Z A;  1Z3Y A;  1WFX A;  4UVB A;  5FD6 A;  2P5K A;  2Q0O A;  3SZP A;  1YI2 I;  1LKX A;  1JHH A;  1JUM A;  4MFE A;  1H88 C;  4B4C A;  1BI1 A;  3J7Y J;  5EDN A;  4B43 A;  4CH7 A;  4XL9 A;  1SD5 A;  2MW8 A;  4KIG A;  4HLY A;  4A0Y A;  2DOA A;  2XRO A;  2CV0 A;  2JWT A;  3OS0 A;  1F5T A;  3J7A Y;  2XGX A;  3BJA A;  3EPZ A;  1Z91 A;  2QKM B;  3JRA A;  5FRN A;  1G59 A;  4XM3 A;  5A2Q Z;  5DCF A;  2O8K A;  1FC3 A;  3TP0 A;  3CO7 C;  3K4L A;  4RA2 A;  2XAH A;  3I59 B;  3IHU A;  1X1B A;  4CXF A;  2X6O A;  2A6T A;  3HRU A;  5DCM A;  3OV8 A;  5HDN A;  5J40 A;  4RB1 A;  5HVQ C;  1W0U A;  1MDM A;  1BBY A;  4FCY A;  4HBL A;  1BR1 A;  3DLL F;  2FXA A;  3GO5 A;  2JA7 J;  1XDU A;  1OJL A;  4HA8 A;  5DD4 A;  2LOO A;  4D5F A;  2NVY J;  3BG9 A;  3C7J A;  2HPM A;  2R93 J;  4V2F A;  2LVS A;  1IDY A;  2XF7 A;  4KN4 X;  4AVP A;  3MZ8 A;  5JLX A;  2WAQ N;  3PNT A;  2HOS A;  2JTV A;  2VKH A;  5K5Q A;  1TWC J;  2I5U A;  4AIK A;  1YS7 A;  2BXZ A;  1TT5 B;  1LUJ B;  4XOT A;  2RNG A;  3WU0 A;  2PLY A;  1XB4 A;  2YSR A;  3F8F A;  2DA1 A;  4IL6 C;  2CH0 A;  2BBY A;  5J1Y A;  2R7W A;  2HVS A;  1X1D A;  5CVR A;  1JTY A;  3GXO A;  2CO5 A;  3Q9V A;  1GDT A;  4BS9 A;  4G8X A;  3VSL A;  4EM1 A;  3I55 I;  2K40 A;  1OCO H;  2JUC A;  2KRH A;  3CCY A;  3IH4 A;  3R0A A;  4AD9 A;  4JYK A;  4NQW A;  5DD8 A;  1YIO A;  1T95 A;  1LE8 B;  1Z05 A;  4U88 A;  3QPS A;  2V1D A;  3SZG A;  2DFE A;  3GTQ J;  4M6X A;  3PO2 J;  1JHF A;  3QOE A;  1QHG A;  3VYS B;  4S05 A;  5F0H A;  2ZSH B;  1PP8 F;  2PEX A;  3H9J A;  4MEY F;  2J5O A;  2ZBK A;  4IEJ A;  3ZRG A;  1BOB A;  1I3A A;  2DTZ A;  4E7K A;  1ZGA A;  3ULQ B;  1HSJ A;  4HV5 A;  1J7K A;  2MLK A;  5H2F C;  2ZFW A;  2F48 A;  4XKC A;  5ERI A;  4PSW A;  5FKN A;  1IRG A;  4L9J A;  3MKY B;  4BJT A;  5IOZ A;  1MJ9 A;  4GCV A;  1ZLJ A;  2VBZ A;  4CCJ A;  2IS2 A;  4BQQ A;  1T6S A;  1H0M A;  4G6Q A;  3A1Y A;  2FNP A;  4XKV A;  2DJN A;  1TP4 A;  2AHQ A;  2LTP A;  4NUB A;  4Y52 J;  4QPQ A;  4Q5S F;  2V6C A;  3E5X A;  3VEP A;  3FF5 A;  4KUM A;  4XLA A;  3L2R A;  4G7H F;  3PSF A;  2KT0 A;  2K4B A;  1EV7 A;  1IXR C;  1KA8 A;  1R5H A;  1B72 B;  2VT3 A;  2Q2E B;  2EIN H;  4JX5 A;  1F4K A;  4M6Y A;  4U7B A;  2W4S A;  4ZYE A;  3TKY A;  2IP2 A;  3CC4 I;  2V26 A;  3TOA A;  3BG3 A;  1JGS A;  3QOP A;  1SMY F;  3HKZ A;  3TED A;  2XAG A;  3K1P A;  4HSR A;  2QQ9 A;  4LLL A;  2JA6 J;  3R61 A;  3WG7 H;  2CQK A;  3X2Q H;  2W24 A;  1LNW A;  3E6B A;  2V1U A;  4F3Q A;  4BQN A;  2OU2 A;  3FHZ A;  3D5S C;  5E3L A;  1H9T A;  3WG9 A;  5LGT A;  5FKM A;  3B6C A;  3LOC A;  3QP5 A;  5J1R A;  3OS1 A;  1XCV A;  2FA5 A;  3NAR A;  2IA1 A;  3DFG A;  1FOW A;  5LRS A;  3KFW X;  2GBY A;  3J7Z I;  5J47 A;  3LFK A;  4A3E J;  1PYV A;  5JI6 A;  2B63 J;  2VQC A;  1N77 A;  2HQ5 A;  3MMY B;  5EEG A;  4HQM A;  5BPI A;  4BBR J;  1I6X A;  1ZR2 A;  3SEZ A;  1R1U A;  4OAY A;  4KFC A;  2F5D A;  4XLC A;  2DPD A;  4L5J A;  5J8F A;  2AXT C;  3MFK A;  4NC7 A;  1K61 A;  2IJL A;  3HBL A;  3QPH A;  1T0F C;  2DTR A;  4DYC A;  4M9Z A;  4YFN F;  1TZL A;  1CF7 A;  3S1M J;  1E3O C;  3ZP5 A;  3L1P A;  5GP9 A;  3SDB A;  1FIP A;  4D7N A;  2VUM J;  3L9F A;  4HDU A;  2PG4 A;  2IVM A;  3OR2 C;  2MC4 A;  3DKX A;  4GYG A;  3ABK H;  3EET A;  1W7P B;  1J75 A;  2DJI A;  2E5N A;  2EIM H;  1R23 A;  4EJW A;  5F1R A;  3AFH A;  4LIT A;  1VQN I;  2COB A;  2AO9 A;  2JK3 A;  3JRI A;  2ECB A;  3OOP A;  3MZY A;  3O8G A;  1LPQ A;  3BZC A;  2EZK A;  2MD0 A;  1J09 A;  1Z3X A;  3PFY A;  2X1C A;  3V7S A;  4ZC3 A;  5L3B A;  2JN6 A;  2JSP A;  3LNQ A;  1QBJ A;  1RR8 C;  3AKZ A;  1FSE A;  4DYR A;  2V6E A;  2K86 A;  4U7D A;  4G7Z F;  4IOC F;  3OY9 A;  1QA6 A;  1OCR H;  4M3E A;  3JR9 A;  4UVA A;  3G71 I;  1MSF C;  3HB9 A;  1A36 A;  1UAA A;  1MBJ A;  1ZR4 A;  1MND A;  1TQI A;  3WE3 A;  4XSX F;  4C2M J;  1W36 C;  2D5V A;  1JKQ C;  1I5Z A;  4AWX B;  5KNL A;  4UUT A;  5DCM B;  5ICC A;  1ETV A;  1MDM B;  2O7O A;  3RJP A;  4IJA A;  2QM3 A;  2IGO A;  5HNF A;  1SMT A;  3J81 Z;  2OA4 A;  1E3H A;  3EYY A;  2RN7 A;  5LHG A;  5B1A H;  4FIS A;  1Z67 A;  1IDZ A;  3BWG A;  3ZMS A;  1VQM I;  3Q0W A;  1O3R A;  4DZJ A;  2DYS H;  2UXN A;  4G6D A;  2VKD A;  3BT9 A;  3GFM A;  1TC3 C;  2DO7 A;  2FNA A;  4A93 J;  5E1X A;  1ETQ A;  2HVQ A;  3AAF A;  2HOT A;  2IW5 A;  4G7O F;  1H8A C;  4CGZ A;  3GZN B;  2CV2 A;  2QQA A;  1GVJ A;  4RAF A;  5FGM A;  5FLX K;  4HOB A;  1XC5 A;  2D2W A;  4LMY A;  1N25 A;  3S3N A;  3I71 A;  4E7J A;  3M07 A;  1XS9 A;  3FXK A;  3LA3 A;  3E5Q A;  3OYB A;  3F0C A;  3BP8 A;  2V1X A;  3LSM A;  2W00 A;  3BR6 A;  4M3G A;  4MFD A;  4NQW B;  4DIQ A;  3WTX C;  1YLF A;  3QP6 A;  3FMQ A;  3WTU C;  2BW3 A;  1FSH A;  4N0B A;  1S72 I;  4RB0 A;  4O5V A;  2E2I J;  1R6R A;  3GTM J;  3FXL A;  4GXO A;  4ZTJ A;  2L9N A;  3K4N A;  4BEH A;  4PJ0 C;  1MGT A;  2WBM A;  3H3Z A;  1MBH A;  2XGE A;  3C2H A;  4X1E A;  2Y0S A;  3K4C A;  4C30 A;  2XPV A;  3ZMD A;  3S14 J;  2G0E A;  5AON A;  2IGK A;  4XR6 A;  1XSD A;  1X1P A;  2KHM A;  3GTK J;  3JRD A;  4A3L J;  2R7Q A;  2CUJ A;  1BIA A;  1S7E A;  2V7F A;  2A05 A;  2ZC2 A;  4IO9 F;  3A4C A;  1LDK B;  2ZSI B;  3DTK A;  4WXD A;  4AID A;  2XHK A;  4WCG A;  2F5F A;  3GTO J;  4MHG A;  1ZGW A;  2K9Q A;  1G3Y A;  3JTH A;  3CJQ B;  2BV6 A;  4DNC A;  2HEO A;  3TO9 A;  1B9M A;  4D9J A;  3L00 A;  4XMY A;  1VQP I;  2Z9O A;  3OWT A;  4DW6 A;  3L2W A;  1P7I A;  2CSO A;  4YFX F;  1K79 A;  3OIO A;  1JT6 A;  2FBI A;  2VN2 A;  3HOZ J;  1S3J A;  1JUP A;  2DFF A;  1WSU A;  2CGP A;  2NOG A;  3CJT B;  2CUE A;  3TOB A;  3BJ6 A;  3JRC A;  2EZL A;  4OMY A;  1ZHF A;  4OMZ A;  4Q4Z F;  4HRI A;  2ZXI A;  4G12 A;  5DDG A;  3S1Q J;  2MGQ A;  1OYI A;  4GO1 A;  1EH6 A;  3BJO A;  1R49 A;  3VSK A;  2PMU A;  3KX2 A;  5CPR B;  5LEJ A;  5IP7 J;  3FK7 A;  4RAY A;  4B48 A;  4RDU A;  5BPD A;  3CUQ A;  4FTH A;  4M73 A;  4BAY A;  1T33 A;  4E7S A;  3M8E A;  4JX4 A;  5ED4 A;  3GTJ J;  2P0W A;  1B4A A;  4BGD A;  1JJ8 C;  2R7X A;  2DMP A;  2MG4 A;  4L9N A;  2KIQ A;  1RKW A;  1I27 A;  3CCU I;  3WHB A;  2DT7 B;  3GZ5 A;  4A3G J;  2DOD A;  2XGC A;  4BBS J;  4JQF A;  3RQ4 A;  3CLO A;  3FBI B;  1U8R A;  2FD5 A;  3PFI A;  1KU7 A;  4II2 A;  3OMY A;  3BTC A;  1U5T B;  3F22 A;  3BTL A;  1EJ9 A;  2X1E A;  3F8M A;  3I4P A;  2P6S A;  1A35 A;  1VTN C;  1TWH J;  4G9Y A;  3ZMZ A;  3C1D A;  4KJZ A;  1K83 J;  4H0E A;  2XAQ A;  1KGS A;  2ID6 A;  3DBL B;  4PDK A;  2OQR A;  2DDA A;  3P5J A;  1CF7 B;  2XSJ C;  4ABZ A;  2Q1Z B;  2Z3Y A;  2P5L C;  1VF9 A;  1RUO A;  4D5C A;  3I59 A;  4RLQ A;  4LK1 F;  2PQ8 A;  3HTU A;  3N05 A;  4II3 A;  5D6E A;  1ZTR A;  1IXS B;  2ZME A;  1FTZ A;  2E71 A;  4UV9 A;  4CZZ A;  4F93 B;  3HL2 A;  1YX5 A;  4CYC B;  3RZO J;  1XG1 A;  1XTA A;  2YS9 A;  1P92 A;  2A6E F;  3DKY A;  4XNF A;  4Y4R A;  3ZGK A;  1OLT A;  4BHP A;  3GME A;  3KEO A;  2K7L A;  2IS1 A;  1TWG J;  2VKE A;  1WVR A;  1QZE A;  1YFH A;  1JI8 A;  3DP7 A;  2GA2 A;  4XOR A;  3TDU C;  1T56 A;  2PMZ A;  5ICF A;  1BM9 A;  5ILU A;  2ZNY A;  4HW0 A;  3BTI A;  4Y33 A;  3LWF A;  3W3C A;  4C3H J;  2DYR H;  1YJW I;  4AYB A;  5J6X A;  2R7R A;  4HX8 A;  1A5J A;  1YTY A;  1EKE A;  1IUF A;  3LFU A;  4HNV A;  5FLM J;  2DCE A;  4D0P A;  1BR2 A;  1TWF J;  4I0B A;  1VQ7 I;  5E17 F;  4XK4 A;  4W97 A;  3HOX J;  3BZK A;  5H6R A;  3DPU A;  4YFK F;  4F92 B;  3KP5 A;  2VBW A;  3REO A;  4AC0 A;  1KU3 A;  1WCM J;  2X85 A;  2I10 A;  1KQ9 A;  4ENK A;  2R5Z B;  4ZYH A;  3H36 A;  3PQJ A;  1LE8 A;  2FSW A;  5K5O A;  4N4O B;  2E1N A;  4ENJ A;  4A0X A;  4A5M A;  1KON A;  3L7W A;  2VC1 A;  5DTD A;  1R71 A;  2DU9 A;  2ZJQ F;  1LEB A;  3FIS A;  2ISY A;  2CUZ A;  2KRC A;  3OL4 A;  2ZXH A;  5D8K B;  2IRF G;  1QU3 A;  3PL8 A;  3PO3 J;  2FMY A;  1IN7 A;  3IKT A;  5IT3 A;  5F08 A;  2COM A;  5D4R A;  4U0V A;  1JXS A;  2DPU A;  2M1B A;  1XDS A;  2M30 A;  2TCT A;  4LB5 A;  4J01 A;  4PFP A;  3LAP A;  5EZH A;  1ZN2 A;  3QYE A;  2RAE A;  3GFL A;  3R6S A;  1ZRE A;  1YO5 C;  5E1W A;  5BNG A;  3LAJ A;  2Z5U A;  3WTY C;  5LFA A;  3K4B A;  3HOU J;  2ZNZ A;  2VJI A;  2MA3 A;  4BDZ A;  1T39 A;  5F04 A;  2XAS A;  5HOD A;  2OTJ I;  3RKQ A;  3DQV C;  5L3F A;  3LMM A;  3M1E A;  2HQR A;  1NH3 A;  1G4D A;  2AXL A;  4E6K G;  5DM7 F;  1IRZ A;  4NBQ A;  2BY1 A;  1UST A;  2BW3 B;  3ESW B;  1V5F A;  3CD6 I;  3S8P A;  3GLL A;  1Y39 A;  1FEX A;  5CJ9 A;  3SFI A;  2P5V A;  3HTS B;  4CA0 A;  4K2E A;  2JVG A;  4C9Y A;  3LSK A;  1KZH A;  4OU0 A;  2QA4 I;  3WHC A;  1MMG A;  1X2M A;  4PJN A;  4Y17 A;  4BHB A;  3O2P E;  3OYC A;  4NB5 A;  2R0Q C;  3CJN A;  4CCO A;  3GFJ A;  3TQN A;  3JRB A;  4N9I A;  2WAQ A;  4KIB A;  1I1S A;  1BL0 A;  1C0W A;  3B6A A;  5LGU A;  5CVV A;  3ZN1 A;  3OS2 A;  1RR7 A;  3IWF A;  5C3E J;  2GAU A;  1YRN B;  3HGG A;  2CWE A;  1TQP A;  2VJ5 A;  4ESF A;  3JAM K;  4IOA F;  2FU4 A;  5JHU A;  1LDD A;  3DEU A;  1KU9 A;  5GAE J;  1DU6 A;  1UB9 A;  5H20 A;  1LFB A;  2PN6 A;  2M34 A;  5GAD J;  2CQQ A;  2H94 A;  2Y2Z A;  2ZKZ A;  5FFX A;  5L3C A;  1UHM A;  3CF2 A;  3GWZ A;  1OYY A;  2J5P A;  1EH8 A;  2DMU A;  1VZ0 A;  3DBR B;  3LST A;  5HDG A;  1KQ8 A;  1WJA A;  3P7N A;  1Y1V J;  3E0J B;  3RPU D;  4E70 A;  2GWR A;  5A2Q K;  2WY8 Q;  2X0L A;  2FML A;  2L54 A;  3K6G A;  4FE7 A;  2STW A;  3GTP J;  1Z77 A;  4HPQ A;  5H6Q A;  1U9N A;  3B73 A;  3DU6 A;  1WJE A;  1TW2 A;  3CUQ B;  2KJB A;  2DFI A;  2QVO A;  1G3S A;  4JX6 A;  1HDP A;  1FBS A;  4C2U A;  3QYF A;  3T0Y A;  2XC7 A;  3I56 I;  1OCP A;  3HOY J;  2DXI A;  2WTE A;  2E1C A;  2VPL A;  2UWM A;  3S2W A;  3BY6 A;  2TRT A;  2KDZ A;  5FO5 A;  1QGP A;  2NXN B;  2OPT A;  2LKP A;  4DJA A;  4A3J J;  3OSG A;  3HUG B;  4IHY A;  4CUG A;  5HNH A;  1HC8 A;  4OIR F;  1B1B A;  1ONV A;  2EJR A;  3CCR I;  3BR1 A;  1P7J A;  2V1N A;  1MIJ A;  3BPV A;  4P5O A;  3BTJ A;  1P4A A;  5ILS A;  2L3D A;  2EIJ H;  5C44 J;  4FAS D;  1FWZ A;  1HQC A;  3RZD J;  1EF4 A;  1JKR C;  2HTS A;  2HKO A;  3E5U A;  2M7B A;  1JJ6 C;  2W1O A;  2ZME B;  4XBF A;  2E5Z A;  1EA3 A;  1VQL I;  5FJ8 J;  4ZDO A;  1BN5 A;  5GAG J;  4L18 B;  4I09 A;  2IGM A;  4R8H A;  3WGG A;  4I6Z A;  4XLF A;  1P9Q C;  1A04 A;  2MFZ A;  4D1Q A;  2F4I A;  1T08 B;  4BXU A;  2CU7 A;  5HLG A;  4HEA 2;  4IKF A;  5GTH C;  1RNL A;  2HTJ A;  3BR2 A;  2HYG D;  1MMD A;  3WGI A;  4XRS A;  3EUH C;  4P55 A;  3HIF A;  4U87 A;  2HYJ A;  4FT8 A;  3DXJ F;  4PGH A;  3L2V A;  1MBE A;  5B1B H;  2OQG A;  1RUN A;  1J2X A;  4PCQ A;  2OC6 A;  3BRO A;  3RIR A;  3FKJ A;  1UEL B;  1WPK A;  3A01 A;  4QWQ A;  1RZ4 A;  2R4G A;  5F0C A;  1S5L C;  3AL0 B;  1P6R A;  1WJC A;  1BI2 A;  3CCM I;  1GXP A;  2XIG A;  1F36 A;  2WB1 N;  5IP6 A;  2FOW A;  1YE9 A;  3MEX A;  3IC7 A;  3HOT A;  1VQ5 I;  2NS7 A;  3C18 A;  2Q8K A;  4N4N B;  2XAJ A;  4ZYD A;  1U6G A;  4M9X A;  2O03 A;  1S9H A;  1AWC A;  1UHS A;  2FOK A;  3TP3 A;  1FTT A;  1FOY A;  5EJC A;  1E0E A;  2K9M A;  5CVU A;  2Z2S B;  3M1C A;  3OYM A;  3BC8 A;  1ETO A;  5DEQ A;  4GGG A;  1U3E M;  5IP9 J;  3KYL A;  2F4M B;  4HV6 A;  1P4W A;  3ZN0 A;  1ZRF A;  2W84 A;  1J5Y A;  1Y0N A;  2ME6 A;  3ZXS A;  2NVX J;  4KMF A;  1R00 A;  3EUH A;  3OYF A;  2VT2 A;  1U5T C;  2HI3 A;  2IEK A;  4RB3 C;  5TRD A;  1UFM A;  3K69 A;  3OL3 A;  3VWB A;  2M8E A;  5E79 C;  3D5R C;  3VYT B;  3S17 J;  2QSG X;  1Y8Q B;  1O57 A;  4KNY A;  2MH9 A;  1K4S A;  3A03 A;  2ELH A;  2XV4 S;  4HLX A;  3RQI A;  4A69 C;  2ISZ A;  1MH4 A;  4HZF A;  5LRR A;  1VFC A;  4WXC A;  3HZJ A;  5HS9 A;  2EV6 A;  3LQR A;  2Z16 A;  4NHJ A;  2A5W A;  1S6L A;  4C2T A;  5JFR A;  6PAX A;  4KIS A;  2OZ6 A;  3HG9 A;  4EVI A;  1YQA A;  3NRV A;  2LR8 A;  5E3O A;  4IX7 A;  3HSR A;  2R7Z J;  4ESJ A;  3CP8 A;  2RQP A;  2GIV A;  3KIO A;  1J0R A;  3CO6 C;  1B9N A;  1Z6R A;  4IXA A;  2FQ3 A;  1B59 A;  1J9I A;  2A5Y B;  3K70 C;  2WAE A;  2HYF A;  3FIW A;  2UUZ A;  2D1H A;  1WH7 A;  5KAI C;  2MD5 A;  1VQ9 I;  3D5L A;  5DUI A;  2FE3 A;  1WZ2 A;  1Z1D A;  3FM3 A;  3E97 A;  2KPM A;  5D6F A;  4I98 B;  2VQG A;  5E1Z B;  4EJT A;  2BY2 A;  3TO7 A;  3JCU C;  2BHY A;  2DQR A;  2QQB A;  3ISP A;  2X6W A;  2HS5 A;  1WJB A;  3KP4 A;  3EQL F;  3FXR A;  4BJ6 C;  1BA5 A;  4B8X A;  3BG5 A;  1IZ1 A;  2VXD A;  3WTW C;  5EYR A;  1U5T A;  4U0W A;  4V2G A;  2H09 A;  2DQL A;  3G1L A;  5DS9 A;  1IF1 A;  1YW8 A;  4CSW A;  1SEU A;  1SVL A;  4AIH A;  3EUK L;  2V9K A;  4I2O A;  3F8C A;  2XPU A;  5EEH A;  3JRH A;  2X9D A;  3E6M A;  2ZXJ A;  2R7S A;  1NG6 A;  2NS0 A;  4IPA A;  5F64 A;  2OJE D;  2LBF B;  3IKV A;  2E1M B;  1IN8 A;  3G1M A;  3QAH A;  1PJR A;  1BIB A;  1OKR A;  1OMI A;  2R7F A;  4JBA A;  3QWL A;  4ITV A;  1VI0 A;  3BR0 A;  4CYC A;  1O3S A;  5HS8 A;  1QVU A;  1IN6 A;  3HGY A;  3K4J A;  1R58 A;  2F5E A;  1ACI A;  4IHW A;  2KL4 A;  2L0K A;  3J81 K;  1ZQ3 P;  1BW6 A;  2QSF X;  2YPR A;  2Y30 A;  3GUD A;  1DPU A;  2DOF A;  4UXN A;  2MC3 A;  2V4J C;  2P7C B;  4CDG A;  4W1U A;  3UKG A;  2EFN A;  1YJN I;  4XLH A;  3OOU A;  2LSO A;  5KAF C;  2YU3 A;  3HOS A;  2R5Y A;  3F6O A;  4HST A;  1ZH5 A;  3ZMU A;  4AM3 A;  3WOD F;  2A07 F;  5JLW A;  3D0S A;  4DYQ A;  1R5G A;  2OBP A;  3FK6 A;  4R1H A;  4UVC A;  4IQJ A;  4M3F A;  3CP2 A;  4F55 A;  2HXO A;  4PK4 A;  1MMS A;  1R4M B;  5LHI A;  3FMR A;  3VYU B;  2R5Z A;  4AIJ A;  4IF4 A;  2QEX I;  1D1B A;  1Y1W J;  4ENM A;  3BQY A;  2LG4 A;  1I6H J;  1UMQ A;  1HKT A;  1RES A;  3MN2 A;  4IHS A;  3S16 J;  3K9T A;  2DI3 A;  1RET A;  2RVC A;  3PNY A;  1QQI A;  1GVD A;  2GXB A;  4A3B J;  3GCM A;  2CQX A;  4G94 A;  3WTZ A;  3CC7 I;  2LK2 A;  3H5R A;  3OIP A;  2MYS A;  5JR3 A;  1O3Q A;  2OCE A;  2H8R A;  3CQZ J;  3CCQ I;  4TV7 A;  1GV2 A;  3R0J A;  3V8L A;  2NNN A;  1R9T J;  3L09 A;  2FJ1 A;  3PNV A;  3K4K A;  2RNJ A;  4LG0 A;  2PJR A;  1BI0 A;  3KZI C;  4JP0 A;  1SFX A;  2MBF A;  1UJ8 A;  4ZZD A;  2GOX B;  4BE2 A;  3RKW A;  9ANT A;  4EM0 B;  1L0O C;  4ENN A;  2OAZ A;  4M3B A;  4OAZ A;  1K6O A;  2DW4 A;  2DMT A;  2HFH A;  1WWX A;  1DP3 A;  3HSF A;  3A01 B;  2A6H F;  3V42 A;  2M8G X;  1WKM A;  4P1W A;  4RLF A;  4B47 A;  4CO8 A;  1VQ6 I;  3A02 A;  5JHF A;  3SYT A;  2DFH A;  2PMH A;  1ITY A;  3LSG A;  2KIM A;  1G8X A;  1P2F A;  1ZKG A;  3RTR A;  1OQY A;  4HNT A;  3RSN A;  1D8K A;  2VI6 A;  4MGR A;  5K7Z A;  2LNB A;  2HDD A;  2EH3 A;  3ABM H;  3Q5F A;  1DPR A;  1H9G A;  1MKM A;  4WXH A;  4DOZ A;  3IH2 A;  4Y7N J;  1DP7 P;  2L01 A;  2EWN A;  3W6V A;  5K5R A;  1OYW A;  4HQE A;  3CUQ C;  2OUM A;  4ZH4 F;  1DDN A;  4BKX A;  4Z2Y A;  2F6C A;  5F0F A;  1R7J A;  4BXF A;  1XD7 A;  3AG3 H;  1D8J A;  1WH5 A;  5LEK A;  3DEE A; 
#chains in the Genus database with same CATH homology
 5EDN A;  5EGO B;  2R5Z B;  2MW8 A;  1LE8 A;  2O9L A;  2JWT A;  1LFU P;  1GUU A;  2VKV A;  5DTD A;  3JRA A;  1YRN A;  3FIS A;  2O8K A;  3TP0 A;  3S1N J;  2DA5 A;  3PO3 J;  2M9H A;  2X6O A;  4A3M J;  5F08 A;  1W0U A;  2TCT A;  3LSJ A;  4FCY A;  2XRL A;  1NTC A;  5EZH A;  2RAE A;  3H0G J;  1APL C;  2JA7 J;  1JKO C;  1OJL A;  3E7L A;  4RBO A;  5BNG A;  4D5F A;  2NVY J;  3BG9 A;  3IH3 A;  2R93 J;  4V2F A;  5IYB J;  2LVS A;  3HOU J;  1IDY A;  1ETW A;  5JLX A;  5F04 A;  2WAQ N;  5HOD A;  3RKQ A;  3S15 J;  3OSF A;  3G1O A;  4XRS G;  2HOS A;  1TWC J;  1IRZ A;  4LOC A;  3JRF A;  3HDD A;  3I4N J;  2DA1 A;  5J1Y A;  5E3M A;  2GM4 A;  5M5W J;  1JTY A;  1ENH A;  1FEX A;  3SFI A;  1HDD C;  1GDT A;  1G2H A;  2Y9Z A;  2ZB9 A;  2K40 A;  3WHC A;  3CCY A;  3IH4 A;  1X2M A;  4JYK A;  2R0Q C;  5FLV A;  3H3V K;  5EZG A;  1LE8 B;  2NVQ J;  3JRB A;  3QPS A;  5M3M J;  1MNM C;  1BL0 A;  3GTQ J;  3PO2 J;  2JJ7 A;  1RPW A;  3B6A A;  1RR7 A;  5F0H A;  5C3E J;  1YRN B;  3HGG A;  4IEJ A;  2DTZ A;  2K9N A;  2FX0 A;  1DU6 A;  1O4X A;  1LFB A;  2CJJ A;  1JT0 A;  1MBF A;  2M34 A;  2CQQ A;  3DCF A;  2Y2Z A;  5FKN A;  3HKZ N;  2YUS A;  5IOZ A;  1BW5 A;  2XB5 A;  1JGG A;  5IOY A;  4XRM A;  2DMU A;  5J3L A;  2DJN A;  2E19 A;  2L7F P;  4BXX J;  3ZQL A;  1Y1V J;  2AHQ A;  3ZOB A;  2LTP A;  4QTR A;  4Y52 J;  4NDL A;  2XGD A;  2GLO A;  1JKP C;  2KT0 A;  2DMN A;  4FE7 A;  2IBD A;  2ME0 A;  1B72 B;  2E2J J;  3GTP J;  1Z77 A;  1U9N A;  1IG7 A;  4UUS A;  2R5Y B;  5EEA A;  2JA5 J;  4JX5 A;  4IHX A;  4JX6 A;  1RKT A;  4BY7 J;  1HDP A;  3HOY J;  1UG2 A;  1FJL A;  1OCP A;  3BG3 A;  1FIA A;  3GTL J;  3TED A;  3NAU A;  1H88 C;  2KDZ A;  2TRT A;  2YU9 J;  3HOW J;  2OPT A;  2X48 A;  2JA6 J;  4A3J J;  3OSG A;  4IHY A;  1JTX A;  1POG A;  2LFB A;  1Z0X A;  5C4J J;  1AKH A;  3BR1 A;  1P7J A;  5E3L A;  3BTJ A;  1W0T A;  5F27 A;  4IHV A;  4S0H B;  5FKM A;  3B6C A;  3LOC A;  4B3A A;  5J1R A;  3I4M J;  1B8I A;  2N8G A;  3NAR A;  5C44 J;  2Y9Y A;  4A3C J;  1ETY A;  2XPW A;  1BJZ A;  2GBY A;  1PUF A;  2MSY A;  3RZD J;  2VPR A;  4A3E J;  1EF4 A;  1JKR C;  2LKX A;  2NS8 A;  2B63 J;  5EF6 A;  2HQ5 A;  4M3D A;  4BBR J;  1JJ6 C;  1ZR2 A;  5FJ8 J;  4A3K J;  4I6Z A;  1NK3 P;  1K61 A;  3HBL A;  3BR5 A;  4DYC A;  2CU7 A;  3S1M J;  1D5Y A;  4A3I J;  3DEW A;  1E3O C;  3BR2 A;  3L1P A;  5GP9 A;  3FKI J;  4XRS A;  2DN0 A;  1FIP A;  4D7N A;  2VUM J;  2HYJ A;  3QPL A;  1MBE A;  2OF7 A;  2COB A;  2AO9 A;  2JK3 A;  3JRI A;  2XB0 X;  3SJM A;  2ECB A;  3ZQF A;  2L7Z A;  4XIC A;  1WPK A;  3A01 A;  3GBG A;  3C2B A;  3O8G A;  3CMY A;  2EZK A;  5EG0 A;  5F0C A;  2H1K A;  2NVT J;  1AU7 A;  2JN6 A;  3LNQ A;  1F36 A;  2WB1 N;  5IP6 A;  1HOM A;  1OFC X;  2LLK A;  4DYR A;  1SFO J;  2W48 A;  2NS7 A;  2JA8 J;  3SDG A;  1ORK A;  3BR3 A;  4BY1 J;  2EQR A;  3GTG J;  3QQA A;  5J1U A;  4M3E A;  3JR9 A;  1MSF C;  3HB9 A;  1UHS A;  3TP3 A;  4MLO A;  1FTT A;  4X6A J;  1MBJ A;  1ZR4 A;  2ECC A;  4C2M J;  1H89 C;  1MSE C;  1ETO A;  5IYC J;  2D5V A;  1JKQ C;  2R92 J;  4UUT A;  3ZQI A;  1NK2 P;  1ETV A;  5IP9 J;  5K7F A;  3IV5 A;  2O7O A;  1ETX A;  5EGO A;  1ETK A;  4AUX A;  1OCT C;  2K9S A;  2ME6 A;  4FIS A;  2NVX J;  1IDZ A;  2HI3 A;  2IEK A;  3Q0W A;  4DZJ A;  4QIW N;  5K7H A;  3HOV J;  1DU0 A;  2QCO A;  3BT9 A;  2EZH A;  2E2H J;  1TC3 C;  3LSP A;  3S17 J;  4A93 J;  5F1J A;  1ETQ A;  2HOT A;  3A03 A;  1U78 A;  3RQI A;  1H8A C;  4A3D J;  4A69 C;  1QRY A;  1MH4 A;  5C4X J;  1VFC A;  3TW7 A;  2Y0S N;  1QPI A;  2P81 A;  1XC5 A;  2EBI A;  5GPA A;  2ELK A;  2LR8 A;  2HXI A;  5E3O A;  1XS9 A;  4QSH A;  2R7Z J;  3F0C A;  2HOA A;  2EZI A;  3K2A A;  5E3N A;  3BR6 A;  4M3G A;  4MFD A;  1MBK A;  3VPR A;  4C3J J;  3FIW A;  1WH7 A;  2WV1 A;  2E2I J;  3M4O J;  3GTM J;  1WI3 A;  2M0C A;  4C3I J;  2M2E A;  1MBH A;  2XGE A;  2CRG A;  4X1E A;  2XPV A;  3S14 J;  2G0E A;  3GTK J;  3JRD A;  3HEF A;  4A3L J;  1BA5 A;  3BG5 A;  1S7E A;  3K7A J;  4MIM A;  5EYR A;  4V2G A;  2L9R A;  5FKK A;  1AHD P;  2XSD C;  3G1L A;  5DS9 A;  3D1N I;  1X2N A;  3GTO J;  1IC8 A;  1ZGW A;  2K9Q A;  1QVT A;  4GFB A;  2XPU A;  3TW6 A;  3JRH A;  2X9D A;  5FKL A;  2JMW A;  2L7M P;  4DW6 A;  1P7I A;  2E1O A;  3OIO A;  3G1M A;  1JT6 A;  1GT0 C;  3MKL A;  4UUS B;  3HOZ J;  1JUP A;  1VI0 A;  3BR0 A;  4D7M A;  1Q1V A;  4CYC A;  2NOG A;  2DA4 A;  1QVU A;  2CUE A;  3HGY A;  5M3F J;  3JRC A;  4IHW A;  3LSR A;  2EZL A;  2L0K A;  1ZQ3 P;  1BW6 A;  1SAN A;  1IGN A;  2Y30 A;  1GV5 A;  2DMQ A;  4G12 A;  1HF0 A;  3BQZ A;  3S1Q J;  1U8B A;  5FKO A;  4M6V A;  2MGQ A;  3Q0U A;  4W1U A;  3UKG A;  3PM1 A;  1AKH B;  2QF7 A;  1B72 A;  3OOU A;  1WGX A;  3ZQH A;  3S2H J;  1JUS A;  3S2D J;  5IP7 J;  2R5Y A;  3FK7 A;  2ID3 A;  4RDU A;  4FTH A;  1B8I B;  1T33 A;  2LD5 A;  1VND A;  5JLW A;  4JX4 A;  4DYQ A;  3GTJ J;  3JRG A;  3FK6 A;  1JJ8 C;  4B1R A;  2DMP A;  1U9O A;  2MG4 A;  1PUF B;  1RKW A;  5GPC A;  5M5Y J;  3WHB A;  4A3G J;  3MVP A;  1ZK8 A;  4FE4 A;  4L5E A;  4M3F A;  2XGC A;  5M5X J;  4BBS J;  2HXO A;  2FD5 A;  2DA2 A;  2R5Z A;  3BTC A;  1MH3 A;  1I50 J;  5IYD J;  1Y1W J;  1X58 A;  3BTL A;  1F43 A;  2Y31 A;  3BQY A;  1I6H J;  1UMQ A;  1RES A;  1TWH J;  2PMZ N;  3MN2 A;  3S16 J;  1K83 J;  1RET A;  2ID6 A;  4DZP A;  1GVD A;  1CQT A;  4ABZ A;  4A3B J;  2DA6 A;  1MBG A;  2CQX A;  2LK2 A;  1VF9 A;  1HLV A;  4D5C A;  2H8R A;  4A3F J;  3CDL A;  1TWA J;  4AYB N;  3CQZ J;  3S1R J;  1HCR A;  3Q0V A;  1ZTR A;  1GV2 A;  4J19 A;  1R9T J;  1IV6 A;  1FTZ A;  2FJ1 A;  4XID A;  2DA7 A;  3JRE A;  4JP0 A;  1I3Q J;  4CYC B;  3RZO J;  1XG1 A;  9ANT A;  4M3B A;  2YS9 A;  1A6I A;  2DMT A;  3A01 B;  3Q3S A;  2M8G X;  3M3Y J;  5EG0 B;  3A02 A;  1TWG J;  2VKE A;  1ITY A;  2CUF A;  3LSG A;  1T56 A;  4I76 A;  2DA3 A;  1ZKG A;  3O8H A;  2LP0 A;  2VI6 A;  3BTI A;  3ZQG A;  5K7Z A;  2HDD A;  4C3H J;  2EH3 A;  2FQ4 A;  5IPA A;  4Y7N J;  3IH2 A;  1A5J A;  3W6V A;  1IJW C;  1IUF A;  4HNV A;  5FLM J;  1TWF J;  2IAI A;  4BKX A;  4XK4 A;  4W97 A;  5F0F A;  4EEF G;  3HOX J;  4MO7 A;  3ZQC A;  1WH5 A;  4AC0 A;  3HM5 A;  1JUM A;  1WCM J;  4MFE A;  2I10 A;  4B4C A;  2LY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...