4PCQA

Crystal structure of mtbaldr (rv2779c)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
ELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MtbAldR
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Possible transcriptional regulatory protein (Probably Lrp/As
total genus 31
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pcqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pcqA02
1D8KA 3PFIA 1HKQA 1CGPA 4P96A 2KIUA 2MH2A 1B6AA 4P55A 4RAZA 5HS9A 3RI4A 4G7ZF 5ICCA 2E7WA 2HWVA 2Z33A 2V9VA 5EEGA 4CXFA 3RPUA 3FM5A 1T38A 5DUKA 1HW5A 3RKWA 2W85A 4A6EA 1K79A 2DPUA 1QBJA 5DD4A 1DUXC 1OYYA 3NEUA 2QYOA 1B9NA 5D5WB 5L3CA 5L3BA 4I02A 1KA8A 5DV5A 5H6RA 2KJBA 1KGSA 2A6HF 1UHMA 4R1HA 3FXUA 3WTUC 4YIFA 1R1TA 4BNCA 1FPQA 1HW1A 4RGXA 4IPAA 1Z05A 1HBXG 2Z9OA 4LG0B 2O0YA 1KU2A 3RYRA 1P4XA 3N4MA 1LEAA 1P6RA 3N97A 3FMRA 4I98B 3K69A 5D5VB 1O3QA 5J6XA 1H9TA 2UZKA 3VEPA 1BJAA 2JPBA 1BC8C 2GXGA 1KQ8A 5KVRA 2QM3A 4ZZDA 3MAJA 1IZ1A 4BAYA 2OU2A 1J5YA 3K9TA 3GFMA 3NQOA 1XB4A 1IN6A 3L09A 1W4MA 3SFZA 2EB7A 2XAHA 2A5YB 2E7XA 4MHGA 3GVAA 1XGOA 5F6FA 1OYIA 3MZHA 5IT9K 4U7BA 1MJAA 5CJ9A 2OZ6A 1IN5A 2DJWA 3QP5A 2MD5A 5HS8A 3RIRA 2DQLA 1K78A 4KMUX 1USSA 2W25A 1IXRC 2RNJA 1P4WA 4GYGA 1O3SA 4I0BA 2M5WA 4ZZLA 1XN7A 5LHGA 3TO9A 4ZH4F 2W57A 2Z99A 4NB5A 4U0WA 3BWGA 3HSRA 1EH6A 2G7HA 4HF1A 2VC0A 1JHHA 1HKSA 1R1VA 4HW0A 2KJCA 5ICGA 2HS5A 2W84A 3P9KA 2P7VB 3QOPA 5CYVA 5LGUA 4S04A 2GXBA 2A61A 5K5OA 3BROA 3MEXA 4I0AA 3BOQA 1F1ZA 1OPCA 1LDJA 3W6JB 5FLXZ 4ON0A 4GYIA 4EJVA 1J59A 3R6SA 5E20A 3CO7C 4TV7A 1PP8F 2Z3YA 3V7SA 4YFNF 3GEZA 5HDKA 2O6GE 2PFBA 1UHWA 2O03A 2ZBCA 3K2ZA 1O3RA 1FYLA 4L9JA 1R36A 2FMLA 4A2UA 1FBQA 3ISPA 1U5TB 3HRSA 2F5CA 2K27A 4IHTA 4U0VA 1KU7A 2YU3A 5D5UB 2WC2A 5LEKA 4IHSA 4BHBA 1L0OC 4JBAA 2M8EA 3GYHX 4IRHA 1V4RA 5D5XB 4XRFA 4A5NA 2O3FA 2VE9A 5ILUA 2M45A 1FOKA 2Q0OA 1FT9A 2DI3A 3KCCA 5AIPA 1STZA 4KNYA 5DCFA 2EA4A 6PAXA 5FGMA 1RIOH 4BHCA 5JI6A 5BOXA 2DFIA 4A12A 1VTNC 3ZN0A 1SAXA 1W7PD 2ZFWA 4N9IA 1ZGJA 2K4BA 2KKOA 3J80K 2MH9A 3TDUC 3BY6A 5D4SA 4HLXA 2MLKA 5FLXK 4HDVA 3I4PA 3E3VA 1HSJA 3HRMA 4G7HF 2HQRA 4LD5A 3PQJA 1EH7A 1GHCA 3BJOA 4L9TA 3U9GA 2IW5A 1JXSA 4JQFA 4M73A 3E6CC 2O61A 3KZYA 2QQAA 3FMQA 1XSVA 3D0SA 2H94A 3M8FA 3S2WA 3R61A 2YPRA 1U8RA 1LJ9A 3CDHA 1B9MA 1R1UA 3SHFA 4CICA 3IWZA 2P5LC 3WTTC 2JRTA 5JVTA 4UHTA 4O5VA 3TOAA 4Z2YA 4FT8A 3ZMVA 4IVNA 2JZYA 2R7DA 2G9WA 2P4WA 2YX4A 1XGSA 3W6KB 4S05A 5J8FA 3QU3A 3CUQB 2BV6A 5HLHA 3HSEA 4OIQF 4K2EA 3HOTA 4KFCA 4OIRF 1BI2A 1IN4A 5DYMA 1I27A 5LGTA 2ISZA 1S7AA 2W24A 4LMYA 5FB2A 3WTYC 1ULYA 2HGCA 4BHPA 1FX7A 4HLYA 1R23A 1I6XA 1W5SA 2XKOA 5K5RA 1ZREA 5F1RA 4A6DA 4PGGA 1BI1A 2Y0MA 5AONA 3HUGA 4PDKA 1XGMA 1E2XA 4G8XA 4MQ9F 3AAFA 1E17A 1G3TA 3RKXA 1IN8A 5DCMA 4RB1A 1TTYA 3KLOA 2HDCA 3TDZC 4RB0A 2WTEA 4PGHA 1FWZA 1S29A 2NS0A 1BIAA 4WF2A 4EJTA 4P9FA 1D3YA 2Z5UA 2ZCWA 4MEYF 2NAZA 1KQ9A 4GGGA 3CUOA 1FBUA 2E1CA 1YW7A 3QPHA 3ECOA 2CG4A 3C3WA 3F6VA 2MLGA 5HLGA 3T8RA 2DT5A 2L54A 3H3UA 4CGZA 3WE2A 3GWZA 4HZFA 4GCVA 4EQQA 3ZMTA 5K1YA 1W5TA 1I5ZA 1K6OA 4RS8A 4LG0A 1QPMA 4EJUA 4OOIA 3I71A 4G7OF 2GA2A 3E6DA 4P5OA 4WCGA 3DPLC 3QAHA 4KT5C 3WG9A 1ON1A 4I7HA 2BYVE 4IJAA 1IRGA 2VOOA 1U78A 3KP5A 4KIFA 2LNBA 1MGTA 1PP7U 3TO6A 4BYYA 2FNAA 1YYVA 4L5IA 3Q9SA 3CUQC 4MEXF 2FNPA 4XLNF 3ZPLA 3LWFA 4L5JA 2E1NA 3ZP5A 5ILSA 2RN7A 1D5VA 3E97A 4E70A 1OKRA 4OMZA 4Q5SF 5HLIA 1Z7UA 1RUNA 3BP8A 2D2WA 2Z4PA 3GZ6A 3OV8A 2EV5A 3C18A 2PI0A 4AIHA 2V1DA 3T0YA 2QBYA 4WWCA 4NQWA 4L9NA 2RDPA 3BJAA 1IN7A 5LHIA 3J81Z 1TBXA 3TKYA 4ZYEA 2A3SA 2ZNYA 2XGXA 3RYPA 1BIBA 4WXCA 4AIKA 1GXQA 1ZGAA 3R0AA 4HDUA 1EV7A 3J81K 1ZG3A 3BDDA 3I53A 5LRRA 4G6DA 3F21A 3EYIA 4ENKA 2EK5A 2A68F 4EMSA 3J7AO 2FEZA 3JTHA 2GZWA 4HF2A 5DDGA 5ED4A 2EWNA 4RB3C 2PEXA 1TW3A 5CVVA 3CO6C 1K7AA 3VODA 3ERED 2K4JA 4KIBA 4EM1A 2JPCA 5FO5A 3DFGA 5ICEA 5E18F 2VC1A 3IRQA 1FSEA 1ZLJA 3PQKA 1H9GA 3LQRA 4XSZF 2VT3A 4CZZA 2X0LA 4HV6A 4LK1F 1MD0A 3IKTA 1SD4A 1K78B 2QZ8A 4I09A 1R5HA 1TQMA 4MTEA 1IUYA 2Q2EA 4WXDA 2F5DA 3FXQA 3TOBA 2F5FA 3JSOA 3FHZA 1SD7A 3I64A 4EV0A 1WWXA 4H0EA 3MFKA 2BE5F 3KP6A 2XROA 1FSHA 3V4GA 2MA3A 2P8TA 3O6BB 1XCVA 2ZMEA 2M87A 2P6SA 4Q48A 4EVIA 2FU4A 4IRIA 4HV5A 1MJBA 3R0JA 2O8XA 1OR7A 1P2FA 3E6BA 1FY7A 4MTDA 2FF4A 4Y13A 3FX3A 2Q8KA 2LSOA 2OA4A 4EM0B 1LDKB 3B02A 4JK1X 2DBBA 5DEQA 1MDMB 1CF7B 3L9FA 4EJOA 3V8KA 1YS6A 1QO0D 1DPRA 1Z1DA 3RKYA 3U2RA 3Q9VA 4LLGF 5LEJA 1ZH5A 3WTXC 5TRDA 4UUVA 4Y15A 4FX0A 3JTGA 3JAMK 3O3KA 1U5TA 3KZZA 3M1EA 1YG2A 2OBPA 2EJRA 1HXDA 4LGWA 1ZRCA 2H27A 2IVMA 2XAQA 3T5XA 4LK0F 1WSUA 3WGGA 5BPIA 2G7UA 3G3ZA 3JAMZ 3KEQA 3QU6A 4OIPF 5DUIA 1TLHB 1QZZA 1MKMA 4EM2A 3CTAA 5KK1A 2FBHA 1QQIA 4XSXF 3GO5A 1QGPA 1SMYF 4LB5A 2EFOA 1T2KA 2CO5A 1B59A 1JHFA 1O7FA 2DU9A 1ZRFA 2HTSA 2FMYA 3I54A 1JE8A 1NHAA 2VBXA 3E5XA 2XUBA 5H20A 1FC3A 4L0ZB 4F7ZA 1FBSA 3IRRA 2WV0A 4WXHA 1ONVA 2KRFA 2YSRA 5HDGA 3QPTA 3M9AA 2L4AA 3WTZA 3ZMZA 4CYDA 1IAWA 4FHTA 2FQ3A 4EGYA 1JGSA 4B8XA 1XD7A 3C7JA 3HOSA 2EV6A 2VOPA 2A07F 1F4KA 1LEBA 1TNSA 4GO1A 3V7CA 5ERIA 1XCBA 5A2QK 2CYYA 2FA5A 2D1VA 2GWRA 3EUHA 2DPDA 4ZYGA 4OINF 4HA8A 2E1AA 1KU3A 4UV8A 2DTRA 3D5LA 3VOEA 2YR2A 2PBIA 1F5TA 5E1WA 2ESHA 1U2WA 4PZJA 4I01A 5CVIA 2L02A 1Z91A 2PQ8A 1BC7C 3I58A 2ESNA 1HSTA 3K0LA 4AIJA 4DQ2A 1L3LA 3WTVC 5D8LB 2VBYA 5L3GA 5TJJA 5HDNA 5E1ZB 5JHUA 5A2QZ 1YTYA 1IXSB 3HHHA 2CVIA 2IA0A 4LLLA 2A6EF 2J5PA 5LLQA 5HVQC 3KEOA 5BQTA 1ON2A 5F64A 1OYWA 2ZO4A 4ETSA 1YIOA 4LB6B 3GUDA 2DK8A 1YLFA 1Y0UA 4U0YA 1WI9A 3O2PE 4L18B 2L3DA 2CSOA 5CVUA 2UXNA 4FX4A 3HRTA 1DDNA 4G9YA 1UB9A 2QLZA 4IRGA 3K1NA 1Z6TA 1J2XA 2QBYB 2VE8A 2VT2A 4CO8A 2ADUA 1I1SA 4KA4A 2H6CA 3GFLA 5DD8A 1C0WA 2FSWA 1LNWA 3OOPA 3LA7A 1KYZA 1LQ1A 4LFUA 2VXZA 1P4AA 5BMZA 3F23A 3M8EA 1ZN2A 2QENA 2GIVA 3GZ5A 3ZMDA 1FLIA 3F8BA 1G3WA 1XMKA 3I0TA 4O6JA 2GA1A 3IL2A 1Q1HA 4HYEA 5HS7A 3GFIA 4O3MA 2OAZA 1IW7F 2L4MA 4M72A 3P9IA 3ZN1A 4CDGA 3HHGA 2CGPA 4MQVA 1IXCA 5L3FA 3DP7A 5IT9Z 2NYXA 2DW4A 1ZHFA 1EH8A 4ASNA 1XMAA 1W7PA 3CLOA 5D4RA 2STWA 2RKHA 4GXOA 5H6QA 2HFHA 3DXJF 3G73A 2HYFA 2QVOA 2QWWA 3RTRA 1BN5A 2UWMA 2BBYA 5HOOA 2EA2A 3E5UA 1S8NA 4HBLA 4HX7A 2FE3A 1HQCA 4HQEA 5L3DA 2K02A 2HKOA 1XGNA 1BI0A 2ACJA 1G3SA 4Q4ZF 2FRHA 2NNNA 2P6TA 4MNUA 3E6MA 5ILVA 2ZMEB 3GXOA 1J9IA 1RI7A 4L0YB 2XAJA 3P9CA 1YFHA 1PDNC 3GF2A 5CVJA 1KU9A 2ZJ2A 3H92A 3RDIA 3WODF 4IF4A 2HTJA 2FOKA 4A0XA 2J5OA 4UXNA 2VBWA 1YW8A 5DCMB 3K1MA 2V1XA 4UNOA 1S3JA 2V6CA 3R4KA 3M7GA 2CW0F 2QQ9A 2B0LA 5D8KB 1REPC 2YX7A 4KICA 2AXLA 1ZG1A 2GQQA 3V7RA 2CQKA 2H09A 1FZPB 2KIMA 2JT1A 2HYGD 2VBZA 2JSXA 2NNYA 3ZMSA 4R79A 2IA2A 1V3FA 3VFZA 2HR3A 4BXUA 1T98A 2JTVA 3WGIA 1DP7P 3MZYA 4YG2F 1R5GA 1AOYA 2MC3A 3GW2A 3WE3A 2HZTA 4BQAA 2BGCA 4U7DA 3GFJA 3DKWA 2KIFA 1R00A 4U88A 1YQAA 4M74A 5FFXA 2EFWA 1T6SA 2Y48A 4ZYDA 2DLLA 4BH9A 2QUFA 4RGSA 2OQRA 1PUEE 3F8CA 1KYWA 2PMUA 2P7CB 3BPVA 2QQBA 2XIGA 3J80Z 1OMIA 1FYMA 1J7KA 3FM3A 3L7WA 2FBIA 2BEOA 2D45A 3ZQ7A 4KIGA 3SZPA 2XRNA 4XLPF 1W7PB 1Z6RA 2NRAC 4M9ZA 4XBFA 4IXAA 4G6QA 4D0PA 2XASA 3HIFA 4P9UA 1UFMA 4QWQA 4OU0A 3MCZA 1RUOA 5IT3A 5E8IA 3K1PA 1YO5C 2XKPA 3KP2A 4ENNA 2V79A 2IP2A 3KLNA 5CVRA 3NRVA 5JR3A 4QLCU 1XDSA 4UVBA 2DAOA 2HKXA 4HX4A 3F22A 2LF7A 2OQGA 2RV8A 4YIIA 2RVCA 1TNTA 3L00A 3TQNA 4RGRA 5BPDA 4UVAA 1G6NA 2PN6A 1SFEA 1FP1D 2X4HA 4OMYA 5E8GA 2XHKA 4I2OA 4EJWA 5E17F 2D1HA 1USTA 2DO7A 1SD6A 2EV0A 3LSTA 3LAPA 1O57A 3ULQB 1D8JA 3ECHA 3IC7A 2L01A 1G4DA 4ENJA 3LA2A 1WKMA 3I59A 5D6FA 4ENMA 4LLNA 2CFXA 2RC4A 1O7LA 2MBFA 2CWEA 3SXYA 1XSDA 4CHUA 2STTA 2Y75A 3L2CA 2IPQX 3HYIA 1AWCA 2XAGA 3KP7A 2HOEA 2FBKA 3WU1B 3WGHA 3EETA 5CLSA 1ODDA 4LJZF 4A5MA 2RGVA 3QRFF 1BOAA 1BBYA 4ZYHA 4KN4X 4UV9A 2EFQA 5FD5A 1XDUA 1QZYA 4OIOF 3F8FA 2XVCA 3KE2A 4KN7X 3FZVA 3ML6A 5K5QA 3MQ0A 4M9XA 4L9VA 2RQPA 1R22A 1WRJA 4KDPA 1YW9A 3T8TA 2H6BA 4AWXB 1B1BA 2XV4S 1FYKA 1F9NA 3WTWC 3KP3A 3FF5A 3BZ6A 1KQ0A 4G94A 2LKPA 3EDPA 2A69F 1R58A 3IWFA 5ICFA 3FWEA 1TQPA 5AIQA 1FNNA 2EFNA 4A0YA 3Q5FA 3R60A 2PMHA 2ZKZA 4Q47A 1MZBA 2VODA 3I5UA 2GAUA 3COAC 5LHHA 1H0MA 5EEHA 1G3YA 3F8NA 1SMTA 1GVJA 3IKVA 4M6XA 3VB2A 3B73A 4ESBA 2OZUA 4WK8F 5JFRA 1DPUA 4ESJA 3FXRA 2PG4A 3ROUA 2K7LA 4AVPA 4AD9A 2UXXA 1TW2A 3KP4A 2DQRA 3GLXA 4N9HA 2IT0A 3LQQA 5D6EA 1A04A 4HQMA 4WX9A 2DK5A 2ETHA 3HSFA 2PLYA 2VONA 2PJPA 5L3EA 3WTSC 3WU0A 3JSPA 1ZG5A 1CF7A 1MDMA 1U6GA 2F2EA 3U1DA 1Z9CA 4KUMA 1R7JA 4R8HA 3MWMA 1ZYRF 3H3ZA 1YS7A 1GXPA 2LF8A 2K86A 3LA3A 1I1GA 3E5QA 3CJNA 2OD5A 3JW4A 3F6OA 1UCRA 1ZRDA 1J0RA 2ZXJA 2P5VA 3SZTA 2M30A 2R7FA 3V8JA 1LVAA 3ABTA 3LAJA 1P92A 1SD5A 3SQNA 5LRSA 3F3XA 1RZ4A 5FFZA 2ISYA 4HOBA 2ZNZA 5J8CA 1RNLA 3DF8A 2V1UA 1U3EM 2ELHA 2VN2A 4HX8A 4M9SA 3RJPA 4RB2C 3I59B 4UVCA 3T1BA 1ZARA 4PCQA 3HTSB 3BJ6A 1IRFA 1BI3A 1QNTA 3F72A 2IA1A 4M6YA 5LBQA 3EQLF 3RPQA 4KMFA 4RGUA 3HRUA 3DEUA 3BPXA 1HKTA 3P7NA 1S7OA 2LDUA 5E1XA 2M1BA 2HEOA 2F5EA 3LFKA 1S6LA 5LGNA 4M71A 4B09A 1U5TC 1BM9A 1LDDA 3EYYA 1SFUA 5BS6A 1T0FA 3QP6A 1J75A 2ZBKA 3DV8A 3ZMUA 3TGNA 3V8LA 1B4AA 1O3TA 1SFXA 3CUQA 3F8MA 2COMA 2P5KA 2XAFA 4DNCA 1IF1A 3HTUA 4HF0A 1FP2A 1MJ9A 3TO7A 2R3SA 5FD6A 4YFKF 1X3UA 3REOA 4A0ZA 3DPTA 2IRFG 1WQ2A 3GX4X 2IJLA 1LB2A 2EFPA 4EGZA 4RAYA 3KETA 3C1DA 4HAMA 3ELKA 1ZAOA 1HW2A 1ZLKA 2HQNA 2C6YA 1T39A 3IHUA 3DQVC 4ESFA 3FMSA 4Y17A 4YFXF 2TDXA 4NHJA 2JSCA 1TQIA 2FXAA 3KFWX 2WWYA 3ABUA 4MGRA 2AS5F 1XSXA 4N0BA 4KYWA
chains in the Genus database with same CATH superfamily
2QYCA 4ZCKA 3OYBA 2GOXB 2V4QA 4OHWA 3RBXA 3UCZP 4F91B 4DZJA 2EQRA 3SEZA 3IO1A 2D3OR 1MBHA 3OVSA 4NX9A 1KD1T 3PO2J 3C14B 4F3QA 3NLCA 1N5YA 1IKXA 1K4SA 4Y34A 3W1YC 2B8PA 2UU9F 1WG5A 3QJJA 3DMJA 2DR8A 2HWVA 2V9VA 1HDPA 2E5HA 3RPUA 5FLXU 1HW5A 4A6EA 1QBJA 3KLEA 1DUXC 2QYOA 1B9NA 4DYRA 4ANDA 4Q44A 4JV2A 3KLIA 3IBCB 5DO2A 2K85A 5B0FA 4FYDA 1R0BG 2ZH9A 1Q82T 1AXQA 1KA8A 1KS2A 3UDVA 4X4PA 4R1HA 2JEIA 3HGGA 4U8VA 2VI6A 3MAAB 1NDKA 3ZQGA 5LMNF 4ZDOA 2WONA 2GCFA 1VQ7S 4IPAA 4J9OA 1BQMB 2O0YA 3ETMA 2MQOA 2QMUB 2DNHA 3TQEA 3RYRA 1KLNA 1M1GA 1YJTA 1P6RA 2YBVA 1GT8A 1BR2A 4JI1J 2DKOB 3N97A 3PACA 5D5VB 2B63J 1RTDA 1O3QA 5J6XA 1VQ4I 4NYOA 1BC8C 5IFMA 2Y1LB 1CC8A 3G8TA 3D5RC 1E3PA 4M3BA 3M32B 2OEJA 4FCYA 1IZ1A 1SH2A 3I5CA 4L72B 1JX4A 1J5YA 3NQOA 5A8KB 1IN6A 1LW2B 3LGNA 4IOCQ 2VKZG 1HNWF 1U0JA 4G3IA 3LSRA 4DPYA 1TL1B 3GV5B 4ZVHA 4FNHA 4U67Q 1TKXB 1YJ9I 3G8QA 3AAWB 2W7AA 3GTQJ 5JXSA 3MZHA 1RKIA 3I4NJ 4KR0B 1MJAA 1BWEA 2DTJA 4ZN1A 3QP5A 2DOFA 2R9LA 1OR7C 5AE2A 1RYRA 2BKOA 2CQNA 5F08A 1NJIT 1HWLA 1USSA 4OIXA 2VJ5A 1X31C 3Q8PB 1NMEB 5BXIA 2ZD1B 1TMMA 3NXZA 4GYGA 1WJCA 2XDVA 1CJUB 2AQFA 1VQOI 4ZZLA 1XN7A 5J4YA 2F8MA 2W57A 2X1BA 3QAEA 2Z99A 4M3EA 1BR1A 4AYBA 1MWYA 5SZTA 2A05A 1VMBA 4XNFA 4NCAA 2A1BA 3BCBA 3SQGB 3JRCA 1JHHA 3D0GE 2J7WA 3GILA 2HS5A 3AJ1A 2O01C 2BQUA 3QOPA 4B08A 5K8PA 5CYVA 4S04A 3OSPA 4QQBA 2BVZA 1Y11A 5K5OA 3BROA 2ABYA 4HI1A 3BOQA 2QJ3A 2RNGA 1OPCA 3ZXSA 4K7QA 3M6UA 4M1KA 1KR4A 1H2UX 2BZ2A 1OYDA 5FLXZ 3J7Z5 2KH9A 2QCOA 1JTYA 3MOZA 5F27A 1G1XA 1QVUA 4XLEA 5J2PB 3CCVI 3EPIA 1A36A 3V7SA 2G0CA 5HDKA 1I5OB 4OZ5A 4ES3A 2F48A 1UHWA 3RW7A 3SEQA 2ZBCA 1O3RA 1KHVA 4L9JA 1LW2A 1YRNA 2FMLA 2OPSB 3H2UB 2FLNA 2KRCA 3ISPA 2AT1B 1WC1A 4IKAA 4C3LA 2F8EX 1WORA 3FK6A 2K27A 3OYEA 4IHTA 4DN9A 3SCJE 2MLYA 4WE1B 4JI0F 1XR5A 5RUBA 5LEKA 4UUSA 2B3TB 4IHSA 3ITHA 3PRVA 4JBAA 3VV2B 2M8EA 5D5XB 4XRFA 4JOUA 1NG7A 1KTVA 4CLPA 4A5NA 1YG0A 1TTHB 2VE9A 1LW0B 2M45A 2V2QA 4K8RA 3ZZ0A 4KNYA 3R5AA 4YB1P 2EA4A 2XO7A 4P2FA 1N52B 4Y2MA 3VZIA 2BDPA 3IRWP 3GYGA 4HYKA 3H59A 5DLFA 4HH1A 4A12A 3SV3A 2IM1A 2NSCA 3NOGA 1FTCA 2HSEB 1NH3A 1ZGJA 3V2UC 1YHQI 2JLEA 3GQCA 1MSFC 5L38A 3NG8A 2MH9A 2DH8A 5HBMB 5GAGI 2OTLI 4M3GA 5FLXK 4BU2A 2E66A 1H8AC 2IW5A 1JXSA 4JQFA 4UF4A 5A2QY 3RAMA 4MK8A 1IDZA 2JRSA 1RTDB 2O61A 4RAGA 2QQAA 2HIQA 3TUZC 2JFDA 2VU5A 2J9DA 4ZVTB 2H94A 2VXDA 2CA9A 2R7RA 2EZLA 4J9MA 4EMDA 1WG1A 1SH3A 1VJQA 1SUQB 2VQGA 4FN5A 5KG2A 1B9MA 3SSRA 3JREA 1U24A 4FE7A 2B7EA 3T6BA 1RHMB 2P5LC 3DLEB 5CYMA 3CCQS 2W82A 3NNHA 4UHTA 4DU8A 4DX7A 3TOAA 4RW9B 4Z2YA 4FT8A 2UXBJ 5EHHA 3DWLE 1VI0A 3C2HA 4IVNA 2JZYA 3H42A 3KLIB 2CJJA 3S1MJ 4P71A 4E7IA 5J8FA 5IS2A 4TU8A 2GX8A 4DOZA 2CUYA 3CTRA 3HOTA 1UW4A 4DR4J 4IUFA 3MMYB 2YNHB 4OIRF 1BI2A 2EKYA 2DNGA 3F56A 4K4SA 3RYLA 1TV6A 3O6QA 2N82B 3TUJC 2HGCA 3OSGA 1JB0C 1ACIA 4BQNA 4HLYA 4HTIA 3M05A 3JSMB 2CRGA 2DODA 5KFCA 2AIRB 3IG1B 1R23A 1W5SA 3ET6A 1S1XA 3FSYA 4BHQA 4LF5F 2IVYA 5K5RA 1SUQA 2AJ2A 4BJTA 1EJ7L 5HROA 3MMBA 1LWFB 1EX8A 1SKSA 3K2AA 3ASNH 2HQCA 3CB4A 3KLVA 1E2XA 4G8XA 4ZIVA 1HNVB 4Q5VA 4FDFA 1G3TA 2HDCA 3H0GJ 2E2HJ 1DP3A 1HPZB 3QGGA 2X1AA 1SVOA 2RQQA 4E8UA 4IFVA 1D1CA 2UXBF 3IWLA 1S29A 1YSJA 2DPIA 1WG4A 3K4CA 4ZCIA 3SZGA 4N56A 1NK0A 1NKCA 3MDFA 3WX8A 1D3YA 1VHFA 1NH7A 2AHOB 2RREA 2ZCWA 3H90A 1X9MA 4NA3A 2IYIA 2HNZA 1T02A 2E1CA 2CV1A 1RAEB 4GMKA 3PV8A 3TBIA 3QAUA 1V55H 4HHJA 3S16J 2BE9B 2MLGA 3NBPA 3AXKA 4ZS6A 3D5SC 3R1LA 2JQ7A 5DQIA 3UDCA 3WE2A 3GWZA 3GMEA 1TFYA 4HZFA 4GCVA 4EQQA 1JT0A 1TKZB 2F40A 5K1YA 4NCGB 5E79C 3CJ4A 4ZYAA 1W5TA 2HNDB 3QPLA 1K6OA 1OCPA 2JMWA 2VG6B 2EFVA 2DA6A 1S7HA 3I71A 2W4CA 5GAHI 2POKA 3NAUA 3W2AA 4G7OF 4V1Ak 1YX2A 2RAQA 2AKWB 2V94A 4KT5C 3WG9A 2MZRA 5J2NB 3KHGA 3S1TA 4I7HA 2UUCF 4NLOA 3HVWA 3W63A 3CF2A 2KRBA 4IJAA 3WG7H 5K8OA 2HVDA 2ZE2B 1P1LA 2YS9A 4CCKA 3M8JA 2DXEA 1SJ4P 3X3UA 2LYVA 3TO6A 4FVMA 4XKCA 1CJTB 4Z7CA 4I6YA 4EO6A 3T1YF 3BYPA 5CABA 4J9KA 2CXEA 4MEXF 3CUQC 2FNPA 1FVQA 2FJ1A 2O9LA 1TQLA 1WTBA 2NXUA 1N5VA 3VAIA 2FYXA 1HBOA 5HLIA 1Z7UA 2ZOMA 1RUNA 3MEGB 3PDNA 2Z4PA 3HMJG 3GZ6A 3KK1A 4QTRA 3GU0A 2EV5A 2IYGA 2FDNA 1IBKJ 4F4KA 2PI0A 3MM8B 1R8BA 1EETA 1R3NA 2RDPA 1Q8LA 3AFHA 2BUNA 3MF5A 3J81Z 3SCKE 1TBXA 4ZYEA 3CWJA 5CYJA 2ZNYA 1JJ4A 3CCEI 2A6TA 3C2PA 1FDNA 4WXCA 3DOKA 3T41A 4J9SA 4YY3J 3ZGKA 1GXQA 1VQKS 4RBUA 5DM7Q 3IAM2 4A93J 2L7FP 1EV7A 1VJWA 2DGVA 3W60A 5KG7A 5LRRA 2HYJA 3F21A 1FNMA 2AF6A 4BACA 2EK5A 3K70D 1H73A 4XPCA 2FEZA 3DTKA 5ED4A 2ZHOA 3HCXA 1C4AA 2K8GA 2ZFUA 2M7AA 2LLZA 2V1NA 3K4NA 2CQBA 1OIAA 2DGOA 3VODA 2OIHA 3ERED 2YKMA 2DTZA 4EM1A 4RNHA 3DFGA 2DA4A 3TW7A 4UZCA 1RAHB 3RRHA 3IV5A 1S49A 3D54A 2VC1A 1FSEA 2R4FA 4UZBA 1ZLJA 3PQKA 3OXLA 3H98A 2XLIA 4FISA 2RQKA 4WTOB 4DX8H 1YBUA 4ID5B 3QRQA 2HGLA 4HV6A 4LK1F 4C9YA 3THVA 3OR2A 1N4LA 1VCTA 4B9LA 3CCWA 2Z1DA 1IBKF 2KVIA 3MAAA 2C3UA 3GTLJ 4MKYA 1NK8A 1W36C 2D5VA 4FYXB 3R8YA 2WVFA 4PZVA 4DWIA 2M70A 4I2QB 2Y9HA 2F5DA 3L1PA 1SD7A 3FKBA 1AYEA 1GV5A 2EZHA 3OWTA 4RW6A 2OSQA 4CP5A 1EP4B 3MFKA 5FDLB 1S7EA 4BE0A 2V8VA 2ZSIB 3M2UB 2HNYA 1NSQA 4QPXA 4MK7A 4QWDA 5EJCA 4V2FA 5AXLA 2DNOA 4NLQA 1S0OA 4KHPF 1WEXA 1PC5A 1QE1B 2Z2ZA 1NM2A 1IJWC 3HFKA 2RHSB 5KOXA 3GFZA 2ZM6J 2ROEA 2FJBB 4PEOA 4PFPA 4HV5A 2Z30B 4YR2A 3FBCA 3R0JA 3L2WA 1WZ2A 1IKVB 2GMJA 1JJCB 3HSJA 3E6BA 2JVGA 1DLOB 2OPQB 3EYZA 4V2GA 5L9XA 2XULA 2LSOA 5IPAA 4KV8B 4PFOA 3DLJA 2JVHA 1VS3A 4F4YA 2ZHAA 2EZIA 2HHPA 4CQ1A 3W64A 1V54H 4G1QB 5D0HA 1XNRJ 3DLGB 3G71S 5DEQA 1RWMB 3L9FA 4LSNB 2V8HA 3C6TB 4Q0BA 4BBRJ 3M4XA 2CQQA 3NNAA 1F60B 4LLGF 4X64J 1C1CB 2HZAA 1FDBA 2M4GA 2OF7A 3KK2A 3U1KA 5GMDA 3WTXC 4UUVA 1HQEB 2FLPA 5IV3A 4NYZA 2DT9A 3O3KA 4HEA2 2QX0A 3BZCA 3G6VA 2LOOA 2AEJA 3OYNA 2HQDA 2EIJH 4F50A 3S2HJ 2EJRA 1HXDA 5GAGU 3CJ2A 1YRNB 4LVNP 5DS9A 3GZ7A 4DCPB 1WSVA 3OVBA 2KDOA 3IMQJ 2H27A 2HHHF 3T5XA 4LK0F 3LSJA 1HYSA 4OFZA 5BPIA 3K5PA 1G59A 2G7UA 2LG4A 3JAMZ 1W7WA 3GJRB 4DR5F 3IRXA 2HQGA 3I32A 4EGLA 2LXFA 1ACMB 3CCMI 1HBNB 4LBPA 4EM2A 1IJFB 2JFKA 3R97A 2YQ0A 4KHPJ 5KG1A 3JR9A 3CPWR 3CTAA 5KK1A 3UN2A 3KJVA 1CQMA 5DZ6A 3CSKA 3GO5A 1QGPA 4LB5A 2EFOA 2ZVIA 3AL0C 2CO5A 1PJ7A 1B59A 4KGMA 1R5ID 1O8BA 3EX7B 2HTSA 4MO7A 2H5IB 2D9PA 5LJ5Y 2VBXA 1T9TA 4UQGA 1UELB 4IX7A 4LIVA 5KCMA 1T8IA 3IRRA 4DV6J 4K5SA 1WDDA 3ZRGA 4C7QA 2YSRA 1YJNI 3M9AA 3S7RA 5LOQA 3VAKA 3CDLA 4DV3J 2X6OA 2E1MB 3HF5A 5IM0A 4B8XA 1IBMJ 4BJ5C 3C7JA 2EV6A 4DSJA 1REVA 2VOPA 4DI6A 1TNSA 5DM6F 2LECA 3S6EA 3DTEA 5A2QK 1P8GA 2CYYA 5GAEU 2D1VA 3J81U 4ZYGA 4OINF 1Q8IA 2LD5A 4ITVA 3DRRA 2E1AA 2PT0A 3OTCA 1KU3A 1AT1B 4UV8A 4DGWB 1WJ5A 2IM2A 1FFWB 4F4AA 3HKZA 4WFNQ 4K50A 2IS6A 2PBIA 5F0HA 2ZOFA 5E1WA 4DIQA 3MD3A 2XPWA 2ESHA 2LFVA 3CDAA 2XBPA 1D8YA 3PHEA 4C8LA 2WAEA 1BC7C 3C2GA 1LOUA 4AIJA 5D78A 1L3LA 3QT6A 4WZMA 5KT7A 2WSEC 1QAYA 5GPAA 4ES2A 3A3OB 3ENVA 2L08A 2OPQA 3RBEA 3Q3SA 5C3EJ 5HDNA 2HGMA 4MKVA 3QJPA 3OJSA 1FTZA 2F4MB 5E1ZB 5JHUA 2PA8D 1NDPA 3TO8A 4UW2A 1VK8A 1IWGA 3HHHA 1W36D 4PXDA 3EGVA 1ON2A 5F64A 3UCUP 2QRRA 2L9NA 2RHQB 2VPZB 1GH8A 2ZO4A 1WC0A 1FJGJ 1X2NA 4LSZB 4J19A 1OY6A 5KG5A 4A8XA 5L46A 3E51A 4JP8A 2W48A 1YLFA 3O2PE 3GYNA 1TU0B 4X4SA 4C8NA 3V6DB 5CVUA 1WKJA 2F4VF 3HRTA 2IJFA 3C14A 1DDNA 3BSAA 1DFDA 3A8EA 4RLEA 5F8JA 5KFNA 1HHQA 3CD5A 4LF8F 2MGZB 2CMPA 2FHJD 2QFIA 1HFEL 1MN9A 4DW6A 2LK2A 4CO8A 1ZZNA 1SBRA 1S1XB 1TUVA 2DO4A 4U6PA 3PNTA 1JKHB 4CZCA 3MN2A 5J3LA 3PHTA 2FZGB 1VRQC 4XICA 1L3UA 4NZ7A 3LA7A 4Z7YA 3D2WA 4X4TA 2WAQA 2WZ1A 5BMZA 3F23A 4K4VA 3TRGA 2N3LA 3M6VA 2A5WA 2CU7A 3FK7A 1BQNB 5GTIC 1TMJA 3GZ5A 3ZMDA 1FLIA 1WH7A 2CJKA 3F8BA 5KFOA 1F2HA 2FTRA 4DR6F 1G3WA 1XMKA 1LXJA 4LUBA 2W9CB 1Q1HA 4M3DA 4HYEA 4ZDPA 1S7IA 2CRLA 2PEHA 5DG7A 4DFJA 1V5EA 2L4MA 2LEBA 3FBEA 3ZN1A 2O5RA 1XR6A 5AXNA 1GX5A 1FJGF 5HMWA 3KDNA 4HRIA 4HSTA 2AX1A 2V9WA 1CEZA 1ITPA 1ZA2B 4MQVA 5EDWA 3IH4A 4WFAQ 1PYOB 2E34A 2GIFA 5L3FA 3DP7A 4XK8C 1VBZA 5IT9Z 4ITSA 1QHGA 2HNDA 3DC2A 3K58A 4X0GA 5FKMA 3VTIA 1TWAJ 2W9BB 1Y8QB 1ZHFA 3CJRB 2UP1A 4D7NA 1MMDA 3DM2B 1W7PA 2V4RA 2STWA 4JV0A 1H89C 3DXJF 2HYFA 3R5DA 4CT9A 3LP1A 2BOLA 3RTRA 2BBYA 1HI1A 2HFSA 4OJ3A 2N4CA 1DTTA 4PR6A 2EA2A 3SI8A 1RJJA 2IAJA 4ZVEA 2DCEA 3D5MA 4OYMA 1OQYA 2ZXIA 5H2FC 2PSZA 4DV0J 3IAM9 3H5XA 4YHHJ 2HMIA 4XKBA 2HKOA 3NNCA 5B08A 1WOSA 2NREA 3TEGA 4EWTA 4Q4ZF 1U49A 2J8SA 3E6MA 5ILVA 4F26A 3QZ7A 2LEPA 3U7JA 3CJ8A 2XGDA 2R92J 1A6IA 3MGJA 2V4JC 3OS1A 2KM8C 1RSCA 2OMLA 4IDKA 4M5DB 1RT6A 4WKYA 1EKRA 1GLNA 4ED6A 2R4GA 3OHBA 2AW0A 4RNOA 1R0CB 3DOMA 4NLGA 2JOQA 2MB0B 4AIDA 2MQ8A 4LFCJ 2WB1A 5KFZA 4KT6A 4X64F 4EZ6A 1RT7B 3DRPA 4NI2A 4KY3A 4CCNA 1ZS6A 4MJKA 4OYXA 1JLGA 2BE7D 2FHKA 2RDJA 2AGQA 4WFXA 1HWIA 1VK3A 3R7NB 3B54A 4HSRA 4KICA 2AXLA 4OYPA 1CPZA 4NRUA 3V7RA 1FZPB 2KIMA 2JT1A 2KRRA 2VG7B 2LEAA 3NAIA 3DHWC 1ERDA 1EKSA 1QAJA 1S6QA 3LANA 4MK9A 3VFZA 3HZJA 3DGPB 3PYFA 3PUBA 2JTVA 1MLAA 2YNIA 4DS4A 2JSPA 3PNIA 4CCJA 3GW2A 2HZTA 4PXCA 4BQAA 3QT8A 3H0PA 1RT6B 2X51A 1RC9A 4O0NA 3VGUA 2K7JA 3DKWA 2KIFA 3TEHB 3IWXA 3LGHA 1JTXA 3D66A 5D4OA 1WKLA 4CO5A 2A2CA 4IFVB 2EFWA 1S0VA 1SJ1A 3THPA 1U1KA 2Q6CA 2Y48A 2DLLA 3X2QH 2QUFA 2ZH4A 3F8CA 4FZVA 2R8JA 4A69C 1ZTWA 2B9WA 3PNVA 1I94F 2PMUA 2P7CB 5CYMB 2HVSA 1FYMA 3K57A 1YJUA 3TOQA 3L7WA 4ELTA 1Y56A 2BRKA 1FESA 4DZPA 1XK8A 3UQSA 1ZTRA 4Q0BB 4EFAC 2HWHA 3JSRA 2MY7A 4A3KJ 4XLPF 1W7PB 2NRAC 4G6QA 3GYXB 1MSWD 5E3LA 4P9UA 4QWQA 1Z4UA 1RUOA 1X4FA 1URNA 3TYTA 1VQ5I 5E8IA 2OELA 1T9WA 5J1EB 3VAMA 2XKPA 1ITYA 1TP4A 2NPIA 2DNLA 3QYFA 5EZGA 2DRDA 4E7LA 4YFUA 5CVRA 3T3FA 2W1OA 3NRVA 3H1CA 4W4MA 4NXMJ 1FI4A 1FO1A 4FVCA 3B6BA 1XDSA 4UVBA 1ZPWX 2DAOA 1X5OA 2HKXA 3DLLF 1JLCA 2DVIA 2BY2A 2M9HA 1I3OB 2ILZA 1POGA 1TKTA 2EZKA 2HFZA 4YIIA 2XMAA 3MMJA 2KN4A 3L9ZA 2MD0A 4UOHA 3FQLA 3KK2B 4OX9J 2NQPA 4D5FA 1G6NA 4URGA 1X1PA 2QO3A 5A8RB 2NZ4A 2DXDA 4N41A 4KPCA 5E8GA 4LR9A 2KT2A 1VQMS 2DGSA 2D1HA 3K7RA 2DO7A 2EV0A 4DFPA 1WH5A 4E6KG 4BY7J 2CW8A 1U48A 4HVZA 3H3VK 1D8JA 2CPEA 5B09A 2WBRA 2O66A 1RWVB 5DDRC 2W01A 3RZOJ 8AT1B 1I51B 3MPWA 4K59A 1K44A 1XNQF 2MBFA 5KFTA 4CH0S 3SXYA 2YWEA 4A3GJ 2RKIB 4CHUA 1IKVA 1MBJA 1IC8A 4CYCB 2J0XA 3PTWA 3KP7A 2EBEA 3VALA 3LSPA 3WU1B 1B72B 5A6WA 1RHQB 1RKTA 3R2DJ 2LKXA 1SJFA 5CLSA 4F3MA 3DLKB 1YQHA 2MY8A 2VPXB 3C19A 1TELA 4EBCA 1X4HA 2RGVA 4ZYHA 1SC1B 2UUTA 2KZMA 4GKKJ 1E6YB 3FZVA 3CJTB 5K5QA 2HLTA 1N77A 3BKTA 4M9XA 4JI8F 3FFIB 1WRJA 4I76A 3PRBA 3SSSA 3RUBL 1YX3A 2H6BA 4K5RA 1TL4A 4JV1A 2Y0SD 3MM8A 4LRCA 4DQRA 2WADA 4IZZA 3KJNB 2DGXA 1KQ0A 1JIHA 3GIMA 4OI6A 3C6UB 3GFXA 4F36A 3IWFA 2XMMA 4DL3A 3UVJB 3FWEA 4OZNA 2E5LF 1Q5VA 2CQPA 2EFNA 3ONQA 4A0YA 3Q5FA 3R60A 2CV2A 4ABZA 1C2PA 1ZM9A 2WAFA 4AXIA 4X62F 3T1AA 4AYBN 3WC0A 4ERDA 1OYEA 3COAC 3Q0WA 2JWNA 4R0JA 3EVWA 3VZHA 2DA2A 4PUSA 4M6XA 3MMAB 1OJLA 3VB2A 4B3XA 4ESBA 2P9GA 2OZUA 3OIOA 5H9FJ 3SBMA 4WK8F 1DPUA 1OO0B 3PJXA 2LVWA 1Y5LB 1CULA 5T41A 2NVUB 2FZKB 2RF2A 2K3KA 2PG4A 5A76A 3MKWB 5F8IA 4OWRB 4JI5F 3GTKJ 2YNFB 5HMXA 4I56A 4O44B 1YI2S 1YITS 3DKYA 4ZJQA 2OI2A 3RQIA 2B5JA 2NUHA 4JI7F 3TW6A 4N9HA 3UVJA 3HHLD 5D4NA 3BR1A 4J9LA 1F0XA 2JX2A 2ECBA 5LXRA 3LQQA 4XLFA 4HQMA 4WX9A 2Y0BB 3HSFA 2OPRA 2PLYA 1IRXA 3BO3A 3ZZYA 2VONA 2VQEF 1TC3C 2MG4A 3WTSC 1UP1A 1MDMA 3DDNA 2J0QD 1Y8RB 1SI9A 5GADJ 2GZOA 2CJ9A 1VQ6S 3BG7A 2HHTA 1ZYRF 3H3ZA 3A0HC 1GXPA 2LF8A 1I1GA 1S10A 2Z16A 4I1TA 4WP8A 2PFFB 1WJDA 3P5JA 3MR2A 1KFSA 5C25A 3OYIA 4MTPA 4NL5A 4A48A 4LFCF 3BGFA 4U7CA 4ED5A 2GV1A 1IQZA 2VD3A 1P92A 1SD5A 1RU1A 1B7YB 2C2NA 4I4BA 3DDKA 3F3XA 3CC2S 5J2NA 3TZZA 6AT1B 2L0KA 2ZKTA 3MM5B 1FE4A 2R7WA 3DF8A 2D3O1 1X1DA 4UOCA 4QR0A 2FVSA 3I96A 2E9RX 5HMZA 2EK1A 2GIRA 5HO4A 1C1CA 1N88A 4RB2C 2MZJA 4ZVQB 4UVCA 1U7LA 4RL1A 4HEA9 5KFRA 1QA6A 3CCJS 3BJ6A 2KZVA 1ZAWA 2VICA 3B4MA 4QWCA 4JOMA 4KB7A 3CCLS 4BL0B 2JNJA 3AG3H 5E1XA 4CTAA 1T7PA 2ZJQF 2AZ3A 2HEOA 1H7WA 3LFKA 5LGNA 4WIIA 5KFYA 3Q83A 1LDDA 3EYYA 3HGYA 1SFUA 4CWBA 1RYSA 2VPYB 1IKYB 5BS6A 4WWSA 1L3TA 3VQTA 4E7HA 2Z56B 4MH8A 1I3AA 2AJ4A 1N78A 4DU7A 1X3ZB 3DV8A 2X85A 3PW0A 3SFGA 5E33A 2RDDA 5HI7A 3CQZJ 3Q0UA 1O3TA 3LOCA 2UUAF 4IQXA 3KNAA 3F8MA 5J47A 1VQLI 3ABMH 2IY5B 3HTUA 2EW9A 2QA4I 2EPIA 3AB4B 5L1JA 2YKPA 5HNFA 2QKLB 1MWQA 5FD6A 3CE8A 3Q22A 4DSEA 5I3QA 5KTQA 3GCMA 1UG0A 2FQ4A 2IRFG 2R7XA 3PJRA 1WQ2A 3MMCA 3MR5A 2IJLA 5DGBA 2XI2A 2KFDA 1C1BB 2G0EA 4X1EA 4RAYA 2BMBA 4RA2A 5KFJA 2A2DA 1HW2A 1ZLKA 2C6YA 3BN4A 4Y17A 1GMWD 1RKJA 1B70B 3EMTA 2QMWA 3DRXA 4Z6YA 1VQNI 2MHEA 2OTJI 3R6GB 3ABUA 3FC9A 1KVJA 4CLSA 3KK1B 1D8KA 3ISNC 2BXJA 2R2UA 4TNOA 5H9FK 3PO3J 3N0VA 3PW5A 2MH2A 1B6AA 4X4NA 4RAZA 3I31A 3IBWA 1RB0A 3RI4A 3FXJA 4MT1A 4G7ZF 3V6KA 1U02A 2ASDA 3G6YA 1JJ2R 4OX9F 2E7WA 3EXYA 3FHNA 1U09A 2IBKA 2ROGA 2NR0A 3FM5A 3MKLA 3RKWA 2W85A 1OYYA 2TRTA 2NXNB 3FGVA 4ZP9A 2E19A 3Q8QB 3QIPB 2DJIA 3SZ2A 3G71I 3HHDA 1QU3A 2Q3PA 5DV5A 3RB6A 2KJBA 2QC3A 1KGSA 3J7YU 4P7VA 1JLAA 3VYRB 3CJ3A 4GFBA 4LFBF 2R7SA 3FXUA 2HVIA 2CQIA 4LIRA 1Y3JA 1R1TA 3VGTA 2MZ1A 4II3A 3M7VA 4RGXA 4PABA 5C7PA 2ASLA 2PMZD 1X4DA 1Z05A 2DJNA 3BS9A 1ZAXA 3MCNA 4OAZA 1L5UA 3LSIA 2KZGA 4QR2A 2N8GA 3OTOF 3OXFA 5CQEA 4QWEA 2KLOA 1YBAA 2LFBA 1YIJI 2J6SA 2VJ4A 2HHWA 4IHXA 1SH0A 5IP9J 2B5JB 1KQ8A 1ELOA 4G1PA 3Q24A 4X65J 2QM3A 4O44A 4ZZDA 2EFGA 1DQ8A 2FLLA 1WI8A 2G2ZA 2W2MP 1HLVA 4DL6A 3GLLA 2V0NA 3S3NA 1Z21A 3K9TA 1VYAA 5MAOA 1XB4A 1BMQB 2Y8WA 1VQMI 2RF2B 1NCLA 3SFZA 2EB7A 1NSPA 3RR7A 2XAHA 2IS1A 4PPZA 3K5OA 1D9FA 2E7XA 2ZH3A 4P6QA 1N34F 3OYGA 2Y1RI 2XCPA 5HVFA 3Q0AA 3GVAA 3J7AY 1XGOA 3CO9A 1T33A 3R5CA 3TX8A 2OZ6A 2F4OB 4ZDNA 2K9QA 4XORA 3RIRA 1Q16B 5M2PA 1K78A 4WYWA 4KMUX 2W25A 2OO4A 1X0FA 2RNJA 4M8LA 4G6VB 5HJYA 1GNKA 2R7UA 2M5WA 4LF5J 1OLTA 5LMUF 4DQIA 3TO9A 4ZH4F 1VI7A 3MMBB 2DRAA 4U0WA 3BWGA 3HSRA 1VQ5S 3ISZA 2RVJA 2G7HA 1XC5A 4HF1A 2XS5A 2VC0A 4J9PA 2VFUA 5HVGA 1K1QA 3I56S 3PIOF 2MTLA 3L2RA 4C2UA 1UFKA 1NG6A 4R25A 3P9KA 2P7VB 5GP9A 1MH3A 2GXBA 4LF7F 1Q4RA 3PYEA 1U0SA 3T1HJ 1NK9A 1FNOA 4I0AA 1OY9A 5FLXY 4C8YA 2XF5A 3W6JB 4ED3A 3D6HB 4ON0A 2GMLA 4EJVA 2LYCA 2HHSA 4HG2A 4JI7J 4TQRA 1CSJA 3R6SA 2YNHA 3CO7C 4DR3F 4J91A 2GGPA 2XLJA 1HA8A 4H4OB 4TN2A 2PO4A 3M1VB 4YFNF 3GEZA 3KG0A 1FKPA 1RA7A 3N05A 4RPFA 2O03A 2M2BA 1R36A 2OTLS 5EN1A 3KIOA 2WB1D 3G8SA 1FBQA 1Q8BA 2BHZA 2MZSA 4NZ0A 1U5TB 3HHLC 3BDEA 1UZDA 4TKTA 2CAJA 2CS3A 1TVRA 1UL3A 1IG7A 2BQRA 3J80Y 1NBEB 3ICLA 2YU3A 3P45B 1AA1B 1U8BA 3E0JB 4BHBA 1XQIA 3HB9A 4IRHA 3J80U 3AH6A 2CWKA 4NMLA 2FY8A 4IOBA 4K4XA 2BBEA 1U25A 5ILUA 4ECSA 5EG0B 4FQGA 1FOKA 5AIPA 3QPIA 4IO9Q 5DCFA 3CP2A 2RRNA 2R7TA 4NYPA 5FGMA 1O0PA 3KYLA 4CT8A 3CJKA 4ZHRB 1S0MA 4AQYJ 1VLYA 2DIVA 1KNZA 1W25A 4RZRA 1HNZJ 2CDQA 4Y3OA 2RU9A 3OL3A 2UXDJ 1RBLA 4N9IA 1HCRA 2GJ2A 4DL4A 1C0UB 2N7CA 2CPHA 2KKOA 3J80K 2YNGA 3TUIC 1AFJA 4NEYA 5FDLA 1LFBA 3WX4A 2CQ1A 3BY6A 5HMYA 5ETKA 4RU9A 5D4SA 1NK5A 1SANA 4HLXA 4OMFG 4ANEA 2HQ5A 3M32A 1EH7A 1GHCA 3BJOA 4RW9A 5D77A 1N33J 3QFHA 2YUSA 2D3UA 4J9RA 4DCJB 1VIXA 3VPRA 1XSVA 1F5BA 2MLXA 5HLTA 3BKUA 4CTAB 2XM3A 2DN0A 5E2QA 1S6UA 3M6WA 2KFZA 4I0WA 1HW8A 2LA4A 2ZZNA 4M5NA 1IJEB 4EI2A 5DQHA 1JMTA 2J6TA 3BR8A 2UVRA 1O4XA 1VRUB 2SXLA 1XR7A 2KXHA 4CICA 3OD2A 3G82A 2GMHA 2YWGA 3WTTC 2JRTA 2X6XA 2HZCA 3DHXA 4BDPA 2KYZA 3GBGA 4QWAA 3TP0A 2UVWA 1KN6A 2LKZA 4XRSG 4LQ9A 5L9NA 2MKSA 2B9SA 2P4WA 2M0CA 4YUDA 2FJAB 3NCRA 5A0YB 4F67A 2V8GA 4BCAA 3CUQB 5HLHA 4A8FA 3HSEA 4A8SA 3O44A 4OYZA 4CCOA 1FKPB 2LKSA 3BTJA 4JV5F 3IM9A 2NVTJ 2ASJA 5DYMA 2ZITA 2YKAA 3H9QA 2CQCA 3S01A 4BY1J 1S97A 5FB2A 2CPFA 1P9QC 4HKQA 1T08B 3DPUA 1YKWA 1WD6A 1T9XA 3PJ9A 3KNGA 4J90A 4UTGA 1S6QB 2AMCB 3ESWB 1WF1A 3R27A 4ICLB 4KKOB 3FMBA 1N33F 1CS4A 2Y8YA 4M5LA 4XKVA 1NXIA 1JXVA 4KIAA 5AT1B 3A1YG 2UZAA 1M5PC 3I87A 4A6DA 4PGGA 2Y0MA 2OPRB 1NB7A 3VR1A 3QBCA 2D69A 1X0PA 2DGQA 3TQ1A 5GMKa 1M1EB 4KSEB 3WBZA 1XGMA 2Q79A 2GHPA 3AAFA 3DRPB 2QG9B 3KJVB 5EWEA 3CF5Q 1EB0A 3N6MA 4ZOSA 3OMYA 1KP6A 3KLOA 1VQNS 5CCLA 2F4FA 1HW9A 1Y1VJ 5KFHA 2GO8A 5LD2C 1PIEA 4GKJF 2YPZA 2N7YA 2BW2A 1U6BA 2GVDA 5FLVA 4FYYB 4PGHA 1RAGB 3OYJA 5G4DA 1K0VA 4B3TJ 3RTVA 2JH3A 3TZXA 5F41A 4WF2A 2W2NP 2R8IA 3OLBA 1S6OA 4B9NA 2Z5UA 4CLZA 2VDIA 2PJRA 4PJNA 4DV1J 5BYQA 4JV5J 1KQ9A 4EUVA 1FBUA 2QQ8A 1APLC 3LL7A 2RJZA 2IAJB 2V4JA 3ECOA 1XG1A 3C3WA 4PUOB 1R4NB 5HLGA 2L7MP 5KFLA 2AEMA 4EBEA 2DT5A 3G1OA 4D3HA 1RKWA 3SQGA 1TK8A 3H2VE 3QIDA 4A8MP 4DX6A 3PW2A 3OTBA 2HFOA 5C42B 1NJZA 1F9EB 2L3MA 3ZO7A 3GG1A 1RP5A 1FKOB 2X1GA 5B1BH 2W7OA 4EJUA 2M8DB 4OOIA 3R5GA 4DXLA 4A8QA 3WQPA 4MLOA 3LSHA 3CC7S 3CVKA 3CDEA 4P5OA 1WJBA 3QAHA 3ENWA 5J2QB 3GTOJ 4RUHA 1IR1A 4RW4A 3CCUS 2VOOA 5LMUJ 4KIFA 2EEYA 2G1HA 1VNDA 4DR5J 4BYYA 4YOEA 2W4SA 3P5BP 3L7OA 1G8XA 3LSMA 2R7OA 2VQHA 2H4WB 3BQZA 3Q2TC 3AJDA 4L5JA 2E1NA 2UUBJ 4MFEA 2RN7A 1U1LA 1D5VA 4E70A 4OMZA 1OISA 4XQFA 3EVMA 4OZLA 2Q66A 2X1EA 4Q5SF 2GS8A 1WSRA 1UJ6A 4JI2F 2FD5A 2ICWG 3O8WA 2D2WA 4DPWA 5IYCJ 3CD6I 2QSGX 3PO5A 3N6NA 1TUWA 2OPTA 2JA8J 1QM9A 2QBYA 3SYTA 1JNRB 1FJCA 3QWPA 4LRAA 3ET6B 1IN7A 1B4SA 4C2MJ 1OJ4A 2HEKA 3ZQQA 2KYXA 2A3SA 2E5NA 3RYPA 3BM7A 1BIBA 4XRMA 3JRGA 3DOLA 3VYUB 1SJQA 1C1BA 3G6XA 4AIKA 1R6VA 5DM6Q 4X66J 3QIPA 3K8WA 3DEEA 3R0AA 2Z2MA 1KSPA 1UCNA 2NXNA 1OCCH 3FEYB 1FOXA 4F2RA 2EC2A 2QA4G 3R9LA 2ZBPA 1KOOA 3G6ES 2KFNA 3S8PA 2QGFB 3BTLA 1JKPC 3J7AO 4O3PA 5KT4A 2AGPA 3JTHA 4L3KA 1SJRA 4HF2A 3Q8YA 5DDGA 3JRHA 1Z1ZA 2P8IA 5FRNA 2PEXA 2V2KA 1TW3A 9ANTA 3JQKA 1R6YA 1Y7PA 3VF0B 4NEZA 2QV6A 1HNXF 3SDGA 2GLOA 2LP0A 1N5QA 4EO8A 4BDZA 4C2TA 2K4JA 4B3AA 5FO5A 1H98A 3ZTSA 2KG1A 2BANB 1X1AA 3LWLA 4Y52J 4KO0B 4BLGA 4LSLB 4DFKA 4QCLA 3SCLE 5L1IA 2VFSA 1QSYA 3HPOA 4ZPBA 1U1RA 4L3NA 3C46A 1H9GA 2VT3A 3EDRB 3X1LB 2X0LA 3C2BA 1LVKA 1YJNS 1J5EJ 5A2QU 3IKTA 2DHSA 2FD2A 1SD4A 5CHCB 1AU7A 4PUOA 2CQXA 3GIKA 1K78B 1I6HJ 2QZ8A 1EIYB 1R5HA 4PXEA 2MKIA 2ALZA 3E01B 1CQTA 4YB6A 1FXRA 2KI2A 4ZPWR 3RKQA 1HR0J 3TOBA 1WOPA 4DPXA 4QPQA 3FHZA 3RSNA 3I64A 2VPRA 2YKOA 1RWPB 4NCBA 2I1RA 5HBMA 4M5DA 1KQKA 3V4GA 2MA3A 2P8TA 4ZVSB 1XCVA 3W8GA 4DUYF 1HHTP 2M87A 3KLFB 2P6SA 2M4KA 3THTA 1TWHJ 1D0XA 4ZDLA 4EVIA 1U2FA 3J7YJ 5KHDA 4USTA 1P2FA 2DHHA 3HT3A 5HATA 4EYHB 2C28A 1E6VB 1FY7A 3KEYA 4LT6A 2FF4A 2H1KA 3KKFA 5HQMA 5LFAA 5I42A 3W5YA 1KQSR 1S72S 2H51B 3TW0A 3DI6B 4EM0B 1TKZA 1DU0A 2DGUA 3B02A 1UVMA 4OI4A 4JK1X 3D7SB 1BA5A 3M8YA 2ACMA 4YMEA 1DARA 2E29A 2WY7Q 2U2FA 2J5AA 2XB2D 1MDMB 3V6HA 3K2YA 4N47A 3NWGA 3DM2A 1J5OA 1FDAA 3V81A 5T7LB 3Q9VA 2P9CA 2RQMA 2L5QA 4TLRA 2UXCJ 1QVGR 5FKKA 4ELUA 2ZSHB 4YRVA 2XGEA 3N9UC 2QA1A 1NHVA 4F0HA 4Y15A 3BF4A 1J5EF 3JTGA 3PX0A 2XNQA 7AT1B 2WVBA 2OPPA 4PYDA 5EX3A 3MM5A 4B9VA 1WJ9A 3M2VA 5IQ6A 2OBPA 3HSDA 1D1AA 1AZSA 3UDLA 3D6TB 4V19J 3NKYA 3E2EA 3N01A 3ZXWA 4IL6C 5ITHA 4DR6J 3W9JA 5EGOB 1PGZA 3WGGA 1U2RA 2U1AA 5DLGA 2BOPA 3QQAA 3HOZJ 4UUXA 3BH7B 3RJMB 4YIRX 1PYSB 2HVEA 5H9EJ 1QQIA 3I9V9 4OLOA 4A8YA 4LF4F 2XSJB 3OYDA 1DGWY 3HM5A 1CJVA 4L76A 4E98A 3ZQIA 4B3RJ 2K3IA 2QSFA 2ILYA 1XMXA 3C6TA 5BYSA 1S77D 2HPMA 1SC7A 3DU5A 3ZZUA 1UVNA 2KL8A 3PNYA 2AEFA 1A9NB 3JYTA 4B02A 3G1MA 2FMYA 4FETA 2HRYA 4AUXA 1Z2ZA 2KPMA 1JE8A 5L1KA 4LVOP 4UOGA 5GMEA 4ZJZA 1WOOA 4LBHA 5HP1A 4L0ZB 1R0AA 4Y7NJ 4MIMA 3A01B 4WXHA 5HDGA 1PUFB 2KJWA 2D74B 5EYRA 3KUGA 3LGMA 1XD7A 3PO4A 1ETYA 3HOSA 4IOAF 1K8AT 4X4VA 1AROP 3UN3A 3MD2A 1J09A 1IM4A 2A07F 3KJFB 1WWHA 2C2KB 1F4KA 1F1BB 3BCAA 1LEBA 3V7CA 5ERIA 1XCBA 3HD2A 1U2CA 3G4SI 2HHUA 5I3UB 4B17A 2GWRA 3EUHA 3EPZA 3PW7A 2E7VA 4HA8A 3IN5A 3A0BC 2E44A 5IYDJ 1W5CC 1FT8A 3VOEA 2YR2A 2IS4A 4G12A 1JLQB 2ZHBA 2HW3A 3I6PA 4QJVA 4N8OA 1ZETA 2DO0A 2IS2A 1U2WA 1V6HA 5EDNA 2EI5A 5E3MA 2AQEA 5CVIA 3K4JA 2FIUA 3NGSA 3V6JA 3I58A 2VUMJ 1HD1A 1RWXB 4HNTA 1HL6A 4EU0A 2YKQA 3WTVC 1JLEB 3S14J 4RBVA 2JA5J 1UHSA 2VUGA 4S0HB 2F9JA 2CUJA 4CLWA 1HBMB 2AGOA 1JLFA 3UW1A 1ETXA 1VQKI 2B0GA 5A2QZ 1BW5A 4BGDA 1BL0A 1G7CB 4LLLA 1VOMA 5IOYA 5LSRA 5HVQC 3KEOA 1E0EA 4X4RA 1KOHA 1EA3A 3A12A 3M2UA 2J9DE 2BM1A 2W2PP 4DV2F 4UY8I 4JI2J 4KJZA 1YIOA 1JLCB 2ZH1A 2X7IA 2PE8A 4YELA 3CCRS 4I2QA 3M9OB 4KBIA 5C25B 1M5OC 2LVSA 1Q0NA 4CLYA 3TJ8A 4RLQA 1C0TB 2BEFA 4DYQA 2QIFA 1RBOB 2ZZTA 2L3DA 4DYCA 2CSOA 1M0SA 3IC1A 2XSJC 2UXNA 1JLFB 1QTNB 1UWBA 3DBRB 3IR5B 1LW0A 1UB9A 1R0AB 3NWTA 2WBMA 3K1NA 1LK5A 2VE8A 2C2EA 3DCFA 4P1WA 4DSFA 3ITHB 3K4MA 1EKEA 3EUHC 4C48A 2ZB9A 4ZPDA 4BQQA 4R0EA 3H5NA 4A8WA 5D8HB 2ZJRF 5KAKA 1HBOB 4RR5A 2BJ3A 3L7PA 2VKVA 1IGNA 1XTAA 3GSDA 1GK8A 1C0WA 3QZ8A 1LNWA 2Y69H 3R1HA 1QAIA 4KISA 4D9JA 1LQ1A 3DRRB 3G2XA 2UUZA 2VXZA 3H5AA 4KC5A 3GJTB 3UNYA 1L3KA 1OPZA 1F3VA 3C66A 1ZN2A 2GAGC 4OHYA 2LBFA 5IWAF 4EATA 3I0TA 1KLMB 2DMNA 2GA1A 4BBSJ 3CEDA 4LOCA 2JJ4D 3SDBA 5HS7A 3GFIA 4O3MA 2DCLA 3OTDA 4AVZA 1DTQA 1AZSB 3P9IA 4CDGA 5J4VA 4NLSA 2LTPA 3TVZA 1NJYA 1OCRH 2CGPA 2OHDA 2K3PA 3A13A 1SIZA 4FKYA 1FNXH 1Z3XA 2W2OP 1K61A 4OZ2A 1LFWA 4OYWA 3MZIA 2VG6A 2HKEA 5EF6A 3B6CA 2NYXA 2BQ3A 5T7LA 3S15J 3EDQB 4PWUA 1IBLJ 3C16A 4ASNA 1XMAA 5AE3A 1WELA 3IR6B 2RKHA 2PA3A 5H6QA 4P10A 2ZDPA 3G73A 3RW6A 2QWWA 2OKQA 4OV1A 2LRDA 3NS5A 4BDYA 3LO3A 1BR4A 1TAUA 1T8EA 3PR5B 5F0WA 4DUYJ 3CCSS 2A6MA 3CD0A 1HQCA 1MBKA 5GPCA 1N6QA 4XO0A 1FVSA 1XWLA 2HDWA 1XGNA 4DR1F 1G3SA 2ZUGA 3FZ2A 3LUYA 2NNNA 4L75A 1IBCB 3MR7A 1J9IA 3JTOA 3P9CA 1PDNC 3GF2A 5IT4A 2ZJ2A 1F9HA 3OUYB 4GKKF 1RISA 1HPZA 4IF4A 2J7UA 4BC7A 3OL9A 3D68A 4HHHA 2FOKA 4ZTJA 2YWWA 2I5UA 5IC6B 4M5JA 1HQEA 2H1YA 3K1MA 4B3SJ 1WEZA 3ZZZA 4UNOA 3TA0A 1S3JA 3HBLA 2Q1LA 4ZVFA 2BOAA 2DR9A 1VRTA 1MN7A 2JN6A 1IV8A 2QQ9A 1QY7A 3HUGB 4ZK7M 1REPC 2YX7A 2DOEA 4FBTA 1FRIA 1VDHA 2BY1A 2APOA 1RU2A 2I6WA 1ZG1A 1B8IA 2WONB 2VA3A 2CQKA 3FEZA 2LXIA 3NBPB 2VBZA 4KV8A 1R8PA 2DGWA 4CO1A 3H5RA 2XB0X 3ZMSA 4R79A 2CIMA 1NPPA 4FXDA 4G65A 1V3FA 2HR3A 1O6XA 3PIPQ 2OJ3A 1IKWB 3MECA 3HO1A 3W5ZA 3GTGJ 4LIWA 1JUSA 4YG2F 3G9CA 1R5GA 4F25A 5C5JA 2FOWA 2V2ZA 1VQ9S 1S72I 2BXYA 4IDKB 2ME6A 2YNGB 2BGCA 3HZGA 4FYWB 1YQAA 3RGIA 2AV5A 4A3BJ 2PD1A 2B6AB 2OEMA 2OEKA 4OYOA 1T6SA 4ZYDA 4H4KA 4B3OB 2YKNB 3OLAA 3NAHA 2XCAA 5KG6A 2OQRA 1T0TV 1FWLA 1AUSL 4ID8A 1WPKA 1VZ0A 2IJNA 2WK4A 1Y5NB 3HOYJ 2QQBA 2O7OA 3PVXA 4FASD 4RBOA 2OFHX 4PG8A 2BEOA 4IHWA 2D45A 3BBCA 2F63A 3NGRA 2E2IJ 1GFWB 1FRJA 5B0CA 1U1QA 2YXLA 4TYBA 4M9ZA 3CJRA 1NEEA 3UE2A 4YB5A 3BR0A 4D0PA 2XWXA 2R0QC 3UD5A 1S1VB 3H9JA 2MGZA 4ECWA 3J81Y 3MCZA 4O4GB 4NLWA 5IXUA 3Q8SB 1LE8A 1T9YA 2AO9A 1FJ7A 1MSEC 1YO5C 5LSOA 3QJLA 2XHCA 3KP2A 4ENNA 1FFSB 3JQJA 3M4OJ 3CMAI 1BGXT 3KLNA 5A6PA 1CJTA 3NEKA 4PG4A 5EUHA 5ADZA 4IOAQ 5HJXA 1HLWA 4IRKA 3EVOA 3LH2S 2FB0A 2LF7A 2GIZA 4JUZA 2OQGA 2RV8A 1RUSA 1Y6IA 1TNTA 2DMQA 1IKYA 3ZZTA 2HQAA 4ER8A 2QA4S 2GOMA 4RX6A 1N54B 3IBFB 2K1RB 4UVAA 1SPBP 2ZH5A 2E5IA 3CCVS 2HK2A 3GLJA 1FP1D 5HQ8A 2HNHA 2ZJQQ 4EJWA 4C9DA 1USTA 4CCLA 3LAPA 1O57A 4ED1A 1YJWS 1V5GA 1Q79A 2RDIA 3ECHA 4Y4RA 1LFPA 1GV2A 2XMJA 1WACA 2P2CB 2DDAA 4ENJA 2HAFA 1QUVA 1Y5IB 4LLNA 2CFXA 4MIBA 5M5XJ 1O7LA 1NUEA 2X1DA 1P6TA 1UZHA 2XAGA 2W9AA 1MH4A 1RLDA 2LH9A 2VIHA 2PJRB 3CC2I 2I10A 3WGHA 2VLAA 4ECRA 3TR5A 1S9HA 1X5PA 2FX0A 5CXTA 1ODDA 2XY5A 1S9EA 1S9EB 4LJZF 2F7VA 4A5MA 3QRFF 3PL8A 4DBQA 2CV0A 4XOTA 1KVKA 2QL5B 4KN4X 2RNEA 2V69A 1UG2A 2VZ9A 3M9MB 3GV8B 1S0NA 1XDUA 1F6TA 3GJQB 3F8FA 2BKPA 2E1OA 4YHHF 3HD1A 4KN7X 3AL0B 2I8EA 4DL5A 1YI2I 3MQ0A 3LFUA 4L9VA 2IM3A 2HPIA 4ATNA 1R22A 4KDPA 1T95A 1FEHA 5B0GA 4K0KJ 2A3JA 4P73A 3BZQA 2BR0A 1LKXA 4XIDA 2JZ5A 2LU1A 2BJEA 1F9NA 3WTWC 5C42A 3FF5A 3JAMY 1CLFA 4DV4J 4U8YA 1ENHA 2WVCA 3F73A 3PYGA 1H72C 2L9RA 4Y3CA 2C3YA 1W2IA 3OIPA 5ICFA 1JJHA 1XX5A 5HSPA 2E36A 4CLTA 1TQPA 3FEXB 2DT7B 3K4KA 3CD6S 2RQ4A 2ZKZA 3HVTB 2BRLA 2DNQA 2MMYA 1ORKA 4U96A 5I4MA 1MMGA 4KPYA 4DJBA 3CJQB 4C8KA 1S79A 1VBYA 5LHHA 1H0MA 5SUHA 1SMTA 1SXLA 1GVJA 2X3GA 5K7HA 2D1CA 3PUFA 1IV6A 5JFRA 3PG9A 4PQAA 4BE1A 1IWAA 3OT9A 3FXRA 2G0IA 1W0UA 3N5FA 4RUAA 4I7FA 2JLFA 4ZVPB 1TW2A 1JT6A 3FXLA 4J7CA 4TQSA 2DQRA 4JX4A 5EWGA 1HQ2A 3GLXA 3BQYA 1BLUA 4NQWB 4JYKA 3C6UA 1V5IB 5D6EA 1LWFA 4CRJA 2XGCA 3NS6A 4F8RA 3DN9A 5M3FJ 3AQOA 2OH2A 2C3MA 2PJPA 1QPIA 2P9EA 3T5KA 3HI9A 2CKWA 2XMTA 2EWHA 4GRSA 4RU2A 2F2EA 1RGVA 3DRSB 1R7JA 4R8HA 4OJ1A 3DYAA 3TVYA 1N75A 4QWBA 3L2UA 5B0DA 2OGUA 3V6DA 1D9DA 1MROB 4DHVA 2K86A 3ABKH 1DAXA 2J9CA 1SC3B 1SVMA 3E5QA 1I3QJ 1S4FA 1RXOB 2XS2A 2XAUA 3AD7C 1UVJA 4GC7A 1HMVB 2ZXJA 3FDYA 1OPIA 5L39A 1R49A 2ATLA 4Q7AA 2R7FA 1H38A 1JK9B 4PWDA 4ED8A 2ZMEC 3LAJA 3CC4I 3NCPA 2ZJPQ 3VWSA 2DA3A 3CD7A 4DG1B 4Y6IA 1RZ4A 5A8KA 3V4MA 3UN5A 4XKWA 2W4DA 1QTMA 1RR8C 2ISYA 5KOWA 2ZNZA 1JWWA 4WCEQ 1RNLA 3VGSA 5KFAA 5B66C 2V1UA 2ELHA 2VN2A 3CJKB 2VFVA 3OL8A 1ZARA 4XIUA 3G82B 3GMGA 3AD9C 3HTSB 2ASYA 4GRIA 2L48A 1IRFA 1NZAA 1BI3A 5KFVA 3BG6A 4KMFA 3RPQA 1PILA 5IT9U 3M1CA 3SSQA 1JKRC 2M1BA 2VDHA 3TJ9A 1UZCA 2F5EA 2NPFA 4ZLLA 4DL0C 4LG3A 3R7SB 4OAYA 2BE2A 4PRFA 3MXHP 5U47A 1MMSA 1HARA 1J75A 2FHJA 1Q1VA 3BQ1A 3UD4P 3ZNUA 3GFYA 3GPAA 1QRYA 9RUBA 4DG1A 4DLEA 5KNLA 4DBRA 1BW6A 1ZKGA 3HJFA 5CD4H 1SFXA 1JUMA 1UJ4A 2XAFA 2YPYA 4K4TA 3GTYX 1IF1A 4HF0A 4ECQA 3TO7A 1IKXB 3AFGA 1ETKA 2D9OA 3EZOA 3U02A 1N6QB 1GX6A 2FVQA 4BEHB 4YR0A 1LWEA 1LB2A 4EGZA 1NHUA 2MQPA 5F9LA 1VQOS 8RUCA 4LRFA 3KTQA 4Y33A 1ZAOA 1EHWA 2R5YB 3FMSA 1XTZA 1S9FA 2R7VA 2R8GA 3OPKA 2MEWA 2B8QA 2B43A 1VQPS 2QSHX 1T9VA 3K5MA 1XSXA 4N0BA 2RRBA 2DYSH 5F3ZA 2M88A 3BR6A 2GNKA 1OQ6A 1SFOJ 5HLFA 1HKQA 2NCKL 3CGIA 3KK3A 2FHOB 2KIUA 1HBUA 1N48A 2BABA 3JQMA 1WEYA 1VQ8S 5ICCA 5DRKA 2DR6A 1HYSB 3CMMA 3OS2A 5EEGA 4CXFA 1T38A 5DUKA 3OFGA 4B3MF 1K79A 2DPUA 4Q45A 3CULA 1Y39A 3FCHA 4E4HA 1K6YA 1X4GA 5D5WB 2LQ5A 2FY1A 3HDSA 5L3BA 4ZPAA 1P7JA 2WY8Q 1TWCJ 1D1BA 2A6HF 1UHMA 3FISA 5K9FA 4BNCA 1JJ8C 1FPQA 2J9EA 1HW1A 3IR7B 4U95A 1NK4A 2Z9OA 4DUZJ 3ISND 4FKXA 1HQUB 3NGUA 3MCMA 1QHHD 1OSDA 3M30A 1TK0A 4EEFG 1P4XA 1S1TB 1KWMA 1JUPA 1JLGB 2J0SD 3MUVP 3RRKA 4OJGA 4NI2B 2UZKA 3VEPA 3FIWA 2JPBA 3GTMJ 1TL7B 2HQ3A 3K70C 3MEEB 5KVRA 1L3SA 3CO0P 4PAAA 3RZDJ 2DH7A 2FC9A 4BAYA 1R27B 4WFYA 2OU2A 5TGTA 3QYBA 3KLFA 3MM6B 2A18A 1XMQJ 1W4MA 3CCJI 3I4HX 3VGVA 2E5ZA 3FQKA 1N25A 1YZ6A 1X9SA 4KHMA 1FIAA 4K0KF 2JLGA 1TKXA 2KU7A 1R7IA 2C2MB 3DFEA 2G13A 3MZ8A 3FKJA 2COBA 4P2SA 3KLEB 2M4MA 1OYIA 5IT9K 3H8YA 5CJ9A 1IN5A 4FS1A 3LSKA 4FF2A 5HS8A 2DQLA 3NMAA 1IUFA 1UW9A 1AB8A 1LPQA 2QL9B 2J0WA 3LP1B 1P4WA 4XM3A 3CDIA 1XIQA 5C24B 4I0BA 4UQTA 4Y00A 1HOMA 2E9ZA 3QATA 4NB5A 1EH6A 2Z57B 2OC6A 3KYCB 3VHQA 1B64A 2XY6A 3RBDA 1R1VA 4DUZF 4HW0A 2KJCA 5ICGA 2W84A 4NA2A 4C0OC 2MPUA 3EICA 4J9NA 2PDAA 4O0IA 3M8WA 2A61A 2B4UA 2FPHX 4OZ1A 4OX6A 3TWZA 3MEXA 2JVRA 4M94A 1F1ZA 2M7BA 4GKJJ 5F8GA 1O5JA 2NXCA 1ZAVA 3MPVA 2XC7A 2I9SA 1JLBA 1EF4A 1J59A 2HVHA 4C3JJ 1PP8F 2PMWA 4RW4B 2I8DA 4TYAA 4E7ZA 3HZEA 5IOZA 2C1EB 3PY8A 3AKZA 3OSFA 3IUOA 4LR7A 2R2RA 3AXMA 4U87A 5KG4A 5ETMA 1ZYQA 2DIUA 3HRSA 1WC4A 3CJ0A 5DDPC 2F5CA 1KEKA 4XTTA 3BR3A 3R2CJ 5KFIA 4U0VA 2RILA 2LQ9A 2FUG2 5D5UB 2F65A 3Q8VA 4LF6F 3ERMA 1NSAA 3ILJA 4DEZA 1GXTA 3GYHX 1RTHB 1IRZA 4J9UE 5M5WJ 3WHIA 2O3FA 2H5JB 2C3PA 4OYBA 4J9QA 2Q0OA 2PI4A 5LJ3Y 1FT9A 3KCCA 4BS2A 2K5CA 1STZA 5LT5A 3I55I 4HNVA 4C8MA 3M8PA 2GM4A 1RIOH 4V19X 4BHCA 5JI6A 1EZZB 1SB6A 5BOXA 4URSA 4FF3A 1H2TZ 2YKNA 4C0BA 1IVZA 3QSYB 3ZN0A 1T11A 1SAXA 2J76E 2ZFWA 1VLOA 2ZE2A 1T03A 5E5NA 2K4BA 4RAFA 4XK4A 3FCVA 1N5SA 3FMWA 4AT1B 2VJVA 3TDUC 3CCQI 1S6PA 3P5TL 2BJ8A 2BVMA 1X5TA 2R7ZJ 3J7ZT 3E3VA 1RT3B 1HSJA 3HRMA 2HQRA 1Q1KA 4L9TA 1Y00A 2IRUA 3U9GA 2JA7J 3AG4H 1VQYA 3MD1A 3N5BA 4M73A 3KZYA 4F04B 3FMQA 3V81B 2AJ1A 2BHYA 3HKWA 4HDHA 1Z77A 4KH1B 4MIAA 3S2WA 3RR8A 4F4XA 2YPRA 2HBZB 1T0FC 1TL5A 3CDHA 1R1UA 3SHFA 2M5YA 3IWZA 3W5XA 3PX6A 1X4AA 4I2PA 3DBHB 2V4JB 2CFOA 1RT7A 5E3QA 5F8HA 4X4UA 5JVTA 4O5VA 5A8WB 4BEHA 1VC0A 3PEHA 2R7DA 3UKGA 4F3OA 2G9WA 3IRXB 4DR2J 1XGSA 1OY8A 3OTOJ 4HTJA 2K06A 4S05A 2EH3A 3TJAA 5K8MA 1K9MT 4DSIA 3QU3A 2BV6A 3AB2B 4OIQF 5EZHA 2GVDB 4K2EA 3MUTP 4KFCA 7FDRA 1IN4A 2MW8A 3W2VA 1I27A 1KONA 3VYTB 4OI0A 2UVVA 1U0HA 4LRBA 2O8KA 1RHKB 2IGNA 1S7AA 2Y30A 4LMYA 4OI3A 3WTYC 1HNXJ 2K40A 3GG0A 3N28A 1FTRA 5FROA 1U9NA 3DKDA 4K4YA 3HDDA 1GMUA 1RTIA 1F43A 4I2PB 2ZH7A 4C4WA 1LXNA 1I6XA 2VKDA 5EX0A 2XKOA 3IM8A 3C3LA 5D0GA 1ZREA 4QIFA 2FGOA 3CZ6A 3OR1C 3V42A 3POTA 1TK5A 5F1RA 4HLBA 1BI1A 3HVRA 2I5JB 4YEJA 8ATCB 5CD4A 4XN3A 4O4RA 2RSQA 4QYRA 5AONA 2ACYA 4XLCA 4B3MJ 3MUMP 1NB2A 3ZQHA 1XMOF 3T1YJ 1E17A 4CO4A 2PFDA 3RKXA 1IN8A 4X4QA 5DCMA 4RB1A 3FFIA 1Y4ZB 1E3HA 3BSNA 3MKYB 3TDZC 1UJ8A 4RB0A 4P74A 3BGRA 5B1AH 2XI3A 2KB2A 2VB6A 3VDXA 2RRAA 5FKLA 5FKNA 5F0FA 5J1UA 2K2PA 3K4LA 1FWZA 3QODA 2X6WA 1T03B 1N0UA 3NWRA 3MPUB 4DPUA 4W90B 1KDNA 3HFVA 2OJED 2AJFE 2BJ1A 4EJTA 4RWXA 1RQ0A 1S12A 3N6LA 1APSA 4MEYF 2V67A 4GGGA 3CUOA 4HT7A 1YW7A 4YY3F 2VA2A 2JL9A 1GT0C 5T14A 1JKHA 3CMQA 3HOWJ 1KZHA 1MWZA 1Z2LA 2QKMB 1PJ6A 4CCMA 2FQQB 3H5YA 3TI0A 4AE5A 2L54A 2R42A 4JI8J 1A31A 4UB8C 4IO9F 1TUGB 4GO7X 3QLHA 3EUAA 1QJHA 2F5GA 2H9ZA 3ZMTA 4C0HA 1RADB 4RS8A 2V7FA 1VQ7I 1BQMA 3VQSA 1SV5A 1BY9A 1H74A 1TKDA 4OX7A 1QD1A 4IHVA 2GA2A 3HVAA 1JKQC 3PSFA 1T56A 3JRAA 2V6AA 3KX2A 4I7FB 3OHAA 3W2WB 1ON1A 2FJVA 2JJ7A 4NLXA 2BYVE 2XRLA 2KRHA 2KTQA 2NVQJ 2NXEA 2HOAA 2BVLA 4KGXB 1RTJB 2B7CB 2LNBA 5AJ3J 1YJVA 1PP7U 2BXZA 2FNAA 2CW7A 1YYVA 5C4XJ 3Q9SA 2AYEA 1QVTA 3BGRB 1PUFA 4XLNF 3ZPLA 3LWFA 3DOLB 3IA0A 2CVEA 2QMXA 3MFIA 3MVPA 2JUGA 4XDCA 2C2DA 4B3RF 5HP1B 4FXWA 3DDIA 3BP8A 3PJWA 2WA0A 2ERRA 2WOMB 3OV8A 4UUSB 4LITA 1KC8T 1FK9A 4DN0A 4KGVB 4A3IJ 4WWCA 4NQWA 2Z8QA 1X1CA 1DHMA 2DISA 3D67A 4Z2XA 2NOGA 2OTJS 2RUSA 3ULHA 3TKYA 1JLQA 1RTIB 3CC7I 4HL9A 4JI3F 4L5EA 1RR7A 3Q0VA 1RWWB 2NLWA 3LNQA 5JVGQ 1F5AA 3L2QA 5I3UA 4HDUA 1FEEA 2HS0A 4QR1A 3J81K 1ZG3A 3I53A 5IP7J 3PKYA 1S59A 2BJ9A 2VIXA 2CZ9A 2R5ZB 2JHEA 4ENKA 5CH7B 3UWTA 2CPYA 2GZWA 1NHKL 2OUGA 1R6RA 3D1OA 2MABA 1RRJA 4HI2A 2DK2A 2KDZA 3CDWA 2DMTA 3CXCR 1QDUB 1H7XA 1FOYA 2ZXWH 1RT1B 5IYBJ 2JUCA 4KIBA 1SJ3P 4USHA 3MAHA 3OY9A 2QLXA 3GIRA 2VASA 3LPEA 1WC6A 1MU2A 5E18F 1AKHA 3IRQA 1FKOA 3OTEA 2B56A 1RABB 1ZELA 1WKKA 2HQFA 5D4PA 1PAEX 4WXOA 4NXNF 3W62A 5AE1A 4CH7A 2KM8B 3JSYA 1UETA 4RJVA 4I68A 1TZLA 3IAS9 4XLAA 1OS5A 4KKOA 1M5KC 4Q2MA 2EPFA 3KPHA 3FXKA 1RDRA 2FZCB 4B3TF 4I09A 2EKNA 1ZBTA 4WXDA 4A4JA 4LF2A 2V50A 3HOUJ 1WUUA 3ZR8X 1GMVA 3TZYA 2F5FA 3JSOA 1A5JA 4H0EA 2BE5F 2MGQA 2Z2SB 2MKCA 4QW9A 3KP6A 3Q86A 1FSHA 4B9MA 4PWWA 2GFFA 3O6BB 1FRHA 2ZMEA 3FSIA 2XMWA 2WB4A 4WJBA 3H5SA 2XY7A 1IXKA 1CJKB 2FU4A 1P7IA 1YDLA 2O8XA 4OI2A 3CCMS 2YX1A 4KFBA 4Y13A 4YDDB 3FX3A 2WW4A 3PFYA 4JI6F 3LW5C 4NC8A 1RACB 1VRUA 4WP9A 1RHRB 2EK6A 2DBBA 4DR2F 4TVAB 4EJOA 5ETNA 3V8KA 1VFCA 1Z3YA 5EGYA 1QO0D 4JYAF 1KQGB 3MAQA 3EUKL 1RTHA 1CQNA 1LV5A 1VHIA 3EGNA 2R5YA 3DLBA 4BXXJ 4LSLA 3IS9B 5LEJA 5BR8F 1U4BA 3I0SA 2RS2A 1NZ8A 2G2YA 4IG3B 2EIKH 4FX0A 4BKXA 1X4CA 3GV7B 3JAMK 1FA0A 4ZJLA 1K0TA 5KT6A 3I82A 4HACB 1Y10A 4BQOA 3PFOA 4JX5A 3JRBA 4UT4A 3OFEA 2W7PA 1ZRCA 3UI3A 2UUBF 2O3DA 2XAQA 1WSUA 5A0YA 3WZ0A 5GAEJ 1A7GE 3CDBA 2YQ1A 2H1LA 2ZJRQ 2HAIA 5DUIA 1TLHB 4USJC 1U6FA 3H5UA 2ZXHA 1NK3P 3HXMA 2FBHA 2HG4A 4XSXF 2WHOA 2AD9A 2IAIA 3M6XA 1B3TA 1T2KA 4L6V3 2W7NA 4TY9A 1ZRFA 4FE4A 2QL7B 2ZH8A 4P75A 5IOLA 3M8QA 3M8QB 4FS2A 3G6EI 4Q8FA 4U7UD 3I54A 4L73A 1NJWA 2GVZB 2UUWA 2ZC3A 2W9BA 4DFMA 5E3NA 1NHAA 3E5XA 1HKAA 2XUBA 5H20A 3HHLA 4KFBB 3HLUA 2QA2A 4YN3B 4JYAJ 1NRKA 5B7WA 2MQNA 4P2MA 3KHLA 3FSXA 2KRFA 1WC3A 4ZPCA 1T3NA 4QBUA 3WTZA 2L4AA 1HA1A 4DR1J 5KFXA 4IRDA 3ZMZA 2LU2A 2VFTA 5KFEA 3M3YJ 4C11A 4EGYA 1RT2A 2KT5A 2VL8A 1B7FA 5DGAA 3UR3C 3Q2SC 3WIUA 3TX0A 1Q95G 1SQFA 2DD8S 3HEFA 4OL8A 2FA5A 1P9YA 2C22A 2DPDA