4PCQA

Crystal structure of mtbaldr (rv2779c)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
ELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Possible transcriptional regulatory protein (Probably Lrp/As
publication title Crystal structure of MtbAldR
rcsb
source organism Mycobacterium tuberculosis
total genus 31
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pcqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pcqA02
3T1BA 3QOPA 3DXJF 3MCZA 4ESFA 3C18A 4WXDA 1FSEA 1JE8A 2E7XA 5K5RA 1Z7UA 4GCVA 4HX8A 1XCVA 4UXNA 4CXFA 1FBQA 4KMFA 3GO5A 1Q1HA 2D1VA 1BC8C 3BDDA 1IXRC 2XAGA 1TNTA 1P4WA 4RAZA 1J59A 2F5CA 4M6XA 2ZFWA 3WU0A 4AIKA 3JTGA 4OMYA 2OZ6A 2OD5A 3CJNA 3GZ6A 2BGCA 3KEOA 1UCRA 3T8TA 4A2UA 2FNAA 3F23A 1IXSB 1XSXA 2PEXA 2VOPA 2EK5A 3U1DA 5F1RA 2OA4A 5AONA 2FE3A 1ZLKA 2V1XA 2FEZA 1EH6A 3RYRA 1R22A 4HDVA 2P4WA 4YFKF 2CVIA 5DD8A 2KIUA 3ABUA 3I0TA 4OIQF 4MQ9F 2K27A 4BH9A 2Z33A 1TBXA 1YTYA 5K1YA 2A6HF 1XGOA 1QZZA 3O3KA 1FC3A 1GHCA 2XV4S 1CF7B 1RZ4A 3PQKA 2ZXJA 2V1DA 2E1NA 1XD7A 3T5XA 4EGZA 1HBXG 1Z6RA 1O57A 3LFKA 4HQMA 3HRTA 3VB2A 1QPMA 1HW1A 3VODA 1D8JA 2M5WA 4HX4A 1G3WA 4HLYA 1XSVA 5CVRA 2PLYA 1L3LA 2PJPA 3V8KA 2L3DA 2RN7A 4AWXB 3K1MA 2W84A 3V4GA 1PDNC 2Y75A 2NNYA 3D5LA 1ZYRF 1R5GA 2RKHA 3NEUA 1MDMB 1ZN2A 2XAHA 4LJZF 4BXUA 2FRHA 2DPUA 2ESHA 2VN2A 2H94A 3CDHA 2FSWA 2XIGA 1SFUA 3LA7A 4AIHA 4UVAA 2EFWA 1MJBA 2MH9A 1R23A 1W7PA 3QP6A 3P7NA 1XB4A 1XDSA 1S29A 4BAYA 5H20A 1MJAA 2O03A 2FA5A 1ZRCA 1IZ1A 4G6DA 4U0WA 3BY6A 3WTVC 1LDDA 3ECHA 3MQ0A 5DUIA 3MWMA 3WODF 2XKPA 5CLSA 1YLFA 3KP6A 2W24A 2QQBA 3I5UA 5L3FA 2V1UA 5IT9Z 2MD5A 1IN6A 1ON1A 3MFKA 2O61A 4UVBA 1LEAA 5E1WA 2G7UA 2HYFA 4B8XA 3L7WA 3DPTA 1GXPA 3P9CA 4WXCA 3R0JA 1ZARA 4A5MA 1DPUA 1ZG3A 4PGGA 4HAMA 5D4RA 2UXNA 3RDIA 4OINF 4ETSA 3BWGA 4OIPF 3F8FA 5BOXA 4L18B 4L0ZB 2GA1A 2DJWA 2HFHA 3VOEA 1X3UA 2ZMEA 4I02A 4Y17A 5ILSA 2IPQX 1K6OA 3MAJA 4A12A 4HLXA 5D5UB 4N0BA 2QBYB 4EJOA 4UUVA 1SMYF 5HDNA 1ZG5A 3FF5A 2L02A 5AIQA 2M45A 4EJWA 4O6JA 3HIFA 4UVCA 2P6SA 3K9TA 3GEZA 2LKPA 1FWZA 1U78A 3IRQA 4LFUA 5H6QA 3B73A 5E8GA 1OKRA 3GYHX 3O6BB 1XMKA 1BM9A 1KGSA 5DEQA 4QLCU 5DCMA 2QZ8A 3LQRA 4EMSA 3EQLF 5KVRA 2RNJA 4KNYA 1E2XA 2BE5F 2LDUA 4KN7X 5BPDA 2V6CA 3H92A 2DQLA 2Q2EA 1YYVA 2AS5F 2HKOA 5HS7A 3FZVA 1LEBA 1J2XA 5ICEA 2ACJA 4BHCA 4ENJA 3ZMVA 2XHKA 3HTSB 3F22A 3FM5A 2HOEA 4LB5A 4IRHA 1R00A 5CVUA 4CGZA 2ZNYA 2FQ3A 4IF4A 5DV5A 2DAOA 1ONVA 2FXAA 2IW5A 3EYIA 4KIFA 2VC0A 2IA2A 1QO0D 2XAJA 2KRFA 1MKMA 1Z91A 3I59A 5D6EA 3NRVA 3CUQB 1R36A 2ETHA 3C3WA 4RB0A 1GXQA 1BOAA 1I5ZA 3M7GA 2ZKZA 1D3YA 1TW2A 3F3XA 3G73A 1XGNA 3EDPA 2PBIA 3GFMA 1FBSA 5KK1A 2QQAA 4IRIA 3GW2A 4OU0A 3CLOA 5CYVA 3HSRA 3GXOA 5LGTA 1O7FA 3U2RA 1S7AA 3RYPA 2GQQA 1MD0A 1FBUA 5FD6A 4KUMA 2VBWA 4EVIA 5D8LB 1DP7P 2EV5A 1LB2A 1T98A 2VBZA 2DQRA 2GXBA 2EJRA 4P9FA 2HQRA 3KETA 1TTYA 4P55A 4LMYA 4M9SA 5IT9K 1ZGJA 4GGGA 2DK5A 3DV8A 4LGWA 4UV9A 4M71A 3QPHA 1AWCA 1QGPA 2P8TA 1BJAA 1TW3A 3WGHA 1V4RA 4HV6A 3WU1B 3N4MA 3E3VA 3ZQ7A 4G7OF 1P4XA 3FX3A 3F8BA 3LA3A 4EQQA 4GO1A 2IVMA 3FXUA 2KIMA 1VTNC 3K2ZA 3OV8A 1SAXA 3ELKA 3WTWC 3WGIA 2XRNA 1YW7A 5D8KB 3W6JB 3RPUA 4CZZA 4LK1F 5L3DA 4G6QA 1FP1D 5LRSA 1IN8A 3KP2A 4OOIA 4KIGA 3EUHA 1Z1DA 2VT2A 2MLKA 4M73A 1PUEE 5HS8A 3KLOA 4RB1A 4H0EA 4QWQA 1BIAA 5E17F 4D0PA 4XLPF 1KYZA 2BBYA 2DTRA 4AD9A 2HQNA 4L5JA 2ZNZA 1DPRA 1DUXC 5JI6A 3Q5FA 2FMLA 4P9UA 5BQTA 4L9TA 2YX4A 3J81Z 3FWEA 1BI0A 2QLZA 2V9VA 3K1NA 2K4JA 2Q0OA 3WTTC 1I27A 2EFPA 1ON2A 2VODA 4I01A 3E5QA 3V7SA 3F72A 2RQPA 2QQ9A 2IA1A 4N9IA 3TDUC 4XSXF 2DO7A 2P7VB 3FM3A 1Z6TA 4MQVA 1ZHFA 2MH2A 3MEXA 2FBHA 3CO6C 1IW7F 4CYDA 5CVVA 4IJAA 2OQGA 2IP2A 5HS9A 3RJPA 3HRMA 3IWZA 5AIPA 1IN5A 4ASNA 4BNCA 4UV8A 3EYYA 2A68F 2A5YB 4M72A 4HF2A 3O2PE 2UWMA 2KKOA 1K7AA 3ZP5A 2VOOA 1JHFA 3ECOA 5ICFA 3AAFA 4G9YA 2NNNA 5DDGA 4ESJA 1D5VA 2Y48A 2EFNA 2HTJA 1FOKA 5E1XA 4Q5SF 3TGNA 3KFWX 4OIRF 1FNNA 2ZCWA 2KJCA 1U6GA 2OZUA 1ZG1A 4EJTA 4GYIA 5LHGA 5FB2A 1U5TC 2FBIA 2VE8A 2VBYA 2F5EA 1HKTA 4A5NA 1OMIA 4MEYF 4MHGA 2O0YA 3HSEA 4FX4A 3GWZA 5D4SA 4KFCA 1XMAA 2CGPA 3JW4A 4HQEA 4HF1A 2K86A 2MBFA 3E5UA 2LF8A 4Q4ZF 5J8FA 2QUFA 2RC4A 1PP7U 2GXGA 1P92A 4KIBA 2EV0A 2JRTA 4YIIA 2PMHA 4ZYEA 3RIRA 3RPQA 1F1ZA 2ISYA 1UHMA 4BHPA 4YFNF 2L54A 3FXQA 2VBXA 5JFRA 5HVQC 1OPCA 1K79A 4NHJA 3KZZA 4WCGA 3DEUA 4CICA 2RGVA 5K5OA 1UFMA 4LK0F 5D6FA 1SFEA 2K7LA 2RVCA 2UXXA 3BJAA 3SXYA 3HRSA 2STWA 4S04A 3HRUA 5LLQA 5ICCA 2CO5A 2DT5A 1IXCA 3CUQC 4U7BA 3TOAA 1O3RA 4I2OA 3GFJA 2YSRA 2VE9A 4MGRA 3F21A 4IVNA 3ERED 1YQAA 4CDGA 4Y13A 1PP8F 4S05A 4JK1X 1STZA 1RUOA 1B9MA 2YU3A 5F6FA 3DPLC 2RDPA 5BPIA 1SD4A 3FMRA 2EFOA 2HZTA 1F5TA 4P96A 4XSZF 4R8HA 2R3SA 1OR7A 3J81K 1KYWA 2B0LA 3U9GA 1G3TA 1XDUA 3GUDA 1F9NA 2JSCA 3ZMSA 1RUNA 4ON0A 2JSXA 2HYGD 1K78B 2NRAC 4WK8F 1ZRDA 4ENNA 3N97A 2GWRA 1W7PD 1YW8A 3QPTA 3F6VA 3HSFA 1QBJA 1W5TA 1YFHA 3C7JA 1LJ9A 3E6DA 3D0SA 1KU3A 2EV6A 4P5OA 4KDPA 1W7PB 4ENMA 2F5FA 1R1VA 3E6MA 5J8CA 2VXZA 4BYYA 4GXOA 2O8XA 5DCFA 4XLNF 5TJJA 2EB7A 4LG0A 1HQCA 1BI2A 2JZYA 2MA3A 5J6XA 2GZWA 1W4MA 2M30A 3TO7A 5DUKA 1U5TB 2J5PA 2BEOA 2A6EF 4YIFA 1XCBA 2IA0A 4RGRA 3ZMDA 4CO8A 1WKMA 5ED4A 2NYXA 4KN4X 5K5QA 1TQIA 2RV8A 3GLXA 4I98B 1FX7A 3ISPA 2UZKA 1HW5A 2WTEA 1H9TA 1A04A 4B09A 3KEQA 3LWFA 1NHAA 3W6KB 1G3SA 2H27A 3HTUA 3RTRA 2EA4A 2CYYA 4ZZDA 4HA8A 3IKVA 4MNUA 3LSTA 5FGMA 3V7RA 2ADUA 2ZMEB 3ZMUA 5EEGA 4I09A 3R0AA 1T39A 3GVAA 2XASA 4IRGA 4IHSA 1UHWA 4R1HA 3ROUA 2LNBA 2XGXA 1QZYA 3QRFF 4Q47A 1YS6A 1G3YA 2EFQA 3QAHA 3R4KA 3CTAA 2VT3A 1YO5C 3COAC 4HOBA 1ZAOA 1KQ0A 3Q9VA 2YPRA 1TNSA 1SD6A 3SFZA 2O3FA 3M8FA 3KP4A 3E6CC 3V8JA 1I1GA 1RNLA 1F4KA 4KMUX 1IRFA 2CG4A 4A6DA 3ZN1A 1P4AA 4M9ZA 3FHZA 4XBFA 1FP2A 2GAUA 2LF7A 1O7LA 4G7HF 2JPBA 4EGYA 2QENA 5F64A 2MLGA 1R1UA 1EV7A 2HWVA 2DFIA 1HXDA 1FYLA 4LB6B 4GYGA 1KQ8A 4M6YA 3V7CA 2X4HA 5LHHA 4WF2A 4AVPA 4F7ZA 1S7OA 2HGCA 4MEXF 4L5IA 5LHIA 2R7FA 3LQQA 4A6EA 1S3JA 3F8MA 1MGTA 1TLHB 4KICA 4RS8A 1BC7C 3H3ZA 1B6AA 3V8LA 1MZBA 1FY7A 3TQNA 4EJUA 2EWNA 1Z05A 2QVOA 4WXHA 4AIJA 1B1BA 5HLIA 4U0YA 3KP7A 6PAXA 3QU6A 3TKYA 2DI3A 4EM1A 2D1HA 4FT8A 5HLHA 2IRFG 3CO7C 3NQOA 2Y0MA 2PFBA 2JT1A 1HSJA 2E1CA 2XROA 1W5SA 3B02A 5CVIA 1FT9A 2Z99A 5HDKA 1ZGAA 3BJ6A 1RIOH 4I0AA 4Y15A 5A2QZ 3GFIA 3QP5A 4IXAA 3WG9A 1T38A 1YS7A 2L4AA 2TDXA 1USSA 5FLXZ 4EJVA 2P6TA 3RI4A 4RGXA 3DP7A 5ILVA 5BMZA 5FFZA 4BHBA 3CUOA 4HZFA 1P2FA 2K02A 5FO5A 2A69F 1R1TA 2ELHA 5FD5A 2H6CA 3PQJA 3OOPA 4RGSA 4U7DA 3SZPA 5JHUA 1D8KA 2QYOA 2DU9A 1JXSA 1H9GA 5HDGA 4PGHA 3E5XA 3FXRA 3ZMTA 2CW0F 1ZREA 2DW4A 1LDKB 2ZJ2A 3LAPA 2IT0A 3QU3A 1R5HA 2FNPA 1AOYA 1XGSA 4HV5A 3I64A 1S6LA 1T0FA 1KQ9A 5LEJA 5E18F 2XVCA 3IKTA 4EM2A 2J5OA 5JR3A 2R7DA 3KP3A 3WGGA 1LDJA 5D5WB 4RB3C 1CF7A 5TRDA 1L0OC 4ENKA 2L01A 1R7JA 4HDUA 3ML6A 2V79A 4ZZLA 3IHUA 4HW0A 2YX7A 3MZHA 1TQPA 2L4MA 1LNWA 4KYWA 5BS6A 3HYIA 1KU7A 2OAZA 5HLGA 3R60A 3DF8A 2NAZA 3R6SA 3DFGA 4O5VA 2P5VA 1USTA 3DQVC 3I54A 4LLNA 3RKWA 5E1ZB 1MJ9A 1MDMA 4A0XA 2A3SA 3M8EA 2E7WA 1QQIA 2GIVA 3EETA 3VEPA 5L3GA 1IUYA 1BI1A 2DBBA 2C6YA 2XUBA 5ERIA 5EEHA 3TO9A 3WE3A 2Q8KA 2GA2A 2OBPA 4G8XA 3I71A 1HKQA 1J9IA 2HTSA 3S2WA 3RKYA 4RB2C 5IT3A 3SQNA 3K69A 1YG2A 1J75A 4OIOF 4R79A 1LQ1A 1WWXA 1DDNA 4JQFA 4L9JA 1FPQA 3BOQA 2HKXA 3KP5A 3JTHA 3M1EA 2KJBA 1I1SA 1KU9A 2ISZA 2D2WA 1J7KA 4BQAA 5LBQA 4CHUA 2M1BA 3F8NA 3HOSA 5LGNA 3TO6A 4U0VA 1SD7A 1T2KA 2FOKA 3J80Z 2VC1A 4IPAA 5A2QK 2HS5A 2W85A 4O3MA 3HUGA 4DNCA 3KLNA 4LLLA 3RKXA 5LEKA 1K78A 3SHFA 4MTDA 5LGUA 5FLXK 1LVAA 3E6BA 1E17A 2XAFA 3P9KA 1RI7A 1KU2A 4A0ZA 4E70A 4K2EA 2QBYA 1WI9A 5E8IA 4Z2YA 3HOTA 4MTEA 1OYWA 4WWCA 1B4AA 2W57A 5CJ9A 2OU2A 2HEOA 1TQMA 4L9VA 1U5TA 2A07F 4KT5C 2M8EA 2JPCA 1BBYA 4ESBA 1IF1A 2Z4PA 4IHTA 2VONA 2PMUA 2BYVE 5JVTA 2X0LA 2QWWA 4WX9A 2ZBKA 2CWEA 3L09A 1KA8A 5FFXA 2DLLA 4PDKA 3REOA 4DQ2A 1B59A 1S8NA 3T8RA 2HDCA 2K4BA 3C1DA 4JBAA 1U8RA 3ZN0A 5HOOA 1EH7A 4M74A 4OMZA 1FZPB 4HX7A 3PFIA 4YFXF 3IWFA 4A0YA 2ESNA 4G94A 2H6BA 1B9NA 2STTA 2A61A 3K1PA 2CSOA 4TV7A 2NS0A 1J0RA 4NB5A 1V3FA 3HHGA 1HSTA 4LD5A 4ZYHA 4N9HA 1H0MA 1WQ2A 1YW9A 3JAMZ 2H09A 1FYKA 3L00A 2DK8A 3KCCA 4I7HA 2G9WA 4RAYA 1CGPA 1C0WA 3GZ5A 4RGUA 3CUQA 5H6RA 3R61A 1P6RA 4PZJA 4U88A 3H3UA 2D45A 3WTSC 3M9AA 3IC7A 4L9NA 4L0YB 1IN7A 1EH8A 3JSOA 4EM0B 1UB9A 1OYIA 1U2WA 2COMA 4LG0B 1BI3A 2FMYA 3BJOA 3I58A 5DD4A 2WC2A 1XSDA 2PG4A 4XRFA 4HYEA 3LA2A 2OQRA 3IRRA 1BN5A 2WV0A 2PI0A 3HHHA 4YG2F 5DCMB 3ABTA 4FX0A 3F6OA 2LSOA 1JGSA 3ULQB 4EV0A 3K0LA 5L3BA 2P5LC 3MZYA 4HF0A 3I4PA 2BV6A 3BPVA 3TDZC 1ZLJA 2E1AA 1Y0UA 3GFLA 3GX4X 3J80K 1BIBA 1OYYA 3L9FA 5LRRA 1XN7A 1HW2A 4G7ZF 2YR2A 3DKWA 3J7AO 1IRGA 2O6GE 1XGMA 4KA4A 2P5KA 2PN6A 3L2CA 2F5DA 2XAQA 1O3QA 1FSHA 3G3ZA 5E20A 1G4DA 3TOBA 3T0YA 2Z9OA 5ILUA 3IL2A 3P9IA 2FBKA 3KE2A 1SD5A 5DYMA 3I59B 1G6NA 1IAWA 1ZH5A 3LAJA 5CVJA 2FF4A 1YIOA 3WE2A 3JSPA 2DPDA 4PCQA 1Z9CA 2M87A 1O3TA 2CQKA 4Q48A 1I6XA 4M9XA 3E97A 1HKSA 1ZRFA 4NQWA 5D5XB 4HBLA 3FMSA 1J5YA 1GVJA 5L3CA 3WTUC 4ZYDA 1WRJA 2MC3A 3ZMZA 2Z5UA 3F8CA 3KZYA 4UNOA 3BZ6A 4ZH4F 2HR3A 3I53A 5L3EA 3WTYC 3BP8A 2G7HA 3VFZA 2AXLA 1R58A 3BPXA 2IJLA 2W25A 2EA2A 3Q9SA 1U3EM 3JAMK 4I0BA 1QNTA 1FLIA 2ZBCA 1REPC 3ZPLA 2CFXA 2JTVA 4ZYGA 1FYMA 3WTXC 3WTZA 5ICGA 2WWYA 5D5VB 4FHTA 3GF2A 4LLGF 4UHTA 2F2EA 1SFXA 1SMTA 2FU4A 2QM3A 1ODDA 2Z3YA 3SZTA 2P7CB 2PQ8A 2XKOA 2KIFA 1T6SA 1O3SA 1IN4A 3FMQA 1JHHA 2ZO4A 1WSUA 1ULYA 3BROA
chains in the Genus database with same CATH superfamily
1T9XA 3DXJF 3H5RA 4DR6J 1UMQA 1ELOA 3NGUA 4ESFA 2YKNB 4U95A 2WAQD 2CJ9A 1U7LA 4KC5A 5K5RA 3L7OA 1WJ9A 3LW5C 5AXMA 4ED7A 3R8YA 4HH1A 1BC8C 2XAGA 4KE5A 1Q7YT 1P4WA 4DN0A 3IH3A 2KHCA 2TRTA 1J59A 3SMZA 2F5CA 1UAWA 2KI2A 4M6XA 3JTGA 2HK3A 1NU4A 1R0CB 2DODA 2HFVA 4A46A 1KR4A 3G71I 3CJNA 3G1MA 2DO4A 3SCJE 5J2QA 4NBQA 2M4GA 3CJ8A 3R2DJ 2W9CA 4K59A 4A2UA 2BRLA 5KT6A 2LQJA 3SYZA 3SZ2A 2VHGA 4J9UE 1T0TV 3MCMA 1C1CB 1XSXA 3U27A 1CJTA 2G2ZA 5DG7A 1N5TA 5C24A 4FBUA 2PEXA 3G9CA 3I5CA 3RSNA 5EZHA 2Z2ZA 4O44A 4C3KA 2GZOA 2FE3A 2G1DA 3QO9A 4RUHA 2LXUA 2LR8A 2HOAA 4DDFA 1KHVA 3OJUA 2MSYA 2QX0A 2E9ZA 4IOAQ 4MFBA 3N5BA 1N32J 1OR7C 4RUAA 5DD8A 1P1LA 3H20A 4J9RA 4OJ1A 4WE1B 1V54H 3BR3A 4OIQF 1RP5A 2K27A 4JV0A 4BH9A 2Z33A 1S1TB 1RHUB 1YRTA 4K4ZA 4UZCA 1FC3A 5HVHA 4ZJLA 5KFJA 4WWSA 3TX8A 5CQGA 3THVA 7FDRA 2ZXJA 1NCLA 4UY85 2V1DA 4AIDA 3FQKA 4X4QA 4FETA 5T14A 2E1NA 1ZOTA 2QKLB 5HP1B 1O57A 2OO4A 2BZ2A 4HQMA 3HRTA 2HNYA 4PFPA 1GK8A 3I4HX 4WFAQ 2CJQA 1D8JA 3K70D 3IP0A 1S0MA 1ORKA 2G0CA 4BS9A 1IKYA 4OLOA 2HQCA 3K0JA 4WK1A 2ZJRQ 3TEGA 2PLYA 2XGEA 3DTEA 3FKIJ 1VQNI 1YX5A 4KGMA 2AJ4A 2RQCA 3VSLA 3QWUA 2JNJA 2DISA 5D0GA 1S9EB 3OL9A 2R5ZA 4LOCA 3K1MA 2DGWA 2UUWA 4TQSA 3V4GA 2Y75A 2M0MA 5KFXA 3UDVA 2QCOA 2RILA 1CEZA 1MDMB 4BXUA 3NAIA 3DDNA 2ESHA 4F0MA 4NYZA 4O3SA 3CDHA 2HAFA 3QQAA 3JTPA 1NDPA 4KR0B 2O8KA 2ILYA 3OS1A 1N34F 4UVAA 4DZJA 4RBOA 5M3FJ 2UXBJ 1EIYB 5L1LA 1FJ7A 4NLGA 5B5EC 1V6HA 4PQUA 2WVCA 1VFJA 1F3FA 2B5JA 1HNIA 2ZZMA 1XN9A 2CUZA 1XDSA 2ZBIA 2LREA 1S29A 1VBZA 3G1OA 5H20A 4M5DA 1M5PC 2FA5A 2J6TA 4NYOA 4PXEA 4MIAA 2HRUA 4U0WA 3ECHA 1IJEB 3LP1A 1Q79A 3M4OJ 3MQ0A 4Y65A 3UVJA 2JC0A 3MWMA 3JRFA 3WODF 1I39A 1IKVA 3J7ZI 1UL3A 1WNEA 1UFWA 3RBDA 1N0UA 2WRMA 1HW8A 2ZJRF 5IT9Z 1TWAJ 2F8MA 1LEAA 4UUWA 5E1WA 2HYFA 2FUG9 1S1VB 3QYYA 3H0DA 9ATCB 3P9CA 4WXCA 1U4BA 5MAOA 1DQ8A 1DURA 2HHTA 1PAEX 3CMEI 3R0JA 1ZARA 2DITA 2HQAA 4DSFA 4PGGA 3QATA 5D4RA 1A7GE 2ADBA 3T1YJ 4Y3OA 3G8TA 3A3NB 4PRFA 3BR1A 4RAFA 4OINF 3UR3C 4YELA 5BOXA 5KAKA 3NP5A 1S7IA 5I3QA 2DJWA 5HANA 1ETWA 3VOEA 1KTQA 4X62F 2G4BA 4I02A 2I6WA 3CJRB 2HMIB 2IS1A 4HLXA 4NLDA 4A4JA 5HDNA 1ZG5A 3TZWA 3M7VA 1S4FA 1LW2B 2QMXA 5A8KA 1XNRF 2L02A 5KT5A 5AIQA 4CI0B 4EJWA 4O6JA 3HIFA 2EC0A 2LKPA 2NVTJ 2JMWA 2KO1A 4DV1J 2WVDA 4LR8A 2TCTA 1RC9A 1S1UB 4QOTA 1OKRA 3A01B 3GYHX 3O6BB 1NTCA 1BM9A 3HXMA 2QRRA 1D5YA 2E1PA 1UMJA 3LQRA 1BHNA 5KVRA 2RNJA 4KNYA 3KNGA 3S6EA 3H40A 2BE5F 4RBUA 5LL6d 4KN7X 2OKQA 5A6PA 3M2VB 3VWBA 1MSFC 1H7WA 2HS0A 3BPSP 4C8ZA 1RT2B 2DR7A 1YYVA 4USUA 2QA4S 5K14B 1B72A 1U2CA 4ED6A 4A3CJ 4OZJA 4BY7J 4D7NA 4URSA 2QKMB 4CH1A 4WZMA 4FNHA 4K5SA 3VZHA 1J2XA 1HFEL 5ICEA 4CNZA 2ACJA 4OZ0A 4ZP7A 2UVRA 1VGYA 3JYTA 3HEFA 3M3YJ 2IRXA 4NLUA 4O4GB 2XHKA 3M9OB 3F22A 1RAHB 3FM5A 2WK4A 3PCOB 2LTPA 4IRHA 4PXCA 2HGMA 2ZITA 1DGRM 3F73A 4FE7A 2B4OA 2QL9B 5CVUA 2M4KA 1J5OB 4RNMA 5ITHA 2DKOB 3RRHA 1XS9A 1CC7A 3BKFA 4IG3A 4IG0B 3F9KA 4C2TA 1ONVA 5H2FC 1FWKA 1OJLA 8RUCA 3MN2A 2KZGA 3GFZA 2VC0A 2GIFA 2DOAA 1MKMA 1S7HA 1W1WE 1VHFA 3R5DA 1N56A 5F08A 2MLZA 2HZAA 5L1IA 5ETOA 2QGFB 1TW2A 1TL7B 5CYMB 2VDHA 3G73A 3BDEA 1TUWA 3EDPA 1BUXA 3GFMA 2BXYA 2YNIB 2QQAA 2VASA 3L4BC 2MZSA 3GV8B 4OU0A 2IGMA 1LE8A 3JREA 4BQNA 3W2AA 3ZTQA 3O2IA 2XO6A 2ASDA 1O7FA 1Q5YA 3OR2A 4J91A 2K9SA 4V2FA 4CNYA 4Y2CA 3CJSA 3KNAA 4OV1A 3MTKA 1GFWB 1NKCA 2P0WA 1XR6A 2VG7A 1T11A 3IA0A 1QVUA 4DIQA 2HLUA 1T0FC 1QAYA 3MCSA 1UJ8A 1VLYA 3DLEB 2HKEA 3MM9B 2XY7A 4UY8T 1K4TA 4RO0A 4USIA 4P9FA 3KETA 1TTYA 2HHVA 1GXTA 3CCVS 1PGZA 1K83J 3H5NA 5J1EA 4NC6A 9ANTA 2VQLA 1N33F 1VFCA 2GBYA 2DY9A 1D3WA 3DV8A 1JLCA 4ED1A 3QPHA 1TL1B 1AWCA 4XIDA 5B0AA 2E2IJ 3ZQHA 2FGOA 2ZE2B 1YJ7A 2XLJA 5BR8F 2SXLA 1WG5A 3G82B 3CLQA 1PUFA 3F8BA 1T9VA 4EQQA 2IVMA 2L3MA 5B09A 3FXUA 4XNFA 4G6VB 1SAXA 3ELKA 3W6JB 3RPUA 1ZA2B 5E3AA 5HQLA 4CZZA 4G6QA 2DA6A 2HWTA 1JKRC 2YKAA 4XDCA 5D0HA 1SJFA 1UEVA 4OOIA 4LF8J 2BX6A 1RE1B 4FPRA 5BYRA 3I87A 2VT2A 2MLKA 2PX9A 3MEGA 4M3EA 1NK8A 3TEDA 3D7SB 2FVSA 4RB1A 1VC6A 1I94F 2V67A 4PG8A 1D0XA 2DEIA 3MVPA 5F1JA 1KVKA 3H36A 4QWQA 1BIAA 3IWNC 5F8IA 1Y5NB 4DV2F 2ATLA 4XLPF 1KYZA 3F56A 1XR7A 3RQ4A 2BYCA 2HBQB 4HG2A 3MR3A 1DHMA 4L5JA 2ZNZA 1DPRA 2UUZA 5IQ6A 3T1HJ 1AROP 2DNPA 2FYXA 4BJ6C 3J81Z 3OV7A 2JFKA 4GKKF 4B3OA 3EXCX 2V9VA 1VRTA 1ZK8A 2K4JA 4IFVB 3KOAA 1G3OA 1I27A 2XB2D 3AD9C 1S1XB 2IJFA 3V7SA 3L1PA 4ANEA 3F72A 5AXNA 2VD3A 4AL5A 2IA1A 4I6ZA 1TK8A 1T95A 5FD1A 2CNNB 2P7VB 1R5ID 1TV6B 3MEXA 3I82A 2FBHA 2VFRA 3CCTA 1S6QA 2M7SA 5E3MA 5CVVA 3OXLA 2AU0A 3NGRA 2VQEF 5T41A 1YITS 1KLMA 4K0KF 2HPUA 3QNWB 2FHMA 1YE9A 1WD6A 2M70A 3RJPA 3IWZA 1AYEA 4FS1A 3GPAA 1Y5LB 2CPZA 1DTQA 3OL6A 1IN5A 4J01A 2HQIA 3BBFA 5HMWA 3ZZRA 2DXEA 3JRCA 2A5YB 2RDDA 4M72A 2GA7A 3E2EA 2UWMA 2KKOA 1K7AA 2MG4A 1NHVA 3ZTPA 2D3ZA 3ECOA 1OSCA 1BR2A 3PYGA 2KFNA 2NNNA 1JIHA 2N3LA 5DS7A 5KFNA 2RU9A 2YU9J 5KFKA 3KFWX 4OIRF 3GTKJ 3NGSA 4PJJA 1U6GA 4KHMA 4BL0B 1ZG1A 3RZAA 1REVA 4MKVA 1DU6A 3NWTA 1U5TC 2ZD1A 1W0UA 4K4TA 4OHZA 4FTHA 4MHGA 1X8DA 4ID8A 1UWBB 2O0YA 1B0PA 5KT7A 2PA8D 5HBMB 3RBEA 5D4SA 1GNKA 5KFAA 4N7TA 3BSCA 4ZKAA 3V81A 1VQLI 3TP2A 3T5LA 1Y0NA 2DHHA 4FF1A 2HVZA 1D0YA 4J00A 5IFMA 4EZ9A 3J7Z5 1AUDA 1VHIA 1JWWA 2QUFA 2B9SA 4LQ9A 1PP7U 3AAWB 2JH3A 1MN9A 2K3IA 3OIPA 2CQ1A 2GHPA 4KIBA 4F36A 2ALZA 4ER8A 3ISNC 1CVJA 4ED4A 3QSIA 4K2XA 1SB6A 1TP4A 3LP2B 5F0WA 1MNDA 3AHPA 2NYHA 1U47A 4U87A 5JFRA 1K79A 2LU2A 3LWMA 4OJ3A 3DEUA 4CICA 5K5OA 1SFEA 3I9ZA 1B3TA 3DC2A 3G4SI 2JEIA 2PD1A 1RHJB 2BY3A 2YPZA 4GVBB 3WBZA 2D3OR 2ZFUA 4ZA1A 1ETYA 1D9FA 2DT5A 1Y1VJ 2K1RA 5JLWA 4HT5A 1FHTA 4UB8C 3GFJA 1N48A 4CZCA 1JLQA 1K8AT 4IVNA 1DU0A 1TKZB 4YB5A 3ERED 4J9QA 4ZVRB 1X2NA 1PP8F 4DUYF 4HHHA 4DU8A 1RT7A 1WSVA 3BT9A 2MABA 2MW8A 4WTOB 3U1KA 3K58A 3N79A 1T05B 3B8HA 1HPZB 3AXKA 1IBMF 3ILIA 4DU7A 4YQWA 5HODA 1MMAA 3OUYA 1MW7A 3PTWA 1OCZH 4M5LA 5ADZA 3CC4S 3PEHA 5HROB 3QOEA 1H88C 4HLBA 1YJVA 2EBEA 2KTQA 1G2HA 1YJRA 3MD1A 2JJ7A 3K4MA 3K4NA 2MZ1A 2AW0A 2GVDB 2F4FA 3ZMSA 1BXNA 1N5SA 3M8QB 3R7SB 3U1LA 3D66A 2JSXA 2HYGD 3QJPA 4YY3J 1KEKA 3AODA 4JX5A 2Z30B 3N28A 5B1AH 2V4JC 1FFSB 1YFHA 3E6DA 1O4XA 1FRMA 2KT3A 4HTJA 2DOEA 4KDPA 4ENMA 2F5FA 1QTNB 1O5JA 3BQ0A 3OMYA 2O8XA 1SC3B 3BO3A 4OI1A 4F55A 2KDOA 2HVHA 3QT7A 4KB7A 3MEKA 2F4VF 2HU9A 4ZITA 4EBCA 5IXUA 4LG0A 1BI2A 2JQ7A 2XSJB 1JTYA 2NXUA 3ZTSA 4CDIA 2MA3A 2GZWA 5CYQB 1W4MA 2F7VA 3D0GE 2FUG2 1F3VA 3M30A 1XCBA 3KHHA 1RAOA 5FKNA 4CO8A 5K7ZA 4CLUA 1WKMA 1Y8QB 5ED4A 3M9NB 1M1EB 3FBIB 3HO1A 3LTOA 3VAMA 4IRDA 5IT4A 2QYGA 3DYAA 1XBWA 4LRBA 3WC2A 4QZVB 3MPUB 1FX7A 2G0IA 1NB2A 3NS7B 1TWHJ 2LMDA 3MKYB 5BXIA 2WTEA 4H4MA 2R7TA 1H9TA 4CT8A 3IM8A 1L3SA 3KEQA 3GCXP 2XMTA 5K9FA 1NHAA 4BJTA 1ETQA 1YJ9S 1T3OA 2H27A 3HOWJ 1TWCJ 2EA4A 2ZOFA 4MNUA 2JVRA 3ISND 1JLAB 3B6AA 3L2WA 2OTLI 3OYFA 2VG5A 3PXGa 3CJKA 3DGPB 5KT4A 3ZC4A 4UTGA 2AZ3A 4E7JA 1SC6A 1DRZA 3M4XA 1HQ2A 4IRGA 2HFZA 1UHWA 2ZEJA 2LNBA 2DGQA 3QRFF 3MM8A 1H74A 3QAHA 3R4KA 3CTAA 2G2YA 4AUXA 2ZHAA 2VT3A 2W7OA 3EICA 2KM8B 3COAC 4HOBA 1LWCA 4A3DJ 5EJCA 2RVJA 3CXCR 2YPRA 1O8BA 3OY9A 3FNNA 4TU8A 4DV4J 3MZIA 1OJ4A 3OVSA 1I1GA 1SKUB 2A2DA 3CNQP 2EKNA 4A6DA 1S9HA 3QPLA 3PW7A 1FEHA 2GAUA 1HBNA 3LQVA 3X2QH 4DPTA 2DH9A 2J6UA 1G4CA 4URQU 2C22A 2XS5A 1Y1WJ 2I5JB 1F5AA 3FC9A 1LWEB 2HWVA 4IO9F 1FYLA 1RHRB 3G86A 1YBTA 4GYGA 3LGHA 2E29A 5E41A 1WJAA 2WCXA 2NREA 4WIIA 2QT7A 3I6PA 3NS6A 3NWRA 3CC7S 4F7ZA 2XG8A 2HHHF 4Y4RA 1HR0J 3IH4A 4A6EA 1MGTA 3HFZB 2XMJA 3R1LA 3J7YJ 4RS8A 5M2UA 1VQKS 1XIQA 2X6WA 2FJBB 2V9KA 2ZOGA 4ECXA 1K1QA 3HKZD 1JLBB 3FCHA 5B1BH 4KT0C 2EWNA 3HSDA 3MMJA 2QA4G 4AIJA 4M3DA 1CPZA 2AGQA 3J7ZT 2IPOB 2GX8A 2KXFA 5DETA 6PAXA 4F91B 1SFKA 2NPFA 4P7VA 2Z2SB 2HNDA 1UW9A 4J5OA 3GQCA 3MM6A 5GADJ 3A8JA 4JI6F 4DR5F 3BKUA 3IV5A 3OHAA 3BLYA 3CJ2A 2UP1A 2DRAA 2FVQA 4B17A 4ILMA 2E1CA 3EUKL 3B02A 4J90A 3K7AJ 5J1YA 2VJ4A 1X4DA 2KN4A 2ZC3A 3NBPA 1ZGAA 1RIOH 4Y15A 1EJ9A 3MKLA 1JUPA 4O3QA 1D9AA 3WG9A 5KFLA 4NA3A 2L4AA 2IBDA 4J9KA 3BH7B 1CG2A 5DLGA 2CV2A 3DKYA 1EP4B 2DT6A 4EJVA 3MOZA 2ZH3A 5BMZA 2B9XA 2BXJA 3CUOA 1HI1A 2HIQA 3IN5A 3DI6B 1E3OC 2GHVC 1P2FA 3IR5B 5KFTA 5DDQC 3SYTA 2R7VA 2A69F 2ZUAA 2VZ9A 1R1TA 2POKA 2ELHA 2WTFA 4BBSJ 3CD0A 3PQJA 3HHKA 4U7CA 3W7BA 4RLQA 2L9WA 4PUOA 3H59A 3K2YA 1WEZA 1V5IB 2MYSA 1YG0A 4NQWB 1ZM9A 2LY2A 3QFWA 1HKAA 2DU9A 2E5LF 1FRKA 2ZDOA 1C4AA 2N8GA 1KOHA 3UO0A 4DYCA 4L6V3 2EZLA 4RUCA 3CE8A 2ME0A 4HL9A 1UKUA 3MUTP 3CCES 2QSWA 3HGGA 2VFVA 2CQXA 2RT3A 1R5HA 2FNPA 4NEYA 2I8DA 1DY3A 2YNHB 4WE1A 5F8GA 1Q16B 1JLEA 3C6TA 2XVCA 3EXYA 5JR3A 3BR9A 3WGGA 2YWGA 2PMWA 5TRDA 1S0VA 3MCOA 2JA8J 5HP1A 2JEFA 1MNMC 4QPQA 1ZM4A 3BG9A 2V79A 1HNWF 1GXLA 5C7PA 1ENHA 2AQFA 1AA7A 1NSPA 1NDLA 5DG8A 3IHUA 4HW0A 3GTOJ 3EWGA 2L4MA 3FXJA 4KYWA 2Y1IA 2QLWA 2AHOB 2AJ2A 4YDXA 3VPRA 2F48A 2OAZA 5HLGA 1NJIT 1FKOB 1S9EA 3R6SA 4O5VA 3H9GA 1RTDB 1TL4A 2LMIA 2AJFE 1YJNS 3UN3A 3NKYA 4ABZA 4W1UA 5FLMJ 1MJ9A 1MDMA 4C11B 4DS4A 2E7WA 2DNRA 3PO5A 3EETA 5IYDJ 3LOCA 1S1WB 5L3GA 3OBIA 4MYUA 2K7JA 2W1BA 2O7OA 2H5IB 1BI1A 2C6YA 3HZGA 4ZJQA 4XQFA 3AG3H 3NMRA 3WE3A 2BE7D 2GA2A 4XICA 1Y3JA 4M5NA 3JTOA 1U1QA 1R31A 1E6YB 4DWIA 1VBYA 2M8GX 2V63A 4QTRA 1J75A 5C42B 4OIOF 4E8UA 2ZMEC 2WOMB 4Q0BB 2EWHA 1DDNA 4JQFA 1FPQA 4RW7A 4P6QA 3OYMA 2WBMA 3M1EA 1ZETA 4JI8J 2IEKA 1I1SA 4MK7A 2OUMA 1KU9A 1TKXA 3PSFA 4ILRA 3EJMA 3DTKA 2P9EA 4ELUA 3VAKA 4BQAA 4S0MA 2M1BA 3F8NA 3MPWA 5LGNA 3ZOBA 1RAIB 1F9EB 1LWFA 3THTA 1SQFA 5G4DA 5F0HA 1S1VA 3TAMA 2CJBA 4AFFA 1X1BA 1BC6A 1U6BA 2L9VA 1HW9A 3CZ6A 2M2EA 1LPQA 4B9MA 4V19J 3CCJS 3OR1C 3C2HA 3LANA 1GEHA 1VJQA 2B7BB 1E17A 2ECBA 4E98A 1GQEA 5MLCV 1HDDC 2ZB9A 1KU2A 4A0ZA 3S1QJ 1NHUA 5J3LA 4D3GA 2KZVA 3CJRA 2DDBA 1VZ0A 4K2EA 2E5JA 5HMYA 1HF0A 3ZGKA 4NRUA 2QG9B 4PWDB 2OPRB 3EDRB 1FFWB 4A8SA 3HOTA 3MKZA 1OYWA 3GILA 4XK8C 4WWCA 5T7LA 5CJ9A 2H9ZA 4RW9A 3KYDB 3KJFB 2K9MA 3VR1A 3CCLS 2HEOA 5ETVA 2A07F 1S1UA 1KBRA 4U96A 3A01A 2M8EA 3TBIA 3LSIA 1QAJA 3SV3A 3CF5Q 4Y2AA 1WKLA 3H1CA 4NOHA 5EDWA 1X1CA 2BYVE 5TGTA 5JVTA 1S79A 2KHMA 2XMUA 3C2GA 2X0LA 3FSYA 2ZBKA 3DBHB 3FK6A 3DRSA 4A93J 1KA8A 2VLAA 5EYRA 2DLLA 2E5GA 3M2VA 1U9NA 1C2PA 3REOA 3LGMA 1QAXA 1RT2A 3KIOA 4U9RA 2X1FA 1S8NA 1B8IB 3BTIA 2DK2A 3RW7A 5K14A 3IMQJ 4DN9A 2ID6A 3KK3A 1JB0C 5HOOA 3HHLC 4OMZA 2GAGC 4EO6A 3PW4A 1FZPB 4IKFA 3EMTA 2W1OA 2BXZA 1W0TA 4A0YA 1JUMA 1OISA 3MAAB 4JV5J 4NLXA 3ZZZA 2WVBA 1M1HA 4USMA 2FOWA 4ZTFA 1HHSA 5DJBA 4LITA 4X65F 2NS0A 1J0RA 1EAYC 1TELA 4NCAA 5FRNA 1JKPC 1J5OA 1FRIA 5HJXA 2O66A 1OCPA 1D1BA 4N9HA 1Z77A 2HWHA 2R8IA 2H09A 4IG0A 3BEGB 1KNZA 4IOBA 4A8KA 2B8QA 3PJ9A 3VHQA 1VRUB 4GFBA 2IRUA 3MDFA 1WJ5A 2H4YB 4PR6A 2CPXA 4TY9A 1F6TA 4RAGA 3TMOA 4RGUA 2ZC4A 3B4MA 2IMWP 3HDSA 2XMWA 1P6RA 3VF0B 4XPCA 4U88A 4LF4J 2DT7B 2RREA 3CF5F 1KVJA 2RQQA 1SIWB 4DCPB 1DZ5A 1TL7A 5CYMA 2J9EA 1ZR4A 3M9AA 3SXLA 1X3ZB 2XZWA 2DRDA 1MN7A 2YNIA 4L9NA 2ZXIA 4LSLB 2FLOA 5C44J 3JSOA 4B3MF 1UB9A 2OPTA 3HFKA 2BE9B 1TFWA 3IH2A 1PSDA 4HR2A 2FMYA 1VQ8I 2XTJP 1N77A 2D1CA 3FRYA 4KHPF 3BJOA 2ZSIB 3I58A 3DRRB 1QM9A 2WC2A 1WFXA 2CRLA 4C2MA 1D8ZA 4QYZK 2AXTC 1MU2B 2UZAA 3P5JA 2PI0A 5I42B 2JEGA 4YMEA 2F4OB 3DLEA 3K5OA 4H4KC 2L2OA 2GMJA 4FX0A 4F4YA 4J9VA 2HG4A 2LSOA 3R9LA 3ULQB 4EV0A 2YWWA 3T41A 4R0EA 1SC7A 3MZYA 1RZMA 1VISA 5J2PB 3CC2S 3H42A 4RNHA 1L3TA 2ZBPA 2CNLB 2VUMJ 1WVRA 4B44A 1ZLJA 2L9DA 3LUYA 2BANB 3GFLA 3GX4X 3J80K 3AD8C 5LRRA 2CV0A 2DFHA 1XN7A 3LP0A 3SSSA 2YR2A 4Q8FA 3HFVA 3DKWA 5F8LA 4DR2J 4A8WA 1NXIA 1C1BB 3QIPB 1XMQJ 2ZH4A 1TWFJ 2OLWA 3L2CA 4LT6A 5E3NA 3MR6A 4ECWA 1KFDA 4QIFA 2I8EA 2LC2A 3DU5A 2RRNA 1KVIA 3SIPB 3G3ZA 1R8CA 5E20A 3W2VB 4PWUA 2Q79A 2W9AA 3VYSB 2UU9J 3OIQA 2R7UA 3D0HE 5DS9A 3VGVA 1OCTC 4JI2J 3KE2A 5F3TA 2JL9A 2FJ1A 3JAMU 4CYUA 5DYMA 3I59B 4C9DA 4XR6A 4K4UA 1IAWA 2OPPB 4DBRA 3HHLD 3MAHA 4CLLA 1SJ1A 1RDRA 2ROEA 2DPDA 3CSKA 2DGSA 2RRBA 4PCQA 3UCGA 3MMBB 2P9GA 3CDUA 1AZSB 2XHCA 3OVAA 4NA2A 2HRTA 4DPXA 1FFGB 1JGGA 4IFVA 1UVJA 1H3DA 1F2GA 2EBIA 2GV1A 3CQZJ 1C0UB 1J5EJ 4WTYA 2NXNB 2KYXA 4GKJF 3BZCA 3M07A 1SXLA 3D9BA 1WDTA 1IGNA 2MKIA 2O1PA 5CH7B 3ZMZA 4FBTA 2Z5UA 4LFBJ 5GMDA 2GVZA 3KZYA 2R7QA 2FHJD 1LK5A 1TQLA 3EM1A 4XKCA 4HYKA 3RRGA 2HR3A 3BSNA 1U0HA 2HQFA 2XGCA 2GW8A 1NPRA 5LD2C 3OQ2A 1R58A 3O8WA 3BPXA 3BGFA 2CG8A 3W9IA 2J7UA 3D1QA 2QIFA 1U3EM 3I0RB 3PO3J 1QNTA 2DMTA 5M3MJ 1FLIA 3EVMA 2XS2A 2DR6A 1FE4A 1EQ0A 3Q86A 1RTHB 3IS9B 3ABMH 1FYMA 3WTXC 4L5EA 4PPZA 2AEMA 3GF2A 4LLGF 3ZR8X 3ZQGA 4UHTA 5CAAA 4JI4J 2Z3YA 4WFYA 3SZTA 4RL1A 1TK0A 3SFUA 4KPYA 3TARA 2XGDA 3KK1B 2ZHOA 2KIFA 2QMWA 1SBRA 2CPJA 3HPHA 1H2TZ 4C3LA 3N6LA 4PJNA 1ULYA 3V6DA 5KG3A 4ECSA 5HN0A 4TYAA 4JOMA 1RT4B 1NK4A 1OCRH 4IDKA 5CXTA 3RUBL 2XPUA 4XOPA 4IQMA 5IC6B 2E7XA 5AJ3F 4IH5A 2L5QA 4KJZA 1REGX 4OYXA 4HX8A 5G0RB 1QUPA 3H3VK 1FBQA 3I5AA 1S72I 3BDDA 1Q8IA 4HTIA 4DGWB 5D78A 5M2RA 1KQKA 4AIKA 4K2JA 5AXKA 3SDEB 4A3GJ 4OMYA 3DLKA 2OZ6A 4OHVA 5FROA 1I6JA 3SFIA 3KEOA 3OTEA 3TR5A 1IBLJ 3RCOA 4MT1A 2FNAA 3F23A 2L41A 2C3YA 2IC3B 3OL7A 3TVZA 1I3AA 3EPZA 2L0KA 3D68A 4CIOA 4D9JA 3LP2A 1KQGB 3JQKA 1FEXA 2DB1A 3GCWP 2X6YA 1X4FA 2V1XA 1EH6A 4FF4A 3RYRA 1YJWI 1NPKA 2X7IA 4HDVA 1NJWA 2ZM6F 1BOBA 4PJLA 2CVIA 2KIUA 2QSHX 3VTIA 1EB0A 3VSKA 4NLVA 3D67A 2ZWPA 4RM3A 3ZQCA 2C2NA 2A10A 3I0TA 2KT2A 3K5MA 5GAHU 4GVBA 4DL7A 4CLPA 1GXUA 3PFEA 4F3MA 3O3KA 1QZZA 3C16B 1W2BR 4J9SA 4CLWA 1FWLA 5HLTA 3OFGA 1CF7B 2KRHA 3UE2A 4LIVA 3SDBA 4M5IA 1FJGF 2OJ3A 2WONA 1HBXG 2KG0A 1TKZA 2HBZB 1MBHA 4P74A 5EZGA 1URNA 1HW1A 1IDYA 1ZM3A 2M5WA 1TT0A 4JI3J 1G3WA 1BWEA 3TW7A 1FKAF 2M9HA 1RYSA 3U1MA 2PJPA 5RUBA 1NEEA 2L3DA 4NC7A 2RN7A 1T9WA 4OZ3A 2CUEA 4OX8A 1POGA 3RRKA 5GPCA 1HBUB 4DV6J 2RAQA 3Q8SB 1OQ3A 3MF5A 1K44A 4AWXB 2W84A 4OFZA 4C2UA 3POTB 4NWBA 2HPIA 4OYIA 2V4RA 3VVUA 2E1RA 4ZVEA 1B0TA 1ZN2A 2XAHA 2GVDA 3HSZA 2FRHA 1LOUA 2PA3A 3M8QA 1IQTA 3AFGA 3BG7A 2VN2A 2FSWA 3JSMB 5K7FA 3H9JA 3T5HA 3CJTB 4RWWA 4IHVA 3ELHA 3LA7A 2ZH2A 2LLKA 4O0NA 2A05A 1U0JA 2R7SA 1R23A 4KO0B 1TL3A 5GTIC 3RB0A 1QPIA 1YIJS 3HJEA 3TNVA 4KH0B 3GTGJ 2ZVSA 4X4SA 4Y2KA 4BAYA 4LF5J 4B48A 2MQLA 2RE1A 1IZ1A 2ZVIA 3VZIA 4J9NA 3BY6A 5M5XJ 1LDDA 1VQPS 5CYQA 4OX7A 4LMZA 1JMTA 4AL6A 2XKPA 2EIJH 3FBFA 1CLFA 2W24A 2QQBA 3HI9A 2XB5A 4NXNF 5L3FA 4GRSA 2XSDC 4DUZF 3IO1A 5JLXA 2DNGA 1URRA 2O61A 3TZXA 3OJSA 2G7UA 2R7RA 3S8SA 4B8XA 5F9NA 5J1RA 4ITSA 1NZAA 3MMAA 3BG3A 4DL5A 1DPUA 4DV5J 4JI1J 4HAMA 1WI8A 3OSPA 1WC4A 1F9FA 3OL8A 3BWGA 2OCCH 4J37A 4BE0A 5KFSA 4HI2A 1UFKA 2C2MB 1X9WA 3PJRA 1Z2ZA 3NY0A 1QRYA 5AT1B 2W82A 1SH2A 2L9RA 2MTLA 4Y17A 3DGPA 3E0JB 3GIKA 3ET6B 3MAJA 4CO4A 2NSBA 4ECUA 5C25A 1TWGJ 1S5ZA 5D5UB 1TKDA 2K9QA 4EJOA 2Z1DA 2VQGA 2BQUA 2ZH6A 1SVOA 3FF5A 1EQMA 1FEEA 2VF3A 1KN6A 2RKIA 2WADA 2GS8A 3AA8A 4UVCA 4JYAF 4YHHF 3CD7A 3GEZA 1SEUA 1VQ6I 2W4DA 3C8YA 1WACA 1UFLA 4MKAA 3S1MJ 3B73A 2B56A 3FXMA 4ZVQB 1XMKA 4FPIA 2B43A 5J4YA 1RTIA 1ZKGA 1JLFB 3LSGA 5DCMA 2QZ8A 2L7FP 4DPOA 3L2QA 4EMSA 6FD1A 4ANDA 4XN0A 2RS2A 3SCIE 2JA6J 3GMGA 4F7VA 3NAUA 4I2PB 2DQLA 4B47A 1I51B 4ZVHA 2LY1A 3R6LB 1V5EA 3IAS9 4BC7A 1V3ZA 2ZJQQ 3HOXJ 5HS7A 3GJRB 1HC8A 1NK7A 1X3WB 2HHWA 3QLHA 3FK4A 3FKBA 2PI4A 4R0JA 3O5TB 1RSCA 2I0XA 3UNGC 4P72A 3H0PA 3ZMVA 3HL2A 3Q0WA 3ZXWA 3CMMA 4C0OC 2JSPA 3AH6A 4AYBN 4CO2A 2Q3PA 4OI3A 4Z2XA 4CGZA 2ZNYA 2WB1A 1RA7A 2FQ3A 4IF4A 2JUCA 2FXAA 2IW5A 1YWXA 4KIFA 4R5PB 1S0OA 1ETVA 1QO0D 4EBEA 2XM3A 4DW6A 5D6EA 3NRVA 4X2BA 2UXCF 2Z8QA 2ZXWH 3T5JA 2ETHA 1OYEA 1GXQA 4ES2A 5F8NA 2KZZA 1Q8LA 3GIJA 1XGNA 3I96A 4FVMA 5KK1A 1NRKA 3Q8RB 1U1KA 2UUBF 4IYQA 3SI8A 3CJ5A 4W98A 1XNQF 4DX8H 3GXOA 1EF4A 3S93A 3EDQB 2ZJQF 3RYPA 1H98A 2H65B 2KPMA 4ZHRB 2L08A 4ECQA 4KUMA 3CJ0A 3QGGA 3ABLH 3FHNA 3I3LA 3UN5A 2BOAA 2KIQA 5SUHA 4XLHA 2JRSA 3PNTA 1GX5A 1X0PA 2EJRA 2E36A 1ZTRA 3MUVP 3DMJB 2NVQJ 2V69A 3UCZP 4M9SA 5EF6A 4Y3CA 1ZGJA 4GGGA 2DXIA 1RWVB 1KS2A 1S12A 3VAFA 5I3PA 4G6TB 2V4JB 4M71A 2RHSB 4C3JJ 2P8TA 1BJAA 2CXEA 3ZZ0A 3L9ZA 5IM0B 1UW4A 2A1BA 3JSRA 2ID3A 2HXIA 2CADA 2K06A 3ZQ7A 4G7OF 1RWNB 2JOQA 5JJBA 2BOLA 4Y2IA 4DR4F 1EKEA 3BTCA 4FXDA 2BJDA 1D0ZA 4WF9Q 2KIMA 3AQPA 1KRPA 3K2ZA 3OV8A 2GM4A 4KGZB 2QEXS 1BJZA 3WHIA 3FFIB 1C0TB 4WKYA 4JP0A 1FP1D 4QSHA 2UXDF 3C15B 3CDWA 5F8MA 1B0VA 4X4RA 1Z21A 4NDLA 2RQKA 4OYMA 3NLCA 4RU2A 2MLYA 3LOUA 2NR0A 4WFBQ 2U2FA 4NCGB 4KIGA 4DV3F 3EUHA 1HLVA 1ZTTA 2DR9A 1S59A 3TZYA 1V5VA 1RU1A 4P2FA 2J5AA 4NI2A 5L1KA 4M73A 5HS8A 2WAQA 4BQOA 1X31C 2NPIA 2KMUA 2NCKL 3PFOA 2JRMA 4D0PA 3W2WB 2DTRA 3KUEA 1G2EA 3D4JA 3A4CA 4PEOA 1DUXC 1WC1A 1WTBA 4DQQA 2Y9YA 4P9UA 5BQTA 5CCMA 2YX4A 4WJBA 2QLZA 1YX2A 2O9LA 4ZVFA 1FKOA 4C8MA 1PAUB 4DR3F 3FBEA 4ETZA 4QQBA 3E5QA 5IC4B 4AYBD 1A9NB 5D6GA 3H2UB 4N9IA 1KP6A 4XSXF 2LRDA 3FM3A 4MQVA 1ZHFA 4RPFA 2JHEA 3CCQS 1S1WA 3CT9A 2AQEA 1IW7F 3TW0A 4CYDA 3OYGA 3K59A 2BJ1A 1WELA 5GAEU 1RLCL 2PGCA 2BJ3A 3FEXB 1AHDP 3ZZPA 4YR2A 1WF2A 1PCAA 1IKWB 3DRPB 4E7HA 1FTTA 1PJ5A 3TX0A 1WG1A 1RQ0A 5DM6Q 2X51A 1E6YA 2ROPA 4BNCA 1GAOA 3EYYA 1ULRA 4HF2A 3FMWA 5FLVA 2WOMA 4Q0BA 3ZP5A 2VOOA 5B0EA 4DOZA 2R0QC 1BD6A 3JRHA 5ICFA 3AAFA 4HRIA 1TVRB 4ESJA 1D5VA 1RK8A 2OPQB 1N25A 1NK5A 1I3OB 4OAYA 2VV5A 2XSJC 2R9LA 1W5CC 5LM7E 3LGNA 2VPZB 1FNNA 5GMEA 3QYEA 3MR5A 4EJTA 1BQMB 4GYIA 4C97A 5FB2A 4J9MA 4A8FA 2F5EA 2W2NP 4E7IA 3G2BA 1HQEA 1IO2A 3G87A 4FQGA 2YWHA 2N7YA 4FX4A 2WB4A 2JK3A 4KV8A 4QR2A 3BC8A 3AG1H 3GIMA 2LXFA 5E79C 3QIDA 5AE2A 1GV5A 1IJWC 1WHWA 1XMAA 2CGPA 1F5BA 4LJMA 2ELKA 5FRMA 3W5YA 4V2GA 2VQFJ 1OO0B 1UVMA 4E6KG 1DQAA 1VQ4I 4JX6A 4Q4ZF 3WHBA 3D5MA 2RC4A 1NDKA 5JMNA 5IOYA 1XTZA 2Y9HA 1XMXA 1DBDA 5KFHA 2OPRA 2ZH1A 1VQ7I 1PILA 5DM6F 5E7OB 4U8VA 2JVHA 4CP5A 1NLKL 3MHYA 1F1ZA 4BHPA 2L54A 2D69A 3S17J 2LVWA 5HK4A 2WVFA 1YI2S 1T94A 4WFZA 2NOGA 3CDIA 1XPXA 3FBCA 1JJ8C 3BG5A 5JUMA 4QU7A 2KM8C 2ZH8A 2RGVA 4OZ5A 2UXXA 3SXYA 3HRSA 2R92J 2F40A 4DI6A 5LMNJ 2STWA 1OPIA 2O67A 2YWKA 3OTOJ 1IXCA 3DLGB 4U7BA 3PO2J 3MEEA 2XAUA 1SUQB 5E3RA 2M0GB 4BE1A 4MGRA 2J7WA 3GSIA 4ZDNA 1YQAA 4MK9A 4CDGA 2VXDA 4Y13A 3V6JA 3P45B 4LF2A 5JHFA 1PIEA 1STZA 5FDLA 2C2RA 4C8NA 2E1OA 3RG6A 1W7WA 2IM1A 4DL0C 4F02A 5FKLA 2YU3A 3DPLC 2KT5A 5BPIA 1SD4A 3IBCB 3OSGA 2EPIA 2HZTA 3OFEA 3RZOJ 3AOCA 4AVZA 4P96A 1RT1B 4A3JJ 2G1HA 2X3GA 1FOXA 2X48A 5LMUJ 1XMOJ 4XSZF 1HI8A 4R8HA 3RJMB 1OR7A 3A0HC 1KYWA 2LFBA 3U9GA 1G3TA 1GH8A 3BBBA 5KFUA 2XCPA 1U1MA 4V1Ak 2WB1N 2XRLA 3Q8VA 1F9NA 2BKPA 4USHA 2A2CA 3V2UC 3AL0B 2KFZA 1QD1A 3HM5A 4P52A 4QR1A 3HUGB 2NRAC 1ZRDA 4ENNA 3UR0A 1N5YB 3HXLA 2BJEA 2F63A 4RLEA 2GWRA 1K4SA 3MFHA 3I0SB 4X64F 5A8WB 2MGZB 2Y9ZA 1JT6A 3HSFA 1W5TA 2MQPA 3C7JA 1DP3A 3HSGA 3KJVB 2OMLA 2EV6A 2RJZA 1W7PB 3H8YA 4LF7F 1R1VA 4EYHB 4I76A 1X4GA 1I6HJ 1NK3P 3EE3A 4LSLA 5F41A 4CUGA 3CIZA 4DZDA 2PEHA 4XLNF 4UUXA 2VDIA 4B4CA 1KFSA 4NASA 1RWOB 2N4DA 2EB7A 1DARA 4ECVA 3DLLQ 4ZPBA 3KHLA 2JZYA 2HFUA 2WSCC 5J6XA 4JI5F 2GGPB 4M5GA 2M52A 2VB6A 5DUKA 2KVIA 1LKZA 3R5BA 2BEOA 1NKBA 4RGRA 1MU2A 1U1RA 3ZMDA 5I42A 4RW4A 4QPXA 4QPTA 4NE9C 3M2RA 5I3UB 4WYWA 4ZK7M 4TU9A 4PG5A 4EI2A 3GONA 3KLFB 5CD4A 1FWPA 5K5QA 3O1LA 1ERDA 1TQIA 4JV1A 3GLXA 4LREA 3RQIA 1FJLA 2GC8A 3ISPA 1HW5A 5J2PA 1HNXJ 3TUZC 3FVYA 1UWAA 3NGTA 3M8PB 2CQ0A 3HG9A 2HZDA 2OELA 5L9NA 4ZP8A 3HTUA 5EGOB 3RTRA 2OPSA 3Q8UA 4MKBA 2CYYA 1NHKL 4EFAC 3LAKA 4QU6A 3LSTA 5TISC 1WH7A 4BC9A 3KLHA 2KJVA 2YTCA 5GMKa 4UF4A 4D5CA 2KZMA 2ZMEB 3QIPA 3R0AA 4RKUC 1FKPB 1S57A 2AT1B 2M7AA 1PO6A 3CCSI 2XASA 3MM7B 1RESA 4IHSA 4NCBA 4DV7F 2XGXA 3LSHA 4Q47A 3S3NA 2XWXA 2W7PA 2ASLA 3U7JA 2FY8A 2M4MA 4B3SF 3Q0UA 5L46A 2J8AA 1ZAOA 2R2RA 3DLLF 2FQ4A 2H54B 3DOKA 2ZZNA 1RKIA 3CMAI 1B64A 3DOMB 1SD6A 3R5JB 2O3FA 3S1TA 4A3EJ 1WJBA 3TP0A 3M8FA 4F3OA 5GAGJ 3E6CC 2CQBA 2F8HA 4J9OA 1VQ9I 4ZYAA 3S3OA 4KMUX 2WAQN 1IRFA 2CG4A 4ZCMA 5K8NA 3ZN1A 3OSFA 4DSLA 1HWUA 4M9ZA 3UFCX 1FP2A 5D3GB 1F9HA 1LFBA 4I99C 1O7LA 3NS5A 4DHVA 1N78A 2JPBA 4BS2A 1U6ZA 3QFHA 3C2BA 3MMBA 4FDFA 2QENA 1AZSA 2ERRA 1R1UA 4IOCQ 1QVGR 1S9GB 5AE3A 3PUBA 2J6SA 9RUBA 2NXNA 2BHZA 3A1YA 2EI5A 3B6BA 3V4MA 4LF9F 3EZUA 5LHIA 2W2MP 4F4KA 3LQQA 4CCNA 2ZHBA 4ZVTB 1M5VC 2WB1D 1Z3YA 3LNQA 4DR1F 3F8MA 2JA2A 1Y00A 2QGUA 2V50A 4X1EA 4ANJA 4KICA 3MD3A 3MPVA 1HL6A 1BC7C 4YRVA 3V8LA 3G8QA 4NC8A 1RISA 4B3AA 1KQFB 3TQNA 1MROA 4HEA2 4WXHA 3IG1B 1SJ3P 5DGAA 4U7UD 3I0RA 4XM3A 4MFEA 2HQGA 2GAHC 3ONQA 3CCRS 2GLOA 3QU6A 2WW4A 3KJNB 4BU2A 4EM1A 2D1HA 5HLHA 3IS9A 4L75A 2R7ZJ 3JRGA 3TW6A 3LSPA 4ZPDA 3ZO7A 2M0CA 1JNRB 2VH7A 3PX0A 4UQTA 3TUIC 3T9ZA 3CO7C 2MZRA 3HOUJ 1OFCX 4A3MJ 2Y0MA 4XKVA 1UVNA 2DNLA 2HBRB 2PFBA 1ITYA 3Q0VA 3GTJJ 3TVYA 3KK1A 2M2BA 1W5SA 4CCKA 2XNQA 1VIOA 3J7YI 1U45A 5KFZA 2R8GA 1ZAVA 1OWXA 1M1KT 4I0AA 2HZVA 3QP5A 3BQYA 4IXAA 4IOCF 3THPA 1RT4A 4YFUA 4KGKA 1YS7A 3CDAA 1IM6A 2BZTA 2IA6A 3FSXA 3SV4A 4IHYA 3N05A 2J8SA 5G0RA 4RGXA 4P75A 4OX9F 4BHQA 5ILVA 2XC9A 4WYLA 3V6HA 4B3TJ 5FFZA 1FK9B 3I55I 4WIQA 1OPZA 4G1QB 2XSFA 4JI0F 4NLPA 2K02A 1Y9OA 3SDEA 3BO4A 5B0BA 4BUPA 5LSLA 5GADI 5FD5A 4OI0A 3K4BA 3CF2A 2QF7A 2UUCJ 4EK2A 3GTPJ 4Q43A 3I56S 4F4ZA 5L9XA 3PSIA 2IC3A 3UDLA 3MOJB 5JHUA 1HWJA 1R6YA 1V3RA 4RDUA 1P9YA 1QSSA 4OI4A 2M88A 4F4XA 2HXOA 1TZ0A 2DMNA 2MZQA 3JSYA 1M5SA 4XN3A 3BG6A 3ZMTA 4DQPA 3ZXSA 4R8UB 5A0YA 3K2AA 3NOCA 2ZJ2A 1N36J 3DM2B 2L48A 1RCOB 1LK7A 1MBKA 3QU3A 3KLGB 3PX4A 1AOYA 1XGSA 3GP9A 1UJ6A 4RNNA 3PFYA 1FIAA 4N77A 5CKTA 1T0FA 2F5GA 2MB0B 1KQ9A 1IRZA 1WJDA 3GZNB 4EM2A 2QC3A 3VYTB 3KP3A 1NBEB 1LXNA 2R2TA 4RB3C 1CF7A 3QQCD 2ILZA 3VYRB 2L01A 2D9PA 3UD3P 2R2UA 5D8HB 5J1NA 5A76A 2V4QA 4CYCA 5GTHC 5CZVA 1LW0B 2ZUGA 4FYVB 4F26A 1TR0A 4Q2LA 4CLTA 1XG1A 5HLFA 3G1LA 1TQPA 2YNFA 2E7VA 1IKXB 5HAOA 4RU9A 2H51B 1TL5A 3NXZA 3NMAA 3R60A 1HBUA 2NAZA 4IFYB 2LEBA 4B9LA 4M5JA 1BQNA 3LALA 4DFKA 3NRBA 3OFHA 3POTA 2FJDB 3I54A 3RKWA 2V8PA 4I0WA 4RLFA 2XF5A 3A3OB 3RGIA 7FD1A 2B6AB 5A2QU 3DBRB 1IUYA 3IRXB 4QWEA 3PG9A 4B3XA 5BYSA 3JSMA 5CABA 3DKXA 2PT0A 1NH7A 5FLXU 4IR9A 3FRZA 4XLEA 5A6WA 3Q2SC 2IBKA 2OBPA 2H5JB 1HKQA 1EKRA 2IHR1 4KO0A 2HTSA 3S2WA 4RB2C 5J2QB 2W8KA 5D4OA 2RIJA 2BDPA 2HNHA 1V5FA 1RJJA 3M9MB 3LO3A 2HKXA 4O44B 1HBMB 3EGNA 4YEJA 3TOQA 2RQ4A 1K1SA 2RS8A 1X4HA 2DMPA 1MBJA 2R2SA 4MFBB 2XF7A 2ISZA 1Y7PA 1TL8A 3IR7B 5LBQA 3HOSA 4FYYB 2H8WA 3TO6A 2AJQA 4PJ0C 4AXIA 1AFJA 2JA5J 3J80Z 4QCLA 4IPAA 2IFXA 1BL0A 2HS5A 3KLNA 1K78A 2B7EA 2DDAA 1M5OC 2MKJA 5LGUA 1LVAA 3E6BA 4FYXB 3QRQA 2FJWA 1FOWA 2HNYB 5LXYA 2XAFA 4WP8A 3HF5A 3SQOP 4B3RF 4PK4A 4I2QA 3ET6A 1N34J 1BR4A 2CU7A 2UUAF 1RAGB 1BWVA 5K7HA 5E8IA 5FKMA 2QO3A 4R25A 4Z2YA 2W9BB 4YUDA 2R8HA 3C2PA 1WHYA 1NSAA 4BEHA 4B02A 4DV5F 4B43A 3DHXA 5DGBA 4Y7NJ 1FIPA 2OU2A 3IWXA 4L9VA 1U5TA 4X6AJ 2H5EA 3K57A 2PFFB 1BBYA 2DA5A 2WY7Q 1W26A 2H1KA 2MZJA 1GMWA 1IR1A 1Z0XA 4OX6A 2HZCA 1JLFA 2XYHB 3TI0A 2VONA 2C3OA 1SC1B 1DTTB 2PMUA 3B54A 3O3LA 2EPFA 4FCYA 2K3FA 3ETMA 4FKYA 1QDUB 2O3DA 2FZKB 3L09A 3MUMP 1H72C 3SCKE 4FXVA 1RWWB 4ILLA 4PDKA 2Y0BB 1TAUA 2QTWA 1B59A 1NAQA 3HLUA 2AYBA 2ATCB 2EVZA 1SL0A 2RU3A 4BGDA 2GMLA 4I6AA 2B5JB 1VQOS 3D6TB 3T6JA 1NK6A 3C1DA 4JBAA 1U8RA 1Z4UA 3ZZYA 3M1CA 3GYGA 4M5DB 5B0GA 2K3KA 2M3DA 1ZPWX 4YFXF 4RWXA 3IWFA 2H6BA 3LP1B 2CDQA 2EIKH 2STTA 1PJ7A 1FE0A 4GO5X 4DR7F 4HKQA 3SBMA 5M5YJ 1IKVB 3HOYJ 2CSOA 4TV7A 1V3FA 4X62J 1JT0A 1HSTA 4LD5A 5IP6A 2IDLA 2R8JA 2VFUA 1H0MA 4A3LJ 3K4JA 1CS4A 1T8EA 3L00A 1BY9A 5IWAF 4KFBB 2XS7A 1XNRJ 2ZFHA 2HAIA 3BJYA 4R5PA 1ZA1B 4OV6A 4AD6A 1C0WA 3RAXA 2AKWB 3TZZA 1SI9A 1HWIA 5GVQA 1UVLA 5H6RA 2YVSA 3UD5A 2KYZA 4DQRA 3LPYA 2JWNA 4DXLA 3PRDA 3R6GB 4ZDLA 3WTSC 3IBWA 2HK2A 2Y0SN 2E71A 2HHSA 5HSPA 4L0YB 1IN7A 2VG6A 1WKKA 1EH8A 2HGNA 1VR6A 1KLNA 1H7XA 2CJYB 4K8RA 1RR7A 1BI3A 5GAHJ 4D3HA 2C3MA 1V3SA 3T5KA 1E0EA 2E5IA 2EH3A 2LQBA 3PR4A 4ZHRA 4X66F 1AXQA 4CSWA 2XCAA 3LA2A 2OQRA 3OYNA 2D3UA 2G9OA 1BN5A 1MMSA 2QFIA 5ETQA 2PDAA 4BJ5C 1VMBA 3ABTA 2H48B 3RAMA 4UQGA 1RT6B 2M3AA 4DS5A 1U8WA 4YOEA 3DMJA 3DXSX 3K0LA 3GZ7A 3QBCA 4HF0A 2ZZTA 3QMQA 4CCHA 2BV6A 1TTHB 2LCWA 3HKZA 2V4JA 2JJ4D 2FQQB 3BPVA 1B72B 2E1AA 3V6KA 2NS8A 2QA4I 2F8EX 4BACA 5J4VA 5IM0A 3GFYA 3OTDA 3L9FA 3M6UA 2HFNA 4XRMA 4F4AA 4G7ZF 1QY7A 2F9DA 5FIIA 1YDLA 2EZHA 1S48A 3J7AO 2CRGA 2CJJA 1IRGA 2O6GE 4NXMF 4KA4A 4NLRA 4KH1B 3AXMA 2UVWA 2PN6A 1WH5A 4M5KA 3R97A 4N41A 4P2XA 3FK7A 4MTPA 1W25A 2N3OA 1JJ4A 3FFIA 4NL5A 2COLA 3IXQA 3OYIA 1C0TA 2MQNA 5AE1A 4XLFA 1O3QA 3OIOA 1T02A 5E3CA 4TY8A 2MPUA 1G4DA 3HD1A 3TOBA 4IG3B 3BV8A 2PE8A 4NCGA 1TAQA 2Z9OA 2DR5A 3L2UA 2V8DA 3BGRB 1FJEB 3ZTRA 2DJIA 1YHQS 1IDZA 2MKYA 3LA0A 3D2WA 2FBKA 2AEJA 3Q3SA 3R5CA 1SD5A 2KL4A 4HPQA 2JA7J 4QIVA 3LL7A 4EGLA 3OYDA 5CVJA 5KAFC 1RBAA 1TU0B 3W2WA 1D1UA 3BR6A 2Q6BA 1Z9CA 1RAFB 2OF7A 3KJQB 4ZPTR 1RAAB 1O3TA 5FKOA 1I6XA 2HBYB 1N33J 4O3NA 3GG0A 4IR1A 1QJHA 2VPWB 3PIOQ 5D5XB 1BLUA 2JDJA 4M5MA 2WAEA 1PKUA 4ID5B 4PUSA 3JS9A 4X4PA 3A8KA 5B08A 2VJVA 1XJWB 4WP9A 2VG7B 3OT9A 1YZ7A 5IP7J 2IGOA 5BR8J 1VRQC 3F8CA 4Z7CA 3BZ6A 1F60B 4JBCA 1R9TJ 4FVCA 2VA3A 3QJJA 1SKSA 4ZH4F 3U02A 3WTYC 3NNHA 3BP8A 2ZOMA 1D0EA 2AD9A 2AXLA 4Y2MA 1RBOB 1RHKB 4NMLA 3CCVI 1BW6A 3GU0A 1QVTA 2M7BA 1IKWA 3DRPA 3G2XA 2GQ2A 3U21A 2W25A 4DG1B 4UOCA 2X1CA 2IM2A 3Q9SA 4XKBA 3JAMK 3FEZA 4K4WA 1ZR2A 4I0BA 5F04A 2Y0SD 2CFXA 3CCZA 3PNVA 3WTZA 1X9SA 5ICGA 4AQYF 5D5VB 4FHTA 1PUFB 3CJ4A 1I94J 2FU4A 2IY5B 4I7FA 3H5AA 1FX4A 1R0AA 1CULA 2OPQA 1X4OA 3I9V9 4I56A 1T56A 3SQGB 5KHDA 4DV2J 3PM1A 4MYTA 4D1QA 2P7CB 4OL8A 2BOPA 1EHWA 1T6SA 2Z2YB 1O3SA 1BQMA 5IT9Y 2CW8A 2ZO4A 1JHHA 1OY6A 2XMMA 3T1BA 3QOPA 5KFQA 4GKKJ 2BA9A 3PIOF 3H5UA 3Q24A 1TT5B 4NLYA 3C18A 4WXDA 1QSLA 1FSEA 3LFUA 1JE8A 2H8RA 4GCVA 3A13A 1SVLA 1OY8A 4ELVA 1XCVA 1Q1HA 2D1VA 1SKWA 2BE2B 3D54A 4JB8B 4RAZA 3O8HA 4MJKA 1VQ5S 2LG4A 4DSEA 2ZFWA 2W2PP 3UQSA 4Y00A 1SAUA 2HHPA 4NMXA 2OD5A 1JQGA 3GZ6A 3BZKA 2BGCA 4W97A 2VQEJ 4DFJA 1YRNA 4WP3A 3BS9A 1LV5A 4PSWA 3FCVA 4B3OB 4ZPAA 1GTEA 3E3XA 4W90B 3OLAA 4B9SA 2VOPA 2EK5A 3CD6S 1IJFB 4ZLJA 1MWYA 1LKXA 2E60A 2OA4A 5H9EJ 1PVEA 2C2OB 3JQMA 1IQZA 3QT8A 2LFVA 4AM3A 1ZLKA 1YSJA 3IAM9 4ZIWA 3G6VA 2X9DA 1NNDA 2KRCA 1J09A 4HT7A 3AJ1A 3CJQB 3M05A 2QLFB 2I9SA 4A8QA 1S6QB 2HS3A 1FMVA 3PO4A 1WWHA 4MQ9F 2G13A 1V9OA 4CQ1A 2UV8G 1TBXA 3H5SA 1KLMB 1YLXA 5EX3A 2W48A 2E1MB 1YITI 1XGOA 1VS3A 2MSSA 3DLGA 2XV4S 1RZ4A 3PQKA 1S6PA 1SUQA 3IP4B 4IRCA 3OYLA 2Y69H 1XD7A 4EGZA 3FZ2A 4HHJA 1Z6RA 1P27B 3H5YA 3LFKA 3VB2A 2VUGA 3VODA 1HWLA 1HYSA 2Z0GA 2NYIA 3M8ZA 2HNZB 1FRXA 1XSVA 4CTAB 2FHKA 2DIVA 1L3LA 2GJIA 3V8KA 1UELB 1RT1A 2HS4A 4IEJA 1IR2A 3GFHA 1REVB 2FVRA 4CH0S 3DOLA 1PDNC 2UVVA 4FF3A 3AOAA 3D5LA 3JTNA 2OFHX 1R5GA 2ZD1B 3NEUA 2AQ4A 1DLOA 3ABKH 4LJZF 1U49A 4ZLNA 3PRBA 3G96A 1HDPA 3TVKA 3PHEA 2DRBA 2OTJS 1SV5B 3MTJA 5LT5A 4MMOA 2K9NA 3QT6A 2ASJA 4OYAA 1X19A 3DGVA 4C3HJ 3F0NA 2F3JA 2MGZA 3I5BA 2XIGA 4ENOA 1UZCA 2CMPA 2Q1ZB 1SFUA 2EFWA 2MH9A 1HNZF 3JRAA 1RTJA 4YN3B 3KJVA 1W7PA 3CGIA 3KLEA 3MI7X 2BW7A 3GJQB 2Y1JA 3P7NA 4GO7X 3TANA 1FESA 2HVRA 4EZ6A 1NK9A 2HYIB 6AT1B 4F04B 4OQJA 3M8SA 1MJAA 3A8EA 4DF4A 4F2RA 2X1EA 2IDEA 3CO0P 4G6DA 2FVCA 4WXOA 1F0XA 2MXYA 3C6UA 4TVAB 1ZYQA 1UG0A 3SZGA 1K6YA 2GGPA 1Q95G 4N4NB 1SC4B 5CLSA 3K5LA 3D3BJ 4DUYJ 1WUUA 1BGXT 4QPOA 1DQ9A 2FJVA 2LVSA 1B70B 1Z3XA 3TUPA 2KH9A 1UEKA 3HVWA 3MFKA 4UVBA 3OL4A 3W3CA 2HEKA 2UV8A 1IBMJ 1DAXA 4DX7A 3TQ1A 4LQ3A 1Q1KA 2ZBRA 3DPTA 3HOZJ 1UZDA 2DHXA 3HPOA 3I4MJ 3C66A 2CIMA 4WBFA 2UXNA 4TU7A 2RF2B 1T9TA 4ETSA 3HKZN 2AO9A 2QYCA 2NOJB 2YWEA 4L0ZB 4L18B 4DLEA 2JFDA 2GA1A 1SCJB 4DV0F 3WG7H 2MJNA 1MG7A 4FNIA 3W60A 4UUSA 5HQMA 1H38A 2F6CA 3MD2A 1X3UA 2ZMEA 2IPQX 3HSJA 2D5VA 3TAPA 4N0BA 4UUVA 1Q53A 3WIUA 1YJTA 2R5YB 2A5WA 3MM7A 2EQRA 2DOFA 5GAEJ 1K73T 3OUYB 2MQMA 5IOZA 1H0HB 1NJXA 3CC4I 2DH8A 1FRJA 2K5CA 3CW2C 4E4HA 3RAQA 3K9TA 2HVIA 1FWZA 2OD4A 4P1WA 3IRQA 2KFDA 2F4VJ 1GMWD 2W00A 2N7CA 2BVMA 3O8GA 3DOMA 1E3HA 5EEAA 1PYVA 1KGSA 4PFOA 3B78A 1UVKA 2I2YA 1GV2A 4QLCU 5E33A 4B9VA 1FNOA 1F43A 3EQLF 1E2XA 2LDUA 2GMHA 5C4XJ 3ENQA 5BPDA 5E0OA 4ZCIA 3OR1A 4TLRA 4IO9Q 2DNOA 3BBCA 4HI1A 2HKOA 2CPEA 3VV2B 1VNDA 3PUFA 2JZ5A 2EFGA 4IH7A 3HTSB 3BTJA 2HOEA 3HDDA 1D8YA 1R00A 4E7SA 2B4VA 2DA7A 2EBGA 2XPWA 2CPHA 1VQMS 2LEAA 5J1UA 3OS2A 4YP3A 5DQIA 2ZJPQ 2IVYA 4ITVA 1S0NA 4A48A 1X5SA 4LUBA 1EETB 5DV5A 2DAOA 3SEOA 5IT9U 1J2VA 1Q86T 3GIRA 4KIAA 1HWKA 2GOMA 3S01A 3IG1A 2XAJA 4CCJA 4OYWA 3AB2B 1YJ9I 4FP9A 1SPBP 1NH8A 3IC1A 4AXJA 1BOAA 3HHLA 4KBIA 3IFEA 4WU2A 2ZKZA 3F0CA 2RD5C 4BY1J 1BE4A 2U1AA 2HWIA 4BCAA 1FBSA 4IRIA 3ZZUA 3ZZOA 2BM0A 4ED5A 2JLGA 1IBKF 3JB9k 2CW7A 3CLOA 3R5GA 2IS6A 5CYVA 3MWBA 5LGTA 2W4PA 3MM8B 1AKHA 3TYTA 1S7AA 2LDIA 1U0SA 1IUJA 1NH3A 1RT5B 4LRFA 2GQQA 1LWCB 1MD0A 5B0DA 5KCMA 5FD6A 1FERA 3C14A 3OTBA 4EVIA 3GG1A 5D8LB 3E01B 3QPSA 1DP7P 2CA9A 5IV4A 1FDBA 2QA1A 4CLSA 2B4PA 2FHJA 4UZBA 1AT1B 4G1QA 4K5RA 2HHHJ 2HQRA 5IYBJ 4CWBA 5KG2A 4LMYA 5E3OA 1N8RT 4ZPWR 1WPKA 4PQAA 2ZJPF 2DK5A 1U02A 2FVPA 2O01C 1ZZNA 2XMKA 3CCUS 3HT0A 1TW3A 3WGHA 2NXJA 4D7MA 2WY8Q 1V4RA 1U1PA 4E7LA 2VPYB 1P7IA 3E3VA 1UPPA 4C4WA 1LNQA 1A31A 1L3VA 1ZZFA 1FD8A 3FCWA 4BQQA 3K70C 4XKWA 3LA3A 5KFGA 4R8UA 1X1DA 4KTQA 4PG7A 4H4OB 3EZOA 3CC7I 3TQEA 3WTWC 4O3OA 2XRNA 2DTJA 2PO4A 4ZDOA 3LSKA 3M1VB 4DR5J 4JI6J 4LK1F 4JYKA 2DGVA 5DDRC 2KP6A 3A0BC 1VQKI 4ICLB 3KP2A 2MKSA 1GT8A 4PABA 1RA6A 4H4KA 4JI7F 2IAJB 2YKNA 3K4LA 2B9EA 1Z1DA 1RT3B 5KFDA 3JQJA 2OH2A 1PUEE 1R3NA 2V1NA 3E8OA 1H2VZ 3KLOA 3QWLA 1LFUP 1WKJA 3T1AA 2CPDA 2VI6A 4H0EA 2DPJA 2KG1A 4RM2A 2HDWA 1LW0A 2BBYA 2CQGA 2HNDB 3G71S 1SANA 4AD9A 4YR3A 2HQNA 4CO0A 5JI6A 4LFCF 3M2UB 4M6VA 2RH3A 1IKXA 2E44A 4CLKA 1BI0A 4DR6F 5HNFA 2XLKA 1GUUA 1C1CA 3CESA 3P96A 2OUGA 5HQ8A 3OHBA 2HVDA 1NKEA 2EFPA 5A8RB 3OS0A 2VODA 2V7FA 2ZWOA 4I01A 3NBPB 1NM2A 1U48A 1HD0A 3C3LA 2D9OA 1R6RA 3FGVA 1UCNA 2XY5A 4DX5A 1EARA 1WZ2A 1SH3A 3PHTA 2E5LJ 1EKSA 1MIJA 4NUBA 2B6AA 3H4BA 4F3QA 4DCJB 5KT3A 4WXWA 1RWKB 3IRXA 1M90T 3RZDJ 2OP5A 1QLNA 2DXFA 1RHQB 4OZNA 2F1FA 3LH2S 2BJ7A 3HM9A 1SJRA 3AL0C 1S1TA 3QSYB 2HPMA 2KL8A 1BQXA 3CCMI 1HLWA 1WOOA 3ESWB 3TRGA 2IP2A 5HS9A 1AW0A 2XMAA 5AIPA 3I9V2 4FF2A 1WSRA 1R27B 4PUOB 3GJTB 2CS3A 4U6PA 2QLJB 4F2SA 2FTRA 5FKKA 3K89A 4I1TA 4DX6A 3O2PE 4UOFA 2HHUA 1IWAA 3FZBA 2D41A 4PKDB 4C8OA 3TA2A 1X7VA 1JHFA 1N32F 2KT0A 3OYKA 2Z57B 1SH0A 2DFFA 5DDGA 1HBMA 2X1DA 2OSRA 2Y48A 4LRAA 1VQNS 3H35A 2M34A 3E51A 1NJYA 1FOKA 5E1XA 4Q5SF 3DFEA 5HVGA 1VYAA 1HNWJ 2KJCA 2OZUA 4NZ7A 3EZ5A 3CCEI 3ILLA 1FOYA 5LHGA 2CPFA 3MXHP 2VE8A 2VBYA 1JLEB 5KFEA 3C6TB 4A5NA 4MEYF 2I10A 3JAMY 1T8IA 1FRHA 2BJ8A 2Q6CA 3HSEA 3GWZA 2C42A 2QL7B 1HIYA 3PEJA 2BRKA 3BN7A 4GDFA 1X1AA 2M9KA 4HQEA 3GTLJ 1KTVA 3LSJA 3M6WA 4HF1A 2MBFA 3BZQA 4YB6A 1KHWA 2CUJA 3IAM2 3W61A 1K0VA 1R43A 4YIRX 1T08B 2GXGA 4CO1A 2J7KA 1S6UA 2E2JJ 1GMVA 3R7NB 2EV0A 5GAGU 2JRTA 2W9BA 5F0CA 3RB3A 3RPQA 2ICWG 3J81U 1P1TA 2A6MA 2O5RA 1UHMA 2UUTA 1VK3A 3GYXB 3HVAA 3W64A 4X84A 1YJNI 2RUGA 1JJHA 2V6AA 4F93B 4K4XA 2ACYA 5BJRA 1APSA 3LAMA 3Q8QB 4M3GA 1B7YB 2ZH9A 2OIHA 4IQ4A 4WCGA 2UXBF 2F4MB 1Z67A 1DTTA 5D6FA 3MFIA 1R8AA 2RVCA 3BJAA 4IOAF 2K3PA 4XDDA 4N5SA 1VCTA 4F25A 5BYQA 3DN9A 3KG4A 2QSFA 3GLLA 4S04A 3CMES 3G6XA 1RKTA 3BPDA 2CO5A 5DDPC 5EUHA 1PBUA 4BXFA 3Q23A 2L7MP 3CUQC 5E3PA 1FVSA 1O3RA 4NEZA 4I2OA 3BDPA 2VE9A 3F21A 3EGWB 3AQOA 1BW5A 2OCEA 4YB1P 3BQ1A 1RUOA 4IO1A 4RW7B 2VA2A 2BBEA 2YKMB 2HMIA 2RDPA 2K9LA 4Q5VA 3DWLE 3FXOA 3K8VA 3FMRA 2EFOA 4RZRA 1F5TA 1TKXB 3NEKA 2ZDPA 1LW2A 2BM1A 5L38A 4C6AA 3CTRA 4FASD 2B0LA 3T1YF 2W4CA 3TP3A 1XQIA 1LWFB 4KFBA 1XDUA 4A69C 3KWMA 3GMEA 3TAMB 3A2KA 2JSCA 4WK3A 5C4JJ 2HFOA 2MKHA 3FBNB 1VC5A 3MM5B