4PCQA

Crystal structure of mtbaldr (rv2779c)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
ELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MtbAldR
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Possible transcriptional regulatory protein (Probably Lrp/As
total genus 31
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pcqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pcqA02
1OR7A 2MD5A 3V7SA 3KLOA 4KUMA 2YPRA 3H3UA 3VODA 4M9XA 5D6EA 5K5OA 2PN6A 4LMYA 1G4DA 4AD9A 3SXYA 1IAWA 3IKTA 5FLXK 4P9UA 2E1CA 1ZGJA 1R36A 3TGNA 4R1HA 3QAHA 2XKOA 2JZYA 2F2EA 3J81Z 4UVBA 3F23A 1DPRA 1IXCA 4EM2A 4NHJA 5LGUA 1I5ZA 4UVCA 1KU7A 1O7FA 4BH9A 2FA5A 2EJRA 3J80Z 4KDPA 3E6CC 3FXQA 3GFIA 5AIPA 3RJPA 3O3KA 4GYGA 1XGMA 2NYXA 2Z99A 4FHTA 4RB0A 2ADUA 2M87A 4YIFA 1GVJA 1BIBA 2P7VB 4WX9A 1BI3A 1BJAA 4Q4ZF 4Q47A 1O3QA 3PFIA 3D0SA 5DEQA 3I53A 4O5VA 1XGOA 5BQTA 2DO7A 3GW2A 2HZTA 4HV5A 1C0WA 5DDGA 3E6DA 4OIQF 4P96A 4JQFA 1TQMA 1Z6RA 1X3UA 1K6OA 5IT3A 2DTRA 3ML6A 1LQ1A 2AS5F 4MTEA 1P2FA 4N9IA 1S29A 4ZZDA 2V9VA 3LWFA 2EFNA 4QWQA 4HF2A 2GA2A 1IN4A 4AWXB 1UHMA 1QZZA 3EDPA 2OZUA 1XSDA 2CSOA 5ICGA 5EEGA 2RNJA 1TNTA 5IT9Z 1OKRA 4R8HA 1BI2A 3SQNA 3O2PE 1J9IA 4RAYA 3H3ZA 2XGXA 3FMQA 1BI1A 1D8KA 1MDMA 1GXQA 4PGGA 1R22A 1MD0A 2XHKA 3RI4A 3EETA 1Q1HA 3FHZA 4HLXA 4ENJA 5LHHA 5IT9K 3FXRA 4D0PA 4B09A 2BEOA 2K27A 1O57A 2VT3A 3MEXA 1KYWA 4K2EA 4CDGA 4IRGA 4L9VA 1IW7F 4XSZF 1DDNA 3HRMA 1H9TA 1ZRCA 1Z9CA 1FSEA 2VONA 2V79A 2K86A 3KE2A 1RNLA 3V4GA 4G94A 3GEZA 3MFKA 1IRFA 5ILUA 4MGRA 1ZLKA 1GXPA 4EJVA 4GO1A 1W7PB 5LEJA 1KQ8A 2BBYA 3ZN1A 1R1TA 3H92A 1FBUA 4XRFA 3IRQA 1SD5A 3KETA 2ZFWA 4P55A 1LEBA 5K5RA 2EWNA 3LFKA 4P9FA 2QENA 2EA4A 1K7AA 2OZ6A 1USSA 5FB2A 5HS7A 4A5NA 3E5QA 3WTZA 2UWMA 2F5EA 3T8TA 1OPCA 3BJOA 2XUBA 2IA2A 3RIRA 4I02A 5D6FA 1Z05A 4I0AA 2DW4A 2MBFA 3KP4A 4YFXF 1JXSA 1UFMA 3BPVA 1ODDA 1A04A 2ZBKA 1PUEE 1XGNA 5HDGA 1LB2A 3ECHA 1EH6A 3BJ6A 4XLNF 3K9TA 4RAZA 2V1XA 1SFUA 3HTSB 1IN7A 2QQ9A 3RKXA 3IRRA 3W6JB 5D5XB 5DCMA 3I64A 3HOSA 1T6SA 1QO0D 2DPUA 3HRSA 4H0EA 4AIHA 3KP3A 1O7LA 4EGZA 3E3VA 5K1YA 2ZCWA 5CYVA 3ZMTA 4LLLA 2A07F 2G7HA 2XAFA 3RYRA 3O6BB 2MLGA 2HKOA 1CF7B 2STTA 1XN7A 1R1VA 1I6XA 2RQPA 2V1DA 2DK8A 2QLZA 1HKQA 2JTVA 1TTYA 4M6YA 1ZH5A 1D3YA 4KA4A 2VC0A 4LGWA 4EMSA 2HS5A 3ZN0A 4KIFA 4MEYF 4M9SA 5JI6A 1BC7C 5H6RA 1NHAA 1W5SA 1HSTA 3AAFA 2FNPA 3KZZA 1RUNA 4CGZA 5DUIA 1QBJA 2L4MA 5HS9A 2A68F 4MQ9F 4DNCA 3GXOA 3WTWC 3G73A 1ZRFA 3TOAA 5JFRA 1QNTA 2HDCA 1XGSA 2D1VA 4OINF 1LDKB 3J80K 2P7CB 3CTAA 2P5LC 2FQ3A 1YLFA 3S2WA 1YIOA 3CDHA 3JTGA 4BXUA 2P6SA 3ABUA 2RKHA 4OIRF 1U5TA 2QWWA 1MGTA 2VXZA 5J8FA 3I59A 4Z2YA 1S6LA 1TQPA 1EH7A 1YO5C 1HW2A 5CVUA 4ZYHA 3K1PA 2PMHA 1ZAOA 4U0VA 2QZ8A 1JE8A 4A5MA 2DI3A 1HQCA 3CUQA 5LHGA 1J2XA 2OA4A 1R5GA 4EM0B 3ELKA 3I5UA 1USTA 3EQLF 2UXNA 3GZ5A 4Y17A 2M5WA 4I0BA 2KIUA 2BE5F 1Y0UA 1W7PA 1S7OA 3I59B 2H27A 1Z6TA 3I0TA 2OQGA 4ZYDA 3P9CA 4UXNA 2RVCA 2KJCA 4N0BA 1XD7A 2EA2A 2JSXA 4CYDA 2LSOA 3BJAA 5KK1A 1SD4A 4KNYA 4EJWA 2FMYA 3KP5A 5A2QZ 1G3TA 3R0JA 3I58A 2MLKA 3I71A 3CO7C 1ZG5A 1O3RA 1I27A 6PAXA 1S8NA 2G9WA 1XMAA 2KRFA 2RV8A 4NQWA 2CG4A 2DAOA 4KMUX 3IWZA 4WXCA 4HOBA 5DV5A 3TQNA 3FXUA 3ZMVA 1B4AA 1HKTA 4L18B 4LK0F 3K2ZA 3ZQ7A 3ZMZA 2ISZA 1H0MA 5BOXA 1Z91A 4AVPA 2RN7A 1ZG3A 4ZZLA 2EV0A 1DPUA 2FBIA 5HOOA 3K0LA 2GWRA 2P8TA 1T38A 4OIPF 5AONA 1UCRA 1XCVA 3Q9SA 2GA1A 2COMA 1MDMB 2OQRA 4I09A 4RGXA 3CUQC 1HKSA 4IHTA 3DXJF 4Q5SF 3LA3A 4OMZA 3BY6A 2O3FA 4HA8A 2FSWA 3FMSA 2GZWA 3QPHA 4RB3C 3RTRA 5HVQC 3ABTA 2E1NA 4L9TA 1F4KA 2J5OA 3OOPA 2P5KA 3V7RA 5HLHA 1D5VA 4EGYA 2A3SA 3PQKA 1U6GA 1YW7A 1XCBA 1OMIA 1UB9A 2ISYA 3ZPLA 1TW3A 2GXGA 3IKVA 1U5TB 3GX4X 1XSXA 5LRSA 2CYYA 4Y15A 3RPQA 3R0AA 3MAJA 2EFPA 2DPDA 4G7OF 4ENMA 1MJBA 2O0YA 5L3GA 3F8NA 2PEXA 2LF8A 2Y48A 5FFZA 2B0LA 1SD7A 2FNAA 4KICA 4RGUA 3G3ZA 5HDKA 2ZBCA 3K1NA 4N9HA 3J81K 2VBZA 1G3WA 4FX0A 3B02A 1LDDA 3L9FA 2NS0A 2HFHA 1WQ2A 2RGVA 5E1ZB 4KN7X 5ERIA 2KJBA 4WK8F 3LQRA 2XKPA 1W7PD 4RB2C 3R4KA 1R7JA 3GO5A 4GGGA 3W6KB 1J59A 2F5CA 4TV7A 3BROA 3R60A 1G6NA 2Z5UA 1QPMA 4UNOA 2HGCA 2L01A 5FLXZ 2DQRA 2E1AA 2VOPA 5DUKA 2HOEA 1IXRC 5E17F 3WU0A 4PZJA 2IRFG 3KP2A 2W24A 2YSRA 4LB5A 3F21A 2IA0A 2JPBA 4P5OA 4LG0A 1Z7UA 3L2CA 5E8IA 3F8FA 3SFZA 2D45A 5E1XA 2Z3YA 3NRVA 3N4MA 4M72A 3WU1B 3CLOA 1OYIA 3SZTA 2Q2EA 5LGNA 1QZYA 2YX7A 1EH8A 3JAMZ 4OIOF 1ZGAA 1OYYA 1TW2A 1P4WA 3DF8A 3SZPA 2TDXA 3GLXA 4FX4A 3LA7A 3DFGA 3E5UA 4EJOA 1R1UA 2GAUA 2XASA 2X4HA 2BGCA 5H6QA 3OV8A 1HBXG 2XVCA 5D5WB 2CVIA 4HQMA 5BMZA 2R3SA 3VFZA 5D8LB 3F72A 5LGTA 1J0RA 2JSCA 3T0YA 2OD5A 2WTEA 4OMYA 1KQ0A 4Q48A 3WGGA 3M7GA 4EQQA 5TRDA 1GHCA 1MKMA 1R23A 2Q0OA 2E7WA 1U2WA 5D4SA 3F8MA 2XV4S 1LEAA 3COAC 2ELHA 2CQKA 2FRHA 4A0ZA 2YR2A 2A6EF 1BC8C 2H6CA 1CGPA 1XDUA 4MHGA 1FYLA 2PG4A 2Z4PA 3E6MA 2EFOA 5ICEA 3L09A 3LAPA 1QGPA 1IF1A 1HW1A 2DT5A 1P4XA 3P7NA 4A2UA 2NNYA 2R7DA 1FNNA 3KEQA 1KU9A 1ON2A 2HYGD 3ERED 5FO5A 3IWFA 5CVRA 3RDIA 2E7XA 4L9NA 3RKYA 4KIGA 3BOQA 3C18A 4KFCA 2MH9A 1XMKA 3FWEA 5CVJA 4WF2A 3J7AO 3B73A 1T0FA 4L5IA 4LB6B 4HV6A 1ZLJA 3JSPA 3ECOA 1LDJA 1T2KA 5HLGA 2FU4A 5ED4A 3CJNA 2OU2A 2XIGA 1ZARA 2AXLA 3GFLA 3GFJA 1HW5A 4HZFA 3E5XA 1SD6A 3ISPA 1FT9A 2XAHA 2H6BA 1RI7A 4U7BA 5DCFA 1ONVA 5LHIA 4LJZF 5BS6A 2EV5A 4HBLA 2Y75A 2XROA 1IN8A 2HYFA 3PQJA 1SFXA 4NB5A 4L0YB 4L0ZB 3V8KA 5HS8A 4RGRA 3KFWX 3EYYA 1KU2A 2X0LA 1R5HA 3CUQB 4HF0A 4ASNA 1G3SA 2VBWA 2G7UA 4G6QA 4EV0A 3T1BA 3U9GA 5L3DA 1B9NA 4M9ZA 5ICCA 3GF2A 5DD4A 3DV8A 2OAZA 4YFKF 2HR3A 3F22A 3C1DA 3NQOA 1IN6A 1FYMA 4CZZA 4M6XA 2P4WA 1H9GA 5FD5A 1DP7P 3TOBA 5J6XA 3HRTA 4WXDA 2DBBA 1RZ4A 1ZREA 2FF4A 4IJAA 1IN5A 2KKOA 1WSUA 3QP6A 1XB4A 3MWMA 1U3EM 3BDDA 1DUXC 2VODA 2W84A 5LRRA 2DLLA 3WTXC 4BYYA 3F6VA 1I1SA 3FX3A 4A0YA 4G6DA 3WE2A 4LLGF 1MJ9A 3HIFA 4ZH4F 3M9AA 1B6AA 5L3FA 1K78B 2EB7A 2VC1A 4IPAA 3MZYA 2ZNZA 1D8JA 1E17A 3KEOA 1ZYRF 4YIIA 4E70A 2ACJA 3F8CA 3ZMUA 1B1BA 3HHGA 3D5LA 1OYWA 4BHCA 5ICFA 5LEKA 3DKWA 2CGPA 2HKXA 3MQ0A 1YW9A 2Q8KA 4O3MA 2ESHA 3WTTC 2ZMEB 4UVAA 5D5VB 4YG2F 3ULQB 2ZNYA 4CXFA 1AOYA 3F6OA 1REPC 1WKMA 4BNCA 1FBSA 3E6BA 3NEUA 4HX8A 3GZ6A 3HYIA 3FM5A 5E18F 2DFIA 4RGSA 2QBYB 1JGSA 2MA3A 1MZBA 2IP2A 1ZG1A 1RIOH 4M73A 2EFQA 4HW0A 3KCCA 3FZVA 2Y0MA 4AIJA 2V6CA 3TO9A 4ON0A 3IC7A 3MZHA 4IXAA 3RYPA 1YQAA 1SAXA 2K4JA 2JPCA 3LAJA 2JT1A 1S3JA 3I4PA 3VEPA 2GXBA 2M45A 1U78A 1K79A 1ULYA 2LKPA 4U7DA 2L3DA 2QYOA 5AIQA 5HLIA 3TO6A 3KLNA 1FBQA 4L5JA 1U5TC 2NRAC 1JHFA 2LNBA 1J5YA 3V8JA 2P6TA 4GXOA 1J75A 5CVIA 1FYKA 2O61A 4G7HF 3K69A 2IW5A 2BV6A 3KP7A 3JSOA 4ESJA 1T39A 4UUVA 2QVOA 3T8RA 5A2QK 2EV6A 3HTUA 2ZO4A 5E1WA 1R00A 2ZJ2A 5CJ9A 2NAZA 5E20A 2PMUA 4EJUA 1WI9A 1KGSA 3CO6C 1K78A 5H20A 4S04A 2IVMA 2L02A 4A0XA 2ZXJA 1G3YA 1YTYA 1KU3A 1FX7A 4BHPA 2FOKA 5EEHA 4ESFA 2KIFA 4RS8A 2K02A 2PBIA 4WWCA 1B9MA 1O3TA 3JTHA 3WG9A 4BQAA 3ZMDA 5J8CA 4JK1X 2K4BA 2F5FA 1P4AA 4U88A 2F5DA 4HDUA 4MQVA 4ETSA 4M71A 3QRFF 3DQVC 2FBKA 3QU3A 3WTSC 5L3BA 3WTUC 3GYHX 4PGHA 1YYVA 4UV8A 3K1MA 1MJAA 2W85A 2K7LA 3M1EA 5F6FA 2YU3A 3FMRA 3KZYA 2CFXA 3HOTA 4DQ2A 4KT5C 1F5TA 1FP2A 2W57A 1YG2A 2FMLA 1LVAA 3QP5A 3RKWA 3ROUA 3GVAA 3TKYA 1FWZA 1W4MA 2FE3A 2DQLA 2M8EA 4I01A 1BM9A 1BOAA 2PI0A 1FSHA 3F3XA 5ILSA 1BI0A 2VN2A 4M74A 2R7FA 3CUOA 4ESBA 2XAQA 2J5PA 4CO8A 4OU0A 4G8XA 2HQRA 5JHUA 4S05A 4Y13A 5F64A 3WE3A 5JR3A 3HHHA 4IRIA 2ESNA 3Q5FA 1SFEA 3P9IA 4LLNA 1XDSA 2ETHA 2OBPA 2ZMEA 4WCGA 1J7KA 2KIMA 5E8GA 4A12A 5KVRA 1V4RA 4BAYA 1FP1D 2HQNA 2V1UA 3WGIA 1WWXA 5D5UB 4KN4X 2PLYA 3R6SA 4PDKA 1IRGA 1EV7A 3REOA 1VTNC 1FPQA 2GQQA 5TJJA 2BYVE 2Z33A 4G7ZF 4HX4A 3ZMSA 2DK5A 1WRJA 5CLSA 2QUFA 3GUDA 2LDUA 1ZHFA 5FGMA 5DCMB 2HTJA 4XLPF 1YFHA 4LK1F 5D8KB 1UHWA 2VOOA 1HXDA 2XRNA 2D1HA 2VBYA 4XBFA 1F9NA 3BPXA 4KYWA 5FD6A 1BBYA 1O3SA 1P6RA 2QM3A 3DEUA 2IPQX 3DPLC 2GIVA 1L0OC 2MH2A 4L9JA 3WTVC 4KMFA 4RB1A 1E2XA 4UHTA 1LNWA 3SHFA 4IHSA 3Q9VA 4CHUA 2VT2A 3WTYC 1TLHB 3TDUC 3TDZC 2CO5A 1FC3A 1L3LA 4I2OA 2A69F 4HDVA 3LSTA 1KA8A 1ZRDA 2O03A 2VE8A 3DP7A 3FF5A 2A61A 4HQEA 3M8EA 4XSXF 4CICA 1PP7U 3HSEA 5LLQA 2FXAA 1SMYF 1P92A 3JAMK 4A6EA 2IA1A 2WWYA 3TO7A 5FFXA 2D2WA 3VOEA 3EUHA 3IL2A 4UV9A 1TQIA 1TBXA 4ENKA 4PCQA 2M1BA 1FY7A 1AWCA 5HDNA 4U0YA 5DD8A 4EM1A 4I7HA 2C6YA 5DYMA 1XSVA 5ILVA 2JRTA 1U8RA 1RUOA 4R79A 1IUYA 1KQ9A 2FBHA 1B59A 1QQIA 3IHUA 4QLCU 2HTSA 2YX4A 1CF7A 4LD5A 3FM3A 3V8LA 1I1GA 2QQBA 3R61A 1S7AA 5L3EA 2PQ8A 2STWA 3QPTA 3T5XA 1ZN2A 2VE9A 4LG0B 3ZP5A 2Z9OA 2NNNA 1BIAA 1STZA 2A6HF 4HLYA 2L4AA 1T98A 1KYZA 3U2RA 1FLIA 3WODF 4EVIA 3C7JA 2HWVA 3BZ6A 2DU9A 5BPDA 3GWZA 3KP6A 1IXSB 3V7CA 4YFNF 2LF7A 2WV0A 4AIKA 1JHHA 2P5VA 3WGHA 1Z1DA 4EJTA 3I54A 4B8XA 1R58A 1IZ1A 4IRHA 4MEXF 3HUGA 1ON1A 1FZPB 2CW0F 2UXXA 5F1RA 2HEOA 3BWGA 3GFMA 2QQAA 3L00A 4F7ZA 4MNUA 3JW4A 3RPUA 3C3WA 1HSJA 1LJ9A 3QOPA 3M8FA 3HSFA 2ZKZA 4IVNA 4HYEA 4U0WA 2FEZA 3HSRA 2IJLA 4KIBA 2H94A 2QBYA 4HAMA 3L7WA 1FOKA 2IT0A 2H09A 2XAJA 2PFBA 4HX7A 2VBXA 1YS6A 2RDPA 4IF4A 4BHBA 2M30A 4FT8A 2PJPA 2L54A 3DPTA 2A5YB 3HRUA 3E97A 5L3CA 4ENNA 4G9YA 1YW8A 4ZYEA 4OOIA 4MTDA 3F8BA 5LBQA 4JBAA 2UZKA 4GYIA 1YS7A 5CVVA 2XAGA 3EYIA 3LQQA 2W25A 4I98B 5K5QA 5BPIA 2O8XA 2DJWA 1SMTA 5JVTA 2WC2A 4ZYGA 4A6DA 2RC4A 3N97A 3MCZA 2CWEA 3VB2A 1TNSA 2EK5A 5D4RA 4LFUA 1V3FA 3BP8A 3U1DA 3LA2A 4WXHA 4HF1A 2MC3A 2EFWA 1PDNC 2O6GE 1PP8F 1BN5A 4O6JA 1F1ZA 4GCVA 3P9KA 1W5TA 3QU6A
chains in the Genus database with same CATH superfamily
1AROP 5F0UA 2ZVIA 5HBMA 1OR7A 4ZC3A 1XMQJ 4A3DJ 3PVXA 1VRUA 5FKNA 1Z4UA 2IRUA 3VODA 1Q8KA 2O5DA 4Z7CA 5FKKA 3DXBA 1S0NA 2EKYA 4F3QA 2EZIA 4BGDA 2R4GA 4AD9A 4RUBA 3OL7A 4NLGA 3K4NA 1K73T 3SXYA 2BOPA 2PA3A 3IKTA 4P9UA 1WCMJ 2KYXA 3TA1A 1ZGJA 1R36A 3TGNA 4R1HA 1IXKA 3AJ1A 3QAHA 1RTJA 2JZYA 3FMBA 1H3DA 1ROFA 1FX4A 2AXTC 4UVBA 1DPRA 3FXKA 3P8BB 5LGUA 3A3PB 4USIA 4UVCA 1KU7A 1O7FA 3ZZTA 3C16B 2AJ0A 1S9GB 4ZVPB 4DDFA 5D0GA 4GO7X 1NK6A 4DV5J 5AXMA 2NZ4A 4OI2A 3CC2S 3C66A 4NNJA 1NHUA 1VIOA 5GAHJ 2U1AA 3CJKA 4I2PB 1ORKA 4GRIA 1XGMA 1RKJA 3R7SB 2Z99A 4FHTA 1VC6A 2UUCJ 4RB0A 1N54B 3DLEB 2G1DA 2P7VB 4WX9A 1SVMA 3AA9A 2QSWA 1PILA 2HVSA 2EPIA 1Q82T 1SH2A 1DQ8A 1SI9A 2X1EA 3PKYA 3PIPF 3ITHB 3M7VA 2Y2ZA 3D0SA 3I53A 3OIPA 2ELKA 2CPYA 2X1BA 3L95X 3KLHA 3V6DB 2AGQA 1CEZA 3RJMB 3QIDA 3DLEA 2MKHA 1JQGA 4DX8H 1C0WA 5DDGA 1PO6A 2LU2A 4M6VA 2JOQA 2OPSA 4JQFA 4XR6A 3B4MA 2HXOA 5IWAJ 1TQMA 1K6OA 5IT3A 4LFAF 4OI0A 1LQ1A 5IP9J 1A7GE 5U47A 3I32A 1EIYB 4N9IA 2VQFF 1H6KX 2RQMA 4F3MA 3U7JA 4HF2A 1GMUA 5GADJ 2R7TA 1QZZA 1S12A 3GSIA 4JI2F 5KFUA 4PXBA 4J01A 1LFBA 4K2JA 1XSDA 3KLGA 4FNHA 4MKBA 3L4BC 3T6BA 5EEGA 2CW7A 3GTPJ 1X19A 5DGBA 5IT9Z 1RHMB 2RILA 2LECA 1NPPA 2FJBB 2NZCA 1GLNA 3HFVA 1W36D 4O3NA 2LXIA 4RAYA 4RW6B 1KP6A 1VRUB 2OGUA 2IM0A 3FMQA 1R6RA 2AMCB 5CABA 3D7SB 3H20A 3CWJA 1GXQA 3JRDA 1MD0A 4EK2A 2XHKA 4JI0F 4OMFG 4F3OA 4HLXA 4B44A 4ECSA 2B9SA 2OD4A 3OPKA 2YWFA 3KK1A 4B09A 3MKZA 3GILA 2BEOA 5IQ6A 2W00A 1O57A 1E3PA 3HHNB 3C3LA 3GYXB 4LSLA 1EHWA 2GGPB 3TI0A 1YJRA 1WPKA 3HRMA 2TRTA 2QEXS 5KFRA 1FJLA 3UQSA 4DGWB 1UVJA 4IKAA 4W98A 3OL9A 5EGOA 3A01A 4DQQA 2G0EA 4A3MJ 2SXLA 2FJ1A 2FPHX 2RREA 2ZH8A 2J0SD 2DCUB 5ILUA 2QSGX 2K3PA 1R0CB 2DMTA 2KL4A 4OZ1A 1FEHA 2BKPA 5IT0A 4Q8FA 1LE8A 4OYWA 3W2VB 1KC8T 1DURA 3TEDA 2DYSH 5KTQA 5JXSA 1HI1A 1FBUA 1OS5A 3QQCD 1RAEB 1FNMA 4LIWA 4C7QA 3AKZA 3L2VA 4P9FA 2EA4A 1H2TZ 1WH5A 3A0BC 3OYGA 4F92B 3LSKA 2CJXB 1MN7A 3FRZA 3P5JA 2F5EA 2ECBA 2LFVA 2PO4A 2DJIA 1G59A 1RAOA 4I02A 2D69A 5HQLA 2AEMA 3E3XA 1Z05A 1DY3A 1Y7PA 2KISA 3MVPA 4ECQA 2DW4A 2MBFA 3LH2S 3M05A 1YHQS 3QQAA 2GAGC 1B4SA 1RT3B 3SEQA 5HANA 5IOYA 1IBLJ 4ZDNA 4IH5A 1IO2A 4DL6A 3BO3A 3DKYA 1WH7A 1N5YA 1PUEE 2ABYA 1H2VZ 5HDGA 4B3RJ 1S0OA 2M9KA 3ECHA 3QO9B 1WHVA 4DEZA 2DT9A 2ME6A 2BJEA 2OH2A 4P2XA 2RRAA 3M8SA 2V1XA 2MZ1A 1SFUA 2QQ9A 3RKXA 3IRRA 4PG7A 2X7IA 3OBIA 4L73A 1HWLA 4WIQA 3OL3A 5D5XB 3HBLA 4WFXA 5DCMA 1LVKA 1TAQA 2HVRA 2FGCA 1UCNA 3DDIA 2XMUA 3G8SA 4D9JA 4K4TA 1T6SA 9ATCB 1CJUA 2W01A 3JYTA 1M5VC 1W1WE 1YJ9I 4AIHA 4U7UK 3L2RA 4EGZA 5AJ3J 3E3VA 5K1YA 4DSLA 3QIPB 3RR8A 2DMQA 2Y1JA 3IRWP 3VALA 3BN4A 4K4VA 3S1QJ 3O6BB 4M3DA 2YNGA 3GFZA 2Y0SN 2RQPA 3K59A 3J7YJ 4NXNF 5KAFC 1Y39A 1HKQA 4P71A 4AL6A 1MBKA 1ZH5A 3H0PA 4OHYA 4DZ6A 3WHCA 2VC0A 4LGWA 2ZBRA 1P27B 2HQCA 4KIFA 1R43A 4MEYF 4M9SA 5JI6A 4ED8A 1RBLA 3U1NA 2ZB9A 5BXIA 3H4BA 3KZZA 1E6YA 3VAIA 3DU6A 1YE9A 4XPEA 2MHEA 4U8YA 1QBJA 2L4MA 3BR2A 5EZHA 4DNCA 1RC9A 2VQGA 3WX4A 1VS3A 3TP3A 4X66F 2XLIA 3TOAA 4G12A 5JFRA 3KLFB 2HW3A 3G1MA 1XGSA 3IFEA 1N5QA 1S77D 4HDGA 2WB1A 4DV0F 1PUFA 1VQSA 1LDKB 2UXCJ 2P7CB 4N8NA 2DCLA 3CD6S 3G82B 1YJWI 5GAGU 2XSJC 5DO2A 3GONA 2LG4A 1C1CB 3N6LA 3QFWA 2I8DA 4LQ9A 4BXUA 1TUWA 1D0XA 2E5ZA 1HWUA 1X4AA 3FCWA 3T1AA 4OYZA 4OIRF 5GAHI 1OCRH 2QWWA 2VPWB 2K3FA 3GB0A 2X3DA 3FBFA 1XK8A 4RUCA 5J8FA 1S6LA 3JSRA 3EDQB 5IS2A 1YO5C 1JIHA 1C0UB 4LFCJ 3ISZA 3HHKA 2XC7A 4WKYA 3DMJA 4J9PA 2B5JA 2Y0BB 3HHLD 3GJTB 1FI4A 2LQ9A 4U0VA 3HI9A 3QYFA 1TTHB 4TU9A 5IWAF 1RISA 3FJ2A 1ETWA 1JUMA 4E8UA 1R5GA 1SVDA 4CTAA 2HS4A 4YDDB 4DYCA 3HG9A 2M0CA 2IRYA 4X65J 1DRZA 3ABKH 2HVHA 1YIJS 4BS2A 5HNFA 3CJ0A 4NI2A 2ZSHB 3I59B 5GAEJ 4IRDA 5J1UA 1RT6B 4OFZA 3QGHA 4TKTA 1SKSA 2RVCA 2KJCA 1XD7A 4CYDA 4USHA 3H5XA 1JKPC 1ZBTA 2IYIA 2GO8A 2V4QA 4I7FA 3AY0A 3GYGA 2H1YA 1F9EB 2OPQB 2M34A 3JQKA 3I71A 3CO7C 1GAOA 4RPFA 1U0SA 4HEA2 4EYIB 3NMAA 1N4LA 2ID3A 4NLTA 2QMUB 2C3MA 4OX9J 1XJWB 2DAOA 4WXCA 2DFFA 5EJCA 3IR7B 3FXUA 2AQ4A 2ZWPA 4JI4F 5HBMB 1WC3A 3ZMZA 2LQ8A 2ISZA 1H0MA 1Z91A 3SZGA 2L08A 3MGJA 2J6SA 4PUSA 2VFTA 2FQQB 4F7VA 5KG4A 5A6PA 1S6PB 1XMBA 5J2QA 3KK1B 5DDOC 1IJFB 1GDTA 1XCVA 4TY9A 3OY9A 3TZXA 5EZGA 3OYDA 2IM2A 4B3OA 4OAZA 2B8QA 4I09A 1DQUA 4IHTA 4Q5SF 2VHGA 1AU7A 2LEBA 1X0FA 3LA3A 2YWEA 3JRGA 2YNHA 3K4LA 2A6TA 2E9TA 2R7QA 4RB3C 1F4KA 2J5OA 1AFIA 3OOPA 4O3PA 2P5KA 3EUHC 2CPHA 1TL5A 1Q8BA 1U6GA 3DFEA 4HHHA 3OR2A 1UB9A 5KOXA 3EICA 2CUZA 1N5YB 5F41A 4PJMA 2DNOA 1IVZA 5D0HA 3IKVA 2XO7A 2GLOA 3K7AJ 3UD3P 3UFCX 3THTA 1CQMA 3M3YJ 4QWBA 4WYLA 2VICA 4DOZA 2WVDA 4GFBA 4GO5X 5FKMA 4HSRA 4G7OF 4OI6A 3MM8A 3R5JB 5L39A 3IAS2 4CLFA 2IY5B 5C24A 4L3KA 2B9XA 1VQ8I 4N5SA 4RGUA 1HHTP 1QAJA 3CIZA 3A2KA 5HDKA 5KG3A 4GKJF 1YQHA 2VBZA 2E1OA 3RU0A 2C3OA 2YWGA 1ZS6A 2IFXA 4ZLPA 1LDDA 2LTPA 1QPIA 3L9FA 2O5RA 1C0TB 4X4UA 1K4SA 3I0SB 4OYXA 2POKA 1HIYA 4KN7X 1X4BA 3JRHA 4RW8A 3D9BA 2W4PA 1W7PD 4IR1A 2HHWA 2EH3A 3PW5A 3V4IB 2MMYA 4P73A 4BKXA 1F2HA 3V6JA 3BJYA 2HBZB 2PA8D 1G6NA 4PJJA 2Z5UA 4TYAA 2R7UA 1UW9A 1T3NA 1X1DA 3SZ2A 1R8BA 1RTDA 4HKQA 3LGNA 2HZAA 4XRSG 4DL4A 2HPMA 1VQKS 2Z2ZA 5FLXZ 2F4VJ 2A2DA 4X4NA 3HPHA 4C8MA 5I3PA 2DA7A 2DNMA 1RBOB 2C2KB 2IJFA 1EJ7L 3K4CA 4RZRA 3LAKA 3KP2A 2KJWA 2VJ4A 2V2KA 5A8KB 4LB5A 2IGKA 2XGPA 3MM6A 2W9BA 2FLPA 3F8FA 3UDLA 3DRPA 2VL1A 2XI2A 3DM2B 1SV5A 3C2HA 2JA5J 1SL0A 4DMZA 2CQBA 4Y4RA 3WU1B 2A18A 5HODA 5KFZA 1RWXB 3SZTA 2WHOA 1HPZA 3BPDA 5FRMA 3M8QB 3BGRA 4KFBB 4RNOA 4LSNB 3ZXWA 2NREA 3JAMZ 1TELA 1RKTA 1ZTRA 2DIVA 2DY1A 2QA4I 4DR5J 4FYDA 4QR2A 3G87A 3ILOA 4MFDA 2M9HA 2B9WA 1HWKA 1P4WA 2QF7A 3DF8A 3SZPA 5J4YA 1MH4A 3THPA 4O3RA 1R1UA 2GAUA 2XASA 1BQNB 3CLQA 3PJ9A 5K9FA 4DR7F 5L8RC 4NMXA 4PSXA 5DZ7A 3HLUA 5H6QA 1MNMC 2KM8B 3AODA 2XVCA 4DV6J 1MSFC 4R5PA 3M30B 3AQPA 3F72A 4DZJA 5LGTA 5IYBJ 2JSCA 1LNQA 2R93J 3EXYA 4ZK7M 1SVOA 4C6AA 1F1BB 1MMLA 1Q0NA 4A69C 4ID5A 1LOUA 5TRDA 1RAFB 3LPEA 1CJVB 2YY3A 2YBVA 4DQIA 2ZD1B 3MUMP 2L7FP 4CO5A 1NRKA 1DQ9A 1NMEB 1WJ9A 1FOWA 2QGFB 1RKWA 3OHBA 1OQYA 1EKEA 2Z2MA 2CQKA 2KN4A 2M7BA 3MECB 5D77A 3MM5B 2MQPA 4XL9A 4IFVA 3HXMA 2DR6A 2HZCA 4OZ0A 4DL5A 3K2AA 4J9RA 1A6QA 1BC8C 4IOAF 2WY7Q 1VCTA 2Z4PA 3GTKJ 3LOUA 1K47A 3AT1B 2Y69H 4E7KA 4LF8J 5K8PA 4LJMA 3NY0A 3ZR8X 1S1VA 3MMCA 3P7NA 1JUPA 2NNYA 5A8RB 1FTCA 3LNQA 4IH6A 2DA5A 1NDKA 4CP5A 1FNNA 1NJYA 1BQMB 3R2CJ 1HBMA 1JT0A 3GPAA 4DYRA 3PIPQ 1IDYA 4RWWA 1RCXB 2GMHA 4URSA 2IBKA 4LIVA 4UB6C 3BO4A 2RRBA 3EUKL 4LVNP 1OPZA 3DLBA 1O0PA 4RBVA 3D4JA 3LP0B 2M7SA 3C18A 2MH9A 4YR0A 1XMKA 1IGNA 5DDPC 2CPIA 3TZZA 5CVJA 4RA2A 1UZCA 2AT1B 4A47A 4A3LJ 1H88C 3GMEA 2XI3A 4KH0B 4A48A 5GPAA 3BLYA 3MTKA 3ESWB 4XORA 1T0FA 1Z1ZA 4HV6A 4NASA 3JSPA 3UCGA 1S57A 5ETTA 2WCXA 2ASJA 4OAYA 2DHXA 2VDIA 4PYDA 3CJNA 4ZPTR 2LXFA 5FLMJ 1ZARA 3GIRA 3IWNC 3GFLA 3GFJA 2E7VA 4DV1F 4HZFA 3V6DA 1PGZA 4ZVHA 2RDDA 2ILYA 5HJXA 2VPXB 4CO1A 3GJRB 1FJEB 4RW7A 1Q5YA 2DH9A 4HBLA 2XROA 2B51A 1IN8A 1K8AT 2V1NA 5B66C 1U8BA 1PIEA 3M1CA 4WCEQ 3SEOA 1N52B 2DO4A 2R5YA 2L9VA 4EI2A 1JI8A 4P9SA 4RAGA 2CQGA 3R9LA 4RNNA 3DXSX 1KU2A 2R7OA 1JJ6C 2XM3A 3KLIB 3IGNA 1B72B 4IG3B 1VQ6S 4EV0A 3SCIE 3U9GA 4M3EA 3HUGB 2AJ2A 3ZZUA 3GF2A 2OAZA 3OFEA 4RBUA 4YFKF 3J7A1 3OVSA 1W7WA 3J7ZI 2W2QP 2H3EB 1FEEA 4GVLA 4WBFA 1SL2A 1RAIB 4NYZA 1RAHB 2W9CA 3OR1A 4M6XA 1VDHA 1U49A 1JJ2R 3A3NB 2PMWA 2RF2B 2AX1A 1HYSB 1U24A 1RT7A 4K5RA 1RZ4A 2QSFA 1TMMA 2FF4A 3HHLA 4DPYA 2U2FA 3MD1A 2KKOA 2XPWA 4ZVEA 1WEXA 5JLWA 5LFAA 2WVEA 3QP6A 1IRZA 3K4MA 4N56A 3KHRA 1XB4A 1SKWA 8AT1B 2DNLA 1ULRA 4J9LA 1OCCH 2W84A 2APOA 2HGLA 4NLVA 2V4RA 1S49A 1I1SA 4A0YA 2DITA 1GVDA 4UT4A 4EO6A 5DZ6A 2LQ5A 2MG4A 2IVFB 5ETQA 4LRFA 4Z37A 2YVSA 2C3UA 2G2ZA 2FLLA 4YIIA 2FD5A 4E70A 5CZVA 3JAMU 1RLDA 2MLYA 3ZMUA 5EX3A 5C42A 3VYSB 2LK2A 3A8KA 1F36A 1YX3A 1NBEB 4ILLA 2VLAA 4JI3J 5ICFA 1NG6A 3DKWA 2CJKA 4K4YA 2ESHA 3MD2A 2PI5A 2ZMEB 4IOCF 4RW9B 1K0VA 1FRIA 5SUHA 2WB4A 1K4TA 3QRRA 1RESA 4YELA 1REPC 2HQIA 3QO9A 1WKMA 4BNCA 1IWGA 5F3TA 2GHWA 3HYIA 4XK4A 4X6AJ 4AT1B 2AU0A 4RGSA 4ZCIA 1JGSA 2WSFC 4A3KJ 1OCOH 1U9OA 2MZJA 4LFBF 4LR7A 4M73A 2EFQA 3TVYA 1OO0B 1Y5NB 2COLA 2C3PA 3AXKA 1C0UA 4MIWA 3C15A 2IA6A 1YK9A 4C30A 3MZHA 3K5OA 1SAXA 2K4JA 4PZVA 3LAJA 2OCEA 1MNEA 3WHIA 4IO9Q 3SCKE 3FDSA 4USWA 1LXNA 2EIMH 5F8GA 2EQRA 3UVJA 4PSWA 3JTOA 3RQIA 5IP6A 4QQBA 2LKPA 1Z77A 2L3DA 2QYOA 2Y9ZA 3GFXA 1Y10A 3OFHA 4ZPVR 5F8IA 5HLIA 2I1RA 3TP0A 1J09A 3KLNA 1FBQA 1XTAA 1WC6A 1CQNA 3BTIA 4CO0A 2BE7D 3H8YA 2E44A 4DUZJ 2V9WA 3PEJA 2R9LA 5I4MA 1FYKA 4G7HF 3K69A 2CJJA 1ZQ3P 1H0HB 4FXVA 1IJEB 2BV6A 3HVAA 5CQGA 2FHMA 4MTPA 3HVRA 5M2UA 4WPAA 4LG3A 3VSLA 3BTLA 3CD6I 2BX6A 1KWMA 1TKZB 3AD9C 3TP2A 4ESJA 3FXMA 3PUFA 1LWEA 1U0JA 2KRRA 2E5JA 1GXTA 4E0DA 5E1WA 1NH3A 5E20A 4LSLB 4EJUA 1WI9A 3SEZA 4RAFA 4F4YA 1W0TA 4NCGA 5BYQA 2E2JJ 5H20A 2CMPA 4NLXA 2QE5A 2F63A 1FKPA 2VQEJ 3NAUA 1BWVA 3SDEA 2P0WA 2MFZA 2IVMA 2ZXJA 1U6BA 4ECVA 3UO0A 5DQIA 2M4GA 1YJWS 1D09B 4X4RA 3DNCA 1JMTA 1IBMF 2DRBA 3H9JA 4P72A 2K5CA 2KIFA 1I39A 1AXQA 4MKAA 3TR5A 4PWDA 3PJRA 4OV1A 1F3FA 1BR1A 3JTHA 3WG9A 3BKUA 1RXOB 2IAIA 3THVA 1HYSA 5F04A 4NZ6A 2RDJA 3IO1A 4ZJLA 3F44A 4B47A 2K4BA 3WHBA 3BTCA 2HHPA 4U88A 5KFJA 3MFIA 4MQVA 3BDEA 3DCFA 4ETSA 2F6CA 2H5JB 4M71A 2OFHX 1R0AA 2C42A 4C3IJ 3PHTA 5FJ4A 4WZMA 2BM0A 5AJ3F 3QU3A 5L38A 3PIOQ 3MMBB 1I3QJ 1NM2A 1QM9A 5L3BA 4LF4J 3D66A 4WF9Q 4PGHA 1ZKGA 4UV8A 3K1MA 3HCXA 2W85A 2K7LA 3EGVA 3M8YA 3H5UA 1RT3A 1XEZA 2CFXA 1JWWA 2CFOA 4TLRA 3ZNUA 2Q1ZB 3GVAA 3CGIA 3TKYA 2CU7A 2MY8A 3G6XA 1FWZA 2G1HA 3IG1B 5KAIC 4MLOA 3AD8C 4Y2KA 4X4OA 2DQLA 2I10A 3HC7A 4BDPA 3I9V9 4KV8A 3AB4B 1JUSA 3S2DJ 4ED7A 1BM9A 1BOAA 3NGTA 3OTOF 2HHQA 2MD0A 4ZPCA 2WSCC 3CUOA 1DZ5A 4G8XA 3DGPA 1R6YA 4YP3A 2P8IA 1YIJI 3O8WA 3WE3A 1V55H 1AUDA 4AC0A 1SC7A 1IKWB 4OYPA 4WXOA 1LE8B 2ZH3A 3CJQA 3P9IA 2FIUA 3VAGA 2WB1N 4OYMA 2ETHA 4WCGA 1M5KC 1J7KA 5K20B 2RKIA 3JREA 4KB7A 3ENWA 3PW0A 3Q8YA 4A12A 1PJRA 4BAYA 1FP1D 4LF6J 1IQZA 1X5PA 2LDYA 1EF4A 4PDKA 3QGIA 2QA1A 4B9NA 4ANCA 3FBIB 1FPQA 3HZGA 4K59A 2Z33A 1OJ4A 2BV3A 2KRCA 2F40A 1ZHFA 3EVWA 2Z2LA 2HBRB 5I3UB 4LK1F 3HMJG 2D1CA 3OD2A 4V19J 1MWZA 3FBNB 2F7VA 2ZE2A 4K0KJ 3KNAA 3CMAS 1F9NA 2LR8A 4KYWA 3EVOA 2QA4S 5FD6A 2ID6A 4F0MA 2CIMA 4MK7A 2XMKA 1RHJB 4CTAB 3DEUA 1X4GA 1UZDA 2BZ2A 3ENVA 4UZBA 3BN7A 2GIVA 3MEGA 4LBIA 1KZHA 5AE1A 5DM6Q 4M95A 1TWAJ 1RT5B 4KMFA 1ERDA 1WEYA 4AL7A 1LNWA 1RHUB 4IKFA 1BOBA 2BKOA 3FQLA 3EPZA 2ROGA 3WTYC 4FE4A 1TLHB 3S8SA 4DV4F 2PI4A 2OP5A 2CO5A 3TA0A 1KA8A 3FNNA 4CLPA 4KIAA 4DR3J 1GXUA 2VE8A 4J37A 3MUVP 3MOJB 5F8JA 2A61A 2BXZA 4ZIWA 3HL2A 2C2OB 2VL8A 3PRBA 1PC5A 3HSEA 2FXAA 3BR6A 4CIOA 3KUHA 1V3ZA 2YKQA 1X1CA 5L9NA 3LL7A 1PUFB 4ITVA 1S1UA 2IA1A 3BT9A 2JC0A 1IG7A 3OMYA 2H5EA 3TO7A 1FTRA 3BGFA 2YXLA 1F2GA 5FFXA 2D2WA 1ETKA 1S7HA 3SFUA 3IL2A 3CDEA 4UUXA 2XLJA 1JKQC 2LOOA 1SJRA 4QOTA 2V50A 2OJED 4NZ0A 4MFBB 3P49B 2H1LA 1FY7A 2W8KA 3CF5F 1SKUB 1KS2A 2R8JA 1U1NA 2GMLA 4WIIA 2NOJB 3CCJI 3OL6A 2X9DA 1RT2A 2O7OA 3LO3A 3HKZA 1VRTB 2JRTA 3LGMA 2Y30A 2P81A 3NAHA 2JLGA 2PMZA 1KQ9A 3OT9A 1S9FA 4JI5F 1G3OA 2BW2A 4N47A 2HTSA 2BY1A 3FM3A 1HHQA 2HIQA 3W2WA 4C3HJ 1I1GA 4FP9A 2NCKL 1S7AA 5L3EA 5FLXY 2CQCA 1K83J 3DDNA 5C42B 3VF0B 3BKFA 4GVBB 1TR0A 3T5XA 5DGAA 3PYFA 2VE9A 2VH7A 2RNEA 1N75A 1S4EA 2JLEA 2Z9OA 5GAHU 3N4WA 2NNNA 3ZFVA 2LFBA 5J1NA 5H9EK 3CCEI 3JTPA 1KYZA 4AYBA 1RE1B 3K4BA 5KG6A 4U95A 1F9HA 3OSFA 3FXOA 5A8RA 4NYPA 1UW4A 3GWZA 2LF7A 1HLWA 1JHHA 4ZJOA 1Z1DA 1WJBA 4TNOA 2BANA 5EGYA 2GNKA 2F48A 3ET6B 3L3CA 3OL8A 1TKDA 1WHWA 3BR5A 2X1DA 4C3KA 3OV7A 4KHPJ 3N6MA 2HEOA 3GFMA 2QQAA 2A6OA 4ECXA 5LOQA 3VGTA 2V4JA 3C3WA 5E3LA 5ETSA 1RBAA 3AH6A 2E1RA 4C4WA 4YEAA 1HDPA 4U0WA 4O0NA 2CQ4A 2KP6A 7FD1A 1XMOJ 2XB2D 4USTA 4KIBA 4IG3A 2H94A 2DGTA 2R8KA 2DXEA 4ZP9A 1WG4A 2EVZA 2M8HA 4YY3J 1YS6A 4F0KA 2RDPA 3GP9A 1U25A 3EGNA 2EFVA 2ZXIA 2JJ4D 4LSNA 2L54A 1X60A 5C7PA 1F5CA 1VQMS 3EX7B 1CQTA 2CPJA 3FISA 4LQ3A 1Z2LA 1UG2A 2HDWA 2GIQA 3EGWB 9RUBA 3W9IA 1HHSA 1F3VA 4DUZF 2NSCA 3PNVA 5LBQA 4GYIA 1RWWB 1WG5A 5CVVA 5IT9U 4QIWD 2XAGA 3BG3A 2ZJQF 4DQPA 2BW3B 4CNYA 5K5QA 1YX2A 4LREA 1YBTA 3FCHA 2Q3PA 5T7LA 2XMMA 3QJJA 3Q0AA 4IQ4A 4EU0A 4ZJZA 3N97A 3OYHA 2ASYA 3HSGA 3M6VA 2JVGA 2CWEA 2F4MB 4IFYB 3BQZA 1TNSA 2EK5A 3I5CA 3LP1A 4FZVA 2M2EA 1A31A 3LWLA 3BP8A 4WXHA 4HF1A 2KKHA 2HK2A 2EFWA 3KJVA 1BN5A 2XWYA 1F1ZA 4GCVA 2AIRB 4Y00A 3G71I 2W8LA 3NNHA 2ZJRQ 2FVSA 1T7PA 2DGSA 3S15J 5L1JA 5F8NA 3V7SA 3KLOA 1UWBA 2CQ7A 4M9XA 3AAWB 2AHQA 1NKBA 2JA2A 5K5OA 1SJ3P 5ETMA 1RDRA 2AZ3A 5IC4B 1T03B 4LMYA 3MM5A 4CCNA 5HVFA 3GLJA 3ZZOA 3KG1A 5FLXK 2OEMA 1E6YB 1TMJA 3W62A 1LV5A 4ES2A 4H4MA 4LF7J 3FEYB 2JLFA 2BM1A 5HLFB 4PG6A 3C46A 2XKOA 1U1RA 2LY9A 4AL5A 4CM2A 4EM2A 1YRNB 1YITS 2DISA 4NXMJ 1ZZNA 5IM0B 4BH9A 3CC2I 1OIAA 3L9ZA 2FA5A 3SCJE 4EWTA 2EJRA 3J80Z 3FVYA 3T6JA 2HZVA 1AUSL 1WTFA 2BRLA 5B5EC 3GFIA 1OY9A 1Q4RA 3PFEA 5AIPA 2RAQA 4XRSA 2NSBA 2Q6CA 4OZJA 3J7AN 3RJPA 3O3KA 4V2FA 4RR5A 2XLKA 3JRIA 4IR9A 3I5AA 1S1TA 1N77A 4PR6A 2L7ZA 1GVJA 3WU2C 2UXCF 1BI3A 3H9GA 4U8VA 1P7IA 1W36C 1T9XA 2KIQA 3CC4I 1S1WB 2HFOA 3TZWA 2CJBA 5FRNA 1O3QA 4USJC 1F60B 3BBFA 2GIZA 4O5VA 1T8EA 4Y3CA 5AXKA 2NVXJ 2JL9A 2LQBA 1JLGA 1B3TA 4HV5A 3E6DA 1BR2A 1RYSA 4YQWA 4PUOB 4YMEA 2MHNA 2MQOA 1LXJA 2XF5A 2QN6B 1U1OA 1Z6RA 2J9EA 1X3UA 4A8QA 2VPLA 3T5LA 2QMXA 4LT6A 2QSHX 2ZOMA 1PBUA 1P2FA 1S29A 3W64A 4TU8A 3LWFA 1PCAA 3FFIB 1G7CB 1SH0A 4QWQA 2GC8A 1IN4A 2B7CB 2YH1A 2GVZA 5J2NA 2Q2EB 1L3TA 5GADU 2DD8S 2OMLA 4TLQA 3WQPA 1HBUB 3MURP 2J0XA 3PNTA 2GA7A 2C22A 4BJ6C 3O2PE 1JLCA 1FJ7A 4BDYA 3H3ZA 1MNDA 3CDWA 4PQAA 1VQYA 3OVBA 4GKKJ 1FFSB 1BI1A 3L2UA 3MEEA 4JP8A 3OJSA 2DT7B 2LMDA 2CQIA 1WOPA 4PGGA 2OPPA 4USVA 1R22A 4QPQA 2B8PA 4UY8T 2IHR1 2BA9A 4YR3A 5LHHA 5IT9K 2QA4G 3LP1B 1G8XA 4D0PA 4ZDPA 5ETOA 3BSAA 5KFMA 3TUPA 4F4XA 1FNOA 5BR8J 3MEXA 3VYUB 2FC9A 4IRGA 4L9VA 1IW7F 4FISA 1R8HA 4CYCB 3GTQJ 1ZRCA 3IRXB 2AQEA 1Z9CA 4OZ3A 4IQXA 3LSMA 3S2HJ 3J7ZT 5DM6F 1IBKJ 3OYEA 1Y3KA 1RNLA 3V81B 2PJRA 2FY1A 1HR0J 2LEPA 2IGMA 2BKNA 2YNIB 2HYIB 2ZDOA 2R0QC 5LJ3Y 3G9CA 4MGRA 1ZLKA 1GXPA 2OTJI 4EJVA 3KK2A 2UUWA 1TL7A 1W7PB 2LREA 2KMUA 1KQ8A 4Q45A 3HFZB 4DS4A 2YNFB 3D68A 4M5DB 3U1MA 5D3GA 4NBQA 3CMEI 2Y8WA 2HNDB 4B4CA 1SD5A 3ENQA 2KVIA 4D1QA 4X4TA 2ZFWA 3CZ6A 5K5RA 1TV6B 2EWNA 2QLXA 2QENA 2F5VA 1GT0C 4DR1F 4B3TJ 3M8JA 5IQQA 3RYLA 4B08A 3H35A 1TFWA 3M2RA 3T8TA 4HTIA 3BJOA 3ZQFA 4DL7A 2DDAA 3TAMA 4DG1A 2XQCA 2IPOB 2IA2A 4DLEA 1NG7A 3RAQA 3CQZJ 3CMQA 3FBCA 2HPIA 4I0AA 2PFFB 4NLQA 5HSPA 4P75A 3HO1A 5LM7E 3KP4A 4LF5J 1TL1B 3NWTA 2DGOA 4DV1J 4U7CA 3IBWA 2R8IA 1YWXA 3W3SA 1TZ0A 2XMVA 3PYDA 3L7OA 1UVLA 1U47A 4B9SA 2W9BB 1V6HA 2GM4A 4RLQA 3GIIA 1Q7LB 4RAZA 1NTCA 5F27A 5KFTA 1R8CA 3J80Y 3VYRB 3GTGJ 1F9FA 1P8GA 2X6WA 4QR0A 3UN5A 3K4KA 4DSFA 3H98A 5DLFA 2E5IA 2BZTA 4ZJQA 3TUZC 1U26A 4PK4A 3I64A 3R1HA 1Z7LA 2DKOB 1RWVB 3KP3A 1Y1WJ 2LKZA 2CWXA 1W2BR 2ZCWA 2OC6A 5CYVA 1VFCA 2QLFB 3CP2A 3I55S 2XAFA 5A76A 3RYRA 4EFAC 2AYMA 2JMWA 1TU0B 2VU5A 5C4JJ 4B3MF 2STTA 1LKZA 1YJ7A 1XN7A 2AX0A 3CJ5A 4TY8A 3A4CA 1KHVA 1YJVA 1PG5B 2F8EX 4U96A 1C4CA 1TTYA 4O44A 1NPRA 4BWMA 4QPTA 3G2BA 4O3QA 1R27B 1DU0A 1CS4A 4BC9A 1BC7C 1W5SA 3AAFA 2L5QA 2MABA 3EVMA 1RUNA 1FDAA 2PEHA 2LH9A 4RNMA 1YZ7A 4ZP6A 3WTWC 1TKZA 1ZRFA 2RIJA 4DV0J 5KFCA 2KG0A 2HHXA 3FZBA 1RSCA 1JTYA 2HDCA 3M8ZA 2D1VA 2ZHBA 1A6LA 4OINF 1S48A 4X66J 2PD1A 4UOGA 4UOFA 4PJ0C 2DNGA 2P5LC 3GE9A 1YLFA 4ZVRB 3S2WA 2XSJA 2Y3YA 1RACB 3DC2A 3MOZA 3ABUA 2RKHA 5DDQC 1YKWA 1U5TA 2Z8QA 4L5EA 4LITA 1NPKA 5F0HA 3I59A 3CJTB 4BS9A 5J2NB 1SVLA 1EH7A 3DLLF 3MXHP 3H5NA 4IO9F 4C3JJ 1RAJA 3VVTA 3G71S 2PMHA 2MXYA 3BB5A 1VI7A 2FZKB 2DI3A 1VF9A 1A9NB 2DOEA 3OTOJ 4X62J 3LANA 5HATA 1FKOA 5HO4A 4EM0B 1WJCA 4C0OC 2VD3A 1USTA 3EQLF 1N36F 2R5YB 5LD2C 3KLVA 2M5WA 4RMNA 2ZE2B 1W7PA 5CQEA 1S7OA 3GV7B 3D6HB 3CC4S 3E01A 4R0EA 1JLQA 2IC3B 2H27A 1UEKA 1S5ZA 4H54A 4J9VA 4BXFA 2OQGA 3P9CA 1S1WA 3TO8A 5J1EB 4P1WA 2AJ4A 1QUPA 2BY2A 2E71A 2EFGA 1VC0A 2MB0B 3AL0C 4W90B 4WE1B 4KNYA 1NHKL 3NWGA 2DYRH 4RJVA 3JSMB 4ECRA 1Y1VJ 3I58A 4A3CJ 3QWLA 3DI6A 1ZG5A 2P9EA 3IM8A 4K5SA 2XTJP 2G9WA 2XPUA 2KRFA 4M3GA 3DYAA 2RV8A 4NQWA 1XR6A 1MMAA 2UUTA 3GR0A 3TWZA 4GRSA 2CG4A 5CH7B 2W9AA 2Z58B 3IWZA 5LSRA 1FFWB 1B4AA 2QIFA 3CUNA 4LK0F 5KFNA 2Z2YB 5F8HA 3CCUS 5BOXA 2GX8A 1WORA 1D3WA 3DKDA 4XKWA 5LMNF 5HOOA 3DBHB 3K0LA 3H40A 1IR2A 3AQOA 2GWRA 5LXYA 3CJRB 5EG0B 4OIPF 4ELTA 5AONA 3T5HA 2AYGA 1K1QA 2GA1A 2BQUA 4ES3A 3KHGA 4IUFA 2DNYA 2OQRA 2B9YA 1UELB 3MR7A 1AZSA 3CUQC 1FRMA 1HKSA 3DRSA 4DL3A 2LKXA 4JV5J 4OMZA 1DJ0A 2O3FA 1N5SA 4HA8A 5DLGA 2FSWA 2GZWA 5G0RB 3KYLA 3DDKA 3RTRA 4KISA 4U9RA 2ZJRF 3G6VA 3CC7S 2E1NA 1UA1A 5KFLA 2DY9A 5HLHA 1D5VA 3A8EA 3CE8A 2VFUA 3CCJS 5L1IA 4PXEA 1OMIA 2ISYA 3ZPLA 2GXGA 1UJ5A 3CCVS 2WONA 1FMWA 1XSXA 2CPZA 3R27A 5LRSA 3FSYA 2CRGA 1RK8A 3HOXJ 4CLKA 2RS8A 4E7ZA 4XO0A 4Q2LA 3W6VA 3W7BA 5GTHC 2WSEC 4ENMA 1MJBA 2UXBF 4DS5A 2XGEA 1T0TV 2O0YA 3AFGA 2X1GA 3R5AA 2PEXA 2LF8A 2Y48A 2LLKA 4PUOA 2F4FA 2KYZA 2DPJA 3PX4A 4YUDA 1HDDC 2FNAA 2Y9HA 3G3ZA 2OIHA 1M5HA 1BY9A 4ILMA 1VK8A 3HHDA 4IRCA 3IAM9 1G3WA 2ASDA 4I99C 3D6FB 1NB2A 2UV8A 2M3DA 3OTBA 2NS0A 3W60A 4D3HA 2O67A 2V67A 2IM1A 1XTZA 4C8NA 2RE1A 4J5OA 2CQNA 4WK8F 1YX5A 2V0NA 4IHYA 2V4JB 4ZVQB 1H72C 1ZETA 3IP4B 3Q0UA 4Y52J 4AYBN 2DPIA 3E2EA 1F0XA 4RM3A 3GO5A 4W92B 3R5DA 2KM8C 1J59A 2F5CA 2JEFA 4B9MA 4TV7A 4HVZA 1D0YA 1S1VB 4CCMA 3R60A 1IR1A 1AKHA 4EEFG 2DHAA 2XO6A 4UNOA 4X0GA 1T33A 3K10A 3LTOA 3GR1A 4CRJA 1HBNB 1PAEX 3SQOP 1CJUB 2L01A 1UFLA 5A0YA 2D3ZA 2L3MA 2DQRA 2E1AA 2CJAA 2PEBA 2HOEA 1IXRC 4ZKAA 1TAUA 1VQ6I 1QJHA 3HHLB 3P96A 1NKEA 2DR5A 5B08A 4JOUA 3QNWB 2Z16A 1XNRF 5HL7Q 1SC1B 1S59A 3F21A 5SZTA 5J1YA 3KPHA 3DTKA 3OW2R 4DX5A 2IA0A 3ZGKA 2JPBA 4LG0A 4DV7J 3L2CA 4ALZA 1CJVA 1T9UA 4GVBA 1VQ7I 1JXLA 4OHVA 4E7JA 3SFZA 3QRPA 1KRPA 2ZWOA 2HWTA 3E1SA 2Z3YA 1T8IA 4NRTA 3N4MA 1R4NB 2LKSA 3TARA 2XZWA 3CLOA 4MH8A 1OYIA 2Q2EA 4XN3A 1UPPA 4A8KA 5LGNA 1QZYA 3IH4A 1IN0A 1EB0A 2VKVA 2YX7A 1KOHA 4WU2A 4PPZA 4OIOF 2MZQA 2FJAB 2OELA 2BW3A 1HQ2A 2K1RB 2F4OB 3HDSA 2DGVA 5D8HB 1ZAWA 1NH7A 2MLXA 2V6AA 1T05A 4B3AA 1FHTA 3ITHA 4KSEB 3LA7A 3M9MB 1GUUA 1BXNA 2RU3A 2QLWA 2XZDB 1I3AA 1TUGB 1ZM9A 1M5PC 2JJ7A 2XZTB 2HHUA 4MIBA 2CVIA 4HQMA 2PDAA 2R3SA 3T1HF 3FRYA 1J0RA 3T0YA 1WI3A 3NS6A 1U7LA 2WTEA 3SQGB 2GV1A 2MJUA 4J19A 4OMYA 1AW0A 1ACMB 2KT2A 3ONQA 5HN0A 2KG1A 4DQSA 4XNFA 3JCUC 4N4NB 1VK3A 1CLFA 5MAOA 1MW7A 4K4ZA 2JA7J 1K9MT 2V9KA 3Q0VA 3PRDA 3C14B 5D15A 1MKMA 2G9OA 1N48A 2DA3A 4ZIVA 2Q0OA 1WC4A 1FRJA 4MKYA 3J81Y 4IOCQ 1U2WA 3CVKA 2J8AA 3F8MA 1DU6A 1X31C 3KJNB 4M63A 4HH0A 1Q16B 2R4FA 2RQQA 3FBBA 2RSQA 3QATA 3X3UA 1HCRA 2ELHA 2EWHA 2ZZMA 2FRHA 5DTDA 1TC3C 1OISA 2JVOA 2CVEA 1WG1A 4DR2J 2WAFA 2H6CA 3PO3J 3FK7A 1FYLA 4II3A 1U48A 3PW4A 3E6MA 1RABB 4AU7A 4C8OA 2BE2A 2YPZA 5DS7A 2HFUA 4HACA 2EFOA 1X1BA 5ICEA 2WB1D 2FLOA 4U6PA 3L09A 2DOAA 3AHPA 1N33J 1HL6A 1RT7B 4ITSA 3PR5B 1P4XA 2VG7A 1NK2P 4KT0C 4HR2A 1N36J 3CEDA 3TBIA 2CQPA 2OD6A 4ZPDA 3KEQA 3UD5A 4P10A 3S3NA 1DGWY 3CCMI 1ON2A 1JLAA 3ERED 2B0GA 1NO8A 1JGGA 2AGPA 4M5NA 3RDIA 4L9NA 5KFDA 3NGSA 3OWTA 1VBXA 4GMKA 5HMWA 3HP6A 4JI0J 4KFCA 1RTIB 4KHRA 1D1CA 1HBNA 3S1MJ 1WKJA 3TJAA 1GFWB 1N88A 1KQKA 3W9JA 4OX8A 3RZAA 3QPSA 2QL5B 3B73A 1FX2A 4L5IA 1OWXA 2NVTJ 3WX8A 3AOBA 1ZLJA 1IKXA 3ECOA 3AJ2A 3M2UB 3KJQB 2H65B 2UU9J 2OU2A 2XIGA 1IBCB 4FYXB 4CH7A 2ZD1A 5FROA 3H42A 1HW5A 3P6YC 2HFNA 3OTCA 1FT9A 2ZH5A 2ZC2A 1RI7A 4U7BA 2DODA 1U09A 4Y2CA 1ONVA 2QSFX 2R7WA 4KAIA 3CP8A 2N4DA 5BS6A 2EV5A 4JP0A 1R5ID 3M8WA 3PQJA 2J76E 1MU2B 2JSPA 2B6AB 3TQEA 3E51A 5KFHA 4L0ZB 5E33A 4JI6J 2HNZA 1MH3A 1J2VA 3KFWX 4J9UE 4ID8A 3MPUB 3VYTB 4DXLA 1RU2A 2X0LA 5G0RA 2DXIA 3BBCA 1X5TA 4HF0A 3W61A 2D7SA 3J7YI 4BQQA 2VBWA 2VUMJ 3D28A 1OPIA 2AV5A 4M9ZA 4PPDA 3DV8A 3F22A 3NQOA 3I4HX 2E36A 4A46A 3KG0A 4EATA 3S93A 1IN6A 2EZKA 1VMBA 2H51B 2OUMA 2P4WA 3R97A 3HULA 5FD5A 1KNZA 3PACA 2AJFE 4OV6A 2L9DA 4ED6A 1OCTC 2DMPA 2C1EB 3DOMA 3PX0A 5BJRA 3LQVA 4IJAA 5HP1B 1PVEA 2KI2A 1N25A 2BVZA 4DL2A 4ED0A 3MWMA 1U3EM 2AYBA 1DUXC 5FKLA 1Q8IA 4TQRA 4EGLA 3M9NB 4A3EJ 5LRRA 3ZTOA 3MECA 4NLUA 3DYAB 5EG0A 3F6VA 3GSDA 2VZ9A 1LW2B 3FX3A 1XNRJ 2OF7A 4ZH4F 2MTLA 1N32J 4KO0B 5L3FA 5KT6A 2EB7A 1IKWA 2ZNZA 3KYCB 3QYEA 4OI3A 3QWUA 2RDIA 3VZIA 1SUQB 2BJ8A 2V8DA 2ACJA 2K7JA 2YKNB 1NCLA 1VRTA 4Y2AA 4YDXA 2FQ4A 3LWMA 3DOLB 4QCLA 1EQ0A 3HHGA 4DL0C 1U4BA 4XN0A 4DFJA 2PE8A 1KQGB 5LEKA 5K14B 4FF3A 3HSZA 2HKXA 3DN9A 2Q8KA 4O3MA 1HBOA 5J4VA 2F4VF 5C44J 3WTTC 4PXDA 4DR1J 3MKLA 4QYRA 1SCJB 3OYAA 5D5VB 4YG2F 1FRLA 8RUCA 3OOUA 1NK3P 2J5AA 1RT1B 1IJWC 2XGQA 3FDYA 2EZHA 2G2OA 2LXUA 2DYAA 2CV1A 3NEUA 4B17A 3Q8QB 2J7UA 3CIMA 3FM5A 3B78A 2QBYB 2E60A 1MZBA 2IP2A 1S7EA 1ZG1A 3MZIA 4AIDA 3DEEA 1ZPWX 2BOAA 4G1PA 3TJ8A 4HW0A 1O4XA 2VPZB 4DPUA 3KCCA 3E01B 2AP6A 1BW6A 2E1PA 2M0GB 3SI8A 2DIUA 3IC7A 1Q95G 1Q8LA 4KGVB 1HWJA 1U1KA 2RS2A 1D0EA 3CMES 1MBGA 3HK2A 1IRXA 2EPFA 2VV5A 3HM5A 2VQEF 2EG2A 1TWFJ 1XMOF 3NNCA 1S3JA 3VEPA 2H48B 2OFGX 3FK4A 2GXBA 1X3ZB 3EGZA 1VHIA 1Y5LB 3BC8A 3TA2A 1QU3A 4DZDA 1U0HA 1ULYA 1MU2A 2B9EA 1UVMA 1NXIA 4U7DA 2HFVA 5AIQA 2CQ0A 4FPRA 1MMNA 4PWUA 4N4OB 1QDUB 4RKUC 2X1FA 4J9NA 3KYDB 2WBRA 3K57A 4L5JA 3N5BA 2NRAC 2FVCA 3DLJA 5F8LA 4DR4J 3CCTA 5KFFA 2CZVC 2DNNA 3MKWB 2XY6A 2P6TA 2CPDA 1WHUA 2CV0A 3ZZZA 2O61A 5KT4A 2J9CA 1MWYA 4LF8F 2CJYB 3OUYB 4ANJA 3JSOA 3M6UA 3CJKB 3QLHB 4KHPF 1IKXB 3Q8PB 5F1JA 1FDNA 1N33F 2FYXA 2RU9A 2XWXA 2W7PA 2KVQE 2FD2A 4ZVTB 5E3OA 4UUVA 3PYGA 1TL3B 4E4HA 2YKNA 3V4IA 5IM0A 3DRYA 2ZO4A 2C2NA 2JHEA 2XF7A 2NAZA 2ZHAA 1B0PA 2YQ1A 4P2FA 4DCJB 1OR7C 1HLVA 3D6MB 3SYZA 3CO6C 1QA6A 3KIOA 1FOXA 2B4PA 4OL8A 2QLJB 3W3CA 5M3FJ 4TXSA 4S04A 2EBIA 5E7OB 2NUHA 2EXUA 3BCBA 3GQCA 4BHPA 5J2MB 5EEHA 4OX6A 3RKQA 3MFHA 1NJIT 4JI4J 2W2OP 2YX1A 5KFAA 1L3KA 2CPFA 4CLZA 3PV8A 2QCOA 3X1LB 4ECUA 3OYBA 1BWEA 2ZOGA 2CWKA 4WWCA 2J9DE 1O3TA 4NLDA 1KLMA 3AL0B 5J8CA 4JK1X 1ETVA 1V5IB 5IPAA 2V8HA 2I2YA 1NAQA 2XRLA 4ZMMA 5D6GA 2F5DA 4DJAA 5CYJA 1YI2I 4MT1A 3B6BA 1OY8A 2CPEA 2XYHB 4I2QA 2DOFA 3TAMB 4DG1B 5L46A 1EZZB 3M2RB 1VQOS 2A10A 1F5AA 3WTSC 3BEGB 2ZEJA 2B4OA 4QWEA 1Y0HA 4I69A 2HWIA 2VJVA 4CNZA 2A5WA 1MJAA 3G8TA 2AYEA 3TEGA 4FS2A 2YU3A 3FMRA 4LF9F 4UUWA 5H2FC 1R31A 2FJWA 2OO4A 1W25A 5JHFA 5HNHA 1JLFB 1YG2A 1LVAA 3RKWA 3ROUA 1APSA 3G4SS 2EINH 2KHCA 1W4MA 1B8IB 3HSJA 3HZJA 3MDFA 1YLXA 2UXDF 1YBUA 4QZVB 4H4KA 3P4UB 2D41A 1IWAA 1R9TJ 1FSHA 3Q8SB 3FXJA 3F3XA 1FXRA 4AXIA 1U1PA 1CJKA 4G3IA 2DA4A 1BL0A 1RPWA 4ZDLA 2EIJH 2J5PA 1ZAVA 4XLAA 4Y13A 2HLTA 1RRJA 2GGPA 5F64A 4DR7J 1QVTA 3HHHA 1TVRB 4IRIA 1WJEA 5D3GB 1AT1B 2ZJPF 1SFEA 3TNVA 4LLNA 4H4MB 4ECTA 3W2AA 2NXNB 2ZMEA 1JKHA 1FKPB 3V5RA 1T03A 3R6GB 2BMBA 2MKIA 5C25B 1V4RA 2WVBA 3NRBA 1HOMA 2V1UA 2KJVA 1CJTB 1OQ6A 1TVRA 5D5UB 4KN4X 2PLYA 4BE0A 1IRGA 3RPUD 3O44A 1EV7A 2BE2B 3KHLA 4YB1P 1JNRB 2QFJA 3REOA 1TKTB 4ICLB 5K8OA 1VQLS 2FVRA 3ZO7A 5TJJA 3DLLQ 4WWSA 3K8VA 1WSVA 1DGRM 3ZMSA 1VQ4S 5GPCA 3GUDA 2LDUA 1U9NA 3RUBL 1YDLA 5FGMA 3N6NA 4O23A 3NOGA 2VG7B 2GOMA 4B3XA 2D74B 4XLPF 4KGZB 2CW8A 1VOMA 1UHWA 2VOOA 4E7SA 3KLGB 1L3VA 2YQ0A 1X7VA 1YJNI 4NDLA 3BPXA 1BBYA 2UXDJ 3HGGA 2HS0A 2IVYA 1HNWF 2BW7A 1D9FA 1FWPA 2B56A 3BZQA 2IPQX 3DPLC 1X9SA 2W7OA 1L0OC 2RHSB 4UF4A 4L9JA 3WTVC 3BSOA 4RB1A 2RAEA 4OWRB 1N6QB 2V6EA 4R5PB 3SHFA 4IHSA 2WVCA 3LA0A 3C2PA 3TDZC 2IBDA 5KT3A 2WVFA 4I2OA 3Q3SA 3VAHA 4IG0A 3W8GA 1KEKA 3K89A 3CB4A 1MSWD 5KFQA 3WC0A 3BR0A 1RWUA 3ZQQA 4MYUA 1FIAA 4UUSA 3I56I 1UMJA 5CYMB 3WBZA 2CDRB 3R8YA 3CULA 1TT5B 2OPRA 1G1XA 2MLZA 1JTXA 4WKRA 2RB7A 3L2WA 3W5XA 1WF2A 1GMWD 1KOOA 1L5UA 2AO9A 2ACYA 1Q81T 3IM9A 1TBXA 5KNLA 3H2UB 4ENKA 3K7RA 3WC2A 3HOWJ 2M1BA 1TWHJ 2JRSA 1AWCA 5HDNA 2PJRB 4A3GJ 1K44A 4U0YA 5DD8A 3S16J 4EM1A 4KGXB 3TW7A 2ZM6F 1T9WA 1EKSA 2H8RA 1U8RA 1RUOA 1FMVA 2Z57B 2KFZA 3MR6A 4UZCA 3ENAA 3PG9A 1VQ7S 2DTJA 3H5RA 5A6WA 2FBHA 4I2PA 2K9LA 2L9SA 1H38A 2HNYA 1QQIA 1T11A 4FE7A 4K50A 1CF7A 2ELJA 1NK0A 3A8JA 3R3TA 1J5EF 4A8OA 3F41A 5C2CA 1ZN2A 1VNDA 4UOHA 3ZP5A 1FNXH 1BIAA 3CCSI 1STZA 2A6HF 3CDLA 2CNLB 1E6VB 4F67A 1WELA 1LWFB 1T98A 1R7IA 4ED4A 4KC5A 4ZYAA 3U2RA 4EVIA 3CCSS 3C7JA 4HNVA 5I42B 2KZMA 4URQU 1FO1A 3H2VE 4AIKA 4YFNF 2WV0A 3QGGA 4F91B 4B1RA 3WGHA 4EJTA 4TYBA 3N79A 1L3UA 3UR0A 1Z0XA 4OJ3A 2VJIA 1U2RA 3ADAC 1R58A 2CJ9A 2LVWA 2MKJA 1CJTA 4KJZA 1IZ1A 4ID5B 4ED3A 3IC1A 2CZ9A 1ON1A 1JLCB 2HHSA 3OIQA 2UXXA 2Z2SB 2L9NA 5F1RA 2WBMA 1KR4A 1UAAA 1P1TA 4LRDA 1ZM4A 3H59A 2ZH6A 1VJWA 1ZPVA 3JW4A 3RPUA 4M5MA 1NK8A 4N76A 2IIHA 1HSJA 2HNHA 4AFFA 1PYTA 2MDAA 3NOCA 2ZKZA 2XY5A 1X0PA 4HYEA 4WP9A 3C6UB 1U8SA 4C2TA 2IJLA 1WTBA 2N7CA 4HAMA 4BBYA 4NUBA 2FHKA 2H09A 3BZCA 2PFBA 3PNIA 4HX7A 2GOXB 2VBXA 4DFPA 4B9TA 2IEKA 1S79A 4JB8B 4BHBA 2HNDA 4DUTA 3R7NB 2DA6A 1MBEA 3RGIA 3E97A 2XNQA 4B02A 4ENNA 4G9YA 1YW8A 3O5TB 4A93J 4A3BJ 3HGYA 1X4HA 4ZYEA 1Y0NA 4HYKA 4WJBA 1LK7A 1EP4A 1NZ8A 2UZKA 1YS7A 3D6TB 2WW4A 1H7XA 4Q0BA 3FMWA 1DAXA 2ZOFA 3TL4X 3EYIA 3SSRA 3TUIC 3LQQA 2W25A 3RRKA 4I98B 3OR2B 4V2GA 1G6BA 5BPIA 2O8XA 4LSZB 1SMTA 5JVTA 2ACMA 3DLKA 4A6DA 4HT7A 2MGZB 2RC4A 3M1VB 3IH3A 1XQIA 2MJNA 2R2TA 3MCZA 1BUXA 3A0HC 2JVHA 1JK9B 2UXBJ 3U1DA 4CO4A 5IV3A 4WTYA 2VIXA 3AJDA 4O6JA 3QU6A 2K8GA 2R2UA 3W5YA 4Y3OA 3L2QA 1D1BA 3ET6A 3DEWA 4KUMA 3H3UA 2NQPA 5GAEI 3CJ8A 4JI3F 5D6EA 3A3OB 2PN6A 1SC4B 4Y33A 3UDCA 1G4DA 5FJ8J 1U45A 5JUMA 5IOLA 2E1CA 2AZ1A 1I6JA 2DFHA 1PKUA 2X48A 3NS7B 2PIIA 3KMSA 3I82A 2F2EA 3A8IA 3F23A 4LIUA 1IXCA 4OI4A 3UD4P 4OZLA 2BR0A 4JI7F 4LOCA 5EUHA 3BG9A 1C0TA 3UW1A 1I5OB 4DV3J 4IFVB 4J9QA 3BM7A 4HH1A 2DXDA 2DK2A 4DSIA 4KYZA 5K5MA 2QV6A 3PSFA 1UJ8A 3E6CC 5E0OA 2D9PA 3SFIA 4BHQA 3V6KA 2O1PA 3FEZA 2YKMB 2DGXA 4ZVUB 1XMQF 3GIMA 4ECZA 4BXXJ 4FYVB 4BQNA 3C6TB 5HJYA 2CQ2A 2M87A 4YIFA 1VQMI 2EC0A 3VTIA 1BIBA 3RAXA 2JRMA 2HMIB 1RHKB 3KLHB 1VQ9I 2FHOB 1N8RT 1TL8A 1FOYA 4JX5A 4Q47A 2DR7A 1U2FA 3HVTB 5LMUF 4HI1A 1NK4A 3PJXA 3EUNA 3I6PA 1B7FA 5BQTA 2ZXHA 1Y5IB 2HZTA 4XLFA 1IKYB 3ZQCA 4PEOA 2OPRB 2O8KA 1UFKA 1Z3YA 3K17A 4JBCA 1WSRA 3NS5A 4A8MP 2DTRA 1AB8A 3ML6A 3I55I 3K70D 2QGUA 3JRCA 4A8WA 2RNGA 4DZPA 4DSKA 4XRMA 4U7UD 1UHMA 3DLHA 2I5JA 3ELHA 1FDDA 3EDPA 1LPQA 4PWDB 1ITYA 1HR0F 4OX9F 5F8MA 2CSOA 5ICGA 1IQTA 2R5ZA 1CULB 1CG2A 3SQNA 1J9IA 4OZ5A 2LP4A 1TKTA 2EK6A 4LF5F 5E3RA 4K4SA 2G0CA 2L2OA 1MDMA 1HNVB 2FJVA 2HVEA 2E5LF 2HQ3A 1V3SA 3RI4A 3EETA 4Y0FA 3FHZA 2HWHA 3MI7X 1TWCJ 4KKOA 1FJGJ 3CPWR 3M2VB 4NCGB 4OHWA 4M1KA 2K27A 2VT3A 3R5GA 2GBYA 3JRBA 4CDGA 5I3QA 1GMWA 2BDPA 4ICLA 5MLCV 1DDNA 2RQCA 1OCPA 4P2MA 2QKLB 3D0HE 1FSEA 4O4RA 2VKEA 2K86A 3KE2A 3ZQLA 3V4GA 4KKOB 2D3O1 4RNHA 5KOWA 1WJAA 3TUJC 2KFDA 1OFCX 2NXNA 3NGUA 3NP5A 3QSIA 3A02A 1H2UX 3JSMA 1R1TA 3EWGA 5GADI 3OYKA 3UKGA 2IS1A 4XRFA 3IRQA 4DX7A 2K3IA 3KETA 2HRTA 3AB2B 3CJSA 3NXZA 4HNTA 4P55A 3LFKA 1TP7A 3UDEA 1I94J 1K7AA 2DNRA 4Q44A 4MIMA 4QPXA 3ISNC 3PO4A 3E5QA 3GTYX 3S32A 4JYKA 1A36A 2DNHA 4WZQA 1M5OC 2GIFA 4IEJA 1WF1A 3HDDA 2HOTA 3CO0P 4E7LA 2R2RA 1R0AB 4CUGA 3TYTA 1SKRA 2GIRA 2CQDA 1RCOB 4V19X 1XC9A 1Y11A 2UP1A 4PKDB 4OHXA 4YB7A 4YFXF 2V26A 1UFMA 3BPVA 1A5JA 2HYJA 4PYAA 3PX6A 1A04A 1UFWA 2ZBKA 1JJ8C 1E3HA 1KVKA 5KFSA 1DARA 2Z0GA 2PGCA 1FEXA 4HPQA 1XGNA 2WA0A 1YJUA 2Q6BA 3I31A 2W1BA 4CCHA 1EH6A 1X1AA 3CT9A 4XLEA 3MM6B 3BJ6A 1LK5A 3MMAA 4XLNF 5GAEU 3K9TA 1MSEC 4I56A 4WXWA 4M3FA 1ZA2B 1ZTWA 2ZMEC 4UY8I 1IN7A 2XMWA 3I5BA 3ZRGA 4KE5A 2KPMA 3GFHA 4U67Q 2BY0A 1QE1A 1QO0D 2DPUA 3JS9A 1SQFA 4H0EA 1O7LA 1RGVA 2HK3A 3MMYB 4B3MJ 1RUSA 5B1BH 3ZMTA 4WFAQ 2EG1A 2M0MA 2A07F 3MZ8A 5I3UA 1WZ2A 1B99A 1E0EA 4HNUA 3KK3A 2MLGA 2HKOA 1CF7B 5D0EA 1SJFA 1R1VA 2L9RA 3MCOA 2N8GA 5L1LA 2V1DA 1J5OA 2JTVA 2OPPB 1YI2S 5LJ5Y 2V94A 1FA0A 1VYAA 4EMSA 4IQMA 5H6RA 1NHAA 1HSTA 2QJ3A 5D78A 4XTTA 5CCMA 5DUIA 2JDJA 2JA8J 3MAAB 5HAOA 2A68F 2HRYA 4MQ9F 3GXOA 3ZZYA 3VQTA 5DDRC 3G73A 2PSZA 1V5FA 2OPQA 1DTQB 5L1KA 3QOEA 1SANA 3CTAA 2FQ3A 5HVHA 1U8WA 2ZXWH 1ETQA 1T9YA 3KJVB 3MCNA 3CDHA 1YIOA 3JTGA 4IRKA 3UN3A 1L3SA 3IAM2 1UWAA 2P6SA 2G0JA 2VB6A 1SC6A 4L6V3 4ED5A 2EK1A 5EHHA 1MGTA 1NDCA 3K5LA 3FKJA 3VAFA 2VG6B 4M8LA 4YY3F 3MCSA 1HW2A 1X4EA 5CVUA 4ZYHA 4ZVGA 2DVIA 3K1PA 3ETMA 1ZAOA 2KT5A 1JE8A 3QBCA 1XX5A 5T41A 1HQCA 5BYSA 5JLXA 1REVB 1JX4A 3KLIA 2XAUA 2ZH2A 3CCQI 2WK4A 4ATNA 2QRRA 4J9MA 4L3NA 2KFYA 4OYBA 3VQSA 3SQGA 1RTHB 2W1OA 4AD6A 4AM3A 2OTLS 3FSXA 5IYCJ 4FKXA 4Y17A 3JRFA 4ZVSB 4I0BA 3RR7A 1Y0UA 1WF0A 1WOSA 3LF0A 3KZIC 2DHGA 2CA9A 4DCPB 3I0TA 3M4OJ 4XMYA 1IBKF 4ZYDA 1FTZA 2BJ9A 5EEAA 2DR9A 1O8BA 5IFMA 1X2NA 4UXNA 4N0BA 3CCMS 1U02A 2TCTA 2EA2A 3C16A 2NPFA 2J6UA 4RLFA 3BJAA 2V9PA 5GMKa 1HNXJ 3PIOF 1SD4A 4EJWA 4CT8A 1ETOA 2ROEA 3ICLA 2FMYA 3KP5A 4E6KG 5A2QZ 2KRBA 4IH7A 3OVAA 5LSOA 3DCAA 3ZZRA 5EWEA 2UVWA 3R0JA 3CJ3A 5C25A 5J2MA 2V8VA 4XIDA 2MLKA 5B3SH 2QLBB 3OSGA 6PAXA 2L48A 1XMAA 2D5VA 4C2MJ 4CO2A 4GC6A 3DI6B 4C98A 2MC4A 4IDKB 4KMUX 3T5JA 1R0BG 5IXUA 3GIJA 4HOBA 5DV5A 3TQNA 2VDHA 3ZMVA 4NEZA 4FCYA 4O0IA 2NS7A 1HKTA 4HACB 3ZQ7A 1F43A 2IAJB 4FYWB 1UEVA 4ZVOB 1ZG3A 3G4SI 4BJTA 1CULA 3P5BP 3HOVJ 3KDOA 2FBIA 2MKCA 2M70A 4GDFA 5HMYA 4F02A 1Y4ZB 2BHZA 2FX0A 1UCRA 1RR7A 3Q9SA 5GP9A 3E0JB 1B8IA 2YKOA 4FF4A 2XS2A 3BS9A 5KFYA 3BSNA 2COMA 1MDMB 3VWBA 1HNVA 4A8FA 2FGOA 1IR0A 5D0RA 2Z30B 4X4QA 2O3DA 4XDDA 1QAYA 5F9LA 2KXFA 1R71A 2KQRA 3PDNA 1VQ4I 4Q0BB 4LBPA 3Q89A 3FMSA 1Z2ZA 4Y2MA 2E2IJ 2HURA 5HVQC 4NRUA 4RU2A 1FWKA 1FE4A 3I87A 3NL0A 1HI0P 5H1SV 3M8RA 3PJWA 4EGYA 2R7VA 3O1LA 1YW7A 3HHEA 3C15B 4C9YA 1H98A 1VISA 2RH3A 1T56A 1D9DA 1DHMA 4IYQA 4BACA 2NS8A 3DWLE 1FD8A 2WAQA 1EKRA 1U5TB 4LR8A 3K58A 3OYJA 4GC7A 2W82A 2K3KA 1IUFA 1QTNB 3MAJA 2EFPA 1N34J 1GX5A 1TKXA 2G13A 3CDAA 4PJNA 5HQMA 3IWXA 1I94F 5KCMA 3LW5C 4A8XA 3H1CA 4NEYA 4Y7NJ 1FXDA 3NCPA 4YHHJ 3J7Z5 2B0LA 1SD7A 3NAIA 1YRTA 1HPZB 3C2GA 2ZBCA 1S9HA 3W8PA 1TZLA 1KBRA 2HEKA 1K61A 1QAIA 3HT0A 3OSPA 3B02A 2XSFA 3RW6A 1NSAA 5K14A 2HFHA 4IG0B 1QHHD 1WQ2A 2BOLA 2E5NA 2IS2A 2RGVA 5E1ZB 3DHXA 1UJ6A 5ERIA 2W2NP 2IGOA 8ATCB 4XLCA 3LQRA 2XKPA 2D3UA 3QODA 4RB2C 3VGVA 1EA3A 3JRAA 5F0CA 2N82B 4ZA1A 4TY8B 3DLAA 2L7MP 4D5FA 1RWOB 1KFSA 2ICWG 1WKLA 2NYIA 2COBA 2XSDC 3V81A 2F1FA 4AUXA 2WAQD 3GG0A 3MF5A 5KFIA 4BY1J 4M3BA 1QPMA 3CCRI 3CD5A 2W4DA 1LWCB 2HGCA 1S9EA 1YOVB 1VR6A 3QYYA 2HQGA 4X84A 2FTRA 3M6WA 2V5HG 3EJMA 4BEHB 2UUCF 2VOPA 2NLWA 5B7WA 5HLFA 2FUG2 5E17F 1EETB 3PFOA 2C28A 3H5SA 2CUYA 4PZJA 3D2WA 3TJ9A 2R42A 4QIEA 2GJ2A 1HC8A 2W24A 2YSRA 3QAUA 2OCCH 1KONA 2I38A 4P5OA 2GVZB 1Z7UA 4Y65A 3GFYA 2KRHA 4XAKA 2D45A 1AKHB 5E1XA 1DQAA 4BDZA 1XN9A 3BSCA 3KXDA 3UR3C 4JI1J 2HBQB 1OMSA 2CPXA 3ILJA 2XB5A 2UUAJ 4M72A 3D5RC 3PW2A 4ERDA 1PYVA 4J91A 3N28A 4F52A 2E34A 3EE3A 3MN2A 2DA2A 1EH8A 4I1TA 4MFEA 1LW0B 3RB0A 4HL9A 5CAAA 1N78A 4JYAJ 3DBRB 1ZGAA 1OYYA 2N4CA 1TW2A 4X4PA 2KL8A 1QVFR 4E2FB 1LEOA 3GBGA 4QU6A 3OTDA 3E5UA 4EJOA 2Y31A 3POTB 2E9RX 1X4CA 2OPSB 1JLQB 2X4HA 1M1HA 1VQ8S 1QAXA 2BGCA 4HTJA 2B7BB 4KFBA 3CCZA 4Q5VA 3OV8A 1HBXG 3S6EA 5D5WB 2MZSA 4ANEA 3MR5A 3DRRB 1RWNB 3VFZA 3GV8B 1LFUP 1PJ5A 3G96A 3HXLA 2QTWA 1CBKA 1FERA 4CLWA 6AT1B 1KQ0A 4PG8A 2LVSA 3WGGA 3LSHA 3M7GA 4NZ7A 1TK5A 5THWA 1R23A 2MSSA 2FDNA 1WGXA 4E7IA 5A8WA 2LQJA 2QG9B 2OI2A 4I4BA 2XV4S 1KFDA 5AT1B 1RTJB 2J0WA 3BKTA 2B3TB 2Y9YA 4KPYA 1AYEA 3JTNA 2YR2A 2OPTA 4USUA 4BUPA 4DFMA 1CGPA 4MHGA 3AG4H 3M32A 4ZITA 2PG4A 2FVQA 4NCBA 4FASD 3SCLE 3ZTSA 3NBPA 3LAPA 1QGPA 1IF1A 2NYHA 1HW1A 2JNJA 5HK4A 4A2UA 1IBLF