4PCQA

Crystal structure of mtbaldr (rv2779c)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
ELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulatory protein (Probably Lrp/As
publication title Crystal structure of MtbAldR
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 31
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pcqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pcqA02
3F3XA 4HV6A 2GZWA 2OZ6A 3TO9A 3E6DA 3HUGA 1KGSA 2XGXA 3J81Z 4CGZA 5L3EA 3WG9A 1K7AA 5FB2A 2HQNA 1XMAA 3ZMDA 4K2EA 3EETA 2NS0A 5LRRA 2OD5A 4NB5A 5BMZA 5HS7A 1Q1HA 2QWWA 2QLZA 1G3WA 2RQPA 2E1NA 1KQ0A 2FMYA 3KZYA 5HS9A 1K78A 1QGPA 5BS6A 2Y0MA 1UFMA 1U6GA 1Z7UA 1O3TA 2QENA 4HF0A 1FLIA 3H3UA 5E18F 1OKRA 5ILSA 1J2XA 5DD8A 1E2XA 2R3SA 2VC1A 2IA0A 3P9KA 1K79A 3DXJF 2NYXA 2F5FA 1MJAA 2NNNA 1USSA 3DEUA 1B9NA 1ZN2A 4IHSA 1DPUA 5FD6A 2CFXA 1RI7A 2EWNA 4LG0B 3B02A 2Z33A 2BBYA 1YS7A 3IKTA 5LGUA 4LK0F 4KIFA 1MJBA 2RNJA 4Z2YA 5AONA 2M30A 1UB9A 3LSTA 4UVAA 4FX4A 1U5TC 3QP5A 3WTUC 2YPRA 2HS5A 1D3YA 6PAXA 2Q0OA 3FXQA 4EMSA 5DUIA 4G6QA 2P6SA 5HVQC 5ILVA 2M5WA 2STTA 1H9GA 3VEPA 2D1VA 1FBQA 3PQKA 4AD9A 1R5GA 5CVJA 2LF7A 3F23A 2B0LA 1SD5A 3T1BA 5KK1A 1SAXA 4L9NA 3I54A 4Y15A 3C3WA 1B9MA 3IL2A 3QU3A 2CW0F 3RKYA 1ON2A 1YYVA 2CSOA 3V8KA 1XD7A 3KP7A 1DP7P 2OBPA 3HRMA 2KKOA 2WC2A 2BE5F 3ZMUA 1ZLJA 2IRFG 1FBSA 4KNYA 1KYZA 1Z9CA 1W7PB 4AIHA 3ZPLA 4WF2A 1LB2A 3BP8A 4IF4A 1R22A 1DUXC 2XAGA 4G8XA 4A6EA 5D6EA 2NRAC 3WTWC 4U7BA 1BI2A 2D1HA 4ASNA 1IN6A 1W7PD 1BC7C 1HXDA 4IPAA 4LK1F 2M87A 3FF5A 1T0FA 4MEYF 2VE9A 4Y13A 4Q48A 1U5TB 2J5OA 2MLKA 5HS8A 2PN6A 1Z6TA 2W57A 2FA5A 4KYWA 4YFKF 1DPRA 2DQLA 5L3DA 1ZG5A 4YFNF 4N0BA 3SZPA 4UUVA 4ZZDA 4OIQF 2L4MA 1HSTA 4AIJA 5DCFA 5K5QA 4MTDA 5FLXZ 1TNSA 3JTHA 3KE2A 4GCVA 1G3SA 3BJ6A 4CICA 3TQNA 3ISPA 1XGNA 4UV8A 2K4BA 4A0XA 2EFNA 3F6OA 3IRQA 4G9YA 1ZAOA 3EDPA 4JK1X 4L5IA 1P92A 4IJAA 1Z91A 2W24A 2DO7A 2O3FA 3F8NA 4OIOF 1HW1A 3E6MA 1BI3A 1MJ9A 2K7LA 4OOIA 1KQ8A 2CG4A 1ZREA 3I5UA 3CO6C 4UV9A 5JFRA 2A68F 2XKPA 5BPDA 1FOKA 1T38A 1SFXA 3KLOA 3RTRA 2JPCA 2UXXA 1R1VA 4QLCU 4EGYA 4NQWA 1GXQA 1W7PA 1XGSA 2EV6A 5H6RA 3GLXA 1R7JA 4ZH4F 3M1EA 2V1DA 2EJRA 3ML6A 2IJLA 2IA1A 2MH2A 3PFIA 1SD7A 1UHMA 2G9WA 4EM2A 1MD0A 4KUMA 4RGUA 2GWRA 3TO7A 3CDHA 2ZFWA 5F1RA 1G3TA 4OIRF 1ZARA 2PJPA 2XAQA 4M6XA 2IPQX 1FNNA 1IXCA 4ENKA 1SMTA 2UWMA 3Q5FA 2DBBA 3SXYA 3E5QA 5LGNA 2AXLA 3GZ5A 2EA2A 3F72A 4ZYGA 2Q2EA 3NQOA 4HX8A 3SZTA 1TTYA 4ON0A 2HYGD 5CLSA 2PQ8A 2P6TA 1S6LA 3HSFA 2OZUA 2AS5F 4I09A 3GO5A 1KU9A 1UHWA 1ZRDA 1IXSB 3FWEA 4WXHA 5K1YA 1KU3A 3I59A 2XASA 2P5LC 3L00A 3D0SA 1K78B 1B1BA 4U88A 4IHTA 1KA8A 1Z6RA 4KN4X 4B09A 4HF2A 2HR3A 2JT1A 3JW4A 3WGIA 1YIOA 1FZPB 5LBQA 3O3KA 1LJ9A 2Q8KA 1I27A 3DKWA 4MTEA 5J6XA 2HWVA 3C7JA 1GVJA 2FSWA 2XVCA 3DQVC 4FHTA 2QUFA 1R36A 1F5TA 1WI9A 2ZBKA 4NHJA 4MHGA 3KCCA 1BBYA 5H20A 3I4PA 1FP2A 3L9FA 1HKTA 2F2EA 1V3FA 1TLHB 2FXAA 4A6DA 2ZMEA 4QWQA 5LGTA 2J5PA 4XLNF 1P4AA 2Z9OA 4CXFA 3F22A 1S7AA 5F64A 3WE3A 3FXRA 1HW2A 5KVRA 4N9IA 4EV0A 1BI1A 2PBIA 1PP7U 3CTAA 4RB2C 3AAFA 1O7FA 2KIUA 5ICFA 1O3RA 2XHKA 1H9TA 1MKMA 2M45A 5D6FA 3T8RA 1TBXA 2JRTA 1NHAA 3QPTA 4LD5A 3VFZA 3HSEA 3ABUA 2QQ9A 4E70A 1XB4A 1DDNA 2OU2A 2MBFA 4DNCA 1W5SA 1B6AA 2HGCA 1EV7A 3R61A 3H3ZA 4LLGF 4BHBA 3I64A 2NAZA 3K1PA 4M73A 5A2QZ 2FE3A 3BY6A 3FXUA 4WWCA 3H92A 4LJZF 3E6BA 5FO5A 1BJAA 3CJNA 1TQMA 2JSCA 2LKPA 1MGTA 1WQ2A 2RVCA 3U2RA 3G3ZA 3BDDA 3ZMSA 3SFZA 5E8IA 3I71A 3I53A 2GIVA 1FWZA 4GGGA 3HSRA 2JPBA 4LLLA 3DP7A 4RGSA 3M8FA 3RIRA 3D5LA 2VE8A 2BGCA 1LEBA 2C6YA 2STWA 1VTNC 4IRGA 3L7WA 3IRRA 3F21A 2H27A 2IT0A 1O3SA 4HZFA 4A0ZA 4AVPA 4CDGA 4RAYA 1PP8F 2A07F 2XUBA 4LB6B 1Z05A 1IN8A 2HOEA 2GQQA 2KRFA 5HDGA 3N4MA 3BOQA 4P55A 4RGXA 3REOA 5ICEA 2L4AA 3TDUC 3T8TA 4P9UA 2XKOA 1IRFA 1ONVA 1SFUA 4ENJA 2ZBCA 5AIPA 2PMUA 4HLXA 1FC3A 2HQRA 3B73A 3IC7A 3GZ6A 2XAHA 4G94A 5HOOA 1B4AA 3V7RA 3MWMA 2P4WA 2EFPA 1I5ZA 1O7LA 1ULYA 1YTYA 4PGHA 5HLHA 1EH7A 1U2WA 3MZYA 4I0AA 4JQFA 3T0YA 2QYOA 1AWCA 3I58A 2F5CA 1F9NA 3N97A 5EEHA 2IW5A 2A69F 2D2WA 5F6FA 3FZVA 1T39A 3J80K 1YS6A 2O03A 4XLPF 2MC3A 4WXCA 4ZYDA 3ERED 5LHGA 4GYIA 3Q9SA 4MNUA 3EYYA 4CZZA 5D4RA 3DPTA 3LAJA 4PCQA 1J5YA 4KT5C 4EJOA 3MZHA 3GFJA 3T5XA 4EJUA 1GHCA 4U0WA 4FX0A 1WWXA 5TRDA 1LQ1A 4CO8A 5LRSA 3RPQA 1I1GA 1P4XA 3TKYA 5HLIA 2M8EA 2CWEA 1OYYA 3F6VA 3ULQB 3MEXA 2YX7A 1O3QA 4S05A 3RKWA 4RB0A 1ZH5A 2P8TA 2V79A 2FRHA 3MCZA 4I02A 1JGSA 5EEGA 1KU2A 3RPUA 1HW5A 3J80Z 3LWFA 1KQ9A 4IXAA 2VBWA 2FEZA 4EJVA 2XV4S 1FY7A 4LMYA 3DPLC 2HTJA 2QVOA 3HTUA 4UVCA 4Q47A 2OA4A 5JVTA 4P9FA 4PZJA 1U78A 3EYIA 3TO6A 4O5VA 4EQQA 1IW7F 4A5NA 2H6CA 3WTSC 3I59B 2F5DA 2M1BA 3FX3A 1RUOA 1CF7A 5CVVA 5ICGA 4BXUA 1FYKA 2FBKA 2HDCA 3BROA 2CVIA 2V1XA 2H6BA 4MGRA 5E17F 3QOPA 3LQQA 2YX4A 4ENNA 4GO1A 2E7XA 2E1AA 4XSZF 1F1ZA 2OAZA 3QPHA 3MAJA 2ZNYA 1QBJA 4U0YA 1FP1D 3V8LA 3ZMZA 2RV8A 1UCRA 1YG2A 2A5YB 3HHHA 1RIOH 2ZMEB 3QP6A 5DCMA 2IVMA 2A6HF 2GXBA 2KIFA 1P6RA 1YO5C 4R1HA 2VT3A 4KMUX 2E7WA 1BM9A 3NRVA 2XIGA 4A5MA 5D8KB 4B8XA 1S3JA 5J8FA 4G7HF 4BHCA 2Y48A 2RGVA 3Q9VA 4WK8F 3E5UA 4KA4A 3KZZA 2CQKA 3HRUA 2A6EF 2PI0A 1S8NA 1QO0D 4BNCA 1Z1DA 3F8MA 4KICA 3U1DA 4I0BA 1WSUA 2WWYA 2O0YA 1FBUA 2KIMA 4MQ9F 1QZYA 2ESNA 4BHPA 5CYVA 4L9TA 3WU0A 1IAWA 1XMKA 4IRHA 2QBYA 4UHTA 3EQLF 3JAMK 3BPXA 3F8BA 3O2PE 3VOEA 5K5OA 3BJOA 1BIAA 4M72A 3JTGA 5HDKA 2JZYA 3KP3A 1ZRCA 4I2OA 3TOBA 4DQ2A 3EUHA 2IA2A 1T2KA 2Z4PA 1H0MA 5BQTA 3M8EA 3WTXC 1USTA 2RC4A 1TNTA 4M9SA 2EV5A 5D5XB 5ED4A 3NEUA 1Y0UA 2K4JA 1REPC 4N9HA 4ESBA 1SD4A 3KP4A 1ON1A 3QRFF 2DLLA 3WE2A 3C18A 4AWXB 1QPMA 3K1MA 4KMFA 2ZKZA 3SQNA 1GXPA 4AIKA 2DPUA 2HZTA 1FPQA 5K5RA 5ERIA 1YQAA 3HRTA 1CGPA 1ZGJA 1ZRFA 1J7KA 1WKMA 3J7AO 2DFIA 5AIQA 2LNBA 3ABTA 1RUNA 1ZLKA 1XDSA 3J81K 4ENMA 1XSVA 3GFIA 4M6YA 1MZBA 4RS8A 1YW7A 3JAMZ 2YR2A 1STZA 2Z5UA 3O6BB 4S04A 2V1UA 1E17A 4A0YA 2ADUA 2YSRA 1ZHFA 2RDPA 3U9GA 1R5HA 2CYYA 4BH9A 1XSXA 2F5EA 5FGMA 4HV5A 2YU3A 3L2CA 2PEXA 1TQPA 2DAOA 4M74A 3OV8A 3GXOA 5D5VB 5DD4A 3OOPA 3ZP5A 3ELKA 5CVUA 1B59A 1XDUA 3E97A 4HA8A 3LAPA 4ESFA 1QNTA 2PMHA 4HAMA 3TGNA 2XAJA 4EM1A 1LDDA 1RNLA 2TDXA 4O6JA 2MA3A 3C1DA 1MDMA 1OMIA 1SMYF 2PFBA 5D5WB 1G3YA 1JHFA 1BOAA 3K0LA 3FMSA 2RKHA 1IN5A 2O61A 2FMLA 3MQ0A 3R6SA 4YG2F 3GX4X 1XGOA 5BPIA 3ZMTA 5CVRA 5D4SA 3HTSB 2EFQA 4H0EA 5LEKA 3GUDA 1R1TA 1TW3A 1FT9A 1KYWA 3BJAA 3GW2A 2W85A 1AOYA 2DK8A 2EFWA 1TQIA 4HW0A 2O6GE 2VN2A 2GA2A 5D5UB 2KJCA 3KFWX 5E8GA 3MFKA 2MLGA 2DTRA 3WTTC 2QQAA 1O57A 3RJPA 3V7SA 2LF8A 2HFHA 4L0ZB 3E3VA 2FQ3A 2LSOA 2ISZA 1U8RA 2OQGA 5E1WA 2FBHA 5ICCA 5DYMA 2HTSA 4A12A 3F8FA 4D0PA 2W25A 2H09A 4XRFA 2DQRA 2V6CA 4LLNA 4R79A 1K6OA 2L02A 5LEJA 2CGPA 3ECHA 4YFXF 5JHUA 4I01A 4MEXF 1HQCA 2WTEA 2HKOA 2BEOA 1RZ4A 3RYRA 2GAUA 2VOOA 1HSJA 4YIIA 3FM3A 4HBLA 4U0VA 1FYLA 5BOXA 1F4KA 2GA1A 4R8HA 4GYGA 2ZXJA 2R7DA 1IXRC 3E5XA 1ZG1A 3TOAA 4UNOA 4HQEA 5DUKA 1JXSA 1OR7A 5DV5A 2P7VB 5L3FA 1HKQA 5IT9K 4BAYA 1HBXG 3IWZA 3M9AA 1FX7A 4KFCA 5CVIA 1LVAA 1BC8C 4WCGA 2VXZA 4HYEA 1IUYA 2DK5A 1XN7A 1CF7B 2XRNA 1OPCA 4Q4ZF 3K1NA 4EJTA 3K2ZA 1QZZA 4OIPF 3QU6A 3SHFA 3K9TA 3E6CC 3ZQ7A 4M71A 2VONA 2W84A 5DDGA 1W4MA 2FF4A 3LFKA 3GYHX 1LDJA 2DJWA 2HKXA 4U7DA 2VBYA 4RAZA 3COAC 1T98A 4ETSA 2E1CA 4I98B 1P2FA 5LHHA 1C0WA 4WXDA 4GXOA 5FLXK 5DCMB 1XCBA 1D8JA 4HDUA 4L9JA 4L9VA 4EGZA 2FBIA 3GWZA 4HX4A 2JTVA 4L0YB 2UXNA 3PQJA 1OYWA 3W6KB 2DI3A 3RDIA 2MD5A 1D8KA 3DF8A 5HLGA 4WX9A 2VT2A 1FYMA 2G7UA 5IT9Z 1YW8A 5E1XA 1SD6A 5E1ZB 1XGMA 2ISYA 1IN4A 4G6DA 3GFMA 3FMQA 1J0RA 1LEAA 3V4GA 4EM0B 3R4KA 3KP2A 3G73A 5HDNA 5FFXA 4KDPA 4HOBA 1R23A 3LA7A 1XCVA 5JR3A 3LA3A 3K69A 3IKVA 2DT5A 4LG0A 5CJ9A 2QBYB 2CO5A 2P5VA 5TJJA 1BI0A 3IHUA 2K02A 3I0TA 3R60A 3KLNA 3WODF 3IWFA 2V9VA 4A2UA 3GF2A 2XAFA 3V8JA 1PUEE 4P5OA 3CUQC 5FD5A 2BYVE 1R58A 2FU4A 2H94A 3LQRA 3FMRA 4RB1A 3HRSA 3KETA 2XROA 1IN7A 2KJBA 4BQAA 2ZJ2A 3BPVA 5D8LB 2GXGA 1ZGAA 1FSHA 1G4DA 1L0OC 5E20A 5IT3A 1I1SA 4Q5SF 3FM5A 2PG4A 1ODDA 4UXNA 5H6QA 4OMYA 2JSXA 4HDVA 3CUOA 1R1UA 3ZMVA 4ZZLA 2D45A 2O8XA 3HOSA 1L3LA 4EVIA 4BYYA 1W5TA 1TW2A 4MQVA 3JSPA 2X4HA 2EV0A 3HYIA 2FNAA 3ZN1A 3DFGA 1IRGA 4OMZA 3KEQA 5FFZA 1WRJA 3WTYC 4OU0A 4PGGA 1LDKB 3RI4A 2X0LA 3RYPA 1KU7A 2L3DA 2PLYA 1ZG3A 3WTVC 4KIGA 3M7GA 2ZNZA 4O3MA 2RN7A 3L09A 4FT8A 1A04A 1EH6A 3DV8A 3RKXA 3HOTA 3ROUA 4Y17A 2DU9A 3CUQB 4L5JA 3QAHA 2L54A 2OQRA 3R0AA 3VB2A 1U5TA 4RB3C 2ETHA 2G7HA 2VOPA 4ZYEA 5L3GA 3KP6A 1MDMB 4P96A 4M9XA 1XSDA 2VBZA 3KP5A 3VODA 3P9IA 3KEOA 2ELHA 4ESJA 1OYIA 3FHZA 2L01A 2A3SA 2LDUA 3S2WA 2VBXA 4XSXF 3R0JA 1FSEA 2ESHA 2K86A 1X3UA 1J59A 2FNPA 1J75A 2DPDA 2IP2A 1G6NA 3WTZA 1T6SA 2WV0A 1QQIA 4M9ZA 2FOKA 5LHIA 2ZO4A 2COMA 4HQMA 4KIBA 2P5KA 2Z3YA 4HF1A 1J9IA 2QM3A 1LNWA 1D5VA 2P7CB 4CYDA 2ZCWA 1BIBA 1YW9A 2R7FA 1HKSA 4IVNA 2QQBA 2NNYA 4G7OF 4F7ZA 2Z99A 4UVBA 1R00A 4YIFA 1SFEA 3TDZC 4I7HA 2VODA 3BWGA 3HHGA 1IF1A 3CLOA 3F8CA 3P9CA 5A2QK 5DEQA 3W6JB 3P7NA 2A61A 1IZ1A 5L3BA 3CO7C 4XBFA 1JHHA 2BV6A 1BN5A 4KN7X 2UZKA 3V7CA 4JBAA 4L18B 1P4WA 2VC0A 4LFUA 4ZYHA 4G7ZF 2EB7A 2HYFA 1ZYRF 3ECOA 5LLQA 2HEOA 3BZ6A 1YLFA 2ACJA 2Y75A 4LGWA 4EJWA 4HX7A 2K27A 5L3CA 3JSOA 3GFLA 3ZN0A 5JI6A 2EFOA 1PDNC 2EA4A 3CUQA 3WGGA 5J8CA 2DW4A 1U3EM 3HIFA 1JE8A 2QZ8A 3WGHA 1S29A 2EK5A 4RGRA 4IRIA 5ILUA 1S7OA 1YFHA 3WU1B 1I6XA 4CHUA 1EH8A 4PDKA 3LA2A 4OINF 2MH9A 3GVAA 4HLYA 4LB5A 3GEZA 4TV7A 1V4RA
chains in the Genus database with same CATH superfamily
4ZP9A 3BTIA 4HV6A 4YHHF 2FQ4A 2GZWA 1I51B 2DVIA 4YFUA 4JI5J 1RTJB 3TZYA 1XR7A 1KGSA 3OYAA 4B9SA 1QE1B 4F93B 3PSFA 2FUG9 2F8MA 2R7QA 1R8BA 3J81U 1FNXH 2L9RA 1RAAB 2B63J 2B7CB 3DI6A 5LRRA 4KKOA 4IOAQ 3H5AA 1QVFR 5EWEA 2HBRB 2EVZA 4CIOA 2KISA 2ME0A 2X3DA 5HS7A 4KAIA 4PQUB 2GC8A 3QSIA 4B3TJ 2RQPA 3GYXB 1LK5A 1OCPA 3KZYA 1XQIA 1GX6A 1OCCH 1QGPA 2CDRB 3C6TA 1U6GA 1O3TA 4KV8A 4HF0A 1VQ5I 2IM1A 2Q3PA 4MO7A 2XSJA 1U2RA 5E18F 4WP9A 5ILSA 1J2XA 5DD8A 1IR2A 2E29A 1WI8A 4LR9A 2EZLA 4UT4A 5E3CA 2XLKA 3P9KA 1RTIA 5J4VA 2HIYA 3HJEA 3Q8UA 1DTQB 2F5FA 4O23A 5EUHA 2AEJA 1RRJA 1MJAA 2D7SA 2X1CA 2Z0GA 5HJXA 2VXDA 3H5NA 3G82A 2CFXA 2EWNA 4KGMA 2NCKL 1YIJI 2AMCB 2UV1A 3BCBA 2B8PA 3LP1B 1NK3P 1GEHA 2I10A 1F60B 3OYKA 4LK0F 3EPIA 2CQHA 2B43A 3P3DA 4MFBB 3QFHA 3GLLA 4M3BA 1O51A 1HD0A 4IQJA 3C2GA 2KL8A 5C24B 1MU2B 2YPRA 2LOOA 1PIEA 2Q0OA 4HKQA 2HAFA 3HOXJ 3S3MA 2V4QA 2YNIB 1LV5A 3D6HB 3EX7B 1SL2A 5HVQC 5ILVA 1S1UA 1EHWA 3LSHA 4NLUA 1KOHA 4B3AA 3WIUA 4RM3A 2STTA 3DRYA 4R0JA 5KT5A 3TUIC 2QYCA 1NPRA 1BQXA 1H9GA 3CO0P 3MZIA 4B9UA 3CMMA 3H9JA 3J7YJ 4AD9A 1R5GA 5CVJA 1SUQB 3H4DA 2LF7A 3F23A 3OYCA 4TXSA 3I54A 3LFUA 2GXAA 5A8KB 1FJLA 4ZJQA 1Y4ZB 3B4DA 4CO1A 3CNQP 1A6QA 3H25A 4DUZF 1JUSA 5DETA 4C8LA 2VG7A 2KKOA 4HRIA 2KXHA 2BE5F 1UZHA 4DN9A 1GMUA 4CTAA 5LMNF 1UELB 2IRFG 4KNYA 1BA5A 1POGA 2GMLA 1BW6A 4YOEA 1G4CA 2M0GB 3BP8A 5LL6d 1MW7A 4KHPJ 1WHVA 1HR0J 2XAGA 4X6AJ 4A6EA 3OSNA 1V5FA 2KG1A 2CW8A 2JH3A 1Y7PA 3W5YA 5B3SH 3EXYA 1W1WE 4ZJOA 2WB1N 5L1LA 1Z77A 2B4UA 2JNJA 3FDSA 1F9EB 1Q8LA 3ZXWA 3DLJA 1S9EB 2M87A 2VF3A 2HU9A 3MI7X 4AT1B 2XY6A 2EFGA 2JUCA 4YB7A 2LFBA 2ROPA 4F3MA 2E1RA 1JLQB 5F9LA 4WP8A 3HSJA 5M3MJ 3ZCOA 4AE5A 2VQCA 3TUPA 2YH1A 1DPRA 2N7YA 2Y1IA 2MXYA 4ECXA 5A8RB 4K0KF 4Y33A 4L74A 4OIQF 2NS1B 7AT1B 3J81j 2KL4A 2PC6A 4AIJA 2K06A 2WZ1A 4DCOB 2CJBA 5DCFA 5K5QA 5M2PA 1P9QC 5DM6Q 2DXIA 4ZCLA 3VGTA 1LWEA 3TJ8A 4IL6C 4EEFG 3BJ6A 3TQNA 2K40A 3HLUA 2Y0SN 4A3LJ 1D9FA 2EKNA 1REVB 3AXKA 3F6OA 2ZJQQ 4IFVA 4ITSA 1XG1A 1ZAOA 3EDPA 1D09B 2YTCA 3GTPJ 2HLTA 3SJMA 2YNFA 2J7UA 1FOXA 2H8WA 1PAEX 2MGZA 3BO3A 3KWMA 2ZUGA 4UB6C 1Z91A 1NDPA 1RTZA 4A3KJ 1UZCA 2O3FA 2R5YA 3H2VE 4XTTA 4C9DA 5DQIA 4UUSA 3M4OJ 3E6MA 3T1YJ 2V2KA 3QPSA 4YR3A 2XLIA 4NYZA 2Y1RI 3Q23A 2XGEA 1NLKL 5JJBA 3BPDA 4QPTA 5JFRA 2HVHA 4Q5VA 4K5RA 1T8EA 2CQNA 3GB0A 3ZQLA 4E6KG 2HFOA 3DM2A 4OV6A 4RW8A 1NUEA 1GXQA 2MD0A 1W7PA 3KLFB 2FJXA 3VWSA 4J9RA 4JI7F 4BU2A 1R7JA 1GXUA 1PYOB 2LQJA 2AO9A 3EDRB 3KUEA 2DFHA 2AHOB 2XSJC 4JX4A 2XO6A 4LF4J 2CKWA 3CDWA 1Q82T 2XZTB 1SPBP 3SYTA 4FPRA 2BANA 3HVWA 2LLZA 4UY85 4B3TF 1M0SA 2NZCA 4ZVOB 1YBTA 2DK2A 2XPUA 3P49B 5J2PA 4RGUA 3PW7A 2GWRA 3CCLS 5KTQA 3ESWB 3TO7A 4RNMA 1AKHA 1G3TA 1S7HA 2CQDA 2O66A 1ZARA 1HBUA 3K8WA 3M1VA 1IXCA 4ENKA 1NO8A 3D1QA 2XSDC 1RT1B 4BWJA 1CJTB 4OYZA 4YB1P 3N9UC 3SXYA 2ASYA 3HZEA 1HBOA 4C3KA 3JTPA 3R5CA 3S1RJ 1YDLA 4A8XA 1UFLA 1WNEA 2E9TA 4HX8A 1FTZA 3CD6S 1V6HA 2HS0A 1TTYA 1O8BA 1EQ0A 3GCWP 4JI4J 2JHEA 4QZVB 2HYGD 1S48A 1HQUA 4DR5F 1JMTA 3X3UA 3MAHA 3IS9A 3MMCB 2DY1A 1S6LA 3IA0A 3TI0A 1UEKA 1YJRA 3IG1A 2PJRB 2GMJA 2E2JJ 2BZ2A 3DI6B 3OVSA 2CQ0A 3NCQA 2IJFA 2XCAA 2VDIA 3MM7B 2D9OA 3P96A 2HI3A 2VV5A 1YZ7A 3M6WA 1RWXB 2DOFA 2YXLA 4OYAA 2VQLA 1TTHB 1NTCA 3UR3C 4DSJA 3L00A 2M2EA 1KKHA 4IHTA 4KN4X 1Z6RA 4B09A 3F56A 3A8IA 2QO3A 1CJKA 1I6HJ 2PI4A 3B6CA 1YIOA 4WK1A 1RAHB 2XSJB 5LBQA 1LJ9A 4LSLA 1I27A 4E7KA 2HWVA 1KSPA 1S49A 2WONB 3MOJB 4YUDA 3CJKA 2L48A 4FHTA 1VLYA 4M95A 2QUFA 4A8YA 1LKXA 4HTJA 3BKTA 3F73A 3CULA 1Q5YA 3KCCA 1BBYA 3DLAA 1Y0NA 3ILIA 3I4PA 1FP2A 4J9SA 2F2EA 1V3FA 4O3OA 2Y2ZA 3G82B 5HMXA 4CCHA 1EAYC 5A76A 3U7JA 4A6DA 3DN9A 5HI7A 4FYVB 5A6WA 2ZMEA 3GMEA 4BQQA 5KFEA 3PIPQ 4IKFA 4DF4A 1Y1WJ 1P4AA 2EG1A 4CXFA 3PJWA 2IJRA 4NXMF 5F64A 5KHDA 3WE3A 3GV7B 4IOCF 3FXRA 3H9GA 4ED8A 2F8HA 2PIIA 3GYGA 4ZCMA 4K4WA 2VIHA 1RAIB 4XLCA 3Q2SC 6FDRA 4KHPF 1O7FA 1O3RA 1HR0F 3DEEA 5D6FA 4FF3A 4XRSA 3GR0A 1NMEB 2CA9A 3GJTB 2OCEA 3QPTA 2YU9J 5MLCV 3SSQA 2QQ9A 2H51B 5U47A 2K1RB 4E70A 2DFEA 2X6OA 1WD6A 3BZQA 3U27A 3NL0A 2RRBA 1QZEA 1W5SA 4D1QA 2XHCA 4DX5A 1I39A 1EV7A 4IO9F 2HOTA 3R2CJ 2AXTC 3CIZA 4B08A 2X6XA 1X1CA 5E3OA 3IC1A 2EPFA 1G7CB 5A2QU 1C0UB 4XKVA 1P9YA 1PJRA 3FXUA 4KC5A 3HT3A 1HWIA 3AHPA 4I7FA 4HDGA 4HL9A 5FO5A 1GTHA 3AXMA 4YEAA 4DL4A 1LXJA 4CTAB 3OYHA 1WSRA 1Q0NA 4Y4RA 1B64A 4DV1F 4M6VA 2IDLA 4ZVPB 2EEYA 5LFAA 1FJ7A 3CJ2A 5KFRA 1BUXA 5E33A 2IGNA 5FRNA 1TKTB 2BUNA 5CHCB 3CCLI 4P7TA 4LLLA 1H2UX 3HKWA 3RIRA 3D5LA 1VISA 3B82A 2C6YA 3UNYA 3OYNA 1E0EA 4KYZA 4X4OA 1V3RA 4DJAA 1QHGA 2R7UA 3ZQHA 3BR1A 1IGNA 1UWBA 3W64A 1O3SA 3TANA 2RKIB 1PP8F 2XUBA 4LB6B 3IM8A 4JB8B 2K2PA 1IN8A 4DFPA 3A2KA 3OLAA 3IV5A 2PDAA 3CD6I 5HDGA 2BJDA 2YKOA 2O01C 2XS2A 2ICWG 3RRGA 4P55A 3REOA 5ICEA 3R7NB 3R8YA 2R8KA 4Y3CA 4BXFA 4P9UA 2XKOA 4G1QA 5SUHA 1IRFA 2RS2A 5AIPA 4HLXA 4ID5A 5H9EK 4OX9J 1XNQJ 3GZ6A 1HDDC 4MIAA 1FNOA 4ZLJA 1QTNB 3TBIA 4LF4F 1N4LA 2MB0B 3QWUA 2MFZA 3MWMA 4M5IA 4V19X 4A3EJ 3QRQA 2PI5A 1DQ8A 2DGOA 4PGHA 2ZH6A 3U1KA 1UW4A 2YNFB 3RPUD 2OUGA 3ISND 3IMQJ 2L9DA 5JUMA 1A6IA 4JQFA 3H5UA 3I58A 3GCXP 1RUSA 2R5YB 2VD3A 3ENWA 1U0HA 1TWAJ 2X9DA 3TW7A 5F8GA 1ENHA 2EW9A 2DFFA 3LMMA 1BL0A 1NPPA 1YRXA 2NVYJ 4RBVA 3L9ZA 4OAYA 1VQOI 5J2NB 3WDOA 1UJ6A 1S1XA 4XLPF 6FD1A 1HNZJ 4Y2IA 2N4DA 8ATCB 3PRVA 1RHKB 5KT6A 2B4PA 2UUWA 5IT9Y 4RW8B 4DV2F 4JI4F 1GXLA 2D3UA 1SFKA 4MKBA 3OYMA 3SQGB 2C2OB 4Z7CA 4LVOP 4X4SA 1KN6A 2BOAA 3GFJA 3W2AA 2F4OB 1GHCA 2OUMA 4HACA 3FNNA 3BQ2A 1X9SA 2F5VA 4NEZA 3HFKA 1WWXA 5GAHJ 2OF7A 1LQ1A 1LW0A 3LW5C 2QGUA 3Q0WA 3CC4I 4ZDPA 5LRSA 4OZJA 1NHVA 4JI8J 5DM7F 1QY7A 2AJ1A 5J2PB 1X4CA 5FLMJ 2LK2A 5EGOA 1RHUB 5D15A 4UQGA 1R89A 3NG8A 2DR7A 3IRWP 2ZMEC 5F27A 1O3QA 1LVKA 1GLNA 4PUOA 4LF8J 3RKWA 3DOLB 4ZPCA 2AT1B 3M1VB 5CQGA 3L2WA 3U02A 2V79A 5ETPA 2R2TA 3G87A 4IRDA 3MCZA 4Y7NJ 2CPDA 4E7IA 2QKLB 1RT6B 2XF5A 2JOQA 2B6AB 4IR1A 4HH0A 1R6YA 3J7Z5 4IXAA 2VBWA 3NKYA 5G0RB 3KHLA 3MMAA 4LT6A 1BMQB 2XV4S 3FSIA 2LY2A 5H9EJ 4RR5A 1IJWC 5FKMA 3W60A 2QVOA 1RABB 4UVCA 3RBEA 1F5AA 5JVTA 1FJEB 1KD1T 4NXNJ 4EK2A 4PZJA 4MTPA 2QA2A 2WB1A 5IOZA 3CCJS 3ZO7A 3K4NA 1HPZB 3HB9A 3CF5Q 2Y0BB 1N77A 4A5NA 4ZP8A 2H6CA 3C6UA 2HLUA 1P27B 2MQMA 1DTTB 5E3MA 3PRDA 2YKQA 2IBKA 1GTEA 1ETQA 4QPOA 2ASLA 5EF6A 1Q7LB 1R27B 5DLFA 2KZZA 1UMJA 5ICGA 2AEMA 2FC9A 5IS2A 2J9CA 4PUSA 4K4VA 5F41A 2BJEA 1ZTTA 2YX4A 1QJHA 2WAEA 2CV2A 5BJRA 1C4AA 3CJKB 2DHXA 1HBNA 4PXCA 4F02A 2E1AA 2JA5J 3I87A 1H7WA 4A8WA 4EUVA 3MAJA 1K73T 1QBJA 1FP1D 3VPRA 2Y0SA 3BG3A 1YG2A 2KHMA 1KHVA 2A5YB 2ZMEB 4ECQA 2HXIA 2RMLA 4JI3J 3RRKA 2VG6A 3ABLH 1YO5C 1EF4A 1MLAA 4CCOA 3MMBA 2KI2A 5IP6A 4EU0A 3NRVA 2OPTA 3W66A 2XIGA 2JRMA 1YJ7A 5GMDA 4K7QA 4DL2A 4B8XA 2HQAA 2DCEA 5LMUF 3DCFA 1U26A 3W61A 1WF0A 3RQIA 2JUGA 4ZVGA 4U87A 3RW7A 4WK8F 2HZVA 3UDCA 3KZZA 4C0HA 4QU7A 2CQKA 4IEJA 2QQ8A 2O5RA 5LSLA 1HWLA 2A6EF 3HGGA 4CCKA 1NJYA 4BDYA 1F5CA 1GX5A 4BNCA 3K4LA 4KICA 3D1NI 1ZR2A 3I0RA 1X0FA 2FHJD 4U7UK 3SYZA 2KIMA 2IXSA 3NAIA 1Z7LA 1N0UA 4LQ3A 1SANA 1QZYA 4A3IJ 5ETTA 3HJFA 3RJMB 1NBEB 1X2NA 1BD6A 3EJMA 1T05B 3WU0A 2GO9A 4X65J 1IAWA 1YE9A 3JYTB 1F9HA 5KT4A 3UR0A 4UHTA 3BPXA 1ZTWA 3AFHA 4ZPWR 3KYDB 5M2UA 4USWA 5K5OA 4HTIA 3MPWA 4I7FB 2K9LA 4M72A 5HDKA 1Z2LA 4CLWA 3S15J 3BKFA 1UJ4A 3AT1B 3KP3A 1S4EA 2H5EA 4ZVSB 2QEXS 3TOBA 2QE5A 4DQ2A 3EUHA 1VFJA 3EGWB 1BR4A 2IA2A 2JRSA 2Z4PA 1TL4A 4E7ZA 4QJVA 3M8EA 4OX9F 3I4MJ 1T8IA 1USTA 1TNTA 2WADA 2EV5A 4M9SA 4N9HA 1FMWA 2G2YA 3KP4A 3MEEA 4LF1A 5D0HA 2UVWA 1RAFB 4N5SA 1FRMA 2BW2A 1ZELA 1RZMA 1WC0A 2XGDA 3SQNA 1GXPA 4AIKA 1K0VA 2UUZA 4E7LA 1JI8A 1RA7A 3CC7S 4V19J 3ZQIA 2DPUA 3OL9A 3MM5A 2GGPA 1WDTA 2VB6A 2BQ3A 3HHEA 4TU7A 3MHYA 1YQAA 2WSEC 4UTGA 2KO1A 3QPIA 4NLTA 3FSYA 2RQQA 3ZQFA 3CEDA 2JVHA 4BQNA 3DKDA 2D41A 3TVZA 2W1OA 1RUNA 4D7MA 2M8GX 2E5IA 3F0CA 5E3PA 5J1PA 3GYNA 4M6YA 1MZBA 1WEZA 2XMUA 1YW7A 2MQLA 3A8EA 3JQKA 1LKZA 2Z5UA 1V54H 1E17A 2V1UA 4UY8T 3S1MJ 1ZHFA 4ID5B 2W01A 5C42A 5HO4A 1TV6B 1R5HA 4BH9A 3OBIA 1N8RT 4CH0S 4IRKA 3K8VA 2QL7B 2BY2A 2PEXA 2KFZA 2KP6A 2MQNA 3GSDA 4UOGA 5D5VB 1ZA1B 3OOPA 3ZP5A 2XWYA 4HA8A 1XDUA 3LF0A 3M2RA 1SEUA 3CCQS 4URSA 2WSCC 4JP0A 3LAPA 2KT3A 5F8JA 3N5BA 1QNTA 4DR6F 4JI8F 2YWEA 3OYLA 3FBNB 2B9XA 3BG9A 5B09A 3OFEA 3H20A 2MTLA 1LDDA 2TDXA 3K5MA 2UUBJ 3K89A 1WORA 1Q79A 1NJIT 1MDMA 3ENAA 4KGXB 4LF8F 5LT5A 2PFBA 1BQMB 2R7WA 1AW0A 1KP6A 1RWWB 2B4OA 1OLTA 2C2KB 3T5LA 2RKHA 1FERA 1VOMA 5KFDA 3A8KA 3A0HC 1M5KC 1W36C 4IYQA 2AYMA 1F36A 2VPRA 2ZM6J 2DPJA 2LVSA 3CVKA 5D4SA 3M07A 3IRXB 4PR6A 4DS4A 1NK2P 2BOLA 3IGNA 3O5TB 1R1TA 1AOYA 3QT7A 5M5YJ 3PACA 4NWBA 5DGBA 2EFWA 4HW0A 5J2MB 2MKCA 3KFWX 1R3NA 4BEHA 3MFKA 5HNHA 1NB7A 2MLGA 1T3OA 2HZAA 3R1HA 4RU2A 3KG1A 1O57A 4I0WA 3NGUA 1EETA 4B48A 4M5NA 2DOAA 3M3YJ 5BXIA 5D3GA 4LRAA 1RSCA 5AE2A 4IRCA 1U8RA 5AXLA 1WEXA 1VRUB 1D0ZA 1WTFA 5DYMA 2E66A 4TN2A 2M4KA 3F8FA 4C3MA 3S01A 1SKUB 3S3NA 4XRFA 4ECYA 4I2PA 1MSWD 4ANDA 2P0WA 3OSGA 1D0YA 2IRYA 3MECA 2CGPA 3ECHA 3OS0A 1MNMC 2HQDA 1HQCA 3C2PA 3T19A 2J6SA 1RZ4A 1VQ8S 4BC9A 2V9WA 2QEXI 1U0SA 3FM3A 4HBLA 3VGUA 1RK8A 2H4YB 3H42A 1F4KA 3SZGA 3HJVA 2GA1A 2JA2A 1XIQA 4EO6A 4LFAF 3OUYA 4JI3F 3TOAA 4UNOA 4ED6A 4C11B 4A69C 3D28A 1CQMA 3N6LA 3IBCB 4PKDB 1S6QA 1QUVA 3GP9A 2QA1A 1HI0P 2CJ9A 9ATCB 2XO7A 2HG4A 1FE4A 3IGVA 5IT9K 2HBYB 3M9AA 1KLMA 3EE3A 2KKHA 3T9ZA 1HD1A 2AJ4A 3Q8YA 1H88C 1MROA 4F55A 1UG2A 1YX3A 2CQIA 1VF9A 3VALA 3BTJA 3NGTA 4OI0A 3M32A 2XRNA 1OPCA 3K1NA 1JLFA 1FWKA 5LJ3Y 4AU7A 4Z2XA 2AHQA 5IYBJ 5IWAJ 1U1NA 1QZZA 1KQKA 3K5LA 4R8UB 3QU6A 5E0OA 3DTKA 2F48A 2FF4A 1OQYA 2F8EX 3EUHC 2B7BB 3LFKA 1HBNB 4XDDA 2VLAA 4CO2A 1FD2A 1LFWA 1WUUA 5CYMB 5K7FA 4U7DA 4AUXA 3ZNUA 3HVAA 2VUGA 1HW9A 1RKIA 4EYIB 2B9SA 2RDJA 4C98A 4LFBJ 4LFCJ 1P2FA 1B7FA 2HNYA 3P5TL 1WJCA 3BZCA 3FDYA 5LD2C 2R4GA 4HDUA 5F8LA 3PTWA 1S6OA 3E2EA 3MMBB 4EGZA 4ZYAA 1FTTA 4XM3A 1M5OC 3PQJA 3NCRA 2OKQA 5C25A 3W6KB 1R8AA 4HNTA 1RT4A 4WX9A 4IQ4A 2ZEJA 2VT2A 3CCQI 3LGHA 4ZVRB 5FIIA 4M1KA 5HVGA 2XY5A 4P71A 1VQPS 3MTJA 2BMBA 3IXQA 1ZM3A 3I0RB 2LRDA 5FLXY 3W65A 2ZDPA 4NOHA 5F9NA 4X4NA 4IO9Q 3QGIA 5M5XJ 2IM2A 1HBMB 1R23A 3AG1H 3LA7A 4RLQA 1XCVA 3LA3A 3IUOA 2O7OA 3S3OA 2NXCA 4BY1J 2X1GA 4UW2A 4CLFA 4NPOA 3IHUA 2K02A 1NPKA 3RR7A 4TU8A 3KLNA 3WODF 3IWFA 3G71S 2IFXA 4J5OA 2DR8A 3SIPB 1XC5A 2IAJB 2NPFA 5HP1B 2L2OA 4NASA 5K8PA 2ZSIB 2RDIA 1U49A 4CI0B 4EMDA 3FMRA 3SI8A 2ZXWH 2HK3A 3CWJA 1AUSL 5I42B 2J0WA 5EZGA 3PW4A 4IHWA 2XROA 1IN7A 3K7AJ 4BQAA 2DMTA 3MEEB 5D8LB 2Y3YA 3BTLA 1G4DA 3PIOQ 2H1YA 5IT3A 1S72I 1JLEB 4Q5SF 3FM5A 4U96A 2B5JB 2BXZA 4UXNA 4OMYA 2UXBJ 4LRCA 2ABYA 2CQGA 4URQU 4JV5J 4QPXA 1N6QA 2O8XA 3MR3A 5K7ZA 1JJHA 2UUBF 1RWUA 2DHGA 1L3LA 4ZJZA 2AZ3A 5B0DA 2GVZA 3GTJJ 1VQ8I 4MQVA 3JSPA 1T9XA 1NCLA 1FFWB 1R0AA 3AJDA 4RKUC 2LY1A 4ZVQB 4OMZA 2VG5A 2OPPA 3L2VA 3KPHA 1B99A 5GPCA 3WTYC 1N88A 1LDKB 2YVSA 2X0LA 2CADA 3EZUA 2QTWA 5J1RA 3QO9A 1LWXA 2ZNZA 1YX5A 4C8KA 3LH2S 4FT8A 3CDUA 2CPYA 2X1FA 4ZVFA 4LUBA 4WTYA 4CLKA 1X7VA 2CPIA 4DX7A 3O3LA 2HNDB 4KO0A 2VIXA 4OI4A 2XS5A 3IAM2 2FLNA 3R0AA 1QPIA 2BV3A 3KEYA 1U5TA 3PJRA 5GMKa 5K8NA 4CUGA 3J7ZT 4YEJA 2R8GA 5T14A 4DFMA 1MDMB 4P96A 3WHCA 4WFAQ 1SVDA 2V7FA 1XSDA 2VBZA 5EX3A 1U6ZA 1R6RA 3K10A 3TX0A 2L9SA 1FVSA 1L3UA 3HSDA 1OYIA 3FHZA 4KE5A 3HVTA 2L01A 4BQOA 4F4WA 3S2WA 4QW9A 4JI1J 5IY5H 4MKYA 2VBXA 2C22A 1FSEA 1DGWY 3MCNA 2FNPA 4OHZA 1J75A 3MAAA 4A8QA 1RACB 3MKLA 3LPYA 3PX4A 3TA0A 1T02A 3NWGA 1TP7A 1UHSA 2CIMA 1OSDA 2ZVSA 1FWLA 2DA6A 1PCAA 4HF1A 5F3TA 2M5YA 1BIBA 1VQPI 3SDEA 5J47A 2HVZA 1EETB 2VKDA 5DM7Q 4XLEA 4G7OF 5IP7J 1H0HB 5D3GB 2KIQA 2Z99A 4ZCIA 3PZPA 1DU0A 1OCTC 3DCAA 3PV8A 1IR1A 1RGVA 1RDRA 4OJGA 4PJJA 3HHGA 3CLOA 5DEQA 3W6JB 2ZJPF 4ABZA 1LFPA 3MECB 3OSPA 1EX8A 2DPIA 2BV6A 1BN5A 3G71I 3MD1A 2DNKA 3HXMA 3V7CA 4L18B 1YRNA 2VC0A 3E3XA 4LFUA 2JA7J 4LFBF 4LFCF 2BQRA 2XB0X 3N0VA 4QIWD 2KZMA 2IGMA 4B47A 1TAQA 2EB7A 5HBMA 2EILH 1EKEA 1WPKA 3I6PA 3TNVA 1ZYRF 1RBOB 8AT1B 3PSIA 3QLHA 2IAIA 4RJVA 2ACJA 2Y75A 1XJWB 4FETA 1TMJA 3L7PA 4B4CA 1MMSA 1X5PA 4OZ5A 1KQSR 5JI6A 1T0FC 4NMLA 1J09A 5B0FA 2J0QD 3CUQA 5KFWA 5J8CA 1MROB 3UW1A 3IAM9 2E1MC 3DXBA 3HIFA 1JE8A 1ZS6A 1S29A 3M32B 4DR3J 1DQAA 1T9UA 2LA4A 2XZDB 4FYXB 4WIQA 4D5FA 1JX4A 2LYCA 1EH8A 3W2VB 4NNJA 1R71A 3LA2A 4XLAA 3VYTB 1XX5A 4LB5A 3AG3H 2MZSA 1V4RA 4OJ3A 4AXIA 1S5ZA 3OXGA 3F3XA 4X0GA 4P74A 3OW2R 3RGIA 1E6VB 3JSBA 3E6DA 1VGYA 1ZAWA 2QSFX 2MLXA 4NDLA 2DISA 1JLBA 2DH9A 1E3OC 1K7AA 2I0XA 3RG6A 1FNMA 4NZ7A 3ZMDA 2HNYB 2LEPA 1IJFB 3RYLA 3POTA 2DIVA 1JKRC 2QSFA 3CJ8A 2QLFB 3DDKA 2XLJA 1F3VA 1F5BA 1U1RA 1RYSA 1Q1HA 4E8UA 2QWWA 2QLZA 3B6BA 1URRA 2MKHA 1WJEA 2FMYA 1RT4B 2LDYA 4WKYA 3I56I 4QR2A 4DUTA 5ETMA 1H72C 2Y0MA 5IXUA 1UFMA 3ZZUA 1APLC 1PO6A 2W8KA 2QENA 3GMGA 1FLIA 3PX0A 3OTBA 3HL2A 1MNEA 1N33J 3K58A 1JLGB 3H3UA 3NCPA 1UJ8A 4AL7A 1OKRA 4R5PA 1ZBTA 4U8VA 1E2XA 1PAUB 3UD5A 2OH2A 3NXZA 4B9LA 1CJUA 2FC8A 2AP6A 4OAZA 4FF4A 2UXBF 4CLSA 2IA0A 1QD1A 4CCNA 3H5SA 4JV5F 1Y00A 4I6YA 1K79A 4TLRA 3K17A 2QC3A 2OAUA 3Q86A 3J7AN 1YJTA 4OX6A 4S0HB 2DA5A 1ZN2A 5DLGA 2XI2A 4PXDA 2RAEA 2E1MB 4IHSA 3K57A 2L5QA 4I68A 1EARA 2VU5A 2F65A 2P9EA 4UUWA 3IKTA 4CO5A 1L3KA 3R5DA 1WI3A 1NSKL 1YOVB 3OWTA 3WX4A 2OPQA 1GXTA 3JS9A 4LF7J 2ECCA 2RNJA 3KHGA 4TNOA 1S1VA 1HQEA 5AONA 2M30A 2RAQA 3LSTA 4F2SA 2GQCA 1MN9A 3DOKA 4OIXA 3QQCD 1U5TC 3TUZC 3WTUC 6PAXA 2NS8A 2AQEA 2ATCB 4XRSG 2ADCA 2C2MB 2B9WA 2CWKA 4Y34A 2K3IA 2QL5B 1TFWA 2WA0A 4Y2AA 4YDDB 3QJJA 1YQHA 2D1VA 1FBQA 3N05A 1RT5B 1R4MB 2LMDA 3DLGA 1SD5A 1XS9A 1IG7A 4F52A 4OI1A 4TY8B 3O44A 3G6XA 2Z30B 3C3WA 1BLUA 4JUZA 2KRCA 4CYCB 2GVZB 2CW0F 1GFWB 4NC7A 2OI2A 1YYVA 2OSRA 2CSOA 1FIAA 3V8KA 3QYBA 1FDBA 3A3OB 3TW6A 1DP7P 3DLLF 2OBPA 5KNLA 2HFSA 3CCTA 2WC2A 2BVMA 2HWHA 1F2HA 4JI1F 3MKZA 1U8WA 4RW4B 3DLKB 2M70A 3OY9A 1M1GA 3PYEA 1JNRB 2BJ7A 3LGNA 1Z9CA 1ACIA 3KLIA 1VFCA 4PAAA 3SQOP 2W8LA 3ZPLA 2E44A 3DRSA 1XTZA 3BKUA 1RWPB 3RTVA 1DUXC 2IEKA 2OD6A 2DO4A 5D6EA 4HNUA 2VQEF 2PA3A 3QWLA 4DR1J 2JSPA 2K7JA 2MJNA 3FFIA 4U7BA 1BI2A 2D1HA 1W0TA 2COLA 1S76D 2CQ7A 1W7PD 2RREA 1QU3A 1ZM9A 4DU7A 4C48A 4OWRB 1U6FA 4UOFA 1GQEA 1SJFA 4C3LA 4WKRA 2HPMA 2VE9A 3H40A 1RHQB 1U5TB 4A8KA 2DNMA 2VQHA 3AG4H 2J5OA 3MCSA 4KJZA 3H35A 4EI2A 1B3TA 1Z6TA 4RLFA 3MM9B 1WFXA 1AZSA 3B4MA 3BSAA 1X4AA 3IM9A 5ETQA 1CJVA 2K3KA 2VKVA 4YFNF 3HVTB 4M5MA 2QCOA 1S9HA 2F7VA 1L3SA 4ECVA 2Z1DA 3HI9A 5GAEJ 2K9SA 2QA4S 3JRAA 3HZGA 3AOAA 4WU2A 2XNQA 1GV5A 1TNSA 4GCVA 3MAAB 3UN5A 2IM3A 3M8SA 1VQYA 1Y9OA 2AGPA 2XYPB 3ISPA 3X2QH 4UV8A 1Z4UA 3OTOJ 2K4BA 2JC0A 4KT0C 2F4FA 4KJIA 5DS9A 4ECZA 4HDHA 4L5IA 3JXOA 3K4JA 3KUHA 3RKQA 1K47A 2DO7A 4OIOF 3NLCA 3I5AA 1HNIA 4DR3F 3QMQA 1OYEA 4NCGA 3KOAA 1YJWI 1NDCA 2AU0A 1P7IA 1IKYA 1HIYA 4B9VA 1MJ9A 2K7LA 1YJ9S 2B3TB 3QRPA 4QU6A 2C2DA 1ZPVA 3CGIA 5KG4A 5JVGQ 4I56A 1HOMA 1FO1A 3KXDA 2B7EA 2XKPA 4LOCA 5BPDA 2WVDA 1FOKA 3BO2A 1FXDA 3DDIA 3R6GB 5EZHA 2E9RX 1S59A 3CE8A 1R1VA 1VC0A 4P75A 5CA5A 2K9MA 4QLCU 4NQWA 2HGLA 4H4MB 2PFFB 3LSPA 3LP0B 3FUYA 3GLXA 2ID6A 1IM6A 4B02A 2YKNA 2EJRA 2PEBA 5HODA 3EUKL 2DGQA 3QLHB 2LXIA 4L6V3 4LR7A 3D4JA 3K4KA 2ZFUA 3CC2S 4XICA 1MD0A 2KHCA 5KFGA 3LUYA 2I8DA 1XR5A 4YN3B 2JEFA 1IKXB 2BY1A 2FGCA 2JFDA 1N33F 5FJ4A 2JLGA 1M1KT 2ZFWA 1N5YA 4F4YA 1V5EA 2XAQA 4M6XA 1HQ2A 3NS5A 3N4WA 4DL3A 4ZTJA 1MWYA 2L3MA 2VKZG 3MOZA 4X64J 5C2GA 3LSMA 2CZ9A 1FD8A 5KFUA 4DXLA 2PE8A 2J76E 4OYMA 4ZYGA 2Q2EA 3M8QA 4DCJB 4MT1A 5KFBA 2DR5A 4ON0A 3BN4A 1WJAA 1KZHA 2Q43A 2WSFC 3P8BB 3U1LA 2PQ8A 3POTB 5I3UB 1NHUA 4ZMMA 2FVQA 2EC2A 3R1LA 4P1WA 2JVGA 2RNEA 1XC9A 1UHWA 1ZRDA 4ES1A 2PFDA 4WXHA 1KU3A 3L7UA 1SC1B 2P5LC 1WKJA 2DNOA 4OZ3A 1T95A 2JFKA 4LRBA 4OI2A 4U8YA 5B0AA 3GQCA 4HPQA 2MKKA 1TKZB 4HF2A 4JOUA 2JT1A 2F9DA 4A3BJ 1QAJA 4I6AA 4PPZA 5DTDA 1FZPB 3TA2A 1F6TA 3O3KA 5ETOA 3CJ4A 2HZDA 3QJPA 1X5SA 4DYCA 2Q8KA 4R5PB 1HCRA 3DKWA 3JAMY 2L7ZA 1GVJA 3K2AA 2HGMA 4JV2A 3KZIC 4CH7A 4G65A 3QRRA 4H4KA 2VFUA 3OXLA 1F5TA 3P5BP 3CJTA 3CCUI 4KB7A 3W8PA 2MSSA 4J9PA 2BJ8A 4DWIA 3L9FA 1HKTA 2DD8S 3BLYA 3CMES 2FXAA 3SDGA 5HLFB 2W4DA 2FOWA 2K5CA 1V9OA 4C8ZA 3RRHA 1JLAB 2YH0A 2OPSB 1TFYA 2X85A 3T6JA 2OPQB 1CQTA 3TMOA 1HW2A 2HWTA 4MMOA 3EICA 2LR8A 3JRHA 4N9IA 2CQCA 4EV0A 3VQSA 4NLVA 3L2QA 2KFDA 5GTIC 2C3PA 3AAFA 4DV6J 2GIZA 1VCTA 2XHKA 1MKMA 4O3QA 3CIMA 4KITB 1B72A 4AQYF 3OR1C 4QWAA 1SVOA 3BREA 1Q5VA 3HM9A 3HSEA 4E4HA 2BRKA 2G0CA 4ZHRA 4RUHA 1YJ9I 1DRZA 2AF6A 1DDNA 3TAMA 2MBFA 1X9MA 4DNCA 1JTXA 1J5OA 4XOPA 1BW5A 3ISNC 4A3JJ 2KT0A 1B8IA 4LSNA 4LLGF 4CLLA 4ZPTR 1ZETA 4NA1A 4CLUA 4M73A 1A5JA 1VK3A 1NG7A 4DG1A 3PUFA 5LOQA 2XC9A 1JKOC 3BY6A 1LE8A 4ECTA 1VQNS 4P52A 3EGZA 4HG2A 3AOBA 5IT0A 1Q7YT 5HANA 4LJZF 4YIRX 4DZDA 4CA0A 5KFCA 1NZAA 1HA8A 4K8RA 3NNHA 2OC6A 3EGVA 3V4IB 4F4AA 1MGTA 2AV5A 4KFBA 3TZZA 2I5JA 2MQOA 4NLGA 1VJWA 3KLIB 4RX6A 3VAIA 3BC8A 3G6EI 2MLZA 4FASD 2H1KA 2MYFA 3CC2I 3H90A 3IP0A 1WC1A 2WBRA 2ZHAA 3G1OA 3VVUA 2GIVA 3OTOF 1FWZA 4EGLA 3HD1A 3MD3A 2BM0A 1TL1A 2X1EA 1R8CA 2ASJA 1S5LC 3KK1A 2F4MB 1LEBA 1FXRA 2STWA 1VTNC 3IRRA 2H27A 5D78A 1XK8A 1TP4A 4G1PA 3K4CA 4HZFA 4A0ZA 4AVPA 1W0UA 2HHUA 3T5JA 3NGDA 2YQ0A 3PO2J 2HOEA 2GQQA 1X4PA 1MMGA 3PKYA 3OR1B 2XPWA 3BOQA 3BT9A 2RB7A 1UETA 1I3AA 4X62J 1YBAA 3BGLA 3OR2A 4RGXA 1CJVB 3TDUC 4ICLB 5FDLB 2Y9ZA 2KYZA 4NBQA 2V4JA 4LF5J 1SFUA 3RZOJ 2OJ3A 3D7SB 2VKRA 1FC3A 2UXDF 5A6PA 3B73A 3TP0A 4RBOA 1TWHJ 3E8OA 2AGQA 4Y3OA 2XAHA 1IBKJ 4G94A 5HOOA 2CRGA 3V7RA 1RXOB 3ZZYA 3P4UB 5D0RA 5IM0A 1TU0B 3KLGB 1U02A 2Y1JA 2DCUB 2DA1A 3GJSB 5HLHA 4JI6J 1WHYA 1EH7A 2HFNA 2J5AA 1U2WA 5ETNA 1ZQ3P 2CPJA 2QYOA 1AWCA 2FVSA 1LPQA 1B0VA 3WQPA 1ZR4A 2XYHB 2UV8A 3KDOA 3EM1A 2F5CA 1HNIB 3HX9A 1S0MA 4NCGB 5FLVA 1WWHA 5EEHA 2A69F 2WB1D 4ZP7A 4WZMA 1KEKA 1TWCJ 2ZJPQ 3J80K 5F04A 4ZVHA 4A8SA 5LSOA 1YVFA 4OZ1A 2DGSA 4DN0A 2MC3A 4P9SA 4X64F 1H38A 2E5NA 4ZYDA 4GDFA 3BYRA 3UDVA 2E5ZA 1C1BA 1S1WA 3G6YA 3HF5A 4A3MJ 4GYIA 3EYYA 3FIWA 1RWKB 3HOVJ 4NQWB 1XMOJ 2OHDA 2Y31A 1FKPB 4A3GJ 1LQ9A 2A0FB 3CJQA 4EJUA 1IO2A 2NVTJ 3MZ8A 2FIUA 2G0JA 3BV8A 4U0WA 1AXQA 4H4KC 4FX0A 5TRDA 2R0QC 4DGWB 4W92B 4CLPA 1NSQA 2A2CA 4NRTA 2LC2A 2XS7A 1A31A 3TKYA 3EWGA 4DSFA 1VR6A 4DQSA 4DUYF 5KFAA 1VQ7S 1A9NB 1SCJB 1OYYA 3VAHA 3F6VA 5ETKA 2L08A 2VQGA 4Q2MA 1N5YB 4M8LA 1JLCA 2OMLA 2DYRH 4WYLA 5E5NA 5FKKA 2YUSA 4QYRA 3C19A 3OSFA 4IQXA 3BR2A 1VQNI 1K61A 3GWCA 4RBUA 3EYZA 2FRHA 1PYSB 2NZ4A 2GHPA 1RT2A 2CWXA 1JGSA 3BPSP 5HN0A 2ZKUA 3A01A 4PJ0C 3D9BA 1D5YA 1KU2A 2X6WA 1HW5A 5KAIC 1D8YA 3LWFA 1Q1VA 3DGPB 1KQ9A 2Q2EB 4HI1A 5HK4A 1PKUA 3C8YA 1RP5A 4LMYA 3R6LB 2D3O1 2RE1A 1S7IA 2E2HJ 1FA0A 2A2DA 5I4MA 5FJ8J 3JQJA 2MZ1A 4O5VA 3L7OA 1UL3A 1PSDA 2OO4A 1WJ5A 3WTSC 1FRKA 4L72B 4NLOA 4DV6F 3FK7A 2I2YA 2F5DA 2M1BA 3FX3A 1ZKGA 3DRRA 4UZBA 3FXLA 2LA6A 3HMJG 2FBKA 2HDCA 1FFSB 3RW6A 3KUGA 3BROA 2O5DA 1U7LA 2NQPA 3FXKA 2DIUA 3EZOA 1U09A 1U6BA 5E17F 3QOPA 3JSRA 4V1Ak 2IS6A 5CD4A 4DV5F 4F50A 3CMYA 1RHJB 2F5GA 4F25A 3WU2C 1YWXA 3E01B 3CCZA 4P2XA 4MIMA 2ZNYA 3T5HA 1RE1B 1NDLA 1TT0A 5IC4B 2ALYB 1FIPA 1FI4A 4TU9A 4LREA 3HHHA 4M63A 2YWFA 4NI2B 4DZJA 2GXBA 3QGGA 2ATLA 1S77D 3KNAA 3QGPA 4J9UE 2KM8C 2KLOA 2E7WA 4IG3A 5ETLA 1JJ8C 4EZ9A 3LOUA 2DTZA 2NYIA 4XRMA 5J8FA 3MDFA 1SBRA 3T6BA 4BHCA 4RNOA 3JSMB 1BY9A 5D4LA 1LW2B 2EBGA 4PSWA 1Q81T 4N4NB 2X51A 3ZQQA 5LXRA 2PI0A 2OD4A 3MM8B 3FCHA 3JB9k 1IKWA 2HHPA 3OR2C 3GILA 3E51A 3TEDA 2AQ4A 4UOCA 4MIBA 4YQWA 1SJRA 3AA8A 2CZ4A 2XULA 2H3EB 1WZ2A 2NUHA 2O0YA 1J5OB 1FBUA 2M0CA 3C15B 1YRTA 4MQ9F 3HGYA 1B8IB 2DXEA 5JHFA 2MABA 4CM2A 2DA4A 2L9NA 5AJ3F 3TYTA 4DG1B 4AC0A 3MCMA 2QBYA 3JAMK 2V69A 4DLEA 4QIVA 3OJUA 3DLLQ 4JYKA 1R5ID 1IKVA 1TKXA 3DYAB 2VHGA 3JTGA 4LIWA 2GJFA 2ZH4A 1X31C 5IOLA 2R7TA 1SC7A 3D0IE 4C7QA 2DYAA 1ICEB 2GM4A 1WEYA 1HNWJ 3AL0C 1E6YA 5CABA 1YIJS 5IPAA 4KFBB 5BQTA 3TVKA 1XMBA 4QTRA 2RC4A 2L7KA 1U2FA 4W4MA 1Y0UA 2K4JA 3M9MB 1REPC 3D6MB 1RBAA 3ILOA 3VSKA 1SD4A 2YWWA 2GCFA 4B3SJ 4BE0A 1ON1A 5LXYA 3LP2A 1S9FA 2DLLA 3NAUA 1TL1B 2M2BA 1QPMA 1N5SA 2P2CB 4ED3A 4KMFA 3DU5A 2ZKZA 3KK1B 3UNGC 5CKTA 4LF2A 2KM8B 1GNKA 1IC8A 1FPQA 3FCVA 4F3OA 5K5RA 1RHMB 4WFZA 1I3OB 1RT3A 3GPAA 3R27A 1ZGJA 2M0MA 1ZRFA 2LXUA 3J7AO 1S99A 2LNBA 3ABTA 2CJYB 3OR2B 4ENMA 1FRXA 4YS2A 1BQNA 4HEA2 2V4RA 2CH0A 2DB1A 3O6BB 2J9EA 4LIVA 4HSTA 3KLEB 1Z2ZA 4A0YA 3MMJA 2ADUA 2D1CA 1XMOF 3NGRA 3TJAA 2CYYA 4FYDA 1UKUA 1QAYA 5GAGJ 5FGMA 2VASA 1G2HA 3CDIA 3EMTA 1RCXB 2ZOFA 1T7PA 2FD5A 4AIDA 1EKSA 3CCRS 3K0JA 4RO0A 4M74A 3OV8A 5H1SV 5IM0B 3GXOA 1U1MA 2BKOA 5DD4A 3V81B 5A8WB 4IHXA 1FTCA 3ELKA 3QAUA 3GFZA 3LPEA 2WOMA 3GCMA 4ESFA 3J81Y 2VA3A 2G4BA 4NZ0A 2UXCF 4DR7J 3S2HJ 1RNLA 5EWFA 3AJ2A 3MEDA 1TL5A 1SMYF 4F4ZA 1GV2A 3R9LA 4F91B 1G3YA 3PJ9A 4Q8FA 4CP5A 3FMSA 1FKOB 5SZTA 4JV1A 1IN5A 2XB5A 4XQFA 4L75A 3K59A 2GFFA 1CG2A 2DHSA 1C1BB 1S1WB 4DL6A 3S8PA 3R6SA 4YG2F 2HVEA 5BPIA 4YP3A 4Y2KA 3G1LA 3HTSB 1G8XA 4M5KA 1LUJB 2NXNA 1ACMB 3Q3SA 1TW3A 2W9CA 4B3MJ 4NCAA 2NS7A 1TQIA 2HHTA 3VR1A 2VN2A 2Z16A 3DRPB 2B8QA 1SV5B 1S97A 3FZBA 3A0BC 2BZTA 2DTRA 4OHXA 1NZ8A 2QQAA 3RJPA 4GVBA 2RRAA 2HFHA 4L0ZB 4D9JA 3E3VA 5C7PA 3KLVA 1J5EJ 1IDZA 4CNYA 3FISA 1WKKA 3AAWB 4C2UA 3NBPA 1KBRA 3U1MA 2FBHA 5ICCA 2I8EA 1UVMA 3M8PA 1T0TV 3LWLA 1U8SA 1JLCB 2HVIA 3BQZA 2R7OA 1LWCA 1UA1A 2V6CA 2C2RA 4LLNA 1LWFB 2C3YA 1VDHA 2DHHA 2Y8YA 4DR4J 2L02A 5LEJA 1RT2B 3BGUA 4YFXF 2VPYB 2VQFJ 4I01A 3OFFA 4HEA9 4PWDA 4Z7YA 2PX9A 2ZE2A 2JLFA 3ZOBA 2Q1LA 2GAUA 1HSJA 4Y2MA 2K8GA 1FYLA 2MY7A 1S9GA 3GJRB 1MBHA 3AQPA 4GYGA 2I9SA 1IXRC 1ZG1A 2LP4A 4F67A 2D69A 3M05A 2DDBA 3A4CA 2CXEA 2EXUA 4ELVA 2BX6A 2AIRB 5DUKA 2DNHA 4OX7A 3K4MA 1WHUA 1JXSA 5L3FA 1HKQA 3W62A 1M5HA 4M5LA 9ANTA 4Y52J 4XORA 4BAYA 1HBXG 3ENVA 2Y9YA 1PBAA 3KHHA 4PG6A 4FP9A 4KFCA 4WE1A 1SKSA 3ZZ0A 4OHVA 2W7PA 3PEJA 2Y1LB 4Q0BA 2VXZA 2DK5A 4GKJJ 4PFPA 3DRRB 4Q4ZF 5T41A 4DSEA 4TYAA 4I4BA 5FRMA 2HNHA 1RWVB 3K2ZA 1WOPA 4FN5A 2CG8A 4LRDA 3SHFA 1QVGR 4HSRA 3E6CC 3ZQ7A 4M71A 4ED1A 2NPIA 4USHA 2W84A 1W4MA 4I1TA 2A5WA 2TRTA 5MAOA 3D3BJ 4NEYA 4F7VA 2D9PA 2EC0A 5J2QB 1N0VC 3HBLA 4HT7A 1YITS 1Z21A 2Z2LA 1W5CC 4NA2A 4O3PA 1C0WA 5TISC 2MEWA 3TVYA 4CSWA 2LP0A 4BLGA 3MEKA 4L9VA 5CYQB 2JTVA 1U1LA 4L0YB 4IG3B 3CCRI 1WG1A 3T9NA 1OYWA 5L1KA 1V5GA 2DI3A 3OHAA 1D8KA 4EBEA 1QM9A 2IBDA 3DF8A 5HLGA 2GAHC 2MKIA 3TZWA 1FYMA 2QFIA 1KWMA 4FE4A 3QNWB 5IT9Z 1IBMF 1X1BA 4BBRJ 1SD6A 2PMZN 3UVJA 5D4PA 3GFMA 5HQ8A 1IKWB 3FMQA 3TL4X 2D74B 4X66F 3TEHB 2A3JA 2DT6A 2L0KA 3R4KA 3PR5B 3M7VA 3CCES 4ZLNA 4LSZB 1HHQA 3LALA 2E71A 1WC5A 4HOBA 2ZDOA 3CESA 1SL1A 3IKVA 4PJMA 2OEJA 4LG0A 2QBYB 3J80U 5LJ5Y 3BGRA 2ADBA 5KFOA 3CD0A 5KOXA 3M6VA 2LD5A 1IKVB 3NOGA 1TKXB 1SIWB 3M2UB 4O44A 2IDEA 2DKOB 1PUEE 1S12A 4KGZB 5BYQA 1VQSA 4BDZA 4W90B 2XEXA 1DLOA 1VBXA 2H94A 3LQRA 2FJDB 5KAKA 3HRSA 2MDAA 3KETA 1DHMA 4O0NA 4PG7A 2ZJ2A 3BPVA 3D5RC 1ZGAA 1YZ6A 2RS8A 1CSJA 3CUNA 4ED0A 3NMAA 3ET6A 1FSHA 1RLCL 2KJVA 1FDDA 4N8OA 5EX0A 2BACA 3KX2A 1Q53A 3SCLE 1D9AA 3TRGA 2A1BA 5H9FJ 3OVBA 2JSXA 1BWEA 3UWTA 2DGUA 3GBGA 3ZMVA 3F44A 4BHQA 4DR7F 2D45A 2WVCA 3Q0VA 4IFYA 3IH4A 2QIFA 3A3PB 5DGAA 3BR0A 1NXIA 5CCMA 2CPZA 3H36A 2FDNA 1L3VA 1FK9A 1Y5IB 2MKSA 4TQRA 3DFGA 1X8DA 2LLKA 1JJ6C 1T9TA 3KTQA 1BJZA 2J7KA 4KHRA 2NVXJ 4IOAF 4JI5F 4DYQA 2XMKA 4K5SA 1FEEA 3QZ8A 3QIPA 4P6QA 4DR2J 5JMNA 1FF2A 4J9VA 3JCUC 2CQ2A 2BW3A 3WTVC 1QUPA 1RWOB 5E79C 2YKMA 4B3MF 3KDNA 2V9PA 5C2CA 2K3PA 2PA8D 1WF2A 1AYEA 3DV8A 2B51A 1NNDA 4OMFG 1Y0HA 4XN0A 1FDAA 5DZ6A 2VL1A 3BQ1A 4JP8A 2GV1A 2QSGX 3PX6A 4L5JA 5T7LA 5L46A 3QAHA 1C0TB 3EVOA 4V2FA 3VB2A 3L4BC 2GJ2A 3MEDB 4IOBA 2VPWB 2VICA 5L3GA 2FY8A 3BDPA 4A8OA 4E0DA 3LTOA 3VODA 2WCXA 3P9IA 5IC6B 5CXTA 1YITI 2ELHA 4DR4F 1HWKA 2MKYA 3L95X 4I6WA 2LDUA 3NWSA 2VQFF 2X7IA 4E7SA 3R0JA 2CUEA 3OYEA 2ESHA 4BE1A 3VAFA 2R7SA 3D0GE 1BE4A 1P8GA 2RT3A 1G6NA 3WTZA 2NXNB 2J8SA 5HMWA 1D0EA 1WOOA 2IMOA 1JNZB 3HOYJ 2FOKA 1U2CA 1JTYA 2XF7A 4KKOB 2COMA 2G9OA 3HKZN 1HFEL 1Y5LB 2B9YA 3MKWB 1LNWA 1D5VA 2ZH2A 3RAXA 5KFSA 5RUBA 2R7FA 2JN6A 2DR6A 3EGNA 4GVBB 3EUNA 3EVMA 3D54A 1MG7A 3C6TB 4GKJF 2ZVIA 2NNYA 4F7ZA 4IHYA 3CJRA 4KSEB 4P73A 3FCWA 1FEXA 4KV8B 4ZN1A 3CCEI 1VS3A 4UVBA 3GG0A 2J7WA 4YIFA 4ZDNA 3SCIE 1SFEA 4I7HA 2LBFA 4JBCA 5J1EA 3JSYA 3BWGA 1RAOA 3IAS2 3LQVA 4J00A 4C8NA 3KYCB 1W2BR 2V8VA 4IX7A 1LWCB 4PYDA 4DZ6A 3MUTP 2A61A 5L3BA 1RTIB 1VK8A 5K14A 2XTJP 2PD1A 2LMIA 2CJAA 4RNFA 4BS2A 2F1FA 4KN7X 4JBAA 1VQOS 4X1EA 1KR4A 3TWZA 5B1BH 4USMA 1S9GB 4G7ZF 2H48B 1BXNA 2LQBA 3A1YA 3BBBA 1TVRA 1OY9A 3HG9A 5KFJA 3OL4A 1T56A 2BE2A 3BG7A 4LGWA 4EJWA 1LFBA 1GUUA 3GU0A 4HX7A 4J7CA 4WK3A 3GFLA 3ZN0A 4LJMA 1PC4A 2X48A 2EH3A 5A2QY 2EFOA 3MCOA 2CJKA 3WGGA 1MWZA 4BJTA 2DW4A 1U3EM 4XAKA 4O4GA 4DMZA 4XO0A 4RGRA 5IFMA 5ILUA 3GFHA 1KOOA 2RH3A 5KFPA 1S1UB 1WHXA 3CC4S 4LBIA 2GAGC 4DFKA 4XNFA 2CAJA 4PDKA 1DARA 4HLBA 3P45B 2MH9A 2RQCA 2OGUA 1YK9A 4TV7A 4PXEA 4LG3A 1YKWA 1NRKA 5AT1B 5CZVA 1ZTRA 1U1KA 5E3QA 1DZ5A 1U48A 2ZOGA 2XGXA 5IQQA 2AYBA 4CNZA 4R0EA 2WVBA 1N54B 3WG9A 2YWKA 5DM6F 2AJFE 3V42A 2HQNA 5FB2A 4UOHA 1YJVA 2WVFA 4K2EA 2Q66A 3EETA 3DHXA 2VG7B 3S14J 2NS0A 9RUBA 4DU8A 2OD5A 3JRFA 1OJLA 4NB5A 4GVLA 1V3ZA 4J90A 2GZOA 1WJBA 2ZJQF 5BMZA 3J7A1 5B0EA 1RCOB 4USKA 2E1NA 1KQ0A 1F3FA 5HS9A 1K78A 3ZGKA 2JDJA 3CMAS 2DGTA 4B3OA 2GW8A 1Z7UA 3PNYA 3TJ9A 2N3LA 1WELA 2HW3A 3P5JA 3HXLA 4PRFA 3IAS9 1HL6A 2VC1A 2MHEA 2R8HA 2N82B 1VHIA 1C1CA 2GHWA 3C66A 1XEZA 3HHDA 4RDUA 2LKZA 3NAHA 1B70B 3Q8PB 2M8DB 4CCLA 2XF6A 3HFZB 4NLPA 3T1YF 2NNNA 1USSA 1B9NA 4C2TA 4ZPDA 2IIHA 1DPUA 1VC6A 1VQ6I 1RI7A 5CPRB 2ZBPA 2L41A 3ITHA 4LG0B 3PXGa 2EZKA 4PPDA 1YS7A 4ED2A 2IY5B 5LGUA 2QLWA 3MR5A 3DMJA 4U7UD 1KTQA 4KIFA 1D0XA 2RSQA 3UI3A 1H2TZ 2KYXA 1NJWA 4Z2YA 1YLXA 4DR2F 4HNVA 4RNHA 4QYZJ 4XPEA 2KB2A 1YX2A 3FQKA 4WXOA 2FZKB 1LWEB 2HS5A 1X4HA 2OTJS 2MKJA 3FXQA 4EMSA 2MQ8A 5DUIA 3AD7C 5K20B 1GAOA 3FQLA 4IFVB 3VQTA 1Y10A 2QLBB 1SAUA 3ABKH 3S93A 3KG0A 2V26A 1EZZB 4WJBA 4OLPA 4ITVA 2MGZB 4M5DA 4DQRA 2V8DA 3VEPA 3ZTPA 5I3QA 3QAEA 4KY3A 3LSRA 2VFRA 5HMYA 1MMLA 3PQKA 2V34A 4UUSB 5KK1A 1BGXT 2DEIA 3MFIA 5DG7A 2PEHA 1SAXA 4L9NA 5J1NA 1NJXA 4Y15A 2MC4A 2IYIA 1DBDA 1XNRJ 3IL2A 1SC4B 2EPIA 3RKYA 3W9IA 2DJNA 1ON2A 2R7ZJ 1IQZA 4JI2J 1RWNB 1XD7A 3KP7A 4OI3A 3NWTA 2ZH7A 1ZLJA 4O3SA 2BKPA 3IH2A 3I55I 1FBSA 4CZCA 2HFZA 1I94J 1QSLA 4BBYA 2DNGA 2ZBRA 3DM2B 4PQUA 3S2DJ 4ZPAA 1W7PB 5J3LA 1GT8A 4AIHA 3CDEA 5DG8A 1N5QA 2QKMB 4WF2A 4BY7J 4TVAB 2BW3B 4OYWA 2ROEA 2YKMB 4G8XA 3Q0AA 2MJUA 2QL9B 1FRHA 2CQPA 2BE9B 2H4WB 4LF9J 3I3LA 4IHVA 3PHEA 2BANB 4L3KA 2G0IA 1NM2A 2A6TA 2G0EA 3EDQB 4QWEA 2UU9J 3LO3A 1HXDA 4IPAA 4BL0B 1DTQA 1T9WA 5T7LB 1JXLA 4MEYF 4Q48A 3VAGA 1AKHB 2MLKA 5HS8A 3HPGA 1HBUB 4TY9A 2PN6A 1SQFA 3OHBA 2FA5A 2W2QP 4EYHB 2GS8A 1S0NA 4RUAA 2VJUA 4KYWA 4CYUA 3AH6A 5DO2A 1FCAA 1HKAA 3LP1A 3PIPF 2DQLA 1HBOB 4WP3A 1ZG5A 4JX6A 1SH0A 3OMYA 2X1DA 2BBEA 4J9LA 3SZPA 4ZZDA 3I9V2 4ZIWA 3EPZA 2L4MA 1HSTA 4GFBA 4MTDA 5FLXZ 1T03A 3JTHA 3KE2A 4BS9A 1G3SA 1HQUB 3IS9B 1MU2A 2PMZA 3UCGA 3BYPA 4OJ1A 2HHXA 3IG1B 4ECWA 3CMAI 3QODA 2YNIA 1N5VA 5B0BA 2EFNA 1B0PA 1TL3A 4G9YA 2M4GA 4RAGA 4CQ1A 3IR6B 2CMPA 1P92A 2RU9A 3DWLE 2W24A 3F8NA 3OS2A 4NUBA 1SUQA 1NK4A 1CJKB 3CT9A 1M1EB 2UV8G 1BI3A 5J1EB 5E3NA 4V19K 4OOIA 4LSLB 4RLEA 1KQ8A 2P8IA 1UCNA 4XN3A 2CG4A 1C2PA 3I5UA 2AW0A 2WK4A 2A68F 3F0NA 1FKAF 4CH1A 1T38A 1SFXA 1OQ6A 3KLOA 1S0VA 2W00A 3AD8C 4DCPB 3M4XA 4A3DJ 1UPPA 2UXXA 4XK8C 2MGQA 1A6LA 1CLFA 4EGYA 4Q7AA 1DP3A 1SH2A 2KRRA 5F1JA 2LDIA 1ETWA 2EV6A 1V5IB 2A6MA 5H6RA 4I2QA 3Q0UA 4BWMA 4P10A 3SXLA 4LR8A 1UEVA 2IHR1 4N41A 3ML6A 4DV3J 1TVRB 2OTJI 1XMXA 1BR2A 2YQ1A 2IA1A 4ECRA 3PFIA 1SD7A 3GV5B 4MIWA 1IBCB 2G9WA 4EM2A 1W25A 1VQKS 3KLHA 2H5IB 3IWXA 3GJQB 3SFUA 4M3GA 2XM3A 1S9EA 3S17J 3QJLA 3OYDA 4FNHA 2CUYA 2CRLA 3CDHA 5F1RA 2W2PP 2OMOA 2PJPA 1FNNA 1VC5A 2O67A 3Q5FA 2DBBA 2MQPA 2ZBQA 1Y6IA 2DNRA 4J9NA 3G2BA 3E5QA 4J37A 4Q44A 4A8FA 3IWNC 5A8RA 2ZWOA 2A05A 2AXLA 3GZ5A 2XMWA 2EA2A 3F72A 1FRJA 5LMNJ 3PO5A 1OY8A 3Q8QB 2NR0A 4X4QA 1XPXA 1V3SA 5CLSA 5ITHA 3HSFA 2OZUA 3PCOB 2B0GA 3GO5A 2M9KA 2CJQA 2CU7A 1REVA 1VQMI 4F4XA 1KU9A 1IXSB 1R4NB 4AD6A 5K1YA 1WC3A 3RB0A 1MMAA 3I59A 1U9OA 3Q8SB 1RKJA 1XNQF 5GAHI 2R4FA 1K78B 1B1BA 1KA8A 2LKSA 3HC7A 4QWBA 2A10A 4FYWB 3JW4A 2C3MA 3TEGA 1XTAA 3PRBA 4OZLA 1JUMA 2JMWA 2M4MA 1SJQA 4MTEA 3PDNA 1RJJA 4MK8A 3C7JA 5HVFA 2XVCA 2J6TA 1AROP 3PW0A 3HSZA 1R36A 1WI9A 1UWBB 3T41A 4MAKA 2ZBKA 4NHJA 4MHGA 3KJVA 3NWRA 2A6OA 3CP8A 2HVRA 2OCCH 3MAQA 3ITHB 4JI2F 3B8HA 2J5PA 4ZPBA 2Z9OA 1RBLA 1HNZF 5F8IA 1MWQA 4QIGA 1S7AA 4FS1A 2W4SA 3BH7B 4L73A 3I4NJ 4G1QB 3DXSX 2YNHA 1I94F 3SDBA 5KVRA 3QYEA 3RBXA 2GMHA 1BI1A 2PBIA 4TQSA 1PP7U 5CH7B 3DGVA 3CTAA 4RUBA 4P2FA 5ICFA 2M45A 2NVUB 5KAFC 1SQEA 3IP4B 3TX8A 3DRXA 4C8MA 5BR8J 2BW7A 1JJ2R 3MURP 4LF9F 4LD5A 4MK9A 5E7OB 1SC3B 3VFZA 3S8SA 3M8RA 5LM7E 3ABUA 1JUPA 2CNLB 5KT3A 4LBHA 3BBCA 1RT1A 2LKXA 4L76A 4R25A 1CJTA 4XDCA 2ZFHA 1UMQA 2UU9F 2HPIA 3DLEA 4M5DB 4PG8A 3UPFA 2O1PA 2HGCA 3N28A 1UFWA 2DITA 3H3ZA 3RCOA 1U0HB 3Q83A 2NAZA 4RA2A 2FE3A 1HWUA 1VIXA 2UVRA 1HC8A 3KHRA 4BXXJ 4JI7J 4YRVA 1X3ZB 3MMCA 3NNCA 1R8HA 3JREA 1S1XB 1WDDA 2BM1A 3E6BA 2PJRA 4I76A 1BJAA 4Y65A 4DQPA 3NS6A 4RNNA 1TQMA 4RW7A 2JSCA 2JA6J 2DOEA 1SFOJ 3MM7A 3C3LA 1D1BA 5FKOA 2LH9A 2RVCA 3CF5F 2V50A 5KG3A 2GNKA 3U2RA 4DQQA 3BDDA 1K1SA 4K4ZA 1N75A 3ZMSA 5KOWA 2Q6CA 2V67A 5E8IA 3LGMA 1VQKI 4NXNF 2Z2SB 3QBCA 2YX1A 4OI6A 1N36J 3I53A 2D3OR 2I38A 4WF9Q 4DV7J 4HACB 2YBVA 2KVIA 3HSRA 2KH9A 4XMYA 4PK4A 3AB2B 2XGPA 3HD2A 4RGSA 2R5ZA 3M8FA 3PNTA 2VE8A 5IYDJ 5BYSA 3THVA 3HHLD 2HS4A 1LW0B 1U4BA 2W9BA 1JIHA 2WONA 3L7WA 3OL7A 2I6WA 3WHBA 2IT0A 4JYAJ 3M9NB 1YRUA 5HMZA 2HOSA 4CDGA 4RAYA 3H0GJ 5EGOB 5CZXA 2A07F 4DPUA 1LXNA 1S72S 1Z05A 1PGZA 4PUOB 5G4DA 2HBZB 2DYSH 4DR5J 4CYUB 1F43A 4OLOA 2K7KA 4LVNP 1H74A 2QA4G 4CDIA 1SJ1A 1MH4A 2O3DA 5KG6A 4DSIA 3CTRA 1ONVA 1KC8T 4ENJA 3OIOA 2ZBCA 2HQCA 2PMUA 5KFMA 3AOCA 5L9XA 3MMAB 1T03B 2KHDA 2HS3A 1PG5B 3BGOP 2OPRA 3D68A 4DV3F 1B4AA 5J1UA 4ILMA 3MFHA 2P4WA 3M8JA 2EFPA 2RD5C 1I5ZA 1TL3B 2ZH9A 1YTYA 1APSA 1HHTP 2K1RA 3C6UB 2MMYA 5F0WA 2HQ3A 3MZYA 4I0AA 3KJNB 3IO1A 3LL7A 3HT0A 5E2QA 2ZWPA 1OO0B 3SCKE 3CZ6A 3SFIA 4C9YA 3SV4A 2M34A 5A0YA 5GAHU 5F6FA 2HIQA 3TZXA 3FZVA 2VKHA 3M8WA 1G2EA 3DLHA 1C0UA 1Q8IA 2KPMA 1YS6A 2O03A 3ZC4A 1FRIA 4OJHA 1CBKA 4WXCA 4DF8A 1RKTA 3FXOA 3ERED 4NXMJ 5LHGA 3PUBA 4MNUA 4KH0B 2LG4A 4CZZA 4X65F 4ECSA 3LAJA 1FRLA 3GFXA 2HVDA 3VVTA 4I2QB 3MVPA 3BG5A 3MZHA 3MR2A 2VG6B 1MNDA 3G6VA 3KNGA 3QGHA 1P6TA 1TKTA 4IOCQ 1NSAA 2R93J 4DPWA 3Q8RB 1EJ7L 2ZKTA 1X4GA 4WIIA 4WFXA 2R8IA 3B6AA 2W1BA 3CXCR 4F0HA 2DNYA 3PNVA 5F0HA 1YGYA 1HNVA 1R31A 1T3NA 4B9MA 1ZA2B 3KLHB 4AXJA 4UY8I 2DGWA 1P1LA 4AYBN 4A48A 1I1GA 1P4XA 5HLIA 3UD3P 4J9MA 2IRUA 2RKIA 3OS1A 3ULQB 2AD9A 2DNNA 1FFGB 4HT5A 4S05A 3SSRA 4PJNA 3S32A 4RB0A 4WYWA 5DG9A 3O8WA 4OHYA 4MFDA 2P8TA 4P72A 4QR0A 1ORKA 3Q22A 5DRKA 2ZC4A 4I02A 2JK3A 1X4OA 2RQ4A 4I6ZA 3FMWA 5EEGA 4NMXA 4KGKA 3J80Z 3PW2A 3CW2C 4II2A 1HYSA 2FEZA 2DMPA 4EJVA 2P9GA 5DDOC 1FY7A 1HLWA 2EWHA 4DV1J 2G2ZA 4AFFA 3R3TA 1OS5A 3DPLC 1FX4A 2HTJA 3HTUA 3NRBA 4OYBA 3DKXA 3WX8A 1N56A 4Q47A 2OA4A 3GONA 5L8RC 4P9FA 5I3PA 1U78A 2FX0A 3NP5A 2UUAJ 4EQQA 2FY1A 2GLOA 2PSZA 3F9KA 5B0CA 3I59B 1RAGB 4EZ6A 3V6HA 3GG1A 4A4JA 3GIRA 1RUOA 2GA7A 4WFNQ 3RBDA 4NYOA 4BXUA 5BR8F 1FYKA 2XHWA 4NC8A 2CVIA 2H6BA 2R3VA 2IYGA 4MGRA 4A47A 2KN4A 5J2NA 3P6YC 2DO0A 4HR2A 3LQQA 5DZ7A 4FBTA 4F26A 3MM5B 2GGPB 1NKCA 2E7XA 4FKXA