4PCQA

Crystal structure of mtbaldr (rv2779c)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
ELDEVDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTDIDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADDFILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MtbAldR
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Possible transcriptional regulatory protein (Probably Lrp/As
total genus 31
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4pcqA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pcqA02
1V3FA 3TDZC 2CYYA 5CVIA 5IT9K 3WU1B 2DQLA 4EMSA 1J59A 3N4MA 1TNSA 4HX4A 3HHGA 2JTVA 2HQNA 5H20A 2W57A 3I59A 4AIHA 1W7PB 1JHHA 3CUOA 3GF2A 3WTWC 2G7UA 4P5OA 3V7SA 4P9FA 4Q48A 3FWEA 1UHWA 1U6GA 4N9HA 4N9IA 3R4KA 2OZ6A 4CICA 2H94A 1AWCA 1EH8A 1HSTA 3V4GA 5L3CA 2D1VA 1ZAOA 1KQ9A 2X4HA 3FMQA 3N97A 4HW0A 3CLOA 3U2RA 2VOPA 3BJ6A 2JRTA 5D8LB 1G3YA 4U0YA 4ASNA 5D5XB 3IRQA 2V1DA 2EFWA 3FXUA 2BBYA 2IJLA 3JSOA 4M73A 3GFJA 1QNTA 4RB3C 2Z3YA 1ZLJA 4MQVA 1S6LA 5LRRA 3BWGA 1MD0A 3T1BA 1IN5A 4EJOA 1G3SA 1XSDA 3L7WA 3WG9A 2VXZA 3FZVA 4RB0A 1IAWA 3SZPA 3WTYC 1XGMA 1FYMA 2YU3A 1SFUA 2COMA 5JI6A 2RKHA 4LK0F 5H6RA 1FBSA 4LB5A 1XMKA 2M30A 4M72A 1ON2A 1DP7P 1CGPA 1U5TB 2FU4A 2H6CA 5ICCA 2MA3A 4BYYA 2DQRA 2HYGD 5JFRA 1L0OC 2XKOA 4M9XA 4MEYF 2HQRA 1QO0D 5E8IA 2JZYA 2IVMA 3GFMA 1D5VA 3LQQA 2QBYB 4UV9A 4KIGA 3QP6A 2L01A 2E1CA 3JSPA 1B4AA 3BPVA 1XD7A 1W7PA 5E18F 5ERIA 4XSZF 1F9NA 2ISZA 5LGNA 1J5YA 1P4WA 2F5FA 3ISPA 5JR3A 4HX7A 1TLHB 5FFZA 4A0ZA 2HWVA 3E6MA 1IUYA 1XDUA 2ESHA 2XRNA 2FOKA 1YS6A 3TDUC 1YLFA 3DV8A 4BQAA 5DCMA 4L9NA 3M7GA 3I53A 4MGRA 5DV5A 4LLNA 2STWA 3MQ0A 3SHFA 2CGPA 3MZHA 3ELKA 1Y0UA 5CVUA 1BC8C 4I98B 4NQWA 2WV0A 3WTUC 3KCCA 4EJWA 1HW5A 1QZYA 1YQAA 3I71A 2BGCA 3LA3A 2LF7A 1XDSA 1ZRFA 3RPQA 4XBFA 4HDUA 2L4AA 2IW5A 3C7JA 1RUOA 4EGYA 2VBZA 2VODA 2IT0A 4HDVA 1FC3A 1UCRA 3G73A 1P6RA 4I02A 3WU0A 2L4MA 3VEPA 2HOEA 4ZYEA 4EJUA 4H0EA 2EFNA 4JK1X 2VT3A 4UV8A 2OBPA 1ON1A 2PLYA 5DDGA 2HR3A 4O5VA 4HLXA 3QRFF 1FOKA 2XASA 2RN7A 2FBIA 1WWXA 2V1XA 3J7AO 3VB2A 3R0AA 2M8EA 4GYIA 1O7FA 2UXXA 3IRRA 4HF1A 1O7LA 1BBYA 5ILSA 1YYVA 2BEOA 2A61A 2RNJA 4QWQA 5LGUA 4LK1F 1VTNC 1MZBA 4PGGA 4CO8A 1S29A 5DEQA 2EFQA 1FSEA 1SMTA 1R58A 4A0XA 2K86A 4Q47A 2DFIA 3TKYA 4EV0A 1LEBA 4WXDA 3QU3A 4ZZLA 1XB4A 4KDPA 1DPUA 1WQ2A 2XUBA 3Q9SA 4UVAA 1U5TC 4G7HF 2EV6A 2R3SA 3MZYA 5HLIA 4HBLA 3WTVC 3BOQA 2H09A 3P9CA 1ULYA 4NB5A 3LQRA 2PMHA 3RDIA 1O3QA 4HV5A 2Q8KA 5FLXK 2L54A 4RAYA 3WGIA 4K2EA 1BIAA 1JGSA 3GLXA 5HOOA 3WTTC 3FMSA 1PP8F 3GW2A 1MGTA 1W7PD 4TV7A 2F2EA 4M6YA 2YX4A 4ETSA 4DNCA 3RPUA 4MTDA 1X3UA 1A04A 4KT5C 5F64A 2P5LC 3QU6A 1TQPA 3LSTA 1V4RA 5TJJA 3CTAA 3K9TA 1ODDA 1KU3A 3D0SA 4YFNF 3HSEA 1F1ZA 2Q0OA 3F8BA 5E1WA 4MQ9F 3C3WA 1ZGAA 4I2OA 5AIQA 5DCMB 4ESBA 3KP4A 1HKSA 2OQGA 1UHMA 2KIUA 5E8GA 2VBWA 1U2WA 1B6AA 3BJOA 5A2QK 2VBXA 3GO5A 1JHFA 2FNAA 3WODF 2OA4A 4A6DA 2Y48A 3JAMZ 1Z7UA 1IF1A 2MH2A 2P8TA 3DPLC 4IHSA 4HOBA 4F7ZA 4LFUA 4UNOA 2KJCA 1FNNA 2AS5F 3GYHX 3EUHA 4PGHA 5L3DA 3B73A 2F5EA 3HIFA 1H9GA 3I58A 3K1NA 4ENNA 3M8EA 1OYIA 3IKTA 4YFXF 2RV8A 3I5UA 3FM3A 3G3ZA 4MNUA 1P4AA 4LLLA 1Z1DA 3HUGA 1XSVA 5BOXA 2UZKA 4PCQA 4BAYA 1R36A 2V1UA 3NEUA 1HKQA 1S7OA 1KA8A 3IKVA 2OQRA 1R23A 4LJZF 4IVNA 2H6BA 3ZPLA 4B09A 5ILVA 5IT9Z 3BPXA 1XGOA 3R60A 1XMAA 2JSXA 1RI7A 3P7NA 1B1BA 1U3EM 4KICA 5D5VB 1E2XA 3F6VA 2ACJA 2QM3A 1R1UA 3ULQB 2DJWA 2MBFA 3LA2A 4BNCA 5E17F 2OZUA 2E7WA 2Z5UA 2D1HA 4G6QA 3KP7A 2EJRA 3P9KA 1R1TA 1XCBA 4HA8A 4R1HA 5BQTA 4KUMA 3EDPA 3HOSA 2CSOA 4YG2F 1FLIA 2P6SA 1ZREA 3K69A 4A5NA 3P9IA 1D8KA 3V7RA 3SQNA 2Z9OA 4KFCA 5FD5A 1BI0A 1MJAA 5CVJA 4EM2A 1IN6A 3NQOA 2EWNA 4EQQA 1LVAA 1SD7A 1ZG5A 2PI0A 1BJAA 4OIOF 1O3RA 3E6CC 2EV5A 5L3EA 1MDMB 4L9VA 2NNNA 3GFIA 2UWMA 2RDPA 2EFOA 3W6KB 3FHZA 4I7HA 2ZNZA 3SXYA 1D3YA 4Z2YA 4WWCA 1IN7A 2BV6A 2DW4A 3BZ6A 2PQ8A 2LSOA 2KKOA 3RTRA 1R22A 4IF4A 3QPHA 2GAUA 3C18A 2WTEA 1EV7A 5EEGA 5E20A 1KU2A 4G8XA 1FYLA 2Z4PA 2HS5A 1LNWA 3V7CA 3KP5A 1DDNA 3MWMA 1G3WA 2DBBA 4B8XA 2W85A 1Z6TA 3IC7A 1HXDA 4ENKA 2XAFA 1G4DA 4L0YB 4AWXB 2HTJA 3RYPA 2CW0F 1HBXG 1BC7C 1BI1A 3QPTA 2LF8A 3KLNA 5K5RA 2C6YA 2K4JA 4IRHA 2DI3A 4IRIA 2A6EF 2E7XA 4IPAA 3ABTA 1XGNA 3GXOA 4R79A 2XKPA 2HGCA 1JXSA 2FQ3A 4DQ2A 3H92A 4U7DA 4CYDA 1O3SA 3I59B 2CG4A 3GX4X 2KIMA 4OU0A 1U78A 2GWRA 4BXUA 1MJ9A 3ABUA 4PDKA 5HS9A 5HDNA 4E70A 3JTGA 2VT2A 2FBKA 2NRAC 2YR2A 1I1GA 2YPRA 4LB6B 1QPMA 2X0LA 4M71A 1OR7A 4HZFA 4ENMA 4YFKF 1KYZA 3FXQA 2P5VA 4HAMA 4KA4A 2VN2A 4HQMA 4I09A 4JBAA 2RQPA 1B9NA 1PDNC 5JHUA 4LD5A 3RI4A 5D4RA 3KP3A 4KMFA 1OPCA 2L3DA 1T39A 4WXHA 2A68F 1F4KA 5DCFA 3VFZA 4O3MA 2Z99A 1UB9A 2ELHA 4L5JA 2CO5A 5BPIA 3L2CA 1SD5A 1RUNA 3ECHA 1LDDA 1H9TA 3QOPA 3FF5A 5FB2A 5IT3A 2LKPA 1TBXA 2XGXA 3TQNA 1IZ1A 3ML6A 1G6NA 4Y15A 4HQEA 3ZMSA 3T5XA 3L09A 1R7JA 4A5MA 2GXBA 1IRGA 1IN4A 3CUQB 2J5PA 3RKWA 3O6BB 4OIQF 1B59A 1BM9A 2NNYA 2P4WA 2V9VA 2KJBA 5LBQA 1AOYA 1REPC 2AXLA 2OD5A 1BI3A 2NYXA 1QZZA 3L9FA 4YIFA 1P92A 3MCZA 1TW3A 3QAHA 4O6JA 2F5DA 5DD8A 4EGZA 5BS6A 4IXAA 4M9SA 5FFXA 3HRMA 1R1VA 5TRDA 2DPUA 3MEXA 2O03A 5H6QA 1P4XA 4A6EA 1YO5C 1HW2A 1YS7A 3SZTA 4GYGA 3DF8A 5LLQA 2ZO4A 2OU2A 3T0YA 1FT9A 2CFXA 4IHTA 1FPQA 2GIVA 2PFBA 2GA2A 3V8LA 4KN4X 1GXPA 2XAJA 3E97A 2H27A 1JE8A 1G3TA 5LHHA 1BI2A 2ZFWA 3E6BA 4R8HA 3ZMDA 4L9JA 1ZHFA 1OYYA 2QQBA 1SFXA 4RAZA 1TQIA 1J0RA 4P55A 4I0AA 2DLLA 2DK8A 4KIBA 2GA1A 4G7ZF 5KK1A 2FSWA 4OIPF 5E1XA 5DUIA 1FP1D 3F23A 1XCVA 1YTYA 3J80K 1DPRA 5F1RA 1H0MA 1BOAA 3COAC 3I54A 1HW1A 5HS7A 5FD6A 5D6EA 2DPDA 2K7LA 2QUFA 2RVCA 5J8CA 3F22A 1ZH5A 5ICGA 4MHGA 2ETHA 1XGSA 3ZMUA 2M5WA 2A07F 3J81Z 1SAXA 1I1SA 3J81K 2QBYA 2Q2EA 1GXQA 4UHTA 1KYWA 2PG4A 3HRTA 1J75A 3DEUA 2R7FA 3WTZA 3ZMZA 2ZBCA 3F8MA 2ZNYA 1Z91A 4HF2A 2ZBKA 1ZARA 1IXSB 3T8TA 3TGNA 4A0YA 3E5XA 4NHJA 5BMZA 1FBQA 4G9YA 1R00A 4L18B 1IW7F 3KETA 4HV6A 3RIRA 4XRFA 5L3BA 3M8FA 1ZLKA 1USTA 1U5TA 4AIKA 4Y17A 3WGHA 2GZWA 4U88A 2JPCA 5HS8A 5FLXZ 5F6FA 3FM5A 1FSHA 2ESNA 3CDHA 1LDJA 3GZ6A 1QQIA 3C1DA 4A2UA 1Z9CA 4UUVA 2V6CA 3HHHA 1IN8A 3O3KA 5K1YA 4FHTA 2XHKA 3DQVC 4Q5SF 1YG2A 2EA4A 4GGGA 2VE9A 1TTYA 2O0YA 2EV0A 3R6SA 3DXJF 5K5QA 2E1NA 2IA2A 5D6FA 2STTA 3WGGA 5BPDA 3CJNA 3NRVA 3EYYA 1MKMA 5HLGA 3JTHA 2EK5A 3S2WA 2FF4A 2VE8A 4ENJA 4RB2C 4G7OF 3ZP5A 2M1BA 1O3TA 4G6DA 4G94A 3GUDA 4U0VA 1U8RA 4OMZA 2QVOA 3KP6A 4XSXF 1WKMA 3CUQA 4GO1A 5LEKA 3GFLA 2O3FA 2IP2A 4M9ZA 3L00A 2RC4A 3ZN1A 3ERED 3K1MA 1KU7A 2QQ9A 5J6XA 4M74A 2PEXA 1XSXA 2Z33A 4HF0A 4IJAA 3F21A 4RGSA 2M87A 2K02A 3IL2A 1K7AA 2FRHA 2P5KA 1T38A 2KRFA 2YX7A 3TO7A 4QLCU 1IRFA 3F6OA 3CO6C 1ZYRF 2VONA 2XVCA 3D5LA 4HYEA 3BY6A 4LLGF 3GZ5A 3AAFA 2Y75A 3WE3A 2HEOA 5ICFA 1FP2A 2RGVA 2ZCWA 4WXCA 1KQ0A 3F8CA 4UVCA 4BHBA 1UFMA 4BHPA 3DPTA 4LGWA 4Q4ZF 3PQJA 2EA2A 3F8FA 4RGUA 2O6GE 4EM1A 1ZN2A 4YIIA 2G7HA 3W6JB 1BIBA 2MLKA 3E5UA 2NS0A 2A3SA 2IA1A 1LJ9A 1GVJA 3EETA 1IXRC 4EJVA 3KFWX 5ED4A 2Y0MA 1ZRCA 3U9GA 4WK8F 1HQCA 4KMUX 2A6HF 1KU9A 1I5ZA 3KP2A 1CF7B 1W4MA 2ZKZA 4OMYA 2XIGA 2YSRA 4Y13A 4L0ZB 2QENA 2GQQA 3HSRA 3KZZA 4HX8A 3R0JA 1F5TA 2L02A 5ICEA 1K78A 3ZMVA 5HVQC 2G9WA 3OOPA 3VODA 4EVIA 5CJ9A 1B9MA 3F8NA 5E1ZB 4EM0B 1HKTA 4ZYHA 3QP5A 1L3LA 1J9IA 2EB7A 4EJTA 2KIFA 3F72A 5D5UB 3CUQC 2ZMEB 2EFPA 2XROA 3LWFA 5LGTA 1C0WA 3H3ZA 3LFKA 1RIOH 3PQKA 2MC3A 1K78B 2ZJ2A 2W24A 3E3VA 3FMRA 1WRJA 3DKWA 1CF7A 2R7DA 2DTRA 4CHUA 2PBIA 1ZG3A 4ON0A 3E6DA 3I0TA 1PP7U 1KQ8A 3HTSB 4I0BA 4ESJA 3K0LA 1D8JA 3Q9VA 1OYWA 5DYMA 5LHIA 2FMLA 2LDUA 4OOIA 1MDMA 2OAZA 4GCVA 5HDKA 4D0PA 3V8KA 5AIPA 4HLYA 2B0LA 2MLGA 4KNYA 3ROUA 4AVPA 4I01A 4MTEA 3RKYA 2FE3A 4RS8A 1SMYF 3DFGA 3FXRA 5ILUA 3BDDA 3H3UA 3F3XA 4OIRF 3ECOA 4FX4A 4BH9A 1FWZA 5FO5A 1TQMA 3RKXA 4WF2A 1KGSA 1W5TA 2WWYA 5DD4A 3IWFA 2IRFG 2DT5A 4XLPF 2DK5A 3HYIA 2P6TA 4UVBA 2CVIA 5DUKA 1K79A 2FNPA 2VOOA 2PN6A 4CZZA 1RZ4A 4FX0A 1SFEA 4RB1A 1YIOA 1YW8A 6PAXA 2ISYA 3O2PE 4P96A 2FEZA 2DO7A 3TOAA 4L9TA 3V8JA 4RGXA 1LEAA 4N0BA 2XV4S 4LG0A 1WSUA 4FT8A 1OKRA 2LNBA 3M9AA 1S7AA 1GHCA 4UXNA 3I4PA 2MH9A 3JW4A 2XAQA 4KIFA 1FY7A 3BROA 2NAZA 5D4SA 2VBYA 2D2WA 2F5CA 1T2KA 3K1PA 4ZYDA 1K6OA 1Z05A 2A69F 4ZZDA 5D8KB 2HKXA 4GXOA 1E17A 2QZ8A 3REOA 2K27A 5FGMA 3EYIA 1USSA 2XAGA 1LQ1A 2VC1A 2JT1A 1I27A 4OINF 3EQLF 5LRSA 4ESFA 2V79A 4AIJA 1MJBA 1ONVA 3KEOA 2O61A 1LDKB 4XLNF 4A12A 3RYRA 2W84A 4IRGA 2UXNA 2HTSA 5D5WB 2ZXJA 5CLSA 1LB2A 3TO9A 1YW9A 2GXGA 4KYWA 1S8NA 2XAHA 3M1EA 1FX7A 3SFZA 3JAMK 2M45A 3TO6A 4PZJA 3HSFA 1RNLA 4WCGA 1J7KA 1ZG1A 2MD5A 4S04A 2TDXA 4WX9A 1T6SA 2WC2A 5EEHA 5K5OA 1TNTA 3BP8A 5CVRA 3B02A 2D45A 2JSCA 2P7CB 2PJPA 1P2FA 3HRUA 3LAJA 4M6XA 1OMIA 1T0FA 4AD9A 4ZH4F 1HSJA 3HOTA 1BN5A 3BJAA 2HDCA 4S05A 3HTUA 5LHGA 3U1DA 3IWZA 2O8XA 3RJPA 1QBJA 4ZYGA 3ZMTA 3R61A 2CWEA 2QQAA 3GEZA 3OV8A 3WTSC 1R5GA 1DUXC 1SD6A 5CYVA 4JQFA 4CDGA 1STZA 3J80Z 3T8RA 3LA7A 3KLOA 2K4BA 2J5OA 3TOBA 4MEXF 3CO7C 4U7BA 3ZN0A 3WTXC 1Z6RA 2ZMEA 4BHCA 5KVRA 3K2ZA 1WI9A 4LG0B 5L3FA 3KE2A 1YFHA 2VC0A 2PMUA 4RGRA 1FYKA 1FZPB 5LEJA 2IPQX 5J8FA 1SD4A 4LMYA 3LAPA 3MAJA 3I64A 2FBHA 5JVTA 2BYVE 1QGPA 1YW7A 1R5HA 1EH6A 2DU9A 2QWWA 1T98A 3HRSA 5AONA 5L3GA 1W5SA 5A2QZ 4P9UA 1PUEE 2FMYA 2JPBA 1J2XA 3DP7A 3KEQA 4U0WA 2IA0A 1EH7A 1Q1HA 3VOEA 1XN7A 1IXCA 3KZYA 3Q5FA 4CXFA 2HYFA 2QYOA 4CGZA 3E5QA 1S3JA 3FX3A 5HLHA 1NHAA 1O57A 2W25A 2DAOA 2QLZA 4KN7X 5CVVA 5HDGA 1I6XA 3WE2A 3PFIA 2A5YB 2HFHA 1FBUA 3IHUA 2HKOA 2CQKA 3ZQ7A 3GWZA 4L5IA 1TW2A 2BE5F 2HZTA 3MFKA 1ZRDA 2E1AA 2FXAA 2FA5A 2ADUA 1ZGJA 3GVAA 2P7VB
chains in the Genus database with same CATH superfamily
2COBA 4A69C 3OR1A 8AT1B 2LMDA 4OFZA 4F26A 2CYYA 1IBMJ 5IT9K 3H2VE 2Q1LA 5KFVA 2FC9A 3N4MA 1TNSA 5FLMJ 1N78A 1RT5B 2IVFB 2AGPA 2DHGA 4WP9A 3MOJB 2DHAA 2PSZA 5C44J 2YWHA 2E2HJ 2QN6B 3ZTRA 2JTVA 5H20A 3I59A 5IP9J 4W97A 1W7PB 5E0OA 1JHHA 1OY8A 2WBRA 2Y8YA 2JLEA 4Q48A 5F8GA 3D5MA 2DEIA 4CLPA 1UHWA 2VPXB 3JYTA 1U6GA 2AHQA 5HQMA 2BYCA 2R2UA 3R4KA 2X1CA 1U02A 3CJTB 1RTIA 4A3BJ 2PFFB 2H94A 5ETKA 1AWCA 2CJJA 4P75A 4EO8A 3N4WA 3EX7B 1HSTA 3UW1A 3V4GA 3RUBL 1GX5A 1N36J 1K61A 2DGUA 4RW8B 3THVA 3S2HJ 1ZAOA 4IHXA 5D4PA 4NCBA 3OS2A 5EWGA 2PT0A 3FMQA 3N97A 3GIKA 1G3OA 1ETVA 3IUOA 3U2RA 3TP2A 4OYZA 3BJ6A 2NYHA 2RU3A 2VFTA 5D8LB 1HW9A 3MEDA 1G3YA 4C2UA 9ANTA 1WDDA 4BBYA 5HP1A 1SL0A 2XHWA 1D9DA 1RT1A 4U0YA 4ID5A 4ASNA 4UOCA 1V55H 4UOFA 2HMIA 2BBYA 3R8YA 5GMKa 2IM0A 2EWHA 1VK3A 3MMJA 1UFWA 4Q45A 1ZLJA 1GVDA 1S6LA 3BWGA 3QWUA 3V4MA 4F02A 4DDFA 1G3SA 1XSDA 1NK6A 2D74B 1FNOA 4JI8J 4I6YA 1VGYA 4C3MA 3SZPA 3WTYC 4K0KF 1NH7A 1VK8A 2YH0A 2COMA 3FBBA 4NASA 3GJSB 5JI6A 2KH9A 1S12A 2OUMA 4LB5A 2APOA 3TARA 3JRAA 1LFWA 2BZTA 1XTAA 4AUXA 3MF5A 4W4MA 4XOTA 4I99C 2JQ7A 1SB6A 2FUG2 2BM1A 2DQRA 1O4XA 2KISA 1FDNA 3J7AY 4RNNA 1L0OC 4UY8T 4OI1A 1SC3B 1RDRA 2YNIA 5KFKA 3GFHA 4IEJA 2JZYA 2IVMA 3K0JA 3CC2I 1VIXA 4FPRA 3GFMA 4NLRA 3VAIA 4DSJA 4ZPAA 3EUKL 3VQTA 4Y4RA 2EI5A 4DX8H 4KIGA 4FYWB 2L01A 5M2PA 1PSDA 1ZA2B 3TZXA 1IR0A 4XSZF 5IQ6A 3K5LA 4ZVQB 2KB2A 1XC9A 2VQEF 4ZITA 2O5RA 1AROP 1XMOF 4HX7A 3PSFA 2J0WA 1PJRA 2XBPA 4D3HA 2CV1A 4AQYJ 1AB8A 2CJQA 4IFYB 2HNZB 2ESHA 2XRNA 1TL1B 2UXDF 5L8RC 3DLAA 2E5GA 1I50J 2K40A 1FXRA 3T1YJ 1I3OB 3KHHA 4N7TA 4BQAA 3KPHA 3J7Z5 4J19A 3WIUA 2M4GA 2VL1A 3CJ3A 1BUXA 2DA7A 2R0QC 3SHFA 1VF9A 3TYTA 1YHQI 2FX0A 3MZHA 2OD4A 1JKQC 4DJBA 1RR7A 3UDEA 3G1MA 3CCMI 5CVUA 1BC8C 2WV0A 3W2WA 1YSJA 4AXJA 3KLFB 3JREA 2WZ1A 2LU1A 1FEEA 4ZHRB 1HW5A 2RIJA 4DR1F 2AX0A 5KFGA 2RH3A 2V0NA 2LF7A 4EYIB 4KPYA 2OI2A 3RPQA 4Q44A 4F93B 3ZOBA 2F4MB 5K7HA 4EGYA 4KISA 2VODA 3UR0A 2V9WA 3DWLE 2HWIA 4PPDA 4DJAA 1MG7A 3RB3A 3PO5A 2EPIA 2RF2B 1NJYA 2IDEA 1RCXB 4WXWA 1P8GA 2HOEA 3Q0VA 2ZZMA 5ETRA 4C98A 3EICA 4JK1X 4ICLB 4WYWA 1IJFB 3MEDB 4E2FB 2OBPA 1SC4B 3S1QJ 3Q89A 1TP4A 4ZTFA 3VB2A 2WOMA 5J2NA 2M8EA 2F5GA 3DTEA 3IRRA 4HF1A 3RZDJ 3M2VB 4JYAF 2Y0SN 1BBYA 5AE2A 2BEOA 4KAIA 2RNJA 3CXCR 3CESA 1VTNC 3GG0A 1B8IB 4O3PA 5CQGA 2GFFA 4LR8A 1SVDA 2H1KA 2OJ3A 1NDCA 1YI2S 4X4VA 5M2UA 3TKYA 1KKHA 1VFJA 4EV0A 2E9TA 1LEBA 2MSSA 3TA2A 2L7FP 3KJFB 5E3CA 4AIDA 4ZZLA 3CCUI 2ECBA 4DU7A 5GAHJ 3IGVA 4X4QA 1I5OB 3MMYB 2M4KA 3LP2B 5HLIA 2I1RA 4JV0A 5FROA 2HIQA 3RDIA 2R4FA 1X9WA 3TW6A 1JMTA 2Q8KA 2HQGA 3GLJA 5FLXK 1SKRA 3UN2A 2X6XA 4K2EA 1R43A 4DR5J 3CCWA 1BLUA 4ILRA 5GTHC 2ADCA 2F2EA 4M6YA 1LPQA 2L7MP 5IS2A 2XI3A 5J47A 3ZXWA 1R8PA 1X3UA 4KT5C 1D9AA 2Z2ZA 4ZVEA 2P9CA 2P5LC 1FRKA 3QRRA 1NCLA 2AQFA 3JSYA 1V4RA 5HVFA 3M30B 1ODDA 2BKNA 2L48A 1JLQB 1LW2B 2VH7A 1VZ0A 1NBEB 4OHZA 4MQ9F 3OL6A 3W7BA 2BABA 2JLFA 3KNGA 1X4EA 1VQ4S 3DN9A 2Y9HA 4HLBA 3OTDA 4I2OA 1RXOB 3T3FA 1UVNA 2OQGA 1SQFA 3GV8B 1NJWA 2VBWA 4IFVA 4CCLA 4ZIWA 2MG4A 4Y65A 3LSJA 3H9GA 2CJ9A 1W0UA 2LR8A 4ED8A 1U1MA 2VBXA 3ZZ0A 1YBAA 2FNAA 1MNMC 3QAUA 4A6DA 2Y48A 1FWKA 4QYZK 1UA1A 1NO8A 2RUGA 1T8IA 3DPLC 2ZFHA 4IHSA 4HOBA 4F7ZA 4HT7A 3BQ0A 2OPTA 2ZUAA 1XBWA 4WU2A 2KJCA 3A03A 2NS8A 4DSFA 1X60A 2BXJA 3HIFA 4FISA 3I58A 3D9BA 3K1NA 1RAGB 3RR7A 1HL6A 3H3VK 3LF0A 1OYIA 3IKTA 3TAMA 4YFXF 4EO6A 2Z58B 4DV2J 2G2YA 2QC3A 1WUUA 4X4TA 4MNUA 4HEA9 2BQ3A 1F43A 5B08A 3HP6A 3HFVA 3HUGA 4EU0A 3DLBA 4G6TB 5BOXA 4M5JA 2DY1A 4CO5A 1NKCA 2CWKA 2ZVIA 4FKXA 5JHFA 1A5JA 1W7WA 4DF8A 4ABZA 1HKQA 2Q79A 1S59A 4ELVA 1R23A 3X2QH 5I42B 3HKZA 2UUAF 5IT9Z 2CZ4A 2F5VA 4DR4J 5E79C 1XMAA 3DI6B 3CCZA 4RNFA 2FJWA 1IJEB 4LQ3A 5D5VB 5HNFA 1OCRH 2ZBIA 4BUPA 2ACJA 1Q53A 3OTEA 5F0CA 2GAHC 3PKMA 2IBOA 4C3JJ 4BNCA 3BR8A 2KZMA 4QIGA 2BOAA 2IJFA 2OZUA 3QIPB 3H98A 3UD3P 1ZM9A 3GJRB 5DG9A 2FC8A 2EJRA 2HEKA 3FBEA 1UA0A 2EPFA 1R1TA 2X3GA 1XCBA 4HA8A 1H7WA 2GBYA 2A10A 5BQTA 1T03A 2AU0A 1RUSA 4U8YA 3OFFA 4YR0A 2RS2A 4F91B 4YG2F 4WP8A 3NS5A 1FE4A 4IOAF 5IT9Y 1A6LA 3ZZZA 5KFBA 1D8KA 1KHVA 1ORKA 3ILLA 3GSIA 3O3LA 3OV7A 3PFYA 1U2FA 2E5IA 2MYFA 3C66A 1FJGJ 4RW4A 5FD5A 4B9MA 1BHNA 1BI0A 4ED1A 2W9BA 4ED5A 2CNKB 2V50A 3BYPA 1QUPA 3DOLB 4DL4A 1URRA 3NGSA 5EUHA 1IN6A 2WCXA 2KHCA 3CDIA 5LXYA 1QLNA 4NL5A 2D9PA 5DM6Q 1N6QA 3BG6A 3O5TB 1HNVA 2EV5A 3QGIA 3K4JA 1WKLA 4V19K 2XWXA 4FXVA 1VQ5I 3FXLA 2ZH2A 2Y1LB 2NNNA 3GFIA 4C3IJ 1C1CB 4FZVA 3DLHA 4LRCA 4NEYA 4I7HA 2NZ4A 4Z2YA 4U8VA 1JX4A 2M7SA 5CPRB 1M0SA 2HHVA 4NLSA 1TQLA 2P8IA 2FDNA 1ZQ3P 4KT6A 2DW4A 3G6XA 3IO1A 1Q0NA 3M8QB 5FDLB 2KKOA 5LSRA 1HKAA 3TP0A 2W7OA 2M8HA 1MH4A 3C18A 5F0WA 2UVVA 2FB0A 2I5JB 5EEGA 3OYNA 2LBFB 3KP5A 3MWMA 1REGX 4M95A 2DNGA 3DOKA 5EJCA 2B4VA 4ENKA 3SMZA 1O6XA 3SBMA 3K8WA 4N56A 1AUSL 3PYDA 5GAGJ 4BE1A 1QVTA 4BDPA 4WWSA 1BR4A 3MPDA 2XLKA 2CW0F 3BR2A 4J37A 1BC7C 3VGVA 3VF0B 2B9EA 2DN0A 2K4JA 2C6YA 4IRHA 4DCPB 4PUOA 5LXRA 4CQ1A 3HUGB 2QA4S 3PEJA 4A48A 2OPSA 2XKPA 2GOMA 4QOTA 5IOYA 1VBXA 2FQ3A 3H92A 2GCFA 5LJ5Y 2HKEA 1O3SA 2CG4A 4NRUA 3CLQA 2DT7B 2KIMA 3SFUA 3CCMS 5B09A 5C25A 1MJ9A 1QU3A 3AA8A 5MAOA 2VT2A 4FBTA 1N77A 2DT9A 4PRFA 3K17A 6FDRA 3MKYB 3CULA 1I1GA 1T33A 4ZN3A 4YEJA 2L9SA 2BKOA 3MM5B 2LECA 2E1MC 1IQZA 4LB6B 3CJ2A 2FVPA 1SJ3P 1QY7A 1Q82T 1EA3A 3DLLF 1FD2A 4U95A 4JX4A 4ENMA 1VYAA 2VFVA 4L76A 2G0IA 4HAMA 2P5VA 1IR2A 4I09A 3A8IA 2XGDA 4C0BA 3D0IE 4C0HA 3LP1A 3HGYA 2CAJA 1FRLA 5JVGF 4BHQA 4DWIA 4NMLA 2ZZTA 1NKEA 2QA4G 1IBLF 3HULA 4BU2A 3E0JB 3RI4A 3UDVA 2FVQA 2OSQA 4WIIA 3QT6A 4XKVA 3C6UB 3PXGa 4J01A 5KG4A 1AU7A 1XNQF 3OFEA 4KMFA 5GADU 3WC2A 1SQGA 3VYTB 2ZH7A 2LQ8A 5B1AH 5F0HA 2QE5A 3EUNA 1RR8C 3EZ5A 2QYCA 3JRIA 2DA6A 3TEHB 3HGGA 5AE1A 3VFZA 3FZBA 4IOCQ 1UB9A 2BRKA 5F8HA 2YWEA 1XG1A 3PW7A 2CO5A 1JJ2R 5E3MA 1J27A 2NREA 3ECHA 1YITI 2YKMB 3FF5A 3BR0A 2GA7A 3Q8YA 2JH3A 4LFCJ 2LKPA 5B0AA 5KFZA 5J1YA 4WU3A 4V2GA 5ITHA 1PUFA 4LR9A 4LF8F 1G6NA 2MKSA 4HQEA 1HI8A 3G8SA 1IDYA 2N8GA 2E66A 4WFZA 3MFHA 1VQKS 1KFDA 4DPXA 3N79A 3L09A 2JLGA 1JWWA 1QAIA 1TFWA 2K3PA 5IV4A 3SJMA 3CUQB 4K5RA 4UUTA 4USJC 4OIQF 4L72B 2YUSA 1RBAA 5KHDA 2CS3A 5A8WB 4IO9Q 3MM6B 1JLBB 2KXNB 1BI3A 1RT7A 2W9BB 4FF4A 5FLVA 5DS9A 4YMEA 2OPRB 5DD8A 5D0GA 3HOWJ 1AA1B 4GO5X 2EKNA 2NS1B 2DPUA 1FWLA 1Q4RA 4O3OA 4O3QA 2Y0BB 4F67A 1U09A 2ZZNA 4M3BA 4C0OC 5FLXY 3RAQA 1T9TA 1XS9A 3MMCB 3DDKA 4K50A 3IH2A 1KEKA 3DF8A 3P4UB 2QV6A 2OU2A 3T0YA 1RBLA 2EG1A 2UUWA 3VWBA 4MIWA 2C3UA 1UTAA 3CJKA 3V8LA 3OYJA 1WHYA 3G9CA 1T0TV 4F4KA 2H27A 1TL5A 1QAJA 1G3TA 3QT5A 1BI2A 1Z4UA 3E6BA 4ELTA 5AJ3J 3DFEA 3W5XA 2IFXA 5BXIA 1LEOA 2R8JA 4ZDPA 1OYYA 2WSEC 3KDOA 3R5AA 2VPYB 1Q8KA 3JS9A 4XN0A 5HK4A 2UV1A 1TQIA 3H36A 4B3RJ 1J0RA 1RHUB 3PKYA 1NMEB 2DLLA 2E7VA 3UD4P 3DOMB 4ANEA 2GA1A 3NY0A 4PXEA 2DNOA 1EZZB 3Q22A 1RSCA 1LK7A 5F8IA 2DNYA 2GVZA 1XCVA 1PBUA 4FTHA 1FWPA 3BM7A 2M0GB 3J80K 1DRZA 5F1RA 3IN5A 2HHXA 3A12A 1NXIA 4O0NA 3QLHA 1PJ5A 2R2SA 5HS7A 1V9OA 4IFYA 4URSA 1S9HA 2DPDA 3AJDA 1E3OC 4DPYA 2AEMA 1YRTA 2OFGX 1OQYA 2DR8A 1H2VZ 2R4GA 1S79A 3ZMUA 1CQTA 2M5WA 3CCJS 2VKDA 4J9OA 1U1RA 4JI5F 1ZETA 4YB6A 5B0FA 1ETYA 3I56S 1RBOB 1GXQA 4ED4A 3K70D 1X4BA 4UZCA 1J75A 4N5SA 3DEUA 4J9UE 1QDUB 2R7FA 3EZOA 3ZMZA 1WI3A 3F8MA 2RNGA 1X4CA 3JQMA 2IYGA 5B7WA 1Z91A 4X84A 2Y0SD 1VLOA 1IXSB 2J7WA 2JWNA 1HC8A 1U47A 3MN2A 2LRDA 2QFJA 5BMZA 3DOMA 2FVRA 4G9YA 1R00A 5J2PB 2EW9A 1HHTP 1WHUA 2OCEA 1IW7F 2FOWA 1MNEA 5L3BA 1ZLKA 3KLGB 2UVUA 2JA8J 2ALZA 4Y17A 1KHWA 2DDAA 3WGHA 1LOUA 2HHWA 3CD6I 2JPCA 4XICA 3DOKB 2L9NA 1QSSA 3OTOJ 1FFWB 4OJHA 3NMRA 2F3JA 4YB5A 4NI2A 2WRMA 3CDHA 3H90A 4KSEB 3FSYA 3AJ2A 2LQBA 4LITA 5KOWA 2XAUA 3BGUA 3ENAA 2Q66A 3PYEA 2X1EA 3HHHA 4J9MA 2CKWA 4TLRA 2R2RA 5K1YA 3OJSA 3VDXA 3HXMA 3P8BB 5JUMA 2BY0A 5T14A 1QAXA 4EZ9A 3POTB 2EA4A 3MMCA 4GGGA 4X65J 4YOEA 3ITHA 1W25A 4NNJA 1V5EA 3KK1A 2K5CA 3R5CA 3PY8A 1PAUB 4MK7A 2B9XA 3IAS2 1VLYA 5B66C 5SZTA 2D3UA 3DXJF 4OHYA 1B7FA 1QVGR 1U6FA 4ES3A 3BB5A 1HHQA 2IS1A 4EI2A 4B3SJ 2NUHA 2GIZA 3NWTA 5HLGA 1HW8A 2ZITA 2MB0B 2RDJA 4CRJA 1K6YA 2HVDA 3J7YJ 4DHVA 3ZQIA 3RJMB 1HBUA 4OI2A 4MFBA 2DGOA 2QLJB 5GTIC 1FEHA 4LQ9A 1WC3A 2KHDA 3AQPA 2BANB 4XSXF 1RTIB 3CUQA 3JQKA 1M5KC 5HL7Q 1VMBA 3GFLA 4ECUA 3J7AN 2Y3YA 5J40A 1RTHB 5J1UA 2IM1A 4GMKA 5KT6A 4ECRA 2HQ5A 5BR8F 4IOCF 2IYIA 4KTQA 1E6VA 1X8DA 3RKQA 1HPZB 4DV6F 2F6CA 4X64J 1GMUA 1S57A 5KFDA 2KJVA 3LGNA 2HYIB 2C42A 4A8MP 3UCUP 3BCBA 1WC5A 2KYXA 4ZVTB 4RGSA 1SBRA 2M87A 2K02A 2FLLA 1RU2A 2XHCA 3PYGA 2YX7A 2J6TA 3M9MB 1E3PA 3TO7A 2ZUGA 1IRFA 2CNOB 2BVZA 2M9KA 3VWSA 3QYFA 2VONA 2JC1A 1VNDA 3M8SA 3I4MJ 1VQ8I 1WH5A 3X3UA 1VQNS 3H9QA 3SYTA 3OFGA 4XDCA 1MIJA 1FP2A 3OR2B 4DSKA 2O9LA 1DLOB 1H7XA 3VAKA 2OV7A 4BHBA 8RUCA 3W2WB 1UFMA 4C2MA 4BHPA 3OIQA 3PQJA 3OXGA 2O6GE 1S0VA 2K2PA 3W6JB 1U7LA 4RZRA 1BIBA 2ILZA 3UVJA 4DQQA 3ETOA 1WJEA 3C6UA 1YJTA 1RKTA 2A3SA 2XCAA 3G4SS 4OI6A 4C3KA 3GTGJ 2DH9A 1Z77A 1S1XA 1NUEA 4RJVA 2B4UA 3KFWX 2UXBF 2E44A 3U9GA 4WK8F 5F9LA 3JXOA 2PMZN 2A6HF 4LSLB 4CNYA 1M5PC 5IT4A 1KU9A 4NYPA 2C1EB 2IRXA 3NRBA 2CQ0A 1CF7B 1W4MA 2MSTA 3NNHA 4OMYA 3HL2A 4X62J 2KM8C 2XIGA 3M8YA 4II2A 5K8PA 5AXMA 2FHMA 3R0JA 5L1LA 1IV6A 1WEYA 2G9WA 3VPRA 1EAYC 3OOPA 3VODA 2W4CA 2JA6J 4MTPA 5A76A 3P5JA 3H42A 4K2JA 1SQEA 3M07A 3QP5A 1L3LA 3KXDA 3F9KA 4GC7A 4FYDA 4I4BA 3F72A 4KFBA 1NK3P 4ZJLA 3D3BJ 1F9HA 2UZAA 2G9OA 1JLQA 2XROA 2ZEJA 4M5LA 3I9ZA 5LGTA 2XSJB 3KYLA 4AT1B 3V6JA 3HHLD 1RIOH 2ZOMA 4I68A 3VAMA 1W36D 1DGWY 1MBKA 7FDRA 3RAMA 1I51B 2CQXA 1BA5A 3PNTA 2CJKA 2QG9B 9ATCB 3FMRA 1Q79A 4EBCA 2VKHA 2IS4A 2MDAA 4YY3F 1CF7A 4LF9J 2R7DA 4C48A 2DIUA 3HFKA 2I5JA 4NCAA 3VYUB 1ZG3A 4U67Q 2MZ1A 3E6DA 3UCGA 3I0TA 2BE7D 1WZ2A 2YBVA 2KT2A 1KQ8A 2E71A 3BLYA 2J0QD 2X7IA 1RT2A 3FK7A 3D6FB 4I0BA 2DEJA 3FCHA 4I2PA 1MWYA 5KG3A 4DR1J 3DDIA 4ZVGA 2LKXA 1ZM4A 5DYMA 4GCVA 2CUJA 2DR6A 4D0PA 3V8KA 3MGJA 5F0UA 4G1QB 1T9WA 5AIPA 3BGFA 4KGMA 2OEJA 1Q1VA 1T05B 3SSQA 3PJRA 5L9NA 3ET6B 4OHWA 3W9IA 4I01A 2OP5A 5GAEJ 4RS8A 2W2PP 1N8RT 5DQIA 3BDDA 4DQRA 3OR2A 4FX4A 4L73A 2IJRA 5FO5A 1XMQF 3GTPJ 3DOLA 4HG2A 1KGSA 3K4MA 1KTVA 3AHPA 3IH4A 4AFFA 3HG9A 1LFUP 4NZ6A 3V6DB 4RU9A 3CCSS 4GVBB 3FZ2A 1TZLA 5I4MA 2YKNA 4UVBA 3EPZA 1RWNB 3PM9A 4PSXA 3W62A 2WSCC 1O8BA 4RB1A 4MIAA 3DRPA 4ZVPB 4H4OA 3GTYX 1YW8A 2IS2A 4I1TA 2ZH5A 3BTIA 4WZQA 2ISYA 3O2PE 3DCFA 4P96A 3ZQLA 1DP3A 3DTKA 3H5NA 4RBOA 3DRSA 2V2KA 2R7UA 2EZHA 4DQSA 1E6YB 1AZSA 1Z67A 2PA3A 4OX7A 2JSPA 2DCLA 1LEAA 2Y0SA 4LG0A 1T08B 3H5UA 3RCOA 1VQLI 4ZJQA 5KFXA 1WEXA 1S7AA 1Z7LA 2M7AA 4EEFG 4KB7A 2W2NP 3PDNA 3JW4A 2XAQA 3G1LA 4M3DA 1JK9B 5GAGI 4C2TA 4ECYA 2ECCA 2M2BA 3TNVA 3C46A 1KN6A 3KHLA 1T2KA 2A69F 4ZZDA 5D8KB 4KV8B 5F3ZA 3REOA 4AYBD 2K27A 1NHKL 1CC7A 3TANA 1UEVA 2CA9A 4M63A 4CCJA 4OINF 2IJNA 3AT1B 2C2NA 3O6QA 3MFIA 3KDNA 5A8RB 3OUYB 4XPEA 4AIJA 4PFPA 1F5AA 1CJUA 4RKUC 1YJRA 5C42B 1JLGA 1ONVA 2PO4A 4FQGA 1MH3A 1TELA 2QLBB 1FKOA 3BYRA 4XLNF 5IPAA 2CNNB 2W84A 2HTSA 4P7VA 1TKXA 2R2TA 3C3LA 3THTA 2J9DE 1Q78A 5D0RA 2HVEA 4DL0C 4KYWA 1S8NA 2C2RA 1K47A 2MZQA 1VBZA 2D1CA 3SFZA 4E7HA 1S1XB 2AJ2A 3JAMK 4E4HA 3PW4A 1K0TA 1AT1B 4HT5A 1LK5A 1ZTTA 3IV5A 4Y3CA 3TEGA 3HSFA 4DX5A 4L75A 2J7UA 1RNLA 3G87A 4DZPA 1H72C 2MD5A 3T9ZA 4LF2A 2MGZB 1T6SA 1MMGA 2DMNA 5B0GA 3IFEA 3TA0A 3MTJA 3B02A 2P7CB 1KZHA 3RW7A 5E3AA 3X1LB 5LSLA 3DMJB 3LAJA 1OMIA 2J76E 3B54A 2B5JB 2L9RA 1BN5A 1DY3A 3PX6A 4S05A 3HTUA 3FQKA 1QE1B 1EQ0A 3S8SA 3IWZA 1RA7A 5AT1B 2XTJP 3RJPA 1F9FA 2GJIA 3QLHB 4DPUA 3WQPA 2HZVA 5EHHA 2XLIA 2H5IB 2CWEA 2HNYB 1SVLA 2DGXA 3Q8VA 3PFEA 1SC7A 2LDYA 5J4YA 1NDKA 4ITVA 2OPQB 5KFFA 1Y5IB 1PGZA 3FDSA 4CDGA 5CABA 2LC2A 3J80Z 2YKOA 3CJ0A 1TL7A 5K8NA 5DS7A 1TR0A 3W60A 2Q43A 4HPQA 2XSJC 1VRTA 2MABA 2YVSA 1FRHA 3R3TA 3CMES 5RUBA 2YKQA 2ZOGA 2EQRA 1XR6A 5KVRA 2XGQA 1S9EA 2R93J 1WI9A 2PMZA 2QX0A 1YFHA 3OSFA 2VC0A 5J2NB 3DBLB 1FYKA 1FZPB 4P9SA 3NCRA 4C11A 4RUAA 5DZ7A 2FBHA 2BYVE 4LRAA 2BV3A 4O44A 1RWPB 2LK2A 1S1TB 4DR2F 1W5SA 3BBCA 4ZPTR 4YHHJ 5A2QZ 4DPWA 4KC5A 2FMYA 1Q7YT 2F4FA 2X9DA 2J9EA 4OYPA 2HHQA 3VOEA 2DXEA 3CUNA 3KZYA 4KY3A 3Q5FA 1QE1A 2VICA 5HMWA 1RISA 2DITA 2QYOA 3E5QA 3FX3A 1FMWA 1NHAA 1GH8A 2NXNA 4ZCMA 3OIOA 4K4ZA 2KG0A 3ZTOA 2EBGA 4OIXA 1JLFA 2K1RB 1LXJA 3IHUA 1FRJA 5KCMA 4CI0B 3OL9A 4R8UA 1T05A 3MFKA 3HC7A 1ZRDA 2V68A 2NCKL 1S99A 4A8SA 1GK8A 3SIPB 3QNWB 4URQU 5CD4H 1JGGA 2AW0A 3CVKA 4P2FA 1RTDA 2NPFA 5D0EA 3W64A 2E36A 2YKMA 4ECVA 4QTRA 2E1RA 3BV8A 5E2QA 3LOCA 4OI3A 4UB8C 1NJXA 2DQLA 4QIFA 3V81A 1J59A 3BC8A 2QJ3A 4HX4A 3HJVA 2MXYA 4LVOP 1JLEA 1RT4B 2YPYA 2VL8A 2AJ0A 3UKGA 4KRWA 4RUBA 3GIJA 2R7QA 3H5SA 4L74A 1FDBA 4AIHA 1S7HA 3Q8QB 3L2WA 1XMOJ 3OOUA 3CUOA 3GF2A 2G7UA 4P5OA 3WC0A 3ISNC 2MQ8A 3FSXA 1IQTA 1U48A 3P5BP 1DFDA 5C4XJ 1RB0A 1T3OA 3FWEA 3BR6A 1CQMA 1HBNA 3GILA 3B4MA 4N9IA 1NK7A 5IT9U 1IR1A 4FVMA 1DU0A 4WP3A 5KAFC 1BMQB 1ZK8A 1NK9A 3L4BC 2B3TB 3MCOA 5G4DA 4LSZB 1QAYA 3AKZA 3K8VA 2HQDA 1CJTA 2Z0GA 2V9PA 4X4UA 1VRQC 3CLOA 3GV5B 4IQ4A 1GT0C 4Q8FA 1YRNA 3GTMJ 2JFDA 4DUYJ 2V8GA 2DR5A 3LAMA 1BR1A 3CJKB 2ERRA 3BGLA 3M8QA 2MKKA 4LFCF 3DLGA 2Z3YA 4MQVA 2HHUA 4X4RA 3FRZA 2ID6A 1R27B 4DCOB 4QIWN 3HJFA 1TKTA 1MD0A 3T1BA 2CWXA 1FOYA 1TUWA 2I0XA 4USVA 1TVRA 5I3QA 3L7WA 1OMSA 3WG9A 3IWXA 2VXZA 3FZVA 1IAWA 2C22A 5F8MA 4QCLA 3A3NB 3P45B 2LEBA 4KV8A 3ILIA 2GC8A 4RW8A 1SFUA 3JRCA 3TZZA 4MYTA 4G1IA 2Z2YB 2RKHA 5KFIA 4LK0F 1SH2A 5BYRA 4XRMA 1NEEA 2VKZG 2HVSA 3IP4B 1CPZA 3CJTA 1DP7P 1U5TB 1LFPA 2W00A 1NK4A 4RMNA 2FU4A 2WY7Q 5ICCA 2MA3A 3IWNC 3W3SA 4A3LJ 3AD9C 1GT8A 3OVAA 2VDIA 4JYAJ 4ZA1A 3PNYA 4ANJA 2F4OB 2AEFA 4FF1A 1FRXA 2J0XA 3EVWA 1J09A 2O8KA 4RW4B 2UXDJ 5FDLA 4TU7A 2KL4A 2A5WA 3ZZYA 1NHUA 3RW6A 4UV9A 2XMKA 2F8EX 2COLA 1N4LA 2E1CA 5JVGQ 1B4AA 1ELOA 1I6JA 4BKXA 1W7PA 5E18F 1BWEA 1F9NA 3FK6A 1WJAA 3FJ2A 1J5YA 4DZDA 1EJ7L 1N48A 1P4WA 2F5FA 3ISPA 3Q0WA 4N4NB 2B4OA 3QIPA 5FFZA 2V6EA 3HDDA 1B0VA 3E6MA 1XDUA 1YJ7A 2ZBQA 3VSLA 1YLFA 4XIUA 1AFIA 2CQPA 5DCMA 5DLGA 4L9NA 4I76A 4LLNA 2K3IA 1QA6A 3F41A 2IHR1 3OYCA 6FD1A 2R8GA 2NVQJ 1HBUB 2QT7A 4E8UA 1Y0UA 3F56A 4I98B 2E1OA 2C2EA 3ISZA 4LIVA 1MWQA 5LMUJ 4OHXA 1YQAA 5JLXA 3I71A 3HM9A 1XWLA 4OX9J 3UWTA 3LA3A 1QVUA 4I2PB 2DOAA 4DZ6A 2N7CA 1NZAA 3VSKA 4WFYA 3MUMP 3DTIA 1UKUA 5DGBA 2IW5A 1RUOA 2PC6A 3HMJG 1FC3A 2QRRA 1UCRA 1P6RA 4ECQA 3V2UC 4OYMA 4BJ5C 4I02A 2L4MA 3KNAA 3KYCB 2ZHOA 5CHCB 1ZPWX 4A47A 4ZYEA 2XSFA 1JLAA 1H98A 4H0EA 4LF5J 4RW6A 1V6HA 4J9PA 3ZZUA 2VT3A 2GMJA 2PDAA 2L9WA 4F55A 5DDGA 2LKZA 4O5VA 3LSPA 2BMBA 1RWXB 2LXIA 1X3WB 3C14B 4HLXA 1DTTA 3RRGA 1FOKA 4EBDA 2HOAA 2G2ZA 3HKZD 1UMQA 2FBIA 4DQPA 2BA9A 4DV2F 3RGIA 1ETKA 3N5FA 5DTDA 2VPWB 3J7AO 1HBOA 4H4MA 3R0AA 3BBFA 3QMQA 3J7ZI 2K9LA 3K4NA 2J5AA 3M2UA 3BG3A 2HDDA 1O7LA 2EVZA 1UHSA 5DZ6A 1RHRB 2A61A 5LGUA 4CO8A 4FCYA 4N8NA 1WCMJ 5DEQA 4A4JA 1FSEA 2F48A 1Q81T 1SMTA 2XNQA 1YRXA 3C8YA 5D78A 3US5A 1X3ZB 1IUJA 3VGTA 3S3OA 2DFIA 4PFOA 1NZ8A 2R5YB 2RVJA 4XNFA 3CC2S 3QU3A 1AKHB 1Y56A 4KDPA 1DPUA 4OZ3A 1VS3A 2D3O1 1IBCB 1KLMB 4PWWA 2XUBA 1JJ6C 1UMJA 1U5TC 2R3SA 3MZYA 2ACMA 4LSLA 3RG6A 4ZLPA 2H09A 3P9CA 3N9UC 1FXLA 1O3QA 4QPXA 4RAYA 2XPUA 2CNLB 2AO9A 3GLXA 1K9MT 3SCKE 4R5PA 1MGTA 4WBFA 4TV7A 4QIEA 3GJQB 4ITSA 4ETSA 4RA2A 4MTDA 3QU6A 2EC0A 1LW2A 3LSTA 1K44A 4P2MA 1RABB 3T1HJ 3CCRI 5TJJA 4IKFA 3VGUA 2BJ8A 3CTAA 3L2VA 1KU3A 3EUAA 2YNGB 2V4RA 4TXSA 5E1WA 2DFEA 1N5YB 2AYGA 2BW3B 3SCLE 1BE4A 4NC7A 3SQGA 2BANA 5L46A 1UG0A 3HHLA 3T6BA 5AIQA 5DCMB 3KP4A 2AT1B 1HKSA 2CV2A 2VKVA 3CCES 1WOOA 5A2QK 2XDVA 4OZ5A 3TAPA 3LP2A 1XQIA 3D1NI 2YY3A 4AU7A 3K58A 4FE7A 3JAMZ 3BKUA 1IF1A 3R1LA 1Y6IA 1IC8A 2KG1A 4JI4J 4JI2F 4CDIA 4DXLA 2FZGB 3GYHX 4HDHA 4QYRA 3B73A 2I2YA 4HSTA 1VC0A 1HF0A 3IMQJ 4F52A 2V4JA 4NCGA 2AJ4A 4DV3J 1FEXA 1RT3B 1PKUA 4WYLA 2RV8A 2OELA 1X9MA 4X65F 4DEZA 1SCJB 3CO0P 1L3KA 2NQPA 4NLYA 2K9NA 1DZ5A 3ZNUA 3OSGA 1XSVA 3MD1A 4XRSA 3CMYA 3KLFA 2VG7A 4LF6J 1R36A 3C2BA 5DG7A 3NEUA 4PG5A 3D0GE 2A6OA 1S7OA 4RWWA 1KA8A 2UUAJ 3LGHA 1ERDA 4M5IA 4LJZF 2GJ2A 2H6BA 1F60B 4PYAA 5ILVA 1XIQA 4ERDA 5T41A 1XGOA 3R60A 4WE1B 1YX2A 1HNIA 1K83J 3DRYA 4Y28C 4S0HB 1RI7A 1GMWA 1U3EM 1SUQB 4Y2AA 2RF2A 4DR6F 2JFKA 4C9DA 1R1UA 2JA7J 4DX6A 4PG7A 1BW5A 4DG1A 4ZDLA 3HK2A 4KHPJ 5IP7J 2E7WA 1S6QB 2FLPA 4A3FJ 2QSWA 2QLXA 4LIRA 1RTZA 3SYZA 4R1HA 4Q8EA 1U8WA 4HYKA 4KUMA 2CSOA 4PJNA 1FLIA 2ZH9A 2P6SA 4IO1A 2KRCA 1Y0NA 1WOPA 5ETLA 1FVSA 5HANA 2KRRA 1D1BA 1BY9A 4QWCA 4ZPBA 4E7ZA 4AQYF 2MGZA 1ZAVA 5E3PA 3W5ZA 2W01A 4LF4F 4ENOA 1JNRB 2BE2A 3NQOA 3M30A 4EQQA 4Q2MA 2XYHB 1I6HJ 1LVAA 1SD7A 5A6WA 2BY3A 2PI0A 2JDJA 2PFDA 1O3RA 1B99A 1D09B 4IG0B 1YVFA 2DODA 5CYJA 1I3QJ 3GTOJ 2ELJA 3FC9A 1YJ9I 1ZZFA 2Y9YA 3OYHA 2RDPA 1U1QA 4LSNA 3CP8A 3U21A 4K0KJ 4YR3A 3FHZA 2ME6A 4JUZA 4HNVA 1IN7A 1H8AC 3PV8A 5C42A 5FKOA 3WIVA 3BZ6A 4F8RA 3BR5A 3FXMA 3LO3A 3DBHB 4QSHA 4B3AA 2LSOA 3FXOA 1R22A 4IF4A 3QPHA 2CQQA 3IGNA 1WTBA 4ECXA 2GVZB 1EV7A 4WTOB 1VQMI 5E20A 1FYLA 2Z4PA 5HO4A 5L1JA 1H6KX 3LNQA 1YITS 1B7YB 4B9SA 2W85A 1HXDA 1KONA 3SFIA 4IR1A 2XAFA 2EFVA 4EZ6A 5GAHU 2HXOA 3ZTPA 2VG6A 3I9V9 2B43A 5E3LA 1VQPI 3NMAA 3RYPA 2W1BA 1HBXG 2G0JA 2NXNB 2RHQB 3QFWA 1BI1A 1IG7A 3IBWA 3QPTA 2LF8A 5K5RA 3VAJA 7AT1B 2HLTA 2MEWA 4DF4A 2QSGX 2DMUA 4IPAA 2RKIB 2R9LA 3IXQA 4R79A 2L7KA 2DXIA 4ZDOA 2HGCA 1JXSA 2W9AA 2DA5A 4U7DA 4HI1A 2HURA 4C97A 1S1TA 1CVJA 4PZVA 5FKNA 1X1PA 3ENWA 3LFUA 4PDKA 4RLEA 5HDNA 1VR6A 3DLEA 2OTLS 2XWYA 1M90T 1C1CA 2ZJPF 3R9LA 2OEKA 2XNRA 2NRAC 2YWGA 1JJCB 5HLFA 1JUMA 4K7QA 2JOQA 4LF8J 3MPWA 2YPRA 1UJ6A 2HGNA 2ZJQF 2R7VA 1QPMA 1UCNA 3M2RA 3H25A 2AZ3A 1OR7A 3O44A 4YFKF 3FXQA 1K0VA 2RDIA 3LPEA 3C2HA 4HQMA 3AA9A 3FQLA 5IWAF 4BBSJ 1T9VA 1S7EA 3S3MA 4LD5A 1OSCA 5D4RA 4ZVFA 3UQSA 4I7FA 2CVEA 4Y2KA 3ONQA 4BY7J 3RRHA 2HS3A 1HFEL 3DLJA 4GKJJ 2HFVA 3HBLA 2DNPA 2A68F 3JQJA 3W1YC 2E60A 3NNAA 2G2OA 1TT5B 3OD2A 5D77A 2B63J 3K7AJ 3BPSP 2FJDB 1NSKL 5F08A 4O3MA 3JB9k 4QJVA 1YHQS 1P6TA 2ELHA 3AAWB 3JRFA 2VB6A 3PL8A 3L2CA 3BEGB 1SD5A 1RUNA 3TQEA 2R5ZB 2MQNA 3MM5A 5DDRC 2QA1A 3TBIA 4HTIA 4A8XA 1B0PA 3BKTA 5IT3A 2ASDA 1W2IA 2WB1A 1TBXA 1YLXA 1U1NA 2ZH6A 3M8PA 3ML6A 2PEHA 4Y15A 1FI4A 2KP6A 5IQQA 4FASD 1XC5A 2V69A 4WFXA 2HYJA 1RESA 4PSWA 4A5MA 2N3LA 4DUTA 4HSRA 4PG4A 1N25A 1DARA 3KJQB 5LT5A 2QLFB 2QSFA 3VZIA 2QEXI 2HOSA 3HHKA 3H59A 4MLOA 2ZSIB 2BE2B 2MY7A 2E5LF 3NAUA 2M7BA 1B59A 2D3ZA 2P4WA 2NNYA 2A2DA 1AOYA 1BJZA 2G1DA 3HX9A 2OD5A 1LWFB 3K59A 3JTPA 1QZZA 3L9FA 4KH0B 2JA5J 3MCZA 3MR7A 4X64F 3TZWA 2IY5B 1H2TZ 2HPMA 1SC1B 1R7IA 5E33A 4HVZA 5TRDA 1TC3C 1RT4A 2OO4A 3BGOP 2DNLA 1YO5C 3D4JA 4IQXA 2NUUG 1FJGF 1OCPA 4B44A 2H3EB 4LIWA 2KFDA 3HZGA 3EPIA 2IGNA 4AE5A 2R8IA 2L9DA 3SZTA 1NAQA 2ZO4A 1WD6A 3N28A 4RBVA 4CLFA 3OJUA 3M9OB 3JCUC 1FT9A 3CCUS 2CFXA 1HD1A 1T56A 3S93A 4RLFA 2XM3A 2GIVA 3KX2A 5A8RA 1ACIA 2VV5A 5I3PA 1GXPA 2XAJA 3HD2A 4N47A 2X6OA 4RAGA 1N75A 3N0VA 2RB7A 2ZFWA 3UVJB 2ZHBA 3B6AA 4C8OA 4I0WA 4R8HA 3CO9A 2CU7A 3ZMDA 4L9JA 1Q1KA 3T19A 4ANDA 3GYGA 3ISND 3GLLA 2QQBA 4B9VA 3V5RA 1WJ9A 1SFXA 2E35A 1SL1A 4ATNA 1PC4A 2BW2A 3NL0A 1D1AA 4V19J 2H5JB 4G7ZF 5KK1A 3FCVA 2V8VA 2LFVA 3BH7B 5E3RA 2W7PA 2RT3A 1YBTA 4ZS6A 1U1OA 5E3QA 2BVLA 2HBZB 3O8GA 3IH3A 2MKCA 1ZAWA 1DPRA 2IAJB 4LVNP 2ZC4A 3IR6B 2M9HA 1MN7A 1BOAA 3M3YJ 2XMJA 2KHMA 5FD6A 2WAFA 4XONA 5D6EA 2K7LA 3MDFA 2RVCA 3F22A 2UP1A 2H1YA 2CUZA 1ZH5A 1N5VA 4JI5J 2HSEB 1XGSA 2NYIA 2QEXS 1Y8RB 4YHHF 2DNZA 1C0TB 1SAXA 5BYQA 1KQSR 1JTYA 4IHWA 2TCTA 2CW8A 3H2UB 1UG2A 1VQNI 5CYMB 2FHJD 1KYWA 5HLTA 3BDEA 1N0UA 3V6DA 4CUGA 1YWXA 3CC4S 3BZKA 5H9FJ 1V5FA 1IBMF 3PSIA 1FESA 1HNXJ 3RR8A 2ZNYA 4P2SA 4CH1A 1L3UA 2YNFA 2EH3A 4OYXA 4DPOA 1ZARA 3T8TA 2QKMB 3GV7B 3GTJJ 2EFGA 4BQQA 2HGLA 4NHJA 3P49B 3SZGA 5DDQC 3T9NA 4TKTA 5GPAA 2J7KA 4HV6A 3ZQHA 4MFBB 4DR3F 3I96A 3EDRB 1XMBA 3MKLA 3BZQA 5C24B 3QPLA 2GZWA 2KIQA 5F6FA 4NMXA 1RT6A 3AODA 4IRCA 1LDJA 3C1DA 1HQEB 2VZ9A 4HH1A 4OI4A 4UUVA 2CQ7A 3VHQA 3O3KA 4EEYA 1Y11A 4M8LA 3G6VA 1YRUA 4CH7A 3KMQA 1ZM3A 2AQ4A 4GO7X 2JMWA 4UUWA 5AXNA 3NAHA 2XG8A 4U7UD 1VJWA 1N5QA 1F5CA 5GADJ 2KQRA 1U0HA 1OPIA 3R6SA 2B5JA 1HBMB 2CQHA 5ETVA 3ZTQA 2E1NA 2IA2A 5K5QA 2MC4A 1NK8A 5BPDA 1OSDA 3W9HA 3TR5A 3CJNA 4ZHRA 1MBGA 1MKMA 1JB0C 1R89A 4RO0A 3GJTB 3JTHA 1ZAXA 4JOMA 2VE8A 4RB2C 4G7OF 3ZP5A 4CWBA 3BSOA 5A8KA 1X1CA 4OYBA 4G6DA 1T9UA 4CTAA 4CIOA 4U0VA 4Y7NJ 1IWAA 2A0FB 4NA3A 3KP6A 1RK8A 3AJ1A 4GO1A 3THPA 4QR1A 1DJ0A 4LRDA 1TL4A 2AJFE 2O3FA 4J9NA 2XZTB 1YJNS 4M9ZA 3L00A 2C2ZB 4IL6C 2EXUA 5BR8J 4QU7A 2RC4A 1QPIA 3ZN1A 3D3CJ 3A02A 1V3RA 1PAEX 5J6XA 4MMOA 1TUGB 2Y69H 2N3OA 4M74A 1NG6A 2PEXA 1VCTA 2XMUA 4OLOA 4IOAQ 1XSXA 4YS2A 4NUBA 4PJMA 4HF0A 2BJEA 2LYVA 3PTWA 4IJAA 4A3MJ 3F21A 1UL3A 2FD2A 2R7SA 3R97A 3QQCD 2FRHA 1ZR4A 2DK2A 2P5KA 1VQOS 4DFJA 1WH7A 1YJWS 3DPUA 2KU7A 4X2BA 4F4WA 2LH9A 3MEEA 4ANCA 2CQGA 5M5WJ 4FKYA 3ZR8X 3WX4A 5DM7F 3FEYB 4C2MJ 1SH0A 2FLOA 2PMZD 4LLGF 3GZ5A 3AAFA 2NS7A 4Y52J 4E0DA 2HEOA 4ALZA 1D8ZA 4WXCA 2R92J 2FJVA 2EKYA 1RLCL 4K4YA 1YGYA 3BQ1A 1GXUA 4LT6A 3HCXA 4JV5J 3BBBA 2EA2A 2UUZA 2E5HA 3F8FA 3ZGKA 3A3PB 2HHTA 3I56I 2K9SA 3WX8A 2XS2A 2VUGA 3W6VA 3T1YF 3PRVA 1Y1VJ 4XQFA 2DGTA 1YIJI 4LFBF 1S9GA 1R8HA 1SJ1A 2XMMA 3EETA 2C2MB 2RD5C 3MMBB 1IXRC 5HATA 2RQKA 5F8LA 1ZRCA 1CJKA 1MU2A 4NCGB 1IM6A 2VQEJ 1OCZH 2J6UA 2D9OA 1VHIA 1DU6A 2ZM6F 1AW0A 2KXFA 4R0EA 3CJQB 2ZKZA 3KIOA 3K7RA 3Q8SB 2ASJA 2HMIB 2LY1A 1WSVA 2HVHA 5L38A 2QENA 2GQQA 3HSRA 4OYOA 2VQGA 1F5TA 3CD6S 4OX8A 3C6TB 1WJDA 1K78A 5C4JJ 4N4OB 4P71A 1HPZA 1MMDA 3MM9A 1XN9A 2CQ3A 5IC6B 1B8IA 1B9MA 5E1ZB 1HKTA 4ZYHA 4IQJA 1WTFA 4RUCA 4WFAQ 3UCZP 1GAOA 3E51A 4C6AA 2I10A 1MROA 4EJTA 5BNGA 2DDBA 3T5JA 1S9EB 2CPIA 2ZMEB 1ZTRA 1X1AA 2BXZA 1NK5A 3H9JA 2FY8A 2MGQA 2JHEA 3H20A 1Z3XA 3H3ZA 3LFKA 3F44A 3AXMA 1VQOI 2MC3A 2ZJQQ 2KYZA 3E3VA 4XRSG 4N8OA 5KFWA 2BY2A 1YBUA 2VG5B 1M5VC 2OPQA 1KBRA 1OY6A 1TWAJ 4DSLA 3R7BB 1SI9A 2F9JA 1PP7U 1U0SA 3OYFA 4K8RA 4ESJA 3K0LA 5EGYA 3Q9VA 3C15A 4OWRB 2IS6A 5LHIA 2OC6A 3NOGA 2LDUA 2W2MP 3GFYA 2E2IJ 1MMLA 1KOOA 1CLFA 2CPYA 3ZC4A 1WHWA 2GZOA 3ASOH 3I31A 2JEGA 4KNYA 3G71I 3QPSA 4MTEA 1XPXA 4KGVB 1YJUA 4ZK7M 3DFGA 1T9XA 3ABLH 3H3UA 4F4XA 3M2UB 3OS0A 3EJMA 3ECOA 4L5EA 3HXLA 4BH9A 2ZC3A 2ZSHB 3CC7I 3LP1B 3K4LA 4W98A 1TQMA 4JP8A 3Q8UA 2MQLA 3NBPA 2WWYA 1UP1A 2WW4A 4PKDB 2IDLA 3MAAA 4B02A 1JKOC 3IWFA 2DT5A 2BJ7A 4M3EA 4ZLLA 2DK5A 4DMZA 5KFHA 3CJSA 3C2PA 4FS1A 4E7LA 3TJAA 2P6TA 3J7YU 4NYOA 5CD4A 3OPKA 5CCMA 1WHXA 3D5RC 4Q2LA 4E7KA 4DI6A 4Z37A 4CZZA 4FX0A 1RAJA 2X6WA 4NZ0A 5C5JA 4XKBA 1YIOA 6PAXA 4FF2A 1HWIA 1XEZA 2OPSB 3MR6A 3V6HA 4RM3A 2DISA 1TP7A 2LXFA 2LY9A 4E7IA 4NLPA 2OIHA 2E5ZA 3O8WA 1H74A 4F3MA 3HO1A 1RT1B 1APLC 2BHZA 3TAQA 1X4PA 1DQ9A 4M94A 4UY85 3OVBA 3FBNB 2ROEA 2UXBJ 1OKRA 3GQCA 3MOZA 3M9AA 4G65A 1Y00A 3RRKA 1VRUB 3KHGA 4DPTA 2YX1A 2CJAA 5T7LA 2PGCA 2FPHX 4K5SA 2V9KA 1PYOB 2VBYA 2KJWA 1QM9A 3UN5A 2ZVSA 1K6OA 5J2MA 5EDWA 4XO0A 2GIFA 5EGOA 3SCJE 4ZCLA 2HKXA 1UW4A 1S0OA 2QZ8A 4LRBA 2B9YA 4XLHA 3EYIA 3K10A 4MT1A 4FVCA 2XAGA 1OQ3A 1S6UA 2VC1A 3SSSA 5M3MJ 1I27A 1K4SA 2GAGC 3OYEA 2BBEA 4YB1P 4L3KA 3DRPB 3R5BA 2LREA 4OJ3A 2NXUA 2H5EA 4A12A 1C4CA 4WIQA 4J9VA 2UXNA 3WBZA 2MQMA 1X1BA 2ZXJA 2LKSA 3MKZA 4DV3F 1LB2A 2MLYA 1MU2B 4PXDA 3K5PA 1YW9A 3SCIE 2YKNB 3MUVP 1GLNA 3M1EA 1FX7A 1LW0B 3FKBA 2GMHA 2UUBJ 3KJVB 2M45A 3JR9A 1QD1A 2HS4A 2XC9A 3RZAA 4WCGA 1J7KA 1ZG1A 4OZJA 3NP5A 4LBPA 4S04A 3LSMA 1QSLA 5IM0B 3OL3A 2XMVA 1MBHA 1C0UB 2P2CB 1Q8LA 5K5OA 2ZJRF 5LFAA 4G1QA 4DUZJ 1UJ8A 5CVRA 1LNQA 2ZXWH 3KHRA 1CS4A 1P2FA 3CMQA 3JTNA 1G7CB 4J5OA 2V94A 3S1MJ 2JEIA 5K14B 3O2IA 1T0FA 3OXFA 3BJAA 5KFAA 2RQMA 3ZQFA 4G6VB 3LSRA 1TVRB 3U1DA 4DS4A 4PJ0C 4B43A 3C16A 4DU8A 2R7XA 1WI6A 4XN3A 4FPIA 1LE8B 3ZMTA 1U8BA 2B6AA 2V4QA 4OAZA 2XB0X 2QQAA 3GEZA 3CDAA 3WTSC 1R5GA 1DUXC 1JKHB 3L3CA 2G1HA 4Z6YA 2GXAA 4K4UA 3JSMA 1SKWA 3BT9A 3OR2C 2WVEA 1SD6A 3HVTB 4WKRA 2AXTC 3W65A 3ZTSA 2EIKH 4JQFA 2FJEB 1Q5VA 3AG3H 4XTTA 4IOBA 3EYZA 1HLVA 1IBKF 2HZCA 1G4CA 3CJ8A 3LA7A 2IA6A 3KLOA 1F6TA 5KG6A 1AYEA 3D7SB 4CLLA 3GTKJ 2J5OA 3TOBA 1WVRA 3CO7C 3MXHP 4BBRJ 2ICWG 3ZN0A 4ECTA 1HDDC 2KFNA 4P7TA 5MLCV 3WTXC 4KJZA 1PVEA 1OPZA 2CQCA 1KNZA 3K5OA 4BCAA 1D1CA 3K2ZA 2MLZA 1IKWA 2I6WA 5L3FA 3KE2A 5CAAA 1DTTB 1SJRA 3DRXA 4NLTA 3PUFA 2DTJA 3FKIJ 4Q43A 2RE1A 2JRSA 2VA3A 2ATCB 4RAFA 4RGRA 2IBKA 1DHMA 5JVHQ 5LJ3Y 4AL7A 1RKWA 4I6AA 3LAPA 3MAJA 1P1LA 3I64A 2AYEA 2ZXIA 5BYSA 1YW7A 1KDNA 1WKJA 4Q5VA 2CFOA 3W2VB 2DU9A 4W90B 4RL1A 3PIPQ 1T98A 4EGLA 4RW6B 4FNIA 4QWEA 4P9UA 3VYSB 2LA4A 3G6ES 3EDQB 4KHPF 1IN0A 2NLWA 3KEQA 4U0WA 4ZMMA 1EH7A 1XN7A 2RUSA 4CCOA 3TI0A 3OYBA 1A35A 2HYFA 4CGZA 2FQQB 1S3JA 2DNHA 1O57A 2B7CB 2W25A 2BACA 2DAOA 4KN7X 5HDGA 4IHYA 4OQJA 4FNHA 3VGSA 4LRFA 3UD5A 3PFIA 1NPPA 2HFHA 5DDPC 2J8AA 3M6WA 4QPOA 4JOUA 4DQIA 4BWJA 1VIOA 1IRZA 2O7OA 2OD6A 5J1EA 5HMYA 3OTCA 3ZQ7A 4A8KA 3GWZA 4L5IA 2KT0A 1KOHA 1VQ7S 5J3LA 2YNFB 2LBFA 1UZHA 2FA5A 3Q86A 4D3GA 3HDSA 1ZGJA 2AQEA 1REVB 2DNNA 1YIJS 5AJ3F 4IO9F 3OSNA 1LE8A 2N82B 1LKXA 1V3FA 3VALA 4LJMA 5EF6A 1FX2A 3WU1B 2AGOA 2DO4A 1RLDA 4EMSA 1TT0A 3EE3A 3I87A 4AXIA 4O44B 1TKZA 3MEGA 3DLEB 2V8DA 3BQZA 3ESWB 3DNCA 2HWTA 1IRXA 4USUA 1UZCA 4U7CA 5K14A 3QYEA 1SFOJ 3I5CA 5FRNA 2PA8D 1X5TA 2Q6CA 1E3HA 2W57A 2ZWPA 4FYXB 2ILYA 5KFMA 3KOAA 3DBRB 3DLKB 4A3EJ 3ETMA 4F50A 1UPPA 4P9FA 2VXDA 3FISA 3G82B 1P9QC 2VPLA 1T11A 4N9HA 4BY1J 1V3SA 2YNHB 2OLWA 3HLUA 1S1VA 5CKTA 2Z2MA 2DD8S 3HVAA 2EINH 4CICA 4BQNA 4P1WA 3VAFA 4O4GA 4Y6IA 4LBHA 1NSQA 1LFBA 1EH8A 2X1BA 2D1VA 3SEZA 3E7LA 1BWVA 4M5DA 3NLCA 1RWVB 1ZM2A 3CWJA 1JTXA 2M88A 3HHNB 3E8OA 2X4HA 2RRBA 2PX9A 2M34A 2HNHA 4CP5A 3U1NA 2QMUB 3BREA 1U1PA 4HW0A 2VOPA 4XLEA 4B17A 2PI5A 1WC0A 4QYZJ 3POTA 2DRBA 2ZMEC 4C9YA 4ILLA 1K4TA 5D5XB 3IRQA 2V1DA 1SC6A 1DGRM 3FXUA 4NZ7A 4DFPA 2IJLA 3MURP 2CPDA 4M73A 4U7UK 3GFJA 1QNTA 4RB3C 5EG0A 3U02A 3BTJA 1CEZA 1GEHA 5LRRA 5A0YB 3KUHA 4TYAA 1J5OB 3AQOA 1R4MB 1R4NB 3PJXA 4RB0A 1S6PA 3QSIA 1XGMA 3QSYB 3OY9A 2F7VA 4CYUB 1VQ6S 4HHHA 1N34J 5D0HA 3GZNB 3H1CA 2XMAA 3A13A 1D5YA 2ZHAA 1OR7C 1FBSA 4O0IA 2YWWA 1LKZA 3PJ9A 2PJRB 2M30A 3MAAB 1ON2A 1VQ5S 3U7JA 2C3OA 4BYYA 2NPIA 3LTOA 3FEXB 3IA0A 5JFRA 4KE5A 4PQAA 3HOXJ 4KFBB 1GV5A 2XKOA 3AL0C 1UVIA 4V2FA 2DA1A 2HAIA 4QIWD 1EP4A 2Y30A 3GFXA 1RETA 3SXLA 3G71S 1I3AA 2AF6A 3AG2H 1JLEB 4PG6A 1ZZNA 1A6QA 3QP6A 3OT9A 4ECSA 1PBAA 3A8JA 3JSPA 1VISA 3IG1B 5F8NA 3KK2B 5D4LA 5ERIA 2J9CA 4KHMA 4NXMJ 4Z7CA 1B64A 2ZFUA 5IY5H 3MPUB 2ISZA 4KO0B 2VPRA 5ADZA 2XCPA 4NC6A 1SIZA 3V42A 1HQUA 2HQCA 3J81U 3V81B 1TLHB 1VQPS 5GAEI 3HHDA 2VLAA 1JIHA 4P2XA 2XPWA 1IUYA 3OQ2A 2C2KB 2FOKA 2V6AA 1YS6A 3L9ZA 2ZH4A 3RTVA 1WJCA 1MN9A 2V8HA 2BHYA 3EPGA 4A3KJ 1H88C 4MGRA 5DV5A 1RHQB 3M6XA 1YG0A 1VQYA 3MQ0A 3QFHA 1EJ9A 3KKFA 2CRLA 2CGPA 2MD0A 3OL7A 5K20B 2AV5A 4DV0J 3SDEA 2BXYA 3OTOF 4NQWA 2AX1A 3PR4A 2GO8A 2VG7B 2A6MA 4TU8A 1M1KT 3GCWP 3S2DJ 1WORA 4OX9F 2KO1A 2FQ4A 5FRMA 3W61A 2BGCA 1M5SA 1XDSA 3GONA 2JNJA 4XBFA 1W1WE 2RAQA 4V1Ak 1WGXA 2MQPA 2Y1IA 1Y0HA 3KG0A 3C7JA 2VBZA 2K3KA 2IT0A 5D4NA 4HDVA 5IFMA 4CT9A 2K7KA 2CXEA 4RNMA 5KFYA 2DTZA 3TW0A 3SV3A 3MM9B 3EGVA 2HRUA 3QGGA 4OMFG 3VEPA 4PXBA 2DFHA 1ZOTA 1AA7A 4X6AJ 3P6YC 1ZA1B 4K59A 1ZS6A 4UV8A 2AGQA 3NGUA 5IP6A 2PLYA 1HWKA 2HFUA 2FJXA 3FK4A 3QRFF 1R6YA 1H38A 2DIVA 2KM8B 2I38A 2E1MB 2DGVA 4M5NA 1WWXA 2V1XA 4NYZA 1JLBA 1HWJA 2HXIA 4P10A 1IO2A 2M8DB 2OPRA 4GYIA 1O7FA 2UXXA 3RQ4A 4RWXA 1UEKA 3CT9A 1MROB 2DO0A 3VTIA 2B0GA 1T0FC 4HEA2 2YNHA 4QWQA 5GPCA 2CPHA 3JAMY 5A8WA 4ZVUB 3FVYA 1RHKB 2VJ5A 4PGGA 3J7ZT 2EFQA 1RWWB 1T8EA 1R58A 1IBKJ 2JWTA 1VFCA 2L0KA 2Y9ZA 1PUFB 2K86A 4Q47A 2KZZA 3S16J 2M2EA 2R7OA 1XB4A 4P74A 1FDDA 3M6UA 3M8JA 3Q9SA 3TWZA 2CPEA 2IXSA 4AYBA 3OR1B 4HBLA 5EX3A 3BOQA 3OYLA 4IRDA 1RGVA 3DGVA 3HF5A 2HRYA 1FNMA 1WF0A 1YZ7A 2DXDA 2L54A 2L2OA 3WGIA 5HROB 1JGSA 3WTTC 1PP8F 3JRHA 4XIDA 4F2SA 5DG8A 2YX4A 4CLZA 1W26A 4YN3B 2BW3A 3RPUA 2XYGB 4FP9A 1A04A 2DRDA 3N5BA 2PI4A 3BN4A 1PJ7A 5TGTA 3JRBA 3I32A 4CO2A 4ZP6A 2F8HA 2FJAB 1IXKA 3TQ1A 4U6PA 3TUZC 3HSEA 2Q0OA 2Z8QA 3C3WA 4UZBA 5B5EC 1ZGAA 4K4SA 1UETA 1SKUB 3OVSA 1FHTA 4ESBA 1TMJA 3E2EA 4CTAB 1IBLJ 1UHMA 2NVUB 4B48A 1Z3YA 3QBCA 3M4OJ 1U2WA 1Q7LB 3D67A 3BJOA 3UR3C 1FFSB 4X4NA 4QQBA 3GO5A 1JHFA 4OAYA 2EILH 3WODF 1S0NA 2OA4A 3ABKH 3DRRA 2EK6A 4RX6A 2GVDB 1TWHJ 3PYFA 4KGKA 3NNCA 4WFBQ 3CGIA 4AC0A 2M70A 3Q83A 4BL0B 1FOXA 1SFKA 1Y39A 4CO3A 3EUHA 4RDUA 4X1EA 2F5EA 4HHUA 2KLOA 4DYRA 3KLVA 1H9GA 3N01A 5E7OB 4ENNA 1FF2A 3M8EA 1ZGWA 1CJUB 1QSYA 3NAIA 3FMWA 4ECZA 3IS9A 2K85A 3G3ZA 2VJ4A 1WI8A 1F3FA 4LLLA 3LUYA 1Z1DA 3K4CA 1X4AA 1RT6B 2JA2A 1NB7A 4E6KG 4KBIA 4PCQA 4BAYA 2IC3A 4BJTA 1Q5YA 2J9DA 1TZ0A 4OZ1A 3IKVA 2KFYA 4B9TA 3J7A1 2OQRA 4GRIA 2HK2A 4B09A 3Q0UA 2CPXA 4XR6A 2HFNA 3BPXA 4AVZA 4UOGA 1OIAA 4GC6A 3FBCA 3BR1A 5ETTA 2JSXA 3P7NA 5FIIA 1B1BA 4DZJA 4KICA 1E2XA 5KAKA 4JI3J 2V4JB 2F9DA 2QM3A 4RLQA 1YI2I 2IAIA 3J81Y 2DY9A 2MBFA 3LA2A 3CDWA 1DAXA 1WPKA 2B6AB 4P6QA 5L1IA 1AFJA 3EZUA 4G6QA 2D1HA 3H5XA 1IGNA 3L95X 3CCVS 3ZZTA 1RYSA 1TV6B 3EDPA 4X4OA 1HNVB 1ZELA 3DKXA 3IP0A 3FFIA 2V2QA 3N6LA 5ETPA 1ZREA 3K69A 4DLGA 1S9FA 1A0OB 2RU9A 3P9IA 1JXVA 1WJFA 2XLJA 3JAMU 4IG3A 4D1QA 2Z9OA 2ZKTA 2A2CA 2R42A 2Z57B 3BSAA 1T95A 4MIBA 4QWAA 1POGA 2E5NA 4UY8I 4NLQA 3NOCA 2WTFA 1MJAA 2CQBA 2U1AA 4TY8A 5KFRA 5M3FJ 1SEUA 1KR4A 2YNGA 2POKA 2DVIA 3O8HA 1ZG5A 1BJAA 3KJVA 4M3GA 2CQ1A 2LDIA 2JUGA 4OIOF 3EGNA 3S1RJ 3CNQP 3NXZA 1WC4A 3HHEA 5L3EA 1EX8A 5KNLA 1MDMB 1SAUA 1HNZJ 4OL8A 1V5VA 2UWMA 3R5DA 8ATCB 3OTBA 3FFIB 9RUBA 3RB4A 2LOOA 2VD3A 1MSWD 2OPPA 3KJNB 2ZNZA 2ELKA 4DV4F 3K70C 1T03B 2YKAA 2IIHA 2BV6A 1BR2A 5HJXA 4KHRA 3UO0A 2HQFA 1ZTWA 3AL0B 4IDKB 2EK1A 3DI6A 2YWKA 3D1HA 3RTRA 4FN5A 2W9CB 4KR0B 2X3DA 5EGOB 2DJNA 2WTEA 1I94F 4G8XA 4DX7A 4YR2A 3V7CA 1DDNA 3T5KA 1FJ7A 1PYVA 4PQUA 4B8XA 1CJTB 1Z6TA 5HBMA 2OFHX 2VA2A 2CPZA 3SDEB 4N41A 4ID8A 5JJBA 3JRGA 5EWFA 1QHHD 2XO7A 2VIXA 3EGZA 3CDEA 2LY2A 3KLNA 1VQKI 4ED6A 2DI3A 4BC9A 2A6EF 4MK9A 2E7XA 5KFCA 3LSHA 1XGNA 4LREA 2QF7A 2XPVA 2WADA 2UU9J 2WAQA 4DQ2A 1WOSA 1WKKA 4CYDA 5C7PA 4KKOA 3OYMA 2WA0A 3R6LB 3GFZA 4IR9A 4M5HA 2GWRA 1Y3KA 1YOVB 1NK0A 1ITPA 5A2QU 4E70A 2XEXA 1X0PA 3JTGA 3LH2S 2FBKA 4K4VA 4A3GJ 1Y3JA 3DYAB 3OXLA 4XK8C 2WAQN 2YR2A 3MM8A 3MEKA 2M0MA 1Q16B 3LSIA 2LXUA 4YDXA 4DW6A 3FBFA 4M71A 3CJ5A 2XZDB 4MIMA 4HZFA 2B51A 1UEUA 3MWBA 2H8WA 5IYDJ 1SJ4P 2IVYA 2Z16A 4JBAA 4CA0A 4PXCA 3TZYA 1Z2ZA 3TA1A 5HJYA 2RQPA 2DXFA 1TKDA 5JHUA 4MFEA 3HSZA 4HKQA 2OKQA 4QU6A 3PW5A 2HPIA 1FK9B 4XLAA 2L7ZA 4B3SF 3H0GJ 3KP3A 2C2DA 3OS1A 2CRGA 2HLUA 4FDFA 1Q86T 1J5EF 4B3MJ 1T9YA 3HSJA 4JI1J 3R5GA 1YQHA 1HOMA 3M1CA 2H48B 3M8PB 3U1KA 1C1BB 2EZIA 5J1PA 3TVYA 1FTTA 5J1NA 2Z99A 1KQGB 3PX4A 4NA1A 3M2RB 5BPIA 1JXLA 1IUFA 2HVIA 1QVFR 2NXEA 2KL8A 4DG1B 2M3DA 3MD2A 2HHHJ 2XGXA 4DR2J 1D9FA 1XR5A 3TQNA 2N4DA 4R25A 1IZ1A 3ILOA 4CYCB 3ZMSA 3T5XA 4O3NA 2A05A 4WE1A 3IRWP 4DFMA 4JI2J 4D7MA 1VJQA 2PEBA 5FLXU 2GXBA 1RHMB 4G12A 4I7FB 3ULHA 3R27A 4CO0A 3RKWA 3O6BB 4USWA 1TWFJ 2LTPA 3ASNH 1BM9A 5LBQA 1REPC 4FETA 3RBDA 5KG7A 2WB1D 2FUG9 2NYXA 1G6BA 4LBIA 1TW3A 3QAHA 4O6JA 3S6EA 4C8KA 4EGZA 1WG4A 5BS6A 1Y10A 4M9SA 5LD2C 3HVRA 2VQFF 5FFXA 3OYGA 3SSRA 3C6TA 2ALYB 1VQ7I 4ICLA 3W66A 4JI4F 3GYNA 1LWEA 3L2RA 4KGZB 4BLGA 2O03A 5H6QA 1P4XA 2DJIA 4ED3A 3IAS9 3CE8A 2NOGA 4RM2A 2CZVC 1H89C 5A2QY 1UFKA 1EF4A 4WJBA 3PO4A 1FFGB 3NGDA 2DH7A 2XF7A 1AXQA 3CJQA 1FPQA 3MMBA 2PFBA 1WF1A 1S97A 4JV2A 4KN4X 4I69A 1TMMA