1ZELA

Crystal structure of rv2827c protein from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
293
Chain Sequence
AMVVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSGESVWAPEYQLVDELVVPLLRVIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein Rv2827c
publication title Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 293
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09407 AbiEi_1 AbiEi antitoxin C-terminal domain
A PF13338 AbiEi_4 Transcriptional regulator, AbiEi antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1040 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1zelA01
1ZELA
chains in the Genus database with same CATH superfamily
1NG6A 3WTTC 1N75A 1UZCA 2A61A 2CRGA 4M72A 2R7VA 3BROA 1YTYA 1ACIA 4I2OA 3JAMK 2OCCH 3PSFA 4B47A 2D45A 5DDGA 3S15J 3I59B 3K1MA 1SD5A 1XCBA 2OAZA 2E2HJ 1U8RA 3RPUD 1ETWA 3I5UA 2YR2A 2NYXA 1P9QC 4MTEA 5DCFA 2AXTC 1X58A 2X1DA 4E7IA 4IRIA 1UB9A 2PLYA 2DXIA 4V19K 3W2AA 4WXHA 3G6EI 1ZGWA 3IAM2 2FBIA 1S29A 2JTVA 1WWXA 4OU0A 2J5PA 1FYLA 1LDKB 3OR1C 3K6GA 3SFIA 4OIOF 1UHMA 2FQ3A 2IP2A 1UCRA 2WADA 2IA0A 2JK3A 2L5QA 2XGXA 5F1RA 1MGTA 5AIQA 1YHQI 2HQNA 2G9WA 1MNDA 1IRXA 4UV8A 3S3NA 2UXXA 1XCVA 1E0EA 5E79C 3BTLA 1QVTA 2GM4A 3T8TA 2VPLA 4KN4X 4IQJA 4KJZA 3HOUJ 2M8GX 2VT2A 1BR4A 5GAGJ 2L9VA 1BI2A 1O3TA 5C3EJ 4C2UA 4LG3A 3I71A 3KEOA 4H4KC 4XQFA 2JZYA 2W84A 3ZQQA 2HTJA 1SFEA 2G0EA 4EQQA 2R7RA 5K5RA 2QBYA 2XV4S 1DU6A 1JHFA 3ZN0A 3E5UA 5ILUA 2Z9OA 1JJ8C 4HLXA 1XB4A 2UUZA 3W6JB 4D1QA 1RETA 3G1MA 2Y9ZA 2E2JJ 3MMYB 3QODA 1XX5A 3PNVA 2KLOA 4A5NA 5L3GA 1VQ5I 2FD5A 3WTYC 2FMLA 2HDWA 2W48A 4L9NA 4GFBA 3WU1B 3TDUC 3KZZA 1YX3A 5HS7A 4BXXJ 4N4OB 2DT5A 2XAJA 5D5WB 3LA7A 3ABLH 3KLNA 1T39A 4LD5A 2W24A 2YUSA 4HQMA 2F2EA 4FE7A 3TEDA 2E1MB 3M07A 5J1YA 4HF0A 5D6FA 1R5HA 4IOAF 2K86A 4ZYDA 1R1TA 2QSGX 3P9KA 1HSJA 1L3LA 2MD0A 2XAHA 3SEZA 2VOPA 4PSWA 5LBQA 4N9IA 4M3DA 2JJ7A 1LQ1A 3K4CA 3DEWA 5J4YA 4DZPA 1O7FA 3TO7A 2LBFA 1LFBA 2DBBA 1FMVA 3DKWA 2X9DA 4RS8A 2M34A 2JA6J 5IOYA 1Z21A 3BQZA 1R1UA 4OMZA 2ZC2A 2VKEA 2D5VA 3CDHA 2GQQA 4HYEA 4ZTJA 1H0MA 5K5OA 1A5JA 2VI6A 4G6QA 4CHUA 1OYIA 2CQKA 2JSCA 3AG4H 3S1NJ 2WB1N 2BEOA 3TP3A 1SEUA 2DFEA 2PMUA 2O6GE 3CJNA 3PIOF 2NS7A 1USTA 2KRFA 3K9TA 1XS9A 4RB0A 2HVRA 1QZYA 1Z05A 3A0BC 4BQQA 3GO5A 1QZZA 1TBXA 4ENNA 3TBIA 3CCLI 4MQ9F 3RTRA 5C4JJ 2EPFA 2IVMA 2MC3A 2M4KA 3PO3J 4QTRA 3OYDA 4YFNF 5EEHA 2L7KA 3KYLA 3H3UA 1HDPA 1JXSA 3DTKA 2HYFA 1MJ9A 4G8XA 1MNMC 3ZN1A 2FE3A 4PK4A 3U21A 1JI8A 1EH7A 3Q3SA 2M8EA 1S5LC 2CSOA 4IQ4A 3O2PE 5DUIA 3DBHB 1IXCA 2V79A 2ME6A 2NNNA 2QEXI 2VUMJ 1DP3A 1B72B 1FNNA 1E3PA 2BW3B 2E2IJ 5KCMA 3BTJA 2E7WA 1Z3XA 2XUBA 2RNGA 1J59A 4RAGA 1SMTA 2HOSA 2UWMA 3KCCA 5HS9A 1T0FA 2COBA 3G73A 3DLAA 5EEAA 4LOCA 2KHMA 2DOEA 4B43A 1T95A 1IW7F 1BW6A 3CESA 1X19A 1KQ9A 5ICFA 2L9SA 5JVTA 3DLLF 1O3QA 3BR5A 1ETYA 2GOXB 2WV0A 2Y75A 3GMEA 4S0HB 2DTRA 3MD2A 3O8GA 3ZQCA 4IHSA 4IHTA 1NTCA 4EJOA 4AIJA 4E7LA 2QM3A 1YI2I 2ADUA 4EV0A 5HOOA 3WHBA 3BOQA 4AIDA 4P55A 5ED4A 5EG0A 3L1PA 1D0YA 4BKXA 5F6FA 3GTJJ 1G59A 4ASNA 4N0BA 4UXNA 3WTXC 4FT8A 3BTCA 1VQMI 2MLGA 3O8HA 3RYRA 4F92B 2BY2A 3W2VA 1I3AA 1YW9A 1T38A 3PUBA 1IJWC 4ESJA 2ZO4A 3OS0A 3LWFA 4A3DJ 2F5EA 2XKOA 1SMYF 2ZNZA 1XC5A 2R7FA 2E5ZA 2NVUB 2K4JA 1DPRA 2Z99A 4RGSA 2LY2A 2HKXA 1FIPA 2M45A 3GTPJ 4BYYA 2XSJC 4M73A 4XN0A 4LMYA 4BY7J 3MVPA 4FQGA 4C3IJ 2WB1A 4D0PA 3OL4A 4A12A 2COMA 2YX4A 5AIPA 2K9NA 1ZKGA 2FQ4A 1J9IA 1A6QA 3IKVA 3EQLF 4BGDA 3LMMA 1WHUA 4L0YB 1OCTC 2TCTA 3QP6A 4IX7A 1MW7A 2NVXJ 1DU0A 4NB5A 2ZB9A 3VPRA 2QQBA 4DYCA 1ZGAA 3ZXSA 2X6YA 1OKRA 1FBSA 2VBXA 2E35A 3FBIB 1KGSA 1R9TJ 2Y2ZA 3OYEA 4XKVA 2HFHA 3DFGA 3GUDA 3LAJA 3VSKA 2QUFA 3DKXA 2XPWA 3HOTA 2H27A 2M87A 2VB6A 1MMGA 2HQ5A 1VQ4I 2HYGD 3PSIA 2M0CA 2ID6A 4BBSJ 3Q5FA 1XG1A 1ZARA 1TTYA 3CO7C 3S17J 3F8NA 2LRDA 3WHCA 1G6NA 4LLNA 4I02A 1RUOA 5E1XA 1B6AA 2CW7A 5TISC 2KRHA 3N05A 4V2GA 4OINF 1DDNA 4OMYA 3PQJA 2KIQA 3OMYA 5BOXA 2CUFA 3D0SA 3EETA 5LHGA 2IGKA 2R3SA 1MH4A 4HX8A 4WXDA 1VQOI 4LG0B 1I50J 1P4XA 3PJRA 2D1VA 1QU3A 1YW7A 1VQ9I 1JKQC 4A3CJ 1RR7A 2ACJA 2DJNA 2KJCA 4LLGF 3F23A 1LFPA 1D1CA 1XMAA 2FSWA 4DZJA 2MGQA 1SVMA 3UR3C 5HLGA 1LPQA 5FD6A 4FX4A 5GTIC 3HBLA 1WJ5A 4MEXF 3CP8A 3T1BA 4KIBA 3GVAA 2QENA 2Y69H 4KFCA 4IXAA 5LGTA 1X1PA 4TV7A 3T0YA 5H6QA 4A3KJ 2JA5J 2DT7B 4YFXF 5JFRA 3FMRA 3U1DA 1KQ8A 1H9TA 2XB0X 2ZMEB 3H36A 3I4MJ 1Z67A 4XLHA 2KZVA 4H0EA 3BWGA 1XN7A 1OCZH 4CCOA 1XPXA 2FNAA 2LP0A 2CS3A 2LR8A 4L5IA 3WTSC 3L2UA 3I58A 4MNUA 3K70D 2NVQJ 2LH9A 4BUPA 4Q48A 3IP4B 4R8HA 2ZJRF 3F22A 1VQ7I 2EZKA 3ELKA 4UUSB 4Y33A 1RC9A 3IRRA 1X3ZB 3ZR8X 4IHWA 4G7OF 3HPGA 1EV7A 1ZK8A 1P4AA 1HW1A 3ECOA 3SDBA 1FP2A 5IT9Z 2A3SA 3OYLA 4RAZA 3KFWX 2EBIA 2KL4A 4KN7X 1YJNI 3Q0VA 4OWRB 4CCJA 2RGVA 4C3HJ 3MKYB 4N4NB 1IV8A 2G7UA 1AKHA 2WC2A 4MTDA 2E19A 3BDDA 3SXYA 2ZSIB 1XMKA 5FB2A 3S3OA 3HHHA 3CLOA 2LG4A 2CQNA 1XGSA 3DBRB 1YJ9I 1HW5A 3OOUA 4EATA 2CFXA 1UJ8A 4WWCA 4LIUA 1S6LA 2H8WA 1OPCA 1BJZA 1X4OA 1PUEE 4BJ5C 1VTNC 1LNWA 4XL9A 4XR6A 4LB5A 3HL2A 4KIFA 3SZTA 2JQ7A 4M6VA 3K2ZA 5ICCA 1OQYA 1UFMA 2EK5A 2OQGA 4ZJZA 4NNJA 2EJRA 2FOWA 1RNLA 1ZQ3P 3GFJA 1DQUA 3FXKA 3ASOH 4FE4A 2J5OA 4P9FA 1FP1D 2M5WA 2I8DA 4PJNA 3L2CA 5CYVA 2E34A 4UB8C 5DYMA 2XROA 3OYFA 1I3QJ 1KYZA 1ODDA 1WCMJ 1X1AA 2M1BA 2O7OA 4ZDLA 3PO2J 3K4BA 3CF5F 3KP2A 1Y0NA 2DTZA 2WA0A 2K3PA 4JQFA 4HPQA 2H8RA 4U87A 4PJ0C 3K7AJ 2K9SA 4A3FJ 2BBYA 4BL0B 5GP9A 3VYSB 4BNCA 2PQ8A 1SANA 1XDSA 3OYIA 2DMPA 1YLFA 2X0LA 2ZXWH 3KE2A 2X6OA 2KIMA 3LA2A 2B0LA 2R7WA 3EYYA 1RKTA 3QPLA 3D5RC 3H3ZA 4G94A 4S04A 5JI6A 3DP7A 4FISA 3FK7A 1LEBA 2LDUA 4A2UA 2EB7A 4XN3A 4B09A 3WODF 4CCKA 3QYEA 3RPQA 4A0XA 1DGRM 2DA3A 2K02A 5K7ZA 1QHGA 1SFXA 5CLSA 2R7XA 4XKCA 3L9FA 3PFYA 2HS5A 2RNJA 3S1RJ 4MEYF 3FKIJ 1W5SA 3H1CA 2DYRH 2EH3A 1FPQA 2L02A 3BR6A 2OA4A 3V42A 1EH6A 4HSRA 3T5XA 3CTAA 4BEHB 4A3JJ 4JP0A 1AOYA 4HEA2 2W82A 5D5XB 4G12A 1KA8A 3N4MA 4Y52J 1AU7A 4U88A 3OYBA 2WY8Q 4ZTFA 4XK4A 1D0ZA 1OYYA 3JRDA 2R5ZB 4YIRX 1AHDP 1F36A 4LK1F 4WX9A 3ERED 2Z5UA 5ERIA 2DA5A 5B1BH 1F4KA 1BOBA 2V1XA 3DU6A 1T33A 3A0HC 1TC3C 5EGOB 3GTQJ 4CYCB 2M0MA 3FXRA 4C3JJ 1ZELA 4JBAA 1WSUA 4HV5A 2KJBA 1T2KA 3JREA 2KDZA 2VJIA 4XLAA 2AQEA 2MC4A 1UHSA 1TNTA 3WE3A 3K69A 2PMHA 4ZC3A 3KP3A 3OYMA 4J19A 3KP5A 4F52A 4LITA 3KP7A 1I39A 1KU7A 2Q8KA 3CJTB 4B3AA 2OV7A 2CV0A 2DN0A 2XHKA 1TWFJ 4MQVA 3MKWB 3E6CC 3EPZA 3CCEI 2Q2EA 2W4SA 4BH9A 5HDKA 1VQ8I 2P6SA 1HQCA 2OTJI 2CO5A 3BCBA 2V1DA 1B9NA 3JSOA 1T8IA 2OD5A 4KDPA 3QPHA 3FXOA 4AUXA 3LSRA 3BY6A 2Z16A 2AS5F 5KHDA 3KEQA 3IWZA 4I09A 2IT0A 1W1WE 3B73A 1J09A 2F4OB 4FTHA 1Z3YA 2BGCA 4LK0F 2FBKA 3H92A 5JVGF 1TW3A 2DFFA 2W7NA 2ID3A 4A93J 5E3OA 3PIPF 4YFKF 2CQXA 1GDTA 1H9GA 1SD6A 1M1EB 2AHQA 1FTTA 3RDIA 3ABKH 2DA4A 4BAYA 1ULYA 1FOWA 2ICWG 2R7TA 2XAGA 3G71I 2VQHA 5F04A 3C1DA 3BR2A 1ITYA 3ABUA 1MNEA 3HRTA 3KYDB 2OUMA 1YRNA 4EJTA 1KQ0A 4GDFA 3HPHA 2NOJB 2FA5A 1SFOJ 4BHCA 3IH2A 4Q47A 1A31A 5HDGA 4OAZA 1DPUA 2RV8A 1FX7A 2BHYA 2ZMEC 3HYIA 4UY8I 3JAMZ 2QCOA 4HDUA 1CF7A 2FXAA 3H9QA 1YYVA 2DFHA 5JHUA 4XLEA 4RLFA 1PDNC 4L5EA 5EZHA 1B59A 2IJLA 2CYYA 1G4DA 3FKJA 4EEFG 3MZ8A 3NWSA 3RQIA 3F8MA 1QNTA 2JN6A 2LK2A 2P6TA 4BBRJ 5J6XA 2R7DA 2A07F 4X0GA 3BG3A 1FYMA 5F1JA 1LEAA 2BZTA 4LIVA 3E3VA 4O6JA 1A04A 5J8CA 4ITVA 2VQGA 1BR2A 5GTHC 4G7ZF 1MJBA 1JUMA 3SQNA 3ECHA 2BXZA 4AC0A 1JT0A 4G9YA 5E8IA 4BJTA 4RGRA 3V4GA 2ZJ2A 3AAFA 1DP7P 4CCLA 4QWQA 2VKHA 2VKDA 4BU2A 1F5TA 3HSRA 2LSOA 4L18B 1A36A 5LRRA 2YPRA 2HNHA 3OWTA 3ZMSA 3I4PA 1U3EM 3H9GA 2FMYA 3GCMA 5DCMA 5M5WJ 4II3A 5E8GA 1W0UA 4DBQA 2HR3A 4IOCF 2KISA 3H5RA 1IRFA 4WK8F 2M30A 1FT9A 2K85A 3EUHC 3V7SA 4A3EJ 1IN6A 1ZR4A 2RKHA 3HM5A 3ZGKA 3OYHA 1YFHA 1ETKA 3I53A 3RCOA 3A1YA 1BIAA 1K7AA 2KIUA 4EM1A 3KP4A 2V26A 2IS2A 2QKMB 1IXSB 1PP7U 5DM7F 4E7ZA 2L4MA 1G3YA 1JJ6C 4II2A 3L2WA 5HNFA 4KNYA 5KAIC 1A35A 1ZRCA 1IUYA 3J7YJ 6PAXA 3CD6I 3FZVA 2LKSA 4IO9F 3CJQB 3ABTA 4M3EA 1W7PA 2Y9YA 2K5CA 5IP6A 2R7SA 4ENMA 1PUFB 1P92A 4IZZA 2HU9A 1T98A 4G6TB 3PUFA 4F7ZA 3W6VA 1FLIA 3ISPA 4A3MJ 4U0WA 1TWCJ 1GXPA 3JR9A 2WTEA 4ON0A 2Y30A 4OIRF 2X1CA 3CJRB 4O5VA 4BQAA 1T6SA 2DMUA 3LSTA 3I59A 2F4MB 1YG2A 3OSGA 5D5UB 3FBNB 1X1BA 1WH7A 1WJAA 3HOVJ 4RB2C 1N78A 1U9NA 5DEQA 1WJDA 2NXNB 3MWMA 3CMMA 2UZKA 4HLYA 5BPIA 1WQ2A 3A01B 1Z7LA 5CQEA 3CUQB 2O9LA 4HOBA 3CLQA 1R5GA 4AVZA 1IGNA 3OL3A 3H0DA 2ZJPF 1W5TA 4PJMA 1WH5A 4M9XA 4YELA 2OU2A 2GLOA 2P5KA 4ZDPA 3OR2C 1Q1VA 3RZOJ 3M3YJ 5DM6F 3F72A 3QAHA 2I10A 2M3AA 1XSXA 1WI9A 1IN4A 1Y39A 4IHYA 3TOBA 3CZ6A 5LHIA 5C44J 1NK2P 3G4SI 2A5YB 4G7HF 4A6EA 4MO7A 3COAC 1Y56A 2KMUA 2JT1A 3NQOA 4CZCA 1D8KA 1LE8B 4BHPA 4CDGA 2F48A 4D7MA 5EDNA 2GIVA 4KICA 1PJRA 2A6EF 1NK3P 3OYKA 2HKOA 1V55H 1F1ZA 4ZZLA 1WVRA 1CQTA 3IAS2 4BE0A 4UUTA 4MLOA 2BHZA 3WTZA 3R4KA 4DGWB 1R22A 3MEXA 1IUFA 1ETVA 2VT3A 1MBKA 1YJWI 1QPIA 3MN2A 3ABMH 2P81A 2VXDA 5KAFC 1HKSA 2OZUA 2QKLB 3GF2A 1LDJA 1P2FA 3QOEA 4QLCU 3CO6C 4E7HA 4N9HA 5L3EA 3GX4X 2R7UA 1TQMA 4A69C 1MDMB 5IYDJ 2F5FA 2KIFA 2ISZA 3X2QH 4WCGA 4L9VA 3L2VA 3S3MA 1FSHA 2KDOA 4HSTA 4CSWA 4NC7A 1YO5C 4C30A 2DODA 2P8TA 3FXMA 3V8JA 2HYJA 3QPSA 5A2QK 2K40A 5JLWA 2DOFA 3TO6A 2K27A 2STTA 5BMZA 1BOAA 5H2FC 3RQ4A 1U5TB 3U9GA 5L3FA 1KYWA 4JX6A 1WJFA 4P5OA 1Z7UA 1YQAA 2L01A 2DMNA 3NRVA 4HX4A 2GWRA 3HOYJ 2JVHA 4I99C 3UNGC 5B1AH 3AG2H 4KUMA 2QWWA 3M8JA 3IH3A 3IHUA 4IPAA 4UV9A 5TGTA 2O8KA 1KONA 1YIOA 3UKGA 3E1SA 4YG2F 3G2BA 1W7PD 4PCQA 2XF7A 3LQQA 1P7IA 1RI7A 4B1RA 3CDLA 2GZWA 5FJ8J 1MMNA 3P7NA 1JUSA 3S14J 1GLNA 2X1EA 2ZXIA 4D7NA 4WF2A 3DPLC 1YW8A 3PFIA 1YS7A 5AONA 5D4RA 2K9LA 4I7HA 3HEFA 3H0GJ 2BYVE 2OBPA 1MBFA 1YX5A 1RUNA 4X1EA 3WGIA 1HC8A 1XD7A 1TZLA 3FXJA 4R79A 3TDZC 3GTMJ 1QA6A 1XMXA 1FMWA 3FHNA 4ZZDA 2VJ5A 2DK5A 2JSPA 2OQRA 2X6XA 2XVCA 2BE5F 5JHFA 3O3KA 1B72A 3RZDJ 2BW3A 4L0ZB 4JOMA 1E17A 1J7KA 4XNFA 1OISA 3CCJI 3M4OJ 3VWBA 1HXDA 4NC6A 4BQNA 1FWZA 5J3LA 3ESWB 3DEUA 3LSIA 1K83J 3LSJA 1TWGJ 5HLIA 2HTSA 3FF5A 4W1UA 1R49A 1J75A 2MD5A 3WTWC 1U5TA 5IYCJ 3HOWJ 2D1HA 1UAAA 1JTYA 1X2NA 2V9VA 3L7WA 5FGMA 3K4NA 3WTUC 4E70A 1IC8A 1BI3A 1IN5A 2HQAA 3KPHA 3OIQA 3BT9A 3W2WA 2JRTA 3O6BB 1TW2A 2WY7Q 4EGZA 4RB3C 2FRHA 2XC7A 5F0HA 3MZHA 2N8GA 4I0AA 1GV5A 2LOOA 4ANJA 2B63J 4BJ6C 3HKZN 1J2XA 2NS0A 3LOCA 5CQGA 2LF8A 2MYSA 1SFKA 2RQQA 3CCSI 5C4XJ 3OIOA 4A3LJ 2H09A 2DYSH 3F8CA 3BJ6A 2DMQA 2DU9A 4JX4A 4M74A 4ESBA 3L00A 1OCPA 2DCEA 1ZN2A 3CC7I 4P1WA 5D5VB 2L7ZA 1SD4A 3AG3H 1MBHA 2ELKA 2IBDA 5CVVA 1YE9A 4LGWA 2O8XA 1RRJA 2LFBA 4IL6C 1K61A 1BBYA 2BXYA 2XF6A 4NC8A 3DPTA 5DD4A 3E7LA 1C0WA 3ZCOA 2LMDA 2JUGA 3BPVA 2IA2A 3CQZJ 4NHJA 3GZ6A 2DI3A 1G3SA 1D8JA 3W3CA 3VYRB 2X4HA 1D5YA 2HDDA 5CVIA 1N25A 3M1CA 5GAEJ 4MFEA 2E1MC 1BA5A 2PJPA 4XMYA 3PM1A 4R1HA 1Y1VJ 5KK1A 1OYWA 2QZ8A 4XKBA 2GXBA 3S2DJ 5E17F 5FKLA 2TDXA 3HOSA 1XSDA 3BP8A 1W0TA 5J4VA 1HLVA 2ESNA 2CJJA 1EF4A 4CO8A 3S93A 2VIXA 3DTIA 5EEGA 4F93B 1WI3A 4XRFA 3R60A 3A02A 4JK1X 2GAUA 3WG9A 4CZZA 3ZMVA 4A0ZA 4CCMA 2VBWA 1X1DA 3BZ6A 3Q9SA 5DUKA 2QQ8A 1K6OA 1VQKI 2R93J 3DKYA 2L4AA 5BNGA 1I5ZA 3BCAA 3GWZA 2JA2A 1RKWA 1BI0A 4J00A 4IHXA 3HG9A 1JTXA 2HOEA 4LG0A 2W00A 3F6VA 1B8IB 2IW5A 1QRYA 3MCZA 3WU2C 3JSPA 2E5NA 2MH2A 3PNYA 4AM3A 1IN8A 2M9HA 2EFPA 2EFQA 1JKPC 2VODA 2A05A 4I76A 2DMTA 2K9QA 2A69F 2ZFWA 1U9OA 2R4GA 1IDZA 4Y7NJ 1Z6TA 5D8LB 4GGGA 2IAIA 3P9CA 1ZLJA 2ZJQF 2LLKA 2CUJA 4RBOA 3VSLA 5FROA 1XTAA 4HX7A 4XLPF 1LFUP 2HOTA 4F3QA 4YIFA 1ETQA 1OR7A 1HKQA 2ZMEA 4XONA 2BVMA 4BE2A 3FXUA 3C3WA 3M1EA 4IKFA 1Z0XA 5BPDA 3AL0B 3VYTB 5K1YA 2PBIA 3ZQLA 2WAEA 2A6TA 1V3FA 2DLLA 1FZPB 1Y6IA 2H1LA 2RREA 2HPMA 2RN7A 3LQRA 2WAFA 4IF4A 2EIMH 4UUSA 4HZFA 3D5SC 3GTOJ 4CCNA 4EM0B 2EIKH 3KETA 1K4TA 2HXOA 1Z1DA 3J7AO 3B02A 5B66C 1U5TC 1W36C 2GA2A 5HS8A 1YS6A 2E1NA 3S1QJ 4BQOA 1ZTRA 2JPBA 4XOTA 4W97A 3U1KA 5ICEA 2O0YA 1FJLA 5LLQA 4NUBA 1D5VA 1WJBA 2W25A 1YOVB 2EFWA 3AKZA 5K5QA 3OY9A 4LB6B 1JGSA 2HQRA 1F43A 3BJOA 1ORKA 3HTSB 3R6SA 2V1UA 1V4RA 4BACA 5IYBJ 3E0JB 4AD9A 4M3FA 1WPKA 4EM2A 1JHHA 1XSVA 3ROUA 5JR3A 4A3IJ 1JGGA 3ASNH 1X2MA 4B4CA 3REOA 2QYOA 3HUGB 5HVQC 2FEZA 3HSEA 3AFHA 2JPCA 3EUHA 3C18A 3SDGA 3PNTA 4L9TA 1TLHB 2E71A 1GVJA 4LLLA 1NG7A 4AYBN 5BQTA 4BHBA 2R5YB 2PX9A 1TQIA 2D2WA 3OS2A 1DGWY 1VQLI 3FXQA 3K10A 1ZGJA 3K0LA 2XGEA 5EYRA 3QP5A 1BI1A 4HBLA 2GA1A 4UB6C 5LFAA 3KLOA 2W1OA 3Q0UA 3QYBA 3M9AA 2KFDA 1LUJB 1S3JA 3LL7A 1B4AA 2CH0A 3F0CA 3BZCA 4M6XA 5LGNA 1MSFC 3FX3A 4HQEA 2HI3A 3R61A 1YITI 2BY0A 4DYQA 2DOAA 3GFMA 5JLXA 4AIKA 3W6KB 5FRMA 5GPAA 1FBUA 2PN6A 3R0AA 5H6RA 5DTDA 5K7FA 1AA7A 2K3FA 1F9NA 4GCVA 1FEXA 3F9KA 3ZQGA 5J8FA 2GXAA 1OCRH 1FSEA 2DO7A 5HNHA 1QBJA 2PI0A 5F27A 5EJCA 2ZSHB 5F08A 1V54H 4BEHA 1Y0UA 3C2HA 1D1BA 1RR8C 1IRGA 2CV1A 1MBGA 2V1NA 3RKXA 5FLMJ 3FM3A 4XRSA 4CUGA 2R5ZA 5LRSA 1R4NB 3T8RA 1HDDC 1ZR2A 2DA1A 3BTIA 2QSFX 3BQYA 2QQAA 2OC6A 4ZH4F 4HNTA 3RIRA 1U8BA 4PGHA 3Q0WA 5EGOA 3R0JA 4CYCA 3CMYA 4U7BA 4FETA 4ABZA 5IY5H 1STZA 1LVKA 1IG7A 2IGOA 2WV1A 1S7EA 2IPQX 2ZXHA 2DAOA 1K79A 2LTPA 5CVUA 4I6ZA 2QLZA 2ZFUA 2EFNA 3GTGJ 2R0QC 4M9SA 2MH9A 3CCVI 2IS4A 3HRUA 1FBQA 2CFOA 3E97A 4HW0A 2YSRA 1WJCA 1OR7C 3RSNA 3D5LA 2UV1A 2VLAA 3ZPLA 2VPRA 1KU3A 2RDPA 1R4MB 4J01A 3DV8A 4NQWB 2XIGA 4E7KA 2NRAC 2BVLA 1IV6A 3ZQFA 3GZ5A 3TW6A 1ETXA 1OFCX 1BL0A 5CPRB 2K9MA 4AYBA 3TP0A 2LY1A 1HF0A 3A4CA 2O3FA 1BC8C 3HC7A 2YX7A 1D0XA 3EUKL 2NVTJ 4RAFA 2O61A 5D4SA 1CGPA 3GFIA 1VF9A 2VKVA 3S2WA 1LVAA 2DT6A 5DV5A 3OYNA 3IH4A 5EZGA 1K4SA 2L7FP 3KEYA 2R92J 4HF2A 2CQQA 3FDYA 3HOXJ 1P6RA 5FKKA 1FOYA 3WGGA 2L0KA 1S9HA 2MLKA 2LREA 2L2OA 2IGNA 3HHGA 2STWA 2QBYB 4U7DA 4DOZA 2L3DA 2DA7A 3EUAA 1OMIA 2IGMA 4KITB 5IP9J 2CG4A 3K4JA 4XOPA 3J80Z 3JTGA 3J81K 1MBJA 2Y0SN 2LF7A 3AG1H 3I64A 3TL4X 2I5UA 5LEJA 2XAQA 1Z6RA 3D1NI 1O3SA 1O3RA 2X51A 3G1LA 5IP7J 1ZG5A 3SEQA 4ZYGA 5J40A 2RVCA 2HWVA 4P96A 4B8XA 5FLXK 3P5JA 2KQRA 2A5WA 3SYTA 1Y8QB 4CXFA 3AL0C 3QPTA 3HGYA 4NQWA 1IN7A 3CCQI 4ESFA 1Y1WJ 2QQ9A 3TMOA 2JMWA 2TRTA 4IVNA 4PJJA 1BR1A 3GTKJ 1K6YA 2KZGA 3M8EA 4EMSA 3HB9A 3MAJA 1FOXA 1HW2A 5D6EA 3J80K 3DTEA 4M9ZA 2B7EA 2LBFB 1I27A 4B48A 3K2AA 1R7JA 1VNDA 3EYIA 1SAUA 3QU3A 4PGGA 1KU9A 2EINH 2Y0MA 5J1UA 4FHTA 2YU3A 4M71A 2LY9A 3JRHA 2VONA 4HG2A 4HF1A 1TWAJ 4HA8A 4FCYA 2PJRB 3ZQHA 2DA2A 4A3GJ 1UELB 2XRLA 2E60A 1SAXA 3PQKA 4GYGA 3I54A 1H89C 4QSHA 1VI0A 3L2RA 2XGDA 2VASA 5F0CA 2IXSA 4F55A 2CU7A 2VXZA 2HPIA 1V5GA 3DU5A 5IOZA 3LNQA 1K78B 2E1CA 2V6CA 1WGXA 1E3HA 3BR1A 1G8XA 2XASA 4DW6A 3QRFF 3HXLA 3TW7A 2DPDA 1NHAA 3FHZA 3BR0A 1MH3A 1LDDA 2F6CA 3N97A 5FFXA 1QHHD 2H94A 4P9UA 4OAYA 2EV5A 3KX2A 2HGCA 3DF8A 3IL2A 3WU0A 3DPUA 3QWLA 2LC2A 2HEOA 1G3TA 2LYCA 3E5QA 2ELJA 3KP6A 2AQFA 3GZNB 2QA4I 2CUZA 2VBYA 2ZBKA 4QIWN 4IEJA 3VYUB 3RKWA 2F5DA 3G1OA 4PDKA 4QPOA 2CW0F 2MSYA 1JT6A 1I6HJ 4D9JA 4FX0A 2VE9A 1TWHJ 2EIJH 2VL8A 2E36A 5CKTA 1HA8A 2Y0SA 1XDUA 3IRQA 4CYDA 3KZYA 4M3GA 2NNYA 3F3XA 2BOLA 3JRGA 2ELHA 4AU7A 3NARA 5ICGA 2XAFA 4KT5C 4KT6A 4RGUA 1UG0A 3U2RA 2Q1ZB 1PUFA 5A2QZ 3CDIA 1P7JA 4KMFA 2K4BA 2PJRA 1GXQA 2XRNA 4XSXF 5LHHA 1B9MA 2OCEA 2ETHA 1ZG1A 3FM5A 3LFUA 5KVRA 3ZMZA 3FWEA 3LSGA 4CA0A 1JUPA 2XPVA 3E5XA 1BC7C 1GV2A 1K78A 5EG0B 3OOPA 3H3VK 1OCCH 3FXLA 4UVAA 2BY1A 1MIJA 4C9YA 4DJAA 1IZ1A 1OLTA 4L9JA 4XBFA 1REPC 1HKTA 4EJUA 2F4IA 1MZBA 2KRCA 3A01A 2JA7J 3IKTA 3CUQA 3OYAA 1R1VA 2E1OA 2R7OA 2DA6A 3C2GA 4AWXB 3L2QA 2HDCA 4PUSA 2XKPA 2M7BA 1BW5A 3Q9VA 3ZOBA 3IV5A 1QPMA 4RA2A 1IXRC 5DS9A 4HRIA 2M4GA 1AWCA 2LVSA 3SZGA 4V2FA 4UUVA 2EZLA 1A6IA 3NAUA 3DXJF 4KYWA 4ETSA 1I1GA 2DDBA 5FO5A 1QGPA 4KISA 3OIPA 3JTHA 1LE8A 1ZLKA 2Z33A 2EILH 4JX5A 3M7GA 2VQCA 2AXLA 3MZYA 3TKYA 3LA3A 1X4PA 4D5CA 2EV6A 2RAEA 3L09A 1MMAA 1SVLA 3JCUC 4Q5SF 3I3LA 2FNPA 2AO9A 2F5VA 2W57A 2Y31A 1GUUA 1BJAA 3OV8A 1JE8A 2RQPA 2XDVA 4M6YA 2OTLI 2EZIA 3MFKA 3I55I 2EA4A 3VEPA 2GIZA 3QU6A 3C2BA 1T56A 1MJAA 4PSXA 5EF6A 3S16J 2WAQN 1PP8F 4I0BA 4XIDA 4U0VA 5TRDA 1BIBA 1LJ9A 2X6WA 4Y13A 3K4KA 3OYJA 2G7HA 4GXOA 1MDMA 4JYKA 4EVIA 1LB2A 3CCMI 1OJLA 2DW4A 3LAPA 1GHCA 2CV2A 2DK8A 1EH8A 3SZPA 1D3YA 5M3FJ 4ZYEA 3RYPA 3VFZA 2JA8J 3MKLA 1ZG3A 3E6BA 3F8BA 3V7CA 4DYRA 2VE8A 4RAYA 3RI4A 3G3ZA 3K1NA 4G6DA 3DCFA 3BZKA 5FKMA 3ZMTA 4XICA 2ME0A 5BS6A 5KNLA 2VBZA 2KP6A 2M2EA 4A0YA 2QF7A 2JRMA 5FD5A 3MKZA 5LGUA 3BG6A 2OJED 4ZYHA 4E7SA 2LKXA 2JVGA 2P5VA 1IF1A 2FF4A 1PYVA 1RESA 1P4WA 2VJJA 3GW2A 4YEJA 1WZ2A 4CICA 4BE1A 2ECCA 2X85A 3GFLA 4MIMA 9ANTA 3F8FA 3K1PA 3ULQB 4EJWA 4BDZA 3BPXA 4M3BA 1XGNA 3CMEI 3LSKA 3LSHA 2MG4A 1R00A 2DJIA 3B6AA 1VQPI 2PMZN 3JRCA 5FKNA 4RDUA 3HRMA 1FY7A 2B9SA 2WWYA 4LFUA 1ENHA 4Z2YA 4MFDA 2ZXJA 2Z1DA 4OOIA 2FX0A 4GRIA 3OS1A 3GYHX 3S8PA 1U6GA 3BR3A 3GEZA 1MKMA 1HSTA 3QQAA 2VN2A 3IUOA 4XKWA 1AKHB 4IRGA 1MBEA 4E4HA 2P7CB 2IS6A 5E20A 1R5ID 1G3WA 1WKMA 3FISA 4K2EA 3TQNA 3HOZJ 3TOAA 2DFIA 2CMPA 3NEUA 1QVUA 2DDAA 5B3SH 1ON2A 5E3LA 1T08B 4RGXA 4BDYA 1U0JA 2WAQA 2ZNYA 1RIOH 3FK6A 4PJLA 3CUQC 3HIFA 1UG2A 2EA2A 4BXFA 2EWNA 2L9NA 1J0RA 4UNOA 3M8FA 5B5EC 3HSFA 3WE2A 2HOAA 1O7LA 4HNVA 2HVQA 1IO2A 1BN5A 3S2HJ 2V6EA 1MMSA 5D8KB 2Z2SB 1RZ4A 5HLHA 3JRAA 1APLC 5CVJA 2H6CA 3MQ0A 1HCRA 1FC3A 3C7JA 2Z3YA 4OIPF 3J7AY 3HZJA 3IC7A 3H5AA 2L54A 1ZHFA 4XLFA 2LKPA 3KIOA 1VZ0A 3KYCB 2C6YA 5LD2C 1IRZA 2E7XA 5HDNA 3DBLB 3CMAI 2VJ4A 1ONVA 4Z6YA 1N77A 1VQNI 3HRSA 1T0FC 4UVBA 3I56I 5L3DA 3H35A 4BY1J 1QO0D 2XPUA 3ML6A 3OYCA 3WG7H 1EJ9A 2NVYJ 1SFUA 2RC4A 3BG7A 3ZQ7A 1JKOC 1ZYRF 3CC4I 2OF7A 2ZCWA 1FYKA 2O5RA 4UHTA 3JRFA 2VOOA 2PFBA 2OZ6A 5FKOA 1L0OC 3ONQA 4IJAA 4BS9A 2UXNA 3QYFA 5DD8A 4X6AJ 5HLTA 1W4MA 1WFXA 3HKZA 2O03A 2XF5A 3GLLA 4B44A 3LFKA 3CUOA 4Y15A 3K70C 3V7RA 1W36D 2EV0A 2P5LC 2YS9A 3FMSA 2V9PA 2XSDC 3ZP5A 3A03A 1E3OC 2PMZA 3WTVC 2R7QA 2A68F 2HZTA 2QVOA 4LJZF 3CCRI 5F0FA 4Y4RA 1Q1HA 2GOMA 1ZRDA 1OCOH 2R7ZJ 4EJVA 1D1AA 4S05A 2PG4A 4ZYAA 5M3MJ 5IT9K 4HDVA 4L5JA 3IWFA 1R23A 4E7JA 4XLNF 1QZEA 3B6CA 3SJMA 2MFZA 4WXCA 4RLQA 3HGGA 1XGOA 2MABA 1I1SA 4HV6A 2BV6A 4CH7A 4D5FA 4AIHA 2NAZA 1BM9A 2H6BA 2XGCA 1IDYA 5E3NA 3BJAA 3CCUI 3OYGA 1SVOA 4A5MA 1ZRFA 1H8AC 1S7AA 3GLXA 4C2MJ 3J7ZI 1NH3A 1B8IA 4A3BJ 1Z91A 3TGNA 3DQVC 5F64A 1Z77A 4Q4ZF 3JRBA 2K7LA 4PFPA 3K4LA 4Y17A 3V8KA 1R58A 1TT0A 2V4JC 3LSPA 2QGUA 5FFZA 5HODA 1USSA 2A6HF 2IRFG 3ZQIA 2GXGA 4A6DA 4RM2A 5J47A 4FASD 3DEEA 4XRMA 2X48A 1FOKA 5IT3A 3RKQA 5E18F 4DIQA 1X1CA 3FMQA 2F5CA 3F21A 3FIWA 3NWTA 3BLYA 4U0YA 2Q2EB 2LD5A 4ENKA 1POGA 2DQRA 3BG9A 4Y3OA 4XRSG 3BG5A 3HJEA 3RKYA 2MW8A 5FRNA 5H20A 2HVSA 1WRJA 2IEKA 2VC1A 1HBXG 1ZH5A 1SD7A 3ERMA 2FUG2 3SFZA 5ILVA 1SC7A 2ISYA 5LEKA 2CGPA 3OSFA 3I9V2 4OIQF 3GTLJ 1O4XA 3H9JA 3S32A 2WBMA 3JRIA 3S1MJ 1R6RA 2PEXA 5CVRA 3HDDA 1S72I 4KMUX 4DBRA 2YU9J 2OPTA 3LSMA 1UHWA 1I6XA 2BY3A 1XGMA 3ZMDA 4XORA 3RPUA 1GT0C 2EFOA 1V5FA 1DUXC 1B1BA 2QSHX 4YRVA 1Z9CA 1YRNB 4ZDOA 3BC8A 3A2KA 5CJ9A 3E6MA 4XLCA 2V7FA 5GPCA 3I0TA 3HTUA 3ZMUA 4RMNA 2LNBA 5E1ZB 5K7HA 2CQ7A 4I98B 1QQIA 4RM3A 1VQ6I 4YIIA 4I01A 1S7OA 3DWLE 3TO9A 1ETOA 1CF7B 1G2HA 2P7VB 1MD0A 1PVEA 3SHFA 3V8LA 1JKRC 1HOMA 1KZHA 2FBHA 3VODA 1TT5B 3HUGA 1EA3A 4KIGA 2NOGA 4NDLA 1KU2A 3QOPA 3ZRGA 4O3MA 1ZAOA 3GBGA 4EGYA 1H88C 2VC0A 2CWEA 1X3UA 2P4WA 2W85A 5E1WA 4IHVA 1FIAA 4HAMA 3E6DA 1TQPA 2R5YA 1RPWA 2KT0A 4MGRA 4QPQA 2Q0OA 3CF2A 2JWTA 2DQLA 1TL8A 1U2WA 5ILSA 1YIJI 4GO1A 2ESHA 4PFOA 1O57A 5GADJ 1ZREA 3CC2I 4F91B 5M5XJ 5M5YJ 1MMDA 3EDPA 1LKXA 2CUEA 3VB2A 1S8NA 4HNUA 2HZDA 2ECBA 3RJPA 4DQ2A 4AVPA 3H5NA 1TNSA 1ERDA 1E2XA 5DCMB 4ENJA 1U78A 3CP2A 2L7MP 3K4MA 4RB1A 4B3XA 5E3MA 2FOKA 2CW8A 3F6OA 1R71A 4C2TA 2V9KA 3VDXA 2JUCA 1Y8RB 2FJ1A 2KPMA 2ZKZA 5GAHJ 4XM3A 2MA3A 1ON1A 3J81Z 5IPAA 2XB5A 4KA4A 5TJJA 2M7AA 4E6KG 1W5CC 1EKEA 2EZHA 4BXUA 2FU4A 2NS8A 4MHGA 2GBYA 1UMQA 2VQLA 3GXOA 1WJEA 1VFCA 4GYIA 1J5YA 2Y48A 5J1RA 3WGHA 1IAWA 3KZIC 2HXIA 3P9IA 1V5EA 4DNCA 5FLVA 5FLXZ 1MSEC 4UVCA 2DPUA 1GVDA 3CCYA 2KKOA 1TP4A 3PL8A 2XAUA 4XSZF 5L3BA 2IS1A 3JW4A 4PZJA 4NBQA 1FTZA 2L9RA 1R36A 5L3CA 1W7PB 1X3WB 2MBFA 2H1KA 4CGZA 4IRHA 2IA1A 2EQRA 2P0WA 3VOEA 3I4NJ
chains in the Genus database with same CATH topology
4HSRA 1NG6A 1N75A 4BEHB 3ZCOA 3OYAA 2JUGA 2R7VA 4HEA2 3C2GA 2R7OA 2W82A 3L2QA 3W3CA 3VYRB 3PSFA 4PUSA 2M7BA 4B47A 3OYBA 2WY8Q 4ZTFA 1D0ZA 3M1CA 3RPUD 2E1MC 4XMYA 4HRIA 1BOBA 1P9QC 2M4GA 3SZGA 3DU6A 2X1DA 4E7IA 4XKBA 2DXIA 3W2AA 2M0MA 3IAM2 3HOSA 1ZELA 4KISA 3OIPA 1LDKB 3OR1C 3K6GA 2VJIA 4XLAA 2WADA 2L5QA 2AQEA 2MC4A 3S93A 2VIXA 3DTIA 1MNDA 4F93B 1IRXA 1E0EA 3S3NA 4ZC3A 2VQCA 3OYMA 2VPLA 4F52A 4LITA 1X4PA 4KJZA 4IQJA 4CCMA 1X1DA 1MMAA 1BR4A 3I3LA 2OV7A 2F5VA 4C2UA 4LG3A 2CV0A 4XQFA 3DKYA 4H4KC 3MKWB 2XDVA 3BCAA 2JA2A 4J00A 3EPZA 3ZQQA 3HG9A 2W00A 2W4SA 2R7RA 4PSXA 3BCBA 2E5NA 3PNYA 3V42A 2UUZA 4D1QA 2X6WA 3OYJA 3K4KA 3MMYB 2Z16A 3QODA 3PNVA 2KLOA 5KHDA 2HDWA 1J09A 2CV2A 2R4GA 1Z3YA 1YX3A 4N4OB 2W7NA 2CUJA 3VSLA 5FROA 4F3QA 2E1MB 4XONA 2BVMA 4BE2A 4IKFA 3AL0B 3VYTB 2R7TA 5KNLA 2WAEA 2A6TA 2MD0A 3SEZA 2KP6A 2VQHA 1Y6IA 4PSWA 1MNEA 3MKZA 2OUMA 2RREA 3BG6A 2HPMA 3K4CA 4E7SA 2WAFA 3HPHA 2NOJB 2JVGA 2LBFA 3D5SC 1PYVA 4OAZA 2VJJA 4CCNA 4YEJA 1FMVA 4BE1A 2X85A 3H9QA 1W36C 1Z21A 4XLEA 4BQOA 4BDZA 4RLFA 4ZTJA 4XOTA 3LSKA 3FKJA 3NWSA 3LSHA 2DJIA 4NUBA 1WJBA 4X0GA 3AKZA 3OY9A 4LIVA 2HVRA 4BQQA 4ITVA 2VQGA 1BR2A 3TBIA 4BACA 3E0JB 3RTRA 2Z1DA 4GRIA 3OS1A 2M4KA 3OYDA 3S8PA 2L7KA 3KYLA 3IUOA 4XKWA 4BJTA 3DTKA 3HUGB 4E4HA 2IS6A 5HVQC 4CCLA 2VKHA 2VKDA 3AFHA 4PK4A 4BU2A 3U21A 1JI8A 2CMPA 3PNTA 2HNHA 3OWTA 1NG7A 4IQ4A 3H9GA 1DP3A 2BW3B 4BDYA 1U0JA 2WAQA 5KCMA 3OS2A 1Z3XA 4PJLA 1DGWY 4II3A 4DBQA 4BXFA 3K10A 2L9NA 2RNGA 3H5RA 2UWMA 2HVQA 5LFAA 2V6EA 3QYBA 2W1OA 3EUHC 2Z2SB 3DLAA 2KHMA 4B43A 1T95A 3LL7A 3CESA 3ZGKA 3OYHA 2CH0A 1X19A 3RCOA 3A1YA 3J7AY 2L9SA 3H5AA 2V26A 2GOXB 4XLFA 2IS2A 1VZ0A 2QKMB 2DOAA 5LD2C 4E7ZA 3MD2A 5FRMA 4II2A 3L2WA 4E7LA 2VJ4A 5HNFA 5HOOA 1N77A 1T0FC 1AA7A 3H35A 1D0YA 1G59A 3OYCA 3CJQB 3F9KA 3BG7A 2K5CA 5HNHA 2R7SA 4F92B 2O5RA 3W2VA 4IZZA 2HU9A 2ZSHB 4G6TB 3ONQA 4BS9A 3PUBA 4BEHA 3C2HA 3QYFA 1D1BA 2CV1A 5HLTA 1WFXA 3HKZA 3OS0A 2XF5A 2V1NA 2E5ZA 4B44A 2X1CA 3CJRB 3K70C 1W36D 2LY2A 4CUGA 2XSJC 3FBNB 4XN0A 2OC6A 4HNTA 1X1BA 1WJAA 2WB1A 1N78A 3OL4A 2PMZA 1WJDA 2R7QA 4U7BA 4FETA 3CMMA 4Y4RA 2GOMA 1Z7LA 5CQEA 1LVKA 1D1AA 4BGDA 2IGOA 2ZXHA 4ZYAA 3LMMA 4AVZA 2ZFUA 3OL3A 3H0DA 4E7JA 4PJMA 4YELA 2IS4A 2MFZA 4IX7A 1MW7A 4RLQA 4ZDPA 2CFOA 3OR2C 1WJCA 1OR7C 3RSNA 3ZXSA 2MABA 2X6YA 3FBIB 4CH7A 3D5LA 2M3AA 2UV1A 2VLAA 4J01A 4NQWB 3CZ6A 4E7KA 3OYEA 4XKVA 2BVLA 3OYGA 1Y56A 5CPRB 3VSKA 2KMUA 4CZCA 2K9MA 3DKXA 4AYBA 3HOTA 2LY1A 3A4CA 2VB6A 3HC7A 1MMGA 1D0XA 1PJRA 3EUKL 3DQVC 3PSIA 3OYKA 4PFPA 3K4LA 1TT0A 2V4JC 2LRDA 3IAS2 4BE0A 4MLOA 2CW7A 2KRHA 3N05A 2DT6A 3OYNA 4RM2A 3KEYA 4FASD 3DEEA 3OMYA 4DGWB 2IGKA 3FDYA 4DIQA 1X1CA 2VXDA 1QU3A 3PJRA 3NWTA 3BLYA 1S9HA 2Q2EB 2LREA 2L2OA 2IGNA 4Y3OA 4DOZA 2QKLB 3EUAA 3QOEA 4E7HA 2IGMA 4KITB 1LFPA 2R7UA 1D1CA 3K4JA 5FRNA 4XOPA 3UR3C 2HVSA 3L2VA 3S3MA 3TL4X 1WJ5A 2FUG2 2KDOA 4HSTA 3CP8A 4NC7A 4CSWA 4C30A 3I9V2 2X51A 3H9JA 3S32A 2DT7B 2WBMA 1R6RA 3SEQA 4DBRA 4XLHA 3LSMA 2KZVA 3RQ4A 2KQRA 2A5WA 3SYTA 4CCOA 3AL0C 1WJFA 4P5OA 4XORA 2CS3A 3L2UA 3TMOA 1V5FA 4PJJA 3K70D 2JVHA 1BR1A 2LH9A 4BUPA 3UNGC 3IP4B 1K6YA 3M8JA 4YRVA 4ZDOA 3BC8A 3A2KA 5TGTA 1KONA 4XLCA 4Y33A 2V7FA 3E1SA 3DTEA 2LBFB 3G2BA 3ZR8X 4B48A 2XF7A 3HPGA 4RMNA 3SDBA 1MMNA 1SAUA 4RM3A 3OYLA 3DWLE 1GLNA 2KL4A 2X1EA 2ZXIA 3DPLC 4OWRB 4CCJA 3MKYB 2K9LA 4N4NB 4HG2A 2PJRB 1EA3A 1YX5A 2ZSIB 3ZRGA 1UELB 3S3OA 2E60A 3GBGA 3L2RA 2LG4A 2VASA 1TZLA 4R79A 2IXSA 4F55A 1FMWA 3FHNA 2VXZA 3DU5A 2HPIA 1V5GA 2VJ5A 3OOUA 4EATA 4LIUA 1G8XA 2JSPA 2X6XA 3HXLA 5JHFA 1X4OA 2BW3A 4JOMA 2F6CA 4QPQA 4BJ5C 3CF2A 1QHHD 4XNFA 4OAYA 3KX2A 4XL9A 4XR6A 4PFOA 3HL2A 4F91B 3DPUA 3VWBA 2LC2A 1MMDA 4BQNA 2LYCA 4ZJZA 1LKXA 2ELJA 3LSIA 2AQFA 4NNJA 4HNUA 1DQUA 2CUZA 2HZDA 3VYUB 1UAAA 3H5NA 1ERDA 3K4NA 3CP2A 4QPOA 3K4MA 2I8DA 4PJNA 4B3XA 2HQAA 4D9JA 3OYFA 2CW8A 1X1AA 4C2TA 2VL8A 3OIQA 4ZDLA 2V9KA 5CKTA 3VDXA 3K4BA 3W2WA 2KPMA 4XM3A 2WY7Q 2WA0A 1HA8A 2Y0SA 2K3PA 2XC7A 4JQFA 4HPQA 2M7AA 4E6KG 4U87A 2LOOA 2BOLA 4BL0B 4ANJA 3VYSB 4BJ6C 2VQLA 4AU7A 5CQGA 3OYIA 4KT6A 1UG0A 2MYSA 1SFKA 2RQQA 1WJEA 2Q1ZB 2R7WA 2PJRA 3D5RC 1V5EA 3LFUA 2DCEA 3LSGA 4XN3A 4P1WA 4CA0A 4CCKA 3QYEA 3PL8A 1DGRM 2XAUA 2R7XA 1QHGA 2IS1A 1YE9A 3PFYA 4XKCA 4C9YA 4DJAA 1OLTA 2XF6A 2P0WA 2F4IA 3DPTA 2KRCA 4NC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEL A; 
#chains in the Genus database with same CATH topology
 1NG6 A;  3WTT C;  1N75 A;  1UZC A;  2A61 A;  2CRG A;  4M72 A;  2R7V A;  3BRO A;  1YTY A;  1ACI A;  4I2O A;  3JAM K;  2OCC H;  3PSF A;  4B47 A;  2D45 A;  5DDG A;  3S15 J;  3I59 B;  3K1M A;  1SD5 A;  1XCB A;  2OAZ A;  2E2H J;  1U8R A;  3RPU D;  1ETW A;  3I5U A;  2YR2 A;  2NYX A;  1P9Q C;  4MTE A;  5DCF A;  2AXT C;  1X58 A;  2X1D A;  4E7I A;  4IRI A;  1UB9 A;  2PLY A;  2DXI A;  4V19 K;  3W2A A;  4WXH A;  3G6E I;  1ZGW A;  3IAM 2;  2FBI A;  1S29 A;  2JTV A;  1WWX A;  4OU0 A;  2J5P A;  1FYL A;  1LDK B;  3OR1 C;  3K6G A;  3SFI A;  4OIO F;  1UHM A;  2FQ3 A;  2IP2 A;  1UCR A;  2WAD A;  2IA0 A;  2JK3 A;  2L5Q A;  2XGX A;  5F1R A;  1MGT A;  5AIQ A;  1YHQ I;  2HQN A;  2G9W A;  1MND A;  1IRX A;  4UV8 A;  3S3N A;  2UXX A;  1XCV A;  1E0E A;  5E79 C;  3BTL A;  1QVT A;  2GM4 A;  3T8T A;  2VPL A;  4KN4 X;  4IQJ A;  4KJZ A;  3HOU J;  2M8G X;  2VT2 A;  1BR4 A;  5GAG J;  2L9V A;  1BI2 A;  1O3T A;  5C3E J;  4C2U A;  4LG3 A;  3I71 A;  3KEO A;  4H4K C;  4XQF A;  2JZY A;  2W84 A;  3ZQQ A;  2HTJ A;  1SFE A;  2G0E A;  4EQQ A;  2R7R A;  5K5R A;  2QBY A;  2XV4 S;  1DU6 A;  1JHF A;  3ZN0 A;  3E5U A;  5ILU A;  2Z9O A;  1JJ8 C;  4HLX A;  1XB4 A;  2UUZ A;  3W6J B;  4D1Q A;  1RET A;  3G1M A;  2Y9Z A;  2E2J J;  3MMY B;  3QOD A;  1XX5 A;  3PNV A;  2KLO A;  4A5N A;  5L3G A;  1VQ5 I;  2FD5 A;  3WTY C;  2FML A;  2HDW A;  2W48 A;  4L9N A;  4GFB A;  3WU1 B;  3TDU C;  3KZZ A;  1YX3 A;  5HS7 A;  4BXX J;  4N4O B;  2DT5 A;  2XAJ A;  5D5W B;  3LA7 A;  3ABL H;  3KLN A;  1T39 A;  4LD5 A;  2W24 A;  2YUS A;  4HQM A;  2F2E A;  4FE7 A;  3TED A;  2E1M B;  3M07 A;  5J1Y A;  4HF0 A;  5D6F A;  1R5H A;  4IOA F;  2K86 A;  4ZYD A;  1R1T A;  2QSG X;  3P9K A;  1HSJ A;  1L3L A;  2MD0 A;  2XAH A;  3SEZ A;  2VOP A;  4PSW A;  5LBQ A;  4N9I A;  4M3D A;  2JJ7 A;  1LQ1 A;  3K4C A;  3DEW A;  5J4Y A;  4DZP A;  1O7F A;  3TO7 A;  2LBF A;  1LFB A;  2DBB A;  1FMV A;  3DKW A;  2X9D A;  4RS8 A;  2M34 A;  2JA6 J;  5IOY A;  1Z21 A;  3BQZ A;  1R1U A;  4OMZ A;  2ZC2 A;  2VKE A;  2D5V A;  3CDH A;  2GQQ A;  4HYE A;  4ZTJ A;  1H0M A;  5K5O A;  1A5J A;  2VI6 A;  4G6Q A;  4CHU A;  1OYI A;  2CQK A;  2JSC A;  3AG4 H;  3S1N J;  2WB1 N;  2BEO A;  3TP3 A;  1SEU A;  2DFE A;  2PMU A;  2O6G E;  3CJN A;  3PIO F;  2NS7 A;  1UST A;  2KRF A;  3K9T A;  1XS9 A;  4RB0 A;  2HVR A;  1QZY A;  1Z05 A;  3A0B C;  4BQQ A;  3GO5 A;  1QZZ A;  1TBX A;  4ENN A;  3TBI A;  3CCL I;  4MQ9 F;  3RTR A;  5C4J J;  2EPF A;  2IVM A;  2MC3 A;  2M4K A;  3PO3 J;  4QTR A;  3OYD A;  4YFN F;  5EEH A;  2L7K A;  3KYL A;  3H3U A;  1HDP A;  1JXS A;  3DTK A;  2HYF A;  1MJ9 A;  4G8X A;  1MNM C;  3ZN1 A;  2FE3 A;  4PK4 A;  3U21 A;  1JI8 A;  1EH7 A;  3Q3S A;  2M8E A;  1S5L C;  2CSO A;  4IQ4 A;  3O2P E;  5DUI A;  3DBH B;  1IXC A;  2V79 A;  2ME6 A;  2NNN A;  2QEX I;  2VUM J;  1DP3 A;  1B72 B;  1FNN A;  1E3P A;  2BW3 B;  2E2I J;  5KCM A;  3BTJ A;  2E7W A;  1Z3X A;  2XUB A;  2RNG A;  1J59 A;  4RAG A;  1SMT A;  2HOS A;  2UWM A;  3KCC A;  5HS9 A;  1T0F A;  2COB A;  3G73 A;  3DLA A;  5EEA A;  4LOC A;  2KHM A;  2DOE A;  4B43 A;  1T95 A;  1IW7 F;  1BW6 A;  3CES A;  1X19 A;  1KQ9 A;  5ICF A;  2L9S A;  5JVT A;  3DLL F;  1O3Q A;  3BR5 A;  1ETY A;  2GOX B;  2WV0 A;  2Y75 A;  3GME A;  4S0H B;  2DTR A;  3MD2 A;  3O8G A;  3ZQC A;  4IHS A;  4IHT A;  1NTC A;  4EJO A;  4AIJ A;  4E7L A;  2QM3 A;  1YI2 I;  2ADU A;  4EV0 A;  5HOO A;  3WHB A;  3BOQ A;  4AID A;  4P55 A;  5ED4 A;  5EG0 A;  3L1P A;  1D0Y A;  4BKX A;  5F6F A;  3GTJ J;  1G59 A;  4ASN A;  4N0B A;  4UXN A;  3WTX C;  4FT8 A;  3BTC A;  1VQM I;  2MLG A;  3O8H A;  3RYR A;  4F92 B;  2BY2 A;  3W2V A;  1I3A A;  1YW9 A;  1T38 A;  3PUB A;  1IJW C;  4ESJ A;  2ZO4 A;  3OS0 A;  3LWF A;  4A3D J;  2F5E A;  2XKO A;  1SMY F;  2ZNZ A;  1XC5 A;  2R7F A;  2E5Z A;  2NVU B;  2K4J A;  1DPR A;  2Z99 A;  4RGS A;  2LY2 A;  2HKX A;  1FIP A;  2M45 A;  3GTP J;  4BYY A;  2XSJ C;  4M73 A;  4XN0 A;  4LMY A;  4BY7 J;  3MVP A;  4FQG A;  4C3I J;  2WB1 A;  4D0P A;  3OL4 A;  4A12 A;  2COM A;  2YX4 A;  5AIP A;  2K9N A;  1ZKG A;  2FQ4 A;  1J9I A;  1A6Q A;  3IKV A;  3EQL F;  4BGD A;  3LMM A;  1WHU A;  4L0Y B;  1OCT C;  2TCT A;  3QP6 A;  4IX7 A;  1MW7 A;  2NVX J;  1DU0 A;  4NB5 A;  2ZB9 A;  3VPR A;  2QQB A;  4DYC A;  1ZGA A;  3ZXS A;  2X6Y A;  1OKR A;  1FBS A;  2VBX A;  2E35 A;  3FBI B;  1KGS A;  1R9T J;  2Y2Z A;  3OYE A;  4XKV A;  2HFH A;  3DFG A;  3GUD A;  3LAJ A;  3VSK A;  2QUF A;  3DKX A;  2XPW A;  3HOT A;  2H27 A;  2M87 A;  2VB6 A;  1MMG A;  2HQ5 A;  1VQ4 I;  2HYG D;  3PSI A;  2M0C A;  2ID6 A;  4BBS J;  3Q5F A;  1XG1 A;  1ZAR A;  1TTY A;  3CO7 C;  3S17 J;  3F8N A;  2LRD A;  3WHC A;  1G6N A;  4LLN A;  4I02 A;  1RUO A;  5E1X A;  1B6A A;  2CW7 A;  5TIS C;  2KRH A;  3N05 A;  4V2G A;  4OIN F;  1DDN A;  4OMY A;  3PQJ A;  2KIQ A;  3OMY A;  5BOX A;  2CUF A;  3D0S A;  3EET A;  5LHG A;  2IGK A;  2R3S A;  1MH4 A;  4HX8 A;  4WXD A;  1VQO I;  4LG0 B;  1I50 J;  1P4X A;  3PJR A;  2D1V A;  1QU3 A;  1YW7 A;  1VQ9 I;  1JKQ C;  4A3C J;  1RR7 A;  2ACJ A;  2DJN A;  2KJC A;  4LLG F;  3F23 A;  1LFP A;  1D1C A;  1XMA A;  2FSW A;  4DZJ A;  2MGQ A;  1SVM A;  3UR3 C;  5HLG A;  1LPQ A;  5FD6 A;  4FX4 A;  5GTI C;  3HBL A;  1WJ5 A;  4MEX F;  3CP8 A;  3T1B A;  4KIB A;  3GVA A;  2QEN A;  2Y69 H;  4KFC A;  4IXA A;  5LGT A;  1X1P A;  4TV7 A;  3T0Y A;  5H6Q A;  4A3K J;  2JA5 J;  2DT7 B;  4YFX F;  5JFR A;  3FMR A;  3U1D A;  1KQ8 A;  1H9T A;  2XB0 X;  2ZME B;  3H36 A;  3I4M J;  1Z67 A;  4XLH A;  2KZV A;  4H0E A;  3BWG A;  1XN7 A;  1OCZ H;  4CCO A;  1XPX A;  2FNA A;  2LP0 A;  2CS3 A;  2LR8 A;  4L5I A;  3WTS C;  3L2U A;  3I58 A;  4MNU A;  3K70 D;  2NVQ J;  2LH9 A;  4BUP A;  4Q48 A;  3IP4 B;  4R8H A;  2ZJR F;  3F22 A;  1VQ7 I;  2EZK A;  3ELK A;  4UUS B;  4Y33 A;  1RC9 A;  3IRR A;  1X3Z B;  3ZR8 X;  4IHW A;  4G7O F;  3HPG A;  1EV7 A;  1ZK8 A;  1P4A A;  1HW1 A;  3ECO A;  3SDB A;  1FP2 A;  5IT9 Z;  2A3S A;  3OYL A;  4RAZ A;  3KFW X;  2EBI A;  2KL4 A;  4KN7 X;  1YJN I;  3Q0V A;  4OWR B;  4CCJ A;  2RGV A;  4C3H J;  3MKY B;  4N4N B;  1IV8 A;  2G7U A;  1AKH A;  2WC2 A;  4MTD A;  2E19 A;  3BDD A;  3SXY A;  2ZSI B;  1XMK A;  5FB2 A;  3S3O A;  3HHH A;  3CLO A;  2LG4 A;  2CQN A;  1XGS A;  3DBR B;  1YJ9 I;  1HW5 A;  3OOU A;  4EAT A;  2CFX A;  1UJ8 A;  4WWC A;  4LIU A;  1S6L A;  2H8W A;  1OPC A;  1BJZ A;  1X4O A;  1PUE E;  4BJ5 C;  1VTN C;  1LNW A;  4XL9 A;  4XR6 A;  4LB5 A;  3HL2 A;  4KIF A;  3SZT A;  2JQ7 A;  4M6V A;  3K2Z A;  5ICC A;  1OQY A;  1UFM A;  2EK5 A;  2OQG A;  4ZJZ A;  4NNJ A;  2EJR A;  2FOW A;  1RNL A;  1ZQ3 P;  3GFJ A;  1DQU A;  3FXK A;  3ASO H;  4FE4 A;  2J5O A;  4P9F A;  1FP1 D;  2M5W A;  2I8D A;  4PJN A;  3L2C A;  5CYV A;  2E34 A;  4UB8 C;  5DYM A;  2XRO A;  3OYF A;  1I3Q J;  1KYZ A;  1ODD A;  1WCM J;  1X1A A;  2M1B A;  2O7O A;  4ZDL A;  3PO2 J;  3K4B A;  3CF5 F;  3KP2 A;  1Y0N A;  2DTZ A;  2WA0 A;  2K3P A;  4JQF A;  4HPQ A;  2H8R A;  4U87 A;  4PJ0 C;  3K7A J;  2K9S A;  4A3F J;  2BBY A;  4BL0 B;  5GP9 A;  3VYS B;  4BNC A;  2PQ8 A;  1SAN A;  1XDS A;  3OYI A;  2DMP A;  1YLF A;  2X0L A;  2ZXW H;  3KE2 A;  2X6O A;  2KIM A;  3LA2 A;  2B0L A;  2R7W A;  3EYY A;  1RKT A;  3QPL A;  3D5R C;  3H3Z A;  4G94 A;  4S04 A;  5JI6 A;  3DP7 A;  4FIS A;  3FK7 A;  1LEB A;  2LDU A;  4A2U A;  2EB7 A;  4XN3 A;  4B09 A;  3WOD F;  4CCK A;  3QYE A;  3RPQ A;  4A0X A;  1DGR M;  2DA3 A;  2K02 A;  5K7Z A;  1QHG A;  1SFX A;  5CLS A;  2R7X A;  4XKC A;  3L9F A;  3PFY A;  2HS5 A;  2RNJ A;  3S1R J;  4MEY F;  3FKI J;  1W5S A;  3H1C A;  2DYR H;  2EH3 A;  1FPQ A;  2L02 A;  3BR6 A;  2OA4 A;  3V42 A;  1EH6 A;  4HSR A;  3T5X A;  3CTA A;  4BEH B;  4A3J J;  4JP0 A;  1AOY A;  4HEA 2;  2W82 A;  5D5X B;  4G12 A;  1KA8 A;  3N4M A;  4Y52 J;  1AU7 A;  4U88 A;  3OYB A;  2WY8 Q;  4ZTF A;  4XK4 A;  1D0Z A;  1OYY A;  3JRD A;  2R5Z B;  4YIR X;  1AHD P;  1F36 A;  4LK1 F;  4WX9 A;  3ERE D;  2Z5U A;  5ERI A;  2DA5 A;  5B1B H;  1F4K A;  1BOB A;  2V1X A;  3DU6 A;  1T33 A;  3A0H C;  1TC3 C;  5EGO B;  3GTQ J;  4CYC B;  2M0M A;  3FXR A;  4C3J J;  1ZEL A;  4JBA A;  1WSU A;  4HV5 A;  2KJB A;  1T2K A;  3JRE A;  2KDZ A;  2VJI A;  4XLA A;  2AQE A;  2MC4 A;  1UHS A;  1TNT A;  3WE3 A;  3K69 A;  2PMH A;  4ZC3 A;  3KP3 A;  3OYM A;  4J19 A;  3KP5 A;  4F52 A;  4LIT A;  3KP7 A;  1I39 A;  1KU7 A;  2Q8K A;  3CJT B;  4B3A A;  2OV7 A;  2CV0 A;  2DN0 A;  2XHK A;  1TWF J;  4MQV A;  3MKW B;  3E6C C;  3EPZ A;  3CCE I;  2Q2E A;  2W4S A;  4BH9 A;  5HDK A;  1VQ8 I;  2P6S A;  1HQC A;  2OTJ I;  2CO5 A;  3BCB A;  2V1D A;  1B9N A;  3JSO A;  1T8I A;  2OD5 A;  4KDP A;  3QPH A;  3FXO A;  4AUX A;  3LSR A;  3BY6 A;  2Z16 A;  2AS5 F;  5KHD A;  3KEQ A;  3IWZ A;  4I09 A;  2IT0 A;  1W1W E;  3B73 A;  1J09 A;  2F4O B;  4FTH A;  1Z3Y A;  2BGC A;  4LK0 F;  2FBK A;  3H92 A;  5JVG F;  1TW3 A;  2DFF A;  2W7N A;  2ID3 A;  4A93 J;  5E3O A;  3PIP F;  4YFK F;  2CQX A;  1GDT A;  1H9G A;  1SD6 A;  1M1E B;  2AHQ A;  1FTT A;  3RDI A;  3ABK H;  2DA4 A;  4BAY A;  1ULY A;  1FOW A;  2ICW G;  2R7T A;  2XAG A;  3G71 I;  2VQH A;  5F04 A;  3C1D A;  3BR2 A;  1ITY A;  3ABU A;  1MNE A;  3HRT A;  3KYD B;  2OUM A;  1YRN A;  4EJT A;  1KQ0 A;  4GDF A;  3HPH A;  2NOJ B;  2FA5 A;  1SFO J;  4BHC A;  3IH2 A;  4Q47 A;  1A31 A;  5HDG A;  4OAZ A;  1DPU A;  2RV8 A;  1FX7 A;  2BHY A;  2ZME C;  3HYI A;  4UY8 I;  3JAM Z;  2QCO A;  4HDU A;  1CF7 A;  2FXA A;  3H9Q A;  1YYV A;  2DFH A;  5JHU A;  4XLE A;  4RLF A;  1PDN C;  4L5E A;  5EZH A;  1B59 A;  2IJL A;  2CYY A;  1G4D A;  3FKJ A;  4EEF G;  3MZ8 A;  3NWS A;  3RQI A;  3F8M A;  1QNT A;  2JN6 A;  2LK2 A;  2P6T A;  4BBR J;  5J6X A;  2R7D A;  2A07 F;  4X0G A;  3BG3 A;  1FYM A;  5F1J A;  1LEA A;  2BZT A;  4LIV A;  3E3V A;  4O6J A;  1A04 A;  5J8C A;  4ITV A;  2VQG A;  1BR2 A;  5GTH C;  4G7Z F;  1MJB A;  1JUM A;  3SQN A;  3ECH A;  2BXZ A;  4AC0 A;  1JT0 A;  4G9Y A;  5E8I A;  4BJT A;  4RGR A;  3V4G A;  2ZJ2 A;  3AAF A;  1DP7 P;  4CCL A;  4QWQ A;  2VKH A;  2VKD A;  4BU2 A;  1F5T A;  3HSR A;  2LSO A;  4L18 B;  1A36 A;  5LRR A;  2YPR A;  2HNH A;  3OWT A;  3ZMS A;  3I4P A;  1U3E M;  3H9G A;  2FMY A;  3GCM A;  5DCM A;  5M5W J;  4II3 A;  5E8G A;  1W0U A;  4DBQ A;  2HR3 A;  4IOC F;  2KIS A;  3H5R A;  1IRF A;  4WK8 F;  2M30 A;  1FT9 A;  2K85 A;  3EUH C;  3V7S A;  4A3E J;  1IN6 A;  1ZR4 A;  2RKH A;  3HM5 A;  3ZGK A;  3OYH A;  1YFH A;  1ETK A;  3I53 A;  3RCO A;  3A1Y A;  1BIA A;  1K7A A;  2KIU A;  4EM1 A;  3KP4 A;  2V26 A;  2IS2 A;  2QKM B;  1IXS B;  1PP7 U;  5DM7 F;  4E7Z A;  2L4M A;  1G3Y A;  1JJ6 C;  4II2 A;  3L2W A;  5HNF A;  4KNY A;  5KAI C;  1A35 A;  1ZRC A;  1IUY A;  3J7Y J;  6PAX A;  3CD6 I;  3FZV A;  2LKS A;  4IO9 F;  3CJQ B;  3ABT A;  4M3E A;  1W7P A;  2Y9Y A;  2K5C A;  5IP6 A;  2R7S A;  4ENM A;  1PUF B;  1P92 A;  4IZZ A;  2HU9 A;  1T98 A;  4G6T B;  3PUF A;  4F7Z A;  3W6V A;  1FLI A;  3ISP A;  4A3M J;  4U0W A;  1TWC J;  1GXP A;  3JR9 A;  2WTE A;  4ON0 A;  2Y30 A;  4OIR F;  2X1C A;  3CJR B;  4O5V A;  4BQA A;  1T6S A;  2DMU A;  3LST A;  3I59 A;  2F4M B;  1YG2 A;  3OSG A;  5D5U B;  3FBN B;  1X1B A;  1WH7 A;  1WJA A;  3HOV J;  4RB2 C;  1N78 A;  1U9N A;  5DEQ A;  1WJD A;  2NXN B;  3MWM A;  3CMM A;  2UZK A;  4HLY A;  5BPI A;  1WQ2 A;  3A01 B;  1Z7L A;  5CQE A;  3CUQ B;  2O9L A;  4HOB A;  3CLQ A;  1R5G A;  4AVZ A;  1IGN A;  3OL3 A;  3H0D A;  2ZJP F;  1W5T A;  4PJM A;  1WH5 A;  4M9X A;  4YEL A;  2OU2 A;  2GLO A;  2P5K A;  4ZDP A;  3OR2 C;  1Q1V A;  3RZO J;  3M3Y J;  5DM6 F;  3F72 A;  3QAH A;  2I10 A;  2M3A A;  1XSX A;  1WI9 A;  1IN4 A;  1Y39 A;  4IHY A;  3TOB A;  3CZ6 A;  5LHI A;  5C44 J;  1NK2 P;  3G4S I;  2A5Y B;  4G7H F;  4A6E A;  4MO7 A;  3COA C;  1Y56 A;  2KMU A;  2JT1 A;  3NQO A;  4CZC A;  1D8K A;  1LE8 B;  4BHP A;  4CDG A;  2F48 A;  4D7M A;  5EDN A;  2GIV A;  4KIC A;  1PJR A;  2A6E F;  1NK3 P;  3OYK A;  2HKO A;  1V55 H;  1F1Z A;  4ZZL A;  1WVR A;  1CQT A;  3IAS 2;  4BE0 A;  4UUT A;  4MLO A;  2BHZ A;  3WTZ A;  3R4K A;  4DGW B;  1R22 A;  3MEX A;  1IUF A;  1ETV A;  2VT3 A;  1MBK A;  1YJW I;  1QPI A;  3MN2 A;  3ABM H;  2P81 A;  2VXD A;  5KAF C;  1HKS A;  2OZU A;  2QKL B;  3GF2 A;  1LDJ A;  1P2F A;  3QOE A;  4QLC U;  3CO6 C;  4E7H A;  4N9H A;  5L3E A;  3GX4 X;  2R7U A;  1TQM A;  4A69 C;  1MDM B;  5IYD J;  2F5F A;  2KIF A;  2ISZ A;  3X2Q H;  4WCG A;  4L9V A;  3L2V A;  3S3M A;  1FSH A;  2KDO A;  4HST A;  4CSW A;  4NC7 A;  1YO5 C;  4C30 A;  2DOD A;  2P8T A;  3FXM A;  3V8J A;  2HYJ A;  3QPS A;  5A2Q K;  2K40 A;  5JLW A;  2DOF A;  3TO6 A;  2K27 A;  2STT A;  5BMZ A;  1BOA A;  5H2F C;  3RQ4 A;  1U5T B;  3U9G A;  5L3F A;  1KYW A;  4JX6 A;  1WJF A;  4P5O A;  1Z7U A;  1YQA A;  2L01 A;  2DMN A;  3NRV A;  4HX4 A;  2GWR A;  3HOY J;  2JVH A;  4I99 C;  3UNG C;  5B1A H;  3AG2 H;  4KUM A;  2QWW A;  3M8J A;  3IH3 A;  3IHU A;  4IPA A;  4UV9 A;  5TGT A;  2O8K A;  1KON A;  1YIO A;  3UKG A;  3E1S A;  4YG2 F;  3G2B A;  1W7P D;  4PCQ A;  2XF7 A;  3LQQ A;  1P7I A;  1RI7 A;  4B1R A;  3CDL A;  2GZW A;  5FJ8 J;  1MMN A;  3P7N A;  1JUS A;  3S14 J;  1GLN A;  2X1E A;  2ZXI A;  4D7N A;  4WF2 A;  3DPL C;  1YW8 A;  3PFI A;  1YS7 A;  5AON A;  5D4R A;  2K9L A;  4I7H A;  3HEF A;  3H0G J;  2BYV E;  2OBP A;  1MBF A;  1YX5 A;  1RUN A;  4X1E A;  3WGI A;  1HC8 A;  1XD7 A;  1TZL A;  3FXJ A;  4R79 A;  3TDZ C;  3GTM J;  1QA6 A;  1XMX A;  1FMW A;  3FHN A;  4ZZD A;  2VJ5 A;  2DK5 A;  2JSP A;  2OQR A;  2X6X A;  2XVC A;  2BE5 F;  5JHF A;  3O3K A;  1B72 A;  3RZD J;  2BW3 A;  4L0Z B;  4JOM A;  1E17 A;  1J7K A;  4XNF A;  1OIS A;  3CCJ I;  3M4O J;  3VWB A;  1HXD A;  4NC6 A;  4BQN A;  1FWZ A;  5J3L A;  3ESW B;  3DEU A;  3LSI A;  1K83 J;  3LSJ A;  1TWG J;  5HLI A;  2HTS A;  3FF5 A;  4W1U A;  1R49 A;  1J75 A;  2MD5 A;  3WTW C;  1U5T A;  5IYC J;  3HOW J;  2D1H A;  1UAA A;  1JTY A;  1X2N A;  2V9V A;  3L7W A;  5FGM A;  3K4N A;  3WTU C;  4E70 A;  1IC8 A;  1BI3 A;  1IN5 A;  2HQA A;  3KPH A;  3OIQ A;  3BT9 A;  3W2W A;  2JRT A;  3O6B B;  1TW2 A;  2WY7 Q;  4EGZ A;  4RB3 C;  2FRH A;  2XC7 A;  5F0H A;  3MZH A;  2N8G A;  4I0A A;  1GV5 A;  2LOO A;  4ANJ A;  2B63 J;  4BJ6 C;  3HKZ N;  1J2X A;  2NS0 A;  3LOC A;  5CQG A;  2LF8 A;  2MYS A;  1SFK A;  2RQQ A;  3CCS I;  5C4X J;  3OIO A;  4A3L J;  2H09 A;  2DYS H;  3F8C A;  3BJ6 A;  2DMQ A;  2DU9 A;  4JX4 A;  4M74 A;  4ESB A;  3L00 A;  1OCP A;  2DCE A;  1ZN2 A;  3CC7 I;  4P1W A;  5D5V B;  2L7Z A;  1SD4 A;  3AG3 H;  1MBH A;  2ELK A;  2IBD A;  5CVV A;  1YE9 A;  4LGW A;  2O8X A;  1RRJ A;  2LFB A;  4IL6 C;  1K61 A;  1BBY A;  2BXY A;  2XF6 A;  4NC8 A;  3DPT A;  5DD4 A;  3E7L A;  1C0W A;  3ZCO A;  2LMD A;  2JUG A;  3BPV A;  2IA2 A;  3CQZ J;  4NHJ A;  3GZ6 A;  2DI3 A;  1G3S A;  1D8J A;  3W3C A;  3VYR B;  2X4H A;  1D5Y A;  2HDD A;  5CVI A;  1N25 A;  3M1C A;  5GAE J;  4MFE A;  2E1M C;  1BA5 A;  2PJP A;  4XMY A;  3PM1 A;  4R1H A;  1Y1V J;  5KK1 A;  1OYW A;  2QZ8 A;  4XKB A;  2GXB A;  3S2D J;  5E17 F;  5FKL A;  2TDX A;  3HOS A;  1XSD A;  3BP8 A;  1W0T A;  5J4V A;  1HLV A;  2ESN A;  2CJJ A;  1EF4 A;  4CO8 A;  3S93 A;  2VIX A;  3DTI A;  5EEG A;  4F93 B;  1WI3 A;  4XRF A;  3R60 A;  3A02 A;  4JK1 X;  2GAU A;  3WG9 A;  4CZZ A;  3ZMV A;  4A0Z A;  4CCM A;  2VBW A;  1X1D A;  3BZ6 A;  3Q9S A;  5DUK A;  2QQ8 A;  1K6O A;  1VQK I;  2R93 J;  3DKY A;  2L4A A;  5BNG A;  1I5Z A;  3BCA A;  3GWZ A;  2JA2 A;  1RKW A;  1BI0 A;  4J00 A;  4IHX A;  3HG9 A;  1JTX A;  2HOE A;  4LG0 A;  2W00 A;  3F6V A;  1B8I B;  2IW5 A;  1QRY A;  3MCZ A;  3WU2 C;  3JSP A;  2E5N A;  2MH2 A;  3PNY A;  4AM3 A;  1IN8 A;  2M9H A;  2EFP A;  2EFQ A;  1JKP C;  2VOD A;  2A05 A;  4I76 A;  2DMT A;  2K9Q A;  2A69 F;  2ZFW A;  1U9O A;  2R4G A;  1IDZ A;  4Y7N J;  1Z6T A;  5D8L B;  4GGG A;  2IAI A;  3P9C A;  1ZLJ A;  2ZJQ F;  2LLK A;  2CUJ A;  4RBO A;  3VSL A;  5FRO A;  1XTA A;  4HX7 A;  4XLP F;  1LFU P;  2HOT A;  4F3Q A;  4YIF A;  1ETQ A;  1OR7 A;  1HKQ A;  2ZME A;  4XON A;  2BVM A;  4BE2 A;  3FXU A;  3C3W A;  3M1E A;  4IKF A;  1Z0X A;  5BPD A;  3AL0 B;  3VYT B;  5K1Y A;  2PBI A;  3ZQL A;  2WAE A;  2A6T A;  1V3F A;  2DLL A;  1FZP B;  1Y6I A;  2H1L A;  2RRE A;  2HPM A;  2RN7 A;  3LQR A;  2WAF A;  4IF4 A;  2EIM H;  4UUS A;  4HZF A;  3D5S C;  3GTO J;  4CCN A;  4EM0 B;  2EIK H;  3KET A;  1K4T A;  2HXO A;  1Z1D A;  3J7A O;  3B02 A;  5B66 C;  1U5T C;  1W36 C;  2GA2 A;  5HS8 A;  1YS6 A;  2E1N A;  3S1Q J;  4BQO A;  1ZTR A;  2JPB A;  4XOT A;  4W97 A;  3U1K A;  5ICE A;  2O0Y A;  1FJL A;  5LLQ A;  4NUB A;  1D5V A;  1WJB A;  2W25 A;  1YOV B;  2EFW A;  3AKZ A;  5K5Q A;  3OY9 A;  4LB6 B;  1JGS A;  2HQR A;  1F43 A;  3BJO A;  1ORK A;  3HTS B;  3R6S A;  2V1U A;  1V4R A;  4BAC A;  5IYB J;  3E0J B;  4AD9 A;  4M3F A;  1WPK A;  4EM2 A;  1JHH A;  1XSV A;  3ROU A;  5JR3 A;  4A3I J;  1JGG A;  3ASN H;  1X2M A;  4B4C A;  3REO A;  2QYO A;  3HUG B;  5HVQ C;  2FEZ A;  3HSE A;  3AFH A;  2JPC A;  3EUH A;  3C18 A;  3SDG A;  3PNT A;  4L9T A;  1TLH B;  2E71 A;  1GVJ A;  4LLL A;  1NG7 A;  4AYB N;  5BQT A;  4BHB A;  2R5Y B;  2PX9 A;  1TQI A;  2D2W A;  3OS2 A;  1DGW Y;  1VQL I;  3FXQ A;  3K10 A;  1ZGJ A;  3K0L A;  2XGE A;  5EYR A;  3QP5 A;  1BI1 A;  4HBL A;  2GA1 A;  4UB6 C;  5LFA A;  3KLO A;  2W1O A;  3Q0U A;  3QYB A;  3M9A A;  2KFD A;  1LUJ B;  1S3J A;  3LL7 A;  1B4A A;  2CH0 A;  3F0C A;  3BZC A;  4M6X A;  5LGN A;  1MSF C;  3FX3 A;  4HQE A;  2HI3 A;  3R61 A;  1YIT I;  2BY0 A;  4DYQ A;  2DOA A;  3GFM A;  5JLX A;  4AIK A;  3W6K B;  5FRM A;  5GPA A;  1FBU A;  2PN6 A;  3R0A A;  5H6R A;  5DTD A;  5K7F A;  1AA7 A;  2K3F A;  1F9N A;  4GCV A;  1FEX A;  3F9K A;  3ZQG A;  5J8F A;  2GXA A;  1OCR H;  1FSE A;  2DO7 A;  5HNH A;  1QBJ A;  2PI0 A;  5F27 A;  5EJC A;  2ZSH B;  5F08 A;  1V54 H;  4BEH A;  1Y0U A;  3C2H A;  1D1B A;  1RR8 C;  1IRG A;  2CV1 A;  1MBG A;  2V1N A;  3RKX A;  5FLM J;  3FM3 A;  4XRS A;  4CUG A;  2R5Z A;  5LRS A;  1R4N B;  3T8R A;  1HDD C;  1ZR2 A;  2DA1 A;  3BTI A;  2QSF X;  3BQY A;  2QQA A;  2OC6 A;  4ZH4 F;  4HNT A;  3RIR A;  1U8B A;  4PGH A;  3Q0W A;  5EGO A;  3R0J A;  4CYC A;  3CMY A;  4U7B A;  4FET A;  4ABZ A;  5IY5 H;  1STZ A;  1LVK A;  1IG7 A;  2IGO A;  2WV1 A;  1S7E A;  2IPQ X;  2ZXH A;  2DAO A;  1K79 A;  2LTP A;  5CVU A;  4I6Z A;  2QLZ A;  2ZFU A;  2EFN A;  3GTG J;  2R0Q C;  4M9S A;  2MH9 A;  3CCV I;  2IS4 A;  3HRU A;  1FBQ A;  2CFO A;  3E97 A;  4HW0 A;  2YSR A;  1WJC A;  1OR7 C;  3RSN A;  3D5L A;  2UV1 A;  2VLA A;  3ZPL A;  2VPR A;  1KU3 A;  2RDP A;  1R4M B;  4J01 A;  3DV8 A;  4NQW B;  2XIG A;  4E7K A;  2NRA C;  2BVL A;  1IV6 A;  3ZQF A;  3GZ5 A;  3TW6 A;  1ETX A;  1OFC X;  1BL0 A;  5CPR B;  2K9M A;  4AYB A;  3TP0 A;  2LY1 A;  1HF0 A;  3A4C A;  2O3F A;  1BC8 C;  3HC7 A;  2YX7 A;  1D0X A;  3EUK L;  2NVT J;  4RAF A;  2O61 A;  5D4S A;  1CGP A;  3GFI A;  1VF9 A;  2VKV A;  3S2W A;  1LVA A;  2DT6 A;  5DV5 A;  3OYN A;  3IH4 A;  5EZG A;  1K4S A;  2L7F P;  3KEY A;  2R92 J;  4HF2 A;  2CQQ A;  3FDY A;  3HOX J;  1P6R A;  5FKK A;  1FOY A;  3WGG A;  2L0K A;  1S9H A;  2MLK A;  2LRE A;  2L2O A;  2IGN A;  3HHG A;  2STW A;  2QBY B;  4U7D A;  4DOZ A;  2L3D A;  2DA7 A;  3EUA A;  1OMI A;  2IGM A;  4KIT B;  5IP9 J;  2CG4 A;  3K4J A;  4XOP A;  3J80 Z;  3JTG A;  3J81 K;  1MBJ A;  2Y0S N;  2LF7 A;  3AG1 H;  3I64 A;  3TL4 X;  2I5U A;  5LEJ A;  2XAQ A;  1Z6R A;  3D1N I;  1O3S A;  1O3R A;  2X51 A;  3G1L A;  5IP7 J;  1ZG5 A;  3SEQ A;  4ZYG A;  5J40 A;  2RVC A;  2HWV A;  4P96 A;  4B8X A;  5FLX K;  3P5J A;  2KQR A;  2A5W A;  3SYT A;  1Y8Q B;  4CXF A;  3AL0 C;  3QPT A;  3HGY A;  4NQW A;  1IN7 A;  3CCQ I;  4ESF A;  1Y1W J;  2QQ9 A;  3TMO A;  2JMW A;  2TRT A;  4IVN A;  4PJJ A;  1BR1 A;  3GTK J;  1K6Y A;  2KZG A;  3M8E A;  4EMS A;  3HB9 A;  3MAJ A;  1FOX A;  1HW2 A;  5D6E A;  3J80 K;  3DTE A;  4M9Z A;  2B7E A;  2LBF B;  1I27 A;  4B48 A;  3K2A A;  1R7J A;  1VND A;  3EYI A;  1SAU A;  3QU3 A;  4PGG A;  1KU9 A;  2EIN H;  2Y0M A;  5J1U A;  4FHT A;  2YU3 A;  4M71 A;  2LY9 A;  3JRH A;  2VON A;  4HG2 A;  4HF1 A;  1TWA J;  4HA8 A;  4FCY A;  2PJR B;  3ZQH A;  2DA2 A;  4A3G J;  1UEL B;  2XRL A;  2E60 A;  1SAX A;  3PQK A;  4GYG A;  3I54 A;  1H89 C;  4QSH A;  1VI0 A;  3L2R A;  2XGD A;  2VAS A;  5F0C A;  2IXS A;  4F55 A;  2CU7 A;  2VXZ A;  2HPI A;  1V5G A;  3DU5 A;  5IOZ A;  3LNQ A;  1K78 B;  2E1C A;  2V6C A;  1WGX A;  1E3H A;  3BR1 A;  1G8X A;  2XAS A;  4DW6 A;  3QRF F;  3HXL A;  3TW7 A;  2DPD A;  1NHA A;  3FHZ A;  3BR0 A;  1MH3 A;  1LDD A;  2F6C A;  3N97 A;  5FFX A;  1QHH D;  2H94 A;  4P9U A;  4OAY A;  2EV5 A;  3KX2 A;  2HGC A;  3DF8 A;  3IL2 A;  3WU0 A;  3DPU A;  3QWL A;  2LC2 A;  2HEO A;  1G3T A;  2LYC A;  3E5Q A;  2ELJ A;  3KP6 A;  2AQF A;  3GZN B;  2QA4 I;  2CUZ A;  2VBY A;  2ZBK A;  4QIW N;  4IEJ A;  3VYU B;  3RKW A;  2F5D A;  3G1O A;  4PDK A;  4QPO A;  2CW0 F;  2MSY A;  1JT6 A;  1I6H J;  4D9J A;  4FX0 A;  2VE9 A;  1TWH J;  2EIJ H;  2VL8 A;  2E36 A;  5CKT A;  1HA8 A;  2Y0S A;  1XDU A;  3IRQ A;  4CYD A;  3KZY A;  4M3G A;  2NNY A;  3F3X A;  2BOL A;  3JRG A;  2ELH A;  4AU7 A;  3NAR A;  5ICG A;  2XAF A;  4KT5 C;  4KT6 A;  4RGU A;  1UG0 A;  3U2R A;  2Q1Z B;  1PUF A;  5A2Q Z;  3CDI A;  1P7J A;  4KMF A;  2K4B A;  2PJR A;  1GXQ A;  2XRN A;  4XSX F;  5LHH A;  1B9M A;  2OCE A;  2ETH A;  1ZG1 A;  3FM5 A;  3LFU A;  5KVR A;  3ZMZ A;  3FWE A;  3LSG A;  4CA0 A;  1JUP A;  2XPV A;  3E5X A;  1BC7 C;  1GV2 A;  1K78 A;  5EG0 B;  3OOP A;  3H3V K;  1OCC H;  3FXL A;  4UVA A;  2BY1 A;  1MIJ A;  4C9Y A;  4DJA A;  1IZ1 A;  1OLT A;  4L9J A;  4XBF A;  1REP C;  1HKT A;  4EJU A;  2F4I A;  1MZB A;  2KRC A;  3A01 A;  2JA7 J;  3IKT A;  3CUQ A;  3OYA A;  1R1V A;  2E1O A;  2R7O A;  2DA6 A;  3C2G A;  4AWX B;  3L2Q A;  2HDC A;  4PUS A;  2XKP A;  2M7B A;  1BW5 A;  3Q9V A;  3ZOB A;  3IV5 A;  1QPM A;  4RA2 A;  1IXR C;  5DS9 A;  4HRI A;  2M4G A;  1AWC A;  2LVS A;  3SZG A;  4V2F A;  4UUV A;  2EZL A;  1A6I A;  3NAU A;  3DXJ F;  4KYW A;  4ETS A;  1I1G A;  2DDB A;  5FO5 A;  1QGP A;  4KIS A;  3OIP A;  3JTH A;  1LE8 A;  1ZLK A;  2Z33 A;  2EIL H;  4JX5 A;  3M7G A;  2VQC A;  2AXL A;  3MZY A;  3TKY A;  3LA3 A;  1X4P A;  4D5C A;  2EV6 A;  2RAE A;  3L09 A;  1MMA A;  1SVL A;  3JCU C;  4Q5S F;  3I3L A;  2FNP A;  2AO9 A;  2F5V A;  2W57 A;  2Y31 A;  1GUU A;  1BJA A;  3OV8 A;  1JE8 A;  2RQP A;  2XDV A;  4M6Y A;  2OTL I;  2EZI A;  3MFK A;  3I55 I;  2EA4 A;  3VEP A;  2GIZ A;  3QU6 A;  3C2B A;  1T56 A;  1MJA A;  4PSX A;  5EF6 A;  3S16 J;  2WAQ N;  1PP8 F;  4I0B A;  4XID A;  4U0V A;  5TRD A;  1BIB A;  1LJ9 A;  2X6W A;  4Y13 A;  3K4K A;  3OYJ A;  2G7H A;  4GXO A;  1MDM A;  4JYK A;  4EVI A;  1LB2 A;  3CCM I;  1OJL A;  2DW4 A;  3LAP A;  1GHC A;  2CV2 A;  2DK8 A;  1EH8 A;  3SZP A;  1D3Y A;  5M3F J;  4ZYE A;  3RYP A;  3VFZ A;  2JA8 J;  3MKL A;  1ZG3 A;  3E6B A;  3F8B A;  3V7C A;  4DYR A;  2VE8 A;  4RAY A;  3RI4 A;  3G3Z A;  3K1N A;  4G6D A;  3DCF A;  3BZK A;  5FKM A;  3ZMT A;  4XIC A;  2ME0 A;  5BS6 A;  5KNL A;  2VBZ A;  2KP6 A;  2M2E A;  4A0Y A;  2QF7 A;  2JRM A;  5FD5 A;  3MKZ A;  5LGU A;  3BG6 A;  2OJE D;  4ZYH A;  4E7S A;  2LKX A;  2JVG A;  2P5V A;  1IF1 A;  2FF4 A;  1PYV A;  1RES A;  1P4W A;  2VJJ A;  3GW2 A;  4YEJ A;  1WZ2 A;  4CIC A;  4BE1 A;  2ECC A;  2X85 A;  3GFL A;  4MIM A;  9ANT A;  3F8F A;  3K1P A;  3ULQ B;  4EJW A;  4BDZ A;  3BPX A;  4M3B A;  1XGN A;  3CME I;  3LSK A;  3LSH A;  2MG4 A;  1R00 A;  2DJI A;  3B6A A;  1VQP I;  2PMZ N;  3JRC A;  5FKN A;  4RDU A;  3HRM A;  1FY7 A;  2B9S A;  2WWY A;  4LFU A;  1ENH A;  4Z2Y A;  4MFD A;  2ZXJ A;  2Z1D A;  4OOI A;  2FX0 A;  4GRI A;  3OS1 A;  3GYH X;  3S8P A;  1U6G A;  3BR3 A;  3GEZ A;  1MKM A;  1HST A;  3QQA A;  2VN2 A;  3IUO A;  4XKW A;  1AKH B;  4IRG A;  1MBE A;  4E4H A;  2P7C B;  2IS6 A;  5E20 A;  1R5I D;  1G3W A;  1WKM A;  3FIS A;  4K2E A;  3TQN A;  3HOZ J;  3TOA A;  2DFI A;  2CMP A;  3NEU A;  1QVU A;  2DDA A;  5B3S H;  1ON2 A;  5E3L A;  1T08 B;  4RGX A;  4BDY A;  1U0J A;  2WAQ A;  2ZNY A;  1RIO H;  3FK6 A;  4PJL A;  3CUQ C;  3HIF A;  1UG2 A;  2EA2 A;  4BXF A;  2EWN A;  2L9N A;  1J0R A;  4UNO A;  3M8F A;  5B5E C;  3HSF A;  3WE2 A;  2HOA A;  1O7L A;  4HNV A;  2HVQ A;  1IO2 A;  1BN5 A;  3S2H J;  2V6E A;  1MMS A;  5D8K B;  2Z2S B;  1RZ4 A;  5HLH A;  3JRA A;  1APL C;  5CVJ A;  2H6C A;  3MQ0 A;  1HCR A;  1FC3 A;  3C7J A;  2Z3Y A;  4OIP F;  3J7A Y;  3HZJ A;  3IC7 A;  3H5A A;  2L54 A;  1ZHF A;  4XLF A;  2LKP A;  3KIO A;  1VZ0 A;  3KYC B;  2C6Y A;  5LD2 C;  1IRZ A;  2E7X A;  5HDN A;  3DBL B;  3CMA I;  2VJ4 A;  1ONV A;  4Z6Y A;  1N77 A;  1VQN I;  3HRS A;  1T0F C;  4UVB A;  3I56 I;  5L3D A;  3H35 A;  4BY1 J;  1QO0 D;  2XPU A;  3ML6 A;  3OYC A;  3WG7 H;  1EJ9 A;  2NVY J;  1SFU A;  2RC4 A;  3BG7 A;  3ZQ7 A;  1JKO C;  1ZYR F;  3CC4 I;  2OF7 A;  2ZCW A;  1FYK A;  2O5R A;  4UHT A;  3JRF A;  2VOO A;  2PFB A;  2OZ6 A;  5FKO A;  1L0O C;  3ONQ A;  4IJA A;  4BS9 A;  2UXN A;  3QYF A;  5DD8 A;  4X6A J;  5HLT A;  1W4M A;  1WFX A;  3HKZ A;  2O03 A;  2XF5 A;  3GLL A;  4B44 A;  3LFK A;  3CUO A;  4Y15 A;  3K70 C;  3V7R A;  1W36 D;  2EV0 A;  2P5L C;  2YS9 A;  3FMS A;  2V9P A;  2XSD C;  3ZP5 A;  3A03 A;  1E3O C;  2PMZ A;  3WTV C;  2R7Q A;  2A68 F;  2HZT A;  2QVO A;  4LJZ F;  3CCR I;  5F0F A;  4Y4R A;  1Q1H A;  2GOM A;  1ZRD A;  1OCO H;  2R7Z J;  4EJV A;  1D1A A;  4S05 A;  2PG4 A;  4ZYA A;  5M3M J;  5IT9 K;  4HDV A;  4L5J A;  3IWF A;  1R23 A;  4E7J A;  4XLN F;  1QZE A;  3B6C A;  3SJM A;  2MFZ A;  4WXC A;  4RLQ A;  3HGG A;  1XGO A;  2MAB A;  1I1S A;  4HV6 A;  2BV6 A;  4CH7 A;  4D5F A;  4AIH A;  2NAZ A;  1BM9 A;  2H6B A;  2XGC A;  1IDY A;  5E3N A;  3BJA A;  3CCU I;  3OYG A;  1SVO A;  4A5M A;  1ZRF A;  1H8A C;  1S7A A;  3GLX A;  4C2M J;  3J7Z I;  1NH3 A;  1B8I A;  4A3B J;  1Z91 A;  3TGN A;  3DQV C;  5F64 A;  1Z77 A;  4Q4Z F;  3JRB A;  2K7L A;  4PFP A;  3K4L A;  4Y17 A;  3V8K A;  1R58 A;  1TT0 A;  2V4J C;  3LSP A;  2QGU A;  5FFZ A;  5HOD A;  1USS A;  2A6H F;  2IRF G;  3ZQI A;  2GXG A;  4A6D A;  4RM2 A;  5J47 A;  4FAS D;  3DEE A;  4XRM A;  2X48 A;  1FOK A;  5IT3 A;  3RKQ A;  5E18 F;  4DIQ A;  1X1C A;  3FMQ A;  2F5C A;  3F21 A;  3FIW A;  3NWT A;  3BLY A;  4U0Y A;  2Q2E B;  2LD5 A;  4ENK A;  1POG A;  2DQR A;  3BG9 A;  4Y3O A;  4XRS G;  3BG5 A;  3HJE A;  3RKY A;  2MW8 A;  5FRN A;  5H20 A;  2HVS A;  1WRJ A;  2IEK A;  2VC1 A;  1HBX G;  1ZH5 A;  1SD7 A;  3ERM A;  2FUG 2;  3SFZ A;  5ILV A;  1SC7 A;  2ISY A;  5LEK A;  2CGP A;  3OSF A;  3I9V 2;  4OIQ F;  3GTL J;  1O4X A;  3H9J A;  3S32 A;  2WBM A;  3JRI A;  3S1M J;  1R6R A;  2PEX A;  5CVR A;  3HDD A;  1S72 I;  4KMU X;  4DBR A;  2YU9 J;  2OPT A;  3LSM A;  1UHW A;  1I6X A;  2BY3 A;  1XGM A;  3ZMD A;  4XOR A;  3RPU A;  1GT0 C;  2EFO A;  1V5F A;  1DUX C;  1B1B A;  2QSH X;  4YRV A;  1Z9C A;  1YRN B;  4ZDO A;  3BC8 A;  3A2K A;  5CJ9 A;  3E6M A;  4XLC A;  2V7F A;  5GPC A;  3I0T A;  3HTU A;  3ZMU A;  4RMN A;  2LNB A;  5E1Z B;  5K7H A;  2CQ7 A;  4I98 B;  1QQI A;  4RM3 A;  1VQ6 I;  4YII A;  4I01 A;  1S7O A;  3DWL E;  3TO9 A;  1ETO A;  1CF7 B;  1G2H A;  2P7V B;  1MD0 A;  1PVE A;  3SHF A;  3V8L A;  1JKR C;  1HOM A;  1KZH A;  2FBH A;  3VOD A;  1TT5 B;  3HUG A;  1EA3 A;  4KIG A;  2NOG A;  4NDL A;  1KU2 A;  3QOP A;  3ZRG A;  4O3M A;  1ZAO A;  3GBG A;  4EGY A;  1H88 C;  2VC0 A;  2CWE A;  1X3U A;  2P4W A;  2W85 A;  5E1W A;  4IHV A;  1FIA A;  4HAM A;  3E6D A;  1TQP A;  2R5Y A;  1RPW A;  2KT0 A;  4MGR A;  4QPQ A;  2Q0O A;  3CF2 A;  2JWT A;  2DQL A;  1TL8 A;  1U2W A;  5ILS A;  1YIJ I;  4GO1 A;  2ESH A;  4PFO A;  1O57 A;  5GAD J;  1ZRE A;  3CC2 I;  4F91 B;  5M5X J;  5M5Y J;  1MMD A;  3EDP A;  1LKX A;  2CUE A;  3VB2 A;  1S8N A;  4HNU A;  2HZD A;  2ECB A;  3RJP A;  4DQ2 A;  4AVP A;  3H5N A;  1TNS A;  1ERD A;  1E2X A;  5DCM B;  4ENJ A;  1U78 A;  3CP2 A;  2L7M P;  3K4M A;  4RB1 A;  4B3X A;  5E3M A;  2FOK A;  2CW8 A;  3F6O A;  1R71 A;  4C2T A;  2V9K A;  3VDX A;  2JUC A;  1Y8R B;  2FJ1 A;  2KPM A;  2ZKZ A;  5GAH J;  4XM3 A;  2MA3 A;  1ON1 A;  3J81 Z;  5IPA A;  2XB5 A;  4KA4 A;  5TJJ A;  2M7A A;  4E6K G;  1W5C C;  1EKE A;  2EZH A;  4BXU A;  2FU4 A;  2NS8 A;  4MHG A;  2GBY A;  1UMQ A;  2VQL A;  3GXO A;  1WJE A;  1VFC A;  4GYI A;  1J5Y A;  2Y48 A;  5J1R A;  3WGH A;  1IAW A;  3KZI C;  2HXI A;  3P9I A;  1V5E A;  4DNC A;  5FLV A;  5FLX Z;  1MSE C;  4UVC A;  2DPU A;  1GVD A;  3CCY A;  2KKO A;  1TP4 A;  3PL8 A;  2XAU A;  4XSZ F;  5L3B A;  2IS1 A;  3JW4 A;  4PZJ A;  4NBQ A;  1FTZ A;  2L9R A;  1R36 A;  5L3C A;  1W7P B;  1X3W B;  2MBF A;  2H1K A;  4CGZ A;  4IRH A;  2IA1 A;  2EQR A;  2P0W A;  3VOE A;  3I4N J; 
#chains in the Genus database with same CATH homology
 4HSR A;  1NG6 A;  1N75 A;  4BEH B;  3ZCO A;  3OYA A;  2JUG A;  2R7V A;  4HEA 2;  3C2G A;  2R7O A;  2W82 A;  3L2Q A;  3W3C A;  3VYR B;  3PSF A;  4PUS A;  2M7B A;  4B47 A;  3OYB A;  2WY8 Q;  4ZTF A;  1D0Z A;  3M1C A;  3RPU D;  2E1M C;  4XMY A;  4HRI A;  1BOB A;  1P9Q C;  2M4G A;  3SZG A;  3DU6 A;  2X1D A;  4E7I A;  4XKB A;  2DXI A;  3W2A A;  2M0M A;  3IAM 2;  3HOS A;  1ZEL A;  4KIS A;  3OIP A;  1LDK B;  3OR1 C;  3K6G A;  2VJI A;  4XLA A;  2WAD A;  2L5Q A;  2AQE A;  2MC4 A;  3S93 A;  2VIX A;  3DTI A;  1MND A;  4F93 B;  1IRX A;  1E0E A;  3S3N A;  4ZC3 A;  2VQC A;  3OYM A;  2VPL A;  4F52 A;  4LIT A;  1X4P A;  4KJZ A;  4IQJ A;  4CCM A;  1X1D A;  1MMA A;  1BR4 A;  3I3L A;  2OV7 A;  2F5V A;  4C2U A;  4LG3 A;  2CV0 A;  4XQF A;  3DKY A;  4H4K C;  3MKW B;  2XDV A;  3BCA A;  2JA2 A;  4J00 A;  3EPZ A;  3ZQQ A;  3HG9 A;  2W00 A;  2W4S A;  2R7R A;  4PSX A;  3BCB A;  2E5N A;  3PNY A;  3V42 A;  2UUZ A;  4D1Q A;  2X6W A;  3OYJ A;  3K4K A;  3MMY B;  2Z16 A;  3QOD A;  3PNV A;  2KLO A;  5KHD A;  2HDW A;  1J09 A;  2CV2 A;  2R4G A;  1Z3Y A;  1YX3 A;  4N4O B;  2W7N A;  2CUJ A;  3VSL A;  5FRO A;  4F3Q A;  2E1M B;  4XON A;  2BVM A;  4BE2 A;  4IKF A;  3AL0 B;  3VYT B;  2R7T A;  5KNL A;  2WAE A;  2A6T A;  2MD0 A;  3SEZ A;  2KP6 A;  2VQH A;  1Y6I A;  4PSW A;  1MNE A;  3MKZ A;  2OUM A;  2RRE A;  3BG6 A;  2HPM A;  3K4C A;  4E7S A;  2WAF A;  3HPH A;  2NOJ B;  2JVG A;  2LBF A;  3D5S C;  1PYV A;  4OAZ A;  2VJJ A;  4CCN A;  4YEJ A;  1FMV A;  4BE1 A;  2X85 A;  3H9Q A;  1W36 C;  1Z21 A;  4XLE A;  4BQO A;  4BDZ A;  4RLF A;  4ZTJ A;  4XOT A;  3LSK A;  3FKJ A;  3NWS A;  3LSH A;  2DJI A;  4NUB A;  1WJB A;  4X0G A;  3AKZ A;  3OY9 A;  4LIV A;  2HVR A;  4BQQ A;  4ITV A;  2VQG A;  1BR2 A;  3TBI A;  4BAC A;  3E0J B;  3RTR A;  2Z1D A;  4GRI A;  3OS1 A;  2M4K A;  3OYD A;  3S8P A;  2L7K A;  3KYL A;  3IUO A;  4XKW A;  4BJT A;  3DTK A;  3HUG B;  4E4H A;  2IS6 A;  5HVQ C;  4CCL A;  2VKH A;  2VKD A;  3AFH A;  4PK4 A;  4BU2 A;  3U21 A;  1JI8 A;  2CMP A;  3PNT A;  2HNH A;  3OWT A;  1NG7 A;  4IQ4 A;  3H9G A;  1DP3 A;  2BW3 B;  4BDY A;  1U0J A;  2WAQ A;  5KCM A;  3OS2 A;  1Z3X A;  4PJL A;  1DGW Y;  4II3 A;  4DBQ A;  4BXF A;  3K10 A;  2L9N A;  2RNG A;  3H5R A;  2UWM A;  2HVQ A;  5LFA A;  2V6E A;  3QYB A;  2W1O A;  3EUH C;  2Z2S B;  3DLA A;  2KHM A;  4B43 A;  1T95 A;  3LL7 A;  3CES A;  3ZGK A;  3OYH A;  2CH0 A;  1X19 A;  3RCO A;  3A1Y A;  3J7A Y;  2L9S A;  3H5A A;  2V26 A;  2GOX B;  4XLF A;  2IS2 A;  1VZ0 A;  2QKM B;  2DOA A;  5LD2 C;  4E7Z A;  3MD2 A;  5FRM A;  4II2 A;  3L2W A;  4E7L A;  2VJ4 A;  5HNF A;  5HOO A;  1N77 A;  1T0F C;  1AA7 A;  3H35 A;  1D0Y A;  1G59 A;  3OYC A;  3CJQ B;  3F9K A;  3BG7 A;  2K5C A;  5HNH A;  2R7S A;  4F92 B;  2O5R A;  3W2V A;  4IZZ A;  2HU9 A;  2ZSH B;  4G6T B;  3ONQ A;  4BS9 A;  3PUB A;  4BEH A;  3C2H A;  3QYF A;  1D1B A;  2CV1 A;  5HLT A;  1WFX A;  3HKZ A;  3OS0 A;  2XF5 A;  2V1N A;  2E5Z A;  4B44 A;  2X1C A;  3CJR B;  3K70 C;  1W36 D;  2LY2 A;  4CUG A;  2XSJ C;  3FBN B;  4XN0 A;  2OC6 A;  4HNT A;  1X1B A;  1WJA A;  2WB1 A;  1N78 A;  3OL4 A;  2PMZ A;  1WJD A;  2R7Q A;  4U7B A;  4FET A;  3CMM A;  4Y4R A;  2GOM A;  1Z7L A;  5CQE A;  1LVK A;  1D1A A;  4BGD A;  2IGO A;  2ZXH A;  4ZYA A;  3LMM A;  4AVZ A;  2ZFU A;  3OL3 A;  3H0D A;  4E7J A;  4PJM A;  4YEL A;  2IS4 A;  2MFZ A;  4IX7 A;  1MW7 A;  4RLQ A;  4ZDP A;  2CFO A;  3OR2 C;  1WJC A;  1OR7 C;  3RSN A;  3ZXS A;  2MAB A;  2X6Y A;  3FBI B;  4CH7 A;  3D5L A;  2M3A A;  2UV1 A;  2VLA A;  4J01 A;  4NQW B;  3CZ6 A;  4E7K A;  3OYE A;  4XKV A;  2BVL A;  3OYG A;  1Y56 A;  5CPR B;  3VSK A;  2KMU A;  4CZC A;  2K9M A;  3DKX A;  4AYB A;  3HOT A;  2LY1 A;  3A4C A;  2VB6 A;  3HC7 A;  1MMG A;  1D0X A;  1PJR A;  3EUK L;  3DQV C;  3PSI A;  3OYK A;  4PFP A;  3K4L A;  1TT0 A;  2V4J C;  2LRD A;  3IAS 2;  4BE0 A;  4MLO A;  2CW7 A;  2KRH A;  3N05 A;  2DT6 A;  3OYN A;  4RM2 A;  3KEY A;  4FAS D;  3DEE A;  3OMY A;  4DGW B;  2IGK A;  3FDY A;  4DIQ A;  1X1C A;  2VXD A;  1QU3 A;  3PJR A;  3NWT A;  3BLY A;  1S9H A;  2Q2E B;  2LRE A;  2L2O A;  2IGN A;  4Y3O A;  4DOZ A;  2QKL B;  3EUA A;  3QOE A;  4E7H A;  2IGM A;  4KIT B;  1LFP A;  2R7U A;  1D1C A;  3K4J A;  5FRN A;  4XOP A;  3UR3 C;  2HVS A;  3L2V A;  3S3M A;  3TL4 X;  1WJ5 A;  2FUG 2;  2KDO A;  4HST A;  3CP8 A;  4NC7 A;  4CSW A;  4C30 A;  3I9V 2;  2X51 A;  3H9J A;  3S32 A;  2DT7 B;  2WBM A;  1R6R A;  3SEQ A;  4DBR A;  4XLH A;  3LSM A;  2KZV A;  3RQ4 A;  2KQR A;  2A5W A;  3SYT A;  4CCO A;  3AL0 C;  1WJF A;  4P5O A;  4XOR A;  2CS3 A;  3L2U A;  3TMO A;  1V5F A;  4PJJ A;  3K70 D;  2JVH A;  1BR1 A;  2LH9 A;  4BUP A;  3UNG C;  3IP4 B;  1K6Y A;  3M8J A;  4YRV A;  4ZDO A;  3BC8 A;  3A2K A;  5TGT A;  1KON A;  4XLC A;  4Y33 A;  2V7F A;  3E1S A;  3DTE A;  2LBF B;  3G2B A;  3ZR8 X;  4B48 A;  2XF7 A;  3HPG A;  4RMN A;  3SDB A;  1MMN A;  1SAU A;  4RM3 A;  3OYL A;  3DWL E;  1GLN A;  2KL4 A;  2X1E A;  2ZXI A;  3DPL C;  4OWR B;  4CCJ A;  3MKY B;  2K9L A;  4N4N B;  4HG2 A;  2PJR B;  1EA3 A;  1YX5 A;  2ZSI B;  3ZRG A;  1UEL B;  3S3O A;  2E60 A;  3GBG A;  3L2R A;  2LG4 A;  2VAS A;  1TZL A;  4R79 A;  2IXS A;  4F55 A;  1FMW A;  3FHN A;  2VXZ A;  3DU5 A;  2HPI A;  1V5G A;  2VJ5 A;  3OOU A;  4EAT A;  4LIU A;  1G8X A;  2JSP A;  2X6X A;  3HXL A;  5JHF A;  1X4O A;  2BW3 A;  4JOM A;  2F6C A;  4QPQ A;  4BJ5 C;  3CF2 A;  1QHH D;  4XNF A;  4OAY A;  3KX2 A;  4XL9 A;  4XR6 A;  4PFO A;  3HL2 A;  4F91 B;  3DPU A;  3VWB A;  2LC2 A;  1MMD A;  4BQN A;  2LYC A;  4ZJZ A;  1LKX A;  2ELJ A;  3LSI A;  2AQF A;  4NNJ A;  4HNU A;  1DQU A;  2CUZ A;  2HZD A;  3VYU B;  1UAA A;  3H5N A;  1ERD A;  3K4N A;  3CP2 A;  4QPO A;  3K4M A;  2I8D A;  4PJN A;  4B3X A;  2HQA A;  4D9J A;  3OYF A;  2CW8 A;  1X1A A;  4C2T A;  2VL8 A;  3OIQ A;  4ZDL A;  2V9K A;  5CKT A;  3VDX A;  3K4B A;  3W2W A;  2KPM A;  4XM3 A;  2WY7 Q;  2WA0 A;  1HA8 A;  2Y0S A;  2K3P A;  2XC7 A;  4JQF A;  4HPQ A;  2M7A A;  4E6K G;  4U87 A;  2LOO A;  2BOL A;  4BL0 B;  4ANJ A;  3VYS B;  4BJ6 C;  2VQL A;  4AU7 A;  5CQG A;  3OYI A;  4KT6 A;  1UG0 A;  2MYS A;  1SFK A;  2RQQ A;  1WJE A;  2Q1Z B;  2R7W A;  2PJR A;  3D5R C;  1V5E A;  3LFU A;  2DCE A;  3LSG A;  4XN3 A;  4P1W A;  4CA0 A;  4CCK A;  3QYE A;  3PL8 A;  1DGR M;  2XAU A;  2R7X A;  1QHG A;  2IS1 A;  1YE9 A;  3PFY A;  4XKC A;  4C9Y A;  4DJA A;  1OLT A;  2XF6 A;  2P0W A;  2F4I A;  3DPT A;  2KRC A;  4NC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...