1ZELA

Crystal structure of rv2827c protein from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
293
Chain Sequence
b'AMVVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSGESVWAPEYQLVDELVVPLLRVIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Rv2827c
publication title Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 92
structure length 293
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09407 AbiEi_1 AbiEi antitoxin C-terminal domain
A PF13338 AbiEi_4 Transcriptional regulator, AbiEi antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1040 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1zelA01
1ZELA
chains in the Genus database with same CATH superfamily
5DUKA 3CUOA 2BW3A 4HX8A 3L2UA 1IN8A 3EUHA 4PSWA 3OYLA 5LGUA 3ZR8X 1SFXA 2VT3A 1G3TA 5H6QA 5E8IA 3HHGA 2YPRA 4KT5C 2XF6A 2FSWA 3D5LA 3PIPF 1QPIA 1BR1A 4KISA 3S14J 3KCCA 3Q0VA 4NDLA 3V4GA 3FWEA 5D4SA 3ABMH 1H9TA 4DGWB 4E7JA 1P7JA 2VXZA 3BCAA 3CMYA 1MBHA 2A68F 4I0BA 1LE8B 1Z05A 2FD5A 4UHTA 5KHDA 1Y0NA 2ESHA 1FYMA 3KEQA 3SFIA 2VOPA 3A4CA 2XKPA 2VOOA 1HA8A 3G4SI 2DFEA 3R0AA 2DU9A 3ZOBA 3KYLA 5KK1A 2ZXWH 2MBFA 5CQEA 1W7PA 1U3EM 1UG0A 2ZJPF 5JI6A 2WTEA 5FRNA 1RETA 4RGUA 1VQ6I 3PUBA 3HM5A 2ICWG 3R61A 4YFNF 1WJEA 2L7FP 1CGPA 1X19A 2EIJH 1YO5C 3CMMA 3BQZA 4NC8A 5HS9A 1XDSA 4HV6A 1K61A 1S29A 3WODF 2H8RA 2CH0A 1QZZA 3VEPA 2R7UA 3CO7C 3SDGA 4XRSA 3RTRA 4E7HA 1DP7P 3F8NA 4FETA 2QEXI 2CFXA 1J5YA 3CD6I 2IA1A 5CLSA 1MBFA 1AKHB 4P1WA 2DW4A 5M3FJ 5JLWA 1P92A 1R58A 1J0RA 3PFIA 3I0TA 4HA8A 2X85A 1X1DA 2PJRA 1XD7A 3IH4A 1I39A 3VWBA 2IW5A 2MLKA 2Z33A 1UAAA 3DXJF 4OIQF 2YUSA 2R7VA 3WHCA 1Y1WJ 1I3QJ 1S3JA 3ML6A 3HSFA 4BXXJ 2DT5A 4ZZDA 2OCEA 2HQNA 4BXUA 4V19K 3CTAA 1P4WA 3E5UA 4XICA 4OU0A 2VQGA 3I55I 3KP6A 1TBXA 6PAXA 1TTYA 1WQ2A 1RPWA 3S8PA 2ZMEB 4FISA 3Q0WA 1XMXA 1MDMB 1OCOH 4M3GA 2VQLA 3GLLA 3HB9A 3KETA 4PJ0C 4I0AA 2W7NA 2P81A 4A3BJ 2MA3A 3LAPA 2VUMJ 2LY9A 2HPMA 3WTVC 1QVUA 2HI3A 1F1ZA 2DODA 3O6BB 1QZEA 2Y0SN 5B3SH 1OR7C 2ECCA 4BJTA 4UUSA 2M1BA 4A3LJ 3IH2A 3CUQB 3M8JA 1MBEA 1OQYA 4ITVA 2CO5A 3CJNA 3K10A 1FTTA 1WHUA 2VKDA 2AHQA 1REPC 5L3GA 2A07F 4F91B 3C3WA 4RGXA 2LREA 2JUGA 1YG2A 2DAOA 3C1DA 4QWQA 2G0EA 5KVRA 2XAJA 4CCMA 4HLYA 4GXOA 3V8LA 3CCEI 1IUYA 3BTJA 4KNYA 1P7IA 1HBXG 2CQNA 2E35A 3ZRGA 3L2RA 4N9IA 1SMYF 3G71I 2R7SA 4B47A 2E60A 3CLOA 2MC3A 1MMNA 1OPCA 2ZXIA 4XKCA 5HODA 5FO5A 1J09A 2HOEA 2QZ8A 1JUSA 1XSDA 1WJBA 3OYIA 1VQ8I 3PQJA 3HIFA 3OSGA 2BW3B 1OCCH 4IEJA 3BDDA 3E97A 1R36A 2HOSA 1ONVA 2QKLB 3RQ4A 3ZQIA 4HNUA 3I58A 5TGTA 4WX9A 3CCRI 3G1MA 3ZQGA 1J75A 2L54A 2A6TA 4A3EJ 3KLNA 4NB5A 2VLAA 3MQ0A 3GTGJ 2FJ1A 1SVMA 5L3DA 3FZVA 1MJ9A 3K4KA 2ZXJA 3WTWC 1ZELA 3RKXA 4WXCA 1ZHFA 3HC7A 2R7ZJ 1BIAA 1LNWA 2FUG2 3BT9A 3FXKA 4XOTA 2UZKA 5F04A 2A5WA 1YJWI 2L3DA 3VOEA 1EA3A 2LP0A 2V9KA 3WG9A 3DFGA 4BBRJ 4QSHA 5J40A 3SXYA 4A3IJ 4M9XA 5J3LA 3JRCA 5L3EA 1H89C 1FC3A 4CA0A 4I99C 2VQHA 4B43A 1NTCA 2F48A 2LOOA 4G12A 2V4JC 1YFHA 2K4JA 5FKLA 1MJAA 4LIVA 4L5EA 2JVGA 3OYMA 2GXBA 1A6IA 1BIBA 1QHGA 3WGGA 2E2JJ 2VODA 5HS8A 4BE2A 3HPGA 3JRBA 1U5TA 2CQQA 1T33A 3QPTA 3E3VA 1XB4A 3MCZA 5DD4A 1WSUA 1GLNA 1S9HA 2DA1A 3L2QA 1R1UA 2NS8A 1TL8A 2OBPA 4RGSA 1BL0A 3KYCB 5FB2A 2BHYA 1WWXA 2XV4S 4QPQA 4B09A 4AU7A 4CCNA 2XDVA 4AD9A 1ORKA 2L9RA 2H6BA 4HSRA 4M73A 4JX4A 2PG4A 4MNUA 4HPQA 2Y0SA 5HLGA 4EJTA 1WKMA 3R0JA 4XORA 4XIDA 4L5JA 2KP6A 5D6EA 3C2GA 2VPRA 5BNGA 4B3XA 3ZMTA 4XRMA 2E34A 4E7KA 2M0MA 4IRGA 2F5FA 3DEUA 4BDZA 3J7AY 2R5ZA 2PJRB 5GAHJ 2E1NA 3F8MA 2HU9A 3KZIC 4YEJA 4K2EA 4LLGF 2GLOA 4L9TA 2JMWA 2Z2SB 2FE3A 1R1TA 2ZNZA 3F8BA 2OC6A 2LF8A 4WWCA 4XBFA 3ZQCA 2LY1A 2IXSA 4BXFA 3RCOA 2NVTJ 1ETWA 3JRHA 1EH8A 3NRVA 1ZN2A 2WY7Q 1OKRA 4CYDA 1W36C 3EUAA 1MSFC 1ODDA 3LAJA 3A02A 2OD5A 1HSTA 5HLHA 5M5WJ 2EBIA 3A0HC 5CPRB 4BQAA 3H0DA 3DQVC 2JRTA 2HKXA 1LQ1A 2CJJA 4CDGA 3RIRA 3J80K 4ZTFA 4BBSJ 2E19A 2FBHA 3DLLF 1UHMA 1IJWC 3LSMA 2EIKH 4AIKA 2EV6A 1KQ8A 2KZVA 5FLMJ 1MMAA 4E7SA 1R23A 1HXDA 1TWAJ 1IN7A 3A0BC 2HZTA 4ZYGA 3CDIA 1POGA 4ZYDA 2PI0A 4AWXB 3OYKA 1YLFA 1Z6TA 2RGVA 4NC6A 3FHZA 1X4PA 2WB1N 3OL4A 1MMSA 2Z1DA 4PDKA 1S8NA 3CDLA 4A12A 4RAFA 4AIJA 4FTHA 1C0WA 1Q1HA 3K7AJ 3I4PA 4LB5A 4HF1A 1JJ6C 2UWMA 4Z2YA 3T0YA 4Y33A 4EQQA 1ZGWA 2GIZA 3ZQHA 1ZQ3P 4CHUA 1XC5A 1FYLA 3H3UA 1X3UA 1R5GA 1BJAA 4E7IA 2ZKZA 2XGEA 3PUFA 2O0YA 2XUBA 3QPHA 2Q2EB 5GPAA 1LPQA 4FT8A 1MBGA 4CCOA 2KIQA 1GVDA 2L01A 1A35A 1NG6A 3JCUC 2KL4A 5CVJA 3LA7A 1R7JA 1V55H 2X6XA 3LMMA 3CCMI 2V26A 4KN4X 2DDBA 2Q8KA 5EGOA 1T2KA 1YHQI 2IEKA 4Q4ZF 2AQFA 4PZJA 5LBQA 2MABA 2R4GA 1JI8A 1N75A 4HBLA 2DK5A 1U2WA 5E3OA 1YIJI 2QF7A 1DU0A 1ITYA 1HOMA 3KP4A 2D45A 2NNNA 2VE9A 1D5YA 4U0WA 1PP8F 3EDPA 4EJUA 5HOOA 1Y6IA 1W4MA 2M9HA 4J01A 1A6QA 1Z3XA 5E3LA 5EYRA 4J19A 1SC7A 4OIRF 4ZYAA 2BE5F 1ETOA 2O7OA 3QODA 5K5RA 4IF4A 2J5PA 2JA6J 3PJRA 1R22A 4D7NA 3O2PE 5M3MJ 3IHUA 3QPSA 3GTKJ 3BPXA 3ABTA 3BQYA 3K4LA 4LK0F 1U8BA 2V9PA 2H09A 1R4NB 1BN5A 1P6RA 1OYYA 1X2NA 3K4JA 2FQ4A 4BHPA 1U5TB 2ZC2A 5CVVA 4A0YA 3OYJA 4IHVA 3JRAA 5DYMA 2O8KA 2PMZA 3IH3A 2L5QA 3CP8A 2FU4A 1JT0A 4UUTA 2GA1A 3KEOA 1IUFA 4CYCA 2XASA 2CU7A 3N4MA 1DGWY 3MKYB 2KIFA 1IRGA 4ZDOA 4GRIA 4XLCA 4MEYF 3SDBA 3K69A 4LGWA 4M3DA 1JHFA 2CMPA 2RQPA 4FHTA 1H9GA 3M8FA 3X2QH 4WCGA 4YFKF 1LVKA 3SZGA 1YRNA 4A3CJ 1SAUA 3BG3A 2HQ5A 1WJCA 2DFFA 3KLOA 1YYVA 3S3MA 2Y69H 3S17J 2NS7A 2JTVA 2O03A 3WE2A 2R5ZB 1Z91A 2OV7A 1AHDP 2OZUA 2K40A 4KICA 3MD2A 1XN7A 2WB1A 5FFZA 1VF9A 4KA4A 3U1KA 4D5FA 5KNLA 2VQCA 1FOYA 1M1EB 1H88C 1G59A 1BW5A 2DQLA 1I5ZA 3E5QA 1HW1A 2VT2A 3BR5A 3Q9VA 2LFBA 1KQ9A 3D5RC 2VBXA 2QENA 1WCMJ 4CUGA 3WU2C 2DOEA 2R7TA 2HWVA 2R7XA 3SYTA 1P9QC 1BI1A 1N78A 2VB6A 2ZBKA 2LSOA 1D0ZA 1I1SA 2M3AA 2Z3YA 4KT6A 2GXGA 2O5RA 2OTLI 2MD5A 3FXUA 4Y4RA 4I76A 3V7RA 5ILUA 3DCFA 2HVRA 3CLQA 2GQQA 1MSEC 2FMYA 3W6JB 5K7HA 4Y3OA 1Z3YA 2JSCA 3GZNB 2NOGA 1XDUA 1QPMA 2ZMEC 3L09A 4HW0A 5J6XA 1O7LA 5C3EJ 2W1OA 2WADA 4M74A 2WBMA 1I3AA 4PGGA 1LFPA 4QPOA 1MIJA 3HEFA 1ACIA 4X0GA 1X1PA 3HRSA 2W85A 3P7NA 4YELA 1SFEA 1K6YA 3P9KA 4LLLA 1GHCA 5DM7F 1HC8A 5D5XB 2JWTA 3CUQC 2VPLA 3CC2I 2VKHA 2DMUA 3KP5A 3K4MA 2B63J 3RDIA 3RPUD 3GFMA 1GT0C 2KPMA 2KDZA 2DOFA 3KPHA 3SJMA 5FGMA 2A61A 2QWWA 5TJJA 1Y0UA 2BZTA 2EQRA 2KHMA 3N97A 4FASD 2XGXA 3W2AA 1ETXA 4UXNA 5FRMA 5EEGA 3I53A 2IJLA 4Y7NJ 2CSOA 4EJWA 4IHYA 3HJEA 4DBQA 2VN2A 1HF0A 1W5TA 2M2EA 1J59A 1W5CC 2DCEA 1OLTA 4IL6C 2HTSA 1EJ9A 2R7RA 4IOCF 5EGOB 5M5YJ 1MZBA 5J8CA 4O3MA 1ZRDA 4JK1X 2W82A 2NS0A 3CP2A 1ERDA 2XF5A 3FF5A 2CW7A 4AUXA 1VQOI 1RRJA 2NVUB 1VI0A 4HAMA 4HYEA 3DU5A 4D5CA 1IAWA 2EFOA 3O3KA 4MTEA 4MFEA 1RR8C 3OOPA 1ZREA 1MNDA 3QP6A 3HOWJ 3M9AA 1Z67A 2DPUA 2E2IJ 2D2WA 1E3PA 1E2XA 1FEXA 2BOLA 4UY8I 2MYSA 2FNPA 3V7SA 3WTXC 3OS2A 1D3YA 2LRDA 3AL0B 3O8HA 1P2FA 1TW2A 2JZYA 4W1UA 3WU1B 1OCPA 2GWRA 3RZDJ 4IOAF 2DFHA 4MIMA 4D1QA 3LL7A 2CV0A 3TEDA 2OCCH 2DFIA 1XG1A 1X3WB 3SHFA 3T8TA 5F6FA 5BOXA 4D7MA 2EPFA 2X51A 3I54A 3TOAA 3IWFA 2W4SA 3AG2H 1XGOA 4CYCB 1UB9A 1D0YA 1LDJA 2Q1ZB 1VFCA 2EJRA 2Z16A 5LGTA 3M8EA 1PYVA 3GTPJ 3DF8A 1RZ4A 2LH9A 2DA4A 4IVNA 1XMAA 2VJJA 2DTZA 3A1YA 3DTIA 1YRNB 1G6NA 3CCVI 1E0EA 3M3YJ 3QRFF 1DQUA 1ZGAA 4I98B 2RAEA 2X6WA 3S2HJ 2DK8A 4EJOA 4KIGA 3V8JA 2VI6A 1SFUA 1W36D 3TP0A 1QZYA 1YIOA 2ZFUA 4DBRA 2MSYA 1TWCJ 3LOCA 1Z77A 2IGMA 4L0ZB 2GAUA 5K7ZA 3HSRA 1BBYA 3HOYJ 4B44A 2E7XA 3QQAA 5DTDA 2RNJA 1TW3A 2DPDA 2K9SA 4DZPA 5A2QZ 4E4HA 1NG7A 2KJCA 2LTPA 2KIMA 3BOQA 2ZB9A 2FQ3A 2ID3A 4P96A 1T0FA 4DQ2A 4BJ6C 5J4VA 5LGNA 3ABKH 3T1BA 4OIOF 4X6AJ 2R7FA 2CV1A 4BHBA 2XSJC 1HW2A 1U6GA 3HBLA 4M6YA 2V6CA 3JSPA 3JRIA 4BJ5C 1UZCA 2ZNYA 2KIUA 2IAIA 4CO8A 2XB0X 5EJCA 3MKZA 3ROUA 3BG6A 3ZQQA 3CF5F 1S7OA 2FOWA 4XK4A 4A0XA 5IOZA 5B5EC 1YQAA 4H0EA 3LSGA 5IY5H 3KZZA 3GEZA 4PJJA 4XKBA 3UR3C 1Z6RA 2YX7A 1IRXA 3I71A 1ZG5A 5C4XJ 3F8FA 3MZYA 3HTSB 3LSPA 1LEBA 1ON1A 2GOXB 3BTCA 2ADUA 2BBYA 4KJZA 4HRIA 3HGGA 4W97A 1U78A 3ZP5A 2HZDA 1FBSA 3TGNA 3HGYA 1VQPI 2DLLA 3C2HA 4DJAA 2DQRA 4UVAA 4XRSG 3QAHA 3GBGA 3PM1A 1KU9A 3G3ZA 3WU0A 2MGQA 1QHHD 4G7ZF 5J1YA 3QPLA 1FBQA 2DMTA 3CESA 3DPUA 4L5IA 1FOXA 4A93J 2QA4I 2VC1A 2RQQA 4QIWN 5EEAA 4F92B 1YI2I 4BUPA 5LHHA 1IRZA 3DV8A 5L3FA 1IF1A 3DKWA 5E1WA 2VKEA 2IS1A 3K4NA 4BDYA 2QLZA 1B72A 5J1UA 2N8GA 3JTGA 3M1CA 4BS9A 4RB2C 4EEFG 4G6DA 5AONA 4C2MJ 3QOEA 4E70A 2A6EF 5FKKA 1VQ4I 2L9VA 3KX2A 3S2WA 1E3HA 2OA4A 4A6EA 1MW7A 2VONA 2CUFA 5JFRA 5JLXA 4LITA 3S1MJ 4MTDA 1V5GA 2HDDA 3E6MA 3JRFA 3HOXJ 3F21A 1VQKI 3AG1H 2UUZA 3E6CC 5HDNA 3LSRA 1SMTA 3L7WA 1IDYA 2KLOA 4N9HA 3VYSB 2XPVA 3VYRB 3LA3A 4KYWA 2QGUA 4BE1A 2QVOA 2LYCA 1SANA 2EZIA 3GMEA 3R4KA 2DBBA 1XGSA 4R1HA 2VJ5A 3J7ZI 1SFKA 3TO6A 4BHCA 2OQGA 1V5FA 1ULYA 2E1MB 5J8FA 1T56A 2O9LA 1U5TC 1R1VA 1VQ9I 1WPKA 2V1UA 3TP3A 2VL8A 5F0FA 1W0TA 3RYRA 2YU3A 3EETA 2W00A 3E0JB 3W3CA 3K70C 2ZCWA 3HXLA 2F4OB 1LVAA 1WH5A 3IRRA 2B0LA 5GAEJ 3KP2A 3S1NJ 3GFLA 3SZPA 4YRVA 4ENKA 4E7LA 4B3AA 2CRGA 2HOTA 1I27A 1BC8C 2Y9ZA 5C4JJ 2M7AA 3KEYA 4RBOA 2QBYA 3CCYA 4U87A 5AIPA 2DXIA 1LDKB 2FF4A 1BI0A 1TQPA 4XLHA 3OR2C 2EFNA 2X1DA 1BOAA 5IT9Z 3LFUA 3WTYC 2LKXA 1K7AA 2IA0A 2XSDC 1LJ9A 1XGNA 2P5KA 4OOIA 1KQ0A 3G1OA 2ZSIB 1BI2A 5F1RA 3R6SA 3DEEA 4ETSA 4MFDA 3KZYA 1STZA 1W7PB 2ESNA 2IGKA 3QP5A 5KAIC 2CQXA 2OU2A 4RB0A 1JTYA 3HHHA 4GGGA 3H35A 2D5VA 4HEA2 1V4RA 1QBJA 1B1BA 3PNVA 3ERMA 2BXYA 3RKQA 2IT0A 1R71A 3PSFA 1Z7UA 2FBIA 2FOKA 3K2AA 3JAMK 3WTSC 2OZ6A 1DUXC 1D0XA 3B6CA 1ZARA 3AFHA 1YX3A 5FJ8J 3I4NJ 1IW7F 1ZG3A 3OWTA 2OUMA 2HQAA 2KT0A 1U0JA 4G6TB 4S0HB 2NVXJ 1B8IA 1MH4A 5HDGA 3H3VK 3CCUI 4ENJA 5JHFA 1HDPA 3NAUA 1FX7A 1I6XA 2F2EA 4IO9F 3TBIA 3KIOA 1SVOA 4EVIA 1XCVA 2LK2A 1SAXA 3CMAI 1KYZA 1RC9A 2IVMA 3NWTA 4V2GA 2LR8A 3GLXA 3Q9SA 1FOKA 1I6HJ 2XVCA 1MH3A 4A3KJ 2X9DA 3F6VA 4ZYHA 1MD0A 5TISC 3BPVA 3E5XA 5FKOA 3HYIA 3S3OA 3L2WA 2BY2A 4OAYA 5KAFC 4P55A 3RPUA 4EATA 3TO7A 4C2TA 4M71A 2JQ7A 1PUFA 3CJTB 4L0YB 4XLNF 4HX4A 3ZMSA 1W5SA 4I2OA 3FMQA 3BROA 2V1XA 5L3BA 1O3TA 5D5WB 1BM9A 4CCJA 2E7WA 2CQ7A 2X0LA 4G9YA 3SQNA 1BW6A 1O3SA 3EPZA 3JRDA 2XAFA 1O57A 3PL8A 1KYWA 2FNAA 3RI4A 2CYYA 1USSA 1U9OA 1WJ5A 2PMZN 3SEZA 4AIHA 1EH7A 2ID6A 4IHWA 1T08B 2JRMA 3FXOA 2P0WA 3WE3A 1B72B 4LLNA 4RAGA 2QSHX 1MBKA 1TC3C 2W25A 4XQFA 4Q5SF 2PJPA 3C18A 5DS9A 2PMUA 3P9CA 2LY2A 3CCSI 2K86A 4PK4A 1A31A 4C2UA 3GTMJ 2OTJI 2HEOA 2IPQX 2M8EA 2FBKA 3PFYA 4UUSB 1WH7A 1A36A 4XOPA 4TV7A 3WHBA 2HYJA 4WF2A 2M45A 1JXSA 4AC0A 4OMZA 3GVAA 4LD5A 4RB3C 2ZXHA 2AXLA 3GWZA 2VJ4A 4BKXA 3LQRA 1OYWA 2EA2A 2WAQA 5KCMA 5D8KB 1H0MA 1TWHJ 1H8AC 4FQGA 1BR2A 1V54H 2Z5UA 4M6VA 1FMVA 4Z6YA 2B9SA 3L9FA 2IGNA 2DA3A 5DEQA 4GDFA 4Y17A 3K6GA 5GP9A 1U9NA 1QQIA 4N0BA 1Z1DA 1Y8RB 2BHZA 2M8GX 2WV1A 3C2BA 3FXJA 4B8XA 5GAGJ 3S93A 2WV0A 1OJLA 3BG9A 3HOTA 3HOVJ 3FK7A 3AL0C 3VYUB 2FXAA 1JUMA 2NYXA 4P5OA 4CZZA 5JVTA 1DU6A 2ME0A 4KIFA 4RAZA 1PDNC 3AAFA 4BQNA 2G7HA 5HLTA 3ISPA 3OYBA 2RV8A 3F8CA 2V79A 5HS7A 2A69F 1Y39A 1OCZH 4J00A 5BMZA 4B48A 1K79A 4CCLA 5GPCA 1D8JA 5EEHA 2M7BA 2BGCA 1QU3A 1BI3A 2CW8A 2L7ZA 1WJFA 3BC8A 3EUKL 3CCJI 4PCQA 1T98A 4DW6A 2FRHA 3VODA 1J7KA 5LEKA 1VQNI 3QOPA 2W48A 4BY7J 5D4RA 2QSGX 4EMSA 3BTLA 2QQ9A 4KMUX 4A0ZA 3BLYA 5LHGA 1S7EA 1VTNC 4A5MA 2DOAA 2XGCA 1UHSA 2XAGA 3GCMA 3LSIA 3OYNA 2A05A 3BZCA 5EZGA 3H92A 4I01A 4LB6B 5L3CA 3FISA 2ME6A 4C3IJ 2O3FA 3CC7I 3G6EI 5EG0A 3IUOA 4MQVA 5BS6A 4G7OF 1ZRFA 2JK3A 1Y1VJ 1QA6A 3F0CA 2IS4A 4IQJA 2IRFG 1HKQA 2CW0F 4A3GJ 1HLVA 1TQMA 4NHJA 3WGIA 1D5VA 2B7EA 1ETQA 2G9WA 5E1XA 3FXRA 3W6KB 3RKYA 1B8IB 2I5UA 2HQRA 1B59A 1TQIA 5GTHC 4LG3A 3TQNA 2V9VA 2GZWA 3IKVA 5K7FA 3OYCA 1FT9A 1MMGA 3I64A 3KP3A 5LEJA 1VQMI 1T39A 2OAZA 1X1CA 1K78A 5E17F 1FMWA 3VPRA 3TMOA 4IRHA 2P8TA 2Z9OA 2PBIA 4I09A 3HRMA 3F9KA 3PNTA 2BYVE 1IGNA 1DP3A 3QYFA 5ICEA 3LWFA 1RNLA 2H1KA 2HXOA 3L2VA 1ZGJA 1RR7A 1HDDC 4D9JA 1AOYA 1G4DA 5CJ9A 2H94A 3V7CA 3ONQA 1RUNA 1MJBA 5J1RA 1X3ZB 2VC0A 1DDNA 3SEQA 1IXSB 5J47A 2LMDA 1AU7A 1PUFB 2EH3A 4FX0A 1TNTA 1LKXA 1G3SA 3PSIA 4KUMA 3TW7A 1XMKA 2JA5J 3MAJA 5DDGA 3IP4B 1GXPA 2KRCA 3FK6A 5A2QK 1KGSA 5JHUA 2O6GE 1WZ2A 1ETVA 1B6AA 5EZHA 3JSOA 2JSPA 2CFOA 4BY1J 2EFWA 2P7VB 1S7AA 5H6RA 3HDDA 3U9GA 1PJRA 2QCOA 3OYHA 3K1PA 1QNTA 1AWCA 1GXQA 4KFCA 1G2HA 4LIUA 1OMIA 3DTEA 3MKLA 4LOCA 4ZJZA 5TRDA 3U2RA 2X1EA 4I7HA 4C9YA 5LRSA 3BJAA 3LSTA 4NC7A 2DDAA 4G7HF 1LE8A 1ZG1A 5BPDA 3A03A 2LKSA 2DT7B 3P9IA 4ASNA 2X6OA 2RC4A 5JR3A 4XKVA 4YG2F 2R7OA 3IL2A 2GM4A 5IYDJ 3E1SA 2VE8A 4DIQA 1RKTA 4B1RA 1R4MB 3VDXA 1LUJB 4HNVA 3B02A 4PJMA 3HKZN 3E6BA 4AYBN 3IRQA 2IS6A 1R00A 2D1VA 4DZJA 4ENNA 3BTIA 5ERIA 3LA2A 2ISYA 2PEXA 2HYGD 3Q3SA 4XLPF 2Q0OA 2ISZA 2ECBA 4HV5A 4G94A 3H5RA 5IYBJ 4NNJA 1VZ0A 4ZC3A 3ZQFA 3HTUA 4PJNA 3K70D 2J5OA 2YX4A 3L00A 1TT0A 3FDYA 4NQWA 4A3JJ 4RLQA 3CCLI 3J80Z 3GTLJ 5E20A 4XSXF 1JKOC 5DUIA 3MMYB 2M0CA 4IX7A 2A3SA 3OR1C 4C3HJ 2ELHA 2QKMB 4UV8A 1NK3P 1KU2A 2AQEA 1MBJA 2ZFWA 3ZCOA 1L3LA 2LNBA 4XN3A 2VBYA 1KA8A 3FXMA 3H5AA 2HTJA 4C30A 5E79C 4ZZLA 4XN0A 1J9IA 3F6OA 1YS6A 5DCFA 4LMYA 5FROA 3CCQI 2H1LA 3QWLA 2KJBA 2H6CA 1FOWA 3VFZA 3RYPA 1PP7U 2ZJ2A 4HNTA 2PN6A 2E36A 2R7WA 3EUHC 3GTOJ 3H36A 2AO9A 4JYKA 2K5CA 4RAYA 3HZJA 5HLIA 1O3QA 4CSWA 1ZH5A 1UJ8A 3F72A 4WXDA 3TDZC 4HX7A 2E1OA 1LB2A 4UNOA 1KZHA 2M4GA 2BXZA 4IZZA 4Y15A 2O61A 1U8RA 2YR2A 4L18B 4RMNA 3K0LA 4GO1A 4I02A 1SD7A 2UXNA 1XCBA 3Q0UA 4BGDA 5EG0B 4L9VA 1IXRC 4MHGA 2IA2A 3M4OJ 3O8GA 1IV8A 3TL4X 4BH9A 4FX4A 4E6KG 3D1NI 4BU2A 4N4NB 3ERED 1LEAA 2FMLA 1YJNI 3J81Z 1IN6A 2R5YA 3OYAA 3HOUJ 4D0PA 4ZH4F 3CF2A 1DPRA 4CXFA 4IHSA 1X2MA 1D1CA 2P6SA 2AS5F 5JVGF 3BG7A 1UMQA 2JPCA 5HVQC 2ZO4A 2F5VA 1ON2A 2R7DA 4A3MJ 3AG4H 3HG9A 2WA0A 1ETKA 2Y0MA 5J4YA 2L7KA 5IP9J 4M3EA 1R5ID 2LBFA 2XRNA 1I50J 1S6LA 1WI9A 5CVUA 3E6DA 3ASNH 1GDTA 1JKQC 5IT3A 3HKZA 1YW7A 2CUZA 4AYBA 3ABLH 2EILH 2XAQA 2NVQJ 4U0YA 3OYEA 2DMPA 4BQQA 2GA2A 3RPQA 2XB5A 3ZMZA 5IT9K 3L1PA 9ANTA 1Y8QB 4XNFA 4P9FA 1QGPA 5LFAA 5ILVA 4S04A 1MKMA 4OAZA 3MKWB 4MLOA 2V6EA 4DOZA 2PFBA 2CUEA 3H9QA 4M9SA 2PMHA 5IP6A 2OQRA 4EGYA 1MGTA 1JE8A 1TWFJ 4HQMA 5IYCJ 5GTIC 1JKRC 3G1LA 2KFDA 1OFCX 1EV7A 3B73A 3V8KA 4C3JJ 3ZN1A 2BY0A 3BCBA 3FKJA 1XGMA 5ILSA 2HYFA 2VASA 4CH7A 4ZTJA 4YFXF 3BG5A 2LD5A 3ULQB 1QRYA 1BC7C 1Z0XA 1ZKGA 2EFQA 1ZLKA 2RVCA 5FLXZ 3PIOF 3S1RJ 2XAUA 3BY6A 5F27A 5K1YA 3J7AO 2FA5A 3VSKA 4MO7A 2XC7A 1R9TJ 4A3DJ 2QQBA 2RN7A 5B1AH 2M5WA 1PUEE 1FNNA 3OL3A 4XONA 1D8KA 3UNGC 2YS9A 4IRIA 2VJIA 1IRFA 4MGRA 2VBWA 2LC2A 1IG7A 4XM3A 3LSKA 4L9NA 2M87A 5K5QA 3BWGA 1EH6A 1GV5A 2BY3A 1XSXA 4CZCA 3G2BA 5CVIA 2HGCA 4NQWB 1JJ8C 3IAS2 2AXTC 2K9QA 1QO0D 1RI7A 3AG3H 1DPUA 4Q48A 3ZN0A 4A69C 2GOMA 2Z99A 4DYRA 3OYFA 2STTA 2KISA 1ZAOA 1YS7A 1PVEA 4PFPA 2JA7J 5EF6A 2UXXA 1R6RA 2X1CA 1O4XA 4BE0A 2DYSH 4X1EA 1IN4A 5H20A 4U7DA 2EWNA 3GX4X 2EFPA 1MMDA 2O8XA 3D5SC 2XKOA 2LDUA 2ETHA 2G7UA 1WI3A 3B6AA 1AA7A 3HRTA 4UVBA 4H4KC 3HL2A 3OOUA 1W0UA 4II2A 2IS2A 1NH3A 2LG4A 4EM2A 4IQ4A 2EZHA 2LF7A 3ZMDA 2P5LC 2EZLA 2DI3A 2E1CA 4IKFA 3JTHA 3H9GA 1IV6A 4IXAA 2DA6A 4F3QA 2NOJB 1MNEA 3GZ6A 2NVYJ 3FM3A 2KRHA 3ZMUA 4O5VA 3TW6A 1OCRH 4IHXA 3ZGKA 1G3WA 5E1ZB 4ENMA 2YU9J 3F3XA 4PSXA 1IC8A 3S32A 1CF7A 2EV0A 2L02A 2PX9A 2DO7A 5ICCA 4IPAA 3C7JA 3GW2A 5D8LB 3LQQA 4PFOA 3OY9A 2R5YB 3I5UA 2JJ7A 3RQIA 3PNYA 4F93B 1GUUA 1T6SA 1HCRA 1IXCA 3BR2A 1N25A 3ELKA 3U1DA 2K7LA 3HRUA 1YITI 2L0KA 3S16J 1ZK8A 2X6YA 1ZRCA 4IHTA 5H2FC 3S15J 2H8WA 3IWZA 2JVHA 2LBFB 3LNQA 1X4OA 2NAZA 2IBDA 1OYIA 4RB1A 1S72I 4PJLA 4GYGA 3GZ5A 1WVRA 3HPHA 2L9SA 3MZ8A 1JGSA 1VQLI 2ZJRF 1XSVA 4KITB 2DN0A 4R79A 3EYYA 3FXLA 3M07A 3FHNA 3H9JA 2PLYA 2NXNB 5ICGA 3J7YJ 4HZFA 4UB8C 4AM3A 4V2FA 1ZTRA 3VYTB 1L0OC 4G6QA 4ANJA 3FIWA 3ESWB 2EB7A 2QQAA 3GUDA 3OIPA 3OIOA 5D6FA 3JR9A 1ZR2A 2WAQN 2KKOA 1O3RA 2WAEA 1R49A 2DA7A 3DP7A 4HDUA 4EJVA 2X4HA 1WFXA 2Q2EA 4XLFA 4M6XA 5B1BH 3BP8A 3I3LA 2LLKA 1BR4A 1EKEA 1KONA 1SEUA 3QU6A 3CZ6A 2MH9A 3CJRB 2R3SA 3FXQA 3ECOA 4KDPA 3DTKA 4ON0A 1S5LC 1E17A 1F36A 2F5EA 3RSNA 1OR7A 3W6VA 2RDPA 1YE9A 4P9UA 1IN5A 4MEXF 2RREA 4UV9A 3SFZA 2JN6A 3R60A 2K9LA 2NNYA 1FPQA 2ZSHB 3OS1A 1ZYRF 1Q1VA 4Q47A 1GV2A 4A2UA 4R8HA 4WK8F 5LD2C 3M7GA 2MD0A 3FM5A 2E5NA 1FWZA 4LG0A 1F4KA 1ETYA 1RESA 3H3ZA 2K4BA 2JA8J 1VQ7I 3IC7A 5FD6A 1MNMC 2I8DA 3L2CA 1TT5B 3ECHA 3OYDA 1V5EA 2DT6A 4GCVA 2L4MA 2STWA 1D1AA 3WTUC 1EF4A 4AVZA 1F43A 2YSRA 2JUCA 4U0VA 4XSZF 2MW8A 3JRGA 3RZOJ 1YW9A 4XKWA 3I59A 1FZPB 4FE7A 3REOA 3MFKA 4XRFA 5D5VB 1TNSA 2IGOA 1HQCA 3UKGA 3FX3A 2OF7A 4OWRB 2WAFA 4BL0B 5DCMA 3CQZJ 3VSLA 1FJLA 4A5NA 2BEOA 5F64A 5HDKA 3IAM2 1SD6A 2K9MA 4I6ZA 4KIBA 2HOAA 1JTXA 2HVQA 4AIDA 1HSJA 4XLAA 3DEWA 4GFBA 1B4AA 1RIOH 1X58A 3VB2A 3GF2A 3NWSA 1VQ5I 1QVTA 2P7CB 2KRFA 3A01A 3P5JA 1WRJA 4XR6A 4QLCU 2HDCA 2V1NA 1CQTA 3K1NA 3KP7A 3F23A 2DJIA 4E7ZA 5DD8A 2HFHA 2NRAC 2K3PA 3GFJA 1W7PD 1B9NA 1ZLJA 3HSEA 2CUJA 3OIQA 2PQ8A 2D1HA 3LSHA 2VBZA 5E3NA 1F5TA 2K3FA 4JBAA 2GIVA 1UELB 4M72A 1HKTA 1UCRA 2F6CA 2COBA 3I9V2 4KN7X 1CF7B 2BVLA 1K6OA 2COMA 2XF7A 4XL9A 4HDVA 1FIAA 3W2VA 2BY1A 4OMYA 4HG2A 2HPIA 2ACJA 3G73A 4RGRA 4II3A 4L9JA 4HF0A 3BR1A 3DLAA 3MVPA 2V7FA 1E3OC 4A6DA 1XX5A 4DYQA 2RNGA 3DKYA 1R5HA 1G8XA 2HVSA 1FP1D 3CC4I 2XPUA 3FBIB 2A6HF 5B66C 4YIRX 3BZKA 1TP4A 3HUGA 1FBUA 4FE4A 1FY7A 2KQRA 4MQ9F 5CYVA 3FBNB 2MG4A 3ZQLA 4BEHA 3V42A 2K02A 3MZHA 3OMYA 4HF2A 3NQOA 4O6JA 4ZDPA 2ZJQF 1BA5A 3PQKA 3KE2A 4RLFA 4Y13A 1V3FA 2EIMH 4U88A 4U7BA 1ENHA 3OV8A 4A3FJ 2QBYB 3HOSA 1USTA 2GXAA 3JW4A 3DKXA 2K9NA 2MC4A 3QU3A 2DYRH 2QQ8A 4YIFA 3DPTA 4BYYA 2EA4A 2XIGA 5ED4A 1JKPC 4NUBA 3BJ6A 1XS9A 4Y52J 2F4MB 5ICFA 1IO2A 2M34A 4RS8A 1T38A 3ZMVA 1WJDA 1FYKA 3CDHA 2QM3A 3J81K 1UG2A 3OS0A 2HDWA 4F52A 2F5DA 1FLIA 1LFBA 4RM2A 4JX6A 1K83J 1FSEA 1F9NA 2P4WA 3D0SA 1FIPA 1APLC 3T8RA 4JQFA 4AVPA 3WGHA 2WY8Q 1YTYA 1RKWA 2VKVA 2CGPA 2M30A 4LK1F 1T95A 2KMUA 2VIXA 1BOBA 2QUFA 5F0CA 2XROA 5LHIA 4HQEA 4GYIA 3WTZA 3BZ6A 2DA2A 4ABZA 4LG0B 4KMFA 4HLXA 4JOMA 4NBQA 2M4KA 4EGZA 5AIQA 1W1WE 4B4CA 1D1BA 3COAC 1FSHA 2OPTA 4YIIA 2LVSA 4QTRA 2UV1A 1J2XA 3FMSA 4F7ZA 2F4IA 1SVLA 4PUSA 5CKTA 2F5CA 3H1CA 2R7QA 4ESFA 3N05A 1Z9CA 1LDDA 1P4AA 2CS3A 2EK5A 2R92J 1A04A 2A5YB 2W24A 4OIPF 3IKTA 1B9MA 3H5NA 4G8XA 3K1MA 3JAMZ 3I59B 2FEZA 2HR3A 4N4OB 3GYHX 1KU3A 3M1EA 3U21A 3SZTA 4CCKA 1YW8A 2CWEA 5F08A 3TKYA 3JREA 4S05A 2JPBA 2EV5A 5E18F 5DCMB 4M3FA 2EZKA 3S1QJ 1Z7LA 3LFKA 4UVCA 2DA5A 1NHAA 1JGGA 2R93J 2K85A 3FKIJ 3S3NA 1YX5A 3FMRA 3PO3J 3TOBA 4BAYA 4DYCA 2HS5A 4DNCA 2R0QC 3A2KA 1HW5A 3MN2A 4ZYEA 1JUPA 5FD5A 3GFIA 2I10A 4CGZA 1NK2P 5DV5A 4OINF 4CICA 5M5XJ 5GADJ 1UFMA 3F22A 3S2DJ 1TLHB 1IZ1A 3K2ZA 1KU7A 3A01B 5CQGA 5FLXK 2W57A 3TDUC 2XRLA 3DPLC 3CJQB 1HKSA 3QYEA 2ELKA 1A5JA 2FX0A 5HNHA 1SFOJ 4IJAA 3BJOA 1VNDA 2V1DA 5LRRA 3AKZA 3QYBA 3WTTC 2Y30A 2E71A 1N77A 3K9TA 3IV5A 3HOZJ 2H27A 5K5OA 4FCYA 1K4SA 5D5UB 2ELJA 1IDZA 2HXIA 2K27A 1FTZA 1OCTC 2XAHA 3ZQ7A 2MH2A 5F0HA 5F1JA 2L2OA 2WC2A 4UB6C 5FLVA 1XTAA 5LLQA 3KFWX 1ZR4A 5E3MA 3EYIA 4XMYA 4PGHA 2BVMA 1DGRM 1P4XA 1X1BA 1UHWA 2L9NA 5E8GA 2Y48A 2TCTA 3BR6A 3ZXSA 1WGXA 3BR0A 3ASOH 2Y31A 3KYDB 1K4TA 3DBRB 3DBHB 1X1AA 1I1GA 2HKOA 3HUGB 2CV2A 3BR3A 3GO5A 5CVRA 3GTQJ 2JT1A 3EQLF 2IP2A 2P5VA 1YJ9I 4WXHA 4BEHB 4BACA 2C6YA 4EV0A 3RKWA 5BQTA 1G3YA 2VXDA 5FKMA 2DMQA 5BPIA 2XGDA 3I4MJ 2E1MC 4ESJA 1AKHA 1WJAA 3PO2J 3DU6A 5IP7J 1GVJA 2DTRA 3K4BA 4ESBA 1O7FA 1Y56A 2E5ZA 1BJZA 2X48A 4XLEA 3CMEI 1RUOA 1JHHA 4JX5A 1SD5A 5FFXA 2XPWA 1JT6A 5IOYA 3OYGA 2MLGA 1YOVB 4ZDLA 2MFZA 4JP0A 4LJZF 3OSFA 2Y9YA 5C44J 2KZGA 2L7MP 2ZMEA 1SD4A 1XPXA 1MDMA 1TWGJ 4UUVA 3E7LA 2TRTA 3ABUA 4LFUA 1Z21A 3W2WA 4HOBA 3MEXA 4F55A 3Q5FA 1FP2A 3K4CA 4M9ZA 2GBYA 2TDXA 2CQKA 3DBLB 2CG4A 1T0FC 2RKHA 1OISA 2QYOA 3CUQA 4M3BA 5HNFA 2BV6A 3ZPLA 3H0GJ 1LFUP 3T5XA 5DM6F 2DJNA 2HNHA 4HSTA 3GTJJ 1K78B 2LKPA 3MWMA 2XHKA 2QSFX 3RJPA 3WG7H 2JA2A 4RM3A 2E2HJ 4BNCA 2Y75A 3CO6C 2KDOA 2W84A 2WWYA 4BQOA 3LSJA 2P6TA 2DMNA 5FKNA 5IPAA 2Y2ZA 3NEUA 4EM0B 1TZLA 4RA2A 3TO9A 5EDNA 3GXOA 2OJED 3DWLE 4EM1A 3NARA 2EINH 2L4AA 4RDUA 1T8IA 3I56I
chains in the Genus database with same CATH topology
2WB1A 3PFYA 2BW3A 5KNLA 3L2UA 4XOPA 2VQCA 4PSWA 3OYLA 1G59A 3ZR8X 2ZXHA 2VJ4A 2X6YA 2JVHA 3D5RC 2LBFB 1X4OA 2XF6A 2WAQA 5KCMA 4CUGA 2R7XA 2R7TA 3D5LA 1BR2A 4PJLA 1P9QC 3SYTA 1N78A 1FMVA 2VB6A 1BR1A 1D0ZA 3HPHA 2L9SA 2IGNA 4KISA 2M3AA 4KT6A 3K6GA 2O5RA 4Y4RA 4DGWB 4KITB 4E7JA 2VXZA 4R79A 2HVRA 3BCAA 3FHNA 3H9JA 3S93A 3HOTA 4Y3OA 3AL0C 3VYUB 1Z3YA 4P5OA 5KHDA 3VYTB 4ANJA 3OIPA 4BQNA 2W1OA 2WADA 5HLTA 2WAEA 3A4CA 2WBMA 3OYBA 1HA8A 1WFXA 4XLFA 3KYLA 1LFPA 3I3LA 4QPOA 4J00A 4X0GA 1BR4A 1KONA 4B48A 5CQEA 4YELA 3CZ6A 4CCLA 1K6YA 3CJRB 1UG0A 5FRNA 2M7BA 3DTKA 3PUBA 1QU3A 2CW8A 2VPLA 2VKHA 3RSNA 1WJEA 1WJFA 3BC8A 3EUKL 3K4MA 1YE9A 3RPUD 1X19A 2KPMA 3CMMA 4NC8A 2RREA 2K9LA 2KHMA 2ZSHB 4FASD 3OS1A 3W2AA 2CH0A 5FRMA 5LD2C 2R7UA 3BLYA 2MD0A 2DOAA 2E5NA 4DBQA 3RTRA 3LSIA 3OYNA 4E7HA 4FETA 2DCEA 1OLTA 2I8DA 3IUOA 2R7RA 2IS4A 3OYDA 4IQJA 1V5EA 2DT6A 4P1WA 1D1AA 2W82A 3CP2A 4AVZA 1ERDA 2XF5A 2CW7A 2X85A 1X1DA 4XKWA 3DU5A 2PJRA 3VWBA 2IGOA 1UAAA 4OWRB 4BL0B 1MNDA 2WAFA 4LG3A 3OYCA 2R7VA 1MMGA 1X1CA 3VSLA 1FMWA 2BOLA 3TMOA 2MYSA 3OS2A 2VQGA 2LRDA 3AL0B 3F9KA 3IAM2 2K9MA 3PNTA 1DP3A 3S8PA 3QYFA 2HVQA 4XLAA 3L2VA 2VQLA 4D9JA 2W7NA 3NWSA 3ONQA 4D1QA 3LL7A 2HPMA 2CV0A 3SEQA 4XR6A 2V1NA 1OR7C 4BJTA 1LKXA 3PSIA 2DJIA 2X51A 4E7ZA 3M8JA 2W4SA 3IP4B 2K3PA 2KRCA 4ITVA 1D0YA 2Q1ZB 3K10A 2CUJA 3OIQA 2VKDA 2JSPA 2CFOA 2Z16A 1PYVA 4F93B 4F91B 3LSHA 2LREA 2JUGA 2LH9A 1PJRA 1UELB 3OYHA 2F6CA 4CCMA 2VJJA 3A1YA 3I9V2 3DTIA 4LIUA 4ZJZA 2BVLA 3DTEA 1E0EA 2XF7A 4XL9A 1DQUA 2X1EA 3W2VA 3L2RA 3ZRGA 4HG2A 2HPIA 2R7SA 2X6WA 4C9YA 4II3A 4B47A 2E60A 3DLAA 1MMNA 4NC7A 2ZXIA 4XKCA 2V7FA 1J09A 1W36D 2DT7B 1WJBA 2ZFUA 4DBRA 3OYIA 2IGMA 2RNGA 4XKVA 2R7OA 3DKYA 2BW3B 1G8XA 3E1SA 2HVSA 4B44A 4DIQA 3FBIB 3VDXA 2QKLB 3RQ4A 4PJMA 2IS6A 4HNUA 5TGTA 4E4HA 1NG7A 2KQRA 2A6TA 3FBNB 4BEHA 3V42A 2VLAA 4BJ6C 3OMYA 3H5RA 4ZDPA 4NNJA 1VZ0A 4RLFA 2CV1A 4ZC3A 3K4KA 4PJNA 3K70D 2XSJC 4U7BA 1ZELA 1TT0A 3FDYA 3HOSA 4RLQA 3HC7A 4BJ5C 2FUG2 3DKXA 4XOTA 2A5WA 2MC4A 3MMYB 4IX7A 1EA3A 3OR1C 2V9KA 2QKMB 3DPTA 3MKZA 3BG6A 3ZQQA 2AQEA 3ZCOA 4NUBA 4XN3A 4CA0A 3H5AA 2VQHA 4C30A 3LSGA 4B43A 4PJJA 2LOOA 4XN0A 4XKBA 5FROA 1WJDA 3UR3C 2V4JC 1IRXA 4LIVA 3OS0A 2HDWA 2GOXB 4KJZA 2JVGA 4F52A 3OYMA 4HNTA 4HRIA 4RM2A 2R7WA 3EUHC 1QHGA 4BE2A 2HZDA 3HPGA 2K5CA 3C2HA 4JQFA 4DJAA 2WY8Q 1GLNA 4CSWA 1S9HA 3L2QA 1T95A 2KMUA 2VIXA 3GBGA 1BOBA 2M4GA 4IZZA 4QPQA 4AU7A 4CCNA 2XDVA 1QHHD 4JOMA 4RMNA 2M4KA 4HSRA 3CESA 4BGDA 1D1BA 3DPUA 4HPQA 2Y0SA 2UV1A 2F4IA 2RQQA 4PUSA 4XORA 5CKTA 3TL4X 4F92B 2R7QA 3N05A 4BUPA 4E6KG 2KP6A 4BU2A 2CS3A 4N4NB 3C2GA 4B3XA 2IS1A 3K4NA 4BDYA 4E7KA 2M0MA 3H5NA 3OYAA 3CF2A 4BDZA 3M1CA 4BS9A 4N4OB 3J7AY 2PJRB 4CCKA 3U21A 2HU9A 1D1CA 3QOEA 4YEJA 2Z2SB 3KX2A 3BG7A 5HVQC 1Z7LA 2F5VA 3HG9A 2WA0A 1MW7A 2OC6A 3S3NA 4LITA 1YX5A 2LY1A 2L7KA 1V5GA 2IXSA 2LBFA 4BXFA 2UUZA 3RCOA 3A2KA 2WY7Q 1W36C 3EUAA 2KLOA 3VYSB 3HKZA 5CPRB 3VYRB 2CUZA 3DQVC 4AYBA 3H0DA 4BE1A 2LYCA 3OYEA 5CQGA 4BQQA 4ZTFA 3DPLC 3CJQB 2VJ5A 1SFKA 3QYEA 4XNFA 5LFAA 5HNHA 3LSMA 1V5FA 2E1MB 4OAZA 3MKWB 4MLOA 2V6EA 4DOZA 2KZVA 3AKZA 1MMAA 3H9QA 3QYBA 4E7SA 2VL8A 1N77A 3K70C 2W00A 3E0JB 3W3CA 3HXLA 2ELJA 3OYKA 1X4PA 3OL4A 4YRVA 4E7LA 2Z1DA 3BCBA 3FKJA 2L2OA 2VASA 2M7AA 3KEYA 4CH7A 4ZTJA 2UWMA 4U87A 4Y33A 2DXIA 4XMYA 2BVMA 1DGRM 1LDKB 1X1BA 2L9NA 3ZXSA 4XLHA 3OR2C 2XAUA 2X1DA 4E7IA 3VSKA 3LFUA 2XC7A 2Q2EB 3OL3A 4XONA 3UNGC 1X1AA 3HUGB 2VJIA 2CV2A 2ZSIB 4CCOA 3DEEA 1NG6A 4BEHB 2KL4A 2IGKA 4BACA 2LC2A 2X6XA 3H35A 3LMMA 2V26A 4HEA2 3LSKA 4XM3A 2VXDA 2AQFA 3PNVA 2E1MC 2MABA 2R4GA 1WJAA 1JI8A 1N75A 3DU6A 3PSFA 4CZCA 3G2BA 1D0XA 4NQWB 3K4BA 3AFHA 1YX3A 3IAS2 3OWTA 1Y56A 2OUMA 5HOOA 2E5ZA 2HQAA 1Y6IA 1U0JA 2GOMA 4G6TB 4J01A 4XLEA 1Z3XA 5JHFA 4ZYAA 3QODA 3OYFA 3PJRA 3TBIA 4PFPA 3OYGA 1R6RA 2X1CA 3K4LA 3NWTA 4ZDLA 2MFZA 4BE0A 3MD2A 1MMDA 3D5SC 1AA7A 4H4KC 3K4JA 3OYJA 3HL2A 3S3OA 1Z21A 3OOUA 3W2WA 4II2A 4OAYA 4F55A 3L2WA 2IS2A 2LG4A 4IQ4A 3K4CA 2PMZA 4EATA 2L5QA 4C2TA 3CP8A 4IKFA 1T0FC 3H9GA 5HNFA 4F3QA 2NOJB 1MNEA 2HNHA 1DGWY 4HSTA 4CCJA 3MKYB 2KRHA 4ZDOA 4GRIA 4XLCA 3SDBA 3EPZA 2CMPA 3ZGKA 2JA2A 4RM3A 3PL8A 4PSXA 3S32A 2KDOA 1LVKA 3SZGA 4BQOA 1WJ5A 3SEZA 1SAUA 3S3MA 1WJCA 2P0WA 3OY9A 4PFOA 4XQFA 1TZLA 2OV7A 3PNYA 3DWLE 2LY2A 4PK4A 4C2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEL A; 
#chains in the Genus database with same CATH topology
 5DUK A;  3CUO A;  2BW3 A;  4HX8 A;  3L2U A;  1IN8 A;  3EUH A;  4PSW A;  3OYL A;  5LGU A;  3ZR8 X;  1SFX A;  2VT3 A;  1G3T A;  5H6Q A;  5E8I A;  3HHG A;  2YPR A;  4KT5 C;  2XF6 A;  2FSW A;  3D5L A;  3PIP F;  1QPI A;  1BR1 A;  4KIS A;  3S14 J;  3KCC A;  3Q0V A;  4NDL A;  3V4G A;  3FWE A;  5D4S A;  3ABM H;  1H9T A;  4DGW B;  4E7J A;  1P7J A;  2VXZ A;  3BCA A;  3CMY A;  1MBH A;  2A68 F;  4I0B A;  1LE8 B;  1Z05 A;  2FD5 A;  4UHT A;  5KHD A;  1Y0N A;  2ESH A;  1FYM A;  3KEQ A;  3SFI A;  2VOP A;  3A4C A;  2XKP A;  2VOO A;  1HA8 A;  3G4S I;  2DFE A;  3R0A A;  2DU9 A;  3ZOB A;  3KYL A;  5KK1 A;  2ZXW H;  2MBF A;  5CQE A;  1W7P A;  1U3E M;  1UG0 A;  2ZJP F;  5JI6 A;  2WTE A;  5FRN A;  1RET A;  4RGU A;  1VQ6 I;  3PUB A;  3HM5 A;  2ICW G;  3R61 A;  4YFN F;  1WJE A;  2L7F P;  1CGP A;  1X19 A;  2EIJ H;  1YO5 C;  3CMM A;  3BQZ A;  4NC8 A;  5HS9 A;  1XDS A;  4HV6 A;  1K61 A;  1S29 A;  3WOD F;  2H8R A;  2CH0 A;  1QZZ A;  3VEP A;  2R7U A;  3CO7 C;  3SDG A;  4XRS A;  3RTR A;  4E7H A;  1DP7 P;  3F8N A;  4FET A;  2QEX I;  2CFX A;  1J5Y A;  3CD6 I;  2IA1 A;  5CLS A;  1MBF A;  1AKH B;  4P1W A;  2DW4 A;  5M3F J;  5JLW A;  1P92 A;  1R58 A;  1J0R A;  3PFI A;  3I0T A;  4HA8 A;  2X85 A;  1X1D A;  2PJR A;  1XD7 A;  3IH4 A;  1I39 A;  3VWB A;  2IW5 A;  2MLK A;  2Z33 A;  1UAA A;  3DXJ F;  4OIQ F;  2YUS A;  2R7V A;  3WHC A;  1Y1W J;  1I3Q J;  1S3J A;  3ML6 A;  3HSF A;  4BXX J;  2DT5 A;  4ZZD A;  2OCE A;  2HQN A;  4BXU A;  4V19 K;  3CTA A;  1P4W A;  3E5U A;  4XIC A;  4OU0 A;  2VQG A;  3I55 I;  3KP6 A;  1TBX A;  6PAX A;  1TTY A;  1WQ2 A;  1RPW A;  3S8P A;  2ZME B;  4FIS A;  3Q0W A;  1XMX A;  1MDM B;  1OCO H;  4M3G A;  2VQL A;  3GLL A;  3HB9 A;  3KET A;  4PJ0 C;  4I0A A;  2W7N A;  2P81 A;  4A3B J;  2MA3 A;  3LAP A;  2VUM J;  2LY9 A;  2HPM A;  3WTV C;  1QVU A;  2HI3 A;  1F1Z A;  2DOD A;  3O6B B;  1QZE A;  2Y0S N;  5B3S H;  1OR7 C;  2ECC A;  4BJT A;  4UUS A;  2M1B A;  4A3L J;  3IH2 A;  3CUQ B;  3M8J A;  1MBE A;  1OQY A;  4ITV A;  2CO5 A;  3CJN A;  3K10 A;  1FTT A;  1WHU A;  2VKD A;  2AHQ A;  1REP C;  5L3G A;  2A07 F;  4F91 B;  3C3W A;  4RGX A;  2LRE A;  2JUG A;  1YG2 A;  2DAO A;  3C1D A;  4QWQ A;  2G0E A;  5KVR A;  2XAJ A;  4CCM A;  4HLY A;  4GXO A;  3V8L A;  3CCE I;  1IUY A;  3BTJ A;  4KNY A;  1P7I A;  1HBX G;  2CQN A;  2E35 A;  3ZRG A;  3L2R A;  4N9I A;  1SMY F;  3G71 I;  2R7S A;  4B47 A;  2E60 A;  3CLO A;  2MC3 A;  1MMN A;  1OPC A;  2ZXI A;  4XKC A;  5HOD A;  5FO5 A;  1J09 A;  2HOE A;  2QZ8 A;  1JUS A;  1XSD A;  1WJB A;  3OYI A;  1VQ8 I;  3PQJ A;  3HIF A;  3OSG A;  2BW3 B;  1OCC H;  4IEJ A;  3BDD A;  3E97 A;  1R36 A;  2HOS A;  1ONV A;  2QKL B;  3RQ4 A;  3ZQI A;  4HNU A;  3I58 A;  5TGT A;  4WX9 A;  3CCR I;  3G1M A;  3ZQG A;  1J75 A;  2L54 A;  2A6T A;  4A3E J;  3KLN A;  4NB5 A;  2VLA A;  3MQ0 A;  3GTG J;  2FJ1 A;  1SVM A;  5L3D A;  3FZV A;  1MJ9 A;  3K4K A;  2ZXJ A;  3WTW C;  1ZEL A;  3RKX A;  4WXC A;  1ZHF A;  3HC7 A;  2R7Z J;  1BIA A;  1LNW A;  2FUG 2;  3BT9 A;  3FXK A;  4XOT A;  2UZK A;  5F04 A;  2A5W A;  1YJW I;  2L3D A;  3VOE A;  1EA3 A;  2LP0 A;  2V9K A;  3WG9 A;  3DFG A;  4BBR J;  4QSH A;  5J40 A;  3SXY A;  4A3I J;  4M9X A;  5J3L A;  3JRC A;  5L3E A;  1H89 C;  1FC3 A;  4CA0 A;  4I99 C;  2VQH A;  4B43 A;  1NTC A;  2F48 A;  2LOO A;  4G12 A;  2V4J C;  1YFH A;  2K4J A;  5FKL A;  1MJA A;  4LIV A;  4L5E A;  2JVG A;  3OYM A;  2GXB A;  1A6I A;  1BIB A;  1QHG A;  3WGG A;  2E2J J;  2VOD A;  5HS8 A;  4BE2 A;  3HPG A;  3JRB A;  1U5T A;  2CQQ A;  1T33 A;  3QPT A;  3E3V A;  1XB4 A;  3MCZ A;  5DD4 A;  1WSU A;  1GLN A;  1S9H A;  2DA1 A;  3L2Q A;  1R1U A;  2NS8 A;  1TL8 A;  2OBP A;  4RGS A;  1BL0 A;  3KYC B;  5FB2 A;  2BHY A;  1WWX A;  2XV4 S;  4QPQ A;  4B09 A;  4AU7 A;  4CCN A;  2XDV A;  4AD9 A;  1ORK A;  2L9R A;  2H6B A;  4HSR A;  4M73 A;  4JX4 A;  2PG4 A;  4MNU A;  4HPQ A;  2Y0S A;  5HLG A;  4EJT A;  1WKM A;  3R0J A;  4XOR A;  4XID A;  4L5J A;  2KP6 A;  5D6E A;  3C2G A;  2VPR A;  5BNG A;  4B3X A;  3ZMT A;  4XRM A;  2E34 A;  4E7K A;  2M0M A;  4IRG A;  2F5F A;  3DEU A;  4BDZ A;  3J7A Y;  2R5Z A;  2PJR B;  5GAH J;  2E1N A;  3F8M A;  2HU9 A;  3KZI C;  4YEJ A;  4K2E A;  4LLG F;  2GLO A;  4L9T A;  2JMW A;  2Z2S B;  2FE3 A;  1R1T A;  2ZNZ A;  3F8B A;  2OC6 A;  2LF8 A;  4WWC A;  4XBF A;  3ZQC A;  2LY1 A;  2IXS A;  4BXF A;  3RCO A;  2NVT J;  1ETW A;  3JRH A;  1EH8 A;  3NRV A;  1ZN2 A;  2WY7 Q;  1OKR A;  4CYD A;  1W36 C;  3EUA A;  1MSF C;  1ODD A;  3LAJ A;  3A02 A;  2OD5 A;  1HST A;  5HLH A;  5M5W J;  2EBI A;  3A0H C;  5CPR B;  4BQA A;  3H0D A;  3DQV C;  2JRT A;  2HKX A;  1LQ1 A;  2CJJ A;  4CDG A;  3RIR A;  3J80 K;  4ZTF A;  4BBS J;  2E19 A;  2FBH A;  3DLL F;  1UHM A;  1IJW C;  3LSM A;  2EIK H;  4AIK A;  2EV6 A;  1KQ8 A;  2KZV A;  5FLM J;  1MMA A;  4E7S A;  1R23 A;  1HXD A;  1TWA J;  1IN7 A;  3A0B C;  2HZT A;  4ZYG A;  3CDI A;  1POG A;  4ZYD A;  2PI0 A;  4AWX B;  3OYK A;  1YLF A;  1Z6T A;  2RGV A;  4NC6 A;  3FHZ A;  1X4P A;  2WB1 N;  3OL4 A;  1MMS A;  2Z1D A;  4PDK A;  1S8N A;  3CDL A;  4A12 A;  4RAF A;  4AIJ A;  4FTH A;  1C0W A;  1Q1H A;  3K7A J;  3I4P A;  4LB5 A;  4HF1 A;  1JJ6 C;  2UWM A;  4Z2Y A;  3T0Y A;  4Y33 A;  4EQQ A;  1ZGW A;  2GIZ A;  3ZQH A;  1ZQ3 P;  4CHU A;  1XC5 A;  1FYL A;  3H3U A;  1X3U A;  1R5G A;  1BJA A;  4E7I A;  2ZKZ A;  2XGE A;  3PUF A;  2O0Y A;  2XUB A;  3QPH A;  2Q2E B;  5GPA A;  1LPQ A;  4FT8 A;  1MBG A;  4CCO A;  2KIQ A;  1GVD A;  2L01 A;  1A35 A;  1NG6 A;  3JCU C;  2KL4 A;  5CVJ A;  3LA7 A;  1R7J A;  1V55 H;  2X6X A;  3LMM A;  3CCM I;  2V26 A;  4KN4 X;  2DDB A;  2Q8K A;  5EGO A;  1T2K A;  1YHQ I;  2IEK A;  4Q4Z F;  2AQF A;  4PZJ A;  5LBQ A;  2MAB A;  2R4G A;  1JI8 A;  1N75 A;  4HBL A;  2DK5 A;  1U2W A;  5E3O A;  1YIJ I;  2QF7 A;  1DU0 A;  1ITY A;  1HOM A;  3KP4 A;  2D45 A;  2NNN A;  2VE9 A;  1D5Y A;  4U0W A;  1PP8 F;  3EDP A;  4EJU A;  5HOO A;  1Y6I A;  1W4M A;  2M9H A;  4J01 A;  1A6Q A;  1Z3X A;  5E3L A;  5EYR A;  4J19 A;  1SC7 A;  4OIR F;  4ZYA A;  2BE5 F;  1ETO A;  2O7O A;  3QOD A;  5K5R A;  4IF4 A;  2J5P A;  2JA6 J;  3PJR A;  1R22 A;  4D7N A;  3O2P E;  5M3M J;  3IHU A;  3QPS A;  3GTK J;  3BPX A;  3ABT A;  3BQY A;  3K4L A;  4LK0 F;  1U8B A;  2V9P A;  2H09 A;  1R4N B;  1BN5 A;  1P6R A;  1OYY A;  1X2N A;  3K4J A;  2FQ4 A;  4BHP A;  1U5T B;  2ZC2 A;  5CVV A;  4A0Y A;  3OYJ A;  4IHV A;  3JRA A;  5DYM A;  2O8K A;  2PMZ A;  3IH3 A;  2L5Q A;  3CP8 A;  2FU4 A;  1JT0 A;  4UUT A;  2GA1 A;  3KEO A;  1IUF A;  4CYC A;  2XAS A;  2CU7 A;  3N4M A;  1DGW Y;  3MKY B;  2KIF A;  1IRG A;  4ZDO A;  4GRI A;  4XLC A;  4MEY F;  3SDB A;  3K69 A;  4LGW A;  4M3D A;  1JHF A;  2CMP A;  2RQP A;  4FHT A;  1H9G A;  3M8F A;  3X2Q H;  4WCG A;  4YFK F;  1LVK A;  3SZG A;  1YRN A;  4A3C J;  1SAU A;  3BG3 A;  2HQ5 A;  1WJC A;  2DFF A;  3KLO A;  1YYV A;  3S3M A;  2Y69 H;  3S17 J;  2NS7 A;  2JTV A;  2O03 A;  3WE2 A;  2R5Z B;  1Z91 A;  2OV7 A;  1AHD P;  2OZU A;  2K40 A;  4KIC A;  3MD2 A;  1XN7 A;  2WB1 A;  5FFZ A;  1VF9 A;  4KA4 A;  3U1K A;  4D5F A;  5KNL A;  2VQC A;  1FOY A;  1M1E B;  1H88 C;  1G59 A;  1BW5 A;  2DQL A;  1I5Z A;  3E5Q A;  1HW1 A;  2VT2 A;  3BR5 A;  3Q9V A;  2LFB A;  1KQ9 A;  3D5R C;  2VBX A;  2QEN A;  1WCM J;  4CUG A;  3WU2 C;  2DOE A;  2R7T A;  2HWV A;  2R7X A;  3SYT A;  1P9Q C;  1BI1 A;  1N78 A;  2VB6 A;  2ZBK A;  2LSO A;  1D0Z A;  1I1S A;  2M3A A;  2Z3Y A;  4KT6 A;  2GXG A;  2O5R A;  2OTL I;  2MD5 A;  3FXU A;  4Y4R A;  4I76 A;  3V7R A;  5ILU A;  3DCF A;  2HVR A;  3CLQ A;  2GQQ A;  1MSE C;  2FMY A;  3W6J B;  5K7H A;  4Y3O A;  1Z3Y A;  2JSC A;  3GZN B;  2NOG A;  1XDU A;  1QPM A;  2ZME C;  3L09 A;  4HW0 A;  5J6X A;  1O7L A;  5C3E J;  2W1O A;  2WAD A;  4M74 A;  2WBM A;  1I3A A;  4PGG A;  1LFP A;  4QPO A;  1MIJ A;  3HEF A;  1ACI A;  4X0G A;  1X1P A;  3HRS A;  2W85 A;  3P7N A;  4YEL A;  1SFE A;  1K6Y A;  3P9K A;  4LLL A;  1GHC A;  5DM7 F;  1HC8 A;  5D5X B;  2JWT A;  3CUQ C;  2VPL A;  3CC2 I;  2VKH A;  2DMU A;  3KP5 A;  3K4M A;  2B63 J;  3RDI A;  3RPU D;  3GFM A;  1GT0 C;  2KPM A;  2KDZ A;  2DOF A;  3KPH A;  3SJM A;  5FGM A;  2A61 A;  2QWW A;  5TJJ A;  1Y0U A;  2BZT A;  2EQR A;  2KHM A;  3N97 A;  4FAS D;  2XGX A;  3W2A A;  1ETX A;  4UXN A;  5FRM A;  5EEG A;  3I53 A;  2IJL A;  4Y7N J;  2CSO A;  4EJW A;  4IHY A;  3HJE A;  4DBQ A;  2VN2 A;  1HF0 A;  1W5T A;  2M2E A;  1J59 A;  1W5C C;  2DCE A;  1OLT A;  4IL6 C;  2HTS A;  1EJ9 A;  2R7R A;  4IOC F;  5EGO B;  5M5Y J;  1MZB A;  5J8C A;  4O3M A;  1ZRD A;  4JK1 X;  2W82 A;  2NS0 A;  3CP2 A;  1ERD A;  2XF5 A;  3FF5 A;  2CW7 A;  4AUX A;  1VQO I;  1RRJ A;  2NVU B;  1VI0 A;  4HAM A;  4HYE A;  3DU5 A;  4D5C A;  1IAW A;  2EFO A;  3O3K A;  4MTE A;  4MFE A;  1RR8 C;  3OOP A;  1ZRE A;  1MND A;  3QP6 A;  3HOW J;  3M9A A;  1Z67 A;  2DPU A;  2E2I J;  2D2W A;  1E3P A;  1E2X A;  1FEX A;  2BOL A;  4UY8 I;  2MYS A;  2FNP A;  3V7S A;  3WTX C;  3OS2 A;  1D3Y A;  2LRD A;  3AL0 B;  3O8H A;  1P2F A;  1TW2 A;  2JZY A;  4W1U A;  3WU1 B;  1OCP A;  2GWR A;  3RZD J;  4IOA F;  2DFH A;  4MIM A;  4D1Q A;  3LL7 A;  2CV0 A;  3TED A;  2OCC H;  2DFI A;  1XG1 A;  1X3W B;  3SHF A;  3T8T A;  5F6F A;  5BOX A;  4D7M A;  2EPF A;  2X51 A;  3I54 A;  3TOA A;  3IWF A;  2W4S A;  3AG2 H;  1XGO A;  4CYC B;  1UB9 A;  1D0Y A;  1LDJ A;  2Q1Z B;  1VFC A;  2EJR A;  2Z16 A;  5LGT A;  3M8E A;  1PYV A;  3GTP J;  3DF8 A;  1RZ4 A;  2LH9 A;  2DA4 A;  4IVN A;  1XMA A;  2VJJ A;  2DTZ A;  3A1Y A;  3DTI A;  1YRN B;  1G6N A;  3CCV I;  1E0E A;  3M3Y J;  3QRF F;  1DQU A;  1ZGA A;  4I98 B;  2RAE A;  2X6W A;  3S2H J;  2DK8 A;  4EJO A;  4KIG A;  3V8J A;  2VI6 A;  1SFU A;  1W36 D;  3TP0 A;  1QZY A;  1YIO A;  2ZFU A;  4DBR A;  2MSY A;  1TWC J;  3LOC A;  1Z77 A;  2IGM A;  4L0Z B;  2GAU A;  5K7Z A;  3HSR A;  1BBY A;  3HOY J;  4B44 A;  2E7X A;  3QQA A;  5DTD A;  2RNJ A;  1TW3 A;  2DPD A;  2K9S A;  4DZP A;  5A2Q Z;  4E4H A;  1NG7 A;  2KJC A;  2LTP A;  2KIM A;  3BOQ A;  2ZB9 A;  2FQ3 A;  2ID3 A;  4P96 A;  1T0F A;  4DQ2 A;  4BJ6 C;  5J4V A;  5LGN A;  3ABK H;  3T1B A;  4OIO F;  4X6A J;  2R7F A;  2CV1 A;  4BHB A;  2XSJ C;  1HW2 A;  1U6G A;  3HBL A;  4M6Y A;  2V6C A;  3JSP A;  3JRI A;  4BJ5 C;  1UZC A;  2ZNY A;  2KIU A;  2IAI A;  4CO8 A;  2XB0 X;  5EJC A;  3MKZ A;  3ROU A;  3BG6 A;  3ZQQ A;  3CF5 F;  1S7O A;  2FOW A;  4XK4 A;  4A0X A;  5IOZ A;  5B5E C;  1YQA A;  4H0E A;  3LSG A;  5IY5 H;  3KZZ A;  3GEZ A;  4PJJ A;  4XKB A;  3UR3 C;  1Z6R A;  2YX7 A;  1IRX A;  3I71 A;  1ZG5 A;  5C4X J;  3F8F A;  3MZY A;  3HTS B;  3LSP A;  1LEB A;  1ON1 A;  2GOX B;  3BTC A;  2ADU A;  2BBY A;  4KJZ A;  4HRI A;  3HGG A;  4W97 A;  1U78 A;  3ZP5 A;  2HZD A;  1FBS A;  3TGN A;  3HGY A;  1VQP I;  2DLL A;  3C2H A;  4DJA A;  2DQR A;  4UVA A;  4XRS G;  3QAH A;  3GBG A;  3PM1 A;  1KU9 A;  3G3Z A;  3WU0 A;  2MGQ A;  1QHH D;  4G7Z F;  5J1Y A;  3QPL A;  1FBQ A;  2DMT A;  3CES A;  3DPU A;  4L5I A;  1FOX A;  4A93 J;  2QA4 I;  2VC1 A;  2RQQ A;  4QIW N;  5EEA A;  4F92 B;  1YI2 I;  4BUP A;  5LHH A;  1IRZ A;  3DV8 A;  5L3F A;  1IF1 A;  3DKW A;  5E1W A;  2VKE A;  2IS1 A;  3K4N A;  4BDY A;  2QLZ A;  1B72 A;  5J1U A;  2N8G A;  3JTG A;  3M1C A;  4BS9 A;  4RB2 C;  4EEF G;  4G6D A;  5AON A;  4C2M J;  3QOE A;  4E70 A;  2A6E F;  5FKK A;  1VQ4 I;  2L9V A;  3KX2 A;  3S2W A;  1E3H A;  2OA4 A;  4A6E A;  1MW7 A;  2VON A;  2CUF A;  5JFR A;  5JLX A;  4LIT A;  3S1M J;  4MTD A;  1V5G A;  2HDD A;  3E6M A;  3JRF A;  3HOX J;  3F21 A;  1VQK I;  3AG1 H;  2UUZ A;  3E6C C;  5HDN A;  3LSR A;  1SMT A;  3L7W A;  1IDY A;  2KLO A;  4N9H A;  3VYS B;  2XPV A;  3VYR B;  3LA3 A;  4KYW A;  2QGU A;  4BE1 A;  2QVO A;  2LYC A;  1SAN A;  2EZI A;  3GME A;  3R4K A;  2DBB A;  1XGS A;  4R1H A;  2VJ5 A;  3J7Z I;  1SFK A;  3TO6 A;  4BHC A;  2OQG A;  1V5F A;  1ULY A;  2E1M B;  5J8F A;  1T56 A;  2O9L A;  1U5T C;  1R1V A;  1VQ9 I;  1WPK A;  2V1U A;  3TP3 A;  2VL8 A;  5F0F A;  1W0T A;  3RYR A;  2YU3 A;  3EET A;  2W00 A;  3E0J B;  3W3C A;  3K70 C;  2ZCW A;  3HXL A;  2F4O B;  1LVA A;  1WH5 A;  3IRR A;  2B0L A;  5GAE J;  3KP2 A;  3S1N J;  3GFL A;  3SZP A;  4YRV A;  4ENK A;  4E7L A;  4B3A A;  2CRG A;  2HOT A;  1I27 A;  1BC8 C;  2Y9Z A;  5C4J J;  2M7A A;  3KEY A;  4RBO A;  2QBY A;  3CCY A;  4U87 A;  5AIP A;  2DXI A;  1LDK B;  2FF4 A;  1BI0 A;  1TQP A;  4XLH A;  3OR2 C;  2EFN A;  2X1D A;  1BOA A;  5IT9 Z;  3LFU A;  3WTY C;  2LKX A;  1K7A A;  2IA0 A;  2XSD C;  1LJ9 A;  1XGN A;  2P5K A;  4OOI A;  1KQ0 A;  3G1O A;  2ZSI B;  1BI2 A;  5F1R A;  3R6S A;  3DEE A;  4ETS A;  4MFD A;  3KZY A;  1STZ A;  1W7P B;  2ESN A;  2IGK A;  3QP5 A;  5KAI C;  2CQX A;  2OU2 A;  4RB0 A;  1JTY A;  3HHH A;  4GGG A;  3H35 A;  2D5V A;  4HEA 2;  1V4R A;  1QBJ A;  1B1B A;  3PNV A;  3ERM A;  2BXY A;  3RKQ A;  2IT0 A;  1R71 A;  3PSF A;  1Z7U A;  2FBI A;  2FOK A;  3K2A A;  3JAM K;  3WTS C;  2OZ6 A;  1DUX C;  1D0X A;  3B6C A;  1ZAR A;  3AFH A;  1YX3 A;  5FJ8 J;  3I4N J;  1IW7 F;  1ZG3 A;  3OWT A;  2OUM A;  2HQA A;  2KT0 A;  1U0J A;  4G6T B;  4S0H B;  2NVX J;  1B8I A;  1MH4 A;  5HDG A;  3H3V K;  3CCU I;  4ENJ A;  5JHF A;  1HDP A;  3NAU A;  1FX7 A;  1I6X A;  2F2E A;  4IO9 F;  3TBI A;  3KIO A;  1SVO A;  4EVI A;  1XCV A;  2LK2 A;  1SAX A;  3CMA I;  1KYZ A;  1RC9 A;  2IVM A;  3NWT A;  4V2G A;  2LR8 A;  3GLX A;  3Q9S A;  1FOK A;  1I6H J;  2XVC A;  1MH3 A;  4A3K J;  2X9D A;  3F6V A;  4ZYH A;  1MD0 A;  5TIS C;  3BPV A;  3E5X A;  5FKO A;  3HYI A;  3S3O A;  3L2W A;  2BY2 A;  4OAY A;  5KAF C;  4P55 A;  3RPU A;  4EAT A;  3TO7 A;  4C2T A;  4M71 A;  2JQ7 A;  1PUF A;  3CJT B;  4L0Y B;  4XLN F;  4HX4 A;  3ZMS A;  1W5S A;  4I2O A;  3FMQ A;  3BRO A;  2V1X A;  5L3B A;  1O3T A;  5D5W B;  1BM9 A;  4CCJ A;  2E7W A;  2CQ7 A;  2X0L A;  4G9Y A;  3SQN A;  1BW6 A;  1O3S A;  3EPZ A;  3JRD A;  2XAF A;  1O57 A;  3PL8 A;  1KYW A;  2FNA A;  3RI4 A;  2CYY A;  1USS A;  1U9O A;  1WJ5 A;  2PMZ N;  3SEZ A;  4AIH A;  1EH7 A;  2ID6 A;  4IHW A;  1T08 B;  2JRM A;  3FXO A;  2P0W A;  3WE3 A;  1B72 B;  4LLN A;  4RAG A;  2QSH X;  1MBK A;  1TC3 C;  2W25 A;  4XQF A;  4Q5S F;  2PJP A;  3C18 A;  5DS9 A;  2PMU A;  3P9C A;  2LY2 A;  3CCS I;  2K86 A;  4PK4 A;  1A31 A;  4C2U A;  3GTM J;  2OTJ I;  2HEO A;  2IPQ X;  2M8E A;  2FBK A;  3PFY A;  4UUS B;  1WH7 A;  1A36 A;  4XOP A;  4TV7 A;  3WHB A;  2HYJ A;  4WF2 A;  2M45 A;  1JXS A;  4AC0 A;  4OMZ A;  3GVA A;  4LD5 A;  4RB3 C;  2ZXH A;  2AXL A;  3GWZ A;  2VJ4 A;  4BKX A;  3LQR A;  1OYW A;  2EA2 A;  2WAQ A;  5KCM A;  5D8K B;  1H0M A;  1TWH J;  1H8A C;  4FQG A;  1BR2 A;  1V54 H;  2Z5U A;  4M6V A;  1FMV A;  4Z6Y A;  2B9S A;  3L9F A;  2IGN A;  2DA3 A;  5DEQ A;  4GDF A;  4Y17 A;  3K6G A;  5GP9 A;  1U9N A;  1QQI A;  4N0B A;  1Z1D A;  1Y8R B;  2BHZ A;  2M8G X;  2WV1 A;  3C2B A;  3FXJ A;  4B8X A;  5GAG J;  3S93 A;  2WV0 A;  1OJL A;  3BG9 A;  3HOT A;  3HOV J;  3FK7 A;  3AL0 C;  3VYU B;  2FXA A;  1JUM A;  2NYX A;  4P5O A;  4CZZ A;  5JVT A;  1DU6 A;  2ME0 A;  4KIF A;  4RAZ A;  1PDN C;  3AAF A;  4BQN A;  2G7H A;  5HLT A;  3ISP A;  3OYB A;  2RV8 A;  3F8C A;  2V79 A;  5HS7 A;  2A69 F;  1Y39 A;  1OCZ H;  4J00 A;  5BMZ A;  4B48 A;  1K79 A;  4CCL A;  5GPC A;  1D8J A;  5EEH A;  2M7B A;  2BGC A;  1QU3 A;  1BI3 A;  2CW8 A;  2L7Z A;  1WJF A;  3BC8 A;  3EUK L;  3CCJ I;  4PCQ A;  1T98 A;  4DW6 A;  2FRH A;  3VOD A;  1J7K A;  5LEK A;  1VQN I;  3QOP A;  2W48 A;  4BY7 J;  5D4R A;  2QSG X;  4EMS A;  3BTL A;  2QQ9 A;  4KMU X;  4A0Z A;  3BLY A;  5LHG A;  1S7E A;  1VTN C;  4A5M A;  2DOA A;  2XGC A;  1UHS A;  2XAG A;  3GCM A;  3LSI A;  3OYN A;  2A05 A;  3BZC A;  5EZG A;  3H92 A;  4I01 A;  4LB6 B;  5L3C A;  3FIS A;  2ME6 A;  4C3I J;  2O3F A;  3CC7 I;  3G6E I;  5EG0 A;  3IUO A;  4MQV A;  5BS6 A;  4G7O F;  1ZRF A;  2JK3 A;  1Y1V J;  1QA6 A;  3F0C A;  2IS4 A;  4IQJ A;  2IRF G;  1HKQ A;  2CW0 F;  4A3G J;  1HLV A;  1TQM A;  4NHJ A;  3WGI A;  1D5V A;  2B7E A;  1ETQ A;  2G9W A;  5E1X A;  3FXR A;  3W6K B;  3RKY A;  1B8I B;  2I5U A;  2HQR A;  1B59 A;  1TQI A;  5GTH C;  4LG3 A;  3TQN A;  2V9V A;  2GZW A;  3IKV A;  5K7F A;  3OYC A;  1FT9 A;  1MMG A;  3I64 A;  3KP3 A;  5LEJ A;  1VQM I;  1T39 A;  2OAZ A;  1X1C A;  1K78 A;  5E17 F;  1FMW A;  3VPR A;  3TMO A;  4IRH A;  2P8T A;  2Z9O A;  2PBI A;  4I09 A;  3HRM A;  3F9K A;  3PNT A;  2BYV E;  1IGN A;  1DP3 A;  3QYF A;  5ICE A;  3LWF A;  1RNL A;  2H1K A;  2HXO A;  3L2V A;  1ZGJ A;  1RR7 A;  1HDD C;  4D9J A;  1AOY A;  1G4D A;  5CJ9 A;  2H94 A;  3V7C A;  3ONQ A;  1RUN A;  1MJB A;  5J1R A;  1X3Z B;  2VC0 A;  1DDN A;  3SEQ A;  1IXS B;  5J47 A;  2LMD A;  1AU7 A;  1PUF B;  2EH3 A;  4FX0 A;  1TNT A;  1LKX A;  1G3S A;  3PSI A;  4KUM A;  3TW7 A;  1XMK A;  2JA5 J;  3MAJ A;  5DDG A;  3IP4 B;  1GXP A;  2KRC A;  3FK6 A;  5A2Q K;  1KGS A;  5JHU A;  2O6G E;  1WZ2 A;  1ETV A;  1B6A A;  5EZH A;  3JSO A;  2JSP A;  2CFO A;  4BY1 J;  2EFW A;  2P7V B;  1S7A A;  5H6R A;  3HDD A;  3U9G A;  1PJR A;  2QCO A;  3OYH A;  3K1P A;  1QNT A;  1AWC A;  1GXQ A;  4KFC A;  1G2H A;  4LIU A;  1OMI A;  3DTE A;  3MKL A;  4LOC A;  4ZJZ A;  5TRD A;  3U2R A;  2X1E A;  4I7H A;  4C9Y A;  5LRS A;  3BJA A;  3LST A;  4NC7 A;  2DDA A;  4G7H F;  1LE8 A;  1ZG1 A;  5BPD A;  3A03 A;  2LKS A;  2DT7 B;  3P9I A;  4ASN A;  2X6O A;  2RC4 A;  5JR3 A;  4XKV A;  4YG2 F;  2R7O A;  3IL2 A;  2GM4 A;  5IYD J;  3E1S A;  2VE8 A;  4DIQ A;  1RKT A;  4B1R A;  1R4M B;  3VDX A;  1LUJ B;  4HNV A;  3B02 A;  4PJM A;  3HKZ N;  3E6B A;  4AYB N;  3IRQ A;  2IS6 A;  1R00 A;  2D1V A;  4DZJ A;  4ENN A;  3BTI A;  5ERI A;  3LA2 A;  2ISY A;  2PEX A;  2HYG D;  3Q3S A;  4XLP F;  2Q0O A;  2ISZ A;  2ECB A;  4HV5 A;  4G94 A;  3H5R A;  5IYB J;  4NNJ A;  1VZ0 A;  4ZC3 A;  3ZQF A;  3HTU A;  4PJN A;  3K70 D;  2J5O A;  2YX4 A;  3L00 A;  1TT0 A;  3FDY A;  4NQW A;  4A3J J;  4RLQ A;  3CCL I;  3J80 Z;  3GTL J;  5E20 A;  4XSX F;  1JKO C;  5DUI A;  3MMY B;  2M0C A;  4IX7 A;  2A3S A;  3OR1 C;  4C3H J;  2ELH A;  2QKM B;  4UV8 A;  1NK3 P;  1KU2 A;  2AQE A;  1MBJ A;  2ZFW A;  3ZCO A;  1L3L A;  2LNB A;  4XN3 A;  2VBY A;  1KA8 A;  3FXM A;  3H5A A;  2HTJ A;  4C30 A;  5E79 C;  4ZZL A;  4XN0 A;  1J9I A;  3F6O A;  1YS6 A;  5DCF A;  4LMY A;  5FRO A;  3CCQ I;  2H1L A;  3QWL A;  2KJB A;  2H6C A;  1FOW A;  3VFZ A;  3RYP A;  1PP7 U;  2ZJ2 A;  4HNT A;  2PN6 A;  2E36 A;  2R7W A;  3EUH C;  3GTO J;  3H36 A;  2AO9 A;  4JYK A;  2K5C A;  4RAY A;  3HZJ A;  5HLI A;  1O3Q A;  4CSW A;  1ZH5 A;  1UJ8 A;  3F72 A;  4WXD A;  3TDZ C;  4HX7 A;  2E1O A;  1LB2 A;  4UNO A;  1KZH A;  2M4G A;  2BXZ A;  4IZZ A;  4Y15 A;  2O61 A;  1U8R A;  2YR2 A;  4L18 B;  4RMN A;  3K0L A;  4GO1 A;  4I02 A;  1SD7 A;  2UXN A;  1XCB A;  3Q0U A;  4BGD A;  5EG0 B;  4L9V A;  1IXR C;  4MHG A;  2IA2 A;  3M4O J;  3O8G A;  1IV8 A;  3TL4 X;  4BH9 A;  4FX4 A;  4E6K G;  3D1N I;  4BU2 A;  4N4N B;  3ERE D;  1LEA A;  2FML A;  1YJN I;  3J81 Z;  1IN6 A;  2R5Y A;  3OYA A;  3HOU J;  4D0P A;  4ZH4 F;  3CF2 A;  1DPR A;  4CXF A;  4IHS A;  1X2M A;  1D1C A;  2P6S A;  2AS5 F;  5JVG F;  3BG7 A;  1UMQ A;  2JPC A;  5HVQ C;  2ZO4 A;  2F5V A;  1ON2 A;  2R7D A;  4A3M J;  3AG4 H;  3HG9 A;  2WA0 A;  1ETK A;  2Y0M A;  5J4Y A;  2L7K A;  5IP9 J;  4M3E A;  1R5I D;  2LBF A;  2XRN A;  1I50 J;  1S6L A;  1WI9 A;  5CVU A;  3E6D A;  3ASN H;  1GDT A;  1JKQ C;  5IT3 A;  3HKZ A;  1YW7 A;  2CUZ A;  4AYB A;  3ABL H;  2EIL H;  2XAQ A;  2NVQ J;  4U0Y A;  3OYE A;  2DMP A;  4BQQ A;  2GA2 A;  3RPQ A;  2XB5 A;  3ZMZ A;  5IT9 K;  3L1P A;  9ANT A;  1Y8Q B;  4XNF A;  4P9F A;  1QGP A;  5LFA A;  5ILV A;  4S04 A;  1MKM A;  4OAZ A;  3MKW B;  4MLO A;  2V6E A;  4DOZ A;  2PFB A;  2CUE A;  3H9Q A;  4M9S A;  2PMH A;  5IP6 A;  2OQR A;  4EGY A;  1MGT A;  1JE8 A;  1TWF J;  4HQM A;  5IYC J;  5GTI C;  1JKR C;  3G1L A;  2KFD A;  1OFC X;  1EV7 A;  3B73 A;  3V8K A;  4C3J J;  3ZN1 A;  2BY0 A;  3BCB A;  3FKJ A;  1XGM A;  5ILS A;  2HYF A;  2VAS A;  4CH7 A;  4ZTJ A;  4YFX F;  3BG5 A;  2LD5 A;  3ULQ B;  1QRY A;  1BC7 C;  1Z0X A;  1ZKG A;  2EFQ A;  1ZLK A;  2RVC A;  5FLX Z;  3PIO F;  3S1R J;  2XAU A;  3BY6 A;  5F27 A;  5K1Y A;  3J7A O;  2FA5 A;  3VSK A;  4MO7 A;  2XC7 A;  1R9T J;  4A3D J;  2QQB A;  2RN7 A;  5B1A H;  2M5W A;  1PUE E;  1FNN A;  3OL3 A;  4XON A;  1D8K A;  3UNG C;  2YS9 A;  4IRI A;  2VJI A;  1IRF A;  4MGR A;  2VBW A;  2LC2 A;  1IG7 A;  4XM3 A;  3LSK A;  4L9N A;  2M87 A;  5K5Q A;  3BWG A;  1EH6 A;  1GV5 A;  2BY3 A;  1XSX A;  4CZC A;  3G2B A;  5CVI A;  2HGC A;  4NQW B;  1JJ8 C;  3IAS 2;  2AXT C;  2K9Q A;  1QO0 D;  1RI7 A;  3AG3 H;  1DPU A;  4Q48 A;  3ZN0 A;  4A69 C;  2GOM A;  2Z99 A;  4DYR A;  3OYF A;  2STT A;  2KIS A;  1ZAO A;  1YS7 A;  1PVE A;  4PFP A;  2JA7 J;  5EF6 A;  2UXX A;  1R6R A;  2X1C A;  1O4X A;  4BE0 A;  2DYS H;  4X1E A;  1IN4 A;  5H20 A;  4U7D A;  2EWN A;  3GX4 X;  2EFP A;  1MMD A;  2O8X A;  3D5S C;  2XKO A;  2LDU A;  2ETH A;  2G7U A;  1WI3 A;  3B6A A;  1AA7 A;  3HRT A;  4UVB A;  4H4K C;  3HL2 A;  3OOU A;  1W0U A;  4II2 A;  2IS2 A;  1NH3 A;  2LG4 A;  4EM2 A;  4IQ4 A;  2EZH A;  2LF7 A;  3ZMD A;  2P5L C;  2EZL A;  2DI3 A;  2E1C A;  4IKF A;  3JTH A;  3H9G A;  1IV6 A;  4IXA A;  2DA6 A;  4F3Q A;  2NOJ B;  1MNE A;  3GZ6 A;  2NVY J;  3FM3 A;  2KRH A;  3ZMU A;  4O5V A;  3TW6 A;  1OCR H;  4IHX A;  3ZGK A;  1G3W A;  5E1Z B;  4ENM A;  2YU9 J;  3F3X A;  4PSX A;  1IC8 A;  3S32 A;  1CF7 A;  2EV0 A;  2L02 A;  2PX9 A;  2DO7 A;  5ICC A;  4IPA A;  3C7J A;  3GW2 A;  5D8L B;  3LQQ A;  4PFO A;  3OY9 A;  2R5Y B;  3I5U A;  2JJ7 A;  3RQI A;  3PNY A;  4F93 B;  1GUU A;  1T6S A;  1HCR A;  1IXC A;  3BR2 A;  1N25 A;  3ELK A;  3U1D A;  2K7L A;  3HRU A;  1YIT I;  2L0K A;  3S16 J;  1ZK8 A;  2X6Y A;  1ZRC A;  4IHT A;  5H2F C;  3S15 J;  2H8W A;  3IWZ A;  2JVH A;  2LBF B;  3LNQ A;  1X4O A;  2NAZ A;  2IBD A;  1OYI A;  4RB1 A;  1S72 I;  4PJL A;  4GYG A;  3GZ5 A;  1WVR A;  3HPH A;  2L9S A;  3MZ8 A;  1JGS A;  1VQL I;  2ZJR F;  1XSV A;  4KIT B;  2DN0 A;  4R79 A;  3EYY A;  3FXL A;  3M07 A;  3FHN A;  3H9J A;  2PLY A;  2NXN B;  5ICG A;  3J7Y J;  4HZF A;  4UB8 C;  4AM3 A;  4V2F A;  1ZTR A;  3VYT B;  1L0O C;  4G6Q A;  4ANJ A;  3FIW A;  3ESW B;  2EB7 A;  2QQA A;  3GUD A;  3OIP A;  3OIO A;  5D6F A;  3JR9 A;  1ZR2 A;  2WAQ N;  2KKO A;  1O3R A;  2WAE A;  1R49 A;  2DA7 A;  3DP7 A;  4HDU A;  4EJV A;  2X4H A;  1WFX A;  2Q2E A;  4XLF A;  4M6X A;  5B1B H;  3BP8 A;  3I3L A;  2LLK A;  1BR4 A;  1EKE A;  1KON A;  1SEU A;  3QU6 A;  3CZ6 A;  2MH9 A;  3CJR B;  2R3S A;  3FXQ A;  3ECO A;  4KDP A;  3DTK A;  4ON0 A;  1S5L C;  1E17 A;  1F36 A;  2F5E A;  3RSN A;  1OR7 A;  3W6V A;  2RDP A;  1YE9 A;  4P9U A;  1IN5 A;  4MEX F;  2RRE A;  4UV9 A;  3SFZ A;  2JN6 A;  3R60 A;  2K9L A;  2NNY A;  1FPQ A;  2ZSH B;  3OS1 A;  1ZYR F;  1Q1V A;  4Q47 A;  1GV2 A;  4A2U A;  4R8H A;  4WK8 F;  5LD2 C;  3M7G A;  2MD0 A;  3FM5 A;  2E5N A;  1FWZ A;  4LG0 A;  1F4K A;  1ETY A;  1RES A;  3H3Z A;  2K4B A;  2JA8 J;  1VQ7 I;  3IC7 A;  5FD6 A;  1MNM C;  2I8D A;  3L2C A;  1TT5 B;  3ECH A;  3OYD A;  1V5E A;  2DT6 A;  4GCV A;  2L4M A;  2STW A;  1D1A A;  3WTU C;  1EF4 A;  4AVZ A;  1F43 A;  2YSR A;  2JUC A;  4U0V A;  4XSZ F;  2MW8 A;  3JRG A;  3RZO J;  1YW9 A;  4XKW A;  3I59 A;  1FZP B;  4FE7 A;  3REO A;  3MFK A;  4XRF A;  5D5V B;  1TNS A;  2IGO A;  1HQC A;  3UKG A;  3FX3 A;  2OF7 A;  4OWR B;  2WAF A;  4BL0 B;  5DCM A;  3CQZ J;  3VSL A;  1FJL A;  4A5N A;  2BEO A;  5F64 A;  5HDK A;  3IAM 2;  1SD6 A;  2K9M A;  4I6Z A;  4KIB A;  2HOA A;  1JTX A;  2HVQ A;  4AID A;  1HSJ A;  4XLA A;  3DEW A;  4GFB A;  1B4A A;  1RIO H;  1X58 A;  3VB2 A;  3GF2 A;  3NWS A;  1VQ5 I;  1QVT A;  2P7C B;  2KRF A;  3A01 A;  3P5J A;  1WRJ A;  4XR6 A;  4QLC U;  2HDC A;  2V1N A;  1CQT A;  3K1N A;  3KP7 A;  3F23 A;  2DJI A;  4E7Z A;  5DD8 A;  2HFH A;  2NRA C;  2K3P A;  3GFJ A;  1W7P D;  1B9N A;  1ZLJ A;  3HSE A;  2CUJ A;  3OIQ A;  2PQ8 A;  2D1H A;  3LSH A;  2VBZ A;  5E3N A;  1F5T A;  2K3F A;  4JBA A;  2GIV A;  1UEL B;  4M72 A;  1HKT A;  1UCR A;  2F6C A;  2COB A;  3I9V 2;  4KN7 X;  1CF7 B;  2BVL A;  1K6O A;  2COM A;  2XF7 A;  4XL9 A;  4HDV A;  1FIA A;  3W2V A;  2BY1 A;  4OMY A;  4HG2 A;  2HPI A;  2ACJ A;  3G73 A;  4RGR A;  4II3 A;  4L9J A;  4HF0 A;  3BR1 A;  3DLA A;  3MVP A;  2V7F A;  1E3O C;  4A6D A;  1XX5 A;  4DYQ A;  2RNG A;  3DKY A;  1R5H A;  1G8X A;  2HVS A;  1FP1 D;  3CC4 I;  2XPU A;  3FBI B;  2A6H F;  5B66 C;  4YIR X;  3BZK A;  1TP4 A;  3HUG A;  1FBU A;  4FE4 A;  1FY7 A;  2KQR A;  4MQ9 F;  5CYV A;  3FBN B;  2MG4 A;  3ZQL A;  4BEH A;  3V42 A;  2K02 A;  3MZH A;  3OMY A;  4HF2 A;  3NQO A;  4O6J A;  4ZDP A;  2ZJQ F;  1BA5 A;  3PQK A;  3KE2 A;  4RLF A;  4Y13 A;  1V3F A;  2EIM H;  4U88 A;  4U7B A;  1ENH A;  3OV8 A;  4A3F J;  2QBY B;  3HOS A;  1UST A;  2GXA A;  3JW4 A;  3DKX A;  2K9N A;  2MC4 A;  3QU3 A;  2DYR H;  2QQ8 A;  4YIF A;  3DPT A;  4BYY A;  2EA4 A;  2XIG A;  5ED4 A;  1JKP C;  4NUB A;  3BJ6 A;  1XS9 A;  4Y52 J;  2F4M B;  5ICF A;  1IO2 A;  2M34 A;  4RS8 A;  1T38 A;  3ZMV A;  1WJD A;  1FYK A;  3CDH A;  2QM3 A;  3J81 K;  1UG2 A;  3OS0 A;  2HDW A;  4F52 A;  2F5D A;  1FLI A;  1LFB A;  4RM2 A;  4JX6 A;  1K83 J;  1FSE A;  1F9N A;  2P4W A;  3D0S A;  1FIP A;  1APL C;  3T8R A;  4JQF A;  4AVP A;  3WGH A;  2WY8 Q;  1YTY A;  1RKW A;  2VKV A;  2CGP A;  2M30 A;  4LK1 F;  1T95 A;  2KMU A;  2VIX A;  1BOB A;  2QUF A;  5F0C A;  2XRO A;  5LHI A;  4HQE A;  4GYI A;  3WTZ A;  3BZ6 A;  2DA2 A;  4ABZ A;  4LG0 B;  4KMF A;  4HLX A;  4JOM A;  4NBQ A;  2M4K A;  4EGZ A;  5AIQ A;  1W1W E;  4B4C A;  1D1B A;  3COA C;  1FSH A;  2OPT A;  4YII A;  2LVS A;  4QTR A;  2UV1 A;  1J2X A;  3FMS A;  4F7Z A;  2F4I A;  1SVL A;  4PUS A;  5CKT A;  2F5C A;  3H1C A;  2R7Q A;  4ESF A;  3N05 A;  1Z9C A;  1LDD A;  1P4A A;  2CS3 A;  2EK5 A;  2R92 J;  1A04 A;  2A5Y B;  2W24 A;  4OIP F;  3IKT A;  1B9M A;  3H5N A;  4G8X A;  3K1M A;  3JAM Z;  3I59 B;  2FEZ A;  2HR3 A;  4N4O B;  3GYH X;  1KU3 A;  3M1E A;  3U21 A;  3SZT A;  4CCK A;  1YW8 A;  2CWE A;  5F08 A;  3TKY A;  3JRE A;  4S05 A;  2JPB A;  2EV5 A;  5E18 F;  5DCM B;  4M3F A;  2EZK A;  3S1Q J;  1Z7L A;  3LFK A;  4UVC A;  2DA5 A;  1NHA A;  1JGG A;  2R93 J;  2K85 A;  3FKI J;  3S3N A;  1YX5 A;  3FMR A;  3PO3 J;  3TOB A;  4BAY A;  4DYC A;  2HS5 A;  4DNC A;  2R0Q C;  3A2K A;  1HW5 A;  3MN2 A;  4ZYE A;  1JUP A;  5FD5 A;  3GFI A;  2I10 A;  4CGZ A;  1NK2 P;  5DV5 A;  4OIN F;  4CIC A;  5M5X J;  5GAD J;  1UFM A;  3F22 A;  3S2D J;  1TLH B;  1IZ1 A;  3K2Z A;  1KU7 A;  3A01 B;  5CQG A;  5FLX K;  2W57 A;  3TDU C;  2XRL A;  3DPL C;  3CJQ B;  1HKS A;  3QYE A;  2ELK A;  1A5J A;  2FX0 A;  5HNH A;  1SFO J;  4IJA A;  3BJO A;  1VND A;  2V1D A;  5LRR A;  3AKZ A;  3QYB A;  3WTT C;  2Y30 A;  2E71 A;  1N77 A;  3K9T A;  3IV5 A;  3HOZ J;  2H27 A;  5K5O A;  4FCY A;  1K4S A;  5D5U B;  2ELJ A;  1IDZ A;  2HXI A;  2K27 A;  1FTZ A;  1OCT C;  2XAH A;  3ZQ7 A;  2MH2 A;  5F0H A;  5F1J A;  2L2O A;  2WC2 A;  4UB6 C;  5FLV A;  1XTA A;  5LLQ A;  3KFW X;  1ZR4 A;  5E3M A;  3EYI A;  4XMY A;  4PGH A;  2BVM A;  1DGR M;  1P4X A;  1X1B A;  1UHW A;  2L9N A;  5E8G A;  2Y48 A;  2TCT A;  3BR6 A;  3ZXS A;  1WGX A;  3BR0 A;  3ASO H;  2Y31 A;  3KYD B;  1K4T A;  3DBR B;  3DBH B;  1X1A A;  1I1G A;  2HKO A;  3HUG B;  2CV2 A;  3BR3 A;  3GO5 A;  5CVR A;  3GTQ J;  2JT1 A;  3EQL F;  2IP2 A;  2P5V A;  1YJ9 I;  4WXH A;  4BEH B;  4BAC A;  2C6Y A;  4EV0 A;  3RKW A;  5BQT A;  1G3Y A;  2VXD A;  5FKM A;  2DMQ A;  5BPI A;  2XGD A;  3I4M J;  2E1M C;  4ESJ A;  1AKH A;  1WJA A;  3PO2 J;  3DU6 A;  5IP7 J;  1GVJ A;  2DTR A;  3K4B A;  4ESB A;  1O7F A;  1Y56 A;  2E5Z A;  1BJZ A;  2X48 A;  4XLE A;  3CME I;  1RUO A;  1JHH A;  4JX5 A;  1SD5 A;  5FFX A;  2XPW A;  1JT6 A;  5IOY A;  3OYG A;  2MLG A;  1YOV B;  4ZDL A;  2MFZ A;  4JP0 A;  4LJZ F;  3OSF A;  2Y9Y A;  5C44 J;  2KZG A;  2L7M P;  2ZME A;  1SD4 A;  1XPX A;  1MDM A;  1TWG J;  4UUV A;  3E7L A;  2TRT A;  3ABU A;  4LFU A;  1Z21 A;  3W2W A;  4HOB A;  3MEX A;  4F55 A;  3Q5F A;  1FP2 A;  3K4C A;  4M9Z A;  2GBY A;  2TDX A;  2CQK A;  3DBL B;  2CG4 A;  1T0F C;  2RKH A;  1OIS A;  2QYO A;  3CUQ A;  4M3B A;  5HNF A;  2BV6 A;  3ZPL A;  3H0G J;  1LFU P;  3T5X A;  5DM6 F;  2DJN A;  2HNH A;  4HST A;  3GTJ J;  1K78 B;  2LKP A;  3MWM A;  2XHK A;  2QSF X;  3RJP A;  3WG7 H;  2JA2 A;  4RM3 A;  2E2H J;  4BNC A;  2Y75 A;  3CO6 C;  2KDO A;  2W84 A;  2WWY A;  4BQO A;  3LSJ A;  2P6T A;  2DMN A;  5FKN A;  5IPA A;  2Y2Z A;  3NEU A;  4EM0 B;  1TZL A;  4RA2 A;  3TO9 A;  5EDN A;  3GXO A;  2OJE D;  3DWL E;  4EM1 A;  3NAR A;  2EIN H;  2L4A A;  4RDU A;  1T8I A;  3I56 I; 
#chains in the Genus database with same CATH homology
 2WB1 A;  3PFY A;  2BW3 A;  5KNL A;  3L2U A;  4XOP A;  2VQC A;  4PSW A;  3OYL A;  1G59 A;  3ZR8 X;  2ZXH A;  2VJ4 A;  2X6Y A;  2JVH A;  3D5R C;  2LBF B;  1X4O A;  2XF6 A;  2WAQ A;  5KCM A;  4CUG A;  2R7X A;  2R7T A;  3D5L A;  1BR2 A;  4PJL A;  1P9Q C;  3SYT A;  1N78 A;  1FMV A;  2VB6 A;  1BR1 A;  1D0Z A;  3HPH A;  2L9S A;  2IGN A;  4KIS A;  2M3A A;  4KT6 A;  3K6G A;  2O5R A;  4Y4R A;  4DGW B;  4KIT B;  4E7J A;  2VXZ A;  4R79 A;  2HVR A;  3BCA A;  3FHN A;  3H9J A;  3S93 A;  3HOT A;  4Y3O A;  3AL0 C;  3VYU B;  1Z3Y A;  4P5O A;  5KHD A;  3VYT B;  4ANJ A;  3OIP A;  4BQN A;  2W1O A;  2WAD A;  5HLT A;  2WAE A;  3A4C A;  2WBM A;  3OYB A;  1HA8 A;  1WFX A;  4XLF A;  3KYL A;  1LFP A;  3I3L A;  4QPO A;  4J00 A;  4X0G A;  1BR4 A;  1KON A;  4B48 A;  5CQE A;  4YEL A;  3CZ6 A;  4CCL A;  1K6Y A;  3CJR B;  1UG0 A;  5FRN A;  2M7B A;  3DTK A;  3PUB A;  1QU3 A;  2CW8 A;  2VPL A;  2VKH A;  3RSN A;  1WJE A;  1WJF A;  3BC8 A;  3EUK L;  3K4M A;  1YE9 A;  3RPU D;  1X19 A;  2KPM A;  3CMM A;  4NC8 A;  2RRE A;  2K9L A;  2KHM A;  2ZSH B;  4FAS D;  3OS1 A;  3W2A A;  2CH0 A;  5FRM A;  5LD2 C;  2R7U A;  3BLY A;  2MD0 A;  2DOA A;  2E5N A;  4DBQ A;  3RTR A;  3LSI A;  3OYN A;  4E7H A;  4FET A;  2DCE A;  1OLT A;  2I8D A;  3IUO A;  2R7R A;  2IS4 A;  3OYD A;  4IQJ A;  1V5E A;  2DT6 A;  4P1W A;  1D1A A;  2W82 A;  3CP2 A;  4AVZ A;  1ERD A;  2XF5 A;  2CW7 A;  2X85 A;  1X1D A;  4XKW A;  3DU5 A;  2PJR A;  3VWB A;  2IGO A;  1UAA A;  4OWR B;  4BL0 B;  1MND A;  2WAF A;  4LG3 A;  3OYC A;  2R7V A;  1MMG A;  1X1C A;  3VSL A;  1FMW A;  2BOL A;  3TMO A;  2MYS A;  3OS2 A;  2VQG A;  2LRD A;  3AL0 B;  3F9K A;  3IAM 2;  2K9M A;  3PNT A;  1DP3 A;  3S8P A;  3QYF A;  2HVQ A;  4XLA A;  3L2V A;  2VQL A;  4D9J A;  2W7N A;  3NWS A;  3ONQ A;  4D1Q A;  3LL7 A;  2HPM A;  2CV0 A;  3SEQ A;  4XR6 A;  2V1N A;  1OR7 C;  4BJT A;  1LKX A;  3PSI A;  2DJI A;  2X51 A;  4E7Z A;  3M8J A;  2W4S A;  3IP4 B;  2K3P A;  2KRC A;  4ITV A;  1D0Y A;  2Q1Z B;  3K10 A;  2CUJ A;  3OIQ A;  2VKD A;  2JSP A;  2CFO A;  2Z16 A;  1PYV A;  4F93 B;  4F91 B;  3LSH A;  2LRE A;  2JUG A;  2LH9 A;  1PJR A;  1UEL B;  3OYH A;  2F6C A;  4CCM A;  2VJJ A;  3A1Y A;  3I9V 2;  3DTI A;  4LIU A;  4ZJZ A;  2BVL A;  3DTE A;  1E0E A;  2XF7 A;  4XL9 A;  1DQU A;  2X1E A;  3W2V A;  3L2R A;  3ZRG A;  4HG2 A;  2HPI A;  2R7S A;  2X6W A;  4C9Y A;  4II3 A;  4B47 A;  2E60 A;  3DLA A;  1MMN A;  4NC7 A;  2ZXI A;  4XKC A;  2V7F A;  1J09 A;  1W36 D;  2DT7 B;  1WJB A;  2ZFU A;  4DBR A;  3OYI A;  2IGM A;  2RNG A;  4XKV A;  2R7O A;  3DKY A;  2BW3 B;  1G8X A;  3E1S A;  2HVS A;  4B44 A;  4DIQ A;  3FBI B;  3VDX A;  2QKL B;  3RQ4 A;  4PJM A;  2IS6 A;  4HNU A;  5TGT A;  4E4H A;  1NG7 A;  2KQR A;  2A6T A;  3FBN B;  4BEH A;  3V42 A;  2VLA A;  4BJ6 C;  3OMY A;  3H5R A;  4ZDP A;  4NNJ A;  1VZ0 A;  4RLF A;  2CV1 A;  4ZC3 A;  3K4K A;  4PJN A;  3K70 D;  2XSJ C;  4U7B A;  1ZEL A;  1TT0 A;  3FDY A;  3HOS A;  4RLQ A;  3HC7 A;  4BJ5 C;  2FUG 2;  3DKX A;  4XOT A;  2A5W A;  2MC4 A;  3MMY B;  4IX7 A;  1EA3 A;  3OR1 C;  2V9K A;  2QKM B;  3DPT A;  3MKZ A;  3BG6 A;  3ZQQ A;  2AQE A;  3ZCO A;  4NUB A;  4XN3 A;  4CA0 A;  3H5A A;  2VQH A;  4C30 A;  3LSG A;  4B43 A;  4PJJ A;  2LOO A;  4XN0 A;  4XKB A;  5FRO A;  1WJD A;  3UR3 C;  2V4J C;  1IRX A;  4LIV A;  3OS0 A;  2HDW A;  2GOX B;  4KJZ A;  2JVG A;  4F52 A;  3OYM A;  4HNT A;  4HRI A;  4RM2 A;  2R7W A;  3EUH C;  1QHG A;  4BE2 A;  2HZD A;  3HPG A;  2K5C A;  3C2H A;  4JQF A;  4DJA A;  2WY8 Q;  1GLN A;  4CSW A;  1S9H A;  3L2Q A;  1T95 A;  2KMU A;  2VIX A;  3GBG A;  1BOB A;  2M4G A;  4IZZ A;  4QPQ A;  4AU7 A;  4CCN A;  2XDV A;  1QHH D;  4JOM A;  4RMN A;  2M4K A;  4HSR A;  3CES A;  4BGD A;  1D1B A;  3DPU A;  4HPQ A;  2Y0S A;  2UV1 A;  2F4I A;  2RQQ A;  4PUS A;  4XOR A;  5CKT A;  3TL4 X;  4F92 B;  2R7Q A;  3N05 A;  4BUP A;  4E6K G;  2KP6 A;  4BU2 A;  2CS3 A;  4N4N B;  3C2G A;  4B3X A;  2IS1 A;  3K4N A;  4BDY A;  4E7K A;  2M0M A;  3H5N A;  3OYA A;  3CF2 A;  4BDZ A;  3M1C A;  4BS9 A;  4N4O B;  3J7A Y;  2PJR B;  4CCK A;  3U21 A;  2HU9 A;  1D1C A;  3QOE A;  4YEJ A;  2Z2S B;  3KX2 A;  3BG7 A;  5HVQ C;  1Z7L A;  2F5V A;  3HG9 A;  2WA0 A;  1MW7 A;  2OC6 A;  3S3N A;  4LIT A;  1YX5 A;  2LY1 A;  2L7K A;  1V5G A;  2IXS A;  2LBF A;  4BXF A;  2UUZ A;  3RCO A;  3A2K A;  2WY7 Q;  1W36 C;  3EUA A;  2KLO A;  3VYS B;  3HKZ A;  5CPR B;  3VYR B;  2CUZ A;  3DQV C;  4AYB A;  3H0D A;  4BE1 A;  2LYC A;  3OYE A;  5CQG A;  4BQQ A;  4ZTF A;  3DPL C;  3CJQ B;  2VJ5 A;  1SFK A;  3QYE A;  4XNF A;  5LFA A;  5HNH A;  3LSM A;  1V5F A;  2E1M B;  4OAZ A;  3MKW B;  4MLO A;  2V6E A;  4DOZ A;  2KZV A;  3AKZ A;  1MMA A;  3H9Q A;  3QYB A;  4E7S A;  2VL8 A;  1N77 A;  3K70 C;  2W00 A;  3E0J B;  3W3C A;  3HXL A;  2ELJ A;  3OYK A;  1X4P A;  3OL4 A;  4YRV A;  4E7L A;  2Z1D A;  3BCB A;  3FKJ A;  2L2O A;  2VAS A;  2M7A A;  3KEY A;  4CH7 A;  4ZTJ A;  2UWM A;  4U87 A;  4Y33 A;  2DXI A;  4XMY A;  2BVM A;  1DGR M;  1LDK B;  1X1B A;  2L9N A;  3ZXS A;  4XLH A;  3OR2 C;  2XAU A;  2X1D A;  4E7I A;  3VSK A;  3LFU A;  2XC7 A;  2Q2E B;  3OL3 A;  4XON A;  3UNG C;  1X1A A;  3HUG B;  2VJI A;  2CV2 A;  2ZSI B;  4CCO A;  3DEE A;  1NG6 A;  4BEH B;  2KL4 A;  2IGK A;  4BAC A;  2LC2 A;  2X6X A;  3H35 A;  3LMM A;  2V26 A;  4HEA 2;  3LSK A;  4XM3 A;  2VXD A;  2AQF A;  3PNV A;  2E1M C;  2MAB A;  2R4G A;  1WJA A;  1JI8 A;  1N75 A;  3DU6 A;  3PSF A;  4CZC A;  3G2B A;  1D0X A;  4NQW B;  3K4B A;  3AFH A;  1YX3 A;  3IAS 2;  3OWT A;  1Y56 A;  2OUM A;  5HOO A;  2E5Z A;  2HQA A;  1Y6I A;  1U0J A;  2GOM A;  4G6T B;  4J01 A;  4XLE A;  1Z3X A;  5JHF A;  4ZYA A;  3QOD A;  3OYF A;  3PJR A;  3TBI A;  4PFP A;  3OYG A;  1R6R A;  2X1C A;  3K4L A;  3NWT A;  4ZDL A;  2MFZ A;  4BE0 A;  3MD2 A;  1MMD A;  3D5S C;  1AA7 A;  4H4K C;  3K4J A;  3OYJ A;  3HL2 A;  3S3O A;  1Z21 A;  3OOU A;  3W2W A;  4II2 A;  4OAY A;  4F55 A;  3L2W A;  2IS2 A;  2LG4 A;  4IQ4 A;  3K4C A;  2PMZ A;  4EAT A;  2L5Q A;  4C2T A;  3CP8 A;  4IKF A;  1T0F C;  3H9G A;  5HNF A;  4F3Q A;  2NOJ B;  1MNE A;  2HNH A;  1DGW Y;  4HST A;  4CCJ A;  3MKY B;  2KRH A;  4ZDO A;  4GRI A;  4XLC A;  3SDB A;  3EPZ A;  2CMP A;  3ZGK A;  2JA2 A;  4RM3 A;  3PL8 A;  4PSX A;  3S32 A;  2KDO A;  1LVK A;  3SZG A;  4BQO A;  1WJ5 A;  3SEZ A;  1SAU A;  3S3M A;  1WJC A;  2P0W A;  3OY9 A;  4PFO A;  4XQF A;  1TZL A;  2OV7 A;  3PNY A;  3DWL E;  2LY2 A;  4PK4 A;  4C2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...