1ZELA

Crystal structure of rv2827c protein from mycobacterium tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
296
structure length
293
Chain Sequence
AMVVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSGESVWAPEYQLVDELVVPLLRVIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Rv2827c
publication title Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 92
structure length 293
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09407 AbiEi_1 AbiEi antitoxin C-terminal domain
A PF13338 AbiEi_4 Transcriptional regulator, AbiEi antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1040 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1zelA01
1ZELA
chains in the Genus database with same CATH superfamily
2IGMA 5AIQA 1BL0A 4IRIA 5K7HA 2LBFA 4UB6C 2VQLA 2LVSA 4KDPA 1R58A 4YG2F 3JAMZ 1W5SA 3J7AO 3IAS2 1CGPA 1KA8A 2VXZA 3I53A 5M3FJ 2IJLA 1LVKA 1K78A 3T0YA 1YTYA 1YJNI 2VOPA 1QBJA 1FMVA 3Q3SA 4IO9F 2ESHA 3S2WA 3IWZA 4UB8C 4AUXA 2BEOA 2VBYA 3GTMJ 3P5JA 5CVIA 1SD4A 3LOCA 3CDLA 1FYLA 5HS9A 1WRJA 1FOXA 1NK2P 3J81K 1ZRFA 1AOYA 3FISA 1IN4A 2H8RA 1RKWA 4V19K 2DFEA 1OMIA 1STZA 4KNYA 1YS6A 3B73A 1HKTA 4HQEA 1A36A 4XORA 5DV5A 5D5WB 2BHYA 2ME6A 1G6NA 4XSZF 2DA4A 1VQOI 4DOZA 4E7SA 4JOMA 4P9FA 4EV0A 3WE2A 2GA1A 2EILH 4UUTA 1A5JA 3W6VA 4IHVA 1I6XA 2BXZA 1A35A 1SAXA 1YYVA 1WJCA 2L9VA 1QQIA 3KETA 1TQPA 4PUSA 4B4CA 4MO7A 4FQGA 4WX9A 4L9NA 3OYIA 1V3FA 2I8DA 2VJ4A 3GYHX 3KPHA 4M3GA 1IW7F 3N4MA 5E8GA 2L0KA 2K9SA 3OL4A 4M6YA 1P4WA 4LLGF 2OA4A 2ZFWA 2HNHA 2ZO4A 2DTRA 2NS0A 4Z2YA 2VQCA 2X85A 3OV8A 4E4HA 1UZCA 5D6EA 3H5AA 5GPCA 3BOQA 2L01A 4CDGA 4IRGA 3WGIA 2D1HA 1YS7A 4IPAA 3BTIA 3V4GA 2E35A 2VC1A 2XSDC 1K6YA 3OYAA 2PQ8A 2DO7A 1YFHA 4GDFA 3HOVJ 1FTTA 1SVOA 1QNTA 5B3SH 1YOVB 3OWTA 1D5VA 2LY2A 4NQWA 3BPXA 2NNYA 2CQKA 3VSKA 1FYMA 4XKCA 4G8XA 4UVBA 2IT0A 2Y0SA 4G6TB 4DYRA 3KEOA 2EZLA 5J8FA 2LNBA 5BS6A 3HHHA 5EEGA 4L5IA 3J7AY 1G59A 2GM4A 4NQWB 1O3QA 3OYLA 1NG6A 3FKIJ 3FKJA 2R3SA 1U3EM 1AKHA 1S6LA 2W48A 3K7AJ 2M0CA 2ME0A 3MMYB 4A0XA 4QIWN 2X6YA 4KITB 2IPQX 2I10A 2TRTA 3FIWA 3R0JA 4AM3A 3QRFF 1VF9A 2Y48A 4B47A 5JVTA 4U88A 1OR7C 5H20A 4IHYA 5HNHA 4CSWA 2V9PA 4M9SA 1Q1HA 2RKHA 1XSDA 4XOPA 2XAUA 4DNCA 1SVMA 4E7IA 2CUEA 3BG6A 1RUNA 5DD8A 2STWA 3BJOA 4AWXB 4F3QA 2NOGA 4EM2A 2K4BA 1REPC 2D5VA 3DWLE 2LRDA 3OS0A 1SC7A 2VL8A 3FXRA 4LB6B 4D0PA 1GDTA 3BDDA 3BQZA 2M1BA 2GIZA 4BY1J 3QWLA 2KJBA 4X1EA 1YJ9I 1ETWA 2DK5A 4L9VA 5CVVA 4BNCA 1RNLA 4YRVA 4E7HA 3LSGA 3CUQA 4DJAA 5JHFA 1TT5B 4KMFA 3BJ6A 2M7BA 3CC2I 3CD6I 2W25A 1XPXA 1K83J 3OIOA 4BJTA 3HTUA 2VBZA 1K61A 1JUSA 4ZYDA 4NB5A 3HOUJ 3CUQB 2L7MP 3L2UA 3HOXJ 1YLFA 3C7JA 4A69C 2JZYA 4HYEA 2EBIA 3VOEA 4N0BA 4ABZA 2X51A 3DPLC 4S05A 3ZN1A 2HDDA 2YS9A 2ZFUA 2A3SA 4OAZA 5DYMA 5EYRA 2JMWA 2MABA 3RIRA 3J81Z 3COAC 2JA6J 3S1MJ 5B1BH 2E1CA 2HXOA 4KISA 4ZZDA 2HU9A 2WB1N 1LE8B 3GVAA 2LK2A 5HVQC 1GUUA 5IT9Z 2EWNA 1AA7A 3OS2A 1O57A 5FFZA 1VQKI 2EJRA 3AKZA 4ZYAA 1LDDA 3GFJA 2NVXJ 1F43A 4ESFA 2XGCA 1G3WA 5F6FA 4R1HA 2R7OA 2R7ZJ 1Z7LA 2VE9A 4FETA 1VQMI 1TBXA 1SMYF 4LD5A 2G7HA 2ELJA 3PUBA 4IQ4A 4CCNA 2UV1A 2ISZA 2PJRA 4RLQA 2QSGX 4BHBA 3X2QH 2Y69H 1D1CA 1LFBA 5D8KB 1NHAA 3ZMDA 1W36C 3LWFA 2P4WA 3TDZC 1XN7A 2MLGA 3BJAA 5TISC 3OYCA 2FUG2 2RVCA 1HSJA 1ZYRF 2L7FP 2NVQJ 3R6SA 1I27A 2DTZA 2F5VA 4P96A 5LHIA 1W7PD 2PJRB 4BQAA 4LITA 1TWAJ 2A05A 2MD5A 3S14J 5GAHJ 2GBYA 2CV2A 3IP4B 2VI6A 5C44J 4WXHA 2NNNA 4RBOA 3IV5A 2OU2A 1K4SA 1JKOC 2YR2A 1J09A 3N05A 2VQHA 1S8NA 3FXUA 1XC5A 3VB2A 1HKSA 2VB6A 3LSJA 1HA8A 3GFLA 3A0HC 4CUGA 1OQYA 2H1KA 5KK1A 1FIPA 3CP2A 2GLOA 3U2RA 3PL8A 1QA6A 3TO9A 2XPVA 4XM3A 3D0SA 4CICA 4JYKA 3HOZJ 2ZJPF 1Y8RB 4Q48A 3OYGA 2P5KA 2PLYA 5JLWA 1HSTA 2EV5A 3BY6A 3HHGA 2AS5F 3PFIA 4E6KG 3F6OA 1ZELA 3QAHA 4ON0A 2QSHX 3O2PE 4PJLA 4DGWB 3SZGA 4RB3C 4HEA2 5K5RA 2XGEA 4L5JA 1W36D 3LFUA 2E34A 3FMSA 3IL2A 2R93J 5CQEA 3S2DJ 5H6QA 2Z9OA 2EZHA 3DPTA 1W5CC 2Y75A 2XKPA 3DP7A 1YIOA 2QBYA 1ZARA 1YW7A 5GPAA 1MDMB 2VKEA 5GTIC 4A3MJ 2PJPA 3UKGA 3KEQA 3TGNA 3DKYA 5IYBJ 4U0VA 1OYYA 1Z3YA 3MD2A 4L0ZB 4HQMA 1FJLA 3EYIA 2V79A 3A1YA 1FX7A 5L3DA 4ZZLA 1I50J 3OOPA 2WC2A 4CHUA 4XMYA 3KP3A 2QBYB 1B6AA 4F7ZA 4L0YB 2H6CA 2EIMH 1KYZA 3HPGA 3WTSC 4M72A 2VODA 2HEOA 3ZP5A 2CRGA 1YE9A 2XB0X 2HYFA 3DTIA 1U78A 2QUFA 2E19A 4WCGA 5ICCA 4ESJA 4XLHA 1KQ0A 4S0HB 3BCAA 1QHHD 2QQAA 1UMQA 2ECBA 3TEDA 1H8AC 4HZFA 5TJJA 1O3TA 2ZXWH 2DU9A 3ML6A 2R5YA 5BMZA 2CQ7A 3HXLA 5ILUA 4HX7A 1R4MB 2CV0A 1P9QC 3OSGA 1IJWC 3RZOJ 2ISYA 2KDZA 4J00A 2RAEA 3E3VA 3JRBA 5F1RA 3UNGC 2KJCA 1TQMA 2PMUA 3IHUA 2KMUA 3Q0VA 2R5YB 4DYQA 1FBQA 2FBHA 3HG9A 3MKYB 3D1NI 3M7GA 3TW6A 1VQLI 2FXAA 4RB2C 3TP3A 1HW1A 4BYYA 1T38A 1T08B 1B72B 4KA4A 5FLXK 1VQ9I 3HRUA 4M74A 3A2KA 2O9LA 2DAOA 2KIMA 1O3RA 3DQVC 2Q1ZB 3WU2C 5HS8A 1U0JA 1TP4A 4U7BA 2IRFG 4Y33A 4D9JA 3KZZA 2Q0OA 1X2NA 2KL4A 2XDVA 1DU6A 5KVRA 1XSXA 5EZGA 1UJ8A 1R23A 4A93J 1R7JA 3GUDA 2BVMA 1EA3A 2Q8KA 5A2QK 2DYSH 3I59A 5AIPA 2R7QA 1VNDA 4HLXA 1HW2A 1Z21A 2NVYJ 3I64A 4E7ZA 1K4TA 1LDJA 3ZR8X 2GXAA 4ZH4F 2Y9ZA 4TV7A 4EJWA 4L5EA 1Z67A 4BHPA 1XCVA 5FRMA 5FD6A 2QCOA 1P4XA 3PFYA 5CPRB 4FISA 2LD5A 1R4NB 2E7WA 5IYDJ 2R92J 1FIAA 3EUKL 1ZH5A 3DKWA 4FASD 3K2ZA 3W6KB 3S8PA 5BPDA 4JQFA 3NEUA 2CV1A 3PO2J 1FWZA 1NH3A 2L4MA 1PUFA 1A6IA 4BHCA 1FOYA 3IKTA 4HX8A 4ZDLA 4A5NA 2TDXA 1S9HA 2FQ4A 3F8FA 3ERED 2W4SA 2PX9A 5GAGJ 3P9CA 2VE8A 2M7AA 2DDBA 3HRTA 3FXJA 3I58A 2P5VA 3F6VA 1YJWI 1QVTA 3WG7H 5HDNA 2ID3A 3H0GJ 2DMUA 4O5VA 3BROA 3NRVA 4M6XA 1MGTA 3ZQFA 1YW9A 1LNWA 1E0EA 4YFKF 5HLHA 3RKYA 5KHDA 2L9RA 1D8KA 2HFHA 1ZK8A 3JSOA 2L4AA 1JXSA 1GLNA 2DT7B 2KRHA 2GXBA 2VJ5A 2X1DA 2L9NA 2XVCA 1ON2A 2IP2A 2FNAA 2O8KA 2ZXHA 1Z7UA 5FD5A 4RLFA 2NOJB 3DU5A 1LEBA 1JI8A 2JQ7A 1IXRC 1XMXA 4PGHA 3TOBA 1FC3A 3OIPA 2DPDA 4IL6C 1YQAA 3KYLA 5D4RA 3F8BA 1Z3XA 2K9LA 5BPIA 1I5ZA 3GX4X 4KT5C 2QKMB 3W3CA 4DQ2A 4UUSA 3Q5FA 2B63J 1X1CA 2DMQA 4HF1A 4OMZA 4EATA 1P6RA 2V1NA 1BIAA 1Y0UA 3JRFA 2XSJC 1RR7A 5HS7A 3DXJF 5DTDA 3M8JA 3ZXSA 2ZJRF 2VASA 1U8RA 3OR2C 5B5EC 3L2WA 1ZGJA 3LA3A 2VPLA 4IKFA 1IRGA 4NDLA 2MA3A 2XAQA 4UUSB 5B66C 1C0WA 2LF8A 4RGSA 1QGPA 1VQ5I 1A04A 5E3LA 2EFOA 3E5UA 4HNVA 3HB9A 3O6BB 4BUPA 2HKXA 5IP6A 4M9XA 2K40A 2M8GX 5EGOA 4KUMA 4Y4RA 3KZIC 2R4GA 3EUHA 3VEPA 2M34A 2IA1A 4BQNA 2IS1A 4FCYA 4KIGA 2V6CA 4BL0B 1U5TA 1MSEC 1GHCA 1VQPI 1FSHA 2M0MA 1JJ6C 4RDUA 2WAQA 3IH4A 4G7HF 5JHUA 2DYRH 4FHTA 2CGPA 4HNUA 1QRYA 2OBPA 5C3EJ 2GOXB 3JRGA 2HQNA 3DBRB 1W7PA 3MVPA 3TBIA 1MH3A 3ECOA 4ZTFA 3OYJA 4XQFA 4GXOA 3LL7A 2IBDA 4G12A 2QGUA 3WTTC 3ZQQA 1TWGJ 4FTHA 4NBQA 2UXNA 1YRNA 4M3BA 5LEKA 2XAGA 2DOFA 2FSWA 1Q1VA 2LY1A 1FBUA 1X3UA 1W7PB 1RIOH 3JW4A 4MEXF 3B6CA 1MIJA 2HZDA 3AAFA 2DFIA 2HI3A 5F64A 3H5RA 3HGYA 1VI0A 4PJJA 4NHJA 1T56A 1G4DA 2OV7A 1YHQI 3FX3A 2JJ7A 3DEUA 1YRNB 1HDDC 3L7WA 3BWGA 4RB0A 5KAIC 4A6EA 4Y7NJ 2Z1DA 3BC8A 3I0TA 1WPKA 3HUGB 5F04A 3O8GA 3PSIA 3KIOA 5L3CA 2JRMA 4YELA 2OF7A 2VLAA 4EJTA 4OU0A 3ZOBA 2LKPA 3S3OA 4BEHA 3HOYJ 3HZJA 3H92A 1WH5A 4M9ZA 2K9NA 4EJUA 1RESA 3QYBA 3DBLB 2LBFB 3BR2A 2HTJA 3ZMZA 2DK8A 2KHMA 4S04A 1XGNA 1A31A 5E3MA 2I5UA 3WHCA 3CO7C 1JT0A 2AO9A 2JPBA 4BEHB 1QVUA 2K9MA 5EZHA 1K78B 1TZLA 1X58A 3ECHA 3GWZA 3FMQA 3HRMA 4A3IJ 3ABTA 2HVQA 3U1KA 3E0JB 2MFZA 2CW7A 4MFEA 1KU3A 2Y2ZA 4DW6A 3OS1A 3BCBA 4XRSA 2CQXA 3CCRI 1RKTA 3PM1A 3S1QJ 1MMGA 2JRTA 3L2QA 1PP7U 1MJ9A 1XG1A 4IHXA 1UFMA 3DLLF 1S5LC 3ONQA 1MD0A 3K1MA 2EIJH 2DA5A 3ZPLA 4LK0F 4N4NB 3BLYA 1VFCA 2BOLA 5GP9A 1E3HA 1TLHB 2M4GA 4BAYA 1BC7C 2YUSA 5D8LB 2NRAC 1FYKA 4L18B 2IAIA 3GFMA 4JP0A 1BI0A 4QWQA 4XNFA 4BS9A 2E1NA 3G1MA 1J5YA 2HS5A 5E20A 1PJRA 2JPCA 1ZHFA 2K86A 4KMUX 1PP8F 3HEFA 1X2MA 3NQOA 5K7ZA 2CW0F 3RYRA 2O03A 2P7CB 1QU3A 3KYDB 2VKHA 1IC8A 4A12A 4X6AJ 4UY8I 2A61A 2K4JA 4A3KJ 4IQJA 4HPQA 3JRCA 2ELHA 2R5ZA 2Y30A 3ZN0A 1V55H 5HDGA 2DOAA 1R1UA 4GCVA 3FHNA 5F08A 2DA1A 3F72A 5K5OA 2JVGA 2R7XA 2CFXA 1OFCX 4CA0A 2QM3A 2GIVA 4J01A 2BW3A 2HYGD 1HBXG 1JKRC 2HOAA 4Q5SF 1L0OC 3CCVI 3CJNA 2K5CA 4H0EA 2H8WA 2FU4A 2QQBA 3PNYA 4PSXA 4WK8F 4MFDA 1T2KA 2DXIA 5LD2C 3HOSA 4PGGA 5CKTA 1F9NA 5F1JA 3J80K 4BXUA 3BR3A 3V8KA 3RZDJ 2BW3B 2Y31A 3OOUA 4CZZA 4LG3A 4BE2A 3MZYA 4NNJA 5JI6A 1AKHB 4BBSJ 5H6RA 1J0RA 2HVRA 2ACJA 2JA8J 1MBGA 1EH7A 3W2WA 2WTEA 3Q0UA 4OINF 5M5XJ 1BA5A 1TTYA 1ETQA 2R7RA 2DI3A 3QP5A 4HV6A 4F92B 2G7UA 1R6RA 2X9DA 2FMYA 2O7OA 2RREA 3LMMA 4RGXA 3AG2H 2YSRA 4I0BA 1SD6A 4J19A 3HM5A 2KZVA 4XIDA 3HOWJ 3JR9A 1JKPC 3SFIA 1HDPA 2AQFA 4XLNF 3BP8A 1USSA 2WAEA 4ETSA 3FBNB 5IPAA 2M2EA 3KYCB 2JWTA 1HW5A 1B8IA 2HOEA 4MIMA 1LB2A 3LSIA 3RQ4A 3S15J 1JGSA 2IS2A 4OWRB 1R22A 5LHHA 1E3OC 1MMAA 3G4SI 1G8XA 2VT2A 3K4KA 3T8TA 2EFPA 4B43A 2OAZA 2RGVA 5ILVA 4X0GA 2PG4A 1I6HJ 3EUHC 3ASNH 3CC4I 2X4HA 2LC2A 1ORKA 1B8IB 4ZDPA 5JR3A 4CGZA 1RRJA 3I4MJ 4ENNA 3FXKA 1G3TA 1ZG1A 5FGMA 1U5TC 5E3NA 5L3EA 3M4OJ 2KRFA 2H09A 5EEAA 1BW5A 1OCZH 2QZ8A 3KP2A 4OMYA 1EF4A 4GRIA 3QU6A 2HXIA 3BG7A 3TKYA 3ASOH 1FOWA 3SZTA 3HC7A 2E36A 3I3LA 3L2RA 2O61A 1U2WA 1TWFJ 2A6EF 1XS9A 4MQ9F 3L2CA 1ZRDA 1WJFA 2FEZA 3MAJA 1HOMA 1LUJB 4A3BJ 4I6ZA 2CG4A 2WV1A 5J4YA 1FZPB 3ABLH 4I76A 4M6VA 3S32A 1AWCA 2IVMA 4RM2A 3C2HA 2F48A 3K70C 1HF0A 2W1OA 5ICFA 4PZJA 3G6EI 3E5XA 4HSTA 3KEYA 3CDIA 1W0UA 3VSLA 1S3JA 4C2MJ 2VBXA 5LLQA 4RMNA 4L9JA 4XSXF 5JVGF 2EK5A 4G7ZF 4BQOA 1WFXA 1MJBA 2XAHA 5LGTA 3T5XA 2XF6A 3LQQA 2F4MB 2ECCA 5C4JJ 1OYIA 5J6XA 4KIFA 1R5ID 2IEKA 1QPIA 4EM0B 2M87A 3UR3C 1IXSB 4IHWA 3ZQGA 2DFFA 3ULQB 2X0LA 4R79A 3KP6A 4CYCA 2ZJQF 2E60A 2K27A 3JTGA 5HLIA 2DODA 1FPQA 1X1BA 3E6DA 4BY7J 5DD4A 4XLEA 3SEZA 3OMYA 4AIDA 4IZZA 5CVRA 2GXGA 4AYBN 3WTUC 2CMPA 2LF7A 3HPHA 3OYFA 3KP7A 2QLZA 2V7FA 1TC3C 3VWBA 5DUIA 4UNOA 1L3LA 4IHSA 3ZMSA 2Z99A 3SQNA 2OTLI 3CMMA 5FKMA 3V8JA 1SAUA 3SEQA 3K70D 3BG5A 1HXDA 1EV7A 5DDGA 5ED4A 1DDNA 2FBKA 2Z33A 3Q0WA 2F4OB 3ABMH 2R7WA 4OIPF 2CO5A 5KCMA 1UELB 3SZPA 2EQRA 2AQEA 3ZMTA 3E1SA 2R7DA 3J80Z 4AIJA 1DUXC 3KLNA 5LRSA 3T8RA 5TRDA 2QSFX 2L9SA 2DT6A 4BE1A 4RAZA 4E7KA 4F52A 3LFKA 1MNEA 3WTXC 2KIFA 2QEXI 2EZIA 1IRXA 3F3XA 2WWYA 4C30A 1B4AA 2VKVA 1ETKA 1MBKA 3DLAA 3H9QA 3QP6A 4RGUA 3AG1H 2STTA 4KFCA 4C9YA 3MWMA 2LY9A 3H0DA 1A6QA 2O3FA 3HYIA 3ZQHA 4A0YA 5FLMJ 1ZRCA 2XGDA 3S93A 3E6MA 3EUAA 4CO8A 2FX0A 2QF7A 4EMSA 2P0WA 4ZC3A 3SYTA 4U87A 4I2OA 2HOSA 3F0CA 1O7FA 5E1WA 4V2FA 1D1AA 1V5EA 1SD5A 1NK3P 4JK1X 3OY9A 2BGCA 1VQ7I 3IRQA 4AC0A 5D5UB 5EG0A 2MH2A 2DDAA 3CMYA 2NVUB 3VFZA 3K4MA 1YIJI 1M1EB 2P7VB 1KGSA 1TQIA 2DMNA 2FD5A 3P9KA 3KP4A 1G3YA 2QENA 4HG2A 2JTVA 5KAFC 3DKXA 5ICGA 2EV0A 3DPUA 1RC9A 2DLLA 2Y9YA 3H1CA 2HGCA 2X48A 2XF7A 5EG0B 2E2HJ 1X1PA 2YU3A 4BE0A 5D4SA 3I55I 5DCMA 3OYHA 4PJMA 2EFNA 4WF2A 3JCUC 2EH3A 5B1AH 1CF7A 4MTDA 4I7HA 4QPQA 3VODA 1Z77A 5M3MJ 2CH0A 3FDYA 1ETYA 4W1UA 1UHSA 1N25A 2OD5A 2ESNA 4M3FA 3SFZA 2IGNA 2JUCA 3CCUI 1SFXA 4IJAA 3QYEA 1IUFA 2RQQA 5DCMB 3TW7A 2CWEA 4HAMA 3PJRA 1R1TA 1IRFA 1CF7B 4UV9A 5FJ8J 3H9GA 2KISA 1OCCH 1SFKA 1P4AA 2WB1A 2IXSA 2ZXIA 3VDXA 5L3GA 2Z2SB 3CC7I 4A2UA 3I9V2 4U7DA 3GZ6A 2FNPA 1IV8A 2ZKZA 4RB1A 3ELKA 1K79A 2HDWA 2FE3A 2JSPA 2XKOA 3E5QA 1XB4A 4LG0A 4BACA 4QTRA 1BOBA 4XRMA 1X3ZB 2XF5A 5TGTA 4XLPF 4B3AA 2F2EA 3ABKH 3K4JA 3PIOF 2NXNB 3K4BA 2MH9A 1IN8A 3K4CA 1AHDP 4OOIA 2EB7A 4LMYA 4IX7A 1KONA 2XB5A 1YX3A 2Q2EA 1ZG3A 4D5FA 1F1ZA 4HLYA 1X4OA 5BOXA 1XMAA 5D5VB 3IRRA 2HVSA 4P55A 2EIKH 3I59B 2EV6A 1H9TA 1ZKGA 3GLLA 4JX5A 5J1RA 1POGA 1WWXA 1H89C 4Q47A 3FF5A 4XN0A 5J3LA 2R7TA 1ZAOA 5DM6F 2WY7Q 2Q2EB 2W00A 3L09A 2H1LA 3GZ5A 3K1NA 2CQQA 5CQGA 2L02A 1SFOJ 3BR1A 5GAEJ 3QPSA 2XRLA 2QVOA 1YG2A 4AYBA 1I1SA 3L2VA 3RPUD 5FKLA 2OJED 1IF1A 4E7JA 1BJAA 2D45A 1KU7A 2HQRA 2WAFA 3H3UA 1R00A 5E17F 3FWEA 1IZ1A 3RSNA 3LSKA 3S3NA 3IUOA 3CCQI 3LSRA 4NC7A 2L54A 3OYKA 1I3QJ 2ZXJA 1BR1A 4DBRA 2BY3A 2WV0A 2DW4A 3BZ6A 3CCYA 2JK3A 4EEFG 4Q4ZF 1T0FC 4HA8A 1U9OA 1AU7A 1BBYA 2XGXA 3CMAI 1DPUA 5J47A 2ZB9A 1JT6A 3ISPA 1VZ0A 1PUFB 2E2IJ 3IC7A 3NWTA 5HNFA 2DPUA 2DFHA 1MMSA 1ON1A 1QO0D 2RC4A 4HF0A 3K10A 3V7RA 4EM1A 5M5WJ 3KLOA 4IOCF 1MH4A 1EH6A 2CU7A 3F8CA 4DZPA 2FJ1A 3QYFA 2GQQA 3ZQ7A 2XASA 2M5WA 4QPOA 4NC6A 1F36A 4ZYEA 2EA4A 3R0AA 2M8EA 2IA0A 4BJ6C 3GLXA 3BPVA 1FP2A 2ZCWA 4I98B 2A69F 1ENHA 4PFOA 1Z9CA 2B7EA 2ZBKA 2JA7J 2VPRA 4QSHA 2M30A 2UZKA 1H9GA 2F5DA 3BR0A 1Z0XA 3PQJA 2JT1A 4ZDOA 1EH8A 4LIUA 3AG3H 4A6DA 1I3AA 2BY1A 4GFBA 3W2AA 2AXLA 3Q9SA 1MKMA 2MW8A 1TNTA 2LTPA 4E70A 1JE8A 4FX4A 4XLFA 3ROUA 3BTLA 5FLVA 3RCOA 1TT0A 1K7AA 1WSUA 1OISA 2F6CA 3M8FA 4C2TA 1JTYA 4RAYA 2OUMA 1R5GA 4JX6A 3RKQA 2FF4A 1ZG5A 5D6FA 2OQGA 3CCEI 1UHMA 4G9YA 4G7OF 2XROA 1IRZA 4A3EJ 4CCMA 3O8HA 2COBA 2L2OA 4A3GJ 5F0CA 4EGZA 2FOKA 1ZQ3P 1VQ8I 1BR4A 1QZEA 4YIRX 1IUYA 3DV8A 5E79C 2AXTC 2P8TA 4UXNA 2L3DA 5FLXZ 2LR8A 2GOMA 2IA2A 2V4JC 3OYEA 3W6JB 4WWCA 2COMA 2DA3A 3GXOA 3A01A 4O3MA 1BI3A 1LKXA 3CDHA 1HQCA 3HRSA 1Z05A 2VC0A 2E7XA 2HYJA 4HDUA 5LEJA 4AU7A 1R49A 4B8XA 5EGOB 1D0YA 3O3KA 3K4NA 4A5MA 1USTA 2KKOA 1ULYA 4FE4A 4YFNF 5IP9J 4CCJA 4M3DA 3OYDA 4F91B 1LQ1A 1Y1WJ 2LLKA 2VBWA 3M1CA 4ENJA 4I02A 1MMDA 5A2QZ 1U5TB 2E1OA 2VIXA 1RZ4A 2R7FA 3CJQB 2GAUA 3GFIA 5DUKA 3RDIA 1U6GA 1D0XA 1OCOH 3ABUA 1ZGAA 3REOA 2GWRA 3LQRA 1XDUA 1P7IA 1R9TJ 3CF5F 2CFOA 1YX5A 1IGNA 5J8CA 3ZGKA 2XIGA 3F23A 2VJJA 3CF2A 4II3A 3GTOJ 3BTJA 1ODDA 4BKXA 3OYBA 2WBMA 2M3AA 4QLCU 5HLGA 4NC8A 2P6SA 1JGGA 3ZRGA 4HDVA 4II2A 1TWHJ 1XCBA 2LKSA 1B9MA 1Z91A 2G9WA 1B1BA 1X1DA 2DOEA 2KIUA 4DIQA 2TCTA 2KT0A 1N77A 2FQ3A 4Y15A 5DCFA 3I56I 1VTNC 1J7KA 4IRHA 3KP5A 1IN5A 4H4KC 3RKXA 2HZTA 3JRIA 5LRRA 4C3HJ 1U9NA 3P9IA 4C3JJ 1IDYA 4RM3A 2HOTA 3LA2A 3WG9A 1KU9A 2D2WA 3SDGA 4Z6YA 2H6BA 2W82A 1SEUA 5FO5A 3CQZJ 2LOOA 1ITYA 3GBGA 3I5UA 3M07A 2WA0A 3OIQA 2MLKA 5E1XA 1UG2A 4MTEA 1ZREA 2A5WA 1TNSA 5HLTA 2N8GA 4GYGA 2X1EA 1X1AA 1S7AA 4L9TA 2VQGA 2JSCA 4BXFA 1DPRA 2XHKA 3SXYA 3H9JA 1E17A 3G1LA 1D3YA 3FK6A 3AL0C 3DTEA 3TP0A 2BYVE 3JTHA 3VYSB 2O8XA 3WE3A 3QPLA 1X4PA 3MN2A 2K02A 3HIFA 1GT0C 3OSFA 2HDCA 3WTYC 2KFDA 1I1GA 3QODA 5ERIA 4WXCA 2VJIA 3I4NJ 5IT9K 2JA2A 4U0WA 5GADJ 4ZYHA 1H0MA 3S1NJ 1ZN2A 3EETA 4B44A 2QYOA 3CJRB 2QWWA 1BI2A 2VN2A 2E5NA 3QU3A 2KRCA 3TOAA 3WHBA 4XRFA 2V9VA 1MW7A 5JLXA 1R5HA 2OQRA 2K7LA 1IV6A 2D1VA 2VXDA 3C3WA 1IN7A 3FM5A 4DZJA 3PO3J 1FLIA 3VYTB 3DEWA 5CJ9A 1JHHA 2DBBA 4LLNA 4LK1F 4CCOA 4DYCA 5K7FA 1T8IA 5DEQA 2OC6A 2ZMEC 1BC8C 2BHZA 2MYSA 4K2EA 3DF8A 3VYRB 2DJNA 2EINH 4U0YA 3WGGA 3IH2A 3K0LA 1Y6IA 1PYVA 2LP0A 3DEEA 1WJDA 3VYUB 2A6HF 1S7EA 3A0BC 3JSPA 5H2FC 1MSFC 1TWCJ 2CQNA 3H36A 1SFUA 1FTZA 3I4PA 4LJZF 3VPRA 3BG9A 1UG0A 2NAZA 3TQNA 2R5ZB 2CYYA 5FFXA 4KT6A 5IY5H 3CCMI 2W24A 3F9KA 3HSEA 1ETOA 5E8IA 2IS6A 3D5RC 2BY0A 5LGNA 1QZZA 1ACIA 3GTLJ 3N97A 4XRSG 1BI1A 1GXPA 4CCKA 2HQAA 1P2FA 1SANA 2PEXA 4G6DA 2E1MC 4JBAA 1HLVA 1LJ9A 5F27A 1WI9A 4YIIA 5IP7J 3MKZA 3FK7A 3EPZA 2M4KA 2RN7A 5EJCA 4G94A 2IW5A 4N4OB 4UHTA 2O0YA 2H27A 1YI2I 5ICEA 1J75A 1Y56A 3EDPA 3HKZN 5LGUA 3JRAA 3PNVA 5L3FA 2Y0MA 3S1RJ 1UAAA 5AONA 1MJAA 3HL2A 3RPUA 2L5QA 2LSOA 3GMEA 2X6XA 3AFHA 4Y52J 1QZYA 1B9NA 1HKQA 3LSMA 4PFPA 1Y8QB 2YPRA 1FY7A 1WKMA 3HGGA 1ZGWA 1ZTRA 1WGXA 2PMZN 3U21A 1LEAA 4EJOA 2W84A 3WU0A 3RYPA 2B0LA 4D7NA 1N78A 1MMNA 1FMWA 2GZWA 1CQTA 1FBSA 2OCEA 1KZHA 1T33A 2DQLA 1WJBA 4FT8A 1SMTA 3MFKA 2ADUA 2ICWG 3OYNA 3A4CA 3IWFA 2K3FA 2ETHA 3ZMVA 3WTWC 1TW3A 3PNTA 1FOKA 1APLC 2LREA 1PVEA 3CUOA 4EVIA 3HBLA 4BDZA 2MG4A 3LAPA 2P6TA 3B6AA 3BT9A 1JKQC 3J7YJ 1LE8A 5CYVA 3WU1B 3E97A 4XN3A 1FP1D 3RQIA 3DU6A 3CLQA 3GZNB 3BG3A 4GYIA 1QHGA 4HNTA 5C4XJ 4R8HA 2LKXA 1SD7A 2HKOA 4GO1A 5FKKA 1JHFA 3ZMUA 4YFXF 3BR5A 2F4IA 2IGKA 4I09A 1PUEE 2OCCH 1XGOA 3L00A 1T0FA 4ANJA 1R71A 4I01A 3FBIB 1BJZA 1XGSA 2OZ6A 3C2BA 4CZCA 2V6EA 1GXQA 4A3FJ 1I39A 2DMTA 4A3JJ 4AIHA 3LSPA 4ZTJA 4MNUA 2DA2A 2WADA 2DMPA 2EFQA 2QKLB 2VONA 4UV8A 2K85A 2B9SA 1KQ9A 2EZKA 5CVJA 1SVLA 3SJMA 3K9TA 3GTKJ 1JUMA 3JRDA 1R36A 4OIQF 1MZBA 4A3CJ 3KFWX 2KP6A 2LDUA 4LGWA 2YU9J 4XKVA 3J7ZI 4BDYA 1OCRH 4MGRA 4F55A 5ILSA 3B02A 3S17J 5E18F 1D0ZA 1J9IA 3R4KA 2F5CA 1WCMJ 3QQAA 4CYCB 3CJTB 2GA2A 1WQ2A 3KZYA 4Y13A 1XD7A 1LPQA 5FKOA 2VUMJ 2XUBA 3H3VK 2KZGA 2C6YA 4IEJA 2KIQA 2CSOA 3WTVC 3F22A 2DJIA 3HDDA 2XRNA 2XC7A 1BOAA 5IYCJ 2DT5A 3CP8A 3GTJJ 3PIPF 4ENKA 1TW2A 2V26A 3QPTA 1FEXA 1JUPA 1WJ5A 3W2VA 1RI7A 3KX2A 1V5FA 1GVJA 2LMDA 4B09A 1ONVA 4XK4A 3SHFA 1IN6A 1BN5A 2CW8A 2W85A 2R7UA 4PCQA 4PDKA 1WVRA 2R7VA 4P5OA 3GF2A 3HTSB 5GTHC 5HDKA 2FRHA 4Y17A 3NAUA 2XAJA 4N9IA 3LNQA 2HPMA 1S7OA 4F93B 2UWMA 3FMRA 3RI4A 2V1DA 3M8EA 3RJPA 3S16J 1WH7A 5LBQA 1ERDA 3DCFA 3HSFA 3IAM2 2DCEA 3OR1C 1T6SA 4BQQA 5F0HA 2BE5F 1WHUA 5BQTA 3H35A 1F4KA 1WJAA 3PUFA 4RS8A 1OKRA 3U9GA 2BV6A 4EQQA 2ZJ2A 2DN0A 2WY8Q 5K5QA 2ZNYA 1MDMA 3ZQCA 4LLLA 2LH9A 2VT3A 2MGQA 3GO5A 4M71A 3ZQIA 2ZNZA 4GGGA 3HJEA 4MEYF 3V7CA 1PDNC 1OCPA 3MZ8A 2NS8A 3MCZA 1W5TA 5IOYA 3M3YJ 3QPHA 2RNGA 4LIVA 3HKZA 2FBIA 2KLOA 3DTKA 1DGRM 2M45A 1Y1VJ 5K1YA 3R61A 2CS3A 2DA7A 3T1BA 3ZCOA 2Z16A 4A0ZA 1MNMC 2V1XA 3S3MA 3P7NA 3R60A 2FA5A 1BM9A 2MSYA 1DP3A 1GVDA 1SFEA 2PBIA 1LFUP 4A3LJ 4HBLA 4PK4A 5FRNA 3K2AA 3CMEI 4OIRF 2P5LC 4DBQA 1O3SA 4WXDA 3GW2A 3FHZA 2BZTA 2JUGA 1R1VA 4RAFA 4HV5A 3TMOA 1IDZA 4XLCA 3C1DA 4MQVA 2ID6A 2PMZA 3KE2A 4HF2A 1OYWA 2NVTJ 5CLSA 4Y3OA 4FX0A 2O6GE 2L7ZA 4XKBA 4D1QA 2HPIA 4P9UA 3RTRA 3QOPA 1EJ9A 4CYDA 1RUOA 3OL3A 2HWVA 2M9HA 2IS4A 2A68F 2OTJI 3BQYA 1XDSA 1VQ4I 3G3ZA 3RKWA 3BZCA 1W0TA 1OLTA 1G2HA 3E7LA 4LOCA 1B72A 1P7JA 2V1UA 4W97A 4OAYA 5IT3A 1K6OA 1IO2A 6PAXA 4FE7A 2HR3A 2VOOA 1X3WB 3TDUC 1MNDA 2HQ5A 3CO6C 2Z3YA 2RDPA 2J5PA 4P1WA 3K1PA 3TO7A 2E71A 4E7LA 2BVLA 3F8NA 9ANTA 4KN4X 1UB9A 1O7LA 2WAQN 3M1EA 2PFBA 3G2BA 1XTAA 3BR6A 3QOEA 1ZLJA 1MBJA 1TL8A 5CVUA 4D5CA 4A3DJ 2BY2A 2G0EA 3S2HJ 4V2GA 2PN6A 1KYWA 4XKWA 1IG7A 4LG0B 3LSTA 1FNNA 1ETXA 1OJLA 4I99C 4HRIA 1Z6TA 1WI3A 2MC4A 4B1RA 2LYCA 3CUQC 5DS9A 3GEZA 1KQ8A 2IGOA 2JVHA 3E6BA 1LVAA 4RAGA 3CTAA 4AVZA 5JFRA 1XGMA 2HTSA 1GV5A 3AL0B 2DQRA 3IKVA 3K69A 2QQ8A 2RNJA 2MBFA 1DGWY 1HC8A 4KN7X 4PJ0C 3GTQJ 1N75A 3FXQA 1XMKA 3CZ6A 4N9HA 1RPWA 2FOWA 2PI0A 3WODF 4ZYGA 3G73A 4AIKA 1NG7A 3OYMA 2JN6A 3A03A 3LSHA 1D8JA 3E6CC 1HCRA 3M9AA 1W1WE 3U1DA 4UVCA 4AD9A 5EDNA 4HOBA 3CESA 2E5ZA 1FT9A 1V4RA 2BBYA 4BJ5C 3TL4X 4NUBA 2L7KA 1ZR4A 3CLOA 4B48A 2MC3A 2NS7A 2ZMEA 3G1OA 4PJNA 1MBFA 3IH3A 1E3PA 4BGDA 2EFWA 3GTGJ 1B59A 2P81A 3EQLF 3I71A 4KICA 5E1ZB 3JAMK 2FMLA 3V7SA 3PSFA 4BBRJ 1X19A 2KDOA 5EEHA 3FXMA 4B3XA 1S29A 2YX7A 3K6GA 3GTPJ 3A02A 3C18A 2ZMEB 2LFBA 2A6TA 2XV4S 5J1YA 5DM7F 1VQ6I 4BXXJ 4O6JA 4PSWA 2RV8A 4XBFA 2UUZA 3HOTA 1OPCA 3ZQLA 2AHQA 4JX4A 2O5RA 1GV2A 4HSRA 1BR2A 1OCTC 1EKEA 1J2XA 1LDKB 5J4VA 2OPTA 4KJZA 4HX4A 4CXFA 3FZVA 3ESWB 3HSRA 4ESBA 1DQUA 4C2UA 2RQPA 1D1BA 2ELKA 3FXOA 1V54H 3MZHA 5IOZA 1DP7P 4XOTA 3V42A 4XONA 3BZKA 2H94A 3NWSA 2DA6A 5EF6A 2W57A 4ITVA 2V9KA 1Y0NA 4KYWA 4ZJZA 4XLAA 4LB5A 2QA4I 1T95A 3F21A 2E1MB 2OZUA 2K9QA 1OR7A 3MEXA 1F5TA 3G71I 2CUZA 3TO6A 4MLOA 2KQRA 2MD0A 3CCSI 2E2JJ 5HODA 3BTCA 1IAWA 2XAFA 5KNLA 3L9FA 4IHTA 2A07F 2K3PA 1MBEA 2EPFA 1RR8C 3RPQA 2F5EA 2A5YB 2NYXA 2Y0SN 1Y39A 3NARA 4RGRA 1BIBA 1DU0A 2XPWA 5LHGA 4C3IJ 3SDBA 2XPUA 3WGHA 3MQ0A 3WTZA 1WJEA 2KPMA 5J1UA 2QQ9A 4MHGA 1FSEA 2UXXA 3ERMA 2W7NA 3FXLA 1NTCA 2Z5UA 4EGYA 1IXCA 3H5NA 4BU2A 1MBHA 4BH9A 1G3SA 5FB2A 1ZLKA 4D7MA 3EYYA 2VKDA 4M73A 4EJVA 4IF4A 1JTXA 3DBHB 3MKLA 2X1CA 5FROA 5FKNA 3A01B 1U8BA 1ETVA 5F0FA 1J59A 1KU2A 3Q9VA 1O4XA 1QPMA 1T39A 4LFUA 4ASNA 2CJJA 1RETA 1D5YA 4XL9A 1UCRA 5BNGA 5J40A 3DFGA 3CCJI 4UVAA 4G6QA 2CUJA 4I0AA 3FM3A 5LFAA 2PMHA 3L1PA 1H88C 4RA2A 4AVPA 2X6WA 1UHWA 1T98A 3JRHA 3PQKA 4IVNA 5D5XB 2R0QC 1LFPA 1WZ2A 1XSVA 2ZC2A 2LG4A 3D5SC 5M5YJ 3KCCA 3I54A 1JJ8C 4OIOF 2JA5J 3GCMA 2ZSIB 4HW0A 4XICA 5HOOA 4IXAA 2ZSHB 3MKWB 4CCLA 4M3EA 3LA7A 1Z1DA 3LAJA 3K4LA 1V5GA 2BXYA 3HUGA 4IOAF 4CH7A 1YO5C 1ZR2A 4XR6A 1BW6A 1VQNI 4YEJA 3D5LA 5L3BA 1S72I 2J5OA 2CUFA 1Z6RA 2F5FA 1XX5A 5E3OA 2EA2A 4YIFA 3F8MA 2YX4A 4UUVA 4KIBA 1E2XA 2R7SA 3JREA 3V8LA 1W4MA 3H3ZA 1P92A 1YW8A 3AG4H 4ENMA 3C2GA 1YITI 2X6OA 3CCLI
chains in the Genus database with same CATH topology
2IGMA 3U21A 2LBFA 2VQLA 2P0WA 4ZC3A 3SYTA 4U87A 3IAS2 1N78A 2VXZA 1MMNA 1E0EA 1FMWA 1D1AA 1LVKA 1V5EA 5KHDA 3OY9A 1FMVA 1WJBA 1GLNA 2DT7B 2KRHA 2VJ5A 3OYNA 3K4MA 2X1DA 2L9NA 3A4CA 2ZXHA 3PNTA 4RLFA 4HG2A 2LREA 3DKXA 3DPUA 2NOJB 4BDZA 3DU5A 2XF7A 1JI8A 4XORA 4BE0A 3OIPA 4XN3A 3DU6A 3KYLA 3OYHA 4PJMA 4DOZA 1QHGA 1Z3XA 2K9LA 4JOMA 4E7SA 4HNTA 4QPQA 2CH0A 3FDYA 2F4IA 2IGKA 2QKMB 3W3CA 1WJCA 2IGNA 4PUSA 1X1CA 4EATA 4ANJA 3QYEA 3OYIA 2V1NA 2RQQA 3FBIB 2I8DA 2VJ4A 2XSJC 3ZXSA 3M8JA 4CZCA 2VASA 3PJRA 2V6EA 3OR2C 3OL4A 3H9GA 3L2WA 1SFKA 2VPLA 2WB1A 2IXSA 2HNHA 2ZXIA 3VDXA 4ZTJA 2Z2SB 4IKFA 2VQCA 2WADA 2X85A 3I9V2 4E4HA 3H5AA 2QKLB 2HDWA 2JSPA 1K6YA 4BUPA 3OYAA 4BACA 1BOBA 2XF5A 4Y4RA 5TGTA 3OWTA 2KP6A 2LY2A 2R4GA 4XKVA 3K4JA 3VSKA 4BDYA 4XKCA 4F55A 3K4BA 3K4CA 2Y0SA 4G6TB 1D0ZA 4BQNA 2IS1A 4IX7A 1KONA 4BL0B 1YX3A 2M0MA 2WAQA 3J7AY 1G59A 4NQWB 2DJIA 1X4OA 4HNUA 3OYLA 2XC7A 2HVSA 2GOXB 1NG6A 3CP8A 3FKJA 2V26A 1WJ5A 3W2VA 4XN0A 3KX2A 1V5FA 3TBIA 4ZTFA 3OYJA 2R7TA 4XQFA 3MMYB 3LL7A 2WY7Q 2CW8A 2Q2EB 2W00A 2R7UA 2X6YA 3ZQQA 4KITB 5CQGA 2R7VA 4P5OA 4B47A 1OR7C 4AYBA 2LY1A 5HNHA 3L2VA 4CSWA 2HPMA 3RPUD 4F93B 2UWMA 4E7JA 2HZDA 4XOPA 2WAFA 2XAUA 3H5RA 3RSNA 4E7IA 3BG6A 3LSKA 3S3NA 4PJJA 3IUOA 4BQQA 1ERDA 3IAM2 2DCEA 3OR1C 2OV7A 4NC7A 3OYKA 4F3QA 3H35A 1BR1A 4DBRA 1WJAA 1T0FC 2Z1DA 3BC8A 2WY8Q 3DWLE 3HUGB 2LRDA 3OS0A 1VZ0A 3PSIA 2LH9A 2VL8A 5HNFA 3NWTA 4YELA 3K10A 2VLAA 3S3OA 4BEHA 3QYFA 2RNGA 4LIVA 4YRVA 3HKZA 4E7HA 2KLOA 3LSGA 3DTKA 1DGRM 4DJAA 4QPOA 5JHFA 2CS3A 3ZCOA 3QYBA 2Z16A 2LBFB 2M7BA 3S3MA 4BJ6C 1DP3A 2KHMA 4PK4A 5FRNA 4BEHB 4BJTA 2K9MA 4PFOA 4DBQA 1TZLA 2JUGA 3TMOA 3L2UA 4XLCA 2HVQA 3E0JB 2MFZA 2CW7A 2PMZA 4ZDOA 3OS1A 3BCBA 4Y3OA 4LIUA 2X51A 3DPLC 4XKBA 4D1QA 2HPIA 3RTRA 1MMGA 2ZFUA 4OAZA 3L2QA 2MABA 3W2AA 4KISA 3OL3A 3ONQA 2HU9A 2IS4A 4XLFA 3RCOA 1TT0A 3BLYA 4N4NB 2BOLA 5HVQC 1AA7A 3OS2A 2M4GA 2F6CA 4C2TA 3AKZA 1OLTA 2OUMA 4ZYAA 4XNFA 4BS9A 4OAYA 1PJRA 4CCMA 1MNDA 2R7OA 1Z7LA 2L2OA 4FETA 1QU3A 1BR4A 2VKHA 4P1WA 4E7LA 2ELJA 2BVLA 3PUBA 4IQ4A 4CCNA 2UV1A 2GOMA 2V4JC 2PJRA 3OYEA 4RLQA 4IQJA 4HPQA 3G2BA 3QOEA 1D1CA 1LKXA 2DOAA 1W36C 4XKWA 3FHNA 4AU7A 3OYCA 1D0YA 2FUG2 2JVGA 3K4NA 2R7XA 4HRIA 4CA0A 2MC4A 2F5VA 2LYCA 4J01A 2BW3A 4CCJA 2PJRB 4LITA 2IGOA 2JVHA 3OYDA 4F91B 2CV2A 3M1CA 3IP4B 1MMDA 2K5CA 4AVZA 3PNYA 4PSXA 2VIXA 3AL0B 2DXIA 1J09A 3N05A 3HOSA 5LD2C 1DGWY 5CKTA 3CJQB 2VQHA 2VB6A 2BW3B 3OOUA 4BE2A 1N75A 4LG3A 1D0XA 1HA8A 3CZ6A 4NNJA 4CUGA 3CP2A 2HVRA 2CFOA 1NG7A 1YX5A 3OYMA 3PL8A 3LSHA 3ZGKA 4XM3A 3W2WA 2VJJA 3CF2A 4II3A 3OYGA 3CESA 2R7RA 3OYBA 2WBMA 2M3AA 2E5ZA 4NC8A 4F92B 4BJ5C 3TL4X 3ZRGA 4II2A 4NUBA 1ZELA 4E6KG 2L7KA 1R6RA 1X1DA 2RREA 3LMMA 4PJLA 4B48A 4DIQA 4PJNA 4DGWB 3SZGA 1N77A 4HEA2 4BGDA 1W36D 3LFUA 2KZVA 4H4KC 5CQEA 2AQFA 3PSFA 3DPTA 1X19A 2KDOA 2WAEA 3FBNB 4RM3A 3LSIA 4B3XA 3RQ4A 3K6GA 2W82A 2IS2A 2A6TA 4OWRB 2LOOA 1MMAA 3GBGA 1G8XA 3K4KA 2WA0A 4PSWA 3HOTA 2UUZA 3OIQA 3DKYA 4B43A 2A5WA 1Z3YA 3MD2A 4X0GA 5HLTA 2X1EA 1X1AA 2O5RA 3A1YA 3EUHC 4HSRA 1BR2A 2LC2A 2VQGA 4ZDPA 4XMYA 4BXFA 1LDKB 3H9JA 3AL0C 3HPGA 3DTEA 4KJZA 3VYSB 1DQUA 1YE9A 4C2UA 3DTIA 1D1BA 1X4PA 4XLHA 3BCAA 1QHHD 4GRIA 3BG7A 4XOTA 3V42A 4XONA 3HC7A 3NWSA 3I3LA 3L2RA 3QODA 4ITVA 2V9KA 4ZJZA 1WJFA 4XLAA 2VJIA 1T95A 2E1MB 3HXLA 2JA2A 4B44A 3CJRB 2CUZA 1P9QC 2CV0A 4MLOA 2KQRA 2MD0A 2E5NA 3S32A 2KRCA 4J00A 4RM2A 3C2HA 1MW7A 5KNLA 3K70C 2W1OA 3UNGC 2K3PA 2KMUA 2VXDA 4HSTA 3KEYA 3VSLA 3VYTB 3HG9A 3MKYB 4RMNA 4CCOA 3SDBA 4BQOA 1WFXA 2OC6A 1WJEA 2KPMA 3A2KA 2MYSA 2XF6A 3VYRB 3DQVC 2Q1ZB 2W7NA 1U0JA 1Y6IA 1PYVA 3DEEA 4Y33A 1WJDA 4D9JA 3VYUB 4U7BA 3UR3C 3H5NA 4BU2A 4R79A 2KL4A 2XDVA 2E60A 2VKDA 1UG0A 2X1CA 1X1BA 5FROA 2BVMA 1EA3A 4XLEA 3SEZA 3OMYA 4KT6A 4IZZA 2CMPA 2R7QA 3F9KA 3HPHA 1Z21A 3OYFA 2IS6A 2V7FA 3VWBA 3D5RC 4E7ZA 3ZR8X 4XL9A 3CMMA 1SAUA 2CUJA 3SEQA 3K70D 4CCKA 5LFAA 2HQAA 5FRMA 2E1MC 3PFYA 2X6WA 5CPRB 2R7WA 1LFPA 3MKZA 5KCMA 1UELB 2LG4A 3D5SC 3EPZA 2M4KA 2AQEA 3EUKL 3E1SA 2ZSIB 4FASD 5HOOA 2ZSHB 4N4OB 3S8PA 3MKWB 4CCLA 4JQFA 1Y56A 2L9SA 2DT6A 4BE1A 3K4LA 2CV1A 4E7KA 3PNVA 1V5GA 4F52A 4CH7A 1MNEA 1UAAA 4XR6A 4YEJA 3D5LA 3HL2A 4ZDLA 1IRXA 2L5QA 4C30A 1S9HA 3DLAA 2X6XA 3H9QA 2W4SA 3AFHA 4C9YA 2M7AA 3H0DA 2R7SA 3LSMA 4PFPA 3C2GA 3S93A 3EUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEL A; 
#chains in the Genus database with same CATH topology
 2IGM A;  5AIQ A;  1BL0 A;  4IRI A;  5K7H A;  2LBF A;  4UB6 C;  2VQL A;  2LVS A;  4KDP A;  1R58 A;  4YG2 F;  3JAM Z;  1W5S A;  3J7A O;  3IAS 2;  1CGP A;  1KA8 A;  2VXZ A;  3I53 A;  5M3F J;  2IJL A;  1LVK A;  1K78 A;  3T0Y A;  1YTY A;  1YJN I;  2VOP A;  1QBJ A;  1FMV A;  3Q3S A;  4IO9 F;  2ESH A;  3S2W A;  3IWZ A;  4UB8 C;  4AUX A;  2BEO A;  2VBY A;  3GTM J;  3P5J A;  5CVI A;  1SD4 A;  3LOC A;  3CDL A;  1FYL A;  5HS9 A;  1WRJ A;  1FOX A;  1NK2 P;  3J81 K;  1ZRF A;  1AOY A;  3FIS A;  1IN4 A;  2H8R A;  1RKW A;  4V19 K;  2DFE A;  1OMI A;  1STZ A;  4KNY A;  1YS6 A;  3B73 A;  1HKT A;  4HQE A;  1A36 A;  4XOR A;  5DV5 A;  5D5W B;  2BHY A;  2ME6 A;  1G6N A;  4XSZ F;  2DA4 A;  1VQO I;  4DOZ A;  4E7S A;  4JOM A;  4P9F A;  4EV0 A;  3WE2 A;  2GA1 A;  2EIL H;  4UUT A;  1A5J A;  3W6V A;  4IHV A;  1I6X A;  2BXZ A;  1A35 A;  1SAX A;  1YYV A;  1WJC A;  2L9V A;  1QQI A;  3KET A;  1TQP A;  4PUS A;  4B4C A;  4MO7 A;  4FQG A;  4WX9 A;  4L9N A;  3OYI A;  1V3F A;  2I8D A;  2VJ4 A;  3GYH X;  3KPH A;  4M3G A;  1IW7 F;  3N4M A;  5E8G A;  2L0K A;  2K9S A;  3OL4 A;  4M6Y A;  1P4W A;  4LLG F;  2OA4 A;  2ZFW A;  2HNH A;  2ZO4 A;  2DTR A;  2NS0 A;  4Z2Y A;  2VQC A;  2X85 A;  3OV8 A;  4E4H A;  1UZC A;  5D6E A;  3H5A A;  5GPC A;  3BOQ A;  2L01 A;  4CDG A;  4IRG A;  3WGI A;  2D1H A;  1YS7 A;  4IPA A;  3BTI A;  3V4G A;  2E35 A;  2VC1 A;  2XSD C;  1K6Y A;  3OYA A;  2PQ8 A;  2DO7 A;  1YFH A;  4GDF A;  3HOV J;  1FTT A;  1SVO A;  1QNT A;  5B3S H;  1YOV B;  3OWT A;  1D5V A;  2LY2 A;  4NQW A;  3BPX A;  2NNY A;  2CQK A;  3VSK A;  1FYM A;  4XKC A;  4G8X A;  4UVB A;  2IT0 A;  2Y0S A;  4G6T B;  4DYR A;  3KEO A;  2EZL A;  5J8F A;  2LNB A;  5BS6 A;  3HHH A;  5EEG A;  4L5I A;  3J7A Y;  1G59 A;  2GM4 A;  4NQW B;  1O3Q A;  3OYL A;  1NG6 A;  3FKI J;  3FKJ A;  2R3S A;  1U3E M;  1AKH A;  1S6L A;  2W48 A;  3K7A J;  2M0C A;  2ME0 A;  3MMY B;  4A0X A;  4QIW N;  2X6Y A;  4KIT B;  2IPQ X;  2I10 A;  2TRT A;  3FIW A;  3R0J A;  4AM3 A;  3QRF F;  1VF9 A;  2Y48 A;  4B47 A;  5JVT A;  4U88 A;  1OR7 C;  5H20 A;  4IHY A;  5HNH A;  4CSW A;  2V9P A;  4M9S A;  1Q1H A;  2RKH A;  1XSD A;  4XOP A;  2XAU A;  4DNC A;  1SVM A;  4E7I A;  2CUE A;  3BG6 A;  1RUN A;  5DD8 A;  2STW A;  3BJO A;  4AWX B;  4F3Q A;  2NOG A;  4EM2 A;  2K4B A;  1REP C;  2D5V A;  3DWL E;  2LRD A;  3OS0 A;  1SC7 A;  2VL8 A;  3FXR A;  4LB6 B;  4D0P A;  1GDT A;  3BDD A;  3BQZ A;  2M1B A;  2GIZ A;  4BY1 J;  3QWL A;  2KJB A;  4X1E A;  1YJ9 I;  1ETW A;  2DK5 A;  4L9V A;  5CVV A;  4BNC A;  1RNL A;  4YRV A;  4E7H A;  3LSG A;  3CUQ A;  4DJA A;  5JHF A;  1TT5 B;  4KMF A;  3BJ6 A;  2M7B A;  3CC2 I;  3CD6 I;  2W25 A;  1XPX A;  1K83 J;  3OIO A;  4BJT A;  3HTU A;  2VBZ A;  1K61 A;  1JUS A;  4ZYD A;  4NB5 A;  3HOU J;  3CUQ B;  2L7M P;  3L2U A;  3HOX J;  1YLF A;  3C7J A;  4A69 C;  2JZY A;  4HYE A;  2EBI A;  3VOE A;  4N0B A;  4ABZ A;  2X51 A;  3DPL C;  4S05 A;  3ZN1 A;  2HDD A;  2YS9 A;  2ZFU A;  2A3S A;  4OAZ A;  5DYM A;  5EYR A;  2JMW A;  2MAB A;  3RIR A;  3J81 Z;  3COA C;  2JA6 J;  3S1M J;  5B1B H;  2E1C A;  2HXO A;  4KIS A;  4ZZD A;  2HU9 A;  2WB1 N;  1LE8 B;  3GVA A;  2LK2 A;  5HVQ C;  1GUU A;  5IT9 Z;  2EWN A;  1AA7 A;  3OS2 A;  1O57 A;  5FFZ A;  1VQK I;  2EJR A;  3AKZ A;  4ZYA A;  1LDD A;  3GFJ A;  2NVX J;  1F43 A;  4ESF A;  2XGC A;  1G3W A;  5F6F A;  4R1H A;  2R7O A;  2R7Z J;  1Z7L A;  2VE9 A;  4FET A;  1VQM I;  1TBX A;  1SMY F;  4LD5 A;  2G7H A;  2ELJ A;  3PUB A;  4IQ4 A;  4CCN A;  2UV1 A;  2ISZ A;  2PJR A;  4RLQ A;  2QSG X;  4BHB A;  3X2Q H;  2Y69 H;  1D1C A;  1LFB A;  5D8K B;  1NHA A;  3ZMD A;  1W36 C;  3LWF A;  2P4W A;  3TDZ C;  1XN7 A;  2MLG A;  3BJA A;  5TIS C;  3OYC A;  2FUG 2;  2RVC A;  1HSJ A;  1ZYR F;  2L7F P;  2NVQ J;  3R6S A;  1I27 A;  2DTZ A;  2F5V A;  4P96 A;  5LHI A;  1W7P D;  2PJR B;  4BQA A;  4LIT A;  1TWA J;  2A05 A;  2MD5 A;  3S14 J;  5GAH J;  2GBY A;  2CV2 A;  3IP4 B;  2VI6 A;  5C44 J;  4WXH A;  2NNN A;  4RBO A;  3IV5 A;  2OU2 A;  1K4S A;  1JKO C;  2YR2 A;  1J09 A;  3N05 A;  2VQH A;  1S8N A;  3FXU A;  1XC5 A;  3VB2 A;  1HKS A;  2VB6 A;  3LSJ A;  1HA8 A;  3GFL A;  3A0H C;  4CUG A;  1OQY A;  2H1K A;  5KK1 A;  1FIP A;  3CP2 A;  2GLO A;  3U2R A;  3PL8 A;  1QA6 A;  3TO9 A;  2XPV A;  4XM3 A;  3D0S A;  4CIC A;  4JYK A;  3HOZ J;  2ZJP F;  1Y8R B;  4Q48 A;  3OYG A;  2P5K A;  2PLY A;  5JLW A;  1HST A;  2EV5 A;  3BY6 A;  3HHG A;  2AS5 F;  3PFI A;  4E6K G;  3F6O A;  1ZEL A;  3QAH A;  4ON0 A;  2QSH X;  3O2P E;  4PJL A;  4DGW B;  3SZG A;  4RB3 C;  4HEA 2;  5K5R A;  2XGE A;  4L5J A;  1W36 D;  3LFU A;  2E34 A;  3FMS A;  3IL2 A;  2R93 J;  5CQE A;  3S2D J;  5H6Q A;  2Z9O A;  2EZH A;  3DPT A;  1W5C C;  2Y75 A;  2XKP A;  3DP7 A;  1YIO A;  2QBY A;  1ZAR A;  1YW7 A;  5GPA A;  1MDM B;  2VKE A;  5GTI C;  4A3M J;  2PJP A;  3UKG A;  3KEQ A;  3TGN A;  3DKY A;  5IYB J;  4U0V A;  1OYY A;  1Z3Y A;  3MD2 A;  4L0Z B;  4HQM A;  1FJL A;  3EYI A;  2V79 A;  3A1Y A;  1FX7 A;  5L3D A;  4ZZL A;  1I50 J;  3OOP A;  2WC2 A;  4CHU A;  4XMY A;  3KP3 A;  2QBY B;  1B6A A;  4F7Z A;  4L0Y B;  2H6C A;  2EIM H;  1KYZ A;  3HPG A;  3WTS C;  4M72 A;  2VOD A;  2HEO A;  3ZP5 A;  2CRG A;  1YE9 A;  2XB0 X;  2HYF A;  3DTI A;  1U78 A;  2QUF A;  2E19 A;  4WCG A;  5ICC A;  4ESJ A;  4XLH A;  1KQ0 A;  4S0H B;  3BCA A;  1QHH D;  2QQA A;  1UMQ A;  2ECB A;  3TED A;  1H8A C;  4HZF A;  5TJJ A;  1O3T A;  2ZXW H;  2DU9 A;  3ML6 A;  2R5Y A;  5BMZ A;  2CQ7 A;  3HXL A;  5ILU A;  4HX7 A;  1R4M B;  2CV0 A;  1P9Q C;  3OSG A;  1IJW C;  3RZO J;  2ISY A;  2KDZ A;  4J00 A;  2RAE A;  3E3V A;  3JRB A;  5F1R A;  3UNG C;  2KJC A;  1TQM A;  2PMU A;  3IHU A;  2KMU A;  3Q0V A;  2R5Y B;  4DYQ A;  1FBQ A;  2FBH A;  3HG9 A;  3MKY B;  3D1N I;  3M7G A;  3TW6 A;  1VQL I;  2FXA A;  4RB2 C;  3TP3 A;  1HW1 A;  4BYY A;  1T38 A;  1T08 B;  1B72 B;  4KA4 A;  5FLX K;  1VQ9 I;  3HRU A;  4M74 A;  3A2K A;  2O9L A;  2DAO A;  2KIM A;  1O3R A;  3DQV C;  2Q1Z B;  3WU2 C;  5HS8 A;  1U0J A;  1TP4 A;  4U7B A;  2IRF G;  4Y33 A;  4D9J A;  3KZZ A;  2Q0O A;  1X2N A;  2KL4 A;  2XDV A;  1DU6 A;  5KVR A;  1XSX A;  5EZG A;  1UJ8 A;  1R23 A;  4A93 J;  1R7J A;  3GUD A;  2BVM A;  1EA3 A;  2Q8K A;  5A2Q K;  2DYS H;  3I59 A;  5AIP A;  2R7Q A;  1VND A;  4HLX A;  1HW2 A;  1Z21 A;  2NVY J;  3I64 A;  4E7Z A;  1K4T A;  1LDJ A;  3ZR8 X;  2GXA A;  4ZH4 F;  2Y9Z A;  4TV7 A;  4EJW A;  4L5E A;  1Z67 A;  4BHP A;  1XCV A;  5FRM A;  5FD6 A;  2QCO A;  1P4X A;  3PFY A;  5CPR B;  4FIS A;  2LD5 A;  1R4N B;  2E7W A;  5IYD J;  2R92 J;  1FIA A;  3EUK L;  1ZH5 A;  3DKW A;  4FAS D;  3K2Z A;  3W6K B;  3S8P A;  5BPD A;  4JQF A;  3NEU A;  2CV1 A;  3PO2 J;  1FWZ A;  1NH3 A;  2L4M A;  1PUF A;  1A6I A;  4BHC A;  1FOY A;  3IKT A;  4HX8 A;  4ZDL A;  4A5N A;  2TDX A;  1S9H A;  2FQ4 A;  3F8F A;  3ERE D;  2W4S A;  2PX9 A;  5GAG J;  3P9C A;  2VE8 A;  2M7A A;  2DDB A;  3HRT A;  3FXJ A;  3I58 A;  2P5V A;  3F6V A;  1YJW I;  1QVT A;  3WG7 H;  5HDN A;  2ID3 A;  3H0G J;  2DMU A;  4O5V A;  3BRO A;  3NRV A;  4M6X A;  1MGT A;  3ZQF A;  1YW9 A;  1LNW A;  1E0E A;  4YFK F;  5HLH A;  3RKY A;  5KHD A;  2L9R A;  1D8K A;  2HFH A;  1ZK8 A;  3JSO A;  2L4A A;  1JXS A;  1GLN A;  2DT7 B;  2KRH A;  2GXB A;  2VJ5 A;  2X1D A;  2L9N A;  2XVC A;  1ON2 A;  2IP2 A;  2FNA A;  2O8K A;  2ZXH A;  1Z7U A;  5FD5 A;  4RLF A;  2NOJ B;  3DU5 A;  1LEB A;  1JI8 A;  2JQ7 A;  1IXR C;  1XMX A;  4PGH A;  3TOB A;  1FC3 A;  3OIP A;  2DPD A;  4IL6 C;  1YQA A;  3KYL A;  5D4R A;  3F8B A;  1Z3X A;  2K9L A;  5BPI A;  1I5Z A;  3GX4 X;  4KT5 C;  2QKM B;  3W3C A;  4DQ2 A;  4UUS A;  3Q5F A;  2B63 J;  1X1C A;  2DMQ A;  4HF1 A;  4OMZ A;  4EAT A;  1P6R A;  2V1N A;  1BIA A;  1Y0U A;  3JRF A;  2XSJ C;  1RR7 A;  5HS7 A;  3DXJ F;  5DTD A;  3M8J A;  3ZXS A;  2ZJR F;  2VAS A;  1U8R A;  3OR2 C;  5B5E C;  3L2W A;  1ZGJ A;  3LA3 A;  2VPL A;  4IKF A;  1IRG A;  4NDL A;  2MA3 A;  2XAQ A;  4UUS B;  5B66 C;  1C0W A;  2LF8 A;  4RGS A;  1QGP A;  1VQ5 I;  1A04 A;  5E3L A;  2EFO A;  3E5U A;  4HNV A;  3HB9 A;  3O6B B;  4BUP A;  2HKX A;  5IP6 A;  4M9X A;  2K40 A;  2M8G X;  5EGO A;  4KUM A;  4Y4R A;  3KZI C;  2R4G A;  3EUH A;  3VEP A;  2M34 A;  2IA1 A;  4BQN A;  2IS1 A;  4FCY A;  4KIG A;  2V6C A;  4BL0 B;  1U5T A;  1MSE C;  1GHC A;  1VQP I;  1FSH A;  2M0M A;  1JJ6 C;  4RDU A;  2WAQ A;  3IH4 A;  4G7H F;  5JHU A;  2DYR H;  4FHT A;  2CGP A;  4HNU A;  1QRY A;  2OBP A;  5C3E J;  2GOX B;  3JRG A;  2HQN A;  3DBR B;  1W7P A;  3MVP A;  3TBI A;  1MH3 A;  3ECO A;  4ZTF A;  3OYJ A;  4XQF A;  4GXO A;  3LL7 A;  2IBD A;  4G12 A;  2QGU A;  3WTT C;  3ZQQ A;  1TWG J;  4FTH A;  4NBQ A;  2UXN A;  1YRN A;  4M3B A;  5LEK A;  2XAG A;  2DOF A;  2FSW A;  1Q1V A;  2LY1 A;  1FBU A;  1X3U A;  1W7P B;  1RIO H;  3JW4 A;  4MEX F;  3B6C A;  1MIJ A;  2HZD A;  3AAF A;  2DFI A;  2HI3 A;  5F64 A;  3H5R A;  3HGY A;  1VI0 A;  4PJJ A;  4NHJ A;  1T56 A;  1G4D A;  2OV7 A;  1YHQ I;  3FX3 A;  2JJ7 A;  3DEU A;  1YRN B;  1HDD C;  3L7W A;  3BWG A;  4RB0 A;  5KAI C;  4A6E A;  4Y7N J;  2Z1D A;  3BC8 A;  3I0T A;  1WPK A;  3HUG B;  5F04 A;  3O8G A;  3PSI A;  3KIO A;  5L3C A;  2JRM A;  4YEL A;  2OF7 A;  2VLA A;  4EJT A;  4OU0 A;  3ZOB A;  2LKP A;  3S3O A;  4BEH A;  3HOY J;  3HZJ A;  3H92 A;  1WH5 A;  4M9Z A;  2K9N A;  4EJU A;  1RES A;  3QYB A;  3DBL B;  2LBF B;  3BR2 A;  2HTJ A;  3ZMZ A;  2DK8 A;  2KHM A;  4S04 A;  1XGN A;  1A31 A;  5E3M A;  2I5U A;  3WHC A;  3CO7 C;  1JT0 A;  2AO9 A;  2JPB A;  4BEH B;  1QVU A;  2K9M A;  5EZH A;  1K78 B;  1TZL A;  1X58 A;  3ECH A;  3GWZ A;  3FMQ A;  3HRM A;  4A3I J;  3ABT A;  2HVQ A;  3U1K A;  3E0J B;  2MFZ A;  2CW7 A;  4MFE A;  1KU3 A;  2Y2Z A;  4DW6 A;  3OS1 A;  3BCB A;  4XRS A;  2CQX A;  3CCR I;  1RKT A;  3PM1 A;  3S1Q J;  1MMG A;  2JRT A;  3L2Q A;  1PP7 U;  1MJ9 A;  1XG1 A;  4IHX A;  1UFM A;  3DLL F;  1S5L C;  3ONQ A;  1MD0 A;  3K1M A;  2EIJ H;  2DA5 A;  3ZPL A;  4LK0 F;  4N4N B;  3BLY A;  1VFC A;  2BOL A;  5GP9 A;  1E3H A;  1TLH B;  2M4G A;  4BAY A;  1BC7 C;  2YUS A;  5D8L B;  2NRA C;  1FYK A;  4L18 B;  2IAI A;  3GFM A;  4JP0 A;  1BI0 A;  4QWQ A;  4XNF A;  4BS9 A;  2E1N A;  3G1M A;  1J5Y A;  2HS5 A;  5E20 A;  1PJR A;  2JPC A;  1ZHF A;  2K86 A;  4KMU X;  1PP8 F;  3HEF A;  1X2M A;  3NQO A;  5K7Z A;  2CW0 F;  3RYR A;  2O03 A;  2P7C B;  1QU3 A;  3KYD B;  2VKH A;  1IC8 A;  4A12 A;  4X6A J;  4UY8 I;  2A61 A;  2K4J A;  4A3K J;  4IQJ A;  4HPQ A;  3JRC A;  2ELH A;  2R5Z A;  2Y30 A;  3ZN0 A;  1V55 H;  5HDG A;  2DOA A;  1R1U A;  4GCV A;  3FHN A;  5F08 A;  2DA1 A;  3F72 A;  5K5O A;  2JVG A;  2R7X A;  2CFX A;  1OFC X;  4CA0 A;  2QM3 A;  2GIV A;  4J01 A;  2BW3 A;  2HYG D;  1HBX G;  1JKR C;  2HOA A;  4Q5S F;  1L0O C;  3CCV I;  3CJN A;  2K5C A;  4H0E A;  2H8W A;  2FU4 A;  2QQB A;  3PNY A;  4PSX A;  4WK8 F;  4MFD A;  1T2K A;  2DXI A;  5LD2 C;  3HOS A;  4PGG A;  5CKT A;  1F9N A;  5F1J A;  3J80 K;  4BXU A;  3BR3 A;  3V8K A;  3RZD J;  2BW3 B;  2Y31 A;  3OOU A;  4CZZ A;  4LG3 A;  4BE2 A;  3MZY A;  4NNJ A;  5JI6 A;  1AKH B;  4BBS J;  5H6R A;  1J0R A;  2HVR A;  2ACJ A;  2JA8 J;  1MBG A;  1EH7 A;  3W2W A;  2WTE A;  3Q0U A;  4OIN F;  5M5X J;  1BA5 A;  1TTY A;  1ETQ A;  2R7R A;  2DI3 A;  3QP5 A;  4HV6 A;  4F92 B;  2G7U A;  1R6R A;  2X9D A;  2FMY A;  2O7O A;  2RRE A;  3LMM A;  4RGX A;  3AG2 H;  2YSR A;  4I0B A;  1SD6 A;  4J19 A;  3HM5 A;  2KZV A;  4XID A;  3HOW J;  3JR9 A;  1JKP C;  3SFI A;  1HDP A;  2AQF A;  4XLN F;  3BP8 A;  1USS A;  2WAE A;  4ETS A;  3FBN B;  5IPA A;  2M2E A;  3KYC B;  2JWT A;  1HW5 A;  1B8I A;  2HOE A;  4MIM A;  1LB2 A;  3LSI A;  3RQ4 A;  3S15 J;  1JGS A;  2IS2 A;  4OWR B;  1R22 A;  5LHH A;  1E3O C;  1MMA A;  3G4S I;  1G8X A;  2VT2 A;  3K4K A;  3T8T A;  2EFP A;  4B43 A;  2OAZ A;  2RGV A;  5ILV A;  4X0G A;  2PG4 A;  1I6H J;  3EUH C;  3ASN H;  3CC4 I;  2X4H A;  2LC2 A;  1ORK A;  1B8I B;  4ZDP A;  5JR3 A;  4CGZ A;  1RRJ A;  3I4M J;  4ENN A;  3FXK A;  1G3T A;  1ZG1 A;  5FGM A;  1U5T C;  5E3N A;  5L3E A;  3M4O J;  2KRF A;  2H09 A;  5EEA A;  1BW5 A;  1OCZ H;  2QZ8 A;  3KP2 A;  4OMY A;  1EF4 A;  4GRI A;  3QU6 A;  2HXI A;  3BG7 A;  3TKY A;  3ASO H;  1FOW A;  3SZT A;  3HC7 A;  2E36 A;  3I3L A;  3L2R A;  2O61 A;  1U2W A;  1TWF J;  2A6E F;  1XS9 A;  4MQ9 F;  3L2C A;  1ZRD A;  1WJF A;  2FEZ A;  3MAJ A;  1HOM A;  1LUJ B;  4A3B J;  4I6Z A;  2CG4 A;  2WV1 A;  5J4Y A;  1FZP B;  3ABL H;  4I76 A;  4M6V A;  3S32 A;  1AWC A;  2IVM A;  4RM2 A;  3C2H A;  2F48 A;  3K70 C;  1HF0 A;  2W1O A;  5ICF A;  4PZJ A;  3G6E I;  3E5X A;  4HST A;  3KEY A;  3CDI A;  1W0U A;  3VSL A;  1S3J A;  4C2M J;  2VBX A;  5LLQ A;  4RMN A;  4L9J A;  4XSX F;  5JVG F;  2EK5 A;  4G7Z F;  4BQO A;  1WFX A;  1MJB A;  2XAH A;  5LGT A;  3T5X A;  2XF6 A;  3LQQ A;  2F4M B;  2ECC A;  5C4J J;  1OYI A;  5J6X A;  4KIF A;  1R5I D;  2IEK A;  1QPI A;  4EM0 B;  2M87 A;  3UR3 C;  1IXS B;  4IHW A;  3ZQG A;  2DFF A;  3ULQ B;  2X0L A;  4R79 A;  3KP6 A;  4CYC A;  2ZJQ F;  2E60 A;  2K27 A;  3JTG A;  5HLI A;  2DOD A;  1FPQ A;  1X1B A;  3E6D A;  4BY7 J;  5DD4 A;  4XLE A;  3SEZ A;  3OMY A;  4AID A;  4IZZ A;  5CVR A;  2GXG A;  4AYB N;  3WTU C;  2CMP A;  2LF7 A;  3HPH A;  3OYF A;  3KP7 A;  2QLZ A;  2V7F A;  1TC3 C;  3VWB A;  5DUI A;  4UNO A;  1L3L A;  4IHS A;  3ZMS A;  2Z99 A;  3SQN A;  2OTL I;  3CMM A;  5FKM A;  3V8J A;  1SAU A;  3SEQ A;  3K70 D;  3BG5 A;  1HXD A;  1EV7 A;  5DDG A;  5ED4 A;  1DDN A;  2FBK A;  2Z33 A;  3Q0W A;  2F4O B;  3ABM H;  2R7W A;  4OIP F;  2CO5 A;  5KCM A;  1UEL B;  3SZP A;  2EQR A;  2AQE A;  3ZMT A;  3E1S A;  2R7D A;  3J80 Z;  4AIJ A;  1DUX C;  3KLN A;  5LRS A;  3T8R A;  5TRD A;  2QSF X;  2L9S A;  2DT6 A;  4BE1 A;  4RAZ A;  4E7K A;  4F52 A;  3LFK A;  1MNE A;  3WTX C;  2KIF A;  2QEX I;  2EZI A;  1IRX A;  3F3X A;  2WWY A;  4C30 A;  1B4A A;  2VKV A;  1ETK A;  1MBK A;  3DLA A;  3H9Q A;  3QP6 A;  4RGU A;  3AG1 H;  2STT A;  4KFC A;  4C9Y A;  3MWM A;  2LY9 A;  3H0D A;  1A6Q A;  2O3F A;  3HYI A;  3ZQH A;  4A0Y A;  5FLM J;  1ZRC A;  2XGD A;  3S93 A;  3E6M A;  3EUA A;  4CO8 A;  2FX0 A;  2QF7 A;  4EMS A;  2P0W A;  4ZC3 A;  3SYT A;  4U87 A;  4I2O A;  2HOS A;  3F0C A;  1O7F A;  5E1W A;  4V2F A;  1D1A A;  1V5E A;  1SD5 A;  1NK3 P;  4JK1 X;  3OY9 A;  2BGC A;  1VQ7 I;  3IRQ A;  4AC0 A;  5D5U B;  5EG0 A;  2MH2 A;  2DDA A;  3CMY A;  2NVU B;  3VFZ A;  3K4M A;  1YIJ I;  1M1E B;  2P7V B;  1KGS A;  1TQI A;  2DMN A;  2FD5 A;  3P9K A;  3KP4 A;  1G3Y A;  2QEN A;  4HG2 A;  2JTV A;  5KAF C;  3DKX A;  5ICG A;  2EV0 A;  3DPU A;  1RC9 A;  2DLL A;  2Y9Y A;  3H1C A;  2HGC A;  2X48 A;  2XF7 A;  5EG0 B;  2E2H J;  1X1P A;  2YU3 A;  4BE0 A;  5D4S A;  3I55 I;  5DCM A;  3OYH A;  4PJM A;  2EFN A;  4WF2 A;  3JCU C;  2EH3 A;  5B1A H;  1CF7 A;  4MTD A;  4I7H A;  4QPQ A;  3VOD A;  1Z77 A;  5M3M J;  2CH0 A;  3FDY A;  1ETY A;  4W1U A;  1UHS A;  1N25 A;  2OD5 A;  2ESN A;  4M3F A;  3SFZ A;  2IGN A;  2JUC A;  3CCU I;  1SFX A;  4IJA A;  3QYE A;  1IUF A;  2RQQ A;  5DCM B;  3TW7 A;  2CWE A;  4HAM A;  3PJR A;  1R1T A;  1IRF A;  1CF7 B;  4UV9 A;  5FJ8 J;  3H9G A;  2KIS A;  1OCC H;  1SFK A;  1P4A A;  2WB1 A;  2IXS A;  2ZXI A;  3VDX A;  5L3G A;  2Z2S B;  3CC7 I;  4A2U A;  3I9V 2;  4U7D A;  3GZ6 A;  2FNP A;  1IV8 A;  2ZKZ A;  4RB1 A;  3ELK A;  1K79 A;  2HDW A;  2FE3 A;  2JSP A;  2XKO A;  3E5Q A;  1XB4 A;  4LG0 A;  4BAC A;  4QTR A;  1BOB A;  4XRM A;  1X3Z B;  2XF5 A;  5TGT A;  4XLP F;  4B3A A;  2F2E A;  3ABK H;  3K4J A;  3PIO F;  2NXN B;  3K4B A;  2MH9 A;  1IN8 A;  3K4C A;  1AHD P;  4OOI A;  2EB7 A;  4LMY A;  4IX7 A;  1KON A;  2XB5 A;  1YX3 A;  2Q2E A;  1ZG3 A;  4D5F A;  1F1Z A;  4HLY A;  1X4O A;  5BOX A;  1XMA A;  5D5V B;  3IRR A;  2HVS A;  4P55 A;  2EIK H;  3I59 B;  2EV6 A;  1H9T A;  1ZKG A;  3GLL A;  4JX5 A;  5J1R A;  1POG A;  1WWX A;  1H89 C;  4Q47 A;  3FF5 A;  4XN0 A;  5J3L A;  2R7T A;  1ZAO A;  5DM6 F;  2WY7 Q;  2Q2E B;  2W00 A;  3L09 A;  2H1L A;  3GZ5 A;  3K1N A;  2CQQ A;  5CQG A;  2L02 A;  1SFO J;  3BR1 A;  5GAE J;  3QPS A;  2XRL A;  2QVO A;  1YG2 A;  4AYB A;  1I1S A;  3L2V A;  3RPU D;  5FKL A;  2OJE D;  1IF1 A;  4E7J A;  1BJA A;  2D45 A;  1KU7 A;  2HQR A;  2WAF A;  3H3U A;  1R00 A;  5E17 F;  3FWE A;  1IZ1 A;  3RSN A;  3LSK A;  3S3N A;  3IUO A;  3CCQ I;  3LSR A;  4NC7 A;  2L54 A;  3OYK A;  1I3Q J;  2ZXJ A;  1BR1 A;  4DBR A;  2BY3 A;  2WV0 A;  2DW4 A;  3BZ6 A;  3CCY A;  2JK3 A;  4EEF G;  4Q4Z F;  1T0F C;  4HA8 A;  1U9O A;  1AU7 A;  1BBY A;  2XGX A;  3CMA I;  1DPU A;  5J47 A;  2ZB9 A;  1JT6 A;  3ISP A;  1VZ0 A;  1PUF B;  2E2I J;  3IC7 A;  3NWT A;  5HNF A;  2DPU A;  2DFH A;  1MMS A;  1ON1 A;  1QO0 D;  2RC4 A;  4HF0 A;  3K10 A;  3V7R A;  4EM1 A;  5M5W J;  3KLO A;  4IOC F;  1MH4 A;  1EH6 A;  2CU7 A;  3F8C A;  4DZP A;  2FJ1 A;  3QYF A;  2GQQ A;  3ZQ7 A;  2XAS A;  2M5W A;  4QPO A;  4NC6 A;  1F36 A;  4ZYE A;  2EA4 A;  3R0A A;  2M8E A;  2IA0 A;  4BJ6 C;  3GLX A;  3BPV A;  1FP2 A;  2ZCW A;  4I98 B;  2A69 F;  1ENH A;  4PFO A;  1Z9C A;  2B7E A;  2ZBK A;  2JA7 J;  2VPR A;  4QSH A;  2M30 A;  2UZK A;  1H9G A;  2F5D A;  3BR0 A;  1Z0X A;  3PQJ A;  2JT1 A;  4ZDO A;  1EH8 A;  4LIU A;  3AG3 H;  4A6D A;  1I3A A;  2BY1 A;  4GFB A;  3W2A A;  2AXL A;  3Q9S A;  1MKM A;  2MW8 A;  1TNT A;  2LTP A;  4E70 A;  1JE8 A;  4FX4 A;  4XLF A;  3ROU A;  3BTL A;  5FLV A;  3RCO A;  1TT0 A;  1K7A A;  1WSU A;  1OIS A;  2F6C A;  3M8F A;  4C2T A;  1JTY A;  4RAY A;  2OUM A;  1R5G A;  4JX6 A;  3RKQ A;  2FF4 A;  1ZG5 A;  5D6F A;  2OQG A;  3CCE I;  1UHM A;  4G9Y A;  4G7O F;  2XRO A;  1IRZ A;  4A3E J;  4CCM A;  3O8H A;  2COB A;  2L2O A;  4A3G J;  5F0C A;  4EGZ A;  2FOK A;  1ZQ3 P;  1VQ8 I;  1BR4 A;  1QZE A;  4YIR X;  1IUY A;  3DV8 A;  5E79 C;  2AXT C;  2P8T A;  4UXN A;  2L3D A;  5FLX Z;  2LR8 A;  2GOM A;  2IA2 A;  2V4J C;  3OYE A;  3W6J B;  4WWC A;  2COM A;  2DA3 A;  3GXO A;  3A01 A;  4O3M A;  1BI3 A;  1LKX A;  3CDH A;  1HQC A;  3HRS A;  1Z05 A;  2VC0 A;  2E7X A;  2HYJ A;  4HDU A;  5LEJ A;  4AU7 A;  1R49 A;  4B8X A;  5EGO B;  1D0Y A;  3O3K A;  3K4N A;  4A5M A;  1UST A;  2KKO A;  1ULY A;  4FE4 A;  4YFN F;  5IP9 J;  4CCJ A;  4M3D A;  3OYD A;  4F91 B;  1LQ1 A;  1Y1W J;  2LLK A;  2VBW A;  3M1C A;  4ENJ A;  4I02 A;  1MMD A;  5A2Q Z;  1U5T B;  2E1O A;  2VIX A;  1RZ4 A;  2R7F A;  3CJQ B;  2GAU A;  3GFI A;  5DUK A;  3RDI A;  1U6G A;  1D0X A;  1OCO H;  3ABU A;  1ZGA A;  3REO A;  2GWR A;  3LQR A;  1XDU A;  1P7I A;  1R9T J;  3CF5 F;  2CFO A;  1YX5 A;  1IGN A;  5J8C A;  3ZGK A;  2XIG A;  3F23 A;  2VJJ A;  3CF2 A;  4II3 A;  3GTO J;  3BTJ A;  1ODD A;  4BKX A;  3OYB A;  2WBM A;  2M3A A;  4QLC U;  5HLG A;  4NC8 A;  2P6S A;  1JGG A;  3ZRG A;  4HDV A;  4II2 A;  1TWH J;  1XCB A;  2LKS A;  1B9M A;  1Z91 A;  2G9W A;  1B1B A;  1X1D A;  2DOE A;  2KIU A;  4DIQ A;  2TCT A;  2KT0 A;  1N77 A;  2FQ3 A;  4Y15 A;  5DCF A;  3I56 I;  1VTN C;  1J7K A;  4IRH A;  3KP5 A;  1IN5 A;  4H4K C;  3RKX A;  2HZT A;  3JRI A;  5LRR A;  4C3H J;  1U9N A;  3P9I A;  4C3J J;  1IDY A;  4RM3 A;  2HOT A;  3LA2 A;  3WG9 A;  1KU9 A;  2D2W A;  3SDG A;  4Z6Y A;  2H6B A;  2W82 A;  1SEU A;  5FO5 A;  3CQZ J;  2LOO A;  1ITY A;  3GBG A;  3I5U A;  3M07 A;  2WA0 A;  3OIQ A;  2MLK A;  5E1X A;  1UG2 A;  4MTE A;  1ZRE A;  2A5W A;  1TNS A;  5HLT A;  2N8G A;  4GYG A;  2X1E A;  1X1A A;  1S7A A;  4L9T A;  2VQG A;  2JSC A;  4BXF A;  1DPR A;  2XHK A;  3SXY A;  3H9J A;  1E17 A;  3G1L A;  1D3Y A;  3FK6 A;  3AL0 C;  3DTE A;  3TP0 A;  2BYV E;  3JTH A;  3VYS B;  2O8X A;  3WE3 A;  3QPL A;  1X4P A;  3MN2 A;  2K02 A;  3HIF A;  1GT0 C;  3OSF A;  2HDC A;  3WTY C;  2KFD A;  1I1G A;  3QOD A;  5ERI A;  4WXC A;  2VJI A;  3I4N J;  5IT9 K;  2JA2 A;  4U0W A;  5GAD J;  4ZYH A;  1H0M A;  3S1N J;  1ZN2 A;  3EET A;  4B44 A;  2QYO A;  3CJR B;  2QWW A;  1BI2 A;  2VN2 A;  2E5N A;  3QU3 A;  2KRC A;  3TOA A;  3WHB A;  4XRF A;  2V9V A;  1MW7 A;  5JLX A;  1R5H A;  2OQR A;  2K7L A;  1IV6 A;  2D1V A;  2VXD A;  3C3W A;  1IN7 A;  3FM5 A;  4DZJ A;  3PO3 J;  1FLI A;  3VYT B;  3DEW A;  5CJ9 A;  1JHH A;  2DBB A;  4LLN A;  4LK1 F;  4CCO A;  4DYC A;  5K7F A;  1T8I A;  5DEQ A;  2OC6 A;  2ZME C;  1BC8 C;  2BHZ A;  2MYS A;  4K2E A;  3DF8 A;  3VYR B;  2DJN A;  2EIN H;  4U0Y A;  3WGG A;  3IH2 A;  3K0L A;  1Y6I A;  1PYV A;  2LP0 A;  3DEE A;  1WJD A;  3VYU B;  2A6H F;  1S7E A;  3A0B C;  3JSP A;  5H2F C;  1MSF C;  1TWC J;  2CQN A;  3H36 A;  1SFU A;  1FTZ A;  3I4P A;  4LJZ F;  3VPR A;  3BG9 A;  1UG0 A;  2NAZ A;  3TQN A;  2R5Z B;  2CYY A;  5FFX A;  4KT6 A;  5IY5 H;  3CCM I;  2W24 A;  3F9K A;  3HSE A;  1ETO A;  5E8I A;  2IS6 A;  3D5R C;  2BY0 A;  5LGN A;  1QZZ A;  1ACI A;  3GTL J;  3N97 A;  4XRS G;  1BI1 A;  1GXP A;  4CCK A;  2HQA A;  1P2F A;  1SAN A;  2PEX A;  4G6D A;  2E1M C;  4JBA A;  1HLV A;  1LJ9 A;  5F27 A;  1WI9 A;  4YII A;  5IP7 J;  3MKZ A;  3FK7 A;  3EPZ A;  2M4K A;  2RN7 A;  5EJC A;  4G94 A;  2IW5 A;  4N4O B;  4UHT A;  2O0Y A;  2H27 A;  1YI2 I;  5ICE A;  1J75 A;  1Y56 A;  3EDP A;  3HKZ N;  5LGU A;  3JRA A;  3PNV A;  5L3F A;  2Y0M A;  3S1R J;  1UAA A;  5AON A;  1MJA A;  3HL2 A;  3RPU A;  2L5Q A;  2LSO A;  3GME A;  2X6X A;  3AFH A;  4Y52 J;  1QZY A;  1B9N A;  1HKQ A;  3LSM A;  4PFP A;  1Y8Q B;  2YPR A;  1FY7 A;  1WKM A;  3HGG A;  1ZGW A;  1ZTR A;  1WGX A;  2PMZ N;  3U21 A;  1LEA A;  4EJO A;  2W84 A;  3WU0 A;  3RYP A;  2B0L A;  4D7N A;  1N78 A;  1MMN A;  1FMW A;  2GZW A;  1CQT A;  1FBS A;  2OCE A;  1KZH A;  1T33 A;  2DQL A;  1WJB A;  4FT8 A;  1SMT A;  3MFK A;  2ADU A;  2ICW G;  3OYN A;  3A4C A;  3IWF A;  2K3F A;  2ETH A;  3ZMV A;  3WTW C;  1TW3 A;  3PNT A;  1FOK A;  1APL C;  2LRE A;  1PVE A;  3CUO A;  4EVI A;  3HBL A;  4BDZ A;  2MG4 A;  3LAP A;  2P6T A;  3B6A A;  3BT9 A;  1JKQ C;  3J7Y J;  1LE8 A;  5CYV A;  3WU1 B;  3E97 A;  4XN3 A;  1FP1 D;  3RQI A;  3DU6 A;  3CLQ A;  3GZN B;  3BG3 A;  4GYI A;  1QHG A;  4HNT A;  5C4X J;  4R8H A;  2LKX A;  1SD7 A;  2HKO A;  4GO1 A;  5FKK A;  1JHF A;  3ZMU A;  4YFX F;  3BR5 A;  2F4I A;  2IGK A;  4I09 A;  1PUE E;  2OCC H;  1XGO A;  3L00 A;  1T0F A;  4ANJ A;  1R71 A;  4I01 A;  3FBI B;  1BJZ A;  1XGS A;  2OZ6 A;  3C2B A;  4CZC A;  2V6E A;  1GXQ A;  4A3F J;  1I39 A;  2DMT A;  4A3J J;  4AIH A;  3LSP A;  4ZTJ A;  4MNU A;  2DA2 A;  2WAD A;  2DMP A;  2EFQ A;  2QKL B;  2VON A;  4UV8 A;  2K85 A;  2B9S A;  1KQ9 A;  2EZK A;  5CVJ A;  1SVL A;  3SJM A;  3K9T A;  3GTK J;  1JUM A;  3JRD A;  1R36 A;  4OIQ F;  1MZB A;  4A3C J;  3KFW X;  2KP6 A;  2LDU A;  4LGW A;  2YU9 J;  4XKV A;  3J7Z I;  4BDY A;  1OCR H;  4MGR A;  4F55 A;  5ILS A;  3B02 A;  3S17 J;  5E18 F;  1D0Z A;  1J9I A;  3R4K A;  2F5C A;  1WCM J;  3QQA A;  4CYC B;  3CJT B;  2GA2 A;  1WQ2 A;  3KZY A;  4Y13 A;  1XD7 A;  1LPQ A;  5FKO A;  2VUM J;  2XUB A;  3H3V K;  2KZG A;  2C6Y A;  4IEJ A;  2KIQ A;  2CSO A;  3WTV C;  3F22 A;  2DJI A;  3HDD A;  2XRN A;  2XC7 A;  1BOA A;  5IYC J;  2DT5 A;  3CP8 A;  3GTJ J;  3PIP F;  4ENK A;  1TW2 A;  2V26 A;  3QPT A;  1FEX A;  1JUP A;  1WJ5 A;  3W2V A;  1RI7 A;  3KX2 A;  1V5F A;  1GVJ A;  2LMD A;  4B09 A;  1ONV A;  4XK4 A;  3SHF A;  1IN6 A;  1BN5 A;  2CW8 A;  2W85 A;  2R7U A;  4PCQ A;  4PDK A;  1WVR A;  2R7V A;  4P5O A;  3GF2 A;  3HTS B;  5GTH C;  5HDK A;  2FRH A;  4Y17 A;  3NAU A;  2XAJ A;  4N9I A;  3LNQ A;  2HPM A;  1S7O A;  4F93 B;  2UWM A;  3FMR A;  3RI4 A;  2V1D A;  3M8E A;  3RJP A;  3S16 J;  1WH7 A;  5LBQ A;  1ERD A;  3DCF A;  3HSF A;  3IAM 2;  2DCE A;  3OR1 C;  1T6S A;  4BQQ A;  5F0H A;  2BE5 F;  1WHU A;  5BQT A;  3H35 A;  1F4K A;  1WJA A;  3PUF A;  4RS8 A;  1OKR A;  3U9G A;  2BV6 A;  4EQQ A;  2ZJ2 A;  2DN0 A;  2WY8 Q;  5K5Q A;  2ZNY A;  1MDM A;  3ZQC A;  4LLL A;  2LH9 A;  2VT3 A;  2MGQ A;  3GO5 A;  4M71 A;  3ZQI A;  2ZNZ A;  4GGG A;  3HJE A;  4MEY F;  3V7C A;  1PDN C;  1OCP A;  3MZ8 A;  2NS8 A;  3MCZ A;  1W5T A;  5IOY A;  3M3Y J;  3QPH A;  2RNG A;  4LIV A;  3HKZ A;  2FBI A;  2KLO A;  3DTK A;  1DGR M;  2M45 A;  1Y1V J;  5K1Y A;  3R61 A;  2CS3 A;  2DA7 A;  3T1B A;  3ZCO A;  2Z16 A;  4A0Z A;  1MNM C;  2V1X A;  3S3M A;  3P7N A;  3R60 A;  2FA5 A;  1BM9 A;  2MSY A;  1DP3 A;  1GVD A;  1SFE A;  2PBI A;  1LFU P;  4A3L J;  4HBL A;  4PK4 A;  5FRN A;  3K2A A;  3CME I;  4OIR F;  2P5L C;  4DBQ A;  1O3S A;  4WXD A;  3GW2 A;  3FHZ A;  2BZT A;  2JUG A;  1R1V A;  4RAF A;  4HV5 A;  3TMO A;  1IDZ A;  4XLC A;  3C1D A;  4MQV A;  2ID6 A;  2PMZ A;  3KE2 A;  4HF2 A;  1OYW A;  2NVT J;  5CLS A;  4Y3O A;  4FX0 A;  2O6G E;  2L7Z A;  4XKB A;  4D1Q A;  2HPI A;  4P9U A;  3RTR A;  3QOP A;  1EJ9 A;  4CYD A;  1RUO A;  3OL3 A;  2HWV A;  2M9H A;  2IS4 A;  2A68 F;  2OTJ I;  3BQY A;  1XDS A;  1VQ4 I;  3G3Z A;  3RKW A;  3BZC A;  1W0T A;  1OLT A;  1G2H A;  3E7L A;  4LOC A;  1B72 A;  1P7J A;  2V1U A;  4W97 A;  4OAY A;  5IT3 A;  1K6O A;  1IO2 A;  6PAX A;  4FE7 A;  2HR3 A;  2VOO A;  1X3W B;  3TDU C;  1MND A;  2HQ5 A;  3CO6 C;  2Z3Y A;  2RDP A;  2J5P A;  4P1W A;  3K1P A;  3TO7 A;  2E71 A;  4E7L A;  2BVL A;  3F8N A;  9ANT A;  4KN4 X;  1UB9 A;  1O7L A;  2WAQ N;  3M1E A;  2PFB A;  3G2B A;  1XTA A;  3BR6 A;  3QOE A;  1ZLJ A;  1MBJ A;  1TL8 A;  5CVU A;  4D5C A;  4A3D J;  2BY2 A;  2G0E A;  3S2H J;  4V2G A;  2PN6 A;  1KYW A;  4XKW A;  1IG7 A;  4LG0 B;  3LST A;  1FNN A;  1ETX A;  1OJL A;  4I99 C;  4HRI A;  1Z6T A;  1WI3 A;  2MC4 A;  4B1R A;  2LYC A;  3CUQ C;  5DS9 A;  3GEZ A;  1KQ8 A;  2IGO A;  2JVH A;  3E6B A;  1LVA A;  4RAG A;  3CTA A;  4AVZ A;  5JFR A;  1XGM A;  2HTS A;  1GV5 A;  3AL0 B;  2DQR A;  3IKV A;  3K69 A;  2QQ8 A;  2RNJ A;  2MBF A;  1DGW Y;  1HC8 A;  4KN7 X;  4PJ0 C;  3GTQ J;  1N75 A;  3FXQ A;  1XMK A;  3CZ6 A;  4N9H A;  1RPW A;  2FOW A;  2PI0 A;  3WOD F;  4ZYG A;  3G73 A;  4AIK A;  1NG7 A;  3OYM A;  2JN6 A;  3A03 A;  3LSH A;  1D8J A;  3E6C C;  1HCR A;  3M9A A;  1W1W E;  3U1D A;  4UVC A;  4AD9 A;  5EDN A;  4HOB A;  3CES A;  2E5Z A;  1FT9 A;  1V4R A;  2BBY A;  4BJ5 C;  3TL4 X;  4NUB A;  2L7K A;  1ZR4 A;  3CLO A;  4B48 A;  2MC3 A;  2NS7 A;  2ZME A;  3G1O A;  4PJN A;  1MBF A;  3IH3 A;  1E3P A;  4BGD A;  2EFW A;  3GTG J;  1B59 A;  2P81 A;  3EQL F;  3I71 A;  4KIC A;  5E1Z B;  3JAM K;  2FML A;  3V7S A;  3PSF A;  4BBR J;  1X19 A;  2KDO A;  5EEH A;  3FXM A;  4B3X A;  1S29 A;  2YX7 A;  3K6G A;  3GTP J;  3A02 A;  3C18 A;  2ZME B;  2LFB A;  2A6T A;  2XV4 S;  5J1Y A;  5DM7 F;  1VQ6 I;  4BXX J;  4O6J A;  4PSW A;  2RV8 A;  4XBF A;  2UUZ A;  3HOT A;  1OPC A;  3ZQL A;  2AHQ A;  4JX4 A;  2O5R A;  1GV2 A;  4HSR A;  1BR2 A;  1OCT C;  1EKE A;  1J2X A;  1LDK B;  5J4V A;  2OPT A;  4KJZ A;  4HX4 A;  4CXF A;  3FZV A;  3ESW B;  3HSR A;  4ESB A;  1DQU A;  4C2U A;  2RQP A;  1D1B A;  2ELK A;  3FXO A;  1V54 H;  3MZH A;  5IOZ A;  1DP7 P;  4XOT A;  3V42 A;  4XON A;  3BZK A;  2H94 A;  3NWS A;  2DA6 A;  5EF6 A;  2W57 A;  4ITV A;  2V9K A;  1Y0N A;  4KYW A;  4ZJZ A;  4XLA A;  4LB5 A;  2QA4 I;  1T95 A;  3F21 A;  2E1M B;  2OZU A;  2K9Q A;  1OR7 A;  3MEX A;  1F5T A;  3G71 I;  2CUZ A;  3TO6 A;  4MLO A;  2KQR A;  2MD0 A;  3CCS I;  2E2J J;  5HOD A;  3BTC A;  1IAW A;  2XAF A;  5KNL A;  3L9F A;  4IHT A;  2A07 F;  2K3P A;  1MBE A;  2EPF A;  1RR8 C;  3RPQ A;  2F5E A;  2A5Y B;  2NYX A;  2Y0S N;  1Y39 A;  3NAR A;  4RGR A;  1BIB A;  1DU0 A;  2XPW A;  5LHG A;  4C3I J;  3SDB A;  2XPU A;  3WGH A;  3MQ0 A;  3WTZ A;  1WJE A;  2KPM A;  5J1U A;  2QQ9 A;  4MHG A;  1FSE A;  2UXX A;  3ERM A;  2W7N A;  3FXL A;  1NTC A;  2Z5U A;  4EGY A;  1IXC A;  3H5N A;  4BU2 A;  1MBH A;  4BH9 A;  1G3S A;  5FB2 A;  1ZLK A;  4D7M A;  3EYY A;  2VKD A;  4M73 A;  4EJV A;  4IF4 A;  1JTX A;  3DBH B;  3MKL A;  2X1C A;  5FRO A;  5FKN A;  3A01 B;  1U8B A;  1ETV A;  5F0F A;  1J59 A;  1KU2 A;  3Q9V A;  1O4X A;  1QPM A;  1T39 A;  4LFU A;  4ASN A;  2CJJ A;  1RET A;  1D5Y A;  4XL9 A;  1UCR A;  5BNG A;  5J40 A;  3DFG A;  3CCJ I;  4UVA A;  4G6Q A;  2CUJ A;  4I0A A;  3FM3 A;  5LFA A;  2PMH A;  3L1P A;  1H88 C;  4RA2 A;  4AVP A;  2X6W A;  1UHW A;  1T98 A;  3JRH A;  3PQK A;  4IVN A;  5D5X B;  2R0Q C;  1LFP A;  1WZ2 A;  1XSV A;  2ZC2 A;  2LG4 A;  3D5S C;  5M5Y J;  3KCC A;  3I54 A;  1JJ8 C;  4OIO F;  2JA5 J;  3GCM A;  2ZSI B;  4HW0 A;  4XIC A;  5HOO A;  4IXA A;  2ZSH B;  3MKW B;  4CCL A;  4M3E A;  3LA7 A;  1Z1D A;  3LAJ A;  3K4L A;  1V5G A;  2BXY A;  3HUG A;  4IOA F;  4CH7 A;  1YO5 C;  1ZR2 A;  4XR6 A;  1BW6 A;  1VQN I;  4YEJ A;  3D5L A;  5L3B A;  1S72 I;  2J5O A;  2CUF A;  1Z6R A;  2F5F A;  1XX5 A;  5E3O A;  2EA2 A;  4YIF A;  3F8M A;  2YX4 A;  4UUV A;  4KIB A;  1E2X A;  2R7S A;  3JRE A;  3V8L A;  1W4M A;  3H3Z A;  1P92 A;  1YW8 A;  3AG4 H;  4ENM A;  3C2G A;  1YIT I;  2X6O A;  3CCL I; 
#chains in the Genus database with same CATH homology
 2IGM A;  3U21 A;  2LBF A;  2VQL A;  2P0W A;  4ZC3 A;  3SYT A;  4U87 A;  3IAS 2;  1N78 A;  2VXZ A;  1MMN A;  1E0E A;  1FMW A;  1D1A A;  1LVK A;  1V5E A;  5KHD A;  3OY9 A;  1FMV A;  1WJB A;  1GLN A;  2DT7 B;  2KRH A;  2VJ5 A;  3OYN A;  3K4M A;  2X1D A;  2L9N A;  3A4C A;  2ZXH A;  3PNT A;  4RLF A;  4HG2 A;  2LRE A;  3DKX A;  3DPU A;  2NOJ B;  4BDZ A;  3DU5 A;  2XF7 A;  1JI8 A;  4XOR A;  4BE0 A;  3OIP A;  4XN3 A;  3DU6 A;  3KYL A;  3OYH A;  4PJM A;  4DOZ A;  1QHG A;  1Z3X A;  2K9L A;  4JOM A;  4E7S A;  4HNT A;  4QPQ A;  2CH0 A;  3FDY A;  2F4I A;  2IGK A;  2QKM B;  3W3C A;  1WJC A;  2IGN A;  4PUS A;  1X1C A;  4EAT A;  4ANJ A;  3QYE A;  3OYI A;  2V1N A;  2RQQ A;  3FBI B;  2I8D A;  2VJ4 A;  2XSJ C;  3ZXS A;  3M8J A;  4CZC A;  2VAS A;  3PJR A;  2V6E A;  3OR2 C;  3OL4 A;  3H9G A;  3L2W A;  1SFK A;  2VPL A;  2WB1 A;  2IXS A;  2HNH A;  2ZXI A;  3VDX A;  4ZTJ A;  2Z2S B;  4IKF A;  2VQC A;  2WAD A;  2X85 A;  3I9V 2;  4E4H A;  3H5A A;  2QKL B;  2HDW A;  2JSP A;  1K6Y A;  4BUP A;  3OYA A;  4BAC A;  1BOB A;  2XF5 A;  4Y4R A;  5TGT A;  3OWT A;  2KP6 A;  2LY2 A;  2R4G A;  4XKV A;  3K4J A;  3VSK A;  4BDY A;  4XKC A;  4F55 A;  3K4B A;  3K4C A;  2Y0S A;  4G6T B;  1D0Z A;  4BQN A;  2IS1 A;  4IX7 A;  1KON A;  4BL0 B;  1YX3 A;  2M0M A;  2WAQ A;  3J7A Y;  1G59 A;  4NQW B;  2DJI A;  1X4O A;  4HNU A;  3OYL A;  2XC7 A;  2HVS A;  2GOX B;  1NG6 A;  3CP8 A;  3FKJ A;  2V26 A;  1WJ5 A;  3W2V A;  4XN0 A;  3KX2 A;  1V5F A;  3TBI A;  4ZTF A;  3OYJ A;  2R7T A;  4XQF A;  3MMY B;  3LL7 A;  2WY7 Q;  2CW8 A;  2Q2E B;  2W00 A;  2R7U A;  2X6Y A;  3ZQQ A;  4KIT B;  5CQG A;  2R7V A;  4P5O A;  4B47 A;  1OR7 C;  4AYB A;  2LY1 A;  5HNH A;  3L2V A;  4CSW A;  2HPM A;  3RPU D;  4F93 B;  2UWM A;  4E7J A;  2HZD A;  4XOP A;  2WAF A;  2XAU A;  3H5R A;  3RSN A;  4E7I A;  3BG6 A;  3LSK A;  3S3N A;  4PJJ A;  3IUO A;  4BQQ A;  1ERD A;  3IAM 2;  2DCE A;  3OR1 C;  2OV7 A;  4NC7 A;  3OYK A;  4F3Q A;  3H35 A;  1BR1 A;  4DBR A;  1WJA A;  1T0F C;  2Z1D A;  3BC8 A;  2WY8 Q;  3DWL E;  3HUG B;  2LRD A;  3OS0 A;  1VZ0 A;  3PSI A;  2LH9 A;  2VL8 A;  5HNF A;  3NWT A;  4YEL A;  3K10 A;  2VLA A;  3S3O A;  4BEH A;  3QYF A;  2RNG A;  4LIV A;  4YRV A;  3HKZ A;  4E7H A;  2KLO A;  3LSG A;  3DTK A;  1DGR M;  4DJA A;  4QPO A;  5JHF A;  2CS3 A;  3ZCO A;  3QYB A;  2Z16 A;  2LBF B;  2M7B A;  3S3M A;  4BJ6 C;  1DP3 A;  2KHM A;  4PK4 A;  5FRN A;  4BEH B;  4BJT A;  2K9M A;  4PFO A;  4DBQ A;  1TZL A;  2JUG A;  3TMO A;  3L2U A;  4XLC A;  2HVQ A;  3E0J B;  2MFZ A;  2CW7 A;  2PMZ A;  4ZDO A;  3OS1 A;  3BCB A;  4Y3O A;  4LIU A;  2X51 A;  3DPL C;  4XKB A;  4D1Q A;  2HPI A;  3RTR A;  1MMG A;  2ZFU A;  4OAZ A;  3L2Q A;  2MAB A;  3W2A A;  4KIS A;  3OL3 A;  3ONQ A;  2HU9 A;  2IS4 A;  4XLF A;  3RCO A;  1TT0 A;  3BLY A;  4N4N B;  2BOL A;  5HVQ C;  1AA7 A;  3OS2 A;  2M4G A;  2F6C A;  4C2T A;  3AKZ A;  1OLT A;  2OUM A;  4ZYA A;  4XNF A;  4BS9 A;  4OAY A;  1PJR A;  4CCM A;  1MND A;  2R7O A;  1Z7L A;  2L2O A;  4FET A;  1QU3 A;  1BR4 A;  2VKH A;  4P1W A;  4E7L A;  2ELJ A;  2BVL A;  3PUB A;  4IQ4 A;  4CCN A;  2UV1 A;  2GOM A;  2V4J C;  2PJR A;  3OYE A;  4RLQ A;  4IQJ A;  4HPQ A;  3G2B A;  3QOE A;  1D1C A;  1LKX A;  2DOA A;  1W36 C;  4XKW A;  3FHN A;  4AU7 A;  3OYC A;  1D0Y A;  2FUG 2;  2JVG A;  3K4N A;  2R7X A;  4HRI A;  4CA0 A;  2MC4 A;  2F5V A;  2LYC A;  4J01 A;  2BW3 A;  4CCJ A;  2PJR B;  4LIT A;  2IGO A;  2JVH A;  3OYD A;  4F91 B;  2CV2 A;  3M1C A;  3IP4 B;  1MMD A;  2K5C A;  4AVZ A;  3PNY A;  4PSX A;  2VIX A;  3AL0 B;  2DXI A;  1J09 A;  3N05 A;  3HOS A;  5LD2 C;  1DGW Y;  5CKT A;  3CJQ B;  2VQH A;  2VB6 A;  2BW3 B;  3OOU A;  4BE2 A;  1N75 A;  4LG3 A;  1D0X A;  1HA8 A;  3CZ6 A;  4NNJ A;  4CUG A;  3CP2 A;  2HVR A;  2CFO A;  1NG7 A;  1YX5 A;  3OYM A;  3PL8 A;  3LSH A;  3ZGK A;  4XM3 A;  3W2W A;  2VJJ A;  3CF2 A;  4II3 A;  3OYG A;  3CES A;  2R7R A;  3OYB A;  2WBM A;  2M3A A;  2E5Z A;  4NC8 A;  4F92 B;  4BJ5 C;  3TL4 X;  3ZRG A;  4II2 A;  4NUB A;  1ZEL A;  4E6K G;  2L7K A;  1R6R A;  1X1D A;  2RRE A;  3LMM A;  4PJL A;  4B48 A;  4DIQ A;  4PJN A;  4DGW B;  3SZG A;  1N77 A;  4HEA 2;  4BGD A;  1W36 D;  3LFU A;  2KZV A;  4H4K C;  5CQE A;  2AQF A;  3PSF A;  3DPT A;  1X19 A;  2KDO A;  2WAE A;  3FBN B;  4RM3 A;  3LSI A;  4B3X A;  3RQ4 A;  3K6G A;  2W82 A;  2IS2 A;  2A6T A;  4OWR B;  2LOO A;  1MMA A;  3GBG A;  1G8X A;  3K4K A;  2WA0 A;  4PSW A;  3HOT A;  2UUZ A;  3OIQ A;  3DKY A;  4B43 A;  2A5W A;  1Z3Y A;  3MD2 A;  4X0G A;  5HLT A;  2X1E A;  1X1A A;  2O5R A;  3A1Y A;  3EUH C;  4HSR A;  1BR2 A;  2LC2 A;  2VQG A;  4ZDP A;  4XMY A;  4BXF A;  1LDK B;  3H9J A;  3AL0 C;  3HPG A;  3DTE A;  4KJZ A;  3VYS B;  1DQU A;  1YE9 A;  4C2U A;  3DTI A;  1D1B A;  1X4P A;  4XLH A;  3BCA A;  1QHH D;  4GRI A;  3BG7 A;  4XOT A;  3V42 A;  4XON A;  3HC7 A;  3NWS A;  3I3L A;  3L2R A;  3QOD A;  4ITV A;  2V9K A;  4ZJZ A;  1WJF A;  4XLA A;  2VJI A;  1T95 A;  2E1M B;  3HXL A;  2JA2 A;  4B44 A;  3CJR B;  2CUZ A;  1P9Q C;  2CV0 A;  4MLO A;  2KQR A;  2MD0 A;  2E5N A;  3S32 A;  2KRC A;  4J00 A;  4RM2 A;  3C2H A;  1MW7 A;  5KNL A;  3K70 C;  2W1O A;  3UNG C;  2K3P A;  2KMU A;  2VXD A;  4HST A;  3KEY A;  3VSL A;  3VYT B;  3HG9 A;  3MKY B;  4RMN A;  4CCO A;  3SDB A;  4BQO A;  1WFX A;  2OC6 A;  1WJE A;  2KPM A;  3A2K A;  2MYS A;  2XF6 A;  3VYR B;  3DQV C;  2Q1Z B;  2W7N A;  1U0J A;  1Y6I A;  1PYV A;  3DEE A;  4Y33 A;  1WJD A;  4D9J A;  3VYU B;  4U7B A;  3UR3 C;  3H5N A;  4BU2 A;  4R79 A;  2KL4 A;  2XDV A;  2E60 A;  2VKD A;  1UG0 A;  2X1C A;  1X1B A;  5FRO A;  2BVM A;  1EA3 A;  4XLE A;  3SEZ A;  3OMY A;  4KT6 A;  4IZZ A;  2CMP A;  2R7Q A;  3F9K A;  3HPH A;  1Z21 A;  3OYF A;  2IS6 A;  2V7F A;  3VWB A;  3D5R C;  4E7Z A;  3ZR8 X;  4XL9 A;  3CMM A;  1SAU A;  2CUJ A;  3SEQ A;  3K70 D;  4CCK A;  5LFA A;  2HQA A;  5FRM A;  2E1M C;  3PFY A;  2X6W A;  5CPR B;  2R7W A;  1LFP A;  3MKZ A;  5KCM A;  1UEL B;  2LG4 A;  3D5S C;  3EPZ A;  2M4K A;  2AQE A;  3EUK L;  3E1S A;  2ZSI B;  4FAS D;  5HOO A;  2ZSH B;  4N4O B;  3S8P A;  3MKW B;  4CCL A;  4JQF A;  1Y56 A;  2L9S A;  2DT6 A;  4BE1 A;  3K4L A;  2CV1 A;  4E7K A;  3PNV A;  1V5G A;  4F52 A;  4CH7 A;  1MNE A;  1UAA A;  4XR6 A;  4YEJ A;  3D5L A;  3HL2 A;  4ZDL A;  1IRX A;  2L5Q A;  4C30 A;  1S9H A;  3DLA A;  2X6X A;  3H9Q A;  2W4S A;  3AFH A;  4C9Y A;  2M7A A;  3H0D A;  2R7S A;  3LSM A;  4PFP A;  3C2G A;  3S93 A;  3EUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...