1BL0A

Multiple antibiotic resistance protein (mara)/dna complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
b'DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*GP*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*G
publication title A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A01
5JLWA 4AUXA 4FCYA 1G2HA 4BBSJ 3A01B 4IHXA 1ETKA 1TWCJ 3LNQA 5EZGA 2XB5A 4W97A 4M3GA 2HYJA 1RKTA 1UMQA 4DW6A 5M3MJ 2CQXA 1MNMC 3QPSA 4A3EJ 2CU7A 3SFIA 5FKMA 1MBGA 5GPAA 3CCYA 2WV1A 3BG9A 1IJWC 4J19A 2NS7A 4BY7J 5IP7J 1ZR4A 2R7ZJ 1XC5A 1WGXA 5IP9J 4FE4A 5EF6A 1T33A 3RZDJ 2R0QC 1CQTA 1ENHA 4FE7A 2JK3A 2LVSA 3TP3A 5FLVA 2K9SA 1E3OC 2DTZA 3GTOJ 3OOUA 5F1JA 1MBKA 1BA5A 1S7EA 1X2NA 3JRDA 3Q0UA 3CMYA 3BR2A 4QSHA 1IDYA 3HOXJ 4A3CJ 3PM1A 3BR1A 2E2HJ 2M9HA 2CRGA 1JKOC 3PO3J 1MSEC 3A02A 4C3JJ 3ZQIA 4A3KJ 1P7IA 4M3BA 1YRNA 3GTLJ 1O4XA 2TCTA 3LSPA 1JUMA 2LP0A 3NAUA 4DZJA 5IOYA 5M5XJ 3GTJJ 2VKEA 2MGQA 1F36A 1TWAJ 2XGEA 5C3EJ 5EYRA 3MKLA 5FJ8J 3MVPA 3HB9A 1IG7A 2WB1N 1FJLA 4V2GA 4W1UA 3JRCA 1IV6A 1ETXA 1I50J 3I4MJ 2I10A 3HOZJ 2HOSA 1AU7A 4RBOA 1TC3C 1QVTA 2ECBA 2K9NA 4A93J 5EGOA 3S1QJ 5K7FA 2M34A 2LLKA 4UUTA 3MN2A 3ZOBA 4JYKA 5EZHA 3Q3SA 2DMQA 3BQYA 3S14J 4M6VA 1RR7A 3IH2A 1PUFB 1WH7A 2LKXA 1ETVA 2R92J 5J1UA 1IC8A 5EG0B 2XSDC 2DMTA 2JN6A 4JX4A 4XRMA 3TP0A 3NARA 1JGGA 3BTLA 5C4XJ 4G12A 5J1YA 2NVTJ 1ETYA 1U9OA 2M0CA 3HOUJ 5FLMJ 2HDDA 1QPIA 2EZIA 2VPRA 1MBFA 5F04A 4A3FJ 1HCRA 4EEFG 4A3BJ 4FTHA 2O9LA 5F08A 1AKHA 1FTTA 1HF0A 2K40A 2EZHA 2P81A 2LK2A 4MO7A 3GTPJ 1QVUA 4X6AJ 1K83J 2E19A 1ZTRA 2B63J 5HODA 2FQ4A 1MBHA 4Y7NJ 1MBJA 2ME6A 1MBEA 1MH3A 1RKWA 3FK7A 1B8IB 2VUMJ 3LSRA 4A3MJ 2L7ZA 3CQZJ 4BY1J 2DA3A 2AO9A 3M3YJ 2DMUA 3GTKJ 1FIAA 3RKQA 1OCPA 1JT6A 1WCMJ 3BTJA 1ETQA 2VKVA 3L1PA 2GLOA 1ZQ3P 1Z0XA 4CYCB 1VI0A 3C2BA 5E3MA 2JA5J 2GM4A 1JTXA 2MSYA 9ANTA 3IH3A 4BKXA 1SFOJ 1X58A 2FX0A 2R93J 2R5YB 1GT0C 1B72B 3S17J 2CQQA 2DA1A 4MFEA 2D5VA 3RZOJ 2E2IJ 4A3LJ 5FKNA 1Y1WJ 2EH3A 4MFDA 2GBYA 4A3IJ 2KT0A 4DZPA 1MH4A 1WI3A 3SDGA 4UUSA 1ITYA 1X2MA 3S15J 2CUEA 2L9RA 1FIPA 2NOGA 3GBGA 1RETA 3QPLA 3RQIA 4D5FA 2HXOA 1D5YA 3H3VK 3ZQCA 4IHYA 2NVYJ 5M3FJ 2HOAA 2E1OA 4XK4A 3JREA 3IH4A 2DN0A 1FTZA 2CJJA 2KDZA 3F0CA 3BR6A 3QQAA 3HBLA 3LSGA 1TWHJ 1ETWA 2NS8A 2ZB9A 3M4OJ 5IOZA 5E3OA 1H8AC 1OJLA 3HKZN 3IV5A 1H89C 1GV2A 1I6HJ 5C4JJ 4AC0A 4XIDA 2H8RA 2Y30A 3TW7A 1JJ6C 1IRZA 5GP9A 1POGA 4DYRA 1LE8B 2TRTA 3E7LA 3K7AJ 3S2HJ 4NDLA 3H0GJ 3LSJA 1JKQC 1ORKA 4M3FA 4C2MJ 1U78A 2R5ZA 3SJMA 4B4CA 2X9DA 1T56A 2QF7A 2W48A 3B6AA 3FISA 3ZQGA 2Y9ZA 1U9NA 4B1RA 3LOCA 1YRNB 1NTCA 3BTIA 2LD5A 1ZK8A 1BJZA 1QRYA 3JRIA 3BR5A 5DTDA 1JUPA 2HXIA 1Q1VA 1U8BA 1F43A 1IGNA 3ZQFA 4A3DJ 2DJNA 4XRSA 3TEDA 4B3AA 4FISA 2M8GX 2LFBA 4DYQA 4A3GJ 2O8KA 3BG3A 3GTGJ 1BW5A 1MSFC 4A69C 1HOMA 2IBDA 2DA7A 3BR3A 1JKPC 3FKIJ 3WHCA 3TW6A 3S1NJ 2ECCA 4M3DA 1Z77A 3B6CA 2EZKA 5EGOB 2XGDA 2XRLA 2JMWA 2JA6J 2ID3A 1FEXA 2CUFA 1VFCA 2EBIA 1AHDP 3O8GA 1XG1A 3VPRA 1ZGWA 5DS9A 1ZR2A 3A01A 2DMPA 1WH5A 4IHWA 4L5EA 2K9QA 4XRSG 3G1OA 1EF4A 1GV5A 2DA2A 1HDDC 1HDPA 3CDLA 2NVQJ 2PMZN 5F0FA 1JUSA 1RESA 1BL0A 1JT0A 4JX6A 3Q0WA 2EQRA 1K61A 4C3HJ 5FKLA 2XPWA 3UKGA 2R5YA 2XGCA 4JX5A 2YU9J 2HI3A 2XPVA 3HEFA 2ELKA 2HOTA 2MG4A 5IYCJ 1WPKA 1BW6A 2M2EA 2QCOA 4QTRA 2COBA 2LR8A 1GDTA 5JLXA 5J1RA 3BQZA 3FIWA 2JWTA 3ZQHA 5IYDJ 3FK6A 1LFBA 3JRBA 1TWFJ 5J3LA 5IP6A 3BG5A 2FJ1A 4I76A 2N8GA 5FKKA 4RDUA 3JRGA 4ABZA 2YUSA 3JR9A 1H88C 2AHQA 3GTMJ 2WAQN 5F27A 2G0EA 4XICA 2RAEA 1UHSA 1ETOA 1Y1VJ 5K7ZA 3DEWA 2O7OA 2OF7A 3S1MJ 3Q0VA 5IPAA 3D1NI 5K7HA 4Y52J 1JKRC 2HQ5A 4X1EA 2L0KA 2JA8J 2DA6A 5E3LA 1DU0A 2IAIA 3HOYJ 1LE8A 4UUSB 2E2JJ 4V2FA 5M5WJ 3HOVJ 1R9TJ 4BBRJ 4I6ZA 1W0UA 3GTQJ 4D7MA 3HOWJ 4JP0A 2OPTA 4QIWN 1NK3P 2LY9A 1OCTC 1APLC 1SANA 2Y31A 4C3IJ 3OIOA 1JTYA 4M3EA 3HDDA 2FD5A 3BTCA 2Y0SN 4S0HB 4IHVA 3A03A 3BR0A 3ZQLA 4MIMA 1I3QJ 1PUFA 3G1MA 4IEJA 1IUFA 2DA4A 1RPWA 3HM5A 5EG0A 1A5JA 3S1RJ 5EDNA 5EEAA 2X6OA 3JRHA 2DA5A 2NVXJ 1ZKGA 3DCFA 3S16J 2XPUA 4GFBA 3PO2J 2Y2ZA 2LTPA 4DYCA 5M5YJ 1UG2A 3HGYA 1P7JA 1XS9A 3OSGA 3G1LA 5E3NA 2DMNA 2Y9YA 3JRFA 1IDZA 2ID6A 2EZLA 2R5ZB 1TWGJ 4AYBN 3O8HA 1GVDA 1LFUP 2MW8A 3WHBA 1NK2P 3BT9A 2VI6A 1VF9A 1W0TA 3HGGA 2L7FP 5GPCA 4MLOA 4LOCA 2X48A 1B8IA 5F0CA 5BNGA 2YS9A 3I4NJ 5C44J 3K2AA 3JRAA 3W6VA 1OFCX 2L7MP 1A6IA 5IYBJ 2XB0X 4CYCA 1GUUA 1VNDA 2ME0A 4BXXJ 3S2DJ 1HLVA 5F0HA 1DU6A 2H1KA 2JA7J 1B72A 1JJ8C 3OSFA 4D7NA 4A3JJ 5FKOA 2JJ7A 1AKHB 4D5CA 4HNVA 2IEKA
chains in the Genus database with same CATH superfamily
3U21A 3ABUA 1X1BA 2RQPA 2KRHA 1FOYA 3A01B 3GZNB 2MABA 3QAHA 1P92A 4CZZA 1IRFA 2P7CB 1UJ8A 4PSXA 4M3GA 2HYJA 1UAAA 3TQNA 3T1BA 3LSMA 1JHHA 5M3MJ 1D0ZA 2KHMA 2JVGA 5FGMA 1HW1A 3SFIA 3HPHA 2PMHA 2EIKH 4KDPA 2EFQA 2ZFWA 2DOEA 3ZQ7A 3CCMI 1HXDA 1LJ9A 2O3FA 4RM2A 1DGWY 1TLHB 2I5UA 5CVIA 4ZC3A 4KITB 3IL2A 5IP9J 4FE4A 2R0QC 1CQTA 1ENHA 3ZQQA 5D5UB 3S8PA 2JK3A 4IF4A 1V5GA 2LVSA 2BY0A 2WB1A 2E60A 4MEYF 1E3OC 2QVOA 3GTOJ 1MBKA 1BA5A 5J8FA 2NAZA 1XN7A 1WFXA 4PZJA 3FBIB 2FBKA 3Q0UA 4IVNA 4LFUA 4PUSA 4G7OF 4KT5C 3OYEA 1B59A 3CMYA 1KQ8A 2EJRA 1J09A 2AXTC 4G9YA 3LA2A 2E1MB 3HOXJ 5LHHA 4RLFA 3G71I 3I59A 3A02A 3RQ4A 3S32A 4C3JJ 4IHSA 3WGIA 3WG9A 1BC8C 4M3BA 5F6FA 3MKWB 1YRNA 4WCGA 3GTLJ 2MLGA 4EM2A 1LEBA 1T0FA 5FLXK 3LSPA 2LP0A 1R23A 4A5NA 5KHDA 4ESJA 4BHPA 2FOWA 2VKEA 2WA0A 2V7FA 4ETSA 1O3QA 3I55I 3QOPA 1TWAJ 5F64A 2KIMA 2ETHA 1FP1D 5GADJ 2PJPA 2MC3A 3DTIA 1SC7A 2Y0MA 3K4MA 4XLEA 1D1CA 2ZNZA 2I8DA 3HB9A 2WB1N 3N4MA 5D4RA 2R7OA 1YTYA 4W1UA 1IV6A 2Z3YA 1D3YA 3DFGA 2KZVA 2I10A 2KRCA 3Q9VA 5LD2C 5K5QA 4P1WA 2CW0F 1LVAA 2CS3A 2AQFA 2FA5A 1RC9A 4BU2A 3M1EA 3FXKA 2PI0A 2M34A 4XKBA 2L2OA 4GXOA 2K7LA 4B48A 4JYKA 2VJJA 3WTZA 2ZBKA 3I71A 3R0JA 3BQYA 3HZJA 1TT0A 1WH7A 3F8BA 3HIFA 3OS0A 1D8JA 1T98A 3D0SA 4E7SA 4U88A 5ILSA 4IOAF 1FSHA 3M8JA 2DMTA 2JN6A 3FDYA 4Y3OA 1VQ4I 4FASD 2NVTJ 5FLXZ 1MDMB 2FQ3A 2M0CA 2QKMB 5IY5H 4A0XA 3VOEA 1MBFA 4EEFG 4BE0A 3G6EI 1HW5A 5F08A 2O5RA 4UVCA 2XKOA 3JCUC 4MNUA 2JPCA 3HXLA 4ESFA 4UV8A 4CCOA 4KT6A 1K83J 2JVHA 3ECOA 4ZH4F 3OYAA 5IT9Z 2K27A 4QWQA 2L7KA 1DDNA 1VQOI 2ELHA 1MBJA 1MH3A 3WTYC 4QPQA 2NOJB 1OMIA 2XAGA 2L7ZA 3CQZJ 2VPLA 2QEXI 1O7FA 3LA3A 3M3YJ 4ON0A 4LK1F 2GLOA 3K4JA 2GXGA 1Z0XA 2DTRA 4ENKA 2IP2A 2K4JA 5DD4A 2JA5J 2LY2A 2QSGX 1XPXA 2PJRA 1J2XA 5LGUA 4ZDLA 2R5YB 4EGZA 1GT0C 3P7NA 3I5UA 2E2IJ 4A3LJ 3PUBA 4NNJA 4ZDPA 1Y1WJ 4ZZLA 4MFDA 5J4YA 4QPOA 2X6YA 2KT0A 1MH4A 2DT7B 1JE8A 1V55H 1X2MA 2CUEA 5FO5A 1FIPA 2KISA 1U3EM 3RQIA 2YX7A 5BPIA 1YX3A 2CV0A 2MA3A 3SZGA 2EPFA 3J81Z 3ZQCA 2R4GA 2QQBA 2W57A 2HOAA 1S3JA 5CPRB 2YR2A 3JREA 2DN0A 3OS1A 1ZH5A 4E4HA 1Y0NA 4Y15A 1QHGA 1TWHJ 4BJTA 2NS8A 2ZB9A 5ED4A 4ANJA 3FHNA 3S3MA 1H89C 1I6HJ 2Y69H 4HDVA 3REOA 3AG4H 2ZO4A 4YG2F 3CESA 5JHUA 1MNDA 2ZMEC 3HOSA 1Z3YA 1T39A 1IRXA 1DGRM 3R61A 2DCEA 3TW7A 3HRMA 2OZ6A 3K7AJ 5H2FC 4FETA 3HRTA 1QBJA 3GZ6A 5L3CA 1U78A 2V1DA 3BJAA 5DV5A 1T56A 2BY2A 2MLKA 2EA2A 1D1AA 2EFOA 3N97A 5E17F 5E20A 2EFPA 1YRNB 3ABMH 1BJZA 2GQQA 2IJLA 4L0YB 3OYIA 4DJAA 1F43A 2HXIA 4WK8F 3WGGA 2AQEA 1U8BA 3FF5A 1XGSA 2JSPA 5L3GA 3UR3C 1IXCA 2DJNA 1IUYA 2HR3A 4Y13A 3K69A 3H9QA 4FISA 3ZMUA 3OYGA 1E3HA 4F92B 4F55A 4DYQA 1MGTA 3WTSC 2O8KA 3ONQA 3QWLA 2IXSA 5DEQA 1B1BA 1WJFA 2DA7A 3CMAI 3P9IA 2QSHX 4Q5SF 3S1NJ 3KEOA 1VQPI 2ECCA 4M3DA 1Z77A 2J5PA 4NBQA 2JMWA 4L5JA 1OKRA 4E7HA 1RNLA 1Q1HA 2CUFA 3V7RA 2ICWG 4KFCA 4XNFA 2YX4A 3VPRA 5LHIA 3F9KA 2W4SA 3BY6A 2PN6A 3DLAA 2R7FA 4PSWA 1OLTA 2DMPA 1SD5A 1T95A 3L7WA 4L5EA 5K1YA 4PCQA 2MH2A 2VIXA 2XIGA 3GYHX 4HF2A 2X85A 2ELJA 1XD7A 5CVRA 3HSEA 4UB8C 1HDDC 1HDPA 2H6CA 3GX4X 4UY8I 2QQAA 4IKFA 2XUBA 2KZGA 1YIOA 2M4KA 4AU7A 2EQRA 4C3HJ 4XMYA 3QP6A 3UKGA 4BNCA 4KIGA 1OPCA 4YFXF 3MFKA 3BCBA 2XGCA 3OYFA 4JX5A 3H5AA 3OYLA 3HEFA 1TP4A 2ELKA 4OMZA 1LKXA 3PSIA 1WPKA 2M2EA 4LG0B 3ZMSA 4B44A 5D6EA 4G8XA 3ZN1A 4XORA 5JLXA 1Z3XA 1UHMA 4HSTA 3ZQHA 3CMEI 5IYDJ 1AWCA 2QLZA 3BCAA 5D8LB 2RNGA 2RNJA 1ZRCA 1LFBA 3TOAA 3T5XA 1PUEE 3JRBA 2F4OB 5J3LA 1U5TC 1X19A 3F8MA 2QENA 1B9NA 3TBIA 1N75A 3AG2H 2VBXA 3QU3A 1UCRA 4BHBA 1T6SA 4KJZA 4P55A 2QZ8A 2YUSA 5HS7A 3CCLI 2AHQA 1SFUA 5F27A 1X1AA 1YQAA 3KP6A 2DU9A 3HPGA 3LAPA 2CGPA 2DBBA 1UHSA 2JSCA 4OAZA 1ETOA 2V9KA 3GFMA 4FX0A 2O7OA 4R1HA 3AAFA 2HEOA 5K7HA 4HF1A 3Q5FA 1JKRC 3JSOA 3HRUA 2L0KA 1NG6A 2JA8J 1DU0A 2IAIA 1N77A 1LE8A 4ASNA 1PVEA 1IAWA 1RUOA 2OBPA 3C2HA 3ZPLA 2K9MA 2FSWA 4JP0A 5FFXA 2OPTA 4RS8A 4NC6A 5E8GA 2GIZA 4XONA 3K0LA 3E6DA 4BJ6C 3QP5A 1QZYA 3CP2A 3CTAA 1JTYA 3H0DA 4BQOA 1B6AA 3I9V2 2X0LA 3JW4A 4I7HA 3BR0A 4AM3A 1PUFA 4G7ZF 1RPWA 1Y6IA 5IT3A 1HC8A 5EG0A 5EEAA 3DCFA 2DK5A 2BY3A 2O03A 3BZCA 1D5VA 3BPVA 3CP8A 1AA7A 1UG2A 1XMAA 2K02A 3AG1H 2M7BA 3ZN0A 1FBUA 1KU2A 3ASNH 2UUZA 1YHQI 1ZLJA 3F8CA 2Y9YA 3WGHA 3JRFA 1XGOA 1GVJA 2RDPA 3FM3A 4Q48A 2F5CA 1LDJA 1GVDA 2R7UA 1SEUA 1G3YA 1V4RA 2VI6A 2MYSA 2Z2SB 3KIOA 4AIHA 3KLNA 1MMAA 2XF6A 5GPCA 4HV6A 1ZREA 2M0MA 2X48A 3KX2A 4LITA 2LKPA 2WC2A 3JRAA 3W6VA 2JUGA 3GO5A 3LSTA 4I99C 2ADUA 2HYGD 4E7LA 4O6JA 4AIKA 1VNDA 2ME0A 3V8KA 2EFWA 2UXXA 1SAXA 4RB0A 3GFJA 1WKMA 5B5EC 5JVGF 1X3ZB 1DU6A 3OS2A 2H1KA 3S3OA 4XLPF 3L2UA 2H94A 4U0WA 2R3SA 1JJ8C 3OSFA 2W25A 3CF2A 2V79A 3V8LA 3PQJA 3D5RC 1XDUA 1HKSA 3OL3A 2WWYA 4II3A 3L2WA 1BI1A 3FMRA 3TKYA 3WU2C 4BBSJ 3ZMDA 2VASA 2VN2A 1ETKA 1TWCJ 4P9FA 2D1HA 5L3DA 2KKOA 2XB5A 2GXBA 2PBIA 1W5CC 3F72A 2FEZA 2E71A 3OWTA 5D5XB 1U0JA 1MNMC 3HHHA 3RPUD 4A3EJ 2JPBA 5GPAA 5TRDA 1ERDA 1QZZA 2LSOA 2VJ5A 2WV1A 1P6RA 4KIFA 3L2VA 4II2A 3SXYA 4MGRA 5IP7J 1ZR4A 2KIFA 1HSJA 2R7ZJ 3FWEA 2A5WA 1WGXA 4Q4ZF 5EF6A 3RZDJ 1ZGJA 4KMUX 4CCJA 1BI2A 3TP3A 5CVVA 5LFAA 2IA2A 3OOUA 2LKSA 4YIRX 1S7EA 4KYWA 3JRDA 3F21A 1A04A 1YE9A 3RIRA 3EUKL 4G94A 2ZJQF 3QODA 1FOKA 2HZDA 2L9VA 3H92A 5KK1A 2QUFA 2ZXJA 2OA4A 3BR2A 1ULYA 5J4VA 3PM1A 2W7NA 1QQIA 2M9HA 2X6WA 4ZYDA 2JT1A 2YU3A 3CCVI 3PO3J 4GCVA 4OIPF 1XCVA 4A3KJ 2ZXWH 1P7IA 3G2BA 1RRJA 2VXDA 4RLQA 2F5VA 3W2WA 3OYCA 1O4XA 4A0ZA 4RB3C 1JUMA 2IRFG 1W5TA 2EWNA 4DZJA 2HTJA 4KIBA 2STTA 5LGTA 2OAZA 1EH7A 1F36A 5C3EJ 1J59A 3EYYA 1R4MB 5EYRA 5FJ8J 4X0GA 2DW4A 3U1KA 1W7PA 2ESHA 3DP7A 1IG7A 3FKJA 4C30A 3K1MA 4V2GA 3JRCA 3R4KA 1ETXA 1VZ0A 1JHFA 1I50J 3I4MJ 3HOZJ 1FNNA 3G3ZA 2ISYA 1EV7A 4GO1A 3WE2A 4RBOA 3E3VA 2KMUA 2ECBA 4RGRA 3T8TA 1S29A 4A93J 2COMA 5D6FA 1BIBA 2PLYA 3RPQA 5FRNA 4JQFA 2H6BA 5CQEA 1PDNC 1VQ8I 1IO2A 4CCMA 1FYKA 1J7KA 2DMQA 3HYIA 2LNBA 2KJCA 4M6VA 3IH2A 3K4CA 1PUFB 3A1YA 3HG9A 2OZUA 5EG0B 2QA4I 2HFHA 2G7HA 2JTVA 3GFLA 4JX4A 1U8RA 3TP0A 4NUBA 1JGGA 3GUDA 1YW7A 4G12A 4AD9A 5J1YA 4FHTA 2O8XA 2ZSHB 1YLFA 2EZIA 2VPRA 4AIJA 2DO7A 4ENMA 2O9LA 2EFNA 4A12A 1J5YA 1HF0A 3BWGA 3CCUI 1B9MA 5GAEJ 2R7DA 2E19A 2VC0A 2B63J 3PFYA 3RI4A 3DEEA 4DOZA 2OU2A 3KCCA 2BZTA 5K5RA 2R7VA 1MMNA 2VQCA 3O2PE 3W2VA 4FT8A 2PQ8A 1P2FA 2XAFA 1IXSB 3DBHB 2F48A 3H5NA 4EGYA 5DUIA 2DMUA 2P6SA 1FIAA 3F22A 1WCMJ 4OU0A 1KA8A 3TDZC 3AG3H 4XL9A 3MKZA 4KN7X 4Y4RA 1JTXA 2MSYA 3HKZA 4XOPA 2RC4A 2P4WA 3CJNA 1HKTA 2QQ8A 4BKXA 1YYVA 1X58A 1FPQA 4EVIA 2W1OA 2P5KA 3S17J 2CQQA 4MFEA 3LAJA 3RZOJ 3I54A 5FKNA 2HGCA 2ZKZA 1SFKA 1P9QC 2IS1A 2GXAA 1SVOA 5DCMA 4YELA 1TT5B 5KCMA 4DZPA 3CO6C 3R6SA 2XAHA 1QO0D 2L9RA 2NOGA 1PYVA 4IO9F 1VQ9I 4Y33A 4B47A 3KEQA 3KP4A 5M3FJ 3FZVA 2E1OA 4XK4A 2GOXB 2F5FA 2XDVA 2DOFA 1I6XA 3IH4A 3CJTB 1R1UA 2XGXA 4A6DA 4GYGA 2KDZA 3F0CA 3BR6A 4PJMA 3DBLB 3QQAA 3TO7A 2FMLA 4EM1A 3M8EA 5FD5A 2DFFA 3K9TA 3KP7A 1OJLA 3HKZN 1DPRA 3IV5A 4BACA 1XMXA 3J7AO 5TGTA 4XKWA 2EINH 4EM0B 2L01A 3IWZA 2PMUA 4PJJA 3DTKA 3PIOF 4EJWA 2FMYA 2H8RA 1JJ6C 2Z16A 5GP9A 1J75A 2RQQA 2TRTA 3E7LA 4L0ZB 1W4MA 4NDLA 3EYIA 1G3TA 3MWMA 3LSJA 3G4SI 1ORKA 4NC7A 1F1ZA 2QBYB 3VYSB 4ESBA 4O5VA 1EH6A 3OR1C 3RKYA 2R5ZA 1WWXA 2QF7A 3B6AA 4CCNA 2K4BA 1U9NA 1RI7A 2UXNA 1YFHA 3LOCA 2BBYA 2NRAC 3K4LA 1K7AA 4D9JA 2BOLA 3DQVC 4G6QA 4S05A 1FC3A 3QU6A 3IKVA 1JUPA 1Q1VA 4XLFA 2CQKA 1TQMA 4BXUA 5D5VB 1UFMA 4A3DJ 3RSNA 4PJ0C 3ERED 2A61A 3ZXSA 2M8GX 4DBRA 1S8NA 3BG3A 4ZYEA 2LYCA 4NQWA 4RB1A 3ULQB 3TW6A 3I58A 4XKVA 3IKTA 3B6CA 1TL8A 5DUKA 2XRLA 1MW7A 1AHDP 3O8GA 1XG1A 1ZGWA 4CO8A 3TO6A 2BVLA 3DWLE 5AIQA 2R7WA 3WODF 3AL0B 3G1OA 1G6NA 2L02A 2LDUA 3HRSA 4ZDOA 2F5EA 1EH8A 4PDKA 5GAGJ 2DA2A 2KDOA 3CDLA 3CCRI 2NVQJ 1ZARA 4RGSA 5F0FA 3L2RA 2B0LA 4GGGA 2VBZA 3WTWC 1BL0A 1MZBA 2H27A 4LGWA 5FKLA 2XPWA 2BW3A 1P4AA 4UUVA 3M7GA 4HA8A 3MZYA 5CJ9A 5F1RA 4K2EA 4EJOA 1S9HA 1OYWA 3C1DA 2E5ZA 2GZWA 4PFPA 1VQ5I 4HRIA 2VT3A 4KICA 4WF2A 2Z33A 4QTRA 3KZYA 2COBA 3BPXA 2H09A 1SVMA 4HDUA 1V54H 3F8FA 1SFEA 1PP7U 2LF8A 3FK6A 4EV0A 1H0MA 2M30A 5CVJA 1W1WE 3JTGA 4LLNA 2M7AA 3CDHA 1VQNI 4RAZA 1UELB 3BG5A 2FJ1A 2YSRA 3BJOA 3C3WA 2DK8A 1BC7C 2N8GA 3QOEA 5FKKA 4AWXB 4BEHA 4KMFA 3JR9A 3C2GA 3EUAA 1V5FA 1X1DA 5HLTA 1V3FA 4IPAA 4XICA 1S7AA 3V4GA 1OYIA 3CCJI 3KYLA 5K7ZA 4HSRA 3ESWB 2WTEA 3S1MJ 3QYBA 1OR7C 4BDYA 2R7QA 1QGPA 4Y52J 2HQ5A 5DCMB 5TISC 4FX4A 2VBYA 2FUG2 5E3LA 5LEKA 3VWBA 3PJRA 2EIJH 5FROA 3HOVJ 4PJLA 4LJZF 4JK1X 4RAFA 4L9JA 4CGZA 4D7MA 4AYBA 2FRHA 1QPMA 3GZ5A 2DAOA 4HBLA 1SANA 4MHGA 3CUQC 4XRFA 4HZFA 4NC8A 4BDZA 2Y31A 1WVRA 1LNWA 4GYIA 4QLCU 3W2AA 3DXJF 3I59B 4M3EA 2H1LA 2OQGA 1IN4A 2WV0A 4B3XA 4CH7A 4S0HB 1YJNI 3C7JA 5GTHC 4M72A 3L09A 4L9VA 1MIJA 3ZQLA 1I3QJ 2B9SA 3G1MA 4IEJA 3RKXA 2DA4A 2XAQA 3KYDB 3ZCOA 3HM5A 1SMTA 3OYJA 1A5JA 3CC7I 5EDNA 3JRHA 4IZZA 2DA5A 1MJ9A 3DV8A 3GW2A 2FOKA 4PGGA 5A2QK 4M6YA 2XSJC 5H20A 1HSTA 2XPUA 4GFBA 3PO2J 2ZFUA 2XRNA 3FM5A 3BROA 1S6LA 1WJCA 3G1LA 3LSIA 4XN0A 1XSVA 5E3NA 1OISA 1Y8RB 4EJTA 3X2QH 4BXFA 4HLXA 2EZLA 3CLOA 1Z7LA 2IA0A 2R5ZB 1UG0A 4HEA2 3O8HA 4AYBN 2JUCA 4XOTA 1XX5A 2MW8A 2XAJA 5KVRA 3VYTB 2QQ9A 2W85A 3ZMTA 2E36A 4U7DA 1HW2A 5ICGA 2CV1A 1KONA 5E1WA 4MLOA 2CFXA 3H9JA 4LOCA 3IC7A 1B8IA 1U6GA 3I56I 5F0CA 5BNGA 2HQNA 5EEGA 4B09A 2YS9A 1T8IA 1XB4A 1DP3A 5E8IA 3P9KA 1OFCX 3TO9A 4M71A 3LWFA 2L7MP 3J80K 4EQQA 1USTA 4FQGA 5IYBJ 2XB0X 3DKYA 2NVUB 2Z9OA 1ZG1A 1GUUA 5LRRA 1FMVA 1E0EA 2A69F 3D5LA 2VT2A 4LLGF 1JXSA 2K3PA 1O3TA 2OCCH 1HLVA 5F0HA 2DDBA 2CFOA 2JA7J 5CYVA 4HX4A 2DJIA 3M07A 5DD8A 1B72A 1QNTA 4D7NA 4A5MA 4M9ZA 4D5CA 2JRTA 2IEKA 4HNVA 1FWZA 4FCYA 5J40A 2E1MC 4HX8A 3E0JB 2PEXA 2A6TA 5EZGA 2OTJI 2QM3A 2GA2A 4RGXA 3MQ0A 1D0YA 4AVPA 4HNUA 2UWMA 3ERMA 3QPSA 1KQ0A 1MBGA 1QZEA 3GMEA 1TW2A 2BXYA 3CCYA 3GWZA 4U0YA 1VQLI 4O3MA 3KLOA 3FBNB 1L3LA 3BG9A 1ZYRF 3I4PA 3RTRA 1YS7A 3OMYA 2DXIA 1UB9A 5HLIA 4DGWB 2D2WA 1MNEA 1I27A 3OYHA 4D0PA 1Z6TA 5ICCA 2DYRH 1T38A 1BOAA 2PJRB 5E79C 1JI8A 3VB2A 3HHGA 1R7JA 2ZNYA 2DFHA 2K9SA 1YX5A 3GEZA 2VJ4A 1EKEA 2R7XA 3NQOA 4ITVA 2K9LA 1KYZA 2EV0A 4L9TA 3K2ZA 2XVCA 1EJ9A 1LDDA 2E7XA 4UB6C 3F8NA 1LEAA 1LDKB 2VBWA 5CVUA 4YFNF 3U1DA 2KJBA 4YIFA 2E2HJ 4YIIA 1JKOC 2V6CA 3ABLH 1OCOH 1MSEC 2OTLI 5J6XA 2HTSA 5B3SH 2FNPA 3I64A 3LSHA 1P4XA 2P0WA 2DFIA 4LMYA 1G3WA 3NAUA 1K4TA 2RGVA 2HWVA 5DM6F 5IOYA 5M5XJ 3GTJJ 2MGQA 3BG7A 2GIVA 1UZCA 1FT9A 3WU0A 1TZLA 3F6OA 1F5TA 3MKLA 5HVQC 3MVPA 1OCCH 3I53A 1VQKI 1FJLA 2DPDA 1YJ9I 2DQLA 2JQ7A 4HW0A 1AOYA 4R8HA 2EA4A 2FBHA 1SD6A 2ZMEA 1AU7A 2HDCA 2VKHA 3CO7C 1QVTA 3OYBA 3H5RA 3AL0C 5EGOA 3S1QJ 6PAXA 4HLYA 3M8FA 1DPUA 2X1EA 3BOQA 2LLKA 2X1CA 3K10A 3MN2A 2IGOA 4I02A 5EZHA 2QGUA 3Q3SA 4RM3A 3K4KA 4E70A 2AS5F 4UNOA 3SQNA 4HQMA 3E5XA 4WXHA 1B4AA 3KZIC 4J00A 1RR7A 3S14J 2LKXA 1QHHD 2XSDC 1R5ID 1WJDA 3VEPA 3DLLF 3BTLA 2HKOA 5C4XJ 3CDIA 1S72I 1H9TA 3LFUA 3JSPA 1I1GA 4UVBA 1YIJI 2DPUA 4AIDA 5FLMJ 3H3UA 2HDDA 1MMSA 1QPIA 4N9HA 5F04A 3ZP5A 2G7UA 1D1BA 4HPQA 4A3FJ 1HCRA 2LBFA 4A3BJ 4FTHA 2VJIA 4DBQA 1AKHA 2E1CA 1FTTA 3SEZA 1BI3A 2K40A 1Z21A 5H6RA 2OD5A 3KEYA 2KP6A 2P81A 2DDAA 4MO7A 1QVUA 3MAJA 4X6AJ 1E3PA 1ZTRA 3K1PA 1I5ZA 4PK4A 5JI6A 3VDXA 2Q2EA 1K78A 2Q1ZB 3CUOA 3FMQA 1MBHA 2VOOA 1I3AA 1XTAA 4HAMA 2ME6A 1MBEA 1B8IB 3E6BA 1WJAA 4A3MJ 4E7KA 4WX9A 1V5EA 2DA3A 2AO9A 3GTKJ 3M9AA 2L5QA 4A2UA 2A6HF 1JT6A 1ETQA 2IGMA 2VKVA 1ZQ3P 4I98B 4ZYAA 3ABTA 2HVRA 1MD0A 1VI0A 2CUJA 5FD6A 3C2BA 4BGDA 4EJUA 5E3MA 2A05A 4KNYA 2HS5A 2IPQX 3OR2C 4G6DA 2BVMA 5HDGA 1G8XA 1ZG5A 1RUNA 1IN6A 1J0RA 2FX0A 2R93J 1KQ9A 1B72B 1IW7F 3W3CA 3HSRA 4IQ4A 2D5VA 3EETA 2NNYA 3L2QA 2EH3A 1IN7A 2GBYA 4A3IJ 2QSFX 5CLSA 2LH9A 3I0TA 3H9GA 5B1BH 1ITYA 3B73A 3S15J 1D5YA 4D5FA 1RETA 5BMZA 3HC7A 4IRGA 1H9GA 3S93A 4IHYA 4HX7A 1YJWI 1IF1A 1A6QA 2O0YA 1BIAA 1T0FC 1ZN2A 4M73A 3WE3A 2CJJA 5HDNA 2MFZA 3HSFA 1U5TA 3R0AA 3ZMZA 3M4OJ 3W6JB 4ENNA 2BE5F 1KU9A 1H8AC 1O57A 2NYXA 2X6XA 4H4KC 4V19K 2L4AA 2MBFA 2Y75A 2DOAA 4OWRB 3PNYA 4XLNF 1ZAOA 1XDSA 2O6GE 2LG4A 3K4NA 3AKZA 4BS9A 3O3KA 4AC0A 1KGSA 4ZYHA 3C18A 4IXAA 1Y8QB 3Q9SA 3A0HC 1K79A 4AVZA 1FOXA 3OL4A 1POGA 4DYRA 2WAFA 1LE8B 4MTEA 3RJPA 3S2HJ 2L9NA 3H0GJ 1KU7A 1SVLA 4M3FA 3OOPA 5D4SA 4BL0B 4HQEA 2A07F 2M1BA 1VQ6I 2VXZA 4B4CA 2X9DA 3ZQGA 1R00A 1NTCA 4NHJA 1YW8A 2AXLA 3V8JA 1BR2A 1S7OA 1ZK8A 4CZCA 4PJNA 2KPMA 2XF5A 3F6VA 3ROUA 1OYYA 1G4DA 3IHUA 1O3SA 2O61A 1A36A 2X51A 1WI9A 4XRSA 1MMGA 2G9WA 3TEDA 1EA3A 3PSFA 4RA2A 3NWSA 3WTUC 3WTTC 1BOBA 2LFBA 3FXRA 4A3GJ 1MKMA 4Z2YA 3GTGJ 2W84A 1HQCA 1HOMA 2IBDA 1R22A 1IRGA 1JKPC 2EIMH 4I01A 4IHTA 2ZMEB 3P5JA 4MQ9F 5DDGA 2BHZA 3WHCA 4C2UA 4LB5A 4OMYA 1FYLA 4YRVA 5EGOB 1SD4A 2JA6J 2P5LC 2VE8A 2ID3A 2NS0A 4CCLA 4BQAA 2E34A 2EBIA 1VFCA 4Y17A 2OQRA 3OYDA 2DFEA 1ZR2A 5LRSA 1O7LA 2FXAA 2ZJRF 2CMPA 1VTNC 4IHWA 5L3FA 1GXQA 4XRSG 1N78A 2R7TA 1F4KA 3V7CA 4A0YA 2IW5A 2PMZN 4N0BA 4R79A 2D45A 1JUSA 1RESA 1QA6A 1FY7A 2VL8A 2A68F 4PGHA 4CSWA 3Q0WA 2WAQA 4NB5A 1WJBA 2LREA 3FXUA 3K1NA 4BE1A 1FLIA 2KIQA 5K5OA 2R5YA 2GWRA 5HLGA 3SZPA 4EATA 2KQRA 2MG4A 2JA2A 2CH0A 2KFDA 3SZTA 5ILVA 2LR8A 4F7ZA 3H3ZA 3T0YA 5J1RA 3AFHA 2CYYA 3BQZA 2JWTA 4IJAA 2Q2EB 4XLHA 5L3EA 1K78B 3FXQA 1P4WA 3E6CC 1ON1A 2DLLA 4S04A 1PP8F 4IQJA 2XASA 2X4HA 3J7YJ 1TQIA 1X1PA 3EQLF 1Y0UA 4BYYA 5TJJA 3DPLC 1UHWA 1ZELA 3FXJA 3IAM2 3QPTA 3EPZA 3KP2A 1NH3A 3JRGA 4ABZA 3OIQA 5HNHA 2HPIA 3ABKH 4XKCA 1Y56A 1H88C 4CUGA 1CGPA 3GTMJ 2Y0SA 3L00A 2WAQN 2HVSA 1GHCA 2G0EA 4N9IA 3WTVC 4H0EA 2RAEA 1D0XA 1XSXA 5KAIC 1IV8A 1GLNA 1Y1VJ 2ZCWA 5CKTA 1VQMI 3DEWA 3RKWA 1TW3A 3CZ6A 3Q0VA 3CC4I 2P6TA 4C2TA 4X1EA 2BHYA 2V26A 1LB2A 2E7WA 3HUGA 4ZYGA 1S5LC 1REPC 2QYOA 3OY9A 1BR1A 4I6ZA 1TNSA 3EDPA 2XKPA 4QIWN 1NK3P 2WAEA 3SEQA 5GAHJ 3ZRGA 4I0BA 3WU1B 2L9SA 4IRIA 1U5TB 2LOOA 3P9CA 5JFRA 3IUOA 4LLLA 4GDFA 3HDDA 3BTCA 5BS6A 1FMWA 4UXNA 1Z67A 4HYEA 2Y0SN 1WQ2A 2WADA 4LD5A 1IUFA 1KU3A 4EJVA 2BV6A 4YFKF 3OYMA 3ZR8X 4F91B 3S1RJ 2CQNA 2X6OA 1ZRFA 2NVXJ 3J7ZI 1ZKGA 3VODA 5IT9K 3RCOA 4N4OB 2Y2ZA 1W7PB 2HOEA 2M87A 2KLOA 2NXNB 3IRQA 4CYDA 2RV8A 2DMNA 3VYRB 2Q0OA 3S3NA 5D5WB 1BM9A 2ID6A 3D5SC 4D1QA 1LFUP 1J9IA 5BPDA 4RAYA 4MEXF 3BT9A 1XSDA 2DQRA 1BN5A 2LY1A 3FXOA 5DYMA 1VF9A 3DU5A 1W0TA 4G6TB 5AONA 4IL6C 4HG2A 4HOBA 2VE9A 4XQFA 4DQ2A 1DP7P 3ASOH 5EEHA 4E6KG 3E5QA 5B66C 3I4NJ 5C44J 2FBIA 3QYEA 4WWCA 1R49A 1L0OC 3DPTA 2VONA 5KNLA 4CYCA 1ON2A 2W24A 5D8KB 3LQQA 2F6CA 1D8KA 4E7JA 3V42A 3DKWA 3J81K 2VQHA 4ZZDA 4LG0A 4BQQA 2WBMA 3GFIA 3F3XA 1Z9CA 2K3FA 4I09A 4WXCA 4A3JJ 3U9GA 1ONVA 1FZPB 4XLCA 2VLAA 1FBQA 1X1CA 1XMKA 5JLWA 1ACIA 1FSEA 3BDDA 4AUXA 2K86A 1G2HA 2HZTA 1Z1DA 4IHXA 3LNQA 2ESNA 2GAUA 3EUHC 4W97A 5JVTA 2ZXIA 1WJEA 1RKTA 1UMQA 4DW6A 1TQPA 2CQXA 1X4OA 2KRFA 3RPUA 1VQ7I 4L9NA 2CU7A 1GXPA 2FNAA 5FKMA 1SD7A 2V1XA 2JRMA 5L3BA 4CXFA 1IJWC 2XC7A 2XROA 4J19A 2NS7A 4BY7J 3TDUC 4A6EA 5E18F 1XC5A 3H35A 2A6EF 3J7AY 1T33A 4CHUA 3A4CA 3DF8A 4FE7A 3SYTA 4M9XA 5FLVA 3VYUB 2DTZA 1YOVB 5F1JA 2Q8KA 5HS9A 2KIUA 1X2NA 2KL4A 2V6EA 5H6QA 4LK0F 3RDIA 2HPMA 2LMDA 4QSHA 3SHFA 1IDYA 1YW9A 4A3CJ 3BR1A 5DM7F 2CUZA 3LA7A 2TDXA 3I3LA 3WG7H 2CRGA 3OV8A 5LLQA 4UV9A 3ZQIA 3BJ6A 2R7SA 1YG2A 2MD0A 3TL4X 1WRJA 3IWFA 1KZHA 2TCTA 4KUMA 2MH9A 1W5SA 4B43A 2RKHA 3IAS2 2XGEA 3HTUA 1R6RA 3KE2A 4CCKA 4CA0A 3DPUA 4EMSA 1E17A 1W7PD 1G59A 4I2OA 2EB7A 4WXDA 3MZ8A 3HUGB 4YEJA 4BHCA 2IS4A 3BLYA 2HOSA 3R60A 4OIOF 5HLHA 3ZGKA 3DEUA 3PNVA 1TC3C 3CCSI 3MKYB 2K9NA 3DTEA 1NG7A 4HV5A 3TOBA 3KFWX 5K7FA 1W36D 5JR3A 4PFOA 4UUTA 3ISPA 4Q47A 3ZOBA 3OYKA 3T8RA 1LVKA 2F5DA 2IS6A 1YITI 1Z6RA 4N4NB 3BZKA 1ETVA 5BOXA 2F4IA 2R92J 3FMSA 5J1UA 4MTDA 1IC8A 1OQYA 1BJAA 3MCZA 4XRMA 3NARA 4CDGA 2ACJA 5FB2A 2P8TA 1LQ1A 2L4MA 1ETYA 1U9OA 3OIPA 2YPRA 3HOUJ 5ERIA 3ELKA 1FX7A 2VODA 3GLXA 3CMMA 4U0VA 3CF5F 1DUXC 4NQWB 4XN3A 3E1SA 3GCMA 4J01A 3TGNA 3K6GA 5DCFA 1ZLKA 1ZGAA 3KP5A 3SFZA 5LHGA 2XV4S 2EZHA 2LK2A 1ZG3A 3N05A 3GTPJ 1CF7A 3H1CA 5A2QZ 3BZ6A 5HODA 2FQ4A 4Y7NJ 3VSKA 1RKWA 3FK7A 2A3SA 3DKXA 2VUMJ 2Y48A 3LSRA 3K4BA 2WY7Q 4BY1J 2L54A 1K4SA 2BXZA 4XSZF 1ODDA 1HA8A 3RKQA 1YI2I 1OCPA 1T08B 3L1PA 3BTJA 1XGMA 4L5IA 2HQAA 4P9UA 4CYCB 1BBYA 2E1NA 2ZC2A 2ZJ2A 4BH9A 1E2XA 1U2WA 2JZYA 3L2CA 2GM4A 2CQ7A 2VB6A 3IH3A 1XCBA 4TV7A 3K70D 1SFOJ 9ANTA 3GF2A 2BW3B 3ML6A 1SAUA 4ENJA 4U87A 2DA1A 2IT0A 3E6MA 1K6YA 1R71A 3J80Z 3SDBA 4RMNA 1I1SA 1OCZH 4P5OA 1WSUA 1MJBA 3SDGA 1WI3A 4UHTA 5HDKA 4UUSA 4BAYA 1FP2A 2V4JC 3GBGA 3QPLA 2DI3A 2HXOA 4C9YA 3H3VK 4KISA 4BJ5C 4CICA 3EUHA 3S2WA 4U7BA 4ZTFA 2NVYJ 1X4PA 1TNTA 2OJED 2RVCA 3F23A 1FTZA 4IRHA 4KN4X 2L3DA 3DBRB 1BR4A 1RZ4A 4LIUA 3HBLA 3LSGA 1IXRC 3CD6I 4BEHB 1ETWA 5AIPA 3GLLA 5IOZA 5E3OA 3JAMK 5E1XA 3HTSB 1WJ5A 1FOWA 1IN5A 1GV2A 1R58A 3NEUA 2FF4A 3KP3A 3LL7A 2IGKA 2LRDA 1BI0A 5C4JJ 2DYSH 3FXMA 5J8CA 4OIRF 1IZ1A 1TBXA 2HU9A 1HKQA 4XIDA 3FX3A 4JOMA 2Y30A 1OR7A 1IRZA 2B7EA 1RIOH 1Z05A 4ZTJA 1W36C 3RYRA 2PFBA 3QYFA 1XGNA 2CW8A 4XR6A 1JKQC 1NHAA 2VC1A 3KYCB 2Z5UA 1N25A 4C2MJ 2OV7A 2IA1A 2W00A 5EJCA 3PL8A 3SJMA 2W48A 2Z99A 3FISA 2Y9ZA 2IGNA 4LIVA 3VSLA 4B1RA 3TMOA 3O6BB 3BTIA 2LD5A 3MD2A 4LG3A 1YO5C 2MC4A 3CUQA 1QRYA 1TTYA 4IX7A 3JRIA 3BR5A 5DTDA 2CV2A 5GTIC 2HKXA 3BG6A 1IGNA 1G3SA 1WHUA 3ZQFA 4HNTA 5B1AH 2VQLA 3PUFA 4JBAA 5E1ZB 1KYWA 4B3AA 1SMYF 2P5VA 3UNGC 1JGSA 3JAMZ 3FHZA 5JHFA 3QRFF 1BW5A 1MSFC 4MQVA 4A69C 2HDWA 3DU6A 3L9FA 5CQGA 3RYPA 4DNCA 1HBXG 3BR3A 1RR8C 2ZJPF 3FKIJ 1R4NB 2M4GA 1R1TA 2HNHA 2EV6A 2EZKA 2GOMA 2M8EA 2K5CA 2XGDA 1FEXA 3HOTA 2UZKA 5DS9A 3A01A 1R5GA 1WH5A 5ICEA 3H36A 2K9QA 3IP4B 2RN7A 2VQGA 2NNNA 1EF4A 1GV5A 3V7SA 3JTHA 3CC2I 3E97A 3MEXA 3K70C 1JT0A 4JX6A 4BE2A 2W82A 1K61A 2V9PA 4OOIA 1DQUA 1M1EB 2IVMA 5LEJA 4RGUA 1Y39A 2YU9J 2HI3A 3BC8A 2XPVA 5ILUA 5KAFC 2V1NA 1T2KA 1K6OA 2HOTA 3E5UA 5IYCJ 2DT6A 2E35A 1BW6A 2LF7A 2QCOA 3PQKA 2CG4A 4BQNA 1MMDA 2LC2A 3IRRA 1CF7B 4OINF 1GDTA 4P96A 1A31A 3FIWA 2Z1DA 2XAUA 4F3QA 3GXOA 2XF7A 4M74A 5LGNA 3G73A 3LFKA 1TWFJ 2F4MB 2PX9A 5IP6A 4E7ZA 2R7RA 3QPHA 3A2KA 4I76A 2DODA 2VOPA 3BP8A 5LBQA 1X3WB 4UVAA 4RDUA 4HF0A 1O3RA 3HJEA 1YS6A 2CSOA 4G7HF 3U2RA 1FYMA 2GA1A 2E5NA 3W6KB 1LUJB 2M3AA 2H8WA 2OF7A 2A5YB 1R36A 2X1DA 1WZ2A 5IPAA 4RB2C 3OYNA 3D1NI 1ZRDA 2HYFA 5FFZA 4IOCF 4KA4A 2DA6A 3COAC 3HOYJ 4UUSB 2E2JJ 5FRMA 4V2FA 5M5WJ 2WY8Q 3PNTA 2FE3A 1R9TJ 4BBRJ 2QBYA 1FBSA 3LSKA 1W0UA 3GTQJ 3CLQA 3HOWJ 2HQRA 3HL2A 1SFXA 1Z91A 4OAYA 4I0AA 2LY9A 3B02A 3ECHA 1APLC 1OCTC 4OIQF 3M1CA 2CW7A 2CO5A 2OCEA 2ISZA 2CWEA 4XM3A 2J5OA 4C3IJ 4F93B 3OIOA 4GRIA 3VFZA 5BQTA 2FD5A 1Z7UA 1ZHFA 2IS2A 5HS8A 4XBFA 3A0BC 1X3UA 4IHVA 3A03A 2VKDA 4MIMA 2K85A 2QWWA 3LQRA 2BY1A 2V9VA 2PMZA 4XLAA 1OCRH 3S16J 1LPQA 1C0WA 2LTPA 1MDMA 4DYCA 4DIQA 5M5YJ 5HOOA 1QU3A 2P7VB 3HGYA 1P7JA 1XS9A 2C6YA 3OSGA 1STZA 2M5WA 4E7IA 1F9NA 1I39A 3WTXC 1A35A 1IDZA 2STWA 4BUPA 1TWGJ 2M45A 3CJQB 3MMYB 3WHBA 1NK2P 5J47A 2DT5A 1PJRA 4L18B 3KZZA 3HGGA 2L7FP 4B8XA 1R5HA 3CCEI 2V1UA 2F2EA 3CUQB 2XHKA 1LFPA 3MZHA 1USSA 2OUMA 2RREA 3ZMVA 4RAGA 2D1VA 3K2AA 3PIPF 2ZXHA 4M9SA 2BEOA 2ZSIB 2EK5A 3CCQI 4M6XA 2QKLB 4Z6YA 1A6IA 4LB6B 1IN8A 2OC6A 1R1VA 3FXLA 4BXXJ 5HNFA 2EV5A 3NWTA 2FU4A 3CJRB 3KETA 2EILH 3S2DJ 4XSXF 2MD5A 4ZJZA 4F52A 2BYVE 3LMMA 1MJAA 2BGCA 5ICFA 2LBFB 2PG4A 3GVAA 3NRVA 5FKOA 2JJ7A 2HVQA 3PFIA 2UV1A 1AKHB 3KPHA
chains in the Genus database with same CATH topology
5JLWA 4AUXA 4FCYA 1G2HA 4BBSJ 3A01B 4IHXA 1ETKA 1TWCJ 3LNQA 5EZGA 2XB5A 4W97A 4M3GA 2HYJA 1RKTA 1UMQA 4DW6A 5M3MJ 2CQXA 1MNMC 3QPSA 4A3EJ 2CU7A 3SFIA 5FKMA 1MBGA 5GPAA 3CCYA 2WV1A 3BG9A 1IJWC 4J19A 2NS7A 4BY7J 5IP7J 1ZR4A 2R7ZJ 1XC5A 1WGXA 5IP9J 4FE4A 5EF6A 1T33A 3RZDJ 2R0QC 1CQTA 1ENHA 4FE7A 2JK3A 2LVSA 3TP3A 5FLVA 2K9SA 1E3OC 2DTZA 3GTOJ 3OOUA 5F1JA 1MBKA 1BA5A 1S7EA 1X2NA 3JRDA 3Q0UA 3CMYA 3BR2A 4QSHA 1IDYA 3HOXJ 4A3CJ 3PM1A 3BR1A 2E2HJ 2M9HA 2CRGA 1JKOC 3PO3J 1MSEC 3A02A 4C3JJ 3ZQIA 4A3KJ 1P7IA 4M3BA 1YRNA 3GTLJ 1O4XA 2TCTA 3LSPA 1JUMA 2LP0A 3NAUA 4DZJA 5IOYA 5M5XJ 3GTJJ 2VKEA 2MGQA 1F36A 1TWAJ 2XGEA 5C3EJ 5EYRA 3MKLA 5FJ8J 3MVPA 3HB9A 1IG7A 2WB1N 1FJLA 4V2GA 4W1UA 3JRCA 1IV6A 1ETXA 1I50J 3I4MJ 2I10A 3HOZJ 2HOSA 1AU7A 4RBOA 1TC3C 1QVTA 2ECBA 2K9NA 4A93J 5EGOA 3S1QJ 5K7FA 2M34A 2LLKA 4UUTA 3MN2A 3ZOBA 4JYKA 5EZHA 3Q3SA 2DMQA 3BQYA 3S14J 4M6VA 1RR7A 3IH2A 1PUFB 1WH7A 2LKXA 1ETVA 2R92J 5J1UA 1IC8A 5EG0B 2XSDC 2DMTA 2JN6A 4JX4A 4XRMA 3TP0A 3NARA 1JGGA 3BTLA 5C4XJ 4G12A 5J1YA 2NVTJ 1ETYA 1U9OA 2M0CA 3HOUJ 5FLMJ 2HDDA 1QPIA 2EZIA 2VPRA 1MBFA 5F04A 4A3FJ 1HCRA 4EEFG 4A3BJ 4FTHA 2O9LA 5F08A 1AKHA 1FTTA 1HF0A 2K40A 2EZHA 2P81A 2LK2A 4MO7A 3GTPJ 1QVUA 4X6AJ 1K83J 2E19A 1ZTRA 2B63J 5HODA 2FQ4A 1MBHA 4Y7NJ 1MBJA 2ME6A 1MBEA 1MH3A 1RKWA 3FK7A 1B8IB 2VUMJ 3LSRA 4A3MJ 2L7ZA 3CQZJ 4BY1J 2DA3A 2AO9A 3M3YJ 2DMUA 3GTKJ 1FIAA 3RKQA 1OCPA 1JT6A 1WCMJ 3BTJA 1ETQA 2VKVA 3L1PA 2GLOA 1ZQ3P 1Z0XA 4CYCB 1VI0A 3C2BA 5E3MA 2JA5J 2GM4A 1JTXA 2MSYA 9ANTA 3IH3A 4BKXA 1SFOJ 1X58A 2FX0A 2R93J 2R5YB 1GT0C 1B72B 3S17J 2CQQA 2DA1A 4MFEA 2D5VA 3RZOJ 2E2IJ 4A3LJ 5FKNA 1Y1WJ 2EH3A 4MFDA 2GBYA 4A3IJ 2KT0A 4DZPA 1MH4A 1WI3A 3SDGA 4UUSA 1ITYA 1X2MA 3S15J 2CUEA 2L9RA 1FIPA 2NOGA 3GBGA 1RETA 3QPLA 3RQIA 4D5FA 2HXOA 1D5YA 3H3VK 3ZQCA 4IHYA 2NVYJ 5M3FJ 2HOAA 2E1OA 4XK4A 3JREA 3IH4A 2DN0A 1FTZA 2CJJA 2KDZA 3F0CA 3BR6A 3QQAA 3HBLA 3LSGA 1TWHJ 1ETWA 2NS8A 2ZB9A 3M4OJ 5IOZA 5E3OA 1H8AC 1OJLA 3HKZN 3IV5A 1H89C 1GV2A 1I6HJ 5C4JJ 4AC0A 4XIDA 2H8RA 2Y30A 3TW7A 1JJ6C 1IRZA 5GP9A 1POGA 4DYRA 1LE8B 2TRTA 3E7LA 3K7AJ 3S2HJ 4NDLA 3H0GJ 3LSJA 1JKQC 1ORKA 4M3FA 4C2MJ 1U78A 2R5ZA 3SJMA 4B4CA 2X9DA 1T56A 2QF7A 2W48A 3B6AA 3FISA 3ZQGA 2Y9ZA 1U9NA 4B1RA 3LOCA 1YRNB 1NTCA 3BTIA 2LD5A 1ZK8A 1BJZA 1QRYA 3JRIA 3BR5A 5DTDA 1JUPA 2HXIA 1Q1VA 1U8BA 1F43A 1IGNA 3ZQFA 4A3DJ 2DJNA 4XRSA 3TEDA 4B3AA 4FISA 2M8GX 2LFBA 4DYQA 4A3GJ 2O8KA 3BG3A 3GTGJ 1BW5A 1MSFC 4A69C 1HOMA 2IBDA 2DA7A 3BR3A 1JKPC 3FKIJ 3WHCA 3TW6A 3S1NJ 2ECCA 4M3DA 1Z77A 3B6CA 2EZKA 5EGOB 2XGDA 2XRLA 2JMWA 2JA6J 2ID3A 1FEXA 2CUFA 1VFCA 2EBIA 1AHDP 3O8GA 1XG1A 3VPRA 1ZGWA 5DS9A 1ZR2A 3A01A 2DMPA 1WH5A 4IHWA 4L5EA 2K9QA 4XRSG 3G1OA 1EF4A 1GV5A 2DA2A 1HDDC 1HDPA 3CDLA 2NVQJ 2PMZN 5F0FA 1JUSA 1RESA 1BL0A 1JT0A 4JX6A 3Q0WA 2EQRA 1K61A 4C3HJ 5FKLA 2XPWA 3UKGA 2R5YA 2XGCA 4JX5A 2YU9J 2HI3A 2XPVA 3HEFA 2ELKA 2HOTA 2MG4A 5IYCJ 1WPKA 1BW6A 2M2EA 2QCOA 4QTRA 2COBA 2LR8A 1GDTA 5JLXA 5J1RA 3BQZA 3FIWA 2JWTA 3ZQHA 5IYDJ 3FK6A 1LFBA 3JRBA 1TWFJ 5J3LA 5IP6A 3BG5A 2FJ1A 4I76A 2N8GA 5FKKA 4RDUA 3JRGA 4ABZA 2YUSA 3JR9A 1H88C 2AHQA 3GTMJ 2WAQN 5F27A 2G0EA 4XICA 2RAEA 1UHSA 1ETOA 1Y1VJ 5K7ZA 3DEWA 2O7OA 2OF7A 3S1MJ 3Q0VA 5IPAA 3D1NI 5K7HA 4Y52J 1JKRC 2HQ5A 4X1EA 2L0KA 2JA8J 2DA6A 5E3LA 1DU0A 2IAIA 3HOYJ 1LE8A 4UUSB 2E2JJ 4V2FA 5M5WJ 3HOVJ 1R9TJ 4BBRJ 4I6ZA 1W0UA 3GTQJ 4D7MA 3HOWJ 4JP0A 2OPTA 4QIWN 1NK3P 2LY9A 1OCTC 1APLC 1SANA 2Y31A 4C3IJ 3OIOA 1JTYA 4M3EA 3HDDA 2FD5A 3BTCA 2Y0SN 4S0HB 4IHVA 3A03A 3BR0A 3ZQLA 4MIMA 1I3QJ 1PUFA 3G1MA 4IEJA 1IUFA 2DA4A 1RPWA 3HM5A 5EG0A 1A5JA 3S1RJ 5EDNA 5EEAA 2X6OA 3JRHA 2DA5A 2NVXJ 1ZKGA 3DCFA 3S16J 2XPUA 4GFBA 3PO2J 2Y2ZA 2LTPA 4DYCA 5M5YJ 1UG2A 3HGYA 1P7JA 1XS9A 3OSGA 3G1LA 5E3NA 2DMNA 2Y9YA 3JRFA 1IDZA 2ID6A 2EZLA 2R5ZB 1TWGJ 4AYBN 3O8HA 1GVDA 1LFUP 2MW8A 3WHBA 1NK2P 3BT9A 2VI6A 1VF9A 1W0TA 3HGGA 2L7FP 5GPCA 4MLOA 4LOCA 2X48A 1B8IA 5F0CA 5BNGA 2YS9A 3I4NJ 5C44J 3K2AA 3JRAA 3W6VA 1OFCX 2L7MP 1A6IA 5IYBJ 2XB0X 4CYCA 1GUUA 1VNDA 2ME0A 4BXXJ 3S2DJ 1HLVA 5F0HA 1DU6A 2H1KA 2JA7J 1B72A 1JJ8C 3OSFA 4D7NA 4A3JJ 5FKOA 2JJ7A 1AKHB 4D5CA 4HNVA 2IEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLW A;  4AUX A;  4FCY A;  1G2H A;  4BBS J;  3A01 B;  4IHX A;  1ETK A;  1TWC J;  3LNQ A;  5EZG A;  2XB5 A;  4W97 A;  4M3G A;  2HYJ A;  1RKT A;  1UMQ A;  4DW6 A;  5M3M J;  2CQX A;  1MNM C;  3QPS A;  4A3E J;  2CU7 A;  3SFI A;  5FKM A;  1MBG A;  5GPA A;  3CCY A;  2WV1 A;  3BG9 A;  1IJW C;  4J19 A;  2NS7 A;  4BY7 J;  5IP7 J;  1ZR4 A;  2R7Z J;  1XC5 A;  1WGX A;  5IP9 J;  4FE4 A;  5EF6 A;  1T33 A;  3RZD J;  2R0Q C;  1CQT A;  1ENH A;  4FE7 A;  2JK3 A;  2LVS A;  3TP3 A;  5FLV A;  2K9S A;  1E3O C;  2DTZ A;  3GTO J;  3OOU A;  5F1J A;  1MBK A;  1BA5 A;  1S7E A;  1X2N A;  3JRD A;  3Q0U A;  3CMY A;  3BR2 A;  4QSH A;  1IDY A;  3HOX J;  4A3C J;  3PM1 A;  3BR1 A;  2E2H J;  2M9H A;  2CRG A;  1JKO C;  3PO3 J;  1MSE C;  3A02 A;  4C3J J;  3ZQI A;  4A3K J;  1P7I A;  4M3B A;  1YRN A;  3GTL J;  1O4X A;  2TCT A;  3LSP A;  1JUM A;  2LP0 A;  3NAU A;  4DZJ A;  5IOY A;  5M5X J;  3GTJ J;  2VKE A;  2MGQ A;  1F36 A;  1TWA J;  2XGE A;  5C3E J;  5EYR A;  3MKL A;  5FJ8 J;  3MVP A;  3HB9 A;  1IG7 A;  2WB1 N;  1FJL A;  4V2G A;  4W1U A;  3JRC A;  1IV6 A;  1ETX A;  1I50 J;  3I4M J;  2I10 A;  3HOZ J;  2HOS A;  1AU7 A;  4RBO A;  1TC3 C;  1QVT A;  2ECB A;  2K9N A;  4A93 J;  5EGO A;  3S1Q J;  5K7F A;  2M34 A;  2LLK A;  4UUT A;  3MN2 A;  3ZOB A;  4JYK A;  5EZH A;  3Q3S A;  2DMQ A;  3BQY A;  3S14 J;  4M6V A;  1RR7 A;  3IH2 A;  1PUF B;  1WH7 A;  2LKX A;  1ETV A;  2R92 J;  5J1U A;  1IC8 A;  5EG0 B;  2XSD C;  2DMT A;  2JN6 A;  4JX4 A;  4XRM A;  3TP0 A;  3NAR A;  1JGG A;  3BTL A;  5C4X J;  4G12 A;  5J1Y A;  2NVT J;  1ETY A;  1U9O A;  2M0C A;  3HOU J;  5FLM J;  2HDD A;  1QPI A;  2EZI A;  2VPR A;  1MBF A;  5F04 A;  4A3F J;  1HCR A;  4EEF G;  4A3B J;  4FTH A;  2O9L A;  5F08 A;  1AKH A;  1FTT A;  1HF0 A;  2K40 A;  2EZH A;  2P81 A;  2LK2 A;  4MO7 A;  3GTP J;  1QVU A;  4X6A J;  1K83 J;  2E19 A;  1ZTR A;  2B63 J;  5HOD A;  2FQ4 A;  1MBH A;  4Y7N J;  1MBJ A;  2ME6 A;  1MBE A;  1MH3 A;  1RKW A;  3FK7 A;  1B8I B;  2VUM J;  3LSR A;  4A3M J;  2L7Z A;  3CQZ J;  4BY1 J;  2DA3 A;  2AO9 A;  3M3Y J;  2DMU A;  3GTK J;  1FIA A;  3RKQ A;  1OCP A;  1JT6 A;  1WCM J;  3BTJ A;  1ETQ A;  2VKV A;  3L1P A;  2GLO A;  1ZQ3 P;  1Z0X A;  4CYC B;  1VI0 A;  3C2B A;  5E3M A;  2JA5 J;  2GM4 A;  1JTX A;  2MSY A;  9ANT A;  3IH3 A;  4BKX A;  1SFO J;  1X58 A;  2FX0 A;  2R93 J;  2R5Y B;  1GT0 C;  1B72 B;  3S17 J;  2CQQ A;  2DA1 A;  4MFE A;  2D5V A;  3RZO J;  2E2I J;  4A3L J;  5FKN A;  1Y1W J;  2EH3 A;  4MFD A;  2GBY A;  4A3I J;  2KT0 A;  4DZP A;  1MH4 A;  1WI3 A;  3SDG A;  4UUS A;  1ITY A;  1X2M A;  3S15 J;  2CUE A;  2L9R A;  1FIP A;  2NOG A;  3GBG A;  1RET A;  3QPL A;  3RQI A;  4D5F A;  2HXO A;  1D5Y A;  3H3V K;  3ZQC A;  4IHY A;  2NVY J;  5M3F J;  2HOA A;  2E1O A;  4XK4 A;  3JRE A;  3IH4 A;  2DN0 A;  1FTZ A;  2CJJ A;  2KDZ A;  3F0C A;  3BR6 A;  3QQA A;  3HBL A;  3LSG A;  1TWH J;  1ETW A;  2NS8 A;  2ZB9 A;  3M4O J;  5IOZ A;  5E3O A;  1H8A C;  1OJL A;  3HKZ N;  3IV5 A;  1H89 C;  1GV2 A;  1I6H J;  5C4J J;  4AC0 A;  4XID A;  2H8R A;  2Y30 A;  3TW7 A;  1JJ6 C;  1IRZ A;  5GP9 A;  1POG A;  4DYR A;  1LE8 B;  2TRT A;  3E7L A;  3K7A J;  3S2H J;  4NDL A;  3H0G J;  3LSJ A;  1JKQ C;  1ORK A;  4M3F A;  4C2M J;  1U78 A;  2R5Z A;  3SJM A;  4B4C A;  2X9D A;  1T56 A;  2QF7 A;  2W48 A;  3B6A A;  3FIS A;  3ZQG A;  2Y9Z A;  1U9N A;  4B1R A;  3LOC A;  1YRN B;  1NTC A;  3BTI A;  2LD5 A;  1ZK8 A;  1BJZ A;  1QRY A;  3JRI A;  3BR5 A;  5DTD A;  1JUP A;  2HXI A;  1Q1V A;  1U8B A;  1F43 A;  1IGN A;  3ZQF A;  4A3D J;  2DJN A;  4XRS A;  3TED A;  4B3A A;  4FIS A;  2M8G X;  2LFB A;  4DYQ A;  4A3G J;  2O8K A;  3BG3 A;  3GTG J;  1BW5 A;  1MSF C;  4A69 C;  1HOM A;  2IBD A;  2DA7 A;  3BR3 A;  1JKP C;  3FKI J;  3WHC A;  3TW6 A;  3S1N J;  2ECC A;  4M3D A;  1Z77 A;  3B6C A;  2EZK A;  5EGO B;  2XGD A;  2XRL A;  2JMW A;  2JA6 J;  2ID3 A;  1FEX A;  2CUF A;  1VFC A;  2EBI A;  1AHD P;  3O8G A;  1XG1 A;  3VPR A;  1ZGW A;  5DS9 A;  1ZR2 A;  3A01 A;  2DMP A;  1WH5 A;  4IHW A;  4L5E A;  2K9Q A;  4XRS G;  3G1O A;  1EF4 A;  1GV5 A;  2DA2 A;  1HDD C;  1HDP A;  3CDL A;  2NVQ J;  2PMZ N;  5F0F A;  1JUS A;  1RES A;  1BL0 A;  1JT0 A;  4JX6 A;  3Q0W A;  2EQR A;  1K61 A;  4C3H J;  5FKL A;  2XPW A;  3UKG A;  2R5Y A;  2XGC A;  4JX5 A;  2YU9 J;  2HI3 A;  2XPV A;  3HEF A;  2ELK A;  2HOT A;  2MG4 A;  5IYC J;  1WPK A;  1BW6 A;  2M2E A;  2QCO A;  4QTR A;  2COB A;  2LR8 A;  1GDT A;  5JLX A;  5J1R A;  3BQZ A;  3FIW A;  2JWT A;  3ZQH A;  5IYD J;  3FK6 A;  1LFB A;  3JRB A;  1TWF J;  5J3L A;  5IP6 A;  3BG5 A;  2FJ1 A;  4I76 A;  2N8G A;  5FKK A;  4RDU A;  3JRG A;  4ABZ A;  2YUS A;  3JR9 A;  1H88 C;  2AHQ A;  3GTM J;  2WAQ N;  5F27 A;  2G0E A;  4XIC A;  2RAE A;  1UHS A;  1ETO A;  1Y1V J;  5K7Z A;  3DEW A;  2O7O A;  2OF7 A;  3S1M J;  3Q0V A;  5IPA A;  3D1N I;  5K7H A;  4Y52 J;  1JKR C;  2HQ5 A;  4X1E A;  2L0K A;  2JA8 J;  2DA6 A;  5E3L A;  1DU0 A;  2IAI A;  3HOY J;  1LE8 A;  4UUS B;  2E2J J;  4V2F A;  5M5W J;  3HOV J;  1R9T J;  4BBR J;  4I6Z A;  1W0U A;  3GTQ J;  4D7M A;  3HOW J;  4JP0 A;  2OPT A;  4QIW N;  1NK3 P;  2LY9 A;  1OCT C;  1APL C;  1SAN A;  2Y31 A;  4C3I J;  3OIO A;  1JTY A;  4M3E A;  3HDD A;  2FD5 A;  3BTC A;  2Y0S N;  4S0H B;  4IHV A;  3A03 A;  3BR0 A;  3ZQL A;  4MIM A;  1I3Q J;  1PUF A;  3G1M A;  4IEJ A;  1IUF A;  2DA4 A;  1RPW A;  3HM5 A;  5EG0 A;  1A5J A;  3S1R J;  5EDN A;  5EEA A;  2X6O A;  3JRH A;  2DA5 A;  2NVX J;  1ZKG A;  3DCF A;  3S16 J;  2XPU A;  4GFB A;  3PO2 J;  2Y2Z A;  2LTP A;  4DYC A;  5M5Y J;  1UG2 A;  3HGY A;  1P7J A;  1XS9 A;  3OSG A;  3G1L A;  5E3N A;  2DMN A;  2Y9Y A;  3JRF A;  1IDZ A;  2ID6 A;  2EZL A;  2R5Z B;  1TWG J;  4AYB N;  3O8H A;  1GVD A;  1LFU P;  2MW8 A;  3WHB A;  1NK2 P;  3BT9 A;  2VI6 A;  1VF9 A;  1W0T A;  3HGG A;  2L7F P;  5GPC A;  4MLO A;  4LOC A;  2X48 A;  1B8I A;  5F0C A;  5BNG A;  2YS9 A;  3I4N J;  5C44 J;  3K2A A;  3JRA A;  3W6V A;  1OFC X;  2L7M P;  1A6I A;  5IYB J;  2XB0 X;  4CYC A;  1GUU A;  1VND A;  2ME0 A;  4BXX J;  3S2D J;  1HLV A;  5F0H A;  1DU6 A;  2H1K A;  2JA7 J;  1B72 A;  1JJ8 C;  3OSF A;  4D7N A;  4A3J J;  5FKO A;  2JJ7 A;  1AKH B;  4D5C A;  4HNV A;  2IEK A; 
#chains in the Genus database with same CATH topology
 3U21 A;  3ABU A;  1X1B A;  2RQP A;  2KRH A;  1FOY A;  3A01 B;  3GZN B;  2MAB A;  3QAH A;  1P92 A;  4CZZ A;  1IRF A;  2P7C B;  1UJ8 A;  4PSX A;  4M3G A;  2HYJ A;  1UAA A;  3TQN A;  3T1B A;  3LSM A;  1JHH A;  5M3M J;  1D0Z A;  2KHM A;  2JVG A;  5FGM A;  1HW1 A;  3SFI A;  3HPH A;  2PMH A;  2EIK H;  4KDP A;  2EFQ A;  2ZFW A;  2DOE A;  3ZQ7 A;  3CCM I;  1HXD A;  1LJ9 A;  2O3F A;  4RM2 A;  1DGW Y;  1TLH B;  2I5U A;  5CVI A;  4ZC3 A;  4KIT B;  3IL2 A;  5IP9 J;  4FE4 A;  2R0Q C;  1CQT A;  1ENH A;  3ZQQ A;  5D5U B;  3S8P A;  2JK3 A;  4IF4 A;  1V5G A;  2LVS A;  2BY0 A;  2WB1 A;  2E60 A;  4MEY F;  1E3O C;  2QVO A;  3GTO J;  1MBK A;  1BA5 A;  5J8F A;  2NAZ A;  1XN7 A;  1WFX A;  4PZJ A;  3FBI B;  2FBK A;  3Q0U A;  4IVN A;  4LFU A;  4PUS A;  4G7O F;  4KT5 C;  3OYE A;  1B59 A;  3CMY A;  1KQ8 A;  2EJR A;  1J09 A;  2AXT C;  4G9Y A;  3LA2 A;  2E1M B;  3HOX J;  5LHH A;  4RLF A;  3G71 I;  3I59 A;  3A02 A;  3RQ4 A;  3S32 A;  4C3J J;  4IHS A;  3WGI A;  3WG9 A;  1BC8 C;  4M3B A;  5F6F A;  3MKW B;  1YRN A;  4WCG A;  3GTL J;  2MLG A;  4EM2 A;  1LEB A;  1T0F A;  5FLX K;  3LSP A;  2LP0 A;  1R23 A;  4A5N A;  5KHD A;  4ESJ A;  4BHP A;  2FOW A;  2VKE A;  2WA0 A;  2V7F A;  4ETS A;  1O3Q A;  3I55 I;  3QOP A;  1TWA J;  5F64 A;  2KIM A;  2ETH A;  1FP1 D;  5GAD J;  2PJP A;  2MC3 A;  3DTI A;  1SC7 A;  2Y0M A;  3K4M A;  4XLE A;  1D1C A;  2ZNZ A;  2I8D A;  3HB9 A;  2WB1 N;  3N4M A;  5D4R A;  2R7O A;  1YTY A;  4W1U A;  1IV6 A;  2Z3Y A;  1D3Y A;  3DFG A;  2KZV A;  2I10 A;  2KRC A;  3Q9V A;  5LD2 C;  5K5Q A;  4P1W A;  2CW0 F;  1LVA A;  2CS3 A;  2AQF A;  2FA5 A;  1RC9 A;  4BU2 A;  3M1E A;  3FXK A;  2PI0 A;  2M34 A;  4XKB A;  2L2O A;  4GXO A;  2K7L A;  4B48 A;  4JYK A;  2VJJ A;  3WTZ A;  2ZBK A;  3I71 A;  3R0J A;  3BQY A;  3HZJ A;  1TT0 A;  1WH7 A;  3F8B A;  3HIF A;  3OS0 A;  1D8J A;  1T98 A;  3D0S A;  4E7S A;  4U88 A;  5ILS A;  4IOA F;  1FSH A;  3M8J A;  2DMT A;  2JN6 A;  3FDY A;  4Y3O A;  1VQ4 I;  4FAS D;  2NVT J;  5FLX Z;  1MDM B;  2FQ3 A;  2M0C A;  2QKM B;  5IY5 H;  4A0X A;  3VOE A;  1MBF A;  4EEF G;  4BE0 A;  3G6E I;  1HW5 A;  5F08 A;  2O5R A;  4UVC A;  2XKO A;  3JCU C;  4MNU A;  2JPC A;  3HXL A;  4ESF A;  4UV8 A;  4CCO A;  4KT6 A;  1K83 J;  2JVH A;  3ECO A;  4ZH4 F;  3OYA A;  5IT9 Z;  2K27 A;  4QWQ A;  2L7K A;  1DDN A;  1VQO I;  2ELH A;  1MBJ A;  1MH3 A;  3WTY C;  4QPQ A;  2NOJ B;  1OMI A;  2XAG A;  2L7Z A;  3CQZ J;  2VPL A;  2QEX I;  1O7F A;  3LA3 A;  3M3Y J;  4ON0 A;  4LK1 F;  2GLO A;  3K4J A;  2GXG A;  1Z0X A;  2DTR A;  4ENK A;  2IP2 A;  2K4J A;  5DD4 A;  2JA5 J;  2LY2 A;  2QSG X;  1XPX A;  2PJR A;  1J2X A;  5LGU A;  4ZDL A;  2R5Y B;  4EGZ A;  1GT0 C;  3P7N A;  3I5U A;  2E2I J;  4A3L J;  3PUB A;  4NNJ A;  4ZDP A;  1Y1W J;  4ZZL A;  4MFD A;  5J4Y A;  4QPO A;  2X6Y A;  2KT0 A;  1MH4 A;  2DT7 B;  1JE8 A;  1V55 H;  1X2M A;  2CUE A;  5FO5 A;  1FIP A;  2KIS A;  1U3E M;  3RQI A;  2YX7 A;  5BPI A;  1YX3 A;  2CV0 A;  2MA3 A;  3SZG A;  2EPF A;  3J81 Z;  3ZQC A;  2R4G A;  2QQB A;  2W57 A;  2HOA A;  1S3J A;  5CPR B;  2YR2 A;  3JRE A;  2DN0 A;  3OS1 A;  1ZH5 A;  4E4H A;  1Y0N A;  4Y15 A;  1QHG A;  1TWH J;  4BJT A;  2NS8 A;  2ZB9 A;  5ED4 A;  4ANJ A;  3FHN A;  3S3M A;  1H89 C;  1I6H J;  2Y69 H;  4HDV A;  3REO A;  3AG4 H;  2ZO4 A;  4YG2 F;  3CES A;  5JHU A;  1MND A;  2ZME C;  3HOS A;  1Z3Y A;  1T39 A;  1IRX A;  1DGR M;  3R61 A;  2DCE A;  3TW7 A;  3HRM A;  2OZ6 A;  3K7A J;  5H2F C;  4FET A;  3HRT A;  1QBJ A;  3GZ6 A;  5L3C A;  1U78 A;  2V1D A;  3BJA A;  5DV5 A;  1T56 A;  2BY2 A;  2MLK A;  2EA2 A;  1D1A A;  2EFO A;  3N97 A;  5E17 F;  5E20 A;  2EFP A;  1YRN B;  3ABM H;  1BJZ A;  2GQQ A;  2IJL A;  4L0Y B;  3OYI A;  4DJA A;  1F43 A;  2HXI A;  4WK8 F;  3WGG A;  2AQE A;  1U8B A;  3FF5 A;  1XGS A;  2JSP A;  5L3G A;  3UR3 C;  1IXC A;  2DJN A;  1IUY A;  2HR3 A;  4Y13 A;  3K69 A;  3H9Q A;  4FIS A;  3ZMU A;  3OYG A;  1E3H A;  4F92 B;  4F55 A;  4DYQ A;  1MGT A;  3WTS C;  2O8K A;  3ONQ A;  3QWL A;  2IXS A;  5DEQ A;  1B1B A;  1WJF A;  2DA7 A;  3CMA I;  3P9I A;  2QSH X;  4Q5S F;  3S1N J;  3KEO A;  1VQP I;  2ECC A;  4M3D A;  1Z77 A;  2J5P A;  4NBQ A;  2JMW A;  4L5J A;  1OKR A;  4E7H A;  1RNL A;  1Q1H A;  2CUF A;  3V7R A;  2ICW G;  4KFC A;  4XNF A;  2YX4 A;  3VPR A;  5LHI A;  3F9K A;  2W4S A;  3BY6 A;  2PN6 A;  3DLA A;  2R7F A;  4PSW A;  1OLT A;  2DMP A;  1SD5 A;  1T95 A;  3L7W A;  4L5E A;  5K1Y A;  4PCQ A;  2MH2 A;  2VIX A;  2XIG A;  3GYH X;  4HF2 A;  2X85 A;  2ELJ A;  1XD7 A;  5CVR A;  3HSE A;  4UB8 C;  1HDD C;  1HDP A;  2H6C A;  3GX4 X;  4UY8 I;  2QQA A;  4IKF A;  2XUB A;  2KZG A;  1YIO A;  2M4K A;  4AU7 A;  2EQR A;  4C3H J;  4XMY A;  3QP6 A;  3UKG A;  4BNC A;  4KIG A;  1OPC A;  4YFX F;  3MFK A;  3BCB A;  2XGC A;  3OYF A;  4JX5 A;  3H5A A;  3OYL A;  3HEF A;  1TP4 A;  2ELK A;  4OMZ A;  1LKX A;  3PSI A;  1WPK A;  2M2E A;  4LG0 B;  3ZMS A;  4B44 A;  5D6E A;  4G8X A;  3ZN1 A;  4XOR A;  5JLX A;  1Z3X A;  1UHM A;  4HST A;  3ZQH A;  3CME I;  5IYD J;  1AWC A;  2QLZ A;  3BCA A;  5D8L B;  2RNG A;  2RNJ A;  1ZRC A;  1LFB A;  3TOA A;  3T5X A;  1PUE E;  3JRB A;  2F4O B;  5J3L A;  1U5T C;  1X19 A;  3F8M A;  2QEN A;  1B9N A;  3TBI A;  1N75 A;  3AG2 H;  2VBX A;  3QU3 A;  1UCR A;  4BHB A;  1T6S A;  4KJZ A;  4P55 A;  2QZ8 A;  2YUS A;  5HS7 A;  3CCL I;  2AHQ A;  1SFU A;  5F27 A;  1X1A A;  1YQA A;  3KP6 A;  2DU9 A;  3HPG A;  3LAP A;  2CGP A;  2DBB A;  1UHS A;  2JSC A;  4OAZ A;  1ETO A;  2V9K A;  3GFM A;  4FX0 A;  2O7O A;  4R1H A;  3AAF A;  2HEO A;  5K7H A;  4HF1 A;  3Q5F A;  1JKR C;  3JSO A;  3HRU A;  2L0K A;  1NG6 A;  2JA8 J;  1DU0 A;  2IAI A;  1N77 A;  1LE8 A;  4ASN A;  1PVE A;  1IAW A;  1RUO A;  2OBP A;  3C2H A;  3ZPL A;  2K9M A;  2FSW A;  4JP0 A;  5FFX A;  2OPT A;  4RS8 A;  4NC6 A;  5E8G A;  2GIZ A;  4XON A;  3K0L A;  3E6D A;  4BJ6 C;  3QP5 A;  1QZY A;  3CP2 A;  3CTA A;  1JTY A;  3H0D A;  4BQO A;  1B6A A;  3I9V 2;  2X0L A;  3JW4 A;  4I7H A;  3BR0 A;  4AM3 A;  1PUF A;  4G7Z F;  1RPW A;  1Y6I A;  5IT3 A;  1HC8 A;  5EG0 A;  5EEA A;  3DCF A;  2DK5 A;  2BY3 A;  2O03 A;  3BZC A;  1D5V A;  3BPV A;  3CP8 A;  1AA7 A;  1UG2 A;  1XMA A;  2K02 A;  3AG1 H;  2M7B A;  3ZN0 A;  1FBU A;  1KU2 A;  3ASN H;  2UUZ A;  1YHQ I;  1ZLJ A;  3F8C A;  2Y9Y A;  3WGH A;  3JRF A;  1XGO A;  1GVJ A;  2RDP A;  3FM3 A;  4Q48 A;  2F5C A;  1LDJ A;  1GVD A;  2R7U A;  1SEU A;  1G3Y A;  1V4R A;  2VI6 A;  2MYS A;  2Z2S B;  3KIO A;  4AIH A;  3KLN A;  1MMA A;  2XF6 A;  5GPC A;  4HV6 A;  1ZRE A;  2M0M A;  2X48 A;  3KX2 A;  4LIT A;  2LKP A;  2WC2 A;  3JRA A;  3W6V A;  2JUG A;  3GO5 A;  3LST A;  4I99 C;  2ADU A;  2HYG D;  4E7L A;  4O6J A;  4AIK A;  1VND A;  2ME0 A;  3V8K A;  2EFW A;  2UXX A;  1SAX A;  4RB0 A;  3GFJ A;  1WKM A;  5B5E C;  5JVG F;  1X3Z B;  1DU6 A;  3OS2 A;  2H1K A;  3S3O A;  4XLP F;  3L2U A;  2H94 A;  4U0W A;  2R3S A;  1JJ8 C;  3OSF A;  2W25 A;  3CF2 A;  2V79 A;  3V8L A;  3PQJ A;  3D5R C;  1XDU A;  1HKS A;  3OL3 A;  2WWY A;  4II3 A;  3L2W A;  1BI1 A;  3FMR A;  3TKY A;  3WU2 C;  4BBS J;  3ZMD A;  2VAS A;  2VN2 A;  1ETK A;  1TWC J;  4P9F A;  2D1H A;  5L3D A;  2KKO A;  2XB5 A;  2GXB A;  2PBI A;  1W5C C;  3F72 A;  2FEZ A;  2E71 A;  3OWT A;  5D5X B;  1U0J A;  1MNM C;  3HHH A;  3RPU D;  4A3E J;  2JPB A;  5GPA A;  5TRD A;  1ERD A;  1QZZ A;  2LSO A;  2VJ5 A;  2WV1 A;  1P6R A;  4KIF A;  3L2V A;  4II2 A;  3SXY A;  4MGR A;  5IP7 J;  1ZR4 A;  2KIF A;  1HSJ A;  2R7Z J;  3FWE A;  2A5W A;  1WGX A;  4Q4Z F;  5EF6 A;  3RZD J;  1ZGJ A;  4KMU X;  4CCJ A;  1BI2 A;  3TP3 A;  5CVV A;  5LFA A;  2IA2 A;  3OOU A;  2LKS A;  4YIR X;  1S7E A;  4KYW A;  3JRD A;  3F21 A;  1A04 A;  1YE9 A;  3RIR A;  3EUK L;  4G94 A;  2ZJQ F;  3QOD A;  1FOK A;  2HZD A;  2L9V A;  3H92 A;  5KK1 A;  2QUF A;  2ZXJ A;  2OA4 A;  3BR2 A;  1ULY A;  5J4V A;  3PM1 A;  2W7N A;  1QQI A;  2M9H A;  2X6W A;  4ZYD A;  2JT1 A;  2YU3 A;  3CCV I;  3PO3 J;  4GCV A;  4OIP F;  1XCV A;  4A3K J;  2ZXW H;  1P7I A;  3G2B A;  1RRJ A;  2VXD A;  4RLQ A;  2F5V A;  3W2W A;  3OYC A;  1O4X A;  4A0Z A;  4RB3 C;  1JUM A;  2IRF G;  1W5T A;  2EWN A;  4DZJ A;  2HTJ A;  4KIB A;  2STT A;  5LGT A;  2OAZ A;  1EH7 A;  1F36 A;  5C3E J;  1J59 A;  3EYY A;  1R4M B;  5EYR A;  5FJ8 J;  4X0G A;  2DW4 A;  3U1K A;  1W7P A;  2ESH A;  3DP7 A;  1IG7 A;  3FKJ A;  4C30 A;  3K1M A;  4V2G A;  3JRC A;  3R4K A;  1ETX A;  1VZ0 A;  1JHF A;  1I50 J;  3I4M J;  3HOZ J;  1FNN A;  3G3Z A;  2ISY A;  1EV7 A;  4GO1 A;  3WE2 A;  4RBO A;  3E3V A;  2KMU A;  2ECB A;  4RGR A;  3T8T A;  1S29 A;  4A93 J;  2COM A;  5D6F A;  1BIB A;  2PLY A;  3RPQ A;  5FRN A;  4JQF A;  2H6B A;  5CQE A;  1PDN C;  1VQ8 I;  1IO2 A;  4CCM A;  1FYK A;  1J7K A;  2DMQ A;  3HYI A;  2LNB A;  2KJC A;  4M6V A;  3IH2 A;  3K4C A;  1PUF B;  3A1Y A;  3HG9 A;  2OZU A;  5EG0 B;  2QA4 I;  2HFH A;  2G7H A;  2JTV A;  3GFL A;  4JX4 A;  1U8R A;  3TP0 A;  4NUB A;  1JGG A;  3GUD A;  1YW7 A;  4G12 A;  4AD9 A;  5J1Y A;  4FHT A;  2O8X A;  2ZSH B;  1YLF A;  2EZI A;  2VPR A;  4AIJ A;  2DO7 A;  4ENM A;  2O9L A;  2EFN A;  4A12 A;  1J5Y A;  1HF0 A;  3BWG A;  3CCU I;  1B9M A;  5GAE J;  2R7D A;  2E19 A;  2VC0 A;  2B63 J;  3PFY A;  3RI4 A;  3DEE A;  4DOZ A;  2OU2 A;  3KCC A;  2BZT A;  5K5R A;  2R7V A;  1MMN A;  2VQC A;  3O2P E;  3W2V A;  4FT8 A;  2PQ8 A;  1P2F A;  2XAF A;  1IXS B;  3DBH B;  2F48 A;  3H5N A;  4EGY A;  5DUI A;  2DMU A;  2P6S A;  1FIA A;  3F22 A;  1WCM J;  4OU0 A;  1KA8 A;  3TDZ C;  3AG3 H;  4XL9 A;  3MKZ A;  4KN7 X;  4Y4R A;  1JTX A;  2MSY A;  3HKZ A;  4XOP A;  2RC4 A;  2P4W A;  3CJN A;  1HKT A;  2QQ8 A;  4BKX A;  1YYV A;  1X58 A;  1FPQ A;  4EVI A;  2W1O A;  2P5K A;  3S17 J;  2CQQ A;  4MFE A;  3LAJ A;  3RZO J;  3I54 A;  5FKN A;  2HGC A;  2ZKZ A;  1SFK A;  1P9Q C;  2IS1 A;  2GXA A;  1SVO A;  5DCM A;  4YEL A;  1TT5 B;  5KCM A;  4DZP A;  3CO6 C;  3R6S A;  2XAH A;  1QO0 D;  2L9R A;  2NOG A;  1PYV A;  4IO9 F;  1VQ9 I;  4Y33 A;  4B47 A;  3KEQ A;  3KP4 A;  5M3F J;  3FZV A;  2E1O A;  4XK4 A;  2GOX B;  2F5F A;  2XDV A;  2DOF A;  1I6X A;  3IH4 A;  3CJT B;  1R1U A;  2XGX A;  4A6D A;  4GYG A;  2KDZ A;  3F0C A;  3BR6 A;  4PJM A;  3DBL B;  3QQA A;  3TO7 A;  2FML A;  4EM1 A;  3M8E A;  5FD5 A;  2DFF A;  3K9T A;  3KP7 A;  1OJL A;  3HKZ N;  1DPR A;  3IV5 A;  4BAC A;  1XMX A;  3J7A O;  5TGT A;  4XKW A;  2EIN H;  4EM0 B;  2L01 A;  3IWZ A;  2PMU A;  4PJJ A;  3DTK A;  3PIO F;  4EJW A;  2FMY A;  2H8R A;  1JJ6 C;  2Z16 A;  5GP9 A;  1J75 A;  2RQQ A;  2TRT A;  3E7L A;  4L0Z B;  1W4M A;  4NDL A;  3EYI A;  1G3T A;  3MWM A;  3LSJ A;  3G4S I;  1ORK A;  4NC7 A;  1F1Z A;  2QBY B;  3VYS B;  4ESB A;  4O5V A;  1EH6 A;  3OR1 C;  3RKY A;  2R5Z A;  1WWX A;  2QF7 A;  3B6A A;  4CCN A;  2K4B A;  1U9N A;  1RI7 A;  2UXN A;  1YFH A;  3LOC A;  2BBY A;  2NRA C;  3K4L A;  1K7A A;  4D9J A;  2BOL A;  3DQV C;  4G6Q A;  4S05 A;  1FC3 A;  3QU6 A;  3IKV A;  1JUP A;  1Q1V A;  4XLF A;  2CQK A;  1TQM A;  4BXU A;  5D5V B;  1UFM A;  4A3D J;  3RSN A;  4PJ0 C;  3ERE D;  2A61 A;  3ZXS A;  2M8G X;  4DBR A;  1S8N A;  3BG3 A;  4ZYE A;  2LYC A;  4NQW A;  4RB1 A;  3ULQ B;  3TW6 A;  3I58 A;  4XKV A;  3IKT A;  3B6C A;  1TL8 A;  5DUK A;  2XRL A;  1MW7 A;  1AHD P;  3O8G A;  1XG1 A;  1ZGW A;  4CO8 A;  3TO6 A;  2BVL A;  3DWL E;  5AIQ A;  2R7W A;  3WOD F;  3AL0 B;  3G1O A;  1G6N A;  2L02 A;  2LDU A;  3HRS A;  4ZDO A;  2F5E A;  1EH8 A;  4PDK A;  5GAG J;  2DA2 A;  2KDO A;  3CDL A;  3CCR I;  2NVQ J;  1ZAR A;  4RGS A;  5F0F A;  3L2R A;  2B0L A;  4GGG A;  2VBZ A;  3WTW C;  1BL0 A;  1MZB A;  2H27 A;  4LGW A;  5FKL A;  2XPW A;  2BW3 A;  1P4A A;  4UUV A;  3M7G A;  4HA8 A;  3MZY A;  5CJ9 A;  5F1R A;  4K2E A;  4EJO A;  1S9H A;  1OYW A;  3C1D A;  2E5Z A;  2GZW A;  4PFP A;  1VQ5 I;  4HRI A;  2VT3 A;  4KIC A;  4WF2 A;  2Z33 A;  4QTR A;  3KZY A;  2COB A;  3BPX A;  2H09 A;  1SVM A;  4HDU A;  1V54 H;  3F8F A;  1SFE A;  1PP7 U;  2LF8 A;  3FK6 A;  4EV0 A;  1H0M A;  2M30 A;  5CVJ A;  1W1W E;  3JTG A;  4LLN A;  2M7A A;  3CDH A;  1VQN I;  4RAZ A;  1UEL B;  3BG5 A;  2FJ1 A;  2YSR A;  3BJO A;  3C3W A;  2DK8 A;  1BC7 C;  2N8G A;  3QOE A;  5FKK A;  4AWX B;  4BEH A;  4KMF A;  3JR9 A;  3C2G A;  3EUA A;  1V5F A;  1X1D A;  5HLT A;  1V3F A;  4IPA A;  4XIC A;  1S7A A;  3V4G A;  1OYI A;  3CCJ I;  3KYL A;  5K7Z A;  4HSR A;  3ESW B;  2WTE A;  3S1M J;  3QYB A;  1OR7 C;  4BDY A;  2R7Q A;  1QGP A;  4Y52 J;  2HQ5 A;  5DCM B;  5TIS C;  4FX4 A;  2VBY A;  2FUG 2;  5E3L A;  5LEK A;  3VWB A;  3PJR A;  2EIJ H;  5FRO A;  3HOV J;  4PJL A;  4LJZ F;  4JK1 X;  4RAF A;  4L9J A;  4CGZ A;  4D7M A;  4AYB A;  2FRH A;  1QPM A;  3GZ5 A;  2DAO A;  4HBL A;  1SAN A;  4MHG A;  3CUQ C;  4XRF A;  4HZF A;  4NC8 A;  4BDZ A;  2Y31 A;  1WVR A;  1LNW A;  4GYI A;  4QLC U;  3W2A A;  3DXJ F;  3I59 B;  4M3E A;  2H1L A;  2OQG A;  1IN4 A;  2WV0 A;  4B3X A;  4CH7 A;  4S0H B;  1YJN I;  3C7J A;  5GTH C;  4M72 A;  3L09 A;  4L9V A;  1MIJ A;  3ZQL A;  1I3Q J;  2B9S A;  3G1M A;  4IEJ A;  3RKX A;  2DA4 A;  2XAQ A;  3KYD B;  3ZCO A;  3HM5 A;  1SMT A;  3OYJ A;  1A5J A;  3CC7 I;  5EDN A;  3JRH A;  4IZZ A;  2DA5 A;  1MJ9 A;  3DV8 A;  3GW2 A;  2FOK A;  4PGG A;  5A2Q K;  4M6Y A;  2XSJ C;  5H20 A;  1HST A;  2XPU A;  4GFB A;  3PO2 J;  2ZFU A;  2XRN A;  3FM5 A;  3BRO A;  1S6L A;  1WJC A;  3G1L A;  3LSI A;  4XN0 A;  1XSV A;  5E3N A;  1OIS A;  1Y8R B;  4EJT A;  3X2Q H;  4BXF A;  4HLX A;  2EZL A;  3CLO A;  1Z7L A;  2IA0 A;  2R5Z B;  1UG0 A;  4HEA 2;  3O8H A;  4AYB N;  2JUC A;  4XOT A;  1XX5 A;  2MW8 A;  2XAJ A;  5KVR A;  3VYT B;  2QQ9 A;  2W85 A;  3ZMT A;  2E36 A;  4U7D A;  1HW2 A;  5ICG A;  2CV1 A;  1KON A;  5E1W A;  4MLO A;  2CFX A;  3H9J A;  4LOC A;  3IC7 A;  1B8I A;  1U6G A;  3I56 I;  5F0C A;  5BNG A;  2HQN A;  5EEG A;  4B09 A;  2YS9 A;  1T8I A;  1XB4 A;  1DP3 A;  5E8I A;  3P9K A;  1OFC X;  3TO9 A;  4M71 A;  3LWF A;  2L7M P;  3J80 K;  4EQQ A;  1UST A;  4FQG A;  5IYB J;  2XB0 X;  3DKY A;  2NVU B;  2Z9O A;  1ZG1 A;  1GUU A;  5LRR A;  1FMV A;  1E0E A;  2A69 F;  3D5L A;  2VT2 A;  4LLG F;  1JXS A;  2K3P A;  1O3T A;  2OCC H;  1HLV A;  5F0H A;  2DDB A;  2CFO A;  2JA7 J;  5CYV A;  4HX4 A;  2DJI A;  3M07 A;  5DD8 A;  1B72 A;  1QNT A;  4D7N A;  4A5M A;  4M9Z A;  4D5C A;  2JRT A;  2IEK A;  4HNV A;  1FWZ A;  4FCY A;  5J40 A;  2E1M C;  4HX8 A;  3E0J B;  2PEX A;  2A6T A;  5EZG A;  2OTJ I;  2QM3 A;  2GA2 A;  4RGX A;  3MQ0 A;  1D0Y A;  4AVP A;  4HNU A;  2UWM A;  3ERM A;  3QPS A;  1KQ0 A;  1MBG A;  1QZE A;  3GME A;  1TW2 A;  2BXY A;  3CCY A;  3GWZ A;  4U0Y A;  1VQL I;  4O3M A;  3KLO A;  3FBN B;  1L3L A;  3BG9 A;  1ZYR F;  3I4P A;  3RTR A;  1YS7 A;  3OMY A;  2DXI A;  1UB9 A;  5HLI A;  4DGW B;  2D2W A;  1MNE A;  1I27 A;  3OYH A;  4D0P A;  1Z6T A;  5ICC A;  2DYR H;  1T38 A;  1BOA A;  2PJR B;  5E79 C;  1JI8 A;  3VB2 A;  3HHG A;  1R7J A;  2ZNY A;  2DFH A;  2K9S A;  1YX5 A;  3GEZ A;  2VJ4 A;  1EKE A;  2R7X A;  3NQO A;  4ITV A;  2K9L A;  1KYZ A;  2EV0 A;  4L9T A;  3K2Z A;  2XVC A;  1EJ9 A;  1LDD A;  2E7X A;  4UB6 C;  3F8N A;  1LEA A;  1LDK B;  2VBW A;  5CVU A;  4YFN F;  3U1D A;  2KJB A;  4YIF A;  2E2H J;  4YII A;  1JKO C;  2V6C A;  3ABL H;  1OCO H;  1MSE C;  2OTL I;  5J6X A;  2HTS A;  5B3S H;  2FNP A;  3I64 A;  3LSH A;  1P4X A;  2P0W A;  2DFI A;  4LMY A;  1G3W A;  3NAU A;  1K4T A;  2RGV A;  2HWV A;  5DM6 F;  5IOY A;  5M5X J;  3GTJ J;  2MGQ A;  3BG7 A;  2GIV A;  1UZC A;  1FT9 A;  3WU0 A;  1TZL A;  3F6O A;  1F5T A;  3MKL A;  5HVQ C;  3MVP A;  1OCC H;  3I53 A;  1VQK I;  1FJL A;  2DPD A;  1YJ9 I;  2DQL A;  2JQ7 A;  4HW0 A;  1AOY A;  4R8H A;  2EA4 A;  2FBH A;  1SD6 A;  2ZME A;  1AU7 A;  2HDC A;  2VKH A;  3CO7 C;  1QVT A;  3OYB A;  3H5R A;  3AL0 C;  5EGO A;  3S1Q J;  6PAX A;  4HLY A;  3M8F A;  1DPU A;  2X1E A;  3BOQ A;  2LLK A;  2X1C A;  3K10 A;  3MN2 A;  2IGO A;  4I02 A;  5EZH A;  2QGU A;  3Q3S A;  4RM3 A;  3K4K A;  4E70 A;  2AS5 F;  4UNO A;  3SQN A;  4HQM A;  3E5X A;  4WXH A;  1B4A A;  3KZI C;  4J00 A;  1RR7 A;  3S14 J;  2LKX A;  1QHH D;  2XSD C;  1R5I D;  1WJD A;  3VEP A;  3DLL F;  3BTL A;  2HKO A;  5C4X J;  3CDI A;  1S72 I;  1H9T A;  3LFU A;  3JSP A;  1I1G A;  4UVB A;  1YIJ I;  2DPU A;  4AID A;  5FLM J;  3H3U A;  2HDD A;  1MMS A;  1QPI A;  4N9H A;  5F04 A;  3ZP5 A;  2G7U A;  1D1B A;  4HPQ A;  4A3F J;  1HCR A;  2LBF A;  4A3B J;  4FTH A;  2VJI A;  4DBQ A;  1AKH A;  2E1C A;  1FTT A;  3SEZ A;  1BI3 A;  2K40 A;  1Z21 A;  5H6R A;  2OD5 A;  3KEY A;  2KP6 A;  2P81 A;  2DDA A;  4MO7 A;  1QVU A;  3MAJ A;  4X6A J;  1E3P A;  1ZTR A;  3K1P A;  1I5Z A;  4PK4 A;  5JI6 A;  3VDX A;  2Q2E A;  1K78 A;  2Q1Z B;  3CUO A;  3FMQ A;  1MBH A;  2VOO A;  1I3A A;  1XTA A;  4HAM A;  2ME6 A;  1MBE A;  1B8I B;  3E6B A;  1WJA A;  4A3M J;  4E7K A;  4WX9 A;  1V5E A;  2DA3 A;  2AO9 A;  3GTK J;  3M9A A;  2L5Q A;  4A2U A;  2A6H F;  1JT6 A;  1ETQ A;  2IGM A;  2VKV A;  1ZQ3 P;  4I98 B;  4ZYA A;  3ABT A;  2HVR A;  1MD0 A;  1VI0 A;  2CUJ A;  5FD6 A;  3C2B A;  4BGD A;  4EJU A;  5E3M A;  2A05 A;  4KNY A;  2HS5 A;  2IPQ X;  3OR2 C;  4G6D A;  2BVM A;  5HDG A;  1G8X A;  1ZG5 A;  1RUN A;  1IN6 A;  1J0R A;  2FX0 A;  2R93 J;  1KQ9 A;  1B72 B;  1IW7 F;  3W3C A;  3HSR A;  4IQ4 A;  2D5V A;  3EET A;  2NNY A;  3L2Q A;  2EH3 A;  1IN7 A;  2GBY A;  4A3I J;  2QSF X;  5CLS A;  2LH9 A;  3I0T A;  3H9G A;  5B1B H;  1ITY A;  3B73 A;  3S15 J;  1D5Y A;  4D5F A;  1RET A;  5BMZ A;  3HC7 A;  4IRG A;  1H9G A;  3S93 A;  4IHY A;  4HX7 A;  1YJW I;  1IF1 A;  1A6Q A;  2O0Y A;  1BIA A;  1T0F C;  1ZN2 A;  4M73 A;  3WE3 A;  2CJJ A;  5HDN A;  2MFZ A;  3HSF A;  1U5T A;  3R0A A;  3ZMZ A;  3M4O J;  3W6J B;  4ENN A;  2BE5 F;  1KU9 A;  1H8A C;  1O57 A;  2NYX A;  2X6X A;  4H4K C;  4V19 K;  2L4A A;  2MBF A;  2Y75 A;  2DOA A;  4OWR B;  3PNY A;  4XLN F;  1ZAO A;  1XDS A;  2O6G E;  2LG4 A;  3K4N A;  3AKZ A;  4BS9 A;  3O3K A;  4AC0 A;  1KGS A;  4ZYH A;  3C18 A;  4IXA A;  1Y8Q B;  3Q9S A;  3A0H C;  1K79 A;  4AVZ A;  1FOX A;  3OL4 A;  1POG A;  4DYR A;  2WAF A;  1LE8 B;  4MTE A;  3RJP A;  3S2H J;  2L9N A;  3H0G J;  1KU7 A;  1SVL A;  4M3F A;  3OOP A;  5D4S A;  4BL0 B;  4HQE A;  2A07 F;  2M1B A;  1VQ6 I;  2VXZ A;  4B4C A;  2X9D A;  3ZQG A;  1R00 A;  1NTC A;  4NHJ A;  1YW8 A;  2AXL A;  3V8J A;  1BR2 A;  1S7O A;  1ZK8 A;  4CZC A;  4PJN A;  2KPM A;  2XF5 A;  3F6V A;  3ROU A;  1OYY A;  1G4D A;  3IHU A;  1O3S A;  2O61 A;  1A36 A;  2X51 A;  1WI9 A;  4XRS A;  1MMG A;  2G9W A;  3TED A;  1EA3 A;  3PSF A;  4RA2 A;  3NWS A;  3WTU C;  3WTT C;  1BOB A;  2LFB A;  3FXR A;  4A3G J;  1MKM A;  4Z2Y A;  3GTG J;  2W84 A;  1HQC A;  1HOM A;  2IBD A;  1R22 A;  1IRG A;  1JKP C;  2EIM H;  4I01 A;  4IHT A;  2ZME B;  3P5J A;  4MQ9 F;  5DDG A;  2BHZ A;  3WHC A;  4C2U A;  4LB5 A;  4OMY A;  1FYL A;  4YRV A;  5EGO B;  1SD4 A;  2JA6 J;  2P5L C;  2VE8 A;  2ID3 A;  2NS0 A;  4CCL A;  4BQA A;  2E34 A;  2EBI A;  1VFC A;  4Y17 A;  2OQR A;  3OYD A;  2DFE A;  1ZR2 A;  5LRS A;  1O7L A;  2FXA A;  2ZJR F;  2CMP A;  1VTN C;  4IHW A;  5L3F A;  1GXQ A;  4XRS G;  1N78 A;  2R7T A;  1F4K A;  3V7C A;  4A0Y A;  2IW5 A;  2PMZ N;  4N0B A;  4R79 A;  2D45 A;  1JUS A;  1RES A;  1QA6 A;  1FY7 A;  2VL8 A;  2A68 F;  4PGH A;  4CSW A;  3Q0W A;  2WAQ A;  4NB5 A;  1WJB A;  2LRE A;  3FXU A;  3K1N A;  4BE1 A;  1FLI A;  2KIQ A;  5K5O A;  2R5Y A;  2GWR A;  5HLG A;  3SZP A;  4EAT A;  2KQR A;  2MG4 A;  2JA2 A;  2CH0 A;  2KFD A;  3SZT A;  5ILV A;  2LR8 A;  4F7Z A;  3H3Z A;  3T0Y A;  5J1R A;  3AFH A;  2CYY A;  3BQZ A;  2JWT A;  4IJA A;  2Q2E B;  4XLH A;  5L3E A;  1K78 B;  3FXQ A;  1P4W A;  3E6C C;  1ON1 A;  2DLL A;  4S04 A;  1PP8 F;  4IQJ A;  2XAS A;  2X4H A;  3J7Y J;  1TQI A;  1X1P A;  3EQL F;  1Y0U A;  4BYY A;  5TJJ A;  3DPL C;  1UHW A;  1ZEL A;  3FXJ A;  3IAM 2;  3QPT A;  3EPZ A;  3KP2 A;  1NH3 A;  3JRG A;  4ABZ A;  3OIQ A;  5HNH A;  2HPI A;  3ABK H;  4XKC A;  1Y56 A;  1H88 C;  4CUG A;  1CGP A;  3GTM J;  2Y0S A;  3L00 A;  2WAQ N;  2HVS A;  1GHC A;  2G0E A;  4N9I A;  3WTV C;  4H0E A;  2RAE A;  1D0X A;  1XSX A;  5KAI C;  1IV8 A;  1GLN A;  1Y1V J;  2ZCW A;  5CKT A;  1VQM I;  3DEW A;  3RKW A;  1TW3 A;  3CZ6 A;  3Q0V A;  3CC4 I;  2P6T A;  4C2T A;  4X1E A;  2BHY A;  2V26 A;  1LB2 A;  2E7W A;  3HUG A;  4ZYG A;  1S5L C;  1REP C;  2QYO A;  3OY9 A;  1BR1 A;  4I6Z A;  1TNS A;  3EDP A;  2XKP A;  4QIW N;  1NK3 P;  2WAE A;  3SEQ A;  5GAH J;  3ZRG A;  4I0B A;  3WU1 B;  2L9S A;  4IRI A;  1U5T B;  2LOO A;  3P9C A;  5JFR A;  3IUO A;  4LLL A;  4GDF A;  3HDD A;  3BTC A;  5BS6 A;  1FMW A;  4UXN A;  1Z67 A;  4HYE A;  2Y0S N;  1WQ2 A;  2WAD A;  4LD5 A;  1IUF A;  1KU3 A;  4EJV A;  2BV6 A;  4YFK F;  3OYM A;  3ZR8 X;  4F91 B;  3S1R J;  2CQN A;  2X6O A;  1ZRF A;  2NVX J;  3J7Z I;  1ZKG A;  3VOD A;  5IT9 K;  3RCO A;  4N4O B;  2Y2Z A;  1W7P B;  2HOE A;  2M87 A;  2KLO A;  2NXN B;  3IRQ A;  4CYD A;  2RV8 A;  2DMN A;  3VYR B;  2Q0O A;  3S3N A;  5D5W B;  1BM9 A;  2ID6 A;  3D5S C;  4D1Q A;  1LFU P;  1J9I A;  5BPD A;  4RAY A;  4MEX F;  3BT9 A;  1XSD A;  2DQR A;  1BN5 A;  2LY1 A;  3FXO A;  5DYM A;  1VF9 A;  3DU5 A;  1W0T A;  4G6T B;  5AON A;  4IL6 C;  4HG2 A;  4HOB A;  2VE9 A;  4XQF A;  4DQ2 A;  1DP7 P;  3ASO H;  5EEH A;  4E6K G;  3E5Q A;  5B66 C;  3I4N J;  5C44 J;  2FBI A;  3QYE A;  4WWC A;  1R49 A;  1L0O C;  3DPT A;  2VON A;  5KNL A;  4CYC A;  1ON2 A;  2W24 A;  5D8K B;  3LQQ A;  2F6C A;  1D8K A;  4E7J A;  3V42 A;  3DKW A;  3J81 K;  2VQH A;  4ZZD A;  4LG0 A;  4BQQ A;  2WBM A;  3GFI A;  3F3X A;  1Z9C A;  2K3F A;  4I09 A;  4WXC A;  4A3J J;  3U9G A;  1ONV A;  1FZP B;  4XLC A;  2VLA A;  1FBQ A;  1X1C A;  1XMK A;  5JLW A;  1ACI A;  1FSE A;  3BDD A;  4AUX A;  2K86 A;  1G2H A;  2HZT A;  1Z1D A;  4IHX A;  3LNQ A;  2ESN A;  2GAU A;  3EUH C;  4W97 A;  5JVT A;  2ZXI A;  1WJE A;  1RKT A;  1UMQ A;  4DW6 A;  1TQP A;  2CQX A;  1X4O A;  2KRF A;  3RPU A;  1VQ7 I;  4L9N A;  2CU7 A;  1GXP A;  2FNA A;  5FKM A;  1SD7 A;  2V1X A;  2JRM A;  5L3B A;  4CXF A;  1IJW C;  2XC7 A;  2XRO A;  4J19 A;  2NS7 A;  4BY7 J;  3TDU C;  4A6E A;  5E18 F;  1XC5 A;  3H35 A;  2A6E F;  3J7A Y;  1T33 A;  4CHU A;  3A4C A;  3DF8 A;  4FE7 A;  3SYT A;  4M9X A;  5FLV A;  3VYU B;  2DTZ A;  1YOV B;  5F1J A;  2Q8K A;  5HS9 A;  2KIU A;  1X2N A;  2KL4 A;  2V6E A;  5H6Q A;  4LK0 F;  3RDI A;  2HPM A;  2LMD A;  4QSH A;  3SHF A;  1IDY A;  1YW9 A;  4A3C J;  3BR1 A;  5DM7 F;  2CUZ A;  3LA7 A;  2TDX A;  3I3L A;  3WG7 H;  2CRG A;  3OV8 A;  5LLQ A;  4UV9 A;  3ZQI A;  3BJ6 A;  2R7S A;  1YG2 A;  2MD0 A;  3TL4 X;  1WRJ A;  3IWF A;  1KZH A;  2TCT A;  4KUM A;  2MH9 A;  1W5S A;  4B43 A;  2RKH A;  3IAS 2;  2XGE A;  3HTU A;  1R6R A;  3KE2 A;  4CCK A;  4CA0 A;  3DPU A;  4EMS A;  1E17 A;  1W7P D;  1G59 A;  4I2O A;  2EB7 A;  4WXD A;  3MZ8 A;  3HUG B;  4YEJ A;  4BHC A;  2IS4 A;  3BLY A;  2HOS A;  3R60 A;  4OIO F;  5HLH A;  3ZGK A;  3DEU A;  3PNV A;  1TC3 C;  3CCS I;  3MKY B;  2K9N A;  3DTE A;  1NG7 A;  4HV5 A;  3TOB A;  3KFW X;  5K7F A;  1W36 D;  5JR3 A;  4PFO A;  4UUT A;  3ISP A;  4Q47 A;  3ZOB A;  3OYK A;  3T8R A;  1LVK A;  2F5D A;  2IS6 A;  1YIT I;  1Z6R A;  4N4N B;  3BZK A;  1ETV A;  5BOX A;  2F4I A;  2R92 J;  3FMS A;  5J1U A;  4MTD A;  1IC8 A;  1OQY A;  1BJA A;  3MCZ A;  4XRM A;  3NAR A;  4CDG A;  2ACJ A;  5FB2 A;  2P8T A;  1LQ1 A;  2L4M A;  1ETY A;  1U9O A;  3OIP A;  2YPR A;  3HOU J;  5ERI A;  3ELK A;  1FX7 A;  2VOD A;  3GLX A;  3CMM A;  4U0V A;  3CF5 F;  1DUX C;  4NQW B;  4XN3 A;  3E1S A;  3GCM A;  4J01 A;  3TGN A;  3K6G A;  5DCF A;  1ZLK A;  1ZGA A;  3KP5 A;  3SFZ A;  5LHG A;  2XV4 S;  2EZH A;  2LK2 A;  1ZG3 A;  3N05 A;  3GTP J;  1CF7 A;  3H1C A;  5A2Q Z;  3BZ6 A;  5HOD A;  2FQ4 A;  4Y7N J;  3VSK A;  1RKW A;  3FK7 A;  2A3S A;  3DKX A;  2VUM J;  2Y48 A;  3LSR A;  3K4B A;  2WY7 Q;  4BY1 J;  2L54 A;  1K4S A;  2BXZ A;  4XSZ F;  1ODD A;  1HA8 A;  3RKQ A;  1YI2 I;  1OCP A;  1T08 B;  3L1P A;  3BTJ A;  1XGM A;  4L5I A;  2HQA A;  4P9U A;  4CYC B;  1BBY A;  2E1N A;  2ZC2 A;  2ZJ2 A;  4BH9 A;  1E2X A;  1U2W A;  2JZY A;  3L2C A;  2GM4 A;  2CQ7 A;  2VB6 A;  3IH3 A;  1XCB A;  4TV7 A;  3K70 D;  1SFO J;  9ANT A;  3GF2 A;  2BW3 B;  3ML6 A;  1SAU A;  4ENJ A;  4U87 A;  2DA1 A;  2IT0 A;  3E6M A;  1K6Y A;  1R71 A;  3J80 Z;  3SDB A;  4RMN A;  1I1S A;  1OCZ H;  4P5O A;  1WSU A;  1MJB A;  3SDG A;  1WI3 A;  4UHT A;  5HDK A;  4UUS A;  4BAY A;  1FP2 A;  2V4J C;  3GBG A;  3QPL A;  2DI3 A;  2HXO A;  4C9Y A;  3H3V K;  4KIS A;  4BJ5 C;  4CIC A;  3EUH A;  3S2W A;  4U7B A;  4ZTF A;  2NVY J;  1X4P A;  1TNT A;  2OJE D;  2RVC A;  3F23 A;  1FTZ A;  4IRH A;  4KN4 X;  2L3D A;  3DBR B;  1BR4 A;  1RZ4 A;  4LIU A;  3HBL A;  3LSG A;  1IXR C;  3CD6 I;  4BEH B;  1ETW A;  5AIP A;  3GLL A;  5IOZ A;  5E3O A;  3JAM K;  5E1X A;  3HTS B;  1WJ5 A;  1FOW A;  1IN5 A;  1GV2 A;  1R58 A;  3NEU A;  2FF4 A;  3KP3 A;  3LL7 A;  2IGK A;  2LRD A;  1BI0 A;  5C4J J;  2DYS H;  3FXM A;  5J8C A;  4OIR F;  1IZ1 A;  1TBX A;  2HU9 A;  1HKQ A;  4XID A;  3FX3 A;  4JOM A;  2Y30 A;  1OR7 A;  1IRZ A;  2B7E A;  1RIO H;  1Z05 A;  4ZTJ A;  1W36 C;  3RYR A;  2PFB A;  3QYF A;  1XGN A;  2CW8 A;  4XR6 A;  1JKQ C;  1NHA A;  2VC1 A;  3KYC B;  2Z5U A;  1N25 A;  4C2M J;  2OV7 A;  2IA1 A;  2W00 A;  5EJC A;  3PL8 A;  3SJM A;  2W48 A;  2Z99 A;  3FIS A;  2Y9Z A;  2IGN A;  4LIV A;  3VSL A;  4B1R A;  3TMO A;  3O6B B;  3BTI A;  2LD5 A;  3MD2 A;  4LG3 A;  1YO5 C;  2MC4 A;  3CUQ A;  1QRY A;  1TTY A;  4IX7 A;  3JRI A;  3BR5 A;  5DTD A;  2CV2 A;  5GTI C;  2HKX A;  3BG6 A;  1IGN A;  1G3S A;  1WHU A;  3ZQF A;  4HNT A;  5B1A H;  2VQL A;  3PUF A;  4JBA A;  5E1Z B;  1KYW A;  4B3A A;  1SMY F;  2P5V A;  3UNG C;  1JGS A;  3JAM Z;  3FHZ A;  5JHF A;  3QRF F;  1BW5 A;  1MSF C;  4MQV A;  4A69 C;  2HDW A;  3DU6 A;  3L9F A;  5CQG A;  3RYP A;  4DNC A;  1HBX G;  3BR3 A;  1RR8 C;  2ZJP F;  3FKI J;  1R4N B;  2M4G A;  1R1T A;  2HNH A;  2EV6 A;  2EZK A;  2GOM A;  2M8E A;  2K5C A;  2XGD A;  1FEX A;  3HOT A;  2UZK A;  5DS9 A;  3A01 A;  1R5G A;  1WH5 A;  5ICE A;  3H36 A;  2K9Q A;  3IP4 B;  2RN7 A;  2VQG A;  2NNN A;  1EF4 A;  1GV5 A;  3V7S A;  3JTH A;  3CC2 I;  3E97 A;  3MEX A;  3K70 C;  1JT0 A;  4JX6 A;  4BE2 A;  2W82 A;  1K61 A;  2V9P A;  4OOI A;  1DQU A;  1M1E B;  2IVM A;  5LEJ A;  4RGU A;  1Y39 A;  2YU9 J;  2HI3 A;  3BC8 A;  2XPV A;  5ILU A;  5KAF C;  2V1N A;  1T2K A;  1K6O A;  2HOT A;  3E5U A;  5IYC J;  2DT6 A;  2E35 A;  1BW6 A;  2LF7 A;  2QCO A;  3PQK A;  2CG4 A;  4BQN A;  1MMD A;  2LC2 A;  3IRR A;  1CF7 B;  4OIN F;  1GDT A;  4P96 A;  1A31 A;  3FIW A;  2Z1D A;  2XAU A;  4F3Q A;  3GXO A;  2XF7 A;  4M74 A;  5LGN A;  3G73 A;  3LFK A;  1TWF J;  2F4M B;  2PX9 A;  5IP6 A;  4E7Z A;  2R7R A;  3QPH A;  3A2K A;  4I76 A;  2DOD A;  2VOP A;  3BP8 A;  5LBQ A;  1X3W B;  4UVA A;  4RDU A;  4HF0 A;  1O3R A;  3HJE A;  1YS6 A;  2CSO A;  4G7H F;  3U2R A;  1FYM A;  2GA1 A;  2E5N A;  3W6K B;  1LUJ B;  2M3A A;  2H8W A;  2OF7 A;  2A5Y B;  1R36 A;  2X1D A;  1WZ2 A;  5IPA A;  4RB2 C;  3OYN A;  3D1N I;  1ZRD A;  2HYF A;  5FFZ A;  4IOC F;  4KA4 A;  2DA6 A;  3COA C;  3HOY J;  4UUS B;  2E2J J;  5FRM A;  4V2F A;  5M5W J;  2WY8 Q;  3PNT A;  2FE3 A;  1R9T J;  4BBR J;  2QBY A;  1FBS A;  3LSK A;  1W0U A;  3GTQ J;  3CLQ A;  3HOW J;  2HQR A;  3HL2 A;  1SFX A;  1Z91 A;  4OAY A;  4I0A A;  2LY9 A;  3B02 A;  3ECH A;  1APL C;  1OCT C;  4OIQ F;  3M1C A;  2CW7 A;  2CO5 A;  2OCE A;  2ISZ A;  2CWE A;  4XM3 A;  2J5O A;  4C3I J;  4F93 B;  3OIO A;  4GRI A;  3VFZ A;  5BQT A;  2FD5 A;  1Z7U A;  1ZHF A;  2IS2 A;  5HS8 A;  4XBF A;  3A0B C;  1X3U A;  4IHV A;  3A03 A;  2VKD A;  4MIM A;  2K85 A;  2QWW A;  3LQR A;  2BY1 A;  2V9V A;  2PMZ A;  4XLA A;  1OCR H;  3S16 J;  1LPQ A;  1C0W A;  2LTP A;  1MDM A;  4DYC A;  4DIQ A;  5M5Y J;  5HOO A;  1QU3 A;  2P7V B;  3HGY A;  1P7J A;  1XS9 A;  2C6Y A;  3OSG A;  1STZ A;  2M5W A;  4E7I A;  1F9N A;  1I39 A;  3WTX C;  1A35 A;  1IDZ A;  2STW A;  4BUP A;  1TWG J;  2M45 A;  3CJQ B;  3MMY B;  3WHB A;  1NK2 P;  5J47 A;  2DT5 A;  1PJR A;  4L18 B;  3KZZ A;  3HGG A;  2L7F P;  4B8X A;  1R5H A;  3CCE I;  2V1U A;  2F2E A;  3CUQ B;  2XHK A;  1LFP A;  3MZH A;  1USS A;  2OUM A;  2RRE A;  3ZMV A;  4RAG A;  2D1V A;  3K2A A;  3PIP F;  2ZXH A;  4M9S A;  2BEO A;  2ZSI B;  2EK5 A;  3CCQ I;  4M6X A;  2QKL B;  4Z6Y A;  1A6I A;  4LB6 B;  1IN8 A;  2OC6 A;  1R1V A;  3FXL A;  4BXX J;  5HNF A;  2EV5 A;  3NWT A;  2FU4 A;  3CJR B;  3KET A;  2EIL H;  3S2D J;  4XSX F;  2MD5 A;  4ZJZ A;  4F52 A;  2BYV E;  3LMM A;  1MJA A;  2BGC A;  5ICF A;  2LBF B;  2PG4 A;  3GVA A;  3NRV A;  5FKO A;  2JJ7 A;  2HVQ A;  3PFI A;  2UV1 A;  1AKH B;  3KPH A; 
#chains in the Genus database with same CATH homology
 5JLW A;  4AUX A;  4FCY A;  1G2H A;  4BBS J;  3A01 B;  4IHX A;  1ETK A;  1TWC J;  3LNQ A;  5EZG A;  2XB5 A;  4W97 A;  4M3G A;  2HYJ A;  1RKT A;  1UMQ A;  4DW6 A;  5M3M J;  2CQX A;  1MNM C;  3QPS A;  4A3E J;  2CU7 A;  3SFI A;  5FKM A;  1MBG A;  5GPA A;  3CCY A;  2WV1 A;  3BG9 A;  1IJW C;  4J19 A;  2NS7 A;  4BY7 J;  5IP7 J;  1ZR4 A;  2R7Z J;  1XC5 A;  1WGX A;  5IP9 J;  4FE4 A;  5EF6 A;  1T33 A;  3RZD J;  2R0Q C;  1CQT A;  1ENH A;  4FE7 A;  2JK3 A;  2LVS A;  3TP3 A;  5FLV A;  2K9S A;  1E3O C;  2DTZ A;  3GTO J;  3OOU A;  5F1J A;  1MBK A;  1BA5 A;  1S7E A;  1X2N A;  3JRD A;  3Q0U A;  3CMY A;  3BR2 A;  4QSH A;  1IDY A;  3HOX J;  4A3C J;  3PM1 A;  3BR1 A;  2E2H J;  2M9H A;  2CRG A;  1JKO C;  3PO3 J;  1MSE C;  3A02 A;  4C3J J;  3ZQI A;  4A3K J;  1P7I A;  4M3B A;  1YRN A;  3GTL J;  1O4X A;  2TCT A;  3LSP A;  1JUM A;  2LP0 A;  3NAU A;  4DZJ A;  5IOY A;  5M5X J;  3GTJ J;  2VKE A;  2MGQ A;  1F36 A;  1TWA J;  2XGE A;  5C3E J;  5EYR A;  3MKL A;  5FJ8 J;  3MVP A;  3HB9 A;  1IG7 A;  2WB1 N;  1FJL A;  4V2G A;  4W1U A;  3JRC A;  1IV6 A;  1ETX A;  1I50 J;  3I4M J;  2I10 A;  3HOZ J;  2HOS A;  1AU7 A;  4RBO A;  1TC3 C;  1QVT A;  2ECB A;  2K9N A;  4A93 J;  5EGO A;  3S1Q J;  5K7F A;  2M34 A;  2LLK A;  4UUT A;  3MN2 A;  3ZOB A;  4JYK A;  5EZH A;  3Q3S A;  2DMQ A;  3BQY A;  3S14 J;  4M6V A;  1RR7 A;  3IH2 A;  1PUF B;  1WH7 A;  2LKX A;  1ETV A;  2R92 J;  5J1U A;  1IC8 A;  5EG0 B;  2XSD C;  2DMT A;  2JN6 A;  4JX4 A;  4XRM A;  3TP0 A;  3NAR A;  1JGG A;  3BTL A;  5C4X J;  4G12 A;  5J1Y A;  2NVT J;  1ETY A;  1U9O A;  2M0C A;  3HOU J;  5FLM J;  2HDD A;  1QPI A;  2EZI A;  2VPR A;  1MBF A;  5F04 A;  4A3F J;  1HCR A;  4EEF G;  4A3B J;  4FTH A;  2O9L A;  5F08 A;  1AKH A;  1FTT A;  1HF0 A;  2K40 A;  2EZH A;  2P81 A;  2LK2 A;  4MO7 A;  3GTP J;  1QVU A;  4X6A J;  1K83 J;  2E19 A;  1ZTR A;  2B63 J;  5HOD A;  2FQ4 A;  1MBH A;  4Y7N J;  1MBJ A;  2ME6 A;  1MBE A;  1MH3 A;  1RKW A;  3FK7 A;  1B8I B;  2VUM J;  3LSR A;  4A3M J;  2L7Z A;  3CQZ J;  4BY1 J;  2DA3 A;  2AO9 A;  3M3Y J;  2DMU A;  3GTK J;  1FIA A;  3RKQ A;  1OCP A;  1JT6 A;  1WCM J;  3BTJ A;  1ETQ A;  2VKV A;  3L1P A;  2GLO A;  1ZQ3 P;  1Z0X A;  4CYC B;  1VI0 A;  3C2B A;  5E3M A;  2JA5 J;  2GM4 A;  1JTX A;  2MSY A;  9ANT A;  3IH3 A;  4BKX A;  1SFO J;  1X58 A;  2FX0 A;  2R93 J;  2R5Y B;  1GT0 C;  1B72 B;  3S17 J;  2CQQ A;  2DA1 A;  4MFE A;  2D5V A;  3RZO J;  2E2I J;  4A3L J;  5FKN A;  1Y1W J;  2EH3 A;  4MFD A;  2GBY A;  4A3I J;  2KT0 A;  4DZP A;  1MH4 A;  1WI3 A;  3SDG A;  4UUS A;  1ITY A;  1X2M A;  3S15 J;  2CUE A;  2L9R A;  1FIP A;  2NOG A;  3GBG A;  1RET A;  3QPL A;  3RQI A;  4D5F A;  2HXO A;  1D5Y A;  3H3V K;  3ZQC A;  4IHY A;  2NVY J;  5M3F J;  2HOA A;  2E1O A;  4XK4 A;  3JRE A;  3IH4 A;  2DN0 A;  1FTZ A;  2CJJ A;  2KDZ A;  3F0C A;  3BR6 A;  3QQA A;  3HBL A;  3LSG A;  1TWH J;  1ETW A;  2NS8 A;  2ZB9 A;  3M4O J;  5IOZ A;  5E3O A;  1H8A C;  1OJL A;  3HKZ N;  3IV5 A;  1H89 C;  1GV2 A;  1I6H J;  5C4J J;  4AC0 A;  4XID A;  2H8R A;  2Y30 A;  3TW7 A;  1JJ6 C;  1IRZ A;  5GP9 A;  1POG A;  4DYR A;  1LE8 B;  2TRT A;  3E7L A;  3K7A J;  3S2H J;  4NDL A;  3H0G J;  3LSJ A;  1JKQ C;  1ORK A;  4M3F A;  4C2M J;  1U78 A;  2R5Z A;  3SJM A;  4B4C A;  2X9D A;  1T56 A;  2QF7 A;  2W48 A;  3B6A A;  3FIS A;  3ZQG A;  2Y9Z A;  1U9N A;  4B1R A;  3LOC A;  1YRN B;  1NTC A;  3BTI A;  2LD5 A;  1ZK8 A;  1BJZ A;  1QRY A;  3JRI A;  3BR5 A;  5DTD A;  1JUP A;  2HXI A;  1Q1V A;  1U8B A;  1F43 A;  1IGN A;  3ZQF A;  4A3D J;  2DJN A;  4XRS A;  3TED A;  4B3A A;  4FIS A;  2M8G X;  2LFB A;  4DYQ A;  4A3G J;  2O8K A;  3BG3 A;  3GTG J;  1BW5 A;  1MSF C;  4A69 C;  1HOM A;  2IBD A;  2DA7 A;  3BR3 A;  1JKP C;  3FKI J;  3WHC A;  3TW6 A;  3S1N J;  2ECC A;  4M3D A;  1Z77 A;  3B6C A;  2EZK A;  5EGO B;  2XGD A;  2XRL A;  2JMW A;  2JA6 J;  2ID3 A;  1FEX A;  2CUF A;  1VFC A;  2EBI A;  1AHD P;  3O8G A;  1XG1 A;  3VPR A;  1ZGW A;  5DS9 A;  1ZR2 A;  3A01 A;  2DMP A;  1WH5 A;  4IHW A;  4L5E A;  2K9Q A;  4XRS G;  3G1O A;  1EF4 A;  1GV5 A;  2DA2 A;  1HDD C;  1HDP A;  3CDL A;  2NVQ J;  2PMZ N;  5F0F A;  1JUS A;  1RES A;  1BL0 A;  1JT0 A;  4JX6 A;  3Q0W A;  2EQR A;  1K61 A;  4C3H J;  5FKL A;  2XPW A;  3UKG A;  2R5Y A;  2XGC A;  4JX5 A;  2YU9 J;  2HI3 A;  2XPV A;  3HEF A;  2ELK A;  2HOT A;  2MG4 A;  5IYC J;  1WPK A;  1BW6 A;  2M2E A;  2QCO A;  4QTR A;  2COB A;  2LR8 A;  1GDT A;  5JLX A;  5J1R A;  3BQZ A;  3FIW A;  2JWT A;  3ZQH A;  5IYD J;  3FK6 A;  1LFB A;  3JRB A;  1TWF J;  5J3L A;  5IP6 A;  3BG5 A;  2FJ1 A;  4I76 A;  2N8G A;  5FKK A;  4RDU A;  3JRG A;  4ABZ A;  2YUS A;  3JR9 A;  1H88 C;  2AHQ A;  3GTM J;  2WAQ N;  5F27 A;  2G0E A;  4XIC A;  2RAE A;  1UHS A;  1ETO A;  1Y1V J;  5K7Z A;  3DEW A;  2O7O A;  2OF7 A;  3S1M J;  3Q0V A;  5IPA A;  3D1N I;  5K7H A;  4Y52 J;  1JKR C;  2HQ5 A;  4X1E A;  2L0K A;  2JA8 J;  2DA6 A;  5E3L A;  1DU0 A;  2IAI A;  3HOY J;  1LE8 A;  4UUS B;  2E2J J;  4V2F A;  5M5W J;  3HOV J;  1R9T J;  4BBR J;  4I6Z A;  1W0U A;  3GTQ J;  4D7M A;  3HOW J;  4JP0 A;  2OPT A;  4QIW N;  1NK3 P;  2LY9 A;  1OCT C;  1APL C;  1SAN A;  2Y31 A;  4C3I J;  3OIO A;  1JTY A;  4M3E A;  3HDD A;  2FD5 A;  3BTC A;  2Y0S N;  4S0H B;  4IHV A;  3A03 A;  3BR0 A;  3ZQL A;  4MIM A;  1I3Q J;  1PUF A;  3G1M A;  4IEJ A;  1IUF A;  2DA4 A;  1RPW A;  3HM5 A;  5EG0 A;  1A5J A;  3S1R J;  5EDN A;  5EEA A;  2X6O A;  3JRH A;  2DA5 A;  2NVX J;  1ZKG A;  3DCF A;  3S16 J;  2XPU A;  4GFB A;  3PO2 J;  2Y2Z A;  2LTP A;  4DYC A;  5M5Y J;  1UG2 A;  3HGY A;  1P7J A;  1XS9 A;  3OSG A;  3G1L A;  5E3N A;  2DMN A;  2Y9Y A;  3JRF A;  1IDZ A;  2ID6 A;  2EZL A;  2R5Z B;  1TWG J;  4AYB N;  3O8H A;  1GVD A;  1LFU P;  2MW8 A;  3WHB A;  1NK2 P;  3BT9 A;  2VI6 A;  1VF9 A;  1W0T A;  3HGG A;  2L7F P;  5GPC A;  4MLO A;  4LOC A;  2X48 A;  1B8I A;  5F0C A;  5BNG A;  2YS9 A;  3I4N J;  5C44 J;  3K2A A;  3JRA A;  3W6V A;  1OFC X;  2L7M P;  1A6I A;  5IYB J;  2XB0 X;  4CYC A;  1GUU A;  1VND A;  2ME0 A;  4BXX J;  3S2D J;  1HLV A;  5F0H A;  1DU6 A;  2H1K A;  2JA7 J;  1B72 A;  1JJ8 C;  3OSF A;  4D7N A;  4A3J J;  5FKO A;  2JJ7 A;  1AKH B;  4D5C A;  4HNV A;  2IEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...