1BL0A

Multiple antibiotic resistance protein (mara)/dna complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*GP*GP*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*G
publication title A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A01
5IP7J 1FIAA 1ZQ3P 2DA1A 2NS8A 5IOZA 2WAQN 1GVDA 2LP0A 2Y9YA 5M5YJ 1GT0C 4A3MJ 1T33A 1FTZA 1TWCJ 2DJNA 3BTJA 2DMUA 3IH4A 1JT6A 2NVYJ 1MBFA 3QQAA 5EEAA 3HOVJ 2O7OA 3RKQA 2EBIA 3L1PA 2VPRA 1ORKA 5EG0A 9ANTA 1IUFA 2LLKA 1W0TA 1HDPA 2MGQA 2XB5A 3O8GA 3ZQFA 3HDDA 2YS9A 2ID6A 1GV5A 3VPRA 1JTYA 5K7FA 2DA3A 2LK2A 2QF7A 1X2MA 1BL0A 1NK2P 4DW6A 4XICA 3A01B 2L7FP 2OF7A 2E2HJ 1H88C 3SFIA 4Y52J 4W97A 3S1RJ 1ZR2A 1S7EA 3S1MJ 1TWGJ 2X9DA 4D5CA 2K9QA 2X48A 4DYQA 1QRYA 4XIDA 3ZQCA 3HGGA 1OJLA 4UUSB 3RZDJ 2B63J 2CUEA 1ZK8A 3FISA 3I4MJ 4B3AA 2RAEA 1OFCX 2ECCA 1JGGA 2CQXA 3B6AA 4I6ZA 1U78A 4A3GJ 2MG4A 4XRMA 3IV5A 4A3KJ 2FJ1A 1ETQA 4AC0A 2HXOA 3JRCA 1JKQC 4X1EA 1WCMJ 2GBYA 2NOGA 4G12A 4XRSA 3O8HA 3FKIJ 1ETWA 2R7ZJ 2ZB9A 5E3MA 1IRZA 1GV2A 5IPAA 1WH7A 2AHQA 4A93J 2HOAA 1FJLA 1P7JA 3HB9A 3S14J 2KT0A 2TRTA 5C4JJ 3G1MA 2Y9ZA 1MH3A 1E3OC 1PUFA 1VF9A 1B8IA 4B4CA 4JX6A 3CMYA 2L0KA 2P81A 4CYCB 5BNGA 1YRNB 1I6HJ 4BXXJ 5FLVA 3BG3A 5IYDJ 4BBRJ 2JA6J 3M4OJ 4AYBN 2LR8A 4V2GA 1RESA 2VI6A 3ZQLA 1I3QJ 2JN6A 3ZQHA 3B6CA 3BT9A 2EZIA 1IC8A 4IHXA 4A3LJ 2COBA 1EF4A 1GUUA 2IBDA 3SJMA 1NK3P 1SANA 1ETKA 2HXIA 5M5XJ 4A3JJ 2R5ZB 3TP0A 3WHBA 4IHYA 5C44J 2R92J 3CCYA 2M34A 2WB1N 1I50J 2M8GX 4LOCA 4QIWN 3BR5A 1H89C 1POGA 4FE7A 2MW8A 3BTIA 2DA4A 5EF6A 1JKPC 5IYCJ 3ZOBA 3K7AJ 1MBEA 2K40A 4MFEA 3C2BA 4IHVA 1LE8A 2NVTJ 3HOZJ 4XK4A 3IH2A 1OCTC 3Q0WA 2E2JJ 1WH5A 2DA5A 4FE4A 3S1NJ 1XG1A 1F36A 2DA2A 2H8RA 3LSPA 2JA5J 2Y31A 5EGOA 2ME6A 1JKOC 3LSJA 3A01A 1AKHB 3JRBA 4MLOA 5DTDA 1U8BA 4A3EJ 4S0HB 5J1UA 2FD5A 3GTOJ 4M3EA 4MFDA 2N8GA 1MNMC 3BQZA 4L5EA 4V2FA 3GTLJ 2L7ZA 2LTPA 1JKRC 2XPUA 2XB0X 3OSGA 1UHSA 4C3JJ 1HCRA 1K61A 1TWFJ 1ETXA 1BW6A 1UG2A 4A3BJ 4DZJA 1LFBA 1H8AC 4A69C 3JRHA 1D5YA 3JRIA 5E3NA 3G1LA 2L7MP 1RKWA 4RDUA 3IH3A 2LFBA 3PM1A 2JMWA 2HOTA 3JRDA 1FIPA 5J3LA 2XSDC 2DMTA 4AUXA 3GTJJ 2M2EA 1IGNA 1B72A 2LY9A 5C3EJ 2HYJA 5EG0B 1JT0A 2H1KA 1A6IA 2DA6A 3OSFA 5GP9A 3K2AA 3G1OA 5DS9A 3HGYA 3NARA 2IAIA 4JX4A 3QPLA 5J1YA 3S2HJ 5M3MJ 2CUFA 4RBOA 1QPIA 1JUMA 2VUMJ 5E3LA 1VI0A 5FKMA 2O8KA 4M3FA 2ECBA 1JJ8C 5F0HA 1JUSA 3JREA 3FIWA 4CYCA 4DZPA 1RKTA 2EZKA 2L9RA 1YRNA 2E1OA 1SFOJ 2R93J 2VKEA 1ENHA 2DN0A 1XC5A 2R0QC 2JJ7A 1A5JA 5F04A 3GTMJ 1WGXA 3BR3A 5F27A 2PMZN 3DCFA 1O4XA 3WHCA 3Q3SA 2K9NA 4M3GA 4GFBA 3RZOJ 3BTCA 1IJWC 3Q0UA 5K7HA 5F0FA 1HF0A 3TW7A 5EZGA 3PO3J 2XGDA 2LKXA 1T56A 5IP6A 3E7LA 1XS9A 3ZQIA 3FK6A 3MKLA 1GDTA 1ITYA 3GBGA 5JLXA 2GLOA 2WV1A 2Y2ZA 3BG5A 1MBJA 2M9HA 5FKLA 4BY1J 2CU7A 3RQIA 3GTKJ 1MSFC 2D5VA 5C4XJ 2NS7A 3MN2A 4IEJA 1Z77A 1PUFB 1B8IB 4JX5A 3H3VK 3LOCA 3BR0A 4M3DA 1Z0XA 5FLMJ 4D7NA 4QTRA 2DTZA 4DYRA 3JRFA 1FTTA 3HOXJ 4FTHA 1ZKGA 5GPAA 4D7MA 1G2HA 2EH3A 3JR9A 3ZQGA 3D1NI 1IDYA 2DMPA 3S16J 5IOYA 4BKXA 2G0EA 3A03A 5GPCA 2DA7A 2K9SA 2FX0A 4J19A 4JP0A 3S17J 5FKNA 1HDDC 1FEXA 2R5YB 5F0CA 1AHDP 1ETVA 1Y1WJ 1R9TJ 2E19A 3GTPJ 3M3YJ 4A3DJ 4C2MJ 2HI3A 2HOSA 1MBKA 1U9NA 4B1RA 1K83J 5JLWA 4IHWA 2FQ4A 3F0CA 1WPKA 5EZHA 3TP3A 5E3OA 1RPWA 4MIMA 1HOMA 2I10A 4NDLA 5IYBJ 4UUSA 3HBLA 3UKGA 2XPVA 3Q0VA 4Y7NJ 2X6OA 4A3CJ 3HM5A 4MO7A 1ZR4A 2TCTA 1BA5A 2ME0A 4I76A 1LE8B 3BR2A 3DEWA 2XGCA 1F43A 2XPWA 4FCYA 1HLVA 1JTXA 1Q1VA 2OPTA 3HOUJ 2KDZA 1MBHA 2Y30A 4W1UA 4FISA 1TWHJ 3HKZN 3H0GJ 2DMQA 1Y1VJ 3TEDA 5EGOB 1APLC 1TC3C 2AO9A 2IEKA 4EEFG 4XRSG 5F1JA 1W0UA 1IV6A 5EDNA 1DU6A 4JYKA 5K7ZA 3BTLA 2EQRA 3CQZJ 2NVXJ 4BBSJ 2EZLA 1X58A 2JK3A 4UUTA 2YUSA 1U9OA 4M3BA 2JWTA 1X2NA 1ZGWA 3NAUA 2M0CA 5FJ8J 3LNQA 3S2DJ 2HDDA 2NVQJ 1VFCA 1QVUA 1ETOA 1MH4A 3PO2J 2YU9J 1VNDA 2JA8J 1JUPA 1QVTA 3A02A 2CRGA 5M5WJ 1BW5A 3GTGJ 3CDLA 1IDZA 1MBGA 3FK7A 1B72B 3JRGA 3LSGA 1AU7A 3OOUA 4A3FJ 2GM4A 5FKKA 3HOWJ 4BY7J 4QSHA 2R5ZA 1RETA 2LVSA 2CJJA 1OCPA 2EZHA 2O9LA 2QCOA 1CQTA 4C3IJ 2MSYA 3HOYJ 5M3FJ 1UMQA 3S1QJ 2LD5A 3I4NJ 3HEFA 3BR6A 2XGEA 3TW6A 5HODA 2ID3A 1DU0A 1JJ6C 1LFUP 1IG7A 2W48A 5FKOA 3BR1A 3BQYA 2ELKA 3MVPA 5IP9J 1P7IA 5EYRA 1ZTRA 4A3IJ 2Y0SN 2DMNA 2JA7J 1ETYA 2CQQA 1RR7A 3LSRA 4HNVA 1TWAJ 4M6VA 4D5FA 3S15J 2XRLA 3QPSA 3OIOA 3W6VA 4DYCA 3GTQJ 5F08A 2R5YA 1NTCA 1MSEC 3BG9A 2VKVA 3JRAA 2HQ5A 1WI3A 1AKHA 3SDGA 5J1RA 4C3HJ 4ABZA 4X6AJ 1BJZA 2E2IJ
chains in the Genus database with same CATH superfamily
1KGSA 3H9QA 4PUSA 1ZQ3P 3C2HA 3AFHA 1BI0A 1D5VA 3BP8A 5ED4A 4KIFA 2VXDA 4RGUA 5IOZA 3M1CA 2KL4A 4BJ6C 2WAQN 4ZTFA 1R36A 2FBKA 1ZREA 3BROA 1O7LA 5M5YJ 3LSKA 1Z91A 1VQ7I 5ICFA 2L9VA 3P9CA 1FTZA 5KK1A 2HFHA 2JRTA 3REOA 2YSRA 2FU4A 1FOWA 4IF4A 5FLXZ 3RKQA 3IAS2 3PQJA 2EBIA 1R5GA 4OU0A 4E7SA 3L1PA 5F6FA 2DPDA 1W5TA 1PJRA 3W6JB 3WGHA 2VBWA 2VPRA 5EG0A 3CO7C 2CQNA 3FHNA 4PGGA 4A5NA 3GZ5A 2FF4A 1KONA 1GV5A 5JFRA 4UB6C 1WVRA 1Y8RB 2MH2A 2OAZA 4PFOA 4AU7A 2DJIA 3FXQA 1UHMA 3HSFA 2QGUA 1X2MA 2QF7A 4IJAA 3TO7A 1NK2P 2COMA 2J5PA 3L09A 1G3TA 2Y48A 1WWXA 1ZAOA 3PSIA 5HS9A 2LKPA 1H88C 3SFIA 3S1RJ 1ODDA 2QBYA 4RGRA 2JRMA 4XSXF 2D1VA 3LFUA 1RUOA 4F52A 2HYGD 3F22A 3PJRA 3A4CA 4ZYAA 3FISA 3J81Z 1MJAA 3I4MJ 1JGGA 2RAEA 1OFCX 2UUZA 1U78A 4WF2A 1LB2A 4L18B 4XRMA 1G59A 1LDDA 1OCRH 2NAZA 3CCLI 2R4GA 1ETQA 1PUEE 3EUAA 4ANJA 1EA3A 2LC2A 1LEBA 3HKZA 1JKQC 2X6XA 4X1EA 2R7UA 2GBYA 2NOGA 3GZ6A 2CSOA 2E35A 2E1MC 1B1BA 4NB5A 4G12A 3PUFA 1U5TB 1TNTA 3FKIJ 1ETWA 3FMRA 4RGXA 2ICWG 1YTYA 2R7ZJ 2M8EA 2Z99A 3S3OA 1GV2A 1UAAA 2D45A 3TDZC 1OYYA 1CGPA 2XUBA 3EPZA 1FJLA 3IRRA 3HB9A 3K4JA 2KT0A 3ULQB 3C7JA 2Y9ZA 1VF9A 2VKHA 3HSRA 3KZZA 4ZYGA 4LMYA 1KA8A 2CFOA 2XAGA 2HOEA 2EFWA 2L0KA 2P81A 2OC6A 2VBXA 2QEXI 2Q0OA 1KYZA 3RTRA 2LREA 4Y33A 2OJED 1BC8C 4FQGA 3M4OJ 4M6YA 4AYBN 4ENNA 2LR8A 3BCBA 4EM1A 4V2GA 1RESA 1I3QJ 2JN6A 5JVTA 1ERDA 1HA8A 3CUQB 3BT9A 1RZ4A 1FMWA 1Z6RA 2LRDA 5CQEA 1X1PA 1GUUA 3B02A 3IAM2 1SANA 2V9KA 1NK3P 3SFZA 4XLNF 1ETKA 3F8BA 5M5XJ 4A3JJ 3ZMVA 4ITVA 1K6OA 2CS3A 2HPMA 3JW4A 1H9GA 2K3PA 5C44J 3CCYA 4BU2A 1N75A 2M34A 2FE3A 2JVGA 2WB1N 1I50J 2M8GX 5K1YA 2QA4I 4QIWN 2GIVA 2HU9A 3UNGC 1MZBA 1T8IA 2QSHX 1RNLA 1OCOH 5JR3A 4IKFA 4D9JA 4FE7A 4E7KA 3DLLF 2XKOA 3MCZA 2VQCA 3CDHA 2Y0SA 4E7LA 2NVTJ 1IO2A 1SMYF 1KYWA 1LVKA 2DOFA 3U21A 3HOZJ 5EEHA 3SYTA 3SEQA 3Q0WA 5EJCA 4KT5C 4FE4A 3T8TA 1XG1A 4QPOA 3N05A 2DPUA 3LQQA 4RB3C 3DPTA 1LDKB 3DWLE 2Q8KA 3FDYA 3I59A 5KCMA 4BEHA 4S04A 1S29A 1AKHB 4U0VA 2ZFUA 2I5UA 2VL8A 4UHTA 4A3EJ 2F5CA 1MNEA 3CCJI 3GTOJ 2N8GA 3DEEA 3GTLJ 4E7ZA 2P6SA 3CC2I 3DTKA 4LG0A 3L7WA 1YIOA 4PGHA 1K79A 3OSGA 2BVMA 1P4XA 3K10A 1K61A 4LK0F 2RNGA 1ON2A 2FBIA 3F8NA 1YYVA 5D6FA 1L3LA 1H8AC 2EA2A 3H3ZA 1P6RA 4EJTA 1D5YA 2R7RA 4HDVA 4KDPA 1BOBA 4II2A 3G1LA 3OYKA 2HTJA 3QYBA 3I55I 1RKWA 2QZ8A 4M6XA 1FC3A 2FXAA 1ZG5A 3PM1A 4OIQF 2XGXA 3DKXA 1ON1A 1FIPA 5J3LA 1JI8A 5J40A 3ABLH 3GTJJ 2M2EA 1B72A 1A36A 2LY9A 4K2EA 5EG0B 2HPIA 4U0WA 1STZA 5GP9A 4IX7A 4C2UA 2IRFG 1WJEA 3GCMA 1YW7A 4EGZA 1D8KA 1V4RA 1MMNA 5M3MJ 2CUFA 4KISA 2ELJA 1JUMA 4UXNA 5FLXK 2VOPA 5H6RA 1U0JA 5LHHA 2CUZA 4M3FA 3K1MA 2P8TA 5D5WB 4AIHA 1QHGA 2ZXWH 1TQIA 5F0HA 2FEZA 4LITA 5JI6A 4CYCA 2QBYB 3BG7A 4OOIA 5GADJ 5KVRA 4IRHA 2R0QC 2JJ7A 2DQLA 5F04A 3S3NA 4I7HA 4P5OA 1H0MA 1GHCA 3A0HC 3BR3A 4I01A 5KAFC 2PMZN 1O4XA 1J2XA 1E2XA 2BZTA 4IO9F 3F9KA 3M8EA 4HSRA 3R60A 2O8XA 4LLNA 1J09A 1IAWA 2IJLA 1T56A 1LJ9A 4NNJA 4HF0A 1XS9A 2KDOA 4I0AA 3C2GA 3VWBA 5HLGA 3MKLA 1GDTA 1ITYA 2BE5F 3BZCA 2OA4A 4ZDOA 5IT9Z 2WV1A 4HF1A 1MBJA 2VE8A 2M9HA 3LAPA 3L2QA 4BY1J 2ZKZA 4BJTA 1UCRA 2CU7A 2F4MB 4Y4RA 2NS7A 3MN2A 2STWA 4RB1A 3ZMZA 4ZZLA 4B47A 2ZJRF 2O3FA 3LOCA 1Y39A 1SC7A 2IW5A 2NOJB 2KJCA 4DYRA 4F92B 1XTAA 2XV4S 1ZKGA 4UVBA 5GPAA 3FXRA 4FT8A 1G2HA 4YFKF 3OYJA 1B4AA 4XKCA 5E8GA 3GUDA 3HSEA 1FOKA 1VQ4I 3QOEA 2QLZA 1AA7A 3HPHA 1BIBA 4BKXA 2G0EA 3A03A 1TT0A 5ILSA 4LD5A 2K9SA 2FX0A 3KIOA 3ABKH 3S17J 3MFKA 3J7AO 2R5YB 2P7VB 2E19A 1W5SA 1D3YA 2L2OA 1R49A 2F4IA 3QRFF 2D2WA 2OCEA 1XMAA 5TISC 2WY7Q 1A35A 1WPKA 5EZHA 3V4GA 1RPWA 1HOMA 4UUSA 3UKGA 3HBLA 2XPVA 3Q0VA 2QQ9A 2X6OA 4MO7A 2TCTA 2JPBA 2ME0A 5B1AH 2BXYA 2Q2EA 1F43A 4A6EA 4KA4A 2KJBA 2XPWA 1Q1VA 2V1XA 1MBHA 3GF2A 3LFKA 2ZJQF 2Y30A 4W1UA 1DQUA 2E1NA 1OYIA 1YJ9I 2E36A 5HDKA 2V79A 2DMQA 2ZSIB 4DIQA 3I59B 2HQAA 4BEHB 2LF8A 5HOOA 3L9FA 3WGIA 1OPCA 3S32A 4NC6A 2BY3A 1DU6A 1USSA 1TL8A 3BTLA 2EQRA 3CQZJ 4P96A 4KUMA 4B48A 1X19A 2EZLA 1X58A 4XLCA 3F6VA 1U9OA 4M3BA 3J80Z 1FBSA 1X4OA 2M0CA 1FYLA 5LRRA 2HDDA 1R5HA 5GAEJ 4UVCA 1QVUA 1WJBA 3PO2J 3CD6I 3HZJA 2CWEA 3FXOA 4R1HA 2JA8J 3G73A 1XGOA 3FKJA 4RMNA 1LQ1A 2VQGA 1P4AA 5E1ZB 1IUYA 3VYRB 1Z3YA 1B72B 1KQ0A 3LSGA 4YIIA 4E7JA 4A3FJ 2GM4A 1WJ5A 2CFXA 2RC4A 3S3MA 5AONA 3HHGA 4QSHA 4HDUA 3GW2A 4RS8A 2VASA 3G2BA 4C3IJ 2FRHA 2F5DA 4F91B 1QQIA 3HEFA 1MIJA 2PJRA 2X0LA 3BJOA 2VB6A 4A0XA 5LGNA 5HODA 2ID3A 4MTDA 3ZMSA 1R4MB 3MMYB 1FWZA 2W48A 3CCSI 4XOTA 3MVPA 1XSDA 3OIPA 1LDJA 1JXSA 4CCLA 2ISYA 1ETYA 2KHMA 3T0YA 1RR7A 4FX4A 4N9IA 4RA2A 4IOAF 2W00A 3HTSB 1BN5A 3WU2C 2EFNA 4EV0A 5K5RA 1XDSA 3KX2A 3ZN1A 4Y13A 1D1BA 2VT2A 1NTCA 1W36C 3PNYA 3T1BA 2OV7A 2VC0A 2AXTC 4BJ5C 1WJAA 5DCFA 3PFYA 3GVAA 1WRJA 4XORA 5CVIA 2KRHA 1BJZA 2LDUA 5LHGA 4C30A 1U3EM 1FIAA 2KIUA 4RAGA 2QSGX 5E18F 1F9NA 1O57A 2UZKA 2HYFA 3LSHA 2NS8A 4XBFA 2LY1A 3ASNH 5LGTA 2LP0A 2WC2A 1HXDA 3SQNA 4A3MJ 1IN6A 1Z67A 3K1PA 2QQ8A 3RKWA 3MQ0A 3SEZA 1TWCJ 2DJNA 3BTJA 1HW5A 2DMUA 2LF7A 5FROA 5DV5A 2HWVA 4MGRA 3SZGA 2O7OA 1W7PD 1O7FA 3VSLA 4XONA 6PAXA 3E97A 3F6OA 1SVMA 3FXJA 3OR1C 4XOPA 2LLKA 4CCJA 3K6GA 3ZQFA 3HDDA 1YW9A 4LLLA 2DA3A 2Q1ZB 3OR2C 1Z1DA 2WAFA 3WODF 2V9VA 2XSJC 2JVHA 1VQ9I 5CLSA 1TP4A 2JUGA 1IRGA 1PYVA 1KZHA 1IRXA 4XICA 1IZ1A 1J5YA 4IRGA 3JSOA 2L7FP 3IUOA 1FYMA 1BR2A 3LA3A 2E5NA 4W97A 4IL6C 1ZR2A 1S7EA 1TQMA 4YFNF 3W2VA 4D5CA 3WU1B 2DODA 4DYQA 1S7AA 5F64A 3OS1A 4UUSB 2B63J 2HQRA 4BACA 2OQRA 2DFEA 2QM3A 4AIKA 4PZJA 3CJQB 2DAOA 3TO6A 4B3AA 2W4SA 4GYGA 2Q2EB 3MWMA 2L4AA 2MG4A 3KEYA 2JSCA 3RDIA 4A3KJ 1R1TA 2PQ8A 2BW3A 2VJ5A 2OQGA 5AIPA 4AC0A 3HL2A 5FRNA 3FXUA 2HXOA 2IGMA 5IY5H 5FO5A 4YIFA 1FBQA 3ZN0A 2XF7A 2E60A 4GXOA 4XRSA 2RN7A 3D5SC 1IXCA 5E3MA 3E6DA 4BQAA 1WI9A 5IPAA 2FSWA 3VYTB 4ASNA 1FSHA 1HKTA 4EMSA 2QWWA 3CLQA 1VQPI 1P7JA 1K6YA 4NHJA 3S14J 2TRTA 3RYPA 4OMZA 1E3OC 1MH3A 1EH7A 3KYLA 1PUFA 5J47A 2V26A 2EFPA 3OMYA 3CMYA 3AG4H 4HBLA 3PUBA 3VYUB 2HEOA 5E1XA 5BNGA 4OWRB 1ZG3A 5IYDJ 5H2FC 4CA0A 2VXZA 4XN0A 4BBRJ 2JA6J 4DBQA 1MDMA 2DTRA 4B8XA 4RAZA 2EFOA 3ZQLA 4BYYA 2O61A 2Z3YA 2EZIA 4NC8A 3E6BA 1WJDA 1DGRM 2CV2A 4M72A 3RYRA 2VONA 2O03A 3H0DA 3COAC 3SXYA 1VQOI 3QAHA 3TP0A 4CH7A 2DDAA 5ICGA 3QP5A 4PJNA 3I64A 3FXLA 2KISA 1H89C 1W7PA 1ZH5A 3HUGA 3QP6A 1MW7A 2V7FA 2MW8A 1JKPC 5IYCJ 3ABTA 1AOYA 1YLFA 4IHVA 3L2RA 1LE8A 3GLLA 2E7XA 5D4SA 3CCEI 1SEUA 3CZ6A 3IH2A 2HZTA 2P6TA 4RAFA 2IA1A 4KITB 4XLFA 5LEKA 4LGWA 3IRQA 2LMDA 5D4RA 2H8RA 2GXBA 2RREA 4KICA 2JA5J 1J9IA 3K4CA 4LFUA 3F23A 2ZCWA 3OWTA 5EGOA 2ME6A 1JKOC 3OYLA 3A01A 4LLGF 5ERIA 3JRBA 1R58A 1W5CC 4HPQA 1IXSB 3L2CA 4HYEA 4S0HB 3HYIA 4JBAA 4MQ9F 2L3DA 2ESNA 2CO5A 1HW2A 4V2FA 2XF6A 3FM3A 1JKRC 5AIQA 2XB0X 3GFMA 3CMAI 1N78A 1TBXA 1UHSA 3K4NA 3TMOA 1HCRA 2DLLA 4IHTA 3CUOA 1SAUA 2UXNA 1V55H 1UG2A 1FP2A 3ROUA 1SVOA 3JRHA 5LHIA 1QZYA 1I6XA 5JHUA 3IP4B 3M9AA 5E3NA 2FUG2 2VQHA 3T8RA 4RDUA 3IH3A 4P9UA 4Q5SF 5FD6A 1XB4A 2HOTA 2V9PA 4WXCA 2P7CB 4G9YA 1W1WE 2DMTA 1T98A 2KQRA 2VT3A 4AUXA 4ZTJA 2P0WA 3KLNA 1JT0A 1S3JA 3P9IA 1O3SA 1BR4A 2DA6A 1Y6IA 2HQNA 1DUXC 3AG3H 1K7AA 2K85A 2KP6A 4ZH4F 3WU0A 5DS9A 1V5GA 5DUIA 4OIPF 1Y8QB 1DPRA 4HX7A 2P5VA 1VQMI 2LYCA 1QPIA 2VUMJ 1VI0A 1KU2A 3K1NA 4OAZA 3WTYC 3E5XA 2QUFA 4FX0A 3GLXA 1YRNA 1YW8A 4LG3A 3S8PA 4UB8C 2NXNB 2DYRH 1QO0D 4PFPA 1ENHA 3DLAA 1J7KA 1A5JA 3GTMJ 4ZZDA 2M5WA 5DD8A 2BHYA 4MTEA 5HVQC 4HNUA 3QWLA 1U5TC 2QVOA 2IVMA 3Q3SA 1SMTA 4GFBA 2XASA 5FB2A 1UHWA 5K7HA 2EA4A 4AD9A 1HF0A 1IW7F 1XMXA 5B1BH 2BW3B 3TW7A 3VEPA 3F8MA 4II3A 2OD5A 2LKXA 1I27A 4E70A 4AM3A 3DKWA 2EFQA 2W57A 2WA0A 2WBMA 1YQAA 3GBGA 4G7HF 4YIRX 3BG5A 1MMGA 4L9VA 1IV8A 5TGTA 5FKLA 3EETA 2BVLA 3ZMTA 3WTTC 2X6YA 5DM7F 4CZCA 3C18A 5D8KB 1MSFC 4LK1F 2D5VA 2A6HF 2DFIA 4B3XA 3KP3A 4A0YA 1PUFB 1W36D 3CUQC 4IQ4A 4CCOA 4JX5A 3H3VK 4B09A 3G6EI 2ZO4A 4M3DA 1Z0XA 2DTZA 1FMVA 3HOXJ 2X1DA 2A6TA 2X85A 4D7MA 3KP2A 3KYDB 2A6EF 2EH3A 3K4KA 3JR9A 4DNCA 3G71I 3ZQGA 1QU3A 3SZPA 3D1NI 3H3UA 5HDGA 2DMPA 2L9NA 3S16J 5CYVA 3EYIA 4IVNA 2XAQA 3NQOA 2W1OA 3H5NA 3SHFA 5GPCA 2XC7A 3OS0A 4J19A 3ZQ7A 3ZMUA 5FKNA 2L01A 4YG2F 2VQLA 3BC8A 4IPAA 3GFIA 1AHDP 1BM9A 3S15J 4CUGA 1PVEA 3K0LA 3R4KA 4B43A 4L9NA 3PNTA 4A3DJ 1QA6A 2VJJA 1F1ZA 4C2MJ 2Y69H 2CW7A 3I4PA 2HOSA 2L4MA 5DCMA 1OYWA 1QZZA 4B1RA 4WK8F 2H6CA 1W7PB 2FQ4A 2LBFA 3EUKL 5E3OA 2HGCA 4MIMA 2I10A 5IYBJ 2E1CA 5CVJA 2WWYA 4H4KC 2PLYA 2X51A 4A3CJ 4WXDA 1BA5A 2W24A 4G6TB 3FWEA 4MEYF 4I76A 1YOVB 1LE8B 4CO8A 1F4KA 2A07F 2UXXA 4YEJA 1SD7A 3IWFA 1G3SA 5E1WA 4AVZA 4FCYA 4HQMA 4CZZA 1MJBA 1K4SA 3S2WA 4HEA2 3I56I 4CYDA 3GYHX 1TWHJ 3HKZN 4A12A 4QPQA 3WTUC 4M74A 5EGOB 5J8FA 4HSTA 4OIRF 3HRUA 2K4JA 2G9WA 2Z5UA 3NEUA 3WE3A 4MQVA 1RR8C 5FRMA 1OKRA 2OZUA 3E1SA 3QPHA 1X3ZB 4S05A 1W0UA 5EDNA 1TLHB 1W4MA 3DV8A 5B5EC 1P2FA 2ZMEC 2IS6A 2JK3A 3P9KA 2YUSA 1HBXG 4BHBA 3LSTA 1BBYA 1WJCA 3KP5A 3P7NA 5BPDA 3NAUA 2R7XA 3S2DJ 2DK5A 2ELHA 3PSFA 1BIAA 4HRIA 1TQPA 2ETHA 1MH4A 3OYDA 3OYAA 1JUPA 2LH9A 2DK8A 1BW5A 3HRTA 4HNTA 2BYVE 1UFMA 2CQ7A 3FK7A 1HKSA 3GFJA 4CCMA 1HKQA 4R8HA 3IC7A 3OOUA 2M0MA 3HOWJ 5FKKA 3RCOA 2W85A 3WG7H 1YX3A 3CF2A 5HNHA 3CCUI 1UB9A 4BY7J 1YO5C 2K86A 4XSZF 3IKVA 3V42A 2O9LA 3LSMA 5H6QA 2BHZA 2ADUA 2ZSHB 4UVAA 3S1QJ 1XX5A 1X3WB 2GZWA 4MNUA 1ZRDA 3I4NJ 3LSIA 3E3VA 3BR6A 2R7QA 1G8XA 3TW6A 2PMUA 3AL0B 2K4BA 4JQFA 2EIKH 1IG7A 2CUJA 2P5KA 4PJ0C 2K02A 3BR1A 4CHUA 1X1AA 3BQYA 3ZMDA 3CCQI 2ELKA 1QNTA 1NG6A 2GQQA 2X4HA 3L00A 1FBUA 1ZTRA 4A3IJ 1KU3A 2Y0SN 4XKVA 2L02A 2DMNA 2JA7J 1D0XA 2CQQA 4ZC3A 2E71A 4HNVA 4M6VA 3OL4A 2RKHA 3QPSA 2NNNA 3W6VA 2R7DA 3V7SA 3HHHA 3GTQJ 2M45A 2MA3A 2ZJPF 1P9QC 4C9YA 5LRSA 2P5LC 4I02A 1I1GA 3JRAA 1WI3A 2M4KA 4C3HJ 4ABZA 2KIMA 3DQVC 3JSPA 4X6AJ 3TL4X 3I9V2 2E2IJ 5IP7J 3MKWB 4UY8I 5DEQA 4BE2A 4F55A 4PJMA 5CJ9A 4KT6A 3V8JA 3PNVA 4AIDA 1LPQA 4BQNA 2Z1DA 2Y9YA 4ZDLA 1GT0C 1T33A 3BOQA 4Q47A 2IP2A 2CMPA 4XM3A 2EWNA 3LWFA 4BAYA 2NVYJ 1MBFA 1SD6A 3DFGA 4G94A 1BOAA 5HLTA 4YFXF 2V1DA 3RKYA 3H92A 2VBYA 3H9GA 3ZXSA 2EV5A 2Y75A 3OYEA 1Z7LA 2RVCA 2G7HA 5L3FA 1ORKA 4HLYA 4NC7A 2F5VA 3HPGA 3TOAA 4EGYA 3KP7A 5DD4A 4CGZA 1FZPB 1HDPA 2MGQA 3BJ6A 2ID6A 1JTYA 2AS5F 2XDVA 4BE1A 1FPQA 2EILH 1G4DA 2KIQA 2JZYA 5CQGA 3KZYA 2F5FA 5KAIC 4DW6A 1D1AA 1HSJA 3NWTA 4U87A 1ZGAA 3BPXA 2AQFA 3JAMZ 4Y52J 2IS1A 5K5OA 1TWGJ 4XKWA 4MEXF 2QQAA 5DCMB 2K9QA 3F3XA 5H20A 2Z16A 2X48A 4LG0B 2LBFB 2B7EA 1GXPA 1QRYA 1KQ8A 3I3LA 1V3FA 4G6QA 3ZQCA 3HGGA 2XVCA 3QYEA 3RZDJ 2CUEA 2RGVA 4LJZF 1MMAA 1ZK8A 1FYKA 3MZ8A 1IXRC 1T0FC 1N77A 5LEJA 2ECCA 3TQNA 1LUJB 2CQXA 3B6AA 4I6ZA 2EIMH 4I2OA 1FOYA 3VSKA 2W25A 1C0WA 1OR7A 1U2WA 1R5ID 2FJ1A 3JTGA 5GAGJ 5BOXA 1JE8A 2MD5A 3F72A 1R7JA 4GGGA 2YU3A 4EJUA 3PIPF 1YX5A 1R6RA 3O8HA 2MLGA 2G7UA 2WTEA 2EPFA 3CTAA 2XRNA 2ZB9A 1IRZA 2K9MA 2HVSA 2AHQA 1SD5A 4A93J 2FNAA 2HOAA 1HQCA 2QSFX 4BXFA 2JA2A 3QU3A 2OTLI 4V19K 3G1MA 3OYNA 1B8IA 2BY1A 3EYYA 3W6KB 4B4CA 4JX6A 5HLHA 1X1CA 3BWGA 2OTJI 4CYCB 4BXXJ 4XQFA 5B3SH 5FLVA 1AWCA 2OZ6A 2L5QA 5L3CA 3OYCA 5GTIC 3F8FA 3QODA 2J5OA 2MD0A 1T2KA 2VI6A 2LNBA 1TT5B 1SFEA 3B6CA 1IC8A 4A3LJ 3A0BC 2COBA 2TDXA 4XLHA 1IRFA 2LSOA 3CCMI 2DQRA 2LG4A 2VOOA 2XIGA 1WFXA 2Z9OA 2EIJH 4ESJA 3F21A 3VFZA 4O5VA 1WSUA 2R92J 3U2RA 4E4HA 4KMUX 3HRMA 3HOSA 4LOCA 3DXJF 1I3AA 2DW4A 1POGA 4NBQA 4G8XA 3I58A 1ZRCA 2PFBA 2DT7B 3GFLA 4M9SA 1ULYA 3BTIA 5ICCA 5DM6F 2DA4A 3KETA 1KU7A 1VQLI 3VODA 3K7AJ 2CV0A 4MFEA 1QZEA 1D1CA 4F93B 3J7AY 3BJAA 1Z6TA 4M73A 1ZG1A 2YX7A 4XK4A 2E2JJ 1YFHA 3S1NJ 2XROA 3E6CC 3H36A 3LSPA 4O3MA 1R1VA 3ONQA 1K78A 1YS7A 1N25A 4BUPA 4U7DA 1JHHA 2HVQA 3LSJA 4C2TA 1TTYA 1LVAA 3AAFA 4MLOA 1EV7A 3K4LA 5DTDA 4RLFA 1U8BA 3GZNB 2FD5A 2IGKA 3DEUA 1X4PA 2KMUA 4MFDA 1MNMC 1XCVA 4L5EA 4KIBA 3AKZA 2L7ZA 4D1QA 1ZYRF 1Z05A 2XPUA 2IA2A 4AWXB 2DBBA 4E7IA 2WAQA 4OMYA 3WTXC 1TWFJ 3OYFA 4BDYA 3QU6A 3L2UA 1BW6A 1B9NA 1LFBA 4LB6B 4KN4X 5TRDA 2KPMA 3JRIA 4GRIA 3ML6A 2F5EA 4DGWB 1G3YA 3KLOA 2LFBA 3MKZA 2L54A 3M8FA 3JRDA 1JGSA 3ELKA 2XSDC 4G7OF 1YHQI 5C3EJ 5HDNA 4AVPA 1A6IA 2GA2A 1SD4A 5D5VB 3OSFA 4CXFA 3K2AA 1FY7A 3J7YJ 2HTSA 2FMYA 2BEOA 3NARA 1R22A 2IAIA 3CLOA 3KEOA 3WE2A 2OU2A 3QPLA 3S2HJ 4EATA 4RBOA 3KYCB 5FD5A 5E3LA 1QHHD 2VODA 5FKMA 2O8KA 1XN7A 2ZXHA 1JJ8C 4E7HA 4P9FA 1JUSA 2RQPA 4DZPA 2EZKA 2L9RA 4XLEA 2E1OA 2F6CA 1SFOJ 1DGWY 1ONVA 3LA7A 3PQKA 3TDUC 2MC3A 3KP4A 2MC4A 5F27A 1Y56A 2M7BA 4PJJA 4Q48A 2K9NA 5CPRB 3IKTA 5L3BA 4KNYA 3RZOJ 4DQ2A 3JAMK 5CVVA 3C1DA 1IJWC 1SVLA 5F0FA 3CJTB 1XD7A 1T6SA 3WG9A 2WY8Q 4BXUA 2DU9A 1VQ5I 3PO3J 2XGDA 2ISZA 1FNNA 2UWMA 2KRCA 3FK6A 3GMEA 1IN7A 4A5MA 4QWQA 1P92A 3JTHA 3KEQA 4OAYA 1PP7U 2ZC2A 3BPVA 4MHGA 3I71A 4PJLA 2BY2A 3GTKJ 2DFFA 1I5ZA 2ZNYA 1SFXA 5C4XJ 1H9TA 4IEJA 1Z77A 2DFHA 3K9TA 1B8IB 2QQBA 3EQLF 2PJRB 2F4OB 4IZZA 1XDUA 2ZXIA 2H1LA 2KRFA 4A2UA 1FP1D 1YI2I 3BR0A 5KHDA 5FLMJ 2GOMA 4D7NA 3JRFA 2IGOA 5DYMA 4FTHA 4EM2A 1ZELA 2O0YA 3JCUC 4AYBA 4BL0B 2GXGA 3E0JB 5ICEA 1IDYA 2W84A 4L0YB 2FNPA 3ERED 3RKXA 4UV9A 4HX8A 1PDNC 3FBNB 2IGNA 5E79C 2DA7A 2KFDA 1Z7UA 2PJPA 1HDDC 1FEXA 2NVUB 4P55A 2RQQA 5F0CA 1ETVA 3ECOA 3DBHB 1E17A 3OY9A 5HS8A 2W82A 3GTPJ 3M3YJ 2WB1A 2M30A 3AG2H 1TW2A 3LL7A 4M9ZA 4CICA 2D1HA 1UELB 1U9NA 5JLWA 4I09A 4F7ZA 4RAYA 3CDIA 3IHUA 4HQEA 3ZGKA 4JK1X 4PK4A 4XR6A 4HX4A 4NDLA 3K70C 4CCNA 2A61A 3HM5A 3I0TA 4RLQA 5ILUA 1ZR4A 2H09A 2ZMEA 3KE2A 3E6MA 3F8CA 3R0AA 2XGCA 3BG6A 3IL2A 1Z21A 4UV8A 3V8LA 3CF5F 1BI1A 4HZFA 1JTXA 3K4BA 2BY0A 4BE0A 2JSPA 3D5LA 4FISA 1UZCA 2L9SA 3FXMA 5HS7A 4D0PA 2F2EA 3H0GJ 1K78B 1Y1VJ 1HSTA 2NYXA 2W7NA 2AO9A 5EEGA 2A5WA 1R4NB 2IEKA 3OL3A 5CKTA 4EEFG 4XRSG 2YR2A 1REPC 4QLCU 5F1JA 4XN3A 1IV6A 3VDXA 4PCQA 1WJFA 3MD2A 4JYKA 5K7ZA 2R7SA 5JHFA 2K3FA 2NVXJ 2CG4A 4A0ZA 2CV1A 3FXKA 4BBSJ 3R0JA 2E1MB 2LY2A 3I54A 4IXAA 4J00A 1R23A 3QYFA 4IQJA 2QYOA 1YIJI 1ZGWA 3LNQA 5LLQA 4UUVA 4M71A 2NVQJ 1D8JA 1VFCA 1WHUA 2BBYA 1BI3A 1ETOA 2YU9J 3A02A 4FETA 4ZYDA 3MAJA 4BHCA 1MNDA 2R7TA 3GTGJ 3CJNA 1IDZA 1QPMA 3HRSA 1CF7A 3MZHA 1O3TA 3O6BB 2STTA 2AQEA 2P4WA 1AU7A 1LKXA 2DO7A 5A2QK 3G3ZA 1YE9A 2MFZA 2QKMB 4I99C 3CC4I 2MYSA 2R5ZA 2LVSA 2CJJA 4U88A 1OCPA 1O3RA 1VQKI 1CQTA 5J4YA 4LIUA 2LD5A 2HDCA 4DBRA 2XGEA 3SDBA 3CP2A 5FKOA 5K5QA 3G4SI 2R7FA 2B0LA 2K7LA 2KIFA 2VLAA 5J6XA 4TV7A 1M1EB 3X2QH 4L9JA 3S93A 2RV8A 3U1KA 2DT6A 3ZRGA 1SAXA 2OUMA 2PMZA 4NUBA 3LSRA 5DDGA 1MKMA 1ZLJA 3OIOA 3KFWX 3ECHA 4DYCA 2H94A 5F08A 4BQQA 2R5YA 1MDMB 3BG9A 3KZIC 2PMHA 1E3PA 5E20A 4BQOA 3SDGA 5J1RA 4XLPF 1JHFA 4U0YA 2IS2A 3QPTA 3NWSA 2FBHA 2GIZA 4HA8A 3OS2A 4GDFA 2DA1A 4ZYHA 3ESWB 2DI3A 1X3UA 5KNLA 2IT0A 3H5AA 3EUHC 1GVDA 3OYMA 2FOWA 3GX4X 4XLAA 2MABA 4RB0A 2E5ZA 2IA0A 3BZ6A 3IH4A 1JT6A 4FHTA 3QQAA 5EEAA 3HUGB 3HOVJ 1IN4A 2R7WA 3E5UA 3QOPA 4LIVA 3OYHA 3UR3C 3CC7I 2GA1A 2JT1A 2WAEA 9ANTA 1IUFA 2V1NA 2ZJ2A 1QBJA 1VQNI 2V1UA 1W0TA 2DOAA 2XB5A 3O8GA 4M9XA 3CO6C 3BLYA 1T0FA 2YS9A 1ZARA 3VPRA 4EVIA 2LOOA 2Y0MA 2VE9A 5K7FA 2FMLA 3U9GA 2LK2A 2M4GA 1NG7A 2O6GE 1BL0A 1S8NA 3NRVA 5BMZA 4RM2A 3A01B 3ZQQA 2OF7A 2E2HJ 2HDWA 1XGSA 3TBIA 3MKYB 3S1MJ 2JTVA 2X9DA 4HV5A 1VTNC 3ZR8X 3MZYA 3BY6A 3OOPA 3W2WA 2PEXA 4DJAA 4XIDA 1OJLA 1X1DA 3PL8A 3DU6A 1WKMA 3ZCOA 2A5YB 2XHKA 2ZMEB 1FSEA 2WADA 4IHSA 3Q9SA 1YG2A 1UJ8A 4WX9A 3FMQA 1BC7C 4A3GJ 3CP8A 2M1BA 5CVUA 2EK5A 1OCZH 3O3KA 1GVJA 4A6DA 3IV5A 3RI4A 1Y0NA 1XMKA 4OIOF 2BOLA 3DP7A 5TJJA 3JRCA 4KN7X 5IT3A 4G7ZF 1XCBA 1WCMJ 3GO5A 3FHZA 1E0EA 1PP8F 4ZDPA 5CVRA 1S6LA 1LFPA 1Y0UA 2VJIA 2F48A 3Q9VA 2QENA 3I5UA 1WH7A 1XSVA 5D5UB 4HF2A 1RUNA 3J7ZI 1B59A 3RIRA 3GEZA 2EJRA 5C4JJ 2NNYA 1IN5A 2VBZA 4KIGA 4BHPA 3WGGA 1J0RA 1SFKA 5L3EA 1VZ0A 3I53A 4Y17A 1NHAA 3K69A 4IOCF 2MH9A 1YRNB 2M87A 1G3WA 1I6HJ 3KP6A 4Y15A 4N0BA 3BG3A 2CW0F 2JUCA 4NQWA 1TNSA 5B66C 3AG1H 2H27A 1EH8A 5E8IA 1OQYA 3ZQHA 3WTZA 3T5XA 1CF7B 4CSWA 3V8KA 3AL0C 3HG9A 4IHXA 1S5LC 3RPQA 3DPLC 3MEXA 3DTEA 1EF4A 1NH3A 3P5JA 4RGSA 2IBDA 1RI7A 3SJMA 1RIOH 3J81K 2HXIA 3RSNA 5GAHJ 4FASD 2R5ZB 1R1UA 2GXAA 3SZTA 2X1EA 1RC9A 4WXHA 3WHBA 3N4MA 5LGUA 1XGMA 4JOMA 3N97A 5FFZA 2OBPA 2ESHA 4WCGA 3CCRI 3M8JA 1ZRFA 4IHYA 4OINF 2VC1A 2GOXB 1MD0A 1X1BA 3TGNA 2EV0A 3BR5A 3A2KA 4I98B 4XL9A 1ZLKA 1WQ2A 4ESFA 3WTWC 1EH6A 4ENJA 1TW3A 2K27A 5EF6A 2K9LA 1Z9CA 1V54H 3ZOBA 3LA2A 5FFXA 1MBEA 2K40A 3C2BA 2M7AA 1OLTA 4BGDA 1LNWA 2FQ3A 5ILVA 1KQ9A 3FM5A 3DBLB 2EB7A 1OCTC 2PBIA 4RM3A 3RJPA 1WH5A 2DA5A 3B73A 5HLIA 1T95A 4KFCA 1F36A 2DA2A 2YPRA 3VB2A 4YRVA 5F1RA 2Y31A 5J4VA 1YJWI 1MMSA 4GCVA 2PI0A 3W2AA 2BV6A 1S7OA 3K70D 3HOTA 4XNFA 1BI2A 5J1UA 2ACJA 4KYWA 1UG0A 4M3EA 3CESA 3M1EA 1I39A 3BQZA 4BNCA 3FF5A 2LTPA 5D8LB 1T39A 2XAHA 3HJEA 1HC8A 1P4WA 5LFAA 1WZ2A 4C3JJ 2VPLA 2C6YA 1ETXA 2UV1A 4A3BJ 4DZJA 2R3SA 2JQ7A 4A69C 3VOEA 4WWCA 1J59A 1OMIA 2A69F 3BZKA 4B44A 2V4JC 2L7MP 2MLKA 3CCVI 4R79A 5J8CA 2JMWA 3FBIB 4O6JA 3Q5FA 4PSWA 2DCEA 1IGNA 2HYJA 2H1KA 4HW0A 3ISPA 3ZP5A 1BJAA 4HV6A 1A04A 3BCAA 3EDPA 1E3HA 4Q4ZF 1T08B 2DYSH 3G1OA 3HGYA 3DKYA 2HVRA 2PN6A 4JX4A 2HZDA 5LBQA 1L0OC 2CGPA 5J1YA 4N4OB 1HW1A 5HNFA 4ENMA 3HIFA 2ECBA 1Q1HA 3JREA 3FIWA 2H6BA 1RKTA 4YELA 1FLIA 1GXQA 2NS0A 2VKEA 5L3GA 2DN0A 1XC5A 3C3WA 2R93J 5JVGF 1EKEA 4KMFA 3ERMA 1MJ9A 5L3DA 4L9TA 4EM0B 1WGXA 2MBFA 2XKPA 1IN8A 2M3AA 4IRIA 3GWZA 1MMDA 3DCFA 3WHCA 4M3GA 1V5FA 3FMSA 2H8WA 1XSXA 3BTCA 4XMYA 4ESBA 3OYGA 3ZPLA 3Q0UA 4EQQA 4H0EA 3R6SA 3ASOH 4GYIA 1S72I 2O5RA 2HS5A 2XF5A 1TZLA 3LQRA 1VQ8I 3OYBA 1RRJA 5EZGA 2FA5A 1Z3XA 5D6EA 3OV8A 3RQ4A 5IP6A 3E7LA 1ZGJA 2CQKA 3ZQIA 2DXIA 4N9HA 1ZHFA 4GO1A 5JLXA 4AIJA 2Y2ZA 2RNJA 4KJZA 2GLOA 4EJOA 2IXSA 3DBRB 4U7BA 3H1CA 5DUKA 2ZXJA 4ZJZA 3H35A 3RQIA 3WTVC 2BGCA 4PDKA 2JPCA 3L2WA 1ACIA 2X1CA 2QKLB 4ETSA 2B9SA 4HLXA 2HR3A 1MGTA 4QTRA 3LMMA 1FTTA 3M07A 3M7GA 1VQ6I 3CJRB 3DU5A 2ZBKA 4LB5A 4HG2A 4NQWB 1OISA 3CMEI 3RPUD 1T38A 3CMMA 2CH0A 1F5TA 2VN2A 2WV0A 3FZVA 2IS4A 5IOYA 1I1SA 4JP0A 4EJVA 1OCCH 2ZNZA 4E6KG 1U6GA 4Y3OA 5LD2C 1Y1WJ 3KPHA 4P1WA 5E17F 1DP7P 1R9TJ 2XAJA 5BS6A 1B9MA 1B6AA 1IF1A 4N4NB 5BQTA 3PIOF 4L5JA 2HI3A 2HKXA 1A6QA 1FX7A 1MBKA 4BS9A 1K83J 4IHWA 3TKYA 3F0CA 2RDPA 3TP3A 2XAFA 2DDBA 5IT9K 3E5QA 5A2QZ 4Y7NJ 4XKBA 3PFIA 3DF8A 1G6NA 2KLOA 3BR2A 3DEWA 2FOKA 1DP3A 3O2PE 1HLVA 1DDNA 1QGPA 2OPTA 2VIXA 2KDZA 1O3QA 3HOUJ 1V5EA 2R7OA 1FT9A 5GTHC 3HTUA 4UNOA 4PSXA 4I0BA 4X0GA 2YX4A 3IWZA 2NRAC 4J01A 3TEDA 1APLC 1TC3C 1FOXA 4Z6YA 1U5TA 2PX9A 1YITI 3HXLA 3V7CA 1KU9A 3GXOA 5BPIA 3OIQA 2DOEA 3ABUA 2E34A 4L5IA 2XAUA 2A05A 4UUTA 2KKOA 3VYSB 2EINH 2JWTA 1X2NA 4HAMA 4ENKA 5FJ8J 4BDZA 2CW8A 4BH9A 4L0ZB 3R61A 3K4MA 4EJWA 1XGNA 3WTSC 1VNDA 1QVTA 1D0YA 3W3CA 2CRGA 5M5WJ 2I8DA 3ABMH 3D5RC 3CDLA 3CUQA 2ZFWA 1MBGA 2OCCH 4RB2C 2AXLA 1S9HA 3JRGA 2EV6A 1LEAA 4Z2YA 3HC7A 4CCKA 2A68F 1RETA 3K2ZA 2V6CA 1SFUA 3OYIA 2EZHA 4ON0A 3V7RA 1R71A 2QCOA 3BDDA 2E7WA 2GAUA 1BR1A 2MSYA 1UMQA 5D5XB 5M3FJ 3HOYJ 3DPUA 3TO9A 1XPXA 2CYYA 3TOBA 5FGMA 2K5CA 4CDGA 1DU0A 2VKDA 2A3SA 2VJ4A 3LAJA 1LFUP 1JJ6C 3D0SA 2R7VA 1OR7C 3DTIA 3H9JA 1D0ZA 2Z2SB 4F3QA 1GLNA 2PG4A 3FX3A 3A1YA 4XRFA 3RPUA 1U8RA 2GWRA 5IP9J 1P7IA 5EYRA 1ZN2A 3EUHA 1EJ9A 2HKOA 2X6WA 4G6DA 2V6EA 1A31A 4DOZA 1R00A 1YJNI 1TWAJ 1USTA 2DT5A 4D5FA 2XRLA 2L7KA 4HOBA 3L2VA 2Z33A 2HNHA 3U1DA 1J75A 3J80K 1DPUA 2KZGA 2KZVA 1MSEC 2VKVA 2HQ5A 1AKHA 2BXZA 2IPQX 2LKSA 1K4TA 3KCCA 3H5RA 4ZYEA 1YS6A
chains in the Genus database with same CATH topology
5IP7J 1FIAA 1ZQ3P 2DA1A 2NS8A 5IOZA 2WAQN 1GVDA 2LP0A 2Y9YA 5M5YJ 1GT0C 4A3MJ 1T33A 1FTZA 1TWCJ 2DJNA 3BTJA 2DMUA 3IH4A 1JT6A 2NVYJ 1MBFA 3QQAA 5EEAA 3HOVJ 2O7OA 3RKQA 2EBIA 3L1PA 2VPRA 1ORKA 5EG0A 9ANTA 1IUFA 2LLKA 1W0TA 1HDPA 2MGQA 2XB5A 3O8GA 3ZQFA 3HDDA 2YS9A 2ID6A 1GV5A 3VPRA 1JTYA 5K7FA 2DA3A 2LK2A 2QF7A 1X2MA 1BL0A 1NK2P 4DW6A 4XICA 3A01B 2L7FP 2OF7A 2E2HJ 1H88C 3SFIA 4Y52J 4W97A 3S1RJ 1ZR2A 1S7EA 3S1MJ 1TWGJ 2X9DA 4D5CA 2K9QA 2X48A 4DYQA 1QRYA 4XIDA 3ZQCA 3HGGA 1OJLA 4UUSB 3RZDJ 2B63J 2CUEA 1ZK8A 3FISA 3I4MJ 4B3AA 2RAEA 1OFCX 2ECCA 1JGGA 2CQXA 3B6AA 4I6ZA 1U78A 4A3GJ 2MG4A 4XRMA 3IV5A 4A3KJ 2FJ1A 1ETQA 4AC0A 2HXOA 3JRCA 1JKQC 4X1EA 1WCMJ 2GBYA 2NOGA 4G12A 4XRSA 3O8HA 3FKIJ 1ETWA 2R7ZJ 2ZB9A 5E3MA 1IRZA 1GV2A 5IPAA 1WH7A 2AHQA 4A93J 2HOAA 1FJLA 1P7JA 3HB9A 3S14J 2KT0A 2TRTA 5C4JJ 3G1MA 2Y9ZA 1MH3A 1E3OC 1PUFA 1VF9A 1B8IA 4B4CA 4JX6A 3CMYA 2L0KA 2P81A 4CYCB 5BNGA 1YRNB 1I6HJ 4BXXJ 5FLVA 3BG3A 5IYDJ 4BBRJ 2JA6J 3M4OJ 4AYBN 2LR8A 4V2GA 1RESA 2VI6A 3ZQLA 1I3QJ 2JN6A 3ZQHA 3B6CA 3BT9A 2EZIA 1IC8A 4IHXA 4A3LJ 2COBA 1EF4A 1GUUA 2IBDA 3SJMA 1NK3P 1SANA 1ETKA 2HXIA 5M5XJ 4A3JJ 2R5ZB 3TP0A 3WHBA 4IHYA 5C44J 2R92J 3CCYA 2M34A 2WB1N 1I50J 2M8GX 4LOCA 4QIWN 3BR5A 1H89C 1POGA 4FE7A 2MW8A 3BTIA 2DA4A 5EF6A 1JKPC 5IYCJ 3ZOBA 3K7AJ 1MBEA 2K40A 4MFEA 3C2BA 4IHVA 1LE8A 2NVTJ 3HOZJ 4XK4A 3IH2A 1OCTC 3Q0WA 2E2JJ 1WH5A 2DA5A 4FE4A 3S1NJ 1XG1A 1F36A 2DA2A 2H8RA 3LSPA 2JA5J 2Y31A 5EGOA 2ME6A 1JKOC 3LSJA 3A01A 1AKHB 3JRBA 4MLOA 5DTDA 1U8BA 4A3EJ 4S0HB 5J1UA 2FD5A 3GTOJ 4M3EA 4MFDA 2N8GA 1MNMC 3BQZA 4L5EA 4V2FA 3GTLJ 2L7ZA 2LTPA 1JKRC 2XPUA 2XB0X 3OSGA 1UHSA 4C3JJ 1HCRA 1K61A 1TWFJ 1ETXA 1BW6A 1UG2A 4A3BJ 4DZJA 1LFBA 1H8AC 4A69C 3JRHA 1D5YA 3JRIA 5E3NA 3G1LA 2L7MP 1RKWA 4RDUA 3IH3A 2LFBA 3PM1A 2JMWA 2HOTA 3JRDA 1FIPA 5J3LA 2XSDC 2DMTA 4AUXA 3GTJJ 2M2EA 1IGNA 1B72A 2LY9A 5C3EJ 2HYJA 5EG0B 1JT0A 2H1KA 1A6IA 2DA6A 3OSFA 5GP9A 3K2AA 3G1OA 5DS9A 3HGYA 3NARA 2IAIA 4JX4A 3QPLA 5J1YA 3S2HJ 5M3MJ 2CUFA 4RBOA 1QPIA 1JUMA 2VUMJ 5E3LA 1VI0A 5FKMA 2O8KA 4M3FA 2ECBA 1JJ8C 5F0HA 1JUSA 3JREA 3FIWA 4CYCA 4DZPA 1RKTA 2EZKA 2L9RA 1YRNA 2E1OA 1SFOJ 2R93J 2VKEA 1ENHA 2DN0A 1XC5A 2R0QC 2JJ7A 1A5JA 5F04A 3GTMJ 1WGXA 3BR3A 5F27A 2PMZN 3DCFA 1O4XA 3WHCA 3Q3SA 2K9NA 4M3GA 4GFBA 3RZOJ 3BTCA 1IJWC 3Q0UA 5K7HA 5F0FA 1HF0A 3TW7A 5EZGA 3PO3J 2XGDA 2LKXA 1T56A 5IP6A 3E7LA 1XS9A 3ZQIA 3FK6A 3MKLA 1GDTA 1ITYA 3GBGA 5JLXA 2GLOA 2WV1A 2Y2ZA 3BG5A 1MBJA 2M9HA 5FKLA 4BY1J 2CU7A 3RQIA 3GTKJ 1MSFC 2D5VA 5C4XJ 2NS7A 3MN2A 4IEJA 1Z77A 1PUFB 1B8IB 4JX5A 3H3VK 3LOCA 3BR0A 4M3DA 1Z0XA 5FLMJ 4D7NA 4QTRA 2DTZA 4DYRA 3JRFA 1FTTA 3HOXJ 4FTHA 1ZKGA 5GPAA 4D7MA 1G2HA 2EH3A 3JR9A 3ZQGA 3D1NI 1IDYA 2DMPA 3S16J 5IOYA 4BKXA 2G0EA 3A03A 5GPCA 2DA7A 2K9SA 2FX0A 4J19A 4JP0A 3S17J 5FKNA 1HDDC 1FEXA 2R5YB 5F0CA 1AHDP 1ETVA 1Y1WJ 1R9TJ 2E19A 3GTPJ 3M3YJ 4A3DJ 4C2MJ 2HI3A 2HOSA 1MBKA 1U9NA 4B1RA 1K83J 5JLWA 4IHWA 2FQ4A 3F0CA 1WPKA 5EZHA 3TP3A 5E3OA 1RPWA 4MIMA 1HOMA 2I10A 4NDLA 5IYBJ 4UUSA 3HBLA 3UKGA 2XPVA 3Q0VA 4Y7NJ 2X6OA 4A3CJ 3HM5A 4MO7A 1ZR4A 2TCTA 1BA5A 2ME0A 4I76A 1LE8B 3BR2A 3DEWA 2XGCA 1F43A 2XPWA 4FCYA 1HLVA 1JTXA 1Q1VA 2OPTA 3HOUJ 2KDZA 1MBHA 2Y30A 4W1UA 4FISA 1TWHJ 3HKZN 3H0GJ 2DMQA 1Y1VJ 3TEDA 5EGOB 1APLC 1TC3C 2AO9A 2IEKA 4EEFG 4XRSG 5F1JA 1W0UA 1IV6A 5EDNA 1DU6A 4JYKA 5K7ZA 3BTLA 2EQRA 3CQZJ 2NVXJ 4BBSJ 2EZLA 1X58A 2JK3A 4UUTA 2YUSA 1U9OA 4M3BA 2JWTA 1X2NA 1ZGWA 3NAUA 2M0CA 5FJ8J 3LNQA 3S2DJ 2HDDA 2NVQJ 1VFCA 1QVUA 1ETOA 1MH4A 3PO2J 2YU9J 1VNDA 2JA8J 1JUPA 1QVTA 3A02A 2CRGA 5M5WJ 1BW5A 3GTGJ 3CDLA 1IDZA 1MBGA 3FK7A 1B72B 3JRGA 3LSGA 1AU7A 3OOUA 4A3FJ 2GM4A 5FKKA 3HOWJ 4BY7J 4QSHA 2R5ZA 1RETA 2LVSA 2CJJA 1OCPA 2EZHA 2O9LA 2QCOA 1CQTA 4C3IJ 2MSYA 3HOYJ 5M3FJ 1UMQA 3S1QJ 2LD5A 3I4NJ 3HEFA 3BR6A 2XGEA 3TW6A 5HODA 2ID3A 1DU0A 1JJ6C 1LFUP 1IG7A 2W48A 5FKOA 3BR1A 3BQYA 2ELKA 3MVPA 5IP9J 1P7IA 5EYRA 1ZTRA 4A3IJ 2Y0SN 2DMNA 2JA7J 1ETYA 2CQQA 1RR7A 3LSRA 4HNVA 1TWAJ 4M6VA 4D5FA 3S15J 2XRLA 3QPSA 3OIOA 3W6VA 4DYCA 3GTQJ 5F08A 2R5YA 1NTCA 1MSEC 3BG9A 2VKVA 3JRAA 2HQ5A 1WI3A 1AKHA 3SDGA 5J1RA 4C3HJ 4ABZA 4X6AJ 1BJZA 2E2IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 J;  1FIA A;  1ZQ3 P;  2DA1 A;  2NS8 A;  5IOZ A;  2WAQ N;  1GVD A;  2LP0 A;  2Y9Y A;  5M5Y J;  1GT0 C;  4A3M J;  1T33 A;  1FTZ A;  1TWC J;  2DJN A;  3BTJ A;  2DMU A;  3IH4 A;  1JT6 A;  2NVY J;  1MBF A;  3QQA A;  5EEA A;  3HOV J;  2O7O A;  3RKQ A;  2EBI A;  3L1P A;  2VPR A;  1ORK A;  5EG0 A;  9ANT A;  1IUF A;  2LLK A;  1W0T A;  1HDP A;  2MGQ A;  2XB5 A;  3O8G A;  3ZQF A;  3HDD A;  2YS9 A;  2ID6 A;  1GV5 A;  3VPR A;  1JTY A;  5K7F A;  2DA3 A;  2LK2 A;  2QF7 A;  1X2M A;  1BL0 A;  1NK2 P;  4DW6 A;  4XIC A;  3A01 B;  2L7F P;  2OF7 A;  2E2H J;  1H88 C;  3SFI A;  4Y52 J;  4W97 A;  3S1R J;  1ZR2 A;  1S7E A;  3S1M J;  1TWG J;  2X9D A;  4D5C A;  2K9Q A;  2X48 A;  4DYQ A;  1QRY A;  4XID A;  3ZQC A;  3HGG A;  1OJL A;  4UUS B;  3RZD J;  2B63 J;  2CUE A;  1ZK8 A;  3FIS A;  3I4M J;  4B3A A;  2RAE A;  1OFC X;  2ECC A;  1JGG A;  2CQX A;  3B6A A;  4I6Z A;  1U78 A;  4A3G J;  2MG4 A;  4XRM A;  3IV5 A;  4A3K J;  2FJ1 A;  1ETQ A;  4AC0 A;  2HXO A;  3JRC A;  1JKQ C;  4X1E A;  1WCM J;  2GBY A;  2NOG A;  4G12 A;  4XRS A;  3O8H A;  3FKI J;  1ETW A;  2R7Z J;  2ZB9 A;  5E3M A;  1IRZ A;  1GV2 A;  5IPA A;  1WH7 A;  2AHQ A;  4A93 J;  2HOA A;  1FJL A;  1P7J A;  3HB9 A;  3S14 J;  2KT0 A;  2TRT A;  5C4J J;  3G1M A;  2Y9Z A;  1MH3 A;  1E3O C;  1PUF A;  1VF9 A;  1B8I A;  4B4C A;  4JX6 A;  3CMY A;  2L0K A;  2P81 A;  4CYC B;  5BNG A;  1YRN B;  1I6H J;  4BXX J;  5FLV A;  3BG3 A;  5IYD J;  4BBR J;  2JA6 J;  3M4O J;  4AYB N;  2LR8 A;  4V2G A;  1RES A;  2VI6 A;  3ZQL A;  1I3Q J;  2JN6 A;  3ZQH A;  3B6C A;  3BT9 A;  2EZI A;  1IC8 A;  4IHX A;  4A3L J;  2COB A;  1EF4 A;  1GUU A;  2IBD A;  3SJM A;  1NK3 P;  1SAN A;  1ETK A;  2HXI A;  5M5X J;  4A3J J;  2R5Z B;  3TP0 A;  3WHB A;  4IHY A;  5C44 J;  2R92 J;  3CCY A;  2M34 A;  2WB1 N;  1I50 J;  2M8G X;  4LOC A;  4QIW N;  3BR5 A;  1H89 C;  1POG A;  4FE7 A;  2MW8 A;  3BTI A;  2DA4 A;  5EF6 A;  1JKP C;  5IYC J;  3ZOB A;  3K7A J;  1MBE A;  2K40 A;  4MFE A;  3C2B A;  4IHV A;  1LE8 A;  2NVT J;  3HOZ J;  4XK4 A;  3IH2 A;  1OCT C;  3Q0W A;  2E2J J;  1WH5 A;  2DA5 A;  4FE4 A;  3S1N J;  1XG1 A;  1F36 A;  2DA2 A;  2H8R A;  3LSP A;  2JA5 J;  2Y31 A;  5EGO A;  2ME6 A;  1JKO C;  3LSJ A;  3A01 A;  1AKH B;  3JRB A;  4MLO A;  5DTD A;  1U8B A;  4A3E J;  4S0H B;  5J1U A;  2FD5 A;  3GTO J;  4M3E A;  4MFD A;  2N8G A;  1MNM C;  3BQZ A;  4L5E A;  4V2F A;  3GTL J;  2L7Z A;  2LTP A;  1JKR C;  2XPU A;  2XB0 X;  3OSG A;  1UHS A;  4C3J J;  1HCR A;  1K61 A;  1TWF J;  1ETX A;  1BW6 A;  1UG2 A;  4A3B J;  4DZJ A;  1LFB A;  1H8A C;  4A69 C;  3JRH A;  1D5Y A;  3JRI A;  5E3N A;  3G1L A;  2L7M P;  1RKW A;  4RDU A;  3IH3 A;  2LFB A;  3PM1 A;  2JMW A;  2HOT A;  3JRD A;  1FIP A;  5J3L A;  2XSD C;  2DMT A;  4AUX A;  3GTJ J;  2M2E A;  1IGN A;  1B72 A;  2LY9 A;  5C3E J;  2HYJ A;  5EG0 B;  1JT0 A;  2H1K A;  1A6I A;  2DA6 A;  3OSF A;  5GP9 A;  3K2A A;  3G1O A;  5DS9 A;  3HGY A;  3NAR A;  2IAI A;  4JX4 A;  3QPL A;  5J1Y A;  3S2H J;  5M3M J;  2CUF A;  4RBO A;  1QPI A;  1JUM A;  2VUM J;  5E3L A;  1VI0 A;  5FKM A;  2O8K A;  4M3F A;  2ECB A;  1JJ8 C;  5F0H A;  1JUS A;  3JRE A;  3FIW A;  4CYC A;  4DZP A;  1RKT A;  2EZK A;  2L9R A;  1YRN A;  2E1O A;  1SFO J;  2R93 J;  2VKE A;  1ENH A;  2DN0 A;  1XC5 A;  2R0Q C;  2JJ7 A;  1A5J A;  5F04 A;  3GTM J;  1WGX A;  3BR3 A;  5F27 A;  2PMZ N;  3DCF A;  1O4X A;  3WHC A;  3Q3S A;  2K9N A;  4M3G A;  4GFB A;  3RZO J;  3BTC A;  1IJW C;  3Q0U A;  5K7H A;  5F0F A;  1HF0 A;  3TW7 A;  5EZG A;  3PO3 J;  2XGD A;  2LKX A;  1T56 A;  5IP6 A;  3E7L A;  1XS9 A;  3ZQI A;  3FK6 A;  3MKL A;  1GDT A;  1ITY A;  3GBG A;  5JLX A;  2GLO A;  2WV1 A;  2Y2Z A;  3BG5 A;  1MBJ A;  2M9H A;  5FKL A;  4BY1 J;  2CU7 A;  3RQI A;  3GTK J;  1MSF C;  2D5V A;  5C4X J;  2NS7 A;  3MN2 A;  4IEJ A;  1Z77 A;  1PUF B;  1B8I B;  4JX5 A;  3H3V K;  3LOC A;  3BR0 A;  4M3D A;  1Z0X A;  5FLM J;  4D7N A;  4QTR A;  2DTZ A;  4DYR A;  3JRF A;  1FTT A;  3HOX J;  4FTH A;  1ZKG A;  5GPA A;  4D7M A;  1G2H A;  2EH3 A;  3JR9 A;  3ZQG A;  3D1N I;  1IDY A;  2DMP A;  3S16 J;  5IOY A;  4BKX A;  2G0E A;  3A03 A;  5GPC A;  2DA7 A;  2K9S A;  2FX0 A;  4J19 A;  4JP0 A;  3S17 J;  5FKN A;  1HDD C;  1FEX A;  2R5Y B;  5F0C A;  1AHD P;  1ETV A;  1Y1W J;  1R9T J;  2E19 A;  3GTP J;  3M3Y J;  4A3D J;  4C2M J;  2HI3 A;  2HOS A;  1MBK A;  1U9N A;  4B1R A;  1K83 J;  5JLW A;  4IHW A;  2FQ4 A;  3F0C A;  1WPK A;  5EZH A;  3TP3 A;  5E3O A;  1RPW A;  4MIM A;  1HOM A;  2I10 A;  4NDL A;  5IYB J;  4UUS A;  3HBL A;  3UKG A;  2XPV A;  3Q0V A;  4Y7N J;  2X6O A;  4A3C J;  3HM5 A;  4MO7 A;  1ZR4 A;  2TCT A;  1BA5 A;  2ME0 A;  4I76 A;  1LE8 B;  3BR2 A;  3DEW A;  2XGC A;  1F43 A;  2XPW A;  4FCY A;  1HLV A;  1JTX A;  1Q1V A;  2OPT A;  3HOU J;  2KDZ A;  1MBH A;  2Y30 A;  4W1U A;  4FIS A;  1TWH J;  3HKZ N;  3H0G J;  2DMQ A;  1Y1V J;  3TED A;  5EGO B;  1APL C;  1TC3 C;  2AO9 A;  2IEK A;  4EEF G;  4XRS G;  5F1J A;  1W0U A;  1IV6 A;  5EDN A;  1DU6 A;  4JYK A;  5K7Z A;  3BTL A;  2EQR A;  3CQZ J;  2NVX J;  4BBS J;  2EZL A;  1X58 A;  2JK3 A;  4UUT A;  2YUS A;  1U9O A;  4M3B A;  2JWT A;  1X2N A;  1ZGW A;  3NAU A;  2M0C A;  5FJ8 J;  3LNQ A;  3S2D J;  2HDD A;  2NVQ J;  1VFC A;  1QVU A;  1ETO A;  1MH4 A;  3PO2 J;  2YU9 J;  1VND A;  2JA8 J;  1JUP A;  1QVT A;  3A02 A;  2CRG A;  5M5W J;  1BW5 A;  3GTG J;  3CDL A;  1IDZ A;  1MBG A;  3FK7 A;  1B72 B;  3JRG A;  3LSG A;  1AU7 A;  3OOU A;  4A3F J;  2GM4 A;  5FKK A;  3HOW J;  4BY7 J;  4QSH A;  2R5Z A;  1RET A;  2LVS A;  2CJJ A;  1OCP A;  2EZH A;  2O9L A;  2QCO A;  1CQT A;  4C3I J;  2MSY A;  3HOY J;  5M3F J;  1UMQ A;  3S1Q J;  2LD5 A;  3I4N J;  3HEF A;  3BR6 A;  2XGE A;  3TW6 A;  5HOD A;  2ID3 A;  1DU0 A;  1JJ6 C;  1LFU P;  1IG7 A;  2W48 A;  5FKO A;  3BR1 A;  3BQY A;  2ELK A;  3MVP A;  5IP9 J;  1P7I A;  5EYR A;  1ZTR A;  4A3I J;  2Y0S N;  2DMN A;  2JA7 J;  1ETY A;  2CQQ A;  1RR7 A;  3LSR A;  4HNV A;  1TWA J;  4M6V A;  4D5F A;  3S15 J;  2XRL A;  3QPS A;  3OIO A;  3W6V A;  4DYC A;  3GTQ J;  5F08 A;  2R5Y A;  1NTC A;  1MSE C;  3BG9 A;  2VKV A;  3JRA A;  2HQ5 A;  1WI3 A;  1AKH A;  3SDG A;  5J1R A;  4C3H J;  4ABZ A;  4X6A J;  1BJZ A;  2E2I J; 
#chains in the Genus database with same CATH topology
 1KGS A;  3H9Q A;  4PUS A;  1ZQ3 P;  3C2H A;  3AFH A;  1BI0 A;  1D5V A;  3BP8 A;  5ED4 A;  4KIF A;  2VXD A;  4RGU A;  5IOZ A;  3M1C A;  2KL4 A;  4BJ6 C;  2WAQ N;  4ZTF A;  1R36 A;  2FBK A;  1ZRE A;  3BRO A;  1O7L A;  5M5Y J;  3LSK A;  1Z91 A;  1VQ7 I;  5ICF A;  2L9V A;  3P9C A;  1FTZ A;  5KK1 A;  2HFH A;  2JRT A;  3REO A;  2YSR A;  2FU4 A;  1FOW A;  4IF4 A;  5FLX Z;  3RKQ A;  3IAS 2;  3PQJ A;  2EBI A;  1R5G A;  4OU0 A;  4E7S A;  3L1P A;  5F6F A;  2DPD A;  1W5T A;  1PJR A;  3W6J B;  3WGH A;  2VBW A;  2VPR A;  5EG0 A;  3CO7 C;  2CQN A;  3FHN A;  4PGG A;  4A5N A;  3GZ5 A;  2FF4 A;  1KON A;  1GV5 A;  5JFR A;  4UB6 C;  1WVR A;  1Y8R B;  2MH2 A;  2OAZ A;  4PFO A;  4AU7 A;  2DJI A;  3FXQ A;  1UHM A;  3HSF A;  2QGU A;  1X2M A;  2QF7 A;  4IJA A;  3TO7 A;  1NK2 P;  2COM A;  2J5P A;  3L09 A;  1G3T A;  2Y48 A;  1WWX A;  1ZAO A;  3PSI A;  5HS9 A;  2LKP A;  1H88 C;  3SFI A;  3S1R J;  1ODD A;  2QBY A;  4RGR A;  2JRM A;  4XSX F;  2D1V A;  3LFU A;  1RUO A;  4F52 A;  2HYG D;  3F22 A;  3PJR A;  3A4C A;  4ZYA A;  3FIS A;  3J81 Z;  1MJA A;  3I4M J;  1JGG A;  2RAE A;  1OFC X;  2UUZ A;  1U78 A;  4WF2 A;  1LB2 A;  4L18 B;  4XRM A;  1G59 A;  1LDD A;  1OCR H;  2NAZ A;  3CCL I;  2R4G A;  1ETQ A;  1PUE E;  3EUA A;  4ANJ A;  1EA3 A;  2LC2 A;  1LEB A;  3HKZ A;  1JKQ C;  2X6X A;  4X1E A;  2R7U A;  2GBY A;  2NOG A;  3GZ6 A;  2CSO A;  2E35 A;  2E1M C;  1B1B A;  4NB5 A;  4G12 A;  3PUF A;  1U5T B;  1TNT A;  3FKI J;  1ETW A;  3FMR A;  4RGX A;  2ICW G;  1YTY A;  2R7Z J;  2M8E A;  2Z99 A;  3S3O A;  1GV2 A;  1UAA A;  2D45 A;  3TDZ C;  1OYY A;  1CGP A;  2XUB A;  3EPZ A;  1FJL A;  3IRR A;  3HB9 A;  3K4J A;  2KT0 A;  3ULQ B;  3C7J A;  2Y9Z A;  1VF9 A;  2VKH A;  3HSR A;  3KZZ A;  4ZYG A;  4LMY A;  1KA8 A;  2CFO A;  2XAG A;  2HOE A;  2EFW A;  2L0K A;  2P81 A;  2OC6 A;  2VBX A;  2QEX I;  2Q0O A;  1KYZ A;  3RTR A;  2LRE A;  4Y33 A;  2OJE D;  1BC8 C;  4FQG A;  3M4O J;  4M6Y A;  4AYB N;  4ENN A;  2LR8 A;  3BCB A;  4EM1 A;  4V2G A;  1RES A;  1I3Q J;  2JN6 A;  5JVT A;  1ERD A;  1HA8 A;  3CUQ B;  3BT9 A;  1RZ4 A;  1FMW A;  1Z6R A;  2LRD A;  5CQE A;  1X1P A;  1GUU A;  3B02 A;  3IAM 2;  1SAN A;  2V9K A;  1NK3 P;  3SFZ A;  4XLN F;  1ETK A;  3F8B A;  5M5X J;  4A3J J;  3ZMV A;  4ITV A;  1K6O A;  2CS3 A;  2HPM A;  3JW4 A;  1H9G A;  2K3P A;  5C44 J;  3CCY A;  4BU2 A;  1N75 A;  2M34 A;  2FE3 A;  2JVG A;  2WB1 N;  1I50 J;  2M8G X;  5K1Y A;  2QA4 I;  4QIW N;  2GIV A;  2HU9 A;  3UNG C;  1MZB A;  1T8I A;  2QSH X;  1RNL A;  1OCO H;  5JR3 A;  4IKF A;  4D9J A;  4FE7 A;  4E7K A;  3DLL F;  2XKO A;  3MCZ A;  2VQC A;  3CDH A;  2Y0S A;  4E7L A;  2NVT J;  1IO2 A;  1SMY F;  1KYW A;  1LVK A;  2DOF A;  3U21 A;  3HOZ J;  5EEH A;  3SYT A;  3SEQ A;  3Q0W A;  5EJC A;  4KT5 C;  4FE4 A;  3T8T A;  1XG1 A;  4QPO A;  3N05 A;  2DPU A;  3LQQ A;  4RB3 C;  3DPT A;  1LDK B;  3DWL E;  2Q8K A;  3FDY A;  3I59 A;  5KCM A;  4BEH A;  4S04 A;  1S29 A;  1AKH B;  4U0V A;  2ZFU A;  2I5U A;  2VL8 A;  4UHT A;  4A3E J;  2F5C A;  1MNE A;  3CCJ I;  3GTO J;  2N8G A;  3DEE A;  3GTL J;  4E7Z A;  2P6S A;  3CC2 I;  3DTK A;  4LG0 A;  3L7W A;  1YIO A;  4PGH A;  1K79 A;  3OSG A;  2BVM A;  1P4X A;  3K10 A;  1K61 A;  4LK0 F;  2RNG A;  1ON2 A;  2FBI A;  3F8N A;  1YYV A;  5D6F A;  1L3L A;  1H8A C;  2EA2 A;  3H3Z A;  1P6R A;  4EJT A;  1D5Y A;  2R7R A;  4HDV A;  4KDP A;  1BOB A;  4II2 A;  3G1L A;  3OYK A;  2HTJ A;  3QYB A;  3I55 I;  1RKW A;  2QZ8 A;  4M6X A;  1FC3 A;  2FXA A;  1ZG5 A;  3PM1 A;  4OIQ F;  2XGX A;  3DKX A;  1ON1 A;  1FIP A;  5J3L A;  1JI8 A;  5J40 A;  3ABL H;  3GTJ J;  2M2E A;  1B72 A;  1A36 A;  2LY9 A;  4K2E A;  5EG0 B;  2HPI A;  4U0W A;  1STZ A;  5GP9 A;  4IX7 A;  4C2U A;  2IRF G;  1WJE A;  3GCM A;  1YW7 A;  4EGZ A;  1D8K A;  1V4R A;  1MMN A;  5M3M J;  2CUF A;  4KIS A;  2ELJ A;  1JUM A;  4UXN A;  5FLX K;  2VOP A;  5H6R A;  1U0J A;  5LHH A;  2CUZ A;  4M3F A;  3K1M A;  2P8T A;  5D5W B;  4AIH A;  1QHG A;  2ZXW H;  1TQI A;  5F0H A;  2FEZ A;  4LIT A;  5JI6 A;  4CYC A;  2QBY B;  3BG7 A;  4OOI A;  5GAD J;  5KVR A;  4IRH A;  2R0Q C;  2JJ7 A;  2DQL A;  5F04 A;  3S3N A;  4I7H A;  4P5O A;  1H0M A;  1GHC A;  3A0H C;  3BR3 A;  4I01 A;  5KAF C;  2PMZ N;  1O4X A;  1J2X A;  1E2X A;  2BZT A;  4IO9 F;  3F9K A;  3M8E A;  4HSR A;  3R60 A;  2O8X A;  4LLN A;  1J09 A;  1IAW A;  2IJL A;  1T56 A;  1LJ9 A;  4NNJ A;  4HF0 A;  1XS9 A;  2KDO A;  4I0A A;  3C2G A;  3VWB A;  5HLG A;  3MKL A;  1GDT A;  1ITY A;  2BE5 F;  3BZC A;  2OA4 A;  4ZDO A;  5IT9 Z;  2WV1 A;  4HF1 A;  1MBJ A;  2VE8 A;  2M9H A;  3LAP A;  3L2Q A;  4BY1 J;  2ZKZ A;  4BJT A;  1UCR A;  2CU7 A;  2F4M B;  4Y4R A;  2NS7 A;  3MN2 A;  2STW A;  4RB1 A;  3ZMZ A;  4ZZL A;  4B47 A;  2ZJR F;  2O3F A;  3LOC A;  1Y39 A;  1SC7 A;  2IW5 A;  2NOJ B;  2KJC A;  4DYR A;  4F92 B;  1XTA A;  2XV4 S;  1ZKG A;  4UVB A;  5GPA A;  3FXR A;  4FT8 A;  1G2H A;  4YFK F;  3OYJ A;  1B4A A;  4XKC A;  5E8G A;  3GUD A;  3HSE A;  1FOK A;  1VQ4 I;  3QOE A;  2QLZ A;  1AA7 A;  3HPH A;  1BIB A;  4BKX A;  2G0E A;  3A03 A;  1TT0 A;  5ILS A;  4LD5 A;  2K9S A;  2FX0 A;  3KIO A;  3ABK H;  3S17 J;  3MFK A;  3J7A O;  2R5Y B;  2P7V B;  2E19 A;  1W5S A;  1D3Y A;  2L2O A;  1R49 A;  2F4I A;  3QRF F;  2D2W A;  2OCE A;  1XMA A;  5TIS C;  2WY7 Q;  1A35 A;  1WPK A;  5EZH A;  3V4G A;  1RPW A;  1HOM A;  4UUS A;  3UKG A;  3HBL A;  2XPV A;  3Q0V A;  2QQ9 A;  2X6O A;  4MO7 A;  2TCT A;  2JPB A;  2ME0 A;  5B1A H;  2BXY A;  2Q2E A;  1F43 A;  4A6E A;  4KA4 A;  2KJB A;  2XPW A;  1Q1V A;  2V1X A;  1MBH A;  3GF2 A;  3LFK A;  2ZJQ F;  2Y30 A;  4W1U A;  1DQU A;  2E1N A;  1OYI A;  1YJ9 I;  2E36 A;  5HDK A;  2V79 A;  2DMQ A;  2ZSI B;  4DIQ A;  3I59 B;  2HQA A;  4BEH B;  2LF8 A;  5HOO A;  3L9F A;  3WGI A;  1OPC A;  3S32 A;  4NC6 A;  2BY3 A;  1DU6 A;  1USS A;  1TL8 A;  3BTL A;  2EQR A;  3CQZ J;  4P96 A;  4KUM A;  4B48 A;  1X19 A;  2EZL A;  1X58 A;  4XLC A;  3F6V A;  1U9O A;  4M3B A;  3J80 Z;  1FBS A;  1X4O A;  2M0C A;  1FYL A;  5LRR A;  2HDD A;  1R5H A;  5GAE J;  4UVC A;  1QVU A;  1WJB A;  3PO2 J;  3CD6 I;  3HZJ A;  2CWE A;  3FXO A;  4R1H A;  2JA8 J;  3G73 A;  1XGO A;  3FKJ A;  4RMN A;  1LQ1 A;  2VQG A;  1P4A A;  5E1Z B;  1IUY A;  3VYR B;  1Z3Y A;  1B72 B;  1KQ0 A;  3LSG A;  4YII A;  4E7J A;  4A3F J;  2GM4 A;  1WJ5 A;  2CFX A;  2RC4 A;  3S3M A;  5AON A;  3HHG A;  4QSH A;  4HDU A;  3GW2 A;  4RS8 A;  2VAS A;  3G2B A;  4C3I J;  2FRH A;  2F5D A;  4F91 B;  1QQI A;  3HEF A;  1MIJ A;  2PJR A;  2X0L A;  3BJO A;  2VB6 A;  4A0X A;  5LGN A;  5HOD A;  2ID3 A;  4MTD A;  3ZMS A;  1R4M B;  3MMY B;  1FWZ A;  2W48 A;  3CCS I;  4XOT A;  3MVP A;  1XSD A;  3OIP A;  1LDJ A;  1JXS A;  4CCL A;  2ISY A;  1ETY A;  2KHM A;  3T0Y A;  1RR7 A;  4FX4 A;  4N9I A;  4RA2 A;  4IOA F;  2W00 A;  3HTS B;  1BN5 A;  3WU2 C;  2EFN A;  4EV0 A;  5K5R A;  1XDS A;  3KX2 A;  3ZN1 A;  4Y13 A;  1D1B A;  2VT2 A;  1NTC A;  1W36 C;  3PNY A;  3T1B A;  2OV7 A;  2VC0 A;  2AXT C;  4BJ5 C;  1WJA A;  5DCF A;  3PFY A;  3GVA A;  1WRJ A;  4XOR A;  5CVI A;  2KRH A;  1BJZ A;  2LDU A;  5LHG A;  4C30 A;  1U3E M;  1FIA A;  2KIU A;  4RAG A;  2QSG X;  5E18 F;  1F9N A;  1O57 A;  2UZK A;  2HYF A;  3LSH A;  2NS8 A;  4XBF A;  2LY1 A;  3ASN H;  5LGT A;  2LP0 A;  2WC2 A;  1HXD A;  3SQN A;  4A3M J;  1IN6 A;  1Z67 A;  3K1P A;  2QQ8 A;  3RKW A;  3MQ0 A;  3SEZ A;  1TWC J;  2DJN A;  3BTJ A;  1HW5 A;  2DMU A;  2LF7 A;  5FRO A;  5DV5 A;  2HWV A;  4MGR A;  3SZG A;  2O7O A;  1W7P D;  1O7F A;  3VSL A;  4XON A;  6PAX A;  3E97 A;  3F6O A;  1SVM A;  3FXJ A;  3OR1 C;  4XOP A;  2LLK A;  4CCJ A;  3K6G A;  3ZQF A;  3HDD A;  1YW9 A;  4LLL A;  2DA3 A;  2Q1Z B;  3OR2 C;  1Z1D A;  2WAF A;  3WOD F;  2V9V A;  2XSJ C;  2JVH A;  1VQ9 I;  5CLS A;  1TP4 A;  2JUG A;  1IRG A;  1PYV A;  1KZH A;  1IRX A;  4XIC A;  1IZ1 A;  1J5Y A;  4IRG A;  3JSO A;  2L7F P;  3IUO A;  1FYM A;  1BR2 A;  3LA3 A;  2E5N A;  4W97 A;  4IL6 C;  1ZR2 A;  1S7E A;  1TQM A;  4YFN F;  3W2V A;  4D5C A;  3WU1 B;  2DOD A;  4DYQ A;  1S7A A;  5F64 A;  3OS1 A;  4UUS B;  2B63 J;  2HQR A;  4BAC A;  2OQR A;  2DFE A;  2QM3 A;  4AIK A;  4PZJ A;  3CJQ B;  2DAO A;  3TO6 A;  4B3A A;  2W4S A;  4GYG A;  2Q2E B;  3MWM A;  2L4A A;  2MG4 A;  3KEY A;  2JSC A;  3RDI A;  4A3K J;  1R1T A;  2PQ8 A;  2BW3 A;  2VJ5 A;  2OQG A;  5AIP A;  4AC0 A;  3HL2 A;  5FRN A;  3FXU A;  2HXO A;  2IGM A;  5IY5 H;  5FO5 A;  4YIF A;  1FBQ A;  3ZN0 A;  2XF7 A;  2E60 A;  4GXO A;  4XRS A;  2RN7 A;  3D5S C;  1IXC A;  5E3M A;  3E6D A;  4BQA A;  1WI9 A;  5IPA A;  2FSW A;  3VYT B;  4ASN A;  1FSH A;  1HKT A;  4EMS A;  2QWW A;  3CLQ A;  1VQP I;  1P7J A;  1K6Y A;  4NHJ A;  3S14 J;  2TRT A;  3RYP A;  4OMZ A;  1E3O C;  1MH3 A;  1EH7 A;  3KYL A;  1PUF A;  5J47 A;  2V26 A;  2EFP A;  3OMY A;  3CMY A;  3AG4 H;  4HBL A;  3PUB A;  3VYU B;  2HEO A;  5E1X A;  5BNG A;  4OWR B;  1ZG3 A;  5IYD J;  5H2F C;  4CA0 A;  2VXZ A;  4XN0 A;  4BBR J;  2JA6 J;  4DBQ A;  1MDM A;  2DTR A;  4B8X A;  4RAZ A;  2EFO A;  3ZQL A;  4BYY A;  2O61 A;  2Z3Y A;  2EZI A;  4NC8 A;  3E6B A;  1WJD A;  1DGR M;  2CV2 A;  4M72 A;  3RYR A;  2VON A;  2O03 A;  3H0D A;  3COA C;  3SXY A;  1VQO I;  3QAH A;  3TP0 A;  4CH7 A;  2DDA A;  5ICG A;  3QP5 A;  4PJN A;  3I64 A;  3FXL A;  2KIS A;  1H89 C;  1W7P A;  1ZH5 A;  3HUG A;  3QP6 A;  1MW7 A;  2V7F A;  2MW8 A;  1JKP C;  5IYC J;  3ABT A;  1AOY A;  1YLF A;  4IHV A;  3L2R A;  1LE8 A;  3GLL A;  2E7X A;  5D4S A;  3CCE I;  1SEU A;  3CZ6 A;  3IH2 A;  2HZT A;  2P6T A;  4RAF A;  2IA1 A;  4KIT B;  4XLF A;  5LEK A;  4LGW A;  3IRQ A;  2LMD A;  5D4R A;  2H8R A;  2GXB A;  2RRE A;  4KIC A;  2JA5 J;  1J9I A;  3K4C A;  4LFU A;  3F23 A;  2ZCW A;  3OWT A;  5EGO A;  2ME6 A;  1JKO C;  3OYL A;  3A01 A;  4LLG F;  5ERI A;  3JRB A;  1R58 A;  1W5C C;  4HPQ A;  1IXS B;  3L2C A;  4HYE A;  4S0H B;  3HYI A;  4JBA A;  4MQ9 F;  2L3D A;  2ESN A;  2CO5 A;  1HW2 A;  4V2F A;  2XF6 A;  3FM3 A;  1JKR C;  5AIQ A;  2XB0 X;  3GFM A;  3CMA I;  1N78 A;  1TBX A;  1UHS A;  3K4N A;  3TMO A;  1HCR A;  2DLL A;  4IHT A;  3CUO A;  1SAU A;  2UXN A;  1V55 H;  1UG2 A;  1FP2 A;  3ROU A;  1SVO A;  3JRH A;  5LHI A;  1QZY A;  1I6X A;  5JHU A;  3IP4 B;  3M9A A;  5E3N A;  2FUG 2;  2VQH A;  3T8R A;  4RDU A;  3IH3 A;  4P9U A;  4Q5S F;  5FD6 A;  1XB4 A;  2HOT A;  2V9P A;  4WXC A;  2P7C B;  4G9Y A;  1W1W E;  2DMT A;  1T98 A;  2KQR A;  2VT3 A;  4AUX A;  4ZTJ A;  2P0W A;  3KLN A;  1JT0 A;  1S3J A;  3P9I A;  1O3S A;  1BR4 A;  2DA6 A;  1Y6I A;  2HQN A;  1DUX C;  3AG3 H;  1K7A A;  2K85 A;  2KP6 A;  4ZH4 F;  3WU0 A;  5DS9 A;  1V5G A;  5DUI A;  4OIP F;  1Y8Q B;  1DPR A;  4HX7 A;  2P5V A;  1VQM I;  2LYC A;  1QPI A;  2VUM J;  1VI0 A;  1KU2 A;  3K1N A;  4OAZ A;  3WTY C;  3E5X A;  2QUF A;  4FX0 A;  3GLX A;  1YRN A;  1YW8 A;  4LG3 A;  3S8P A;  4UB8 C;  2NXN B;  2DYR H;  1QO0 D;  4PFP A;  1ENH A;  3DLA A;  1J7K A;  1A5J A;  3GTM J;  4ZZD A;  2M5W A;  5DD8 A;  2BHY A;  4MTE A;  5HVQ C;  4HNU A;  3QWL A;  1U5T C;  2QVO A;  2IVM A;  3Q3S A;  1SMT A;  4GFB A;  2XAS A;  5FB2 A;  1UHW A;  5K7H A;  2EA4 A;  4AD9 A;  1HF0 A;  1IW7 F;  1XMX A;  5B1B H;  2BW3 B;  3TW7 A;  3VEP A;  3F8M A;  4II3 A;  2OD5 A;  2LKX A;  1I27 A;  4E70 A;  4AM3 A;  3DKW A;  2EFQ A;  2W57 A;  2WA0 A;  2WBM A;  1YQA A;  3GBG A;  4G7H F;  4YIR X;  3BG5 A;  1MMG A;  4L9V A;  1IV8 A;  5TGT A;  5FKL A;  3EET A;  2BVL A;  3ZMT A;  3WTT C;  2X6Y A;  5DM7 F;  4CZC A;  3C18 A;  5D8K B;  1MSF C;  4LK1 F;  2D5V A;  2A6H F;  2DFI A;  4B3X A;  3KP3 A;  4A0Y A;  1PUF B;  1W36 D;  3CUQ C;  4IQ4 A;  4CCO A;  4JX5 A;  3H3V K;  4B09 A;  3G6E I;  2ZO4 A;  4M3D A;  1Z0X A;  2DTZ A;  1FMV A;  3HOX J;  2X1D A;  2A6T A;  2X85 A;  4D7M A;  3KP2 A;  3KYD B;  2A6E F;  2EH3 A;  3K4K A;  3JR9 A;  4DNC A;  3G71 I;  3ZQG A;  1QU3 A;  3SZP A;  3D1N I;  3H3U A;  5HDG A;  2DMP A;  2L9N A;  3S16 J;  5CYV A;  3EYI A;  4IVN A;  2XAQ A;  3NQO A;  2W1O A;  3H5N A;  3SHF A;  5GPC A;  2XC7 A;  3OS0 A;  4J19 A;  3ZQ7 A;  3ZMU A;  5FKN A;  2L01 A;  4YG2 F;  2VQL A;  3BC8 A;  4IPA A;  3GFI A;  1AHD P;  1BM9 A;  3S15 J;  4CUG A;  1PVE A;  3K0L A;  3R4K A;  4B43 A;  4L9N A;  3PNT A;  4A3D J;  1QA6 A;  2VJJ A;  1F1Z A;  4C2M J;  2Y69 H;  2CW7 A;  3I4P A;  2HOS A;  2L4M A;  5DCM A;  1OYW A;  1QZZ A;  4B1R A;  4WK8 F;  2H6C A;  1W7P B;  2FQ4 A;  2LBF A;  3EUK L;  5E3O A;  2HGC A;  4MIM A;  2I10 A;  5IYB J;  2E1C A;  5CVJ A;  2WWY A;  4H4K C;  2PLY A;  2X51 A;  4A3C J;  4WXD A;  1BA5 A;  2W24 A;  4G6T B;  3FWE A;  4MEY F;  4I76 A;  1YOV B;  1LE8 B;  4CO8 A;  1F4K A;  2A07 F;  2UXX A;  4YEJ A;  1SD7 A;  3IWF A;  1G3S A;  5E1W A;  4AVZ A;  4FCY A;  4HQM A;  4CZZ A;  1MJB A;  1K4S A;  3S2W A;  4HEA 2;  3I56 I;  4CYD A;  3GYH X;  1TWH J;  3HKZ N;  4A12 A;  4QPQ A;  3WTU C;  4M74 A;  5EGO B;  5J8F A;  4HST A;  4OIR F;  3HRU A;  2K4J A;  2G9W A;  2Z5U A;  3NEU A;  3WE3 A;  4MQV A;  1RR8 C;  5FRM A;  1OKR A;  2OZU A;  3E1S A;  3QPH A;  1X3Z B;  4S05 A;  1W0U A;  5EDN A;  1TLH B;  1W4M A;  3DV8 A;  5B5E C;  1P2F A;  2ZME C;  2IS6 A;  2JK3 A;  3P9K A;  2YUS A;  1HBX G;  4BHB A;  3LST A;  1BBY A;  1WJC A;  3KP5 A;  3P7N A;  5BPD A;  3NAU A;  2R7X A;  3S2D J;  2DK5 A;  2ELH A;  3PSF A;  1BIA A;  4HRI A;  1TQP A;  2ETH A;  1MH4 A;  3OYD A;  3OYA A;  1JUP A;  2LH9 A;  2DK8 A;  1BW5 A;  3HRT A;  4HNT A;  2BYV E;  1UFM A;  2CQ7 A;  3FK7 A;  1HKS A;  3GFJ A;  4CCM A;  1HKQ A;  4R8H A;  3IC7 A;  3OOU A;  2M0M A;  3HOW J;  5FKK A;  3RCO A;  2W85 A;  3WG7 H;  1YX3 A;  3CF2 A;  5HNH A;  3CCU I;  1UB9 A;  4BY7 J;  1YO5 C;  2K86 A;  4XSZ F;  3IKV A;  3V42 A;  2O9L A;  3LSM A;  5H6Q A;  2BHZ A;  2ADU A;  2ZSH B;  4UVA A;  3S1Q J;  1XX5 A;  1X3W B;  2GZW A;  4MNU A;  1ZRD A;  3I4N J;  3LSI A;  3E3V A;  3BR6 A;  2R7Q A;  1G8X A;  3TW6 A;  2PMU A;  3AL0 B;  2K4B A;  4JQF A;  2EIK H;  1IG7 A;  2CUJ A;  2P5K A;  4PJ0 C;  2K02 A;  3BR1 A;  4CHU A;  1X1A A;  3BQY A;  3ZMD A;  3CCQ I;  2ELK A;  1QNT A;  1NG6 A;  2GQQ A;  2X4H A;  3L00 A;  1FBU A;  1ZTR A;  4A3I J;  1KU3 A;  2Y0S N;  4XKV A;  2L02 A;  2DMN A;  2JA7 J;  1D0X A;  2CQQ A;  4ZC3 A;  2E71 A;  4HNV A;  4M6V A;  3OL4 A;  2RKH A;  3QPS A;  2NNN A;  3W6V A;  2R7D A;  3V7S A;  3HHH A;  3GTQ J;  2M45 A;  2MA3 A;  2ZJP F;  1P9Q C;  4C9Y A;  5LRS A;  2P5L C;  4I02 A;  1I1G A;  3JRA A;  1WI3 A;  2M4K A;  4C3H J;  4ABZ A;  2KIM A;  3DQV C;  3JSP A;  4X6A J;  3TL4 X;  3I9V 2;  2E2I J;  5IP7 J;  3MKW B;  4UY8 I;  5DEQ A;  4BE2 A;  4F55 A;  4PJM A;  5CJ9 A;  4KT6 A;  3V8J A;  3PNV A;  4AID A;  1LPQ A;  4BQN A;  2Z1D A;  2Y9Y A;  4ZDL A;  1GT0 C;  1T33 A;  3BOQ A;  4Q47 A;  2IP2 A;  2CMP A;  4XM3 A;  2EWN A;  3LWF A;  4BAY A;  2NVY J;  1MBF A;  1SD6 A;  3DFG A;  4G94 A;  1BOA A;  5HLT A;  4YFX F;  2V1D A;  3RKY A;  3H92 A;  2VBY A;  3H9G A;  3ZXS A;  2EV5 A;  2Y75 A;  3OYE A;  1Z7L A;  2RVC A;  2G7H A;  5L3F A;  1ORK A;  4HLY A;  4NC7 A;  2F5V A;  3HPG A;  3TOA A;  4EGY A;  3KP7 A;  5DD4 A;  4CGZ A;  1FZP B;  1HDP A;  2MGQ A;  3BJ6 A;  2ID6 A;  1JTY A;  2AS5 F;  2XDV A;  4BE1 A;  1FPQ A;  2EIL H;  1G4D A;  2KIQ A;  2JZY A;  5CQG A;  3KZY A;  2F5F A;  5KAI C;  4DW6 A;  1D1A A;  1HSJ A;  3NWT A;  4U87 A;  1ZGA A;  3BPX A;  2AQF A;  3JAM Z;  4Y52 J;  2IS1 A;  5K5O A;  1TWG J;  4XKW A;  4MEX F;  2QQA A;  5DCM B;  2K9Q A;  3F3X A;  5H20 A;  2Z16 A;  2X48 A;  4LG0 B;  2LBF B;  2B7E A;  1GXP A;  1QRY A;  1KQ8 A;  3I3L A;  1V3F A;  4G6Q A;  3ZQC A;  3HGG A;  2XVC A;  3QYE A;  3RZD J;  2CUE A;  2RGV A;  4LJZ F;  1MMA A;  1ZK8 A;  1FYK A;  3MZ8 A;  1IXR C;  1T0F C;  1N77 A;  5LEJ A;  2ECC A;  3TQN A;  1LUJ B;  2CQX A;  3B6A A;  4I6Z A;  2EIM H;  4I2O A;  1FOY A;  3VSK A;  2W25 A;  1C0W A;  1OR7 A;  1U2W A;  1R5I D;  2FJ1 A;  3JTG A;  5GAG J;  5BOX A;  1JE8 A;  2MD5 A;  3F72 A;  1R7J A;  4GGG A;  2YU3 A;  4EJU A;  3PIP F;  1YX5 A;  1R6R A;  3O8H A;  2MLG A;  2G7U A;  2WTE A;  2EPF A;  3CTA A;  2XRN A;  2ZB9 A;  1IRZ A;  2K9M A;  2HVS A;  2AHQ A;  1SD5 A;  4A93 J;  2FNA A;  2HOA A;  1HQC A;  2QSF X;  4BXF A;  2JA2 A;  3QU3 A;  2OTL I;  4V19 K;  3G1M A;  3OYN A;  1B8I A;  2BY1 A;  3EYY A;  3W6K B;  4B4C A;  4JX6 A;  5HLH A;  1X1C A;  3BWG A;  2OTJ I;  4CYC B;  4BXX J;  4XQF A;  5B3S H;  5FLV A;  1AWC A;  2OZ6 A;  2L5Q A;  5L3C A;  3OYC A;  5GTI C;  3F8F A;  3QOD A;  2J5O A;  2MD0 A;  1T2K A;  2VI6 A;  2LNB A;  1TT5 B;  1SFE A;  3B6C A;  1IC8 A;  4A3L J;  3A0B C;  2COB A;  2TDX A;  4XLH A;  1IRF A;  2LSO A;  3CCM I;  2DQR A;  2LG4 A;  2VOO A;  2XIG A;  1WFX A;  2Z9O A;  2EIJ H;  4ESJ A;  3F21 A;  3VFZ A;  4O5V A;  1WSU A;  2R92 J;  3U2R A;  4E4H A;  4KMU X;  3HRM A;  3HOS A;  4LOC A;  3DXJ F;  1I3A A;  2DW4 A;  1POG A;  4NBQ A;  4G8X A;  3I58 A;  1ZRC A;  2PFB A;  2DT7 B;  3GFL A;  4M9S A;  1ULY A;  3BTI A;  5ICC A;  5DM6 F;  2DA4 A;  3KET A;  1KU7 A;  1VQL I;  3VOD A;  3K7A J;  2CV0 A;  4MFE A;  1QZE A;  1D1C A;  4F93 B;  3J7A Y;  3BJA A;  1Z6T A;  4M73 A;  1ZG1 A;  2YX7 A;  4XK4 A;  2E2J J;  1YFH A;  3S1N J;  2XRO A;  3E6C C;  3H36 A;  3LSP A;  4O3M A;  1R1V A;  3ONQ A;  1K78 A;  1YS7 A;  1N25 A;  4BUP A;  4U7D A;  1JHH A;  2HVQ A;  3LSJ A;  4C2T A;  1TTY A;  1LVA A;  3AAF A;  4MLO A;  1EV7 A;  3K4L A;  5DTD A;  4RLF A;  1U8B A;  3GZN B;  2FD5 A;  2IGK A;  3DEU A;  1X4P A;  2KMU A;  4MFD A;  1MNM C;  1XCV A;  4L5E A;  4KIB A;  3AKZ A;  2L7Z A;  4D1Q A;  1ZYR F;  1Z05 A;  2XPU A;  2IA2 A;  4AWX B;  2DBB A;  4E7I A;  2WAQ A;  4OMY A;  3WTX C;  1TWF J;  3OYF A;  4BDY A;  3QU6 A;  3L2U A;  1BW6 A;  1B9N A;  1LFB A;  4LB6 B;  4KN4 X;  5TRD A;  2KPM A;  3JRI A;  4GRI A;  3ML6 A;  2F5E A;  4DGW B;  1G3Y A;  3KLO A;  2LFB A;  3MKZ A;  2L54 A;  3M8F A;  3JRD A;  1JGS A;  3ELK A;  2XSD C;  4G7O F;  1YHQ I;  5C3E J;  5HDN A;  4AVP A;  1A6I A;  2GA2 A;  1SD4 A;  5D5V B;  3OSF A;  4CXF A;  3K2A A;  1FY7 A;  3J7Y J;  2HTS A;  2FMY A;  2BEO A;  3NAR A;  1R22 A;  2IAI A;  3CLO A;  3KEO A;  3WE2 A;  2OU2 A;  3QPL A;  3S2H J;  4EAT A;  4RBO A;  3KYC B;  5FD5 A;  5E3L A;  1QHH D;  2VOD A;  5FKM A;  2O8K A;  1XN7 A;  2ZXH A;  1JJ8 C;  4E7H A;  4P9F A;  1JUS A;  2RQP A;  4DZP A;  2EZK A;  2L9R A;  4XLE A;  2E1O A;  2F6C A;  1SFO J;  1DGW Y;  1ONV A;  3LA7 A;  3PQK A;  3TDU C;  2MC3 A;  3KP4 A;  2MC4 A;  5F27 A;  1Y56 A;  2M7B A;  4PJJ A;  4Q48 A;  2K9N A;  5CPR B;  3IKT A;  5L3B A;  4KNY A;  3RZO J;  4DQ2 A;  3JAM K;  5CVV A;  3C1D A;  1IJW C;  1SVL A;  5F0F A;  3CJT B;  1XD7 A;  1T6S A;  3WG9 A;  2WY8 Q;  4BXU A;  2DU9 A;  1VQ5 I;  3PO3 J;  2XGD A;  2ISZ A;  1FNN A;  2UWM A;  2KRC A;  3FK6 A;  3GME A;  1IN7 A;  4A5M A;  4QWQ A;  1P92 A;  3JTH A;  3KEQ A;  4OAY A;  1PP7 U;  2ZC2 A;  3BPV A;  4MHG A;  3I71 A;  4PJL A;  2BY2 A;  3GTK J;  2DFF A;  1I5Z A;  2ZNY A;  1SFX A;  5C4X J;  1H9T A;  4IEJ A;  1Z77 A;  2DFH A;  3K9T A;  1B8I B;  2QQB A;  3EQL F;  2PJR B;  2F4O B;  4IZZ A;  1XDU A;  2ZXI A;  2H1L A;  2KRF A;  4A2U A;  1FP1 D;  1YI2 I;  3BR0 A;  5KHD A;  5FLM J;  2GOM A;  4D7N A;  3JRF A;  2IGO A;  5DYM A;  4FTH A;  4EM2 A;  1ZEL A;  2O0Y A;  3JCU C;  4AYB A;  4BL0 B;  2GXG A;  3E0J B;  5ICE A;  1IDY A;  2W84 A;  4L0Y B;  2FNP A;  3ERE D;  3RKX A;  4UV9 A;  4HX8 A;  1PDN C;  3FBN B;  2IGN A;  5E79 C;  2DA7 A;  2KFD A;  1Z7U A;  2PJP A;  1HDD C;  1FEX A;  2NVU B;  4P55 A;  2RQQ A;  5F0C A;  1ETV A;  3ECO A;  3DBH B;  1E17 A;  3OY9 A;  5HS8 A;  2W82 A;  3GTP J;  3M3Y J;  2WB1 A;  2M30 A;  3AG2 H;  1TW2 A;  3LL7 A;  4M9Z A;  4CIC A;  2D1H A;  1UEL B;  1U9N A;  5JLW A;  4I09 A;  4F7Z A;  4RAY A;  3CDI A;  3IHU A;  4HQE A;  3ZGK A;  4JK1 X;  4PK4 A;  4XR6 A;  4HX4 A;  4NDL A;  3K70 C;  4CCN A;  2A61 A;  3HM5 A;  3I0T A;  4RLQ A;  5ILU A;  1ZR4 A;  2H09 A;  2ZME A;  3KE2 A;  3E6M A;  3F8C A;  3R0A A;  2XGC A;  3BG6 A;  3IL2 A;  1Z21 A;  4UV8 A;  3V8L A;  3CF5 F;  1BI1 A;  4HZF A;  1JTX A;  3K4B A;  2BY0 A;  4BE0 A;  2JSP A;  3D5L A;  4FIS A;  1UZC A;  2L9S A;  3FXM A;  5HS7 A;  4D0P A;  2F2E A;  3H0G J;  1K78 B;  1Y1V J;  1HST A;  2NYX A;  2W7N A;  2AO9 A;  5EEG A;  2A5W A;  1R4N B;  2IEK A;  3OL3 A;  5CKT A;  4EEF G;  4XRS G;  2YR2 A;  1REP C;  4QLC U;  5F1J A;  4XN3 A;  1IV6 A;  3VDX A;  4PCQ A;  1WJF A;  3MD2 A;  4JYK A;  5K7Z A;  2R7S A;  5JHF A;  2K3F A;  2NVX J;  2CG4 A;  4A0Z A;  2CV1 A;  3FXK A;  4BBS J;  3R0J A;  2E1M B;  2LY2 A;  3I54 A;  4IXA A;  4J00 A;  1R23 A;  3QYF A;  4IQJ A;  2QYO A;  1YIJ I;  1ZGW A;  3LNQ A;  5LLQ A;  4UUV A;  4M71 A;  2NVQ J;  1D8J A;  1VFC A;  1WHU A;  2BBY A;  1BI3 A;  1ETO A;  2YU9 J;  3A02 A;  4FET A;  4ZYD A;  3MAJ A;  4BHC A;  1MND A;  2R7T A;  3GTG J;  3CJN A;  1IDZ A;  1QPM A;  3HRS A;  1CF7 A;  3MZH A;  1O3T A;  3O6B B;  2STT A;  2AQE A;  2P4W A;  1AU7 A;  1LKX A;  2DO7 A;  5A2Q K;  3G3Z A;  1YE9 A;  2MFZ A;  2QKM B;  4I99 C;  3CC4 I;  2MYS A;  2R5Z A;  2LVS A;  2CJJ A;  4U88 A;  1OCP A;  1O3R A;  1VQK I;  1CQT A;  5J4Y A;  4LIU A;  2LD5 A;  2HDC A;  4DBR A;  2XGE A;  3SDB A;  3CP2 A;  5FKO A;  5K5Q A;  3G4S I;  2R7F A;  2B0L A;  2K7L A;  2KIF A;  2VLA A;  5J6X A;  4TV7 A;  1M1E B;  3X2Q H;  4L9J A;  3S93 A;  2RV8 A;  3U1K A;  2DT6 A;  3ZRG A;  1SAX A;  2OUM A;  2PMZ A;  4NUB A;  3LSR A;  5DDG A;  1MKM A;  1ZLJ A;  3OIO A;  3KFW X;  3ECH A;  4DYC A;  2H94 A;  5F08 A;  4BQQ A;  2R5Y A;  1MDM B;  3BG9 A;  3KZI C;  2PMH A;  1E3P A;  5E20 A;  4BQO A;  3SDG A;  5J1R A;  4XLP F;  1JHF A;  4U0Y A;  2IS2 A;  3QPT A;  3NWS A;  2FBH A;  2GIZ A;  4HA8 A;  3OS2 A;  4GDF A;  2DA1 A;  4ZYH A;  3ESW B;  2DI3 A;  1X3U A;  5KNL A;  2IT0 A;  3H5A A;  3EUH C;  1GVD A;  3OYM A;  2FOW A;  3GX4 X;  4XLA A;  2MAB A;  4RB0 A;  2E5Z A;  2IA0 A;  3BZ6 A;  3IH4 A;  1JT6 A;  4FHT A;  3QQA A;  5EEA A;  3HUG B;  3HOV J;  1IN4 A;  2R7W A;  3E5U A;  3QOP A;  4LIV A;  3OYH A;  3UR3 C;  3CC7 I;  2GA1 A;  2JT1 A;  2WAE A;  9ANT A;  1IUF A;  2V1N A;  2ZJ2 A;  1QBJ A;  1VQN I;  2V1U A;  1W0T A;  2DOA A;  2XB5 A;  3O8G A;  4M9X A;  3CO6 C;  3BLY A;  1T0F A;  2YS9 A;  1ZAR A;  3VPR A;  4EVI A;  2LOO A;  2Y0M A;  2VE9 A;  5K7F A;  2FML A;  3U9G A;  2LK2 A;  2M4G A;  1NG7 A;  2O6G E;  1BL0 A;  1S8N A;  3NRV A;  5BMZ A;  4RM2 A;  3A01 B;  3ZQQ A;  2OF7 A;  2E2H J;  2HDW A;  1XGS A;  3TBI A;  3MKY B;  3S1M J;  2JTV A;  2X9D A;  4HV5 A;  1VTN C;  3ZR8 X;  3MZY A;  3BY6 A;  3OOP A;  3W2W A;  2PEX A;  4DJA A;  4XID A;  1OJL A;  1X1D A;  3PL8 A;  3DU6 A;  1WKM A;  3ZCO A;  2A5Y B;  2XHK A;  2ZME B;  1FSE A;  2WAD A;  4IHS A;  3Q9S A;  1YG2 A;  1UJ8 A;  4WX9 A;  3FMQ A;  1BC7 C;  4A3G J;  3CP8 A;  2M1B A;  5CVU A;  2EK5 A;  1OCZ H;  3O3K A;  1GVJ A;  4A6D A;  3IV5 A;  3RI4 A;  1Y0N A;  1XMK A;  4OIO F;  2BOL A;  3DP7 A;  5TJJ A;  3JRC A;  4KN7 X;  5IT3 A;  4G7Z F;  1XCB A;  1WCM J;  3GO5 A;  3FHZ A;  1E0E A;  1PP8 F;  4ZDP A;  5CVR A;  1S6L A;  1LFP A;  1Y0U A;  2VJI A;  2F48 A;  3Q9V A;  2QEN A;  3I5U A;  1WH7 A;  1XSV A;  5D5U B;  4HF2 A;  1RUN A;  3J7Z I;  1B59 A;  3RIR A;  3GEZ A;  2EJR A;  5C4J J;  2NNY A;  1IN5 A;  2VBZ A;  4KIG A;  4BHP A;  3WGG A;  1J0R A;  1SFK A;  5L3E A;  1VZ0 A;  3I53 A;  4Y17 A;  1NHA A;  3K69 A;  4IOC F;  2MH9 A;  1YRN B;  2M87 A;  1G3W A;  1I6H J;  3KP6 A;  4Y15 A;  4N0B A;  3BG3 A;  2CW0 F;  2JUC A;  4NQW A;  1TNS A;  5B66 C;  3AG1 H;  2H27 A;  1EH8 A;  5E8I A;  1OQY A;  3ZQH A;  3WTZ A;  3T5X A;  1CF7 B;  4CSW A;  3V8K A;  3AL0 C;  3HG9 A;  4IHX A;  1S5L C;  3RPQ A;  3DPL C;  3MEX A;  3DTE A;  1EF4 A;  1NH3 A;  3P5J A;  4RGS A;  2IBD A;  1RI7 A;  3SJM A;  1RIO H;  3J81 K;  2HXI A;  3RSN A;  5GAH J;  4FAS D;  2R5Z B;  1R1U A;  2GXA A;  3SZT A;  2X1E A;  1RC9 A;  4WXH A;  3WHB A;  3N4M A;  5LGU A;  1XGM A;  4JOM A;  3N97 A;  5FFZ A;  2OBP A;  2ESH A;  4WCG A;  3CCR I;  3M8J A;  1ZRF A;  4IHY A;  4OIN F;  2VC1 A;  2GOX B;  1MD0 A;  1X1B A;  3TGN A;  2EV0 A;  3BR5 A;  3A2K A;  4I98 B;  4XL9 A;  1ZLK A;  1WQ2 A;  4ESF A;  3WTW C;  1EH6 A;  4ENJ A;  1TW3 A;  2K27 A;  5EF6 A;  2K9L A;  1Z9C A;  1V54 H;  3ZOB A;  3LA2 A;  5FFX A;  1MBE A;  2K40 A;  3C2B A;  2M7A A;  1OLT A;  4BGD A;  1LNW A;  2FQ3 A;  5ILV A;  1KQ9 A;  3FM5 A;  3DBL B;  2EB7 A;  1OCT C;  2PBI A;  4RM3 A;  3RJP A;  1WH5 A;  2DA5 A;  3B73 A;  5HLI A;  1T95 A;  4KFC A;  1F36 A;  2DA2 A;  2YPR A;  3VB2 A;  4YRV A;  5F1R A;  2Y31 A;  5J4V A;  1YJW I;  1MMS A;  4GCV A;  2PI0 A;  3W2A A;  2BV6 A;  1S7O A;  3K70 D;  3HOT A;  4XNF A;  1BI2 A;  5J1U A;  2ACJ A;  4KYW A;  1UG0 A;  4M3E A;  3CES A;  3M1E A;  1I39 A;  3BQZ A;  4BNC A;  3FF5 A;  2LTP A;  5D8L B;  1T39 A;  2XAH A;  3HJE A;  1HC8 A;  1P4W A;  5LFA A;  1WZ2 A;  4C3J J;  2VPL A;  2C6Y A;  1ETX A;  2UV1 A;  4A3B J;  4DZJ A;  2R3S A;  2JQ7 A;  4A69 C;  3VOE A;  4WWC A;  1J59 A;  1OMI A;  2A69 F;  3BZK A;  4B44 A;  2V4J C;  2L7M P;  2MLK A;  3CCV I;  4R79 A;  5J8C A;  2JMW A;  3FBI B;  4O6J A;  3Q5F A;  4PSW A;  2DCE A;  1IGN A;  2HYJ A;  2H1K A;  4HW0 A;  3ISP A;  3ZP5 A;  1BJA A;  4HV6 A;  1A04 A;  3BCA A;  3EDP A;  1E3H A;  4Q4Z F;  1T08 B;  2DYS H;  3G1O A;  3HGY A;  3DKY A;  2HVR A;  2PN6 A;  4JX4 A;  2HZD A;  5LBQ A;  1L0O C;  2CGP A;  5J1Y A;  4N4O B;  1HW1 A;  5HNF A;  4ENM A;  3HIF A;  2ECB A;  1Q1H A;  3JRE A;  3FIW A;  2H6B A;  1RKT A;  4YEL A;  1FLI A;  1GXQ A;  2NS0 A;  2VKE A;  5L3G A;  2DN0 A;  1XC5 A;  3C3W A;  2R93 J;  5JVG F;  1EKE A;  4KMF A;  3ERM A;  1MJ9 A;  5L3D A;  4L9T A;  4EM0 B;  1WGX A;  2MBF A;  2XKP A;  1IN8 A;  2M3A A;  4IRI A;  3GWZ A;  1MMD A;  3DCF A;  3WHC A;  4M3G A;  1V5F A;  3FMS A;  2H8W A;  1XSX A;  3BTC A;  4XMY A;  4ESB A;  3OYG A;  3ZPL A;  3Q0U A;  4EQQ A;  4H0E A;  3R6S A;  3ASO H;  4GYI A;  1S72 I;  2O5R A;  2HS5 A;  2XF5 A;  1TZL A;  3LQR A;  1VQ8 I;  3OYB A;  1RRJ A;  5EZG A;  2FA5 A;  1Z3X A;  5D6E A;  3OV8 A;  3RQ4 A;  5IP6 A;  3E7L A;  1ZGJ A;  2CQK A;  3ZQI A;  2DXI A;  4N9H A;  1ZHF A;  4GO1 A;  5JLX A;  4AIJ A;  2Y2Z A;  2RNJ A;  4KJZ A;  2GLO A;  4EJO A;  2IXS A;  3DBR B;  4U7B A;  3H1C A;  5DUK A;  2ZXJ A;  4ZJZ A;  3H35 A;  3RQI A;  3WTV C;  2BGC A;  4PDK A;  2JPC A;  3L2W A;  1ACI A;  2X1C A;  2QKL B;  4ETS A;  2B9S A;  4HLX A;  2HR3 A;  1MGT A;  4QTR A;  3LMM A;  1FTT A;  3M07 A;  3M7G A;  1VQ6 I;  3CJR B;  3DU5 A;  2ZBK A;  4LB5 A;  4HG2 A;  4NQW B;  1OIS A;  3CME I;  3RPU D;  1T38 A;  3CMM A;  2CH0 A;  1F5T A;  2VN2 A;  2WV0 A;  3FZV A;  2IS4 A;  5IOY A;  1I1S A;  4JP0 A;  4EJV A;  1OCC H;  2ZNZ A;  4E6K G;  1U6G A;  4Y3O A;  5LD2 C;  1Y1W J;  3KPH A;  4P1W A;  5E17 F;  1DP7 P;  1R9T J;  2XAJ A;  5BS6 A;  1B9M A;  1B6A A;  1IF1 A;  4N4N B;  5BQT A;  3PIO F;  4L5J A;  2HI3 A;  2HKX A;  1A6Q A;  1FX7 A;  1MBK A;  4BS9 A;  1K83 J;  4IHW A;  3TKY A;  3F0C A;  2RDP A;  3TP3 A;  2XAF A;  2DDB A;  5IT9 K;  3E5Q A;  5A2Q Z;  4Y7N J;  4XKB A;  3PFI A;  3DF8 A;  1G6N A;  2KLO A;  3BR2 A;  3DEW A;  2FOK A;  1DP3 A;  3O2P E;  1HLV A;  1DDN A;  1QGP A;  2OPT A;  2VIX A;  2KDZ A;  1O3Q A;  3HOU J;  1V5E A;  2R7O A;  1FT9 A;  5GTH C;  3HTU A;  4UNO A;  4PSX A;  4I0B A;  4X0G A;  2YX4 A;  3IWZ A;  2NRA C;  4J01 A;  3TED A;  1APL C;  1TC3 C;  1FOX A;  4Z6Y A;  1U5T A;  2PX9 A;  1YIT I;  3HXL A;  3V7C A;  1KU9 A;  3GXO A;  5BPI A;  3OIQ A;  2DOE A;  3ABU A;  2E34 A;  4L5I A;  2XAU A;  2A05 A;  4UUT A;  2KKO A;  3VYS B;  2EIN H;  2JWT A;  1X2N A;  4HAM A;  4ENK A;  5FJ8 J;  4BDZ A;  2CW8 A;  4BH9 A;  4L0Z B;  3R61 A;  3K4M A;  4EJW A;  1XGN A;  3WTS C;  1VND A;  1QVT A;  1D0Y A;  3W3C A;  2CRG A;  5M5W J;  2I8D A;  3ABM H;  3D5R C;  3CDL A;  3CUQ A;  2ZFW A;  1MBG A;  2OCC H;  4RB2 C;  2AXL A;  1S9H A;  3JRG A;  2EV6 A;  1LEA A;  4Z2Y A;  3HC7 A;  4CCK A;  2A68 F;  1RET A;  3K2Z A;  2V6C A;  1SFU A;  3OYI A;  2EZH A;  4ON0 A;  3V7R A;  1R71 A;  2QCO A;  3BDD A;  2E7W A;  2GAU A;  1BR1 A;  2MSY A;  1UMQ A;  5D5X B;  5M3F J;  3HOY J;  3DPU A;  3TO9 A;  1XPX A;  2CYY A;  3TOB A;  5FGM A;  2K5C A;  4CDG A;  1DU0 A;  2VKD A;  2A3S A;  2VJ4 A;  3LAJ A;  1LFU P;  1JJ6 C;  3D0S A;  2R7V A;  1OR7 C;  3DTI A;  3H9J A;  1D0Z A;  2Z2S B;  4F3Q A;  1GLN A;  2PG4 A;  3FX3 A;  3A1Y A;  4XRF A;  3RPU A;  1U8R A;  2GWR A;  5IP9 J;  1P7I A;  5EYR A;  1ZN2 A;  3EUH A;  1EJ9 A;  2HKO A;  2X6W A;  4G6D A;  2V6E A;  1A31 A;  4DOZ A;  1R00 A;  1YJN I;  1TWA J;  1UST A;  2DT5 A;  4D5F A;  2XRL A;  2L7K A;  4HOB A;  3L2V A;  2Z33 A;  2HNH A;  3U1D A;  1J75 A;  3J80 K;  1DPU A;  2KZG A;  2KZV A;  1MSE C;  2VKV A;  2HQ5 A;  1AKH A;  2BXZ A;  2IPQ X;  2LKS A;  1K4T A;  3KCC A;  3H5R A;  4ZYE A;  1YS6 A; 
#chains in the Genus database with same CATH homology
 5IP7 J;  1FIA A;  1ZQ3 P;  2DA1 A;  2NS8 A;  5IOZ A;  2WAQ N;  1GVD A;  2LP0 A;  2Y9Y A;  5M5Y J;  1GT0 C;  4A3M J;  1T33 A;  1FTZ A;  1TWC J;  2DJN A;  3BTJ A;  2DMU A;  3IH4 A;  1JT6 A;  2NVY J;  1MBF A;  3QQA A;  5EEA A;  3HOV J;  2O7O A;  3RKQ A;  2EBI A;  3L1P A;  2VPR A;  1ORK A;  5EG0 A;  9ANT A;  1IUF A;  2LLK A;  1W0T A;  1HDP A;  2MGQ A;  2XB5 A;  3O8G A;  3ZQF A;  3HDD A;  2YS9 A;  2ID6 A;  1GV5 A;  3VPR A;  1JTY A;  5K7F A;  2DA3 A;  2LK2 A;  2QF7 A;  1X2M A;  1BL0 A;  1NK2 P;  4DW6 A;  4XIC A;  3A01 B;  2L7F P;  2OF7 A;  2E2H J;  1H88 C;  3SFI A;  4Y52 J;  4W97 A;  3S1R J;  1ZR2 A;  1S7E A;  3S1M J;  1TWG J;  2X9D A;  4D5C A;  2K9Q A;  2X48 A;  4DYQ A;  1QRY A;  4XID A;  3ZQC A;  3HGG A;  1OJL A;  4UUS B;  3RZD J;  2B63 J;  2CUE A;  1ZK8 A;  3FIS A;  3I4M J;  4B3A A;  2RAE A;  1OFC X;  2ECC A;  1JGG A;  2CQX A;  3B6A A;  4I6Z A;  1U78 A;  4A3G J;  2MG4 A;  4XRM A;  3IV5 A;  4A3K J;  2FJ1 A;  1ETQ A;  4AC0 A;  2HXO A;  3JRC A;  1JKQ C;  4X1E A;  1WCM J;  2GBY A;  2NOG A;  4G12 A;  4XRS A;  3O8H A;  3FKI J;  1ETW A;  2R7Z J;  2ZB9 A;  5E3M A;  1IRZ A;  1GV2 A;  5IPA A;  1WH7 A;  2AHQ A;  4A93 J;  2HOA A;  1FJL A;  1P7J A;  3HB9 A;  3S14 J;  2KT0 A;  2TRT A;  5C4J J;  3G1M A;  2Y9Z A;  1MH3 A;  1E3O C;  1PUF A;  1VF9 A;  1B8I A;  4B4C A;  4JX6 A;  3CMY A;  2L0K A;  2P81 A;  4CYC B;  5BNG A;  1YRN B;  1I6H J;  4BXX J;  5FLV A;  3BG3 A;  5IYD J;  4BBR J;  2JA6 J;  3M4O J;  4AYB N;  2LR8 A;  4V2G A;  1RES A;  2VI6 A;  3ZQL A;  1I3Q J;  2JN6 A;  3ZQH A;  3B6C A;  3BT9 A;  2EZI A;  1IC8 A;  4IHX A;  4A3L J;  2COB A;  1EF4 A;  1GUU A;  2IBD A;  3SJM A;  1NK3 P;  1SAN A;  1ETK A;  2HXI A;  5M5X J;  4A3J J;  2R5Z B;  3TP0 A;  3WHB A;  4IHY A;  5C44 J;  2R92 J;  3CCY A;  2M34 A;  2WB1 N;  1I50 J;  2M8G X;  4LOC A;  4QIW N;  3BR5 A;  1H89 C;  1POG A;  4FE7 A;  2MW8 A;  3BTI A;  2DA4 A;  5EF6 A;  1JKP C;  5IYC J;  3ZOB A;  3K7A J;  1MBE A;  2K40 A;  4MFE A;  3C2B A;  4IHV A;  1LE8 A;  2NVT J;  3HOZ J;  4XK4 A;  3IH2 A;  1OCT C;  3Q0W A;  2E2J J;  1WH5 A;  2DA5 A;  4FE4 A;  3S1N J;  1XG1 A;  1F36 A;  2DA2 A;  2H8R A;  3LSP A;  2JA5 J;  2Y31 A;  5EGO A;  2ME6 A;  1JKO C;  3LSJ A;  3A01 A;  1AKH B;  3JRB A;  4MLO A;  5DTD A;  1U8B A;  4A3E J;  4S0H B;  5J1U A;  2FD5 A;  3GTO J;  4M3E A;  4MFD A;  2N8G A;  1MNM C;  3BQZ A;  4L5E A;  4V2F A;  3GTL J;  2L7Z A;  2LTP A;  1JKR C;  2XPU A;  2XB0 X;  3OSG A;  1UHS A;  4C3J J;  1HCR A;  1K61 A;  1TWF J;  1ETX A;  1BW6 A;  1UG2 A;  4A3B J;  4DZJ A;  1LFB A;  1H8A C;  4A69 C;  3JRH A;  1D5Y A;  3JRI A;  5E3N A;  3G1L A;  2L7M P;  1RKW A;  4RDU A;  3IH3 A;  2LFB A;  3PM1 A;  2JMW A;  2HOT A;  3JRD A;  1FIP A;  5J3L A;  2XSD C;  2DMT A;  4AUX A;  3GTJ J;  2M2E A;  1IGN A;  1B72 A;  2LY9 A;  5C3E J;  2HYJ A;  5EG0 B;  1JT0 A;  2H1K A;  1A6I A;  2DA6 A;  3OSF A;  5GP9 A;  3K2A A;  3G1O A;  5DS9 A;  3HGY A;  3NAR A;  2IAI A;  4JX4 A;  3QPL A;  5J1Y A;  3S2H J;  5M3M J;  2CUF A;  4RBO A;  1QPI A;  1JUM A;  2VUM J;  5E3L A;  1VI0 A;  5FKM A;  2O8K A;  4M3F A;  2ECB A;  1JJ8 C;  5F0H A;  1JUS A;  3JRE A;  3FIW A;  4CYC A;  4DZP A;  1RKT A;  2EZK A;  2L9R A;  1YRN A;  2E1O A;  1SFO J;  2R93 J;  2VKE A;  1ENH A;  2DN0 A;  1XC5 A;  2R0Q C;  2JJ7 A;  1A5J A;  5F04 A;  3GTM J;  1WGX A;  3BR3 A;  5F27 A;  2PMZ N;  3DCF A;  1O4X A;  3WHC A;  3Q3S A;  2K9N A;  4M3G A;  4GFB A;  3RZO J;  3BTC A;  1IJW C;  3Q0U A;  5K7H A;  5F0F A;  1HF0 A;  3TW7 A;  5EZG A;  3PO3 J;  2XGD A;  2LKX A;  1T56 A;  5IP6 A;  3E7L A;  1XS9 A;  3ZQI A;  3FK6 A;  3MKL A;  1GDT A;  1ITY A;  3GBG A;  5JLX A;  2GLO A;  2WV1 A;  2Y2Z A;  3BG5 A;  1MBJ A;  2M9H A;  5FKL A;  4BY1 J;  2CU7 A;  3RQI A;  3GTK J;  1MSF C;  2D5V A;  5C4X J;  2NS7 A;  3MN2 A;  4IEJ A;  1Z77 A;  1PUF B;  1B8I B;  4JX5 A;  3H3V K;  3LOC A;  3BR0 A;  4M3D A;  1Z0X A;  5FLM J;  4D7N A;  4QTR A;  2DTZ A;  4DYR A;  3JRF A;  1FTT A;  3HOX J;  4FTH A;  1ZKG A;  5GPA A;  4D7M A;  1G2H A;  2EH3 A;  3JR9 A;  3ZQG A;  3D1N I;  1IDY A;  2DMP A;  3S16 J;  5IOY A;  4BKX A;  2G0E A;  3A03 A;  5GPC A;  2DA7 A;  2K9S A;  2FX0 A;  4J19 A;  4JP0 A;  3S17 J;  5FKN A;  1HDD C;  1FEX A;  2R5Y B;  5F0C A;  1AHD P;  1ETV A;  1Y1W J;  1R9T J;  2E19 A;  3GTP J;  3M3Y J;  4A3D J;  4C2M J;  2HI3 A;  2HOS A;  1MBK A;  1U9N A;  4B1R A;  1K83 J;  5JLW A;  4IHW A;  2FQ4 A;  3F0C A;  1WPK A;  5EZH A;  3TP3 A;  5E3O A;  1RPW A;  4MIM A;  1HOM A;  2I10 A;  4NDL A;  5IYB J;  4UUS A;  3HBL A;  3UKG A;  2XPV A;  3Q0V A;  4Y7N J;  2X6O A;  4A3C J;  3HM5 A;  4MO7 A;  1ZR4 A;  2TCT A;  1BA5 A;  2ME0 A;  4I76 A;  1LE8 B;  3BR2 A;  3DEW A;  2XGC A;  1F43 A;  2XPW A;  4FCY A;  1HLV A;  1JTX A;  1Q1V A;  2OPT A;  3HOU J;  2KDZ A;  1MBH A;  2Y30 A;  4W1U A;  4FIS A;  1TWH J;  3HKZ N;  3H0G J;  2DMQ A;  1Y1V J;  3TED A;  5EGO B;  1APL C;  1TC3 C;  2AO9 A;  2IEK A;  4EEF G;  4XRS G;  5F1J A;  1W0U A;  1IV6 A;  5EDN A;  1DU6 A;  4JYK A;  5K7Z A;  3BTL A;  2EQR A;  3CQZ J;  2NVX J;  4BBS J;  2EZL A;  1X58 A;  2JK3 A;  4UUT A;  2YUS A;  1U9O A;  4M3B A;  2JWT A;  1X2N A;  1ZGW A;  3NAU A;  2M0C A;  5FJ8 J;  3LNQ A;  3S2D J;  2HDD A;  2NVQ J;  1VFC A;  1QVU A;  1ETO A;  1MH4 A;  3PO2 J;  2YU9 J;  1VND A;  2JA8 J;  1JUP A;  1QVT A;  3A02 A;  2CRG A;  5M5W J;  1BW5 A;  3GTG J;  3CDL A;  1IDZ A;  1MBG A;  3FK7 A;  1B72 B;  3JRG A;  3LSG A;  1AU7 A;  3OOU A;  4A3F J;  2GM4 A;  5FKK A;  3HOW J;  4BY7 J;  4QSH A;  2R5Z A;  1RET A;  2LVS A;  2CJJ A;  1OCP A;  2EZH A;  2O9L A;  2QCO A;  1CQT A;  4C3I J;  2MSY A;  3HOY J;  5M3F J;  1UMQ A;  3S1Q J;  2LD5 A;  3I4N J;  3HEF A;  3BR6 A;  2XGE A;  3TW6 A;  5HOD A;  2ID3 A;  1DU0 A;  1JJ6 C;  1LFU P;  1IG7 A;  2W48 A;  5FKO A;  3BR1 A;  3BQY A;  2ELK A;  3MVP A;  5IP9 J;  1P7I A;  5EYR A;  1ZTR A;  4A3I J;  2Y0S N;  2DMN A;  2JA7 J;  1ETY A;  2CQQ A;  1RR7 A;  3LSR A;  4HNV A;  1TWA J;  4M6V A;  4D5F A;  3S15 J;  2XRL A;  3QPS A;  3OIO A;  3W6V A;  4DYC A;  3GTQ J;  5F08 A;  2R5Y A;  1NTC A;  1MSE C;  3BG9 A;  2VKV A;  3JRA A;  2HQ5 A;  1WI3 A;  1AKH A;  3SDG A;  5J1R A;  4C3H J;  4ABZ A;  4X6A J;  1BJZ A;  2E2I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...