1BL0A

Multiple antibiotic resistance protein (mara)/dna complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
116
Chain Sequence
DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*GP*GP*GP*AP*TP*TP*TP*AP*GP*CP*AP*AP*AP*AP*CP*G
publication title A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 36
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1998-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1bl0A01
1XC5A 3RQIA 4JP0A 5FKOA 3S2HJ 4X6AJ 5C3EJ 3D1NI 1H88C 1W0UA 2O8KA 3LNQA 4IHYA 1TWFJ 2M8GX 2FX0A 4LOCA 3JRAA 1MH3A 1X2MA 2NS8A 3BQZA 1K83J 1DU0A 3FIWA 3DEWA 4EEFG 1D5YA 1ENHA 1JUPA 1ZKGA 1YRNA 1IV6A 4A3IJ 1ETQA 3C2BA 5E3MA 1I6HJ 3O8GA 4M3EA 1RPWA 3BR5A 1MBHA 2DTZA 3HOXJ 5J1RA 1A5JA 3ZQHA 1PUFB 2NVTJ 2OPTA 2DA7A 3S1MJ 1ETYA 1K61A 1Q1VA 1JJ8C 3M4OJ 2L7MP 3HOUJ 2DJNA 3HDDA 2L7ZA 2Y30A 1TWAJ 3QPLA 4FE7A 5F04A 1QRYA 4V2GA 4A3KJ 1MBFA 1OCPA 2RAEA 2HOTA 1U9NA 3IV5A 3PO3J 2XB5A 1JUMA 1NK3P 2LVSA 2Y9ZA 1JJ6C 3MKLA 2XPWA 1DU6A 2DMUA 3JRFA 2R7ZJ 4M3BA 5C4XJ 4M6VA 5EDNA 1TWHJ 4BY1J 3MVPA 2VKVA 2VPRA 4A3EJ 3S14J 4B1RA 5EG0B 3HBLA 1U78A 1JKPC 3HGYA 1HCRA 2VI6A 2HI3A 2R5ZA 5EGOB 4XICA 3JRIA 3HOYJ 1H8AC 4CYCA 4A93J 2TCTA 1GDTA 4M3FA 1B8IB 4JX5A 1LFUP 3BR2A 3IH3A 5EYRA 2EBIA 4FCYA 5F27A 4DYCA 3TEDA 3NARA 1NK2P 2JK3A 2TRTA 2PMZN 1HOMA 3HKZN 2CQXA 3HOVJ 4A3MJ 4IHVA 2G0EA 1ETVA 2O7OA 5M5XJ 4A3CJ 3S1QJ 1JKRC 2DMNA 3O8HA 2R0QC 1FIAA 5EF6A 1YRNB 1GUUA 2OF7A 2WAQN 1G2HA 2I10A 1APLC 2FJ1A 1XG1A 2L9RA 1S7EA 5K7HA 1BJZA 5IYBJ 4I6ZA 4JYKA 2DA6A 3JR9A 3SFIA 1BL0A 1LE8A 5M5YJ 3GBGA 2CRGA 4JX6A 2ZB9A 2VUMJ 1XS9A 3BG5A 3BG9A 1MBEA 2QF7A 5DTDA 1RR7A 3B6CA 1Z0XA 3HEFA 1R9TJ 1IUFA 2JA5J 5FJ8J 1OFCX 4L5EA 2EQRA 1I3QJ 2R93J 5JLWA 4DZPA 2DA4A 2M34A 1T56A 5JLXA 4C3IJ 2CQQA 2XRLA 4FTHA 1BW6A 3JREA 3HOZJ 2HXOA 4AUXA 4B3AA 2HQ5A 3Q0UA 4Y7NJ 1B72B 4BBRJ 5HODA 5M5WJ 3OSFA 3DCFA 1AHDP 2XGCA 2M0CA 1F36A 2MW8A 2M9HA 2DA2A 1H89C 2R5ZB 1VI0A 3S1NJ 3CDLA 2NOGA 1FTTA 3HM5A 1A6IA 5IP6A 1JUSA 1JT0A 1HF0A 2JMWA 4CYCB 4DYRA 1FTZA 2E1OA 5FKMA 4GFBA 1GV5A 4XRMA 3GTOJ 2KT0A 5GP9A 2CU7A 1HDDC 5FLMJ 2Y31A 1X2NA 3PO2J 2DA3A 4XRSA 3OIOA 4MLOA 4A69C 1F43A 2E2HJ 3M3YJ 1WGXA 3PM1A 3BTLA 3GTKJ 2HDDA 1WH7A 1SFOJ 3CQZJ 3FISA 2LK2A 4J19A 2EZKA 5IOYA 4D7MA 3RKQA 2JN6A 1ZK8A 5K7FA 4W1UA 2ID3A 5C44J 2NVXJ 3I4MJ 1IC8A 1RETA 2B63J 2Y0SN 1AU7A 1LE8B 3A03A 2ECBA 3SDGA 5E3OA 2N8GA 3WHCA 3CMYA 3K7AJ 1FEXA 3BR0A 2HYJA 1TWCJ 2P81A 1ZQ3P 4UUSB 3A01B 3ZQCA 3S16J 1IDZA 1GV2A 2Y2ZA 2DMQA 2K9SA 1LFBA 1NTCA 1JTXA 2FQ4A 1ITYA 3B6AA 5IYDJ 2COBA 1W0TA 2K9NA 1MBJA 2ECCA 3MN2A 2JWTA 4DZJA 2X9DA 4AYBN 1CQTA 3Q3SA 2IBDA 1RESA 1IRZA 3Q0VA 2HXIA 2LTPA 1JGGA 5M3MJ 4QIWN 4MO7A 4UUTA 2L0KA 3GTQJ 3WHBA 3JRBA 1ZTRA 2DN0A 2FD5A 2X6OA 4BKXA 1ETOA 2LR8A 2K40A 3QPSA 1O4XA 4IHWA 2IAIA 2DMPA 2HOAA 3S2DJ 1EF4A 2W48A 1E3OC 1FJLA 1VFCA 1GT0C 2JJ7A 4A3JJ 1MH4A 4C3HJ 3LSPA 1P7IA 3JRCA 2DA5A 3HGGA 1WI3A 4A3DJ 2CJJA 2YUSA 2CUEA 4BBSJ 3VPRA 2XPUA 3TP3A 5FKKA 5F1JA 1SANA 3IH2A 1ZR2A 2K9QA 5K7ZA 4M3GA 3G1LA 3OSGA 2ME6A 4W97A 2E19A 3BQYA 2EH3A 3HOWJ 3Q0WA 1AKHA 1ZGWA 5C4JJ 1JT6A 1X58A 4XRSG 3G1OA 3ZQFA 1QVTA 2L7FP 2CUFA 2M2EA 4A3GJ 5FKLA 4B4CA 2XGEA 5GPAA 2ID6A 1BA5A 2NVYJ 3S1RJ 4IHXA 1U8BA 1IJWC 2WV1A 2O9LA 5EGOA 5BNGA 5E3NA 1U9OA 4QTRA 3RZOJ 1MSEC 4QSHA 5FLVA 3HB9A 2KDZA 1Z77A 4XIDA 2MG4A 2AHQA 4BXXJ 3JRDA 3FKIJ 2VKEA 1POGA 1B8IA 1MNMC 1UHSA 3BR6A 4I76A 3S15J 4C3JJ 3ZQGA 1UG2A 3ZOBA 3SJMA 1I50J 1VNDA 1UMQA 5EZGA 1Y1VJ 4D5FA 4JX4A 2NVQJ 1ZR4A 2LD5A 5F0FA 4X1EA 2WB1N 3UKGA 5IPAA 3H3VK 3JRGA 2LY9A 4DYQA 4MFEA 2E2IJ 2AO9A 4RBOA 2LFBA 2GM4A 1FIPA 2X48A 5E3LA 4A3LJ 1ETKA 2LKXA 2MGQA 4D7NA 3GTPJ 2R5YA 1JKQC 1IG7A 4FISA 1JKOC 2GBYA 1ETWA 1RKWA 3LOCA 3RZDJ 4C2MJ 3GTMJ 2HOSA 4FE4A 5FKNA 2EZIA 2Y9YA 1VF9A 2XB0X 3FK6A 3OOUA 5IYCJ 1QVUA 1AKHB 5IP7J 3ZQIA 3E7LA 3LSGA 1TC3C 1TWGJ 1WCMJ 5GPCA 2NS7A 1BW5A 1HDPA 3CCYA 1B72A 3G1MA 2ELKA 4S0HB 4AC0A 1QPIA 3S17J 2YS9A 3BTIA 3BR3A 3TW7A 4D5CA 2LP0A 1WH5A 2LLKA 2JA8J 5EZHA 1MBKA 5F08A 1OCTC 4MIMA 2JA6J 3H0GJ 2D5VA 5EEAA 1ORKA 1Y1WJ 3BTJA 4HNVA 3QQAA 4A3BJ 3BT9A 1RKTA 3F0CA 2E2JJ 1PUFA 1MBGA 3BR1A 2DA1A 3LSRA 3ZQLA 2XSDC 3BG3A 4RDUA 3L1PA 3GTJJ 2H1KA 1MSFC 1OJLA 3BTCA 3K2AA 3FK7A 5J3LA 1JTYA 2IEKA 1GVDA 9ANTA 5M3FJ 2QCOA 3W6VA 2GLOA 3IH4A 5J1UA 1T33A 3TP0A 5F0CA 4A3FJ 2YU9J 3A02A 5J1YA 2DMTA 4M3DA 4MFDA 4ABZA 5IOZA 3I4NJ 4XK4A 2MSYA 4BY7J 3JRHA 2R5YB 1P7JA 4Y52J 2EZHA 3LSJA 3TW6A 4G12A 5IP9J 1IGNA 4UUSA 2H8RA 4NDLA 4DW6A 1WPKA 3A01A 5EG0A 4IEJA 2EZLA 3GTGJ 4V2FA 1HLVA 1IDYA 2ME0A 2XPVA 2JA7J 5DS9A 2R92J 3GTLJ 2XGDA 5F0HA 3NAUA 1ETXA
chains in the Genus database with same CATH superfamily
3RKYA 3LSTA 4HQEA 4NC7A 4BHBA 4JP0A 3H5RA 2W82A 2V4JC 1W0UA 4ZDLA 3W2VA 2O8KA 2DDAA 4FX4A 4M6XA 3LNQA 1LDDA 2M8GX 1FSEA 4E70A 4KT6A 3JW4A 5DUIA 3SXYA 2PFBA 3P7NA 1DU0A 4EEFG 2IRFG 1UJ8A 1W5CC 3PUBA 1RNLA 1ENHA 1WRJA 3E0JB 1FNNA 3PSIA 3L00A 2GXBA 1YS7A 3C2BA 2HPIA 2FSWA 2HFHA 3O8GA 1AA7A 2PJPA 4CSWA 1U5TC 5FFXA 1XN7A 2F5FA 2V1UA 1Z7UA 4ZTFA 4OINF 3HOXJ 1Z1DA 2WWYA 3I59A 3WE2A 1P2FA 3A1YA 1QZEA 5L3EA 3BZCA 2F5EA 2VKHA 2DA7A 1VZ0A 5K1YA 1OCOH 2WY7Q 4CCLA 4KJZA 1R36A 2VXDA 1YJNI 3M4OJ 4EATA 3BC8A 1ZARA 2DPDA 1TWAJ 3E6CC 3CMEI 1WSUA 1EV7A 3EQLF 5H20A 3KEQA 1MBFA 3PO3J 3IV5A 1B1BA 2KP6A 5ICGA 3QU3A 4YFXF 1K4SA 2LVSA 2Y9ZA 3HC7A 2E5NA 2JRMA 2PEXA 4HW0A 3ESWB 4XLPF 1NH3A 4HF1A 5EDNA 4BY1J 4ZC3A 4F55A 2VPRA 4LK0F 4CCNA 1EA3A 4A3EJ 2XF6A 4EV0A 3OYBA 1U78A 2NYXA 2PMZA 5CVUA 2BHZA 3C2HA 3OYJA 3PIPF 5EGOB 1BI0A 4A6EA 3ZMDA 1A35A 2F4IA 4ZYEA 4L18B 4HX7A 1H8AC 4CYCA 2V1XA 4QWQA 3TQNA 5HS8A 1PUEE 2A5YB 3GLXA 2IGMA 1YG2A 4JX5A 3BR2A 3OYMA 2EBIA 1VQMI 4N0BA 2VC0A 1BN5A 3TO6A 5CVIA 3OYNA 1P4WA 3HKZN 3KCCA 2F5VA 2G0EA 2O7OA 1FYKA 5DCMB 1A36A 4A3CJ 3S1QJ 4KUMA 2DMNA 3O8HA 3RJPA 1Y39A 3M8FA 1FIAA 3QYFA 1VQOI 4R1HA 3D5SC 2CSOA 1QNTA 4E7ZA 5E1XA 2I10A 4I98B 2FJ1A 1TLHB 1XG1A 4B44A 4ITVA 1VQ7I 2KZGA 1A6QA 3ZQQA 1S7EA 3GX4X 1T08B 4JYKA 2DA6A 3SFIA 1BL0A 2VBXA 5IT9K 1IUYA 1HQCA 4WXCA 3GBGA 1YIJI 4JX6A 2BW3A 1OMIA 3K4BA 1RR7A 1Z0XA 4G9YA 3SZTA 3KZYA 3FMQA 1UG0A 4D0PA 1IRFA 3AL0B 4O5VA 3LFUA 1R5ID 3K1PA 4R79A 4KDPA 4KICA 1XMAA 4OAYA 3CCEI 5AONA 2YX7A 4L5IA 1VQ5I 1OYYA 3HSFA 1TT0A 3ZXSA 5LHIA 1UHWA 3G4SI 4KNYA 1TNSA 3HPGA 3HOZJ 1IN6A 4B3AA 1Y0UA 2KJCA 2L9NA 2BXYA 3JCUC 3L2RA 4ESJA 2JSPA 2RQQA 4RB2C 2CMPA 5J47A 3B73A 1UB9A 2M9HA 3CESA 4I09A 1EH8A 3BPXA 4GRIA 2HVQA 2R5ZB 2NOGA 5IP6A 2JMWA 2ETHA 3GTOJ 4GFBA 2QKMB 1GV5A 4BQOA 5FB2A 1K78A 1WZ2A 1J9IA 2KT0A 2DU9A 2FMYA 2EFOA 2HVRA 5D6FA 1VQ4I 2H6BA 3K4MA 2RNJA 2MD5A 5LFAA 1RR8C 4XRSA 4MLOA 5D5WB 2RDPA 3OMYA 2QLZA 2A6EF 1W36D 2LY1A 3FISA 2LK2A 4J19A 2EZKA 4A0XA 4D7MA 1ZH5A 2K9MA 2KDOA 5LLQA 3C3WA 1J09A 1ZG3A 2EIKH 1FP1D 1U3EM 3HPHA 2DFFA 5TGTA 6PAXA 2NVXJ 1N78A 1RETA 1FP2A 2KQRA 2Y0SN 2LF7A 1LE8B 3GZNB 3I54A 3SDGA 1JHFA 3CLQA 5B5EC 5E3OA 4HAMA 3K7AJ 2HYJA 2W00A 2HKXA 1G8XA 3OL4A 4UUSB 1SAUA 1QHGA 4ZZDA 5FLXK 1GV2A 1JTXA 5LD2C 2FQ4A 3HL2A 2FMLA 5DCFA 3BDDA 1W0TA 3IRQA 4HQMA 3OS2A 5B1BH 2ECCA 1K6YA 1MKMA 2R7UA 2UZKA 3J80Z 2VLAA 3OYLA 1J0RA 2IGNA 4KIGA 1N25A 3DQVC 4QIWN 1O57A 2L0KA 3ABLH 3GTQJ 1YW8A 2DN0A 4KYWA 1ETOA 3QAHA 3L9FA 2H94A 2BHYA 3SDBA 3H92A 2HOAA 3HUGA 4DOZA 3K4KA 4G6QA 3REOA 2NAZA 1YW7A 3LSPA 1P7IA 4LG0B 4KT5C 4XKWA 2ELJA 4L9JA 4MQ9F 2VOOA 2DA5A 3DLAA 1WI3A 4A3DJ 2CJJA 4JK1X 4Y3OA 5JI6A 5ICFA 5FKKA 4CCOA 2LOOA 3H36A 2LKPA 3IH2A 3GFLA 1PP7U 3D0SA 4G7HF 1S7OA 2QQ9A 2V6EA 2HS5A 1FY7A 4M3GA 3G1LA 3SYTA 5LRRA 4W97A 1P4AA 3BQYA 4EM0B 2VJIA 1UCRA 2CO5A 1DDNA 3HOWJ 3KP3A 4HBLA 4DIQA 1Y0NA 1AKHA 1ZGWA 3FXQA 1YOVB 4QPOA 1IO2A 1OYIA 1R23A 3G1OA 2QM3A 5HLTA 3LSIA 1BM9A 3MCZA 2UXXA 2G7UA 2L7FP 3T8RA 2A6HF 2IJLA 4U87A 2HDCA 2XGEA 2AQFA 5GPAA 3M8EA 5H6RA 2QGUA 1IJWC 1BC8C 3DTEA 1MDMB 5TJJA 2ZXIA 1NG7A 3ABTA 1GXPA 1U9OA 3RZOJ 1P4XA 3QP5A 5FLVA 4S04A 4HG2A 4XORA 2CQKA 2X6WA 2D1VA 4ENJA 3U1KA 4BXXJ 4FT8A 1B9NA 3FKIJ 2VKEA 4QLCU 2M7BA 4I76A 2RKHA 3ZMTA 4C3JJ 3ZQGA 3M8JA 2L5QA 1SVLA 2BVMA 2F6CA 3SJMA 2BOLA 1IXCA 2RREA 4BU2A 4LB5A 1Y1VJ 4D5FA 2L9SA 4IO9F 2NVQJ 1ZR4A 2LD5A 1BOAA 5F0FA 4U0YA 2WB1N 3O2PE 3M07A 3J7AO 2FEZA 2JT1A 3GZ6A 3H9JA 2ACJA 2LG4A 5HDKA 3HIFA 5E3LA 3ABKH 1E0EA 4BE0A 2HYFA 1ETKA 1CF7A 5CVJA 2EV0A 2DJIA 4O6JA 2MGQA 3DLLF 3GWZA 4FISA 4HF2A 1JKOC 3U21A 3N4MA 3LOCA 1Y56A 3CCSI 3PJRA 5FKNA 2ZXWH 3R60A 4P5OA 3FM3A 2EV5A 3F8BA 1VQNI 3N97A 4KIBA 1QVUA 2MLGA 3E5UA 1ZYRF 2MH9A 3LSGA 2ESNA 3DXJF 2W57A 3I3LA 3TOAA 2LH9A 1UAAA 2Y48A 4M71A 5FLXZ 3N05A 1RI7A 3CCQI 3X2QH 4EJWA 2YSRA 1E2XA 2JRTA 1MZBA 4CA0A 2E71A 2HZDA 3NWTA 3S17J 3DKWA 4LGWA 2NNYA 4MTEA 1FOKA 1G59A 5EZHA 1MBKA 3F8MA 2M87A 1Z7LA 4LJZF 2O8XA 4MIMA 2JA6J 5JFRA 1Y1WJ 1WJ5A 4HNVA 5ICEA 2E1CA 1ZRDA 3GMEA 2XF7A 3BWGA 5JR3A 2HEOA 2RQPA 5F6FA 5ILSA 3I53A 1MBGA 3BR1A 3WTWC 4LIVA 3WU0A 2DA1A 3IWZA 2PI0A 2PJRB 3LSRA 3ZQLA 1MSFC 1QZZA 2JQ7A 4ENKA 4N9HA 1G4DA 2BBYA 3JSPA 2P6TA 3C1DA 2GLOA 4RLQA 3FXOA 1T33A 5DM7F 4OU0A 4ZZLA 2H8WA 5B66C 1B4AA 2QQBA 2X1CA 1N77A 3IAM2 4EJTA 5J40A 2M3AA 1ULYA 5GTIC 5D8LB 1IV8A 3I4NJ 3MWMA 4XK4A 2MSYA 4BY7J 2R5YB 3DTIA 2NOJB 1P9QC 3TDZC 1IGNA 2EFWA 2H8RA 4DW6A 1WPKA 2KKOA 2CV2A 1LPQA 1QBJA 1BIAA 1LKXA 1R5GA 1T0FC 2Q0OA 1I1GA 4V2FA 3OYFA 4XLFA 1S5LC 2HQAA 2DQRA 1HLVA 1IDYA 1W5SA 4BEHA 2HPMA 1ZG1A 1I5ZA 1UZCA 2VJ4A 2JA7J 2K4BA 2LREA 2KISA 2R92J 1S3JA 1V3FA 2VT3A 4G6DA 2LDUA 2IGKA 2ZJPF 4FX0A 2ISZA 3NAUA 3OR1C 1KQ8A 4P9UA 3U9GA 4C2UA 4IKFA 3R0JA 2H1LA 4XMYA 3DPLC 5C3EJ 1H88C 1MNDA 3DPUA 2Y69H 3CJNA 3S93A 2OC6A 4IHYA 4R8HA 1BJAA 2J5OA 3BQZA 3QOPA 2AQEA 5K5RA 3DEUA 5D5UB 3DEWA 3F3XA 1WI9A 2VKDA 3GYHX 2GWRA 1JUPA 3I4PA 3HTSB 1BI3A 4AM3A 2F2EA 2YU3A 4IOCF 1ETQA 2A05A 4B43A 4P55A 5E3MA 4M3EA 3PL8A 3BR5A 1IN4A 2P7VB 4U0WA 2EINH 2LNBA 1SMYF 1RRJA 3F6OA 2DTZA 1EH7A 4E7LA 3RPUD 1M1EB 4N9IA 4LLGF 1O7LA 1C0WA 1JJ8C 4UNOA 2H27A 1B59A 1U8RA 2ZNYA 3QRFF 2L7ZA 4XL9A 2DTRA 2IP2A 3WU1B 3DV8A 1YW9A 3PFYA 4FE7A 1X3UA 2ZXHA 2YX4A 1W5TA 2M8EA 1W1WE 3SQNA 1QRYA 4XOPA 1S72I 1OCPA 3AG1H 2HOTA 2LMDA 2W24A 1JUMA 2O61A 1NK3P 1FMWA 1BR2A 1JJ6C 3SHFA 1ONVA 1R1TA 3FBIB 1K79A 2XPWA 1IRGA 5DUKA 3U2RA 2DMUA 4WXDA 3JRFA 3MVPA 2VKVA 4M6YA 4LG3A 3RPQA 3KYLA 2P6SA 1MJBA 1HBXG 4ASNA 5TRDA 2CS3A 3DKYA 4RM2A 3HGYA 4YG2F 1HCRA 2VI6A 3WG9A 2O5RA 2XAJA 4DBQA 5CKTA 1KZHA 1LVAA 4A93J 3VYSB 1FOWA 4YFNF 2PMUA 1FBUA 1Z05A 3CCVI 3F9KA 1E3HA 1TW2A 4XKCA 1X3WB 2CV1A 1B8IB 4F7ZA 4UV9A 4UVCA 2ZJRF 2GIZA 3MZHA 1GVJA 3IH3A 3MKYB 5CQGA 4C30A 4FCYA 1SVMA 3W2AA 4D1QA 2ZMEA 2Y0MA 1TBXA 3OL3A 2PMZN 3CP8A 2CQXA 3GFMA 1EH6A 5M5XJ 2BY0A 1JKRC 2QQ8A 4BE1A 2ZNZA 3GFJA 2DYRH 5D4RA 1QA6A 4KMUX 1W36C 2ZC2A 3ML6A 1GUUA 3E5XA 5FD5A 5BPDA 3WTXC 5LGUA 5K7HA 1BJZA 1TZLA 4EJVA 2GOXB 2A69F 2GIVA 2QKLB 1N75A 1U0JA 2DK5A 3MZYA 2CRGA 2YPRA 5CLSA 5HNFA 1XS9A 3TKYA 3TMOA 3NRVA 3BG9A 4A5MA 2R7QA 1XSXA 2JA5J 4NHJA 1EJ9A 5FJ8J 2WAEA 1I3QJ 4KA4A 2FBKA 2UWMA 5JLXA 2V6CA 4XSZF 3VSLA 2CFXA 3CCJI 3K1MA 1J5YA 2CQQA 5HLIA 1Z9CA 1FWZA 1XDUA 3OS0A 1ZAOA 1BW6A 4NB5A 1R71A 2XGXA 1BR1A 2R7DA 4OAZA 4PK4A 5HODA 1NG6A 2WY8Q 1HW2A 4LD5A 2M0CA 2KL4A 2WA0A 1WVRA 2MW8A 3WTUC 3A4CA 1D3YA 1LB2A 1L0OC 2PN6A 1VI0A 3WGIA 3T1BA 1WJEA 5LGTA 1FTTA 4HYEA 4KISA 1JT0A 4CYCB 2XV4S 4UUVA 1FTZA 2P5LC 5FKMA 4XQFA 1G3WA 4GXOA 1D5VA 4Y15A 1HDDC 5FLMJ 1P6RA 3KP7A 1P92A 3VYUB 1X2NA 3PO2J 4BJ5C 2K85A 4L9VA 3HG9A 3OIOA 3R0AA 1F43A 2CW7A 3EUHC 2C6YA 3M3YJ 1SFOJ 2VONA 2QA4I 2QSHX 1U5TA 2L2OA 3M1EA 3J81Z 1XB4A 4ESFA 4YIRX 4HPQA 3CJTB 4Y4RA 2EA2A 3CJRB 1IC8A 4AIHA 2LF8A 2B63J 3W3CA 1AU7A 3A03A 2ECBA 2ICWG 3WU2C 1D0XA 2W7NA 3KLOA 3WHCA 1KONA 1R58A 2DOAA 5HS9A 1FEXA 5BQTA 2P81A 1MJAA 3CF2A 4XNFA 3J80K 4BACA 3ZQCA 3S16J 1VQ6I 4PCQA 2BVLA 2Y2ZA 2DMQA 1LFBA 3K70D 1DP7P 1R7JA 5HLHA 4C9YA 3DF8A 1ITYA 2F5CA 5IYDJ 1FSHA 3OR2C 1BR4A 4G7OF 3MN2A 4BDYA 2JWTA 1YI2I 4IRHA 2FUG2 3D5LA 3Q0VA 1J59A 2HXIA 2QENA 3OIQA 5M3MJ 3IHUA 2R7SA 1B6AA 4UUTA 2H09A 3J7YJ 3JRBA 3RYPA 2LR8A 5D8KB 2K40A 2OZUA 1O4XA 2DMPA 3DFGA 4A5NA 5E1WA 2M45A 2W48A 2NNNA 5J8FA 1VFCA 4IQ4A 1BC7C 2Z2SB 1V5EA 1MH4A 3OV8A 3P9KA 4C3HJ 4HX4A 3OOPA 2FRHA 3JRCA 1QHHD 1CGPA 2HNHA 3HOSA 3ECOA 1SD4A 2XPUA 5BOXA 4HRIA 1SANA 5CPRB 3BPVA 1X1DA 1PYVA 4G6TB 1ZR2A 4Q4ZF 1TQPA 2GAUA 2K9QA 3KP4A 1UELB 4P96A 3OYKA 1FZPB 3OSGA 3FMSA 2DT5A 3DU5A 3CUQB 4IZZA 2EH3A 3WODF 2HQRA 3PNYA 2BY1A 4B3XA 3MKZA 5BS6A 2DO7A 2R4GA 3FDYA 1LQ1A 2CUFA 4AIDA 1X1BA 3S3NA 4RMNA 3VB2A 2A6TA 1QPMA 2B7EA 1ERDA 5LEJA 5FGMA 3EYIA 1JHHA 1XGSA 3BY6A 3RDIA 2EFNA 2WV1A 2O9LA 1KA8A 5EGOA 2LYCA 5EEGA 5BNGA 5E3NA 3GUDA 2MYSA 3LMMA 2HZTA 3BCAA 3K69A 4IOAF 3HYIA 1XX5A 2KDZA 2CW8A 3JRDA 3HRTA 4B48A 1POGA 1UHSA 2QEXI 2V9KA 3S15J 1UG2A 1RUOA 1MMAA 3ZOBA 4HNUA 5DM6F 3G3ZA 2ZFUA 3QYBA 1Q1HA 2VBZA 4ON0A 4E6KG 5F1RA 4CHUA 1VNDA 4ESBA 1STZA 1UMQA 2K7LA 5EZGA 3E6BA 1ON2A 1S6LA 2ELHA 1H0MA 4XKVA 1ZG5A 2XHKA 3TGNA 3UKGA 1SEUA 3H3VK 3HUGB 2CG4A 2BV6A 3Q5FA 2F4OB 3I5UA 1SFXA 2W85A 4B09A 2O0YA 4LITA 1BI2A 2LBFB 2AO9A 3AL0C 3BOQA 2LFBA 3IC7A 2X48A 3CUQC 3EYYA 4RAYA 2CWEA 3VWBA 5J8CA 3H35A 3I0TA 4EQQA 2X6YA 4D7NA 5JHFA 3GTPJ 3AKZA 1IG7A 4KN4X 4X0GA 5KAIC 1ETWA 2O3FA 2EILH 1DPRA 4LK1F 4RLFA 3TO9A 1JXSA 5DV5A 1O3RA 3CC7I 3CMAI 3GTMJ 5HNHA 2HOSA 1JI8A 1R4NB 3LA3A 3OOUA 3JAMK 1A31A 1E3PA 2CQ7A 4RAGA 4G8XA 1AKHB 2STWA 4E7HA 2DI3A 4NC8A 2VBYA 4XRFA 1TC3C 3K4NA 2HGCA 4D9JA 3U1DA 3CCYA 4ETSA 2ELKA 1W7PB 3EUKL 4S0HB 1QPIA 3S3OA 5ILVA 2Z9OA 1YQAA 4PFPA 5J4VA 3BR3A 3HKZA 3TW7A 3AG3H 3COAC 3EUAA 1BBYA 2X0LA 3QOEA 1OCRH 4FETA 3ONQA 1MMSA 3DBRB 3H0GJ 5EEAA 3QU6A 3HZJA 4XLHA 5GAEJ 1TTYA 3K4JA 1YFHA 3BT9A 3F23A 1ZRCA 2E2JJ 1XMXA 1PUFA 3RCOA 3SEQA 4B8XA 2DPUA 4IXAA 2IGOA 2JPCA 3OY9A 3SFZA 1OJLA 4HSRA 4MGRA 3EETA 3W2WA 4CO8A 5J3LA 1JTYA 4XBFA 1KU2A 1QZYA 5KCMA 4ANJA 3FBNB 1GVDA 4Z2YA 3HRSA 3BP8A 2QSGX 4OIQF 3IH4A 3L2WA 5B3SH 4J01A 2RNGA 5KK1A 1XGMA 3FM5A 4A3FJ 2KLOA 2EIJH 2XRNA 5J1YA 5FROA 4IQJA 3H9QA 2DMTA 4M3DA 1XGOA 4HEA2 2IA2A 3OIPA 4MFDA 2Q2EA 2DFHA 3ZMZA 1PDNC 4PFOA 5IOZA 1V5GA 1CF7B 2L54A 4XN3A 2CGPA 3FXLA 4Y52J 1P7JA 3UNGC 2CQNA 2EZHA 2EFQA 4IL6C 1O7FA 2P5VA 4LMYA 3TW6A 3K10A 4UUSA 4NDLA 5EG0A 1DGRM 1UFMA 2X85A 4CH7A 5DYMA 4MEXF 3CC2I 4RAZA 1TNTA 2BXZA 3QP6A 3KZZA 4UXNA 2VN2A 2ZCWA 2K3PA 5DS9A 3OYHA 1O3QA 3K0LA 3GFIA 3GTLJ 3O3KA 4AIKA 3OYCA 3E3VA 2KHMA 2QBYA 3ASOH 2W4SA 1Z67A 5A2QK 4PJNA 1Z3YA 4I0AA 4GO1A 5K5OA 2AXTC 4RB0A 5FKOA 3R6SA 2Z33A 1TW3A 3V4GA 1F5TA 1XTAA 3E97A 1TWFJ 4LOCA 1MH3A 1RC9A 2DT6A 2NS8A 3IKTA 3OYIA 1K83J 2VE8A 4Y17A 3FIWA 1HKSA 5HLGA 1D5YA 3AFHA 1YRNA 3QYEA 2DQLA 3G73A 1IN8A 4LG0A 1IV6A 2DXIA 2LSOA 2IA1A 1YX3A 3RI4A 3TDUC 1RPWA 1MBHA 2ZKZA 2OQRA 3WTTC 1V55H 2OTJI 4WCGA 5J1RA 1A5JA 4P1WA 3K6GA 2VASA 2OPTA 3L2CA 2E1NA 4FASD 1ETYA 2IA0A 1LEAA 1OCCH 4J00A 3L2UA 4M9ZA 4A12A 1VQKI 5E18F 3CF5F 1Z91A 2DJNA 4M73A 2AS5F 3HDDA 4M72A 2Z16A 2Y30A 2XASA 3ISPA 2OAZA 5BPIA 1HW5A 2R7XA 4PZJA 4M9XA 2FNAA 2JUCA 4PJMA 4A3KJ 5B1AH 2RAEA 2XB5A 1TP4A 5L3DA 3ROUA 4BAYA 4FQGA 4WK8F 3OYAA 3G6EI 1QU3A 2EPFA 1WQ2A 5AIQA 2BYVE 1IAWA 2F48A 4LFUA 3DBHB 1U6GA 4UB6C 3QWLA 3B02A 4M6VA 1TWHJ 1FBSA 3JAMZ 1FYLA 2XF5A 2D1HA 3CTAA 3HBLA 3BG7A 4BHCA 1MDMA 2WTEA 4EJOA 3SZGA 3JRIA 3S3MA 2FNPA 2HDWA 4L0ZB 1LDJA 1MGTA 3V7SA 4BEHB 4I7HA 5FD6A 2KRFA 2MABA 3LFKA 2WAQA 1R49A 2CH0A 1YE9A 2R7FA 1D1BA 1GDTA 4O3MA 4YEJA 4A0ZA 2IS2A 3IUOA 1LFUP 3OYGA 4L0YB 5EYRA 3I71A 3JTHA 3KIOA 4IRGA 5ED4A 3TO7A 3TEDA 1VQ8I 4BJTA 1NK2P 2JK3A 2TRTA 3L2VA 1VTNC 1HOMA 3CUOA 3HOVJ 4A3MJ 4IHVA 3AG4H 2X51A 5FRMA 5J4YA 5E17F 2QUFA 4RAFA 3HRMA 1OKRA 4MEYF 3RSNA 3KPHA 3T0YA 2MLKA 3V8LA 5EF6A 3DKXA 3CCRI 1I1SA 3P9IA 4E7JA 3WTSC 1APLC 3I9V2 1HSTA 3G2BA 4XLCA 2L9RA 3LQQA 2IPQX 3AAFA 1XD7A 2VQLA 4RM3A 1SVOA 4N4OB 5IYBJ 1O3TA 3L09A 2ZB9A 2VUMJ 2K02A 4N4NB 1OCZH 3BG5A 3FXJA 4U7BA 2RN7A 1I27A 4UVAA 5DTDA 3HEFA 4HNTA 2PMHA 1Y6IA 1IUFA 2I5UA 2RV8A 3ELKA 3ERMA 2X6XA 3ZQ7A 3MMYB 1FOYA 3MD2A 2OTLI 2R93J 2Q8KA 2DFIA 5F64A 5JLWA 3K70C 2DA4A 2M34A 1T56A 4C3IJ 4XLAA 2DOEA 3HXLA 2XRLA 4CYDA 4FTHA 3MAJA 2VXZA 2L02A 2HQ5A 1R1UA 4HZFA 1T0FA 4Y7NJ 1B72B 4EM2A 4PJLA 4BBRJ 4YFKF 5LGNA 4NQWA 1G6NA 1T38A 3CO6C 2GA2A 3LAPA 1VQ9I 5LBQA 4ZDPA 1AHDP 1X4OA 2M4KA 3GO5A 1F36A 3E6MA 2R7WA 3GEZA 1H89C 1SMTA 2ZSHB 2HTSA 1F1ZA 1ZGAA 3CDHA 3CDLA 5A2QZ 3HM5A 1MD0A 1T8IA 2ZSIB 1YJ9I 2WBMA 1HW1A 3EDPA 5LEKA 4XRMA 1PJRA 1QQIA 2Y31A 5E20A 2VQHA 3J81K 3F72A 4JQFA 3RQ4A 2E5ZA 2R7RA 5E79C 3ASNH 1SD5A 4CCMA 2KRHA 2E2HJ 2ZMEB 2R3SA 1X1CA 3E5QA 3H1CA 4BE2A 1WGXA 1X4PA 1XMKA 3PM1A 2HDDA 3GTKJ 3ECHA 5FO5A 2Z99A 3CQZJ 4JOMA 2OBPA 2P7CB 2JTVA 4ZH4F 5IOYA 3RKQA 5FRNA 1QO0D 2QVOA 3NQOA 5K7FA 2FE3A 4W1UA 4A0YA 2ID3A 4HSTA 3I4MJ 4PJ0C 1HXDA 4ZTJA 4AYBA 4ZDOA 4E7KA 1H9GA 2HR3A 3FF5A 3I58A 4GCVA 3DEEA 3PQJA 3BR0A 1TWCJ 3CLOA 3MKWB 3HHGA 1ZQ3P 2XAHA 3VDXA 3A01B 5IT3A 3V42A 3VYRB 1W7PD 1IDZA 3BCBA 4PUSA 4AVZA 1S29A 2V1DA 2XDVA 3B6AA 4WF2A 2ZFWA 1OYWA 4KITB 1K6OA 2JVHA 4TV7A 5CJ9A 3VEPA 3Q3SA 2MA3A 4BXFA 1IRZA 2DK8A 1K4TA 2WV0A 2VJ5A 3HSRA 4P9FA 2IT0A 4C2TA 4F3QA 4MO7A 3WHBA 3LSHA 1T98A 2KFDA 4HX8A 2M5WA 2K3FA 1X3ZB 3QPSA 4IHWA 4OMZA 2XAFA 4IVNA 5TISC 2VE9A 2DYSH 1E3OC 4NUBA 3DPTA 1OR7C 3FWEA 4A3JJ 4F93B 3KE2A 3WTVC 3W6JB 2GXGA 5HDGA 3RKWA 2NVUB 2L4MA 4WXHA 2DOFA 5CQEA 2YUSA 1Z6TA 2CUEA 4BBSJ 3VPRA 3TP3A 3CP2A 3I59B 2YR2A 2E35A 4F91B 2XIGA 2KRCA 4RS8A 1V54H 1MJ9A 1HA8A 3P9CA 3BJ6A 2V26A 2ME6A 5GAHJ 4HDVA 2DDBA 5BMZA 1U5TB 2Y75A 5HVQC 5L3CA 1UHMA 3Q0WA 1WWXA 5LHGA 5C4JJ 1X58A 3WGGA 3GF2A 1QVTA 4Q5SF 1YITI 4A3GJ 2UUZA 2FOWA 2VB6A 3OWTA 4B4CA 1LVKA 3VSKA 2VPLA 3F22A 3H0DA 1FC3A 1YIOA 2NVYJ 1R1VA 3S1RJ 4IHXA 3KP5A 2VIXA 3ZGKA 2K86A 4M9SA 3K1NA 1X19A 2IXSA 4XLNF 4QTRA 4PJJA 4E7SA 4QSHA 1MSEC 2OD5A 3DU6A 3HB9A 3LQRA 4II3A 5E8IA 1Z77A 1KQ9A 4XIDA 1F9NA 2MG4A 2XUBA 2DODA 4BGDA 3SZPA 1B8IA 2CUZA 3BR6A 1XGNA 4OIPF 2L9VA 3O6BB 1T39A 3ZMVA 2QZ8A 1I50J 4L9TA 2P5KA 5KHDA 3CJQB 1HC8A 5IY5H 1BOBA 2VL8A 4X1EA 1REPC 2XVCA 2I8DA 3Q9VA 4BDZA 3I55I 4BQAA 2LY9A 3LSMA 4G7ZF 2FF4A 3CCMI 2E2IJ 2XKOA 3KETA 2KIFA 2MC3A 4AU7A 3EUHA 4CUGA 2CYYA 4PSXA 4UY8I 3EPZA 1TQIA 4EJUA 4HDUA 1LEBA 4K2EA 1R5HA 2DT7B 1MMGA 2BW3B 4M74A 4AD9A 4BXUA 1YX5A 2GBYA 5LHHA 1RKWA 2A61A 2J5PA 3RZDJ 4C2MJ 3CCLI 1TL8A 2E7XA 4E4HA 2EZIA 1KU3A 3OS1A 2Y9YA 2XAGA 1VF9A 4BUPA 2L3DA 3F8CA 1WJAA 2D45A 3K9TA 5IP7J 5DD4A 3ZQIA 3F8FA 1WJCA 4EM1A 2RVCA 2XAQA 3E7LA 2W1OA 1J75A 1AOYA 4BL0B 4EVIA 1WCMJ 3G71I 1PVEA 2NS7A 4GGGA 4ZJZA 4IX7A 4EGZA 3G1MA 3WG7H 1GHCA 4XN0A 4AC0A 2X1DA 3BTIA 1IXSB 3WTZA 1JE8A 2L01A 4OIRF 5HS7A 3MQ0A 2LP0A 2LLKA 4BYYA 5F08A 3HOTA 4EGYA 2IVMA 2GQQA 4Z6YA 1FT9A 1ORKA 2H6CA 2XROA 3BTJA 1ZLJA 2OQGA 3QQAA 1NHAA 2F4MB 4A3BJ 1S9HA 1K78B 1R6RA 3ZPLA 4LIUA 2RC4A 4XOTA 1LNWA 3F0CA 3CDIA 3QODA 1H9TA 4OMYA 2ADUA 3FHZA 4RGUA 1XSVA 5ICCA 4RDUA 2FA5A 2M0MA 2XSDC 3L1PA 3GCMA 2H1KA 1I39A 3K2AA 1W4MA 3FK7A 2P4WA 3IRRA 2HWVA 2X4HA 4U88A 1OLTA 2QCOA 2M30A 3W6VA 2ZJQF 1G3TA 5F0CA 2YU9J 4HF0A 4E7IA 4PGHA 1V5FA 3KP2A 3VYTB 2G7HA 4ABZA 2QYOA 2HU9A 4GDFA 3F6VA 2NXNB 5D5XB 2DFEA 2EJRA 3H3ZA 4GYGA 2V79A 4PGGA 3LSJA 2L4AA 3KYDB 2E60A 4IEJA 4MHGA 2PLYA 2EZLA 3GTGJ 1V4RA 2MH2A 1LJ9A 2FXAA 5AIPA 2K9LA 4A2UA 2Z5UA 4I02A 4WWCA 1USSA 4OOIA 4BH9A 2IW5A 2FOKA 1ACIA 2HYGD 2ISYA 2XGDA 2NS0A 5F0HA 1ETXA 1XC5A 3RQIA 5KVRA 3KX2A 4YIIA 1X1PA 3S2HJ 4CZZA 4X6AJ 3D1NI 1HKTA 2EK5A 2VQCA 2ZBKA 4EMSA 4WX9A 1DPUA 1EKEA 2FX0A 2UV1A 3JRAA 5DCMA 1X2MA 1IF1A 2ZXJA 3E1SA 1T6SA 3ULQB 1ZKGA 1VQPI 2JA2A 1XSDA 2EFPA 3ZN0A 3BZKA 2WC2A 4A3IJ 2EV6A 3BJOA 1I6HJ 4IJAA 1TT5B 4U7DA 1SAXA 3RTRA 1K7AA 4HA8A 1ODDA 4XR6A 1IZ1A 2QSFX 1RUNA 4RB1A 2VODA 1LFPA 2FBHA 1ZN2A 3ZQHA 1PUFB 1MMNA 1YS6A 1ZLKA 3KZIC 1S8NA 3VODA 2NVTJ 2JUGA 3S1MJ 1K61A 1FMVA 1Q1VA 3PIOF 4AIJA 2L7MP 3CUQA 3H3UA 3HOUJ 1XCVA 2OA4A 3V8KA 2HVSA 3QPLA 1ZELA 1KYZA 2E36A 5F04A 4XONA 2STTA 4V2GA 2PQ8A 4IHTA 1U9NA 2VT2A 2Q2EB 2HOEA 1RIOH 2ESHA 1S7AA 2O03A 2G9WA 3MKLA 4II2A 4BNCA 1DU6A 2JVGA 4MQVA 5ILUA 4M3BA 2R7ZJ 5C4XJ 3TOBA 2M1BA 3IAS2 3D5RC 5LRSA 4S05A 3S14J 1JGSA 4B1RA 5EG0B 1Z21A 1JKPC 3M7GA 3JSOA 3M9AA 3PNVA 2HI3A 3WGHA 2R5ZA 3HOYJ 4XICA 4DBRA 1X1AA 1ZRFA 3HSEA 4ZYHA 3ERED 4B47A 2P8TA 3HHHA 2DW4A 2IS4A 4NBQA 4F92B 4BQQA 1D0ZA 2TCTA 2MFZA 3DTKA 3V7CA 4M3FA 4CXFA 4BS9A 2QBYB 1FLIA 3WTYC 2KZVA 3KP6A 3S32A 5F27A 4DYCA 2FBIA 3NARA 2V9VA 1YLFA 2V9PA 4ZYGA 5H6QA 1ETVA 2EB7A 4I99C 2R0QC 1L3LA 5E1ZB 1YRNB 2BEOA 2LBFA 2OCCH 3FZVA 2OF7A 2BE5F 3AG2H 3DBLB 2WAQN 1XPXA 1G2HA 1R4MB 4V19K 1U2WA 4YELA 4I6ZA 3JR9A 2OU2A 5GAGJ 3RPUA 5K5QA 1LE8A 5M5YJ 4IPAA 2EIMH 4PSWA 4CGZA 1MBEA 2QF7A 3B6CA 3LAJA 3BZ6A 1R9TJ 3GLLA 3R61A 3FX3A 3HJEA 2A68F 2X1EA 3BJAA 1FPQA 2CUJA 3CD6I 1OFCX 4L5EA 4XLEA 5CYVA 2EQRA 5IT9Z 2VBWA 4DZPA 3KEOA 2XSJC 1DGWY 3A0HC 1GXQA 3H5NA 3PSFA 2L7KA 2M4GA 3JREA 3LA7A 2HXOA 4AUXA 1J7KA 3Q0UA 3GZ5A 1W7PA 1T2KA 5M5WJ 1Y8RB 2F5DA 2PBIA 3HRUA 3OSFA 3DCFA 2XGCA 1WFXA 2DA2A 1HSJA 3VOEA 3S1NJ 1A6IA 1HF0A 1JUSA 2JZYA 1IW7F 2JSCA 4DYRA 2Q1ZB 2E1OA 3IP4B 2R7TA 3PUFA 5GP9A 2CU7A 3C2GA 2Z3YA 3I64A 4XM3A 2DA3A 2Y0SA 4YRVA 3DWLE 3C18A 4A69C 2XC7A 5JVGF 5J6XA 3GVAA 2KMUA 3BTLA 1RZ4A 2QQAA 2D2WA 1WH7A 2DCEA 3CCUI 1O3SA 3PNTA 4JBAA 3IWFA 4BJ6C 2JN6A 3KLNA 3IL2A 4I01A 1ZK8A 4AVPA 4G94A 2O6GE 5C44J 4MTDA 1G3SA 4PDKA 3ABMH 3K4LA 3ZRGA 3MEXA 5DDGA 1KYWA 3Q9SA 5DEQA 4UVBA 3V8JA 2N8GA 1E17A 3CMYA 1D0YA 1FYMA 3RKXA 2E34A 3TBIA 5H2FC 2GA1A 2FQ3A 2OCEA 2K9SA 2OJED 1NTCA 1D1CA 4Y13A 1ZGJA 4CICA 2GXAA 5CVRA 2COBA 4MNUA 2K9NA 1MBJA 1D8JA 4HV5A 4RB3C 3C7JA 2CW0F 4DZJA 2X9DA 4AYBN 1CQTA 1IXRC 1RESA 2IBDA 4KIFA 2BY2A 3ZMSA 2KJBA 2LTPA 2MBFA 5D4SA 1JGGA 3E6DA 4NQWB 4OWRB 4CCJA 1WJDA 2W84A 2AXLA 1ZTRA 2FD5A 2X6OA 5E8GA 4BKXA 4DNCA 1ZHFA 1R00A 2QWWA 3H5AA 1WKMA 2IAIA 2A3SA 2VQGA 3S2DJ 1EF4A 4NNJA 5D5VB 1FJLA 1GT0C 2JJ7A 4XKBA 2DBBA 2XAUA 1Z3XA 2B0LA 2PX9A 3HGGA 3S2WA 4H4KC 3TL4X 2Z1DA 2A5WA 3IKVA 5L3FA 4DQ2A 3SEZA 2XKPA 4DJAA 3FKJA 3M1CA 1Y8QB 4HV6A 2TDXA 5F1JA 1IN5A 1I3AA 1G3YA 2BY3A 4DGWB 2K4JA 3LSKA 5EEHA 1KGSA 3J7AY 2IS1A 5K7ZA 4LB6B 3K4CA 2E19A 3FXMA 3QPTA 1SD6A 1B9MA 1D1AA 2OV7A 3OYDA 3ZP5A 2ZO4A 1SD7A 1JT6A 3ZR8X 1KQ0A 1WJBA 4XRSG 3ZQFA 4XSXF 1WJFA 2M2EA 3FHNA 2A07F 1XDSA 5FKLA 5JHUA 3W6KB 4UB8C 1SC7A 1YO5C 4IHSA 2ID6A 1BA5A 3QPHA 2DLLA 2RGVA 4ZYDA 1U8BA 1MNEA 4KFCA 4CZCA 4NC6A 3PFIA 4AWXB 2PG4A 2WB1A 2E1MB 2HKOA 3ZCOA 2UXNA 3OYEA 1DUXC 1T95A 4LLLA 3BLYA 2CFOA 3BROA 2K5CA 4L9NA 3JTGA 2LKSA 1IRXA 2AHQA 2GZWA 3ABUA 4RGRA 2W25A 5KNLA 2EWNA 1MNMC 2VOPA 2WAFA 4CCKA 3UR3C 1I6XA 4HLXA 2PJRA 5D6EA 4H0EA 3BG6A 3T5XA 4JX4A 2HQNA 2R7VA 1PP8F 3HTUA 1LDKB 4I2OA 1F4KA 5IPAA 2FU4A 3JRGA 2CV0A 3F21A 2COMA 4DYQA 3ZMUA 2V7FA 4MFEA 1D8KA 4U0VA 4RBOA 2GM4A 1FIPA 5JVTA 3LA2A 5ERIA 2OZ6A 4A3LJ 3GW2A 3DP7A 2LKXA 4LLNA 3KYCB 1J2XA 3LL7A 2R5YA 1SFUA 1JKQC 4HLYA 3KFWX 1R22A 1YYVA 1HKQA 4Y33A 4F52A 5CVVA 2IS6A 3CZ6A 1IN7A 1SFKA 2DAOA 2V1NA 4FE4A 3FMRA 1XCBA 2MC4A 3KEYA 2XB0X 3FK6A 2VJJA 4YIFA 5IYCJ 1FX7A 5EJCA 4BHPA 3P5JA 2OUMA 2NRAC 3LWFA 2E1MC 4A6DA 1MIJA 3R4KA 1TWGJ 2HTJA 5GPCA 1TQMA 4IF4A 1BW5A 1HDPA 3GXOA 1B72A 1VQLI 3H9GA 1BI1A 3VFZA 1FOXA 4ENNA 3RYRA 2R7OA 2YS9A 2ZJ2A 2E7WA 1OPCA 4D5CA 4QPQA 1USTA 1WH5A 3L7WA 4FHTA 1ON1A 4GYIA 5GTHC 2JA8J 1AWCA 3CO7C 1OCTC 2KIQA 2ZMEC 2D5VA 4I0BA 2GOMA 5GADJ 1BIBA 1QGPA 2WADA 1ZREA 4OIOF 4Q47A 1A04A 5HDNA 5KAFC 4IRIA 3NWSA 1RKTA 2BZTA 1WHUA 5L3GA 1Z6RA 3ZN1A 3I56I 3RIRA 3FXUA 1OR7A 2P0WA 1DQUA 3CMMA 5L3BA 3GTJJ 3BG3A 2LC2A 2VC1A 3A2KA 3BTCA 3K2ZA 2LRDA 2MD0A 4L5JA 2BGCA 4UHTA 4ZYAA 5DD8A 1MMDA 1SFEA 2IEKA 9ANTA 5M3FJ 1FBQA 5J1UA 3MZ8A 3T8TA 3J7ZI 4RGXA 2KIUA 4ENMA 3TP0A 1YJWI 2B9SA 3A02A 1MW7A 1OQYA 4RGSA 3NEUA 2KPMA 1LUJB 3L2QA 3F8NA 2KIMA 3WE3A 3S8PA 4UV8A 3FXRA 5FFZA 3JRHA 3A0BC 4KN7X 1YHQI 4KMFA 4G12A 5IP9J 2JPBA 3A01A 3FXKA 1OISA 3CC4I 1KU7A 3MFKA 1KU9A 2EA4A 4HOBA 3V7RA 5HOOA 4BQNA 4Q48A 2K27A 2ME0A 2XPVA 4RA2A 4CDGA 1DP3A 3PQKA 2LY2A 2M7AA 1YTYA 1GLNA
chains in the Genus database with same CATH topology
1XC5A 3RQIA 4JP0A 5FKOA 3S2HJ 4X6AJ 5C3EJ 3D1NI 1H88C 1W0UA 2O8KA 3LNQA 4IHYA 1TWFJ 2M8GX 2FX0A 4LOCA 3JRAA 1MH3A 1X2MA 2NS8A 3BQZA 1K83J 1DU0A 3FIWA 3DEWA 4EEFG 1D5YA 1ENHA 1JUPA 1ZKGA 1YRNA 1IV6A 4A3IJ 1ETQA 3C2BA 5E3MA 1I6HJ 3O8GA 4M3EA 1RPWA 3BR5A 1MBHA 2DTZA 3HOXJ 5J1RA 1A5JA 3ZQHA 1PUFB 2NVTJ 2OPTA 2DA7A 3S1MJ 1ETYA 1K61A 1Q1VA 1JJ8C 3M4OJ 2L7MP 3HOUJ 2DJNA 3HDDA 2L7ZA 2Y30A 1TWAJ 3QPLA 4FE7A 5F04A 1QRYA 4V2GA 4A3KJ 1MBFA 1OCPA 2RAEA 2HOTA 1U9NA 3IV5A 3PO3J 2XB5A 1JUMA 1NK3P 2LVSA 2Y9ZA 1JJ6C 3MKLA 2XPWA 1DU6A 2DMUA 3JRFA 2R7ZJ 4M3BA 5C4XJ 4M6VA 5EDNA 1TWHJ 4BY1J 3MVPA 2VKVA 2VPRA 4A3EJ 3S14J 4B1RA 5EG0B 3HBLA 1U78A 1JKPC 3HGYA 1HCRA 2VI6A 2HI3A 2R5ZA 5EGOB 4XICA 3JRIA 3HOYJ 1H8AC 4CYCA 4A93J 2TCTA 1GDTA 4M3FA 1B8IB 4JX5A 1LFUP 3BR2A 3IH3A 5EYRA 2EBIA 4FCYA 5F27A 4DYCA 3TEDA 3NARA 1NK2P 2JK3A 2TRTA 2PMZN 1HOMA 3HKZN 2CQXA 3HOVJ 4A3MJ 4IHVA 2G0EA 1ETVA 2O7OA 5M5XJ 4A3CJ 3S1QJ 1JKRC 2DMNA 3O8HA 2R0QC 1FIAA 5EF6A 1YRNB 1GUUA 2OF7A 2WAQN 1G2HA 2I10A 1APLC 2FJ1A 1XG1A 2L9RA 1S7EA 5K7HA 1BJZA 5IYBJ 4I6ZA 4JYKA 2DA6A 3JR9A 3SFIA 1BL0A 1LE8A 5M5YJ 3GBGA 2CRGA 4JX6A 2ZB9A 2VUMJ 1XS9A 3BG5A 3BG9A 1MBEA 2QF7A 5DTDA 1RR7A 3B6CA 1Z0XA 3HEFA 1R9TJ 1IUFA 2JA5J 5FJ8J 1OFCX 4L5EA 2EQRA 1I3QJ 2R93J 5JLWA 4DZPA 2DA4A 2M34A 1T56A 5JLXA 4C3IJ 2CQQA 2XRLA 4FTHA 1BW6A 3JREA 3HOZJ 2HXOA 4AUXA 4B3AA 2HQ5A 3Q0UA 4Y7NJ 1B72B 4BBRJ 5HODA 5M5WJ 3OSFA 3DCFA 1AHDP 2XGCA 2M0CA 1F36A 2MW8A 2M9HA 2DA2A 1H89C 2R5ZB 1VI0A 3S1NJ 3CDLA 2NOGA 1FTTA 3HM5A 1A6IA 5IP6A 1JUSA 1JT0A 1HF0A 2JMWA 4CYCB 4DYRA 1FTZA 2E1OA 5FKMA 4GFBA 1GV5A 4XRMA 3GTOJ 2KT0A 5GP9A 2CU7A 1HDDC 5FLMJ 2Y31A 1X2NA 3PO2J 2DA3A 4XRSA 3OIOA 4MLOA 4A69C 1F43A 2E2HJ 3M3YJ 1WGXA 3PM1A 3BTLA 3GTKJ 2HDDA 1WH7A 1SFOJ 3CQZJ 3FISA 2LK2A 4J19A 2EZKA 5IOYA 4D7MA 3RKQA 2JN6A 1ZK8A 5K7FA 4W1UA 2ID3A 5C44J 2NVXJ 3I4MJ 1IC8A 1RETA 2B63J 2Y0SN 1AU7A 1LE8B 3A03A 2ECBA 3SDGA 5E3OA 2N8GA 3WHCA 3CMYA 3K7AJ 1FEXA 3BR0A 2HYJA 1TWCJ 2P81A 1ZQ3P 4UUSB 3A01B 3ZQCA 3S16J 1IDZA 1GV2A 2Y2ZA 2DMQA 2K9SA 1LFBA 1NTCA 1JTXA 2FQ4A 1ITYA 3B6AA 5IYDJ 2COBA 1W0TA 2K9NA 1MBJA 2ECCA 3MN2A 2JWTA 4DZJA 2X9DA 4AYBN 1CQTA 3Q3SA 2IBDA 1RESA 1IRZA 3Q0VA 2HXIA 2LTPA 1JGGA 5M3MJ 4QIWN 4MO7A 4UUTA 2L0KA 3GTQJ 3WHBA 3JRBA 1ZTRA 2DN0A 2FD5A 2X6OA 4BKXA 1ETOA 2LR8A 2K40A 3QPSA 1O4XA 4IHWA 2IAIA 2DMPA 2HOAA 3S2DJ 1EF4A 2W48A 1E3OC 1FJLA 1VFCA 1GT0C 2JJ7A 4A3JJ 1MH4A 4C3HJ 3LSPA 1P7IA 3JRCA 2DA5A 3HGGA 1WI3A 4A3DJ 2CJJA 2YUSA 2CUEA 4BBSJ 3VPRA 2XPUA 3TP3A 5FKKA 5F1JA 1SANA 3IH2A 1ZR2A 2K9QA 5K7ZA 4M3GA 3G1LA 3OSGA 2ME6A 4W97A 2E19A 3BQYA 2EH3A 3HOWJ 3Q0WA 1AKHA 1ZGWA 5C4JJ 1JT6A 1X58A 4XRSG 3G1OA 3ZQFA 1QVTA 2L7FP 2CUFA 2M2EA 4A3GJ 5FKLA 4B4CA 2XGEA 5GPAA 2ID6A 1BA5A 2NVYJ 3S1RJ 4IHXA 1U8BA 1IJWC 2WV1A 2O9LA 5EGOA 5BNGA 5E3NA 1U9OA 4QTRA 3RZOJ 1MSEC 4QSHA 5FLVA 3HB9A 2KDZA 1Z77A 4XIDA 2MG4A 2AHQA 4BXXJ 3JRDA 3FKIJ 2VKEA 1POGA 1B8IA 1MNMC 1UHSA 3BR6A 4I76A 3S15J 4C3JJ 3ZQGA 1UG2A 3ZOBA 3SJMA 1I50J 1VNDA 1UMQA 5EZGA 1Y1VJ 4D5FA 4JX4A 2NVQJ 1ZR4A 2LD5A 5F0FA 4X1EA 2WB1N 3UKGA 5IPAA 3H3VK 3JRGA 2LY9A 4DYQA 4MFEA 2E2IJ 2AO9A 4RBOA 2LFBA 2GM4A 1FIPA 2X48A 5E3LA 4A3LJ 1ETKA 2LKXA 2MGQA 4D7NA 3GTPJ 2R5YA 1JKQC 1IG7A 4FISA 1JKOC 2GBYA 1ETWA 1RKWA 3LOCA 3RZDJ 4C2MJ 3GTMJ 2HOSA 4FE4A 5FKNA 2EZIA 2Y9YA 1VF9A 2XB0X 3FK6A 3OOUA 5IYCJ 1QVUA 1AKHB 5IP7J 3ZQIA 3E7LA 3LSGA 1TC3C 1TWGJ 1WCMJ 5GPCA 2NS7A 1BW5A 1HDPA 3CCYA 1B72A 3G1MA 2ELKA 4S0HB 4AC0A 1QPIA 3S17J 2YS9A 3BTIA 3BR3A 3TW7A 4D5CA 2LP0A 1WH5A 2LLKA 2JA8J 5EZHA 1MBKA 5F08A 1OCTC 4MIMA 2JA6J 3H0GJ 2D5VA 5EEAA 1ORKA 1Y1WJ 3BTJA 4HNVA 3QQAA 4A3BJ 3BT9A 1RKTA 3F0CA 2E2JJ 1PUFA 1MBGA 3BR1A 2DA1A 3LSRA 3ZQLA 2XSDC 3BG3A 4RDUA 3L1PA 3GTJJ 2H1KA 1MSFC 1OJLA 3BTCA 3K2AA 3FK7A 5J3LA 1JTYA 2IEKA 1GVDA 9ANTA 5M3FJ 2QCOA 3W6VA 2GLOA 3IH4A 5J1UA 1T33A 3TP0A 5F0CA 4A3FJ 2YU9J 3A02A 5J1YA 2DMTA 4M3DA 4MFDA 4ABZA 5IOZA 3I4NJ 4XK4A 2MSYA 4BY7J 3JRHA 2R5YB 1P7JA 4Y52J 2EZHA 3LSJA 3TW6A 4G12A 5IP9J 1IGNA 4UUSA 2H8RA 4NDLA 4DW6A 1WPKA 3A01A 5EG0A 4IEJA 2EZLA 3GTGJ 4V2FA 1HLVA 1IDYA 2ME0A 2XPVA 2JA7J 5DS9A 2R92J 3GTLJ 2XGDA 5F0HA 3NAUA 1ETXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC5 A;  3RQI A;  4JP0 A;  5FKO A;  3S2H J;  4X6A J;  5C3E J;  3D1N I;  1H88 C;  1W0U A;  2O8K A;  3LNQ A;  4IHY A;  1TWF J;  2M8G X;  2FX0 A;  4LOC A;  3JRA A;  1MH3 A;  1X2M A;  2NS8 A;  3BQZ A;  1K83 J;  1DU0 A;  3FIW A;  3DEW A;  4EEF G;  1D5Y A;  1ENH A;  1JUP A;  1ZKG A;  1YRN A;  1IV6 A;  4A3I J;  1ETQ A;  3C2B A;  5E3M A;  1I6H J;  3O8G A;  4M3E A;  1RPW A;  3BR5 A;  1MBH A;  2DTZ A;  3HOX J;  5J1R A;  1A5J A;  3ZQH A;  1PUF B;  2NVT J;  2OPT A;  2DA7 A;  3S1M J;  1ETY A;  1K61 A;  1Q1V A;  1JJ8 C;  3M4O J;  2L7M P;  3HOU J;  2DJN A;  3HDD A;  2L7Z A;  2Y30 A;  1TWA J;  3QPL A;  4FE7 A;  5F04 A;  1QRY A;  4V2G A;  4A3K J;  1MBF A;  1OCP A;  2RAE A;  2HOT A;  1U9N A;  3IV5 A;  3PO3 J;  2XB5 A;  1JUM A;  1NK3 P;  2LVS A;  2Y9Z A;  1JJ6 C;  3MKL A;  2XPW A;  1DU6 A;  2DMU A;  3JRF A;  2R7Z J;  4M3B A;  5C4X J;  4M6V A;  5EDN A;  1TWH J;  4BY1 J;  3MVP A;  2VKV A;  2VPR A;  4A3E J;  3S14 J;  4B1R A;  5EG0 B;  3HBL A;  1U78 A;  1JKP C;  3HGY A;  1HCR A;  2VI6 A;  2HI3 A;  2R5Z A;  5EGO B;  4XIC A;  3JRI A;  3HOY J;  1H8A C;  4CYC A;  4A93 J;  2TCT A;  1GDT A;  4M3F A;  1B8I B;  4JX5 A;  1LFU P;  3BR2 A;  3IH3 A;  5EYR A;  2EBI A;  4FCY A;  5F27 A;  4DYC A;  3TED A;  3NAR A;  1NK2 P;  2JK3 A;  2TRT A;  2PMZ N;  1HOM A;  3HKZ N;  2CQX A;  3HOV J;  4A3M J;  4IHV A;  2G0E A;  1ETV A;  2O7O A;  5M5X J;  4A3C J;  3S1Q J;  1JKR C;  2DMN A;  3O8H A;  2R0Q C;  1FIA A;  5EF6 A;  1YRN B;  1GUU A;  2OF7 A;  2WAQ N;  1G2H A;  2I10 A;  1APL C;  2FJ1 A;  1XG1 A;  2L9R A;  1S7E A;  5K7H A;  1BJZ A;  5IYB J;  4I6Z A;  4JYK A;  2DA6 A;  3JR9 A;  3SFI A;  1BL0 A;  1LE8 A;  5M5Y J;  3GBG A;  2CRG A;  4JX6 A;  2ZB9 A;  2VUM J;  1XS9 A;  3BG5 A;  3BG9 A;  1MBE A;  2QF7 A;  5DTD A;  1RR7 A;  3B6C A;  1Z0X A;  3HEF A;  1R9T J;  1IUF A;  2JA5 J;  5FJ8 J;  1OFC X;  4L5E A;  2EQR A;  1I3Q J;  2R93 J;  5JLW A;  4DZP A;  2DA4 A;  2M34 A;  1T56 A;  5JLX A;  4C3I J;  2CQQ A;  2XRL A;  4FTH A;  1BW6 A;  3JRE A;  3HOZ J;  2HXO A;  4AUX A;  4B3A A;  2HQ5 A;  3Q0U A;  4Y7N J;  1B72 B;  4BBR J;  5HOD A;  5M5W J;  3OSF A;  3DCF A;  1AHD P;  2XGC A;  2M0C A;  1F36 A;  2MW8 A;  2M9H A;  2DA2 A;  1H89 C;  2R5Z B;  1VI0 A;  3S1N J;  3CDL A;  2NOG A;  1FTT A;  3HM5 A;  1A6I A;  5IP6 A;  1JUS A;  1JT0 A;  1HF0 A;  2JMW A;  4CYC B;  4DYR A;  1FTZ A;  2E1O A;  5FKM A;  4GFB A;  1GV5 A;  4XRM A;  3GTO J;  2KT0 A;  5GP9 A;  2CU7 A;  1HDD C;  5FLM J;  2Y31 A;  1X2N A;  3PO2 J;  2DA3 A;  4XRS A;  3OIO A;  4MLO A;  4A69 C;  1F43 A;  2E2H J;  3M3Y J;  1WGX A;  3PM1 A;  3BTL A;  3GTK J;  2HDD A;  1WH7 A;  1SFO J;  3CQZ J;  3FIS A;  2LK2 A;  4J19 A;  2EZK A;  5IOY A;  4D7M A;  3RKQ A;  2JN6 A;  1ZK8 A;  5K7F A;  4W1U A;  2ID3 A;  5C44 J;  2NVX J;  3I4M J;  1IC8 A;  1RET A;  2B63 J;  2Y0S N;  1AU7 A;  1LE8 B;  3A03 A;  2ECB A;  3SDG A;  5E3O A;  2N8G A;  3WHC A;  3CMY A;  3K7A J;  1FEX A;  3BR0 A;  2HYJ A;  1TWC J;  2P81 A;  1ZQ3 P;  4UUS B;  3A01 B;  3ZQC A;  3S16 J;  1IDZ A;  1GV2 A;  2Y2Z A;  2DMQ A;  2K9S A;  1LFB A;  1NTC A;  1JTX A;  2FQ4 A;  1ITY A;  3B6A A;  5IYD J;  2COB A;  1W0T A;  2K9N A;  1MBJ A;  2ECC A;  3MN2 A;  2JWT A;  4DZJ A;  2X9D A;  4AYB N;  1CQT A;  3Q3S A;  2IBD A;  1RES A;  1IRZ A;  3Q0V A;  2HXI A;  2LTP A;  1JGG A;  5M3M J;  4QIW N;  4MO7 A;  4UUT A;  2L0K A;  3GTQ J;  3WHB A;  3JRB A;  1ZTR A;  2DN0 A;  2FD5 A;  2X6O A;  4BKX A;  1ETO A;  2LR8 A;  2K40 A;  3QPS A;  1O4X A;  4IHW A;  2IAI A;  2DMP A;  2HOA A;  3S2D J;  1EF4 A;  2W48 A;  1E3O C;  1FJL A;  1VFC A;  1GT0 C;  2JJ7 A;  4A3J J;  1MH4 A;  4C3H J;  3LSP A;  1P7I A;  3JRC A;  2DA5 A;  3HGG A;  1WI3 A;  4A3D J;  2CJJ A;  2YUS A;  2CUE A;  4BBS J;  3VPR A;  2XPU A;  3TP3 A;  5FKK A;  5F1J A;  1SAN A;  3IH2 A;  1ZR2 A;  2K9Q A;  5K7Z A;  4M3G A;  3G1L A;  3OSG A;  2ME6 A;  4W97 A;  2E19 A;  3BQY A;  2EH3 A;  3HOW J;  3Q0W A;  1AKH A;  1ZGW A;  5C4J J;  1JT6 A;  1X58 A;  4XRS G;  3G1O A;  3ZQF A;  1QVT A;  2L7F P;  2CUF A;  2M2E A;  4A3G J;  5FKL A;  4B4C A;  2XGE A;  5GPA A;  2ID6 A;  1BA5 A;  2NVY J;  3S1R J;  4IHX A;  1U8B A;  1IJW C;  2WV1 A;  2O9L A;  5EGO A;  5BNG A;  5E3N A;  1U9O A;  4QTR A;  3RZO J;  1MSE C;  4QSH A;  5FLV A;  3HB9 A;  2KDZ A;  1Z77 A;  4XID A;  2MG4 A;  2AHQ A;  4BXX J;  3JRD A;  3FKI J;  2VKE A;  1POG A;  1B8I A;  1MNM C;  1UHS A;  3BR6 A;  4I76 A;  3S15 J;  4C3J J;  3ZQG A;  1UG2 A;  3ZOB A;  3SJM A;  1I50 J;  1VND A;  1UMQ A;  5EZG A;  1Y1V J;  4D5F A;  4JX4 A;  2NVQ J;  1ZR4 A;  2LD5 A;  5F0F A;  4X1E A;  2WB1 N;  3UKG A;  5IPA A;  3H3V K;  3JRG A;  2LY9 A;  4DYQ A;  4MFE A;  2E2I J;  2AO9 A;  4RBO A;  2LFB A;  2GM4 A;  1FIP A;  2X48 A;  5E3L A;  4A3L J;  1ETK A;  2LKX A;  2MGQ A;  4D7N A;  3GTP J;  2R5Y A;  1JKQ C;  1IG7 A;  4FIS A;  1JKO C;  2GBY A;  1ETW A;  1RKW A;  3LOC A;  3RZD J;  4C2M J;  3GTM J;  2HOS A;  4FE4 A;  5FKN A;  2EZI A;  2Y9Y A;  1VF9 A;  2XB0 X;  3FK6 A;  3OOU A;  5IYC J;  1QVU A;  1AKH B;  5IP7 J;  3ZQI A;  3E7L A;  3LSG A;  1TC3 C;  1TWG J;  1WCM J;  5GPC A;  2NS7 A;  1BW5 A;  1HDP A;  3CCY A;  1B72 A;  3G1M A;  2ELK A;  4S0H B;  4AC0 A;  1QPI A;  3S17 J;  2YS9 A;  3BTI A;  3BR3 A;  3TW7 A;  4D5C A;  2LP0 A;  1WH5 A;  2LLK A;  2JA8 J;  5EZH A;  1MBK A;  5F08 A;  1OCT C;  4MIM A;  2JA6 J;  3H0G J;  2D5V A;  5EEA A;  1ORK A;  1Y1W J;  3BTJ A;  4HNV A;  3QQA A;  4A3B J;  3BT9 A;  1RKT A;  3F0C A;  2E2J J;  1PUF A;  1MBG A;  3BR1 A;  2DA1 A;  3LSR A;  3ZQL A;  2XSD C;  3BG3 A;  4RDU A;  3L1P A;  3GTJ J;  2H1K A;  1MSF C;  1OJL A;  3BTC A;  3K2A A;  3FK7 A;  5J3L A;  1JTY A;  2IEK A;  1GVD A;  9ANT A;  5M3F J;  2QCO A;  3W6V A;  2GLO A;  3IH4 A;  5J1U A;  1T33 A;  3TP0 A;  5F0C A;  4A3F J;  2YU9 J;  3A02 A;  5J1Y A;  2DMT A;  4M3D A;  4MFD A;  4ABZ A;  5IOZ A;  3I4N J;  4XK4 A;  2MSY A;  4BY7 J;  3JRH A;  2R5Y B;  1P7J A;  4Y52 J;  2EZH A;  3LSJ A;  3TW6 A;  4G12 A;  5IP9 J;  1IGN A;  4UUS A;  2H8R A;  4NDL A;  4DW6 A;  1WPK A;  3A01 A;  5EG0 A;  4IEJ A;  2EZL A;  3GTG J;  4V2F A;  1HLV A;  1IDY A;  2ME0 A;  2XPV A;  2JA7 J;  5DS9 A;  2R92 J;  3GTL J;  2XGD A;  5F0H A;  3NAU A;  1ETX A; 
#chains in the Genus database with same CATH topology
 3RKY A;  3LST A;  4HQE A;  4NC7 A;  4BHB A;  4JP0 A;  3H5R A;  2W82 A;  2V4J C;  1W0U A;  4ZDL A;  3W2V A;  2O8K A;  2DDA A;  4FX4 A;  4M6X A;  3LNQ A;  1LDD A;  2M8G X;  1FSE A;  4E70 A;  4KT6 A;  3JW4 A;  5DUI A;  3SXY A;  2PFB A;  3P7N A;  1DU0 A;  4EEF G;  2IRF G;  1UJ8 A;  1W5C C;  3PUB A;  1RNL A;  1ENH A;  1WRJ A;  3E0J B;  1FNN A;  3PSI A;  3L00 A;  2GXB A;  1YS7 A;  3C2B A;  2HPI A;  2FSW A;  2HFH A;  3O8G A;  1AA7 A;  2PJP A;  4CSW A;  1U5T C;  5FFX A;  1XN7 A;  2F5F A;  2V1U A;  1Z7U A;  4ZTF A;  4OIN F;  3HOX J;  1Z1D A;  2WWY A;  3I59 A;  3WE2 A;  1P2F A;  3A1Y A;  1QZE A;  5L3E A;  3BZC A;  2F5E A;  2VKH A;  2DA7 A;  1VZ0 A;  5K1Y A;  1OCO H;  2WY7 Q;  4CCL A;  4KJZ A;  1R36 A;  2VXD A;  1YJN I;  3M4O J;  4EAT A;  3BC8 A;  1ZAR A;  2DPD A;  1TWA J;  3E6C C;  3CME I;  1WSU A;  1EV7 A;  3EQL F;  5H20 A;  3KEQ A;  1MBF A;  3PO3 J;  3IV5 A;  1B1B A;  2KP6 A;  5ICG A;  3QU3 A;  4YFX F;  1K4S A;  2LVS A;  2Y9Z A;  3HC7 A;  2E5N A;  2JRM A;  2PEX A;  4HW0 A;  3ESW B;  4XLP F;  1NH3 A;  4HF1 A;  5EDN A;  4BY1 J;  4ZC3 A;  4F55 A;  2VPR A;  4LK0 F;  4CCN A;  1EA3 A;  4A3E J;  2XF6 A;  4EV0 A;  3OYB A;  1U78 A;  2NYX A;  2PMZ A;  5CVU A;  2BHZ A;  3C2H A;  3OYJ A;  3PIP F;  5EGO B;  1BI0 A;  4A6E A;  3ZMD A;  1A35 A;  2F4I A;  4ZYE A;  4L18 B;  4HX7 A;  1H8A C;  4CYC A;  2V1X A;  4QWQ A;  3TQN A;  5HS8 A;  1PUE E;  2A5Y B;  3GLX A;  2IGM A;  1YG2 A;  4JX5 A;  3BR2 A;  3OYM A;  2EBI A;  1VQM I;  4N0B A;  2VC0 A;  1BN5 A;  3TO6 A;  5CVI A;  3OYN A;  1P4W A;  3HKZ N;  3KCC A;  2F5V A;  2G0E A;  2O7O A;  1FYK A;  5DCM B;  1A36 A;  4A3C J;  3S1Q J;  4KUM A;  2DMN A;  3O8H A;  3RJP A;  1Y39 A;  3M8F A;  1FIA A;  3QYF A;  1VQO I;  4R1H A;  3D5S C;  2CSO A;  1QNT A;  4E7Z A;  5E1X A;  2I10 A;  4I98 B;  2FJ1 A;  1TLH B;  1XG1 A;  4B44 A;  4ITV A;  1VQ7 I;  2KZG A;  1A6Q A;  3ZQQ A;  1S7E A;  3GX4 X;  1T08 B;  4JYK A;  2DA6 A;  3SFI A;  1BL0 A;  2VBX A;  5IT9 K;  1IUY A;  1HQC A;  4WXC A;  3GBG A;  1YIJ I;  4JX6 A;  2BW3 A;  1OMI A;  3K4B A;  1RR7 A;  1Z0X A;  4G9Y A;  3SZT A;  3KZY A;  3FMQ A;  1UG0 A;  4D0P A;  1IRF A;  3AL0 B;  4O5V A;  3LFU A;  1R5I D;  3K1P A;  4R79 A;  4KDP A;  4KIC A;  1XMA A;  4OAY A;  3CCE I;  5AON A;  2YX7 A;  4L5I A;  1VQ5 I;  1OYY A;  3HSF A;  1TT0 A;  3ZXS A;  5LHI A;  1UHW A;  3G4S I;  4KNY A;  1TNS A;  3HPG A;  3HOZ J;  1IN6 A;  4B3A A;  1Y0U A;  2KJC A;  2L9N A;  2BXY A;  3JCU C;  3L2R A;  4ESJ A;  2JSP A;  2RQQ A;  4RB2 C;  2CMP A;  5J47 A;  3B73 A;  1UB9 A;  2M9H A;  3CES A;  4I09 A;  1EH8 A;  3BPX A;  4GRI A;  2HVQ A;  2R5Z B;  2NOG A;  5IP6 A;  2JMW A;  2ETH A;  3GTO J;  4GFB A;  2QKM B;  1GV5 A;  4BQO A;  5FB2 A;  1K78 A;  1WZ2 A;  1J9I A;  2KT0 A;  2DU9 A;  2FMY A;  2EFO A;  2HVR A;  5D6F A;  1VQ4 I;  2H6B A;  3K4M A;  2RNJ A;  2MD5 A;  5LFA A;  1RR8 C;  4XRS A;  4MLO A;  5D5W B;  2RDP A;  3OMY A;  2QLZ A;  2A6E F;  1W36 D;  2LY1 A;  3FIS A;  2LK2 A;  4J19 A;  2EZK A;  4A0X A;  4D7M A;  1ZH5 A;  2K9M A;  2KDO A;  5LLQ A;  3C3W A;  1J09 A;  1ZG3 A;  2EIK H;  1FP1 D;  1U3E M;  3HPH A;  2DFF A;  5TGT A;  6PAX A;  2NVX J;  1N78 A;  1RET A;  1FP2 A;  2KQR A;  2Y0S N;  2LF7 A;  1LE8 B;  3GZN B;  3I54 A;  3SDG A;  1JHF A;  3CLQ A;  5B5E C;  5E3O A;  4HAM A;  3K7A J;  2HYJ A;  2W00 A;  2HKX A;  1G8X A;  3OL4 A;  4UUS B;  1SAU A;  1QHG A;  4ZZD A;  5FLX K;  1GV2 A;  1JTX A;  5LD2 C;  2FQ4 A;  3HL2 A;  2FML A;  5DCF A;  3BDD A;  1W0T A;  3IRQ A;  4HQM A;  3OS2 A;  5B1B H;  2ECC A;  1K6Y A;  1MKM A;  2R7U A;  2UZK A;  3J80 Z;  2VLA A;  3OYL A;  1J0R A;  2IGN A;  4KIG A;  1N25 A;  3DQV C;  4QIW N;  1O57 A;  2L0K A;  3ABL H;  3GTQ J;  1YW8 A;  2DN0 A;  4KYW A;  1ETO A;  3QAH A;  3L9F A;  2H94 A;  2BHY A;  3SDB A;  3H92 A;  2HOA A;  3HUG A;  4DOZ A;  3K4K A;  4G6Q A;  3REO A;  2NAZ A;  1YW7 A;  3LSP A;  1P7I A;  4LG0 B;  4KT5 C;  4XKW A;  2ELJ A;  4L9J A;  4MQ9 F;  2VOO A;  2DA5 A;  3DLA A;  1WI3 A;  4A3D J;  2CJJ A;  4JK1 X;  4Y3O A;  5JI6 A;  5ICF A;  5FKK A;  4CCO A;  2LOO A;  3H36 A;  2LKP A;  3IH2 A;  3GFL A;  1PP7 U;  3D0S A;  4G7H F;  1S7O A;  2QQ9 A;  2V6E A;  2HS5 A;  1FY7 A;  4M3G A;  3G1L A;  3SYT A;  5LRR A;  4W97 A;  1P4A A;  3BQY A;  4EM0 B;  2VJI A;  1UCR A;  2CO5 A;  1DDN A;  3HOW J;  3KP3 A;  4HBL A;  4DIQ A;  1Y0N A;  1AKH A;  1ZGW A;  3FXQ A;  1YOV B;  4QPO A;  1IO2 A;  1OYI A;  1R23 A;  3G1O A;  2QM3 A;  5HLT A;  3LSI A;  1BM9 A;  3MCZ A;  2UXX A;  2G7U A;  2L7F P;  3T8R A;  2A6H F;  2IJL A;  4U87 A;  2HDC A;  2XGE A;  2AQF A;  5GPA A;  3M8E A;  5H6R A;  2QGU A;  1IJW C;  1BC8 C;  3DTE A;  1MDM B;  5TJJ A;  2ZXI A;  1NG7 A;  3ABT A;  1GXP A;  1U9O A;  3RZO J;  1P4X A;  3QP5 A;  5FLV A;  4S04 A;  4HG2 A;  4XOR A;  2CQK A;  2X6W A;  2D1V A;  4ENJ A;  3U1K A;  4BXX J;  4FT8 A;  1B9N A;  3FKI J;  2VKE A;  4QLC U;  2M7B A;  4I76 A;  2RKH A;  3ZMT A;  4C3J J;  3ZQG A;  3M8J A;  2L5Q A;  1SVL A;  2BVM A;  2F6C A;  3SJM A;  2BOL A;  1IXC A;  2RRE A;  4BU2 A;  4LB5 A;  1Y1V J;  4D5F A;  2L9S A;  4IO9 F;  2NVQ J;  1ZR4 A;  2LD5 A;  1BOA A;  5F0F A;  4U0Y A;  2WB1 N;  3O2P E;  3M07 A;  3J7A O;  2FEZ A;  2JT1 A;  3GZ6 A;  3H9J A;  2ACJ A;  2LG4 A;  5HDK A;  3HIF A;  5E3L A;  3ABK H;  1E0E A;  4BE0 A;  2HYF A;  1ETK A;  1CF7 A;  5CVJ A;  2EV0 A;  2DJI A;  4O6J A;  2MGQ A;  3DLL F;  3GWZ A;  4FIS A;  4HF2 A;  1JKO C;  3U21 A;  3N4M A;  3LOC A;  1Y56 A;  3CCS I;  3PJR A;  5FKN A;  2ZXW H;  3R60 A;  4P5O A;  3FM3 A;  2EV5 A;  3F8B A;  1VQN I;  3N97 A;  4KIB A;  1QVU A;  2MLG A;  3E5U A;  1ZYR F;  2MH9 A;  3LSG A;  2ESN A;  3DXJ F;  2W57 A;  3I3L A;  3TOA A;  2LH9 A;  1UAA A;  2Y48 A;  4M71 A;  5FLX Z;  3N05 A;  1RI7 A;  3CCQ I;  3X2Q H;  4EJW A;  2YSR A;  1E2X A;  2JRT A;  1MZB A;  4CA0 A;  2E71 A;  2HZD A;  3NWT A;  3S17 J;  3DKW A;  4LGW A;  2NNY A;  4MTE A;  1FOK A;  1G59 A;  5EZH A;  1MBK A;  3F8M A;  2M87 A;  1Z7L A;  4LJZ F;  2O8X A;  4MIM A;  2JA6 J;  5JFR A;  1Y1W J;  1WJ5 A;  4HNV A;  5ICE A;  2E1C A;  1ZRD A;  3GME A;  2XF7 A;  3BWG A;  5JR3 A;  2HEO A;  2RQP A;  5F6F A;  5ILS A;  3I53 A;  1MBG A;  3BR1 A;  3WTW C;  4LIV A;  3WU0 A;  2DA1 A;  3IWZ A;  2PI0 A;  2PJR B;  3LSR A;  3ZQL A;  1MSF C;  1QZZ A;  2JQ7 A;  4ENK A;  4N9H A;  1G4D A;  2BBY A;  3JSP A;  2P6T A;  3C1D A;  2GLO A;  4RLQ A;  3FXO A;  1T33 A;  5DM7 F;  4OU0 A;  4ZZL A;  2H8W A;  5B66 C;  1B4A A;  2QQB A;  2X1C A;  1N77 A;  3IAM 2;  4EJT A;  5J40 A;  2M3A A;  1ULY A;  5GTI C;  5D8L B;  1IV8 A;  3I4N J;  3MWM A;  4XK4 A;  2MSY A;  4BY7 J;  2R5Y B;  3DTI A;  2NOJ B;  1P9Q C;  3TDZ C;  1IGN A;  2EFW A;  2H8R A;  4DW6 A;  1WPK A;  2KKO A;  2CV2 A;  1LPQ A;  1QBJ A;  1BIA A;  1LKX A;  1R5G A;  1T0F C;  2Q0O A;  1I1G A;  4V2F A;  3OYF A;  4XLF A;  1S5L C;  2HQA A;  2DQR A;  1HLV A;  1IDY A;  1W5S A;  4BEH A;  2HPM A;  1ZG1 A;  1I5Z A;  1UZC A;  2VJ4 A;  2JA7 J;  2K4B A;  2LRE A;  2KIS A;  2R92 J;  1S3J A;  1V3F A;  2VT3 A;  4G6D A;  2LDU A;  2IGK A;  2ZJP F;  4FX0 A;  2ISZ A;  3NAU A;  3OR1 C;  1KQ8 A;  4P9U A;  3U9G A;  4C2U A;  4IKF A;  3R0J A;  2H1L A;  4XMY A;  3DPL C;  5C3E J;  1H88 C;  1MND A;  3DPU A;  2Y69 H;  3CJN A;  3S93 A;  2OC6 A;  4IHY A;  4R8H A;  1BJA A;  2J5O A;  3BQZ A;  3QOP A;  2AQE A;  5K5R A;  3DEU A;  5D5U B;  3DEW A;  3F3X A;  1WI9 A;  2VKD A;  3GYH X;  2GWR A;  1JUP A;  3I4P A;  3HTS B;  1BI3 A;  4AM3 A;  2F2E A;  2YU3 A;  4IOC F;  1ETQ A;  2A05 A;  4B43 A;  4P55 A;  5E3M A;  4M3E A;  3PL8 A;  3BR5 A;  1IN4 A;  2P7V B;  4U0W A;  2EIN H;  2LNB A;  1SMY F;  1RRJ A;  3F6O A;  2DTZ A;  1EH7 A;  4E7L A;  3RPU D;  1M1E B;  4N9I A;  4LLG F;  1O7L A;  1C0W A;  1JJ8 C;  4UNO A;  2H27 A;  1B59 A;  1U8R A;  2ZNY A;  3QRF F;  2L7Z A;  4XL9 A;  2DTR A;  2IP2 A;  3WU1 B;  3DV8 A;  1YW9 A;  3PFY A;  4FE7 A;  1X3U A;  2ZXH A;  2YX4 A;  1W5T A;  2M8E A;  1W1W E;  3SQN A;  1QRY A;  4XOP A;  1S72 I;  1OCP A;  3AG1 H;  2HOT A;  2LMD A;  2W24 A;  1JUM A;  2O61 A;  1NK3 P;  1FMW A;  1BR2 A;  1JJ6 C;  3SHF A;  1ONV A;  1R1T A;  3FBI B;  1K79 A;  2XPW A;  1IRG A;  5DUK A;  3U2R A;  2DMU A;  4WXD A;  3JRF A;  3MVP A;  2VKV A;  4M6Y A;  4LG3 A;  3RPQ A;  3KYL A;  2P6S A;  1MJB A;  1HBX G;  4ASN A;  5TRD A;  2CS3 A;  3DKY A;  4RM2 A;  3HGY A;  4YG2 F;  1HCR A;  2VI6 A;  3WG9 A;  2O5R A;  2XAJ A;  4DBQ A;  5CKT A;  1KZH A;  1LVA A;  4A93 J;  3VYS B;  1FOW A;  4YFN F;  2PMU A;  1FBU A;  1Z05 A;  3CCV I;  3F9K A;  1E3H A;  1TW2 A;  4XKC A;  1X3W B;  2CV1 A;  1B8I B;  4F7Z A;  4UV9 A;  4UVC A;  2ZJR F;  2GIZ A;  3MZH A;  1GVJ A;  3IH3 A;  3MKY B;  5CQG A;  4C30 A;  4FCY A;  1SVM A;  3W2A A;  4D1Q A;  2ZME A;  2Y0M A;  1TBX A;  3OL3 A;  2PMZ N;  3CP8 A;  2CQX A;  3GFM A;  1EH6 A;  5M5X J;  2BY0 A;  1JKR C;  2QQ8 A;  4BE1 A;  2ZNZ A;  3GFJ A;  2DYR H;  5D4R A;  1QA6 A;  4KMU X;  1W36 C;  2ZC2 A;  3ML6 A;  1GUU A;  3E5X A;  5FD5 A;  5BPD A;  3WTX C;  5LGU A;  5K7H A;  1BJZ A;  1TZL A;  4EJV A;  2GOX B;  2A69 F;  2GIV A;  2QKL B;  1N75 A;  1U0J A;  2DK5 A;  3MZY A;  2CRG A;  2YPR A;  5CLS A;  5HNF A;  1XS9 A;  3TKY A;  3TMO A;  3NRV A;  3BG9 A;  4A5M A;  2R7Q A;  1XSX A;  2JA5 J;  4NHJ A;  1EJ9 A;  5FJ8 J;  2WAE A;  1I3Q J;  4KA4 A;  2FBK A;  2UWM A;  5JLX A;  2V6C A;  4XSZ F;  3VSL A;  2CFX A;  3CCJ I;  3K1M A;  1J5Y A;  2CQQ A;  5HLI A;  1Z9C A;  1FWZ A;  1XDU A;  3OS0 A;  1ZAO A;  1BW6 A;  4NB5 A;  1R71 A;  2XGX A;  1BR1 A;  2R7D A;  4OAZ A;  4PK4 A;  5HOD A;  1NG6 A;  2WY8 Q;  1HW2 A;  4LD5 A;  2M0C A;  2KL4 A;  2WA0 A;  1WVR A;  2MW8 A;  3WTU C;  3A4C A;  1D3Y A;  1LB2 A;  1L0O C;  2PN6 A;  1VI0 A;  3WGI A;  3T1B A;  1WJE A;  5LGT A;  1FTT A;  4HYE A;  4KIS A;  1JT0 A;  4CYC B;  2XV4 S;  4UUV A;  1FTZ A;  2P5L C;  5FKM A;  4XQF A;  1G3W A;  4GXO A;  1D5V A;  4Y15 A;  1HDD C;  5FLM J;  1P6R A;  3KP7 A;  1P92 A;  3VYU B;  1X2N A;  3PO2 J;  4BJ5 C;  2K85 A;  4L9V A;  3HG9 A;  3OIO A;  3R0A A;  1F43 A;  2CW7 A;  3EUH C;  2C6Y A;  3M3Y J;  1SFO J;  2VON A;  2QA4 I;  2QSH X;  1U5T A;  2L2O A;  3M1E A;  3J81 Z;  1XB4 A;  4ESF A;  4YIR X;  4HPQ A;  3CJT B;  4Y4R A;  2EA2 A;  3CJR B;  1IC8 A;  4AIH A;  2LF8 A;  2B63 J;  3W3C A;  1AU7 A;  3A03 A;  2ECB A;  2ICW G;  3WU2 C;  1D0X A;  2W7N A;  3KLO A;  3WHC A;  1KON A;  1R58 A;  2DOA A;  5HS9 A;  1FEX A;  5BQT A;  2P81 A;  1MJA A;  3CF2 A;  4XNF A;  3J80 K;  4BAC A;  3ZQC A;  3S16 J;  1VQ6 I;  4PCQ A;  2BVL A;  2Y2Z A;  2DMQ A;  1LFB A;  3K70 D;  1DP7 P;  1R7J A;  5HLH A;  4C9Y A;  3DF8 A;  1ITY A;  2F5C A;  5IYD J;  1FSH A;  3OR2 C;  1BR4 A;  4G7O F;  3MN2 A;  4BDY A;  2JWT A;  1YI2 I;  4IRH A;  2FUG 2;  3D5L A;  3Q0V A;  1J59 A;  2HXI A;  2QEN A;  3OIQ A;  5M3M J;  3IHU A;  2R7S A;  1B6A A;  4UUT A;  2H09 A;  3J7Y J;  3JRB A;  3RYP A;  2LR8 A;  5D8K B;  2K40 A;  2OZU A;  1O4X A;  2DMP A;  3DFG A;  4A5N A;  5E1W A;  2M45 A;  2W48 A;  2NNN A;  5J8F A;  1VFC A;  4IQ4 A;  1BC7 C;  2Z2S B;  1V5E A;  1MH4 A;  3OV8 A;  3P9K A;  4C3H J;  4HX4 A;  3OOP A;  2FRH A;  3JRC A;  1QHH D;  1CGP A;  2HNH A;  3HOS A;  3ECO A;  1SD4 A;  2XPU A;  5BOX A;  4HRI A;  1SAN A;  5CPR B;  3BPV A;  1X1D A;  1PYV A;  4G6T B;  1ZR2 A;  4Q4Z F;  1TQP A;  2GAU A;  2K9Q A;  3KP4 A;  1UEL B;  4P96 A;  3OYK A;  1FZP B;  3OSG A;  3FMS A;  2DT5 A;  3DU5 A;  3CUQ B;  4IZZ A;  2EH3 A;  3WOD F;  2HQR A;  3PNY A;  2BY1 A;  4B3X A;  3MKZ A;  5BS6 A;  2DO7 A;  2R4G A;  3FDY A;  1LQ1 A;  2CUF A;  4AID A;  1X1B A;  3S3N A;  4RMN A;  3VB2 A;  2A6T A;  1QPM A;  2B7E A;  1ERD A;  5LEJ A;  5FGM A;  3EYI A;  1JHH A;  1XGS A;  3BY6 A;  3RDI A;  2EFN A;  2WV1 A;  2O9L A;  1KA8 A;  5EGO A;  2LYC A;  5EEG A;  5BNG A;  5E3N A;  3GUD A;  2MYS A;  3LMM A;  2HZT A;  3BCA A;  3K69 A;  4IOA F;  3HYI A;  1XX5 A;  2KDZ A;  2CW8 A;  3JRD A;  3HRT A;  4B48 A;  1POG A;  1UHS A;  2QEX I;  2V9K A;  3S15 J;  1UG2 A;  1RUO A;  1MMA A;  3ZOB A;  4HNU A;  5DM6 F;  3G3Z A;  2ZFU A;  3QYB A;  1Q1H A;  2VBZ A;  4ON0 A;  4E6K G;  5F1R A;  4CHU A;  1VND A;  4ESB A;  1STZ A;  1UMQ A;  2K7L A;  5EZG A;  3E6B A;  1ON2 A;  1S6L A;  2ELH A;  1H0M A;  4XKV A;  1ZG5 A;  2XHK A;  3TGN A;  3UKG A;  1SEU A;  3H3V K;  3HUG B;  2CG4 A;  2BV6 A;  3Q5F A;  2F4O B;  3I5U A;  1SFX A;  2W85 A;  4B09 A;  2O0Y A;  4LIT A;  1BI2 A;  2LBF B;  2AO9 A;  3AL0 C;  3BOQ A;  2LFB A;  3IC7 A;  2X48 A;  3CUQ C;  3EYY A;  4RAY A;  2CWE A;  3VWB A;  5J8C A;  3H35 A;  3I0T A;  4EQQ A;  2X6Y A;  4D7N A;  5JHF A;  3GTP J;  3AKZ A;  1IG7 A;  4KN4 X;  4X0G A;  5KAI C;  1ETW A;  2O3F A;  2EIL H;  1DPR A;  4LK1 F;  4RLF A;  3TO9 A;  1JXS A;  5DV5 A;  1O3R A;  3CC7 I;  3CMA I;  3GTM J;  5HNH A;  2HOS A;  1JI8 A;  1R4N B;  3LA3 A;  3OOU A;  3JAM K;  1A31 A;  1E3P A;  2CQ7 A;  4RAG A;  4G8X A;  1AKH B;  2STW A;  4E7H A;  2DI3 A;  4NC8 A;  2VBY A;  4XRF A;  1TC3 C;  3K4N A;  2HGC A;  4D9J A;  3U1D A;  3CCY A;  4ETS A;  2ELK A;  1W7P B;  3EUK L;  4S0H B;  1QPI A;  3S3O A;  5ILV A;  2Z9O A;  1YQA A;  4PFP A;  5J4V A;  3BR3 A;  3HKZ A;  3TW7 A;  3AG3 H;  3COA C;  3EUA A;  1BBY A;  2X0L A;  3QOE A;  1OCR H;  4FET A;  3ONQ A;  1MMS A;  3DBR B;  3H0G J;  5EEA A;  3QU6 A;  3HZJ A;  4XLH A;  5GAE J;  1TTY A;  3K4J A;  1YFH A;  3BT9 A;  3F23 A;  1ZRC A;  2E2J J;  1XMX A;  1PUF A;  3RCO A;  3SEQ A;  4B8X A;  2DPU A;  4IXA A;  2IGO A;  2JPC A;  3OY9 A;  3SFZ A;  1OJL A;  4HSR A;  4MGR A;  3EET A;  3W2W A;  4CO8 A;  5J3L A;  1JTY A;  4XBF A;  1KU2 A;  1QZY A;  5KCM A;  4ANJ A;  3FBN B;  1GVD A;  4Z2Y A;  3HRS A;  3BP8 A;  2QSG X;  4OIQ F;  3IH4 A;  3L2W A;  5B3S H;  4J01 A;  2RNG A;  5KK1 A;  1XGM A;  3FM5 A;  4A3F J;  2KLO A;  2EIJ H;  2XRN A;  5J1Y A;  5FRO A;  4IQJ A;  3H9Q A;  2DMT A;  4M3D A;  1XGO A;  4HEA 2;  2IA2 A;  3OIP A;  4MFD A;  2Q2E A;  2DFH A;  3ZMZ A;  1PDN C;  4PFO A;  5IOZ A;  1V5G A;  1CF7 B;  2L54 A;  4XN3 A;  2CGP A;  3FXL A;  4Y52 J;  1P7J A;  3UNG C;  2CQN A;  2EZH A;  2EFQ A;  4IL6 C;  1O7F A;  2P5V A;  4LMY A;  3TW6 A;  3K10 A;  4UUS A;  4NDL A;  5EG0 A;  1DGR M;  1UFM A;  2X85 A;  4CH7 A;  5DYM A;  4MEX F;  3CC2 I;  4RAZ A;  1TNT A;  2BXZ A;  3QP6 A;  3KZZ A;  4UXN A;  2VN2 A;  2ZCW A;  2K3P A;  5DS9 A;  3OYH A;  1O3Q A;  3K0L A;  3GFI A;  3GTL J;  3O3K A;  4AIK A;  3OYC A;  3E3V A;  2KHM A;  2QBY A;  3ASO H;  2W4S A;  1Z67 A;  5A2Q K;  4PJN A;  1Z3Y A;  4I0A A;  4GO1 A;  5K5O A;  2AXT C;  4RB0 A;  5FKO A;  3R6S A;  2Z33 A;  1TW3 A;  3V4G A;  1F5T A;  1XTA A;  3E97 A;  1TWF J;  4LOC A;  1MH3 A;  1RC9 A;  2DT6 A;  2NS8 A;  3IKT A;  3OYI A;  1K83 J;  2VE8 A;  4Y17 A;  3FIW A;  1HKS A;  5HLG A;  1D5Y A;  3AFH A;  1YRN A;  3QYE A;  2DQL A;  3G73 A;  1IN8 A;  4LG0 A;  1IV6 A;  2DXI A;  2LSO A;  2IA1 A;  1YX3 A;  3RI4 A;  3TDU C;  1RPW A;  1MBH A;  2ZKZ A;  2OQR A;  3WTT C;  1V55 H;  2OTJ I;  4WCG A;  5J1R A;  1A5J A;  4P1W A;  3K6G A;  2VAS A;  2OPT A;  3L2C A;  2E1N A;  4FAS D;  1ETY A;  2IA0 A;  1LEA A;  1OCC H;  4J00 A;  3L2U A;  4M9Z A;  4A12 A;  1VQK I;  5E18 F;  3CF5 F;  1Z91 A;  2DJN A;  4M73 A;  2AS5 F;  3HDD A;  4M72 A;  2Z16 A;  2Y30 A;  2XAS A;  3ISP A;  2OAZ A;  5BPI A;  1HW5 A;  2R7X A;  4PZJ A;  4M9X A;  2FNA A;  2JUC A;  4PJM A;  4A3K J;  5B1A H;  2RAE A;  2XB5 A;  1TP4 A;  5L3D A;  3ROU A;  4BAY A;  4FQG A;  4WK8 F;  3OYA A;  3G6E I;  1QU3 A;  2EPF A;  1WQ2 A;  5AIQ A;  2BYV E;  1IAW A;  2F48 A;  4LFU A;  3DBH B;  1U6G A;  4UB6 C;  3QWL A;  3B02 A;  4M6V A;  1TWH J;  1FBS A;  3JAM Z;  1FYL A;  2XF5 A;  2D1H A;  3CTA A;  3HBL A;  3BG7 A;  4BHC A;  1MDM A;  2WTE A;  4EJO A;  3SZG A;  3JRI A;  3S3M A;  2FNP A;  2HDW A;  4L0Z B;  1LDJ A;  1MGT A;  3V7S A;  4BEH B;  4I7H A;  5FD6 A;  2KRF A;  2MAB A;  3LFK A;  2WAQ A;  1R49 A;  2CH0 A;  1YE9 A;  2R7F A;  1D1B A;  1GDT A;  4O3M A;  4YEJ A;  4A0Z A;  2IS2 A;  3IUO A;  1LFU P;  3OYG A;  4L0Y B;  5EYR A;  3I71 A;  3JTH A;  3KIO A;  4IRG A;  5ED4 A;  3TO7 A;  3TED A;  1VQ8 I;  4BJT A;  1NK2 P;  2JK3 A;  2TRT A;  3L2V A;  1VTN C;  1HOM A;  3CUO A;  3HOV J;  4A3M J;  4IHV A;  3AG4 H;  2X51 A;  5FRM A;  5J4Y A;  5E17 F;  2QUF A;  4RAF A;  3HRM A;  1OKR A;  4MEY F;  3RSN A;  3KPH A;  3T0Y A;  2MLK A;  3V8L A;  5EF6 A;  3DKX A;  3CCR I;  1I1S A;  3P9I A;  4E7J A;  3WTS C;  1APL C;  3I9V 2;  1HST A;  3G2B A;  4XLC A;  2L9R A;  3LQQ A;  2IPQ X;  3AAF A;  1XD7 A;  2VQL A;  4RM3 A;  1SVO A;  4N4O B;  5IYB J;  1O3T A;  3L09 A;  2ZB9 A;  2VUM J;  2K02 A;  4N4N B;  1OCZ H;  3BG5 A;  3FXJ A;  4U7B A;  2RN7 A;  1I27 A;  4UVA A;  5DTD A;  3HEF A;  4HNT A;  2PMH A;  1Y6I A;  1IUF A;  2I5U A;  2RV8 A;  3ELK A;  3ERM A;  2X6X A;  3ZQ7 A;  3MMY B;  1FOY A;  3MD2 A;  2OTL I;  2R93 J;  2Q8K A;  2DFI A;  5F64 A;  5JLW A;  3K70 C;  2DA4 A;  2M34 A;  1T56 A;  4C3I J;  4XLA A;  2DOE A;  3HXL A;  2XRL A;  4CYD A;  4FTH A;  3MAJ A;  2VXZ A;  2L02 A;  2HQ5 A;  1R1U A;  4HZF A;  1T0F A;  4Y7N J;  1B72 B;  4EM2 A;  4PJL A;  4BBR J;  4YFK F;  5LGN A;  4NQW A;  1G6N A;  1T38 A;  3CO6 C;  2GA2 A;  3LAP A;  1VQ9 I;  5LBQ A;  4ZDP A;  1AHD P;  1X4O A;  2M4K A;  3GO5 A;  1F36 A;  3E6M A;  2R7W A;  3GEZ A;  1H89 C;  1SMT A;  2ZSH B;  2HTS A;  1F1Z A;  1ZGA A;  3CDH A;  3CDL A;  5A2Q Z;  3HM5 A;  1MD0 A;  1T8I A;  2ZSI B;  1YJ9 I;  2WBM A;  1HW1 A;  3EDP A;  5LEK A;  4XRM A;  1PJR A;  1QQI A;  2Y31 A;  5E20 A;  2VQH A;  3J81 K;  3F72 A;  4JQF A;  3RQ4 A;  2E5Z A;  2R7R A;  5E79 C;  3ASN H;  1SD5 A;  4CCM A;  2KRH A;  2E2H J;  2ZME B;  2R3S A;  1X1C A;  3E5Q A;  3H1C A;  4BE2 A;  1WGX A;  1X4P A;  1XMK A;  3PM1 A;  2HDD A;  3GTK J;  3ECH A;  5FO5 A;  2Z99 A;  3CQZ J;  4JOM A;  2OBP A;  2P7C B;  2JTV A;  4ZH4 F;  5IOY A;  3RKQ A;  5FRN A;  1QO0 D;  2QVO A;  3NQO A;  5K7F A;  2FE3 A;  4W1U A;  4A0Y A;  2ID3 A;  4HST A;  3I4M J;  4PJ0 C;  1HXD A;  4ZTJ A;  4AYB A;  4ZDO A;  4E7K A;  1H9G A;  2HR3 A;  3FF5 A;  3I58 A;  4GCV A;  3DEE A;  3PQJ A;  3BR0 A;  1TWC J;  3CLO A;  3MKW B;  3HHG A;  1ZQ3 P;  2XAH A;  3VDX A;  3A01 B;  5IT3 A;  3V42 A;  3VYR B;  1W7P D;  1IDZ A;  3BCB A;  4PUS A;  4AVZ A;  1S29 A;  2V1D A;  2XDV A;  3B6A A;  4WF2 A;  2ZFW A;  1OYW A;  4KIT B;  1K6O A;  2JVH A;  4TV7 A;  5CJ9 A;  3VEP A;  3Q3S A;  2MA3 A;  4BXF A;  1IRZ A;  2DK8 A;  1K4T A;  2WV0 A;  2VJ5 A;  3HSR A;  4P9F A;  2IT0 A;  4C2T A;  4F3Q A;  4MO7 A;  3WHB A;  3LSH A;  1T98 A;  2KFD A;  4HX8 A;  2M5W A;  2K3F A;  1X3Z B;  3QPS A;  4IHW A;  4OMZ A;  2XAF A;  4IVN A;  5TIS C;  2VE9 A;  2DYS H;  1E3O C;  4NUB A;  3DPT A;  1OR7 C;  3FWE A;  4A3J J;  4F93 B;  3KE2 A;  3WTV C;  3W6J B;  2GXG A;  5HDG A;  3RKW A;  2NVU B;  2L4M A;  4WXH A;  2DOF A;  5CQE A;  2YUS A;  1Z6T A;  2CUE A;  4BBS J;  3VPR A;  3TP3 A;  3CP2 A;  3I59 B;  2YR2 A;  2E35 A;  4F91 B;  2XIG A;  2KRC A;  4RS8 A;  1V54 H;  1MJ9 A;  1HA8 A;  3P9C A;  3BJ6 A;  2V26 A;  2ME6 A;  5GAH J;  4HDV A;  2DDB A;  5BMZ A;  1U5T B;  2Y75 A;  5HVQ C;  5L3C A;  1UHM A;  3Q0W A;  1WWX A;  5LHG A;  5C4J J;  1X58 A;  3WGG A;  3GF2 A;  1QVT A;  4Q5S F;  1YIT I;  4A3G J;  2UUZ A;  2FOW A;  2VB6 A;  3OWT A;  4B4C A;  1LVK A;  3VSK A;  2VPL A;  3F22 A;  3H0D A;  1FC3 A;  1YIO A;  2NVY J;  1R1V A;  3S1R J;  4IHX A;  3KP5 A;  2VIX A;  3ZGK A;  2K86 A;  4M9S A;  3K1N A;  1X19 A;  2IXS A;  4XLN F;  4QTR A;  4PJJ A;  4E7S A;  4QSH A;  1MSE C;  2OD5 A;  3DU6 A;  3HB9 A;  3LQR A;  4II3 A;  5E8I A;  1Z77 A;  1KQ9 A;  4XID A;  1F9N A;  2MG4 A;  2XUB A;  2DOD A;  4BGD A;  3SZP A;  1B8I A;  2CUZ A;  3BR6 A;  1XGN A;  4OIP F;  2L9V A;  3O6B B;  1T39 A;  3ZMV A;  2QZ8 A;  1I50 J;  4L9T A;  2P5K A;  5KHD A;  3CJQ B;  1HC8 A;  5IY5 H;  1BOB A;  2VL8 A;  4X1E A;  1REP C;  2XVC A;  2I8D A;  3Q9V A;  4BDZ A;  3I55 I;  4BQA A;  2LY9 A;  3LSM A;  4G7Z F;  2FF4 A;  3CCM I;  2E2I J;  2XKO A;  3KET A;  2KIF A;  2MC3 A;  4AU7 A;  3EUH A;  4CUG A;  2CYY A;  4PSX A;  4UY8 I;  3EPZ A;  1TQI A;  4EJU A;  4HDU A;  1LEB A;  4K2E A;  1R5H A;  2DT7 B;  1MMG A;  2BW3 B;  4M74 A;  4AD9 A;  4BXU A;  1YX5 A;  2GBY A;  5LHH A;  1RKW A;  2A61 A;  2J5P A;  3RZD J;  4C2M J;  3CCL I;  1TL8 A;  2E7X A;  4E4H A;  2EZI A;  1KU3 A;  3OS1 A;  2Y9Y A;  2XAG A;  1VF9 A;  4BUP A;  2L3D A;  3F8C A;  1WJA A;  2D45 A;  3K9T A;  5IP7 J;  5DD4 A;  3ZQI A;  3F8F A;  1WJC A;  4EM1 A;  2RVC A;  2XAQ A;  3E7L A;  2W1O A;  1J75 A;  1AOY A;  4BL0 B;  4EVI A;  1WCM J;  3G71 I;  1PVE A;  2NS7 A;  4GGG A;  4ZJZ A;  4IX7 A;  4EGZ A;  3G1M A;  3WG7 H;  1GHC A;  4XN0 A;  4AC0 A;  2X1D A;  3BTI A;  1IXS B;  3WTZ A;  1JE8 A;  2L01 A;  4OIR F;  5HS7 A;  3MQ0 A;  2LP0 A;  2LLK A;  4BYY A;  5F08 A;  3HOT A;  4EGY A;  2IVM A;  2GQQ A;  4Z6Y A;  1FT9 A;  1ORK A;  2H6C A;  2XRO A;  3BTJ A;  1ZLJ A;  2OQG A;  3QQA A;  1NHA A;  2F4M B;  4A3B J;  1S9H A;  1K78 B;  1R6R A;  3ZPL A;  4LIU A;  2RC4 A;  4XOT A;  1LNW A;  3F0C A;  3CDI A;  3QOD A;  1H9T A;  4OMY A;  2ADU A;  3FHZ A;  4RGU A;  1XSV A;  5ICC A;  4RDU A;  2FA5 A;  2M0M A;  2XSD C;  3L1P A;  3GCM A;  2H1K A;  1I39 A;  3K2A A;  1W4M A;  3FK7 A;  2P4W A;  3IRR A;  2HWV A;  2X4H A;  4U88 A;  1OLT A;  2QCO A;  2M30 A;  3W6V A;  2ZJQ F;  1G3T A;  5F0C A;  2YU9 J;  4HF0 A;  4E7I A;  4PGH A;  1V5F A;  3KP2 A;  3VYT B;  2G7H A;  4ABZ A;  2QYO A;  2HU9 A;  4GDF A;  3F6V A;  2NXN B;  5D5X B;  2DFE A;  2EJR A;  3H3Z A;  4GYG A;  2V79 A;  4PGG A;  3LSJ A;  2L4A A;  3KYD B;  2E60 A;  4IEJ A;  4MHG A;  2PLY A;  2EZL A;  3GTG J;  1V4R A;  2MH2 A;  1LJ9 A;  2FXA A;  5AIP A;  2K9L A;  4A2U A;  2Z5U A;  4I02 A;  4WWC A;  1USS A;  4OOI A;  4BH9 A;  2IW5 A;  2FOK A;  1ACI A;  2HYG D;  2ISY A;  2XGD A;  2NS0 A;  5F0H A;  1ETX A;  1XC5 A;  3RQI A;  5KVR A;  3KX2 A;  4YII A;  1X1P A;  3S2H J;  4CZZ A;  4X6A J;  3D1N I;  1HKT A;  2EK5 A;  2VQC A;  2ZBK A;  4EMS A;  4WX9 A;  1DPU A;  1EKE A;  2FX0 A;  2UV1 A;  3JRA A;  5DCM A;  1X2M A;  1IF1 A;  2ZXJ A;  3E1S A;  1T6S A;  3ULQ B;  1ZKG A;  1VQP I;  2JA2 A;  1XSD A;  2EFP A;  3ZN0 A;  3BZK A;  2WC2 A;  4A3I J;  2EV6 A;  3BJO A;  1I6H J;  4IJA A;  1TT5 B;  4U7D A;  1SAX A;  3RTR A;  1K7A A;  4HA8 A;  1ODD A;  4XR6 A;  1IZ1 A;  2QSF X;  1RUN A;  4RB1 A;  2VOD A;  1LFP A;  2FBH A;  1ZN2 A;  3ZQH A;  1PUF B;  1MMN A;  1YS6 A;  1ZLK A;  3KZI C;  1S8N A;  3VOD A;  2NVT J;  2JUG A;  3S1M J;  1K61 A;  1FMV A;  1Q1V A;  3PIO F;  4AIJ A;  2L7M P;  3CUQ A;  3H3U A;  3HOU J;  1XCV A;  2OA4 A;  3V8K A;  2HVS A;  3QPL A;  1ZEL A;  1KYZ A;  2E36 A;  5F04 A;  4XON A;  2STT A;  4V2G A;  2PQ8 A;  4IHT A;  1U9N A;  2VT2 A;  2Q2E B;  2HOE A;  1RIO H;  2ESH A;  1S7A A;  2O03 A;  2G9W A;  3MKL A;  4II2 A;  4BNC A;  1DU6 A;  2JVG A;  4MQV A;  5ILU A;  4M3B A;  2R7Z J;  5C4X J;  3TOB A;  2M1B A;  3IAS 2;  3D5R C;  5LRS A;  4S05 A;  3S14 J;  1JGS A;  4B1R A;  5EG0 B;  1Z21 A;  1JKP C;  3M7G A;  3JSO A;  3M9A A;  3PNV A;  2HI3 A;  3WGH A;  2R5Z A;  3HOY J;  4XIC A;  4DBR A;  1X1A A;  1ZRF A;  3HSE A;  4ZYH A;  3ERE D;  4B47 A;  2P8T A;  3HHH A;  2DW4 A;  2IS4 A;  4NBQ A;  4F92 B;  4BQQ A;  1D0Z A;  2TCT A;  2MFZ A;  3DTK A;  3V7C A;  4M3F A;  4CXF A;  4BS9 A;  2QBY B;  1FLI A;  3WTY C;  2KZV A;  3KP6 A;  3S32 A;  5F27 A;  4DYC A;  2FBI A;  3NAR A;  2V9V A;  1YLF A;  2V9P A;  4ZYG A;  5H6Q A;  1ETV A;  2EB7 A;  4I99 C;  2R0Q C;  1L3L A;  5E1Z B;  1YRN B;  2BEO A;  2LBF A;  2OCC H;  3FZV A;  2OF7 A;  2BE5 F;  3AG2 H;  3DBL B;  2WAQ N;  1XPX A;  1G2H A;  1R4M B;  4V19 K;  1U2W A;  4YEL A;  4I6Z A;  3JR9 A;  2OU2 A;  5GAG J;  3RPU A;  5K5Q A;  1LE8 A;  5M5Y J;  4IPA A;  2EIM H;  4PSW A;  4CGZ A;  1MBE A;  2QF7 A;  3B6C A;  3LAJ A;  3BZ6 A;  1R9T J;  3GLL A;  3R61 A;  3FX3 A;  3HJE A;  2A68 F;  2X1E A;  3BJA A;  1FPQ A;  2CUJ A;  3CD6 I;  1OFC X;  4L5E A;  4XLE A;  5CYV A;  2EQR A;  5IT9 Z;  2VBW A;  4DZP A;  3KEO A;  2XSJ C;  1DGW Y;  3A0H C;  1GXQ A;  3H5N A;  3PSF A;  2L7K A;  2M4G A;  3JRE A;  3LA7 A;  2HXO A;  4AUX A;  1J7K A;  3Q0U A;  3GZ5 A;  1W7P A;  1T2K A;  5M5W J;  1Y8R B;  2F5D A;  2PBI A;  3HRU A;  3OSF A;  3DCF A;  2XGC A;  1WFX A;  2DA2 A;  1HSJ A;  3VOE A;  3S1N J;  1A6I A;  1HF0 A;  1JUS A;  2JZY A;  1IW7 F;  2JSC A;  4DYR A;  2Q1Z B;  2E1O A;  3IP4 B;  2R7T A;  3PUF A;  5GP9 A;  2CU7 A;  3C2G A;  2Z3Y A;  3I64 A;  4XM3 A;  2DA3 A;  2Y0S A;  4YRV A;  3DWL E;  3C18 A;  4A69 C;  2XC7 A;  5JVG F;  5J6X A;  3GVA A;  2KMU A;  3BTL A;  1RZ4 A;  2QQA A;  2D2W A;  1WH7 A;  2DCE A;  3CCU I;  1O3S A;  3PNT A;  4JBA A;  3IWF A;  4BJ6 C;  2JN6 A;  3KLN A;  3IL2 A;  4I01 A;  1ZK8 A;  4AVP A;  4G94 A;  2O6G E;  5C44 J;  4MTD A;  1G3S A;  4PDK A;  3ABM H;  3K4L A;  3ZRG A;  3MEX A;  5DDG A;  1KYW A;  3Q9S A;  5DEQ A;  4UVB A;  3V8J A;  2N8G A;  1E17 A;  3CMY A;  1D0Y A;  1FYM A;  3RKX A;  2E34 A;  3TBI A;  5H2F C;  2GA1 A;  2FQ3 A;  2OCE A;  2K9S A;  2OJE D;  1NTC A;  1D1C A;  4Y13 A;  1ZGJ A;  4CIC A;  2GXA A;  5CVR A;  2COB A;  4MNU A;  2K9N A;  1MBJ A;  1D8J A;  4HV5 A;  4RB3 C;  3C7J A;  2CW0 F;  4DZJ A;  2X9D A;  4AYB N;  1CQT A;  1IXR C;  1RES A;  2IBD A;  4KIF A;  2BY2 A;  3ZMS A;  2KJB A;  2LTP A;  2MBF A;  5D4S A;  1JGG A;  3E6D A;  4NQW B;  4OWR B;  4CCJ A;  1WJD A;  2W84 A;  2AXL A;  1ZTR A;  2FD5 A;  2X6O A;  5E8G A;  4BKX A;  4DNC A;  1ZHF A;  1R00 A;  2QWW A;  3H5A A;  1WKM A;  2IAI A;  2A3S A;  2VQG A;  3S2D J;  1EF4 A;  4NNJ A;  5D5V B;  1FJL A;  1GT0 C;  2JJ7 A;  4XKB A;  2DBB A;  2XAU A;  1Z3X A;  2B0L A;  2PX9 A;  3HGG A;  3S2W A;  4H4K C;  3TL4 X;  2Z1D A;  2A5W A;  3IKV A;  5L3F A;  4DQ2 A;  3SEZ A;  2XKP A;  4DJA A;  3FKJ A;  3M1C A;  1Y8Q B;  4HV6 A;  2TDX A;  5F1J A;  1IN5 A;  1I3A A;  1G3Y A;  2BY3 A;  4DGW B;  2K4J A;  3LSK A;  5EEH A;  1KGS A;  3J7A Y;  2IS1 A;  5K7Z A;  4LB6 B;  3K4C A;  2E19 A;  3FXM A;  3QPT A;  1SD6 A;  1B9M A;  1D1A A;  2OV7 A;  3OYD A;  3ZP5 A;  2ZO4 A;  1SD7 A;  1JT6 A;  3ZR8 X;  1KQ0 A;  1WJB A;  4XRS G;  3ZQF A;  4XSX F;  1WJF A;  2M2E A;  3FHN A;  2A07 F;  1XDS A;  5FKL A;  5JHU A;  3W6K B;  4UB8 C;  1SC7 A;  1YO5 C;  4IHS A;  2ID6 A;  1BA5 A;  3QPH A;  2DLL A;  2RGV A;  4ZYD A;  1U8B A;  1MNE A;  4KFC A;  4CZC A;  4NC6 A;  3PFI A;  4AWX B;  2PG4 A;  2WB1 A;  2E1M B;  2HKO A;  3ZCO A;  2UXN A;  3OYE A;  1DUX C;  1T95 A;  4LLL A;  3BLY A;  2CFO A;  3BRO A;  2K5C A;  4L9N A;  3JTG A;  2LKS A;  1IRX A;  2AHQ A;  2GZW A;  3ABU A;  4RGR A;  2W25 A;  5KNL A;  2EWN A;  1MNM C;  2VOP A;  2WAF A;  4CCK A;  3UR3 C;  1I6X A;  4HLX A;  2PJR A;  5D6E A;  4H0E A;  3BG6 A;  3T5X A;  4JX4 A;  2HQN A;  2R7V A;  1PP8 F;  3HTU A;  1LDK B;  4I2O A;  1F4K A;  5IPA A;  2FU4 A;  3JRG A;  2CV0 A;  3F21 A;  2COM A;  4DYQ A;  3ZMU A;  2V7F A;  4MFE A;  1D8K A;  4U0V A;  4RBO A;  2GM4 A;  1FIP A;  5JVT A;  3LA2 A;  5ERI A;  2OZ6 A;  4A3L J;  3GW2 A;  3DP7 A;  2LKX A;  4LLN A;  3KYC B;  1J2X A;  3LL7 A;  2R5Y A;  1SFU A;  1JKQ C;  4HLY A;  3KFW X;  1R22 A;  1YYV A;  1HKQ A;  4Y33 A;  4F52 A;  5CVV A;  2IS6 A;  3CZ6 A;  1IN7 A;  1SFK A;  2DAO A;  2V1N A;  4FE4 A;  3FMR A;  1XCB A;  2MC4 A;  3KEY A;  2XB0 X;  3FK6 A;  2VJJ A;  4YIF A;  5IYC J;  1FX7 A;  5EJC A;  4BHP A;  3P5J A;  2OUM A;  2NRA C;  3LWF A;  2E1M C;  4A6D A;  1MIJ A;  3R4K A;  1TWG J;  2HTJ A;  5GPC A;  1TQM A;  4IF4 A;  1BW5 A;  1HDP A;  3GXO A;  1B72 A;  1VQL I;  3H9G A;  1BI1 A;  3VFZ A;  1FOX A;  4ENN A;  3RYR A;  2R7O A;  2YS9 A;  2ZJ2 A;  2E7W A;  1OPC A;  4D5C A;  4QPQ A;  1UST A;  1WH5 A;  3L7W A;  4FHT A;  1ON1 A;  4GYI A;  5GTH C;  2JA8 J;  1AWC A;  3CO7 C;  1OCT C;  2KIQ A;  2ZME C;  2D5V A;  4I0B A;  2GOM A;  5GAD J;  1BIB A;  1QGP A;  2WAD A;  1ZRE A;  4OIO F;  4Q47 A;  1A04 A;  5HDN A;  5KAF C;  4IRI A;  3NWS A;  1RKT A;  2BZT A;  1WHU A;  5L3G A;  1Z6R A;  3ZN1 A;  3I56 I;  3RIR A;  3FXU A;  1OR7 A;  2P0W A;  1DQU A;  3CMM A;  5L3B A;  3GTJ J;  3BG3 A;  2LC2 A;  2VC1 A;  3A2K A;  3BTC A;  3K2Z A;  2LRD A;  2MD0 A;  4L5J A;  2BGC A;  4UHT A;  4ZYA A;  5DD8 A;  1MMD A;  1SFE A;  2IEK A;  9ANT A;  5M3F J;  1FBQ A;  5J1U A;  3MZ8 A;  3T8T A;  3J7Z I;  4RGX A;  2KIU A;  4ENM A;  3TP0 A;  1YJW I;  2B9S A;  3A02 A;  1MW7 A;  1OQY A;  4RGS A;  3NEU A;  2KPM A;  1LUJ B;  3L2Q A;  3F8N A;  2KIM A;  3WE3 A;  3S8P A;  4UV8 A;  3FXR A;  5FFZ A;  3JRH A;  3A0B C;  4KN7 X;  1YHQ I;  4KMF A;  4G12 A;  5IP9 J;  2JPB A;  3A01 A;  3FXK A;  1OIS A;  3CC4 I;  1KU7 A;  3MFK A;  1KU9 A;  2EA4 A;  4HOB A;  3V7R A;  5HOO A;  4BQN A;  4Q48 A;  2K27 A;  2ME0 A;  2XPV A;  4RA2 A;  4CDG A;  1DP3 A;  3PQK A;  2LY2 A;  2M7A A;  1YTY A;  1GLN A; 
#chains in the Genus database with same CATH homology
 1XC5 A;  3RQI A;  4JP0 A;  5FKO A;  3S2H J;  4X6A J;  5C3E J;  3D1N I;  1H88 C;  1W0U A;  2O8K A;  3LNQ A;  4IHY A;  1TWF J;  2M8G X;  2FX0 A;  4LOC A;  3JRA A;  1MH3 A;  1X2M A;  2NS8 A;  3BQZ A;  1K83 J;  1DU0 A;  3FIW A;  3DEW A;  4EEF G;  1D5Y A;  1ENH A;  1JUP A;  1ZKG A;  1YRN A;  1IV6 A;  4A3I J;  1ETQ A;  3C2B A;  5E3M A;  1I6H J;  3O8G A;  4M3E A;  1RPW A;  3BR5 A;  1MBH A;  2DTZ A;  3HOX J;  5J1R A;  1A5J A;  3ZQH A;  1PUF B;  2NVT J;  2OPT A;  2DA7 A;  3S1M J;  1ETY A;  1K61 A;  1Q1V A;  1JJ8 C;  3M4O J;  2L7M P;  3HOU J;  2DJN A;  3HDD A;  2L7Z A;  2Y30 A;  1TWA J;  3QPL A;  4FE7 A;  5F04 A;  1QRY A;  4V2G A;  4A3K J;  1MBF A;  1OCP A;  2RAE A;  2HOT A;  1U9N A;  3IV5 A;  3PO3 J;  2XB5 A;  1JUM A;  1NK3 P;  2LVS A;  2Y9Z A;  1JJ6 C;  3MKL A;  2XPW A;  1DU6 A;  2DMU A;  3JRF A;  2R7Z J;  4M3B A;  5C4X J;  4M6V A;  5EDN A;  1TWH J;  4BY1 J;  3MVP A;  2VKV A;  2VPR A;  4A3E J;  3S14 J;  4B1R A;  5EG0 B;  3HBL A;  1U78 A;  1JKP C;  3HGY A;  1HCR A;  2VI6 A;  2HI3 A;  2R5Z A;  5EGO B;  4XIC A;  3JRI A;  3HOY J;  1H8A C;  4CYC A;  4A93 J;  2TCT A;  1GDT A;  4M3F A;  1B8I B;  4JX5 A;  1LFU P;  3BR2 A;  3IH3 A;  5EYR A;  2EBI A;  4FCY A;  5F27 A;  4DYC A;  3TED A;  3NAR A;  1NK2 P;  2JK3 A;  2TRT A;  2PMZ N;  1HOM A;  3HKZ N;  2CQX A;  3HOV J;  4A3M J;  4IHV A;  2G0E A;  1ETV A;  2O7O A;  5M5X J;  4A3C J;  3S1Q J;  1JKR C;  2DMN A;  3O8H A;  2R0Q C;  1FIA A;  5EF6 A;  1YRN B;  1GUU A;  2OF7 A;  2WAQ N;  1G2H A;  2I10 A;  1APL C;  2FJ1 A;  1XG1 A;  2L9R A;  1S7E A;  5K7H A;  1BJZ A;  5IYB J;  4I6Z A;  4JYK A;  2DA6 A;  3JR9 A;  3SFI A;  1BL0 A;  1LE8 A;  5M5Y J;  3GBG A;  2CRG A;  4JX6 A;  2ZB9 A;  2VUM J;  1XS9 A;  3BG5 A;  3BG9 A;  1MBE A;  2QF7 A;  5DTD A;  1RR7 A;  3B6C A;  1Z0X A;  3HEF A;  1R9T J;  1IUF A;  2JA5 J;  5FJ8 J;  1OFC X;  4L5E A;  2EQR A;  1I3Q J;  2R93 J;  5JLW A;  4DZP A;  2DA4 A;  2M34 A;  1T56 A;  5JLX A;  4C3I J;  2CQQ A;  2XRL A;  4FTH A;  1BW6 A;  3JRE A;  3HOZ J;  2HXO A;  4AUX A;  4B3A A;  2HQ5 A;  3Q0U A;  4Y7N J;  1B72 B;  4BBR J;  5HOD A;  5M5W J;  3OSF A;  3DCF A;  1AHD P;  2XGC A;  2M0C A;  1F36 A;  2MW8 A;  2M9H A;  2DA2 A;  1H89 C;  2R5Z B;  1VI0 A;  3S1N J;  3CDL A;  2NOG A;  1FTT A;  3HM5 A;  1A6I A;  5IP6 A;  1JUS A;  1JT0 A;  1HF0 A;  2JMW A;  4CYC B;  4DYR A;  1FTZ A;  2E1O A;  5FKM A;  4GFB A;  1GV5 A;  4XRM A;  3GTO J;  2KT0 A;  5GP9 A;  2CU7 A;  1HDD C;  5FLM J;  2Y31 A;  1X2N A;  3PO2 J;  2DA3 A;  4XRS A;  3OIO A;  4MLO A;  4A69 C;  1F43 A;  2E2H J;  3M3Y J;  1WGX A;  3PM1 A;  3BTL A;  3GTK J;  2HDD A;  1WH7 A;  1SFO J;  3CQZ J;  3FIS A;  2LK2 A;  4J19 A;  2EZK A;  5IOY A;  4D7M A;  3RKQ A;  2JN6 A;  1ZK8 A;  5K7F A;  4W1U A;  2ID3 A;  5C44 J;  2NVX J;  3I4M J;  1IC8 A;  1RET A;  2B63 J;  2Y0S N;  1AU7 A;  1LE8 B;  3A03 A;  2ECB A;  3SDG A;  5E3O A;  2N8G A;  3WHC A;  3CMY A;  3K7A J;  1FEX A;  3BR0 A;  2HYJ A;  1TWC J;  2P81 A;  1ZQ3 P;  4UUS B;  3A01 B;  3ZQC A;  3S16 J;  1IDZ A;  1GV2 A;  2Y2Z A;  2DMQ A;  2K9S A;  1LFB A;  1NTC A;  1JTX A;  2FQ4 A;  1ITY A;  3B6A A;  5IYD J;  2COB A;  1W0T A;  2K9N A;  1MBJ A;  2ECC A;  3MN2 A;  2JWT A;  4DZJ A;  2X9D A;  4AYB N;  1CQT A;  3Q3S A;  2IBD A;  1RES A;  1IRZ A;  3Q0V A;  2HXI A;  2LTP A;  1JGG A;  5M3M J;  4QIW N;  4MO7 A;  4UUT A;  2L0K A;  3GTQ J;  3WHB A;  3JRB A;  1ZTR A;  2DN0 A;  2FD5 A;  2X6O A;  4BKX A;  1ETO A;  2LR8 A;  2K40 A;  3QPS A;  1O4X A;  4IHW A;  2IAI A;  2DMP A;  2HOA A;  3S2D J;  1EF4 A;  2W48 A;  1E3O C;  1FJL A;  1VFC A;  1GT0 C;  2JJ7 A;  4A3J J;  1MH4 A;  4C3H J;  3LSP A;  1P7I A;  3JRC A;  2DA5 A;  3HGG A;  1WI3 A;  4A3D J;  2CJJ A;  2YUS A;  2CUE A;  4BBS J;  3VPR A;  2XPU A;  3TP3 A;  5FKK A;  5F1J A;  1SAN A;  3IH2 A;  1ZR2 A;  2K9Q A;  5K7Z A;  4M3G A;  3G1L A;  3OSG A;  2ME6 A;  4W97 A;  2E19 A;  3BQY A;  2EH3 A;  3HOW J;  3Q0W A;  1AKH A;  1ZGW A;  5C4J J;  1JT6 A;  1X58 A;  4XRS G;  3G1O A;  3ZQF A;  1QVT A;  2L7F P;  2CUF A;  2M2E A;  4A3G J;  5FKL A;  4B4C A;  2XGE A;  5GPA A;  2ID6 A;  1BA5 A;  2NVY J;  3S1R J;  4IHX A;  1U8B A;  1IJW C;  2WV1 A;  2O9L A;  5EGO A;  5BNG A;  5E3N A;  1U9O A;  4QTR A;  3RZO J;  1MSE C;  4QSH A;  5FLV A;  3HB9 A;  2KDZ A;  1Z77 A;  4XID A;  2MG4 A;  2AHQ A;  4BXX J;  3JRD A;  3FKI J;  2VKE A;  1POG A;  1B8I A;  1MNM C;  1UHS A;  3BR6 A;  4I76 A;  3S15 J;  4C3J J;  3ZQG A;  1UG2 A;  3ZOB A;  3SJM A;  1I50 J;  1VND A;  1UMQ A;  5EZG A;  1Y1V J;  4D5F A;  4JX4 A;  2NVQ J;  1ZR4 A;  2LD5 A;  5F0F A;  4X1E A;  2WB1 N;  3UKG A;  5IPA A;  3H3V K;  3JRG A;  2LY9 A;  4DYQ A;  4MFE A;  2E2I J;  2AO9 A;  4RBO A;  2LFB A;  2GM4 A;  1FIP A;  2X48 A;  5E3L A;  4A3L J;  1ETK A;  2LKX A;  2MGQ A;  4D7N A;  3GTP J;  2R5Y A;  1JKQ C;  1IG7 A;  4FIS A;  1JKO C;  2GBY A;  1ETW A;  1RKW A;  3LOC A;  3RZD J;  4C2M J;  3GTM J;  2HOS A;  4FE4 A;  5FKN A;  2EZI A;  2Y9Y A;  1VF9 A;  2XB0 X;  3FK6 A;  3OOU A;  5IYC J;  1QVU A;  1AKH B;  5IP7 J;  3ZQI A;  3E7L A;  3LSG A;  1TC3 C;  1TWG J;  1WCM J;  5GPC A;  2NS7 A;  1BW5 A;  1HDP A;  3CCY A;  1B72 A;  3G1M A;  2ELK A;  4S0H B;  4AC0 A;  1QPI A;  3S17 J;  2YS9 A;  3BTI A;  3BR3 A;  3TW7 A;  4D5C A;  2LP0 A;  1WH5 A;  2LLK A;  2JA8 J;  5EZH A;  1MBK A;  5F08 A;  1OCT C;  4MIM A;  2JA6 J;  3H0G J;  2D5V A;  5EEA A;  1ORK A;  1Y1W J;  3BTJ A;  4HNV A;  3QQA A;  4A3B J;  3BT9 A;  1RKT A;  3F0C A;  2E2J J;  1PUF A;  1MBG A;  3BR1 A;  2DA1 A;  3LSR A;  3ZQL A;  2XSD C;  3BG3 A;  4RDU A;  3L1P A;  3GTJ J;  2H1K A;  1MSF C;  1OJL A;  3BTC A;  3K2A A;  3FK7 A;  5J3L A;  1JTY A;  2IEK A;  1GVD A;  9ANT A;  5M3F J;  2QCO A;  3W6V A;  2GLO A;  3IH4 A;  5J1U A;  1T33 A;  3TP0 A;  5F0C A;  4A3F J;  2YU9 J;  3A02 A;  5J1Y A;  2DMT A;  4M3D A;  4MFD A;  4ABZ A;  5IOZ A;  3I4N J;  4XK4 A;  2MSY A;  4BY7 J;  3JRH A;  2R5Y B;  1P7J A;  4Y52 J;  2EZH A;  3LSJ A;  3TW6 A;  4G12 A;  5IP9 J;  1IGN A;  4UUS A;  2H8R A;  4NDL A;  4DW6 A;  1WPK A;  3A01 A;  5EG0 A;  4IEJ A;  2EZL A;  3GTG J;  4V2F A;  1HLV A;  1IDY A;  2ME0 A;  2XPV A;  2JA7 J;  5DS9 A;  2R92 J;  3GTL J;  2XGD A;  5F0H A;  3NAU A;  1ETX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...