2EB7A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii 7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 56
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eb7A00
2ZFWA 1BN5A 5CYVA 1XGMA 5L3CA 2F5EA 5E18F 1XN7A 3SQNA 3DXJF 3ZMDA 5LEJA 1ZRCA 1U78A 2RN7A 4HF1A 4P9UA 3LA2A 5BPIA 3MAJA 2Z99A 1P4XA 2XAJA 2H94A 2RVCA 3QPTA 4CZZA 2EFPA 4WWCA 4ESBA 3DF8A 2Q2EA 3DKWA 1BM9A 4WCGA 2D1VA 1USSA 3W6JB 2MH9A 5ICGA 1P4WA 3L09A 1TW2A 3FM5A 1FYKA 2EA4A 2STWA 1ZYRF 3U1DA 4I0BA 3TDZC 5D6FA 2ZKZA 3EYYA 3P7NA 3E5XA 1FBSA 5LLQA 2XV4S 2HWVA 4FT8A 1R58A 2EFQA 1I27A 2P5KA 2LSOA 3GF2A 2HYFA 3R61A 1KQ0A 2UWMA 2DBBA 2QWWA 3FMRA 4P9FA 4ZYHA 3F8NA 1UCRA 3K9TA 1K78A 1HKSA 3VOEA 1ZGAA 3FZVA 1TQIA 5D8LB 2VE8A 1DDNA 3RKWA 4PGHA 1VTNC 1TNTA 1YO5C 5EEHA 4KMUX 3I53A 1AWCA 3QAHA 1FWZA 4PZJA 1P4AA 1PP7U 1GXQA 3IRRA 4ZZLA 4OINF 2GXBA 2J5OA 3FXQA 4HV6A 1BBYA 4IHSA 3MZYA 2DK5A 1P2FA 1JE8A 4S05A 2KIUA 3GLXA 3TOAA 2R7FA 1HBXG 4MQVA 2G9WA 3V8KA 3DFGA 2P4WA 3TOBA 5BOXA 1IRGA 4LLLA 1K6OA 3DPTA 5JFRA 3I59B 4ZYEA 1KU7A 2GA1A 1MZBA 4N9IA 1R36A 5F1RA 3BP8A 3KLNA 3CJNA 1W5SA 1IUYA 1I1SA 3K2ZA 4QLCU 1IXCA 2ESNA 1WSUA 1RNLA 3FX3A 4I0AA 5HVQC 3IWZA 2EWNA 3DPLC 2E1CA 4MEYF 1YW8A 4AVPA 3COAC 4UHTA 4OMYA 2LKPA 1SFUA 2DO7A 2ZMEA 3TO7A 1ODDA 2ZCWA 1T6SA 4R79A 5F6FA 2TDXA 4WK8F 3E5QA 4LLNA 3P9CA 4KN4X 5E8GA 3HOTA 3CUQA 3KLOA 1L0OC 2GXGA 1FYLA 3MQ0A 4EQQA 4ZH4F 2JPBA 2EV6A 1XSVA 4WF2A 1XDSA 2FE3A 1U3EM 3F6VA 4RAYA 1WKMA 1IAWA 3HHGA 2IPQX 2LNBA 4IRGA 4BNCA 5HDKA 1GXPA 5FFZA 3BZ6A 2VOOA 5HLIA 2VN2A 2ISZA 1ZG5A 1P92A 2QZ8A 1IXRC 1HSJA 3WU0A 2DT5A 5J8CA 3TKYA 2HYGD 3V8LA 4N9HA 3HSEA 3U9GA 5L3BA 4HAMA 3GX4X 5LRRA 6PAXA 2K02A 2RQPA 2O61A 5DEQA 2RNJA 3O3KA 1QO0D 3CTAA 2EV5A 5CVUA 4P5OA 1WWXA 3BOQA 4CXFA 4WXDA 5DD8A 2L3DA 1NHAA 1XGSA 4R1HA 4HX4A 2W24A 4LK0F 1D8KA 4ESFA 3V8JA 1LDDA 4HBLA 2HKOA 3WTWC 2F5DA 1B59A 4AD9A 5ICCA 3GW2A 2PN6A 3F8FA 3IRQA 1TQMA 1IN8A 2GAUA 2IA1A 1USTA 2MBFA 3PQJA 1MDMA 5E1XA 3WE3A 1HW1A 2HEOA 3IKTA 4EJWA 1U5TC 3F23A 4BYYA 1LJ9A 1OYWA 4EGZA 3HRSA 1MJ9A 5AIPA 5BPDA 1R23A 3K69A 4H0EA 2NRAC 4B09A 3M1EA 4DNCA 1Z05A 3R6SA 4A0ZA 4Y15A 3OOPA 1RIOH 4IRIA 4E70A 2NNNA 5K5OA 2VXZA 3D5LA 4LFUA 2CFXA 5IT3A 5LGUA 2ZBKA 3GYHX 2DLLA 1SMYF 4L0ZB 2VBXA 2PMUA 2ZO4A 1Z6TA 2VBWA 1A04A 2PEXA 3ML6A 2E7XA 5IT9Z 5FLXK 2D2WA 4IPAA 4A6EA 1Z6RA 4Y13A 4I98B 2LF8A 4M73A 3ZN1A 3KEOA 2W84A 2V79A 1BC8C 2YU3A 3WODF 2DQRA 2DTRA 4LB6B 4OIOF 2Y75A 3HRTA 5LHGA 1YFHA 3I58A 1OR7A 4EM1A 1BI3A 2QLZA 1TNSA 3KZZA 2HQRA 2K27A 2O6GE 2YPRA 2HGCA 3L00A 1S8NA 5JR3A 5HS8A 3H3ZA 1BI2A 3BROA 3J81Z 2NAZA 2XAGA 2BBYA 2IA2A 4ENJA 2A69F 1G4DA 3E3VA 2K4JA 5LHHA 4M9ZA 5JHUA 3E6BA 3IKVA 2XASA 2VE9A 4JK1X 1UHWA 1UHMA 2WWYA 3J7AO 1I6XA 3R60A 1WQ2A 3KP4A 3PQKA 5HLGA 3U2RA 1H9GA 4HW0A 1K78B 1XMAA 3DEUA 1TBXA 1ON1A 4XBFA 1SD7A 1Z7UA 2L4MA 3HHHA 4PDKA 4HX7A 2K4BA 1YTYA 4GO1A 4UNOA 2ETHA 3G73A 3EYIA 1R00A 3KEQA 4HQMA 5AIQA 1REPC 5FO5A 3MZHA 3H92A 1YIOA 2Z33A 3RJPA 3VEPA 3C7JA 4PGGA 3PFIA 3TQNA 3CLOA 1G3YA 1EH8A 3QP5A 4M9SA 2HDCA 5DDGA 1AOYA 2QUFA 2RDPA 1U6GA 2E1NA 3GXOA 3BJOA 3O2PE 2H6CA 5HS7A 2EJRA 5E1WA 3TO9A 3T8TA 1IN7A 4EGYA 5D5WB 3ZMTA 3RYPA 1W7PA 3F8MA 1FNNA 1KQ9A 5H6RA 2CW0F 1QZZA 2OQGA 3GFLA 4G94A 3Q9VA 1T98A 1QBJA 1SD5A 2VONA 2CSOA 1UB9A 2HTSA 1IZ1A 1ZHFA 2ZMEB 1O7FA 2QVOA 5KK1A 2O03A 5L3GA 2A5YB 3L7WA 1UFMA 1QNTA 4G7ZF 3GUDA 1FP1D 4OIQF 4OIPF 4ZYDA 4RB1A 3CUQB 2VBZA 3T0YA 2W57A 3KP3A 2AXLA 2P7VB 2VODA 1Z91A 2KIMA 1O57A 1XSXA 5E20A 4HV5A 2ZNZA 4KMFA 3RYRA 4I01A 3R4KA 4LJZF 1K79A 3QP6A 1S7AA 4GYGA 1KQ8A 2KJBA 1YW9A 2HQNA 2XROA 2WTEA 2E7WA 1ZG1A 1OPCA 2CGPA 5FD5A 4LLGF 1TQPA 2ADUA 4RAZA 3QRFF 1J59A 4LB5A 2BYVE 4XLPF 4FX0A 1FY7A 4HYEA 5DCFA 3BWGA 4IXAA 2MC3A 3F8BA 3LSTA 5LRSA 1J7KA 4WX9A 4G9YA 4A12A 3E6DA 2XHKA 3IL2A 1V3FA 1LVAA 4ETSA 2K7LA 2R7DA 1TLHB 2CYYA 4MTEA 1ZARA 3TDUC 2VC1A 3JAMZ 4HX8A 1ZLJA 2XAFA 2D45A 2EV0A 3VODA 2PI0A 1DPUA 3SFZA 3RTRA 3HTUA 4ASNA 5JI6A 2FNPA 1KA8A 2W25A 4JQFA 4L9TA 1U2WA 2EFNA 2EFWA 3RPUA 3F3XA 2IVMA 4I2OA 1MDMB 1DUXC 4BAYA 1F9NA 5DV5A 2WV0A 2HS5A 1J5YA 4U0WA 1R22A 1J75A 4M72A 4BXUA 1RI7A 4O6JA 1O3TA 2P6TA 3M9AA 2BEOA 4EJOA 5LBQA 3N4MA 2ELHA 4L9VA 4BHBA 4IVNA 3HIFA 4K2EA 3CUQC 2MA3A 5LGNA 4IF4A 1YQAA 3ERED 2DPUA 4TV7A 1G3WA 1G3SA 3VB2A 5LEKA 3GO5A 2COMA 2FF4A 2V9VA 2VC0A 2FRHA 5LHIA 2OQRA 2MLGA 1W4MA 3LQQA 4U7BA 1OKRA 3HUGA 2A3SA 2PG4A 4RGUA 3WTVC 2JPCA 4GCVA 3HYIA 4CO8A 1SFXA 3GZ6A 4A2UA 2HZTA 4R8HA 1ZH5A 3B02A 2L54A 2GZWA 1OMIA 3M7GA 3KZYA 1LB2A 1BI0A 4LGWA 5DYMA 3ULQB 3GFMA 3KFWX 3CO6C 1IF1A 5D8KB 2M1BA 1E2XA 2DAOA 3GVAA 4BQAA 4CHUA 1OYIA 4OU0A 5EEGA 1SMTA 1IRFA 4FHTA 4MHGA 2OA4A 3ZPLA 1Z9CA 1WI9A 5FGMA 1ULYA 3BJ6A 3AAFA 3GFJA 3IHUA 3L9FA 4HF0A 1RUNA 1J0RA 4LK1F 4EV0A 5HLHA 2XAHA 5ERIA 2L01A 1S29A 3ZMZA 2P5LC 5IT9K 3F22A 3NRVA 4EJUA 4KICA 2IW5A 5DUKA 1BI1A 5FB2A 1U5TA 2H6BA 2HFHA 2KJCA 4OMZA 1RZ4A 4KNYA 3LFKA 3S2WA 1OYYA 4Q5SF 2KRFA 2J5PA 2L02A 3P9KA 5ICEA 5ILUA 1W7PD 1JGSA 4XSZF 1W5TA 1ZGJA 3LQRA 1D5VA 2OAZA 1R1TA 2PQ8A 5AONA 2DQLA 4PCQA 5CJ9A 5K5RA 4XSXF 4HDVA 2RGVA 2XKOA 5F64A 3ZMVA 3EQLF 2DPDA 2XIGA 3RIRA 3J81K 1XMKA 2KIFA 1EV7A 2YR2A 2FBHA 3WTZA 1JHHA 1HKTA 3M8EA 4RS8A 4Y17A 2ZNYA 3VFZA 3ZMSA 2ESHA 4XLNF 3WU1B 3JTHA 4EM0B 2QQBA 2LDUA 3GZ5A 3C1DA 1HW2A 2DW4A 5DCMA 4LG0A 3QU6A 4MEXF 2OZ6A 1YYVA 1W7PB 1R1UA 3SXYA 3ROUA 4UUVA 1FP2A 2YX7A 1J9IA 2XAQA 2BV6A 2QYOA 1MGTA 4LD5A 1R5GA 2IRFG 1YS6A 3ECOA 3GFIA 1HKQA 4YFXF 1T0FA 1GHCA 4G7OF 4P55A 5A2QZ 3ELKA 1STZA 3SZTA 3E97A 4NHJA 5D5UB 2L4AA 1SD4A 3LA7A 2XUBA 2V6CA 2GA2A 4MTDA 2UXXA 3JW4A 4YIFA 3D0SA 5L3FA 1F5TA 2EB7A 4YG2F 3BJAA 1EH6A 4MGRA 1DPRA 2XRNA 4I02A 2M45A 1QZYA 4CGZA 5K1YA 2FSWA 4I7HA 1YLFA 3T5XA 5BMZA 1F4KA 3GWZA 2P8TA 2QM3A 4WXHA 2MLKA 1XCVA 2K86A 2QQ9A 1CF7A 1QGPA 1HQCA 5H20A 5BQTA 3G3ZA 5L3DA 2Z3YA 1FPQA 4KN7X 3EETA 1FLIA 3F8CA 2PJPA 3T1BA 4L18B 3WTXC 4G6DA 5CVIA 2JRTA 2FU4A 1Y0UA 5DUIA 1LDJA 3KP7A 5ILVA 3FXUA 5E17F 1MJBA 1B6AA 2A6HF 4EM2A 1LEAA 2NNYA 1D3YA 1KU9A 3TO6A 1B9MA 3HSFA 4F7ZA 1FOKA 2KKOA 2OD5A 1XDUA 5E8IA 4P96A 3J80Z 3FXRA 3E6MA 5CVJA 2XVCA 1ZREA 1D8JA 3I71A 2OZUA 4BH9A 4Q48A 3BY6A 4YIIA 3JTGA 1O3RA 2A61A 2XGXA 1P6RA 4L9JA 3K1PA 4ESJA 3I64A 4UV8A 5HDNA 3P9IA 2HOEA 3E5UA 2O0YA 4KA4A 4L9NA 3CDHA 5KVRA 1TTYA 2BGCA 4GYIA 2F2EA 2NS0A 4KIGA 1B4AA 4HLXA 4LMYA 1I5ZA 4M9XA 2DFIA 3OV8A 2IJLA 2PBIA 4UV9A 2W85A 4IHTA 3N97A 2QBYA 3F72A 3FHZA 1PUEE 3ZP5A 4U0YA 2PLYA 5CLSA 1FSHA 3JAMK 2ZXJA 4HDUA 1ONVA 4U7DA 2JTVA 4YFNF 5L3EA 2LF7A 3TGNA 2ZJ2A 5D4RA 3C18A 3RKYA 4AIKA 2DI3A 2YX4A 4ZYGA 4G7HF 3W6KB 3L2CA 1BIAA 1MKMA 4HQEA 3V7RA 2CO5A 3R0JA 3SHFA 3WG9A 4A5NA 2M30A 2Y48A 3B73A 3WE2A 1LNWA 1GVJA 3MCZA 4UVCA 4OOIA 1R1VA 5E1ZB 1C0WA 2F5FA 3EUHA 1KU2A 4FX4A 3LWFA 4HA8A 1I1GA 1FYMA 1Z1DA 1PP8F 3V7SA 5H6QA 3ISPA 1SAXA 2VOPA 2C6YA 3QOPA 2QQAA 4I09A 4ENNA 4L0YB 2X0LA 2VT2A 2GIVA 3E6CC 2Y0MA 2FMYA 5J6XA 5DD4A 1KGSA 1H0MA 3ABTA 3QPHA 5HOOA 4EJTA 1YS7A 4KIBA 1S7OA 1B9NA 1FSEA 2H09A 2VBYA 4M6XA 1BIBA 4RGRA 3K1MA 1U5TB 3ECHA 1FBQA 4A0YA 4A6DA 1WRJA 4HZFA 1LQ1A 3JSOA 1FZPB 3HRUA 5BS6A 3WTSC 2V1UA 1ZAOA 4OIRF 1E17A 5TRDA 5HS9A 4L5IA 2IT0A 4DQ2A 3IC7A 3ABUA 2RKHA 1U8RA 3K1NA 4UXNA 1ZRFA 4QWQA 1IN6A 2V1XA 4EVIA 2FNAA 5JVTA 4IRHA 1XGOA 4UVBA 1PDNC 2HKXA 2ISYA 4RB0A 4EMSA 5HDGA 3REOA 2Z5UA 4D0PA 4ENMA 4O5VA 1BOAA 3BPVA 4ZZDA 4ENKA 5DCMB 1JXSA 4LG0B 3WTYC 3ZN0A 1FBUA 5FD6A 1B1BA 3IWFA 5LGTA 1ZLKA 5D6EA 4KYWA 2CWEA 1ZN2A 2NYXA 4Q4ZF 2WC2A 1G3TA 5K5QA 4XRFA 1ZRDA 4GXOA 3I0TA 4UVAA 2AS5F 3KP2A 1MD0A 1R7JA 4KUMA 1HXDA 1XGNA 1ZG3A 2CG4A 1X3UA 4G8XA 2PMHA 2RV8A 3I5UA 5CVVA 2Q8KA 2FA5A 4HOBA 2A68F 1XD7A 2DU9A 1HW5A 3RDIA 2GWRA 3JSPA 4AIJA 3I54A 2M8EA 2O8XA 4M71A 3FM3A 4M74A 4RB3C 2BE5F 3HOSA 3HRMA 4RGSA 4ON0A 3Q5FA 3SZPA 1FC3A 4JBAA 1V4RA 3I59A 1BJAA 1O7LA 5TJJA 4KDPA 4IJAA 1H9TA 2Q0OA 1IW7F 3DV8A 4U88A 2IP2A 5CVRA 3RPQA 1CF7B 3MEXA 2X4HA 1F1ZA 5D5VB 2GQQA 1T39A 2FQ3A 4G6QA 1EH7A 3KP5A 3DP7A 1T2KA 3KETA 4MQ9F 1K7AA 2FXAA 4L5JA 3WGIA 3WTTC 2G7HA 3MFKA 3KP6A 4Z2YA 3T8RA 4M6YA 1Q1HA 1TW3A 2FBIA 2YSRA 1R5HA 4Q47A 1IN5A 2DK8A 4AIHA 3NEUA 3BDDA 1FT9A 1HSTA 2O3FA 3ZMUA 1ON2A 2JSCA 3Q9SA 5A2QK 1O3QA 2HR3A 1LDKB 3CUOA 4CYDA 1SFEA 4CICA 4RB2C 4RGXA 2PFBA 2VT3A 4NB5A 4NQWA 4YFKF 2A6EF 3CO7C 2IA0A 2A07F 3HTSB 3WTUC 1G6NA 4B8XA 5ILSA 2MD5A 4EJVA 2EFOA 1XB4A 4BHCA 4N0BA 3MWMA 1RUOA 3WGGA 3FF5A 2UZKA 2R3SA 3KCCA 3RI4A 4HF2A 2Z9OA 2QENA 2D1HA 2EA2A 2FBKA 3FMQA 2OBPA 3NQOA 2STTA 3V4GA 3V7CA 2XKPA 1L3LA 1CGPA 4A5MA 2FOKA 5D5XB 1BC7C 2OU2A 5D4SA 2P5VA 4KIFA 5FFXA 1KYZA 2QBYB 5FLXZ 3K0LA 2P7CB 3GEZA 3F6OA 3M8FA 4KFCA 2JT1A 1S3JA 1QPMA 2CQKA 2ACJA 3LAJA 2G7UA 4MNUA 4BHPA 2UXNA 1J2XA 2M5WA 1XSDA 3ZQ7A 2M87A 3QU3A 1SD6A 1YG2A 3WGHA 2MH2A 3O6BB 2F5CA 3FWEA 1IN4A 5ED4A 3EDPA 4KT5C 2V1DA 4GGGA 3H3UA 3J80K 3DQVC 1JHFA 3R0AA 4WXCA 3FMSA 4U0VA 3LA3A 3C3WA 3I4PA 4S04A 2P6SA 2RC4A 3RKXA 2FMLA 1KYWA 3KE2A 1IXSB 3HSRA 4CDGA 1LEBA 2FEZA 2HTJA 2H27A 1T38A 1O3SA 1XCBA 4HLYA 3LAPA 1QQIA 5ICFA 4AWXB 4O3MA 1DP7P 1FX7A 2B0LA 1MJAA 2JZYA 1KU3A 4A0XA 3F21A 5J8FA 3BPXA 2EK5A 1S6LA 1YW7A
chains in the Genus database with same CATH superfamily
2ZFWA 9ANTA 1BN5A 5CYVA 1Z77A 1XGMA 2DCEA 3W2AA 5L3CA 2F5EA 5E18F 4HSRA 4KISA 1ETKA 1XN7A 3SQNA 3DXJF 3DWLE 3ZMDA 5LEJA 4B3XA 2BY1A 1ZRCA 2QSHX 1A5JA 1U78A 2RN7A 4HF1A 4P9UA 3LA2A 2X6YA 5BPIA 1X2MA 3K4JA 5FLMJ 4NUBA 4XOTA 2EQRA 1T56A 1WFXA 3MAJA 2Z99A 5E3NA 1P4XA 2MSYA 3B6AA 2XAJA 2H94A 1EA3A 2MFZA 2RVCA 3QPTA 3H5NA 4CZZA 3HM5A 1HLVA 2EFPA 4WWCA 4ESBA 3DF8A 3MKWB 2Q2EA 3DKWA 1BM9A 1PYVA 2O7OA 3SZGA 4WCGA 3V42A 2D1VA 2LBFA 4B4CA 2CQQA 2XF7A 1USSA 3W6JB 2MH9A 5B1BH 5ICGA 1JKRC 3HOXJ 2EZHA 2JA8J 3BTJA 1P4WA 1NG6A 2DMPA 4XICA 5HNFA 1W1WE 3L09A 1TW2A 3FM5A 1JKQC 1FYKA 3PJRA 2EA4A 1XG1A 1ITYA 3I4NJ 2ZB9A 2DN0A 2STWA 2Y9ZA 5FKLA 1ZYRF 3U1DA 4HNTA 2XGEA 4I0BA 3TDZC 4D7MA 5D6FA 1BL0A 2ZKZA 3EYYA 3P7NA 2Y9YA 3K4NA 4BQQA 3W3CA 2IS2A 4AIDA 3E5XA 1FBSA 3GTJJ 1KZHA 5LLQA 3HPGA 3O8GA 4MLOA 3CMEI 4XNFA 2XV4S 2HWVA 3K4LA 4FT8A 2E1OA 1UAAA 1R58A 2EFQA 2IS4A 3VSLA 1I27A 2P5KA 2LSOA 4BGDA 4J19A 3GF2A 1S72I 2HYFA 5JVGF 4FTHA 3R61A 1KQ0A 3G4SI 2EPFA 5J47A 4IKFA 1EKEA 1OISA 4FQGA 4AYBN 3BCAA 2DBBA 2QWWA 4DGWB 4BQOA 2UWMA 2ID6A 3FMRA 1GDTA 4P9FA 4CUGA 4ZYHA 3F8NA 1UCRA 1PUFA 3K9TA 1K78A 1HKSA 2NS7A 3S8PA 2DODA 3VOEA 1ZGAA 3FZVA 1TQIA 5D8LB 2VE8A 1MSFC 4CH7A 1DDNA 3DTEA 2VASA 3RKWA 4PGHA 4CCOA 5GAEJ 2EIKH 3G6EI 2ZXWH 1VTNC 1TNTA 3H9QA 1YO5C 5EEHA 4KMUX 4PJLA 3I53A 1AWCA 1MMGA 3NARA 3QAHA 2RAEA 1FWZA 4G12A 4PZJA 3S1NJ 1P4AA 1PP7U 3H1CA 1GXQA 3IRRA 5C3EJ 2VQCA 3H9GA 3SYTA 4A3IJ 4ZZLA 4OINF 2LVSA 3CZ6A 5B5EC 4OWRB 1FMWA 4M3DA 2GXBA 2J5OA 3FXQA 4HV6A 4MFEA 3K6GA 3BC8A 1SFKA 1MMSA 1BBYA 4IHSA 3MZYA 2DK5A 1DGRM 1P2FA 1JE8A 4S05A 2KIUA 3GLXA 3VYTB 3TOAA 4A3GJ 2R7FA 1FOXA 1HBXG 1VZ0A 4MQVA 1D0YA 1IC8A 2E71A 2G9WA 3V8KA 4XRSA 4BY1J 1K83J 3DFGA 1S7EA 2P4WA 1K4SA 4XK4A 3TOBA 3HOUJ 5BOXA 1IRGA 3ZRGA 1JJ6C 2E1MC 2XRLA 4LLLA 4V2FA 3ABMH 2CUZA 1K6OA 3DPTA 5EEAA 5JFRA 3I59B 4YIRX 4ZYEA 1KU7A 2GA1A 2RQQA 2JVHA 4II2A 1MZBA 2H1LA 4N9IA 3IAS2 3PFYA 2ID3A 1R36A 1SVLA 3L2VA 2Y31A 5F1RA 3BP8A 3KLNA 3CJNA 3JRDA 1W5SA 1IUYA 1I1SA 4BBRJ 1WH5A 2OC6A 3K2ZA 4QLCU 3S14J 1IXCA 2ESNA 1WSUA 1T95A 1RNLA 1V5FA 2Q1ZB 3FX3A 3KX2A 1XS9A 4I0AA 3QYEA 5HVQC 3WHCA 1YX5A 1U9NA 3IWZA 2EWNA 3DPLC 4OAYA 1MNDA 4MEYF 2E1CA 1YW8A 3JRCA 4AVPA 3COAC 3SFIA 4UHTA 2W1OA 4IHVA 1U8BA 1UHSA 4OMYA 2MABA 2LKPA 1SFUA 2DO7A 2ZMEA 4NBQA 1VQ4I 1B8IA 2KL4A 3TO7A 1ODDA 2ZCWA 3JRGA 2W4SA 1T6SA 4R79A 1JGGA 5F6FA 4IOCF 4PK4A 2TDXA 1E3PA 4WK8F 4IZZA 3E5QA 4LLNA 2L9NA 1MMNA 2I5UA 3P9CA 4KN4X 4U87A 2VKHA 5E8GA 3BCBA 3HOTA 1X1BA 3CUQA 3K2AA 3KLOA 1L0OC 2GXGA 1FYLA 5F1JA 3MQ0A 4EQQA 2X6OA 4ZH4F 2JPBA 2EV6A 1XSVA 5F0HA 4WF2A 3EPZA 5EF6A 1XDSA 2FE3A 2IS6A 1P9QC 2N8GA 5F08A 4NQWB 1U3EM 3F6VA 4RAYA 1WKMA 2DA5A 2JQ7A 3KYDB 5F27A 3QOEA 1IAWA 5B3SH 3HHGA 1RR8C 2LY9A 2IPQX 4C3IJ 3TEDA 2LNBA 2BY0A 4IRGA 4BS9A 2IXSA 1OJLA 4BNCA 5HDKA 2EIJH 2HQ5A 3M1CA 2IGOA 2NOJB 1GXPA 5FFZA 3BZ6A 2VOOA 2WA0A 4DZJA 5HLIA 2VN2A 2ISZA 3CESA 3D5SC 1ZG5A 1I50J 1P92A 1Z21A 4XONA 1BR1A 2QZ8A 1IXRC 1HSJA 2LRDA 3FXJA 3WU0A 3CP2A 2X9DA 2LMDA 2DT5A 2VQGA 5J8CA 3TKYA 4OAZA 1AA7A 2HYGD 2ME6A 1NTCA 5DS9A 3V8LA 4N9HA 3HSEA 3U9GA 5L3BA 4HAMA 3GX4X 2I10A 3CF2A 3FKJA 5LRRA 6PAXA 3HJEA 1D1BA 3TMOA 4UUSB 2CV2A 1WZ2A 2K02A 2RQPA 4B1RA 2CUFA 2O61A 5DEQA 2RNJA 3O3KA 4BEHB 3KIOA 3ERMA 3G1LA 1Y39A 1MNMC 3EUAA 1QO0D 3CTAA 3GLLA 2LREA 2WB1N 1Y6IA 2DA1A 2EV5A 5CVUA 2JSPA 4HSTA 4P5OA 2XSJC 2EILH 4DW6A 1WWXA 3BOQA 4CXFA 4WXDA 5CPRB 5DD8A 2L3DA 1NHAA 5IP9J 1XGSA 4R1HA 2UUZA 3CCJI 4HX4A 2W24A 4LK0F 1D8KA 4ESFA 3V8JA 1P7JA 1LDDA 4XORA 4HNUA 4HBLA 3BR1A 2HKOA 3E0JB 3WTWC 2F5DA 2K9MA 3BLYA 3OYMA 2OF7A 1B59A 4I99C 4AD9A 5ICCA 3GW2A 4HEA2 4KT6A 2PN6A 2JMWA 3F8FA 3IRQA 4J00A 1TQMA 2LY1A 1IN8A 2VUMJ 2GAUA 3K4MA 2IA1A 1USTA 2MBFA 3DTIA 3LNQA 3PQJA 1MDMA 3F9KA 4BU2A 2KQRA 3CCMI 5E1XA 2OJED 3WE3A 2JUGA 2KDOA 1NK2P 5EDNA 2ME0A 1HW1A 2YU9J 2HEOA 3IKTA 4EJWA 1U5TC 5K7HA 3PNYA 3F23A 2K9NA 1R4MB 3AG3H 4BYYA 1LJ9A 3W6VA 3L2WA 2GBYA 5H2FC 1OYWA 2HI3A 4EGZA 4IOAF 3L1PA 3HRSA 1MJ9A 4A3JJ 5AIPA 2CFOA 5BPDA 1OCRH 4RAFA 4DYRA 3K7AJ 1R23A 3K69A 4H0EA 2NRAC 1X1AA 4B09A 2PX9A 3M1EA 4N4OB 4DNCA 3OSFA 4UB6C 2IAIA 2VJ4A 1HDDC 5JHFA 1Z05A 2AO9A 3R6SA 4A0ZA 4Y15A 3C2HA 4BKXA 5IYCJ 3OOPA 1RIOH 4IRIA 1BR2A 4E70A 1Y1WJ 2NNNA 2NVYJ 5K5OA 2CW8A 3SJMA 4B48A 1D5YA 2VXZA 3C2BA 1YI2I 3D5LA 2MYSA 2QKLB 4LFUA 1SVMA 4ZDOA 1DU6A 2CFXA 5IT3A 3DEWA 1DQUA 5LGUA 2GLOA 3HOZJ 2ZBKA 3GYHX 3HBLA 2DLLA 1FTTA 4IHYA 1SMYF 3QPSA 5IOZA 4L0ZB 1HF0A 3S3OA 1JTYA 2VBXA 2PMUA 2ZO4A 1Z6TA 2VBWA 3BR2A 1A04A 4M3EA 4AVZA 2RNGA 2PEXA 3ML6A 3ZR8X 2E7XA 5IT9Z 3BTIA 5FLXK 2D2WA 4IPAA 4A6EA 1Z6RA 4Y13A 4I98B 2LF8A 4M73A 1QVTA 3RZDJ 3ZN1A 5EG0A 1ZK8A 3KEOA 1BA5A 2E5NA 5B1AH 2W84A 3FXKA 2V79A 1BC8C 2HU9A 2CJJA 2YU3A 2DQRA 3WODF 2DTRA 4LB6B 4CZCA 4OIOF 4Y52J 1BJZA 2Y75A 2ZJRF 2R4GA 4C3JJ 4Y3OA 3HRTA 5LHGA 1YFHA 3I58A 3IH2A 1OR7A 4EM1A 3CDLA 4I76A 1BI3A 3FK6A 2HZDA 1HA8A 2Q2EB 2QLZA 1TNSA 2M7BA 1I39A 3OL4A 1ORKA 2YS9A 2CUEA 2LBFB 4GDFA 2I8DA 3KZZA 2HQRA 3OYNA 2K27A 1WJFA 1MBJA 2O6GE 2YPRA 2HGCA 3BG7A 3L00A 1S8NA 3QODA 5JR3A 5HS8A 3H3ZA 1BI2A 3BROA 3FXMA 3J81Z 1AHDP 4XIDA 2NAZA 2XAGA 2Y0SN 3D1NI 1NK3P 2BBYA 2IA2A 2OCCH 4ENJA 2A69F 2HVQA 1G4DA 2NOGA 3WHBA 3HG9A 3E3VA 2K4JA 5LHHA 3KZIC 4M9ZA 3JRHA 2R7RA 3OIQA 5JHUA 3FDYA 1K4TA 3E6BA 5FKOA 3IKVA 4FE4A 3GTLJ 2X6XA 2XASA 2VE9A 1JUSA 4JK1X 1UHWA 1UHMA 2Z1DA 3Q0UA 2WWYA 2CU7A 4UY8I 2W7NA 4C3HJ 2X1EA 2X1DA 3I55I 3LSJA 4E7SA 2CV1A 3J7AO 1I6XA 3R60A 1WQ2A 3KP4A 3PQKA 1HCRA 1H88C 5HLGA 2X48A 3S2HJ 3U2RA 2KDZA 1H9GA 4HW0A 1YITI 3TP0A 1PUFB 1K78B 2E35A 1XMAA 3DEUA 5JLXA 1TBXA 1ON1A 4XBFA 5F0CA 1LPQA 1SD7A 1Z7UA 2L4MA 2IGNA 3HHHA 4PDKA 3MKZA 4HX7A 2K4BA 1YTYA 4GO1A 1S9HA 2EZKA 2CQXA 4UNOA 3K70D 3SDGA 2ETHA 3G73A 3FBIB 4AM3A 2L9SA 3EYIA 1R00A 1VQ6I 1N78A 3KEQA 4XLHA 5EGOA 4HQMA 2JK3A 4I6ZA 5AIQA 3TW7A 3S17J 1REPC 2NVQJ 4BQNA 5FO5A 3MZHA 4XQFA 3H92A 5GTIC 2LH9A 1FMVA 1RC9A 1V5GA 4W97A 1YIOA 2Z33A 3G1OA 5F0FA 3RJPA 1F36A 3VEPA 2E60A 3C7JA 2HYJA 3JCUC 4PGGA 3PFIA 3TQNA 3CLOA 1XPXA 3KPHA 1G3YA 2VKDA 1EH8A 4Y33A 2TRTA 2ZSHB 3G71I 4A3MJ 3RQ4A 3QP5A 4M9SA 1JT6A 2HDCA 5DDGA 4ZTFA 1RESA 3VWBA 3AKZA 1AOYA 4MIMA 2QUFA 4E7ZA 2RDPA 4QPOA 1U6GA 2LD5A 2E1NA 2DMNA 2HOSA 3GXOA 3BJOA 3O2PE 2H6CA 2H8RA 2EZLA 4IHWA 1TWFJ 5HS7A 4BE2A 2EJRA 5FROA 5E1WA 3TO9A 5LD2C 3T8TA 1IN7A 4Y7NJ 4EGYA 5D5WB 3ZXSA 3ZMTA 1ENHA 3RYPA 1W7PA 3F8MA 4PFOA 1FNNA 1KQ9A 5H6RA 2CW0F 2DA3A 1QZZA 2OQGA 2DT7B 2Y0SA 3CDIA 3GFLA 5K7FA 1IDYA 4G94A 2M0MA 4BUPA 2F4IA 3Q9VA 2GIZA 2ELKA 2M3AA 2DJIA 1T98A 4XLEA 2XB0X 1VQNI 1QBJA 3VYSB 1E3OC 3UKGA 1SD5A 3TBIA 2VONA 3A4CA 2CSOA 3OYCA 1UB9A 2IGKA 2LY2A 4BJ5C 4CCKA 3OYFA 2HTSA 5KAFC 1JT0A 4RAGA 1IZ1A 1D1AA 1ZHFA 2ZMEB 3LSHA 1O7FA 5J3LA 2QVOA 3OL3A 5KK1A 2O03A 1B8IB 3RSNA 5L3GA 5DTDA 2A5YB 3JRAA 2HOTA 3L7WA 1UFMA 4B44A 1QNTA 4L5EA 1VQ8I 4G7ZF 2FJ1A 3ZQCA 5M3MJ 3GUDA 1FP1D 4OIQF 3CD6I 3JREA 4OIPF 4ZYDA 1YIJI 2OUMA 3CUQB 4RB1A 5IYDJ 2VBZA 5IYBJ 3T0YA 2W57A 3KP3A 5FRNA 1LUJB 1X1CA 2AXLA 2P7VB 2VODA 1Z91A 2KIMA 3QYFA 5J40A 1ZQ3P 2F4OB 4F52A 1O57A 1XSXA 2A05A 2GOMA 4ZJZA 2UV1A 5E20A 4HV5A 2M7AA 1MW7A 2ZNZA 1IV8A 4KMFA 3RYRA 2DJNA 4I01A 5E3OA 1SAUA 3R4KA 3H5AA 4LJZF 3LSRA 1R49A 1K79A 3QP6A 1N75A 1S7AA 2IBDA 4GYGA 4QIWN 1KQ8A 2NVUB 2KJBA 4AC0A 1YW9A 1TWCJ 2HQNA 3OYDA 3DBHB 3OYLA 2XF6A 2XROA 3OWTA 2W00A 2WTEA 3OIPA 4BDZA 2L7KA 2E7WA 2BW3A 2DTZA 1OPCA 1ZG1A 2E36A 2Y2ZA 5FD5A 2CGPA 3SEZA 2K40A 5FKNA 1GV2A 4LLGF 1TQPA 2ADUA 4CCLA 4RAZA 3QRFF 1J59A 2PMZA 4LB5A 2BYVE 4FISA 4XLPF 4FX0A 1FY7A 4HYEA 5DCFA 1MSEC 2R7XA 3CC4I 3H5RA 3BWGA 4IXAA 2XSDC 3A2KA 2MC3A 3ZGKA 3F8BA 1FJLA 3LSTA 5LRSA 1J7KA 4WX9A 4G9YA 4A12A 1Q1VA 3BQZA 3EUHC 2V26A 1T8IA 3MN2A 3E6DA 2XHKA 3IL2A 4HPQA 3DCFA 1V3FA 1LVAA 4ETSA 2K7LA 3AG1H 3CF5F 2R7DA 1TLHB 1TT0A 2CYYA 4MTEA 4YEJA 1ZARA 3TDUC 2VC1A 4H4KC 3JAMZ 1WPKA 4HX8A 3IUOA 1ZLJA 3IH4A 4PJMA 2XAFA 2D45A 1W0UA 2EV0A 2OCEA 3QQAA 2MC4A 3VODA 2PI0A 1DPUA 3OMYA 2WADA 2JA2A 3SFZA 3RTRA 3HTUA 4ASNA 5JI6A 2V6EA 2FNPA 3S3NA 2W25A 1KA8A 4JQFA 4L9TA 5KHDA 4IL6C 1U2WA 1WHUA 2EFNA 2W82A 2EFWA 2IS1A 1Z67A 2ZJPF 3A0BC 3RPUA 4X6AJ 3K70C 3M07A 3F3XA 2IVMA 4I2OA 3ASNH 1Y0NA 2HOAA 4JYKA 1D0XA 1MBGA 1Z0XA 3BTLA 5F04A 1MDMB 2NVTJ 3RKQA 1DUXC 5E79C 4Z6YA 5HLTA 5B66C 4BAYA 4M3BA 2K5CA 1F9NA 3CJRB 3DBRB 5DV5A 2WV0A 4IHXA 3PNTA 2FX0A 1A6QA 3DLLF 4Y4RA 1MMAA 1X4PA 2HS5A 1J5YA 4A3BJ 5J1RA 2MW8A 4U0WA 3DTKA 1R22A 2ZMEC 4IQ4A 1J75A 4M72A 4BXUA 1RI7A 4O6JA 3CCRI 1O3TA 2P6TA 3M9AA 2BEOA 4ABZA 4EJOA 2K85A 3HL2A 2BVLA 2DOAA 5LBQA 4E7JA 3N4MA 2ELHA 4L9VA 4BHBA 4IVNA 2CS3A 3HIFA 4K2EA 3CUQC 5M3FJ 2O8KA 2MA3A 5LGNA 2LLKA 1FOYA 4IF4A 5C44J 1YQAA 3H0GJ 5CQEA 3ERED 2DPUA 1YJ9I 2Y30A 3FK7A 3GTQJ 4TV7A 4NDLA 1G3WA 2JRMA 1G3SA 4XKVA 3BR3A 3VB2A 2ZJQF 5LEKA 3ZCOA 1POGA 3GO5A 2COMA 3KYLA 1R9TJ 2FF4A 2V9VA 3BZCA 2K9SA 2CUJA 2AQFA 2VC0A 2DDBA 2FRHA 2QQ8A 5LHIA 3OYIA 2OQRA 2JJ7A 2L0KA 2QGUA 3FXOA 2MLGA 3GMEA 5E3LA 1Y8RB 1W4MA 3LQQA 4U7BA 1OKRA 3I9V2 5EG0B 3BG3A 3HUGA 2R5YA 2A3SA 2G0EA 2PG4A 2BXYA 2BHYA 4NC8A 3HEFA 4RGUA 3WTVC 2JPCA 2K9LA 3HYIA 4GCVA 4CO8A 2LYCA 1SFXA 1EJ9A 1QVUA 3GZ6A 4A2UA 2HZTA 3AFHA 3L2UA 2BY2A 4R8HA 3OS2A 4PFPA 3S1QJ 1ZH5A 3UNGC 4N4NB 2L7ZA 3CCLI 3B02A 1VF9A 2L54A 3RQIA 2GZWA 1OMIA 2FD5A 3M7GA 3KZYA 1G2HA 1TC3C 2DA7A 1LB2A 1BI0A 4LGWA 5DYMA 3ULQB 2PJRA 3GFMA 3P5JA 2HXOA 1RKTA 2JUCA 3H35A 3KFWX 3W2WA 3CO6C 5TISC 4FETA 3MKLA 3G1MA 4MO7A 5D8KB 1IF1A 2D5VA 4ITVA 4E7IA 2M1BA 1UJ8A 1E2XA 5GAGJ 2XPWA 5KNLA 1R6RA 2DAOA 1OCZH 3GVAA 4IEJA 4BQAA 3BTCA 4CHUA 1OYIA 2DDAA 4OU0A 2AXTC 3MZ8A 3M3YJ 5EEGA 1SMTA 1IRFA 4FHTA 1I6HJ 3ZQFA 2QF7A 4MHGA 2OA4A 3ZPLA 4CCJA 4M3FA 1Z9CA 4C2MJ 1H8AC 2QEXI 1WI9A 3KYCB 5FGMA 3BQYA 4RM2A 3CP8A 1JJ8C 1ULYA 1H89C 3ABKH 5JLWA 2WAEA 1BW5A 3AG2H 3BJ6A 4RM3A 3AAFA 2V4JC 3GFJA 1OFCX 1G59A 3IHUA 3L9FA 4HF0A 1RUNA 3CCVI 1J0RA 4LK1F 4EV0A 2R92J 5HLHA 2XAHA 5ERIA 1QHHD 2LOOA 3CCUI 1O4XA 1ETYA 2L01A 1S29A 1NH3A 4GRIA 3ZMZA 4QPQA 2P5LC 5IT9K 2EINH 3F22A 4A3LJ 1N77A 3NRVA 4EJUA 2VPRA 4KICA 2IW5A 2JA7J 5DUKA 1ETXA 3DKXA 1BI1A 1ZKGA 5FB2A 3ZQLA 3CMAI 2ECBA 1U5TA 2H6BA 2HFHA 2LFBA 2KJCA 1MNEA 4OMZA 1RZ4A 4KNYA 4M3GA 3LFKA 3TP3A 1PJRA 4AUXA 1IJWC 3S2WA 2A6TA 1OYYA 1GLNA 1UZCA 5EGOB 1DGWY 4Q5SF 2KRFA 2J5PA 2L02A 3P9KA 4D5CA 5ICEA 1W7PD 5ILUA 3OYKA 1X1DA 1WJ5A 3OSGA 1A31A 1GT0C 1JGSA 2AQEA 4XSZF 3OR1C 1W5TA 3BT9A 4RLFA 1ZGJA 2CQNA 3LQRA 1D5VA 1M1EB 2OAZA 5M5XJ 1R1TA 2PQ8A 5AONA 2DQLA 4PCQA 5CJ9A 4BBSJ 5K5RA 2M2EA 2DYRH 3LFUA 4XSXF 4HDVA 2RGVA 2XKOA 5F64A 1X3WB 5KCMA 3ZMVA 3EQLF 3K4CA 3U1KA 2VJJA 4RA2A 2DPDA 3S15J 2XIGA 3RIRA 2GXAA 3J81K 1XMKA 1JI8A 2QSGX 3BZKA 2KIFA 1EV7A 2Y69H 2FBHA 2YR2A 3WTZA 1JHHA 1HKTA 3HOWJ 3M8EA 4PJNA 4RS8A 4Y17A 2ZNYA 3VYUB 5EZGA 3VFZA 5KAIC 2ESHA 5BNGA 1QRYA 3ZMSA 3S16J 1ACIA 3QWLA 4NC6A 4XLNF 1W36D 3WU1B 3DU5A 2VLAA 3JTHA 4EM0B 2QQBA 4BXFA 2LDUA 3GZ5A 4BY7J 3C1DA 3H0DA 4KJZA 1PVEA 1Y56A 2FOWA 1HW2A 2DW4A 3OIOA 5DCMA 3AL0B 1OCPA 4LG0A 4M6VA 1B72A 3QU6A 5IPAA 2JA5J 2KLOA 2XGDA 4MEXF 3LSIA 1FIPA 2OZ6A 1YYVA 3VDXA 1X2NA 4CCNA 1W7PB 1R1UA 3SXYA 1IGNA 1LKXA 3ROUA 4UUVA 4XLCA 3FIWA 1FP2A 2YX7A 1J9IA 2XAQA 2BV6A 2QYOA 1MGTA 4LD5A 3A0HC 1OR7C 1R5GA 2IRFG 3RCOA 3F0CA 4BXXJ 4C2TA 2VKVA 1YS6A 4FASD 4DIQA 3PSFA 1HC8A 2WAFA 2XF5A 3ECOA 4UB8C 3GFIA 1IDZA 1HKQA 4YFXF 1T0FA 1GHCA 4G7OF 3WU2C 4P55A 5A2QZ 3ELKA 2KRHA 1STZA 2X51A 3SZTA 3U21A 3E97A 1ZTRA 4NHJA 2R7TA 3PO2J 5D5UB 2BY3A 2L4AA 1SD4A 3J7AY 5HNHA 3LA7A 2XUBA 2HXIA 2V6CA 2GA2A 4MTDA 2UXXA 1LVKA 4JX5A 3JW4A 4C2UA 4YIFA 3D0SA 5L3FA 1F5TA 2EB7A 1LE8A 1VQ7I 1WI3A 2NXNB 3HGYA 3ONQA 4DBRA 3LL7A 5FKKA 2L5QA 3DLAA 4BE1A 4YG2F 2DT6A 3BJAA 1EH6A 4MGRA 2OPTA 3SDBA 4JOMA 1JUPA 4XRSG 1DPRA 2XRNA 2ELJA 1ZELA 4RDUA 1RPWA 3HC7A 3DU6A 2Z2SB 4I02A 2O5RA 2M45A 5M5YJ 1QZYA 1WVRA 1BW6A 4CGZA 2XPVA 1TZLA 5K1YA 2FSWA 3L2RA 4I7HA 1YLFA 3T5XA 5BMZA 1YE9A 2XGCA 1F4KA 3GWZA 5GTHC 2P8TA 2QM3A 4WXHA 4XLFA 2MLKA 3PIPF 1XCVA 2K86A 2BW3B 2QQ9A 4YRVA 1CF7A 1QGPA 1D0ZA 2A5WA 1HQCA 5H20A 4HRIA 5BQTA 3G3ZA 4NNJA 5L3DA 2Z3YA 1FPQA 1T33A 4KN7X 3EETA 1FOWA 3S3MA 5GPAA 1YJWI 2NS8A 1OCTC 3WG7H 1FLIA 3RPUD 3F8CA 2R93J 2JA6J 2PJPA 3T1BA 4L18B 3WTXC 1FTZA 1JTXA 2XPUA 3OY9A 4BJ6C 2HVSA 2CMPA 4G6DA 1VQ5I 4IO9F 1XMXA 2M4KA 2VKEA 4HG2A 3PUBA 1ZR2A 5CVIA 2JRTA 1CQTA 2FU4A 1Y0UA 3BR0A 5DUIA 4IQJA 2CH0A 4AU7A 2PMZN 1LDJA 3KP7A 5ILVA 3FXUA 5E17F 1AKHA 5C4XJ 1V55H 3H3VK 2H8WA 1MJBA 1B6AA 2K9QA 1XC5A 2A6HF 4EM2A 5GP9A 1LEAA 4ANJA 2NNYA 1D3YA 3FKIJ 2P0WA 1KU9A 3FHNA 2EZIA 2VPLA 3H9JA 3TO6A 1B9MA 1OQYA 3HSFA 2WV1A 3CC7I 4F7ZA 2B9SA 1ZGWA 1FOKA 3AL0C 2KKOA 2ICWG 2OD5A 1XDUA 5E8IA 2HQAA 1YRNA 4P96A 3J80Z 3FXRA 3CCQI 4D9JA 3ZOBA 1YJNI 2LR8A 4PUSA 2R7UA 2CW7A 3E6MA 3N05A 5CVJA 1ETVA 2XVCA 2ZXHA 1ZREA 1W5CC 4XN3A 4F93B 1YOVB 1S5LC 2WAQN 3PSIA 1J09A 1D8JA 3IAM2 3OOUA 1E0EA 3I71A 2OZUA 4PSXA 4B43A 2ZC2A 4BH9A 3A01A 4Q48A 3BY6A 2M34A 4YIIA 3JTGA 1O3RA 2A61A 2XGXA 1P6RA 4L9JA 3K1PA 4ESJA 1UELB 1OCCH 2R5ZA 2X1CA 4DYCA 3MVPA 2DA2A 3HZJA 2DOEA 5EZHA 3I64A 4UV8A 3PM1A 3HPHA 5HDNA 2HPIA 4BJTA 3P9IA 2HOEA 3E5UA 2F4MB 2KZGA 2O0YA 4KA4A 4L9NA 3CDHA 2ECCA 3HB9A 5K7ZA 1W36C 5KVRA 1TTYA 2BGCA 2KP6A 4GYIA 3ZQIA 2F2EA 2NS0A 2XAUA 4KIGA 5GAHJ 1B4AA 4HLXA 4LMYA 1MIJA 3MD2A 1I5ZA 4M9XA 2DFIA 3ASOH 3GZNB 3W2VA 4A3FJ 3OV8A 2IJLA 2PBIA 4F3QA 1K61A 4UV9A 2KIQA 2W85A 2BVMA 3DEEA 3RZOJ 4CSWA 3TL4X 4IHTA 4GFBA 3N97A 3GTMJ 3Q0WA 3PO3J 1APLC 2DA6A 2KZVA 3F72A 2QBYA 3FHZA 1PUEE 3ZP5A 1G8XA 4U0YA 4ZC3A 2PLYA 5CLSA 1FSHA 3BG9A 3JAMK 2ZXJA 4HDUA 1ONVA 2HPMA 4U7DA 3CCYA 2P81A 2JTVA 1TL8A 2WBMA 2DMQA 2E2IJ 4YFNF 5L3EA 1BR4A 3FISA 2LF7A 3TGNA 2ZJ2A 3HUGB 1SC7A 5D4RA 3C18A 3RKYA 1MBFA 2BHZA 2R5YB 4PJJA 3HOVJ 4AIKA 2CRGA 2EBIA 2R7SA 3S1MJ 2XB5A 2DI3A 1VQLI 2L2OA 3JRBA 3LMMA 4XM3A 2YX4A 4ZYGA 2F48A 4G7HF 3W6KB 3L2CA 5IP7J 5DM6F 1VQMI 1BIAA 4XN0A 5IP6A 2X6WA 3DPUA 1MKMA 4HQEA 1IRXA 2XDVA 2DXIA 2E19A 2EIMH 3V7RA 3I56I 2PJRB 2CO5A 3HOYJ 3R0JA 3GTGJ 1Z3XA 3SHFA 4LIUA 3WG9A 4XR6A 1W0TA 4A5NA 2JN6A 2M30A 2Y48A 3B73A 3WE2A 1LNWA 1GVJA 1SEUA 3MCZA 5J1UA 4UVCA 1NG7A 2FUG2 2K3FA 3HXLA 3BR5A 1Z3YA 4OOIA 1R1VA 4XOPA 5E1ZB 2E5ZA 1C0WA 4X1EA 1UMQA 2F5FA 1I3QJ 3EUHA 1KU2A 4FX4A 3ZQQA 2VI6A 3LWFA 2TCTA 1WJEA 2R7WA 4HA8A 1MMDA 4BL0B 1I1GA 4B47A 1FYMA 4XLAA 1Z1DA 2WY8Q 1ZR4A 1PP8F 1VNDA 3V7SA 2QCOA 5H6QA 2WAQA 5IOYA 2HDWA 3ISPA 3OYAA 1SAXA 2VOPA 3J7ZI 3LSPA 1MBKA 2C6YA 3QOPA 2QQAA 1ETWA 2V9KA 4I09A 1Z7LA 4ENNA 4L0YB 2X0LA 4CYCA 2VT2A 2GIVA 3E6CC 2Y0MA 3Q0VA 2FMYA 5J6XA 5DD4A 1KGSA 3FBNB 1H0MA 3ABTA 3QPHA 5HOOA 4EJTA 4W1UA 1YS7A 1IV6A 3S1RJ 4KIBA 2DFFA 1S7OA 3JRFA 1B9NA 2VL8A 4CA0A 3IP4B 1FSEA 2H09A 2VBYA 3OYGA 2DA4A 1DP3A 4EEFG 4ZDPA 4M6XA 1TT5B 5IY5H 5GPCA 1BIBA 4RGRA 4A69C 5DM7F 4A3CJ 3K1MA 1U5TB 3ECHA 1IRZA 1P7IA 1A35A 2KISA 1FBQA 2M4GA 4A0YA 1Y8QB 4A6DA 2VB6A 5CKTA 2FQ4A 4ZYAA 4ZDLA 4E4HA 1WJBA 1WRJA 4HZFA 1LQ1A 4LG3A 3GTPJ 3JSOA 1FZPB 3HRUA 2GM4A 3LSKA 3S2DJ 4V2GA 5BS6A 3WTSC 1RR7A 4DJAA 2KHMA 2V1UA 1ZAOA 2E2JJ 4OIRF 3MMYB 1E17A 3ESWB 5TRDA 3VSKA 5HS9A 1OCOH 4L5IA 4C9YA 2IT0A 4DQ2A 4XRMA 4BDYA 3IC7A 3ABUA 3BG6A 4NC7A 2RKHA 1U8RA 3K1NA 3GTKJ 3A1YA 4UXNA 1ZRFA 2HVRA 3IH3A 4QWQA 2BOLA 1IN6A 2B7EA 2V1XA 4AYBA 2FNAA 4EVIA 5JVTA 4E7HA 2O9LA 4IRHA 1XGOA 1IG7A 4UVBA 1PDNC 2HKXA 2ISYA 1TWAJ 5EJCA 4RB0A 4EMSA 2V9PA 2AHQA 1VI0A 3ZQHA 5HDGA 3REOA 2Z5UA 4D0PA 4ENMA 4BE0A 3HKZN 4F55A 4QSHA 3PIOF 5E3MA 2VQHA 4O5VA 5FLVA 1BOAA 3BPVA 4ZZDA 4ENKA 2VQLA 5DCMB 1JXSA 4LG0B 3WTYC 3ZN0A 1B72B 1FBUA 3IWFA 1B1BA 2F5VA 2OV7A 5FD6A 5D6EA 5LGTA 1VFCA 1YHQI 1ZLKA 1WJAA 2CWEA 4E7KA 4KYWA 1ZN2A 2NYXA 3CJTB 3IV5A 4Q4ZF 1JKPC 4F91B 2DOFA 2WC2A 1G3TA 5K5QA 3NWTA 1X4OA 4XRFA 1ZRDA 5C4JJ 2DMTA 3M8JA 3E1SA 4UUTA 3E7LA 4GXOA 1TP4A 3I0TA 4UVAA 4RLQA 2AS5F 1QU3A 1X1PA 3KP2A 1MD0A 3D5RC 1R7JA 5FJ8J 1HOMA 4E6KG 3A03A 4KUMA 4A3DJ 3H36A 1HXDA 1XGNA 1ZG3A 1X58A 1DU0A 2E2HJ 2CG4A 1X3UA 4G8XA 1QPIA 4B3AA 2M9HA 2QA4I 2PMHA 3JRIA 2HDDA 3SEQA 2RV8A 1EF4A 3I5UA 3QPLA 4S0HB 1R5ID 3A02A 2BZTA 1VQ9I 5CVVA 2Q8KA 2FA5A 4ZTJA 4J01A 3PL8A 4HOBA 2A68F 4BACA 1LE8B 1XD7A 2NVXJ 1XTAA 2DU9A 2KPMA 1IO2A 1HW5A 3RDIA 3L2QA 2GWRA 2ZSIB 4PJ0C 3EUKL 3JSPA 4AIJA 3I54A 2M8EA 4RBOA 2V7FA 5FKMA 2O8XA 4M71A 3FM3A 2GOXB 2LG4A 4M74A 4RB3C 1GUUA 2BE5F 3HOSA 4IX7A 1YX3A 1TWHJ 3HRMA 4RGSA 4ON0A 2R7QA 3O8HA 3OYBA 3Q5FA 3SZPA 4LOCA 1FC3A 2LK2A 4JBAA 1V4RA 3I59A 1BJAA 1O7LA 5TJJA 4KDPA 2VXDA 1QA6A 2XC7A 4XKWA 4IJAA 1H9TA 2COBA 2IEKA 1X3ZB 1ETOA 4DBQA 2R7ZJ 2Q0OA 1IW7F 4P1WA 3DV8A 4U88A 2IP2A 2LKXA 5CVRA 3RPQA 3S93A 1LFBA 1CF7B 2E34A 3MEXA 4C30A 1V5EA 4XKCA 2X4HA 1R4NB 1F1ZA 3TW6A 5D5VB 3CLQA 2GQQA 2B63J 1T39A 2FQ3A 2QKMB 4G6QA 2L7FP 1EH7A 3KP5A 3HGGA 2LC2A 3DP7A 3S32A 1T2KA 2DFEA 3KETA 4MQ9F 1K7AA 2FXAA 1SVOA 4L5JA 3WGIA 1N25A 1WJCA 3QYBA 3WTTC 3BR6A 1XX5A 2G7HA 3FXLA 3KP6A 4Z2YA 3T8RA 4YELA 4M6YA 1ETQA 3MFKA 1WH7A 1Q1HA 1TW3A 2FBIA 2YSRA 1V54H 5CQGA 3GCMA 3NAUA 1R5HA 3OYEA 3HKZA 4Q47A 4QTRA 4CCMA 3CCEI 1IN5A 2DK8A 4AIHA 4A93J 4II3A 2DMUA 3NEUA 4JX6A 2QSFX 1FT9A 2W48A 3BDDA 3X2QH 1HSTA 2Z16A 2O3FA 3ZMUA 1I3AA 1ON2A 3NWSA 2JSCA 3Q9SA 5A2QK 1R71A 2KFDA 1O3QA 2HR3A 1AKHB 1LDKB 4JP0A 4DOZA 3CUOA 1MBHA 1T08B 3VYRB 4CYDA 4PSWA 2RREA 1SFEA 1AU7A 4CICA 4RB2C 3JR9A 2L7MP 5FRMA 4RGXA 3LSGA 3HDDA 1FIAA 2PFBA 2VT3A 4NB5A 4NQWA 2MD0A 4YFKF 2A6EF 4MFDA 4D5FA 4EATA 3OYHA 3CO7C 3AG4H 4LIVA 2IA0A 3J7YJ 2A07F 2OTLI 3HTSB 3OS1A 5J1YA 1F43A 3UR3C 1G6NA 3WTUC 4DZPA 4B8XA 4DYQA 4F92B 1YRNB 1QHGA 2V1NA 5ILSA 2MD5A 1JUMA 3PUFA 1VQOI 4EJVA 2EFOA 1XB4A 4BHCA 3K4KA 4N0BA 1U9OA 2LKSA 2M8GX 3MWMA 5J4VA 1RUOA 4V19K 3BG5A 3WGGA 3FF5A 3K10A 2UZKA 3A01B 2VIXA 2R3SA 1ERDA 3OS0A 3KCCA 3RI4A 4HF2A 2WB1A 5TGTA 2DFHA 2MG4A 4D1QA 2CQ7A 1TWGJ 3OR2C 2L9RA 2R5ZB 4XMYA 2Z9OA 2QENA 2D1HA 1T0FC 2EA2A 2FBKA 3FMQA 4A3EJ 1LFUP 1RETA 1MH3A 1GVDA 2OBPA 3NQOA 2STTA 3V4GA 3I4MJ 4XL9A 4UUSA 5GADJ 4KITB 1E3HA 3MKYB 1GV5A 3V7CA 1MBEA 1FEXA 5EYRA 5J4YA 2XKPA 2JWTA 4G6TB 5LFAA 1L3LA 1CGPA 4A5MA 4BEHA 2FOKA 5D5XB 3DBLB 4LITA 4RMNA 4FCYA 2F6CA 3G2BA 1IUFA 1BC7C 5HODA 2OU2A 2K3PA 5D4SA 2P5VA 2L9VA 4KIFA 4XKBA 5FFXA 1KYZA 2QBYB 5FLXZ 3K0LA 2P7CB 3GEZA 3F6OA 3M8FA 4E7LA 1A6IA 4KFCA 2OTJI 2MGQA 2JT1A 1S3JA 1JKOC 1QPMA 3Q3SA 4FE7A 2CQKA 2ACJA 1WGXA 3I3LA 3LAJA 2G7UA 1VQKI 3GBGA 3CMYA 4MNUA 4BHPA 2CV0A 2UXNA 1J2XA 2M5WA 1XSDA 3ZQ7A 3CCSI 2M87A 1WCMJ 1SD6A 3QU3A 4D7NA 1SFOJ 2KT0A 1D1CA 1YG2A 3PNVA 1BOBA 1UG0A 2M0CA 2WY7Q 3OYJA 3WGHA 2BXZA 2MH2A 3O6BB 2F5CA 2X85A 3FWEA 1IN4A 5ED4A 3EDPA 2JVGA 2H1KA 3KEYA 4KT5C 1Y1VJ 2V1DA 2LTPA 4CYCB 1HDPA 3H3UA 4GGGA 3ZQGA 3J80K 3LOCA 3DQVC 2IGMA 1RRJA 1JHFA 1K6YA 3ABLH 3R0AA 3CC2I 2ZXIA 3DKYA 2ZFUA 1KONA 3B6CA 4WXCA 3FMSA 4U0VA 1RKWA 2LP0A 3LA3A 2VJIA 3C3WA 3CQZJ 1UG2A 3I4PA 2HNHA 2R7VA 2VJ5A 4S04A 2P6SA 2RC4A 3RKXA 2FMLA 3C2GA 1KYWA 1WJDA 2KRCA 3KE2A 1IXSB 3HSRA 4CDGA 3GTOJ 1LEBA 2FEZA 2HTJA 2H27A 2R0QC 1T38A 1O3SA 2R7OA 5M5WJ 3K4BA 1XCBA 3VPRA 2KMUA 4HLYA 4JX4A 4X0GA 3LAPA 1QQIA 1OLTA 1A36A 5ICFA 4AWXB 2YUSA 3LSMA 1DP7P 4O3MA 1QZEA 3CMMA 1FX7A 1VQPI 1U0JA 2B0LA 1MJAA 1MH4A 2JZYA 1LFPA 1KU3A 1SANA 2DYSH 3M4OJ 4A0XA 4A3KJ 3F21A 2EH3A 5J8FA 2E1MB 4HNVA 3BPXA 1X19A 2EK5A 3CJQB 1S6LA 1YW7A
chains in the Genus database with same CATH topology
2ZFWA 1BN5A 5CYVA 1XGMA 5L3CA 2F5EA 5E18F 1XN7A 3SQNA 3DXJF 3ZMDA 5LEJA 1ZRCA 1U78A 2RN7A 4HF1A 4P9UA 3LA2A 5BPIA 3MAJA 2Z99A 1P4XA 2XAJA 2H94A 2RVCA 3QPTA 4CZZA 2EFPA 4WWCA 4ESBA 3DF8A 2Q2EA 3DKWA 1BM9A 4WCGA 2D1VA 1USSA 3W6JB 2MH9A 5ICGA 1P4WA 3L09A 1TW2A 3FM5A 1FYKA 2EA4A 2STWA 1ZYRF 3U1DA 4I0BA 3TDZC 5D6FA 2ZKZA 3EYYA 3P7NA 3E5XA 1FBSA 5LLQA 2XV4S 2HWVA 4FT8A 1R58A 2EFQA 1I27A 2P5KA 2LSOA 3GF2A 2HYFA 3R61A 1KQ0A 2UWMA 2DBBA 2QWWA 3FMRA 4P9FA 4ZYHA 3F8NA 1UCRA 3K9TA 1K78A 1HKSA 3VOEA 1ZGAA 3FZVA 1TQIA 5D8LB 2VE8A 1DDNA 3RKWA 4PGHA 1VTNC 1TNTA 1YO5C 5EEHA 4KMUX 3I53A 1AWCA 3QAHA 1FWZA 4PZJA 1P4AA 1PP7U 1GXQA 3IRRA 4ZZLA 4OINF 2GXBA 2J5OA 3FXQA 4HV6A 1BBYA 4IHSA 3MZYA 2DK5A 1P2FA 1JE8A 4S05A 2KIUA 3GLXA 3TOAA 2R7FA 1HBXG 4MQVA 2G9WA 3V8KA 3DFGA 2P4WA 3TOBA 5BOXA 1IRGA 4LLLA 1K6OA 3DPTA 5JFRA 3I59B 4ZYEA 1KU7A 2GA1A 1MZBA 4N9IA 1R36A 5F1RA 3BP8A 3KLNA 3CJNA 1W5SA 1IUYA 1I1SA 3K2ZA 4QLCU 1IXCA 2ESNA 1WSUA 1RNLA 3FX3A 4I0AA 5HVQC 3IWZA 2EWNA 3DPLC 2E1CA 4MEYF 1YW8A 4AVPA 3COAC 4UHTA 4OMYA 2LKPA 1SFUA 2DO7A 2ZMEA 3TO7A 1ODDA 2ZCWA 1T6SA 4R79A 5F6FA 2TDXA 4WK8F 3E5QA 4LLNA 3P9CA 4KN4X 5E8GA 3HOTA 3CUQA 3KLOA 1L0OC 2GXGA 1FYLA 3MQ0A 4EQQA 4ZH4F 2JPBA 2EV6A 1XSVA 4WF2A 1XDSA 2FE3A 1U3EM 3F6VA 4RAYA 1WKMA 1IAWA 3HHGA 2IPQX 2LNBA 4IRGA 4BNCA 5HDKA 1GXPA 5FFZA 3BZ6A 2VOOA 5HLIA 2VN2A 2ISZA 1ZG5A 1P92A 2QZ8A 1IXRC 1HSJA 3WU0A 2DT5A 5J8CA 3TKYA 2HYGD 3V8LA 4N9HA 3HSEA 3U9GA 5L3BA 4HAMA 3GX4X 5LRRA 6PAXA 2K02A 2RQPA 2O61A 5DEQA 2RNJA 3O3KA 1QO0D 3CTAA 2EV5A 5CVUA 4P5OA 1WWXA 3BOQA 4CXFA 4WXDA 5DD8A 2L3DA 1NHAA 1XGSA 4R1HA 4HX4A 2W24A 4LK0F 1D8KA 4ESFA 3V8JA 1LDDA 4HBLA 2HKOA 3WTWC 2F5DA 1B59A 4AD9A 5ICCA 3GW2A 2PN6A 3F8FA 3IRQA 1TQMA 1IN8A 2GAUA 2IA1A 1USTA 2MBFA 3PQJA 1MDMA 5E1XA 3WE3A 1HW1A 2HEOA 3IKTA 4EJWA 1U5TC 3F23A 4BYYA 1LJ9A 1OYWA 4EGZA 3HRSA 1MJ9A 5AIPA 5BPDA 1R23A 3K69A 4H0EA 2NRAC 4B09A 3M1EA 4DNCA 1Z05A 3R6SA 4A0ZA 4Y15A 3OOPA 1RIOH 4IRIA 4E70A 2NNNA 5K5OA 2VXZA 3D5LA 4LFUA 2CFXA 5IT3A 5LGUA 2ZBKA 3GYHX 2DLLA 1SMYF 4L0ZB 2VBXA 2PMUA 2ZO4A 1Z6TA 2VBWA 1A04A 2PEXA 3ML6A 2E7XA 5IT9Z 5FLXK 2D2WA 4IPAA 4A6EA 1Z6RA 4Y13A 4I98B 2LF8A 4M73A 3ZN1A 3KEOA 2W84A 2V79A 1BC8C 2YU3A 3WODF 2DQRA 2DTRA 4LB6B 4OIOF 2Y75A 3HRTA 5LHGA 1YFHA 3I58A 1OR7A 4EM1A 1BI3A 2QLZA 1TNSA 3KZZA 2HQRA 2K27A 2O6GE 2YPRA 2HGCA 3L00A 1S8NA 5JR3A 5HS8A 3H3ZA 1BI2A 3BROA 3J81Z 2NAZA 2XAGA 2BBYA 2IA2A 4ENJA 2A69F 1G4DA 3E3VA 2K4JA 5LHHA 4M9ZA 5JHUA 3E6BA 3IKVA 2XASA 2VE9A 4JK1X 1UHWA 1UHMA 2WWYA 3J7AO 1I6XA 3R60A 1WQ2A 3KP4A 3PQKA 5HLGA 3U2RA 1H9GA 4HW0A 1K78B 1XMAA 3DEUA 1TBXA 1ON1A 4XBFA 1SD7A 1Z7UA 2L4MA 3HHHA 4PDKA 4HX7A 2K4BA 1YTYA 4GO1A 4UNOA 2ETHA 3G73A 3EYIA 1R00A 3KEQA 4HQMA 5AIQA 1REPC 5FO5A 3MZHA 3H92A 1YIOA 2Z33A 3RJPA 3VEPA 3C7JA 4PGGA 3PFIA 3TQNA 3CLOA 1G3YA 1EH8A 3QP5A 4M9SA 2HDCA 5DDGA 1AOYA 2QUFA 2RDPA 1U6GA 2E1NA 3GXOA 3BJOA 3O2PE 2H6CA 5HS7A 2EJRA 5E1WA 3TO9A 3T8TA 1IN7A 4EGYA 5D5WB 3ZMTA 3RYPA 1W7PA 3F8MA 1FNNA 1KQ9A 5H6RA 2CW0F 1QZZA 2OQGA 3GFLA 4G94A 3Q9VA 1T98A 1QBJA 1SD5A 2VONA 2CSOA 1UB9A 2HTSA 1IZ1A 1ZHFA 2ZMEB 1O7FA 2QVOA 5KK1A 2O03A 5L3GA 2A5YB 3L7WA 1UFMA 1QNTA 4G7ZF 3GUDA 1FP1D 4OIQF 4OIPF 4ZYDA 4RB1A 3CUQB 2VBZA 3T0YA 2W57A 3KP3A 2AXLA 2P7VB 2VODA 1Z91A 2KIMA 1O57A 1XSXA 5E20A 4HV5A 2ZNZA 4KMFA 3RYRA 4I01A 3R4KA 4LJZF 1K79A 3QP6A 1S7AA 4GYGA 1KQ8A 2KJBA 1YW9A 2HQNA 2XROA 2WTEA 2E7WA 1ZG1A 1OPCA 2CGPA 5FD5A 4LLGF 1TQPA 2ADUA 4RAZA 3QRFF 1J59A 4LB5A 2BYVE 4XLPF 4FX0A 1FY7A 4HYEA 5DCFA 3BWGA 4IXAA 2MC3A 3F8BA 3LSTA 5LRSA 1J7KA 4WX9A 4G9YA 4A12A 3E6DA 2XHKA 3IL2A 1V3FA 1LVAA 4ETSA 2K7LA 2R7DA 1TLHB 2CYYA 4MTEA 1ZARA 3TDUC 2VC1A 3JAMZ 4HX8A 1ZLJA 2XAFA 2D45A 2EV0A 3VODA 2PI0A 1DPUA 3SFZA 3RTRA 3HTUA 4ASNA 5JI6A 2FNPA 1KA8A 2W25A 4JQFA 4L9TA 1U2WA 2EFNA 2EFWA 3RPUA 3F3XA 2IVMA 4I2OA 1MDMB 1DUXC 4BAYA 1F9NA 5DV5A 2WV0A 2HS5A 1J5YA 4U0WA 1R22A 1J75A 4M72A 4BXUA 1RI7A 4O6JA 1O3TA 2P6TA 3M9AA 2BEOA 4EJOA 5LBQA 3N4MA 2ELHA 4L9VA 4BHBA 4IVNA 3HIFA 4K2EA 3CUQC 2MA3A 5LGNA 4IF4A 1YQAA 3ERED 2DPUA 4TV7A 1G3WA 1G3SA 3VB2A 5LEKA 3GO5A 2COMA 2FF4A 2V9VA 2VC0A 2FRHA 5LHIA 2OQRA 2MLGA 1W4MA 3LQQA 4U7BA 1OKRA 3HUGA 2A3SA 2PG4A 4RGUA 3WTVC 2JPCA 4GCVA 3HYIA 4CO8A 1SFXA 3GZ6A 4A2UA 2HZTA 4R8HA 1ZH5A 3B02A 2L54A 2GZWA 1OMIA 3M7GA 3KZYA 1LB2A 1BI0A 4LGWA 5DYMA 3ULQB 3GFMA 3KFWX 3CO6C 1IF1A 5D8KB 2M1BA 1E2XA 2DAOA 3GVAA 4BQAA 4CHUA 1OYIA 4OU0A 5EEGA 1SMTA 1IRFA 4FHTA 4MHGA 2OA4A 3ZPLA 1Z9CA 1WI9A 5FGMA 1ULYA 3BJ6A 3AAFA 3GFJA 3IHUA 3L9FA 4HF0A 1RUNA 1J0RA 4LK1F 4EV0A 5HLHA 2XAHA 5ERIA 2L01A 1S29A 3ZMZA 2P5LC 5IT9K 3F22A 3NRVA 4EJUA 4KICA 2IW5A 5DUKA 1BI1A 5FB2A 1U5TA 2H6BA 2HFHA 2KJCA 4OMZA 1RZ4A 4KNYA 3LFKA 3S2WA 1OYYA 4Q5SF 2KRFA 2J5PA 2L02A 3P9KA 5ICEA 5ILUA 1W7PD 1JGSA 4XSZF 1W5TA 1ZGJA 3LQRA 1D5VA 2OAZA 1R1TA 2PQ8A 5AONA 2DQLA 4PCQA 5CJ9A 5K5RA 4XSXF 4HDVA 2RGVA 2XKOA 5F64A 3ZMVA 3EQLF 2DPDA 2XIGA 3RIRA 3J81K 1XMKA 2KIFA 1EV7A 2YR2A 2FBHA 3WTZA 1JHHA 1HKTA 3M8EA 4RS8A 4Y17A 2ZNYA 3VFZA 3ZMSA 2ESHA 4XLNF 3WU1B 3JTHA 4EM0B 2QQBA 2LDUA 3GZ5A 3C1DA 1HW2A 2DW4A 5DCMA 4LG0A 3QU6A 4MEXF 2OZ6A 1YYVA 1W7PB 1R1UA 3SXYA 3ROUA 4UUVA 1FP2A 2YX7A 1J9IA 2XAQA 2BV6A 2QYOA 1MGTA 4LD5A 1R5GA 2IRFG 1YS6A 3ECOA 3GFIA 1HKQA 4YFXF 1T0FA 1GHCA 4G7OF 4P55A 5A2QZ 3ELKA 1STZA 3SZTA 3E97A 4NHJA 5D5UB 2L4AA 1SD4A 3LA7A 2XUBA 2V6CA 2GA2A 4MTDA 2UXXA 3JW4A 4YIFA 3D0SA 5L3FA 1F5TA 2EB7A 4YG2F 3BJAA 1EH6A 4MGRA 1DPRA 2XRNA 4I02A 2M45A 1QZYA 4CGZA 5K1YA 2FSWA 4I7HA 1YLFA 3T5XA 5BMZA 1F4KA 3GWZA 2P8TA 2QM3A 4WXHA 2MLKA 1XCVA 2K86A 2QQ9A 1CF7A 1QGPA 1HQCA 5H20A 5BQTA 3G3ZA 5L3DA 2Z3YA 1FPQA 4KN7X 3EETA 1FLIA 3F8CA 2PJPA 3T1BA 4L18B 3WTXC 4G6DA 5CVIA 2JRTA 2FU4A 1Y0UA 5DUIA 1LDJA 3KP7A 5ILVA 3FXUA 5E17F 1MJBA 1B6AA 2A6HF 4EM2A 1LEAA 2NNYA 1D3YA 1KU9A 3TO6A 1B9MA 3HSFA 4F7ZA 1FOKA 2KKOA 2OD5A 1XDUA 5E8IA 4P96A 3J80Z 3FXRA 3E6MA 5CVJA 2XVCA 1ZREA 1D8JA 3I71A 2OZUA 4BH9A 4Q48A 3BY6A 4YIIA 3JTGA 1O3RA 2A61A 2XGXA 1P6RA 4L9JA 3K1PA 4ESJA 3I64A 4UV8A 5HDNA 3P9IA 2HOEA 3E5UA 2O0YA 4KA4A 4L9NA 3CDHA 5KVRA 1TTYA 2BGCA 4GYIA 2F2EA 2NS0A 4KIGA 1B4AA 4HLXA 4LMYA 1I5ZA 4M9XA 2DFIA 3OV8A 2IJLA 2PBIA 4UV9A 2W85A 4IHTA 3N97A 2QBYA 3F72A 3FHZA 1PUEE 3ZP5A 4U0YA 2PLYA 5CLSA 1FSHA 3JAMK 2ZXJA 4HDUA 1ONVA 4U7DA 2JTVA 4YFNF 5L3EA 2LF7A 3TGNA 2ZJ2A 5D4RA 3C18A 3RKYA 4AIKA 2DI3A 2YX4A 4ZYGA 4G7HF 3W6KB 3L2CA 1BIAA 1MKMA 4HQEA 3V7RA 2CO5A 3R0JA 3SHFA 3WG9A 4A5NA 2M30A 2Y48A 3B73A 3WE2A 1LNWA 1GVJA 3MCZA 4UVCA 4OOIA 1R1VA 5E1ZB 1C0WA 2F5FA 3EUHA 1KU2A 4FX4A 3LWFA 4HA8A 1I1GA 1FYMA 1Z1DA 1PP8F 3V7SA 5H6QA 3ISPA 1SAXA 2VOPA 2C6YA 3QOPA 2QQAA 4I09A 4ENNA 4L0YB 2X0LA 2VT2A 2GIVA 3E6CC 2Y0MA 2FMYA 5J6XA 5DD4A 1KGSA 1H0MA 3ABTA 3QPHA 5HOOA 4EJTA 1YS7A 4KIBA 1S7OA 1B9NA 1FSEA 2H09A 2VBYA 4M6XA 1BIBA 4RGRA 3K1MA 1U5TB 3ECHA 1FBQA 4A0YA 4A6DA 1WRJA 4HZFA 1LQ1A 3JSOA 1FZPB 3HRUA 5BS6A 3WTSC 2V1UA 1ZAOA 4OIRF 1E17A 5TRDA 5HS9A 4L5IA 2IT0A 4DQ2A 3IC7A 3ABUA 2RKHA 1U8RA 3K1NA 4UXNA 1ZRFA 4QWQA 1IN6A 2V1XA 4EVIA 2FNAA 5JVTA 4IRHA 1XGOA 4UVBA 1PDNC 2HKXA 2ISYA 4RB0A 4EMSA 5HDGA 3REOA 2Z5UA 4D0PA 4ENMA 4O5VA 1BOAA 3BPVA 4ZZDA 4ENKA 5DCMB 1JXSA 4LG0B 3WTYC 3ZN0A 1FBUA 5FD6A 1B1BA 3IWFA 5LGTA 1ZLKA 5D6EA 4KYWA 2CWEA 1ZN2A 2NYXA 4Q4ZF 2WC2A 1G3TA 5K5QA 4XRFA 1ZRDA 4GXOA 3I0TA 4UVAA 2AS5F 3KP2A 1MD0A 1R7JA 4KUMA 1HXDA 1XGNA 1ZG3A 2CG4A 1X3UA 4G8XA 2PMHA 2RV8A 3I5UA 5CVVA 2Q8KA 2FA5A 4HOBA 2A68F 1XD7A 2DU9A 1HW5A 3RDIA 2GWRA 3JSPA 4AIJA 3I54A 2M8EA 2O8XA 4M71A 3FM3A 4M74A 4RB3C 2BE5F 3HOSA 3HRMA 4RGSA 4ON0A 3Q5FA 3SZPA 1FC3A 4JBAA 1V4RA 3I59A 1BJAA 1O7LA 5TJJA 4KDPA 4IJAA 1H9TA 2Q0OA 1IW7F 3DV8A 4U88A 2IP2A 5CVRA 3RPQA 1CF7B 3MEXA 2X4HA 1F1ZA 5D5VB 2GQQA 1T39A 2FQ3A 4G6QA 1EH7A 3KP5A 3DP7A 1T2KA 3KETA 4MQ9F 1K7AA 2FXAA 4L5JA 3WGIA 3WTTC 2G7HA 3MFKA 3KP6A 4Z2YA 3T8RA 4M6YA 1Q1HA 1TW3A 2FBIA 2YSRA 1R5HA 4Q47A 1IN5A 2DK8A 4AIHA 3NEUA 3BDDA 1FT9A 1HSTA 2O3FA 3ZMUA 1ON2A 2JSCA 3Q9SA 5A2QK 1O3QA 2HR3A 1LDKB 3CUOA 4CYDA 1SFEA 4CICA 4RB2C 4RGXA 2PFBA 2VT3A 4NB5A 4NQWA 4YFKF 2A6EF 3CO7C 2IA0A 2A07F 3HTSB 3WTUC 1G6NA 4B8XA 5ILSA 2MD5A 4EJVA 2EFOA 1XB4A 4BHCA 4N0BA 3MWMA 1RUOA 3WGGA 3FF5A 2UZKA 2R3SA 3KCCA 3RI4A 4HF2A 2Z9OA 2QENA 2D1HA 2EA2A 2FBKA 3FMQA 2OBPA 3NQOA 2STTA 3V4GA 3V7CA 2XKPA 1L3LA 1CGPA 4A5MA 2FOKA 5D5XB 1BC7C 2OU2A 5D4SA 2P5VA 4KIFA 5FFXA 1KYZA 2QBYB 5FLXZ 3K0LA 2P7CB 3GEZA 3F6OA 3M8FA 4KFCA 2JT1A 1S3JA 1QPMA 2CQKA 2ACJA 3LAJA 2G7UA 4MNUA 4BHPA 2UXNA 1J2XA 2M5WA 1XSDA 3ZQ7A 2M87A 3QU3A 1SD6A 1YG2A 3WGHA 2MH2A 3O6BB 2F5CA 3FWEA 1IN4A 5ED4A 3EDPA 4KT5C 2V1DA 4GGGA 3H3UA 3J80K 3DQVC 1JHFA 3R0AA 4WXCA 3FMSA 4U0VA 3LA3A 3C3WA 3I4PA 4S04A 2P6SA 2RC4A 3RKXA 2FMLA 1KYWA 3KE2A 1IXSB 3HSRA 4CDGA 1LEBA 2FEZA 2HTJA 2H27A 1T38A 1O3SA 1XCBA 4HLYA 3LAPA 1QQIA 5ICFA 4AWXB 4O3MA 1DP7P 1FX7A 2B0LA 1MJAA 2JZYA 1KU3A 4A0XA 3F21A 5J8FA 3BPXA 2EK5A 1S6LA 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFW A;  1BN5 A;  5CYV A;  1XGM A;  5L3C A;  2F5E A;  5E18 F;  1XN7 A;  3SQN A;  3DXJ F;  3ZMD A;  5LEJ A;  1ZRC A;  1U78 A;  2RN7 A;  4HF1 A;  4P9U A;  3LA2 A;  5BPI A;  3MAJ A;  2Z99 A;  1P4X A;  2XAJ A;  2H94 A;  2RVC A;  3QPT A;  4CZZ A;  2EFP A;  4WWC A;  4ESB A;  3DF8 A;  2Q2E A;  3DKW A;  1BM9 A;  4WCG A;  2D1V A;  1USS A;  3W6J B;  2MH9 A;  5ICG A;  1P4W A;  3L09 A;  1TW2 A;  3FM5 A;  1FYK A;  2EA4 A;  2STW A;  1ZYR F;  3U1D A;  4I0B A;  3TDZ C;  5D6F A;  2ZKZ A;  3EYY A;  3P7N A;  3E5X A;  1FBS A;  5LLQ A;  2XV4 S;  2HWV A;  4FT8 A;  1R58 A;  2EFQ A;  1I27 A;  2P5K A;  2LSO A;  3GF2 A;  2HYF A;  3R61 A;  1KQ0 A;  2UWM A;  2DBB A;  2QWW A;  3FMR A;  4P9F A;  4ZYH A;  3F8N A;  1UCR A;  3K9T A;  1K78 A;  1HKS A;  3VOE A;  1ZGA A;  3FZV A;  1TQI A;  5D8L B;  2VE8 A;  1DDN A;  3RKW A;  4PGH A;  1VTN C;  1TNT A;  1YO5 C;  5EEH A;  4KMU X;  3I53 A;  1AWC A;  3QAH A;  1FWZ A;  4PZJ A;  1P4A A;  1PP7 U;  1GXQ A;  3IRR A;  4ZZL A;  4OIN F;  2GXB A;  2J5O A;  3FXQ A;  4HV6 A;  1BBY A;  4IHS A;  3MZY A;  2DK5 A;  1P2F A;  1JE8 A;  4S05 A;  2KIU A;  3GLX A;  3TOA A;  2R7F A;  1HBX G;  4MQV A;  2G9W A;  3V8K A;  3DFG A;  2P4W A;  3TOB A;  5BOX A;  1IRG A;  4LLL A;  1K6O A;  3DPT A;  5JFR A;  3I59 B;  4ZYE A;  1KU7 A;  2GA1 A;  1MZB A;  4N9I A;  1R36 A;  5F1R A;  3BP8 A;  3KLN A;  3CJN A;  1W5S A;  1IUY A;  1I1S A;  3K2Z A;  4QLC U;  1IXC A;  2ESN A;  1WSU A;  1RNL A;  3FX3 A;  4I0A A;  5HVQ C;  3IWZ A;  2EWN A;  3DPL C;  2E1C A;  4MEY F;  1YW8 A;  4AVP A;  3COA C;  4UHT A;  4OMY A;  2LKP A;  1SFU A;  2DO7 A;  2ZME A;  3TO7 A;  1ODD A;  2ZCW A;  1T6S A;  4R79 A;  5F6F A;  2TDX A;  4WK8 F;  3E5Q A;  4LLN A;  3P9C A;  4KN4 X;  5E8G A;  3HOT A;  3CUQ A;  3KLO A;  1L0O C;  2GXG A;  1FYL A;  3MQ0 A;  4EQQ A;  4ZH4 F;  2JPB A;  2EV6 A;  1XSV A;  4WF2 A;  1XDS A;  2FE3 A;  1U3E M;  3F6V A;  4RAY A;  1WKM A;  1IAW A;  3HHG A;  2IPQ X;  2LNB A;  4IRG A;  4BNC A;  5HDK A;  1GXP A;  5FFZ A;  3BZ6 A;  2VOO A;  5HLI A;  2VN2 A;  2ISZ A;  1ZG5 A;  1P92 A;  2QZ8 A;  1IXR C;  1HSJ A;  3WU0 A;  2DT5 A;  5J8C A;  3TKY A;  2HYG D;  3V8L A;  4N9H A;  3HSE A;  3U9G A;  5L3B A;  4HAM A;  3GX4 X;  5LRR A;  6PAX A;  2K02 A;  2RQP A;  2O61 A;  5DEQ A;  2RNJ A;  3O3K A;  1QO0 D;  3CTA A;  2EV5 A;  5CVU A;  4P5O A;  1WWX A;  3BOQ A;  4CXF A;  4WXD A;  5DD8 A;  2L3D A;  1NHA A;  1XGS A;  4R1H A;  4HX4 A;  2W24 A;  4LK0 F;  1D8K A;  4ESF A;  3V8J A;  1LDD A;  4HBL A;  2HKO A;  3WTW C;  2F5D A;  1B59 A;  4AD9 A;  5ICC A;  3GW2 A;  2PN6 A;  3F8F A;  3IRQ A;  1TQM A;  1IN8 A;  2GAU A;  2IA1 A;  1UST A;  2MBF A;  3PQJ A;  1MDM A;  5E1X A;  3WE3 A;  1HW1 A;  2HEO A;  3IKT A;  4EJW A;  1U5T C;  3F23 A;  4BYY A;  1LJ9 A;  1OYW A;  4EGZ A;  3HRS A;  1MJ9 A;  5AIP A;  5BPD A;  1R23 A;  3K69 A;  4H0E A;  2NRA C;  4B09 A;  3M1E A;  4DNC A;  1Z05 A;  3R6S A;  4A0Z A;  4Y15 A;  3OOP A;  1RIO H;  4IRI A;  4E70 A;  2NNN A;  5K5O A;  2VXZ A;  3D5L A;  4LFU A;  2CFX A;  5IT3 A;  5LGU A;  2ZBK A;  3GYH X;  2DLL A;  1SMY F;  4L0Z B;  2VBX A;  2PMU A;  2ZO4 A;  1Z6T A;  2VBW A;  1A04 A;  2PEX A;  3ML6 A;  2E7X A;  5IT9 Z;  5FLX K;  2D2W A;  4IPA A;  4A6E A;  1Z6R A;  4Y13 A;  4I98 B;  2LF8 A;  4M73 A;  3ZN1 A;  3KEO A;  2W84 A;  2V79 A;  1BC8 C;  2YU3 A;  3WOD F;  2DQR A;  2DTR A;  4LB6 B;  4OIO F;  2Y75 A;  3HRT A;  5LHG A;  1YFH A;  3I58 A;  1OR7 A;  4EM1 A;  1BI3 A;  2QLZ A;  1TNS A;  3KZZ A;  2HQR A;  2K27 A;  2O6G E;  2YPR A;  2HGC A;  3L00 A;  1S8N A;  5JR3 A;  5HS8 A;  3H3Z A;  1BI2 A;  3BRO A;  3J81 Z;  2NAZ A;  2XAG A;  2BBY A;  2IA2 A;  4ENJ A;  2A69 F;  1G4D A;  3E3V A;  2K4J A;  5LHH A;  4M9Z A;  5JHU A;  3E6B A;  3IKV A;  2XAS A;  2VE9 A;  4JK1 X;  1UHW A;  1UHM A;  2WWY A;  3J7A O;  1I6X A;  3R60 A;  1WQ2 A;  3KP4 A;  3PQK A;  5HLG A;  3U2R A;  1H9G A;  4HW0 A;  1K78 B;  1XMA A;  3DEU A;  1TBX A;  1ON1 A;  4XBF A;  1SD7 A;  1Z7U A;  2L4M A;  3HHH A;  4PDK A;  4HX7 A;  2K4B A;  1YTY A;  4GO1 A;  4UNO A;  2ETH A;  3G73 A;  3EYI A;  1R00 A;  3KEQ A;  4HQM A;  5AIQ A;  1REP C;  5FO5 A;  3MZH A;  3H92 A;  1YIO A;  2Z33 A;  3RJP A;  3VEP A;  3C7J A;  4PGG A;  3PFI A;  3TQN A;  3CLO A;  1G3Y A;  1EH8 A;  3QP5 A;  4M9S A;  2HDC A;  5DDG A;  1AOY A;  2QUF A;  2RDP A;  1U6G A;  2E1N A;  3GXO A;  3BJO A;  3O2P E;  2H6C A;  5HS7 A;  2EJR A;  5E1W A;  3TO9 A;  3T8T A;  1IN7 A;  4EGY A;  5D5W B;  3ZMT A;  3RYP A;  1W7P A;  3F8M A;  1FNN A;  1KQ9 A;  5H6R A;  2CW0 F;  1QZZ A;  2OQG A;  3GFL A;  4G94 A;  3Q9V A;  1T98 A;  1QBJ A;  1SD5 A;  2VON A;  2CSO A;  1UB9 A;  2HTS A;  1IZ1 A;  1ZHF A;  2ZME B;  1O7F A;  2QVO A;  5KK1 A;  2O03 A;  5L3G A;  2A5Y B;  3L7W A;  1UFM A;  1QNT A;  4G7Z F;  3GUD A;  1FP1 D;  4OIQ F;  4OIP F;  4ZYD A;  4RB1 A;  3CUQ B;  2VBZ A;  3T0Y A;  2W57 A;  3KP3 A;  2AXL A;  2P7V B;  2VOD A;  1Z91 A;  2KIM A;  1O57 A;  1XSX A;  5E20 A;  4HV5 A;  2ZNZ A;  4KMF A;  3RYR A;  4I01 A;  3R4K A;  4LJZ F;  1K79 A;  3QP6 A;  1S7A A;  4GYG A;  1KQ8 A;  2KJB A;  1YW9 A;  2HQN A;  2XRO A;  2WTE A;  2E7W A;  1ZG1 A;  1OPC A;  2CGP A;  5FD5 A;  4LLG F;  1TQP A;  2ADU A;  4RAZ A;  3QRF F;  1J59 A;  4LB5 A;  2BYV E;  4XLP F;  4FX0 A;  1FY7 A;  4HYE A;  5DCF A;  3BWG A;  4IXA A;  2MC3 A;  3F8B A;  3LST A;  5LRS A;  1J7K A;  4WX9 A;  4G9Y A;  4A12 A;  3E6D A;  2XHK A;  3IL2 A;  1V3F A;  1LVA A;  4ETS A;  2K7L A;  2R7D A;  1TLH B;  2CYY A;  4MTE A;  1ZAR A;  3TDU C;  2VC1 A;  3JAM Z;  4HX8 A;  1ZLJ A;  2XAF A;  2D45 A;  2EV0 A;  3VOD A;  2PI0 A;  1DPU A;  3SFZ A;  3RTR A;  3HTU A;  4ASN A;  5JI6 A;  2FNP A;  1KA8 A;  2W25 A;  4JQF A;  4L9T A;  1U2W A;  2EFN A;  2EFW A;  3RPU A;  3F3X A;  2IVM A;  4I2O A;  1MDM B;  1DUX C;  4BAY A;  1F9N A;  5DV5 A;  2WV0 A;  2HS5 A;  1J5Y A;  4U0W A;  1R22 A;  1J75 A;  4M72 A;  4BXU A;  1RI7 A;  4O6J A;  1O3T A;  2P6T A;  3M9A A;  2BEO A;  4EJO A;  5LBQ A;  3N4M A;  2ELH A;  4L9V A;  4BHB A;  4IVN A;  3HIF A;  4K2E A;  3CUQ C;  2MA3 A;  5LGN A;  4IF4 A;  1YQA A;  3ERE D;  2DPU A;  4TV7 A;  1G3W A;  1G3S A;  3VB2 A;  5LEK A;  3GO5 A;  2COM A;  2FF4 A;  2V9V A;  2VC0 A;  2FRH A;  5LHI A;  2OQR A;  2MLG A;  1W4M A;  3LQQ A;  4U7B A;  1OKR A;  3HUG A;  2A3S A;  2PG4 A;  4RGU A;  3WTV C;  2JPC A;  4GCV A;  3HYI A;  4CO8 A;  1SFX A;  3GZ6 A;  4A2U A;  2HZT A;  4R8H A;  1ZH5 A;  3B02 A;  2L54 A;  2GZW A;  1OMI A;  3M7G A;  3KZY A;  1LB2 A;  1BI0 A;  4LGW A;  5DYM A;  3ULQ B;  3GFM A;  3KFW X;  3CO6 C;  1IF1 A;  5D8K B;  2M1B A;  1E2X A;  2DAO A;  3GVA A;  4BQA A;  4CHU A;  1OYI A;  4OU0 A;  5EEG A;  1SMT A;  1IRF A;  4FHT A;  4MHG A;  2OA4 A;  3ZPL A;  1Z9C A;  1WI9 A;  5FGM A;  1ULY A;  3BJ6 A;  3AAF A;  3GFJ A;  3IHU A;  3L9F A;  4HF0 A;  1RUN A;  1J0R A;  4LK1 F;  4EV0 A;  5HLH A;  2XAH A;  5ERI A;  2L01 A;  1S29 A;  3ZMZ A;  2P5L C;  5IT9 K;  3F22 A;  3NRV A;  4EJU A;  4KIC A;  2IW5 A;  5DUK A;  1BI1 A;  5FB2 A;  1U5T A;  2H6B A;  2HFH A;  2KJC A;  4OMZ A;  1RZ4 A;  4KNY A;  3LFK A;  3S2W A;  1OYY A;  4Q5S F;  2KRF A;  2J5P A;  2L02 A;  3P9K A;  5ICE A;  5ILU A;  1W7P D;  1JGS A;  4XSZ F;  1W5T A;  1ZGJ A;  3LQR A;  1D5V A;  2OAZ A;  1R1T A;  2PQ8 A;  5AON A;  2DQL A;  4PCQ A;  5CJ9 A;  5K5R A;  4XSX F;  4HDV A;  2RGV A;  2XKO A;  5F64 A;  3ZMV A;  3EQL F;  2DPD A;  2XIG A;  3RIR A;  3J81 K;  1XMK A;  2KIF A;  1EV7 A;  2YR2 A;  2FBH A;  3WTZ A;  1JHH A;  1HKT A;  3M8E A;  4RS8 A;  4Y17 A;  2ZNY A;  3VFZ A;  3ZMS A;  2ESH A;  4XLN F;  3WU1 B;  3JTH A;  4EM0 B;  2QQB A;  2LDU A;  3GZ5 A;  3C1D A;  1HW2 A;  2DW4 A;  5DCM A;  4LG0 A;  3QU6 A;  4MEX F;  2OZ6 A;  1YYV A;  1W7P B;  1R1U A;  3SXY A;  3ROU A;  4UUV A;  1FP2 A;  2YX7 A;  1J9I A;  2XAQ A;  2BV6 A;  2QYO A;  1MGT A;  4LD5 A;  1R5G A;  2IRF G;  1YS6 A;  3ECO A;  3GFI A;  1HKQ A;  4YFX F;  1T0F A;  1GHC A;  4G7O F;  4P55 A;  5A2Q Z;  3ELK A;  1STZ A;  3SZT A;  3E97 A;  4NHJ A;  5D5U B;  2L4A A;  1SD4 A;  3LA7 A;  2XUB A;  2V6C A;  2GA2 A;  4MTD A;  2UXX A;  3JW4 A;  4YIF A;  3D0S A;  5L3F A;  1F5T A;  2EB7 A;  4YG2 F;  3BJA A;  1EH6 A;  4MGR A;  1DPR A;  2XRN A;  4I02 A;  2M45 A;  1QZY A;  4CGZ A;  5K1Y A;  2FSW A;  4I7H A;  1YLF A;  3T5X A;  5BMZ A;  1F4K A;  3GWZ A;  2P8T A;  2QM3 A;  4WXH A;  2MLK A;  1XCV A;  2K86 A;  2QQ9 A;  1CF7 A;  1QGP A;  1HQC A;  5H20 A;  5BQT A;  3G3Z A;  5L3D A;  2Z3Y A;  1FPQ A;  4KN7 X;  3EET A;  1FLI A;  3F8C A;  2PJP A;  3T1B A;  4L18 B;  3WTX C;  4G6D A;  5CVI A;  2JRT A;  2FU4 A;  1Y0U A;  5DUI A;  1LDJ A;  3KP7 A;  5ILV A;  3FXU A;  5E17 F;  1MJB A;  1B6A A;  2A6H F;  4EM2 A;  1LEA A;  2NNY A;  1D3Y A;  1KU9 A;  3TO6 A;  1B9M A;  3HSF A;  4F7Z A;  1FOK A;  2KKO A;  2OD5 A;  1XDU A;  5E8I A;  4P96 A;  3J80 Z;  3FXR A;  3E6M A;  5CVJ A;  2XVC A;  1ZRE A;  1D8J A;  3I71 A;  2OZU A;  4BH9 A;  4Q48 A;  3BY6 A;  4YII A;  3JTG A;  1O3R A;  2A61 A;  2XGX A;  1P6R A;  4L9J A;  3K1P A;  4ESJ A;  3I64 A;  4UV8 A;  5HDN A;  3P9I A;  2HOE A;  3E5U A;  2O0Y A;  4KA4 A;  4L9N A;  3CDH A;  5KVR A;  1TTY A;  2BGC A;  4GYI A;  2F2E A;  2NS0 A;  4KIG A;  1B4A A;  4HLX A;  4LMY A;  1I5Z A;  4M9X A;  2DFI A;  3OV8 A;  2IJL A;  2PBI A;  4UV9 A;  2W85 A;  4IHT A;  3N97 A;  2QBY A;  3F72 A;  3FHZ A;  1PUE E;  3ZP5 A;  4U0Y A;  2PLY A;  5CLS A;  1FSH A;  3JAM K;  2ZXJ A;  4HDU A;  1ONV A;  4U7D A;  2JTV A;  4YFN F;  5L3E A;  2LF7 A;  3TGN A;  2ZJ2 A;  5D4R A;  3C18 A;  3RKY A;  4AIK A;  2DI3 A;  2YX4 A;  4ZYG A;  4G7H F;  3W6K B;  3L2C A;  1BIA A;  1MKM A;  4HQE A;  3V7R A;  2CO5 A;  3R0J A;  3SHF A;  3WG9 A;  4A5N A;  2M30 A;  2Y48 A;  3B73 A;  3WE2 A;  1LNW A;  1GVJ A;  3MCZ A;  4UVC A;  4OOI A;  1R1V A;  5E1Z B;  1C0W A;  2F5F A;  3EUH A;  1KU2 A;  4FX4 A;  3LWF A;  4HA8 A;  1I1G A;  1FYM A;  1Z1D A;  1PP8 F;  3V7S A;  5H6Q A;  3ISP A;  1SAX A;  2VOP A;  2C6Y A;  3QOP A;  2QQA A;  4I09 A;  4ENN A;  4L0Y B;  2X0L A;  2VT2 A;  2GIV A;  3E6C C;  2Y0M A;  2FMY A;  5J6X A;  5DD4 A;  1KGS A;  1H0M A;  3ABT A;  3QPH A;  5HOO A;  4EJT A;  1YS7 A;  4KIB A;  1S7O A;  1B9N A;  1FSE A;  2H09 A;  2VBY A;  4M6X A;  1BIB A;  4RGR A;  3K1M A;  1U5T B;  3ECH A;  1FBQ A;  4A0Y A;  4A6D A;  1WRJ A;  4HZF A;  1LQ1 A;  3JSO A;  1FZP B;  3HRU A;  5BS6 A;  3WTS C;  2V1U A;  1ZAO A;  4OIR F;  1E17 A;  5TRD A;  5HS9 A;  4L5I A;  2IT0 A;  4DQ2 A;  3IC7 A;  3ABU A;  2RKH A;  1U8R A;  3K1N A;  4UXN A;  1ZRF A;  4QWQ A;  1IN6 A;  2V1X A;  4EVI A;  2FNA A;  5JVT A;  4IRH A;  1XGO A;  4UVB A;  1PDN C;  2HKX A;  2ISY A;  4RB0 A;  4EMS A;  5HDG A;  3REO A;  2Z5U A;  4D0P A;  4ENM A;  4O5V A;  1BOA A;  3BPV A;  4ZZD A;  4ENK A;  5DCM B;  1JXS A;  4LG0 B;  3WTY C;  3ZN0 A;  1FBU A;  5FD6 A;  1B1B A;  3IWF A;  5LGT A;  1ZLK A;  5D6E A;  4KYW A;  2CWE A;  1ZN2 A;  2NYX A;  4Q4Z F;  2WC2 A;  1G3T A;  5K5Q A;  4XRF A;  1ZRD A;  4GXO A;  3I0T A;  4UVA A;  2AS5 F;  3KP2 A;  1MD0 A;  1R7J A;  4KUM A;  1HXD A;  1XGN A;  1ZG3 A;  2CG4 A;  1X3U A;  4G8X A;  2PMH A;  2RV8 A;  3I5U A;  5CVV A;  2Q8K A;  2FA5 A;  4HOB A;  2A68 F;  1XD7 A;  2DU9 A;  1HW5 A;  3RDI A;  2GWR A;  3JSP A;  4AIJ A;  3I54 A;  2M8E A;  2O8X A;  4M71 A;  3FM3 A;  4M74 A;  4RB3 C;  2BE5 F;  3HOS A;  3HRM A;  4RGS A;  4ON0 A;  3Q5F A;  3SZP A;  1FC3 A;  4JBA A;  1V4R A;  3I59 A;  1BJA A;  1O7L A;  5TJJ A;  4KDP A;  4IJA A;  1H9T A;  2Q0O A;  1IW7 F;  3DV8 A;  4U88 A;  2IP2 A;  5CVR A;  3RPQ A;  1CF7 B;  3MEX A;  2X4H A;  1F1Z A;  5D5V B;  2GQQ A;  1T39 A;  2FQ3 A;  4G6Q A;  1EH7 A;  3KP5 A;  3DP7 A;  1T2K A;  3KET A;  4MQ9 F;  1K7A A;  2FXA A;  4L5J A;  3WGI A;  3WTT C;  2G7H A;  3MFK A;  3KP6 A;  4Z2Y A;  3T8R A;  4M6Y A;  1Q1H A;  1TW3 A;  2FBI A;  2YSR A;  1R5H A;  4Q47 A;  1IN5 A;  2DK8 A;  4AIH A;  3NEU A;  3BDD A;  1FT9 A;  1HST A;  2O3F A;  3ZMU A;  1ON2 A;  2JSC A;  3Q9S A;  5A2Q K;  1O3Q A;  2HR3 A;  1LDK B;  3CUO A;  4CYD A;  1SFE A;  4CIC A;  4RB2 C;  4RGX A;  2PFB A;  2VT3 A;  4NB5 A;  4NQW A;  4YFK F;  2A6E F;  3CO7 C;  2IA0 A;  2A07 F;  3HTS B;  3WTU C;  1G6N A;  4B8X A;  5ILS A;  2MD5 A;  4EJV A;  2EFO A;  1XB4 A;  4BHC A;  4N0B A;  3MWM A;  1RUO A;  3WGG A;  3FF5 A;  2UZK A;  2R3S A;  3KCC A;  3RI4 A;  4HF2 A;  2Z9O A;  2QEN A;  2D1H A;  2EA2 A;  2FBK A;  3FMQ A;  2OBP A;  3NQO A;  2STT A;  3V4G A;  3V7C A;  2XKP A;  1L3L A;  1CGP A;  4A5M A;  2FOK A;  5D5X B;  1BC7 C;  2OU2 A;  5D4S A;  2P5V A;  4KIF A;  5FFX A;  1KYZ A;  2QBY B;  5FLX Z;  3K0L A;  2P7C B;  3GEZ A;  3F6O A;  3M8F A;  4KFC A;  2JT1 A;  1S3J A;  1QPM A;  2CQK A;  2ACJ A;  3LAJ A;  2G7U A;  4MNU A;  4BHP A;  2UXN A;  1J2X A;  2M5W A;  1XSD A;  3ZQ7 A;  2M87 A;  3QU3 A;  1SD6 A;  1YG2 A;  3WGH A;  2MH2 A;  3O6B B;  2F5C A;  3FWE A;  1IN4 A;  5ED4 A;  3EDP A;  4KT5 C;  2V1D A;  4GGG A;  3H3U A;  3J80 K;  3DQV C;  1JHF A;  3R0A A;  4WXC A;  3FMS A;  4U0V A;  3LA3 A;  3C3W A;  3I4P A;  4S04 A;  2P6S A;  2RC4 A;  3RKX A;  2FML A;  1KYW A;  3KE2 A;  1IXS B;  3HSR A;  4CDG A;  1LEB A;  2FEZ A;  2HTJ A;  2H27 A;  1T38 A;  1O3S A;  1XCB A;  4HLY A;  3LAP A;  1QQI A;  5ICF A;  4AWX B;  4O3M A;  1DP7 P;  1FX7 A;  2B0L A;  1MJA A;  2JZY A;  1KU3 A;  4A0X A;  3F21 A;  5J8F A;  3BPX A;  2EK5 A;  1S6L A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 2ZFW A;  9ANT A;  1BN5 A;  5CYV A;  1Z77 A;  1XGM A;  2DCE A;  3W2A A;  5L3C A;  2F5E A;  5E18 F;  4HSR A;  4KIS A;  1ETK A;  1XN7 A;  3SQN A;  3DXJ F;  3DWL E;  3ZMD A;  5LEJ A;  4B3X A;  2BY1 A;  1ZRC A;  2QSH X;  1A5J A;  1U78 A;  2RN7 A;  4HF1 A;  4P9U A;  3LA2 A;  2X6Y A;  5BPI A;  1X2M A;  3K4J A;  5FLM J;  4NUB A;  4XOT A;  2EQR A;  1T56 A;  1WFX A;  3MAJ A;  2Z99 A;  5E3N A;  1P4X A;  2MSY A;  3B6A A;  2XAJ A;  2H94 A;  1EA3 A;  2MFZ A;  2RVC A;  3QPT A;  3H5N A;  4CZZ A;  3HM5 A;  1HLV A;  2EFP A;  4WWC A;  4ESB A;  3DF8 A;  3MKW B;  2Q2E A;  3DKW A;  1BM9 A;  1PYV A;  2O7O A;  3SZG A;  4WCG A;  3V42 A;  2D1V A;  2LBF A;  4B4C A;  2CQQ A;  2XF7 A;  1USS A;  3W6J B;  2MH9 A;  5B1B H;  5ICG A;  1JKR C;  3HOX J;  2EZH A;  2JA8 J;  3BTJ A;  1P4W A;  1NG6 A;  2DMP A;  4XIC A;  5HNF A;  1W1W E;  3L09 A;  1TW2 A;  3FM5 A;  1JKQ C;  1FYK A;  3PJR A;  2EA4 A;  1XG1 A;  1ITY A;  3I4N J;  2ZB9 A;  2DN0 A;  2STW A;  2Y9Z A;  5FKL A;  1ZYR F;  3U1D A;  4HNT A;  2XGE A;  4I0B A;  3TDZ C;  4D7M A;  5D6F A;  1BL0 A;  2ZKZ A;  3EYY A;  3P7N A;  2Y9Y A;  3K4N A;  4BQQ A;  3W3C A;  2IS2 A;  4AID A;  3E5X A;  1FBS A;  3GTJ J;  1KZH A;  5LLQ A;  3HPG A;  3O8G A;  4MLO A;  3CME I;  4XNF A;  2XV4 S;  2HWV A;  3K4L A;  4FT8 A;  2E1O A;  1UAA A;  1R58 A;  2EFQ A;  2IS4 A;  3VSL A;  1I27 A;  2P5K A;  2LSO A;  4BGD A;  4J19 A;  3GF2 A;  1S72 I;  2HYF A;  5JVG F;  4FTH A;  3R61 A;  1KQ0 A;  3G4S I;  2EPF A;  5J47 A;  4IKF A;  1EKE A;  1OIS A;  4FQG A;  4AYB N;  3BCA A;  2DBB A;  2QWW A;  4DGW B;  4BQO A;  2UWM A;  2ID6 A;  3FMR A;  1GDT A;  4P9F A;  4CUG A;  4ZYH A;  3F8N A;  1UCR A;  1PUF A;  3K9T A;  1K78 A;  1HKS A;  2NS7 A;  3S8P A;  2DOD A;  3VOE A;  1ZGA A;  3FZV A;  1TQI A;  5D8L B;  2VE8 A;  1MSF C;  4CH7 A;  1DDN A;  3DTE A;  2VAS A;  3RKW A;  4PGH A;  4CCO A;  5GAE J;  2EIK H;  3G6E I;  2ZXW H;  1VTN C;  1TNT A;  3H9Q A;  1YO5 C;  5EEH A;  4KMU X;  4PJL A;  3I53 A;  1AWC A;  1MMG A;  3NAR A;  3QAH A;  2RAE A;  1FWZ A;  4G12 A;  4PZJ A;  3S1N J;  1P4A A;  1PP7 U;  3H1C A;  1GXQ A;  3IRR A;  5C3E J;  2VQC A;  3H9G A;  3SYT A;  4A3I J;  4ZZL A;  4OIN F;  2LVS A;  3CZ6 A;  5B5E C;  4OWR B;  1FMW A;  4M3D A;  2GXB A;  2J5O A;  3FXQ A;  4HV6 A;  4MFE A;  3K6G A;  3BC8 A;  1SFK A;  1MMS A;  1BBY A;  4IHS A;  3MZY A;  2DK5 A;  1DGR M;  1P2F A;  1JE8 A;  4S05 A;  2KIU A;  3GLX A;  3VYT B;  3TOA A;  4A3G J;  2R7F A;  1FOX A;  1HBX G;  1VZ0 A;  4MQV A;  1D0Y A;  1IC8 A;  2E71 A;  2G9W A;  3V8K A;  4XRS A;  4BY1 J;  1K83 J;  3DFG A;  1S7E A;  2P4W A;  1K4S A;  4XK4 A;  3TOB A;  3HOU J;  5BOX A;  1IRG A;  3ZRG A;  1JJ6 C;  2E1M C;  2XRL A;  4LLL A;  4V2F A;  3ABM H;  2CUZ A;  1K6O A;  3DPT A;  5EEA A;  5JFR A;  3I59 B;  4YIR X;  4ZYE A;  1KU7 A;  2GA1 A;  2RQQ A;  2JVH A;  4II2 A;  1MZB A;  2H1L A;  4N9I A;  3IAS 2;  3PFY A;  2ID3 A;  1R36 A;  1SVL A;  3L2V A;  2Y31 A;  5F1R A;  3BP8 A;  3KLN A;  3CJN A;  3JRD A;  1W5S A;  1IUY A;  1I1S A;  4BBR J;  1WH5 A;  2OC6 A;  3K2Z A;  4QLC U;  3S14 J;  1IXC A;  2ESN A;  1WSU A;  1T95 A;  1RNL A;  1V5F A;  2Q1Z B;  3FX3 A;  3KX2 A;  1XS9 A;  4I0A A;  3QYE A;  5HVQ C;  3WHC A;  1YX5 A;  1U9N A;  3IWZ A;  2EWN A;  3DPL C;  4OAY A;  1MND A;  4MEY F;  2E1C A;  1YW8 A;  3JRC A;  4AVP A;  3COA C;  3SFI A;  4UHT A;  2W1O A;  4IHV A;  1U8B A;  1UHS A;  4OMY A;  2MAB A;  2LKP A;  1SFU A;  2DO7 A;  2ZME A;  4NBQ A;  1VQ4 I;  1B8I A;  2KL4 A;  3TO7 A;  1ODD A;  2ZCW A;  3JRG A;  2W4S A;  1T6S A;  4R79 A;  1JGG A;  5F6F A;  4IOC F;  4PK4 A;  2TDX A;  1E3P A;  4WK8 F;  4IZZ A;  3E5Q A;  4LLN A;  2L9N A;  1MMN A;  2I5U A;  3P9C A;  4KN4 X;  4U87 A;  2VKH A;  5E8G A;  3BCB A;  3HOT A;  1X1B A;  3CUQ A;  3K2A A;  3KLO A;  1L0O C;  2GXG A;  1FYL A;  5F1J A;  3MQ0 A;  4EQQ A;  2X6O A;  4ZH4 F;  2JPB A;  2EV6 A;  1XSV A;  5F0H A;  4WF2 A;  3EPZ A;  5EF6 A;  1XDS A;  2FE3 A;  2IS6 A;  1P9Q C;  2N8G A;  5F08 A;  4NQW B;  1U3E M;  3F6V A;  4RAY A;  1WKM A;  2DA5 A;  2JQ7 A;  3KYD B;  5F27 A;  3QOE A;  1IAW A;  5B3S H;  3HHG A;  1RR8 C;  2LY9 A;  2IPQ X;  4C3I J;  3TED A;  2LNB A;  2BY0 A;  4IRG A;  4BS9 A;  2IXS A;  1OJL A;  4BNC A;  5HDK A;  2EIJ H;  2HQ5 A;  3M1C A;  2IGO A;  2NOJ B;  1GXP A;  5FFZ A;  3BZ6 A;  2VOO A;  2WA0 A;  4DZJ A;  5HLI A;  2VN2 A;  2ISZ A;  3CES A;  3D5S C;  1ZG5 A;  1I50 J;  1P92 A;  1Z21 A;  4XON A;  1BR1 A;  2QZ8 A;  1IXR C;  1HSJ A;  2LRD A;  3FXJ A;  3WU0 A;  3CP2 A;  2X9D A;  2LMD A;  2DT5 A;  2VQG A;  5J8C A;  3TKY A;  4OAZ A;  1AA7 A;  2HYG D;  2ME6 A;  1NTC A;  5DS9 A;  3V8L A;  4N9H A;  3HSE A;  3U9G A;  5L3B A;  4HAM A;  3GX4 X;  2I10 A;  3CF2 A;  3FKJ A;  5LRR A;  6PAX A;  3HJE A;  1D1B A;  3TMO A;  4UUS B;  2CV2 A;  1WZ2 A;  2K02 A;  2RQP A;  4B1R A;  2CUF A;  2O61 A;  5DEQ A;  2RNJ A;  3O3K A;  4BEH B;  3KIO A;  3ERM A;  3G1L A;  1Y39 A;  1MNM C;  3EUA A;  1QO0 D;  3CTA A;  3GLL A;  2LRE A;  2WB1 N;  1Y6I A;  2DA1 A;  2EV5 A;  5CVU A;  2JSP A;  4HST A;  4P5O A;  2XSJ C;  2EIL H;  4DW6 A;  1WWX A;  3BOQ A;  4CXF A;  4WXD A;  5CPR B;  5DD8 A;  2L3D A;  1NHA A;  5IP9 J;  1XGS A;  4R1H A;  2UUZ A;  3CCJ I;  4HX4 A;  2W24 A;  4LK0 F;  1D8K A;  4ESF A;  3V8J A;  1P7J A;  1LDD A;  4XOR A;  4HNU A;  4HBL A;  3BR1 A;  2HKO A;  3E0J B;  3WTW C;  2F5D A;  2K9M A;  3BLY A;  3OYM A;  2OF7 A;  1B59 A;  4I99 C;  4AD9 A;  5ICC A;  3GW2 A;  4HEA 2;  4KT6 A;  2PN6 A;  2JMW A;  3F8F A;  3IRQ A;  4J00 A;  1TQM A;  2LY1 A;  1IN8 A;  2VUM J;  2GAU A;  3K4M A;  2IA1 A;  1UST A;  2MBF A;  3DTI A;  3LNQ A;  3PQJ A;  1MDM A;  3F9K A;  4BU2 A;  2KQR A;  3CCM I;  5E1X A;  2OJE D;  3WE3 A;  2JUG A;  2KDO A;  1NK2 P;  5EDN A;  2ME0 A;  1HW1 A;  2YU9 J;  2HEO A;  3IKT A;  4EJW A;  1U5T C;  5K7H A;  3PNY A;  3F23 A;  2K9N A;  1R4M B;  3AG3 H;  4BYY A;  1LJ9 A;  3W6V A;  3L2W A;  2GBY A;  5H2F C;  1OYW A;  2HI3 A;  4EGZ A;  4IOA F;  3L1P A;  3HRS A;  1MJ9 A;  4A3J J;  5AIP A;  2CFO A;  5BPD A;  1OCR H;  4RAF A;  4DYR A;  3K7A J;  1R23 A;  3K69 A;  4H0E A;  2NRA C;  1X1A A;  4B09 A;  2PX9 A;  3M1E A;  4N4O B;  4DNC A;  3OSF A;  4UB6 C;  2IAI A;  2VJ4 A;  1HDD C;  5JHF A;  1Z05 A;  2AO9 A;  3R6S A;  4A0Z A;  4Y15 A;  3C2H A;  4BKX A;  5IYC J;  3OOP A;  1RIO H;  4IRI A;  1BR2 A;  4E70 A;  1Y1W J;  2NNN A;  2NVY J;  5K5O A;  2CW8 A;  3SJM A;  4B48 A;  1D5Y A;  2VXZ A;  3C2B A;  1YI2 I;  3D5L A;  2MYS A;  2QKL B;  4LFU A;  1SVM A;  4ZDO A;  1DU6 A;  2CFX A;  5IT3 A;  3DEW A;  1DQU A;  5LGU A;  2GLO A;  3HOZ J;  2ZBK A;  3GYH X;  3HBL A;  2DLL A;  1FTT A;  4IHY A;  1SMY F;  3QPS A;  5IOZ A;  4L0Z B;  1HF0 A;  3S3O A;  1JTY A;  2VBX A;  2PMU A;  2ZO4 A;  1Z6T A;  2VBW A;  3BR2 A;  1A04 A;  4M3E A;  4AVZ A;  2RNG A;  2PEX A;  3ML6 A;  3ZR8 X;  2E7X A;  5IT9 Z;  3BTI A;  5FLX K;  2D2W A;  4IPA A;  4A6E A;  1Z6R A;  4Y13 A;  4I98 B;  2LF8 A;  4M73 A;  1QVT A;  3RZD J;  3ZN1 A;  5EG0 A;  1ZK8 A;  3KEO A;  1BA5 A;  2E5N A;  5B1A H;  2W84 A;  3FXK A;  2V79 A;  1BC8 C;  2HU9 A;  2CJJ A;  2YU3 A;  2DQR A;  3WOD F;  2DTR A;  4LB6 B;  4CZC A;  4OIO F;  4Y52 J;  1BJZ A;  2Y75 A;  2ZJR F;  2R4G A;  4C3J J;  4Y3O A;  3HRT A;  5LHG A;  1YFH A;  3I58 A;  3IH2 A;  1OR7 A;  4EM1 A;  3CDL A;  4I76 A;  1BI3 A;  3FK6 A;  2HZD A;  1HA8 A;  2Q2E B;  2QLZ A;  1TNS A;  2M7B A;  1I39 A;  3OL4 A;  1ORK A;  2YS9 A;  2CUE A;  2LBF B;  4GDF A;  2I8D A;  3KZZ A;  2HQR A;  3OYN A;  2K27 A;  1WJF A;  1MBJ A;  2O6G E;  2YPR A;  2HGC A;  3BG7 A;  3L00 A;  1S8N A;  3QOD A;  5JR3 A;  5HS8 A;  3H3Z A;  1BI2 A;  3BRO A;  3FXM A;  3J81 Z;  1AHD P;  4XID A;  2NAZ A;  2XAG A;  2Y0S N;  3D1N I;  1NK3 P;  2BBY A;  2IA2 A;  2OCC H;  4ENJ A;  2A69 F;  2HVQ A;  1G4D A;  2NOG A;  3WHB A;  3HG9 A;  3E3V A;  2K4J A;  5LHH A;  3KZI C;  4M9Z A;  3JRH A;  2R7R A;  3OIQ A;  5JHU A;  3FDY A;  1K4T A;  3E6B A;  5FKO A;  3IKV A;  4FE4 A;  3GTL J;  2X6X A;  2XAS A;  2VE9 A;  1JUS A;  4JK1 X;  1UHW A;  1UHM A;  2Z1D A;  3Q0U A;  2WWY A;  2CU7 A;  4UY8 I;  2W7N A;  4C3H J;  2X1E A;  2X1D A;  3I55 I;  3LSJ A;  4E7S A;  2CV1 A;  3J7A O;  1I6X A;  3R60 A;  1WQ2 A;  3KP4 A;  3PQK A;  1HCR A;  1H88 C;  5HLG A;  2X48 A;  3S2H J;  3U2R A;  2KDZ A;  1H9G A;  4HW0 A;  1YIT I;  3TP0 A;  1PUF B;  1K78 B;  2E35 A;  1XMA A;  3DEU A;  5JLX A;  1TBX A;  1ON1 A;  4XBF A;  5F0C A;  1LPQ A;  1SD7 A;  1Z7U A;  2L4M A;  2IGN A;  3HHH A;  4PDK A;  3MKZ A;  4HX7 A;  2K4B A;  1YTY A;  4GO1 A;  1S9H A;  2EZK A;  2CQX A;  4UNO A;  3K70 D;  3SDG A;  2ETH A;  3G73 A;  3FBI B;  4AM3 A;  2L9S A;  3EYI A;  1R00 A;  1VQ6 I;  1N78 A;  3KEQ A;  4XLH A;  5EGO A;  4HQM A;  2JK3 A;  4I6Z A;  5AIQ A;  3TW7 A;  3S17 J;  1REP C;  2NVQ J;  4BQN A;  5FO5 A;  3MZH A;  4XQF A;  3H92 A;  5GTI C;  2LH9 A;  1FMV A;  1RC9 A;  1V5G A;  4W97 A;  1YIO A;  2Z33 A;  3G1O A;  5F0F A;  3RJP A;  1F36 A;  3VEP A;  2E60 A;  3C7J A;  2HYJ A;  3JCU C;  4PGG A;  3PFI A;  3TQN A;  3CLO A;  1XPX A;  3KPH A;  1G3Y A;  2VKD A;  1EH8 A;  4Y33 A;  2TRT A;  2ZSH B;  3G71 I;  4A3M J;  3RQ4 A;  3QP5 A;  4M9S A;  1JT6 A;  2HDC A;  5DDG A;  4ZTF A;  1RES A;  3VWB A;  3AKZ A;  1AOY A;  4MIM A;  2QUF A;  4E7Z A;  2RDP A;  4QPO A;  1U6G A;  2LD5 A;  2E1N A;  2DMN A;  2HOS A;  3GXO A;  3BJO A;  3O2P E;  2H6C A;  2H8R A;  2EZL A;  4IHW A;  1TWF J;  5HS7 A;  4BE2 A;  2EJR A;  5FRO A;  5E1W A;  3TO9 A;  5LD2 C;  3T8T A;  1IN7 A;  4Y7N J;  4EGY A;  5D5W B;  3ZXS A;  3ZMT A;  1ENH A;  3RYP A;  1W7P A;  3F8M A;  4PFO A;  1FNN A;  1KQ9 A;  5H6R A;  2CW0 F;  2DA3 A;  1QZZ A;  2OQG A;  2DT7 B;  2Y0S A;  3CDI A;  3GFL A;  5K7F A;  1IDY A;  4G94 A;  2M0M A;  4BUP A;  2F4I A;  3Q9V A;  2GIZ A;  2ELK A;  2M3A A;  2DJI A;  1T98 A;  4XLE A;  2XB0 X;  1VQN I;  1QBJ A;  3VYS B;  1E3O C;  3UKG A;  1SD5 A;  3TBI A;  2VON A;  3A4C A;  2CSO A;  3OYC A;  1UB9 A;  2IGK A;  2LY2 A;  4BJ5 C;  4CCK A;  3OYF A;  2HTS A;  5KAF C;  1JT0 A;  4RAG A;  1IZ1 A;  1D1A A;  1ZHF A;  2ZME B;  3LSH A;  1O7F A;  5J3L A;  2QVO A;  3OL3 A;  5KK1 A;  2O03 A;  1B8I B;  3RSN A;  5L3G A;  5DTD A;  2A5Y B;  3JRA A;  2HOT A;  3L7W A;  1UFM A;  4B44 A;  1QNT A;  4L5E A;  1VQ8 I;  4G7Z F;  2FJ1 A;  3ZQC A;  5M3M J;  3GUD A;  1FP1 D;  4OIQ F;  3CD6 I;  3JRE A;  4OIP F;  4ZYD A;  1YIJ I;  2OUM A;  3CUQ B;  4RB1 A;  5IYD J;  2VBZ A;  5IYB J;  3T0Y A;  2W57 A;  3KP3 A;  5FRN A;  1LUJ B;  1X1C A;  2AXL A;  2P7V B;  2VOD A;  1Z91 A;  2KIM A;  3QYF A;  5J40 A;  1ZQ3 P;  2F4O B;  4F52 A;  1O57 A;  1XSX A;  2A05 A;  2GOM A;  4ZJZ A;  2UV1 A;  5E20 A;  4HV5 A;  2M7A A;  1MW7 A;  2ZNZ A;  1IV8 A;  4KMF A;  3RYR A;  2DJN A;  4I01 A;  5E3O A;  1SAU A;  3R4K A;  3H5A A;  4LJZ F;  3LSR A;  1R49 A;  1K79 A;  3QP6 A;  1N75 A;  1S7A A;  2IBD A;  4GYG A;  4QIW N;  1KQ8 A;  2NVU B;  2KJB A;  4AC0 A;  1YW9 A;  1TWC J;  2HQN A;  3OYD A;  3DBH B;  3OYL A;  2XF6 A;  2XRO A;  3OWT A;  2W00 A;  2WTE A;  3OIP A;  4BDZ A;  2L7K A;  2E7W A;  2BW3 A;  2DTZ A;  1OPC A;  1ZG1 A;  2E36 A;  2Y2Z A;  5FD5 A;  2CGP A;  3SEZ A;  2K40 A;  5FKN A;  1GV2 A;  4LLG F;  1TQP A;  2ADU A;  4CCL A;  4RAZ A;  3QRF F;  1J59 A;  2PMZ A;  4LB5 A;  2BYV E;  4FIS A;  4XLP F;  4FX0 A;  1FY7 A;  4HYE A;  5DCF A;  1MSE C;  2R7X A;  3CC4 I;  3H5R A;  3BWG A;  4IXA A;  2XSD C;  3A2K A;  2MC3 A;  3ZGK A;  3F8B A;  1FJL A;  3LST A;  5LRS A;  1J7K A;  4WX9 A;  4G9Y A;  4A12 A;  1Q1V A;  3BQZ A;  3EUH C;  2V26 A;  1T8I A;  3MN2 A;  3E6D A;  2XHK A;  3IL2 A;  4HPQ A;  3DCF A;  1V3F A;  1LVA A;  4ETS A;  2K7L A;  3AG1 H;  3CF5 F;  2R7D A;  1TLH B;  1TT0 A;  2CYY A;  4MTE A;  4YEJ A;  1ZAR A;  3TDU C;  2VC1 A;  4H4K C;  3JAM Z;  1WPK A;  4HX8 A;  3IUO A;  1ZLJ A;  3IH4 A;  4PJM A;  2XAF A;  2D45 A;  1W0U A;  2EV0 A;  2OCE A;  3QQA A;  2MC4 A;  3VOD A;  2PI0 A;  1DPU A;  3OMY A;  2WAD A;  2JA2 A;  3SFZ A;  3RTR A;  3HTU A;  4ASN A;  5JI6 A;  2V6E A;  2FNP A;  3S3N A;  2W25 A;  1KA8 A;  4JQF A;  4L9T A;  5KHD A;  4IL6 C;  1U2W A;  1WHU A;  2EFN A;  2W82 A;  2EFW A;  2IS1 A;  1Z67 A;  2ZJP F;  3A0B C;  3RPU A;  4X6A J;  3K70 C;  3M07 A;  3F3X A;  2IVM A;  4I2O A;  3ASN H;  1Y0N A;  2HOA A;  4JYK A;  1D0X A;  1MBG A;  1Z0X A;  3BTL A;  5F04 A;  1MDM B;  2NVT J;  3RKQ A;  1DUX C;  5E79 C;  4Z6Y A;  5HLT A;  5B66 C;  4BAY A;  4M3B A;  2K5C A;  1F9N A;  3CJR B;  3DBR B;  5DV5 A;  2WV0 A;  4IHX A;  3PNT A;  2FX0 A;  1A6Q A;  3DLL F;  4Y4R A;  1MMA A;  1X4P A;  2HS5 A;  1J5Y A;  4A3B J;  5J1R A;  2MW8 A;  4U0W A;  3DTK A;  1R22 A;  2ZME C;  4IQ4 A;  1J75 A;  4M72 A;  4BXU A;  1RI7 A;  4O6J A;  3CCR I;  1O3T A;  2P6T A;  3M9A A;  2BEO A;  4ABZ A;  4EJO A;  2K85 A;  3HL2 A;  2BVL A;  2DOA A;  5LBQ A;  4E7J A;  3N4M A;  2ELH A;  4L9V A;  4BHB A;  4IVN A;  2CS3 A;  3HIF A;  4K2E A;  3CUQ C;  5M3F J;  2O8K A;  2MA3 A;  5LGN A;  2LLK A;  1FOY A;  4IF4 A;  5C44 J;  1YQA A;  3H0G J;  5CQE A;  3ERE D;  2DPU A;  1YJ9 I;  2Y30 A;  3FK7 A;  3GTQ J;  4TV7 A;  4NDL A;  1G3W A;  2JRM A;  1G3S A;  4XKV A;  3BR3 A;  3VB2 A;  2ZJQ F;  5LEK A;  3ZCO A;  1POG A;  3GO5 A;  2COM A;  3KYL A;  1R9T J;  2FF4 A;  2V9V A;  3BZC A;  2K9S A;  2CUJ A;  2AQF A;  2VC0 A;  2DDB A;  2FRH A;  2QQ8 A;  5LHI A;  3OYI A;  2OQR A;  2JJ7 A;  2L0K A;  2QGU A;  3FXO A;  2MLG A;  3GME A;  5E3L A;  1Y8R B;  1W4M A;  3LQQ A;  4U7B A;  1OKR A;  3I9V 2;  5EG0 B;  3BG3 A;  3HUG A;  2R5Y A;  2A3S A;  2G0E A;  2PG4 A;  2BXY A;  2BHY A;  4NC8 A;  3HEF A;  4RGU A;  3WTV C;  2JPC A;  2K9L A;  3HYI A;  4GCV A;  4CO8 A;  2LYC A;  1SFX A;  1EJ9 A;  1QVU A;  3GZ6 A;  4A2U A;  2HZT A;  3AFH A;  3L2U A;  2BY2 A;  4R8H A;  3OS2 A;  4PFP A;  3S1Q J;  1ZH5 A;  3UNG C;  4N4N B;  2L7Z A;  3CCL I;  3B02 A;  1VF9 A;  2L54 A;  3RQI A;  2GZW A;  1OMI A;  2FD5 A;  3M7G A;  3KZY A;  1G2H A;  1TC3 C;  2DA7 A;  1LB2 A;  1BI0 A;  4LGW A;  5DYM A;  3ULQ B;  2PJR A;  3GFM A;  3P5J A;  2HXO A;  1RKT A;  2JUC A;  3H35 A;  3KFW X;  3W2W A;  3CO6 C;  5TIS C;  4FET A;  3MKL A;  3G1M A;  4MO7 A;  5D8K B;  1IF1 A;  2D5V A;  4ITV A;  4E7I A;  2M1B A;  1UJ8 A;  1E2X A;  5GAG J;  2XPW A;  5KNL A;  1R6R A;  2DAO A;  1OCZ H;  3GVA A;  4IEJ A;  4BQA A;  3BTC A;  4CHU A;  1OYI A;  2DDA A;  4OU0 A;  2AXT C;  3MZ8 A;  3M3Y J;  5EEG A;  1SMT A;  1IRF A;  4FHT A;  1I6H J;  3ZQF A;  2QF7 A;  4MHG A;  2OA4 A;  3ZPL A;  4CCJ A;  4M3F A;  1Z9C A;  4C2M J;  1H8A C;  2QEX I;  1WI9 A;  3KYC B;  5FGM A;  3BQY A;  4RM2 A;  3CP8 A;  1JJ8 C;  1ULY A;  1H89 C;  3ABK H;  5JLW A;  2WAE A;  1BW5 A;  3AG2 H;  3BJ6 A;  4RM3 A;  3AAF A;  2V4J C;  3GFJ A;  1OFC X;  1G59 A;  3IHU A;  3L9F A;  4HF0 A;  1RUN A;  3CCV I;  1J0R A;  4LK1 F;  4EV0 A;  2R92 J;  5HLH A;  2XAH A;  5ERI A;  1QHH D;  2LOO A;  3CCU I;  1O4X A;  1ETY A;  2L01 A;  1S29 A;  1NH3 A;  4GRI A;  3ZMZ A;  4QPQ A;  2P5L C;  5IT9 K;  2EIN H;  3F22 A;  4A3L J;  1N77 A;  3NRV A;  4EJU A;  2VPR A;  4KIC A;  2IW5 A;  2JA7 J;  5DUK A;  1ETX A;  3DKX A;  1BI1 A;  1ZKG A;  5FB2 A;  3ZQL A;  3CMA I;  2ECB A;  1U5T A;  2H6B A;  2HFH A;  2LFB A;  2KJC A;  1MNE A;  4OMZ A;  1RZ4 A;  4KNY A;  4M3G A;  3LFK A;  3TP3 A;  1PJR A;  4AUX A;  1IJW C;  3S2W A;  2A6T A;  1OYY A;  1GLN A;  1UZC A;  5EGO B;  1DGW Y;  4Q5S F;  2KRF A;  2J5P A;  2L02 A;  3P9K A;  4D5C A;  5ICE A;  1W7P D;  5ILU A;  3OYK A;  1X1D A;  1WJ5 A;  3OSG A;  1A31 A;  1GT0 C;  1JGS A;  2AQE A;  4XSZ F;  3OR1 C;  1W5T A;  3BT9 A;  4RLF A;  1ZGJ A;  2CQN A;  3LQR A;  1D5V A;  1M1E B;  2OAZ A;  5M5X J;  1R1T A;  2PQ8 A;  5AON A;  2DQL A;  4PCQ A;  5CJ9 A;  4BBS J;  5K5R A;  2M2E A;  2DYR H;  3LFU A;  4XSX F;  4HDV A;  2RGV A;  2XKO A;  5F64 A;  1X3W B;  5KCM A;  3ZMV A;  3EQL F;  3K4C A;  3U1K A;  2VJJ A;  4RA2 A;  2DPD A;  3S15 J;  2XIG A;  3RIR A;  2GXA A;  3J81 K;  1XMK A;  1JI8 A;  2QSG X;  3BZK A;  2KIF A;  1EV7 A;  2Y69 H;  2FBH A;  2YR2 A;  3WTZ A;  1JHH A;  1HKT A;  3HOW J;  3M8E A;  4PJN A;  4RS8 A;  4Y17 A;  2ZNY A;  3VYU B;  5EZG A;  3VFZ A;  5KAI C;  2ESH A;  5BNG A;  1QRY A;  3ZMS A;  3S16 J;  1ACI A;  3QWL A;  4NC6 A;  4XLN F;  1W36 D;  3WU1 B;  3DU5 A;  2VLA A;  3JTH A;  4EM0 B;  2QQB A;  4BXF A;  2LDU A;  3GZ5 A;  4BY7 J;  3C1D A;  3H0D A;  4KJZ A;  1PVE A;  1Y56 A;  2FOW A;  1HW2 A;  2DW4 A;  3OIO A;  5DCM A;  3AL0 B;  1OCP A;  4LG0 A;  4M6V A;  1B72 A;  3QU6 A;  5IPA A;  2JA5 J;  2KLO A;  2XGD A;  4MEX F;  3LSI A;  1FIP A;  2OZ6 A;  1YYV A;  3VDX A;  1X2N A;  4CCN A;  1W7P B;  1R1U A;  3SXY A;  1IGN A;  1LKX A;  3ROU A;  4UUV A;  4XLC A;  3FIW A;  1FP2 A;  2YX7 A;  1J9I A;  2XAQ A;  2BV6 A;  2QYO A;  1MGT A;  4LD5 A;  3A0H C;  1OR7 C;  1R5G A;  2IRF G;  3RCO A;  3F0C A;  4BXX J;  4C2T A;  2VKV A;  1YS6 A;  4FAS D;  4DIQ A;  3PSF A;  1HC8 A;  2WAF A;  2XF5 A;  3ECO A;  4UB8 C;  3GFI A;  1IDZ A;  1HKQ A;  4YFX F;  1T0F A;  1GHC A;  4G7O F;  3WU2 C;  4P55 A;  5A2Q Z;  3ELK A;  2KRH A;  1STZ A;  2X51 A;  3SZT A;  3U21 A;  3E97 A;  1ZTR A;  4NHJ A;  2R7T A;  3PO2 J;  5D5U B;  2BY3 A;  2L4A A;  1SD4 A;  3J7A Y;  5HNH A;  3LA7 A;  2XUB A;  2HXI A;  2V6C A;  2GA2 A;  4MTD A;  2UXX A;  1LVK A;  4JX5 A;  3JW4 A;  4C2U A;  4YIF A;  3D0S A;  5L3F A;  1F5T A;  2EB7 A;  1LE8 A;  1VQ7 I;  1WI3 A;  2NXN B;  3HGY A;  3ONQ A;  4DBR A;  3LL7 A;  5FKK A;  2L5Q A;  3DLA A;  4BE1 A;  4YG2 F;  2DT6 A;  3BJA A;  1EH6 A;  4MGR A;  2OPT A;  3SDB A;  4JOM A;  1JUP A;  4XRS G;  1DPR A;  2XRN A;  2ELJ A;  1ZEL A;  4RDU A;  1RPW A;  3HC7 A;  3DU6 A;  2Z2S B;  4I02 A;  2O5R A;  2M45 A;  5M5Y J;  1QZY A;  1WVR A;  1BW6 A;  4CGZ A;  2XPV A;  1TZL A;  5K1Y A;  2FSW A;  3L2R A;  4I7H A;  1YLF A;  3T5X A;  5BMZ A;  1YE9 A;  2XGC A;  1F4K A;  3GWZ A;  5GTH C;  2P8T A;  2QM3 A;  4WXH A;  4XLF A;  2MLK A;  3PIP F;  1XCV A;  2K86 A;  2BW3 B;  2QQ9 A;  4YRV A;  1CF7 A;  1QGP A;  1D0Z A;  2A5W A;  1HQC A;  5H20 A;  4HRI A;  5BQT A;  3G3Z A;  4NNJ A;  5L3D A;  2Z3Y A;  1FPQ A;  1T33 A;  4KN7 X;  3EET A;  1FOW A;  3S3M A;  5GPA A;  1YJW I;  2NS8 A;  1OCT C;  3WG7 H;  1FLI A;  3RPU D;  3F8C A;  2R93 J;  2JA6 J;  2PJP A;  3T1B A;  4L18 B;  3WTX C;  1FTZ A;  1JTX A;  2XPU A;  3OY9 A;  4BJ6 C;  2HVS A;  2CMP A;  4G6D A;  1VQ5 I;  4IO9 F;  1XMX A;  2M4K A;  2VKE A;  4HG2 A;  3PUB A;  1ZR2 A;  5CVI A;  2JRT A;  1CQT A;  2FU4 A;  1Y0U A;  3BR0 A;  5DUI A;  4IQJ A;  2CH0 A;  4AU7 A;  2PMZ N;  1LDJ A;  3KP7 A;  5ILV A;  3FXU A;  5E17 F;  1AKH A;  5C4X J;  1V55 H;  3H3V K;  2H8W A;  1MJB A;  1B6A A;  2K9Q A;  1XC5 A;  2A6H F;  4EM2 A;  5GP9 A;  1LEA A;  4ANJ A;  2NNY A;  1D3Y A;  3FKI J;  2P0W A;  1KU9 A;  3FHN A;  2EZI A;  2VPL A;  3H9J A;  3TO6 A;  1B9M A;  1OQY A;  3HSF A;  2WV1 A;  3CC7 I;  4F7Z A;  2B9S A;  1ZGW A;  1FOK A;  3AL0 C;  2KKO A;  2ICW G;  2OD5 A;  1XDU A;  5E8I A;  2HQA A;  1YRN A;  4P96 A;  3J80 Z;  3FXR A;  3CCQ I;  4D9J A;  3ZOB A;  1YJN I;  2LR8 A;  4PUS A;  2R7U A;  2CW7 A;  3E6M A;  3N05 A;  5CVJ A;  1ETV A;  2XVC A;  2ZXH A;  1ZRE A;  1W5C C;  4XN3 A;  4F93 B;  1YOV B;  1S5L C;  2WAQ N;  3PSI A;  1J09 A;  1D8J A;  3IAM 2;  3OOU A;  1E0E A;  3I71 A;  2OZU A;  4PSX A;  4B43 A;  2ZC2 A;  4BH9 A;  3A01 A;  4Q48 A;  3BY6 A;  2M34 A;  4YII A;  3JTG A;  1O3R A;  2A61 A;  2XGX A;  1P6R A;  4L9J A;  3K1P A;  4ESJ A;  1UEL B;  1OCC H;  2R5Z A;  2X1C A;  4DYC A;  3MVP A;  2DA2 A;  3HZJ A;  2DOE A;  5EZH A;  3I64 A;  4UV8 A;  3PM1 A;  3HPH A;  5HDN A;  2HPI A;  4BJT A;  3P9I A;  2HOE A;  3E5U A;  2F4M B;  2KZG A;  2O0Y A;  4KA4 A;  4L9N A;  3CDH A;  2ECC A;  3HB9 A;  5K7Z A;  1W36 C;  5KVR A;  1TTY A;  2BGC A;  2KP6 A;  4GYI A;  3ZQI A;  2F2E A;  2NS0 A;  2XAU A;  4KIG A;  5GAH J;  1B4A A;  4HLX A;  4LMY A;  1MIJ A;  3MD2 A;  1I5Z A;  4M9X A;  2DFI A;  3ASO H;  3GZN B;  3W2V A;  4A3F J;  3OV8 A;  2IJL A;  2PBI A;  4F3Q A;  1K61 A;  4UV9 A;  2KIQ A;  2W85 A;  2BVM A;  3DEE A;  3RZO J;  4CSW A;  3TL4 X;  4IHT A;  4GFB A;  3N97 A;  3GTM J;  3Q0W A;  3PO3 J;  1APL C;  2DA6 A;  2KZV A;  3F72 A;  2QBY A;  3FHZ A;  1PUE E;  3ZP5 A;  1G8X A;  4U0Y A;  4ZC3 A;  2PLY A;  5CLS A;  1FSH A;  3BG9 A;  3JAM K;  2ZXJ A;  4HDU A;  1ONV A;  2HPM A;  4U7D A;  3CCY A;  2P81 A;  2JTV A;  1TL8 A;  2WBM A;  2DMQ A;  2E2I J;  4YFN F;  5L3E A;  1BR4 A;  3FIS A;  2LF7 A;  3TGN A;  2ZJ2 A;  3HUG B;  1SC7 A;  5D4R A;  3C18 A;  3RKY A;  1MBF A;  2BHZ A;  2R5Y B;  4PJJ A;  3HOV J;  4AIK A;  2CRG A;  2EBI A;  2R7S A;  3S1M J;  2XB5 A;  2DI3 A;  1VQL I;  2L2O A;  3JRB A;  3LMM A;  4XM3 A;  2YX4 A;  4ZYG A;  2F48 A;  4G7H F;  3W6K B;  3L2C A;  5IP7 J;  5DM6 F;  1VQM I;  1BIA A;  4XN0 A;  5IP6 A;  2X6W A;  3DPU A;  1MKM A;  4HQE A;  1IRX A;  2XDV A;  2DXI A;  2E19 A;  2EIM H;  3V7R A;  3I56 I;  2PJR B;  2CO5 A;  3HOY J;  3R0J A;  3GTG J;  1Z3X A;  3SHF A;  4LIU A;  3WG9 A;  4XR6 A;  1W0T A;  4A5N A;  2JN6 A;  2M30 A;  2Y48 A;  3B73 A;  3WE2 A;  1LNW A;  1GVJ A;  1SEU A;  3MCZ A;  5J1U A;  4UVC A;  1NG7 A;  2FUG 2;  2K3F A;  3HXL A;  3BR5 A;  1Z3Y A;  4OOI A;  1R1V A;  4XOP A;  5E1Z B;  2E5Z A;  1C0W A;  4X1E A;  1UMQ A;  2F5F A;  1I3Q J;  3EUH A;  1KU2 A;  4FX4 A;  3ZQQ A;  2VI6 A;  3LWF A;  2TCT A;  1WJE A;  2R7W A;  4HA8 A;  1MMD A;  4BL0 B;  1I1G A;  4B47 A;  1FYM A;  4XLA A;  1Z1D A;  2WY8 Q;  1ZR4 A;  1PP8 F;  1VND A;  3V7S A;  2QCO A;  5H6Q A;  2WAQ A;  5IOY A;  2HDW A;  3ISP A;  3OYA A;  1SAX A;  2VOP A;  3J7Z I;  3LSP A;  1MBK A;  2C6Y A;  3QOP A;  2QQA A;  1ETW A;  2V9K A;  4I09 A;  1Z7L A;  4ENN A;  4L0Y B;  2X0L A;  4CYC A;  2VT2 A;  2GIV A;  3E6C C;  2Y0M A;  3Q0V A;  2FMY A;  5J6X A;  5DD4 A;  1KGS A;  3FBN B;  1H0M A;  3ABT A;  3QPH A;  5HOO A;  4EJT A;  4W1U A;  1YS7 A;  1IV6 A;  3S1R J;  4KIB A;  2DFF A;  1S7O A;  3JRF A;  1B9N A;  2VL8 A;  4CA0 A;  3IP4 B;  1FSE A;  2H09 A;  2VBY A;  3OYG A;  2DA4 A;  1DP3 A;  4EEF G;  4ZDP A;  4M6X A;  1TT5 B;  5IY5 H;  5GPC A;  1BIB A;  4RGR A;  4A69 C;  5DM7 F;  4A3C J;  3K1M A;  1U5T B;  3ECH A;  1IRZ A;  1P7I A;  1A35 A;  2KIS A;  1FBQ A;  2M4G A;  4A0Y A;  1Y8Q B;  4A6D A;  2VB6 A;  5CKT A;  2FQ4 A;  4ZYA A;  4ZDL A;  4E4H A;  1WJB A;  1WRJ A;  4HZF A;  1LQ1 A;  4LG3 A;  3GTP J;  3JSO A;  1FZP B;  3HRU A;  2GM4 A;  3LSK A;  3S2D J;  4V2G A;  5BS6 A;  3WTS C;  1RR7 A;  4DJA A;  2KHM A;  2V1U A;  1ZAO A;  2E2J J;  4OIR F;  3MMY B;  1E17 A;  3ESW B;  5TRD A;  3VSK A;  5HS9 A;  1OCO H;  4L5I A;  4C9Y A;  2IT0 A;  4DQ2 A;  4XRM A;  4BDY A;  3IC7 A;  3ABU A;  3BG6 A;  4NC7 A;  2RKH A;  1U8R A;  3K1N A;  3GTK J;  3A1Y A;  4UXN A;  1ZRF A;  2HVR A;  3IH3 A;  4QWQ A;  2BOL A;  1IN6 A;  2B7E A;  2V1X A;  4AYB A;  2FNA A;  4EVI A;  5JVT A;  4E7H A;  2O9L A;  4IRH A;  1XGO A;  1IG7 A;  4UVB A;  1PDN C;  2HKX A;  2ISY A;  1TWA J;  5EJC A;  4RB0 A;  4EMS A;  2V9P A;  2AHQ A;  1VI0 A;  3ZQH A;  5HDG A;  3REO A;  2Z5U A;  4D0P A;  4ENM A;  4BE0 A;  3HKZ N;  4F55 A;  4QSH A;  3PIO F;  5E3M A;  2VQH A;  4O5V A;  5FLV A;  1BOA A;  3BPV A;  4ZZD A;  4ENK A;  2VQL A;  5DCM B;  1JXS A;  4LG0 B;  3WTY C;  3ZN0 A;  1B72 B;  1FBU A;  3IWF A;  1B1B A;  2F5V A;  2OV7 A;  5FD6 A;  5D6E A;  5LGT A;  1VFC A;  1YHQ I;  1ZLK A;  1WJA A;  2CWE A;  4E7K A;  4KYW A;  1ZN2 A;  2NYX A;  3CJT B;  3IV5 A;  4Q4Z F;  1JKP C;  4F91 B;  2DOF A;  2WC2 A;  1G3T A;  5K5Q A;  3NWT A;  1X4O A;  4XRF A;  1ZRD A;  5C4J J;  2DMT A;  3M8J A;  3E1S A;  4UUT A;  3E7L A;  4GXO A;  1TP4 A;  3I0T A;  4UVA A;  4RLQ A;  2AS5 F;  1QU3 A;  1X1P A;  3KP2 A;  1MD0 A;  3D5R C;  1R7J A;  5FJ8 J;  1HOM A;  4E6K G;  3A03 A;  4KUM A;  4A3D J;  3H36 A;  1HXD A;  1XGN A;  1ZG3 A;  1X58 A;  1DU0 A;  2E2H J;  2CG4 A;  1X3U A;  4G8X A;  1QPI A;  4B3A A;  2M9H A;  2QA4 I;  2PMH A;  3JRI A;  2HDD A;  3SEQ A;  2RV8 A;  1EF4 A;  3I5U A;  3QPL A;  4S0H B;  1R5I D;  3A02 A;  2BZT A;  1VQ9 I;  5CVV A;  2Q8K A;  2FA5 A;  4ZTJ A;  4J01 A;  3PL8 A;  4HOB A;  2A68 F;  4BAC A;  1LE8 B;  1XD7 A;  2NVX J;  1XTA A;  2DU9 A;  2KPM A;  1IO2 A;  1HW5 A;  3RDI A;  3L2Q A;  2GWR A;  2ZSI B;  4PJ0 C;  3EUK L;  3JSP A;  4AIJ A;  3I54 A;  2M8E A;  4RBO A;  2V7F A;  5FKM A;  2O8X A;  4M71 A;  3FM3 A;  2GOX B;  2LG4 A;  4M74 A;  4RB3 C;  1GUU A;  2BE5 F;  3HOS A;  4IX7 A;  1YX3 A;  1TWH J;  3HRM A;  4RGS A;  4ON0 A;  2R7Q A;  3O8H A;  3OYB A;  3Q5F A;  3SZP A;  4LOC A;  1FC3 A;  2LK2 A;  4JBA A;  1V4R A;  3I59 A;  1BJA A;  1O7L A;  5TJJ A;  4KDP A;  2VXD A;  1QA6 A;  2XC7 A;  4XKW A;  4IJA A;  1H9T A;  2COB A;  2IEK A;  1X3Z B;  1ETO A;  4DBQ A;  2R7Z J;  2Q0O A;  1IW7 F;  4P1W A;  3DV8 A;  4U88 A;  2IP2 A;  2LKX A;  5CVR A;  3RPQ A;  3S93 A;  1LFB A;  1CF7 B;  2E34 A;  3MEX A;  4C30 A;  1V5E A;  4XKC A;  2X4H A;  1R4N B;  1F1Z A;  3TW6 A;  5D5V B;  3CLQ A;  2GQQ A;  2B63 J;  1T39 A;  2FQ3 A;  2QKM B;  4G6Q A;  2L7F P;  1EH7 A;  3KP5 A;  3HGG A;  2LC2 A;  3DP7 A;  3S32 A;  1T2K A;  2DFE A;  3KET A;  4MQ9 F;  1K7A A;  2FXA A;  1SVO A;  4L5J A;  3WGI A;  1N25 A;  1WJC A;  3QYB A;  3WTT C;  3BR6 A;  1XX5 A;  2G7H A;  3FXL A;  3KP6 A;  4Z2Y A;  3T8R A;  4YEL A;  4M6Y A;  1ETQ A;  3MFK A;  1WH7 A;  1Q1H A;  1TW3 A;  2FBI A;  2YSR A;  1V54 H;  5CQG A;  3GCM A;  3NAU A;  1R5H A;  3OYE A;  3HKZ A;  4Q47 A;  4QTR A;  4CCM A;  3CCE I;  1IN5 A;  2DK8 A;  4AIH A;  4A93 J;  4II3 A;  2DMU A;  3NEU A;  4JX6 A;  2QSF X;  1FT9 A;  2W48 A;  3BDD A;  3X2Q H;  1HST A;  2Z16 A;  2O3F A;  3ZMU A;  1I3A A;  1ON2 A;  3NWS A;  2JSC A;  3Q9S A;  5A2Q K;  1R71 A;  2KFD A;  1O3Q A;  2HR3 A;  1AKH B;  1LDK B;  4JP0 A;  4DOZ A;  3CUO A;  1MBH A;  1T08 B;  3VYR B;  4CYD A;  4PSW A;  2RRE A;  1SFE A;  1AU7 A;  4CIC A;  4RB2 C;  3JR9 A;  2L7M P;  5FRM A;  4RGX A;  3LSG A;  3HDD A;  1FIA A;  2PFB A;  2VT3 A;  4NB5 A;  4NQW A;  2MD0 A;  4YFK F;  2A6E F;  4MFD A;  4D5F A;  4EAT A;  3OYH A;  3CO7 C;  3AG4 H;  4LIV A;  2IA0 A;  3J7Y J;  2A07 F;  2OTL I;  3HTS B;  3OS1 A;  5J1Y A;  1F43 A;  3UR3 C;  1G6N A;  3WTU C;  4DZP A;  4B8X A;  4DYQ A;  4F92 B;  1YRN B;  1QHG A;  2V1N A;  5ILS A;  2MD5 A;  1JUM A;  3PUF A;  1VQO I;  4EJV A;  2EFO A;  1XB4 A;  4BHC A;  3K4K A;  4N0B A;  1U9O A;  2LKS A;  2M8G X;  3MWM A;  5J4V A;  1RUO A;  4V19 K;  3BG5 A;  3WGG A;  3FF5 A;  3K10 A;  2UZK A;  3A01 B;  2VIX A;  2R3S A;  1ERD A;  3OS0 A;  3KCC A;  3RI4 A;  4HF2 A;  2WB1 A;  5TGT A;  2DFH A;  2MG4 A;  4D1Q A;  2CQ7 A;  1TWG J;  3OR2 C;  2L9R A;  2R5Z B;  4XMY A;  2Z9O A;  2QEN A;  2D1H A;  1T0F C;  2EA2 A;  2FBK A;  3FMQ A;  4A3E J;  1LFU P;  1RET A;  1MH3 A;  1GVD A;  2OBP A;  3NQO A;  2STT A;  3V4G A;  3I4M J;  4XL9 A;  4UUS A;  5GAD J;  4KIT B;  1E3H A;  3MKY B;  1GV5 A;  3V7C A;  1MBE A;  1FEX A;  5EYR A;  5J4Y A;  2XKP A;  2JWT A;  4G6T B;  5LFA A;  1L3L A;  1CGP A;  4A5M A;  4BEH A;  2FOK A;  5D5X B;  3DBL B;  4LIT A;  4RMN A;  4FCY A;  2F6C A;  3G2B A;  1IUF A;  1BC7 C;  5HOD A;  2OU2 A;  2K3P A;  5D4S A;  2P5V A;  2L9V A;  4KIF A;  4XKB A;  5FFX A;  1KYZ A;  2QBY B;  5FLX Z;  3K0L A;  2P7C B;  3GEZ A;  3F6O A;  3M8F A;  4E7L A;  1A6I A;  4KFC A;  2OTJ I;  2MGQ A;  2JT1 A;  1S3J A;  1JKO C;  1QPM A;  3Q3S A;  4FE7 A;  2CQK A;  2ACJ A;  1WGX A;  3I3L A;  3LAJ A;  2G7U A;  1VQK I;  3GBG A;  3CMY A;  4MNU A;  4BHP A;  2CV0 A;  2UXN A;  1J2X A;  2M5W A;  1XSD A;  3ZQ7 A;  3CCS I;  2M87 A;  1WCM J;  1SD6 A;  3QU3 A;  4D7N A;  1SFO J;  2KT0 A;  1D1C A;  1YG2 A;  3PNV A;  1BOB A;  1UG0 A;  2M0C A;  2WY7 Q;  3OYJ A;  3WGH A;  2BXZ A;  2MH2 A;  3O6B B;  2F5C A;  2X85 A;  3FWE A;  1IN4 A;  5ED4 A;  3EDP A;  2JVG A;  2H1K A;  3KEY A;  4KT5 C;  1Y1V J;  2V1D A;  2LTP A;  4CYC B;  1HDP A;  3H3U A;  4GGG A;  3ZQG A;  3J80 K;  3LOC A;  3DQV C;  2IGM A;  1RRJ A;  1JHF A;  1K6Y A;  3ABL H;  3R0A A;  3CC2 I;  2ZXI A;  3DKY A;  2ZFU A;  1KON A;  3B6C A;  4WXC A;  3FMS A;  4U0V A;  1RKW A;  2LP0 A;  3LA3 A;  2VJI A;  3C3W A;  3CQZ J;  1UG2 A;  3I4P A;  2HNH A;  2R7V A;  2VJ5 A;  4S04 A;  2P6S A;  2RC4 A;  3RKX A;  2FML A;  3C2G A;  1KYW A;  1WJD A;  2KRC A;  3KE2 A;  1IXS B;  3HSR A;  4CDG A;  3GTO J;  1LEB A;  2FEZ A;  2HTJ A;  2H27 A;  2R0Q C;  1T38 A;  1O3S A;  2R7O A;  5M5W J;  3K4B A;  1XCB A;  3VPR A;  2KMU A;  4HLY A;  4JX4 A;  4X0G A;  3LAP A;  1QQI A;  1OLT A;  1A36 A;  5ICF A;  4AWX B;  2YUS A;  3LSM A;  1DP7 P;  4O3M A;  1QZE A;  3CMM A;  1FX7 A;  1VQP I;  1U0J A;  2B0L A;  1MJA A;  1MH4 A;  2JZY A;  1LFP A;  1KU3 A;  1SAN A;  2DYS H;  3M4O J;  4A0X A;  4A3K J;  3F21 A;  2EH3 A;  5J8F A;  2E1M B;  4HNV A;  3BPX A;  1X19 A;  2EK5 A;  3CJQ B;  1S6L A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 2ZFW A;  1BN5 A;  5CYV A;  1XGM A;  5L3C A;  2F5E A;  5E18 F;  1XN7 A;  3SQN A;  3DXJ F;  3ZMD A;  5LEJ A;  1ZRC A;  1U78 A;  2RN7 A;  4HF1 A;  4P9U A;  3LA2 A;  5BPI A;  3MAJ A;  2Z99 A;  1P4X A;  2XAJ A;  2H94 A;  2RVC A;  3QPT A;  4CZZ A;  2EFP A;  4WWC A;  4ESB A;  3DF8 A;  2Q2E A;  3DKW A;  1BM9 A;  4WCG A;  2D1V A;  1USS A;  3W6J B;  2MH9 A;  5ICG A;  1P4W A;  3L09 A;  1TW2 A;  3FM5 A;  1FYK A;  2EA4 A;  2STW A;  1ZYR F;  3U1D A;  4I0B A;  3TDZ C;  5D6F A;  2ZKZ A;  3EYY A;  3P7N A;  3E5X A;  1FBS A;  5LLQ A;  2XV4 S;  2HWV A;  4FT8 A;  1R58 A;  2EFQ A;  1I27 A;  2P5K A;  2LSO A;  3GF2 A;  2HYF A;  3R61 A;  1KQ0 A;  2UWM A;  2DBB A;  2QWW A;  3FMR A;  4P9F A;  4ZYH A;  3F8N A;  1UCR A;  3K9T A;  1K78 A;  1HKS A;  3VOE A;  1ZGA A;  3FZV A;  1TQI A;  5D8L B;  2VE8 A;  1DDN A;  3RKW A;  4PGH A;  1VTN C;  1TNT A;  1YO5 C;  5EEH A;  4KMU X;  3I53 A;  1AWC A;  3QAH A;  1FWZ A;  4PZJ A;  1P4A A;  1PP7 U;  1GXQ A;  3IRR A;  4ZZL A;  4OIN F;  2GXB A;  2J5O A;  3FXQ A;  4HV6 A;  1BBY A;  4IHS A;  3MZY A;  2DK5 A;  1P2F A;  1JE8 A;  4S05 A;  2KIU A;  3GLX A;  3TOA A;  2R7F A;  1HBX G;  4MQV A;  2G9W A;  3V8K A;  3DFG A;  2P4W A;  3TOB A;  5BOX A;  1IRG A;  4LLL A;  1K6O A;  3DPT A;  5JFR A;  3I59 B;  4ZYE A;  1KU7 A;  2GA1 A;  1MZB A;  4N9I A;  1R36 A;  5F1R A;  3BP8 A;  3KLN A;  3CJN A;  1W5S A;  1IUY A;  1I1S A;  3K2Z A;  4QLC U;  1IXC A;  2ESN A;  1WSU A;  1RNL A;  3FX3 A;  4I0A A;  5HVQ C;  3IWZ A;  2EWN A;  3DPL C;  2E1C A;  4MEY F;  1YW8 A;  4AVP A;  3COA C;  4UHT A;  4OMY A;  2LKP A;  1SFU A;  2DO7 A;  2ZME A;  3TO7 A;  1ODD A;  2ZCW A;  1T6S A;  4R79 A;  5F6F A;  2TDX A;  4WK8 F;  3E5Q A;  4LLN A;  3P9C A;  4KN4 X;  5E8G A;  3HOT A;  3CUQ A;  3KLO A;  1L0O C;  2GXG A;  1FYL A;  3MQ0 A;  4EQQ A;  4ZH4 F;  2JPB A;  2EV6 A;  1XSV A;  4WF2 A;  1XDS A;  2FE3 A;  1U3E M;  3F6V A;  4RAY A;  1WKM A;  1IAW A;  3HHG A;  2IPQ X;  2LNB A;  4IRG A;  4BNC A;  5HDK A;  1GXP A;  5FFZ A;  3BZ6 A;  2VOO A;  5HLI A;  2VN2 A;  2ISZ A;  1ZG5 A;  1P92 A;  2QZ8 A;  1IXR C;  1HSJ A;  3WU0 A;  2DT5 A;  5J8C A;  3TKY A;  2HYG D;  3V8L A;  4N9H A;  3HSE A;  3U9G A;  5L3B A;  4HAM A;  3GX4 X;  5LRR A;  6PAX A;  2K02 A;  2RQP A;  2O61 A;  5DEQ A;  2RNJ A;  3O3K A;  1QO0 D;  3CTA A;  2EV5 A;  5CVU A;  4P5O A;  1WWX A;  3BOQ A;  4CXF A;  4WXD A;  5DD8 A;  2L3D A;  1NHA A;  1XGS A;  4R1H A;  4HX4 A;  2W24 A;  4LK0 F;  1D8K A;  4ESF A;  3V8J A;  1LDD A;  4HBL A;  2HKO A;  3WTW C;  2F5D A;  1B59 A;  4AD9 A;  5ICC A;  3GW2 A;  2PN6 A;  3F8F A;  3IRQ A;  1TQM A;  1IN8 A;  2GAU A;  2IA1 A;  1UST A;  2MBF A;  3PQJ A;  1MDM A;  5E1X A;  3WE3 A;  1HW1 A;  2HEO A;  3IKT A;  4EJW A;  1U5T C;  3F23 A;  4BYY A;  1LJ9 A;  1OYW A;  4EGZ A;  3HRS A;  1MJ9 A;  5AIP A;  5BPD A;  1R23 A;  3K69 A;  4H0E A;  2NRA C;  4B09 A;  3M1E A;  4DNC A;  1Z05 A;  3R6S A;  4A0Z A;  4Y15 A;  3OOP A;  1RIO H;  4IRI A;  4E70 A;  2NNN A;  5K5O A;  2VXZ A;  3D5L A;  4LFU A;  2CFX A;  5IT3 A;  5LGU A;  2ZBK A;  3GYH X;  2DLL A;  1SMY F;  4L0Z B;  2VBX A;  2PMU A;  2ZO4 A;  1Z6T A;  2VBW A;  1A04 A;  2PEX A;  3ML6 A;  2E7X A;  5IT9 Z;  5FLX K;  2D2W A;  4IPA A;  4A6E A;  1Z6R A;  4Y13 A;  4I98 B;  2LF8 A;  4M73 A;  3ZN1 A;  3KEO A;  2W84 A;  2V79 A;  1BC8 C;  2YU3 A;  3WOD F;  2DQR A;  2DTR A;  4LB6 B;  4OIO F;  2Y75 A;  3HRT A;  5LHG A;  1YFH A;  3I58 A;  1OR7 A;  4EM1 A;  1BI3 A;  2QLZ A;  1TNS A;  3KZZ A;  2HQR A;  2K27 A;  2O6G E;  2YPR A;  2HGC A;  3L00 A;  1S8N A;  5JR3 A;  5HS8 A;  3H3Z A;  1BI2 A;  3BRO A;  3J81 Z;  2NAZ A;  2XAG A;  2BBY A;  2IA2 A;  4ENJ A;  2A69 F;  1G4D A;  3E3V A;  2K4J A;  5LHH A;  4M9Z A;  5JHU A;  3E6B A;  3IKV A;  2XAS A;  2VE9 A;  4JK1 X;  1UHW A;  1UHM A;  2WWY A;  3J7A O;  1I6X A;  3R60 A;  1WQ2 A;  3KP4 A;  3PQK A;  5HLG A;  3U2R A;  1H9G A;  4HW0 A;  1K78 B;  1XMA A;  3DEU A;  1TBX A;  1ON1 A;  4XBF A;  1SD7 A;  1Z7U A;  2L4M A;  3HHH A;  4PDK A;  4HX7 A;  2K4B A;  1YTY A;  4GO1 A;  4UNO A;  2ETH A;  3G73 A;  3EYI A;  1R00 A;  3KEQ A;  4HQM A;  5AIQ A;  1REP C;  5FO5 A;  3MZH A;  3H92 A;  1YIO A;  2Z33 A;  3RJP A;  3VEP A;  3C7J A;  4PGG A;  3PFI A;  3TQN A;  3CLO A;  1G3Y A;  1EH8 A;  3QP5 A;  4M9S A;  2HDC A;  5DDG A;  1AOY A;  2QUF A;  2RDP A;  1U6G A;  2E1N A;  3GXO A;  3BJO A;  3O2P E;  2H6C A;  5HS7 A;  2EJR A;  5E1W A;  3TO9 A;  3T8T A;  1IN7 A;  4EGY A;  5D5W B;  3ZMT A;  3RYP A;  1W7P A;  3F8M A;  1FNN A;  1KQ9 A;  5H6R A;  2CW0 F;  1QZZ A;  2OQG A;  3GFL A;  4G94 A;  3Q9V A;  1T98 A;  1QBJ A;  1SD5 A;  2VON A;  2CSO A;  1UB9 A;  2HTS A;  1IZ1 A;  1ZHF A;  2ZME B;  1O7F A;  2QVO A;  5KK1 A;  2O03 A;  5L3G A;  2A5Y B;  3L7W A;  1UFM A;  1QNT A;  4G7Z F;  3GUD A;  1FP1 D;  4OIQ F;  4OIP F;  4ZYD A;  4RB1 A;  3CUQ B;  2VBZ A;  3T0Y A;  2W57 A;  3KP3 A;  2AXL A;  2P7V B;  2VOD A;  1Z91 A;  2KIM A;  1O57 A;  1XSX A;  5E20 A;  4HV5 A;  2ZNZ A;  4KMF A;  3RYR A;  4I01 A;  3R4K A;  4LJZ F;  1K79 A;  3QP6 A;  1S7A A;  4GYG A;  1KQ8 A;  2KJB A;  1YW9 A;  2HQN A;  2XRO A;  2WTE A;  2E7W A;  1ZG1 A;  1OPC A;  2CGP A;  5FD5 A;  4LLG F;  1TQP A;  2ADU A;  4RAZ A;  3QRF F;  1J59 A;  4LB5 A;  2BYV E;  4XLP F;  4FX0 A;  1FY7 A;  4HYE A;  5DCF A;  3BWG A;  4IXA A;  2MC3 A;  3F8B A;  3LST A;  5LRS A;  1J7K A;  4WX9 A;  4G9Y A;  4A12 A;  3E6D A;  2XHK A;  3IL2 A;  1V3F A;  1LVA A;  4ETS A;  2K7L A;  2R7D A;  1TLH B;  2CYY A;  4MTE A;  1ZAR A;  3TDU C;  2VC1 A;  3JAM Z;  4HX8 A;  1ZLJ A;  2XAF A;  2D45 A;  2EV0 A;  3VOD A;  2PI0 A;  1DPU A;  3SFZ A;  3RTR A;  3HTU A;  4ASN A;  5JI6 A;  2FNP A;  1KA8 A;  2W25 A;  4JQF A;  4L9T A;  1U2W A;  2EFN A;  2EFW A;  3RPU A;  3F3X A;  2IVM A;  4I2O A;  1MDM B;  1DUX C;  4BAY A;  1F9N A;  5DV5 A;  2WV0 A;  2HS5 A;  1J5Y A;  4U0W A;  1R22 A;  1J75 A;  4M72 A;  4BXU A;  1RI7 A;  4O6J A;  1O3T A;  2P6T A;  3M9A A;  2BEO A;  4EJO A;  5LBQ A;  3N4M A;  2ELH A;  4L9V A;  4BHB A;  4IVN A;  3HIF A;  4K2E A;  3CUQ C;  2MA3 A;  5LGN A;  4IF4 A;  1YQA A;  3ERE D;  2DPU A;  4TV7 A;  1G3W A;  1G3S A;  3VB2 A;  5LEK A;  3GO5 A;  2COM A;  2FF4 A;  2V9V A;  2VC0 A;  2FRH A;  5LHI A;  2OQR A;  2MLG A;  1W4M A;  3LQQ A;  4U7B A;  1OKR A;  3HUG A;  2A3S A;  2PG4 A;  4RGU A;  3WTV C;  2JPC A;  4GCV A;  3HYI A;  4CO8 A;  1SFX A;  3GZ6 A;  4A2U A;  2HZT A;  4R8H A;  1ZH5 A;  3B02 A;  2L54 A;  2GZW A;  1OMI A;  3M7G A;  3KZY A;  1LB2 A;  1BI0 A;  4LGW A;  5DYM A;  3ULQ B;  3GFM A;  3KFW X;  3CO6 C;  1IF1 A;  5D8K B;  2M1B A;  1E2X A;  2DAO A;  3GVA A;  4BQA A;  4CHU A;  1OYI A;  4OU0 A;  5EEG A;  1SMT A;  1IRF A;  4FHT A;  4MHG A;  2OA4 A;  3ZPL A;  1Z9C A;  1WI9 A;  5FGM A;  1ULY A;  3BJ6 A;  3AAF A;  3GFJ A;  3IHU A;  3L9F A;  4HF0 A;  1RUN A;  1J0R A;  4LK1 F;  4EV0 A;  5HLH A;  2XAH A;  5ERI A;  2L01 A;  1S29 A;  3ZMZ A;  2P5L C;  5IT9 K;  3F22 A;  3NRV A;  4EJU A;  4KIC A;  2IW5 A;  5DUK A;  1BI1 A;  5FB2 A;  1U5T A;  2H6B A;  2HFH A;  2KJC A;  4OMZ A;  1RZ4 A;  4KNY A;  3LFK A;  3S2W A;  1OYY A;  4Q5S F;  2KRF A;  2J5P A;  2L02 A;  3P9K A;  5ICE A;  5ILU A;  1W7P D;  1JGS A;  4XSZ F;  1W5T A;  1ZGJ A;  3LQR A;  1D5V A;  2OAZ A;  1R1T A;  2PQ8 A;  5AON A;  2DQL A;  4PCQ A;  5CJ9 A;  5K5R A;  4XSX F;  4HDV A;  2RGV A;  2XKO A;  5F64 A;  3ZMV A;  3EQL F;  2DPD A;  2XIG A;  3RIR A;  3J81 K;  1XMK A;  2KIF A;  1EV7 A;  2YR2 A;  2FBH A;  3WTZ A;  1JHH A;  1HKT A;  3M8E A;  4RS8 A;  4Y17 A;  2ZNY A;  3VFZ A;  3ZMS A;  2ESH A;  4XLN F;  3WU1 B;  3JTH A;  4EM0 B;  2QQB A;  2LDU A;  3GZ5 A;  3C1D A;  1HW2 A;  2DW4 A;  5DCM A;  4LG0 A;  3QU6 A;  4MEX F;  2OZ6 A;  1YYV A;  1W7P B;  1R1U A;  3SXY A;  3ROU A;  4UUV A;  1FP2 A;  2YX7 A;  1J9I A;  2XAQ A;  2BV6 A;  2QYO A;  1MGT A;  4LD5 A;  1R5G A;  2IRF G;  1YS6 A;  3ECO A;  3GFI A;  1HKQ A;  4YFX F;  1T0F A;  1GHC A;  4G7O F;  4P55 A;  5A2Q Z;  3ELK A;  1STZ A;  3SZT A;  3E97 A;  4NHJ A;  5D5U B;  2L4A A;  1SD4 A;  3LA7 A;  2XUB A;  2V6C A;  2GA2 A;  4MTD A;  2UXX A;  3JW4 A;  4YIF A;  3D0S A;  5L3F A;  1F5T A;  2EB7 A;  4YG2 F;  3BJA A;  1EH6 A;  4MGR A;  1DPR A;  2XRN A;  4I02 A;  2M45 A;  1QZY A;  4CGZ A;  5K1Y A;  2FSW A;  4I7H A;  1YLF A;  3T5X A;  5BMZ A;  1F4K A;  3GWZ A;  2P8T A;  2QM3 A;  4WXH A;  2MLK A;  1XCV A;  2K86 A;  2QQ9 A;  1CF7 A;  1QGP A;  1HQC A;  5H20 A;  5BQT A;  3G3Z A;  5L3D A;  2Z3Y A;  1FPQ A;  4KN7 X;  3EET A;  1FLI A;  3F8C A;  2PJP A;  3T1B A;  4L18 B;  3WTX C;  4G6D A;  5CVI A;  2JRT A;  2FU4 A;  1Y0U A;  5DUI A;  1LDJ A;  3KP7 A;  5ILV A;  3FXU A;  5E17 F;  1MJB A;  1B6A A;  2A6H F;  4EM2 A;  1LEA A;  2NNY A;  1D3Y A;  1KU9 A;  3TO6 A;  1B9M A;  3HSF A;  4F7Z A;  1FOK A;  2KKO A;  2OD5 A;  1XDU A;  5E8I A;  4P96 A;  3J80 Z;  3FXR A;  3E6M A;  5CVJ A;  2XVC A;  1ZRE A;  1D8J A;  3I71 A;  2OZU A;  4BH9 A;  4Q48 A;  3BY6 A;  4YII A;  3JTG A;  1O3R A;  2A61 A;  2XGX A;  1P6R A;  4L9J A;  3K1P A;  4ESJ A;  3I64 A;  4UV8 A;  5HDN A;  3P9I A;  2HOE A;  3E5U A;  2O0Y A;  4KA4 A;  4L9N A;  3CDH A;  5KVR A;  1TTY A;  2BGC A;  4GYI A;  2F2E A;  2NS0 A;  4KIG A;  1B4A A;  4HLX A;  4LMY A;  1I5Z A;  4M9X A;  2DFI A;  3OV8 A;  2IJL A;  2PBI A;  4UV9 A;  2W85 A;  4IHT A;  3N97 A;  2QBY A;  3F72 A;  3FHZ A;  1PUE E;  3ZP5 A;  4U0Y A;  2PLY A;  5CLS A;  1FSH A;  3JAM K;  2ZXJ A;  4HDU A;  1ONV A;  4U7D A;  2JTV A;  4YFN F;  5L3E A;  2LF7 A;  3TGN A;  2ZJ2 A;  5D4R A;  3C18 A;  3RKY A;  4AIK A;  2DI3 A;  2YX4 A;  4ZYG A;  4G7H F;  3W6K B;  3L2C A;  1BIA A;  1MKM A;  4HQE A;  3V7R A;  2CO5 A;  3R0J A;  3SHF A;  3WG9 A;  4A5N A;  2M30 A;  2Y48 A;  3B73 A;  3WE2 A;  1LNW A;  1GVJ A;  3MCZ A;  4UVC A;  4OOI A;  1R1V A;  5E1Z B;  1C0W A;  2F5F A;  3EUH A;  1KU2 A;  4FX4 A;  3LWF A;  4HA8 A;  1I1G A;  1FYM A;  1Z1D A;  1PP8 F;  3V7S A;  5H6Q A;  3ISP A;  1SAX A;  2VOP A;  2C6Y A;  3QOP A;  2QQA A;  4I09 A;  4ENN A;  4L0Y B;  2X0L A;  2VT2 A;  2GIV A;  3E6C C;  2Y0M A;  2FMY A;  5J6X A;  5DD4 A;  1KGS A;  1H0M A;  3ABT A;  3QPH A;  5HOO A;  4EJT A;  1YS7 A;  4KIB A;  1S7O A;  1B9N A;  1FSE A;  2H09 A;  2VBY A;  4M6X A;  1BIB A;  4RGR A;  3K1M A;  1U5T B;  3ECH A;  1FBQ A;  4A0Y A;  4A6D A;  1WRJ A;  4HZF A;  1LQ1 A;  3JSO A;  1FZP B;  3HRU A;  5BS6 A;  3WTS C;  2V1U A;  1ZAO A;  4OIR F;  1E17 A;  5TRD A;  5HS9 A;  4L5I A;  2IT0 A;  4DQ2 A;  3IC7 A;  3ABU A;  2RKH A;  1U8R A;  3K1N A;  4UXN A;  1ZRF A;  4QWQ A;  1IN6 A;  2V1X A;  4EVI A;  2FNA A;  5JVT A;  4IRH A;  1XGO A;  4UVB A;  1PDN C;  2HKX A;  2ISY A;  4RB0 A;  4EMS A;  5HDG A;  3REO A;  2Z5U A;  4D0P A;  4ENM A;  4O5V A;  1BOA A;  3BPV A;  4ZZD A;  4ENK A;  5DCM B;  1JXS A;  4LG0 B;  3WTY C;  3ZN0 A;  1FBU A;  5FD6 A;  1B1B A;  3IWF A;  5LGT A;  1ZLK A;  5D6E A;  4KYW A;  2CWE A;  1ZN2 A;  2NYX A;  4Q4Z F;  2WC2 A;  1G3T A;  5K5Q A;  4XRF A;  1ZRD A;  4GXO A;  3I0T A;  4UVA A;  2AS5 F;  3KP2 A;  1MD0 A;  1R7J A;  4KUM A;  1HXD A;  1XGN A;  1ZG3 A;  2CG4 A;  1X3U A;  4G8X A;  2PMH A;  2RV8 A;  3I5U A;  5CVV A;  2Q8K A;  2FA5 A;  4HOB A;  2A68 F;  1XD7 A;  2DU9 A;  1HW5 A;  3RDI A;  2GWR A;  3JSP A;  4AIJ A;  3I54 A;  2M8E A;  2O8X A;  4M71 A;  3FM3 A;  4M74 A;  4RB3 C;  2BE5 F;  3HOS A;  3HRM A;  4RGS A;  4ON0 A;  3Q5F A;  3SZP A;  1FC3 A;  4JBA A;  1V4R A;  3I59 A;  1BJA A;  1O7L A;  5TJJ A;  4KDP A;  4IJA A;  1H9T A;  2Q0O A;  1IW7 F;  3DV8 A;  4U88 A;  2IP2 A;  5CVR A;  3RPQ A;  1CF7 B;  3MEX A;  2X4H A;  1F1Z A;  5D5V B;  2GQQ A;  1T39 A;  2FQ3 A;  4G6Q A;  1EH7 A;  3KP5 A;  3DP7 A;  1T2K A;  3KET A;  4MQ9 F;  1K7A A;  2FXA A;  4L5J A;  3WGI A;  3WTT C;  2G7H A;  3MFK A;  3KP6 A;  4Z2Y A;  3T8R A;  4M6Y A;  1Q1H A;  1TW3 A;  2FBI A;  2YSR A;  1R5H A;  4Q47 A;  1IN5 A;  2DK8 A;  4AIH A;  3NEU A;  3BDD A;  1FT9 A;  1HST A;  2O3F A;  3ZMU A;  1ON2 A;  2JSC A;  3Q9S A;  5A2Q K;  1O3Q A;  2HR3 A;  1LDK B;  3CUO A;  4CYD A;  1SFE A;  4CIC A;  4RB2 C;  4RGX A;  2PFB A;  2VT3 A;  4NB5 A;  4NQW A;  4YFK F;  2A6E F;  3CO7 C;  2IA0 A;  2A07 F;  3HTS B;  3WTU C;  1G6N A;  4B8X A;  5ILS A;  2MD5 A;  4EJV A;  2EFO A;  1XB4 A;  4BHC A;  4N0B A;  3MWM A;  1RUO A;  3WGG A;  3FF5 A;  2UZK A;  2R3S A;  3KCC A;  3RI4 A;  4HF2 A;  2Z9O A;  2QEN A;  2D1H A;  2EA2 A;  2FBK A;  3FMQ A;  2OBP A;  3NQO A;  2STT A;  3V4G A;  3V7C A;  2XKP A;  1L3L A;  1CGP A;  4A5M A;  2FOK A;  5D5X B;  1BC7 C;  2OU2 A;  5D4S A;  2P5V A;  4KIF A;  5FFX A;  1KYZ A;  2QBY B;  5FLX Z;  3K0L A;  2P7C B;  3GEZ A;  3F6O A;  3M8F A;  4KFC A;  2JT1 A;  1S3J A;  1QPM A;  2CQK A;  2ACJ A;  3LAJ A;  2G7U A;  4MNU A;  4BHP A;  2UXN A;  1J2X A;  2M5W A;  1XSD A;  3ZQ7 A;  2M87 A;  3QU3 A;  1SD6 A;  1YG2 A;  3WGH A;  2MH2 A;  3O6B B;  2F5C A;  3FWE A;  1IN4 A;  5ED4 A;  3EDP A;  4KT5 C;  2V1D A;  4GGG A;  3H3U A;  3J80 K;  3DQV C;  1JHF A;  3R0A A;  4WXC A;  3FMS A;  4U0V A;  3LA3 A;  3C3W A;  3I4P A;  4S04 A;  2P6S A;  2RC4 A;  3RKX A;  2FML A;  1KYW A;  3KE2 A;  1IXS B;  3HSR A;  4CDG A;  1LEB A;  2FEZ A;  2HTJ A;  2H27 A;  1T38 A;  1O3S A;  1XCB A;  4HLY A;  3LAP A;  1QQI A;  5ICF A;  4AWX B;  4O3M A;  1DP7 P;  1FX7 A;  2B0L A;  1MJA A;  2JZY A;  1KU3 A;  4A0X A;  3F21 A;  5J8F A;  3BPX A;  2EK5 A;  1S6L A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...