2EB7A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii 7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
141
structure length
141
Chain Sequence
b'ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 56
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eb7A00
2NNYA 3KP5A 1IN4A 2FMLA 1F1ZA 3ECOA 1ZAOA 4I7HA 3WGGA 3L2CA 1AWCA 4JBAA 3SZPA 1HW2A 2CFXA 1ON2A 4OIPF 2GA2A 4JQFA 1YS6A 2F5EA 1WQ2A 3FHZA 2RNJA 2DAOA 3E3VA 4ZYGA 3FX3A 3LA7A 2JPBA 4A0XA 4BHCA 3CO6C 2IRFG 1KU2A 1IW7F 3WE2A 4R1HA 2KIUA 4XRFA 3O2PE 1KYZA 3LFKA 5J8FA 3SQNA 5DCMA 3ZN0A 1YG2A 5D5UB 3JTGA 5BQTA 2L3DA 2HQRA 3P9KA 1XMAA 2GXBA 3EYIA 2WC2A 2BBYA 4LB6B 3TKYA 4WXCA 2DTRA 2EA2A 3FMSA 4LB5A 2YU3A 3DKWA 1HBXG 1W4MA 2VT2A 2RKHA 1WRJA 2JZYA 3V7SA 4L0ZB 2DPDA 4LLGF 4UVCA 3M1EA 3BWGA 3CUQA 3DF8A 1LDKB 2K4JA 3IKVA 3BJ6A 2DK5A 4ENNA 3V8KA 1USTA 2XGXA 3KP2A 4LGWA 5JHUA 5A2QK 4IF4A 4OIOF 4RGSA 1S7OA 2IP2A 3V8JA 1R36A 1XGSA 1EH8A 3HRTA 1O7FA 2GIVA 2QWWA 2O3FA 1LEBA 4AIHA 1S29A 5K5RA 3Q9SA 4L18B 2VE8A 2CSOA 2CQKA 1STZA 4AD9A 1JHHA 4KIGA 1EH6A 4I98B 4HAMA 2PLYA 3F3XA 3E6DA 1TLHB 1TW3A 1OYYA 3ZPLA 4L0YB 4I0AA 1O3SA 5DCMB 4UV8A 3E5QA 2D1HA 2Z5UA 1B9MA 1H9TA 1HW5A 2OQRA 2ZJ2A 1P4AA 3E5UA 2ZO4A 5ERIA 3R4KA 3CUQB 3LWFA 4ESJA 5AONA 2HR3A 1ZYRF 1P6RA 3TOBA 2XVCA 1O3TA 5D6EA 3WGHA 3CLOA 2VE9A 1IRGA 1UHWA 3WTSC 4Q5SF 1YS7A 3GYHX 4CICA 3Q5FA 3JSPA 5D8KB 1J5YA 4BQAA 1A04A 4HX8A 5D8LB 1JGSA 2RDPA 1WWXA 5H6QA 2UXXA 2OU2A 3PQJA 3DXJF 1KQ9A 4ZYHA 4WX9A 2QBYA 1SAXA 2RN7A 3IHUA 1UFMA 1G3SA 4UNOA 4ZH4F 1USSA 5EEGA 4FX0A 4M73A 4A0ZA 3NQOA 3TDUC 5F64A 4HZFA 1SFXA 3BDDA 5CYVA 3ERED 1U5TB 4S05A 2F2EA 1YFHA 1H0MA 1BI2A 1T6SA 2KJBA 3J81K 5DUIA 1Z6TA 4KN7X 3EQLF 1KGSA 4NHJA 2A3SA 1J7KA 3KFWX 3I71A 4N0BA 3DFGA 2F5DA 3GFLA 4ETSA 2VC0A 1VTNC 4CYDA 1J75A 3JTHA 2K86A 4FT8A 2FEZA 4AVPA 3FZVA 4NQWA 1DP7P 2MLKA 5J6XA 2HEOA 2CO5A 3H3UA 2L01A 2O03A 2MC3A 4YG2F 1H9GA 2QBYB 1ZLKA 2IA2A 5LGNA 1YIOA 2KJCA 2UXNA 1FYLA 1R22A 3FM5A 1L3LA 4M9ZA 1FP2A 4HQMA 2M45A 2QYOA 1R1TA 3L7WA 1LVAA 5E1WA 3QP5A 3TOAA 2DO7A 4KN4X 1OMIA 2P6TA 3R0AA 1ONVA 3ELKA 1U3EM 3KEQA 3DP7A 4RGXA 1BIAA 3WG9A 4YIIA 5LEKA 3RKWA 1LQ1A 2NRAC 4LLNA 5HLIA 3JAMK 4HX4A 5CVUA 2COMA 2XASA 2XIGA 1ZRDA 3F8FA 3I4PA 2P5LC 4A6EA 3F8BA 4WXHA 4PGGA 3KLOA 2FSWA 1QPMA 2GA1A 1KYWA 2D2WA 2XV4S 1FZPB 4Y13A 3TO6A 5HS8A 1ZHFA 6PAXA 3RJPA 2Z9OA 2XUBA 3DPLC 2TDXA 2ETHA 4OOIA 4KIBA 4Q47A 1MJAA 3B73A 4P9UA 1IXCA 3CUOA 3E5XA 2E1CA 4G8XA 1IN7A 5D6FA 5FD6A 4HW0A 2V1XA 5BPIA 2PMUA 3HSFA 2KKOA 3GF2A 1KQ8A 4H0EA 2ZMEA 1TBXA 3MWMA 2BYVE 5ILSA 5HOOA 1ZGJA 3F8NA 3I59A 1JE8A 4I01A 5FLXZ 5ILUA 2ZKZA 1XCBA 3MQ0A 5HS7A 5DCFA 4QLCU 4HYEA 4BNCA 1F9NA 4GGGA 2NYXA 4LMYA 1FLIA 3JSOA 1T98A 4BYYA 4ENMA 5DV5A 3C3WA 4PDKA 2ISZA 2KIFA 4IRHA 1EH7A 3ZMDA 3V7RA 5BS6A 1QO0D 2FNPA 4HDVA 4OMYA 3ZMZA 1DPUA 4OMZA 1D8JA 5D5XB 2A69F 4ESBA 4EV0A 2EFQA 5DDGA 2FQ3A 4KA4A 1FNNA 3FXUA 3K2ZA 4A2UA 4I02A 2W84A 1O3RA 2FNAA 5BMZA 3I59B 2DPUA 2XROA 1ZG1A 5FO5A 1IXRC 2ISYA 1ZRFA 2ZBKA 2PG4A 2M30A 2ADUA 2VBXA 1XCVA 5IT9Z 2MH2A 2JRTA 3BJAA 1R00A 3BPXA 5FB2A 4RB3C 1B1BA 2Q2EA 3TGNA 3EDPA 2ACJA 1QQIA 3BZ6A 3K69A 4YFKF 3T8TA 5AIPA 2XAJA 4A5MA 4ENKA 3ECHA 2K27A 3KCCA 1HW1A 1W7PD 2R7DA 2ZNYA 5H20A 4CO8A 3J7AO 4MNUA 2EV6A 1C0WA 2W24A 2CG4A 3HUGA 4GYIA 2QM3A 3BJOA 2W57A 4DQ2A 4WK8F 1T2KA 3HRSA 1J2XA 1S7AA 2RGVA 2HDCA 3E6BA 3F6VA 5E18F 5LHIA 4AIKA 1I6XA 3W6KB 2H27A 2Z33A 3L9FA 1Z7UA 1BC8C 3CJNA 4ZZDA 3KP7A 5BOXA 1MJ9A 1SD4A 3ZMUA 5K5OA 3K1PA 1F4KA 1PUEE 3Q9VA 2Q8KA 1OPCA 3ML6A 5CVIA 1O7LA 4UV9A 5DD8A 5ICCA 3F6OA 1BIBA 2P5KA 2QLZA 2A68F 4ESFA 1E17A 4EM1A 5E1XA 2MBFA 1IUYA 2VBZA 1TQIA 1IXSB 4M72A 5L3BA 4MQ9F 3LAPA 2A07F 2HKXA 4UXNA 3R6SA 1T39A 4CHUA 1ZG5A 2BV6A 3DPTA 3CO7C 1G6NA 4P5OA 3WTYC 3GX4X 4K2EA 2YPRA 4G7OF 2CGPA 1XSXA 2ZXJA 2EFPA 1IN5A 4L9NA 1IAWA 4HF1A 3S2WA 4U88A 5DYMA 1K79A 3ZQ7A 1O57A 2L54A 4MHGA 4MGRA 2FBKA 3F21A 4U0VA 1PP8F 1U6GA 4YFXF 4EM0B 1EV7A 4S04A 4RAYA 1O3QA 2LSOA 3GZ5A 4EVIA 3T8RA 2C6YA 5FFXA 4EQQA 2HS5A 3BOQA 2M87A 3GWZA 1UB9A 3HSEA 4LJZF 1U5TC 1FBQA 3R60A 3HIFA 1REPC 4GYGA 1GXQA 4B8XA 1XSDA 2IA0A 4XSXF 4KIFA 5E17F 2W25A 2W85A 4UVBA 1XN7A 2CW0F 4CZZA 3BY6A 3M8EA 3MZHA 2PEXA 4Y15A 2A6HF 3TDZC 3F23A 2P7VB 2VBWA 1I5ZA 5F6FA 4Q4ZF 4CGZA 2H09A 5A2QZ 3O6BB 1XB4A 3WTTC 5BPDA 5K5QA 2FE3A 3WTUC 2V1UA 1ZRCA 2H6CA 2UZKA 5TRDA 3GW2A 5CVVA 1JHFA 4G6DA 4BHPA 1J59A 4RGRA 3KE2A 2P6SA 1S8NA 1HSJA 2JT1A 1V4RA 2DT5A 3V7CA 1XGNA 1TQMA 1Z05A 2HYGD 3ABUA 3KP6A 3LSTA 4L9JA 1K7AA 1WKMA 2QVOA 3GFJA 3LQQA 2YX7A 3COAC 1UHMA 3ZP5A 4AIJA 3IRRA 1IF1A 3H3ZA 4P96A 2OQGA 3QAHA 3QPHA 5ED4A 3WODF 5F1RA 1NHAA 3JW4A 3GFMA 2GXGA 1MZBA 1BBYA 3MZYA 3P9IA 3O3KA 3E6CC 5ICGA 4GCVA 1ZN2A 2L4AA 4G7HF 5KVRA 1ON1A 2E7WA 1CF7A 1ZREA 3W6JB 2IT0A 5LRRA 4IHSA 5J8CA 2VOOA 4HF0A 1XGOA 3J80K 1BI1A 2HQNA 2V79A 3QP6A 3N97A 1GXPA 5TJJA 1I27A 2PN6A 3KEOA 5JFRA 4HF2A 1D5VA 1P4WA 4L5IA 3ABTA 4A12A 1TTYA 1ULYA 2EV0A 2GZWA 3FMQA 4OIRF 5LBQA 2CWEA 4YIFA 1RZ4A 2O6GE 1ZGAA 2OZUA 1U2WA 1I1SA 4EJTA 3DV8A 3TQNA 3FM3A 3J81Z 1XDUA 5L3CA 1J0RA 2OBPA 4HX7A 1R1VA 4RB1A 4Y17A 3LAJA 2E7XA 1CF7B 4WWCA 3VOEA 3QU6A 1FBUA 1B59A 1XMKA 4KFCA 3D5LA 1XGMA 2OZ6A 5HLHA 4KYWA 2A61A 3QPTA 2LF8A 2EFNA 3REOA 2ZNZA 2NNNA 2GWRA 1B9NA 5DEQA 3VFZA 5L3EA 1FYKA 1MKMA 2DBBA 2HOEA 2VONA 1TW2A 4M74A 2O61A 2H94A 3U2RA 3IKTA 4MEYF 5ICFA 2AXLA 1YO5C 2LNBA 4XLNF 2BEOA 4I2OA 3T1BA 3G3ZA 4R8HA 2YR2A 2P7CB 1SD6A 4G94A 3GO5A 4GXOA 1SD5A 1FC3A 2R3SA 2Y48A 3HRMA 4L9VA 1R23A 5LEJA 2PMHA 1XSVA 2GAUA 1YW8A 2FU4A 2LDUA 3I0TA 2HGCA 1G3TA 2FF4A 2XKOA 2STWA 2WV0A 3KP4A 3KZZA 3JAMZ 4CDGA 4EMSA 4N9IA 4R79A 3SXYA 3WTXC 1XD7A 4EJVA 3IWFA 2OD5A 4MEXF 2GQQA 2EB7A 4F7ZA 1PDNC 3I58A 1OYIA 4RGUA 3RPUA 1UCRA 2JTVA 3V8LA 3E97A 3BP8A 4M71A 2XKPA 4JK1X 1YTYA 3GFIA 2QQBA 2VN2A 1IN8A 3QU3A 3K0LA 2OAZA 2FRHA 3C1DA 2Y0MA 2MLGA 5JI6A 4EM2A 5HDNA 1R58A 3I64A 5D5VB 2ZMEB 3D0SA 2J5OA 3MAJA 4PGHA 3I54A 1E2XA 2QQAA 2RV8A 3P9CA 2R7FA 3BPVA 1CGPA 3WTWC 3WU0A 1R5HA 2Z99A 2XAGA 1GHCA 4D0PA 5AIQA 3QOPA 4ON0A 2FOKA 1T0FA 4MTEA 4NB5A 1K78A 3EYYA 3WGIA 3RYRA 4ZYDA 3T5XA 1RIOH 2DK8A 2KIMA 1HXDA 1DUXC 2EFOA 3KETA 4WCGA 3G73A 2NAZA 4EGYA 5HDGA 1Z91A 3PQKA 3SHFA 1S3JA 3TO7A 4LD5A 2CYYA 4U7BA 1IN6A 2G9WA 4QWQA 2EJRA 2XRNA 3M7GA 3VB2A 4CXFA 4KMUX 2IA1A 5LGTA 1FX7A 3WTVC 4A6DA 1ZG3A 3OOPA 4U7DA 1X3UA 4XLPF 3GEZA 2Q0OA 4OU0A 1BI3A 4UVAA 4LFUA 1FT9A 2HWVA 4LG0A 5IT3A 4HDUA 5FD5A 2PJPA 2Z3YA 1FWZA 4P9FA 4ENJA 3F8MA 3SFZA 4IXAA 2NS0A 3FMRA 2IPQX 2FBHA 3M8FA 2D45A 3LA2A 2X0LA 5KK1A 1OR7A 1B6AA 1HKSA 1YW7A 5D4RA 2FBIA 1K78B 3KP3A 3RYPA 1QGPA 4ASNA 3HHGA 5DD4A 5HS9A 3WTZA 2G7UA 5HVQC 4MTDA 4G7ZF 2P4WA 3VEPA 1BOAA 1FPQA 3U1DA 5ILVA 4EGZA 1G4DA 2HKOA 5CLSA 3ROUA 1P92A 3ZMSA 3NEUA 1KQ0A 3MCZA 2M1BA 3CUQC 1QZZA 1ODDA 3L00A 1BC7C 2STTA 4IPAA 2BGCA 3F22A 3M9AA 5E8IA 4PZJA 4M6YA 4KDPA 5LHGA 1LJ9A 4BHBA 1GVJA 4LG0B 1BN5A 2RQPA 3BROA 1RUOA 1ZARA 2PQ8A 3E6MA 4IVNA 5L3GA 2MA3A 2PFBA 2IJLA 2PI0A 4IJAA 5DUKA 1J9IA 4Q48A 2V1DA 5JR3A 3DEUA 2RVCA 1JXSA 4A0YA 5L3FA 1PP7U 4XSZF 3HRUA 3IL2A 1AOYA 2HTJA 3EETA 4LK1F 4N9HA 3R0JA 4BAYA 4I0BA 3L09A 2B0LA 5HDKA 1U5TA 5E20A 4U0YA 1U78A 2EK5A 2V9VA 3ULQB 4FX4A 3TO9A 3GXOA 4RAZA 1MD0A 4G9YA 1SMTA 5H6RA 4O6JA 2DI3A 2HYFA 2VODA 3IC7A 1SMYF 4KICA 2VC1A 2VOPA 2P8TA 1IRFA 5FFZA 3CTAA 4M9SA 2YX4A 5CVRA 1FYMA 3QRFF 2ESNA 1W5SA 2G7HA 4HV5A 5E8GA 1WSUA 1QNTA 3N4MA 3V4GA 1D8KA 4O5VA 4GO1A 2VXZA 2J5PA 4WXDA 3IRQA 4OIQF 2EA4A 1OYWA 2XAFA 2QUFA 2P5VA 3RKYA 2XAQA 4KNYA 2K4BA 1Z1DA 3FWEA 1FOKA 3RDIA 2WWYA 4Z2YA 2LF7A 3HOTA 2WTEA 4IRGA 3GUDA 2ELHA 3C18A 3IWZA 5LGUA 2AS5F 4ZZLA 1L0OC 2A5YB 2JPCA 1W7PA 3K1MA 4M9XA 5LHHA 2Y75A 1Z6RA 2HTSA 1BM9A 3F8CA 5LRSA 1TNTA 3DQVC 2O8XA 2UWMA 3GVAA 3FF5A 4P55A 4IRIA 1YLFA 1TNSA 2YSRA 3HTUA 5ICEA 1RUNA 1HKTA 2KRFA 3KLNA 2E1NA 2FXAA 4DNCA 1S6LA 1MDMA 1Y0UA 1TQPA 1OKRA 4XBFA 4KUMA 4HLYA 4MQVA 3AAFA 1FSEA 3T0YA 4HV6A 2RC4A 3I5UA 3HHHA 3K1NA 2PBIA 1Q1HA 3ISPA 2VBYA 3HSRA 5JVTA 4O3MA 2DU9A 1WI9A 3LQRA 2V6CA 4EJOA 2O0YA 4EJUA 5FLXK 3WU1B 3B02A 3RKXA 1P2FA 3MFKA 1KU7A 5D4SA 4HA8A 3RTRA 5L3DA 1W7PB 1LB2A 3WE3A 2M8EA 2DW4A 3PFIA 5D5WB 1LDDA 1P4XA 2MD5A 3MEXA 4TV7A 4B09A 4BH9A 1LNWA 4A5NA 2HFHA 1I1GA 3HOSA 2F5CA 1RI7A 4LK0F 4U0WA 1G3WA 1FBSA 5FGMA 4RB2C 1T38A 2K02A 4BXUA 1MDMB 4RB0A 4FHTA 5CJ9A 4RS8A 3SZTA 1HSTA 1Z9CA 4YFNF 2DQRA 1MGTA 4IHTA 2ZFWA 1LDJA 1DDNA 1K6OA 1BI0A 1HKQA 2F5FA 1KU3A 1QZYA 3U9GA 4UHTA 4HBLA 3RIRA 1F5TA 3J80Z 1YYVA 1IZ1A 1KU9A 2MH9A 3LA3A 2LKPA 2VT3A 3GLXA 3ZMTA 3FXRA 5IT9K 3RI4A 1RNLA 3CDHA 2QZ8A 1R7JA 1SD7A 2QQ9A 5E1ZB 2BE5F 3I53A 2QENA 2D1VA 2DQLA 1D3YA 1QBJA 2EFWA 1W5TA 4KT5C 1ZLJA 1U8RA 4HLXA 4KMFA 3GZ6A 4G6QA 3RPQA 2FA5A 4HQEA 2A6EF 3ZN1A 4PCQA 3NRVA 5LLQA 1FY7A 2HZTA 3HTSB 1FSHA 1YW9A 2X4HA 2IVMA 5HLGA 2ZCWA 1KA8A 3FXQA 4ZYEA 4E70A 3F72A 1R1UA 1V3FA 1YQAA 1FP1D 5K1YA 1DPRA 5CVJA 3OV8A 3R61A 2H6BA 2L02A 2M5WA 1ZH5A 2L4MA 4HOBA 3ZMVA 3EUHA 1BJAA 1HQCA 2DLLA 4UUVA 2K7LA 4WF2A 4I09A 2FMYA 2ESHA 4LLLA 5EEHA 4L5JA 2IW5A 2JSCA 1MJBA 1SFEA 1B4AA 1LEAA 3HYIA 1R5GA 1SFUA 1XDSA 2XHKA 3C7JA 4EJWA 3K9TA 2EWNA 2DFIA 4M6XA 4OINF 3VODA 2OA4A 2XAHA 3P7NA 1G3YA 3H92A 4L9TA 2EV5A 3KZYA 4AWXB
chains in the Genus database with same CATH superfamily
3DTKA 4XONA 3KP5A 2NNYA 1R49A 1IN4A 3JRBA 1D1CA 1K4SA 2CQXA 2FMLA 1F1ZA 3NAUA 2ELKA 3ECOA 1ZAOA 4I7HA 3WGGA 1LE8A 3CDLA 3L2CA 1AWCA 4DJAA 5JVGF 4BEHB 4JBAA 3SZPA 4XLFA 1HW2A 1APLC 2CFXA 4OAZA 1ON2A 3FXMA 3ERMA 1I3AA 1S9HA 1R4NB 5J3LA 3I55I 4OIPF 2GA2A 3G4SI 1MNDA 2KZVA 3HEFA 3GTPJ 4JQFA 2PJRA 1TWCJ 2RQQA 4MIMA 2UV1A 1SANA 3CMYA 1IRXA 1V5EA 1YS6A 2F5EA 3L2QA 3HPGA 1WQ2A 3FHZA 2RNJA 1DP3A 2DAOA 3SYTA 1X3WB 3E3VA 2UUZA 4QTRA 4ZYGA 3FX3A 1VQOI 3LA7A 2IXSA 3HOWJ 2JPBA 4A0XA 4BHCA 3CO6C 3H9QA 1ZQ3P 2IRFG 1KU2A 1OFCX 3JRGA 2XF6A 5B3SH 1G8XA 3GTGJ 3HOYJ 1IW7F 3WE2A 2OCCH 4R1HA 2KIUA 4XRFA 5EZHA 3O2PE 1KYZA 1WH7A 3LFKA 2Y2ZA 5J8FA 2V26A 3SQNA 5DCMA 3ZN0A 1YG2A 5D5UB 1QZEA 3JTGA 2E2IJ 5BQTA 2L3DA 2HQRA 2JA2A 3P9KA 3KEYA 1WHUA 1XMAA 5B1BH 2XDVA 4HRIA 2JA6J 5CPRB 2GXBA 3EYIA 2WC2A 2VUMJ 2BBYA 3BR0A 4LB6B 2X1CA 3TBIA 3TKYA 1QU3A 1YIJI 2DYRH 2DTRA 2ID6A 2EA2A 3FMSA 4WXCA 3K70C 2HU9A 4LB5A 2YU3A 3DKWA 3L1PA 1HBXG 1RKTA 2E1MB 1W4MA 2VT2A 2RKHA 1WRJA 2JZYA 3V7SA 4L0ZB 3BG7A 2DPDA 4LLGF 1D1BA 2LMDA 4UVCA 1AHDP 2VKVA 3M1EA 3BWGA 4XRSG 3CUQA 3DF8A 1LDKB 5HLTA 3CP8A 1A35A 2K4JA 2QGUA 3FDYA 2DFHA 3IKVA 1XPXA 3BJ6A 2DK5A 4ENNA 1LE8B 2V9KA 5FLMJ 3V8KA 1USTA 2XGXA 3KP2A 4ZC3A 4LGWA 5JHUA 3TP3A 5A2QK 3J7YJ 4IF4A 4OIOF 2RAEA 1B72A 4RGSA 1S7OA 2IP2A 2V4JC 3V8JA 5IOYA 1R36A 2HZDA 2EPFA 3E1SA 4X0GA 1XGSA 4YRVA 2PJRB 3HM5A 1P7JA 1EH8A 3LMMA 4F55A 3HRTA 3GTJJ 1O7FA 2GIVA 2QWWA 2O3FA 1LEBA 2QSGX 1GVDA 4AIHA 1Y8QB 1QRYA 1S29A 5K5RA 2LY9A 3Q9SA 4L18B 2VE8A 2CSOA 3HZJA 2CQKA 1STZA 3BG6A 4A3GJ 4XLHA 2XC7A 4AD9A 1JHHA 5CKTA 2CJJA 2JRMA 4KIGA 3DBLB 1EH6A 4I98B 4HAMA 1EF4A 1TC3C 2PLYA 3F3XA 3E6DA 1MMDA 1TLHB 1TW3A 1OYYA 3ZPLA 3PIPF 2LY2A 4L0YB 3HPHA 4I0AA 4B1RA 1O3SA 3A2KA 1MIJA 3QODA 4E7LA 5DCMB 2V6EA 2COBA 1R5ID 2CV0A 4UV8A 1FTTA 3E5QA 4ZDPA 2KP6A 1QVTA 2D1HA 1W36C 1OCCH 2B9SA 1YITI 2Z5UA 1B9MA 1H9TA 4DZPA 1HW5A 1NK3P 2OQRA 2ZJ2A 1P4AA 1EKEA 5EGOA 2YU9J 4C3HJ 3C2HA 3E5UA 2ZO4A 2DA1A 3DLLF 1D0YA 5ERIA 3R4KA 3V42A 4DGWB 2WAQN 3CUQB 3LWFA 2ME0A 5K7HA 5AONA 2HR3A 4ESJA 1ZYRF 1P6RA 3TOBA 2XVCA 1O3TA 2Y31A 5D6EA 1OISA 2FD5A 4RAGA 3WGHA 3CLOA 3OWTA 3HB9A 2QKMB 3H3VK 4HNVA 4A69C 2L9RA 3S3NA 2VE9A 1IRGA 1UHWA 3WTSC 4Q5SF 1YS7A 4XRSA 3GYHX 3K4JA 4CICA 3Q5FA 1B72B 3JSPA 3LNQA 2KDZA 5D8KB 1J5YA 4BQAA 1A04A 5TGTA 3VDXA 2Z16A 4HX8A 5D8LB 1LPQA 1JGSA 2RDPA 2XSDC 1WWXA 5H6QA 2UXXA 1IO2A 4I76A 4XL9A 1Z77A 2OU2A 2VQLA 3H0DA 3PQJA 2WAEA 2NS8A 1Y0NA 1DU6A 3DXJF 1KQ9A 3RPUD 4ZYHA 3ABMH 1FIPA 4WX9A 2QBYA 1SAXA 2KLOA 2RN7A 3IHUA 1MSFC 1UFMA 1G3SA 2DCEA 4II2A 4UNOA 4ZH4F 4D9JA 4E4HA 4Z6YA 1USSA 4IZZA 5EEGA 4XIDA 2GOMA 4FX0A 4M73A 3NQOA 4A0ZA 3TDUC 5F64A 4HZFA 1SFXA 3BDDA 1SEUA 3FBIB 5CYVA 3G1MA 1KONA 1VQ4I 3BT9A 1QHHD 1TWGJ 3ERED 1IC8A 2JSPA 1U5TB 2EIJH 2F2EA 4S05A 1YFHA 5EGOB 1H0MA 4OAYA 4EEFG 1BI2A 2LRDA 1YRNA 3D5RC 1T6SA 2KJBA 2DOEA 2QQ8A 5M5YJ 3J81K 3KYDB 5DUIA 1Z6TA 4KN7X 3EQLF 1KGSA 4NHJA 2A3SA 1J7KA 3ZQIA 3KFWX 1V5GA 4RM2A 4M3BA 3I71A 2HQAA 2E2JJ 3SZGA 2DFFA 4N0BA 3DFGA 2F5DA 2PMZA 3GFLA 4ETSA 2VC0A 1VTNC 4CYDA 1J75A 3H36A 3JTHA 2LD5A 2K86A 2R7QA 1ZELA 3RQIA 4FT8A 2FEZA 4AVPA 2WA0A 2VIXA 5C44J 3FZVA 4NQWA 1DP7P 2DDAA 2MLKA 5J6XA 1X1BA 4AC0A 2HEOA 1I3QJ 2CO5A 1UJ8A 5C4JJ 3H3UA 3HOXJ 2L01A 2VJIA 2O03A 2MC3A 4YG2F 1H9GA 2QBYB 1ZLKA 2DMPA 2IA2A 5LGNA 1YIOA 1ETVA 2IGOA 2KJCA 2UXNA 5JLXA 1FYLA 5E3LA 1MW7A 1R22A 4GFBA 2TRTA 3FM5A 5IP9J 1ZGWA 1L3LA 4M9ZA 1FP2A 1X19A 4HQMA 2M45A 4ZTFA 2HPIA 2QYOA 1R1TA 1S7EA 3L7WA 1LVAA 5E1WA 3A01A 5F1JA 3QP5A 4XMYA 4Y3OA 3TOAA 2DO7A 4KN4X 1OMIA 2P6TA 4XN3A 2K5CA 3R0AA 3CC7I 2HQ5A 1ONVA 3ELKA 5DTDA 1U3EM 3KEQA 1I6HJ 3DP7A 4FE7A 3P5JA 1BIAA 4RGXA 5F04A 4A3CJ 3WG9A 4YIIA 5LEKA 3LSRA 3RKWA 1TWAJ 3OYCA 4IOCF 1LQ1A 2NRAC 2EIMH 4XOPA 4LLNA 5HLIA 3JAMK 3IAM2 4HX4A 5CVUA 4L5EA 2COMA 3H5RA 2XASA 2XIGA 2ZFUA 2K9LA 3WHBA 2CRGA 3AKZA 1ZRDA 5GAGJ 3F8FA 3I4PA 3H35A 3OR2C 5KAIC 3L2UA 2P5LC 2OPTA 2MW8A 3BTJA 1SVLA 4IQ4A 3K70D 2W48A 4C2MJ 4HG2A 3OYBA 1SVOA 2VB6A 4NQWB 2CV2A 4A6EA 5E3OA 3F8BA 4WXHA 3JCUC 3K10A 5CQEA 3U21A 3KLOA 3QYFA 4PGGA 5FROA 2FSWA 1QPMA 4XN0A 5B1AH 5GAEJ 3EUKL 2GA1A 1KYWA 2D2WA 2OC6A 3FXLA 2XV4S 3FISA 1FZPB 4Y13A 2E19A 3TO6A 5HS8A 1H88C 4PJMA 5FKOA 2JA7J 1ZHFA 3HBLA 4B3XA 6PAXA 4PSWA 3RJPA 2XUBA 3DPLC 4HNTA 2Z9OA 1JI8A 2TDXA 2VL8A 2ETHA 3G1LA 4OOIA 4E7SA 4KIBA 4Q47A 1MJAA 3VSKA 4E7IA 3RQ4A 4BJ5C 1UG0A 3B73A 4P9UA 4BS9A 2LBFA 3A01B 4NC7A 2W82A 1IXCA 4M6VA 5IYDJ 1SAUA 3CUOA 3DCFA 3E5XA 2K9SA 2E1CA 4G8XA 1IN7A 1BJZA 4V2FA 5D6FA 2YUSA 5FD6A 3BG3A 1MH3A 3G6EI 4HW0A 3ZQCA 2V1XA 2L7FP 3KIOA 5BPIA 2PMUA 3HSFA 4IHXA 2KKOA 2LR8A 4CA0A 3GF2A 1KQ8A 4H0EA 2ZMEA 3DBRB 1TBXA 1V5FA 3MWMA 3CJQB 5EDNA 1YX3A 2NOGA 2BYVE 4NDLA 1XMXA 2KIQA 5ILSA 5HOOA 1ZGJA 3F8NA 4A3MJ 4C2TA 3I59A 1JE8A 1FOYA 2H8RA 2DA2A 4I01A 4JX6A 5FLXZ 3ZCOA 5ILUA 2ZKZA 1XCBA 2M7BA 3MQ0A 5HS7A 1W36D 5J1YA 5DCFA 1RPWA 3ESWB 4QLCU 1QHGA 3BR5A 4HYEA 4BNCA 2X1EA 2MFZA 3SFIA 3ZQFA 3AL0C 1F9NA 4GGGA 2NYXA 4B47A 1SC7A 4LMYA 1Y39A 3JSOA 2GXAA 2O5RA 3OYEA 4BDZA 1T98A 1FLIA 4BYYA 2BW3A 3IH2A 4BJTA 4ENMA 2HDDA 5DV5A 3C3WA 3BQZA 4PDKA 3IP4B 3I56I 4IHVA 2VASA 3JRAA 2E2HJ 1OCZH 1N77A 2KIFA 2ISZA 4IRHA 1EH7A 5E79C 3GBGA 3ZMDA 3V7RA 5BS6A 5F08A 5F0HA 2EIKH 4PFOA 1JT6A 1YHQI 1QO0D 2FNPA 3MKYB 4HDVA 4OMYA 1N25A 3ZMZA 5H2FC 1OCOH 4OMZA 1LFUP 1D8JA 1DPUA 5D5XB 4C2UA 2A69F 1RR7A 4ESBA 2R93J 2LBFB 4B44A 4EV0A 2EFQA 2CUJA 2MC4A 2X6YA 1G59A 2HVSA 5DDGA 2FQ3A 2IAIA 4ZTJA 3PJRA 4XRMA 4PFPA 5KHDA 4KA4A 1RETA 1FNNA 1D0ZA 5IP6A 2BY2A 3JRDA 3IUOA 5J4YA 4MLOA 4PJ0C 3BCBA 2WY8Q 1POGA 3FXUA 3K2ZA 2AHQA 4A2UA 4I02A 2W84A 3L2VA 3FXOA 5BNGA 1O3RA 2BOLA 1X2MA 2FNAA 5BMZA 2L7KA 1IRZA 2HYJA 1LKXA 3BQYA 1QPIA 3I59B 4BJ6C 2DPUA 4BDYA 2XROA 1ZG1A 1WCMJ 3BC8A 5FO5A 1IXRC 4LOCA 3S17J 2L0KA 2E60A 2ISYA 1ZRFA 2L7MP 2ZBKA 2PG4A 3CCMI 3CC2I 2M30A 1NK2P 2ADUA 2VBXA 1VQ6I 2M7AA 3OYDA 2Z1DA 1XCVA 1ACIA 5IT9Z 1OCTC 2BW3B 2MH2A 2JRTA 2Q1ZB 3BJAA 1R00A 4OWRB 3A4CA 3BPXA 3FK7A 1B1BA 2Q2EA 4XQFA 5FB2A 4RB3C 2KZGA 2X6XA 3TGNA 3EDPA 2ACJA 2OTJI 1QQIA 4C30A 2NXNB 2M8GX 3BZ6A 3K69A 1S72I 4YFKF 3T8TA 3HC7A 3G71I 2KHMA 2XAJA 5AIPA 4A5MA 4ENKA 3ECHA 2HNHA 4NUBA 2X48A 3GTMJ 1MBJA 2K27A 4BQOA 2R7UA 3KCCA 4BBRJ 1HW1A 3OSFA 1W7PD 2E71A 2ZXWH 4X6AJ 2NVTJ 2CU7A 2R7DA 2ZNYA 2H8WA 5H20A 4PUSA 2E1MC 2K40A 4CO8A 4F91B 3J7AO 4MNUA 3DWLE 2JA5J 2EV6A 1C0WA 2W24A 2CG4A 3HUGA 4GYIA 1AA7A 2EZLA 3J7ZI 1I50J 1OCRH 2QM3A 4PK4A 3BJOA 3CCJI 2W57A 1LUJB 2LH9A 2QSHX 4DQ2A 3GMEA 4WK8F 5IP7J 3OSGA 1T2KA 3HRSA 4NC8A 4XR6A 2Z2SB 1J2XA 1S7AA 2DYSH 1JKPC 1FMVA 3M07A 2RGVA 1CQTA 2MD0A 1YE9A 1TZLA 2CW8A 1GLNA 3NARA 2HDCA 5DM6F 3JREA 3CD6I 3E6BA 3F6VA 5E18F 5LHIA 1FTZA 4AIKA 1I6XA 3W6KB 2PX9A 3M1CA 2P0WA 1E0EA 4XKBA 3QWLA 2H27A 2Z33A 3L9FA 3CCSI 4V19K 1Z7UA 1BC8C 1X3ZB 2F4IA 5K7ZA 3ASOH 3CJNA 3FHNA 4XLAA 2IGMA 4ZZDA 3KP7A 1P9QC 1M1EB 5BOXA 3TMOA 1OR7C 2FUG2 5B5EC 4FE4A 1MJ9A 4FTHA 1SD4A 3ZMUA 5K5OA 1JUSA 4BXFA 1VZ0A 3K1PA 4BE1A 1SFOJ 1F4KA 1PUEE 1I39A 3E7LA 4AWXB 2A05A 3Q9VA 2Q8KA 1OPCA 3ML6A 5CVIA 1O7LA 4UV9A 5DD8A 5ICCA 5LD2C 2JMWA 2L9NA 3F6OA 1S5LC 2JUGA 1BIBA 2Q2EB 5J4VA 1WZ2A 2P5KA 2QLZA 2A68F 4DYCA 4ESFA 5K7FA 1E17A 2K3FA 4EM1A 4C9YA 5E1XA 4CUGA 3OS0A 2MBFA 3OYKA 3BR3A 1IUYA 2VBZA 1HDPA 5EYRA 2R7XA 1TQIA 1K4TA 5FKKA 1IXSB 4M72A 5HNFA 5L3BA 3BZCA 4MQ9F 5J1UA 3LAPA 2KMUA 2A07F 4BQNA 4A3EJ 1N78A 4UB6C 2HKXA 4UXNA 1U8BA 4HSTA 2XGDA 3JRHA 3OMYA 2DODA 1W5CC 3R6SA 1ETKA 1T39A 4CHUA 1ZG5A 2BV6A 1JUPA 1MNEA 2DT7B 3HUGB 4QPOA 3DPTA 3VPRA 3CO7C 3ZGKA 1G6NA 3I4NJ 4P5OA 3S3MA 4DYRA 3WTYC 3GX4X 1OQYA 2QCOA 4K2EA 3S2DJ 4PSXA 2DA7A 2K85A 2YPRA 2MGQA 4G7OF 2CGPA 2R5ZA 1XSXA 2ZXJA 2EFPA 1IN5A 4L9NA 1IAWA 2VI6A 2CUZA 4C3JJ 4HF1A 4LG3A 2Y69H 5KNLA 3S2WA 4UB8C 4U88A 1LFBA 4JX5A 5DYMA 1K79A 3OIQA 4I99C 1BL0A 4UY8I 3ZQ7A 4N4OB 4KT6A 1O57A 2K9QA 4ABZA 2EQRA 2L54A 4MHGA 4MGRA 2FBKA 3F21A 3S14J 4U0VA 1PP8F 1UELB 1U6GA 4YFXF 2K9NA 2DJNA 4EM0B 1EV7A 4S04A 2R7OA 3G2BA 1ZK8A 2DJIA 4BQQA 4A3IJ 4RAYA 1O3QA 2LSOA 3GZ5A 3H9GA 5JHFA 1FJLA 4J00A 4EVIA 1X2NA 3T8RA 2C6YA 4BE0A 2GOXB 5FFXA 2CV1A 4EQQA 2HS5A 2ZJPF 3BOQA 2M87A 4D7NA 5HNHA 3SEQA 3D1NI 1J09A 3GWZA 1UB9A 3HSEA 4II3A 4LJZF 1U5TC 1FBQA 3R60A 3HIFA 2R5YA 1REPC 5E3MA 4GYGA 4F93B 1TT0A 1GXQA 4B8XA 2F5VA 1XSDA 2IA0A 3TL4X 1MMGA 4BBSJ 4XSXF 3LSPA 3D5SC 2M34A 4RAFA 4KIFA 2ZC2A 5E17F 2W25A 2R92J 2W85A 4UVBA 1XN7A 3S32A 2CW0F 4M3GA 4CZZA 4GDFA 3BY6A 1Y56A 3M8EA 1Y1VJ 3ABKH 3ABLH 3MZHA 2PEXA 4Y15A 2HDWA 3PSIA 2A6HF 2XAUA 2LP0A 3TDZC 3F23A 3GCMA 4MO7A 2P7VB 2VBWA 1I5ZA 2I10A 5F6FA 3U1KA 2W1OA 4Q4ZF 4CGZA 3Q0WA 2R5ZB 1WVRA 1YX5A 2H09A 5EJCA 5A2QZ 3O6BB 4ZDLA 4CSWA 1XB4A 3Q0VA 3WTTC 4BKXA 4ANJA 2ZB9A 4D1QA 5BPDA 1N75A 3WG7H 5K5QA 1MBGA 2FE3A 5FRNA 1IG7A 3BTCA 2LOOA 3MZ8A 3WTUC 2EH3A 2V1UA 1BA5A 1ZRCA 2H6CA 4B3AA 2UZKA 5TRDA 2XGEA 3GW2A 4IKFA 4AU7A 2X6WA 5LFAA 5CVVA 4MFEA 1JHFA 4G6DA 4BHPA 1J59A 3S1RJ 4RGRA 3KE2A 2ECBA 2P6SA 1S8NA 2BXYA 1HSJA 2JT1A 1V4RA 2DT5A 3KZIC 4W1UA 3OYIA 2XPWA 4IX7A 4LITA 3ONQA 3V7CA 1ZR4A 1U0JA 3A0HC 1XGNA 4M3EA 1TQMA 1Z0XA 2TCTA 1Z05A 2HYGD 3ABUA 4ZYAA 3KP6A 3LSTA 1X58A 3ZXSA 4L9JA 1K7AA 1WKMA 2QVOA 5EF6A 3GFJA 2CQ7A 3LQQA 3CCRI 2EZIA 2DXIA 3C2BA 4G12A 3GTKJ 2MABA 2YX7A 1SFKA 3W6VA 3COAC 1UHMA 3ZP5A 4AIJA 1UHSA 1BR2A 3PM1A 3PNYA 3IRRA 5GADJ 2M0CA 2Y0SA 1ZTRA 1TT5B 3QOEA 2R5YB 1IF1A 3H3ZA 1WJAA 1ETQA 4FETA 3ZQHA 2IS4A 4P96A 2OQGA 3QAHA 2JN6A 1R9TJ 3QPHA 3M3YJ 5ED4A 2I5UA 3WODF 3MKZA 4E6KG 1VQPI 5F1RA 3KYCB 4FISA 2DN0A 3S93A 4DZJA 1NHAA 3HG9A 4RMNA 4CYCA 3FK6A 2CQQA 3JW4A 2DA6A 1UMQA 3GFMA 2IS2A 2GXGA 2FX0A 1ORKA 2VPLA 1MZBA 4XORA 2MG4A 3S15J 1BBYA 2VJ4A 3H5AA 3MZYA 3P9IA 3O3KA 3E6CC 2CH0A 3A1YA 1EJ9A 3M8JA 1DGWY 2X1DA 4YIRX 5ICGA 4GCVA 1ZN2A 3MN2A 5EG0A 2F4OB 2L4AA 4G7HF 5KVRA 4AYBA 1ON1A 2E7WA 3DPUA 4QSHA 1CF7A 1NTCA 5E3NA 1ZREA 3W6JB 3AG3H 3HKZA 2IT0A 2JVHA 5LRRA 2R0QC 4IHSA 3LSIA 3QYBA 5J8CA 4A3KJ 2VOOA 3DEEA 5FKNA 1VF9A 2M0MA 2HOTA 3PO2J 2ICWG 4HF0A 1XGOA 5EEAA 1JGGA 3J80K 4YELA 1BI1A 1ETOA 2HQNA 2KISA 2V79A 3Q3SA 1JT0A 2JVGA 3QP6A 3A0BC 2LKXA 3LSJA 4AUXA 2LTPA 3N97A 1GXPA 2IS6A 5TJJA 1W0UA 1I27A 2PN6A 3KEOA 4E7ZA 5JFRA 3CMAI 4HF2A 2JUCA 1D5VA 1YRNB 1P4WA 4L5IA 2HVQA 2V7FA 1IJWC 1D0XA 3AFHA 2VKEA 3ABTA 3O8HA 1HLVA 2L2OA 5J47A 2GIZA 4A12A 1TTYA 3QQAA 2OJED 4BE2A 4CCMA 1VNDA 2HOSA 1O4XA 1ULYA 1WFXA 2EV0A 4Y33A 2GZWA 4QIWN 3FMQA 3LSMA 3HGGA 3A03A 1FMWA 4OIRF 5LBQA 2CWEA 5IY5H 4YIFA 1RZ4A 2A6TA 1BR1A 2O6GE 1ZGAA 2OZUA 2R7RA 1U2WA 1YJWI 3JRCA 1I1SA 4EJTA 3DV8A 3TQNA 3FM3A 1RKWA 2ZSHB 3J81Z 1XDUA 5L3CA 2JK3A 1J0RA 3TP0A 5GPCA 2OBPA 2RNGA 4HX7A 1R1VA 1A36A 1GV5A 4RB1A 3K2AA 2ID3A 2PMZN 4Y17A 1X1PA 1IV6A 1JJ6C 5EG0B 2QA4I 3LAJA 3ZQGA 2E7XA 1CF7B 4WWCA 3HDDA 3VOEA 3QU6A 1FBUA 2WB1A 1B59A 1XMKA 2M3AA 4KFCA 3D5LA 1XGMA 2OZ6A 2WY7Q 2DMTA 3HJEA 2KDOA 4FQGA 3OIOA 4CH7A 5HLHA 4KYWA 3JR9A 3I4MJ 1F36A 2AO9A 2A61A 2KT0A 3QPTA 1T33A 2LF8A 2EFNA 3LFUA 3REOA 4AYBN 2ZNZA 2NNNA 4NBQA 2GWRA 1B9NA 1X1AA 5DEQA 2E5ZA 3VFZA 5L3EA 3HKZN 1FYKA 1MKMA 2DBBA 2HOEA 2VONA 1K83J 1TW2A 4M74A 2XF7A 2O61A 2BHZA 1V54H 2H94A 3U2RA 3IKTA 4MEYF 2LREA 5ICFA 2AXLA 4UUSA 1YO5C 4FASD 2LLKA 2LNBA 4XLNF 2BEOA 2HVRA 2NVUB 4I2OA 3T1BA 3S1MJ 3G3ZA 4R8HA 2DA5A 2YR2A 2P7CB 1HC8A 1VI0A 3CZ6A 1HF0A 1SD6A 3VYSB 2GLOA 1MMSA 3BLYA 4G94A 3W2VA 3BR2A 3GO5A 4GXOA 5IPAA 1YJ9I 1SD5A 1FC3A 2R3SA 3OYMA 3KX2A 2Y48A 3HRMA 4L9VA 4BUPA 1R23A 3IV5A 1MMAA 1Z3XA 2NOJB 5LEJA 2PMHA 1XSVA 2GAUA 1YW8A 2FU4A 2LDUA 2VQHA 3OYHA 3I0TA 3H1CA 2HGCA 3PNVA 1G3TA 3PO3J 2FF4A 2XKOA 2STWA 2WV0A 3KP4A 3KZZA 1MBFA 3JAMZ 5F27A 3S2HJ 4CDGA 3CCEI 4EMSA 4N9IA 4R79A 2B63J 3SXYA 3WTXC 4IO9F 4A93J 3RKQA 1VQ9I 1W0TA 4PJLA 1XD7A 2ELJA 4EJVA 3IWFA 2OD5A 2WADA 4MEXF 2GQQA 2EB7A 4F7ZA 1PDNC 4IQJA 3TW7A 3I58A 1OYIA 1PUFA 2WBMA 1NG6A 4RGUA 3RPUA 1UCRA 2JTVA 4IEJA 4KJZA 2R7WA 3V8LA 3MKLA 3E97A 3BP8A 4M71A 2XKPA 4JK1X 1YTYA 3GFIA 2QQBA 5FLVA 1GDTA 1HCRA 4F3QA 2VN2A 3CP2A 1IN8A 2L7ZA 1XG1A 2LFBA 3QU3A 3K0LA 2OAZA 2FRHA 4F52A 4NNJA 3C1DA 2Y0MA 3F9KA 2XPUA 2MLGA 5JI6A 3SJMA 4B4CA 4UUSB 3BCAA 1ETWA 2R7VA 4GRIA 4EM2A 4DIQA 4DBQA 5HDNA 1R58A 3I64A 5D5VB 2ZMEB 3D0SA 2J5OA 3MAJA 1JKQC 4PGHA 3I54A 1E2XA 2H1LA 2OF7A 2QQAA 2RV8A 1ETYA 1KZHA 2NVQJ 3P9CA 2R7FA 1E3OC 2IBDA 3CF2A 3L2WA 3EUHC 1K6YA 3BPVA 1CGPA 3ZOBA 3WTWC 3HOZJ 2NVYJ 3W2AA 3WU0A 4ITVA 1R5HA 2Z99A 1W1WE 2XAGA 3VWBA 1GHCA 3IH4A 4D0PA 1PVEA 5AIQA 3QOPA 2E36A 4DOZA 3WU2C 4ON0A 5GAHJ 2FOKA 1MBHA 5FJ8J 3GTOJ 1T0FA 4MTEA 5GPAA 4NB5A 4KITB 4YEJA 5M3MJ 1K78A 1VQLI 1DGRM 3EYYA 5C3EJ 3DU6A 3WGIA 3RYRA 1WGXA 3OYNA 1Q1VA 4ZYDA 3T5XA 3K7AJ 2I8DA 1RIOH 1XX5A 2DK8A 3S1QJ 2KIMA 1HXDA 1DUXC 2EFOA 3OR1C 3KETA 4NC6A 4WCGA 3G73A 2CUEA 2NAZA 2JJ7A 1PUFB 3CJRB 3CCLI 3QPLA 4EGYA 1T56A 5HDGA 1Z91A 3PQKA 3SHFA 1S3JA 3TO7A 2JA8J 4LD5A 2CYYA 3WHCA 4XICA 4U7BA 1IN6A 2G9WA 3QPSA 2EJRA 3IH3A 2XRNA 4QWQA 2JWTA 3M7GA 4ZDOA 3FBNB 2HOAA 1IDYA 1GV2A 3ASNH 4KMUX 3VB2A 2IA1A 4CXFA 5LGTA 2EBIA 2BXZA 2O8KA 1FX7A 3WTVC 4A6DA 1ZG3A 3OOPA 4M3DA 1X3UA 4U7DA 3CC4I 1OJLA 3J7AY 4E7KA 2OUMA 4D7MA 3DKYA 4XLPF 1HOMA 3VSLA 3GEZA 2Q0OA 5GP9A 4OU0A 3BTIA 1TL8A 3CCQI 2V1NA 4DBRA 1HDDC 4HPQA 1BI3A 1Y1WJ 3VYRB 4UVAA 4LFUA 1FT9A 2HWVA 4CCKA 5IYBJ 2AQFA 2E1OA 4LG0A 5IT3A 4HDUA 5FD5A 2PJPA 3G1OA 3OYAA 2Z3YA 1FWZA 4P9FA 4J01A 1WJBA 3JRIA 4ENJA 2F4MB 3PIOF 3F8MA 3SFZA 3DEWA 4IXAA 2NS0A 3FMRA 2IPQX 2FBHA 3M8FA 1A31A 2D45A 1SVMA 3LA2A 2X0LA 5KK1A 1OR7A 2LKSA 2QEXI 2BVLA 1B6AA 5GTHC 1HKSA 1YW7A 2XB0X 3E0JB 5D4RA 3CMEI 2FBIA 1K78B 3GTQJ 3KP3A 3RYPA 1TWFJ 1XC5A 4IHWA 1QGPA 4ASNA 3EUAA 3HHGA 5DD4A 5F0FA 2F48A 2XRLA 5HS9A 4A3DJ 3WTZA 4Y7NJ 2G7UA 5HVQC 4MTDA 2WAQA 4AVZA 4G7ZF 2P4WA 3I3LA 3GZNB 3VEPA 3BR6A 1BOAA 1FPQA 3QYEA 3U1DA 5ILVA 3HGYA 4EGZA 4HSRA 2OCEA 2R4GA 1G4DA 2HKOA 1QVUA 3K4NA 1MSEC 5CLSA 4H4KC 3ROUA 1P92A 3ZMSA 4FCYA 3UR3C 4QPQA 3NEUA 2K9MA 4XKVA 1KQ0A 2V9PA 3MCZA 2M1BA 3CUQC 1YI2I 2QF7A 1QZZA 1ODDA 3L00A 3S8PA 1EA3A 2M9HA 1AU7A 1BC7C 2M4KA 2XB5A 2STTA 1XTAA 4IPAA 3HOUJ 2IEKA 1RC9A 2BGCA 3JRFA 3KYLA 3F22A 2AQEA 3M9AA 5E8IA 2DA3A 4M6YA 4PZJA 4KDPA 3W3CA 5LHGA 3GLLA 1LJ9A 4BHBA 3LOCA 3BR1A 3CMMA 1GVJA 4E7JA 4LG0B 3DTIA 1BN5A 2VLAA 3B6AA 2RQPA 3BROA 2R7SA 5DM7F 1TP4A 1RUOA 3K4BA 1FIAA 4D5FA 3Q0UA 1ZARA 2PQ8A 2X51A 3E6MA 4IVNA 4B48A 5L3GA 2MA3A 2PFBA 1ETXA 1JTXA 2QKLB 2IJLA 2PI0A 2LC2A 4IJAA 5DUKA 3S1NJ 1J9IA 3NWSA 3HL2A 4Q48A 2ZXIA 2V1DA 5JR3A 3DEUA 2RVCA 3ZRGA 1JXSA 4A0YA 5L3FA 3AG4H 2DTZA 4DYQA 1PP7U 5JLWA 2GM4A 4XSZF 3HRUA 3IL2A 2IS1A 2QSFX 1AOYA 2HTJA 3EETA 1Z3YA 4LK1F 4N9HA 2DA4A 3R0JA 1JUMA 2KRHA 3HOVJ 2R7ZJ 1OLTA 2NVXJ 3VYUB 2E35A 2KFDA 4I0BA 4BAYA 3L09A 3OYJA 3RSNA 2B0LA 2M4GA 5HDKA 1PYVA 1U5TA 2LY1A 5TISC 5E20A 4U0YA 1U78A 2EK5A 2V9VA 3CF5F 3ULQB 4FX4A 3TO9A 3TW6A 3GXOA 4RAZA 3FIWA 2DT6A 1MD0A 4G9YA 3X2QH 4BY7J 1VQMI 3FXKA 2CS3A 2LG4A 2XGCA 1SMTA 1VQKI 5H6RA 2A5WA 4CCLA 4O6JA 2DI3A 4RLQA 2HXOA 2HYFA 2VODA 4Y52J 4HNUA 1PJRA 1QA6A 2BY1A 3IC7A 1RR8C 1VQ5I 4EATA 4A3FJ 1SMYF 2KQRA 4KICA 3HXLA 4RBOA 2O7OA 2ME6A 2VC1A 2VOPA 2P8TA 1DU0A 1IRFA 5FFZA 1YOVB 3PUFA 3CTAA 4M9SA 2Y30A 2YX4A 5CVRA 1FYMA 3DBHB 1LVKA 3N05A 5M5WJ 3PSFA 1WJFA 3QRFF 3OL3A 3GTLJ 2Y9YA 1WJEA 2GBYA 2ESNA 1W5SA 2G7HA 3ZR8X 4HV5A 5E8GA 3SDGA 1WJ5A 2BVMA 1WSUA 3K4MA 1QNTA 1IDZA 3N4MA 3V4GA 1D8KA 2HPMA 1Z67A 2W7NA 4O5VA 4GO1A 2VXZA 2J5PA 2BY0A 4WXDA 3IRQA 4OIQF 2EA4A 3TEDA 3CCVI 2ZXHA 1R4MB 1OYWA 3LSHA 4I6ZA 1FEXA 2XAFA 2QUFA 2P5VA 3RKYA 2K3PA 1X4PA 2XAQA 3H0GJ 2DMQA 4KNYA 4JP0A 2K4BA 1Z1DA 3FWEA 3K4LA 4LIVA 1FOKA 3RDIA 2WWYA 1E3HA 4Z2YA 2BY3A 2LF7A 3HOTA 2WTEA 2BHYA 3EPZA 3LSKA 4IRGA 4D5CA 4XK4A 3GUDA 2ELHA 3C18A 3IWZA 2HI3A 1VQNI 5LGUA 2AS5F 2EZHA 1RESA 2WAFA 2VPRA 4ZZLA 4M3FA 4RLFA 1L0OC 3L2RA 2A5YB 2W00A 2JPCA 4S0HB 1JJ8C 2VKHA 1W7PA 3K1MA 1ENHA 4XNFA 3KPHA 4M9XA 3K4KA 5LHHA 2Y75A 1R6RA 4G6TB 1Z6RA 3A02A 2HTSA 1BM9A 1H89C 3IAS2 3F8CA 5J1RA 1A6QA 5LRSA 3FXJA 1TNTA 3DQVC 3FKIJ 2OTLI 2O8XA 3BZKA 2UWMA 3GVAA 3FF5A 4IHYA 4P55A 3CJTB 4IRIA 4A3BJ 1YLFA 3OY9A 2CQNA 3SDBA 1TNSA 2YSRA 3HTUA 5ICEA 3OYFA 2XSJC 1RUNA 2KRFA 3KLNA 1HKTA 2E1NA 1ZR2A 2FXAA 4DNCA 1S6LA 3UNGC 4N4NB 1MDMA 1Y0UA 3CQZJ 3MKWB 1TQPA 4BY1J 1OKRA 4XBFA 4KUMA 1BR4A 1A6IA 4MQVA 4HLYA 3AAFA 2LVSA 3W2WA 1FSEA 3T0YA 4HV6A 2RC4A 3CLQA 3RZOJ 4U87A 3I5UA 3HHHA 2IGNA 3B6CA 3BG9A 3K1NA 2PBIA 1Q1HA 3ISPA 4V2GA 2F6CA 2VBYA 3HSRA 4KISA 1WI3A 4JX4A 4XM3A 5JVTA 4AIDA 5DS9A 1LFPA 2P81A 4O3MA 2DU9A 1WI9A 1X1DA 3LQRA 2V6CA 4EJOA 2O0YA 4EJUA 5FLXK 1G2HA 3WU1B 3B02A 1WPKA 3RKXA 1ITYA 2KL4A 4BACA 1P2FA 3MFKA 2LK2A 1KU7A 5D4SA 4CZCA 1NH3A 4HA8A 2O9LA 5B66C 3RTRA 1W7PB 5L3DA 2EINH 4Y4RA 5HODA 1LB2A 1V55H 3AG1H 1IGNA 3WE3A 4CYCB 3OIPA 2M8EA 1Y8RB 2DW4A 1BOBA 3PFIA 5D5WB 2CFOA 1LDDA 1BW5A 2IGKA 2ZJRF 3MVPA 4B43A 3OS1A 5F0CA 2Y0SN 1P4XA 1T8IA 2BZTA 2X9DA 2DMUA 2FJ1A 3K4CA 2MD5A 4DW6A 3CCYA 1IUFA 4A3JJ 3H9JA 4J19A 1WJCA 1UAAA 2VJJA 3DKXA 3MEXA 1FOXA 4TV7A 4B09A 1TWHJ 4BH9A 1LNWA 1T08B 4HEA2 4A5NA 2HFHA 4IL6C 4E7HA 4BXXJ 1I1GA 3I9V2 3HOSA 4UUTA 2F5CA 3ZQQA 1E3PA 1RI7A 4LK0F 3RZDJ 4U0WA 1G3WA 3DU5A 1FBSA 5FGMA 4RB2C 1T38A 2HXIA 2K02A 5J40A 4BXUA 4RA2A 1MDMB 4RB0A 4FHTA 5CJ9A 4RS8A 5M5XJ 3SZTA 1HSTA 1JKOC 1D5YA 1Z9CA 4YFNF 3PUBA 2LYCA 1YJNI 2DQRA 1MGTA 4IHTA 3AG2H 2ZFWA 2D5VA 1LDJA 1DDNA 1K6OA 1BI0A 1HKQA 1FOWA 2ECCA 1Z21A 2F5FA 3LL7A 4CCJA 1KU3A 1QZYA 3U9GA 4UHTA 4HBLA 3RIRA 3O8GA 1F5TA 2VQCA 2DDBA 3J80Z 1YYVA 3NWTA 2FQ4A 4XLCA 1VFCA 3CDIA 1IZ1A 1KU9A 4P1WA 1Y6IA 2MH9A 3LA3A 4AM3A 2VQGA 2E5NA 2LKPA 1U9OA 2R7TA 2VT3A 2JQ7A 5CQGA 3GLXA 1GT0C 2ZJQF 2N8GA 2ZMEC 3PNTA 1GUUA 3PL8A 1AKHA 4X1EA 3ZMTA 3M4OJ 2NS7A 3FXRA 5IT9K 2W4SA 1WJDA 5KAFC 3RI4A 1RNLA 1WH5A 2L9SA 2XF5A 2EILH 4IOAF 3DTEA 3OOUA 4W97A 4F92B 3BTLA 3CDHA 2QZ8A 1R7JA 1SD7A 1IV8A 2QQ9A 4JOMA 5E1ZB 1BW6A 2BE5F 2M2EA 1HA8A 3I53A 2QENA 4MFDA 2Y9ZA 2D1VA 2DQLA 2AXTC 4XOTA 1D3YA 2VKDA 2EFWA 2X85A 1W5TA 4KT5C 4CCOA 1ZLJA 3OYLA 1B8IA 1QBJA 1MNMC 1U8RA 4HLXA 2CMPA 4KMFA 3F0CA 3GZ6A 5IYCJ 2WV1A 5M3FJ 2DOAA 2VXDA 1JTYA 4G6QA 2DFEA 1A5JA 5GTIC 3RPQA 2FA5A 4HQEA 2A6EF 2CUFA 9ANTA 2G0EA 3ZN1A 4PCQA 4PJJA 3NRVA 5LLQA 1K61A 3MD2A 1FY7A 2HZTA 3C2GA 3MMYB 4PJNA 3HTSB 4RM3A 1YW9A 2X4HA 2WB1N 1FSHA 2IVMA 5FKLA 5HLGA 2ZCWA 3OL4A 3LSGA 1KA8A 1UZCA 3FXQA 2H1KA 4ZYEA 3PFYA 4E70A 3F72A 1Z7LA 1UG2A 5IOZA 1R1UA 3FKJA 3VYTB 1V3FA 1YQAA 3H5NA 1FP1D 2E34A 1F43A 2X6OA 5K1YA 1DPRA 4BEHA 1MMNA 1MH4A 4BGDA 2L9VA 1VQ7I 2L5QA 5CVJA 3OV8A 5C4XJ 3R61A 2H6BA 2L02A 2KRCA 2M5WA 4XLEA 1XS9A 1ZH5A 2RREA 1OCPA 4BL0B 3CCUI 2L4MA 4HOBA 3ZMVA 3EUHA 2CW7A 2B7EA 1DQUA 1BJAA 4A3LJ 1HQCA 2DLLA 2FOWA 3OYGA 4UUVA 1D1AA 2K7LA 1JKRC 2EZKA 1RRJA 4WF2A 1AKHB 1U9NA 2VJ5A 1R71A 3S16J 4I09A 2ZSIB 4LIUA 2KPMA 2FMYA 3AL0B 1NG7A 2ESHA 1P7IA 4LLLA 5EEHA 4L5JA 2IW5A 3RCOA 4RDUA 2JSCA 5KCMA 4CCNA 2OV7A 1MJBA 1SFEA 1B4AA 4ZJZA 4XKCA 2MSYA 1T95A 1LEAA 4C3IJ 3ZQLA 1VQ8I 5EZGA 3HYIA 3SEZA 3BG5A 1R5GA 2XPVA 2MYSA 1T0FC 4BU2A 1B8IB 5FRMA 1SFUA 2DMNA 4XKWA 3S3OA 1MBKA 1XDSA 2XHKA 3C7JA 1H8AC 1ZKGA 4EJWA 3K9TA 2EWNA 2DFIA 3DLAA 1ERDA 4M6XA 4OINF 2YS9A 3VODA 1MBEA 4JYKA 2OA4A 2XAHA 3P7NA 1G3YA 3UKGA 3H92A 3OS2A 4L9TA 1X4OA 1X1CA 2DOFA 2EV5A 3KZYA 3K6GA 5FKMA 3CESA
chains in the Genus database with same CATH topology
2NNYA 3KP5A 1IN4A 2FMLA 1F1ZA 3ECOA 1ZAOA 4I7HA 3WGGA 3L2CA 1AWCA 4JBAA 3SZPA 1HW2A 2CFXA 1ON2A 4OIPF 2GA2A 4JQFA 1YS6A 2F5EA 1WQ2A 3FHZA 2RNJA 2DAOA 3E3VA 4ZYGA 3FX3A 3LA7A 2JPBA 4A0XA 4BHCA 3CO6C 2IRFG 1KU2A 1IW7F 3WE2A 4R1HA 2KIUA 4XRFA 3O2PE 1KYZA 3LFKA 5J8FA 3SQNA 5DCMA 3ZN0A 1YG2A 5D5UB 3JTGA 5BQTA 2L3DA 2HQRA 3P9KA 1XMAA 2GXBA 3EYIA 2WC2A 2BBYA 4LB6B 3TKYA 4WXCA 2DTRA 2EA2A 3FMSA 4LB5A 2YU3A 3DKWA 1HBXG 1W4MA 2VT2A 2RKHA 1WRJA 2JZYA 3V7SA 4L0ZB 2DPDA 4LLGF 4UVCA 3M1EA 3BWGA 3CUQA 3DF8A 1LDKB 2K4JA 3IKVA 3BJ6A 2DK5A 4ENNA 3V8KA 1USTA 2XGXA 3KP2A 4LGWA 5JHUA 5A2QK 4IF4A 4OIOF 4RGSA 1S7OA 2IP2A 3V8JA 1R36A 1XGSA 1EH8A 3HRTA 1O7FA 2GIVA 2QWWA 2O3FA 1LEBA 4AIHA 1S29A 5K5RA 3Q9SA 4L18B 2VE8A 2CSOA 2CQKA 1STZA 4AD9A 1JHHA 4KIGA 1EH6A 4I98B 4HAMA 2PLYA 3F3XA 3E6DA 1TLHB 1TW3A 1OYYA 3ZPLA 4L0YB 4I0AA 1O3SA 5DCMB 4UV8A 3E5QA 2D1HA 2Z5UA 1B9MA 1H9TA 1HW5A 2OQRA 2ZJ2A 1P4AA 3E5UA 2ZO4A 5ERIA 3R4KA 3CUQB 3LWFA 4ESJA 5AONA 2HR3A 1ZYRF 1P6RA 3TOBA 2XVCA 1O3TA 5D6EA 3WGHA 3CLOA 2VE9A 1IRGA 1UHWA 3WTSC 4Q5SF 1YS7A 3GYHX 4CICA 3Q5FA 3JSPA 5D8KB 1J5YA 4BQAA 1A04A 4HX8A 5D8LB 1JGSA 2RDPA 1WWXA 5H6QA 2UXXA 2OU2A 3PQJA 3DXJF 1KQ9A 4ZYHA 4WX9A 2QBYA 1SAXA 2RN7A 3IHUA 1UFMA 1G3SA 4UNOA 4ZH4F 1USSA 5EEGA 4FX0A 4M73A 4A0ZA 3NQOA 3TDUC 5F64A 4HZFA 1SFXA 3BDDA 5CYVA 3ERED 1U5TB 4S05A 2F2EA 1YFHA 1H0MA 1BI2A 1T6SA 2KJBA 3J81K 5DUIA 1Z6TA 4KN7X 3EQLF 1KGSA 4NHJA 2A3SA 1J7KA 3KFWX 3I71A 4N0BA 3DFGA 2F5DA 3GFLA 4ETSA 2VC0A 1VTNC 4CYDA 1J75A 3JTHA 2K86A 4FT8A 2FEZA 4AVPA 3FZVA 4NQWA 1DP7P 2MLKA 5J6XA 2HEOA 2CO5A 3H3UA 2L01A 2O03A 2MC3A 4YG2F 1H9GA 2QBYB 1ZLKA 2IA2A 5LGNA 1YIOA 2KJCA 2UXNA 1FYLA 1R22A 3FM5A 1L3LA 4M9ZA 1FP2A 4HQMA 2M45A 2QYOA 1R1TA 3L7WA 1LVAA 5E1WA 3QP5A 3TOAA 2DO7A 4KN4X 1OMIA 2P6TA 3R0AA 1ONVA 3ELKA 1U3EM 3KEQA 3DP7A 4RGXA 1BIAA 3WG9A 4YIIA 5LEKA 3RKWA 1LQ1A 2NRAC 4LLNA 5HLIA 3JAMK 4HX4A 5CVUA 2COMA 2XASA 2XIGA 1ZRDA 3F8FA 3I4PA 2P5LC 4A6EA 3F8BA 4WXHA 4PGGA 3KLOA 2FSWA 1QPMA 2GA1A 1KYWA 2D2WA 2XV4S 1FZPB 4Y13A 3TO6A 5HS8A 1ZHFA 6PAXA 3RJPA 2Z9OA 2XUBA 3DPLC 2TDXA 2ETHA 4OOIA 4KIBA 4Q47A 1MJAA 3B73A 4P9UA 1IXCA 3CUOA 3E5XA 2E1CA 4G8XA 1IN7A 5D6FA 5FD6A 4HW0A 2V1XA 5BPIA 2PMUA 3HSFA 2KKOA 3GF2A 1KQ8A 4H0EA 2ZMEA 1TBXA 3MWMA 2BYVE 5ILSA 5HOOA 1ZGJA 3F8NA 3I59A 1JE8A 4I01A 5FLXZ 5ILUA 2ZKZA 1XCBA 3MQ0A 5HS7A 5DCFA 4QLCU 4HYEA 4BNCA 1F9NA 4GGGA 2NYXA 4LMYA 1FLIA 3JSOA 1T98A 4BYYA 4ENMA 5DV5A 3C3WA 4PDKA 2ISZA 2KIFA 4IRHA 1EH7A 3ZMDA 3V7RA 5BS6A 1QO0D 2FNPA 4HDVA 4OMYA 3ZMZA 1DPUA 4OMZA 1D8JA 5D5XB 2A69F 4ESBA 4EV0A 2EFQA 5DDGA 2FQ3A 4KA4A 1FNNA 3FXUA 3K2ZA 4A2UA 4I02A 2W84A 1O3RA 2FNAA 5BMZA 3I59B 2DPUA 2XROA 1ZG1A 5FO5A 1IXRC 2ISYA 1ZRFA 2ZBKA 2PG4A 2M30A 2ADUA 2VBXA 1XCVA 5IT9Z 2MH2A 2JRTA 3BJAA 1R00A 3BPXA 5FB2A 4RB3C 1B1BA 2Q2EA 3TGNA 3EDPA 2ACJA 1QQIA 3BZ6A 3K69A 4YFKF 3T8TA 5AIPA 2XAJA 4A5MA 4ENKA 3ECHA 2K27A 3KCCA 1HW1A 1W7PD 2R7DA 2ZNYA 5H20A 4CO8A 3J7AO 4MNUA 2EV6A 1C0WA 2W24A 2CG4A 3HUGA 4GYIA 2QM3A 3BJOA 2W57A 4DQ2A 4WK8F 1T2KA 3HRSA 1J2XA 1S7AA 2RGVA 2HDCA 3E6BA 3F6VA 5E18F 5LHIA 4AIKA 1I6XA 3W6KB 2H27A 2Z33A 3L9FA 1Z7UA 1BC8C 3CJNA 4ZZDA 3KP7A 5BOXA 1MJ9A 1SD4A 3ZMUA 5K5OA 3K1PA 1F4KA 1PUEE 3Q9VA 2Q8KA 1OPCA 3ML6A 5CVIA 1O7LA 4UV9A 5DD8A 5ICCA 3F6OA 1BIBA 2P5KA 2QLZA 2A68F 4ESFA 1E17A 4EM1A 5E1XA 2MBFA 1IUYA 2VBZA 1TQIA 1IXSB 4M72A 5L3BA 4MQ9F 3LAPA 2A07F 2HKXA 4UXNA 3R6SA 1T39A 4CHUA 1ZG5A 2BV6A 3DPTA 3CO7C 1G6NA 4P5OA 3WTYC 3GX4X 4K2EA 2YPRA 4G7OF 2CGPA 1XSXA 2ZXJA 2EFPA 1IN5A 4L9NA 1IAWA 4HF1A 3S2WA 4U88A 5DYMA 1K79A 3ZQ7A 1O57A 2L54A 4MHGA 4MGRA 2FBKA 3F21A 4U0VA 1PP8F 1U6GA 4YFXF 4EM0B 1EV7A 4S04A 4RAYA 1O3QA 2LSOA 3GZ5A 4EVIA 3T8RA 2C6YA 5FFXA 4EQQA 2HS5A 3BOQA 2M87A 3GWZA 1UB9A 3HSEA 4LJZF 1U5TC 1FBQA 3R60A 3HIFA 1REPC 4GYGA 1GXQA 4B8XA 1XSDA 2IA0A 4XSXF 4KIFA 5E17F 2W25A 2W85A 4UVBA 1XN7A 2CW0F 4CZZA 3BY6A 3M8EA 3MZHA 2PEXA 4Y15A 2A6HF 3TDZC 3F23A 2P7VB 2VBWA 1I5ZA 5F6FA 4Q4ZF 4CGZA 2H09A 5A2QZ 3O6BB 1XB4A 3WTTC 5BPDA 5K5QA 2FE3A 3WTUC 2V1UA 1ZRCA 2H6CA 2UZKA 5TRDA 3GW2A 5CVVA 1JHFA 4G6DA 4BHPA 1J59A 4RGRA 3KE2A 2P6SA 1S8NA 1HSJA 2JT1A 1V4RA 2DT5A 3V7CA 1XGNA 1TQMA 1Z05A 2HYGD 3ABUA 3KP6A 3LSTA 4L9JA 1K7AA 1WKMA 2QVOA 3GFJA 3LQQA 2YX7A 3COAC 1UHMA 3ZP5A 4AIJA 3IRRA 1IF1A 3H3ZA 4P96A 2OQGA 3QAHA 3QPHA 5ED4A 3WODF 5F1RA 1NHAA 3JW4A 3GFMA 2GXGA 1MZBA 1BBYA 3MZYA 3P9IA 3O3KA 3E6CC 5ICGA 4GCVA 1ZN2A 2L4AA 4G7HF 5KVRA 1ON1A 2E7WA 1CF7A 1ZREA 3W6JB 2IT0A 5LRRA 4IHSA 5J8CA 2VOOA 4HF0A 1XGOA 3J80K 1BI1A 2HQNA 2V79A 3QP6A 3N97A 1GXPA 5TJJA 1I27A 2PN6A 3KEOA 5JFRA 4HF2A 1D5VA 1P4WA 4L5IA 3ABTA 4A12A 1TTYA 1ULYA 2EV0A 2GZWA 3FMQA 4OIRF 5LBQA 2CWEA 4YIFA 1RZ4A 2O6GE 1ZGAA 2OZUA 1U2WA 1I1SA 4EJTA 3DV8A 3TQNA 3FM3A 3J81Z 1XDUA 5L3CA 1J0RA 2OBPA 4HX7A 1R1VA 4RB1A 4Y17A 3LAJA 2E7XA 1CF7B 4WWCA 3VOEA 3QU6A 1FBUA 1B59A 1XMKA 4KFCA 3D5LA 1XGMA 2OZ6A 5HLHA 4KYWA 2A61A 3QPTA 2LF8A 2EFNA 3REOA 2ZNZA 2NNNA 2GWRA 1B9NA 5DEQA 3VFZA 5L3EA 1FYKA 1MKMA 2DBBA 2HOEA 2VONA 1TW2A 4M74A 2O61A 2H94A 3U2RA 3IKTA 4MEYF 5ICFA 2AXLA 1YO5C 2LNBA 4XLNF 2BEOA 4I2OA 3T1BA 3G3ZA 4R8HA 2YR2A 2P7CB 1SD6A 4G94A 3GO5A 4GXOA 1SD5A 1FC3A 2R3SA 2Y48A 3HRMA 4L9VA 1R23A 5LEJA 2PMHA 1XSVA 2GAUA 1YW8A 2FU4A 2LDUA 3I0TA 2HGCA 1G3TA 2FF4A 2XKOA 2STWA 2WV0A 3KP4A 3KZZA 3JAMZ 4CDGA 4EMSA 4N9IA 4R79A 3SXYA 3WTXC 1XD7A 4EJVA 3IWFA 2OD5A 4MEXF 2GQQA 2EB7A 4F7ZA 1PDNC 3I58A 1OYIA 4RGUA 3RPUA 1UCRA 2JTVA 3V8LA 3E97A 3BP8A 4M71A 2XKPA 4JK1X 1YTYA 3GFIA 2QQBA 2VN2A 1IN8A 3QU3A 3K0LA 2OAZA 2FRHA 3C1DA 2Y0MA 2MLGA 5JI6A 4EM2A 5HDNA 1R58A 3I64A 5D5VB 2ZMEB 3D0SA 2J5OA 3MAJA 4PGHA 3I54A 1E2XA 2QQAA 2RV8A 3P9CA 2R7FA 3BPVA 1CGPA 3WTWC 3WU0A 1R5HA 2Z99A 2XAGA 1GHCA 4D0PA 5AIQA 3QOPA 4ON0A 2FOKA 1T0FA 4MTEA 4NB5A 1K78A 3EYYA 3WGIA 3RYRA 4ZYDA 3T5XA 1RIOH 2DK8A 2KIMA 1HXDA 1DUXC 2EFOA 3KETA 4WCGA 3G73A 2NAZA 4EGYA 5HDGA 1Z91A 3PQKA 3SHFA 1S3JA 3TO7A 4LD5A 2CYYA 4U7BA 1IN6A 2G9WA 4QWQA 2EJRA 2XRNA 3M7GA 3VB2A 4CXFA 4KMUX 2IA1A 5LGTA 1FX7A 3WTVC 4A6DA 1ZG3A 3OOPA 4U7DA 1X3UA 4XLPF 3GEZA 2Q0OA 4OU0A 1BI3A 4UVAA 4LFUA 1FT9A 2HWVA 4LG0A 5IT3A 4HDUA 5FD5A 2PJPA 2Z3YA 1FWZA 4P9FA 4ENJA 3F8MA 3SFZA 4IXAA 2NS0A 3FMRA 2IPQX 2FBHA 3M8FA 2D45A 3LA2A 2X0LA 5KK1A 1OR7A 1B6AA 1HKSA 1YW7A 5D4RA 2FBIA 1K78B 3KP3A 3RYPA 1QGPA 4ASNA 3HHGA 5DD4A 5HS9A 3WTZA 2G7UA 5HVQC 4MTDA 4G7ZF 2P4WA 3VEPA 1BOAA 1FPQA 3U1DA 5ILVA 4EGZA 1G4DA 2HKOA 5CLSA 3ROUA 1P92A 3ZMSA 3NEUA 1KQ0A 3MCZA 2M1BA 3CUQC 1QZZA 1ODDA 3L00A 1BC7C 2STTA 4IPAA 2BGCA 3F22A 3M9AA 5E8IA 4PZJA 4M6YA 4KDPA 5LHGA 1LJ9A 4BHBA 1GVJA 4LG0B 1BN5A 2RQPA 3BROA 1RUOA 1ZARA 2PQ8A 3E6MA 4IVNA 5L3GA 2MA3A 2PFBA 2IJLA 2PI0A 4IJAA 5DUKA 1J9IA 4Q48A 2V1DA 5JR3A 3DEUA 2RVCA 1JXSA 4A0YA 5L3FA 1PP7U 4XSZF 3HRUA 3IL2A 1AOYA 2HTJA 3EETA 4LK1F 4N9HA 3R0JA 4BAYA 4I0BA 3L09A 2B0LA 5HDKA 1U5TA 5E20A 4U0YA 1U78A 2EK5A 2V9VA 3ULQB 4FX4A 3TO9A 3GXOA 4RAZA 1MD0A 4G9YA 1SMTA 5H6RA 4O6JA 2DI3A 2HYFA 2VODA 3IC7A 1SMYF 4KICA 2VC1A 2VOPA 2P8TA 1IRFA 5FFZA 3CTAA 4M9SA 2YX4A 5CVRA 1FYMA 3QRFF 2ESNA 1W5SA 2G7HA 4HV5A 5E8GA 1WSUA 1QNTA 3N4MA 3V4GA 1D8KA 4O5VA 4GO1A 2VXZA 2J5PA 4WXDA 3IRQA 4OIQF 2EA4A 1OYWA 2XAFA 2QUFA 2P5VA 3RKYA 2XAQA 4KNYA 2K4BA 1Z1DA 3FWEA 1FOKA 3RDIA 2WWYA 4Z2YA 2LF7A 3HOTA 2WTEA 4IRGA 3GUDA 2ELHA 3C18A 3IWZA 5LGUA 2AS5F 4ZZLA 1L0OC 2A5YB 2JPCA 1W7PA 3K1MA 4M9XA 5LHHA 2Y75A 1Z6RA 2HTSA 1BM9A 3F8CA 5LRSA 1TNTA 3DQVC 2O8XA 2UWMA 3GVAA 3FF5A 4P55A 4IRIA 1YLFA 1TNSA 2YSRA 3HTUA 5ICEA 1RUNA 1HKTA 2KRFA 3KLNA 2E1NA 2FXAA 4DNCA 1S6LA 1MDMA 1Y0UA 1TQPA 1OKRA 4XBFA 4KUMA 4HLYA 4MQVA 3AAFA 1FSEA 3T0YA 4HV6A 2RC4A 3I5UA 3HHHA 3K1NA 2PBIA 1Q1HA 3ISPA 2VBYA 3HSRA 5JVTA 4O3MA 2DU9A 1WI9A 3LQRA 2V6CA 4EJOA 2O0YA 4EJUA 5FLXK 3WU1B 3B02A 3RKXA 1P2FA 3MFKA 1KU7A 5D4SA 4HA8A 3RTRA 5L3DA 1W7PB 1LB2A 3WE3A 2M8EA 2DW4A 3PFIA 5D5WB 1LDDA 1P4XA 2MD5A 3MEXA 4TV7A 4B09A 4BH9A 1LNWA 4A5NA 2HFHA 1I1GA 3HOSA 2F5CA 1RI7A 4LK0F 4U0WA 1G3WA 1FBSA 5FGMA 4RB2C 1T38A 2K02A 4BXUA 1MDMB 4RB0A 4FHTA 5CJ9A 4RS8A 3SZTA 1HSTA 1Z9CA 4YFNF 2DQRA 1MGTA 4IHTA 2ZFWA 1LDJA 1DDNA 1K6OA 1BI0A 1HKQA 2F5FA 1KU3A 1QZYA 3U9GA 4UHTA 4HBLA 3RIRA 1F5TA 3J80Z 1YYVA 1IZ1A 1KU9A 2MH9A 3LA3A 2LKPA 2VT3A 3GLXA 3ZMTA 3FXRA 5IT9K 3RI4A 1RNLA 3CDHA 2QZ8A 1R7JA 1SD7A 2QQ9A 5E1ZB 2BE5F 3I53A 2QENA 2D1VA 2DQLA 1D3YA 1QBJA 2EFWA 1W5TA 4KT5C 1ZLJA 1U8RA 4HLXA 4KMFA 3GZ6A 4G6QA 3RPQA 2FA5A 4HQEA 2A6EF 3ZN1A 4PCQA 3NRVA 5LLQA 1FY7A 2HZTA 3HTSB 1FSHA 1YW9A 2X4HA 2IVMA 5HLGA 2ZCWA 1KA8A 3FXQA 4ZYEA 4E70A 3F72A 1R1UA 1V3FA 1YQAA 1FP1D 5K1YA 1DPRA 5CVJA 3OV8A 3R61A 2H6BA 2L02A 2M5WA 1ZH5A 2L4MA 4HOBA 3ZMVA 3EUHA 1BJAA 1HQCA 2DLLA 4UUVA 2K7LA 4WF2A 4I09A 2FMYA 2ESHA 4LLLA 5EEHA 4L5JA 2IW5A 2JSCA 1MJBA 1SFEA 1B4AA 1LEAA 3HYIA 1R5GA 1SFUA 1XDSA 2XHKA 3C7JA 4EJWA 3K9TA 2EWNA 2DFIA 4M6XA 4OINF 3VODA 2OA4A 2XAHA 3P7NA 1G3YA 3H92A 4L9TA 2EV5A 3KZYA 4AWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NNY A;  3KP5 A;  1IN4 A;  2FML A;  1F1Z A;  3ECO A;  1ZAO A;  4I7H A;  3WGG A;  3L2C A;  1AWC A;  4JBA A;  3SZP A;  1HW2 A;  2CFX A;  1ON2 A;  4OIP F;  2GA2 A;  4JQF A;  1YS6 A;  2F5E A;  1WQ2 A;  3FHZ A;  2RNJ A;  2DAO A;  3E3V A;  4ZYG A;  3FX3 A;  3LA7 A;  2JPB A;  4A0X A;  4BHC A;  3CO6 C;  2IRF G;  1KU2 A;  1IW7 F;  3WE2 A;  4R1H A;  2KIU A;  4XRF A;  3O2P E;  1KYZ A;  3LFK A;  5J8F A;  3SQN A;  5DCM A;  3ZN0 A;  1YG2 A;  5D5U B;  3JTG A;  5BQT A;  2L3D A;  2HQR A;  3P9K A;  1XMA A;  2GXB A;  3EYI A;  2WC2 A;  2BBY A;  4LB6 B;  3TKY A;  4WXC A;  2DTR A;  2EA2 A;  3FMS A;  4LB5 A;  2YU3 A;  3DKW A;  1HBX G;  1W4M A;  2VT2 A;  2RKH A;  1WRJ A;  2JZY A;  3V7S A;  4L0Z B;  2DPD A;  4LLG F;  4UVC A;  3M1E A;  3BWG A;  3CUQ A;  3DF8 A;  1LDK B;  2K4J A;  3IKV A;  3BJ6 A;  2DK5 A;  4ENN A;  3V8K A;  1UST A;  2XGX A;  3KP2 A;  4LGW A;  5JHU A;  5A2Q K;  4IF4 A;  4OIO F;  4RGS A;  1S7O A;  2IP2 A;  3V8J A;  1R36 A;  1XGS A;  1EH8 A;  3HRT A;  1O7F A;  2GIV A;  2QWW A;  2O3F A;  1LEB A;  4AIH A;  1S29 A;  5K5R A;  3Q9S A;  4L18 B;  2VE8 A;  2CSO A;  2CQK A;  1STZ A;  4AD9 A;  1JHH A;  4KIG A;  1EH6 A;  4I98 B;  4HAM A;  2PLY A;  3F3X A;  3E6D A;  1TLH B;  1TW3 A;  1OYY A;  3ZPL A;  4L0Y B;  4I0A A;  1O3S A;  5DCM B;  4UV8 A;  3E5Q A;  2D1H A;  2Z5U A;  1B9M A;  1H9T A;  1HW5 A;  2OQR A;  2ZJ2 A;  1P4A A;  3E5U A;  2ZO4 A;  5ERI A;  3R4K A;  3CUQ B;  3LWF A;  4ESJ A;  5AON A;  2HR3 A;  1ZYR F;  1P6R A;  3TOB A;  2XVC A;  1O3T A;  5D6E A;  3WGH A;  3CLO A;  2VE9 A;  1IRG A;  1UHW A;  3WTS C;  4Q5S F;  1YS7 A;  3GYH X;  4CIC A;  3Q5F A;  3JSP A;  5D8K B;  1J5Y A;  4BQA A;  1A04 A;  4HX8 A;  5D8L B;  1JGS A;  2RDP A;  1WWX A;  5H6Q A;  2UXX A;  2OU2 A;  3PQJ A;  3DXJ F;  1KQ9 A;  4ZYH A;  4WX9 A;  2QBY A;  1SAX A;  2RN7 A;  3IHU A;  1UFM A;  1G3S A;  4UNO A;  4ZH4 F;  1USS A;  5EEG A;  4FX0 A;  4M73 A;  4A0Z A;  3NQO A;  3TDU C;  5F64 A;  4HZF A;  1SFX A;  3BDD A;  5CYV A;  3ERE D;  1U5T B;  4S05 A;  2F2E A;  1YFH A;  1H0M A;  1BI2 A;  1T6S A;  2KJB A;  3J81 K;  5DUI A;  1Z6T A;  4KN7 X;  3EQL F;  1KGS A;  4NHJ A;  2A3S A;  1J7K A;  3KFW X;  3I71 A;  4N0B A;  3DFG A;  2F5D A;  3GFL A;  4ETS A;  2VC0 A;  1VTN C;  4CYD A;  1J75 A;  3JTH A;  2K86 A;  4FT8 A;  2FEZ A;  4AVP A;  3FZV A;  4NQW A;  1DP7 P;  2MLK A;  5J6X A;  2HEO A;  2CO5 A;  3H3U A;  2L01 A;  2O03 A;  2MC3 A;  4YG2 F;  1H9G A;  2QBY B;  1ZLK A;  2IA2 A;  5LGN A;  1YIO A;  2KJC A;  2UXN A;  1FYL A;  1R22 A;  3FM5 A;  1L3L A;  4M9Z A;  1FP2 A;  4HQM A;  2M45 A;  2QYO A;  1R1T A;  3L7W A;  1LVA A;  5E1W A;  3QP5 A;  3TOA A;  2DO7 A;  4KN4 X;  1OMI A;  2P6T A;  3R0A A;  1ONV A;  3ELK A;  1U3E M;  3KEQ A;  3DP7 A;  4RGX A;  1BIA A;  3WG9 A;  4YII A;  5LEK A;  3RKW A;  1LQ1 A;  2NRA C;  4LLN A;  5HLI A;  3JAM K;  4HX4 A;  5CVU A;  2COM A;  2XAS A;  2XIG A;  1ZRD A;  3F8F A;  3I4P A;  2P5L C;  4A6E A;  3F8B A;  4WXH A;  4PGG A;  3KLO A;  2FSW A;  1QPM A;  2GA1 A;  1KYW A;  2D2W A;  2XV4 S;  1FZP B;  4Y13 A;  3TO6 A;  5HS8 A;  1ZHF A;  6PAX A;  3RJP A;  2Z9O A;  2XUB A;  3DPL C;  2TDX A;  2ETH A;  4OOI A;  4KIB A;  4Q47 A;  1MJA A;  3B73 A;  4P9U A;  1IXC A;  3CUO A;  3E5X A;  2E1C A;  4G8X A;  1IN7 A;  5D6F A;  5FD6 A;  4HW0 A;  2V1X A;  5BPI A;  2PMU A;  3HSF A;  2KKO A;  3GF2 A;  1KQ8 A;  4H0E A;  2ZME A;  1TBX A;  3MWM A;  2BYV E;  5ILS A;  5HOO A;  1ZGJ A;  3F8N A;  3I59 A;  1JE8 A;  4I01 A;  5FLX Z;  5ILU A;  2ZKZ A;  1XCB A;  3MQ0 A;  5HS7 A;  5DCF A;  4QLC U;  4HYE A;  4BNC A;  1F9N A;  4GGG A;  2NYX A;  4LMY A;  1FLI A;  3JSO A;  1T98 A;  4BYY A;  4ENM A;  5DV5 A;  3C3W A;  4PDK A;  2ISZ A;  2KIF A;  4IRH A;  1EH7 A;  3ZMD A;  3V7R A;  5BS6 A;  1QO0 D;  2FNP A;  4HDV A;  4OMY A;  3ZMZ A;  1DPU A;  4OMZ A;  1D8J A;  5D5X B;  2A69 F;  4ESB A;  4EV0 A;  2EFQ A;  5DDG A;  2FQ3 A;  4KA4 A;  1FNN A;  3FXU A;  3K2Z A;  4A2U A;  4I02 A;  2W84 A;  1O3R A;  2FNA A;  5BMZ A;  3I59 B;  2DPU A;  2XRO A;  1ZG1 A;  5FO5 A;  1IXR C;  2ISY A;  1ZRF A;  2ZBK A;  2PG4 A;  2M30 A;  2ADU A;  2VBX A;  1XCV A;  5IT9 Z;  2MH2 A;  2JRT A;  3BJA A;  1R00 A;  3BPX A;  5FB2 A;  4RB3 C;  1B1B A;  2Q2E A;  3TGN A;  3EDP A;  2ACJ A;  1QQI A;  3BZ6 A;  3K69 A;  4YFK F;  3T8T A;  5AIP A;  2XAJ A;  4A5M A;  4ENK A;  3ECH A;  2K27 A;  3KCC A;  1HW1 A;  1W7P D;  2R7D A;  2ZNY A;  5H20 A;  4CO8 A;  3J7A O;  4MNU A;  2EV6 A;  1C0W A;  2W24 A;  2CG4 A;  3HUG A;  4GYI A;  2QM3 A;  3BJO A;  2W57 A;  4DQ2 A;  4WK8 F;  1T2K A;  3HRS A;  1J2X A;  1S7A A;  2RGV A;  2HDC A;  3E6B A;  3F6V A;  5E18 F;  5LHI A;  4AIK A;  1I6X A;  3W6K B;  2H27 A;  2Z33 A;  3L9F A;  1Z7U A;  1BC8 C;  3CJN A;  4ZZD A;  3KP7 A;  5BOX A;  1MJ9 A;  1SD4 A;  3ZMU A;  5K5O A;  3K1P A;  1F4K A;  1PUE E;  3Q9V A;  2Q8K A;  1OPC A;  3ML6 A;  5CVI A;  1O7L A;  4UV9 A;  5DD8 A;  5ICC A;  3F6O A;  1BIB A;  2P5K A;  2QLZ A;  2A68 F;  4ESF A;  1E17 A;  4EM1 A;  5E1X A;  2MBF A;  1IUY A;  2VBZ A;  1TQI A;  1IXS B;  4M72 A;  5L3B A;  4MQ9 F;  3LAP A;  2A07 F;  2HKX A;  4UXN A;  3R6S A;  1T39 A;  4CHU A;  1ZG5 A;  2BV6 A;  3DPT A;  3CO7 C;  1G6N A;  4P5O A;  3WTY C;  3GX4 X;  4K2E A;  2YPR A;  4G7O F;  2CGP A;  1XSX A;  2ZXJ A;  2EFP A;  1IN5 A;  4L9N A;  1IAW A;  4HF1 A;  3S2W A;  4U88 A;  5DYM A;  1K79 A;  3ZQ7 A;  1O57 A;  2L54 A;  4MHG A;  4MGR A;  2FBK A;  3F21 A;  4U0V A;  1PP8 F;  1U6G A;  4YFX F;  4EM0 B;  1EV7 A;  4S04 A;  4RAY A;  1O3Q A;  2LSO A;  3GZ5 A;  4EVI A;  3T8R A;  2C6Y A;  5FFX A;  4EQQ A;  2HS5 A;  3BOQ A;  2M87 A;  3GWZ A;  1UB9 A;  3HSE A;  4LJZ F;  1U5T C;  1FBQ A;  3R60 A;  3HIF A;  1REP C;  4GYG A;  1GXQ A;  4B8X A;  1XSD A;  2IA0 A;  4XSX F;  4KIF A;  5E17 F;  2W25 A;  2W85 A;  4UVB A;  1XN7 A;  2CW0 F;  4CZZ A;  3BY6 A;  3M8E A;  3MZH A;  2PEX A;  4Y15 A;  2A6H F;  3TDZ C;  3F23 A;  2P7V B;  2VBW A;  1I5Z A;  5F6F A;  4Q4Z F;  4CGZ A;  2H09 A;  5A2Q Z;  3O6B B;  1XB4 A;  3WTT C;  5BPD A;  5K5Q A;  2FE3 A;  3WTU C;  2V1U A;  1ZRC A;  2H6C A;  2UZK A;  5TRD A;  3GW2 A;  5CVV A;  1JHF A;  4G6D A;  4BHP A;  1J59 A;  4RGR A;  3KE2 A;  2P6S A;  1S8N A;  1HSJ A;  2JT1 A;  1V4R A;  2DT5 A;  3V7C A;  1XGN A;  1TQM A;  1Z05 A;  2HYG D;  3ABU A;  3KP6 A;  3LST A;  4L9J A;  1K7A A;  1WKM A;  2QVO A;  3GFJ A;  3LQQ A;  2YX7 A;  3COA C;  1UHM A;  3ZP5 A;  4AIJ A;  3IRR A;  1IF1 A;  3H3Z A;  4P96 A;  2OQG A;  3QAH A;  3QPH A;  5ED4 A;  3WOD F;  5F1R A;  1NHA A;  3JW4 A;  3GFM A;  2GXG A;  1MZB A;  1BBY A;  3MZY A;  3P9I A;  3O3K A;  3E6C C;  5ICG A;  4GCV A;  1ZN2 A;  2L4A A;  4G7H F;  5KVR A;  1ON1 A;  2E7W A;  1CF7 A;  1ZRE A;  3W6J B;  2IT0 A;  5LRR A;  4IHS A;  5J8C A;  2VOO A;  4HF0 A;  1XGO A;  3J80 K;  1BI1 A;  2HQN A;  2V79 A;  3QP6 A;  3N97 A;  1GXP A;  5TJJ A;  1I27 A;  2PN6 A;  3KEO A;  5JFR A;  4HF2 A;  1D5V A;  1P4W A;  4L5I A;  3ABT A;  4A12 A;  1TTY A;  1ULY A;  2EV0 A;  2GZW A;  3FMQ A;  4OIR F;  5LBQ A;  2CWE A;  4YIF A;  1RZ4 A;  2O6G E;  1ZGA A;  2OZU A;  1U2W A;  1I1S A;  4EJT A;  3DV8 A;  3TQN A;  3FM3 A;  3J81 Z;  1XDU A;  5L3C A;  1J0R A;  2OBP A;  4HX7 A;  1R1V A;  4RB1 A;  4Y17 A;  3LAJ A;  2E7X A;  1CF7 B;  4WWC A;  3VOE A;  3QU6 A;  1FBU A;  1B59 A;  1XMK A;  4KFC A;  3D5L A;  1XGM A;  2OZ6 A;  5HLH A;  4KYW A;  2A61 A;  3QPT A;  2LF8 A;  2EFN A;  3REO A;  2ZNZ A;  2NNN A;  2GWR A;  1B9N A;  5DEQ A;  3VFZ A;  5L3E A;  1FYK A;  1MKM A;  2DBB A;  2HOE A;  2VON A;  1TW2 A;  4M74 A;  2O61 A;  2H94 A;  3U2R A;  3IKT A;  4MEY F;  5ICF A;  2AXL A;  1YO5 C;  2LNB A;  4XLN F;  2BEO A;  4I2O A;  3T1B A;  3G3Z A;  4R8H A;  2YR2 A;  2P7C B;  1SD6 A;  4G94 A;  3GO5 A;  4GXO A;  1SD5 A;  1FC3 A;  2R3S A;  2Y48 A;  3HRM A;  4L9V A;  1R23 A;  5LEJ A;  2PMH A;  1XSV A;  2GAU A;  1YW8 A;  2FU4 A;  2LDU A;  3I0T A;  2HGC A;  1G3T A;  2FF4 A;  2XKO A;  2STW A;  2WV0 A;  3KP4 A;  3KZZ A;  3JAM Z;  4CDG A;  4EMS A;  4N9I A;  4R79 A;  3SXY A;  3WTX C;  1XD7 A;  4EJV A;  3IWF A;  2OD5 A;  4MEX F;  2GQQ A;  2EB7 A;  4F7Z A;  1PDN C;  3I58 A;  1OYI A;  4RGU A;  3RPU A;  1UCR A;  2JTV A;  3V8L A;  3E97 A;  3BP8 A;  4M71 A;  2XKP A;  4JK1 X;  1YTY A;  3GFI A;  2QQB A;  2VN2 A;  1IN8 A;  3QU3 A;  3K0L A;  2OAZ A;  2FRH A;  3C1D A;  2Y0M A;  2MLG A;  5JI6 A;  4EM2 A;  5HDN A;  1R58 A;  3I64 A;  5D5V B;  2ZME B;  3D0S A;  2J5O A;  3MAJ A;  4PGH A;  3I54 A;  1E2X A;  2QQA A;  2RV8 A;  3P9C A;  2R7F A;  3BPV A;  1CGP A;  3WTW C;  3WU0 A;  1R5H A;  2Z99 A;  2XAG A;  1GHC A;  4D0P A;  5AIQ A;  3QOP A;  4ON0 A;  2FOK A;  1T0F A;  4MTE A;  4NB5 A;  1K78 A;  3EYY A;  3WGI A;  3RYR A;  4ZYD A;  3T5X A;  1RIO H;  2DK8 A;  2KIM A;  1HXD A;  1DUX C;  2EFO A;  3KET A;  4WCG A;  3G73 A;  2NAZ A;  4EGY A;  5HDG A;  1Z91 A;  3PQK A;  3SHF A;  1S3J A;  3TO7 A;  4LD5 A;  2CYY A;  4U7B A;  1IN6 A;  2G9W A;  4QWQ A;  2EJR A;  2XRN A;  3M7G A;  3VB2 A;  4CXF A;  4KMU X;  2IA1 A;  5LGT A;  1FX7 A;  3WTV C;  4A6D A;  1ZG3 A;  3OOP A;  4U7D A;  1X3U A;  4XLP F;  3GEZ A;  2Q0O A;  4OU0 A;  1BI3 A;  4UVA A;  4LFU A;  1FT9 A;  2HWV A;  4LG0 A;  5IT3 A;  4HDU A;  5FD5 A;  2PJP A;  2Z3Y A;  1FWZ A;  4P9F A;  4ENJ A;  3F8M A;  3SFZ A;  4IXA A;  2NS0 A;  3FMR A;  2IPQ X;  2FBH A;  3M8F A;  2D45 A;  3LA2 A;  2X0L A;  5KK1 A;  1OR7 A;  1B6A A;  1HKS A;  1YW7 A;  5D4R A;  2FBI A;  1K78 B;  3KP3 A;  3RYP A;  1QGP A;  4ASN A;  3HHG A;  5DD4 A;  5HS9 A;  3WTZ A;  2G7U A;  5HVQ C;  4MTD A;  4G7Z F;  2P4W A;  3VEP A;  1BOA A;  1FPQ A;  3U1D A;  5ILV A;  4EGZ A;  1G4D A;  2HKO A;  5CLS A;  3ROU A;  1P92 A;  3ZMS A;  3NEU A;  1KQ0 A;  3MCZ A;  2M1B A;  3CUQ C;  1QZZ A;  1ODD A;  3L00 A;  1BC7 C;  2STT A;  4IPA A;  2BGC A;  3F22 A;  3M9A A;  5E8I A;  4PZJ A;  4M6Y A;  4KDP A;  5LHG A;  1LJ9 A;  4BHB A;  1GVJ A;  4LG0 B;  1BN5 A;  2RQP A;  3BRO A;  1RUO A;  1ZAR A;  2PQ8 A;  3E6M A;  4IVN A;  5L3G A;  2MA3 A;  2PFB A;  2IJL A;  2PI0 A;  4IJA A;  5DUK A;  1J9I A;  4Q48 A;  2V1D A;  5JR3 A;  3DEU A;  2RVC A;  1JXS A;  4A0Y A;  5L3F A;  1PP7 U;  4XSZ F;  3HRU A;  3IL2 A;  1AOY A;  2HTJ A;  3EET A;  4LK1 F;  4N9H A;  3R0J A;  4BAY A;  4I0B A;  3L09 A;  2B0L A;  5HDK A;  1U5T A;  5E20 A;  4U0Y A;  1U78 A;  2EK5 A;  2V9V A;  3ULQ B;  4FX4 A;  3TO9 A;  3GXO A;  4RAZ A;  1MD0 A;  4G9Y A;  1SMT A;  5H6R A;  4O6J A;  2DI3 A;  2HYF A;  2VOD A;  3IC7 A;  1SMY F;  4KIC A;  2VC1 A;  2VOP A;  2P8T A;  1IRF A;  5FFZ A;  3CTA A;  4M9S A;  2YX4 A;  5CVR A;  1FYM A;  3QRF F;  2ESN A;  1W5S A;  2G7H A;  4HV5 A;  5E8G A;  1WSU A;  1QNT A;  3N4M A;  3V4G A;  1D8K A;  4O5V A;  4GO1 A;  2VXZ A;  2J5P A;  4WXD A;  3IRQ A;  4OIQ F;  2EA4 A;  1OYW A;  2XAF A;  2QUF A;  2P5V A;  3RKY A;  2XAQ A;  4KNY A;  2K4B A;  1Z1D A;  3FWE A;  1FOK A;  3RDI A;  2WWY A;  4Z2Y A;  2LF7 A;  3HOT A;  2WTE A;  4IRG A;  3GUD A;  2ELH A;  3C18 A;  3IWZ A;  5LGU A;  2AS5 F;  4ZZL A;  1L0O C;  2A5Y B;  2JPC A;  1W7P A;  3K1M A;  4M9X A;  5LHH A;  2Y75 A;  1Z6R A;  2HTS A;  1BM9 A;  3F8C A;  5LRS A;  1TNT A;  3DQV C;  2O8X A;  2UWM A;  3GVA A;  3FF5 A;  4P55 A;  4IRI A;  1YLF A;  1TNS A;  2YSR A;  3HTU A;  5ICE A;  1RUN A;  1HKT A;  2KRF A;  3KLN A;  2E1N A;  2FXA A;  4DNC A;  1S6L A;  1MDM A;  1Y0U A;  1TQP A;  1OKR A;  4XBF A;  4KUM A;  4HLY A;  4MQV A;  3AAF A;  1FSE A;  3T0Y A;  4HV6 A;  2RC4 A;  3I5U A;  3HHH A;  3K1N A;  2PBI A;  1Q1H A;  3ISP A;  2VBY A;  3HSR A;  5JVT A;  4O3M A;  2DU9 A;  1WI9 A;  3LQR A;  2V6C A;  4EJO A;  2O0Y A;  4EJU A;  5FLX K;  3WU1 B;  3B02 A;  3RKX A;  1P2F A;  3MFK A;  1KU7 A;  5D4S A;  4HA8 A;  3RTR A;  5L3D A;  1W7P B;  1LB2 A;  3WE3 A;  2M8E A;  2DW4 A;  3PFI A;  5D5W B;  1LDD A;  1P4X A;  2MD5 A;  3MEX A;  4TV7 A;  4B09 A;  4BH9 A;  1LNW A;  4A5N A;  2HFH A;  1I1G A;  3HOS A;  2F5C A;  1RI7 A;  4LK0 F;  4U0W A;  1G3W A;  1FBS A;  5FGM A;  4RB2 C;  1T38 A;  2K02 A;  4BXU A;  1MDM B;  4RB0 A;  4FHT A;  5CJ9 A;  4RS8 A;  3SZT A;  1HST A;  1Z9C A;  4YFN F;  2DQR A;  1MGT A;  4IHT A;  2ZFW A;  1LDJ A;  1DDN A;  1K6O A;  1BI0 A;  1HKQ A;  2F5F A;  1KU3 A;  1QZY A;  3U9G A;  4UHT A;  4HBL A;  3RIR A;  1F5T A;  3J80 Z;  1YYV A;  1IZ1 A;  1KU9 A;  2MH9 A;  3LA3 A;  2LKP A;  2VT3 A;  3GLX A;  3ZMT A;  3FXR A;  5IT9 K;  3RI4 A;  1RNL A;  3CDH A;  2QZ8 A;  1R7J A;  1SD7 A;  2QQ9 A;  5E1Z B;  2BE5 F;  3I53 A;  2QEN A;  2D1V A;  2DQL A;  1D3Y A;  1QBJ A;  2EFW A;  1W5T A;  4KT5 C;  1ZLJ A;  1U8R A;  4HLX A;  4KMF A;  3GZ6 A;  4G6Q A;  3RPQ A;  2FA5 A;  4HQE A;  2A6E F;  3ZN1 A;  4PCQ A;  3NRV A;  5LLQ A;  1FY7 A;  2HZT A;  3HTS B;  1FSH A;  1YW9 A;  2X4H A;  2IVM A;  5HLG A;  2ZCW A;  1KA8 A;  3FXQ A;  4ZYE A;  4E70 A;  3F72 A;  1R1U A;  1V3F A;  1YQA A;  1FP1 D;  5K1Y A;  1DPR A;  5CVJ A;  3OV8 A;  3R61 A;  2H6B A;  2L02 A;  2M5W A;  1ZH5 A;  2L4M A;  4HOB A;  3ZMV A;  3EUH A;  1BJA A;  1HQC A;  2DLL A;  4UUV A;  2K7L A;  4WF2 A;  4I09 A;  2FMY A;  2ESH A;  4LLL A;  5EEH A;  4L5J A;  2IW5 A;  2JSC A;  1MJB A;  1SFE A;  1B4A A;  1LEA A;  3HYI A;  1R5G A;  1SFU A;  1XDS A;  2XHK A;  3C7J A;  4EJW A;  3K9T A;  2EWN A;  2DFI A;  4M6X A;  4OIN F;  3VOD A;  2OA4 A;  2XAH A;  3P7N A;  1G3Y A;  3H92 A;  4L9T A;  2EV5 A;  3KZY A;  4AWX B; 
#chains in the Genus database with same CATH topology
 3DTK A;  4XON A;  3KP5 A;  2NNY A;  1R49 A;  1IN4 A;  3JRB A;  1D1C A;  1K4S A;  2CQX A;  2FML A;  1F1Z A;  3NAU A;  2ELK A;  3ECO A;  1ZAO A;  4I7H A;  3WGG A;  1LE8 A;  3CDL A;  3L2C A;  1AWC A;  4DJA A;  5JVG F;  4BEH B;  4JBA A;  3SZP A;  4XLF A;  1HW2 A;  1APL C;  2CFX A;  4OAZ A;  1ON2 A;  3FXM A;  3ERM A;  1I3A A;  1S9H A;  1R4N B;  5J3L A;  3I55 I;  4OIP F;  2GA2 A;  3G4S I;  1MND A;  2KZV A;  3HEF A;  3GTP J;  4JQF A;  2PJR A;  1TWC J;  2RQQ A;  4MIM A;  2UV1 A;  1SAN A;  3CMY A;  1IRX A;  1V5E A;  1YS6 A;  2F5E A;  3L2Q A;  3HPG A;  1WQ2 A;  3FHZ A;  2RNJ A;  1DP3 A;  2DAO A;  3SYT A;  1X3W B;  3E3V A;  2UUZ A;  4QTR A;  4ZYG A;  3FX3 A;  1VQO I;  3LA7 A;  2IXS A;  3HOW J;  2JPB A;  4A0X A;  4BHC A;  3CO6 C;  3H9Q A;  1ZQ3 P;  2IRF G;  1KU2 A;  1OFC X;  3JRG A;  2XF6 A;  5B3S H;  1G8X A;  3GTG J;  3HOY J;  1IW7 F;  3WE2 A;  2OCC H;  4R1H A;  2KIU A;  4XRF A;  5EZH A;  3O2P E;  1KYZ A;  1WH7 A;  3LFK A;  2Y2Z A;  5J8F A;  2V26 A;  3SQN A;  5DCM A;  3ZN0 A;  1YG2 A;  5D5U B;  1QZE A;  3JTG A;  2E2I J;  5BQT A;  2L3D A;  2HQR A;  2JA2 A;  3P9K A;  3KEY A;  1WHU A;  1XMA A;  5B1B H;  2XDV A;  4HRI A;  2JA6 J;  5CPR B;  2GXB A;  3EYI A;  2WC2 A;  2VUM J;  2BBY A;  3BR0 A;  4LB6 B;  2X1C A;  3TBI A;  3TKY A;  1QU3 A;  1YIJ I;  2DYR H;  2DTR A;  2ID6 A;  2EA2 A;  3FMS A;  4WXC A;  3K70 C;  2HU9 A;  4LB5 A;  2YU3 A;  3DKW A;  3L1P A;  1HBX G;  1RKT A;  2E1M B;  1W4M A;  2VT2 A;  2RKH A;  1WRJ A;  2JZY A;  3V7S A;  4L0Z B;  3BG7 A;  2DPD A;  4LLG F;  1D1B A;  2LMD A;  4UVC A;  1AHD P;  2VKV A;  3M1E A;  3BWG A;  4XRS G;  3CUQ A;  3DF8 A;  1LDK B;  5HLT A;  3CP8 A;  1A35 A;  2K4J A;  2QGU A;  3FDY A;  2DFH A;  3IKV A;  1XPX A;  3BJ6 A;  2DK5 A;  4ENN A;  1LE8 B;  2V9K A;  5FLM J;  3V8K A;  1UST A;  2XGX A;  3KP2 A;  4ZC3 A;  4LGW A;  5JHU A;  3TP3 A;  5A2Q K;  3J7Y J;  4IF4 A;  4OIO F;  2RAE A;  1B72 A;  4RGS A;  1S7O A;  2IP2 A;  2V4J C;  3V8J A;  5IOY A;  1R36 A;  2HZD A;  2EPF A;  3E1S A;  4X0G A;  1XGS A;  4YRV A;  2PJR B;  3HM5 A;  1P7J A;  1EH8 A;  3LMM A;  4F55 A;  3HRT A;  3GTJ J;  1O7F A;  2GIV A;  2QWW A;  2O3F A;  1LEB A;  2QSG X;  1GVD A;  4AIH A;  1Y8Q B;  1QRY A;  1S29 A;  5K5R A;  2LY9 A;  3Q9S A;  4L18 B;  2VE8 A;  2CSO A;  3HZJ A;  2CQK A;  1STZ A;  3BG6 A;  4A3G J;  4XLH A;  2XC7 A;  4AD9 A;  1JHH A;  5CKT A;  2CJJ A;  2JRM A;  4KIG A;  3DBL B;  1EH6 A;  4I98 B;  4HAM A;  1EF4 A;  1TC3 C;  2PLY A;  3F3X A;  3E6D A;  1MMD A;  1TLH B;  1TW3 A;  1OYY A;  3ZPL A;  3PIP F;  2LY2 A;  4L0Y B;  3HPH A;  4I0A A;  4B1R A;  1O3S A;  3A2K A;  1MIJ A;  3QOD A;  4E7L A;  5DCM B;  2V6E A;  2COB A;  1R5I D;  2CV0 A;  4UV8 A;  1FTT A;  3E5Q A;  4ZDP A;  2KP6 A;  1QVT A;  2D1H A;  1W36 C;  1OCC H;  2B9S A;  1YIT I;  2Z5U A;  1B9M A;  1H9T A;  4DZP A;  1HW5 A;  1NK3 P;  2OQR A;  2ZJ2 A;  1P4A A;  1EKE A;  5EGO A;  2YU9 J;  4C3H J;  3C2H A;  3E5U A;  2ZO4 A;  2DA1 A;  3DLL F;  1D0Y A;  5ERI A;  3R4K A;  3V42 A;  4DGW B;  2WAQ N;  3CUQ B;  3LWF A;  2ME0 A;  5K7H A;  5AON A;  2HR3 A;  4ESJ A;  1ZYR F;  1P6R A;  3TOB A;  2XVC A;  1O3T A;  2Y31 A;  5D6E A;  1OIS A;  2FD5 A;  4RAG A;  3WGH A;  3CLO A;  3OWT A;  3HB9 A;  2QKM B;  3H3V K;  4HNV A;  4A69 C;  2L9R A;  3S3N A;  2VE9 A;  1IRG A;  1UHW A;  3WTS C;  4Q5S F;  1YS7 A;  4XRS A;  3GYH X;  3K4J A;  4CIC A;  3Q5F A;  1B72 B;  3JSP A;  3LNQ A;  2KDZ A;  5D8K B;  1J5Y A;  4BQA A;  1A04 A;  5TGT A;  3VDX A;  2Z16 A;  4HX8 A;  5D8L B;  1LPQ A;  1JGS A;  2RDP A;  2XSD C;  1WWX A;  5H6Q A;  2UXX A;  1IO2 A;  4I76 A;  4XL9 A;  1Z77 A;  2OU2 A;  2VQL A;  3H0D A;  3PQJ A;  2WAE A;  2NS8 A;  1Y0N A;  1DU6 A;  3DXJ F;  1KQ9 A;  3RPU D;  4ZYH A;  3ABM H;  1FIP A;  4WX9 A;  2QBY A;  1SAX A;  2KLO A;  2RN7 A;  3IHU A;  1MSF C;  1UFM A;  1G3S A;  2DCE A;  4II2 A;  4UNO A;  4ZH4 F;  4D9J A;  4E4H A;  4Z6Y A;  1USS A;  4IZZ A;  5EEG A;  4XID A;  2GOM A;  4FX0 A;  4M73 A;  3NQO A;  4A0Z A;  3TDU C;  5F64 A;  4HZF A;  1SFX A;  3BDD A;  1SEU A;  3FBI B;  5CYV A;  3G1M A;  1KON A;  1VQ4 I;  3BT9 A;  1QHH D;  1TWG J;  3ERE D;  1IC8 A;  2JSP A;  1U5T B;  2EIJ H;  2F2E A;  4S05 A;  1YFH A;  5EGO B;  1H0M A;  4OAY A;  4EEF G;  1BI2 A;  2LRD A;  1YRN A;  3D5R C;  1T6S A;  2KJB A;  2DOE A;  2QQ8 A;  5M5Y J;  3J81 K;  3KYD B;  5DUI A;  1Z6T A;  4KN7 X;  3EQL F;  1KGS A;  4NHJ A;  2A3S A;  1J7K A;  3ZQI A;  3KFW X;  1V5G A;  4RM2 A;  4M3B A;  3I71 A;  2HQA A;  2E2J J;  3SZG A;  2DFF A;  4N0B A;  3DFG A;  2F5D A;  2PMZ A;  3GFL A;  4ETS A;  2VC0 A;  1VTN C;  4CYD A;  1J75 A;  3H36 A;  3JTH A;  2LD5 A;  2K86 A;  2R7Q A;  1ZEL A;  3RQI A;  4FT8 A;  2FEZ A;  4AVP A;  2WA0 A;  2VIX A;  5C44 J;  3FZV A;  4NQW A;  1DP7 P;  2DDA A;  2MLK A;  5J6X A;  1X1B A;  4AC0 A;  2HEO A;  1I3Q J;  2CO5 A;  1UJ8 A;  5C4J J;  3H3U A;  3HOX J;  2L01 A;  2VJI A;  2O03 A;  2MC3 A;  4YG2 F;  1H9G A;  2QBY B;  1ZLK A;  2DMP A;  2IA2 A;  5LGN A;  1YIO A;  1ETV A;  2IGO A;  2KJC A;  2UXN A;  5JLX A;  1FYL A;  5E3L A;  1MW7 A;  1R22 A;  4GFB A;  2TRT A;  3FM5 A;  5IP9 J;  1ZGW A;  1L3L A;  4M9Z A;  1FP2 A;  1X19 A;  4HQM A;  2M45 A;  4ZTF A;  2HPI A;  2QYO A;  1R1T A;  1S7E A;  3L7W A;  1LVA A;  5E1W A;  3A01 A;  5F1J A;  3QP5 A;  4XMY A;  4Y3O A;  3TOA A;  2DO7 A;  4KN4 X;  1OMI A;  2P6T A;  4XN3 A;  2K5C A;  3R0A A;  3CC7 I;  2HQ5 A;  1ONV A;  3ELK A;  5DTD A;  1U3E M;  3KEQ A;  1I6H J;  3DP7 A;  4FE7 A;  3P5J A;  1BIA A;  4RGX A;  5F04 A;  4A3C J;  3WG9 A;  4YII A;  5LEK A;  3LSR A;  3RKW A;  1TWA J;  3OYC A;  4IOC F;  1LQ1 A;  2NRA C;  2EIM H;  4XOP A;  4LLN A;  5HLI A;  3JAM K;  3IAM 2;  4HX4 A;  5CVU A;  4L5E A;  2COM A;  3H5R A;  2XAS A;  2XIG A;  2ZFU A;  2K9L A;  3WHB A;  2CRG A;  3AKZ A;  1ZRD A;  5GAG J;  3F8F A;  3I4P A;  3H35 A;  3OR2 C;  5KAI C;  3L2U A;  2P5L C;  2OPT A;  2MW8 A;  3BTJ A;  1SVL A;  4IQ4 A;  3K70 D;  2W48 A;  4C2M J;  4HG2 A;  3OYB A;  1SVO A;  2VB6 A;  4NQW B;  2CV2 A;  4A6E A;  5E3O A;  3F8B A;  4WXH A;  3JCU C;  3K10 A;  5CQE A;  3U21 A;  3KLO A;  3QYF A;  4PGG A;  5FRO A;  2FSW A;  1QPM A;  4XN0 A;  5B1A H;  5GAE J;  3EUK L;  2GA1 A;  1KYW A;  2D2W A;  2OC6 A;  3FXL A;  2XV4 S;  3FIS A;  1FZP B;  4Y13 A;  2E19 A;  3TO6 A;  5HS8 A;  1H88 C;  4PJM A;  5FKO A;  2JA7 J;  1ZHF A;  3HBL A;  4B3X A;  6PAX A;  4PSW A;  3RJP A;  2XUB A;  3DPL C;  4HNT A;  2Z9O A;  1JI8 A;  2TDX A;  2VL8 A;  2ETH A;  3G1L A;  4OOI A;  4E7S A;  4KIB A;  4Q47 A;  1MJA A;  3VSK A;  4E7I A;  3RQ4 A;  4BJ5 C;  1UG0 A;  3B73 A;  4P9U A;  4BS9 A;  2LBF A;  3A01 B;  4NC7 A;  2W82 A;  1IXC A;  4M6V A;  5IYD J;  1SAU A;  3CUO A;  3DCF A;  3E5X A;  2K9S A;  2E1C A;  4G8X A;  1IN7 A;  1BJZ A;  4V2F A;  5D6F A;  2YUS A;  5FD6 A;  3BG3 A;  1MH3 A;  3G6E I;  4HW0 A;  3ZQC A;  2V1X A;  2L7F P;  3KIO A;  5BPI A;  2PMU A;  3HSF A;  4IHX A;  2KKO A;  2LR8 A;  4CA0 A;  3GF2 A;  1KQ8 A;  4H0E A;  2ZME A;  3DBR B;  1TBX A;  1V5F A;  3MWM A;  3CJQ B;  5EDN A;  1YX3 A;  2NOG A;  2BYV E;  4NDL A;  1XMX A;  2KIQ A;  5ILS A;  5HOO A;  1ZGJ A;  3F8N A;  4A3M J;  4C2T A;  3I59 A;  1JE8 A;  1FOY A;  2H8R A;  2DA2 A;  4I01 A;  4JX6 A;  5FLX Z;  3ZCO A;  5ILU A;  2ZKZ A;  1XCB A;  2M7B A;  3MQ0 A;  5HS7 A;  1W36 D;  5J1Y A;  5DCF A;  1RPW A;  3ESW B;  4QLC U;  1QHG A;  3BR5 A;  4HYE A;  4BNC A;  2X1E A;  2MFZ A;  3SFI A;  3ZQF A;  3AL0 C;  1F9N A;  4GGG A;  2NYX A;  4B47 A;  1SC7 A;  4LMY A;  1Y39 A;  3JSO A;  2GXA A;  2O5R A;  3OYE A;  4BDZ A;  1T98 A;  1FLI A;  4BYY A;  2BW3 A;  3IH2 A;  4BJT A;  4ENM A;  2HDD A;  5DV5 A;  3C3W A;  3BQZ A;  4PDK A;  3IP4 B;  3I56 I;  4IHV A;  2VAS A;  3JRA A;  2E2H J;  1OCZ H;  1N77 A;  2KIF A;  2ISZ A;  4IRH A;  1EH7 A;  5E79 C;  3GBG A;  3ZMD A;  3V7R A;  5BS6 A;  5F08 A;  5F0H A;  2EIK H;  4PFO A;  1JT6 A;  1YHQ I;  1QO0 D;  2FNP A;  3MKY B;  4HDV A;  4OMY A;  1N25 A;  3ZMZ A;  5H2F C;  1OCO H;  4OMZ A;  1LFU P;  1D8J A;  1DPU A;  5D5X B;  4C2U A;  2A69 F;  1RR7 A;  4ESB A;  2R93 J;  2LBF B;  4B44 A;  4EV0 A;  2EFQ A;  2CUJ A;  2MC4 A;  2X6Y A;  1G59 A;  2HVS A;  5DDG A;  2FQ3 A;  2IAI A;  4ZTJ A;  3PJR A;  4XRM A;  4PFP A;  5KHD A;  4KA4 A;  1RET A;  1FNN A;  1D0Z A;  5IP6 A;  2BY2 A;  3JRD A;  3IUO A;  5J4Y A;  4MLO A;  4PJ0 C;  3BCB A;  2WY8 Q;  1POG A;  3FXU A;  3K2Z A;  2AHQ A;  4A2U A;  4I02 A;  2W84 A;  3L2V A;  3FXO A;  5BNG A;  1O3R A;  2BOL A;  1X2M A;  2FNA A;  5BMZ A;  2L7K A;  1IRZ A;  2HYJ A;  1LKX A;  3BQY A;  1QPI A;  3I59 B;  4BJ6 C;  2DPU A;  4BDY A;  2XRO A;  1ZG1 A;  1WCM J;  3BC8 A;  5FO5 A;  1IXR C;  4LOC A;  3S17 J;  2L0K A;  2E60 A;  2ISY A;  1ZRF A;  2L7M P;  2ZBK A;  2PG4 A;  3CCM I;  3CC2 I;  2M30 A;  1NK2 P;  2ADU A;  2VBX A;  1VQ6 I;  2M7A A;  3OYD A;  2Z1D A;  1XCV A;  1ACI A;  5IT9 Z;  1OCT C;  2BW3 B;  2MH2 A;  2JRT A;  2Q1Z B;  3BJA A;  1R00 A;  4OWR B;  3A4C A;  3BPX A;  3FK7 A;  1B1B A;  2Q2E A;  4XQF A;  5FB2 A;  4RB3 C;  2KZG A;  2X6X A;  3TGN A;  3EDP A;  2ACJ A;  2OTJ I;  1QQI A;  4C30 A;  2NXN B;  2M8G X;  3BZ6 A;  3K69 A;  1S72 I;  4YFK F;  3T8T A;  3HC7 A;  3G71 I;  2KHM A;  2XAJ A;  5AIP A;  4A5M A;  4ENK A;  3ECH A;  2HNH A;  4NUB A;  2X48 A;  3GTM J;  1MBJ A;  2K27 A;  4BQO A;  2R7U A;  3KCC A;  4BBR J;  1HW1 A;  3OSF A;  1W7P D;  2E71 A;  2ZXW H;  4X6A J;  2NVT J;  2CU7 A;  2R7D A;  2ZNY A;  2H8W A;  5H20 A;  4PUS A;  2E1M C;  2K40 A;  4CO8 A;  4F91 B;  3J7A O;  4MNU A;  3DWL E;  2JA5 J;  2EV6 A;  1C0W A;  2W24 A;  2CG4 A;  3HUG A;  4GYI A;  1AA7 A;  2EZL A;  3J7Z I;  1I50 J;  1OCR H;  2QM3 A;  4PK4 A;  3BJO A;  3CCJ I;  2W57 A;  1LUJ B;  2LH9 A;  2QSH X;  4DQ2 A;  3GME A;  4WK8 F;  5IP7 J;  3OSG A;  1T2K A;  3HRS A;  4NC8 A;  4XR6 A;  2Z2S B;  1J2X A;  1S7A A;  2DYS H;  1JKP C;  1FMV A;  3M07 A;  2RGV A;  1CQT A;  2MD0 A;  1YE9 A;  1TZL A;  2CW8 A;  1GLN A;  3NAR A;  2HDC A;  5DM6 F;  3JRE A;  3CD6 I;  3E6B A;  3F6V A;  5E18 F;  5LHI A;  1FTZ A;  4AIK A;  1I6X A;  3W6K B;  2PX9 A;  3M1C A;  2P0W A;  1E0E A;  4XKB A;  3QWL A;  2H27 A;  2Z33 A;  3L9F A;  3CCS I;  4V19 K;  1Z7U A;  1BC8 C;  1X3Z B;  2F4I A;  5K7Z A;  3ASO H;  3CJN A;  3FHN A;  4XLA A;  2IGM A;  4ZZD A;  3KP7 A;  1P9Q C;  1M1E B;  5BOX A;  3TMO A;  1OR7 C;  2FUG 2;  5B5E C;  4FE4 A;  1MJ9 A;  4FTH A;  1SD4 A;  3ZMU A;  5K5O A;  1JUS A;  4BXF A;  1VZ0 A;  3K1P A;  4BE1 A;  1SFO J;  1F4K A;  1PUE E;  1I39 A;  3E7L A;  4AWX B;  2A05 A;  3Q9V A;  2Q8K A;  1OPC A;  3ML6 A;  5CVI A;  1O7L A;  4UV9 A;  5DD8 A;  5ICC A;  5LD2 C;  2JMW A;  2L9N A;  3F6O A;  1S5L C;  2JUG A;  1BIB A;  2Q2E B;  5J4V A;  1WZ2 A;  2P5K A;  2QLZ A;  2A68 F;  4DYC A;  4ESF A;  5K7F A;  1E17 A;  2K3F A;  4EM1 A;  4C9Y A;  5E1X A;  4CUG A;  3OS0 A;  2MBF A;  3OYK A;  3BR3 A;  1IUY A;  2VBZ A;  1HDP A;  5EYR A;  2R7X A;  1TQI A;  1K4T A;  5FKK A;  1IXS B;  4M72 A;  5HNF A;  5L3B A;  3BZC A;  4MQ9 F;  5J1U A;  3LAP A;  2KMU A;  2A07 F;  4BQN A;  4A3E J;  1N78 A;  4UB6 C;  2HKX A;  4UXN A;  1U8B A;  4HST A;  2XGD A;  3JRH A;  3OMY A;  2DOD A;  1W5C C;  3R6S A;  1ETK A;  1T39 A;  4CHU A;  1ZG5 A;  2BV6 A;  1JUP A;  1MNE A;  2DT7 B;  3HUG B;  4QPO A;  3DPT A;  3VPR A;  3CO7 C;  3ZGK A;  1G6N A;  3I4N J;  4P5O A;  3S3M A;  4DYR A;  3WTY C;  3GX4 X;  1OQY A;  2QCO A;  4K2E A;  3S2D J;  4PSX A;  2DA7 A;  2K85 A;  2YPR A;  2MGQ A;  4G7O F;  2CGP A;  2R5Z A;  1XSX A;  2ZXJ A;  2EFP A;  1IN5 A;  4L9N A;  1IAW A;  2VI6 A;  2CUZ A;  4C3J J;  4HF1 A;  4LG3 A;  2Y69 H;  5KNL A;  3S2W A;  4UB8 C;  4U88 A;  1LFB A;  4JX5 A;  5DYM A;  1K79 A;  3OIQ A;  4I99 C;  1BL0 A;  4UY8 I;  3ZQ7 A;  4N4O B;  4KT6 A;  1O57 A;  2K9Q A;  4ABZ A;  2EQR A;  2L54 A;  4MHG A;  4MGR A;  2FBK A;  3F21 A;  3S14 J;  4U0V A;  1PP8 F;  1UEL B;  1U6G A;  4YFX F;  2K9N A;  2DJN A;  4EM0 B;  1EV7 A;  4S04 A;  2R7O A;  3G2B A;  1ZK8 A;  2DJI A;  4BQQ A;  4A3I J;  4RAY A;  1O3Q A;  2LSO A;  3GZ5 A;  3H9G A;  5JHF A;  1FJL A;  4J00 A;  4EVI A;  1X2N A;  3T8R A;  2C6Y A;  4BE0 A;  2GOX B;  5FFX A;  2CV1 A;  4EQQ A;  2HS5 A;  2ZJP F;  3BOQ A;  2M87 A;  4D7N A;  5HNH A;  3SEQ A;  3D1N I;  1J09 A;  3GWZ A;  1UB9 A;  3HSE A;  4II3 A;  4LJZ F;  1U5T C;  1FBQ A;  3R60 A;  3HIF A;  2R5Y A;  1REP C;  5E3M A;  4GYG A;  4F93 B;  1TT0 A;  1GXQ A;  4B8X A;  2F5V A;  1XSD A;  2IA0 A;  3TL4 X;  1MMG A;  4BBS J;  4XSX F;  3LSP A;  3D5S C;  2M34 A;  4RAF A;  4KIF A;  2ZC2 A;  5E17 F;  2W25 A;  2R92 J;  2W85 A;  4UVB A;  1XN7 A;  3S32 A;  2CW0 F;  4M3G A;  4CZZ A;  4GDF A;  3BY6 A;  1Y56 A;  3M8E A;  1Y1V J;  3ABK H;  3ABL H;  3MZH A;  2PEX A;  4Y15 A;  2HDW A;  3PSI A;  2A6H F;  2XAU A;  2LP0 A;  3TDZ C;  3F23 A;  3GCM A;  4MO7 A;  2P7V B;  2VBW A;  1I5Z A;  2I10 A;  5F6F A;  3U1K A;  2W1O A;  4Q4Z F;  4CGZ A;  3Q0W A;  2R5Z B;  1WVR A;  1YX5 A;  2H09 A;  5EJC A;  5A2Q Z;  3O6B B;  4ZDL A;  4CSW A;  1XB4 A;  3Q0V A;  3WTT C;  4BKX A;  4ANJ A;  2ZB9 A;  4D1Q A;  5BPD A;  1N75 A;  3WG7 H;  5K5Q A;  1MBG A;  2FE3 A;  5FRN A;  1IG7 A;  3BTC A;  2LOO A;  3MZ8 A;  3WTU C;  2EH3 A;  2V1U A;  1BA5 A;  1ZRC A;  2H6C A;  4B3A A;  2UZK A;  5TRD A;  2XGE A;  3GW2 A;  4IKF A;  4AU7 A;  2X6W A;  5LFA A;  5CVV A;  4MFE A;  1JHF A;  4G6D A;  4BHP A;  1J59 A;  3S1R J;  4RGR A;  3KE2 A;  2ECB A;  2P6S A;  1S8N A;  2BXY A;  1HSJ A;  2JT1 A;  1V4R A;  2DT5 A;  3KZI C;  4W1U A;  3OYI A;  2XPW A;  4IX7 A;  4LIT A;  3ONQ A;  3V7C A;  1ZR4 A;  1U0J A;  3A0H C;  1XGN A;  4M3E A;  1TQM A;  1Z0X A;  2TCT A;  1Z05 A;  2HYG D;  3ABU A;  4ZYA A;  3KP6 A;  3LST A;  1X58 A;  3ZXS A;  4L9J A;  1K7A A;  1WKM A;  2QVO A;  5EF6 A;  3GFJ A;  2CQ7 A;  3LQQ A;  3CCR I;  2EZI A;  2DXI A;  3C2B A;  4G12 A;  3GTK J;  2MAB A;  2YX7 A;  1SFK A;  3W6V A;  3COA C;  1UHM A;  3ZP5 A;  4AIJ A;  1UHS A;  1BR2 A;  3PM1 A;  3PNY A;  3IRR A;  5GAD J;  2M0C A;  2Y0S A;  1ZTR A;  1TT5 B;  3QOE A;  2R5Y B;  1IF1 A;  3H3Z A;  1WJA A;  1ETQ A;  4FET A;  3ZQH A;  2IS4 A;  4P96 A;  2OQG A;  3QAH A;  2JN6 A;  1R9T J;  3QPH A;  3M3Y J;  5ED4 A;  2I5U A;  3WOD F;  3MKZ A;  4E6K G;  1VQP I;  5F1R A;  3KYC B;  4FIS A;  2DN0 A;  3S93 A;  4DZJ A;  1NHA A;  3HG9 A;  4RMN A;  4CYC A;  3FK6 A;  2CQQ A;  3JW4 A;  2DA6 A;  1UMQ A;  3GFM A;  2IS2 A;  2GXG A;  2FX0 A;  1ORK A;  2VPL A;  1MZB A;  4XOR A;  2MG4 A;  3S15 J;  1BBY A;  2VJ4 A;  3H5A A;  3MZY A;  3P9I A;  3O3K A;  3E6C C;  2CH0 A;  3A1Y A;  1EJ9 A;  3M8J A;  1DGW Y;  2X1D A;  4YIR X;  5ICG A;  4GCV A;  1ZN2 A;  3MN2 A;  5EG0 A;  2F4O B;  2L4A A;  4G7H F;  5KVR A;  4AYB A;  1ON1 A;  2E7W A;  3DPU A;  4QSH A;  1CF7 A;  1NTC A;  5E3N A;  1ZRE A;  3W6J B;  3AG3 H;  3HKZ A;  2IT0 A;  2JVH A;  5LRR A;  2R0Q C;  4IHS A;  3LSI A;  3QYB A;  5J8C A;  4A3K J;  2VOO A;  3DEE A;  5FKN A;  1VF9 A;  2M0M A;  2HOT A;  3PO2 J;  2ICW G;  4HF0 A;  1XGO A;  5EEA A;  1JGG A;  3J80 K;  4YEL A;  1BI1 A;  1ETO A;  2HQN A;  2KIS A;  2V79 A;  3Q3S A;  1JT0 A;  2JVG A;  3QP6 A;  3A0B C;  2LKX A;  3LSJ A;  4AUX A;  2LTP A;  3N97 A;  1GXP A;  2IS6 A;  5TJJ A;  1W0U A;  1I27 A;  2PN6 A;  3KEO A;  4E7Z A;  5JFR A;  3CMA I;  4HF2 A;  2JUC A;  1D5V A;  1YRN B;  1P4W A;  4L5I A;  2HVQ A;  2V7F A;  1IJW C;  1D0X A;  3AFH A;  2VKE A;  3ABT A;  3O8H A;  1HLV A;  2L2O A;  5J47 A;  2GIZ A;  4A12 A;  1TTY A;  3QQA A;  2OJE D;  4BE2 A;  4CCM A;  1VND A;  2HOS A;  1O4X A;  1ULY A;  1WFX A;  2EV0 A;  4Y33 A;  2GZW A;  4QIW N;  3FMQ A;  3LSM A;  3HGG A;  3A03 A;  1FMW A;  4OIR F;  5LBQ A;  2CWE A;  5IY5 H;  4YIF A;  1RZ4 A;  2A6T A;  1BR1 A;  2O6G E;  1ZGA A;  2OZU A;  2R7R A;  1U2W A;  1YJW I;  3JRC A;  1I1S A;  4EJT A;  3DV8 A;  3TQN A;  3FM3 A;  1RKW A;  2ZSH B;  3J81 Z;  1XDU A;  5L3C A;  2JK3 A;  1J0R A;  3TP0 A;  5GPC A;  2OBP A;  2RNG A;  4HX7 A;  1R1V A;  1A36 A;  1GV5 A;  4RB1 A;  3K2A A;  2ID3 A;  2PMZ N;  4Y17 A;  1X1P A;  1IV6 A;  1JJ6 C;  5EG0 B;  2QA4 I;  3LAJ A;  3ZQG A;  2E7X A;  1CF7 B;  4WWC A;  3HDD A;  3VOE A;  3QU6 A;  1FBU A;  2WB1 A;  1B59 A;  1XMK A;  2M3A A;  4KFC A;  3D5L A;  1XGM A;  2OZ6 A;  2WY7 Q;  2DMT A;  3HJE A;  2KDO A;  4FQG A;  3OIO A;  4CH7 A;  5HLH A;  4KYW A;  3JR9 A;  3I4M J;  1F36 A;  2AO9 A;  2A61 A;  2KT0 A;  3QPT A;  1T33 A;  2LF8 A;  2EFN A;  3LFU A;  3REO A;  4AYB N;  2ZNZ A;  2NNN A;  4NBQ A;  2GWR A;  1B9N A;  1X1A A;  5DEQ A;  2E5Z A;  3VFZ A;  5L3E A;  3HKZ N;  1FYK A;  1MKM A;  2DBB A;  2HOE A;  2VON A;  1K83 J;  1TW2 A;  4M74 A;  2XF7 A;  2O61 A;  2BHZ A;  1V54 H;  2H94 A;  3U2R A;  3IKT A;  4MEY F;  2LRE A;  5ICF A;  2AXL A;  4UUS A;  1YO5 C;  4FAS D;  2LLK A;  2LNB A;  4XLN F;  2BEO A;  2HVR A;  2NVU B;  4I2O A;  3T1B A;  3S1M J;  3G3Z A;  4R8H A;  2DA5 A;  2YR2 A;  2P7C B;  1HC8 A;  1VI0 A;  3CZ6 A;  1HF0 A;  1SD6 A;  3VYS B;  2GLO A;  1MMS A;  3BLY A;  4G94 A;  3W2V A;  3BR2 A;  3GO5 A;  4GXO A;  5IPA A;  1YJ9 I;  1SD5 A;  1FC3 A;  2R3S A;  3OYM A;  3KX2 A;  2Y48 A;  3HRM A;  4L9V A;  4BUP A;  1R23 A;  3IV5 A;  1MMA A;  1Z3X A;  2NOJ B;  5LEJ A;  2PMH A;  1XSV A;  2GAU A;  1YW8 A;  2FU4 A;  2LDU A;  2VQH A;  3OYH A;  3I0T A;  3H1C A;  2HGC A;  3PNV A;  1G3T A;  3PO3 J;  2FF4 A;  2XKO A;  2STW A;  2WV0 A;  3KP4 A;  3KZZ A;  1MBF A;  3JAM Z;  5F27 A;  3S2H J;  4CDG A;  3CCE I;  4EMS A;  4N9I A;  4R79 A;  2B63 J;  3SXY A;  3WTX C;  4IO9 F;  4A93 J;  3RKQ A;  1VQ9 I;  1W0T A;  4PJL A;  1XD7 A;  2ELJ A;  4EJV A;  3IWF A;  2OD5 A;  2WAD A;  4MEX F;  2GQQ A;  2EB7 A;  4F7Z A;  1PDN C;  4IQJ A;  3TW7 A;  3I58 A;  1OYI A;  1PUF A;  2WBM A;  1NG6 A;  4RGU A;  3RPU A;  1UCR A;  2JTV A;  4IEJ A;  4KJZ A;  2R7W A;  3V8L A;  3MKL A;  3E97 A;  3BP8 A;  4M71 A;  2XKP A;  4JK1 X;  1YTY A;  3GFI A;  2QQB A;  5FLV A;  1GDT A;  1HCR A;  4F3Q A;  2VN2 A;  3CP2 A;  1IN8 A;  2L7Z A;  1XG1 A;  2LFB A;  3QU3 A;  3K0L A;  2OAZ A;  2FRH A;  4F52 A;  4NNJ A;  3C1D A;  2Y0M A;  3F9K A;  2XPU A;  2MLG A;  5JI6 A;  3SJM A;  4B4C A;  4UUS B;  3BCA A;  1ETW A;  2R7V A;  4GRI A;  4EM2 A;  4DIQ A;  4DBQ A;  5HDN A;  1R58 A;  3I64 A;  5D5V B;  2ZME B;  3D0S A;  2J5O A;  3MAJ A;  1JKQ C;  4PGH A;  3I54 A;  1E2X A;  2H1L A;  2OF7 A;  2QQA A;  2RV8 A;  1ETY A;  1KZH A;  2NVQ J;  3P9C A;  2R7F A;  1E3O C;  2IBD A;  3CF2 A;  3L2W A;  3EUH C;  1K6Y A;  3BPV A;  1CGP A;  3ZOB A;  3WTW C;  3HOZ J;  2NVY J;  3W2A A;  3WU0 A;  4ITV A;  1R5H A;  2Z99 A;  1W1W E;  2XAG A;  3VWB A;  1GHC A;  3IH4 A;  4D0P A;  1PVE A;  5AIQ A;  3QOP A;  2E36 A;  4DOZ A;  3WU2 C;  4ON0 A;  5GAH J;  2FOK A;  1MBH A;  5FJ8 J;  3GTO J;  1T0F A;  4MTE A;  5GPA A;  4NB5 A;  4KIT B;  4YEJ A;  5M3M J;  1K78 A;  1VQL I;  1DGR M;  3EYY A;  5C3E J;  3DU6 A;  3WGI A;  3RYR A;  1WGX A;  3OYN A;  1Q1V A;  4ZYD A;  3T5X A;  3K7A J;  2I8D A;  1RIO H;  1XX5 A;  2DK8 A;  3S1Q J;  2KIM A;  1HXD A;  1DUX C;  2EFO A;  3OR1 C;  3KET A;  4NC6 A;  4WCG A;  3G73 A;  2CUE A;  2NAZ A;  2JJ7 A;  1PUF B;  3CJR B;  3CCL I;  3QPL A;  4EGY A;  1T56 A;  5HDG A;  1Z91 A;  3PQK A;  3SHF A;  1S3J A;  3TO7 A;  2JA8 J;  4LD5 A;  2CYY A;  3WHC A;  4XIC A;  4U7B A;  1IN6 A;  2G9W A;  3QPS A;  2EJR A;  3IH3 A;  2XRN A;  4QWQ A;  2JWT A;  3M7G A;  4ZDO A;  3FBN B;  2HOA A;  1IDY A;  1GV2 A;  3ASN H;  4KMU X;  3VB2 A;  2IA1 A;  4CXF A;  5LGT A;  2EBI A;  2BXZ A;  2O8K A;  1FX7 A;  3WTV C;  4A6D A;  1ZG3 A;  3OOP A;  4M3D A;  1X3U A;  4U7D A;  3CC4 I;  1OJL A;  3J7A Y;  4E7K A;  2OUM A;  4D7M A;  3DKY A;  4XLP F;  1HOM A;  3VSL A;  3GEZ A;  2Q0O A;  5GP9 A;  4OU0 A;  3BTI A;  1TL8 A;  3CCQ I;  2V1N A;  4DBR A;  1HDD C;  4HPQ A;  1BI3 A;  1Y1W J;  3VYR B;  4UVA A;  4LFU A;  1FT9 A;  2HWV A;  4CCK A;  5IYB J;  2AQF A;  2E1O A;  4LG0 A;  5IT3 A;  4HDU A;  5FD5 A;  2PJP A;  3G1O A;  3OYA A;  2Z3Y A;  1FWZ A;  4P9F A;  4J01 A;  1WJB A;  3JRI A;  4ENJ A;  2F4M B;  3PIO F;  3F8M A;  3SFZ A;  3DEW A;  4IXA A;  2NS0 A;  3FMR A;  2IPQ X;  2FBH A;  3M8F A;  1A31 A;  2D45 A;  1SVM A;  3LA2 A;  2X0L A;  5KK1 A;  1OR7 A;  2LKS A;  2QEX I;  2BVL A;  1B6A A;  5GTH C;  1HKS A;  1YW7 A;  2XB0 X;  3E0J B;  5D4R A;  3CME I;  2FBI A;  1K78 B;  3GTQ J;  3KP3 A;  3RYP A;  1TWF J;  1XC5 A;  4IHW A;  1QGP A;  4ASN A;  3EUA A;  3HHG A;  5DD4 A;  5F0F A;  2F48 A;  2XRL A;  5HS9 A;  4A3D J;  3WTZ A;  4Y7N J;  2G7U A;  5HVQ C;  4MTD A;  2WAQ A;  4AVZ A;  4G7Z F;  2P4W A;  3I3L A;  3GZN B;  3VEP A;  3BR6 A;  1BOA A;  1FPQ A;  3QYE A;  3U1D A;  5ILV A;  3HGY A;  4EGZ A;  4HSR A;  2OCE A;  2R4G A;  1G4D A;  2HKO A;  1QVU A;  3K4N A;  1MSE C;  5CLS A;  4H4K C;  3ROU A;  1P92 A;  3ZMS A;  4FCY A;  3UR3 C;  4QPQ A;  3NEU A;  2K9M A;  4XKV A;  1KQ0 A;  2V9P A;  3MCZ A;  2M1B A;  3CUQ C;  1YI2 I;  2QF7 A;  1QZZ A;  1ODD A;  3L00 A;  3S8P A;  1EA3 A;  2M9H A;  1AU7 A;  1BC7 C;  2M4K A;  2XB5 A;  2STT A;  1XTA A;  4IPA A;  3HOU J;  2IEK A;  1RC9 A;  2BGC A;  3JRF A;  3KYL A;  3F22 A;  2AQE A;  3M9A A;  5E8I A;  2DA3 A;  4M6Y A;  4PZJ A;  4KDP A;  3W3C A;  5LHG A;  3GLL A;  1LJ9 A;  4BHB A;  3LOC A;  3BR1 A;  3CMM A;  1GVJ A;  4E7J A;  4LG0 B;  3DTI A;  1BN5 A;  2VLA A;  3B6A A;  2RQP A;  3BRO A;  2R7S A;  5DM7 F;  1TP4 A;  1RUO A;  3K4B A;  1FIA A;  4D5F A;  3Q0U A;  1ZAR A;  2PQ8 A;  2X51 A;  3E6M A;  4IVN A;  4B48 A;  5L3G A;  2MA3 A;  2PFB A;  1ETX A;  1JTX A;  2QKL B;  2IJL A;  2PI0 A;  2LC2 A;  4IJA A;  5DUK A;  3S1N J;  1J9I A;  3NWS A;  3HL2 A;  4Q48 A;  2ZXI A;  2V1D A;  5JR3 A;  3DEU A;  2RVC A;  3ZRG A;  1JXS A;  4A0Y A;  5L3F A;  3AG4 H;  2DTZ A;  4DYQ A;  1PP7 U;  5JLW A;  2GM4 A;  4XSZ F;  3HRU A;  3IL2 A;  2IS1 A;  2QSF X;  1AOY A;  2HTJ A;  3EET A;  1Z3Y A;  4LK1 F;  4N9H A;  2DA4 A;  3R0J A;  1JUM A;  2KRH A;  3HOV J;  2R7Z J;  1OLT A;  2NVX J;  3VYU B;  2E35 A;  2KFD A;  4I0B A;  4BAY A;  3L09 A;  3OYJ A;  3RSN A;  2B0L A;  2M4G A;  5HDK A;  1PYV A;  1U5T A;  2LY1 A;  5TIS C;  5E20 A;  4U0Y A;  1U78 A;  2EK5 A;  2V9V A;  3CF5 F;  3ULQ B;  4FX4 A;  3TO9 A;  3TW6 A;  3GXO A;  4RAZ A;  3FIW A;  2DT6 A;  1MD0 A;  4G9Y A;  3X2Q H;  4BY7 J;  1VQM I;  3FXK A;  2CS3 A;  2LG4 A;  2XGC A;  1SMT A;  1VQK I;  5H6R A;  2A5W A;  4CCL A;  4O6J A;  2DI3 A;  4RLQ A;  2HXO A;  2HYF A;  2VOD A;  4Y52 J;  4HNU A;  1PJR A;  1QA6 A;  2BY1 A;  3IC7 A;  1RR8 C;  1VQ5 I;  4EAT A;  4A3F J;  1SMY F;  2KQR A;  4KIC A;  3HXL A;  4RBO A;  2O7O A;  2ME6 A;  2VC1 A;  2VOP A;  2P8T A;  1DU0 A;  1IRF A;  5FFZ A;  1YOV B;  3PUF A;  3CTA A;  4M9S A;  2Y30 A;  2YX4 A;  5CVR A;  1FYM A;  3DBH B;  1LVK A;  3N05 A;  5M5W J;  3PSF A;  1WJF A;  3QRF F;  3OL3 A;  3GTL J;  2Y9Y A;  1WJE A;  2GBY A;  2ESN A;  1W5S A;  2G7H A;  3ZR8 X;  4HV5 A;  5E8G A;  3SDG A;  1WJ5 A;  2BVM A;  1WSU A;  3K4M A;  1QNT A;  1IDZ A;  3N4M A;  3V4G A;  1D8K A;  2HPM A;  1Z67 A;  2W7N A;  4O5V A;  4GO1 A;  2VXZ A;  2J5P A;  2BY0 A;  4WXD A;  3IRQ A;  4OIQ F;  2EA4 A;  3TED A;  3CCV I;  2ZXH A;  1R4M B;  1OYW A;  3LSH A;  4I6Z A;  1FEX A;  2XAF A;  2QUF A;  2P5V A;  3RKY A;  2K3P A;  1X4P A;  2XAQ A;  3H0G J;  2DMQ A;  4KNY A;  4JP0 A;  2K4B A;  1Z1D A;  3FWE A;  3K4L A;  4LIV A;  1FOK A;  3RDI A;  2WWY A;  1E3H A;  4Z2Y A;  2BY3 A;  2LF7 A;  3HOT A;  2WTE A;  2BHY A;  3EPZ A;  3LSK A;  4IRG A;  4D5C A;  4XK4 A;  3GUD A;  2ELH A;  3C18 A;  3IWZ A;  2HI3 A;  1VQN I;  5LGU A;  2AS5 F;  2EZH A;  1RES A;  2WAF A;  2VPR A;  4ZZL A;  4M3F A;  4RLF A;  1L0O C;  3L2R A;  2A5Y B;  2W00 A;  2JPC A;  4S0H B;  1JJ8 C;  2VKH A;  1W7P A;  3K1M A;  1ENH A;  4XNF A;  3KPH A;  4M9X A;  3K4K A;  5LHH A;  2Y75 A;  1R6R A;  4G6T B;  1Z6R A;  3A02 A;  2HTS A;  1BM9 A;  1H89 C;  3IAS 2;  3F8C A;  5J1R A;  1A6Q A;  5LRS A;  3FXJ A;  1TNT A;  3DQV C;  3FKI J;  2OTL I;  2O8X A;  3BZK A;  2UWM A;  3GVA A;  3FF5 A;  4IHY A;  4P55 A;  3CJT B;  4IRI A;  4A3B J;  1YLF A;  3OY9 A;  2CQN A;  3SDB A;  1TNS A;  2YSR A;  3HTU A;  5ICE A;  3OYF A;  2XSJ C;  1RUN A;  2KRF A;  3KLN A;  1HKT A;  2E1N A;  1ZR2 A;  2FXA A;  4DNC A;  1S6L A;  3UNG C;  4N4N B;  1MDM A;  1Y0U A;  3CQZ J;  3MKW B;  1TQP A;  4BY1 J;  1OKR A;  4XBF A;  4KUM A;  1BR4 A;  1A6I A;  4MQV A;  4HLY A;  3AAF A;  2LVS A;  3W2W A;  1FSE A;  3T0Y A;  4HV6 A;  2RC4 A;  3CLQ A;  3RZO J;  4U87 A;  3I5U A;  3HHH A;  2IGN A;  3B6C A;  3BG9 A;  3K1N A;  2PBI A;  1Q1H A;  3ISP A;  4V2G A;  2F6C A;  2VBY A;  3HSR A;  4KIS A;  1WI3 A;  4JX4 A;  4XM3 A;  5JVT A;  4AID A;  5DS9 A;  1LFP A;  2P81 A;  4O3M A;  2DU9 A;  1WI9 A;  1X1D A;  3LQR A;  2V6C A;  4EJO A;  2O0Y A;  4EJU A;  5FLX K;  1G2H A;  3WU1 B;  3B02 A;  1WPK A;  3RKX A;  1ITY A;  2KL4 A;  4BAC A;  1P2F A;  3MFK A;  2LK2 A;  1KU7 A;  5D4S A;  4CZC A;  1NH3 A;  4HA8 A;  2O9L A;  5B66 C;  3RTR A;  1W7P B;  5L3D A;  2EIN H;  4Y4R A;  5HOD A;  1LB2 A;  1V55 H;  3AG1 H;  1IGN A;  3WE3 A;  4CYC B;  3OIP A;  2M8E A;  1Y8R B;  2DW4 A;  1BOB A;  3PFI A;  5D5W B;  2CFO A;  1LDD A;  1BW5 A;  2IGK A;  2ZJR F;  3MVP A;  4B43 A;  3OS1 A;  5F0C A;  2Y0S N;  1P4X A;  1T8I A;  2BZT A;  2X9D A;  2DMU A;  2FJ1 A;  3K4C A;  2MD5 A;  4DW6 A;  3CCY A;  1IUF A;  4A3J J;  3H9J A;  4J19 A;  1WJC A;  1UAA A;  2VJJ A;  3DKX A;  3MEX A;  1FOX A;  4TV7 A;  4B09 A;  1TWH J;  4BH9 A;  1LNW A;  1T08 B;  4HEA 2;  4A5N A;  2HFH A;  4IL6 C;  4E7H A;  4BXX J;  1I1G A;  3I9V 2;  3HOS A;  4UUT A;  2F5C A;  3ZQQ A;  1E3P A;  1RI7 A;  4LK0 F;  3RZD J;  4U0W A;  1G3W A;  3DU5 A;  1FBS A;  5FGM A;  4RB2 C;  1T38 A;  2HXI A;  2K02 A;  5J40 A;  4BXU A;  4RA2 A;  1MDM B;  4RB0 A;  4FHT A;  5CJ9 A;  4RS8 A;  5M5X J;  3SZT A;  1HST A;  1JKO C;  1D5Y A;  1Z9C A;  4YFN F;  3PUB A;  2LYC A;  1YJN I;  2DQR A;  1MGT A;  4IHT A;  3AG2 H;  2ZFW A;  2D5V A;  1LDJ A;  1DDN A;  1K6O A;  1BI0 A;  1HKQ A;  1FOW A;  2ECC A;  1Z21 A;  2F5F A;  3LL7 A;  4CCJ A;  1KU3 A;  1QZY A;  3U9G A;  4UHT A;  4HBL A;  3RIR A;  3O8G A;  1F5T A;  2VQC A;  2DDB A;  3J80 Z;  1YYV A;  3NWT A;  2FQ4 A;  4XLC A;  1VFC A;  3CDI A;  1IZ1 A;  1KU9 A;  4P1W A;  1Y6I A;  2MH9 A;  3LA3 A;  4AM3 A;  2VQG A;  2E5N A;  2LKP A;  1U9O A;  2R7T A;  2VT3 A;  2JQ7 A;  5CQG A;  3GLX A;  1GT0 C;  2ZJQ F;  2N8G A;  2ZME C;  3PNT A;  1GUU A;  3PL8 A;  1AKH A;  4X1E A;  3ZMT A;  3M4O J;  2NS7 A;  3FXR A;  5IT9 K;  2W4S A;  1WJD A;  5KAF C;  3RI4 A;  1RNL A;  1WH5 A;  2L9S A;  2XF5 A;  2EIL H;  4IOA F;  3DTE A;  3OOU A;  4W97 A;  4F92 B;  3BTL A;  3CDH A;  2QZ8 A;  1R7J A;  1SD7 A;  1IV8 A;  2QQ9 A;  4JOM A;  5E1Z B;  1BW6 A;  2BE5 F;  2M2E A;  1HA8 A;  3I53 A;  2QEN A;  4MFD A;  2Y9Z A;  2D1V A;  2DQL A;  2AXT C;  4XOT A;  1D3Y A;  2VKD A;  2EFW A;  2X85 A;  1W5T A;  4KT5 C;  4CCO A;  1ZLJ A;  3OYL A;  1B8I A;  1QBJ A;  1MNM C;  1U8R A;  4HLX A;  2CMP A;  4KMF A;  3F0C A;  3GZ6 A;  5IYC J;  2WV1 A;  5M3F J;  2DOA A;  2VXD A;  1JTY A;  4G6Q A;  2DFE A;  1A5J A;  5GTI C;  3RPQ A;  2FA5 A;  4HQE A;  2A6E F;  2CUF A;  9ANT A;  2G0E A;  3ZN1 A;  4PCQ A;  4PJJ A;  3NRV A;  5LLQ A;  1K61 A;  3MD2 A;  1FY7 A;  2HZT A;  3C2G A;  3MMY B;  4PJN A;  3HTS B;  4RM3 A;  1YW9 A;  2X4H A;  2WB1 N;  1FSH A;  2IVM A;  5FKL A;  5HLG A;  2ZCW A;  3OL4 A;  3LSG A;  1KA8 A;  1UZC A;  3FXQ A;  2H1K A;  4ZYE A;  3PFY A;  4E70 A;  3F72 A;  1Z7L A;  1UG2 A;  5IOZ A;  1R1U A;  3FKJ A;  3VYT B;  1V3F A;  1YQA A;  3H5N A;  1FP1 D;  2E34 A;  1F43 A;  2X6O A;  5K1Y A;  1DPR A;  4BEH A;  1MMN A;  1MH4 A;  4BGD A;  2L9V A;  1VQ7 I;  2L5Q A;  5CVJ A;  3OV8 A;  5C4X J;  3R61 A;  2H6B A;  2L02 A;  2KRC A;  2M5W A;  4XLE A;  1XS9 A;  1ZH5 A;  2RRE A;  1OCP A;  4BL0 B;  3CCU I;  2L4M A;  4HOB A;  3ZMV A;  3EUH A;  2CW7 A;  2B7E A;  1DQU A;  1BJA A;  4A3L J;  1HQC A;  2DLL A;  2FOW A;  3OYG A;  4UUV A;  1D1A A;  2K7L A;  1JKR C;  2EZK A;  1RRJ A;  4WF2 A;  1AKH B;  1U9N A;  2VJ5 A;  1R71 A;  3S16 J;  4I09 A;  2ZSI B;  4LIU A;  2KPM A;  2FMY A;  3AL0 B;  1NG7 A;  2ESH A;  1P7I A;  4LLL A;  5EEH A;  4L5J A;  2IW5 A;  3RCO A;  4RDU A;  2JSC A;  5KCM A;  4CCN A;  2OV7 A;  1MJB A;  1SFE A;  1B4A A;  4ZJZ A;  4XKC A;  2MSY A;  1T95 A;  1LEA A;  4C3I J;  3ZQL A;  1VQ8 I;  5EZG A;  3HYI A;  3SEZ A;  3BG5 A;  1R5G A;  2XPV A;  2MYS A;  1T0F C;  4BU2 A;  1B8I B;  5FRM A;  1SFU A;  2DMN A;  4XKW A;  3S3O A;  1MBK A;  1XDS A;  2XHK A;  3C7J A;  1H8A C;  1ZKG A;  4EJW A;  3K9T A;  2EWN A;  2DFI A;  3DLA A;  1ERD A;  4M6X A;  4OIN F;  2YS9 A;  3VOD A;  1MBE A;  4JYK A;  2OA4 A;  2XAH A;  3P7N A;  1G3Y A;  3UKG A;  3H92 A;  3OS2 A;  4L9T A;  1X4O A;  1X1C A;  2DOF A;  2EV5 A;  3KZY A;  3K6G A;  5FKM A;  3CES A; 
#chains in the Genus database with same CATH homology
 2NNY A;  3KP5 A;  1IN4 A;  2FML A;  1F1Z A;  3ECO A;  1ZAO A;  4I7H A;  3WGG A;  3L2C A;  1AWC A;  4JBA A;  3SZP A;  1HW2 A;  2CFX A;  1ON2 A;  4OIP F;  2GA2 A;  4JQF A;  1YS6 A;  2F5E A;  1WQ2 A;  3FHZ A;  2RNJ A;  2DAO A;  3E3V A;  4ZYG A;  3FX3 A;  3LA7 A;  2JPB A;  4A0X A;  4BHC A;  3CO6 C;  2IRF G;  1KU2 A;  1IW7 F;  3WE2 A;  4R1H A;  2KIU A;  4XRF A;  3O2P E;  1KYZ A;  3LFK A;  5J8F A;  3SQN A;  5DCM A;  3ZN0 A;  1YG2 A;  5D5U B;  3JTG A;  5BQT A;  2L3D A;  2HQR A;  3P9K A;  1XMA A;  2GXB A;  3EYI A;  2WC2 A;  2BBY A;  4LB6 B;  3TKY A;  4WXC A;  2DTR A;  2EA2 A;  3FMS A;  4LB5 A;  2YU3 A;  3DKW A;  1HBX G;  1W4M A;  2VT2 A;  2RKH A;  1WRJ A;  2JZY A;  3V7S A;  4L0Z B;  2DPD A;  4LLG F;  4UVC A;  3M1E A;  3BWG A;  3CUQ A;  3DF8 A;  1LDK B;  2K4J A;  3IKV A;  3BJ6 A;  2DK5 A;  4ENN A;  3V8K A;  1UST A;  2XGX A;  3KP2 A;  4LGW A;  5JHU A;  5A2Q K;  4IF4 A;  4OIO F;  4RGS A;  1S7O A;  2IP2 A;  3V8J A;  1R36 A;  1XGS A;  1EH8 A;  3HRT A;  1O7F A;  2GIV A;  2QWW A;  2O3F A;  1LEB A;  4AIH A;  1S29 A;  5K5R A;  3Q9S A;  4L18 B;  2VE8 A;  2CSO A;  2CQK A;  1STZ A;  4AD9 A;  1JHH A;  4KIG A;  1EH6 A;  4I98 B;  4HAM A;  2PLY A;  3F3X A;  3E6D A;  1TLH B;  1TW3 A;  1OYY A;  3ZPL A;  4L0Y B;  4I0A A;  1O3S A;  5DCM B;  4UV8 A;  3E5Q A;  2D1H A;  2Z5U A;  1B9M A;  1H9T A;  1HW5 A;  2OQR A;  2ZJ2 A;  1P4A A;  3E5U A;  2ZO4 A;  5ERI A;  3R4K A;  3CUQ B;  3LWF A;  4ESJ A;  5AON A;  2HR3 A;  1ZYR F;  1P6R A;  3TOB A;  2XVC A;  1O3T A;  5D6E A;  3WGH A;  3CLO A;  2VE9 A;  1IRG A;  1UHW A;  3WTS C;  4Q5S F;  1YS7 A;  3GYH X;  4CIC A;  3Q5F A;  3JSP A;  5D8K B;  1J5Y A;  4BQA A;  1A04 A;  4HX8 A;  5D8L B;  1JGS A;  2RDP A;  1WWX A;  5H6Q A;  2UXX A;  2OU2 A;  3PQJ A;  3DXJ F;  1KQ9 A;  4ZYH A;  4WX9 A;  2QBY A;  1SAX A;  2RN7 A;  3IHU A;  1UFM A;  1G3S A;  4UNO A;  4ZH4 F;  1USS A;  5EEG A;  4FX0 A;  4M73 A;  4A0Z A;  3NQO A;  3TDU C;  5F64 A;  4HZF A;  1SFX A;  3BDD A;  5CYV A;  3ERE D;  1U5T B;  4S05 A;  2F2E A;  1YFH A;  1H0M A;  1BI2 A;  1T6S A;  2KJB A;  3J81 K;  5DUI A;  1Z6T A;  4KN7 X;  3EQL F;  1KGS A;  4NHJ A;  2A3S A;  1J7K A;  3KFW X;  3I71 A;  4N0B A;  3DFG A;  2F5D A;  3GFL A;  4ETS A;  2VC0 A;  1VTN C;  4CYD A;  1J75 A;  3JTH A;  2K86 A;  4FT8 A;  2FEZ A;  4AVP A;  3FZV A;  4NQW A;  1DP7 P;  2MLK A;  5J6X A;  2HEO A;  2CO5 A;  3H3U A;  2L01 A;  2O03 A;  2MC3 A;  4YG2 F;  1H9G A;  2QBY B;  1ZLK A;  2IA2 A;  5LGN A;  1YIO A;  2KJC A;  2UXN A;  1FYL A;  1R22 A;  3FM5 A;  1L3L A;  4M9Z A;  1FP2 A;  4HQM A;  2M45 A;  2QYO A;  1R1T A;  3L7W A;  1LVA A;  5E1W A;  3QP5 A;  3TOA A;  2DO7 A;  4KN4 X;  1OMI A;  2P6T A;  3R0A A;  1ONV A;  3ELK A;  1U3E M;  3KEQ A;  3DP7 A;  4RGX A;  1BIA A;  3WG9 A;  4YII A;  5LEK A;  3RKW A;  1LQ1 A;  2NRA C;  4LLN A;  5HLI A;  3JAM K;  4HX4 A;  5CVU A;  2COM A;  2XAS A;  2XIG A;  1ZRD A;  3F8F A;  3I4P A;  2P5L C;  4A6E A;  3F8B A;  4WXH A;  4PGG A;  3KLO A;  2FSW A;  1QPM A;  2GA1 A;  1KYW A;  2D2W A;  2XV4 S;  1FZP B;  4Y13 A;  3TO6 A;  5HS8 A;  1ZHF A;  6PAX A;  3RJP A;  2Z9O A;  2XUB A;  3DPL C;  2TDX A;  2ETH A;  4OOI A;  4KIB A;  4Q47 A;  1MJA A;  3B73 A;  4P9U A;  1IXC A;  3CUO A;  3E5X A;  2E1C A;  4G8X A;  1IN7 A;  5D6F A;  5FD6 A;  4HW0 A;  2V1X A;  5BPI A;  2PMU A;  3HSF A;  2KKO A;  3GF2 A;  1KQ8 A;  4H0E A;  2ZME A;  1TBX A;  3MWM A;  2BYV E;  5ILS A;  5HOO A;  1ZGJ A;  3F8N A;  3I59 A;  1JE8 A;  4I01 A;  5FLX Z;  5ILU A;  2ZKZ A;  1XCB A;  3MQ0 A;  5HS7 A;  5DCF A;  4QLC U;  4HYE A;  4BNC A;  1F9N A;  4GGG A;  2NYX A;  4LMY A;  1FLI A;  3JSO A;  1T98 A;  4BYY A;  4ENM A;  5DV5 A;  3C3W A;  4PDK A;  2ISZ A;  2KIF A;  4IRH A;  1EH7 A;  3ZMD A;  3V7R A;  5BS6 A;  1QO0 D;  2FNP A;  4HDV A;  4OMY A;  3ZMZ A;  1DPU A;  4OMZ A;  1D8J A;  5D5X B;  2A69 F;  4ESB A;  4EV0 A;  2EFQ A;  5DDG A;  2FQ3 A;  4KA4 A;  1FNN A;  3FXU A;  3K2Z A;  4A2U A;  4I02 A;  2W84 A;  1O3R A;  2FNA A;  5BMZ A;  3I59 B;  2DPU A;  2XRO A;  1ZG1 A;  5FO5 A;  1IXR C;  2ISY A;  1ZRF A;  2ZBK A;  2PG4 A;  2M30 A;  2ADU A;  2VBX A;  1XCV A;  5IT9 Z;  2MH2 A;  2JRT A;  3BJA A;  1R00 A;  3BPX A;  5FB2 A;  4RB3 C;  1B1B A;  2Q2E A;  3TGN A;  3EDP A;  2ACJ A;  1QQI A;  3BZ6 A;  3K69 A;  4YFK F;  3T8T A;  5AIP A;  2XAJ A;  4A5M A;  4ENK A;  3ECH A;  2K27 A;  3KCC A;  1HW1 A;  1W7P D;  2R7D A;  2ZNY A;  5H20 A;  4CO8 A;  3J7A O;  4MNU A;  2EV6 A;  1C0W A;  2W24 A;  2CG4 A;  3HUG A;  4GYI A;  2QM3 A;  3BJO A;  2W57 A;  4DQ2 A;  4WK8 F;  1T2K A;  3HRS A;  1J2X A;  1S7A A;  2RGV A;  2HDC A;  3E6B A;  3F6V A;  5E18 F;  5LHI A;  4AIK A;  1I6X A;  3W6K B;  2H27 A;  2Z33 A;  3L9F A;  1Z7U A;  1BC8 C;  3CJN A;  4ZZD A;  3KP7 A;  5BOX A;  1MJ9 A;  1SD4 A;  3ZMU A;  5K5O A;  3K1P A;  1F4K A;  1PUE E;  3Q9V A;  2Q8K A;  1OPC A;  3ML6 A;  5CVI A;  1O7L A;  4UV9 A;  5DD8 A;  5ICC A;  3F6O A;  1BIB A;  2P5K A;  2QLZ A;  2A68 F;  4ESF A;  1E17 A;  4EM1 A;  5E1X A;  2MBF A;  1IUY A;  2VBZ A;  1TQI A;  1IXS B;  4M72 A;  5L3B A;  4MQ9 F;  3LAP A;  2A07 F;  2HKX A;  4UXN A;  3R6S A;  1T39 A;  4CHU A;  1ZG5 A;  2BV6 A;  3DPT A;  3CO7 C;  1G6N A;  4P5O A;  3WTY C;  3GX4 X;  4K2E A;  2YPR A;  4G7O F;  2CGP A;  1XSX A;  2ZXJ A;  2EFP A;  1IN5 A;  4L9N A;  1IAW A;  4HF1 A;  3S2W A;  4U88 A;  5DYM A;  1K79 A;  3ZQ7 A;  1O57 A;  2L54 A;  4MHG A;  4MGR A;  2FBK A;  3F21 A;  4U0V A;  1PP8 F;  1U6G A;  4YFX F;  4EM0 B;  1EV7 A;  4S04 A;  4RAY A;  1O3Q A;  2LSO A;  3GZ5 A;  4EVI A;  3T8R A;  2C6Y A;  5FFX A;  4EQQ A;  2HS5 A;  3BOQ A;  2M87 A;  3GWZ A;  1UB9 A;  3HSE A;  4LJZ F;  1U5T C;  1FBQ A;  3R60 A;  3HIF A;  1REP C;  4GYG A;  1GXQ A;  4B8X A;  1XSD A;  2IA0 A;  4XSX F;  4KIF A;  5E17 F;  2W25 A;  2W85 A;  4UVB A;  1XN7 A;  2CW0 F;  4CZZ A;  3BY6 A;  3M8E A;  3MZH A;  2PEX A;  4Y15 A;  2A6H F;  3TDZ C;  3F23 A;  2P7V B;  2VBW A;  1I5Z A;  5F6F A;  4Q4Z F;  4CGZ A;  2H09 A;  5A2Q Z;  3O6B B;  1XB4 A;  3WTT C;  5BPD A;  5K5Q A;  2FE3 A;  3WTU C;  2V1U A;  1ZRC A;  2H6C A;  2UZK A;  5TRD A;  3GW2 A;  5CVV A;  1JHF A;  4G6D A;  4BHP A;  1J59 A;  4RGR A;  3KE2 A;  2P6S A;  1S8N A;  1HSJ A;  2JT1 A;  1V4R A;  2DT5 A;  3V7C A;  1XGN A;  1TQM A;  1Z05 A;  2HYG D;  3ABU A;  3KP6 A;  3LST A;  4L9J A;  1K7A A;  1WKM A;  2QVO A;  3GFJ A;  3LQQ A;  2YX7 A;  3COA C;  1UHM A;  3ZP5 A;  4AIJ A;  3IRR A;  1IF1 A;  3H3Z A;  4P96 A;  2OQG A;  3QAH A;  3QPH A;  5ED4 A;  3WOD F;  5F1R A;  1NHA A;  3JW4 A;  3GFM A;  2GXG A;  1MZB A;  1BBY A;  3MZY A;  3P9I A;  3O3K A;  3E6C C;  5ICG A;  4GCV A;  1ZN2 A;  2L4A A;  4G7H F;  5KVR A;  1ON1 A;  2E7W A;  1CF7 A;  1ZRE A;  3W6J B;  2IT0 A;  5LRR A;  4IHS A;  5J8C A;  2VOO A;  4HF0 A;  1XGO A;  3J80 K;  1BI1 A;  2HQN A;  2V79 A;  3QP6 A;  3N97 A;  1GXP A;  5TJJ A;  1I27 A;  2PN6 A;  3KEO A;  5JFR A;  4HF2 A;  1D5V A;  1P4W A;  4L5I A;  3ABT A;  4A12 A;  1TTY A;  1ULY A;  2EV0 A;  2GZW A;  3FMQ A;  4OIR F;  5LBQ A;  2CWE A;  4YIF A;  1RZ4 A;  2O6G E;  1ZGA A;  2OZU A;  1U2W A;  1I1S A;  4EJT A;  3DV8 A;  3TQN A;  3FM3 A;  3J81 Z;  1XDU A;  5L3C A;  1J0R A;  2OBP A;  4HX7 A;  1R1V A;  4RB1 A;  4Y17 A;  3LAJ A;  2E7X A;  1CF7 B;  4WWC A;  3VOE A;  3QU6 A;  1FBU A;  1B59 A;  1XMK A;  4KFC A;  3D5L A;  1XGM A;  2OZ6 A;  5HLH A;  4KYW A;  2A61 A;  3QPT A;  2LF8 A;  2EFN A;  3REO A;  2ZNZ A;  2NNN A;  2GWR A;  1B9N A;  5DEQ A;  3VFZ A;  5L3E A;  1FYK A;  1MKM A;  2DBB A;  2HOE A;  2VON A;  1TW2 A;  4M74 A;  2O61 A;  2H94 A;  3U2R A;  3IKT A;  4MEY F;  5ICF A;  2AXL A;  1YO5 C;  2LNB A;  4XLN F;  2BEO A;  4I2O A;  3T1B A;  3G3Z A;  4R8H A;  2YR2 A;  2P7C B;  1SD6 A;  4G94 A;  3GO5 A;  4GXO A;  1SD5 A;  1FC3 A;  2R3S A;  2Y48 A;  3HRM A;  4L9V A;  1R23 A;  5LEJ A;  2PMH A;  1XSV A;  2GAU A;  1YW8 A;  2FU4 A;  2LDU A;  3I0T A;  2HGC A;  1G3T A;  2FF4 A;  2XKO A;  2STW A;  2WV0 A;  3KP4 A;  3KZZ A;  3JAM Z;  4CDG A;  4EMS A;  4N9I A;  4R79 A;  3SXY A;  3WTX C;  1XD7 A;  4EJV A;  3IWF A;  2OD5 A;  4MEX F;  2GQQ A;  2EB7 A;  4F7Z A;  1PDN C;  3I58 A;  1OYI A;  4RGU A;  3RPU A;  1UCR A;  2JTV A;  3V8L A;  3E97 A;  3BP8 A;  4M71 A;  2XKP A;  4JK1 X;  1YTY A;  3GFI A;  2QQB A;  2VN2 A;  1IN8 A;  3QU3 A;  3K0L A;  2OAZ A;  2FRH A;  3C1D A;  2Y0M A;  2MLG A;  5JI6 A;  4EM2 A;  5HDN A;  1R58 A;  3I64 A;  5D5V B;  2ZME B;  3D0S A;  2J5O A;  3MAJ A;  4PGH A;  3I54 A;  1E2X A;  2QQA A;  2RV8 A;  3P9C A;  2R7F A;  3BPV A;  1CGP A;  3WTW C;  3WU0 A;  1R5H A;  2Z99 A;  2XAG A;  1GHC A;  4D0P A;  5AIQ A;  3QOP A;  4ON0 A;  2FOK A;  1T0F A;  4MTE A;  4NB5 A;  1K78 A;  3EYY A;  3WGI A;  3RYR A;  4ZYD A;  3T5X A;  1RIO H;  2DK8 A;  2KIM A;  1HXD A;  1DUX C;  2EFO A;  3KET A;  4WCG A;  3G73 A;  2NAZ A;  4EGY A;  5HDG A;  1Z91 A;  3PQK A;  3SHF A;  1S3J A;  3TO7 A;  4LD5 A;  2CYY A;  4U7B A;  1IN6 A;  2G9W A;  4QWQ A;  2EJR A;  2XRN A;  3M7G A;  3VB2 A;  4CXF A;  4KMU X;  2IA1 A;  5LGT A;  1FX7 A;  3WTV C;  4A6D A;  1ZG3 A;  3OOP A;  4U7D A;  1X3U A;  4XLP F;  3GEZ A;  2Q0O A;  4OU0 A;  1BI3 A;  4UVA A;  4LFU A;  1FT9 A;  2HWV A;  4LG0 A;  5IT3 A;  4HDU A;  5FD5 A;  2PJP A;  2Z3Y A;  1FWZ A;  4P9F A;  4ENJ A;  3F8M A;  3SFZ A;  4IXA A;  2NS0 A;  3FMR A;  2IPQ X;  2FBH A;  3M8F A;  2D45 A;  3LA2 A;  2X0L A;  5KK1 A;  1OR7 A;  1B6A A;  1HKS A;  1YW7 A;  5D4R A;  2FBI A;  1K78 B;  3KP3 A;  3RYP A;  1QGP A;  4ASN A;  3HHG A;  5DD4 A;  5HS9 A;  3WTZ A;  2G7U A;  5HVQ C;  4MTD A;  4G7Z F;  2P4W A;  3VEP A;  1BOA A;  1FPQ A;  3U1D A;  5ILV A;  4EGZ A;  1G4D A;  2HKO A;  5CLS A;  3ROU A;  1P92 A;  3ZMS A;  3NEU A;  1KQ0 A;  3MCZ A;  2M1B A;  3CUQ C;  1QZZ A;  1ODD A;  3L00 A;  1BC7 C;  2STT A;  4IPA A;  2BGC A;  3F22 A;  3M9A A;  5E8I A;  4PZJ A;  4M6Y A;  4KDP A;  5LHG A;  1LJ9 A;  4BHB A;  1GVJ A;  4LG0 B;  1BN5 A;  2RQP A;  3BRO A;  1RUO A;  1ZAR A;  2PQ8 A;  3E6M A;  4IVN A;  5L3G A;  2MA3 A;  2PFB A;  2IJL A;  2PI0 A;  4IJA A;  5DUK A;  1J9I A;  4Q48 A;  2V1D A;  5JR3 A;  3DEU A;  2RVC A;  1JXS A;  4A0Y A;  5L3F A;  1PP7 U;  4XSZ F;  3HRU A;  3IL2 A;  1AOY A;  2HTJ A;  3EET A;  4LK1 F;  4N9H A;  3R0J A;  4BAY A;  4I0B A;  3L09 A;  2B0L A;  5HDK A;  1U5T A;  5E20 A;  4U0Y A;  1U78 A;  2EK5 A;  2V9V A;  3ULQ B;  4FX4 A;  3TO9 A;  3GXO A;  4RAZ A;  1MD0 A;  4G9Y A;  1SMT A;  5H6R A;  4O6J A;  2DI3 A;  2HYF A;  2VOD A;  3IC7 A;  1SMY F;  4KIC A;  2VC1 A;  2VOP A;  2P8T A;  1IRF A;  5FFZ A;  3CTA A;  4M9S A;  2YX4 A;  5CVR A;  1FYM A;  3QRF F;  2ESN A;  1W5S A;  2G7H A;  4HV5 A;  5E8G A;  1WSU A;  1QNT A;  3N4M A;  3V4G A;  1D8K A;  4O5V A;  4GO1 A;  2VXZ A;  2J5P A;  4WXD A;  3IRQ A;  4OIQ F;  2EA4 A;  1OYW A;  2XAF A;  2QUF A;  2P5V A;  3RKY A;  2XAQ A;  4KNY A;  2K4B A;  1Z1D A;  3FWE A;  1FOK A;  3RDI A;  2WWY A;  4Z2Y A;  2LF7 A;  3HOT A;  2WTE A;  4IRG A;  3GUD A;  2ELH A;  3C18 A;  3IWZ A;  5LGU A;  2AS5 F;  4ZZL A;  1L0O C;  2A5Y B;  2JPC A;  1W7P A;  3K1M A;  4M9X A;  5LHH A;  2Y75 A;  1Z6R A;  2HTS A;  1BM9 A;  3F8C A;  5LRS A;  1TNT A;  3DQV C;  2O8X A;  2UWM A;  3GVA A;  3FF5 A;  4P55 A;  4IRI A;  1YLF A;  1TNS A;  2YSR A;  3HTU A;  5ICE A;  1RUN A;  1HKT A;  2KRF A;  3KLN A;  2E1N A;  2FXA A;  4DNC A;  1S6L A;  1MDM A;  1Y0U A;  1TQP A;  1OKR A;  4XBF A;  4KUM A;  4HLY A;  4MQV A;  3AAF A;  1FSE A;  3T0Y A;  4HV6 A;  2RC4 A;  3I5U A;  3HHH A;  3K1N A;  2PBI A;  1Q1H A;  3ISP A;  2VBY A;  3HSR A;  5JVT A;  4O3M A;  2DU9 A;  1WI9 A;  3LQR A;  2V6C A;  4EJO A;  2O0Y A;  4EJU A;  5FLX K;  3WU1 B;  3B02 A;  3RKX A;  1P2F A;  3MFK A;  1KU7 A;  5D4S A;  4HA8 A;  3RTR A;  5L3D A;  1W7P B;  1LB2 A;  3WE3 A;  2M8E A;  2DW4 A;  3PFI A;  5D5W B;  1LDD A;  1P4X A;  2MD5 A;  3MEX A;  4TV7 A;  4B09 A;  4BH9 A;  1LNW A;  4A5N A;  2HFH A;  1I1G A;  3HOS A;  2F5C A;  1RI7 A;  4LK0 F;  4U0W A;  1G3W A;  1FBS A;  5FGM A;  4RB2 C;  1T38 A;  2K02 A;  4BXU A;  1MDM B;  4RB0 A;  4FHT A;  5CJ9 A;  4RS8 A;  3SZT A;  1HST A;  1Z9C A;  4YFN F;  2DQR A;  1MGT A;  4IHT A;  2ZFW A;  1LDJ A;  1DDN A;  1K6O A;  1BI0 A;  1HKQ A;  2F5F A;  1KU3 A;  1QZY A;  3U9G A;  4UHT A;  4HBL A;  3RIR A;  1F5T A;  3J80 Z;  1YYV A;  1IZ1 A;  1KU9 A;  2MH9 A;  3LA3 A;  2LKP A;  2VT3 A;  3GLX A;  3ZMT A;  3FXR A;  5IT9 K;  3RI4 A;  1RNL A;  3CDH A;  2QZ8 A;  1R7J A;  1SD7 A;  2QQ9 A;  5E1Z B;  2BE5 F;  3I53 A;  2QEN A;  2D1V A;  2DQL A;  1D3Y A;  1QBJ A;  2EFW A;  1W5T A;  4KT5 C;  1ZLJ A;  1U8R A;  4HLX A;  4KMF A;  3GZ6 A;  4G6Q A;  3RPQ A;  2FA5 A;  4HQE A;  2A6E F;  3ZN1 A;  4PCQ A;  3NRV A;  5LLQ A;  1FY7 A;  2HZT A;  3HTS B;  1FSH A;  1YW9 A;  2X4H A;  2IVM A;  5HLG A;  2ZCW A;  1KA8 A;  3FXQ A;  4ZYE A;  4E70 A;  3F72 A;  1R1U A;  1V3F A;  1YQA A;  1FP1 D;  5K1Y A;  1DPR A;  5CVJ A;  3OV8 A;  3R61 A;  2H6B A;  2L02 A;  2M5W A;  1ZH5 A;  2L4M A;  4HOB A;  3ZMV A;  3EUH A;  1BJA A;  1HQC A;  2DLL A;  4UUV A;  2K7L A;  4WF2 A;  4I09 A;  2FMY A;  2ESH A;  4LLL A;  5EEH A;  4L5J A;  2IW5 A;  2JSC A;  1MJB A;  1SFE A;  1B4A A;  1LEA A;  3HYI A;  1R5G A;  1SFU A;  1XDS A;  2XHK A;  3C7J A;  4EJW A;  3K9T A;  2EWN A;  2DFI A;  4M6X A;  4OIN F;  3VOD A;  2OA4 A;  2XAH A;  3P7N A;  1G3Y A;  3H92 A;  4L9T A;  2EV5 A;  3KZY A;  4AWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...