2EB7A

Crystal structure of the hypothetical regulator from sulfolobus tokodaii 7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title Crystal structure of the MarR family regulatory protein, ST1710, from Sulfolobus tokodaii strain 7
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 56
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2eb7A00
2XROA 3RPUA 2EB7A 4P55A 2XAQA 4UXNA 2HDCA 2VE8A 2M45A 2XAJA 1FSHA 4TV7A 2HQNA 1KQ8A 1XGSA 3E6MA 3F72A 4ENMA 4HF1A 2XAHA 1IZ1A 2EK5A 3BROA 2VT2A 3DEUA 5L3EA 2GQQA 3MAJA 4FT8A 5L3DA 1TW3A 1U5TB 3B73A 5HLGA 3EETA 2OD5A 3HRSA 5KK1A 3SFZA 2W84A 1FYMA 2DO7A 4IXAA 5ICCA 4U7DA 2JRTA 2DQRA 5HS9A 2ISZA 1Z9CA 2P7VB 2W57A 5JFRA 3DQVC 5LHIA 3RYPA 2LF8A 3PQKA 1EH8A 3TKYA 2O61A 1U78A 3LQRA 3QPTA 4RAZA 1O7LA 2XAFA 1T2KA 1ZLKA 4L18B 2EFOA 1XCVA 1KU7A 1Z05A 5LLQA 4KFCA 2V79A 4A6EA 5CLSA 1IRGA 1PUEE 2UXXA 1SD6A 2A6HF 1OPCA 2D1VA 4G9YA 4RB1A 1LNWA 1R00A 4P9FA 1IXCA 4OIPF 1SFEA 5CYVA 1UHWA 3Q9SA 1RNLA 2CYYA 3U1DA 1QZYA 3IRQA 1G3YA 4UV9A 1PDNC 2QUFA 2O0YA 3MWMA 1K78A 3IRRA 5LHHA 3GF2A 5JHUA 4FX0A 3MFKA 3I71A 2EFNA 3T8TA 1FYKA 4MHGA 4GYGA 3L9FA 4ENJA 2ZFWA 4ESFA 3IKVA 3TO6A 4O3MA 4U88A 1XDUA 4KN4X 2JPBA 2O8XA 4PGHA 1OR7A 1AWCA 2VC0A 2L54A 2BYVE 2K4JA 2IT0A 3V7RA 3KEQA 3J80K 5HVQC 2ZMEA 3K1PA 4RGRA 4PGGA 2JZYA 2WV0A 2ISYA 3JW4A 4UVBA 1W7PD 3IL2A 4LD5A 4ZYEA 3GW2A 3F6OA 2FMLA 2F5CA 4LLNA 3FXUA 4YG2F 1SD4A 3KLOA 1MZBA 3L2CA 4M73A 1QGPA 2IVMA 1HSJA 1P6RA 3V7CA 3ZQ7A 1UFMA 3HIFA 2C6YA 2FBKA 4XLNF 2FA5A 3OOPA 3JSPA 3M8FA 2FNPA 5JI6A 2CO5A 1WKMA 3I53A 5H20A 2P7CB 4WF2A 3TO9A 3WTTC 2DW4A 2DFIA 5FGMA 3WE3A 2L3DA 2Y0MA 4D0PA 3FWEA 2DT5A 4M9ZA 5ERIA 1HSTA 5DEQA 2Z9OA 4M6YA 2CW0F 5IT9K 1YW9A 2WTEA 3B02A 1L3LA 1IN4A 3HHHA 3ZMUA 2PLYA 3H92A 2OU2A 3IWFA 2XV4S 4HOBA 4M9SA 5LRSA 2GXBA 2DBBA 2JSCA 4MEXF 1G4DA 2ADUA 3ZN0A 1PP8F 3PFIA 3BZ6A 4OIRF 1L0OC 3E5UA 2X0LA 1S8NA 4KIBA 4CXFA 3T0YA 4CHUA 1YLFA 1ZGAA 3HRTA 2FRHA 2D45A 3F8FA 5D5VB 5DV5A 1EH7A 1WI9A 1XCBA 5LGNA 1FP1D 1YO5C 1FY7A 3AAFA 1ZARA 2KIUA 2PI0A 4Q48A 2V1UA 4I0AA 2EFPA 2QBYA 2LKPA 5F1RA 4U0VA 1E2XA 1ZRFA 5CVVA 1ULYA 2P6SA 1FT9A 3HSFA 3DP7A 3IKTA 2PEXA 4K2EA 3GX4X 1B9NA 2YSRA 2CSOA 3ERED 2VBYA 3HTUA 4OU0A 1XB4A 2UZKA 4AIHA 1W7PB 3E6BA 4ZYGA 3FX3A 1H9TA 2OZ6A 3KZYA 1TQIA 1SD7A 5DCMA 4EGYA 5BMZA 3KCCA 1FNNA 5E1ZB 3KETA 2F5DA 1GXPA 2GAUA 3KE2A 2CWEA 4RAYA 2M1BA 3FM5A 5LHGA 4HQEA 3FMQA 2Z99A 4DNCA 1LEAA 4HYEA 3WU0A 3F3XA 4L9VA 2QQ9A 1J9IA 3V8JA 3BJ6A 4RB0A 1YYVA 4ENNA 4N9IA 5DD8A 3RTRA 3SZTA 3FXQA 2L4MA 4CO8A 1S3JA 2VONA 3H3ZA 2M30A 3HRMA 4YFKF 3WTSC 1BC8C 1BIBA 1FBSA 5LRRA 3KP4A 2YX7A 3RPQA 3ZMSA 2V1XA 2KKOA 2H6BA 1MD0A 2OZUA 4RS8A 4I0BA 3WTYC 4I09A 1S7AA 1USSA 1TBXA 4CICA 4Z2YA 3F8NA 3RKWA 3FHZA 3WG9A 5FLXZ 1D8KA 1R1TA 3U2RA 4ZH4F 3R6SA 5CJ9A 4Q5SF 3HTSB 2ZNYA 3P9KA 3EQLF 1S29A 2QWWA 2BEOA 5J8CA 1U8RA 4LG0B 4A0ZA 2A61A 3LFKA 3WGHA 5DDGA 2J5OA 1YS6A 1VTNC 1I5ZA 1YIOA 3LWFA 5FFZA 2STTA 1ZYRF 1BI3A 1BIAA 2DU9A 2HQRA 2ZKZA 3DPTA 3GFIA 1T38A 5HLIA 2FOKA 1SFXA 1V3FA 2A3SA 1SFUA 3ABTA 2A68F 1KQ0A 2NYXA 1K7AA 4EJVA 1ONVA 1TNSA 4ZZLA 3EUHA 3MZHA 4KN7X 3EYIA 1NHAA 3I5UA 2JTVA 3ABUA 2FNAA 3JTHA 4R8HA 3C7JA 1ZLJA 4IRHA 4BYYA 2UXNA 2W24A 4L0YB 1XN7A 2VBXA 2QM3A 3M8EA 1LQ1A 1BOAA 2HS5A 2XIGA 3WTWC 3M9AA 4HLYA 3WGGA 1IW7F 3MQ0A 4EJUA 3TO7A 1XGOA 4L9NA 3E5QA 3F23A 3BDDA 5L3FA 1BN5A 3O3KA 1F9NA 3R4KA 1KGSA 2FBHA 3O2PE 1YS7A 4ZZDA 2XGXA 1HKTA 2DK8A 1O3TA 4BXUA 5A2QK 2IRFG 1SMYF 3CUQB 1O3RA 1UCRA 3C18A 1FC3A 2ELHA 2NS0A 1LDJA 1ZG3A 1OYWA 4I7HA 3MEXA 1U5TA 2R7FA 3P7NA 2BBYA 3MZYA 4PDKA 4HA8A 1BC7C 2XRNA 2P5KA 1C0WA 1RI7A 5HDNA 4OINF 5HS7A 1PP7U 2MC3A 1T6SA 3ECHA 2R7DA 1FPQA 1R7JA 3BWGA 1BM9A 1EH6A 1FLIA 3SHFA 3WU1B 4G94A 4R1HA 4MTEA 1D3YA 1DP7P 4LB5A 2NNNA 4RGXA 1ZG5A 1XMAA 1J59A 3K1MA 4KIGA 1QO0D 3ZPLA 1W4MA 3QPHA 4ESBA 2RVCA 3DV8A 4HBLA 3WE2A 2HGCA 2ZJ2A 5FFXA 3BY6A 2PMUA 4N0BA 1HBXG 3QP6A 3E97A 4U0YA 2V9VA 2FE3A 1LB2A 3FMSA 2DQLA 4HX4A 2H09A 4EGZA 4AIJA 1I27A 1SAXA 1ZG1A 1SMTA 4DQ2A 3F8BA 4WWCA 3IWZA 5D4RA 2HWVA 5E1WA 3KFWX 5DYMA 1JHFA 1ZREA 2Z33A 1DPUA 1TTYA 3L09A 2H94A 1U5TC 1IRFA 3BPXA 5D4SA 1HW2A 3V8KA 1TQPA 5DD4A 4L9JA 3NEUA 1YW8A 4IVNA 1TW2A 4MNUA 1AOYA 3G3ZA 1ZAOA 1G3SA 2D1HA 3HOTA 2L02A 4OIOF 4AWXB 4NHJA 2OA4A 2KRFA 3KP5A 3KZZA 2G7UA 2HR3A 5H6QA 4H0EA 3CO7C 3KP3A 4S05A 1D8JA 1U2WA 5LGTA 1O57A 1IF1A 1LEBA 2LF7A 2E1NA 3F8MA 3F22A 2F5FA 4Y13A 1FSEA 1HKSA 2P6TA 4M9XA 3TGNA 2P5LC 4ESJA 2BGCA 2Z3YA 4CGZA 3J80Z 4HX8A 4GO1A 5D8LB 4Q4ZF 2HOEA 4AD9A 3WTUC 5CVRA 1B6AA 3F6VA 3COAC 3DPLC 3HUGA 4HAMA 3TQNA 2O6GE 3ZN1A 1BI0A 1U6GA 1QBJA 1FX7A 5ICEA 3JTGA 1USTA 4M6XA 1FWZA 5ICGA 3FZVA 4OMYA 4ENKA 5FD6A 5HDGA 1S7OA 1RUNA 4L0ZB 3KLNA 3NQOA 4GCVA 2PBIA 1MKMA 3KEOA 2FXAA 2YX4A 1Q1HA 2FBIA 1Z6RA 1ON1A 5BPDA 1CF7B 4M71A 1O3SA 4IF4A 2PN6A 1KU2A 4BHBA 3F21A 3N4MA 5BOXA 4GGGA 3KP6A 2E1CA 1RIOH 4KA4A 2PFBA 1Y0UA 1DDNA 4UUVA 5IT9Z 2RC4A 3EYYA 2ETHA 1OYIA 1R36A 2B0LA 3LAJA 2HYGD 2XKOA 4EVIA 2EV6A 4HX7A 3VEPA 1OYYA 4JK1X 4KT5C 1W5SA 3QRFF 5D5WB 2HYFA 3KP7A 1IN8A 2HTSA 3K1NA 3E6CC 1MJBA 5EEGA 4MEYF 1W7PA 4ZYDA 5HDKA 3FF5A 4UVCA 4OOIA 4LJZF 4ASNA 1MJ9A 2VODA 4IRGA 2QVOA 2IP2A 3E6DA 4XSXF 2QYOA 5D8KB 1G3TA 4QLCU 1DUXC 1TQMA 3S2WA 1P4AA 3T8RA 1Z91A 3ELKA 4LFUA 4KDPA 4HF0A 3V7SA 1R1VA 2R3SA 5ICFA 4B09A 3U9GA 1RUOA 4LGWA 5CVUA 2L01A 1B9MA 3T5XA 1S6LA 5FB2A 1JXSA 3J81K 3N97A 5D5UB 4WK8F 1P92A 2RN7A 1XD7A 3WTZA 1MDMB 1R5GA 2OAZA 3HSEA 3QAHA 6PAXA 2LNBA 2QZ8A 4HV6A 3WGIA 4HQMA 3RIRA 1DPRA 2PJPA 5L3CA 1JHHA 1CGPA 2CG4A 4WXDA 2VN2A 4UVAA 1YFHA 2O3FA 4YIFA 3K2ZA 1P4WA 3GO5A 3ZMTA 1G6NA 4RGUA 5TJJA 3V4GA 4PCQA 1GHCA 2QENA 2KJCA 2LSOA 1HW1A 4A6DA 1IN5A 1BJAA 2ZXJA 4UHTA 4LG0A 1HKQA 5LBQA 4G8XA 3GFLA 2XASA 3CTAA 3CJNA 4LMYA 4LLLA 1ZHFA 4EMSA 3I59B 3K0LA 3TOAA 2KIFA 5HS8A 4A5MA 1RZ4A 4G7OF 4XLPF 3I58A 1IAWA 2K7LA 2MLKA 5J8FA 3ZP5A 3RI4A 4EV0A 1H9GA 2BV6A 4WXCA 3GEZA 3PQJA 2P5VA 2COMA 3GFJA 3HSRA 4LK0F 4RB2C 4FHTA 3ISPA 4EJWA 2A69F 1J0RA 2YU3A 2EA2A 4NQWA 2W25A 2QQBA 1OMIA 1ZH5A 3REOA 5AIQA 1BI1A 2VE9A 2IPQX 2Y75A 3TDZC 1KU3A 4F7ZA 2L4AA 1XSDA 1R58A 2HTJA 3CO6C 2A07F 2STWA 1MGTA 3VOEA 3JAMK 5FO5A 2NNYA 2CGPA 2NAZA 4KMFA 2AS5F 3GFMA 2DPUA 4HW0A 1TNTA 1B4AA 4BHCA 4U7BA 1BBYA 2K4BA 2D2WA 1GVJA 2GA1A 4KUMA 3QP5A 1I6XA 1XGNA 1T39A 3JAMZ 3CUQA 3R0AA 4JBAA 5E8GA 5IT3A 5K5RA 3DKWA 2F5EA 2ACJA 4L5JA 2RGVA 3RYRA 3I54A 2IJLA 3SQNA 1B59A 3W6KB 1XDSA 1F1ZA 3R0JA 4HF2A 3GWZA 1OKRA 2HKXA 3MCZA 4JQFA 3GYHX 5F64A 2FF4A 1I1SA 3LA7A 1R5HA 3BPVA 2H27A 4KIFA 2AXLA 1EV7A 4O6JA 5JVTA 5ILUA 1YG2A 5H6RA 2YR2A 4ON0A 2XHKA 4I98B 2RQPA 5A2QZ 3HRUA 1QQIA 3GUDA 3QOPA 3BP8A 2VC1A 4A0XA 2HZTA 3ZMZA 3LA3A 4P5OA 3G73A 4MTDA 3IHUA 2ZO4A 5J6XA 5ED4A 3Q5FA 2EA4A 3P9IA 3I64A 3J7AO 2IA2A 3R61A 2LDUA 1D5VA 2EV0A 4HZFA 2VBZA 1FOKA 3I0TA 2K02A 3HHGA 5BQTA 3GLXA 3IC7A 1GXQA 1W5TA 2XAGA 3CUQC 1JGSA 4IJAA 1LVAA 4WX9A 4MQ9F 2GWRA 1K6OA 4BH9A 2HFHA 2MBFA 3L7WA 3TDUC 1R1UA 5ILSA 2PQ8A 2DK5A 3GZ6A 1YW7A 3CLOA 5ILVA 2FQ3A 4FX4A 2UWMA 1O7FA 1F5TA 3RJPA 2Y48A 2ZNZA 2V6CA 1ZRDA 1ODDA 3V8LA 3RKYA 5K5OA 5LEJA 3DXJF 3T1BA 3FXRA 5LEKA 2HKOA 2EWNA 1STZA 2Q0OA 4HDUA 1A04A 2E7WA 2MA3A 2OQRA 3ZMVA 1T0FA 2DI3A 4YIIA 2J5PA 4G7HF 4LK1F 1KQ9A 2RV8A 1T98A 4QWQA 1K78B 2WC2A 4YFNF 2P8TA 1R22A 3O6BB 4EM0B 1X3UA 2MH2A 5EEHA 5BS6A 4UNOA 4ETSA 1I1GA 3VODA 2ESHA 3GZ5A 3D5LA 4O5VA 3W6JB 1Z7UA 4P9UA 1WSUA 4IHSA 2W85A 4E70A 1QNTA 2HEOA 1LDKB 3DF8A 2ZMEB 1B1BA 5K5QA 4KNYA 4RGSA 3SXYA 4MGRA 5D5XB 1CF7A 4WCGA 4YFXF 5AIPA 2H6CA 3CUOA 1LDDA 4M72A 3WODF 4ZYHA 5BPIA 2VOOA 4CYDA 1P4XA 4OIQF 2DPDA 2IA1A 3QU3A 3C3WA 2CFXA 5TRDA 3L00A 4L5IA 5F6FA 5DUIA 1YQAA 2FSWA 3ECOA 4AVPA 2RNJA 3GVAA 2Q2EA 5E17F 1KYZA 1FZPB 4GYIA 2NRAC 3BJOA 1J2XA 4I2OA 2VOPA 4MQVA 5L3BA 3R60A 4A5NA 2MD5A 1JE8A 5CVJA 3FM3A 4A0YA 3WTXC 4I02A 1WRJA 1IUYA 1J7KA 4OMZA 4BHPA 1P2FA 2M8EA 2Z5UA 3K69A 3OV8A 2VBWA 4GXOA 1Z1DA 4WXHA 1FBQA 3QU6A 1XGMA 4XRFA 4I01A 2A5YB 2G7HA 1IN6A 5LGUA 1IXSB 4EM1A 2DAOA 1E17A 2MLGA 4Y15A 3H3UA 2FU4A 1REPC 4XSZF 1J5YA 4G6QA 3LA2A 5E1XA 2G9WA 4CZZA 3LAPA 1ZRCA 4U0WA 1FYLA 4LB6B 3RKXA 3GXOA 4NB5A 5L3GA 2P4WA 1MDMA 2XUBA 4IRIA 1HW5A 3ZMDA 4KICA 4A2UA 4R79A 2F2EA 2O03A 2KJBA 4HDVA 2QBYB 2JT1A 1TLHB 4LLGF 1F4KA 4L9TA 4N9HA 1ON2A 1KYWA 3FMRA 4RB3C 2OQGA 2BE5F 5JR3A 1H0MA 2WWYA 3RDIA 4EM2A 4HV5A 1U3EM 2DLLA 5AONA 5K1YA 2GIVA 4IPAA 2KIMA 4M74A 5DCMB 1FP2A 2OBPA 4BQAA 5DUKA 3J81Z 3SZPA 2XKPA 3I4PA 2EFWA 2DTRA 2RDPA 4KYWA 2EV5A 3I59A 5KVRA 4BAYA 4KMUX 2YPRA 2K27A 4EJOA 3TOBA 3BJAA 1KU9A 5D6FA 1YTYA 5E18F 1J75A 2RKHA 5FLXK 4P96A 2Q8KA 3F8CA 4Y17A 3HOSA 2E7XA 4XBFA 2ZBKA 4UV8A 5D6EA 1HXDA 1WWXA 1QPMA 4G6DA 2IW5A 5HLHA 2EJRA 4BNCA 3LQQA 2EFQA 2MH9A 2GXGA 1XSXA 4AIKA 1IXRC 2FMYA 4CDGA 1XMKA 3Q9VA 3D0SA 2A6EF 2CQKA 1ZN2A 2JPCA 3DFGA 2PMHA 5FD5A 1SD5A 1FBUA 2M87A 3JSOA 2ESNA 1HQCA 5CVIA 2PG4A 4G7ZF 1QZZA 2K86A 2ZCWA 1G3WA 1UHMA 3P9CA 4B8XA 1O3QA 1IN7A 1BI2A 1WQ2A 3E5XA 2QQAA 4Q47A 1MJAA 5E8IA 1LJ9A 3NRVA 3WTVC 5HOOA 2TDXA 5DCFA 4A12A 1KA8A 4S04A 1K79A 3ROUA 2QLZA 3M7GA 2VT3A 2VXZA 4EJTA 3KP2A 1UB9A 1XSVA 2V1DA 2IA0A 1Z6TA 3LSTA 2XVCA 4PZJA 2M5WA 3E3VA 2X4HA 4IHTA 3VB2A 3BOQA 3VFZA 4HLXA 2GA2A 3C1DA 4EQQA 3ULQB 3HYIA 3M1EA 3K9TA 2GZWA 3ML6A 1V4RA 1R23A 5E20A 3EDPA 3CDHA 1ZGJA 2FEZA
chains in the Genus database with same CATH superfamily
2XROA 3CCVI 4BQQA 4E7ZA 3CCLI 3RPUA 2B63J 4FASD 3P5JA 2VB6A 3NWSA 1ETXA 2EB7A 3FXOA 2HXOA 4P55A 2XAQA 4UXNA 2HDCA 1FOWA 2VE8A 2WBMA 2M45A 2XAJA 4V2FA 3LSPA 1FSHA 5EEAA 4TV7A 3SJMA 4NDLA 2HQNA 2QQ8A 1PYVA 1KQ8A 1EJ9A 1XGSA 3E6MA 3F72A 4ENMA 1ACIA 4HF1A 3DBHB 2VLAA 4BBSJ 3GTQJ 4JX4A 2LRDA 2XAHA 1IZ1A 4XKBA 2EK5A 5M5YJ 2F4MB 3MKZA 3BROA 4ITVA 1LE8A 1AKHB 2VT2A 3DEUA 1VQLI 4BY1J 4MFDA 5B1BH 5L3EA 2GQQA 1SC7A 3MAJA 1IGNA 2X1DA 1S72I 4I76A 4FT8A 3W3CA 5L3DA 2B9SA 1TW3A 1U5TB 3B73A 5HLGA 3U21A 3EETA 4CSWA 2OD5A 5FLVA 1QU3A 3HRSA 3LSJA 3SFZA 2W84A 5KK1A 3D1NI 1TT5B 1FYMA 2DO7A 4IXAA 4I99C 5ICCA 4U7DA 3VYTB 2JRTA 1MBGA 3ERMA 2DQRA 4PSXA 1YX3A 1U8BA 3FBIB 5HS9A 1E3OC 2ISZA 2R7QA 1Z9CA 1HOMA 2P7VB 2W57A 5TGTA 1HCRA 5JFRA 3DQVC 5LHIA 2QF7A 3RYPA 2LF8A 3PQKA 1EH8A 2JA2A 3TKYA 2FOWA 2O61A 1T08B 2R92J 1GT0C 1U78A 4XRMA 2KLOA 3LQRA 3QPTA 4RAZA 2A5WA 1O7LA 2XAFA 4B1RA 3DTKA 4XKCA 1T2KA 4QPQA 1OCOH 1ZLKA 4L18B 2EFOA 3CJRB 1XCVA 1KU7A 1Z05A 1H8AC 1K4TA 4DYCA 3M3YJ 5LLQA 1E3HA 4KFCA 2V79A 4C2TA 4A6EA 3DWLE 5CLSA 2CFOA 3OR2C 1NK3P 2QSGX 4IKFA 4RMNA 5FKMA 4QIWN 1IRGA 5IYBJ 4G12A 3K10A 1PUEE 5CPRB 2UXXA 1T95A 3DBRB 1SD6A 2X85A 3BZKA 2A6HF 3K4CA 4RAFA 4X6AJ 3IH3A 1OPCA 1UELB 2GOMA 4XRSG 2D1VA 5IOZA 4G9YA 4RB1A 5EGOB 2DA3A 1LNWA 4BXFA 3CCJI 2MW8A 4D9JA 1R00A 3NARA 3RSNA 2E60A 1VQOI 2EZHA 4P9FA 2M4KA 4A3FJ 1IXCA 3AL0C 4OIPF 1SFEA 5CYVA 1D0ZA 1UHWA 3B6CA 4A3DJ 3Q9SA 1RNLA 2CYYA 5FKOA 3U1DA 1QZYA 1HLVA 1A36A 2WAFA 3OIQA 3QPSA 3IRQA 4EATA 3A01A 1ZQ3P 1Z7LA 1G3YA 1UZCA 4UV9A 1PDNC 2R7XA 2QUFA 4LOCA 3ABMH 1Z67A 3DU6A 2O0YA 3A02A 3MWMA 2ZXHA 1K78A 2VL8A 3IRRA 5LHHA 1Q1VA 3GF2A 5JHUA 4FX0A 3MFKA 3I71A 2EFNA 5LFAA 3T8TA 1FYKA 2O9LA 4A3MJ 4MHGA 4GYGA 3L9FA 1VZ0A 3A4CA 4IO9F 2ZFWA 4ENJA 4ESFA 3IKVA 3TO6A 3BCBA 5FRMA 3H9JA 2QKMB 3OYJA 2NVQJ 2XB5A 4O3MA 4U88A 3OSGA 1XDUA 4KN4X 2E2JJ 2JPBA 3ZQFA 4XM3A 3A01B 3G2BA 1YOVB 2O8XA 4PGHA 1OR7A 1B72B 4XK4A 1AWCA 5F27A 4N4OB 2VC0A 2L54A 2BYVE 2K4JA 2IT0A 3V7RA 2L9VA 3KEQA 1FOYA 4D7MA 5HVQC 2ZMEA 3K1PA 3J80K 4RGRA 4PGGA 2JZYA 2WV0A 2R7SA 1QRYA 2E2IJ 2ISYA 3JW4A 2LH9A 2W4SA 4UVBA 3S2HJ 3S2DJ 1W7PD 3HGGA 2PJRA 3IL2A 1KONA 2K9LA 4LD5A 4ZYEA 3GW2A 2HVSA 1U9NA 3F6OA 2FMLA 2F5CA 4LLNA 3FXUA 1N75A 4GFBA 4HG2A 4YG2F 1SD4A 3KLOA 1MZBA 2Z16A 2AQEA 2DMNA 5EF6A 1Z3YA 2EZKA 3H9QA 3L2CA 4M73A 1QGPA 2IVMA 1HSJA 1P6RA 3V7CA 3OL4A 3ZQ7A 5J1RA 1UFMA 4UB6C 3ZRGA 3HIFA 2VPLA 2Y31A 2C6YA 2FBKA 4XLNF 2FA5A 1N77A 3OOPA 2DA7A 1WJAA 3JSPA 3M8FA 2FNPA 3V42A 1FIAA 3HZJA 5JI6A 3OYNA 3RKQA 2CO5A 1WKMA 3I53A 5H20A 2P7CB 4WF2A 3TO9A 2RNGA 3WTTC 2TCTA 5JLXA 3HG9A 3CC4I 2DW4A 2E1MC 3J7ZI 2DFIA 5FGMA 4ZC3A 3WE3A 2L3DA 2H1KA 1QHHD 2L2OA 2Y0MA 3Q3SA 2CUFA 4D0PA 2W48A 4XICA 3FWEA 2DA2A 2DT5A 2DMUA 4M9ZA 2MC4A 5ERIA 2JA8J 1HSTA 2LBFB 5DEQA 5M3FJ 4BY7J 4A3IJ 3C2HA 2VJ4A 2CQXA 2Z9OA 3HUGB 2F4IA 2LMDA 4M6YA 2CW0F 2DA4A 1YRNB 5IT9K 1YW9A 2WTEA 4CYCA 3B02A 5HLTA 2O8KA 5EZGA 3BTCA 1L3LA 2DFHA 1IN4A 2LP0A 2R7ZJ 4JX5A 3DEEA 3HHHA 2XPUA 3GCMA 1I50J 3ZMUA 2PLYA 3H92A 3DCFA 2OU2A 3IWFA 2QEXI 1Y39A 5EYRA 2BXZA 2XV4S 1A6QA 2EIMH 4HOBA 4M9SA 2BW3B 5LRSA 2GXBA 1OR7C 2DBBA 2JSCA 1W1WE 4MEXF 1G4DA 3FXKA 4CYCB 2ADUA 2ZMEC 3ZN0A 5JLWA 3OYEA 3ABLH 1BJZA 1PP8F 3PFIA 3BZ6A 4OIRF 4PK4A 2XGDA 1L0OC 3E5UA 2X0LA 1A5JA 2XF5A 1LKXA 1S8NA 4KIBA 2ZJRF 2O5RA 4CXFA 5FKNA 4DZJA 3T0YA 4CHUA 2Y9YA 5EDNA 3PNTA 5B1AH 3S3OA 1YLFA 1ZGAA 2LTPA 3HRTA 3UR3C 2FRHA 2D45A 3BQZA 3F8FA 2R5ZA 5D5VB 1G2HA 5DV5A 1A31A 1EH7A 2JSPA 1WI9A 2Y9ZA 1X2NA 1XCBA 2K9MA 3CF2A 5EZHA 4BE1A 3FBNB 4RAGA 2VKEA 3WG7H 1OCTC 3WHBA 5LGNA 1FP1D 1YO5C 1E0EA 4XOTA 1FY7A 1ZARA 2KIUA 3HJEA 3AAFA 2PI0A 3KIOA 4Q48A 2V1UA 4I0AA 2EFPA 2JJ7A 1VQ4I 2QBYA 1YIJI 3QQAA 2OJED 2LKPA 5F1RA 4CH7A 4LITA 1BR1A 2XF7A 4U0VA 1E2XA 1ZRFA 5CVVA 2DDBA 3QODA 1ULYA 2P6SA 2R5ZB 1FT9A 3HSFA 4XN0A 1VNDA 3L1PA 2E1OA 3DP7A 3IKTA 2PEXA 4RLFA 3CCUI 4C9YA 2F48A 4K2EA 3GX4X 4C30A 3K4NA 1B9NA 1V55H 2YSRA 2CSOA 3DBLB 2K40A 2LOOA 1JGGA 3GTGJ 3PUFA 2LC2A 3ERED 2VBYA 3HTUA 3TEDA 3OYHA 1JKPC 1Z3XA 3HPGA 2UUZA 2JK3A 4OU0A 3PO3J 1XB4A 4F91B 2UZKA 4AIHA 1W7PB 4PFOA 3E6BA 5C44J 1S9HA 3L2QA 4ZYGA 3FX3A 3CCMI 1H9TA 2OZ6A 3KZYA 1RR7A 1TQIA 1SD7A 5DCMA 3QYBA 2E36A 4AM3A 4EGYA 5BNGA 4F92B 5BMZA 2BOLA 2MSYA 3KCCA 1FNNA 2QA4I 5E1ZB 3OR1C 4XR6A 3KETA 2QKLB 2F5DA 1ETWA 2GAUA 3KE2A 1GXPA 3ZQLA 2CWEA 4RAYA 3LFUA 4YIRX 1XTAA 2M1BA 3FM5A 3BG7A 5LHGA 5GAEJ 4HQEA 2BVLA 2Z99A 3FMQA 4DNCA 1LEAA 4HYEA 3WU0A 2JUGA 2F5VA 2JRMA 3F3XA 2EZIA 1VQ8I 2JVHA 4BJ6C 4L9VA 4LG3A 3PIPF 1IJWC 3OYIA 2R7RA 1ZTRA 2QQ9A 3U1KA 1MH3A 1J9IA 2X1CA 2V6EA 3V8JA 5B5EC 2K3PA 1ORKA 2WAEA 3BJ6A 4RB0A 1DQUA 4M3BA 1YYVA 4ENNA 1Y8QB 2V4JC 1ZELA 4N9IA 3H3VK 4GRIA 4HNTA 2KMUA 4ZDLA 1X4PA 5DD8A 1WJ5A 2CRGA 3RTRA 4FETA 3SZTA 1MW7A 3FXQA 2L4MA 4CO8A 1S3JA 1WJBA 2VONA 2DXIA 1ETKA 5IYCJ 3H3ZA 2M30A 2VKHA 3HRMA 3TMOA 4YFKF 3WTSC 3S1RJ 1BC8C 1BIBA 1FBSA 5LRRA 3KP4A 2CMPA 3DTIA 2YX7A 5IY5H 2VXDA 2COBA 3RPQA 2CS3A 3ZMSA 2V1XA 2CW7A 2KKOA 2BY1A 2H6BA 4Y3OA 1MD0A 2OZUA 4RS8A 4E4HA 4I0BA 3WTYC 4BE0A 1OCCH 4I09A 3PJRA 4FISA 1S7AA 1USSA 2X51A 1TBXA 4CICA 4Z2YA 3F8NA 3RKWA 3PSFA 3FHZA 3DU5A 5E3LA 3WG9A 3MMYB 1YITI 3PO2J 5FLXZ 1B8IB 1D8KA 3HKZA 1R1TA 4II2A 3OOUA 2BY0A 3U2RA 2V9KA 4ZH4F 3RPUD 3R6SA 1MIJA 5CJ9A 4Q5SF 5FKLA 3HTSB 4BEHA 2ZNYA 1FJLA 3P9KA 4XLAA 2IGOA 3EQLF 1S29A 2CQ7A 3NAUA 4N4NB 3WHCA 3BC8A 2QWWA 2BEOA 4OAYA 1HA8A 5J8CA 1U8RA 2VASA 1HDPA 2CV2A 4LG0B 4A0ZA 1MBHA 2A61A 3LFKA 3PSIA 2R7VA 1FOXA 3M4OJ 2YUSA 3S93A 3WGHA 5DDGA 2J5OA 1YS6A 1VTNC 2R4GA 3HOWJ 5CQEA 4M3EA 2QGUA 1VQ5I 3A2KA 1I5ZA 1I39A 1YIOA 3F9KA 3KEYA 2OUMA 3LWFA 2K5CA 3UKGA 5FFZA 2ZXIA 3J7AY 3I3LA 2STTA 1ZYRF 2X1EA 4IQ4A 1BI3A 1BIAA 2DU9A 4D1QA 2K9SA 3LSKA 2HQRA 2ZKZA 3DPTA 3VWBA 3GFIA 1T38A 1V5FA 1XMXA 1D1CA 3IAM2 1YI2I 5HLIA 2KZGA 2FOKA 1SFXA 1V3FA 3RCOA 1JKOC 1ITYA 1MMDA 2A3SA 4E7LA 1SFUA 3ABTA 2IGNA 1TWAJ 2A68F 2M2EA 1EF4A 1KQ0A 2NYXA 1K7AA 4EJVA 3RQIA 1ONVA 1TNSA 4ZZLA 4NQWB 2EPFA 3EUHA 3MZHA 1PJRA 1WJDA 4KN7X 3EYIA 1VQ9I 1NHAA 3A03A 3I5UA 4D5CA 4MIMA 3CDLA 3QOEA 2YU9J 2JTVA 3ABUA 2M34A 1JKQC 4AUXA 3OYAA 4JP0A 1LFUP 2FNAA 3JTHA 4R8HA 3C7JA 1ZLJA 5H2FC 4IRHA 4BYYA 4CA0A 2UXNA 4A69C 2W24A 4MFEA 1WJCA 2VJ5A 4CCOA 4L0YB 2V26A 1XN7A 2AO9A 2VPRA 2VBXA 3C2GA 3BCAA 2QM3A 1RETA 3M8EA 3SDBA 1LQ1A 1TWFJ 1BOAA 2HS5A 4KISA 2XIGA 4F93B 4B48A 3WTWC 3M9AA 4HLYA 2BHYA 3CCEI 3WGGA 1IW7F 4UY8I 2WAQN 3EUAA 3MQ0A 3OIOA 4EJUA 3TO7A 1XGOA 4L9NA 4HNVA 3E5QA 3CMYA 1WJFA 5C3EJ 3F23A 2M3AA 5E3MA 3BDDA 4II3A 4CCKA 1GV5A 5IP6A 5L3FA 2G0EA 1BN5A 3GTJJ 1LUJB 3GTOJ 5J4YA 3O3KA 1F9NA 3R4KA 2IGKA 1KGSA 2FBHA 2M7BA 3O2PE 1YS7A 2L0KA 4ZZDA 1SEUA 2XGXA 1HKTA 2DK8A 1O3TA 1DGWY 4BXUA 5A2QK 4AYBA 2IRFG 1SMYF 2EBIA 3CUQB 2XB0X 1O3RA 1JT6A 1T8IA 2ECBA 1AKHA 1UCRA 3C18A 1BR4A 4ZDOA 1FC3A 2ELHA 3FDYA 2NS0A 4GDFA 3FKJA 1POGA 4QSHA 1LDJA 4CUGA 1ZG3A 5EG0A 1OYWA 2DODA 4I7HA 3MEXA 1U5TA 2R7FA 3P7NA 2BBYA 5IYDJ 2MFZA 3MZYA 1WPKA 2XRLA 4J00A 1A6IA 4PDKA 5B3SH 2I5UA 4HA8A 2XRNA 1BC7C 2P5KA 2LLKA 1C0WA 1RI7A 4JOMA 1OFCX 2OPTA 4OINF 5HDNA 4B44A 4XLCA 2JMWA 5HS7A 1PP7U 4ABZA 1MNDA 2MC3A 1T6SA 3ECHA 2R7DA 1FPQA 4A3EJ 1K61A 1R7JA 3BWGA 3KPHA 5EG0B 1BM9A 1EH6A 3K70C 3CLQA 1FLIA 5KAFC 3SHFA 3WU1B 2BY2A 4G94A 4R1HA 4MTEA 1D3YA 1NG7A 1V5GA 2KISA 1DP7P 3MD2A 1I3AA 4LB5A 2LY9A 1SAUA 2ELJA 2NNNA 2KFDA 3SDGA 4RGXA 1RKTA 1ZG5A 1XMAA 4JX6A 3EUHC 4W1UA 2X48A 3ZXSA 4DYRA 1J59A 2BXYA 3K1MA 2IBDA 1QO0D 4KIGA 5IPAA 3ZPLA 2NVUB 1W4MA 2EH3A 2GBYA 3QPHA 4ESBA 3ESWB 4E7KA 2RVCA 3DV8A 4HBLA 3WE2A 1GUUA 2HGCA 5IP7J 2ZJ2A 5FFXA 4DJAA 3OS0A 3BY6A 2PMUA 4N0BA 5EGOA 5FRNA 4NNJA 1HBXG 1ERDA 4XKVA 4RDUA 2HVRA 1OJLA 2K9QA 4ZYAA 3HOXJ 4DW6A 3QP6A 4XNFA 3E97A 2M4GA 4U0YA 3H36A 4A3BJ 2CUEA 2V9VA 2FE3A 2Y2ZA 1LB2A 3FMSA 5KNLA 2DQLA 1X3WB 4C2UA 4F52A 3S32A 2LFBA 4FE4A 4HX4A 2LKSA 3TBIA 2H09A 3MZ8A 4EGZA 3FXJA 1I27A 4AIJA 1SAXA 1ZG1A 5CQGA 1SMTA 2DA6A 4DQ2A 2WB1A 2HI3A 1ETYA 2DT6A 3BG9A 2DT7B 5GAGJ 4YEJA 3F8BA 3JR9A 4WWCA 1MMSA 3IWZA 5D4RA 1FEXA 2HWVA 2VI6A 2DOAA 5E1WA 3KFWX 4C2MJ 4RA2A 5DYMA 4A3JJ 1JHFA 4D5FA 3HOYJ 1ZREA 2Z33A 3X2QH 4P1WA 1DPUA 1TTYA 3FK7A 3BTLA 3L09A 2H94A 3IV5A 3ZR8X 1U5TC 1B72A 1IRFA 3BPXA 2P0WA 5D4SA 1QZEA 1HW2A 2BZTA 2VIXA 3HOVJ 3V8KA 3Q0WA 1TQPA 2CQNA 5DD4A 2H8RA 4L9JA 2ME0A 1PVEA 3ONQA 3NEUA 1YW8A 4IVNA 1TW2A 4MNUA 1AOYA 1W0TA 3G3ZA 5J3LA 5HNFA 1HF0A 4A93J 1ZAOA 2ELKA 1G3SA 2D1HA 3BR0A 3HOTA 2L02A 4EEFG 4OIOF 4AWXB 3GTLJ 3S1QJ 3HGYA 2DTZA 4NHJA 2L7MP 1D1AA 3L2RA 2L7ZA 2OA4A 5F0FA 2KRFA 3KP5A 2F6CA 3KZZA 1Y6IA 1UAAA 2G7UA 2HR3A 5H6QA 4H0EA 3CO7C 2ZC2A 3KP3A 4S05A 1NTCA 1D8JA 1U2WA 1YE9A 5LGTA 1O57A 1MBJA 2VQCA 1IF1A 3CP8A 2LF7A 3CD6I 1LEBA 4A3GJ 1U9OA 2E1NA 2EILH 3F8MA 3QYFA 3VDXA 3OYFA 3F22A 1G8XA 2F5FA 4Y13A 2FQ4A 4BBRJ 1FSEA 2GLOA 3HXLA 4HNUA 5J1UA 2E19A 2PMZA 1HKSA 2P6TA 4M9XA 3TGNA 2P5LC 4ESJA 1R71A 1MNEA 2DDAA 2BGCA 2Z3YA 4E7HA 4B4CA 4CGZA 1HC8A 1OQYA 3J80Z 2CU7A 3TP3A 4HX8A 4GO1A 5D8LB 4Q4ZF 2HOEA 3JCUC 4AD9A 1Y1VJ 2L7KA 2LBFA 3WTUC 5CVRA 4BQOA 1B6AA 3F6VA 3OYKA 2HOTA 3COAC 3M1CA 3DPLC 3HUGA 4HAMA 3TQNA 1YRNA 2O6GE 1KZHA 3ZN1A 2KT0A 4PJMA 4XLEA 3H5NA 2H1LA 1BI0A 3K7AJ 3ZQIA 2KZVA 4BACA 1U6GA 4BJ5C 1QBJA 1FX7A 1VQ7I 5ICEA 3JTGA 1TZLA 1USTA 2FD5A 3NWTA 1FWZA 4M6XA 2XAUA 5ICGA 2XSDC 3OYGA 4I6ZA 1TP4A 4KT6A 3FZVA 1X1AA 4CCNA 3G4SI 4OMYA 2LY1A 5E79C 4PJLA 5HNHA 2R5YB 4UB8C 4ENKA 2WY7Q 5FD6A 2BW3A 5HDGA 1AU7A 3OL3A 1S7OA 4ZTJA 3W6VA 1RUNA 3S1NJ 4L0ZB 3KLNA 1YX5A 3NQOA 4GCVA 2PBIA 1MKMA 2E71A 3KEOA 1QVUA 1BR2A 4BQNA 2FXAA 2KDZA 3BR3A 2YX4A 1U0JA 1UMQA 3QYEA 1Q1HA 2FBIA 3FXMA 3VYSB 4BKXA 4Z6YA 1Z6RA 1ON1A 2HOAA 5BPDA 1CF7B 4M71A 1RPWA 1O3SA 1YJWI 2NVXJ 4IF4A 2PN6A 1D0YA 1KU2A 3VYRB 4BHBA 3FISA 2NOGA 3F21A 3N4MA 1N78A 3MVPA 5BOXA 2LR8A 4GGGA 3KP6A 2E1CA 1RIOH 4KA4A 2PFBA 2DFEA 1ETQA 3OYCA 3HOUJ 1Y0UA 3E1SA 1DDNA 4UUVA 5IT9Z 2RC4A 4BUPA 3EYYA 3A0BC 2HPMA 2ETHA 1OYIA 2WADA 3I9V2 2QSFX 1R36A 2B0LA 3LAJA 2HYGD 3G6EI 2Q2EB 2XKOA 3LSIA 2EV6A 4HX7A 3VEPA 4BL0B 1OYYA 4EVIA 1Y1WJ 4JK1X 2NVYJ 2JUCA 4KT5C 1W5SA 3QRFF 1XX5A 5D5WB 2HYFA 1JUMA 3KP7A 1K6YA 1Y56A 1IN8A 1VF9A 3ZQHA 2HTSA 2JA7J 3AG2H 2OV7A 3K1NA 3E6CC 1VQMI 2K3FA 4DOZA 4IOAF 3HL2A 1MJBA 5EEGA 3PL8A 2ZJPF 4MEYF 1W7PA 5FKKA 4ZYDA 5HDKA 3HM5A 3FF5A 3H5RA 2ZJQF 4RLQA 1G59A 1T33A 3RZOJ 3JRBA 4UVCA 4OOIA 2XF6A 4LJZF 4ASNA 1MJ9A 2VODA 4IRGA 2CQQA 2MG4A 4HPQA 4UUSB 2ID6A 2ZB9A 2QVOA 2IP2A 2VQHA 3E6DA 2E2HJ 4XSXF 2QYOA 5D8KB 1ZR4A 2OCCH 1G3TA 4QLCU 1BOBA 1DUXC 1TQMA 5IOYA 1GVDA 2X6WA 3S2WA 3LSHA 2HZDA 1P4AA 3T8RA 2NVTJ 1Z91A 3ELKA 4LFUA 4KDPA 2IS2A 2R7TA 4HF0A 3V7SA 1O4XA 1R1VA 2R3SA 5ICFA 4B09A 3U9GA 4L5EA 1RUOA 1V5EA 3H5AA 4LGWA 2Z1DA 1N25A 4XKWA 2CV0A 1RESA 1Y0NA 3H1CA 2L01A 5CVUA 1B9MA 4LIVA 3T5XA 1S6LA 2DCEA 1WZ2A 1WFXA 4U87A 5FB2A 2HQ5A 1JXSA 1P9QC 3J81K 4J19A 3N97A 2GOXB 5D5UB 4WK8F 3Q0VA 1E3PA 1P92A 4MLOA 2RN7A 1XD7A 3WTZA 1MDMB 3K4KA 1R5GA 2OAZA 2IAIA 2E5NA 3HSEA 3QAHA 6PAXA 3M07A 1R4MB 3L2VA 2EIKH 2LNBA 2QZ8A 4HV6A 3WGIA 2EIJH 4HQMA 3RIRA 1HDDC 1DPRA 2MGQA 2PJPA 5L3CA 4PJ0C 1JHHA 2CJJA 4IEJA 1CGPA 2R7UA 4DGWB 1UG0A 3BG3A 1RR8C 2CG4A 2LK2A 3LOCA 4WXDA 3F0CA 2XDVA 3OIPA 2VN2A 3IH2A 4DZPA 2IGMA 4UVAA 1R6RA 1YFHA 2O3FA 4YIFA 3HKZN 3EPZA 3K2ZA 1B8IA 3CP2A 3KYLA 4H4KC 1TWCJ 1OCZH 1P4WA 3GO5A 3ZMTA 2R7WA 1G6NA 1W5CC 4RGUA 3ZQQA 5TJJA 3V4GA 4PCQA 3RQ4A 1GHCA 2HQAA 2QENA 2KJCA 1R5ID 2LSOA 1HW1A 3ZCOA 4A6DA 1IN5A 1BJAA 2RQQA 2ZXJA 2LG4A 2M0MA 2N8GA 3S3MA 4UHTA 3BR1A 4LG0A 9ANTA 1HKQA 5LBQA 4G8XA 3GFLA 2XASA 3CTAA 5K7HA 1RC9A 2KQRA 4FQGA 3CJNA 1K4SA 2IS1A 4LMYA 4LLLA 1ZHFA 4EMSA 3I59B 1OISA 1TT0A 3K0LA 4RM2A 3TOAA 1X1DA 3CJQB 1WVRA 2KIFA 1F43A 4NUBA 4IZZA 5HS8A 4A5MA 5FLMJ 1RZ4A 4G7OF 4XLPF 1DGRM 3I58A 1IAWA 2JA5J 2H8WA 1IRXA 4A3LJ 3MKYB 3HDDA 2K7LA 2KDOA 2MLKA 4PSWA 4XMYA 5J8FA 3ZP5A 3RI4A 4EV0A 2GIZA 2CV1A 1H9GA 2BV6A 4WXCA 3W2AA 2QSHX 2XSJC 3GEZA 3PQJA 2P5VA 1JJ6C 2HNHA 2COMA 3GFJA 2HPIA 3HSRA 2MYSA 4LK0F 4RB2C 1K83J 4FHTA 3ISPA 3H9GA 5C4JJ 4EJWA 2A69F 2M8GX 2L9SA 3CJTB 5GPAA 1J0RA 2YU3A 5FJ8J 1PUFB 2PX9A 3DKYA 3K4BA 3VYUB 2EA2A 4NQWA 2W25A 4A3KJ 2QQBA 1OMIA 1ZH5A 3REOA 5AIQA 1BI1A 1JTXA 2BVMA 2VE9A 4IQJA 5F1JA 4M3GA 2IPQX 2Y75A 3TDZC 4OWRB 1T56A 1KU3A 3CCYA 4F7ZA 1DP3A 2HVQA 2L4AA 3M8JA 1XSDA 1R58A 2HTJA 1TWHJ 2NS7A 3CO6C 1CQTA 2A07F 2STWA 4XRSA 1MGTA 3VOEA 3JAMK 5FO5A 1GDTA 2E35A 5KAIC 2NNYA 1X1PA 1X4OA 1GLNA 2CGPA 2NAZA 4KMFA 4BU2A 2VQGA 2GXAA 4PJJA 2AS5F 3GFMA 2NXNB 1P7IA 2DPUA 2V9PA 4HW0A 3JRGA 3AKZA 2LY2A 1TNTA 4PJNA 4C3IJ 1B4AA 3ZOBA 4AC0A 4BHCA 1FTZA 3CZ6A 2X6XA 3BG5A 4U7BA 1W36C 1BBYA 2K4BA 2MD0A 2D2WA 3LSRA 1XG1A 1GVJA 1RKWA 2GA1A 1MBEA 2CUZA 4KUMA 3QP5A 1I6XA 1XGNA 1T39A 2HYJA 3JAMZ 3CUQA 3R0AA 4FE7A 4QTRA 4JBAA 1IO2A 3Q0UA 5E8GA 1LFBA 5IT3A 5K5RA 3DKWA 2F5EA 2JA6J 2ACJA 4L5JA 2LYCA 2RGVA 3ASNH 5J4VA 3RYRA 2KRCA 2HU9A 2Y0SA 5DM7F 3I54A 4BE2A 1NK2P 1Z77A 2IJLA 3O8HA 2UV1A 2MABA 2ZSHB 4CCLA 3SQNA 1B59A 3W6KB 3H0GJ 1XDSA 1F1ZA 3R0JA 4S0HB 4B47A 3GWZA 4HF2A 1WCMJ 1SVOA 1OKRA 2HKXA 4DBRA 3MCZA 4JQFA 3TW6A 1IDZA 3GYHX 1IRZA 4IHXA 5F64A 2FF4A 2VKDA 1JUPA 4CZCA 2DJIA 3LMMA 1I1SA 5GP9A 3LA7A 4BDZA 1R5HA 3BPVA 2H27A 1R4NB 3E7LA 4KIFA 2AXLA 1GV2A 3HEFA 4AVZA 3AFHA 3VSKA 1EV7A 4O6JA 5JVTA 1UHSA 1IDYA 3AG1H 4E7JA 5ILUA 2CH0A 4HEA2 1YG2A 3GLLA 2YR2A 1SVLA 5H6RA 4IOCF 3WU2C 5DM6F 3CMEI 4ON0A 2F4OB 4V2GA 2D5VA 4KITB 2EQRA 2XHKA 1ENHA 1X19A 3CDIA 1OCPA 2ZFUA 3AG4H 4I98B 4F55A 2XGCA 3ZQCA 2ZSIB 3S8PA 4FCYA 2RQPA 2JWTA 2WAQA 3HRUA 1QQIA 5A2QZ 3HBLA 3OMYA 1EA3A 4X1EA 5F0CA 3UNGC 3GUDA 3QOPA 3BP8A 3PNYA 2L7FP 4ANJA 1MH4A 4IHVA 4ZJZA 2Z2SB 3IP4B 2VC1A 4A0XA 4IX7A 2HZTA 2AHQA 3SFIA 3ZMZA 1TL8A 3LA3A 4P5OA 3LNQA 2I8DA 5JHFA 3G73A 4CCJA 1EKEA 1LVKA 3AL0B 4Y52J 4MTDA 4XIDA 3IHUA 4M6VA 3LSMA 2ZO4A 1P7JA 5GADJ 5J6XA 5ED4A 2W1OA 3G1LA 4BDYA 3Q5FA 2EA4A 1IV6A 3P9IA 2WY8Q 3I64A 3MN2A 3J7AO 3OS1A 2IA2A 3R61A 2LDUA 1D5VA 2EV0A 2WB1N 3W2VA 4HZFA 3TP0A 2VBZA 4XORA 2E34A 1FOKA 1QA6A 2AQFA 3SYTA 3I0TA 2K02A 3HHGA 5BQTA 3GLXA 3IC7A 4XLHA 1GXQA 5GPCA 3VSLA 1W5TA 2XAGA 3CUQC 1JGSA 3CCRI 4IJAA 1LE8B 3GTPJ 2O7OA 4YRVA 1ZR2A 1LVAA 3KZIC 4A3CJ 3FHNA 1WH5A 3IUOA 1V54H 1VQ6I 3W2WA 4WX9A 4MQ9F 3GMEA 2GWRA 2Y69H 1K6OA 1X58A 1SFKA 4BH9A 2HFHA 3LL7A 2MBFA 3L7WA 3TDUC 1VQNI 1R1UA 4J01A 2QCOA 5ILSA 1MBKA 4OAZA 4PFPA 2PQ8A 2DK5A 3GZ6A 1YW7A 3OSFA 5EJCA 3CLOA 5ILVA 4LIUA 2FQ3A 5GAHJ 2JN6A 3GTMJ 4FX4A 2UWMA 2YS9A 1O7FA 3PM1A 3OYLA 1WH7A 3HC7A 1MBFA 1F5TA 3RJPA 2Y30A 2Y48A 2ZNZA 5IP9J 2V6CA 3MKWB 1ZRDA 1ODDA 1A35A 3V8LA 3RKYA 5K5OA 5LEJA 5K7ZA 4XQFA 1FTTA 3DXJF 3PNVA 3T1BA 3FXRA 5LEKA 3BQYA 1MSEC 2HKOA 1FMWA 4NC6A 2EWNA 3BG6A 2PMZN 4YELA 2K9NA 2ECCA 2FUG2 1STZA 2GM4A 2Q0OA 4IL6C 4XL9A 4HDUA 1A04A 2E7WA 2MA3A 2E1MB 4CCMA 3SEQA 4HRIA 2OQRA 3ZMVA 1UJ8A 1T0FA 2DI3A 4YIIA 2J5PA 5F08A 1MMAA 4FTHA 1BL0A 4G7HF 3IH4A 4LK1F 3SEZA 1KQ9A 3ZGKA 1Y8RB 4NC8A 1OLTA 2AXTC 1T98A 2ICWG 2RV8A 4QWQA 2ME6A 3MKLA 4B43A 1K78B 2WC2A 4YFNF 4AU7A 2P8TA 1R22A 3O6BB 4EM0B 1X3UA 2MH2A 1SANA 5EEHA 1R49A 5BS6A 3CMAI 4UNOA 1ETVA 4IHYA 4ETSA 2LVSA 1I1GA 1QPIA 3VODA 3G1OA 2ESHA 4E7IA 3GZ5A 5CKTA 3D5LA 1YJNI 1W0UA 4O5VA 4W97A 3W6JB 1Z7UA 4P9UA 3PUBA 2R5YA 1WSUA 5HODA 2X6YA 1BW5A 2VJJA 3J7YJ 4IHSA 4BXXJ 2W85A 4E70A 1QNTA 2HEOA 5TISC 1LDKB 1JJ8C 3DF8A 5C4XJ 2ZMEB 1XPXA 1JTYA 2V1NA 1B1BA 5K5QA 4KNYA 4RGSA 2X9DA 4IHWA 3SXYA 3JREA 4MGRA 1ZKGA 1ZK8A 2PJRB 5D5XB 1CF7A 4WCGA 4YFXF 5AIPA 2H6CA 3JRCA 3CUOA 4E7SA 3TW7A 2WA0A 4XLFA 1LDDA 4M72A 1WI3A 2W7NA 3WODF 4ZYHA 5BPIA 2VOOA 4CYDA 1P4XA 2L5QA 4OIQF 2DPDA 2R0QC 2DMTA 2IA1A 2L9NA 2HOSA 3QU3A 3C3WA 2CFXA 5KCMA 5FROA 5TRDA 3L00A 4L5IA 5M5XJ 3G1MA 2FJ1A 1TWGJ 3S3NA 5F6FA 5DUIA 1YQAA 2FSWA 3S1MJ 3S16J 1MMGA 4HSTA 1X3ZB 2LD5A 3ECOA 4AVPA 2A6TA 2RNJA 3S15J 3GVAA 4Y4RA 1S5LC 2Q2EA 3KX2A 2DJNA 5E17F 1KYZA 1FZPB 4GYIA 3OYMA 4JYKA 2NRAC 2DOFA 3RZDJ 3BJOA 1J2XA 3K6GA 5J1YA 4I2OA 4MQVA 5L3BA 1J09A 2RREA 3R60A 4A5NA 2R93J 2MD5A 2VOPA 5K7FA 3L2UA 1JE8A 5CVJA 3FM3A 4A0YA 3WTXC 4F3QA 4I02A 1WRJA 1T0FC 3OY9A 2FX0A 1QHGA 1IUYA 1LPQA 3CQZJ 1J7KA 1WHUA 2M7AA 3AG3H 1DU6A 2OTLI 4OMZA 4BHPA 1P2FA 2DN0A 2M8EA 2Z5UA 3L2WA 4C3JJ 1AHDP 3K69A 3OV8A 1I3QJ 3K4LA 2VBWA 2V7FA 4GXOA 1Z1DA 4WXHA 1W36D 1FBQA 3QU6A 1AA7A 1XGMA 2BY3A 2OF7A 4XRFA 4UUSA 2HDDA 3JRIA 4I01A 2A5YB 4B3XA 4Y33A 2G7HA 3BR5A 5J40A 1IN6A 5B66C 2XPWA 5LGUA 1IXSB 2W82A 1MNMC 4EM1A 5DS9A 4BGDA 2I10A 1BW6A 2DAOA 5J47A 3D5SC 1E17A 1M1EB 2MLGA 1D0XA 3PFYA 4Y15A 2XPVA 4M3FA 4KJZA 5E3NA 1ZGWA 3H3UA 2FU4A 3N05A 1REPC 4XSZF 3A0HC 1J5YA 4G6QA 3LA2A 5E1XA 2G9WA 2DOEA 2CUJA 2E5ZA 4CZZA 3LAPA 3CF5F 4NBQA 5F04A 5KHDA 4BJTA 1ZRCA 2IS4A 1FMVA 1APLC 3QPLA 4D7NA 4U0WA 3ZQGA 1FYLA 3EUKL 4LB6B 3RKXA 2L9RA 3GXOA 4NB5A 3DPUA 1NH3A 5L3GA 4RBOA 2P4WA 1MDMA 2XUBA 3TL4X 4IRIA 1JI8A 1HW5A 3ZMDA 4KICA 1JUSA 2K85A 4A2UA 3IAS2 3BTIA 4R79A 2IXSA 1YHQI 2F2EA 4V19K 2O03A 2KJBA 2ZXWH 4M3DA 4HDVA 2QBYB 2LREA 2NOJB 3CMMA 2JT1A 3GZNB 1TLHB 4LLGF 1F4KA 4L9TA 4N9HA 1ON2A 3S14J 1KYWA 1ETOA 3FMRA 4RB3C 4C3HJ 4DBQA 5F0HA 4ZDPA 2OQGA 2BE5F 1Z21A 5JR3A 3K70D 3JRDA 1H0MA 2WWYA 1X2MA 3RDIA 5LD2C 4EM2A 2EINH 1MSFC 1SFOJ 3HPHA 2X6OA 4ZTFA 3K2AA 4HV5A 4QPOA 5JVGF 1WJEA 1U3EM 2DLLA 5AONA 2P81A 2GIVA 3BR6A 4IPAA 5K1YA 3DKXA 2KIMA 4M74A 5DCMB 2JVGA 1FP2A 1NG6A 1UG2A 1XS9A 2OBPA 3FXLA 4BQAA 1BA5A 4XONA 1X1BA 2DYSH 4MO7A 5DUKA 3J81Z 3SZPA 3HOZJ 2XKPA 3I4PA 2EFWA 2DTRA 2RDPA 4KYWA 1FIPA 2EV5A 3I59A 5KVRA 2OTJI 4BAYA 2LKXA 4KMUX 1JKRC 2YPRA 2K27A 4EJOA 3TOBA 3BJAA 3QWLA 3I4NJ 1KU9A 3BR2A 1WGXA 3FKIJ 5M5WJ 1S7EA 3H0DA 5D6FA 1YTYA 5E18F 1J75A 2RKHA 1DU0A 2VUMJ 2HDWA 5FLXK 3I4MJ 2KPMA 1YJ9I 2KIQA 2DA1A 3LSGA 4P96A 4X0GA 2RAEA 2Q8KA 3F8CA 4Y17A 2VKVA 3HOSA 2DYRH 2E7XA 4XBFA 2ZBKA 4UV8A 1LFPA 5D6EA 1HXDA 1WWXA 1QPMA 2M9HA 3K4JA 3KYDB 3JRAA 2KP6A 1PUFA 2M0CA 4G6DA 2IW5A 1TC3C 3B6AA 5HLHA 2XGEA 2EJRA 4BNCA 3JRFA 1Z0XA 2WV1A 3H35A 2Q1ZB 3C2BA 3HB9A 2EFQA 3LQQA 2MH9A 1VI0A 2GXGA 1XSXA 3SZGA 4AIKA 1H88C 1IXRC 2FMYA 4CDGA 5GTIC 3JRHA 3ASOH 2A05A 2OC6A 1QVTA 1XMKA 3Q9VA 3D0SA 4HSRA 2A6EF 3KYCB 2CQKA 1ZN2A 3PIOF 2JPCA 3DFGA 2PMHA 2KHMA 5FD5A 2IS6A 3OYBA 1SD5A 3I55I 1FBUA 2M87A 3JSOA 2ESNA 1MMNA 2NS8A 3G71I 2BHZA 4BS9A 3DLLF 2KL4A 3E0JB 3GBGA 1HQCA 3I56I 5CVIA 2PG4A 3BLYA 3OYDA 3BT9A 2CW8A 2DMPA 3O8GA 1IG7A 4G7ZF 1QZZA 2K86A 2ZCWA 3DLAA 1G3WA 3A1YA 4B3AA 1UHMA 3P9CA 3CCSI 4PUSA 3D5RC 4B8XA 5GTHC 1O3QA 4BEHB 1IN7A 1BI2A 1IV8A 2KRHA 2VQLA 1WQ2A 4G6TB 3E5XA 3CESA 4DIQA 2QQAA 3K4MA 1X1CA 4E6KG 1H89C 3CC7I 4Q47A 1RRJA 1MJAA 2Y0SN 1JT0A 2IEKA 5E8IA 1LJ9A 3NRVA 3WTVC 5HOOA 2TDXA 2ID3A 3FIWA 5DCFA 4A12A 1F36A 1KA8A 4S04A 1K79A 3ABKH 3ROUA 2QLZA 1D5YA 3M7GA 2VT3A 2VXZA 2W00A 3OWTA 4AYBN 1OCRH 4EJTA 2JQ7A 5E3OA 3KP2A 3OS2A 3CCQI 1UB9A 1XSVA 4XN3A 2XC7A 1XC5A 2V1DA 2IA0A 1VQKI 1Z6TA 1VQPI 1VFCA 3BZCA 3LSTA 2XVCA 4PZJA 4UUTA 2M5WA 3FK6A 3E3VA 2X4HA 4RM3A 2OCEA 4IHTA 3VB2A 3VPRA 2DFFA 1I6HJ 3BOQA 1IUFA 2R7OA 2HXIA 1SVMA 3VFZA 4HLXA 4AIDA 4DYQA 3DTEA 2TRTA 5M3MJ 3BTJA 2EZLA 2GA2A 3C1DA 4EQQA 3DEWA 4XOPA 3ULQB 3HYIA 1D1BA 2DA5A 4NC7A 5DTDA 3M1EA 1R9TJ 3K9TA 2GZWA 3ML6A 1V4RA 1IC8A 2DMQA 3GTKJ 1R23A 2VJIA 3S17J 4Y7NJ 3CC2I 2B7EA 5E20A 3EDPA 3CDHA 1ZGJA 2FEZA
chains in the Genus database with same CATH topology
2XROA 3RPUA 2EB7A 4P55A 2XAQA 4UXNA 2HDCA 2VE8A 2M45A 2XAJA 1FSHA 4TV7A 2HQNA 1KQ8A 1XGSA 3E6MA 3F72A 4ENMA 4HF1A 2XAHA 1IZ1A 2EK5A 3BROA 2VT2A 3DEUA 5L3EA 2GQQA 3MAJA 4FT8A 5L3DA 1TW3A 1U5TB 3B73A 5HLGA 3EETA 2OD5A 3HRSA 5KK1A 3SFZA 2W84A 1FYMA 2DO7A 4IXAA 5ICCA 4U7DA 2JRTA 2DQRA 5HS9A 2ISZA 1Z9CA 2P7VB 2W57A 5JFRA 3DQVC 5LHIA 3RYPA 2LF8A 3PQKA 1EH8A 3TKYA 2O61A 1U78A 3LQRA 3QPTA 4RAZA 1O7LA 2XAFA 1T2KA 1ZLKA 4L18B 2EFOA 1XCVA 1KU7A 1Z05A 5LLQA 4KFCA 2V79A 4A6EA 5CLSA 1IRGA 1PUEE 2UXXA 1SD6A 2A6HF 1OPCA 2D1VA 4G9YA 4RB1A 1LNWA 1R00A 4P9FA 1IXCA 4OIPF 1SFEA 5CYVA 1UHWA 3Q9SA 1RNLA 2CYYA 3U1DA 1QZYA 3IRQA 1G3YA 4UV9A 1PDNC 2QUFA 2O0YA 3MWMA 1K78A 3IRRA 5LHHA 3GF2A 5JHUA 4FX0A 3MFKA 3I71A 2EFNA 3T8TA 1FYKA 4MHGA 4GYGA 3L9FA 4ENJA 2ZFWA 4ESFA 3IKVA 3TO6A 4O3MA 4U88A 1XDUA 4KN4X 2JPBA 2O8XA 4PGHA 1OR7A 1AWCA 2VC0A 2L54A 2BYVE 2K4JA 2IT0A 3V7RA 3KEQA 3J80K 5HVQC 2ZMEA 3K1PA 4RGRA 4PGGA 2JZYA 2WV0A 2ISYA 3JW4A 4UVBA 1W7PD 3IL2A 4LD5A 4ZYEA 3GW2A 3F6OA 2FMLA 2F5CA 4LLNA 3FXUA 4YG2F 1SD4A 3KLOA 1MZBA 3L2CA 4M73A 1QGPA 2IVMA 1HSJA 1P6RA 3V7CA 3ZQ7A 1UFMA 3HIFA 2C6YA 2FBKA 4XLNF 2FA5A 3OOPA 3JSPA 3M8FA 2FNPA 5JI6A 2CO5A 1WKMA 3I53A 5H20A 2P7CB 4WF2A 3TO9A 3WTTC 2DW4A 2DFIA 5FGMA 3WE3A 2L3DA 2Y0MA 4D0PA 3FWEA 2DT5A 4M9ZA 5ERIA 1HSTA 5DEQA 2Z9OA 4M6YA 2CW0F 5IT9K 1YW9A 2WTEA 3B02A 1L3LA 1IN4A 3HHHA 3ZMUA 2PLYA 3H92A 2OU2A 3IWFA 2XV4S 4HOBA 4M9SA 5LRSA 2GXBA 2DBBA 2JSCA 4MEXF 1G4DA 2ADUA 3ZN0A 1PP8F 3PFIA 3BZ6A 4OIRF 1L0OC 3E5UA 2X0LA 1S8NA 4KIBA 4CXFA 3T0YA 4CHUA 1YLFA 1ZGAA 3HRTA 2FRHA 2D45A 3F8FA 5D5VB 5DV5A 1EH7A 1WI9A 1XCBA 5LGNA 1FP1D 1YO5C 1FY7A 3AAFA 1ZARA 2KIUA 2PI0A 4Q48A 2V1UA 4I0AA 2EFPA 2QBYA 2LKPA 5F1RA 4U0VA 1E2XA 1ZRFA 5CVVA 1ULYA 2P6SA 1FT9A 3HSFA 3DP7A 3IKTA 2PEXA 4K2EA 3GX4X 1B9NA 2YSRA 2CSOA 3ERED 2VBYA 3HTUA 4OU0A 1XB4A 2UZKA 4AIHA 1W7PB 3E6BA 4ZYGA 3FX3A 1H9TA 2OZ6A 3KZYA 1TQIA 1SD7A 5DCMA 4EGYA 5BMZA 3KCCA 1FNNA 5E1ZB 3KETA 2F5DA 1GXPA 2GAUA 3KE2A 2CWEA 4RAYA 2M1BA 3FM5A 5LHGA 4HQEA 3FMQA 2Z99A 4DNCA 1LEAA 4HYEA 3WU0A 3F3XA 4L9VA 2QQ9A 1J9IA 3V8JA 3BJ6A 4RB0A 1YYVA 4ENNA 4N9IA 5DD8A 3RTRA 3SZTA 3FXQA 2L4MA 4CO8A 1S3JA 2VONA 3H3ZA 2M30A 3HRMA 4YFKF 3WTSC 1BC8C 1BIBA 1FBSA 5LRRA 3KP4A 2YX7A 3RPQA 3ZMSA 2V1XA 2KKOA 2H6BA 1MD0A 2OZUA 4RS8A 4I0BA 3WTYC 4I09A 1S7AA 1USSA 1TBXA 4CICA 4Z2YA 3F8NA 3RKWA 3FHZA 3WG9A 5FLXZ 1D8KA 1R1TA 3U2RA 4ZH4F 3R6SA 5CJ9A 4Q5SF 3HTSB 2ZNYA 3P9KA 3EQLF 1S29A 2QWWA 2BEOA 5J8CA 1U8RA 4LG0B 4A0ZA 2A61A 3LFKA 3WGHA 5DDGA 2J5OA 1YS6A 1VTNC 1I5ZA 1YIOA 3LWFA 5FFZA 2STTA 1ZYRF 1BI3A 1BIAA 2DU9A 2HQRA 2ZKZA 3DPTA 3GFIA 1T38A 5HLIA 2FOKA 1SFXA 1V3FA 2A3SA 1SFUA 3ABTA 2A68F 1KQ0A 2NYXA 1K7AA 4EJVA 1ONVA 1TNSA 4ZZLA 3EUHA 3MZHA 4KN7X 3EYIA 1NHAA 3I5UA 2JTVA 3ABUA 2FNAA 3JTHA 4R8HA 3C7JA 1ZLJA 4IRHA 4BYYA 2UXNA 2W24A 4L0YB 1XN7A 2VBXA 2QM3A 3M8EA 1LQ1A 1BOAA 2HS5A 2XIGA 3WTWC 3M9AA 4HLYA 3WGGA 1IW7F 3MQ0A 4EJUA 3TO7A 1XGOA 4L9NA 3E5QA 3F23A 3BDDA 5L3FA 1BN5A 3O3KA 1F9NA 3R4KA 1KGSA 2FBHA 3O2PE 1YS7A 4ZZDA 2XGXA 1HKTA 2DK8A 1O3TA 4BXUA 5A2QK 2IRFG 1SMYF 3CUQB 1O3RA 1UCRA 3C18A 1FC3A 2ELHA 2NS0A 1LDJA 1ZG3A 1OYWA 4I7HA 3MEXA 1U5TA 2R7FA 3P7NA 2BBYA 3MZYA 4PDKA 4HA8A 1BC7C 2XRNA 2P5KA 1C0WA 1RI7A 5HDNA 4OINF 5HS7A 1PP7U 2MC3A 1T6SA 3ECHA 2R7DA 1FPQA 1R7JA 3BWGA 1BM9A 1EH6A 1FLIA 3SHFA 3WU1B 4G94A 4R1HA 4MTEA 1D3YA 1DP7P 4LB5A 2NNNA 4RGXA 1ZG5A 1XMAA 1J59A 3K1MA 4KIGA 1QO0D 3ZPLA 1W4MA 3QPHA 4ESBA 2RVCA 3DV8A 4HBLA 3WE2A 2HGCA 2ZJ2A 5FFXA 3BY6A 2PMUA 4N0BA 1HBXG 3QP6A 3E97A 4U0YA 2V9VA 2FE3A 1LB2A 3FMSA 2DQLA 4HX4A 2H09A 4EGZA 4AIJA 1I27A 1SAXA 1ZG1A 1SMTA 4DQ2A 3F8BA 4WWCA 3IWZA 5D4RA 2HWVA 5E1WA 3KFWX 5DYMA 1JHFA 1ZREA 2Z33A 1DPUA 1TTYA 3L09A 2H94A 1U5TC 1IRFA 3BPXA 5D4SA 1HW2A 3V8KA 1TQPA 5DD4A 4L9JA 3NEUA 1YW8A 4IVNA 1TW2A 4MNUA 1AOYA 3G3ZA 1ZAOA 1G3SA 2D1HA 3HOTA 2L02A 4OIOF 4AWXB 4NHJA 2OA4A 2KRFA 3KP5A 3KZZA 2G7UA 2HR3A 5H6QA 4H0EA 3CO7C 3KP3A 4S05A 1D8JA 1U2WA 5LGTA 1O57A 1IF1A 1LEBA 2LF7A 2E1NA 3F8MA 3F22A 2F5FA 4Y13A 1FSEA 1HKSA 2P6TA 4M9XA 3TGNA 2P5LC 4ESJA 2BGCA 2Z3YA 4CGZA 3J80Z 4HX8A 4GO1A 5D8LB 4Q4ZF 2HOEA 4AD9A 3WTUC 5CVRA 1B6AA 3F6VA 3COAC 3DPLC 3HUGA 4HAMA 3TQNA 2O6GE 3ZN1A 1BI0A 1U6GA 1QBJA 1FX7A 5ICEA 3JTGA 1USTA 4M6XA 1FWZA 5ICGA 3FZVA 4OMYA 4ENKA 5FD6A 5HDGA 1S7OA 1RUNA 4L0ZB 3KLNA 3NQOA 4GCVA 2PBIA 1MKMA 3KEOA 2FXAA 2YX4A 1Q1HA 2FBIA 1Z6RA 1ON1A 5BPDA 1CF7B 4M71A 1O3SA 4IF4A 2PN6A 1KU2A 4BHBA 3F21A 3N4MA 5BOXA 4GGGA 3KP6A 2E1CA 1RIOH 4KA4A 2PFBA 1Y0UA 1DDNA 4UUVA 5IT9Z 2RC4A 3EYYA 2ETHA 1OYIA 1R36A 2B0LA 3LAJA 2HYGD 2XKOA 4EVIA 2EV6A 4HX7A 3VEPA 1OYYA 4JK1X 4KT5C 1W5SA 3QRFF 5D5WB 2HYFA 3KP7A 1IN8A 2HTSA 3K1NA 3E6CC 1MJBA 5EEGA 4MEYF 1W7PA 4ZYDA 5HDKA 3FF5A 4UVCA 4OOIA 4LJZF 4ASNA 1MJ9A 2VODA 4IRGA 2QVOA 2IP2A 3E6DA 4XSXF 2QYOA 5D8KB 1G3TA 4QLCU 1DUXC 1TQMA 3S2WA 1P4AA 3T8RA 1Z91A 3ELKA 4LFUA 4KDPA 4HF0A 3V7SA 1R1VA 2R3SA 5ICFA 4B09A 3U9GA 1RUOA 4LGWA 5CVUA 2L01A 1B9MA 3T5XA 1S6LA 5FB2A 1JXSA 3J81K 3N97A 5D5UB 4WK8F 1P92A 2RN7A 1XD7A 3WTZA 1MDMB 1R5GA 2OAZA 3HSEA 3QAHA 6PAXA 2LNBA 2QZ8A 4HV6A 3WGIA 4HQMA 3RIRA 1DPRA 2PJPA 5L3CA 1JHHA 1CGPA 2CG4A 4WXDA 2VN2A 4UVAA 1YFHA 2O3FA 4YIFA 3K2ZA 1P4WA 3GO5A 3ZMTA 1G6NA 4RGUA 5TJJA 3V4GA 4PCQA 1GHCA 2QENA 2KJCA 2LSOA 1HW1A 4A6DA 1IN5A 1BJAA 2ZXJA 4UHTA 4LG0A 1HKQA 5LBQA 4G8XA 3GFLA 2XASA 3CTAA 3CJNA 4LMYA 4LLLA 1ZHFA 4EMSA 3I59B 3K0LA 3TOAA 2KIFA 5HS8A 4A5MA 1RZ4A 4G7OF 4XLPF 3I58A 1IAWA 2K7LA 2MLKA 5J8FA 3ZP5A 3RI4A 4EV0A 1H9GA 2BV6A 4WXCA 3GEZA 3PQJA 2P5VA 2COMA 3GFJA 3HSRA 4LK0F 4RB2C 4FHTA 3ISPA 4EJWA 2A69F 1J0RA 2YU3A 2EA2A 4NQWA 2W25A 2QQBA 1OMIA 1ZH5A 3REOA 5AIQA 1BI1A 2VE9A 2IPQX 2Y75A 3TDZC 1KU3A 4F7ZA 2L4AA 1XSDA 1R58A 2HTJA 3CO6C 2A07F 2STWA 1MGTA 3VOEA 3JAMK 5FO5A 2NNYA 2CGPA 2NAZA 4KMFA 2AS5F 3GFMA 2DPUA 4HW0A 1TNTA 1B4AA 4BHCA 4U7BA 1BBYA 2K4BA 2D2WA 1GVJA 2GA1A 4KUMA 3QP5A 1I6XA 1XGNA 1T39A 3JAMZ 3CUQA 3R0AA 4JBAA 5E8GA 5IT3A 5K5RA 3DKWA 2F5EA 2ACJA 4L5JA 2RGVA 3RYRA 3I54A 2IJLA 3SQNA 1B59A 3W6KB 1XDSA 1F1ZA 3R0JA 4HF2A 3GWZA 1OKRA 2HKXA 3MCZA 4JQFA 3GYHX 5F64A 2FF4A 1I1SA 3LA7A 1R5HA 3BPVA 2H27A 4KIFA 2AXLA 1EV7A 4O6JA 5JVTA 5ILUA 1YG2A 5H6RA 2YR2A 4ON0A 2XHKA 4I98B 2RQPA 5A2QZ 3HRUA 1QQIA 3GUDA 3QOPA 3BP8A 2VC1A 4A0XA 2HZTA 3ZMZA 3LA3A 4P5OA 3G73A 4MTDA 3IHUA 2ZO4A 5J6XA 5ED4A 3Q5FA 2EA4A 3P9IA 3I64A 3J7AO 2IA2A 3R61A 2LDUA 1D5VA 2EV0A 4HZFA 2VBZA 1FOKA 3I0TA 2K02A 3HHGA 5BQTA 3GLXA 3IC7A 1GXQA 1W5TA 2XAGA 3CUQC 1JGSA 4IJAA 1LVAA 4WX9A 4MQ9F 2GWRA 1K6OA 4BH9A 2HFHA 2MBFA 3L7WA 3TDUC 1R1UA 5ILSA 2PQ8A 2DK5A 3GZ6A 1YW7A 3CLOA 5ILVA 2FQ3A 4FX4A 2UWMA 1O7FA 1F5TA 3RJPA 2Y48A 2ZNZA 2V6CA 1ZRDA 1ODDA 3V8LA 3RKYA 5K5OA 5LEJA 3DXJF 3T1BA 3FXRA 5LEKA 2HKOA 2EWNA 1STZA 2Q0OA 4HDUA 1A04A 2E7WA 2MA3A 2OQRA 3ZMVA 1T0FA 2DI3A 4YIIA 2J5PA 4G7HF 4LK1F 1KQ9A 2RV8A 1T98A 4QWQA 1K78B 2WC2A 4YFNF 2P8TA 1R22A 3O6BB 4EM0B 1X3UA 2MH2A 5EEHA 5BS6A 4UNOA 4ETSA 1I1GA 3VODA 2ESHA 3GZ5A 3D5LA 4O5VA 3W6JB 1Z7UA 4P9UA 1WSUA 4IHSA 2W85A 4E70A 1QNTA 2HEOA 1LDKB 3DF8A 2ZMEB 1B1BA 5K5QA 4KNYA 4RGSA 3SXYA 4MGRA 5D5XB 1CF7A 4WCGA 4YFXF 5AIPA 2H6CA 3CUOA 1LDDA 4M72A 3WODF 4ZYHA 5BPIA 2VOOA 4CYDA 1P4XA 4OIQF 2DPDA 2IA1A 3QU3A 3C3WA 2CFXA 5TRDA 3L00A 4L5IA 5F6FA 5DUIA 1YQAA 2FSWA 3ECOA 4AVPA 2RNJA 3GVAA 2Q2EA 5E17F 1KYZA 1FZPB 4GYIA 2NRAC 3BJOA 1J2XA 4I2OA 2VOPA 4MQVA 5L3BA 3R60A 4A5NA 2MD5A 1JE8A 5CVJA 3FM3A 4A0YA 3WTXC 4I02A 1WRJA 1IUYA 1J7KA 4OMZA 4BHPA 1P2FA 2M8EA 2Z5UA 3K69A 3OV8A 2VBWA 4GXOA 1Z1DA 4WXHA 1FBQA 3QU6A 1XGMA 4XRFA 4I01A 2A5YB 2G7HA 1IN6A 5LGUA 1IXSB 4EM1A 2DAOA 1E17A 2MLGA 4Y15A 3H3UA 2FU4A 1REPC 4XSZF 1J5YA 4G6QA 3LA2A 5E1XA 2G9WA 4CZZA 3LAPA 1ZRCA 4U0WA 1FYLA 4LB6B 3RKXA 3GXOA 4NB5A 5L3GA 2P4WA 1MDMA 2XUBA 4IRIA 1HW5A 3ZMDA 4KICA 4A2UA 4R79A 2F2EA 2O03A 2KJBA 4HDVA 2QBYB 2JT1A 1TLHB 4LLGF 1F4KA 4L9TA 4N9HA 1ON2A 1KYWA 3FMRA 4RB3C 2OQGA 2BE5F 5JR3A 1H0MA 2WWYA 3RDIA 4EM2A 4HV5A 1U3EM 2DLLA 5AONA 5K1YA 2GIVA 4IPAA 2KIMA 4M74A 5DCMB 1FP2A 2OBPA 4BQAA 5DUKA 3J81Z 3SZPA 2XKPA 3I4PA 2EFWA 2DTRA 2RDPA 4KYWA 2EV5A 3I59A 5KVRA 4BAYA 4KMUX 2YPRA 2K27A 4EJOA 3TOBA 3BJAA 1KU9A 5D6FA 1YTYA 5E18F 1J75A 2RKHA 5FLXK 4P96A 2Q8KA 3F8CA 4Y17A 3HOSA 2E7XA 4XBFA 2ZBKA 4UV8A 5D6EA 1HXDA 1WWXA 1QPMA 4G6DA 2IW5A 5HLHA 2EJRA 4BNCA 3LQQA 2EFQA 2MH9A 2GXGA 1XSXA 4AIKA 1IXRC 2FMYA 4CDGA 1XMKA 3Q9VA 3D0SA 2A6EF 2CQKA 1ZN2A 2JPCA 3DFGA 2PMHA 5FD5A 1SD5A 1FBUA 2M87A 3JSOA 2ESNA 1HQCA 5CVIA 2PG4A 4G7ZF 1QZZA 2K86A 2ZCWA 1G3WA 1UHMA 3P9CA 4B8XA 1O3QA 1IN7A 1BI2A 1WQ2A 3E5XA 2QQAA 4Q47A 1MJAA 5E8IA 1LJ9A 3NRVA 3WTVC 5HOOA 2TDXA 5DCFA 4A12A 1KA8A 4S04A 1K79A 3ROUA 2QLZA 3M7GA 2VT3A 2VXZA 4EJTA 3KP2A 1UB9A 1XSVA 2V1DA 2IA0A 1Z6TA 3LSTA 2XVCA 4PZJA 2M5WA 3E3VA 2X4HA 4IHTA 3VB2A 3BOQA 3VFZA 4HLXA 2GA2A 3C1DA 4EQQA 3ULQB 3HYIA 3M1EA 3K9TA 2GZWA 3ML6A 1V4RA 1R23A 5E20A 3EDPA 3CDHA 1ZGJA 2FEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRO A;  3RPU A;  2EB7 A;  4P55 A;  2XAQ A;  4UXN A;  2HDC A;  2VE8 A;  2M45 A;  2XAJ A;  1FSH A;  4TV7 A;  2HQN A;  1KQ8 A;  1XGS A;  3E6M A;  3F72 A;  4ENM A;  4HF1 A;  2XAH A;  1IZ1 A;  2EK5 A;  3BRO A;  2VT2 A;  3DEU A;  5L3E A;  2GQQ A;  3MAJ A;  4FT8 A;  5L3D A;  1TW3 A;  1U5T B;  3B73 A;  5HLG A;  3EET A;  2OD5 A;  3HRS A;  5KK1 A;  3SFZ A;  2W84 A;  1FYM A;  2DO7 A;  4IXA A;  5ICC A;  4U7D A;  2JRT A;  2DQR A;  5HS9 A;  2ISZ A;  1Z9C A;  2P7V B;  2W57 A;  5JFR A;  3DQV C;  5LHI A;  3RYP A;  2LF8 A;  3PQK A;  1EH8 A;  3TKY A;  2O61 A;  1U78 A;  3LQR A;  3QPT A;  4RAZ A;  1O7L A;  2XAF A;  1T2K A;  1ZLK A;  4L18 B;  2EFO A;  1XCV A;  1KU7 A;  1Z05 A;  5LLQ A;  4KFC A;  2V79 A;  4A6E A;  5CLS A;  1IRG A;  1PUE E;  2UXX A;  1SD6 A;  2A6H F;  1OPC A;  2D1V A;  4G9Y A;  4RB1 A;  1LNW A;  1R00 A;  4P9F A;  1IXC A;  4OIP F;  1SFE A;  5CYV A;  1UHW A;  3Q9S A;  1RNL A;  2CYY A;  3U1D A;  1QZY A;  3IRQ A;  1G3Y A;  4UV9 A;  1PDN C;  2QUF A;  2O0Y A;  3MWM A;  1K78 A;  3IRR A;  5LHH A;  3GF2 A;  5JHU A;  4FX0 A;  3MFK A;  3I71 A;  2EFN A;  3T8T A;  1FYK A;  4MHG A;  4GYG A;  3L9F A;  4ENJ A;  2ZFW A;  4ESF A;  3IKV A;  3TO6 A;  4O3M A;  4U88 A;  1XDU A;  4KN4 X;  2JPB A;  2O8X A;  4PGH A;  1OR7 A;  1AWC A;  2VC0 A;  2L54 A;  2BYV E;  2K4J A;  2IT0 A;  3V7R A;  3KEQ A;  3J80 K;  5HVQ C;  2ZME A;  3K1P A;  4RGR A;  4PGG A;  2JZY A;  2WV0 A;  2ISY A;  3JW4 A;  4UVB A;  1W7P D;  3IL2 A;  4LD5 A;  4ZYE A;  3GW2 A;  3F6O A;  2FML A;  2F5C A;  4LLN A;  3FXU A;  4YG2 F;  1SD4 A;  3KLO A;  1MZB A;  3L2C A;  4M73 A;  1QGP A;  2IVM A;  1HSJ A;  1P6R A;  3V7C A;  3ZQ7 A;  1UFM A;  3HIF A;  2C6Y A;  2FBK A;  4XLN F;  2FA5 A;  3OOP A;  3JSP A;  3M8F A;  2FNP A;  5JI6 A;  2CO5 A;  1WKM A;  3I53 A;  5H20 A;  2P7C B;  4WF2 A;  3TO9 A;  3WTT C;  2DW4 A;  2DFI A;  5FGM A;  3WE3 A;  2L3D A;  2Y0M A;  4D0P A;  3FWE A;  2DT5 A;  4M9Z A;  5ERI A;  1HST A;  5DEQ A;  2Z9O A;  4M6Y A;  2CW0 F;  5IT9 K;  1YW9 A;  2WTE A;  3B02 A;  1L3L A;  1IN4 A;  3HHH A;  3ZMU A;  2PLY A;  3H92 A;  2OU2 A;  3IWF A;  2XV4 S;  4HOB A;  4M9S A;  5LRS A;  2GXB A;  2DBB A;  2JSC A;  4MEX F;  1G4D A;  2ADU A;  3ZN0 A;  1PP8 F;  3PFI A;  3BZ6 A;  4OIR F;  1L0O C;  3E5U A;  2X0L A;  1S8N A;  4KIB A;  4CXF A;  3T0Y A;  4CHU A;  1YLF A;  1ZGA A;  3HRT A;  2FRH A;  2D45 A;  3F8F A;  5D5V B;  5DV5 A;  1EH7 A;  1WI9 A;  1XCB A;  5LGN A;  1FP1 D;  1YO5 C;  1FY7 A;  3AAF A;  1ZAR A;  2KIU A;  2PI0 A;  4Q48 A;  2V1U A;  4I0A A;  2EFP A;  2QBY A;  2LKP A;  5F1R A;  4U0V A;  1E2X A;  1ZRF A;  5CVV A;  1ULY A;  2P6S A;  1FT9 A;  3HSF A;  3DP7 A;  3IKT A;  2PEX A;  4K2E A;  3GX4 X;  1B9N A;  2YSR A;  2CSO A;  3ERE D;  2VBY A;  3HTU A;  4OU0 A;  1XB4 A;  2UZK A;  4AIH A;  1W7P B;  3E6B A;  4ZYG A;  3FX3 A;  1H9T A;  2OZ6 A;  3KZY A;  1TQI A;  1SD7 A;  5DCM A;  4EGY A;  5BMZ A;  3KCC A;  1FNN A;  5E1Z B;  3KET A;  2F5D A;  1GXP A;  2GAU A;  3KE2 A;  2CWE A;  4RAY A;  2M1B A;  3FM5 A;  5LHG A;  4HQE A;  3FMQ A;  2Z99 A;  4DNC A;  1LEA A;  4HYE A;  3WU0 A;  3F3X A;  4L9V A;  2QQ9 A;  1J9I A;  3V8J A;  3BJ6 A;  4RB0 A;  1YYV A;  4ENN A;  4N9I A;  5DD8 A;  3RTR A;  3SZT A;  3FXQ A;  2L4M A;  4CO8 A;  1S3J A;  2VON A;  3H3Z A;  2M30 A;  3HRM A;  4YFK F;  3WTS C;  1BC8 C;  1BIB A;  1FBS A;  5LRR A;  3KP4 A;  2YX7 A;  3RPQ A;  3ZMS A;  2V1X A;  2KKO A;  2H6B A;  1MD0 A;  2OZU A;  4RS8 A;  4I0B A;  3WTY C;  4I09 A;  1S7A A;  1USS A;  1TBX A;  4CIC A;  4Z2Y A;  3F8N A;  3RKW A;  3FHZ A;  3WG9 A;  5FLX Z;  1D8K A;  1R1T A;  3U2R A;  4ZH4 F;  3R6S A;  5CJ9 A;  4Q5S F;  3HTS B;  2ZNY A;  3P9K A;  3EQL F;  1S29 A;  2QWW A;  2BEO A;  5J8C A;  1U8R A;  4LG0 B;  4A0Z A;  2A61 A;  3LFK A;  3WGH A;  5DDG A;  2J5O A;  1YS6 A;  1VTN C;  1I5Z A;  1YIO A;  3LWF A;  5FFZ A;  2STT A;  1ZYR F;  1BI3 A;  1BIA A;  2DU9 A;  2HQR A;  2ZKZ A;  3DPT A;  3GFI A;  1T38 A;  5HLI A;  2FOK A;  1SFX A;  1V3F A;  2A3S A;  1SFU A;  3ABT A;  2A68 F;  1KQ0 A;  2NYX A;  1K7A A;  4EJV A;  1ONV A;  1TNS A;  4ZZL A;  3EUH A;  3MZH A;  4KN7 X;  3EYI A;  1NHA A;  3I5U A;  2JTV A;  3ABU A;  2FNA A;  3JTH A;  4R8H A;  3C7J A;  1ZLJ A;  4IRH A;  4BYY A;  2UXN A;  2W24 A;  4L0Y B;  1XN7 A;  2VBX A;  2QM3 A;  3M8E A;  1LQ1 A;  1BOA A;  2HS5 A;  2XIG A;  3WTW C;  3M9A A;  4HLY A;  3WGG A;  1IW7 F;  3MQ0 A;  4EJU A;  3TO7 A;  1XGO A;  4L9N A;  3E5Q A;  3F23 A;  3BDD A;  5L3F A;  1BN5 A;  3O3K A;  1F9N A;  3R4K A;  1KGS A;  2FBH A;  3O2P E;  1YS7 A;  4ZZD A;  2XGX A;  1HKT A;  2DK8 A;  1O3T A;  4BXU A;  5A2Q K;  2IRF G;  1SMY F;  3CUQ B;  1O3R A;  1UCR A;  3C18 A;  1FC3 A;  2ELH A;  2NS0 A;  1LDJ A;  1ZG3 A;  1OYW A;  4I7H A;  3MEX A;  1U5T A;  2R7F A;  3P7N A;  2BBY A;  3MZY A;  4PDK A;  4HA8 A;  1BC7 C;  2XRN A;  2P5K A;  1C0W A;  1RI7 A;  5HDN A;  4OIN F;  5HS7 A;  1PP7 U;  2MC3 A;  1T6S A;  3ECH A;  2R7D A;  1FPQ A;  1R7J A;  3BWG A;  1BM9 A;  1EH6 A;  1FLI A;  3SHF A;  3WU1 B;  4G94 A;  4R1H A;  4MTE A;  1D3Y A;  1DP7 P;  4LB5 A;  2NNN A;  4RGX A;  1ZG5 A;  1XMA A;  1J59 A;  3K1M A;  4KIG A;  1QO0 D;  3ZPL A;  1W4M A;  3QPH A;  4ESB A;  2RVC A;  3DV8 A;  4HBL A;  3WE2 A;  2HGC A;  2ZJ2 A;  5FFX A;  3BY6 A;  2PMU A;  4N0B A;  1HBX G;  3QP6 A;  3E97 A;  4U0Y A;  2V9V A;  2FE3 A;  1LB2 A;  3FMS A;  2DQL A;  4HX4 A;  2H09 A;  4EGZ A;  4AIJ A;  1I27 A;  1SAX A;  1ZG1 A;  1SMT A;  4DQ2 A;  3F8B A;  4WWC A;  3IWZ A;  5D4R A;  2HWV A;  5E1W A;  3KFW X;  5DYM A;  1JHF A;  1ZRE A;  2Z33 A;  1DPU A;  1TTY A;  3L09 A;  2H94 A;  1U5T C;  1IRF A;  3BPX A;  5D4S A;  1HW2 A;  3V8K A;  1TQP A;  5DD4 A;  4L9J A;  3NEU A;  1YW8 A;  4IVN A;  1TW2 A;  4MNU A;  1AOY A;  3G3Z A;  1ZAO A;  1G3S A;  2D1H A;  3HOT A;  2L02 A;  4OIO F;  4AWX B;  4NHJ A;  2OA4 A;  2KRF A;  3KP5 A;  3KZZ A;  2G7U A;  2HR3 A;  5H6Q A;  4H0E A;  3CO7 C;  3KP3 A;  4S05 A;  1D8J A;  1U2W A;  5LGT A;  1O57 A;  1IF1 A;  1LEB A;  2LF7 A;  2E1N A;  3F8M A;  3F22 A;  2F5F A;  4Y13 A;  1FSE A;  1HKS A;  2P6T A;  4M9X A;  3TGN A;  2P5L C;  4ESJ A;  2BGC A;  2Z3Y A;  4CGZ A;  3J80 Z;  4HX8 A;  4GO1 A;  5D8L B;  4Q4Z F;  2HOE A;  4AD9 A;  3WTU C;  5CVR A;  1B6A A;  3F6V A;  3COA C;  3DPL C;  3HUG A;  4HAM A;  3TQN A;  2O6G E;  3ZN1 A;  1BI0 A;  1U6G A;  1QBJ A;  1FX7 A;  5ICE A;  3JTG A;  1UST A;  4M6X A;  1FWZ A;  5ICG A;  3FZV A;  4OMY A;  4ENK A;  5FD6 A;  5HDG A;  1S7O A;  1RUN A;  4L0Z B;  3KLN A;  3NQO A;  4GCV A;  2PBI A;  1MKM A;  3KEO A;  2FXA A;  2YX4 A;  1Q1H A;  2FBI A;  1Z6R A;  1ON1 A;  5BPD A;  1CF7 B;  4M71 A;  1O3S A;  4IF4 A;  2PN6 A;  1KU2 A;  4BHB A;  3F21 A;  3N4M A;  5BOX A;  4GGG A;  3KP6 A;  2E1C A;  1RIO H;  4KA4 A;  2PFB A;  1Y0U A;  1DDN A;  4UUV A;  5IT9 Z;  2RC4 A;  3EYY A;  2ETH A;  1OYI A;  1R36 A;  2B0L A;  3LAJ A;  2HYG D;  2XKO A;  4EVI A;  2EV6 A;  4HX7 A;  3VEP A;  1OYY A;  4JK1 X;  4KT5 C;  1W5S A;  3QRF F;  5D5W B;  2HYF A;  3KP7 A;  1IN8 A;  2HTS A;  3K1N A;  3E6C C;  1MJB A;  5EEG A;  4MEY F;  1W7P A;  4ZYD A;  5HDK A;  3FF5 A;  4UVC A;  4OOI A;  4LJZ F;  4ASN A;  1MJ9 A;  2VOD A;  4IRG A;  2QVO A;  2IP2 A;  3E6D A;  4XSX F;  2QYO A;  5D8K B;  1G3T A;  4QLC U;  1DUX C;  1TQM A;  3S2W A;  1P4A A;  3T8R A;  1Z91 A;  3ELK A;  4LFU A;  4KDP A;  4HF0 A;  3V7S A;  1R1V A;  2R3S A;  5ICF A;  4B09 A;  3U9G A;  1RUO A;  4LGW A;  5CVU A;  2L01 A;  1B9M A;  3T5X A;  1S6L A;  5FB2 A;  1JXS A;  3J81 K;  3N97 A;  5D5U B;  4WK8 F;  1P92 A;  2RN7 A;  1XD7 A;  3WTZ A;  1MDM B;  1R5G A;  2OAZ A;  3HSE A;  3QAH A;  6PAX A;  2LNB A;  2QZ8 A;  4HV6 A;  3WGI A;  4HQM A;  3RIR A;  1DPR A;  2PJP A;  5L3C A;  1JHH A;  1CGP A;  2CG4 A;  4WXD A;  2VN2 A;  4UVA A;  1YFH A;  2O3F A;  4YIF A;  3K2Z A;  1P4W A;  3GO5 A;  3ZMT A;  1G6N A;  4RGU A;  5TJJ A;  3V4G A;  4PCQ A;  1GHC A;  2QEN A;  2KJC A;  2LSO A;  1HW1 A;  4A6D A;  1IN5 A;  1BJA A;  2ZXJ A;  4UHT A;  4LG0 A;  1HKQ A;  5LBQ A;  4G8X A;  3GFL A;  2XAS A;  3CTA A;  3CJN A;  4LMY A;  4LLL A;  1ZHF A;  4EMS A;  3I59 B;  3K0L A;  3TOA A;  2KIF A;  5HS8 A;  4A5M A;  1RZ4 A;  4G7O F;  4XLP F;  3I58 A;  1IAW A;  2K7L A;  2MLK A;  5J8F A;  3ZP5 A;  3RI4 A;  4EV0 A;  1H9G A;  2BV6 A;  4WXC A;  3GEZ A;  3PQJ A;  2P5V A;  2COM A;  3GFJ A;  3HSR A;  4LK0 F;  4RB2 C;  4FHT A;  3ISP A;  4EJW A;  2A69 F;  1J0R A;  2YU3 A;  2EA2 A;  4NQW A;  2W25 A;  2QQB A;  1OMI A;  1ZH5 A;  3REO A;  5AIQ A;  1BI1 A;  2VE9 A;  2IPQ X;  2Y75 A;  3TDZ C;  1KU3 A;  4F7Z A;  2L4A A;  1XSD A;  1R58 A;  2HTJ A;  3CO6 C;  2A07 F;  2STW A;  1MGT A;  3VOE A;  3JAM K;  5FO5 A;  2NNY A;  2CGP A;  2NAZ A;  4KMF A;  2AS5 F;  3GFM A;  2DPU A;  4HW0 A;  1TNT A;  1B4A A;  4BHC A;  4U7B A;  1BBY A;  2K4B A;  2D2W A;  1GVJ A;  2GA1 A;  4KUM A;  3QP5 A;  1I6X A;  1XGN A;  1T39 A;  3JAM Z;  3CUQ A;  3R0A A;  4JBA A;  5E8G A;  5IT3 A;  5K5R A;  3DKW A;  2F5E A;  2ACJ A;  4L5J A;  2RGV A;  3RYR A;  3I54 A;  2IJL A;  3SQN A;  1B59 A;  3W6K B;  1XDS A;  1F1Z A;  3R0J A;  4HF2 A;  3GWZ A;  1OKR A;  2HKX A;  3MCZ A;  4JQF A;  3GYH X;  5F64 A;  2FF4 A;  1I1S A;  3LA7 A;  1R5H A;  3BPV A;  2H27 A;  4KIF A;  2AXL A;  1EV7 A;  4O6J A;  5JVT A;  5ILU A;  1YG2 A;  5H6R A;  2YR2 A;  4ON0 A;  2XHK A;  4I98 B;  2RQP A;  5A2Q Z;  3HRU A;  1QQI A;  3GUD A;  3QOP A;  3BP8 A;  2VC1 A;  4A0X A;  2HZT A;  3ZMZ A;  3LA3 A;  4P5O A;  3G73 A;  4MTD A;  3IHU A;  2ZO4 A;  5J6X A;  5ED4 A;  3Q5F A;  2EA4 A;  3P9I A;  3I64 A;  3J7A O;  2IA2 A;  3R61 A;  2LDU A;  1D5V A;  2EV0 A;  4HZF A;  2VBZ A;  1FOK A;  3I0T A;  2K02 A;  3HHG A;  5BQT A;  3GLX A;  3IC7 A;  1GXQ A;  1W5T A;  2XAG A;  3CUQ C;  1JGS A;  4IJA A;  1LVA A;  4WX9 A;  4MQ9 F;  2GWR A;  1K6O A;  4BH9 A;  2HFH A;  2MBF A;  3L7W A;  3TDU C;  1R1U A;  5ILS A;  2PQ8 A;  2DK5 A;  3GZ6 A;  1YW7 A;  3CLO A;  5ILV A;  2FQ3 A;  4FX4 A;  2UWM A;  1O7F A;  1F5T A;  3RJP A;  2Y48 A;  2ZNZ A;  2V6C A;  1ZRD A;  1ODD A;  3V8L A;  3RKY A;  5K5O A;  5LEJ A;  3DXJ F;  3T1B A;  3FXR A;  5LEK A;  2HKO A;  2EWN A;  1STZ A;  2Q0O A;  4HDU A;  1A04 A;  2E7W A;  2MA3 A;  2OQR A;  3ZMV A;  1T0F A;  2DI3 A;  4YII A;  2J5P A;  4G7H F;  4LK1 F;  1KQ9 A;  2RV8 A;  1T98 A;  4QWQ A;  1K78 B;  2WC2 A;  4YFN F;  2P8T A;  1R22 A;  3O6B B;  4EM0 B;  1X3U A;  2MH2 A;  5EEH A;  5BS6 A;  4UNO A;  4ETS A;  1I1G A;  3VOD A;  2ESH A;  3GZ5 A;  3D5L A;  4O5V A;  3W6J B;  1Z7U A;  4P9U A;  1WSU A;  4IHS A;  2W85 A;  4E70 A;  1QNT A;  2HEO A;  1LDK B;  3DF8 A;  2ZME B;  1B1B A;  5K5Q A;  4KNY A;  4RGS A;  3SXY A;  4MGR A;  5D5X B;  1CF7 A;  4WCG A;  4YFX F;  5AIP A;  2H6C A;  3CUO A;  1LDD A;  4M72 A;  3WOD F;  4ZYH A;  5BPI A;  2VOO A;  4CYD A;  1P4X A;  4OIQ F;  2DPD A;  2IA1 A;  3QU3 A;  3C3W A;  2CFX A;  5TRD A;  3L00 A;  4L5I A;  5F6F A;  5DUI A;  1YQA A;  2FSW A;  3ECO A;  4AVP A;  2RNJ A;  3GVA A;  2Q2E A;  5E17 F;  1KYZ A;  1FZP B;  4GYI A;  2NRA C;  3BJO A;  1J2X A;  4I2O A;  2VOP A;  4MQV A;  5L3B A;  3R60 A;  4A5N A;  2MD5 A;  1JE8 A;  5CVJ A;  3FM3 A;  4A0Y A;  3WTX C;  4I02 A;  1WRJ A;  1IUY A;  1J7K A;  4OMZ A;  4BHP A;  1P2F A;  2M8E A;  2Z5U A;  3K69 A;  3OV8 A;  2VBW A;  4GXO A;  1Z1D A;  4WXH A;  1FBQ A;  3QU6 A;  1XGM A;  4XRF A;  4I01 A;  2A5Y B;  2G7H A;  1IN6 A;  5LGU A;  1IXS B;  4EM1 A;  2DAO A;  1E17 A;  2MLG A;  4Y15 A;  3H3U A;  2FU4 A;  1REP C;  4XSZ F;  1J5Y A;  4G6Q A;  3LA2 A;  5E1X A;  2G9W A;  4CZZ A;  3LAP A;  1ZRC A;  4U0W A;  1FYL A;  4LB6 B;  3RKX A;  3GXO A;  4NB5 A;  5L3G A;  2P4W A;  1MDM A;  2XUB A;  4IRI A;  1HW5 A;  3ZMD A;  4KIC A;  4A2U A;  4R79 A;  2F2E A;  2O03 A;  2KJB A;  4HDV A;  2QBY B;  2JT1 A;  1TLH B;  4LLG F;  1F4K A;  4L9T A;  4N9H A;  1ON2 A;  1KYW A;  3FMR A;  4RB3 C;  2OQG A;  2BE5 F;  5JR3 A;  1H0M A;  2WWY A;  3RDI A;  4EM2 A;  4HV5 A;  1U3E M;  2DLL A;  5AON A;  5K1Y A;  2GIV A;  4IPA A;  2KIM A;  4M74 A;  5DCM B;  1FP2 A;  2OBP A;  4BQA A;  5DUK A;  3J81 Z;  3SZP A;  2XKP A;  3I4P A;  2EFW A;  2DTR A;  2RDP A;  4KYW A;  2EV5 A;  3I59 A;  5KVR A;  4BAY A;  4KMU X;  2YPR A;  2K27 A;  4EJO A;  3TOB A;  3BJA A;  1KU9 A;  5D6F A;  1YTY A;  5E18 F;  1J75 A;  2RKH A;  5FLX K;  4P96 A;  2Q8K A;  3F8C A;  4Y17 A;  3HOS A;  2E7X A;  4XBF A;  2ZBK A;  4UV8 A;  5D6E A;  1HXD A;  1WWX A;  1QPM A;  4G6D A;  2IW5 A;  5HLH A;  2EJR A;  4BNC A;  3LQQ A;  2EFQ A;  2MH9 A;  2GXG A;  1XSX A;  4AIK A;  1IXR C;  2FMY A;  4CDG A;  1XMK A;  3Q9V A;  3D0S A;  2A6E F;  2CQK A;  1ZN2 A;  2JPC A;  3DFG A;  2PMH A;  5FD5 A;  1SD5 A;  1FBU A;  2M87 A;  3JSO A;  2ESN A;  1HQC A;  5CVI A;  2PG4 A;  4G7Z F;  1QZZ A;  2K86 A;  2ZCW A;  1G3W A;  1UHM A;  3P9C A;  4B8X A;  1O3Q A;  1IN7 A;  1BI2 A;  1WQ2 A;  3E5X A;  2QQA A;  4Q47 A;  1MJA A;  5E8I A;  1LJ9 A;  3NRV A;  3WTV C;  5HOO A;  2TDX A;  5DCF A;  4A12 A;  1KA8 A;  4S04 A;  1K79 A;  3ROU A;  2QLZ A;  3M7G A;  2VT3 A;  2VXZ A;  4EJT A;  3KP2 A;  1UB9 A;  1XSV A;  2V1D A;  2IA0 A;  1Z6T A;  3LST A;  2XVC A;  4PZJ A;  2M5W A;  3E3V A;  2X4H A;  4IHT A;  3VB2 A;  3BOQ A;  3VFZ A;  4HLX A;  2GA2 A;  3C1D A;  4EQQ A;  3ULQ B;  3HYI A;  3M1E A;  3K9T A;  2GZW A;  3ML6 A;  1V4R A;  1R23 A;  5E20 A;  3EDP A;  3CDH A;  1ZGJ A;  2FEZ A; 
#chains in the Genus database with same CATH topology
 2XRO A;  3CCV I;  4BQQ A;  4E7Z A;  3CCL I;  3RPU A;  2B63 J;  4FAS D;  3P5J A;  2VB6 A;  3NWS A;  1ETX A;  2EB7 A;  3FXO A;  2HXO A;  4P55 A;  2XAQ A;  4UXN A;  2HDC A;  1FOW A;  2VE8 A;  2WBM A;  2M45 A;  2XAJ A;  4V2F A;  3LSP A;  1FSH A;  5EEA A;  4TV7 A;  3SJM A;  4NDL A;  2HQN A;  2QQ8 A;  1PYV A;  1KQ8 A;  1EJ9 A;  1XGS A;  3E6M A;  3F72 A;  4ENM A;  1ACI A;  4HF1 A;  3DBH B;  2VLA A;  4BBS J;  3GTQ J;  4JX4 A;  2LRD A;  2XAH A;  1IZ1 A;  4XKB A;  2EK5 A;  5M5Y J;  2F4M B;  3MKZ A;  3BRO A;  4ITV A;  1LE8 A;  1AKH B;  2VT2 A;  3DEU A;  1VQL I;  4BY1 J;  4MFD A;  5B1B H;  5L3E A;  2GQQ A;  1SC7 A;  3MAJ A;  1IGN A;  2X1D A;  1S72 I;  4I76 A;  4FT8 A;  3W3C A;  5L3D A;  2B9S A;  1TW3 A;  1U5T B;  3B73 A;  5HLG A;  3U21 A;  3EET A;  4CSW A;  2OD5 A;  5FLV A;  1QU3 A;  3HRS A;  3LSJ A;  3SFZ A;  2W84 A;  5KK1 A;  3D1N I;  1TT5 B;  1FYM A;  2DO7 A;  4IXA A;  4I99 C;  5ICC A;  4U7D A;  3VYT B;  2JRT A;  1MBG A;  3ERM A;  2DQR A;  4PSX A;  1YX3 A;  1U8B A;  3FBI B;  5HS9 A;  1E3O C;  2ISZ A;  2R7Q A;  1Z9C A;  1HOM A;  2P7V B;  2W57 A;  5TGT A;  1HCR A;  5JFR A;  3DQV C;  5LHI A;  2QF7 A;  3RYP A;  2LF8 A;  3PQK A;  1EH8 A;  2JA2 A;  3TKY A;  2FOW A;  2O61 A;  1T08 B;  2R92 J;  1GT0 C;  1U78 A;  4XRM A;  2KLO A;  3LQR A;  3QPT A;  4RAZ A;  2A5W A;  1O7L A;  2XAF A;  4B1R A;  3DTK A;  4XKC A;  1T2K A;  4QPQ A;  1OCO H;  1ZLK A;  4L18 B;  2EFO A;  3CJR B;  1XCV A;  1KU7 A;  1Z05 A;  1H8A C;  1K4T A;  4DYC A;  3M3Y J;  5LLQ A;  1E3H A;  4KFC A;  2V79 A;  4C2T A;  4A6E A;  3DWL E;  5CLS A;  2CFO A;  3OR2 C;  1NK3 P;  2QSG X;  4IKF A;  4RMN A;  5FKM A;  4QIW N;  1IRG A;  5IYB J;  4G12 A;  3K10 A;  1PUE E;  5CPR B;  2UXX A;  1T95 A;  3DBR B;  1SD6 A;  2X85 A;  3BZK A;  2A6H F;  3K4C A;  4RAF A;  4X6A J;  3IH3 A;  1OPC A;  1UEL B;  2GOM A;  4XRS G;  2D1V A;  5IOZ A;  4G9Y A;  4RB1 A;  5EGO B;  2DA3 A;  1LNW A;  4BXF A;  3CCJ I;  2MW8 A;  4D9J A;  1R00 A;  3NAR A;  3RSN A;  2E60 A;  1VQO I;  2EZH A;  4P9F A;  2M4K A;  4A3F J;  1IXC A;  3AL0 C;  4OIP F;  1SFE A;  5CYV A;  1D0Z A;  1UHW A;  3B6C A;  4A3D J;  3Q9S A;  1RNL A;  2CYY A;  5FKO A;  3U1D A;  1QZY A;  1HLV A;  1A36 A;  2WAF A;  3OIQ A;  3QPS A;  3IRQ A;  4EAT A;  3A01 A;  1ZQ3 P;  1Z7L A;  1G3Y A;  1UZC A;  4UV9 A;  1PDN C;  2R7X A;  2QUF A;  4LOC A;  3ABM H;  1Z67 A;  3DU6 A;  2O0Y A;  3A02 A;  3MWM A;  2ZXH A;  1K78 A;  2VL8 A;  3IRR A;  5LHH A;  1Q1V A;  3GF2 A;  5JHU A;  4FX0 A;  3MFK A;  3I71 A;  2EFN A;  5LFA A;  3T8T A;  1FYK A;  2O9L A;  4A3M J;  4MHG A;  4GYG A;  3L9F A;  1VZ0 A;  3A4C A;  4IO9 F;  2ZFW A;  4ENJ A;  4ESF A;  3IKV A;  3TO6 A;  3BCB A;  5FRM A;  3H9J A;  2QKM B;  3OYJ A;  2NVQ J;  2XB5 A;  4O3M A;  4U88 A;  3OSG A;  1XDU A;  4KN4 X;  2E2J J;  2JPB A;  3ZQF A;  4XM3 A;  3A01 B;  3G2B A;  1YOV B;  2O8X A;  4PGH A;  1OR7 A;  1B72 B;  4XK4 A;  1AWC A;  5F27 A;  4N4O B;  2VC0 A;  2L54 A;  2BYV E;  2K4J A;  2IT0 A;  3V7R A;  2L9V A;  3KEQ A;  1FOY A;  4D7M A;  5HVQ C;  2ZME A;  3K1P A;  3J80 K;  4RGR A;  4PGG A;  2JZY A;  2WV0 A;  2R7S A;  1QRY A;  2E2I J;  2ISY A;  3JW4 A;  2LH9 A;  2W4S A;  4UVB A;  3S2H J;  3S2D J;  1W7P D;  3HGG A;  2PJR A;  3IL2 A;  1KON A;  2K9L A;  4LD5 A;  4ZYE A;  3GW2 A;  2HVS A;  1U9N A;  3F6O A;  2FML A;  2F5C A;  4LLN A;  3FXU A;  1N75 A;  4GFB A;  4HG2 A;  4YG2 F;  1SD4 A;  3KLO A;  1MZB A;  2Z16 A;  2AQE A;  2DMN A;  5EF6 A;  1Z3Y A;  2EZK A;  3H9Q A;  3L2C A;  4M73 A;  1QGP A;  2IVM A;  1HSJ A;  1P6R A;  3V7C A;  3OL4 A;  3ZQ7 A;  5J1R A;  1UFM A;  4UB6 C;  3ZRG A;  3HIF A;  2VPL A;  2Y31 A;  2C6Y A;  2FBK A;  4XLN F;  2FA5 A;  1N77 A;  3OOP A;  2DA7 A;  1WJA A;  3JSP A;  3M8F A;  2FNP A;  3V42 A;  1FIA A;  3HZJ A;  5JI6 A;  3OYN A;  3RKQ A;  2CO5 A;  1WKM A;  3I53 A;  5H20 A;  2P7C B;  4WF2 A;  3TO9 A;  2RNG A;  3WTT C;  2TCT A;  5JLX A;  3HG9 A;  3CC4 I;  2DW4 A;  2E1M C;  3J7Z I;  2DFI A;  5FGM A;  4ZC3 A;  3WE3 A;  2L3D A;  2H1K A;  1QHH D;  2L2O A;  2Y0M A;  3Q3S A;  2CUF A;  4D0P A;  2W48 A;  4XIC A;  3FWE A;  2DA2 A;  2DT5 A;  2DMU A;  4M9Z A;  2MC4 A;  5ERI A;  2JA8 J;  1HST A;  2LBF B;  5DEQ A;  5M3F J;  4BY7 J;  4A3I J;  3C2H A;  2VJ4 A;  2CQX A;  2Z9O A;  3HUG B;  2F4I A;  2LMD A;  4M6Y A;  2CW0 F;  2DA4 A;  1YRN B;  5IT9 K;  1YW9 A;  2WTE A;  4CYC A;  3B02 A;  5HLT A;  2O8K A;  5EZG A;  3BTC A;  1L3L A;  2DFH A;  1IN4 A;  2LP0 A;  2R7Z J;  4JX5 A;  3DEE A;  3HHH A;  2XPU A;  3GCM A;  1I50 J;  3ZMU A;  2PLY A;  3H92 A;  3DCF A;  2OU2 A;  3IWF A;  2QEX I;  1Y39 A;  5EYR A;  2BXZ A;  2XV4 S;  1A6Q A;  2EIM H;  4HOB A;  4M9S A;  2BW3 B;  5LRS A;  2GXB A;  1OR7 C;  2DBB A;  2JSC A;  1W1W E;  4MEX F;  1G4D A;  3FXK A;  4CYC B;  2ADU A;  2ZME C;  3ZN0 A;  5JLW A;  3OYE A;  3ABL H;  1BJZ A;  1PP8 F;  3PFI A;  3BZ6 A;  4OIR F;  4PK4 A;  2XGD A;  1L0O C;  3E5U A;  2X0L A;  1A5J A;  2XF5 A;  1LKX A;  1S8N A;  4KIB A;  2ZJR F;  2O5R A;  4CXF A;  5FKN A;  4DZJ A;  3T0Y A;  4CHU A;  2Y9Y A;  5EDN A;  3PNT A;  5B1A H;  3S3O A;  1YLF A;  1ZGA A;  2LTP A;  3HRT A;  3UR3 C;  2FRH A;  2D45 A;  3BQZ A;  3F8F A;  2R5Z A;  5D5V B;  1G2H A;  5DV5 A;  1A31 A;  1EH7 A;  2JSP A;  1WI9 A;  2Y9Z A;  1X2N A;  1XCB A;  2K9M A;  3CF2 A;  5EZH A;  4BE1 A;  3FBN B;  4RAG A;  2VKE A;  3WG7 H;  1OCT C;  3WHB A;  5LGN A;  1FP1 D;  1YO5 C;  1E0E A;  4XOT A;  1FY7 A;  1ZAR A;  2KIU A;  3HJE A;  3AAF A;  2PI0 A;  3KIO A;  4Q48 A;  2V1U A;  4I0A A;  2EFP A;  2JJ7 A;  1VQ4 I;  2QBY A;  1YIJ I;  3QQA A;  2OJE D;  2LKP A;  5F1R A;  4CH7 A;  4LIT A;  1BR1 A;  2XF7 A;  4U0V A;  1E2X A;  1ZRF A;  5CVV A;  2DDB A;  3QOD A;  1ULY A;  2P6S A;  2R5Z B;  1FT9 A;  3HSF A;  4XN0 A;  1VND A;  3L1P A;  2E1O A;  3DP7 A;  3IKT A;  2PEX A;  4RLF A;  3CCU I;  4C9Y A;  2F48 A;  4K2E A;  3GX4 X;  4C30 A;  3K4N A;  1B9N A;  1V55 H;  2YSR A;  2CSO A;  3DBL B;  2K40 A;  2LOO A;  1JGG A;  3GTG J;  3PUF A;  2LC2 A;  3ERE D;  2VBY A;  3HTU A;  3TED A;  3OYH A;  1JKP C;  1Z3X A;  3HPG A;  2UUZ A;  2JK3 A;  4OU0 A;  3PO3 J;  1XB4 A;  4F91 B;  2UZK A;  4AIH A;  1W7P B;  4PFO A;  3E6B A;  5C44 J;  1S9H A;  3L2Q A;  4ZYG A;  3FX3 A;  3CCM I;  1H9T A;  2OZ6 A;  3KZY A;  1RR7 A;  1TQI A;  1SD7 A;  5DCM A;  3QYB A;  2E36 A;  4AM3 A;  4EGY A;  5BNG A;  4F92 B;  5BMZ A;  2BOL A;  2MSY A;  3KCC A;  1FNN A;  2QA4 I;  5E1Z B;  3OR1 C;  4XR6 A;  3KET A;  2QKL B;  2F5D A;  1ETW A;  2GAU A;  3KE2 A;  1GXP A;  3ZQL A;  2CWE A;  4RAY A;  3LFU A;  4YIR X;  1XTA A;  2M1B A;  3FM5 A;  3BG7 A;  5LHG A;  5GAE J;  4HQE A;  2BVL A;  2Z99 A;  3FMQ A;  4DNC A;  1LEA A;  4HYE A;  3WU0 A;  2JUG A;  2F5V A;  2JRM A;  3F3X A;  2EZI A;  1VQ8 I;  2JVH A;  4BJ6 C;  4L9V A;  4LG3 A;  3PIP F;  1IJW C;  3OYI A;  2R7R A;  1ZTR A;  2QQ9 A;  3U1K A;  1MH3 A;  1J9I A;  2X1C A;  2V6E A;  3V8J A;  5B5E C;  2K3P A;  1ORK A;  2WAE A;  3BJ6 A;  4RB0 A;  1DQU A;  4M3B A;  1YYV A;  4ENN A;  1Y8Q B;  2V4J C;  1ZEL A;  4N9I A;  3H3V K;  4GRI A;  4HNT A;  2KMU A;  4ZDL A;  1X4P A;  5DD8 A;  1WJ5 A;  2CRG A;  3RTR A;  4FET A;  3SZT A;  1MW7 A;  3FXQ A;  2L4M A;  4CO8 A;  1S3J A;  1WJB A;  2VON A;  2DXI A;  1ETK A;  5IYC J;  3H3Z A;  2M30 A;  2VKH A;  3HRM A;  3TMO A;  4YFK F;  3WTS C;  3S1R J;  1BC8 C;  1BIB A;  1FBS A;  5LRR A;  3KP4 A;  2CMP A;  3DTI A;  2YX7 A;  5IY5 H;  2VXD A;  2COB A;  3RPQ A;  2CS3 A;  3ZMS A;  2V1X A;  2CW7 A;  2KKO A;  2BY1 A;  2H6B A;  4Y3O A;  1MD0 A;  2OZU A;  4RS8 A;  4E4H A;  4I0B A;  3WTY C;  4BE0 A;  1OCC H;  4I09 A;  3PJR A;  4FIS A;  1S7A A;  1USS A;  2X51 A;  1TBX A;  4CIC A;  4Z2Y A;  3F8N A;  3RKW A;  3PSF A;  3FHZ A;  3DU5 A;  5E3L A;  3WG9 A;  3MMY B;  1YIT I;  3PO2 J;  5FLX Z;  1B8I B;  1D8K A;  3HKZ A;  1R1T A;  4II2 A;  3OOU A;  2BY0 A;  3U2R A;  2V9K A;  4ZH4 F;  3RPU D;  3R6S A;  1MIJ A;  5CJ9 A;  4Q5S F;  5FKL A;  3HTS B;  4BEH A;  2ZNY A;  1FJL A;  3P9K A;  4XLA A;  2IGO A;  3EQL F;  1S29 A;  2CQ7 A;  3NAU A;  4N4N B;  3WHC A;  3BC8 A;  2QWW A;  2BEO A;  4OAY A;  1HA8 A;  5J8C A;  1U8R A;  2VAS A;  1HDP A;  2CV2 A;  4LG0 B;  4A0Z A;  1MBH A;  2A61 A;  3LFK A;  3PSI A;  2R7V A;  1FOX A;  3M4O J;  2YUS A;  3S93 A;  3WGH A;  5DDG A;  2J5O A;  1YS6 A;  1VTN C;  2R4G A;  3HOW J;  5CQE A;  4M3E A;  2QGU A;  1VQ5 I;  3A2K A;  1I5Z A;  1I39 A;  1YIO A;  3F9K A;  3KEY A;  2OUM A;  3LWF A;  2K5C A;  3UKG A;  5FFZ A;  2ZXI A;  3J7A Y;  3I3L A;  2STT A;  1ZYR F;  2X1E A;  4IQ4 A;  1BI3 A;  1BIA A;  2DU9 A;  4D1Q A;  2K9S A;  3LSK A;  2HQR A;  2ZKZ A;  3DPT A;  3VWB A;  3GFI A;  1T38 A;  1V5F A;  1XMX A;  1D1C A;  3IAM 2;  1YI2 I;  5HLI A;  2KZG A;  2FOK A;  1SFX A;  1V3F A;  3RCO A;  1JKO C;  1ITY A;  1MMD A;  2A3S A;  4E7L A;  1SFU A;  3ABT A;  2IGN A;  1TWA J;  2A68 F;  2M2E A;  1EF4 A;  1KQ0 A;  2NYX A;  1K7A A;  4EJV A;  3RQI A;  1ONV A;  1TNS A;  4ZZL A;  4NQW B;  2EPF A;  3EUH A;  3MZH A;  1PJR A;  1WJD A;  4KN7 X;  3EYI A;  1VQ9 I;  1NHA A;  3A03 A;  3I5U A;  4D5C A;  4MIM A;  3CDL A;  3QOE A;  2YU9 J;  2JTV A;  3ABU A;  2M34 A;  1JKQ C;  4AUX A;  3OYA A;  4JP0 A;  1LFU P;  2FNA A;  3JTH A;  4R8H A;  3C7J A;  1ZLJ A;  5H2F C;  4IRH A;  4BYY A;  4CA0 A;  2UXN A;  4A69 C;  2W24 A;  4MFE A;  1WJC A;  2VJ5 A;  4CCO A;  4L0Y B;  2V26 A;  1XN7 A;  2AO9 A;  2VPR A;  2VBX A;  3C2G A;  3BCA A;  2QM3 A;  1RET A;  3M8E A;  3SDB A;  1LQ1 A;  1TWF J;  1BOA A;  2HS5 A;  4KIS A;  2XIG A;  4F93 B;  4B48 A;  3WTW C;  3M9A A;  4HLY A;  2BHY A;  3CCE I;  3WGG A;  1IW7 F;  4UY8 I;  2WAQ N;  3EUA A;  3MQ0 A;  3OIO A;  4EJU A;  3TO7 A;  1XGO A;  4L9N A;  4HNV A;  3E5Q A;  3CMY A;  1WJF A;  5C3E J;  3F23 A;  2M3A A;  5E3M A;  3BDD A;  4II3 A;  4CCK A;  1GV5 A;  5IP6 A;  5L3F A;  2G0E A;  1BN5 A;  3GTJ J;  1LUJ B;  3GTO J;  5J4Y A;  3O3K A;  1F9N A;  3R4K A;  2IGK A;  1KGS A;  2FBH A;  2M7B A;  3O2P E;  1YS7 A;  2L0K A;  4ZZD A;  1SEU A;  2XGX A;  1HKT A;  2DK8 A;  1O3T A;  1DGW Y;  4BXU A;  5A2Q K;  4AYB A;  2IRF G;  1SMY F;  2EBI A;  3CUQ B;  2XB0 X;  1O3R A;  1JT6 A;  1T8I A;  2ECB A;  1AKH A;  1UCR A;  3C18 A;  1BR4 A;  4ZDO A;  1FC3 A;  2ELH A;  3FDY A;  2NS0 A;  4GDF A;  3FKJ A;  1POG A;  4QSH A;  1LDJ A;  4CUG A;  1ZG3 A;  5EG0 A;  1OYW A;  2DOD A;  4I7H A;  3MEX A;  1U5T A;  2R7F A;  3P7N A;  2BBY A;  5IYD J;  2MFZ A;  3MZY A;  1WPK A;  2XRL A;  4J00 A;  1A6I A;  4PDK A;  5B3S H;  2I5U A;  4HA8 A;  2XRN A;  1BC7 C;  2P5K A;  2LLK A;  1C0W A;  1RI7 A;  4JOM A;  1OFC X;  2OPT A;  4OIN F;  5HDN A;  4B44 A;  4XLC A;  2JMW A;  5HS7 A;  1PP7 U;  4ABZ A;  1MND A;  2MC3 A;  1T6S A;  3ECH A;  2R7D A;  1FPQ A;  4A3E J;  1K61 A;  1R7J A;  3BWG A;  3KPH A;  5EG0 B;  1BM9 A;  1EH6 A;  3K70 C;  3CLQ A;  1FLI A;  5KAF C;  3SHF A;  3WU1 B;  2BY2 A;  4G94 A;  4R1H A;  4MTE A;  1D3Y A;  1NG7 A;  1V5G A;  2KIS A;  1DP7 P;  3MD2 A;  1I3A A;  4LB5 A;  2LY9 A;  1SAU A;  2ELJ A;  2NNN A;  2KFD A;  3SDG A;  4RGX A;  1RKT A;  1ZG5 A;  1XMA A;  4JX6 A;  3EUH C;  4W1U A;  2X48 A;  3ZXS A;  4DYR A;  1J59 A;  2BXY A;  3K1M A;  2IBD A;  1QO0 D;  4KIG A;  5IPA A;  3ZPL A;  2NVU B;  1W4M A;  2EH3 A;  2GBY A;  3QPH A;  4ESB A;  3ESW B;  4E7K A;  2RVC A;  3DV8 A;  4HBL A;  3WE2 A;  1GUU A;  2HGC A;  5IP7 J;  2ZJ2 A;  5FFX A;  4DJA A;  3OS0 A;  3BY6 A;  2PMU A;  4N0B A;  5EGO A;  5FRN A;  4NNJ A;  1HBX G;  1ERD A;  4XKV A;  4RDU A;  2HVR A;  1OJL A;  2K9Q A;  4ZYA A;  3HOX J;  4DW6 A;  3QP6 A;  4XNF A;  3E97 A;  2M4G A;  4U0Y A;  3H36 A;  4A3B J;  2CUE A;  2V9V A;  2FE3 A;  2Y2Z A;  1LB2 A;  3FMS A;  5KNL A;  2DQL A;  1X3W B;  4C2U A;  4F52 A;  3S32 A;  2LFB A;  4FE4 A;  4HX4 A;  2LKS A;  3TBI A;  2H09 A;  3MZ8 A;  4EGZ A;  3FXJ A;  1I27 A;  4AIJ A;  1SAX A;  1ZG1 A;  5CQG A;  1SMT A;  2DA6 A;  4DQ2 A;  2WB1 A;  2HI3 A;  1ETY A;  2DT6 A;  3BG9 A;  2DT7 B;  5GAG J;  4YEJ A;  3F8B A;  3JR9 A;  4WWC A;  1MMS A;  3IWZ A;  5D4R A;  1FEX A;  2HWV A;  2VI6 A;  2DOA A;  5E1W A;  3KFW X;  4C2M J;  4RA2 A;  5DYM A;  4A3J J;  1JHF A;  4D5F A;  3HOY J;  1ZRE A;  2Z33 A;  3X2Q H;  4P1W A;  1DPU A;  1TTY A;  3FK7 A;  3BTL A;  3L09 A;  2H94 A;  3IV5 A;  3ZR8 X;  1U5T C;  1B72 A;  1IRF A;  3BPX A;  2P0W A;  5D4S A;  1QZE A;  1HW2 A;  2BZT A;  2VIX A;  3HOV J;  3V8K A;  3Q0W A;  1TQP A;  2CQN A;  5DD4 A;  2H8R A;  4L9J A;  2ME0 A;  1PVE A;  3ONQ A;  3NEU A;  1YW8 A;  4IVN A;  1TW2 A;  4MNU A;  1AOY A;  1W0T A;  3G3Z A;  5J3L A;  5HNF A;  1HF0 A;  4A93 J;  1ZAO A;  2ELK A;  1G3S A;  2D1H A;  3BR0 A;  3HOT A;  2L02 A;  4EEF G;  4OIO F;  4AWX B;  3GTL J;  3S1Q J;  3HGY A;  2DTZ A;  4NHJ A;  2L7M P;  1D1A A;  3L2R A;  2L7Z A;  2OA4 A;  5F0F A;  2KRF A;  3KP5 A;  2F6C A;  3KZZ A;  1Y6I A;  1UAA A;  2G7U A;  2HR3 A;  5H6Q A;  4H0E A;  3CO7 C;  2ZC2 A;  3KP3 A;  4S05 A;  1NTC A;  1D8J A;  1U2W A;  1YE9 A;  5LGT A;  1O57 A;  1MBJ A;  2VQC A;  1IF1 A;  3CP8 A;  2LF7 A;  3CD6 I;  1LEB A;  4A3G J;  1U9O A;  2E1N A;  2EIL H;  3F8M A;  3QYF A;  3VDX A;  3OYF A;  3F22 A;  1G8X A;  2F5F A;  4Y13 A;  2FQ4 A;  4BBR J;  1FSE A;  2GLO A;  3HXL A;  4HNU A;  5J1U A;  2E19 A;  2PMZ A;  1HKS A;  2P6T A;  4M9X A;  3TGN A;  2P5L C;  4ESJ A;  1R71 A;  1MNE A;  2DDA A;  2BGC A;  2Z3Y A;  4E7H A;  4B4C A;  4CGZ A;  1HC8 A;  1OQY A;  3J80 Z;  2CU7 A;  3TP3 A;  4HX8 A;  4GO1 A;  5D8L B;  4Q4Z F;  2HOE A;  3JCU C;  4AD9 A;  1Y1V J;  2L7K A;  2LBF A;  3WTU C;  5CVR A;  4BQO A;  1B6A A;  3F6V A;  3OYK A;  2HOT A;  3COA C;  3M1C A;  3DPL C;  3HUG A;  4HAM A;  3TQN A;  1YRN A;  2O6G E;  1KZH A;  3ZN1 A;  2KT0 A;  4PJM A;  4XLE A;  3H5N A;  2H1L A;  1BI0 A;  3K7A J;  3ZQI A;  2KZV A;  4BAC A;  1U6G A;  4BJ5 C;  1QBJ A;  1FX7 A;  1VQ7 I;  5ICE A;  3JTG A;  1TZL A;  1UST A;  2FD5 A;  3NWT A;  1FWZ A;  4M6X A;  2XAU A;  5ICG A;  2XSD C;  3OYG A;  4I6Z A;  1TP4 A;  4KT6 A;  3FZV A;  1X1A A;  4CCN A;  3G4S I;  4OMY A;  2LY1 A;  5E79 C;  4PJL A;  5HNH A;  2R5Y B;  4UB8 C;  4ENK A;  2WY7 Q;  5FD6 A;  2BW3 A;  5HDG A;  1AU7 A;  3OL3 A;  1S7O A;  4ZTJ A;  3W6V A;  1RUN A;  3S1N J;  4L0Z B;  3KLN A;  1YX5 A;  3NQO A;  4GCV A;  2PBI A;  1MKM A;  2E71 A;  3KEO A;  1QVU A;  1BR2 A;  4BQN A;  2FXA A;  2KDZ A;  3BR3 A;  2YX4 A;  1U0J A;  1UMQ A;  3QYE A;  1Q1H A;  2FBI A;  3FXM A;  3VYS B;  4BKX A;  4Z6Y A;  1Z6R A;  1ON1 A;  2HOA A;  5BPD A;  1CF7 B;  4M71 A;  1RPW A;  1O3S A;  1YJW I;  2NVX J;  4IF4 A;  2PN6 A;  1D0Y A;  1KU2 A;  3VYR B;  4BHB A;  3FIS A;  2NOG A;  3F21 A;  3N4M A;  1N78 A;  3MVP A;  5BOX A;  2LR8 A;  4GGG A;  3KP6 A;  2E1C A;  1RIO H;  4KA4 A;  2PFB A;  2DFE A;  1ETQ A;  3OYC A;  3HOU J;  1Y0U A;  3E1S A;  1DDN A;  4UUV A;  5IT9 Z;  2RC4 A;  4BUP A;  3EYY A;  3A0B C;  2HPM A;  2ETH A;  1OYI A;  2WAD A;  3I9V 2;  2QSF X;  1R36 A;  2B0L A;  3LAJ A;  2HYG D;  3G6E I;  2Q2E B;  2XKO A;  3LSI A;  2EV6 A;  4HX7 A;  3VEP A;  4BL0 B;  1OYY A;  4EVI A;  1Y1W J;  4JK1 X;  2NVY J;  2JUC A;  4KT5 C;  1W5S A;  3QRF F;  1XX5 A;  5D5W B;  2HYF A;  1JUM A;  3KP7 A;  1K6Y A;  1Y56 A;  1IN8 A;  1VF9 A;  3ZQH A;  2HTS A;  2JA7 J;  3AG2 H;  2OV7 A;  3K1N A;  3E6C C;  1VQM I;  2K3F A;  4DOZ A;  4IOA F;  3HL2 A;  1MJB A;  5EEG A;  3PL8 A;  2ZJP F;  4MEY F;  1W7P A;  5FKK A;  4ZYD A;  5HDK A;  3HM5 A;  3FF5 A;  3H5R A;  2ZJQ F;  4RLQ A;  1G59 A;  1T33 A;  3RZO J;  3JRB A;  4UVC A;  4OOI A;  2XF6 A;  4LJZ F;  4ASN A;  1MJ9 A;  2VOD A;  4IRG A;  2CQQ A;  2MG4 A;  4HPQ A;  4UUS B;  2ID6 A;  2ZB9 A;  2QVO A;  2IP2 A;  2VQH A;  3E6D A;  2E2H J;  4XSX F;  2QYO A;  5D8K B;  1ZR4 A;  2OCC H;  1G3T A;  4QLC U;  1BOB A;  1DUX C;  1TQM A;  5IOY A;  1GVD A;  2X6W A;  3S2W A;  3LSH A;  2HZD A;  1P4A A;  3T8R A;  2NVT J;  1Z91 A;  3ELK A;  4LFU A;  4KDP A;  2IS2 A;  2R7T A;  4HF0 A;  3V7S A;  1O4X A;  1R1V A;  2R3S A;  5ICF A;  4B09 A;  3U9G A;  4L5E A;  1RUO A;  1V5E A;  3H5A A;  4LGW A;  2Z1D A;  1N25 A;  4XKW A;  2CV0 A;  1RES A;  1Y0N A;  3H1C A;  2L01 A;  5CVU A;  1B9M A;  4LIV A;  3T5X A;  1S6L A;  2DCE A;  1WZ2 A;  1WFX A;  4U87 A;  5FB2 A;  2HQ5 A;  1JXS A;  1P9Q C;  3J81 K;  4J19 A;  3N97 A;  2GOX B;  5D5U B;  4WK8 F;  3Q0V A;  1E3P A;  1P92 A;  4MLO A;  2RN7 A;  1XD7 A;  3WTZ A;  1MDM B;  3K4K A;  1R5G A;  2OAZ A;  2IAI A;  2E5N A;  3HSE A;  3QAH A;  6PAX A;  3M07 A;  1R4M B;  3L2V A;  2EIK H;  2LNB A;  2QZ8 A;  4HV6 A;  3WGI A;  2EIJ H;  4HQM A;  3RIR A;  1HDD C;  1DPR A;  2MGQ A;  2PJP A;  5L3C A;  4PJ0 C;  1JHH A;  2CJJ A;  4IEJ A;  1CGP A;  2R7U A;  4DGW B;  1UG0 A;  3BG3 A;  1RR8 C;  2CG4 A;  2LK2 A;  3LOC A;  4WXD A;  3F0C A;  2XDV A;  3OIP A;  2VN2 A;  3IH2 A;  4DZP A;  2IGM A;  4UVA A;  1R6R A;  1YFH A;  2O3F A;  4YIF A;  3HKZ N;  3EPZ A;  3K2Z A;  1B8I A;  3CP2 A;  3KYL A;  4H4K C;  1TWC J;  1OCZ H;  1P4W A;  3GO5 A;  3ZMT A;  2R7W A;  1G6N A;  1W5C C;  4RGU A;  3ZQQ A;  5TJJ A;  3V4G A;  4PCQ A;  3RQ4 A;  1GHC A;  2HQA A;  2QEN A;  2KJC A;  1R5I D;  2LSO A;  1HW1 A;  3ZCO A;  4A6D A;  1IN5 A;  1BJA A;  2RQQ A;  2ZXJ A;  2LG4 A;  2M0M A;  2N8G A;  3S3M A;  4UHT A;  3BR1 A;  4LG0 A;  9ANT A;  1HKQ A;  5LBQ A;  4G8X A;  3GFL A;  2XAS A;  3CTA A;  5K7H A;  1RC9 A;  2KQR A;  4FQG A;  3CJN A;  1K4S A;  2IS1 A;  4LMY A;  4LLL A;  1ZHF A;  4EMS A;  3I59 B;  1OIS A;  1TT0 A;  3K0L A;  4RM2 A;  3TOA A;  1X1D A;  3CJQ B;  1WVR A;  2KIF A;  1F43 A;  4NUB A;  4IZZ A;  5HS8 A;  4A5M A;  5FLM J;  1RZ4 A;  4G7O F;  4XLP F;  1DGR M;  3I58 A;  1IAW A;  2JA5 J;  2H8W A;  1IRX A;  4A3L J;  3MKY B;  3HDD A;  2K7L A;  2KDO A;  2MLK A;  4PSW A;  4XMY A;  5J8F A;  3ZP5 A;  3RI4 A;  4EV0 A;  2GIZ A;  2CV1 A;  1H9G A;  2BV6 A;  4WXC A;  3W2A A;  2QSH X;  2XSJ C;  3GEZ A;  3PQJ A;  2P5V A;  1JJ6 C;  2HNH A;  2COM A;  3GFJ A;  2HPI A;  3HSR A;  2MYS A;  4LK0 F;  4RB2 C;  1K83 J;  4FHT A;  3ISP A;  3H9G A;  5C4J J;  4EJW A;  2A69 F;  2M8G X;  2L9S A;  3CJT B;  5GPA A;  1J0R A;  2YU3 A;  5FJ8 J;  1PUF B;  2PX9 A;  3DKY A;  3K4B A;  3VYU B;  2EA2 A;  4NQW A;  2W25 A;  4A3K J;  2QQB A;  1OMI A;  1ZH5 A;  3REO A;  5AIQ A;  1BI1 A;  1JTX A;  2BVM A;  2VE9 A;  4IQJ A;  5F1J A;  4M3G A;  2IPQ X;  2Y75 A;  3TDZ C;  4OWR B;  1T56 A;  1KU3 A;  3CCY A;  4F7Z A;  1DP3 A;  2HVQ A;  2L4A A;  3M8J A;  1XSD A;  1R58 A;  2HTJ A;  1TWH J;  2NS7 A;  3CO6 C;  1CQT A;  2A07 F;  2STW A;  4XRS A;  1MGT A;  3VOE A;  3JAM K;  5FO5 A;  1GDT A;  2E35 A;  5KAI C;  2NNY A;  1X1P A;  1X4O A;  1GLN A;  2CGP A;  2NAZ A;  4KMF A;  4BU2 A;  2VQG A;  2GXA A;  4PJJ A;  2AS5 F;  3GFM A;  2NXN B;  1P7I A;  2DPU A;  2V9P A;  4HW0 A;  3JRG A;  3AKZ A;  2LY2 A;  1TNT A;  4PJN A;  4C3I J;  1B4A A;  3ZOB A;  4AC0 A;  4BHC A;  1FTZ A;  3CZ6 A;  2X6X A;  3BG5 A;  4U7B A;  1W36 C;  1BBY A;  2K4B A;  2MD0 A;  2D2W A;  3LSR A;  1XG1 A;  1GVJ A;  1RKW A;  2GA1 A;  1MBE A;  2CUZ A;  4KUM A;  3QP5 A;  1I6X A;  1XGN A;  1T39 A;  2HYJ A;  3JAM Z;  3CUQ A;  3R0A A;  4FE7 A;  4QTR A;  4JBA A;  1IO2 A;  3Q0U A;  5E8G A;  1LFB A;  5IT3 A;  5K5R A;  3DKW A;  2F5E A;  2JA6 J;  2ACJ A;  4L5J A;  2LYC A;  2RGV A;  3ASN H;  5J4V A;  3RYR A;  2KRC A;  2HU9 A;  2Y0S A;  5DM7 F;  3I54 A;  4BE2 A;  1NK2 P;  1Z77 A;  2IJL A;  3O8H A;  2UV1 A;  2MAB A;  2ZSH B;  4CCL A;  3SQN A;  1B59 A;  3W6K B;  3H0G J;  1XDS A;  1F1Z A;  3R0J A;  4S0H B;  4B47 A;  3GWZ A;  4HF2 A;  1WCM J;  1SVO A;  1OKR A;  2HKX A;  4DBR A;  3MCZ A;  4JQF A;  3TW6 A;  1IDZ A;  3GYH X;  1IRZ A;  4IHX A;  5F64 A;  2FF4 A;  2VKD A;  1JUP A;  4CZC A;  2DJI A;  3LMM A;  1I1S A;  5GP9 A;  3LA7 A;  4BDZ A;  1R5H A;  3BPV A;  2H27 A;  1R4N B;  3E7L A;  4KIF A;  2AXL A;  1GV2 A;  3HEF A;  4AVZ A;  3AFH A;  3VSK A;  1EV7 A;  4O6J A;  5JVT A;  1UHS A;  1IDY A;  3AG1 H;  4E7J A;  5ILU A;  2CH0 A;  4HEA 2;  1YG2 A;  3GLL A;  2YR2 A;  1SVL A;  5H6R A;  4IOC F;  3WU2 C;  5DM6 F;  3CME I;  4ON0 A;  2F4O B;  4V2G A;  2D5V A;  4KIT B;  2EQR A;  2XHK A;  1ENH A;  1X19 A;  3CDI A;  1OCP A;  2ZFU A;  3AG4 H;  4I98 B;  4F55 A;  2XGC A;  3ZQC A;  2ZSI B;  3S8P A;  4FCY A;  2RQP A;  2JWT A;  2WAQ A;  3HRU A;  1QQI A;  5A2Q Z;  3HBL A;  3OMY A;  1EA3 A;  4X1E A;  5F0C A;  3UNG C;  3GUD A;  3QOP A;  3BP8 A;  3PNY A;  2L7F P;  4ANJ A;  1MH4 A;  4IHV A;  4ZJZ A;  2Z2S B;  3IP4 B;  2VC1 A;  4A0X A;  4IX7 A;  2HZT A;  2AHQ A;  3SFI A;  3ZMZ A;  1TL8 A;  3LA3 A;  4P5O A;  3LNQ A;  2I8D A;  5JHF A;  3G73 A;  4CCJ A;  1EKE A;  1LVK A;  3AL0 B;  4Y52 J;  4MTD A;  4XID A;  3IHU A;  4M6V A;  3LSM A;  2ZO4 A;  1P7J A;  5GAD J;  5J6X A;  5ED4 A;  2W1O A;  3G1L A;  4BDY A;  3Q5F A;  2EA4 A;  1IV6 A;  3P9I A;  2WY8 Q;  3I64 A;  3MN2 A;  3J7A O;  3OS1 A;  2IA2 A;  3R61 A;  2LDU A;  1D5V A;  2EV0 A;  2WB1 N;  3W2V A;  4HZF A;  3TP0 A;  2VBZ A;  4XOR A;  2E34 A;  1FOK A;  1QA6 A;  2AQF A;  3SYT A;  3I0T A;  2K02 A;  3HHG A;  5BQT A;  3GLX A;  3IC7 A;  4XLH A;  1GXQ A;  5GPC A;  3VSL A;  1W5T A;  2XAG A;  3CUQ C;  1JGS A;  3CCR I;  4IJA A;  1LE8 B;  3GTP J;  2O7O A;  4YRV A;  1ZR2 A;  1LVA A;  3KZI C;  4A3C J;  3FHN A;  1WH5 A;  3IUO A;  1V54 H;  1VQ6 I;  3W2W A;  4WX9 A;  4MQ9 F;  3GME A;  2GWR A;  2Y69 H;  1K6O A;  1X58 A;  1SFK A;  4BH9 A;  2HFH A;  3LL7 A;  2MBF A;  3L7W A;  3TDU C;  1VQN I;  1R1U A;  4J01 A;  2QCO A;  5ILS A;  1MBK A;  4OAZ A;  4PFP A;  2PQ8 A;  2DK5 A;  3GZ6 A;  1YW7 A;  3OSF A;  5EJC A;  3CLO A;  5ILV A;  4LIU A;  2FQ3 A;  5GAH J;  2JN6 A;  3GTM J;  4FX4 A;  2UWM A;  2YS9 A;  1O7F A;  3PM1 A;  3OYL A;  1WH7 A;  3HC7 A;  1MBF A;  1F5T A;  3RJP A;  2Y30 A;  2Y48 A;  2ZNZ A;  5IP9 J;  2V6C A;  3MKW B;  1ZRD A;  1ODD A;  1A35 A;  3V8L A;  3RKY A;  5K5O A;  5LEJ A;  5K7Z A;  4XQF A;  1FTT A;  3DXJ F;  3PNV A;  3T1B A;  3FXR A;  5LEK A;  3BQY A;  1MSE C;  2HKO A;  1FMW A;  4NC6 A;  2EWN A;  3BG6 A;  2PMZ N;  4YEL A;  2K9N A;  2ECC A;  2FUG 2;  1STZ A;  2GM4 A;  2Q0O A;  4IL6 C;  4XL9 A;  4HDU A;  1A04 A;  2E7W A;  2MA3 A;  2E1M B;  4CCM A;  3SEQ A;  4HRI A;  2OQR A;  3ZMV A;  1UJ8 A;  1T0F A;  2DI3 A;  4YII A;  2J5P A;  5F08 A;  1MMA A;  4FTH A;  1BL0 A;  4G7H F;  3IH4 A;  4LK1 F;  3SEZ A;  1KQ9 A;  3ZGK A;  1Y8R B;  4NC8 A;  1OLT A;  2AXT C;  1T98 A;  2ICW G;  2RV8 A;  4QWQ A;  2ME6 A;  3MKL A;  4B43 A;  1K78 B;  2WC2 A;  4YFN F;  4AU7 A;  2P8T A;  1R22 A;  3O6B B;  4EM0 B;  1X3U A;  2MH2 A;  1SAN A;  5EEH A;  1R49 A;  5BS6 A;  3CMA I;  4UNO A;  1ETV A;  4IHY A;  4ETS A;  2LVS A;  1I1G A;  1QPI A;  3VOD A;  3G1O A;  2ESH A;  4E7I A;  3GZ5 A;  5CKT A;  3D5L A;  1YJN I;  1W0U A;  4O5V A;  4W97 A;  3W6J B;  1Z7U A;  4P9U A;  3PUB A;  2R5Y A;  1WSU A;  5HOD A;  2X6Y A;  1BW5 A;  2VJJ A;  3J7Y J;  4IHS A;  4BXX J;  2W85 A;  4E70 A;  1QNT A;  2HEO A;  5TIS C;  1LDK B;  1JJ8 C;  3DF8 A;  5C4X J;  2ZME B;  1XPX A;  1JTY A;  2V1N A;  1B1B A;  5K5Q A;  4KNY A;  4RGS A;  2X9D A;  4IHW A;  3SXY A;  3JRE A;  4MGR A;  1ZKG A;  1ZK8 A;  2PJR B;  5D5X B;  1CF7 A;  4WCG A;  4YFX F;  5AIP A;  2H6C A;  3JRC A;  3CUO A;  4E7S A;  3TW7 A;  2WA0 A;  4XLF A;  1LDD A;  4M72 A;  1WI3 A;  2W7N A;  3WOD F;  4ZYH A;  5BPI A;  2VOO A;  4CYD A;  1P4X A;  2L5Q A;  4OIQ F;  2DPD A;  2R0Q C;  2DMT A;  2IA1 A;  2L9N A;  2HOS A;  3QU3 A;  3C3W A;  2CFX A;  5KCM A;  5FRO A;  5TRD A;  3L00 A;  4L5I A;  5M5X J;  3G1M A;  2FJ1 A;  1TWG J;  3S3N A;  5F6F A;  5DUI A;  1YQA A;  2FSW A;  3S1M J;  3S16 J;  1MMG A;  4HST A;  1X3Z B;  2LD5 A;  3ECO A;  4AVP A;  2A6T A;  2RNJ A;  3S15 J;  3GVA A;  4Y4R A;  1S5L C;  2Q2E A;  3KX2 A;  2DJN A;  5E17 F;  1KYZ A;  1FZP B;  4GYI A;  3OYM A;  4JYK A;  2NRA C;  2DOF A;  3RZD J;  3BJO A;  1J2X A;  3K6G A;  5J1Y A;  4I2O A;  4MQV A;  5L3B A;  1J09 A;  2RRE A;  3R60 A;  4A5N A;  2R93 J;  2MD5 A;  2VOP A;  5K7F A;  3L2U A;  1JE8 A;  5CVJ A;  3FM3 A;  4A0Y A;  3WTX C;  4F3Q A;  4I02 A;  1WRJ A;  1T0F C;  3OY9 A;  2FX0 A;  1QHG A;  1IUY A;  1LPQ A;  3CQZ J;  1J7K A;  1WHU A;  2M7A A;  3AG3 H;  1DU6 A;  2OTL I;  4OMZ A;  4BHP A;  1P2F A;  2DN0 A;  2M8E A;  2Z5U A;  3L2W A;  4C3J J;  1AHD P;  3K69 A;  3OV8 A;  1I3Q J;  3K4L A;  2VBW A;  2V7F A;  4GXO A;  1Z1D A;  4WXH A;  1W36 D;  1FBQ A;  3QU6 A;  1AA7 A;  1XGM A;  2BY3 A;  2OF7 A;  4XRF A;  4UUS A;  2HDD A;  3JRI A;  4I01 A;  2A5Y B;  4B3X A;  4Y33 A;  2G7H A;  3BR5 A;  5J40 A;  1IN6 A;  5B66 C;  2XPW A;  5LGU A;  1IXS B;  2W82 A;  1MNM C;  4EM1 A;  5DS9 A;  4BGD A;  2I10 A;  1BW6 A;  2DAO A;  5J47 A;  3D5S C;  1E17 A;  1M1E B;  2MLG A;  1D0X A;  3PFY A;  4Y15 A;  2XPV A;  4M3F A;  4KJZ A;  5E3N A;  1ZGW A;  3H3U A;  2FU4 A;  3N05 A;  1REP C;  4XSZ F;  3A0H C;  1J5Y A;  4G6Q A;  3LA2 A;  5E1X A;  2G9W A;  2DOE A;  2CUJ A;  2E5Z A;  4CZZ A;  3LAP A;  3CF5 F;  4NBQ A;  5F04 A;  5KHD A;  4BJT A;  1ZRC A;  2IS4 A;  1FMV A;  1APL C;  3QPL A;  4D7N A;  4U0W A;  3ZQG A;  1FYL A;  3EUK L;  4LB6 B;  3RKX A;  2L9R A;  3GXO A;  4NB5 A;  3DPU A;  1NH3 A;  5L3G A;  4RBO A;  2P4W A;  1MDM A;  2XUB A;  3TL4 X;  4IRI A;  1JI8 A;  1HW5 A;  3ZMD A;  4KIC A;  1JUS A;  2K85 A;  4A2U A;  3IAS 2;  3BTI A;  4R79 A;  2IXS A;  1YHQ I;  2F2E A;  4V19 K;  2O03 A;  2KJB A;  2ZXW H;  4M3D A;  4HDV A;  2QBY B;  2LRE A;  2NOJ B;  3CMM A;  2JT1 A;  3GZN B;  1TLH B;  4LLG F;  1F4K A;  4L9T A;  4N9H A;  1ON2 A;  3S14 J;  1KYW A;  1ETO A;  3FMR A;  4RB3 C;  4C3H J;  4DBQ A;  5F0H A;  4ZDP A;  2OQG A;  2BE5 F;  1Z21 A;  5JR3 A;  3K70 D;  3JRD A;  1H0M A;  2WWY A;  1X2M A;  3RDI A;  5LD2 C;  4EM2 A;  2EIN H;  1MSF C;  1SFO J;  3HPH A;  2X6O A;  4ZTF A;  3K2A A;  4HV5 A;  4QPO A;  5JVG F;  1WJE A;  1U3E M;  2DLL A;  5AON A;  2P81 A;  2GIV A;  3BR6 A;  4IPA A;  5K1Y A;  3DKX A;  2KIM A;  4M74 A;  5DCM B;  2JVG A;  1FP2 A;  1NG6 A;  1UG2 A;  1XS9 A;  2OBP A;  3FXL A;  4BQA A;  1BA5 A;  4XON A;  1X1B A;  2DYS H;  4MO7 A;  5DUK A;  3J81 Z;  3SZP A;  3HOZ J;  2XKP A;  3I4P A;  2EFW A;  2DTR A;  2RDP A;  4KYW A;  1FIP A;  2EV5 A;  3I59 A;  5KVR A;  2OTJ I;  4BAY A;  2LKX A;  4KMU X;  1JKR C;  2YPR A;  2K27 A;  4EJO A;  3TOB A;  3BJA A;  3QWL A;  3I4N J;  1KU9 A;  3BR2 A;  1WGX A;  3FKI J;  5M5W J;  1S7E A;  3H0D A;  5D6F A;  1YTY A;  5E18 F;  1J75 A;  2RKH A;  1DU0 A;  2VUM J;  2HDW A;  5FLX K;  3I4M J;  2KPM A;  1YJ9 I;  2KIQ A;  2DA1 A;  3LSG A;  4P96 A;  4X0G A;  2RAE A;  2Q8K A;  3F8C A;  4Y17 A;  2VKV A;  3HOS A;  2DYR H;  2E7X A;  4XBF A;  2ZBK A;  4UV8 A;  1LFP A;  5D6E A;  1HXD A;  1WWX A;  1QPM A;  2M9H A;  3K4J A;  3KYD B;  3JRA A;  2KP6 A;  1PUF A;  2M0C A;  4G6D A;  2IW5 A;  1TC3 C;  3B6A A;  5HLH A;  2XGE A;  2EJR A;  4BNC A;  3JRF A;  1Z0X A;  2WV1 A;  3H35 A;  2Q1Z B;  3C2B A;  3HB9 A;  2EFQ A;  3LQQ A;  2MH9 A;  1VI0 A;  2GXG A;  1XSX A;  3SZG A;  4AIK A;  1H88 C;  1IXR C;  2FMY A;  4CDG A;  5GTI C;  3JRH A;  3ASO H;  2A05 A;  2OC6 A;  1QVT A;  1XMK A;  3Q9V A;  3D0S A;  4HSR A;  2A6E F;  3KYC B;  2CQK A;  1ZN2 A;  3PIO F;  2JPC A;  3DFG A;  2PMH A;  2KHM A;  5FD5 A;  2IS6 A;  3OYB A;  1SD5 A;  3I55 I;  1FBU A;  2M87 A;  3JSO A;  2ESN A;  1MMN A;  2NS8 A;  3G71 I;  2BHZ A;  4BS9 A;  3DLL F;  2KL4 A;  3E0J B;  3GBG A;  1HQC A;  3I56 I;  5CVI A;  2PG4 A;  3BLY A;  3OYD A;  3BT9 A;  2CW8 A;  2DMP A;  3O8G A;  1IG7 A;  4G7Z F;  1QZZ A;  2K86 A;  2ZCW A;  3DLA A;  1G3W A;  3A1Y A;  4B3A A;  1UHM A;  3P9C A;  3CCS I;  4PUS A;  3D5R C;  4B8X A;  5GTH C;  1O3Q A;  4BEH B;  1IN7 A;  1BI2 A;  1IV8 A;  2KRH A;  2VQL A;  1WQ2 A;  4G6T B;  3E5X A;  3CES A;  4DIQ A;  2QQA A;  3K4M A;  1X1C A;  4E6K G;  1H89 C;  3CC7 I;  4Q47 A;  1RRJ A;  1MJA A;  2Y0S N;  1JT0 A;  2IEK A;  5E8I A;  1LJ9 A;  3NRV A;  3WTV C;  5HOO A;  2TDX A;  2ID3 A;  3FIW A;  5DCF A;  4A12 A;  1F36 A;  1KA8 A;  4S04 A;  1K79 A;  3ABK H;  3ROU A;  2QLZ A;  1D5Y A;  3M7G A;  2VT3 A;  2VXZ A;  2W00 A;  3OWT A;  4AYB N;  1OCR H;  4EJT A;  2JQ7 A;  5E3O A;  3KP2 A;  3OS2 A;  3CCQ I;  1UB9 A;  1XSV A;  4XN3 A;  2XC7 A;  1XC5 A;  2V1D A;  2IA0 A;  1VQK I;  1Z6T A;  1VQP I;  1VFC A;  3BZC A;  3LST A;  2XVC A;  4PZJ A;  4UUT A;  2M5W A;  3FK6 A;  3E3V A;  2X4H A;  4RM3 A;  2OCE A;  4IHT A;  3VB2 A;  3VPR A;  2DFF A;  1I6H J;  3BOQ A;  1IUF A;  2R7O A;  2HXI A;  1SVM A;  3VFZ A;  4HLX A;  4AID A;  4DYQ A;  3DTE A;  2TRT A;  5M3M J;  3BTJ A;  2EZL A;  2GA2 A;  3C1D A;  4EQQ A;  3DEW A;  4XOP A;  3ULQ B;  3HYI A;  1D1B A;  2DA5 A;  4NC7 A;  5DTD A;  3M1E A;  1R9T J;  3K9T A;  2GZW A;  3ML6 A;  1V4R A;  1IC8 A;  2DMQ A;  3GTK J;  1R23 A;  2VJI A;  3S17 J;  4Y7N J;  3CC2 I;  2B7E A;  5E20 A;  3EDP A;  3CDH A;  1ZGJ A;  2FEZ A; 
#chains in the Genus database with same CATH homology
 2XRO A;  3RPU A;  2EB7 A;  4P55 A;  2XAQ A;  4UXN A;  2HDC A;  2VE8 A;  2M45 A;  2XAJ A;  1FSH A;  4TV7 A;  2HQN A;  1KQ8 A;  1XGS A;  3E6M A;  3F72 A;  4ENM A;  4HF1 A;  2XAH A;  1IZ1 A;  2EK5 A;  3BRO A;  2VT2 A;  3DEU A;  5L3E A;  2GQQ A;  3MAJ A;  4FT8 A;  5L3D A;  1TW3 A;  1U5T B;  3B73 A;  5HLG A;  3EET A;  2OD5 A;  3HRS A;  5KK1 A;  3SFZ A;  2W84 A;  1FYM A;  2DO7 A;  4IXA A;  5ICC A;  4U7D A;  2JRT A;  2DQR A;  5HS9 A;  2ISZ A;  1Z9C A;  2P7V B;  2W57 A;  5JFR A;  3DQV C;  5LHI A;  3RYP A;  2LF8 A;  3PQK A;  1EH8 A;  3TKY A;  2O61 A;  1U78 A;  3LQR A;  3QPT A;  4RAZ A;  1O7L A;  2XAF A;  1T2K A;  1ZLK A;  4L18 B;  2EFO A;  1XCV A;  1KU7 A;  1Z05 A;  5LLQ A;  4KFC A;  2V79 A;  4A6E A;  5CLS A;  1IRG A;  1PUE E;  2UXX A;  1SD6 A;  2A6H F;  1OPC A;  2D1V A;  4G9Y A;  4RB1 A;  1LNW A;  1R00 A;  4P9F A;  1IXC A;  4OIP F;  1SFE A;  5CYV A;  1UHW A;  3Q9S A;  1RNL A;  2CYY A;  3U1D A;  1QZY A;  3IRQ A;  1G3Y A;  4UV9 A;  1PDN C;  2QUF A;  2O0Y A;  3MWM A;  1K78 A;  3IRR A;  5LHH A;  3GF2 A;  5JHU A;  4FX0 A;  3MFK A;  3I71 A;  2EFN A;  3T8T A;  1FYK A;  4MHG A;  4GYG A;  3L9F A;  4ENJ A;  2ZFW A;  4ESF A;  3IKV A;  3TO6 A;  4O3M A;  4U88 A;  1XDU A;  4KN4 X;  2JPB A;  2O8X A;  4PGH A;  1OR7 A;  1AWC A;  2VC0 A;  2L54 A;  2BYV E;  2K4J A;  2IT0 A;  3V7R A;  3KEQ A;  3J80 K;  5HVQ C;  2ZME A;  3K1P A;  4RGR A;  4PGG A;  2JZY A;  2WV0 A;  2ISY A;  3JW4 A;  4UVB A;  1W7P D;  3IL2 A;  4LD5 A;  4ZYE A;  3GW2 A;  3F6O A;  2FML A;  2F5C A;  4LLN A;  3FXU A;  4YG2 F;  1SD4 A;  3KLO A;  1MZB A;  3L2C A;  4M73 A;  1QGP A;  2IVM A;  1HSJ A;  1P6R A;  3V7C A;  3ZQ7 A;  1UFM A;  3HIF A;  2C6Y A;  2FBK A;  4XLN F;  2FA5 A;  3OOP A;  3JSP A;  3M8F A;  2FNP A;  5JI6 A;  2CO5 A;  1WKM A;  3I53 A;  5H20 A;  2P7C B;  4WF2 A;  3TO9 A;  3WTT C;  2DW4 A;  2DFI A;  5FGM A;  3WE3 A;  2L3D A;  2Y0M A;  4D0P A;  3FWE A;  2DT5 A;  4M9Z A;  5ERI A;  1HST A;  5DEQ A;  2Z9O A;  4M6Y A;  2CW0 F;  5IT9 K;  1YW9 A;  2WTE A;  3B02 A;  1L3L A;  1IN4 A;  3HHH A;  3ZMU A;  2PLY A;  3H92 A;  2OU2 A;  3IWF A;  2XV4 S;  4HOB A;  4M9S A;  5LRS A;  2GXB A;  2DBB A;  2JSC A;  4MEX F;  1G4D A;  2ADU A;  3ZN0 A;  1PP8 F;  3PFI A;  3BZ6 A;  4OIR F;  1L0O C;  3E5U A;  2X0L A;  1S8N A;  4KIB A;  4CXF A;  3T0Y A;  4CHU A;  1YLF A;  1ZGA A;  3HRT A;  2FRH A;  2D45 A;  3F8F A;  5D5V B;  5DV5 A;  1EH7 A;  1WI9 A;  1XCB A;  5LGN A;  1FP1 D;  1YO5 C;  1FY7 A;  3AAF A;  1ZAR A;  2KIU A;  2PI0 A;  4Q48 A;  2V1U A;  4I0A A;  2EFP A;  2QBY A;  2LKP A;  5F1R A;  4U0V A;  1E2X A;  1ZRF A;  5CVV A;  1ULY A;  2P6S A;  1FT9 A;  3HSF A;  3DP7 A;  3IKT A;  2PEX A;  4K2E A;  3GX4 X;  1B9N A;  2YSR A;  2CSO A;  3ERE D;  2VBY A;  3HTU A;  4OU0 A;  1XB4 A;  2UZK A;  4AIH A;  1W7P B;  3E6B A;  4ZYG A;  3FX3 A;  1H9T A;  2OZ6 A;  3KZY A;  1TQI A;  1SD7 A;  5DCM A;  4EGY A;  5BMZ A;  3KCC A;  1FNN A;  5E1Z B;  3KET A;  2F5D A;  1GXP A;  2GAU A;  3KE2 A;  2CWE A;  4RAY A;  2M1B A;  3FM5 A;  5LHG A;  4HQE A;  3FMQ A;  2Z99 A;  4DNC A;  1LEA A;  4HYE A;  3WU0 A;  3F3X A;  4L9V A;  2QQ9 A;  1J9I A;  3V8J A;  3BJ6 A;  4RB0 A;  1YYV A;  4ENN A;  4N9I A;  5DD8 A;  3RTR A;  3SZT A;  3FXQ A;  2L4M A;  4CO8 A;  1S3J A;  2VON A;  3H3Z A;  2M30 A;  3HRM A;  4YFK F;  3WTS C;  1BC8 C;  1BIB A;  1FBS A;  5LRR A;  3KP4 A;  2YX7 A;  3RPQ A;  3ZMS A;  2V1X A;  2KKO A;  2H6B A;  1MD0 A;  2OZU A;  4RS8 A;  4I0B A;  3WTY C;  4I09 A;  1S7A A;  1USS A;  1TBX A;  4CIC A;  4Z2Y A;  3F8N A;  3RKW A;  3FHZ A;  3WG9 A;  5FLX Z;  1D8K A;  1R1T A;  3U2R A;  4ZH4 F;  3R6S A;  5CJ9 A;  4Q5S F;  3HTS B;  2ZNY A;  3P9K A;  3EQL F;  1S29 A;  2QWW A;  2BEO A;  5J8C A;  1U8R A;  4LG0 B;  4A0Z A;  2A61 A;  3LFK A;  3WGH A;  5DDG A;  2J5O A;  1YS6 A;  1VTN C;  1I5Z A;  1YIO A;  3LWF A;  5FFZ A;  2STT A;  1ZYR F;  1BI3 A;  1BIA A;  2DU9 A;  2HQR A;  2ZKZ A;  3DPT A;  3GFI A;  1T38 A;  5HLI A;  2FOK A;  1SFX A;  1V3F A;  2A3S A;  1SFU A;  3ABT A;  2A68 F;  1KQ0 A;  2NYX A;  1K7A A;  4EJV A;  1ONV A;  1TNS A;  4ZZL A;  3EUH A;  3MZH A;  4KN7 X;  3EYI A;  1NHA A;  3I5U A;  2JTV A;  3ABU A;  2FNA A;  3JTH A;  4R8H A;  3C7J A;  1ZLJ A;  4IRH A;  4BYY A;  2UXN A;  2W24 A;  4L0Y B;  1XN7 A;  2VBX A;  2QM3 A;  3M8E A;  1LQ1 A;  1BOA A;  2HS5 A;  2XIG A;  3WTW C;  3M9A A;  4HLY A;  3WGG A;  1IW7 F;  3MQ0 A;  4EJU A;  3TO7 A;  1XGO A;  4L9N A;  3E5Q A;  3F23 A;  3BDD A;  5L3F A;  1BN5 A;  3O3K A;  1F9N A;  3R4K A;  1KGS A;  2FBH A;  3O2P E;  1YS7 A;  4ZZD A;  2XGX A;  1HKT A;  2DK8 A;  1O3T A;  4BXU A;  5A2Q K;  2IRF G;  1SMY F;  3CUQ B;  1O3R A;  1UCR A;  3C18 A;  1FC3 A;  2ELH A;  2NS0 A;  1LDJ A;  1ZG3 A;  1OYW A;  4I7H A;  3MEX A;  1U5T A;  2R7F A;  3P7N A;  2BBY A;  3MZY A;  4PDK A;  4HA8 A;  1BC7 C;  2XRN A;  2P5K A;  1C0W A;  1RI7 A;  5HDN A;  4OIN F;  5HS7 A;  1PP7 U;  2MC3 A;  1T6S A;  3ECH A;  2R7D A;  1FPQ A;  1R7J A;  3BWG A;  1BM9 A;  1EH6 A;  1FLI A;  3SHF A;  3WU1 B;  4G94 A;  4R1H A;  4MTE A;  1D3Y A;  1DP7 P;  4LB5 A;  2NNN A;  4RGX A;  1ZG5 A;  1XMA A;  1J59 A;  3K1M A;  4KIG A;  1QO0 D;  3ZPL A;  1W4M A;  3QPH A;  4ESB A;  2RVC A;  3DV8 A;  4HBL A;  3WE2 A;  2HGC A;  2ZJ2 A;  5FFX A;  3BY6 A;  2PMU A;  4N0B A;  1HBX G;  3QP6 A;  3E97 A;  4U0Y A;  2V9V A;  2FE3 A;  1LB2 A;  3FMS A;  2DQL A;  4HX4 A;  2H09 A;  4EGZ A;  4AIJ A;  1I27 A;  1SAX A;  1ZG1 A;  1SMT A;  4DQ2 A;  3F8B A;  4WWC A;  3IWZ A;  5D4R A;  2HWV A;  5E1W A;  3KFW X;  5DYM A;  1JHF A;  1ZRE A;  2Z33 A;  1DPU A;  1TTY A;  3L09 A;  2H94 A;  1U5T C;  1IRF A;  3BPX A;  5D4S A;  1HW2 A;  3V8K A;  1TQP A;  5DD4 A;  4L9J A;  3NEU A;  1YW8 A;  4IVN A;  1TW2 A;  4MNU A;  1AOY A;  3G3Z A;  1ZAO A;  1G3S A;  2D1H A;  3HOT A;  2L02 A;  4OIO F;  4AWX B;  4NHJ A;  2OA4 A;  2KRF A;  3KP5 A;  3KZZ A;  2G7U A;  2HR3 A;  5H6Q A;  4H0E A;  3CO7 C;  3KP3 A;  4S05 A;  1D8J A;  1U2W A;  5LGT A;  1O57 A;  1IF1 A;  1LEB A;  2LF7 A;  2E1N A;  3F8M A;  3F22 A;  2F5F A;  4Y13 A;  1FSE A;  1HKS A;  2P6T A;  4M9X A;  3TGN A;  2P5L C;  4ESJ A;  2BGC A;  2Z3Y A;  4CGZ A;  3J80 Z;  4HX8 A;  4GO1 A;  5D8L B;  4Q4Z F;  2HOE A;  4AD9 A;  3WTU C;  5CVR A;  1B6A A;  3F6V A;  3COA C;  3DPL C;  3HUG A;  4HAM A;  3TQN A;  2O6G E;  3ZN1 A;  1BI0 A;  1U6G A;  1QBJ A;  1FX7 A;  5ICE A;  3JTG A;  1UST A;  4M6X A;  1FWZ A;  5ICG A;  3FZV A;  4OMY A;  4ENK A;  5FD6 A;  5HDG A;  1S7O A;  1RUN A;  4L0Z B;  3KLN A;  3NQO A;  4GCV A;  2PBI A;  1MKM A;  3KEO A;  2FXA A;  2YX4 A;  1Q1H A;  2FBI A;  1Z6R A;  1ON1 A;  5BPD A;  1CF7 B;  4M71 A;  1O3S A;  4IF4 A;  2PN6 A;  1KU2 A;  4BHB A;  3F21 A;  3N4M A;  5BOX A;  4GGG A;  3KP6 A;  2E1C A;  1RIO H;  4KA4 A;  2PFB A;  1Y0U A;  1DDN A;  4UUV A;  5IT9 Z;  2RC4 A;  3EYY A;  2ETH A;  1OYI A;  1R36 A;  2B0L A;  3LAJ A;  2HYG D;  2XKO A;  4EVI A;  2EV6 A;  4HX7 A;  3VEP A;  1OYY A;  4JK1 X;  4KT5 C;  1W5S A;  3QRF F;  5D5W B;  2HYF A;  3KP7 A;  1IN8 A;  2HTS A;  3K1N A;  3E6C C;  1MJB A;  5EEG A;  4MEY F;  1W7P A;  4ZYD A;  5HDK A;  3FF5 A;  4UVC A;  4OOI A;  4LJZ F;  4ASN A;  1MJ9 A;  2VOD A;  4IRG A;  2QVO A;  2IP2 A;  3E6D A;  4XSX F;  2QYO A;  5D8K B;  1G3T A;  4QLC U;  1DUX C;  1TQM A;  3S2W A;  1P4A A;  3T8R A;  1Z91 A;  3ELK A;  4LFU A;  4KDP A;  4HF0 A;  3V7S A;  1R1V A;  2R3S A;  5ICF A;  4B09 A;  3U9G A;  1RUO A;  4LGW A;  5CVU A;  2L01 A;  1B9M A;  3T5X A;  1S6L A;  5FB2 A;  1JXS A;  3J81 K;  3N97 A;  5D5U B;  4WK8 F;  1P92 A;  2RN7 A;  1XD7 A;  3WTZ A;  1MDM B;  1R5G A;  2OAZ A;  3HSE A;  3QAH A;  6PAX A;  2LNB A;  2QZ8 A;  4HV6 A;  3WGI A;  4HQM A;  3RIR A;  1DPR A;  2PJP A;  5L3C A;  1JHH A;  1CGP A;  2CG4 A;  4WXD A;  2VN2 A;  4UVA A;  1YFH A;  2O3F A;  4YIF A;  3K2Z A;  1P4W A;  3GO5 A;  3ZMT A;  1G6N A;  4RGU A;  5TJJ A;  3V4G A;  4PCQ A;  1GHC A;  2QEN A;  2KJC A;  2LSO A;  1HW1 A;  4A6D A;  1IN5 A;  1BJA A;  2ZXJ A;  4UHT A;  4LG0 A;  1HKQ A;  5LBQ A;  4G8X A;  3GFL A;  2XAS A;  3CTA A;  3CJN A;  4LMY A;  4LLL A;  1ZHF A;  4EMS A;  3I59 B;  3K0L A;  3TOA A;  2KIF A;  5HS8 A;  4A5M A;  1RZ4 A;  4G7O F;  4XLP F;  3I58 A;  1IAW A;  2K7L A;  2MLK A;  5J8F A;  3ZP5 A;  3RI4 A;  4EV0 A;  1H9G A;  2BV6 A;  4WXC A;  3GEZ A;  3PQJ A;  2P5V A;  2COM A;  3GFJ A;  3HSR A;  4LK0 F;  4RB2 C;  4FHT A;  3ISP A;  4EJW A;  2A69 F;  1J0R A;  2YU3 A;  2EA2 A;  4NQW A;  2W25 A;  2QQB A;  1OMI A;  1ZH5 A;  3REO A;  5AIQ A;  1BI1 A;  2VE9 A;  2IPQ X;  2Y75 A;  3TDZ C;  1KU3 A;  4F7Z A;  2L4A A;  1XSD A;  1R58 A;  2HTJ A;  3CO6 C;  2A07 F;  2STW A;  1MGT A;  3VOE A;  3JAM K;  5FO5 A;  2NNY A;  2CGP A;  2NAZ A;  4KMF A;  2AS5 F;  3GFM A;  2DPU A;  4HW0 A;  1TNT A;  1B4A A;  4BHC A;  4U7B A;  1BBY A;  2K4B A;  2D2W A;  1GVJ A;  2GA1 A;  4KUM A;  3QP5 A;  1I6X A;  1XGN A;  1T39 A;  3JAM Z;  3CUQ A;  3R0A A;  4JBA A;  5E8G A;  5IT3 A;  5K5R A;  3DKW A;  2F5E A;  2ACJ A;  4L5J A;  2RGV A;  3RYR A;  3I54 A;  2IJL A;  3SQN A;  1B59 A;  3W6K B;  1XDS A;  1F1Z A;  3R0J A;  4HF2 A;  3GWZ A;  1OKR A;  2HKX A;  3MCZ A;  4JQF A;  3GYH X;  5F64 A;  2FF4 A;  1I1S A;  3LA7 A;  1R5H A;  3BPV A;  2H27 A;  4KIF A;  2AXL A;  1EV7 A;  4O6J A;  5JVT A;  5ILU A;  1YG2 A;  5H6R A;  2YR2 A;  4ON0 A;  2XHK A;  4I98 B;  2RQP A;  5A2Q Z;  3HRU A;  1QQI A;  3GUD A;  3QOP A;  3BP8 A;  2VC1 A;  4A0X A;  2HZT A;  3ZMZ A;  3LA3 A;  4P5O A;  3G73 A;  4MTD A;  3IHU A;  2ZO4 A;  5J6X A;  5ED4 A;  3Q5F A;  2EA4 A;  3P9I A;  3I64 A;  3J7A O;  2IA2 A;  3R61 A;  2LDU A;  1D5V A;  2EV0 A;  4HZF A;  2VBZ A;  1FOK A;  3I0T A;  2K02 A;  3HHG A;  5BQT A;  3GLX A;  3IC7 A;  1GXQ A;  1W5T A;  2XAG A;  3CUQ C;  1JGS A;  4IJA A;  1LVA A;  4WX9 A;  4MQ9 F;  2GWR A;  1K6O A;  4BH9 A;  2HFH A;  2MBF A;  3L7W A;  3TDU C;  1R1U A;  5ILS A;  2PQ8 A;  2DK5 A;  3GZ6 A;  1YW7 A;  3CLO A;  5ILV A;  2FQ3 A;  4FX4 A;  2UWM A;  1O7F A;  1F5T A;  3RJP A;  2Y48 A;  2ZNZ A;  2V6C A;  1ZRD A;  1ODD A;  3V8L A;  3RKY A;  5K5O A;  5LEJ A;  3DXJ F;  3T1B A;  3FXR A;  5LEK A;  2HKO A;  2EWN A;  1STZ A;  2Q0O A;  4HDU A;  1A04 A;  2E7W A;  2MA3 A;  2OQR A;  3ZMV A;  1T0F A;  2DI3 A;  4YII A;  2J5P A;  4G7H F;  4LK1 F;  1KQ9 A;  2RV8 A;  1T98 A;  4QWQ A;  1K78 B;  2WC2 A;  4YFN F;  2P8T A;  1R22 A;  3O6B B;  4EM0 B;  1X3U A;  2MH2 A;  5EEH A;  5BS6 A;  4UNO A;  4ETS A;  1I1G A;  3VOD A;  2ESH A;  3GZ5 A;  3D5L A;  4O5V A;  3W6J B;  1Z7U A;  4P9U A;  1WSU A;  4IHS A;  2W85 A;  4E70 A;  1QNT A;  2HEO A;  1LDK B;  3DF8 A;  2ZME B;  1B1B A;  5K5Q A;  4KNY A;  4RGS A;  3SXY A;  4MGR A;  5D5X B;  1CF7 A;  4WCG A;  4YFX F;  5AIP A;  2H6C A;  3CUO A;  1LDD A;  4M72 A;  3WOD F;  4ZYH A;  5BPI A;  2VOO A;  4CYD A;  1P4X A;  4OIQ F;  2DPD A;  2IA1 A;  3QU3 A;  3C3W A;  2CFX A;  5TRD A;  3L00 A;  4L5I A;  5F6F A;  5DUI A;  1YQA A;  2FSW A;  3ECO A;  4AVP A;  2RNJ A;  3GVA A;  2Q2E A;  5E17 F;  1KYZ A;  1FZP B;  4GYI A;  2NRA C;  3BJO A;  1J2X A;  4I2O A;  2VOP A;  4MQV A;  5L3B A;  3R60 A;  4A5N A;  2MD5 A;  1JE8 A;  5CVJ A;  3FM3 A;  4A0Y A;  3WTX C;  4I02 A;  1WRJ A;  1IUY A;  1J7K A;  4OMZ A;  4BHP A;  1P2F A;  2M8E A;  2Z5U A;  3K69 A;  3OV8 A;  2VBW A;  4GXO A;  1Z1D A;  4WXH A;  1FBQ A;  3QU6 A;  1XGM A;  4XRF A;  4I01 A;  2A5Y B;  2G7H A;  1IN6 A;  5LGU A;  1IXS B;  4EM1 A;  2DAO A;  1E17 A;  2MLG A;  4Y15 A;  3H3U A;  2FU4 A;  1REP C;  4XSZ F;  1J5Y A;  4G6Q A;  3LA2 A;  5E1X A;  2G9W A;  4CZZ A;  3LAP A;  1ZRC A;  4U0W A;  1FYL A;  4LB6 B;  3RKX A;  3GXO A;  4NB5 A;  5L3G A;  2P4W A;  1MDM A;  2XUB A;  4IRI A;  1HW5 A;  3ZMD A;  4KIC A;  4A2U A;  4R79 A;  2F2E A;  2O03 A;  2KJB A;  4HDV A;  2QBY B;  2JT1 A;  1TLH B;  4LLG F;  1F4K A;  4L9T A;  4N9H A;  1ON2 A;  1KYW A;  3FMR A;  4RB3 C;  2OQG A;  2BE5 F;  5JR3 A;  1H0M A;  2WWY A;  3RDI A;  4EM2 A;  4HV5 A;  1U3E M;  2DLL A;  5AON A;  5K1Y A;  2GIV A;  4IPA A;  2KIM A;  4M74 A;  5DCM B;  1FP2 A;  2OBP A;  4BQA A;  5DUK A;  3J81 Z;  3SZP A;  2XKP A;  3I4P A;  2EFW A;  2DTR A;  2RDP A;  4KYW A;  2EV5 A;  3I59 A;  5KVR A;  4BAY A;  4KMU X;  2YPR A;  2K27 A;  4EJO A;  3TOB A;  3BJA A;  1KU9 A;  5D6F A;  1YTY A;  5E18 F;  1J75 A;  2RKH A;  5FLX K;  4P96 A;  2Q8K A;  3F8C A;  4Y17 A;  3HOS A;  2E7X A;  4XBF A;  2ZBK A;  4UV8 A;  5D6E A;  1HXD A;  1WWX A;  1QPM A;  4G6D A;  2IW5 A;  5HLH A;  2EJR A;  4BNC A;  3LQQ A;  2EFQ A;  2MH9 A;  2GXG A;  1XSX A;  4AIK A;  1IXR C;  2FMY A;  4CDG A;  1XMK A;  3Q9V A;  3D0S A;  2A6E F;  2CQK A;  1ZN2 A;  2JPC A;  3DFG A;  2PMH A;  5FD5 A;  1SD5 A;  1FBU A;  2M87 A;  3JSO A;  2ESN A;  1HQC A;  5CVI A;  2PG4 A;  4G7Z F;  1QZZ A;  2K86 A;  2ZCW A;  1G3W A;  1UHM A;  3P9C A;  4B8X A;  1O3Q A;  1IN7 A;  1BI2 A;  1WQ2 A;  3E5X A;  2QQA A;  4Q47 A;  1MJA A;  5E8I A;  1LJ9 A;  3NRV A;  3WTV C;  5HOO A;  2TDX A;  5DCF A;  4A12 A;  1KA8 A;  4S04 A;  1K79 A;  3ROU A;  2QLZ A;  3M7G A;  2VT3 A;  2VXZ A;  4EJT A;  3KP2 A;  1UB9 A;  1XSV A;  2V1D A;  2IA0 A;  1Z6T A;  3LST A;  2XVC A;  4PZJ A;  2M5W A;  3E3V A;  2X4H A;  4IHT A;  3VB2 A;  3BOQ A;  3VFZ A;  4HLX A;  2GA2 A;  3C1D A;  4EQQ A;  3ULQ B;  3HYI A;  3M1E A;  3K9T A;  2GZW A;  3ML6 A;  1V4R A;  1R23 A;  5E20 A;  3EDP A;  3CDH A;  1ZGJ A;  2FEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...