3ZCOA

Crystal structure of s. cerevisiae sir3 c-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
ETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords REGULATORY PROTEIN SIR3
publication title Dimerization of Sir3 Via its C-Terminal Winged Helix Domain is Essential for Yeast Heterochromatin Formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 36
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zcoA00
3ZCOA
chains in the Genus database with same CATH superfamily
2Z99A 4AIKA 2F5DA 3G2BA 5M3FJ 2HYJA 3LMMA 2KRCA 2QENA 3O8HA 3E7LA 1A6QA 3I59B 1HLVA 3UR3C 1KA8A 2K9LA 4CH7A 1RR8C 2GOMA 3IWFA 2GBYA 2JT1A 1WQ2A 5HDGA 3A01B 3I0TA 3CCSI 1IJWC 3SEZA 2XSDC 2XAGA 2V1DA 3SXYA 4E6KG 2PMUA 1R9TJ 3DLLF 2QYOA 3WHCA 4A3KJ 3AG1H 2PBIA 4G6DA 1DQUA 3P7NA 3TEDA 4J19A 1L3LA 4RGUA 4XONA 2RREA 1Z6RA 2KL4A 3HTSB 1T56A 1YJWI 2R5YA 3RYPA 2OJED 1YRNB 2VE8A 3W6JB 3F8NA 4M6XA 4LB6B 1XGMA 2CQKA 2KIFA 1LDKB 3HRMA 1F4KA 3CD6I 2HFHA 2BV6A 1IF1A 4Y7NJ 4MIMA 3WTZA 1GXPA 1PUFA 1I50J 2JTVA 1R5GA 1SFUA 4IHYA 2CUEA 5CQEA 4DYCA 1K79A 3RQIA 1AWCA 4JQFA 2DO7A 5DCMB 2K5CA 1RRJA 2CUFA 3MFKA 4Y3OA 1PYVA 2LP0A 2OAZA 1MJBA 5LD2C 3S1RJ 1ETKA 5B66C 3Q9VA 5HLGA 4ZYDA 2L9VA 2XVCA 1E17A 2V79A 4ESJA 2LKXA 2I8DA 2CO5A 1LPQA 1MZBA 4XIDA 2ELJA 2A5YB 2ZSIB 4A3CJ 2X85A 5EG0B 2M7BA 2BW3A 1I6XA 4M3FA 2MLGA 1MMDA 5LFAA 1HC8A 3G71I 2DYRH 2NS8A 2NVQJ 1UFMA 3ZMUA 4HSRA 4M3BA 4A0YA 5LLQA 4A3JJ 2E2HJ 1U5TB 3S1QJ 2QWWA 5EEGA 2CRGA 4I09A 5GTHC 2D5VA 1J7KA 1A36A 3QPSA 1LFBA 4ETSA 3ZP5A 2X51A 3F0CA 2DT5A 3RI4A 3ABTA 2DXIA 2CW0F 4RBOA 2X6OA 3MKZA 3KIOA 4IHWA 5F1RA 3JTHA 4LIUA 4J00A 3OYCA 1NG7A 3S93A 2Y0SN 3BR0A 5CJ9A 2HVRA 3ERED 1S7EA 4CGZA 3ZQ7A 3PFYA 1ITYA 1HDDC 1TQMA 2P81A 5JLXA 5GPAA 4EJUA 1FX7A 2JRTA 2K02A 1Z91A 3RDIA 3JRDA 1WH5A 1TW3A 2EIKH 1G8XA 2O61A 4JOMA 4E7JA 4RGSA 1TWGJ 4DQ2A 3WGGA 5HOOA 3ZRGA 2ADUA 2KJCA 3TO7A 1MKMA 4MO7A 1BR4A 1P2FA 5E8IA 2Y9ZA 2HKXA 2DQLA 4RLFA 4HNTA 3HB9A 1D8KA 1KU3A 1UHWA 3PSFA 1JUPA 3FMQA 2DT6A 4LJZF 3EETA 5IP7J 3ASNH 1N75A 1Z1DA 2IGOA 2KMUA 2QEXI 2ZJQF 1YIOA 4Y17A 1YW7A 3SZGA 3BZCA 4C30A 1MBFA 1IV8A 1BOBA 4U0YA 2BEOA 4A5MA 4A3MJ 4ZDPA 3CC2I 4O5VA 2CGPA 2VXDA 5EGOB 1KZHA 3ZQHA 3GTMJ 4XLEA 2F4OB 3OSGA 2X4HA 2BHYA 5DCFA 4BGDA 2KZVA 3LL7A 4XRFA 1TP4A 5FFZA 4E4HA 3FX3A 2HOEA 3SEQA 2R7XA 2ZJ2A 4AIJA 3FWEA 2HQNA 5ICCA 1D8JA 3OIPA 3FM3A 2PFBA 1KYWA 3R4KA 3CCYA 4RAYA 1O4XA 2H6CA 4AIDA 3LAPA 3DP7A 2G0EA 4IVNA 2IA2A 4A12A 2W4SA 3HRSA 4KISA 1F43A 1E3PA 5F04A 3ABKH 4Q4ZF 4EVIA 1WJAA 4Z2YA 1A35A 2ME6A 2VONA 2GQQA 4GYGA 1EA3A 1N25A 3IUOA 4D5FA 5K7HA 3WG9A 2PJPA 2MSYA 3QP6A 4XNFA 2D2WA 4M72A 5E1WA 2EK5A 3I3LA 4QTRA 4CZZA 2ZCWA 4NBQA 4MFEA 4BQNA 3BTLA 4D0PA 4N0BA 3WG7H 1T38A 2DI3A 4JX5A 2ECBA 3R60A 2UV1A 1OR7C 4BXUA 2NVTJ 2Z1DA 4IX7A 3S1NJ 2F4MB 2IVMA 3GX4X 3CDIA 5HDKA 3K0LA 4X0GA 1AKHA 4UUSA 1S8NA 3NAUA 4PK4A 2BVLA 3ML6A 2QZ8A 2VJ4A 4KITB 3H5AA 4RGXA 4JYKA 2GZWA 3ZGKA 4NDLA 3VB2A 4HDUA 5FKKA 3DV8A 2IT0A 4S05A 4E7SA 4PGHA 2R7DA 1DPRA 2LKSA 3DTKA 4DW6A 4U7BA 3QPTA 2V1XA 4RM3A 2EFPA 1TWHJ 4OOIA 3WE2A 1K4TA 3KE2A 2H8RA 2K3PA 1B9NA 3CTAA 4C2UA 3CMEI 2XSJC 3GXOA 3WGIA 1VF9A 2IPQX 2LRDA 3HRUA 1G3SA 1FP2A 5J3LA 2R7ZJ 4E7KA 2HTJA 2CV1A 4XN3A 2DFFA 2JVHA 3BG7A 2ECCA 1WJ5A 2UUZA 2VBZA 5BPDA 1MGTA 3W2AA 4QIWN 5JI6A 2P0WA 1T95A 1MMGA 5TJJA 3GZ5A 2NRAC 4G6QA 3MAJA 4LK1F 1TWAJ 2Y69H 3OYIA 2VQGA 1VQ7I 4HG2A 1F5TA 1QBJA 1UB9A 2X1CA 1ETWA 4IKFA 3J80K 1BOAA 1WJBA 2UZKA 1DUXC 5HS9A 1XGNA 1ON1A 2L4AA 3FXUA 2L54A 4MGRA 3S16J 3KZYA 2GXBA 4FTHA 5JVGF 3CUQA 2OCEA 1JHFA 1TWCJ 3GVAA 1EKEA 4BL0B 1MMAA 4A69C 3N4MA 2OZUA 2A68F 1TNSA 1KU2A 5J40A 3F6VA 3CCUI 3SDBA 4B3AA 5B1BH 5L3GA 2VJIA 2WY8Q 5AONA 4A3BJ 1HOMA 4AD9A 2L7MP 3D5RC 1BR1A 4Y4RA 4YELA 1FIPA 1EH8A 1ZN2A 2XF5A 2O6GE 5L3DA 4EEFG 2WWYA 2E7WA 1O3RA 4C2TA 5LBQA 1RIOH 1JHHA 4XKCA 1B8IB 1UJ8A 4OIQF 1E0EA 3HOZJ 1Z0XA 2P8TA 1R49A 4ZYHA 3B02A 2XV4S 2PJRB 5BQTA 4GFBA 2E71A 4G7OF 1ZLKA 4CCJA 1P7JA 3B6AA 3QPHA 3C2GA 5IT3A 1K6OA 1H8AC 1FTTA 2L9RA 1PUEE 1SVLA 1W4MA 3ECHA 1GXQA 3OYKA 4EV0A 2BHZA 2L5QA 1B72A 3TO9A 4ASNA 4EM2A 1CGPA 4DYQA 2KDZA 3BTJA 1USSA 5J1UA 1XCBA 2PG4A 3FZVA 1Z3XA 2YU9J 2VQLA 3CO7C 3HKZN 4HQMA 3HZJA 2L0KA 1X3WB 2P5LC 4M73A 1BI3A 2K40A 3P9CA 3S3OA 3HUGB 2FOWA 4BQAA 2K9SA 1R1TA 1IV6A 3E1SA 5F0CA 1YE9A 3HHGA 1U8BA 5E3LA 4LG0B 1SD7A 4LFUA 2YSRA 3F8FA 1MBHA 1S7OA 2LREA 3BG9A 3P5JA 4ESBA 1I1SA 4A3LJ 3QRFF 2M5WA 3OYGA 1RESA 1WSUA 4A2UA 5D5WB 3OYLA 1OMIA 1LE8A 4HOBA 2PN6A 1H88C 5EJCA 1ZQ3P 3VFZA 4G94A 2R7TA 1KGSA 3DTEA 5E20A 2PMZA 3J7AY 3OR1C 2NS7A 1WWXA 2DTRA 3GLXA 4CXFA 2MABA 1BC8C 2CW7A 3J7AO 5J8FA 3HHHA 3OYMA 1LEAA 1P4WA 3JW4A 4RM2A 1IUFA 3Q0VA 3H3ZA 2M4KA 1JXSA 2XRLA 2F48A 2K86A 3G4SI 2QUFA 2HU9A 4HW0A 3CO6C 3ZMVA 1RUNA 2IS4A 2ZBKA 3Q5FA 1BL0A 4CCLA 2VI6A 2V1UA 1MBKA 1RI7A 5IOYA 3Q0WA 4XLFA 2LNBA 3N05A 4AWXB 2OV7A 4Z6YA 1D0ZA 1D1BA 2FOKA 1GHCA 1F36A 3K10A 1IW7F 3I55I 4ZC3A 3PNYA 3E6CC 2AO9A 2KQRA 4R1HA 2Y75A 5FD5A 3FHZA 5JHUA 1XDSA 2LSOA 5CYVA 1B6AA 1WPKA 2LLKA 2Z33A 4ZZDA 3DBRB 2ELKA 3HTUA 4A3GJ 4NHJA 5FGMA 2ME0A 1EH7A 2ZXIA 2AQFA 1KQ9A 2N8GA 1FLIA 3G1MA 1MIJA 1LQ1A 1VZ0A 3QOPA 4OWRB 5J1RA 2WAEA 3ONQA 3KFWX 4N9HA 5FLXZ 2NYXA 2L01A 1IDYA 5KCMA 4GYIA 5KVRA 4EJTA 3LNQA 3FBNB 2G7HA 3GMEA 1MD0A 1WFXA 1QZYA 4XKVA 1TBXA 1T8IA 2OU2A 2O03A 4HNVA 3PO3J 3E6DA 4KUMA 3KYLA 3ZOBA 2FEZA 4L5IA 5K5QA 1X19A 2NNNA 3H3UA 4EQQA 4LITA 1OPCA 1WJCA 1P4AA 3QU3A 3B73A 1T6SA 2HQ5A 4RAFA 3VPRA 1T0FC 1K6YA 1MJ9A 1UZCA 2DLLA 1NHAA 4LGWA 3GEZA 4BH9A 2DDBA 2VKEA 1X2NA 1Y1WJ 2B7EA 1D5VA 3RZOJ 2IS1A 3L00A 4JK1X 2GWRA 3LFKA 4PDKA 2KFDA 1SMYF 4P5OA 4Y15A 3TP3A 4EJOA 2CV0A 1DGRM 2FQ4A 3LA2A 4XRSG 3CJRB 2XAJA 2OUMA 2QQ8A 5BNGA 5JHFA 2LDUA 1XMXA 2P7VB 2IGKA 4EATA 5E3MA 3JREA 4DYRA 3C18A 4YFNF 1R71A 4I76A 3NWTA 3PL8A 2QBYB 1ZLJA 2JA6J 2MC3A 2ESHA 4BDYA 1VQ4I 2VQCA 3OS2A 3M8FA 2DN0A 2ISZA 2VODA 3CF5F 4JX6A 1EJ9A 1HDPA 4BJTA 2O7OA 2JMWA 1U8RA 1R36A 2K4JA 5TRDA 2X1DA 3VYUB 4L0YB 1FBQA 5FFXA 4G7HF 1G4DA 2B63J 4WX9A 1D0XA 2WBMA 1QVUA 2P5KA 1QHHD 1RZ4A 3WU1B 1TWFJ 2HKOA 2XROA 5E1XA 3U1KA 1FSHA 1R5ID 4ON0A 1Z7LA 2IAIA 1G3YA 2ZB9A 2CS3A 5FKLA 3I5UA 5LGNA 1FNNA 4CYDA 3BY6A 4UVCA 3AAFA 4GDFA 1YG2A 5K5RA 3PIOF 3F8CA 1QO0D 2ZJPF 2ZXJA 1SD6A 2R7FA 2EV0A 3M8EA 2EB7A 2FRHA 2NXNB 3FXJA 2DAOA 2Z5UA 1Z05A 1C0WA 3VYTB 3DU6A 1Y39A 3QYEA 2A5WA 1U5TC 1HBXG 5CVVA 5GAEJ 3KCCA 2EZIA 3A03A 3VOEA 1FYMA 3MMYB 5DTDA 4II3A 1JKOC 4HF1A 3K4MA 5IT9Z 1JT6A 1LDJA 1YITI 5H20A 2CYYA 3H0DA 4EMSA 3K1PA 4D9JA 3I54A 2Y48A 3DU5A 4XOPA 3J7YJ 3WTTC 1RNLA 3HPHA 4FISA 1YOVB 1POGA 4ZH4F 4UUSB 3WTYC 5BS6A 1FYLA 2EQRA 4DZPA 2M7AA 3ERMA 4I99C 3BPXA 4EGZA 1J2XA 5FKMA 1JKQC 1JGGA 1DDNA 1TW2A 5HVQC 2MW8A 2M45A 2VOOA 4UV8A 2F5FA 2CUZA 4GO1A 3AG2H 4BHPA 1X1AA 1ZR2A 1APLC 2JZYA 2X48A 1J59A 3I71A 2VC0A 2VIXA 5LGUA 3GO5A 4M3EA 1IRZA 3A0HC 1BBYA 2Y30A 2Z16A 1IRXA 3RCOA 4U88A 3OSFA 2IXSA 1U2WA 3M4OJ 1SFKA 3EUAA 5F64A 1EF4A 3HOSA 4NC8A 4HPQA 2GA1A 2OA4A 2YR2A 1IN5A 2HR3A 2KIQA 3E6MA 3OYAA 3KZIC 1SD5A 1Y56A 3NRVA 3O3KA 2WAQA 4FX4A 2HPIA 2Z2SB 2K3FA 3GTJJ 2R5ZB 1YTYA 4OAZA 1OR7A 2RVCA 2WY7Q 3S2DJ 1AA7A 3CLOA 2E35A 3ASOH 4AU7A 4YIRX 3L7WA 1GV2A 2ID3A 4AUXA 3S1MJ 3LWFA 1S6LA 1YS7A 4DNCA 2W1OA 3CMYA 1X1BA 3JTGA 1TZLA 4C3HJ 3S3MA 1SFXA 5JFRA 4M9SA 2LKPA 3CQZJ 3DWLE 2L02A 1VQ6I 2YX7A 5KHDA 1ZKGA 3T0YA 3CESA 4HYEA 3PJRA 1WZ2A 3ZMTA 3MEXA 2F5CA 2JSCA 3KP3A 5CVUA 2KKOA 3D1NI 2O8KA 1JGSA 1I3AA 2ZMEC 4A3IJ 2CU7A 2X0LA 3MVPA 2DYSH 2R93J 3W6VA 3IH4A 4AIHA 1T39A 1BI0A 4GGGA 4KT5C 3VODA 3OR2C 1JKRC 1ZAOA 2E1MB 3K4LA 1D0YA 1ZGAA 2GOXB 1LVKA 1UHSA 1QPMA 2HOTA 2HXIA 5DDGA 3A4CA 2M34A 5KNLA 2XIGA 2XASA 5IT9K 3F6OA 2DFHA 2GXAA 2Q2EB 1OISA 3GZNB 3CCJI 4Y52J 4XRSA 1X3UA 3VSLA 1ETVA 1ETOA 3H5RA 4GXOA 1XDUA 3CDHA 4A3FJ 1IGNA 1SD4A 2DMTA 1Q1VA 2LH9A 3BQYA 5EEHA 3VYRB 3H1CA 3RPUD 5FJ8J 4E7IA 2WV1A 4M71A 5D5XB 1J09A 4KNYA 2ID6A 2Q0OA 5F27A 2WC2A 4BACA 4HX4A 4WF2A 3MZHA 2M30A 4CYCA 4BE1A 1D1CA 2BY3A 2R7WA 4HZFA 4A5NA 3KEYA 2RQPA 3M07A 2RNGA 3RTRA 3GF2A 1MDMA 3TOBA 2EIJH 1OCTC 4QSHA 3DEEA 4L9VA 1I27A 4H4KC 5D4RA 1JJ6C 4M3GA 3I4PA 4EM0B 1WJDA 4HV5A 3HSEA 2DU9A 2JQ7A 4II2A 2HWVA 3GTQJ 1WHUA 3WTVC 3RKXA 3OIQA 4XMYA 3T1BA 3ZQFA 4F92B 4BHCA 3VWBA 1S72I 1KQ8A 5J6XA 3K4NA 1MNDA 4IQ4A 1WI9A 2ZO4A 2A6TA 1DP7P 3J81K 4XK4A 3U2RA 3C2HA 3BCBA 1VI0A 4NQWA 1K78A 2HVQA 4ENJA 3PQKA 2TDXA 4XM3A 3SFIA 4XLHA 2EFWA 1ON2A 1S3JA 3GLLA 1B59A 2A6EF 1BIAA 2VXZA 4CDGA 5HS7A 2STTA 4PUSA 3BR2A 1W36C 2L9SA 1TTYA 3FXQA 1W36D 2LC2A 3CCLI 3OIOA 3ZQGA 5EYRA 2WB1A 2EILH 4BS9A 3GYHX 1CF7A 3F3XA 4UHTA 2GLOA 2ACJA 3TP0A 1TL8A 3I9V2 3AG3H 3K1NA 4CCOA 2A61A 5H6RA 3KP6A 4OAYA 3HOVJ 2STWA 3K2AA 2L4MA 2DOAA 3FXOA 2JA5J 4MQ9F 2J5OA 4BEHB 3CLQA 3LFUA 1LFPA 3S15J 5LHHA 4JP0A 3ZQQA 1OLTA 4IRHA 1L0OC 1MJAA 2BY1A 5GP9A 3JAMK 3IH3A 4FE4A 5LRRA 1Q1HA 1BJAA 2ZMEB 4B1RA 1I1GA 3E0JB 1XN7A 3G3ZA 1IZ1A 2H94A 2LY9A 4YG2F 4MNUA 4CSWA 3HEFA 2MA3A 2LD5A 1LEBA 3LSIA 3K4JA 1BJZA 3QP5A 4WXHA 1BC7C 2RQQA 1FJLA 2VASA 3B6CA 5IYBJ 5J4VA 3J80Z 3KLNA 1N78A 2QM3A 2YS9A 2HOAA 4NUBA 3QODA 4XN0A 4F3QA 4LK0F 4F93B 2LBFB 5DD8A 2I5UA 4ENKA 5HLIA 4BAYA 5IY5H 2K9QA 4KIGA 2DQRA 2R7RA 2F2EA 4WK8F 4E7HA 1FOXA 3D5SC 1NG6A 3SFZA 1Y1VJ 3BR3A 2RN7A 3HIFA 2UXXA 2WV0A 3C3WA 3MKYB 1Y6IA 2K7LA 1I6HJ 2VKVA 4PJNA 5E79C 1OKRA 3K70C 4IOAF 3ZN1A 4CZCA 2YU3A 1ZHFA 2COMA 1IG7A 2MG4A 2RAEA 3L2RA 2VOPA 4IRIA 2X6YA 2UWMA 2XUBA 2PMZN 2NNYA 5IPAA 3TW7A 3S14J 3M8JA 1DU0A 2PI0A 3PO2J 4BE2A 3NARA 4G7ZF 1MSFC 2V9VA 4CCMA 4OINF 3OYHA 4V19K 4IRGA 5F08A 2CQNA 3DEUA 3MZ8A 2VKHA 2B0LA 5J8CA 2L7ZA 3HOWJ 4FX0A 3HDDA 2VPRA 4KIBA 3CP2A 2JSPA 3SJMA 1SFEA 5M3MJ 2X6WA 2P5VA 2ISYA 4HA8A 2V7FA 4QPOA 3EQLF 4B09A 2XGCA 5D8KB 2FU4A 1UAAA 1O57A 4BDZA 3I59A 2JPCA 3TO6A 2W85A 3BWGA 1T0FA 1WGXA 4BHBA 2EFNA 3ABUA 2V9KA 3V7RA 3PNTA 1IRGA 3A01A 1R23A 1ZTRA 1P4XA 3CDLA 3FDYA 4C3IJ 5B1AH 2AS5F 2O8XA 2OTJI 3M7GA 2M0MA 1W5CC 4M3DA 3GZ6A 1FOWA 3HC7A 2E7XA 4JBAA 2EA2A 1RR7A 1Y8QB 1P6RA 1YQAA 3DBHB 1FMVA 2CJJA 2OQRA 2DMUA 4RAGA 3OY9A 5AIPA 2EBIA 2HS5A 1YLFA 2ESNA 5HS8A 4XICA 2L7KA 1KU7A 2C6YA 2JK3A 2XAFA 3LSTA 1YRNA 2KIMA 1YIJI 2HEOA 3MWMA 5C44J 3FKJA 2XAQA 4F7ZA 1ENHA 1QNTA 2L9NA 2DMQA 2XB5A 5D5UB 1MH3A 4Q47A 2BZTA 3SZTA 3ROUA 4HF0A 3HGGA 4XKWA 4I01A 2W82A 1TT5B 1UELB 2HVSA 1KU9A 2K85A 3TBIA 1ZG5A 1IN6A 2IEKA 5HLTA 3JSPA 1TC3C 5DCMA 1Y0UA 2W48A 2DBBA 4U0VA 2H27A 4I2OA 1W7PB 3BZ6A 5LHIA 1FSEA 2EA4A 2KRFA 4HAMA 4RS8A 1W0UA 5FLMJ 2HXOA 4BYYA 2MBFA 3S17J 1S29A 3ZMZA 3MKWB 3F23A 4WXCA 1P9QC 3OMYA 1R4NB 1OCOH 4A0XA 2HNHA 3QWLA 1YW9A 3WTWC 1ZR4A 1JT0A 1GDTA 2GA2A 5FKOA 1TNTA 1R00A 5J47A 3CCMI 3E3VA 1VNDA 4D1QA 1R1UA 2EH3A 1FC3A 3QAHA 3UNGC 2DA2A 2GM4A 2FE3A 2O3FA 4NC6A 5EG0A 1ODDA 3RPQA 2HGCA 4WCGA 1E3HA 2WAFA 3H9JA 3OS0A 3LOCA 4B47A 5E17F 4XLCA 1HF0A 3O8GA 3QOEA 2WADA 3DCFA 3FK6A 3U1DA 5ICFA 1FP1D 5ILSA 1E3OC 1U5TA 2QLZA 5B5EC 1PDNC 3GFJA 3F9KA 3IRRA 1JJ8C 2M8EA 2OC6A 4QLCU 5C3EJ 4UNOA 4HX8A 3REOA 3HOTA 1TQIA 2QF7A 4MEYF 1SMTA 1GT0C 3OL3A 1VTNC 2O0YA 3TGNA 1ZRFA 4JX4A 2R5YB 4FCYA 2AHQA 1LDDA 1V5FA 1WJFA 2DMPA 4A0ZA 3A2KA 2M8GX 1BA5A 3IL2A 3QQAA 5D4SA 1J0RA 1Z21A 2G7UA 1GV5A 2R7SA 4QPQA 3TKYA 4OIOF 3RYRA 5EZHA 3V42A 3C2BA 3DBLB 1PUFB 1RETA 1XGSA 2E19A 2IP2A 1FYKA 5M5XJ 4CCNA 3PFIA 2EZHA 4WWCA 2AXLA 2K4BA 3I53A 2HZDA 4R8HA 2QGUA 4D7MA 5EEAA 3JRBA 1YI2I 1LVAA 4AYBA 4G9YA 3V4GA 3MN2A 2DFEA 2FA5A 1V4RA 4X1EA 2CV2A 3L2CA 3C1DA 3FBIB 4YFKF 3HGYA 3KP4A 1O7FA 2L2OA 3DKYA 1H0MA 4U7DA 4BE0A 4RAZA 1LJ9A 1WH7A 3HOUJ 2BW3B 2I10A 3K1MA 5DV5A 2XDVA 4I0BA 5EGOA 4IO9F 2HQAA 2FBKA 2NVXJ 2OBPA 2K27A 1TQPA 2AXTC 3BT9A 1WJEA 3FXRA 3A1YA 2VL8A 2ETHA 3DTIA 1GVJA 1R4MB 2DA5A 2IA1A 5ILVA 2R7VA 4AVPA 2GAUA 1MBEA 1TT0A 3NWSA 3MZYA 4DBQA 4UY8I 5CVJA 2WAQN 1O3TA 2DK5A 1EV7A 1FBSA 4N4OB 4O6JA 1USTA 1BW6A 2EPFA 3K4CA 4RLQA 4L9TA 4MEXF 3J7ZI 2IGNA 1XC5A 5CKTA 2FMLA 1AU7A 1OYIA 1R6RA 4PJMA 2XKPA 5AIQA 3BG5A 1J5YA 4HV6A 3EYIA 3H3VK 2E34A 3E5QA 3GWZA 4LMYA 2VBXA 2XPVA 3DKXA 3OOPA 3L2WA 4V2FA 3K69A 3H5NA 4XLAA 1PP7U 2P6TA 1UCRA 4IEJA 5CPRB 3HL2A 4HQEA 2LK2A 2HTSA 2V9PA 5DD4A 3ZQLA 2MH9A 2E1OA 2MD0A 4E70A 2HQRA 4EJWA 1RPWA 2QSGX 3KP5A 3RPUA 3BZKA 1YW8A 1IN8A 2IA0A 1OCRH 2JA8J 5DUIA 5HNFA 3CC7I 1Y8RB 3CMMA 2GIVA 4BQQA 1LFUP 1QVTA 2E5ZA 2YPRA 3FK7A 2VE9A 3CCQI 1MSEC 3E6BA 1QZZA 1HW1A 3LSHA 2HPMA 2ELHA 4CICA 2FUG2 1FT9A 2DA1A 1FIAA 2VT3A 3BR5A 4ZYEA 4IZZA 4AC0A 3VYSB 2Y31A 4UV9A 3K4KA 3H0GJ 4ZTFA 2YX4A 4CHUA 3L9FA 5K1YA 1IN4A 3KETA 2LF8A 2YUSA 5GAGJ 5IP9J 5L3BA 1YJNI 3HOYJ 3BR1A 1IN7A 2QQAA 1F9NA 3IAS2 2KISA 4B8XA 4V2GA 3PNVA 3ZMDA 3ZPLA 1Z77A 2E1MC 3EDPA 2LF7A 5CLSA 2XF6A 4I98B 4A6DA 2G9WA 2O9LA 4C9YA 5GADJ 5CVIA 5F1JA 4BJ6C 2LTPA 3OYNA 2VB6A 1ETYA 4GRIA 3M9AA 1K61A 1T33A 1I5ZA 5EZGA 1BN5A 2CQXA 3RIRA 4PFOA 1V55H 3F21A 2BY0A 3CJTB 3IC7A 4XLNF 4OIRF 4DBRA 3BCAA 4MTDA 4M9ZA 2EINH 3H36A 2V6CA 1V5EA 3K9TA 1FOYA 4IHTA 2H09A 5D6EA 3T5XA 3CCRI 1N77A 4RDUA 4XORA 3E97A 2TCTA 4P55A 4RA2A 2QSHX 4XKBA 2EV5A 5D8LB 4H0EA 2HOSA 2JJ7A 4IHVA 2MH2A 1OQYA 3NEUA 2E1NA 5CVRA 3CJNA 2VJJA 4HDVA 2LYCA 1H9TA 1AKHB 5DM6F 1XSDA 2X1EA 1JKPC 5IYCJ 4ZJZA 3AFHA 5KAIC 1ZARA 1U0JA 3WTXC 2W00A 2WB1N 4YIIA 3LAJA 3PIPF 1XS9A 3GTGJ 1Z3YA 4UXNA 4G8XA 1KQ0A 1W0TA 1B8IA 2IS6A 2OD5A 3IV5A 2LR8A 4P96A 2PJRA 3IH2A 3LSRA 3JRFA 5DUKA 3D0SA 4HEA2 2K9MA 4YEJA 3EUHC 1G3TA 4ITVA 1YX3A 3TOAA 3R0JA 4XBFA 3ESWB 1ZG3A 5LEKA 2V4JC 3W6KB 5BOXA 1I3QJ 3KLOA 3ZR8X 2A05A 5DM7F 1XMAA 5ED4A 3BQZA 2QA4I 5ICGA 3GW2A 3FMSA 3RKYA 4L5JA 3C7JA 3TMOA 3OWTA 3M1EA 2X6XA 3IWZA 2IW5A 5LGTA 3J81Z 1KYZA 2CW8A 2XHKA 3V7SA 3BJ6A 3U21A 3BPVA 1FOKA 4PCQA 5E3OA 4LLGF 4Q5SF 3HUGA 3S2HJ 3HJEA 3S2WA 5BPIA 1X1CA 4C2MJ 4LG0A 2BGCA 2MD5A 4HX7A 1NTCA 1ULYA 2ZXHA 4FE7A 5HDNA 2JRMA 2ZNYA 3IHUA 1PJRA 2PX9A 2HYGD 3BJOA 4UB8C 2TRTA 5E8GA 3AKZA 4XQFA 3CUQB 4BKXA 3TDZC 2Y0MA 2V6EA 1QZEA 2OF7A 1XPXA 1XSVA 4KMFA 5LRSA 2BOLA 5K5OA 2JA2A 4XSZF 1HCRA 3WU2C 2RV8A 2F6CA 1KONA 3O2PE 2PEXA 2JPBA 3BOQA 1J9IA 4ABZA 1ZGJA 2A3SA 4C3JJ 4BU2A 3H9QA 5IYDJ 2VKDA 1ZG1A 2BXZA 3FHNA 1CQTA 3JAMZ 2IS2A 3MKLA 4LB5A 4G12A 3G6EI 4B48A 2IJLA 5ILUA 1B1BA 3RJPA 2WA0A 5FD6A 5TGTA 2E2JJ 2RGVA 3LQQA 4I6ZA 4ZZLA 1A5JA 1G59A 4UUTA 1A6IA 2H8WA 3S32A 3OS1A 1HKTA 4FHTA 3RSNA 1AOYA 3I56I 3JCUC 5ERIA 2W7NA 2EJRA 2BVMA 3WGHA 1ZREA 1ERDA 2EFOA 2LY1A 1B72B 1U6GA 1HSTA 2ZFUA 2XPUA 2ICWG 2DCEA 4FASD 2CFOA 2KDOA 2CG4A 1BI2A 4L0ZB 1X1PA 2KHMA 3AG4H 3HRTA 4PSXA 4F91B 3K6GA 4P9FA 5FKNA 4LLNA 1OYWA 2BYVE 1REPC 3AL0B 4KN7X 1U9OA 2BE5F 2OZ6A 4M6YA 5HLHA 2OTLI 4M9XA 1DGWY 3DPLC 2LG4A 3JRIA 2D45A 3ZN0A 3R61A 4L18B 1ORKA 3KEQA 2B9SA 1T2KA 4MQVA 3U9GA 5GPCA 1T98A 2JA7J 1OFCX 1HSJA 5K7FA 4KJZA 5DYMA 1LE8B 3I64A 2NVUB 1S5LC 1FWZA 4KYWA 2D1VA 2KT0A 1QPIA 2E1CA 3RKWA 3GTLJ 3LA7A 3KYCB 3DPTA 3LSGA 4EGYA 2VBWA 4UUVA 2FMYA 4CUGA 1QU3A 4XOTA 3Q3SA 4MTEA 3PSIA 1D3YA 3GFMA 1WRJA 2W25A 3TW6A 3CP8A 4TV7A 1OCCH 5GAHJ 2EWNA 2E2IJ 1DU6A 3IKTA 2EIMH 1YJ9I 3KP2A 1O3QA 1HKSA 4HBLA 3ZQCA 2DFIA 3CF2A 2DPUA 4IHSA 2Y9YA 3DKWA 3BP8A 2XGDA 3IAM2 2MLKA 2W24A 4LIVA 3L2VA 2QBYA 4OU0A 1X1DA 1JI8A 2MC4A 3IRQA 1LKXA 4KA4A 4YRVA 5J4YA 2COBA 3DFGA 2BXYA 2KRHA 5JR3A 2VPLA 2XB0X 1AHDP 2JWTA 1S7AA 2IBDA 4HRIA 3ULQB 1S9HA 1STZA 2RNJA 3GTKJ 1X58A 4BNCA 1W7PD 3OV8A 1UG0A 3K4BA 3NQOA 3ELKA 3WE3A 3FKIJ 5D5VB 4L9NA 3JRGA 4A3EJ 1SAUA 3OOUA 4OIPF 3I58A 1QGPA 3DLAA 5JVTA 1H9GA 1DP3A 3DEWA 2FD5A 4MLOA 2QVOA 4X6AJ 1Z7UA 4XSXF 2DK8A 1QA6A 4ZTJA 3WODF 1Z67A 4GCVA 4BY1J 1A04A 3MQ0A 1VQLI 3L2UA 5LHGA 4N4NB 3QPLA 3OYEA 1JTYA 3A0BC 2JVGA 4D7NA 1Z9CA 4EM1A 3K70D 3A02A 3F8MA 3DF8A 2FSWA 3FXLA 5KAFC 3JRCA 6PAXA 4LG3A 4HNUA 5C4XJ 2BBYA 2NOJB 2CWEA 1BW5A 2LY2A 5H6QA 1DPUA 1ZK8A 1FPQA 1GLNA 1ZYRF 1BR2A 4NC7A 5L3FA 2HDDA 2PMHA 4KFCA 3GBGA 3VEPA 1V3FA 1YO5C 3PQJA 3R0AA 1U3EM 3G73A 2GIZA 1UG2A 1XMKA 2MGQA 3Q0UA 5E1ZB 2DTZA 4KMUX 2DA6A 2LFBA 3F72A 2EV6A 1GUUA 4HSTA 1RKWA 1X4PA 5L3EA 4Y13A 5A2QZ 3M3YJ 5F6FA 4B43A 3DPUA 2QQBA 3RZDJ 3L1PA 4AYBN 5FB2A 4D5CA 2Q1ZB 1G2HA 2P7CB 5FRNA 3K2ZA 4HLYA 1ZGWA 1IRFA 4I7HA 3V8JA 4Y33A 4B4CA 1XB4A 1XSXA 4ZDOA 3GFIA 2Z3YA 2E60A 2HZTA 3MCZA 3ZXSA 3OYJA 1M1EB 2QCOA 1XTAA 2ZJRF 1G6NA 2EZLA 2XC7A 1BI1A 3RQ4A 4BBRJ 4U0WA 3P9KA 3FISA 2ZNZA 2V1NA 1U78A 2H6BA 3FXKA 3QU6A 4AVZA 1B4AA 1H89C 2XAHA 3QYBA 1D5YA 4UVBA 5FLVA 4HF2A 2DDAA 3W2VA 2L7FP 3FIWA 1NH3A 4IF4A 2R5ZA 4P1WA 3PM1A 2VQHA 1J75A 2F5VA 2KZGA 2R0QC 4J01A 1GVDA 1IAWA 1QHGA 5EF6A 4MHGA 1SFOJ 5TISC 2PLYA 3LSJA 2FNPA 4BJ5C 4BBSJ 3EUKL 2Y0SA 3OYBA 4A93J 3VSKA 1T08B 3BTIA 3UKGA 2CSOA 4IXAA 1MW7A 2F5EA 4FQGA 1SC7A 5E18F 5L3CA 2ZC2A 2CUJA 3I4NJ 4BXXJ 1WI3A 2W84A 2ZSHB 2IRFG 2Y2ZA 3KZZA 2M0CA 4RB3C 5C4JJ 4U87A 1XGOA 2FQ3A 3WHBA 3H35A 4CCKA 1FMWA 1I39A 2LOOA 3OL4A 2QKMB 4KN4X 2VUMJ 3BLYA 1VQMI 2V26A 3LSPA 4L5EA 1UMQA 5K7ZA 1R5HA 2KLOA 4LLLA 4F52A 3GCMA 4A6EA 2NS0A 1QRYA 1PP8F 3DQVC 3GTPJ 1W5SA 3I4MJ 4RB2C 2DA3A 4ESFA 1LNWA 2QKLB 3CUOA 3FXMA 5F0HA 2Q2EA 4PJ0C 1MBJA 2Q8KA 4XRMA 3BDDA 2EFQA 1IXRC 5DS9A 5ICEA 2DMNA 3E5XA 4P9UA 4IL6C 5A2QK 2DA7A 4BQOA 3CJQB 1V54H 3HSFA 4DZJA 3WTUC 1A31A 4R79A 1R7JA 3W3CA 5IP6A 2AQEA 2VLAA 3KX2A 3V7CA 4LOCA 4DJAA 3BR6A 2XKOA 2M2EA 1MNEA 4S04A 4PJJA 1ETXA 3ABMH 1X2MA 2NVYJ 1OJLA 1BIBA 3BG3A 3F8BA 2ZFWA 4QWQA 4KT6A 2RKHA 4ZYGA 1IXSB 3G1OA 4O3MA 1D1AA 3H9GA 2HDCA 4I02A 4PGGA 5HNHA 3LSMA 3D5LA 1ZRCA 3GUDA 3HBLA 3F22A 1K7AA 5IOZA 2DPDA 3CZ6A 2UXNA 1RUOA 4ENNA 5M5YJ 2QSFX 3QYFA 1MMSA 1VFCA 3TQNA 1LUJB 2FBIA 4F55A 3ZMSA 1VQKI 3GTOJ 2IGMA 3FF5A 4NB5A 2M3AA 2JUGA 3CC4I 3IP4B 2BY2A 3SDGA 4W97A 2RC4A 1X4OA 5FRMA 9ANTA 1RC9A 5DEQA 2HYFA 4XL9A 5BMZA 4B3XA 2D1HA 1ZELA 2RDPA 2DOFA 2L3DA 4Q48A 3EUHA 3RKQA 3LSKA 3W2WA 3HSRA 3K7AJ 1VQ8I 3P9IA 1ONVA 2A6HF 1HW5A 1ETQA 1SAXA 1MH4A 3O6BB 4KICA 3V8LA 4ENMA 1WVRA 3ABLH 3N97A 3CMAI 1RKTA 1OCPA 2EZKA 3HPGA 4RGRA 4OMYA 2XRNA 1HA8A 4HLXA 4FETA 1R1VA 3ZCOA 1ZRDA 2GXGA 1K83J 1VQOI 4BUPA 1VQNI 5FO5A 4I0AA 1HXDA 5EDNA 1O7LA 3IKVA 2QQ9A 2P6SA 4YFXF 3L2QA 5LEJA 2JUCA 4BEHA 2H1KA 2OQGA 3KP7A 4PJLA 3V8KA 3HOXJ 2DW4A 1OCZH 3VDXA 1FBUA 1MNMC 4KIFA 1W1WE 1W5TA 2ZMEA 4CYCB 2KIUA 1EH6A 3HG9A 3TDUC 1F1ZA 2CH0A 3KYDB 2XAUA 3R6SA 2DJIA 5JLWA 3JRAA 1MDMB 2M9HA 4ZYAA 5FROA 2CQQA 1HKQA 3SHFA 4PZJA 4BY7J 2LMDA 1XX5A 1R58A 2M1BA 2NAZA 1FY7A 2VBYA 4IPAA 1PVEA 3CCEI 1TLHB 1YS6A 3ECOA 3M1CA 5HODA 4NNJA 2VC1A 3LQRA 5GTIC 5M5WJ 3OYFA 2ZXWH 2LBFA 4PSWA 3SYTA 2J5PA 1WCMJ 1E2XA 4CA0A 2OPTA 1JTXA 2FXAA 3LA3A 2HDWA 4EJVA 1XG1A 2ZKZA 3PUBA 4PFPA 3CCVI 3EYYA 2F4IA 3DXJF 5B3SH 5KK1A 4NQWB 1K78B 1NK3P 4S0HB 2LVSA 4G6TB 4DOZA 4A3DJ 4IOCF 1QQIA 4M6VA 1YYVA 2DJNA 3BROA 4RB0A 3EPZA 1YFHA 5D6FA 1HQCA 3X2QH 1VQ5I 1FTZA 2DA4A 2FNAA 3HYIA 1XD7A 2R4GA 1LB2A 3JRHA 2P4WA 1K4SA 1Z6TA 4CO8A 3SZPA 2VJ5A 4K2EA 2XGEA 1VQPI 1CF7B 1FZPB 1JUMA 2HI3A 4LD5A 3BC8A 5H2FC 4ANJA 3JSOA 3G1LA 4M74A 3COAC 2PQ8A 1ACIA 2MFZA 4E7LA 2Z9OA 2H1LA 3TL4X 3BTCA 3CUQC 2KP6A 3S3NA 2XF7A 2FBHA 1MMNA 2VT2A 2M4GA 1JE8A 1IO2A 4IHXA 4E7ZA 1IC8A 3BJAA 2WTEA 2XPWA 1IUYA 4BXFA 4FT8A 3ISPA 1IDZA 1YX5A 3L09A 2XGXA 1YHQI 2CMPA 2FX0A 2DOEA 5F0FA 1P92A 3HKZA 1V5GA 4XLPF 2E5NA 4RB1A 1UHMA 2R3SA 4ZDLA 1B9MA 2CFXA 2R7QA 1G3WA 1SANA 3S8PA 2KJBA 2DT7B 3T8RA 1U9NA 3OYDA 2K9NA 2M87A 3HXLA 1MBGA 1P7IA 3FM5A 4IJAA 1SVMA 4AM3A 5FLXK 1WKMA 4IQJA 3KEOA 5CQGA 2NOGA 4XR6A 1Y0NA 4N9IA 3JR9A 4MFDA 4YIFA 2KPMA 3T8TA 1NK2P 3Q9SA 3BG6A 1IXCA 3KPHA 4W1UA 2JN6A 2O5RA 2R92J 3GFLA 3SQNA 1HW2A 4DIQA 3PUFA 4RMNA 1X3ZB 4OMZA 4UB6C 1O3SA 3AL0C 1ZH5A 1JUSA 1XCVA 5E3NA 4WXDA 1SVOA 2FF4A 2R7OA 3H92A 3MD2A 3ZQIA 1SEUA 1BM9A 1VQ9I 2E36A 2R7UA 1OYYA 2W57A 3E5UA 1W7PA 3HM5A 1R22A 5J1YA 3WU0A 4KDPA 2OCCH 4UVAA 2A07F 2X9DA 4B44A 2CQ7A 4L9JA 2MYSA 3WTSC 2FJ1A 2A69F 4DGWB 1FEXA 2DODA 3FMRA 2VN2A
chains in the Genus database with same CATH topology
5KCMA 3G2BA 3LMMA 2KRCA 3FBNB 3FKJA 1WFXA 2L9NA 4XKVA 3UR3C 4CH7A 2K9LA 3CF2A 2GOMA 4XKWA 2W82A 3KYLA 1UELB 4LIVA 1X19A 3IAM2 3L2VA 2HVSA 3SEZA 1X1DA 3TBIA 1JI8A 2MC4A 4LITA 1WJCA 5HLTA 4E6KG 1LKXA 1T0FC 1K6YA 4YRVA 2KRHA 1DQUA 2VPLA 4XONA 4HRIA 2RREA 3MKWB 2IS1A 2KL4A 1S9HA 1P9QC 3OMYA 2HNHA 4P5OA 1UG0A 3K4BA 2CV0A 1DGRM 4D1QA 3CJRB 2OUMA 1SAUA 3OOUA 1LDKB 3DLAA 3UNGC 5JHFA 1DP3A 4MLOA 2IGKA 4EATA 4ZTJA 2WAFA 3H9JA 3NWTA 3PL8A 3OS0A 4B47A 4XLCA 3QOEA 2WADA 2VQCA 5CQEA 4BDYA 3OS2A 4JQFA 3L2UA 4N4NB 3OYEA 2JVGA 3F9KA 2K5CA 4BJTA 2OC6A 3K70D 2X1DA 3VYUB 3HOTA 4Y3OA 1PYVA 4LG3A 4HNUA 2NOJB 3OL3A 1D0XA 2LY2A 2WBMA 5LD2C 1GLNA 1BR2A 4NC7A 1V5FA 1WJFA 3GBGA 3A2KA 1QHHD 2I8DA 1Z7LA 1Z21A 2ELJA 2ZSIB 2X85A 2CS3A 2R7SA 2M7BA 4QPQA 2BW3A 4HSTA 3V42A 1X4PA 1MMDA 5LFAA 4B43A 3DPUA 4HSRA 2Q1ZB 5FRNA 4CCNA 4Y33A 2HZDA 4ZDOA 2E60A 2X51A 3VYTB 3DU6A 3QYEA 2A5WA 3ZXSA 3OYJA 4AYBA 2XC7A 3RQ4A 2DXIA 2CV2A 3FBIB 2V1NA 3MKZA 3MMYB 4AVZA 2L2OA 3DKYA 4II3A 4LIUA 4J00A 3K4MA 3OYCA 1NG7A 3QYBA 3S93A 2HVRA 3H0DA 4BE0A 3W2VA 3PFYA 4D9JA 2BW3B 3DU5A 4XOPA 2XDVA 4P1WA 3HPHA 2VQHA 2HQAA 2F5VA 1G8XA 4J01A 4JOMA 4E7JA 1QHGA 1WJEA 2M7AA 3A1YA 2VL8A 5HOOA 3ZRGA 4BJ5C 3DTIA 3EUKL 2Y0SA 3OYBA 5HVQC 3VSKA 1BR4A 2CUZA 2R7VA 1MW7A 1X1AA 1TT0A 4RLFA 2CUJA 3NWSA 4DBQA 4HNTA 2ZSHB 2VIXA 4N4OB 2Z16A 4U87A 3PSFA 1IRXA 3RCOA 2DT6A 2IXSA 4CCKA 3H35A 4RLQA 1SFKA 1FMWA 3EUAA 3K4CA 2LOOA 1N75A 2IGNA 2IGOA 2QKMB 3OL4A 4HPQA 4NC8A 3HOSA 2KMUA 5CKTA 3BLYA 3SZGA 2V26A 4C30A 1R6RA 4PJMA 3OYAA 1Y56A 1BOBA 2KLOA 4F52A 2WAQA 4ZDPA 2HPIA 2Z2SB 4OAZA 2WY7Q 2VXDA 3DKXA 1AA7A 3L2WA 4AU7A 3DQVC 3H5NA 4XLAA 4XLEA 2QKLB 4BGDA 2KZVA 3LL7A 2W1OA 5CPRB 4E4HA 3HL2A 1X1BA 3SEQA 2R7XA 1TZLA 3OIPA 2MD0A 3S3MA 3DWLE 5KHDA 4BQOA 3CESA 3CJQB 3PJRA 5HNFA 4R79A 3W3CA 2W4SA 2AQEA 3CMMA 4BQQA 2VLAA 3KX2A 4KISA 2E5ZA 1WJAA 3LSHA 4DJAA 2HPMA 1MNEA 2FUG2 4PJJA 4IZZA 1EA3A 3IUOA 4XNFA 3VYSB 3K4KA 4ZTFA 3OR2C 2E1MB 3I3LA 4KT6A 3K4LA 1D0YA 1D1AA 2GOXB 3H9GA 1LVKA 4BQNA 3A4CA 5HNHA 3IAS2 3LSMA 5KNLA 3D5LA 2Q2EB 3PNVA 2UV1A 1OR7C 3CZ6A 2E1MC 3VSLA 2XF6A 2Z1DA 3H5RA 4IX7A 4C9YA 3QYFA 4BJ6C 3OYNA 2VB6A 4F55A 4GRIA 4X0GA 2IGMA 2LH9A 2M3AA 4PK4A 2JUGA 2BVLA 3VYRB 2VJ4A 3IP4B 3RPUD 4KITB 3H5AA 1X4OA 4PFOA 4E7IA 5FRMA 1J09A 3ZGKA 4BACA 4XL9A 4BE1A 1D1CA 4B3XA 4DBRA 2R7WA 3BCAA 1ZELA 4E7SA 3LSKA 3KEYA 3DTKA 3W2WA 1V5EA 2RNGA 3RTRA 4U7BA 4RM3A 1N77A 3DEEA 4XORA 2K3PA 4H4KC 3HPGA 4XKBA 4C2UA 1HA8A 2XSJC 1WJDA 4FETA 3ZCOA 2LRDA 4II2A 4BUPA 3OIQA 4XMYA 4E7KA 4F92B 2CV1A 4XN3A 2VJJA 2LYCA 3VWBA 2JVHA 3BG7A 2UUZA 1WJ5A 3L2QA 3W2AA 3K4NA 4BEHA 1MNDA 2X1EA 2P0WA 1T95A 1MMGA 4IQ4A 4PJLA 2A6TA 3AFHA 4ZJZA 3C2HA 3VDXA 3BCBA 1U0JA 2W00A 2HVQA 4XM3A 3OYIA 1Z3YA 2VQGA 3HG9A 4HG2A 4XLHA 2CH0A 2X1CA 2IS6A 2XAUA 4IKFA 2DJIA 2VXZA 5FROA 4ZYAA 1WJBA 4PUSA 1W36C 2L9SA 1W36D 2PJRA 2LC2A 2WB1A 4BS9A 4HEA2 2K9MA 4YEJA 3EUHC 4ITVA 3M1CA 1YX3A 4NNJA 2V4JC 3I9V2 4CCOA 4BL0B 1MMAA 3OYFA 3ZR8X 2LBFA 4PSWA 3SYTA 4OAYA 4CA0A 2DOAA 4BEHB 2HDWA 3LFUA 1LFPA 3PUBA 4PFPA 3SDBA 2F4IA 3ZQQA 4NQWB 1OLTA 4G6TB 4DOZA 3TMOA 3OWTA 2X6XA 2VJIA 2WY8Q 3E0JB 3D5RC 1BR1A 4Y4RA 4YELA 2CW8A 2XF5A 3EPZA 3U21A 4C2TA 4XKCA 4CSWA 2R4GA 1E0EA 3LSIA 3K4JA 1X1CA 2RQQA 2PJRB 2VASA 2VJ5A 2ZXHA 1PJRA 3AKZA 1N78A 4CCJA 4XQFA 3BC8A 3C2GA 4ANJA 4NUBA 3QODA 2V6EA 4XN0A 4F3QA 4F93B 2LBFB 2BOLA 2JA2A 2MFZA 3OYKA 2F6CA 4E7LA 1KONA 2L5QA 3TL4X 2R7RA 4E7HA 2KP6A 3S3NA 3D5SC 1NG6A 2XF7A 1MMNA 1Z3XA 4BU2A 3H9QA 2VKDA 2VQLA 2M4GA 3FHNA 3MKYB 1Y6IA 4E7ZA 4PJNA 3K70C 2IS2A 3S3OA 4CZCA 3HUGB 4BXFA 1YX5A 3E1SA 1YE9A 3L2RA 4B48A 2X6YA 2CMPA 2UWMA 2LREA 2WA0A 5TGTA 3HKZA 3OYGA 1V5GA 2E5NA 1G59A 3M8JA 3S32A 4ZDLA 3OS1A 4BE2A 3RSNA 3OYLA 4CCMA 3OYHA 2W7NA 2R7QA 2BVMA 1ERDA 2LY1A 3S8PA 3DTEA 2R7TA 2DT7B 2VKHA 2ZFUA 2PMZA 2DCEA 4FASD 3OR1C 3OYDA 2CFOA 3J7AY 2KDOA 3HXLA 2MABA 2CW7A 2KHMA 3OYMA 4PSXA 4RM2A 4F91B 4IQJA 3CP2A 3K6GA 5CQGA 2JSPA 2M4KA 4XR6A 3AL0B 2X6WA 2KPMA 4QPOA 2V7FA 2HU9A 2IS4A 3BG6A 1UAAA 4CCLA 2O5RA 4BDZA 1DGWY 3DPLC 2LG4A 4DIQA 4XLFA 4RMNA 3N05A 2OV7A 1D0ZA 3AL0C 2V9KA 1D1BA 3PNTA 3FDYA 3K10A 4ZC3A 2R7OA 4KJZA 3MD2A 2M0MA 3PNYA 2R7UA 2KQRA 3HC7A 3DPTA 3LSGA 1FMVA 4CUGA 4B44A 1QU3A 4XOTA 2ZXIA 2AQFA 3PSIA 3OY9A 2MYSA 3CP8A 1VZ0A 4OWRB 2L7KA 2WAEA 4DGWB 3ONQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCO A; 
#chains in the Genus database with same CATH topology
 2Z99 A;  4AIK A;  2F5D A;  3G2B A;  5M3F J;  2HYJ A;  3LMM A;  2KRC A;  2QEN A;  3O8H A;  3E7L A;  1A6Q A;  3I59 B;  1HLV A;  3UR3 C;  1KA8 A;  2K9L A;  4CH7 A;  1RR8 C;  2GOM A;  3IWF A;  2GBY A;  2JT1 A;  1WQ2 A;  5HDG A;  3A01 B;  3I0T A;  3CCS I;  1IJW C;  3SEZ A;  2XSD C;  2XAG A;  2V1D A;  3SXY A;  4E6K G;  2PMU A;  1R9T J;  3DLL F;  2QYO A;  3WHC A;  4A3K J;  3AG1 H;  2PBI A;  4G6D A;  1DQU A;  3P7N A;  3TED A;  4J19 A;  1L3L A;  4RGU A;  4XON A;  2RRE A;  1Z6R A;  2KL4 A;  3HTS B;  1T56 A;  1YJW I;  2R5Y A;  3RYP A;  2OJE D;  1YRN B;  2VE8 A;  3W6J B;  3F8N A;  4M6X A;  4LB6 B;  1XGM A;  2CQK A;  2KIF A;  1LDK B;  3HRM A;  1F4K A;  3CD6 I;  2HFH A;  2BV6 A;  1IF1 A;  4Y7N J;  4MIM A;  3WTZ A;  1GXP A;  1PUF A;  1I50 J;  2JTV A;  1R5G A;  1SFU A;  4IHY A;  2CUE A;  5CQE A;  4DYC A;  1K79 A;  3RQI A;  1AWC A;  4JQF A;  2DO7 A;  5DCM B;  2K5C A;  1RRJ A;  2CUF A;  3MFK A;  4Y3O A;  1PYV A;  2LP0 A;  2OAZ A;  1MJB A;  5LD2 C;  3S1R J;  1ETK A;  5B66 C;  3Q9V A;  5HLG A;  4ZYD A;  2L9V A;  2XVC A;  1E17 A;  2V79 A;  4ESJ A;  2LKX A;  2I8D A;  2CO5 A;  1LPQ A;  1MZB A;  4XID A;  2ELJ A;  2A5Y B;  2ZSI B;  4A3C J;  2X85 A;  5EG0 B;  2M7B A;  2BW3 A;  1I6X A;  4M3F A;  2MLG A;  1MMD A;  5LFA A;  1HC8 A;  3G71 I;  2DYR H;  2NS8 A;  2NVQ J;  1UFM A;  3ZMU A;  4HSR A;  4M3B A;  4A0Y A;  5LLQ A;  4A3J J;  2E2H J;  1U5T B;  3S1Q J;  2QWW A;  5EEG A;  2CRG A;  4I09 A;  5GTH C;  2D5V A;  1J7K A;  1A36 A;  3QPS A;  1LFB A;  4ETS A;  3ZP5 A;  2X51 A;  3F0C A;  2DT5 A;  3RI4 A;  3ABT A;  2DXI A;  2CW0 F;  4RBO A;  2X6O A;  3MKZ A;  3KIO A;  4IHW A;  5F1R A;  3JTH A;  4LIU A;  4J00 A;  3OYC A;  1NG7 A;  3S93 A;  2Y0S N;  3BR0 A;  5CJ9 A;  2HVR A;  3ERE D;  1S7E A;  4CGZ A;  3ZQ7 A;  3PFY A;  1ITY A;  1HDD C;  1TQM A;  2P81 A;  5JLX A;  5GPA A;  4EJU A;  1FX7 A;  2JRT A;  2K02 A;  1Z91 A;  3RDI A;  3JRD A;  1WH5 A;  1TW3 A;  2EIK H;  1G8X A;  2O61 A;  4JOM A;  4E7J A;  4RGS A;  1TWG J;  4DQ2 A;  3WGG A;  5HOO A;  3ZRG A;  2ADU A;  2KJC A;  3TO7 A;  1MKM A;  4MO7 A;  1BR4 A;  1P2F A;  5E8I A;  2Y9Z A;  2HKX A;  2DQL A;  4RLF A;  4HNT A;  3HB9 A;  1D8K A;  1KU3 A;  1UHW A;  3PSF A;  1JUP A;  3FMQ A;  2DT6 A;  4LJZ F;  3EET A;  5IP7 J;  3ASN H;  1N75 A;  1Z1D A;  2IGO A;  2KMU A;  2QEX I;  2ZJQ F;  1YIO A;  4Y17 A;  1YW7 A;  3SZG A;  3BZC A;  4C30 A;  1MBF A;  1IV8 A;  1BOB A;  4U0Y A;  2BEO A;  4A5M A;  4A3M J;  4ZDP A;  3CC2 I;  4O5V A;  2CGP A;  2VXD A;  5EGO B;  1KZH A;  3ZQH A;  3GTM J;  4XLE A;  2F4O B;  3OSG A;  2X4H A;  2BHY A;  5DCF A;  4BGD A;  2KZV A;  3LL7 A;  4XRF A;  1TP4 A;  5FFZ A;  4E4H A;  3FX3 A;  2HOE A;  3SEQ A;  2R7X A;  2ZJ2 A;  4AIJ A;  3FWE A;  2HQN A;  5ICC A;  1D8J A;  3OIP A;  3FM3 A;  2PFB A;  1KYW A;  3R4K A;  3CCY A;  4RAY A;  1O4X A;  2H6C A;  4AID A;  3LAP A;  3DP7 A;  2G0E A;  4IVN A;  2IA2 A;  4A12 A;  2W4S A;  3HRS A;  4KIS A;  1F43 A;  1E3P A;  5F04 A;  3ABK H;  4Q4Z F;  4EVI A;  1WJA A;  4Z2Y A;  1A35 A;  2ME6 A;  2VON A;  2GQQ A;  4GYG A;  1EA3 A;  1N25 A;  3IUO A;  4D5F A;  5K7H A;  3WG9 A;  2PJP A;  2MSY A;  3QP6 A;  4XNF A;  2D2W A;  4M72 A;  5E1W A;  2EK5 A;  3I3L A;  4QTR A;  4CZZ A;  2ZCW A;  4NBQ A;  4MFE A;  4BQN A;  3BTL A;  4D0P A;  4N0B A;  3WG7 H;  1T38 A;  2DI3 A;  4JX5 A;  2ECB A;  3R60 A;  2UV1 A;  1OR7 C;  4BXU A;  2NVT J;  2Z1D A;  4IX7 A;  3S1N J;  2F4M B;  2IVM A;  3GX4 X;  3CDI A;  5HDK A;  3K0L A;  4X0G A;  1AKH A;  4UUS A;  1S8N A;  3NAU A;  4PK4 A;  2BVL A;  3ML6 A;  2QZ8 A;  2VJ4 A;  4KIT B;  3H5A A;  4RGX A;  4JYK A;  2GZW A;  3ZGK A;  4NDL A;  3VB2 A;  4HDU A;  5FKK A;  3DV8 A;  2IT0 A;  4S05 A;  4E7S A;  4PGH A;  2R7D A;  1DPR A;  2LKS A;  3DTK A;  4DW6 A;  4U7B A;  3QPT A;  2V1X A;  4RM3 A;  2EFP A;  1TWH J;  4OOI A;  3WE2 A;  1K4T A;  3KE2 A;  2H8R A;  2K3P A;  1B9N A;  3CTA A;  4C2U A;  3CME I;  2XSJ C;  3GXO A;  3WGI A;  1VF9 A;  2IPQ X;  2LRD A;  3HRU A;  1G3S A;  1FP2 A;  5J3L A;  2R7Z J;  4E7K A;  2HTJ A;  2CV1 A;  4XN3 A;  2DFF A;  2JVH A;  3BG7 A;  2ECC A;  1WJ5 A;  2UUZ A;  2VBZ A;  5BPD A;  1MGT A;  3W2A A;  4QIW N;  5JI6 A;  2P0W A;  1T95 A;  1MMG A;  5TJJ A;  3GZ5 A;  2NRA C;  4G6Q A;  3MAJ A;  4LK1 F;  1TWA J;  2Y69 H;  3OYI A;  2VQG A;  1VQ7 I;  4HG2 A;  1F5T A;  1QBJ A;  1UB9 A;  2X1C A;  1ETW A;  4IKF A;  3J80 K;  1BOA A;  1WJB A;  2UZK A;  1DUX C;  5HS9 A;  1XGN A;  1ON1 A;  2L4A A;  3FXU A;  2L54 A;  4MGR A;  3S16 J;  3KZY A;  2GXB A;  4FTH A;  5JVG F;  3CUQ A;  2OCE A;  1JHF A;  1TWC J;  3GVA A;  1EKE A;  4BL0 B;  1MMA A;  4A69 C;  3N4M A;  2OZU A;  2A68 F;  1TNS A;  1KU2 A;  5J40 A;  3F6V A;  3CCU I;  3SDB A;  4B3A A;  5B1B H;  5L3G A;  2VJI A;  2WY8 Q;  5AON A;  4A3B J;  1HOM A;  4AD9 A;  2L7M P;  3D5R C;  1BR1 A;  4Y4R A;  4YEL A;  1FIP A;  1EH8 A;  1ZN2 A;  2XF5 A;  2O6G E;  5L3D A;  4EEF G;  2WWY A;  2E7W A;  1O3R A;  4C2T A;  5LBQ A;  1RIO H;  1JHH A;  4XKC A;  1B8I B;  1UJ8 A;  4OIQ F;  1E0E A;  3HOZ J;  1Z0X A;  2P8T A;  1R49 A;  4ZYH A;  3B02 A;  2XV4 S;  2PJR B;  5BQT A;  4GFB A;  2E71 A;  4G7O F;  1ZLK A;  4CCJ A;  1P7J A;  3B6A A;  3QPH A;  3C2G A;  5IT3 A;  1K6O A;  1H8A C;  1FTT A;  2L9R A;  1PUE E;  1SVL A;  1W4M A;  3ECH A;  1GXQ A;  3OYK A;  4EV0 A;  2BHZ A;  2L5Q A;  1B72 A;  3TO9 A;  4ASN A;  4EM2 A;  1CGP A;  4DYQ A;  2KDZ A;  3BTJ A;  1USS A;  5J1U A;  1XCB A;  2PG4 A;  3FZV A;  1Z3X A;  2YU9 J;  2VQL A;  3CO7 C;  3HKZ N;  4HQM A;  3HZJ A;  2L0K A;  1X3W B;  2P5L C;  4M73 A;  1BI3 A;  2K40 A;  3P9C A;  3S3O A;  3HUG B;  2FOW A;  4BQA A;  2K9S A;  1R1T A;  1IV6 A;  3E1S A;  5F0C A;  1YE9 A;  3HHG A;  1U8B A;  5E3L A;  4LG0 B;  1SD7 A;  4LFU A;  2YSR A;  3F8F A;  1MBH A;  1S7O A;  2LRE A;  3BG9 A;  3P5J A;  4ESB A;  1I1S A;  4A3L J;  3QRF F;  2M5W A;  3OYG A;  1RES A;  1WSU A;  4A2U A;  5D5W B;  3OYL A;  1OMI A;  1LE8 A;  4HOB A;  2PN6 A;  1H88 C;  5EJC A;  1ZQ3 P;  3VFZ A;  4G94 A;  2R7T A;  1KGS A;  3DTE A;  5E20 A;  2PMZ A;  3J7A Y;  3OR1 C;  2NS7 A;  1WWX A;  2DTR A;  3GLX A;  4CXF A;  2MAB A;  1BC8 C;  2CW7 A;  3J7A O;  5J8F A;  3HHH A;  3OYM A;  1LEA A;  1P4W A;  3JW4 A;  4RM2 A;  1IUF A;  3Q0V A;  3H3Z A;  2M4K A;  1JXS A;  2XRL A;  2F48 A;  2K86 A;  3G4S I;  2QUF A;  2HU9 A;  4HW0 A;  3CO6 C;  3ZMV A;  1RUN A;  2IS4 A;  2ZBK A;  3Q5F A;  1BL0 A;  4CCL A;  2VI6 A;  2V1U A;  1MBK A;  1RI7 A;  5IOY A;  3Q0W A;  4XLF A;  2LNB A;  3N05 A;  4AWX B;  2OV7 A;  4Z6Y A;  1D0Z A;  1D1B A;  2FOK A;  1GHC A;  1F36 A;  3K10 A;  1IW7 F;  3I55 I;  4ZC3 A;  3PNY A;  3E6C C;  2AO9 A;  2KQR A;  4R1H A;  2Y75 A;  5FD5 A;  3FHZ A;  5JHU A;  1XDS A;  2LSO A;  5CYV A;  1B6A A;  1WPK A;  2LLK A;  2Z33 A;  4ZZD A;  3DBR B;  2ELK A;  3HTU A;  4A3G J;  4NHJ A;  5FGM A;  2ME0 A;  1EH7 A;  2ZXI A;  2AQF A;  1KQ9 A;  2N8G A;  1FLI A;  3G1M A;  1MIJ A;  1LQ1 A;  1VZ0 A;  3QOP A;  4OWR B;  5J1R A;  2WAE A;  3ONQ A;  3KFW X;  4N9H A;  5FLX Z;  2NYX A;  2L01 A;  1IDY A;  5KCM A;  4GYI A;  5KVR A;  4EJT A;  3LNQ A;  3FBN B;  2G7H A;  3GME A;  1MD0 A;  1WFX A;  1QZY A;  4XKV A;  1TBX A;  1T8I A;  2OU2 A;  2O03 A;  4HNV A;  3PO3 J;  3E6D A;  4KUM A;  3KYL A;  3ZOB A;  2FEZ A;  4L5I A;  5K5Q A;  1X19 A;  2NNN A;  3H3U A;  4EQQ A;  4LIT A;  1OPC A;  1WJC A;  1P4A A;  3QU3 A;  3B73 A;  1T6S A;  2HQ5 A;  4RAF A;  3VPR A;  1T0F C;  1K6Y A;  1MJ9 A;  1UZC A;  2DLL A;  1NHA A;  4LGW A;  3GEZ A;  4BH9 A;  2DDB A;  2VKE A;  1X2N A;  1Y1W J;  2B7E A;  1D5V A;  3RZO J;  2IS1 A;  3L00 A;  4JK1 X;  2GWR A;  3LFK A;  4PDK A;  2KFD A;  1SMY F;  4P5O A;  4Y15 A;  3TP3 A;  4EJO A;  2CV0 A;  1DGR M;  2FQ4 A;  3LA2 A;  4XRS G;  3CJR B;  2XAJ A;  2OUM A;  2QQ8 A;  5BNG A;  5JHF A;  2LDU A;  1XMX A;  2P7V B;  2IGK A;  4EAT A;  5E3M A;  3JRE A;  4DYR A;  3C18 A;  4YFN F;  1R71 A;  4I76 A;  3NWT A;  3PL8 A;  2QBY B;  1ZLJ A;  2JA6 J;  2MC3 A;  2ESH A;  4BDY A;  1VQ4 I;  2VQC A;  3OS2 A;  3M8F A;  2DN0 A;  2ISZ A;  2VOD A;  3CF5 F;  4JX6 A;  1EJ9 A;  1HDP A;  4BJT A;  2O7O A;  2JMW A;  1U8R A;  1R36 A;  2K4J A;  5TRD A;  2X1D A;  3VYU B;  4L0Y B;  1FBQ A;  5FFX A;  4G7H F;  1G4D A;  2B63 J;  4WX9 A;  1D0X A;  2WBM A;  1QVU A;  2P5K A;  1QHH D;  1RZ4 A;  3WU1 B;  1TWF J;  2HKO A;  2XRO A;  5E1X A;  3U1K A;  1FSH A;  1R5I D;  4ON0 A;  1Z7L A;  2IAI A;  1G3Y A;  2ZB9 A;  2CS3 A;  5FKL A;  3I5U A;  5LGN A;  1FNN A;  4CYD A;  3BY6 A;  4UVC A;  3AAF A;  4GDF A;  1YG2 A;  5K5R A;  3PIO F;  3F8C A;  1QO0 D;  2ZJP F;  2ZXJ A;  1SD6 A;  2R7F A;  2EV0 A;  3M8E A;  2EB7 A;  2FRH A;  2NXN B;  3FXJ A;  2DAO A;  2Z5U A;  1Z05 A;  1C0W A;  3VYT B;  3DU6 A;  1Y39 A;  3QYE A;  2A5W A;  1U5T C;  1HBX G;  5CVV A;  5GAE J;  3KCC A;  2EZI A;  3A03 A;  3VOE A;  1FYM A;  3MMY B;  5DTD A;  4II3 A;  1JKO C;  4HF1 A;  3K4M A;  5IT9 Z;  1JT6 A;  1LDJ A;  1YIT I;  5H20 A;  2CYY A;  3H0D A;  4EMS A;  3K1P A;  4D9J A;  3I54 A;  2Y48 A;  3DU5 A;  4XOP A;  3J7Y J;  3WTT C;  1RNL A;  3HPH A;  4FIS A;  1YOV B;  1POG A;  4ZH4 F;  4UUS B;  3WTY C;  5BS6 A;  1FYL A;  2EQR A;  4DZP A;  2M7A A;  3ERM A;  4I99 C;  3BPX A;  4EGZ A;  1J2X A;  5FKM A;  1JKQ C;  1JGG A;  1DDN A;  1TW2 A;  5HVQ C;  2MW8 A;  2M45 A;  2VOO A;  4UV8 A;  2F5F A;  2CUZ A;  4GO1 A;  3AG2 H;  4BHP A;  1X1A A;  1ZR2 A;  1APL C;  2JZY A;  2X48 A;  1J59 A;  3I71 A;  2VC0 A;  2VIX A;  5LGU A;  3GO5 A;  4M3E A;  1IRZ A;  3A0H C;  1BBY A;  2Y30 A;  2Z16 A;  1IRX A;  3RCO A;  4U88 A;  3OSF A;  2IXS A;  1U2W A;  3M4O J;  1SFK A;  3EUA A;  5F64 A;  1EF4 A;  3HOS A;  4NC8 A;  4HPQ A;  2GA1 A;  2OA4 A;  2YR2 A;  1IN5 A;  2HR3 A;  2KIQ A;  3E6M A;  3OYA A;  3KZI C;  1SD5 A;  1Y56 A;  3NRV A;  3O3K A;  2WAQ A;  4FX4 A;  2HPI A;  2Z2S B;  2K3F A;  3GTJ J;  2R5Z B;  1YTY A;  4OAZ A;  1OR7 A;  2RVC A;  2WY7 Q;  3S2D J;  1AA7 A;  3CLO A;  2E35 A;  3ASO H;  4AU7 A;  4YIR X;  3L7W A;  1GV2 A;  2ID3 A;  4AUX A;  3S1M J;  3LWF A;  1S6L A;  1YS7 A;  4DNC A;  2W1O A;  3CMY A;  1X1B A;  3JTG A;  1TZL A;  4C3H J;  3S3M A;  1SFX A;  5JFR A;  4M9S A;  2LKP A;  3CQZ J;  3DWL E;  2L02 A;  1VQ6 I;  2YX7 A;  5KHD A;  1ZKG A;  3T0Y A;  3CES A;  4HYE A;  3PJR A;  1WZ2 A;  3ZMT A;  3MEX A;  2F5C A;  2JSC A;  3KP3 A;  5CVU A;  2KKO A;  3D1N I;  2O8K A;  1JGS A;  1I3A A;  2ZME C;  4A3I J;  2CU7 A;  2X0L A;  3MVP A;  2DYS H;  2R93 J;  3W6V A;  3IH4 A;  4AIH A;  1T39 A;  1BI0 A;  4GGG A;  4KT5 C;  3VOD A;  3OR2 C;  1JKR C;  1ZAO A;  2E1M B;  3K4L A;  1D0Y A;  1ZGA A;  2GOX B;  1LVK A;  1UHS A;  1QPM A;  2HOT A;  2HXI A;  5DDG A;  3A4C A;  2M34 A;  5KNL A;  2XIG A;  2XAS A;  5IT9 K;  3F6O A;  2DFH A;  2GXA A;  2Q2E B;  1OIS A;  3GZN B;  3CCJ I;  4Y52 J;  4XRS A;  1X3U A;  3VSL A;  1ETV A;  1ETO A;  3H5R A;  4GXO A;  1XDU A;  3CDH A;  4A3F J;  1IGN A;  1SD4 A;  2DMT A;  1Q1V A;  2LH9 A;  3BQY A;  5EEH A;  3VYR B;  3H1C A;  3RPU D;  5FJ8 J;  4E7I A;  2WV1 A;  4M71 A;  5D5X B;  1J09 A;  4KNY A;  2ID6 A;  2Q0O A;  5F27 A;  2WC2 A;  4BAC A;  4HX4 A;  4WF2 A;  3MZH A;  2M30 A;  4CYC A;  4BE1 A;  1D1C A;  2BY3 A;  2R7W A;  4HZF A;  4A5N A;  3KEY A;  2RQP A;  3M07 A;  2RNG A;  3RTR A;  3GF2 A;  1MDM A;  3TOB A;  2EIJ H;  1OCT C;  4QSH A;  3DEE A;  4L9V A;  1I27 A;  4H4K C;  5D4R A;  1JJ6 C;  4M3G A;  3I4P A;  4EM0 B;  1WJD A;  4HV5 A;  3HSE A;  2DU9 A;  2JQ7 A;  4II2 A;  2HWV A;  3GTQ J;  1WHU A;  3WTV C;  3RKX A;  3OIQ A;  4XMY A;  3T1B A;  3ZQF A;  4F92 B;  4BHC A;  3VWB A;  1S72 I;  1KQ8 A;  5J6X A;  3K4N A;  1MND A;  4IQ4 A;  1WI9 A;  2ZO4 A;  2A6T A;  1DP7 P;  3J81 K;  4XK4 A;  3U2R A;  3C2H A;  3BCB A;  1VI0 A;  4NQW A;  1K78 A;  2HVQ A;  4ENJ A;  3PQK A;  2TDX A;  4XM3 A;  3SFI A;  4XLH A;  2EFW A;  1ON2 A;  1S3J A;  3GLL A;  1B59 A;  2A6E F;  1BIA A;  2VXZ A;  4CDG A;  5HS7 A;  2STT A;  4PUS A;  3BR2 A;  1W36 C;  2L9S A;  1TTY A;  3FXQ A;  1W36 D;  2LC2 A;  3CCL I;  3OIO A;  3ZQG A;  5EYR A;  2WB1 A;  2EIL H;  4BS9 A;  3GYH X;  1CF7 A;  3F3X A;  4UHT A;  2GLO A;  2ACJ A;  3TP0 A;  1TL8 A;  3I9V 2;  3AG3 H;  3K1N A;  4CCO A;  2A61 A;  5H6R A;  3KP6 A;  4OAY A;  3HOV J;  2STW A;  3K2A A;  2L4M A;  2DOA A;  3FXO A;  2JA5 J;  4MQ9 F;  2J5O A;  4BEH B;  3CLQ A;  3LFU A;  1LFP A;  3S15 J;  5LHH A;  4JP0 A;  3ZQQ A;  1OLT A;  4IRH A;  1L0O C;  1MJA A;  2BY1 A;  5GP9 A;  3JAM K;  3IH3 A;  4FE4 A;  5LRR A;  1Q1H A;  1BJA A;  2ZME B;  4B1R A;  1I1G A;  3E0J B;  1XN7 A;  3G3Z A;  1IZ1 A;  2H94 A;  2LY9 A;  4YG2 F;  4MNU A;  4CSW A;  3HEF A;  2MA3 A;  2LD5 A;  1LEB A;  3LSI A;  3K4J A;  1BJZ A;  3QP5 A;  4WXH A;  1BC7 C;  2RQQ A;  1FJL A;  2VAS A;  3B6C A;  5IYB J;  5J4V A;  3J80 Z;  3KLN A;  1N78 A;  2QM3 A;  2YS9 A;  2HOA A;  4NUB A;  3QOD A;  4XN0 A;  4F3Q A;  4LK0 F;  4F93 B;  2LBF B;  5DD8 A;  2I5U A;  4ENK A;  5HLI A;  4BAY A;  5IY5 H;  2K9Q A;  4KIG A;  2DQR A;  2R7R A;  2F2E A;  4WK8 F;  4E7H A;  1FOX A;  3D5S C;  1NG6 A;  3SFZ A;  1Y1V J;  3BR3 A;  2RN7 A;  3HIF A;  2UXX A;  2WV0 A;  3C3W A;  3MKY B;  1Y6I A;  2K7L A;  1I6H J;  2VKV A;  4PJN A;  5E79 C;  1OKR A;  3K70 C;  4IOA F;  3ZN1 A;  4CZC A;  2YU3 A;  1ZHF A;  2COM A;  1IG7 A;  2MG4 A;  2RAE A;  3L2R A;  2VOP A;  4IRI A;  2X6Y A;  2UWM A;  2XUB A;  2PMZ N;  2NNY A;  5IPA A;  3TW7 A;  3S14 J;  3M8J A;  1DU0 A;  2PI0 A;  3PO2 J;  4BE2 A;  3NAR A;  4G7Z F;  1MSF C;  2V9V A;  4CCM A;  4OIN F;  3OYH A;  4V19 K;  4IRG A;  5F08 A;  2CQN A;  3DEU A;  3MZ8 A;  2VKH A;  2B0L A;  5J8C A;  2L7Z A;  3HOW J;  4FX0 A;  3HDD A;  2VPR A;  4KIB A;  3CP2 A;  2JSP A;  3SJM A;  1SFE A;  5M3M J;  2X6W A;  2P5V A;  2ISY A;  4HA8 A;  2V7F A;  4QPO A;  3EQL F;  4B09 A;  2XGC A;  5D8K B;  2FU4 A;  1UAA A;  1O57 A;  4BDZ A;  3I59 A;  2JPC A;  3TO6 A;  2W85 A;  3BWG A;  1T0F A;  1WGX A;  4BHB A;  2EFN A;  3ABU A;  2V9K A;  3V7R A;  3PNT A;  1IRG A;  3A01 A;  1R23 A;  1ZTR A;  1P4X A;  3CDL A;  3FDY A;  4C3I J;  5B1A H;  2AS5 F;  2O8X A;  2OTJ I;  3M7G A;  2M0M A;  1W5C C;  4M3D A;  3GZ6 A;  1FOW A;  3HC7 A;  2E7X A;  4JBA A;  2EA2 A;  1RR7 A;  1Y8Q B;  1P6R A;  1YQA A;  3DBH B;  1FMV A;  2CJJ A;  2OQR A;  2DMU A;  4RAG A;  3OY9 A;  5AIP A;  2EBI A;  2HS5 A;  1YLF A;  2ESN A;  5HS8 A;  4XIC A;  2L7K A;  1KU7 A;  2C6Y A;  2JK3 A;  2XAF A;  3LST A;  1YRN A;  2KIM A;  1YIJ I;  2HEO A;  3MWM A;  5C44 J;  3FKJ A;  2XAQ A;  4F7Z A;  1ENH A;  1QNT A;  2L9N A;  2DMQ A;  2XB5 A;  5D5U B;  1MH3 A;  4Q47 A;  2BZT A;  3SZT A;  3ROU A;  4HF0 A;  3HGG A;  4XKW A;  4I01 A;  2W82 A;  1TT5 B;  1UEL B;  2HVS A;  1KU9 A;  2K85 A;  3TBI A;  1ZG5 A;  1IN6 A;  2IEK A;  5HLT A;  3JSP A;  1TC3 C;  5DCM A;  1Y0U A;  2W48 A;  2DBB A;  4U0V A;  2H27 A;  4I2O A;  1W7P B;  3BZ6 A;  5LHI A;  1FSE A;  2EA4 A;  2KRF A;  4HAM A;  4RS8 A;  1W0U A;  5FLM J;  2HXO A;  4BYY A;  2MBF A;  3S17 J;  1S29 A;  3ZMZ A;  3MKW B;  3F23 A;  4WXC A;  1P9Q C;  3OMY A;  1R4N B;  1OCO H;  4A0X A;  2HNH A;  3QWL A;  1YW9 A;  3WTW C;  1ZR4 A;  1JT0 A;  1GDT A;  2GA2 A;  5FKO A;  1TNT A;  1R00 A;  5J47 A;  3CCM I;  3E3V A;  1VND A;  4D1Q A;  1R1U A;  2EH3 A;  1FC3 A;  3QAH A;  3UNG C;  2DA2 A;  2GM4 A;  2FE3 A;  2O3F A;  4NC6 A;  5EG0 A;  1ODD A;  3RPQ A;  2HGC A;  4WCG A;  1E3H A;  2WAF A;  3H9J A;  3OS0 A;  3LOC A;  4B47 A;  5E17 F;  4XLC A;  1HF0 A;  3O8G A;  3QOE A;  2WAD A;  3DCF A;  3FK6 A;  3U1D A;  5ICF A;  1FP1 D;  5ILS A;  1E3O C;  1U5T A;  2QLZ A;  5B5E C;  1PDN C;  3GFJ A;  3F9K A;  3IRR A;  1JJ8 C;  2M8E A;  2OC6 A;  4QLC U;  5C3E J;  4UNO A;  4HX8 A;  3REO A;  3HOT A;  1TQI A;  2QF7 A;  4MEY F;  1SMT A;  1GT0 C;  3OL3 A;  1VTN C;  2O0Y A;  3TGN A;  1ZRF A;  4JX4 A;  2R5Y B;  4FCY A;  2AHQ A;  1LDD A;  1V5F A;  1WJF A;  2DMP A;  4A0Z A;  3A2K A;  2M8G X;  1BA5 A;  3IL2 A;  3QQA A;  5D4S A;  1J0R A;  1Z21 A;  2G7U A;  1GV5 A;  2R7S A;  4QPQ A;  3TKY A;  4OIO F;  3RYR A;  5EZH A;  3V42 A;  3C2B A;  3DBL B;  1PUF B;  1RET A;  1XGS A;  2E19 A;  2IP2 A;  1FYK A;  5M5X J;  4CCN A;  3PFI A;  2EZH A;  4WWC A;  2AXL A;  2K4B A;  3I53 A;  2HZD A;  4R8H A;  2QGU A;  4D7M A;  5EEA A;  3JRB A;  1YI2 I;  1LVA A;  4AYB A;  4G9Y A;  3V4G A;  3MN2 A;  2DFE A;  2FA5 A;  1V4R A;  4X1E A;  2CV2 A;  3L2C A;  3C1D A;  3FBI B;  4YFK F;  3HGY A;  3KP4 A;  1O7F A;  2L2O A;  3DKY A;  1H0M A;  4U7D A;  4BE0 A;  4RAZ A;  1LJ9 A;  1WH7 A;  3HOU J;  2BW3 B;  2I10 A;  3K1M A;  5DV5 A;  2XDV A;  4I0B A;  5EGO A;  4IO9 F;  2HQA A;  2FBK A;  2NVX J;  2OBP A;  2K27 A;  1TQP A;  2AXT C;  3BT9 A;  1WJE A;  3FXR A;  3A1Y A;  2VL8 A;  2ETH A;  3DTI A;  1GVJ A;  1R4M B;  2DA5 A;  2IA1 A;  5ILV A;  2R7V A;  4AVP A;  2GAU A;  1MBE A;  1TT0 A;  3NWS A;  3MZY A;  4DBQ A;  4UY8 I;  5CVJ A;  2WAQ N;  1O3T A;  2DK5 A;  1EV7 A;  1FBS A;  4N4O B;  4O6J A;  1UST A;  1BW6 A;  2EPF A;  3K4C A;  4RLQ A;  4L9T A;  4MEX F;  3J7Z I;  2IGN A;  1XC5 A;  5CKT A;  2FML A;  1AU7 A;  1OYI A;  1R6R A;  4PJM A;  2XKP A;  5AIQ A;  3BG5 A;  1J5Y A;  4HV6 A;  3EYI A;  3H3V K;  2E34 A;  3E5Q A;  3GWZ A;  4LMY A;  2VBX A;  2XPV A;  3DKX A;  3OOP A;  3L2W A;  4V2F A;  3K69 A;  3H5N A;  4XLA A;  1PP7 U;  2P6T A;  1UCR A;  4IEJ A;  5CPR B;  3HL2 A;  4HQE A;  2LK2 A;  2HTS A;  2V9P A;  5DD4 A;  3ZQL A;  2MH9 A;  2E1O A;  2MD0 A;  4E70 A;  2HQR A;  4EJW A;  1RPW A;  2QSG X;  3KP5 A;  3RPU A;  3BZK A;  1YW8 A;  1IN8 A;  2IA0 A;  1OCR H;  2JA8 J;  5DUI A;  5HNF A;  3CC7 I;  1Y8R B;  3CMM A;  2GIV A;  4BQQ A;  1LFU P;  1QVT A;  2E5Z A;  2YPR A;  3FK7 A;  2VE9 A;  3CCQ I;  1MSE C;  3E6B A;  1QZZ A;  1HW1 A;  3LSH A;  2HPM A;  2ELH A;  4CIC A;  2FUG 2;  1FT9 A;  2DA1 A;  1FIA A;  2VT3 A;  3BR5 A;  4ZYE A;  4IZZ A;  4AC0 A;  3VYS B;  2Y31 A;  4UV9 A;  3K4K A;  3H0G J;  4ZTF A;  2YX4 A;  4CHU A;  3L9F A;  5K1Y A;  1IN4 A;  3KET A;  2LF8 A;  2YUS A;  5GAG J;  5IP9 J;  5L3B A;  1YJN I;  3HOY J;  3BR1 A;  1IN7 A;  2QQA A;  1F9N A;  3IAS 2;  2KIS A;  4B8X A;  4V2G A;  3PNV A;  3ZMD A;  3ZPL A;  1Z77 A;  2E1M C;  3EDP A;  2LF7 A;  5CLS A;  2XF6 A;  4I98 B;  4A6D A;  2G9W A;  2O9L A;  4C9Y A;  5GAD J;  5CVI A;  5F1J A;  4BJ6 C;  2LTP A;  3OYN A;  2VB6 A;  1ETY A;  4GRI A;  3M9A A;  1K61 A;  1T33 A;  1I5Z A;  5EZG A;  1BN5 A;  2CQX A;  3RIR A;  4PFO A;  1V55 H;  3F21 A;  2BY0 A;  3CJT B;  3IC7 A;  4XLN F;  4OIR F;  4DBR A;  3BCA A;  4MTD A;  4M9Z A;  2EIN H;  3H36 A;  2V6C A;  1V5E A;  3K9T A;  1FOY A;  4IHT A;  2H09 A;  5D6E A;  3T5X A;  3CCR I;  1N77 A;  4RDU A;  4XOR A;  3E97 A;  2TCT A;  4P55 A;  4RA2 A;  2QSH X;  4XKB A;  2EV5 A;  5D8L B;  4H0E A;  2HOS A;  2JJ7 A;  4IHV A;  2MH2 A;  1OQY A;  3NEU A;  2E1N A;  5CVR A;  3CJN A;  2VJJ A;  4HDV A;  2LYC A;  1H9T A;  1AKH B;  5DM6 F;  1XSD A;  2X1E A;  1JKP C;  5IYC J;  4ZJZ A;  3AFH A;  5KAI C;  1ZAR A;  1U0J A;  3WTX C;  2W00 A;  2WB1 N;  4YII A;  3LAJ A;  3PIP F;  1XS9 A;  3GTG J;  1Z3Y A;  4UXN A;  4G8X A;  1KQ0 A;  1W0T A;  1B8I A;  2IS6 A;  2OD5 A;  3IV5 A;  2LR8 A;  4P96 A;  2PJR A;  3IH2 A;  3LSR A;  3JRF A;  5DUK A;  3D0S A;  4HEA 2;  2K9M A;  4YEJ A;  3EUH C;  1G3T A;  4ITV A;  1YX3 A;  3TOA A;  3R0J A;  4XBF A;  3ESW B;  1ZG3 A;  5LEK A;  2V4J C;  3W6K B;  5BOX A;  1I3Q J;  3KLO A;  3ZR8 X;  2A05 A;  5DM7 F;  1XMA A;  5ED4 A;  3BQZ A;  2QA4 I;  5ICG A;  3GW2 A;  3FMS A;  3RKY A;  4L5J A;  3C7J A;  3TMO A;  3OWT A;  3M1E A;  2X6X A;  3IWZ A;  2IW5 A;  5LGT A;  3J81 Z;  1KYZ A;  2CW8 A;  2XHK A;  3V7S A;  3BJ6 A;  3U21 A;  3BPV A;  1FOK A;  4PCQ A;  5E3O A;  4LLG F;  4Q5S F;  3HUG A;  3S2H J;  3HJE A;  3S2W A;  5BPI A;  1X1C A;  4C2M J;  4LG0 A;  2BGC A;  2MD5 A;  4HX7 A;  1NTC A;  1ULY A;  2ZXH A;  4FE7 A;  5HDN A;  2JRM A;  2ZNY A;  3IHU A;  1PJR A;  2PX9 A;  2HYG D;  3BJO A;  4UB8 C;  2TRT A;  5E8G A;  3AKZ A;  4XQF A;  3CUQ B;  4BKX A;  3TDZ C;  2Y0M A;  2V6E A;  1QZE A;  2OF7 A;  1XPX A;  1XSV A;  4KMF A;  5LRS A;  2BOL A;  5K5O A;  2JA2 A;  4XSZ F;  1HCR A;  3WU2 C;  2RV8 A;  2F6C A;  1KON A;  3O2P E;  2PEX A;  2JPB A;  3BOQ A;  1J9I A;  4ABZ A;  1ZGJ A;  2A3S A;  4C3J J;  4BU2 A;  3H9Q A;  5IYD J;  2VKD A;  1ZG1 A;  2BXZ A;  3FHN A;  1CQT A;  3JAM Z;  2IS2 A;  3MKL A;  4LB5 A;  4G12 A;  3G6E I;  4B48 A;  2IJL A;  5ILU A;  1B1B A;  3RJP A;  2WA0 A;  5FD6 A;  5TGT A;  2E2J J;  2RGV A;  3LQQ A;  4I6Z A;  4ZZL A;  1A5J A;  1G59 A;  4UUT A;  1A6I A;  2H8W A;  3S32 A;  3OS1 A;  1HKT A;  4FHT A;  3RSN A;  1AOY A;  3I56 I;  3JCU C;  5ERI A;  2W7N A;  2EJR A;  2BVM A;  3WGH A;  1ZRE A;  1ERD A;  2EFO A;  2LY1 A;  1B72 B;  1U6G A;  1HST A;  2ZFU A;  2XPU A;  2ICW G;  2DCE A;  4FAS D;  2CFO A;  2KDO A;  2CG4 A;  1BI2 A;  4L0Z B;  1X1P A;  2KHM A;  3AG4 H;  3HRT A;  4PSX A;  4F91 B;  3K6G A;  4P9F A;  5FKN A;  4LLN A;  1OYW A;  2BYV E;  1REP C;  3AL0 B;  4KN7 X;  1U9O A;  2BE5 F;  2OZ6 A;  4M6Y A;  5HLH A;  2OTL I;  4M9X A;  1DGW Y;  3DPL C;  2LG4 A;  3JRI A;  2D45 A;  3ZN0 A;  3R61 A;  4L18 B;  1ORK A;  3KEQ A;  2B9S A;  1T2K A;  4MQV A;  3U9G A;  5GPC A;  1T98 A;  2JA7 J;  1OFC X;  1HSJ A;  5K7F A;  4KJZ A;  5DYM A;  1LE8 B;  3I64 A;  2NVU B;  1S5L C;  1FWZ A;  4KYW A;  2D1V A;  2KT0 A;  1QPI A;  2E1C A;  3RKW A;  3GTL J;  3LA7 A;  3KYC B;  3DPT A;  3LSG A;  4EGY A;  2VBW A;  4UUV A;  2FMY A;  4CUG A;  1QU3 A;  4XOT A;  3Q3S A;  4MTE A;  3PSI A;  1D3Y A;  3GFM A;  1WRJ A;  2W25 A;  3TW6 A;  3CP8 A;  4TV7 A;  1OCC H;  5GAH J;  2EWN A;  2E2I J;  1DU6 A;  3IKT A;  2EIM H;  1YJ9 I;  3KP2 A;  1O3Q A;  1HKS A;  4HBL A;  3ZQC A;  2DFI A;  3CF2 A;  2DPU A;  4IHS A;  2Y9Y A;  3DKW A;  3BP8 A;  2XGD A;  3IAM 2;  2MLK A;  2W24 A;  4LIV A;  3L2V A;  2QBY A;  4OU0 A;  1X1D A;  1JI8 A;  2MC4 A;  3IRQ A;  1LKX A;  4KA4 A;  4YRV A;  5J4Y A;  2COB A;  3DFG A;  2BXY A;  2KRH A;  5JR3 A;  2VPL A;  2XB0 X;  1AHD P;  2JWT A;  1S7A A;  2IBD A;  4HRI A;  3ULQ B;  1S9H A;  1STZ A;  2RNJ A;  3GTK J;  1X58 A;  4BNC A;  1W7P D;  3OV8 A;  1UG0 A;  3K4B A;  3NQO A;  3ELK A;  3WE3 A;  3FKI J;  5D5V B;  4L9N A;  3JRG A;  4A3E J;  1SAU A;  3OOU A;  4OIP F;  3I58 A;  1QGP A;  3DLA A;  5JVT A;  1H9G A;  1DP3 A;  3DEW A;  2FD5 A;  4MLO A;  2QVO A;  4X6A J;  1Z7U A;  4XSX F;  2DK8 A;  1QA6 A;  4ZTJ A;  3WOD F;  1Z67 A;  4GCV A;  4BY1 J;  1A04 A;  3MQ0 A;  1VQL I;  3L2U A;  5LHG A;  4N4N B;  3QPL A;  3OYE A;  1JTY A;  3A0B C;  2JVG A;  4D7N A;  1Z9C A;  4EM1 A;  3K70 D;  3A02 A;  3F8M A;  3DF8 A;  2FSW A;  3FXL A;  5KAF C;  3JRC A;  6PAX A;  4LG3 A;  4HNU A;  5C4X J;  2BBY A;  2NOJ B;  2CWE A;  1BW5 A;  2LY2 A;  5H6Q A;  1DPU A;  1ZK8 A;  1FPQ A;  1GLN A;  1ZYR F;  1BR2 A;  4NC7 A;  5L3F A;  2HDD A;  2PMH A;  4KFC A;  3GBG A;  3VEP A;  1V3F A;  1YO5 C;  3PQJ A;  3R0A A;  1U3E M;  3G73 A;  2GIZ A;  1UG2 A;  1XMK A;  2MGQ A;  3Q0U A;  5E1Z B;  2DTZ A;  4KMU X;  2DA6 A;  2LFB A;  3F72 A;  2EV6 A;  1GUU A;  4HST A;  1RKW A;  1X4P A;  5L3E A;  4Y13 A;  5A2Q Z;  3M3Y J;  5F6F A;  4B43 A;  3DPU A;  2QQB A;  3RZD J;  3L1P A;  4AYB N;  5FB2 A;  4D5C A;  2Q1Z B;  1G2H A;  2P7C B;  5FRN A;  3K2Z A;  4HLY A;  1ZGW A;  1IRF A;  4I7H A;  3V8J A;  4Y33 A;  4B4C A;  1XB4 A;  1XSX A;  4ZDO A;  3GFI A;  2Z3Y A;  2E60 A;  2HZT A;  3MCZ A;  3ZXS A;  3OYJ A;  1M1E B;  2QCO A;  1XTA A;  2ZJR F;  1G6N A;  2EZL A;  2XC7 A;  1BI1 A;  3RQ4 A;  4BBR J;  4U0W A;  3P9K A;  3FIS A;  2ZNZ A;  2V1N A;  1U78 A;  2H6B A;  3FXK A;  3QU6 A;  4AVZ A;  1B4A A;  1H89 C;  2XAH A;  3QYB A;  1D5Y A;  4UVB A;  5FLV A;  4HF2 A;  2DDA A;  3W2V A;  2L7F P;  3FIW A;  1NH3 A;  4IF4 A;  2R5Z A;  4P1W A;  3PM1 A;  2VQH A;  1J75 A;  2F5V A;  2KZG A;  2R0Q C;  4J01 A;  1GVD A;  1IAW A;  1QHG A;  5EF6 A;  4MHG A;  1SFO J;  5TIS C;  2PLY A;  3LSJ A;  2FNP A;  4BJ5 C;  4BBS J;  3EUK L;  2Y0S A;  3OYB A;  4A93 J;  3VSK A;  1T08 B;  3BTI A;  3UKG A;  2CSO A;  4IXA A;  1MW7 A;  2F5E A;  4FQG A;  1SC7 A;  5E18 F;  5L3C A;  2ZC2 A;  2CUJ A;  3I4N J;  4BXX J;  1WI3 A;  2W84 A;  2ZSH B;  2IRF G;  2Y2Z A;  3KZZ A;  2M0C A;  4RB3 C;  5C4J J;  4U87 A;  1XGO A;  2FQ3 A;  3WHB A;  3H35 A;  4CCK A;  1FMW A;  1I39 A;  2LOO A;  3OL4 A;  2QKM B;  4KN4 X;  2VUM J;  3BLY A;  1VQM I;  2V26 A;  3LSP A;  4L5E A;  1UMQ A;  5K7Z A;  1R5H A;  2KLO A;  4LLL A;  4F52 A;  3GCM A;  4A6E A;  2NS0 A;  1QRY A;  1PP8 F;  3DQV C;  3GTP J;  1W5S A;  3I4M J;  4RB2 C;  2DA3 A;  4ESF A;  1LNW A;  2QKL B;  3CUO A;  3FXM A;  5F0H A;  2Q2E A;  4PJ0 C;  1MBJ A;  2Q8K A;  4XRM A;  3BDD A;  2EFQ A;  1IXR C;  5DS9 A;  5ICE A;  2DMN A;  3E5X A;  4P9U A;  4IL6 C;  5A2Q K;  2DA7 A;  4BQO A;  3CJQ B;  1V54 H;  3HSF A;  4DZJ A;  3WTU C;  1A31 A;  4R79 A;  1R7J A;  3W3C A;  5IP6 A;  2AQE A;  2VLA A;  3KX2 A;  3V7C A;  4LOC A;  4DJA A;  3BR6 A;  2XKO A;  2M2E A;  1MNE A;  4S04 A;  4PJJ A;  1ETX A;  3ABM H;  1X2M A;  2NVY J;  1OJL A;  1BIB A;  3BG3 A;  3F8B A;  2ZFW A;  4QWQ A;  4KT6 A;  2RKH A;  4ZYG A;  1IXS B;  3G1O A;  4O3M A;  1D1A A;  3H9G A;  2HDC A;  4I02 A;  4PGG A;  5HNH A;  3LSM A;  3D5L A;  1ZRC A;  3GUD A;  3HBL A;  3F22 A;  1K7A A;  5IOZ A;  2DPD A;  3CZ6 A;  2UXN A;  1RUO A;  4ENN A;  5M5Y J;  2QSF X;  3QYF A;  1MMS A;  1VFC A;  3TQN A;  1LUJ B;  2FBI A;  4F55 A;  3ZMS A;  1VQK I;  3GTO J;  2IGM A;  3FF5 A;  4NB5 A;  2M3A A;  2JUG A;  3CC4 I;  3IP4 B;  2BY2 A;  3SDG A;  4W97 A;  2RC4 A;  1X4O A;  5FRM A;  9ANT A;  1RC9 A;  5DEQ A;  2HYF A;  4XL9 A;  5BMZ A;  4B3X A;  2D1H A;  1ZEL A;  2RDP A;  2DOF A;  2L3D A;  4Q48 A;  3EUH A;  3RKQ A;  3LSK A;  3W2W A;  3HSR A;  3K7A J;  1VQ8 I;  3P9I A;  1ONV A;  2A6H F;  1HW5 A;  1ETQ A;  1SAX A;  1MH4 A;  3O6B B;  4KIC A;  3V8L A;  4ENM A;  1WVR A;  3ABL H;  3N97 A;  3CMA I;  1RKT A;  1OCP A;  2EZK A;  3HPG A;  4RGR A;  4OMY A;  2XRN A;  1HA8 A;  4HLX A;  4FET A;  1R1V A;  3ZCO A;  1ZRD A;  2GXG A;  1K83 J;  1VQO I;  4BUP A;  1VQN I;  5FO5 A;  4I0A A;  1HXD A;  5EDN A;  1O7L A;  3IKV A;  2QQ9 A;  2P6S A;  4YFX F;  3L2Q A;  5LEJ A;  2JUC A;  4BEH A;  2H1K A;  2OQG A;  3KP7 A;  4PJL A;  3V8K A;  3HOX J;  2DW4 A;  1OCZ H;  3VDX A;  1FBU A;  1MNM C;  4KIF A;  1W1W E;  1W5T A;  2ZME A;  4CYC B;  2KIU A;  1EH6 A;  3HG9 A;  3TDU C;  1F1Z A;  2CH0 A;  3KYD B;  2XAU A;  3R6S A;  2DJI A;  5JLW A;  3JRA A;  1MDM B;  2M9H A;  4ZYA A;  5FRO A;  2CQQ A;  1HKQ A;  3SHF A;  4PZJ A;  4BY7 J;  2LMD A;  1XX5 A;  1R58 A;  2M1B A;  2NAZ A;  1FY7 A;  2VBY A;  4IPA A;  1PVE A;  3CCE I;  1TLH B;  1YS6 A;  3ECO A;  3M1C A;  5HOD A;  4NNJ A;  2VC1 A;  3LQR A;  5GTI C;  5M5W J;  3OYF A;  2ZXW H;  2LBF A;  4PSW A;  3SYT A;  2J5P A;  1WCM J;  1E2X A;  4CA0 A;  2OPT A;  1JTX A;  2FXA A;  3LA3 A;  2HDW A;  4EJV A;  1XG1 A;  2ZKZ A;  3PUB A;  4PFP A;  3CCV I;  3EYY A;  2F4I A;  3DXJ F;  5B3S H;  5KK1 A;  4NQW B;  1K78 B;  1NK3 P;  4S0H B;  2LVS A;  4G6T B;  4DOZ A;  4A3D J;  4IOC F;  1QQI A;  4M6V A;  1YYV A;  2DJN A;  3BRO A;  4RB0 A;  3EPZ A;  1YFH A;  5D6F A;  1HQC A;  3X2Q H;  1VQ5 I;  1FTZ A;  2DA4 A;  2FNA A;  3HYI A;  1XD7 A;  2R4G A;  1LB2 A;  3JRH A;  2P4W A;  1K4S A;  1Z6T A;  4CO8 A;  3SZP A;  2VJ5 A;  4K2E A;  2XGE A;  1VQP I;  1CF7 B;  1FZP B;  1JUM A;  2HI3 A;  4LD5 A;  3BC8 A;  5H2F C;  4ANJ A;  3JSO A;  3G1L A;  4M74 A;  3COA C;  2PQ8 A;  1ACI A;  2MFZ A;  4E7L A;  2Z9O A;  2H1L A;  3TL4 X;  3BTC A;  3CUQ C;  2KP6 A;  3S3N A;  2XF7 A;  2FBH A;  1MMN A;  2VT2 A;  2M4G A;  1JE8 A;  1IO2 A;  4IHX A;  4E7Z A;  1IC8 A;  3BJA A;  2WTE A;  2XPW A;  1IUY A;  4BXF A;  4FT8 A;  3ISP A;  1IDZ A;  1YX5 A;  3L09 A;  2XGX A;  1YHQ I;  2CMP A;  2FX0 A;  2DOE A;  5F0F A;  1P92 A;  3HKZ A;  1V5G A;  4XLP F;  2E5N A;  4RB1 A;  1UHM A;  2R3S A;  4ZDL A;  1B9M A;  2CFX A;  2R7Q A;  1G3W A;  1SAN A;  3S8P A;  2KJB A;  2DT7 B;  3T8R A;  1U9N A;  3OYD A;  2K9N A;  2M87 A;  3HXL A;  1MBG A;  1P7I A;  3FM5 A;  4IJA A;  1SVM A;  4AM3 A;  5FLX K;  1WKM A;  4IQJ A;  3KEO A;  5CQG A;  2NOG A;  4XR6 A;  1Y0N A;  4N9I A;  3JR9 A;  4MFD A;  4YIF A;  2KPM A;  3T8T A;  1NK2 P;  3Q9S A;  3BG6 A;  1IXC A;  3KPH A;  4W1U A;  2JN6 A;  2O5R A;  2R92 J;  3GFL A;  3SQN A;  1HW2 A;  4DIQ A;  3PUF A;  4RMN A;  1X3Z B;  4OMZ A;  4UB6 C;  1O3S A;  3AL0 C;  1ZH5 A;  1JUS A;  1XCV A;  5E3N A;  4WXD A;  1SVO A;  2FF4 A;  2R7O A;  3H92 A;  3MD2 A;  3ZQI A;  1SEU A;  1BM9 A;  1VQ9 I;  2E36 A;  2R7U A;  1OYY A;  2W57 A;  3E5U A;  1W7P A;  3HM5 A;  1R22 A;  5J1Y A;  3WU0 A;  4KDP A;  2OCC H;  4UVA A;  2A07 F;  2X9D A;  4B44 A;  2CQ7 A;  4L9J A;  2MYS A;  3WTS C;  2FJ1 A;  2A69 F;  4DGW B;  1FEX A;  2DOD A;  3FMR A;  2VN2 A; 
#chains in the Genus database with same CATH homology
 5KCM A;  3G2B A;  3LMM A;  2KRC A;  3FBN B;  3FKJ A;  1WFX A;  2L9N A;  4XKV A;  3UR3 C;  4CH7 A;  2K9L A;  3CF2 A;  2GOM A;  4XKW A;  2W82 A;  3KYL A;  1UEL B;  4LIV A;  1X19 A;  3IAM 2;  3L2V A;  2HVS A;  3SEZ A;  1X1D A;  3TBI A;  1JI8 A;  2MC4 A;  4LIT A;  1WJC A;  5HLT A;  4E6K G;  1LKX A;  1T0F C;  1K6Y A;  4YRV A;  2KRH A;  1DQU A;  2VPL A;  4XON A;  4HRI A;  2RRE A;  3MKW B;  2IS1 A;  2KL4 A;  1S9H A;  1P9Q C;  3OMY A;  2HNH A;  4P5O A;  1UG0 A;  3K4B A;  2CV0 A;  1DGR M;  4D1Q A;  3CJR B;  2OUM A;  1SAU A;  3OOU A;  1LDK B;  3DLA A;  3UNG C;  5JHF A;  1DP3 A;  4MLO A;  2IGK A;  4EAT A;  4ZTJ A;  2WAF A;  3H9J A;  3NWT A;  3PL8 A;  3OS0 A;  4B47 A;  4XLC A;  3QOE A;  2WAD A;  2VQC A;  5CQE A;  4BDY A;  3OS2 A;  4JQF A;  3L2U A;  4N4N B;  3OYE A;  2JVG A;  3F9K A;  2K5C A;  4BJT A;  2OC6 A;  3K70 D;  2X1D A;  3VYU B;  3HOT A;  4Y3O A;  1PYV A;  4LG3 A;  4HNU A;  2NOJ B;  3OL3 A;  1D0X A;  2LY2 A;  2WBM A;  5LD2 C;  1GLN A;  1BR2 A;  4NC7 A;  1V5F A;  1WJF A;  3GBG A;  3A2K A;  1QHH D;  2I8D A;  1Z7L A;  1Z21 A;  2ELJ A;  2ZSI B;  2X85 A;  2CS3 A;  2R7S A;  2M7B A;  4QPQ A;  2BW3 A;  4HST A;  3V42 A;  1X4P A;  1MMD A;  5LFA A;  4B43 A;  3DPU A;  4HSR A;  2Q1Z B;  5FRN A;  4CCN A;  4Y33 A;  2HZD A;  4ZDO A;  2E60 A;  2X51 A;  3VYT B;  3DU6 A;  3QYE A;  2A5W A;  3ZXS A;  3OYJ A;  4AYB A;  2XC7 A;  3RQ4 A;  2DXI A;  2CV2 A;  3FBI B;  2V1N A;  3MKZ A;  3MMY B;  4AVZ A;  2L2O A;  3DKY A;  4II3 A;  4LIU A;  4J00 A;  3K4M A;  3OYC A;  1NG7 A;  3QYB A;  3S93 A;  2HVR A;  3H0D A;  4BE0 A;  3W2V A;  3PFY A;  4D9J A;  2BW3 B;  3DU5 A;  4XOP A;  2XDV A;  4P1W A;  3HPH A;  2VQH A;  2HQA A;  2F5V A;  1G8X A;  4J01 A;  4JOM A;  4E7J A;  1QHG A;  1WJE A;  2M7A A;  3A1Y A;  2VL8 A;  5HOO A;  3ZRG A;  4BJ5 C;  3DTI A;  3EUK L;  2Y0S A;  3OYB A;  5HVQ C;  3VSK A;  1BR4 A;  2CUZ A;  2R7V A;  1MW7 A;  1X1A A;  1TT0 A;  4RLF A;  2CUJ A;  3NWS A;  4DBQ A;  4HNT A;  2ZSH B;  2VIX A;  4N4O B;  2Z16 A;  4U87 A;  3PSF A;  1IRX A;  3RCO A;  2DT6 A;  2IXS A;  4CCK A;  3H35 A;  4RLQ A;  1SFK A;  1FMW A;  3EUA A;  3K4C A;  2LOO A;  1N75 A;  2IGN A;  2IGO A;  2QKM B;  3OL4 A;  4HPQ A;  4NC8 A;  3HOS A;  2KMU A;  5CKT A;  3BLY A;  3SZG A;  2V26 A;  4C30 A;  1R6R A;  4PJM A;  3OYA A;  1Y56 A;  1BOB A;  2KLO A;  4F52 A;  2WAQ A;  4ZDP A;  2HPI A;  2Z2S B;  4OAZ A;  2WY7 Q;  2VXD A;  3DKX A;  1AA7 A;  3L2W A;  4AU7 A;  3DQV C;  3H5N A;  4XLA A;  4XLE A;  2QKL B;  4BGD A;  2KZV A;  3LL7 A;  2W1O A;  5CPR B;  4E4H A;  3HL2 A;  1X1B A;  3SEQ A;  2R7X A;  1TZL A;  3OIP A;  2MD0 A;  3S3M A;  3DWL E;  5KHD A;  4BQO A;  3CES A;  3CJQ B;  3PJR A;  5HNF A;  4R79 A;  3W3C A;  2W4S A;  2AQE A;  3CMM A;  4BQQ A;  2VLA A;  3KX2 A;  4KIS A;  2E5Z A;  1WJA A;  3LSH A;  4DJA A;  2HPM A;  1MNE A;  2FUG 2;  4PJJ A;  4IZZ A;  1EA3 A;  3IUO A;  4XNF A;  3VYS B;  3K4K A;  4ZTF A;  3OR2 C;  2E1M B;  3I3L A;  4KT6 A;  3K4L A;  1D0Y A;  1D1A A;  2GOX B;  3H9G A;  1LVK A;  4BQN A;  3A4C A;  5HNH A;  3IAS 2;  3LSM A;  5KNL A;  3D5L A;  2Q2E B;  3PNV A;  2UV1 A;  1OR7 C;  3CZ6 A;  2E1M C;  3VSL A;  2XF6 A;  2Z1D A;  3H5R A;  4IX7 A;  4C9Y A;  3QYF A;  4BJ6 C;  3OYN A;  2VB6 A;  4F55 A;  4GRI A;  4X0G A;  2IGM A;  2LH9 A;  2M3A A;  4PK4 A;  2JUG A;  2BVL A;  3VYR B;  2VJ4 A;  3IP4 B;  3RPU D;  4KIT B;  3H5A A;  1X4O A;  4PFO A;  4E7I A;  5FRM A;  1J09 A;  3ZGK A;  4BAC A;  4XL9 A;  4BE1 A;  1D1C A;  4B3X A;  4DBR A;  2R7W A;  3BCA A;  1ZEL A;  4E7S A;  3LSK A;  3KEY A;  3DTK A;  3W2W A;  1V5E A;  2RNG A;  3RTR A;  4U7B A;  4RM3 A;  1N77 A;  3DEE A;  4XOR A;  2K3P A;  4H4K C;  3HPG A;  4XKB A;  4C2U A;  1HA8 A;  2XSJ C;  1WJD A;  4FET A;  3ZCO A;  2LRD A;  4II2 A;  4BUP A;  3OIQ A;  4XMY A;  4E7K A;  4F92 B;  2CV1 A;  4XN3 A;  2VJJ A;  2LYC A;  3VWB A;  2JVH A;  3BG7 A;  2UUZ A;  1WJ5 A;  3L2Q A;  3W2A A;  3K4N A;  4BEH A;  1MND A;  2X1E A;  2P0W A;  1T95 A;  1MMG A;  4IQ4 A;  4PJL A;  2A6T A;  3AFH A;  4ZJZ A;  3C2H A;  3VDX A;  3BCB A;  1U0J A;  2W00 A;  2HVQ A;  4XM3 A;  3OYI A;  1Z3Y A;  2VQG A;  3HG9 A;  4HG2 A;  4XLH A;  2CH0 A;  2X1C A;  2IS6 A;  2XAU A;  4IKF A;  2DJI A;  2VXZ A;  5FRO A;  4ZYA A;  1WJB A;  4PUS A;  1W36 C;  2L9S A;  1W36 D;  2PJR A;  2LC2 A;  2WB1 A;  4BS9 A;  4HEA 2;  2K9M A;  4YEJ A;  3EUH C;  4ITV A;  3M1C A;  1YX3 A;  4NNJ A;  2V4J C;  3I9V 2;  4CCO A;  4BL0 B;  1MMA A;  3OYF A;  3ZR8 X;  2LBF A;  4PSW A;  3SYT A;  4OAY A;  4CA0 A;  2DOA A;  4BEH B;  2HDW A;  3LFU A;  1LFP A;  3PUB A;  4PFP A;  3SDB A;  2F4I A;  3ZQQ A;  4NQW B;  1OLT A;  4G6T B;  4DOZ A;  3TMO A;  3OWT A;  2X6X A;  2VJI A;  2WY8 Q;  3E0J B;  3D5R C;  1BR1 A;  4Y4R A;  4YEL A;  2CW8 A;  2XF5 A;  3EPZ A;  3U21 A;  4C2T A;  4XKC A;  4CSW A;  2R4G A;  1E0E A;  3LSI A;  3K4J A;  1X1C A;  2RQQ A;  2PJR B;  2VAS A;  2VJ5 A;  2ZXH A;  1PJR A;  3AKZ A;  1N78 A;  4CCJ A;  4XQF A;  3BC8 A;  3C2G A;  4ANJ A;  4NUB A;  3QOD A;  2V6E A;  4XN0 A;  4F3Q A;  4F93 B;  2LBF B;  2BOL A;  2JA2 A;  2MFZ A;  3OYK A;  2F6C A;  4E7L A;  1KON A;  2L5Q A;  3TL4 X;  2R7R A;  4E7H A;  2KP6 A;  3S3N A;  3D5S C;  1NG6 A;  2XF7 A;  1MMN A;  1Z3X A;  4BU2 A;  3H9Q A;  2VKD A;  2VQL A;  2M4G A;  3FHN A;  3MKY B;  1Y6I A;  4E7Z A;  4PJN A;  3K70 C;  2IS2 A;  3S3O A;  4CZC A;  3HUG B;  4BXF A;  1YX5 A;  3E1S A;  1YE9 A;  3L2R A;  4B48 A;  2X6Y A;  2CMP A;  2UWM A;  2LRE A;  2WA0 A;  5TGT A;  3HKZ A;  3OYG A;  1V5G A;  2E5N A;  1G59 A;  3M8J A;  3S32 A;  4ZDL A;  3OS1 A;  4BE2 A;  3RSN A;  3OYL A;  4CCM A;  3OYH A;  2W7N A;  2R7Q A;  2BVM A;  1ERD A;  2LY1 A;  3S8P A;  3DTE A;  2R7T A;  2DT7 B;  2VKH A;  2ZFU A;  2PMZ A;  2DCE A;  4FAS D;  3OR1 C;  3OYD A;  2CFO A;  3J7A Y;  2KDO A;  3HXL A;  2MAB A;  2CW7 A;  2KHM A;  3OYM A;  4PSX A;  4RM2 A;  4F91 B;  4IQJ A;  3CP2 A;  3K6G A;  5CQG A;  2JSP A;  2M4K A;  4XR6 A;  3AL0 B;  2X6W A;  2KPM A;  4QPO A;  2V7F A;  2HU9 A;  2IS4 A;  3BG6 A;  1UAA A;  4CCL A;  2O5R A;  4BDZ A;  1DGW Y;  3DPL C;  2LG4 A;  4DIQ A;  4XLF A;  4RMN A;  3N05 A;  2OV7 A;  1D0Z A;  3AL0 C;  2V9K A;  1D1B A;  3PNT A;  3FDY A;  3K10 A;  4ZC3 A;  2R7O A;  4KJZ A;  3MD2 A;  2M0M A;  3PNY A;  2R7U A;  2KQR A;  3HC7 A;  3DPT A;  3LSG A;  1FMV A;  4CUG A;  4B44 A;  1QU3 A;  4XOT A;  2ZXI A;  2AQF A;  3PSI A;  3OY9 A;  2MYS A;  3CP8 A;  1VZ0 A;  4OWR B;  2L7K A;  2WAE A;  4DGW B;  3ONQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...