3ZCOA

Crystal structure of s. cerevisiae sir3 c-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
ETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization of Sir3 Via its C-Terminal Winged Helix Domain is Essential for Yeast Heterochromatin Formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords REGULATORY PROTEIN SIR3
total genus 36
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zcoA00
3ZCOA
chains in the Genus database with same CATH superfamily
4BY1J 3HGYA 2EFOA 1RZ4A 4BBRJ 4CSWA 4YIIA 3ZP5A 3PQKA 4IKFA 4JBAA 4AWXB 3SDGA 4D7NA 2K9NA 4KA4A 2A05A 1LNWA 2ELKA 5E79C 3CDLA 2GXBA 2QGUA 2RREA 3RDIA 3LAJA 2A68F 2MYSA 3AG3H 1YE9A 1OQYA 3DEWA 1E3PA 3LSPA 2VOPA 4FISA 3ABUA 3DPLC 5CVJA 1IN8A 3K10A 3K69A 3ISPA 1A35A 3ERMA 5H2FC 3W3CA 4FTHA 2F4IA 1E2XA 2LFBA 4LMYA 3ZQIA 5H20A 3VYSB 4RM2A 2LF8A 3F8BA 1HDDC 2W48A 5CKTA 2YSRA 2ZJPF 3JRAA 3CJRB 4B43A 3V7CA 1W36D 1NHAA 2RAEA 3O8HA 1O3TA 2Y0MA 2AQEA 2DMUA 4ZYDA 4H4KC 1IO2A 2OJED 3BOQA 4CDGA 2OCEA 5LD2C 4M71A 1A6QA 3WG9A 2WA0A 2WB1N 2QSFX 1ZG1A 4G6TB 3K70C 2BYVE 4KIBA 1QQIA 4A5MA 1LEBA 5E3MA 5CVRA 2ZO4A 2DQRA 4DZPA 4ZZLA 1WJEA 1UG0A 3QOPA 3OS2A 3C1DA 3BTCA 4OAZA 2UZKA 2M0MA 2GLOA 3HRSA 3JTGA 2ZXHA 1HW1A 4DW6A 3DP7A 4GRIA 1QZYA 3S32A 4HF1A 4HAMA 4LK0F 3HHHA 4XBFA 2R5ZA 1MW7A 1CF7A 4XLNF 1FNNA 2EINH 1FMWA 1E3HA 3RKQA 4DYCA 2Y0SN 4A3LJ 1GV2A 1MH3A 5D6FA 5LGUA 1OYYA 5BQTA 2STWA 2R3SA 1WI9A 4HV5A 4CCJA 5IOYA 3A4CA 4R1HA 1X4OA 2QZ8A 2YU3A 2OV7A 5F64A 5FLXZ 4V2FA 1Z1DA 3ZQQA 5TISC 3IH2A 4XKVA 1YO5C 3HXLA 5DCMB 1QRYA 3CUQA 2RQPA 3H3UA 2VPRA 4I01A 5L3FA 5EG0B 3WE3A 3WODF 1KA8A 3LSIA 5FKNA 1REPC 4AIKA 2GOMA 2F5CA 2ZMEC 2XF6A 1VTNC 2RV8A 1IXSB 1WRJA 2V9PA 2H6BA 2YX4A 1P6RA 1ERDA 2JPCA 4W97A 3UNGC 1RIOH 2BVMA 5EJCA 3K6GA 2N8GA 3BPXA 4RLFA 2GBYA 4IX7A 2XGCA 2V4JC 4K2EA 2GA1A 1T0FC 2CFOA 1SANA 1POGA 3WU1B 1RPWA 1ON1A 2XF7A 1RRJA 1WQ2A 2O8XA 3I0TA 1N25A 2BY3A 2MD0A 4HX7A 2MFZA 1GVDA 1B6AA 3BR3A 1ZRCA 2G7UA 2O7OA 3ECOA 2DFEA 3ABMH 1PJRA 1X3UA 2P7CB 4ESBA 2NVUB 1BIAA 5E1ZB 2E1MB 5LGNA 2ID6A 3G73A 2WV1A 3EUHA 3RKXA 3LSRA 4RGSA 2VL8A 2VLAA 4ZTJA 1XB4A 4S04A 5HDNA 3TO7A 3E5XA 1OPCA 1B1BA 2FBIA 5FFXA 4D0PA 3FKIJ 1S7OA 3CF2A 1YJNI 2A5WA 3CMAI 1K6OA 3BR0A 3QRFF 1S9HA 3WGHA 2YR2A 3SQNA 1HKSA 1XSDA 1U6GA 2WC2A 3K1MA 3S1MJ 3CCMI 2F4MB 2KZVA 2GZWA 2IGKA 1NG6A 1TQMA 3E5QA 1LFUP 1X2MA 3S1RJ 3A2KA 2VT3A 3I59B 2K3PA 2OCCH 3P7NA 4M3DA 5LBQA 5GTIC 4LLGF 3KZIC 1KONA 5DTDA 1D5VA 5FB2A 4PGHA 1ZGAA 2R4GA 1BW6A 2MABA 1W5CC 5BPDA 3K7AJ 2FNPA 4IF4A 1GXQA 5M3MJ 2WY8Q 2K9LA 4BKXA 2V79A 3IRRA 1IAWA 4RBOA 1VQ9I 2L7KA 3ZQHA 3V42A 2V1XA 2EIMH 2JUCA 5E18F 2A69F 2X6XA 5DCFA 4OIRF 4EJVA 1JE8A 2HTJA 3IP4B 3KYCB 3F22A 2QA4I 3ZMVA 5C4JJ 1E0EA 2NVXJ 3W6VA 5BMZA 2P5VA 3CCQI 1Z9CA 4A93J 3OMYA 1XGNA 3PNYA 3LSMA 4BYYA 3LA3A 3OY9A 5IT9Z 1OISA 5D5UB 2CV2A 4KUMA 2DLLA 2L2OA 2FJ1A 4BUPA 2JK3A 2Z1DA 3CLOA 1Z91A 1QVUA 4M3EA 5FLMJ 3IV5A 3CCSI 4NBQA 5EYRA 1UG2A 3F3XA 3I55I 3MKZA 4A6DA 1PDNC 3FX3A 2QQAA 3L1PA 4EATA 1T6SA 2MW8A 5L3BA 3CLQA 3IUOA 3VYUB 4L0YB 4UVAA 1ZRFA 2X85A 1D0ZA 5FROA 1JHHA 5E3NA 1U8BA 1W1WE 1XMXA 4CYCB 1PUFA 3W2VA 2HVSA 4BDYA 3MKLA 1QHGA 5EEGA 2Z3YA 2KPMA 2L4AA 4XLHA 5DD8A 3HSEA 2X4HA 2W4SA 3ASNH 2R7OA 3V8LA 5E1XA 2QSHX 2KLOA 1ZG3A 1ZGWA 2OC6A 3A0BC 2DCEA 4CZZA 4WX9A 1Q1VA 2PJRB 3L9FA 1U9NA 1U9OA 3I71A 4B47A 2HOAA 2GA2A 3HRUA 1TQIA 5ILVA 4GGGA 5GPCA 4ENJA 2M3AA 2G7HA 2IW5A 1W0TA 2OAZA 1FZPB 2DA6A 2JPBA 2XSDC 2WY7Q 3GMEA 1I1SA 2Z33A 1HA8A 3H9QA 1MNMC 4XOPA 3GWZA 3ZMTA 2XRLA 4I76A 5LHIA 1Y8QB 1T38A 1ULYA 5CJ9A 5DM6F 4ZDLA 2EH3A 3CD6I 5CQEA 1YW9A 3GUDA 3EQLF 3C3WA 2X1DA 3BZ6A 1MBKA 1WI3A 4EEFG 5B3SH 2A5YB 3J81Z 1EJ9A 3CMMA 1GXPA 3RTRA 4UVCA 2CQQA 2EFPA 5B5EC 5D4SA 4XRMA 1ETXA 2ZSHB 3ML6A 3KFWX 1DDNA 4A69C 4KITB 2QF7A 5HOOA 3JRBA 3BP8A 3KP6A 3HSRA 3LSGA 3QP6A 3L2UA 4DNCA 2P5KA 2M7BA 2Y9YA 3Q9SA 4RGRA 5D8KB 5IT9K 2R7WA 3J7AY 3MZ8A 2BW3B 2LKXA 1K79A 2GXAA 4F93B 3TDZC 4KFCA 3CO7C 4PZJA 3LQQA 1IUYA 2ESHA 3BWGA 2TRTA 1KQ9A 3OYCA 2ZC2A 2LYCA 4NC7A 4MQ9F 1B8IA 1DGWY 1ETOA 1Y1WJ 3VYTB 4B48A 4YG2F 3AG4H 3MN2A 2NVYJ 1XS9A 2RQQA 4M6YA 5TRDA 2XPUA 2XSJC 2O8KA 3TGNA 2COMA 2ACJA 3JRCA 1G3YA 4A3CJ 2DK8A 2WADA 4XLPF 4HPQA 4E7LA 1DP3A 2LF7A 1DP7P 2VB6A 2G9WA 3LOCA 2HI3A 3KEOA 1VI0A 3QQAA 4N9HA 5J4VA 3KP3A 5JVGF 2A6EF 2NAZA 1USTA 4FE7A 4MIMA 3KZYA 2ECCA 1R22A 1JKQC 1OCZH 1FP1D 4CXFA 1BJZA 1XPXA 2KL4A 3DPUA 2DMTA 4Y3OA 4EM2A 4XLCA 2FRHA 4NNJA 3DTKA 1QHHD 2L9RA 2Q2EB 1J09A 3SZTA 2R7ZJ 1UCRA 3A1YA 2XPWA 2TDXA 2KRFA 5K7FA 5FLXK 2F6CA 2ICWG 3FK6A 2J5OA 4P55A 1SFKA 1XMAA 1ZKGA 1FIAA 2QLZA 2X6OA 2L02A 1IV8A 2PMUA 2IA1A 4XORA 3FXLA 4XMYA 5DEQA 3F8NA 3E6CC 3F23A 3CC4I 3OYBA 4M6XA 4II3A 5B1BH 2HDDA 4F3QA 3MCZA 5K5OA 3G2BA 2ZJRF 3HOZJ 1TC3C 1V3FA 3W2AA 4RS8A 4P1WA 3HOSA 3IH4A 3I5UA 4G7ZF 1Z3YA 2K9QA 2GXGA 4A12A 2A07F 1J2XA 1QU3A 4DGWB 2Y48A 2LMDA 3DFGA 2Q0OA 2Y0SA 1UELB 4WXHA 4PJJA 5EDNA 1B4AA 1P2FA 2CQNA 3K2AA 3TKYA 3K4BA 2X51A 4ZYGA 4EM1A 1MSFC 1WCMJ 3C2GA 1W4MA 3FIWA 3JW4A 4Y4RA 3HPHA 3RI4A 2M9HA 3H3VK 2HYFA 2MG4A 1EH6A 3CP8A 2W85A 3H5NA 2DFFA 5KNLA 4IHYA 5F0CA 3N97A 2OTJI 4HSRA 3ECHA 2Y31A 2UV1A 2HYGD 4YFXF 4EQQA 4BQQA 1XDSA 3BG3A 2QYOA 4AD9A 3M1CA 3DF8A 4LLNA 4L0ZB 3GLXA 2DOFA 1H88C 2IS2A 4CO8A 1LQ1A 1U2WA 4LITA 4GYGA 3TBIA 3RPUD 2O6GE 2QQBA 1Z0XA 1ZLJA 2IA0A 1UAAA 2VQLA 4I02A 4KIFA 2E7WA 2E1CA 2PJPA 2LKPA 1A6IA 3HHGA 2HGCA 3BG9A 3F9KA 1S7EA 1BI2A 4KMUX 2EV5A 3TP3A 3WTVC 1LJ9A 3M07A 5J3LA 4MTEA 3S93A 3MAJA 2E1MC 2XGDA 2VBXA 2E1OA 4I6ZA 4Y13A 4DYRA 2IGOA 3CCUI 1X3WB 2Z16A 3I53A 5J8FA 1BIBA 2R7TA 3IWFA 4L9VA 1LPQA 2BXYA 3QPSA 3KETA 3P5JA 1IJWC 2DFHA 2Y75A 2D1HA 1IRGA 1P7JA 2ZJ2A 3V8JA 5LEKA 2ADUA 1XD7A 1TQPA 4XM3A 3OSGA 1RKWA 2OQGA 1DU0A 2BGCA 2EZKA 2AO9A 1VQKI 1MJAA 4RDUA 1XGOA 4YIFA 2DT5A 1DPRA 3S1QJ 2VQGA 3LWFA 4WCGA 2KP6A 3PUFA 1N75A 1SVOA 1I3QJ 1Z6RA 2ETHA 1BBYA 1P92A 3QP5A 1X3ZB 4BHBA 4RGUA 2COBA 4ASNA 2BOLA 2X1EA 3DKYA 4WXDA 2FSWA 3JAMZ 1KYWA 3E3VA 5BPIA 4LOCA 2DJIA 5FLVA 3OOPA 1KQ8A 2MLGA 2E2JJ 4RB2C 2H1LA 1WJFA 2MH2A 3OIPA 4ENMA 2CWEA 2XKPA 1YG2A 3UR3C 2KIQA 3K4CA 2KIMA 1YFHA 2C6YA 3C2HA 4E6KG 2DOEA 3HOUJ 1P9QC 2CG4A 2ISYA 2EPFA 3GFJA 4MFDA 1LDJA 1OCPA 4C3IJ 5JVTA 3JRFA 4BJ5C 4CH7A 1SD4A 2I10A 1FWZA 3R0AA 4O5VA 1U0JA 4U7BA 1G6NA 3CC7I 3GF2A 5F04A 1FC3A 4OINF 1A36A 3GTGJ 3ZN1A 1LUJB 1UJ8A 2DXIA 2VC0A 2F4OB 2Z5UA 2L9NA 1RUOA 3DBRB 1R9TJ 2ZFUA 5GP9A 1R58A 4M3GA 1NK3P 4UUTA 1FIPA 1IW7F 1YOVB 4BQOA 2LC2A 4DJAA 3BG7A 2HTSA 3HPGA 3EDPA 4NC8A 1YYVA 2F5VA 1D3YA 4KNYA 3BQZA 3JREA 3J7AO 1W5TA 3AL0B 5FFZA 1FOXA 2FUG2 2KKOA 2OZUA 3BPVA 3WTYC 2M7AA 2W57A 2XPVA 2MC4A 2ZXWH 5ICEA 2VI6A 2JA8J 3OL3A 2R5YB 4YIRX 2LTPA 1ETKA 1VQ5I 3BJ6A 1FTZA 3ZMZA 1Z67A 3LFUA 2XF5A 4A3DJ 3ZQ7A 2AXTC 1WH7A 3TOBA 1Z7UA 2O61A 4EJTA 4BXXJ 2XRNA 1D8JA 3I59A 2LD5A 4XONA 4HF2A 3OYIA 4E7JA 1HC8A 3OR2C 4OMZA 3G1LA 4EGZA 1TT5B 2FXAA 2FX0A 2EB7A 4DOZA 4UY8I 1ZTRA 2VE9A 3DKXA 2DODA 1Y39A 1VFCA 4XLEA 4AIDA 2ZXJA 4M6VA 1QZEA 4V19K 2H09A 2VUMJ 1PUEE 4P9FA 3WTXC 4P96A 1D1BA 2VKEA 1VQNI 1R1UA 5B66C 5J1RA 3SDBA 2FEZA 3GX4X 2TCTA 3OIQA 4BBSJ 3CCYA 4G8XA 4JOMA 4AYBA 1Y1VJ 1JI8A 3WGIA 2ZFWA 3BROA 3FKJA 5FRNA 2VASA 1YIOA 2LH9A 2M34A 2JA6J 1ODDA 3KIOA 1J5YA 3CZ6A 3OS1A 5DUKA 1K4TA 4MNUA 4UB8C 5EZHA 4E7IA 3OYEA 3BR5A 3BC8A 1HOMA 2R7DA 3HOYJ 4YELA 1YTYA 5E8IA 4ZYHA 3FMQA 3DEUA 5JLXA 4L9JA 2GQQA 3N05A 3B6AA 2JN6A 1XSVA 3H36A 2CUEA 3GW2A 1ZLKA 2R7UA 1IRFA 3GTPJ 2DO7A 4LG0B 5FO5A 2M0CA 2FBHA 1WSUA 2H94A 1MNEA 1WWXA 2PMZA 4IXAA 4NC6A 4D1QA 3FMRA 4HEA2 2F5FA 2MD5A 2V26A 1D1CA 1FX7A 4WXCA 2BY1A 2BZTA 2ZJQF 2CV0A 2YU9J 4RB1A 4PJ0C 2ZMEB 3I4MJ 1FMVA 2B0LA 2E2HJ 3GFLA 5E20A 2EFQA 2H8RA 5E17F 2PMHA 4BGDA 2CMPA 2W00A 5EZGA 1XX5A 3RYRA 4F7ZA 1IC8A 4L9NA 2QUFA 2EILH 3E1SA 4HBLA 2JZYA 1RUNA 3ZQFA 3DU5A 5HS8A 3EUKL 2JUGA 3QYFA 1YQAA 4UUVA 1DU6A 1OMIA 3U1DA 2IAIA 1IXCA 4IOCF 4MFEA 3F21A 2OBPA 2JQ7A 4BACA 2WBMA 4HQMA 1TNTA 2NYXA 4XKBA 1BC8C 5C3EJ 3ULQB 2A6HF 2M1BA 1IV6A 2V9VA 4L18B 2P81A 1FOKA 3I54A 4JX6A 1WH5A 3KEQA 1J9IA 1WJ5A 2XAUA 4A3MJ 2EV6A 2DAOA 1ZG5A 3LMMA 3U21A 3D1NI 2A6TA 2P8TA 1MKMA 3R4KA 2EBIA 2ME6A 1MBEA 2ZSIB 1BI0A 2M8GX 2ELHA 4A3KJ 1OCTC 3QWLA 1R00A 2DN0A 5F0HA 3HOTA 3MFKA 4F55A 2KIUA 2DI3A 1STZA 2EZHA 1AOYA 2CUZA 2W84A 4YEJA 4TV7A 1BJAA 4EV0A 2X48A 2HDWA 2Q2EA 2K85A 3KP4A 5LRRA 2HS5A 1FOWA 1XGMA 1VQ7I 2P4WA 4WWCA 2LY2A 1MH4A 1U5TB 1YX5A 3E0JB 3MD2A 3TDUC 2EK5A 2DA3A 1SAXA 2H8WA 1UHMA 2HKOA 5D8LB 5J40A 2VE8A 4IRGA 4HZFA 2HQNA 4EJUA 3SZPA 4ZH4F 2V6CA 1FSEA 4S0HB 4AIHA 3I4PA 3WTSC 4RAYA 1XSXA 4XN0A 5LHGA 3JR9A 3S3OA 4L5EA 5K7ZA 1BOBA 2BBYA 2ZB9A 2HXIA 4YRVA 3BTJA 4F92B 5GAGJ 2ZCWA 4MQVA 4RAGA 2CQ7A 2LP0A 4HV6A 5E3OA 2WAFA 3L00A 1X2NA 1SFXA 4LK1F 3SEZA 1FY7A 4KT5C 1GHCA 2DOAA 4G9YA 3F72A 2IP2A 2E36A 2P6TA 3HG9A 3CQZJ 3DBLB 1ZH5A 4D9JA 3ZMDA 1YIJI 1WZ2A 4GYIA 2BW3A 1JHFA 1XCVA 1E17A 4BNCA 2I8DA 1WHUA 1J0RA 4ZJZA 3DV8A 3HL2A 1O57A 3DLLF 5AIPA 4L5IA 4RB3C 1I6XA 2DT7B 3HUGA 3BR2A 1JJ6C 3CCLI 5CVUA 3GZNB 5ICCA 2ZNZA 4Y17A 2KIFA 2PMZN 2STTA 1SC7A 2LG4A 2DFIA 2RKHA 4M3BA 2OPTA 4B3AA 1HF0A 4NUBA 1F9NA 3CJNA 2BY2A 5J1UA 3E7LA 4MTDA 2KHMA 2XDVA 4A3FJ 3WHCA 1KU3A 3JRGA 4U7DA 1FP2A 2R7RA 4QPOA 1IDYA 1QGPA 2PBIA 3JCUC 3M8FA 2XHKA 2KDZA 3KP7A 2GM4A 3S2HJ 4R8HA 2QSGX 3TOAA 3OYGA 2PLYA 4HNUA 4BEHB 3CDIA 1TW3A 4JK1X 3TL4X 3PSIA 3H5RA 1SD7A 4DBQA 5GAHJ 2HVRA 3HRMA 1R36A 3ZPLA 2XAFA 3M7GA 3GFIA 4CZCA 4PFPA 3Q0VA 4HF0A 3DXJF 1PYVA 4E70A 1YS7A 3I3LA 2NS7A 2E5NA 4IL6C 1LVKA 4B8XA 1EH8A 4CHUA 3WTWC 2O03A 2IT0A 2UXXA 1C0WA 4HYEA 3RPQA 2K4BA 1FOYA 3J80K 3HEFA 2VQHA 5EEHA 2XROA 2R5ZB 5D5XB 4J19A 1N78A 2E60A 4UXNA 2BHZA 5AIQA 4DQ2A 4XRFA 1Y56A 1KU9A 1S8NA 2RN7A 4D7MA 2XUBA 4N0BA 2LVSA 3H92A 1XGSA 4KN7X 2CRGA 4BL0B 1T08B 2H6CA 4XOTA 2X6WA 3BCAA 4M72A 4XKCA 4BAYA 4CCMA 2GAUA 1VQPI 5FJ8J 3D0SA 4GDFA 1Z7LA 4UUSB 1W7PA 2VC1A 1YW8A 4R79A 2HR3A 1YHQI 2ID3A 4NQWB 1WPKA 3PFIA 4OOIA 1TW2A 3S16J 4PSWA 4A3BJ 3PIOF 3NEUA 3G1OA 3G4SI 3BG5A 4II2A 2HFHA 3S2DJ 4IHVA 3QOEA 5IP6A 1RETA 1ZHFA 3GTOJ 2R93J 2FBKA 2NRAC 2FE3A 3BCBA 2DU9A 3H1CA 1VQMI 5BNGA 1IN7A 2KFDA 2O3FA 2LBFB 3PNTA 3SFZA 2JA7J 3JTHA 2A3SA 4CUGA 4HRIA 1TWCJ 1V54H 1R6RA 2K9MA 1G59A 3MKWB 2P7VB 5B1AH 2MSYA 3P9KA 2L54A 2JRMA 3ZQGA 2X6YA 1OYIA 2JRTA 2XGXA 1BA5A 1K78A 1KGSA 1LKXA 2CUFA 3MVPA 2B63J 1TWGJ 3FXUA 4N4NB 1O3QA 3OYJA 1VQ8I 1UHSA 2VXDA 3TQNA 5HVQC 1R23A 2P0WA 3RQIA 1S3JA 3KX2A 3CC2I 2V1UA 3BJOA 1W7PD 2LREA 3X2QH 4N4OB 3R6SA 3IHUA 1HLVA 2HEOA 2FF4A 4MGRA 1VQ6I 1ONVA 1DGRM 1MNDA 4V2GA 3S3MA 3CMEI 3FISA 5J6XA 4E7HA 3ONQA 4LJZF 5FD6A 4QWQA 1B8IB 1RNLA 1WJDA 4C3JJ 3ZQLA 1JGSA 1SAUA 2JTVA 3OYHA 5DYMA 3QYEA 1IF1A 4IRHA 1ZARA 2L9SA 3Q0WA 2UWMA 3T8TA 1OR7C 2MH9A 5F0FA 2HOSA 2XASA 1I27A 1I50J 1AU7A 2Y9ZA 1BN5A 3S17J 5HDGA 1HBXG 2LLKA 1FYLA 2NS8A 2X1CA 3R61A 1YRNA 1GDTA 1G3WA 4L5JA 5L3CA 2E2IJ 1K6YA 2M4KA 1R49A 2JWTA 3KP5A 1G8XA 3H0GJ 1BR4A 5LHHA 5K7HA 3WU2C 1D8KA 3CCEI 1SMTA 3IH3A 4HLYA 4XLAA 4EMSA 3ELKA 2L5QA 2PJRA 3BY6A 3CCJI 4BQNA 1J59A 5FKLA 3OWTA 2ECBA 2W24A 3VOEA 3S3NA 2ELJA 2VBYA 3MMYB 5IT3A 1QZZA 1FEXA 2IGNA 2CSOA 2YS9A 3A03A 3FK7A 4CYDA 1PVEA 1TL8A 5ICGA 3ZOBA 1V55H 3VODA 1WGXA 1ORKA 1APLC 2IPQX 4OIPF 1ETWA 1HW5A 1ZQ3P 1R1TA 4KN4X 2XAJA 4IHTA 2E1NA 2Q1ZB 2QVOA 4ENKA 4A0YA 4X6AJ 2M87A 5M5WJ 3M1EA 5HLGA 2F5DA 3CUQC 3KYLA 3PO3J 2HPMA 2IJLA 1WKMA 2PFBA 4BE2A 2R7SA 1W36C 1YI2I 4OMYA 3LL7A 3HDDA 4RGXA 1XDUA 1ZRDA 3GTLJ 4O6JA 1XN7A 3SJMA 1YW7A 2PQ8A 4B44A 4OAYA 1T33A 2DDAA 2E71A 2OUMA 5F08A 4CYCA 1TWAJ 1IN5A 2EZLA 2E19A 3C7JA 2Q8KA 3RSNA 2BV6A 3GFMA 2KJCA 3K4JA 1FYKA 1XTAA 4I09A 1K83J 1ON2A 3RYPA 1DQUA 1SVLA 3HRTA 4RMNA 1T2KA 5K5RA 1ITYA 5HS7A 3O8GA 5LFAA 3ZGKA 4BJ6C 1TWFJ 1Z21A 4LD5A 2NOGA 1JTXA 4I99C 2DBBA 1FPQA 4QPQA 1I5ZA 2ZXIA 3KLOA 4JX4A 4RLQA 4A3GJ 4ESFA 4P9UA 1U5TA 2XAQA 1UHWA 3CTAA 1MGTA 3F8CA 4RM3A 2R7VA 2Y69H 4F91B 3HBLA 4BHPA 1ZREA 4J01A 1SMYF 5C4XJ 4A2UA 5HS9A 5FRMA 1GUUA 3K4KA 4FE4A 3GEZA 3JRDA 5ED4A 1NG7A 2M8EA 3DU6A 2CQKA 2DJNA 3CF5F 1RR7A 2QQ9A 1KU7A 2QKMB 5HLTA 1VQLI 3LQRA 2KISA 2DW4A 4XR6A 2LKSA 3DPTA 1TTYA 3L2QA 4AC0A 1SFEA 1R5ID 3QU6A 4A0ZA 1AKHB 3K4LA 3GXOA 4LIVA 3S1NJ 3TMOA 4WK8F 1IZ1A 2HU9A 2KRHA 2R92J 3LAPA 4X1EA 1QPIA 5BS6A 1JT0A 2DA5A 3PM1A 5ICFA 3W2WA 4Y7NJ 3HB9A 1MIJA 4IHWA 2MGQA 3K4NA 2DA4A 3FXOA 4IJAA 1IUFA 1JUMA 4MO7A 3A01A 4JP0A 2VPLA 5KAIC 2B9SA 1EF4A 3KLNA 1JKOC 1DPUA 1VQOI 4PJLA 2WTEA 1FBQA 3GZ5A 4KYWA 2KJBA 3TW6A 1Z3XA 2DYSH 5EEAA 3A0HC 3P9IA 5L3GA 4QTRA 3V4GA 4NHJA 4CGZA 2IA2A 1MMGA 2X9DA 2FNAA 1RKTA 4PK4A 2YUSA 3LSHA 4HOBA 4E4HA 3DCFA 3HZJA 5HDKA 5JHFA 4AVPA 1F5TA 1FT9A 4Q4ZF 5H6QA 3DTIA 3DBHB 1OFCX 1EKEA 4CICA 2DPDA 5KHDA 2RNJA 5LLQA 2MLKA 2QM3A 3GVAA 4HLXA 2M45A 4A0XA 4DYQA 4S05A 3F8MA 1IDZA 2DMNA 1UZCA 2L9VA 3M8EA 4DZJA 3PNVA 4MEXF 1OJLA 3FXMA 4M3FA 3KE2A 4PJMA 4IO9F 2V6EA 3M4OJ 3HSFA 3CUOA 1YX3A 1TT0A 2FQ3A 5HODA 2CW7A 3CMYA 5ILUA 3VDXA 3SZGA 2OA4A 2H1KA 1HW2A 3MEXA 3QPTA 1FJLA 3LSJA 4HW0A 1AHDP 5J1YA 3OYLA 4EM0B 2Z99A 1MMNA 4Q48A 3E6BA 3RZOJ 3TW7A 4BXFA 2D2WA 2V1NA 1TWHJ 2M5WA 5E3LA 3F0CA 2LY1A 3COAC 2CJJA 2HOEA 3ZMUA 3L2RA 2FOWA 2LY9A 4PGGA 1MJBA 3QPLA 2WB1A 3SEQA 1T39A 4MHGA 2LOOA 4A3JJ 1QVTA 1ZN2A 4KDPA 1BM9A 3H0DA 3HOWJ 3TO6A 5DUIA 2G0EA 1Y6IA 2IRFG 3BLYA 4L9TA 1OCOH 4G7OF 3HTUA 1U8RA 1H9GA 2CUJA 2XB0X 3QODA 3U1KA 4ENNA 1F4KA 1R5HA 3JSOA 2PX9A 4FX0A 2JSPA 5CVIA 3VPRA 2F2EA 5TGTA 1FSHA 2BY0A 2ZBKA 1ZYRF 3ABTA 2DPUA 1LDDA 2R5YA 1ETVA 1UB9A 4G6DA 2Y2ZA 4OIOF 2L7FP 4KMFA 3GBGA 1ETYA 3FZVA 1L3LA 2IS4A 3T1BA 3BR6A 4XRSA 4MLOA 3PL8A 3RKWA 3WG7H 5IYDJ 2L4MA 5EF6A 3G71I 1X4PA 3OYMA 2CV1A 3L09A 2VXZA 4ZTFA 2XGEA 3O2PE 1TLHB 3RZDJ 4XICA 4UVBA 3RJPA 4QSHA 4F52A 2EA2A 1VZ0A 2HZTA 2NXNB 2DMQA 2E7XA 2P6SA 4X0GA 1EH7A 2VJIA 4A3IJ 4G7HF 3AG1H 4BHCA 1PUFB 4Y33A 1SFUA 1Y0NA 4JYKA 4OU0A 1R1VA 2EJRA 3VB2A 1B72A 4I7HA 2OZ6A 3LFKA 2CH0A 2K7LA 2VQCA 1H9TA 3ABLH 2DMPA 5CQGA 3HOVJ 3CCVI 3REOA 5DS9A 2QENA 4HX8A 4EJOA 5H6RA 3O3KA 5E8GA 1WJBA 5GAEJ 1LVAA 3MKYB 2KDOA 3A01B 2K02A 4Z2YA 1FBSA 4IHSA 3AAFA 5HLHA 2IGMA 3FMSA 2GWRA 4CA0A 1K78B 2CW8A 2FMYA 3AG2H 5J4YA 1SD5A 1U3EM 3JRIA 2D45A 1T95A 3I58A 1UFMA 1RC9A 1R4MB 4E7SA 4PDKA 3ZR8X 1U5TC 3HOXJ 3MZYA 4JQFA 2LNBA 2CGPA 2VODA 5D5VB 3W6JB 1M1EB 2L7ZA 4XSXF 3BTIA 3AKZA 4Y52J 3OR1C 4IVNA 1BR2A 3H3ZA 2VJ4A 3TEDA 1QBJA 4Z6YA 5IOZA 1A5JA 3MZHA 3IRQA 3GYHX 3EYIA 4DIQA 1I1GA 3FXQA 4G6QA 2BHYA 4FASD 1Q1HA 4ANJA 5DV5A 4Q5SF 3KEYA 3CESA 1OYWA 3HKZA 1SD6A 2L3DA 3LNQA 1CGPA 3GTQJ 1XMKA 2PEXA 1LE8B 2R7XA 3M3YJ 1LEAA 5GADJ 2XVCA 4UUSA 2HKXA 1IRZA 1E3OC 2NOJB 1G4DA 1X1AA 5D5WB 2EWNA 2HPIA 4ZYAA 2XAHA 1XG1A 2QCOA 2QQ8A 2DYRH 4KJZA 5A2QZ 2PG4A 3LSTA 3ZMSA 4EGYA 1K61A 2JA5J 2W25A 2AHQA 1TZLA 5FKMA 3NWTA 4YFNF 5J8CA 4IEJA 1B72B 2PI0A 3WE2A 1KU2A 3SXYA 3ZQCA 2VT2A 1R71A 2JSCA 2W1OA 3E6DA 2CS3A 3D5RC 4M9SA 4NDLA 2XAGA 4RAZA 4LB6B 5A2QK 4KICA 1OCRH 4FQGA 2K86A 3KPHA 5HNHA 3PO2J 1BC7C 4H0EA 2ZMEA 3P9CA 5LGTA 1BI3A 2B7EA 3S15J 1TNSA 4XNFA 4ZC3A 4ETSA 3IL2A 1I39A 1ZELA 2L0KA 1S72I 1OR7A 3G6EI 3BDDA 4RAFA 3DEEA 3AL0C 2XV4S 3RCOA 4AM3A 3S14J 3E6MA 1Z05A 1WVRA 1HSJA 2L7MP 2AQFA 3FHZA 1W5SA 5M5YJ 3K1PA 2BVLA 1F36A 4M74A 1V5GA 4AUXA 3IAM2 3K4MA 3ABKH 3DKWA 3FXKA 4ABZA 3HJEA 5GPAA 3B73A 4U0YA 3LSKA 1JKRC 2XIGA 1D1AA 1AA7A 2QBYB 3CJQB 1XC5A 1VNDA 2VKVA 2YX7A 3NARA 3VSKA 3WU0A 4GFBA 4NB5A 5IP7J 1D0XA 3E5UA 4FX4A 3NAUA 3L7WA 3K1NA 1K4SA 2OU2A 2LR8A 1YS6A 5KVRA 3Q5FA 1JKPC 1DUXC 3K70D 2P5LC 4A3EJ 2V1DA 5DCMA 2FMLA 4EVIA 2XB5A 1ZAOA 5EGOA 2CU7A 4I0BA 1T0FA 3NQOA 4B3XA 2VJ5A 3KYDB 1HKQA 2WAQA 4I0AA 3HM5A 4U0WA 3ZCOA 3ESWB 4OWRB 2F5EA 2EIJH 5ERIA 3PSFA 1SFOJ 1J75A 4XRSG 2IS1A 4HX4A 4UV9A 4ZDPA 1X1CA 5CVVA 5F6FA 2QKLB 3OYFA 4EJWA 3HYIA 3EYYA 4HDVA 2F48A 1MBFA 4CCNA 1Y0UA 4ZDOA 1ZR2A 1LB2A 1S29A 1KQ0A 1G3TA 1JXSA 4I2OA 2R7FA 4XLFA 1W0UA 1O3SA 1OKRA 2HDCA 4RA2A 5HNFA 2LDUA 4D5CA 2W82A 4BH9A 4ITVA 2EFNA 3IAS2 3FWEA 2AS5F 2D5VA 1NTCA 5GTHC 3CP2A 1LE8A 2DTRA 2DQLA 5JI6A 3TP0A 5IP9J 1WJCA 3ASOH 1V5FA 2HWVA 1MDMB 2IBDA 1HQCA 2A61A 3BZCA 1JTYA 3GTMJ 1F1ZA 3U2RA 2DDBA 1P7IA 5FGMA 4AVZA 1GT0C 4U87A 2O5RA 3HC7A 3FXRA 2R0QC 3GO5A 1GV5A 3VWBA 1ETQA 1MBGA 3U9GA 3OSFA 3WGGA 1KYZA 2JVGA 3Q9VA 3T0YA 4PJNA 2UUZA 3OOUA 1K7AA 2J5PA 2IVMA 1V5EA 4LIUA 3SFIA 5JLWA 3LA7A 4BS9A 1QPMA 1SEUA 2M2EA 4BE0A 3J7YJ 2ME0A 1EV7A 1HXDA 3H35A 2BE5F 2HOTA 2VN2A 2M30A 2OTLI 1UMQA 1NK2P 2VKHA 4HNTA 3K9TA 2KQRA 3HTSB 3LA2A 3V7RA 3SHFA 3NWSA 4U88A 4GO1A 2JMWA 4GXOA 1LDKB 3C18A 3L2VA 3M8JA 1LFBA 2NNNA 3V8KA 5J47A 2RC4A 4M73A 4XKWA 1X19A 1RR8C 3GCMA 3PUBA 4AYBN 3Q3SA 2Z9OA 5JHUA 1P4WA 2LRDA 1JT6A 2RDPA 4UNOA 1L0OC 1W7PB 2FD5A 1S7AA 1FYMA 2HQAA 1P4AA 1O7LA 1Y8RB 2L01A 2IS6A 2K27A 4E7ZA 2O9LA 2NVTJ 1BR1A 1MSEC 2R7QA 3BG6A 5F1RA 4BU2A 1AWCA 1FLIA 1XCBA 2DT6A 3J81K 3B6CA 6PAXA 1T56A 2KMUA 1IN4A 3IKTA 4KISA 1X1BA 4Y15A 2K9SA 1LFPA 3BQYA 2Y30A 2HQ5A 3DLAA 3JSPA 3L2WA 4IQJA 1R4NB 3IWZA 3GZ6A 5TJJA 1MZBA 1GLNA 2V9KA 4U0VA 2LK2A 5FKOA 1H89C 1MD0A 1IGNA 1O3RA 2NVQJ 3ERED 1QA6A 1FTTA 1JUPA 4DBRA 4E7KA 3BT9A 4N9IA 4HA8A 3TO9A 4ESJA 3GTKJ 3OYDA 4BY7J 3ZRGA 5K1YA 2WV0A 3H9GA 2HQRA 1S6LA 3T8RA 3JAMK 3HIFA 4FETA 5IYBJ 1V4RA 2V7FA 2NNYA 3MQ0A 3WHBA 3PFYA 5AONA 2EFWA 1SVMA 5KCMA 1KZHA 1TBXA 1VQ4I 1MMDA 3AFHA 4FCYA 5BOXA 4IHXA 4O3MA 3ZN0A 1Z77A 5JFRA 1U78A 5E1WA 3FHNA 3D5SC 5D4RA 1EA3A 3BTLA 2FOKA 4XK4A 4HNVA 3ZXSA 2XC7A 4C30A 3L2CA 1BW5A 1D5YA 3H9JA 3K2ZA 2QWWA 4WF2A 3WTUC 5IY5H 3HUGB 5F1JA 2KRCA 5IPAA 3WTTC 2IEKA 4LFUA 3E97A 3M9AA 3PJRA 4HQEA 1VF9A 4AIJA 3OL4A 1YRNB 4M9XA 3DWLE 1B9MA 2BXZA 3I64A 4UB6C 4JX5A 3OYNA 2RGVA 2FA5A 1USSA 2MC3A 3CDHA 2K5CA 5L3DA 2E5ZA 3J7ZI 2WWYA 1JUSA 1TP4A 1O7FA 2K4JA 3Q0UA 4UHTA 1HDPA 1HKTA 2EA4A 2ESNA 4C2MJ 3RIRA 1OLTA 3I56I 2NS0A 2K3FA 1IG7A 1G3SA 1S5LC 3EUAA 2H27A 4CCLA 3WTZA 3D5LA 1P4XA 1I3AA 2KZGA 1A04A 1YITI 1JGGA 4P5OA 1AKHA 4IQ4A 2XKOA 3OYAA 1MBHA 2GIVA 4J00A 3HKZN 4XL9A 1R5GA 4B09A 3QU3A 1ACIA 2AXLA 5HLIA 2EZIA 2EV0A 4CCKA 1MJ9A 1R7JA 3HGGA 4GCVA 2VOOA 2D1VA 4Q47A 3CCRI 3C2BA 4QIWN 3BZKA 1T98A 1RESA 2W7NA 4M9ZA 1O4XA 2OQRA 1H0MA 3IC7A 1ENHA 3J80Z 1MDMA 2IXSA 1OCCH 3QPHA 4G12A 1QO0D 1X58A 4HSTA 3W6KB 4CCOA 4NQWA 2WAEA 4HDUA 2KT0A 2YPRA 2VIXA 1Z6TA 3FXJA 2VONA 3PQJA 2DA7A 4LB5A 1MBJA 1MMAA 3NRVA 1D0YA 3I9V2 5DDGA 2DTZA 4XN3A 3R60A 1ZGJA 5KAFC 4PUSA 3O6BB 1HCRA 2OF7A 4LG0A 2CO5A 2ZKZA 1T8IA 2Z2SB 2ZNYA 3DTEA 3F6OA 3MWMA 5FD5A 3KP2A 4BJTA 4KT6A 1YLFA 1ZK8A 2CQXA 4UV8A 2RVCA 3PIPF 2VBWA 2E34A 1PP7U 4BXUA 4B1RA 4BDZA 3JRHA 2X0LA 2QBYA 1IN6A 3OIOA 4OIQF 5DM7F 3B02A 1YJWI 9ANTA 4MEYF 5C44J 3GLLA 3H5AA 1B9NA 2CFXA 4KIGA 4I98B 3F6VA 4D5FA 4W1UA 2OD5A 3OYKA 4FT8A 2CYYA 3GTJJ 2HNHA 3RKYA 4LLLA 3EETA 2VJJA 5LEJA 3CUQB 4C3HJ 4IPAA 1BI1A 5CLSA 3EPZA 1H8AC 2FU4A 2EQRA 2HZDA 2PN6A 3EUHC 3KCCA 4ON0A 5K5QA 2E35A 5KK1A 1JJ8C 4XIDA 2VKDA 3QAHA 4C9YA 3OV8A 3CJTB 4C2UA 3FDYA 5FKKA 5EGOB 2FQ4A 1BL0A 3FM3A 2BEOA 4PFOA 1CQTA 1WFXA 1IXRC 1X1PA 2WAQN 5M5XJ 1A31A 3SYTA 4G94A 4FHTA 5F27A 3A02A 3T5XA 5EG0A 4BE1A 5ILSA 4BEHA 3VFZA 3N4MA 3DQVC 1HSTA 3ROUA 4XSZF 3S2WA 1N77A 2JT1A 3CO6C 3V7SA 2GIZA 3VEPA 4AU7A 3FF5A 1X1DA 4B4CA 3FBNB 3VSLA 2UXNA 2HVQA 4LG3A 2GOXB 4YFKF 4IZZA 2CW0F 4BQAA 2VBZA 4RB0A 2I5UA 2JVHA 1QNTA 5D6EA 4A5NA 5DD4A 3RPUA 2K40A 3IKVA 1GVJA 2LSOA 4PCQA 2O0YA 4QLCU 5M3FJ 1BOAA 3RQ4A 2LBFA 2MA3A 4HG2A 2DK5A 1J7KA 5JR3A 4ZZDA 2JA2A 3VYRB 1G2HA 1NH3A 3OS0A 3FM5A 1MMSA 4IOAF 3F8FA 2MBFA 4ZYEA 3FBIB 2DA1A 1ZR4A 3I4NJ 3QYBA 1IRXA 2ISZA 2HYJA 4PSXA 4XQFA 1I6HJ 2RNGA 1WJAA 4IRIA 3KZZA 4LGWA 4A6EA 3R0JA 2DA2A 4C2TA 3K0LA 1F43A 2M4GA 2EIKH 5L3EA 5LRSA 2HXOA 1YJ9I 3UKGA 1PP8F 5IYCJ 1B59A 1FBUA 2QEXI 1RI7A 5CYVA 1CF7B 3G3ZA 2JJ7A 3S8PA 3G1MA 5CPRB 3BR1A 3BJAA
chains in the Genus database with same CATH topology
1ZELA 3QOEA 1UAAA 2VQLA 4CSWA 3DEEA 3AL0C 3RCOA 4IKFA 3BCBA 3F9KA 2AQFA 2BVLA 1V5GA 2RREA 3IAM2 3K4MA 3PNTA 2LBFB 4HRIA 2MYSA 4CUGA 3S93A 1R6RA 1YE9A 2E1MC 2K9MA 3MKWB 1G59A 3LSKA 1D1AA 1AA7A 3DPLC 3CJQB 2IGOA 2X6YA 2Z16A 3K10A 3VSKA 2R7TA 1LKXA 3W3CA 1D0XA 2F4IA 4N4NB 3OYJA 2VXDA 3VYSB 5HVQC 4RM2A 5CKTA 4XM3A 2P0WA 3CJRB 3KX2A 4B43A 1W36D 3K70D 2LREA 4N4OB 4ZC3A 2AQEA 4H4KC 2VQGA 2KP6A 1N75A 1DGRM 1MNDA 3S3MA 4B3XA 2VJ5A 4E7HA 5LD2C 3ONQA 2BOLA 2WA0A 2WAQA 2X1EA 3DKYA 3ZCOA 1WJDA 4OWRB 3PSFA 4G6TB 2IS1A 2DJIA 3K70C 4ZDPA 1SAUA 1X1CA 3OYHA 3QYEA 1WJFA 2QKLB 3OIPA 2L9SA 3OYFA 3UR3C 1WJEA 1UG0A 3K4CA 3OS2A 2UWMA 1OR7C 4OAZA 2M0MA 4CCNA 3C2HA 4E6KG 2ZXHA 4ZDOA 2X1CA 4GRIA 1P9QC 3S32A 1MW7A 4XLFA 1K6YA 4BJ5C 4CH7A 2M4KA 1U0JA 1FMWA 4U7BA 5HNFA 1G8XA 2W82A 4ITVA 1BR4A 3IAS2 3CP2A 2DXIA 1WJCA 4XLAA 2L9NA 2L5QA 1V5FA 4CCJA 3A4CA 1X4OA 2ZFUA 2OV7A 2PJRA 3ZQQA 4XKVA 4BQNA 3HXLA 4AVZA 2LC2A 3OWTA 4BQOA 4DJAA 3BG7A 4U87A 2ELJA 2O5RA 3S3NA 3MMYB 3HPGA 3HC7A 4NC8A 2IGNA 2F5VA 3VWBA 3LSIA 3AL0B 2JVGA 4PJNA 2FUG2 2UUZA 2GOMA 3OOUA 2M7AA 1V5EA 2MC4A 4LIUA 2Q1ZB 2XF6A 3OL3A 4BS9A 3KYLA 4BE0A 1ERDA 2HPMA 3H35A 3UNGC 4BE2A 2R7SA 3LFUA 1W36C 2XF5A 2BVMA 3LL7A 3K6GA 2VKHA 4HNTA 4RLFA 4IX7A 2KQRA 2V4JC 4B44A 1T0FC 2CFOA 4OAYA 4XONA 3OYIA 2OUMA 4E7JA 3OR2C 2XF7A 3NWSA 3RSNA 4DOZA 2MD0A 1LDKB 3DKXA 3L2VA 2MFZA 3M8JA 3K4JA 4XLEA 1DQUA 4RMNA 1PJRA 5LFAA 4XKWA 3ZGKA 1X19A 4BJ6C 2E1MB 3PUBA 1D1BA 1Z21A 2LRDA 2VL8A 4QPQA 2VLAA 4ZTJA 2ZXIA 3SDBA 4RLQA 3OIQA 2HQAA 4JOMA 4AYBA 2IS6A 3CF2A 4RM3A 2R7VA 4F91B 1JI8A 2A5WA 4E7ZA 4J01A 1BR1A 1S9HA 2R7QA 3BG6A 5FRMA 3K4KA 4BU2A 1NG7A 3FKJA 5FRNA 2VASA 3DU6A 2DT6A 2LH9A 2KZVA 2IGKA 2KMUA 1NG6A 2QKMB 5HLTA 3CZ6A 4XR6A 3OS1A 4KISA 1X1BA 3DPTA 1LFPA 4E7IA 3A2KA 3OYEA 3BC8A 2K3PA 3L2QA 3DLAA 4IQJA 3L2WA 4YELA 1GLNA 3K4LA 4LIVA 2V9KA 1KONA 3TMOA 2HU9A 2KRHA 2R4GA 3N05A 2MABA 3W2WA 4DBRA 4E7KA 2WY8Q 2K9LA 3K4NA 2R7UA 3OYDA 2L7KA 3V42A 3ZRGA 3H9GA 2VPLA 1MNEA 2X6XA 2PMZA 4D1QA 4HEA2 4FETA 2V26A 3IP4B 1D1CA 4PJLA 2V7FA 3PFYA 1E0EA 1Z3XA 5KCMA 2CV0A 1MMDA 3AFHA 3OMYA 3FHNA 1FMVA 3PNYA 3LSMA 3OY9A 1MMGA 3D5SC 2CV2A 4PK4A 1EA3A 4BGDA 3LSHA 2CMPA 2L2OA 2W00A 3ZXSA 2XC7A 4BUPA 4C30A 4E4HA 2Z1DA 3H9JA 3E1SA 5JHFA 3HUGB 3MKZA 2KRCA 3DU5A 3DTIA 3EUKL 2JUGA 3QYFA 3PJRA 4EATA 5KHDA 3IUOA 3OL4A 3VYUB 3DWLE 3OYNA 2X85A 4BACA 1D0ZA 2WBMA 4XKBA 5FROA 2K5CA 3PNVA 2HVSA 3W2VA 4BDYA 1QHGA 4PJMA 2E5ZA 2KPMA 4XLHA 2V6EA 2W4SA 1OLTA 2R7OA 2KLOA 1WJ5A 2XAUA 2OC6A 1YX3A 1TT0A 2DCEA 3EUAA 2CW7A 3LMMA 3U21A 2PJRB 2A6TA 3VDXA 3SZGA 4B47A 4CCLA 3D5LA 4P5OA 2ZSIB 3OYLA 2M3AA 4IQ4A 3OYAA 1MMNA 4J00A 4XL9A 2WY7Q 4BXFA 1HA8A 2V1NA 3HOTA 3H9QA 4CCKA 4F55A 4XOPA 2LY1A 3L2RA 2CUZA 4YEJA 2WB1A 3SEQA 2W7NA 2LOOA 4ZDLA 3H0DA 2HDWA 5CQEA 2IXSA 4HSTA 4CCOA 2X1DA 1Y6IA 3BLYA 2LY2A 2WAEA 2CUJA 3QODA 1YX5A 3CMMA 3RTRA 2JSPA 2VIXA 3E0JB 3MD2A 5TGTA 2ZSHB 1MMAA 4KITB 5HOOA 1D0YA 3I9V2 3LSGA 3L2UA 3GBGA 2M7BA 2IS4A 4MLOA 4XN3A 3PL8A 2R7WA 3J7AY 4XN0A 2BW3B 4PUSA 1X4PA 3OYMA 2CV1A 4F93B 2VXZA 3S3OA 1BOBA 2Z2SB 4ZTFA 3DTEA 4YRVA 4F92B 4BJTA 4KT6A 4F52A 1VZ0A 3OYCA 2LYCA 2WAFA 4X0GA 4NC7A 3SEZA 1DGWY 4BDZA 2VJIA 2DOAA 3VYTB 4B48A 3HG9A 4Y33A 4D9JA 2RQQA 3H5AA 2CH0A 2BW3A 2XSJC 2I8DA 2VQCA 4ZJZA 5CQGA 3HL2A 2WADA 3OYKA 3MKYB 1WJBA 4HPQA 4E7LA 2DT7B 2HNHA 1DP3A 2KDOA 2VB6A 2IGMA 2VJJA 4CA0A 2LG4A 3EPZA 2CW8A 4NUBA 2HZDA 3EUHC 1T95A 2VKDA 2KL4A 3DPUA 4E7SA 4Y3OA 3ZR8X 4XLCA 2KHMA 2XDVA 4NNJA 4C9YA 3DTKA 1QHHD 2Q2EB 4JQFA 4C2UA 1J09A 3FDYA 2R7RA 4QPOA 3A1YA 4PFOA 1WFXA 2F6CA 3OYGA 3SYTA 3AKZA 1SFKA 3OR1C 4HNUA 4BEHB 1BR2A 4BE1A 3TL4X 2VJ4A 3PSIA 4BEHA 3H5RA 4DBQA 2HVRA 3DQVC 1N77A 4XORA 4XMYA 4DIQA 3OYBA 4AU7A 1X1DA 4II3A 4ANJA 4FASD 4CZCA 3FBNB 4PFPA 3KEYA 3VSLA 1PYVA 2HVQA 3CESA 3HKZA 3I3LA 4LG3A 2GOXB 4IZZA 4F3QA 2E5NA 3G2BA 2R7XA 1LVKA 2JVHA 3W2AA 4P1WA 3HOSA 1Z3YA 2NOJB 1X1AA 2HPIA 4ZYAA 1QU3A 2VQHA 4DGWB 2Y0SA 3RQ4A 2LBFA 1UELB 4HG2A 1N78A 2E60A 4KJZA 4PJJA 2JA2A 3VYRB 3OS0A 1Y56A 3K4BA 2X51A 1TZLA 3FBIB 3C2GA 3NWTA 4Y4RA 3HPHA 3QYBA 4BL0B 1IRXA 4XOTA 4PSXA 2X6WA 3BCAA 3CP8A 3H5NA 4XKCA 4XQFA 4CCMA 2RNGA 1WJAA 5KNLA 4HSRA 1Z7LA 4C2TA 2W1OA 2UV1A 2M4GA 2CS3A 4BQQA 3D5RC 4R79A 3M1CA 4NQWB 5HNHA 4PSWA 2IS2A 3S8PA 4LITA 3TBIA 5CPRB 3RPUD 4XNFA 4II2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCO A; 
#chains in the Genus database with same CATH topology
 4BY1 J;  3HGY A;  2EFO A;  1RZ4 A;  4BBR J;  4CSW A;  4YII A;  3ZP5 A;  3PQK A;  4IKF A;  4JBA A;  4AWX B;  3SDG A;  4D7N A;  2K9N A;  4KA4 A;  2A05 A;  1LNW A;  2ELK A;  5E79 C;  3CDL A;  2GXB A;  2QGU A;  2RRE A;  3RDI A;  3LAJ A;  2A68 F;  2MYS A;  3AG3 H;  1YE9 A;  1OQY A;  3DEW A;  1E3P A;  3LSP A;  2VOP A;  4FIS A;  3ABU A;  3DPL C;  5CVJ A;  1IN8 A;  3K10 A;  3K69 A;  3ISP A;  1A35 A;  3ERM A;  5H2F C;  3W3C A;  4FTH A;  2F4I A;  1E2X A;  2LFB A;  4LMY A;  3ZQI A;  5H20 A;  3VYS B;  4RM2 A;  2LF8 A;  3F8B A;  1HDD C;  2W48 A;  5CKT A;  2YSR A;  2ZJP F;  3JRA A;  3CJR B;  4B43 A;  3V7C A;  1W36 D;  1NHA A;  2RAE A;  3O8H A;  1O3T A;  2Y0M A;  2AQE A;  2DMU A;  4ZYD A;  4H4K C;  1IO2 A;  2OJE D;  3BOQ A;  4CDG A;  2OCE A;  5LD2 C;  4M71 A;  1A6Q A;  3WG9 A;  2WA0 A;  2WB1 N;  2QSF X;  1ZG1 A;  4G6T B;  3K70 C;  2BYV E;  4KIB A;  1QQI A;  4A5M A;  1LEB A;  5E3M A;  5CVR A;  2ZO4 A;  2DQR A;  4DZP A;  4ZZL A;  1WJE A;  1UG0 A;  3QOP A;  3OS2 A;  3C1D A;  3BTC A;  4OAZ A;  2UZK A;  2M0M A;  2GLO A;  3HRS A;  3JTG A;  2ZXH A;  1HW1 A;  4DW6 A;  3DP7 A;  4GRI A;  1QZY A;  3S32 A;  4HF1 A;  4HAM A;  4LK0 F;  3HHH A;  4XBF A;  2R5Z A;  1MW7 A;  1CF7 A;  4XLN F;  1FNN A;  2EIN H;  1FMW A;  1E3H A;  3RKQ A;  4DYC A;  2Y0S N;  4A3L J;  1GV2 A;  1MH3 A;  5D6F A;  5LGU A;  1OYY A;  5BQT A;  2STW A;  2R3S A;  1WI9 A;  4HV5 A;  4CCJ A;  5IOY A;  3A4C A;  4R1H A;  1X4O A;  2QZ8 A;  2YU3 A;  2OV7 A;  5F64 A;  5FLX Z;  4V2F A;  1Z1D A;  3ZQQ A;  5TIS C;  3IH2 A;  4XKV A;  1YO5 C;  3HXL A;  5DCM B;  1QRY A;  3CUQ A;  2RQP A;  3H3U A;  2VPR A;  4I01 A;  5L3F A;  5EG0 B;  3WE3 A;  3WOD F;  1KA8 A;  3LSI A;  5FKN A;  1REP C;  4AIK A;  2GOM A;  2F5C A;  2ZME C;  2XF6 A;  1VTN C;  2RV8 A;  1IXS B;  1WRJ A;  2V9P A;  2H6B A;  2YX4 A;  1P6R A;  1ERD A;  2JPC A;  4W97 A;  3UNG C;  1RIO H;  2BVM A;  5EJC A;  3K6G A;  2N8G A;  3BPX A;  4RLF A;  2GBY A;  4IX7 A;  2XGC A;  2V4J C;  4K2E A;  2GA1 A;  1T0F C;  2CFO A;  1SAN A;  1POG A;  3WU1 B;  1RPW A;  1ON1 A;  2XF7 A;  1RRJ A;  1WQ2 A;  2O8X A;  3I0T A;  1N25 A;  2BY3 A;  2MD0 A;  4HX7 A;  2MFZ A;  1GVD A;  1B6A A;  3BR3 A;  1ZRC A;  2G7U A;  2O7O A;  3ECO A;  2DFE A;  3ABM H;  1PJR A;  1X3U A;  2P7C B;  4ESB A;  2NVU B;  1BIA A;  5E1Z B;  2E1M B;  5LGN A;  2ID6 A;  3G73 A;  2WV1 A;  3EUH A;  3RKX A;  3LSR A;  4RGS A;  2VL8 A;  2VLA A;  4ZTJ A;  1XB4 A;  4S04 A;  5HDN A;  3TO7 A;  3E5X A;  1OPC A;  1B1B A;  2FBI A;  5FFX A;  4D0P A;  3FKI J;  1S7O A;  3CF2 A;  1YJN I;  2A5W A;  3CMA I;  1K6O A;  3BR0 A;  3QRF F;  1S9H A;  3WGH A;  2YR2 A;  3SQN A;  1HKS A;  1XSD A;  1U6G A;  2WC2 A;  3K1M A;  3S1M J;  3CCM I;  2F4M B;  2KZV A;  2GZW A;  2IGK A;  1NG6 A;  1TQM A;  3E5Q A;  1LFU P;  1X2M A;  3S1R J;  3A2K A;  2VT3 A;  3I59 B;  2K3P A;  2OCC H;  3P7N A;  4M3D A;  5LBQ A;  5GTI C;  4LLG F;  3KZI C;  1KON A;  5DTD A;  1D5V A;  5FB2 A;  4PGH A;  1ZGA A;  2R4G A;  1BW6 A;  2MAB A;  1W5C C;  5BPD A;  3K7A J;  2FNP A;  4IF4 A;  1GXQ A;  5M3M J;  2WY8 Q;  2K9L A;  4BKX A;  2V79 A;  3IRR A;  1IAW A;  4RBO A;  1VQ9 I;  2L7K A;  3ZQH A;  3V42 A;  2V1X A;  2EIM H;  2JUC A;  5E18 F;  2A69 F;  2X6X A;  5DCF A;  4OIR F;  4EJV A;  1JE8 A;  2HTJ A;  3IP4 B;  3KYC B;  3F22 A;  2QA4 I;  3ZMV A;  5C4J J;  1E0E A;  2NVX J;  3W6V A;  5BMZ A;  2P5V A;  3CCQ I;  1Z9C A;  4A93 J;  3OMY A;  1XGN A;  3PNY A;  3LSM A;  4BYY A;  3LA3 A;  3OY9 A;  5IT9 Z;  1OIS A;  5D5U B;  2CV2 A;  4KUM A;  2DLL A;  2L2O A;  2FJ1 A;  4BUP A;  2JK3 A;  2Z1D A;  3CLO A;  1Z91 A;  1QVU A;  4M3E A;  5FLM J;  3IV5 A;  3CCS I;  4NBQ A;  5EYR A;  1UG2 A;  3F3X A;  3I55 I;  3MKZ A;  4A6D A;  1PDN C;  3FX3 A;  2QQA A;  3L1P A;  4EAT A;  1T6S A;  2MW8 A;  5L3B A;  3CLQ A;  3IUO A;  3VYU B;  4L0Y B;  4UVA A;  1ZRF A;  2X85 A;  1D0Z A;  5FRO A;  1JHH A;  5E3N A;  1U8B A;  1W1W E;  1XMX A;  4CYC B;  1PUF A;  3W2V A;  2HVS A;  4BDY A;  3MKL A;  1QHG A;  5EEG A;  2Z3Y A;  2KPM A;  2L4A A;  4XLH A;  5DD8 A;  3HSE A;  2X4H A;  2W4S A;  3ASN H;  2R7O A;  3V8L A;  5E1X A;  2QSH X;  2KLO A;  1ZG3 A;  1ZGW A;  2OC6 A;  3A0B C;  2DCE A;  4CZZ A;  4WX9 A;  1Q1V A;  2PJR B;  3L9F A;  1U9N A;  1U9O A;  3I71 A;  4B47 A;  2HOA A;  2GA2 A;  3HRU A;  1TQI A;  5ILV A;  4GGG A;  5GPC A;  4ENJ A;  2M3A A;  2G7H A;  2IW5 A;  1W0T A;  2OAZ A;  1FZP B;  2DA6 A;  2JPB A;  2XSD C;  2WY7 Q;  3GME A;  1I1S A;  2Z33 A;  1HA8 A;  3H9Q A;  1MNM C;  4XOP A;  3GWZ A;  3ZMT A;  2XRL A;  4I76 A;  5LHI A;  1Y8Q B;  1T38 A;  1ULY A;  5CJ9 A;  5DM6 F;  4ZDL A;  2EH3 A;  3CD6 I;  5CQE A;  1YW9 A;  3GUD A;  3EQL F;  3C3W A;  2X1D A;  3BZ6 A;  1MBK A;  1WI3 A;  4EEF G;  5B3S H;  2A5Y B;  3J81 Z;  1EJ9 A;  3CMM A;  1GXP A;  3RTR A;  4UVC A;  2CQQ A;  2EFP A;  5B5E C;  5D4S A;  4XRM A;  1ETX A;  2ZSH B;  3ML6 A;  3KFW X;  1DDN A;  4A69 C;  4KIT B;  2QF7 A;  5HOO A;  3JRB A;  3BP8 A;  3KP6 A;  3HSR A;  3LSG A;  3QP6 A;  3L2U A;  4DNC A;  2P5K A;  2M7B A;  2Y9Y A;  3Q9S A;  4RGR A;  5D8K B;  5IT9 K;  2R7W A;  3J7A Y;  3MZ8 A;  2BW3 B;  2LKX A;  1K79 A;  2GXA A;  4F93 B;  3TDZ C;  4KFC A;  3CO7 C;  4PZJ A;  3LQQ A;  1IUY A;  2ESH A;  3BWG A;  2TRT A;  1KQ9 A;  3OYC A;  2ZC2 A;  2LYC A;  4NC7 A;  4MQ9 F;  1B8I A;  1DGW Y;  1ETO A;  1Y1W J;  3VYT B;  4B48 A;  4YG2 F;  3AG4 H;  3MN2 A;  2NVY J;  1XS9 A;  2RQQ A;  4M6Y A;  5TRD A;  2XPU A;  2XSJ C;  2O8K A;  3TGN A;  2COM A;  2ACJ A;  3JRC A;  1G3Y A;  4A3C J;  2DK8 A;  2WAD A;  4XLP F;  4HPQ A;  4E7L A;  1DP3 A;  2LF7 A;  1DP7 P;  2VB6 A;  2G9W A;  3LOC A;  2HI3 A;  3KEO A;  1VI0 A;  3QQA A;  4N9H A;  5J4V A;  3KP3 A;  5JVG F;  2A6E F;  2NAZ A;  1UST A;  4FE7 A;  4MIM A;  3KZY A;  2ECC A;  1R22 A;  1JKQ C;  1OCZ H;  1FP1 D;  4CXF A;  1BJZ A;  1XPX A;  2KL4 A;  3DPU A;  2DMT A;  4Y3O A;  4EM2 A;  4XLC A;  2FRH A;  4NNJ A;  3DTK A;  1QHH D;  2L9R A;  2Q2E B;  1J09 A;  3SZT A;  2R7Z J;  1UCR A;  3A1Y A;  2XPW A;  2TDX A;  2KRF A;  5K7F A;  5FLX K;  2F6C A;  2ICW G;  3FK6 A;  2J5O A;  4P55 A;  1SFK A;  1XMA A;  1ZKG A;  1FIA A;  2QLZ A;  2X6O A;  2L02 A;  1IV8 A;  2PMU A;  2IA1 A;  4XOR A;  3FXL A;  4XMY A;  5DEQ A;  3F8N A;  3E6C C;  3F23 A;  3CC4 I;  3OYB A;  4M6X A;  4II3 A;  5B1B H;  2HDD A;  4F3Q A;  3MCZ A;  5K5O A;  3G2B A;  2ZJR F;  3HOZ J;  1TC3 C;  1V3F A;  3W2A A;  4RS8 A;  4P1W A;  3HOS A;  3IH4 A;  3I5U A;  4G7Z F;  1Z3Y A;  2K9Q A;  2GXG A;  4A12 A;  2A07 F;  1J2X A;  1QU3 A;  4DGW B;  2Y48 A;  2LMD A;  3DFG A;  2Q0O A;  2Y0S A;  1UEL B;  4WXH A;  4PJJ A;  5EDN A;  1B4A A;  1P2F A;  2CQN A;  3K2A A;  3TKY A;  3K4B A;  2X51 A;  4ZYG A;  4EM1 A;  1MSF C;  1WCM J;  3C2G A;  1W4M A;  3FIW A;  3JW4 A;  4Y4R A;  3HPH A;  3RI4 A;  2M9H A;  3H3V K;  2HYF A;  2MG4 A;  1EH6 A;  3CP8 A;  2W85 A;  3H5N A;  2DFF A;  5KNL A;  4IHY A;  5F0C A;  3N97 A;  2OTJ I;  4HSR A;  3ECH A;  2Y31 A;  2UV1 A;  2HYG D;  4YFX F;  4EQQ A;  4BQQ A;  1XDS A;  3BG3 A;  2QYO A;  4AD9 A;  3M1C A;  3DF8 A;  4LLN A;  4L0Z B;  3GLX A;  2DOF A;  1H88 C;  2IS2 A;  4CO8 A;  1LQ1 A;  1U2W A;  4LIT A;  4GYG A;  3TBI A;  3RPU D;  2O6G E;  2QQB A;  1Z0X A;  1ZLJ A;  2IA0 A;  1UAA A;  2VQL A;  4I02 A;  4KIF A;  2E7W A;  2E1C A;  2PJP A;  2LKP A;  1A6I A;  3HHG A;  2HGC A;  3BG9 A;  3F9K A;  1S7E A;  1BI2 A;  4KMU X;  2EV5 A;  3TP3 A;  3WTV C;  1LJ9 A;  3M07 A;  5J3L A;  4MTE A;  3S93 A;  3MAJ A;  2E1M C;  2XGD A;  2VBX A;  2E1O A;  4I6Z A;  4Y13 A;  4DYR A;  2IGO A;  3CCU I;  1X3W B;  2Z16 A;  3I53 A;  5J8F A;  1BIB A;  2R7T A;  3IWF A;  4L9V A;  1LPQ A;  2BXY A;  3QPS A;  3KET A;  3P5J A;  1IJW C;  2DFH A;  2Y75 A;  2D1H A;  1IRG A;  1P7J A;  2ZJ2 A;  3V8J A;  5LEK A;  2ADU A;  1XD7 A;  1TQP A;  4XM3 A;  3OSG A;  1RKW A;  2OQG A;  1DU0 A;  2BGC A;  2EZK A;  2AO9 A;  1VQK I;  1MJA A;  4RDU A;  1XGO A;  4YIF A;  2DT5 A;  1DPR A;  3S1Q J;  2VQG A;  3LWF A;  4WCG A;  2KP6 A;  3PUF A;  1N75 A;  1SVO A;  1I3Q J;  1Z6R A;  2ETH A;  1BBY A;  1P92 A;  3QP5 A;  1X3Z B;  4BHB A;  4RGU A;  2COB A;  4ASN A;  2BOL A;  2X1E A;  3DKY A;  4WXD A;  2FSW A;  3JAM Z;  1KYW A;  3E3V A;  5BPI A;  4LOC A;  2DJI A;  5FLV A;  3OOP A;  1KQ8 A;  2MLG A;  2E2J J;  4RB2 C;  2H1L A;  1WJF A;  2MH2 A;  3OIP A;  4ENM A;  2CWE A;  2XKP A;  1YG2 A;  3UR3 C;  2KIQ A;  3K4C A;  2KIM A;  1YFH A;  2C6Y A;  3C2H A;  4E6K G;  2DOE A;  3HOU J;  1P9Q C;  2CG4 A;  2ISY A;  2EPF A;  3GFJ A;  4MFD A;  1LDJ A;  1OCP A;  4C3I J;  5JVT A;  3JRF A;  4BJ5 C;  4CH7 A;  1SD4 A;  2I10 A;  1FWZ A;  3R0A A;  4O5V A;  1U0J A;  4U7B A;  1G6N A;  3CC7 I;  3GF2 A;  5F04 A;  1FC3 A;  4OIN F;  1A36 A;  3GTG J;  3ZN1 A;  1LUJ B;  1UJ8 A;  2DXI A;  2VC0 A;  2F4O B;  2Z5U A;  2L9N A;  1RUO A;  3DBR B;  1R9T J;  2ZFU A;  5GP9 A;  1R58 A;  4M3G A;  1NK3 P;  4UUT A;  1FIP A;  1IW7 F;  1YOV B;  4BQO A;  2LC2 A;  4DJA A;  3BG7 A;  2HTS A;  3HPG A;  3EDP A;  4NC8 A;  1YYV A;  2F5V A;  1D3Y A;  4KNY A;  3BQZ A;  3JRE A;  3J7A O;  1W5T A;  3AL0 B;  5FFZ A;  1FOX A;  2FUG 2;  2KKO A;  2OZU A;  3BPV A;  3WTY C;  2M7A A;  2W57 A;  2XPV A;  2MC4 A;  2ZXW H;  5ICE A;  2VI6 A;  2JA8 J;  3OL3 A;  2R5Y B;  4YIR X;  2LTP A;  1ETK A;  1VQ5 I;  3BJ6 A;  1FTZ A;  3ZMZ A;  1Z67 A;  3LFU A;  2XF5 A;  4A3D J;  3ZQ7 A;  2AXT C;  1WH7 A;  3TOB A;  1Z7U A;  2O61 A;  4EJT A;  4BXX J;  2XRN A;  1D8J A;  3I59 A;  2LD5 A;  4XON A;  4HF2 A;  3OYI A;  4E7J A;  1HC8 A;  3OR2 C;  4OMZ A;  3G1L A;  4EGZ A;  1TT5 B;  2FXA A;  2FX0 A;  2EB7 A;  4DOZ A;  4UY8 I;  1ZTR A;  2VE9 A;  3DKX A;  2DOD A;  1Y39 A;  1VFC A;  4XLE A;  4AID A;  2ZXJ A;  4M6V A;  1QZE A;  4V19 K;  2H09 A;  2VUM J;  1PUE E;  4P9F A;  3WTX C;  4P96 A;  1D1B A;  2VKE A;  1VQN I;  1R1U A;  5B66 C;  5J1R A;  3SDB A;  2FEZ A;  3GX4 X;  2TCT A;  3OIQ A;  4BBS J;  3CCY A;  4G8X A;  4JOM A;  4AYB A;  1Y1V J;  1JI8 A;  3WGI A;  2ZFW A;  3BRO A;  3FKJ A;  5FRN A;  2VAS A;  1YIO A;  2LH9 A;  2M34 A;  2JA6 J;  1ODD A;  3KIO A;  1J5Y A;  3CZ6 A;  3OS1 A;  5DUK A;  1K4T A;  4MNU A;  4UB8 C;  5EZH A;  4E7I A;  3OYE A;  3BR5 A;  3BC8 A;  1HOM A;  2R7D A;  3HOY J;  4YEL A;  1YTY A;  5E8I A;  4ZYH A;  3FMQ A;  3DEU A;  5JLX A;  4L9J A;  2GQQ A;  3N05 A;  3B6A A;  2JN6 A;  1XSV A;  3H36 A;  2CUE A;  3GW2 A;  1ZLK A;  2R7U A;  1IRF A;  3GTP J;  2DO7 A;  4LG0 B;  5FO5 A;  2M0C A;  2FBH A;  1WSU A;  2H94 A;  1MNE A;  1WWX A;  2PMZ A;  4IXA A;  4NC6 A;  4D1Q A;  3FMR A;  4HEA 2;  2F5F A;  2MD5 A;  2V26 A;  1D1C A;  1FX7 A;  4WXC A;  2BY1 A;  2BZT A;  2ZJQ F;  2CV0 A;  2YU9 J;  4RB1 A;  4PJ0 C;  2ZME B;  3I4M J;  1FMV A;  2B0L A;  2E2H J;  3GFL A;  5E20 A;  2EFQ A;  2H8R A;  5E17 F;  2PMH A;  4BGD A;  2CMP A;  2W00 A;  5EZG A;  1XX5 A;  3RYR A;  4F7Z A;  1IC8 A;  4L9N A;  2QUF A;  2EIL H;  3E1S A;  4HBL A;  2JZY A;  1RUN A;  3ZQF A;  3DU5 A;  5HS8 A;  3EUK L;  2JUG A;  3QYF A;  1YQA A;  4UUV A;  1DU6 A;  1OMI A;  3U1D A;  2IAI A;  1IXC A;  4IOC F;  4MFE A;  3F21 A;  2OBP A;  2JQ7 A;  4BAC A;  2WBM A;  4HQM A;  1TNT A;  2NYX A;  4XKB A;  1BC8 C;  5C3E J;  3ULQ B;  2A6H F;  2M1B A;  1IV6 A;  2V9V A;  4L18 B;  2P81 A;  1FOK A;  3I54 A;  4JX6 A;  1WH5 A;  3KEQ A;  1J9I A;  1WJ5 A;  2XAU A;  4A3M J;  2EV6 A;  2DAO A;  1ZG5 A;  3LMM A;  3U21 A;  3D1N I;  2A6T A;  2P8T A;  1MKM A;  3R4K A;  2EBI A;  2ME6 A;  1MBE A;  2ZSI B;  1BI0 A;  2M8G X;  2ELH A;  4A3K J;  1OCT C;  3QWL A;  1R00 A;  2DN0 A;  5F0H A;  3HOT A;  3MFK A;  4F55 A;  2KIU A;  2DI3 A;  1STZ A;  2EZH A;  1AOY A;  2CUZ A;  2W84 A;  4YEJ A;  4TV7 A;  1BJA A;  4EV0 A;  2X48 A;  2HDW A;  2Q2E A;  2K85 A;  3KP4 A;  5LRR A;  2HS5 A;  1FOW A;  1XGM A;  1VQ7 I;  2P4W A;  4WWC A;  2LY2 A;  1MH4 A;  1U5T B;  1YX5 A;  3E0J B;  3MD2 A;  3TDU C;  2EK5 A;  2DA3 A;  1SAX A;  2H8W A;  1UHM A;  2HKO A;  5D8L B;  5J40 A;  2VE8 A;  4IRG A;  4HZF A;  2HQN A;  4EJU A;  3SZP A;  4ZH4 F;  2V6C A;  1FSE A;  4S0H B;  4AIH A;  3I4P A;  3WTS C;  4RAY A;  1XSX A;  4XN0 A;  5LHG A;  3JR9 A;  3S3O A;  4L5E A;  5K7Z A;  1BOB A;  2BBY A;  2ZB9 A;  2HXI A;  4YRV A;  3BTJ A;  4F92 B;  5GAG J;  2ZCW A;  4MQV A;  4RAG A;  2CQ7 A;  2LP0 A;  4HV6 A;  5E3O A;  2WAF A;  3L00 A;  1X2N A;  1SFX A;  4LK1 F;  3SEZ A;  1FY7 A;  4KT5 C;  1GHC A;  2DOA A;  4G9Y A;  3F72 A;  2IP2 A;  2E36 A;  2P6T A;  3HG9 A;  3CQZ J;  3DBL B;  1ZH5 A;  4D9J A;  3ZMD A;  1YIJ I;  1WZ2 A;  4GYI A;  2BW3 A;  1JHF A;  1XCV A;  1E17 A;  4BNC A;  2I8D A;  1WHU A;  1J0R A;  4ZJZ A;  3DV8 A;  3HL2 A;  1O57 A;  3DLL F;  5AIP A;  4L5I A;  4RB3 C;  1I6X A;  2DT7 B;  3HUG A;  3BR2 A;  1JJ6 C;  3CCL I;  5CVU A;  3GZN B;  5ICC A;  2ZNZ A;  4Y17 A;  2KIF A;  2PMZ N;  2STT A;  1SC7 A;  2LG4 A;  2DFI A;  2RKH A;  4M3B A;  2OPT A;  4B3A A;  1HF0 A;  4NUB A;  1F9N A;  3CJN A;  2BY2 A;  5J1U A;  3E7L A;  4MTD A;  2KHM A;  2XDV A;  4A3F J;  3WHC A;  1KU3 A;  3JRG A;  4U7D A;  1FP2 A;  2R7R A;  4QPO A;  1IDY A;  1QGP A;  2PBI A;  3JCU C;  3M8F A;  2XHK A;  2KDZ A;  3KP7 A;  2GM4 A;  3S2H J;  4R8H A;  2QSG X;  3TOA A;  3OYG A;  2PLY A;  4HNU A;  4BEH B;  3CDI A;  1TW3 A;  4JK1 X;  3TL4 X;  3PSI A;  3H5R A;  1SD7 A;  4DBQ A;  5GAH J;  2HVR A;  3HRM A;  1R36 A;  3ZPL A;  2XAF A;  3M7G A;  3GFI A;  4CZC A;  4PFP A;  3Q0V A;  4HF0 A;  3DXJ F;  1PYV A;  4E70 A;  1YS7 A;  3I3L A;  2NS7 A;  2E5N A;  4IL6 C;  1LVK A;  4B8X A;  1EH8 A;  4CHU A;  3WTW C;  2O03 A;  2IT0 A;  2UXX A;  1C0W A;  4HYE A;  3RPQ A;  2K4B A;  1FOY A;  3J80 K;  3HEF A;  2VQH A;  5EEH A;  2XRO A;  2R5Z B;  5D5X B;  4J19 A;  1N78 A;  2E60 A;  4UXN A;  2BHZ A;  5AIQ A;  4DQ2 A;  4XRF A;  1Y56 A;  1KU9 A;  1S8N A;  2RN7 A;  4D7M A;  2XUB A;  4N0B A;  2LVS A;  3H92 A;  1XGS A;  4KN7 X;  2CRG A;  4BL0 B;  1T08 B;  2H6C A;  4XOT A;  2X6W A;  3BCA A;  4M72 A;  4XKC A;  4BAY A;  4CCM A;  2GAU A;  1VQP I;  5FJ8 J;  3D0S A;  4GDF A;  1Z7L A;  4UUS B;  1W7P A;  2VC1 A;  1YW8 A;  4R79 A;  2HR3 A;  1YHQ I;  2ID3 A;  4NQW B;  1WPK A;  3PFI A;  4OOI A;  1TW2 A;  3S16 J;  4PSW A;  4A3B J;  3PIO F;  3NEU A;  3G1O A;  3G4S I;  3BG5 A;  4II2 A;  2HFH A;  3S2D J;  4IHV A;  3QOE A;  5IP6 A;  1RET A;  1ZHF A;  3GTO J;  2R93 J;  2FBK A;  2NRA C;  2FE3 A;  3BCB A;  2DU9 A;  3H1C A;  1VQM I;  5BNG A;  1IN7 A;  2KFD A;  2O3F A;  2LBF B;  3PNT A;  3SFZ A;  2JA7 J;  3JTH A;  2A3S A;  4CUG A;  4HRI A;  1TWC J;  1V54 H;  1R6R A;  2K9M A;  1G59 A;  3MKW B;  2P7V B;  5B1A H;  2MSY A;  3P9K A;  2L54 A;  2JRM A;  3ZQG A;  2X6Y A;  1OYI A;  2JRT A;  2XGX A;  1BA5 A;  1K78 A;  1KGS A;  1LKX A;  2CUF A;  3MVP A;  2B63 J;  1TWG J;  3FXU A;  4N4N B;  1O3Q A;  3OYJ A;  1VQ8 I;  1UHS A;  2VXD A;  3TQN A;  5HVQ C;  1R23 A;  2P0W A;  3RQI A;  1S3J A;  3KX2 A;  3CC2 I;  2V1U A;  3BJO A;  1W7P D;  2LRE A;  3X2Q H;  4N4O B;  3R6S A;  3IHU A;  1HLV A;  2HEO A;  2FF4 A;  4MGR A;  1VQ6 I;  1ONV A;  1DGR M;  1MND A;  4V2G A;  3S3M A;  3CME I;  3FIS A;  5J6X A;  4E7H A;  3ONQ A;  4LJZ F;  5FD6 A;  4QWQ A;  1B8I B;  1RNL A;  1WJD A;  4C3J J;  3ZQL A;  1JGS A;  1SAU A;  2JTV A;  3OYH A;  5DYM A;  3QYE A;  1IF1 A;  4IRH A;  1ZAR A;  2L9S A;  3Q0W A;  2UWM A;  3T8T A;  1OR7 C;  2MH9 A;  5F0F A;  2HOS A;  2XAS A;  1I27 A;  1I50 J;  1AU7 A;  2Y9Z A;  1BN5 A;  3S17 J;  5HDG A;  1HBX G;  2LLK A;  1FYL A;  2NS8 A;  2X1C A;  3R61 A;  1YRN A;  1GDT A;  1G3W A;  4L5J A;  5L3C A;  2E2I J;  1K6Y A;  2M4K A;  1R49 A;  2JWT A;  3KP5 A;  1G8X A;  3H0G J;  1BR4 A;  5LHH A;  5K7H A;  3WU2 C;  1D8K A;  3CCE I;  1SMT A;  3IH3 A;  4HLY A;  4XLA A;  4EMS A;  3ELK A;  2L5Q A;  2PJR A;  3BY6 A;  3CCJ I;  4BQN A;  1J59 A;  5FKL A;  3OWT A;  2ECB A;  2W24 A;  3VOE A;  3S3N A;  2ELJ A;  2VBY A;  3MMY B;  5IT3 A;  1QZZ A;  1FEX A;  2IGN A;  2CSO A;  2YS9 A;  3A03 A;  3FK7 A;  4CYD A;  1PVE A;  1TL8 A;  5ICG A;  3ZOB A;  1V55 H;  3VOD A;  1WGX A;  1ORK A;  1APL C;  2IPQ X;  4OIP F;  1ETW A;  1HW5 A;  1ZQ3 P;  1R1T A;  4KN4 X;  2XAJ A;  4IHT A;  2E1N A;  2Q1Z B;  2QVO A;  4ENK A;  4A0Y A;  4X6A J;  2M87 A;  5M5W J;  3M1E A;  5HLG A;  2F5D A;  3CUQ C;  3KYL A;  3PO3 J;  2HPM A;  2IJL A;  1WKM A;  2PFB A;  4BE2 A;  2R7S A;  1W36 C;  1YI2 I;  4OMY A;  3LL7 A;  3HDD A;  4RGX A;  1XDU A;  1ZRD A;  3GTL J;  4O6J A;  1XN7 A;  3SJM A;  1YW7 A;  2PQ8 A;  4B44 A;  4OAY A;  1T33 A;  2DDA A;  2E71 A;  2OUM A;  5F08 A;  4CYC A;  1TWA J;  1IN5 A;  2EZL A;  2E19 A;  3C7J A;  2Q8K A;  3RSN A;  2BV6 A;  3GFM A;  2KJC A;  3K4J A;  1FYK A;  1XTA A;  4I09 A;  1K83 J;  1ON2 A;  3RYP A;  1DQU A;  1SVL A;  3HRT A;  4RMN A;  1T2K A;  5K5R A;  1ITY A;  5HS7 A;  3O8G A;  5LFA A;  3ZGK A;  4BJ6 C;  1TWF J;  1Z21 A;  4LD5 A;  2NOG A;  1JTX A;  4I99 C;  2DBB A;  1FPQ A;  4QPQ A;  1I5Z A;  2ZXI A;  3KLO A;  4JX4 A;  4RLQ A;  4A3G J;  4ESF A;  4P9U A;  1U5T A;  2XAQ A;  1UHW A;  3CTA A;  1MGT A;  3F8C A;  4RM3 A;  2R7V A;  2Y69 H;  4F91 B;  3HBL A;  4BHP A;  1ZRE A;  4J01 A;  1SMY F;  5C4X J;  4A2U A;  5HS9 A;  5FRM A;  1GUU A;  3K4K A;  4FE4 A;  3GEZ A;  3JRD A;  5ED4 A;  1NG7 A;  2M8E A;  3DU6 A;  2CQK A;  2DJN A;  3CF5 F;  1RR7 A;  2QQ9 A;  1KU7 A;  2QKM B;  5HLT A;  1VQL I;  3LQR A;  2KIS A;  2DW4 A;  4XR6 A;  2LKS A;  3DPT A;  1TTY A;  3L2Q A;  4AC0 A;  1SFE A;  1R5I D;  3QU6 A;  4A0Z A;  1AKH B;  3K4L A;  3GXO A;  4LIV A;  3S1N J;  3TMO A;  4WK8 F;  1IZ1 A;  2HU9 A;  2KRH A;  2R92 J;  3LAP A;  4X1E A;  1QPI A;  5BS6 A;  1JT0 A;  2DA5 A;  3PM1 A;  5ICF A;  3W2W A;  4Y7N J;  3HB9 A;  1MIJ A;  4IHW A;  2MGQ A;  3K4N A;  2DA4 A;  3FXO A;  4IJA A;  1IUF A;  1JUM A;  4MO7 A;  3A01 A;  4JP0 A;  2VPL A;  5KAI C;  2B9S A;  1EF4 A;  3KLN A;  1JKO C;  1DPU A;  1VQO I;  4PJL A;  2WTE A;  1FBQ A;  3GZ5 A;  4KYW A;  2KJB A;  3TW6 A;  1Z3X A;  2DYS H;  5EEA A;  3A0H C;  3P9I A;  5L3G A;  4QTR A;  3V4G A;  4NHJ A;  4CGZ A;  2IA2 A;  1MMG A;  2X9D A;  2FNA A;  1RKT A;  4PK4 A;  2YUS A;  3LSH A;  4HOB A;  4E4H A;  3DCF A;  3HZJ A;  5HDK A;  5JHF A;  4AVP A;  1F5T A;  1FT9 A;  4Q4Z F;  5H6Q A;  3DTI A;  3DBH B;  1OFC X;  1EKE A;  4CIC A;  2DPD A;  5KHD A;  2RNJ A;  5LLQ A;  2MLK A;  2QM3 A;  3GVA A;  4HLX A;  2M45 A;  4A0X A;  4DYQ A;  4S05 A;  3F8M A;  1IDZ A;  2DMN A;  1UZC A;  2L9V A;  3M8E A;  4DZJ A;  3PNV A;  4MEX F;  1OJL A;  3FXM A;  4M3F A;  3KE2 A;  4PJM A;  4IO9 F;  2V6E A;  3M4O J;  3HSF A;  3CUO A;  1YX3 A;  1TT0 A;  2FQ3 A;  5HOD A;  2CW7 A;  3CMY A;  5ILU A;  3VDX A;  3SZG A;  2OA4 A;  2H1K A;  1HW2 A;  3MEX A;  3QPT A;  1FJL A;  3LSJ A;  4HW0 A;  1AHD P;  5J1Y A;  3OYL A;  4EM0 B;  2Z99 A;  1MMN A;  4Q48 A;  3E6B A;  3RZO J;  3TW7 A;  4BXF A;  2D2W A;  2V1N A;  1TWH J;  2M5W A;  5E3L A;  3F0C A;  2LY1 A;  3COA C;  2CJJ A;  2HOE A;  3ZMU A;  3L2R A;  2FOW A;  2LY9 A;  4PGG A;  1MJB A;  3QPL A;  2WB1 A;  3SEQ A;  1T39 A;  4MHG A;  2LOO A;  4A3J J;  1QVT A;  1ZN2 A;  4KDP A;  1BM9 A;  3H0D A;  3HOW J;  3TO6 A;  5DUI A;  2G0E A;  1Y6I A;  2IRF G;  3BLY A;  4L9T A;  1OCO H;  4G7O F;  3HTU A;  1U8R A;  1H9G A;  2CUJ A;  2XB0 X;  3QOD A;  3U1K A;  4ENN A;  1F4K A;  1R5H A;  3JSO A;  2PX9 A;  4FX0 A;  2JSP A;  5CVI A;  3VPR A;  2F2E A;  5TGT A;  1FSH A;  2BY0 A;  2ZBK A;  1ZYR F;  3ABT A;  2DPU A;  1LDD A;  2R5Y A;  1ETV A;  1UB9 A;  4G6D A;  2Y2Z A;  4OIO F;  2L7F P;  4KMF A;  3GBG A;  1ETY A;  3FZV A;  1L3L A;  2IS4 A;  3T1B A;  3BR6 A;  4XRS A;  4MLO A;  3PL8 A;  3RKW A;  3WG7 H;  5IYD J;  2L4M A;  5EF6 A;  3G71 I;  1X4P A;  3OYM A;  2CV1 A;  3L09 A;  2VXZ A;  4ZTF A;  2XGE A;  3O2P E;  1TLH B;  3RZD J;  4XIC A;  4UVB A;  3RJP A;  4QSH A;  4F52 A;  2EA2 A;  1VZ0 A;  2HZT A;  2NXN B;  2DMQ A;  2E7X A;  2P6S A;  4X0G A;  1EH7 A;  2VJI A;  4A3I J;  4G7H F;  3AG1 H;  4BHC A;  1PUF B;  4Y33 A;  1SFU A;  1Y0N A;  4JYK A;  4OU0 A;  1R1V A;  2EJR A;  3VB2 A;  1B72 A;  4I7H A;  2OZ6 A;  3LFK A;  2CH0 A;  2K7L A;  2VQC A;  1H9T A;  3ABL H;  2DMP A;  5CQG A;  3HOV J;  3CCV I;  3REO A;  5DS9 A;  2QEN A;  4HX8 A;  4EJO A;  5H6R A;  3O3K A;  5E8G A;  1WJB A;  5GAE J;  1LVA A;  3MKY B;  2KDO A;  3A01 B;  2K02 A;  4Z2Y A;  1FBS A;  4IHS A;  3AAF A;  5HLH A;  2IGM A;  3FMS A;  2GWR A;  4CA0 A;  1K78 B;  2CW8 A;  2FMY A;  3AG2 H;  5J4Y A;  1SD5 A;  1U3E M;  3JRI A;  2D45 A;  1T95 A;  3I58 A;  1UFM A;  1RC9 A;  1R4M B;  4E7S A;  4PDK A;  3ZR8 X;  1U5T C;  3HOX J;  3MZY A;  4JQF A;  2LNB A;  2CGP A;  2VOD A;  5D5V B;  3W6J B;  1M1E B;  2L7Z A;  4XSX F;  3BTI A;  3AKZ A;  4Y52 J;  3OR1 C;  4IVN A;  1BR2 A;  3H3Z A;  2VJ4 A;  3TED A;  1QBJ A;  4Z6Y A;  5IOZ A;  1A5J A;  3MZH A;  3IRQ A;  3GYH X;  3EYI A;  4DIQ A;  1I1G A;  3FXQ A;  4G6Q A;  2BHY A;  4FAS D;  1Q1H A;  4ANJ A;  5DV5 A;  4Q5S F;  3KEY A;  3CES A;  1OYW A;  3HKZ A;  1SD6 A;  2L3D A;  3LNQ A;  1CGP A;  3GTQ J;  1XMK A;  2PEX A;  1LE8 B;  2R7X A;  3M3Y J;  1LEA A;  5GAD J;  2XVC A;  4UUS A;  2HKX A;  1IRZ A;  1E3O C;  2NOJ B;  1G4D A;  1X1A A;  5D5W B;  2EWN A;  2HPI A;  4ZYA A;  2XAH A;  1XG1 A;  2QCO A;  2QQ8 A;  2DYR H;  4KJZ A;  5A2Q Z;  2PG4 A;  3LST A;  3ZMS A;  4EGY A;  1K61 A;  2JA5 J;  2W25 A;  2AHQ A;  1TZL A;  5FKM A;  3NWT A;  4YFN F;  5J8C A;  4IEJ A;  1B72 B;  2PI0 A;  3WE2 A;  1KU2 A;  3SXY A;  3ZQC A;  2VT2 A;  1R71 A;  2JSC A;  2W1O A;  3E6D A;  2CS3 A;  3D5R C;  4M9S A;  4NDL A;  2XAG A;  4RAZ A;  4LB6 B;  5A2Q K;  4KIC A;  1OCR H;  4FQG A;  2K86 A;  3KPH A;  5HNH A;  3PO2 J;  1BC7 C;  4H0E A;  2ZME A;  3P9C A;  5LGT A;  1BI3 A;  2B7E A;  3S15 J;  1TNS A;  4XNF A;  4ZC3 A;  4ETS A;  3IL2 A;  1I39 A;  1ZEL A;  2L0K A;  1S72 I;  1OR7 A;  3G6E I;  3BDD A;  4RAF A;  3DEE A;  3AL0 C;  2XV4 S;  3RCO A;  4AM3 A;  3S14 J;  3E6M A;  1Z05 A;  1WVR A;  1HSJ A;  2L7M P;  2AQF A;  3FHZ A;  1W5S A;  5M5Y J;  3K1P A;  2BVL A;  1F36 A;  4M74 A;  1V5G A;  4AUX A;  3IAM 2;  3K4M A;  3ABK H;  3DKW A;  3FXK A;  4ABZ A;  3HJE A;  5GPA A;  3B73 A;  4U0Y A;  3LSK A;  1JKR C;  2XIG A;  1D1A A;  1AA7 A;  2QBY B;  3CJQ B;  1XC5 A;  1VND A;  2VKV A;  2YX7 A;  3NAR A;  3VSK A;  3WU0 A;  4GFB A;  4NB5 A;  5IP7 J;  1D0X A;  3E5U A;  4FX4 A;  3NAU A;  3L7W A;  3K1N A;  1K4S A;  2OU2 A;  2LR8 A;  1YS6 A;  5KVR A;  3Q5F A;  1JKP C;  1DUX C;  3K70 D;  2P5L C;  4A3E J;  2V1D A;  5DCM A;  2FML A;  4EVI A;  2XB5 A;  1ZAO A;  5EGO A;  2CU7 A;  4I0B A;  1T0F A;  3NQO A;  4B3X A;  2VJ5 A;  3KYD B;  1HKQ A;  2WAQ A;  4I0A A;  3HM5 A;  4U0W A;  3ZCO A;  3ESW B;  4OWR B;  2F5E A;  2EIJ H;  5ERI A;  3PSF A;  1SFO J;  1J75 A;  4XRS G;  2IS1 A;  4HX4 A;  4UV9 A;  4ZDP A;  1X1C A;  5CVV A;  5F6F A;  2QKL B;  3OYF A;  4EJW A;  3HYI A;  3EYY A;  4HDV A;  2F48 A;  1MBF A;  4CCN A;  1Y0U A;  4ZDO A;  1ZR2 A;  1LB2 A;  1S29 A;  1KQ0 A;  1G3T A;  1JXS A;  4I2O A;  2R7F A;  4XLF A;  1W0U A;  1O3S A;  1OKR A;  2HDC A;  4RA2 A;  5HNF A;  2LDU A;  4D5C A;  2W82 A;  4BH9 A;  4ITV A;  2EFN A;  3IAS 2;  3FWE A;  2AS5 F;  2D5V A;  1NTC A;  5GTH C;  3CP2 A;  1LE8 A;  2DTR A;  2DQL A;  5JI6 A;  3TP0 A;  5IP9 J;  1WJC A;  3ASO H;  1V5F A;  2HWV A;  1MDM B;  2IBD A;  1HQC A;  2A61 A;  3BZC A;  1JTY A;  3GTM J;  1F1Z A;  3U2R A;  2DDB A;  1P7I A;  5FGM A;  4AVZ A;  1GT0 C;  4U87 A;  2O5R A;  3HC7 A;  3FXR A;  2R0Q C;  3GO5 A;  1GV5 A;  3VWB A;  1ETQ A;  1MBG A;  3U9G A;  3OSF A;  3WGG A;  1KYZ A;  2JVG A;  3Q9V A;  3T0Y A;  4PJN A;  2UUZ A;  3OOU A;  1K7A A;  2J5P A;  2IVM A;  1V5E A;  4LIU A;  3SFI A;  5JLW A;  3LA7 A;  4BS9 A;  1QPM A;  1SEU A;  2M2E A;  4BE0 A;  3J7Y J;  2ME0 A;  1EV7 A;  1HXD A;  3H35 A;  2BE5 F;  2HOT A;  2VN2 A;  2M30 A;  2OTL I;  1UMQ A;  1NK2 P;  2VKH A;  4HNT A;  3K9T A;  2KQR A;  3HTS B;  3LA2 A;  3V7R A;  3SHF A;  3NWS A;  4U88 A;  4GO1 A;  2JMW A;  4GXO A;  1LDK B;  3C18 A;  3L2V A;  3M8J A;  1LFB A;  2NNN A;  3V8K A;  5J47 A;  2RC4 A;  4M73 A;  4XKW A;  1X19 A;  1RR8 C;  3GCM A;  3PUB A;  4AYB N;  3Q3S A;  2Z9O A;  5JHU A;  1P4W A;  2LRD A;  1JT6 A;  2RDP A;  4UNO A;  1L0O C;  1W7P B;  2FD5 A;  1S7A A;  1FYM A;  2HQA A;  1P4A A;  1O7L A;  1Y8R B;  2L01 A;  2IS6 A;  2K27 A;  4E7Z A;  2O9L A;  2NVT J;  1BR1 A;  1MSE C;  2R7Q A;  3BG6 A;  5F1R A;  4BU2 A;  1AWC A;  1FLI A;  1XCB A;  2DT6 A;  3J81 K;  3B6C A;  6PAX A;  1T56 A;  2KMU A;  1IN4 A;  3IKT A;  4KIS A;  1X1B A;  4Y15 A;  2K9S A;  1LFP A;  3BQY A;  2Y30 A;  2HQ5 A;  3DLA A;  3JSP A;  3L2W A;  4IQJ A;  1R4N B;  3IWZ A;  3GZ6 A;  5TJJ A;  1MZB A;  1GLN A;  2V9K A;  4U0V A;  2LK2 A;  5FKO A;  1H89 C;  1MD0 A;  1IGN A;  1O3R A;  2NVQ J;  3ERE D;  1QA6 A;  1FTT A;  1JUP A;  4DBR A;  4E7K A;  3BT9 A;  4N9I A;  4HA8 A;  3TO9 A;  4ESJ A;  3GTK J;  3OYD A;  4BY7 J;  3ZRG A;  5K1Y A;  2WV0 A;  3H9G A;  2HQR A;  1S6L A;  3T8R A;  3JAM K;  3HIF A;  4FET A;  5IYB J;  1V4R A;  2V7F A;  2NNY A;  3MQ0 A;  3WHB A;  3PFY A;  5AON A;  2EFW A;  1SVM A;  5KCM A;  1KZH A;  1TBX A;  1VQ4 I;  1MMD A;  3AFH A;  4FCY A;  5BOX A;  4IHX A;  4O3M A;  3ZN0 A;  1Z77 A;  5JFR A;  1U78 A;  5E1W A;  3FHN A;  3D5S C;  5D4R A;  1EA3 A;  3BTL A;  2FOK A;  4XK4 A;  4HNV A;  3ZXS A;  2XC7 A;  4C30 A;  3L2C A;  1BW5 A;  1D5Y A;  3H9J A;  3K2Z A;  2QWW A;  4WF2 A;  3WTU C;  5IY5 H;  3HUG B;  5F1J A;  2KRC A;  5IPA A;  3WTT C;  2IEK A;  4LFU A;  3E97 A;  3M9A A;  3PJR A;  4HQE A;  1VF9 A;  4AIJ A;  3OL4 A;  1YRN B;  4M9X A;  3DWL E;  1B9M A;  2BXZ A;  3I64 A;  4UB6 C;  4JX5 A;  3OYN A;  2RGV A;  2FA5 A;  1USS A;  2MC3 A;  3CDH A;  2K5C A;  5L3D A;  2E5Z A;  3J7Z I;  2WWY A;  1JUS A;  1TP4 A;  1O7F A;  2K4J A;  3Q0U A;  4UHT A;  1HDP A;  1HKT A;  2EA4 A;  2ESN A;  4C2M J;  3RIR A;  1OLT A;  3I56 I;  2NS0 A;  2K3F A;  1IG7 A;  1G3S A;  1S5L C;  3EUA A;  2H27 A;  4CCL A;  3WTZ A;  3D5L A;  1P4X A;  1I3A A;  2KZG A;  1A04 A;  1YIT I;  1JGG A;  4P5O A;  1AKH A;  4IQ4 A;  2XKO A;  3OYA A;  1MBH A;  2GIV A;  4J00 A;  3HKZ N;  4XL9 A;  1R5G A;  4B09 A;  3QU3 A;  1ACI A;  2AXL A;  5HLI A;  2EZI A;  2EV0 A;  4CCK A;  1MJ9 A;  1R7J A;  3HGG A;  4GCV A;  2VOO A;  2D1V A;  4Q47 A;  3CCR I;  3C2B A;  4QIW N;  3BZK A;  1T98 A;  1RES A;  2W7N A;  4M9Z A;  1O4X A;  2OQR A;  1H0M A;  3IC7 A;  1ENH A;  3J80 Z;  1MDM A;  2IXS A;  1OCC H;  3QPH A;  4G12 A;  1QO0 D;  1X58 A;  4HST A;  3W6K B;  4CCO A;  4NQW A;  2WAE A;  4HDU A;  2KT0 A;  2YPR A;  2VIX A;  1Z6T A;  3FXJ A;  2VON A;  3PQJ A;  2DA7 A;  4LB5 A;  1MBJ A;  1MMA A;  3NRV A;  1D0Y A;  3I9V 2;  5DDG A;  2DTZ A;  4XN3 A;  3R60 A;  1ZGJ A;  5KAF C;  4PUS A;  3O6B B;  1HCR A;  2OF7 A;  4LG0 A;  2CO5 A;  2ZKZ A;  1T8I A;  2Z2S B;  2ZNY A;  3DTE A;  3F6O A;  3MWM A;  5FD5 A;  3KP2 A;  4BJT A;  4KT6 A;  1YLF A;  1ZK8 A;  2CQX A;  4UV8 A;  2RVC A;  3PIP F;  2VBW A;  2E34 A;  1PP7 U;  4BXU A;  4B1R A;  4BDZ A;  3JRH A;  2X0L A;  2QBY A;  1IN6 A;  3OIO A;  4OIQ F;  5DM7 F;  3B02 A;  1YJW I;  9ANT A;  4MEY F;  5C44 J;  3GLL A;  3H5A A;  1B9N A;  2CFX A;  4KIG A;  4I98 B;  3F6V A;  4D5F A;  4W1U A;  2OD5 A;  3OYK A;  4FT8 A;  2CYY A;  3GTJ J;  2HNH A;  3RKY A;  4LLL A;  3EET A;  2VJJ A;  5LEJ A;  3CUQ B;  4C3H J;  4IPA A;  1BI1 A;  5CLS A;  3EPZ A;  1H8A C;  2FU4 A;  2EQR A;  2HZD A;  2PN6 A;  3EUH C;  3KCC A;  4ON0 A;  5K5Q A;  2E35 A;  5KK1 A;  1JJ8 C;  4XID A;  2VKD A;  3QAH A;  4C9Y A;  3OV8 A;  3CJT B;  4C2U A;  3FDY A;  5FKK A;  5EGO B;  2FQ4 A;  1BL0 A;  3FM3 A;  2BEO A;  4PFO A;  1CQT A;  1WFX A;  1IXR C;  1X1P A;  2WAQ N;  5M5X J;  1A31 A;  3SYT A;  4G94 A;  4FHT A;  5F27 A;  3A02 A;  3T5X A;  5EG0 A;  4BE1 A;  5ILS A;  4BEH A;  3VFZ A;  3N4M A;  3DQV C;  1HST A;  3ROU A;  4XSZ F;  3S2W A;  1N77 A;  2JT1 A;  3CO6 C;  3V7S A;  2GIZ A;  3VEP A;  4AU7 A;  3FF5 A;  1X1D A;  4B4C A;  3FBN B;  3VSL A;  2UXN A;  2HVQ A;  4LG3 A;  2GOX B;  4YFK F;  4IZZ A;  2CW0 F;  4BQA A;  2VBZ A;  4RB0 A;  2I5U A;  2JVH A;  1QNT A;  5D6E A;  4A5N A;  5DD4 A;  3RPU A;  2K40 A;  3IKV A;  1GVJ A;  2LSO A;  4PCQ A;  2O0Y A;  4QLC U;  5M3F J;  1BOA A;  3RQ4 A;  2LBF A;  2MA3 A;  4HG2 A;  2DK5 A;  1J7K A;  5JR3 A;  4ZZD A;  2JA2 A;  3VYR B;  1G2H A;  1NH3 A;  3OS0 A;  3FM5 A;  1MMS A;  4IOA F;  3F8F A;  2MBF A;  4ZYE A;  3FBI B;  2DA1 A;  1ZR4 A;  3I4N J;  3QYB A;  1IRX A;  2ISZ A;  2HYJ A;  4PSX A;  4XQF A;  1I6H J;  2RNG A;  1WJA A;  4IRI A;  3KZZ A;  4LGW A;  4A6E A;  3R0J A;  2DA2 A;  4C2T A;  3K0L A;  1F43 A;  2M4G A;  2EIK H;  5L3E A;  5LRS A;  2HXO A;  1YJ9 I;  3UKG A;  1PP8 F;  5IYC J;  1B59 A;  1FBU A;  2QEX I;  1RI7 A;  5CYV A;  1CF7 B;  3G3Z A;  2JJ7 A;  3S8P A;  3G1M A;  5CPR B;  3BR1 A;  3BJA A; 
#chains in the Genus database with same CATH homology
 1ZEL A;  3QOE A;  1UAA A;  2VQL A;  4CSW A;  3DEE A;  3AL0 C;  3RCO A;  4IKF A;  3BCB A;  3F9K A;  2AQF A;  2BVL A;  1V5G A;  2RRE A;  3IAM 2;  3K4M A;  3PNT A;  2LBF B;  4HRI A;  2MYS A;  4CUG A;  3S93 A;  1R6R A;  1YE9 A;  2E1M C;  2K9M A;  3MKW B;  1G59 A;  3LSK A;  1D1A A;  1AA7 A;  3DPL C;  3CJQ B;  2IGO A;  2X6Y A;  2Z16 A;  3K10 A;  3VSK A;  2R7T A;  1LKX A;  3W3C A;  1D0X A;  2F4I A;  4N4N B;  3OYJ A;  2VXD A;  3VYS B;  5HVQ C;  4RM2 A;  5CKT A;  4XM3 A;  2P0W A;  3CJR B;  3KX2 A;  4B43 A;  1W36 D;  3K70 D;  2LRE A;  4N4O B;  4ZC3 A;  2AQE A;  4H4K C;  2VQG A;  2KP6 A;  1N75 A;  1DGR M;  1MND A;  3S3M A;  4B3X A;  2VJ5 A;  4E7H A;  5LD2 C;  3ONQ A;  2BOL A;  2WA0 A;  2WAQ A;  2X1E A;  3DKY A;  3ZCO A;  1WJD A;  4OWR B;  3PSF A;  4G6T B;  2IS1 A;  2DJI A;  3K70 C;  4ZDP A;  1SAU A;  1X1C A;  3OYH A;  3QYE A;  1WJF A;  2QKL B;  3OIP A;  2L9S A;  3OYF A;  3UR3 C;  1WJE A;  1UG0 A;  3K4C A;  3OS2 A;  2UWM A;  1OR7 C;  4OAZ A;  2M0M A;  4CCN A;  3C2H A;  4E6K G;  2ZXH A;  4ZDO A;  2X1C A;  4GRI A;  1P9Q C;  3S32 A;  1MW7 A;  4XLF A;  1K6Y A;  4BJ5 C;  4CH7 A;  2M4K A;  1U0J A;  1FMW A;  4U7B A;  5HNF A;  1G8X A;  2W82 A;  4ITV A;  1BR4 A;  3IAS 2;  3CP2 A;  2DXI A;  1WJC A;  4XLA A;  2L9N A;  2L5Q A;  1V5F A;  4CCJ A;  3A4C A;  1X4O A;  2ZFU A;  2OV7 A;  2PJR A;  3ZQQ A;  4XKV A;  4BQN A;  3HXL A;  4AVZ A;  2LC2 A;  3OWT A;  4BQO A;  4DJA A;  3BG7 A;  4U87 A;  2ELJ A;  2O5R A;  3S3N A;  3MMY B;  3HPG A;  3HC7 A;  4NC8 A;  2IGN A;  2F5V A;  3VWB A;  3LSI A;  3AL0 B;  2JVG A;  4PJN A;  2FUG 2;  2UUZ A;  2GOM A;  3OOU A;  2M7A A;  1V5E A;  2MC4 A;  4LIU A;  2Q1Z B;  2XF6 A;  3OL3 A;  4BS9 A;  3KYL A;  4BE0 A;  1ERD A;  2HPM A;  3H35 A;  3UNG C;  4BE2 A;  2R7S A;  3LFU A;  1W36 C;  2XF5 A;  2BVM A;  3LL7 A;  3K6G A;  2VKH A;  4HNT A;  4RLF A;  4IX7 A;  2KQR A;  2V4J C;  4B44 A;  1T0F C;  2CFO A;  4OAY A;  4XON A;  3OYI A;  2OUM A;  4E7J A;  3OR2 C;  2XF7 A;  3NWS A;  3RSN A;  4DOZ A;  2MD0 A;  1LDK B;  3DKX A;  3L2V A;  2MFZ A;  3M8J A;  3K4J A;  4XLE A;  1DQU A;  4RMN A;  1PJR A;  5LFA A;  4XKW A;  3ZGK A;  1X19 A;  4BJ6 C;  2E1M B;  3PUB A;  1D1B A;  1Z21 A;  2LRD A;  2VL8 A;  4QPQ A;  2VLA A;  4ZTJ A;  2ZXI A;  3SDB A;  4RLQ A;  3OIQ A;  2HQA A;  4JOM A;  4AYB A;  2IS6 A;  3CF2 A;  4RM3 A;  2R7V A;  4F91 B;  1JI8 A;  2A5W A;  4E7Z A;  4J01 A;  1BR1 A;  1S9H A;  2R7Q A;  3BG6 A;  5FRM A;  3K4K A;  4BU2 A;  1NG7 A;  3FKJ A;  5FRN A;  2VAS A;  3DU6 A;  2DT6 A;  2LH9 A;  2KZV A;  2IGK A;  2KMU A;  1NG6 A;  2QKM B;  5HLT A;  3CZ6 A;  4XR6 A;  3OS1 A;  4KIS A;  1X1B A;  3DPT A;  1LFP A;  4E7I A;  3A2K A;  3OYE A;  3BC8 A;  2K3P A;  3L2Q A;  3DLA A;  4IQJ A;  3L2W A;  4YEL A;  1GLN A;  3K4L A;  4LIV A;  2V9K A;  1KON A;  3TMO A;  2HU9 A;  2KRH A;  2R4G A;  3N05 A;  2MAB A;  3W2W A;  4DBR A;  4E7K A;  2WY8 Q;  2K9L A;  3K4N A;  2R7U A;  3OYD A;  2L7K A;  3V42 A;  3ZRG A;  3H9G A;  2VPL A;  1MNE A;  2X6X A;  2PMZ A;  4D1Q A;  4HEA 2;  4FET A;  2V26 A;  3IP4 B;  1D1C A;  4PJL A;  2V7F A;  3PFY A;  1E0E A;  1Z3X A;  5KCM A;  2CV0 A;  1MMD A;  3AFH A;  3OMY A;  3FHN A;  1FMV A;  3PNY A;  3LSM A;  3OY9 A;  1MMG A;  3D5S C;  2CV2 A;  4PK4 A;  1EA3 A;  4BGD A;  3LSH A;  2CMP A;  2L2O A;  2W00 A;  3ZXS A;  2XC7 A;  4BUP A;  4C30 A;  4E4H A;  2Z1D A;  3H9J A;  3E1S A;  5JHF A;  3HUG B;  3MKZ A;  2KRC A;  3DU5 A;  3DTI A;  3EUK L;  2JUG A;  3QYF A;  3PJR A;  4EAT A;  5KHD A;  3IUO A;  3OL4 A;  3VYU B;  3DWL E;  3OYN A;  2X85 A;  4BAC A;  1D0Z A;  2WBM A;  4XKB A;  5FRO A;  2K5C A;  3PNV A;  2HVS A;  3W2V A;  4BDY A;  1QHG A;  4PJM A;  2E5Z A;  2KPM A;  4XLH A;  2V6E A;  2W4S A;  1OLT A;  2R7O A;  2KLO A;  1WJ5 A;  2XAU A;  2OC6 A;  1YX3 A;  1TT0 A;  2DCE A;  3EUA A;  2CW7 A;  3LMM A;  3U21 A;  2PJR B;  2A6T A;  3VDX A;  3SZG A;  4B47 A;  4CCL A;  3D5L A;  4P5O A;  2ZSI B;  3OYL A;  2M3A A;  4IQ4 A;  3OYA A;  1MMN A;  4J00 A;  4XL9 A;  2WY7 Q;  4BXF A;  1HA8 A;  2V1N A;  3HOT A;  3H9Q A;  4CCK A;  4F55 A;  4XOP A;  2LY1 A;  3L2R A;  2CUZ A;  4YEJ A;  2WB1 A;  3SEQ A;  2W7N A;  2LOO A;  4ZDL A;  3H0D A;  2HDW A;  5CQE A;  2IXS A;  4HST A;  4CCO A;  2X1D A;  1Y6I A;  3BLY A;  2LY2 A;  2WAE A;  2CUJ A;  3QOD A;  1YX5 A;  3CMM A;  3RTR A;  2JSP A;  2VIX A;  3E0J B;  3MD2 A;  5TGT A;  2ZSH B;  1MMA A;  4KIT B;  5HOO A;  1D0Y A;  3I9V 2;  3LSG A;  3L2U A;  3GBG A;  2M7B A;  2IS4 A;  4MLO A;  4XN3 A;  3PL8 A;  2R7W A;  3J7A Y;  4XN0 A;  2BW3 B;  4PUS A;  1X4P A;  3OYM A;  2CV1 A;  4F93 B;  2VXZ A;  3S3O A;  1BOB A;  2Z2S B;  4ZTF A;  3DTE A;  4YRV A;  4F92 B;  4BJT A;  4KT6 A;  4F52 A;  1VZ0 A;  3OYC A;  2LYC A;  2WAF A;  4X0G A;  4NC7 A;  3SEZ A;  1DGW Y;  4BDZ A;  2VJI A;  2DOA A;  3VYT B;  4B48 A;  3HG9 A;  4Y33 A;  4D9J A;  2RQQ A;  3H5A A;  2CH0 A;  2BW3 A;  2XSJ C;  2I8D A;  2VQC A;  4ZJZ A;  5CQG A;  3HL2 A;  2WAD A;  3OYK A;  3MKY B;  1WJB A;  4HPQ A;  4E7L A;  2DT7 B;  2HNH A;  1DP3 A;  2KDO A;  2VB6 A;  2IGM A;  2VJJ A;  4CA0 A;  2LG4 A;  3EPZ A;  2CW8 A;  4NUB A;  2HZD A;  3EUH C;  1T95 A;  2VKD A;  2KL4 A;  3DPU A;  4E7S A;  4Y3O A;  3ZR8 X;  4XLC A;  2KHM A;  2XDV A;  4NNJ A;  4C9Y A;  3DTK A;  1QHH D;  2Q2E B;  4JQF A;  4C2U A;  1J09 A;  3FDY A;  2R7R A;  4QPO A;  3A1Y A;  4PFO A;  1WFX A;  2F6C A;  3OYG A;  3SYT A;  3AKZ A;  1SFK A;  3OR1 C;  4HNU A;  4BEH B;  1BR2 A;  4BE1 A;  3TL4 X;  2VJ4 A;  3PSI A;  4BEH A;  3H5R A;  4DBQ A;  2HVR A;  3DQV C;  1N77 A;  4XOR A;  4XMY A;  4DIQ A;  3OYB A;  4AU7 A;  1X1D A;  4II3 A;  4ANJ A;  4FAS D;  4CZC A;  3FBN B;  4PFP A;  3KEY A;  3VSL A;  1PYV A;  2HVQ A;  3CES A;  3HKZ A;  3I3L A;  4LG3 A;  2GOX B;  4IZZ A;  4F3Q A;  2E5N A;  3G2B A;  2R7X A;  1LVK A;  2JVH A;  3W2A A;  4P1W A;  3HOS A;  1Z3Y A;  2NOJ B;  1X1A A;  2HPI A;  4ZYA A;  1QU3 A;  2VQH A;  4DGW B;  2Y0S A;  3RQ4 A;  2LBF A;  1UEL B;  4HG2 A;  1N78 A;  2E60 A;  4KJZ A;  4PJJ A;  2JA2 A;  3VYR B;  3OS0 A;  1Y56 A;  3K4B A;  2X51 A;  1TZL A;  3FBI B;  3C2G A;  3NWT A;  4Y4R A;  3HPH A;  3QYB A;  4BL0 B;  1IRX A;  4XOT A;  4PSX A;  2X6W A;  3BCA A;  3CP8 A;  3H5N A;  4XKC A;  4XQF A;  4CCM A;  2RNG A;  1WJA A;  5KNL A;  4HSR A;  1Z7L A;  4C2T A;  2W1O A;  2UV1 A;  2M4G A;  2CS3 A;  4BQQ A;  3D5R C;  4R79 A;  3M1C A;  4NQW B;  5HNH A;  4PSW A;  2IS2 A;  3S8P A;  4LIT A;  3TBI A;  5CPR B;  3RPU D;  4XNF A;  4II2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...