3ZCOA

Crystal structure of s. cerevisiae sir3 c-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
ETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization of Sir3 Via its C-Terminal Winged Helix Domain is Essential for Yeast Heterochromatin Formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords REGULATORY PROTEIN SIR3
total genus 36
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zcoA00
3ZCOA
chains in the Genus database with same CATH superfamily
2AS5F 1WQ2A 2EV6A 5FJ8J 5TISC 2AO9A 1U8BA 1J59A 2M8GX 2XKPA 1SVMA 2WTEA 2L9NA 1ZYRF 3M07A 5LRSA 2DFHA 2IJLA 1MMNA 1NHAA 4NHJA 1TQPA 3BOQA 3OV8A 1O7LA 1TL8A 2HOAA 4DYCA 1LE8B 1AKHB 3DKYA 1J75A 2R7WA 3DXJF 2DU9A 5E3NA 4M3BA 4M71A 4HF2A 3F21A 4DOZA 2GXGA 3DTIA 4Y15A 4PSWA 2PG4A 4KICA 4EJUA 1P7JA 2P5LC 4NC6A 4XORA 2PEXA 4LOCA 1BOAA 2XGEA 4OAZA 4UVBA 2EB7A 2M1BA 2RNGA 2V1DA 4S0HB 2KJBA 1E3PA 4QLCU 3K69A 4C2MJ 1P4XA 2X51A 3AL0C 1BBYA 2R7QA 1FLIA 1LB2A 2VPLA 2GA2A 3V4GA 4M72A 2FOKA 4ANJA 1R49A 3KIOA 3CCEI 3I5UA 5J8CA 5GPCA 1KYZA 5GTIC 3HIFA 2JPBA 2O3FA 4IKFA 1SFEA 2A6HF 2VT2A 1S7AA 4UUVA 2COMA 2ZNYA 4XKWA 1XG1A 5HLIA 1FX7A 4BXXJ 4KUMA 2E1NA 3JSPA 3RQ4A 1W7PB 5IT3A 3KETA 4IEJA 4A3BJ 1IUYA 1QQIA 2F48A 2QLZA 4HEA2 3E97A 4L0YB 4A3MJ 2GWRA 3I59B 1PP8F 1YHQI 1GXPA 1IN4A 1T33A 3FXJA 1F43A 2IGOA 4IZZA 4XM3A 2KZGA 3GFLA 3M1EA 4NNJA 2V7FA 3CLOA 2PJRB 1RR7A 3AG3H 5LGNA 1VF9A 3PFIA 4ZYGA 2BHYA 1X4OA 1U2WA 3VSLA 3ZR8X 3MFKA 4DJAA 1R22A 1XPXA 4R1HA 3L00A 1BA5A 3HKZN 3I71A 2WB1N 4PUSA 1TNSA 4ABZA 3L1PA 5B3SH 1QVUA 1OR7C 2FXAA 4NBQA 4WCGA 1Y6IA 1PVEA 3TGNA 5H6RA 2VOOA 4MFDA 2Q0OA 2B7EA 2EBIA 1IDZA 3K4NA 1LE8A 2LRDA 1AKHA 1F5TA 4QPQA 4XONA 3R60A 1O3RA 2Y69H 2ZNZA 2J5PA 3B6AA 3VODA 3WE3A 3J7ZI 3H9GA 1LQ1A 4ENNA 4LJZF 4M3DA 1QVTA 2DW4A 1IRZA 3HC7A 3ZP5A 5GPAA 3HRSA 3I3LA 1JI8A 3G4SI 3IP4B 2R92J 5FLXZ 2JSPA 3OYMA 1QRYA 3CDHA 3MD2A 3QOPA 4KMUX 1Y56A 1GXQA 1MSFC 4H4KC 2K4BA 4S05A 5E1ZB 4AIKA 1WJFA 3JRAA 3S1NJ 2L4MA 4E7ZA 4BBSJ 4J19A 1NTCA 3IRQA 2DOEA 2RKHA 1JKQC 3CJQB 3KZYA 5D6EA 3ONQA 4HOBA 3E3VA 3WHBA 2QZ8A 4IHWA 1IV8A 2DODA 3SJMA 3DEWA 1Z0XA 2CUJA 2ZXHA 1HW1A 3GBGA 2A07F 2O03A 1X1BA 3B02A 4RGSA 4BU2A 2R7FA 1T08B 1YX5A 2H27A 3HZJA 1JGSA 2XIGA 2RQPA 3KP4A 3TEDA 2XPUA 2QVOA 1OCRH 4FE7A 2AQFA 1K6OA 2DA5A 4AUXA 1L3LA 2W1OA 2AXLA 1B4AA 2B0LA 1U9OA 2K3FA 3C1DA 3DV8A 1JHFA 1D5VA 3E5UA 1HKSA 2K27A 1HDDC 2DCEA 3A0BC 2EIKH 4IJAA 5HNFA 2E36A 1FP2A 1YW7A 2IW5A 1X3WB 1T8IA 1ZKGA 2L0KA 2R0QC 4RA2A 2HYJA 3VYTB 1YLFA 2HS5A 2FQ3A 3RYRA 2QSGX 2NVXJ 1FNNA 2MABA 2WV1A 4CH7A 1EH6A 2M30A 4KFCA 2VBZA 5K7FA 1WVRA 5F08A 3F23A 1IAWA 3A0HC 1LNWA 4ZYDA 3DTKA 5DUIA 1LEBA 1ZQ3P 3UR3C 5K1YA 3CUOA 4KDPA 4ETSA 5E3MA 2JJ7A 3G1MA 2M7BA 3O6BB 3ZMVA 1FYLA 3RPQA 2H94A 5E3LA 3LQRA 2UV1A 3ZPLA 3FBNB 3HKZA 1ZTRA 1MW7A 2A6TA 4XKVA 3Q0VA 1W5TA 1K4SA 4PJJA 3TL4X 5J1RA 3LA2A 5FLVA 2L9SA 1BJZA 3KP3A 4RB2C 3CJNA 4GYGA 3JRHA 5CJ9A 1SFOJ 3LSKA 5ICGA 3PUBA 3LAPA 1ETYA 1LDDA 3M1CA 1BC8C 3FF5A 1TLHB 2PBIA 5ILUA 1D0XA 4RAZA 3J80K 5C44J 1LFUP 1MBGA 3PL8A 2M0CA 1JUMA 5HNHA 1ZH5A 4A93J 1HF0A 3OR2C 5ILVA 4WK8F 1JT0A 1Z3XA 2IA1A 5EGOB 3OIQA 4G6QA 2FEZA 3J80Z 2MH9A 3GMEA 1BJAA 1IXSB 4DBQA 1VQNI 4RM3A 4B44A 3DPTA 2XF5A 3HPGA 2XROA 2ZSIB 2X85A 1KA8A 3OYIA 1HDPA 2PQ8A 2EV0A 3RKQA 2R93J 4I99C 2WC2A 1G6NA 4P9UA 2YSRA 1MJBA 3GZ5A 2CQQA 4D0PA 2QUFA 5CKTA 1K6YA 2KIMA 4RBOA 1O3QA 1QA6A 1YIOA 1N77A 1K61A 1YX3A 2FQ4A 4A3DJ 4IHXA 5J4YA 4JK1X 1WWXA 4HRIA 2CH0A 3O8GA 2GIVA 4XK4A 3CQZJ 4OINF 5A2QZ 4BDYA 4HX7A 2IEKA 4ZC3A 1ETQA 3BQYA 1BR2A 3WTSC 4RGXA 5C3EJ 3H3UA 3ELKA 4JP0A 4RB3C 2ZC2A 4XRSA 4O3MA 1SD4A 2D2WA 3H9JA 2R7VA 1FSEA 1I1GA 3PUFA 3N05A 1GHCA 1YQAA 3L7WA 3K7AJ 1S29A 1T6SA 1X3UA 4M9SA 4F92B 5LGTA 3OYLA 1EH8A 2JA6J 4YG2F 2VXDA 4ASNA 4AVZA 2R5ZA 2XAFA 3O3KA 4L0ZB 1PJRA 4ZZDA 4BY7J 3JTGA 1ERDA 5BQTA 3I4MJ 4PZJA 2Y9ZA 2DPDA 2DBBA 1W5CC 3JRGA 2K02A 5ILSA 2RQQA 4NC8A 1ZLKA 3FMQA 3TO6A 1QBJA 5FRMA 3CD6I 4IPAA 2VC0A 1TWCJ 3WHCA 1W36D 4BQNA 2R7OA 1K78A 3L2QA 3L9FA 4HPQA 1RZ4A 3D5SC 3BG7A 1XTAA 2DFIA 1I27A 2VN2A 2BVLA 4KMFA 5JHUA 5DCFA 1V4RA 2BOLA 1TNTA 4EM0B 2L3DA 3LMMA 2D45A 5F64A 3KYCB 2DDAA 4E4HA 3FKIJ 5KAIC 5AIPA 2M34A 4M6VA 3M3YJ 1JUPA 1FBQA 4U0VA 4K2EA 1JGGA 2M8EA 1Z6TA 2HQRA 4A3KJ 3S16J 3CP8A 4BKXA 1Z9CA 3GTGJ 2K9LA 3R6SA 2W24A 2DFEA 1L0OC 2VASA 2VJ5A 2W57A 4XLCA 1ZARA 2F5EA 1R6RA 3FZVA 3KZIC 1HW5A 4UY8I 2VBYA 3K1MA 4Z2YA 2KPMA 3ECHA 3MKWB 4A0XA 3BT9A 2GBYA 2LY9A 3F9KA 2CFXA 4XIDA 4CYCB 3MKYB 1E2XA 2JA5J 2HPIA 1YJNI 3K1NA 2FBKA 1AHDP 1UHSA 2E7XA 4BY1J 3BLYA 2BY3A 4IHYA 2BVMA 1R5GA 2F4MB 1E0EA 1OYWA 1ZGJA 1XGMA 3BCBA 4XN0A 3KP2A 4EM1A 4Y3OA 2LD5A 1S8NA 1U3EM 1FOWA 3WGHA 4MFEA 1X1PA 4I0AA 4KIGA 2QENA 1TTYA 4AC0A 2MH2A 3T8TA 1TQMA 2D5VA 3AFHA 2KL4A 3S3MA 3NQOA 2CSOA 5CQEA 3QAHA 2LVSA 3PM1A 3OL4A 4ENMA 4EVIA 1IXRC 4M3FA 3TO9A 4CCMA 4NUBA 5TGTA 4CYDA 4I2OA 3HOVJ 5M3FJ 2EZLA 3UNGC 5IY5H 4O5VA 4A5NA 5E79C 3FXUA 4E7HA 2M7AA 2BV6A 3F3XA 2CGPA 4QTRA 5J8FA 2A68F 3K4CA 4KT6A 1WJAA 2F5VA 3CCLI 4L18B 2VKDA 2L01A 2V1NA 4C3JJ 4HAMA 5EDNA 3JRFA 1IC8A 3OYAA 4CDGA 1XGOA 3ABTA 3OYHA 1EH7A 5JLXA 3V8KA 2LY1A 3D0SA 2ZSHB 2X1EA 2CJJA 2M4GA 4BJ6C 4U0YA 3KEQA 4U7BA 2V79A 4IO9F 1IV6A 1X3ZB 1S9HA 3SZPA 3CLQA 3K4KA 3WU1B 3LSRA 4AIJA 1JTYA 4PFPA 3RIRA 2DA4A 1A36A 4LLLA 1QHHD 5FKNA 5FD5A 5DDGA 5EEAA 3DU5A 5M5XJ 3RI4A 5DCMA 2LNBA 2WWYA 2E1CA 4IVNA 2E2HJ 2A5YB 2JUGA 4ENKA 3K70D 2KDOA 4AVPA 3ZRGA 2KQRA 2PMHA 1IW7F 2HYGD 2OPTA 2EZIA 2KRFA 2O6GE 3GTMJ 4CSWA 3HOUJ 4E7LA 3CCUI 2DA1A 4BBRJ 1JUSA 1ZN2A 3I4NJ 1BM9A 4DYRA 2J5OA 3FK6A 1ETXA 3F8FA 1Y8QB 2FBHA 4N0BA 2DXIA 1MBKA 4YEJA 2KT0A 2ZO4A 4GXOA 2KHMA 1W1WE 2X6YA 3PO2J 2E34A 3H9QA 1ZRCA 1P4AA 2VE9A 1GLNA 1EV7A 2M87A 2P6SA 2DQLA 3ZQGA 1BR4A 3E0JB 1DQUA 4OMZA 1OYYA 3GTQJ 2XB0X 1YS7A 2JQ7A 3ECOA 3PNYA 1DPUA 4HSRA 1BIAA 2P7VB 2K85A 2OD5A 3LA3A 1V54H 1H88C 3D5RC 4BJ5C 1VTNC 3ZQLA 1XD7A 4UB8C 5EJCA 3K4LA 3DBLB 4RLFA 1R9TJ 2A6EF 5DUKA 3J81Z 3OS0A 1T39A 1Z1DA 2YR2A 3W2AA 3ESWB 2XPWA 4YIIA 2OUMA 1B9NA 4BXUA 4F91B 2GQQA 1RRJA 3OMYA 4KA4A 2HOSA 2P4WA 1ACIA 4ESBA 4I01A 4BHPA 3A03A 3BR6A 2X6OA 1X4PA 4UUTA 5D5WB 3F6OA 3BJ6A 1FIPA 4IRHA 5B1BH 3GW2A 3I55I 3L2CA 1B9MA 2O8KA 3E7LA 3K4BA 2VXZA 1VQ7I 1J0RA 5BPIA 2A61A 4JBAA 1WCMJ 3M8EA 4HV6A 4CCNA 1FY7A 2P0WA 3GTPJ 2TRTA 2E2JJ 4MQVA 1UHMA 2IGNA 3A02A 4A3JJ 1TZLA 3RKYA 5GAEJ 1DP7P 1H8AC 1GV2A 3PSIA 3IKVA 5BPDA 5J4VA 3QYFA 1BIBA 1U5TB 4II2A 1ODDA 4FX0A 1LPQA 3G6EI 5D4RA 3NARA 2CS3A 2CO5A 2LLKA 3VB2A 1W4MA 2ZFUA 2UUZA 2MYSA 4BE1A 1ETVA 4KN7X 3G1OA 3JR9A 2ID3A 4CCLA 3S93A 2BY2A 2YUSA 1G3WA 3RPUA 1WI9A 3ML6A 3PIOF 3H36A 1JJ6C 2DFFA 4EQQA 2R4GA 4EJOA 1P4WA 4LD5A 2CW7A 4BJTA 1UCRA 4HNVA 2HYFA 2XRLA 1X1DA 1V3FA 1CGPA 1F1ZA 3I58A 2HDDA 3UKGA 1UZCA 2NXNB 1VQ4I 3LWFA 1Z67A 2N8GA 3F6VA 1K7AA 3BTCA 3E6DA 3IH2A 5F1JA 3GTJJ 3MCZA 5LGUA 4DQ2A 1FIAA 2I5UA 4D7NA 5JFRA 4BE0A 5D4SA 2DA3A 1V5FA 2K9NA 4Q48A 2UXXA 2HXOA 4JOMA 1ZGWA 1R36A 3FXMA 3MZ8A 3HSRA 3GWZA 2QGUA 1AOYA 3FXQA 2JRTA 2W84A 3FHNA 4ZYHA 2VJ4A 1SFKA 2WY8Q 3BCAA 5GTHC 3H5NA 5K5RA 3GLXA 4ZDOA 1MD0A 1YOVB 2ETHA 2BGCA 4XRSG 1GUUA 1Z7LA 3JSOA 3ABLH 1OCPA 1T98A 4NQWB 4XRFA 4M9XA 4MTDA 1R58A 4I76A 2QBYB 4P96A 1F4KA 1MGTA 3C7JA 3TOBA 4S04A 1VZ0A 2Z33A 2W82A 4ESJA 2CU7A 2W85A 1ZR2A 4IXAA 1J2XA 1Z6RA 2E1MC 3ZQQA 4EMSA 3LSJA 2ELJA 1UFMA 1IN7A 3DCFA 4BS9A 1REPC 4ON0A 1FOXA 4Q47A 2I10A 3A1YA 5IP9J 5EF6A 2ZCWA 2LK2A 3GFJA 1FEXA 2FA5A 1ONVA 2BY1A 2KZVA 4FT8A 4RAFA 4DGWB 2WY7Q 3VYSB 4BL0B 4Y7NJ 1UMQA 1JT6A 4UB6C 5LRRA 1TWGJ 4KT5C 5BMZA 2JK3A 5HS8A 3WGIA 2R3SA 2I8DA 1WPKA 1NG7A 1T0FC 3SEZA 2A5WA 2K3PA 3L2VA 2EFWA 4L9NA 2PLYA 4BUPA 4L9VA 3AG2H 1DU0A 2EZKA 4HA8A 2A3SA 2MC3A 3BR0A 1U9NA 2ZBKA 1BI2A 1QZZA 5KHDA 1FBSA 2DT7B 3LSTA 5E1XA 1I6HJ 1P6RA 4U7DA 1UG2A 3ULQB 3V42A 4C2UA 3R61A 2P5KA 1I3QJ 2CQXA 3VOEA 2JSCA 1XMXA 5D5XB 1FP1D 4BE2A 2VJIA 1ZK8A 1GVDA 1ZHFA 1ZAOA 2GZWA 2K5CA 2LY2A 3R4KA 5D8LB 1P92A 5E8IA 2LKXA 2ICWG 1VQ9I 3PSFA 2Z99A 4C30A 5D5VB 3S8PA 2HU9A 2MD0A 1HC8A 1LDJA 4XKBA 2DYSH 4FX4A 2LTPA 5ICFA 2EFPA 2EILH 2DT5A 2ME0A 3H0GJ 3KP5A 4PDKA 4XN3A 2YPRA 3SQNA 3VEPA 5IP7J 2ME6A 3CO7C 1MBHA 3V8LA 2LBFB 2H1KA 2HZTA 4JYKA 1IRXA 4XOPA 3LSMA 4CA0A 3K0LA 1MDMB 2QM3A 2EWNA 2WB1A 2Z3YA 2CV1A 1RC9A 4AIDA 4RGRA 3MZHA 1IN5A 1X1CA 2ELHA 4NQWA 3FIWA 4D5CA 3HHHA 1LFPA 1OJLA 4A5MA 3E5QA 4F7ZA 5EG0B 1MH3A 2K9QA 3QPLA 2IA0A 2KRCA 1U5TC 2JMWA 3W3CA 4WXDA 1ZR4A 3DEEA 3FMRA 1H9TA 4AYBA 4GYIA 2RREA 1OKRA 3LA7A 5K5OA 1Y8RB 4CHUA 5EEGA 3CCQI 5E1WA 2DMUA 3ZMUA 3D5LA 1J09A 1Y39A 2Z16A 1FTTA 5HDKA 4CXFA 1UB9A 2OJED 4HZFA 2DMQA 5HLTA 3DQVC 9ANTA 2JA8J 2G0EA 3H1CA 3P9CA 3VYRB 3PJRA 1P9QC 2DOFA 3C3WA 4IQJA 4MIMA 1RR8C 4BAYA 1IJWC 5LEJA 3DLLF 2V1UA 2EFQA 2KLOA 3RQIA 1S7EA 5C4JJ 2V6CA 3RKXA 3BDDA 3IWFA 4M73A 4HBLA 4N9HA 1SAUA 4DZJA 5LD2C 2WADA 2H6CA 1YFHA 3CC4I 2EPFA 1OLTA 4FQGA 5CLSA 3TP0A 2RVCA 3RCOA 4J00A 3LSGA 2DTRA 2XGDA 4V2GA 2R7XA 3GXOA 1FOKA 3ZQIA 5K5QA 5HS7A 5F0HA 1YS6A 2JT1A 5L3FA 2UXNA 2DJIA 2NVUB 1V5GA 3C2BA 4FHTA 4JQFA 1C0WA 5B66C 1YYVA 2RAEA 1B8IA 3P9IA 4IHTA 3CC7I 2F5DA 3G2BA 4I09A 2O5RA 2ID6A 2GAUA 3FXOA 1SD7A 3HBLA 5JR3A 4D1QA 3HJEA 3KX2A 1I50J 2X1CA 2JWTA 2E5NA 3E1SA 5DTDA 1R4MB 2VQCA 4DIQA 2XC7A 4A12A 1SANA 1FYKA 3CCVI 2K9SA 2JVHA 2OF7A 4M6XA 3ZOBA 1S3JA 1RKTA 4LG0B 1G4DA 3B73A 3HRMA 2IT0A 1MJ9A 3HEFA 3ASNH 4GRIA 4BGDA 2ELKA 4PJNA 4JX6A 2M3AA 3BJAA 3QYEA 3MVPA 5DV5A 1A6QA 3SFIA 1DDNA 2MLGA 3KCCA 1WH7A 2H6BA 1MBFA 3TOAA 3P5JA 2YU3A 3I56I 5FLXK 1FJLA 2VE8A 2QYOA 1WJ5A 2YX7A 2HGCA 4JX4A 4DBRA 2AQEA 2K4JA 4QIWN 4UNOA 2R7UA 2DOAA 3CUQB 3CCRI 4P5OA 1D8KA 1F9NA 1VI0A 2EZHA 4KN4X 2L02A 3RPUD 1U8RA 2M9HA 4G6TB 4AM3A 1A31A 3K1PA 4ZYAA 3GEZA 4V19K 2JUCA 1LKXA 1DGWY 4Q4ZF 4D5FA 4HX4A 1WJDA 5KCMA 2Z1DA 1Q1VA 4ZTJA 3QODA 3EUKL 1D8JA 4W1UA 4YFKF 1FZPB 1V5EA 3JTHA 4XSZF 3PNVA 2FF4A 4WXHA 5E17F 1EKEA 3EYYA 4AWXB 2L9VA 3OYDA 1DUXC 3IC7A 5HOOA 5FGMA 3I0TA 4MNUA 4EJTA 1QPMA 5GAHJ 4PCQA 3Q0UA 2MC4A 3NAUA 3TBIA 4A3CJ 4DNCA 5F04A 1PUFA 3ABMH 5DS9A 2EJRA 2NVYJ 4XRMA 1QGPA 2IRFG 4A2UA 5IP6A 1I39A 4PJ0C 3CDIA 2E35A 1QPIA 1XDUA 2BHZA 2FX0A 3HHGA 2OTLI 5FKLA 4OMYA 1XSDA 4Y4RA 3NWTA 4M9ZA 4EGYA 1O7FA 1U6GA 4M3EA 2EIJH 4B48A 5DD8A 3ZXSA 5HLGA 3BP8A 3Q0WA 1GV5A 3K6GA 1DGRM 1FMWA 2QKLB 3SYTA 4XLPF 3PIPF 5D5UB 1HKTA 4PGGA 2BBYA 4E6KG 1BC7C 2OV7A 1W7PD 3NRVA 3HTSB 3LFUA 1A6IA 4U0WA 3S1QJ 1BI0A 3F8BA 3MEXA 4HF0A 3RSNA 2E19A 2DMPA 2ZMEC 4UVCA 1GT0C 3BQZA 5IYDJ 2E60A 3VDXA 1SFXA 2HQAA 2L2OA 3CC2I 2YX4A 2ZB9A 3CUQA 2LR8A 3GUDA 2W7NA 1Z3YA 2AHQA 2PFBA 1YW8A 5IPAA 5IYCJ 3EUHA 2QKMB 4HDVA 5JHFA 2EFOA 2FNAA 1BI1A 1OISA 2E1OA 2FUG2 2CW0F 3GVAA 2XAQA 2KIQA 2DMNA 3FWEA 1KGSA 2E71A 2XHKA 3KP7A 3QWLA 3K4JA 3CMYA 2HZDA 1DP3A 3GFMA 2LSOA 2IGMA 2WA0A 3GX4X 2OA4A 1DPRA 2X4HA 3HOWJ 1OFCX 2HDWA 4II3A 3ZQFA 3ZN0A 4XLNF 3WTUC 1VQKI 3QU6A 1AA7A 3PFYA 3ROUA 4ESFA 1R7JA 2JZYA 5H2FC 2NVTJ 2NS7A 1R5ID 2WBMA 3RTRA 3IWZA 3EQLF 4L5IA 4RB0A 4BQQA 4BQAA 4B3XA 3HOTA 3G3ZA 3DKXA 3K2AA 1VFCA 4X6AJ 2C6YA 3TW6A 2CQNA 2R5ZB 2RC4A 2BEOA 1IRGA 4IOAF 1IG7A 4MQ9F 3OYCA 3HSEA 1G59A 1QNTA 3ZCOA 3MKLA 2QWWA 1AWCA 4AIHA 3DPLC 4BHBA 4XQFA 2JRMA 2OC6A 3FX3A 5GADJ 3WG7H 2MSYA 2RNJA 2GOMA 3CDLA 2H8RA 2LKSA 2HVRA 1SC7A 2PJPA 2DA6A 3DPUA 4RLQA 3S2WA 2DYRH 1RIOH 1LVKA 3PQKA 5L3CA 2E5ZA 5J1UA 3FXRA 4LLGF 3LAJA 2K7LA 1MMAA 3CF5F 4OWRB 1MBEA 1OYIA 2PJRA 4CO8A 1Z91A 4P55A 3DFGA 4HNTA 4B43A 3BTIA 1BN5A 3K10A 3BR3A 5BS6A 2VONA 1KU3A 2XAHA 3COAC 1RNLA 1PUEE 3HYIA 3EYIA 1G3TA 1TBXA 4RB1A 3FXLA 5FKKA 3OOUA 2EINH 1ZGAA 6PAXA 2PMUA 3U2RA 3MN2A 3BZKA 4Q5SF 1ON1A 2VPRA 4FISA 3ABKH 3LOCA 3LL7A 2D1HA 1W0UA 3DLAA 1LDKB 2FD5A 4BQOA 2IGKA 1ETWA 4BHCA 2MW8A 4EJVA 2WAFA 4IF4A 4E70A 2M2EA 2KDZA 3WTYC 4C3IJ 2VT3A 1VQOI 4CYCA 4A3EJ 3HPHA 2NS8A 1WHUA 3KZZA 2F4IA 1MMDA 1EJ9A 1P7IA 3HDDA 4G7ZF 3M7GA 1QHGA 1UJ8A 1JHHA 1SMTA 1WFXA 2GXBA 1KZHA 3HTUA 1HW2A 2PI0A 2VI6A 2CQ7A 2LG4A 1XS9A 1RETA 3I59A 2M5WA 4JX5A 3LNQA 1WKMA 1JKOC 2M45A 4WWCA 3H5RA 4G7OF 3KE2A 2LF8A 2TDXA 3DTEA 5TRDA 3L2WA 1D1CA 2NYXA 3OSGA 4EM2A 1YI2I 2R7TA 2Q2EB 3S3NA 1MNEA 3S2DJ 2VIXA 4U87A 3JRDA 4HLXA 1IN8A 2FE3A 3CCJI 2P7CB 2H09A 1XB4A 1CF7B 3ZQCA 2V9KA 2L4AA 4X1EA 1SMYF 3OYJA 5B1AH 1KU2A 2IAIA 3U21A 4A0YA 4YFNF 1D1BA 2M0MA 1X2MA 2IBDA 4MEXF 2VOPA 2BE5F 2STWA 4KJZA 2JTVA 1FSHA 2OZ6A 4G94A 5CVRA 4XR6A 2P8TA 1ZELA 2QCOA 2CWEA 5KNLA 4GFBA 3FM5A 3Q9SA 5JVTA 1JTXA 3GTLJ 4HG2A 1E3HA 2L7MP 2QSHX 2VQHA 4RDUA 1T56A 4ZDLA 1LVAA 5ICCA 5A2QK 2IVMA 4G8XA 3KEOA 2A05A 4DYQA 1JKRC 4TV7A 3MMYB 2ESNA 4ITVA 3OY9A 3BY6A 1Z05A 3WTXC 1RUNA 4Y17A 5EGOA 1ON2A 3OYFA 1BOBA 5F6FA 5IOYA 2Q1ZB 4LIUA 4L9JA 5FROA 1J7KA 2LF7A 4BH9A 1K78B 4BEHA 3E6BA 1XN7A 3O2PE 1XGSA 2W25A 3WODF 5LBQA 1ETOA 4D7MA 4N4NB 2XAUA 3OOPA 1XSVA 3V7RA 3U9GA 1S72I 1WH5A 4RMNA 3D1NI 4HNUA 2XDVA 3IH3A 3IHUA 4ZTFA 2L5QA 1M1EB 5M5WJ 3CUQC 4BACA 1O3SA 3TDZC 3CP2A 3JRIA 3HRTA 3EUHC 3VWBA 3HG9A 2ZFWA 2ZMEA 2LP0A 3JREA 1CQTA 4I6ZA 2W4SA 4DW6A 1FTZA 2DT6A 3J7AY 1O57A 1QZYA 5IT9Z 1D1AA 5JVGF 4BNCA 1R23A 2HVQA 2Y75A 2BXZA 3SDGA 2ZJQF 1APLC 4C3HJ 4RGUA 3JRBA 1TC3C 3BJOA 5LHIA 2ISZA 2BZTA 2VBWA 1VQPI 5DM6F 1VQLI 3QQAA 3BZCA 5EEHA 4IHVA 4IQ4A 5LHHA 2HXIA 2IXSA 2VKEA 3QOEA 3P7NA 3SDBA 4CICA 4UUSB 1MDMA 4OAYA 3M8FA 4XKCA 2MD5A 1ZRFA 3OL3A 4PSXA 4PGHA 4B09A 2XAGA 2CV2A 1Y1WJ 3ABUA 2DDBA 4PK4A 2O61A 1IDYA 1OQYA 4F93B 5HODA 2Z2SB 4HSTA 1N75A 3OYEA 4Y13A 1B59A 1D3YA 2Z5UA 4RM2A 2VODA 3OYGA 3CCSI 1QU3A 2JPCA 4B4CA 5H6QA 3VFZA 1OCCH 3SFZA 3HL2A 2BW3A 2ESHA 4P1WA 1V55H 3KPHA 3F72A 1XCVA 2CRGA 3J7YJ 5FKMA 1IRFA 1KYWA 1QZEA 3FK7A 1X19A 2OBPA 3VPRA 2LYCA 5E20A 2HTSA 2DA7A 2DQRA 3CJTB 5L3EA 1R1VA 4DZPA 3GTKJ 3FM3A 1T38A 2HKOA 2CQKA 2CUZA 5M5YJ 5J1YA 2AXTC 3ZN1A 1ZG1A 5ERIA 1I6XA 4M74A 5E18F 3OR1C 2X6XA 2WAEA 5CYVA 3SHFA 4XICA 1GVJA 2XUBA 4HW0A 1RPWA 3HB9A 2LOOA 2K86A 3FHZA 3I9V2 5LEKA 3KYDB 1SD6A 3BPXA 4MEYF 5KK1A 5FLMJ 3ZMDA 2Y30A 2WV0A 4I0BA 3REOA 2MFZA 2X1DA 3O8HA 2GM4A 3IL2A 2E2IJ 5JI6A 3QYBA 3K4MA 4BYYA 4RS8A 2F5FA 4W97A 5D8KB 2Y0MA 3PNTA 1B8IB 3M4OJ 4XL9A 3AL0B 3ZQ7A 1YG2A 3RZDJ 1FYMA 5K7HA 2ZXJA 3WU0A 3OWTA 1H9GA 4G9YA 1YE9A 2EFNA 3QRFF 2D1VA 1W7PA 1OMIA 1SD5A 1SFUA 3WE2A 1K83J 1P2FA 1R1UA 4C9YA 1VQ8I 1R5HA 1SVLA 2HPMA 3L2UA 1I1SA 2MA3A 3T0YA 2B63J 3HOZJ 3DEUA 3W6JB 3QP6A 1BL0A 2OU2A 3TKYA 2NAZA 1VQ6I 1B72B 2IPQX 4MGRA 2F5CA 2ZXWH 1FOYA 2GOXB 4F55A 1OCZH 2XVCA 1D5YA 4NB5A 3K9TA 2R7SA 1WRJA 4E7SA 3RKWA 4CZCA 2XSDC 2HVSA 4A0ZA 2G9WA 1MNDA 4KNYA 4OIRF 2DI3A 4A6EA 3CMAI 2BYVE 2DLLA 4UVAA 2VQLA 3DBHB 2XGCA 3A4CA 2CUFA 3HOXJ 4LK0F 3U1DA 2MG4A 2DPUA 2Y2ZA 3JCUC 2DJNA 3HGGA 1STZA 2HNHA 3M9AA 3RYPA 3R0JA 4HYEA 1FC3A 4Y52J 4L5JA 3IUOA 3G73A 3LQQA 4NC7A 4YFXF 3AKZA 1SAXA 2X9DA 2VLAA 5F0CA 4EGZA 3OIPA 1YW9A 3C2GA 1T95A 2HQ5A 2LKPA 3S17J 2F6CA 2P5VA 2BY0A 3NWSA 4MO7A 3E6CC 2MGQA 5CQGA 5KVRA 2XRNA 1LFBA 2MBFA 4CCKA 3HRUA 2CFOA 2IS1A 5LHGA 1R00A 2YS9A 1BW6A 1K79A 5L3GA 2VB6A 2L7FP 2FU4A 4UXNA 2RV8A 5IT9K 3BR1A 5HDGA 2WAQN 2VQGA 3ASOH 1YO5C 1IXCA 3J7AO 1MIJA 4KIBA 4N4OB 4LK1F 1MH4A 4PFOA 4YRVA 3LSIA 2EQRA 3IAM2 1ZREA 1JE8A 1W5SA 1QO0D 1XX5A 5DD4A 3PQJA 4QSHA 2KFDA 2HEOA 3GZNB 1IO2A 4XSXF 3K70C 3CCYA 4ZH4F 4XBFA 1X1AA 3H5AA 2P6TA 3DWLE 3I64A 1YJ9I 2DTZA 3Q9VA 3HGYA 5IYBJ 4L5EA 4GCVA 2HTJA 3X2QH 4GO1A 3A01A 4AYBN 2UWMA 1U5TA 3S2HJ 4ZDPA 1POGA 4U88A 1G3YA 1UG0A 4IRGA 3LSPA 3G1LA 2PX9A 4XLFA 3MWMA 4FTHA 1B72A 3S14J 1T2KA 4BDZA 1X2NA 1FMVA 1HKQA 2GLOA 3ERED 4XLHA 2ZKZA 2FBIA 2XASA 5DYMA 3TQNA 2VUMJ 4PJLA 1X58A 3AG1H 2V4JC 3CF2A 1G3SA 4IL6C 4XLEA 3WTZA 4BEHB 2MLKA 1JKPC 2Q8KA 2CV0A 1F36A 4MLOA 3H3VK 3T5XA 1XGNA 4A3LJ 2QQ9A 2R7DA 1O4XA 4N9IA 2CMPA 2GA1A 4EATA 5J47A 1N78A 2PMZN 1ETKA 2FOWA 1R71A 4LG0A 2HOTA 4WF2A 1RUOA 1XCBA 2EV5A 2NOGA 4XNFA 1MJAA 1FT9A 1TT0A 1DU6A 3FISA 3F22A 4LIVA 1D0YA 5HS9A 3LSHA 3BG3A 3KYLA 1UAAA 1YIJI 3OIOA 2HQNA 3BPVA 3N97A 1NH3A 1I3AA 3QPSA 4B3AA 2IP2A 1YITI 4KITB 1PYVA 1H89C 3W2WA 4EEFG 2VKVA 3BROA 4L9TA 2QQ8A 5CVJA 1TW3A 2W48A 2KMUA 4HF1A 4F3QA 3FXKA 2E7WA 2EH3A 4A69C 5FFXA 2XPVA 2DK8A 1FBUA 3WG9A 3EETA 5LLQA 5JLWA 1WZ2A 2Y9YA 3MQ0A 3AAFA 2R5YB 2ISYA 3WTVC 2XSJC 2IS4A 1J9IA 3EPZA 3OYKA 3BG6A 3C18A 3P9KA 4HQEA 2FNPA 5LFAA 2G7UA 4CCJA 4M3GA 2K9MA 4A6DA 3F8MA 3BR2A 2QQBA 5FO5A 2M4KA 1VQMI 4LMYA 3KLNA 1HOMA 1A5JA 4UHTA 2BW3B 3OYBA 4A3GJ 5IOZA 2LFBA 2HDCA 3F8NA 1LEAA 2VL8A 5H20A 5CVIA 2V9VA 3F0CA 2ACJA 1OPCA 3QP5A 2H8WA 4B8XA 2EA2A 1PUFB 3IAS2 4KIFA 2VKHA 3IH4A 3VYUB 3R0AA 4G6DA 4IRIA 2ZMEB 1ITYA 4M6YA 4B1RA 5FD6A 2QQAA 4C2TA 5ED4A 4IX7A 1A35A 5K7ZA 2DO7A 1HXDA 1WGXA 4EJWA 2JVGA 2XKOA 3E6MA 2F4OB 4D9JA 4XMYA 2ZJRF 2R7RA 4ZYEA 2DAOA 2DN0A 3L2RA 3W6VA 2OQGA 1YRNB 3GTOJ 3VSKA 4AD9A 3HUGA 5DEQA 2KIFA 4IOCF 3B6CA 1R4NB 2STTA 2HWVA 5EZHA 2OQRA 3GLLA 4LB5A 1Z7UA 3ISPA 4AU7A 3SXYA 4J01A 3TW7A 2ZXIA 2W00A 4RAYA 3E5XA 4B47A 2IS6A 1HA8A 4MHGA 4BXFA 4CZZA 4CUGA 3DKWA 4H0EA 2OCCH 1MSEC 3TP3A 3WTWC 5B5EC 3A2KA 5DM7F 3GFIA 2WAQA 1ORKA 2YU9J 2FJ1A 2UZKA 5EG0A 1TW2A 5EYRA 1IGNA 2Y0SA 3MKZA 2HKXA 2LMDA 4Y33A 3KFWX 3LFKA 1E3OC 2V9PA 3IRRA 3ZQHA 5CVVA 1ZG5A 2PN6A 3EUAA 3BWGA 1NK3P 2LDUA 4FE4A 3T8RA 2FSWA 1XDSA 4OIOF 1KU9A 3I54A 1B1BA 2NNNA 1XMAA 5J3LA 1I5ZA 3V8JA 5TJJA 1WJBA 2E1MB 2VBXA 2O9LA 2KKOA 1NG6A 2Y48A 3CCMI 3GCMA 1CF7A 5HDNA 2OAZA 1W36C 1HSJA 3RDIA 1EA3A 4YELA 3M8JA 4R8HA 1JJ8C 1BI3A 1TWHJ 4HX8A 1ULYA 3WTTC 1BR1A 2F2EA 4WXCA 4V2FA 4G7HF 1UHWA 2Y31A 2FRHA 5GAGJ 2CUEA 2XF6A 1KQ0A 4LLNA 3CO6C 3HOSA 3GYHX 2Z9OA 1U78A 4OIPF 5FKOA 1TWFJ 3RZOJ 1HQCA 3DP7A 3Q3SA 2NS0A 4LITA 1MMSA 1YJWI 1IUFA 2V6EA 1FWZA 1G8XA 5E8GA 2O0YA 2X0LA 3W2VA 3FMSA 3H0DA 3JAMK 3S32A 4HV5A 3S3OA 1Z77A 1E17A 2A69F 3JW4A 5EZGA 3ZMTA 4XOTA 3T1BA 3IKTA 1KQ8A 3OS2A 3N4MA 1H0MA 4OU0A 2DMTA 4FETA 4XLAA 4E7JA 3C2HA 5FFZA 1VNDA 1RKWA 4CGZA 1LJ9A 1WSUA 2JA7J 3GZ6A 1USTA 1XC5A 3DBRB 5F0FA 5AONA 5FB2A 3A01B 2O7OA 3HM5A 5HVQC 4WX9A 3U1KA 1GDTA 1IF1A 3S15J 4G12A 2ECCA 2VC1A 1KQ9A 4X0GA 3JRCA 1KONA 2FMYA 2KIUA 3TO7A 2XF7A 3H35A 1RESA 4KYWA 5BNGA 2X48A 1Y0NA 3BG9A 2VJJA 2RDPA 1WI3A 1B6AA 4FASD 2KJCA 2RN7A 2V1XA 4OOIA 3CTAA 3WGGA 4OIQF 4HDUA 2LBFA 3BZ6A 3DU6A 3HXLA 2XV4S 1RI7A 2LC2A 1WJEA 3K2ZA 2KRHA 1HCRA 3V7SA 2QSFX 4QPOA 5BOXA 3FDYA 2EIMH 2H1LA 2KISA 3MAJA 4E7IA 4LFUA 1HLVA 5AIQA 2EK5A 3AG4H 1KU7A 2L7KA 4UV9A 4R79A 2FMLA 1ENHA 4P9FA 3SEQA 3QPHA 1OCOH 5D6FA 1FPQA 3CESA 5FRNA 1Z21A 3Q5FA 2ZJPF 2R7ZJ 1MMGA 2OCEA 2V26A 5J6XA 2TCTA 3F8CA 3KLOA 2NVQJ 5J40A 2KP6A 4E7KA 2GXAA 2IA2A 2CG4A 4O6JA 4NDLA 1S7OA 3PO3J 2G7HA 3HSFA 5M3MJ 2HR3A 1PP7U 2COBA 2K40A 4YIFA 1EF4A 3BC8A 4ZJZA 4HQMA 1TP4A 3TDUC 1PDNC 1WJCA 5CVUA 3G71I 3S1MJ 3OYNA 2P81A 3QPTA 4GGGA 1K4TA 3H92A 1SVOA 1D0ZA 3I4PA 3L09A 3S1RJ 4HLYA 3CJRB 4RAGA 4I7HA 1XMKA 3ZMSA 1IZ1A 2CW8A 3BTLA 5C4XJ 3ZMZA 5HLHA 2NNYA 1TWAJ 2OZUA 3SZGA 2BXYA 2GIZA 1ZRDA 2DK5A 3WU2C 2XB5A 1UELB 1G2HA 2X6WA 3GF2A 4QWQA 2HOEA 4GDFA 1NK2P 3HOYJ 1SEUA 5L3DA 3GO5A 4A3IJ 4LGWA 4F52A 2HFHA 2HI3A 3FBIB 1O3TA 2PMZA 4Z6YA 3V7CA 3SZTA 1MBJA 2LREA 3ERMA 3JAMZ 4UV8A 1IN6A 1XSXA 2LH9A 4LG3A 3W6KB 1Y0UA 2L7ZA 3CZ6A 2QA4I 3RJPA 2JA2A 4MTEA 2QEXI 5KAFC 2O8XA 4YIRX 2Q2EA 3EDPA 1LUJB 3BG5A 3DF8A 1OCTC 4CCOA 5L3BA 1ZG3A 2CYYA 4I98B 1R1TA 4I02A 2OTJI 3I53A 2ZJ2A 3OSFA 2B9SA 1YRNA 1YTYA 3HUGB 5E3OA 1TQIA 3ZGKA 3H3ZA 3QU3A 4KISA 4LB6B 2R5YA 1MKMA 1MNMC 1VQ5I 4PJMA 2ADUA 5GP9A 4ZZLA 3CMEI 1W0TA 4ENJA 3KP6A 2ECBA 1T0FA 2XAJA 1JXSA 2NOJB 2Y0SN 1Y1VJ 2IS2A 2NRAC 2EA4A 2XGXA 1S6LA 4UUSA 2JN6A 4FCYA 5CPRB 1S5LC 2DA2A 1USSA 1MZBA 3CMMA 3IV5A 2RGVA 3J81K 2QBYA 1U0JA 3BR5A 3OS1A 4EV0A 1J5YA 1HBXG 1Q1HA 4IHSA 1BW5A 3BTJA 3KEYA 1A04A 3TMOA 5DCMB 1AU7A 2L54A 5ICEA 4A3FJ 1ZLJA 1N25A 2L9RA 2QF7A 1HSTA 1TT5B 5F27A 5F1RA 1OR7A 3MZYA 3NEUA 3FKJA
chains in the Genus database with same CATH topology
3NWTA 4N4OB 4PFOA 1QHHD 4B48A 4YRVA 3LSIA 3IAM2 3ZXSA 3DU5A 2L9NA 3K6GA 1DGRM 1FMWA 2QKLB 3SYTA 2JUGA 3K70C 3K70D 1MMNA 2KDOA 3H5AA 1X1AA 3DWLE 4E6KG 3ZRGA 2KQRA 2OV7A 2UWMA 3LFUA 3DKYA 2R7WA 4ZDPA 3RSNA 1UG0A 4XLFA 4DOZA 2E60A 3VDXA 3DTIA 4PSWA 4CSWA 2HQAA 4BDZA 1FMVA 2L2OA 4E7LA 4XORA 4XLHA 2W7NA 4OAZA 1Z3YA 2RNGA 4PJLA 2QKMB 2V4JC 5JHFA 2FUG2 3CF2A 4XLEA 2DXIA 4BEHB 2X51A 4YEJA 3AL0C 3K4JA 2KHMA 2R7QA 2HZDA 2CV0A 1DP3A 2X6YA 4MLOA 2VPLA 3H9QA 2IGMA 2WA0A 1GLNA 4ANJA 4II3A 2CMPA 2HDWA 4EATA 1N78A 1BR4A 3E0JB 1DQUA 4IKFA 1AA7A 3PFYA 4XNFA 3PNYA 4XKWA 4HSRA 3RQ4A 1TT0A 2WBMA 4LIVA 1D0YA 3LSHA 3RTRA 3D5RC 3KYLA 4BJ5C 1UAAA 4HEA2 4BQQA 3K4LA 4B3XA 3HOTA 4RLFA 3OS0A 3DKXA 2IGOA 4IZZA 4KITB 1PYVA 4XM3A 3W2WA 3W2AA 2OUMA 4NNJA 4F91B 2V7FA 2PJRB 3OMYA 2KMUA 4F3QA 3OYCA 1G59A 3ZCOA 1X4OA 1X4PA 3VSLA 3DPLC 3ZR8X 4DJAA 4XQFA 2OC6A 2GOMA 2HVRA 4RLQA 3DPUA 4PUSA 2XSJC 2IS4A 3K4BA 1LVKA 1OR7C 2VXZA 3EPZA 3OYKA 3BG6A 1Y6IA 2E5ZA 4CCNA 2P0WA 5LFAA 4CCJA 1MMAA 2K9MA 4OWRB 3K4NA 2LRDA 2PJRA 2IGNA 4QPQA 4XONA 2M4KA 1TZLA 4HNTA 4B43A 3K10A 3PSIA 3H9GA 2BW3B 3QYFA 3OYBA 2VL8A 4II2A 3HC7A 3OOUA 2CS3A 1JI8A 3I3LA 3IP4B 2JSPA 2ZFUA 2UUZA 3OYMA 2MYSA 3IAS2 3MD2A 4BE1A 1Y56A 2VKHA 3VYUB 4H4KC 4CCLA 3S93A 3LL7A 1WJFA 4E7ZA 3DLAA 1LDKB 4BQOA 3CJQB 2R4GA 2IGKA 4C2TA 4IX7A 2WAFA 3ONQA 2CW7A 4BJTA 3HPHA 2JVGA 1X1DA 2CUJA 2ZXHA 2F4IA 1MMDA 4D9JA 4XMYA 3GBGA 2R7RA 1X1BA 3L2RA 4BU2A 3VSKA 1YX5A 1QHGA 1WFXA 2AQFA 4AU7A 2LG4A 2W1OA 4J01A 4BE0A 1V5FA 2ZXIA 2W00A 4B47A 2IS6A 4JOMA 3H5RA 1HA8A 4BXFA 4CUGA 2DCEA 3DTEA 5HNFA 3L2WA 1D1CA 3A2KA 2R7TA 2WAQA 2Q2EB 3FHNA 2VJ4A 1SFKA 2WY8Q 3S3NA 3BCAA 1MNEA 3H5NA 2VIXA 4U87A 4ZDOA 1Z7LA 3VYTB 2Y0SA 3MKZA 4Y33A 4NQWB 2V9KA 3OYJA 3EUAA 3U21A 2MABA 1VZ0A 1D1BA 2W82A 2M0MA 4CH7A 4KJZA 2E1MC 3ZQQA 2ELJA 1WJBA 2E1MB 4XR6A 1ZELA 1NG6A 4BS9A 3A1YA 1W36C 5KNLA 3DTKA 4HG2A 1EA3A 4YELA 2KZVA 3UR3C 3M8JA 2VQHA 4DGWB 2WY7Q 3VYSB 4BL0B 4ZDLA 2M7BA 2UV1A 1BR1A 3FBNB 3HKZA 2I8DA 2A6TA 1MW7A 4XKVA 1NG7A 1T0FC 4PJJA 3SEZA 2K3PA 2A5WA 2XF6A 3MMYB 3TL4X 4ITVA 4BUPA 3L2VA 3OY9A 2L9SA 3HOSA 3OYFA 3LSKA 3PUBA 1BOBA 5KHDA 2DT7B 2Q1ZB 3M1CA 4LIUA 4LITA 5FROA 2V6EA 1G8XA 4BEHA 3V42A 4C2UA 1D0XA 3W2VA 3H0DA 3S32A 4N4NB 3S3OA 2XAUA 4BE2A 2VJIA 2K5CA 4Y4RA 2LY2A 3PL8A 5HNHA 4RMNA 4HNUA 2XDVA 3OR2C 4XOTA 3PSFA 4ZTFA 2L5QA 4C30A 4BACA 3OS2A 3S8PA 1Z3XA 2HU9A 2MD0A 3OIQA 3CP2A 4XKBA 4FETA 3EUHC 4XLAA 4DBQA 4E7JA 3C2HA 4RM3A 3DPTA 4B44A 3VWBA 2XF5A 3HPGA 3HG9A 4XN3A 2ZSIB 2X85A 3OYIA 2LBFB 1IRXA 4XOPA 3LSMA 2W4SA 4CA0A 2DT6A 3J7AY 1D1AA 2WB1A 5HVQC 2CV1A 5CKTA 1K6YA 2HVQA 1X1CA 1N77A 1LFPA 4X0GA 1YX3A 1KONA 2XF7A 3H35A 4IQ4A 4HRIA 2IXSA 2CH0A 2VJJA 2KRCA 3QOEA 3SDBA 4FASD 4OAYA 3W3CA 4BDYA 4XKCA 4ZC3A 3DEEA 3OL3A 4AYBA 4PSXA 1BR2A 2LBFA 2RREA 3DU6A 3HXLA 2CV2A 2LC2A 1WJEA 2KRHA 4PK4A 4QPOA 3D5LA 3OYEA 4F93B 1J09A 2Z2SB 3FDYA 1N75A 4HSTA 4E7IA 2Z16A 3H9JA 2R7VA 2L7KA 4RM2A 1QU3A 3OYGA 3N05A 4R79A 5HLTA 3DQVC 3SEQA 3VYRB 4F92B 3PJRA 3HL2A 3CESA 2BW3A 1Z21A 4P1WA 3OYLA 5FRNA 1P9QC 4IQJA 1MMGA 2V26A 2VXDA 4AVZA 2KLOA 1PJRA 2KP6A 4E7KA 1ERDA 5LD2C 1SAUA 1X19A 2WADA 2LYCA 2RQQA 4NC8A 3BC8A 4ZJZA 1OLTA 5FRMA 1W36D 2CUZA 1WJCA 3RCOA 4BQNA 4J00A 3LSGA 2R7OA 3L2QA 4HPQA 3OYNA 2R7XA 3OR1C 2X6XA 2WAEA 3D5SC 3BG7A 2DJIA 1D0ZA 1V5GA 4JQFA 2BVLA 3CJRB 2LOOA 2BOLA 3I9V2 3G2BA 3LMMA 2O5RA 2CW8A 4D1QA 3KX2A 2MFZA 2X1CA 4E4HA 2X1DA 2E5NA 3QYBA 3K4MA 3SZGA 3E1SA 3PNTA 2VQCA 4DIQA 2XC7A 4XL9A 3AL0B 1UELB 2JVHA 2X6WA 3CP8A 2K9LA 3OWTA 4GRIA 2VASA 2VJ5A 4XLCA 1YE9A 4F52A 3FBIB 4BGDA 1R6RA 4PJNA 2PMZA 2M3AA 2LREA 3QYEA 4C9YA 2KPMA 2LH9A 4LG3A 3MKWB 2HPMA 3L2UA 3CZ6A 2JA2A 1WJ5A 3F9KA 3MKYB 4DBRA 2AQEA 2HPIA 2GOXB 4F55A 3BLYA 2BVMA 4CCOA 2R7UA 1E0EA 2DOAA 3BCBA 4XN0A 4P5OA 2R7SA 4E7SA 4Y3OA 4CZCA 2HVSA 3RPUD 1MNDA 4G6TB 4ZYAA 2VQLA 3AFHA 1LKXA 2KL4A 3HUGB 3S3MA 3A4CA 1DGWY 5CQEA 3ZGKA 4KISA 1WJDA 3OL4A 2HNHA 5KCMA 2Z1DA 4PJMA 4CCMA 4ZTJA 3QODA 3EUKL 3IUOA 4NUBA 5TGTA 1V5EA 4NC7A 3UNGC 3PNVA 3AKZA 2NOJB 2IS2A 4E7HA 2M7AA 2VLAA 3OIPA 5CPRB 3C2GA 1T95A 3OYDA 2F6CA 3K4CA 4KT6A 5HOOA 1WJAA 2F5VA 2VKDA 3NWSA 3CMMA 2V1NA 5CQGA 1U0JA 2MC4A 3TBIA 3OYAA 4CCKA 3OS1A 3OYHA 2CFOA 2LY1A 2IS1A 2ZSHB 2X1EA 2M4GA 3KEYA 4BJ6C 3TMOA 2VB6A 4U7BA 1S9HA 2VQGA 3K4KA 4PFPA 3FKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCO A; 
#chains in the Genus database with same CATH topology
 2AS5 F;  1WQ2 A;  2EV6 A;  5FJ8 J;  5TIS C;  2AO9 A;  1U8B A;  1J59 A;  2M8G X;  2XKP A;  1SVM A;  2WTE A;  2L9N A;  1ZYR F;  3M07 A;  5LRS A;  2DFH A;  2IJL A;  1MMN A;  1NHA A;  4NHJ A;  1TQP A;  3BOQ A;  3OV8 A;  1O7L A;  1TL8 A;  2HOA A;  4DYC A;  1LE8 B;  1AKH B;  3DKY A;  1J75 A;  2R7W A;  3DXJ F;  2DU9 A;  5E3N A;  4M3B A;  4M71 A;  4HF2 A;  3F21 A;  4DOZ A;  2GXG A;  3DTI A;  4Y15 A;  4PSW A;  2PG4 A;  4KIC A;  4EJU A;  1P7J A;  2P5L C;  4NC6 A;  4XOR A;  2PEX A;  4LOC A;  1BOA A;  2XGE A;  4OAZ A;  4UVB A;  2EB7 A;  2M1B A;  2RNG A;  2V1D A;  4S0H B;  2KJB A;  1E3P A;  4QLC U;  3K69 A;  4C2M J;  1P4X A;  2X51 A;  3AL0 C;  1BBY A;  2R7Q A;  1FLI A;  1LB2 A;  2VPL A;  2GA2 A;  3V4G A;  4M72 A;  2FOK A;  4ANJ A;  1R49 A;  3KIO A;  3CCE I;  3I5U A;  5J8C A;  5GPC A;  1KYZ A;  5GTI C;  3HIF A;  2JPB A;  2O3F A;  4IKF A;  1SFE A;  2A6H F;  2VT2 A;  1S7A A;  4UUV A;  2COM A;  2ZNY A;  4XKW A;  1XG1 A;  5HLI A;  1FX7 A;  4BXX J;  4KUM A;  2E1N A;  3JSP A;  3RQ4 A;  1W7P B;  5IT3 A;  3KET A;  4IEJ A;  4A3B J;  1IUY A;  1QQI A;  2F48 A;  2QLZ A;  4HEA 2;  3E97 A;  4L0Y B;  4A3M J;  2GWR A;  3I59 B;  1PP8 F;  1YHQ I;  1GXP A;  1IN4 A;  1T33 A;  3FXJ A;  1F43 A;  2IGO A;  4IZZ A;  4XM3 A;  2KZG A;  3GFL A;  3M1E A;  4NNJ A;  2V7F A;  3CLO A;  2PJR B;  1RR7 A;  3AG3 H;  5LGN A;  1VF9 A;  3PFI A;  4ZYG A;  2BHY A;  1X4O A;  1U2W A;  3VSL A;  3ZR8 X;  3MFK A;  4DJA A;  1R22 A;  1XPX A;  4R1H A;  3L00 A;  1BA5 A;  3HKZ N;  3I71 A;  2WB1 N;  4PUS A;  1TNS A;  4ABZ A;  3L1P A;  5B3S H;  1QVU A;  1OR7 C;  2FXA A;  4NBQ A;  4WCG A;  1Y6I A;  1PVE A;  3TGN A;  5H6R A;  2VOO A;  4MFD A;  2Q0O A;  2B7E A;  2EBI A;  1IDZ A;  3K4N A;  1LE8 A;  2LRD A;  1AKH A;  1F5T A;  4QPQ A;  4XON A;  3R60 A;  1O3R A;  2Y69 H;  2ZNZ A;  2J5P A;  3B6A A;  3VOD A;  3WE3 A;  3J7Z I;  3H9G A;  1LQ1 A;  4ENN A;  4LJZ F;  4M3D A;  1QVT A;  2DW4 A;  1IRZ A;  3HC7 A;  3ZP5 A;  5GPA A;  3HRS A;  3I3L A;  1JI8 A;  3G4S I;  3IP4 B;  2R92 J;  5FLX Z;  2JSP A;  3OYM A;  1QRY A;  3CDH A;  3MD2 A;  3QOP A;  4KMU X;  1Y56 A;  1GXQ A;  1MSF C;  4H4K C;  2K4B A;  4S05 A;  5E1Z B;  4AIK A;  1WJF A;  3JRA A;  3S1N J;  2L4M A;  4E7Z A;  4BBS J;  4J19 A;  1NTC A;  3IRQ A;  2DOE A;  2RKH A;  1JKQ C;  3CJQ B;  3KZY A;  5D6E A;  3ONQ A;  4HOB A;  3E3V A;  3WHB A;  2QZ8 A;  4IHW A;  1IV8 A;  2DOD A;  3SJM A;  3DEW A;  1Z0X A;  2CUJ A;  2ZXH A;  1HW1 A;  3GBG A;  2A07 F;  2O03 A;  1X1B A;  3B02 A;  4RGS A;  4BU2 A;  2R7F A;  1T08 B;  1YX5 A;  2H27 A;  3HZJ A;  1JGS A;  2XIG A;  2RQP A;  3KP4 A;  3TED A;  2XPU A;  2QVO A;  1OCR H;  4FE7 A;  2AQF A;  1K6O A;  2DA5 A;  4AUX A;  1L3L A;  2W1O A;  2AXL A;  1B4A A;  2B0L A;  1U9O A;  2K3F A;  3C1D A;  3DV8 A;  1JHF A;  1D5V A;  3E5U A;  1HKS A;  2K27 A;  1HDD C;  2DCE A;  3A0B C;  2EIK H;  4IJA A;  5HNF A;  2E36 A;  1FP2 A;  1YW7 A;  2IW5 A;  1X3W B;  1T8I A;  1ZKG A;  2L0K A;  2R0Q C;  4RA2 A;  2HYJ A;  3VYT B;  1YLF A;  2HS5 A;  2FQ3 A;  3RYR A;  2QSG X;  2NVX J;  1FNN A;  2MAB A;  2WV1 A;  4CH7 A;  1EH6 A;  2M30 A;  4KFC A;  2VBZ A;  5K7F A;  1WVR A;  5F08 A;  3F23 A;  1IAW A;  3A0H C;  1LNW A;  4ZYD A;  3DTK A;  5DUI A;  1LEB A;  1ZQ3 P;  3UR3 C;  5K1Y A;  3CUO A;  4KDP A;  4ETS A;  5E3M A;  2JJ7 A;  3G1M A;  2M7B A;  3O6B B;  3ZMV A;  1FYL A;  3RPQ A;  2H94 A;  5E3L A;  3LQR A;  2UV1 A;  3ZPL A;  3FBN B;  3HKZ A;  1ZTR A;  1MW7 A;  2A6T A;  4XKV A;  3Q0V A;  1W5T A;  1K4S A;  4PJJ A;  3TL4 X;  5J1R A;  3LA2 A;  5FLV A;  2L9S A;  1BJZ A;  3KP3 A;  4RB2 C;  3CJN A;  4GYG A;  3JRH A;  5CJ9 A;  1SFO J;  3LSK A;  5ICG A;  3PUB A;  3LAP A;  1ETY A;  1LDD A;  3M1C A;  1BC8 C;  3FF5 A;  1TLH B;  2PBI A;  5ILU A;  1D0X A;  4RAZ A;  3J80 K;  5C44 J;  1LFU P;  1MBG A;  3PL8 A;  2M0C A;  1JUM A;  5HNH A;  1ZH5 A;  4A93 J;  1HF0 A;  3OR2 C;  5ILV A;  4WK8 F;  1JT0 A;  1Z3X A;  2IA1 A;  5EGO B;  3OIQ A;  4G6Q A;  2FEZ A;  3J80 Z;  2MH9 A;  3GME A;  1BJA A;  1IXS B;  4DBQ A;  1VQN I;  4RM3 A;  4B44 A;  3DPT A;  2XF5 A;  3HPG A;  2XRO A;  2ZSI B;  2X85 A;  1KA8 A;  3OYI A;  1HDP A;  2PQ8 A;  2EV0 A;  3RKQ A;  2R93 J;  4I99 C;  2WC2 A;  1G6N A;  4P9U A;  2YSR A;  1MJB A;  3GZ5 A;  2CQQ A;  4D0P A;  2QUF A;  5CKT A;  1K6Y A;  2KIM A;  4RBO A;  1O3Q A;  1QA6 A;  1YIO A;  1N77 A;  1K61 A;  1YX3 A;  2FQ4 A;  4A3D J;  4IHX A;  5J4Y A;  4JK1 X;  1WWX A;  4HRI A;  2CH0 A;  3O8G A;  2GIV A;  4XK4 A;  3CQZ J;  4OIN F;  5A2Q Z;  4BDY A;  4HX7 A;  2IEK A;  4ZC3 A;  1ETQ A;  3BQY A;  1BR2 A;  3WTS C;  4RGX A;  5C3E J;  3H3U A;  3ELK A;  4JP0 A;  4RB3 C;  2ZC2 A;  4XRS A;  4O3M A;  1SD4 A;  2D2W A;  3H9J A;  2R7V A;  1FSE A;  1I1G A;  3PUF A;  3N05 A;  1GHC A;  1YQA A;  3L7W A;  3K7A J;  1S29 A;  1T6S A;  1X3U A;  4M9S A;  4F92 B;  5LGT A;  3OYL A;  1EH8 A;  2JA6 J;  4YG2 F;  2VXD A;  4ASN A;  4AVZ A;  2R5Z A;  2XAF A;  3O3K A;  4L0Z B;  1PJR A;  4ZZD A;  4BY7 J;  3JTG A;  1ERD A;  5BQT A;  3I4M J;  4PZJ A;  2Y9Z A;  2DPD A;  2DBB A;  1W5C C;  3JRG A;  2K02 A;  5ILS A;  2RQQ A;  4NC8 A;  1ZLK A;  3FMQ A;  3TO6 A;  1QBJ A;  5FRM A;  3CD6 I;  4IPA A;  2VC0 A;  1TWC J;  3WHC A;  1W36 D;  4BQN A;  2R7O A;  1K78 A;  3L2Q A;  3L9F A;  4HPQ A;  1RZ4 A;  3D5S C;  3BG7 A;  1XTA A;  2DFI A;  1I27 A;  2VN2 A;  2BVL A;  4KMF A;  5JHU A;  5DCF A;  1V4R A;  2BOL A;  1TNT A;  4EM0 B;  2L3D A;  3LMM A;  2D45 A;  5F64 A;  3KYC B;  2DDA A;  4E4H A;  3FKI J;  5KAI C;  5AIP A;  2M34 A;  4M6V A;  3M3Y J;  1JUP A;  1FBQ A;  4U0V A;  4K2E A;  1JGG A;  2M8E A;  1Z6T A;  2HQR A;  4A3K J;  3S16 J;  3CP8 A;  4BKX A;  1Z9C A;  3GTG J;  2K9L A;  3R6S A;  2W24 A;  2DFE A;  1L0O C;  2VAS A;  2VJ5 A;  2W57 A;  4XLC A;  1ZAR A;  2F5E A;  1R6R A;  3FZV A;  3KZI C;  1HW5 A;  4UY8 I;  2VBY A;  3K1M A;  4Z2Y A;  2KPM A;  3ECH A;  3MKW B;  4A0X A;  3BT9 A;  2GBY A;  2LY9 A;  3F9K A;  2CFX A;  4XID A;  4CYC B;  3MKY B;  1E2X A;  2JA5 J;  2HPI A;  1YJN I;  3K1N A;  2FBK A;  1AHD P;  1UHS A;  2E7X A;  4BY1 J;  3BLY A;  2BY3 A;  4IHY A;  2BVM A;  1R5G A;  2F4M B;  1E0E A;  1OYW A;  1ZGJ A;  1XGM A;  3BCB A;  4XN0 A;  3KP2 A;  4EM1 A;  4Y3O A;  2LD5 A;  1S8N A;  1U3E M;  1FOW A;  3WGH A;  4MFE A;  1X1P A;  4I0A A;  4KIG A;  2QEN A;  1TTY A;  4AC0 A;  2MH2 A;  3T8T A;  1TQM A;  2D5V A;  3AFH A;  2KL4 A;  3S3M A;  3NQO A;  2CSO A;  5CQE A;  3QAH A;  2LVS A;  3PM1 A;  3OL4 A;  4ENM A;  4EVI A;  1IXR C;  4M3F A;  3TO9 A;  4CCM A;  4NUB A;  5TGT A;  4CYD A;  4I2O A;  3HOV J;  5M3F J;  2EZL A;  3UNG C;  5IY5 H;  4O5V A;  4A5N A;  5E79 C;  3FXU A;  4E7H A;  2M7A A;  2BV6 A;  3F3X A;  2CGP A;  4QTR A;  5J8F A;  2A68 F;  3K4C A;  4KT6 A;  1WJA A;  2F5V A;  3CCL I;  4L18 B;  2VKD A;  2L01 A;  2V1N A;  4C3J J;  4HAM A;  5EDN A;  3JRF A;  1IC8 A;  3OYA A;  4CDG A;  1XGO A;  3ABT A;  3OYH A;  1EH7 A;  5JLX A;  3V8K A;  2LY1 A;  3D0S A;  2ZSH B;  2X1E A;  2CJJ A;  2M4G A;  4BJ6 C;  4U0Y A;  3KEQ A;  4U7B A;  2V79 A;  4IO9 F;  1IV6 A;  1X3Z B;  1S9H A;  3SZP A;  3CLQ A;  3K4K A;  3WU1 B;  3LSR A;  4AIJ A;  1JTY A;  4PFP A;  3RIR A;  2DA4 A;  1A36 A;  4LLL A;  1QHH D;  5FKN A;  5FD5 A;  5DDG A;  5EEA A;  3DU5 A;  5M5X J;  3RI4 A;  5DCM A;  2LNB A;  2WWY A;  2E1C A;  4IVN A;  2E2H J;  2A5Y B;  2JUG A;  4ENK A;  3K70 D;  2KDO A;  4AVP A;  3ZRG A;  2KQR A;  2PMH A;  1IW7 F;  2HYG D;  2OPT A;  2EZI A;  2KRF A;  2O6G E;  3GTM J;  4CSW A;  3HOU J;  4E7L A;  3CCU I;  2DA1 A;  4BBR J;  1JUS A;  1ZN2 A;  3I4N J;  1BM9 A;  4DYR A;  2J5O A;  3FK6 A;  1ETX A;  3F8F A;  1Y8Q B;  2FBH A;  4N0B A;  2DXI A;  1MBK A;  4YEJ A;  2KT0 A;  2ZO4 A;  4GXO A;  2KHM A;  1W1W E;  2X6Y A;  3PO2 J;  2E34 A;  3H9Q A;  1ZRC A;  1P4A A;  2VE9 A;  1GLN A;  1EV7 A;  2M87 A;  2P6S A;  2DQL A;  3ZQG A;  1BR4 A;  3E0J B;  1DQU A;  4OMZ A;  1OYY A;  3GTQ J;  2XB0 X;  1YS7 A;  2JQ7 A;  3ECO A;  3PNY A;  1DPU A;  4HSR A;  1BIA A;  2P7V B;  2K85 A;  2OD5 A;  3LA3 A;  1V54 H;  1H88 C;  3D5R C;  4BJ5 C;  1VTN C;  3ZQL A;  1XD7 A;  4UB8 C;  5EJC A;  3K4L A;  3DBL B;  4RLF A;  1R9T J;  2A6E F;  5DUK A;  3J81 Z;  3OS0 A;  1T39 A;  1Z1D A;  2YR2 A;  3W2A A;  3ESW B;  2XPW A;  4YII A;  2OUM A;  1B9N A;  4BXU A;  4F91 B;  2GQQ A;  1RRJ A;  3OMY A;  4KA4 A;  2HOS A;  2P4W A;  1ACI A;  4ESB A;  4I01 A;  4BHP A;  3A03 A;  3BR6 A;  2X6O A;  1X4P A;  4UUT A;  5D5W B;  3F6O A;  3BJ6 A;  1FIP A;  4IRH A;  5B1B H;  3GW2 A;  3I55 I;  3L2C A;  1B9M A;  2O8K A;  3E7L A;  3K4B A;  2VXZ A;  1VQ7 I;  1J0R A;  5BPI A;  2A61 A;  4JBA A;  1WCM J;  3M8E A;  4HV6 A;  4CCN A;  1FY7 A;  2P0W A;  3GTP J;  2TRT A;  2E2J J;  4MQV A;  1UHM A;  2IGN A;  3A02 A;  4A3J J;  1TZL A;  3RKY A;  5GAE J;  1DP7 P;  1H8A C;  1GV2 A;  3PSI A;  3IKV A;  5BPD A;  5J4V A;  3QYF A;  1BIB A;  1U5T B;  4II2 A;  1ODD A;  4FX0 A;  1LPQ A;  3G6E I;  5D4R A;  3NAR A;  2CS3 A;  2CO5 A;  2LLK A;  3VB2 A;  1W4M A;  2ZFU A;  2UUZ A;  2MYS A;  4BE1 A;  1ETV A;  4KN7 X;  3G1O A;  3JR9 A;  2ID3 A;  4CCL A;  3S93 A;  2BY2 A;  2YUS A;  1G3W A;  3RPU A;  1WI9 A;  3ML6 A;  3PIO F;  3H36 A;  1JJ6 C;  2DFF A;  4EQQ A;  2R4G A;  4EJO A;  1P4W A;  4LD5 A;  2CW7 A;  4BJT A;  1UCR A;  4HNV A;  2HYF A;  2XRL A;  1X1D A;  1V3F A;  1CGP A;  1F1Z A;  3I58 A;  2HDD A;  3UKG A;  1UZC A;  2NXN B;  1VQ4 I;  3LWF A;  1Z67 A;  2N8G A;  3F6V A;  1K7A A;  3BTC A;  3E6D A;  3IH2 A;  5F1J A;  3GTJ J;  3MCZ A;  5LGU A;  4DQ2 A;  1FIA A;  2I5U A;  4D7N A;  5JFR A;  4BE0 A;  5D4S A;  2DA3 A;  1V5F A;  2K9N A;  4Q48 A;  2UXX A;  2HXO A;  4JOM A;  1ZGW A;  1R36 A;  3FXM A;  3MZ8 A;  3HSR A;  3GWZ A;  2QGU A;  1AOY A;  3FXQ A;  2JRT A;  2W84 A;  3FHN A;  4ZYH A;  2VJ4 A;  1SFK A;  2WY8 Q;  3BCA A;  5GTH C;  3H5N A;  5K5R A;  3GLX A;  4ZDO A;  1MD0 A;  1YOV B;  2ETH A;  2BGC A;  4XRS G;  1GUU A;  1Z7L A;  3JSO A;  3ABL H;  1OCP A;  1T98 A;  4NQW B;  4XRF A;  4M9X A;  4MTD A;  1R58 A;  4I76 A;  2QBY B;  4P96 A;  1F4K A;  1MGT A;  3C7J A;  3TOB A;  4S04 A;  1VZ0 A;  2Z33 A;  2W82 A;  4ESJ A;  2CU7 A;  2W85 A;  1ZR2 A;  4IXA A;  1J2X A;  1Z6R A;  2E1M C;  3ZQQ A;  4EMS A;  3LSJ A;  2ELJ A;  1UFM A;  1IN7 A;  3DCF A;  4BS9 A;  1REP C;  4ON0 A;  1FOX A;  4Q47 A;  2I10 A;  3A1Y A;  5IP9 J;  5EF6 A;  2ZCW A;  2LK2 A;  3GFJ A;  1FEX A;  2FA5 A;  1ONV A;  2BY1 A;  2KZV A;  4FT8 A;  4RAF A;  4DGW B;  2WY7 Q;  3VYS B;  4BL0 B;  4Y7N J;  1UMQ A;  1JT6 A;  4UB6 C;  5LRR A;  1TWG J;  4KT5 C;  5BMZ A;  2JK3 A;  5HS8 A;  3WGI A;  2R3S A;  2I8D A;  1WPK A;  1NG7 A;  1T0F C;  3SEZ A;  2A5W A;  2K3P A;  3L2V A;  2EFW A;  4L9N A;  2PLY A;  4BUP A;  4L9V A;  3AG2 H;  1DU0 A;  2EZK A;  4HA8 A;  2A3S A;  2MC3 A;  3BR0 A;  1U9N A;  2ZBK A;  1BI2 A;  1QZZ A;  5KHD A;  1FBS A;  2DT7 B;  3LST A;  5E1X A;  1I6H J;  1P6R A;  4U7D A;  1UG2 A;  3ULQ B;  3V42 A;  4C2U A;  3R61 A;  2P5K A;  1I3Q J;  2CQX A;  3VOE A;  2JSC A;  1XMX A;  5D5X B;  1FP1 D;  4BE2 A;  2VJI A;  1ZK8 A;  1GVD A;  1ZHF A;  1ZAO A;  2GZW A;  2K5C A;  2LY2 A;  3R4K A;  5D8L B;  1P92 A;  5E8I A;  2LKX A;  2ICW G;  1VQ9 I;  3PSF A;  2Z99 A;  4C30 A;  5D5V B;  3S8P A;  2HU9 A;  2MD0 A;  1HC8 A;  1LDJ A;  4XKB A;  2DYS H;  4FX4 A;  2LTP A;  5ICF A;  2EFP A;  2EIL H;  2DT5 A;  2ME0 A;  3H0G J;  3KP5 A;  4PDK A;  4XN3 A;  2YPR A;  3SQN A;  3VEP A;  5IP7 J;  2ME6 A;  3CO7 C;  1MBH A;  3V8L A;  2LBF B;  2H1K A;  2HZT A;  4JYK A;  1IRX A;  4XOP A;  3LSM A;  4CA0 A;  3K0L A;  1MDM B;  2QM3 A;  2EWN A;  2WB1 A;  2Z3Y A;  2CV1 A;  1RC9 A;  4AID A;  4RGR A;  3MZH A;  1IN5 A;  1X1C A;  2ELH A;  4NQW A;  3FIW A;  4D5C A;  3HHH A;  1LFP A;  1OJL A;  4A5M A;  3E5Q A;  4F7Z A;  5EG0 B;  1MH3 A;  2K9Q A;  3QPL A;  2IA0 A;  2KRC A;  1U5T C;  2JMW A;  3W3C A;  4WXD A;  1ZR4 A;  3DEE A;  3FMR A;  1H9T A;  4AYB A;  4GYI A;  2RRE A;  1OKR A;  3LA7 A;  5K5O A;  1Y8R B;  4CHU A;  5EEG A;  3CCQ I;  5E1W A;  2DMU A;  3ZMU A;  3D5L A;  1J09 A;  1Y39 A;  2Z16 A;  1FTT A;  5HDK A;  4CXF A;  1UB9 A;  2OJE D;  4HZF A;  2DMQ A;  5HLT A;  3DQV C;  9ANT A;  2JA8 J;  2G0E A;  3H1C A;  3P9C A;  3VYR B;  3PJR A;  1P9Q C;  2DOF A;  3C3W A;  4IQJ A;  4MIM A;  1RR8 C;  4BAY A;  1IJW C;  5LEJ A;  3DLL F;  2V1U A;  2EFQ A;  2KLO A;  3RQI A;  1S7E A;  5C4J J;  2V6C A;  3RKX A;  3BDD A;  3IWF A;  4M73 A;  4HBL A;  4N9H A;  1SAU A;  4DZJ A;  5LD2 C;  2WAD A;  2H6C A;  1YFH A;  3CC4 I;  2EPF A;  1OLT A;  4FQG A;  5CLS A;  3TP0 A;  2RVC A;  3RCO A;  4J00 A;  3LSG A;  2DTR A;  2XGD A;  4V2G A;  2R7X A;  3GXO A;  1FOK A;  3ZQI A;  5K5Q A;  5HS7 A;  5F0H A;  1YS6 A;  2JT1 A;  5L3F A;  2UXN A;  2DJI A;  2NVU B;  1V5G A;  3C2B A;  4FHT A;  4JQF A;  1C0W A;  5B66 C;  1YYV A;  2RAE A;  1B8I A;  3P9I A;  4IHT A;  3CC7 I;  2F5D A;  3G2B A;  4I09 A;  2O5R A;  2ID6 A;  2GAU A;  3FXO A;  1SD7 A;  3HBL A;  5JR3 A;  4D1Q A;  3HJE A;  3KX2 A;  1I50 J;  2X1C A;  2JWT A;  2E5N A;  3E1S A;  5DTD A;  1R4M B;  2VQC A;  4DIQ A;  2XC7 A;  4A12 A;  1SAN A;  1FYK A;  3CCV I;  2K9S A;  2JVH A;  2OF7 A;  4M6X A;  3ZOB A;  1S3J A;  1RKT A;  4LG0 B;  1G4D A;  3B73 A;  3HRM A;  2IT0 A;  1MJ9 A;  3HEF A;  3ASN H;  4GRI A;  4BGD A;  2ELK A;  4PJN A;  4JX6 A;  2M3A A;  3BJA A;  3QYE A;  3MVP A;  5DV5 A;  1A6Q A;  3SFI A;  1DDN A;  2MLG A;  3KCC A;  1WH7 A;  2H6B A;  1MBF A;  3TOA A;  3P5J A;  2YU3 A;  3I56 I;  5FLX K;  1FJL A;  2VE8 A;  2QYO A;  1WJ5 A;  2YX7 A;  2HGC A;  4JX4 A;  4DBR A;  2AQE A;  2K4J A;  4QIW N;  4UNO A;  2R7U A;  2DOA A;  3CUQ B;  3CCR I;  4P5O A;  1D8K A;  1F9N A;  1VI0 A;  2EZH A;  4KN4 X;  2L02 A;  3RPU D;  1U8R A;  2M9H A;  4G6T B;  4AM3 A;  1A31 A;  3K1P A;  4ZYA A;  3GEZ A;  4V19 K;  2JUC A;  1LKX A;  1DGW Y;  4Q4Z F;  4D5F A;  4HX4 A;  1WJD A;  5KCM A;  2Z1D A;  1Q1V A;  4ZTJ A;  3QOD A;  3EUK L;  1D8J A;  4W1U A;  4YFK F;  1FZP B;  1V5E A;  3JTH A;  4XSZ F;  3PNV A;  2FF4 A;  4WXH A;  5E17 F;  1EKE A;  3EYY A;  4AWX B;  2L9V A;  3OYD A;  1DUX C;  3IC7 A;  5HOO A;  5FGM A;  3I0T A;  4MNU A;  4EJT A;  1QPM A;  5GAH J;  4PCQ A;  3Q0U A;  2MC4 A;  3NAU A;  3TBI A;  4A3C J;  4DNC A;  5F04 A;  1PUF A;  3ABM H;  5DS9 A;  2EJR A;  2NVY J;  4XRM A;  1QGP A;  2IRF G;  4A2U A;  5IP6 A;  1I39 A;  4PJ0 C;  3CDI A;  2E35 A;  1QPI A;  1XDU A;  2BHZ A;  2FX0 A;  3HHG A;  2OTL I;  5FKL A;  4OMY A;  1XSD A;  4Y4R A;  3NWT A;  4M9Z A;  4EGY A;  1O7F A;  1U6G A;  4M3E A;  2EIJ H;  4B48 A;  5DD8 A;  3ZXS A;  5HLG A;  3BP8 A;  3Q0W A;  1GV5 A;  3K6G A;  1DGR M;  1FMW A;  2QKL B;  3SYT A;  4XLP F;  3PIP F;  5D5U B;  1HKT A;  4PGG A;  2BBY A;  4E6K G;  1BC7 C;  2OV7 A;  1W7P D;  3NRV A;  3HTS B;  3LFU A;  1A6I A;  4U0W A;  3S1Q J;  1BI0 A;  3F8B A;  3MEX A;  4HF0 A;  3RSN A;  2E19 A;  2DMP A;  2ZME C;  4UVC A;  1GT0 C;  3BQZ A;  5IYD J;  2E60 A;  3VDX A;  1SFX A;  2HQA A;  2L2O A;  3CC2 I;  2YX4 A;  2ZB9 A;  3CUQ A;  2LR8 A;  3GUD A;  2W7N A;  1Z3Y A;  2AHQ A;  2PFB A;  1YW8 A;  5IPA A;  5IYC J;  3EUH A;  2QKM B;  4HDV A;  5JHF A;  2EFO A;  2FNA A;  1BI1 A;  1OIS A;  2E1O A;  2FUG 2;  2CW0 F;  3GVA A;  2XAQ A;  2KIQ A;  2DMN A;  3FWE A;  1KGS A;  2E71 A;  2XHK A;  3KP7 A;  3QWL A;  3K4J A;  3CMY A;  2HZD A;  1DP3 A;  3GFM A;  2LSO A;  2IGM A;  2WA0 A;  3GX4 X;  2OA4 A;  1DPR A;  2X4H A;  3HOW J;  1OFC X;  2HDW A;  4II3 A;  3ZQF A;  3ZN0 A;  4XLN F;  3WTU C;  1VQK I;  3QU6 A;  1AA7 A;  3PFY A;  3ROU A;  4ESF A;  1R7J A;  2JZY A;  5H2F C;  2NVT J;  2NS7 A;  1R5I D;  2WBM A;  3RTR A;  3IWZ A;  3EQL F;  4L5I A;  4RB0 A;  4BQQ A;  4BQA A;  4B3X A;  3HOT A;  3G3Z A;  3DKX A;  3K2A A;  1VFC A;  4X6A J;  2C6Y A;  3TW6 A;  2CQN A;  2R5Z B;  2RC4 A;  2BEO A;  1IRG A;  4IOA F;  1IG7 A;  4MQ9 F;  3OYC A;  3HSE A;  1G59 A;  1QNT A;  3ZCO A;  3MKL A;  2QWW A;  1AWC A;  4AIH A;  3DPL C;  4BHB A;  4XQF A;  2JRM A;  2OC6 A;  3FX3 A;  5GAD J;  3WG7 H;  2MSY A;  2RNJ A;  2GOM A;  3CDL A;  2H8R A;  2LKS A;  2HVR A;  1SC7 A;  2PJP A;  2DA6 A;  3DPU A;  4RLQ A;  3S2W A;  2DYR H;  1RIO H;  1LVK A;  3PQK A;  5L3C A;  2E5Z A;  5J1U A;  3FXR A;  4LLG F;  3LAJ A;  2K7L A;  1MMA A;  3CF5 F;  4OWR B;  1MBE A;  1OYI A;  2PJR A;  4CO8 A;  1Z91 A;  4P55 A;  3DFG A;  4HNT A;  4B43 A;  3BTI A;  1BN5 A;  3K10 A;  3BR3 A;  5BS6 A;  2VON A;  1KU3 A;  2XAH A;  3COA C;  1RNL A;  1PUE E;  3HYI A;  3EYI A;  1G3T A;  1TBX A;  4RB1 A;  3FXL A;  5FKK A;  3OOU A;  2EIN H;  1ZGA A;  6PAX A;  2PMU A;  3U2R A;  3MN2 A;  3BZK A;  4Q5S F;  1ON1 A;  2VPR A;  4FIS A;  3ABK H;  3LOC A;  3LL7 A;  2D1H A;  1W0U A;  3DLA A;  1LDK B;  2FD5 A;  4BQO A;  2IGK A;  1ETW A;  4BHC A;  2MW8 A;  4EJV A;  2WAF A;  4IF4 A;  4E70 A;  2M2E A;  2KDZ A;  3WTY C;  4C3I J;  2VT3 A;  1VQO I;  4CYC A;  4A3E J;  3HPH A;  2NS8 A;  1WHU A;  3KZZ A;  2F4I A;  1MMD A;  1EJ9 A;  1P7I A;  3HDD A;  4G7Z F;  3M7G A;  1QHG A;  1UJ8 A;  1JHH A;  1SMT A;  1WFX A;  2GXB A;  1KZH A;  3HTU A;  1HW2 A;  2PI0 A;  2VI6 A;  2CQ7 A;  2LG4 A;  1XS9 A;  1RET A;  3I59 A;  2M5W A;  4JX5 A;  3LNQ A;  1WKM A;  1JKO C;  2M45 A;  4WWC A;  3H5R A;  4G7O F;  3KE2 A;  2LF8 A;  2TDX A;  3DTE A;  5TRD A;  3L2W A;  1D1C A;  2NYX A;  3OSG A;  4EM2 A;  1YI2 I;  2R7T A;  2Q2E B;  3S3N A;  1MNE A;  3S2D J;  2VIX A;  4U87 A;  3JRD A;  4HLX A;  1IN8 A;  2FE3 A;  3CCJ I;  2P7C B;  2H09 A;  1XB4 A;  1CF7 B;  3ZQC A;  2V9K A;  2L4A A;  4X1E A;  1SMY F;  3OYJ A;  5B1A H;  1KU2 A;  2IAI A;  3U21 A;  4A0Y A;  4YFN F;  1D1B A;  2M0M A;  1X2M A;  2IBD A;  4MEX F;  2VOP A;  2BE5 F;  2STW A;  4KJZ A;  2JTV A;  1FSH A;  2OZ6 A;  4G94 A;  5CVR A;  4XR6 A;  2P8T A;  1ZEL A;  2QCO A;  2CWE A;  5KNL A;  4GFB A;  3FM5 A;  3Q9S A;  5JVT A;  1JTX A;  3GTL J;  4HG2 A;  1E3H A;  2L7M P;  2QSH X;  2VQH A;  4RDU A;  1T56 A;  4ZDL A;  1LVA A;  5ICC A;  5A2Q K;  2IVM A;  4G8X A;  3KEO A;  2A05 A;  4DYQ A;  1JKR C;  4TV7 A;  3MMY B;  2ESN A;  4ITV A;  3OY9 A;  3BY6 A;  1Z05 A;  3WTX C;  1RUN A;  4Y17 A;  5EGO A;  1ON2 A;  3OYF A;  1BOB A;  5F6F A;  5IOY A;  2Q1Z B;  4LIU A;  4L9J A;  5FRO A;  1J7K A;  2LF7 A;  4BH9 A;  1K78 B;  4BEH A;  3E6B A;  1XN7 A;  3O2P E;  1XGS A;  2W25 A;  3WOD F;  5LBQ A;  1ETO A;  4D7M A;  4N4N B;  2XAU A;  3OOP A;  1XSV A;  3V7R A;  3U9G A;  1S72 I;  1WH5 A;  4RMN A;  3D1N I;  4HNU A;  2XDV A;  3IH3 A;  3IHU A;  4ZTF A;  2L5Q A;  1M1E B;  5M5W J;  3CUQ C;  4BAC A;  1O3S A;  3TDZ C;  3CP2 A;  3JRI A;  3HRT A;  3EUH C;  3VWB A;  3HG9 A;  2ZFW A;  2ZME A;  2LP0 A;  3JRE A;  1CQT A;  4I6Z A;  2W4S A;  4DW6 A;  1FTZ A;  2DT6 A;  3J7A Y;  1O57 A;  1QZY A;  5IT9 Z;  1D1A A;  5JVG F;  4BNC A;  1R23 A;  2HVQ A;  2Y75 A;  2BXZ A;  3SDG A;  2ZJQ F;  1APL C;  4C3H J;  4RGU A;  3JRB A;  1TC3 C;  3BJO A;  5LHI A;  2ISZ A;  2BZT A;  2VBW A;  1VQP I;  5DM6 F;  1VQL I;  3QQA A;  3BZC A;  5EEH A;  4IHV A;  4IQ4 A;  5LHH A;  2HXI A;  2IXS A;  2VKE A;  3QOE A;  3P7N A;  3SDB A;  4CIC A;  4UUS B;  1MDM A;  4OAY A;  3M8F A;  4XKC A;  2MD5 A;  1ZRF A;  3OL3 A;  4PSX A;  4PGH A;  4B09 A;  2XAG A;  2CV2 A;  1Y1W J;  3ABU A;  2DDB A;  4PK4 A;  2O61 A;  1IDY A;  1OQY A;  4F93 B;  5HOD A;  2Z2S B;  4HST A;  1N75 A;  3OYE A;  4Y13 A;  1B59 A;  1D3Y A;  2Z5U A;  4RM2 A;  2VOD A;  3OYG A;  3CCS I;  1QU3 A;  2JPC A;  4B4C A;  5H6Q A;  3VFZ A;  1OCC H;  3SFZ A;  3HL2 A;  2BW3 A;  2ESH A;  4P1W A;  1V55 H;  3KPH A;  3F72 A;  1XCV A;  2CRG A;  3J7Y J;  5FKM A;  1IRF A;  1KYW A;  1QZE A;  3FK7 A;  1X19 A;  2OBP A;  3VPR A;  2LYC A;  5E20 A;  2HTS A;  2DA7 A;  2DQR A;  3CJT B;  5L3E A;  1R1V A;  4DZP A;  3GTK J;  3FM3 A;  1T38 A;  2HKO A;  2CQK A;  2CUZ A;  5M5Y J;  5J1Y A;  2AXT C;  3ZN1 A;  1ZG1 A;  5ERI A;  1I6X A;  4M74 A;  5E18 F;  3OR1 C;  2X6X A;  2WAE A;  5CYV A;  3SHF A;  4XIC A;  1GVJ A;  2XUB A;  4HW0 A;  1RPW A;  3HB9 A;  2LOO A;  2K86 A;  3FHZ A;  3I9V 2;  5LEK A;  3KYD B;  1SD6 A;  3BPX A;  4MEY F;  5KK1 A;  5FLM J;  3ZMD A;  2Y30 A;  2WV0 A;  4I0B A;  3REO A;  2MFZ A;  2X1D A;  3O8H A;  2GM4 A;  3IL2 A;  2E2I J;  5JI6 A;  3QYB A;  3K4M A;  4BYY A;  4RS8 A;  2F5F A;  4W97 A;  5D8K B;  2Y0M A;  3PNT A;  1B8I B;  3M4O J;  4XL9 A;  3AL0 B;  3ZQ7 A;  1YG2 A;  3RZD J;  1FYM A;  5K7H A;  2ZXJ A;  3WU0 A;  3OWT A;  1H9G A;  4G9Y A;  1YE9 A;  2EFN A;  3QRF F;  2D1V A;  1W7P A;  1OMI A;  1SD5 A;  1SFU A;  3WE2 A;  1K83 J;  1P2F A;  1R1U A;  4C9Y A;  1VQ8 I;  1R5H A;  1SVL A;  2HPM A;  3L2U A;  1I1S A;  2MA3 A;  3T0Y A;  2B63 J;  3HOZ J;  3DEU A;  3W6J B;  3QP6 A;  1BL0 A;  2OU2 A;  3TKY A;  2NAZ A;  1VQ6 I;  1B72 B;  2IPQ X;  4MGR A;  2F5C A;  2ZXW H;  1FOY A;  2GOX B;  4F55 A;  1OCZ H;  2XVC A;  1D5Y A;  4NB5 A;  3K9T A;  2R7S A;  1WRJ A;  4E7S A;  3RKW A;  4CZC A;  2XSD C;  2HVS A;  4A0Z A;  2G9W A;  1MND A;  4KNY A;  4OIR F;  2DI3 A;  4A6E A;  3CMA I;  2BYV E;  2DLL A;  4UVA A;  2VQL A;  3DBH B;  2XGC A;  3A4C A;  2CUF A;  3HOX J;  4LK0 F;  3U1D A;  2MG4 A;  2DPU A;  2Y2Z A;  3JCU C;  2DJN A;  3HGG A;  1STZ A;  2HNH A;  3M9A A;  3RYP A;  3R0J A;  4HYE A;  1FC3 A;  4Y52 J;  4L5J A;  3IUO A;  3G73 A;  3LQQ A;  4NC7 A;  4YFX F;  3AKZ A;  1SAX A;  2X9D A;  2VLA A;  5F0C A;  4EGZ A;  3OIP A;  1YW9 A;  3C2G A;  1T95 A;  2HQ5 A;  2LKP A;  3S17 J;  2F6C A;  2P5V A;  2BY0 A;  3NWS A;  4MO7 A;  3E6C C;  2MGQ A;  5CQG A;  5KVR A;  2XRN A;  1LFB A;  2MBF A;  4CCK A;  3HRU A;  2CFO A;  2IS1 A;  5LHG A;  1R00 A;  2YS9 A;  1BW6 A;  1K79 A;  5L3G A;  2VB6 A;  2L7F P;  2FU4 A;  4UXN A;  2RV8 A;  5IT9 K;  3BR1 A;  5HDG A;  2WAQ N;  2VQG A;  3ASO H;  1YO5 C;  1IXC A;  3J7A O;  1MIJ A;  4KIB A;  4N4O B;  4LK1 F;  1MH4 A;  4PFO A;  4YRV A;  3LSI A;  2EQR A;  3IAM 2;  1ZRE A;  1JE8 A;  1W5S A;  1QO0 D;  1XX5 A;  5DD4 A;  3PQJ A;  4QSH A;  2KFD A;  2HEO A;  3GZN B;  1IO2 A;  4XSX F;  3K70 C;  3CCY A;  4ZH4 F;  4XBF A;  1X1A A;  3H5A A;  2P6T A;  3DWL E;  3I64 A;  1YJ9 I;  2DTZ A;  3Q9V A;  3HGY A;  5IYB J;  4L5E A;  4GCV A;  2HTJ A;  3X2Q H;  4GO1 A;  3A01 A;  4AYB N;  2UWM A;  1U5T A;  3S2H J;  4ZDP A;  1POG A;  4U88 A;  1G3Y A;  1UG0 A;  4IRG A;  3LSP A;  3G1L A;  2PX9 A;  4XLF A;  3MWM A;  4FTH A;  1B72 A;  3S14 J;  1T2K A;  4BDZ A;  1X2N A;  1FMV A;  1HKQ A;  2GLO A;  3ERE D;  4XLH A;  2ZKZ A;  2FBI A;  2XAS A;  5DYM A;  3TQN A;  2VUM J;  4PJL A;  1X58 A;  3AG1 H;  2V4J C;  3CF2 A;  1G3S A;  4IL6 C;  4XLE A;  3WTZ A;  4BEH B;  2MLK A;  1JKP C;  2Q8K A;  2CV0 A;  1F36 A;  4MLO A;  3H3V K;  3T5X A;  1XGN A;  4A3L J;  2QQ9 A;  2R7D A;  1O4X A;  4N9I A;  2CMP A;  2GA1 A;  4EAT A;  5J47 A;  1N78 A;  2PMZ N;  1ETK A;  2FOW A;  1R71 A;  4LG0 A;  2HOT A;  4WF2 A;  1RUO A;  1XCB A;  2EV5 A;  2NOG A;  4XNF A;  1MJA A;  1FT9 A;  1TT0 A;  1DU6 A;  3FIS A;  3F22 A;  4LIV A;  1D0Y A;  5HS9 A;  3LSH A;  3BG3 A;  3KYL A;  1UAA A;  1YIJ I;  3OIO A;  2HQN A;  3BPV A;  3N97 A;  1NH3 A;  1I3A A;  3QPS A;  4B3A A;  2IP2 A;  1YIT I;  4KIT B;  1PYV A;  1H89 C;  3W2W A;  4EEF G;  2VKV A;  3BRO A;  4L9T A;  2QQ8 A;  5CVJ A;  1TW3 A;  2W48 A;  2KMU A;  4HF1 A;  4F3Q A;  3FXK A;  2E7W A;  2EH3 A;  4A69 C;  5FFX A;  2XPV A;  2DK8 A;  1FBU A;  3WG9 A;  3EET A;  5LLQ A;  5JLW A;  1WZ2 A;  2Y9Y A;  3MQ0 A;  3AAF A;  2R5Y B;  2ISY A;  3WTV C;  2XSJ C;  2IS4 A;  1J9I A;  3EPZ A;  3OYK A;  3BG6 A;  3C18 A;  3P9K A;  4HQE A;  2FNP A;  5LFA A;  2G7U A;  4CCJ A;  4M3G A;  2K9M A;  4A6D A;  3F8M A;  3BR2 A;  2QQB A;  5FO5 A;  2M4K A;  1VQM I;  4LMY A;  3KLN A;  1HOM A;  1A5J A;  4UHT A;  2BW3 B;  3OYB A;  4A3G J;  5IOZ A;  2LFB A;  2HDC A;  3F8N A;  1LEA A;  2VL8 A;  5H20 A;  5CVI A;  2V9V A;  3F0C A;  2ACJ A;  1OPC A;  3QP5 A;  2H8W A;  4B8X A;  2EA2 A;  1PUF B;  3IAS 2;  4KIF A;  2VKH A;  3IH4 A;  3VYU B;  3R0A A;  4G6D A;  4IRI A;  2ZME B;  1ITY A;  4M6Y A;  4B1R A;  5FD6 A;  2QQA A;  4C2T A;  5ED4 A;  4IX7 A;  1A35 A;  5K7Z A;  2DO7 A;  1HXD A;  1WGX A;  4EJW A;  2JVG A;  2XKO A;  3E6M A;  2F4O B;  4D9J A;  4XMY A;  2ZJR F;  2R7R A;  4ZYE A;  2DAO A;  2DN0 A;  3L2R A;  3W6V A;  2OQG A;  1YRN B;  3GTO J;  3VSK A;  4AD9 A;  3HUG A;  5DEQ A;  2KIF A;  4IOC F;  3B6C A;  1R4N B;  2STT A;  2HWV A;  5EZH A;  2OQR A;  3GLL A;  4LB5 A;  1Z7U A;  3ISP A;  4AU7 A;  3SXY A;  4J01 A;  3TW7 A;  2ZXI A;  2W00 A;  4RAY A;  3E5X A;  4B47 A;  2IS6 A;  1HA8 A;  4MHG A;  4BXF A;  4CZZ A;  4CUG A;  3DKW A;  4H0E A;  2OCC H;  1MSE C;  3TP3 A;  3WTW C;  5B5E C;  3A2K A;  5DM7 F;  3GFI A;  2WAQ A;  1ORK A;  2YU9 J;  2FJ1 A;  2UZK A;  5EG0 A;  1TW2 A;  5EYR A;  1IGN A;  2Y0S A;  3MKZ A;  2HKX A;  2LMD A;  4Y33 A;  3KFW X;  3LFK A;  1E3O C;  2V9P A;  3IRR A;  3ZQH A;  5CVV A;  1ZG5 A;  2PN6 A;  3EUA A;  3BWG A;  1NK3 P;  2LDU A;  4FE4 A;  3T8R A;  2FSW A;  1XDS A;  4OIO F;  1KU9 A;  3I54 A;  1B1B A;  2NNN A;  1XMA A;  5J3L A;  1I5Z A;  3V8J A;  5TJJ A;  1WJB A;  2E1M B;  2VBX A;  2O9L A;  2KKO A;  1NG6 A;  2Y48 A;  3CCM I;  3GCM A;  1CF7 A;  5HDN A;  2OAZ A;  1W36 C;  1HSJ A;  3RDI A;  1EA3 A;  4YEL A;  3M8J A;  4R8H A;  1JJ8 C;  1BI3 A;  1TWH J;  4HX8 A;  1ULY A;  3WTT C;  1BR1 A;  2F2E A;  4WXC A;  4V2F A;  4G7H F;  1UHW A;  2Y31 A;  2FRH A;  5GAG J;  2CUE A;  2XF6 A;  1KQ0 A;  4LLN A;  3CO6 C;  3HOS A;  3GYH X;  2Z9O A;  1U78 A;  4OIP F;  5FKO A;  1TWF J;  3RZO J;  1HQC A;  3DP7 A;  3Q3S A;  2NS0 A;  4LIT A;  1MMS A;  1YJW I;  1IUF A;  2V6E A;  1FWZ A;  1G8X A;  5E8G A;  2O0Y A;  2X0L A;  3W2V A;  3FMS A;  3H0D A;  3JAM K;  3S32 A;  4HV5 A;  3S3O A;  1Z77 A;  1E17 A;  2A69 F;  3JW4 A;  5EZG A;  3ZMT A;  4XOT A;  3T1B A;  3IKT A;  1KQ8 A;  3OS2 A;  3N4M A;  1H0M A;  4OU0 A;  2DMT A;  4FET A;  4XLA A;  4E7J A;  3C2H A;  5FFZ A;  1VND A;  1RKW A;  4CGZ A;  1LJ9 A;  1WSU A;  2JA7 J;  3GZ6 A;  1UST A;  1XC5 A;  3DBR B;  5F0F A;  5AON A;  5FB2 A;  3A01 B;  2O7O A;  3HM5 A;  5HVQ C;  4WX9 A;  3U1K A;  1GDT A;  1IF1 A;  3S15 J;  4G12 A;  2ECC A;  2VC1 A;  1KQ9 A;  4X0G A;  3JRC A;  1KON A;  2FMY A;  2KIU A;  3TO7 A;  2XF7 A;  3H35 A;  1RES A;  4KYW A;  5BNG A;  2X48 A;  1Y0N A;  3BG9 A;  2VJJ A;  2RDP A;  1WI3 A;  1B6A A;  4FAS D;  2KJC A;  2RN7 A;  2V1X A;  4OOI A;  3CTA A;  3WGG A;  4OIQ F;  4HDU A;  2LBF A;  3BZ6 A;  3DU6 A;  3HXL A;  2XV4 S;  1RI7 A;  2LC2 A;  1WJE A;  3K2Z A;  2KRH A;  1HCR A;  3V7S A;  2QSF X;  4QPO A;  5BOX A;  3FDY A;  2EIM H;  2H1L A;  2KIS A;  3MAJ A;  4E7I A;  4LFU A;  1HLV A;  5AIQ A;  2EK5 A;  3AG4 H;  1KU7 A;  2L7K A;  4UV9 A;  4R79 A;  2FML A;  1ENH A;  4P9F A;  3SEQ A;  3QPH A;  1OCO H;  5D6F A;  1FPQ A;  3CES A;  5FRN A;  1Z21 A;  3Q5F A;  2ZJP F;  2R7Z J;  1MMG A;  2OCE A;  2V26 A;  5J6X A;  2TCT A;  3F8C A;  3KLO A;  2NVQ J;  5J40 A;  2KP6 A;  4E7K A;  2GXA A;  2IA2 A;  2CG4 A;  4O6J A;  4NDL A;  1S7O A;  3PO3 J;  2G7H A;  3HSF A;  5M3M J;  2HR3 A;  1PP7 U;  2COB A;  2K40 A;  4YIF A;  1EF4 A;  3BC8 A;  4ZJZ A;  4HQM A;  1TP4 A;  3TDU C;  1PDN C;  1WJC A;  5CVU A;  3G71 I;  3S1M J;  3OYN A;  2P81 A;  3QPT A;  4GGG A;  1K4T A;  3H92 A;  1SVO A;  1D0Z A;  3I4P A;  3L09 A;  3S1R J;  4HLY A;  3CJR B;  4RAG A;  4I7H A;  1XMK A;  3ZMS A;  1IZ1 A;  2CW8 A;  3BTL A;  5C4X J;  3ZMZ A;  5HLH A;  2NNY A;  1TWA J;  2OZU A;  3SZG A;  2BXY A;  2GIZ A;  1ZRD A;  2DK5 A;  3WU2 C;  2XB5 A;  1UEL B;  1G2H A;  2X6W A;  3GF2 A;  4QWQ A;  2HOE A;  4GDF A;  1NK2 P;  3HOY J;  1SEU A;  5L3D A;  3GO5 A;  4A3I J;  4LGW A;  4F52 A;  2HFH A;  2HI3 A;  3FBI B;  1O3T A;  2PMZ A;  4Z6Y A;  3V7C A;  3SZT A;  1MBJ A;  2LRE A;  3ERM A;  3JAM Z;  4UV8 A;  1IN6 A;  1XSX A;  2LH9 A;  4LG3 A;  3W6K B;  1Y0U A;  2L7Z A;  3CZ6 A;  2QA4 I;  3RJP A;  2JA2 A;  4MTE A;  2QEX I;  5KAF C;  2O8X A;  4YIR X;  2Q2E A;  3EDP A;  1LUJ B;  3BG5 A;  3DF8 A;  1OCT C;  4CCO A;  5L3B A;  1ZG3 A;  2CYY A;  4I98 B;  1R1T A;  4I02 A;  2OTJ I;  3I53 A;  2ZJ2 A;  3OSF A;  2B9S A;  1YRN A;  1YTY A;  3HUG B;  5E3O A;  1TQI A;  3ZGK A;  3H3Z A;  3QU3 A;  4KIS A;  4LB6 B;  2R5Y A;  1MKM A;  1MNM C;  1VQ5 I;  4PJM A;  2ADU A;  5GP9 A;  4ZZL A;  3CME I;  1W0T A;  4ENJ A;  3KP6 A;  2ECB A;  1T0F A;  2XAJ A;  1JXS A;  2NOJ B;  2Y0S N;  1Y1V J;  2IS2 A;  2NRA C;  2EA4 A;  2XGX A;  1S6L A;  4UUS A;  2JN6 A;  4FCY A;  5CPR B;  1S5L C;  2DA2 A;  1USS A;  1MZB A;  3CMM A;  3IV5 A;  2RGV A;  3J81 K;  2QBY A;  1U0J A;  3BR5 A;  3OS1 A;  4EV0 A;  1J5Y A;  1HBX G;  1Q1H A;  4IHS A;  1BW5 A;  3BTJ A;  3KEY A;  1A04 A;  3TMO A;  5DCM B;  1AU7 A;  2L54 A;  5ICE A;  4A3F J;  1ZLJ A;  1N25 A;  2L9R A;  2QF7 A;  1HST A;  1TT5 B;  5F27 A;  5F1R A;  1OR7 A;  3MZY A;  3NEU A;  3FKJ A; 
#chains in the Genus database with same CATH homology
 3NWT A;  4N4O B;  4PFO A;  1QHH D;  4B48 A;  4YRV A;  3LSI A;  3IAM 2;  3ZXS A;  3DU5 A;  2L9N A;  3K6G A;  1DGR M;  1FMW A;  2QKL B;  3SYT A;  2JUG A;  3K70 C;  3K70 D;  1MMN A;  2KDO A;  3H5A A;  1X1A A;  3DWL E;  4E6K G;  3ZRG A;  2KQR A;  2OV7 A;  2UWM A;  3LFU A;  3DKY A;  2R7W A;  4ZDP A;  3RSN A;  1UG0 A;  4XLF A;  4DOZ A;  2E60 A;  3VDX A;  3DTI A;  4PSW A;  4CSW A;  2HQA A;  4BDZ A;  1FMV A;  2L2O A;  4E7L A;  4XOR A;  4XLH A;  2W7N A;  4OAZ A;  1Z3Y A;  2RNG A;  4PJL A;  2QKM B;  2V4J C;  5JHF A;  2FUG 2;  3CF2 A;  4XLE A;  2DXI A;  4BEH B;  2X51 A;  4YEJ A;  3AL0 C;  3K4J A;  2KHM A;  2R7Q A;  2HZD A;  2CV0 A;  1DP3 A;  2X6Y A;  4MLO A;  2VPL A;  3H9Q A;  2IGM A;  2WA0 A;  1GLN A;  4ANJ A;  4II3 A;  2CMP A;  2HDW A;  4EAT A;  1N78 A;  1BR4 A;  3E0J B;  1DQU A;  4IKF A;  1AA7 A;  3PFY A;  4XNF A;  3PNY A;  4XKW A;  4HSR A;  3RQ4 A;  1TT0 A;  2WBM A;  4LIV A;  1D0Y A;  3LSH A;  3RTR A;  3D5R C;  3KYL A;  4BJ5 C;  1UAA A;  4HEA 2;  4BQQ A;  3K4L A;  4B3X A;  3HOT A;  4RLF A;  3OS0 A;  3DKX A;  2IGO A;  4IZZ A;  4KIT B;  1PYV A;  4XM3 A;  3W2W A;  3W2A A;  2OUM A;  4NNJ A;  4F91 B;  2V7F A;  2PJR B;  3OMY A;  2KMU A;  4F3Q A;  3OYC A;  1G59 A;  3ZCO A;  1X4O A;  1X4P A;  3VSL A;  3DPL C;  3ZR8 X;  4DJA A;  4XQF A;  2OC6 A;  2GOM A;  2HVR A;  4RLQ A;  3DPU A;  4PUS A;  2XSJ C;  2IS4 A;  3K4B A;  1LVK A;  1OR7 C;  2VXZ A;  3EPZ A;  3OYK A;  3BG6 A;  1Y6I A;  2E5Z A;  4CCN A;  2P0W A;  5LFA A;  4CCJ A;  1MMA A;  2K9M A;  4OWR B;  3K4N A;  2LRD A;  2PJR A;  2IGN A;  4QPQ A;  4XON A;  2M4K A;  1TZL A;  4HNT A;  4B43 A;  3K10 A;  3PSI A;  3H9G A;  2BW3 B;  3QYF A;  3OYB A;  2VL8 A;  4II2 A;  3HC7 A;  3OOU A;  2CS3 A;  1JI8 A;  3I3L A;  3IP4 B;  2JSP A;  2ZFU A;  2UUZ A;  3OYM A;  2MYS A;  3IAS 2;  3MD2 A;  4BE1 A;  1Y56 A;  2VKH A;  3VYU B;  4H4K C;  4CCL A;  3S93 A;  3LL7 A;  1WJF A;  4E7Z A;  3DLA A;  1LDK B;  4BQO A;  3CJQ B;  2R4G A;  2IGK A;  4C2T A;  4IX7 A;  2WAF A;  3ONQ A;  2CW7 A;  4BJT A;  3HPH A;  2JVG A;  1X1D A;  2CUJ A;  2ZXH A;  2F4I A;  1MMD A;  4D9J A;  4XMY A;  3GBG A;  2R7R A;  1X1B A;  3L2R A;  4BU2 A;  3VSK A;  1YX5 A;  1QHG A;  1WFX A;  2AQF A;  4AU7 A;  2LG4 A;  2W1O A;  4J01 A;  4BE0 A;  1V5F A;  2ZXI A;  2W00 A;  4B47 A;  2IS6 A;  4JOM A;  3H5R A;  1HA8 A;  4BXF A;  4CUG A;  2DCE A;  3DTE A;  5HNF A;  3L2W A;  1D1C A;  3A2K A;  2R7T A;  2WAQ A;  2Q2E B;  3FHN A;  2VJ4 A;  1SFK A;  2WY8 Q;  3S3N A;  3BCA A;  1MNE A;  3H5N A;  2VIX A;  4U87 A;  4ZDO A;  1Z7L A;  3VYT B;  2Y0S A;  3MKZ A;  4Y33 A;  4NQW B;  2V9K A;  3OYJ A;  3EUA A;  3U21 A;  2MAB A;  1VZ0 A;  1D1B A;  2W82 A;  2M0M A;  4CH7 A;  4KJZ A;  2E1M C;  3ZQQ A;  2ELJ A;  1WJB A;  2E1M B;  4XR6 A;  1ZEL A;  1NG6 A;  4BS9 A;  3A1Y A;  1W36 C;  5KNL A;  3DTK A;  4HG2 A;  1EA3 A;  4YEL A;  2KZV A;  3UR3 C;  3M8J A;  2VQH A;  4DGW B;  2WY7 Q;  3VYS B;  4BL0 B;  4ZDL A;  2M7B A;  2UV1 A;  1BR1 A;  3FBN B;  3HKZ A;  2I8D A;  2A6T A;  1MW7 A;  4XKV A;  1NG7 A;  1T0F C;  4PJJ A;  3SEZ A;  2K3P A;  2A5W A;  2XF6 A;  3MMY B;  3TL4 X;  4ITV A;  4BUP A;  3L2V A;  3OY9 A;  2L9S A;  3HOS A;  3OYF A;  3LSK A;  3PUB A;  1BOB A;  5KHD A;  2DT7 B;  2Q1Z B;  3M1C A;  4LIU A;  4LIT A;  5FRO A;  2V6E A;  1G8X A;  4BEH A;  3V42 A;  4C2U A;  1D0X A;  3W2V A;  3H0D A;  3S32 A;  4N4N B;  3S3O A;  2XAU A;  4BE2 A;  2VJI A;  2K5C A;  4Y4R A;  2LY2 A;  3PL8 A;  5HNH A;  4RMN A;  4HNU A;  2XDV A;  3OR2 C;  4XOT A;  3PSF A;  4ZTF A;  2L5Q A;  4C30 A;  4BAC A;  3OS2 A;  3S8P A;  1Z3X A;  2HU9 A;  2MD0 A;  3OIQ A;  3CP2 A;  4XKB A;  4FET A;  3EUH C;  4XLA A;  4DBQ A;  4E7J A;  3C2H A;  4RM3 A;  3DPT A;  4B44 A;  3VWB A;  2XF5 A;  3HPG A;  3HG9 A;  4XN3 A;  2ZSI B;  2X85 A;  3OYI A;  2LBF B;  1IRX A;  4XOP A;  3LSM A;  2W4S A;  4CA0 A;  2DT6 A;  3J7A Y;  1D1A A;  2WB1 A;  5HVQ C;  2CV1 A;  5CKT A;  1K6Y A;  2HVQ A;  1X1C A;  1N77 A;  1LFP A;  4X0G A;  1YX3 A;  1KON A;  2XF7 A;  3H35 A;  4IQ4 A;  4HRI A;  2IXS A;  2CH0 A;  2VJJ A;  2KRC A;  3QOE A;  3SDB A;  4FAS D;  4OAY A;  3W3C A;  4BDY A;  4XKC A;  4ZC3 A;  3DEE A;  3OL3 A;  4AYB A;  4PSX A;  1BR2 A;  2LBF A;  2RRE A;  3DU6 A;  3HXL A;  2CV2 A;  2LC2 A;  1WJE A;  2KRH A;  4PK4 A;  4QPO A;  3D5L A;  3OYE A;  4F93 B;  1J09 A;  2Z2S B;  3FDY A;  1N75 A;  4HST A;  4E7I A;  2Z16 A;  3H9J A;  2R7V A;  2L7K A;  4RM2 A;  1QU3 A;  3OYG A;  3N05 A;  4R79 A;  5HLT A;  3DQV C;  3SEQ A;  3VYR B;  4F92 B;  3PJR A;  3HL2 A;  3CES A;  2BW3 A;  1Z21 A;  4P1W A;  3OYL A;  5FRN A;  1P9Q C;  4IQJ A;  1MMG A;  2V26 A;  2VXD A;  4AVZ A;  2KLO A;  1PJR A;  2KP6 A;  4E7K A;  1ERD A;  5LD2 C;  1SAU A;  1X19 A;  2WAD A;  2LYC A;  2RQQ A;  4NC8 A;  3BC8 A;  4ZJZ A;  1OLT A;  5FRM A;  1W36 D;  2CUZ A;  1WJC A;  3RCO A;  4BQN A;  4J00 A;  3LSG A;  2R7O A;  3L2Q A;  4HPQ A;  3OYN A;  2R7X A;  3OR1 C;  2X6X A;  2WAE A;  3D5S C;  3BG7 A;  2DJI A;  1D0Z A;  1V5G A;  4JQF A;  2BVL A;  3CJR B;  2LOO A;  2BOL A;  3I9V 2;  3G2B A;  3LMM A;  2O5R A;  2CW8 A;  4D1Q A;  3KX2 A;  2MFZ A;  2X1C A;  4E4H A;  2X1D A;  2E5N A;  3QYB A;  3K4M A;  3SZG A;  3E1S A;  3PNT A;  2VQC A;  4DIQ A;  2XC7 A;  4XL9 A;  3AL0 B;  1UEL B;  2JVH A;  2X6W A;  3CP8 A;  2K9L A;  3OWT A;  4GRI A;  2VAS A;  2VJ5 A;  4XLC A;  1YE9 A;  4F52 A;  3FBI B;  4BGD A;  1R6R A;  4PJN A;  2PMZ A;  2M3A A;  2LRE A;  3QYE A;  4C9Y A;  2KPM A;  2LH9 A;  4LG3 A;  3MKW B;  2HPM A;  3L2U A;  3CZ6 A;  2JA2 A;  1WJ5 A;  3F9K A;  3MKY B;  4DBR A;  2AQE A;  2HPI A;  2GOX B;  4F55 A;  3BLY A;  2BVM A;  4CCO A;  2R7U A;  1E0E A;  2DOA A;  3BCB A;  4XN0 A;  4P5O A;  2R7S A;  4E7S A;  4Y3O A;  4CZC A;  2HVS A;  3RPU D;  1MND A;  4G6T B;  4ZYA A;  2VQL A;  3AFH A;  1LKX A;  2KL4 A;  3HUG B;  3S3M A;  3A4C A;  1DGW Y;  5CQE A;  3ZGK A;  4KIS A;  1WJD A;  3OL4 A;  2HNH A;  5KCM A;  2Z1D A;  4PJM A;  4CCM A;  4ZTJ A;  3QOD A;  3EUK L;  3IUO A;  4NUB A;  5TGT A;  1V5E A;  4NC7 A;  3UNG C;  3PNV A;  3AKZ A;  2NOJ B;  2IS2 A;  4E7H A;  2M7A A;  2VLA A;  3OIP A;  5CPR B;  3C2G A;  1T95 A;  3OYD A;  2F6C A;  3K4C A;  4KT6 A;  5HOO A;  1WJA A;  2F5V A;  2VKD A;  3NWS A;  3CMM A;  2V1N A;  5CQG A;  1U0J A;  2MC4 A;  3TBI A;  3OYA A;  4CCK A;  3OS1 A;  3OYH A;  2CFO A;  2LY1 A;  2IS1 A;  2ZSH B;  2X1E A;  2M4G A;  3KEY A;  4BJ6 C;  3TMO A;  2VB6 A;  4U7B A;  1S9H A;  2VQG A;  3K4K A;  4PFP A;  3FKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...