3ZCOA

Crystal structure of s. cerevisiae sir3 c-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
ETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords REGULATORY PROTEIN SIR3
publication title Dimerization of Sir3 Via its C-Terminal Winged Helix Domain is Essential for Yeast Heterochromatin Formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zcoA00
3ZCOA
chains in the Genus database with same CATH superfamily
4G6TB 2IXSA 2VBZA 3WG7H 4KISA 4Q4ZF 3PO2J 2ELJA 1FTZA 4IHYA 1JHHA 3HUGB 3FXLA 1DDNA 3KZZA 1FLIA 3I4PA 4ZTFA 1G59A 1X1AA 3FDYA 1U0JA 4HSRA 4XK4A 2VKDA 2OPTA 1REPC 5ICEA 4D5CA 4ZYHA 3HOWJ 2EFQA 1WJCA 4I99C 1VQOI 2DFIA 4DZJA 4ZDPA 2R7UA 4XN3A 1NHAA 2P5KA 2MG4A 5FGMA 2FBHA 1FSEA 5HS8A 3E97A 3E0JB 3F9KA 3GEZA 4IOCF 1R4NB 2Z5UA 5LBQA 4ABZA 1PJRA 1PUFB 3A01B 1W1WE 4OMZA 4B8XA 3VDXA 1Z0XA 5E3MA 4MEXF 3EUHA 2JRTA 1HKQA 3VODA 1QA6A 1MBGA 1IN7A 1W5SA 2QQ8A 1OFCX 2CUZA 5DYMA 1D0XA 3ZQIA 5HNFA 3CCUI 2NS8A 1PVEA 4Z2YA 3F6VA 2ESHA 3ABUA 3GWZA 2KT0A 2GA1A 3E5XA 4YG2F 4U88A 1R5GA 4BJTA 4OMYA 4B43A 3HEFA 4A5NA 2IGMA 4Q48A 4F7ZA 3GZ5A 3E5UA 1Y39A 2IT0A 4XQFA 1TQMA 2MLGA 5J1RA 2QUFA 3BROA 4DIQA 1M1EB 4L9NA 5EYRA 3I53A 1GHCA 3QQAA 3KLOA 2DLLA 2OBPA 2A6HF 1OISA 4PFPA 3IV5A 5JLWA 5CVUA 1HW2A 4QPQA 4KIGA 2LOOA 1ETXA 3PSFA 1K83J 4AIDA 1P7IA 3BJ6A 4XLCA 2MABA 2ECBA 4XN0A 2QVOA 3TO9A 2FMYA 5CKTA 4EM0B 3GFIA 1QZYA 2JQ7A 1PUEE 2NYXA 1FNNA 1YHQI 2X1DA 2ZMEA 4AWXB 4PJMA 3ULQB 1FZPB 3HGYA 2COBA 1DGRM 2YR2A 1NK3P 2FBIA 3MZYA 2VB6A 4L9TA 3LSMA 5K7FA 2HTJA 1MSFC 3OS2A 3F8MA 1T98A 1TWAJ 4Z6YA 3J80K 1IUYA 4BJ6C 1STZA 1VNDA 2QQBA 4A3EJ 1OKRA 3A0BC 2P7VB 3K1MA 2Q2EA 2ZJ2A 4I76A 2PJPA 1MMDA 1W36D 2E35A 2ME0A 4E6KG 1IRFA 3NARA 5FLXK 2IPQX 3K69A 1ETWA 1E3OC 4M6YA 4JQFA 3H5NA 4LJZF 2CYYA 2K9SA 3K4NA 3MCZA 4HLXA 1UHSA 2XHKA 2GIZA 2HR3A 3BR0A 3G2BA 1XCBA 4WWCA 3HRMA 2DK5A 1HW5A 5F0CA 1ZG1A 5EEAA 4IHWA 4Q5SF 2DA4A 4WCGA 3A4CA 4NQWB 1WRJA 2EBIA 5HDGA 2YU3A 4XOPA 3OV8A 2FU4A 1J5YA 1YE9A 4EJWA 1K4TA 3V8JA 1I27A 2CFXA 3JRAA 2EIMH 2W84A 5LEKA 2VOPA 4HX8A 3CCQI 1G6NA 4R1HA 2QSHX 2HGCA 4KNYA 1S6LA 3QYBA 5DD4A 4WX9A 3K70C 3M4OJ 4HW0A 3GZ6A 1O3TA 5DS9A 1GV5A 2YX7A 4HZFA 2FSWA 4Y33A 4XLNF 3Q0UA 4L0YB 2DN0A 2IAIA 2BYVE 2L9VA 4EMSA 1QZEA 2Z3YA 5BS6A 3WGGA 1U3EM 2PG4A 1W5CC 5FD5A 1JTYA 4XNFA 1QQIA 3HOZJ 4BEHA 3G1OA 5CPRB 2R7WA 2AO9A 3MD2A 4ESJA 1DUXC 2FOKA 2IGOA 1ACIA 3PO3J 2BW3A 3I59A 5D4SA 3QPLA 4BDYA 5LHIA 4ENMA 3MZ8A 2M9HA 4NC6A 2O9LA 2VPLA 1LDJA 2X0LA 2A61A 2F4MB 1RUNA 1I1GA 4NC8A 3SEZA 1D1CA 4P9FA 1A5JA 2TCTA 3C2GA 3M1EA 4BBRJ 1IV8A 3AFHA 1G2HA 5FKKA 3ZQ7A 3D1NI 4J00A 2CH0A 3S1QJ 3KP2A 2NVYJ 5DD8A 3KEQA 3J7ZI 2OU2A 4AYBN 4HX4A 4WXDA 2P0WA 4Y13A 1R9TJ 4D1QA 2F48A 2DMUA 4U0WA 1R4MB 1XCVA 2QF7A 2K9MA 3T5XA 1FOXA 2XAGA 3WU2C 4OIRF 2XF5A 4CYCA 2XROA 4HNTA 2L7MP 4BAYA 4M72A 4UUSA 4ZYAA 4BGDA 1SAXA 2KRCA 2M45A 1LQ1A 2P8TA 3K4BA 5F0HA 3G4SI 3H35A 2VC1A 4IVNA 2DXIA 4R79A 2F5FA 2M8GX 2Z33A 2VODA 1X2MA 1AKHA 2MA3A 4W1UA 4XR6A 1MDMA 2EB7A 4G7ZF 2WAQA 2I10A 2LLKA 4M3DA 4A5MA 1YJNI 3S3MA 1YS7A 5IT3A 3RKQA 4I01A 2EV5A 3BTLA 2M7BA 4P1WA 3JRHA 5K5OA 1TLHB 3HL2A 3MVPA 5KCMA 2EFPA 2VJ4A 2Y31A 1U6GA 1FBUA 3C3WA 1FTTA 4H4KC 1WH5A 4ENKA 2NAZA 3LAJA 4FX0A 2WAEA 1I6HJ 3JTHA 4ZZLA 4QPOA 1MW7A 4KT5C 5D5VB 4PJJA 1S9HA 5GPCA 3GTJJ 4A3DJ 4X0GA 3M9AA 2ECCA 3S1MJ 4DGWB 1BW6A 1L0OC 5DUKA 1KU7A 5L3FA 1A36A 2X1EA 2XV4S 1GT0C 3CJTB 1IJWC 2LRDA 1MNMC 4PJLA 4BY1J 3RJPA 3FKIJ 4FE7A 4OIOF 5LGNA 1PUFA 2HKXA 1J75A 3ZMUA 4DOZA 4N4OB 1IN5A 3OMYA 1HA8A 4E70A 2E71A 4HQEA 1X1DA 2W57A 2LFBA 1OCOH 3J7AO 4KIFA 1TWCJ 2V1DA 2VE9A 2LKXA 2JT1A 4HBLA 2O5RA 5GAHJ 4BS9A 3CJNA 4HOBA 3ZR8X 3W6JB 2D1VA 2LP0A 1YX5A 5B3SH 3ZMVA 4LG3A 5F64A 2COMA 3IWFA 2M87A 2MC3A 1KYWA 2M5WA 2V7FA 4A0YA 2WV1A 2ZBKA 4CSWA 2JWTA 3WE3A 5DCMA 4XM3A 1P2FA 1IRGA 1EH6A 3DTIA 4A0XA 5E17F 1FPQA 2LBFA 3K4MA 3I9V2 4FETA 3T8TA 2PQ8A 4DQ2A 1C0WA 1HCRA 3TW7A 3L00A 4CCJA 4PFOA 3GMEA 4KITB 4AD9A 1YO5C 2FF4A 2L0KA 1Z9CA 3LA7A 2KJBA 1EA3A 2ZJRF 3OIOA 1OCPA 5CYVA 3EYIA 1A6IA 2EFOA 4M73A 3RKYA 3HPGA 2MC4A 1P4XA 3LSIA 2VBWA 3IL2A 4XRFA 2BXYA 1T38A 3K1NA 4ZC3A 3WTZA 3S1NJ 3VB2A 3KETA 2CFOA 4UV8A 1B6AA 1Y8RB 2DFEA 1BC7C 1RETA 2Y0SA 2LF8A 4N9HA 5J4YA 1NTCA 4G9YA 2HDDA 3FMSA 3N05A 4UVAA 3IKVA 1Y0NA 2F5VA 4ZJZA 5BMZA 2E7WA 1H9GA 4WK8F 2WADA 1O3SA 1FY7A 3HTSB 4A6DA 2JN6A 4HV6A 2Z1DA 3M7GA 1OCTC 4HF2A 1LFPA 1R58A 1S7OA 1YW7A 1BOAA 1HW1A 1IN8A 4LD5A 4W97A 5KNLA 4HF0A 3EUAA 1BJAA 2KZGA 4GYIA 3RKWA 5J47A 1SFOJ 3F8CA 3DTEA 3ML6A 5D8KB 5B1AH 2L7ZA 2IJLA 1FBSA 3FX3A 2P6SA 1AA7A 2VJJA 4KIBA 4LOCA 2WA0A 4ITVA 3OYEA 4IOAF 5HNHA 3SJMA 5FFXA 2DT7B 3Q0VA 1Z7LA 2K3FA 3ABKH 2DOEA 2RV8A 4L18B 1J9IA 1HOMA 4BBSJ 4RB3C 3C1DA 4XL9A 1DU0A 2EILH 3TGNA 3LAPA 5ERIA 3U9GA 5D8LB 2PMHA 4G6QA 2CQKA 1H8AC 1LUJB 4L0ZB 2IA1A 3CCRI 4K2EA 5F6FA 1W5TA 2BOLA 5H2FC 1BM9A 1JHFA 2F6CA 1KONA 1WH7A 1LKXA 3BG3A 3ERMA 4BXXJ 1KU9A 3FK7A 2EV0A 4KA4A 1UAAA 4RLQA 1J59A 4PJ0C 1QVUA 4A6EA 5ICGA 5K1YA 1RIOH 4UVBA 1S3JA 4UXNA 4UNOA 2FA5A 2FBKA 1XMAA 2I8DA 3HPHA 4F93B 3ISPA 1YIOA 1ZR4A 5DTDA 4RGXA 4PGGA 1IZ1A 3TP3A 1ETYA 3DV8A 2Z16A 4HA8A 5HLIA 4ZYGA 5E1WA 2B63J 4RLFA 4Y4RA 2E1CA 1R22A 2D2WA 1V5EA 2K86A 3DKXA 3KLNA 2HKOA 2V6CA 3CLOA 3LQRA 4RM3A 2M2EA 2R5ZA 3O8GA 1P6RA 3S2HJ 3F8FA 1MD0A 4NB5A 3DU6A 1BR2A 2AHQA 4EQQA 3I3LA 1VTNC 4S0HB 1FJLA 1BJZA 3H0DA 4AM3A 4NUBA 3SZGA 1X58A 2LYCA 2EJRA 2QEXI 4HF1A 4II2A 4JP0A 4KN4X 3Q0WA 1G8XA 1O3QA 4FQGA 2X6XA 1BC8C 2LC2A 2CWEA 2HPIA 3X2QH 1ZRDA 2FRHA 4QWQA 1XTAA 5IYBJ 3PFYA 4FHTA 4PCQA 2WB1A 3ZXSA 4A12A 1WI3A 1ZLKA 2KPMA 2F5DA 2CQXA 1N75A 2LNBA 2HOAA 4A0ZA 1YX3A 2DA2A 1R5HA 5FFZA 2QBYB 1V4RA 2B0LA 1OMIA 2RQPA 1X1BA 3HRUA 1V3FA 1H0MA 1UB9A 1K79A 2CQ7A 2RC4A 2DT6A 1S5LC 5FKLA 2DFHA 5EGOB 1CF7A 3BLYA 3I54A 5AONA 2E2HJ 4U0VA 2HTSA 1IDYA 3OYGA 4GFBA 2FUG2 4RB2C 3EYYA 2Y75A 5GAGJ 3TW6A 1OCZH 1G3SA 2DA5A 1F5TA 1D0YA 2GWRA 3HM5A 2PMUA 2JVGA 3VPRA 4JX5A 1WJFA 2DTRA 2CG4A 3BT9A 3GTOJ 3DBLB 1VF9A 2DU9A 5F27A 5FKOA 3ABLH 1ODDA 1RKWA 4GDFA 2IA2A 1Q1VA 1YW9A 1WJAA 2E19A 3IAM2 3CUQB 4CCOA 2ICWG 1IF1A 1VQ5I 3JREA 5E1ZB 3CZ6A 3AG4H 4CH7A 2E60A 3MKZA 3FISA 3LSRA 1KGSA 1T56A 2LKSA 1B72A 2ZXWH 2R93J 3DXJF 3ZP5A 2HWVA 2DQLA 3R0JA 2WV0A 3F23A 4TV7A 3OSFA 1HDPA 1FOYA 2BZTA 3HXLA 1ZREA 3H1CA 3EPZA 2HI3A 3DEWA 4E4HA 1W0TA 4HLYA 5DCFA 2H6CA 4L5JA 1P9QC 2FOWA 2QWWA 2WY8Q 5IYDJ 3CMYA 2QENA 3A1YA 3CCVI 1RKTA 3TDUC 2W7NA 4KMFA 3DKWA 2OQRA 3SZTA 2R5YB 4I09A 1YLFA 2MGQA 3QYFA 4HDUA 2XGCA 3CCJI 4A3JJ 4DW6A 1KU2A 2L4AA 3HJEA 4CGZA 4IO9F 2FJ1A 2OC6A 2DQRA 1IN4A 1QHGA 4HSTA 5M3MJ 1HSJA 1U8BA 2V9PA 1YS6A 1CQTA 4RS8A 2FX0A 1BW5A 4A3CJ 3S3OA 4XOTA 3CF5F 1XGOA 3K4KA 4ZYDA 1TT5B 1XDSA 4GO1A 1TW2A 3L2UA 4G7OF 5K5RA 2O3FA 2HOEA 3FWEA 3OYKA 1SVLA 4RAGA 3T8RA 1Z6RA 2H8WA 5A2QK 2E7XA 4G6DA 3FBNB 4BXFA 4BHBA 1TQIA 1LE8A 4II3A 2UXXA 3V7CA 3L9FA 3JW4A 4A3MJ 2XUBA 5BPDA 2ISZA 4Y15A 3V4GA 4BXUA 4LFUA 4YEJA 5H6RA 5GTIC 5EG0B 1J09A 4BHCA 2A68F 2FNAA 2V1XA 1WFXA 2EFNA 3GTGJ 5HLTA 1MKMA 4BQNA 3CC2I 3M07A 5E18F 4XLFA 3VYUB 2NS7A 2HQ5A 2VBYA 4XRMA 1FMWA 3RQIA 3CESA 1YJWI 1TBXA 3JRGA 2K5CA 3HSEA 1EH8A 4B3AA 2MYSA 5IP6A 3QPTA 4IQ4A 3W2AA 5JR3A 3GTLJ 3SEQA 1W4MA 4N9IA 5CQEA 3R6SA 1TW3A 4LIVA 3ZQCA 2E36A 2HVQA 4EGYA 1AU7A 2ZSIB 3BR3A 1UHMA 2F4OB 2M30A 2QA4I 1XGSA 4MO7A 3DLAA 2ZJQF 2DMQA 3BY6A 4IX7A 2ZSHB 3GFMA 3H92A 1U78A 3QAHA 3RTRA 4EV0A 2JJ7A 3IKTA 1FC3A 2DI3A 2A07F 5J6XA 3ECOA 4D0PA 3GUDA 2EPFA 4H0EA 1B8IB 3I56I 2K4JA 3W2VA 4C2TA 2EZIA 2IA0A 2LREA 2ZJPF 2LH9A 1O7FA 1Z6TA 2PLYA 1B9MA 4V2GA 5HLGA 1V55H 1SD4A 5KHDA 3NQOA 3QP5A 4MFDA 3RPUA 3OYJA 1OYIA 4FCYA 4KFCA 3IWZA 4PZJA 1ZR2A 3BTJA 1UG0A 2OV7A 2L9RA 1R5ID 2P5LC 2Z99A 4D9JA 4RAFA 2VQLA 3ZQGA 1NG6A 4CCKA 1LEBA 1T08B 3O6BB 4NC7A 2DMTA 5CVJA 3JTGA 5D5WB 2EWNA 1X4OA 5LLQA 2HOTA 3MKWB 2BHYA 2GXAA 5KK1A 4AIJA 2KKOA 3RI4A 1UELB 4OOIA 2WC2A 3VOEA 3R0AA 4ON0A 4IHVA 3KCCA 2HU9A 5C4XJ 2XSDC 4LITA 3OYIA 3C2BA 1I3QJ 1S29A 4I98B 1Y1VJ 3G1MA 4BDZA 5L3BA 1G3YA 4NNJA 4QLCU 2PJRA 1T2KA 2XAFA 4BU2A 2VQHA 1WJEA 4UY8I 2DYRH 3E5QA 3LA3A 3PQJA 2W25A 2Z9OA 2VJIA 2STTA 3IH3A 4GGGA 3GBGA 2K4BA 3RIRA 1X3ZB 1IAWA 4M74A 3PNYA 2M4GA 4XSZF 5EF6A 1ZRCA 2A69F 2BY2A 1MJ9A 1N78A 3K2AA 1T8IA 1B9NA 2VJ5A 2WAQN 2ZXJA 1WSUA 5B1BH 1BI2A 3JAMZ 3CP8A 1MBJA 4BQOA 2JUCA 3DEEA 1MBFA 2OUMA 4MNUA 4OIPF 2VXZA 1J7KA 4G8XA 2VT3A 3QU6A 4HQMA 4M9SA 3ZMSA 1JKOC 3LNQA 1JGSA 3IC7A 3C7JA 2OA4A 3W6KB 4XKCA 4FT8A 2O0YA 1KQ0A 3A02A 3HSFA 1SMYF 1MIJA 2ME6A 1GVJA 3J7YJ 1MMNA 4BE1A 1IO2A 1U5TB 2VT2A 1W7PB 3KYCB 1JKRC 3SXYA 2NOGA 5F0FA 3U2RA 1T0FC 3CCEI 2Q0OA 1QBJA 5J4VA 3A03A 4XLAA 5FO5A 2DFFA 2FNPA 3TBIA 4BJ5C 3GXOA 4JK1X 1F1ZA 1H9TA 3ZOBA 1QRYA 2ISYA 3GTPJ 2UZKA 5K5QA 4RMNA 5BNGA 2R7DA 3RZOJ 2X6OA 1JGGA 1GLNA 2JA8J 3QU3A 1ON1A 3SQNA 2KISA 1ZRFA 2R0QC 5FJ8J 2ZNYA 4YIIA 3CCMI 4ZZDA 4OIQF 3MN2A 1F9NA 1J2XA 2EA2A 2DTZA 1K4SA 2V6EA 4A3BJ 3KP4A 3U1DA 2MH9A 2KIUA 2RREA 2M8EA 3RKXA 1X2NA 2DAOA 1X4PA 2GIVA 3DPUA 2CV1A 4U87A 2HDWA 4FISA 1R7JA 4ESFA 2FQ3A 4B44A 1ENHA 2H8RA 3BPXA 5E79C 2XASA 3S16J 2HS5A 4OU0A 1FT9A 2NNNA 4M6XA 3H9QA 5CJ9A 5M5YJ 2GM4A 1N25A 4BH9A 2RVCA 2M7AA 3GFJA 4IRHA 2K27A 4I02A 3U1KA 3S17J 2CO5A 4A3FJ 1VFCA 5C44J 1LEAA 1MNEA 1FSHA 4OAZA 1F36A 3AG1H 3M1CA 2R7TA 1U5TC 2UV1A 1I1SA 3OR1C 1RNLA 2KZVA 1XGNA 2ZCWA 1TWHJ 3KFWX 2QSGX 1Z3XA 3BDDA 2ESNA 1MBHA 1VQNI 3LSTA 3CJQB 4LMYA 4LG0A 2W48A 5EEHA 2X1CA 3BR5A 1WJDA 5LD2C 1MJAA 5J1UA 5BOXA 2KIQA 2DO7A 1YIJI 2BHZA 2Y0SN 5TJJA 1IRXA 2JMWA 2RN7A 3UR3C 3V8KA 1JXSA 4OWRB 1QNTA 3KP6A 5L3EA 1R1UA 5HS7A 2V26A 3R4KA 1NK2P 2H1LA 3BJAA 3OYMA 1XS9A 1SMTA 3HBLA 4C3IJ 2HYGD 1ZGAA 3HUGA 4AIHA 2JA2A 1ZELA 2L9SA 4RGUA 3WGIA 1BI1A 3K6GA 4F3QA 4AIKA 3GLXA 3RPUD 4A3KJ 1YITI 4GXOA 1HC8A 4HDVA 1R6RA 3KX2A 2KJCA 1RR8C 4YRVA 5E3NA 3EDPA 4I0BA 1L3LA 1USTA 5CVRA 6PAXA 3JRBA 2DDAA 4OINF 3CUOA 3CMEI 1YYVA 5DEQA 1GVDA 3AG3H 1YTYA 1XD7A 3VEPA 1APLC 2E5ZA 2PFBA 4RAYA 2ZKZA 3H3UA 4B3XA 4GRIA 1QVTA 2KIMA 3A01A 1FOKA 2MH2A 2FEZA 4L9VA 4XRSG 1R71A 2B7EA 3CLQA 3CMMA 5IOZA 1MMAA 1SD6A 2HZDA 4I0AA 3BZKA 1NH3A 1XN7A 2RKHA 1WI9A 3K4CA 3PM1A 3HTUA 3ASNH 5JVTA 3PIPF 1BL0A 1EF4A 1FMVA 2W85A 3KP3A 2EFWA 1BR1A 3CDLA 2G7HA 5FLVA 4BHPA 1KU3A 3QPSA 3FMQA 4UUTA 1K6OA 4BYYA 4CICA 2UWMA 2ELHA 4EM2A 5EDNA 2BY3A 4AC0A 3ECHA 1N77A 3CC7I 1F43A 1FIAA 1MGTA 3K4JA 3ABMH 2E5NA 3S3NA 2Y9YA 3JAMK 3TOBA 3LOCA 5LEJA 4AUXA 1FEXA 3PL8A 5D6FA 4ASNA 3WU1B 2ZXIA 3H9JA 4PK4A 3J81Z 3HKZA 2E1NA 5L3CA 1T0FA 1D3YA 2JPBA 2M4KA 3DWLE 3ERED 1K78B 2YUSA 4X1EA 1HKSA 1HSTA 1OPCA 2XPUA 4HRIA 4HPQA 3LSJA 2LY9A 2RDPA 3SDGA 5LHGA 3BZ6A 1RUOA 2VC0A 3KPHA 4EM1A 3DBHB 1YOVB 4LK1F 3W2WA 1IN6A 3REOA 1YI2I 4UVCA 2Q1ZB 2X6YA 4LLGF 2WB1N 4S04A 2NVTJ 3LSPA 4ENJA 3B6AA 2HEOA 3FBIB 4P96A 1Y8QB 2HQRA 2XDVA 2JPCA 2CQQA 2Y69H 2PMZA 3LFUA 1I5ZA 2ETHA 2R4GA 1EH7A 3ZMZA 2DBBA 3K2ZA 3OS1A 4E7SA 5E20A 2HOSA 1GV2A 2H94A 4IF4A 2DA3A 2HXIA 2CQNA 2R7SA 1O57A 2IP2A 2IBDA 1Y0UA 3ELKA 2VL8A 1VQ6I 1B1BA 3LL7A 3I58A 2XRNA 3M8JA 4IXAA 3MKYB 1Y1WJ 2HZTA 3G3ZA 3IP4B 4DJAA 1H89C 3E7LA 3H9GA 4A2UA 4D7NA 4I7HA 2R7RA 2HQNA 2K40A 4NDLA 4A93J 3H0GJ 1JUMA 2NXNB 3OYBA 4NQWA 2PI0A 4V19K 2JUGA 3DPTA 3RYRA 1U5TA 4EJTA 1W7PA 2VBXA 5CQGA 1YRNB 2O03A 2K3PA 2B9SA 1DQUA 2PN6A 4ESBA 1T6SA 2XSJC 3WU0A 3K0LA 4BE2A 4UB8C 4EATA 5DM6F 2OCCH 4BE0A 1EJ9A 3HDDA 1RRJA 3KYDB 3RYPA 4F91B 1PYVA 1TC3C 1A31A 3KEYA 1UG2A 4EVIA 3RCOA 1WWXA 4IZZA 4E7ZA 3I4NJ 3L09A 5D5XB 1IUFA 4RB0A 4AU7A 1IXSB 2VASA 2DA6A 2HVSA 1TT0A 1QPIA 2FMLA 2LTPA 4E7LA 4E7JA 3HRTA 1BIAA 3LQQA 4EGZA 2G7UA 3M8FA 3MZHA 4C3JJ 5ILSA 4DYQA 3G1LA 3W3CA 3IRQA 1ERDA 1FOWA 1TWFJ 2K85A 5CLSA 2Y30A 4PUSA 1ZG5A 3VYRB 2ZXHA 2DW4A 3M8EA 2NVUB 4D7MA 5FRMA 3HOXJ 2W00A 1LPQA 1R49A 2OF7A 3VSKA 3TO6A 3FMRA 2IVMA 5J8CA 2DJIA 3JRIA 2HPMA 1K7AA 1HXDA 2M0CA 3RDIA 4B1RA 1SANA 3JRDA 1S7EA 2QLZA 4YIFA 1OLTA 2Y0MA 2CRGA 1JT0A 1R36A 5L3GA 4XKBA 4AVPA 3CCSI 5GP9A 5D4RA 2CV2A 2ZMEB 2BV6A 2MBFA 3L2RA 1ZARA 4L9JA 4XLEA 3F6OA 3EUHC 2KHMA 2MLKA 2O8XA 2V1NA 3E1SA 3O8HA 1RPWA 4JBAA 1XMXA 2VKVA 2VQGA 4F52A 4MQ9F 4KN7X 4IRGA 1V54H 5B66C 3BG6A 2OZUA 5HDKA 2VIXA 2X4HA 1EV7A 1IV6A 2Q2EB 2CJJA 2O7OA 5AIPA 2WBMA 3JCUC 1A6QA 1AWCA 2LY2A 3P5JA 2M34A 3CF2A 2GBYA 4HYEA 3V8LA 3GTKJ 4IHTA 4U7DA 3AAFA 1RC9A 2JTVA 3I71A 5E8GA 1ZQ3P 2A5WA 3FIWA 2DJNA 2DMPA 1D8JA 1LNWA 3IAS2 2ZB9A 2WTEA 1O3RA 1O4XA 2MSYA 1BA5A 4Q47A 4BQAA 2ADUA 2R7OA 3J81K 2NRAC 4DYCA 4E7KA 1KYZA 2X6WA 3DEUA 3GCMA 3T1BA 2BEOA 2GXBA 1BR4A 2F4IA 3GW2A 2GZWA 4R8HA 1A04A 5IP7J 3HIFA 2XC7A 4HNVA 4LGWA 1B4AA 1GDTA 1R1TA 4BACA 5JVGF 3KYLA 5LGUA 3E6BA 3A0HC 3GYHX 5F1JA 2F2EA 3JRCA 1IRZA 3HOSA 2EIKH 2Q8KA 3BQYA 1Y6IA 3D5LA 5HVQC 1SFEA 4P9UA 1UCRA 2L01A 1DU6A 2RQQA 2ZMEC 4WXCA 3QODA 4IPAA 3L1PA 3K70D 5ILVA 3BG5A 2O61A 1KZHA 3V7RA 1JJ6C 2DA1A 1Z1DA 2YX4A 1WPKA 1X19A 3V42A 5ILUA 4CCNA 3SHFA 3HOVJ 5CVIA 2MD0A 1ETQA 4M71A 5LFAA 1ULYA 9ANTA 1X3WB 2KMUA 3A2KA 2RGVA 2E1MB 4HEA2 3AKZA 4BEHB 3BCAA 4P55A 5JFRA 3OYHA 2XF6A 2L54A 3MWMA 4KYWA 1ZK8A 4A3LJ 2BW3B 2XAJA 3WTVC 3ZPLA 2LY1A 4FE4A 1P7JA 2DODA 3GO5A 1ZGJA 1OQYA 2IGKA 2DYSH 3H5AA 5E1XA 2AXLA 3CO6C 3OYDA 2OZ6A 1BI0A 3BPVA 2EIJH 2DMNA 3F3XA 2EZHA 2TRTA 2KRFA 2XF7A 3SYTA 3NRVA 3CUQC 4NHJA 2JRMA 2W24A 2LVSA 4IQJA 4HAMA 1SEUA 3P9KA 3K4LA 3CCLI 4CYCB 4UUSB 1FYMA 3OS0A 2X85A 4CCLA 2X48A 1SFKA 1TNTA 3JR9A 4CYDA 2STWA 4CZZA 3Q9VA 1KQ9A 4YFNF 3SDBA 5TGTA 1VQPI 2YS9A 5GADJ 3M3YJ 1AKHB 1JUSA 2QQ9A 3CJRB 2QZ8A 4RGRA 4F92B 5BQTA 3L2WA 1P4AA 2KDZA 2IRFG 1MDMB 1D5VA 1ZTRA 4E7IA 5ICCA 4M9XA 1Z3YA 2CUFA 3KZIC 1R1VA 3TL4X 3CP2A 3ZQFA 3ASOH 3PFIA 5HOOA 4M3EA 1YW8A 3PNVA 2EQRA 2R7XA 1F4KA 1XGMA 2QCOA 3ZGKA 3CO7C 4ZDOA 4DBRA 3QOPA 3W6VA 2EH3A 1UZCA 3E6CC 2DOAA 2CMPA 2E1MC 1FYKA 2OCEA 3OIPA 5IT9Z 3OOUA 2X51A 2V9KA 3H3VK 2BE5F 2NOJB 4M6VA 1FWZA 5CVVA 1OCRH 2CW8A 3EETA 2V4JC 2D45A 1E0EA 4L5IA 1IXRC 2IS6A 1MMSA 1YRNA 4D5FA 4G12A 2XGDA 3NAUA 3WHBA 4E7HA 3P9IA 2GLOA 3N4MA 4CCMA 5DM7F 3DU5A 1GXPA 1P92A 4B09A 3FXKA 3OSGA 3R60A 1VQ4I 1JT6A 1Z67A 3OYLA 3DF8A 1SAUA 3GZNB 3K7AJ 1ZN2A 3LSKA 3WTYC 1HLVA 2JK3A 1Y56A 1P4WA 4C9YA 3HHGA 4QTRA 1YG2A 5IP9J 1CGPA 4U0YA 4IHSA 4CDGA 2HFHA 4JYKA 1IC8A 3D5RC 1ZG3A 2BGCA 4C2UA 1DGWY 4L5EA 1LDKB 4GCVA 3HC7A 2IS4A 4C2MJ 3CDHA 3OYFA 2OQGA 5DCMB 2JA6J 2KDOA 3KZYA 4XSXF 3FM5A 3H3ZA 2LBFB 5LRRA 1PDNC 5GTHC 2CGPA 3SFZA 5IOYA 1G4DA 1E2XA 4XIDA 3CCYA 5FRNA 3P7NA 4IJAA 3DPLC 3WTXC 3H5RA 4XLHA 5DV5A 1LB2A 4MGRA 2BY0A 3WTWC 2FQ4A 3HHHA 1XSDA 2AS5F 4P5OA 3PUFA 2J5PA 1U2WA 2A6EF 4WXHA 1FYLA 2LG4A 4QSHA 3GTMJ 3O2PE 4S05A 2EV6A 3FM3A 4Y3OA 5DDGA 3Q3SA 4F55A 5IPAA 3TQNA 3DFGA 1WGXA 2JA7J 2QBYA 1J0RA 2Y48A 1FP2A 3KP5A 3FF5A 1VQ8I 1X3UA 3ONQA 1GUUA 1USSA 3FKJA 3HB9A 5FROA 5IY5H 3ZQLA 3CC4I 2KLOA 3K10A 4KJZA 3UNGC 2DK8A 4PJNA 4DBQA 5E3OA 5EGOA 2E1OA 2X9DA 2XAQA 4CZCA 3I55I 2C6YA 1QHHD 5LGTA 4Y7NJ 3OOPA 3WHCA 4A69C 2GOXB 3LA2A 1LVAA 4ANJA 1XC5A 3ZQHA 2VKEA 5FLMJ 2D5VA 3TO7A 1QGPA 3OY9A 1JE8A 2NVQJ 3GF2A 3I64A 3C18A 4JX6A 1ZGWA 1ORKA 1V5FA 2IS2A 4BL0B 1YQAA 3OR2C 2L02A 2KIFA 4A3IJ 2BBYA 2QKMB 3G73A 1MBEA 2XB5A 4UB6C 2G0EA 3F21A 2PBIA 2LF7A 3CUQA 2R92J 4XKWA 3OYNA 2LK2A 2A3SA 2D1HA 2EZLA 1UFMA 2KFDA 3BJOA 3DCFA 3HGGA 2QYOA 5IYCJ 3Q5FA 1T39A 5ED4A 1EKEA 3OL4A 5F08A 3E6MA 2N8GA 3COAC 4XONA 1T33A 1ITYA 2JA5J 4JOMA 1WKMA 2BVLA 2W4SA 4RBOA 5D5UB 2L5QA 2XB0X 3LWFA 2KL4A 3FHNA 5LRSA 1RESA 2K9LA 3QPHA 4MTEA 4XBFA 1R00A 2VXDA 3PUBA 1DP7P 1BBYA 1QZZA 3U21A 3S14J 2EA4A 4OAYA 2VLAA 3TEDA 3B02A 1ONVA 2R5YA 2IS1A 3PSIA 2Y2ZA 1B59A 1S7AA 1LVKA 4XKVA 4XRSA 2DPUA 3HOYJ 3HKZN 5HLHA 1MSEC 2ID6A 4LLLA 3D0SA 3QOEA 1Z91A 2XGXA 2R5ZB 1U8RA 3VYSB 1NG7A 2L7FP 2O8KA 5AIQA 2Z2SB 3KE2A 3ZMDA 5IT9K 2KRHA 4Y52J 2W1OA 1MH4A 3N97A 5GAEJ 3FXRA 3K9TA 1YJ9I 2MD5A 1D1AA 1DPRA 5HS9A 2RNGA 3BR6A 4RA2A 1OCCH 3L2CA 1O7LA 3ZCOA 2BY1A 4IEJA 2BVMA 3BP8A 5K7ZA 5GPAA 1XPXA 4B48A 4CXFA 2PMZN 2FE3A 3QP6A 3FHZA 1E3PA 3H36A 3LMMA 1AHDP 2OAZA 2ZFUA 4LK0F 2IW5A 1JKPC 4QIWN 2IGNA 2F5EA 3GX4X 5FKNA 1BOBA 1ZLJA 3F8NA 4M9ZA 2EZKA 2E2IJ 1HKTA 2QQAA 4BQQA 1SC7A 2LDUA 5EG0A 2KQRA 4PGHA 3CDIA 3BOQA 1E17A 3NWTA 2E2JJ 2A6TA 4ZDLA 1W0UA 3DBRB 1CF7B 1D1BA 2V9VA 2UUZA 4YFXF 1OYYA 1OR7C 2LR8A 5M5XJ 3FXQA 4FX4A 2XPVA 4V2FA 1D5YA 2ZO4A 3DQVC 2L7KA 4MTDA 3PIOF 4CHUA 3OYAA 5KAIC 4ZTJA 2RAEA 2HYFA 2AQFA 3ZQQA 3JRFA 3EQLF 1QO0D 3S32A 5JHFA 4AVZA 3HOTA 2LSOA 4BY7J 2P7CB 2XRLA 2O6GE 2H27A 2GOMA 2DPDA 1VI0A 1Z05A 1R23A 3CQZJ 5ICFA 2R7FA 3DP7A 2PEXA 1ZH5A 2EK5A 4M3BA 4DZPA 2VI6A 4A3GJ 1B8IA 3QWLA 1WJBA 3TKYA 3VFZA 1MBKA 2VE8A 1V5GA 3BR1A 1B72B 5FD6A 1AOYA 1LFUP 1XMKA 1UJ8A 2WWYA 1U9NA 2JSCA 3I0TA 2K9NA 2GXGA 2R7QA 3GTQJ 3DKYA 4X6AJ 5E8IA 4UUVA 1DPUA 3LFKA 3I4MJ 4HV5A 1HDDC 2NVXJ 2CV0A 3S15J 1JUPA 3SZPA 1X1PA 4HX7A 3BTIA 4KMUX 1S72I 3DLLF 2HYJA 5J40A 4I6ZA 2R7ZJ 1JI8A 1KQ8A 5KVRA 1SD5A 5LHHA 2CW0F 2P81A 1MJBA 3QYEA 4BKXA 3S93A 3CD6I 5JLXA 1XB4A 3E3VA 3FXOA 4ZYEA 4MLOA 3BG9A 4FASD 2L3DA 1VQKI 1MH3A 2AXTC 2VQCA 4C30A 3RPQA 1FIPA 4RM2A 4J19A 3ABTA 1VQ7I 3PJRA 1HQCA 4AYBA 2A5YB 4GYGA 2OTJI 2DA7A 1XG1A 4KICA 5EEGA 3HSRA 5HDNA 2M1BA 4PSXA 1SD7A 2XPWA 1WHUA 2A05A 1H88C 1SFXA 1FBQA 1WVRA 2AQEA 3WTTC 5BPIA 4LLNA 2JZYA 4KDPA 2QGUA 3B73A 1Q1HA 2VONA 3BTCA 3SFIA 1Z21A 3L7WA 3JSPA 2XIGA 4PSWA 1W36C 4MFEA 2LMDA 3KIOA 4MIMA 1LE8B 1FP1D 1HBXG 1X1CA 5FB2A 2EINH 3HOUJ 2P6TA 3NWSA 4RGSA 3BQZA 3CTAA 3T0YA 3OWTA 3TMOA 5J1YA 1XX5A 2TDXA 3OIQA 5JHUA 4ZH4F 2H09A 4RAZA 3QRFF 1OYWA 4MQVA 4N4NB 2ELKA 1LJ9A 1U9OA 3AG2H 2GA2A 3RSNA 1UMQA 1BI3A 3IH2A 3E6DA 4EJOA 3PQKA 3NEUA 3HZJA 2F5CA 3S2WA 5J3LA 4RB1A 1ZYRF 5D6EA 1SVMA 2J5OA 2QM3A 3HRSA 1IG7A 3FXJA 3ROUA 3JSOA 4O6JA 2XAHA 2R3SA 3PNTA 1D8KA 1PP8F 1ETVA 1S8NA 2IEKA 4YFKF 4J01A 3KEOA 3RZDJ 1TQPA 3MAJA 2OJED 3G6EI 5A2QZ 2V79A 4XORA 4U7BA 3D5SC 2M3AA 1JKQC 4LB5A 2NS0A 4O3MA 1ON2A 4G94A 3WTSC 2H1KA 4M3GA 3TP0A 1A35A 1FX7A 3I5UA 2NNYA 1D0ZA 2RNJA 4XMYA 5C3EJ 1TTYA 1VQ9I 1JJ8C 4B4CA 4RDUA 4M3FA 1OR7A 3BG7A 3DTKA 2PX9A 3RQ4A 1Z7UA 5EZHA 1ETKA 2YSRA 3GVAA 4BUPA 1VQLI 2K7LA 5B5EC 3Q9SA 3IRRA 1GXQA 4N0BA 2V1UA 1XSVA 4IRIA 1XSXA 4G7HF 3WE2A 1E3HA 2ZNZA 3ZN0A 3P9CA 2HQAA 1ETOA 2CUEA 1TNSA 1OJLA 1QPMA 2P5VA 3L2VA 2K9QA 2OTLI 2K02A 2VKHA 3F0CA 2GAUA 2Y9ZA 2ACJA 3WG9A 3C2HA 2CW7A 3VWBA 2OD5A 4C3HJ 2HVRA 1IGNA 2PJRB 4MEYF 1LFBA 4BNCA 3AL0B 3VYTB 3TOAA 2XKOA 3S8PA 3WTUC 4LB6B 3IHUA 1TP4A 1I3AA 1SVOA 2HXOA 2W82A 5E3LA 4DNCA 2HNHA 3ZRGA 1IDZA 3S1RJ 3WODF 1DP3A 1POGA 2VOOA 2FD5A 4CUGA 4IKFA 1MMGA 3HYIA 3VSLA 3FXUA 5HODA 2WY7Q 3J7AY 1KA8A 1ZAOA 2JVHA 3L2QA 2DCEA 2MFZA 2VPRA 2CS3A 3O3KA 2ID3A 5L3DA 4MHGA 3MMYB 3ZN1A 5TISC 3ZMTA 2HDCA 3IUOA 2ZFWA 1G3WA 3WGHA 4O5VA 4KUMA 3F22A 4IL6C 3OYCA 1Z77A 5KAFC 1RR7A 1T95A 1RI7A 3FXMA 5FKMA 5C4JJ 2DOFA 4CA0A 3EUKL 3LSHA 2I5UA 4UHTA 4DYRA 1IXCA 3ESWB 1UHWA 5DUIA 3V7SA 2UXNA 3R61A 5EJCA 4HNUA 1K6YA 4UV9A 1IW7F 4EJUA 2JSPA 2DDBA 3S2DJ 3GFLA 4FTHA 2KP6A 2L9NA 3TDZC 4XLPF 1HF0A 1I50J 2WAFA 4I2OA 2H6BA 5M3FJ 1TL8A 5H20A 3GLLA 4IHXA 1I39A 3J80Z 3UKGA 3FZVA 4ENNA 2VN2A 3F8BA 3MKLA 2XKPA 4B47A 1SFUA 2LKPA 4NBQA 3AL0C 2L4MA 5F1RA 3G71I 1JTXA 2GQQA 3BCBA 1LDDA 2E34A 4CO8A 3BWGA 5FLXZ 5J8FA 2YPRA 4JX4A 1TWGJ 5H6QA 2XGEA 3IH4A 4Y17A 1RZ4A 2CU7A 3I59B 2XAUA 5TRDA 2BXZA 5M5WJ 2QKLB 1QU3A 1WJ5A 4LIUA 4WF2A 3HG9A 1ZKGA 3B6CA 1BIBA 5K7HA 5F04A 2LD5A 1PP7U 2L2OA 1ZHFA 2G9WA 1K78A 1XDUA 2VUMJ 2DT5A 4ETSA 3MQ0A 5EZGA 3MFKA 2CSOA 3LSGA 1WQ2A 5JI6A 3BR2A 1MNDA 2QSFX 1W7PD 4YELA 3CMAI 1WCMJ 4HG2A 1YFHA 4EEFG 3OL3A 1TZLA 1VQMI 1MZBA 3F72A 1VZ0A 1BN5A 3MEXA 4LG0B 2FXAA 2YU9J 2P4WA 1G3TA 2XVCA 2R7VA 4KT6A 4XICA 3K1PA 4YIRX 3BZCA 3KP7A 2MW8A 3BC8A 1I6XA 3FK6A 4EJVA 1WZ2A 2M0MA 2ZC2A 4PDKA 2CUJA 1K61A
chains in the Genus database with same CATH topology
4G6TB 4NUBA 2IXSA 3SZGA 4KISA 2LYCA 2ELJA 1N77A 4XKWA 3K4JA 4II2A 3OYNA 2E5NA 3HUGB 3S3NA 1G8XA 2X6XA 4ZTFA 1G59A 1X1AA 2LC2A 1U0JA 2HPIA 3FDYA 4HSRA 3PL8A 3PFYA 2VKDA 2WB1A 3OL4A 3ZXSA 2ZXIA 4XONA 1WJCA 2KPMA 3H9JA 4PK4A 4JOMA 1N75A 3HKZA 4ZDPA 1YX3A 2BVLA 2M4KA 2W4SA 3DWLE 4XN3A 2R7UA 2L5QA 3E0JB 3F9KA 2KL4A 4HPQA 4HRIA 3FHNA 1X1BA 2K9LA 2VXDA 1PJRA 3PUBA 2DT6A 3W2WA 3BLYA 3VDXA 3U21A 3OYGA 4OAYA 2VLAA 2FUG2 2Q1ZB 2X6YA 2IS1A 2CUZA 3PSIA 5HNFA 1D0XA 4XKVA 1LVKA 1D0YA 3FBIB 2XDVA 2JVGA 2PMZA 3LFUA 2R4GA 3QOEA 1WJFA 3VYSB 1NG7A 4BJTA 3OS1A 4B43A 2Z2SB 2KRHA 4E7SA 2IGMA 2W1OA 1WJAA 3IAM2 4CCOA 2R7SA 1D1AA 2RNGA 4XQFA 2VL8A 3CZ6A 3ZCOA 4CH7A 2E60A 4DIQA 3MKZA 2BVMA 3LL7A 3M8JA 3MKYB 3IP4B 4DJAA 4PFPA 3H9GA 4B48A 3LMMA 2R7RA 2ZFUA 4QPQA 2LOOA 2IGNA 3OYBA 3PSFA 1BOBA 2JUGA 3DPTA 4XLCA 2MABA 5CQGA 4BQQA 3HXLA 2K3PA 4XN0A 5CKTA 1DQUA 2KQRA 3EPZA 4E4HA 1P9QC 2WY8Q 3NWTA 2A6TA 4ZDLA 3A1YA 2XSJC 1D1BA 2X1DA 2UUZA 4BE2A 4EATA 4BE0A 4PJMA 2W7NA 1OR7C 4F91B 1PYVA 3KEYA 1DGRM 3QYFA 3DQVC 2L7KA 2VB6A 3RCOA 3LSMA 3OYAA 4IZZA 4E7ZA 4ZTJA 3OS2A 2AQFA 3ZQQA 4BJ6C 3S32A 2OC6A 4AU7A 5JHFA 4AVZA 2VASA 3HOTA 2HVSA 1TT0A 1QHGA 4HSTA 4E7LA 1MMDA 4E7JA 1W36D 2GOMA 3S3OA 4XOTA 4E6KG 3W3CA 4JQFA 3H5NA 3K4KA 1ERDA 3L2UA 3K4NA 4PUSA 3OYKA 3VYRB 2ZXHA 1WJBA 5FRMA 2W00A 3G2BA 1V5GA 3VSKA 3FBNB 4BXFA 4II3A 2DJIA 2HPMA 3A4CA 4NQWB 2R7QA 3DKYA 4YEJA 4XOPA 1J09A 1OLTA 2CV0A 1WFXA 1YE9A 5HLTA 4BQNA 4XKBA 4XLFA 2CV2A 3VYUB 1FMWA 3CESA 3L2RA 1JI8A 2K5CA 4XLEA 3EUHC 2MYSA 3W2AA 2KHMA 3QYBA 2V1NA 4IQ4A 3QYEA 3K70C 3E1SA 3S93A 3SEQA 2VQGA 5CQEA 4F52A 4LIVA 3BG6A 2HVQA 4MLOA 4FASD 2ZSIB 2VIXA 4Y33A 2VQCA 4C30A 2Q2EB 4RM2A 3DLAA 3PJRA 2WBMA 4AYBA 2ZSHB 4IX7A 2LY2A 3CF2A 3RTRA 4XNFA 4BEHA 5CPRB 2R7WA 4PSXA 3MD2A 2IGOA 2AQEA 2A5WA 2BW3A 4BDYA 2VPLA 3W2VA 3IAS2 4C2TA 2LREA 2LH9A 3SEZA 4NC8A 1Z21A 1D1CA 3C2GA 4PSWA 5KHDA 1W36C 2R7OA 3AFHA 3OYJA 4E7KA 1X1CA 4J00A 2CH0A 1UG0A 2X6WA 2OV7A 1BR4A 2F4IA 2P0WA 4D9JA 2XC7A 4D1QA 3NWSA 2VQLA 3OWTA 3TMOA 1NG6A 4BACA 2K9MA 4CCKA 3KYLA 3OIQA 2XF5A 4HNTA 4NC7A 4ZYAA 4BGDA 3HOSA 2KRCA 1X4OA 3D5LA 1Y6IA 3K4BA 3H35A 5HVQC 2DXIA 3MKWB 4N4NB 4R79A 2RQQA 3RSNA 3QODA 1UELB 3K70D 2HU9A 4XR6A 2WAQA 4LITA 3OYIA 1X19A 3V42A 4BDZA 4CCNA 2MD0A 3S3MA 4NNJA 5LFAA 2PJRA 2KMUA 4BU2A 2M7BA 3A2KA 2E1MB 2VQHA 1WJEA 4P1WA 4HEA2 3AKZA 3HL2A 4BEHB 5KCMA 3PNTA 2VJ4A 3BCAA 3OYHA 2XF6A 4J01A 2VJIA 2BW3B 2LY1A 4H4KC 3GBGA 4XORA 4U7BA 3D5SC 2M4GA 2M3AA 2WAEA 3PNYA 2IGKA 4QPOA 1MW7A 3H5AA 4PJJA 1N78A 1S9HA 3OYDA 2VJ5A 4X0GA 1D0ZA 3CP8A 4XMYA 4DGWB 4BQOA 2XF7A 3DEEA 2X1EA 3SYTA 2OUMA 2LRDA 4PJLA 2VXZA 4IQJA 3BG7A 3DTKA 3RQ4A 3K4LA 4DOZA 4BUPA 4N4OB 4XKCA 3OMYA 1HA8A 3OS0A 2X85A 1X1DA 4CCLA 1SFKA 1MMNA 4BE1A 3SDBA 5TGTA 1T0FC 2O5RA 2HQAA 4BS9A 3CJRB 3ZR8X 4F92B 3L2WA 4XLAA 3L2VA 1YX5A 4E7IA 2VKHA 3TBIA 4BJ5C 4LG3A 1Z3YA 3C2HA 3CP2A 2CW7A 3TL4X 5HOOA 3VWBA 3PNVA 2HVRA 2V7FA 4RMNA 2R7XA 2PJRB 4CSWA 3AL0B 1GLNA 3VYTB 3ZGKA 4XM3A 3S8PA 4ZDOA 4DBRA 3DTIA 2W82A 2LBFA 3K4MA 2HNHA 3I9V2 3ZRGA 2DOAA 2CMPA 2E1MC 4FETA 3OIPA 3OOUA 2X51A 1DP3A 2V9KA 2NOJB 2V6EA 4CUGA 4IKFA 1MMGA 4CCJA 4PFOA 2CW8A 3VSLA 4KITB 2V4JC 2WY7Q 3J7AY 1E0EA 2JVHA 3L2QA 2RREA 2DCEA 2MFZA 3DPUA 2CS3A 1X4PA 3MMYB 2IS6A 2CV1A 1EA3A 4U87A 2HDWA 3IUOA 3HPGA 2MC4A 4E7HA 3LSIA 4CCMA 4B44A 3OYCA 3DU5A 4ZC3A 1T95A 3H9QA 2CFOA 3OYLA 1SAUA 2M7AA 4CA0A 3LSKA 3EUKL 3LSHA 2Y0SA 1Y56A 1MNEA 4HNUA 4OAZA 4C9YA 3M1CA 1K6YA 3N05A 2R7TA 2UV1A 2JSPA 2F5VA 3OR1C 4ZJZA 2WADA 2KZVA 2KP6A 2L9NA 3D5RC 2Z1DA 4C2UA 1Z3XA 2WAFA 1DGWY 1LFPA 1LDKB 3CJQB 3HC7A 2IS4A 5KNLA 3OYFA 3EUAA 2KDOA 2X1CA 1WJDA 5LD2C 3DTEA 2LBFB 4B47A 3AL0C 1IRXA 5FRNA 1AA7A 2VJJA 3BCBA 3UR3C 2WA0A 4ITVA 3DPLC 3OYEA 4OWRB 3H5RA 4XLHA 2V26A 5HNHA 3OYMA 2DT7B 1Z7LA 2JA2A 4P5OA 1ZELA 2L9SA 3K6GA 4F3QA 2LG4A 2XAUA 3RPUD 4XL9A 2QKLB 1QU3A 1WJ5A 4LIUA 1R6RA 3KX2A 4Y3OA 3HG9A 4F55A 4YRVA 2BOLA 2F6CA 2L2OA 1KONA 1LKXA 3LSGA 1UAAA 4RLQA 3ONQA 3FKJA 5FROA 1MNDA 2E5ZA 4F93B 4YELA 2I8DA 2KLOA 3HPHA 3K10A 4GRIA 4B3XA 4KJZA 3UNGC 4PJNA 4DBQA 4HG2A 4CZCA 1QHHD 2Z16A 3OL3A 1TZLA 4RLFA 4Y4RA 2GOXB 3CMMA 4ANJA 1MMAA 2HZDA 1VZ0A 1V5EA 3OY9A 3DKXA 2R7VA 4KT6A 3K4CA 4RM3A 3BC8A 1V5FA 2IS2A 4BL0B 1FMVA 1BR1A 3OR2C 3DU6A 1BR2A 2M0MA 3I3LA 2QKMB 2CUJA 3H0DA 2UWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCO A; 
#chains in the Genus database with same CATH topology
 4G6T B;  2IXS A;  2VBZ A;  3WG7 H;  4KIS A;  4Q4Z F;  3PO2 J;  2ELJ A;  1FTZ A;  4IHY A;  1JHH A;  3HUG B;  3FXL A;  1DDN A;  3KZZ A;  1FLI A;  3I4P A;  4ZTF A;  1G59 A;  1X1A A;  3FDY A;  1U0J A;  4HSR A;  4XK4 A;  2VKD A;  2OPT A;  1REP C;  5ICE A;  4D5C A;  4ZYH A;  3HOW J;  2EFQ A;  1WJC A;  4I99 C;  1VQO I;  2DFI A;  4DZJ A;  4ZDP A;  2R7U A;  4XN3 A;  1NHA A;  2P5K A;  2MG4 A;  5FGM A;  2FBH A;  1FSE A;  5HS8 A;  3E97 A;  3E0J B;  3F9K A;  3GEZ A;  4IOC F;  1R4N B;  2Z5U A;  5LBQ A;  4ABZ A;  1PJR A;  1PUF B;  3A01 B;  1W1W E;  4OMZ A;  4B8X A;  3VDX A;  1Z0X A;  5E3M A;  4MEX F;  3EUH A;  2JRT A;  1HKQ A;  3VOD A;  1QA6 A;  1MBG A;  1IN7 A;  1W5S A;  2QQ8 A;  1OFC X;  2CUZ A;  5DYM A;  1D0X A;  3ZQI A;  5HNF A;  3CCU I;  2NS8 A;  1PVE A;  4Z2Y A;  3F6V A;  2ESH A;  3ABU A;  3GWZ A;  2KT0 A;  2GA1 A;  3E5X A;  4YG2 F;  4U88 A;  1R5G A;  4BJT A;  4OMY A;  4B43 A;  3HEF A;  4A5N A;  2IGM A;  4Q48 A;  4F7Z A;  3GZ5 A;  3E5U A;  1Y39 A;  2IT0 A;  4XQF A;  1TQM A;  2MLG A;  5J1R A;  2QUF A;  3BRO A;  4DIQ A;  1M1E B;  4L9N A;  5EYR A;  3I53 A;  1GHC A;  3QQA A;  3KLO A;  2DLL A;  2OBP A;  2A6H F;  1OIS A;  4PFP A;  3IV5 A;  5JLW A;  5CVU A;  1HW2 A;  4QPQ A;  4KIG A;  2LOO A;  1ETX A;  3PSF A;  1K83 J;  4AID A;  1P7I A;  3BJ6 A;  4XLC A;  2MAB A;  2ECB A;  4XN0 A;  2QVO A;  3TO9 A;  2FMY A;  5CKT A;  4EM0 B;  3GFI A;  1QZY A;  2JQ7 A;  1PUE E;  2NYX A;  1FNN A;  1YHQ I;  2X1D A;  2ZME A;  4AWX B;  4PJM A;  3ULQ B;  1FZP B;  3HGY A;  2COB A;  1DGR M;  2YR2 A;  1NK3 P;  2FBI A;  3MZY A;  2VB6 A;  4L9T A;  3LSM A;  5K7F A;  2HTJ A;  1MSF C;  3OS2 A;  3F8M A;  1T98 A;  1TWA J;  4Z6Y A;  3J80 K;  1IUY A;  4BJ6 C;  1STZ A;  1VND A;  2QQB A;  4A3E J;  1OKR A;  3A0B C;  2P7V B;  3K1M A;  2Q2E A;  2ZJ2 A;  4I76 A;  2PJP A;  1MMD A;  1W36 D;  2E35 A;  2ME0 A;  4E6K G;  1IRF A;  3NAR A;  5FLX K;  2IPQ X;  3K69 A;  1ETW A;  1E3O C;  4M6Y A;  4JQF A;  3H5N A;  4LJZ F;  2CYY A;  2K9S A;  3K4N A;  3MCZ A;  4HLX A;  1UHS A;  2XHK A;  2GIZ A;  2HR3 A;  3BR0 A;  3G2B A;  1XCB A;  4WWC A;  3HRM A;  2DK5 A;  1HW5 A;  5F0C A;  1ZG1 A;  5EEA A;  4IHW A;  4Q5S F;  2DA4 A;  4WCG A;  3A4C A;  4NQW B;  1WRJ A;  2EBI A;  5HDG A;  2YU3 A;  4XOP A;  3OV8 A;  2FU4 A;  1J5Y A;  1YE9 A;  4EJW A;  1K4T A;  3V8J A;  1I27 A;  2CFX A;  3JRA A;  2EIM H;  2W84 A;  5LEK A;  2VOP A;  4HX8 A;  3CCQ I;  1G6N A;  4R1H A;  2QSH X;  2HGC A;  4KNY A;  1S6L A;  3QYB A;  5DD4 A;  4WX9 A;  3K70 C;  3M4O J;  4HW0 A;  3GZ6 A;  1O3T A;  5DS9 A;  1GV5 A;  2YX7 A;  4HZF A;  2FSW A;  4Y33 A;  4XLN F;  3Q0U A;  4L0Y B;  2DN0 A;  2IAI A;  2BYV E;  2L9V A;  4EMS A;  1QZE A;  2Z3Y A;  5BS6 A;  3WGG A;  1U3E M;  2PG4 A;  1W5C C;  5FD5 A;  1JTY A;  4XNF A;  1QQI A;  3HOZ J;  4BEH A;  3G1O A;  5CPR B;  2R7W A;  2AO9 A;  3MD2 A;  4ESJ A;  1DUX C;  2FOK A;  2IGO A;  1ACI A;  3PO3 J;  2BW3 A;  3I59 A;  5D4S A;  3QPL A;  4BDY A;  5LHI A;  4ENM A;  3MZ8 A;  2M9H A;  4NC6 A;  2O9L A;  2VPL A;  1LDJ A;  2X0L A;  2A61 A;  2F4M B;  1RUN A;  1I1G A;  4NC8 A;  3SEZ A;  1D1C A;  4P9F A;  1A5J A;  2TCT A;  3C2G A;  3M1E A;  4BBR J;  1IV8 A;  3AFH A;  1G2H A;  5FKK A;  3ZQ7 A;  3D1N I;  4J00 A;  2CH0 A;  3S1Q J;  3KP2 A;  2NVY J;  5DD8 A;  3KEQ A;  3J7Z I;  2OU2 A;  4AYB N;  4HX4 A;  4WXD A;  2P0W A;  4Y13 A;  1R9T J;  4D1Q A;  2F48 A;  2DMU A;  4U0W A;  1R4M B;  1XCV A;  2QF7 A;  2K9M A;  3T5X A;  1FOX A;  2XAG A;  3WU2 C;  4OIR F;  2XF5 A;  4CYC A;  2XRO A;  4HNT A;  2L7M P;  4BAY A;  4M72 A;  4UUS A;  4ZYA A;  4BGD A;  1SAX A;  2KRC A;  2M45 A;  1LQ1 A;  2P8T A;  3K4B A;  5F0H A;  3G4S I;  3H35 A;  2VC1 A;  4IVN A;  2DXI A;  4R79 A;  2F5F A;  2M8G X;  2Z33 A;  2VOD A;  1X2M A;  1AKH A;  2MA3 A;  4W1U A;  4XR6 A;  1MDM A;  2EB7 A;  4G7Z F;  2WAQ A;  2I10 A;  2LLK A;  4M3D A;  4A5M A;  1YJN I;  3S3M A;  1YS7 A;  5IT3 A;  3RKQ A;  4I01 A;  2EV5 A;  3BTL A;  2M7B A;  4P1W A;  3JRH A;  5K5O A;  1TLH B;  3HL2 A;  3MVP A;  5KCM A;  2EFP A;  2VJ4 A;  2Y31 A;  1U6G A;  1FBU A;  3C3W A;  1FTT A;  4H4K C;  1WH5 A;  4ENK A;  2NAZ A;  3LAJ A;  4FX0 A;  2WAE A;  1I6H J;  3JTH A;  4ZZL A;  4QPO A;  1MW7 A;  4KT5 C;  5D5V B;  4PJJ A;  1S9H A;  5GPC A;  3GTJ J;  4A3D J;  4X0G A;  3M9A A;  2ECC A;  3S1M J;  4DGW B;  1BW6 A;  1L0O C;  5DUK A;  1KU7 A;  5L3F A;  1A36 A;  2X1E A;  2XV4 S;  1GT0 C;  3CJT B;  1IJW C;  2LRD A;  1MNM C;  4PJL A;  4BY1 J;  3RJP A;  3FKI J;  4FE7 A;  4OIO F;  5LGN A;  1PUF A;  2HKX A;  1J75 A;  3ZMU A;  4DOZ A;  4N4O B;  1IN5 A;  3OMY A;  1HA8 A;  4E70 A;  2E71 A;  4HQE A;  1X1D A;  2W57 A;  2LFB A;  1OCO H;  3J7A O;  4KIF A;  1TWC J;  2V1D A;  2VE9 A;  2LKX A;  2JT1 A;  4HBL A;  2O5R A;  5GAH J;  4BS9 A;  3CJN A;  4HOB A;  3ZR8 X;  3W6J B;  2D1V A;  2LP0 A;  1YX5 A;  5B3S H;  3ZMV A;  4LG3 A;  5F64 A;  2COM A;  3IWF A;  2M87 A;  2MC3 A;  1KYW A;  2M5W A;  2V7F A;  4A0Y A;  2WV1 A;  2ZBK A;  4CSW A;  2JWT A;  3WE3 A;  5DCM A;  4XM3 A;  1P2F A;  1IRG A;  1EH6 A;  3DTI A;  4A0X A;  5E17 F;  1FPQ A;  2LBF A;  3K4M A;  3I9V 2;  4FET A;  3T8T A;  2PQ8 A;  4DQ2 A;  1C0W A;  1HCR A;  3TW7 A;  3L00 A;  4CCJ A;  4PFO A;  3GME A;  4KIT B;  4AD9 A;  1YO5 C;  2FF4 A;  2L0K A;  1Z9C A;  3LA7 A;  2KJB A;  1EA3 A;  2ZJR F;  3OIO A;  1OCP A;  5CYV A;  3EYI A;  1A6I A;  2EFO A;  4M73 A;  3RKY A;  3HPG A;  2MC4 A;  1P4X A;  3LSI A;  2VBW A;  3IL2 A;  4XRF A;  2BXY A;  1T38 A;  3K1N A;  4ZC3 A;  3WTZ A;  3S1N J;  3VB2 A;  3KET A;  2CFO A;  4UV8 A;  1B6A A;  1Y8R B;  2DFE A;  1BC7 C;  1RET A;  2Y0S A;  2LF8 A;  4N9H A;  5J4Y A;  1NTC A;  4G9Y A;  2HDD A;  3FMS A;  3N05 A;  4UVA A;  3IKV A;  1Y0N A;  2F5V A;  4ZJZ A;  5BMZ A;  2E7W A;  1H9G A;  4WK8 F;  2WAD A;  1O3S A;  1FY7 A;  3HTS B;  4A6D A;  2JN6 A;  4HV6 A;  2Z1D A;  3M7G A;  1OCT C;  4HF2 A;  1LFP A;  1R58 A;  1S7O A;  1YW7 A;  1BOA A;  1HW1 A;  1IN8 A;  4LD5 A;  4W97 A;  5KNL A;  4HF0 A;  3EUA A;  1BJA A;  2KZG A;  4GYI A;  3RKW A;  5J47 A;  1SFO J;  3F8C A;  3DTE A;  3ML6 A;  5D8K B;  5B1A H;  2L7Z A;  2IJL A;  1FBS A;  3FX3 A;  2P6S A;  1AA7 A;  2VJJ A;  4KIB A;  4LOC A;  2WA0 A;  4ITV A;  3OYE A;  4IOA F;  5HNH A;  3SJM A;  5FFX A;  2DT7 B;  3Q0V A;  1Z7L A;  2K3F A;  3ABK H;  2DOE A;  2RV8 A;  4L18 B;  1J9I A;  1HOM A;  4BBS J;  4RB3 C;  3C1D A;  4XL9 A;  1DU0 A;  2EIL H;  3TGN A;  3LAP A;  5ERI A;  3U9G A;  5D8L B;  2PMH A;  4G6Q A;  2CQK A;  1H8A C;  1LUJ B;  4L0Z B;  2IA1 A;  3CCR I;  4K2E A;  5F6F A;  1W5T A;  2BOL A;  5H2F C;  1BM9 A;  1JHF A;  2F6C A;  1KON A;  1WH7 A;  1LKX A;  3BG3 A;  3ERM A;  4BXX J;  1KU9 A;  3FK7 A;  2EV0 A;  4KA4 A;  1UAA A;  4RLQ A;  1J59 A;  4PJ0 C;  1QVU A;  4A6E A;  5ICG A;  5K1Y A;  1RIO H;  4UVB A;  1S3J A;  4UXN A;  4UNO A;  2FA5 A;  2FBK A;  1XMA A;  2I8D A;  3HPH A;  4F93 B;  3ISP A;  1YIO A;  1ZR4 A;  5DTD A;  4RGX A;  4PGG A;  1IZ1 A;  3TP3 A;  1ETY A;  3DV8 A;  2Z16 A;  4HA8 A;  5HLI A;  4ZYG A;  5E1W A;  2B63 J;  4RLF A;  4Y4R A;  2E1C A;  1R22 A;  2D2W A;  1V5E A;  2K86 A;  3DKX A;  3KLN A;  2HKO A;  2V6C A;  3CLO A;  3LQR A;  4RM3 A;  2M2E A;  2R5Z A;  3O8G A;  1P6R A;  3S2H J;  3F8F A;  1MD0 A;  4NB5 A;  3DU6 A;  1BR2 A;  2AHQ A;  4EQQ A;  3I3L A;  1VTN C;  4S0H B;  1FJL A;  1BJZ A;  3H0D A;  4AM3 A;  4NUB A;  3SZG A;  1X58 A;  2LYC A;  2EJR A;  2QEX I;  4HF1 A;  4II2 A;  4JP0 A;  4KN4 X;  3Q0W A;  1G8X A;  1O3Q A;  4FQG A;  2X6X A;  1BC8 C;  2LC2 A;  2CWE A;  2HPI A;  3X2Q H;  1ZRD A;  2FRH A;  4QWQ A;  1XTA A;  5IYB J;  3PFY A;  4FHT A;  4PCQ A;  2WB1 A;  3ZXS A;  4A12 A;  1WI3 A;  1ZLK A;  2KPM A;  2F5D A;  2CQX A;  1N75 A;  2LNB A;  2HOA A;  4A0Z A;  1YX3 A;  2DA2 A;  1R5H A;  5FFZ A;  2QBY B;  1V4R A;  2B0L A;  1OMI A;  2RQP A;  1X1B A;  3HRU A;  1V3F A;  1H0M A;  1UB9 A;  1K79 A;  2CQ7 A;  2RC4 A;  2DT6 A;  1S5L C;  5FKL A;  2DFH A;  5EGO B;  1CF7 A;  3BLY A;  3I54 A;  5AON A;  2E2H J;  4U0V A;  2HTS A;  1IDY A;  3OYG A;  4GFB A;  2FUG 2;  4RB2 C;  3EYY A;  2Y75 A;  5GAG J;  3TW6 A;  1OCZ H;  1G3S A;  2DA5 A;  1F5T A;  1D0Y A;  2GWR A;  3HM5 A;  2PMU A;  2JVG A;  3VPR A;  4JX5 A;  1WJF A;  2DTR A;  2CG4 A;  3BT9 A;  3GTO J;  3DBL B;  1VF9 A;  2DU9 A;  5F27 A;  5FKO A;  3ABL H;  1ODD A;  1RKW A;  4GDF A;  2IA2 A;  1Q1V A;  1YW9 A;  1WJA A;  2E19 A;  3IAM 2;  3CUQ B;  4CCO A;  2ICW G;  1IF1 A;  1VQ5 I;  3JRE A;  5E1Z B;  3CZ6 A;  3AG4 H;  4CH7 A;  2E60 A;  3MKZ A;  3FIS A;  3LSR A;  1KGS A;  1T56 A;  2LKS A;  1B72 A;  2ZXW H;  2R93 J;  3DXJ F;  3ZP5 A;  2HWV A;  2DQL A;  3R0J A;  2WV0 A;  3F23 A;  4TV7 A;  3OSF A;  1HDP A;  1FOY A;  2BZT A;  3HXL A;  1ZRE A;  3H1C A;  3EPZ A;  2HI3 A;  3DEW A;  4E4H A;  1W0T A;  4HLY A;  5DCF A;  2H6C A;  4L5J A;  1P9Q C;  2FOW A;  2QWW A;  2WY8 Q;  5IYD J;  3CMY A;  2QEN A;  3A1Y A;  3CCV I;  1RKT A;  3TDU C;  2W7N A;  4KMF A;  3DKW A;  2OQR A;  3SZT A;  2R5Y B;  4I09 A;  1YLF A;  2MGQ A;  3QYF A;  4HDU A;  2XGC A;  3CCJ I;  4A3J J;  4DW6 A;  1KU2 A;  2L4A A;  3HJE A;  4CGZ A;  4IO9 F;  2FJ1 A;  2OC6 A;  2DQR A;  1IN4 A;  1QHG A;  4HST A;  5M3M J;  1HSJ A;  1U8B A;  2V9P A;  1YS6 A;  1CQT A;  4RS8 A;  2FX0 A;  1BW5 A;  4A3C J;  3S3O A;  4XOT A;  3CF5 F;  1XGO A;  3K4K A;  4ZYD A;  1TT5 B;  1XDS A;  4GO1 A;  1TW2 A;  3L2U A;  4G7O F;  5K5R A;  2O3F A;  2HOE A;  3FWE A;  3OYK A;  1SVL A;  4RAG A;  3T8R A;  1Z6R A;  2H8W A;  5A2Q K;  2E7X A;  4G6D A;  3FBN B;  4BXF A;  4BHB A;  1TQI A;  1LE8 A;  4II3 A;  2UXX A;  3V7C A;  3L9F A;  3JW4 A;  4A3M J;  2XUB A;  5BPD A;  2ISZ A;  4Y15 A;  3V4G A;  4BXU A;  4LFU A;  4YEJ A;  5H6R A;  5GTI C;  5EG0 B;  1J09 A;  4BHC A;  2A68 F;  2FNA A;  2V1X A;  1WFX A;  2EFN A;  3GTG J;  5HLT A;  1MKM A;  4BQN A;  3CC2 I;  3M07 A;  5E18 F;  4XLF A;  3VYU B;  2NS7 A;  2HQ5 A;  2VBY A;  4XRM A;  1FMW A;  3RQI A;  3CES A;  1YJW I;  1TBX A;  3JRG A;  2K5C A;  3HSE A;  1EH8 A;  4B3A A;  2MYS A;  5IP6 A;  3QPT A;  4IQ4 A;  3W2A A;  5JR3 A;  3GTL J;  3SEQ A;  1W4M A;  4N9I A;  5CQE A;  3R6S A;  1TW3 A;  4LIV A;  3ZQC A;  2E36 A;  2HVQ A;  4EGY A;  1AU7 A;  2ZSI B;  3BR3 A;  1UHM A;  2F4O B;  2M30 A;  2QA4 I;  1XGS A;  4MO7 A;  3DLA A;  2ZJQ F;  2DMQ A;  3BY6 A;  4IX7 A;  2ZSH B;  3GFM A;  3H92 A;  1U78 A;  3QAH A;  3RTR A;  4EV0 A;  2JJ7 A;  3IKT A;  1FC3 A;  2DI3 A;  2A07 F;  5J6X A;  3ECO A;  4D0P A;  3GUD A;  2EPF A;  4H0E A;  1B8I B;  3I56 I;  2K4J A;  3W2V A;  4C2T A;  2EZI A;  2IA0 A;  2LRE A;  2ZJP F;  2LH9 A;  1O7F A;  1Z6T A;  2PLY A;  1B9M A;  4V2G A;  5HLG A;  1V55 H;  1SD4 A;  5KHD A;  3NQO A;  3QP5 A;  4MFD A;  3RPU A;  3OYJ A;  1OYI A;  4FCY A;  4KFC A;  3IWZ A;  4PZJ A;  1ZR2 A;  3BTJ A;  1UG0 A;  2OV7 A;  2L9R A;  1R5I D;  2P5L C;  2Z99 A;  4D9J A;  4RAF A;  2VQL A;  3ZQG A;  1NG6 A;  4CCK A;  1LEB A;  1T08 B;  3O6B B;  4NC7 A;  2DMT A;  5CVJ A;  3JTG A;  5D5W B;  2EWN A;  1X4O A;  5LLQ A;  2HOT A;  3MKW B;  2BHY A;  2GXA A;  5KK1 A;  4AIJ A;  2KKO A;  3RI4 A;  1UEL B;  4OOI A;  2WC2 A;  3VOE A;  3R0A A;  4ON0 A;  4IHV A;  3KCC A;  2HU9 A;  5C4X J;  2XSD C;  4LIT A;  3OYI A;  3C2B A;  1I3Q J;  1S29 A;  4I98 B;  1Y1V J;  3G1M A;  4BDZ A;  5L3B A;  1G3Y A;  4NNJ A;  4QLC U;  2PJR A;  1T2K A;  2XAF A;  4BU2 A;  2VQH A;  1WJE A;  4UY8 I;  2DYR H;  3E5Q A;  3LA3 A;  3PQJ A;  2W25 A;  2Z9O A;  2VJI A;  2STT A;  3IH3 A;  4GGG A;  3GBG A;  2K4B A;  3RIR A;  1X3Z B;  1IAW A;  4M74 A;  3PNY A;  2M4G A;  4XSZ F;  5EF6 A;  1ZRC A;  2A69 F;  2BY2 A;  1MJ9 A;  1N78 A;  3K2A A;  1T8I A;  1B9N A;  2VJ5 A;  2WAQ N;  2ZXJ A;  1WSU A;  5B1B H;  1BI2 A;  3JAM Z;  3CP8 A;  1MBJ A;  4BQO A;  2JUC A;  3DEE A;  1MBF A;  2OUM A;  4MNU A;  4OIP F;  2VXZ A;  1J7K A;  4G8X A;  2VT3 A;  3QU6 A;  4HQM A;  4M9S A;  3ZMS A;  1JKO C;  3LNQ A;  1JGS A;  3IC7 A;  3C7J A;  2OA4 A;  3W6K B;  4XKC A;  4FT8 A;  2O0Y A;  1KQ0 A;  3A02 A;  3HSF A;  1SMY F;  1MIJ A;  2ME6 A;  1GVJ A;  3J7Y J;  1MMN A;  4BE1 A;  1IO2 A;  1U5T B;  2VT2 A;  1W7P B;  3KYC B;  1JKR C;  3SXY A;  2NOG A;  5F0F A;  3U2R A;  1T0F C;  3CCE I;  2Q0O A;  1QBJ A;  5J4V A;  3A03 A;  4XLA A;  5FO5 A;  2DFF A;  2FNP A;  3TBI A;  4BJ5 C;  3GXO A;  4JK1 X;  1F1Z A;  1H9T A;  3ZOB A;  1QRY A;  2ISY A;  3GTP J;  2UZK A;  5K5Q A;  4RMN A;  5BNG A;  2R7D A;  3RZO J;  2X6O A;  1JGG A;  1GLN A;  2JA8 J;  3QU3 A;  1ON1 A;  3SQN A;  2KIS A;  1ZRF A;  2R0Q C;  5FJ8 J;  2ZNY A;  4YII A;  3CCM I;  4ZZD A;  4OIQ F;  3MN2 A;  1F9N A;  1J2X A;  2EA2 A;  2DTZ A;  1K4S A;  2V6E A;  4A3B J;  3KP4 A;  3U1D A;  2MH9 A;  2KIU A;  2RRE A;  2M8E A;  3RKX A;  1X2N A;  2DAO A;  1X4P A;  2GIV A;  3DPU A;  2CV1 A;  4U87 A;  2HDW A;  4FIS A;  1R7J A;  4ESF A;  2FQ3 A;  4B44 A;  1ENH A;  2H8R A;  3BPX A;  5E79 C;  2XAS A;  3S16 J;  2HS5 A;  4OU0 A;  1FT9 A;  2NNN A;  4M6X A;  3H9Q A;  5CJ9 A;  5M5Y J;  2GM4 A;  1N25 A;  4BH9 A;  2RVC A;  2M7A A;  3GFJ A;  4IRH A;  2K27 A;  4I02 A;  3U1K A;  3S17 J;  2CO5 A;  4A3F J;  1VFC A;  5C44 J;  1LEA A;  1MNE A;  1FSH A;  4OAZ A;  1F36 A;  3AG1 H;  3M1C A;  2R7T A;  1U5T C;  2UV1 A;  1I1S A;  3OR1 C;  1RNL A;  2KZV A;  1XGN A;  2ZCW A;  1TWH J;  3KFW X;  2QSG X;  1Z3X A;  3BDD A;  2ESN A;  1MBH A;  1VQN I;  3LST A;  3CJQ B;  4LMY A;  4LG0 A;  2W48 A;  5EEH A;  2X1C A;  3BR5 A;  1WJD A;  5LD2 C;  1MJA A;  5J1U A;  5BOX A;  2KIQ A;  2DO7 A;  1YIJ I;  2BHZ A;  2Y0S N;  5TJJ A;  1IRX A;  2JMW A;  2RN7 A;  3UR3 C;  3V8K A;  1JXS A;  4OWR B;  1QNT A;  3KP6 A;  5L3E A;  1R1U A;  5HS7 A;  2V26 A;  3R4K A;  1NK2 P;  2H1L A;  3BJA A;  3OYM A;  1XS9 A;  1SMT A;  3HBL A;  4C3I J;  2HYG D;  1ZGA A;  3HUG A;  4AIH A;  2JA2 A;  1ZEL A;  2L9S A;  4RGU A;  3WGI A;  1BI1 A;  3K6G A;  4F3Q A;  4AIK A;  3GLX A;  3RPU D;  4A3K J;  1YIT I;  4GXO A;  1HC8 A;  4HDV A;  1R6R A;  3KX2 A;  2KJC A;  1RR8 C;  4YRV A;  5E3N A;  3EDP A;  4I0B A;  1L3L A;  1UST A;  5CVR A;  6PAX A;  3JRB A;  2DDA A;  4OIN F;  3CUO A;  3CME I;  1YYV A;  5DEQ A;  1GVD A;  3AG3 H;  1YTY A;  1XD7 A;  3VEP A;  1APL C;  2E5Z A;  2PFB A;  4RAY A;  2ZKZ A;  3H3U A;  4B3X A;  4GRI A;  1QVT A;  2KIM A;  3A01 A;  1FOK A;  2MH2 A;  2FEZ A;  4L9V A;  4XRS G;  1R71 A;  2B7E A;  3CLQ A;  3CMM A;  5IOZ A;  1MMA A;  1SD6 A;  2HZD A;  4I0A A;  3BZK A;  1NH3 A;  1XN7 A;  2RKH A;  1WI9 A;  3K4C A;  3PM1 A;  3HTU A;  3ASN H;  5JVT A;  3PIP F;  1BL0 A;  1EF4 A;  1FMV A;  2W85 A;  3KP3 A;  2EFW A;  1BR1 A;  3CDL A;  2G7H A;  5FLV A;  4BHP A;  1KU3 A;  3QPS A;  3FMQ A;  4UUT A;  1K6O A;  4BYY A;  4CIC A;  2UWM A;  2ELH A;  4EM2 A;  5EDN A;  2BY3 A;  4AC0 A;  3ECH A;  1N77 A;  3CC7 I;  1F43 A;  1FIA A;  1MGT A;  3K4J A;  3ABM H;  2E5N A;  3S3N A;  2Y9Y A;  3JAM K;  3TOB A;  3LOC A;  5LEJ A;  4AUX A;  1FEX A;  3PL8 A;  5D6F A;  4ASN A;  3WU1 B;  2ZXI A;  3H9J A;  4PK4 A;  3J81 Z;  3HKZ A;  2E1N A;  5L3C A;  1T0F A;  1D3Y A;  2JPB A;  2M4K A;  3DWL E;  3ERE D;  1K78 B;  2YUS A;  4X1E A;  1HKS A;  1HST A;  1OPC A;  2XPU A;  4HRI A;  4HPQ A;  3LSJ A;  2LY9 A;  2RDP A;  3SDG A;  5LHG A;  3BZ6 A;  1RUO A;  2VC0 A;  3KPH A;  4EM1 A;  3DBH B;  1YOV B;  4LK1 F;  3W2W A;  1IN6 A;  3REO A;  1YI2 I;  4UVC A;  2Q1Z B;  2X6Y A;  4LLG F;  2WB1 N;  4S04 A;  2NVT J;  3LSP A;  4ENJ A;  3B6A A;  2HEO A;  3FBI B;  4P96 A;  1Y8Q B;  2HQR A;  2XDV A;  2JPC A;  2CQQ A;  2Y69 H;  2PMZ A;  3LFU A;  1I5Z A;  2ETH A;  2R4G A;  1EH7 A;  3ZMZ A;  2DBB A;  3K2Z A;  3OS1 A;  4E7S A;  5E20 A;  2HOS A;  1GV2 A;  2H94 A;  4IF4 A;  2DA3 A;  2HXI A;  2CQN A;  2R7S A;  1O57 A;  2IP2 A;  2IBD A;  1Y0U A;  3ELK A;  2VL8 A;  1VQ6 I;  1B1B A;  3LL7 A;  3I58 A;  2XRN A;  3M8J A;  4IXA A;  3MKY B;  1Y1W J;  2HZT A;  3G3Z A;  3IP4 B;  4DJA A;  1H89 C;  3E7L A;  3H9G A;  4A2U A;  4D7N A;  4I7H A;  2R7R A;  2HQN A;  2K40 A;  4NDL A;  4A93 J;  3H0G J;  1JUM A;  2NXN B;  3OYB A;  4NQW A;  2PI0 A;  4V19 K;  2JUG A;  3DPT A;  3RYR A;  1U5T A;  4EJT A;  1W7P A;  2VBX A;  5CQG A;  1YRN B;  2O03 A;  2K3P A;  2B9S A;  1DQU A;  2PN6 A;  4ESB A;  1T6S A;  2XSJ C;  3WU0 A;  3K0L A;  4BE2 A;  4UB8 C;  4EAT A;  5DM6 F;  2OCC H;  4BE0 A;  1EJ9 A;  3HDD A;  1RRJ A;  3KYD B;  3RYP A;  4F91 B;  1PYV A;  1TC3 C;  1A31 A;  3KEY A;  1UG2 A;  4EVI A;  3RCO A;  1WWX A;  4IZZ A;  4E7Z A;  3I4N J;  3L09 A;  5D5X B;  1IUF A;  4RB0 A;  4AU7 A;  1IXS B;  2VAS A;  2DA6 A;  2HVS A;  1TT0 A;  1QPI A;  2FML A;  2LTP A;  4E7L A;  4E7J A;  3HRT A;  1BIA A;  3LQQ A;  4EGZ A;  2G7U A;  3M8F A;  3MZH A;  4C3J J;  5ILS A;  4DYQ A;  3G1L A;  3W3C A;  3IRQ A;  1ERD A;  1FOW A;  1TWF J;  2K85 A;  5CLS A;  2Y30 A;  4PUS A;  1ZG5 A;  3VYR B;  2ZXH A;  2DW4 A;  3M8E A;  2NVU B;  4D7M A;  5FRM A;  3HOX J;  2W00 A;  1LPQ A;  1R49 A;  2OF7 A;  3VSK A;  3TO6 A;  3FMR A;  2IVM A;  5J8C A;  2DJI A;  3JRI A;  2HPM A;  1K7A A;  1HXD A;  2M0C A;  3RDI A;  4B1R A;  1SAN A;  3JRD A;  1S7E A;  2QLZ A;  4YIF A;  1OLT A;  2Y0M A;  2CRG A;  1JT0 A;  1R36 A;  5L3G A;  4XKB A;  4AVP A;  3CCS I;  5GP9 A;  5D4R A;  2CV2 A;  2ZME B;  2BV6 A;  2MBF A;  3L2R A;  1ZAR A;  4L9J A;  4XLE A;  3F6O A;  3EUH C;  2KHM A;  2MLK A;  2O8X A;  2V1N A;  3E1S A;  3O8H A;  1RPW A;  4JBA A;  1XMX A;  2VKV A;  2VQG A;  4F52 A;  4MQ9 F;  4KN7 X;  4IRG A;  1V54 H;  5B66 C;  3BG6 A;  2OZU A;  5HDK A;  2VIX A;  2X4H A;  1EV7 A;  1IV6 A;  2Q2E B;  2CJJ A;  2O7O A;  5AIP A;  2WBM A;  3JCU C;  1A6Q A;  1AWC A;  2LY2 A;  3P5J A;  2M34 A;  3CF2 A;  2GBY A;  4HYE A;  3V8L A;  3GTK J;  4IHT A;  4U7D A;  3AAF A;  1RC9 A;  2JTV A;  3I71 A;  5E8G A;  1ZQ3 P;  2A5W A;  3FIW A;  2DJN A;  2DMP A;  1D8J A;  1LNW A;  3IAS 2;  2ZB9 A;  2WTE A;  1O3R A;  1O4X A;  2MSY A;  1BA5 A;  4Q47 A;  4BQA A;  2ADU A;  2R7O A;  3J81 K;  2NRA C;  4DYC A;  4E7K A;  1KYZ A;  2X6W A;  3DEU A;  3GCM A;  3T1B A;  2BEO A;  2GXB A;  1BR4 A;  2F4I A;  3GW2 A;  2GZW A;  4R8H A;  1A04 A;  5IP7 J;  3HIF A;  2XC7 A;  4HNV A;  4LGW A;  1B4A A;  1GDT A;  1R1T A;  4BAC A;  5JVG F;  3KYL A;  5LGU A;  3E6B A;  3A0H C;  3GYH X;  5F1J A;  2F2E A;  3JRC A;  1IRZ A;  3HOS A;  2EIK H;  2Q8K A;  3BQY A;  1Y6I A;  3D5L A;  5HVQ C;  1SFE A;  4P9U A;  1UCR A;  2L01 A;  1DU6 A;  2RQQ A;  2ZME C;  4WXC A;  3QOD A;  4IPA A;  3L1P A;  3K70 D;  5ILV A;  3BG5 A;  2O61 A;  1KZH A;  3V7R A;  1JJ6 C;  2DA1 A;  1Z1D A;  2YX4 A;  1WPK A;  1X19 A;  3V42 A;  5ILU A;  4CCN A;  3SHF A;  3HOV J;  5CVI A;  2MD0 A;  1ETQ A;  4M71 A;  5LFA A;  1ULY A;  9ANT A;  1X3W B;  2KMU A;  3A2K A;  2RGV A;  2E1M B;  4HEA 2;  3AKZ A;  4BEH B;  3BCA A;  4P55 A;  5JFR A;  3OYH A;  2XF6 A;  2L54 A;  3MWM A;  4KYW A;  1ZK8 A;  4A3L J;  2BW3 B;  2XAJ A;  3WTV C;  3ZPL A;  2LY1 A;  4FE4 A;  1P7J A;  2DOD A;  3GO5 A;  1ZGJ A;  1OQY A;  2IGK A;  2DYS H;  3H5A A;  5E1X A;  2AXL A;  3CO6 C;  3OYD A;  2OZ6 A;  1BI0 A;  3BPV A;  2EIJ H;  2DMN A;  3F3X A;  2EZH A;  2TRT A;  2KRF A;  2XF7 A;  3SYT A;  3NRV A;  3CUQ C;  4NHJ A;  2JRM A;  2W24 A;  2LVS A;  4IQJ A;  4HAM A;  1SEU A;  3P9K A;  3K4L A;  3CCL I;  4CYC B;  4UUS B;  1FYM A;  3OS0 A;  2X85 A;  4CCL A;  2X48 A;  1SFK A;  1TNT A;  3JR9 A;  4CYD A;  2STW A;  4CZZ A;  3Q9V A;  1KQ9 A;  4YFN F;  3SDB A;  5TGT A;  1VQP I;  2YS9 A;  5GAD J;  3M3Y J;  1AKH B;  1JUS A;  2QQ9 A;  3CJR B;  2QZ8 A;  4RGR A;  4F92 B;  5BQT A;  3L2W A;  1P4A A;  2KDZ A;  2IRF G;  1MDM B;  1D5V A;  1ZTR A;  4E7I A;  5ICC A;  4M9X A;  1Z3Y A;  2CUF A;  3KZI C;  1R1V A;  3TL4 X;  3CP2 A;  3ZQF A;  3ASO H;  3PFI A;  5HOO A;  4M3E A;  1YW8 A;  3PNV A;  2EQR A;  2R7X A;  1F4K A;  1XGM A;  2QCO A;  3ZGK A;  3CO7 C;  4ZDO A;  4DBR A;  3QOP A;  3W6V A;  2EH3 A;  1UZC A;  3E6C C;  2DOA A;  2CMP A;  2E1M C;  1FYK A;  2OCE A;  3OIP A;  5IT9 Z;  3OOU A;  2X51 A;  2V9K A;  3H3V K;  2BE5 F;  2NOJ B;  4M6V A;  1FWZ A;  5CVV A;  1OCR H;  2CW8 A;  3EET A;  2V4J C;  2D45 A;  1E0E A;  4L5I A;  1IXR C;  2IS6 A;  1MMS A;  1YRN A;  4D5F A;  4G12 A;  2XGD A;  3NAU A;  3WHB A;  4E7H A;  3P9I A;  2GLO A;  3N4M A;  4CCM A;  5DM7 F;  3DU5 A;  1GXP A;  1P92 A;  4B09 A;  3FXK A;  3OSG A;  3R60 A;  1VQ4 I;  1JT6 A;  1Z67 A;  3OYL A;  3DF8 A;  1SAU A;  3GZN B;  3K7A J;  1ZN2 A;  3LSK A;  3WTY C;  1HLV A;  2JK3 A;  1Y56 A;  1P4W A;  4C9Y A;  3HHG A;  4QTR A;  1YG2 A;  5IP9 J;  1CGP A;  4U0Y A;  4IHS A;  4CDG A;  2HFH A;  4JYK A;  1IC8 A;  3D5R C;  1ZG3 A;  2BGC A;  4C2U A;  1DGW Y;  4L5E A;  1LDK B;  4GCV A;  3HC7 A;  2IS4 A;  4C2M J;  3CDH A;  3OYF A;  2OQG A;  5DCM B;  2JA6 J;  2KDO A;  3KZY A;  4XSX F;  3FM5 A;  3H3Z A;  2LBF B;  5LRR A;  1PDN C;  5GTH C;  2CGP A;  3SFZ A;  5IOY A;  1G4D A;  1E2X A;  4XID A;  3CCY A;  5FRN A;  3P7N A;  4IJA A;  3DPL C;  3WTX C;  3H5R A;  4XLH A;  5DV5 A;  1LB2 A;  4MGR A;  2BY0 A;  3WTW C;  2FQ4 A;  3HHH A;  1XSD A;  2AS5 F;  4P5O A;  3PUF A;  2J5P A;  1U2W A;  2A6E F;  4WXH A;  1FYL A;  2LG4 A;  4QSH A;  3GTM J;  3O2P E;  4S05 A;  2EV6 A;  3FM3 A;  4Y3O A;  5DDG A;  3Q3S A;  4F55 A;  5IPA A;  3TQN A;  3DFG A;  1WGX A;  2JA7 J;  2QBY A;  1J0R A;  2Y48 A;  1FP2 A;  3KP5 A;  3FF5 A;  1VQ8 I;  1X3U A;  3ONQ A;  1GUU A;  1USS A;  3FKJ A;  3HB9 A;  5FRO A;  5IY5 H;  3ZQL A;  3CC4 I;  2KLO A;  3K10 A;  4KJZ A;  3UNG C;  2DK8 A;  4PJN A;  4DBQ A;  5E3O A;  5EGO A;  2E1O A;  2X9D A;  2XAQ A;  4CZC A;  3I55 I;  2C6Y A;  1QHH D;  5LGT A;  4Y7N J;  3OOP A;  3WHC A;  4A69 C;  2GOX B;  3LA2 A;  1LVA A;  4ANJ A;  1XC5 A;  3ZQH A;  2VKE A;  5FLM J;  2D5V A;  3TO7 A;  1QGP A;  3OY9 A;  1JE8 A;  2NVQ J;  3GF2 A;  3I64 A;  3C18 A;  4JX6 A;  1ZGW A;  1ORK A;  1V5F A;  2IS2 A;  4BL0 B;  1YQA A;  3OR2 C;  2L02 A;  2KIF A;  4A3I J;  2BBY A;  2QKM B;  3G73 A;  1MBE A;  2XB5 A;  4UB6 C;  2G0E A;  3F21 A;  2PBI A;  2LF7 A;  3CUQ A;  2R92 J;  4XKW A;  3OYN A;  2LK2 A;  2A3S A;  2D1H A;  2EZL A;  1UFM A;  2KFD A;  3BJO A;  3DCF A;  3HGG A;  2QYO A;  5IYC J;  3Q5F A;  1T39 A;  5ED4 A;  1EKE A;  3OL4 A;  5F08 A;  3E6M A;  2N8G A;  3COA C;  4XON A;  1T33 A;  1ITY A;  2JA5 J;  4JOM A;  1WKM A;  2BVL A;  2W4S A;  4RBO A;  5D5U B;  2L5Q A;  2XB0 X;  3LWF A;  2KL4 A;  3FHN A;  5LRS A;  1RES A;  2K9L A;  3QPH A;  4MTE A;  4XBF A;  1R00 A;  2VXD A;  3PUB A;  1DP7 P;  1BBY A;  1QZZ A;  3U21 A;  3S14 J;  2EA4 A;  4OAY A;  2VLA A;  3TED A;  3B02 A;  1ONV A;  2R5Y A;  2IS1 A;  3PSI A;  2Y2Z A;  1B59 A;  1S7A A;  1LVK A;  4XKV A;  4XRS A;  2DPU A;  3HOY J;  3HKZ N;  5HLH A;  1MSE C;  2ID6 A;  4LLL A;  3D0S A;  3QOE A;  1Z91 A;  2XGX A;  2R5Z B;  1U8R A;  3VYS B;  1NG7 A;  2L7F P;  2O8K A;  5AIQ A;  2Z2S B;  3KE2 A;  3ZMD A;  5IT9 K;  2KRH A;  4Y52 J;  2W1O A;  1MH4 A;  3N97 A;  5GAE J;  3FXR A;  3K9T A;  1YJ9 I;  2MD5 A;  1D1A A;  1DPR A;  5HS9 A;  2RNG A;  3BR6 A;  4RA2 A;  1OCC H;  3L2C A;  1O7L A;  3ZCO A;  2BY1 A;  4IEJ A;  2BVM A;  3BP8 A;  5K7Z A;  5GPA A;  1XPX A;  4B48 A;  4CXF A;  2PMZ N;  2FE3 A;  3QP6 A;  3FHZ A;  1E3P A;  3H36 A;  3LMM A;  1AHD P;  2OAZ A;  2ZFU A;  4LK0 F;  2IW5 A;  1JKP C;  4QIW N;  2IGN A;  2F5E A;  3GX4 X;  5FKN A;  1BOB A;  1ZLJ A;  3F8N A;  4M9Z A;  2EZK A;  2E2I J;  1HKT A;  2QQA A;  4BQQ A;  1SC7 A;  2LDU A;  5EG0 A;  2KQR A;  4PGH A;  3CDI A;  3BOQ A;  1E17 A;  3NWT A;  2E2J J;  2A6T A;  4ZDL A;  1W0U A;  3DBR B;  1CF7 B;  1D1B A;  2V9V A;  2UUZ A;  4YFX F;  1OYY A;  1OR7 C;  2LR8 A;  5M5X J;  3FXQ A;  4FX4 A;  2XPV A;  4V2F A;  1D5Y A;  2ZO4 A;  3DQV C;  2L7K A;  4MTD A;  3PIO F;  4CHU A;  3OYA A;  5KAI C;  4ZTJ A;  2RAE A;  2HYF A;  2AQF A;  3ZQQ A;  3JRF A;  3EQL F;  1QO0 D;  3S32 A;  5JHF A;  4AVZ A;  3HOT A;  2LSO A;  4BY7 J;  2P7C B;  2XRL A;  2O6G E;  2H27 A;  2GOM A;  2DPD A;  1VI0 A;  1Z05 A;  1R23 A;  3CQZ J;  5ICF A;  2R7F A;  3DP7 A;  2PEX A;  1ZH5 A;  2EK5 A;  4M3B A;  4DZP A;  2VI6 A;  4A3G J;  1B8I A;  3QWL A;  1WJB A;  3TKY A;  3VFZ A;  1MBK A;  2VE8 A;  1V5G A;  3BR1 A;  1B72 B;  5FD6 A;  1AOY A;  1LFU P;  1XMK A;  1UJ8 A;  2WWY A;  1U9N A;  2JSC A;  3I0T A;  2K9N A;  2GXG A;  2R7Q A;  3GTQ J;  3DKY A;  4X6A J;  5E8I A;  4UUV A;  1DPU A;  3LFK A;  3I4M J;  4HV5 A;  1HDD C;  2NVX J;  2CV0 A;  3S15 J;  1JUP A;  3SZP A;  1X1P A;  4HX7 A;  3BTI A;  4KMU X;  1S72 I;  3DLL F;  2HYJ A;  5J40 A;  4I6Z A;  2R7Z J;  1JI8 A;  1KQ8 A;  5KVR A;  1SD5 A;  5LHH A;  2CW0 F;  2P81 A;  1MJB A;  3QYE A;  4BKX A;  3S93 A;  3CD6 I;  5JLX A;  1XB4 A;  3E3V A;  3FXO A;  4ZYE A;  4MLO A;  3BG9 A;  4FAS D;  2L3D A;  1VQK I;  1MH3 A;  2AXT C;  2VQC A;  4C30 A;  3RPQ A;  1FIP A;  4RM2 A;  4J19 A;  3ABT A;  1VQ7 I;  3PJR A;  1HQC A;  4AYB A;  2A5Y B;  4GYG A;  2OTJ I;  2DA7 A;  1XG1 A;  4KIC A;  5EEG A;  3HSR A;  5HDN A;  2M1B A;  4PSX A;  1SD7 A;  2XPW A;  1WHU A;  2A05 A;  1H88 C;  1SFX A;  1FBQ A;  1WVR A;  2AQE A;  3WTT C;  5BPI A;  4LLN A;  2JZY A;  4KDP A;  2QGU A;  3B73 A;  1Q1H A;  2VON A;  3BTC A;  3SFI A;  1Z21 A;  3L7W A;  3JSP A;  2XIG A;  4PSW A;  1W36 C;  4MFE A;  2LMD A;  3KIO A;  4MIM A;  1LE8 B;  1FP1 D;  1HBX G;  1X1C A;  5FB2 A;  2EIN H;  3HOU J;  2P6T A;  3NWS A;  4RGS A;  3BQZ A;  3CTA A;  3T0Y A;  3OWT A;  3TMO A;  5J1Y A;  1XX5 A;  2TDX A;  3OIQ A;  5JHU A;  4ZH4 F;  2H09 A;  4RAZ A;  3QRF F;  1OYW A;  4MQV A;  4N4N B;  2ELK A;  1LJ9 A;  1U9O A;  3AG2 H;  2GA2 A;  3RSN A;  1UMQ A;  1BI3 A;  3IH2 A;  3E6D A;  4EJO A;  3PQK A;  3NEU A;  3HZJ A;  2F5C A;  3S2W A;  5J3L A;  4RB1 A;  1ZYR F;  5D6E A;  1SVM A;  2J5O A;  2QM3 A;  3HRS A;  1IG7 A;  3FXJ A;  3ROU A;  3JSO A;  4O6J A;  2XAH A;  2R3S A;  3PNT A;  1D8K A;  1PP8 F;  1ETV A;  1S8N A;  2IEK A;  4YFK F;  4J01 A;  3KEO A;  3RZD J;  1TQP A;  3MAJ A;  2OJE D;  3G6E I;  5A2Q Z;  2V79 A;  4XOR A;  4U7B A;  3D5S C;  2M3A A;  1JKQ C;  4LB5 A;  2NS0 A;  4O3M A;  1ON2 A;  4G94 A;  3WTS C;  2H1K A;  4M3G A;  3TP0 A;  1A35 A;  1FX7 A;  3I5U A;  2NNY A;  1D0Z A;  2RNJ A;  4XMY A;  5C3E J;  1TTY A;  1VQ9 I;  1JJ8 C;  4B4C A;  4RDU A;  4M3F A;  1OR7 A;  3BG7 A;  3DTK A;  2PX9 A;  3RQ4 A;  1Z7U A;  5EZH A;  1ETK A;  2YSR A;  3GVA A;  4BUP A;  1VQL I;  2K7L A;  5B5E C;  3Q9S A;  3IRR A;  1GXQ A;  4N0B A;  2V1U A;  1XSV A;  4IRI A;  1XSX A;  4G7H F;  3WE2 A;  1E3H A;  2ZNZ A;  3ZN0 A;  3P9C A;  2HQA A;  1ETO A;  2CUE A;  1TNS A;  1OJL A;  1QPM A;  2P5V A;  3L2V A;  2K9Q A;  2OTL I;  2K02 A;  2VKH A;  3F0C A;  2GAU A;  2Y9Z A;  2ACJ A;  3WG9 A;  3C2H A;  2CW7 A;  3VWB A;  2OD5 A;  4C3H J;  2HVR A;  1IGN A;  2PJR B;  4MEY F;  1LFB A;  4BNC A;  3AL0 B;  3VYT B;  3TOA A;  2XKO A;  3S8P A;  3WTU C;  4LB6 B;  3IHU A;  1TP4 A;  1I3A A;  1SVO A;  2HXO A;  2W82 A;  5E3L A;  4DNC A;  2HNH A;  3ZRG A;  1IDZ A;  3S1R J;  3WOD F;  1DP3 A;  1POG A;  2VOO A;  2FD5 A;  4CUG A;  4IKF A;  1MMG A;  3HYI A;  3VSL A;  3FXU A;  5HOD A;  2WY7 Q;  3J7A Y;  1KA8 A;  1ZAO A;  2JVH A;  3L2Q A;  2DCE A;  2MFZ A;  2VPR A;  2CS3 A;  3O3K A;  2ID3 A;  5L3D A;  4MHG A;  3MMY B;  3ZN1 A;  5TIS C;  3ZMT A;  2HDC A;  3IUO A;  2ZFW A;  1G3W A;  3WGH A;  4O5V A;  4KUM A;  3F22 A;  4IL6 C;  3OYC A;  1Z77 A;  5KAF C;  1RR7 A;  1T95 A;  1RI7 A;  3FXM A;  5FKM A;  5C4J J;  2DOF A;  4CA0 A;  3EUK L;  3LSH A;  2I5U A;  4UHT A;  4DYR A;  1IXC A;  3ESW B;  1UHW A;  5DUI A;  3V7S A;  2UXN A;  3R61 A;  5EJC A;  4HNU A;  1K6Y A;  4UV9 A;  1IW7 F;  4EJU A;  2JSP A;  2DDB A;  3S2D J;  3GFL A;  4FTH A;  2KP6 A;  2L9N A;  3TDZ C;  4XLP F;  1HF0 A;  1I50 J;  2WAF A;  4I2O A;  2H6B A;  5M3F J;  1TL8 A;  5H20 A;  3GLL A;  4IHX A;  1I39 A;  3J80 Z;  3UKG A;  3FZV A;  4ENN A;  2VN2 A;  3F8B A;  3MKL A;  2XKP A;  4B47 A;  1SFU A;  2LKP A;  4NBQ A;  3AL0 C;  2L4M A;  5F1R A;  3G71 I;  1JTX A;  2GQQ A;  3BCB A;  1LDD A;  2E34 A;  4CO8 A;  3BWG A;  5FLX Z;  5J8F A;  2YPR A;  4JX4 A;  1TWG J;  5H6Q A;  2XGE A;  3IH4 A;  4Y17 A;  1RZ4 A;  2CU7 A;  3I59 B;  2XAU A;  5TRD A;  2BXZ A;  5M5W J;  2QKL B;  1QU3 A;  1WJ5 A;  4LIU A;  4WF2 A;  3HG9 A;  1ZKG A;  3B6C A;  1BIB A;  5K7H A;  5F04 A;  2LD5 A;  1PP7 U;  2L2O A;  1ZHF A;  2G9W A;  1K78 A;  1XDU A;  2VUM J;  2DT5 A;  4ETS A;  3MQ0 A;  5EZG A;  3MFK A;  2CSO A;  3LSG A;  1WQ2 A;  5JI6 A;  3BR2 A;  1MND A;  2QSF X;  1W7P D;  4YEL A;  3CMA I;  1WCM J;  4HG2 A;  1YFH A;  4EEF G;  3OL3 A;  1TZL A;  1VQM I;  1MZB A;  3F72 A;  1VZ0 A;  1BN5 A;  3MEX A;  4LG0 B;  2FXA A;  2YU9 J;  2P4W A;  1G3T A;  2XVC A;  2R7V A;  4KT6 A;  4XIC A;  3K1P A;  4YIR X;  3BZC A;  3KP7 A;  2MW8 A;  3BC8 A;  1I6X A;  3FK6 A;  4EJV A;  1WZ2 A;  2M0M A;  2ZC2 A;  4PDK A;  2CUJ A;  1K61 A; 
#chains in the Genus database with same CATH homology
 4G6T B;  4NUB A;  2IXS A;  3SZG A;  4KIS A;  2LYC A;  2ELJ A;  1N77 A;  4XKW A;  3K4J A;  4II2 A;  3OYN A;  2E5N A;  3HUG B;  3S3N A;  1G8X A;  2X6X A;  4ZTF A;  1G59 A;  1X1A A;  2LC2 A;  1U0J A;  2HPI A;  3FDY A;  4HSR A;  3PL8 A;  3PFY A;  2VKD A;  2WB1 A;  3OL4 A;  3ZXS A;  2ZXI A;  4XON A;  1WJC A;  2KPM A;  3H9J A;  4PK4 A;  4JOM A;  1N75 A;  3HKZ A;  4ZDP A;  1YX3 A;  2BVL A;  2M4K A;  2W4S A;  3DWL E;  4XN3 A;  2R7U A;  2L5Q A;  3E0J B;  3F9K A;  2KL4 A;  4HPQ A;  4HRI A;  3FHN A;  1X1B A;  2K9L A;  2VXD A;  1PJR A;  3PUB A;  2DT6 A;  3W2W A;  3BLY A;  3VDX A;  3U21 A;  3OYG A;  4OAY A;  2VLA A;  2FUG 2;  2Q1Z B;  2X6Y A;  2IS1 A;  2CUZ A;  3PSI A;  5HNF A;  1D0X A;  4XKV A;  1LVK A;  1D0Y A;  3FBI B;  2XDV A;  2JVG A;  2PMZ A;  3LFU A;  2R4G A;  3QOE A;  1WJF A;  3VYS B;  1NG7 A;  4BJT A;  3OS1 A;  4B43 A;  2Z2S B;  2KRH A;  4E7S A;  2IGM A;  2W1O A;  1WJA A;  3IAM 2;  4CCO A;  2R7S A;  1D1A A;  2RNG A;  4XQF A;  2VL8 A;  3CZ6 A;  3ZCO A;  4CH7 A;  2E60 A;  4DIQ A;  3MKZ A;  2BVM A;  3LL7 A;  3M8J A;  3MKY B;  3IP4 B;  4DJA A;  4PFP A;  3H9G A;  4B48 A;  3LMM A;  2R7R A;  2ZFU A;  4QPQ A;  2LOO A;  2IGN A;  3OYB A;  3PSF A;  1BOB A;  2JUG A;  3DPT A;  4XLC A;  2MAB A;  5CQG A;  4BQQ A;  3HXL A;  2K3P A;  4XN0 A;  5CKT A;  1DQU A;  2KQR A;  3EPZ A;  4E4H A;  1P9Q C;  2WY8 Q;  3NWT A;  2A6T A;  4ZDL A;  3A1Y A;  2XSJ C;  1D1B A;  2X1D A;  2UUZ A;  4BE2 A;  4EAT A;  4BE0 A;  4PJM A;  2W7N A;  1OR7 C;  4F91 B;  1PYV A;  3KEY A;  1DGR M;  3QYF A;  3DQV C;  2L7K A;  2VB6 A;  3RCO A;  3LSM A;  3OYA A;  4IZZ A;  4E7Z A;  4ZTJ A;  3OS2 A;  2AQF A;  3ZQQ A;  4BJ6 C;  3S32 A;  2OC6 A;  4AU7 A;  5JHF A;  4AVZ A;  2VAS A;  3HOT A;  2HVS A;  1TT0 A;  1QHG A;  4HST A;  4E7L A;  1MMD A;  4E7J A;  1W36 D;  2GOM A;  3S3O A;  4XOT A;  4E6K G;  3W3C A;  4JQF A;  3H5N A;  3K4K A;  1ERD A;  3L2U A;  3K4N A;  4PUS A;  3OYK A;  3VYR B;  2ZXH A;  1WJB A;  5FRM A;  2W00 A;  3G2B A;  1V5G A;  3VSK A;  3FBN B;  4BXF A;  4II3 A;  2DJI A;  2HPM A;  3A4C A;  4NQW B;  2R7Q A;  3DKY A;  4YEJ A;  4XOP A;  1J09 A;  1OLT A;  2CV0 A;  1WFX A;  1YE9 A;  5HLT A;  4BQN A;  4XKB A;  4XLF A;  2CV2 A;  3VYU B;  1FMW A;  3CES A;  3L2R A;  1JI8 A;  2K5C A;  4XLE A;  3EUH C;  2MYS A;  3W2A A;  2KHM A;  3QYB A;  2V1N A;  4IQ4 A;  3QYE A;  3K70 C;  3E1S A;  3S93 A;  3SEQ A;  2VQG A;  5CQE A;  4F52 A;  4LIV A;  3BG6 A;  2HVQ A;  4MLO A;  4FAS D;  2ZSI B;  2VIX A;  4Y33 A;  2VQC A;  4C30 A;  2Q2E B;  4RM2 A;  3DLA A;  3PJR A;  2WBM A;  4AYB A;  2ZSH B;  4IX7 A;  2LY2 A;  3CF2 A;  3RTR A;  4XNF A;  4BEH A;  5CPR B;  2R7W A;  4PSX A;  3MD2 A;  2IGO A;  2AQE A;  2A5W A;  2BW3 A;  4BDY A;  2VPL A;  3W2V A;  3IAS 2;  4C2T A;  2LRE A;  2LH9 A;  3SEZ A;  4NC8 A;  1Z21 A;  1D1C A;  3C2G A;  4PSW A;  5KHD A;  1W36 C;  2R7O A;  3AFH A;  3OYJ A;  4E7K A;  1X1C A;  4J00 A;  2CH0 A;  1UG0 A;  2X6W A;  2OV7 A;  1BR4 A;  2F4I A;  2P0W A;  4D9J A;  2XC7 A;  4D1Q A;  3NWS A;  2VQL A;  3OWT A;  3TMO A;  1NG6 A;  4BAC A;  2K9M A;  4CCK A;  3KYL A;  3OIQ A;  2XF5 A;  4HNT A;  4NC7 A;  4ZYA A;  4BGD A;  3HOS A;  2KRC A;  1X4O A;  3D5L A;  1Y6I A;  3K4B A;  3H35 A;  5HVQ C;  2DXI A;  3MKW B;  4N4N B;  4R79 A;  2RQQ A;  3RSN A;  3QOD A;  1UEL B;  3K70 D;  2HU9 A;  4XR6 A;  2WAQ A;  4LIT A;  3OYI A;  1X19 A;  3V42 A;  4BDZ A;  4CCN A;  2MD0 A;  3S3M A;  4NNJ A;  5LFA A;  2PJR A;  2KMU A;  4BU2 A;  2M7B A;  3A2K A;  2E1M B;  2VQH A;  1WJE A;  4P1W A;  4HEA 2;  3AKZ A;  3HL2 A;  4BEH B;  5KCM A;  3PNT A;  2VJ4 A;  3BCA A;  3OYH A;  2XF6 A;  4J01 A;  2VJI A;  2BW3 B;  2LY1 A;  4H4K C;  3GBG A;  4XOR A;  4U7B A;  3D5S C;  2M4G A;  2M3A A;  2WAE A;  3PNY A;  2IGK A;  4QPO A;  1MW7 A;  3H5A A;  4PJJ A;  1N78 A;  1S9H A;  3OYD A;  2VJ5 A;  4X0G A;  1D0Z A;  3CP8 A;  4XMY A;  4DGW B;  4BQO A;  2XF7 A;  3DEE A;  2X1E A;  3SYT A;  2OUM A;  2LRD A;  4PJL A;  2VXZ A;  4IQJ A;  3BG7 A;  3DTK A;  3RQ4 A;  3K4L A;  4DOZ A;  4BUP A;  4N4O B;  4XKC A;  3OMY A;  1HA8 A;  3OS0 A;  2X85 A;  1X1D A;  4CCL A;  1SFK A;  1MMN A;  4BE1 A;  3SDB A;  5TGT A;  1T0F C;  2O5R A;  2HQA A;  4BS9 A;  3CJR B;  3ZR8 X;  4F92 B;  3L2W A;  4XLA A;  3L2V A;  1YX5 A;  4E7I A;  2VKH A;  3TBI A;  4BJ5 C;  4LG3 A;  1Z3Y A;  3C2H A;  3CP2 A;  2CW7 A;  3TL4 X;  5HOO A;  3VWB A;  3PNV A;  2HVR A;  2V7F A;  4RMN A;  2R7X A;  2PJR B;  4CSW A;  3AL0 B;  1GLN A;  3VYT B;  3ZGK A;  4XM3 A;  3S8P A;  4ZDO A;  4DBR A;  3DTI A;  2W82 A;  2LBF A;  3K4M A;  2HNH A;  3I9V 2;  3ZRG A;  2DOA A;  2CMP A;  2E1M C;  4FET A;  3OIP A;  3OOU A;  2X51 A;  1DP3 A;  2V9K A;  2NOJ B;  2V6E A;  4CUG A;  4IKF A;  1MMG A;  4CCJ A;  4PFO A;  2CW8 A;  3VSL A;  4KIT B;  2V4J C;  2WY7 Q;  3J7A Y;  1E0E A;  2JVH A;  3L2Q A;  2RRE A;  2DCE A;  2MFZ A;  3DPU A;  2CS3 A;  1X4P A;  3MMY B;  2IS6 A;  2CV1 A;  1EA3 A;  4U87 A;  2HDW A;  3IUO A;  3HPG A;  2MC4 A;  4E7H A;  3LSI A;  4CCM A;  4B44 A;  3OYC A;  3DU5 A;  4ZC3 A;  1T95 A;  3H9Q A;  2CFO A;  3OYL A;  1SAU A;  2M7A A;  4CA0 A;  3LSK A;  3EUK L;  3LSH A;  2Y0S A;  1Y56 A;  1MNE A;  4HNU A;  4OAZ A;  4C9Y A;  3M1C A;  1K6Y A;  3N05 A;  2R7T A;  2UV1 A;  2JSP A;  2F5V A;  3OR1 C;  4ZJZ A;  2WAD A;  2KZV A;  2KP6 A;  2L9N A;  3D5R C;  2Z1D A;  4C2U A;  1Z3X A;  2WAF A;  1DGW Y;  1LFP A;  1LDK B;  3CJQ B;  3HC7 A;  2IS4 A;  5KNL A;  3OYF A;  3EUA A;  2KDO A;  2X1C A;  1WJD A;  5LD2 C;  3DTE A;  2LBF B;  4B47 A;  3AL0 C;  1IRX A;  5FRN A;  1AA7 A;  2VJJ A;  3BCB A;  3UR3 C;  2WA0 A;  4ITV A;  3DPL C;  3OYE A;  4OWR B;  3H5R A;  4XLH A;  2V26 A;  5HNH A;  3OYM A;  2DT7 B;  1Z7L A;  2JA2 A;  4P5O A;  1ZEL A;  2L9S A;  3K6G A;  4F3Q A;  2LG4 A;  2XAU A;  3RPU D;  4XL9 A;  2QKL B;  1QU3 A;  1WJ5 A;  4LIU A;  1R6R A;  3KX2 A;  4Y3O A;  3HG9 A;  4F55 A;  4YRV A;  2BOL A;  2F6C A;  2L2O A;  1KON A;  1LKX A;  3LSG A;  1UAA A;  4RLQ A;  3ONQ A;  3FKJ A;  5FRO A;  1MND A;  2E5Z A;  4F93 B;  4YEL A;  2I8D A;  2KLO A;  3HPH A;  3K10 A;  4GRI A;  4B3X A;  4KJZ A;  3UNG C;  4PJN A;  4DBQ A;  4HG2 A;  4CZC A;  1QHH D;  2Z16 A;  3OL3 A;  1TZL A;  4RLF A;  4Y4R A;  2GOX B;  3CMM A;  4ANJ A;  1MMA A;  2HZD A;  1VZ0 A;  1V5E A;  3OY9 A;  3DKX A;  2R7V A;  4KT6 A;  3K4C A;  4RM3 A;  3BC8 A;  1V5F A;  2IS2 A;  4BL0 B;  1FMV A;  1BR1 A;  3OR2 C;  3DU6 A;  1BR2 A;  2M0M A;  3I3L A;  2QKM B;  2CUJ A;  3H0D A;  2UWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...