3ZCOA

Crystal structure of s. cerevisiae sir3 c-terminal domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
ETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dimerization of Sir3 Via its C-Terminal Winged Helix Domain is Essential for Yeast Heterochromatin Formation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords REGULATORY PROTEIN SIR3
total genus 36
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2450 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zcoA00
3ZCOA
chains in the Genus database with same CATH superfamily
4I09A 4DYRA 3QOEA 1KU3A 2DXIA 5M3MJ 4BJ5C 4BH9A 4Z6YA 3WE3A 5DUKA 4LIUA 1HCRA 5E3LA 2D5VA 4JX6A 1YRNA 1R6RA 2IEKA 3I71A 5K1YA 2L7FP 3KZIC 5J8CA 3GTJJ 1K61A 5LGNA 4S04A 3GWZA 3SYTA 2FE3A 3WHBA 1N75A 2CFOA 1KZHA 4KUMA 3HPGA 3IC7A 2KQRA 1LEBA 1LB2A 3ZQGA 3SDBA 4HF0A 5FJ8J 3O8GA 2ZMEB 1BC7C 4CCKA 2VBWA 3LSMA 1D1BA 3CO7C 3K0LA 1YTYA 2Y2ZA 1XSXA 2GIVA 1A31A 1IDZA 6PAXA 4FISA 5B3SH 4RLFA 4DBRA 3J7ZI 2XAUA 3H36A 1X58A 1ETWA 2BY0A 2NNYA 1WCMJ 3NWSA 5FD5A 3DEEA 2NVYJ 4OIRF 1PVEA 2HYGD 2FD5A 1J7KA 2KZVA 1FBQA 3DLAA 1H0MA 4G7ZF 1ZLJA 2HGCA 1APLC 3Q9SA 1ZR2A 4IKFA 5HDNA 4C3IJ 2HNHA 3HOUJ 5IYBJ 1PYVA 4AU7A 3OYMA 3TGNA 3KZYA 1DGRM 2A68F 3VSKA 4ZDOA 2LSOA 1U8BA 1NHAA 2HOTA 4BEHA 3HKZN 1J0RA 5BPIA 4O3MA 3H5NA 4MEXF 2XSJC 2A69F 3LAJA 3M07A 2FBHA 3L2WA 3V42A 2HOAA 1S7EA 5F0CA 3TEDA 2LBFA 4U87A 2ZFUA 3DFGA 2BXYA 3RPUA 1ITYA 2H8RA 1L3LA 4YIRX 4G94A 1W1WE 1YW9A 1EH7A 4V19K 3A01A 1G2HA 1S29A 2NS7A 1JKRC 5K5OA 3O3KA 4WK8F 3JCUC 1KGSA 1ORKA 5C3EJ 3WTVC 2NNNA 1HLVA 3HRTA 3ZQIA 4C2MJ 2UWMA 3H3UA 2G7HA 2IS1A 1LDDA 3NAUA 4IHWA 2ETHA 2EZIA 3KEOA 4DGWB 3BG7A 4E7ZA 1HDPA 2RQPA 3OYDA 3SFZA 4DZPA 3CCSI 2X1CA 1JHHA 2MABA 2CW8A 5TISC 3BOQA 3D5SC 1K78A 3K4CA 3HUGB 1DU6A 4IEJA 3I9V2 3LWFA 1G3TA 1YW7A 1UCRA 4MLOA 2WTEA 2NVUB 3CO6C 1VZ0A 4CA0A 3ZQLA 1G3WA 4PJ0C 4IRIA 3D1NI 2WADA 4LITA 1TP4A 1B72B 2E2HJ 3KP5A 3KEYA 4E4HA 3HHGA 5JFRA 1D0XA 4HBLA 1LDJA 4E7JA 4CCJA 1TC3C 4Y7NJ 3JRDA 4HQMA 1LNWA 3DPUA 5FB2A 5HNHA 3EUHA 1JI8A 5M5YJ 3F0CA 2HYFA 3CC4I 3HGGA 5FLXZ 1R5HA 4FETA 3I4PA 3DPTA 4UVCA 3S2HJ 1FMVA 4NNJA 4BQQA 3KZZA 2UV1A 1RR8C 4D7NA 4M6XA 2ZJPF 4X0GA 2B63J 3SJMA 1IN5A 2XRNA 2JZYA 2HKOA 2XKOA 5GPAA 2LRDA 3KP7A 5E18F 3Q5FA 4U7BA 2CRGA 3BJ6A 5GAHJ 1QZYA 2VXDA 2STWA 2GOXB 4LK1F 3ABKH 3HOWJ 2EFOA 2FEZA 5EGOB 2DN0A 4HQEA 4A3IJ 2MA3A 1AOYA 3S32A 1FSEA 1TLHB 2K4JA 2L9RA 4PGHA 5JHUA 3OSGA 4V2GA 1EKEA 2W48A 5E3OA 5DDGA 1MBHA 1N25A 5JI6A 1RI7A 4NHJA 4Y17A 4LD5A 3CCYA 1T6SA 4LIVA 2IGMA 2L4MA 1TQMA 3HXLA 2MYSA 3E5QA 3FXUA 4GCVA 1FEXA 5DTDA 5ILVA 2OQGA 2DYSH 2C6YA 2PEXA 2X9DA 2KFDA 3H0DA 1XD7A 2VBZA 1IGNA 3CLOA 3BR6A 3FMSA 4KYWA 1IXCA 2K9SA 2NVTJ 3HOZJ 3E5XA 3VOEA 1U5TB 2GBYA 3DTIA 2P81A 5FLXK 4EGZA 1C0WA 3JRFA 1IRZA 2QSHX 5CVUA 1I3AA 3M8EA 1HW1A 3HC7A 3I56I 3BCBA 2BVLA 9ANTA 5FKOA 4B44A 1BOAA 4IRHA 3VYTB 3K70D 2DFFA 2GM4A 2V1NA 2BXZA 1Y39A 2M8GX 2BOLA 1F4KA 1SC7A 1GDTA 1K83J 2V6EA 4RLQA 1IDYA 4KFCA 2AQFA 3LSHA 3BTCA 4ESFA 2EV0A 4OIOF 2GWRA 2BW3A 3ZQFA 1S6LA 2F5DA 1OPCA 1WKMA 2I5UA 5IOZA 3DP7A 5ICCA 4RAZA 3MZHA 3HGYA 4ENKA 4CCLA 2Y75A 4UHTA 1SFUA 3W6KB 4AWXB 2PJPA 2BE5F 2VXZA 5ICFA 2NOGA 2L9SA 1YHQI 1XMKA 2NYXA 3JRBA 3ISPA 4B4CA 3LSIA 2M3AA 2IAIA 3GBGA 4MGRA 1R9TJ 2IA2A 3CC7I 2EZLA 1MJ9A 2ZSIB 3CMEI 3OV8A 4EQQA 1D1AA 5EGOA 2CJJA 2L02A 2KRHA 2RN7A 1ZRFA 4XLFA 1D1CA 2EWNA 4EM2A 2HOEA 3OYFA 2PG4A 3KYLA 5HODA 4KDPA 4WXDA 4F7ZA 1FY7A 2D2WA 1DU0A 2O8XA 4AIJA 1DUXC 2DA7A 3AG2H 3E3VA 3NQOA 4KICA 2NVXJ 1G3YA 2VBYA 3M9AA 5CVIA 2XF5A 1SFOJ 5D8KB 1XMAA 1ULYA 1V54H 3VWBA 3PQJA 2Q1ZB 4WXHA 5CPRB 2AQEA 2HTSA 5J47A 5D5XB 3L00A 4LG0B 5BNGA 3J81K 1EF4A 4YIIA 4A2UA 2G7UA 2GA1A 2DFIA 3WG7H 1WJEA 4RM3A 4MIMA 2ACJA 2Z33A 4CCMA 5LRSA 2HQAA 1W0UA 2VKVA 4FE4A 2A61A 3BR2A 5EEGA 5H20A 4A3DJ 3C7JA 2Y9ZA 3QOPA 4P1WA 2F4IA 3AL0B 1OLTA 4MQ9F 1QNTA 3TQNA 1BR4A 4D7MA 2LKXA 1QZZA 2PLYA 2XGXA 1KU9A 2L5QA 4M3EA 2PX9A 4BQAA 3W2AA 1D0ZA 4ENMA 4ZYGA 2LLKA 2P6SA 4YELA 2FOWA 2VJIA 3RPQA 3JTGA 3GW2A 2DT7B 4BKXA 2HVSA 2CMPA 4CCOA 2H27A 2JUGA 2JA8J 1O7LA 4NC8A 3TOAA 3BQYA 2KIUA 4XOTA 4XOPA 2JVGA 4OWRB 4RS8A 1SFKA 3SZGA 2ZJRF 5KVRA 2PJRB 4BUPA 5L3GA 1L0OC 4NUBA 5E17F 5FLVA 2HFHA 1HOMA 1RC9A 2P7CB 1YQAA 4EV0A 4M71A 4IHYA 4CSWA 5EEAA 3EUAA 2Y0SA 2YSRA 1YE9A 1LVAA 4P5OA 2VQGA 4A3JJ 3I5UA 3G1OA 2BZTA 4BQNA 4I02A 3GLXA 1AKHB 3B73A 5FGMA 4XLCA 2LKPA 2LF8A 5HS9A 4UUVA 4QPQA 4IHVA 2ZB9A 4MTDA 5CYVA 1ZK8A 1F1ZA 1V4RA 4R79A 2O3FA 2DOEA 3P9CA 1TNSA 2XPWA 2QLZA 1W5SA 2L4AA 3CJQB 2IPQX 3GO5A 3K9TA 2HPMA 3PL8A 5F1RA 2QSGX 2Y48A 3I55I 3IL2A 1IXSB 2V9KA 2M45A 2XSDC 3HOSA 3OIQA 4BY1J 1ZG5A 4GGGA 1VFCA 3GFMA 1IC8A 3HJEA 3BJAA 1CF7A 3OIOA 3G2BA 1MMAA 3DEWA 3HBLA 3ECHA 1U0JA 2CUJA 3T8TA 1A35A 3PQKA 3N97A 1VQ5I 1OMIA 2DMUA 5F1JA 5K5RA 1H9TA 4I6ZA 2J5PA 2DLLA 2LF7A 2ZKZA 2CWEA 5GPCA 3MCZA 3H0GJ 1SD4A 4F52A 4I0BA 1XTAA 4RB0A 1BI3A 3LNQA 1WJDA 1TTYA 3MKYB 3CLQA 2VIXA 2V9PA 5FD6A 5A2QZ 2EINH 3QU3A 5H6RA 3WGHA 1U2WA 1WGXA 3HG9A 2MD5A 2WAQA 1JTYA 4Q5SF 4CYCB 3RQ4A 4F55A 4AC0A 2O61A 3IUOA 1FLIA 4KN4X 2JUCA 1HSTA 1LUJB 3K4JA 4UB8C 3FXQA 4M9SA 2RAEA 1V55H 3H35A 3BLYA 3PFIA 4RMNA 4CZCA 1TWAJ 1GXPA 2R5ZB 5F27A 1STZA 3OSFA 1LPQA 5FLMJ 1POGA 1Z9CA 3T0YA 2JMWA 1J2XA 1OCZH 3JREA 4RBOA 1BIAA 2K86A 3OL4A 3RJPA 5LGTA 2IGKA 3LMMA 4NC6A 4GRIA 1RR7A 4I99C 1MGTA 3F3XA 1QQIA 2VKEA 4XLHA 4BJTA 4HX7A 4B09A 1FC3A 3I58A 4XKWA 3ERED 4II3A 5KAIC 2KL4A 3S1NJ 4S0HB 5CVRA 1K79A 1Z91A 5E1XA 5EF6A 1Y0NA 3RKXA 3F23A 2E7WA 2LR8A 2KIQA 3QPLA 3L2CA 2PMZN 2JPCA 3RKWA 5JLWA 3KYCB 3HSEA 3ZMZA 3MQ0A 4LK0F 2V1DA 1Y1VJ 5EG0A 2IGNA 3S93A 1AA7A 1GXQA 5C44J 2D1VA 1WPKA 4I2OA 2X0LA 4PZJA 1I1GA 1E0EA 4BXUA 4BE1A 1T0FC 2NXNB 3C2GA 3ZRGA 4PFPA 1I1SA 2LDUA 3FIWA 1IN6A 4HLYA 2O0YA 4XBFA 1T95A 4RDUA 3ABTA 3GEZA 1LDKB 1F5TA 3S8PA 3J80K 1P7IA 1RKTA 5DM6F 1R1TA 3TW7A 2W24A 3BQZA 1FOWA 3CTAA 1WVRA 2KDOA 2DBBA 5LEJA 4U0YA 3JSOA 1RUNA 3HOVJ 2X51A 4G8XA 2R4GA 2KIMA 3OR2C 1D5VA 4PJJA 5E1ZB 3OWTA 3ELKA 4UV8A 3DEUA 1SFXA 3L2RA 2A6HF 1VF9A 3RZOJ 1P7JA 4AUXA 3DKXA 4NQWA 1SAXA 4RAFA 2K27A 4ASNA 4I98B 3PIOF 5AONA 3I4MJ 2MBFA 4ZYDA 2HYJA 1GV2A 2R5ZA 4O5VA 3F21A 2XF7A 2V6CA 1JJ8C 1MJAA 1XGMA 2KKOA 1FMWA 1J5YA 2MH9A 3OMYA 3LFUA 3FM5A 2MLGA 5GAEJ 4GYGA 5JR3A 5DCMB 2RQQA 2GZWA 1Z77A 3PFYA 4HOBA 4A3FJ 1TQIA 2EPFA 5L3EA 3FXKA 1IW7F 3FX3A 2Y0SN 5FKKA 1NK2P 4OAZA 2CU7A 1B9MA 2WB1A 2HDWA 2XB5A 4BHPA 4XLAA 2VPLA 1JHFA 2XHKA 3E0JB 5E20A 3RTRA 4BS9A 3BG9A 3CUQB 2YUSA 3H9GA 3P9IA 4G7OF 5IYDJ 3AG4H 2UXXA 4D0PA 5IYCJ 4A5MA 1FNNA 1ZGWA 4OMYA 2OC6A 2E71A 2K02A 2M8EA 1YOVB 2GXBA 1B6AA 1XX5A 5JHFA 4FX4A 1OCOH 1TWHJ 1IUYA 4MFDA 5J3LA 1W7PA 2ZXJA 2PN6A 2LG4A 5E3MA 4XONA 4ETSA 3LQQA 2CO5A 3QODA 2OD5A 3FISA 1ETYA 2COBA 1EJ9A 1QVUA 1P4XA 4JBAA 2VE9A 3E6DA 3HOTA 2VUMJ 2VL8A 2BYVE 1WJAA 2VC1A 3D0SA 4CUGA 5C4XJ 2QVOA 2OCEA 5LRRA 4BHCA 1U9OA 2VQCA 2VBXA 1DP3A 1FSHA 4E7IA 2L2OA 2M0CA 4AVZA 5HOOA 3CF2A 3NARA 1X2NA 5CLSA 3HB9A 3S1QJ 2L9NA 1KQ8A 4P9UA 3RSNA 2TCTA 2HZTA 3WTTC 3WTWC 4A3CJ 2FMYA 1REPC 2M9HA 2VODA 2D1HA 1PDNC 1VTNC 1WI9A 3SZPA 2Y30A 2WAQN 4H0EA 3TKYA 3BZ6A 3K1MA 1TWCJ 4M3BA 5J4YA 5D5VB 1TW2A 3AG1H 2LFBA 3GFJA 1JUMA 2M4GA 2KIFA 3RIRA 3H3ZA 3PNTA 1X1PA 1R7JA 1XCBA 3L2UA 3ZQCA 4E7LA 4W97A 4QIWN 4ESBA 3ZN0A 3LSPA 4CYCA 1J75A 2KDZA 1IF1A 2IRFG 3K4NA 4Y15A 3ABLH 1B8IA 1FX7A 1Z7UA 2J5OA 2ZNZA 4I0AA 1O3RA 1TT0A 3OOUA 3VYSB 3PIPF 1BA5A 3CCVI 2F5EA 2JTVA 4WCGA 3F22A 1H89C 4A3LJ 5L3BA 3PSFA 3MZYA 1AWCA 3FBNB 1ACIA 4RB3C 2QBYB 1QVTA 4Q48A 3G1LA 2OZ6A 1KONA 2ESHA 2R7XA 2OV7A 3G1MA 1IRGA 3RI4A 3AKZA 4QWQA 4CO8A 3FHZA 2R7OA 1YIOA 4JX5A 4EJOA 2V1XA 3MEXA 1MIJA 3HUGA 2NVQJ 5J6XA 1IJWC 4GXOA 2FBKA 2E35A 4GO1A 4NBQA 4Y4RA 3PJRA 2AXLA 3FKJA 4ZYEA 1KA8A 3TP3A 1SD5A 4M6VA 1I27A 4L9TA 2GA2A 2R5YB 1MBEA 1AU7A 2JA6J 3REOA 2DOAA 5D5UB 4BXXJ 2I8DA 3RCOA 2OTLI 2R7DA 4XIDA 1DPUA 4BAYA 2CG4A 5D6FA 3GYHX 3K4MA 2FJ1A 4LJZF 2AXTC 4L9NA 3CQZJ 2H8WA 1GT0C 1USSA 2Y9YA 4CGZA 2QUFA 1K6OA 1I5ZA 5ED4A 1XB4A 4E6KG 1VQ7I 3JW4A 2IS6A 2QZ8A 3MAJA 1IZ1A 2B0LA 3V4GA 1ETQA 4XRFA 1XCVA 1OCPA 4HX4A 4A3GJ 3H5RA 2DA1A 1FTZA 2VJJA 1QHHD 1XDUA 3HZJA 5EJCA 1WJCA 3OIPA 4Q4ZF 1SAUA 5E79C 4ON0A 3JRHA 3OYHA 4CZZA 3A02A 2DT5A 4I76A 2VI6A 5B5EC 3MKZA 3S3MA 2DI3A 3CDIA 3JRIA 3R61A 3WE2A 2X85A 1QO0D 3WU2C 3S15J 1R1UA 3GFIA 3Q3SA 1PP8F 4IQJA 3BPXA 1S8NA 4ZH4F 3ABMH 4RA2A 4WXCA 3TOBA 4NQWB 4AIDA 2JQ7A 4HLXA 4U7DA 3WTYC 3A0BC 3F8CA 4IJAA 2DDAA 5CVJA 3HEFA 2XAJA 3EDPA 3UR3C 1D8KA 3IWZA 2ISZA 2LBFB 2CS3A 3BJOA 3G4SI 3WGGA 3GZ6A 4GFBA 3IKVA 3EYIA 1LFBA 4L0ZB 1U5TC 1Y6IA 2X1DA 4ZDLA 2WV0A 3WU1B 2DK5A 1SEUA 2BBYA 3V8JA 1U3EM 1I3QJ 3PO3J 2JJ7A 3G3ZA 4JP0A 3MWMA 3VFZA 3MMYB 1OYYA 1T98A 3BTIA 1OYWA 3VSLA 4YG2F 4WWCA 1IN4A 2QENA 4F91B 2PJRA 4DNCA 2JSCA 2OBPA 2W57A 1JTXA 2XAHA 4LLNA 4L5JA 1G8XA 1D3YA 4A6DA 3L2VA 3Q0VA 4LOCA 3JRCA 3H1CA 2FXAA 4LG3A 2WAFA 2HVQA 4M3FA 1SD7A 5K7HA 5HLHA 4XRSA 1MZBA 4DW6A 1SD6A 3M1CA 1KU2A 3FHNA 2AO9A 3E1SA 5K7FA 5EG0B 3FXJA 4QPOA 3GUDA 4R8HA 4QSHA 5F08A 4ZJZA 2Y69H 3ZOBA 2VONA 2ADUA 1LKXA 3C3WA 5BMZA 3CMAI 5LHHA 3H5AA 3M8JA 3GTMJ 2X4HA 4DQ2A 1MDMB 1MD0A 5EEHA 2DMQA 4UXNA 2FBIA 2HR3A 4IHTA 1IUFA 5J1UA 3DKYA 3F6VA 3CDLA 4KA4A 2P5KA 3BTLA 1JUPA 4J19A 5JLXA 1KQ9A 4G6QA 2VT3A 1BR2A 2QKLB 3IAM2 4AYBN 2NOJB 4II2A 3RKQA 3I0TA 1WJFA 2Z9OA 2F48A 2Z99A 3OL3A 3CMMA 4XSXF 2KZGA 3BG6A 5EZGA 1MMGA 3DCFA 3KP6A 4XKBA 2VQHA 2E36A 3GCMA 3E97A 2WWYA 2E34A 2BHZA 4OIPF 1T08B 1D0YA 1FBUA 4G12A 1U6GA 4NC7A 1YITI 1JKOC 3R4KA 3DV8A 1VQ4I 5GTHC 2ESNA 2KP6A 3QPSA 1SANA 4XQFA 2LYCA 2A6EF 1ETKA 2HQ5A 4BY7J 3CD6I 1JE8A 4HF1A 2VE8A 3FZVA 4A3EJ 1U78A 2ICWG 2ZFWA 2IT0A 1HXDA 3CP8A 1JKQC 3I4NJ 3R60A 1WH5A 1IN8A 1K78B 4BNCA 2L7ZA 5LBQA 1RPWA 4CH7A 2HXOA 5DCMA 3DU6A 2JRTA 2KMUA 3D5LA 3HIFA 2OZUA 2YPRA 3GZ5A 4BDYA 1MH4A 1ZAOA 2GXGA 2CQXA 2ZXIA 1W36D 1K7AA 2YU9J 3U21A 2KLOA 1X4PA 1O3QA 2VPRA 3CDHA 3M7GA 2JK3A 3ZMSA 2W4SA 1TWFJ 4KIGA 4QTRA 3BC8A 4JYKA 2EFPA 2WAEA 3DF8A 2DTRA 5ICGA 1OQYA 2P7VB 3OYGA 2KRFA 2OTJI 2HVRA 4IOAF 2HPIA 2R7QA 1VQOI 2YX4A 2K4BA 3K4LA 4UVBA 3ZQQA 1A36A 2DA3A 4PUSA 2HWVA 2HXIA 2X6OA 5B66C 1R4MB 2CUEA 4RGSA 4F92B 3FK6A 5TJJA 1R36A 2HQNA 3F8BA 5K5QA 5D6EA 3H9JA 2DPDA 4LG0A 1Z3XA 4FASD 5IT3A 2IW5A 1HKQA 2YU3A 1MBGA 4BDZA 1MNEA 3U1KA 5CJ9A 2LH9A 1YJ9I 1IN7A 4D5FA 5M5WJ 1BI2A 1NK3P 2QQBA 3F6OA 5D4RA 1QA6A 1OISA 4CICA 4C3JJ 1MNMC 3L9FA 2ECCA 3WGIA 3F8NA 1ENHA 2DFHA 1YS7A 4U88A 3WTXC 4HDVA 4BACA 5FKMA 2VJ5A 3S17J 1UMQA 4UV9A 3OS1A 4D5CA 5C4JJ 1ONVA 4HRIA 1VQLI 3VEPA 2WBMA 3T8RA 1Z6RA 1XSDA 3M4OJ 5F0FA 2K7LA 1BC8C 3JRAA 4KT5C 1J9IA 3V7CA 1BOBA 2FUG2 5CKTA 2ZMEC 3HHHA 4A93J 4RB1A 1MKMA 2ZXWH 5FRNA 2DMTA 3BTJA 3OYIA 2K9MA 2MC3A 3TDZC 4IL6C 2CUZA 4M3GA 5KHDA 1Z1DA 4HF2A 4Y52J 2ZMEA 3IKTA 1B59A 4A5NA 2E1MB 1A6QA 5J4VA 4WX9A 1KYZA 2IXSA 5FFXA 2GLOA 3SZTA 4Z2YA 1G3SA 3J80Z 1Z7LA 1E2XA 2OCCH 3PM1A 1HQCA 1YS6A 1LVKA 2A5WA 3F72A 1RNLA 3OYLA 1P2FA 3ZR8X 1JKPC 2Z2SB 1RUOA 2XVCA 4KJZA 1YRNB 1IRFA 4M3DA 2E19A 3O8HA 5ILSA 4XMYA 2XRLA 2P5VA 3ML6A 3ZP5A 2ZBKA 4ZTFA 1B72A 3LSRA 4PJMA 5DCFA 2QCOA 3WTZA 4UB6C 2VB6A 1S5LC 3ASNH 4F3QA 3LSJA 1G59A 4XNFA 2GAUA 1T2KA 1ZQ3P 4Y13A 5F6FA 3IH4A 2QQAA 2FMLA 3EETA 5ILUA 2DOFA 1JGSA 1UAAA 2XASA 2VN2A 2R93J 5FKLA 2EBIA 4OIQF 3KP2A 4DZJA 3LAPA 3T1BA 3PNVA 2RKHA 4D1QA 1USTA 1H8AC 1ZGJA 2DCEA 4ZZDA 3NEUA 2XPUA 2RREA 1X1AA 1QHGA 4BXFA 2WV1A 1YG2A 1I39A 2CV2A 3KEQA 2XGCA 4B1RA 4RGUA 4C3HJ 3BCAA 1RKWA 4HA8A 1A6IA 1IG7A 3TO9A 3VB2A 4HX8A 1OR7A 3P5JA 4KISA 1Z3YA 3G71I 1TQPA 3RYPA 2LK2A 4CYDA 1J09A 1YX5A 2XV4S 1S7OA 2KHMA 3N05A 5BQTA 5GADJ 2BVMA 2QWWA 3K7AJ 3EUKL 2Z16A 5EZHA 1SMTA 4N9HA 5H6QA 4XR6A 2XIGA 1R00A 3C18A 2FRHA 3GLLA 1Z6TA 4G7HF 3O2PE 2IS4A 1JGGA 2HI3A 5HVQC 4E7SA 2ZJQF 3K2ZA 5KCMA 1IV8A 4DOZA 2L0KA 4OAYA 1OKRA 3IRQA 2VJ4A 2CQ7A 2Z1DA 4KT6A 1R22A 3IRRA 3CUQC 4UVAA 2RVCA 1U8RA 1MNDA 1X3UA 3WG9A 5KNLA 2GQQA 4I7HA 4S05A 1IRXA 2BY1A 4KN7X 3U1DA 2D45A 1GLNA 2K9LA 3S2WA 2LVSA 3EUHC 3I59B 2P6TA 4IX7A 1X3WB 3LA7A 3PSIA 2FQ4A 2CGPA 5KAFC 5HLGA 3GTLJ 1QU3A 3K4KA 4ZZLA 3QQAA 2B7EA 1MBJA 2W85A 3U2RA 2DPUA 1Y8RB 3BROA 3LSKA 2ELKA 4XLPF 5FROA 3QYBA 2BY2A 2PMZA 3CESA 2W7NA 1SVMA 2OJED 1XGSA 1TZLA 3L2QA 3Q0UA 5LD2C 4XKVA 1HBXG 1SMYF 3WHCA 3JAMK 4UY8I 1S3JA 1HA8A 1EH8A 2PFBA 1VQMI 2W00A 4AM3A 1VQPI 2UUZA 2LOOA 3H3VK 4HG2A 2MD0A 3EPZA 3TL4X 5E8IA 1BI0A 1HSJA 2JSPA 2QSFX 2RDPA 3BY6A 1W7PD 5DV5A 2DFEA 4IPAA 3ZQ7A 2IBDA 1G6NA 1M1EB 2F2EA 3M1EA 3S1MJ 1Z05A 1LEAA 3QPTA 5HLIA 4TV7A 2V9VA 4XKCA 5E1WA 5DUIA 2EV5A 3E5UA 3LSTA 2PBIA 4A0XA 2LP0A 1T0FA 1V5FA 2R7WA 3FF5A 3QYEA 5CQEA 4IF4A 3SHFA 4B3XA 3FXRA 1ZKGA 1DQUA 1YW8A 4IHXA 3LOCA 4HSRA 2VT2A 1W5CC 4HNTA 3R0AA 1BW6A 5HS7A 3KIOA 1MDMA 2G0EA 2K5CA 3E7LA 1P9QC 4MO7A 5DEQA 3MFKA 3QP6A 1BW5A 1D8JA 2ME0A 3I53A 2R7VA 3CJTB 3EYYA 4B8XA 1FBSA 3HDDA 5FRMA 2EH3A 5IPAA 2R7ZJ 1UB9A 1PUFA 2YX7A 1F43A 3B6CA 3KLNA 4HPQA 3BT9A 4W1UA 2AHQA 3DXJF 3KP3A 1S72I 1PP7U 2E1MC 2DODA 3ESWB 2XROA 3I59A 5B1AH 5TRDA 4O6JA 3K1NA 1ON1A 2RGVA 2ZC2A 1BIBA 2RC4A 4Y33A 3CCUI 5F04A 1GV5A 2OPTA 1O57A 4ZTJA 1N78A 3CUQA 3S3OA 3W2WA 1XDSA 3DTEA 1X2MA 2Y0MA 4L5IA 3F8FA 3LL7A 1E3HA 2MGQA 4XRSG 4B48A 1HC8A 2KJCA 2EILH 2XB0X 1E17A 2TRTA 4XRMA 1LE8B 5ICEA 1ZG1A 4X6AJ 2LNBA 2N8GA 2HDCA 2O6GE 5M3FJ 5HNFA 1BM9A 1P4WA 3DU5A 2GXAA 2MG4A 3DLLF 3CCQI 2EZHA 1UG0A 2MC4A 2ZSHB 1I50J 4OINF 4B43A 3VYRB 3HM5A 2E1CA 1MMNA 2R7SA 4FHTA 1TT5B 4JQFA 2E5NA 2OAZA 2M2EA 2QM3A 1HKTA 5BPDA 4I01A 4A3KJ 3JRGA 1FPQA 5L3FA 5DYMA 3E6CC 4IRGA 2ZNYA 4YFKF 1QZEA 3GTGJ 4FTHA 3BR1A 2Q0OA 2QKMB 3AL0C 4IQ4A 4BJ6C 4HNVA 4PJNA 3J7YJ 3HTSB 4PJLA 1ZH5A 2P0WA 1WJBA 1FT9A 4IO9F 1O4XA 4KITB 1MJBA 2XAFA 3K4BA 2O7OA 3L1PA 1RESA 3UKGA 3BPVA 4FT8A 1OYIA 2VLAA 2Q2EA 2R92J 4DYCA 3QRFF 2ECBA 1PJRA 2X1EA 2DO7A 4EJTA 1EA3A 1XG1A 1ZGAA 1SVLA 1XS9A 3ZCOA 3R0JA 3GX4X 3MD2A 4EJUA 4BBSJ 4HDUA 1RRJA 4HW0A 3AG3H 4LLGF 4AD9A 2A5YB 3BR0A 5B1BH 3C2HA 1V3FA 1Z21A 2M5WA 2HEOA 3GTPJ 3COAC 2HQRA 4BQOA 2A3SA 4BEHB 3MKWB 1W36C 3J7AO 2CQQA 3MKLA 3CCRI 2X6WA 2F5CA 4IVNA 2IA1A 3PUBA 3J81Z 1FIPA 3OS0A 2IJLA 2DT6A 1VQ6I 4M9XA 3HOXJ 5JVGF 2GOMA 4OU0A 4MHGA 4HV6A 1GHCA 4XSZF 1HKSA 2FSWA 1KQ0A 2BGCA 5LEKA 1YX3A 2K85A 2K9NA 2F6CA 1OCCH 3G73A 1F36A 3ROUA 2EFWA 3HRMA 4MQVA 2LD5A 2BY3A 2PMUA 1XGOA 3W2VA 1Y8QB 3Q9VA 3FK7A 1TW3A 2VQLA 4YEJA 2QF7A 5ERIA 3GZNB 1IO2A 1WRJA 1D5YA 3ONQA 3HYIA 4ZC3A 2O03A 3MVPA 2R7TA 2JWTA 1IAWA 1FOXA 3DTKA 3TMOA 1LFPA 1O7FA 3OR1C 2STTA 1JUSA 5BS6A 4MEYF 1FWZA 2WC2A 3BZKA 3P9KA 4GDFA 4HAMA 1T8IA 2EFNA 4C2TA 5E3NA 3SXYA 4F93B 1MBKA 4MFEA 3N4MA 1B8IB 1LE8A 1VQNI 1JT6A 2ID3A 3OS2A 1WWXA 1X1DA 2PMHA 1H88C 2IS2A 3C1DA 3BG3A 3HRUA 2DQLA 3KLOA 1DDNA 3A2KA 2BV6A 4L5EA 2HZDA 2FOKA 1Q1HA 4A0ZA 3G6EI 2Z3YA 5GAGJ 1FIAA 3PO2J 1WI3A 2A05A 3DKWA 4BL0B 4IHSA 4UUSA 3D5RC 1Z67A 1MSFC 1VQ8I 1ZG3A 2DK8A 4WF2A 1Y0UA 1T33A 1WZ2A 3GTQJ 2O8KA 1YLFA 1R5ID 2CV1A 2H09A 1ZELA 3A4CA 3IH2A 2CH0A 3RQIA 2ZJ2A 3KCCA 2W82A 2F5VA 3ERMA 1CF7B 4A12A 2TDXA 4U0VA 4MTEA 4ENNA 1YIJI 4ZDPA 2DAOA 4HEA2 1NG7A 1FYLA 1W7PB 4B47A 1X3ZB 4DYQA 3JAMZ 5CVVA 1W4MA 2CW0F 2EB7A 1X1BA 2EZKA 3CZ6A 1GUUA 1R4NB 3LA2A 4EM1A 3A1YA 1NTCA 5J8FA 3TW6A 1ERDA 2YR2A 3LA3A 4EJWA 4C2UA 1UG2A 3FKIJ 4A0YA 4AIKA 3V7RA 4J01A 1JXSA 2I10A 4EVIA 1XGNA 4HSTA 4L0YB 4PSWA 3ZQHA 4EMSA 3I3LA 3ZMTA 4CHUA 1VNDA 1S7AA 4FCYA 1SFEA 2ZO4A 4AYBA 2XGDA 4A3BJ 1ZN2A 1ETVA 1Y56A 4M73A 3K70C 1R58A 2VKHA 3Q0WA 3SEQA 3BDDA 3LQRA 3RYRA 2LKSA 4RB2C 4J00A 2L54A 4RAGA 3TO7A 4DJAA 2IA0A 3X2QH 2E1OA 1DP7P 3GFLA 2EA2A 2OQRA 2MW8A 4ESJA 3CUOA 4M72A 1OCTC 3HSFA 2R5YA 1O3SA 3UNGC 2RV8A 3DBHB 3GTKJ 4E7KA 1ZREA 1J59A 3BZCA 4ZYAA 4H4KC 1WSUA 2QQ8A 1XPXA 2Q8KA 1HW5A 5AIQA 2CFXA 2DA6A 2W25A 1EH6A 4XN3A 2W1OA 2EIMH 2OUMA 2L3DA 4L9VA 3KPHA 4EM0B 1LFUP 1ZRDA 1XN7A 1MMSA 2EQRA 2DA4A 1UHSA 5E8GA 3FBIB 2DYRH 3QP5A 2A07F 2BHYA 3BR5A 1FP1D 2PQ8A 5GTIC 2BEOA 1FYKA 1QRYA 3BR3A 1BL0A 3DWLE 2JA7J 4P96A 1YFHA 5D4SA 3SQNA 1E3OC 2JPBA 2LREA 1PUEE 1A04A 1GVJA 5LGUA 4PCQA 3ZPLA 3ZMDA 5IT9K 3HSRA 4P9FA 2V7FA 3DBLB 2QA4I 2XDVA 3K1PA 5FO5A 4HNUA 3L7WA 4GYIA 5GP9A 4ZYHA 1HF0A 1EV7A 1QPMA 1X4OA 4L18B 1YI2I 1ETOA 2G9WA 2LY9A 2Z5UA 2JVHA 2FA5A 1UELB 3HL2A 4EGYA 3EQLF 1ZTRA 3K6GA 4N4NB 1UFMA 3ZMVA 3OYKA 1IV6A 3IP4B 1X1CA 2F5FA 2IGOA 4EATA 2XUBA 4BE2A 2KPMA 4HYEA 2V1UA 1MBFA 4M6YA 1IXRC 3IH3A 2NS0A 2RNJA 1B1BA 5IT9Z 4G6DA 2JRMA 5IP9J 1ZHFA 1YO5C 3AFHA 3OOPA 2VOPA 3V7SA 2K3PA 4XN0A 1V5GA 4ANJA 1K4TA 2HU9A 2XF6A 1ODDA 2XKPA 2NRAC 2XC7A 3GVAA 1YYVA 2IP2A 1YJNI 1GVDA 2JA5J 5HDKA 2JA2A 3NWTA 2MSYA 2WY8Q 3M8FA 3QU6A 3ZN1A 2E1NA 4HZFA 5HS8A 1JT0A 2DTZA 3KETA 4CDGA 3S1RJ 2KISA 2A6TA 2DW4A 5D5WB 4U0WA 5DM7F 1I6XA 3I54A 1WJ5A 2E2IJ 1KYWA 4YRVA 3C2BA 5J1RA 1MW7A 1O3TA 2ISYA 1Y1WJ 2V26A 4FE7A 4M74A 2XPVA 1R1VA 2EJRA 2OU2A 3W3CA 2E7XA 2K40A 4N9IA 2ZXHA 2ZCWA 5JVTA 4IZZA 3OY9A 4KIBA 2UZKA 3CCJI 2EA4A 3L09A 4C30A 3JR9A 1FYMA 1OCRH 4D9JA 2FX0A 1U5TA 2M4KA 2V4JC 4G6TB 1R49A 2DQRA 2ID6A 1AHDP 4FQGA 1QGPA 4XK4A 3VYUB 2L01A 3WTSC 2CUFA 3DQVC 4P55A 3FM3A 5HDGA 2H1KA 5J1YA 2QQ9A 2M1BA 3CCLI 2IVMA 3CP2A 2Q2EB 4JOMA 2F4OB 3VODA 5D8LB 2DA5A 2HS5A 4DBQA 1P6RA 3H92A 3CJRB 3TP0A 4BYYA 3QAHA 3QWLA 3S2DJ 2RNGA 2HTJA 3OYNA 2DMPA 3AAFA 4YIFA 1K4SA 3KE2A 2H94A 2EIJH 3GMEA 2VC0A 3CMYA 2QBYA 5BOXA 2HDDA 2DMNA 5HLTA 2E5ZA 2X6XA 2X6YA 3B6AA 2F4MB 3GXOA 1UZCA 2FNAA 1NG6A 4XICA 4XLNF 2M34A 3OYJA 1ZR4A 4CXFA 1XC5A 4QLCU 4BU2A 4ENJA 3SFIA 4R1HA 4XL9A 3VPRA 2W84A 3HKZA 1FP2A 4RAYA 4BBRJ 2L7KA 1FJLA 2E60A 3W6JB 3S14J 1FOYA 2M7BA 3ZXSA 2NAZA 4B3AA 3FMRA 3A01B 4BHBA 2UXNA 3HPHA 3KP4A 4EEFG 5H2FC 1YJWI 2VASA 1FTTA 5F64A 3HRSA 5LHGA 2OF7A 5TGTA 3OYEA 1U9NA 1JJ6C 3SDGA 2HKXA 1A5JA 5L3CA 4RGXA 2ME6A 4XLEA 3QYFA 2FQ3A 3F8MA 2R0QC 5KK1A 4XORA 1BN5A 5DS9A 1BJZA 1RIOH 4Y3OA 4LFUA 1N77A 2XGEA 1RZ4A 2WB1N 1UHWA 4LGWA 2GIZA 2QYOA 3K2AA 2Y31A 1R71A 4BE0A 2DJNA 2LMDA 1OR7C 5F0HA 1BBYA 3H9QA 2L9VA 2DJIA 2O5RA 4DIQA 5AIPA 2HOSA 4N4OB 2ELHA 5EDNA 1DGWY 1FOKA 3LFKA 3OYCA 3RDIA 2COMA 4M9ZA 4MNUA 3QPHA 1XSVA 1F9NA 1BJAA 2DU9A 2AS5F 1K6YA 4NB5A 1OFCX 1VI0A 5IY5H 2LC2A 2FNPA 1W0TA 1OJLA 2R3SA 2M87A 3ZMUA 3V8LA 5LHIA 4K2EA 3OYAA 4YFNF 2L7MP 2EFQA 2H1LA 1KU7A 3O6BB 1ZYRF 3FMQA 2EIKH 4AIHA 1FZPB 1T39A 5IP7J 3OYBA 2P5LC 1BR1A 3TO6A 1AKHA 2KJBA 3P7NA 4YFXF 4UUTA 5DD8A 2DA2A 3KYDB 1ON2A 4UUSB 5K7ZA 4PDKA 3WODF 2MLKA 1MH3A 4KIFA 1TNTA 3BWGA 4EJVA 2LY2A 3BP8A 3FXMA 1ZARA 2CSOA 3WU0A 4KNYA 1P92A 2QEXI 3CCMI 3E6BA 4IXAA 1V5EA 3JTHA 3HTUA 4KMUX 3S3NA 1HDDC 1H9GA 4C9YA 4HV5A 2R7UA 1T56A 1W5TA 3PNYA 2KRCA 2B9SA 3I64A 2WY7Q 1WFXA 2JN6A 2CQNA 2R7RA 3ZGKA 4BGDA 2O9LA 1DPRA 3MZ8A 3BG5A 1TWGJ 1TBXA 1R5GA 4N0BA 5L3DA 1XMXA 3CCEI 2EV6A 3ULQB 5J40A 4KMFA 1BI1A 3ASOH 1WHUA 1QBJA 4JK1X 2JT1A 3LSGA 4IOCF 3U9GA 4G9YA 3HOYJ 2K3FA 2YS9A 2XAQA 2K9QA 3RPUD 2KT0A 5IP6A 3RZDJ 3FWEA 3T5XA 1TL8A 3W6VA 1PUFB 2LTPA 3IV5A 3J7AY 3GF2A 4FX0A 3GTOJ 2VOOA 4X1EA 2ELJA 3K69A 1RETA 3F9KA 2M7AA 3RKYA 1NH3A 1ZRCA 3CJNA 5LLQA 1I6HJ 4PFOA 4LLLA 3JSPA 4PSXA 2E2JJ 3M3YJ 2P8TA 4OOIA 5DD4A 5IOYA 2M30A 3S16J 1CQTA 1LJ9A 3NRVA 1ETXA 1UHMA 2FF4A 1LQ1A 3VDXA 2P4WA 3TBIA 3FXOA 5M5XJ 5EYRA 1R23A 2H6CA 2H6BA 2WA0A 4A69C 1G4DA 4V2FA 4ITVA 4CCNA 2OA4A 2XAGA 1S9HA 1Z0XA 5A2QK 4E7HA 1MSEC 2DDBA 1QPIA 4A3MJ 1WQ2A 5FFZA 1ZLKA 4NDLA 3PUFA 2R7FA 4Q47A 5LFAA 2MH2A 4LB5A 2M0MA 3WTUC 4RGRA 3A03A 2VKDA 3FDYA 4PK4A 3B02A 4E70A 3CF5F 1HW2A 1MMDA 3MN2A 4ABZA 3DBRB 1X19A 2LY1A 4A6EA 1Q1VA 5FKNA 4L9JA 4OMZA 1SVOA 1UJ8A 2X48A 2V79A 3ECOA 5CQGA 4AVPA 1VQKI 3E6MA 2CW7A 1E3PA 1P4AA 2MFZA 3KX2A 2BW3B 3V8KA 4XM3A 1WH7A 3IWFA 4LB6B 2CQKA 3IAS2 3TDUC 3CC2I 1T38A 1VQ9I 3FXLA 4JX4A 3K10A 4RM2A 1B9NA 3ABUA 3DPLC 4PGGA 3R6SA 2PI0A 4LMYA 3A0HC 2CV0A 2NS8A 2QGUA 1B4AA 2EK5A 2FU4A 2CYYA 4UNOA 1CGPA 3KFWX 3SEZA 3IHUA
chains in the Genus database with same CATH topology
1ZELA 3QOEA 2DXIA 3A4CA 3OL4A 1Z3XA 4BJ5C 4FASD 2CH0A 2IGKA 2W82A 4BDZA 2F5VA 3LMMA 4LIUA 1MNEA 4GRIA 1R6RA 2LH9A 4ZDPA 4HEA2 4XLHA 1NG7A 4B47A 4BJTA 4XKWA 4II3A 2KL4A 3SYTA 1X1BA 1N75A 3CZ6A 2CFOA 4BACA 2VJ5A 3OS1A 3HPGA 3A1YA 4HRIA 2KQRA 1ERDA 2WBMA 4C2UA 3SDBA 4J01A 4CCKA 3LSMA 4HSTA 2IGNA 1D1BA 4PSWA 1AA7A 3S93A 3I3LA 1BOBA 2FUG2 5CKTA 4AYBA 5FRNA 3OYIA 2K9MA 1Y56A 5KHDA 2CUZA 3K70C 4BE1A 2VKHA 1T0FC 3C2GA 4RLFA 3SEQA 3ZRGA 4PFPA 2XAUA 4DBRA 3NWSA 4J00A 3DEEA 4DJAA 2E1MB 1T95A 2KZVA 3DLAA 2IXSA 1LDKB 3UNGC 3S8PA 1Z7LA 4IKFA 4E7KA 1LVKA 2HNHA 2KDOA 2A5WA 4ZYAA 4H4KC 3OYLA 3ZR8X 1PYVA 4AU7A 2Z2SB 3OYMA 2X51A 2R4GA 1DGRM 3OR2C 4KJZA 4PJJA 3VSKA 3OWTA 4ZDOA 4BEHA 3L2RA 4XN3A 2W1OA 2OUMA 4XMYA 4ZTFA 3H5NA 2XSJC 4PJMA 3DKXA 3FBIB 3L2WA 3V42A 2VB6A 4F3QA 2LBFA 4U87A 1G59A 2ZFUA 4XNFA 3DWLE 2XF7A 1UAAA 2LREA 1FMWA 3OMYA 3LFUA 2RQQA 3PNVA 2V7FA 3PFYA 2XDVA 4D1QA 2UWMA 4HNUA 2DCEA 2IS1A 1X4OA 2RREA 4OAZA 4DGWB 3BG7A 4E7ZA 1X1AA 1QHGA 4BXFA 2WB1A 2HDWA 3OYDA 2JVHA 1UELB 3HL2A 2X1CA 2CV2A 4XLAA 2VPLA 2MABA 2CW8A 3D5SC 3E0JB 3BCAA 3RTRA 4BS9A 3K4CA 3HUGB 3K6GA 4N4NB 3I9V2 3H9GA 3OYKA 3IP4B 4KISA 1Z3YA 1X1CA 4MLOA 2IGOA 4EATA 1J09A 1YX5A 4BE2A 2KHMA 2KPMA 1VZ0A 3N05A 4CA0A 2BVMA 3EUKL 2OC6A 2Z16A 4XR6A 5JHFA 2WADA 3AFHA 4LITA 2K3PA 4XN0A 1V5GA 4ANJA 3KEYA 2HU9A 2XF6A 4E4HA 1D0XA 4E7JA 2IS4A 4CCJA 2XC7A 2LG4A 4XONA 5HVQC 4E7SA 3QODA 3DPUA 5KCMA 4DOZA 5HNHA 1JI8A 4OAYA 2JA2A 3NWTA 2VJ4A 2Z1DA 2WY8Q 3HOTA 2VL8A 4KT6A 4FETA 1WJAA 4CUGA 3DPTA 1MNDA 2A6TA 1FMVA 4NNJA 4BQQA 2UV1A 5KNLA 2VQCA 1DP3A 1IRXA 4E7IA 2L2OA 4AVZA 1WJ5A 5HOOA 4X0GA 4YRVA 3CF2A 1GLNA 1MW7A 2K9LA 2L9NA 3RSNA 2V26A 3EUHC 2LRDA 3W3CA 4IX7A 4U7BA 3PSIA 2ZXHA 2VXDA 4IZZA 2GOXB 1QU3A 3K4KA 3OY9A 4C30A 3LSKA 3S32A 2M4GA 4D9JA 4G6TB 2M4KA 2V4JC 5FROA 3PNTA 2PMZA 3CESA 3QYBA 3L2UA 2W7NA 4E7LA 1TZLA 3L2QA 3VYUB 5LD2C 4XKVA 3DQVC 1HA8A 3K4NA 4LIVA 2IGMA 3HXLA 2W00A 2MYSA 2UUZA 2LOOA 4HG2A 2MD0A 3CP2A 1TT0A 2Q2EB 3EPZA 3OOUA 4JOMA 3VYSB 3TL4X 3H0DA 2JSPA 4DBQA 3CJRB 3PSFA 3FBNB 3DTIA 2RNGA 3OYNA 2R7XA 1KONA 2OV7A 3AKZA 4XKCA 2R7OA 3HC7A 3BCBA 2BVLA 5HLTA 2E5ZA 2X6XA 2X6YA 4B44A 3VYTB 3K70D 1NG6A 2V1NA 4Y4RA 3PJRA 1V5FA 2BOLA 3FKJA 3OYJA 2R7WA 3QYEA 5CQEA 4B3XA 4BU2A 2V6EA 4RLQA 2AQFA 1DQUA 3LSHA 4HSRA 4XL9A 3HKZA 4HNTA 2BW3A 2DOAA 2L7KA 2I8DA 2E60A 3RCOA 2M7BA 3ZXSA 2K5CA 1P9QC 4CCLA 3K4MA 3HPHA 2VXZA 2VASA 2R7VA 2L9SA 5FRMA 5TGTA 3OYEA 3LSIA 4HPQA 2M3AA 3GBGA 4E6KG 2IS6A 4XLEA 3QYFA 2E1MC 2ZSIB 4XORA 4Y3OA 1N77A 1D1AA 2KRHA 4Y33A 3H5RA 4XLFA 4BE0A 2VJJA 1D1CA 1QHHD 4ZTJA 1N78A 3OYFA 1OR7C 1WJCA 3OIPA 1SAUA 3KYLA 3S3OA 3W2WA 3DTEA 3H9QA 4DIQA 2DJIA 2O5RA 3OYHA 4N4OB 1DGWY 3OYCA 3LL7A 4B48A 3MKZA 2XF5A 3S3MA 1K6YA 3VWBA 2Q1ZB 5CPRB 2AQEA 2LC2A 2X85A 5HNFA 4IQJA 3DU5A 2MC4A 1UG0A 2ZSHB 4NQWB 4B43A 3OYAA 3VYRB 1WJEA 4RM3A 1MMNA 4CCMA 2HQAA 2R7SA 4JQFA 3UR3C 2E5NA 3OYBA 4P1WA 2LBFB 2F4IA 3AL0B 1BR1A 1OLTA 2CS3A 1BR4A 1Y6IA 2X1DA 4ZDLA 2QKMB 3AL0C 4IQ4A 2L5QA 4BJ6C 4PJNA 4PJLA 2P0WA 3W2AA 1D0ZA 1WJBA 2LY2A 3MMYB 4KITB 3K4BA 4YELA 2VJIA 3VSLA 2PJRA 4F91B 2DT7B 2HVSA 2VLAA 2CMPA 4CCOA 1V5EA 2JUGA 1G8XA 3S3NA 1PJRA 2X1EA 4NC8A 4C9YA 3L2VA 2R7UA 1EA3A 4LG3A 2WAFA 4XOTA 2HVQA 4XOPA 3ZCOA 2JVGA 2KRCA 3PNYA 3MD2A 4OWRB 2WY7Q 1WFXA 1SFKA 3SZGA 2R7RA 3M1CA 3ZGKA 4BGDA 3FHNA 2PJRB 4BUPA 3E1SA 4NUBA 3C2HA 4QPOA 1Z21A 4ZJZA 3LSGA 4BQOA 4BEHB 1LKXA 4CSWA 3MKWB 1W36C 3EUAA 1E0EA 2Y0SA 3H5AA 1YE9A 3M8JA 4P5OA 2VQGA 4BQNA 2X6WA 3RPUD 4XLCA 3PUBA 3OS0A 4QPQA 3DKYA 2DT6A 3J7AY 2ELJA 4R79A 2GOMA 3F9KA 2M7AA 1BR2A 2QKLB 3IAM2 4PFOA 2NOJB 3CJQB 4II2A 4PSXA 1YX3A 2HPMA 3PL8A 1WJFA 3OL3A 3CMMA 3BG6A 1MMGA 2F6CA 2V9KA 4XKBA 3HOSA 2VQHA 3OIQA 3VDXA 3TBIA 1D0YA 2WA0A 4NC7A 3W2VA 4ITVA 3G2BA 1MMAA 4CCNA 2VQLA 1U0JA 1S9HA 2CUJA 4YEJA 4E7HA 2KP6A 3ONQA 4ZC3A 2R7TA 4XQFA 2LYCA 5LFAA 3DTKA 3TMOA 1LFPA 2M0MA 2VKDA 3CP8A 3OR1C 3FDYA 4F52A 4PK4A 1MMDA 1WJDA 4CH7A 1X19A 3MKYB 3DU6A 2KMUA 2LY1A 3D5LA 4C2TA 2VIXA 4F93B 4BDYA 1W36D 2ZXIA 3HG9A 3OS2A 1X1DA 2IS2A 3U21A 2WAQA 5CQGA 2KLOA 1X4PA 2W4SA 3RQ4A 4F55A 3BC8A 2CW7A 2MFZA 3KX2A 3IUOA 3A2KA 2BW3B 2WAEA 3K4JA 4XM3A 2HZDA 3OYGA 3IAS2 2HVRA 2HPIA 3H35A 2R7QA 3BLYA 3K4LA 4RMNA 4CZCA 3K10A 4RM2A 3DPLC 3ZQQA 4PUSA 4BL0B 3D5RC 4F92B 2CV0A 2CV1A 3SEZA 3H9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZCO A; 
#chains in the Genus database with same CATH topology
 4I09 A;  4DYR A;  3QOE A;  1KU3 A;  2DXI A;  5M3M J;  4BJ5 C;  4BH9 A;  4Z6Y A;  3WE3 A;  5DUK A;  4LIU A;  1HCR A;  5E3L A;  2D5V A;  4JX6 A;  1YRN A;  1R6R A;  2IEK A;  3I71 A;  5K1Y A;  2L7F P;  3KZI C;  5J8C A;  3GTJ J;  1K61 A;  5LGN A;  4S04 A;  3GWZ A;  3SYT A;  2FE3 A;  3WHB A;  1N75 A;  2CFO A;  1KZH A;  4KUM A;  3HPG A;  3IC7 A;  2KQR A;  1LEB A;  1LB2 A;  3ZQG A;  3SDB A;  4HF0 A;  5FJ8 J;  3O8G A;  2ZME B;  1BC7 C;  4CCK A;  2VBW A;  3LSM A;  1D1B A;  3CO7 C;  3K0L A;  1YTY A;  2Y2Z A;  1XSX A;  2GIV A;  1A31 A;  1IDZ A;  6PAX A;  4FIS A;  5B3S H;  4RLF A;  4DBR A;  3J7Z I;  2XAU A;  3H36 A;  1X58 A;  1ETW A;  2BY0 A;  2NNY A;  1WCM J;  3NWS A;  5FD5 A;  3DEE A;  2NVY J;  4OIR F;  1PVE A;  2HYG D;  2FD5 A;  1J7K A;  2KZV A;  1FBQ A;  3DLA A;  1H0M A;  4G7Z F;  1ZLJ A;  2HGC A;  1APL C;  3Q9S A;  1ZR2 A;  4IKF A;  5HDN A;  4C3I J;  2HNH A;  3HOU J;  5IYB J;  1PYV A;  4AU7 A;  3OYM A;  3TGN A;  3KZY A;  1DGR M;  2A68 F;  3VSK A;  4ZDO A;  2LSO A;  1U8B A;  1NHA A;  2HOT A;  4BEH A;  3HKZ N;  1J0R A;  5BPI A;  4O3M A;  3H5N A;  4MEX F;  2XSJ C;  2A69 F;  3LAJ A;  3M07 A;  2FBH A;  3L2W A;  3V42 A;  2HOA A;  1S7E A;  5F0C A;  3TED A;  2LBF A;  4U87 A;  2ZFU A;  3DFG A;  2BXY A;  3RPU A;  1ITY A;  2H8R A;  1L3L A;  4YIR X;  4G94 A;  1W1W E;  1YW9 A;  1EH7 A;  4V19 K;  3A01 A;  1G2H A;  1S29 A;  2NS7 A;  1JKR C;  5K5O A;  3O3K A;  4WK8 F;  3JCU C;  1KGS A;  1ORK A;  5C3E J;  3WTV C;  2NNN A;  1HLV A;  3HRT A;  3ZQI A;  4C2M J;  2UWM A;  3H3U A;  2G7H A;  2IS1 A;  1LDD A;  3NAU A;  4IHW A;  2ETH A;  2EZI A;  3KEO A;  4DGW B;  3BG7 A;  4E7Z A;  1HDP A;  2RQP A;  3OYD A;  3SFZ A;  4DZP A;  3CCS I;  2X1C A;  1JHH A;  2MAB A;  2CW8 A;  5TIS C;  3BOQ A;  3D5S C;  1K78 A;  3K4C A;  3HUG B;  1DU6 A;  4IEJ A;  3I9V 2;  3LWF A;  1G3T A;  1YW7 A;  1UCR A;  4MLO A;  2WTE A;  2NVU B;  3CO6 C;  1VZ0 A;  4CA0 A;  3ZQL A;  1G3W A;  4PJ0 C;  4IRI A;  3D1N I;  2WAD A;  4LIT A;  1TP4 A;  1B72 B;  2E2H J;  3KP5 A;  3KEY A;  4E4H A;  3HHG A;  5JFR A;  1D0X A;  4HBL A;  1LDJ A;  4E7J A;  4CCJ A;  1TC3 C;  4Y7N J;  3JRD A;  4HQM A;  1LNW A;  3DPU A;  5FB2 A;  5HNH A;  3EUH A;  1JI8 A;  5M5Y J;  3F0C A;  2HYF A;  3CC4 I;  3HGG A;  5FLX Z;  1R5H A;  4FET A;  3I4P A;  3DPT A;  4UVC A;  3S2H J;  1FMV A;  4NNJ A;  4BQQ A;  3KZZ A;  2UV1 A;  1RR8 C;  4D7N A;  4M6X A;  2ZJP F;  4X0G A;  2B63 J;  3SJM A;  1IN5 A;  2XRN A;  2JZY A;  2HKO A;  2XKO A;  5GPA A;  2LRD A;  3KP7 A;  5E18 F;  3Q5F A;  4U7B A;  2CRG A;  3BJ6 A;  5GAH J;  1QZY A;  2VXD A;  2STW A;  2GOX B;  4LK1 F;  3ABK H;  3HOW J;  2EFO A;  2FEZ A;  5EGO B;  2DN0 A;  4HQE A;  4A3I J;  2MA3 A;  1AOY A;  3S32 A;  1FSE A;  1TLH B;  2K4J A;  2L9R A;  4PGH A;  5JHU A;  3OSG A;  4V2G A;  1EKE A;  2W48 A;  5E3O A;  5DDG A;  1MBH A;  1N25 A;  5JI6 A;  1RI7 A;  4NHJ A;  4Y17 A;  4LD5 A;  3CCY A;  1T6S A;  4LIV A;  2IGM A;  2L4M A;  1TQM A;  3HXL A;  2MYS A;  3E5Q A;  3FXU A;  4GCV A;  1FEX A;  5DTD A;  5ILV A;  2OQG A;  2DYS H;  2C6Y A;  2PEX A;  2X9D A;  2KFD A;  3H0D A;  1XD7 A;  2VBZ A;  1IGN A;  3CLO A;  3BR6 A;  3FMS A;  4KYW A;  1IXC A;  2K9S A;  2NVT J;  3HOZ J;  3E5X A;  3VOE A;  1U5T B;  2GBY A;  3DTI A;  2P81 A;  5FLX K;  4EGZ A;  1C0W A;  3JRF A;  1IRZ A;  2QSH X;  5CVU A;  1I3A A;  3M8E A;  1HW1 A;  3HC7 A;  3I56 I;  3BCB A;  2BVL A;  9ANT A;  5FKO A;  4B44 A;  1BOA A;  4IRH A;  3VYT B;  3K70 D;  2DFF A;  2GM4 A;  2V1N A;  2BXZ A;  1Y39 A;  2M8G X;  2BOL A;  1F4K A;  1SC7 A;  1GDT A;  1K83 J;  2V6E A;  4RLQ A;  1IDY A;  4KFC A;  2AQF A;  3LSH A;  3BTC A;  4ESF A;  2EV0 A;  4OIO F;  2GWR A;  2BW3 A;  3ZQF A;  1S6L A;  2F5D A;  1OPC A;  1WKM A;  2I5U A;  5IOZ A;  3DP7 A;  5ICC A;  4RAZ A;  3MZH A;  3HGY A;  4ENK A;  4CCL A;  2Y75 A;  4UHT A;  1SFU A;  3W6K B;  4AWX B;  2PJP A;  2BE5 F;  2VXZ A;  5ICF A;  2NOG A;  2L9S A;  1YHQ I;  1XMK A;  2NYX A;  3JRB A;  3ISP A;  4B4C A;  3LSI A;  2M3A A;  2IAI A;  3GBG A;  4MGR A;  1R9T J;  2IA2 A;  3CC7 I;  2EZL A;  1MJ9 A;  2ZSI B;  3CME I;  3OV8 A;  4EQQ A;  1D1A A;  5EGO A;  2CJJ A;  2L02 A;  2KRH A;  2RN7 A;  1ZRF A;  4XLF A;  1D1C A;  2EWN A;  4EM2 A;  2HOE A;  3OYF A;  2PG4 A;  3KYL A;  5HOD A;  4KDP A;  4WXD A;  4F7Z A;  1FY7 A;  2D2W A;  1DU0 A;  2O8X A;  4AIJ A;  1DUX C;  2DA7 A;  3AG2 H;  3E3V A;  3NQO A;  4KIC A;  2NVX J;  1G3Y A;  2VBY A;  3M9A A;  5CVI A;  2XF5 A;  1SFO J;  5D8K B;  1XMA A;  1ULY A;  1V54 H;  3VWB A;  3PQJ A;  2Q1Z B;  4WXH A;  5CPR B;  2AQE A;  2HTS A;  5J47 A;  5D5X B;  3L00 A;  4LG0 B;  5BNG A;  3J81 K;  1EF4 A;  4YII A;  4A2U A;  2G7U A;  2GA1 A;  2DFI A;  3WG7 H;  1WJE A;  4RM3 A;  4MIM A;  2ACJ A;  2Z33 A;  4CCM A;  5LRS A;  2HQA A;  1W0U A;  2VKV A;  4FE4 A;  2A61 A;  3BR2 A;  5EEG A;  5H20 A;  4A3D J;  3C7J A;  2Y9Z A;  3QOP A;  4P1W A;  2F4I A;  3AL0 B;  1OLT A;  4MQ9 F;  1QNT A;  3TQN A;  1BR4 A;  4D7M A;  2LKX A;  1QZZ A;  2PLY A;  2XGX A;  1KU9 A;  2L5Q A;  4M3E A;  2PX9 A;  4BQA A;  3W2A A;  1D0Z A;  4ENM A;  4ZYG A;  2LLK A;  2P6S A;  4YEL A;  2FOW A;  2VJI A;  3RPQ A;  3JTG A;  3GW2 A;  2DT7 B;  4BKX A;  2HVS A;  2CMP A;  4CCO A;  2H27 A;  2JUG A;  2JA8 J;  1O7L A;  4NC8 A;  3TOA A;  3BQY A;  2KIU A;  4XOT A;  4XOP A;  2JVG A;  4OWR B;  4RS8 A;  1SFK A;  3SZG A;  2ZJR F;  5KVR A;  2PJR B;  4BUP A;  5L3G A;  1L0O C;  4NUB A;  5E17 F;  5FLV A;  2HFH A;  1HOM A;  1RC9 A;  2P7C B;  1YQA A;  4EV0 A;  4M71 A;  4IHY A;  4CSW A;  5EEA A;  3EUA A;  2Y0S A;  2YSR A;  1YE9 A;  1LVA A;  4P5O A;  2VQG A;  4A3J J;  3I5U A;  3G1O A;  2BZT A;  4BQN A;  4I02 A;  3GLX A;  1AKH B;  3B73 A;  5FGM A;  4XLC A;  2LKP A;  2LF8 A;  5HS9 A;  4UUV A;  4QPQ A;  4IHV A;  2ZB9 A;  4MTD A;  5CYV A;  1ZK8 A;  1F1Z A;  1V4R A;  4R79 A;  2O3F A;  2DOE A;  3P9C A;  1TNS A;  2XPW A;  2QLZ A;  1W5S A;  2L4A A;  3CJQ B;  2IPQ X;  3GO5 A;  3K9T A;  2HPM A;  3PL8 A;  5F1R A;  2QSG X;  2Y48 A;  3I55 I;  3IL2 A;  1IXS B;  2V9K A;  2M45 A;  2XSD C;  3HOS A;  3OIQ A;  4BY1 J;  1ZG5 A;  4GGG A;  1VFC A;  3GFM A;  1IC8 A;  3HJE A;  3BJA A;  1CF7 A;  3OIO A;  3G2B A;  1MMA A;  3DEW A;  3HBL A;  3ECH A;  1U0J A;  2CUJ A;  3T8T A;  1A35 A;  3PQK A;  3N97 A;  1VQ5 I;  1OMI A;  2DMU A;  5F1J A;  5K5R A;  1H9T A;  4I6Z A;  2J5P A;  2DLL A;  2LF7 A;  2ZKZ A;  2CWE A;  5GPC A;  3MCZ A;  3H0G J;  1SD4 A;  4F52 A;  4I0B A;  1XTA A;  4RB0 A;  1BI3 A;  3LNQ A;  1WJD A;  1TTY A;  3MKY B;  3CLQ A;  2VIX A;  2V9P A;  5FD6 A;  5A2Q Z;  2EIN H;  3QU3 A;  5H6R A;  3WGH A;  1U2W A;  1WGX A;  3HG9 A;  2MD5 A;  2WAQ A;  1JTY A;  4Q5S F;  4CYC B;  3RQ4 A;  4F55 A;  4AC0 A;  2O61 A;  3IUO A;  1FLI A;  4KN4 X;  2JUC A;  1HST A;  1LUJ B;  3K4J A;  4UB8 C;  3FXQ A;  4M9S A;  2RAE A;  1V55 H;  3H35 A;  3BLY A;  3PFI A;  4RMN A;  4CZC A;  1TWA J;  1GXP A;  2R5Z B;  5F27 A;  1STZ A;  3OSF A;  1LPQ A;  5FLM J;  1POG A;  1Z9C A;  3T0Y A;  2JMW A;  1J2X A;  1OCZ H;  3JRE A;  4RBO A;  1BIA A;  2K86 A;  3OL4 A;  3RJP A;  5LGT A;  2IGK A;  3LMM A;  4NC6 A;  4GRI A;  1RR7 A;  4I99 C;  1MGT A;  3F3X A;  1QQI A;  2VKE A;  4XLH A;  4BJT A;  4HX7 A;  4B09 A;  1FC3 A;  3I58 A;  4XKW A;  3ERE D;  4II3 A;  5KAI C;  2KL4 A;  3S1N J;  4S0H B;  5CVR A;  1K79 A;  1Z91 A;  5E1X A;  5EF6 A;  1Y0N A;  3RKX A;  3F23 A;  2E7W A;  2LR8 A;  2KIQ A;  3QPL A;  3L2C A;  2PMZ N;  2JPC A;  3RKW A;  5JLW A;  3KYC B;  3HSE A;  3ZMZ A;  3MQ0 A;  4LK0 F;  2V1D A;  1Y1V J;  5EG0 A;  2IGN A;  3S93 A;  1AA7 A;  1GXQ A;  5C44 J;  2D1V A;  1WPK A;  4I2O A;  2X0L A;  4PZJ A;  1I1G A;  1E0E A;  4BXU A;  4BE1 A;  1T0F C;  2NXN B;  3C2G A;  3ZRG A;  4PFP A;  1I1S A;  2LDU A;  3FIW A;  1IN6 A;  4HLY A;  2O0Y A;  4XBF A;  1T95 A;  4RDU A;  3ABT A;  3GEZ A;  1LDK B;  1F5T A;  3S8P A;  3J80 K;  1P7I A;  1RKT A;  5DM6 F;  1R1T A;  3TW7 A;  2W24 A;  3BQZ A;  1FOW A;  3CTA A;  1WVR A;  2KDO A;  2DBB A;  5LEJ A;  4U0Y A;  3JSO A;  1RUN A;  3HOV J;  2X51 A;  4G8X A;  2R4G A;  2KIM A;  3OR2 C;  1D5V A;  4PJJ A;  5E1Z B;  3OWT A;  3ELK A;  4UV8 A;  3DEU A;  1SFX A;  3L2R A;  2A6H F;  1VF9 A;  3RZO J;  1P7J A;  4AUX A;  3DKX A;  4NQW A;  1SAX A;  4RAF A;  2K27 A;  4ASN A;  4I98 B;  3PIO F;  5AON A;  3I4M J;  2MBF A;  4ZYD A;  2HYJ A;  1GV2 A;  2R5Z A;  4O5V A;  3F21 A;  2XF7 A;  2V6C A;  1JJ8 C;  1MJA A;  1XGM A;  2KKO A;  1FMW A;  1J5Y A;  2MH9 A;  3OMY A;  3LFU A;  3FM5 A;  2MLG A;  5GAE J;  4GYG A;  5JR3 A;  5DCM B;  2RQQ A;  2GZW A;  1Z77 A;  3PFY A;  4HOB A;  4A3F J;  1TQI A;  2EPF A;  5L3E A;  3FXK A;  1IW7 F;  3FX3 A;  2Y0S N;  5FKK A;  1NK2 P;  4OAZ A;  2CU7 A;  1B9M A;  2WB1 A;  2HDW A;  2XB5 A;  4BHP A;  4XLA A;  2VPL A;  1JHF A;  2XHK A;  3E0J B;  5E20 A;  3RTR A;  4BS9 A;  3BG9 A;  3CUQ B;  2YUS A;  3H9G A;  3P9I A;  4G7O F;  5IYD J;  3AG4 H;  2UXX A;  4D0P A;  5IYC J;  4A5M A;  1FNN A;  1ZGW A;  4OMY A;  2OC6 A;  2E71 A;  2K02 A;  2M8E A;  1YOV B;  2GXB A;  1B6A A;  1XX5 A;  5JHF A;  4FX4 A;  1OCO H;  1TWH J;  1IUY A;  4MFD A;  5J3L A;  1W7P A;  2ZXJ A;  2PN6 A;  2LG4 A;  5E3M A;  4XON A;  4ETS A;  3LQQ A;  2CO5 A;  3QOD A;  2OD5 A;  3FIS A;  1ETY A;  2COB A;  1EJ9 A;  1QVU A;  1P4X A;  4JBA A;  2VE9 A;  3E6D A;  3HOT A;  2VUM J;  2VL8 A;  2BYV E;  1WJA A;  2VC1 A;  3D0S A;  4CUG A;  5C4X J;  2QVO A;  2OCE A;  5LRR A;  4BHC A;  1U9O A;  2VQC A;  2VBX A;  1DP3 A;  1FSH A;  4E7I A;  2L2O A;  2M0C A;  4AVZ A;  5HOO A;  3CF2 A;  3NAR A;  1X2N A;  5CLS A;  3HB9 A;  3S1Q J;  2L9N A;  1KQ8 A;  4P9U A;  3RSN A;  2TCT A;  2HZT A;  3WTT C;  3WTW C;  4A3C J;  2FMY A;  1REP C;  2M9H A;  2VOD A;  2D1H A;  1PDN C;  1VTN C;  1WI9 A;  3SZP A;  2Y30 A;  2WAQ N;  4H0E A;  3TKY A;  3BZ6 A;  3K1M A;  1TWC J;  4M3B A;  5J4Y A;  5D5V B;  1TW2 A;  3AG1 H;  2LFB A;  3GFJ A;  1JUM A;  2M4G A;  2KIF A;  3RIR A;  3H3Z A;  3PNT A;  1X1P A;  1R7J A;  1XCB A;  3L2U A;  3ZQC A;  4E7L A;  4W97 A;  4QIW N;  4ESB A;  3ZN0 A;  3LSP A;  4CYC A;  1J75 A;  2KDZ A;  1IF1 A;  2IRF G;  3K4N A;  4Y15 A;  3ABL H;  1B8I A;  1FX7 A;  1Z7U A;  2J5O A;  2ZNZ A;  4I0A A;  1O3R A;  1TT0 A;  3OOU A;  3VYS B;  3PIP F;  1BA5 A;  3CCV I;  2F5E A;  2JTV A;  4WCG A;  3F22 A;  1H89 C;  4A3L J;  5L3B A;  3PSF A;  3MZY A;  1AWC A;  3FBN B;  1ACI A;  4RB3 C;  2QBY B;  1QVT A;  4Q48 A;  3G1L A;  2OZ6 A;  1KON A;  2ESH A;  2R7X A;  2OV7 A;  3G1M A;  1IRG A;  3RI4 A;  3AKZ A;  4QWQ A;  4CO8 A;  3FHZ A;  2R7O A;  1YIO A;  4JX5 A;  4EJO A;  2V1X A;  3MEX A;  1MIJ A;  3HUG A;  2NVQ J;  5J6X A;  1IJW C;  4GXO A;  2FBK A;  2E35 A;  4GO1 A;  4NBQ A;  4Y4R A;  3PJR A;  2AXL A;  3FKJ A;  4ZYE A;  1KA8 A;  3TP3 A;  1SD5 A;  4M6V A;  1I27 A;  4L9T A;  2GA2 A;  2R5Y B;  1MBE A;  1AU7 A;  2JA6 J;  3REO A;  2DOA A;  5D5U B;  4BXX J;  2I8D A;  3RCO A;  2OTL I;  2R7D A;  4XID A;  1DPU A;  4BAY A;  2CG4 A;  5D6F A;  3GYH X;  3K4M A;  2FJ1 A;  4LJZ F;  2AXT C;  4L9N A;  3CQZ J;  2H8W A;  1GT0 C;  1USS A;  2Y9Y A;  4CGZ A;  2QUF A;  1K6O A;  1I5Z A;  5ED4 A;  1XB4 A;  4E6K G;  1VQ7 I;  3JW4 A;  2IS6 A;  2QZ8 A;  3MAJ A;  1IZ1 A;  2B0L A;  3V4G A;  1ETQ A;  4XRF A;  1XCV A;  1OCP A;  4HX4 A;  4A3G J;  3H5R A;  2DA1 A;  1FTZ A;  2VJJ A;  1QHH D;  1XDU A;  3HZJ A;  5EJC A;  1WJC A;  3OIP A;  4Q4Z F;  1SAU A;  5E79 C;  4ON0 A;  3JRH A;  3OYH A;  4CZZ A;  3A02 A;  2DT5 A;  4I76 A;  2VI6 A;  5B5E C;  3MKZ A;  3S3M A;  2DI3 A;  3CDI A;  3JRI A;  3R61 A;  3WE2 A;  2X85 A;  1QO0 D;  3WU2 C;  3S15 J;  1R1U A;  3GFI A;  3Q3S A;  1PP8 F;  4IQJ A;  3BPX A;  1S8N A;  4ZH4 F;  3ABM H;  4RA2 A;  4WXC A;  3TOB A;  4NQW B;  4AID A;  2JQ7 A;  4HLX A;  4U7D A;  3WTY C;  3A0B C;  3F8C A;  4IJA A;  2DDA A;  5CVJ A;  3HEF A;  2XAJ A;  3EDP A;  3UR3 C;  1D8K A;  3IWZ A;  2ISZ A;  2LBF B;  2CS3 A;  3BJO A;  3G4S I;  3WGG A;  3GZ6 A;  4GFB A;  3IKV A;  3EYI A;  1LFB A;  4L0Z B;  1U5T C;  1Y6I A;  2X1D A;  4ZDL A;  2WV0 A;  3WU1 B;  2DK5 A;  1SEU A;  2BBY A;  3V8J A;  1U3E M;  1I3Q J;  3PO3 J;  2JJ7 A;  3G3Z A;  4JP0 A;  3MWM A;  3VFZ A;  3MMY B;  1OYY A;  1T98 A;  3BTI A;  1OYW A;  3VSL A;  4YG2 F;  4WWC A;  1IN4 A;  2QEN A;  4F91 B;  2PJR A;  4DNC A;  2JSC A;  2OBP A;  2W57 A;  1JTX A;  2XAH A;  4LLN A;  4L5J A;  1G8X A;  1D3Y A;  4A6D A;  3L2V A;  3Q0V A;  4LOC A;  3JRC A;  3H1C A;  2FXA A;  4LG3 A;  2WAF A;  2HVQ A;  4M3F A;  1SD7 A;  5K7H A;  5HLH A;  4XRS A;  1MZB A;  4DW6 A;  1SD6 A;  3M1C A;  1KU2 A;  3FHN A;  2AO9 A;  3E1S A;  5K7F A;  5EG0 B;  3FXJ A;  4QPO A;  3GUD A;  4R8H A;  4QSH A;  5F08 A;  4ZJZ A;  2Y69 H;  3ZOB A;  2VON A;  2ADU A;  1LKX A;  3C3W A;  5BMZ A;  3CMA I;  5LHH A;  3H5A A;  3M8J A;  3GTM J;  2X4H A;  4DQ2 A;  1MDM B;  1MD0 A;  5EEH A;  2DMQ A;  4UXN A;  2FBI A;  2HR3 A;  4IHT A;  1IUF A;  5J1U A;  3DKY A;  3F6V A;  3CDL A;  4KA4 A;  2P5K A;  3BTL A;  1JUP A;  4J19 A;  5JLX A;  1KQ9 A;  4G6Q A;  2VT3 A;  1BR2 A;  2QKL B;  3IAM 2;  4AYB N;  2NOJ B;  4II2 A;  3RKQ A;  3I0T A;  1WJF A;  2Z9O A;  2F48 A;  2Z99 A;  3OL3 A;  3CMM A;  4XSX F;  2KZG A;  3BG6 A;  5EZG A;  1MMG A;  3DCF A;  3KP6 A;  4XKB A;  2VQH A;  2E36 A;  3GCM A;  3E97 A;  2WWY A;  2E34 A;  2BHZ A;  4OIP F;  1T08 B;  1D0Y A;  1FBU A;  4G12 A;  1U6G A;  4NC7 A;  1YIT I;  1JKO C;  3R4K A;  3DV8 A;  1VQ4 I;  5GTH C;  2ESN A;  2KP6 A;  3QPS A;  1SAN A;  4XQF A;  2LYC A;  2A6E F;  1ETK A;  2HQ5 A;  4BY7 J;  3CD6 I;  1JE8 A;  4HF1 A;  2VE8 A;  3FZV A;  4A3E J;  1U78 A;  2ICW G;  2ZFW A;  2IT0 A;  1HXD A;  3CP8 A;  1JKQ C;  3I4N J;  3R60 A;  1WH5 A;  1IN8 A;  1K78 B;  4BNC A;  2L7Z A;  5LBQ A;  1RPW A;  4CH7 A;  2HXO A;  5DCM A;  3DU6 A;  2JRT A;  2KMU A;  3D5L A;  3HIF A;  2OZU A;  2YPR A;  3GZ5 A;  4BDY A;  1MH4 A;  1ZAO A;  2GXG A;  2CQX A;  2ZXI A;  1W36 D;  1K7A A;  2YU9 J;  3U21 A;  2KLO A;  1X4P A;  1O3Q A;  2VPR A;  3CDH A;  3M7G A;  2JK3 A;  3ZMS A;  2W4S A;  1TWF J;  4KIG A;  4QTR A;  3BC8 A;  4JYK A;  2EFP A;  2WAE A;  3DF8 A;  2DTR A;  5ICG A;  1OQY A;  2P7V B;  3OYG A;  2KRF A;  2OTJ I;  2HVR A;  4IOA F;  2HPI A;  2R7Q A;  1VQO I;  2YX4 A;  2K4B A;  3K4L A;  4UVB A;  3ZQQ A;  1A36 A;  2DA3 A;  4PUS A;  2HWV A;  2HXI A;  2X6O A;  5B66 C;  1R4M B;  2CUE A;  4RGS A;  4F92 B;  3FK6 A;  5TJJ A;  1R36 A;  2HQN A;  3F8B A;  5K5Q A;  5D6E A;  3H9J A;  2DPD A;  4LG0 A;  1Z3X A;  4FAS D;  5IT3 A;  2IW5 A;  1HKQ A;  2YU3 A;  1MBG A;  4BDZ A;  1MNE A;  3U1K A;  5CJ9 A;  2LH9 A;  1YJ9 I;  1IN7 A;  4D5F A;  5M5W J;  1BI2 A;  1NK3 P;  2QQB A;  3F6O A;  5D4R A;  1QA6 A;  1OIS A;  4CIC A;  4C3J J;  1MNM C;  3L9F A;  2ECC A;  3WGI A;  3F8N A;  1ENH A;  2DFH A;  1YS7 A;  4U88 A;  3WTX C;  4HDV A;  4BAC A;  5FKM A;  2VJ5 A;  3S17 J;  1UMQ A;  4UV9 A;  3OS1 A;  4D5C A;  5C4J J;  1ONV A;  4HRI A;  1VQL I;  3VEP A;  2WBM A;  3T8R A;  1Z6R A;  1XSD A;  3M4O J;  5F0F A;  2K7L A;  1BC8 C;  3JRA A;  4KT5 C;  1J9I A;  3V7C A;  1BOB A;  2FUG 2;  5CKT A;  2ZME C;  3HHH A;  4A93 J;  4RB1 A;  1MKM A;  2ZXW H;  5FRN A;  2DMT A;  3BTJ A;  3OYI A;  2K9M A;  2MC3 A;  3TDZ C;  4IL6 C;  2CUZ A;  4M3G A;  5KHD A;  1Z1D A;  4HF2 A;  4Y52 J;  2ZME A;  3IKT A;  1B59 A;  4A5N A;  2E1M B;  1A6Q A;  5J4V A;  4WX9 A;  1KYZ A;  2IXS A;  5FFX A;  2GLO A;  3SZT A;  4Z2Y A;  1G3S A;  3J80 Z;  1Z7L A;  1E2X A;  2OCC H;  3PM1 A;  1HQC A;  1YS6 A;  1LVK A;  2A5W A;  3F72 A;  1RNL A;  3OYL A;  1P2F A;  3ZR8 X;  1JKP C;  2Z2S B;  1RUO A;  2XVC A;  4KJZ A;  1YRN B;  1IRF A;  4M3D A;  2E19 A;  3O8H A;  5ILS A;  4XMY A;  2XRL A;  2P5V A;  3ML6 A;  3ZP5 A;  2ZBK A;  4ZTF A;  1B72 A;  3LSR A;  4PJM A;  5DCF A;  2QCO A;  3WTZ A;  4UB6 C;  2VB6 A;  1S5L C;  3ASN H;  4F3Q A;  3LSJ A;  1G59 A;  4XNF A;  2GAU A;  1T2K A;  1ZQ3 P;  4Y13 A;  5F6F A;  3IH4 A;  2QQA A;  2FML A;  3EET A;  5ILU A;  2DOF A;  1JGS A;  1UAA A;  2XAS A;  2VN2 A;  2R93 J;  5FKL A;  2EBI A;  4OIQ F;  3KP2 A;  4DZJ A;  3LAP A;  3T1B A;  3PNV A;  2RKH A;  4D1Q A;  1UST A;  1H8A C;  1ZGJ A;  2DCE A;  4ZZD A;  3NEU A;  2XPU A;  2RRE A;  1X1A A;  1QHG A;  4BXF A;  2WV1 A;  1YG2 A;  1I39 A;  2CV2 A;  3KEQ A;  2XGC A;  4B1R A;  4RGU A;  4C3H J;  3BCA A;  1RKW A;  4HA8 A;  1A6I A;  1IG7 A;  3TO9 A;  3VB2 A;  4HX8 A;  1OR7 A;  3P5J A;  4KIS A;  1Z3Y A;  3G71 I;  1TQP A;  3RYP A;  2LK2 A;  4CYD A;  1J09 A;  1YX5 A;  2XV4 S;  1S7O A;  2KHM A;  3N05 A;  5BQT A;  5GAD J;  2BVM A;  2QWW A;  3K7A J;  3EUK L;  2Z16 A;  5EZH A;  1SMT A;  4N9H A;  5H6Q A;  4XR6 A;  2XIG A;  1R00 A;  3C18 A;  2FRH A;  3GLL A;  1Z6T A;  4G7H F;  3O2P E;  2IS4 A;  1JGG A;  2HI3 A;  5HVQ C;  4E7S A;  2ZJQ F;  3K2Z A;  5KCM A;  1IV8 A;  4DOZ A;  2L0K A;  4OAY A;  1OKR A;  3IRQ A;  2VJ4 A;  2CQ7 A;  2Z1D A;  4KT6 A;  1R22 A;  3IRR A;  3CUQ C;  4UVA A;  2RVC A;  1U8R A;  1MND A;  1X3U A;  3WG9 A;  5KNL A;  2GQQ A;  4I7H A;  4S05 A;  1IRX A;  2BY1 A;  4KN7 X;  3U1D A;  2D45 A;  1GLN A;  2K9L A;  3S2W A;  2LVS A;  3EUH C;  3I59 B;  2P6T A;  4IX7 A;  1X3W B;  3LA7 A;  3PSI A;  2FQ4 A;  2CGP A;  5KAF C;  5HLG A;  3GTL J;  1QU3 A;  3K4K A;  4ZZL A;  3QQA A;  2B7E A;  1MBJ A;  2W85 A;  3U2R A;  2DPU A;  1Y8R B;  3BRO A;  3LSK A;  2ELK A;  4XLP F;  5FRO A;  3QYB A;  2BY2 A;  2PMZ A;  3CES A;  2W7N A;  1SVM A;  2OJE D;  1XGS A;  1TZL A;  3L2Q A;  3Q0U A;  5LD2 C;  4XKV A;  1HBX G;  1SMY F;  3WHC A;  3JAM K;  4UY8 I;  1S3J A;  1HA8 A;  1EH8 A;  2PFB A;  1VQM I;  2W00 A;  4AM3 A;  1VQP I;  2UUZ A;  2LOO A;  3H3V K;  4HG2 A;  2MD0 A;  3EPZ A;  3TL4 X;  5E8I A;  1BI0 A;  1HSJ A;  2JSP A;  2QSF X;  2RDP A;  3BY6 A;  1W7P D;  5DV5 A;  2DFE A;  4IPA A;  3ZQ7 A;  2IBD A;  1G6N A;  1M1E B;  2F2E A;  3M1E A;  3S1M J;  1Z05 A;  1LEA A;  3QPT A;  5HLI A;  4TV7 A;  2V9V A;  4XKC A;  5E1W A;  5DUI A;  2EV5 A;  3E5U A;  3LST A;  2PBI A;  4A0X A;  2LP0 A;  1T0F A;  1V5F A;  2R7W A;  3FF5 A;  3QYE A;  5CQE A;  4IF4 A;  3SHF A;  4B3X A;  3FXR A;  1ZKG A;  1DQU A;  1YW8 A;  4IHX A;  3LOC A;  4HSR A;  2VT2 A;  1W5C C;  4HNT A;  3R0A A;  1BW6 A;  5HS7 A;  3KIO A;  1MDM A;  2G0E A;  2K5C A;  3E7L A;  1P9Q C;  4MO7 A;  5DEQ A;  3MFK A;  3QP6 A;  1BW5 A;  1D8J A;  2ME0 A;  3I53 A;  2R7V A;  3CJT B;  3EYY A;  4B8X A;  1FBS A;  3HDD A;  5FRM A;  2EH3 A;  5IPA A;  2R7Z J;  1UB9 A;  1PUF A;  2YX7 A;  1F43 A;  3B6C A;  3KLN A;  4HPQ A;  3BT9 A;  4W1U A;  2AHQ A;  3DXJ F;  3KP3 A;  1S72 I;  1PP7 U;  2E1M C;  2DOD A;  3ESW B;  2XRO A;  3I59 A;  5B1A H;  5TRD A;  4O6J A;  3K1N A;  1ON1 A;  2RGV A;  2ZC2 A;  1BIB A;  2RC4 A;  4Y33 A;  3CCU I;  5F04 A;  1GV5 A;  2OPT A;  1O57 A;  4ZTJ A;  1N78 A;  3CUQ A;  3S3O A;  3W2W A;  1XDS A;  3DTE A;  1X2M A;  2Y0M A;  4L5I A;  3F8F A;  3LL7 A;  1E3H A;  2MGQ A;  4XRS G;  4B48 A;  1HC8 A;  2KJC A;  2EIL H;  2XB0 X;  1E17 A;  2TRT A;  4XRM A;  1LE8 B;  5ICE A;  1ZG1 A;  4X6A J;  2LNB A;  2N8G A;  2HDC A;  2O6G E;  5M3F J;  5HNF A;  1BM9 A;  1P4W A;  3DU5 A;  2GXA A;  2MG4 A;  3DLL F;  3CCQ I;  2EZH A;  1UG0 A;  2MC4 A;  2ZSH B;  1I50 J;  4OIN F;  4B43 A;  3VYR B;  3HM5 A;  2E1C A;  1MMN A;  2R7S A;  4FHT A;  1TT5 B;  4JQF A;  2E5N A;  2OAZ A;  2M2E A;  2QM3 A;  1HKT A;  5BPD A;  4I01 A;  4A3K J;  3JRG A;  1FPQ A;  5L3F A;  5DYM A;  3E6C C;  4IRG A;  2ZNY A;  4YFK F;  1QZE A;  3GTG J;  4FTH A;  3BR1 A;  2Q0O A;  2QKM B;  3AL0 C;  4IQ4 A;  4BJ6 C;  4HNV A;  4PJN A;  3J7Y J;  3HTS B;  4PJL A;  1ZH5 A;  2P0W A;  1WJB A;  1FT9 A;  4IO9 F;  1O4X A;  4KIT B;  1MJB A;  2XAF A;  3K4B A;  2O7O A;  3L1P A;  1RES A;  3UKG A;  3BPV A;  4FT8 A;  1OYI A;  2VLA A;  2Q2E A;  2R92 J;  4DYC A;  3QRF F;  2ECB A;  1PJR A;  2X1E A;  2DO7 A;  4EJT A;  1EA3 A;  1XG1 A;  1ZGA A;  1SVL A;  1XS9 A;  3ZCO A;  3R0J A;  3GX4 X;  3MD2 A;  4EJU A;  4BBS J;  4HDU A;  1RRJ A;  4HW0 A;  3AG3 H;  4LLG F;  4AD9 A;  2A5Y B;  3BR0 A;  5B1B H;  3C2H A;  1V3F A;  1Z21 A;  2M5W A;  2HEO A;  3GTP J;  3COA C;  2HQR A;  4BQO A;  2A3S A;  4BEH B;  3MKW B;  1W36 C;  3J7A O;  2CQQ A;  3MKL A;  3CCR I;  2X6W A;  2F5C A;  4IVN A;  2IA1 A;  3PUB A;  3J81 Z;  1FIP A;  3OS0 A;  2IJL A;  2DT6 A;  1VQ6 I;  4M9X A;  3HOX J;  5JVG F;  2GOM A;  4OU0 A;  4MHG A;  4HV6 A;  1GHC A;  4XSZ F;  1HKS A;  2FSW A;  1KQ0 A;  2BGC A;  5LEK A;  1YX3 A;  2K85 A;  2K9N A;  2F6C A;  1OCC H;  3G73 A;  1F36 A;  3ROU A;  2EFW A;  3HRM A;  4MQV A;  2LD5 A;  2BY3 A;  2PMU A;  1XGO A;  3W2V A;  1Y8Q B;  3Q9V A;  3FK7 A;  1TW3 A;  2VQL A;  4YEJ A;  2QF7 A;  5ERI A;  3GZN B;  1IO2 A;  1WRJ A;  1D5Y A;  3ONQ A;  3HYI A;  4ZC3 A;  2O03 A;  3MVP A;  2R7T A;  2JWT A;  1IAW A;  1FOX A;  3DTK A;  3TMO A;  1LFP A;  1O7F A;  3OR1 C;  2STT A;  1JUS A;  5BS6 A;  4MEY F;  1FWZ A;  2WC2 A;  3BZK A;  3P9K A;  4GDF A;  4HAM A;  1T8I A;  2EFN A;  4C2T A;  5E3N A;  3SXY A;  4F93 B;  1MBK A;  4MFE A;  3N4M A;  1B8I B;  1LE8 A;  1VQN I;  1JT6 A;  2ID3 A;  3OS2 A;  1WWX A;  1X1D A;  2PMH A;  1H88 C;  2IS2 A;  3C1D A;  3BG3 A;  3HRU A;  2DQL A;  3KLO A;  1DDN A;  3A2K A;  2BV6 A;  4L5E A;  2HZD A;  2FOK A;  1Q1H A;  4A0Z A;  3G6E I;  2Z3Y A;  5GAG J;  1FIA A;  3PO2 J;  1WI3 A;  2A05 A;  3DKW A;  4BL0 B;  4IHS A;  4UUS A;  3D5R C;  1Z67 A;  1MSF C;  1VQ8 I;  1ZG3 A;  2DK8 A;  4WF2 A;  1Y0U A;  1T33 A;  1WZ2 A;  3GTQ J;  2O8K A;  1YLF A;  1R5I D;  2CV1 A;  2H09 A;  1ZEL A;  3A4C A;  3IH2 A;  2CH0 A;  3RQI A;  2ZJ2 A;  3KCC A;  2W82 A;  2F5V A;  3ERM A;  1CF7 B;  4A12 A;  2TDX A;  4U0V A;  4MTE A;  4ENN A;  1YIJ I;  4ZDP A;  2DAO A;  4HEA 2;  1NG7 A;  1FYL A;  1W7P B;  4B47 A;  1X3Z B;  4DYQ A;  3JAM Z;  5CVV A;  1W4M A;  2CW0 F;  2EB7 A;  1X1B A;  2EZK A;  3CZ6 A;  1GUU A;  1R4N B;  3LA2 A;  4EM1 A;  3A1Y A;  1NTC A;  5J8F A;  3TW6 A;  1ERD A;  2YR2 A;  3LA3 A;  4EJW A;  4C2U A;  1UG2 A;  3FKI J;  4A0Y A;  4AIK A;  3V7R A;  4J01 A;  1JXS A;  2I10 A;  4EVI A;  1XGN A;  4HST A;  4L0Y B;  4PSW A;  3ZQH A;  4EMS A;  3I3L A;  3ZMT A;  4CHU A;  1VND A;  1S7A A;  4FCY A;  1SFE A;  2ZO4 A;  4AYB A;  2XGD A;  4A3B J;  1ZN2 A;  1ETV A;  1Y56 A;  4M73 A;  3K70 C;  1R58 A;  2VKH A;  3Q0W A;  3SEQ A;  3BDD A;  3LQR A;  3RYR A;  2LKS A;  4RB2 C;  4J00 A;  2L54 A;  4RAG A;  3TO7 A;  4DJA A;  2IA0 A;  3X2Q H;  2E1O A;  1DP7 P;  3GFL A;  2EA2 A;  2OQR A;  2MW8 A;  4ESJ A;  3CUO A;  4M72 A;  1OCT C;  3HSF A;  2R5Y A;  1O3S A;  3UNG C;  2RV8 A;  3DBH B;  3GTK J;  4E7K A;  1ZRE A;  1J59 A;  3BZC A;  4ZYA A;  4H4K C;  1WSU A;  2QQ8 A;  1XPX A;  2Q8K A;  1HW5 A;  5AIQ A;  2CFX A;  2DA6 A;  2W25 A;  1EH6 A;  4XN3 A;  2W1O A;  2EIM H;  2OUM A;  2L3D A;  4L9V A;  3KPH A;  4EM0 B;  1LFU P;  1ZRD A;  1XN7 A;  1MMS A;  2EQR A;  2DA4 A;  1UHS A;  5E8G A;  3FBI B;  2DYR H;  3QP5 A;  2A07 F;  2BHY A;  3BR5 A;  1FP1 D;  2PQ8 A;  5GTI C;  2BEO A;  1FYK A;  1QRY A;  3BR3 A;  1BL0 A;  3DWL E;  2JA7 J;  4P96 A;  1YFH A;  5D4S A;  3SQN A;  1E3O C;  2JPB A;  2LRE A;  1PUE E;  1A04 A;  1GVJ A;  5LGU A;  4PCQ A;  3ZPL A;  3ZMD A;  5IT9 K;  3HSR A;  4P9F A;  2V7F A;  3DBL B;  2QA4 I;  2XDV A;  3K1P A;  5FO5 A;  4HNU A;  3L7W A;  4GYI A;  5GP9 A;  4ZYH A;  1HF0 A;  1EV7 A;  1QPM A;  1X4O A;  4L18 B;  1YI2 I;  1ETO A;  2G9W A;  2LY9 A;  2Z5U A;  2JVH A;  2FA5 A;  1UEL B;  3HL2 A;  4EGY A;  3EQL F;  1ZTR A;  3K6G A;  4N4N B;  1UFM A;  3ZMV A;  3OYK A;  1IV6 A;  3IP4 B;  1X1C A;  2F5F A;  2IGO A;  4EAT A;  2XUB A;  4BE2 A;  2KPM A;  4HYE A;  2V1U A;  1MBF A;  4M6Y A;  1IXR C;  3IH3 A;  2NS0 A;  2RNJ A;  1B1B A;  5IT9 Z;  4G6D A;  2JRM A;  5IP9 J;  1ZHF A;  1YO5 C;  3AFH A;  3OOP A;  2VOP A;  3V7S A;  2K3P A;  4XN0 A;  1V5G A;  4ANJ A;  1K4T A;  2HU9 A;  2XF6 A;  1ODD A;  2XKP A;  2NRA C;  2XC7 A;  3GVA A;  1YYV A;  2IP2 A;  1YJN I;  1GVD A;  2JA5 J;  5HDK A;  2JA2 A;  3NWT A;  2MSY A;  2WY8 Q;  3M8F A;  3QU6 A;  3ZN1 A;  2E1N A;  4HZF A;  5HS8 A;  1JT0 A;  2DTZ A;  3KET A;  4CDG A;  3S1R J;  2KIS A;  2A6T A;  2DW4 A;  5D5W B;  4U0W A;  5DM7 F;  1I6X A;  3I54 A;  1WJ5 A;  2E2I J;  1KYW A;  4YRV A;  3C2B A;  5J1R A;  1MW7 A;  1O3T A;  2ISY A;  1Y1W J;  2V26 A;  4FE7 A;  4M74 A;  2XPV A;  1R1V A;  2EJR A;  2OU2 A;  3W3C A;  2E7X A;  2K40 A;  4N9I A;  2ZXH A;  2ZCW A;  5JVT A;  4IZZ A;  3OY9 A;  4KIB A;  2UZK A;  3CCJ I;  2EA4 A;  3L09 A;  4C30 A;  3JR9 A;  1FYM A;  1OCR H;  4D9J A;  2FX0 A;  1U5T A;  2M4K A;  2V4J C;  4G6T B;  1R49 A;  2DQR A;  2ID6 A;  1AHD P;  4FQG A;  1QGP A;  4XK4 A;  3VYU B;  2L01 A;  3WTS C;  2CUF A;  3DQV C;  4P55 A;  3FM3 A;  5HDG A;  2H1K A;  5J1Y A;  2QQ9 A;  2M1B A;  3CCL I;  2IVM A;  3CP2 A;  2Q2E B;  4JOM A;  2F4O B;  3VOD A;  5D8L B;  2DA5 A;  2HS5 A;  4DBQ A;  1P6R A;  3H92 A;  3CJR B;  3TP0 A;  4BYY A;  3QAH A;  3QWL A;  3S2D J;  2RNG A;  2HTJ A;  3OYN A;  2DMP A;  3AAF A;  4YIF A;  1K4S A;  3KE2 A;  2H94 A;  2EIJ H;  3GME A;  2VC0 A;  3CMY A;  2QBY A;  5BOX A;  2HDD A;  2DMN A;  5HLT A;  2E5Z A;  2X6X A;  2X6Y A;  3B6A A;  2F4M B;  3GXO A;  1UZC A;  2FNA A;  1NG6 A;  4XIC A;  4XLN F;  2M34 A;  3OYJ A;  1ZR4 A;  4CXF A;  1XC5 A;  4QLC U;  4BU2 A;  4ENJ A;  3SFI A;  4R1H A;  4XL9 A;  3VPR A;  2W84 A;  3HKZ A;  1FP2 A;  4RAY A;  4BBR J;  2L7K A;  1FJL A;  2E60 A;  3W6J B;  3S14 J;  1FOY A;  2M7B A;  3ZXS A;  2NAZ A;  4B3A A;  3FMR A;  3A01 B;  4BHB A;  2UXN A;  3HPH A;  3KP4 A;  4EEF G;  5H2F C;  1YJW I;  2VAS A;  1FTT A;  5F64 A;  3HRS A;  5LHG A;  2OF7 A;  5TGT A;  3OYE A;  1U9N A;  1JJ6 C;  3SDG A;  2HKX A;  1A5J A;  5L3C A;  4RGX A;  2ME6 A;  4XLE A;  3QYF A;  2FQ3 A;  3F8M A;  2R0Q C;  5KK1 A;  4XOR A;  1BN5 A;  5DS9 A;  1BJZ A;  1RIO H;  4Y3O A;  4LFU A;  1N77 A;  2XGE A;  1RZ4 A;  2WB1 N;  1UHW A;  4LGW A;  2GIZ A;  2QYO A;  3K2A A;  2Y31 A;  1R71 A;  4BE0 A;  2DJN A;  2LMD A;  1OR7 C;  5F0H A;  1BBY A;  3H9Q A;  2L9V A;  2DJI A;  2O5R A;  4DIQ A;  5AIP A;  2HOS A;  4N4O B;  2ELH A;  5EDN A;  1DGW Y;  1FOK A;  3LFK A;  3OYC A;  3RDI A;  2COM A;  4M9Z A;  4MNU A;  3QPH A;  1XSV A;  1F9N A;  1BJA A;  2DU9 A;  2AS5 F;  1K6Y A;  4NB5 A;  1OFC X;  1VI0 A;  5IY5 H;  2LC2 A;  2FNP A;  1W0T A;  1OJL A;  2R3S A;  2M87 A;  3ZMU A;  3V8L A;  5LHI A;  4K2E A;  3OYA A;  4YFN F;  2L7M P;  2EFQ A;  2H1L A;  1KU7 A;  3O6B B;  1ZYR F;  3FMQ A;  2EIK H;  4AIH A;  1FZP B;  1T39 A;  5IP7 J;  3OYB A;  2P5L C;  1BR1 A;  3TO6 A;  1AKH A;  2KJB A;  3P7N A;  4YFX F;  4UUT A;  5DD8 A;  2DA2 A;  3KYD B;  1ON2 A;  4UUS B;  5K7Z A;  4PDK A;  3WOD F;  2MLK A;  1MH3 A;  4KIF A;  1TNT A;  3BWG A;  4EJV A;  2LY2 A;  3BP8 A;  3FXM A;  1ZAR A;  2CSO A;  3WU0 A;  4KNY A;  1P92 A;  2QEX I;  3CCM I;  3E6B A;  4IXA A;  1V5E A;  3JTH A;  3HTU A;  4KMU X;  3S3N A;  1HDD C;  1H9G A;  4C9Y A;  4HV5 A;  2R7U A;  1T56 A;  1W5T A;  3PNY A;  2KRC A;  2B9S A;  3I64 A;  2WY7 Q;  1WFX A;  2JN6 A;  2CQN A;  2R7R A;  3ZGK A;  4BGD A;  2O9L A;  1DPR A;  3MZ8 A;  3BG5 A;  1TWG J;  1TBX A;  1R5G A;  4N0B A;  5L3D A;  1XMX A;  3CCE I;  2EV6 A;  3ULQ B;  5J40 A;  4KMF A;  1BI1 A;  3ASO H;  1WHU A;  1QBJ A;  4JK1 X;  2JT1 A;  3LSG A;  4IOC F;  3U9G A;  4G9Y A;  3HOY J;  2K3F A;  2YS9 A;  2XAQ A;  2K9Q A;  3RPU D;  2KT0 A;  5IP6 A;  3RZD J;  3FWE A;  3T5X A;  1TL8 A;  3W6V A;  1PUF B;  2LTP A;  3IV5 A;  3J7A Y;  3GF2 A;  4FX0 A;  3GTO J;  2VOO A;  4X1E A;  2ELJ A;  3K69 A;  1RET A;  3F9K A;  2M7A A;  3RKY A;  1NH3 A;  1ZRC A;  3CJN A;  5LLQ A;  1I6H J;  4PFO A;  4LLL A;  3JSP A;  4PSX A;  2E2J J;  3M3Y J;  2P8T A;  4OOI A;  5DD4 A;  5IOY A;  2M30 A;  3S16 J;  1CQT A;  1LJ9 A;  3NRV A;  1ETX A;  1UHM A;  2FF4 A;  1LQ1 A;  3VDX A;  2P4W A;  3TBI A;  3FXO A;  5M5X J;  5EYR A;  1R23 A;  2H6C A;  2H6B A;  2WA0 A;  4A69 C;  1G4D A;  4V2F A;  4ITV A;  4CCN A;  2OA4 A;  2XAG A;  1S9H A;  1Z0X A;  5A2Q K;  4E7H A;  1MSE C;  2DDB A;  1QPI A;  4A3M J;  1WQ2 A;  5FFZ A;  1ZLK A;  4NDL A;  3PUF A;  2R7F A;  4Q47 A;  5LFA A;  2MH2 A;  4LB5 A;  2M0M A;  3WTU C;  4RGR A;  3A03 A;  2VKD A;  3FDY A;  4PK4 A;  3B02 A;  4E70 A;  3CF5 F;  1HW2 A;  1MMD A;  3MN2 A;  4ABZ A;  3DBR B;  1X19 A;  2LY1 A;  4A6E A;  1Q1V A;  5FKN A;  4L9J A;  4OMZ A;  1SVO A;  1UJ8 A;  2X48 A;  2V79 A;  3ECO A;  5CQG A;  4AVP A;  1VQK I;  3E6M A;  2CW7 A;  1E3P A;  1P4A A;  2MFZ A;  3KX2 A;  2BW3 B;  3V8K A;  4XM3 A;  1WH7 A;  3IWF A;  4LB6 B;  2CQK A;  3IAS 2;  3TDU C;  3CC2 I;  1T38 A;  1VQ9 I;  3FXL A;  4JX4 A;  3K10 A;  4RM2 A;  1B9N A;  3ABU A;  3DPL C;  4PGG A;  3R6S A;  2PI0 A;  4LMY A;  3A0H C;  2CV0 A;  2NS8 A;  2QGU A;  1B4A A;  2EK5 A;  2FU4 A;  2CYY A;  4UNO A;  1CGP A;  3KFW X;  3SEZ A;  3IHU A; 
#chains in the Genus database with same CATH homology
 1ZEL A;  3QOE A;  2DXI A;  3A4C A;  3OL4 A;  1Z3X A;  4BJ5 C;  4FAS D;  2CH0 A;  2IGK A;  2W82 A;  4BDZ A;  2F5V A;  3LMM A;  4LIU A;  1MNE A;  4GRI A;  1R6R A;  2LH9 A;  4ZDP A;  4HEA 2;  4XLH A;  1NG7 A;  4B47 A;  4BJT A;  4XKW A;  4II3 A;  2KL4 A;  3SYT A;  1X1B A;  1N75 A;  3CZ6 A;  2CFO A;  4BAC A;  2VJ5 A;  3OS1 A;  3HPG A;  3A1Y A;  4HRI A;  2KQR A;  1ERD A;  2WBM A;  4C2U A;  3SDB A;  4J01 A;  4CCK A;  3LSM A;  4HST A;  2IGN A;  1D1B A;  4PSW A;  1AA7 A;  3S93 A;  3I3L A;  1BOB A;  2FUG 2;  5CKT A;  4AYB A;  5FRN A;  3OYI A;  2K9M A;  1Y56 A;  5KHD A;  2CUZ A;  3K70 C;  4BE1 A;  2VKH A;  1T0F C;  3C2G A;  4RLF A;  3SEQ A;  3ZRG A;  4PFP A;  2XAU A;  4DBR A;  3NWS A;  4J00 A;  3DEE A;  4DJA A;  2E1M B;  1T95 A;  2KZV A;  3DLA A;  2IXS A;  1LDK B;  3UNG C;  3S8P A;  1Z7L A;  4IKF A;  4E7K A;  1LVK A;  2HNH A;  2KDO A;  2A5W A;  4ZYA A;  4H4K C;  3OYL A;  3ZR8 X;  1PYV A;  4AU7 A;  2Z2S B;  3OYM A;  2X51 A;  2R4G A;  1DGR M;  3OR2 C;  4KJZ A;  4PJJ A;  3VSK A;  3OWT A;  4ZDO A;  4BEH A;  3L2R A;  4XN3 A;  2W1O A;  2OUM A;  4XMY A;  4ZTF A;  3H5N A;  2XSJ C;  4PJM A;  3DKX A;  3FBI B;  3L2W A;  3V42 A;  2VB6 A;  4F3Q A;  2LBF A;  4U87 A;  1G59 A;  2ZFU A;  4XNF A;  3DWL E;  2XF7 A;  1UAA A;  2LRE A;  1FMW A;  3OMY A;  3LFU A;  2RQQ A;  3PNV A;  2V7F A;  3PFY A;  2XDV A;  4D1Q A;  2UWM A;  4HNU A;  2DCE A;  2IS1 A;  1X4O A;  2RRE A;  4OAZ A;  4DGW B;  3BG7 A;  4E7Z A;  1X1A A;  1QHG A;  4BXF A;  2WB1 A;  2HDW A;  3OYD A;  2JVH A;  1UEL B;  3HL2 A;  2X1C A;  2CV2 A;  4XLA A;  2VPL A;  2MAB A;  2CW8 A;  3D5S C;  3E0J B;  3BCA A;  3RTR A;  4BS9 A;  3K4C A;  3HUG B;  3K6G A;  4N4N B;  3I9V 2;  3H9G A;  3OYK A;  3IP4 B;  4KIS A;  1Z3Y A;  1X1C A;  4MLO A;  2IGO A;  4EAT A;  1J09 A;  1YX5 A;  4BE2 A;  2KHM A;  2KPM A;  1VZ0 A;  3N05 A;  4CA0 A;  2BVM A;  3EUK L;  2OC6 A;  2Z16 A;  4XR6 A;  5JHF A;  2WAD A;  3AFH A;  4LIT A;  2K3P A;  4XN0 A;  1V5G A;  4ANJ A;  3KEY A;  2HU9 A;  2XF6 A;  4E4H A;  1D0X A;  4E7J A;  2IS4 A;  4CCJ A;  2XC7 A;  2LG4 A;  4XON A;  5HVQ C;  4E7S A;  3QOD A;  3DPU A;  5KCM A;  4DOZ A;  5HNH A;  1JI8 A;  4OAY A;  2JA2 A;  3NWT A;  2VJ4 A;  2Z1D A;  2WY8 Q;  3HOT A;  2VL8 A;  4KT6 A;  4FET A;  1WJA A;  4CUG A;  3DPT A;  1MND A;  2A6T A;  1FMV A;  4NNJ A;  4BQQ A;  2UV1 A;  5KNL A;  2VQC A;  1DP3 A;  1IRX A;  4E7I A;  2L2O A;  4AVZ A;  1WJ5 A;  5HOO A;  4X0G A;  4YRV A;  3CF2 A;  1GLN A;  1MW7 A;  2K9L A;  2L9N A;  3RSN A;  2V26 A;  3EUH C;  2LRD A;  3W3C A;  4IX7 A;  4U7B A;  3PSI A;  2ZXH A;  2VXD A;  4IZZ A;  2GOX B;  1QU3 A;  3K4K A;  3OY9 A;  4C30 A;  3LSK A;  3S32 A;  2M4G A;  4D9J A;  4G6T B;  2M4K A;  2V4J C;  5FRO A;  3PNT A;  2PMZ A;  3CES A;  3QYB A;  3L2U A;  2W7N A;  4E7L A;  1TZL A;  3L2Q A;  3VYU B;  5LD2 C;  4XKV A;  3DQV C;  1HA8 A;  3K4N A;  4LIV A;  2IGM A;  3HXL A;  2W00 A;  2MYS A;  2UUZ A;  2LOO A;  4HG2 A;  2MD0 A;  3CP2 A;  1TT0 A;  2Q2E B;  3EPZ A;  3OOU A;  4JOM A;  3VYS B;  3TL4 X;  3H0D A;  2JSP A;  4DBQ A;  3CJR B;  3PSF A;  3FBN B;  3DTI A;  2RNG A;  3OYN A;  2R7X A;  1KON A;  2OV7 A;  3AKZ A;  4XKC A;  2R7O A;  3HC7 A;  3BCB A;  2BVL A;  5HLT A;  2E5Z A;  2X6X A;  2X6Y A;  4B44 A;  3VYT B;  3K70 D;  1NG6 A;  2V1N A;  4Y4R A;  3PJR A;  1V5F A;  2BOL A;  3FKJ A;  3OYJ A;  2R7W A;  3QYE A;  5CQE A;  4B3X A;  4BU2 A;  2V6E A;  4RLQ A;  2AQF A;  1DQU A;  3LSH A;  4HSR A;  4XL9 A;  3HKZ A;  4HNT A;  2BW3 A;  2DOA A;  2L7K A;  2I8D A;  2E60 A;  3RCO A;  2M7B A;  3ZXS A;  2K5C A;  1P9Q C;  4CCL A;  3K4M A;  3HPH A;  2VXZ A;  2VAS A;  2R7V A;  2L9S A;  5FRM A;  5TGT A;  3OYE A;  3LSI A;  4HPQ A;  2M3A A;  3GBG A;  4E6K G;  2IS6 A;  4XLE A;  3QYF A;  2E1M C;  2ZSI B;  4XOR A;  4Y3O A;  1N77 A;  1D1A A;  2KRH A;  4Y33 A;  3H5R A;  4XLF A;  4BE0 A;  2VJJ A;  1D1C A;  1QHH D;  4ZTJ A;  1N78 A;  3OYF A;  1OR7 C;  1WJC A;  3OIP A;  1SAU A;  3KYL A;  3S3O A;  3W2W A;  3DTE A;  3H9Q A;  4DIQ A;  2DJI A;  2O5R A;  3OYH A;  4N4O B;  1DGW Y;  3OYC A;  3LL7 A;  4B48 A;  3MKZ A;  2XF5 A;  3S3M A;  1K6Y A;  3VWB A;  2Q1Z B;  5CPR B;  2AQE A;  2LC2 A;  2X85 A;  5HNF A;  4IQJ A;  3DU5 A;  2MC4 A;  1UG0 A;  2ZSH B;  4NQW B;  4B43 A;  3OYA A;  3VYR B;  1WJE A;  4RM3 A;  1MMN A;  4CCM A;  2HQA A;  2R7S A;  4JQF A;  3UR3 C;  2E5N A;  3OYB A;  4P1W A;  2LBF B;  2F4I A;  3AL0 B;  1BR1 A;  1OLT A;  2CS3 A;  1BR4 A;  1Y6I A;  2X1D A;  4ZDL A;  2QKM B;  3AL0 C;  4IQ4 A;  2L5Q A;  4BJ6 C;  4PJN A;  4PJL A;  2P0W A;  3W2A A;  1D0Z A;  1WJB A;  2LY2 A;  3MMY B;  4KIT B;  3K4B A;  4YEL A;  2VJI A;  3VSL A;  2PJR A;  4F91 B;  2DT7 B;  2HVS A;  2VLA A;  2CMP A;  4CCO A;  1V5E A;  2JUG A;  1G8X A;  3S3N A;  1PJR A;  2X1E A;  4NC8 A;  4C9Y A;  3L2V A;  2R7U A;  1EA3 A;  4LG3 A;  2WAF A;  4XOT A;  2HVQ A;  4XOP A;  3ZCO A;  2JVG A;  2KRC A;  3PNY A;  3MD2 A;  4OWR B;  2WY7 Q;  1WFX A;  1SFK A;  3SZG A;  2R7R A;  3M1C A;  3ZGK A;  4BGD A;  3FHN A;  2PJR B;  4BUP A;  3E1S A;  4NUB A;  3C2H A;  4QPO A;  1Z21 A;  4ZJZ A;  3LSG A;  4BQO A;  4BEH B;  1LKX A;  4CSW A;  3MKW B;  1W36 C;  3EUA A;  1E0E A;  2Y0S A;  3H5A A;  1YE9 A;  3M8J A;  4P5O A;  2VQG A;  4BQN A;  2X6W A;  3RPU D;  4XLC A;  3PUB A;  3OS0 A;  4QPQ A;  3DKY A;  2DT6 A;  3J7A Y;  2ELJ A;  4R79 A;  2GOM A;  3F9K A;  2M7A A;  1BR2 A;  2QKL B;  3IAM 2;  4PFO A;  2NOJ B;  3CJQ B;  4II2 A;  4PSX A;  1YX3 A;  2HPM A;  3PL8 A;  1WJF A;  3OL3 A;  3CMM A;  3BG6 A;  1MMG A;  2F6C A;  2V9K A;  4XKB A;  3HOS A;  2VQH A;  3OIQ A;  3VDX A;  3TBI A;  1D0Y A;  2WA0 A;  4NC7 A;  3W2V A;  4ITV A;  3G2B A;  1MMA A;  4CCN A;  2VQL A;  1U0J A;  1S9H A;  2CUJ A;  4YEJ A;  4E7H A;  2KP6 A;  3ONQ A;  4ZC3 A;  2R7T A;  4XQF A;  2LYC A;  5LFA A;  3DTK A;  3TMO A;  1LFP A;  2M0M A;  2VKD A;  3CP8 A;  3OR1 C;  3FDY A;  4F52 A;  4PK4 A;  1MMD A;  1WJD A;  4CH7 A;  1X19 A;  3MKY B;  3DU6 A;  2KMU A;  2LY1 A;  3D5L A;  4C2T A;  2VIX A;  4F93 B;  4BDY A;  1W36 D;  2ZXI A;  3HG9 A;  3OS2 A;  1X1D A;  2IS2 A;  3U21 A;  2WAQ A;  5CQG A;  2KLO A;  1X4P A;  2W4S A;  3RQ4 A;  4F55 A;  3BC8 A;  2CW7 A;  2MFZ A;  3KX2 A;  3IUO A;  3A2K A;  2BW3 B;  2WAE A;  3K4J A;  4XM3 A;  2HZD A;  3OYG A;  3IAS 2;  2HVR A;  2HPI A;  3H35 A;  2R7Q A;  3BLY A;  3K4L A;  4RMN A;  4CZC A;  3K10 A;  4RM2 A;  3DPL C;  3ZQQ A;  4PUS A;  4BL0 B;  3D5R C;  4F92 B;  2CV0 A;  2CV1 A;  3SEZ A;  3H9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...