4Y7NJ

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4y7nJ00
2AHQA 2DMNA 3ZQIA 2E2IJ 2DMUA 2TCTA 2LR8A 3OSFA 5EZHA 5F1JA 1GV2A 3TEDA 5EGOB 1LFUP 3RQIA 3FKIJ 4EEFG 3PO2J 2ID3A 2MW8A 2X48A 5J1RA 4A3MJ 4J19A 1U8BA 2X6OA 1B8IB 2CQQA 3S17J 2CUEA 2JWTA 4MLOA 2WB1N 4AYBN 3O8HA 1A6IA 2P81A 1HOMA 1UG2A 2GLOA 3TW6A 2FQ4A 4IHYA 2I10A 2LFBA 1SANA 2EQRA 2MG4A 3MN2A 2R5YB 2JK3A 3D1NI 4JX6A 4JP0A 1OCPA 3HB9A 4XRMA 3SJMA 5EEAA 1ETOA 2XB0X 1BW6A 3GTLJ 1Q1VA 1X2NA 2DMTA 2QF7A 3HKZN 3S2DJ 3BR2A 3S1RJ 3HOVJ 4DZPA 5GPAA 5IP7J 5M5XJ 1IJWC 1JJ6C 1JKOC 3S16J 3LSJA 5GP9A 2DA7A 1GUUA 3SDGA 3LSGA 2E2JJ 2ME6A 2XPUA 1MH3A 1E3OC 3S1NJ 1RPWA 3LNQA 1POGA 2E19A 3MKLA 1MBKA 4B1RA 3CQZJ 3F0CA 3FISA 3Q0VA 3Q3SA 1RR7A 1JKRC 1GDTA 2TRTA 3JRAA 2DA2A 3B6AA 5EG0A 1OCTC 2CQXA 3A01B 1G2HA 3BTJA 5DTDA 3BTLA 1TC3C 4DYQA 3S1MJ 1IV6A 1JT0A 1OJLA 2QCOA 9ANTA 1JUSA 5IYBJ 1WGXA 2KT0A 1ETVA 2LVSA 1Y1VJ 2RAEA 5E3LA 4MFDA 1Z77A 4QSHA 4UUSB 5FKLA 3MVPA 3JRBA 1WI3A 3ZOBA 3S2HJ 4IEJA 4M3FA 2R92J 4A3GJ 1RESA 2EZHA 5M3MJ 2E2HJ 4FE4A 2LD5A 3WHCA 1GT0C 1FTZA 1VNDA 5C4JJ 2HOSA 2R5ZB 1VI0A 3FK7A 3HOUJ 1LE8B 4A3FJ 3JRFA 2JN6A 5M5YJ 4C2MJ 4W97A 3HGYA 5F0HA 5IP6A 1ITYA 3A03A 5J1UA 2DMQA 1JUPA 3S15J 4C3IJ 1BW5A 3M4OJ 5HODA 2H1KA 3HDDA 5F08A 4G12A 3HOXJ 4M3GA 1QPIA 2EZLA 1TWFJ 3BQYA 5IOZA 1MBFA 2DN0A 2XGCA 4ABZA 5FLMJ 3HOWJ 2WAQN 4A3JJ 1JJ8C 2GBYA 2OF7A 3BR5A 5FKKA 3M3YJ 2L9RA 3H0GJ 1JKPC 2NS7A 3GTKJ 1LFBA 1JT6A 2NVXJ 4S0HB 3HGGA 3OIOA 4W1UA 3HOZJ 4BY7J 2O9LA 2HOTA 4A3BJ 5IYDJ 5IPAA 4BBRJ 1AU7A 1BL0A 2JA6J 1D5YA 2AO9A 4M3DA 2HOAA 1APLC 1RETA 2EBIA 1AKHA 5FKMA 1SFOJ 3I4MJ 4L5EA 2EZKA 2M2EA 1W0UA 4A3KJ 1PUFA 4A3LJ 2ELKA 3TW7A 4JYKA 4M6VA 3TP0A 1A5JA 3JRGA 1ZGWA 1H8AC 4RDUA 4B4CA 4IHVA 2H8RA 1JTXA 2ZB9A 4IHWA 2LK2A 1ETQA 3LSPA 2HXIA 1ZR2A 3BG5A 2DA1A 5FLVA 2LKXA 2ME0A 3G1OA 5K7FA 3BR1A 1H89C 3W6VA 3S14J 2R5ZA 1XC5A 3Q0WA 3WHBA 1BJZA 1YRNB 5M3FJ 1WH7A 4D5FA 2JMWA 2HQ5A 3C2BA 1ZTRA 1U78A 4CYCA 2JA8J 2M34A 4D7NA 3BR3A 3O8GA 1HCRA 2CRGA 2CU7A 3Q0UA 2XPWA 2DMPA 5J1YA 1B72B 2NVQJ 4IHXA 3GTMJ 5C44J 2JA7J 5EZGA 2Y9ZA 4A69C 3G1LA 5EF6A 4AC0A 5IOYA 1UMQA 4B3AA 2LTPA 5BNGA 1ZK8A 4I76A 4DZJA 1WCMJ 1DU0A 1ETYA 1QVTA 4XRSG 4XK4A 5F0CA 2XGDA 5JLXA 1Y1WJ 2G0EA 1U9OA 1ENHA 1FJLA 2K9NA 5K7ZA 1TWCJ 3JRHA 3GTJJ 2DA3A 1MH4A 4XICA 2CJJA 5EGOA 1IC8A 4DYRA 3JREA 3IH3A 3ZQFA 3PO3J 2K9QA 2ID6A 1B8IA 1P7JA 3IV5A 5C4XJ 1JUMA 1VFCA 5GPCA 2NOGA 2HYJA 3BR6A 3NARA 1NTCA 2PMZN 1JTYA 2L7FP 1ZKGA 1MBGA 3CCYA 2R93J 1OFCX 3BR0A 2R5YA 3HEFA 2HDDA 2K9SA 1JGGA 1F36A 2M0CA 2MGQA 3HBLA 2VUMJ 3LSRA 5EDNA 3NAUA 1HDPA 4FISA 1I50J 3BTIA 4M3EA 3BQZA 1VF9A 4Y52J 4D5CA 3GBGA 5EG0B 2JJ7A 5J3LA 2EZIA 3JRDA 1WPKA 2XRLA 2VKVA 2X9DA 2YU9J 2LP0A 3OOUA 4XIDA 1IUFA 4DYCA 1HDDC 2E1OA 3GTQJ 4M3BA 2ECBA 1ZQ3P 5F27A 1ETXA 4D7MA 4X1EA 1WH5A 3A01A 2IAIA 2FX0A 2XGEA 3CMYA 2EH3A 2FD5A 4FE7A 2IBDA 2CUFA 2DJNA 4A3IJ 4A93J 1F43A 1MBHA 3UKGA 2GM4A 3FIWA 1IGNA 2MSYA 4UUSA 3ZQHA 3VPRA 3OSGA 4JX5A 4BBSJ 2Y2ZA 4FCYA 1FIAA 1MBEA 1T33A 3DCFA 2M8GX 5F0FA 3RZOJ 2Y31A 3JRIA 3IH4A 4NDLA 2N8GA 5K7HA 1U9NA 2Y9YA 1TWHJ 3SFIA 1LE8A 4BXXJ 1AHDP 1HF0A 2JA5J 2OPTA 2Y0SN 4LOCA 1IDZA 3HM5A 2O7OA 3G1MA 5F04A 3TP3A 4A3EJ 2R7ZJ 3IH2A 4FTHA 2FJ1A 2NS8A 3GTGJ 1TWGJ 1S7EA 1XG1A 1I3QJ 2ECCA 2L7MP 5IP9J 4Y7NJ 3BT9A 1CQTA 1X58A 1ETWA 5C3EJ 1ORKA 2R0QC 1O4XA 2DA6A 3B6CA 5FKOA 3ZQCA 1AKHB 3PM1A 3HOYJ 4MO7A 4HNVA 2WV1A 3RKQA 1TWAJ 4V2GA 4C3JJ 2D5VA 1GVDA 3QQAA 1QVUA 2XPVA 3LOCA 1H88C 1MBJA 2HXOA 3RZDJ 2NVYJ 5E3NA 2NVTJ 5EYRA 3H3VK 1MSFC 4A3DJ 1NK2P 1JKQC 2VI6A 3QPLA 2IEKA 1PUFB 1UHSA 1X2MA 1HLVA 4MFEA 3BG9A 2VPRA 3L1PA 2COBA 2O8KA 1IG7A 1DU6A 4QTRA 3GTPJ 3K2AA 5FJ8J 2YS9A 4UUTA 4I6ZA 4DW6A 1I6HJ 3I4NJ 1FEXA 4BKXA 1RKTA 1NK3P 3FK6A 1MSEC 3QPSA 3CDLA 1EF4A 4A3CJ 1FIPA 1K61A 1W0TA 3BG3A 4QIWN 4X6AJ 1P7IA 2M9HA 2XB5A 4BY1J 4CYCB 1Z0XA 2Y30A 2HI3A 5E3OA 1T56A 1R9TJ 2LLKA 1ZR4A 4AUXA 2LY9A 3K7AJ 1K83J 4XRSA 2B63J 5M5WJ 2DTZA 4GFBA 2L0KA 5FKNA 4RBOA 1MNMC 4MIMA 1GV5A 1YRNA 2K40A 3BTCA 3A02A 4C3HJ 1IRZA 2W48A 1ETKA 1FTTA 3JR9A 1BA5A 2L7ZA 3GTOJ 4V2FA 1QRYA 2VKEA 3DEWA 2KDZA 1IDYA 5DS9A 5IYCJ 3ZQLA 1XS9A 1B72A 3ZQGA 3S1QJ 2YUSA 3E7LA 4JX4A 5E3MA 2XSDC 3JRCA 2DA4A 1RKWA 2DA5A 5JLWA
chains in the Genus database with same CATH superfamily
2E2IJ 2DMUA 2QKMB 3OSFA 4GRIA 1YJWI 5L3EA 2MC4A 4UV9A 3TEDA 5EGOB 3PIPF 1BBYA 3RQIA 3V8KA 1MNEA 3H35A 3R6SA 3PO2J 2MW8A 2E1NA 5J40A 5J1RA 4HBLA 4J19A 2LNBA 3IL2A 2CUEA 1V5EA 4D9JA 4ZH4F 1PP8F 5EEHA 3OOPA 4F55A 1HOMA 1EJ9A 3S8PA 2V1UA 2XAHA 4A12A 3E6MA 4IHYA 1TT0A 2LFBA 1FP1D 2G7HA 3EPZA 4F7ZA 5ICCA 4BE2A 2R5YB 1HSJA 4HG2A 4JP0A 5J4VA 1WJAA 1U0JA 5EEAA 1ETOA 3GTLJ 1BW6A 3L2QA 2NXNB 2DMTA 2QF7A 2LREA 3IC7A 4HQEA 2OV7A 3LSKA 1HBXG 3SXYA 2RV8A 3CJQB 3S1RJ 3BZKA 1Y56A 5IP7J 3L9FA 1JJ6C 4ZYAA 4EJVA 3N4MA 1JKOC 3RJPA 5CKTA 3NWSA 2TDXA 1VQ6I 2F5CA 1Y0NA 3BDDA 2ME6A 1MH3A 4IO9F 1LVAA 1RPWA 2BZTA 1LFPA 3JW4A 4BS9A 2ZJRF 3DKYA 1BIBA 3CQZJ 3F0CA 1T98A 4UUVA 1GDTA 4Q47A 3H9QA 4N9IA 3TOAA 3FHZA 4RMNA 1Y8QB 3ZMUA 3JRAA 3A4CA 2P7CB 2CQXA 4BYYA 4EJUA 1S7AA 3CDHA 1Z05A 4NNJA 1VQKI 3M9AA 3SEZA 1MMAA 2ZNZA 4EV0A 4L9JA 2K86A 2QCOA 2BEOA 2DBBA 1WGXA 2KT0A 5JI6A 2LVSA 1D8KA 3MCZA 5E3LA 1IN5A 3QU3A 3JRBA 1R4MB 2X6WA 3JSOA 2VBWA 4IEJA 2V4JC 5D5XB 4M3FA 4H0EA 1HC8A 4DOZA 3B73A 3WTWC 4A3GJ 4HSRA 1SVLA 5M3MJ 1O7LA 4E7JA 1IAWA 3FX3A 2QVOA 3VFZA 1GT0C 1FTZA 2KRCA 2ZO4A 3A2KA 3HOUJ 1UCRA 2Q2EB 1LE8B 1LJ9A 2FNAA 5GAGJ 1OLTA 2FNPA 2KIFA 2JN6A 5M5YJ 1N75A 3HGYA 2EV6A 4KUMA 1ITYA 3A03A 3HSEA 5J1UA 2HR3A 2XAUA 3VOEA 4C30A 3DQVC 4WK8F 2EV5A 5HODA 4PJJA 2M87A 2Q1ZB 3I59B 4G12A 2WY7Q 3K0LA 4DIQA 2XGCA 4LLLA 3SEQA 1YHQI 1XB4A 2PG4A 4CCNA 3RYRA 2OF7A 2RNJA 3T5XA 1AOYA 4MQ9F 4E4HA 5FKKA 2L9RA 1SD5A 3H0GJ 1JKPC 3ZMTA 1RR8C 2XRNA 4XLAA 3LSIA 2DAOA 5LGTA 2Z33A 4W1UA 3WTXC 2HOTA 2HNHA 5GTHC 4BBRJ 1AU7A 1U6GA 1BIAA 1ON1A 1KU2A 1FPQA 3OL4A 1X1PA 2LYCA 1D5YA 3ULQB 3JAMK 2ZC2A 1B59A 4RGXA 4PGGA 1AKHA 4GYGA 4A6DA 3KP3A 2H6BA 1WHUA 2X1EA 3S32A 5D6EA 4PK4A 1W0UA 4A3KJ 2OCCH 5DEQA 4LMYA 2LF7A 1F1ZA 4M6YA 1SFXA 3H9GA 3HPHA 4CCMA 5DM7F 4RDUA 4B4CA 1D8JA 4IHWA 2ZB9A 5FRMA 2LK2A 1ETQA 4ZDPA 1I3AA 3KLNA 3WE3A 2HQNA 3OYLA 3L2VA 5FLVA 2ME0A 5LHIA 3OYIA 3G4SI 4Y4RA 2HOEA 2Q8KA 4KJZA 3M8EA 5CVJA 4N9HA 1XC5A 2Q2EA 2O61A 5M3FJ 1LNWA 1W1WE 3C2BA 1YW9A 2VC1A 5FB2A 5LD2C 4JK1X 2A5YB 1JGSA 4HSTA 4D7NA 3BR3A 2ESHA 2M3AA 4E7HA 2QBYB 3OWTA 4Y3OA 2CU7A 3Q0UA 2WTEA 1B72B 1V3FA 4KT5C 2F4IA 3HJEA 3I59A 2XKOA 1DGWY 2KMUA 1U5TA 1IO2A 3GLLA 3LSHA 1ZRFA 2P0WA 3FXJA 1FMVA 1LDKB 2STWA 1QZZA 5IOYA 4B43A 1YW7A 5LLQA 1CF7A 2IGOA 2XAGA 2LTPA 4I76A 1S7OA 2LF8A 2ZMEA 4L9NA 4YFKF 5LEKA 3I4PA 4DZJA 1KGSA 2GIZA 1WCMJ 4E7LA 1DDNA 4XRSG 1WZ2A 5GAHJ 3F22A 2XGDA 2XVCA 3SFZA 4E7ZA 4UVAA 5ICFA 2K9NA 2BV6A 5K7ZA 1X1DA 1MH4A 3FXUA 4NBQA 2ZMEC 1RUNA 1W7PB 1U3EM 1OQYA 3D5SC 3ZQFA 4II2A 1TTYA 2R3SA 4FETA 4UB6C 5E20A 2ID6A 5ED4A 2O6GE 1TBXA 4BDZA 1T0FA 3BJAA 3ELKA 3QYBA 4YIIA 2L5QA 3S3MA 1LKXA 3PFIA 1JTYA 1Y39A 1ZKGA 2QSHX 3OYGA 1BI1A 2ICWG 2R93J 3LSTA 1OFCX 1XTAA 1JGGA 1TLHB 1T0FC 3RPQA 4BDYA 1R71A 3HBLA 2ISYA 3QP6A 4AU7A 4FISA 1I50J 3PSFA 3WTVC 3DPLC 3BTIA 3BZ6A 3EUKL 3QODA 4R8HA 3HG9A 3HZJA 2PI0A 4G6DA 2Z5UA 2HZTA 2RREA 3OL3A 2XRLA 1K4SA 2X9DA 2W7NA 3DBRB 2LP0A 3LQQA 2H27A 3GO5A 4DYCA 3E6DA 3K6GA 2L4MA 4KYWA 2R7TA 2LKPA 2VT2A 1JXSA 4BQOA 4HAMA 2ECBA 5HS8A 4XKWA 3PNYA 3AKZA 1G3TA 2BW3A 3WU1B 2MD0A 3GUDA 1A31A 5F27A 1G3SA 2RDPA 1J9IA 2J5OA 4ZYGA 1R5HA 5KK1A 3R0JA 4X1EA 5E1XA 2IAIA 1E3HA 4CXFA 1QZEA 4OU0A 2FD5A 3AG3H 4IJAA 1QGPA 2PMUA 1K4TA 2CUFA 4I99C 1ERDA 2ETHA 2EJRA 3ABMH 1MBHA 3UKGA 1N77A 1RC9A 4KITB 3GF2A 1D1BA 4CZZA 1IGNA 4CA0A 2R7VA 4BJTA 2M30A 5E79C 1FIAA 1T33A 5F1RA 3RZOJ 3ZCOA 3IH4A 3VB2A 4N4NB 1P2FA 4LB6B 4QPOA 2JA5J 1IW7F 2KQRA 4KICA 5TISC 3I56I 3OS2A 2CMPA 4U0VA 2LMDA 4LOCA 2FBKA 2K85A 4UNOA 2PQ8A 3OYCA 4HV6A 1G8XA 1QZYA 2NVUB 4L9TA 4A3EJ 2BY2A 2EWNA 5KAIC 4D0PA 4FTHA 1Z7UA 2NS8A 1LVKA 1I1GA 2GXGA 3CTAA 2CWEA 5L3BA 1P6RA 1UB9A 2VJ4A 2ECCA 2L7MP 3ZMDA 1S8NA 1ON2A 3MQ0A 3SZPA 2DFHA 5H6RA 1STZA 3LA3A 4G7OF 3QPHA 3J81K 2D5VA 4UHTA 4S04A 1ODDA 3QQAA 4XN0A 5BQTA 5D8LB 2DFEA 4Y13A 2XPVA 3LOCA 3SHFA 3HXLA 5FROA 3H3VK 1QNTA 4A3DJ 1YJNI 2VI6A 3DBLB 2FA5A 3HSFA 3TGNA 1PUFB 2XSJC 2ZKZA 2A05A 3UR3C 1MMNA 2DK8A 2VPRA 4PJ0C 1IG7A 5JLWA 3KZIC 2YS9A 1B1BA 5FJ8J 1UG0A 4RM2A 2GIVA 2DYSH 3FXKA 3QRFF 4DW6A 2ZFWA 2V1XA 3IAS2 2IGMA 3BPXA 3OYAA 2Y69H 2DJIA 2M1BA 5BMZA 2DOAA 4LLGF 1NH3A 2XF5A 1EF4A 4G9YA 3TO7A 3DF8A 5A2QZ 4BE0A 1XSVA 2NYXA 1YTYA 4CCLA 4AD9A 4LG0B 2XIGA 3BOQA 5HOOA 1Z0XA 1Y8RB 2VQHA 4G7HF 5LRSA 5E3OA 1T56A 3DKXA 3HL2A 4AUXA 2LY9A 4KNYA 5D4RA 3LA7A 1N78A 4Q5SF 5M5WJ 2UXNA 1E3PA 3VYRB 2EFWA 5HS9A 2GXAA 4MIMA 1GV5A 4GXOA 2IGKA 3GZ5A 1ETKA 5KNLA 4LJZF 2NRAC 1OR7A 1X1BA 3AG2H 2EA2A 2M7AA 1KQ8A 4A6EA 4V2FA 2O8XA 2QENA 4HA8A 2EIJH 2LRDA 2D1HA 5DS9A 3ZP5A 3CP8A 2RKHA 5KHDA 3ZQLA 3LFUA 3TDUC 1J7KA 1P4WA 2DA4A 3CP2A 3GFMA 4ZJZA 1IXCA 2JZYA 1OR7C 2DMNA 4M73A 1QA6A 3WTUC 2K7LA 2KDOA 1YITI 4ZYHA 3C2GA 3FKIJ 4BU2A 2XROA 5KVRA 1U8BA 1YW8A 1ZAOA 2CQQA 2CS3A 3FF5A 3W2AA 4MLOA 2WB1N 2Z3YA 1ZN2A 2FOKA 5HNHA 1TQPA 4AYBN 3O8HA 3CF5F 4ZZLA 1A6IA 2RQQA 2XF7A 4MTEA 5IT3A 2BVMA 4OMZA 3TW6A 3V7RA 1LDJA 3TOBA 1TQMA 2QSFX 3L2UA 2LY1A 1SANA 5EEGA 3MN2A 1L0OC 3ZMSA 2E60A 1UZCA 3CZ6A 4HLXA 2KHMA 4F93B 4OMYA 1WJ5A 3ZMZA 1OCPA 1O3QA 1HKSA 2V79A 2XB0X 4MHGA 1X2NA 1DUXC 1SEUA 1ACIA 1R6RA 5TRDA 4OIPF 4FHTA 3RPUA 1FBQA 1ZG1A 4ESBA 5HS7A 3GYHX 4J01A 2ISZA 4DZPA 4AM3A 3F23A 5AIPA 1R36A 3AG4H 4LFUA 3S1NJ 3FXOA 1RNLA 1T95A 3LNQA 1POGA 2CUZA 4XLCA 4LGWA 2E19A 3E97A 2Y0MA 2UV1A 2NOJB 3CJRB 3Q0VA 1RR7A 2PFBA 2TRTA 2OTLI 2DA2A 5EG0A 2EFPA 3CMAI 3A01B 2K3PA 2KPMA 3IKTA 3BTLA 4DYQA 4WXHA 4CSWA 3ML6A 2K3FA 3S1MJ 1ZHFA 1IV6A 1IUYA 3L00A 1JT0A 3BPVA 1OJLA 3RKWA 2IT0A 9ANTA 2LBFA 3KEOA 4I2OA 3WU0A 5IYBJ 1USSA 3HPGA 2KIUA 2KKOA 2E1CA 4DJAA 1Z77A 4PGHA 3IAM2 2E71A 3K4KA 3ZOBA 1YI2I 3S2HJ 2WY8Q 4RGUA 2ZJ2A 3O3KA 1TQIA 4P9FA 1UELB 3DEUA 1FC3A 1VNDA 2HOSA 2R5ZB 3F8NA 5K5QA 1W36C 1IF1A 4YG2F 3JRFA 1BR4A 2MBFA 3J7AO 2H09A 1JI8A 2QLZA 5LGNA 1BR1A 2V9KA 3QOPA 5L3DA 1B6AA 1QHHD 1MD0A 2A69F 4RGSA 5B66C 3JTGA 2EFOA 3RDIA 4WXCA 3NQOA 4HX7A 1T39A 3HDDA 1X1AA 2CW0F 3HOXJ 2HTSA 4CGZA 5IOZA 1MBFA 5DYMA 1ZELA 5FLMJ 3HOWJ 4RS8A 3J80Z 1JJ8C 1J75A 2DT7B 3WG9A 3BR5A 5H6QA 3BCAA 3OIPA 3M3YJ 3KP4A 4EJTA 2WV0A 2IW5A 4OWRB 4EJWA 1MKMA 2EFQA 1LFBA 1JT6A 2NVXJ 3BY6A 3HGGA 3OIOA 4A3BJ 2R7WA 5GTIC 2BYVE 5IPAA 2MFZA 1XCVA 1HXDA 2QKLB 2A07F 2JA6J 2BHZA 2VE8A 4M3DA 4CCKA 4BEHB 3COAC 1APLC 2W1OA 5E1WA 4HW0A 1SFOJ 4ZYDA 1I39A 4GDFA 1Z1DA 3QYFA 3KP5A 2F48A 4L9VA 3FM5A 3CCSI 2KZGA 2QZ8A 5D5WB 2FBHA 2XGXA 2HWVA 2R7XA 1K6YA 3RCOA 4LLNA 4Y17A 4JYKA 4M6VA 2MLKA 4CZCA 1A5JA 3JSPA 3OYHA 3FBIB 5JHFA 2CO5A 4GGGA 1I6XA 2GA1A 2AXTC 2H8RA 1CGPA 1B9MA 1FOKA 2ZNYA 4BQQA 3GFIA 5DCMB 2HXIA 2VKHA 4KIFA 3IWFA 3WE2A 4BXFA 2ZXWH 5K7FA 2ZXJA 3RPUD 4BACA 2R5ZA 4IPAA 3F8FA 3B02A 4R79A 4RLFA 2OTJI 1BI3A 1J59A 2PN6A 3OS0A 1R5GA 2E5ZA 2F4OB 2YSRA 4HQMA 3L2RA 1Z6TA 1HA8A 4CCOA 1WJDA 3BC8A 3GFLA 4CYCA 5TGTA 1HCRA 3KFWX 5BPDA 2P5LC 2BE5F 2JUCA 3BG7A 2NVQJ 1R22A 4RA2A 5FGMA 1Y6IA 4XLNF 4P1WA 1HQCA 1ZG5A 2KRHA 2Y9ZA 2DDAA 3G1LA 1FOYA 4G7ZF 1K78B 4QPQA 3CCMI 3LA2A 2OC6A 2HQRA 4FT8A 3CF2A 4ITVA 1ZK8A 2KLOA 1W36D 3R4KA 3EQLF 4Z6YA 1ETYA 4DNCA 3I54A 4XK4A 5F0CA 5JLXA 1Y1WJ 2G0EA 1U9OA 1ENHA 2X85A 4N0BA 5D8KB 1P9QC 1P4AA 2IVMA 1ZREA 4G94A 2CJJA 5EGOA 4LIUA 3JREA 4KIGA 4PFOA 2JUGA 3ECHA 3EUAA 4IXAA 1V4RA 4XSXF 3PO3J 3OR1C 5FLXZ 1BI0A 1RUOA 1GVJA 2PMHA 3C3WA 1JUMA 5B1BH 2NOGA 1DPRA 1I5ZA 1AA7A 5HDKA 2DFIA 2PMZN 4B44A 3M1EA 4XR6A 3A1YA 3CCYA 2QSGX 3BR0A 2FQ3A 2R5YA 2CW8A 3EETA 3V42A 4P5OA 1F36A 2MGQA 3LSRA 3NAUA 1HDPA 3QAHA 3P7NA 4IKFA 3K9TA 4OIRF 1U8RA 3KYLA 4L5JA 4QWQA 2ZXIA 2W84A 3R0AA 2DODA 5D6FA 3RQ4A 2H94A 5HLGA 2EZIA 3FM3A 3JRDA 5JVTA 2VKVA 2MH9A 1XMAA 2FXAA 1SC7A 3C1DA 2HFHA 2KISA 1YIOA 4ON0A 2VXZA 1HDDC 2E1OA 4CHUA 1WVRA 2Z16A 3GTQJ 4JBAA 1ZQ3P 1TZLA 1S29A 2DT6A 1FLIA 1WWXA 1ETXA 1BN5A 3K1PA 2FX0A 3PSIA 2JTVA 1A36A 1NHAA 3CMYA 2A6TA 2HGCA 2LG4A 4FE7A 2R7DA 2UXXA 3MWMA 1OKRA 1DGRM 2CG4A 1LUJB 3S3OA 3ZGKA 2K02A 3FIWA 3MEXA 4E7SA 2MSYA 3CUQB 3ZQHA 2VODA 3OSGA 4JX5A 5ICEA 1V5GA 2Y2ZA 4IRHA 1OYWA 3BG6A 2E1MB 5IT9K 3JRIA 4Z2YA 2Y9YA 2DDBA 5ILUA 3SFIA 1LE8A 3GCMA 4BXXJ 2NNNA 2XF6A 1MJBA 2FBIA 4IQJA 4MGRA 1MGTA 1KQ0A 3G3ZA 2WAEA 3ZQ7A 1RZ4A 3FMRA 1IDZA 2L9VA 3HUGB 3G1MA 1P4XA 1B9NA 1MDMB 3TP3A 3QP5A 5DD4A 2K5CA 2R7ZJ 1W5SA 1XGMA 1MMDA 2ZJPF 4MEYF 1Q1HA 3K4MA 2VQLA 4DBQA 1S7EA 4BGDA 5L3CA 4EQQA 1R5ID 3FXLA 3K69A 5IP9J 4BJ6C 1OMIA 4XNFA 4Y7NJ 1CQTA 2JQ7A 5C3EJ 1ORKA 4I09A 2R0QC 2LOOA 2CV0A 4KN7X 4KA4A 3B6CA 4GYIA 2XAQA 4BHPA 1WFXA 3CCVI 3PM1A 1FYLA 2R7SA 3LSMA 2L7KA 2WV1A 4C3JJ 2X1DA 3IRQA 1SD6A 4RGRA 1QVUA 4Y15A 2V9VA 3CCUI 2HXOA 3RZDJ 3WGIA 1OPCA 2NVYJ 5E3NA 3U21A 1FSEA 5HLTA 1MSFC 2FMYA 4WX9A 1JKQC 2Z1DA 1NK2P 4OIOF 3KPHA 3N05A 2X6YA 3AAFA 2AS5F 1OISA 4MFEA 3ZRGA 3L1PA 4XKVA 2WB1A 3K2ZA 5E18F 4QTRA 1Z9CA 3GXOA 4CICA 4RLQA 1MMSA 4AYBA 2L01A 3IWZA 3DBHB 3OR2C 2VKDA 5JVGF 2MLGA 4BKXA 1ZGJA 1EKEA 5HNFA 1O3SA 2LDUA 1KONA 2R7QA 2X1CA 5HVQC 1MJAA 3CDLA 3HRSA 3E5QA 4XLEA 5DCFA 5LHGA 1RRJA 4QIWN 1P7IA 3FWEA 5DUIA 4HF2A 3VSKA 2Y30A 1JHFA 2OUMA 1T6SA 5CPRB 1GLNA 1ZGAA 2ESNA 3M7GA 3H3ZA 2ZSIB 1W4MA 4PJLA 5CQGA 2XHKA 3MKWB 4BL0B 4HDUA 3Q5FA 1QBJA 2HVSA 1OYYA 3GWZA 3L2WA 2FU4A 3PNTA 4BQNA 4H4KC 3GLXA 4U7DA 4RAFA 3CUQC 2KFDA 1DP3A 1X4PA 4IQ4A 2IA2A 3EYIA 1UHWA 3JR9A 1BA5A 2L7ZA 1TW2A 3NWTA 2G7UA 4LK0F 3CMMA 2PJRB 1QRYA 1IDYA 1XN7A 2QBYA 2EIKH 2MH2A 1D0XA 4M9ZA 1XS9A 1B72A 4A0ZA 3MAJA 1VQ9I 3E7LA 2XSDC 1VQMI 3JRCA 1Z7LA 4ZYEA 2L9SA 3AFHA 3FMQA 3WTSC 2TCTA 2LR8A 4PFPA 5F1JA 4PDKA 4OAYA 3E6CC 3U2RA 1R1TA 2O3FA 4EEFG 2A3SA 2ID3A 3ONQA 4NHJA 2X48A 1HW2A 4A3MJ 1B8IB 2X6OA 2G9WA 2VL8A 4RB2C 3S17J 3I53A 1YYVA 1H9GA 2JWTA 3W2WA 3QU6A 5LEJA 2STTA 2A6EF 4XKBA 3T8TA 3E0JB 2DW4A 2YR2A 3HIFA 2P81A 3E3VA 4KDPA 2HYGD 3LFKA 4XQFA 2D2WA 2JK3A 3DXJF 1W7PA 2L4AA 3D0SA 2V26A 1VQ5I 1ZH5A 4UY8I 3FZVA 3HB9A 3SJMA 1GXQA 2X4HA 3V8LA 3HKZN 2DQLA 3H0DA 3S2DJ 1D0ZA 1DP7P 3BR2A 2DYRH 4RB1A 1BM9A 3HOVJ 3REOA 1IJWC 5M5XJ 4LITA 3S16J 4UVBA 1EV7A 2DA7A 3SDGA 3LSGA 4Y33A 3ABTA 4HYEA 1LB2A 2VOOA 2XDVA 3RSNA 1YS6A 3VWBA 2O03A 1MBKA 1MZBA 4UV8A 3ZR8X 2FMLA 4B1RA 2B7EA 3IRRA 4KISA 4I98B 1MNDA 1LQ1A 1AWCA 1OCTC 3H1CA 4HZFA 1S5LC 3BTJA 4IOAF 1A04A 5DTDA 2KZVA 1TC3C 4I02A 1K7AA 3D5LA 1X3WB 1TNSA 3ISPA 1JUSA 3RYPA 1H9TA 1ETVA 1Y1VJ 3HRTA 1P92A 2PJRA 2RVCA 1LDDA 4EVIA 4UUSB 3MVPA 3EUHA 2W00A 2X51A 2XUBA 2ELHA 4KN4X 1SVOA 2V7FA 2V9PA 3CCJI 1YIJI 1OCOH 1RESA 2EZHA 1KA8A 2E2HJ 3VYUB 2EPFA 1G4DA 2Q0OA 2LD5A 4D1QA 3EDPA 3GMEA 4KT6A 2Z2SB 5C4JJ 3FBNB 4E6KG 3T0YA 1VI0A 3EYYA 3FK7A 3S2WA 4ZZDA 4A3FJ 2HPIA 1K6OA 3ZN0A 5CQEA 3EUHC 3SYTA 2R4GA 3V7CA 3S3NA 4LB5A 1UFMA 4U0WA 3VEPA 2ELJA 3Q9VA 4C2MJ 4W97A 4E7KA 5F0HA 5IP6A 1S9HA 1WJEA 2DMQA 3S15J 2UZKA 4IX7A 4C3IJ 2DO7A 2PLYA 2BXYA 3WGHA 2K9LA 5F08A 2FE3A 2FSWA 2EZLA 1TWFJ 4O5VA 4UVCA 3G73A 1QPIA 2F5VA 2DN0A 1KU9A 1X19A 2WAQN 3BJOA 2GBYA 3KEYA 2F5EA 3KE2A 5FFXA 1ZLJA 2LY2A 4G6QA 5DUKA 2XAFA 3ZMVA 3P9CA 5E1ZB 2B9SA 2GQQA 3V7SA 2W25A 1N25A 2EK5A 1QQIA 5IYDJ 1IXRC 2H1LA 3T1BA 2NNYA 4HNUA 1XSXA 3DP7A 3RIRA 2AO9A 2JVGA 5LBQA 3SQNA 3MZYA 2OU2A 2XAJA 1RETA 5BS6A 1J0RA 1I27A 5FKMA 3RKXA 2BY0A 3M1CA 5FO5A 3GW2A 3I4MJ 3HOTA 1XMXA 4L5EA 3ABKH 3JAMZ 3J7AY 4HDVA 3I9V2 3OYEA 5FD5A 1PP7U 4XRFA 2OCEA 5B1AH 4L18B 4LIVA 1VQOI 2IS4A 4M71A 3FKJA 1PUFA 4EM2A 3WTYC 4NUBA 2ELKA 3TW7A 3I5UA 3JRGA 3N97A 1F5TA 1ZGWA 4HX4A 1W7PD 4U0YA 4IHVA 5J8CA 1EH6A 1JTXA 2EFNA 5AIQA 4A0YA 3K1MA 3O2PE 5ICGA 1T38A 2CGPA 1VQ7I 3LSPA 2PMZA 3BG5A 2E7WA 2DA1A 2BY1A 4G6TB 2PX9A 2IJLA 2ZSHB 3QWLA 3AL0B 1VTNC 3S14J 3IP4B 3WHBA 1YQAA 1YRNB 3CJTB 5LHHA 4YIRX 5J6XA 5IT9Z 2JMWA 2M7BA 3QOEA 4LG0A 1ZTRA 2QUFA 1U78A 2F5DA 2FUG2 3P9IA 4IRGA 2JT1A 2M34A 2JVHA 3H5RA 3SZGA 3QPTA 4CUGA 4LD5A 2CRGA 4XLHA 2VJIA 2DMPA 2DPUA 4IHXA 1Y0UA 2D45A 2F4MB 3GTMJ 2OZ6A 4BH9A 1ULYA 5C44J 3DKWA 2P7VB 1VQPI 4EGZA 2GOXB 4JOMA 4JQFA 5EF6A 4AC0A 4B3AA 2P4WA 2RQPA 4FX0A 2CH0A 3R61A 3CLOA 3X2QH 1MMGA 1SD7A 1Z3XA 1DU0A 1QVTA 2BBYA 1R1VA 1XDUA 1VQNI 5BPIA 1TWCJ 3JRHA 3GTJJ 2V1NA 1YOVB 2DA3A 1IN4A 2P8TA 5CVUA 3I71A 2CV1A 5CJ9A 5CVRA 2HQAA 3TQNA 4BUPA 3FMSA 3PIOF 2JSCA 5KAFC 2K9QA 2JSPA 1REPC 2R7OA 1IRXA 2I5UA 1P7JA 5E8IA 1YX3A 1TNTA 4G8XA 1VFCA 5GPCA 3G6EI 3GFJA 2HYJA 4U87A 3BR6A 2JRMA 3NARA 5CYVA 2K9MA 2OJED 5E17F 3HEFA 2JA2A 2HDDA 2IRFG 3CC7I 1FBUA 2K9SA 1G3WA 1HW1A 2JPCA 1J5YA 3L2CA 4KFCA 1WJBA 2E5NA 2VUMJ 5EDNA 3CCQI 1ZYRF 1YLFA 4XM3A 3GX4X 4XBFA 5DDGA 4M3EA 4F92B 3RTRA 4PUSA 1R58A 1LPQA 4D5CA 3L7WA 3GBGA 1FYKA 2VBXA 5J3LA 2E35A 1WPKA 4MEXF 2DT5A 3HRUA 1TT5B 3H5NA 3OOUA 2YU9J 2HS5A 2A68F 2KJCA 4NQWB 4PCQA 3TKYA 2D1VA 1F4KA 3NRVA 5HLIA 4M3BA 4XLPF 5CVVA 3TDZC 3F8CA 3G71I 3U9GA 5DM6F 2FEZA 3TMOA 2WC2A 3KETA 1WH5A 3A01A 5ERIA 2VN2A 3L09A 4U88A 2JPBA 1USTA 1IN8A 2XGEA 2EH3A 3F21A 3RKYA 2DJNA 1SFUA 3DEEA 1WSUA 1U2WA 5F6FA 1KU7A 3K4JA 3CDIA 4RAZA 3C18A 4M9SA 2GZWA 1NG6A 1V54H 1YG2A 1FYMA 1PVEA 4L0ZB 5FRNA 4P96A 4BBSJ 4M9XA 1IRGA 2BVLA 1MBEA 2M8GX 2VT3A 5F0FA 2C6YA 4NDLA 2K4JA 2IGNA 2N8GA 5K7HA 3I3LA 3GZ6A 1VQ4I 3CLQA 3CO7C 1TWHJ 1T2KA 2QYOA 4YFXF 1AHDP 3CCLI 2FRHA 1XDSA 4DBRA 1HF0A 3CC2I 3TO9A 1FWZA 2Y0SN 4LG3A 4PSWA 1PDNC 1FMWA 2O7OA 2NS0A 2YX7A 2M0MA 2BXZA 2R7UA 5H2FC 3IH2A 3ASOH 2FJ1A 4AIHA 4BAYA 4F52A 1WRJA 3GTGJ 1XG1A 2HDCA 3OYFA 2XASA 1I3QJ 2GWRA 3LMMA 3BT9A 4NC8A 1X58A 4ETSA 1ETWA 3W3CA 1D3YA 2EA4A 2KL4A 1O4XA 2DLLA 2DA6A 3DLLF 3ZQCA 1AKHB 4MO7A 3ZQQA 3VODA 2MC3A 1TWAJ 2HZDA 1R7JA 2W4SA 1GVDA 3M8FA 1O7FA 3C7JA 5J47A 5D5UB 1MBJA 4F3QA 1EH8A 3M07A 3MZHA 4IZZA 2NVTJ 5EYRA 4A5NA 3J81Z 2L02A 3V4GA 2HYFA 4NQWA 2IP2A 2DOFA 5LGUA 2PEXA 4HEA2 1UHSA 3GVAA 5JR3A 2CW7A 1X2MA 4BEHA 1HLVA 3BG9A 2COBA 4MTDA 1ZRCA 4RM3A 3GTPJ 3P5JA 2I8DA 3FXMA 2CQ7A 3F8BA 4B3XA 4PZJA 4I6ZA 3PFYA 2HTJA 4IOCF 5D4SA 5LRRA 1WJFA 1FEXA 4XONA 1NK3P 3E6BA 5A2QK 2HVQA 1G3YA 2VBZA 4AIDA 3K10A 3QPSA 5TJJA 3RI4A 2KIQA 3ERED 1F9NA 2QEXI 1FIPA 1K61A 1X3ZB 3BJ6A 3F72A 4X6AJ 1KQ9A 2L3DA 2PBIA 2W57A 3HKZA 3I64A 4V19K 2LLKA 5DCMA 5LFAA 1ZR4A 3K7AJ 2XKPA 2ZBKA 3F6OA 1QHGA 4HNTA 4XRSA 4RB3C 2JRTA 2DTZA 5D5VB 2ZJQF 4GFBA 2L0KA 1ZARA 2RN7A 4XN3A 4OIQF 4QLCU 2K40A 1U5TB 2Y75A 3ZN1A 2IS2A 1IRZA 1E17A 3UNGC 3W6KB 2M45A 3WG7H 4L0YB 1CF7B 1S6LA 3DEWA 2KDZA 5IYCJ 2ZMEB 4NB5A 4AVPA 4IHSA 3ZQGA 2W24A 2YUSA 5GADJ 3SZTA 3A0BC 4JX4A 5E3MA 3MFKA 1RKWA 2RNGA 2DA5A 3DTKA 2FF4A 2VOPA 1V55H 1HKQA 2AHQA 3ZQIA 2L9NA 5EZHA 1GV2A 2OAZA 1K78A 2VBYA 1LFUP 2CFXA 4P55A 3WU2C 2HDWA 2L54A 2J5PA 1Z3YA 4KMUX 1UG2A 4XL9A 2VQCA 2GLOA 1TW3A 1X3UA 1BR2A 2FQ4A 2I10A 3VYSB 1VQ8I 4Q4ZF 2EQRA 2MG4A 2F6CA 3DV8A 4CH7A 3D1NI 3KEQA 1D5VA 5HLHA 2MYSA 4JX6A 1V5FA 2DQRA 1GHCA 4XRMA 2E36A 4ZTFA 4II3A 2HKXA 3WGGA 3WTTC 4C2TA 1Q1VA 1D1CA 4B48A 4XMYA 2EILH 4ESFA 2LC2A 3F6VA 3LL7A 4ESJA 2HVRA 2P5KA 5GPAA 1ZLKA 3OYKA 3LSJA 5K5OA 2WAQA 1R00A 5GP9A 3JTHA 4HOBA 1JE8A 1GUUA 2E2JJ 2RC4A 2XPUA 1E3OC 1OYIA 2E7XA 3OYDA 4ZTJA 3HTUA 4DGWB 2FOWA 1E2XA 2OA4A 3MKLA 2BW3B 1YJ9I 2DXIA 3FISA 3Q3SA 2M5WA 1JKRC 2HPMA 3H5AA 2COMA 4EMSA 1XD7A 3B6AA 1K79A 1TL8A 4PJNA 2K27A 2E34A 4RB0A 1G2HA 2W82A 2X6XA 1DQUA 4K2EA 5CLSA 3KP6A 2EIMH 5H20A 1YO5C 5BOXA 2K4BA 3Q9SA 2RAEA 3OS1A 4MFDA 4QSHA 5FKLA 4YEJA 2OZUA 5AONA 1WI3A 3KIOA 1G59A 1VZ0A 4S05A 1PJRA 1U5TC 2ACJA 3TO6A 3C2HA 2R92J 4P9UA 1R1UA 4FE4A 4XLFA 3WHCA 3KZYA 1ZRDA 3PNVA 3CUOA 3PQKA 3MD2A 3OYNA 3K70C 4ENKA 2WWYA 2W85A 3K1NA 4ZDLA 1QO0D 1WQ2A 3IUOA 3KZZA 3BP8A 3S93A 1BJAA 2MABA 2M4GA 3CUQA 2DI3A 4IL6C 4YRVA 3MKYB 1SAXA 5KCMA 4HRIA 1JUPA 3PL8A 1IZ1A 1W5CC 4WCGA 5JHUA 2DFFA 3HC7A 1GXPA 3M4OJ 1BW5A 2H1KA 1MW7A 2A61A 4HF0A 2VJ5A 3JCUC 3J80K 2M8EA 2P6TA 4XSZF 5ILSA 4M3GA 3BQYA 3GZNB 2GA2A 1M1EB 3CMEI 4IF4A 3CD6I 4GO1A 4ABZA 2IS6A 4A3JJ 1RIOH 1YFHA 2E1MC 2MA3A 3HUGA 1EH7A 2VE9A 1XCBA 3OYBA 1MDMA 2KIMA 2NS7A 3ESWB 4EGYA 1FP2A 1IN7A 1KYZA 2QGUA 3GTKJ 4HLYA 3KP7A 1BOBA 4S0HB 2PJPA 4IHTA 1WKMA 2DK5A 2M4KA 4BY7J 3WTZA 3HOZJ 5IY5H 2IPQX 2KJBA 1UJ8A 2GAUA 3F3XA 2O9LA 5B5EC 1XGOA 2V6CA 4IRIA 1BL0A 1PYVA 3OY9A 3T8RA 2DTRA 3OYJA 4HPQA 2HOAA 3BZCA 2IS1A 2Y48A 3J7YJ 3W6JB 3M8JA 2EBIA 2QQAA 3KP2A 5ILVA 4AIJA 2DPDA 6PAXA 1HSTA 2QQ9A 4FASD 1FBSA 2DU9A 3ROUA 2EZKA 2YX4A 2LH9A 2M2EA 4WF2A 1XPXA 2B0LA 3TL4X 2DOEA 3DTIA 2CQKA 3K4BA 2VONA 4O3MA 2LKSA 2OD5A 2CFOA 1SD4A 4A3LJ 3TP0A 3H36A 3I0TA 1H8AC 2QA4I 3CCEI 3WODF 2XC7A 2CV2A 3OIQA 4ENMA 5FFZA 1ZR2A 4E7IA 3CESA 4RAGA 3PUBA 4DQ2A 2LKXA 3G1OA 3J7ZI 3BR1A 3OMYA 4EM0B 1MIJA 1H89C 2ZXHA 2VLAA 3W6VA 2WA0A 4AIKA 1R49A 1KU3A 1QPMA 3Q0WA 4L5IA 1BJZA 1WH7A 3O6BB 4D5FA 3DLAA 2H6CA 2HQ5A 3I55I 4EM1A 2JA8J 1X1CA 4AWXB 3O8GA 3PJRA 3V8JA 4R1HA 3F9KA 1BC8C 2XPWA 5J1YA 1C0WA 3HRMA 3D5RC 3DU6A 1HW5A 2JA7J 3CO6C 5EZGA 3DPUA 1XX5A 1ZG3A 1UHMA 2UWMA 5HDNA 4A69C 2BHYA 3MKZA 1O3TA 2H8WA 2HU9A 1FOWA 1UMQA 1XMKA 5K5RA 1YE9A 1KYWA 1DPUA 2BOLA 3KYDB 3DFGA 1S3JA 5BNGA 1B4AA 1HKTA 3K70D 1W5TA 2GOMA 2R7RA 1WI9A 1FT9A 4KIBA 2O5RA 1IXSB 2WBMA 2WADA 2QWWA 3DWLE 1FJLA 5FLXK 4MQVA 1T08B 4XICA 3F8MA 2HEOA 1IC8A 4EJOA 4DYRA 3IH3A 3A0HC 4NC6A 2CYYA 2BY3A 1B8IA 3IV5A 2A6HF 3LAPA 3SDBA 5C4XJ 4LK1F 3LWFA 1A35A 2ADUA 2XV4S 4E70A 4J00A 4PSXA 1L3LA 3FXRA 1NTCA 3H92A 3HHGA 1Z91A 3E5XA 2L7FP 3U1KA 1MBGA 3KYCB 2EB7A 1YS7A 2VB6A 2Y0SA 1YX5A 2V1DA 3LQRA 4UXNA 2X0LA 2P6SA 1FY7A 2M0CA 4BHBA 3DPTA 4B47A 3K4NA 2QQBA 2VASA 3VSLA 1IRFA 3H9JA 4YELA 4WWCA 4KMFA 4XOPA 4EATA 3BQZA 1VF9A 3G2BA 3I58A 4OINF 4UB8C 4X0GA 4A0XA 4Y52J 5EG0B 4BNCA 4CO8A 2AXLA 2JJ7A 1OCCH 3OV8A 1IN6A 4CCJA 2LSOA 1T8IA 5J8FA 2YPRA 4U7BA 4XIDA 2VQGA 2F2EA 1IUFA 4XKCA 5L3FA 1SFEA 4WXDA 4M72A 4HF1A 3H3UA 2LBFB 1SFKA 3IKVA 2EV0A 4PJMA 1E0EA 2ZFUA 4ZC3A 4IVNA 2F5FA 3VDXA 2QM3A 3U1DA 4D7MA 1SMTA 4ASNA 4AVZA 2P5VA 1ONVA 4A5MA 3P9KA 5CVIA 2IBDA 4Q48A 5B3SH 5DV5A 5J4YA 4A3IJ 2IXSA 4A93J 1F43A 2GM4A 3HSRA 4BXUA 2Z9OA 1I1SA 1IV8A 2R7FA 4UUSA 3VPRA 3NEUA 4FCYA 2YU3A 3ASNH 3DCFA 2Y31A 2Z99A 3FXQA 4XORA 3E5UA 4C2UA 1OCZH 2DCEA 4RAYA 1SMYF 1U9NA 1Z67A 5EJCA 4OOIA 4FQGA 2KP6A 1D1AA 4I7HA 3ECOA 1EA3A 1XSDA 2BGCA 2OPTA 1QU3A 3CJNA 2IA0A 3K4CA 3HM5A 4I01A 3CC4I 4I0AA 3TBIA 5F04A 3BLYA 4BHCA 1O3RA 4HV5A 4YIFA 3ABLH 5GAEJ 1TWGJ 3E1SA 1VQLI 4YFNF 4BQAA 1G6NA 1JHHA 1Z6RA 2VPLA 4CYDA 3ZXSA 1J2XA 2OBPA 2OQGA 2VC0A 5E8GA 4ZDOA 4C9YA 3OYMA 2RGVA 2WAFA 1O57A 5FKOA 3VYTB 3BWGA 3HOYJ 4F91B 1H0MA 3AG1H 4HNVA 4ENNA 3RKQA 3HYIA 4V2GA 3K4LA 5K1YA 3DU5A 3CCRI 3BROA 3ERMA 1RI7A 3FDYA 1NG7A 3GEZA 5HDGA 1H88C 4M6XA 1J09A 3PQJA 5L3GA 1PUEE 2GXBA 2A5WA 2NAZA 3QPLA 4B8XA 2IEKA 1MJ9A 4OAZA 4BJ5C 1FX7A 4GCVA 3IHUA 3KCCA 1FZPB 1OCRH 1D0YA 2O8KA 1DU6A 3K2AA 3HHHA 3QYEA 2O0YA 2MD5A 1SAUA 4UUTA 1BI2A 3DTEA 2CSOA 3KLOA 1I6HJ 3W2VA 2L2OA 3I4NJ 4BE1A 1Z21A 1BC7C 1RKTA 4TV7A 3FK6A 1MSEC 2UUZA 4CDGA 3ZPLA 2VJJA 5FD6A 4A3CJ 1W0TA 3BG3A 1FOXA 2OQRA 2ZCWA 4FX4A 2M9HA 2XB5A 4N4OB 4A2UA 4BY1J 4CYCB 4XOTA 2HI3A 1A6QA 2IA1A 2KRFA 4M74A 4B09A 4I0BA 4ANJA 2AQEA 1FNNA 1R9TJ 1X4OA 2V6EA 1S72I 2CQNA 1K83J 2B63J 5F64A 3MZ8A 5FKNA 3HOSA 4RBOA 1XGNA 3PUFA 1BOAA 3KX2A 1MNMC 2EINH 1YRNA 1R4NB 5JFRA 4NC7A 3BTCA 3A02A 3ABUA 4C3HJ 1SVMA 2W48A 4HX8A 1LEAA 1XGSA 1LEBA 1UAAA 1FTTA 1R23A 2AQFA 3GTOJ 4ENJA 2VKEA 2HKOA 3LAJA 3BCBA 4O6JA 3AL0C 1WJCA 2CUJA 2VXDA 3MMYB 3FHNA 3S1QJ 2QQ8A 3HTSB 1TP4A 1KZHA 5DD8A 4MNUA 1FSHA 3R60A 2VIXA
chains in the Genus database with same CATH topology
2AHQA 2DMNA 3ZQIA 2E2IJ 2DMUA 2TCTA 2LR8A 3OSFA 5EZHA 5F1JA 1GV2A 3TEDA 5EGOB 1LFUP 3RQIA 3FKIJ 4EEFG 3PO2J 2ID3A 2MW8A 2X48A 5J1RA 4A3MJ 4J19A 1U8BA 2X6OA 1B8IB 2CQQA 3S17J 2CUEA 2JWTA 4MLOA 2WB1N 4AYBN 3O8HA 1A6IA 2P81A 1HOMA 1UG2A 2GLOA 3TW6A 2FQ4A 4IHYA 2I10A 2LFBA 1SANA 2EQRA 2MG4A 3MN2A 2R5YB 2JK3A 3D1NI 4JX6A 4JP0A 1OCPA 3HB9A 4XRMA 3SJMA 5EEAA 1ETOA 2XB0X 1BW6A 3GTLJ 1Q1VA 1X2NA 2DMTA 2QF7A 3HKZN 3S2DJ 3BR2A 3S1RJ 3HOVJ 4DZPA 5GPAA 5IP7J 5M5XJ 1IJWC 1JJ6C 1JKOC 3S16J 3LSJA 5GP9A 2DA7A 1GUUA 3SDGA 3LSGA 2E2JJ 2ME6A 2XPUA 1MH3A 1E3OC 3S1NJ 1RPWA 3LNQA 1POGA 2E19A 3MKLA 1MBKA 4B1RA 3CQZJ 3F0CA 3FISA 3Q0VA 3Q3SA 1RR7A 1JKRC 1GDTA 2TRTA 3JRAA 2DA2A 3B6AA 5EG0A 1OCTC 2CQXA 3A01B 1G2HA 3BTJA 5DTDA 3BTLA 1TC3C 4DYQA 3S1MJ 1IV6A 1JT0A 1OJLA 2QCOA 9ANTA 1JUSA 5IYBJ 1WGXA 2KT0A 1ETVA 2LVSA 1Y1VJ 2RAEA 5E3LA 4MFDA 1Z77A 4QSHA 4UUSB 5FKLA 3MVPA 3JRBA 1WI3A 3ZOBA 3S2HJ 4IEJA 4M3FA 2R92J 4A3GJ 1RESA 2EZHA 5M3MJ 2E2HJ 4FE4A 2LD5A 3WHCA 1GT0C 1FTZA 1VNDA 5C4JJ 2HOSA 2R5ZB 1VI0A 3FK7A 3HOUJ 1LE8B 4A3FJ 3JRFA 2JN6A 5M5YJ 4C2MJ 4W97A 3HGYA 5F0HA 5IP6A 1ITYA 3A03A 5J1UA 2DMQA 1JUPA 3S15J 4C3IJ 1BW5A 3M4OJ 5HODA 2H1KA 3HDDA 5F08A 4G12A 3HOXJ 4M3GA 1QPIA 2EZLA 1TWFJ 3BQYA 5IOZA 1MBFA 2DN0A 2XGCA 4ABZA 5FLMJ 3HOWJ 2WAQN 4A3JJ 1JJ8C 2GBYA 2OF7A 3BR5A 5FKKA 3M3YJ 2L9RA 3H0GJ 1JKPC 2NS7A 3GTKJ 1LFBA 1JT6A 2NVXJ 4S0HB 3HGGA 3OIOA 4W1UA 3HOZJ 4BY7J 2O9LA 2HOTA 4A3BJ 5IYDJ 5IPAA 4BBRJ 1AU7A 1BL0A 2JA6J 1D5YA 2AO9A 4M3DA 2HOAA 1APLC 1RETA 2EBIA 1AKHA 5FKMA 1SFOJ 3I4MJ 4L5EA 2EZKA 2M2EA 1W0UA 4A3KJ 1PUFA 4A3LJ 2ELKA 3TW7A 4JYKA 4M6VA 3TP0A 1A5JA 3JRGA 1ZGWA 1H8AC 4RDUA 4B4CA 4IHVA 2H8RA 1JTXA 2ZB9A 4IHWA 2LK2A 1ETQA 3LSPA 2HXIA 1ZR2A 3BG5A 2DA1A 5FLVA 2LKXA 2ME0A 3G1OA 5K7FA 3BR1A 1H89C 3W6VA 3S14J 2R5ZA 1XC5A 3Q0WA 3WHBA 1BJZA 1YRNB 5M3FJ 1WH7A 4D5FA 2JMWA 2HQ5A 3C2BA 1ZTRA 1U78A 4CYCA 2JA8J 2M34A 4D7NA 3BR3A 3O8GA 1HCRA 2CRGA 2CU7A 3Q0UA 2XPWA 2DMPA 5J1YA 1B72B 2NVQJ 4IHXA 3GTMJ 5C44J 2JA7J 5EZGA 2Y9ZA 4A69C 3G1LA 5EF6A 4AC0A 5IOYA 1UMQA 4B3AA 2LTPA 5BNGA 1ZK8A 4I76A 4DZJA 1WCMJ 1DU0A 1ETYA 1QVTA 4XRSG 4XK4A 5F0CA 2XGDA 5JLXA 1Y1WJ 2G0EA 1U9OA 1ENHA 1FJLA 2K9NA 5K7ZA 1TWCJ 3JRHA 3GTJJ 2DA3A 1MH4A 4XICA 2CJJA 5EGOA 1IC8A 4DYRA 3JREA 3IH3A 3ZQFA 3PO3J 2K9QA 2ID6A 1B8IA 1P7JA 3IV5A 5C4XJ 1JUMA 1VFCA 5GPCA 2NOGA 2HYJA 3BR6A 3NARA 1NTCA 2PMZN 1JTYA 2L7FP 1ZKGA 1MBGA 3CCYA 2R93J 1OFCX 3BR0A 2R5YA 3HEFA 2HDDA 2K9SA 1JGGA 1F36A 2M0CA 2MGQA 3HBLA 2VUMJ 3LSRA 5EDNA 3NAUA 1HDPA 4FISA 1I50J 3BTIA 4M3EA 3BQZA 1VF9A 4Y52J 4D5CA 3GBGA 5EG0B 2JJ7A 5J3LA 2EZIA 3JRDA 1WPKA 2XRLA 2VKVA 2X9DA 2YU9J 2LP0A 3OOUA 4XIDA 1IUFA 4DYCA 1HDDC 2E1OA 3GTQJ 4M3BA 2ECBA 1ZQ3P 5F27A 1ETXA 4D7MA 4X1EA 1WH5A 3A01A 2IAIA 2FX0A 2XGEA 3CMYA 2EH3A 2FD5A 4FE7A 2IBDA 2CUFA 2DJNA 4A3IJ 4A93J 1F43A 1MBHA 3UKGA 2GM4A 3FIWA 1IGNA 2MSYA 4UUSA 3ZQHA 3VPRA 3OSGA 4JX5A 4BBSJ 2Y2ZA 4FCYA 1FIAA 1MBEA 1T33A 3DCFA 2M8GX 5F0FA 3RZOJ 2Y31A 3JRIA 3IH4A 4NDLA 2N8GA 5K7HA 1U9NA 2Y9YA 1TWHJ 3SFIA 1LE8A 4BXXJ 1AHDP 1HF0A 2JA5J 2OPTA 2Y0SN 4LOCA 1IDZA 3HM5A 2O7OA 3G1MA 5F04A 3TP3A 4A3EJ 2R7ZJ 3IH2A 4FTHA 2FJ1A 2NS8A 3GTGJ 1TWGJ 1S7EA 1XG1A 1I3QJ 2ECCA 2L7MP 5IP9J 4Y7NJ 3BT9A 1CQTA 1X58A 1ETWA 5C3EJ 1ORKA 2R0QC 1O4XA 2DA6A 3B6CA 5FKOA 3ZQCA 1AKHB 3PM1A 3HOYJ 4MO7A 4HNVA 2WV1A 3RKQA 1TWAJ 4V2GA 4C3JJ 2D5VA 1GVDA 3QQAA 1QVUA 2XPVA 3LOCA 1H88C 1MBJA 2HXOA 3RZDJ 2NVYJ 5E3NA 2NVTJ 5EYRA 3H3VK 1MSFC 4A3DJ 1NK2P 1JKQC 2VI6A 3QPLA 2IEKA 1PUFB 1UHSA 1X2MA 1HLVA 4MFEA 3BG9A 2VPRA 3L1PA 2COBA 2O8KA 1IG7A 1DU6A 4QTRA 3GTPJ 3K2AA 5FJ8J 2YS9A 4UUTA 4I6ZA 4DW6A 1I6HJ 3I4NJ 1FEXA 4BKXA 1RKTA 1NK3P 3FK6A 1MSEC 3QPSA 3CDLA 1EF4A 4A3CJ 1FIPA 1K61A 1W0TA 3BG3A 4QIWN 4X6AJ 1P7IA 2M9HA 2XB5A 4BY1J 4CYCB 1Z0XA 2Y30A 2HI3A 5E3OA 1T56A 1R9TJ 2LLKA 1ZR4A 4AUXA 2LY9A 3K7AJ 1K83J 4XRSA 2B63J 5M5WJ 2DTZA 4GFBA 2L0KA 5FKNA 4RBOA 1MNMC 4MIMA 1GV5A 1YRNA 2K40A 3BTCA 3A02A 4C3HJ 1IRZA 2W48A 1ETKA 1FTTA 3JR9A 1BA5A 2L7ZA 3GTOJ 4V2FA 1QRYA 2VKEA 3DEWA 2KDZA 1IDYA 5DS9A 5IYCJ 3ZQLA 1XS9A 1B72A 3ZQGA 3S1QJ 2YUSA 3E7LA 4JX4A 5E3MA 2XSDC 3JRCA 2DA4A 1RKWA 2DA5A 5JLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHQ A;  2DMN A;  3ZQI A;  2E2I J;  2DMU A;  2TCT A;  2LR8 A;  3OSF A;  5EZH A;  5F1J A;  1GV2 A;  3TED A;  5EGO B;  1LFU P;  3RQI A;  3FKI J;  4EEF G;  3PO2 J;  2ID3 A;  2MW8 A;  2X48 A;  5J1R A;  4A3M J;  4J19 A;  1U8B A;  2X6O A;  1B8I B;  2CQQ A;  3S17 J;  2CUE A;  2JWT A;  4MLO A;  2WB1 N;  4AYB N;  3O8H A;  1A6I A;  2P81 A;  1HOM A;  1UG2 A;  2GLO A;  3TW6 A;  2FQ4 A;  4IHY A;  2I10 A;  2LFB A;  1SAN A;  2EQR A;  2MG4 A;  3MN2 A;  2R5Y B;  2JK3 A;  3D1N I;  4JX6 A;  4JP0 A;  1OCP A;  3HB9 A;  4XRM A;  3SJM A;  5EEA A;  1ETO A;  2XB0 X;  1BW6 A;  3GTL J;  1Q1V A;  1X2N A;  2DMT A;  2QF7 A;  3HKZ N;  3S2D J;  3BR2 A;  3S1R J;  3HOV J;  4DZP A;  5GPA A;  5IP7 J;  5M5X J;  1IJW C;  1JJ6 C;  1JKO C;  3S16 J;  3LSJ A;  5GP9 A;  2DA7 A;  1GUU A;  3SDG A;  3LSG A;  2E2J J;  2ME6 A;  2XPU A;  1MH3 A;  1E3O C;  3S1N J;  1RPW A;  3LNQ A;  1POG A;  2E19 A;  3MKL A;  1MBK A;  4B1R A;  3CQZ J;  3F0C A;  3FIS A;  3Q0V A;  3Q3S A;  1RR7 A;  1JKR C;  1GDT A;  2TRT A;  3JRA A;  2DA2 A;  3B6A A;  5EG0 A;  1OCT C;  2CQX A;  3A01 B;  1G2H A;  3BTJ A;  5DTD A;  3BTL A;  1TC3 C;  4DYQ A;  3S1M J;  1IV6 A;  1JT0 A;  1OJL A;  2QCO A;  9ANT A;  1JUS A;  5IYB J;  1WGX A;  2KT0 A;  1ETV A;  2LVS A;  1Y1V J;  2RAE A;  5E3L A;  4MFD A;  1Z77 A;  4QSH A;  4UUS B;  5FKL A;  3MVP A;  3JRB A;  1WI3 A;  3ZOB A;  3S2H J;  4IEJ A;  4M3F A;  2R92 J;  4A3G J;  1RES A;  2EZH A;  5M3M J;  2E2H J;  4FE4 A;  2LD5 A;  3WHC A;  1GT0 C;  1FTZ A;  1VND A;  5C4J J;  2HOS A;  2R5Z B;  1VI0 A;  3FK7 A;  3HOU J;  1LE8 B;  4A3F J;  3JRF A;  2JN6 A;  5M5Y J;  4C2M J;  4W97 A;  3HGY A;  5F0H A;  5IP6 A;  1ITY A;  3A03 A;  5J1U A;  2DMQ A;  1JUP A;  3S15 J;  4C3I J;  1BW5 A;  3M4O J;  5HOD A;  2H1K A;  3HDD A;  5F08 A;  4G12 A;  3HOX J;  4M3G A;  1QPI A;  2EZL A;  1TWF J;  3BQY A;  5IOZ A;  1MBF A;  2DN0 A;  2XGC A;  4ABZ A;  5FLM J;  3HOW J;  2WAQ N;  4A3J J;  1JJ8 C;  2GBY A;  2OF7 A;  3BR5 A;  5FKK A;  3M3Y J;  2L9R A;  3H0G J;  1JKP C;  2NS7 A;  3GTK J;  1LFB A;  1JT6 A;  2NVX J;  4S0H B;  3HGG A;  3OIO A;  4W1U A;  3HOZ J;  4BY7 J;  2O9L A;  2HOT A;  4A3B J;  5IYD J;  5IPA A;  4BBR J;  1AU7 A;  1BL0 A;  2JA6 J;  1D5Y A;  2AO9 A;  4M3D A;  2HOA A;  1APL C;  1RET A;  2EBI A;  1AKH A;  5FKM A;  1SFO J;  3I4M J;  4L5E A;  2EZK A;  2M2E A;  1W0U A;  4A3K J;  1PUF A;  4A3L J;  2ELK A;  3TW7 A;  4JYK A;  4M6V A;  3TP0 A;  1A5J A;  3JRG A;  1ZGW A;  1H8A C;  4RDU A;  4B4C A;  4IHV A;  2H8R A;  1JTX A;  2ZB9 A;  4IHW A;  2LK2 A;  1ETQ A;  3LSP A;  2HXI A;  1ZR2 A;  3BG5 A;  2DA1 A;  5FLV A;  2LKX A;  2ME0 A;  3G1O A;  5K7F A;  3BR1 A;  1H89 C;  3W6V A;  3S14 J;  2R5Z A;  1XC5 A;  3Q0W A;  3WHB A;  1BJZ A;  1YRN B;  5M3F J;  1WH7 A;  4D5F A;  2JMW A;  2HQ5 A;  3C2B A;  1ZTR A;  1U78 A;  4CYC A;  2JA8 J;  2M34 A;  4D7N A;  3BR3 A;  3O8G A;  1HCR A;  2CRG A;  2CU7 A;  3Q0U A;  2XPW A;  2DMP A;  5J1Y A;  1B72 B;  2NVQ J;  4IHX A;  3GTM J;  5C44 J;  2JA7 J;  5EZG A;  2Y9Z A;  4A69 C;  3G1L A;  5EF6 A;  4AC0 A;  5IOY A;  1UMQ A;  4B3A A;  2LTP A;  5BNG A;  1ZK8 A;  4I76 A;  4DZJ A;  1WCM J;  1DU0 A;  1ETY A;  1QVT A;  4XRS G;  4XK4 A;  5F0C A;  2XGD A;  5JLX A;  1Y1W J;  2G0E A;  1U9O A;  1ENH A;  1FJL A;  2K9N A;  5K7Z A;  1TWC J;  3JRH A;  3GTJ J;  2DA3 A;  1MH4 A;  4XIC A;  2CJJ A;  5EGO A;  1IC8 A;  4DYR A;  3JRE A;  3IH3 A;  3ZQF A;  3PO3 J;  2K9Q A;  2ID6 A;  1B8I A;  1P7J A;  3IV5 A;  5C4X J;  1JUM A;  1VFC A;  5GPC A;  2NOG A;  2HYJ A;  3BR6 A;  3NAR A;  1NTC A;  2PMZ N;  1JTY A;  2L7F P;  1ZKG A;  1MBG A;  3CCY A;  2R93 J;  1OFC X;  3BR0 A;  2R5Y A;  3HEF A;  2HDD A;  2K9S A;  1JGG A;  1F36 A;  2M0C A;  2MGQ A;  3HBL A;  2VUM J;  3LSR A;  5EDN A;  3NAU A;  1HDP A;  4FIS A;  1I50 J;  3BTI A;  4M3E A;  3BQZ A;  1VF9 A;  4Y52 J;  4D5C A;  3GBG A;  5EG0 B;  2JJ7 A;  5J3L A;  2EZI A;  3JRD A;  1WPK A;  2XRL A;  2VKV A;  2X9D A;  2YU9 J;  2LP0 A;  3OOU A;  4XID A;  1IUF A;  4DYC A;  1HDD C;  2E1O A;  3GTQ J;  4M3B A;  2ECB A;  1ZQ3 P;  5F27 A;  1ETX A;  4D7M A;  4X1E A;  1WH5 A;  3A01 A;  2IAI A;  2FX0 A;  2XGE A;  3CMY A;  2EH3 A;  2FD5 A;  4FE7 A;  2IBD A;  2CUF A;  2DJN A;  4A3I J;  4A93 J;  1F43 A;  1MBH A;  3UKG A;  2GM4 A;  3FIW A;  1IGN A;  2MSY A;  4UUS A;  3ZQH A;  3VPR A;  3OSG A;  4JX5 A;  4BBS J;  2Y2Z A;  4FCY A;  1FIA A;  1MBE A;  1T33 A;  3DCF A;  2M8G X;  5F0F A;  3RZO J;  2Y31 A;  3JRI A;  3IH4 A;  4NDL A;  2N8G A;  5K7H A;  1U9N A;  2Y9Y A;  1TWH J;  3SFI A;  1LE8 A;  4BXX J;  1AHD P;  1HF0 A;  2JA5 J;  2OPT A;  2Y0S N;  4LOC A;  1IDZ A;  3HM5 A;  2O7O A;  3G1M A;  5F04 A;  3TP3 A;  4A3E J;  2R7Z J;  3IH2 A;  4FTH A;  2FJ1 A;  2NS8 A;  3GTG J;  1TWG J;  1S7E A;  1XG1 A;  1I3Q J;  2ECC A;  2L7M P;  5IP9 J;  4Y7N J;  3BT9 A;  1CQT A;  1X58 A;  1ETW A;  5C3E J;  1ORK A;  2R0Q C;  1O4X A;  2DA6 A;  3B6C A;  5FKO A;  3ZQC A;  1AKH B;  3PM1 A;  3HOY J;  4MO7 A;  4HNV A;  2WV1 A;  3RKQ A;  1TWA J;  4V2G A;  4C3J J;  2D5V A;  1GVD A;  3QQA A;  1QVU A;  2XPV A;  3LOC A;  1H88 C;  1MBJ A;  2HXO A;  3RZD J;  2NVY J;  5E3N A;  2NVT J;  5EYR A;  3H3V K;  1MSF C;  4A3D J;  1NK2 P;  1JKQ C;  2VI6 A;  3QPL A;  2IEK A;  1PUF B;  1UHS A;  1X2M A;  1HLV A;  4MFE A;  3BG9 A;  2VPR A;  3L1P A;  2COB A;  2O8K A;  1IG7 A;  1DU6 A;  4QTR A;  3GTP J;  3K2A A;  5FJ8 J;  2YS9 A;  4UUT A;  4I6Z A;  4DW6 A;  1I6H J;  3I4N J;  1FEX A;  4BKX A;  1RKT A;  1NK3 P;  3FK6 A;  1MSE C;  3QPS A;  3CDL A;  1EF4 A;  4A3C J;  1FIP A;  1K61 A;  1W0T A;  3BG3 A;  4QIW N;  4X6A J;  1P7I A;  2M9H A;  2XB5 A;  4BY1 J;  4CYC B;  1Z0X A;  2Y30 A;  2HI3 A;  5E3O A;  1T56 A;  1R9T J;  2LLK A;  1ZR4 A;  4AUX A;  2LY9 A;  3K7A J;  1K83 J;  4XRS A;  2B63 J;  5M5W J;  2DTZ A;  4GFB A;  2L0K A;  5FKN A;  4RBO A;  1MNM C;  4MIM A;  1GV5 A;  1YRN A;  2K40 A;  3BTC A;  3A02 A;  4C3H J;  1IRZ A;  2W48 A;  1ETK A;  1FTT A;  3JR9 A;  1BA5 A;  2L7Z A;  3GTO J;  4V2F A;  1QRY A;  2VKE A;  3DEW A;  2KDZ A;  1IDY A;  5DS9 A;  5IYC J;  3ZQL A;  1XS9 A;  1B72 A;  3ZQG A;  3S1Q J;  2YUS A;  3E7L A;  4JX4 A;  5E3M A;  2XSD C;  3JRC A;  2DA4 A;  1RKW A;  2DA5 A;  5JLW A; 
#chains in the Genus database with same CATH topology
 2E2I J;  2DMU A;  2QKM B;  3OSF A;  4GRI A;  1YJW I;  5L3E A;  2MC4 A;  4UV9 A;  3TED A;  5EGO B;  3PIP F;  1BBY A;  3RQI A;  3V8K A;  1MNE A;  3H35 A;  3R6S A;  3PO2 J;  2MW8 A;  2E1N A;  5J40 A;  5J1R A;  4HBL A;  4J19 A;  2LNB A;  3IL2 A;  2CUE A;  1V5E A;  4D9J A;  4ZH4 F;  1PP8 F;  5EEH A;  3OOP A;  4F55 A;  1HOM A;  1EJ9 A;  3S8P A;  2V1U A;  2XAH A;  4A12 A;  3E6M A;  4IHY A;  1TT0 A;  2LFB A;  1FP1 D;  2G7H A;  3EPZ A;  4F7Z A;  5ICC A;  4BE2 A;  2R5Y B;  1HSJ A;  4HG2 A;  4JP0 A;  5J4V A;  1WJA A;  1U0J A;  5EEA A;  1ETO A;  3GTL J;  1BW6 A;  3L2Q A;  2NXN B;  2DMT A;  2QF7 A;  2LRE A;  3IC7 A;  4HQE A;  2OV7 A;  3LSK A;  1HBX G;  3SXY A;  2RV8 A;  3CJQ B;  3S1R J;  3BZK A;  1Y56 A;  5IP7 J;  3L9F A;  1JJ6 C;  4ZYA A;  4EJV A;  3N4M A;  1JKO C;  3RJP A;  5CKT A;  3NWS A;  2TDX A;  1VQ6 I;  2F5C A;  1Y0N A;  3BDD A;  2ME6 A;  1MH3 A;  4IO9 F;  1LVA A;  1RPW A;  2BZT A;  1LFP A;  3JW4 A;  4BS9 A;  2ZJR F;  3DKY A;  1BIB A;  3CQZ J;  3F0C A;  1T98 A;  4UUV A;  1GDT A;  4Q47 A;  3H9Q A;  4N9I A;  3TOA A;  3FHZ A;  4RMN A;  1Y8Q B;  3ZMU A;  3JRA A;  3A4C A;  2P7C B;  2CQX A;  4BYY A;  4EJU A;  1S7A A;  3CDH A;  1Z05 A;  4NNJ A;  1VQK I;  3M9A A;  3SEZ A;  1MMA A;  2ZNZ A;  4EV0 A;  4L9J A;  2K86 A;  2QCO A;  2BEO A;  2DBB A;  1WGX A;  2KT0 A;  5JI6 A;  2LVS A;  1D8K A;  3MCZ A;  5E3L A;  1IN5 A;  3QU3 A;  3JRB A;  1R4M B;  2X6W A;  3JSO A;  2VBW A;  4IEJ A;  2V4J C;  5D5X B;  4M3F A;  4H0E A;  1HC8 A;  4DOZ A;  3B73 A;  3WTW C;  4A3G J;  4HSR A;  1SVL A;  5M3M J;  1O7L A;  4E7J A;  1IAW A;  3FX3 A;  2QVO A;  3VFZ A;  1GT0 C;  1FTZ A;  2KRC A;  2ZO4 A;  3A2K A;  3HOU J;  1UCR A;  2Q2E B;  1LE8 B;  1LJ9 A;  2FNA A;  5GAG J;  1OLT A;  2FNP A;  2KIF A;  2JN6 A;  5M5Y J;  1N75 A;  3HGY A;  2EV6 A;  4KUM A;  1ITY A;  3A03 A;  3HSE A;  5J1U A;  2HR3 A;  2XAU A;  3VOE A;  4C30 A;  3DQV C;  4WK8 F;  2EV5 A;  5HOD A;  4PJJ A;  2M87 A;  2Q1Z B;  3I59 B;  4G12 A;  2WY7 Q;  3K0L A;  4DIQ A;  2XGC A;  4LLL A;  3SEQ A;  1YHQ I;  1XB4 A;  2PG4 A;  4CCN A;  3RYR A;  2OF7 A;  2RNJ A;  3T5X A;  1AOY A;  4MQ9 F;  4E4H A;  5FKK A;  2L9R A;  1SD5 A;  3H0G J;  1JKP C;  3ZMT A;  1RR8 C;  2XRN A;  4XLA A;  3LSI A;  2DAO A;  5LGT A;  2Z33 A;  4W1U A;  3WTX C;  2HOT A;  2HNH A;  5GTH C;  4BBR J;  1AU7 A;  1U6G A;  1BIA A;  1ON1 A;  1KU2 A;  1FPQ A;  3OL4 A;  1X1P A;  2LYC A;  1D5Y A;  3ULQ B;  3JAM K;  2ZC2 A;  1B59 A;  4RGX A;  4PGG A;  1AKH A;  4GYG A;  4A6D A;  3KP3 A;  2H6B A;  1WHU A;  2X1E A;  3S32 A;  5D6E A;  4PK4 A;  1W0U A;  4A3K J;  2OCC H;  5DEQ A;  4LMY A;  2LF7 A;  1F1Z A;  4M6Y A;  1SFX A;  3H9G A;  3HPH A;  4CCM A;  5DM7 F;  4RDU A;  4B4C A;  1D8J A;  4IHW A;  2ZB9 A;  5FRM A;  2LK2 A;  1ETQ A;  4ZDP A;  1I3A A;  3KLN A;  3WE3 A;  2HQN A;  3OYL A;  3L2V A;  5FLV A;  2ME0 A;  5LHI A;  3OYI A;  3G4S I;  4Y4R A;  2HOE A;  2Q8K A;  4KJZ A;  3M8E A;  5CVJ A;  4N9H A;  1XC5 A;  2Q2E A;  2O61 A;  5M3F J;  1LNW A;  1W1W E;  3C2B A;  1YW9 A;  2VC1 A;  5FB2 A;  5LD2 C;  4JK1 X;  2A5Y B;  1JGS A;  4HST A;  4D7N A;  3BR3 A;  2ESH A;  2M3A A;  4E7H A;  2QBY B;  3OWT A;  4Y3O A;  2CU7 A;  3Q0U A;  2WTE A;  1B72 B;  1V3F A;  4KT5 C;  2F4I A;  3HJE A;  3I59 A;  2XKO A;  1DGW Y;  2KMU A;  1U5T A;  1IO2 A;  3GLL A;  3LSH A;  1ZRF A;  2P0W A;  3FXJ A;  1FMV A;  1LDK B;  2STW A;  1QZZ A;  5IOY A;  4B43 A;  1YW7 A;  5LLQ A;  1CF7 A;  2IGO A;  2XAG A;  2LTP A;  4I76 A;  1S7O A;  2LF8 A;  2ZME A;  4L9N A;  4YFK F;  5LEK A;  3I4P A;  4DZJ A;  1KGS A;  2GIZ A;  1WCM J;  4E7L A;  1DDN A;  4XRS G;  1WZ2 A;  5GAH J;  3F22 A;  2XGD A;  2XVC A;  3SFZ A;  4E7Z A;  4UVA A;  5ICF A;  2K9N A;  2BV6 A;  5K7Z A;  1X1D A;  1MH4 A;  3FXU A;  4NBQ A;  2ZME C;  1RUN A;  1W7P B;  1U3E M;  1OQY A;  3D5S C;  3ZQF A;  4II2 A;  1TTY A;  2R3S A;  4FET A;  4UB6 C;  5E20 A;  2ID6 A;  5ED4 A;  2O6G E;  1TBX A;  4BDZ A;  1T0F A;  3BJA A;  3ELK A;  3QYB A;  4YII A;  2L5Q A;  3S3M A;  1LKX A;  3PFI A;  1JTY A;  1Y39 A;  1ZKG A;  2QSH X;  3OYG A;  1BI1 A;  2ICW G;  2R93 J;  3LST A;  1OFC X;  1XTA A;  1JGG A;  1TLH B;  1T0F C;  3RPQ A;  4BDY A;  1R71 A;  3HBL A;  2ISY A;  3QP6 A;  4AU7 A;  4FIS A;  1I50 J;  3PSF A;  3WTV C;  3DPL C;  3BTI A;  3BZ6 A;  3EUK L;  3QOD A;  4R8H A;  3HG9 A;  3HZJ A;  2PI0 A;  4G6D A;  2Z5U A;  2HZT A;  2RRE A;  3OL3 A;  2XRL A;  1K4S A;  2X9D A;  2W7N A;  3DBR B;  2LP0 A;  3LQQ A;  2H27 A;  3GO5 A;  4DYC A;  3E6D A;  3K6G A;  2L4M A;  4KYW A;  2R7T A;  2LKP A;  2VT2 A;  1JXS A;  4BQO A;  4HAM A;  2ECB A;  5HS8 A;  4XKW A;  3PNY A;  3AKZ A;  1G3T A;  2BW3 A;  3WU1 B;  2MD0 A;  3GUD A;  1A31 A;  5F27 A;  1G3S A;  2RDP A;  1J9I A;  2J5O A;  4ZYG A;  1R5H A;  5KK1 A;  3R0J A;  4X1E A;  5E1X A;  2IAI A;  1E3H A;  4CXF A;  1QZE A;  4OU0 A;  2FD5 A;  3AG3 H;  4IJA A;  1QGP A;  2PMU A;  1K4T A;  2CUF A;  4I99 C;  1ERD A;  2ETH A;  2EJR A;  3ABM H;  1MBH A;  3UKG A;  1N77 A;  1RC9 A;  4KIT B;  3GF2 A;  1D1B A;  4CZZ A;  1IGN A;  4CA0 A;  2R7V A;  4BJT A;  2M30 A;  5E79 C;  1FIA A;  1T33 A;  5F1R A;  3RZO J;  3ZCO A;  3IH4 A;  3VB2 A;  4N4N B;  1P2F A;  4LB6 B;  4QPO A;  2JA5 J;  1IW7 F;  2KQR A;  4KIC A;  5TIS C;  3I56 I;  3OS2 A;  2CMP A;  4U0V A;  2LMD A;  4LOC A;  2FBK A;  2K85 A;  4UNO A;  2PQ8 A;  3OYC A;  4HV6 A;  1G8X A;  1QZY A;  2NVU B;  4L9T A;  4A3E J;  2BY2 A;  2EWN A;  5KAI C;  4D0P A;  4FTH A;  1Z7U A;  2NS8 A;  1LVK A;  1I1G A;  2GXG A;  3CTA A;  2CWE A;  5L3B A;  1P6R A;  1UB9 A;  2VJ4 A;  2ECC A;  2L7M P;  3ZMD A;  1S8N A;  1ON2 A;  3MQ0 A;  3SZP A;  2DFH A;  5H6R A;  1STZ A;  3LA3 A;  4G7O F;  3QPH A;  3J81 K;  2D5V A;  4UHT A;  4S04 A;  1ODD A;  3QQA A;  4XN0 A;  5BQT A;  5D8L B;  2DFE A;  4Y13 A;  2XPV A;  3LOC A;  3SHF A;  3HXL A;  5FRO A;  3H3V K;  1QNT A;  4A3D J;  1YJN I;  2VI6 A;  3DBL B;  2FA5 A;  3HSF A;  3TGN A;  1PUF B;  2XSJ C;  2ZKZ A;  2A05 A;  3UR3 C;  1MMN A;  2DK8 A;  2VPR A;  4PJ0 C;  1IG7 A;  5JLW A;  3KZI C;  2YS9 A;  1B1B A;  5FJ8 J;  1UG0 A;  4RM2 A;  2GIV A;  2DYS H;  3FXK A;  3QRF F;  4DW6 A;  2ZFW A;  2V1X A;  3IAS 2;  2IGM A;  3BPX A;  3OYA A;  2Y69 H;  2DJI A;  2M1B A;  5BMZ A;  2DOA A;  4LLG F;  1NH3 A;  2XF5 A;  1EF4 A;  4G9Y A;  3TO7 A;  3DF8 A;  5A2Q Z;  4BE0 A;  1XSV A;  2NYX A;  1YTY A;  4CCL A;  4AD9 A;  4LG0 B;  2XIG A;  3BOQ A;  5HOO A;  1Z0X A;  1Y8R B;  2VQH A;  4G7H F;  5LRS A;  5E3O A;  1T56 A;  3DKX A;  3HL2 A;  4AUX A;  2LY9 A;  4KNY A;  5D4R A;  3LA7 A;  1N78 A;  4Q5S F;  5M5W J;  2UXN A;  1E3P A;  3VYR B;  2EFW A;  5HS9 A;  2GXA A;  4MIM A;  1GV5 A;  4GXO A;  2IGK A;  3GZ5 A;  1ETK A;  5KNL A;  4LJZ F;  2NRA C;  1OR7 A;  1X1B A;  3AG2 H;  2EA2 A;  2M7A A;  1KQ8 A;  4A6E A;  4V2F A;  2O8X A;  2QEN A;  4HA8 A;  2EIJ H;  2LRD A;  2D1H A;  5DS9 A;  3ZP5 A;  3CP8 A;  2RKH A;  5KHD A;  3ZQL A;  3LFU A;  3TDU C;  1J7K A;  1P4W A;  2DA4 A;  3CP2 A;  3GFM A;  4ZJZ A;  1IXC A;  2JZY A;  1OR7 C;  2DMN A;  4M73 A;  1QA6 A;  3WTU C;  2K7L A;  2KDO A;  1YIT I;  4ZYH A;  3C2G A;  3FKI J;  4BU2 A;  2XRO A;  5KVR A;  1U8B A;  1YW8 A;  1ZAO A;  2CQQ A;  2CS3 A;  3FF5 A;  3W2A A;  4MLO A;  2WB1 N;  2Z3Y A;  1ZN2 A;  2FOK A;  5HNH A;  1TQP A;  4AYB N;  3O8H A;  3CF5 F;  4ZZL A;  1A6I A;  2RQQ A;  2XF7 A;  4MTE A;  5IT3 A;  2BVM A;  4OMZ A;  3TW6 A;  3V7R A;  1LDJ A;  3TOB A;  1TQM A;  2QSF X;  3L2U A;  2LY1 A;  1SAN A;  5EEG A;  3MN2 A;  1L0O C;  3ZMS A;  2E60 A;  1UZC A;  3CZ6 A;  4HLX A;  2KHM A;  4F93 B;  4OMY A;  1WJ5 A;  3ZMZ A;  1OCP A;  1O3Q A;  1HKS A;  2V79 A;  2XB0 X;  4MHG A;  1X2N A;  1DUX C;  1SEU A;  1ACI A;  1R6R A;  5TRD A;  4OIP F;  4FHT A;  3RPU A;  1FBQ A;  1ZG1 A;  4ESB A;  5HS7 A;  3GYH X;  4J01 A;  2ISZ A;  4DZP A;  4AM3 A;  3F23 A;  5AIP A;  1R36 A;  3AG4 H;  4LFU A;  3S1N J;  3FXO A;  1RNL A;  1T95 A;  3LNQ A;  1POG A;  2CUZ A;  4XLC A;  4LGW A;  2E19 A;  3E97 A;  2Y0M A;  2UV1 A;  2NOJ B;  3CJR B;  3Q0V A;  1RR7 A;  2PFB A;  2TRT A;  2OTL I;  2DA2 A;  5EG0 A;  2EFP A;  3CMA I;  3A01 B;  2K3P A;  2KPM A;  3IKT A;  3BTL A;  4DYQ A;  4WXH A;  4CSW A;  3ML6 A;  2K3F A;  3S1M J;  1ZHF A;  1IV6 A;  1IUY A;  3L00 A;  1JT0 A;  3BPV A;  1OJL A;  3RKW A;  2IT0 A;  9ANT A;  2LBF A;  3KEO A;  4I2O A;  3WU0 A;  5IYB J;  1USS A;  3HPG A;  2KIU A;  2KKO A;  2E1C A;  4DJA A;  1Z77 A;  4PGH A;  3IAM 2;  2E71 A;  3K4K A;  3ZOB A;  1YI2 I;  3S2H J;  2WY8 Q;  4RGU A;  2ZJ2 A;  3O3K A;  1TQI A;  4P9F A;  1UEL B;  3DEU A;  1FC3 A;  1VND A;  2HOS A;  2R5Z B;  3F8N A;  5K5Q A;  1W36 C;  1IF1 A;  4YG2 F;  3JRF A;  1BR4 A;  2MBF A;  3J7A O;  2H09 A;  1JI8 A;  2QLZ A;  5LGN A;  1BR1 A;  2V9K A;  3QOP A;  5L3D A;  1B6A A;  1QHH D;  1MD0 A;  2A69 F;  4RGS A;  5B66 C;  3JTG A;  2EFO A;  3RDI A;  4WXC A;  3NQO A;  4HX7 A;  1T39 A;  3HDD A;  1X1A A;  2CW0 F;  3HOX J;  2HTS A;  4CGZ A;  5IOZ A;  1MBF A;  5DYM A;  1ZEL A;  5FLM J;  3HOW J;  4RS8 A;  3J80 Z;  1JJ8 C;  1J75 A;  2DT7 B;  3WG9 A;  3BR5 A;  5H6Q A;  3BCA A;  3OIP A;  3M3Y J;  3KP4 A;  4EJT A;  2WV0 A;  2IW5 A;  4OWR B;  4EJW A;  1MKM A;  2EFQ A;  1LFB A;  1JT6 A;  2NVX J;  3BY6 A;  3HGG A;  3OIO A;  4A3B J;  2R7W A;  5GTI C;  2BYV E;  5IPA A;  2MFZ A;  1XCV A;  1HXD A;  2QKL B;  2A07 F;  2JA6 J;  2BHZ A;  2VE8 A;  4M3D A;  4CCK A;  4BEH B;  3COA C;  1APL C;  2W1O A;  5E1W A;  4HW0 A;  1SFO J;  4ZYD A;  1I39 A;  4GDF A;  1Z1D A;  3QYF A;  3KP5 A;  2F48 A;  4L9V A;  3FM5 A;  3CCS I;  2KZG A;  2QZ8 A;  5D5W B;  2FBH A;  2XGX A;  2HWV A;  2R7X A;  1K6Y A;  3RCO A;  4LLN A;  4Y17 A;  4JYK A;  4M6V A;  2MLK A;  4CZC A;  1A5J A;  3JSP A;  3OYH A;  3FBI B;  5JHF A;  2CO5 A;  4GGG A;  1I6X A;  2GA1 A;  2AXT C;  2H8R A;  1CGP A;  1B9M A;  1FOK A;  2ZNY A;  4BQQ A;  3GFI A;  5DCM B;  2HXI A;  2VKH A;  4KIF A;  3IWF A;  3WE2 A;  4BXF A;  2ZXW H;  5K7F A;  2ZXJ A;  3RPU D;  4BAC A;  2R5Z A;  4IPA A;  3F8F A;  3B02 A;  4R79 A;  4RLF A;  2OTJ I;  1BI3 A;  1J59 A;  2PN6 A;  3OS0 A;  1R5G A;  2E5Z A;  2F4O B;  2YSR A;  4HQM A;  3L2R A;  1Z6T A;  1HA8 A;  4CCO A;  1WJD A;  3BC8 A;  3GFL A;  4CYC A;  5TGT A;  1HCR A;  3KFW X;  5BPD A;  2P5L C;  2BE5 F;  2JUC A;  3BG7 A;  2NVQ J;  1R22 A;  4RA2 A;  5FGM A;  1Y6I A;  4XLN F;  4P1W A;  1HQC A;  1ZG5 A;  2KRH A;  2Y9Z A;  2DDA A;  3G1L A;  1FOY A;  4G7Z F;  1K78 B;  4QPQ A;  3CCM I;  3LA2 A;  2OC6 A;  2HQR A;  4FT8 A;  3CF2 A;  4ITV A;  1ZK8 A;  2KLO A;  1W36 D;  3R4K A;  3EQL F;  4Z6Y A;  1ETY A;  4DNC A;  3I54 A;  4XK4 A;  5F0C A;  5JLX A;  1Y1W J;  2G0E A;  1U9O A;  1ENH A;  2X85 A;  4N0B A;  5D8K B;  1P9Q C;  1P4A A;  2IVM A;  1ZRE A;  4G94 A;  2CJJ A;  5EGO A;  4LIU A;  3JRE A;  4KIG A;  4PFO A;  2JUG A;  3ECH A;  3EUA A;  4IXA A;  1V4R A;  4XSX F;  3PO3 J;  3OR1 C;  5FLX Z;  1BI0 A;  1RUO A;  1GVJ A;  2PMH A;  3C3W A;  1JUM A;  5B1B H;  2NOG A;  1DPR A;  1I5Z A;  1AA7 A;  5HDK A;  2DFI A;  2PMZ N;  4B44 A;  3M1E A;  4XR6 A;  3A1Y A;  3CCY A;  2QSG X;  3BR0 A;  2FQ3 A;  2R5Y A;  2CW8 A;  3EET A;  3V42 A;  4P5O A;  1F36 A;  2MGQ A;  3LSR A;  3NAU A;  1HDP A;  3QAH A;  3P7N A;  4IKF A;  3K9T A;  4OIR F;  1U8R A;  3KYL A;  4L5J A;  4QWQ A;  2ZXI A;  2W84 A;  3R0A A;  2DOD A;  5D6F A;  3RQ4 A;  2H94 A;  5HLG A;  2EZI A;  3FM3 A;  3JRD A;  5JVT A;  2VKV A;  2MH9 A;  1XMA A;  2FXA A;  1SC7 A;  3C1D A;  2HFH A;  2KIS A;  1YIO A;  4ON0 A;  2VXZ A;  1HDD C;  2E1O A;  4CHU A;  1WVR A;  2Z16 A;  3GTQ J;  4JBA A;  1ZQ3 P;  1TZL A;  1S29 A;  2DT6 A;  1FLI A;  1WWX A;  1ETX A;  1BN5 A;  3K1P A;  2FX0 A;  3PSI A;  2JTV A;  1A36 A;  1NHA A;  3CMY A;  2A6T A;  2HGC A;  2LG4 A;  4FE7 A;  2R7D A;  2UXX A;  3MWM A;  1OKR A;  1DGR M;  2CG4 A;  1LUJ B;  3S3O A;  3ZGK A;  2K02 A;  3FIW A;  3MEX A;  4E7S A;  2MSY A;  3CUQ B;  3ZQH A;  2VOD A;  3OSG A;  4JX5 A;  5ICE A;  1V5G A;  2Y2Z A;  4IRH A;  1OYW A;  3BG6 A;  2E1M B;  5IT9 K;  3JRI A;  4Z2Y A;  2Y9Y A;  2DDB A;  5ILU A;  3SFI A;  1LE8 A;  3GCM A;  4BXX J;  2NNN A;  2XF6 A;  1MJB A;  2FBI A;  4IQJ A;  4MGR A;  1MGT A;  1KQ0 A;  3G3Z A;  2WAE A;  3ZQ7 A;  1RZ4 A;  3FMR A;  1IDZ A;  2L9V A;  3HUG B;  3G1M A;  1P4X A;  1B9N A;  1MDM B;  3TP3 A;  3QP5 A;  5DD4 A;  2K5C A;  2R7Z J;  1W5S A;  1XGM A;  1MMD A;  2ZJP F;  4MEY F;  1Q1H A;  3K4M A;  2VQL A;  4DBQ A;  1S7E A;  4BGD A;  5L3C A;  4EQQ A;  1R5I D;  3FXL A;  3K69 A;  5IP9 J;  4BJ6 C;  1OMI A;  4XNF A;  4Y7N J;  1CQT A;  2JQ7 A;  5C3E J;  1ORK A;  4I09 A;  2R0Q C;  2LOO A;  2CV0 A;  4KN7 X;  4KA4 A;  3B6C A;  4GYI A;  2XAQ A;  4BHP A;  1WFX A;  3CCV I;  3PM1 A;  1FYL A;  2R7S A;  3LSM A;  2L7K A;  2WV1 A;  4C3J J;  2X1D A;  3IRQ A;  1SD6 A;  4RGR A;  1QVU A;  4Y15 A;  2V9V A;  3CCU I;  2HXO A;  3RZD J;  3WGI A;  1OPC A;  2NVY J;  5E3N A;  3U21 A;  1FSE A;  5HLT A;  1MSF C;  2FMY A;  4WX9 A;  1JKQ C;  2Z1D A;  1NK2 P;  4OIO F;  3KPH A;  3N05 A;  2X6Y A;  3AAF A;  2AS5 F;  1OIS A;  4MFE A;  3ZRG A;  3L1P A;  4XKV A;  2WB1 A;  3K2Z A;  5E18 F;  4QTR A;  1Z9C A;  3GXO A;  4CIC A;  4RLQ A;  1MMS A;  4AYB A;  2L01 A;  3IWZ A;  3DBH B;  3OR2 C;  2VKD A;  5JVG F;  2MLG A;  4BKX A;  1ZGJ A;  1EKE A;  5HNF A;  1O3S A;  2LDU A;  1KON A;  2R7Q A;  2X1C A;  5HVQ C;  1MJA A;  3CDL A;  3HRS A;  3E5Q A;  4XLE A;  5DCF A;  5LHG A;  1RRJ A;  4QIW N;  1P7I A;  3FWE A;  5DUI A;  4HF2 A;  3VSK A;  2Y30 A;  1JHF A;  2OUM A;  1T6S A;  5CPR B;  1GLN A;  1ZGA A;  2ESN A;  3M7G A;  3H3Z A;  2ZSI B;  1W4M A;  4PJL A;  5CQG A;  2XHK A;  3MKW B;  4BL0 B;  4HDU A;  3Q5F A;  1QBJ A;  2HVS A;  1OYY A;  3GWZ A;  3L2W A;  2FU4 A;  3PNT A;  4BQN A;  4H4K C;  3GLX A;  4U7D A;  4RAF A;  3CUQ C;  2KFD A;  1DP3 A;  1X4P A;  4IQ4 A;  2IA2 A;  3EYI A;  1UHW A;  3JR9 A;  1BA5 A;  2L7Z A;  1TW2 A;  3NWT A;  2G7U A;  4LK0 F;  3CMM A;  2PJR B;  1QRY A;  1IDY A;  1XN7 A;  2QBY A;  2EIK H;  2MH2 A;  1D0X A;  4M9Z A;  1XS9 A;  1B72 A;  4A0Z A;  3MAJ A;  1VQ9 I;  3E7L A;  2XSD C;  1VQM I;  3JRC A;  1Z7L A;  4ZYE A;  2L9S A;  3AFH A;  3FMQ A;  3WTS C;  2TCT A;  2LR8 A;  4PFP A;  5F1J A;  4PDK A;  4OAY A;  3E6C C;  3U2R A;  1R1T A;  2O3F A;  4EEF G;  2A3S A;  2ID3 A;  3ONQ A;  4NHJ A;  2X48 A;  1HW2 A;  4A3M J;  1B8I B;  2X6O A;  2G9W A;  2VL8 A;  4RB2 C;  3S17 J;  3I53 A;  1YYV A;  1H9G A;  2JWT A;  3W2W A;  3QU6 A;  5LEJ A;  2STT A;  2A6E F;  4XKB A;  3T8T A;  3E0J B;  2DW4 A;  2YR2 A;  3HIF A;  2P81 A;  3E3V A;  4KDP A;  2HYG D;  3LFK A;  4XQF A;  2D2W A;  2JK3 A;  3DXJ F;  1W7P A;  2L4A A;  3D0S A;  2V26 A;  1VQ5 I;  1ZH5 A;  4UY8 I;  3FZV A;  3HB9 A;  3SJM A;  1GXQ A;  2X4H A;  3V8L A;  3HKZ N;  2DQL A;  3H0D A;  3S2D J;  1D0Z A;  1DP7 P;  3BR2 A;  2DYR H;  4RB1 A;  1BM9 A;  3HOV J;  3REO A;  1IJW C;  5M5X J;  4LIT A;  3S16 J;  4UVB A;  1EV7 A;  2DA7 A;  3SDG A;  3LSG A;  4Y33 A;  3ABT A;  4HYE A;  1LB2 A;  2VOO A;  2XDV A;  3RSN A;  1YS6 A;  3VWB A;  2O03 A;  1MBK A;  1MZB A;  4UV8 A;  3ZR8 X;  2FML A;  4B1R A;  2B7E A;  3IRR A;  4KIS A;  4I98 B;  1MND A;  1LQ1 A;  1AWC A;  1OCT C;  3H1C A;  4HZF A;  1S5L C;  3BTJ A;  4IOA F;  1A04 A;  5DTD A;  2KZV A;  1TC3 C;  4I02 A;  1K7A A;  3D5L A;  1X3W B;  1TNS A;  3ISP A;  1JUS A;  3RYP A;  1H9T A;  1ETV A;  1Y1V J;  3HRT A;  1P92 A;  2PJR A;  2RVC A;  1LDD A;  4EVI A;  4UUS B;  3MVP A;  3EUH A;  2W00 A;  2X51 A;  2XUB A;  2ELH A;  4KN4 X;  1SVO A;  2V7F A;  2V9P A;  3CCJ I;  1YIJ I;  1OCO H;  1RES A;  2EZH A;  1KA8 A;  2E2H J;  3VYU B;  2EPF A;  1G4D A;  2Q0O A;  2LD5 A;  4D1Q A;  3EDP A;  3GME A;  4KT6 A;  2Z2S B;  5C4J J;  3FBN B;  4E6K G;  3T0Y A;  1VI0 A;  3EYY A;  3FK7 A;  3S2W A;  4ZZD A;  4A3F J;  2HPI A;  1K6O A;  3ZN0 A;  5CQE A;  3EUH C;  3SYT A;  2R4G A;  3V7C A;  3S3N A;  4LB5 A;  1UFM A;  4U0W A;  3VEP A;  2ELJ A;  3Q9V A;  4C2M J;  4W97 A;  4E7K A;  5F0H A;  5IP6 A;  1S9H A;  1WJE A;  2DMQ A;  3S15 J;  2UZK A;  4IX7 A;  4C3I J;  2DO7 A;  2PLY A;  2BXY A;  3WGH A;  2K9L A;  5F08 A;  2FE3 A;  2FSW A;  2EZL A;  1TWF J;  4O5V A;  4UVC A;  3G73 A;  1QPI A;  2F5V A;  2DN0 A;  1KU9 A;  1X19 A;  2WAQ N;  3BJO A;  2GBY A;  3KEY A;  2F5E A;  3KE2 A;  5FFX A;  1ZLJ A;  2LY2 A;  4G6Q A;  5DUK A;  2XAF A;  3ZMV A;  3P9C A;  5E1Z B;  2B9S A;  2GQQ A;  3V7S A;  2W25 A;  1N25 A;  2EK5 A;  1QQI A;  5IYD J;  1IXR C;  2H1L A;  3T1B A;  2NNY A;  4HNU A;  1XSX A;  3DP7 A;  3RIR A;  2AO9 A;  2JVG A;  5LBQ A;  3SQN A;  3MZY A;  2OU2 A;  2XAJ A;  1RET A;  5BS6 A;  1J0R A;  1I27 A;  5FKM A;  3RKX A;  2BY0 A;  3M1C A;  5FO5 A;  3GW2 A;  3I4M J;  3HOT A;  1XMX A;  4L5E A;  3ABK H;  3JAM Z;  3J7A Y;  4HDV A;  3I9V 2;  3OYE A;  5FD5 A;  1PP7 U;  4XRF A;  2OCE A;  5B1A H;  4L18 B;  4LIV A;  1VQO I;  2IS4 A;  4M71 A;  3FKJ A;  1PUF A;  4EM2 A;  3WTY C;  4NUB A;  2ELK A;  3TW7 A;  3I5U A;  3JRG A;  3N97 A;  1F5T A;  1ZGW A;  4HX4 A;  1W7P D;  4U0Y A;  4IHV A;  5J8C A;  1EH6 A;  1JTX A;  2EFN A;  5AIQ A;  4A0Y A;  3K1M A;  3O2P E;  5ICG A;  1T38 A;  2CGP A;  1VQ7 I;  3LSP A;  2PMZ A;  3BG5 A;  2E7W A;  2DA1 A;  2BY1 A;  4G6T B;  2PX9 A;  2IJL A;  2ZSH B;  3QWL A;  3AL0 B;  1VTN C;  3S14 J;  3IP4 B;  3WHB A;  1YQA A;  1YRN B;  3CJT B;  5LHH A;  4YIR X;  5J6X A;  5IT9 Z;  2JMW A;  2M7B A;  3QOE A;  4LG0 A;  1ZTR A;  2QUF A;  1U78 A;  2F5D A;  2FUG 2;  3P9I A;  4IRG A;  2JT1 A;  2M34 A;  2JVH A;  3H5R A;  3SZG A;  3QPT A;  4CUG A;  4LD5 A;  2CRG A;  4XLH A;  2VJI A;  2DMP A;  2DPU A;  4IHX A;  1Y0U A;  2D45 A;  2F4M B;  3GTM J;  2OZ6 A;  4BH9 A;  1ULY A;  5C44 J;  3DKW A;  2P7V B;  1VQP I;  4EGZ A;  2GOX B;  4JOM A;  4JQF A;  5EF6 A;  4AC0 A;  4B3A A;  2P4W A;  2RQP A;  4FX0 A;  2CH0 A;  3R61 A;  3CLO A;  3X2Q H;  1MMG A;  1SD7 A;  1Z3X A;  1DU0 A;  1QVT A;  2BBY A;  1R1V A;  1XDU A;  1VQN I;  5BPI A;  1TWC J;  3JRH A;  3GTJ J;  2V1N A;  1YOV B;  2DA3 A;  1IN4 A;  2P8T A;  5CVU A;  3I71 A;  2CV1 A;  5CJ9 A;  5CVR A;  2HQA A;  3TQN A;  4BUP A;  3FMS A;  3PIO F;  2JSC A;  5KAF C;  2K9Q A;  2JSP A;  1REP C;  2R7O A;  1IRX A;  2I5U A;  1P7J A;  5E8I A;  1YX3 A;  1TNT A;  4G8X A;  1VFC A;  5GPC A;  3G6E I;  3GFJ A;  2HYJ A;  4U87 A;  3BR6 A;  2JRM A;  3NAR A;  5CYV A;  2K9M A;  2OJE D;  5E17 F;  3HEF A;  2JA2 A;  2HDD A;  2IRF G;  3CC7 I;  1FBU A;  2K9S A;  1G3W A;  1HW1 A;  2JPC A;  1J5Y A;  3L2C A;  4KFC A;  1WJB A;  2E5N A;  2VUM J;  5EDN A;  3CCQ I;  1ZYR F;  1YLF A;  4XM3 A;  3GX4 X;  4XBF A;  5DDG A;  4M3E A;  4F92 B;  3RTR A;  4PUS A;  1R58 A;  1LPQ A;  4D5C A;  3L7W A;  3GBG A;  1FYK A;  2VBX A;  5J3L A;  2E35 A;  1WPK A;  4MEX F;  2DT5 A;  3HRU A;  1TT5 B;  3H5N A;  3OOU A;  2YU9 J;  2HS5 A;  2A68 F;  2KJC A;  4NQW B;  4PCQ A;  3TKY A;  2D1V A;  1F4K A;  3NRV A;  5HLI A;  4M3B A;  4XLP F;  5CVV A;  3TDZ C;  3F8C A;  3G71 I;  3U9G A;  5DM6 F;  2FEZ A;  3TMO A;  2WC2 A;  3KET A;  1WH5 A;  3A01 A;  5ERI A;  2VN2 A;  3L09 A;  4U88 A;  2JPB A;  1UST A;  1IN8 A;  2XGE A;  2EH3 A;  3F21 A;  3RKY A;  2DJN A;  1SFU A;  3DEE A;  1WSU A;  1U2W A;  5F6F A;  1KU7 A;  3K4J A;  3CDI A;  4RAZ A;  3C18 A;  4M9S A;  2GZW A;  1NG6 A;  1V54 H;  1YG2 A;  1FYM A;  1PVE A;  4L0Z B;  5FRN A;  4P96 A;  4BBS J;  4M9X A;  1IRG A;  2BVL A;  1MBE A;  2M8G X;  2VT3 A;  5F0F A;  2C6Y A;  4NDL A;  2K4J A;  2IGN A;  2N8G A;  5K7H A;  3I3L A;  3GZ6 A;  1VQ4 I;  3CLQ A;  3CO7 C;  1TWH J;  1T2K A;  2QYO A;  4YFX F;  1AHD P;  3CCL I;  2FRH A;  1XDS A;  4DBR A;  1HF0 A;  3CC2 I;  3TO9 A;  1FWZ A;  2Y0S N;  4LG3 A;  4PSW A;  1PDN C;  1FMW A;  2O7O A;  2NS0 A;  2YX7 A;  2M0M A;  2BXZ A;  2R7U A;  5H2F C;  3IH2 A;  3ASO H;  2FJ1 A;  4AIH A;  4BAY A;  4F52 A;  1WRJ A;  3GTG J;  1XG1 A;  2HDC A;  3OYF A;  2XAS A;  1I3Q J;  2GWR A;  3LMM A;  3BT9 A;  4NC8 A;  1X58 A;  4ETS A;  1ETW A;  3W3C A;  1D3Y A;  2EA4 A;  2KL4 A;  1O4X A;  2DLL A;  2DA6 A;  3DLL F;  3ZQC A;  1AKH B;  4MO7 A;  3ZQQ A;  3VOD A;  2MC3 A;  1TWA J;  2HZD A;  1R7J A;  2W4S A;  1GVD A;  3M8F A;  1O7F A;  3C7J A;  5J47 A;  5D5U B;  1MBJ A;  4F3Q A;  1EH8 A;  3M07 A;  3MZH A;  4IZZ A;  2NVT J;  5EYR A;  4A5N A;  3J81 Z;  2L02 A;  3V4G A;  2HYF A;  4NQW A;  2IP2 A;  2DOF A;  5LGU A;  2PEX A;  4HEA 2;  1UHS A;  3GVA A;  5JR3 A;  2CW7 A;  1X2M A;  4BEH A;  1HLV A;  3BG9 A;  2COB A;  4MTD A;  1ZRC A;  4RM3 A;  3GTP J;  3P5J A;  2I8D A;  3FXM A;  2CQ7 A;  3F8B A;  4B3X A;  4PZJ A;  4I6Z A;  3PFY A;  2HTJ A;  4IOC F;  5D4S A;  5LRR A;  1WJF A;  1FEX A;  4XON A;  1NK3 P;  3E6B A;  5A2Q K;  2HVQ A;  1G3Y A;  2VBZ A;  4AID A;  3K10 A;  3QPS A;  5TJJ A;  3RI4 A;  2KIQ A;  3ERE D;  1F9N A;  2QEX I;  1FIP A;  1K61 A;  1X3Z B;  3BJ6 A;  3F72 A;  4X6A J;  1KQ9 A;  2L3D A;  2PBI A;  2W57 A;  3HKZ A;  3I64 A;  4V19 K;  2LLK A;  5DCM A;  5LFA A;  1ZR4 A;  3K7A J;  2XKP A;  2ZBK A;  3F6O A;  1QHG A;  4HNT A;  4XRS A;  4RB3 C;  2JRT A;  2DTZ A;  5D5V B;  2ZJQ F;  4GFB A;  2L0K A;  1ZAR A;  2RN7 A;  4XN3 A;  4OIQ F;  4QLC U;  2K40 A;  1U5T B;  2Y75 A;  3ZN1 A;  2IS2 A;  1IRZ A;  1E17 A;  3UNG C;  3W6K B;  2M45 A;  3WG7 H;  4L0Y B;  1CF7 B;  1S6L A;  3DEW A;  2KDZ A;  5IYC J;  2ZME B;  4NB5 A;  4AVP A;  4IHS A;  3ZQG A;  2W24 A;  2YUS A;  5GAD J;  3SZT A;  3A0B C;  4JX4 A;  5E3M A;  3MFK A;  1RKW A;  2RNG A;  2DA5 A;  3DTK A;  2FF4 A;  2VOP A;  1V55 H;  1HKQ A;  2AHQ A;  3ZQI A;  2L9N A;  5EZH A;  1GV2 A;  2OAZ A;  1K78 A;  2VBY A;  1LFU P;  2CFX A;  4P55 A;  3WU2 C;  2HDW A;  2L54 A;  2J5P A;  1Z3Y A;  4KMU X;  1UG2 A;  4XL9 A;  2VQC A;  2GLO A;  1TW3 A;  1X3U A;  1BR2 A;  2FQ4 A;  2I10 A;  3VYS B;  1VQ8 I;  4Q4Z F;  2EQR A;  2MG4 A;  2F6C A;  3DV8 A;  4CH7 A;  3D1N I;  3KEQ A;  1D5V A;  5HLH A;  2MYS A;  4JX6 A;  1V5F A;  2DQR A;  1GHC A;  4XRM A;  2E36 A;  4ZTF A;  4II3 A;  2HKX A;  3WGG A;  3WTT C;  4C2T A;  1Q1V A;  1D1C A;  4B48 A;  4XMY A;  2EIL H;  4ESF A;  2LC2 A;  3F6V A;  3LL7 A;  4ESJ A;  2HVR A;  2P5K A;  5GPA A;  1ZLK A;  3OYK A;  3LSJ A;  5K5O A;  2WAQ A;  1R00 A;  5GP9 A;  3JTH A;  4HOB A;  1JE8 A;  1GUU A;  2E2J J;  2RC4 A;  2XPU A;  1E3O C;  1OYI A;  2E7X A;  3OYD A;  4ZTJ A;  3HTU A;  4DGW B;  2FOW A;  1E2X A;  2OA4 A;  3MKL A;  2BW3 B;  1YJ9 I;  2DXI A;  3FIS A;  3Q3S A;  2M5W A;  1JKR C;  2HPM A;  3H5A A;  2COM A;  4EMS A;  1XD7 A;  3B6A A;  1K79 A;  1TL8 A;  4PJN A;  2K27 A;  2E34 A;  4RB0 A;  1G2H A;  2W82 A;  2X6X A;  1DQU A;  4K2E A;  5CLS A;  3KP6 A;  2EIM H;  5H20 A;  1YO5 C;  5BOX A;  2K4B A;  3Q9S A;  2RAE A;  3OS1 A;  4MFD A;  4QSH A;  5FKL A;  4YEJ A;  2OZU A;  5AON A;  1WI3 A;  3KIO A;  1G59 A;  1VZ0 A;  4S05 A;  1PJR A;  1U5T C;  2ACJ A;  3TO6 A;  3C2H A;  2R92 J;  4P9U A;  1R1U A;  4FE4 A;  4XLF A;  3WHC A;  3KZY A;  1ZRD A;  3PNV A;  3CUO A;  3PQK A;  3MD2 A;  3OYN A;  3K70 C;  4ENK A;  2WWY A;  2W85 A;  3K1N A;  4ZDL A;  1QO0 D;  1WQ2 A;  3IUO A;  3KZZ A;  3BP8 A;  3S93 A;  1BJA A;  2MAB A;  2M4G A;  3CUQ A;  2DI3 A;  4IL6 C;  4YRV A;  3MKY B;  1SAX A;  5KCM A;  4HRI A;  1JUP A;  3PL8 A;  1IZ1 A;  1W5C C;  4WCG A;  5JHU A;  2DFF A;  3HC7 A;  1GXP A;  3M4O J;  1BW5 A;  2H1K A;  1MW7 A;  2A61 A;  4HF0 A;  2VJ5 A;  3JCU C;  3J80 K;  2M8E A;  2P6T A;  4XSZ F;  5ILS A;  4M3G A;  3BQY A;  3GZN B;  2GA2 A;  1M1E B;  3CME I;  4IF4 A;  3CD6 I;  4GO1 A;  4ABZ A;  2IS6 A;  4A3J J;  1RIO H;  1YFH A;  2E1M C;  2MA3 A;  3HUG A;  1EH7 A;  2VE9 A;  1XCB A;  3OYB A;  1MDM A;  2KIM A;  2NS7 A;  3ESW B;  4EGY A;  1FP2 A;  1IN7 A;  1KYZ A;  2QGU A;  3GTK J;  4HLY A;  3KP7 A;  1BOB A;  4S0H B;  2PJP A;  4IHT A;  1WKM A;  2DK5 A;  2M4K A;  4BY7 J;  3WTZ A;  3HOZ J;  5IY5 H;  2IPQ X;  2KJB A;  1UJ8 A;  2GAU A;  3F3X A;  2O9L A;  5B5E C;  1XGO A;  2V6C A;  4IRI A;  1BL0 A;  1PYV A;  3OY9 A;  3T8R A;  2DTR A;  3OYJ A;  4HPQ A;  2HOA A;  3BZC A;  2IS1 A;  2Y48 A;  3J7Y J;  3W6J B;  3M8J A;  2EBI A;  2QQA A;  3KP2 A;  5ILV A;  4AIJ A;  2DPD A;  6PAX A;  1HST A;  2QQ9 A;  4FAS D;  1FBS A;  2DU9 A;  3ROU A;  2EZK A;  2YX4 A;  2LH9 A;  2M2E A;  4WF2 A;  1XPX A;  2B0L A;  3TL4 X;  2DOE A;  3DTI A;  2CQK A;  3K4B A;  2VON A;  4O3M A;  2LKS A;  2OD5 A;  2CFO A;  1SD4 A;  4A3L J;  3TP0 A;  3H36 A;  3I0T A;  1H8A C;  2QA4 I;  3CCE I;  3WOD F;  2XC7 A;  2CV2 A;  3OIQ A;  4ENM A;  5FFZ A;  1ZR2 A;  4E7I A;  3CES A;  4RAG A;  3PUB A;  4DQ2 A;  2LKX A;  3G1O A;  3J7Z I;  3BR1 A;  3OMY A;  4EM0 B;  1MIJ A;  1H89 C;  2ZXH A;  2VLA A;  3W6V A;  2WA0 A;  4AIK A;  1R49 A;  1KU3 A;  1QPM A;  3Q0W A;  4L5I A;  1BJZ A;  1WH7 A;  3O6B B;  4D5F A;  3DLA A;  2H6C A;  2HQ5 A;  3I55 I;  4EM1 A;  2JA8 J;  1X1C A;  4AWX B;  3O8G A;  3PJR A;  3V8J A;  4R1H A;  3F9K A;  1BC8 C;  2XPW A;  5J1Y A;  1C0W A;  3HRM A;  3D5R C;  3DU6 A;  1HW5 A;  2JA7 J;  3CO6 C;  5EZG A;  3DPU A;  1XX5 A;  1ZG3 A;  1UHM A;  2UWM A;  5HDN A;  4A69 C;  2BHY A;  3MKZ A;  1O3T A;  2H8W A;  2HU9 A;  1FOW A;  1UMQ A;  1XMK A;  5K5R A;  1YE9 A;  1KYW A;  1DPU A;  2BOL A;  3KYD B;  3DFG A;  1S3J A;  5BNG A;  1B4A A;  1HKT A;  3K70 D;  1W5T A;  2GOM A;  2R7R A;  1WI9 A;  1FT9 A;  4KIB A;  2O5R A;  1IXS B;  2WBM A;  2WAD A;  2QWW A;  3DWL E;  1FJL A;  5FLX K;  4MQV A;  1T08 B;  4XIC A;  3F8M A;  2HEO A;  1IC8 A;  4EJO A;  4DYR A;  3IH3 A;  3A0H C;  4NC6 A;  2CYY A;  2BY3 A;  1B8I A;  3IV5 A;  2A6H F;  3LAP A;  3SDB A;  5C4X J;  4LK1 F;  3LWF A;  1A35 A;  2ADU A;  2XV4 S;  4E70 A;  4J00 A;  4PSX A;  1L3L A;  3FXR A;  1NTC A;  3H92 A;  3HHG A;  1Z91 A;  3E5X A;  2L7F P;  3U1K A;  1MBG A;  3KYC B;  2EB7 A;  1YS7 A;  2VB6 A;  2Y0S A;  1YX5 A;  2V1D A;  3LQR A;  4UXN A;  2X0L A;  2P6S A;  1FY7 A;  2M0C A;  4BHB A;  3DPT A;  4B47 A;  3K4N A;  2QQB A;  2VAS A;  3VSL A;  1IRF A;  3H9J A;  4YEL A;  4WWC A;  4KMF A;  4XOP A;  4EAT A;  3BQZ A;  1VF9 A;  3G2B A;  3I58 A;  4OIN F;  4UB8 C;  4X0G A;  4A0X A;  4Y52 J;  5EG0 B;  4BNC A;  4CO8 A;  2AXL A;  2JJ7 A;  1OCC H;  3OV8 A;  1IN6 A;  4CCJ A;  2LSO A;  1T8I A;  5J8F A;  2YPR A;  4U7B A;  4XID A;  2VQG A;  2F2E A;  1IUF A;  4XKC A;  5L3F A;  1SFE A;  4WXD A;  4M72 A;  4HF1 A;  3H3U A;  2LBF B;  1SFK A;  3IKV A;  2EV0 A;  4PJM A;  1E0E A;  2ZFU A;  4ZC3 A;  4IVN A;  2F5F A;  3VDX A;  2QM3 A;  3U1D A;  4D7M A;  1SMT A;  4ASN A;  4AVZ A;  2P5V A;  1ONV A;  4A5M A;  3P9K A;  5CVI A;  2IBD A;  4Q48 A;  5B3S H;  5DV5 A;  5J4Y A;  4A3I J;  2IXS A;  4A93 J;  1F43 A;  2GM4 A;  3HSR A;  4BXU A;  2Z9O A;  1I1S A;  1IV8 A;  2R7F A;  4UUS A;  3VPR A;  3NEU A;  4FCY A;  2YU3 A;  3ASN H;  3DCF A;  2Y31 A;  2Z99 A;  3FXQ A;  4XOR A;  3E5U A;  4C2U A;  1OCZ H;  2DCE A;  4RAY A;  1SMY F;  1U9N A;  1Z67 A;  5EJC A;  4OOI A;  4FQG A;  2KP6 A;  1D1A A;  4I7H A;  3ECO A;  1EA3 A;  1XSD A;  2BGC A;  2OPT A;  1QU3 A;  3CJN A;  2IA0 A;  3K4C A;  3HM5 A;  4I01 A;  3CC4 I;  4I0A A;  3TBI A;  5F04 A;  3BLY A;  4BHC A;  1O3R A;  4HV5 A;  4YIF A;  3ABL H;  5GAE J;  1TWG J;  3E1S A;  1VQL I;  4YFN F;  4BQA A;  1G6N A;  1JHH A;  1Z6R A;  2VPL A;  4CYD A;  3ZXS A;  1J2X A;  2OBP A;  2OQG A;  2VC0 A;  5E8G A;  4ZDO A;  4C9Y A;  3OYM A;  2RGV A;  2WAF A;  1O57 A;  5FKO A;  3VYT B;  3BWG A;  3HOY J;  4F91 B;  1H0M A;  3AG1 H;  4HNV A;  4ENN A;  3RKQ A;  3HYI A;  4V2G A;  3K4L A;  5K1Y A;  3DU5 A;  3CCR I;  3BRO A;  3ERM A;  1RI7 A;  3FDY A;  1NG7 A;  3GEZ A;  5HDG A;  1H88 C;  4M6X A;  1J09 A;  3PQJ A;  5L3G A;  1PUE E;  2GXB A;  2A5W A;  2NAZ A;  3QPL A;  4B8X A;  2IEK A;  1MJ9 A;  4OAZ A;  4BJ5 C;  1FX7 A;  4GCV A;  3IHU A;  3KCC A;  1FZP B;  1OCR H;  1D0Y A;  2O8K A;  1DU6 A;  3K2A A;  3HHH A;  3QYE A;  2O0Y A;  2MD5 A;  1SAU A;  4UUT A;  1BI2 A;  3DTE A;  2CSO A;  3KLO A;  1I6H J;  3W2V A;  2L2O A;  3I4N J;  4BE1 A;  1Z21 A;  1BC7 C;  1RKT A;  4TV7 A;  3FK6 A;  1MSE C;  2UUZ A;  4CDG A;  3ZPL A;  2VJJ A;  5FD6 A;  4A3C J;  1W0T A;  3BG3 A;  1FOX A;  2OQR A;  2ZCW A;  4FX4 A;  2M9H A;  2XB5 A;  4N4O B;  4A2U A;  4BY1 J;  4CYC B;  4XOT A;  2HI3 A;  1A6Q A;  2IA1 A;  2KRF A;  4M74 A;  4B09 A;  4I0B A;  4ANJ A;  2AQE A;  1FNN A;  1R9T J;  1X4O A;  2V6E A;  1S72 I;  2CQN A;  1K83 J;  2B63 J;  5F64 A;  3MZ8 A;  5FKN A;  3HOS A;  4RBO A;  1XGN A;  3PUF A;  1BOA A;  3KX2 A;  1MNM C;  2EIN H;  1YRN A;  1R4N B;  5JFR A;  4NC7 A;  3BTC A;  3A02 A;  3ABU A;  4C3H J;  1SVM A;  2W48 A;  4HX8 A;  1LEA A;  1XGS A;  1LEB A;  1UAA A;  1FTT A;  1R23 A;  2AQF A;  3GTO J;  4ENJ A;  2VKE A;  2HKO A;  3LAJ A;  3BCB A;  4O6J A;  3AL0 C;  1WJC A;  2CUJ A;  2VXD A;  3MMY B;  3FHN A;  3S1Q J;  2QQ8 A;  3HTS B;  1TP4 A;  1KZH A;  5DD8 A;  4MNU A;  1FSH A;  3R60 A;  2VIX A; 
#chains in the Genus database with same CATH homology
 2AHQ A;  2DMN A;  3ZQI A;  2E2I J;  2DMU A;  2TCT A;  2LR8 A;  3OSF A;  5EZH A;  5F1J A;  1GV2 A;  3TED A;  5EGO B;  1LFU P;  3RQI A;  3FKI J;  4EEF G;  3PO2 J;  2ID3 A;  2MW8 A;  2X48 A;  5J1R A;  4A3M J;  4J19 A;  1U8B A;  2X6O A;  1B8I B;  2CQQ A;  3S17 J;  2CUE A;  2JWT A;  4MLO A;  2WB1 N;  4AYB N;  3O8H A;  1A6I A;  2P81 A;  1HOM A;  1UG2 A;  2GLO A;  3TW6 A;  2FQ4 A;  4IHY A;  2I10 A;  2LFB A;  1SAN A;  2EQR A;  2MG4 A;  3MN2 A;  2R5Y B;  2JK3 A;  3D1N I;  4JX6 A;  4JP0 A;  1OCP A;  3HB9 A;  4XRM A;  3SJM A;  5EEA A;  1ETO A;  2XB0 X;  1BW6 A;  3GTL J;  1Q1V A;  1X2N A;  2DMT A;  2QF7 A;  3HKZ N;  3S2D J;  3BR2 A;  3S1R J;  3HOV J;  4DZP A;  5GPA A;  5IP7 J;  5M5X J;  1IJW C;  1JJ6 C;  1JKO C;  3S16 J;  3LSJ A;  5GP9 A;  2DA7 A;  1GUU A;  3SDG A;  3LSG A;  2E2J J;  2ME6 A;  2XPU A;  1MH3 A;  1E3O C;  3S1N J;  1RPW A;  3LNQ A;  1POG A;  2E19 A;  3MKL A;  1MBK A;  4B1R A;  3CQZ J;  3F0C A;  3FIS A;  3Q0V A;  3Q3S A;  1RR7 A;  1JKR C;  1GDT A;  2TRT A;  3JRA A;  2DA2 A;  3B6A A;  5EG0 A;  1OCT C;  2CQX A;  3A01 B;  1G2H A;  3BTJ A;  5DTD A;  3BTL A;  1TC3 C;  4DYQ A;  3S1M J;  1IV6 A;  1JT0 A;  1OJL A;  2QCO A;  9ANT A;  1JUS A;  5IYB J;  1WGX A;  2KT0 A;  1ETV A;  2LVS A;  1Y1V J;  2RAE A;  5E3L A;  4MFD A;  1Z77 A;  4QSH A;  4UUS B;  5FKL A;  3MVP A;  3JRB A;  1WI3 A;  3ZOB A;  3S2H J;  4IEJ A;  4M3F A;  2R92 J;  4A3G J;  1RES A;  2EZH A;  5M3M J;  2E2H J;  4FE4 A;  2LD5 A;  3WHC A;  1GT0 C;  1FTZ A;  1VND A;  5C4J J;  2HOS A;  2R5Z B;  1VI0 A;  3FK7 A;  3HOU J;  1LE8 B;  4A3F J;  3JRF A;  2JN6 A;  5M5Y J;  4C2M J;  4W97 A;  3HGY A;  5F0H A;  5IP6 A;  1ITY A;  3A03 A;  5J1U A;  2DMQ A;  1JUP A;  3S15 J;  4C3I J;  1BW5 A;  3M4O J;  5HOD A;  2H1K A;  3HDD A;  5F08 A;  4G12 A;  3HOX J;  4M3G A;  1QPI A;  2EZL A;  1TWF J;  3BQY A;  5IOZ A;  1MBF A;  2DN0 A;  2XGC A;  4ABZ A;  5FLM J;  3HOW J;  2WAQ N;  4A3J J;  1JJ8 C;  2GBY A;  2OF7 A;  3BR5 A;  5FKK A;  3M3Y J;  2L9R A;  3H0G J;  1JKP C;  2NS7 A;  3GTK J;  1LFB A;  1JT6 A;  2NVX J;  4S0H B;  3HGG A;  3OIO A;  4W1U A;  3HOZ J;  4BY7 J;  2O9L A;  2HOT A;  4A3B J;  5IYD J;  5IPA A;  4BBR J;  1AU7 A;  1BL0 A;  2JA6 J;  1D5Y A;  2AO9 A;  4M3D A;  2HOA A;  1APL C;  1RET A;  2EBI A;  1AKH A;  5FKM A;  1SFO J;  3I4M J;  4L5E A;  2EZK A;  2M2E A;  1W0U A;  4A3K J;  1PUF A;  4A3L J;  2ELK A;  3TW7 A;  4JYK A;  4M6V A;  3TP0 A;  1A5J A;  3JRG A;  1ZGW A;  1H8A C;  4RDU A;  4B4C A;  4IHV A;  2H8R A;  1JTX A;  2ZB9 A;  4IHW A;  2LK2 A;  1ETQ A;  3LSP A;  2HXI A;  1ZR2 A;  3BG5 A;  2DA1 A;  5FLV A;  2LKX A;  2ME0 A;  3G1O A;  5K7F A;  3BR1 A;  1H89 C;  3W6V A;  3S14 J;  2R5Z A;  1XC5 A;  3Q0W A;  3WHB A;  1BJZ A;  1YRN B;  5M3F J;  1WH7 A;  4D5F A;  2JMW A;  2HQ5 A;  3C2B A;  1ZTR A;  1U78 A;  4CYC A;  2JA8 J;  2M34 A;  4D7N A;  3BR3 A;  3O8G A;  1HCR A;  2CRG A;  2CU7 A;  3Q0U A;  2XPW A;  2DMP A;  5J1Y A;  1B72 B;  2NVQ J;  4IHX A;  3GTM J;  5C44 J;  2JA7 J;  5EZG A;  2Y9Z A;  4A69 C;  3G1L A;  5EF6 A;  4AC0 A;  5IOY A;  1UMQ A;  4B3A A;  2LTP A;  5BNG A;  1ZK8 A;  4I76 A;  4DZJ A;  1WCM J;  1DU0 A;  1ETY A;  1QVT A;  4XRS G;  4XK4 A;  5F0C A;  2XGD A;  5JLX A;  1Y1W J;  2G0E A;  1U9O A;  1ENH A;  1FJL A;  2K9N A;  5K7Z A;  1TWC J;  3JRH A;  3GTJ J;  2DA3 A;  1MH4 A;  4XIC A;  2CJJ A;  5EGO A;  1IC8 A;  4DYR A;  3JRE A;  3IH3 A;  3ZQF A;  3PO3 J;  2K9Q A;  2ID6 A;  1B8I A;  1P7J A;  3IV5 A;  5C4X J;  1JUM A;  1VFC A;  5GPC A;  2NOG A;  2HYJ A;  3BR6 A;  3NAR A;  1NTC A;  2PMZ N;  1JTY A;  2L7F P;  1ZKG A;  1MBG A;  3CCY A;  2R93 J;  1OFC X;  3BR0 A;  2R5Y A;  3HEF A;  2HDD A;  2K9S A;  1JGG A;  1F36 A;  2M0C A;  2MGQ A;  3HBL A;  2VUM J;  3LSR A;  5EDN A;  3NAU A;  1HDP A;  4FIS A;  1I50 J;  3BTI A;  4M3E A;  3BQZ A;  1VF9 A;  4Y52 J;  4D5C A;  3GBG A;  5EG0 B;  2JJ7 A;  5J3L A;  2EZI A;  3JRD A;  1WPK A;  2XRL A;  2VKV A;  2X9D A;  2YU9 J;  2LP0 A;  3OOU A;  4XID A;  1IUF A;  4DYC A;  1HDD C;  2E1O A;  3GTQ J;  4M3B A;  2ECB A;  1ZQ3 P;  5F27 A;  1ETX A;  4D7M A;  4X1E A;  1WH5 A;  3A01 A;  2IAI A;  2FX0 A;  2XGE A;  3CMY A;  2EH3 A;  2FD5 A;  4FE7 A;  2IBD A;  2CUF A;  2DJN A;  4A3I J;  4A93 J;  1F43 A;  1MBH A;  3UKG A;  2GM4 A;  3FIW A;  1IGN A;  2MSY A;  4UUS A;  3ZQH A;  3VPR A;  3OSG A;  4JX5 A;  4BBS J;  2Y2Z A;  4FCY A;  1FIA A;  1MBE A;  1T33 A;  3DCF A;  2M8G X;  5F0F A;  3RZO J;  2Y31 A;  3JRI A;  3IH4 A;  4NDL A;  2N8G A;  5K7H A;  1U9N A;  2Y9Y A;  1TWH J;  3SFI A;  1LE8 A;  4BXX J;  1AHD P;  1HF0 A;  2JA5 J;  2OPT A;  2Y0S N;  4LOC A;  1IDZ A;  3HM5 A;  2O7O A;  3G1M A;  5F04 A;  3TP3 A;  4A3E J;  2R7Z J;  3IH2 A;  4FTH A;  2FJ1 A;  2NS8 A;  3GTG J;  1TWG J;  1S7E A;  1XG1 A;  1I3Q J;  2ECC A;  2L7M P;  5IP9 J;  4Y7N J;  3BT9 A;  1CQT A;  1X58 A;  1ETW A;  5C3E J;  1ORK A;  2R0Q C;  1O4X A;  2DA6 A;  3B6C A;  5FKO A;  3ZQC A;  1AKH B;  3PM1 A;  3HOY J;  4MO7 A;  4HNV A;  2WV1 A;  3RKQ A;  1TWA J;  4V2G A;  4C3J J;  2D5V A;  1GVD A;  3QQA A;  1QVU A;  2XPV A;  3LOC A;  1H88 C;  1MBJ A;  2HXO A;  3RZD J;  2NVY J;  5E3N A;  2NVT J;  5EYR A;  3H3V K;  1MSF C;  4A3D J;  1NK2 P;  1JKQ C;  2VI6 A;  3QPL A;  2IEK A;  1PUF B;  1UHS A;  1X2M A;  1HLV A;  4MFE A;  3BG9 A;  2VPR A;  3L1P A;  2COB A;  2O8K A;  1IG7 A;  1DU6 A;  4QTR A;  3GTP J;  3K2A A;  5FJ8 J;  2YS9 A;  4UUT A;  4I6Z A;  4DW6 A;  1I6H J;  3I4N J;  1FEX A;  4BKX A;  1RKT A;  1NK3 P;  3FK6 A;  1MSE C;  3QPS A;  3CDL A;  1EF4 A;  4A3C J;  1FIP A;  1K61 A;  1W0T A;  3BG3 A;  4QIW N;  4X6A J;  1P7I A;  2M9H A;  2XB5 A;  4BY1 J;  4CYC B;  1Z0X A;  2Y30 A;  2HI3 A;  5E3O A;  1T56 A;  1R9T J;  2LLK A;  1ZR4 A;  4AUX A;  2LY9 A;  3K7A J;  1K83 J;  4XRS A;  2B63 J;  5M5W J;  2DTZ A;  4GFB A;  2L0K A;  5FKN A;  4RBO A;  1MNM C;  4MIM A;  1GV5 A;  1YRN A;  2K40 A;  3BTC A;  3A02 A;  4C3H J;  1IRZ A;  2W48 A;  1ETK A;  1FTT A;  3JR9 A;  1BA5 A;  2L7Z A;  3GTO J;  4V2F A;  1QRY A;  2VKE A;  3DEW A;  2KDZ A;  1IDY A;  5DS9 A;  5IYC J;  3ZQL A;  1XS9 A;  1B72 A;  3ZQG A;  3S1Q J;  2YUS A;  3E7L A;  4JX4 A;  5E3M A;  2XSD C;  3JRC A;  2DA4 A;  1RKW A;  2DA5 A;  5JLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...