4Y7NJ

The structure insight into 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4y7nJ00
2M9HA 4UUSA 4AC0A 5E3LA 3BR2A 3CCYA 3NARA 4D7NA 2NVYJ 3SFIA 3FKIJ 1ZR4A 1FJLA 1WH7A 3O8GA 2ME0A 2LTPA 4C3HJ 1Y1WJ 2EZLA 1UG2A 3HB9A 3QPLA 2HOSA 3JRGA 1JGGA 2HOAA 1SANA 5F04A 3BT9A 5FKOA 1APLC 5DS9A 3WHCA 2VUMJ 1AU7A 5J3LA 2L9RA 3B6CA 1U78A 1BA5A 3H0GJ 2FJ1A 2E1OA 3WHBA 5C3EJ 2L7ZA 4MLOA 2JJ7A 3S1NJ 4MIMA 4V2FA 2L0KA 3IH3A 5E3OA 2O8KA 1WCMJ 1ETXA 5FLVA 5M5XJ 3K2AA 1K61A 2JN6A 3HOZJ 5F0HA 1HOMA 4BXXJ 4FE4A 5F0CA 5HODA 2LD5A 1B8IB 1JT0A 1RKTA 1MBFA 1P7IA 4DYCA 3GTKJ 4LOCA 4M3BA 4J19A 1ETYA 3GTMJ 1TWAJ 2X6OA 5FKKA 2HYJA 1IDZA 2CUEA 3B6AA 4BKXA 2IAIA 3FK6A 4A3LJ 1OCPA 1MBKA 5F27A 3JREA 9ANTA 2DA7A 1U9NA 2CRGA 1RPWA 2OF7A 3LNQA 1F43A 3VPRA 2O7OA 1DU6A 2Y9YA 3S1RJ 1ZK8A 1I6HJ 3BG5A 2XB5A 3BR0A 4C3JJ 1GUUA 2LY9A 1LFUP 3LOCA 5EZHA 3TW6A 5K7FA 4IHYA 3ZQGA 4XIDA 4MO7A 4XRMA 2VKVA 1ZR2A 4XICA 5M5WJ 1BW5A 2NOGA 4M6VA 2LP0A 4B1RA 4XK4A 2P81A 1IC8A 1JUPA 2EBIA 3IV5A 5EG0B 2E19A 1B8IA 2B63J 3GTPJ 5EDNA 4AUXA 3TP0A 2CUFA 1HF0A 2M0CA 4CYCB 3G1OA 1ORKA 3HGGA 2DMQA 2WAQN 1AKHB 2ZB9A 2R93J 2JWTA 1U9OA 5JLXA 1JUSA 3MN2A 4MFDA 2EZHA 1IGNA 5JLWA 2HXOA 2WV1A 1S7EA 2Y9ZA 3IH4A 3Q0WA 4B3AA 4JX5A 1ETVA 3JRHA 2VI6A 2MGQA 3D1NI 1OJLA 1H88C 3Q0UA 2DJNA 2DA4A 2XGCA 4W1UA 3TP3A 1BL0A 3OIOA 2DA3A 3MVPA 2K9SA 4JX4A 1RESA 4JP0A 4W97A 3OOUA 5FKMA 1VNDA 3W6VA 1GV2A 3FK7A 4BBSJ 2K9QA 4QSHA 3HOWJ 4DYRA 1MBHA 1JJ6C 2HI3A 3OSFA 2X9DA 2GLOA 5DTDA 2M8GX 4FISA 3ZQIA 2Y31A 1VI0A 3ZQLA 2M2EA 3PM1A 4BY7J 3K7AJ 1F36A 1H89C 2LLKA 3RZDJ 4IHWA 5GP9A 1MSEC 2LKXA 1HCRA 2DN0A 3JRDA 4C3IJ 5EG0A 1OCTC 5J1RA 1FIPA 2KDZA 1VFCA 3HOXJ 1IRZA 1XC5A 3IH2A 3S1QJ 3Q3SA 5IP9J 4X6AJ 3GTJJ 3PO3J 4CYCA 4D5FA 2LK2A 2DMTA 2R92J 3A02A 1AKHA 4A3CJ 1WI3A 2E2IJ 5EZGA 3G1MA 3S16J 2DA5A 5E3MA 4A69C 2LR8A 1EF4A 1A6IA 2R5ZB 1TC3C 5M3MJ 2CU7A 3HOVJ 3FIWA 4IHXA 1G2HA 4NDLA 2R5YB 2HDDA 2FQ4A 2NVQJ 3MKLA 3S2DJ 5J1UA 3HEFA 3RQIA 3SJMA 1CQTA 1TWHJ 2JA6J 2JA7J 5IPAA 2EQRA 1D5YA 2VKEA 2DA2A 2K9NA 2W48A 4G12A 4A3JJ 3JRIA 3H3VK 1T56A 1HDPA 1MH4A 4JYKA 4Y7NJ 3BTIA 1O4XA 1RKWA 3A01B 1Y1VJ 2IEKA 1X58A 2G0EA 1Z77A 5GPAA 1JKRC 1IG7A 1OFCX 3HDDA 1QPIA 1LE8B 3TW7A 3JRBA 2Y30A 1XS9A 2Y0SN 1I50J 3S17J 3ZOBA 4XRSA 5M3FJ 4AYBN 2HXIA 4D5CA 5K7HA 2DA1A 2CQQA 4RBOA 1LFBA 1WGXA 3ZQHA 4M3GA 1TWGJ 1ZTRA 1A5JA 3HGYA 2R5ZA 3DEWA 2JK3A 4M3EA 2MW8A 2HQ5A 2R5YA 2HOTA 3BTLA 2I10A 3UKGA 4A3IJ 4RDUA 1T33A 1XG1A 1P7JA 1WH5A 3HBLA 5EYRA 2DTZA 3C2BA 4MFEA 1ETQA 5BNGA 5EGOB 2MG4A 4BY1J 3GTQJ 1QVUA 2ECBA 1GDTA 2E2HJ 2XB0X 5IOZA 3FISA 4I6ZA 4A3EJ 1HLVA 2XPWA 2H8RA 1PUFB 1JT6A 5FLMJ 3A01A 2DMPA 1U8BA 4GFBA 1QVTA 1AHDP 3SDGA 3LSJA 1RETA 1SFOJ 2R0QC 2COBA 2DA6A 1LE8A 3CMYA 2R7ZJ 3CDLA 2GBYA 2XPUA 3BQYA 2NS7A 5C44J 3PO2J 1ITYA 1YRNB 2AHQA 4A3FJ 1ETKA 4FE7A 4DYQA 1B72B 2LVSA 1MNMC 3E7LA 3JRCA 2XSDC 3S15J 1MH3A 3BG3A 4V2GA 1ETWA 1FIAA 2TCTA 4A3KJ 2FX0A 1VF9A 3G1LA 1JJ8C 2E2JJ 2XGEA 2KT0A 2K40A 3BQZA 1MBEA 1DU0A 2LFBA 2AO9A 5F08A 3ZQFA 4I76A 3L1PA 2QCOA 1ENHA 2RAEA 2Y2ZA 3QPSA 5EGOA 1ETOA 3I4MJ 3HKZN 3O8HA 2EZIA 3BR5A 2ECCA 3I4NJ 1PUFA 5IP6A 4FTHA 2VPRA 1ZQ3P 3ZQCA 3GTOJ 4A3BJ 2MSYA 5FKNA 5M5YJ 2XPVA 2YUSA 2D5VA 2JA5J 1Q1VA 5K7ZA 2ID6A 1GVDA 4HNVA 4JX6A 1MBGA 4A93J 1K83J 5J1YA 5FJ8J 1BW6A 1YRNA 3RZOJ 1B72A 4DZJA 3F0CA 1HDDC 4X1EA 1RR7A 4M3FA 4BBRJ 4DZPA 1IUFA 5FKLA 5F0FA 1Z0XA 2ME6A 1X2MA 1ZGWA 5C4XJ 1TWCJ 1JTYA 5C4JJ 3JRAA 5EF6A 4DW6A 1QRYA 2TRTA 1WPKA 1NK2P 3S2HJ 1X2NA 4C2MJ 3RKQA 5IYCJ 3M3YJ 5IYBJ 2CQXA 3BTCA 3BTJA 2JA8J 1MSFC 1MBJA 2ID3A 1POGA 4S0HB 2IBDA 1R9TJ 4Y52J 3S14J 5EEAA 5IOYA 2WB1N 2CJJA 5F1JA 4IHVA 1IDYA 3A03A 3HOYJ 2JMWA 2NS8A 1FEXA 4QTRA 1FTZA 3Q0VA 2EH3A 2L7MP 4A3GJ 1BJZA 1TWFJ 2XRLA 4UUSB 4A3MJ 2NVTJ 2X48A 5GPCA 2XGDA 1GT0C 2L7FP 3BR6A 3LSRA 5IYDJ 2DMUA 3HM5A 2YS9A 1NK3P 3LSPA 1GV5A 4UUTA 3GTGJ 3QQAA 2PMZN 2ELKA 4L5EA 1IV6A 4EEFG 4QIWN 3S1MJ 3LSGA 1JKOC 3GTLJ 4IEJA 3JRFA 3NAUA 5IP7J 1FTTA 3OSGA 2DMNA 2GM4A 1W0UA 4A3DJ 1ZKGA 1JUMA 1W0TA 1JKQC 3BG9A 2N8GA 3M4OJ 1JKPC 1IJWC 2M34A 4B4CA 2EZKA 2FD5A 4D7MA 1NTCA 2QF7A 2NVXJ 3CQZJ 5E3NA 4ABZA 3BR1A 2YU9J 3TEDA 1H8AC 3HOUJ 4XRSG 1JTXA 2H1KA 1I3QJ 1UHSA 1UMQA 4M3DA 3GBGA 3DCFA 2O9LA 4FCYA 3JR9A 1E3OC 2OPTA 3BR3A
chains in the Genus database with same CATH superfamily
5ICFA 2M9HA 1JI8A 1YW8A 1UAAA 5DM6F 3CCYA 3NARA 4I0BA 4D7NA 3MKZA 1H9GA 3FKIJ 1FJLA 3I53A 1ZG3A 4IX7A 4KT6A 4O6JA 4F7ZA 2LTPA 3QU6A 4C3HJ 3BDDA 3JTHA 3JRGA 2IS6A 3PIPF 5ILVA 3EQLF 4ZZLA 4KNYA 1TQPA 2DOAA 2F2EA 3WGIA 2LY2A 3ERMA 1BC7C 4P9FA 3B6CA 4QPOA 3DTKA 2DK8A 3MCZA 3H0GJ 2Y69H 2E1OA 4MGRA 3E5XA 2OBPA 4YG2F 4MLOA 2CGPA 3FXRA 2Z9OA 3L00A 4MIMA 1PDNC 2QUFA 5HLTA 3WTYC 1I6XA 1WCMJ 5IY5H 5FLVA 1K78A 5M5XJ 2F4IA 2Z99A 3O2PE 1K61A 2JN6A 2PMUA 1HOMA 1XSVA 1A36A 4BXXJ 1FBQA 3EYYA 2EFWA 1P92A 4P1WA 1RKTA 1Z6TA 4K2EA 3OYEA 4DYCA 4M3BA 4WWCA 1ETYA 3OYJA 2EILH 4ESJA 2HYJA 3ZR8X 1Z21A 3EETA 1R58A 3G71I 3NEUA 3F23A 4KICA 1RNLA 2K02A 3V8LA 3F8NA 4AU7A 2HVSA 1D8JA 1DDNA 1KQ8A 2JUGA 5F1RA 3GWZA 2OZUA 2JA2A 3FHZA 4HQEA 1MBKA 4HX7A 3LFKA 2H1LA 4DQ2A 1WVRA 4XRFA 1O57A 2DA7A 9ANTA 4HQMA 3OYCA 1LDDA 4CA0A 1XGMA 1F43A 3I64A 4E70A 4E7IA 2VKDA 3RCOA 3CC2I 5HS7A 2XB5A 5CQEA 1FOWA 4C3JJ 1GUUA 1TNSA 1YLFA 2LY9A 3A0HC 5EZHA 1LFUP 4XIDA 4MO7A 1DGWY 3QPHA 4OINF 4XICA 1QQIA 1V55H 4GCVA 5KCMA 4PSXA 2AQEA 2HOEA 2DT7B 5IT3A 2LP0A 3MMYB 1BBYA 5ED4A 4QWQA 1D1CA 2KJCA 2P81A 2V9KA 1IRGA 4EV0A 5L3DA 3IV5A 3CMEI 1FPQA 2XKPA 2MLGA 5EG0B 4PGHA 3ECOA 3EYIA 3P9CA 2F5VA 1W5TA 2XRNA 4YELA 4P55A 4XLHA 3RYPA 2CV2A 2Z5UA 3G1OA 2WAQN 3TKYA 2ZB9A 2JWTA 3WG7H 2PJPA 5JLXA 4KFCA 3VYUB 2EZHA 5JLWA 4B3AA 3B73A 4CCJA 5DV5A 5J47A 3NRVA 2HPIA 2OJED 2VJJA 4HBLA 4UB6C 5KAIC 3F6VA 3NWTA 4PFOA 3WU0A 3OIOA 2DA3A 3MVPA 3T0YA 1LVKA 1GXQA 4JX4A 1IUYA 4Y33A 3QOPA 5E20A 4U7DA 2D1VA 2Q2EA 4KMUX 1GV2A 4HPQA 5KNLA 3RJPA 4WX9A 3J80K 1MBHA 2I8DA 2KJBA 1JJ6C 2H27A 1PYVA 5DTDA 1VI0A 3FXKA 4BY7J 1STZA 3K70C 1F36A 1H89C 2W24A 3RZDJ 3TOBA 4AIHA 3JSOA 2VE9A 4RA2A 4DIQA 3JRDA 1X1CA 2IVMA 1O7LA 1KONA 1HKTA 3BJOA 2CW0F 3QRFF 1BM9A 2W1OA 1JE8A 2ZXJA 5IP9J 2R7XA 3PO3J 5FO5A 1R1UA 1MJAA 5LLQA 2LREA 4CSWA 3A02A 2YU3A 2KHMA 1W5CC 4FHTA 4B44A 5B1AH 1JHHA 4L5IA 2PG4A 2DFIA 5TRDA 1EH8A 3VSKA 2EIKH 3QP6A 1MW7A 4A69C 3I0TA 1TC3C 2CU7A 2DFFA 2R5YB 2AS5F 3S2DJ 2LF7A 3IKTA 2L54A 2R7SA 1TWHJ 1X19A 3ECHA 2XVCA 2R7TA 4BE2A 5JFRA 1FLIA 4B48A 4BNCA 2E1MB 3OYHA 3HPGA 3CCEI 3DLAA 2HKOA 2XAJA 2HVQA 5K1YA 3JRIA 1W7PD 3JTGA 5LGUA 1VQMI 2KZVA 1XSDA 1W36D 2EV6A 4JYKA 5DD8A 4BL0B 1O4XA 1CF7A 3DP7A 1YJ9I 2EFQA 1RKWA 2VT2A 2R7UA 5GPAA 1JKRC 1OFCX 1P2FA 2EWNA 1W4MA 1G59A 1TQMA 3SZPA 1XB4A 2M5WA 1XS9A 3MZ8A 4ITVA 4WXHA 3L2RA 2R7RA 4IL6C 1ZLKA 1VQ8I 1LQ1A 2HXIA 2EV0A 1N78A 3OS0A 5LBQA 5GTHC 2DYRH 4ZYEA 4YEJA 1U3EM 1RUOA 2XROA 2P7CB 2CQQA 1U8RA 1WGXA 3TOAA 2F5EA 1YITI 1P6RA 4M3GA 1A5JA 1QHHD 2R5ZA 3DEWA 3PFIA 4J00A 4PJJA 2HOTA 4OIRF 1FP2A 1QA6A 3ZMDA 3UKGA 2F4MB 4HEA2 4B09A 1IF1A 1IV8A 1ON1A 4BXFA 1T33A 4RDUA 2DU9A 3CUOA 4MFEA 1IXRC 1ETQA 5CVJA 3CJQB 3Q9VA 1T0FC 3S32A 3AG2H 4BDZA 3DU5A 1QHGA 2ECBA 1OKRA 5H6QA 3DTEA 3CDIA 3I4PA 3KYLA 4I6ZA 2XPWA 2L4MA 3GF2A 3HPHA 2R7WA 2OTJI 4LGWA 5HNFA 1XGNA 2A5YB 3TBIA 1LEAA 3CC7I 4HLXA 5GAHJ 2OTLI 2LYCA 3SDGA 5B3SH 1RETA 4HRIA 1LE8A 3FXUA 4IRHA 4BEHA 4FX4A 2B9SA 3KZIC 1X1PA 2XPUA 2MFZA 2NS7A 2LDUA 3ZMUA 2AHQA 2FA5A 1D8KA 2NYXA 1L0OC 2ZXWH 5BPIA 2ZFWA 2BY2A 1I5ZA 1A31A 1Z3YA 2DAOA 2W25A 1Y8RB 1QZEA 4XONA 3LQQA 5KVRA 2FX0A 3G1LA 2E2JJ 3WTSC 3H5RA 2AQFA 2XGEA 4A12A 3N97A 2STTA 2HGCA 3KLOA 1V3FA 1ZRDA 4PJMA 2RQPA 2KKOA 2COMA 3SEZA 2VC0A 3ZQFA 4NBQA 1YJNI 2QCOA 3TGNA 1D5VA 4XLNF 1ENHA 2V6CA 5DCMB 4HF1A 4UUVA 3SZTA 2QA4I 1ETOA 3KPHA 2KLOA 2XAQA 2QYOA 3O8HA 2VBXA 3QYEA 3DPUA 2JVHA 2B0LA 3EUHA 2ADUA 3B02A 1SMTA 4FTHA 2XASA 3GTOJ 5DM7F 2CQ7A 4BHPA 3K2ZA 4C2TA 4AVPA 2MSYA 1F5TA 1VQ4I 1D0XA 2D5VA 5DUKA 3VDXA 4A0ZA 1O3QA 2ID6A 1GVDA 2ZXIA 4XLEA 5E18F 4RB2C 3CLOA 2DPUA 3COAC 2H94A 5FFZA 2X1CA 4DJAA 4CUGA 1BW6A 2L9VA 1SFUA 1XX5A 3ESWB 1B72A 1HDDC 2PN6A 2R4GA 4A0YA 4ZYDA 4LLGF 4M3FA 5BMZA 5LHHA 4IOAF 6PAXA 2GXGA 2ME6A 1Z0XA 2M3AA 5C4XJ 4WCGA 5C4JJ 4P9UA 3JRAA 3CF5F 4DW6A 4CH7A 1NK2P 3FDYA 3AG3H 5CLSA 3WU2C 3BTCA 5LHGA 2EA4A 1WJEA 3LSTA 2ID3A 3FBIB 3R4KA 2IBDA 1R9TJ 4Y4RA 3S14J 1OR7A 2IRFG 1U0JA 3DQVC 1QPMA 4BQOA 3K4KA 2JUCA 2FMLA 5D6FA 4BHBA 4BQNA 4U88A 2DCEA 4HV5A 1D1BA 2IS1A 3A03A 3HOYJ 1HA8A 2FBHA 2NS0A 3CO6C 4ON0A 3OOPA 5AIQA 4L18B 3BPVA 4UVAA 4D9JA 2WA0A 1X3WB 2L7MP 4A3GJ 2BE5F 2GIVA 2ZO4A 5HDNA 1A6QA 3HZJA 2XGDA 5GPCA 1GT0C 1M1EB 2DOEA 4E4HA 2M1BA 3AFHA 3HM5A 4ZYHA 3W2AA 4UUTA 2ELKA 3KFWX 3C2HA 4L5EA 4MQ9F 1IV6A 1HKSA 3K1NA 2QBYA 4IOCF 4I7HA 3NAUA 3F8MA 2DMNA 3LA2A 3DBRB 3PNTA 1LUJB 3HKZA 4A3DJ 3H5NA 2HNHA 1J0RA 4CCLA 3BG9A 5DEQA 4KYWA 3ZN0A 1JKPC 3S3OA 1O3SA 4F52A 1UJ8A 3AG1H 4U87A 1FYMA 2BHZA 4HNTA 1UCRA 2XIGA 5E8IA 3AAFA 2NVXJ 1K78B 3F6OA 1DQUA 3VODA 4IRGA 3IC7A 4ABZA 4NC8A 4OIPF 3TEDA 2DFEA 4I01A 4XRSG 5F6FA 4M9SA 3I55I 4M3DA 3GBGA 1K4SA 1R00A 5HNHA 2BBYA 3FMQA 4PCQA 2WAEA 2LF8A 1OCCH 1FZPB 1N75A 1KYWA 4D0PA 1U5TA 1SVOA 4F91B 3ABTA 2NVYJ 3SFIA 3CC4I 4NQWA 2A07F 1OISA 3V4GA 3O8GA 4G8XA 2R7OA 2K85A 4XN0A 3OYMA 1EH7A 5AONA 2D45A 2HDCA 2HOSA 3T8RA 1MIJA 3ZQ7A 1ZREA 5F04A 2P5VA 3BT9A 1T8IA 3G2BA 3DKXA 5F64A 1APLC 4OIQF 2WY7Q 5DS9A 2BY3A 1AU7A 4XLFA 2L9RA 3CF2A 4LB6B 1R4NB 2RGVA 1QZYA 2FJ1A 4IZZA 3TO6A 4KJZA 4S05A 2KPMA 3BC8A 5JI6A 5C3EJ 2L7ZA 1SC7A 1KQ0A 2CH0A 2JJ7A 5FD5A 3IWFA 4V2FA 3IH3A 1WJ5A 1VQOI 3WTVC 3VOEA 2A6EF 2WTEA 1X1DA 2KMUA 3HOZJ 1IN4A 5F0HA 5LRSA 2CO5A 1SFKA 3H9GA 2O8XA 4G6DA 2QQAA 3VWBA 1SD7A 3ZMSA 2DLLA 2OAZA 1MBFA 2ZNZA 3LFUA 2NVUB 4LOCA 5E79C 1N25A 1TWAJ 3H1CA 2VOPA 1IN8A 3H92A 3MZHA 3B6AA 3M07A 1ODDA 3FK6A 3J7AO 4CO8A 2VQGA 3RKWA 4WK8F 3QODA 3H9JA 3GFMA 3JREA 1XCVA 4HDUA 4UNOA 1U9NA 5EEGA 3SZGA 3DPLC 4EQQA 1UZCA 2OF7A 4CYDA 3LNQA 2BHYA 2O7OA 2K27A 3ULQB 1HBXG 2DI3A 3BCAA 4CHUA 3PSFA 3AL0B 3A4CA 2Q2EB 3O6BB 5K7FA 2IPQX 4IHYA 4ZH4F 1K79A 2H6BA 1KA8A 2VKVA 2VN2A 3D0SA 4ZTJA 5M5WJ 3HOTA 2VBWA 4RLQA 2GA1A 1BW5A 1OCRH 1Z67A 2E7WA 1Z9CA 4XK4A 5D5UB 3KEOA 5D4SA 2GAUA 4XMYA 3OS1A 2L7KA 5B1BH 1B8IA 1WI9A 3BROA 2ZJPF 3ZQQA 1BR1A 4AUXA 3TP0A 3WGHA 2JRMA 3GFLA 4BQQA 3CJRB 3OYAA 3OYKA 4GGGA 1X4PA 2M0MA 2R93J 4X0GA 3MN2A 4MFDA 4XM3A 1IN7A 4M6XA 2WADA 3VYRB 2Y9ZA 2E34A 4JX5A 3OL4A 1LJ9A 3VYSB 3JRHA 2GQQA 1OJLA 3FM5A 1H88C 2DJNA 2J5OA 2KISA 2DA4A 3A2KA 1BL0A 2RKHA 2CW7A 2W00A 4C2UA 2HQRA 2X1DA 4M74A 4W97A 3OOUA 4OMYA 4G7OF 4BH9A 2MD5A 3OMYA 2JSCA 2CV1A 2Y0MA 1I1GA 3V42A 3HOWJ 2VASA 1Y56A 3J7ZI 3OSFA 2M8GX 4FISA 4II3A 2Y31A 3ZQIA 3ZQLA 2VXDA 2E35A 4I99C 1Y39A 4TV7A 1CF7B 2LKXA 1HCRA 2ZNYA 4C3IJ 3NQOA 2KDZA 1R5ID 2XKOA 3K4NA 5HDGA 3HOXJ 1XC5A 4XR6A 2WB1A 3IH2A 3M1EA 2PBIA 1ONVA 5JVTA 3GTJJ 5JVGF 1YX5A 3DBHB 4XKVA 2PEXA 2YSRA 3HHHA 4PDKA 3W6JB 2HYGD 2BYVE 3PSIA 1S7OA 2ZMEA 2RC4A 2EPFA 1LDKB 1R7JA 2KIQA 2DA5A 2HEOA 2LR8A 1EF4A 1A6IA 2R5ZB 5M3MJ 3FIWA 5TISC 1E17A 4JQFA 4NDLA 2HDDA 2FQ4A 3MKLA 3KYDB 3V7CA 3SJMA 4RGRA 2KFDA 3KEYA 4XKCA 2BEOA 1CQTA 3QYBA 2L9SA 4QPQA 1X3ZB 2DA2A 2VKEA 4GO1A 5HS9A 1IXCA 5HOOA 2E1CA 2H8WA 4BQAA 2QGUA 4G12A 4A3JJ 3ABUA 4A2UA 1YQAA 3F22A 4LMYA 3H3VK 1HDPA 3CCVI 2R7DA 1ZG5A 1VQNI 4ETSA 1S72I 3DEEA 1MH4A 2AXLA 4U0WA 3LL7A 1BI0A 3BTIA 1B9NA 4HDVA 2KQRA 2CQKA 4OU0A 2VONA 3E6CC 2IEKA 1Z05A 2VJ4A 1RI7A 2G0EA 2YX4A 4EGYA 1IG7A 2K3PA 2MBFA 3RPQA 2XAHA 1XGOA 3E5QA 3HSEA 3J81K 1LE8B 5D6EA 4BEHB 3CO7C 3BJ6A 4BE0A 2LBFA 2V7FA 1O7FA 4RGXA 5DD4A 5TGTA 1MMNA 1YW7A 1REPC 5K7HA 1WJBA 3WTTC 3K70D 3GLXA 4RBOA 1LFBA 1BC8C 4WF2A 3MD2A 3SYTA 2R7VA 2MW8A 4G94A 4LITA 4FETA 1Q1HA 1KZHA 3FXOA 4OMZA 1JXSA 5FD6A 3S2WA 1ZGJA 1SD5A 3OYFA 2ZKZA 1XG1A 1WHUA 3D5LA 5ILUA 3HBLA 1OYYA 1SD4A 4HF2A 4BU2A 1MNDA 5ICCA 3KYCB 4PJLA 2VQHA 2MLKA 2E2HJ 3J7YJ 3I56I 1FY7A 2JPBA 2FUG2 4RAFA 4BJ5C 3TMOA 5HLHA 2V9PA 2JPCA 1PVEA 1U8BA 1QVTA 1WKMA 1MMDA 1BOAA 2ZSHB 4FQGA 1DP7P 4FASD 1SFOJ 5KK1A 5D4RA 2R0QC 2DPDA 1EA3A 2DA6A 3CMYA 4EJWA 3CDLA 3PFYA 5C44J 3DU6A 4RLFA 1K4TA 3EUAA 4A3FJ 1ETKA 1B72B 2LVSA 4LK1F 4L5JA 3SXYA 3WODF 1Y0UA 3OYGA 1DP3A 2F4OB 2MA3A 2MH2A 2P6SA 3S15J 4LG0A 4RB3C 4V2GA 1ETWA 3ABKH 2HZTA 2TCTA 1D0ZA 4DNCA 2KT0A 1LKXA 5HVQC 2K7LA 1BI1A 4BGDA 4M71A 2FRHA 1DU0A 5F08A 4I76A 2E71A 2W84A 3L1PA 3ZPLA 2UV1A 3DPTA 3ZN1A 2PQ8A 1LFPA 1TQIA 3RPUD 1Y6IA 3JW4A 3K4LA 5BOXA 5EGOA 4XN3A 3PIOF 3I4MJ 2PJRA 2ESHA 2EZIA 3BR5A 4MEYF 3HIFA 4RAYA 2OCCH 4KN7X 2KRHA 4IQJA 1Z1DA 2L02A 2V1XA 2VPRA 3ZQCA 2QKMB 2ISZA 4A3BJ 4AYBA 1LNWA 2NAZA 4N9IA 4BJTA 1KU3A 3ELKA 3P7NA 1BJAA 2JZYA 5K7ZA 2O03A 3J7AY 2H6CA 1XPXA 4IHSA 2DT6A 1MBGA 2GZWA 4DBRA 2ELJA 1KGSA 5J4YA 1I39A 1VZ0A 3LQRA 5FJ8J 2QVOA 4ZC3A 4YFKF 3FMSA 1OYIA 4OAZA 4X1EA 1HKQA 1FOXA 5ICEA 3KP3A 4DZPA 1IUFA 1XMXA 4XOPA 4UV9A 1R71A 3CESA 3GMEA 3MZYA 1HW1A 2QBYB 1J9IA 5E8GA 2KDOA 2L5QA 2FBIA 3HRTA 5LHIA 2GA2A 5EF6A 1E0EA 2RV8A 2M7AA 2TRTA 2IGOA 3HRSA 3QU3A 3F8CA 2VE8A 1X2NA 4R79A 1ZAOA 2XHKA 4C2MJ 5IYCJ 5IYBJ 2W82A 2NNNA 4S0HB 2DDAA 5DUIA 5D5XB 4Y52J 2M30A 5EEAA 3EUHC 3RKXA 1RZ4A 2WB1N 4EJOA 2RVCA 1A04A 4IHVA 1TBXA 1IDYA 3I3LA 3ISPA 3A0BC 1YIJI 1YJWI 4AIDA 2DO7A 3GFIA 3ZXSA 2CFOA 3I59B 4F55A 5CVVA 2IXSA 5L3GA 1WRJA 3GZ5A 2JMWA 2NS8A 1FEXA 1B59A 4QTRA 1FTZA 2XF5A 2EH3A 4L0ZB 3J81Z 4A3MJ 3L2UA 3BR6A 3PL8A 1U5TB 4L9TA 3LSRA 2UXXA 4YIIA 2GIZA 3G6EI 4XNFA 2ZJRF 1N77A 4OWRB 1NK3P 4NQWB 1GV5A 5FGMA 1YG2A 2JSPA 2CSOA 1R36A 1Y8QB 1OMIA 4ENNA 1TT5B 1BR2A 1JKOC 3GTLJ 4IEJA 2CV0A 3JRFA 3CCJI 3V8JA 3K1MA 2A6TA 4I09A 1ULYA 3R60A 1MNEA 3H5AA 4L9NA 4UV8A 3ASOH 2P4WA 2M34A 2M8EA 2CS3A 4CXFA 3FXMA 4IHTA 3WTZA 3R6SA 3PUFA 1NTCA 2QQBA 5LD2C 1ZARA 3E6BA 2QSHX 3M8FA 3HOUJ 1JTXA 3G73A 1UMQA 3FXQA 2O9LA 1P4XA 2DT5A 5KHDA 2QLZA 3KX2A 2FF4A 3LSMA 4AWXB 2VODA 2E1MC 2C6YA 5BPDA 4B43A 4UUSA 4AC0A 5E3LA 3BR2A 4N9HA 1FSHA 5LGTA 1BR4A 1ZR4A 4XSXF 3CCQI 1J2XA 1G3TA 3V8KA 5J4VA 2BXYA 4PSWA 4PZJA 3HB9A 1VQ7I 4XORA 3VB2A 2Q0OA 2HOAA 2Y0SA 2WBMA 2GOMA 2KRFA 2MYSA 5LGNA 3ERED 4ZDLA 3TDUC 2X6YA 3WHCA 3IUOA 5J3LA 1U78A 3KE2A 1GHCA 5HS8A 4Y13A 5CQGA 1WFXA 2HU9A 3WHBA 3OYLA 5EEHA 2IS4A 2EJRA 4C9YA 1UHMA 3RPUA 3S1NJ 4BS9A 2L0KA 1YOVB 2IA0A 3U2RA 2O8KA 4G6QA 3FBNB 3T8TA 2A5WA 4ZDOA 1NHAA 2QM3A 2CUZA 3K2AA 5J8FA 4DOZA 1KYZA 4LIUA 4YFNF 2GOXB 1XGSA 4G6TB 2KP6A 4HV6A 1J09A 1DPUA 3LA7A 3CCUI 2OA4A 3OYBA 4M72A 1B8IB 1JT0A 4LLLA 3GTKJ 2XF6A 2LC2A 1U5TC 4J19A 1R1TA 1D1AA 2PMHA 5FKKA 1GLNA 1I27A 1S9HA 1YTYA 1T6SA 4EJUA 2CUEA 1OCZH 5DDGA 4BKXA 4Q5SF 3K0LA 3CCRI 4JBAA 4A3LJ 1T0FA 2O61A 1OCPA 5F27A 1QU3A 1HSTA 2QQ8A 3P5JA 4XLPF 3CP2A 1YX3A 2LOOA 2K5CA 2R3SA 3LAPA 1K6YA 1W7PA 3CP8A 2CRGA 2V1NA 3VPRA 1UFMA 1KU2A 3EUKL 2Y9YA 4BUPA 1ZK8A 2FSWA 3BG5A 2HZDA 2DDBA 1FOKA 2Z2SB 3K1PA 2M4KA 2OD5A 1UG0A 2XAUA 3ZMVA 2E1NA 1WJFA 4NHJA 3ZQGA 2YPRA 2BW3A 3KP5A 4I98B 4XRMA 5JR3A 4PJNA 1X3UA 4NNJA 5EJCA 1FMWA 4R8HA 2UWMA 1G8XA 4E7SA 1FSEA 1DGRM 2NOGA 4HLYA 3UR3C 2RN7A 1IC8A 3DKYA 1JUPA 1D3YA 4B3XA 4XOTA 3DV8A 3RI4A 1MGTA 3I5UA 2IGNA 3KIOA 3GTPJ 3QWLA 5CYVA 1SVMA 3CUQA 3FZVA 1XDUA 1HF0A 4A5NA 2CFXA 4F93B 2EFPA 2YX7A 3HGGA 2DMQA 4KUMA 4XBFA 1WSUA 2HVRA 1V54H 1O3RA 1U9OA 1VQLI 4ZJZA 2ZMEB 1T95A 5ERIA 1SEUA 2P6TA 2MD0A 1IGNA 2BGCA 5D8LB 2WV1A 3DFGA 3IH4A 2EV5A 2V79A 3FX3A 3T1BA 2VPLA 1XMAA 4ENKA 2E7XA 3H3UA 3IHUA 2MGQA 3LWFA 2XAGA 3K4CA 2HKXA 1O3TA 1S5LC 3TP3A 4E6KG 2K9SA 4KN4X 1MKMA 1V5GA 2NXNB 2EFOA 4BDYA 5FKMA 4Q4ZF 1P4AA 2P7VB 1EKEA 2K9QA 4EVIA 2VLAA 3CTAA 3ABLH 3U21A 3GVAA 2DYSH 2X9DA 1E2XA 1VQ5I 1Z7UA 2LRDA 2GLOA 1TZLA 2M2EA 4B8XA 1UB9A 1FYKA 2MABA 3C2GA 2RDPA 3PQKA 1ZGAA 2LLKA 4I2OA 4KIGA 5GP9A 1MSEC 3BZCA 2DN0A 1OCTC 5J1RA 1FIPA 3LMMA 1AA7A 3HOSA 1VFCA 1IRZA 3VEPA 3S1QJ 3WTWC 4KIFA 3TO7A 3TDZC 3PJRA 3HTUA 3F21A 1YE9A 4CYCA 4D5FA 2LK2A 1ZRFA 2LBFB 2W7NA 3QAHA 5GADJ 3L2CA 1AKHA 2LKPA 2K4JA 2RREA 2E2IJ 2FNAA 2PX9A 3G1MA 2STWA 1MJBA 3LSHA 2WAFA 3BWGA 3HRUA 4EM2A 2VQCA 3F8FA 1WJDA 2MC4A 5E3MA 2VXZA 3OR1C 1AWCA 3HOVJ 4RM3A 4IHXA 3GUDA 1ERDA 1EH6A 3MAJA 3HEFA 4LD5A 3RQIA 3MKWB 2HFHA 2PMZA 2JA6J 2JA7J 2NOJB 3I71A 4OIOF 1F4KA 2EQRA 3IWZA 1H9TA 3RKYA 3HUGA 1WQ2A 2HQNA 1F1ZA 4LB5A 1USTA 3C1DA 2DODA 2LY1A 3TO9A 2CG4A 3LA3A 4Y15A 1SVLA 3W2WA 4Q47A 1SFEA 1WJCA 2W4SA 4QLCU 1LVAA 2LG4A 4XQFA 4Z6YA 4Y7NJ 3OYDA 3CCLI 3P9IA 1TLHB 2WAQA 4L9VA 2P5LC 1A35A 1X58A 1IRXA 2K9LA 4CICA 5H20A 2FMYA 3OWTA 3HSFA 3R61A 3F72A 1QPIA 2JQ7A 3L2WA 3HDDA 1SMYF 3TW7A 4IJAA 3JRBA 1Z6RA 2Y30A 2Y0SN 1YFHA 1I50J 1ZELA 3ZOBA 5J8CA 3KEQA 4BAYA 3JCUC 3BP8A 3PNVA 1FMVA 1NG6A 4EATA 4E7KA 5LRRA 3FXJA 2DA1A 3H0DA 1TTYA 4LG0B 1XMKA 1ZTRA 3HGYA 2VB6A 1R4MB 4M3EA 4UY8I 2HQ5A 3SDBA 3GZNB 4BHCA 3BTLA 5CPRB 5JHUA 2O3FA 3ZCOA 1MMSA 1RIOH 2ESNA 1R5HA 1P7JA 1YHQI 1E3PA 1WH5A 2F5DA 1ZG1A 1IRFA 1FP1D 5DYMA 2IP2A 5BNGA 5EGOB 2HTSA 4XLAA 4BY1J 4Z2YA 2PJRB 1QVUA 1GDTA 1BN5A 4ZYAA 1FTTA 3K4BA 3FISA 4P96A 4A3EJ 2H8RA 1JT6A 2L4AA 5TJJA 1LB2A 3A01A 4LLNA 4HAMA 4S04A 2A05A 2BV6A 2X6WA 1FBUA 1SAXA 1HW2A 4KIBA 1AHDP 2ISYA 4LG3A 1G3WA 3LSJA 2LH9A 2Z3YA 3CMMA 1L3LA 2COBA 3U1DA 3C7JA 3N05A 3Q5FA 3WG9A 2GBYA 1KU9A 3BQYA 3PO2J 1ITYA 5B5EC 2UZKA 1KQ9A 2RNJA 1YS6A 3WU1B 4FE7A 4I02A 4N4OB 3GW2A 2WWYA 4GYGA 4MEXF 1J5YA 2PLYA 4HOBA 1QZZA 1LPQA 4HA8A 4EJTA 4A3KJ 1VF9A 1HXDA 5BQTA 2BXZA 1MBEA 1QGPA 2LFBA 2OQRA 3ZMTA 2NNYA 1XTAA 2AO9A 1XCBA 4L9JA 3WGGA 3DTIA 2Y2ZA 5H6RA 3H35A 4UB8C 3V7RA 1LDJA 3IRRA 2WY8Q 3HKZN 2VJ5A 2DJIA 2YR2A 3ASNH 5AIPA 1NH3A 2DFHA 5GAEJ 3I4NJ 1PUFA 3RSNA 5IP6A 1WJAA 5FROA 3GZ6A 1ZQ3P 2G7UA 5FKNA 3MKYB 1YW9A 3AL0C 2XPVA 1OLTA 2P8TA 2JA5J 1Q1VA 4HNVA 2FU4A 3FM3A 5E1ZB 4BACA 5L3BA 3CZ6A 3C18A 5J1YA 1YRNA 3V7SA 3RZOJ 2HQAA 5FRMA 2E60A 3F0CA 3L2QA 2J5PA 1FX7A 2RQQA 3BLYA 5IT9Z 1TP4A 4BBRJ 4UVCA 3SEQA 2D1HA 3FXLA 1MDMA 4FT8A 3NWSA 3E1SA 2LKSA 3CLQA 1ZGWA 2HR3A 1R1VA 1JTYA 4BJ6C 1IAWA 3BPXA 1CGPA 4A6EA 2VBYA 3G4SI 1V5FA 5E1XA 5H2FC 1QRYA 4R1HA 5J40A 2G7HA 4RAGA 2E5ZA 3BG6A 3RKQA 2JA8J 1HSJA 3BTJA 3P9KA 3HTSB 1BI2A 1G3SA 1MBJA 1VQPI 1POGA 4KT5C 2HPMA 5GTIC 3PUBA 2CJJA 3I9V2 3DF8A 1FOYA 3ROUA 1P9QC 2UUZA 2OZ6A 3R0JA 4XL9A 4MHGA 1T98A 1R49A 3E6DA 2R7QA 4UHTA 3ZRGA 2KIFA 3ONQA 4ANJA 3E5UA 3U1KA 2W57A 2DOFA 2X6XA 3Q0VA 3BZ6A 1BJZA 4UUSB 2PI0A 3HHGA 2DXIA 2Q1ZB 4CCNA 5IYDJ 4RB0A 2F5FA 2YS9A 4HSRA 3G3ZA 2BOLA 2PMZN 2FE3A 4ESBA 3DKWA 3OS2A 4E7ZA 1S6LA 3W3CA 4EEFG 4I0AA 3DEUA 3E6MA 3LSGA 4HG2A 2A3SA 2BY0A 2FQ3A 1P4WA 2EK5A 2Y48A 4P5OA 5IP7J 2XF7A 3K9TA 3CCSI 4M9XA 1W0UA 2GM4A 1ACIA 2VBZA 1MZBA 4OAYA 2KIUA 5L3CA 1ZKGA 1IXSB 3SFZA 1JUMA 3WTXC 1TNTA 3QPTA 1W0TA 2K3FA 2N8GA 3R0AA 4M73A 3M4OJ 1H0MA 5CVRA 2E36A 4XLCA 3HG9A 2P5KA 1IJWC 2TDXA 2E5NA 4RGSA 2PFBA 3HC7A 4D7MA 2M87A 1B4AA 2QKLB 2LNBA 5E3NA 1QO0D 2W85A 2YU9J 4ENJA 1HQCA 1HC8A 4Y3OA 1R22A 1I3QJ 1NG7A 4D1QA 2CWEA 3DCFA 3JR9A 1E3OC 3F9KA 3UNGC 1FC3A 1S3JA 1D0YA 3S3NA 1ZH5A 3BR3A 2EA2A 2OCEA 2VL8A 3GCMA 4PK4A 2EIMH 1X4OA 2O5RA 1GVJA 2V4JC 2HTJA 1WH7A 1YYVA 4ZYGA 1J75A 3MQ0A 2VJIA 2ME0A 3A1YA 4KISA 1Y1WJ 2EZLA 1UG2A 3QPLA 5L3FA 1JGGA 1S7AA 1DPRA 1SANA 1W7PB 2L01A 5FKOA 3IP4B 2QZ8A 2IA1A 3H3ZA 5CVUA 4IVNA 4O5VA 2VUMJ 3KETA 4EMSA 2JTVA 1BA5A 2IS2A 5D5WB 2KRCA 3K4MA 3ML6A 1AOYA 3KZYA 3M7GA 4JOMA 2Q8KA 3LAJA 2BW3B 2L2OA 3M9AA 3Q9SA 5DCFA 2IGKA 3K10A 4E7JA 5E3OA 2V1DA 3HJEA 1ETXA 3E0JB 4NC7A 2Z1DA 2KIMA 4U7BA 2K4BA 3OY9A 4NC6A 5K5OA 1X1AA 2L9NA 4FE4A 5F0CA 4ESFA 5HODA 2XDVA 1JHFA 1OPCA 2LD5A 4HSTA 3H9QA 1P7IA 2BVMA 3MWMA 4FX0A 3CUQB 2ZSIB 2O6GE 3GTMJ 2KZGA 2X6OA 1T38A 2A6HF 4ASNA 1IDZA 4RM2A 2FOWA 3IAM2 2V9VA 2DTRA 5GAGJ 2IAIA 2DK5A 2EFNA 1FNNA 3F3XA 2VQLA 3REOA 3WE3A 5HLGA 4ZDPA 3E97A 3M1CA 3T5XA 1RPWA 1RRJA 3CD6I 4LIVA 2M45A 4XSZF 3D5RC 1DU6A 1IO2A 1E3HA 2X0LA 3S1RJ 1G4DA 1I6HJ 2DBBA 2QSGX 5CKTA 3KCCA 4U0YA 1IZ1A 3BR0A 4JK1X 3LOCA 1XD7A 3TW6A 4E7HA 2K9MA 4N0BA 3RQ4A 3KLNA 1RC9A 1SAUA 1MD0A 4F92B 3GX4X 2ZBKA 4RGUA 1ZR2A 1G3YA 2CMPA 3K4JA 2F6CA 4M9ZA 1DUXC 3DWLE 4M6VA 5JHFA 2XAFA 4IF4A 4HX4A 4Y17A 3EDPA 4B1RA 3X2QH 3FF5A 2EBIA 4GXOA 3CDHA 1S8NA 1PP7U 2F5CA 2K86A 2E19A 3WE2A 2B63J 3CJNA 2QENA 5EDNA 2ZFUA 2CUFA 3KP6A 3M8EA 2M0CA 4Q48A 1XSXA 4CYCB 1OR7C 4XKWA 5LEJA 1ORKA 3L9FA 2JRTA 1XN7A 1AKHB 3E3VA 3PNYA 1JUSA 1R23A 1I1SA 4EJVA 1KU7A 1EV7A 2HXOA 5LFAA 1S7EA 3Q0WA 2F48A 4NB5A 2X51A 1ETVA 4LK0F 3D5SC 2VI6A 1W36C 3D1NI 3OYNA 4KMFA 3Q0UA 4M6YA 3TL4X 2XGCA 1TW3A 4W1UA 4KITB 2QEXI 1MMGA 2HS5A 4IRIA 3KP2A 4AVZA 1RESA 3VFZA 4JP0A 4G9YA 2DW4A 4RAZA 3W6VA 1VNDA 4YRVA 1SFXA 3FK7A 3HUGB 4BBSJ 4QSHA 3BJAA 4DYRA 3OL3A 3GYHX 1YS7A 2HI3A 4CZCA 2LMDA 4J01A 3PM1A 4H0EA 3F8BA 3QP5A 5BS6A 3K7AJ 4DGWB 4WXDA 4GRIA 2Z16A 1QBJA 4IHWA 3RTRA 4V19K 1Z7LA 5EG0A 3CUQC 2IGMA 2H09A 3Q3SA 3OIPA 2XV4S 4ENMA 2QWWA 4X6AJ 2M7BA 2BVLA 3BG7A 5HDKA 4N4NB 5K5RA 4NUBA 3K69A 2DMTA 2R92J 1U2WA 1VQ9I 4F3QA 4A3CJ 1WI3A 1T08B 1USSA 3J80Z 5E17F 3AKZA 5EZGA 1ZRCA 2DQRA 3GLLA 1ZYRF 3S16J 3M8JA 1R6RA 5E1WA 1W1WE 3TQNA 4ZTFA 3CJTB 4CCOA 4PGGA 5A2QK 3GEZA 1TT0A 1G2HA 2NVQJ 1T2KA 1RUNA 5J1UA 3ABMH 3ZP5A 4HX8A 2D2WA 3QOEA 3S93A 4KDPA 4GYIA 2HDWA 4XKBA 1VQKI 4MTDA 5IPAA 2A68F 4AIKA 1D5YA 2K9NA 3BY6A 2W48A 5B66C 3L09A 2ACJA 2HWVA 1J59A 4YIRX 1TL8A 1VQ6I 3KP7A 5FFXA 5FLXK 2UXNA 3GFJA 1T56A 2X4HA 3OIQA 3DBLB 4CCMA 1G6NA 4HF0A 4CCKA 4B47A 3A01B 1Y1VJ 2R7FA 3O3KA 4OOIA 1BI3A 4PFPA 1Z77A 3AG4H 4UXNA 4CDGA 1T39A 1FBSA 2CQNA 1QNTA 2XUBA 1BOBA 2KL4A 3S17J 4YIFA 4XRSA 2EIJH 3K6GA 5M3FJ 4AYBN 5FB2A 4BE1A 3DLLF 3L2VA 1ZN2A 2GXBA 2VC1A 4D5CA 3CMAI 4HNUA 3FMRA 3ZQHA 3S3MA 1TWGJ 3ZGKA 2WV0A 2JK3A 5HLIA 3FKJA 2R5YA 1IN6A 5J6XA 3JAMK 4A0XA 2I10A 2G9WA 2HYFA 4A5MA 2IW5A 4A3IJ 5EYRA 2DTZA 2V1UA 3C2BA 1ON2A 2ZJ2A 1IN5A 1HW5A 1V5EA 2MG4A 2ZC2A 3LSKA 3GTQJ 3GXOA 4A6DA 2XB0X 5IOZA 3W2VA 5K5QA 2V26A 5FRNA 3HL2A 1HLVA 1Y0NA 4IKFA 1S29A 1ZLJA 1PUFB 2QQ9A 1YO5C 5FLMJ 2DMPA 4II2A 1FT9A 4GFBA 3OR2C 3S8PA 1PJRA 3BZKA 1YIOA 1XDSA 2OUMA 4LFUA 2R7ZJ 2BZTA 3QYFA 2GXAA 2FNPA 4G7ZF 2JT1A 1W5SA 2A61A 1YRNB 3EPZA 2LSOA 4DBQA 1MNMC 4DYQA 2O0YA 1UELB 1B1BA 3RDIA 3CCMI 3E7LA 3JRCA 2ETHA 2XSDC 2A69F 1MH3A 3BG3A 1MDMB 1UHWA 1FIAA 2OQGA 2GWRA 4RB1A 3I59A 1Z91A 1JJ8C 2K40A 2OC6A 2RNGA 3BQZA 2ELHA 2IJLA 4L0YB 3SHFA 1WZ2A 2VIXA 2WC2A 2RAEA 3QPSA 3LSIA 1MMAA 3IRQA 4G7HF 2B7EA 3WTUC 5IT9K 4HW0A 1I3AA 4CGZA 5D5VB 2ECCA 3H36A 1OCOH 3JSPA 1V4RA 4O3MA 4HZFA 4CZZA 2OU2A 5M5YJ 2YUSA 1IW7F 1EJ9A 5CJ9A 4EM1A 4ZZDA 4JX6A 3FWEA 2MH9A 3HYIA 4IXAA 1Z3XA 4A93J 1K83J 2X1EA 1BIBA 4AD9A 4DZJA 3FHNA 1RR7A 2V6EA 1BIAA 1RR8C 4BYYA 4PUSA 5FKLA 5F0FA 3RYRA 1X2MA 2FXAA 1TW2A 2ZJQF 1TWCJ 2ZCWA 3I58A 1LEBA 5A2QZ 5ILSA 5LEKA 5CVIA 2CYYA 1B9MA 1WPKA 2CUJA 3IL2A 1ZHFA 3S2HJ 3MFKA 1GXPA 2VKHA 3M3YJ 5DCMA 2CQXA 3HRMA 1MSFC 2ZMEC 1X1BA 3IKVA 3N4MA 3U9GA 3W6KB 1U6GA 2ZXHA 3HXLA 3RIRA 4RS8A 5IOYA 3MEXA 1VTNC 5F1JA 4EM0B 4KA4A 1R5GA 5FLXZ 2FOKA 1WWXA 4MNUA 4AIJA 4MQVA 4GDFA 4AM3A 2MC3A 4IO9F 4RMNA 2IA2A 4C30A 3OYIA 2JVGA 2ICWG 1MJ9A 4YFXF 2VOOA 3OV8A 1JGSA 1YI2I 5KAFC 1K6OA 2XC7A 1TWFJ 2XRLA 2NVTJ 4U0VA 2CW8A 2X48A 3GO5A 4WXCA 2L7FP 1FYLA 2DMUA 1SD6A 2BY1A 3LSPA 2X85A 2XSJC 3GTGJ 3QQAA 1PP8F 2DQLA 5ICGA 2FBKA 4PJ0C 1C0WA 3C3WA 4UVBA 2XGXA 4IQ4A 4QIWN 3S1MJ 2M4GA 3ZMZA 2I5UA 3KP4A 4LJZF 3OSGA 1J7KA 3JAMZ 5D8KB 3IAS2 1FWZA 4E7LA 4MTEA 2FEZA 1JKQC 2Y75A 3SQNA 2Z33A 3KZZA 3VYTB 1PUEE 1K7AA 1OQYA 3PQJA 1B6AA 2IT0A 4B4CA 2EZKA 3BOQA 3L7WA 4BXUA 2EB7A 2FD5A 2VT3A 4H4KC 5L3EA 3I54A 3BCBA 2QF7A 2QSFX 3CQZJ 3VSLA 1OYWA 3BR1A 4HYEA 1H8AC 2OV7A 2H1KA 1UHSA 2P0WA 2L3DA 1F9NA 4FCYA 4IPAA 2EINH 2OPTA 4EGZA 2NRAC 3DXJF 2AXTC 3HSRA
chains in the Genus database with same CATH topology
2M9HA 4UUSA 4AC0A 5E3LA 3BR2A 3CCYA 3NARA 4D7NA 2NVYJ 3SFIA 3FKIJ 1ZR4A 1FJLA 1WH7A 3O8GA 2ME0A 2LTPA 4C3HJ 1Y1WJ 2EZLA 1UG2A 3HB9A 3QPLA 2HOSA 3JRGA 1JGGA 2HOAA 1SANA 5F04A 3BT9A 5FKOA 1APLC 5DS9A 3WHCA 2VUMJ 1AU7A 5J3LA 2L9RA 3B6CA 1U78A 1BA5A 3H0GJ 2FJ1A 2E1OA 3WHBA 5C3EJ 2L7ZA 4MLOA 2JJ7A 3S1NJ 4MIMA 4V2FA 2L0KA 3IH3A 5E3OA 2O8KA 1WCMJ 1ETXA 5FLVA 5M5XJ 3K2AA 1K61A 2JN6A 3HOZJ 5F0HA 1HOMA 4BXXJ 4FE4A 5F0CA 5HODA 2LD5A 1B8IB 1JT0A 1RKTA 1MBFA 1P7IA 4DYCA 3GTKJ 4LOCA 4M3BA 4J19A 1ETYA 3GTMJ 1TWAJ 2X6OA 5FKKA 2HYJA 1IDZA 2CUEA 3B6AA 4BKXA 2IAIA 3FK6A 4A3LJ 1OCPA 1MBKA 5F27A 3JREA 9ANTA 2DA7A 1U9NA 2CRGA 1RPWA 2OF7A 3LNQA 1F43A 3VPRA 2O7OA 1DU6A 2Y9YA 3S1RJ 1ZK8A 1I6HJ 3BG5A 2XB5A 3BR0A 4C3JJ 1GUUA 2LY9A 1LFUP 3LOCA 5EZHA 3TW6A 5K7FA 4IHYA 3ZQGA 4XIDA 4MO7A 4XRMA 2VKVA 1ZR2A 4XICA 5M5WJ 1BW5A 2NOGA 4M6VA 2LP0A 4B1RA 4XK4A 2P81A 1IC8A 1JUPA 2EBIA 3IV5A 5EG0B 2E19A 1B8IA 2B63J 3GTPJ 5EDNA 4AUXA 3TP0A 2CUFA 1HF0A 2M0CA 4CYCB 3G1OA 1ORKA 3HGGA 2DMQA 2WAQN 1AKHB 2ZB9A 2R93J 2JWTA 1U9OA 5JLXA 1JUSA 3MN2A 4MFDA 2EZHA 1IGNA 5JLWA 2HXOA 2WV1A 1S7EA 2Y9ZA 3IH4A 3Q0WA 4B3AA 4JX5A 1ETVA 3JRHA 2VI6A 2MGQA 3D1NI 1OJLA 1H88C 3Q0UA 2DJNA 2DA4A 2XGCA 4W1UA 3TP3A 1BL0A 3OIOA 2DA3A 3MVPA 2K9SA 4JX4A 1RESA 4JP0A 4W97A 3OOUA 5FKMA 1VNDA 3W6VA 1GV2A 3FK7A 4BBSJ 2K9QA 4QSHA 3HOWJ 4DYRA 1MBHA 1JJ6C 2HI3A 3OSFA 2X9DA 2GLOA 5DTDA 2M8GX 4FISA 3ZQIA 2Y31A 1VI0A 3ZQLA 2M2EA 3PM1A 4BY7J 3K7AJ 1F36A 1H89C 2LLKA 3RZDJ 4IHWA 5GP9A 1MSEC 2LKXA 1HCRA 2DN0A 3JRDA 4C3IJ 5EG0A 1OCTC 5J1RA 1FIPA 2KDZA 1VFCA 3HOXJ 1IRZA 1XC5A 3IH2A 3S1QJ 3Q3SA 5IP9J 4X6AJ 3GTJJ 3PO3J 4CYCA 4D5FA 2LK2A 2DMTA 2R92J 3A02A 1AKHA 4A3CJ 1WI3A 2E2IJ 5EZGA 3G1MA 3S16J 2DA5A 5E3MA 4A69C 2LR8A 1EF4A 1A6IA 2R5ZB 1TC3C 5M3MJ 2CU7A 3HOVJ 3FIWA 4IHXA 1G2HA 4NDLA 2R5YB 2HDDA 2FQ4A 2NVQJ 3MKLA 3S2DJ 5J1UA 3HEFA 3RQIA 3SJMA 1CQTA 1TWHJ 2JA6J 2JA7J 5IPAA 2EQRA 1D5YA 2VKEA 2DA2A 2K9NA 2W48A 4G12A 4A3JJ 3JRIA 3H3VK 1T56A 1HDPA 1MH4A 4JYKA 4Y7NJ 3BTIA 1O4XA 1RKWA 3A01B 1Y1VJ 2IEKA 1X58A 2G0EA 1Z77A 5GPAA 1JKRC 1IG7A 1OFCX 3HDDA 1QPIA 1LE8B 3TW7A 3JRBA 2Y30A 1XS9A 2Y0SN 1I50J 3S17J 3ZOBA 4XRSA 5M3FJ 4AYBN 2HXIA 4D5CA 5K7HA 2DA1A 2CQQA 4RBOA 1LFBA 1WGXA 3ZQHA 4M3GA 1TWGJ 1ZTRA 1A5JA 3HGYA 2R5ZA 3DEWA 2JK3A 4M3EA 2MW8A 2HQ5A 2R5YA 2HOTA 3BTLA 2I10A 3UKGA 4A3IJ 4RDUA 1T33A 1XG1A 1P7JA 1WH5A 3HBLA 5EYRA 2DTZA 3C2BA 4MFEA 1ETQA 5BNGA 5EGOB 2MG4A 4BY1J 3GTQJ 1QVUA 2ECBA 1GDTA 2E2HJ 2XB0X 5IOZA 3FISA 4I6ZA 4A3EJ 1HLVA 2XPWA 2H8RA 1PUFB 1JT6A 5FLMJ 3A01A 2DMPA 1U8BA 4GFBA 1QVTA 1AHDP 3SDGA 3LSJA 1RETA 1SFOJ 2R0QC 2COBA 2DA6A 1LE8A 3CMYA 2R7ZJ 3CDLA 2GBYA 2XPUA 3BQYA 2NS7A 5C44J 3PO2J 1ITYA 1YRNB 2AHQA 4A3FJ 1ETKA 4FE7A 4DYQA 1B72B 2LVSA 1MNMC 3E7LA 3JRCA 2XSDC 3S15J 1MH3A 3BG3A 4V2GA 1ETWA 1FIAA 2TCTA 4A3KJ 2FX0A 1VF9A 3G1LA 1JJ8C 2E2JJ 2XGEA 2KT0A 2K40A 3BQZA 1MBEA 1DU0A 2LFBA 2AO9A 5F08A 3ZQFA 4I76A 3L1PA 2QCOA 1ENHA 2RAEA 2Y2ZA 3QPSA 5EGOA 1ETOA 3I4MJ 3HKZN 3O8HA 2EZIA 3BR5A 2ECCA 3I4NJ 1PUFA 5IP6A 4FTHA 2VPRA 1ZQ3P 3ZQCA 3GTOJ 4A3BJ 2MSYA 5FKNA 5M5YJ 2XPVA 2YUSA 2D5VA 2JA5J 1Q1VA 5K7ZA 2ID6A 1GVDA 4HNVA 4JX6A 1MBGA 4A93J 1K83J 5J1YA 5FJ8J 1BW6A 1YRNA 3RZOJ 1B72A 4DZJA 3F0CA 1HDDC 4X1EA 1RR7A 4M3FA 4BBRJ 4DZPA 1IUFA 5FKLA 5F0FA 1Z0XA 2ME6A 1X2MA 1ZGWA 5C4XJ 1TWCJ 1JTYA 5C4JJ 3JRAA 5EF6A 4DW6A 1QRYA 2TRTA 1WPKA 1NK2P 3S2HJ 1X2NA 4C2MJ 3RKQA 5IYCJ 3M3YJ 5IYBJ 2CQXA 3BTCA 3BTJA 2JA8J 1MSFC 1MBJA 2ID3A 1POGA 4S0HB 2IBDA 1R9TJ 4Y52J 3S14J 5EEAA 5IOYA 2WB1N 2CJJA 5F1JA 4IHVA 1IDYA 3A03A 3HOYJ 2JMWA 2NS8A 1FEXA 4QTRA 1FTZA 3Q0VA 2EH3A 2L7MP 4A3GJ 1BJZA 1TWFJ 2XRLA 4UUSB 4A3MJ 2NVTJ 2X48A 5GPCA 2XGDA 1GT0C 2L7FP 3BR6A 3LSRA 5IYDJ 2DMUA 3HM5A 2YS9A 1NK3P 3LSPA 1GV5A 4UUTA 3GTGJ 3QQAA 2PMZN 2ELKA 4L5EA 1IV6A 4EEFG 4QIWN 3S1MJ 3LSGA 1JKOC 3GTLJ 4IEJA 3JRFA 3NAUA 5IP7J 1FTTA 3OSGA 2DMNA 2GM4A 1W0UA 4A3DJ 1ZKGA 1JUMA 1W0TA 1JKQC 3BG9A 2N8GA 3M4OJ 1JKPC 1IJWC 2M34A 4B4CA 2EZKA 2FD5A 4D7MA 1NTCA 2QF7A 2NVXJ 3CQZJ 5E3NA 4ABZA 3BR1A 2YU9J 3TEDA 1H8AC 3HOUJ 4XRSG 1JTXA 2H1KA 1I3QJ 1UHSA 1UMQA 4M3DA 3GBGA 3DCFA 2O9LA 4FCYA 3JR9A 1E3OC 2OPTA 3BR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9H A;  4UUS A;  4AC0 A;  5E3L A;  3BR2 A;  3CCY A;  3NAR A;  4D7N A;  2NVY J;  3SFI A;  3FKI J;  1ZR4 A;  1FJL A;  1WH7 A;  3O8G A;  2ME0 A;  2LTP A;  4C3H J;  1Y1W J;  2EZL A;  1UG2 A;  3HB9 A;  3QPL A;  2HOS A;  3JRG A;  1JGG A;  2HOA A;  1SAN A;  5F04 A;  3BT9 A;  5FKO A;  1APL C;  5DS9 A;  3WHC A;  2VUM J;  1AU7 A;  5J3L A;  2L9R A;  3B6C A;  1U78 A;  1BA5 A;  3H0G J;  2FJ1 A;  2E1O A;  3WHB A;  5C3E J;  2L7Z A;  4MLO A;  2JJ7 A;  3S1N J;  4MIM A;  4V2F A;  2L0K A;  3IH3 A;  5E3O A;  2O8K A;  1WCM J;  1ETX A;  5FLV A;  5M5X J;  3K2A A;  1K61 A;  2JN6 A;  3HOZ J;  5F0H A;  1HOM A;  4BXX J;  4FE4 A;  5F0C A;  5HOD A;  2LD5 A;  1B8I B;  1JT0 A;  1RKT A;  1MBF A;  1P7I A;  4DYC A;  3GTK J;  4LOC A;  4M3B A;  4J19 A;  1ETY A;  3GTM J;  1TWA J;  2X6O A;  5FKK A;  2HYJ A;  1IDZ A;  2CUE A;  3B6A A;  4BKX A;  2IAI A;  3FK6 A;  4A3L J;  1OCP A;  1MBK A;  5F27 A;  3JRE A;  9ANT A;  2DA7 A;  1U9N A;  2CRG A;  1RPW A;  2OF7 A;  3LNQ A;  1F43 A;  3VPR A;  2O7O A;  1DU6 A;  2Y9Y A;  3S1R J;  1ZK8 A;  1I6H J;  3BG5 A;  2XB5 A;  3BR0 A;  4C3J J;  1GUU A;  2LY9 A;  1LFU P;  3LOC A;  5EZH A;  3TW6 A;  5K7F A;  4IHY A;  3ZQG A;  4XID A;  4MO7 A;  4XRM A;  2VKV A;  1ZR2 A;  4XIC A;  5M5W J;  1BW5 A;  2NOG A;  4M6V A;  2LP0 A;  4B1R A;  4XK4 A;  2P81 A;  1IC8 A;  1JUP A;  2EBI A;  3IV5 A;  5EG0 B;  2E19 A;  1B8I A;  2B63 J;  3GTP J;  5EDN A;  4AUX A;  3TP0 A;  2CUF A;  1HF0 A;  2M0C A;  4CYC B;  3G1O A;  1ORK A;  3HGG A;  2DMQ A;  2WAQ N;  1AKH B;  2ZB9 A;  2R93 J;  2JWT A;  1U9O A;  5JLX A;  1JUS A;  3MN2 A;  4MFD A;  2EZH A;  1IGN A;  5JLW A;  2HXO A;  2WV1 A;  1S7E A;  2Y9Z A;  3IH4 A;  3Q0W A;  4B3A A;  4JX5 A;  1ETV A;  3JRH A;  2VI6 A;  2MGQ A;  3D1N I;  1OJL A;  1H88 C;  3Q0U A;  2DJN A;  2DA4 A;  2XGC A;  4W1U A;  3TP3 A;  1BL0 A;  3OIO A;  2DA3 A;  3MVP A;  2K9S A;  4JX4 A;  1RES A;  4JP0 A;  4W97 A;  3OOU A;  5FKM A;  1VND A;  3W6V A;  1GV2 A;  3FK7 A;  4BBS J;  2K9Q A;  4QSH A;  3HOW J;  4DYR A;  1MBH A;  1JJ6 C;  2HI3 A;  3OSF A;  2X9D A;  2GLO A;  5DTD A;  2M8G X;  4FIS A;  3ZQI A;  2Y31 A;  1VI0 A;  3ZQL A;  2M2E A;  3PM1 A;  4BY7 J;  3K7A J;  1F36 A;  1H89 C;  2LLK A;  3RZD J;  4IHW A;  5GP9 A;  1MSE C;  2LKX A;  1HCR A;  2DN0 A;  3JRD A;  4C3I J;  5EG0 A;  1OCT C;  5J1R A;  1FIP A;  2KDZ A;  1VFC A;  3HOX J;  1IRZ A;  1XC5 A;  3IH2 A;  3S1Q J;  3Q3S A;  5IP9 J;  4X6A J;  3GTJ J;  3PO3 J;  4CYC A;  4D5F A;  2LK2 A;  2DMT A;  2R92 J;  3A02 A;  1AKH A;  4A3C J;  1WI3 A;  2E2I J;  5EZG A;  3G1M A;  3S16 J;  2DA5 A;  5E3M A;  4A69 C;  2LR8 A;  1EF4 A;  1A6I A;  2R5Z B;  1TC3 C;  5M3M J;  2CU7 A;  3HOV J;  3FIW A;  4IHX A;  1G2H A;  4NDL A;  2R5Y B;  2HDD A;  2FQ4 A;  2NVQ J;  3MKL A;  3S2D J;  5J1U A;  3HEF A;  3RQI A;  3SJM A;  1CQT A;  1TWH J;  2JA6 J;  2JA7 J;  5IPA A;  2EQR A;  1D5Y A;  2VKE A;  2DA2 A;  2K9N A;  2W48 A;  4G12 A;  4A3J J;  3JRI A;  3H3V K;  1T56 A;  1HDP A;  1MH4 A;  4JYK A;  4Y7N J;  3BTI A;  1O4X A;  1RKW A;  3A01 B;  1Y1V J;  2IEK A;  1X58 A;  2G0E A;  1Z77 A;  5GPA A;  1JKR C;  1IG7 A;  1OFC X;  3HDD A;  1QPI A;  1LE8 B;  3TW7 A;  3JRB A;  2Y30 A;  1XS9 A;  2Y0S N;  1I50 J;  3S17 J;  3ZOB A;  4XRS A;  5M3F J;  4AYB N;  2HXI A;  4D5C A;  5K7H A;  2DA1 A;  2CQQ A;  4RBO A;  1LFB A;  1WGX A;  3ZQH A;  4M3G A;  1TWG J;  1ZTR A;  1A5J A;  3HGY A;  2R5Z A;  3DEW A;  2JK3 A;  4M3E A;  2MW8 A;  2HQ5 A;  2R5Y A;  2HOT A;  3BTL A;  2I10 A;  3UKG A;  4A3I J;  4RDU A;  1T33 A;  1XG1 A;  1P7J A;  1WH5 A;  3HBL A;  5EYR A;  2DTZ A;  3C2B A;  4MFE A;  1ETQ A;  5BNG A;  5EGO B;  2MG4 A;  4BY1 J;  3GTQ J;  1QVU A;  2ECB A;  1GDT A;  2E2H J;  2XB0 X;  5IOZ A;  3FIS A;  4I6Z A;  4A3E J;  1HLV A;  2XPW A;  2H8R A;  1PUF B;  1JT6 A;  5FLM J;  3A01 A;  2DMP A;  1U8B A;  4GFB A;  1QVT A;  1AHD P;  3SDG A;  3LSJ A;  1RET A;  1SFO J;  2R0Q C;  2COB A;  2DA6 A;  1LE8 A;  3CMY A;  2R7Z J;  3CDL A;  2GBY A;  2XPU A;  3BQY A;  2NS7 A;  5C44 J;  3PO2 J;  1ITY A;  1YRN B;  2AHQ A;  4A3F J;  1ETK A;  4FE7 A;  4DYQ A;  1B72 B;  2LVS A;  1MNM C;  3E7L A;  3JRC A;  2XSD C;  3S15 J;  1MH3 A;  3BG3 A;  4V2G A;  1ETW A;  1FIA A;  2TCT A;  4A3K J;  2FX0 A;  1VF9 A;  3G1L A;  1JJ8 C;  2E2J J;  2XGE A;  2KT0 A;  2K40 A;  3BQZ A;  1MBE A;  1DU0 A;  2LFB A;  2AO9 A;  5F08 A;  3ZQF A;  4I76 A;  3L1P A;  2QCO A;  1ENH A;  2RAE A;  2Y2Z A;  3QPS A;  5EGO A;  1ETO A;  3I4M J;  3HKZ N;  3O8H A;  2EZI A;  3BR5 A;  2ECC A;  3I4N J;  1PUF A;  5IP6 A;  4FTH A;  2VPR A;  1ZQ3 P;  3ZQC A;  3GTO J;  4A3B J;  2MSY A;  5FKN A;  5M5Y J;  2XPV A;  2YUS A;  2D5V A;  2JA5 J;  1Q1V A;  5K7Z A;  2ID6 A;  1GVD A;  4HNV A;  4JX6 A;  1MBG A;  4A93 J;  1K83 J;  5J1Y A;  5FJ8 J;  1BW6 A;  1YRN A;  3RZO J;  1B72 A;  4DZJ A;  3F0C A;  1HDD C;  4X1E A;  1RR7 A;  4M3F A;  4BBR J;  4DZP A;  1IUF A;  5FKL A;  5F0F A;  1Z0X A;  2ME6 A;  1X2M A;  1ZGW A;  5C4X J;  1TWC J;  1JTY A;  5C4J J;  3JRA A;  5EF6 A;  4DW6 A;  1QRY A;  2TRT A;  1WPK A;  1NK2 P;  3S2H J;  1X2N A;  4C2M J;  3RKQ A;  5IYC J;  3M3Y J;  5IYB J;  2CQX A;  3BTC A;  3BTJ A;  2JA8 J;  1MSF C;  1MBJ A;  2ID3 A;  1POG A;  4S0H B;  2IBD A;  1R9T J;  4Y52 J;  3S14 J;  5EEA A;  5IOY A;  2WB1 N;  2CJJ A;  5F1J A;  4IHV A;  1IDY A;  3A03 A;  3HOY J;  2JMW A;  2NS8 A;  1FEX A;  4QTR A;  1FTZ A;  3Q0V A;  2EH3 A;  2L7M P;  4A3G J;  1BJZ A;  1TWF J;  2XRL A;  4UUS B;  4A3M J;  2NVT J;  2X48 A;  5GPC A;  2XGD A;  1GT0 C;  2L7F P;  3BR6 A;  3LSR A;  5IYD J;  2DMU A;  3HM5 A;  2YS9 A;  1NK3 P;  3LSP A;  1GV5 A;  4UUT A;  3GTG J;  3QQA A;  2PMZ N;  2ELK A;  4L5E A;  1IV6 A;  4EEF G;  4QIW N;  3S1M J;  3LSG A;  1JKO C;  3GTL J;  4IEJ A;  3JRF A;  3NAU A;  5IP7 J;  1FTT A;  3OSG A;  2DMN A;  2GM4 A;  1W0U A;  4A3D J;  1ZKG A;  1JUM A;  1W0T A;  1JKQ C;  3BG9 A;  2N8G A;  3M4O J;  1JKP C;  1IJW C;  2M34 A;  4B4C A;  2EZK A;  2FD5 A;  4D7M A;  1NTC A;  2QF7 A;  2NVX J;  3CQZ J;  5E3N A;  4ABZ A;  3BR1 A;  2YU9 J;  3TED A;  1H8A C;  3HOU J;  4XRS G;  1JTX A;  2H1K A;  1I3Q J;  1UHS A;  1UMQ A;  4M3D A;  3GBG A;  3DCF A;  2O9L A;  4FCY A;  3JR9 A;  1E3O C;  2OPT A;  3BR3 A; 
#chains in the Genus database with same CATH topology
 5ICF A;  2M9H A;  1JI8 A;  1YW8 A;  1UAA A;  5DM6 F;  3CCY A;  3NAR A;  4I0B A;  4D7N A;  3MKZ A;  1H9G A;  3FKI J;  1FJL A;  3I53 A;  1ZG3 A;  4IX7 A;  4KT6 A;  4O6J A;  4F7Z A;  2LTP A;  3QU6 A;  4C3H J;  3BDD A;  3JTH A;  3JRG A;  2IS6 A;  3PIP F;  5ILV A;  3EQL F;  4ZZL A;  4KNY A;  1TQP A;  2DOA A;  2F2E A;  3WGI A;  2LY2 A;  3ERM A;  1BC7 C;  4P9F A;  3B6C A;  4QPO A;  3DTK A;  2DK8 A;  3MCZ A;  3H0G J;  2Y69 H;  2E1O A;  4MGR A;  3E5X A;  2OBP A;  4YG2 F;  4MLO A;  2CGP A;  3FXR A;  2Z9O A;  3L00 A;  4MIM A;  1PDN C;  2QUF A;  5HLT A;  3WTY C;  1I6X A;  1WCM J;  5IY5 H;  5FLV A;  1K78 A;  5M5X J;  2F4I A;  2Z99 A;  3O2P E;  1K61 A;  2JN6 A;  2PMU A;  1HOM A;  1XSV A;  1A36 A;  4BXX J;  1FBQ A;  3EYY A;  2EFW A;  1P92 A;  4P1W A;  1RKT A;  1Z6T A;  4K2E A;  3OYE A;  4DYC A;  4M3B A;  4WWC A;  1ETY A;  3OYJ A;  2EIL H;  4ESJ A;  2HYJ A;  3ZR8 X;  1Z21 A;  3EET A;  1R58 A;  3G71 I;  3NEU A;  3F23 A;  4KIC A;  1RNL A;  2K02 A;  3V8L A;  3F8N A;  4AU7 A;  2HVS A;  1D8J A;  1DDN A;  1KQ8 A;  2JUG A;  5F1R A;  3GWZ A;  2OZU A;  2JA2 A;  3FHZ A;  4HQE A;  1MBK A;  4HX7 A;  3LFK A;  2H1L A;  4DQ2 A;  1WVR A;  4XRF A;  1O57 A;  2DA7 A;  9ANT A;  4HQM A;  3OYC A;  1LDD A;  4CA0 A;  1XGM A;  1F43 A;  3I64 A;  4E70 A;  4E7I A;  2VKD A;  3RCO A;  3CC2 I;  5HS7 A;  2XB5 A;  5CQE A;  1FOW A;  4C3J J;  1GUU A;  1TNS A;  1YLF A;  2LY9 A;  3A0H C;  5EZH A;  1LFU P;  4XID A;  4MO7 A;  1DGW Y;  3QPH A;  4OIN F;  4XIC A;  1QQI A;  1V55 H;  4GCV A;  5KCM A;  4PSX A;  2AQE A;  2HOE A;  2DT7 B;  5IT3 A;  2LP0 A;  3MMY B;  1BBY A;  5ED4 A;  4QWQ A;  1D1C A;  2KJC A;  2P81 A;  2V9K A;  1IRG A;  4EV0 A;  5L3D A;  3IV5 A;  3CME I;  1FPQ A;  2XKP A;  2MLG A;  5EG0 B;  4PGH A;  3ECO A;  3EYI A;  3P9C A;  2F5V A;  1W5T A;  2XRN A;  4YEL A;  4P55 A;  4XLH A;  3RYP A;  2CV2 A;  2Z5U A;  3G1O A;  2WAQ N;  3TKY A;  2ZB9 A;  2JWT A;  3WG7 H;  2PJP A;  5JLX A;  4KFC A;  3VYU B;  2EZH A;  5JLW A;  4B3A A;  3B73 A;  4CCJ A;  5DV5 A;  5J47 A;  3NRV A;  2HPI A;  2OJE D;  2VJJ A;  4HBL A;  4UB6 C;  5KAI C;  3F6V A;  3NWT A;  4PFO A;  3WU0 A;  3OIO A;  2DA3 A;  3MVP A;  3T0Y A;  1LVK A;  1GXQ A;  4JX4 A;  1IUY A;  4Y33 A;  3QOP A;  5E20 A;  4U7D A;  2D1V A;  2Q2E A;  4KMU X;  1GV2 A;  4HPQ A;  5KNL A;  3RJP A;  4WX9 A;  3J80 K;  1MBH A;  2I8D A;  2KJB A;  1JJ6 C;  2H27 A;  1PYV A;  5DTD A;  1VI0 A;  3FXK A;  4BY7 J;  1STZ A;  3K70 C;  1F36 A;  1H89 C;  2W24 A;  3RZD J;  3TOB A;  4AIH A;  3JSO A;  2VE9 A;  4RA2 A;  4DIQ A;  3JRD A;  1X1C A;  2IVM A;  1O7L A;  1KON A;  1HKT A;  3BJO A;  2CW0 F;  3QRF F;  1BM9 A;  2W1O A;  1JE8 A;  2ZXJ A;  5IP9 J;  2R7X A;  3PO3 J;  5FO5 A;  1R1U A;  1MJA A;  5LLQ A;  2LRE A;  4CSW A;  3A02 A;  2YU3 A;  2KHM A;  1W5C C;  4FHT A;  4B44 A;  5B1A H;  1JHH A;  4L5I A;  2PG4 A;  2DFI A;  5TRD A;  1EH8 A;  3VSK A;  2EIK H;  3QP6 A;  1MW7 A;  4A69 C;  3I0T A;  1TC3 C;  2CU7 A;  2DFF A;  2R5Y B;  2AS5 F;  3S2D J;  2LF7 A;  3IKT A;  2L54 A;  2R7S A;  1TWH J;  1X19 A;  3ECH A;  2XVC A;  2R7T A;  4BE2 A;  5JFR A;  1FLI A;  4B48 A;  4BNC A;  2E1M B;  3OYH A;  3HPG A;  3CCE I;  3DLA A;  2HKO A;  2XAJ A;  2HVQ A;  5K1Y A;  3JRI A;  1W7P D;  3JTG A;  5LGU A;  1VQM I;  2KZV A;  1XSD A;  1W36 D;  2EV6 A;  4JYK A;  5DD8 A;  4BL0 B;  1O4X A;  1CF7 A;  3DP7 A;  1YJ9 I;  2EFQ A;  1RKW A;  2VT2 A;  2R7U A;  5GPA A;  1JKR C;  1OFC X;  1P2F A;  2EWN A;  1W4M A;  1G59 A;  1TQM A;  3SZP A;  1XB4 A;  2M5W A;  1XS9 A;  3MZ8 A;  4ITV A;  4WXH A;  3L2R A;  2R7R A;  4IL6 C;  1ZLK A;  1VQ8 I;  1LQ1 A;  2HXI A;  2EV0 A;  1N78 A;  3OS0 A;  5LBQ A;  5GTH C;  2DYR H;  4ZYE A;  4YEJ A;  1U3E M;  1RUO A;  2XRO A;  2P7C B;  2CQQ A;  1U8R A;  1WGX A;  3TOA A;  2F5E A;  1YIT I;  1P6R A;  4M3G A;  1A5J A;  1QHH D;  2R5Z A;  3DEW A;  3PFI A;  4J00 A;  4PJJ A;  2HOT A;  4OIR F;  1FP2 A;  1QA6 A;  3ZMD A;  3UKG A;  2F4M B;  4HEA 2;  4B09 A;  1IF1 A;  1IV8 A;  1ON1 A;  4BXF A;  1T33 A;  4RDU A;  2DU9 A;  3CUO A;  4MFE A;  1IXR C;  1ETQ A;  5CVJ A;  3CJQ B;  3Q9V A;  1T0F C;  3S32 A;  3AG2 H;  4BDZ A;  3DU5 A;  1QHG A;  2ECB A;  1OKR A;  5H6Q A;  3DTE A;  3CDI A;  3I4P A;  3KYL A;  4I6Z A;  2XPW A;  2L4M A;  3GF2 A;  3HPH A;  2R7W A;  2OTJ I;  4LGW A;  5HNF A;  1XGN A;  2A5Y B;  3TBI A;  1LEA A;  3CC7 I;  4HLX A;  5GAH J;  2OTL I;  2LYC A;  3SDG A;  5B3S H;  1RET A;  4HRI A;  1LE8 A;  3FXU A;  4IRH A;  4BEH A;  4FX4 A;  2B9S A;  3KZI C;  1X1P A;  2XPU A;  2MFZ A;  2NS7 A;  2LDU A;  3ZMU A;  2AHQ A;  2FA5 A;  1D8K A;  2NYX A;  1L0O C;  2ZXW H;  5BPI A;  2ZFW A;  2BY2 A;  1I5Z A;  1A31 A;  1Z3Y A;  2DAO A;  2W25 A;  1Y8R B;  1QZE A;  4XON A;  3LQQ A;  5KVR A;  2FX0 A;  3G1L A;  2E2J J;  3WTS C;  3H5R A;  2AQF A;  2XGE A;  4A12 A;  3N97 A;  2STT A;  2HGC A;  3KLO A;  1V3F A;  1ZRD A;  4PJM A;  2RQP A;  2KKO A;  2COM A;  3SEZ A;  2VC0 A;  3ZQF A;  4NBQ A;  1YJN I;  2QCO A;  3TGN A;  1D5V A;  4XLN F;  1ENH A;  2V6C A;  5DCM B;  4HF1 A;  4UUV A;  3SZT A;  2QA4 I;  1ETO A;  3KPH A;  2KLO A;  2XAQ A;  2QYO A;  3O8H A;  2VBX A;  3QYE A;  3DPU A;  2JVH A;  2B0L A;  3EUH A;  2ADU A;  3B02 A;  1SMT A;  4FTH A;  2XAS A;  3GTO J;  5DM7 F;  2CQ7 A;  4BHP A;  3K2Z A;  4C2T A;  4AVP A;  2MSY A;  1F5T A;  1VQ4 I;  1D0X A;  2D5V A;  5DUK A;  3VDX A;  4A0Z A;  1O3Q A;  2ID6 A;  1GVD A;  2ZXI A;  4XLE A;  5E18 F;  4RB2 C;  3CLO A;  2DPU A;  3COA C;  2H94 A;  5FFZ A;  2X1C A;  4DJA A;  4CUG A;  1BW6 A;  2L9V A;  1SFU A;  1XX5 A;  3ESW B;  1B72 A;  1HDD C;  2PN6 A;  2R4G A;  4A0Y A;  4ZYD A;  4LLG F;  4M3F A;  5BMZ A;  5LHH A;  4IOA F;  6PAX A;  2GXG A;  2ME6 A;  1Z0X A;  2M3A A;  5C4X J;  4WCG A;  5C4J J;  4P9U A;  3JRA A;  3CF5 F;  4DW6 A;  4CH7 A;  1NK2 P;  3FDY A;  3AG3 H;  5CLS A;  3WU2 C;  3BTC A;  5LHG A;  2EA4 A;  1WJE A;  3LST A;  2ID3 A;  3FBI B;  3R4K A;  2IBD A;  1R9T J;  4Y4R A;  3S14 J;  1OR7 A;  2IRF G;  1U0J A;  3DQV C;  1QPM A;  4BQO A;  3K4K A;  2JUC A;  2FML A;  5D6F A;  4BHB A;  4BQN A;  4U88 A;  2DCE A;  4HV5 A;  1D1B A;  2IS1 A;  3A03 A;  3HOY J;  1HA8 A;  2FBH A;  2NS0 A;  3CO6 C;  4ON0 A;  3OOP A;  5AIQ A;  4L18 B;  3BPV A;  4UVA A;  4D9J A;  2WA0 A;  1X3W B;  2L7M P;  4A3G J;  2BE5 F;  2GIV A;  2ZO4 A;  5HDN A;  1A6Q A;  3HZJ A;  2XGD A;  5GPC A;  1GT0 C;  1M1E B;  2DOE A;  4E4H A;  2M1B A;  3AFH A;  3HM5 A;  4ZYH A;  3W2A A;  4UUT A;  2ELK A;  3KFW X;  3C2H A;  4L5E A;  4MQ9 F;  1IV6 A;  1HKS A;  3K1N A;  2QBY A;  4IOC F;  4I7H A;  3NAU A;  3F8M A;  2DMN A;  3LA2 A;  3DBR B;  3PNT A;  1LUJ B;  3HKZ A;  4A3D J;  3H5N A;  2HNH A;  1J0R A;  4CCL A;  3BG9 A;  5DEQ A;  4KYW A;  3ZN0 A;  1JKP C;  3S3O A;  1O3S A;  4F52 A;  1UJ8 A;  3AG1 H;  4U87 A;  1FYM A;  2BHZ A;  4HNT A;  1UCR A;  2XIG A;  5E8I A;  3AAF A;  2NVX J;  1K78 B;  3F6O A;  1DQU A;  3VOD A;  4IRG A;  3IC7 A;  4ABZ A;  4NC8 A;  4OIP F;  3TED A;  2DFE A;  4I01 A;  4XRS G;  5F6F A;  4M9S A;  3I55 I;  4M3D A;  3GBG A;  1K4S A;  1R00 A;  5HNH A;  2BBY A;  3FMQ A;  4PCQ A;  2WAE A;  2LF8 A;  1OCC H;  1FZP B;  1N75 A;  1KYW A;  4D0P A;  1U5T A;  1SVO A;  4F91 B;  3ABT A;  2NVY J;  3SFI A;  3CC4 I;  4NQW A;  2A07 F;  1OIS A;  3V4G A;  3O8G A;  4G8X A;  2R7O A;  2K85 A;  4XN0 A;  3OYM A;  1EH7 A;  5AON A;  2D45 A;  2HDC A;  2HOS A;  3T8R A;  1MIJ A;  3ZQ7 A;  1ZRE A;  5F04 A;  2P5V A;  3BT9 A;  1T8I A;  3G2B A;  3DKX A;  5F64 A;  1APL C;  4OIQ F;  2WY7 Q;  5DS9 A;  2BY3 A;  1AU7 A;  4XLF A;  2L9R A;  3CF2 A;  4LB6 B;  1R4N B;  2RGV A;  1QZY A;  2FJ1 A;  4IZZ A;  3TO6 A;  4KJZ A;  4S05 A;  2KPM A;  3BC8 A;  5JI6 A;  5C3E J;  2L7Z A;  1SC7 A;  1KQ0 A;  2CH0 A;  2JJ7 A;  5FD5 A;  3IWF A;  4V2F A;  3IH3 A;  1WJ5 A;  1VQO I;  3WTV C;  3VOE A;  2A6E F;  2WTE A;  1X1D A;  2KMU A;  3HOZ J;  1IN4 A;  5F0H A;  5LRS A;  2CO5 A;  1SFK A;  3H9G A;  2O8X A;  4G6D A;  2QQA A;  3VWB A;  1SD7 A;  3ZMS A;  2DLL A;  2OAZ A;  1MBF A;  2ZNZ A;  3LFU A;  2NVU B;  4LOC A;  5E79 C;  1N25 A;  1TWA J;  3H1C A;  2VOP A;  1IN8 A;  3H92 A;  3MZH A;  3B6A A;  3M07 A;  1ODD A;  3FK6 A;  3J7A O;  4CO8 A;  2VQG A;  3RKW A;  4WK8 F;  3QOD A;  3H9J A;  3GFM A;  3JRE A;  1XCV A;  4HDU A;  4UNO A;  1U9N A;  5EEG A;  3SZG A;  3DPL C;  4EQQ A;  1UZC A;  2OF7 A;  4CYD A;  3LNQ A;  2BHY A;  2O7O A;  2K27 A;  3ULQ B;  1HBX G;  2DI3 A;  3BCA A;  4CHU A;  3PSF A;  3AL0 B;  3A4C A;  2Q2E B;  3O6B B;  5K7F A;  2IPQ X;  4IHY A;  4ZH4 F;  1K79 A;  2H6B A;  1KA8 A;  2VKV A;  2VN2 A;  3D0S A;  4ZTJ A;  5M5W J;  3HOT A;  2VBW A;  4RLQ A;  2GA1 A;  1BW5 A;  1OCR H;  1Z67 A;  2E7W A;  1Z9C A;  4XK4 A;  5D5U B;  3KEO A;  5D4S A;  2GAU A;  4XMY A;  3OS1 A;  2L7K A;  5B1B H;  1B8I A;  1WI9 A;  3BRO A;  2ZJP F;  3ZQQ A;  1BR1 A;  4AUX A;  3TP0 A;  3WGH A;  2JRM A;  3GFL A;  4BQQ A;  3CJR B;  3OYA A;  3OYK A;  4GGG A;  1X4P A;  2M0M A;  2R93 J;  4X0G A;  3MN2 A;  4MFD A;  4XM3 A;  1IN7 A;  4M6X A;  2WAD A;  3VYR B;  2Y9Z A;  2E34 A;  4JX5 A;  3OL4 A;  1LJ9 A;  3VYS B;  3JRH A;  2GQQ A;  1OJL A;  3FM5 A;  1H88 C;  2DJN A;  2J5O A;  2KIS A;  2DA4 A;  3A2K A;  1BL0 A;  2RKH A;  2CW7 A;  2W00 A;  4C2U A;  2HQR A;  2X1D A;  4M74 A;  4W97 A;  3OOU A;  4OMY A;  4G7O F;  4BH9 A;  2MD5 A;  3OMY A;  2JSC A;  2CV1 A;  2Y0M A;  1I1G A;  3V42 A;  3HOW J;  2VAS A;  1Y56 A;  3J7Z I;  3OSF A;  2M8G X;  4FIS A;  4II3 A;  2Y31 A;  3ZQI A;  3ZQL A;  2VXD A;  2E35 A;  4I99 C;  1Y39 A;  4TV7 A;  1CF7 B;  2LKX A;  1HCR A;  2ZNY A;  4C3I J;  3NQO A;  2KDZ A;  1R5I D;  2XKO A;  3K4N A;  5HDG A;  3HOX J;  1XC5 A;  4XR6 A;  2WB1 A;  3IH2 A;  3M1E A;  2PBI A;  1ONV A;  5JVT A;  3GTJ J;  5JVG F;  1YX5 A;  3DBH B;  4XKV A;  2PEX A;  2YSR A;  3HHH A;  4PDK A;  3W6J B;  2HYG D;  2BYV E;  3PSI A;  1S7O A;  2ZME A;  2RC4 A;  2EPF A;  1LDK B;  1R7J A;  2KIQ A;  2DA5 A;  2HEO A;  2LR8 A;  1EF4 A;  1A6I A;  2R5Z B;  5M3M J;  3FIW A;  5TIS C;  1E17 A;  4JQF A;  4NDL A;  2HDD A;  2FQ4 A;  3MKL A;  3KYD B;  3V7C A;  3SJM A;  4RGR A;  2KFD A;  3KEY A;  4XKC A;  2BEO A;  1CQT A;  3QYB A;  2L9S A;  4QPQ A;  1X3Z B;  2DA2 A;  2VKE A;  4GO1 A;  5HS9 A;  1IXC A;  5HOO A;  2E1C A;  2H8W A;  4BQA A;  2QGU A;  4G12 A;  4A3J J;  3ABU A;  4A2U A;  1YQA A;  3F22 A;  4LMY A;  3H3V K;  1HDP A;  3CCV I;  2R7D A;  1ZG5 A;  1VQN I;  4ETS A;  1S72 I;  3DEE A;  1MH4 A;  2AXL A;  4U0W A;  3LL7 A;  1BI0 A;  3BTI A;  1B9N A;  4HDV A;  2KQR A;  2CQK A;  4OU0 A;  2VON A;  3E6C C;  2IEK A;  1Z05 A;  2VJ4 A;  1RI7 A;  2G0E A;  2YX4 A;  4EGY A;  1IG7 A;  2K3P A;  2MBF A;  3RPQ A;  2XAH A;  1XGO A;  3E5Q A;  3HSE A;  3J81 K;  1LE8 B;  5D6E A;  4BEH B;  3CO7 C;  3BJ6 A;  4BE0 A;  2LBF A;  2V7F A;  1O7F A;  4RGX A;  5DD4 A;  5TGT A;  1MMN A;  1YW7 A;  1REP C;  5K7H A;  1WJB A;  3WTT C;  3K70 D;  3GLX A;  4RBO A;  1LFB A;  1BC8 C;  4WF2 A;  3MD2 A;  3SYT A;  2R7V A;  2MW8 A;  4G94 A;  4LIT A;  4FET A;  1Q1H A;  1KZH A;  3FXO A;  4OMZ A;  1JXS A;  5FD6 A;  3S2W A;  1ZGJ A;  1SD5 A;  3OYF A;  2ZKZ A;  1XG1 A;  1WHU A;  3D5L A;  5ILU A;  3HBL A;  1OYY A;  1SD4 A;  4HF2 A;  4BU2 A;  1MND A;  5ICC A;  3KYC B;  4PJL A;  2VQH A;  2MLK A;  2E2H J;  3J7Y J;  3I56 I;  1FY7 A;  2JPB A;  2FUG 2;  4RAF A;  4BJ5 C;  3TMO A;  5HLH A;  2V9P A;  2JPC A;  1PVE A;  1U8B A;  1QVT A;  1WKM A;  1MMD A;  1BOA A;  2ZSH B;  4FQG A;  1DP7 P;  4FAS D;  1SFO J;  5KK1 A;  5D4R A;  2R0Q C;  2DPD A;  1EA3 A;  2DA6 A;  3CMY A;  4EJW A;  3CDL A;  3PFY A;  5C44 J;  3DU6 A;  4RLF A;  1K4T A;  3EUA A;  4A3F J;  1ETK A;  1B72 B;  2LVS A;  4LK1 F;  4L5J A;  3SXY A;  3WOD F;  1Y0U A;  3OYG A;  1DP3 A;  2F4O B;  2MA3 A;  2MH2 A;  2P6S A;  3S15 J;  4LG0 A;  4RB3 C;  4V2G A;  1ETW A;  3ABK H;  2HZT A;  2TCT A;  1D0Z A;  4DNC A;  2KT0 A;  1LKX A;  5HVQ C;  2K7L A;  1BI1 A;  4BGD A;  4M71 A;  2FRH A;  1DU0 A;  5F08 A;  4I76 A;  2E71 A;  2W84 A;  3L1P A;  3ZPL A;  2UV1 A;  3DPT A;  3ZN1 A;  2PQ8 A;  1LFP A;  1TQI A;  3RPU D;  1Y6I A;  3JW4 A;  3K4L A;  5BOX A;  5EGO A;  4XN3 A;  3PIO F;  3I4M J;  2PJR A;  2ESH A;  2EZI A;  3BR5 A;  4MEY F;  3HIF A;  4RAY A;  2OCC H;  4KN7 X;  2KRH A;  4IQJ A;  1Z1D A;  2L02 A;  2V1X A;  2VPR A;  3ZQC A;  2QKM B;  2ISZ A;  4A3B J;  4AYB A;  1LNW A;  2NAZ A;  4N9I A;  4BJT A;  1KU3 A;  3ELK A;  3P7N A;  1BJA A;  2JZY A;  5K7Z A;  2O03 A;  3J7A Y;  2H6C A;  1XPX A;  4IHS A;  2DT6 A;  1MBG A;  2GZW A;  4DBR A;  2ELJ A;  1KGS A;  5J4Y A;  1I39 A;  1VZ0 A;  3LQR A;  5FJ8 J;  2QVO A;  4ZC3 A;  4YFK F;  3FMS A;  1OYI A;  4OAZ A;  4X1E A;  1HKQ A;  1FOX A;  5ICE A;  3KP3 A;  4DZP A;  1IUF A;  1XMX A;  4XOP A;  4UV9 A;  1R71 A;  3CES A;  3GME A;  3MZY A;  1HW1 A;  2QBY B;  1J9I A;  5E8G A;  2KDO A;  2L5Q A;  2FBI A;  3HRT A;  5LHI A;  2GA2 A;  5EF6 A;  1E0E A;  2RV8 A;  2M7A A;  2TRT A;  2IGO A;  3HRS A;  3QU3 A;  3F8C A;  2VE8 A;  1X2N A;  4R79 A;  1ZAO A;  2XHK A;  4C2M J;  5IYC J;  5IYB J;  2W82 A;  2NNN A;  4S0H B;  2DDA A;  5DUI A;  5D5X B;  4Y52 J;  2M30 A;  5EEA A;  3EUH C;  3RKX A;  1RZ4 A;  2WB1 N;  4EJO A;  2RVC A;  1A04 A;  4IHV A;  1TBX A;  1IDY A;  3I3L A;  3ISP A;  3A0B C;  1YIJ I;  1YJW I;  4AID A;  2DO7 A;  3GFI A;  3ZXS A;  2CFO A;  3I59 B;  4F55 A;  5CVV A;  2IXS A;  5L3G A;  1WRJ A;  3GZ5 A;  2JMW A;  2NS8 A;  1FEX A;  1B59 A;  4QTR A;  1FTZ A;  2XF5 A;  2EH3 A;  4L0Z B;  3J81 Z;  4A3M J;  3L2U A;  3BR6 A;  3PL8 A;  1U5T B;  4L9T A;  3LSR A;  2UXX A;  4YII A;  2GIZ A;  3G6E I;  4XNF A;  2ZJR F;  1N77 A;  4OWR B;  1NK3 P;  4NQW B;  1GV5 A;  5FGM A;  1YG2 A;  2JSP A;  2CSO A;  1R36 A;  1Y8Q B;  1OMI A;  4ENN A;  1TT5 B;  1BR2 A;  1JKO C;  3GTL J;  4IEJ A;  2CV0 A;  3JRF A;  3CCJ I;  3V8J A;  3K1M A;  2A6T A;  4I09 A;  1ULY A;  3R60 A;  1MNE A;  3H5A A;  4L9N A;  4UV8 A;  3ASO H;  2P4W A;  2M34 A;  2M8E A;  2CS3 A;  4CXF A;  3FXM A;  4IHT A;  3WTZ A;  3R6S A;  3PUF A;  1NTC A;  2QQB A;  5LD2 C;  1ZAR A;  3E6B A;  2QSH X;  3M8F A;  3HOU J;  1JTX A;  3G73 A;  1UMQ A;  3FXQ A;  2O9L A;  1P4X A;  2DT5 A;  5KHD A;  2QLZ A;  3KX2 A;  2FF4 A;  3LSM A;  4AWX B;  2VOD A;  2E1M C;  2C6Y A;  5BPD A;  4B43 A;  4UUS A;  4AC0 A;  5E3L A;  3BR2 A;  4N9H A;  1FSH A;  5LGT A;  1BR4 A;  1ZR4 A;  4XSX F;  3CCQ I;  1J2X A;  1G3T A;  3V8K A;  5J4V A;  2BXY A;  4PSW A;  4PZJ A;  3HB9 A;  1VQ7 I;  4XOR A;  3VB2 A;  2Q0O A;  2HOA A;  2Y0S A;  2WBM A;  2GOM A;  2KRF A;  2MYS A;  5LGN A;  3ERE D;  4ZDL A;  3TDU C;  2X6Y A;  3WHC A;  3IUO A;  5J3L A;  1U78 A;  3KE2 A;  1GHC A;  5HS8 A;  4Y13 A;  5CQG A;  1WFX A;  2HU9 A;  3WHB A;  3OYL A;  5EEH A;  2IS4 A;  2EJR A;  4C9Y A;  1UHM A;  3RPU A;  3S1N J;  4BS9 A;  2L0K A;  1YOV B;  2IA0 A;  3U2R A;  2O8K A;  4G6Q A;  3FBN B;  3T8T A;  2A5W A;  4ZDO A;  1NHA A;  2QM3 A;  2CUZ A;  3K2A A;  5J8F A;  4DOZ A;  1KYZ A;  4LIU A;  4YFN F;  2GOX B;  1XGS A;  4G6T B;  2KP6 A;  4HV6 A;  1J09 A;  1DPU A;  3LA7 A;  3CCU I;  2OA4 A;  3OYB A;  4M72 A;  1B8I B;  1JT0 A;  4LLL A;  3GTK J;  2XF6 A;  2LC2 A;  1U5T C;  4J19 A;  1R1T A;  1D1A A;  2PMH A;  5FKK A;  1GLN A;  1I27 A;  1S9H A;  1YTY A;  1T6S A;  4EJU A;  2CUE A;  1OCZ H;  5DDG A;  4BKX A;  4Q5S F;  3K0L A;  3CCR I;  4JBA A;  4A3L J;  1T0F A;  2O61 A;  1OCP A;  5F27 A;  1QU3 A;  1HST A;  2QQ8 A;  3P5J A;  4XLP F;  3CP2 A;  1YX3 A;  2LOO A;  2K5C A;  2R3S A;  3LAP A;  1K6Y A;  1W7P A;  3CP8 A;  2CRG A;  2V1N A;  3VPR A;  1UFM A;  1KU2 A;  3EUK L;  2Y9Y A;  4BUP A;  1ZK8 A;  2FSW A;  3BG5 A;  2HZD A;  2DDB A;  1FOK A;  2Z2S B;  3K1P A;  2M4K A;  2OD5 A;  1UG0 A;  2XAU A;  3ZMV A;  2E1N A;  1WJF A;  4NHJ A;  3ZQG A;  2YPR A;  2BW3 A;  3KP5 A;  4I98 B;  4XRM A;  5JR3 A;  4PJN A;  1X3U A;  4NNJ A;  5EJC A;  1FMW A;  4R8H A;  2UWM A;  1G8X A;  4E7S A;  1FSE A;  1DGR M;  2NOG A;  4HLY A;  3UR3 C;  2RN7 A;  1IC8 A;  3DKY A;  1JUP A;  1D3Y A;  4B3X A;  4XOT A;  3DV8 A;  3RI4 A;  1MGT A;  3I5U A;  2IGN A;  3KIO A;  3GTP J;  3QWL A;  5CYV A;  1SVM A;  3CUQ A;  3FZV A;  1XDU A;  1HF0 A;  4A5N A;  2CFX A;  4F93 B;  2EFP A;  2YX7 A;  3HGG A;  2DMQ A;  4KUM A;  4XBF A;  1WSU A;  2HVR A;  1V54 H;  1O3R A;  1U9O A;  1VQL I;  4ZJZ A;  2ZME B;  1T95 A;  5ERI A;  1SEU A;  2P6T A;  2MD0 A;  1IGN A;  2BGC A;  5D8L B;  2WV1 A;  3DFG A;  3IH4 A;  2EV5 A;  2V79 A;  3FX3 A;  3T1B A;  2VPL A;  1XMA A;  4ENK A;  2E7X A;  3H3U A;  3IHU A;  2MGQ A;  3LWF A;  2XAG A;  3K4C A;  2HKX A;  1O3T A;  1S5L C;  3TP3 A;  4E6K G;  2K9S A;  4KN4 X;  1MKM A;  1V5G A;  2NXN B;  2EFO A;  4BDY A;  5FKM A;  4Q4Z F;  1P4A A;  2P7V B;  1EKE A;  2K9Q A;  4EVI A;  2VLA A;  3CTA A;  3ABL H;  3U21 A;  3GVA A;  2DYS H;  2X9D A;  1E2X A;  1VQ5 I;  1Z7U A;  2LRD A;  2GLO A;  1TZL A;  2M2E A;  4B8X A;  1UB9 A;  1FYK A;  2MAB A;  3C2G A;  2RDP A;  3PQK A;  1ZGA A;  2LLK A;  4I2O A;  4KIG A;  5GP9 A;  1MSE C;  3BZC A;  2DN0 A;  1OCT C;  5J1R A;  1FIP A;  3LMM A;  1AA7 A;  3HOS A;  1VFC A;  1IRZ A;  3VEP A;  3S1Q J;  3WTW C;  4KIF A;  3TO7 A;  3TDZ C;  3PJR A;  3HTU A;  3F21 A;  1YE9 A;  4CYC A;  4D5F A;  2LK2 A;  1ZRF A;  2LBF B;  2W7N A;  3QAH A;  5GAD J;  3L2C A;  1AKH A;  2LKP A;  2K4J A;  2RRE A;  2E2I J;  2FNA A;  2PX9 A;  3G1M A;  2STW A;  1MJB A;  3LSH A;  2WAF A;  3BWG A;  3HRU A;  4EM2 A;  2VQC A;  3F8F A;  1WJD A;  2MC4 A;  5E3M A;  2VXZ A;  3OR1 C;  1AWC A;  3HOV J;  4RM3 A;  4IHX A;  3GUD A;  1ERD A;  1EH6 A;  3MAJ A;  3HEF A;  4LD5 A;  3RQI A;  3MKW B;  2HFH A;  2PMZ A;  2JA6 J;  2JA7 J;  2NOJ B;  3I71 A;  4OIO F;  1F4K A;  2EQR A;  3IWZ A;  1H9T A;  3RKY A;  3HUG A;  1WQ2 A;  2HQN A;  1F1Z A;  4LB5 A;  1UST A;  3C1D A;  2DOD A;  2LY1 A;  3TO9 A;  2CG4 A;  3LA3 A;  4Y15 A;  1SVL A;  3W2W A;  4Q47 A;  1SFE A;  1WJC A;  2W4S A;  4QLC U;  1LVA A;  2LG4 A;  4XQF A;  4Z6Y A;  4Y7N J;  3OYD A;  3CCL I;  3P9I A;  1TLH B;  2WAQ A;  4L9V A;  2P5L C;  1A35 A;  1X58 A;  1IRX A;  2K9L A;  4CIC A;  5H20 A;  2FMY A;  3OWT A;  3HSF A;  3R61 A;  3F72 A;  1QPI A;  2JQ7 A;  3L2W A;  3HDD A;  1SMY F;  3TW7 A;  4IJA A;  3JRB A;  1Z6R A;  2Y30 A;  2Y0S N;  1YFH A;  1I50 J;  1ZEL A;  3ZOB A;  5J8C A;  3KEQ A;  4BAY A;  3JCU C;  3BP8 A;  3PNV A;  1FMV A;  1NG6 A;  4EAT A;  4E7K A;  5LRR A;  3FXJ A;  2DA1 A;  3H0D A;  1TTY A;  4LG0 B;  1XMK A;  1ZTR A;  3HGY A;  2VB6 A;  1R4M B;  4M3E A;  4UY8 I;  2HQ5 A;  3SDB A;  3GZN B;  4BHC A;  3BTL A;  5CPR B;  5JHU A;  2O3F A;  3ZCO A;  1MMS A;  1RIO H;  2ESN A;  1R5H A;  1P7J A;  1YHQ I;  1E3P A;  1WH5 A;  2F5D A;  1ZG1 A;  1IRF A;  1FP1 D;  5DYM A;  2IP2 A;  5BNG A;  5EGO B;  2HTS A;  4XLA A;  4BY1 J;  4Z2Y A;  2PJR B;  1QVU A;  1GDT A;  1BN5 A;  4ZYA A;  1FTT A;  3K4B A;  3FIS A;  4P96 A;  4A3E J;  2H8R A;  1JT6 A;  2L4A A;  5TJJ A;  1LB2 A;  3A01 A;  4LLN A;  4HAM A;  4S04 A;  2A05 A;  2BV6 A;  2X6W A;  1FBU A;  1SAX A;  1HW2 A;  4KIB A;  1AHD P;  2ISY A;  4LG3 A;  1G3W A;  3LSJ A;  2LH9 A;  2Z3Y A;  3CMM A;  1L3L A;  2COB A;  3U1D A;  3C7J A;  3N05 A;  3Q5F A;  3WG9 A;  2GBY A;  1KU9 A;  3BQY A;  3PO2 J;  1ITY A;  5B5E C;  2UZK A;  1KQ9 A;  2RNJ A;  1YS6 A;  3WU1 B;  4FE7 A;  4I02 A;  4N4O B;  3GW2 A;  2WWY A;  4GYG A;  4MEX F;  1J5Y A;  2PLY A;  4HOB A;  1QZZ A;  1LPQ A;  4HA8 A;  4EJT A;  4A3K J;  1VF9 A;  1HXD A;  5BQT A;  2BXZ A;  1MBE A;  1QGP A;  2LFB A;  2OQR A;  3ZMT A;  2NNY A;  1XTA A;  2AO9 A;  1XCB A;  4L9J A;  3WGG A;  3DTI A;  2Y2Z A;  5H6R A;  3H35 A;  4UB8 C;  3V7R A;  1LDJ A;  3IRR A;  2WY8 Q;  3HKZ N;  2VJ5 A;  2DJI A;  2YR2 A;  3ASN H;  5AIP A;  1NH3 A;  2DFH A;  5GAE J;  3I4N J;  1PUF A;  3RSN A;  5IP6 A;  1WJA A;  5FRO A;  3GZ6 A;  1ZQ3 P;  2G7U A;  5FKN A;  3MKY B;  1YW9 A;  3AL0 C;  2XPV A;  1OLT A;  2P8T A;  2JA5 J;  1Q1V A;  4HNV A;  2FU4 A;  3FM3 A;  5E1Z B;  4BAC A;  5L3B A;  3CZ6 A;  3C18 A;  5J1Y A;  1YRN A;  3V7S A;  3RZO J;  2HQA A;  5FRM A;  2E60 A;  3F0C A;  3L2Q A;  2J5P A;  1FX7 A;  2RQQ A;  3BLY A;  5IT9 Z;  1TP4 A;  4BBR J;  4UVC A;  3SEQ A;  2D1H A;  3FXL A;  1MDM A;  4FT8 A;  3NWS A;  3E1S A;  2LKS A;  3CLQ A;  1ZGW A;  2HR3 A;  1R1V A;  1JTY A;  4BJ6 C;  1IAW A;  3BPX A;  1CGP A;  4A6E A;  2VBY A;  3G4S I;  1V5F A;  5E1X A;  5H2F C;  1QRY A;  4R1H A;  5J40 A;  2G7H A;  4RAG A;  2E5Z A;  3BG6 A;  3RKQ A;  2JA8 J;  1HSJ A;  3BTJ A;  3P9K A;  3HTS B;  1BI2 A;  1G3S A;  1MBJ A;  1VQP I;  1POG A;  4KT5 C;  2HPM A;  5GTI C;  3PUB A;  2CJJ A;  3I9V 2;  3DF8 A;  1FOY A;  3ROU A;  1P9Q C;  2UUZ A;  2OZ6 A;  3R0J A;  4XL9 A;  4MHG A;  1T98 A;  1R49 A;  3E6D A;  2R7Q A;  4UHT A;  3ZRG A;  2KIF A;  3ONQ A;  4ANJ A;  3E5U A;  3U1K A;  2W57 A;  2DOF A;  2X6X A;  3Q0V A;  3BZ6 A;  1BJZ A;  4UUS B;  2PI0 A;  3HHG A;  2DXI A;  2Q1Z B;  4CCN A;  5IYD J;  4RB0 A;  2F5F A;  2YS9 A;  4HSR A;  3G3Z A;  2BOL A;  2PMZ N;  2FE3 A;  4ESB A;  3DKW A;  3OS2 A;  4E7Z A;  1S6L A;  3W3C A;  4EEF G;  4I0A A;  3DEU A;  3E6M A;  3LSG A;  4HG2 A;  2A3S A;  2BY0 A;  2FQ3 A;  1P4W A;  2EK5 A;  2Y48 A;  4P5O A;  5IP7 J;  2XF7 A;  3K9T A;  3CCS I;  4M9X A;  1W0U A;  2GM4 A;  1ACI A;  2VBZ A;  1MZB A;  4OAY A;  2KIU A;  5L3C A;  1ZKG A;  1IXS B;  3SFZ A;  1JUM A;  3WTX C;  1TNT A;  3QPT A;  1W0T A;  2K3F A;  2N8G A;  3R0A A;  4M73 A;  3M4O J;  1H0M A;  5CVR A;  2E36 A;  4XLC A;  3HG9 A;  2P5K A;  1IJW C;  2TDX A;  2E5N A;  4RGS A;  2PFB A;  3HC7 A;  4D7M A;  2M87 A;  1B4A A;  2QKL B;  2LNB A;  5E3N A;  1QO0 D;  2W85 A;  2YU9 J;  4ENJ A;  1HQC A;  1HC8 A;  4Y3O A;  1R22 A;  1I3Q J;  1NG7 A;  4D1Q A;  2CWE A;  3DCF A;  3JR9 A;  1E3O C;  3F9K A;  3UNG C;  1FC3 A;  1S3J A;  1D0Y A;  3S3N A;  1ZH5 A;  3BR3 A;  2EA2 A;  2OCE A;  2VL8 A;  3GCM A;  4PK4 A;  2EIM H;  1X4O A;  2O5R A;  1GVJ A;  2V4J C;  2HTJ A;  1WH7 A;  1YYV A;  4ZYG A;  1J75 A;  3MQ0 A;  2VJI A;  2ME0 A;  3A1Y A;  4KIS A;  1Y1W J;  2EZL A;  1UG2 A;  3QPL A;  5L3F A;  1JGG A;  1S7A A;  1DPR A;  1SAN A;  1W7P B;  2L01 A;  5FKO A;  3IP4 B;  2QZ8 A;  2IA1 A;  3H3Z A;  5CVU A;  4IVN A;  4O5V A;  2VUM J;  3KET A;  4EMS A;  2JTV A;  1BA5 A;  2IS2 A;  5D5W B;  2KRC A;  3K4M A;  3ML6 A;  1AOY A;  3KZY A;  3M7G A;  4JOM A;  2Q8K A;  3LAJ A;  2BW3 B;  2L2O A;  3M9A A;  3Q9S A;  5DCF A;  2IGK A;  3K10 A;  4E7J A;  5E3O A;  2V1D A;  3HJE A;  1ETX A;  3E0J B;  4NC7 A;  2Z1D A;  2KIM A;  4U7B A;  2K4B A;  3OY9 A;  4NC6 A;  5K5O A;  1X1A A;  2L9N A;  4FE4 A;  5F0C A;  4ESF A;  5HOD A;  2XDV A;  1JHF A;  1OPC A;  2LD5 A;  4HST A;  3H9Q A;  1P7I A;  2BVM A;  3MWM A;  4FX0 A;  3CUQ B;  2ZSI B;  2O6G E;  3GTM J;  2KZG A;  2X6O A;  1T38 A;  2A6H F;  4ASN A;  1IDZ A;  4RM2 A;  2FOW A;  3IAM 2;  2V9V A;  2DTR A;  5GAG J;  2IAI A;  2DK5 A;  2EFN A;  1FNN A;  3F3X A;  2VQL A;  3REO A;  3WE3 A;  5HLG A;  4ZDP A;  3E97 A;  3M1C A;  3T5X A;  1RPW A;  1RRJ A;  3CD6 I;  4LIV A;  2M45 A;  4XSZ F;  3D5R C;  1DU6 A;  1IO2 A;  1E3H A;  2X0L A;  3S1R J;  1G4D A;  1I6H J;  2DBB A;  2QSG X;  5CKT A;  3KCC A;  4U0Y A;  1IZ1 A;  3BR0 A;  4JK1 X;  3LOC A;  1XD7 A;  3TW6 A;  4E7H A;  2K9M A;  4N0B A;  3RQ4 A;  3KLN A;  1RC9 A;  1SAU A;  1MD0 A;  4F92 B;  3GX4 X;  2ZBK A;  4RGU A;  1ZR2 A;  1G3Y A;  2CMP A;  3K4J A;  2F6C A;  4M9Z A;  1DUX C;  3DWL E;  4M6V A;  5JHF A;  2XAF A;  4IF4 A;  4HX4 A;  4Y17 A;  3EDP A;  4B1R A;  3X2Q H;  3FF5 A;  2EBI A;  4GXO A;  3CDH A;  1S8N A;  1PP7 U;  2F5C A;  2K86 A;  2E19 A;  3WE2 A;  2B63 J;  3CJN A;  2QEN A;  5EDN A;  2ZFU A;  2CUF A;  3KP6 A;  3M8E A;  2M0C A;  4Q48 A;  1XSX A;  4CYC B;  1OR7 C;  4XKW A;  5LEJ A;  1ORK A;  3L9F A;  2JRT A;  1XN7 A;  1AKH B;  3E3V A;  3PNY A;  1JUS A;  1R23 A;  1I1S A;  4EJV A;  1KU7 A;  1EV7 A;  2HXO A;  5LFA A;  1S7E A;  3Q0W A;  2F48 A;  4NB5 A;  2X51 A;  1ETV A;  4LK0 F;  3D5S C;  2VI6 A;  1W36 C;  3D1N I;  3OYN A;  4KMF A;  3Q0U A;  4M6Y A;  3TL4 X;  2XGC A;  1TW3 A;  4W1U A;  4KIT B;  2QEX I;  1MMG A;  2HS5 A;  4IRI A;  3KP2 A;  4AVZ A;  1RES A;  3VFZ A;  4JP0 A;  4G9Y A;  2DW4 A;  4RAZ A;  3W6V A;  1VND A;  4YRV A;  1SFX A;  3FK7 A;  3HUG B;  4BBS J;  4QSH A;  3BJA A;  4DYR A;  3OL3 A;  3GYH X;  1YS7 A;  2HI3 A;  4CZC A;  2LMD A;  4J01 A;  3PM1 A;  4H0E A;  3F8B A;  3QP5 A;  5BS6 A;  3K7A J;  4DGW B;  4WXD A;  4GRI A;  2Z16 A;  1QBJ A;  4IHW A;  3RTR A;  4V19 K;  1Z7L A;  5EG0 A;  3CUQ C;  2IGM A;  2H09 A;  3Q3S A;  3OIP A;  2XV4 S;  4ENM A;  2QWW A;  4X6A J;  2M7B A;  2BVL A;  3BG7 A;  5HDK A;  4N4N B;  5K5R A;  4NUB A;  3K69 A;  2DMT A;  2R92 J;  1U2W A;  1VQ9 I;  4F3Q A;  4A3C J;  1WI3 A;  1T08 B;  1USS A;  3J80 Z;  5E17 F;  3AKZ A;  5EZG A;  1ZRC A;  2DQR A;  3GLL A;  1ZYR F;  3S16 J;  3M8J A;  1R6R A;  5E1W A;  1W1W E;  3TQN A;  4ZTF A;  3CJT B;  4CCO A;  4PGG A;  5A2Q K;  3GEZ A;  1TT0 A;  1G2H A;  2NVQ J;  1T2K A;  1RUN A;  5J1U A;  3ABM H;  3ZP5 A;  4HX8 A;  2D2W A;  3QOE A;  3S93 A;  4KDP A;  4GYI A;  2HDW A;  4XKB A;  1VQK I;  4MTD A;  5IPA A;  2A68 F;  4AIK A;  1D5Y A;  2K9N A;  3BY6 A;  2W48 A;  5B66 C;  3L09 A;  2ACJ A;  2HWV A;  1J59 A;  4YIR X;  1TL8 A;  1VQ6 I;  3KP7 A;  5FFX A;  5FLX K;  2UXN A;  3GFJ A;  1T56 A;  2X4H A;  3OIQ A;  3DBL B;  4CCM A;  1G6N A;  4HF0 A;  4CCK A;  4B47 A;  3A01 B;  1Y1V J;  2R7F A;  3O3K A;  4OOI A;  1BI3 A;  4PFP A;  1Z77 A;  3AG4 H;  4UXN A;  4CDG A;  1T39 A;  1FBS A;  2CQN A;  1QNT A;  2XUB A;  1BOB A;  2KL4 A;  3S17 J;  4YIF A;  4XRS A;  2EIJ H;  3K6G A;  5M3F J;  4AYB N;  5FB2 A;  4BE1 A;  3DLL F;  3L2V A;  1ZN2 A;  2GXB A;  2VC1 A;  4D5C A;  3CMA I;  4HNU A;  3FMR A;  3ZQH A;  3S3M A;  1TWG J;  3ZGK A;  2WV0 A;  2JK3 A;  5HLI A;  3FKJ A;  2R5Y A;  1IN6 A;  5J6X A;  3JAM K;  4A0X A;  2I10 A;  2G9W A;  2HYF A;  4A5M A;  2IW5 A;  4A3I J;  5EYR A;  2DTZ A;  2V1U A;  3C2B A;  1ON2 A;  2ZJ2 A;  1IN5 A;  1HW5 A;  1V5E A;  2MG4 A;  2ZC2 A;  3LSK A;  3GTQ J;  3GXO A;  4A6D A;  2XB0 X;  5IOZ A;  3W2V A;  5K5Q A;  2V26 A;  5FRN A;  3HL2 A;  1HLV A;  1Y0N A;  4IKF A;  1S29 A;  1ZLJ A;  1PUF B;  2QQ9 A;  1YO5 C;  5FLM J;  2DMP A;  4II2 A;  1FT9 A;  4GFB A;  3OR2 C;  3S8P A;  1PJR A;  3BZK A;  1YIO A;  1XDS A;  2OUM A;  4LFU A;  2R7Z J;  2BZT A;  3QYF A;  2GXA A;  2FNP A;  4G7Z F;  2JT1 A;  1W5S A;  2A61 A;  1YRN B;  3EPZ A;  2LSO A;  4DBQ A;  1MNM C;  4DYQ A;  2O0Y A;  1UEL B;  1B1B A;  3RDI A;  3CCM I;  3E7L A;  3JRC A;  2ETH A;  2XSD C;  2A69 F;  1MH3 A;  3BG3 A;  1MDM B;  1UHW A;  1FIA A;  2OQG A;  2GWR A;  4RB1 A;  3I59 A;  1Z91 A;  1JJ8 C;  2K40 A;  2OC6 A;  2RNG A;  3BQZ A;  2ELH A;  2IJL A;  4L0Y B;  3SHF A;  1WZ2 A;  2VIX A;  2WC2 A;  2RAE A;  3QPS A;  3LSI A;  1MMA A;  3IRQ A;  4G7H F;  2B7E A;  3WTU C;  5IT9 K;  4HW0 A;  1I3A A;  4CGZ A;  5D5V B;  2ECC A;  3H36 A;  1OCO H;  3JSP A;  1V4R A;  4O3M A;  4HZF A;  4CZZ A;  2OU2 A;  5M5Y J;  2YUS A;  1IW7 F;  1EJ9 A;  5CJ9 A;  4EM1 A;  4ZZD A;  4JX6 A;  3FWE A;  2MH9 A;  3HYI A;  4IXA A;  1Z3X A;  4A93 J;  1K83 J;  2X1E A;  1BIB A;  4AD9 A;  4DZJ A;  3FHN A;  1RR7 A;  2V6E A;  1BIA A;  1RR8 C;  4BYY A;  4PUS A;  5FKL A;  5F0F A;  3RYR A;  1X2M A;  2FXA A;  1TW2 A;  2ZJQ F;  1TWC J;  2ZCW A;  3I58 A;  1LEB A;  5A2Q Z;  5ILS A;  5LEK A;  5CVI A;  2CYY A;  1B9M A;  1WPK A;  2CUJ A;  3IL2 A;  1ZHF A;  3S2H J;  3MFK A;  1GXP A;  2VKH A;  3M3Y J;  5DCM A;  2CQX A;  3HRM A;  1MSF C;  2ZME C;  1X1B A;  3IKV A;  3N4M A;  3U9G A;  3W6K B;  1U6G A;  2ZXH A;  3HXL A;  3RIR A;  4RS8 A;  5IOY A;  3MEX A;  1VTN C;  5F1J A;  4EM0 B;  4KA4 A;  1R5G A;  5FLX Z;  2FOK A;  1WWX A;  4MNU A;  4AIJ A;  4MQV A;  4GDF A;  4AM3 A;  2MC3 A;  4IO9 F;  4RMN A;  2IA2 A;  4C30 A;  3OYI A;  2JVG A;  2ICW G;  1MJ9 A;  4YFX F;  2VOO A;  3OV8 A;  1JGS A;  1YI2 I;  5KAF C;  1K6O A;  2XC7 A;  1TWF J;  2XRL A;  2NVT J;  4U0V A;  2CW8 A;  2X48 A;  3GO5 A;  4WXC A;  2L7F P;  1FYL A;  2DMU A;  1SD6 A;  2BY1 A;  3LSP A;  2X85 A;  2XSJ C;  3GTG J;  3QQA A;  1PP8 F;  2DQL A;  5ICG A;  2FBK A;  4PJ0 C;  1C0W A;  3C3W A;  4UVB A;  2XGX A;  4IQ4 A;  4QIW N;  3S1M J;  2M4G A;  3ZMZ A;  2I5U A;  3KP4 A;  4LJZ F;  3OSG A;  1J7K A;  3JAM Z;  5D8K B;  3IAS 2;  1FWZ A;  4E7L A;  4MTE A;  2FEZ A;  1JKQ C;  2Y75 A;  3SQN A;  2Z33 A;  3KZZ A;  3VYT B;  1PUE E;  1K7A A;  1OQY A;  3PQJ A;  1B6A A;  2IT0 A;  4B4C A;  2EZK A;  3BOQ A;  3L7W A;  4BXU A;  2EB7 A;  2FD5 A;  2VT3 A;  4H4K C;  5L3E A;  3I54 A;  3BCB A;  2QF7 A;  2QSF X;  3CQZ J;  3VSL A;  1OYW A;  3BR1 A;  4HYE A;  1H8A C;  2OV7 A;  2H1K A;  1UHS A;  2P0W A;  2L3D A;  1F9N A;  4FCY A;  4IPA A;  2EIN H;  2OPT A;  4EGZ A;  2NRA C;  3DXJ F;  2AXT C;  3HSR A; 
#chains in the Genus database with same CATH homology
 2M9H A;  4UUS A;  4AC0 A;  5E3L A;  3BR2 A;  3CCY A;  3NAR A;  4D7N A;  2NVY J;  3SFI A;  3FKI J;  1ZR4 A;  1FJL A;  1WH7 A;  3O8G A;  2ME0 A;  2LTP A;  4C3H J;  1Y1W J;  2EZL A;  1UG2 A;  3HB9 A;  3QPL A;  2HOS A;  3JRG A;  1JGG A;  2HOA A;  1SAN A;  5F04 A;  3BT9 A;  5FKO A;  1APL C;  5DS9 A;  3WHC A;  2VUM J;  1AU7 A;  5J3L A;  2L9R A;  3B6C A;  1U78 A;  1BA5 A;  3H0G J;  2FJ1 A;  2E1O A;  3WHB A;  5C3E J;  2L7Z A;  4MLO A;  2JJ7 A;  3S1N J;  4MIM A;  4V2F A;  2L0K A;  3IH3 A;  5E3O A;  2O8K A;  1WCM J;  1ETX A;  5FLV A;  5M5X J;  3K2A A;  1K61 A;  2JN6 A;  3HOZ J;  5F0H A;  1HOM A;  4BXX J;  4FE4 A;  5F0C A;  5HOD A;  2LD5 A;  1B8I B;  1JT0 A;  1RKT A;  1MBF A;  1P7I A;  4DYC A;  3GTK J;  4LOC A;  4M3B A;  4J19 A;  1ETY A;  3GTM J;  1TWA J;  2X6O A;  5FKK A;  2HYJ A;  1IDZ A;  2CUE A;  3B6A A;  4BKX A;  2IAI A;  3FK6 A;  4A3L J;  1OCP A;  1MBK A;  5F27 A;  3JRE A;  9ANT A;  2DA7 A;  1U9N A;  2CRG A;  1RPW A;  2OF7 A;  3LNQ A;  1F43 A;  3VPR A;  2O7O A;  1DU6 A;  2Y9Y A;  3S1R J;  1ZK8 A;  1I6H J;  3BG5 A;  2XB5 A;  3BR0 A;  4C3J J;  1GUU A;  2LY9 A;  1LFU P;  3LOC A;  5EZH A;  3TW6 A;  5K7F A;  4IHY A;  3ZQG A;  4XID A;  4MO7 A;  4XRM A;  2VKV A;  1ZR2 A;  4XIC A;  5M5W J;  1BW5 A;  2NOG A;  4M6V A;  2LP0 A;  4B1R A;  4XK4 A;  2P81 A;  1IC8 A;  1JUP A;  2EBI A;  3IV5 A;  5EG0 B;  2E19 A;  1B8I A;  2B63 J;  3GTP J;  5EDN A;  4AUX A;  3TP0 A;  2CUF A;  1HF0 A;  2M0C A;  4CYC B;  3G1O A;  1ORK A;  3HGG A;  2DMQ A;  2WAQ N;  1AKH B;  2ZB9 A;  2R93 J;  2JWT A;  1U9O A;  5JLX A;  1JUS A;  3MN2 A;  4MFD A;  2EZH A;  1IGN A;  5JLW A;  2HXO A;  2WV1 A;  1S7E A;  2Y9Z A;  3IH4 A;  3Q0W A;  4B3A A;  4JX5 A;  1ETV A;  3JRH A;  2VI6 A;  2MGQ A;  3D1N I;  1OJL A;  1H88 C;  3Q0U A;  2DJN A;  2DA4 A;  2XGC A;  4W1U A;  3TP3 A;  1BL0 A;  3OIO A;  2DA3 A;  3MVP A;  2K9S A;  4JX4 A;  1RES A;  4JP0 A;  4W97 A;  3OOU A;  5FKM A;  1VND A;  3W6V A;  1GV2 A;  3FK7 A;  4BBS J;  2K9Q A;  4QSH A;  3HOW J;  4DYR A;  1MBH A;  1JJ6 C;  2HI3 A;  3OSF A;  2X9D A;  2GLO A;  5DTD A;  2M8G X;  4FIS A;  3ZQI A;  2Y31 A;  1VI0 A;  3ZQL A;  2M2E A;  3PM1 A;  4BY7 J;  3K7A J;  1F36 A;  1H89 C;  2LLK A;  3RZD J;  4IHW A;  5GP9 A;  1MSE C;  2LKX A;  1HCR A;  2DN0 A;  3JRD A;  4C3I J;  5EG0 A;  1OCT C;  5J1R A;  1FIP A;  2KDZ A;  1VFC A;  3HOX J;  1IRZ A;  1XC5 A;  3IH2 A;  3S1Q J;  3Q3S A;  5IP9 J;  4X6A J;  3GTJ J;  3PO3 J;  4CYC A;  4D5F A;  2LK2 A;  2DMT A;  2R92 J;  3A02 A;  1AKH A;  4A3C J;  1WI3 A;  2E2I J;  5EZG A;  3G1M A;  3S16 J;  2DA5 A;  5E3M A;  4A69 C;  2LR8 A;  1EF4 A;  1A6I A;  2R5Z B;  1TC3 C;  5M3M J;  2CU7 A;  3HOV J;  3FIW A;  4IHX A;  1G2H A;  4NDL A;  2R5Y B;  2HDD A;  2FQ4 A;  2NVQ J;  3MKL A;  3S2D J;  5J1U A;  3HEF A;  3RQI A;  3SJM A;  1CQT A;  1TWH J;  2JA6 J;  2JA7 J;  5IPA A;  2EQR A;  1D5Y A;  2VKE A;  2DA2 A;  2K9N A;  2W48 A;  4G12 A;  4A3J J;  3JRI A;  3H3V K;  1T56 A;  1HDP A;  1MH4 A;  4JYK A;  4Y7N J;  3BTI A;  1O4X A;  1RKW A;  3A01 B;  1Y1V J;  2IEK A;  1X58 A;  2G0E A;  1Z77 A;  5GPA A;  1JKR C;  1IG7 A;  1OFC X;  3HDD A;  1QPI A;  1LE8 B;  3TW7 A;  3JRB A;  2Y30 A;  1XS9 A;  2Y0S N;  1I50 J;  3S17 J;  3ZOB A;  4XRS A;  5M3F J;  4AYB N;  2HXI A;  4D5C A;  5K7H A;  2DA1 A;  2CQQ A;  4RBO A;  1LFB A;  1WGX A;  3ZQH A;  4M3G A;  1TWG J;  1ZTR A;  1A5J A;  3HGY A;  2R5Z A;  3DEW A;  2JK3 A;  4M3E A;  2MW8 A;  2HQ5 A;  2R5Y A;  2HOT A;  3BTL A;  2I10 A;  3UKG A;  4A3I J;  4RDU A;  1T33 A;  1XG1 A;  1P7J A;  1WH5 A;  3HBL A;  5EYR A;  2DTZ A;  3C2B A;  4MFE A;  1ETQ A;  5BNG A;  5EGO B;  2MG4 A;  4BY1 J;  3GTQ J;  1QVU A;  2ECB A;  1GDT A;  2E2H J;  2XB0 X;  5IOZ A;  3FIS A;  4I6Z A;  4A3E J;  1HLV A;  2XPW A;  2H8R A;  1PUF B;  1JT6 A;  5FLM J;  3A01 A;  2DMP A;  1U8B A;  4GFB A;  1QVT A;  1AHD P;  3SDG A;  3LSJ A;  1RET A;  1SFO J;  2R0Q C;  2COB A;  2DA6 A;  1LE8 A;  3CMY A;  2R7Z J;  3CDL A;  2GBY A;  2XPU A;  3BQY A;  2NS7 A;  5C44 J;  3PO2 J;  1ITY A;  1YRN B;  2AHQ A;  4A3F J;  1ETK A;  4FE7 A;  4DYQ A;  1B72 B;  2LVS A;  1MNM C;  3E7L A;  3JRC A;  2XSD C;  3S15 J;  1MH3 A;  3BG3 A;  4V2G A;  1ETW A;  1FIA A;  2TCT A;  4A3K J;  2FX0 A;  1VF9 A;  3G1L A;  1JJ8 C;  2E2J J;  2XGE A;  2KT0 A;  2K40 A;  3BQZ A;  1MBE A;  1DU0 A;  2LFB A;  2AO9 A;  5F08 A;  3ZQF A;  4I76 A;  3L1P A;  2QCO A;  1ENH A;  2RAE A;  2Y2Z A;  3QPS A;  5EGO A;  1ETO A;  3I4M J;  3HKZ N;  3O8H A;  2EZI A;  3BR5 A;  2ECC A;  3I4N J;  1PUF A;  5IP6 A;  4FTH A;  2VPR A;  1ZQ3 P;  3ZQC A;  3GTO J;  4A3B J;  2MSY A;  5FKN A;  5M5Y J;  2XPV A;  2YUS A;  2D5V A;  2JA5 J;  1Q1V A;  5K7Z A;  2ID6 A;  1GVD A;  4HNV A;  4JX6 A;  1MBG A;  4A93 J;  1K83 J;  5J1Y A;  5FJ8 J;  1BW6 A;  1YRN A;  3RZO J;  1B72 A;  4DZJ A;  3F0C A;  1HDD C;  4X1E A;  1RR7 A;  4M3F A;  4BBR J;  4DZP A;  1IUF A;  5FKL A;  5F0F A;  1Z0X A;  2ME6 A;  1X2M A;  1ZGW A;  5C4X J;  1TWC J;  1JTY A;  5C4J J;  3JRA A;  5EF6 A;  4DW6 A;  1QRY A;  2TRT A;  1WPK A;  1NK2 P;  3S2H J;  1X2N A;  4C2M J;  3RKQ A;  5IYC J;  3M3Y J;  5IYB J;  2CQX A;  3BTC A;  3BTJ A;  2JA8 J;  1MSF C;  1MBJ A;  2ID3 A;  1POG A;  4S0H B;  2IBD A;  1R9T J;  4Y52 J;  3S14 J;  5EEA A;  5IOY A;  2WB1 N;  2CJJ A;  5F1J A;  4IHV A;  1IDY A;  3A03 A;  3HOY J;  2JMW A;  2NS8 A;  1FEX A;  4QTR A;  1FTZ A;  3Q0V A;  2EH3 A;  2L7M P;  4A3G J;  1BJZ A;  1TWF J;  2XRL A;  4UUS B;  4A3M J;  2NVT J;  2X48 A;  5GPC A;  2XGD A;  1GT0 C;  2L7F P;  3BR6 A;  3LSR A;  5IYD J;  2DMU A;  3HM5 A;  2YS9 A;  1NK3 P;  3LSP A;  1GV5 A;  4UUT A;  3GTG J;  3QQA A;  2PMZ N;  2ELK A;  4L5E A;  1IV6 A;  4EEF G;  4QIW N;  3S1M J;  3LSG A;  1JKO C;  3GTL J;  4IEJ A;  3JRF A;  3NAU A;  5IP7 J;  1FTT A;  3OSG A;  2DMN A;  2GM4 A;  1W0U A;  4A3D J;  1ZKG A;  1JUM A;  1W0T A;  1JKQ C;  3BG9 A;  2N8G A;  3M4O J;  1JKP C;  1IJW C;  2M34 A;  4B4C A;  2EZK A;  2FD5 A;  4D7M A;  1NTC A;  2QF7 A;  2NVX J;  3CQZ J;  5E3N A;  4ABZ A;  3BR1 A;  2YU9 J;  3TED A;  1H8A C;  3HOU J;  4XRS G;  1JTX A;  2H1K A;  1I3Q J;  1UHS A;  1UMQ A;  4M3D A;  3GBG A;  3DCF A;  2O9L A;  4FCY A;  3JR9 A;  1E3O C;  2OPT A;  3BR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...