4B4CA

Crystal structure of the dna-binding domain of human chd1.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
204
structure length
187
Chain Sequence
KGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKKEALSGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
publication title Crystal Structure of the DNA-Binding Domain of Human Chd1.
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 66
structure length 187
sequence length 204
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18375 CDH1_2_SANT_HL1 CDH1/2 SANT-Helical linker 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4b4cA02
4XICA 1AKHA 3ZQLA 3FKIJ 2NOGA 3JRDA 3S2HJ 1X2NA 4FISA 4A3MJ 9ANTA 4Y52J 3IH2A 2IBDA 2ECCA 4DYRA 1IDZA 3FISA 4DW6A 5FKMA 3TEDA 2E2HJ 4A3GJ 1JT6A 5F1JA 1TWGJ 1FTZA 5K7ZA 3RQIA 2K40A 2XB0X 1RPWA 5EZGA 5IPAA 3NARA 1HCRA 2XGEA 4B4CA 1WI3A 1XS9A 3H0GJ 1JGGA 1U9NA 2ELKA 3LSJA 3Q0VA 2HYJA 3BTLA 2VKVA 1IGNA 2JA7J 2ZB9A 1BJZA 4QTRA 3IH3A 4C3HJ 3Q0UA 1TWHJ 2EZKA 3GTOJ 2R0QC 1A6IA 5C44J 1HDDC 3HOWJ 3PO2J 1WPKA 2LP0A 4M3FA 2EZHA 2KT0A 2YS9A 2HOAA 2HI3A 3GTPJ 2CJJA 5IP7J 5GP9A 2LKXA 1LFBA 4X6AJ 1I6HJ 1U8BA 4IHWA 2Y0SN 2R92J 1TWAJ 1Q1VA 3NAUA 1ZGWA 1X2MA 1APLC 3RKQA 3I4MJ 2EQRA 1WH5A 3HKZN 4W97A 1UMQA 2DA1A 4BBRJ 2M0CA 3L1PA 3HGYA 4C3JJ 4UUSA 1BW5A 2DA3A 2R5ZA 2FD5A 1AHDP 5DS9A 2DA5A 1QVUA 5M3FJ 2IEKA 1GUUA 2R5YA 2L7ZA 3HOYJ 5J1UA 1RKWA 1HDPA 4Y7NJ 3GTKJ 3CCYA 1B8IB 4FE7A 1JUMA 2DA4A 3BR2A 2LLKA 3LOCA 4UUTA 3H3VK 1WCMJ 3QQAA 5C4JJ 1LFUP 1LE8B 1R9TJ 1ETXA 4LOCA 2DMPA 1ETYA 1ETQA 2L0KA 5FJ8J 1GVDA 2O9LA 1ZR2A 2VPRA 4GFBA 1E3OC 3BR3A 1NK3P 1JTYA 2VKEA 1MBFA 1ZK8A 3HOUJ 2Y2ZA 3VPRA 1FTTA 5EZHA 3GTQJ 1HLVA 1JUPA 5EEAA 1Y1WJ 3CMYA 2DJNA 4L5EA 2X6OA 2NVTJ 1SANA 3G1MA 4IEJA 5FLMJ 1QPIA 4IHVA 3OSFA 2FX0A 4W1UA 3TW7A 1WH7A 3I4NJ 3CDLA 3S2DJ 2CU7A 4MLOA 4JX4A 2QCOA 2ID3A 1FIAA 2P81A 1O4XA 4M6VA 2HQ5A 4IHXA 2E2JJ 1YRNB 1JUSA 4RBOA 2MGQA 1FEXA 2DTZA 3HM5A 2JN6A 2JA5J 5EGOB 4X1EA 5M5XJ 3ZQFA 2JA8J 2COBA 2R93J 4AYBN 1ORKA 3HDDA 4MFEA 1MH3A 2FJ1A 1OJLA 2HOSA 1MSEC 2H1KA 3SFIA 1H89C 5F04A 1IRZA 2ME6A 1TC3C 3HBLA 3ZQIA 2M8GX 2O7OA 1JKPC 2YUSA 4A3KJ 2N8GA 1WGXA 4G12A 1NK2P 4AC0A 2AO9A 5E3LA 2M9HA 3WHCA 2GLOA 5GPAA 1VI0A 1TWFJ 4BXXJ 1G2HA 2DN0A 2M2EA 1JT0A 1CQTA 2DMUA 3A03A 2ECBA 1SFOJ 3BG5A 3HB9A 5IOYA 2K9QA 4S0HB 5K7FA 3OSGA 4A93J 5EG0B 2CUEA 4XRMA 2CRGA 4IHYA 1ZR4A 1HOMA 3JR9A 3GTJJ 1F36A 4B1RA 4CYCB 3JRFA 4A3BJ 5FKOA 3TP3A 1MNMC 4A3EJ 2W48A 5EYRA 3O8HA 3HEFA 1K61A 1ETVA 1HF0A 2L7FP 3GTGJ 1U78A 3S15J 2LFBA 2QF7A 1AKHB 1QRYA 5GPCA 4D7NA 4C3IJ 3BQZA 3BR5A 3QPLA 3SJMA 3W6VA 2DMQA 2X9DA 3FIWA 3MKLA 3HOZJ 3C2BA 5IP9J 1GDTA 4BBSJ 2HXIA 2DMNA 1B72B 2D5VA 1GT0C 2XSDC 1BA5A 1ITYA 1OCTC 2JA6J 5EF6A 4NDLA 2B63J 2JWTA 1RESA 3Q3SA 4XIDA 4XRSA 3A01A 3PM1A 1DU0A 2EBIA 2GM4A 1AU7A 5IYCJ 4A3JJ 2R7ZJ 5FKKA 3PO3J 1OFCX 5DTDA 3D1NI 1FIPA 1IJWC 5HODA 2HDDA 3ZOBA 1MBJA 5F0HA 3RZOJ 1OCPA 1RETA 3M3YJ 1ZKGA 1PUFB 3JRHA 3BG3A 2TCTA 2WAQN 3MN2A 2K9NA 4A3IJ 3OOUA 3B6AA 1XC5A 2LTPA 2HXOA 1QVTA 2LK2A 4M3EA 5EDNA 2E19A 4QIWN 2NS8A 1F43A 1ETOA 3BR0A 1JKRC 5M5WJ 3G1LA 5JLWA 1VFCA 2PMZN 1MSFC 3S1RJ 2WV1A 1IDYA 4B3AA 5BNGA 1POGA 3CQZJ 3IH4A 4UUSB 3K2AA 1JKOC 3JREA 5IYBJ 4ABZA 2ID6A 5F08A 4RDUA 1DU6A 2AHQA 3M4OJ 4JP0A 1Z77A 3RZDJ 2R5YB 1I3QJ 2DA6A 4DYCA 4A69C 1W0UA 2NVQJ 2JMWA 3HOXJ 4FE4A 2CQQA 4JX5A 3BTJA 1D5YA 2IAIA 1RR7A 3F0CA 2LR8A 2LVSA 5M3MJ 1S7EA 3Q0WA 3ZQCA 1ENHA 4MO7A 4XRSG 3ZQGA 1GV5A 4BY1J 2M34A 2XPVA 2O8KA 4BY7J 3JRBA 1JJ8C 4I6ZA 1MH4A 2KDZA 4D5FA 3FK7A 1MBEA 5E3NA 1MBKA 2CUFA 3QPSA 3S14J 3JRAA 2EZLA 2L9RA 1Y1VJ 2E1OA 3A02A 1IG7A 1B72A 3JRGA 3BG9A 4A3LJ 1FJLA 3LSPA 3TW6A 2EH3A 3TP0A 3GTMJ 3HOVJ 4JX6A 2MG4A 5C4XJ 3UKGA 2HOTA 2H8RA 3LSRA 4V2GA 1IUFA 3SDGA 1TWCJ 1Z0XA 5E3OA 1ETWA 1B8IA 3IV5A 2OF7A 2EZIA 5JLXA 3DEWA 4MIMA 3O8GA 5F27A 5E3MA 1LE8A 1UG2A 2X48A 2XGDA 2G0EA 1ZQ3P 2Y9ZA 1NTCA 3MVPA 1IV6A 3HGGA 2XRLA 3ZQHA 3S17J 1P7JA 2GBYA 4A3DJ 1JTXA 1PUFA 1H8AC 2Y9YA 3JRIA 5M5YJ 2MW8A 2JJ7A 4M3DA 2DMTA 5C3EJ 5J1YA 2I10A 1BW6A 1VNDA 3WHBA 5FKNA 2NS7A 2XB5A 3LSGA 1H88C 2NVXJ 5IP6A 3GBGA 3BR6A 3OIOA 4QSHA 5K7HA 2YU9J 1W0TA 3K7AJ 1T56A 2DA7A 4FCYA 3FK6A 2DA2A 4DZJA 1A5JA 3BTIA 1JJ6C 1U9OA 2XPWA 4DZPA 4C2MJ 1RKTA 3BR1A 2L7MP 4JYKA 1YRNA 4V2FA 1VF9A 3GTLJ 3DCFA 4BKXA 4D7MA 2OPTA 2E2IJ 5FKLA 5EGOA 2XPUA 2RAEA 5F0FA 2JK3A 2WB1N 4J19A 1GV2A 2ME0A 2NVYJ 3S1MJ 5F0CA 3BT9A 2K9SA 5IOZA 3S1NJ 4A3CJ 4DYQA 4HNVA 3JRCA 4M3GA 4XK4A 2TRTA 5IYDJ 2LY9A 5J3LA 1EF4A 2VI6A 5J1RA 4A3FJ 3G1OA 2R5ZB 2Y30A 4M3BA 1P7IA 3LNQA 4I76A 4EEFG 4AUXA 5EG0A 1BL0A 2VUMJ 3B6CA 4FTHA 3BTCA 3E7LA 1MBHA 1ETKA 1MBGA 1X58A 4CYCA 2MSYA 1I50J 3A01B 1JKQC 1UHSA 2LD5A 2FQ4A 3BQYA 1IC8A 2Y31A 4D5CA 1T33A 3S1QJ 2XGCA 3S16J 1ZTRA 1XG1A 5FLVA 1K83J 2CQXA 4MFDA
chains in the Genus database with same CATH superfamily
4XICA 2JUGA 3ZQLA 3JRDA 3S2HJ 3FZVA 2XDVA 3HYIA 3BP8A 3W2WA 3IH2A 4HDUA 3CDIA 2ECCA 1PJRA 3R4KA 1DGRM 1X4OA 3HRTA 3CUOA 4A3GJ 3GZ6A 1BIBA 4IQ4A 4HLYA 3MD2A 1FTZA 4LB6B 2ELHA 2DFIA 5EZGA 1RPWA 3EUHC 2VQHA 3NARA 1IW7F 1DPUA 3I59A 1YW8A 4FX0A 4A0ZA 4EQQA 4B4CA 2HYGD 5J40A 3ULQB 3DFGA 1JGGA 1U9NA 1U5TC 3LSJA 3IRQA 2KISA 2HYJA 4FASD 3BTLA 5A2QK 1IN7A 1X4PA 2JA2A 3BZ6A 3HRMA 2DDBA 2ZB9A 4QTRA 2XKOA 2UV1A 3DPUA 3VYUB 2VONA 4YG2F 4LB5A 2EZKA 5E1ZB 3V7SA 3GTOJ 4U0VA 1R1UA 2R0QC 1HDDC 1AOYA 2Y0SA 5FFXA 4DJAA 3E6BA 2QM3A 1LNWA 2CS3A 4M9SA 4RB0A 1LJ9A 5IP7J 2O03A 2MFZA 1Y6IA 2OU2A 2Z1DA 5ICGA 1QQIA 4IHWA 2HKXA 2CV2A 1Q1VA 2P0WA 3NAUA 1TZLA 1ZELA 3NWSA 4ZH4F 1G8XA 4LK1F 4RGSA 2KZGA 1PVEA 3RKQA 1SFXA 2DYRH 2EQRA 2GIZA 2P4WA 1YW9A 3GUDA 1D8JA 4ETSA 5CYVA 3S93A 1QBJA 2FEZA 3FM3A 3PNYA 3GCMA 2DA3A 2KIMA 2KL4A 2DA5A 1NH3A 3BG7A 4GRIA 2NVUB 3WTYC 3WU0A 1VQ8I 1YX3A 2L7ZA 1RKWA 2FQ3A 1EV7A 1JUMA 3VSLA 4II3A 5CKTA 3OS2A 3VFZA 1MJAA 2DBBA 2CMPA 2QGUA 2JVGA 1R36A 4LOCA 2DMPA 1O3RA 1ETQA 1MJBA 2VJIA 1GVDA 5FJ8J 4LGWA 2O9LA 2VPRA 4GO1A 3BR3A 5K5OA 1LB2A 1NK3P 1JTYA 1T0FC 2DOFA 2WA0A 3CDHA 2X6XA 3BCAA 4D1QA 4GYIA 4IHTA 1IRXA 3VPRA 1HLVA 1IO2A 2V4JC 1Y1WJ 2IW5A 2KIFA 1DDNA 1ON1A 2D1HA 1L3LA 3U9GA 4BJ6C 5FLMJ 4IEJA 1DP3A 5AIQA 3ZN0A 1WH7A 3BG6A 2HOEA 1K78A 3HSFA 1OR7A 2QCOA 2ID3A 3K10A 3WGHA 2K7LA 5HDNA 2HQ5A 2E2JJ 1JUSA 2HGCA 1IXRC 2Y48A 4ENKA 5L3CA 2JA5J 2M0MA 1ONVA 3AFHA 4A6EA 4F7ZA 3REOA 1ZYRF 2KPMA 4LFUA 3ZQFA 2JA8J 3QWLA 5DEQA 4OOIA 4AYBN 4BXUA 1QU3A 3E3VA 3FF5A 2AQFA 5KHDA 1D0ZA 1Z21A 3L2CA 1BC8C 4ZJZA 3S3MA 2H1KA 3Q9VA 3V8LA 4A5NA 1IRZA 1Z7LA 1SMYF 2ME6A 1TC3C 2WY7Q 3HBLA 4O3MA 1HQCA 2O7OA 2YUSA 2CUZA 4L9TA 4WCGA 3W2VA 2N8GA 4E7KA 1NK2P 4AC0A 2AO9A 2X6YA 1MNEA 3WHCA 5GPAA 1TWFJ 3OYKA 2Q0OA 4BE2A 4LIVA 2F5FA 2XVCA 3OOPA 3CCMI 4NUBA 5D6EA 5B5EC 3A03A 1K6YA 1CQTA 3LSTA 2KIUA 1ZAOA 2IGOA 1SFOJ 4KNYA 3ZGKA 1FOWA 1LDKB 1TW3A 2Z16A 3QU3A 2OBPA 3BG5A 4Y17A 2J5PA 5J4VA 3GZ5A 5AONA 4A93J 1S29A 4XRMA 4F52A 2JT1A 2L01A 2RN7A 1P2FA 4G6QA 4ANJA 3ZN1A 1PYVA 1JI8A 3R0JA 3G3ZA 5FRNA 2JVHA 5FKOA 3TP3A 5DM7F 1YITI 1R22A 4HV5A 2E7XA 2EK5A 2GA1A 2NOJB 2VBWA 3GTGJ 1U78A 3DBLB 3M9AA 2HTJA 1S7OA 2QF7A 2WBMA 4ZZLA 2GXGA 4CCOA 4U7DA 3BR5A 4QLCU 1Y39A 3RPUA 1XSDA 3MKLA 5HNFA 4E7JA 5IP9J 5B1BH 2O61A 3A1YA 6PAXA 1B72B 2FMLA 2XSDC 2W57A 4LITA 2WV0A 4XL9A 2EIJH 2V79A 1W5TA 1PP7U 3V42A 5EF6A 2B63J 2JWTA 4BDYA 2DYSH 4BQOA 2WTEA 3KLNA 2BEOA 2XF6A 2VJ5A 2IS4A 1S8NA 2A6EF 3LA3A 3R6SA 2R7ZJ 3PO3J 2OQGA 2ZFWA 1OFCX 4L5JA 2F5EA 5DTDA 3D1NI 2K27A 4IJAA 3TMOA 2DDAA 2Q8KA 5HODA 2HDDA 3MFKA 3RZOJ 1OCPA 2K02A 1Z3XA 3M3YJ 3KZZA 3WTZA 1D8KA 1ZKGA 2ZSHB 3JRHA 2M7BA 2WAQN 3SZTA 4NC7A 2BHZA 3VSKA 3W6KB 4IO9F 3R60A 4D0PA 4AWXB 3UNGC 4UUVA 1F4KA 3LA2A 2OCEA 2LYCA 4EMSA 1OYYA 4M3EA 3G4SI 3BZKA 2CQKA 2W82A 2MD5A 1I1GA 3HUGA 1X3WB 1JKRC 2A69F 2ESHA 1FSHA 5LHHA 5JLWA 1EKEA 2PMZN 1GLNA 2J5OA 4NQWA 1FYLA 1IDYA 1POGA 4UUSB 1DQUA 5J6XA 3TGNA 1VQLI 2LOOA 4G6DA 4IRGA 4ABZA 4IOAF 2M45A 2BVLA 5F08A 3E6CC 4NC6A 2AHQA 3JTHA 2KRCA 3M4OJ 1WZ2A 2Q2EB 4JP0A 4YEJA 1R7JA 2ZXHA 1G59A 1I3QJ 3E0JB 4DNCA 2O8XA 3I58A 3BTJA 3BLYA 3X2QH 1ZGAA 3ONQA 2VBXA 4H4KC 4U88A 2PJRB 2DPDA 3U2RA 2QQ9A 3MZHA 4BY1J 3F9KA 5K1YA 1FY7A 3DKWA 2XPVA 4LG0B 2GZWA 3M8FA 1JJ8C 3K4CA 3R61A 1QZEA 2KDZA 3CC7I 2PI0A 4QPQA 1YOVB 2PJPA 1MMSA 1P4WA 2V1UA 2P8TA 3DV8A 4BEHA 2ZO4A 2HNHA 2CW0F 3M1CA 2OC6A 4XLNF 4HQMA 1YW7A 1OYWA 1B72A 2X51A 3ZXSA 4DIQA 2EH3A 3P5JA 3GTMJ 3PL8A 4EJTA 3K70D 2MG4A 4UY8I 2HKOA 5ERIA 3BJOA 5E3OA 1TWCJ 1Z0XA 2OZ6A 1E2XA 3ZRGA 5FLXZ 5JLXA 1YFHA 1LVAA 1N77A 2RQPA 5AIPA 5F27A 3UR3C 1UG2A 2X48A 5CVRA 3MVPA 3P9IA 3HHGA 1G6NA 3S17J 1MMDA 2L4MA 3F8NA 1H8AC 1REPC 2Y9YA 2B9SA 2ZBKA 3WGIA 2LH9A 4CUGA 2L02A 2AXTC 4RM2A 1VNDA 2LF7A 3OYAA 3BWGA 3GO5A 5JHUA 4OU0A 5FD6A 2VJJA 1H88C 1IXCA 4QSHA 3JCUC 2EA4A 5K7HA 4KT6A 1W0TA 4UV8A 3DWLE 3KEQA 3FK6A 1A5JA 4P5OA 4EVIA 4HSTA 4KFCA 2DFFA 4BQNA 2XAHA 2XPWA 3E97A 3O6BB 5LFAA 3BR1A 2EA2A 2UXXA 1KU9A 4CCNA 1YRNA 3GTLJ 4D7MA 3IHUA 1BI2A 5FKLA 5EGOA 1RIOH 2RAEA 5F0FA 4Z6YA 1TQIA 2WB1N 5FLXK 3L2WA 5DDGA 2NVYJ 3I71A 3I5UA 1JHFA 2WADA 1EJ9A 3ERED 3CUQC 1W4MA 2E1NA 1IAWA 2CSOA 4LG0A 4GGGA 1KYWA 4PK4A 2L2OA 4BYYA 4H0EA 1LEBA 3AAFA 5J3LA 1EF4A 2IJLA 4B8XA 1BIAA 4KITB 5J1RA 2A05A 2VXDA 4A3FJ 3K1MA 2JQ7A 3NQOA 3RSNA 4RAYA 1FX7A 1XDSA 3LNQA 2F5VA 3PNTA 3MQ0A 2ZSIB 1SD6A 2JSCA 3PFIA 2VUMJ 3B6CA 3WU2C 1E17A 1WKMA 2GIVA 3DU6A 1IXSB 3KYDB 2XASA 2MSYA 3A01B 2ADUA 4BHPA 1UHSA 4K2EA 2KDOA 1IUYA 2BBYA 2LD5A 1IC8A 2MABA 4LIUA 3M07A 2VJ4A 2DQLA 5DM6F 1K83J 3RZDJ 2R7DA 2VT3A 4JBAA 2NOGA 9ANTA 4A3MJ 4Y52J 4DQ2A 1BM9A 5EJCA 2IBDA 4DYRA 3MKWB 1IDZA 1QHGA 3G6EI 3IL2A 4DW6A 3I55I 3CC2I 3V7CA 3TEDA 1WJAA 2E2HJ 1JT6A 2L9SA 2OCCH 5F1JA 2ZKZA 1U2WA 3RQIA 5K7ZA 2XB0X 3GWZA 5J47A 3BC8A 3DLLF 2E1MC 2IS6A 1FOKA 2M1BA 3FXUA 3J81Z 4Y13A 5HLGA 1LDDA 2K3PA 5BS6A 4ENNA 2A5WA 3IWZA 1B1BA 2JA7J 2MH9A 4CSWA 2NS0A 3KP3A 5FFZA 4C3HJ 1TWHJ 1B4AA 2P7CB 3M1EA 5HS9A 2A5YB 1E3PA 3VDXA 1X1DA 4M3FA 3WE3A 4I7HA 2UXNA 1PP8F 2ZFUA 1N78A 3TQNA 4I2OA 2CJJA 4PJLA 4NHJA 4X6AJ 1U8BA 3ABMH 5IT3A 3V8KA 4MEYF 2R92J 1EA3A 4XLFA 2GOMA 1T95A 3TOBA 2EPFA 1Z1DA 5JVTA 4FQGA 1WH5A 2ACJA 1FP1D 4XLCA 1HSTA 2DA1A 2DCEA 4BBRJ 2PEXA 3L1PA 2P5KA 4KIBA 3GFLA 1IZ1A 3HGYA 5HDGA 4RLFA 2H09A 3IKVA 1V3FA 1AHDP 2ZC2A 3L2VA 4UB8C 2GWRA 3J81K 1QZYA 5GTIC 3K4BA 1Z3YA 2GXBA 1W5CC 4M9ZA 2IEKA 4EJVA 2QBYA 4ZYAA 2DOEA 2Y69H 4YRVA 2R5YA 3HOYJ 4E7IA 5LGTA 4KT5C 3CJRB 3CCYA 1GHCA 2DA4A 2QENA 1YHQI 4UUTA 1RI7A 2XV4S 1OR7C 5FB2A 2RNGA 1J09A 1R1TA 2PG4A 2QQAA 4EATA 3WU1B 1R00A 1R9TJ 3K4NA 1LQ1A 3HSRA 2R7TA 1U6GA 4RB2C 2V6CA 1ETYA 2LMDA 2XUBA 2L0KA 1O3TA 3FXQA 3H5AA 3CF5F 3VYTB 2VB6A 1J59A 4QPOA 3VYRB 3DLAA 2AQEA 2EILH 2VKEA 1MBFA 5HDKA 1FWZA 1BR1A 4CCJA 1ZG3A 4KYWA 2Y2ZA 1U3EM 2LDUA 3ZQ7A 1FTTA 2ZXWH 1Q1HA 1JUPA 4S04A 5LGUA 3CMYA 2RVCA 2BY1A 3I0TA 2EV5A 3K2ZA 3L2QA 1SANA 1IN8A 3DTIA 3G1MA 2HFHA 4KUMA 3OSFA 4W1UA 4A5MA 4IL6C 4YFXF 2W00A 4LLLA 3S2DJ 3CCQI 1J7KA 4ESJA 1XTAA 3SQNA 4HDVA 2P81A 1O4XA 3KP4A 4M6VA 4GYGA 1SFUA 3J7AO 5GAHJ 3S3NA 2MGQA 2OA4A 2FMYA 2DTZA 2JN6A 1TW2A 4RB3C 2WC2A 5CQEA 2COBA 2I5UA 3HDDA 4MFEA 1MH3A 3DU5A 1W1WE 3FMQA 1OJLA 1OPCA 5E8IA 3ASNH 5F04A 3OYFA 1G3YA 2K86A 2M8GX 1ZG5A 4EGYA 3FXJA 3T8TA 1KQ0A 2BE5F 5HLIA 1O3SA 4ZYGA 4AU7A 3OMYA 4BXXJ 3BROA 4ZC3A 2PMHA 1E0EA 2H6CA 3ZR8X 1ODDA 2G9WA 4A6DA 3HB9A 3HJEA 2EB7A 4KMFA 2K9QA 1X1PA 1AWCA 2CUEA 5GAEJ 2LRDA 3D5SC 2YPRA 1TL8A 3QOPA 4DBRA 4IHYA 2B0LA 1HOMA 1RC9A 1F36A 1W7PA 4CCKA 1KU2A 4A3BJ 3JRFA 1W36D 4FX4A 1R71A 4B3XA 1G3TA 1WJBA 1BR4A 1YJ9I 4BL0B 2GOXB 4A3EJ 3CO7C 1HKQA 2K85A 2W48A 5LHIA 2M4KA 2DW4A 1VZ0A 2RDPA 3F8FA 1V5GA 2LFBA 1AKHB 3PIOF 3EUAA 2HWVA 3SHFA 4N4OB 2VN2A 1VQKI 3JAMZ 2LSOA 3QPLA 1I27A 2DMQA 1IN4A 2HQAA 2QVOA 3J7ZI 1XGNA 3HOZJ 4XKWA 2ZMEB 4BBSJ 2DMNA 2E34A 4JQFA 2W24A 1ZRCA 2ELJA 2EFOA 2E5NA 3KYCB 1VTNC 1OCTC 3CZ6A 3DPTA 2XGXA 3HHHA 5GAGJ 1BOAA 5HLHA 2JA6J 1X1CA 2LF8A 4RGXA 3RIRA 2BZTA 1LUJB 3RDIA 5LLQA 4XIDA 4RAZA 3HRUA 4HBLA 2MH2A 1F9NA 2XIGA 3PM1A 3MZYA 3DPLC 2K9MA 2GM4A 2V1NA 1VQ6I 2EV0A 4OIRF 3ZMTA 3OYCA 1SD7A 2F5CA 2DT5A 4BE0A 3K6GA 4BS9A 5TISC 3ZOBA 3OYHA 2M7AA 2Q1ZB 5F0HA 2BYVE 1XMKA 4CH7A 4BGDA 2QSFX 1PUFB 1YJWI 2DAOA 2JUCA 4OMZA 3COAC 2KFDA 3T8RA 3BDDA 3PNVA 2QEXI 3W2AA 4I0BA 2LTPA 2O0YA 2PX9A 4HF1A 1T8IA 4Q48A 4BHBA 4QIWN 1F43A 1XMXA 2WAEA 4II2A 3J7AY 4ITVA 4HAMA 2Y0MA 3S1RJ 1SVMA 5CLSA 2EFWA 4EM1A 2X1DA 3OYEA 1U5TB 2A6TA 3IH4A 1ZLKA 3K2AA 5CJ9A 3EQLF 3TL4X 2K4JA 3ZMZA 4HX8A 4CO8A 1S6LA 1TNTA 4V19K 4CCLA 1IN6A 3TO6A 4RDUA 3LSHA 1Z05A 4ZYEA 1VQ7I 2LBFB 3MEXA 3FHZA 1Z77A 2XF7A 4WXHA 4UHTA 3SYTA 1W0UA 2NVQJ 5DD8A 1YG2A 2JMWA 3ERMA 4FE4A 1VQOI 4I02A 1FMVA 2FSWA 2IAIA 1SVLA 3R0AA 1FPQA 2D1VA 2KIQA 4IX7A 2XAQA 3Q0WA 4XRSG 1GV5A 1W36C 1MH4A 4E4HA 4EJWA 4M6YA 3NRVA 3KX2A 4DBQA 1KA8A 5E3NA 3I9V2 3QPSA 2NXNB 5DV5A 3OV8A 3LFUA 2L9RA 4KISA 2ZMEA 2LY2A 2H8WA 1X3UA 2LNBA 2AS5F 1XCBA 3JRGA 2QLZA 2JSPA 5DCFA 2M30A 2CYYA 4BDZA 1HBXG 3B02A 2PQ8A 2DFEA 2RC4A 3DTKA 4MQVA 3F21A 3LSRA 3F8CA 4V2GA 2D45A 2Z33A 3WODF 1ETWA 3JW4A 4P9UA 4P9FA 1T98A 2X1EA 2BGCA 5B66C 4XN3A 4MIMA 3CTAA 3WG7H 4HF0A 5H20A 5CVIA 3E6MA 2Y9ZA 1I39A 5HVQC 3HL2A 2R4GA 4EM2A 2X85A 3RYPA 4CHUA 2W84A 1S72I 2FNAA 3ABUA 1PUFA 4G94A 2MW8A 2JJ7A 1P4AA 2DMTA 3OR1C 4M3DA 4XONA 3DBRB 2QUFA 3QP6A 2R7XA 5J1YA 3MMYB 1J2XA 3WHBA 1QGPA 3OYIA 5DUIA 2XB5A 3OIOA 1M1EB 2VBZA 4HX4A 2IGKA 1T56A 3LA7A 4FCYA 2DA2A 2STTA 3BTIA 3C2GA 4B44A 1U9OA 1V4RA 4E7SA 3LAJA 3U1KA 3F72A 3KPHA 3K4JA 1FYKA 3QPTA 3K1NA 2L7MP 1YS6A 1WWXA 4R8HA 4V2FA 2H1LA 2XSJC 1TT0A 4I98B 2OPTA 2E2IJ 1OISA 2XPUA 1HW5A 4HF2A 1GV2A 1SFKA 4F91B 4NNJA 1I3AA 5GTHC 3MKYB 2CFOA 4GXOA 3HTUA 3T1BA 2ZJRF 4E7HA 3S1MJ 1ZGJA 1ACIA 2OV7A 3BT9A 2K9SA 1R5HA 3BJ6A 1ZRDA 1TBXA 5LRSA 2AXLA 1TQMA 2LC2A 4ASNA 3T5XA 5BPDA 2KRHA 4HA8A 1KZHA 4M3GA 2TRTA 2DXIA 5IYDJ 5TJJA 4OIPF 1EH7A 1ZARA 2DJIA 4HZFA 4XLHA 2PMUA 4PCQA 2L7KA 4BHCA 3CP2A 4R79A 3CMMA 3FDYA 2M5WA 4RLQA 2R5ZB 1BC7C 1SFEA 2DFHA 2BV6A 2CWEA 2A6HF 2LREA 2VXZA 1V5EA 1P7IA 3ABLH 3ECOA 4RA2A 3PFYA 2KRFA 2P5VA 4NBQA 1DP7P 3U1DA 1SC7A 1GVJA 3WTWC 1HA8A 4N4NB 3BTCA 3E7LA 4U0WA 4ON0A 5CPRB 3MKZA 5LD2C 1XPXA 2IA2A 3FMRA 1T39A 4N0BA 1I50J 2L4AA 4HRIA 1Y56A 3KZIC 1BOBA 2ZXIA 2FQ4A 3BQYA 1UFMA 2Y31A 1UG0A 1T33A 4PUSA 3FKJA 4D5CA 1XG1A 1S9HA 2KQRA 1UZCA 4HX7A 1T38A 2O6GE 1CF7B 1X2NA 5D5VB 4MGRA 2X0LA 3PUBA 4PDKA 2EFNA 5FKMA 1FLIA 5DUKA 2VQCA 4L0YB 2Z99A 2K40A 3PSFA 2RQQA 3BY6A 4F55A 5IPAA 2HPMA 1STZA 4HOBA 1T2KA 2UUZA 3CCVI 2HQRA 2V1XA 1XS9A 3H0GJ 3SEZA 1G3SA 2ELKA 5J8CA 3GYHX 5LGNA 1IGNA 3GMEA 2VLAA 4HSRA 2VQLA 3LSIA 2YX7A 3GVAA 1W7PD 1BJZA 1P4XA 3A0HC 1F5TA 3Q0UA 2BOLA 2MYSA 3PO2J 5C44J 4IRIA 3KP6A 1Z9CA 2CGPA 3OL4A 4P55A 2V9PA 3AL0B 2FF4A 3NEUA 2HOAA 4HG2A 3EUKL 2OAZA 1O7FA 3QYEA 5GP9A 2PLYA 1U8RA 3RCOA 1K4SA 3K1PA 2Y0SN 4OMYA 3V7RA 1ZGWA 1WJDA 1A36A 2ZNYA 1D0XA 2NNNA 1APLC 1SAUA 3I4MJ 5E18F 1R1VA 3BCBA 3CCJI 2NNYA 2HDWA 1UMQA 3C18A 1FZPB 5L3DA 1LEAA 2M0CA 4UUSA 2CQNA 1BW5A 5B1AH 1WJEA 2R5ZA 1XGMA 1DGWY 2XROA 3WTTC 4IRHA 2V9VA 2FD5A 2BW3B 1JGSA 5DYMA 4M9XA 1QVUA 5M3FJ 2Q2EA 3NWTA 2PN6A 2IGNA 1GUUA 3I4PA 4XLAA 1QO0D 3TOAA 3EETA 2CQ7A 5J1UA 1HDPA 1IF1A 1B8IB 3D5LA 4FE7A 3OS0A 1H9TA 2LLKA 1MGTA 3LOCA 1SAXA 1EH8A 4HNUA 1WCMJ 2OTJI 5C4JJ 4YIFA 3DP7A 2PJRA 4I99C 2XAGA 3G73A 1LE8B 3E6DA 1UB9A 3KCCA 4B09A 5HS7A 3ELKA 1VQMI 1E3OC 4CA0A 1P92A 3VWBA 2FE3A 1ZK8A 5LHGA 3AKZA 3CCRI 2RGVA 4KA4A 4ENJA 2DT7B 2HTSA 2L9NA 3GFMA 2Z9OA 5EZHA 3OY9A 2YX4A 5EEAA 2K3FA 1LFPA 2DJNA 4LG3A 1VQ5I 2XKPA 4KIGA 4XMYA 3N97A 2RKHA 1KGSA 2R7QA 4XR6A 4IHVA 2M4GA 4Z2YA 2GA2A 5DCMB 3TBIA 2STWA 4BU2A 3N4MA 2ESNA 4MLOA 1R6RA 2E36A 1FIAA 4JOMA 4IHXA 2W4SA 3MZ8A 2OZUA 4CZCA 4O5VA 2F2EA 4X1EA 1FMWA 3EYYA 2HVQA 3RI4A 4M71A 1J5YA 1B59A 2MC4A 5BMZA 3SEQA 4OWRB 4BJTA 2QZ8A 1I1SA 2IA0A 2HOSA 1K7AA 1MSEC 3SFIA 5ICFA 1Z91A 3W6JB 3WGGA 1LPQA 1H89C 2ISZA 3CC4I 1A31A 1N75A 3DEEA 1BBYA 1JKPC 4P96A 5TGTA 5J8FA 2DODA 4WF2A 5CVJA 1TLHB 4G12A 2CH0A 2CV1A 2GLOA 2M9HA 1VI0A 2M87A 4CYDA 2YR2A 1G2HA 4FHTA 3CF2A 5L3EA 1FNNA 2DMUA 4B48A 3L2RA 3S2WA 2ZJ2A 3WG9A 2HS5A 2FNPA 3KZYA 4S0HB 1LDJA 5ICCA 4MQ9F 3ESWB 5D6FA 5K7FA 1WVRA 5EG0B 3OSGA 3QYBA 2BXZA 3J7YJ 1Y0UA 1ZR4A 3JR9A 3HC7A 1D5VA 4B1RA 4CYCB 2JZYA 1IRGA 3HKZA 1VQ4I 1A04A 3SZGA 3QRFF 2Z2SB 4O6JA 3CMEI 1QA6A 3PIPF 3DBHB 1K61A 2QWWA 1ETVA 3RPUD 3CUQB 1MDMB 1USTA 2W25A 2KKOA 4IKFA 1QRYA 2QQ8A 1QHHD 4D7NA 5GPCA 4C3IJ 3BQZA 3DTEA 3WTVC 4UVAA 3SJMA 3AG1H 1BI1A 2X9DA 1V55H 3S8PA 2HZDA 3CESA 3FIWA 1X1BA 3CCLI 3SZPA 1ZG1A 3C2BA 2HXIA 1UHWA 2VE8A 1GT0C 4B47A 1BA5A 1ITYA 2CG4A 2QYOA 4F93B 1GXPA 1HW2A 4EGZA 2E7WA 5ED4A 4OINF 3I59B 1YYVA 3OIQA 1RESA 3PUFA 4G7HF 3ECHA 3KIOA 1R23A 5LEJA 2NYXA 3A01A 4IPAA 3QPHA 2EBIA 1AU7A 5IYCJ 2OTLI 2FOWA 4A3JJ 5FKKA 2WAQA 1HW1A 4PJJA 4RAGA 2FBHA 1K6OA 3OYMA 3L2UA 1IJWC 2W1OA 1HC8A 3IAS2 3C2HA 2FXAA 2BY3A 1MBJA 1A6QA 1RUOA 2ISYA 3KETA 3E1SA 5D4SA 3RKWA 3TO9A 3DQVC 3BG3A 1Z67A 2TCTA 3BOQA 3AG3H 1OCOH 1R5GA 2K9NA 5KAIC 1HKSA 1WJFA 2JRMA 3OOUA 4A3IJ 2L54A 2HEOA 3B6AA 1XC5A 1BN5A 4U87A 5EDNA 3OYLA 3WTXC 3Q5FA 3ZCOA 3CP8A 4LK0F 4BQQA 3CCEI 3BR0A 2E1MB 3ISPA 3DEUA 4MHGA 3CMAI 5M5WJ 4ZTFA 1RZ4A 2FOKA 1MSFC 4YIRX 2ICWG 3LSKA 3QODA 3QU6A 1RNLA 5BNGA 4BE1A 1JKOC 2ZMEC 2MC3A 1VQNI 2HYFA 1Z6RA 1C0WA 2OJED 2ID6A 4XOTA 1CGPA 1DU6A 2MLGA 1B9NA 1XMAA 2FBIA 3CJNA 2DK5A 5IT9Z 3F3XA 4EV0A 2VOPA 3ZMUA 3HOXJ 4I09A 3HRSA 4JX5A 5CVVA 1FOYA 3V4GA 2VE9A 1D5YA 2V6EA 1ZH5A 3N05A 2R3SA 3HZJA 2LR8A 5M3MJ 1S7EA 1IN5A 2F5DA 3ZQCA 1J0RA 4MO7A 5H2FC 2O8KA 4Q4ZF 1MDMA 1TQPA 5KCMA 3JRBA 1YX5A 4ZDPA 3IP4B 3BPVA 2WAFA 3FK7A 3FXOA 1NHAA 2MLKA 4L9VA 3I56I 2KHMA 2V26A 5IY5H 2CO5A 2RNJA 4XLPF 3JRAA 4L18B 4KJZA 1Y1VJ 2E1OA 5D5XB 1IG7A 3LFKA 4AVPA 4A3LJ 2CV0A 5D5WB 4WWCA 3TW6A 3KEOA 3LSPA 3HOVJ 1UHMA 2IPQX 3DKYA 3G2BA 4JX6A 4CZZA 4ENMA 5C4XJ 3UKGA 2HOTA 2P6TA 3MCZA 5K5RA 1IUFA 4XKBA 1FT9A 3ZMDA 2OF7A 2DTRA 3IV5A 3IAM2 4XORA 3JTGA 1K78B 3KP5A 2EZIA 4HV6A 3DEWA 2FUG2 5IT9K 3H1CA 5EEHA 2A07F 1JHHA 3RKXA 2LKPA 2XGDA 1ZQ3P 2FU4A 1KU3A 1F1ZA 3A4CA 1NTCA 3F22A 3RJPA 5H6RA 3FXMA 3ZQHA 4XNFA 1DUXC 1KONA 1V54H 5JHFA 5HOOA 4A3DJ 1SD4A 4L9JA 2A3SA 4KIFA 3JRIA 3OWTA 4PJ0C 5M5YJ 4RAFA 3LL7A 2VKHA 4X0GA 3HOTA 1IRFA 1KYZA 5FROA 3HTSB 2DI3A 3I3LA 2NS7A 3H9GA 2NVXJ 3LSGA 3BR6A 3D0SA 3EDPA 5DD4A 3MWMA 3U21A 3K7AJ 4WX9A 4BXFA 3GFIA 1SVOA 4C30A 4A12A 2L5QA 2FBKA 4C2MJ 1ZHFA 3M7GA 2WB1A 2NRAC 1BI0A 2QKLB 1D1AA 4UXNA 3RPQA 3OYGA 1S5LC 2XAFA 4JYKA 3P9KA 1FBSA 3KLOA 4E70A 1LKXA 3CD6I 5D5UB 4CCMA 4J19A 1T08B 4KN7X 5ILSA 3FXKA 3FHNA 1AA7A 4XRFA 4PFPA 4U7BA 2P7VB 3SDBA 4IXAA 5F0CA 4XKCA 5IOZA 1LVKA 4DYQA 1S7AA 3JAMK 1PDNC 2KLOA 4HNVA 3K0LA 4A0YA 1HXDA 2XAJA 3FXRA 5L3BA 2QA4I 2QSHX 3IKTA 1B6AA 4L9NA 1YI2I 4MTDA 1Z6TA 2VI6A 2EWNA 3HPGA 3L9FA 1IV8A 2Y30A 1MW7A 1X19A 1YQAA 5E79C 4I76A 2F4IA 1BI3A 1FSEA 2OD5A 3MAJA 4RGRA 4FTHA 4OAYA 1QPMA 2K4BA 3VYSB 4EJOA 1MBHA 3LMMA 4YFKF 3P7NA 1MBGA 2ZXJA 2R7WA 2G7UA 3ROUA 3GF2A 2MBFA 2XRNA 2Z3YA 1JKQC 3SFZA 1E3HA 2HPIA 2XGCA 3S16J 1ZTRA 2I8DA 3KP7A 2E5ZA 2CQXA 2E35A 1AKHA 3FKIJ 4HYEA 4FISA 2P5LC 1OKRA 2UWMA 2W7NA 4G6TB 3VB2A 3QOEA 1TP4A 2R7RA 2WY8Q 5ILVA 3FISA 5K5QA 4J01A 2R7FA 1L0OC 3L09A 1ERDA 2ZCWA 3VODA 4KICA 1W5SA 4PGGA 2V7FA 3JSPA 1TWGJ 2BY0A 1Y0NA 4RGUA 4TV7A 4KMUX 3GZNB 3KE2A 4IVNA 5ILUA 3HUGB 4S05A 1SEUA 1HCRA 2KZVA 4YELA 1FOXA 2HVRA 3GLXA 2XGEA 5LBQA 1WI3A 3E5UA 1NG7A 2R7OA 4NQWB 4BH9A 3OYNA 2E1CA 3Q0VA 1UJ8A 3PSIA 2VKVA 4PGHA 2IA1A 3F6OA 3IH3A 4C2UA 3K4KA 4M6XA 1WJCA 4LJZF 3LQQA 5JFRA 1A6IA 2RV8A 3HOWJ 1WPKA 2LP0A 4G8XA 1D3YA 2EZHA 1OCZH 2ZJPF 2KT0A 3RQ4A 2YS9A 5FO5A 2L9VA 2VIXA 2HI3A 3GTPJ 3HSEA 4G9YA 2X1CA 2KP6A 2LKSA 2LKXA 4WK8F 4Q5SF 1SD5A 1LFBA 1Y8QB 1MJ9A 1I6HJ 2K9LA 3LQRA 4BJ5C 1TWAJ 1XCVA 2LY1A 2VKDA 3TO7A 3KFWX 3OIPA 1X2MA 3EUHA 1KQ9A 1J75A 3HKZN 4W97A 2KMUA 2HZTA 4ZTJA 4M73A 3H3UA 2HQNA 1U5TA 3ABTA 4PSWA 4BEHB 4C3JJ 4ZYHA 3H92A 1D0YA 5DS9A 5LEKA 3DXJF 2LBFA 1MIJA 3OYBA 3OR2C 3J80Z 1KQ8A 3S32A 3QYFA 3H3ZA 3CCSI 1P9QC 4Y7NJ 5FD5A 2JPBA 3GTKJ 1X3ZB 4IZZA 3BR2A 1OLTA 2DU9A 2HVSA 3K4MA 3RKYA 3H3VK 1O57A 5E1WA 3QQAA 1YS7A 4LD5A 1LFUP 4PZJA 5EEGA 4LLGF 1R5ID 3DF8A 3EYIA 4BNCA 1ETXA 4KN4X 1DPRA 1A35A 1G3WA 2F6CA 3C1DA 2R7UA 5KAFC 4OAZA 1ZR2A 3IUOA 4GFBA 3AL0C 1R58A 4OIOF 1VQ9I 1MD0A 1Z7UA 1MMAA 3FMSA 4N9HA 3FWEA 4J00A 1HSJA 1OQYA 2R7SA 3I54A 4XSZF 2PBIA 1YTYA 3HG9A 3HOUJ 1ZREA 5CQGA 3GTQJ 4ZDLA 4MTEA 1KU7A 1JXSA 4E7LA 2EJRA 3IWFA 2Y75A 1H0MA 4BACA 3VEPA 4L5EA 2X6OA 3BZCA 2NVTJ 3WTSC 4HEA2 3WE2A 2H27A 4AIKA 1UCRA 4YIIA 2G7HA 5JI6A 1QPIA 2FX0A 3TW7A 4EJUA 2GXAA 3CDLA 1QZZA 2CU7A 2VQGA 3Q9SA 4JX4A 2FA5A 3TDZC 3I4NJ 2VODA 2XAUA 3GXOA 3GFJA 3J80K 1TTYA 4M74A 2VOOA 2V9KA 3ABKH 1YRNB 4AD9A 4XQFA 1S3JA 4RBOA 1FEXA 1O7LA 1FBUA 2DQRA 4FETA 4IOCF 3HM5A 1MMNA 5EGOB 1QNTA 5TRDA 5M5XJ 4FT8A 2E71A 2R93J 1ORKA 2EFPA 2FJ1A 5GADJ 4R1HA 1VQPI 1T0FA 4UNOA 5D8KB 2ZNZA 2VC1A 2VT2A 3KP2A 4XKVA 4Q47A 2QQBA 3ZQIA 3FBIB 4UVBA 3ZMVA 1U0JA 3I64A 4JK1X 4NC8A 3OS1A 2XC7A 4A3KJ 3A2KA 2FRHA 1K79A 1WGXA 2GQQA 1FBQA 3OYDA 1ULYA 5E3LA 4XLEA 4RB1A 5BPIA 1K4TA 2DN0A 3AG2H 3T0YA 2M2EA 3BPXA 3E5QA 3RTRA 2DK8A 1JT0A 4CGZA 2ECBA 4HLXA 3H5RA 4Y4RA 5L3GA 1HKTA 3PJRA 4G7OF 4YFNF 1RUNA 5IOYA 4LLNA 4HNTA 1OCCH 3LSMA 1YIOA 3HXLA 2P6SA 2JRTA 1OYIA 5CVUA 2CRGA 4OIQF 1R4NB 3HPHA 2DOAA 3F8BA 3GTJJ 2X6WA 3WTUC 3GW2A 1MNMC 2MA3A 2YU3A 4IHSA 3GX4X 5B3SH 1MKMA 5EYRA 5F64A 3O8HA 4QWQA 3HEFA 1HF0A 2L7FP 3RYRA 2LG4A 3S15J 1R49A 3ZQQA 2VL8A 3OL3A 3GLLA 1UELB 4IQJA 2WWYA 4AIHA 2ETHA 1OCRH 2B7EA 2TDXA 2KJBA 3W6VA 5FRMA 1WQ2A 1R4MB 3HOSA 1Y8RB 1GDTA 3VOEA 4U0YA 4N9IA 1XGSA 2L3DA 2D5VA 3O3KA 2V1DA 2F4MB 4WXDA 3V8JA 2F48A 2BHYA 3CLOA 5H6QA 3F23A 1XX5A 4NDLA 3CLQA 3L7WA 3Q3SA 3PQKA 2X4HA 4XRSA 3TKYA 2A61A 2VBYA 3IC7A 1SMTA 1DU0A 5F6FA 1EH6A 1X1AA 2DLLA 2IS2A 3FXLA 1YE9A 2IP2A 4RMNA 1XSXA 3PQJA 2HDCA 1BR2A 1FIPA 5BQTA 3K69A 4IF4A 1V5FA 4XBFA 1RETA 1CF7A 4C2TA 2CFXA 3ML6A 4PSXA 2EIMH 2XHKA 2D2WA 2VC0A 1MZBA 2EFQA 5BOXA 1WJ5A 4AIJA 3MN2A 3H36A 2MD0A 2XF5A 5E1XA 4D9JA 2BY2A 3H9JA 1XN7A 1WI9A 1B9MA 2HXOA 1QVTA 1I5ZA 2LK2A 2E19A 3FM5A 4E7ZA 2NS8A 5JR3A 1YLFA 1ETOA 3G71I 3G1LA 1VFCA 3SXYA 4UV9A 4UB6C 2WV1A 1RRJA 4B3AA 4ESFA 3CQZJ 4AYBA 3H5NA 4DOZA 3JREA 1USSA 3DKXA 3ASOH 3GEZA 4PFOA 5IYBJ 4KDPA 5D8LB 1WHUA 2HU9A 4DGWB 2CUJA 4L0ZB 4HQEA 1WRJA 2GAUA 2QBYB 1TT5B 3F6VA 2VASA 2R5YB 1XGOA 2DA6A 4DYCA 4A69C 4GDFA 2HR3A 3I53A 3CJTB 4BUPA 2CQQA 4E6KG 4RS8A 1RR7A 1WFXA 2M8EA 3F0CA 5E20A 2LVSA 2H94A 4CICA 4M72A 1ON2A 4MEXF 3K70C 1XSVA 4XM3A 1ENHA 3ZQGA 1XD7A 5L3FA 3F8MA 1N25A 2M34A 4BAYA 4BY7J 4I6ZA 2K5CA 4AM3A 4D5FA 2BVMA 2DPUA 1I6XA 1G4DA 4L5IA 1MBEA 1PUEE 1MBKA 4F3QA 2CUFA 3D5RC 3S3OA 3S14J 4NB5A 2EZLA 3EPZA 3K9TA 4MNUA 3A02A 3LAPA 2BW3A 4LMYA 1YO5C 1UAAA 3BG9A 5LRRA 1FJLA 2RREA 2VPLA 1XDUA 3TP0A 1RR8C 4ZYDA 3C7JA 3H0DA 2H8RA 1P6RA 3W3CA 5JVGF 3KEYA 3SDGA 5FGMA 4Y33A 1B8IA 3KYLA 2R7VA 2IXSA 3CCUI 2OQRA 5KNLA 5ICEA 2IGMA 3L00A 2IT0A 4XN0A 3O8GA 1LE8A 5E3MA 3FX3A 2G0EA 2COMA 3P9CA 1IV6A 4XSXF 3HGGA 4ZDOA 3O2PE 1FC3A 2XRLA 3OYJA 5HLTA 1P7JA 2GBYA 1JTXA 2F4OB 3ZMSA 3QP5A 2BXYA 1OMIA 3TDUC 2EIKH 5KVRA 3QAHA 4AVZA 5J4YA 5C3EJ 1ZRFA 3CO6C 2I10A 1BW6A 1TNSA 5FKNA 1J9IA 4Y3OA 3M8EA 3H35A 2JTVA 4PJNA 4ESBA 3BJAA 3E5XA 5IP6A 3ZP5A 3GBGA 1T6SA 4CXFA 2YU9J 1O3QA 2DA7A 3FBNB 3ZPLA 4DZJA 1JJ6C 2IRFG 2CW7A 5DCMA 1MMGA 2E60A 2Z5UA 4DZPA 1ZN2A 1RKTA 1FP2A 2QKMB 2W85A 4B43A 5HNHA 2EINH 2DO7A 4P1WA 5F1RA 5E17F 1VF9A 1BJAA 3DCFA 2IS1A 4Y15A 3M8JA 4BKXA 1XB4A 2O3FA 4ZZDA 3IRRA 2UZKA 5E8GA 2JK3A 1W7PB 5HS8A 2ME0A 1D1BA 3HIFA 4HW0A 4AIDA 1JE8A 4WXCA 2PMZA 3K4LA 1FYMA 4UVCA 3S1NJ 2KJCA 3B73A 3JSOA 4A3CJ 4G7ZF 4I01A 3LWFA 3JRCA 4BQAA 4XK4A 2PFBA 4F92B 2LY9A 1GXQA 4HPQA 2QSGX 4EM0B 4A2UA 2IVMA 3H9QA 1NG6A 3G1OA 5KK1A 2EV6A 2DT6A 2C6YA 2JPCA 2A68F 1H9GA 4M3BA 3CJQB 4XOPA 1D1CA 4EEFG 5A2QZ 1MNDA 4C9YA 5D4RA 4AUXA 5EG0A 1BL0A 1WSUA 2M3AA 1YIJI 4PJMA 2O5RA 2ZJQF 1ETKA 4CDGA 1X58A 4CYCA 1YJNI 4RM3A 2OUMA 1ZLJA 3AG4H 4GCVA 4A0XA 3A0BC 2NAZA 2H6BA 3S1QJ 4I0AA 2YSRA 3CUQA 5FLVA 2CW8A 4MFDA 3C3WA
chains in the Genus database with same CATH topology
4XICA 1AKHA 3ZQLA 3FKIJ 2NOGA 3JRDA 3S2HJ 1X2NA 4FISA 4A3MJ 9ANTA 4Y52J 3IH2A 2IBDA 2ECCA 4DYRA 1IDZA 3FISA 4DW6A 5FKMA 3TEDA 2E2HJ 4A3GJ 1JT6A 5F1JA 1TWGJ 1FTZA 5K7ZA 3RQIA 2K40A 2XB0X 1RPWA 5EZGA 5IPAA 3NARA 1HCRA 2XGEA 4B4CA 1WI3A 1XS9A 3H0GJ 1JGGA 1U9NA 2ELKA 3LSJA 3Q0VA 2HYJA 3BTLA 2VKVA 1IGNA 2JA7J 2ZB9A 1BJZA 4QTRA 3IH3A 4C3HJ 3Q0UA 1TWHJ 2EZKA 3GTOJ 2R0QC 1A6IA 5C44J 1HDDC 3HOWJ 3PO2J 1WPKA 2LP0A 4M3FA 2EZHA 2KT0A 2YS9A 2HOAA 2HI3A 3GTPJ 2CJJA 5IP7J 5GP9A 2LKXA 1LFBA 4X6AJ 1I6HJ 1U8BA 4IHWA 2Y0SN 2R92J 1TWAJ 1Q1VA 3NAUA 1ZGWA 1X2MA 1APLC 3RKQA 3I4MJ 2EQRA 1WH5A 3HKZN 4W97A 1UMQA 2DA1A 4BBRJ 2M0CA 3L1PA 3HGYA 4C3JJ 4UUSA 1BW5A 2DA3A 2R5ZA 2FD5A 1AHDP 5DS9A 2DA5A 1QVUA 5M3FJ 2IEKA 1GUUA 2R5YA 2L7ZA 3HOYJ 5J1UA 1RKWA 1HDPA 4Y7NJ 3GTKJ 3CCYA 1B8IB 4FE7A 1JUMA 2DA4A 3BR2A 2LLKA 3LOCA 4UUTA 3H3VK 1WCMJ 3QQAA 5C4JJ 1LFUP 1LE8B 1R9TJ 1ETXA 4LOCA 2DMPA 1ETYA 1ETQA 2L0KA 5FJ8J 1GVDA 2O9LA 1ZR2A 2VPRA 4GFBA 1E3OC 3BR3A 1NK3P 1JTYA 2VKEA 1MBFA 1ZK8A 3HOUJ 2Y2ZA 3VPRA 1FTTA 5EZHA 3GTQJ 1HLVA 1JUPA 5EEAA 1Y1WJ 3CMYA 2DJNA 4L5EA 2X6OA 2NVTJ 1SANA 3G1MA 4IEJA 5FLMJ 1QPIA 4IHVA 3OSFA 2FX0A 4W1UA 3TW7A 1WH7A 3I4NJ 3CDLA 3S2DJ 2CU7A 4MLOA 4JX4A 2QCOA 2ID3A 1FIAA 2P81A 1O4XA 4M6VA 2HQ5A 4IHXA 2E2JJ 1YRNB 1JUSA 4RBOA 2MGQA 1FEXA 2DTZA 3HM5A 2JN6A 2JA5J 5EGOB 4X1EA 5M5XJ 3ZQFA 2JA8J 2COBA 2R93J 4AYBN 1ORKA 3HDDA 4MFEA 1MH3A 2FJ1A 1OJLA 2HOSA 1MSEC 2H1KA 3SFIA 1H89C 5F04A 1IRZA 2ME6A 1TC3C 3HBLA 3ZQIA 2M8GX 2O7OA 1JKPC 2YUSA 4A3KJ 2N8GA 1WGXA 4G12A 1NK2P 4AC0A 2AO9A 5E3LA 2M9HA 3WHCA 2GLOA 5GPAA 1VI0A 1TWFJ 4BXXJ 1G2HA 2DN0A 2M2EA 1JT0A 1CQTA 2DMUA 3A03A 2ECBA 1SFOJ 3BG5A 3HB9A 5IOYA 2K9QA 4S0HB 5K7FA 3OSGA 4A93J 5EG0B 2CUEA 4XRMA 2CRGA 4IHYA 1ZR4A 1HOMA 3JR9A 3GTJJ 1F36A 4B1RA 4CYCB 3JRFA 4A3BJ 5FKOA 3TP3A 1MNMC 4A3EJ 2W48A 5EYRA 3O8HA 3HEFA 1K61A 1ETVA 1HF0A 2L7FP 3GTGJ 1U78A 3S15J 2LFBA 2QF7A 1AKHB 1QRYA 5GPCA 4D7NA 4C3IJ 3BQZA 3BR5A 3QPLA 3SJMA 3W6VA 2DMQA 2X9DA 3FIWA 3MKLA 3HOZJ 3C2BA 5IP9J 1GDTA 4BBSJ 2HXIA 2DMNA 1B72B 2D5VA 1GT0C 2XSDC 1BA5A 1ITYA 1OCTC 2JA6J 5EF6A 4NDLA 2B63J 2JWTA 1RESA 3Q3SA 4XIDA 4XRSA 3A01A 3PM1A 1DU0A 2EBIA 2GM4A 1AU7A 5IYCJ 4A3JJ 2R7ZJ 5FKKA 3PO3J 1OFCX 5DTDA 3D1NI 1FIPA 1IJWC 5HODA 2HDDA 3ZOBA 1MBJA 5F0HA 3RZOJ 1OCPA 1RETA 3M3YJ 1ZKGA 1PUFB 3JRHA 3BG3A 2TCTA 2WAQN 3MN2A 2K9NA 4A3IJ 3OOUA 3B6AA 1XC5A 2LTPA 2HXOA 1QVTA 2LK2A 4M3EA 5EDNA 2E19A 4QIWN 2NS8A 1F43A 1ETOA 3BR0A 1JKRC 5M5WJ 3G1LA 5JLWA 1VFCA 2PMZN 1MSFC 3S1RJ 2WV1A 1IDYA 4B3AA 5BNGA 1POGA 3CQZJ 3IH4A 4UUSB 3K2AA 1JKOC 3JREA 5IYBJ 4ABZA 2ID6A 5F08A 4RDUA 1DU6A 2AHQA 3M4OJ 4JP0A 1Z77A 3RZDJ 2R5YB 1I3QJ 2DA6A 4DYCA 4A69C 1W0UA 2NVQJ 2JMWA 3HOXJ 4FE4A 2CQQA 4JX5A 3BTJA 1D5YA 2IAIA 1RR7A 3F0CA 2LR8A 2LVSA 5M3MJ 1S7EA 3Q0WA 3ZQCA 1ENHA 4MO7A 4XRSG 3ZQGA 1GV5A 4BY1J 2M34A 2XPVA 2O8KA 4BY7J 3JRBA 1JJ8C 4I6ZA 1MH4A 2KDZA 4D5FA 3FK7A 1MBEA 5E3NA 1MBKA 2CUFA 3QPSA 3S14J 3JRAA 2EZLA 2L9RA 1Y1VJ 2E1OA 3A02A 1IG7A 1B72A 3JRGA 3BG9A 4A3LJ 1FJLA 3LSPA 3TW6A 2EH3A 3TP0A 3GTMJ 3HOVJ 4JX6A 2MG4A 5C4XJ 3UKGA 2HOTA 2H8RA 3LSRA 4V2GA 1IUFA 3SDGA 1TWCJ 1Z0XA 5E3OA 1ETWA 1B8IA 3IV5A 2OF7A 2EZIA 5JLXA 3DEWA 4MIMA 3O8GA 5F27A 5E3MA 1LE8A 1UG2A 2X48A 2XGDA 2G0EA 1ZQ3P 2Y9ZA 1NTCA 3MVPA 1IV6A 3HGGA 2XRLA 3ZQHA 3S17J 1P7JA 2GBYA 4A3DJ 1JTXA 1PUFA 1H8AC 2Y9YA 3JRIA 5M5YJ 2MW8A 2JJ7A 4M3DA 2DMTA 5C3EJ 5J1YA 2I10A 1BW6A 1VNDA 3WHBA 5FKNA 2NS7A 2XB5A 3LSGA 1H88C 2NVXJ 5IP6A 3GBGA 3BR6A 3OIOA 4QSHA 5K7HA 2YU9J 1W0TA 3K7AJ 1T56A 2DA7A 4FCYA 3FK6A 2DA2A 4DZJA 1A5JA 3BTIA 1JJ6C 1U9OA 2XPWA 4DZPA 4C2MJ 1RKTA 3BR1A 2L7MP 4JYKA 1YRNA 4V2FA 1VF9A 3GTLJ 3DCFA 4BKXA 4D7MA 2OPTA 2E2IJ 5FKLA 5EGOA 2XPUA 2RAEA 5F0FA 2JK3A 2WB1N 4J19A 1GV2A 2ME0A 2NVYJ 3S1MJ 5F0CA 3BT9A 2K9SA 5IOZA 3S1NJ 4A3CJ 4DYQA 4HNVA 3JRCA 4M3GA 4XK4A 2TRTA 5IYDJ 2LY9A 5J3LA 1EF4A 2VI6A 5J1RA 4A3FJ 3G1OA 2R5ZB 2Y30A 4M3BA 1P7IA 3LNQA 4I76A 4EEFG 4AUXA 5EG0A 1BL0A 2VUMJ 3B6CA 4FTHA 3BTCA 3E7LA 1MBHA 1ETKA 1MBGA 1X58A 4CYCA 2MSYA 1I50J 3A01B 1JKQC 1UHSA 2LD5A 2FQ4A 3BQYA 1IC8A 2Y31A 4D5CA 1T33A 3S1QJ 2XGCA 3S16J 1ZTRA 1XG1A 5FLVA 1K83J 2CQXA 4MFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIC A;  1AKH A;  3ZQL A;  3FKI J;  2NOG A;  3JRD A;  3S2H J;  1X2N A;  4FIS A;  4A3M J;  9ANT A;  4Y52 J;  3IH2 A;  2IBD A;  2ECC A;  4DYR A;  1IDZ A;  3FIS A;  4DW6 A;  5FKM A;  3TED A;  2E2H J;  4A3G J;  1JT6 A;  5F1J A;  1TWG J;  1FTZ A;  5K7Z A;  3RQI A;  2K40 A;  2XB0 X;  1RPW A;  5EZG A;  5IPA A;  3NAR A;  1HCR A;  2XGE A;  4B4C A;  1WI3 A;  1XS9 A;  3H0G J;  1JGG A;  1U9N A;  2ELK A;  3LSJ A;  3Q0V A;  2HYJ A;  3BTL A;  2VKV A;  1IGN A;  2JA7 J;  2ZB9 A;  1BJZ A;  4QTR A;  3IH3 A;  4C3H J;  3Q0U A;  1TWH J;  2EZK A;  3GTO J;  2R0Q C;  1A6I A;  5C44 J;  1HDD C;  3HOW J;  3PO2 J;  1WPK A;  2LP0 A;  4M3F A;  2EZH A;  2KT0 A;  2YS9 A;  2HOA A;  2HI3 A;  3GTP J;  2CJJ A;  5IP7 J;  5GP9 A;  2LKX A;  1LFB A;  4X6A J;  1I6H J;  1U8B A;  4IHW A;  2Y0S N;  2R92 J;  1TWA J;  1Q1V A;  3NAU A;  1ZGW A;  1X2M A;  1APL C;  3RKQ A;  3I4M J;  2EQR A;  1WH5 A;  3HKZ N;  4W97 A;  1UMQ A;  2DA1 A;  4BBR J;  2M0C A;  3L1P A;  3HGY A;  4C3J J;  4UUS A;  1BW5 A;  2DA3 A;  2R5Z A;  2FD5 A;  1AHD P;  5DS9 A;  2DA5 A;  1QVU A;  5M3F J;  2IEK A;  1GUU A;  2R5Y A;  2L7Z A;  3HOY J;  5J1U A;  1RKW A;  1HDP A;  4Y7N J;  3GTK J;  3CCY A;  1B8I B;  4FE7 A;  1JUM A;  2DA4 A;  3BR2 A;  2LLK A;  3LOC A;  4UUT A;  3H3V K;  1WCM J;  3QQA A;  5C4J J;  1LFU P;  1LE8 B;  1R9T J;  1ETX A;  4LOC A;  2DMP A;  1ETY A;  1ETQ A;  2L0K A;  5FJ8 J;  1GVD A;  2O9L A;  1ZR2 A;  2VPR A;  4GFB A;  1E3O C;  3BR3 A;  1NK3 P;  1JTY A;  2VKE A;  1MBF A;  1ZK8 A;  3HOU J;  2Y2Z A;  3VPR A;  1FTT A;  5EZH A;  3GTQ J;  1HLV A;  1JUP A;  5EEA A;  1Y1W J;  3CMY A;  2DJN A;  4L5E A;  2X6O A;  2NVT J;  1SAN A;  3G1M A;  4IEJ A;  5FLM J;  1QPI A;  4IHV A;  3OSF A;  2FX0 A;  4W1U A;  3TW7 A;  1WH7 A;  3I4N J;  3CDL A;  3S2D J;  2CU7 A;  4MLO A;  4JX4 A;  2QCO A;  2ID3 A;  1FIA A;  2P81 A;  1O4X A;  4M6V A;  2HQ5 A;  4IHX A;  2E2J J;  1YRN B;  1JUS A;  4RBO A;  2MGQ A;  1FEX A;  2DTZ A;  3HM5 A;  2JN6 A;  2JA5 J;  5EGO B;  4X1E A;  5M5X J;  3ZQF A;  2JA8 J;  2COB A;  2R93 J;  4AYB N;  1ORK A;  3HDD A;  4MFE A;  1MH3 A;  2FJ1 A;  1OJL A;  2HOS A;  1MSE C;  2H1K A;  3SFI A;  1H89 C;  5F04 A;  1IRZ A;  2ME6 A;  1TC3 C;  3HBL A;  3ZQI A;  2M8G X;  2O7O A;  1JKP C;  2YUS A;  4A3K J;  2N8G A;  1WGX A;  4G12 A;  1NK2 P;  4AC0 A;  2AO9 A;  5E3L A;  2M9H A;  3WHC A;  2GLO A;  5GPA A;  1VI0 A;  1TWF J;  4BXX J;  1G2H A;  2DN0 A;  2M2E A;  1JT0 A;  1CQT A;  2DMU A;  3A03 A;  2ECB A;  1SFO J;  3BG5 A;  3HB9 A;  5IOY A;  2K9Q A;  4S0H B;  5K7F A;  3OSG A;  4A93 J;  5EG0 B;  2CUE A;  4XRM A;  2CRG A;  4IHY A;  1ZR4 A;  1HOM A;  3JR9 A;  3GTJ J;  1F36 A;  4B1R A;  4CYC B;  3JRF A;  4A3B J;  5FKO A;  3TP3 A;  1MNM C;  4A3E J;  2W48 A;  5EYR A;  3O8H A;  3HEF A;  1K61 A;  1ETV A;  1HF0 A;  2L7F P;  3GTG J;  1U78 A;  3S15 J;  2LFB A;  2QF7 A;  1AKH B;  1QRY A;  5GPC A;  4D7N A;  4C3I J;  3BQZ A;  3BR5 A;  3QPL A;  3SJM A;  3W6V A;  2DMQ A;  2X9D A;  3FIW A;  3MKL A;  3HOZ J;  3C2B A;  5IP9 J;  1GDT A;  4BBS J;  2HXI A;  2DMN A;  1B72 B;  2D5V A;  1GT0 C;  2XSD C;  1BA5 A;  1ITY A;  1OCT C;  2JA6 J;  5EF6 A;  4NDL A;  2B63 J;  2JWT A;  1RES A;  3Q3S A;  4XID A;  4XRS A;  3A01 A;  3PM1 A;  1DU0 A;  2EBI A;  2GM4 A;  1AU7 A;  5IYC J;  4A3J J;  2R7Z J;  5FKK A;  3PO3 J;  1OFC X;  5DTD A;  3D1N I;  1FIP A;  1IJW C;  5HOD A;  2HDD A;  3ZOB A;  1MBJ A;  5F0H A;  3RZO J;  1OCP A;  1RET A;  3M3Y J;  1ZKG A;  1PUF B;  3JRH A;  3BG3 A;  2TCT A;  2WAQ N;  3MN2 A;  2K9N A;  4A3I J;  3OOU A;  3B6A A;  1XC5 A;  2LTP A;  2HXO A;  1QVT A;  2LK2 A;  4M3E A;  5EDN A;  2E19 A;  4QIW N;  2NS8 A;  1F43 A;  1ETO A;  3BR0 A;  1JKR C;  5M5W J;  3G1L A;  5JLW A;  1VFC A;  2PMZ N;  1MSF C;  3S1R J;  2WV1 A;  1IDY A;  4B3A A;  5BNG A;  1POG A;  3CQZ J;  3IH4 A;  4UUS B;  3K2A A;  1JKO C;  3JRE A;  5IYB J;  4ABZ A;  2ID6 A;  5F08 A;  4RDU A;  1DU6 A;  2AHQ A;  3M4O J;  4JP0 A;  1Z77 A;  3RZD J;  2R5Y B;  1I3Q J;  2DA6 A;  4DYC A;  4A69 C;  1W0U A;  2NVQ J;  2JMW A;  3HOX J;  4FE4 A;  2CQQ A;  4JX5 A;  3BTJ A;  1D5Y A;  2IAI A;  1RR7 A;  3F0C A;  2LR8 A;  2LVS A;  5M3M J;  1S7E A;  3Q0W A;  3ZQC A;  1ENH A;  4MO7 A;  4XRS G;  3ZQG A;  1GV5 A;  4BY1 J;  2M34 A;  2XPV A;  2O8K A;  4BY7 J;  3JRB A;  1JJ8 C;  4I6Z A;  1MH4 A;  2KDZ A;  4D5F A;  3FK7 A;  1MBE A;  5E3N A;  1MBK A;  2CUF A;  3QPS A;  3S14 J;  3JRA A;  2EZL A;  2L9R A;  1Y1V J;  2E1O A;  3A02 A;  1IG7 A;  1B72 A;  3JRG A;  3BG9 A;  4A3L J;  1FJL A;  3LSP A;  3TW6 A;  2EH3 A;  3TP0 A;  3GTM J;  3HOV J;  4JX6 A;  2MG4 A;  5C4X J;  3UKG A;  2HOT A;  2H8R A;  3LSR A;  4V2G A;  1IUF A;  3SDG A;  1TWC J;  1Z0X A;  5E3O A;  1ETW A;  1B8I A;  3IV5 A;  2OF7 A;  2EZI A;  5JLX A;  3DEW A;  4MIM A;  3O8G A;  5F27 A;  5E3M A;  1LE8 A;  1UG2 A;  2X48 A;  2XGD A;  2G0E A;  1ZQ3 P;  2Y9Z A;  1NTC A;  3MVP A;  1IV6 A;  3HGG A;  2XRL A;  3ZQH A;  3S17 J;  1P7J A;  2GBY A;  4A3D J;  1JTX A;  1PUF A;  1H8A C;  2Y9Y A;  3JRI A;  5M5Y J;  2MW8 A;  2JJ7 A;  4M3D A;  2DMT A;  5C3E J;  5J1Y A;  2I10 A;  1BW6 A;  1VND A;  3WHB A;  5FKN A;  2NS7 A;  2XB5 A;  3LSG A;  1H88 C;  2NVX J;  5IP6 A;  3GBG A;  3BR6 A;  3OIO A;  4QSH A;  5K7H A;  2YU9 J;  1W0T A;  3K7A J;  1T56 A;  2DA7 A;  4FCY A;  3FK6 A;  2DA2 A;  4DZJ A;  1A5J A;  3BTI A;  1JJ6 C;  1U9O A;  2XPW A;  4DZP A;  4C2M J;  1RKT A;  3BR1 A;  2L7M P;  4JYK A;  1YRN A;  4V2F A;  1VF9 A;  3GTL J;  3DCF A;  4BKX A;  4D7M A;  2OPT A;  2E2I J;  5FKL A;  5EGO A;  2XPU A;  2RAE A;  5F0F A;  2JK3 A;  2WB1 N;  4J19 A;  1GV2 A;  2ME0 A;  2NVY J;  3S1M J;  5F0C A;  3BT9 A;  2K9S A;  5IOZ A;  3S1N J;  4A3C J;  4DYQ A;  4HNV A;  3JRC A;  4M3G A;  4XK4 A;  2TRT A;  5IYD J;  2LY9 A;  5J3L A;  1EF4 A;  2VI6 A;  5J1R A;  4A3F J;  3G1O A;  2R5Z B;  2Y30 A;  4M3B A;  1P7I A;  3LNQ A;  4I76 A;  4EEF G;  4AUX A;  5EG0 A;  1BL0 A;  2VUM J;  3B6C A;  4FTH A;  3BTC A;  3E7L A;  1MBH A;  1ETK A;  1MBG A;  1X58 A;  4CYC A;  2MSY A;  1I50 J;  3A01 B;  1JKQ C;  1UHS A;  2LD5 A;  2FQ4 A;  3BQY A;  1IC8 A;  2Y31 A;  4D5C A;  1T33 A;  3S1Q J;  2XGC A;  3S16 J;  1ZTR A;  1XG1 A;  5FLV A;  1K83 J;  2CQX A;  4MFD A; 
#chains in the Genus database with same CATH topology
 4XIC A;  2JUG A;  3ZQL A;  3JRD A;  3S2H J;  3FZV A;  2XDV A;  3HYI A;  3BP8 A;  3W2W A;  3IH2 A;  4HDU A;  3CDI A;  2ECC A;  1PJR A;  3R4K A;  1DGR M;  1X4O A;  3HRT A;  3CUO A;  4A3G J;  3GZ6 A;  1BIB A;  4IQ4 A;  4HLY A;  3MD2 A;  1FTZ A;  4LB6 B;  2ELH A;  2DFI A;  5EZG A;  1RPW A;  3EUH C;  2VQH A;  3NAR A;  1IW7 F;  1DPU A;  3I59 A;  1YW8 A;  4FX0 A;  4A0Z A;  4EQQ A;  4B4C A;  2HYG D;  5J40 A;  3ULQ B;  3DFG A;  1JGG A;  1U9N A;  1U5T C;  3LSJ A;  3IRQ A;  2KIS A;  2HYJ A;  4FAS D;  3BTL A;  5A2Q K;  1IN7 A;  1X4P A;  2JA2 A;  3BZ6 A;  3HRM A;  2DDB A;  2ZB9 A;  4QTR A;  2XKO A;  2UV1 A;  3DPU A;  3VYU B;  2VON A;  4YG2 F;  4LB5 A;  2EZK A;  5E1Z B;  3V7S A;  3GTO J;  4U0V A;  1R1U A;  2R0Q C;  1HDD C;  1AOY A;  2Y0S A;  5FFX A;  4DJA A;  3E6B A;  2QM3 A;  1LNW A;  2CS3 A;  4M9S A;  4RB0 A;  1LJ9 A;  5IP7 J;  2O03 A;  2MFZ A;  1Y6I A;  2OU2 A;  2Z1D A;  5ICG A;  1QQI A;  4IHW A;  2HKX A;  2CV2 A;  1Q1V A;  2P0W A;  3NAU A;  1TZL A;  1ZEL A;  3NWS A;  4ZH4 F;  1G8X A;  4LK1 F;  4RGS A;  2KZG A;  1PVE A;  3RKQ A;  1SFX A;  2DYR H;  2EQR A;  2GIZ A;  2P4W A;  1YW9 A;  3GUD A;  1D8J A;  4ETS A;  5CYV A;  3S93 A;  1QBJ A;  2FEZ A;  3FM3 A;  3PNY A;  3GCM A;  2DA3 A;  2KIM A;  2KL4 A;  2DA5 A;  1NH3 A;  3BG7 A;  4GRI A;  2NVU B;  3WTY C;  3WU0 A;  1VQ8 I;  1YX3 A;  2L7Z A;  1RKW A;  2FQ3 A;  1EV7 A;  1JUM A;  3VSL A;  4II3 A;  5CKT A;  3OS2 A;  3VFZ A;  1MJA A;  2DBB A;  2CMP A;  2QGU A;  2JVG A;  1R36 A;  4LOC A;  2DMP A;  1O3R A;  1ETQ A;  1MJB A;  2VJI A;  1GVD A;  5FJ8 J;  4LGW A;  2O9L A;  2VPR A;  4GO1 A;  3BR3 A;  5K5O A;  1LB2 A;  1NK3 P;  1JTY A;  1T0F C;  2DOF A;  2WA0 A;  3CDH A;  2X6X A;  3BCA A;  4D1Q A;  4GYI A;  4IHT A;  1IRX A;  3VPR A;  1HLV A;  1IO2 A;  2V4J C;  1Y1W J;  2IW5 A;  2KIF A;  1DDN A;  1ON1 A;  2D1H A;  1L3L A;  3U9G A;  4BJ6 C;  5FLM J;  4IEJ A;  1DP3 A;  5AIQ A;  3ZN0 A;  1WH7 A;  3BG6 A;  2HOE A;  1K78 A;  3HSF A;  1OR7 A;  2QCO A;  2ID3 A;  3K10 A;  3WGH A;  2K7L A;  5HDN A;  2HQ5 A;  2E2J J;  1JUS A;  2HGC A;  1IXR C;  2Y48 A;  4ENK A;  5L3C A;  2JA5 J;  2M0M A;  1ONV A;  3AFH A;  4A6E A;  4F7Z A;  3REO A;  1ZYR F;  2KPM A;  4LFU A;  3ZQF A;  2JA8 J;  3QWL A;  5DEQ A;  4OOI A;  4AYB N;  4BXU A;  1QU3 A;  3E3V A;  3FF5 A;  2AQF A;  5KHD A;  1D0Z A;  1Z21 A;  3L2C A;  1BC8 C;  4ZJZ A;  3S3M A;  2H1K A;  3Q9V A;  3V8L A;  4A5N A;  1IRZ A;  1Z7L A;  1SMY F;  2ME6 A;  1TC3 C;  2WY7 Q;  3HBL A;  4O3M A;  1HQC A;  2O7O A;  2YUS A;  2CUZ A;  4L9T A;  4WCG A;  3W2V A;  2N8G A;  4E7K A;  1NK2 P;  4AC0 A;  2AO9 A;  2X6Y A;  1MNE A;  3WHC A;  5GPA A;  1TWF J;  3OYK A;  2Q0O A;  4BE2 A;  4LIV A;  2F5F A;  2XVC A;  3OOP A;  3CCM I;  4NUB A;  5D6E A;  5B5E C;  3A03 A;  1K6Y A;  1CQT A;  3LST A;  2KIU A;  1ZAO A;  2IGO A;  1SFO J;  4KNY A;  3ZGK A;  1FOW A;  1LDK B;  1TW3 A;  2Z16 A;  3QU3 A;  2OBP A;  3BG5 A;  4Y17 A;  2J5P A;  5J4V A;  3GZ5 A;  5AON A;  4A93 J;  1S29 A;  4XRM A;  4F52 A;  2JT1 A;  2L01 A;  2RN7 A;  1P2F A;  4G6Q A;  4ANJ A;  3ZN1 A;  1PYV A;  1JI8 A;  3R0J A;  3G3Z A;  5FRN A;  2JVH A;  5FKO A;  3TP3 A;  5DM7 F;  1YIT I;  1R22 A;  4HV5 A;  2E7X A;  2EK5 A;  2GA1 A;  2NOJ B;  2VBW A;  3GTG J;  1U78 A;  3DBL B;  3M9A A;  2HTJ A;  1S7O A;  2QF7 A;  2WBM A;  4ZZL A;  2GXG A;  4CCO A;  4U7D A;  3BR5 A;  4QLC U;  1Y39 A;  3RPU A;  1XSD A;  3MKL A;  5HNF A;  4E7J A;  5IP9 J;  5B1B H;  2O61 A;  3A1Y A;  6PAX A;  1B72 B;  2FML A;  2XSD C;  2W57 A;  4LIT A;  2WV0 A;  4XL9 A;  2EIJ H;  2V79 A;  1W5T A;  1PP7 U;  3V42 A;  5EF6 A;  2B63 J;  2JWT A;  4BDY A;  2DYS H;  4BQO A;  2WTE A;  3KLN A;  2BEO A;  2XF6 A;  2VJ5 A;  2IS4 A;  1S8N A;  2A6E F;  3LA3 A;  3R6S A;  2R7Z J;  3PO3 J;  2OQG A;  2ZFW A;  1OFC X;  4L5J A;  2F5E A;  5DTD A;  3D1N I;  2K27 A;  4IJA A;  3TMO A;  2DDA A;  2Q8K A;  5HOD A;  2HDD A;  3MFK A;  3RZO J;  1OCP A;  2K02 A;  1Z3X A;  3M3Y J;  3KZZ A;  3WTZ A;  1D8K A;  1ZKG A;  2ZSH B;  3JRH A;  2M7B A;  2WAQ N;  3SZT A;  4NC7 A;  2BHZ A;  3VSK A;  3W6K B;  4IO9 F;  3R60 A;  4D0P A;  4AWX B;  3UNG C;  4UUV A;  1F4K A;  3LA2 A;  2OCE A;  2LYC A;  4EMS A;  1OYY A;  4M3E A;  3G4S I;  3BZK A;  2CQK A;  2W82 A;  2MD5 A;  1I1G A;  3HUG A;  1X3W B;  1JKR C;  2A69 F;  2ESH A;  1FSH A;  5LHH A;  5JLW A;  1EKE A;  2PMZ N;  1GLN A;  2J5O A;  4NQW A;  1FYL A;  1IDY A;  1POG A;  4UUS B;  1DQU A;  5J6X A;  3TGN A;  1VQL I;  2LOO A;  4G6D A;  4IRG A;  4ABZ A;  4IOA F;  2M45 A;  2BVL A;  5F08 A;  3E6C C;  4NC6 A;  2AHQ A;  3JTH A;  2KRC A;  3M4O J;  1WZ2 A;  2Q2E B;  4JP0 A;  4YEJ A;  1R7J A;  2ZXH A;  1G59 A;  1I3Q J;  3E0J B;  4DNC A;  2O8X A;  3I58 A;  3BTJ A;  3BLY A;  3X2Q H;  1ZGA A;  3ONQ A;  2VBX A;  4H4K C;  4U88 A;  2PJR B;  2DPD A;  3U2R A;  2QQ9 A;  3MZH A;  4BY1 J;  3F9K A;  5K1Y A;  1FY7 A;  3DKW A;  2XPV A;  4LG0 B;  2GZW A;  3M8F A;  1JJ8 C;  3K4C A;  3R61 A;  1QZE A;  2KDZ A;  3CC7 I;  2PI0 A;  4QPQ A;  1YOV B;  2PJP A;  1MMS A;  1P4W A;  2V1U A;  2P8T A;  3DV8 A;  4BEH A;  2ZO4 A;  2HNH A;  2CW0 F;  3M1C A;  2OC6 A;  4XLN F;  4HQM A;  1YW7 A;  1OYW A;  1B72 A;  2X51 A;  3ZXS A;  4DIQ A;  2EH3 A;  3P5J A;  3GTM J;  3PL8 A;  4EJT A;  3K70 D;  2MG4 A;  4UY8 I;  2HKO A;  5ERI A;  3BJO A;  5E3O A;  1TWC J;  1Z0X A;  2OZ6 A;  1E2X A;  3ZRG A;  5FLX Z;  5JLX A;  1YFH A;  1LVA A;  1N77 A;  2RQP A;  5AIP A;  5F27 A;  3UR3 C;  1UG2 A;  2X48 A;  5CVR A;  3MVP A;  3P9I A;  3HHG A;  1G6N A;  3S17 J;  1MMD A;  2L4M A;  3F8N A;  1H8A C;  1REP C;  2Y9Y A;  2B9S A;  2ZBK A;  3WGI A;  2LH9 A;  4CUG A;  2L02 A;  2AXT C;  4RM2 A;  1VND A;  2LF7 A;  3OYA A;  3BWG A;  3GO5 A;  5JHU A;  4OU0 A;  5FD6 A;  2VJJ A;  1H88 C;  1IXC A;  4QSH A;  3JCU C;  2EA4 A;  5K7H A;  4KT6 A;  1W0T A;  4UV8 A;  3DWL E;  3KEQ A;  3FK6 A;  1A5J A;  4P5O A;  4EVI A;  4HST A;  4KFC A;  2DFF A;  4BQN A;  2XAH A;  2XPW A;  3E97 A;  3O6B B;  5LFA A;  3BR1 A;  2EA2 A;  2UXX A;  1KU9 A;  4CCN A;  1YRN A;  3GTL J;  4D7M A;  3IHU A;  1BI2 A;  5FKL A;  5EGO A;  1RIO H;  2RAE A;  5F0F A;  4Z6Y A;  1TQI A;  2WB1 N;  5FLX K;  3L2W A;  5DDG A;  2NVY J;  3I71 A;  3I5U A;  1JHF A;  2WAD A;  1EJ9 A;  3ERE D;  3CUQ C;  1W4M A;  2E1N A;  1IAW A;  2CSO A;  4LG0 A;  4GGG A;  1KYW A;  4PK4 A;  2L2O A;  4BYY A;  4H0E A;  1LEB A;  3AAF A;  5J3L A;  1EF4 A;  2IJL A;  4B8X A;  1BIA A;  4KIT B;  5J1R A;  2A05 A;  2VXD A;  4A3F J;  3K1M A;  2JQ7 A;  3NQO A;  3RSN A;  4RAY A;  1FX7 A;  1XDS A;  3LNQ A;  2F5V A;  3PNT A;  3MQ0 A;  2ZSI B;  1SD6 A;  2JSC A;  3PFI A;  2VUM J;  3B6C A;  3WU2 C;  1E17 A;  1WKM A;  2GIV A;  3DU6 A;  1IXS B;  3KYD B;  2XAS A;  2MSY A;  3A01 B;  2ADU A;  4BHP A;  1UHS A;  4K2E A;  2KDO A;  1IUY A;  2BBY A;  2LD5 A;  1IC8 A;  2MAB A;  4LIU A;  3M07 A;  2VJ4 A;  2DQL A;  5DM6 F;  1K83 J;  3RZD J;  2R7D A;  2VT3 A;  4JBA A;  2NOG A;  9ANT A;  4A3M J;  4Y52 J;  4DQ2 A;  1BM9 A;  5EJC A;  2IBD A;  4DYR A;  3MKW B;  1IDZ A;  1QHG A;  3G6E I;  3IL2 A;  4DW6 A;  3I55 I;  3CC2 I;  3V7C A;  3TED A;  1WJA A;  2E2H J;  1JT6 A;  2L9S A;  2OCC H;  5F1J A;  2ZKZ A;  1U2W A;  3RQI A;  5K7Z A;  2XB0 X;  3GWZ A;  5J47 A;  3BC8 A;  3DLL F;  2E1M C;  2IS6 A;  1FOK A;  2M1B A;  3FXU A;  3J81 Z;  4Y13 A;  5HLG A;  1LDD A;  2K3P A;  5BS6 A;  4ENN A;  2A5W A;  3IWZ A;  1B1B A;  2JA7 J;  2MH9 A;  4CSW A;  2NS0 A;  3KP3 A;  5FFZ A;  4C3H J;  1TWH J;  1B4A A;  2P7C B;  3M1E A;  5HS9 A;  2A5Y B;  1E3P A;  3VDX A;  1X1D A;  4M3F A;  3WE3 A;  4I7H A;  2UXN A;  1PP8 F;  2ZFU A;  1N78 A;  3TQN A;  4I2O A;  2CJJ A;  4PJL A;  4NHJ A;  4X6A J;  1U8B A;  3ABM H;  5IT3 A;  3V8K A;  4MEY F;  2R92 J;  1EA3 A;  4XLF A;  2GOM A;  1T95 A;  3TOB A;  2EPF A;  1Z1D A;  5JVT A;  4FQG A;  1WH5 A;  2ACJ A;  1FP1 D;  4XLC A;  1HST A;  2DA1 A;  2DCE A;  4BBR J;  2PEX A;  3L1P A;  2P5K A;  4KIB A;  3GFL A;  1IZ1 A;  3HGY A;  5HDG A;  4RLF A;  2H09 A;  3IKV A;  1V3F A;  1AHD P;  2ZC2 A;  3L2V A;  4UB8 C;  2GWR A;  3J81 K;  1QZY A;  5GTI C;  3K4B A;  1Z3Y A;  2GXB A;  1W5C C;  4M9Z A;  2IEK A;  4EJV A;  2QBY A;  4ZYA A;  2DOE A;  2Y69 H;  4YRV A;  2R5Y A;  3HOY J;  4E7I A;  5LGT A;  4KT5 C;  3CJR B;  3CCY A;  1GHC A;  2DA4 A;  2QEN A;  1YHQ I;  4UUT A;  1RI7 A;  2XV4 S;  1OR7 C;  5FB2 A;  2RNG A;  1J09 A;  1R1T A;  2PG4 A;  2QQA A;  4EAT A;  3WU1 B;  1R00 A;  1R9T J;  3K4N A;  1LQ1 A;  3HSR A;  2R7T A;  1U6G A;  4RB2 C;  2V6C A;  1ETY A;  2LMD A;  2XUB A;  2L0K A;  1O3T A;  3FXQ A;  3H5A A;  3CF5 F;  3VYT B;  2VB6 A;  1J59 A;  4QPO A;  3VYR B;  3DLA A;  2AQE A;  2EIL H;  2VKE A;  1MBF A;  5HDK A;  1FWZ A;  1BR1 A;  4CCJ A;  1ZG3 A;  4KYW A;  2Y2Z A;  1U3E M;  2LDU A;  3ZQ7 A;  1FTT A;  2ZXW H;  1Q1H A;  1JUP A;  4S04 A;  5LGU A;  3CMY A;  2RVC A;  2BY1 A;  3I0T A;  2EV5 A;  3K2Z A;  3L2Q A;  1SAN A;  1IN8 A;  3DTI A;  3G1M A;  2HFH A;  4KUM A;  3OSF A;  4W1U A;  4A5M A;  4IL6 C;  4YFX F;  2W00 A;  4LLL A;  3S2D J;  3CCQ I;  1J7K A;  4ESJ A;  1XTA A;  3SQN A;  4HDV A;  2P81 A;  1O4X A;  3KP4 A;  4M6V A;  4GYG A;  1SFU A;  3J7A O;  5GAH J;  3S3N A;  2MGQ A;  2OA4 A;  2FMY A;  2DTZ A;  2JN6 A;  1TW2 A;  4RB3 C;  2WC2 A;  5CQE A;  2COB A;  2I5U A;  3HDD A;  4MFE A;  1MH3 A;  3DU5 A;  1W1W E;  3FMQ A;  1OJL A;  1OPC A;  5E8I A;  3ASN H;  5F04 A;  3OYF A;  1G3Y A;  2K86 A;  2M8G X;  1ZG5 A;  4EGY A;  3FXJ A;  3T8T A;  1KQ0 A;  2BE5 F;  5HLI A;  1O3S A;  4ZYG A;  4AU7 A;  3OMY A;  4BXX J;  3BRO A;  4ZC3 A;  2PMH A;  1E0E A;  2H6C A;  3ZR8 X;  1ODD A;  2G9W A;  4A6D A;  3HB9 A;  3HJE A;  2EB7 A;  4KMF A;  2K9Q A;  1X1P A;  1AWC A;  2CUE A;  5GAE J;  2LRD A;  3D5S C;  2YPR A;  1TL8 A;  3QOP A;  4DBR A;  4IHY A;  2B0L A;  1HOM A;  1RC9 A;  1F36 A;  1W7P A;  4CCK A;  1KU2 A;  4A3B J;  3JRF A;  1W36 D;  4FX4 A;  1R71 A;  4B3X A;  1G3T A;  1WJB A;  1BR4 A;  1YJ9 I;  4BL0 B;  2GOX B;  4A3E J;  3CO7 C;  1HKQ A;  2K85 A;  2W48 A;  5LHI A;  2M4K A;  2DW4 A;  1VZ0 A;  2RDP A;  3F8F A;  1V5G A;  2LFB A;  1AKH B;  3PIO F;  3EUA A;  2HWV A;  3SHF A;  4N4O B;  2VN2 A;  1VQK I;  3JAM Z;  2LSO A;  3QPL A;  1I27 A;  2DMQ A;  1IN4 A;  2HQA A;  2QVO A;  3J7Z I;  1XGN A;  3HOZ J;  4XKW A;  2ZME B;  4BBS J;  2DMN A;  2E34 A;  4JQF A;  2W24 A;  1ZRC A;  2ELJ A;  2EFO A;  2E5N A;  3KYC B;  1VTN C;  1OCT C;  3CZ6 A;  3DPT A;  2XGX A;  3HHH A;  5GAG J;  1BOA A;  5HLH A;  2JA6 J;  1X1C A;  2LF8 A;  4RGX A;  3RIR A;  2BZT A;  1LUJ B;  3RDI A;  5LLQ A;  4XID A;  4RAZ A;  3HRU A;  4HBL A;  2MH2 A;  1F9N A;  2XIG A;  3PM1 A;  3MZY A;  3DPL C;  2K9M A;  2GM4 A;  2V1N A;  1VQ6 I;  2EV0 A;  4OIR F;  3ZMT A;  3OYC A;  1SD7 A;  2F5C A;  2DT5 A;  4BE0 A;  3K6G A;  4BS9 A;  5TIS C;  3ZOB A;  3OYH A;  2M7A A;  2Q1Z B;  5F0H A;  2BYV E;  1XMK A;  4CH7 A;  4BGD A;  2QSF X;  1PUF B;  1YJW I;  2DAO A;  2JUC A;  4OMZ A;  3COA C;  2KFD A;  3T8R A;  3BDD A;  3PNV A;  2QEX I;  3W2A A;  4I0B A;  2LTP A;  2O0Y A;  2PX9 A;  4HF1 A;  1T8I A;  4Q48 A;  4BHB A;  4QIW N;  1F43 A;  1XMX A;  2WAE A;  4II2 A;  3J7A Y;  4ITV A;  4HAM A;  2Y0M A;  3S1R J;  1SVM A;  5CLS A;  2EFW A;  4EM1 A;  2X1D A;  3OYE A;  1U5T B;  2A6T A;  3IH4 A;  1ZLK A;  3K2A A;  5CJ9 A;  3EQL F;  3TL4 X;  2K4J A;  3ZMZ A;  4HX8 A;  4CO8 A;  1S6L A;  1TNT A;  4V19 K;  4CCL A;  1IN6 A;  3TO6 A;  4RDU A;  3LSH A;  1Z05 A;  4ZYE A;  1VQ7 I;  2LBF B;  3MEX A;  3FHZ A;  1Z77 A;  2XF7 A;  4WXH A;  4UHT A;  3SYT A;  1W0U A;  2NVQ J;  5DD8 A;  1YG2 A;  2JMW A;  3ERM A;  4FE4 A;  1VQO I;  4I02 A;  1FMV A;  2FSW A;  2IAI A;  1SVL A;  3R0A A;  1FPQ A;  2D1V A;  2KIQ A;  4IX7 A;  2XAQ A;  3Q0W A;  4XRS G;  1GV5 A;  1W36 C;  1MH4 A;  4E4H A;  4EJW A;  4M6Y A;  3NRV A;  3KX2 A;  4DBQ A;  1KA8 A;  5E3N A;  3I9V 2;  3QPS A;  2NXN B;  5DV5 A;  3OV8 A;  3LFU A;  2L9R A;  4KIS A;  2ZME A;  2LY2 A;  2H8W A;  1X3U A;  2LNB A;  2AS5 F;  1XCB A;  3JRG A;  2QLZ A;  2JSP A;  5DCF A;  2M30 A;  2CYY A;  4BDZ A;  1HBX G;  3B02 A;  2PQ8 A;  2DFE A;  2RC4 A;  3DTK A;  4MQV A;  3F21 A;  3LSR A;  3F8C A;  4V2G A;  2D45 A;  2Z33 A;  3WOD F;  1ETW A;  3JW4 A;  4P9U A;  4P9F A;  1T98 A;  2X1E A;  2BGC A;  5B66 C;  4XN3 A;  4MIM A;  3CTA A;  3WG7 H;  4HF0 A;  5H20 A;  5CVI A;  3E6M A;  2Y9Z A;  1I39 A;  5HVQ C;  3HL2 A;  2R4G A;  4EM2 A;  2X85 A;  3RYP A;  4CHU A;  2W84 A;  1S72 I;  2FNA A;  3ABU A;  1PUF A;  4G94 A;  2MW8 A;  2JJ7 A;  1P4A A;  2DMT A;  3OR1 C;  4M3D A;  4XON A;  3DBR B;  2QUF A;  3QP6 A;  2R7X A;  5J1Y A;  3MMY B;  1J2X A;  3WHB A;  1QGP A;  3OYI A;  5DUI A;  2XB5 A;  3OIO A;  1M1E B;  2VBZ A;  4HX4 A;  2IGK A;  1T56 A;  3LA7 A;  4FCY A;  2DA2 A;  2STT A;  3BTI A;  3C2G A;  4B44 A;  1U9O A;  1V4R A;  4E7S A;  3LAJ A;  3U1K A;  3F72 A;  3KPH A;  3K4J A;  1FYK A;  3QPT A;  3K1N A;  2L7M P;  1YS6 A;  1WWX A;  4R8H A;  4V2F A;  2H1L A;  2XSJ C;  1TT0 A;  4I98 B;  2OPT A;  2E2I J;  1OIS A;  2XPU A;  1HW5 A;  4HF2 A;  1GV2 A;  1SFK A;  4F91 B;  4NNJ A;  1I3A A;  5GTH C;  3MKY B;  2CFO A;  4GXO A;  3HTU A;  3T1B A;  2ZJR F;  4E7H A;  3S1M J;  1ZGJ A;  1ACI A;  2OV7 A;  3BT9 A;  2K9S A;  1R5H A;  3BJ6 A;  1ZRD A;  1TBX A;  5LRS A;  2AXL A;  1TQM A;  2LC2 A;  4ASN A;  3T5X A;  5BPD A;  2KRH A;  4HA8 A;  1KZH A;  4M3G A;  2TRT A;  2DXI A;  5IYD J;  5TJJ A;  4OIP F;  1EH7 A;  1ZAR A;  2DJI A;  4HZF A;  4XLH A;  2PMU A;  4PCQ A;  2L7K A;  4BHC A;  3CP2 A;  4R79 A;  3CMM A;  3FDY A;  2M5W A;  4RLQ A;  2R5Z B;  1BC7 C;  1SFE A;  2DFH A;  2BV6 A;  2CWE A;  2A6H F;  2LRE A;  2VXZ A;  1V5E A;  1P7I A;  3ABL H;  3ECO A;  4RA2 A;  3PFY A;  2KRF A;  2P5V A;  4NBQ A;  1DP7 P;  3U1D A;  1SC7 A;  1GVJ A;  3WTW C;  1HA8 A;  4N4N B;  3BTC A;  3E7L A;  4U0W A;  4ON0 A;  5CPR B;  3MKZ A;  5LD2 C;  1XPX A;  2IA2 A;  3FMR A;  1T39 A;  4N0B A;  1I50 J;  2L4A A;  4HRI A;  1Y56 A;  3KZI C;  1BOB A;  2ZXI A;  2FQ4 A;  3BQY A;  1UFM A;  2Y31 A;  1UG0 A;  1T33 A;  4PUS A;  3FKJ A;  4D5C A;  1XG1 A;  1S9H A;  2KQR A;  1UZC A;  4HX7 A;  1T38 A;  2O6G E;  1CF7 B;  1X2N A;  5D5V B;  4MGR A;  2X0L A;  3PUB A;  4PDK A;  2EFN A;  5FKM A;  1FLI A;  5DUK A;  2VQC A;  4L0Y B;  2Z99 A;  2K40 A;  3PSF A;  2RQQ A;  3BY6 A;  4F55 A;  5IPA A;  2HPM A;  1STZ A;  4HOB A;  1T2K A;  2UUZ A;  3CCV I;  2HQR A;  2V1X A;  1XS9 A;  3H0G J;  3SEZ A;  1G3S A;  2ELK A;  5J8C A;  3GYH X;  5LGN A;  1IGN A;  3GME A;  2VLA A;  4HSR A;  2VQL A;  3LSI A;  2YX7 A;  3GVA A;  1W7P D;  1BJZ A;  1P4X A;  3A0H C;  1F5T A;  3Q0U A;  2BOL A;  2MYS A;  3PO2 J;  5C44 J;  4IRI A;  3KP6 A;  1Z9C A;  2CGP A;  3OL4 A;  4P55 A;  2V9P A;  3AL0 B;  2FF4 A;  3NEU A;  2HOA A;  4HG2 A;  3EUK L;  2OAZ A;  1O7F A;  3QYE A;  5GP9 A;  2PLY A;  1U8R A;  3RCO A;  1K4S A;  3K1P A;  2Y0S N;  4OMY A;  3V7R A;  1ZGW A;  1WJD A;  1A36 A;  2ZNY A;  1D0X A;  2NNN A;  1APL C;  1SAU A;  3I4M J;  5E18 F;  1R1V A;  3BCB A;  3CCJ I;  2NNY A;  2HDW A;  1UMQ A;  3C18 A;  1FZP B;  5L3D A;  1LEA A;  2M0C A;  4UUS A;  2CQN A;  1BW5 A;  5B1A H;  1WJE A;  2R5Z A;  1XGM A;  1DGW Y;  2XRO A;  3WTT C;  4IRH A;  2V9V A;  2FD5 A;  2BW3 B;  1JGS A;  5DYM A;  4M9X A;  1QVU A;  5M3F J;  2Q2E A;  3NWT A;  2PN6 A;  2IGN A;  1GUU A;  3I4P A;  4XLA A;  1QO0 D;  3TOA A;  3EET A;  2CQ7 A;  5J1U A;  1HDP A;  1IF1 A;  1B8I B;  3D5L A;  4FE7 A;  3OS0 A;  1H9T A;  2LLK A;  1MGT A;  3LOC A;  1SAX A;  1EH8 A;  4HNU A;  1WCM J;  2OTJ I;  5C4J J;  4YIF A;  3DP7 A;  2PJR A;  4I99 C;  2XAG A;  3G73 A;  1LE8 B;  3E6D A;  1UB9 A;  3KCC A;  4B09 A;  5HS7 A;  3ELK A;  1VQM I;  1E3O C;  4CA0 A;  1P92 A;  3VWB A;  2FE3 A;  1ZK8 A;  5LHG A;  3AKZ A;  3CCR I;  2RGV A;  4KA4 A;  4ENJ A;  2DT7 B;  2HTS A;  2L9N A;  3GFM A;  2Z9O A;  5EZH A;  3OY9 A;  2YX4 A;  5EEA A;  2K3F A;  1LFP A;  2DJN A;  4LG3 A;  1VQ5 I;  2XKP A;  4KIG A;  4XMY A;  3N97 A;  2RKH A;  1KGS A;  2R7Q A;  4XR6 A;  4IHV A;  2M4G A;  4Z2Y A;  2GA2 A;  5DCM B;  3TBI A;  2STW A;  4BU2 A;  3N4M A;  2ESN A;  4MLO A;  1R6R A;  2E36 A;  1FIA A;  4JOM A;  4IHX A;  2W4S A;  3MZ8 A;  2OZU A;  4CZC A;  4O5V A;  2F2E A;  4X1E A;  1FMW A;  3EYY A;  2HVQ A;  3RI4 A;  4M71 A;  1J5Y A;  1B59 A;  2MC4 A;  5BMZ A;  3SEQ A;  4OWR B;  4BJT A;  2QZ8 A;  1I1S A;  2IA0 A;  2HOS A;  1K7A A;  1MSE C;  3SFI A;  5ICF A;  1Z91 A;  3W6J B;  3WGG A;  1LPQ A;  1H89 C;  2ISZ A;  3CC4 I;  1A31 A;  1N75 A;  3DEE A;  1BBY A;  1JKP C;  4P96 A;  5TGT A;  5J8F A;  2DOD A;  4WF2 A;  5CVJ A;  1TLH B;  4G12 A;  2CH0 A;  2CV1 A;  2GLO A;  2M9H A;  1VI0 A;  2M87 A;  4CYD A;  2YR2 A;  1G2H A;  4FHT A;  3CF2 A;  5L3E A;  1FNN A;  2DMU A;  4B48 A;  3L2R A;  3S2W A;  2ZJ2 A;  3WG9 A;  2HS5 A;  2FNP A;  3KZY A;  4S0H B;  1LDJ A;  5ICC A;  4MQ9 F;  3ESW B;  5D6F A;  5K7F A;  1WVR A;  5EG0 B;  3OSG A;  3QYB A;  2BXZ A;  3J7Y J;  1Y0U A;  1ZR4 A;  3JR9 A;  3HC7 A;  1D5V A;  4B1R A;  4CYC B;  2JZY A;  1IRG A;  3HKZ A;  1VQ4 I;  1A04 A;  3SZG A;  3QRF F;  2Z2S B;  4O6J A;  3CME I;  1QA6 A;  3PIP F;  3DBH B;  1K61 A;  2QWW A;  1ETV A;  3RPU D;  3CUQ B;  1MDM B;  1UST A;  2W25 A;  2KKO A;  4IKF A;  1QRY A;  2QQ8 A;  1QHH D;  4D7N A;  5GPC A;  4C3I J;  3BQZ A;  3DTE A;  3WTV C;  4UVA A;  3SJM A;  3AG1 H;  1BI1 A;  2X9D A;  1V55 H;  3S8P A;  2HZD A;  3CES A;  3FIW A;  1X1B A;  3CCL I;  3SZP A;  1ZG1 A;  3C2B A;  2HXI A;  1UHW A;  2VE8 A;  1GT0 C;  4B47 A;  1BA5 A;  1ITY A;  2CG4 A;  2QYO A;  4F93 B;  1GXP A;  1HW2 A;  4EGZ A;  2E7W A;  5ED4 A;  4OIN F;  3I59 B;  1YYV A;  3OIQ A;  1RES A;  3PUF A;  4G7H F;  3ECH A;  3KIO A;  1R23 A;  5LEJ A;  2NYX A;  3A01 A;  4IPA A;  3QPH A;  2EBI A;  1AU7 A;  5IYC J;  2OTL I;  2FOW A;  4A3J J;  5FKK A;  2WAQ A;  1HW1 A;  4PJJ A;  4RAG A;  2FBH A;  1K6O A;  3OYM A;  3L2U A;  1IJW C;  2W1O A;  1HC8 A;  3IAS 2;  3C2H A;  2FXA A;  2BY3 A;  1MBJ A;  1A6Q A;  1RUO A;  2ISY A;  3KET A;  3E1S A;  5D4S A;  3RKW A;  3TO9 A;  3DQV C;  3BG3 A;  1Z67 A;  2TCT A;  3BOQ A;  3AG3 H;  1OCO H;  1R5G A;  2K9N A;  5KAI C;  1HKS A;  1WJF A;  2JRM A;  3OOU A;  4A3I J;  2L54 A;  2HEO A;  3B6A A;  1XC5 A;  1BN5 A;  4U87 A;  5EDN A;  3OYL A;  3WTX C;  3Q5F A;  3ZCO A;  3CP8 A;  4LK0 F;  4BQQ A;  3CCE I;  3BR0 A;  2E1M B;  3ISP A;  3DEU A;  4MHG A;  3CMA I;  5M5W J;  4ZTF A;  1RZ4 A;  2FOK A;  1MSF C;  4YIR X;  2ICW G;  3LSK A;  3QOD A;  3QU6 A;  1RNL A;  5BNG A;  4BE1 A;  1JKO C;  2ZME C;  2MC3 A;  1VQN I;  2HYF A;  1Z6R A;  1C0W A;  2OJE D;  2ID6 A;  4XOT A;  1CGP A;  1DU6 A;  2MLG A;  1B9N A;  1XMA A;  2FBI A;  3CJN A;  2DK5 A;  5IT9 Z;  3F3X A;  4EV0 A;  2VOP A;  3ZMU A;  3HOX J;  4I09 A;  3HRS A;  4JX5 A;  5CVV A;  1FOY A;  3V4G A;  2VE9 A;  1D5Y A;  2V6E A;  1ZH5 A;  3N05 A;  2R3S A;  3HZJ A;  2LR8 A;  5M3M J;  1S7E A;  1IN5 A;  2F5D A;  3ZQC A;  1J0R A;  4MO7 A;  5H2F C;  2O8K A;  4Q4Z F;  1MDM A;  1TQP A;  5KCM A;  3JRB A;  1YX5 A;  4ZDP A;  3IP4 B;  3BPV A;  2WAF A;  3FK7 A;  3FXO A;  1NHA A;  2MLK A;  4L9V A;  3I56 I;  2KHM A;  2V26 A;  5IY5 H;  2CO5 A;  2RNJ A;  4XLP F;  3JRA A;  4L18 B;  4KJZ A;  1Y1V J;  2E1O A;  5D5X B;  1IG7 A;  3LFK A;  4AVP A;  4A3L J;  2CV0 A;  5D5W B;  4WWC A;  3TW6 A;  3KEO A;  3LSP A;  3HOV J;  1UHM A;  2IPQ X;  3DKY A;  3G2B A;  4JX6 A;  4CZZ A;  4ENM A;  5C4X J;  3UKG A;  2HOT A;  2P6T A;  3MCZ A;  5K5R A;  1IUF A;  4XKB A;  1FT9 A;  3ZMD A;  2OF7 A;  2DTR A;  3IV5 A;  3IAM 2;  4XOR A;  3JTG A;  1K78 B;  3KP5 A;  2EZI A;  4HV6 A;  3DEW A;  2FUG 2;  5IT9 K;  3H1C A;  5EEH A;  2A07 F;  1JHH A;  3RKX A;  2LKP A;  2XGD A;  1ZQ3 P;  2FU4 A;  1KU3 A;  1F1Z A;  3A4C A;  1NTC A;  3F22 A;  3RJP A;  5H6R A;  3FXM A;  3ZQH A;  4XNF A;  1DUX C;  1KON A;  1V54 H;  5JHF A;  5HOO A;  4A3D J;  1SD4 A;  4L9J A;  2A3S A;  4KIF A;  3JRI A;  3OWT A;  4PJ0 C;  5M5Y J;  4RAF A;  3LL7 A;  2VKH A;  4X0G A;  3HOT A;  1IRF A;  1KYZ A;  5FRO A;  3HTS B;  2DI3 A;  3I3L A;  2NS7 A;  3H9G A;  2NVX J;  3LSG A;  3BR6 A;  3D0S A;  3EDP A;  5DD4 A;  3MWM A;  3U21 A;  3K7A J;  4WX9 A;  4BXF A;  3GFI A;  1SVO A;  4C30 A;  4A12 A;  2L5Q A;  2FBK A;  4C2M J;  1ZHF A;  3M7G A;  2WB1 A;  2NRA C;  1BI0 A;  2QKL B;  1D1A A;  4UXN A;  3RPQ A;  3OYG A;  1S5L C;  2XAF A;  4JYK A;  3P9K A;  1FBS A;  3KLO A;  4E70 A;  1LKX A;  3CD6 I;  5D5U B;  4CCM A;  4J19 A;  1T08 B;  4KN7 X;  5ILS A;  3FXK A;  3FHN A;  1AA7 A;  4XRF A;  4PFP A;  4U7B A;  2P7V B;  3SDB A;  4IXA A;  5F0C A;  4XKC A;  5IOZ A;  1LVK A;  4DYQ A;  1S7A A;  3JAM K;  1PDN C;  2KLO A;  4HNV A;  3K0L A;  4A0Y A;  1HXD A;  2XAJ A;  3FXR A;  5L3B A;  2QA4 I;  2QSH X;  3IKT A;  1B6A A;  4L9N A;  1YI2 I;  4MTD A;  1Z6T A;  2VI6 A;  2EWN A;  3HPG A;  3L9F A;  1IV8 A;  2Y30 A;  1MW7 A;  1X19 A;  1YQA A;  5E79 C;  4I76 A;  2F4I A;  1BI3 A;  1FSE A;  2OD5 A;  3MAJ A;  4RGR A;  4FTH A;  4OAY A;  1QPM A;  2K4B A;  3VYS B;  4EJO A;  1MBH A;  3LMM A;  4YFK F;  3P7N A;  1MBG A;  2ZXJ A;  2R7W A;  2G7U A;  3ROU A;  3GF2 A;  2MBF A;  2XRN A;  2Z3Y A;  1JKQ C;  3SFZ A;  1E3H A;  2HPI A;  2XGC A;  3S16 J;  1ZTR A;  2I8D A;  3KP7 A;  2E5Z A;  2CQX A;  2E35 A;  1AKH A;  3FKI J;  4HYE A;  4FIS A;  2P5L C;  1OKR A;  2UWM A;  2W7N A;  4G6T B;  3VB2 A;  3QOE A;  1TP4 A;  2R7R A;  2WY8 Q;  5ILV A;  3FIS A;  5K5Q A;  4J01 A;  2R7F A;  1L0O C;  3L09 A;  1ERD A;  2ZCW A;  3VOD A;  4KIC A;  1W5S A;  4PGG A;  2V7F A;  3JSP A;  1TWG J;  2BY0 A;  1Y0N A;  4RGU A;  4TV7 A;  4KMU X;  3GZN B;  3KE2 A;  4IVN A;  5ILU A;  3HUG B;  4S05 A;  1SEU A;  1HCR A;  2KZV A;  4YEL A;  1FOX A;  2HVR A;  3GLX A;  2XGE A;  5LBQ A;  1WI3 A;  3E5U A;  1NG7 A;  2R7O A;  4NQW B;  4BH9 A;  3OYN A;  2E1C A;  3Q0V A;  1UJ8 A;  3PSI A;  2VKV A;  4PGH A;  2IA1 A;  3F6O A;  3IH3 A;  4C2U A;  3K4K A;  4M6X A;  1WJC A;  4LJZ F;  3LQQ A;  5JFR A;  1A6I A;  2RV8 A;  3HOW J;  1WPK A;  2LP0 A;  4G8X A;  1D3Y A;  2EZH A;  1OCZ H;  2ZJP F;  2KT0 A;  3RQ4 A;  2YS9 A;  5FO5 A;  2L9V A;  2VIX A;  2HI3 A;  3GTP J;  3HSE A;  4G9Y A;  2X1C A;  2KP6 A;  2LKS A;  2LKX A;  4WK8 F;  4Q5S F;  1SD5 A;  1LFB A;  1Y8Q B;  1MJ9 A;  1I6H J;  2K9L A;  3LQR A;  4BJ5 C;  1TWA J;  1XCV A;  2LY1 A;  2VKD A;  3TO7 A;  3KFW X;  3OIP A;  1X2M A;  3EUH A;  1KQ9 A;  1J75 A;  3HKZ N;  4W97 A;  2KMU A;  2HZT A;  4ZTJ A;  4M73 A;  3H3U A;  2HQN A;  1U5T A;  3ABT A;  4PSW A;  4BEH B;  4C3J J;  4ZYH A;  3H92 A;  1D0Y A;  5DS9 A;  5LEK A;  3DXJ F;  2LBF A;  1MIJ A;  3OYB A;  3OR2 C;  3J80 Z;  1KQ8 A;  3S32 A;  3QYF A;  3H3Z A;  3CCS I;  1P9Q C;  4Y7N J;  5FD5 A;  2JPB A;  3GTK J;  1X3Z B;  4IZZ A;  3BR2 A;  1OLT A;  2DU9 A;  2HVS A;  3K4M A;  3RKY A;  3H3V K;  1O57 A;  5E1W A;  3QQA A;  1YS7 A;  4LD5 A;  1LFU P;  4PZJ A;  5EEG A;  4LLG F;  1R5I D;  3DF8 A;  3EYI A;  4BNC A;  1ETX A;  4KN4 X;  1DPR A;  1A35 A;  1G3W A;  2F6C A;  3C1D A;  2R7U A;  5KAF C;  4OAZ A;  1ZR2 A;  3IUO A;  4GFB A;  3AL0 C;  1R58 A;  4OIO F;  1VQ9 I;  1MD0 A;  1Z7U A;  1MMA A;  3FMS A;  4N9H A;  3FWE A;  4J00 A;  1HSJ A;  1OQY A;  2R7S A;  3I54 A;  4XSZ F;  2PBI A;  1YTY A;  3HG9 A;  3HOU J;  1ZRE A;  5CQG A;  3GTQ J;  4ZDL A;  4MTE A;  1KU7 A;  1JXS A;  4E7L A;  2EJR A;  3IWF A;  2Y75 A;  1H0M A;  4BAC A;  3VEP A;  4L5E A;  2X6O A;  3BZC A;  2NVT J;  3WTS C;  4HEA 2;  3WE2 A;  2H27 A;  4AIK A;  1UCR A;  4YII A;  2G7H A;  5JI6 A;  1QPI A;  2FX0 A;  3TW7 A;  4EJU A;  2GXA A;  3CDL A;  1QZZ A;  2CU7 A;  2VQG A;  3Q9S A;  4JX4 A;  2FA5 A;  3TDZ C;  3I4N J;  2VOD A;  2XAU A;  3GXO A;  3GFJ A;  3J80 K;  1TTY A;  4M74 A;  2VOO A;  2V9K A;  3ABK H;  1YRN B;  4AD9 A;  4XQF A;  1S3J A;  4RBO A;  1FEX A;  1O7L A;  1FBU A;  2DQR A;  4FET A;  4IOC F;  3HM5 A;  1MMN A;  5EGO B;  1QNT A;  5TRD A;  5M5X J;  4FT8 A;  2E71 A;  2R93 J;  1ORK A;  2EFP A;  2FJ1 A;  5GAD J;  4R1H A;  1VQP I;  1T0F A;  4UNO A;  5D8K B;  2ZNZ A;  2VC1 A;  2VT2 A;  3KP2 A;  4XKV A;  4Q47 A;  2QQB A;  3ZQI A;  3FBI B;  4UVB A;  3ZMV A;  1U0J A;  3I64 A;  4JK1 X;  4NC8 A;  3OS1 A;  2XC7 A;  4A3K J;  3A2K A;  2FRH A;  1K79 A;  1WGX A;  2GQQ A;  1FBQ A;  3OYD A;  1ULY A;  5E3L A;  4XLE A;  4RB1 A;  5BPI A;  1K4T A;  2DN0 A;  3AG2 H;  3T0Y A;  2M2E A;  3BPX A;  3E5Q A;  3RTR A;  2DK8 A;  1JT0 A;  4CGZ A;  2ECB A;  4HLX A;  3H5R A;  4Y4R A;  5L3G A;  1HKT A;  3PJR A;  4G7O F;  4YFN F;  1RUN A;  5IOY A;  4LLN A;  4HNT A;  1OCC H;  3LSM A;  1YIO A;  3HXL A;  2P6S A;  2JRT A;  1OYI A;  5CVU A;  2CRG A;  4OIQ F;  1R4N B;  3HPH A;  2DOA A;  3F8B A;  3GTJ J;  2X6W A;  3WTU C;  3GW2 A;  1MNM C;  2MA3 A;  2YU3 A;  4IHS A;  3GX4 X;  5B3S H;  1MKM A;  5EYR A;  5F64 A;  3O8H A;  4QWQ A;  3HEF A;  1HF0 A;  2L7F P;  3RYR A;  2LG4 A;  3S15 J;  1R49 A;  3ZQQ A;  2VL8 A;  3OL3 A;  3GLL A;  1UEL B;  4IQJ A;  2WWY A;  4AIH A;  2ETH A;  1OCR H;  2B7E A;  2TDX A;  2KJB A;  3W6V A;  5FRM A;  1WQ2 A;  1R4M B;  3HOS A;  1Y8R B;  1GDT A;  3VOE A;  4U0Y A;  4N9I A;  1XGS A;  2L3D A;  2D5V A;  3O3K A;  2V1D A;  2F4M B;  4WXD A;  3V8J A;  2F48 A;  2BHY A;  3CLO A;  5H6Q A;  3F23 A;  1XX5 A;  4NDL A;  3CLQ A;  3L7W A;  3Q3S A;  3PQK A;  2X4H A;  4XRS A;  3TKY A;  2A61 A;  2VBY A;  3IC7 A;  1SMT A;  1DU0 A;  5F6F A;  1EH6 A;  1X1A A;  2DLL A;  2IS2 A;  3FXL A;  1YE9 A;  2IP2 A;  4RMN A;  1XSX A;  3PQJ A;  2HDC A;  1BR2 A;  1FIP A;  5BQT A;  3K69 A;  4IF4 A;  1V5F A;  4XBF A;  1RET A;  1CF7 A;  4C2T A;  2CFX A;  3ML6 A;  4PSX A;  2EIM H;  2XHK A;  2D2W A;  2VC0 A;  1MZB A;  2EFQ A;  5BOX A;  1WJ5 A;  4AIJ A;  3MN2 A;  3H36 A;  2MD0 A;  2XF5 A;  5E1X A;  4D9J A;  2BY2 A;  3H9J A;  1XN7 A;  1WI9 A;  1B9M A;  2HXO A;  1QVT A;  1I5Z A;  2LK2 A;  2E19 A;  3FM5 A;  4E7Z A;  2NS8 A;  5JR3 A;  1YLF A;  1ETO A;  3G71 I;  3G1L A;  1VFC A;  3SXY A;  4UV9 A;  4UB6 C;  2WV1 A;  1RRJ A;  4B3A A;  4ESF A;  3CQZ J;  4AYB A;  3H5N A;  4DOZ A;  3JRE A;  1USS A;  3DKX A;  3ASO H;  3GEZ A;  4PFO A;  5IYB J;  4KDP A;  5D8L B;  1WHU A;  2HU9 A;  4DGW B;  2CUJ A;  4L0Z B;  4HQE A;  1WRJ A;  2GAU A;  2QBY B;  1TT5 B;  3F6V A;  2VAS A;  2R5Y B;  1XGO A;  2DA6 A;  4DYC A;  4A69 C;  4GDF A;  2HR3 A;  3I53 A;  3CJT B;  4BUP A;  2CQQ A;  4E6K G;  4RS8 A;  1RR7 A;  1WFX A;  2M8E A;  3F0C A;  5E20 A;  2LVS A;  2H94 A;  4CIC A;  4M72 A;  1ON2 A;  4MEX F;  3K70 C;  1XSV A;  4XM3 A;  1ENH A;  3ZQG A;  1XD7 A;  5L3F A;  3F8M A;  1N25 A;  2M34 A;  4BAY A;  4BY7 J;  4I6Z A;  2K5C A;  4AM3 A;  4D5F A;  2BVM A;  2DPU A;  1I6X A;  1G4D A;  4L5I A;  1MBE A;  1PUE E;  1MBK A;  4F3Q A;  2CUF A;  3D5R C;  3S3O A;  3S14 J;  4NB5 A;  2EZL A;  3EPZ A;  3K9T A;  4MNU A;  3A02 A;  3LAP A;  2BW3 A;  4LMY A;  1YO5 C;  1UAA A;  3BG9 A;  5LRR A;  1FJL A;  2RRE A;  2VPL A;  1XDU A;  3TP0 A;  1RR8 C;  4ZYD A;  3C7J A;  3H0D A;  2H8R A;  1P6R A;  3W3C A;  5JVG F;  3KEY A;  3SDG A;  5FGM A;  4Y33 A;  1B8I A;  3KYL A;  2R7V A;  2IXS A;  3CCU I;  2OQR A;  5KNL A;  5ICE A;  2IGM A;  3L00 A;  2IT0 A;  4XN0 A;  3O8G A;  1LE8 A;  5E3M A;  3FX3 A;  2G0E A;  2COM A;  3P9C A;  1IV6 A;  4XSX F;  3HGG A;  4ZDO A;  3O2P E;  1FC3 A;  2XRL A;  3OYJ A;  5HLT A;  1P7J A;  2GBY A;  1JTX A;  2F4O B;  3ZMS A;  3QP5 A;  2BXY A;  1OMI A;  3TDU C;  2EIK H;  5KVR A;  3QAH A;  4AVZ A;  5J4Y A;  5C3E J;  1ZRF A;  3CO6 C;  2I10 A;  1BW6 A;  1TNS A;  5FKN A;  1J9I A;  4Y3O A;  3M8E A;  3H35 A;  2JTV A;  4PJN A;  4ESB A;  3BJA A;  3E5X A;  5IP6 A;  3ZP5 A;  3GBG A;  1T6S A;  4CXF A;  2YU9 J;  1O3Q A;  2DA7 A;  3FBN B;  3ZPL A;  4DZJ A;  1JJ6 C;  2IRF G;  2CW7 A;  5DCM A;  1MMG A;  2E60 A;  2Z5U A;  4DZP A;  1ZN2 A;  1RKT A;  1FP2 A;  2QKM B;  2W85 A;  4B43 A;  5HNH A;  2EIN H;  2DO7 A;  4P1W A;  5F1R A;  5E17 F;  1VF9 A;  1BJA A;  3DCF A;  2IS1 A;  4Y15 A;  3M8J A;  4BKX A;  1XB4 A;  2O3F A;  4ZZD A;  3IRR A;  2UZK A;  5E8G A;  2JK3 A;  1W7P B;  5HS8 A;  2ME0 A;  1D1B A;  3HIF A;  4HW0 A;  4AID A;  1JE8 A;  4WXC A;  2PMZ A;  3K4L A;  1FYM A;  4UVC A;  3S1N J;  2KJC A;  3B73 A;  3JSO A;  4A3C J;  4G7Z F;  4I01 A;  3LWF A;  3JRC A;  4BQA A;  4XK4 A;  2PFB A;  4F92 B;  2LY9 A;  1GXQ A;  4HPQ A;  2QSG X;  4EM0 B;  4A2U A;  2IVM A;  3H9Q A;  1NG6 A;  3G1O A;  5KK1 A;  2EV6 A;  2DT6 A;  2C6Y A;  2JPC A;  2A68 F;  1H9G A;  4M3B A;  3CJQ B;  4XOP A;  1D1C A;  4EEF G;  5A2Q Z;  1MND A;  4C9Y A;  5D4R A;  4AUX A;  5EG0 A;  1BL0 A;  1WSU A;  2M3A A;  1YIJ I;  4PJM A;  2O5R A;  2ZJQ F;  1ETK A;  4CDG A;  1X58 A;  4CYC A;  1YJN I;  4RM3 A;  2OUM A;  1ZLJ A;  3AG4 H;  4GCV A;  4A0X A;  3A0B C;  2NAZ A;  2H6B A;  3S1Q J;  4I0A A;  2YSR A;  3CUQ A;  5FLV A;  2CW8 A;  4MFD A;  3C3W A; 
#chains in the Genus database with same CATH homology
 4XIC A;  1AKH A;  3ZQL A;  3FKI J;  2NOG A;  3JRD A;  3S2H J;  1X2N A;  4FIS A;  4A3M J;  9ANT A;  4Y52 J;  3IH2 A;  2IBD A;  2ECC A;  4DYR A;  1IDZ A;  3FIS A;  4DW6 A;  5FKM A;  3TED A;  2E2H J;  4A3G J;  1JT6 A;  5F1J A;  1TWG J;  1FTZ A;  5K7Z A;  3RQI A;  2K40 A;  2XB0 X;  1RPW A;  5EZG A;  5IPA A;  3NAR A;  1HCR A;  2XGE A;  4B4C A;  1WI3 A;  1XS9 A;  3H0G J;  1JGG A;  1U9N A;  2ELK A;  3LSJ A;  3Q0V A;  2HYJ A;  3BTL A;  2VKV A;  1IGN A;  2JA7 J;  2ZB9 A;  1BJZ A;  4QTR A;  3IH3 A;  4C3H J;  3Q0U A;  1TWH J;  2EZK A;  3GTO J;  2R0Q C;  1A6I A;  5C44 J;  1HDD C;  3HOW J;  3PO2 J;  1WPK A;  2LP0 A;  4M3F A;  2EZH A;  2KT0 A;  2YS9 A;  2HOA A;  2HI3 A;  3GTP J;  2CJJ A;  5IP7 J;  5GP9 A;  2LKX A;  1LFB A;  4X6A J;  1I6H J;  1U8B A;  4IHW A;  2Y0S N;  2R92 J;  1TWA J;  1Q1V A;  3NAU A;  1ZGW A;  1X2M A;  1APL C;  3RKQ A;  3I4M J;  2EQR A;  1WH5 A;  3HKZ N;  4W97 A;  1UMQ A;  2DA1 A;  4BBR J;  2M0C A;  3L1P A;  3HGY A;  4C3J J;  4UUS A;  1BW5 A;  2DA3 A;  2R5Z A;  2FD5 A;  1AHD P;  5DS9 A;  2DA5 A;  1QVU A;  5M3F J;  2IEK A;  1GUU A;  2R5Y A;  2L7Z A;  3HOY J;  5J1U A;  1RKW A;  1HDP A;  4Y7N J;  3GTK J;  3CCY A;  1B8I B;  4FE7 A;  1JUM A;  2DA4 A;  3BR2 A;  2LLK A;  3LOC A;  4UUT A;  3H3V K;  1WCM J;  3QQA A;  5C4J J;  1LFU P;  1LE8 B;  1R9T J;  1ETX A;  4LOC A;  2DMP A;  1ETY A;  1ETQ A;  2L0K A;  5FJ8 J;  1GVD A;  2O9L A;  1ZR2 A;  2VPR A;  4GFB A;  1E3O C;  3BR3 A;  1NK3 P;  1JTY A;  2VKE A;  1MBF A;  1ZK8 A;  3HOU J;  2Y2Z A;  3VPR A;  1FTT A;  5EZH A;  3GTQ J;  1HLV A;  1JUP A;  5EEA A;  1Y1W J;  3CMY A;  2DJN A;  4L5E A;  2X6O A;  2NVT J;  1SAN A;  3G1M A;  4IEJ A;  5FLM J;  1QPI A;  4IHV A;  3OSF A;  2FX0 A;  4W1U A;  3TW7 A;  1WH7 A;  3I4N J;  3CDL A;  3S2D J;  2CU7 A;  4MLO A;  4JX4 A;  2QCO A;  2ID3 A;  1FIA A;  2P81 A;  1O4X A;  4M6V A;  2HQ5 A;  4IHX A;  2E2J J;  1YRN B;  1JUS A;  4RBO A;  2MGQ A;  1FEX A;  2DTZ A;  3HM5 A;  2JN6 A;  2JA5 J;  5EGO B;  4X1E A;  5M5X J;  3ZQF A;  2JA8 J;  2COB A;  2R93 J;  4AYB N;  1ORK A;  3HDD A;  4MFE A;  1MH3 A;  2FJ1 A;  1OJL A;  2HOS A;  1MSE C;  2H1K A;  3SFI A;  1H89 C;  5F04 A;  1IRZ A;  2ME6 A;  1TC3 C;  3HBL A;  3ZQI A;  2M8G X;  2O7O A;  1JKP C;  2YUS A;  4A3K J;  2N8G A;  1WGX A;  4G12 A;  1NK2 P;  4AC0 A;  2AO9 A;  5E3L A;  2M9H A;  3WHC A;  2GLO A;  5GPA A;  1VI0 A;  1TWF J;  4BXX J;  1G2H A;  2DN0 A;  2M2E A;  1JT0 A;  1CQT A;  2DMU A;  3A03 A;  2ECB A;  1SFO J;  3BG5 A;  3HB9 A;  5IOY A;  2K9Q A;  4S0H B;  5K7F A;  3OSG A;  4A93 J;  5EG0 B;  2CUE A;  4XRM A;  2CRG A;  4IHY A;  1ZR4 A;  1HOM A;  3JR9 A;  3GTJ J;  1F36 A;  4B1R A;  4CYC B;  3JRF A;  4A3B J;  5FKO A;  3TP3 A;  1MNM C;  4A3E J;  2W48 A;  5EYR A;  3O8H A;  3HEF A;  1K61 A;  1ETV A;  1HF0 A;  2L7F P;  3GTG J;  1U78 A;  3S15 J;  2LFB A;  2QF7 A;  1AKH B;  1QRY A;  5GPC A;  4D7N A;  4C3I J;  3BQZ A;  3BR5 A;  3QPL A;  3SJM A;  3W6V A;  2DMQ A;  2X9D A;  3FIW A;  3MKL A;  3HOZ J;  3C2B A;  5IP9 J;  1GDT A;  4BBS J;  2HXI A;  2DMN A;  1B72 B;  2D5V A;  1GT0 C;  2XSD C;  1BA5 A;  1ITY A;  1OCT C;  2JA6 J;  5EF6 A;  4NDL A;  2B63 J;  2JWT A;  1RES A;  3Q3S A;  4XID A;  4XRS A;  3A01 A;  3PM1 A;  1DU0 A;  2EBI A;  2GM4 A;  1AU7 A;  5IYC J;  4A3J J;  2R7Z J;  5FKK A;  3PO3 J;  1OFC X;  5DTD A;  3D1N I;  1FIP A;  1IJW C;  5HOD A;  2HDD A;  3ZOB A;  1MBJ A;  5F0H A;  3RZO J;  1OCP A;  1RET A;  3M3Y J;  1ZKG A;  1PUF B;  3JRH A;  3BG3 A;  2TCT A;  2WAQ N;  3MN2 A;  2K9N A;  4A3I J;  3OOU A;  3B6A A;  1XC5 A;  2LTP A;  2HXO A;  1QVT A;  2LK2 A;  4M3E A;  5EDN A;  2E19 A;  4QIW N;  2NS8 A;  1F43 A;  1ETO A;  3BR0 A;  1JKR C;  5M5W J;  3G1L A;  5JLW A;  1VFC A;  2PMZ N;  1MSF C;  3S1R J;  2WV1 A;  1IDY A;  4B3A A;  5BNG A;  1POG A;  3CQZ J;  3IH4 A;  4UUS B;  3K2A A;  1JKO C;  3JRE A;  5IYB J;  4ABZ A;  2ID6 A;  5F08 A;  4RDU A;  1DU6 A;  2AHQ A;  3M4O J;  4JP0 A;  1Z77 A;  3RZD J;  2R5Y B;  1I3Q J;  2DA6 A;  4DYC A;  4A69 C;  1W0U A;  2NVQ J;  2JMW A;  3HOX J;  4FE4 A;  2CQQ A;  4JX5 A;  3BTJ A;  1D5Y A;  2IAI A;  1RR7 A;  3F0C A;  2LR8 A;  2LVS A;  5M3M J;  1S7E A;  3Q0W A;  3ZQC A;  1ENH A;  4MO7 A;  4XRS G;  3ZQG A;  1GV5 A;  4BY1 J;  2M34 A;  2XPV A;  2O8K A;  4BY7 J;  3JRB A;  1JJ8 C;  4I6Z A;  1MH4 A;  2KDZ A;  4D5F A;  3FK7 A;  1MBE A;  5E3N A;  1MBK A;  2CUF A;  3QPS A;  3S14 J;  3JRA A;  2EZL A;  2L9R A;  1Y1V J;  2E1O A;  3A02 A;  1IG7 A;  1B72 A;  3JRG A;  3BG9 A;  4A3L J;  1FJL A;  3LSP A;  3TW6 A;  2EH3 A;  3TP0 A;  3GTM J;  3HOV J;  4JX6 A;  2MG4 A;  5C4X J;  3UKG A;  2HOT A;  2H8R A;  3LSR A;  4V2G A;  1IUF A;  3SDG A;  1TWC J;  1Z0X A;  5E3O A;  1ETW A;  1B8I A;  3IV5 A;  2OF7 A;  2EZI A;  5JLX A;  3DEW A;  4MIM A;  3O8G A;  5F27 A;  5E3M A;  1LE8 A;  1UG2 A;  2X48 A;  2XGD A;  2G0E A;  1ZQ3 P;  2Y9Z A;  1NTC A;  3MVP A;  1IV6 A;  3HGG A;  2XRL A;  3ZQH A;  3S17 J;  1P7J A;  2GBY A;  4A3D J;  1JTX A;  1PUF A;  1H8A C;  2Y9Y A;  3JRI A;  5M5Y J;  2MW8 A;  2JJ7 A;  4M3D A;  2DMT A;  5C3E J;  5J1Y A;  2I10 A;  1BW6 A;  1VND A;  3WHB A;  5FKN A;  2NS7 A;  2XB5 A;  3LSG A;  1H88 C;  2NVX J;  5IP6 A;  3GBG A;  3BR6 A;  3OIO A;  4QSH A;  5K7H A;  2YU9 J;  1W0T A;  3K7A J;  1T56 A;  2DA7 A;  4FCY A;  3FK6 A;  2DA2 A;  4DZJ A;  1A5J A;  3BTI A;  1JJ6 C;  1U9O A;  2XPW A;  4DZP A;  4C2M J;  1RKT A;  3BR1 A;  2L7M P;  4JYK A;  1YRN A;  4V2F A;  1VF9 A;  3GTL J;  3DCF A;  4BKX A;  4D7M A;  2OPT A;  2E2I J;  5FKL A;  5EGO A;  2XPU A;  2RAE A;  5F0F A;  2JK3 A;  2WB1 N;  4J19 A;  1GV2 A;  2ME0 A;  2NVY J;  3S1M J;  5F0C A;  3BT9 A;  2K9S A;  5IOZ A;  3S1N J;  4A3C J;  4DYQ A;  4HNV A;  3JRC A;  4M3G A;  4XK4 A;  2TRT A;  5IYD J;  2LY9 A;  5J3L A;  1EF4 A;  2VI6 A;  5J1R A;  4A3F J;  3G1O A;  2R5Z B;  2Y30 A;  4M3B A;  1P7I A;  3LNQ A;  4I76 A;  4EEF G;  4AUX A;  5EG0 A;  1BL0 A;  2VUM J;  3B6C A;  4FTH A;  3BTC A;  3E7L A;  1MBH A;  1ETK A;  1MBG A;  1X58 A;  4CYC A;  2MSY A;  1I50 J;  3A01 B;  1JKQ C;  1UHS A;  2LD5 A;  2FQ4 A;  3BQY A;  1IC8 A;  2Y31 A;  4D5C A;  1T33 A;  3S1Q J;  2XGC A;  3S16 J;  1ZTR A;  1XG1 A;  5FLV A;  1K83 J;  2CQX A;  4MFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...