4B4CA

Crystal structure of the dna-binding domain of human chd1.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
204
structure length
187
Chain Sequence
KGFSDAEIRRFIKSYKKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLAKKEALSGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1
publication title Crystal Structure of the DNA-Binding Domain of Human Chd1.
rcsb
source organism Homo sapiens
total genus 66
structure length 187
sequence length 204
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18375 CDH1_2_SANT_HL1 CDH1/2 SANT-Helical linker 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4b4cA02
3S1NJ 3TW7A 3QPLA 2XGCA 2Y9YA 3FIWA 5DTDA 2XGEA 3BG5A 5F0FA 2JK3A 3M4OJ 5EZHA 2AO9A 1K61A 3GTPJ 3B6CA 1LFBA 3S16J 3S17J 2XPUA 2TRTA 2XRLA 4M3FA 5IP9J 2CUFA 4IHXA 1FIAA 1PUFB 3FK7A 4CYCA 3CCYA 5IYCJ 2ECCA 5BNGA 3GTGJ 3BG3A 2ME6A 1X2MA 2FX0A 3I4MJ 2Y0SN 2DA1A 2YUSA 4MO7A 4S0HB 4A3GJ 3ZQIA 1IJWC 4V2GA 1GV2A 2HXIA 1OCTC 2R92J 4B3AA 1QPIA 4A3JJ 2FD5A 2W48A 5K7ZA 2R5YB 2B63J 1XG1A 1WH5A 2NVQJ 3HOYJ 2GM4A 1HDPA 4A3MJ 3HM5A 4HNVA 2M0CA 1PUFA 2LK2A 1F43A 2CU7A 4A3IJ 1JKOC 2CJJA 5EG0B 2EZKA 3S15J 3MN2A 1VI0A 1Q1VA 1MBGA 3OOUA 4A3CJ 1TWCJ 2O7OA 2JA5J 4I76A 1TWGJ 5FLMJ 4BY1J 1MSEC 4XK4A 1IGNA 2R5YA 4XRSA 2COBA 5F27A 2L7ZA 2HOTA 3GTJJ 2R7ZJ 2I10A 3BR5A 1W0TA 3Q0WA 1MBEA 3MVPA 5EG0A 1JUSA 1I6HJ 2NS8A 1ETVA 5IP6A 3G1OA 1SFOJ 2JWTA 1JTXA 3ZOBA 4I6ZA 5FKMA 2AHQA 4FCYA 2EZHA 2ZB9A 3GTLJ 3UKGA 1GDTA 1POGA 5EEAA 5C3EJ 2Y2ZA 4FE7A 3FISA 3WHCA 1BW5A 1RESA 3DCFA 2XB0X 1U9OA 3CQZJ 2CUEA 2O8KA 1JUMA 4BBSJ 4AUXA 5EYRA 3TW6A 1GUUA 4XICA 3LSGA 1HF0A 5DS9A 4DZPA 3K7AJ 4IHVA 5F0CA 5F0HA 4FTHA 2NOGA 2P81A 3SDGA 2K40A 5IOZA 4Y7NJ 3HOWJ 5F04A 2Y9ZA 4D7MA 3I4NJ 2TCTA 4C3HJ 1WGXA 5GPCA 2DTZA 2MG4A 5IOYA 5EF6A 3Q0VA 4BBRJ 3BTJA 3A01B 2N8GA 2ID3A 2WV1A 3QQAA 3PM1A 1WH7A 1F36A 2X9DA 2Y31A 4C3IJ 2OF7A 2E2JJ 1JGGA 4RBOA 2YS9A 1VF9A 5J1RA 1DU0A 3O8GA 1HCRA 4AYBN 2HOSA 1QVTA 5EDNA 1JTYA 1RETA 1T33A 1ZKGA 2LLKA 2R0QC 2DMQA 2GBYA 2R93J 5FKKA 1JKPC 1BJZA 4MLOA 2Y30A 2IAIA 1G2HA 3Q3SA 3JRBA 1IG7A 4MFDA 3A01A 3BQYA 3F0CA 2FJ1A 3OSGA 2DN0A 3HOVJ 1IRZA 2K9SA 5M3MJ 2WB1N 4UUTA 3O8HA 3PO2J 2XPVA 2EBIA 2LTPA 2FQ4A 4DYRA 1ORKA 3BTLA 2EQRA 5HODA 4FE4A 3OIOA 1RR7A 3JRFA 1VFCA 1U8BA 1HOMA 4BXXJ 3HOZJ 3BTCA 4C2MJ 1P7JA 4AC0A 3LSPA 5E3NA 4JX4A 2LP0A 4XRMA 4NDLA 3JRGA 2MGQA 2CRGA 2L0KA 1A6IA 1U9NA 4BKXA 1WPKA 2XGDA 3HOXJ 1IV6A 2DA4A 5C4XJ 4DZJA 2JA6J 1ETYA 3IH2A 2D5VA 1XC5A 4A3KJ 3RZDJ 1U78A 1Y1VJ 2L9RA 4L5EA 2HOAA 2ELKA 1MH3A 3JRCA 3GTKJ 3QPSA 3ZQFA 2NVTJ 2JA8J 5FLVA 3S14J 5FKOA 2E2HJ 1IDYA 2LVSA 4MFEA 3S1MJ 1HLVA 5EGOB 3BQZA 3BR3A 1ENHA 3K2AA 5C4JJ 1A5JA 1OFCX 4X1EA 2JA7J 1LE8B 2KDZA 1AKHB 5E3MA 1ETOA 2NVXJ 4A69C 3BT9A 3SFIA 3G1LA 2NVYJ 3L1PA 2YU9J 3GTMJ 2DJNA 2VKVA 5J1YA 2R5ZB 4MIMA 5IP7J 2XPWA 1ETXA 5GP9A 1FTTA 2ECBA 5EGOA 4QSHA 3LOCA 3JRHA 2L7MP 2LY9A 2JN6A 5J3LA 1RKTA 2OPTA 4B1RA 4UUSB 1LE8A 4M6VA 1OCPA 3S2DJ 2LFBA 1ZGWA 5M5XJ 2M9HA 1AU7A 2XSDC 4FISA 3W6VA 1H8AC 5IYDJ 1I3QJ 5J1UA 4IHWA 3GTQJ 1X2NA 4DYQA 2DMPA 3TP0A 1H88C 4QTRA 1Z77A 3RZOJ 3CMYA 3PO3J 1JT0A 3BR6A 3JRAA 5JLXA 1FTZA 1GV5A 2VPRA 2R5ZA 3G1MA 2GLOA 3BR2A 2DMTA 3VPRA 1X58A 4M3EA 4C3JJ 1QVUA 1ZR4A 3HBLA 3ZQLA 1TWHJ 3BTIA 3DEWA 4UUSA 1APLC 1YRNB 2HDDA 5K7HA 4A3EJ 3BG9A 1ETKA 5FKNA 2DMUA 2G0EA 2M34A 4M3DA 1WCMJ 5EZGA 1ZK8A 4XIDA 2VKEA 1GVDA 1LFUP 2O9LA 2DA5A 1IDZA 3E7LA 1SANA 2DA7A 1TC3C 4J19A 3HGGA 2E19A 3WHBA 2EZIA 1W0UA 3HGYA 2L7FP 4JYKA 3HOUJ 2ME0A 2RAEA 4ABZA 2M8GX 3FK6A 2DA2A 1YRNA 2X6OA 1NK2P 4A3BJ 1FJLA 2E2IJ 3A03A 3MKLA 2QCOA 3HKZN 3RKQA 2LR8A 4LOCA 3LNQA 4B4CA 3IV5A 3NAUA 4D5FA 3JR9A 1WI3A 3C2BA 3BR1A 1UMQA 2EH3A 2XB5A 1MH4A 1B72B 1P7IA 3RQIA 1UG2A 2DMNA 5E3OA 1BA5A 2IEKA 1E3OC 4IHYA 2MW8A 1Z0XA 3IH4A 1H89C 5FKLA 1OJLA 1JKRC 4Y52J 1MSFC 1T56A 4IEJA 2QF7A 4EEFG 2LKXA 5M3FJ 3HB9A 1RKWA 4W1UA 9ANTA 3JREA 1BW6A 2DA3A 1UHSA 3IH3A 5F08A 3TEDA 2K9QA 4G12A 3B6AA 1B8IB 2HQ5A 2JMWA 3LSJA 4D5CA 2VUMJ 4X6AJ 5K7FA 4A3LJ 1VNDA 4M3GA 5IYBJ 5E3LA 1AHDP 1B72A 3JRIA 2HXOA 5GPAA 2E1OA 3NARA 1GT0C 2MSYA 3JRDA 1K83J 2HYJA 3HDDA 1FEXA 3A02A 1DU6A 2WAQN 3H0GJ 1EF4A 1TWAJ 3OSFA 3S2HJ 1ZR2A 3Q0UA 1ZQ3P 1IUFA 1TWFJ 3BR0A 5F1JA 1XS9A 1O4XA 1JKQC 1D5YA 3GTOJ 2K9NA 1JT6A 1MNMC 3GBGA 4M3BA 4DYCA 2HI3A 1Y1WJ 5M5YJ 3S1RJ 1MBFA 1B8IA 2CQXA 2IBDA 2VI6A 2EZLA 3HEFA 1BL0A 3ZQHA 4JX5A 1HDDC 1ETQA 4XRSG 1AKHA 2M2EA 1R9TJ 3FKIJ 1RPWA 4A3DJ 1I50J 1ZTRA 1MBKA 1ETWA 2H1KA 1JJ8C 4V2FA 2NS7A 3S1QJ 3SJMA 2H8RA 1MBJA 1IC8A 1MBHA 4JX6A 5M5WJ 5JLWA 4A93J 5C44J 1NTCA 3D1NI 1ITYA 1JUPA 1FIPA 4DW6A 3CDLA 1JJ6C 2KT0A 2ID6A 4GFBA 4W97A 1QRYA 2LD5A 2JJ7A 4CYCB 3H3VK 4JP0A 4BY7J 4D7NA 1CQTA 3TP3A 3ZQGA 4QIWN 3M3YJ 2DA6A 2CQQA 2PMZN 5IPAA 3LSRA 3ZQCA 5FJ8J 1S7EA 4A3FJ 2X48A 1NK3P 4RDUA
chains in the Genus database with same CATH superfamily
4BHBA 2DOAA 5DTDA 2ISZA 2F5VA 2JK3A 1XDUA 3GEZA 3J7AY 3M4OJ 4KMUX 1DP3A 3QRFF 3S17J 2TRTA 1I5ZA 1R71A 2Z33A 1IN5A 2RVCA 2R3SA 1PUFB 1R1VA 1OYIA 2EV5A 4NC7A 5FLXZ 4CYCA 4BE1A 1XSDA 4HRIA 4ZDLA 1LEAA 2BW3B 3EYYA 5BQTA 4RGXA 2KISA 3BG3A 1LFPA 1FOYA 3O6BB 1E3HA 2YSRA 3PFYA 3G6EI 2ME6A 2QSFX 1USTA 1OMIA 2BHZA 2DA1A 2O8XA 5AIQA 1LB2A 4MEXF 3ZQIA 4V2GA 2HXIA 1KONA 4XM3A 1OCTC 5D6EA 4XKCA 1DDNA 4B3AA 3K9TA 4ZTJA 4A3JJ 2FD5A 3W3CA 4XORA 1XB4A 1FSEA 2JUGA 5DM6F 4C2TA 2GM4A 2X85A 1IRXA 3G2BA 5IT9Z 2BVLA 1PUFA 4G7HF 4I0AA 1JKOC 2HR3A 3OS1A 1K4SA 3J7YJ 2BW3A 3M8JA 3MAJA 3S15J 4DIQA 2DTRA 1Q1VA 5DM7F 1UHWA 3VYUB 1MBGA 3OOUA 4A3CJ 3JCUC 4FHTA 3BG6A 4GDFA 5LEKA 5FLMJ 2A61A 5F64A 1D0YA 2E7XA 4LLGF 4AIDA 3CO6C 2PMUA 3E5UA 1RRJA 4Y13A 4XRSA 1KU2A 1T95A 1Z91A 3GTJJ 4UV8A 2R7ZJ 4NBQA 4FETA 2RDPA 4IRGA 4ESJA 2K27A 3DFGA 2XV4S 1YTYA 1W0TA 3ZP5A 3CLQA 1ZARA 3LSHA 2O03A 2V9PA 2P6TA 3K4BA 1RI7A 1FOWA 5IP6A 2HTJA 1X1CA 1SAXA 2KRFA 3ZOBA 4IHTA 3V8KA 3EETA 3SYTA 3LFUA 3HL2A 3V4GA 4EVIA 5HNFA 5GTHC 3UKGA 2KJBA 3HSRA 1IZ1A 1BW5A 1RESA 1SD4A 3U21A 4ENKA 5D5UB 2NNYA 3CQZJ 2CUEA 2O8KA 2QBYB 1D0XA 4AUXA 3H9JA 4IO9F 3H0DA 1R36A 4IRHA 5EEGA 1DPUA 2K4BA 4XLAA 4RM3A 5ERIA 2FOWA 2KRCA 2ZXJA 2K40A 2XROA 3HOWJ 5F04A 2OZ6A 1WGXA 2YX7A 2WV0A 2HU9A 2MG4A 1JGSA 3PNVA 3VOEA 2Y75A 5HOOA 4WXHA 4GGGA 2ID3A 5B1BH 1F36A 5E8GA 2X9DA 3F8CA 4C3IJ 3OYAA 2QBYA 3QPHA 1YQAA 2YS9A 3BG7A 1MNDA 4CH7A 1TBXA 2PX9A 3MKWB 1DU0A 2HEOA 3W6JB 1QBJA 5B66C 3CUQC 2HYFA 5JI6A 1RETA 1T33A 1LKXA 4XOPA 2WTEA 3CJQB 2R7SA 2DMQA 2R93J 3CCVI 5FKKA 4L0YB 3BCBA 2Y30A 3GMEA 4FQGA 4IZZA 4E7HA 3P5JA 2M7AA 5IY5H 2CWEA 2OAZA 2EB7A 3FZVA 2ZNZA 4CCLA 4IRIA 4F55A 4E70A 3P9CA 4BS9A 4KICA 1MNEA 4IOCF 2HNHA 2Q0OA 2K9SA 4YFKF 1BC8C 2YR2A 1MJAA 2GXGA 4LD5A 4M9SA 1SMTA 1QHGA 2XPVA 4P5OA 5F6FA 5DV5A 3SEZA 5DDGA 1ORKA 3VDXA 2O6GE 1S3JA 2EQRA 2DPUA 2KZVA 1XGSA 5HODA 2MH9A 3QP6A 1U3EM 1JXSA 3JRFA 1P9QC 1P2FA 1U6GA 5KAFC 5J6XA 4BXXJ 3WTTC 3HOZJ 1ON2A 3BTCA 3J7AO 4AC0A 3I71A 1LDKB 4NDLA 2MGQA 2COMA 3AG3H 2IP2A 3K1MA 3OS0A 3O2PE 4NQWB 4BKXA 1OCZH 4AVPA 2XGDA 1QZEA 5C4XJ 4G6DA 1WQ2A 1XC5A 4NHJA 2FNPA 2K9MA 4A3KJ 1U78A 1I1GA 4JBAA 3F8MA 2L9RA 2HOAA 2ELKA 4PZJA 1MH3A 2M4KA 3A0HC 3V8JA 5ICGA 5HDGA 1UB9A 1T6SA 4ON0A 4EJUA 1V5EA 4RAYA 1D8KA 4CCOA 2K9LA 2LVSA 4MFEA 2DFFA 2IGNA 1SD6A 3BPVA 2JPCA 3N97A 1HLVA 1PDNC 4OAYA 4ASNA 3BR3A 2OQGA 4IKFA 4X1EA 1TQIA 4NQWA 2MABA 4RS8A 3PFIA 5JVGF 1LE8B 2GXBA 1TQPA 2BHYA 5FRMA 1AKHB 2P6SA 2ZFUA 3IHUA 3R60A 2HS5A 1ETOA 4XLNF 2NVXJ 4OMYA 2IRFG 4A69C 3H36A 3BT9A 3SFIA 4H4KC 2DK8A 5HVQC 5FFZA 2JZYA 2YU9J 4MTDA 3GTMJ 4BQAA 4N4NB 3ESWB 5H6QA 2DJNA 5L3EA 2B0LA 3E97A 2R5ZB 4MIMA 3TL4X 4P1WA 2XPWA 2A3SA 1ETXA 5GP9A 1FTTA 4QSHA 3JRHA 4RB2C 3I58A 2L7MP 5J3LA 1T2KA 2W24A 4B1RA 1LE8A 1R1UA 1J9IA 1BR2A 4IF4A 4HA8A 4FASD 3S2DJ 3ABKH 1AU7A 3HHHA 2WAFA 2XSDC 1Y6IA 3CF2A 4XN0A 4IQ4A 1GHCA 1QPMA 4DYQA 1VQPI 3TP0A 1EH7A 4B44A 2HTSA 2EFQA 3RZOJ 2CSOA 3IWFA 3JRAA 1D1CA 1D1BA 2I8DA 2F6CA 4R1HA 5CVJA 2V26A 2VPRA 2R5ZA 4B09A 1K6OA 3BR2A 2CUZA 3ELKA 1J75A 4M3EA 2EA4A 4II2A 4BJTA 1A35A 4HSRA 1WJAA 3BTIA 1YRNB 2HDDA 2L2OA 3FXOA 5K7HA 1XTAA 3H5RA 3L9FA 1XMKA 3PSFA 2F4IA 1HXDA 4HSTA 2Z99A 5EZGA 2BXYA 1ZK8A 2BV6A 2ZNYA 2DQLA 3LSKA 1DGRM 3F8FA 2F4MB 4HLXA 3E7LA 3K1PA 2CG4A 2E1MB 4U0WA 1MMSA 3KZZA 4B48A 4BXFA 4UNOA 2JPBA 2L7FP 1KYZA 4JYKA 4WWCA 4A6DA 4S04A 2PLYA 2DODA 4HF0A 1QQIA 1IRGA 2A69F 4PK4A 2ZMEB 1YRNA 1Z3XA 1USSA 2V6CA 1IO2A 2DI3A 2K86A 2A5YB 5HDKA 1NK2P 2HVQA 3GFJA 2E2IJ 1A6QA 4Y4RA 3RKQA 1XX5A 2ZFWA 4PJ0C 4U7BA 2VOPA 2MLKA 3IV5A 3ZN0A 4D5FA 5BOXA 1FP1D 1J0RA 2XGXA 3C2BA 2BBYA 2Y69H 2DK5A 2D1VA 2CGPA 1VQOI 2EIJH 4RB3C 1B72B 3WGHA 2A6TA 1SFEA 1SMYF 2DMNA 1VQ9I 2H94A 3WU1B 5KAIC 2PG4A 2MD0A 4HAMA 4BQOA 3M8EA 2ZMEA 1RIOH 3HSFA 1PJRA 4BUPA 1IUYA 3CUOA 1R22A 2C6YA 2LKXA 5M3FJ 5CVRA 1ERDA 4W1UA 2GIVA 3H3ZA 4E7ZA 4O5VA 1UHSA 3IH3A 4RAZA 4ZYHA 5H2FC 1ZRDA 3C3WA 3F9KA 4GCVA 3RJPA 4BL0B 2BE5F 4I02A 3V7RA 3KFWX 1QGPA 3BCAA 5K7FA 1VNDA 2XAQA 2EPFA 3IKTA 2NYXA 3O3KA 4OMZA 5E20A 3VYRB 1B72A 1H9TA 2HXOA 5GPAA 1K7AA 3FWEA 4EQQA 3KYCB 1GT0C 2HYJA 3KEYA 2R7UA 5HLIA 3M7GA 2L5QA 2LREA 2F48A 4RAGA 5TRDA 4XSZF 1VZ0A 4JQFA 1IUFA 5F1JA 1IF1A 1JKQC 1KU3A 1G4DA 3HUGB 3LQRA 1JT6A 2HKOA 4O3MA 4M3BA 4E7JA 1XGNA 2HFHA 4RGRA 2G9WA 5M5YJ 1MBFA 3ONQA 2K5CA 2GOXB 4G8XA 1YJNI 4G6QA 3ZQHA 1ETQA 3C18A 2X1DA 2M2EA 4EM2A 3RPUD 3QP5A 4LK1F 4KUMA 2FBKA 2FSWA 3CC2I 1GVJA 1YITI 4PJNA 1MBKA 2VBYA 1ETWA 3BP8A 3VSLA 3FXLA 3DEEA 1WHUA 5CVVA 2O5RA 2H1KA 3ZMUA 2QUFA 3DPTA 4R79A 2LY1A 5LGNA 4Y33A 5J4YA 3FX3A 5D6FA 2M87A 1VQ5I 4UVAA 3K69A 1MBHA 4JX6A 1K78B 1R1TA 5JLWA 5DYMA 4EGYA 3HUGA 1NTCA 1R00A 1UCRA 3K4NA 3WE3A 1H9GA 4PSXA 5D8LB 4PUSA 2ID6A 2CYYA 2JJ7A 3I59B 3FMQA 4C2UA 5DD8A 4ZYAA 3TGNA 5LRSA 1LVAA 1ZLKA 4BY7J 1AOYA 5FO5A 4QIWN 3ZQGA 1FNNA 3HJEA 2OQRA 2K85A 3OYFA 4QPOA 1S7EA 5EJCA 1MMDA 4PSWA 3RQ4A 2VODA 1BN5A 4RDUA 3S1NJ 4AYBA 3FIWA 2EA2A 4D9JA 1R5HA 1K78A 1EV7A 2Z9OA 3LSMA 5EZHA 3CJNA 4BGDA 1K61A 1WI9A 3W2VA 3GTPJ 3VODA 1LFBA 3GFMA 4RM2A 3GX4X 4M9ZA 3WGIA 4NC6A 2XPUA 2O0YA 5IP9J 4BACA 1BIBA 2CUFA 4IX7A 3UNGC 1FIAA 1RUNA 1G3YA 4PCQA 3I59A 2KIUA 3E0JB 4RMNA 3JAMZ 1EKEA 4HDVA 3R4KA 1IW7F 2DAOA 2BY3A 3CCYA 5IYCJ 3RPUA 5L3FA 2ECCA 5BNGA 3GTGJ 3R0AA 1ZN2A 4A3GJ 1SAUA 2YUSA 4MO7A 4S0HB 4ESBA 1FBUA 3OYCA 1I39A 3HC7A 3R61A 2V4JC 1LNWA 3OIPA 5L3GA 1OYWA 5E17F 2ZSIB 2W48A 2R5YB 1XG1A 3FHNA 3HOYJ 4MQ9F 4M71A 3RIRA 4OIRF 1HDPA 2LBFB 1NG7A 3HM5A 3QYBA 3VYTB 3HKZA 4B8XA 1F43A 2LK2A 3ASOH 4L9NA 2RC4A 5E79C 4TV7A 2F5CA 4MNUA 5BPIA 2B9SA 3J7ZI 4JK1X 1XMAA 3SZPA 1AA7A 1E2XA 2O7OA 3IC7A 3SZGA 3F23A 1A36A 5IT3A 3FHZA 4PJLA 2DOFA 3MMYB 1MSEC 4XK4A 3AG4H 2DLLA 3MQ0A 2P7CB 2CW8A 2L3DA 2R5YA 4I09A 5A2QK 5FD6A 2LKPA 2L7ZA 3K4JA 3OR1C 2IS4A 1IRFA 1Z67A 1RNLA 3NWSA 2LBFA 1W7PD 3CUQB 2HZDA 4KDPA 3BR5A 3GF2A 1SVLA 1YS7A 4MTEA 4ENNA 3BZKA 1I6HJ 3CF5F 1HKSA 4HV6A 5LHGA 3OYMA 5J4VA 2JWTA 4FCYA 3D5LA 3CO7C 1FPQA 3OYKA 3KEOA 1GXQA 1MGTA 1QU3A 3FF5A 1I27A 4OU0A 2W85A 1LPQA 2LSOA 3AG1H 3R0JA 3DCFA 2XB0X 1U9OA 1JUMA 1ZREA 1GUUA 3T1BA 1W5SA 4XICA 2QKLB 3I54A 2KJCA 3DBHB 3CUQA 4N9HA 3K7AJ 1B9MA 5J40A 3DTKA 1W7PB 4FTHA 2NOGA 2VJ4A 3LWFA 3KP5A 3RPQA 2LDUA 1DGWY 4D7MA 3EYIA 3J81Z 1TW2A 2CH0A 5LRRA 3SDBA 2LY2A 5IOYA 2DT5A 4LLLA 3Q0VA 4BBRJ 1PUEE 5E18F 4LLNA 1GXPA 4RLFA 1BI1A 3TDZC 2RREA 2QENA 3DPLC 1JGGA 5H6RA 2VJ5A 3IAM2 3F8NA 3RI4A 2IPQX 1V5FA 2CUJA 2QQ9A 3DTIA 1YW9A 3BC8A 3DXJF 4HNTA 2UXXA 4AYBN 4BQQA 2HOSA 2JSPA 1IV8A 1QVTA 1CF7B 1W7PA 5EDNA 2HVSA 3K70C 2R0QC 1TP4A 2OCCH 3VSKA 4CDGA 3RKYA 1G2HA 3ISPA 1T98A 2F5DA 4A0ZA 2OCEA 2ZJRF 1B1BA 3OSGA 2GA2A 2XC7A 2I5UA 2QZ8A 3IL2A 3BY6A 2DN0A 2HPIA 2WB1N 5H20A 3OS2A 3OYNA 2JTVA 1VQLI 1ACIA 3LAJA 1TTYA 2HDWA 2VN2A 4PJJA 2ACJA 2LTPA 2FQ4A 4DYRA 4CZZA 3BTLA 2KRHA 1M1EB 3RKXA 1CF7A 2QVOA 4L9VA 2E34A 2GA1A 4A2UA 4KA4A 3OIOA 1RR7A 1VFCA 3Q9VA 2KHMA 1U8BA 3I64A 1HOMA 1X4OA 3EDPA 2GZWA 1P7JA 1ZG5A 2DT6A 3DP7A 3OIQA 2G7HA 2VASA 2QSHX 2CV1A 1K79A 2CRGA 3H9GA 2L0KA 1SVMA 4IOAF 3OL3A 3JW4A 1DQUA 1U9NA 1KQ0A 4BNCA 3HOXJ 5GAHJ 5TGTA 1WJ5A 2A68F 3BJOA 4M72A 3EUHC 1HKQA 4F93B 2DYSH 3RZDJ 3SZTA 1Z6RA 3KP6A 3VWBA 2D2WA 2EV6A 4AIHA 4L5EA 4KYWA 1PVEA 1IN6A 3JRCA 3GTKJ 3QPSA 2NVTJ 2JA8J 1JHFA 1WJDA 3WTUC 4E7SA 2R7DA 3S14J 3ABUA 4CSWA 5DCFA 2E2HJ 5J8CA 3GUDA 5DEQA 3A1YA 5K5QA 4HF1A 1UAAA 3KP3A 3S1MJ 4IJAA 3JTGA 3H3UA 4ZDOA 2L9VA 3BQZA 3Q5FA 1KQ8A 3EUAA 4ZYDA 4LFUA 2JA7J 3RSNA 1Z7LA 4XSXF 2KDZA 2QQ8A 2Q8KA 4KN4X 4HX4A 1F9NA 2F5FA 2L02A 2LKSA 1S6LA 2JRMA 2P7VB 2ETHA 4A5NA 3G1LA 1IN4A 2HZTA 3S93A 5LFAA 2E36A 3TO6A 3QU6A 5L3CA 3L1PA 4XMYA 2DU9A 2R4GA 4N4OB 2R7WA 4JOMA 5J1YA 3B02A 1REPC 2BGCA 4M6XA 1T39A 2VC1A 3GXOA 2VJIA 3CMMA 1X1PA 1ZGAA 3F8BA 3LSTA 1J59A 4F52A 1X1AA 2P5KA 4M6VA 1OCPA 2HVRA 3C2GA 4E4HA 2A5WA 3DPUA 3HG9A 4I98B 3EUKL 4XKWA 1ZGWA 2JQ7A 4NNJA 1B59A 3CTAA 3I53A 4CXFA 2JVGA 4IHWA 4O6JA 3DBLB 1MJ9A 3U1DA 3DWLE 3WGGA 2STWA 1HC8A 2A6HF 1XCVA 1Z77A 5AIPA 4QTRA 1IAWA 3PO3J 1GLNA 2X1CA 3BZ6A 5J47A 4WX9A 1FTZA 1FP2A 3QYEA 3HPHA 2V1XA 2GLOA 1EA3A 2DMTA 2OV7A 3KZYA 4X0GA 3COAC 1T0FA 2J5OA 4C3JJ 3HRMA 2DBBA 1ZR4A 1C0WA 4LB5A 4NB5A 1N25A 3DEWA 3VEPA 1W4MA 5FFXA 4AIJA 4A3EJ 2NXNB 3OR2C 3PIOF 4LG3A 2M0MA 1LDDA 2DMUA 2J5PA 3QOPA 1QO0D 2GQQA 2M34A 4M3DA 3T8RA 1WCMJ 4XIDA 1AWCA 1BI3A 3BOQA 5CJ9A 3CCRI 1IDZA 2LOOA 2EV0A 3C7JA 1TC3C 3IRRA 3WHBA 4KISA 4YELA 3HGYA 2M7BA 3PJRA 4A5MA 2XASA 2X4HA 3KETA 3ML6A 2BEOA 2ME0A 2CO5A 2VXDA 4DGWB 2XF7A 2M8GX 3FK6A 2DA2A 2BY1A 2Z5UA 5HLGA 3OL4A 1WZ2A 2P5LC 4AM3A 1XGMA 4A3BJ 3K4MA 1FJLA 5D8KB 4I99C 3A03A 3MKLA 5FGMA 2IVMA 5KK1A 5D5WB 1ZYRF 4L5JA 2X6XA 5HS7A 2LR8A 3L2RA 4B4CA 2Y0SA 3NAUA 4WK8F 3PIPF 1B9NA 1N78A 3N4MA 1VQ7I 1BM9A 2XB5A 3H35A 4PFPA 4Q4ZF 4L18B 1PYVA 2OTJI 3QAHA 2DYRH 2XKPA 5E1WA 4IHYA 1BIAA 1Z0XA 3IH4A 1H89C 3QWLA 3AG2H 2XAGA 1O57A 3HZJA 4HEA2 4F91B 1X3WB 4Y52J 2V1UA 1T56A 2NOJB 5HS8A 2QF7A 2WY8Q 1IN7A 4XLFA 2W1OA 3E3VA 3H5NA 3KP2A 2IS6A 3TEDA 2K9QA 2L7KA 4EGZA 3B6AA 4XL9A 5L3DA 2DOEA 2HQ5A 4YFNF 5F1RA 2JMWA 3LSJA 2VUMJ 4X6AJ 2L9NA 5CYVA 2R7RA 1I1SA 2IJLA 3WTXC 3PQKA 2KP6A 2QQBA 3J80Z 1YOVB 1QZYA 3NARA 1K83J 1D8JA 3A02A 3W6KB 1BR4A 3H0GJ 5CKTA 1TWAJ 3GFIA 1ZR2A 3S2HJ 3OYEA 4BEHB 2DXIA 1VQ8I 1IXRC 4UXNA 5HLHA 3ZRGA 3FMSA 1QNTA 4LB6B 4HQEA 3DKXA 1Y1WJ 4AVZA 1ZHFA 1VQNI 2IBDA 3GLXA 4Y17A 4JX5A 4XRSG 5AONA 1AKHA 3FKIJ 1R4MB 2W00A 2PJPA 2VJJA 1I50J 3NWTA 3KLNA 4A3DJ 1VQKI 3AL0B 4C9YA 3C1DA 4XQFA 1YIJI 1MDMB 3FKJA 3WTYC 3SJMA 2H8RA 3Q9SA 1OCCH 2JA2A 1IC8A 3ZQ7A 1JHHA 3RDIA 4BEHA 2XVCA 4CCMA 3D1NI 1ITYA 4DW6A 3L2WA 3HOSA 2QYOA 4IL6C 1OCRH 5KHDA 1SFUA 4JP0A 3HRSA 1K4TA 5FRNA 4B3XA 3GW2A 2IA2A 2XRNA 4ZZLA 4U87A 3TP3A 2ELHA 2VE9A 3E5XA 1SVOA 2PMHA 1G3SA 2CQQA 3M8FA 3QPTA 5L3BA 1HW1A 3LSRA 4A3FJ 2LC2A 1NK3P 3D5SC 1MDMA 3QODA 1HW2A 3JSOA 1S7OA 3TW7A 2XGCA 2Y9YA 1J09A 2HGCA 1YYVA 3BG5A 5F0FA 4CGZA 1EH6A 1XCBA 2AO9A 3B6CA 2ZXHA 2HKXA 2XRLA 4F7ZA 4M3FA 2FA5A 1KQ9A 2ZXIA 4EJOA 1P92A 3G4SI 5CPRB 3FK7A 4CO8A 2JUCA 5ILVA 2Z3YA 1E3PA 1S72I 2F5EA 1O7LA 1OR7C 4S05A 4XLCA 3FXUA 2DPDA 3DTEA 1XSVA 1R6RA 4KIBA 5KVRA 4IHSA 3I4MJ 2Y0SN 4IPAA 1IJWC 2VBZA 3M9AA 3MD2A 1NG6A 3OMYA 2R92J 2K02A 4E7LA 4BAYA 2IT0A 2EFNA 2FMLA 2AXTC 5K7ZA 3B73A 4LK0F 2B63J 3MWMA 1MD0A 1YG2A 3K2ZA 2MH2A 1OPCA 1STZA 2NVQJ 1MMAA 1Z21A 4M9XA 5DUIA 3K70D 4HLYA 4HNVA 2M0CA 2E5NA 3ABMH 1ZAOA 2V6EA 5EG0B 3DKYA 3K4CA 5LGTA 3RCOA 2WAEA 1O3SA 1YX5A 1ON1A 2EZKA 2FBHA 2L9SA 2FUG2 1BI2A 3MN2A 1VI0A 2CQNA 3PUFA 3HXLA 1TWCJ 2RNJA 2FRHA 5HNHA 1ODDA 2JA5J 4UY8I 1J2XA 1TWGJ 3F21A 1HQCA 1WFXA 3CC7I 4OIQF 1BOAA 1P4WA 2CW0F 5FD5A 5FLXK 2ZSHB 2XDVA 1Y0NA 1IGNA 1XPXA 2DW4A 1T08B 2COBA 5F27A 3T0YA 2O3FA 4YIIA 4A6EA 3IWZA 3MZHA 3U1KA 1MZBA 4K2EA 1WWXA 4BE2A 2EJRA 2BY2A 3NRVA 3Q0WA 1H0MA 3MVPA 5KCMA 5EG0A 1JUSA 2MFZA 1Y8RB 3RTRA 1XD7A 1FSHA 1XDSA 1V3FA 1ETVA 3G1OA 1JTXA 5FKMA 4UB8C 2EZHA 1TZLA 2XHKA 3K4KA 4U0YA 2F2EA 1A04A 2LG4A 1O3QA 2NAZA 4FE7A 3FISA 4ZH4F 2PN6A 4AWXB 3KYLA 3P9IA 4E7KA 2DFHA 3E6DA 2KIMA 4GYIA 4OIPF 4BBSJ 5EYRA 3TW6A 4HW0A 3OYLA 2RV8A 1Y56A 3KPHA 5DS9A 1HF0A 2R7VA 4IHVA 1SFKA 3SQNA 1HW5A 5F0CA 5IOZA 4Y7NJ 1V55H 3CP8A 2Y9ZA 2JT1A 3CCMI 3I4NJ 1FYLA 1KZHA 1D1AA 3LQQA 4CCNA 2BY0A 1V54H 2XKOA 3V7CA 5EF6A 2PEXA 3BTJA 2E60A 2OJED 2WV1A 3K4LA 3KE2A 2ADUA 3HPGA 4Y15A 4P9UA 3LA2A 4II3A 1E17A 4F3QA 4KITB 1VQ4I 4RBOA 1VF9A 5LD2C 3GYHX 2CFOA 3OOPA 2WY7Q 4ANJA 1HCRA 2W82A 2V1NA 2M8EA 2EFWA 3FXRA 5D4SA 4BQNA 2H1LA 1IXSB 2FBIA 2V7FA 1ZKGA 4G6TB 3E6BA 2GBYA 3HRTA 2ZO4A 4MLOA 4HZFA 3H92A 3EPZA 1DUXC 3PQJA 3G3ZA 4MFDA 2OA4A 4DQ2A 3BQYA 3QOEA 1B4AA 3F0CA 3WTZA 4A12A 2PFBA 3SXYA 2CV0A 2K3FA 3EUHA 4F92B 3HOVJ 1N75A 2WADA 4UUTA 3BZCA 5DD4A 4U0VA 3O8HA 2STTA 3A2KA 2D1HA 3D0SA 1ZG3A 1Z05A 1U5TC 3DKWA 2KDOA 4U7DA 3HHGA 2FOKA 1ZH5A 5KNLA 3V8LA 3TO7A 4HG2A 5TISC 1YW8A 1SD5A 3BDDA 1YE9A 1HSTA 2IA0A 3VFZA 4C2MJ 3CCJI 1OLTA 2W25A 5E3NA 3LSPA 2IXSA 2LP0A 3NQOA 4XRMA 2R7TA 4MQVA 2Z1DA 1WJBA 3I56I 1WPKA 3PSIA 4LG0B 2F4OB 2QKMB 4ENMA 2JA6J 3SEQA 1ETYA 3KP4A 3TOAA 1QA6A 3DQVC 5ICFA 4ZTFA 1Y1VJ 3FBNB 5JHUA 4CCKA 3F22A 4J01A 1O3TA 3ZQFA 1WSUA 3PUBA 3FBIB 5B5EC 5FLVA 4XKVA 5FKOA 4WCGA 1Y39A 1ONVA 4XKBA 2WA0A 2VKDA 3F6VA 4KT5C 3KCCA 5EGOB 4XLHA 2P4WA 1ENHA 3K2AA 5C4JJ 2W57A 2X1EA 3OYIA 5EEHA 5ICCA 2X51A 4CHUA 4LG0A 4UHTA 2CS3A 3LAPA 2LF8A 2DFEA 3DLAA 3ZXSA 1PP7U 3ZGKA 3CJRB 3PNTA 3N05A 1FWZA 5GAEJ 4QLCU 1UJ8A 5ED4A 5BMZA 2PI0A 2IGOA 1U2WA 2W7NA 1X1BA 2HQNA 4DJAA 4B43A 2H6BA 5K5OA 1FMWA 1UELB 1YX3A 3FMRA 4KMFA 2UZKA 5K1YA 1MMNA 4GRIA 5EGOA 4Z2YA 2JN6A 4A0XA 4UUSB 2H8WA 3FXQA 3HTSB 2CQ7A 4EJVA 4FISA 3GWZA 3I5UA 4BYYA 3W6VA 3SFZA 1I3QJ 3KZIC 3WU0A 5ILUA 3DU6A 3GTQJ 1KYWA 1BOBA 3E6CC 2L54A 4QWQA 2DMPA 4KJZA 3CMYA 4HV5A 3BR6A 4Y3OA 3G1MA 3VPRA 3PL8A 1X58A 2OC6A 4PJMA 2FF4A 3MZYA 3ZQLA 1TWHJ 3HTUA 2ZJPF 4HNUA 4UUSA 1YJWI 2QGUA 3BG9A 3U9GA 5FKNA 3HIFA 2G0EA 2IA1A 2PMZA 2VKEA 1GVDA 3KP7A 1L0OC 2DA5A 2Y0MA 1SANA 2NVUB 2GIZA 5LGUA 3HGGA 2HOEA 2KKOA 2EZIA 1W0UA 2KIQA 4NUBA 3OV8A 1X4PA 3ASNH 4RLQA 3GFLA 5LHHA 1FLIA 5FROA 3NEUA 5TJJA 2R7FA 4ABZA 3KX2A 4YFXF 2X6WA 1YW7A 2ZCWA 4YG2F 1R58A 1WVRA 3ZMVA 2FE3A 2HDCA 3A0BC 2ELJA 2QCOA 1W1WE 3HKZN 4KIFA 3CMAI 4LOCA 2DFIA 3LNQA 3ROUA 4HYEA 3IAS2 2JRTA 3W2AA 3OWTA 3P7NA 1WI3A 1O3RA 3BR1A 2VL8A 4DNCA 4Q48A 1MH4A 3E1SA 3RQIA 4YEJA 2O61A 1TT0A 2OU2A 2IEKA 1E3OC 1JI8A 2MW8A 2VQGA 4I2OA 5FKLA 5E1ZB 4RGUA 3MFKA 1OJLA 2KL4A 3AKZA 1JKRC 1MSFC 3WG9A 5BS6A 4IEJA 2H09A 2M4GA 1XGOA 4EEFG 4E7IA 3HB9A 9ANTA 2DA3A 1FX7A 2MC3A 2QLZA 1FBSA 4LMYA 5F08A 3M07A 3HOTA 2VXZA 3LL7A 4HDUA 5GADJ 3WG7H 4A3LJ 4BHCA 4M3GA 2RQQA 5IYBJ 5E8IA 2VLAA 3GLLA 2E35A 2ZKZA 3JRIA 2E71A 2ZJQF 3LSIA 4Q47A 6PAXA 3PNYA 1FEXA 2Q2EB 2VPLA 1EF4A 3OSFA 3H1CA 3Q0UA 1ZQ3P 1FC3A 1G3TA 3DBRB 1O4XA 1D5YA 2K9NA 4ITVA 4ZJZA 1YLFA 3GBGA 5J8FA 1PP8F 1MIJA 4DYCA 2HI3A 2QA4I 1T38A 1X19A 1YJ9I 2M1BA 2VI6A 2V1DA 1R9TJ 1NHAA 2EILH 2LRDA 4J00A 4CUGA 4WF2A 1ZG1A 2UUZA 4UV9A 3DF8A 1N77A 2FQ3A 2V9KA 1F1ZA 5JR3A 4UB6C 3OYGA 3WTSC 4HOBA 3CESA 4V2FA 2NS7A 5LHIA 2Q2EA 3S1QJ 4PDKA 4Q5SF 4LIUA 1MBJA 3TQNA 2UV1A 3L2UA 2HPMA 1WJCA 3I9V2 4A93J 4KT6A 4P96A 4E6KG 5C44J 2CMPA 4BJ6C 3K0LA 1W36C 2LNBA 1FOKA 3CP2A 2KT0A 2K3PA 1R7JA 1QRYA 1LEBA 1SC7A 3FM5A 1P6RA 3BJAA 2DDBA 2GXAA 4KNYA 2UWMA 4V19K 4BU2A 4D7NA 1OR7A 2WC2A 4GO1A 2DA6A 5CQGA 4PGGA 3WTWC 3ZN1A 1P4AA 2PMZN 3ABTA 1XMXA 1Z6TA 5IPAA 1P4XA 3S3MA 1X3ZB 2VBXA 2X48A 3MCZA 5LLQA 1ZLJA 2AQEA 4L9TA 4LITA 4NC8A 3KLOA 3QPLA 1HA8A 2XGEA 1S9HA 4ETSA 1YS6A 3ABLH 1A31A 1TL8A 3S16J 2Y48A 3G71I 2R7XA 2ISYA 2KIFA 4IHXA 1F5TA 3D5RC 2JSCA 4MGRA 1BR1A 3OYJA 1BJAA 1KU7A 4XBFA 2ZC2A 5A2QZ 1R4NB 5ICEA 2VKHA 1X2MA 2FX0A 2GWRA 3S8PA 3CMEI 1LQ1A 3JTHA 1EH8A 3QYFA 1GV2A 2RQPA 4UVBA 3S32A 1QPIA 3BJ6A 4R8HA 3U2RA 1OQYA 2YX4A 2LYCA 1ULYA 2DO7A 1R23A 2G7UA 1WH5A 2RNGA 2UXNA 1Q1HA 1KA8A 4XOTA 4Z6YA 1I3AA 4A3MJ 1VTNC 1RZ4A 1TNSA 1FZPB 2CU7A 3K6GA 4OWRB 1KU9A 4A3IJ 2CJJA 3KEQA 4HQMA 2VBWA 3ECOA 4IQJA 4XR6A 3MKYB 3VB2A 4ZDPA 4LGWA 1E0EA 4YRVA 1OCOH 3CCSI 4I76A 4BY1J 1Z1DA 4P55A 1BBYA 2FXAA 3L00A 3VYSB 3ZMDA 3CDIA 4DBQA 5HDNA 4QPQA 1Z9CA 3I0TA 4G7OF 1LDJA 1WRJA 1R49A 3JAMK 1ZRFA 4I01A 4OINF 2IGKA 2QSGX 2HOTA 2FU4A 4M6YA 3C2HA 1MMGA 1G6NA 2BYVE 3TO9A 5CVIA 2I10A 2ESHA 1HSJA 2PQ8A 2XAUA 1MBEA 3CD6I 4XRFA 3ZQQA 2NS8A 4EM1A 1SFOJ 1J5YA 1FYKA 2IS1A 4EATA 4FX4A 2OBPA 3GO5A 2AHQA 4I6ZA 4P9FA 3HRUA 5E1XA 3AFHA 3BPXA 2LF7A 3RKWA 3AL0C 1MW7A 3L09A 4G9YA 2ZB9A 4ZYEA 3GTLJ 2ZBKA 4OAZA 4LJZF 2KQRA 1GDTA 1POGA 2A05A 4HBLA 5EEAA 1JE8A 5C3EJ 2KZGA 2PBIA 2Y2ZA 3WHCA 1VQ6I 3MKZA 1QZZA 2CFXA 3TBIA 2QM3A 5B1AH 1LUJB 1ZELA 3RYPA 2FNAA 2M5WA 1HBXG 1EJ9A 3CCLI 1UFMA 2EK5A 1DPRA 2PJRB 3LSGA 1U5TB 2XF6A 4PGHA 1X3UA 1U8RA 4DZPA 4CICA 3E5QA 5F0HA 2X0LA 1FY7A 4UVCA 2H27A 2P81A 3SDGA 3ERED 4EMSA 3CCQI 1RR8C 2TCTA 4C3HJ 1U0JA 5GPCA 2DTZA 1OKRA 2A07F 2VOOA 2VQLA 3CJTB 3A01B 1SEUA 2VONA 2N8GA 1FBQA 3F72A 3I3LA 1OISA 4A0YA 4BDZA 3QQAA 3PM1A 2VE8A 3WU2C 1S8NA 1WH7A 4HX7A 1Z3YA 3L7WA 2E1NA 2EINH 2Y31A 4L9JA 4CA0A 2OF7A 2XAFA 2E2JJ 4MEYF 4C30A 2BOLA 3F6OA 4IVNA 3E6MA 3REOA 1FOXA 3OY9A 5J1RA 2PJRA 1U5TA 1S29A 3O8GA 4I0BA 2K7LA 1JTYA 4KFCA 2LLKA 4ZC3A 2HYGD 1JKPC 1BJZA 4L5IA 2IAIA 3Q3SA 2X6YA 1Y0UA 3JRBA 1IG7A 3A01A 1RUOA 3GVAA 1W5CC 3LFKA 4ESFA 2FJ1A 2MD5A 2EWNA 1WJFA 3CDHA 4D1QA 1IRZA 5M3MJ 2MYSA 4KN7X 2VQHA 5ILSA 4CCJA 3J81K 5CVUA 3I4PA 1S7AA 5D5XB 3PO2J 3CZ6A 2EBIA 3OYDA 4HPQA 3CCUI 2DCEA 1T0FC 1X1DA 1XSXA 2AQFA 2RKHA 3LA7A 5DCMB 5LBQA 2QEXI 4FE4A 3AAFA 2FMYA 5DUKA 2HWVA 1TQMA 4EM0B 3LA3A 3BLYA 1WJEA 4CZCA 4JX4A 1SFXA 2GOMA 3ZMZA 3JRGA 2Q1ZB 2R7OA 2BZTA 3TOBA 1A6IA 1IV6A 3W2WA 2DA4A 5HS9A 4BJ5C 3KIOA 1BC7C 4DZJA 3IH2A 2D5VA 2XIGA 2L4MA 2E7WA 2B7EA 3BWGA 4HX8A 1VQMI 3IP4B 4DBRA 1QHHD 5DCMA 2P0WA 2D45A 5FB2A 1R5ID 2KMUA 1OYYA 1IDYA 5CLSA 3FM3A 4GYGA 2VC0A 4RA2A 3MZ8A 3CCEI 4OIOF 1A5JA 1OFCX 3L2VA 2EIKH 5GAGJ 2AXLA 3ZCOA 1UZCA 5BPDA 1R5GA 1FYMA 4B47A 5E3MA 2QWWA 3L2QA 4ZYGA 3WTVC 2BXZA 3DLLF 1YHQI 2NVYJ 5IT9K 4OOIA 2V79A 3A4CA 3HYIA 2L01A 4DOZA 1HKTA 3V42A 3V7SA 2WAQA 5K5RA 1SD7A 4RB1A 2VKVA 1K6YA 3IRQA 3QU3A 3MEXA 3ZR8X 5IP7J 3H5AA 4YIRX 4AIKA 3CC4I 4MHGA 2E1CA 2ECBA 3IKVA 3LOCA 1FT9A 2XUBA 2M30A 2WBMA 2LY9A 3DV8A 3T5XA 2TDXA 1RKTA 2OPTA 5HLTA 1TLHB 2LFBA 4AU7A 4I7HA 3ZMSA 5JHFA 5M5XJ 2CQKA 2M9HA 4HF2A 1J7KA 1H8AC 5IYDJ 5J1UA 4D0PA 4YIFA 2BVMA 1YI2I 1X2NA 1TT5B 4BXUA 4RGSA 1H88C 1JT0A 1B6AA 3S3OA 1T8IA 2DDAA 5JLXA 2R7QA 1GV5A 2HQAA 2LMDA 4AD9A 3I55I 3ECHA 1L3LA 4GXOA 2P8TA 5LEJA 3M1CA 1DP7P 1UG0A 1QVUA 2KLOA 3HBLA 1TW3A 2W4SA 2ZXWH 2GAUA 3F3XA 2VIXA 1YFHA 1YIOA 1APLC 1V4RA 3KYDB 3GZ5A 4XLPF 2XF5A 1ETKA 3TMOA 3OYBA 1NH3A 1G8XA 2VQCA 3FXJA 3TDUC 1LFUP 3K10A 4WXCA 2O9LA 1RC9A 4N0BA 2DA7A 1UHMA 4M73A 3ZPLA 1G3WA 4J19A 2DQRA 1MJBA 1LVKA 2E19A 2K4JA 4FT8A 1KGSA 5GTIC 3LMMA 4LIVA 3WODF 3HOUJ 5JVTA 2RAEA 4RB0A 2MC4A 3RYRA 2YU3A 2X6OA 4XLEA 1W36D 4ENJA 5B3SH 1IN8A 4KIGA 2Z2SB 2A6EF 3FDYA 1IXCA 2ESNA 2WB1A 2DT7B 2WWYA 2YPRA 3IUOA 2CW7A 1G59A 1D5VA 3JR9A 1S5LC 2OD5A 3SHFA 2KPMA 2NS0A 1UMQA 1W5TA 2M45A 2W84A 3S3NA 2EH3A 1P7IA 2RN7A 1UG2A 2NRAC 3OYHA 5E3OA 1BA5A 2EFOA 3TKYA 1V5GA 4BHPA 4H0EA 5CQEA 3BROA 4EV0A 2OZUA 4FX0A 1BI0A 4RAFA 3DEUA 3S2WA 2XSJC 4EJWA 2XAHA 1Z7UA 1RKWA 2EIMH 2RGVA 1BW6A 3ERMA 3FXMA 3JREA 3P9KA 2MA3A 4G94A 1LJ9A 3UR3C 1MKMA 4G12A 4PFOA 4G7ZF 1B8IB 2E5ZA 2XAJA 3DU5A 4WXDA 4D5CA 2V9VA 1D0ZA 4L0ZB 3HSEA 2MBFA 5E3LA 3ZMTA 2E1MC 4BH9A 4BDYA 3T8TA 4EJTA 1AHDP 3JSPA 3FXKA 2ZJ2A 2NNNA 2E1OA 1ZRCA 1I6XA 3X2QH 1YO5C 2MSYA 3WE2A 3JRDA 2IGMA 2ICWG 2OUMA 2JVHA 2DJIA 3HDDA 2VT2A 1DU6A 2WAQN 2M3AA 2QQAA 2VB6A 1FMVA 2ZMEC 4UUVA 3GZ6A 1TWFJ 2HQRA 3BR0A 3GCMA 4CYDA 1XS9A 3GTOJ 1MNMC 3K1NA 4IXAA 4XNFA 2FEZA 5D4RA 3S1RJ 3G73A 2P5VA 1B8IA 2CQXA 3ULQB 4XN3A 4XONA 2EZLA 3HEFA 1BL0A 1F4KA 2KFDA 1HDDC 3GZNB 1RPWA 3EQLF 2LH9A 1ZTRA 5D5VB 2EFPA 1TNTA 2IW5A 2Z16A 3H9QA 1JJ8C 1CGPA 2IS2A 4ZZDA 3M1EA 1Y8QB 1O7FA 5M5WJ 1D3YA 4BE0A 1JUPA 1FIPA 2AS5F 4N9IA 5JFRA 3CDLA 3J80K 1JJ6C 1XN7A 4GFBA 4W97A 2OTLI 2L4AA 2LD5A 2MLGA 4CYCB 1WKMA 3H3VK 1CQTA 3M3YJ 3R6SA 2CV2A 3L2CA 3CLOA 3ZQCA 5FJ8J 2VT3A 4U88A 4M74A 2H6CA 1ZGJA
chains in the Genus database with same CATH topology
3S1NJ 3TW7A 3QPLA 2XGCA 2Y9YA 3FIWA 5DTDA 2XGEA 3BG5A 5F0FA 2JK3A 3M4OJ 5EZHA 2AO9A 1K61A 3GTPJ 3B6CA 1LFBA 3S16J 3S17J 2XPUA 2TRTA 2XRLA 4M3FA 5IP9J 2CUFA 4IHXA 1FIAA 1PUFB 3FK7A 4CYCA 3CCYA 5IYCJ 2ECCA 5BNGA 3GTGJ 3BG3A 2ME6A 1X2MA 2FX0A 3I4MJ 2Y0SN 2DA1A 2YUSA 4MO7A 4S0HB 4A3GJ 3ZQIA 1IJWC 4V2GA 1GV2A 2HXIA 1OCTC 2R92J 4B3AA 1QPIA 4A3JJ 2FD5A 2W48A 5K7ZA 2R5YB 2B63J 1XG1A 1WH5A 2NVQJ 3HOYJ 2GM4A 1HDPA 4A3MJ 3HM5A 4HNVA 2M0CA 1PUFA 2LK2A 1F43A 2CU7A 4A3IJ 1JKOC 2CJJA 5EG0B 2EZKA 3S15J 3MN2A 1VI0A 1Q1VA 1MBGA 3OOUA 4A3CJ 1TWCJ 2O7OA 2JA5J 4I76A 1TWGJ 5FLMJ 4BY1J 1MSEC 4XK4A 1IGNA 2R5YA 4XRSA 2COBA 5F27A 2L7ZA 2HOTA 3GTJJ 2R7ZJ 2I10A 3BR5A 1W0TA 3Q0WA 1MBEA 3MVPA 5EG0A 1JUSA 1I6HJ 2NS8A 1ETVA 5IP6A 3G1OA 1SFOJ 2JWTA 1JTXA 3ZOBA 4I6ZA 5FKMA 2AHQA 4FCYA 2EZHA 2ZB9A 3GTLJ 3UKGA 1GDTA 1POGA 5EEAA 5C3EJ 2Y2ZA 4FE7A 3FISA 3WHCA 1BW5A 1RESA 3DCFA 2XB0X 1U9OA 3CQZJ 2CUEA 2O8KA 1JUMA 4BBSJ 4AUXA 5EYRA 3TW6A 1GUUA 4XICA 3LSGA 1HF0A 5DS9A 4DZPA 3K7AJ 4IHVA 5F0CA 5F0HA 4FTHA 2NOGA 2P81A 3SDGA 2K40A 5IOZA 4Y7NJ 3HOWJ 5F04A 2Y9ZA 4D7MA 3I4NJ 2TCTA 4C3HJ 1WGXA 5GPCA 2DTZA 2MG4A 5IOYA 5EF6A 3Q0VA 4BBRJ 3BTJA 3A01B 2N8GA 2ID3A 2WV1A 3QQAA 3PM1A 1WH7A 1F36A 2X9DA 2Y31A 4C3IJ 2OF7A 2E2JJ 1JGGA 4RBOA 2YS9A 1VF9A 5J1RA 1DU0A 3O8GA 1HCRA 4AYBN 2HOSA 1QVTA 5EDNA 1JTYA 1RETA 1T33A 1ZKGA 2LLKA 2R0QC 2DMQA 2GBYA 2R93J 5FKKA 1JKPC 1BJZA 4MLOA 2Y30A 2IAIA 1G2HA 3Q3SA 3JRBA 1IG7A 4MFDA 3A01A 3BQYA 3F0CA 2FJ1A 3OSGA 2DN0A 3HOVJ 1IRZA 2K9SA 5M3MJ 2WB1N 4UUTA 3O8HA 3PO2J 2XPVA 2EBIA 2LTPA 2FQ4A 4DYRA 1ORKA 3BTLA 2EQRA 5HODA 4FE4A 3OIOA 1RR7A 3JRFA 1VFCA 1U8BA 1HOMA 4BXXJ 3HOZJ 3BTCA 4C2MJ 1P7JA 4AC0A 3LSPA 5E3NA 4JX4A 2LP0A 4XRMA 4NDLA 3JRGA 2MGQA 2CRGA 2L0KA 1A6IA 1U9NA 4BKXA 1WPKA 2XGDA 3HOXJ 1IV6A 2DA4A 5C4XJ 4DZJA 2JA6J 1ETYA 3IH2A 2D5VA 1XC5A 4A3KJ 3RZDJ 1U78A 1Y1VJ 2L9RA 4L5EA 2HOAA 2ELKA 1MH3A 3JRCA 3GTKJ 3QPSA 3ZQFA 2NVTJ 2JA8J 5FLVA 3S14J 5FKOA 2E2HJ 1IDYA 2LVSA 4MFEA 3S1MJ 1HLVA 5EGOB 3BQZA 3BR3A 1ENHA 3K2AA 5C4JJ 1A5JA 1OFCX 4X1EA 2JA7J 1LE8B 2KDZA 1AKHB 5E3MA 1ETOA 2NVXJ 4A69C 3BT9A 3SFIA 3G1LA 2NVYJ 3L1PA 2YU9J 3GTMJ 2DJNA 2VKVA 5J1YA 2R5ZB 4MIMA 5IP7J 2XPWA 1ETXA 5GP9A 1FTTA 2ECBA 5EGOA 4QSHA 3LOCA 3JRHA 2L7MP 2LY9A 2JN6A 5J3LA 1RKTA 2OPTA 4B1RA 4UUSB 1LE8A 4M6VA 1OCPA 3S2DJ 2LFBA 1ZGWA 5M5XJ 2M9HA 1AU7A 2XSDC 4FISA 3W6VA 1H8AC 5IYDJ 1I3QJ 5J1UA 4IHWA 3GTQJ 1X2NA 4DYQA 2DMPA 3TP0A 1H88C 4QTRA 1Z77A 3RZOJ 3CMYA 3PO3J 1JT0A 3BR6A 3JRAA 5JLXA 1FTZA 1GV5A 2VPRA 2R5ZA 3G1MA 2GLOA 3BR2A 2DMTA 3VPRA 1X58A 4M3EA 4C3JJ 1QVUA 1ZR4A 3HBLA 3ZQLA 1TWHJ 3BTIA 3DEWA 4UUSA 1APLC 1YRNB 2HDDA 5K7HA 4A3EJ 3BG9A 1ETKA 5FKNA 2DMUA 2G0EA 2M34A 4M3DA 1WCMJ 5EZGA 1ZK8A 4XIDA 2VKEA 1GVDA 1LFUP 2O9LA 2DA5A 1IDZA 3E7LA 1SANA 2DA7A 1TC3C 4J19A 3HGGA 2E19A 3WHBA 2EZIA 1W0UA 3HGYA 2L7FP 4JYKA 3HOUJ 2ME0A 2RAEA 4ABZA 2M8GX 3FK6A 2DA2A 1YRNA 2X6OA 1NK2P 4A3BJ 1FJLA 2E2IJ 3A03A 3MKLA 2QCOA 3HKZN 3RKQA 2LR8A 4LOCA 3LNQA 4B4CA 3IV5A 3NAUA 4D5FA 3JR9A 1WI3A 3C2BA 3BR1A 1UMQA 2EH3A 2XB5A 1MH4A 1B72B 1P7IA 3RQIA 1UG2A 2DMNA 5E3OA 1BA5A 2IEKA 1E3OC 4IHYA 2MW8A 1Z0XA 3IH4A 1H89C 5FKLA 1OJLA 1JKRC 4Y52J 1MSFC 1T56A 4IEJA 2QF7A 4EEFG 2LKXA 5M3FJ 3HB9A 1RKWA 4W1UA 9ANTA 3JREA 1BW6A 2DA3A 1UHSA 3IH3A 5F08A 3TEDA 2K9QA 4G12A 3B6AA 1B8IB 2HQ5A 2JMWA 3LSJA 4D5CA 2VUMJ 4X6AJ 5K7FA 4A3LJ 1VNDA 4M3GA 5IYBJ 5E3LA 1AHDP 1B72A 3JRIA 2HXOA 5GPAA 2E1OA 3NARA 1GT0C 2MSYA 3JRDA 1K83J 2HYJA 3HDDA 1FEXA 3A02A 1DU6A 2WAQN 3H0GJ 1EF4A 1TWAJ 3OSFA 3S2HJ 1ZR2A 3Q0UA 1ZQ3P 1IUFA 1TWFJ 3BR0A 5F1JA 1XS9A 1O4XA 1JKQC 1D5YA 3GTOJ 2K9NA 1JT6A 1MNMC 3GBGA 4M3BA 4DYCA 2HI3A 1Y1WJ 5M5YJ 3S1RJ 1MBFA 1B8IA 2CQXA 2IBDA 2VI6A 2EZLA 3HEFA 1BL0A 3ZQHA 4JX5A 1HDDC 1ETQA 4XRSG 1AKHA 2M2EA 1R9TJ 3FKIJ 1RPWA 4A3DJ 1I50J 1ZTRA 1MBKA 1ETWA 2H1KA 1JJ8C 4V2FA 2NS7A 3S1QJ 3SJMA 2H8RA 1MBJA 1IC8A 1MBHA 4JX6A 5M5WJ 5JLWA 4A93J 5C44J 1NTCA 3D1NI 1ITYA 1JUPA 1FIPA 4DW6A 3CDLA 1JJ6C 2KT0A 2ID6A 4GFBA 4W97A 1QRYA 2LD5A 2JJ7A 4CYCB 3H3VK 4JP0A 4BY7J 4D7NA 1CQTA 3TP3A 3ZQGA 4QIWN 3M3YJ 2DA6A 2CQQA 2PMZN 5IPAA 3LSRA 3ZQCA 5FJ8J 1S7EA 4A3FJ 2X48A 1NK3P 4RDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N J;  3TW7 A;  3QPL A;  2XGC A;  2Y9Y A;  3FIW A;  5DTD A;  2XGE A;  3BG5 A;  5F0F A;  2JK3 A;  3M4O J;  5EZH A;  2AO9 A;  1K61 A;  3GTP J;  3B6C A;  1LFB A;  3S16 J;  3S17 J;  2XPU A;  2TRT A;  2XRL A;  4M3F A;  5IP9 J;  2CUF A;  4IHX A;  1FIA A;  1PUF B;  3FK7 A;  4CYC A;  3CCY A;  5IYC J;  2ECC A;  5BNG A;  3GTG J;  3BG3 A;  2ME6 A;  1X2M A;  2FX0 A;  3I4M J;  2Y0S N;  2DA1 A;  2YUS A;  4MO7 A;  4S0H B;  4A3G J;  3ZQI A;  1IJW C;  4V2G A;  1GV2 A;  2HXI A;  1OCT C;  2R92 J;  4B3A A;  1QPI A;  4A3J J;  2FD5 A;  2W48 A;  5K7Z A;  2R5Y B;  2B63 J;  1XG1 A;  1WH5 A;  2NVQ J;  3HOY J;  2GM4 A;  1HDP A;  4A3M J;  3HM5 A;  4HNV A;  2M0C A;  1PUF A;  2LK2 A;  1F43 A;  2CU7 A;  4A3I J;  1JKO C;  2CJJ A;  5EG0 B;  2EZK A;  3S15 J;  3MN2 A;  1VI0 A;  1Q1V A;  1MBG A;  3OOU A;  4A3C J;  1TWC J;  2O7O A;  2JA5 J;  4I76 A;  1TWG J;  5FLM J;  4BY1 J;  1MSE C;  4XK4 A;  1IGN A;  2R5Y A;  4XRS A;  2COB A;  5F27 A;  2L7Z A;  2HOT A;  3GTJ J;  2R7Z J;  2I10 A;  3BR5 A;  1W0T A;  3Q0W A;  1MBE A;  3MVP A;  5EG0 A;  1JUS A;  1I6H J;  2NS8 A;  1ETV A;  5IP6 A;  3G1O A;  1SFO J;  2JWT A;  1JTX A;  3ZOB A;  4I6Z A;  5FKM A;  2AHQ A;  4FCY A;  2EZH A;  2ZB9 A;  3GTL J;  3UKG A;  1GDT A;  1POG A;  5EEA A;  5C3E J;  2Y2Z A;  4FE7 A;  3FIS A;  3WHC A;  1BW5 A;  1RES A;  3DCF A;  2XB0 X;  1U9O A;  3CQZ J;  2CUE A;  2O8K A;  1JUM A;  4BBS J;  4AUX A;  5EYR A;  3TW6 A;  1GUU A;  4XIC A;  3LSG A;  1HF0 A;  5DS9 A;  4DZP A;  3K7A J;  4IHV A;  5F0C A;  5F0H A;  4FTH A;  2NOG A;  2P81 A;  3SDG A;  2K40 A;  5IOZ A;  4Y7N J;  3HOW J;  5F04 A;  2Y9Z A;  4D7M A;  3I4N J;  2TCT A;  4C3H J;  1WGX A;  5GPC A;  2DTZ A;  2MG4 A;  5IOY A;  5EF6 A;  3Q0V A;  4BBR J;  3BTJ A;  3A01 B;  2N8G A;  2ID3 A;  2WV1 A;  3QQA A;  3PM1 A;  1WH7 A;  1F36 A;  2X9D A;  2Y31 A;  4C3I J;  2OF7 A;  2E2J J;  1JGG A;  4RBO A;  2YS9 A;  1VF9 A;  5J1R A;  1DU0 A;  3O8G A;  1HCR A;  4AYB N;  2HOS A;  1QVT A;  5EDN A;  1JTY A;  1RET A;  1T33 A;  1ZKG A;  2LLK A;  2R0Q C;  2DMQ A;  2GBY A;  2R93 J;  5FKK A;  1JKP C;  1BJZ A;  4MLO A;  2Y30 A;  2IAI A;  1G2H A;  3Q3S A;  3JRB A;  1IG7 A;  4MFD A;  3A01 A;  3BQY A;  3F0C A;  2FJ1 A;  3OSG A;  2DN0 A;  3HOV J;  1IRZ A;  2K9S A;  5M3M J;  2WB1 N;  4UUT A;  3O8H A;  3PO2 J;  2XPV A;  2EBI A;  2LTP A;  2FQ4 A;  4DYR A;  1ORK A;  3BTL A;  2EQR A;  5HOD A;  4FE4 A;  3OIO A;  1RR7 A;  3JRF A;  1VFC A;  1U8B A;  1HOM A;  4BXX J;  3HOZ J;  3BTC A;  4C2M J;  1P7J A;  4AC0 A;  3LSP A;  5E3N A;  4JX4 A;  2LP0 A;  4XRM A;  4NDL A;  3JRG A;  2MGQ A;  2CRG A;  2L0K A;  1A6I A;  1U9N A;  4BKX A;  1WPK A;  2XGD A;  3HOX J;  1IV6 A;  2DA4 A;  5C4X J;  4DZJ A;  2JA6 J;  1ETY A;  3IH2 A;  2D5V A;  1XC5 A;  4A3K J;  3RZD J;  1U78 A;  1Y1V J;  2L9R A;  4L5E A;  2HOA A;  2ELK A;  1MH3 A;  3JRC A;  3GTK J;  3QPS A;  3ZQF A;  2NVT J;  2JA8 J;  5FLV A;  3S14 J;  5FKO A;  2E2H J;  1IDY A;  2LVS A;  4MFE A;  3S1M J;  1HLV A;  5EGO B;  3BQZ A;  3BR3 A;  1ENH A;  3K2A A;  5C4J J;  1A5J A;  1OFC X;  4X1E A;  2JA7 J;  1LE8 B;  2KDZ A;  1AKH B;  5E3M A;  1ETO A;  2NVX J;  4A69 C;  3BT9 A;  3SFI A;  3G1L A;  2NVY J;  3L1P A;  2YU9 J;  3GTM J;  2DJN A;  2VKV A;  5J1Y A;  2R5Z B;  4MIM A;  5IP7 J;  2XPW A;  1ETX A;  5GP9 A;  1FTT A;  2ECB A;  5EGO A;  4QSH A;  3LOC A;  3JRH A;  2L7M P;  2LY9 A;  2JN6 A;  5J3L A;  1RKT A;  2OPT A;  4B1R A;  4UUS B;  1LE8 A;  4M6V A;  1OCP A;  3S2D J;  2LFB A;  1ZGW A;  5M5X J;  2M9H A;  1AU7 A;  2XSD C;  4FIS A;  3W6V A;  1H8A C;  5IYD J;  1I3Q J;  5J1U A;  4IHW A;  3GTQ J;  1X2N A;  4DYQ A;  2DMP A;  3TP0 A;  1H88 C;  4QTR A;  1Z77 A;  3RZO J;  3CMY A;  3PO3 J;  1JT0 A;  3BR6 A;  3JRA A;  5JLX A;  1FTZ A;  1GV5 A;  2VPR A;  2R5Z A;  3G1M A;  2GLO A;  3BR2 A;  2DMT A;  3VPR A;  1X58 A;  4M3E A;  4C3J J;  1QVU A;  1ZR4 A;  3HBL A;  3ZQL A;  1TWH J;  3BTI A;  3DEW A;  4UUS A;  1APL C;  1YRN B;  2HDD A;  5K7H A;  4A3E J;  3BG9 A;  1ETK A;  5FKN A;  2DMU A;  2G0E A;  2M34 A;  4M3D A;  1WCM J;  5EZG A;  1ZK8 A;  4XID A;  2VKE A;  1GVD A;  1LFU P;  2O9L A;  2DA5 A;  1IDZ A;  3E7L A;  1SAN A;  2DA7 A;  1TC3 C;  4J19 A;  3HGG A;  2E19 A;  3WHB A;  2EZI A;  1W0U A;  3HGY A;  2L7F P;  4JYK A;  3HOU J;  2ME0 A;  2RAE A;  4ABZ A;  2M8G X;  3FK6 A;  2DA2 A;  1YRN A;  2X6O A;  1NK2 P;  4A3B J;  1FJL A;  2E2I J;  3A03 A;  3MKL A;  2QCO A;  3HKZ N;  3RKQ A;  2LR8 A;  4LOC A;  3LNQ A;  4B4C A;  3IV5 A;  3NAU A;  4D5F A;  3JR9 A;  1WI3 A;  3C2B A;  3BR1 A;  1UMQ A;  2EH3 A;  2XB5 A;  1MH4 A;  1B72 B;  1P7I A;  3RQI A;  1UG2 A;  2DMN A;  5E3O A;  1BA5 A;  2IEK A;  1E3O C;  4IHY A;  2MW8 A;  1Z0X A;  3IH4 A;  1H89 C;  5FKL A;  1OJL A;  1JKR C;  4Y52 J;  1MSF C;  1T56 A;  4IEJ A;  2QF7 A;  4EEF G;  2LKX A;  5M3F J;  3HB9 A;  1RKW A;  4W1U A;  9ANT A;  3JRE A;  1BW6 A;  2DA3 A;  1UHS A;  3IH3 A;  5F08 A;  3TED A;  2K9Q A;  4G12 A;  3B6A A;  1B8I B;  2HQ5 A;  2JMW A;  3LSJ A;  4D5C A;  2VUM J;  4X6A J;  5K7F A;  4A3L J;  1VND A;  4M3G A;  5IYB J;  5E3L A;  1AHD P;  1B72 A;  3JRI A;  2HXO A;  5GPA A;  2E1O A;  3NAR A;  1GT0 C;  2MSY A;  3JRD A;  1K83 J;  2HYJ A;  3HDD A;  1FEX A;  3A02 A;  1DU6 A;  2WAQ N;  3H0G J;  1EF4 A;  1TWA J;  3OSF A;  3S2H J;  1ZR2 A;  3Q0U A;  1ZQ3 P;  1IUF A;  1TWF J;  3BR0 A;  5F1J A;  1XS9 A;  1O4X A;  1JKQ C;  1D5Y A;  3GTO J;  2K9N A;  1JT6 A;  1MNM C;  3GBG A;  4M3B A;  4DYC A;  2HI3 A;  1Y1W J;  5M5Y J;  3S1R J;  1MBF A;  1B8I A;  2CQX A;  2IBD A;  2VI6 A;  2EZL A;  3HEF A;  1BL0 A;  3ZQH A;  4JX5 A;  1HDD C;  1ETQ A;  4XRS G;  1AKH A;  2M2E A;  1R9T J;  3FKI J;  1RPW A;  4A3D J;  1I50 J;  1ZTR A;  1MBK A;  1ETW A;  2H1K A;  1JJ8 C;  4V2F A;  2NS7 A;  3S1Q J;  3SJM A;  2H8R A;  1MBJ A;  1IC8 A;  1MBH A;  4JX6 A;  5M5W J;  5JLW A;  4A93 J;  5C44 J;  1NTC A;  3D1N I;  1ITY A;  1JUP A;  1FIP A;  4DW6 A;  3CDL A;  1JJ6 C;  2KT0 A;  2ID6 A;  4GFB A;  4W97 A;  1QRY A;  2LD5 A;  2JJ7 A;  4CYC B;  3H3V K;  4JP0 A;  4BY7 J;  4D7N A;  1CQT A;  3TP3 A;  3ZQG A;  4QIW N;  3M3Y J;  2DA6 A;  2CQQ A;  2PMZ N;  5IPA A;  3LSR A;  3ZQC A;  5FJ8 J;  1S7E A;  4A3F J;  2X48 A;  1NK3 P;  4RDU A; 
#chains in the Genus database with same CATH topology
 4BHB A;  2DOA A;  5DTD A;  2ISZ A;  2F5V A;  2JK3 A;  1XDU A;  3GEZ A;  3J7A Y;  3M4O J;  4KMU X;  1DP3 A;  3QRF F;  3S17 J;  2TRT A;  1I5Z A;  1R71 A;  2Z33 A;  1IN5 A;  2RVC A;  2R3S A;  1PUF B;  1R1V A;  1OYI A;  2EV5 A;  4NC7 A;  5FLX Z;  4CYC A;  4BE1 A;  1XSD A;  4HRI A;  4ZDL A;  1LEA A;  2BW3 B;  3EYY A;  5BQT A;  4RGX A;  2KIS A;  3BG3 A;  1LFP A;  1FOY A;  3O6B B;  1E3H A;  2YSR A;  3PFY A;  3G6E I;  2ME6 A;  2QSF X;  1UST A;  1OMI A;  2BHZ A;  2DA1 A;  2O8X A;  5AIQ A;  1LB2 A;  4MEX F;  3ZQI A;  4V2G A;  2HXI A;  1KON A;  4XM3 A;  1OCT C;  5D6E A;  4XKC A;  1DDN A;  4B3A A;  3K9T A;  4ZTJ A;  4A3J J;  2FD5 A;  3W3C A;  4XOR A;  1XB4 A;  1FSE A;  2JUG A;  5DM6 F;  4C2T A;  2GM4 A;  2X85 A;  1IRX A;  3G2B A;  5IT9 Z;  2BVL A;  1PUF A;  4G7H F;  4I0A A;  1JKO C;  2HR3 A;  3OS1 A;  1K4S A;  3J7Y J;  2BW3 A;  3M8J A;  3MAJ A;  3S15 J;  4DIQ A;  2DTR A;  1Q1V A;  5DM7 F;  1UHW A;  3VYU B;  1MBG A;  3OOU A;  4A3C J;  3JCU C;  4FHT A;  3BG6 A;  4GDF A;  5LEK A;  5FLM J;  2A61 A;  5F64 A;  1D0Y A;  2E7X A;  4LLG F;  4AID A;  3CO6 C;  2PMU A;  3E5U A;  1RRJ A;  4Y13 A;  4XRS A;  1KU2 A;  1T95 A;  1Z91 A;  3GTJ J;  4UV8 A;  2R7Z J;  4NBQ A;  4FET A;  2RDP A;  4IRG A;  4ESJ A;  2K27 A;  3DFG A;  2XV4 S;  1YTY A;  1W0T A;  3ZP5 A;  3CLQ A;  1ZAR A;  3LSH A;  2O03 A;  2V9P A;  2P6T A;  3K4B A;  1RI7 A;  1FOW A;  5IP6 A;  2HTJ A;  1X1C A;  1SAX A;  2KRF A;  3ZOB A;  4IHT A;  3V8K A;  3EET A;  3SYT A;  3LFU A;  3HL2 A;  3V4G A;  4EVI A;  5HNF A;  5GTH C;  3UKG A;  2KJB A;  3HSR A;  1IZ1 A;  1BW5 A;  1RES A;  1SD4 A;  3U21 A;  4ENK A;  5D5U B;  2NNY A;  3CQZ J;  2CUE A;  2O8K A;  2QBY B;  1D0X A;  4AUX A;  3H9J A;  4IO9 F;  3H0D A;  1R36 A;  4IRH A;  5EEG A;  1DPU A;  2K4B A;  4XLA A;  4RM3 A;  5ERI A;  2FOW A;  2KRC A;  2ZXJ A;  2K40 A;  2XRO A;  3HOW J;  5F04 A;  2OZ6 A;  1WGX A;  2YX7 A;  2WV0 A;  2HU9 A;  2MG4 A;  1JGS A;  3PNV A;  3VOE A;  2Y75 A;  5HOO A;  4WXH A;  4GGG A;  2ID3 A;  5B1B H;  1F36 A;  5E8G A;  2X9D A;  3F8C A;  4C3I J;  3OYA A;  2QBY A;  3QPH A;  1YQA A;  2YS9 A;  3BG7 A;  1MND A;  4CH7 A;  1TBX A;  2PX9 A;  3MKW B;  1DU0 A;  2HEO A;  3W6J B;  1QBJ A;  5B66 C;  3CUQ C;  2HYF A;  5JI6 A;  1RET A;  1T33 A;  1LKX A;  4XOP A;  2WTE A;  3CJQ B;  2R7S A;  2DMQ A;  2R93 J;  3CCV I;  5FKK A;  4L0Y B;  3BCB A;  2Y30 A;  3GME A;  4FQG A;  4IZZ A;  4E7H A;  3P5J A;  2M7A A;  5IY5 H;  2CWE A;  2OAZ A;  2EB7 A;  3FZV A;  2ZNZ A;  4CCL A;  4IRI A;  4F55 A;  4E70 A;  3P9C A;  4BS9 A;  4KIC A;  1MNE A;  4IOC F;  2HNH A;  2Q0O A;  2K9S A;  4YFK F;  1BC8 C;  2YR2 A;  1MJA A;  2GXG A;  4LD5 A;  4M9S A;  1SMT A;  1QHG A;  2XPV A;  4P5O A;  5F6F A;  5DV5 A;  3SEZ A;  5DDG A;  1ORK A;  3VDX A;  2O6G E;  1S3J A;  2EQR A;  2DPU A;  2KZV A;  1XGS A;  5HOD A;  2MH9 A;  3QP6 A;  1U3E M;  1JXS A;  3JRF A;  1P9Q C;  1P2F A;  1U6G A;  5KAF C;  5J6X A;  4BXX J;  3WTT C;  3HOZ J;  1ON2 A;  3BTC A;  3J7A O;  4AC0 A;  3I71 A;  1LDK B;  4NDL A;  2MGQ A;  2COM A;  3AG3 H;  2IP2 A;  3K1M A;  3OS0 A;  3O2P E;  4NQW B;  4BKX A;  1OCZ H;  4AVP A;  2XGD A;  1QZE A;  5C4X J;  4G6D A;  1WQ2 A;  1XC5 A;  4NHJ A;  2FNP A;  2K9M A;  4A3K J;  1U78 A;  1I1G A;  4JBA A;  3F8M A;  2L9R A;  2HOA A;  2ELK A;  4PZJ A;  1MH3 A;  2M4K A;  3A0H C;  3V8J A;  5ICG A;  5HDG A;  1UB9 A;  1T6S A;  4ON0 A;  4EJU A;  1V5E A;  4RAY A;  1D8K A;  4CCO A;  2K9L A;  2LVS A;  4MFE A;  2DFF A;  2IGN A;  1SD6 A;  3BPV A;  2JPC A;  3N97 A;  1HLV A;  1PDN C;  4OAY A;  4ASN A;  3BR3 A;  2OQG A;  4IKF A;  4X1E A;  1TQI A;  4NQW A;  2MAB A;  4RS8 A;  3PFI A;  5JVG F;  1LE8 B;  2GXB A;  1TQP A;  2BHY A;  5FRM A;  1AKH B;  2P6S A;  2ZFU A;  3IHU A;  3R60 A;  2HS5 A;  1ETO A;  4XLN F;  2NVX J;  4OMY A;  2IRF G;  4A69 C;  3H36 A;  3BT9 A;  3SFI A;  4H4K C;  2DK8 A;  5HVQ C;  5FFZ A;  2JZY A;  2YU9 J;  4MTD A;  3GTM J;  4BQA A;  4N4N B;  3ESW B;  5H6Q A;  2DJN A;  5L3E A;  2B0L A;  3E97 A;  2R5Z B;  4MIM A;  3TL4 X;  4P1W A;  2XPW A;  2A3S A;  1ETX A;  5GP9 A;  1FTT A;  4QSH A;  3JRH A;  4RB2 C;  3I58 A;  2L7M P;  5J3L A;  1T2K A;  2W24 A;  4B1R A;  1LE8 A;  1R1U A;  1J9I A;  1BR2 A;  4IF4 A;  4HA8 A;  4FAS D;  3S2D J;  3ABK H;  1AU7 A;  3HHH A;  2WAF A;  2XSD C;  1Y6I A;  3CF2 A;  4XN0 A;  4IQ4 A;  1GHC A;  1QPM A;  4DYQ A;  1VQP I;  3TP0 A;  1EH7 A;  4B44 A;  2HTS A;  2EFQ A;  3RZO J;  2CSO A;  3IWF A;  3JRA A;  1D1C A;  1D1B A;  2I8D A;  2F6C A;  4R1H A;  5CVJ A;  2V26 A;  2VPR A;  2R5Z A;  4B09 A;  1K6O A;  3BR2 A;  2CUZ A;  3ELK A;  1J75 A;  4M3E A;  2EA4 A;  4II2 A;  4BJT A;  1A35 A;  4HSR A;  1WJA A;  3BTI A;  1YRN B;  2HDD A;  2L2O A;  3FXO A;  5K7H A;  1XTA A;  3H5R A;  3L9F A;  1XMK A;  3PSF A;  2F4I A;  1HXD A;  4HST A;  2Z99 A;  5EZG A;  2BXY A;  1ZK8 A;  2BV6 A;  2ZNY A;  2DQL A;  3LSK A;  1DGR M;  3F8F A;  2F4M B;  4HLX A;  3E7L A;  3K1P A;  2CG4 A;  2E1M B;  4U0W A;  1MMS A;  3KZZ A;  4B48 A;  4BXF A;  4UNO A;  2JPB A;  2L7F P;  1KYZ A;  4JYK A;  4WWC A;  4A6D A;  4S04 A;  2PLY A;  2DOD A;  4HF0 A;  1QQI A;  1IRG A;  2A69 F;  4PK4 A;  2ZME B;  1YRN A;  1Z3X A;  1USS A;  2V6C A;  1IO2 A;  2DI3 A;  2K86 A;  2A5Y B;  5HDK A;  1NK2 P;  2HVQ A;  3GFJ A;  2E2I J;  1A6Q A;  4Y4R A;  3RKQ A;  1XX5 A;  2ZFW A;  4PJ0 C;  4U7B A;  2VOP A;  2MLK A;  3IV5 A;  3ZN0 A;  4D5F A;  5BOX A;  1FP1 D;  1J0R A;  2XGX A;  3C2B A;  2BBY A;  2Y69 H;  2DK5 A;  2D1V A;  2CGP A;  1VQO I;  2EIJ H;  4RB3 C;  1B72 B;  3WGH A;  2A6T A;  1SFE A;  1SMY F;  2DMN A;  1VQ9 I;  2H94 A;  3WU1 B;  5KAI C;  2PG4 A;  2MD0 A;  4HAM A;  4BQO A;  3M8E A;  2ZME A;  1RIO H;  3HSF A;  1PJR A;  4BUP A;  1IUY A;  3CUO A;  1R22 A;  2C6Y A;  2LKX A;  5M3F J;  5CVR A;  1ERD A;  4W1U A;  2GIV A;  3H3Z A;  4E7Z A;  4O5V A;  1UHS A;  3IH3 A;  4RAZ A;  4ZYH A;  5H2F C;  1ZRD A;  3C3W A;  3F9K A;  4GCV A;  3RJP A;  4BL0 B;  2BE5 F;  4I02 A;  3V7R A;  3KFW X;  1QGP A;  3BCA A;  5K7F A;  1VND A;  2XAQ A;  2EPF A;  3IKT A;  2NYX A;  3O3K A;  4OMZ A;  5E20 A;  3VYR B;  1B72 A;  1H9T A;  2HXO A;  5GPA A;  1K7A A;  3FWE A;  4EQQ A;  3KYC B;  1GT0 C;  2HYJ A;  3KEY A;  2R7U A;  5HLI A;  3M7G A;  2L5Q A;  2LRE A;  2F48 A;  4RAG A;  5TRD A;  4XSZ F;  1VZ0 A;  4JQF A;  1IUF A;  5F1J A;  1IF1 A;  1JKQ C;  1KU3 A;  1G4D A;  3HUG B;  3LQR A;  1JT6 A;  2HKO A;  4O3M A;  4M3B A;  4E7J A;  1XGN A;  2HFH A;  4RGR A;  2G9W A;  5M5Y J;  1MBF A;  3ONQ A;  2K5C A;  2GOX B;  4G8X A;  1YJN I;  4G6Q A;  3ZQH A;  1ETQ A;  3C18 A;  2X1D A;  2M2E A;  4EM2 A;  3RPU D;  3QP5 A;  4LK1 F;  4KUM A;  2FBK A;  2FSW A;  3CC2 I;  1GVJ A;  1YIT I;  4PJN A;  1MBK A;  2VBY A;  1ETW A;  3BP8 A;  3VSL A;  3FXL A;  3DEE A;  1WHU A;  5CVV A;  2O5R A;  2H1K A;  3ZMU A;  2QUF A;  3DPT A;  4R79 A;  2LY1 A;  5LGN A;  4Y33 A;  5J4Y A;  3FX3 A;  5D6F A;  2M87 A;  1VQ5 I;  4UVA A;  3K69 A;  1MBH A;  4JX6 A;  1K78 B;  1R1T A;  5JLW A;  5DYM A;  4EGY A;  3HUG A;  1NTC A;  1R00 A;  1UCR A;  3K4N A;  3WE3 A;  1H9G A;  4PSX A;  5D8L B;  4PUS A;  2ID6 A;  2CYY A;  2JJ7 A;  3I59 B;  3FMQ A;  4C2U A;  5DD8 A;  4ZYA A;  3TGN A;  5LRS A;  1LVA A;  1ZLK A;  4BY7 J;  1AOY A;  5FO5 A;  4QIW N;  3ZQG A;  1FNN A;  3HJE A;  2OQR A;  2K85 A;  3OYF A;  4QPO A;  1S7E A;  5EJC A;  1MMD A;  4PSW A;  3RQ4 A;  2VOD A;  1BN5 A;  4RDU A;  3S1N J;  4AYB A;  3FIW A;  2EA2 A;  4D9J A;  1R5H A;  1K78 A;  1EV7 A;  2Z9O A;  3LSM A;  5EZH A;  3CJN A;  4BGD A;  1K61 A;  1WI9 A;  3W2V A;  3GTP J;  3VOD A;  1LFB A;  3GFM A;  4RM2 A;  3GX4 X;  4M9Z A;  3WGI A;  4NC6 A;  2XPU A;  2O0Y A;  5IP9 J;  4BAC A;  1BIB A;  2CUF A;  4IX7 A;  3UNG C;  1FIA A;  1RUN A;  1G3Y A;  4PCQ A;  3I59 A;  2KIU A;  3E0J B;  4RMN A;  3JAM Z;  1EKE A;  4HDV A;  3R4K A;  1IW7 F;  2DAO A;  2BY3 A;  3CCY A;  5IYC J;  3RPU A;  5L3F A;  2ECC A;  5BNG A;  3GTG J;  3R0A A;  1ZN2 A;  4A3G J;  1SAU A;  2YUS A;  4MO7 A;  4S0H B;  4ESB A;  1FBU A;  3OYC A;  1I39 A;  3HC7 A;  3R61 A;  2V4J C;  1LNW A;  3OIP A;  5L3G A;  1OYW A;  5E17 F;  2ZSI B;  2W48 A;  2R5Y B;  1XG1 A;  3FHN A;  3HOY J;  4MQ9 F;  4M71 A;  3RIR A;  4OIR F;  1HDP A;  2LBF B;  1NG7 A;  3HM5 A;  3QYB A;  3VYT B;  3HKZ A;  4B8X A;  1F43 A;  2LK2 A;  3ASO H;  4L9N A;  2RC4 A;  5E79 C;  4TV7 A;  2F5C A;  4MNU A;  5BPI A;  2B9S A;  3J7Z I;  4JK1 X;  1XMA A;  3SZP A;  1AA7 A;  1E2X A;  2O7O A;  3IC7 A;  3SZG A;  3F23 A;  1A36 A;  5IT3 A;  3FHZ A;  4PJL A;  2DOF A;  3MMY B;  1MSE C;  4XK4 A;  3AG4 H;  2DLL A;  3MQ0 A;  2P7C B;  2CW8 A;  2L3D A;  2R5Y A;  4I09 A;  5A2Q K;  5FD6 A;  2LKP A;  2L7Z A;  3K4J A;  3OR1 C;  2IS4 A;  1IRF A;  1Z67 A;  1RNL A;  3NWS A;  2LBF A;  1W7P D;  3CUQ B;  2HZD A;  4KDP A;  3BR5 A;  3GF2 A;  1SVL A;  1YS7 A;  4MTE A;  4ENN A;  3BZK A;  1I6H J;  3CF5 F;  1HKS A;  4HV6 A;  5LHG A;  3OYM A;  5J4V A;  2JWT A;  4FCY A;  3D5L A;  3CO7 C;  1FPQ A;  3OYK A;  3KEO A;  1GXQ A;  1MGT A;  1QU3 A;  3FF5 A;  1I27 A;  4OU0 A;  2W85 A;  1LPQ A;  2LSO A;  3AG1 H;  3R0J A;  3DCF A;  2XB0 X;  1U9O A;  1JUM A;  1ZRE A;  1GUU A;  3T1B A;  1W5S A;  4XIC A;  2QKL B;  3I54 A;  2KJC A;  3DBH B;  3CUQ A;  4N9H A;  3K7A J;  1B9M A;  5J40 A;  3DTK A;  1W7P B;  4FTH A;  2NOG A;  2VJ4 A;  3LWF A;  3KP5 A;  3RPQ A;  2LDU A;  1DGW Y;  4D7M A;  3EYI A;  3J81 Z;  1TW2 A;  2CH0 A;  5LRR A;  3SDB A;  2LY2 A;  5IOY A;  2DT5 A;  4LLL A;  3Q0V A;  4BBR J;  1PUE E;  5E18 F;  4LLN A;  1GXP A;  4RLF A;  1BI1 A;  3TDZ C;  2RRE A;  2QEN A;  3DPL C;  1JGG A;  5H6R A;  2VJ5 A;  3IAM 2;  3F8N A;  3RI4 A;  2IPQ X;  1V5F A;  2CUJ A;  2QQ9 A;  3DTI A;  1YW9 A;  3BC8 A;  3DXJ F;  4HNT A;  2UXX A;  4AYB N;  4BQQ A;  2HOS A;  2JSP A;  1IV8 A;  1QVT A;  1CF7 B;  1W7P A;  5EDN A;  2HVS A;  3K70 C;  2R0Q C;  1TP4 A;  2OCC H;  3VSK A;  4CDG A;  3RKY A;  1G2H A;  3ISP A;  1T98 A;  2F5D A;  4A0Z A;  2OCE A;  2ZJR F;  1B1B A;  3OSG A;  2GA2 A;  2XC7 A;  2I5U A;  2QZ8 A;  3IL2 A;  3BY6 A;  2DN0 A;  2HPI A;  2WB1 N;  5H20 A;  3OS2 A;  3OYN A;  2JTV A;  1VQL I;  1ACI A;  3LAJ A;  1TTY A;  2HDW A;  2VN2 A;  4PJJ A;  2ACJ A;  2LTP A;  2FQ4 A;  4DYR A;  4CZZ A;  3BTL A;  2KRH A;  1M1E B;  3RKX A;  1CF7 A;  2QVO A;  4L9V A;  2E34 A;  2GA1 A;  4A2U A;  4KA4 A;  3OIO A;  1RR7 A;  1VFC A;  3Q9V A;  2KHM A;  1U8B A;  3I64 A;  1HOM A;  1X4O A;  3EDP A;  2GZW A;  1P7J A;  1ZG5 A;  2DT6 A;  3DP7 A;  3OIQ A;  2G7H A;  2VAS A;  2QSH X;  2CV1 A;  1K79 A;  2CRG A;  3H9G A;  2L0K A;  1SVM A;  4IOA F;  3OL3 A;  3JW4 A;  1DQU A;  1U9N A;  1KQ0 A;  4BNC A;  3HOX J;  5GAH J;  5TGT A;  1WJ5 A;  2A68 F;  3BJO A;  4M72 A;  3EUH C;  1HKQ A;  4F93 B;  2DYS H;  3RZD J;  3SZT A;  1Z6R A;  3KP6 A;  3VWB A;  2D2W A;  2EV6 A;  4AIH A;  4L5E A;  4KYW A;  1PVE A;  1IN6 A;  3JRC A;  3GTK J;  3QPS A;  2NVT J;  2JA8 J;  1JHF A;  1WJD A;  3WTU C;  4E7S A;  2R7D A;  3S14 J;  3ABU A;  4CSW A;  5DCF A;  2E2H J;  5J8C A;  3GUD A;  5DEQ A;  3A1Y A;  5K5Q A;  4HF1 A;  1UAA A;  3KP3 A;  3S1M J;  4IJA A;  3JTG A;  3H3U A;  4ZDO A;  2L9V A;  3BQZ A;  3Q5F A;  1KQ8 A;  3EUA A;  4ZYD A;  4LFU A;  2JA7 J;  3RSN A;  1Z7L A;  4XSX F;  2KDZ A;  2QQ8 A;  2Q8K A;  4KN4 X;  4HX4 A;  1F9N A;  2F5F A;  2L02 A;  2LKS A;  1S6L A;  2JRM A;  2P7V B;  2ETH A;  4A5N A;  3G1L A;  1IN4 A;  2HZT A;  3S93 A;  5LFA A;  2E36 A;  3TO6 A;  3QU6 A;  5L3C A;  3L1P A;  4XMY A;  2DU9 A;  2R4G A;  4N4O B;  2R7W A;  4JOM A;  5J1Y A;  3B02 A;  1REP C;  2BGC A;  4M6X A;  1T39 A;  2VC1 A;  3GXO A;  2VJI A;  3CMM A;  1X1P A;  1ZGA A;  3F8B A;  3LST A;  1J59 A;  4F52 A;  1X1A A;  2P5K A;  4M6V A;  1OCP A;  2HVR A;  3C2G A;  4E4H A;  2A5W A;  3DPU A;  3HG9 A;  4I98 B;  3EUK L;  4XKW A;  1ZGW A;  2JQ7 A;  4NNJ A;  1B59 A;  3CTA A;  3I53 A;  4CXF A;  2JVG A;  4IHW A;  4O6J A;  3DBL B;  1MJ9 A;  3U1D A;  3DWL E;  3WGG A;  2STW A;  1HC8 A;  2A6H F;  1XCV A;  1Z77 A;  5AIP A;  4QTR A;  1IAW A;  3PO3 J;  1GLN A;  2X1C A;  3BZ6 A;  5J47 A;  4WX9 A;  1FTZ A;  1FP2 A;  3QYE A;  3HPH A;  2V1X A;  2GLO A;  1EA3 A;  2DMT A;  2OV7 A;  3KZY A;  4X0G A;  3COA C;  1T0F A;  2J5O A;  4C3J J;  3HRM A;  2DBB A;  1ZR4 A;  1C0W A;  4LB5 A;  4NB5 A;  1N25 A;  3DEW A;  3VEP A;  1W4M A;  5FFX A;  4AIJ A;  4A3E J;  2NXN B;  3OR2 C;  3PIO F;  4LG3 A;  2M0M A;  1LDD A;  2DMU A;  2J5P A;  3QOP A;  1QO0 D;  2GQQ A;  2M34 A;  4M3D A;  3T8R A;  1WCM J;  4XID A;  1AWC A;  1BI3 A;  3BOQ A;  5CJ9 A;  3CCR I;  1IDZ A;  2LOO A;  2EV0 A;  3C7J A;  1TC3 C;  3IRR A;  3WHB A;  4KIS A;  4YEL A;  3HGY A;  2M7B A;  3PJR A;  4A5M A;  2XAS A;  2X4H A;  3KET A;  3ML6 A;  2BEO A;  2ME0 A;  2CO5 A;  2VXD A;  4DGW B;  2XF7 A;  2M8G X;  3FK6 A;  2DA2 A;  2BY1 A;  2Z5U A;  5HLG A;  3OL4 A;  1WZ2 A;  2P5L C;  4AM3 A;  1XGM A;  4A3B J;  3K4M A;  1FJL A;  5D8K B;  4I99 C;  3A03 A;  3MKL A;  5FGM A;  2IVM A;  5KK1 A;  5D5W B;  1ZYR F;  4L5J A;  2X6X A;  5HS7 A;  2LR8 A;  3L2R A;  4B4C A;  2Y0S A;  3NAU A;  4WK8 F;  3PIP F;  1B9N A;  1N78 A;  3N4M A;  1VQ7 I;  1BM9 A;  2XB5 A;  3H35 A;  4PFP A;  4Q4Z F;  4L18 B;  1PYV A;  2OTJ I;  3QAH A;  2DYR H;  2XKP A;  5E1W A;  4IHY A;  1BIA A;  1Z0X A;  3IH4 A;  1H89 C;  3QWL A;  3AG2 H;  2XAG A;  1O57 A;  3HZJ A;  4HEA 2;  4F91 B;  1X3W B;  4Y52 J;  2V1U A;  1T56 A;  2NOJ B;  5HS8 A;  2QF7 A;  2WY8 Q;  1IN7 A;  4XLF A;  2W1O A;  3E3V A;  3H5N A;  3KP2 A;  2IS6 A;  3TED A;  2K9Q A;  2L7K A;  4EGZ A;  3B6A A;  4XL9 A;  5L3D A;  2DOE A;  2HQ5 A;  4YFN F;  5F1R A;  2JMW A;  3LSJ A;  2VUM J;  4X6A J;  2L9N A;  5CYV A;  2R7R A;  1I1S A;  2IJL A;  3WTX C;  3PQK A;  2KP6 A;  2QQB A;  3J80 Z;  1YOV B;  1QZY A;  3NAR A;  1K83 J;  1D8J A;  3A02 A;  3W6K B;  1BR4 A;  3H0G J;  5CKT A;  1TWA J;  3GFI A;  1ZR2 A;  3S2H J;  3OYE A;  4BEH B;  2DXI A;  1VQ8 I;  1IXR C;  4UXN A;  5HLH A;  3ZRG A;  3FMS A;  1QNT A;  4LB6 B;  4HQE A;  3DKX A;  1Y1W J;  4AVZ A;  1ZHF A;  1VQN I;  2IBD A;  3GLX A;  4Y17 A;  4JX5 A;  4XRS G;  5AON A;  1AKH A;  3FKI J;  1R4M B;  2W00 A;  2PJP A;  2VJJ A;  1I50 J;  3NWT A;  3KLN A;  4A3D J;  1VQK I;  3AL0 B;  4C9Y A;  3C1D A;  4XQF A;  1YIJ I;  1MDM B;  3FKJ A;  3WTY C;  3SJM A;  2H8R A;  3Q9S A;  1OCC H;  2JA2 A;  1IC8 A;  3ZQ7 A;  1JHH A;  3RDI A;  4BEH A;  2XVC A;  4CCM A;  3D1N I;  1ITY A;  4DW6 A;  3L2W A;  3HOS A;  2QYO A;  4IL6 C;  1OCR H;  5KHD A;  1SFU A;  4JP0 A;  3HRS A;  1K4T A;  5FRN A;  4B3X A;  3GW2 A;  2IA2 A;  2XRN A;  4ZZL A;  4U87 A;  3TP3 A;  2ELH A;  2VE9 A;  3E5X A;  1SVO A;  2PMH A;  1G3S A;  2CQQ A;  3M8F A;  3QPT A;  5L3B A;  1HW1 A;  3LSR A;  4A3F J;  2LC2 A;  1NK3 P;  3D5S C;  1MDM A;  3QOD A;  1HW2 A;  3JSO A;  1S7O A;  3TW7 A;  2XGC A;  2Y9Y A;  1J09 A;  2HGC A;  1YYV A;  3BG5 A;  5F0F A;  4CGZ A;  1EH6 A;  1XCB A;  2AO9 A;  3B6C A;  2ZXH A;  2HKX A;  2XRL A;  4F7Z A;  4M3F A;  2FA5 A;  1KQ9 A;  2ZXI A;  4EJO A;  1P92 A;  3G4S I;  5CPR B;  3FK7 A;  4CO8 A;  2JUC A;  5ILV A;  2Z3Y A;  1E3P A;  1S72 I;  2F5E A;  1O7L A;  1OR7 C;  4S05 A;  4XLC A;  3FXU A;  2DPD A;  3DTE A;  1XSV A;  1R6R A;  4KIB A;  5KVR A;  4IHS A;  3I4M J;  2Y0S N;  4IPA A;  1IJW C;  2VBZ A;  3M9A A;  3MD2 A;  1NG6 A;  3OMY A;  2R92 J;  2K02 A;  4E7L A;  4BAY A;  2IT0 A;  2EFN A;  2FML A;  2AXT C;  5K7Z A;  3B73 A;  4LK0 F;  2B63 J;  3MWM A;  1MD0 A;  1YG2 A;  3K2Z A;  2MH2 A;  1OPC A;  1STZ A;  2NVQ J;  1MMA A;  1Z21 A;  4M9X A;  5DUI A;  3K70 D;  4HLY A;  4HNV A;  2M0C A;  2E5N A;  3ABM H;  1ZAO A;  2V6E A;  5EG0 B;  3DKY A;  3K4C A;  5LGT A;  3RCO A;  2WAE A;  1O3S A;  1YX5 A;  1ON1 A;  2EZK A;  2FBH A;  2L9S A;  2FUG 2;  1BI2 A;  3MN2 A;  1VI0 A;  2CQN A;  3PUF A;  3HXL A;  1TWC J;  2RNJ A;  2FRH A;  5HNH A;  1ODD A;  2JA5 J;  4UY8 I;  1J2X A;  1TWG J;  3F21 A;  1HQC A;  1WFX A;  3CC7 I;  4OIQ F;  1BOA A;  1P4W A;  2CW0 F;  5FD5 A;  5FLX K;  2ZSH B;  2XDV A;  1Y0N A;  1IGN A;  1XPX A;  2DW4 A;  1T08 B;  2COB A;  5F27 A;  3T0Y A;  2O3F A;  4YII A;  4A6E A;  3IWZ A;  3MZH A;  3U1K A;  1MZB A;  4K2E A;  1WWX A;  4BE2 A;  2EJR A;  2BY2 A;  3NRV A;  3Q0W A;  1H0M A;  3MVP A;  5KCM A;  5EG0 A;  1JUS A;  2MFZ A;  1Y8R B;  3RTR A;  1XD7 A;  1FSH A;  1XDS A;  1V3F A;  1ETV A;  3G1O A;  1JTX A;  5FKM A;  4UB8 C;  2EZH A;  1TZL A;  2XHK A;  3K4K A;  4U0Y A;  2F2E A;  1A04 A;  2LG4 A;  1O3Q A;  2NAZ A;  4FE7 A;  3FIS A;  4ZH4 F;  2PN6 A;  4AWX B;  3KYL A;  3P9I A;  4E7K A;  2DFH A;  3E6D A;  2KIM A;  4GYI A;  4OIP F;  4BBS J;  5EYR A;  3TW6 A;  4HW0 A;  3OYL A;  2RV8 A;  1Y56 A;  3KPH A;  5DS9 A;  1HF0 A;  2R7V A;  4IHV A;  1SFK A;  3SQN A;  1HW5 A;  5F0C A;  5IOZ A;  4Y7N J;  1V55 H;  3CP8 A;  2Y9Z A;  2JT1 A;  3CCM I;  3I4N J;  1FYL A;  1KZH A;  1D1A A;  3LQQ A;  4CCN A;  2BY0 A;  1V54 H;  2XKO A;  3V7C A;  5EF6 A;  2PEX A;  3BTJ A;  2E60 A;  2OJE D;  2WV1 A;  3K4L A;  3KE2 A;  2ADU A;  3HPG A;  4Y15 A;  4P9U A;  3LA2 A;  4II3 A;  1E17 A;  4F3Q A;  4KIT B;  1VQ4 I;  4RBO A;  1VF9 A;  5LD2 C;  3GYH X;  2CFO A;  3OOP A;  2WY7 Q;  4ANJ A;  1HCR A;  2W82 A;  2V1N A;  2M8E A;  2EFW A;  3FXR A;  5D4S A;  4BQN A;  2H1L A;  1IXS B;  2FBI A;  2V7F A;  1ZKG A;  4G6T B;  3E6B A;  2GBY A;  3HRT A;  2ZO4 A;  4MLO A;  4HZF A;  3H92 A;  3EPZ A;  1DUX C;  3PQJ A;  3G3Z A;  4MFD A;  2OA4 A;  4DQ2 A;  3BQY A;  3QOE A;  1B4A A;  3F0C A;  3WTZ A;  4A12 A;  2PFB A;  3SXY A;  2CV0 A;  2K3F A;  3EUH A;  4F92 B;  3HOV J;  1N75 A;  2WAD A;  4UUT A;  3BZC A;  5DD4 A;  4U0V A;  3O8H A;  2STT A;  3A2K A;  2D1H A;  3D0S A;  1ZG3 A;  1Z05 A;  1U5T C;  3DKW A;  2KDO A;  4U7D A;  3HHG A;  2FOK A;  1ZH5 A;  5KNL A;  3V8L A;  3TO7 A;  4HG2 A;  5TIS C;  1YW8 A;  1SD5 A;  3BDD A;  1YE9 A;  1HST A;  2IA0 A;  3VFZ A;  4C2M J;  3CCJ I;  1OLT A;  2W25 A;  5E3N A;  3LSP A;  2IXS A;  2LP0 A;  3NQO A;  4XRM A;  2R7T A;  4MQV A;  2Z1D A;  1WJB A;  3I56 I;  1WPK A;  3PSI A;  4LG0 B;  2F4O B;  2QKM B;  4ENM A;  2JA6 J;  3SEQ A;  1ETY A;  3KP4 A;  3TOA A;  1QA6 A;  3DQV C;  5ICF A;  4ZTF A;  1Y1V J;  3FBN B;  5JHU A;  4CCK A;  3F22 A;  4J01 A;  1O3T A;  3ZQF A;  1WSU A;  3PUB A;  3FBI B;  5B5E C;  5FLV A;  4XKV A;  5FKO A;  4WCG A;  1Y39 A;  1ONV A;  4XKB A;  2WA0 A;  2VKD A;  3F6V A;  4KT5 C;  3KCC A;  5EGO B;  4XLH A;  2P4W A;  1ENH A;  3K2A A;  5C4J J;  2W57 A;  2X1E A;  3OYI A;  5EEH A;  5ICC A;  2X51 A;  4CHU A;  4LG0 A;  4UHT A;  2CS3 A;  3LAP A;  2LF8 A;  2DFE A;  3DLA A;  3ZXS A;  1PP7 U;  3ZGK A;  3CJR B;  3PNT A;  3N05 A;  1FWZ A;  5GAE J;  4QLC U;  1UJ8 A;  5ED4 A;  5BMZ A;  2PI0 A;  2IGO A;  1U2W A;  2W7N A;  1X1B A;  2HQN A;  4DJA A;  4B43 A;  2H6B A;  5K5O A;  1FMW A;  1UEL B;  1YX3 A;  3FMR A;  4KMF A;  2UZK A;  5K1Y A;  1MMN A;  4GRI A;  5EGO A;  4Z2Y A;  2JN6 A;  4A0X A;  4UUS B;  2H8W A;  3FXQ A;  3HTS B;  2CQ7 A;  4EJV A;  4FIS A;  3GWZ A;  3I5U A;  4BYY A;  3W6V A;  3SFZ A;  1I3Q J;  3KZI C;  3WU0 A;  5ILU A;  3DU6 A;  3GTQ J;  1KYW A;  1BOB A;  3E6C C;  2L54 A;  4QWQ A;  2DMP A;  4KJZ A;  3CMY A;  4HV5 A;  3BR6 A;  4Y3O A;  3G1M A;  3VPR A;  3PL8 A;  1X58 A;  2OC6 A;  4PJM A;  2FF4 A;  3MZY A;  3ZQL A;  1TWH J;  3HTU A;  2ZJP F;  4HNU A;  4UUS A;  1YJW I;  2QGU A;  3BG9 A;  3U9G A;  5FKN A;  3HIF A;  2G0E A;  2IA1 A;  2PMZ A;  2VKE A;  1GVD A;  3KP7 A;  1L0O C;  2DA5 A;  2Y0M A;  1SAN A;  2NVU B;  2GIZ A;  5LGU A;  3HGG A;  2HOE A;  2KKO A;  2EZI A;  1W0U A;  2KIQ A;  4NUB A;  3OV8 A;  1X4P A;  3ASN H;  4RLQ A;  3GFL A;  5LHH A;  1FLI A;  5FRO A;  3NEU A;  5TJJ A;  2R7F A;  4ABZ A;  3KX2 A;  4YFX F;  2X6W A;  1YW7 A;  2ZCW A;  4YG2 F;  1R58 A;  1WVR A;  3ZMV A;  2FE3 A;  2HDC A;  3A0B C;  2ELJ A;  2QCO A;  1W1W E;  3HKZ N;  4KIF A;  3CMA I;  4LOC A;  2DFI A;  3LNQ A;  3ROU A;  4HYE A;  3IAS 2;  2JRT A;  3W2A A;  3OWT A;  3P7N A;  1WI3 A;  1O3R A;  3BR1 A;  2VL8 A;  4DNC A;  4Q48 A;  1MH4 A;  3E1S A;  3RQI A;  4YEJ A;  2O61 A;  1TT0 A;  2OU2 A;  2IEK A;  1E3O C;  1JI8 A;  2MW8 A;  2VQG A;  4I2O A;  5FKL A;  5E1Z B;  4RGU A;  3MFK A;  1OJL A;  2KL4 A;  3AKZ A;  1JKR C;  1MSF C;  3WG9 A;  5BS6 A;  4IEJ A;  2H09 A;  2M4G A;  1XGO A;  4EEF G;  4E7I A;  3HB9 A;  9ANT A;  2DA3 A;  1FX7 A;  2MC3 A;  2QLZ A;  1FBS A;  4LMY A;  5F08 A;  3M07 A;  3HOT A;  2VXZ A;  3LL7 A;  4HDU A;  5GAD J;  3WG7 H;  4A3L J;  4BHC A;  4M3G A;  2RQQ A;  5IYB J;  5E8I A;  2VLA A;  3GLL A;  2E35 A;  2ZKZ A;  3JRI A;  2E71 A;  2ZJQ F;  3LSI A;  4Q47 A;  6PAX A;  3PNY A;  1FEX A;  2Q2E B;  2VPL A;  1EF4 A;  3OSF A;  3H1C A;  3Q0U A;  1ZQ3 P;  1FC3 A;  1G3T A;  3DBR B;  1O4X A;  1D5Y A;  2K9N A;  4ITV A;  4ZJZ A;  1YLF A;  3GBG A;  5J8F A;  1PP8 F;  1MIJ A;  4DYC A;  2HI3 A;  2QA4 I;  1T38 A;  1X19 A;  1YJ9 I;  2M1B A;  2VI6 A;  2V1D A;  1R9T J;  1NHA A;  2EIL H;  2LRD A;  4J00 A;  4CUG A;  4WF2 A;  1ZG1 A;  2UUZ A;  4UV9 A;  3DF8 A;  1N77 A;  2FQ3 A;  2V9K A;  1F1Z A;  5JR3 A;  4UB6 C;  3OYG A;  3WTS C;  4HOB A;  3CES A;  4V2F A;  2NS7 A;  5LHI A;  2Q2E A;  3S1Q J;  4PDK A;  4Q5S F;  4LIU A;  1MBJ A;  3TQN A;  2UV1 A;  3L2U A;  2HPM A;  1WJC A;  3I9V 2;  4A93 J;  4KT6 A;  4P96 A;  4E6K G;  5C44 J;  2CMP A;  4BJ6 C;  3K0L A;  1W36 C;  2LNB A;  1FOK A;  3CP2 A;  2KT0 A;  2K3P A;  1R7J A;  1QRY A;  1LEB A;  1SC7 A;  3FM5 A;  1P6R A;  3BJA A;  2DDB A;  2GXA A;  4KNY A;  2UWM A;  4V19 K;  4BU2 A;  4D7N A;  1OR7 A;  2WC2 A;  4GO1 A;  2DA6 A;  5CQG A;  4PGG A;  3WTW C;  3ZN1 A;  1P4A A;  2PMZ N;  3ABT A;  1XMX A;  1Z6T A;  5IPA A;  1P4X A;  3S3M A;  1X3Z B;  2VBX A;  2X48 A;  3MCZ A;  5LLQ A;  1ZLJ A;  2AQE A;  4L9T A;  4LIT A;  4NC8 A;  3KLO A;  3QPL A;  1HA8 A;  2XGE A;  1S9H A;  4ETS A;  1YS6 A;  3ABL H;  1A31 A;  1TL8 A;  3S16 J;  2Y48 A;  3G71 I;  2R7X A;  2ISY A;  2KIF A;  4IHX A;  1F5T A;  3D5R C;  2JSC A;  4MGR A;  1BR1 A;  3OYJ A;  1BJA A;  1KU7 A;  4XBF A;  2ZC2 A;  5A2Q Z;  1R4N B;  5ICE A;  2VKH A;  1X2M A;  2FX0 A;  2GWR A;  3S8P A;  3CME I;  1LQ1 A;  3JTH A;  1EH8 A;  3QYF A;  1GV2 A;  2RQP A;  4UVB A;  3S32 A;  1QPI A;  3BJ6 A;  4R8H A;  3U2R A;  1OQY A;  2YX4 A;  2LYC A;  1ULY A;  2DO7 A;  1R23 A;  2G7U A;  1WH5 A;  2RNG A;  2UXN A;  1Q1H A;  1KA8 A;  4XOT A;  4Z6Y A;  1I3A A;  4A3M J;  1VTN C;  1RZ4 A;  1TNS A;  1FZP B;  2CU7 A;  3K6G A;  4OWR B;  1KU9 A;  4A3I J;  2CJJ A;  3KEQ A;  4HQM A;  2VBW A;  3ECO A;  4IQJ A;  4XR6 A;  3MKY B;  3VB2 A;  4ZDP A;  4LGW A;  1E0E A;  4YRV A;  1OCO H;  3CCS I;  4I76 A;  4BY1 J;  1Z1D A;  4P55 A;  1BBY A;  2FXA A;  3L00 A;  3VYS B;  3ZMD A;  3CDI A;  4DBQ A;  5HDN A;  4QPQ A;  1Z9C A;  3I0T A;  4G7O F;  1LDJ A;  1WRJ A;  1R49 A;  3JAM K;  1ZRF A;  4I01 A;  4OIN F;  2IGK A;  2QSG X;  2HOT A;  2FU4 A;  4M6Y A;  3C2H A;  1MMG A;  1G6N A;  2BYV E;  3TO9 A;  5CVI A;  2I10 A;  2ESH A;  1HSJ A;  2PQ8 A;  2XAU A;  1MBE A;  3CD6 I;  4XRF A;  3ZQQ A;  2NS8 A;  4EM1 A;  1SFO J;  1J5Y A;  1FYK A;  2IS1 A;  4EAT A;  4FX4 A;  2OBP A;  3GO5 A;  2AHQ A;  4I6Z A;  4P9F A;  3HRU A;  5E1X A;  3AFH A;  3BPX A;  2LF7 A;  3RKW A;  3AL0 C;  1MW7 A;  3L09 A;  4G9Y A;  2ZB9 A;  4ZYE A;  3GTL J;  2ZBK A;  4OAZ A;  4LJZ F;  2KQR A;  1GDT A;  1POG A;  2A05 A;  4HBL A;  5EEA A;  1JE8 A;  5C3E J;  2KZG A;  2PBI A;  2Y2Z A;  3WHC A;  1VQ6 I;  3MKZ A;  1QZZ A;  2CFX A;  3TBI A;  2QM3 A;  5B1A H;  1LUJ B;  1ZEL A;  3RYP A;  2FNA A;  2M5W A;  1HBX G;  1EJ9 A;  3CCL I;  1UFM A;  2EK5 A;  1DPR A;  2PJR B;  3LSG A;  1U5T B;  2XF6 A;  4PGH A;  1X3U A;  1U8R A;  4DZP A;  4CIC A;  3E5Q A;  5F0H A;  2X0L A;  1FY7 A;  4UVC A;  2H27 A;  2P81 A;  3SDG A;  3ERE D;  4EMS A;  3CCQ I;  1RR8 C;  2TCT A;  4C3H J;  1U0J A;  5GPC A;  2DTZ A;  1OKR A;  2A07 F;  2VOO A;  2VQL A;  3CJT B;  3A01 B;  1SEU A;  2VON A;  2N8G A;  1FBQ A;  3F72 A;  3I3L A;  1OIS A;  4A0Y A;  4BDZ A;  3QQA A;  3PM1 A;  2VE8 A;  3WU2 C;  1S8N A;  1WH7 A;  4HX7 A;  1Z3Y A;  3L7W A;  2E1N A;  2EIN H;  2Y31 A;  4L9J A;  4CA0 A;  2OF7 A;  2XAF A;  2E2J J;  4MEY F;  4C30 A;  2BOL A;  3F6O A;  4IVN A;  3E6M A;  3REO A;  1FOX A;  3OY9 A;  5J1R A;  2PJR A;  1U5T A;  1S29 A;  3O8G A;  4I0B A;  2K7L A;  1JTY A;  4KFC A;  2LLK A;  4ZC3 A;  2HYG D;  1JKP C;  1BJZ A;  4L5I A;  2IAI A;  3Q3S A;  2X6Y A;  1Y0U A;  3JRB A;  1IG7 A;  3A01 A;  1RUO A;  3GVA A;  1W5C C;  3LFK A;  4ESF A;  2FJ1 A;  2MD5 A;  2EWN A;  1WJF A;  3CDH A;  4D1Q A;  1IRZ A;  5M3M J;  2MYS A;  4KN7 X;  2VQH A;  5ILS A;  4CCJ A;  3J81 K;  5CVU A;  3I4P A;  1S7A A;  5D5X B;  3PO2 J;  3CZ6 A;  2EBI A;  3OYD A;  4HPQ A;  3CCU I;  2DCE A;  1T0F C;  1X1D A;  1XSX A;  2AQF A;  2RKH A;  3LA7 A;  5DCM B;  5LBQ A;  2QEX I;  4FE4 A;  3AAF A;  2FMY A;  5DUK A;  2HWV A;  1TQM A;  4EM0 B;  3LA3 A;  3BLY A;  1WJE A;  4CZC A;  4JX4 A;  1SFX A;  2GOM A;  3ZMZ A;  3JRG A;  2Q1Z B;  2R7O A;  2BZT A;  3TOB A;  1A6I A;  1IV6 A;  3W2W A;  2DA4 A;  5HS9 A;  4BJ5 C;  3KIO A;  1BC7 C;  4DZJ A;  3IH2 A;  2D5V A;  2XIG A;  2L4M A;  2E7W A;  2B7E A;  3BWG A;  4HX8 A;  1VQM I;  3IP4 B;  4DBR A;  1QHH D;  5DCM A;  2P0W A;  2D45 A;  5FB2 A;  1R5I D;  2KMU A;  1OYY A;  1IDY A;  5CLS A;  3FM3 A;  4GYG A;  2VC0 A;  4RA2 A;  3MZ8 A;  3CCE I;  4OIO F;  1A5J A;  1OFC X;  3L2V A;  2EIK H;  5GAG J;  2AXL A;  3ZCO A;  1UZC A;  5BPD A;  1R5G A;  1FYM A;  4B47 A;  5E3M A;  2QWW A;  3L2Q A;  4ZYG A;  3WTV C;  2BXZ A;  3DLL F;  1YHQ I;  2NVY J;  5IT9 K;  4OOI A;  2V79 A;  3A4C A;  3HYI A;  2L01 A;  4DOZ A;  1HKT A;  3V42 A;  3V7S A;  2WAQ A;  5K5R A;  1SD7 A;  4RB1 A;  2VKV A;  1K6Y A;  3IRQ A;  3QU3 A;  3MEX A;  3ZR8 X;  5IP7 J;  3H5A A;  4YIR X;  4AIK A;  3CC4 I;  4MHG A;  2E1C A;  2ECB A;  3IKV A;  3LOC A;  1FT9 A;  2XUB A;  2M30 A;  2WBM A;  2LY9 A;  3DV8 A;  3T5X A;  2TDX A;  1RKT A;  2OPT A;  5HLT A;  1TLH B;  2LFB A;  4AU7 A;  4I7H A;  3ZMS A;  5JHF A;  5M5X J;  2CQK A;  2M9H A;  4HF2 A;  1J7K A;  1H8A C;  5IYD J;  5J1U A;  4D0P A;  4YIF A;  2BVM A;  1YI2 I;  1X2N A;  1TT5 B;  4BXU A;  4RGS A;  1H88 C;  1JT0 A;  1B6A A;  3S3O A;  1T8I A;  2DDA A;  5JLX A;  2R7Q A;  1GV5 A;  2HQA A;  2LMD A;  4AD9 A;  3I55 I;  3ECH A;  1L3L A;  4GXO A;  2P8T A;  5LEJ A;  3M1C A;  1DP7 P;  1UG0 A;  1QVU A;  2KLO A;  3HBL A;  1TW3 A;  2W4S A;  2ZXW H;  2GAU A;  3F3X A;  2VIX A;  1YFH A;  1YIO A;  1APL C;  1V4R A;  3KYD B;  3GZ5 A;  4XLP F;  2XF5 A;  1ETK A;  3TMO A;  3OYB A;  1NH3 A;  1G8X A;  2VQC A;  3FXJ A;  3TDU C;  1LFU P;  3K10 A;  4WXC A;  2O9L A;  1RC9 A;  4N0B A;  2DA7 A;  1UHM A;  4M73 A;  3ZPL A;  1G3W A;  4J19 A;  2DQR A;  1MJB A;  1LVK A;  2E19 A;  2K4J A;  4FT8 A;  1KGS A;  5GTI C;  3LMM A;  4LIV A;  3WOD F;  3HOU J;  5JVT A;  2RAE A;  4RB0 A;  2MC4 A;  3RYR A;  2YU3 A;  2X6O A;  4XLE A;  1W36 D;  4ENJ A;  5B3S H;  1IN8 A;  4KIG A;  2Z2S B;  2A6E F;  3FDY A;  1IXC A;  2ESN A;  2WB1 A;  2DT7 B;  2WWY A;  2YPR A;  3IUO A;  2CW7 A;  1G59 A;  1D5V A;  3JR9 A;  1S5L C;  2OD5 A;  3SHF A;  2KPM A;  2NS0 A;  1UMQ A;  1W5T A;  2M45 A;  2W84 A;  3S3N A;  2EH3 A;  1P7I A;  2RN7 A;  1UG2 A;  2NRA C;  3OYH A;  5E3O A;  1BA5 A;  2EFO A;  3TKY A;  1V5G A;  4BHP A;  4H0E A;  5CQE A;  3BRO A;  4EV0 A;  2OZU A;  4FX0 A;  1BI0 A;  4RAF A;  3DEU A;  3S2W A;  2XSJ C;  4EJW A;  2XAH A;  1Z7U A;  1RKW A;  2EIM H;  2RGV A;  1BW6 A;  3ERM A;  3FXM A;  3JRE A;  3P9K A;  2MA3 A;  4G94 A;  1LJ9 A;  3UR3 C;  1MKM A;  4G12 A;  4PFO A;  4G7Z F;  1B8I B;  2E5Z A;  2XAJ A;  3DU5 A;  4WXD A;  4D5C A;  2V9V A;  1D0Z A;  4L0Z B;  3HSE A;  2MBF A;  5E3L A;  3ZMT A;  2E1M C;  4BH9 A;  4BDY A;  3T8T A;  4EJT A;  1AHD P;  3JSP A;  3FXK A;  2ZJ2 A;  2NNN A;  2E1O A;  1ZRC A;  1I6X A;  3X2Q H;  1YO5 C;  2MSY A;  3WE2 A;  3JRD A;  2IGM A;  2ICW G;  2OUM A;  2JVH A;  2DJI A;  3HDD A;  2VT2 A;  1DU6 A;  2WAQ N;  2M3A A;  2QQA A;  2VB6 A;  1FMV A;  2ZME C;  4UUV A;  3GZ6 A;  1TWF J;  2HQR A;  3BR0 A;  3GCM A;  4CYD A;  1XS9 A;  3GTO J;  1MNM C;  3K1N A;  4IXA A;  4XNF A;  2FEZ A;  5D4R A;  3S1R J;  3G73 A;  2P5V A;  1B8I A;  2CQX A;  3ULQ B;  4XN3 A;  4XON A;  2EZL A;  3HEF A;  1BL0 A;  1F4K A;  2KFD A;  1HDD C;  3GZN B;  1RPW A;  3EQL F;  2LH9 A;  1ZTR A;  5D5V B;  2EFP A;  1TNT A;  2IW5 A;  2Z16 A;  3H9Q A;  1JJ8 C;  1CGP A;  2IS2 A;  4ZZD A;  3M1E A;  1Y8Q B;  1O7F A;  5M5W J;  1D3Y A;  4BE0 A;  1JUP A;  1FIP A;  2AS5 F;  4N9I A;  5JFR A;  3CDL A;  3J80 K;  1JJ6 C;  1XN7 A;  4GFB A;  4W97 A;  2OTL I;  2L4A A;  2LD5 A;  2MLG A;  4CYC B;  1WKM A;  3H3V K;  1CQT A;  3M3Y J;  3R6S A;  2CV2 A;  3L2C A;  3CLO A;  3ZQC A;  5FJ8 J;  2VT3 A;  4U88 A;  4M74 A;  2H6C A;  1ZGJ A; 
#chains in the Genus database with same CATH homology
 3S1N J;  3TW7 A;  3QPL A;  2XGC A;  2Y9Y A;  3FIW A;  5DTD A;  2XGE A;  3BG5 A;  5F0F A;  2JK3 A;  3M4O J;  5EZH A;  2AO9 A;  1K61 A;  3GTP J;  3B6C A;  1LFB A;  3S16 J;  3S17 J;  2XPU A;  2TRT A;  2XRL A;  4M3F A;  5IP9 J;  2CUF A;  4IHX A;  1FIA A;  1PUF B;  3FK7 A;  4CYC A;  3CCY A;  5IYC J;  2ECC A;  5BNG A;  3GTG J;  3BG3 A;  2ME6 A;  1X2M A;  2FX0 A;  3I4M J;  2Y0S N;  2DA1 A;  2YUS A;  4MO7 A;  4S0H B;  4A3G J;  3ZQI A;  1IJW C;  4V2G A;  1GV2 A;  2HXI A;  1OCT C;  2R92 J;  4B3A A;  1QPI A;  4A3J J;  2FD5 A;  2W48 A;  5K7Z A;  2R5Y B;  2B63 J;  1XG1 A;  1WH5 A;  2NVQ J;  3HOY J;  2GM4 A;  1HDP A;  4A3M J;  3HM5 A;  4HNV A;  2M0C A;  1PUF A;  2LK2 A;  1F43 A;  2CU7 A;  4A3I J;  1JKO C;  2CJJ A;  5EG0 B;  2EZK A;  3S15 J;  3MN2 A;  1VI0 A;  1Q1V A;  1MBG A;  3OOU A;  4A3C J;  1TWC J;  2O7O A;  2JA5 J;  4I76 A;  1TWG J;  5FLM J;  4BY1 J;  1MSE C;  4XK4 A;  1IGN A;  2R5Y A;  4XRS A;  2COB A;  5F27 A;  2L7Z A;  2HOT A;  3GTJ J;  2R7Z J;  2I10 A;  3BR5 A;  1W0T A;  3Q0W A;  1MBE A;  3MVP A;  5EG0 A;  1JUS A;  1I6H J;  2NS8 A;  1ETV A;  5IP6 A;  3G1O A;  1SFO J;  2JWT A;  1JTX A;  3ZOB A;  4I6Z A;  5FKM A;  2AHQ A;  4FCY A;  2EZH A;  2ZB9 A;  3GTL J;  3UKG A;  1GDT A;  1POG A;  5EEA A;  5C3E J;  2Y2Z A;  4FE7 A;  3FIS A;  3WHC A;  1BW5 A;  1RES A;  3DCF A;  2XB0 X;  1U9O A;  3CQZ J;  2CUE A;  2O8K A;  1JUM A;  4BBS J;  4AUX A;  5EYR A;  3TW6 A;  1GUU A;  4XIC A;  3LSG A;  1HF0 A;  5DS9 A;  4DZP A;  3K7A J;  4IHV A;  5F0C A;  5F0H A;  4FTH A;  2NOG A;  2P81 A;  3SDG A;  2K40 A;  5IOZ A;  4Y7N J;  3HOW J;  5F04 A;  2Y9Z A;  4D7M A;  3I4N J;  2TCT A;  4C3H J;  1WGX A;  5GPC A;  2DTZ A;  2MG4 A;  5IOY A;  5EF6 A;  3Q0V A;  4BBR J;  3BTJ A;  3A01 B;  2N8G A;  2ID3 A;  2WV1 A;  3QQA A;  3PM1 A;  1WH7 A;  1F36 A;  2X9D A;  2Y31 A;  4C3I J;  2OF7 A;  2E2J J;  1JGG A;  4RBO A;  2YS9 A;  1VF9 A;  5J1R A;  1DU0 A;  3O8G A;  1HCR A;  4AYB N;  2HOS A;  1QVT A;  5EDN A;  1JTY A;  1RET A;  1T33 A;  1ZKG A;  2LLK A;  2R0Q C;  2DMQ A;  2GBY A;  2R93 J;  5FKK A;  1JKP C;  1BJZ A;  4MLO A;  2Y30 A;  2IAI A;  1G2H A;  3Q3S A;  3JRB A;  1IG7 A;  4MFD A;  3A01 A;  3BQY A;  3F0C A;  2FJ1 A;  3OSG A;  2DN0 A;  3HOV J;  1IRZ A;  2K9S A;  5M3M J;  2WB1 N;  4UUT A;  3O8H A;  3PO2 J;  2XPV A;  2EBI A;  2LTP A;  2FQ4 A;  4DYR A;  1ORK A;  3BTL A;  2EQR A;  5HOD A;  4FE4 A;  3OIO A;  1RR7 A;  3JRF A;  1VFC A;  1U8B A;  1HOM A;  4BXX J;  3HOZ J;  3BTC A;  4C2M J;  1P7J A;  4AC0 A;  3LSP A;  5E3N A;  4JX4 A;  2LP0 A;  4XRM A;  4NDL A;  3JRG A;  2MGQ A;  2CRG A;  2L0K A;  1A6I A;  1U9N A;  4BKX A;  1WPK A;  2XGD A;  3HOX J;  1IV6 A;  2DA4 A;  5C4X J;  4DZJ A;  2JA6 J;  1ETY A;  3IH2 A;  2D5V A;  1XC5 A;  4A3K J;  3RZD J;  1U78 A;  1Y1V J;  2L9R A;  4L5E A;  2HOA A;  2ELK A;  1MH3 A;  3JRC A;  3GTK J;  3QPS A;  3ZQF A;  2NVT J;  2JA8 J;  5FLV A;  3S14 J;  5FKO A;  2E2H J;  1IDY A;  2LVS A;  4MFE A;  3S1M J;  1HLV A;  5EGO B;  3BQZ A;  3BR3 A;  1ENH A;  3K2A A;  5C4J J;  1A5J A;  1OFC X;  4X1E A;  2JA7 J;  1LE8 B;  2KDZ A;  1AKH B;  5E3M A;  1ETO A;  2NVX J;  4A69 C;  3BT9 A;  3SFI A;  3G1L A;  2NVY J;  3L1P A;  2YU9 J;  3GTM J;  2DJN A;  2VKV A;  5J1Y A;  2R5Z B;  4MIM A;  5IP7 J;  2XPW A;  1ETX A;  5GP9 A;  1FTT A;  2ECB A;  5EGO A;  4QSH A;  3LOC A;  3JRH A;  2L7M P;  2LY9 A;  2JN6 A;  5J3L A;  1RKT A;  2OPT A;  4B1R A;  4UUS B;  1LE8 A;  4M6V A;  1OCP A;  3S2D J;  2LFB A;  1ZGW A;  5M5X J;  2M9H A;  1AU7 A;  2XSD C;  4FIS A;  3W6V A;  1H8A C;  5IYD J;  1I3Q J;  5J1U A;  4IHW A;  3GTQ J;  1X2N A;  4DYQ A;  2DMP A;  3TP0 A;  1H88 C;  4QTR A;  1Z77 A;  3RZO J;  3CMY A;  3PO3 J;  1JT0 A;  3BR6 A;  3JRA A;  5JLX A;  1FTZ A;  1GV5 A;  2VPR A;  2R5Z A;  3G1M A;  2GLO A;  3BR2 A;  2DMT A;  3VPR A;  1X58 A;  4M3E A;  4C3J J;  1QVU A;  1ZR4 A;  3HBL A;  3ZQL A;  1TWH J;  3BTI A;  3DEW A;  4UUS A;  1APL C;  1YRN B;  2HDD A;  5K7H A;  4A3E J;  3BG9 A;  1ETK A;  5FKN A;  2DMU A;  2G0E A;  2M34 A;  4M3D A;  1WCM J;  5EZG A;  1ZK8 A;  4XID A;  2VKE A;  1GVD A;  1LFU P;  2O9L A;  2DA5 A;  1IDZ A;  3E7L A;  1SAN A;  2DA7 A;  1TC3 C;  4J19 A;  3HGG A;  2E19 A;  3WHB A;  2EZI A;  1W0U A;  3HGY A;  2L7F P;  4JYK A;  3HOU J;  2ME0 A;  2RAE A;  4ABZ A;  2M8G X;  3FK6 A;  2DA2 A;  1YRN A;  2X6O A;  1NK2 P;  4A3B J;  1FJL A;  2E2I J;  3A03 A;  3MKL A;  2QCO A;  3HKZ N;  3RKQ A;  2LR8 A;  4LOC A;  3LNQ A;  4B4C A;  3IV5 A;  3NAU A;  4D5F A;  3JR9 A;  1WI3 A;  3C2B A;  3BR1 A;  1UMQ A;  2EH3 A;  2XB5 A;  1MH4 A;  1B72 B;  1P7I A;  3RQI A;  1UG2 A;  2DMN A;  5E3O A;  1BA5 A;  2IEK A;  1E3O C;  4IHY A;  2MW8 A;  1Z0X A;  3IH4 A;  1H89 C;  5FKL A;  1OJL A;  1JKR C;  4Y52 J;  1MSF C;  1T56 A;  4IEJ A;  2QF7 A;  4EEF G;  2LKX A;  5M3F J;  3HB9 A;  1RKW A;  4W1U A;  9ANT A;  3JRE A;  1BW6 A;  2DA3 A;  1UHS A;  3IH3 A;  5F08 A;  3TED A;  2K9Q A;  4G12 A;  3B6A A;  1B8I B;  2HQ5 A;  2JMW A;  3LSJ A;  4D5C A;  2VUM J;  4X6A J;  5K7F A;  4A3L J;  1VND A;  4M3G A;  5IYB J;  5E3L A;  1AHD P;  1B72 A;  3JRI A;  2HXO A;  5GPA A;  2E1O A;  3NAR A;  1GT0 C;  2MSY A;  3JRD A;  1K83 J;  2HYJ A;  3HDD A;  1FEX A;  3A02 A;  1DU6 A;  2WAQ N;  3H0G J;  1EF4 A;  1TWA J;  3OSF A;  3S2H J;  1ZR2 A;  3Q0U A;  1ZQ3 P;  1IUF A;  1TWF J;  3BR0 A;  5F1J A;  1XS9 A;  1O4X A;  1JKQ C;  1D5Y A;  3GTO J;  2K9N A;  1JT6 A;  1MNM C;  3GBG A;  4M3B A;  4DYC A;  2HI3 A;  1Y1W J;  5M5Y J;  3S1R J;  1MBF A;  1B8I A;  2CQX A;  2IBD A;  2VI6 A;  2EZL A;  3HEF A;  1BL0 A;  3ZQH A;  4JX5 A;  1HDD C;  1ETQ A;  4XRS G;  1AKH A;  2M2E A;  1R9T J;  3FKI J;  1RPW A;  4A3D J;  1I50 J;  1ZTR A;  1MBK A;  1ETW A;  2H1K A;  1JJ8 C;  4V2F A;  2NS7 A;  3S1Q J;  3SJM A;  2H8R A;  1MBJ A;  1IC8 A;  1MBH A;  4JX6 A;  5M5W J;  5JLW A;  4A93 J;  5C44 J;  1NTC A;  3D1N I;  1ITY A;  1JUP A;  1FIP A;  4DW6 A;  3CDL A;  1JJ6 C;  2KT0 A;  2ID6 A;  4GFB A;  4W97 A;  1QRY A;  2LD5 A;  2JJ7 A;  4CYC B;  3H3V K;  4JP0 A;  4BY7 J;  4D7N A;  1CQT A;  3TP3 A;  3ZQG A;  4QIW N;  3M3Y J;  2DA6 A;  2CQQ A;  2PMZ N;  5IPA A;  3LSR A;  3ZQC A;  5FJ8 J;  1S7E A;  4A3F J;  2X48 A;  1NK3 P;  4RDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...