3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
2OD5A 5BQTA 2DU9A 3NEUA 3SZTA 1D5VA 1PP7U 4DQ2A 1OPCA 1GXPA 3VODA 2GWRA 4HA8A 4MHGA 3LQQA 5D6FA 3VEPA 5HVQC 1LDDA 5CJ9A 5LRRA 2IPQX 3B73A 2O8XA 3W6JB 1J7KA 4ENKA 2JPCA 2ZNYA 5LLQA 5HLIA 4AVPA 4EJWA 2IA1A 3KP7A 5AIQA 4OIQF 1IZ1A 1D3YA 2ZMEA 3E5XA 2FBIA 3F6VA 4ENJA 2FF4A 2GXBA 1UHMA 2BV6A 3GO5A 5CVUA 1EH6A 4EV0A 3KLNA 2EV6A 1FSEA 3D5LA 2IRFG 5LEJA 1K6OA 1BN5A 2G7UA 3DEUA 5HDNA 1BC7C 4ESFA 3KLOA 4A6EA 5E8GA 3EQLF 3RIRA 2QUFA 1MDMA 4KN4X 4KN7X 2IW5A 2GIVA 2TDXA 4A5NA 2A07F 5AONA 1P2FA 5LEKA 1W7PB 3I71A 3RPQA 3J81Z 2UZKA 1G4DA 4JQFA 3IKTA 1IRFA 2JT1A 3JSPA 4XSZF 3V4GA 3BPXA 2RVCA 4G7OF 3OOPA 4MQVA 2FE3A 1NHAA 2W25A 4G6DA 1HSTA 3CDHA 4N9HA 3SXYA 1ZREA 3V8KA 3I53A 4L18B 2VBWA 2QYOA 2OAZA 2NYXA 4ZH4F 1K7AA 1ON1A 3C3WA 4ZYDA 1WI9A 2R7DA 1IXSB 4DNCA 3V8LA 5J8CA 3G73A 3WE2A 1R5GA 2MLKA 2XAGA 4O5VA 5K5QA 2EFWA 1U5TB 5BOXA 2CYYA 2QQ9A 2YX7A 3KEQA 5K5RA 3O6BB 1YS7A 3J7AO 4UXNA 4WWCA 4XSXF 3JTGA 3FHZA 3CUQB 5DUKA 4KICA 1YIOA 3LA2A 3ZPLA 2XROA 1T98A 2LNBA 1G3YA 1H9GA 2ZKZA 3CUQC 3GWZA 1R5HA 1SAXA 1O3RA 1G6NA 1TW2A 2RC4A 3KP4A 5FFXA 3S2WA 5ICGA 3KP6A 3LA3A 1W4MA 3GFIA 3HTUA 2VBXA 1TNTA 1HBXG 4CXFA 5BS6A 2IT0A 2DT5A 5L3GA 5ILVA 1CF7A 1USSA 3R61A 2EJRA 2E7XA 3K69A 3TQNA 2M45A 2QQAA 3ELKA 1TQMA 3TDUC 5AIPA 1SFUA 2HTSA 5DEQA 4HBLA 1QZZA 2P5LC 4EQQA 3KETA 4EGZA 1J5YA 3I64A 3I58A 1KA8A 4LB6B 3WTZA 1R58A 4I7HA 2A5YB 2V1XA 2L54A 2X0LA 2OZ6A 4IF4A 4ZYEA 2P6SA 3EETA 1R36A 1SFXA 4UUVA 1XDUA 4UV9A 4IXAA 3MAJA 4M71A 5IT9Z 1O7FA 4B09A 3WE3A 3F8FA 5H6QA 3JTHA 3HRMA 4I02A 1STZA 1FBQA 2K4BA 4BYYA 3T8RA 3ZP5A 4IHTA 3ZMZA 4EM2A 3V8JA 3MCZA 4G8XA 4OINF 5D4RA 5FGMA 2FQ3A 1ZARA 2ELHA 4HLYA 1L0OC 3FWEA 3E6BA 3GZ6A 3IC7A 4AIKA 3NRVA 5DD8A 3R6SA 1FC3A 1X3UA 5HS8A 2P5VA 5F1RA 3BJ6A 4MQ9F 4IVNA 1IXCA 1IN8A 3BOQA 3GXOA 5CYVA 1S8NA 1HKSA 4ZZDA 4NQWA 4RAYA 3ROUA 1KU7A 1DPUA 1B6AA 1XB4A 1F1ZA 2XKPA 3C7JA 3J80Z 3BZ6A 4UHTA 3R0AA 2BYVE 2X4HA 2Q0OA 1UFMA 1HSJA 2E7WA 2VONA 2UXNA 2DO7A 4I0AA 4WX9A 1Q1HA 2MC3A 1W5TA 3TDZC 3O3KA 1TQPA 4HAMA 2PLYA 4XLPF 3DP7A 2E1NA 1Z7UA 2V1DA 3CJNA 4M9ZA 2P5KA 1B59A 2KIUA 4M74A 1D8KA 2XHKA 2CO5A 2VXZA 1BI0A 4GYIA 1J0RA 1BJAA 2Y48A 1KU3A 2FBKA 1EH7A 2OBPA 4AD9A 4IRIA 3RYPA 4Z2YA 3MEXA 3EYYA 2F5FA 4ESBA 3WTWC 5FO5A 4WK8F 5FD6A 5DV5A 1XD7A 3ML6A 2QM3A 1SFEA 3JAMK 4O6JA 1SD5A 3ISPA 4HQMA 4M6YA 3F3XA 1RUOA 2DQRA 1V4RA 3CUQA 3WTTC 2CSOA 5FD5A 2MLGA 1SMYF 1WSUA 3ZMUA 1O3SA 2OA4A 2EA4A 1V3FA 1LVAA 3GEZA 2K27A 1BIBA 1BBYA 5E18F 3E97A 4TV7A 4EJVA 2YX4A 4XLNF 3FM3A 2JZYA 1MZBA 5BPIA 3HOSA 1BI1A 3FXRA 4LMYA 2DW4A 3CTAA 5JVTA 3WU1B 2RGVA 3ERED 4L5JA 5LHHA 1B1BA 3HSFA 1YW8A 1KU2A 4KMUX 2PI0A 5ILUA 1IRGA 5E1WA 1ZH5A 4U7BA 1R1TA 4RB1A 2A6HF 3I54A 3WTXC 4WF2A 3TOAA 1FY7A 1FX7A 4ENMA 1W7PA 1S7AA 5DCFA 4HYEA 2ESNA 2A68F 2XRNA 5HLHA 1YTYA 1XSVA 4OIPF 3ECHA 2J5PA 4CICA 5FLXK 3DXJF 2ZXJA 4GYGA 2EB7A 4BXUA 4GXOA 2PN6A 4P96A 3J81K 3OV8A 3EUHA 3BDDA 3RDIA 4OIOF 2HEOA 5D6EA 1YQAA 1W5SA 5JR3A 4OOIA 1GXQA 3KFWX 1U5TA 5BPDA 3V7SA 1MJ9A 1G3WA 5LGNA 1TQIA 2FA5A 1LDKB 1XDSA 1DDNA 5LHGA 3R0JA 4HOBA 4EVIA 3J80K 3F8MA 1ONVA 3ZN0A 3QU6A 4UNOA 1XCVA 1ODDA 3NQOA 1KU9A 1SD4A 2D1VA 4WXDA 2WTEA 1FZPB 3V7RA 4U88A 4P5OA 2VN2A 3T0YA 2IVMA 4HDUA 3KZZA 5CLSA 5FLXZ 3GFMA 2K02A 3MFKA 3TOBA 1ZHFA 1CF7B 3L7WA 3SHFA 2DTRA 1TW3A 4BAYA 2JPBA 5EEHA 4A0ZA 2IP2A 3GFJA 1BM9A 3WGIA 1A04A 4R79A 3W6KB 4KYWA 2L4MA 2NRAC 2DAOA 1SD7A 1JGSA 2XV4S 2Z33A 5DD4A 3DPTA 4CDGA 2FXAA 2GXGA 2M1BA 1KQ8A 2Q8KA 4ETSA 3M1EA 1OYYA 4KDPA 4HLXA 1MGTA 1R22A 1J59A 3ABUA 2RN7A 4IJAA 4Q48A 5K1YA 4EM1A 4Y17A 3I0TA 1RNLA 2D1HA 4L5IA 1FYMA 4RAZA 5KVRA 1JE8A 4WCGA 2RKHA 3F8CA 3FX3A 2XAFA 4OMZA 5LGTA 1FYLA 5J8FA 4A12A 2HZTA 3KP2A 3CO7C 2F5DA 1KQ9A 4A2UA 2STWA 1YW9A 2KJBA 5L3BA 3L9FA 1E17A 2Z99A 2QBYA 1U8RA 1ZG3A 3M8FA 5IT3A 1H0MA 4HX8A 2CW0F 3KZYA 2HGCA 3HHHA 2A6EF 1MKMA 5CVRA 1ZN2A 2ESHA 2H6BA 3CLOA 2MH2A 4KA4A 1DUXC 4P9FA 4G6QA 2MD5A 5D5XB 4HV6A 2VC1A 3HHGA 1BIAA 1QBJA 3DF8A 4Q47A 2GA1A 4R1HA 3HIFA 2W24A 3T8TA 3EYIA 4A0XA 5E8IA 3D0SA 2EFQA 1S6LA 2HQRA 4CGZA 2C6YA 2WC2A 1H9TA 3ZMDA 5HDGA 5D8KB 4ENNA 4LFUA 3F23A 3R4KA 3BPVA 1T39A 4LG0B 4LK1F 4PZJA 5E1ZB 4RGXA 4I2OA 4I09A 3DPLC 2WWYA 2ZCWA 1LNWA 5F6FA 3R60A 3WGHA 2VE9A 1FWZA 2OQRA 5TRDA 3HYIA 3GZ5A 2YSRA 3O2PE 2GA2A 1IN5A 4MGRA 4N0BA 3QU3A 5J6XA 4GCVA 3QPTA 3ZN1A 1S3JA 3WG9A 2ZBKA 1XGNA 2OZUA 1U3EM 1PP8F 3RYRA 4CZZA 3RTRA 1FBUA 3KE2A 3MZHA 4RB0A 4HF0A 1R1UA 2K86A 2GZWA 4CO8A 2QVOA 2DK8A 1OYWA 2LF7A 3SFZA 3WTUC 2KJCA 4QWQA 4ZYGA 2YPRA 4EJOA 2PBIA 4S04A 4M6XA 4OU0A 5H6RA 3H3ZA 3K1PA 3ZQ7A 4HF2A 4YIFA 2Z3YA 2EA2A 3G3ZA 3VOEA 2M5WA 3IWZA 2XAHA 2P8TA 2PEXA 1U5TC 2H09A 2QQBA 2VT2A 2CGPA 2FU4A 4BNCA 2IA0A 4RB3C 3QRFF 1Y0UA 3VB2A 3GW2A 4FT8A 2AXLA 4LJZF 2LDUA 1B9NA 1Z05A 3ABTA 4UV8A 1QO0D 4FHTA 1R7JA 3GLXA 2NNNA 1REPC 4IRHA 4IPAA 4GO1A 2BGCA 4RS8A 5ERIA 2IJLA 5ICFA 3ECOA 4R8HA 4CYDA 2FNPA 2ISZA 2FMLA 4L9VA 1ZG1A 4I0BA 4PDKA 5EEGA 2NNYA 4OIRF 4FX4A 4A0YA 1LEBA 2A61A 3FXUA 4BHPA 4Q5SF 1UCRA 2F2EA 3F21A 4LB5A 2QLZA 3PFIA 2K4JA 4HX4A 1Z91A 3TO6A 5CVVA 4RGRA 1XSXA 1T2KA 3MQ0A 2UWMA 2DPDA 3TKYA 3I59B 3E5UA 2GAUA 2O61A 3L00A 3P9KA 5L3DA 1JHFA 2FSWA 2MBFA 3GFLA 3K9TA 3RKWA 1FLIA 1FBSA 1ZRDA 4NHJA 3HOTA 1OKRA 5D5VB 4HDVA 3RKXA 4LD5A 1TNSA 2PG4A 1P6RA 3BWGA 1U2WA 1HW5A 5LGUA 1KYWA 3T1BA 5FB2A 2W85A 4EMSA 2JSCA 1BC8C 2ZNZA 3U1DA 4D0PA 4LG0A 3HTSB 5L3FA 2HFHA 4M9SA 2RQPA 3H3UA 2PQ8A 1ZGAA 1G3TA 1WRJA 1B4AA 3BP8A 1LEAA 3F8NA 1J2XA 1QNTA 2ADUA 2GQQA 4QLCU 4I01A 2L4AA 5D4SA 1R23A 1FPQA 2HYGD 1FT9A 2XASA 5D8LB 1B9MA 1I1GA 3ZMVA 4H0EA 1OMIA 1XMAA 1KGSA 2CFXA 5K5OA 4KFCA 2F5CA 2XAQA 5LBQA 3LAJA 3REOA 4BH9A 5CVJA 1O57A 5CVIA 3TGNA 2XUBA 1YFHA 3HUGA 4KIBA 1TBXA 5E1XA 2KIFA 2H27A 3KP3A 2ISYA 1MJBA 4KIGA 3COAC 4YFNF 3P9IA 1I6XA 3QAHA 1ZRFA 2ZJ2A 1IN7A 1FP1D 3BJOA 2CQKA 1EV7A 2G9WA 3WU0A 3WTYC 4E70A 2FEZA 2EFOA 5E20A 3F6OA 5A2QK 1IAWA 1XGSA 5JHUA 4EJTA 4HX7A 1W7PD 3E6CC 2ACJA 1IXRC 3IKVA 4KT5C 5H20A 1I5ZA 2Y75A 1J75A 2O6GE 1QZYA 4O3MA 3V7CA 1S29A 2M30A 1XSDA 2E1CA 1P92A 2W84A 4XRFA 1L3LA 2FBHA 2WV0A 1ZLJA 3JAMZ 4LGWA 1FSHA 3LFKA 3M8EA 5L3CA 2EWNA 1WWXA 2QZ8A 1ZGJA 4S05A 3T5XA 4LLLA 4MNUA 1R00A 3Q9VA 2EV0A 1T6SA 3QP6A 2ZMEB 2PFBA 4KNYA 4G94A 5FFZA 3RI4A 2OQGA 4JK1X 2DBBA 2CWEA 3N97A 3RJPA 2G7HA 4KIFA 1Z6RA 2ETHA 3AAFA 1U6GA 4LLNA 1TTYA 2O3FA 3FM5A 1P4AA 1Z6TA 4MEXF 1P4WA 4LLGF 1K78B 2H94A 4EJUA 2YU3A 2VBZA 1KQ0A 2PMUA 3VFZA 2JRTA 3LA7A 5IT9K 1PUEE 3BROA 3N4MA 2R3SA 1HXDA 1BI2A 3GF2A 2D2WA 3K1NA 3P7NA 1HW2A 3QOPA 1E2XA 5HS7A 1ON2A 1T0FA 3QP5A 4GGGA 3H92A 3IHUA 1KYZA 4M73A 1HKQA 2EFNA 2RDPA 4U0VA 4AIJA 2L02A 2PMHA 2HOEA 3MWMA 2DLLA 1RZ4A 2R7FA 2BEOA 4L9NA 1LB2A 3E3VA 3IRQA 2XGXA 4L0YB 3WODF 1PDNC 3ZMSA 4M9XA 3TO7A 1MDMB 3DFGA 2DFIA 5LHIA 4AWXB 5D5WB 1J9IA 1TLHB 1HQCA 2O03A 4HQEA 4K2EA 4L9TA 2XAJA 1IW7F 1YO5C 5ICCA 4RGUA 4XBFA 2Z9OA 1SMTA 1UB9A 1XCBA 1IUYA 3LAPA 1IN4A 2XIGA 2YR2A 5TJJA 4AIHA 4BQAA 3FZVA 3GYHX 3E6DA 4L0ZB 2MH9A 3BJAA 3SZPA 5ED4A 3I4PA 3EDPA 2P6TA 3HSRA 1AWCA 3I59A 3M9AA 5JI6A 3E6MA 2EK5A 2HQNA 1YYVA 5DYMA 3C18A 2LSOA 2P7CB 3KEOA 2FNAA 3FF5A 2QBYB 2O0YA 4G9YA 2XKOA 4MEYF 4HV5A 3GVAA 3WTVC 3U2RA 1DPRA 3HSEA 4I98B 1F9NA 4WXHA 2DPUA 4MTDA 5E17F 1IN6A 1G3SA 4IHSA 1FNNA 1I27A 3B02A 4PGHA 2VT3A 4ZYHA 2LKPA 3DKWA 4CHUA 3IWFA 4ASNA 1LQ1A 4YFKF 1F4KA 3JW4A 2VODA 4M72A 1P4XA 2KIMA 4YIIA 5DCMB 3KP5A 4RGSA 3PQJA 6PAXA 1XGMA 2DI3A 2Y0MA 1FP2A 4YG2F 2XVCA 4PGGA 4EGYA 4KMFA 3HRUA 2P7VB 1ZRCA 1RUNA 3Q5FA 5ICEA 1F5TA 2VBYA 1U78A 2BBYA 2RV8A 3IL2A 1LDJA 4HF1A 2JTVA 3TO9A 2BE5F 5KK1A 1QQIA 1K78A 2M87A 3QPHA 1JXSA 1EH8A 2QWWA 2OU2A 4HZFA 2LF8A 2FOKA 4LK0F 1JHHA 4P55A 4RB2C 4Q4ZF 3HRSA 3L09A 4ZZLA 1FYKA 3F22A 2K7LA 3KCCA 3FMQA 3CUOA 1T38A 2Q2EA 2DK5A 2HS5A 2P4WA 4ON0A 5HLGA 2M8EA 2IA2A 1ZLKA 4G7ZF 3K0LA 1I1SA 1S7OA 2W57A 2PJPA 1ZYRF 4P9UA 1YS6A 3BY6A 2Z5UA 4L9JA 2EFPA 1XN7A 2EV5A 3CO6C 1DP7P 3FXQA 4A5MA 1OR7A 3K1MA 1QGPA 2RNJA 1K79A 3LQRA 1GVJA 1YLFA 4U0YA 2A3SA 1HW1A 4B8XA 3FMSA 1HKTA 2H6CA 3ZMTA 1CGPA 3PQKA 1YW7A 2STTA 3LWFA 5A2QZ 5DUIA 5LRSA 2HDCA 3I5UA 2KRFA 2MA3A 3GUDA 3FMRA 1BI3A 1UHWA 2DQLA 1SD6A 1OYIA 4ESJA 4A6DA 1R1VA 5F64A 3DQVC 2VOOA 1VTNC 1Z9CA 1XGOA 2HKXA 2FRHA 2V9VA 2ZFWA 3DV8A 1QPMA 2A69F 4OMYA 1BOAA 4UVCA 3MZYA 2L3DA 3RPUA 1ULYA 2V1UA 3K2ZA 4YFXF 2V6CA 4U7DA 2VOPA 4F7ZA 1FOKA 3WGGA 1RIOH 1MJAA 1ZG5A 4FX0A 1C0WA 3P9CA 1O3TA 3GX4X 4PCQA 4BHCA 2FMYA 1GHCA 1AOYA 2KKOA 4UVBA 4EM0B 4BHBA 3L2CA 4G7HF 1O3QA 3HRTA 5BMZA 2D45A 2CG4A 4HW0A 3RKYA 3IRRA 1XMKA 5HDKA 1Z1DA 2HTJA 2NS0A 1YG2A 2HWVA 1ZAOA 4Y15A 5DDGA 2HKOA 2VE8A 4NB5A 3E5QA 5L3EA 2COMA 5DCMA 5D5UB 2VC0A 1WQ2A 1O7LA 3Q9SA 4UVAA 1MD0A 5ILSA 3ULQB 3F72A 2UXXA 3LSTA 2QENA 4KUMA 5HS9A 4JBAA 3C1DA 2HR3A 3F8BA 5HOOA 1WKMA 2HYFA 1D8JA 4WXCA 1LJ9A 4IRGA 3SQNA 2F5EA 2L01A 2B0LA 2ZO4A 1RI7A 4MTEA 4Y13A 2NAZA 4U0WA 2AS5F 3WTSC 1USTA 3JSOA 5JFRA 3M7GA 4N9IA 3U9GA 2J5OA 2V79A 1IF1A
chains in the Genus database with same CATH superfamily
2OD5A 5BQTA 2DU9A 3DCFA 3NEUA 3SZTA 1D5VA 1X1CA 3QYEA 1PP7U 2JSPA 4OAYA 4DQ2A 1OPCA 1VQ7I 1GXPA 3VODA 2GWRA 4HA8A 1T95A 4MHGA 4RA2A 1TT0A 4U87A 3DLLF 3I55I 4FCYA 3LQQA 1OCCH 3LSHA 5D6FA 1LDDA 3VEPA 5HVQC 5CJ9A 5LRRA 2IPQX 2XPWA 3PFYA 3B73A 2KRHA 4XMYA 2O8XA 3ASOH 1BR4A 3W6JB 1CQTA 5HODA 1J7KA 1MMNA 4ENKA 1K4TA 2A5WA 2JPCA 2ZNYA 4JX6A 4B4CA 5LLQA 4IOCF 5HLIA 4AVPA 2OUMA 2DMPA 4EJWA 2IA1A 3FBNB 3C2GA 1GT0C 5FKOA 3KP7A 3CZ6A 4XKCA 1ETVA 5AIQA 1UMQA 4OIQF 3HM5A 2KISA 1IZ1A 1D3YA 1MMGA 2ZMEA 3E5XA 2FBIA 2R7TA 2CV1A 2GM4A 3KIOA 3F6VA 4ENJA 2FF4A 2GXBA 3OYJA 1UHMA 2GLOA 2BV6A 2O8KA 3GO5A 5CVUA 2HU9A 1EH6A 5DS9A 3DEEA 3GTOJ 3RCOA 3AFHA 3KEYA 4EV0A 3KLNA 2UV1A 3LOCA 2EV6A 4HPQA 4CCKA 1V5EA 2Y31A 1YRNB 2NOJB 1FSEA 1HCRA 3FXJA 1Z7LA 3D5LA 2IRFG 5LEJA 2VXDA 3BCBA 2DT6A 1BN5A 3W3CA 3ZGKA 1K6OA 2G7UA 2K9QA 3DEUA 5GP9A 5HDNA 1BC7C 4ESFA 1DGRM 3KLOA 1OFCX 2LVSA 4A6EA 1X1DA 1BJZA 5E8GA 4CCLA 4D7MA 3EQLF 5F04A 3FISA 2XRLA 3RIRA 5IOYA 1A31A 3EUHC 2IGOA 2QUFA 3LSGA 1MDMA 4KN4X 1IC8A 3VYUB 4KN7X 2IW5A 2WBMA 4B47A 4BS9A 2GIVA 2TDXA 3OIQA 4A5NA 2CJJA 3CCMI 2A07F 3I4NJ 3PSIA 5AONA 3ZQHA 5LFAA 4UUSB 1P2FA 1WI3A 2M9HA 2NS8A 5LEKA 1W7PB 1JT0A 1ITYA 3I71A 1GVDA 5M3FJ 2CFOA 3RPQA 3J81Z 2UZKA 1G4DA 2F5VA 4JQFA 3IKTA 1IRFA 2JT1A 2ME6A 4XSZF 3V4GA 3JSPA 3ABLH 1ENHA 2LH9A 3BPXA 3D5SC 3K4NA 5E79C 2RVCA 4G7OF 3OOPA 1GDTA 4MQVA 2BW3B 5J40A 2FE3A 1NHAA 2W25A 4G6DA 5GPAA 1HSTA 1SAUA 2YS9A 4QSHA 3CDHA 4N9HA 3SXYA 1P7IA 2P0WA 1ZREA 1RKWA 3V8KA 3I53A 4L18B 2VBWA 2E2JJ 4LIUA 2QYOA 2DFFA 1WJFA 2OAZA 2NYXA 4ZH4F 1K7AA 2OTLI 3SDGA 2LY1A 1ON1A 4ZTFA 3C3WA 1A6QA 4ZYDA 5JHFA 1WI9A 3ZQQA 2R7DA 1JJ6C 1IXSB 4DNCA 3V8LA 5J8CA 3G73A 3WE2A 1R5GA 2MLKA 2XAGA 4O5VA 2R5ZB 5K5QA 1K61A 2QGUA 4QTRA 2EFWA 1U5TB 5BOXA 2XF6A 1B72B 4XLCA 1D1AA 1WJ5A 2CYYA 2QQ9A 1WFXA 2YX7A 3KEQA 4BUPA 3H35A 2FX0A 3AKZA 5K5RA 3O6BB 1AKHA 3GTMJ 4GFBA 1YS7A 3J7AO 1QPIA 4HEA2 4UXNA 4A3IJ 4WWCA 4UUSA 4XSXF 3JTGA 3FHZA 3CUQB 5DUKA 3FXKA 4KICA 3VSLA 1YIOA 3LA2A 3ZPLA 2XROA 2JUCA 1T98A 1TC3C 2LNBA 1G3YA 2Y69H 2JQ7A 4YELA 1Y56A 3PIOF 1H9GA 2ZKZA 3CUQC 2EQRA 3BZCA 3GWZA 3KZIC 1R5HA 3PNTA 5JLWA 1SAXA 1O3RA 2PX9A 1G6NA 1TW2A 2RC4A 4RAFA 1TZLA 3KP4A 2CQXA 5FFXA 2CMPA 4KISA 3S2WA 5ICGA 1PUFB 5EDNA 3KP6A 2B63J 1MNDA 2KZGA 3LA3A 3NAUA 1IV8A 3HGYA 1W4MA 3GFIA 2IGKA 1FIAA 3HPGA 3HTUA 2VBXA 1TNTA 1HBXG 4CXFA 5BS6A 3I56I 2IT0A 2DT5A 3CD6I 2AQEA 4XORA 5L3GA 5ILVA 2M0CA 4BXXJ 1CF7A 5FLMJ 2BZTA 2DOEA 2IBDA 1USSA 2B9SA 3R61A 1MBHA 3J7AY 2EJRA 2X48A 2E7XA 3S1NJ 3K69A 5GTHC 1RESA 2XGCA 2HVQA 2QSGX 2ZJPF 1E3OC 2KHMA 3TQNA 2H1LA 1Z3XA 2R5YB 2M45A 2QQAA 3ELKA 1JTYA 1TQMA 3OL4A 3GMEA 3TDUC 5AIPA 3TBIA 3MVPA 1SFUA 2Z1DA 2HTSA 1SVOA 4HBLA 5DEQA 4KITB 4RBOA 1QZZA 2P5LC 2DYSH 2CQ7A 4EQQA 2KP6A 3KETA 4DZPA 4EGZA 1J5YA 1JT6A 1YX3A 2KPMA 3I64A 3S15J 1EF4A 3I58A 1KA8A 5EZGA 2F4MB 4LB6B 3WTZA 1R58A 4I7HA 2A5YB 2V1XA 2L54A 2V9PA 2X0LA 2XF5A 4MIMA 2CV0A 2OZ6A 1JKQC 4IF4A 1ZELA 2MG4A 4ZYEA 2P6SA 3EETA 1R36A 1SFXA 4JP0A 4UUVA 2EIKH 3QPLA 1PUFA 1XDUA 1T56A 4UV9A 1SFOJ 4IXAA 3MAJA 4M71A 3WHCA 1VZ0A 4EATA 3K4LA 5IT9Z 3OYHA 1O7FA 4B09A 3WE3A 3F8FA 5H6QA 3JTHA 4E7HA 1D0XA 1MSEC 5TGTA 3LSIA 3G1LA 3HRMA 4I02A 1STZA 2F48A 5B1AH 2DA2A 1FBQA 2E71A 1LPQA 2NVQJ 3S8PA 2K4BA 4BYYA 2EZKA 2LTPA 1WJAA 3OR1C 3T8RA 4A3KJ 5DM6F 2BHZA 3ZP5A 2PMZN 4IHTA 5FKLA 3ZMZA 4EM2A 1MW7A 2XF7A 1SEUA 2IS2A 3V8JA 3MCZA 1ETYA 4G8XA 4OINF 5D4RA 1BA5A 2OCCH 5FGMA 2KLOA 2FQ3A 1N75A 4PK4A 1ZARA 2ELHA 4C9YA 4HLYA 1L0OC 4XRMA 3FWEA 2QQ8A 3E6BA 2QEXI 3BR0A 3GZ6A 3A03A 3IC7A 3MKLA 4F93B 4AIKA 1NK3P 3NRVA 1A36A 3H3VK 5F27A 5DD8A 3R6SA 2HOAA 3IH2A 1FC3A 1X3UA 5HS8A 2P5VA 2Q1ZB 3ONQA 1V55H 1LVKA 5F1RA 3BJ6A 5J3LA 4MQ9F 4IVNA 1IXCA 5LD2C 1IN8A 3G6EI 1BL0A 3K6GA 5KHDA 1ETOA 3BOQA 3GXOA 2G0EA 4HNVA 5CYVA 1XTAA 2DMQA 3CCLI 2Q2EB 1S8NA 1HKSA 4ZZDA 2H8WA 4NQWA 4RAYA 3L2RA 3ROUA 3WG7H 4CCNA 1KU7A 1DPUA 1B6AA 4CZCA 1XB4A 1F1ZA 2ZSHB 2UUZA 2XKPA 3C7JA 3H0DA 2MW8A 3J80Z 2ZXWH 2XAUA 3BZ6A 2VKEA 4NDLA 4UHTA 3R0AA 1QHHD 1WH7A 2BYVE 2PJRA 3JRCA 3L2WA 2X4HA 2Q0OA 4AUXA 4C3IJ 1UFMA 2E5NA 4DW6A 1HSJA 2K85A 3S17J 2E7WA 2VONA 2UXNA 2DO7A 1F36A 1UAAA 5BNGA 5B5EC 2H8RA 3PNVA 4I0AA 4WX9A 1Q1HA 4H4KC 2MC3A 1W5TA 4PJMA 3TDZC 1BR2A 4A93J 3HOYJ 5FRNA 2PMZA 3O3KA 1TQPA 4HAMA 2PLYA 2NVYJ 4XLPF 5IY5H 3JRBA 2XGDA 1UJ8A 1VQNI 3DP7A 2E1NA 1Z7UA 1DQUA 2V1DA 3CJNA 4M9ZA 1KONA 2P5KA 1B59A 2KIUA 4M74A 1ACIA 1D8KA 3WHBA 2RQQA 2XHKA 2CO5A 2VXZA 1BI0A 4GYIA 1J0RA 1BJAA 3RKQA 1W0UA 1LE8B 2Y48A 1KU3A 1ETWA 2FBKA 3FBIB 2WAFA 1EH7A 2DXIA 2OBPA 5GPCA 3JRGA 4AD9A 4IRIA 2IS1A 2NVTJ 3RYPA 4Z2YA 4W97A 3MEXA 3BG5A 3EYYA 1OCPA 2DMNA 2F5FA 4ESBA 2IS4A 3WTWC 1FIPA 5FO5A 4WK8F 5FD6A 5DV5A 1XD7A 3K4BA 3ML6A 3BR1A 2MC4A 4XONA 3BCAA 1JUMA 1PJRA 4XRSG 2VQCA 2QM3A 4F91B 1SFEA 3JAMK 4CYCA 2IGMA 2WB1A 3DWLE 1ZGWA 2WAEA 2K9MA 5EF6A 2ELJA 4O6JA 1SD5A 3ISPA 3HC7A 4HQMA 4M6YA 1MBJA 2DA7A 2IXSA 1FMWA 3F3XA 3OYCA 1RUOA 3B6AA 4AC0A 1OCZH 2PJRB 2DQRA 1V4RA 3CUQA 1YITI 3WTTC 1P9QC 2M8GX 2CSOA 1RPWA 5FD5A 2MLGA 1JI8A 2I10A 3F9KA 1SMYF 3FDYA 4D7NA 4BQNA 4OAZA 1ZK8A 1W1WE 2NVUB 4CYCB 1XS9A 1WSUA 1KZHA 3ZMUA 1O3SA 4FTHA 2OA4A 2ECCA 2EA4A 3I3LA 1V3FA 1LVAA 2VJIA 3TP0A 1QVTA 4JX5A 1ZQ3P 3GEZA 2Y2ZA 2K27A 1BIBA 1BBYA 5E18F 2LBFA 3ABKH 3E97A 2M2EA 3HPHA 4TV7A 4EJVA 2YX4A 1P7JA 2OF7A 4XLNF 3BG9A 3A4CA 2JZYA 3FM3A 1MZBA 3Q3SA 5BPIA 1YRNA 3A0BC 1BI1A 2LYCA 3HOSA 3FXRA 4LMYA 5KAFC 2DW4A 1SC7A 3CTAA 5C4XJ 3E0JB 4ANJA 5JVTA 3WU1B 2K3PA 2RGVA 3A02A 3ERED 3BLYA 4L5JA 5LHHA 4AIDA 1B1BA 1APLC 4XQFA 3HSFA 1ETQA 2K3FA 2X1DA 1YW8A 2O5RA 1K6YA 2GBYA 1KU2A 3PL8A 3HZJA 4KMUX 2PI0A 5ILUA 1IRGA 1F43A 5E1WA 2LD5A 1ZH5A 2HI3A 1R1TA 2JRMA 2V7FA 4U7BA 3UNGC 4RB1A 2A6HF 3I54A 3WTXC 4WF2A 2K9SA 3G2BA 1DU0A 3OOUA 4E7ZA 1YIJI 3BR3A 1FY7A 3TOAA 1R49A 1FX7A 2CUJA 4ENMA 2WB1N 1W7PA 4F55A 5TISC 2X1CA 1TL8A 3CJTB 3K4KA 2R7RA 3B6CA 1S7AA 5DCFA 4B3XA 4NQWB 2R7WA 4HYEA 3RPUD 2ESNA 2R7OA 2A68F 2FOWA 4FASD 2DFEA 2XRNA 5HLHA 3OS0A 1YTYA 1XSVA 4B48A 1RR8C 4OIPF 4XLEA 2A05A 3HG9A 4FETA 4C30A 3ECHA 3CQZJ 3FXLA 2J5PA 4E6KG 4CICA 4XLAA 2ME0A 1X19A 5FLXK 4BE0A 2LBFB 3DXJF 3CLQA 1SANA 2VKVA 2ZXJA 3K4CA 4GYGA 1MMAA 3TMOA 2EB7A 2JA8J 4BXUA 2WA0A 5EG0A 2JJ7A 2E1OA 2PN6A 2QKMB 2DFHA 3LSKA 3OV8A 4GXOA 3EUHA 4P96A 3BDDA 3RDIA 3J81K 3OYKA 1U0JA 4OIOF 2MFZA 5D6EA 2HEOA 1VQOI 1LUJB 4IKFA 2DTZA 3OYBA 1PYVA 2LLKA 5GTIC 1YQAA 4NNJA 1W5SA 5JR3A 3VDXA 1PVEA 4OOIA 5FKKA 3TW7A 1GXQA 4DIQA 4E4HA 3KFWX 1OJLA 1U5TA 2M34A 3ESWB 4BY1J 5BPDA 4NC7A 3V7SA 1I6HJ 1MJ9A 4NC6A 1G3WA 1AA7A 2DDBA 2ZC2A 1MNMC 5LGNA 1TQIA 2FA5A 2WY8Q 1LDKB 1XDSA 1DDNA 4C2UA 5LHGA 3CCUI 3R0JA 4HOBA 4EVIA 3FK6A 3UR3C 3J80K 1AU7A 5E3MA 3M07A 4RLQA 1ZKGA 2K9NA 1QRYA 3F8MA 1LE8A 1R4MB 2BY1A 1ONVA 1BOBA 3ZN0A 3QU6A 1NK2P 4UNOA 2JWTA 4M3FA 1XCVA 3TL4X 1VQ4I 1HDPA 1ODDA 3NQOA 4II3A 1KU9A 4OWRB 1W0TA 2EZLA 3K70C 1SD4A 4BEHB 2D1VA 4XLHA 4WXDA 2WTEA 1WJBA 2ZJQF 1RKTA 1FZPB 4MFDA 3V7RA 4PUSA 4U88A 3RQ4A 2XB5A 4XKVA 3CCRI 4P5OA 2VN2A 3T0YA 2IVMA 3DBLB 5C44J 4HDUA 2JA6J 3KZZA 5CLSA 1POGA 1QHGA 5FLXZ 3HDDA 1I50J 1UHSA 3GFMA 2L0KA 2K02A 1K83J 3MFKA 3TOBA 1ZHFA 2E60A 3L7WA 3SHFA 3V42A 1B8IA 2DTRA 1CF7B 3S2DJ 1TW3A 4ABZA 4BAYA 2JPBA 1NH3A 5EEHA 4A0ZA 1I3AA 2IP2A 2CRGA 5HLTA 2LK2A 3EPZA 3GFJA 1Q1VA 2BY3A 4IL6C 1BM9A 3WGIA 3PO3J 3ZQCA 2CW8A 1A04A 4R79A 3W6KB 4KYWA 3KX2A 3UKGA 2L4MA 2X6OA 2NRAC 5IOZA 2DAOA 5GADJ 1SD7A 4L5EA 4BE2A 1JGSA 2XV4S 2Z33A 5E3OA 5DD4A 3DPTA 4CDGA 3H5NA 3SJMA 2FXAA 3S1RJ 1VNDA 3K4JA 2GXGA 2M1BA 1KQ8A 2Q8KA 1FOXA 4ETSA 2VPLA 3M1EA 1OYYA 4KDPA 2HXIA 4HLXA 1MGTA 1R22A 1J59A 3ABUA 2BXZA 2RN7A 5F0FA 1A35A 1G2HA 4IJAA 1BW6A 4Q48A 3OYLA 5IYDJ 1U9OA 2JA2A 4MFEA 2X6YA 5K1YA 3Q0UA 3PIPF 1Z21A 1J09A 3O8HA 4EM1A 1Z77A 4Y17A 3I0TA 1RNLA 5FJ8J 2D1HA 4L5IA 3G4SI 1WGXA 1Y1WJ 1FYMA 4RAZA 5JLXA 3BQZA 5KVRA 1JE8A 4WCGA 1JKPC 2RKHA 3F8CA 4ITVA 3FX3A 2XAFA 4OMZA 5LGTA 1FYLA 3PUFA 3X2QH 5J8FA 3L2VA 4A12A 1UZCA 2MD0A 2HZTA 5CQGA 3KP2A 3CO7C 2F5DA 2MABA 1KQ9A 4A2UA 4IOAF 2STWA 1YW9A 2KJBA 1T8IA 5L3BA 4P1WA 3L9FA 1XX5A 4PJNA 1FEXA 4A3CJ 3S3MA 1E17A 2Z99A 2QBYA 1V54H 2Y9YA 1ZG3A 1U8RA 1QA6A 2CQQA 3M8FA 5IT3A 1H0MA 4HX8A 2CW0F 4A3LJ 2BVLA 1MSFC 3KZYA 2HGCA 3HHHA 2A6EF 4BL0B 2M4GA 1MKMA 5CVRA 1ZN2A 2ESHA 2H6BA 2ID3A 1X2MA 3JRFA 3CLOA 2MH2A 3SFIA 4KA4A 1DUXC 1VQ5I 2VI6A 4P9FA 4G6QA 2MD5A 3EUKL 2ID6A 5D5XB 4HV6A 4AM3A 5FKMA 1FOYA 2I8DA 3GTPJ 2RREA 2VC1A 3HHGA 1BIAA 1QBJA 3DF8A 4Q47A 2BXYA 2GA1A 2CQNA 3BQYA 2E35A 3KPHA 4R1HA 4IQ4A 3DTEA 3M8JA 3MMYB 4B3AA 5M5YJ 4ZDOA 3HIFA 3NWTA 2R7SA 2RNGA 4IHVA 3HEFA 2W24A 4QPOA 3T8TA 3EYIA 4A0XA 1R5ID 2L7FP 5E8IA 4DOZA 2L9SA 3C2HA 3D0SA 4YEJA 1ETKA 2EFQA 3MD2A 1S6LA 2DDAA 2HQRA 4CGZA 2C6YA 2WC2A 1E3HA 1VI0A 4MO7A 2M7BA 4XL9A 1H9TA 3ZMDA 4DGWB 5HDGA 1O4XA 3E1SA 3CCQI 5D8KB 4ENNA 4XM3A 2CH0A 3JRHA 4LFUA 3F23A 3R4KA 1DP3A 1HOMA 1NTCA 5E3NA 4BQQA 3BPVA 1T39A 4LG0B 1Z67A 4LK1F 3HOVJ 4PZJA 2DA3A 4ZTJA 3SEQA 5E1ZB 4RGXA 4I2OA 3G1OA 4I09A 3DPLC 5IPAA 2VQGA 5IP7J 2W82A 2WWYA 2ZCWA 1LFPA 1LNWA 1X1BA 3K4MA 1TWFJ 5F6FA 4BJTA 3R60A 2X51A 3EUAA 1ZTRA 3OY9A 3FIWA 1Z3YA 3WGHA 2VE9A 1FWZA 3MKYB 2OQRA 3A01B 5TRDA 3HYIA 1FTZA 3GZ5A 3HL2A 2YSRA 2L9VA 1X4PA 3O2PE 2GA2A 1IN5A 4MGRA 3CC2I 4CA0A 2DOAA 4N0BA 2O9LA 3QU3A 3HGGA 5J6XA 4GCVA 1E3PA 3QPTA 3ZN1A 1S3JA 3WG9A 4IZZA 1VQMI 2ZBKA 1XGNA 2OZUA 3M3YJ 3HJEA 2YUSA 2W00A 1U3EM 1PP8F 2JVHA 3M4OJ 3RYRA 3A0HC 4CZZA 3RTRA 3TEDA 1FBUA 3KE2A 4CCOA 3JRIA 3MZHA 3OMYA 2X6WA 3CP8A 3QWLA 2F4OB 2LREA 4RB0A 1EA3A 4HF0A 1R1UA 2K86A 1IG7A 3RZOJ 2GZWA 3H1CA 5EGOA 3OYMA 3FHNA 3RZDJ 1VF9A 1B72A 4RDUA 3IP4B 4CO8A 2DA1A 2QVOA 3GTJJ 2DT7B 4BQOA 2DK8A 1OYWA 2LF7A 2BY0A 3SFZA 5GAGJ 5GAEJ 3WTUC 2VQHA 2EINH 2KJCA 4QWQA 2WV1A 4I6ZA 4ZYGA 2F4IA 2YPRA 4EJOA 1N25A 2PBIA 2CUEA 4S04A 4M6XA 4OU0A 5CPRB 5H6RA 4UB6C 3H3ZA 3K1PA 3ZQ7A 4HF2A 4E7JA 2OCEA 4YIFA 3IAM2 2Z3YA 4PJLA 2EA2A 3G3ZA 4A3MJ 4F52A 3VOEA 2M5WA 4IHYA 1LFUP 4V2FA 3IWZA 3W6VA 1IDZA 1R4NB 2XAHA 2P8TA 5EGOB 1UELB 2PEXA 4PFOA 1U5TC 2H09A 1G8XA 2QQBA 2VT2A 1YOVB 2DA5A 2CGPA 2FU4A 4BNCA 2IA0A 1Y6IA 3OYIA 2KZVA 5IP6A 4RB3C 3ZXSA 3QRFF 1Y0UA 3VB2A 5F1JA 3GW2A 3I9V2 4FT8A 2AXLA 4LJZF 1X2NA 3LSMA 4ZDPA 1BR1A 2LDUA 1B9NA 2R7QA 4HSTA 3VPRA 1Z05A 4RM2A 4BJ5C 3ABTA 2TRTA 4UV8A 1QO0D 3AG1H 4FHTA 1R7JA 3GLXA 3J7YJ 1FMVA 2NNNA 1REPC 4IRHA 4IPAA 4BBRJ 2XDVA 2E1MB 4GO1A 2BGCA 4RS8A 5ERIA 4YRVA 3CJRB 2IJLA 5ICFA 3ECOA 4R8HA 4XLFA 2FNPA 4CYDA 2ISZA 2FMLA 4L9VA 2V6EA 1ZG1A 4I0BA 4E7SA 3OYFA 1NG7A 4PDKA 5C3EJ 5EEGA 1N78A 2NNYA 4OIRF 4FX4A 4A0YA 1LEBA 2VJJA 2A61A 3FXUA 4BHPA 4Q5SF 1UCRA 2F2EA 4PSWA 3F21A 3QOEA 3AL0B 5B66C 3NARA 2QLZA 4LB5A 2X9DA 1LKXA 3PFIA 2K4JA 4HX4A 4DYQA 1Z91A 5GAHJ 3TO6A 1X1AA 5CVVA 3DKXA 1XSXA 4RGRA 3OYNA 1T2KA 3MQ0A 2IGNA 5EZHA 5E3LA 1IUFA 2H1KA 3OS1A 2UWMA 1MBGA 2DPDA 3TKYA 3I59B 4FE7A 4FE4A 4IX7A 1EJ9A 4DJAA 3E5UA 2GAUA 2LKXA 4CCMA 2O61A 3L00A 3G1MA 3HXLA 2HYJA 1V5FA 3P9KA 3TP3A 5L3DA 1Z0XA 2YU9J 1JHFA 2FSWA 4M3GA 2MBFA 1BW5A 3HB9A 4J00A 4I76A 3GFLA 2X6XA 3K9TA 1WJCA 3RKWA 3SEZA 1FLIA 1FBSA 4W1UA 1VQKI 1H88C 1ZRDA 4NHJA 3HOTA 1OKRA 2ICWG 1T08B 2K9LA 2M7AA 5D5VB 4HDVA 2GOMA 4BE1A 1IJWC 4BACA 3RKXA 4LD5A 1TNSA 1TWAJ 2PG4A 4LG3A 4RMNA 1OLTA 1P6RA 3BWGA 1U2WA 2Z2SB 3PM1A 1YHQI 1HW5A 5LGUA 2EZHA 3ZQIA 1KYWA 3DBHB 4PFPA 2V4JC 3T1BA 1W36C 3LFUA 5FB2A 2W85A 1A6IA 4EMSA 4XN3A 2JSCA 2XPVA 4E7KA 1BC8C 4XOTA 4ZC3A 2ZNZA 3PJRA 3U1DA 4D0PA 4LG0A 3HTSB 2R7UA 5L3FA 3H36A 2HFHA 4M9SA 2RQPA 3AG2H 3H3UA 1VFCA 2E34A 1XPXA 2PQ8A 5H2FC 1WHUA 3BZKA 1ZGAA 1G3TA 4V2GA 1WRJA 1B4AA 4IQJA 3BP8A 1LEAA 5J4VA 4BXFA 2EIMH 3F8NA 1J2XA 1QNTA 3BTLA 2DODA 2ADUA 3JCUC 5KAIC 2GQQA 1SFKA 4QLCU 4I01A 2L4AA 2OV7A 5D4SA 1R23A 2VJ5A 1FPQA 2Y0SA 3HOZJ 2E36A 1JKOC 2WY7Q 2HYGD 1FOWA 3SDBA 1FT9A 2XASA 5D8LB 3QYFA 5K7FA 1DGWY 1B9MA 1I1GA 3ZMVA 1HA8A 4H0EA 3PUBA 3GTGJ 1OMIA 2MSYA 2ZXIA 1XMAA 1KGSA 4N4NB 2CFXA 5K5OA 5J47A 2EILH 2R0QC 4KFCA 2F5CA 2XAQA 5LBQA 3LAJA 3REOA 2A6TA 2OPTA 1MBEA 1D1CA 4BH9A 5CVJA 1ERDA 3N05A 1O57A 1RRJA 2NS7A 3Q0VA 5CVIA 3MZ8A 3TGNA 2XUBA 3CF2A 1YFHA 3HUGA 2JA5J 2EPFA 3KYCB 4KIBA 1TBXA 5E1XA 2KIFA 1GV2A 2H27A 2JUGA 3KP3A 2W7NA 2ISYA 1MJBA 1HDDC 2TCTA 2DJIA 2DMUA 4KIGA 2E5ZA 3COAC 4YFNF 2KT0A 2VL8A 3U21A 3P9IA 1I6XA 3QAHA 1X3WB 1FTTA 1ZRFA 1RR7A 2ZJ2A 1IN7A 2VIXA 3CCEI 2ECBA 1FP1D 3BJOA 2CQKA 1EV7A 3CP2A 5IYBJ 3S3OA 1I3QJ 2G9WA 1A5JA 3OR2C 1IDYA 2L9NA 4CSWA 3WU0A 4RAGA 3P5JA 3WTYC 2OTJI 4E70A 2FEZA 2L7KA 2EFOA 5E20A 3F6OA 1V5GA 5A2QK 1IAWA 1R6RA 1GUUA 2Y0SN 2L5QA 3GCMA 1XGSA 5JHUA 2L7ZA 3BTCA 3U1KA 4EJTA 2W48A 1DU6A 1UG0A 4HX7A 2LOOA 1W7PD 3E6CC 2ACJA 1IXRC 3CCYA 1YI2I 3IKVA 2KDZA 3OSGA 4CH7A 4KT5C 4PSXA 5J1UA 2DOFA 5H20A 4AU7A 1I5ZA 2GOXB 2Y75A 1J75A 2O6GE 2VQLA 1QZYA 1XG1A 4O3MA 3V7CA 1S29A 2M30A 2V9KA 3H9JA 1SVLA 1XSDA 2E1CA 3BR2A 1HLVA 2N8GA 1P92A 3CC7I 2HPIA 2HDWA 2NVXJ 2W84A 3ERMA 1WCMJ 1OCOH 5B1BH 4XRFA 2E1MC 2MYSA 4UB8C 1L3LA 2WADA 2FBHA 2WV0A 3ZR8X 4NBQA 1ZLJA 2QSFX 3JAMZ 4HG2A 4LGWA 1QVUA 1FSHA 3LFKA 3M8EA 5F08A 2EWNA 2Z16A 5L3CA 1WWXA 4NUBA 2QZ8A 1ZGJA 4RM3A 4S05A 3BR6A 3T5XA 4LLLA 4MNUA 3VWBA 5IYCJ 1R00A 2R92J 4C3JJ 3Q9VA 2EV0A 1T6SA 3QP6A 2ZMEB 1VQ9I 2PFBA 4KNYA 3QODA 2V26A 4C2TA 4G94A 2CW7A 5FFZA 3RI4A 2OQGA 4JK1X 2DBBA 2CWEA 3N97A 3RJPA 2G7HA 4KIFA 3J7ZI 5HNHA 3ABMH 1Z6RA 2ETHA 3AAFA 4Y3OA 2JMWA 1U6GA 4LLNA 3DBRB 4IHWA 2X85A 1TTYA 4BU2A 2O3FA 2VPRA 3ZQLA 3FM5A 3O8GA 2AQFA 4S0HB 1HC8A 1P4AA 1Z6TA 1RC9A 3S1QJ 2XGEA 4XN0A 4MEXF 1P4WA 4LLGF 1K78B 1MH4A 1W36D 2H94A 2KMUA 2W1OA 4EJUA 2YU3A 2VBZA 4G6TB 5K7HA 3FKJA 4XNFA 2KRCA 1KQ0A 3ZCOA 4XOPA 1AKHB 1MMDA 1IV6A 3CMYA 1MBFA 2PMUA 5CKTA 2R5ZA 4J01A 3VFZA 1T0FC 2JRTA 3LA7A 5IT9K 1PUEE 2ELKA 3BROA 3N4MA 1D1BA 4B1RA 4ZJZA 2R3SA 1HXDA 4BBSJ 3JR9A 3OWTA 1BI2A 3GF2A 4D5FA 2D2WA 3K1NA 3CDIA 3IV5A 4Y4RA 2LP0A 3P7NA 1HW2A 3OIPA 4LOCA 2HXOA 4D9JA 3QOPA 2KDOA 1WVRA 2LFBA 1E2XA 5HS7A 1ON2A 5J1YA 2LRDA 3E7LA 1VQPI 2EH3A 5FROA 1T0FA 3CF5F 3QP5A 3D1NI 2I5UA 4GGGA 3H92A 3IHUA 1KYZA 3GLLA 3S1MJ 1SVMA 4XICA 4M73A 1HKQA 1Y1VJ 2EFNA 2RDPA 4JYKA 3HBLA 3OYAA 1MMSA 3CMEI 2LKSA 3W2VA 2ZXHA 4U0VA 3OS2A 4AIJA 2L02A 4GRIA 2PMHA 3IAS2 4FQGA 2M4KA 4E7IA 2HOEA 2VUMJ 3GBGA 2DLLA 3MWMA 1RZ4A 2R7FA 1YJNI 2BEOA 2VJ4A 4L9NA 5IP9J 2IS6A 1LB2A 3E3VA 3IRQA 2XGXA 4L0YB 5FLVA 3GTKJ 2IEKA 4BJ6C 1JUPA 3WODF 1PDNC 3BG6A 3C2BA 3BTJA 3ZMSA 4M9XA 2ZJRF 2M0MA 3TO7A 1MDMB 2L9RA 4KJZA 1H8AC 4NC8A 4BKXA 3DFGA 2F6CA 2DFIA 3IH4A 5LHIA 3L2QA 4AWXB 5D5WB 2DCEA 5JVGF 1J9IA 2KFDA 3BG3A 4XKWA 1TLHB 1HQCA 2O03A 4HQEA 4K2EA 4L9TA 2RAEA 2LY2A 3FKIJ 2XAJA 3HKZN 4V19K 1IW7F 1YO5C 3A01A 3OSFA 5ICCA 4RGUA 4A3DJ 4XBFA 4D1QA 2Z9OA 2VB6A 3AG3H 1SMTA 1UB9A 3FK7A 4A3FJ 1XCBA 1IUYA 4KT6A 2ZB9A 4YIRX 1VQ6I 3LAPA 2O7OA 4Y7NJ 1IN4A 2DJNA 2XIGA 2YR2A 5TJJA 4AIHA 4BQAA 3FXOA 3QYBA 4RLFA 3S16J 3W2AA 2R7ZJ 3FZVA 3S14J 3GYHX 1Y8RB 3E6DA 4L0ZB 3OIOA 4AVZA 2R93J 4J19A 4AYBN 2MH9A 3BJAA 3SZPA 5ED4A 3I4PA 2GXAA 3EDPA 2JK3A 2JVGA 1VQ8I 5F0CA 1IRXA 5EYRA 2P6TA 3HSRA 1AWCA 3I59A 1MH3A 3M9AA 4A3JJ 3HOWJ 5JI6A 1TP4A 1XMXA 3E6MA 3CC4I 2JN6A 2EK5A 4B43A 3H5RA 1Y39A 1RETA 1IGNA 2HQNA 1S7EA 1YYVA 1QZEA 5DYMA 3C18A 2E19A 4HNUA 2NOGA 2JA7J 2LSOA 5M5XJ 2FD5A 2VASA 4D5CA 2P7CB 2ZMEC 1OCRH 3KEOA 2FNAA 2HVRA 2DN0A 3FF5A 1M1EB 1X58A 2QBYB 3LMMA 4A69C 2O0YA 3BG7A 4G9YA 3SYTA 1WZ2A 2XKOA 2HOTA 4MEYF 1X3ZB 4HV5A 5EJCA 1ZR4A 3GVAA 3WTVC 1E0EA 3D5RC 3U2RA 3WU2C 1I39A 2AO9A 1DPRA 3HSEA 4II2A 4I98B 4A3EJ 2E2IJ 1F9NA 4WXHA 2DPUA 3HKZA 4MTDA 5E17F 1IN6A 1G3SA 2D5VA 4IHSA 2FQ4A 1FNNA 1I27A 1D5YA 3B02A 3LSPA 2OC6A 3L2UA 4PGHA 2VT3A 4ZYHA 2M3AA 2LKPA 2R4GA 3DKWA 3GZNB 4CHUA 3IWFA 4ASNA 2X1EA 1LQ1A 4YFKF 2DYRH 1F4KA 3JW4A 2ZFUA 3OL3A 5HNFA 4GDFA 4Y52J 2VODA 4CUGA 4G12A 4M72A 1P4XA 2E2HJ 2KIMA 3DU6A 4YIIA 3TW6A 5DCMB 3KP5A 4AYBA 4RGSA 1G59A 3K2AA 4PJJA 5FKNA 3PQJA 6PAXA 1OCTC 1XGMA 2DI3A 3CCVI 2Y0MA 1FP2A 4YG2F 2XB0X 2XVCA 4I99C 3DEWA 2BOLA 1NG6A 3BT9A 4PGGA 1JKRC 4EGYA 4KMFA 3HRUA 2P7VB 1ZRCA 4ZDLA 3ZQFA 3CMMA 1RUNA 3Q5FA 2LMDA 2P81A 5ICEA 2OJED 1F5TA 3ZOBA 2VBYA 3S2HJ 1U78A 2BBYA 3BR5A 3FXMA 4QIWN 3PO2J 2RV8A 3IL2A 4BDZA 2MGQA 4A3GJ 1TWCJ 1LDJA 3NWSA 3DPUA 4ZYAA 5DTDA 2BVMA 4HF1A 3JREA 3H5AA 4IO9F 1JTXA 3CDLA 3VYTB 2JTVA 1W5CC 4FISA 1H89C 3CESA 2EBIA 3PNYA 3MKWB 2HNHA 2BE5F 4XKBA 3TO9A 4C2MJ 4HSRA 5KK1A 1QQIA 1K78A 3VSKA 2BHYA 2M87A 3QPHA 1JXSA 2KL4A 1EH8A 5CQEA 1WJEA 3A2KA 2QWWA 2OU2A 4HZFA 2LF8A 4X0GA 2FOKA 3HOUJ 4LK0F 1JHHA 3DTIA 4P55A 4RB2C 4Z6YA 4Q4ZF 2NXNB 3HRSA 3L09A 3BC8A 4ZZLA 4IHXA 3L1PA 1FYKA 2HPMA 3F22A 3QQAA 3RSNA 4DBRA 2QKLB 3VYRB 2K7LA 4BEHA 3KCCA 3FMQA 3CUOA 1T38A 2Q2EA 3CCSI 2DK5A 2HS5A 1TWHJ 2L2OA 4XK4A 5FRMA 2P4WA 1S72I 4ON0A 5HLGA 3OYDA 2Y9ZA 2M8EA 2IA2A 1MIJA 1ZLKA 4G7ZF 2QF7A 3K0LA 4JOMA 2QCOA 1I1SA 4XRSA 1XC5A 2HOSA 1S7OA 2W57A 3ZQGA 2PJPA 2HQAA 1ZYRF 4P9UA 5J1RA 1YS6A 3BY6A 2Z5UA 3PSFA 3DKYA 4L9JA 1EKEA 4XIDA 2HDDA 2EFPA 1XN7A 3SZGA 2EV5A 3CO6C 1DP7P 2K40A 3FXQA 4A5MA 1OR7A 3K1MA 1QGPA 2RNJA 1K79A 3GTQJ 3LQRA 1GVJA 1GLNA 1YLFA 4U0YA 1VQLI 2A3SA 1HW1A 2R5YA 4B8XA 1MBKA 3FMSA 1HKTA 5J4YA 3GTLJ 2H6CA 2LG4A 3ZMTA 3AG4H 1CGPA 3PQKA 1YW7A 2KIQA 1LFBA 4DYRA 3HUGB 2STTA 2L7MP 2K5CA 1IRZA 5B3SH 4BDYA 3LWFA 5A2QZ 4HNTA 5M5WJ 3QPSA 5DUIA 1MNEA 5LRSA 2HDCA 1YX5A 4DYCA 3I5UA 2KRFA 1S5LC 3GUDA 2MA3A 3FMRA 4UUTA 3G71I 1BI3A 1UHWA 2DQLA 1SD6A 3IH3A 1YJ9I 1OYIA 1D0YA 1K4SA 4BGDA 4ESJA 4A6DA 4M3BA 1R1VA 4LIVA 5F64A 3DQVC 2BY2A 3S3NA 2VOOA 2CS3A 1VTNC 3H9GA 1Z9CA 1XGOA 2HKXA 2FRHA 1IO2A 1X1PA 2V9VA 2ZFWA 3DV8A 1YE9A 9ANTA 4C3HJ 1OISA 1QPMA 2BW3A 5EG0B 2A69F 2CUZA 4OMYA 5EEAA 1U9NA 1BOAA 2R7XA 4UVCA 3MN2A 3MZYA 2L3DA 4M3DA 2XC7A 3H9QA 3RQIA 3RPUA 4HRIA 1WPKA 1ULYA 3KYDB 5F0HA 2V1UA 3LSRA 1UG2A 3MKZA 1TWGJ 4QPQA 3K2ZA 4YFXF 2V6CA 4U7DA 2VOPA 4F7ZA 1FOKA 2FUG2 2IAIA 1U8BA 3WGGA 5C4JJ 1RIOH 1MJAA 3LSJA 1ZG5A 4CCJA 1ETXA 1OR7C 4FX0A 5DM7F 4IEJA 3ZRGA 2CV2A 3DU5A 1C0WA 3P9CA 3HOXJ 1O3TA 1R71A 3GX4X 2LR8A 4PCQA 2B7EA 1X4OA 2WAQA 4B44A 4BHCA 5KNLA 2FMYA 2GIZA 1R9TJ 2HQ5A 1N77A 1GHCA 5M3MJ 2COBA 1AOYA 2KKOA 2XPUA 4UVBA 1T33A 2VKHA 4EM0B 4BHBA 3L2CA 4G7HF 1ZR2A 1O3QA 3HRTA 4N4OB 5BMZA 4UY8I 2CG4A 4BY7J 3K70D 2D45A 3DLAA 3ASNH 4HW0A 2HVSA 1JUSA 3IUOA 5KCMA 3RKYA 2VLAA 1YJWI 3VYSB 3IRRA 1XMKA 5HDKA 1JJ8C 3AL0C 1Z1DA 2HTJA 2R7VA 3JRDA 2NS0A 3CJQB 1ORKA 4A3BJ 2V1NA 3I4MJ 1YG2A 2LY9A 4M3EA 2QSHX 3S32A 2HWVA 3A1YA 1ZAOA 4M6VA 4X1EA 4Y15A 5DDGA 2HKOA 2VE8A 1Y8QB 3S93A 4X6AJ 4NB5A 3E5QA 3M1CA 5L3EA 1AHDP 2COMA 5DCMA 5D5UB 2VC0A 2AXTC 2AHQA 1WQ2A 3OYEA 1O7LA 1D0ZA 3Q9SA 4EEFG 3LNQA 3H0GJ 4UVAA 4DZJA 2QA4I 1QU3A 2LC2A 1MD0A 3DTKA 3K10A 1OQYA 5ILSA 2EZIA 3ULQB 3OYGA 1HF0A 3CMAI 1TT5B 3LL7A 2VKDA 1S9HA 3F72A 2UXXA 1GV5A 3LSTA 3W2WA 1FJLA 4E7LA 2QENA 3BTIA 4KUMA 5HS9A 4JBAA 3C1DA 2HR3A 3F8BA 5HOOA 4Y33A 2KQRA 1WKMA 2HYFA 1D8JA 4WXCA 1B8IB 1LJ9A 2XSJC 3KYLA 4IRGA 4JX4A 2CU7A 1WJDA 3SQNA 2DA4A 3F0CA 3Q0WA 2F5EA 2WAQN 2W4SA 4MLOA 2L01A 5K7ZA 4XR6A 2B0LA 2ZO4A 4F3QA 1RI7A 1WH5A 4PJ0C 3JRAA 2HZDA 4LITA 3K7AJ 4MTEA 4Y13A 2EIJH 2NAZA 2DA6A 4U0WA 2AS5F 1Y0NA 3WTSC 1USTA 3JSOA 2FJ1A 4DBQA 5JFRA 3M7GA 4N9IA 3CCJI 2ZSIB 1JGGA 2CUFA 3U9GA 2Y30A 2XSDC 2J5OA 2V79A 4F92B 2DMTA 1IF1A
chains in the Genus database with same CATH topology
2OD5A 5BQTA 2DU9A 3NEUA 3SZTA 1D5VA 1PP7U 4DQ2A 1OPCA 1GXPA 3VODA 2GWRA 4HA8A 4MHGA 3LQQA 5D6FA 3VEPA 5HVQC 1LDDA 5CJ9A 5LRRA 2IPQX 3B73A 2O8XA 3W6JB 1J7KA 4ENKA 2JPCA 2ZNYA 5LLQA 5HLIA 4AVPA 4EJWA 2IA1A 3KP7A 5AIQA 4OIQF 1IZ1A 1D3YA 2ZMEA 3E5XA 2FBIA 3F6VA 4ENJA 2FF4A 2GXBA 1UHMA 2BV6A 3GO5A 5CVUA 1EH6A 4EV0A 3KLNA 2EV6A 1FSEA 3D5LA 2IRFG 5LEJA 1K6OA 1BN5A 2G7UA 3DEUA 5HDNA 1BC7C 4ESFA 3KLOA 4A6EA 5E8GA 3EQLF 3RIRA 2QUFA 1MDMA 4KN4X 4KN7X 2IW5A 2GIVA 2TDXA 4A5NA 2A07F 5AONA 1P2FA 5LEKA 1W7PB 3I71A 3RPQA 3J81Z 2UZKA 1G4DA 4JQFA 3IKTA 1IRFA 2JT1A 3JSPA 4XSZF 3V4GA 3BPXA 2RVCA 4G7OF 3OOPA 4MQVA 2FE3A 1NHAA 2W25A 4G6DA 1HSTA 3CDHA 4N9HA 3SXYA 1ZREA 3V8KA 3I53A 4L18B 2VBWA 2QYOA 2OAZA 2NYXA 4ZH4F 1K7AA 1ON1A 3C3WA 4ZYDA 1WI9A 2R7DA 1IXSB 4DNCA 3V8LA 5J8CA 3G73A 3WE2A 1R5GA 2MLKA 2XAGA 4O5VA 5K5QA 2EFWA 1U5TB 5BOXA 2CYYA 2QQ9A 2YX7A 3KEQA 5K5RA 3O6BB 1YS7A 3J7AO 4UXNA 4WWCA 4XSXF 3JTGA 3FHZA 3CUQB 5DUKA 4KICA 1YIOA 3LA2A 3ZPLA 2XROA 1T98A 2LNBA 1G3YA 1H9GA 2ZKZA 3CUQC 3GWZA 1R5HA 1SAXA 1O3RA 1G6NA 1TW2A 2RC4A 3KP4A 5FFXA 3S2WA 5ICGA 3KP6A 3LA3A 1W4MA 3GFIA 3HTUA 2VBXA 1TNTA 1HBXG 4CXFA 5BS6A 2IT0A 2DT5A 5L3GA 5ILVA 1CF7A 1USSA 3R61A 2EJRA 2E7XA 3K69A 3TQNA 2M45A 2QQAA 3ELKA 1TQMA 3TDUC 5AIPA 1SFUA 2HTSA 5DEQA 4HBLA 1QZZA 2P5LC 4EQQA 3KETA 4EGZA 1J5YA 3I64A 3I58A 1KA8A 4LB6B 3WTZA 1R58A 4I7HA 2A5YB 2V1XA 2L54A 2X0LA 2OZ6A 4IF4A 4ZYEA 2P6SA 3EETA 1R36A 1SFXA 4UUVA 1XDUA 4UV9A 4IXAA 3MAJA 4M71A 5IT9Z 1O7FA 4B09A 3WE3A 3F8FA 5H6QA 3JTHA 3HRMA 4I02A 1STZA 1FBQA 2K4BA 4BYYA 3T8RA 3ZP5A 4IHTA 3ZMZA 4EM2A 3V8JA 3MCZA 4G8XA 4OINF 5D4RA 5FGMA 2FQ3A 1ZARA 2ELHA 4HLYA 1L0OC 3FWEA 3E6BA 3GZ6A 3IC7A 4AIKA 3NRVA 5DD8A 3R6SA 1FC3A 1X3UA 5HS8A 2P5VA 5F1RA 3BJ6A 4MQ9F 4IVNA 1IXCA 1IN8A 3BOQA 3GXOA 5CYVA 1S8NA 1HKSA 4ZZDA 4NQWA 4RAYA 3ROUA 1KU7A 1DPUA 1B6AA 1XB4A 1F1ZA 2XKPA 3C7JA 3J80Z 3BZ6A 4UHTA 3R0AA 2BYVE 2X4HA 2Q0OA 1UFMA 1HSJA 2E7WA 2VONA 2UXNA 2DO7A 4I0AA 4WX9A 1Q1HA 2MC3A 1W5TA 3TDZC 3O3KA 1TQPA 4HAMA 2PLYA 4XLPF 3DP7A 2E1NA 1Z7UA 2V1DA 3CJNA 4M9ZA 2P5KA 1B59A 2KIUA 4M74A 1D8KA 2XHKA 2CO5A 2VXZA 1BI0A 4GYIA 1J0RA 1BJAA 2Y48A 1KU3A 2FBKA 1EH7A 2OBPA 4AD9A 4IRIA 3RYPA 4Z2YA 3MEXA 3EYYA 2F5FA 4ESBA 3WTWC 5FO5A 4WK8F 5FD6A 5DV5A 1XD7A 3ML6A 2QM3A 1SFEA 3JAMK 4O6JA 1SD5A 3ISPA 4HQMA 4M6YA 3F3XA 1RUOA 2DQRA 1V4RA 3CUQA 3WTTC 2CSOA 5FD5A 2MLGA 1SMYF 1WSUA 3ZMUA 1O3SA 2OA4A 2EA4A 1V3FA 1LVAA 3GEZA 2K27A 1BIBA 1BBYA 5E18F 3E97A 4TV7A 4EJVA 2YX4A 4XLNF 3FM3A 2JZYA 1MZBA 5BPIA 3HOSA 1BI1A 3FXRA 4LMYA 2DW4A 3CTAA 5JVTA 3WU1B 2RGVA 3ERED 4L5JA 5LHHA 1B1BA 3HSFA 1YW8A 1KU2A 4KMUX 2PI0A 5ILUA 1IRGA 5E1WA 1ZH5A 4U7BA 1R1TA 4RB1A 2A6HF 3I54A 3WTXC 4WF2A 3TOAA 1FY7A 1FX7A 4ENMA 1W7PA 1S7AA 5DCFA 4HYEA 2ESNA 2A68F 2XRNA 5HLHA 1YTYA 1XSVA 4OIPF 3ECHA 2J5PA 4CICA 5FLXK 3DXJF 2ZXJA 4GYGA 2EB7A 4BXUA 4GXOA 2PN6A 4P96A 3J81K 3OV8A 3EUHA 3BDDA 3RDIA 4OIOF 2HEOA 5D6EA 1YQAA 1W5SA 5JR3A 4OOIA 1GXQA 3KFWX 1U5TA 5BPDA 3V7SA 1MJ9A 1G3WA 5LGNA 1TQIA 2FA5A 1LDKB 1XDSA 1DDNA 5LHGA 3R0JA 4HOBA 4EVIA 3J80K 3F8MA 1ONVA 3ZN0A 3QU6A 4UNOA 1XCVA 1ODDA 3NQOA 1KU9A 1SD4A 2D1VA 4WXDA 2WTEA 1FZPB 3V7RA 4U88A 4P5OA 2VN2A 3T0YA 2IVMA 4HDUA 3KZZA 5CLSA 5FLXZ 3GFMA 2K02A 3MFKA 3TOBA 1ZHFA 1CF7B 3L7WA 3SHFA 2DTRA 1TW3A 4BAYA 2JPBA 5EEHA 4A0ZA 2IP2A 3GFJA 1BM9A 3WGIA 1A04A 4R79A 3W6KB 4KYWA 2L4MA 2NRAC 2DAOA 1SD7A 1JGSA 2XV4S 2Z33A 5DD4A 3DPTA 4CDGA 2FXAA 2GXGA 2M1BA 1KQ8A 2Q8KA 4ETSA 3M1EA 1OYYA 4KDPA 4HLXA 1MGTA 1R22A 1J59A 3ABUA 2RN7A 4IJAA 4Q48A 5K1YA 4EM1A 4Y17A 3I0TA 1RNLA 2D1HA 4L5IA 1FYMA 4RAZA 5KVRA 1JE8A 4WCGA 2RKHA 3F8CA 3FX3A 2XAFA 4OMZA 5LGTA 1FYLA 5J8FA 4A12A 2HZTA 3KP2A 3CO7C 2F5DA 1KQ9A 4A2UA 2STWA 1YW9A 2KJBA 5L3BA 3L9FA 1E17A 2Z99A 2QBYA 1U8RA 1ZG3A 3M8FA 5IT3A 1H0MA 4HX8A 2CW0F 3KZYA 2HGCA 3HHHA 2A6EF 1MKMA 5CVRA 1ZN2A 2ESHA 2H6BA 3CLOA 2MH2A 4KA4A 1DUXC 4P9FA 4G6QA 2MD5A 5D5XB 4HV6A 2VC1A 3HHGA 1BIAA 1QBJA 3DF8A 4Q47A 2GA1A 4R1HA 3HIFA 2W24A 3T8TA 3EYIA 4A0XA 5E8IA 3D0SA 2EFQA 1S6LA 2HQRA 4CGZA 2C6YA 2WC2A 1H9TA 3ZMDA 5HDGA 5D8KB 4ENNA 4LFUA 3F23A 3R4KA 3BPVA 1T39A 4LG0B 4LK1F 4PZJA 5E1ZB 4RGXA 4I2OA 4I09A 3DPLC 2WWYA 2ZCWA 1LNWA 5F6FA 3R60A 3WGHA 2VE9A 1FWZA 2OQRA 5TRDA 3HYIA 3GZ5A 2YSRA 3O2PE 2GA2A 1IN5A 4MGRA 4N0BA 3QU3A 5J6XA 4GCVA 3QPTA 3ZN1A 1S3JA 3WG9A 2ZBKA 1XGNA 2OZUA 1U3EM 1PP8F 3RYRA 4CZZA 3RTRA 1FBUA 3KE2A 3MZHA 4RB0A 4HF0A 1R1UA 2K86A 2GZWA 4CO8A 2QVOA 2DK8A 1OYWA 2LF7A 3SFZA 3WTUC 2KJCA 4QWQA 4ZYGA 2YPRA 4EJOA 2PBIA 4S04A 4M6XA 4OU0A 5H6RA 3H3ZA 3K1PA 3ZQ7A 4HF2A 4YIFA 2Z3YA 2EA2A 3G3ZA 3VOEA 2M5WA 3IWZA 2XAHA 2P8TA 2PEXA 1U5TC 2H09A 2QQBA 2VT2A 2CGPA 2FU4A 4BNCA 2IA0A 4RB3C 3QRFF 1Y0UA 3VB2A 3GW2A 4FT8A 2AXLA 4LJZF 2LDUA 1B9NA 1Z05A 3ABTA 4UV8A 1QO0D 4FHTA 1R7JA 3GLXA 2NNNA 1REPC 4IRHA 4IPAA 4GO1A 2BGCA 4RS8A 5ERIA 2IJLA 5ICFA 3ECOA 4R8HA 4CYDA 2FNPA 2ISZA 2FMLA 4L9VA 1ZG1A 4I0BA 4PDKA 5EEGA 2NNYA 4OIRF 4FX4A 4A0YA 1LEBA 2A61A 3FXUA 4BHPA 4Q5SF 1UCRA 2F2EA 3F21A 4LB5A 2QLZA 3PFIA 2K4JA 4HX4A 1Z91A 3TO6A 5CVVA 4RGRA 1XSXA 1T2KA 3MQ0A 2UWMA 2DPDA 3TKYA 3I59B 3E5UA 2GAUA 2O61A 3L00A 3P9KA 5L3DA 1JHFA 2FSWA 2MBFA 3GFLA 3K9TA 3RKWA 1FLIA 1FBSA 1ZRDA 4NHJA 3HOTA 1OKRA 5D5VB 4HDVA 3RKXA 4LD5A 1TNSA 2PG4A 1P6RA 3BWGA 1U2WA 1HW5A 5LGUA 1KYWA 3T1BA 5FB2A 2W85A 4EMSA 2JSCA 1BC8C 2ZNZA 3U1DA 4D0PA 4LG0A 3HTSB 5L3FA 2HFHA 4M9SA 2RQPA 3H3UA 2PQ8A 1ZGAA 1G3TA 1WRJA 1B4AA 3BP8A 1LEAA 3F8NA 1J2XA 1QNTA 2ADUA 2GQQA 4QLCU 4I01A 2L4AA 5D4SA 1R23A 1FPQA 2HYGD 1FT9A 2XASA 5D8LB 1B9MA 1I1GA 3ZMVA 4H0EA 1OMIA 1XMAA 1KGSA 2CFXA 5K5OA 4KFCA 2F5CA 2XAQA 5LBQA 3LAJA 3REOA 4BH9A 5CVJA 1O57A 5CVIA 3TGNA 2XUBA 1YFHA 3HUGA 4KIBA 1TBXA 5E1XA 2KIFA 2H27A 3KP3A 2ISYA 1MJBA 4KIGA 3COAC 4YFNF 3P9IA 1I6XA 3QAHA 1ZRFA 2ZJ2A 1IN7A 1FP1D 3BJOA 2CQKA 1EV7A 2G9WA 3WU0A 3WTYC 4E70A 2FEZA 2EFOA 5E20A 3F6OA 5A2QK 1IAWA 1XGSA 5JHUA 4EJTA 4HX7A 1W7PD 3E6CC 2ACJA 1IXRC 3IKVA 4KT5C 5H20A 1I5ZA 2Y75A 1J75A 2O6GE 1QZYA 4O3MA 3V7CA 1S29A 2M30A 1XSDA 2E1CA 1P92A 2W84A 4XRFA 1L3LA 2FBHA 2WV0A 1ZLJA 3JAMZ 4LGWA 1FSHA 3LFKA 3M8EA 5L3CA 2EWNA 1WWXA 2QZ8A 1ZGJA 4S05A 3T5XA 4LLLA 4MNUA 1R00A 3Q9VA 2EV0A 1T6SA 3QP6A 2ZMEB 2PFBA 4KNYA 4G94A 5FFZA 3RI4A 2OQGA 4JK1X 2DBBA 2CWEA 3N97A 3RJPA 2G7HA 4KIFA 1Z6RA 2ETHA 3AAFA 1U6GA 4LLNA 1TTYA 2O3FA 3FM5A 1P4AA 1Z6TA 4MEXF 1P4WA 4LLGF 1K78B 2H94A 4EJUA 2YU3A 2VBZA 1KQ0A 2PMUA 3VFZA 2JRTA 3LA7A 5IT9K 1PUEE 3BROA 3N4MA 2R3SA 1HXDA 1BI2A 3GF2A 2D2WA 3K1NA 3P7NA 1HW2A 3QOPA 1E2XA 5HS7A 1ON2A 1T0FA 3QP5A 4GGGA 3H92A 3IHUA 1KYZA 4M73A 1HKQA 2EFNA 2RDPA 4U0VA 4AIJA 2L02A 2PMHA 2HOEA 3MWMA 2DLLA 1RZ4A 2R7FA 2BEOA 4L9NA 1LB2A 3E3VA 3IRQA 2XGXA 4L0YB 3WODF 1PDNC 3ZMSA 4M9XA 3TO7A 1MDMB 3DFGA 2DFIA 5LHIA 4AWXB 5D5WB 1J9IA 1TLHB 1HQCA 2O03A 4HQEA 4K2EA 4L9TA 2XAJA 1IW7F 1YO5C 5ICCA 4RGUA 4XBFA 2Z9OA 1SMTA 1UB9A 1XCBA 1IUYA 3LAPA 1IN4A 2XIGA 2YR2A 5TJJA 4AIHA 4BQAA 3FZVA 3GYHX 3E6DA 4L0ZB 2MH9A 3BJAA 3SZPA 5ED4A 3I4PA 3EDPA 2P6TA 3HSRA 1AWCA 3I59A 3M9AA 5JI6A 3E6MA 2EK5A 2HQNA 1YYVA 5DYMA 3C18A 2LSOA 2P7CB 3KEOA 2FNAA 3FF5A 2QBYB 2O0YA 4G9YA 2XKOA 4MEYF 4HV5A 3GVAA 3WTVC 3U2RA 1DPRA 3HSEA 4I98B 1F9NA 4WXHA 2DPUA 4MTDA 5E17F 1IN6A 1G3SA 4IHSA 1FNNA 1I27A 3B02A 4PGHA 2VT3A 4ZYHA 2LKPA 3DKWA 4CHUA 3IWFA 4ASNA 1LQ1A 4YFKF 1F4KA 3JW4A 2VODA 4M72A 1P4XA 2KIMA 4YIIA 5DCMB 3KP5A 4RGSA 3PQJA 6PAXA 1XGMA 2DI3A 2Y0MA 1FP2A 4YG2F 2XVCA 4PGGA 4EGYA 4KMFA 3HRUA 2P7VB 1ZRCA 1RUNA 3Q5FA 5ICEA 1F5TA 2VBYA 1U78A 2BBYA 2RV8A 3IL2A 1LDJA 4HF1A 2JTVA 3TO9A 2BE5F 5KK1A 1QQIA 1K78A 2M87A 3QPHA 1JXSA 1EH8A 2QWWA 2OU2A 4HZFA 2LF8A 2FOKA 4LK0F 1JHHA 4P55A 4RB2C 4Q4ZF 3HRSA 3L09A 4ZZLA 1FYKA 3F22A 2K7LA 3KCCA 3FMQA 3CUOA 1T38A 2Q2EA 2DK5A 2HS5A 2P4WA 4ON0A 5HLGA 2M8EA 2IA2A 1ZLKA 4G7ZF 3K0LA 1I1SA 1S7OA 2W57A 2PJPA 1ZYRF 4P9UA 1YS6A 3BY6A 2Z5UA 4L9JA 2EFPA 1XN7A 2EV5A 3CO6C 1DP7P 3FXQA 4A5MA 1OR7A 3K1MA 1QGPA 2RNJA 1K79A 3LQRA 1GVJA 1YLFA 4U0YA 2A3SA 1HW1A 4B8XA 3FMSA 1HKTA 2H6CA 3ZMTA 1CGPA 3PQKA 1YW7A 2STTA 3LWFA 5A2QZ 5DUIA 5LRSA 2HDCA 3I5UA 2KRFA 2MA3A 3GUDA 3FMRA 1BI3A 1UHWA 2DQLA 1SD6A 1OYIA 4ESJA 4A6DA 1R1VA 5F64A 3DQVC 2VOOA 1VTNC 1Z9CA 1XGOA 2HKXA 2FRHA 2V9VA 2ZFWA 3DV8A 1QPMA 2A69F 4OMYA 1BOAA 4UVCA 3MZYA 2L3DA 3RPUA 1ULYA 2V1UA 3K2ZA 4YFXF 2V6CA 4U7DA 2VOPA 4F7ZA 1FOKA 3WGGA 1RIOH 1MJAA 1ZG5A 4FX0A 1C0WA 3P9CA 1O3TA 3GX4X 4PCQA 4BHCA 2FMYA 1GHCA 1AOYA 2KKOA 4UVBA 4EM0B 4BHBA 3L2CA 4G7HF 1O3QA 3HRTA 5BMZA 2D45A 2CG4A 4HW0A 3RKYA 3IRRA 1XMKA 5HDKA 1Z1DA 2HTJA 2NS0A 1YG2A 2HWVA 1ZAOA 4Y15A 5DDGA 2HKOA 2VE8A 4NB5A 3E5QA 5L3EA 2COMA 5DCMA 5D5UB 2VC0A 1WQ2A 1O7LA 3Q9SA 4UVAA 1MD0A 5ILSA 3ULQB 3F72A 2UXXA 3LSTA 2QENA 4KUMA 5HS9A 4JBAA 3C1DA 2HR3A 3F8BA 5HOOA 1WKMA 2HYFA 1D8JA 4WXCA 1LJ9A 4IRGA 3SQNA 2F5EA 2L01A 2B0LA 2ZO4A 1RI7A 4MTEA 4Y13A 2NAZA 4U0WA 2AS5F 3WTSC 1USTA 3JSOA 5JFRA 3M7GA 4N9IA 3U9GA 2J5OA 2V79A 1IF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OD5 A;  5BQT A;  2DU9 A;  3NEU A;  3SZT A;  1D5V A;  1PP7 U;  4DQ2 A;  1OPC A;  1GXP A;  3VOD A;  2GWR A;  4HA8 A;  4MHG A;  3LQQ A;  5D6F A;  3VEP A;  5HVQ C;  1LDD A;  5CJ9 A;  5LRR A;  2IPQ X;  3B73 A;  2O8X A;  3W6J B;  1J7K A;  4ENK A;  2JPC A;  2ZNY A;  5LLQ A;  5HLI A;  4AVP A;  4EJW A;  2IA1 A;  3KP7 A;  5AIQ A;  4OIQ F;  1IZ1 A;  1D3Y A;  2ZME A;  3E5X A;  2FBI A;  3F6V A;  4ENJ A;  2FF4 A;  2GXB A;  1UHM A;  2BV6 A;  3GO5 A;  5CVU A;  1EH6 A;  4EV0 A;  3KLN A;  2EV6 A;  1FSE A;  3D5L A;  2IRF G;  5LEJ A;  1K6O A;  1BN5 A;  2G7U A;  3DEU A;  5HDN A;  1BC7 C;  4ESF A;  3KLO A;  4A6E A;  5E8G A;  3EQL F;  3RIR A;  2QUF A;  1MDM A;  4KN4 X;  4KN7 X;  2IW5 A;  2GIV A;  2TDX A;  4A5N A;  2A07 F;  5AON A;  1P2F A;  5LEK A;  1W7P B;  3I71 A;  3RPQ A;  3J81 Z;  2UZK A;  1G4D A;  4JQF A;  3IKT A;  1IRF A;  2JT1 A;  3JSP A;  4XSZ F;  3V4G A;  3BPX A;  2RVC A;  4G7O F;  3OOP A;  4MQV A;  2FE3 A;  1NHA A;  2W25 A;  4G6D A;  1HST A;  3CDH A;  4N9H A;  3SXY A;  1ZRE A;  3V8K A;  3I53 A;  4L18 B;  2VBW A;  2QYO A;  2OAZ A;  2NYX A;  4ZH4 F;  1K7A A;  1ON1 A;  3C3W A;  4ZYD A;  1WI9 A;  2R7D A;  1IXS B;  4DNC A;  3V8L A;  5J8C A;  3G73 A;  3WE2 A;  1R5G A;  2MLK A;  2XAG A;  4O5V A;  5K5Q A;  2EFW A;  1U5T B;  5BOX A;  2CYY A;  2QQ9 A;  2YX7 A;  3KEQ A;  5K5R A;  3O6B B;  1YS7 A;  3J7A O;  4UXN A;  4WWC A;  4XSX F;  3JTG A;  3FHZ A;  3CUQ B;  5DUK A;  4KIC A;  1YIO A;  3LA2 A;  3ZPL A;  2XRO A;  1T98 A;  2LNB A;  1G3Y A;  1H9G A;  2ZKZ A;  3CUQ C;  3GWZ A;  1R5H A;  1SAX A;  1O3R A;  1G6N A;  1TW2 A;  2RC4 A;  3KP4 A;  5FFX A;  3S2W A;  5ICG A;  3KP6 A;  3LA3 A;  1W4M A;  3GFI A;  3HTU A;  2VBX A;  1TNT A;  1HBX G;  4CXF A;  5BS6 A;  2IT0 A;  2DT5 A;  5L3G A;  5ILV A;  1CF7 A;  1USS A;  3R61 A;  2EJR A;  2E7X A;  3K69 A;  3TQN A;  2M45 A;  2QQA A;  3ELK A;  1TQM A;  3TDU C;  5AIP A;  1SFU A;  2HTS A;  5DEQ A;  4HBL A;  1QZZ A;  2P5L C;  4EQQ A;  3KET A;  4EGZ A;  1J5Y A;  3I64 A;  3I58 A;  1KA8 A;  4LB6 B;  3WTZ A;  1R58 A;  4I7H A;  2A5Y B;  2V1X A;  2L54 A;  2X0L A;  2OZ6 A;  4IF4 A;  4ZYE A;  2P6S A;  3EET A;  1R36 A;  1SFX A;  4UUV A;  1XDU A;  4UV9 A;  4IXA A;  3MAJ A;  4M71 A;  5IT9 Z;  1O7F A;  4B09 A;  3WE3 A;  3F8F A;  5H6Q A;  3JTH A;  3HRM A;  4I02 A;  1STZ A;  1FBQ A;  2K4B A;  4BYY A;  3T8R A;  3ZP5 A;  4IHT A;  3ZMZ A;  4EM2 A;  3V8J A;  3MCZ A;  4G8X A;  4OIN F;  5D4R A;  5FGM A;  2FQ3 A;  1ZAR A;  2ELH A;  4HLY A;  1L0O C;  3FWE A;  3E6B A;  3GZ6 A;  3IC7 A;  4AIK A;  3NRV A;  5DD8 A;  3R6S A;  1FC3 A;  1X3U A;  5HS8 A;  2P5V A;  5F1R A;  3BJ6 A;  4MQ9 F;  4IVN A;  1IXC A;  1IN8 A;  3BOQ A;  3GXO A;  5CYV A;  1S8N A;  1HKS A;  4ZZD A;  4NQW A;  4RAY A;  3ROU A;  1KU7 A;  1DPU A;  1B6A A;  1XB4 A;  1F1Z A;  2XKP A;  3C7J A;  3J80 Z;  3BZ6 A;  4UHT A;  3R0A A;  2BYV E;  2X4H A;  2Q0O A;  1UFM A;  1HSJ A;  2E7W A;  2VON A;  2UXN A;  2DO7 A;  4I0A A;  4WX9 A;  1Q1H A;  2MC3 A;  1W5T A;  3TDZ C;  3O3K A;  1TQP A;  4HAM A;  2PLY A;  4XLP F;  3DP7 A;  2E1N A;  1Z7U A;  2V1D A;  3CJN A;  4M9Z A;  2P5K A;  1B59 A;  2KIU A;  4M74 A;  1D8K A;  2XHK A;  2CO5 A;  2VXZ A;  1BI0 A;  4GYI A;  1J0R A;  1BJA A;  2Y48 A;  1KU3 A;  2FBK A;  1EH7 A;  2OBP A;  4AD9 A;  4IRI A;  3RYP A;  4Z2Y A;  3MEX A;  3EYY A;  2F5F A;  4ESB A;  3WTW C;  5FO5 A;  4WK8 F;  5FD6 A;  5DV5 A;  1XD7 A;  3ML6 A;  2QM3 A;  1SFE A;  3JAM K;  4O6J A;  1SD5 A;  3ISP A;  4HQM A;  4M6Y A;  3F3X A;  1RUO A;  2DQR A;  1V4R A;  3CUQ A;  3WTT C;  2CSO A;  5FD5 A;  2MLG A;  1SMY F;  1WSU A;  3ZMU A;  1O3S A;  2OA4 A;  2EA4 A;  1V3F A;  1LVA A;  3GEZ A;  2K27 A;  1BIB A;  1BBY A;  5E18 F;  3E97 A;  4TV7 A;  4EJV A;  2YX4 A;  4XLN F;  3FM3 A;  2JZY A;  1MZB A;  5BPI A;  3HOS A;  1BI1 A;  3FXR A;  4LMY A;  2DW4 A;  3CTA A;  5JVT A;  3WU1 B;  2RGV A;  3ERE D;  4L5J A;  5LHH A;  1B1B A;  3HSF A;  1YW8 A;  1KU2 A;  4KMU X;  2PI0 A;  5ILU A;  1IRG A;  5E1W A;  1ZH5 A;  4U7B A;  1R1T A;  4RB1 A;  2A6H F;  3I54 A;  3WTX C;  4WF2 A;  3TOA A;  1FY7 A;  1FX7 A;  4ENM A;  1W7P A;  1S7A A;  5DCF A;  4HYE A;  2ESN A;  2A68 F;  2XRN A;  5HLH A;  1YTY A;  1XSV A;  4OIP F;  3ECH A;  2J5P A;  4CIC A;  5FLX K;  3DXJ F;  2ZXJ A;  4GYG A;  2EB7 A;  4BXU A;  4GXO A;  2PN6 A;  4P96 A;  3J81 K;  3OV8 A;  3EUH A;  3BDD A;  3RDI A;  4OIO F;  2HEO A;  5D6E A;  1YQA A;  1W5S A;  5JR3 A;  4OOI A;  1GXQ A;  3KFW X;  1U5T A;  5BPD A;  3V7S A;  1MJ9 A;  1G3W A;  5LGN A;  1TQI A;  2FA5 A;  1LDK B;  1XDS A;  1DDN A;  5LHG A;  3R0J A;  4HOB A;  4EVI A;  3J80 K;  3F8M A;  1ONV A;  3ZN0 A;  3QU6 A;  4UNO A;  1XCV A;  1ODD A;  3NQO A;  1KU9 A;  1SD4 A;  2D1V A;  4WXD A;  2WTE A;  1FZP B;  3V7R A;  4U88 A;  4P5O A;  2VN2 A;  3T0Y A;  2IVM A;  4HDU A;  3KZZ A;  5CLS A;  5FLX Z;  3GFM A;  2K02 A;  3MFK A;  3TOB A;  1ZHF A;  1CF7 B;  3L7W A;  3SHF A;  2DTR A;  1TW3 A;  4BAY A;  2JPB A;  5EEH A;  4A0Z A;  2IP2 A;  3GFJ A;  1BM9 A;  3WGI A;  1A04 A;  4R79 A;  3W6K B;  4KYW A;  2L4M A;  2NRA C;  2DAO A;  1SD7 A;  1JGS A;  2XV4 S;  2Z33 A;  5DD4 A;  3DPT A;  4CDG A;  2FXA A;  2GXG A;  2M1B A;  1KQ8 A;  2Q8K A;  4ETS A;  3M1E A;  1OYY A;  4KDP A;  4HLX A;  1MGT A;  1R22 A;  1J59 A;  3ABU A;  2RN7 A;  4IJA A;  4Q48 A;  5K1Y A;  4EM1 A;  4Y17 A;  3I0T A;  1RNL A;  2D1H A;  4L5I A;  1FYM A;  4RAZ A;  5KVR A;  1JE8 A;  4WCG A;  2RKH A;  3F8C A;  3FX3 A;  2XAF A;  4OMZ A;  5LGT A;  1FYL A;  5J8F A;  4A12 A;  2HZT A;  3KP2 A;  3CO7 C;  2F5D A;  1KQ9 A;  4A2U A;  2STW A;  1YW9 A;  2KJB A;  5L3B A;  3L9F A;  1E17 A;  2Z99 A;  2QBY A;  1U8R A;  1ZG3 A;  3M8F A;  5IT3 A;  1H0M A;  4HX8 A;  2CW0 F;  3KZY A;  2HGC A;  3HHH A;  2A6E F;  1MKM A;  5CVR A;  1ZN2 A;  2ESH A;  2H6B A;  3CLO A;  2MH2 A;  4KA4 A;  1DUX C;  4P9F A;  4G6Q A;  2MD5 A;  5D5X B;  4HV6 A;  2VC1 A;  3HHG A;  1BIA A;  1QBJ A;  3DF8 A;  4Q47 A;  2GA1 A;  4R1H A;  3HIF A;  2W24 A;  3T8T A;  3EYI A;  4A0X A;  5E8I A;  3D0S A;  2EFQ A;  1S6L A;  2HQR A;  4CGZ A;  2C6Y A;  2WC2 A;  1H9T A;  3ZMD A;  5HDG A;  5D8K B;  4ENN A;  4LFU A;  3F23 A;  3R4K A;  3BPV A;  1T39 A;  4LG0 B;  4LK1 F;  4PZJ A;  5E1Z B;  4RGX A;  4I2O A;  4I09 A;  3DPL C;  2WWY A;  2ZCW A;  1LNW A;  5F6F A;  3R60 A;  3WGH A;  2VE9 A;  1FWZ A;  2OQR A;  5TRD A;  3HYI A;  3GZ5 A;  2YSR A;  3O2P E;  2GA2 A;  1IN5 A;  4MGR A;  4N0B A;  3QU3 A;  5J6X A;  4GCV A;  3QPT A;  3ZN1 A;  1S3J A;  3WG9 A;  2ZBK A;  1XGN A;  2OZU A;  1U3E M;  1PP8 F;  3RYR A;  4CZZ A;  3RTR A;  1FBU A;  3KE2 A;  3MZH A;  4RB0 A;  4HF0 A;  1R1U A;  2K86 A;  2GZW A;  4CO8 A;  2QVO A;  2DK8 A;  1OYW A;  2LF7 A;  3SFZ A;  3WTU C;  2KJC A;  4QWQ A;  4ZYG A;  2YPR A;  4EJO A;  2PBI A;  4S04 A;  4M6X A;  4OU0 A;  5H6R A;  3H3Z A;  3K1P A;  3ZQ7 A;  4HF2 A;  4YIF A;  2Z3Y A;  2EA2 A;  3G3Z A;  3VOE A;  2M5W A;  3IWZ A;  2XAH A;  2P8T A;  2PEX A;  1U5T C;  2H09 A;  2QQB A;  2VT2 A;  2CGP A;  2FU4 A;  4BNC A;  2IA0 A;  4RB3 C;  3QRF F;  1Y0U A;  3VB2 A;  3GW2 A;  4FT8 A;  2AXL A;  4LJZ F;  2LDU A;  1B9N A;  1Z05 A;  3ABT A;  4UV8 A;  1QO0 D;  4FHT A;  1R7J A;  3GLX A;  2NNN A;  1REP C;  4IRH A;  4IPA A;  4GO1 A;  2BGC A;  4RS8 A;  5ERI A;  2IJL A;  5ICF A;  3ECO A;  4R8H A;  4CYD A;  2FNP A;  2ISZ A;  2FML A;  4L9V A;  1ZG1 A;  4I0B A;  4PDK A;  5EEG A;  2NNY A;  4OIR F;  4FX4 A;  4A0Y A;  1LEB A;  2A61 A;  3FXU A;  4BHP A;  4Q5S F;  1UCR A;  2F2E A;  3F21 A;  4LB5 A;  2QLZ A;  3PFI A;  2K4J A;  4HX4 A;  1Z91 A;  3TO6 A;  5CVV A;  4RGR A;  1XSX A;  1T2K A;  3MQ0 A;  2UWM A;  2DPD A;  3TKY A;  3I59 B;  3E5U A;  2GAU A;  2O61 A;  3L00 A;  3P9K A;  5L3D A;  1JHF A;  2FSW A;  2MBF A;  3GFL A;  3K9T A;  3RKW A;  1FLI A;  1FBS A;  1ZRD A;  4NHJ A;  3HOT A;  1OKR A;  5D5V B;  4HDV A;  3RKX A;  4LD5 A;  1TNS A;  2PG4 A;  1P6R A;  3BWG A;  1U2W A;  1HW5 A;  5LGU A;  1KYW A;  3T1B A;  5FB2 A;  2W85 A;  4EMS A;  2JSC A;  1BC8 C;  2ZNZ A;  3U1D A;  4D0P A;  4LG0 A;  3HTS B;  5L3F A;  2HFH A;  4M9S A;  2RQP A;  3H3U A;  2PQ8 A;  1ZGA A;  1G3T A;  1WRJ A;  1B4A A;  3BP8 A;  1LEA A;  3F8N A;  1J2X A;  1QNT A;  2ADU A;  2GQQ A;  4QLC U;  4I01 A;  2L4A A;  5D4S A;  1R23 A;  1FPQ A;  2HYG D;  1FT9 A;  2XAS A;  5D8L B;  1B9M A;  1I1G A;  3ZMV A;  4H0E A;  1OMI A;  1XMA A;  1KGS A;  2CFX A;  5K5O A;  4KFC A;  2F5C A;  2XAQ A;  5LBQ A;  3LAJ A;  3REO A;  4BH9 A;  5CVJ A;  1O57 A;  5CVI A;  3TGN A;  2XUB A;  1YFH A;  3HUG A;  4KIB A;  1TBX A;  5E1X A;  2KIF A;  2H27 A;  3KP3 A;  2ISY A;  1MJB A;  4KIG A;  3COA C;  4YFN F;  3P9I A;  1I6X A;  3QAH A;  1ZRF A;  2ZJ2 A;  1IN7 A;  1FP1 D;  3BJO A;  2CQK A;  1EV7 A;  2G9W A;  3WU0 A;  3WTY C;  4E70 A;  2FEZ A;  2EFO A;  5E20 A;  3F6O A;  5A2Q K;  1IAW A;  1XGS A;  5JHU A;  4EJT A;  4HX7 A;  1W7P D;  3E6C C;  2ACJ A;  1IXR C;  3IKV A;  4KT5 C;  5H20 A;  1I5Z A;  2Y75 A;  1J75 A;  2O6G E;  1QZY A;  4O3M A;  3V7C A;  1S29 A;  2M30 A;  1XSD A;  2E1C A;  1P92 A;  2W84 A;  4XRF A;  1L3L A;  2FBH A;  2WV0 A;  1ZLJ A;  3JAM Z;  4LGW A;  1FSH A;  3LFK A;  3M8E A;  5L3C A;  2EWN A;  1WWX A;  2QZ8 A;  1ZGJ A;  4S05 A;  3T5X A;  4LLL A;  4MNU A;  1R00 A;  3Q9V A;  2EV0 A;  1T6S A;  3QP6 A;  2ZME B;  2PFB A;  4KNY A;  4G94 A;  5FFZ A;  3RI4 A;  2OQG A;  4JK1 X;  2DBB A;  2CWE A;  3N97 A;  3RJP A;  2G7H A;  4KIF A;  1Z6R A;  2ETH A;  3AAF A;  1U6G A;  4LLN A;  1TTY A;  2O3F A;  3FM5 A;  1P4A A;  1Z6T A;  4MEX F;  1P4W A;  4LLG F;  1K78 B;  2H94 A;  4EJU A;  2YU3 A;  2VBZ A;  1KQ0 A;  2PMU A;  3VFZ A;  2JRT A;  3LA7 A;  5IT9 K;  1PUE E;  3BRO A;  3N4M A;  2R3S A;  1HXD A;  1BI2 A;  3GF2 A;  2D2W A;  3K1N A;  3P7N A;  1HW2 A;  3QOP A;  1E2X A;  5HS7 A;  1ON2 A;  1T0F A;  3QP5 A;  4GGG A;  3H92 A;  3IHU A;  1KYZ A;  4M73 A;  1HKQ A;  2EFN A;  2RDP A;  4U0V A;  4AIJ A;  2L02 A;  2PMH A;  2HOE A;  3MWM A;  2DLL A;  1RZ4 A;  2R7F A;  2BEO A;  4L9N A;  1LB2 A;  3E3V A;  3IRQ A;  2XGX A;  4L0Y B;  3WOD F;  1PDN C;  3ZMS A;  4M9X A;  3TO7 A;  1MDM B;  3DFG A;  2DFI A;  5LHI A;  4AWX B;  5D5W B;  1J9I A;  1TLH B;  1HQC A;  2O03 A;  4HQE A;  4K2E A;  4L9T A;  2XAJ A;  1IW7 F;  1YO5 C;  5ICC A;  4RGU A;  4XBF A;  2Z9O A;  1SMT A;  1UB9 A;  1XCB A;  1IUY A;  3LAP A;  1IN4 A;  2XIG A;  2YR2 A;  5TJJ A;  4AIH A;  4BQA A;  3FZV A;  3GYH X;  3E6D A;  4L0Z B;  2MH9 A;  3BJA A;  3SZP A;  5ED4 A;  3I4P A;  3EDP A;  2P6T A;  3HSR A;  1AWC A;  3I59 A;  3M9A A;  5JI6 A;  3E6M A;  2EK5 A;  2HQN A;  1YYV A;  5DYM A;  3C18 A;  2LSO A;  2P7C B;  3KEO A;  2FNA A;  3FF5 A;  2QBY B;  2O0Y A;  4G9Y A;  2XKO A;  4MEY F;  4HV5 A;  3GVA A;  3WTV C;  3U2R A;  1DPR A;  3HSE A;  4I98 B;  1F9N A;  4WXH A;  2DPU A;  4MTD A;  5E17 F;  1IN6 A;  1G3S A;  4IHS A;  1FNN A;  1I27 A;  3B02 A;  4PGH A;  2VT3 A;  4ZYH A;  2LKP A;  3DKW A;  4CHU A;  3IWF A;  4ASN A;  1LQ1 A;  4YFK F;  1F4K A;  3JW4 A;  2VOD A;  4M72 A;  1P4X A;  2KIM A;  4YII A;  5DCM B;  3KP5 A;  4RGS A;  3PQJ A;  6PAX A;  1XGM A;  2DI3 A;  2Y0M A;  1FP2 A;  4YG2 F;  2XVC A;  4PGG A;  4EGY A;  4KMF A;  3HRU A;  2P7V B;  1ZRC A;  1RUN A;  3Q5F A;  5ICE A;  1F5T A;  2VBY A;  1U78 A;  2BBY A;  2RV8 A;  3IL2 A;  1LDJ A;  4HF1 A;  2JTV A;  3TO9 A;  2BE5 F;  5KK1 A;  1QQI A;  1K78 A;  2M87 A;  3QPH A;  1JXS A;  1EH8 A;  2QWW A;  2OU2 A;  4HZF A;  2LF8 A;  2FOK A;  4LK0 F;  1JHH A;  4P55 A;  4RB2 C;  4Q4Z F;  3HRS A;  3L09 A;  4ZZL A;  1FYK A;  3F22 A;  2K7L A;  3KCC A;  3FMQ A;  3CUO A;  1T38 A;  2Q2E A;  2DK5 A;  2HS5 A;  2P4W A;  4ON0 A;  5HLG A;  2M8E A;  2IA2 A;  1ZLK A;  4G7Z F;  3K0L A;  1I1S A;  1S7O A;  2W57 A;  2PJP A;  1ZYR F;  4P9U A;  1YS6 A;  3BY6 A;  2Z5U A;  4L9J A;  2EFP A;  1XN7 A;  2EV5 A;  3CO6 C;  1DP7 P;  3FXQ A;  4A5M A;  1OR7 A;  3K1M A;  1QGP A;  2RNJ A;  1K79 A;  3LQR A;  1GVJ A;  1YLF A;  4U0Y A;  2A3S A;  1HW1 A;  4B8X A;  3FMS A;  1HKT A;  2H6C A;  3ZMT A;  1CGP A;  3PQK A;  1YW7 A;  2STT A;  3LWF A;  5A2Q Z;  5DUI A;  5LRS A;  2HDC A;  3I5U A;  2KRF A;  2MA3 A;  3GUD A;  3FMR A;  1BI3 A;  1UHW A;  2DQL A;  1SD6 A;  1OYI A;  4ESJ A;  4A6D A;  1R1V A;  5F64 A;  3DQV C;  2VOO A;  1VTN C;  1Z9C A;  1XGO A;  2HKX A;  2FRH A;  2V9V A;  2ZFW A;  3DV8 A;  1QPM A;  2A69 F;  4OMY A;  1BOA A;  4UVC A;  3MZY A;  2L3D A;  3RPU A;  1ULY A;  2V1U A;  3K2Z A;  4YFX F;  2V6C A;  4U7D A;  2VOP A;  4F7Z A;  1FOK A;  3WGG A;  1RIO H;  1MJA A;  1ZG5 A;  4FX0 A;  1C0W A;  3P9C A;  1O3T A;  3GX4 X;  4PCQ A;  4BHC A;  2FMY A;  1GHC A;  1AOY A;  2KKO A;  4UVB A;  4EM0 B;  4BHB A;  3L2C A;  4G7H F;  1O3Q A;  3HRT A;  5BMZ A;  2D45 A;  2CG4 A;  4HW0 A;  3RKY A;  3IRR A;  1XMK A;  5HDK A;  1Z1D A;  2HTJ A;  2NS0 A;  1YG2 A;  2HWV A;  1ZAO A;  4Y15 A;  5DDG A;  2HKO A;  2VE8 A;  4NB5 A;  3E5Q A;  5L3E A;  2COM A;  5DCM A;  5D5U B;  2VC0 A;  1WQ2 A;  1O7L A;  3Q9S A;  4UVA A;  1MD0 A;  5ILS A;  3ULQ B;  3F72 A;  2UXX A;  3LST A;  2QEN A;  4KUM A;  5HS9 A;  4JBA A;  3C1D A;  2HR3 A;  3F8B A;  5HOO A;  1WKM A;  2HYF A;  1D8J A;  4WXC A;  1LJ9 A;  4IRG A;  3SQN A;  2F5E A;  2L01 A;  2B0L A;  2ZO4 A;  1RI7 A;  4MTE A;  4Y13 A;  2NAZ A;  4U0W A;  2AS5 F;  3WTS C;  1UST A;  3JSO A;  5JFR A;  3M7G A;  4N9I A;  3U9G A;  2J5O A;  2V79 A;  1IF1 A; 
#chains in the Genus database with same CATH topology
 2OD5 A;  5BQT A;  2DU9 A;  3DCF A;  3NEU A;  3SZT A;  1D5V A;  1X1C A;  3QYE A;  1PP7 U;  2JSP A;  4OAY A;  4DQ2 A;  1OPC A;  1VQ7 I;  1GXP A;  3VOD A;  2GWR A;  4HA8 A;  1T95 A;  4MHG A;  4RA2 A;  1TT0 A;  4U87 A;  3DLL F;  3I55 I;  4FCY A;  3LQQ A;  1OCC H;  3LSH A;  5D6F A;  1LDD A;  3VEP A;  5HVQ C;  5CJ9 A;  5LRR A;  2IPQ X;  2XPW A;  3PFY A;  3B73 A;  2KRH A;  4XMY A;  2O8X A;  3ASO H;  1BR4 A;  3W6J B;  1CQT A;  5HOD A;  1J7K A;  1MMN A;  4ENK A;  1K4T A;  2A5W A;  2JPC A;  2ZNY A;  4JX6 A;  4B4C A;  5LLQ A;  4IOC F;  5HLI A;  4AVP A;  2OUM A;  2DMP A;  4EJW A;  2IA1 A;  3FBN B;  3C2G A;  1GT0 C;  5FKO A;  3KP7 A;  3CZ6 A;  4XKC A;  1ETV A;  5AIQ A;  1UMQ A;  4OIQ F;  3HM5 A;  2KIS A;  1IZ1 A;  1D3Y A;  1MMG A;  2ZME A;  3E5X A;  2FBI A;  2R7T A;  2CV1 A;  2GM4 A;  3KIO A;  3F6V A;  4ENJ A;  2FF4 A;  2GXB A;  3OYJ A;  1UHM A;  2GLO A;  2BV6 A;  2O8K A;  3GO5 A;  5CVU A;  2HU9 A;  1EH6 A;  5DS9 A;  3DEE A;  3GTO J;  3RCO A;  3AFH A;  3KEY A;  4EV0 A;  3KLN A;  2UV1 A;  3LOC A;  2EV6 A;  4HPQ A;  4CCK A;  1V5E A;  2Y31 A;  1YRN B;  2NOJ B;  1FSE A;  1HCR A;  3FXJ A;  1Z7L A;  3D5L A;  2IRF G;  5LEJ A;  2VXD A;  3BCB A;  2DT6 A;  1BN5 A;  3W3C A;  3ZGK A;  1K6O A;  2G7U A;  2K9Q A;  3DEU A;  5GP9 A;  5HDN A;  1BC7 C;  4ESF A;  1DGR M;  3KLO A;  1OFC X;  2LVS A;  4A6E A;  1X1D A;  1BJZ A;  5E8G A;  4CCL A;  4D7M A;  3EQL F;  5F04 A;  3FIS A;  2XRL A;  3RIR A;  5IOY A;  1A31 A;  3EUH C;  2IGO A;  2QUF A;  3LSG A;  1MDM A;  4KN4 X;  1IC8 A;  3VYU B;  4KN7 X;  2IW5 A;  2WBM A;  4B47 A;  4BS9 A;  2GIV A;  2TDX A;  3OIQ A;  4A5N A;  2CJJ A;  3CCM I;  2A07 F;  3I4N J;  3PSI A;  5AON A;  3ZQH A;  5LFA A;  4UUS B;  1P2F A;  1WI3 A;  2M9H A;  2NS8 A;  5LEK A;  1W7P B;  1JT0 A;  1ITY A;  3I71 A;  1GVD A;  5M3F J;  2CFO A;  3RPQ A;  3J81 Z;  2UZK A;  1G4D A;  2F5V A;  4JQF A;  3IKT A;  1IRF A;  2JT1 A;  2ME6 A;  4XSZ F;  3V4G A;  3JSP A;  3ABL H;  1ENH A;  2LH9 A;  3BPX A;  3D5S C;  3K4N A;  5E79 C;  2RVC A;  4G7O F;  3OOP A;  1GDT A;  4MQV A;  2BW3 B;  5J40 A;  2FE3 A;  1NHA A;  2W25 A;  4G6D A;  5GPA A;  1HST A;  1SAU A;  2YS9 A;  4QSH A;  3CDH A;  4N9H A;  3SXY A;  1P7I A;  2P0W A;  1ZRE A;  1RKW A;  3V8K A;  3I53 A;  4L18 B;  2VBW A;  2E2J J;  4LIU A;  2QYO A;  2DFF A;  1WJF A;  2OAZ A;  2NYX A;  4ZH4 F;  1K7A A;  2OTL I;  3SDG A;  2LY1 A;  1ON1 A;  4ZTF A;  3C3W A;  1A6Q A;  4ZYD A;  5JHF A;  1WI9 A;  3ZQQ A;  2R7D A;  1JJ6 C;  1IXS B;  4DNC A;  3V8L A;  5J8C A;  3G73 A;  3WE2 A;  1R5G A;  2MLK A;  2XAG A;  4O5V A;  2R5Z B;  5K5Q A;  1K61 A;  2QGU A;  4QTR A;  2EFW A;  1U5T B;  5BOX A;  2XF6 A;  1B72 B;  4XLC A;  1D1A A;  1WJ5 A;  2CYY A;  2QQ9 A;  1WFX A;  2YX7 A;  3KEQ A;  4BUP A;  3H35 A;  2FX0 A;  3AKZ A;  5K5R A;  3O6B B;  1AKH A;  3GTM J;  4GFB A;  1YS7 A;  3J7A O;  1QPI A;  4HEA 2;  4UXN A;  4A3I J;  4WWC A;  4UUS A;  4XSX F;  3JTG A;  3FHZ A;  3CUQ B;  5DUK A;  3FXK A;  4KIC A;  3VSL A;  1YIO A;  3LA2 A;  3ZPL A;  2XRO A;  2JUC A;  1T98 A;  1TC3 C;  2LNB A;  1G3Y A;  2Y69 H;  2JQ7 A;  4YEL A;  1Y56 A;  3PIO F;  1H9G A;  2ZKZ A;  3CUQ C;  2EQR A;  3BZC A;  3GWZ A;  3KZI C;  1R5H A;  3PNT A;  5JLW A;  1SAX A;  1O3R A;  2PX9 A;  1G6N A;  1TW2 A;  2RC4 A;  4RAF A;  1TZL A;  3KP4 A;  2CQX A;  5FFX A;  2CMP A;  4KIS A;  3S2W A;  5ICG A;  1PUF B;  5EDN A;  3KP6 A;  2B63 J;  1MND A;  2KZG A;  3LA3 A;  3NAU A;  1IV8 A;  3HGY A;  1W4M A;  3GFI A;  2IGK A;  1FIA A;  3HPG A;  3HTU A;  2VBX A;  1TNT A;  1HBX G;  4CXF A;  5BS6 A;  3I56 I;  2IT0 A;  2DT5 A;  3CD6 I;  2AQE A;  4XOR A;  5L3G A;  5ILV A;  2M0C A;  4BXX J;  1CF7 A;  5FLM J;  2BZT A;  2DOE A;  2IBD A;  1USS A;  2B9S A;  3R61 A;  1MBH A;  3J7A Y;  2EJR A;  2X48 A;  2E7X A;  3S1N J;  3K69 A;  5GTH C;  1RES A;  2XGC A;  2HVQ A;  2QSG X;  2ZJP F;  1E3O C;  2KHM A;  3TQN A;  2H1L A;  1Z3X A;  2R5Y B;  2M45 A;  2QQA A;  3ELK A;  1JTY A;  1TQM A;  3OL4 A;  3GME A;  3TDU C;  5AIP A;  3TBI A;  3MVP A;  1SFU A;  2Z1D A;  2HTS A;  1SVO A;  4HBL A;  5DEQ A;  4KIT B;  4RBO A;  1QZZ A;  2P5L C;  2DYS H;  2CQ7 A;  4EQQ A;  2KP6 A;  3KET A;  4DZP A;  4EGZ A;  1J5Y A;  1JT6 A;  1YX3 A;  2KPM A;  3I64 A;  3S15 J;  1EF4 A;  3I58 A;  1KA8 A;  5EZG A;  2F4M B;  4LB6 B;  3WTZ A;  1R58 A;  4I7H A;  2A5Y B;  2V1X A;  2L54 A;  2V9P A;  2X0L A;  2XF5 A;  4MIM A;  2CV0 A;  2OZ6 A;  1JKQ C;  4IF4 A;  1ZEL A;  2MG4 A;  4ZYE A;  2P6S A;  3EET A;  1R36 A;  1SFX A;  4JP0 A;  4UUV A;  2EIK H;  3QPL A;  1PUF A;  1XDU A;  1T56 A;  4UV9 A;  1SFO J;  4IXA A;  3MAJ A;  4M71 A;  3WHC A;  1VZ0 A;  4EAT A;  3K4L A;  5IT9 Z;  3OYH A;  1O7F A;  4B09 A;  3WE3 A;  3F8F A;  5H6Q A;  3JTH A;  4E7H A;  1D0X A;  1MSE C;  5TGT A;  3LSI A;  3G1L A;  3HRM A;  4I02 A;  1STZ A;  2F48 A;  5B1A H;  2DA2 A;  1FBQ A;  2E71 A;  1LPQ A;  2NVQ J;  3S8P A;  2K4B A;  4BYY A;  2EZK A;  2LTP A;  1WJA A;  3OR1 C;  3T8R A;  4A3K J;  5DM6 F;  2BHZ A;  3ZP5 A;  2PMZ N;  4IHT A;  5FKL A;  3ZMZ A;  4EM2 A;  1MW7 A;  2XF7 A;  1SEU A;  2IS2 A;  3V8J A;  3MCZ A;  1ETY A;  4G8X A;  4OIN F;  5D4R A;  1BA5 A;  2OCC H;  5FGM A;  2KLO A;  2FQ3 A;  1N75 A;  4PK4 A;  1ZAR A;  2ELH A;  4C9Y A;  4HLY A;  1L0O C;  4XRM A;  3FWE A;  2QQ8 A;  3E6B A;  2QEX I;  3BR0 A;  3GZ6 A;  3A03 A;  3IC7 A;  3MKL A;  4F93 B;  4AIK A;  1NK3 P;  3NRV A;  1A36 A;  3H3V K;  5F27 A;  5DD8 A;  3R6S A;  2HOA A;  3IH2 A;  1FC3 A;  1X3U A;  5HS8 A;  2P5V A;  2Q1Z B;  3ONQ A;  1V55 H;  1LVK A;  5F1R A;  3BJ6 A;  5J3L A;  4MQ9 F;  4IVN A;  1IXC A;  5LD2 C;  1IN8 A;  3G6E I;  1BL0 A;  3K6G A;  5KHD A;  1ETO A;  3BOQ A;  3GXO A;  2G0E A;  4HNV A;  5CYV A;  1XTA A;  2DMQ A;  3CCL I;  2Q2E B;  1S8N A;  1HKS A;  4ZZD A;  2H8W A;  4NQW A;  4RAY A;  3L2R A;  3ROU A;  3WG7 H;  4CCN A;  1KU7 A;  1DPU A;  1B6A A;  4CZC A;  1XB4 A;  1F1Z A;  2ZSH B;  2UUZ A;  2XKP A;  3C7J A;  3H0D A;  2MW8 A;  3J80 Z;  2ZXW H;  2XAU A;  3BZ6 A;  2VKE A;  4NDL A;  4UHT A;  3R0A A;  1QHH D;  1WH7 A;  2BYV E;  2PJR A;  3JRC A;  3L2W A;  2X4H A;  2Q0O A;  4AUX A;  4C3I J;  1UFM A;  2E5N A;  4DW6 A;  1HSJ A;  2K85 A;  3S17 J;  2E7W A;  2VON A;  2UXN A;  2DO7 A;  1F36 A;  1UAA A;  5BNG A;  5B5E C;  2H8R A;  3PNV A;  4I0A A;  4WX9 A;  1Q1H A;  4H4K C;  2MC3 A;  1W5T A;  4PJM A;  3TDZ C;  1BR2 A;  4A93 J;  3HOY J;  5FRN A;  2PMZ A;  3O3K A;  1TQP A;  4HAM A;  2PLY A;  2NVY J;  4XLP F;  5IY5 H;  3JRB A;  2XGD A;  1UJ8 A;  1VQN I;  3DP7 A;  2E1N A;  1Z7U A;  1DQU A;  2V1D A;  3CJN A;  4M9Z A;  1KON A;  2P5K A;  1B59 A;  2KIU A;  4M74 A;  1ACI A;  1D8K A;  3WHB A;  2RQQ A;  2XHK A;  2CO5 A;  2VXZ A;  1BI0 A;  4GYI A;  1J0R A;  1BJA A;  3RKQ A;  1W0U A;  1LE8 B;  2Y48 A;  1KU3 A;  1ETW A;  2FBK A;  3FBI B;  2WAF A;  1EH7 A;  2DXI A;  2OBP A;  5GPC A;  3JRG A;  4AD9 A;  4IRI A;  2IS1 A;  2NVT J;  3RYP A;  4Z2Y A;  4W97 A;  3MEX A;  3BG5 A;  3EYY A;  1OCP A;  2DMN A;  2F5F A;  4ESB A;  2IS4 A;  3WTW C;  1FIP A;  5FO5 A;  4WK8 F;  5FD6 A;  5DV5 A;  1XD7 A;  3K4B A;  3ML6 A;  3BR1 A;  2MC4 A;  4XON A;  3BCA A;  1JUM A;  1PJR A;  4XRS G;  2VQC A;  2QM3 A;  4F91 B;  1SFE A;  3JAM K;  4CYC A;  2IGM A;  2WB1 A;  3DWL E;  1ZGW A;  2WAE A;  2K9M A;  5EF6 A;  2ELJ A;  4O6J A;  1SD5 A;  3ISP A;  3HC7 A;  4HQM A;  4M6Y A;  1MBJ A;  2DA7 A;  2IXS A;  1FMW A;  3F3X A;  3OYC A;  1RUO A;  3B6A A;  4AC0 A;  1OCZ H;  2PJR B;  2DQR A;  1V4R A;  3CUQ A;  1YIT I;  3WTT C;  1P9Q C;  2M8G X;  2CSO A;  1RPW A;  5FD5 A;  2MLG A;  1JI8 A;  2I10 A;  3F9K A;  1SMY F;  3FDY A;  4D7N A;  4BQN A;  4OAZ A;  1ZK8 A;  1W1W E;  2NVU B;  4CYC B;  1XS9 A;  1WSU A;  1KZH A;  3ZMU A;  1O3S A;  4FTH A;  2OA4 A;  2ECC A;  2EA4 A;  3I3L A;  1V3F A;  1LVA A;  2VJI A;  3TP0 A;  1QVT A;  4JX5 A;  1ZQ3 P;  3GEZ A;  2Y2Z A;  2K27 A;  1BIB A;  1BBY A;  5E18 F;  2LBF A;  3ABK H;  3E97 A;  2M2E A;  3HPH A;  4TV7 A;  4EJV A;  2YX4 A;  1P7J A;  2OF7 A;  4XLN F;  3BG9 A;  3A4C A;  2JZY A;  3FM3 A;  1MZB A;  3Q3S A;  5BPI A;  1YRN A;  3A0B C;  1BI1 A;  2LYC A;  3HOS A;  3FXR A;  4LMY A;  5KAF C;  2DW4 A;  1SC7 A;  3CTA A;  5C4X J;  3E0J B;  4ANJ A;  5JVT A;  3WU1 B;  2K3P A;  2RGV A;  3A02 A;  3ERE D;  3BLY A;  4L5J A;  5LHH A;  4AID A;  1B1B A;  1APL C;  4XQF A;  3HSF A;  1ETQ A;  2K3F A;  2X1D A;  1YW8 A;  2O5R A;  1K6Y A;  2GBY A;  1KU2 A;  3PL8 A;  3HZJ A;  4KMU X;  2PI0 A;  5ILU A;  1IRG A;  1F43 A;  5E1W A;  2LD5 A;  1ZH5 A;  2HI3 A;  1R1T A;  2JRM A;  2V7F A;  4U7B A;  3UNG C;  4RB1 A;  2A6H F;  3I54 A;  3WTX C;  4WF2 A;  2K9S A;  3G2B A;  1DU0 A;  3OOU A;  4E7Z A;  1YIJ I;  3BR3 A;  1FY7 A;  3TOA A;  1R49 A;  1FX7 A;  2CUJ A;  4ENM A;  2WB1 N;  1W7P A;  4F55 A;  5TIS C;  2X1C A;  1TL8 A;  3CJT B;  3K4K A;  2R7R A;  3B6C A;  1S7A A;  5DCF A;  4B3X A;  4NQW B;  2R7W A;  4HYE A;  3RPU D;  2ESN A;  2R7O A;  2A68 F;  2FOW A;  4FAS D;  2DFE A;  2XRN A;  5HLH A;  3OS0 A;  1YTY A;  1XSV A;  4B48 A;  1RR8 C;  4OIP F;  4XLE A;  2A05 A;  3HG9 A;  4FET A;  4C30 A;  3ECH A;  3CQZ J;  3FXL A;  2J5P A;  4E6K G;  4CIC A;  4XLA A;  2ME0 A;  1X19 A;  5FLX K;  4BE0 A;  2LBF B;  3DXJ F;  3CLQ A;  1SAN A;  2VKV A;  2ZXJ A;  3K4C A;  4GYG A;  1MMA A;  3TMO A;  2EB7 A;  2JA8 J;  4BXU A;  2WA0 A;  5EG0 A;  2JJ7 A;  2E1O A;  2PN6 A;  2QKM B;  2DFH A;  3LSK A;  3OV8 A;  4GXO A;  3EUH A;  4P96 A;  3BDD A;  3RDI A;  3J81 K;  3OYK A;  1U0J A;  4OIO F;  2MFZ A;  5D6E A;  2HEO A;  1VQO I;  1LUJ B;  4IKF A;  2DTZ A;  3OYB A;  1PYV A;  2LLK A;  5GTI C;  1YQA A;  4NNJ A;  1W5S A;  5JR3 A;  3VDX A;  1PVE A;  4OOI A;  5FKK A;  3TW7 A;  1GXQ A;  4DIQ A;  4E4H A;  3KFW X;  1OJL A;  1U5T A;  2M34 A;  3ESW B;  4BY1 J;  5BPD A;  4NC7 A;  3V7S A;  1I6H J;  1MJ9 A;  4NC6 A;  1G3W A;  1AA7 A;  2DDB A;  2ZC2 A;  1MNM C;  5LGN A;  1TQI A;  2FA5 A;  2WY8 Q;  1LDK B;  1XDS A;  1DDN A;  4C2U A;  5LHG A;  3CCU I;  3R0J A;  4HOB A;  4EVI A;  3FK6 A;  3UR3 C;  3J80 K;  1AU7 A;  5E3M A;  3M07 A;  4RLQ A;  1ZKG A;  2K9N A;  1QRY A;  3F8M A;  1LE8 A;  1R4M B;  2BY1 A;  1ONV A;  1BOB A;  3ZN0 A;  3QU6 A;  1NK2 P;  4UNO A;  2JWT A;  4M3F A;  1XCV A;  3TL4 X;  1VQ4 I;  1HDP A;  1ODD A;  3NQO A;  4II3 A;  1KU9 A;  4OWR B;  1W0T A;  2EZL A;  3K70 C;  1SD4 A;  4BEH B;  2D1V A;  4XLH A;  4WXD A;  2WTE A;  1WJB A;  2ZJQ F;  1RKT A;  1FZP B;  4MFD A;  3V7R A;  4PUS A;  4U88 A;  3RQ4 A;  2XB5 A;  4XKV A;  3CCR I;  4P5O A;  2VN2 A;  3T0Y A;  2IVM A;  3DBL B;  5C44 J;  4HDU A;  2JA6 J;  3KZZ A;  5CLS A;  1POG A;  1QHG A;  5FLX Z;  3HDD A;  1I50 J;  1UHS A;  3GFM A;  2L0K A;  2K02 A;  1K83 J;  3MFK A;  3TOB A;  1ZHF A;  2E60 A;  3L7W A;  3SHF A;  3V42 A;  1B8I A;  2DTR A;  1CF7 B;  3S2D J;  1TW3 A;  4ABZ A;  4BAY A;  2JPB A;  1NH3 A;  5EEH A;  4A0Z A;  1I3A A;  2IP2 A;  2CRG A;  5HLT A;  2LK2 A;  3EPZ A;  3GFJ A;  1Q1V A;  2BY3 A;  4IL6 C;  1BM9 A;  3WGI A;  3PO3 J;  3ZQC A;  2CW8 A;  1A04 A;  4R79 A;  3W6K B;  4KYW A;  3KX2 A;  3UKG A;  2L4M A;  2X6O A;  2NRA C;  5IOZ A;  2DAO A;  5GAD J;  1SD7 A;  4L5E A;  4BE2 A;  1JGS A;  2XV4 S;  2Z33 A;  5E3O A;  5DD4 A;  3DPT A;  4CDG A;  3H5N A;  3SJM A;  2FXA A;  3S1R J;  1VND A;  3K4J A;  2GXG A;  2M1B A;  1KQ8 A;  2Q8K A;  1FOX A;  4ETS A;  2VPL A;  3M1E A;  1OYY A;  4KDP A;  2HXI A;  4HLX A;  1MGT A;  1R22 A;  1J59 A;  3ABU A;  2BXZ A;  2RN7 A;  5F0F A;  1A35 A;  1G2H A;  4IJA A;  1BW6 A;  4Q48 A;  3OYL A;  5IYD J;  1U9O A;  2JA2 A;  4MFE A;  2X6Y A;  5K1Y A;  3Q0U A;  3PIP F;  1Z21 A;  1J09 A;  3O8H A;  4EM1 A;  1Z77 A;  4Y17 A;  3I0T A;  1RNL A;  5FJ8 J;  2D1H A;  4L5I A;  3G4S I;  1WGX A;  1Y1W J;  1FYM A;  4RAZ A;  5JLX A;  3BQZ A;  5KVR A;  1JE8 A;  4WCG A;  1JKP C;  2RKH A;  3F8C A;  4ITV A;  3FX3 A;  2XAF A;  4OMZ A;  5LGT A;  1FYL A;  3PUF A;  3X2Q H;  5J8F A;  3L2V A;  4A12 A;  1UZC A;  2MD0 A;  2HZT A;  5CQG A;  3KP2 A;  3CO7 C;  2F5D A;  2MAB A;  1KQ9 A;  4A2U A;  4IOA F;  2STW A;  1YW9 A;  2KJB A;  1T8I A;  5L3B A;  4P1W A;  3L9F A;  1XX5 A;  4PJN A;  1FEX A;  4A3C J;  3S3M A;  1E17 A;  2Z99 A;  2QBY A;  1V54 H;  2Y9Y A;  1ZG3 A;  1U8R A;  1QA6 A;  2CQQ A;  3M8F A;  5IT3 A;  1H0M A;  4HX8 A;  2CW0 F;  4A3L J;  2BVL A;  1MSF C;  3KZY A;  2HGC A;  3HHH A;  2A6E F;  4BL0 B;  2M4G A;  1MKM A;  5CVR A;  1ZN2 A;  2ESH A;  2H6B A;  2ID3 A;  1X2M A;  3JRF A;  3CLO A;  2MH2 A;  3SFI A;  4KA4 A;  1DUX C;  1VQ5 I;  2VI6 A;  4P9F A;  4G6Q A;  2MD5 A;  3EUK L;  2ID6 A;  5D5X B;  4HV6 A;  4AM3 A;  5FKM A;  1FOY A;  2I8D A;  3GTP J;  2RRE A;  2VC1 A;  3HHG A;  1BIA A;  1QBJ A;  3DF8 A;  4Q47 A;  2BXY A;  2GA1 A;  2CQN A;  3BQY A;  2E35 A;  3KPH A;  4R1H A;  4IQ4 A;  3DTE A;  3M8J A;  3MMY B;  4B3A A;  5M5Y J;  4ZDO A;  3HIF A;  3NWT A;  2R7S A;  2RNG A;  4IHV A;  3HEF A;  2W24 A;  4QPO A;  3T8T A;  3EYI A;  4A0X A;  1R5I D;  2L7F P;  5E8I A;  4DOZ A;  2L9S A;  3C2H A;  3D0S A;  4YEJ A;  1ETK A;  2EFQ A;  3MD2 A;  1S6L A;  2DDA A;  2HQR A;  4CGZ A;  2C6Y A;  2WC2 A;  1E3H A;  1VI0 A;  4MO7 A;  2M7B A;  4XL9 A;  1H9T A;  3ZMD A;  4DGW B;  5HDG A;  1O4X A;  3E1S A;  3CCQ I;  5D8K B;  4ENN A;  4XM3 A;  2CH0 A;  3JRH A;  4LFU A;  3F23 A;  3R4K A;  1DP3 A;  1HOM A;  1NTC A;  5E3N A;  4BQQ A;  3BPV A;  1T39 A;  4LG0 B;  1Z67 A;  4LK1 F;  3HOV J;  4PZJ A;  2DA3 A;  4ZTJ A;  3SEQ A;  5E1Z B;  4RGX A;  4I2O A;  3G1O A;  4I09 A;  3DPL C;  5IPA A;  2VQG A;  5IP7 J;  2W82 A;  2WWY A;  2ZCW A;  1LFP A;  1LNW A;  1X1B A;  3K4M A;  1TWF J;  5F6F A;  4BJT A;  3R60 A;  2X51 A;  3EUA A;  1ZTR A;  3OY9 A;  3FIW A;  1Z3Y A;  3WGH A;  2VE9 A;  1FWZ A;  3MKY B;  2OQR A;  3A01 B;  5TRD A;  3HYI A;  1FTZ A;  3GZ5 A;  3HL2 A;  2YSR A;  2L9V A;  1X4P A;  3O2P E;  2GA2 A;  1IN5 A;  4MGR A;  3CC2 I;  4CA0 A;  2DOA A;  4N0B A;  2O9L A;  3QU3 A;  3HGG A;  5J6X A;  4GCV A;  1E3P A;  3QPT A;  3ZN1 A;  1S3J A;  3WG9 A;  4IZZ A;  1VQM I;  2ZBK A;  1XGN A;  2OZU A;  3M3Y J;  3HJE A;  2YUS A;  2W00 A;  1U3E M;  1PP8 F;  2JVH A;  3M4O J;  3RYR A;  3A0H C;  4CZZ A;  3RTR A;  3TED A;  1FBU A;  3KE2 A;  4CCO A;  3JRI A;  3MZH A;  3OMY A;  2X6W A;  3CP8 A;  3QWL A;  2F4O B;  2LRE A;  4RB0 A;  1EA3 A;  4HF0 A;  1R1U A;  2K86 A;  1IG7 A;  3RZO J;  2GZW A;  3H1C A;  5EGO A;  3OYM A;  3FHN A;  3RZD J;  1VF9 A;  1B72 A;  4RDU A;  3IP4 B;  4CO8 A;  2DA1 A;  2QVO A;  3GTJ J;  2DT7 B;  4BQO A;  2DK8 A;  1OYW A;  2LF7 A;  2BY0 A;  3SFZ A;  5GAG J;  5GAE J;  3WTU C;  2VQH A;  2EIN H;  2KJC A;  4QWQ A;  2WV1 A;  4I6Z A;  4ZYG A;  2F4I A;  2YPR A;  4EJO A;  1N25 A;  2PBI A;  2CUE A;  4S04 A;  4M6X A;  4OU0 A;  5CPR B;  5H6R A;  4UB6 C;  3H3Z A;  3K1P A;  3ZQ7 A;  4HF2 A;  4E7J A;  2OCE A;  4YIF A;  3IAM 2;  2Z3Y A;  4PJL A;  2EA2 A;  3G3Z A;  4A3M J;  4F52 A;  3VOE A;  2M5W A;  4IHY A;  1LFU P;  4V2F A;  3IWZ A;  3W6V A;  1IDZ A;  1R4N B;  2XAH A;  2P8T A;  5EGO B;  1UEL B;  2PEX A;  4PFO A;  1U5T C;  2H09 A;  1G8X A;  2QQB A;  2VT2 A;  1YOV B;  2DA5 A;  2CGP A;  2FU4 A;  4BNC A;  2IA0 A;  1Y6I A;  3OYI A;  2KZV A;  5IP6 A;  4RB3 C;  3ZXS A;  3QRF F;  1Y0U A;  3VB2 A;  5F1J A;  3GW2 A;  3I9V 2;  4FT8 A;  2AXL A;  4LJZ F;  1X2N A;  3LSM A;  4ZDP A;  1BR1 A;  2LDU A;  1B9N A;  2R7Q A;  4HST A;  3VPR A;  1Z05 A;  4RM2 A;  4BJ5 C;  3ABT A;  2TRT A;  4UV8 A;  1QO0 D;  3AG1 H;  4FHT A;  1R7J A;  3GLX A;  3J7Y J;  1FMV A;  2NNN A;  1REP C;  4IRH A;  4IPA A;  4BBR J;  2XDV A;  2E1M B;  4GO1 A;  2BGC A;  4RS8 A;  5ERI A;  4YRV A;  3CJR B;  2IJL A;  5ICF A;  3ECO A;  4R8H A;  4XLF A;  2FNP A;  4CYD A;  2ISZ A;  2FML A;  4L9V A;  2V6E A;  1ZG1 A;  4I0B A;  4E7S A;  3OYF A;  1NG7 A;  4PDK A;  5C3E J;  5EEG A;  1N78 A;  2NNY A;  4OIR F;  4FX4 A;  4A0Y A;  1LEB A;  2VJJ A;  2A61 A;  3FXU A;  4BHP A;  4Q5S F;  1UCR A;  2F2E A;  4PSW A;  3F21 A;  3QOE A;  3AL0 B;  5B66 C;  3NAR A;  2QLZ A;  4LB5 A;  2X9D A;  1LKX A;  3PFI A;  2K4J A;  4HX4 A;  4DYQ A;  1Z91 A;  5GAH J;  3TO6 A;  1X1A A;  5CVV A;  3DKX A;  1XSX A;  4RGR A;  3OYN A;  1T2K A;  3MQ0 A;  2IGN A;  5EZH A;  5E3L A;  1IUF A;  2H1K A;  3OS1 A;  2UWM A;  1MBG A;  2DPD A;  3TKY A;  3I59 B;  4FE7 A;  4FE4 A;  4IX7 A;  1EJ9 A;  4DJA A;  3E5U A;  2GAU A;  2LKX A;  4CCM A;  2O61 A;  3L00 A;  3G1M A;  3HXL A;  2HYJ A;  1V5F A;  3P9K A;  3TP3 A;  5L3D A;  1Z0X A;  2YU9 J;  1JHF A;  2FSW A;  4M3G A;  2MBF A;  1BW5 A;  3HB9 A;  4J00 A;  4I76 A;  3GFL A;  2X6X A;  3K9T A;  1WJC A;  3RKW A;  3SEZ A;  1FLI A;  1FBS A;  4W1U A;  1VQK I;  1H88 C;  1ZRD A;  4NHJ A;  3HOT A;  1OKR A;  2ICW G;  1T08 B;  2K9L A;  2M7A A;  5D5V B;  4HDV A;  2GOM A;  4BE1 A;  1IJW C;  4BAC A;  3RKX A;  4LD5 A;  1TNS A;  1TWA J;  2PG4 A;  4LG3 A;  4RMN A;  1OLT A;  1P6R A;  3BWG A;  1U2W A;  2Z2S B;  3PM1 A;  1YHQ I;  1HW5 A;  5LGU A;  2EZH A;  3ZQI A;  1KYW A;  3DBH B;  4PFP A;  2V4J C;  3T1B A;  1W36 C;  3LFU A;  5FB2 A;  2W85 A;  1A6I A;  4EMS A;  4XN3 A;  2JSC A;  2XPV A;  4E7K A;  1BC8 C;  4XOT A;  4ZC3 A;  2ZNZ A;  3PJR A;  3U1D A;  4D0P A;  4LG0 A;  3HTS B;  2R7U A;  5L3F A;  3H36 A;  2HFH A;  4M9S A;  2RQP A;  3AG2 H;  3H3U A;  1VFC A;  2E34 A;  1XPX A;  2PQ8 A;  5H2F C;  1WHU A;  3BZK A;  1ZGA A;  1G3T A;  4V2G A;  1WRJ A;  1B4A A;  4IQJ A;  3BP8 A;  1LEA A;  5J4V A;  4BXF A;  2EIM H;  3F8N A;  1J2X A;  1QNT A;  3BTL A;  2DOD A;  2ADU A;  3JCU C;  5KAI C;  2GQQ A;  1SFK A;  4QLC U;  4I01 A;  2L4A A;  2OV7 A;  5D4S A;  1R23 A;  2VJ5 A;  1FPQ A;  2Y0S A;  3HOZ J;  2E36 A;  1JKO C;  2WY7 Q;  2HYG D;  1FOW A;  3SDB A;  1FT9 A;  2XAS A;  5D8L B;  3QYF A;  5K7F A;  1DGW Y;  1B9M A;  1I1G A;  3ZMV A;  1HA8 A;  4H0E A;  3PUB A;  3GTG J;  1OMI A;  2MSY A;  2ZXI A;  1XMA A;  1KGS A;  4N4N B;  2CFX A;  5K5O A;  5J47 A;  2EIL H;  2R0Q C;  4KFC A;  2F5C A;  2XAQ A;  5LBQ A;  3LAJ A;  3REO A;  2A6T A;  2OPT A;  1MBE A;  1D1C A;  4BH9 A;  5CVJ A;  1ERD A;  3N05 A;  1O57 A;  1RRJ A;  2NS7 A;  3Q0V A;  5CVI A;  3MZ8 A;  3TGN A;  2XUB A;  3CF2 A;  1YFH A;  3HUG A;  2JA5 J;  2EPF A;  3KYC B;  4KIB A;  1TBX A;  5E1X A;  2KIF A;  1GV2 A;  2H27 A;  2JUG A;  3KP3 A;  2W7N A;  2ISY A;  1MJB A;  1HDD C;  2TCT A;  2DJI A;  2DMU A;  4KIG A;  2E5Z A;  3COA C;  4YFN F;  2KT0 A;  2VL8 A;  3U21 A;  3P9I A;  1I6X A;  3QAH A;  1X3W B;  1FTT A;  1ZRF A;  1RR7 A;  2ZJ2 A;  1IN7 A;  2VIX A;  3CCE I;  2ECB A;  1FP1 D;  3BJO A;  2CQK A;  1EV7 A;  3CP2 A;  5IYB J;  3S3O A;  1I3Q J;  2G9W A;  1A5J A;  3OR2 C;  1IDY A;  2L9N A;  4CSW A;  3WU0 A;  4RAG A;  3P5J A;  3WTY C;  2OTJ I;  4E70 A;  2FEZ A;  2L7K A;  2EFO A;  5E20 A;  3F6O A;  1V5G A;  5A2Q K;  1IAW A;  1R6R A;  1GUU A;  2Y0S N;  2L5Q A;  3GCM A;  1XGS A;  5JHU A;  2L7Z A;  3BTC A;  3U1K A;  4EJT A;  2W48 A;  1DU6 A;  1UG0 A;  4HX7 A;  2LOO A;  1W7P D;  3E6C C;  2ACJ A;  1IXR C;  3CCY A;  1YI2 I;  3IKV A;  2KDZ A;  3OSG A;  4CH7 A;  4KT5 C;  4PSX A;  5J1U A;  2DOF A;  5H20 A;  4AU7 A;  1I5Z A;  2GOX B;  2Y75 A;  1J75 A;  2O6G E;  2VQL A;  1QZY A;  1XG1 A;  4O3M A;  3V7C A;  1S29 A;  2M30 A;  2V9K A;  3H9J A;  1SVL A;  1XSD A;  2E1C A;  3BR2 A;  1HLV A;  2N8G A;  1P92 A;  3CC7 I;  2HPI A;  2HDW A;  2NVX J;  2W84 A;  3ERM A;  1WCM J;  1OCO H;  5B1B H;  4XRF A;  2E1M C;  2MYS A;  4UB8 C;  1L3L A;  2WAD A;  2FBH A;  2WV0 A;  3ZR8 X;  4NBQ A;  1ZLJ A;  2QSF X;  3JAM Z;  4HG2 A;  4LGW A;  1QVU A;  1FSH A;  3LFK A;  3M8E A;  5F08 A;  2EWN A;  2Z16 A;  5L3C A;  1WWX A;  4NUB A;  2QZ8 A;  1ZGJ A;  4RM3 A;  4S05 A;  3BR6 A;  3T5X A;  4LLL A;  4MNU A;  3VWB A;  5IYC J;  1R00 A;  2R92 J;  4C3J J;  3Q9V A;  2EV0 A;  1T6S A;  3QP6 A;  2ZME B;  1VQ9 I;  2PFB A;  4KNY A;  3QOD A;  2V26 A;  4C2T A;  4G94 A;  2CW7 A;  5FFZ A;  3RI4 A;  2OQG A;  4JK1 X;  2DBB A;  2CWE A;  3N97 A;  3RJP A;  2G7H A;  4KIF A;  3J7Z I;  5HNH A;  3ABM H;  1Z6R A;  2ETH A;  3AAF A;  4Y3O A;  2JMW A;  1U6G A;  4LLN A;  3DBR B;  4IHW A;  2X85 A;  1TTY A;  4BU2 A;  2O3F A;  2VPR A;  3ZQL A;  3FM5 A;  3O8G A;  2AQF A;  4S0H B;  1HC8 A;  1P4A A;  1Z6T A;  1RC9 A;  3S1Q J;  2XGE A;  4XN0 A;  4MEX F;  1P4W A;  4LLG F;  1K78 B;  1MH4 A;  1W36 D;  2H94 A;  2KMU A;  2W1O A;  4EJU A;  2YU3 A;  2VBZ A;  4G6T B;  5K7H A;  3FKJ A;  4XNF A;  2KRC A;  1KQ0 A;  3ZCO A;  4XOP A;  1AKH B;  1MMD A;  1IV6 A;  3CMY A;  1MBF A;  2PMU A;  5CKT A;  2R5Z A;  4J01 A;  3VFZ A;  1T0F C;  2JRT A;  3LA7 A;  5IT9 K;  1PUE E;  2ELK A;  3BRO A;  3N4M A;  1D1B A;  4B1R A;  4ZJZ A;  2R3S A;  1HXD A;  4BBS J;  3JR9 A;  3OWT A;  1BI2 A;  3GF2 A;  4D5F A;  2D2W A;  3K1N A;  3CDI A;  3IV5 A;  4Y4R A;  2LP0 A;  3P7N A;  1HW2 A;  3OIP A;  4LOC A;  2HXO A;  4D9J A;  3QOP A;  2KDO A;  1WVR A;  2LFB A;  1E2X A;  5HS7 A;  1ON2 A;  5J1Y A;  2LRD A;  3E7L A;  1VQP I;  2EH3 A;  5FRO A;  1T0F A;  3CF5 F;  3QP5 A;  3D1N I;  2I5U A;  4GGG A;  3H92 A;  3IHU A;  1KYZ A;  3GLL A;  3S1M J;  1SVM A;  4XIC A;  4M73 A;  1HKQ A;  1Y1V J;  2EFN A;  2RDP A;  4JYK A;  3HBL A;  3OYA A;  1MMS A;  3CME I;  2LKS A;  3W2V A;  2ZXH A;  4U0V A;  3OS2 A;  4AIJ A;  2L02 A;  4GRI A;  2PMH A;  3IAS 2;  4FQG A;  2M4K A;  4E7I A;  2HOE A;  2VUM J;  3GBG A;  2DLL A;  3MWM A;  1RZ4 A;  2R7F A;  1YJN I;  2BEO A;  2VJ4 A;  4L9N A;  5IP9 J;  2IS6 A;  1LB2 A;  3E3V A;  3IRQ A;  2XGX A;  4L0Y B;  5FLV A;  3GTK J;  2IEK A;  4BJ6 C;  1JUP A;  3WOD F;  1PDN C;  3BG6 A;  3C2B A;  3BTJ A;  3ZMS A;  4M9X A;  2ZJR F;  2M0M A;  3TO7 A;  1MDM B;  2L9R A;  4KJZ A;  1H8A C;  4NC8 A;  4BKX A;  3DFG A;  2F6C A;  2DFI A;  3IH4 A;  5LHI A;  3L2Q A;  4AWX B;  5D5W B;  2DCE A;  5JVG F;  1J9I A;  2KFD A;  3BG3 A;  4XKW A;  1TLH B;  1HQC A;  2O03 A;  4HQE A;  4K2E A;  4L9T A;  2RAE A;  2LY2 A;  3FKI J;  2XAJ A;  3HKZ N;  4V19 K;  1IW7 F;  1YO5 C;  3A01 A;  3OSF A;  5ICC A;  4RGU A;  4A3D J;  4XBF A;  4D1Q A;  2Z9O A;  2VB6 A;  3AG3 H;  1SMT A;  1UB9 A;  3FK7 A;  4A3F J;  1XCB A;  1IUY A;  4KT6 A;  2ZB9 A;  4YIR X;  1VQ6 I;  3LAP A;  2O7O A;  4Y7N J;  1IN4 A;  2DJN A;  2XIG A;  2YR2 A;  5TJJ A;  4AIH A;  4BQA A;  3FXO A;  3QYB A;  4RLF A;  3S16 J;  3W2A A;  2R7Z J;  3FZV A;  3S14 J;  3GYH X;  1Y8R B;  3E6D A;  4L0Z B;  3OIO A;  4AVZ A;  2R93 J;  4J19 A;  4AYB N;  2MH9 A;  3BJA A;  3SZP A;  5ED4 A;  3I4P A;  2GXA A;  3EDP A;  2JK3 A;  2JVG A;  1VQ8 I;  5F0C A;  1IRX A;  5EYR A;  2P6T A;  3HSR A;  1AWC A;  3I59 A;  1MH3 A;  3M9A A;  4A3J J;  3HOW J;  5JI6 A;  1TP4 A;  1XMX A;  3E6M A;  3CC4 I;  2JN6 A;  2EK5 A;  4B43 A;  3H5R A;  1Y39 A;  1RET A;  1IGN A;  2HQN A;  1S7E A;  1YYV A;  1QZE A;  5DYM A;  3C18 A;  2E19 A;  4HNU A;  2NOG A;  2JA7 J;  2LSO A;  5M5X J;  2FD5 A;  2VAS A;  4D5C A;  2P7C B;  2ZME C;  1OCR H;  3KEO A;  2FNA A;  2HVR A;  2DN0 A;  3FF5 A;  1M1E B;  1X58 A;  2QBY B;  3LMM A;  4A69 C;  2O0Y A;  3BG7 A;  4G9Y A;  3SYT A;  1WZ2 A;  2XKO A;  2HOT A;  4MEY F;  1X3Z B;  4HV5 A;  5EJC A;  1ZR4 A;  3GVA A;  3WTV C;  1E0E A;  3D5R C;  3U2R A;  3WU2 C;  1I39 A;  2AO9 A;  1DPR A;  3HSE A;  4II2 A;  4I98 B;  4A3E J;  2E2I J;  1F9N A;  4WXH A;  2DPU A;  3HKZ A;  4MTD A;  5E17 F;  1IN6 A;  1G3S A;  2D5V A;  4IHS A;  2FQ4 A;  1FNN A;  1I27 A;  1D5Y A;  3B02 A;  3LSP A;  2OC6 A;  3L2U A;  4PGH A;  2VT3 A;  4ZYH A;  2M3A A;  2LKP A;  2R4G A;  3DKW A;  3GZN B;  4CHU A;  3IWF A;  4ASN A;  2X1E A;  1LQ1 A;  4YFK F;  2DYR H;  1F4K A;  3JW4 A;  2ZFU A;  3OL3 A;  5HNF A;  4GDF A;  4Y52 J;  2VOD A;  4CUG A;  4G12 A;  4M72 A;  1P4X A;  2E2H J;  2KIM A;  3DU6 A;  4YII A;  3TW6 A;  5DCM B;  3KP5 A;  4AYB A;  4RGS A;  1G59 A;  3K2A A;  4PJJ A;  5FKN A;  3PQJ A;  6PAX A;  1OCT C;  1XGM A;  2DI3 A;  3CCV I;  2Y0M A;  1FP2 A;  4YG2 F;  2XB0 X;  2XVC A;  4I99 C;  3DEW A;  2BOL A;  1NG6 A;  3BT9 A;  4PGG A;  1JKR C;  4EGY A;  4KMF A;  3HRU A;  2P7V B;  1ZRC A;  4ZDL A;  3ZQF A;  3CMM A;  1RUN A;  3Q5F A;  2LMD A;  2P81 A;  5ICE A;  2OJE D;  1F5T A;  3ZOB A;  2VBY A;  3S2H J;  1U78 A;  2BBY A;  3BR5 A;  3FXM A;  4QIW N;  3PO2 J;  2RV8 A;  3IL2 A;  4BDZ A;  2MGQ A;  4A3G J;  1TWC J;  1LDJ A;  3NWS A;  3DPU A;  4ZYA A;  5DTD A;  2BVM A;  4HF1 A;  3JRE A;  3H5A A;  4IO9 F;  1JTX A;  3CDL A;  3VYT B;  2JTV A;  1W5C C;  4FIS A;  1H89 C;  3CES A;  2EBI A;  3PNY A;  3MKW B;  2HNH A;  2BE5 F;  4XKB A;  3TO9 A;  4C2M J;  4HSR A;  5KK1 A;  1QQI A;  1K78 A;  3VSK A;  2BHY A;  2M87 A;  3QPH A;  1JXS A;  2KL4 A;  1EH8 A;  5CQE A;  1WJE A;  3A2K A;  2QWW A;  2OU2 A;  4HZF A;  2LF8 A;  4X0G A;  2FOK A;  3HOU J;  4LK0 F;  1JHH A;  3DTI A;  4P55 A;  4RB2 C;  4Z6Y A;  4Q4Z F;  2NXN B;  3HRS A;  3L09 A;  3BC8 A;  4ZZL A;  4IHX A;  3L1P A;  1FYK A;  2HPM A;  3F22 A;  3QQA A;  3RSN A;  4DBR A;  2QKL B;  3VYR B;  2K7L A;  4BEH A;  3KCC A;  3FMQ A;  3CUO A;  1T38 A;  2Q2E A;  3CCS I;  2DK5 A;  2HS5 A;  1TWH J;  2L2O A;  4XK4 A;  5FRM A;  2P4W A;  1S72 I;  4ON0 A;  5HLG A;  3OYD A;  2Y9Z A;  2M8E A;  2IA2 A;  1MIJ A;  1ZLK A;  4G7Z F;  2QF7 A;  3K0L A;  4JOM A;  2QCO A;  1I1S A;  4XRS A;  1XC5 A;  2HOS A;  1S7O A;  2W57 A;  3ZQG A;  2PJP A;  2HQA A;  1ZYR F;  4P9U A;  5J1R A;  1YS6 A;  3BY6 A;  2Z5U A;  3PSF A;  3DKY A;  4L9J A;  1EKE A;  4XID A;  2HDD A;  2EFP A;  1XN7 A;  3SZG A;  2EV5 A;  3CO6 C;  1DP7 P;  2K40 A;  3FXQ A;  4A5M A;  1OR7 A;  3K1M A;  1QGP A;  2RNJ A;  1K79 A;  3GTQ J;  3LQR A;  1GVJ A;  1GLN A;  1YLF A;  4U0Y A;  1VQL I;  2A3S A;  1HW1 A;  2R5Y A;  4B8X A;  1MBK A;  3FMS A;  1HKT A;  5J4Y A;  3GTL J;  2H6C A;  2LG4 A;  3ZMT A;  3AG4 H;  1CGP A;  3PQK A;  1YW7 A;  2KIQ A;  1LFB A;  4DYR A;  3HUG B;  2STT A;  2L7M P;  2K5C A;  1IRZ A;  5B3S H;  4BDY A;  3LWF A;  5A2Q Z;  4HNT A;  5M5W J;  3QPS A;  5DUI A;  1MNE A;  5LRS A;  2HDC A;  1YX5 A;  4DYC A;  3I5U A;  2KRF A;  1S5L C;  3GUD A;  2MA3 A;  3FMR A;  4UUT A;  3G71 I;  1BI3 A;  1UHW A;  2DQL A;  1SD6 A;  3IH3 A;  1YJ9 I;  1OYI A;  1D0Y A;  1K4S A;  4BGD A;  4ESJ A;  4A6D A;  4M3B A;  1R1V A;  4LIV A;  5F64 A;  3DQV C;  2BY2 A;  3S3N A;  2VOO A;  2CS3 A;  1VTN C;  3H9G A;  1Z9C A;  1XGO A;  2HKX A;  2FRH A;  1IO2 A;  1X1P A;  2V9V A;  2ZFW A;  3DV8 A;  1YE9 A;  9ANT A;  4C3H J;  1OIS A;  1QPM A;  2BW3 A;  5EG0 B;  2A69 F;  2CUZ A;  4OMY A;  5EEA A;  1U9N A;  1BOA A;  2R7X A;  4UVC A;  3MN2 A;  3MZY A;  2L3D A;  4M3D A;  2XC7 A;  3H9Q A;  3RQI A;  3RPU A;  4HRI A;  1WPK A;  1ULY A;  3KYD B;  5F0H A;  2V1U A;  3LSR A;  1UG2 A;  3MKZ A;  1TWG J;  4QPQ A;  3K2Z A;  4YFX F;  2V6C A;  4U7D A;  2VOP A;  4F7Z A;  1FOK A;  2FUG 2;  2IAI A;  1U8B A;  3WGG A;  5C4J J;  1RIO H;  1MJA A;  3LSJ A;  1ZG5 A;  4CCJ A;  1ETX A;  1OR7 C;  4FX0 A;  5DM7 F;  4IEJ A;  3ZRG A;  2CV2 A;  3DU5 A;  1C0W A;  3P9C A;  3HOX J;  1O3T A;  1R71 A;  3GX4 X;  2LR8 A;  4PCQ A;  2B7E A;  1X4O A;  2WAQ A;  4B44 A;  4BHC A;  5KNL A;  2FMY A;  2GIZ A;  1R9T J;  2HQ5 A;  1N77 A;  1GHC A;  5M3M J;  2COB A;  1AOY A;  2KKO A;  2XPU A;  4UVB A;  1T33 A;  2VKH A;  4EM0 B;  4BHB A;  3L2C A;  4G7H F;  1ZR2 A;  1O3Q A;  3HRT A;  4N4O B;  5BMZ A;  4UY8 I;  2CG4 A;  4BY7 J;  3K70 D;  2D45 A;  3DLA A;  3ASN H;  4HW0 A;  2HVS A;  1JUS A;  3IUO A;  5KCM A;  3RKY A;  2VLA A;  1YJW I;  3VYS B;  3IRR A;  1XMK A;  5HDK A;  1JJ8 C;  3AL0 C;  1Z1D A;  2HTJ A;  2R7V A;  3JRD A;  2NS0 A;  3CJQ B;  1ORK A;  4A3B J;  2V1N A;  3I4M J;  1YG2 A;  2LY9 A;  4M3E A;  2QSH X;  3S32 A;  2HWV A;  3A1Y A;  1ZAO A;  4M6V A;  4X1E A;  4Y15 A;  5DDG A;  2HKO A;  2VE8 A;  1Y8Q B;  3S93 A;  4X6A J;  4NB5 A;  3E5Q A;  3M1C A;  5L3E A;  1AHD P;  2COM A;  5DCM A;  5D5U B;  2VC0 A;  2AXT C;  2AHQ A;  1WQ2 A;  3OYE A;  1O7L A;  1D0Z A;  3Q9S A;  4EEF G;  3LNQ A;  3H0G J;  4UVA A;  4DZJ A;  2QA4 I;  1QU3 A;  2LC2 A;  1MD0 A;  3DTK A;  3K10 A;  1OQY A;  5ILS A;  2EZI A;  3ULQ B;  3OYG A;  1HF0 A;  3CMA I;  1TT5 B;  3LL7 A;  2VKD A;  1S9H A;  3F72 A;  2UXX A;  1GV5 A;  3LST A;  3W2W A;  1FJL A;  4E7L A;  2QEN A;  3BTI A;  4KUM A;  5HS9 A;  4JBA A;  3C1D A;  2HR3 A;  3F8B A;  5HOO A;  4Y33 A;  2KQR A;  1WKM A;  2HYF A;  1D8J A;  4WXC A;  1B8I B;  1LJ9 A;  2XSJ C;  3KYL A;  4IRG A;  4JX4 A;  2CU7 A;  1WJD A;  3SQN A;  2DA4 A;  3F0C A;  3Q0W A;  2F5E A;  2WAQ N;  2W4S A;  4MLO A;  2L01 A;  5K7Z A;  4XR6 A;  2B0L A;  2ZO4 A;  4F3Q A;  1RI7 A;  1WH5 A;  4PJ0 C;  3JRA A;  2HZD A;  4LIT A;  3K7A J;  4MTE A;  4Y13 A;  2EIJ H;  2NAZ A;  2DA6 A;  4U0W A;  2AS5 F;  1Y0N A;  3WTS C;  1UST A;  3JSO A;  2FJ1 A;  4DBQ A;  5JFR A;  3M7G A;  4N9I A;  3CCJ I;  2ZSI B;  1JGG A;  2CUF A;  3U9G A;  2Y30 A;  2XSD C;  2J5O A;  2V79 A;  4F92 B;  2DMT A;  1IF1 A; 
#chains in the Genus database with same CATH homology
 2OD5 A;  5BQT A;  2DU9 A;  3NEU A;  3SZT A;  1D5V A;  1PP7 U;  4DQ2 A;  1OPC A;  1GXP A;  3VOD A;  2GWR A;  4HA8 A;  4MHG A;  3LQQ A;  5D6F A;  3VEP A;  5HVQ C;  1LDD A;  5CJ9 A;  5LRR A;  2IPQ X;  3B73 A;  2O8X A;  3W6J B;  1J7K A;  4ENK A;  2JPC A;  2ZNY A;  5LLQ A;  5HLI A;  4AVP A;  4EJW A;  2IA1 A;  3KP7 A;  5AIQ A;  4OIQ F;  1IZ1 A;  1D3Y A;  2ZME A;  3E5X A;  2FBI A;  3F6V A;  4ENJ A;  2FF4 A;  2GXB A;  1UHM A;  2BV6 A;  3GO5 A;  5CVU A;  1EH6 A;  4EV0 A;  3KLN A;  2EV6 A;  1FSE A;  3D5L A;  2IRF G;  5LEJ A;  1K6O A;  1BN5 A;  2G7U A;  3DEU A;  5HDN A;  1BC7 C;  4ESF A;  3KLO A;  4A6E A;  5E8G A;  3EQL F;  3RIR A;  2QUF A;  1MDM A;  4KN4 X;  4KN7 X;  2IW5 A;  2GIV A;  2TDX A;  4A5N A;  2A07 F;  5AON A;  1P2F A;  5LEK A;  1W7P B;  3I71 A;  3RPQ A;  3J81 Z;  2UZK A;  1G4D A;  4JQF A;  3IKT A;  1IRF A;  2JT1 A;  3JSP A;  4XSZ F;  3V4G A;  3BPX A;  2RVC A;  4G7O F;  3OOP A;  4MQV A;  2FE3 A;  1NHA A;  2W25 A;  4G6D A;  1HST A;  3CDH A;  4N9H A;  3SXY A;  1ZRE A;  3V8K A;  3I53 A;  4L18 B;  2VBW A;  2QYO A;  2OAZ A;  2NYX A;  4ZH4 F;  1K7A A;  1ON1 A;  3C3W A;  4ZYD A;  1WI9 A;  2R7D A;  1IXS B;  4DNC A;  3V8L A;  5J8C A;  3G73 A;  3WE2 A;  1R5G A;  2MLK A;  2XAG A;  4O5V A;  5K5Q A;  2EFW A;  1U5T B;  5BOX A;  2CYY A;  2QQ9 A;  2YX7 A;  3KEQ A;  5K5R A;  3O6B B;  1YS7 A;  3J7A O;  4UXN A;  4WWC A;  4XSX F;  3JTG A;  3FHZ A;  3CUQ B;  5DUK A;  4KIC A;  1YIO A;  3LA2 A;  3ZPL A;  2XRO A;  1T98 A;  2LNB A;  1G3Y A;  1H9G A;  2ZKZ A;  3CUQ C;  3GWZ A;  1R5H A;  1SAX A;  1O3R A;  1G6N A;  1TW2 A;  2RC4 A;  3KP4 A;  5FFX A;  3S2W A;  5ICG A;  3KP6 A;  3LA3 A;  1W4M A;  3GFI A;  3HTU A;  2VBX A;  1TNT A;  1HBX G;  4CXF A;  5BS6 A;  2IT0 A;  2DT5 A;  5L3G A;  5ILV A;  1CF7 A;  1USS A;  3R61 A;  2EJR A;  2E7X A;  3K69 A;  3TQN A;  2M45 A;  2QQA A;  3ELK A;  1TQM A;  3TDU C;  5AIP A;  1SFU A;  2HTS A;  5DEQ A;  4HBL A;  1QZZ A;  2P5L C;  4EQQ A;  3KET A;  4EGZ A;  1J5Y A;  3I64 A;  3I58 A;  1KA8 A;  4LB6 B;  3WTZ A;  1R58 A;  4I7H A;  2A5Y B;  2V1X A;  2L54 A;  2X0L A;  2OZ6 A;  4IF4 A;  4ZYE A;  2P6S A;  3EET A;  1R36 A;  1SFX A;  4UUV A;  1XDU A;  4UV9 A;  4IXA A;  3MAJ A;  4M71 A;  5IT9 Z;  1O7F A;  4B09 A;  3WE3 A;  3F8F A;  5H6Q A;  3JTH A;  3HRM A;  4I02 A;  1STZ A;  1FBQ A;  2K4B A;  4BYY A;  3T8R A;  3ZP5 A;  4IHT A;  3ZMZ A;  4EM2 A;  3V8J A;  3MCZ A;  4G8X A;  4OIN F;  5D4R A;  5FGM A;  2FQ3 A;  1ZAR A;  2ELH A;  4HLY A;  1L0O C;  3FWE A;  3E6B A;  3GZ6 A;  3IC7 A;  4AIK A;  3NRV A;  5DD8 A;  3R6S A;  1FC3 A;  1X3U A;  5HS8 A;  2P5V A;  5F1R A;  3BJ6 A;  4MQ9 F;  4IVN A;  1IXC A;  1IN8 A;  3BOQ A;  3GXO A;  5CYV A;  1S8N A;  1HKS A;  4ZZD A;  4NQW A;  4RAY A;  3ROU A;  1KU7 A;  1DPU A;  1B6A A;  1XB4 A;  1F1Z A;  2XKP A;  3C7J A;  3J80 Z;  3BZ6 A;  4UHT A;  3R0A A;  2BYV E;  2X4H A;  2Q0O A;  1UFM A;  1HSJ A;  2E7W A;  2VON A;  2UXN A;  2DO7 A;  4I0A A;  4WX9 A;  1Q1H A;  2MC3 A;  1W5T A;  3TDZ C;  3O3K A;  1TQP A;  4HAM A;  2PLY A;  4XLP F;  3DP7 A;  2E1N A;  1Z7U A;  2V1D A;  3CJN A;  4M9Z A;  2P5K A;  1B59 A;  2KIU A;  4M74 A;  1D8K A;  2XHK A;  2CO5 A;  2VXZ A;  1BI0 A;  4GYI A;  1J0R A;  1BJA A;  2Y48 A;  1KU3 A;  2FBK A;  1EH7 A;  2OBP A;  4AD9 A;  4IRI A;  3RYP A;  4Z2Y A;  3MEX A;  3EYY A;  2F5F A;  4ESB A;  3WTW C;  5FO5 A;  4WK8 F;  5FD6 A;  5DV5 A;  1XD7 A;  3ML6 A;  2QM3 A;  1SFE A;  3JAM K;  4O6J A;  1SD5 A;  3ISP A;  4HQM A;  4M6Y A;  3F3X A;  1RUO A;  2DQR A;  1V4R A;  3CUQ A;  3WTT C;  2CSO A;  5FD5 A;  2MLG A;  1SMY F;  1WSU A;  3ZMU A;  1O3S A;  2OA4 A;  2EA4 A;  1V3F A;  1LVA A;  3GEZ A;  2K27 A;  1BIB A;  1BBY A;  5E18 F;  3E97 A;  4TV7 A;  4EJV A;  2YX4 A;  4XLN F;  3FM3 A;  2JZY A;  1MZB A;  5BPI A;  3HOS A;  1BI1 A;  3FXR A;  4LMY A;  2DW4 A;  3CTA A;  5JVT A;  3WU1 B;  2RGV A;  3ERE D;  4L5J A;  5LHH A;  1B1B A;  3HSF A;  1YW8 A;  1KU2 A;  4KMU X;  2PI0 A;  5ILU A;  1IRG A;  5E1W A;  1ZH5 A;  4U7B A;  1R1T A;  4RB1 A;  2A6H F;  3I54 A;  3WTX C;  4WF2 A;  3TOA A;  1FY7 A;  1FX7 A;  4ENM A;  1W7P A;  1S7A A;  5DCF A;  4HYE A;  2ESN A;  2A68 F;  2XRN A;  5HLH A;  1YTY A;  1XSV A;  4OIP F;  3ECH A;  2J5P A;  4CIC A;  5FLX K;  3DXJ F;  2ZXJ A;  4GYG A;  2EB7 A;  4BXU A;  4GXO A;  2PN6 A;  4P96 A;  3J81 K;  3OV8 A;  3EUH A;  3BDD A;  3RDI A;  4OIO F;  2HEO A;  5D6E A;  1YQA A;  1W5S A;  5JR3 A;  4OOI A;  1GXQ A;  3KFW X;  1U5T A;  5BPD A;  3V7S A;  1MJ9 A;  1G3W A;  5LGN A;  1TQI A;  2FA5 A;  1LDK B;  1XDS A;  1DDN A;  5LHG A;  3R0J A;  4HOB A;  4EVI A;  3J80 K;  3F8M A;  1ONV A;  3ZN0 A;  3QU6 A;  4UNO A;  1XCV A;  1ODD A;  3NQO A;  1KU9 A;  1SD4 A;  2D1V A;  4WXD A;  2WTE A;  1FZP B;  3V7R A;  4U88 A;  4P5O A;  2VN2 A;  3T0Y A;  2IVM A;  4HDU A;  3KZZ A;  5CLS A;  5FLX Z;  3GFM A;  2K02 A;  3MFK A;  3TOB A;  1ZHF A;  1CF7 B;  3L7W A;  3SHF A;  2DTR A;  1TW3 A;  4BAY A;  2JPB A;  5EEH A;  4A0Z A;  2IP2 A;  3GFJ A;  1BM9 A;  3WGI A;  1A04 A;  4R79 A;  3W6K B;  4KYW A;  2L4M A;  2NRA C;  2DAO A;  1SD7 A;  1JGS A;  2XV4 S;  2Z33 A;  5DD4 A;  3DPT A;  4CDG A;  2FXA A;  2GXG A;  2M1B A;  1KQ8 A;  2Q8K A;  4ETS A;  3M1E A;  1OYY A;  4KDP A;  4HLX A;  1MGT A;  1R22 A;  1J59 A;  3ABU A;  2RN7 A;  4IJA A;  4Q48 A;  5K1Y A;  4EM1 A;  4Y17 A;  3I0T A;  1RNL A;  2D1H A;  4L5I A;  1FYM A;  4RAZ A;  5KVR A;  1JE8 A;  4WCG A;  2RKH A;  3F8C A;  3FX3 A;  2XAF A;  4OMZ A;  5LGT A;  1FYL A;  5J8F A;  4A12 A;  2HZT A;  3KP2 A;  3CO7 C;  2F5D A;  1KQ9 A;  4A2U A;  2STW A;  1YW9 A;  2KJB A;  5L3B A;  3L9F A;  1E17 A;  2Z99 A;  2QBY A;  1U8R A;  1ZG3 A;  3M8F A;  5IT3 A;  1H0M A;  4HX8 A;  2CW0 F;  3KZY A;  2HGC A;  3HHH A;  2A6E F;  1MKM A;  5CVR A;  1ZN2 A;  2ESH A;  2H6B A;  3CLO A;  2MH2 A;  4KA4 A;  1DUX C;  4P9F A;  4G6Q A;  2MD5 A;  5D5X B;  4HV6 A;  2VC1 A;  3HHG A;  1BIA A;  1QBJ A;  3DF8 A;  4Q47 A;  2GA1 A;  4R1H A;  3HIF A;  2W24 A;  3T8T A;  3EYI A;  4A0X A;  5E8I A;  3D0S A;  2EFQ A;  1S6L A;  2HQR A;  4CGZ A;  2C6Y A;  2WC2 A;  1H9T A;  3ZMD A;  5HDG A;  5D8K B;  4ENN A;  4LFU A;  3F23 A;  3R4K A;  3BPV A;  1T39 A;  4LG0 B;  4LK1 F;  4PZJ A;  5E1Z B;  4RGX A;  4I2O A;  4I09 A;  3DPL C;  2WWY A;  2ZCW A;  1LNW A;  5F6F A;  3R60 A;  3WGH A;  2VE9 A;  1FWZ A;  2OQR A;  5TRD A;  3HYI A;  3GZ5 A;  2YSR A;  3O2P E;  2GA2 A;  1IN5 A;  4MGR A;  4N0B A;  3QU3 A;  5J6X A;  4GCV A;  3QPT A;  3ZN1 A;  1S3J A;  3WG9 A;  2ZBK A;  1XGN A;  2OZU A;  1U3E M;  1PP8 F;  3RYR A;  4CZZ A;  3RTR A;  1FBU A;  3KE2 A;  3MZH A;  4RB0 A;  4HF0 A;  1R1U A;  2K86 A;  2GZW A;  4CO8 A;  2QVO A;  2DK8 A;  1OYW A;  2LF7 A;  3SFZ A;  3WTU C;  2KJC A;  4QWQ A;  4ZYG A;  2YPR A;  4EJO A;  2PBI A;  4S04 A;  4M6X A;  4OU0 A;  5H6R A;  3H3Z A;  3K1P A;  3ZQ7 A;  4HF2 A;  4YIF A;  2Z3Y A;  2EA2 A;  3G3Z A;  3VOE A;  2M5W A;  3IWZ A;  2XAH A;  2P8T A;  2PEX A;  1U5T C;  2H09 A;  2QQB A;  2VT2 A;  2CGP A;  2FU4 A;  4BNC A;  2IA0 A;  4RB3 C;  3QRF F;  1Y0U A;  3VB2 A;  3GW2 A;  4FT8 A;  2AXL A;  4LJZ F;  2LDU A;  1B9N A;  1Z05 A;  3ABT A;  4UV8 A;  1QO0 D;  4FHT A;  1R7J A;  3GLX A;  2NNN A;  1REP C;  4IRH A;  4IPA A;  4GO1 A;  2BGC A;  4RS8 A;  5ERI A;  2IJL A;  5ICF A;  3ECO A;  4R8H A;  4CYD A;  2FNP A;  2ISZ A;  2FML A;  4L9V A;  1ZG1 A;  4I0B A;  4PDK A;  5EEG A;  2NNY A;  4OIR F;  4FX4 A;  4A0Y A;  1LEB A;  2A61 A;  3FXU A;  4BHP A;  4Q5S F;  1UCR A;  2F2E A;  3F21 A;  4LB5 A;  2QLZ A;  3PFI A;  2K4J A;  4HX4 A;  1Z91 A;  3TO6 A;  5CVV A;  4RGR A;  1XSX A;  1T2K A;  3MQ0 A;  2UWM A;  2DPD A;  3TKY A;  3I59 B;  3E5U A;  2GAU A;  2O61 A;  3L00 A;  3P9K A;  5L3D A;  1JHF A;  2FSW A;  2MBF A;  3GFL A;  3K9T A;  3RKW A;  1FLI A;  1FBS A;  1ZRD A;  4NHJ A;  3HOT A;  1OKR A;  5D5V B;  4HDV A;  3RKX A;  4LD5 A;  1TNS A;  2PG4 A;  1P6R A;  3BWG A;  1U2W A;  1HW5 A;  5LGU A;  1KYW A;  3T1B A;  5FB2 A;  2W85 A;  4EMS A;  2JSC A;  1BC8 C;  2ZNZ A;  3U1D A;  4D0P A;  4LG0 A;  3HTS B;  5L3F A;  2HFH A;  4M9S A;  2RQP A;  3H3U A;  2PQ8 A;  1ZGA A;  1G3T A;  1WRJ A;  1B4A A;  3BP8 A;  1LEA A;  3F8N A;  1J2X A;  1QNT A;  2ADU A;  2GQQ A;  4QLC U;  4I01 A;  2L4A A;  5D4S A;  1R23 A;  1FPQ A;  2HYG D;  1FT9 A;  2XAS A;  5D8L B;  1B9M A;  1I1G A;  3ZMV A;  4H0E A;  1OMI A;  1XMA A;  1KGS A;  2CFX A;  5K5O A;  4KFC A;  2F5C A;  2XAQ A;  5LBQ A;  3LAJ A;  3REO A;  4BH9 A;  5CVJ A;  1O57 A;  5CVI A;  3TGN A;  2XUB A;  1YFH A;  3HUG A;  4KIB A;  1TBX A;  5E1X A;  2KIF A;  2H27 A;  3KP3 A;  2ISY A;  1MJB A;  4KIG A;  3COA C;  4YFN F;  3P9I A;  1I6X A;  3QAH A;  1ZRF A;  2ZJ2 A;  1IN7 A;  1FP1 D;  3BJO A;  2CQK A;  1EV7 A;  2G9W A;  3WU0 A;  3WTY C;  4E70 A;  2FEZ A;  2EFO A;  5E20 A;  3F6O A;  5A2Q K;  1IAW A;  1XGS A;  5JHU A;  4EJT A;  4HX7 A;  1W7P D;  3E6C C;  2ACJ A;  1IXR C;  3IKV A;  4KT5 C;  5H20 A;  1I5Z A;  2Y75 A;  1J75 A;  2O6G E;  1QZY A;  4O3M A;  3V7C A;  1S29 A;  2M30 A;  1XSD A;  2E1C A;  1P92 A;  2W84 A;  4XRF A;  1L3L A;  2FBH A;  2WV0 A;  1ZLJ A;  3JAM Z;  4LGW A;  1FSH A;  3LFK A;  3M8E A;  5L3C A;  2EWN A;  1WWX A;  2QZ8 A;  1ZGJ A;  4S05 A;  3T5X A;  4LLL A;  4MNU A;  1R00 A;  3Q9V A;  2EV0 A;  1T6S A;  3QP6 A;  2ZME B;  2PFB A;  4KNY A;  4G94 A;  5FFZ A;  3RI4 A;  2OQG A;  4JK1 X;  2DBB A;  2CWE A;  3N97 A;  3RJP A;  2G7H A;  4KIF A;  1Z6R A;  2ETH A;  3AAF A;  1U6G A;  4LLN A;  1TTY A;  2O3F A;  3FM5 A;  1P4A A;  1Z6T A;  4MEX F;  1P4W A;  4LLG F;  1K78 B;  2H94 A;  4EJU A;  2YU3 A;  2VBZ A;  1KQ0 A;  2PMU A;  3VFZ A;  2JRT A;  3LA7 A;  5IT9 K;  1PUE E;  3BRO A;  3N4M A;  2R3S A;  1HXD A;  1BI2 A;  3GF2 A;  2D2W A;  3K1N A;  3P7N A;  1HW2 A;  3QOP A;  1E2X A;  5HS7 A;  1ON2 A;  1T0F A;  3QP5 A;  4GGG A;  3H92 A;  3IHU A;  1KYZ A;  4M73 A;  1HKQ A;  2EFN A;  2RDP A;  4U0V A;  4AIJ A;  2L02 A;  2PMH A;  2HOE A;  3MWM A;  2DLL A;  1RZ4 A;  2R7F A;  2BEO A;  4L9N A;  1LB2 A;  3E3V A;  3IRQ A;  2XGX A;  4L0Y B;  3WOD F;  1PDN C;  3ZMS A;  4M9X A;  3TO7 A;  1MDM B;  3DFG A;  2DFI A;  5LHI A;  4AWX B;  5D5W B;  1J9I A;  1TLH B;  1HQC A;  2O03 A;  4HQE A;  4K2E A;  4L9T A;  2XAJ A;  1IW7 F;  1YO5 C;  5ICC A;  4RGU A;  4XBF A;  2Z9O A;  1SMT A;  1UB9 A;  1XCB A;  1IUY A;  3LAP A;  1IN4 A;  2XIG A;  2YR2 A;  5TJJ A;  4AIH A;  4BQA A;  3FZV A;  3GYH X;  3E6D A;  4L0Z B;  2MH9 A;  3BJA A;  3SZP A;  5ED4 A;  3I4P A;  3EDP A;  2P6T A;  3HSR A;  1AWC A;  3I59 A;  3M9A A;  5JI6 A;  3E6M A;  2EK5 A;  2HQN A;  1YYV A;  5DYM A;  3C18 A;  2LSO A;  2P7C B;  3KEO A;  2FNA A;  3FF5 A;  2QBY B;  2O0Y A;  4G9Y A;  2XKO A;  4MEY F;  4HV5 A;  3GVA A;  3WTV C;  3U2R A;  1DPR A;  3HSE A;  4I98 B;  1F9N A;  4WXH A;  2DPU A;  4MTD A;  5E17 F;  1IN6 A;  1G3S A;  4IHS A;  1FNN A;  1I27 A;  3B02 A;  4PGH A;  2VT3 A;  4ZYH A;  2LKP A;  3DKW A;  4CHU A;  3IWF A;  4ASN A;  1LQ1 A;  4YFK F;  1F4K A;  3JW4 A;  2VOD A;  4M72 A;  1P4X A;  2KIM A;  4YII A;  5DCM B;  3KP5 A;  4RGS A;  3PQJ A;  6PAX A;  1XGM A;  2DI3 A;  2Y0M A;  1FP2 A;  4YG2 F;  2XVC A;  4PGG A;  4EGY A;  4KMF A;  3HRU A;  2P7V B;  1ZRC A;  1RUN A;  3Q5F A;  5ICE A;  1F5T A;  2VBY A;  1U78 A;  2BBY A;  2RV8 A;  3IL2 A;  1LDJ A;  4HF1 A;  2JTV A;  3TO9 A;  2BE5 F;  5KK1 A;  1QQI A;  1K78 A;  2M87 A;  3QPH A;  1JXS A;  1EH8 A;  2QWW A;  2OU2 A;  4HZF A;  2LF8 A;  2FOK A;  4LK0 F;  1JHH A;  4P55 A;  4RB2 C;  4Q4Z F;  3HRS A;  3L09 A;  4ZZL A;  1FYK A;  3F22 A;  2K7L A;  3KCC A;  3FMQ A;  3CUO A;  1T38 A;  2Q2E A;  2DK5 A;  2HS5 A;  2P4W A;  4ON0 A;  5HLG A;  2M8E A;  2IA2 A;  1ZLK A;  4G7Z F;  3K0L A;  1I1S A;  1S7O A;  2W57 A;  2PJP A;  1ZYR F;  4P9U A;  1YS6 A;  3BY6 A;  2Z5U A;  4L9J A;  2EFP A;  1XN7 A;  2EV5 A;  3CO6 C;  1DP7 P;  3FXQ A;  4A5M A;  1OR7 A;  3K1M A;  1QGP A;  2RNJ A;  1K79 A;  3LQR A;  1GVJ A;  1YLF A;  4U0Y A;  2A3S A;  1HW1 A;  4B8X A;  3FMS A;  1HKT A;  2H6C A;  3ZMT A;  1CGP A;  3PQK A;  1YW7 A;  2STT A;  3LWF A;  5A2Q Z;  5DUI A;  5LRS A;  2HDC A;  3I5U A;  2KRF A;  2MA3 A;  3GUD A;  3FMR A;  1BI3 A;  1UHW A;  2DQL A;  1SD6 A;  1OYI A;  4ESJ A;  4A6D A;  1R1V A;  5F64 A;  3DQV C;  2VOO A;  1VTN C;  1Z9C A;  1XGO A;  2HKX A;  2FRH A;  2V9V A;  2ZFW A;  3DV8 A;  1QPM A;  2A69 F;  4OMY A;  1BOA A;  4UVC A;  3MZY A;  2L3D A;  3RPU A;  1ULY A;  2V1U A;  3K2Z A;  4YFX F;  2V6C A;  4U7D A;  2VOP A;  4F7Z A;  1FOK A;  3WGG A;  1RIO H;  1MJA A;  1ZG5 A;  4FX0 A;  1C0W A;  3P9C A;  1O3T A;  3GX4 X;  4PCQ A;  4BHC A;  2FMY A;  1GHC A;  1AOY A;  2KKO A;  4UVB A;  4EM0 B;  4BHB A;  3L2C A;  4G7H F;  1O3Q A;  3HRT A;  5BMZ A;  2D45 A;  2CG4 A;  4HW0 A;  3RKY A;  3IRR A;  1XMK A;  5HDK A;  1Z1D A;  2HTJ A;  2NS0 A;  1YG2 A;  2HWV A;  1ZAO A;  4Y15 A;  5DDG A;  2HKO A;  2VE8 A;  4NB5 A;  3E5Q A;  5L3E A;  2COM A;  5DCM A;  5D5U B;  2VC0 A;  1WQ2 A;  1O7L A;  3Q9S A;  4UVA A;  1MD0 A;  5ILS A;  3ULQ B;  3F72 A;  2UXX A;  3LST A;  2QEN A;  4KUM A;  5HS9 A;  4JBA A;  3C1D A;  2HR3 A;  3F8B A;  5HOO A;  1WKM A;  2HYF A;  1D8J A;  4WXC A;  1LJ9 A;  4IRG A;  3SQN A;  2F5E A;  2L01 A;  2B0L A;  2ZO4 A;  1RI7 A;  4MTE A;  4Y13 A;  2NAZ A;  4U0W A;  2AS5 F;  3WTS C;  1UST A;  3JSO A;  5JFR A;  3M7G A;  4N9I A;  3U9G A;  2J5O A;  2V79 A;  1IF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...