3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
3HSRA 3F6VA 5FLXK 2M1BA 2A61A 1UB9A 2CWEA 4RS8A 2E7WA 1QPMA 4HF0A 1E2XA 2WV0A 2JRTA 3B02A 2B0LA 5D5WB 1LB2A 1BIBA 2KJCA 2XIGA 2DK5A 1OR7A 2PN6A 3CTAA 1HW2A 3DV8A 5CVRA 2PMUA 3F8BA 4GXOA 1R58A 4CICA 1HKQA 1TW2A 4MHGA 3FMQA 3C7JA 1O7LA 4L9NA 4ESFA 2W57A 2HKOA 3EYIA 3SXYA 4Q47A 1XMKA 4MGRA 5DUIA 5D6FA 3J81Z 1T2KA 1P6RA 4U0WA 2WTEA 1K79A 4OIQF 5BQTA 4RGUA 1REPC 4QLCU 3HOSA 1ON1A 3E97A 3OOPA 3RDIA 1MJ9A 2A07F 3TDUC 1KYZA 2VN2A 4G8XA 2DBBA 3DPLC 1HKSA 1TQMA 2XKPA 4UHTA 2ESNA 3E6BA 5LGUA 4RB0A 2H27A 5JI6A 3F23A 1GXQA 3EQLF 1MDMB 2BGCA 4LLNA 1FNNA 3GFLA 3G3ZA 3LA7A 4AWXB 5FLXZ 1PP8F 1YW7A 4EMSA 4PGGA 1IF1A 2NYXA 3GF2A 1TQPA 2NAZA 3VEPA 1SFEA 2E1NA 3MCZA 5D6EA 4BHCA 1MD0A 2IA1A 1I1GA 3QU6A 4P96A 4H0EA 5HS7A 5KK1A 5FFZA 3KZYA 3GVAA 1IW7F 1IN6A 3I0TA 2VXZA 5LBQA 2GXGA 2L3DA 3KP3A 3MFKA 1R7JA 2WWYA 4EJWA 1U5TA 5ILSA 3ZQ7A 4B09A 3TO7A 4ZZLA 1ZG3A 1J5YA 4IVNA 1S6LA 2VC0A 2QBYA 4HF1A 3I5UA 3DEUA 3O3KA 1SAXA 4M9XA 1SD4A 4MNUA 2IRFG 3KEQA 3HYIA 2P6SA 5BOXA 3BROA 3JAMK 4HA8A 1XMAA 4CHUA 4G7OF 4KA4A 1XCBA 2STWA 1B6AA 2DW4A 3FMRA 5J6XA 2DI3A 5E1ZB 1J75A 2GA2A 3E6MA 2EV5A 2Z33A 4OINF 2GA1A 5K5QA 2MLGA 3F8NA 1WWXA 5TJJA 4U0VA 3M1EA 3SFZA 1S8NA 1TBXA 3HSFA 3H3UA 3RKYA 3BDDA 5LEJA 2MBFA 3ZN0A 4WXDA 3WTXC 3T8RA 2OA4A 4MEYF 2DK8A 3FM5A 2HS5A 2XKOA 4N0BA 4CXFA 1ZLKA 4I7HA 2P8TA 3CDHA 1D8KA 4KYWA 2H09A 2XGXA 5J8CA 2HZTA 1FBQA 4KT5C 4GYGA 5A2QK 4XLNF 4RGRA 1J2XA 2XAFA 3N97A 2QWWA 1R5GA 3TOAA 2R3SA 4EV0A 3VB2A 3WG9A 4ETSA 4BAYA 2QYOA 4UV8A 4L5IA 1YTYA 2M45A 5D5VB 3FM3A 3CUQB 2FNPA 2R7DA 3PQKA 2ZKZA 2XAQA 4OIPF 3M7GA 5TRDA 2RN7A 5AIPA 3M8EA 4KICA 5L3EA 3WGHA 2PFBA 3V7CA 5DUKA 3REOA 2EB7A 1FC3A 2HFHA 3MEXA 4JK1X 1FLIA 1BC8C 3FHZA 3S2WA 4UVCA 4ENMA 1FYLA 1D5VA 2XRNA 3CUQC 4IXAA 1T0FA 1MZBA 2A5YB 3R60A 3LAPA 2HYFA 5K5RA 3PFIA 1L3LA 2MC3A 5DDGA 1KU9A 5DD8A 4BHPA 3GW2A 5HDKA 4OIOF 4D0PA 4Q4ZF 4OIRF 2DLLA 2QUFA 2EFOA 3L00A 2MA3A 1FSEA 2Z9OA 2XHKA 2BE5F 1J59A 2Y0MA 2BBYA 5CVVA 4A0XA 3Q5FA 1LDKB 5A2QZ 1ZG1A 3H3ZA 3F21A 2VBXA 1Z9CA 1ZN2A 3P9IA 4EGZA 4HDVA 4WK8F 4L18B 1FPQA 1BM9A 5BPDA 3DKWA 1G3SA 2P7VB 4CZZA 4F7ZA 4KMFA 3J80K 3Q9SA 1OPCA 2JTVA 1STZA 2L4MA 5E18F 4IPAA 5D4RA 2IA0A 3MWMA 1ODDA 3W6KB 2A3SA 2NRAC 3MQ0A 1P92A 4KIFA 5JHUA 3V4GA 3RPQA 2ZNZA 2ISZA 3IRQA 3GX4X 3FF5A 5DCMB 1ZAOA 1O3SA 1EH8A 2DU9A 3I54A 4HYEA 2Q2EA 2O8XA 4YFKF 3ZMDA 1XDUA 4R1HA 2ZCWA 4BH9A 3M9AA 5LHHA 2GAUA 2A6HF 1ZG5A 2JSCA 3J81K 4L0YB 2OQGA 4M71A 1DPUA 3CJNA 5LHGA 1U2WA 3V8KA 1XCVA 4WX9A 4GCVA 4ZZDA 3WTWC 4MEXF 1JHHA 5E8IA 3ROUA 3K2ZA 4A12A 4IJAA 4O5VA 3WTTC 4O3MA 1A04A 4S04A 1QO0D 2V1XA 4PZJA 3SHFA 1WI9A 2Q0OA 4WXCA 1SD5A 1U5TB 2QBYB 2M8EA 2OQRA 3KP5A 1D8JA 1SFXA 1IXCA 1KA8A 2GZWA 3GLXA 2P5KA 2FMLA 4ZH4F 4P55A 5FD6A 4RAZA 5HDNA 2K4JA 4HX7A 4Y17A 3E6DA 1WQ2A 1HXDA 5E1XA 5KVRA 4KIGA 1YQAA 2ADUA 1U5TC 3DFGA 4WXHA 3L09A 1W7PA 2HOEA 1RUOA 5HLIA 4IF4A 2O03A 3BP8A 4A5MA 4HF2A 1W5TA 2H6BA 1W7PD 1LEAA 1TNTA 1IXRC 1XN7A 5FB2A 2EA4A 1KQ0A 1ZGJA 1FYKA 1ZH5A 3ZMZA 1T39A 1DP7P 5HVQC 4OMYA 1PP7U 3I59A 2CGPA 3GEZA 2K86A 4XSZF 3LSTA 5JVTA 2LNBA 5F64A 1F4KA 2L01A 4EVIA 4FT8A 2D45A 1ULYA 5L3CA 2G9WA 1FBSA 3GFIA 3IL2A 2DQRA 1S7OA 3WTVC 4CO8A 2H94A 4RB3C 5CLSA 1QZZA 1ZRDA 1IN8A 3IRRA 1VTNC 1XGMA 4HZFA 4LK0F 2Y75A 4GGGA 4LGWA 4U7BA 1BBYA 3IWZA 5FFXA 2LF8A 3F8CA 2DPUA 2ISYA 2P4WA 3SZTA 5FO5A 2MH9A 3C18A 1ZHFA 3ABUA 2M5WA 1UHWA 1YLFA 1KU7A 2HKXA 3BOQA 3U2RA 4AIKA 1YW8A 1ZRCA 4PDKA 4P5OA 3EETA 5JFRA 1G3WA 1QNTA 4DNCA 3AAFA 2VOPA 2UXNA 4G7HF 3RYPA 1R5HA 3VODA 1Z05A 1H9GA 1USTA 2ACJA 2STTA 2W25A 2RV8A 2PG4A 1DDNA 4MTEA 4N9IA 4HOBA 1RNLA 3LA2A 5K5OA 2ESHA 2G7HA 2XAJA 1BJAA 4JQFA 5LHIA 2DAOA 1O3QA 3R6SA 2K4BA 1SD7A 4I09A 3E5UA 4TV7A 3L2CA 2TDXA 3I71A 2ZXJA 4I98B 4ENKA 4A0ZA 2O0YA 4L9TA 2PQ8A 2CO5A 2VT2A 2F5CA 1KQ8A 3HRTA 3FXQA 3LWFA 2L4AA 4QWQA 3U1DA 3E5XA 2HTJA 2CW0F 3K1NA 1YG2A 1HKTA 4HV6A 1OYWA 3IC7A 4IRIA 1Z6TA 5L3DA 3GXOA 1K7AA 3FZVA 1F9NA 3V8LA 3KEOA 1BN5A 1K78B 1W4MA 2EFQA 3ZPLA 5L3FA 2O61A 2DFIA 2IJLA 3WE2A 2ELHA 3ZN1A 3T1BA 4XSXF 4LG0B 3WTZA 3IHUA 2OBPA 5ICFA 4P9UA 2ZBKA 1GVJA 1OKRA 3DQVC 2AXLA 1R00A 4ZYEA 3KFWX 2HQRA 4FHTA 1FOKA 1FSHA 1LVAA 2UWMA 2DQLA 1MDMA 5E20A 2W84A 1C0WA 1V3FA 2FA5A 1U3EM 1J0RA 4HV5A 1MKMA 2QQAA 3WTUC 3V7RA 2D1VA 1OYYA 3ZMSA 1G6NA 4AD9A 3RKXA 4RB2C 3ZMTA 1XGSA 2CSOA 2M87A 4UNOA 2GXBA 3C3WA 5FGMA 2JZYA 4LB5A 2M30A 2RC4A 1T98A 5LLQA 1ZRFA 4HDUA 3RI4A 2O3FA 2HEOA 3P9KA 1O57A 1S29A 5L3GA 2IP2A 2EK5A 4E70A 5CJ9A 4G9YA 4UXNA 1G3YA 1F5TA 4M9ZA 3HOTA 4EM1A 1IRGA 2VBZA 5CVJA 5ICGA 3B73A 1SFUA 3VFZA 4ESJA 4LLLA 1FYMA 5HS8A 3CO6C 4HX8A 3DF8A 2QQBA 4HW0A 4EJVA 1CF7A 4LLGF 1XSVA 2MLKA 3KP4A 2XVCA 1B59A 2ZMEB 2KIUA 1OYIA 1U6GA 1WSUA 4HLYA 3LAJA 1BC7C 3RJPA 5HLHA 1FP1D 1G4DA 1EH7A 1TQIA 1IRFA 2V1UA 2H6CA 3F3XA 1L0OC 4HX4A 2HYGD 4KNYA 1LJ9A 1O3TA 3QP6A 1V4RA 2QM3A 3HRUA 1BI3A 3WE3A 1WRJA 4MQVA 1YIOA 2KKOA 1W7PB 2YPRA 2LDUA 2FXAA 5L3BA 4ON0A 5EEGA 2K02A 3HHGA 1J7KA 2K7LA 5LEKA 3ELKA 4M73A 4HQMA 1Q1HA 2ZFWA 5ILUA 4R8HA 2G7UA 4NHJA 4Z2YA 1FZPB 4MQ9F 2P7CB 2Q8KA 4M72A 3TO9A 4KIBA 3I59B 3ECOA 5AONA 3QP5A 1BOAA 4Q5SF 5DYMA 3F22A 4AIJA 2D2WA 2O6GE 1HW1A 1LQ1A 1K6OA 4UV9A 2W85A 4KFCA 2OZ6A 4EQQA 3EDPA 1IN5A 4KN7X 3ML6A 1FY7A 4G6DA 2IVMA 3R61A 1MGTA 3IKVA 2RQPA 3SZPA 3BJOA 4I0AA 1QBJA 1GXPA 3N4MA 2FMYA 3E6CC 3I58A 5CYVA 3KE2A 1Y0UA 3CUOA 3K0LA 5EEHA 2COMA 3V8JA 4A6DA 1YW9A 3HHHA 4EM0B 1XSXA 3JSPA 1YFHA 3ZMUA 3OV8A 5D5UB 3L7WA 3HIFA 1KU2A 3K9TA 3D5LA 2NS0A 3ZP5A 4I01A 3I64A 4B8XA 1R23A 3F8FA 2V1DA 2FRHA 3TKYA 3WTSC 2YR2A 4IHTA 4LJZF 2PBIA 3WGIA 1G3TA 3KLOA 1TLHB 2QVOA 4IRHA 4N9HA 2C6YA 2XROA 5HS9A 2P6TA 4I02A 2EJRA 3DPTA 2YSRA 2DT5A 4YFNF 5ICEA 1O3RA 1HSJA 3RTRA 4JBAA 2XV4S 3LQQA 2LSOA 5F6FA 3EUHA 1FT9A 2EV6A 3KP2A 3MZHA 1LDDA 1H0MA 3GZ5A 5E17F 2KRFA 1TNSA 4GO1A 4HQEA 2IPQX 2UZKA 4KDPA 3GFJA 2PI0A 1EH6A 3M8FA 5IT9K 2DTRA 1LDJA 2OZUA 2CFXA 1CGPA 1S3JA 2KIMA 4UUVA 2K27A 1JE8A 4I2OA 4AIHA 2HGCA 3WODF 5AIQA 1UHMA 3R4KA 4OU0A 4M74A 1JXSA 1I1SA 2PLYA 3BPXA 1Z91A 2FSWA 5HLGA 4ENJA 1SMYF 5F1RA 2Z5UA 5IT3A 1TW3A 4IRGA 1Z6RA 2RGVA 1R1UA 1FX7A 1HSTA 3WTYC 1TTYA 2HR3A 3HRSA 1I27A 4WWCA 2EFNA 1DUXC 4ZYHA 5H6RA 2Z99A 3BWGA 3RYRA 3EYYA 1YYVA 4NQWA 4XBFA 1R36A 4U0YA 1ONVA 5DCMA 1PDNC 1EV7A 4KUMA 5BPIA 2FNAA 4CDGA 2RDPA 2OU2A 3T8TA 1YO5C 4UVAA 3SQNA 4DQ2A 3IKTA 1DPRA 4BNCA 1ON2A 1AOYA 3ISPA 4CYDA 2RKHA 1ZREA 5LRRA 5D4SA 1P4XA 2PEXA 3NEUA 2JPCA 1RI7A 4A2UA 2L02A 3KETA 2GIVA 2Z3YA 3LQRA 3ECHA 4LD5A 2W24A 4HLXA 3T0YA 4M9SA 1JHFA 3MAJA 1YS6A 4L9JA 3J7AO 2HDCA 4YFXF 2CG4A 3E5QA 5IT9Z 1F1ZA 3E3VA 2FE3A 2VC1A 2V79A 6PAXA 4YIIA 2XUBA 3HTUA 4ZYDA 2ZNYA 3GO5A 1ZLJA 2FBKA 2QENA 2Y48A 5D8LB 2IT0A 1P4WA 5FD5A 1CF7B 1I5ZA 2NNNA 3F8MA 1KU3A 4I0BA 2CQKA 1HQCA 1P4AA 2J5PA 3RPUA 2EA2A 2KIFA 1BI2A 3QRFF 1RIOH 1H9TA 2ETHA 5LGNA 1BI0A 3O2PE 4LB6B 5JR3A 4RGXA 5H6QA 3G73A 3BJ6A 5HOOA 2LKPA 5ICCA 2X4HA 1MJBA 2DPDA 3R0AA 3CLOA 2LF7A 3QPTA 3ZMVA 3Q9VA 1HBXG 2F5EA 1JGSA 2DO7A 3TQNA 1WKMA 2P5LC 2QZ8A 2VBWA 1T6SA 5BMZA 2QQ9A 5DEQA 2EWNA 4OMZA 4ASNA 5K1YA 1QQIA 3C1DA 3WU1B 4R79A 2XAHA 2VOOA 1R22A 3K1MA 3W6JB 3JSOA 3GYHX 3FX3A 3K69A 1RZ4A 3NRVA 3O6BB 2IA2A 1B4AA 3HSEA 2VT3A 2MH2A 2HTSA 3TOBA 4A5NA 2VE9A 2V6CA 1B9MA 3FWEA 1QGPA 4EGYA 1KYWA 1FP2A 4CGZA 4YG2F 1IN7A 4ZYGA 4EJUA 1J9IA 4BXUA 3JTGA 4ESBA 4Q48A 4LMYA 5ERIA 1UFMA 3R0JA 3FXUA 2RNJA 4XLPF 2A68F 2F5DA 2YU3A 1XGNA 5HDGA 4L5JA 4PGHA 3T5XA 3QAHA 2J5OA 4EJOA 2F5FA 4M6YA 3L9FA 1XDSA 1BIAA 1IN4A 1Z7UA 2KJBA 2L54A 3ULQB 3BJAA 2XAGA 3JAMZ 4XRFA 1X3UA 4EJTA 5LRSA 1OMIA 4MTDA 4OOIA 1SD6A 2OD5A 1ZARA 2WC2A 1XD7A 4NB5A 1QZYA 2FU4A 2FQ3A 2FBHA 3P7NA 1XGOA 5LGTA 2HWVA 2V9VA 3HUGA 3K1PA 4LK1F 2NNYA 2JT1A 2OAZA 3JW4A 1U8RA 2D1HA 3FXRA 1O7FA 3TO6A 4LFUA 3KCCA 4U88A 2YX7A 3GUDA 4Y15A 3KZZA 4Y13A 3P9CA 1IUYA 2ZO4A 1IXSB 4KN4X 1XSDA 1Z1DA 1IZ1A 4GYIA 3IWFA 1MJAA 3BY6A 4IHSA 1T38A 5D8KB 1NHAA 2HQNA 2PJPA 3ERED 4G6QA 1B9NA 4FX0A 5BS6A 5D5XB 1LNWA 2BYVE 1HW5A 4RB1A 1ZGAA 5ED4A 4L0ZB 2AS5F 1R1TA 4KMUX 2XASA 3PQJA 2ZJ2A 4BQAA 2A6EF 5J8FA 1B1BA 3I53A 2VONA 3LA3A 2E1CA 3HRMA 4O6JA 1K78A 2X0LA 3JTHA 2MD5A 4HAMA 3GFMA 1KQ9A 1IAWA 4A6EA 4PCQA 1U78A 3I4PA 3MZYA 4LG0A 2VE8A 2VBYA 4AVPA 4K2EA 1I6XA 2VODA 3DXJF 3D0SA 2FOKA 1KGSA 3FMSA 3KP7A 2EFWA 1LEBA 1R1VA 3QOPA 2CYYA 2GQQA 5DD4A 2UXXA 2P5VA 4A0YA 3RKWA 3NQOA 3HTSB 2F2EA 1E17A 4G94A 4BHBA 3TGNA 2A69F 3TDZC 1PUEE 3CUQA 3ABTA 4S05A 1YS7A 2IW5A 2YX4A 2FBIA 3H92A 3F6OA 3F72A 4WF2A 2FEZA 4YIFA 1ZYRF 3V7SA 3CO7C 4G7ZF 4L9VA 3U9GA 4U7DA 3VOEA 3BPVA 2EV0A 1D3YA 4BYYA 2RVCA 3QU3A 2EFPA 4HBLA 2QLZA 2BEOA 5E8GA 2GWRA 5DV5A 4RGSA 1S7AA 2BV6A 1USSA 3QPHA 2FF4A 2E7XA 3RIRA 3BZ6A 5E1WA 3LFKA 4M6XA 4P9FA 4EM2A 1FBUA 5CVUA 1UCRA 3WU0A 3WGGA 3DP7A 3KLNA 3KP6A 4WCGA 3COAC 5ILVA 3GZ6A 1GHCA 2PMHA 1P2FA 4FX4A 1XB4A 1FWZA 1BI1A 4UVBA 1W5SA 2JPBA 5CVIA 5DCFA 5H20A 4ENNA 3J80Z 1SMTA 4RAYA 1RUNA 2ZMEA 1AWCA 3GWZA 2R7FA
chains in the Genus database with same CATH superfamily
2VKDA 3HSRA 3F6VA 5FLXK 2M1BA 2A61A 1OLTA 2W82A 1UB9A 2WAEA 1YX3A 2CWEA 2YUSA 3KYCB 3CMYA 1N77A 4RS8A 1JUPA 2E7WA 3A4CA 2CQNA 1QPMA 2XDVA 3FK6A 1PYVA 4M6VA 4HF0A 5K7FA 1WPKA 1E2XA 5KAFC 3A0BC 2WV0A 3QYBA 2JRTA 4JYKA 3ZQLA 4FETA 1UJ8A 1WGXA 3B02A 3LSRA 2R93J 1BA5A 1ZR2A 2B0LA 1FIAA 2HOAA 5D5WB 1LB2A 2B63J 3VYUB 1BIBA 2KJCA 3O8HA 1BL0A 3WHBA 3CLQA 1X4OA 1Z3YA 4HSTA 1X3WB 2XIGA 3MZ8A 3IH4A 1YX5A 2DK5A 1OR7A 2PN6A 2K5CA 3Q0UA 5IY5H 3B6CA 3CCVI 1XPXA 3CTAA 4XK4A 5GADJ 2M7AA 4A69C 1HW2A 1UG2A 3DV8A 5CVRA 2PMUA 3F8BA 4GXOA 1R58A 1T8IA 1RKTA 3DEEA 4Y3OA 3FISA 1VQ6I 4CICA 2EZIA 3FKIJ 1HKQA 1TW2A 1Y56A 4MHGA 3WHCA 3FMQA 3C7JA 3BR1A 4DZPA 3QQAA 1G8XA 1O7LA 4FQGA 2F6CA 1SFKA 2WY8Q 4L9NA 5FLMJ 4ESFA 2W57A 2HKOA 4HNUA 1SANA 3EYIA 3SXYA 2OF7A 4Q47A 5C4JJ 1XMKA 2CQ7A 4MGRA 1XTAA 5BNGA 2HXIA 3CQZJ 5DUIA 2X1DA 5D6FA 2M3AA 3J81Z 1T2KA 1POGA 1P6RA 4U0WA 2WTEA 1K79A 2JA2A 1MMNA 2R5ZB 3L1PA 2ICWG 4BUPA 4OIQF 5BQTA 4RGUA 1REPC 4QLCU 3HOSA 1D1BA 2DA7A 1ON1A 3E97A 3OOPA 3RDIA 1MJ9A 2A07F 3TDUC 1F43A 2EILH 1RETA 2EPFA 2NVXJ 2LFBA 5GAEJ 2QA4I 1KYZA 2MGQA 2VN2A 4G8XA 2GOMA 2DBBA 3BQYA 4NDLA 1ZR4A 5GTIC 3DPLC 1HKSA 1TQMA 2XKPA 2ZXHA 4UHTA 3GTGJ 2ESNA 1PUFB 3E6BA 2NVTJ 2V7FA 5LGUA 2JA7J 2M7BA 3K70C 4QTRA 4RB0A 3RQ4A 2H27A 2LBFA 5JI6A 2QKMB 3F23A 4FCYA 4BL0B 1GXQA 2XGEA 1FTTA 3EQLF 1MDMB 1W0TA 2BW3A 2KL4A 3S1NJ 4W97A 5B1AH 3QPSA 2BGCA 2Y9ZA 3BTLA 4LLNA 2BY2A 1I50J 1FNNA 1MNMC 3VDXA 2Y69H 2JA8J 4Y7NJ 2RAEA 1ETKA 3G6EI 3F0CA 3GFLA 1PVEA 3G3ZA 1FOWA 3LA7A 4F55A 4AWXB 4BEHB 5FLXZ 1PP8F 5IP7J 1YW7A 4EMSA 4PGGA 1IF1A 2NYXA 3GF2A 1HDPA 1TQPA 4GDFA 3IAS2 2NAZA 4JOMA 3VEPA 5FKNA 1SFEA 2E1NA 3CMMA 3MCZA 1B8IA 4BQQA 5D6EA 1K6YA 4BHCA 1N78A 4RM2A 1MD0A 2IA1A 1I1GA 3QU6A 4P96A 4H0EA 5HS7A 5KK1A 5FFZA 3KZYA 2AQFA 3GVAA 2HVSA 2DDAA 1IW7F 3I3LA 1IN6A 3I0TA 4UB6C 3OSFA 4ZDLA 4IQ4A 2VXZA 3CESA 1OJLA 1ETWA 5LBQA 2GXGA 2L3DA 3KP3A 1T08B 3MFKA 4EATA 2HU9A 1R7JA 1FOXA 2WWYA 2VJIA 2L2OA 4EJWA 2CRGA 4XRSA 4RDUA 1U5TA 5ILSA 4NBQA 3ZQ7A 3TO7A 1U9NA 4B09A 1ZG3A 4E7ZA 4ZZLA 1J5YA 4IVNA 1S6LA 2VC0A 4RAFA 2QBYA 2HZDA 3I5UA 2VB6A 3DEUA 3RQIA 4HF1A 3HUGB 3O3KA 2E1MC 1SAXA 4M9XA 3D5RC 5JHFA 1SD4A 4MNUA 2K9SA 5EGOA 2HVRA 2IRFG 2IS2A 3KEQA 5DM7F 3HYIA 2BY0A 1RRJA 2P6SA 2F5VA 1RR7A 4IHVA 2ID3A 2WB1N 3A0HC 4RMNA 1LKXA 3J7ZI 4FE4A 5BOXA 3GTJJ 2L7KA 3BROA 3JAMK 4HA8A 1XMAA 4CHUA 4G7OF 4KA4A 4BQOA 1X1CA 1XCBA 2M8GX 3QODA 4YELA 2STWA 1B6AA 4RM3A 4D9JA 3K7AJ 2DW4A 3FMRA 5C4XJ 4JX4A 5J6XA 2DI3A 4II2A 2XC7A 5E1ZB 4D5CA 2I8DA 1J75A 4D1QA 4XIDA 2XF7A 1BR2A 1A36A 2GA2A 3E6MA 2EV5A 2KQRA 3KEYA 2DA3A 1JT0A 3ASNH 3VYRB 2Z33A 4OINF 2GA1A 3ZQIA 5K5QA 2DMQA 1HF0A 2MLGA 1BW5A 4A3FJ 3F8NA 2DYRH 2ZSIB 3Q0WA 1WWXA 4UUTA 5TJJA 4U0VA 1E3OC 4CCMA 2TCTA 2IGKA 3M1EA 3SFZA 1S8NA 1TBXA 3HSFA 3BG3A 3H3UA 3RKYA 4AUXA 5LFAA 3BDDA 5LEJA 5IYBJ 3PFYA 2MBFA 1IDZA 4XLFA 3ZN0A 4WXDA 3WTXC 3T8RA 5KHDA 2OA4A 3G71I 4MEYF 2DK8A 3Q0VA 3FM5A 1JTXA 2HS5A 4HNTA 3BZKA 3OY9A 3NWTA 2XKOA 4N0BA 5C44J 2O7OA 2W00A 2I5UA 3ZQQA 5FRNA 4CXFA 2O5RA 4C3HJ 4A3JJ 1ZLKA 4I7HA 2P8TA 3CDHA 3CP2A 1D8KA 4KYWA 2IS4A 1UAAA 4XR6A 2H09A 2XGXA 2ELJA 1K61A 5J8CA 2L9NA 4V19K 2HZTA 3B6AA 1FBQA 3DBLB 2CS3A 5JLWA 4KT5C 4GYGA 5A2QK 2X85A 1HC8A 3IH3A 2LY2A 3A01B 4XLNF 2XSJC 4RGRA 1J2XA 2DA4A 2XAFA 3N97A 2COBA 4XQFA 2QWWA 1R5GA 3TOAA 1RC9A 2A5WA 2R3SA 4EV0A 3HJEA 1IGNA 2LP0A 4PJJA 1MSEC 3VB2A 2KDZA 2LR8A 3WG9A 4ETSA 1KZHA 4BAYA 2QYOA 4D7NA 1AA7A 2Y0SA 3BTIA 4UV8A 2GOXB 4L5IA 3H3VK 1YTYA 2M45A 5D5VB 3S16J 2DMNA 3FM3A 3CUQB 3S32A 4AYBA 2FNPA 2IBDA 4OAZA 4BGDA 2G0EA 2R7DA 3PQKA 4PFPA 2ZKZA 2XAQA 4OIPF 4IEJA 4DYCA 2LMDA 3M7GA 2ZC2A 5TRDA 1X1PA 1K4SA 1Y8RB 1ITYA 2RN7A 5AIPA 2QSFX 1K4TA 3M8EA 1LFPA 3CDLA 3KIOA 4KICA 1FIPA 4M3BA 1GDTA 5L3EA 3WGHA 2PFBA 2JUCA 5J4VA 4X1EA 4XRMA 1VQOI 3V7CA 5DUKA 3REOA 1TWHJ 2E71A 2EB7A 1VQ7I 1FC3A 4ZC3A 2HFHA 3MEXA 4JK1X 2DXIA 1FLIA 1BC8C 3FHZA 2OV7A 3S2WA 3LSMA 4UVCA 4ZTFA 1V54H 4ENMA 1FYLA 1D5VA 2FUG2 2XRNA 1UG0A 3CUQC 4IXAA 5KAIC 1T0FA 1X1AA 4HPQA 3HZJA 3TW6A 1MZBA 2A5YB 4XOPA 1D0XA 1EA3A 1UELB 3R60A 3LAPA 2HYFA 2ME6A 5K5RA 4NC6A 3UNGC 4PSXA 3PFIA 4IQJA 4PK4A 1L3LA 1MBGA 2MC3A 3E7LA 5IOYA 5DDGA 1KU9A 5DD8A 2E2HJ 5CPRB 4BHPA 1ZELA 3GW2A 5HDKA 1H88C 1MBFA 1S9HA 2RREA 3L2WA 4OIOF 3H9JA 1AKHB 4D0PA 4Q4ZF 4OIRF 1BR1A 2DODA 2DLLA 3M4OJ 2M34A 1XX5A 2QUFA 2E5ZA 1Y1VJ 2EFOA 3OL4A 3L00A 2MA3A 2IGMA 4BY7J 1FSEA 2Z9OA 3S3MA 2KDOA 1OCZH 1NG6A 3RZDJ 2XHKA 1RESA 4XMYA 2BE5F 1J59A 1Z21A 2Y0MA 4A3EJ 4DW6A 2BBYA 1TP4A 5CVVA 4BQNA 1DQUA 4A0XA 3Q5FA 1LDKB 5A2QZ 2R7TA 1ZG1A 3OMYA 3CCQI 2E2IJ 2LH9A 2K3PA 5J4YA 5DM6F 4B1RA 3H3ZA 3OYGA 4RAGA 3F21A 2DDBA 2VBXA 1Z9CA 3LSGA 1ZN2A 2E1OA 3P9IA 4EGZA 5HNHA 4HDVA 4N4NB 4WK8F 2ZJQF 2JA6J 4L18B 1FPQA 1BM9A 5HNFA 2ZMEC 1DU0A 1EF4A 5BPDA 4F92B 4JX6A 1W1WE 3DKWA 4Y33A 1G3SA 2P7VB 4CZZA 4F7ZA 4KMFA 3J80K 3Q9SA 1OPCA 2JTVA 3OOUA 1STZA 2L4MA 2Y30A 3MN2A 2DOEA 2DFEA 3FK7A 1R49A 3S3NA 2UUZA 2ECBA 5E18F 4IPAA 2K9QA 4UY8I 5KCMA 3OYEA 2X48A 2GLOA 5D4RA 2JMWA 2WAQA 3PNTA 2K9NA 2IA0A 3H0GJ 3MWMA 2R4GA 1ODDA 3FXLA 1MBEA 3W6KB 2A3SA 2X6OA 2NRAC 3MQ0A 1P92A 1I39A 1JUMA 3HGGA 4KIFA 5JHUA 1OR7C 1X2NA 3V4GA 1VFCA 3HDDA 3DLLF 2ZXWH 5M5WJ 1H8AC 1OQYA 1YI2I 4Z6YA 3RPQA 2ZNZA 2ISZA 3OWTA 1MMAA 3IRQA 3N05A 2VQCA 1YITI 3GX4X 2R5YA 3FF5A 5DCMB 1ZAOA 4F52A 5F0HA 1O3SA 3K6GA 3K2AA 1EH8A 1FMVA 3PM1A 2DU9A 3I54A 4XICA 2E36A 2Q2EA 4HYEA 3FXOA 1X58A 2O8XA 4YFKF 3HC7A 3PNYA 3C2HA 1QHHD 3ZMDA 1XDUA 3VWBA 4R1HA 2IXSA 3GTOJ 2BW3B 2ZCWA 4BH9A 3M9AA 5LHHA 2GAUA 4BJ6C 4B3XA 2A6HF 1ZG5A 2JSCA 3J81K 4A3BJ 1N25A 4HRIA 1SEUA 4L0YB 2OQGA 3RCOA 4M71A 3PIOF 1DPUA 3CJNA 5M3FJ 2KIQA 5LHGA 3JREA 4L5EA 1U2WA 1VQLI 2ZFUA 2XPWA 2M0MA 3V8KA 4CYCA 4B4CA 1XCVA 2P81A 4WX9A 4GCVA 1YIJI 1ACIA 4ZZDA 1B8IB 3WTWC 4I99C 1E0EA 3AL0B 4MEXF 1JHHA 5E8IA 1LFUP 4PFOA 1MIJA 3K4JA 3W2VA 3JRGA 1R5ID 2IGNA 3ROUA 3K2ZA 4XN0A 4A12A 4IJAA 1Y8QB 3DLAA 4O5VA 4X6AJ 3WTTC 4O3MA 1A04A 4S04A 1QO0D 3Q3SA 2V1XA 4PZJA 1MMSA 3SHFA 1WI9A 2Q0OA 4WXCA 1TZLA 1SD5A 1U5TB 4CSWA 2QBYB 3OL3A 2AO9A 1FEXA 3HGYA 4KT6A 2M8EA 2OQRA 3KP5A 2OPTA 4MO7A 2BZTA 3VSLA 1VQKI 1LE8B 1ETVA 3ZQGA 2L9RA 1D8JA 1SFXA 3AFHA 1IXCA 3MKYB 1KA8A 2GZWA 3GLXA 2P5KA 3AL0C 2FMLA 4ZH4F 5EJCA 4P55A 5FD6A 5EZGA 4RAZA 3CCMI 5HDNA 2K4JA 2Z16A 4MIMA 3FDYA 4HX7A 4Y17A 3E6DA 1WQ2A 3L2QA 1VNDA 1HXDA 5E1XA 5KVRA 4KIGA 1HA8A 3SEQA 1ZKGA 3OYMA 2VJ5A 1YQAA 2R7ZJ 2ZB9A 3AG4H 3LSKA 2ADUA 3GZNB 1U5TC 2CW7A 2QEXI 3DFGA 4WXHA 3JRHA 3L09A 1W7PA 2ECCA 2HOEA 3HKZN 1RUOA 5HLIA 2WA0A 2H8RA 3OYNA 3G2BA 4IF4A 2O03A 2Z2SB 3G1LA 3BP8A 4UUSA 4A5MA 1JKQC 4HF2A 1W5TA 2H6BA 1W7PD 1LEAA 2DT6A 3V42A 3HOYJ 3S2DJ 2KT0A 1TNTA 1IXRC 1XN7A 5FB2A 5M5XJ 2KLOA 3ZR8X 4E7HA 2EA4A 2JN6A 1KQ0A 2TRTA 1ZGJA 1IJWC 1FYKA 5H2FC 1ZH5A 3ZMZA 2LKSA 1YJWI 1ETYA 5E3OA 1T39A 1DP7P 1XG1A 5HVQC 4OMYA 1PP7U 3I59A 2CGPA 3GEZA 4IKFA 2K86A 4MFDA 4XSZF 2V9KA 3KZIC 2ZXIA 3I4MJ 3JCUC 4IZZA 1JI8A 2HDWA 3LSTA 3PNVA 5JVTA 2LNBA 4XLAA 1WI3A 5F64A 1F4KA 2L01A 4EVIA 1B72B 4FT8A 2HOTA 3TMOA 2LY1A 2X6XA 2D45A 1ULYA 5L3CA 2G9WA 1FBSA 1QA6A 4F93B 3GFIA 3IL2A 2DQRA 3CC7I 3CCRI 2BY1A 1S7OA 2DOAA 3WTVC 4CO8A 3M1CA 1OCCH 2H94A 2JA5J 2XB5A 4FTHA 4RB3C 2K85A 4BXXJ 5CLSA 5GTHC 1QZZA 1ZRDA 1IN8A 4BJ5C 3IRRA 1MNDA 2MYSA 4DYRA 1VTNC 1XGMA 4UB8C 1Q1VA 4CUGA 4HZFA 2PJRA 3HOVJ 2VKVA 4LK0F 5J40A 1X1BA 2Y75A 1R4MB 4GGGA 4LGWA 5FKMA 2Z1DA 4U7BA 1BBYA 2HPIA 3DTKA 3IWZA 3BR0A 5FFXA 1A31A 2F4MB 2LF8A 4LG3A 3F8CA 1G2HA 2KRCA 2XRLA 2DPUA 3H9GA 2FX0A 3EPZA 2BY3A 2LOOA 2ISYA 2P4WA 1GT0C 3ABLH 3SZTA 2P0WA 4MFEA 1X4PA 5FO5A 2E1MB 2X6YA 2MH9A 3C18A 1ZHFA 1WJ5A 2BXYA 3ABUA 2M5WA 4ZYAA 3ZQHA 2NOJB 3OS0A 1UHWA 1YLFA 2FQ4A 3FXMA 2HKXA 5F0FA 3BOQA 1KU7A 3M07A 3U2RA 3OR2C 1ETXA 3RSNA 9ANTA 4AIKA 1YW8A 1ZRCA 3K4LA 5B1BH 1K83J 4XOTA 2VQLA 2W4SA 4PDKA 4P5OA 4LIVA 4CCKA 2LC2A 3TP3A 4NUBA 1I6HJ 3EETA 1ETQA 1HOMA 5JFRA 3BG7A 5EG0A 5FRMA 1G3WA 1QNTA 3L2UA 2EINH 4DNCA 3AAFA 2VOPA 2UXNA 4G7HF 4ITVA 3RYPA 1R5HA 2LRDA 2EIMH 1VQPI 1HLVA 4PJMA 3VODA 4BBSJ 4IX7A 1Z05A 1H9GA 1USTA 2ACJA 5E3MA 2STTA 2W25A 3S8PA 3BTJA 2RV8A 2JK3A 2PG4A 3HPHA 4MTEA 2WB1A 4XKBA 1DDNA 2HVQA 4N9IA 4HOBA 2WY7Q 1RNLA 3LA2A 5K5OA 4X0GA 2LG4A 1D1AA 2ESHA 3GTMJ 2G7HA 3OS1A 2XAJA 2E34A 2VQGA 4AM3A 1TWGJ 1BJAA 2VJ4A 3H1CA 2LTPA 1A6IA 4JQFA 3EUKL 5LHIA 3A03A 1MBKA 2X51A 2DAOA 4AU7A 1O3QA 1TWAJ 3R6SA 2K4BA 1ENHA 2PMZA 2CJJA 1SD7A 2LY9A 4I09A 3E5UA 4TV7A 4FISA 2TDXA 3L2CA 3I71A 1IUFA 4LIUA 2ZXJA 4I98B 4ENKA 2EIKH 1T0FC 4A0ZA 2O0YA 3S1QJ 4L9TA 3W2WA 4XORA 1NK3P 2D5VA 2PQ8A 2CO5A 2VT2A 1X3ZB 4XLEA 2F5CA 2AXTC 3HRTA 3RPUD 3FXQA 4HEA2 5F1JA 3LWFA 1KQ8A 2L4AA 5B66C 4QWQA 3U1DA 3E5XA 5EEAA 3S3OA 1TWFJ 4Y4RA 5EZHA 3FXKA 5K7ZA 2HTJA 1BOBA 2WAFA 2CW0F 3K1NA 2ZJPF 1QZEA 1YG2A 1SVLA 1QU3A 1HKTA 4HV6A 1OYWA 3IC7A 3TP0A 5GAHJ 3AG1H 3S1MJ 4IRIA 2MSYA 3SEZA 1Z6TA 5L3DA 1Y39A 3GXOA 1K7AA 1JTYA 3FZVA 3A1YA 1JT6A 2DMUA 3OYIA 3FXJA 1F9NA 4ABZA 3H35A 3CMAI 3M8JA 3KEOA 3V8LA 1BN5A 1K78B 1VF9A 1W4MA 2EFQA 1OCPA 2V9PA 4V2GA 3ZPLA 5L3FA 2O61A 2WBMA 1D1CA 2DFIA 2IJLA 4XKWA 3WE2A 2CFOA 2ELHA 2KFDA 3T1BA 4XSXF 3BR2A 2B7EA 3ZN1A 3K70D 2O9LA 4LG0B 4A93J 5CQEA 1DP3A 3WTZA 5FLVA 1TL8A 3IHUA 3K4MA 2OBPA 3SDBA 5ICFA 4GRIA 1BR4A 2JQ7A 4P9UA 2ZBKA 1MBJA 3CCSI 1GVJA 1OKRA 3DQVC 5GP9A 4NC7A 2AXLA 1M1EB 1R00A 3OYKA 3BG5A 4ZYEA 1LPQA 3CCJI 3IH2A 1PUFA 3KFWX 1AHDP 2HQRA 3MKLA 4CH7A 1WCMJ 1OCOH 4FHTA 2DA2A 2KZVA 1FOKA 4E7JA 1FTZA 2QCOA 1FSHA 1LVAA 2O8KA 2UWMA 2DQLA 1MDMA 2HQAA 2F4OB 5E20A 4IO9F 2W84A 4C2TA 3OYBA 1TT0A 1C0WA 3UKGA 1V3FA 5J47A 4U87A 1MH3A 2FA5A 3DKYA 1U3EM 1J0RA 4HV5A 2Q2EB 1MKMA 2QQAA 3DU5A 3WTUC 3V7RA 3JR9A 2HQ5A 2D1VA 1JJ6C 1OYYA 1GVDA 3ZMSA 1G6NA 1D5YA 4AD9A 3RKXA 2KPMA 4RB2C 1HDDC 1QRYA 3ZMTA 1XGSA 2RQQA 3OYCA 2CSOA 2M87A 4UNOA 3QYEA 1IRZA 2GXBA 3C3WA 2BHZA 2EZHA 2MD0A 5FGMA 2JZYA 4LB5A 2M30A 2RC4A 1T98A 4ZDOA 5LLQA 1ZRFA 2VJJA 4HDUA 3RI4A 2H1KA 2O3FA 2HEOA 2VASA 2QSHX 1QVTA 3P9KA 4I6ZA 1O57A 1S29A 2EBIA 5L3GA 3D1NI 2R7VA 2IP2A 4BU2A 4XLHA 1WHUA 2EK5A 4E70A 4CYCB 5CJ9A 4CCLA 1SAUA 2NXNB 2UV1A 4G9YA 2DA1A 4DOZA 4UXNA 1G3YA 2DA6A 1F5TA 4M9ZA 4QSHA 1YRNA 3HOTA 4EM1A 1IRGA 2MABA 2OCCH 2VBZA 5TISC 5CVJA 5ICGA 3B73A 1SFUA 3JRCA 3VFZA 4ESJA 2CUFA 4LLLA 1FYMA 5HS8A 3CO6C 4E4HA 4HX8A 1MNEA 3DF8A 3I4NJ 2QQBA 4HW0A 4AVZA 4EJVA 1CF7A 2E19A 1T95A 1MH4A 4DBRA 1T33A 3A02A 2GXAA 4LLGF 1JGGA 3MVPA 1XSVA 2MLKA 3KP4A 5LD2C 1WJAA 2XVCA 1B59A 3MMYB 3ZCOA 5FJ8J 2ZMEB 2KIUA 1OYIA 4N4OB 1U6GA 1WSUA 4HLYA 3LAJA 1ETOA 1BC7C 3RJPA 2VQHA 2GM4A 2XGDA 3H9QA 5HLHA 1FP1D 1G4DA 1EH7A 2IAIA 1TQIA 4DJAA 3I55I 4B43A 4IOAF 1IRFA 3IUOA 2V1UA 2H6CA 3F3XA 4C30A 1V5EA 4NNJA 4XONA 1L0OC 4HX4A 2HYGD 3PUFA 4KNYA 5IYDJ 2KISA 1UZCA 2R92J 1LJ9A 2LLKA 1O3TA 3ONQA 3QP6A 1YE9A 4W1UA 1V4RA 2DCEA 2QM3A 2JVGA 3BR6A 2CMPA 3HRUA 5FKOA 1BI3A 1I3QJ 4A3KJ 3WE3A 3OYDA 1WRJA 2GIZA 1NG7A 4MQVA 3LNQA 1YIOA 3BC8A 4GFBA 2KKOA 5M3MJ 4RLFA 2V6EA 1Z77A 2N8GA 3ZXSA 4BS9A 1P9QC 1W7PB 3CCLI 1U8BA 1AU7A 2YPRA 2LDUA 1Z7LA 2FXAA 2DN0A 3ASOH 3LSPA 5L3BA 4ON0A 1FJLA 5EEGA 4UUSB 2K02A 3HHGA 1J7KA 4YIRX 1DU6A 2K7LA 5LEKA 3ELKA 4BJTA 4M73A 4HQMA 1Q1HA 5IOZA 3QWLA 2ZFWA 5ILUA 4R8HA 2G7UA 1W5CC 3CCUI 2QSGX 4Z2YA 2LREA 1FZPB 2LYCA 4BDZA 4NHJA 4MQ9F 1NH3A 2P7CB 2FD5A 2R7SA 2Q8KA 4XLCA 4M72A 3TO9A 3GLLA 2L7ZA 3I59B 3LSIA 4KIBA 1ZGWA 3ECOA 4PJNA 5AONA 3QP5A 1BOAA 4Q5SF 5DYMA 3F22A 4AIJA 3NARA 2DOFA 2D2WA 2O6GE 1HW1A 1W0UA 1LQ1A 2XB0X 3W3CA 1Z0XA 1K6OA 3BQZA 4UV9A 2W85A 2M9HA 4KFCA 2XPUA 3L2RA 2DFHA 2OZ6A 4EQQA 3EDPA 1IN5A 4KN7X 3ML6A 1IV8A 3ZQFA 2NVQJ 3A01A 1FY7A 1WJEA 4G6DA 1WJDA 2KZGA 1OISA 2IVMA 2MG4A 3R61A 1MMGA 2M0CA 2CUEA 2DMTA 1MGTA 3IKVA 4A3IJ 2RQPA 3SZPA 3CDIA 1GLNA 3BJOA 4I0AA 1QBJA 1RKWA 3C2GA 1GXPA 3N4MA 2CW8A 1XS9A 4II3A 3PSFA 2K3FA 2FMYA 3E6CC 3I58A 3S2HJ 2LBFB 2DA5A 5CYVA 3KE2A 1Y0UA 2W48A 3TL4X 3CUOA 2KMUA 3GBGA 3BTCA 3K0LA 1VQ8I 1LFBA 5EEHA 4BBRJ 4BE2A 3S15J 4C3IJ 3DKXA 2COMA 3V8JA 1TC3C 4A6DA 1YW9A 2A05A 3HHHA 5FROA 2ID6A 4EM0B 2FOWA 1XSXA 2X6WA 3PO2J 5C3EJ 3JSPA 1YFHA 5IP6A 3P5JA 3ZMUA 3OV8A 4FE7A 2MW8A 5D5UB 2ELKA 3L7WA 1ZTRA 3HIFA 3HOZJ 3EUAA 3AG2H 3OR1C 1KU2A 1JUSA 3K9TA 5KNLA 1V55H 3BCBA 3D5LA 3TBIA 2NS0A 3ZP5A 1V5GA 4I01A 2CUJA 3S14J 2YU9J 3SYTA 2AHQA 3CJRB 1DGRM 2BHYA 3I64A 4B8XA 3M3YJ 1R23A 3S1RJ 1VQ9I 3F8FA 1SVMA 2V1DA 1S5LC 1NTCA 4HSRA 2FRHA 5B5EC 3TKYA 3WTSC 2YR2A 4IHTA 4LJZF 3OS2A 2PBIA 1WZ2A 3WGIA 1G3TA 3KLOA 1TLHB 2QVOA 5EG0B 4XRSG 3G1OA 1QPIA 4IRHA 4N9HA 2C6YA 1A5JA 2XROA 3NWSA 5HS9A 2JUGA 3HOWJ 2CV2A 3L2VA 5EGOB 3E1SA 1VQ4I 2P6TA 1UMQA 1AKHA 4I02A 4B48A 2EJRA 1S72I 2ZJRF 1G59A 3DPTA 2VIXA 2YSRA 2CQXA 4XKCA 2DT5A 3WU2C 3QPLA 1Y0NA 3HOXJ 4YFNF 1Z67A 3JRBA 5ICEA 1O3RA 2VPLA 1HSJA 3BZCA 3HKZA 3RTRA 4JBAA 2XV4S 3PIPF 3LQQA 1Z3XA 4IOCF 2LSOA 5F6FA 3EUHA 1FT9A 2EV6A 3KP2A 3VPRA 3MZHA 4XNFA 1LDDA 4CCOA 3K4NA 4B44A 1H0MA 1OCTC 3GZ5A 5E17F 3W2AA 2KRFA 1TNSA 2YS9A 4GO1A 3H5NA 1CQTA 3AKZA 4QPQA 2BXZA 4HQEA 2IPQX 2FJ1A 1GV5A 4KITB 2UZKA 3QYFA 4KDPA 1T56A 3GFJA 1EH6A 3M8FA 1JKRC 2PI0A 5J1UA 5IT9K 3CC2I 2QF7A 2CH0A 3OIOA 2DTRA 1LDJA 2OZUA 3OYLA 2HI3A 2CFXA 3SFIA 1CGPA 1S3JA 2KIMA 3KYDB 4UUVA 5IYCJ 4QIWN 3K10A 1VQ5I 3CJQB 2K27A 1D0ZA 5DTDA 1JE8A 2VUMJ 4I2OA 4AIHA 3BG9A 2HGCA 1E3HA 2K9MA 4IL6C 2AQEA 3WODF 3OIPA 1W36D 2K40A 5AIQA 1UHMA 3R4KA 4OU0A 4DGWB 4M74A 1JXSA 1I1SA 2PLYA 3HPGA 3BPXA 1SVOA 1Z91A 2FSWA 3LFUA 5HLGA 4ENJA 3ABKH 3PO3J 1SMYF 5F1RA 2Z5UA 5IT3A 1OCRH 5DS9A 4IHXA 1TW3A 2R7OA 3I56I 3CP8A 4IRGA 1JKOC 1Z6RA 2RGVA 1R1UA 1FX7A 1HSTA 3WTYC 4ANJA 1TTYA 2HR3A 3W6VA 3HRSA 3KX2A 1I27A 1WJCA 2EFNA 4WWCA 1IO2A 3IV5A 1DUXC 4ZYHA 5H6RA 2Z99A 3BWGA 1MW7A 3RYRA 3EYYA 1YYVA 4NQWA 5TGTA 4XBFA 3GTKJ 4A3GJ 4PSWA 1R36A 2L5QA 4DBQA 4U0YA 2DJIA 4XN3A 3TW7A 1ONVA 5DCMA 1PDNC 1EV7A 3OIQA 4KUMA 5BPIA 2IEKA 2FNAA 4CDGA 2RDPA 2OU2A 2CU7A 4MLOA 4P1WA 3T8TA 1YO5C 4UVAA 3SQNA 4DQ2A 1XMXA 3KYLA 3IKTA 1DPRA 3PL8A 1JJ8C 4BNCA 1ON2A 2LK2A 3K4CA 1AOYA 3ISPA 4CYDA 2RKHA 1ZREA 2HPMA 3VYSB 5LRRA 5D4SA 1P4XA 2PEXA 3NEUA 2KHMA 2DTZA 2JPCA 3MKWB 2R0QC 1RI7A 2IGOA 4A2UA 1YJNI 1U9OA 5CKTA 2L02A 4H4KC 1E3PA 3KETA 2GIVA 2Z3YA 3LQRA 3ECHA 4LD5A 2EIJH 2W24A 3C2BA 3A2KA 2E60A 3G1MA 3DWLE 4A3DJ 4RLQA 1A6QA 4HLXA 3F9KA 3T0YA 1X1DA 1LVKA 2ZSHB 1WJBA 4M9SA 1JHFA 1UHSA 4BE1A 4J19A 4CCNA 3G4SI 3MAJA 1YS6A 2XF6A 4I76A 4L9JA 3GTLJ 2LD5A 2LVSA 3J7AO 2HDCA 4A3MJ 4YFXF 2CG4A 3E5QA 4D5FA 1GUUA 4F91B 5EF6A 1DGWY 5IT9Z 3CZ6A 1F1ZA 3CD6I 3E3VA 2FE3A 3HBLA 1Y1WJ 2VC1A 4KJZA 2V79A 6PAXA 1ERDA 4YIIA 2XUBA 2JRMA 1TWCJ 4DZJA 3CF5F 2OCEA 4EEFG 3HTUA 4ZYDA 1YJ9I 2ZNYA 1LUJB 2XGCA 3GO5A 1YRNB 2VKHA 2R7XA 1ZLJA 2FBKA 2JWTA 2L7MP 2QENA 2Y48A 3VYTB 3DTEA 5D8LB 2EZLA 4RBOA 1LE8A 2IT0A 1P4WA 3MD2A 2H8WA 5FD5A 1CF7B 3ERMA 1I5ZA 2NNNA 3F8MA 1KU3A 3DCFA 1WFXA 2CQKA 1HQCA 1P4AA 4I0BA 1A35A 4IHWA 1D0YA 2J5PA 3RPUA 2DFFA 2EA2A 5CQGA 4A3CJ 2KIFA 1BI2A 4QPOA 3QRFF 1RIOH 1H9TA 2ETHA 5E3NA 5LGNA 1BI0A 3J7AY 3O2PE 3H5RA 4LB6B 5JR3A 4RGXA 5H6QA 3MKZA 2L0KA 3SDGA 4C2UA 3G73A 5IPAA 1IG7A 3BJ6A 4E6KG 3GTQJ 5HOOA 2X9DA 2LKPA 5J3LA 3LMMA 5ICCA 2X4HA 1MJBA 2DPDA 1YHQI 3R0AA 1FOYA 3CLOA 3S93A 2IS6A 2LF7A 3BR3A 2Y2ZA 4M3FA 3QPTA 2PMZN 3ZMVA 4RA2A 3H5AA 3Q9VA 1HBXG 3BR5A 5F0CA 1WH7A 4A3LJ 2F5EA 1JGSA 5HLTA 2DO7A 4JX5A 3TQNA 2OTLI 1WKMA 2P5LC 2QZ8A 2VBWA 1T6SA 5BMZA 3BCAA 1X19A 2QQ9A 3FIWA 3WG7H 2F48A 3DBRB 5DEQA 2EWNA 4E7LA 2CUZA 4OMZA 3H36A 4ASNA 2GBYA 4ZJZA 1EJ9A 5K1YA 1QQIA 2L7FP 3C1DA 3WU1B 1P7IA 2EZKA 3ZQCA 2CV1A 4R79A 2VLAA 2Y9YA 4ZTJA 2R5ZA 2E2JJ 2XAHA 5JLXA 2VOOA 1R22A 3K1MA 3W6JB 1J09A 3JSOA 3FX3A 3GYHX 2HYJA 2B9SA 1B72A 3K69A 1RZ4A 3NRVA 3O6BB 2IA2A 3LL7A 1WVRA 3DBHB 1B4AA 1RPWA 3HSEA 5K7HA 2VT3A 2MH2A 2HTSA 3TOBA 3U1KA 1PJRA 4A5NA 2K9LA 2MFZA 2E5NA 3ZGKA 2VE9A 2V6CA 1B9MA 3FWEA 1VQMI 1QGPA 4EGYA 1KYWA 1FP2A 4CGZA 4BKXA 4YG2F 1IN7A 4ZYGA 4EJUA 3ZOBA 1J9IA 3D5SC 4BXUA 2WADA 2VKEA 3KPHA 4ESBA 3JTGA 1TT5B 4Q48A 4LMYA 1R6RA 2R5YB 1U0JA 5GPCA 5ERIA 1UFMA 1H89C 3HB9A 3IAM2 3R0JA 3FXUA 2RNJA 4XLPF 4CZCA 2A68F 2F5DA 2YU3A 2OUMA 1XGNA 5HDGA 4L5JA 3BG6A 3S17J 2NVYJ 1XC5A 2JSPA 2X1EA 4PGHA 3TEDA 3T5XA 2XAUA 3QAHA 4BEHA 2J5OA 2E35A 4EJOA 2F5FA 4C9YA 4LITA 4M6YA 2X1CA 4BDYA 3UR3C 3L9FA 2QGUA 1XDSA 1BIAA 3OSGA 2LKXA 1IN4A 2Y0SN 1Z7UA 4M3DA 2KJBA 2BVMA 2L54A 4E7IA 3GMEA 3ULQB 3BJAA 4BE0A 2XAGA 5E79C 3JAMZ 4AYBN 4XRFA 1X3UA 3CJTB 2HXOA 3PSIA 5J1YA 3CCEI 3FKJA 4EJTA 1VZ0A 5LRSA 1OMIA 4MTDA 4OOIA 1SD6A 2OD5A 1ZARA 2WC2A 1XD7A 4NB5A 5GAGJ 1QZYA 2FU4A 2OTJI 2JVHA 2FQ3A 5F04A 2FBHA 3P7NA 3K4KA 1HCRA 1XGOA 3QOEA 5LGTA 4CA0A 1VI0A 2HWVA 2V9VA 4DIQA 2IS1A 4C2MJ 2VL8A 3FBNB 3HUGA 3K1PA 4LK1F 2VI6A 2R7RA 4J01A 2NNYA 4PUSA 2JT1A 2R7WA 4XM3A 1JKPC 2OAZA 4ZDPA 5EDNA 3HG9A 1QVUA 2W7NA 3JW4A 3OYHA 3AG3H 1U8RA 3K4BA 2D1HA 3CMEI 1NK2P 3FXRA 4BY1J 1QHGA 3GCMA 4F3QA 1N75A 1O7FA 3TO6A 4LFUA 3KCCA 4PJLA 4U88A 2YX7A 1X2MA 2CQQA 5EYRA 2NS7A 3GUDA 4Y15A 2DMPA 3KZZA 1IC8A 2BVLA 3P9CA 3HM5A 3U21A 4Y13A 1IUYA 2ZO4A 1IXSB 4KN4X 2V4JC 1XSDA 1Z1DA 1IZ1A 2NOGA 2Y31A 4G12A 4GYIA 3IWFA 1MJAA 3BY6A 4OAYA 4B47A 1T38A 4IHSA 3H0DA 3LSHA 1MSFC 5D8KB 1ZQ3P 4E7SA 1NHAA 3JRDA 2PX9A 4AIDA 2HQNA 2PJPA 4M3GA 3HOUJ 4CCJA 3ERED 4G6QA 1B9NA 5GPAA 4FX0A 5BS6A 3JRIA 2MC4A 2A6TA 2JJ7A 5D5XB 2NS8A 2L9SA 4IHYA 2L9VA 1LNWA 5FKLA 3OYAA 5JVGF 2NVUB 3CCYA 4C3JJ 5E3LA 2BYVE 1HW5A 4RB1A 1ZGAA 5ED4A 4L0ZB 2AS5F 1R1TA 4S0HB 4KMUX 2XASA 1BJZA 3SZGA 3ESWB 2ZJ2A 3PQJA 3ABMH 1KONA 2F4IA 2M4KA 3HL2A 4BQAA 2A6EF 4FASD 3BT9A 5J8FA 1B1BA 3I53A 2VONA 3PJRA 1I3AA 3LA3A 3NAUA 2EQRA 2Q1ZB 2E1CA 1V5FA 3HRMA 4NC8A 2OJED 4JP0A 2CV0A 3EUHC 4O6JA 1K78A 2X0LA 3ZRGA 3JTHA 2MD5A 4BACA 4LOCA 4XL9A 4HAMA 2HDDA 2M2EA 4HG2A 2XF5A 3GFMA 4PJ0C 1KQ9A 4M3EA 1IAWA 4A6EA 3JRFA 3SJMA 4PCQA 1U78A 3I4PA 4YRVA 2HOSA 4KISA 3MZYA 4LG0A 4DYQA 2VE8A 2VBYA 3BLYA 4AVPA 3X2QH 4K2EA 1I6XA 3RZOJ 2R7UA 2VODA 3DXJF 2V26A 1BW6A 3D0SA 2FOKA 1KGSA 3DU6A 1VQNI 1MBHA 5F08A 3FMSA 3KP7A 2EFWA 2WAQN 1SFOJ 1R1VA 1LEBA 3O8GA 2W1OA 3QOPA 2CYYA 2GQQA 1W36C 5DD4A 2UXXA 2P5VA 5FKKA 4A0YA 3RKWA 3NQOA 3HTSB 2XPVA 1APLC 2F2EA 2VXDA 3HEFA 1E17A 4G94A 1R4NB 5IP9J 4BHBA 2OC6A 3TGNA 3CC4I 2A69F 4NQWB 4XKVA 5HODA 3DTIA 2PJRB 3TDZC 3LSJA 3FBIB 3PUBA 1WJFA 1PUEE 3CUQA 3CF2A 3ABTA 4S05A 1YS7A 2IW5A 1R9TJ 2YX4A 2WV1A 2FBIA 2QQ8A 3H92A 3F6OA 1P7JA 4HNVA 3F72A 5J1RA 4WF2A 2XSDC 1Y6IA 2FEZA 3OYJA 3FHNA 4YIFA 3E0JB 1ZYRF 3V7SA 3CO7C 4V2FA 4G7ZF 4L9VA 3U9GA 5M5YJ 4U7DA 3VOEA 2ME0A 5B3SH 3BPVA 5F27A 2EV0A 1ZK8A 4OWRB 3J7YJ 3OYFA 1D3YA 4BYYA 1FMWA 1EKEA 2RVCA 1WH5A 3QU3A 1F36A 2EFPA 4HBLA 2V1NA 1O4XA 1IDYA 2KRHA 1SC7A 2DJNA 1RR8C 1IV6A 2QLZA 2HNHA 3JRAA 4Y52J 1MMDA 2BEOA 4G6TB 5E8GA 2GWRA 2R7QA 4B3AA 1S7EA 4AC0A 1OFCX 5DV5A 4RGSA 1S7AA 2BV6A 1USSA 3QPHA 2FF4A 2E7XA 3RIRA 3BZ6A 2KP6A 3LFKA 4M6XA 5E1WA 4P9FA 4EM2A 1FBUA 5CVUA 2M4GA 1UCRA 4YEJA 3WU0A 3RKQA 3GTPJ 3LOCA 3WGGA 2I10A 2VPRA 3DP7A 3KLNA 3KP6A 4BXFA 4WCGA 5ILVA 3COAC 3GZ6A 2H1LA 1GHCA 2PMHA 1P2FA 4FX4A 1XB4A 2RNGA 1FWZA 1BI1A 1IRXA 4UVBA 2EH3A 1YOVB 2DT7B 1W5SA 2JPBA 3I9V2 4D7MA 5CVIA 5DCFA 5H20A 4E7KA 4ENNA 4J00A 2DYSH 3J80Z 3HXLA 1SMTA 4RAYA 2QKLB 3IP4B 1RUNA 2ZMEA 2BOLA 3DPUA 1AWCA 3DEWA 3GWZA 1R71A 3VSKA 2R7FA 1ORKA 1GV2A
chains in the Genus database with same CATH topology
3HSRA 3F6VA 5FLXK 2M1BA 2A61A 1UB9A 2CWEA 4RS8A 2E7WA 1QPMA 4HF0A 1E2XA 2WV0A 2JRTA 3B02A 2B0LA 5D5WB 1LB2A 1BIBA 2KJCA 2XIGA 2DK5A 1OR7A 2PN6A 3CTAA 1HW2A 3DV8A 5CVRA 2PMUA 3F8BA 4GXOA 1R58A 4CICA 1HKQA 1TW2A 4MHGA 3FMQA 3C7JA 1O7LA 4L9NA 4ESFA 2W57A 2HKOA 3EYIA 3SXYA 4Q47A 1XMKA 4MGRA 5DUIA 5D6FA 3J81Z 1T2KA 1P6RA 4U0WA 2WTEA 1K79A 4OIQF 5BQTA 4RGUA 1REPC 4QLCU 3HOSA 1ON1A 3E97A 3OOPA 3RDIA 1MJ9A 2A07F 3TDUC 1KYZA 2VN2A 4G8XA 2DBBA 3DPLC 1HKSA 1TQMA 2XKPA 4UHTA 2ESNA 3E6BA 5LGUA 4RB0A 2H27A 5JI6A 3F23A 1GXQA 3EQLF 1MDMB 2BGCA 4LLNA 1FNNA 3GFLA 3G3ZA 3LA7A 4AWXB 5FLXZ 1PP8F 1YW7A 4EMSA 4PGGA 1IF1A 2NYXA 3GF2A 1TQPA 2NAZA 3VEPA 1SFEA 2E1NA 3MCZA 5D6EA 4BHCA 1MD0A 2IA1A 1I1GA 3QU6A 4P96A 4H0EA 5HS7A 5KK1A 5FFZA 3KZYA 3GVAA 1IW7F 1IN6A 3I0TA 2VXZA 5LBQA 2GXGA 2L3DA 3KP3A 3MFKA 1R7JA 2WWYA 4EJWA 1U5TA 5ILSA 3ZQ7A 4B09A 3TO7A 4ZZLA 1ZG3A 1J5YA 4IVNA 1S6LA 2VC0A 2QBYA 4HF1A 3I5UA 3DEUA 3O3KA 1SAXA 4M9XA 1SD4A 4MNUA 2IRFG 3KEQA 3HYIA 2P6SA 5BOXA 3BROA 3JAMK 4HA8A 1XMAA 4CHUA 4G7OF 4KA4A 1XCBA 2STWA 1B6AA 2DW4A 3FMRA 5J6XA 2DI3A 5E1ZB 1J75A 2GA2A 3E6MA 2EV5A 2Z33A 4OINF 2GA1A 5K5QA 2MLGA 3F8NA 1WWXA 5TJJA 4U0VA 3M1EA 3SFZA 1S8NA 1TBXA 3HSFA 3H3UA 3RKYA 3BDDA 5LEJA 2MBFA 3ZN0A 4WXDA 3WTXC 3T8RA 2OA4A 4MEYF 2DK8A 3FM5A 2HS5A 2XKOA 4N0BA 4CXFA 1ZLKA 4I7HA 2P8TA 3CDHA 1D8KA 4KYWA 2H09A 2XGXA 5J8CA 2HZTA 1FBQA 4KT5C 4GYGA 5A2QK 4XLNF 4RGRA 1J2XA 2XAFA 3N97A 2QWWA 1R5GA 3TOAA 2R3SA 4EV0A 3VB2A 3WG9A 4ETSA 4BAYA 2QYOA 4UV8A 4L5IA 1YTYA 2M45A 5D5VB 3FM3A 3CUQB 2FNPA 2R7DA 3PQKA 2ZKZA 2XAQA 4OIPF 3M7GA 5TRDA 2RN7A 5AIPA 3M8EA 4KICA 5L3EA 3WGHA 2PFBA 3V7CA 5DUKA 3REOA 2EB7A 1FC3A 2HFHA 3MEXA 4JK1X 1FLIA 1BC8C 3FHZA 3S2WA 4UVCA 4ENMA 1FYLA 1D5VA 2XRNA 3CUQC 4IXAA 1T0FA 1MZBA 2A5YB 3R60A 3LAPA 2HYFA 5K5RA 3PFIA 1L3LA 2MC3A 5DDGA 1KU9A 5DD8A 4BHPA 3GW2A 5HDKA 4OIOF 4D0PA 4Q4ZF 4OIRF 2DLLA 2QUFA 2EFOA 3L00A 2MA3A 1FSEA 2Z9OA 2XHKA 2BE5F 1J59A 2Y0MA 2BBYA 5CVVA 4A0XA 3Q5FA 1LDKB 5A2QZ 1ZG1A 3H3ZA 3F21A 2VBXA 1Z9CA 1ZN2A 3P9IA 4EGZA 4HDVA 4WK8F 4L18B 1FPQA 1BM9A 5BPDA 3DKWA 1G3SA 2P7VB 4CZZA 4F7ZA 4KMFA 3J80K 3Q9SA 1OPCA 2JTVA 1STZA 2L4MA 5E18F 4IPAA 5D4RA 2IA0A 3MWMA 1ODDA 3W6KB 2A3SA 2NRAC 3MQ0A 1P92A 4KIFA 5JHUA 3V4GA 3RPQA 2ZNZA 2ISZA 3IRQA 3GX4X 3FF5A 5DCMB 1ZAOA 1O3SA 1EH8A 2DU9A 3I54A 4HYEA 2Q2EA 2O8XA 4YFKF 3ZMDA 1XDUA 4R1HA 2ZCWA 4BH9A 3M9AA 5LHHA 2GAUA 2A6HF 1ZG5A 2JSCA 3J81K 4L0YB 2OQGA 4M71A 1DPUA 3CJNA 5LHGA 1U2WA 3V8KA 1XCVA 4WX9A 4GCVA 4ZZDA 3WTWC 4MEXF 1JHHA 5E8IA 3ROUA 3K2ZA 4A12A 4IJAA 4O5VA 3WTTC 4O3MA 1A04A 4S04A 1QO0D 2V1XA 4PZJA 3SHFA 1WI9A 2Q0OA 4WXCA 1SD5A 1U5TB 2QBYB 2M8EA 2OQRA 3KP5A 1D8JA 1SFXA 1IXCA 1KA8A 2GZWA 3GLXA 2P5KA 2FMLA 4ZH4F 4P55A 5FD6A 4RAZA 5HDNA 2K4JA 4HX7A 4Y17A 3E6DA 1WQ2A 1HXDA 5E1XA 5KVRA 4KIGA 1YQAA 2ADUA 1U5TC 3DFGA 4WXHA 3L09A 1W7PA 2HOEA 1RUOA 5HLIA 4IF4A 2O03A 3BP8A 4A5MA 4HF2A 1W5TA 2H6BA 1W7PD 1LEAA 1TNTA 1IXRC 1XN7A 5FB2A 2EA4A 1KQ0A 1ZGJA 1FYKA 1ZH5A 3ZMZA 1T39A 1DP7P 5HVQC 4OMYA 1PP7U 3I59A 2CGPA 3GEZA 2K86A 4XSZF 3LSTA 5JVTA 2LNBA 5F64A 1F4KA 2L01A 4EVIA 4FT8A 2D45A 1ULYA 5L3CA 2G9WA 1FBSA 3GFIA 3IL2A 2DQRA 1S7OA 3WTVC 4CO8A 2H94A 4RB3C 5CLSA 1QZZA 1ZRDA 1IN8A 3IRRA 1VTNC 1XGMA 4HZFA 4LK0F 2Y75A 4GGGA 4LGWA 4U7BA 1BBYA 3IWZA 5FFXA 2LF8A 3F8CA 2DPUA 2ISYA 2P4WA 3SZTA 5FO5A 2MH9A 3C18A 1ZHFA 3ABUA 2M5WA 1UHWA 1YLFA 1KU7A 2HKXA 3BOQA 3U2RA 4AIKA 1YW8A 1ZRCA 4PDKA 4P5OA 3EETA 5JFRA 1G3WA 1QNTA 4DNCA 3AAFA 2VOPA 2UXNA 4G7HF 3RYPA 1R5HA 3VODA 1Z05A 1H9GA 1USTA 2ACJA 2STTA 2W25A 2RV8A 2PG4A 1DDNA 4MTEA 4N9IA 4HOBA 1RNLA 3LA2A 5K5OA 2ESHA 2G7HA 2XAJA 1BJAA 4JQFA 5LHIA 2DAOA 1O3QA 3R6SA 2K4BA 1SD7A 4I09A 3E5UA 4TV7A 3L2CA 2TDXA 3I71A 2ZXJA 4I98B 4ENKA 4A0ZA 2O0YA 4L9TA 2PQ8A 2CO5A 2VT2A 2F5CA 1KQ8A 3HRTA 3FXQA 3LWFA 2L4AA 4QWQA 3U1DA 3E5XA 2HTJA 2CW0F 3K1NA 1YG2A 1HKTA 4HV6A 1OYWA 3IC7A 4IRIA 1Z6TA 5L3DA 3GXOA 1K7AA 3FZVA 1F9NA 3V8LA 3KEOA 1BN5A 1K78B 1W4MA 2EFQA 3ZPLA 5L3FA 2O61A 2DFIA 2IJLA 3WE2A 2ELHA 3ZN1A 3T1BA 4XSXF 4LG0B 3WTZA 3IHUA 2OBPA 5ICFA 4P9UA 2ZBKA 1GVJA 1OKRA 3DQVC 2AXLA 1R00A 4ZYEA 3KFWX 2HQRA 4FHTA 1FOKA 1FSHA 1LVAA 2UWMA 2DQLA 1MDMA 5E20A 2W84A 1C0WA 1V3FA 2FA5A 1U3EM 1J0RA 4HV5A 1MKMA 2QQAA 3WTUC 3V7RA 2D1VA 1OYYA 3ZMSA 1G6NA 4AD9A 3RKXA 4RB2C 3ZMTA 1XGSA 2CSOA 2M87A 4UNOA 2GXBA 3C3WA 5FGMA 2JZYA 4LB5A 2M30A 2RC4A 1T98A 5LLQA 1ZRFA 4HDUA 3RI4A 2O3FA 2HEOA 3P9KA 1O57A 1S29A 5L3GA 2IP2A 2EK5A 4E70A 5CJ9A 4G9YA 4UXNA 1G3YA 1F5TA 4M9ZA 3HOTA 4EM1A 1IRGA 2VBZA 5CVJA 5ICGA 3B73A 1SFUA 3VFZA 4ESJA 4LLLA 1FYMA 5HS8A 3CO6C 4HX8A 3DF8A 2QQBA 4HW0A 4EJVA 1CF7A 4LLGF 1XSVA 2MLKA 3KP4A 2XVCA 1B59A 2ZMEB 2KIUA 1OYIA 1U6GA 1WSUA 4HLYA 3LAJA 1BC7C 3RJPA 5HLHA 1FP1D 1G4DA 1EH7A 1TQIA 1IRFA 2V1UA 2H6CA 3F3XA 1L0OC 4HX4A 2HYGD 4KNYA 1LJ9A 1O3TA 3QP6A 1V4RA 2QM3A 3HRUA 1BI3A 3WE3A 1WRJA 4MQVA 1YIOA 2KKOA 1W7PB 2YPRA 2LDUA 2FXAA 5L3BA 4ON0A 5EEGA 2K02A 3HHGA 1J7KA 2K7LA 5LEKA 3ELKA 4M73A 4HQMA 1Q1HA 2ZFWA 5ILUA 4R8HA 2G7UA 4NHJA 4Z2YA 1FZPB 4MQ9F 2P7CB 2Q8KA 4M72A 3TO9A 4KIBA 3I59B 3ECOA 5AONA 3QP5A 1BOAA 4Q5SF 5DYMA 3F22A 4AIJA 2D2WA 2O6GE 1HW1A 1LQ1A 1K6OA 4UV9A 2W85A 4KFCA 2OZ6A 4EQQA 3EDPA 1IN5A 4KN7X 3ML6A 1FY7A 4G6DA 2IVMA 3R61A 1MGTA 3IKVA 2RQPA 3SZPA 3BJOA 4I0AA 1QBJA 1GXPA 3N4MA 2FMYA 3E6CC 3I58A 5CYVA 3KE2A 1Y0UA 3CUOA 3K0LA 5EEHA 2COMA 3V8JA 4A6DA 1YW9A 3HHHA 4EM0B 1XSXA 3JSPA 1YFHA 3ZMUA 3OV8A 5D5UB 3L7WA 3HIFA 1KU2A 3K9TA 3D5LA 2NS0A 3ZP5A 4I01A 3I64A 4B8XA 1R23A 3F8FA 2V1DA 2FRHA 3TKYA 3WTSC 2YR2A 4IHTA 4LJZF 2PBIA 3WGIA 1G3TA 3KLOA 1TLHB 2QVOA 4IRHA 4N9HA 2C6YA 2XROA 5HS9A 2P6TA 4I02A 2EJRA 3DPTA 2YSRA 2DT5A 4YFNF 5ICEA 1O3RA 1HSJA 3RTRA 4JBAA 2XV4S 3LQQA 2LSOA 5F6FA 3EUHA 1FT9A 2EV6A 3KP2A 3MZHA 1LDDA 1H0MA 3GZ5A 5E17F 2KRFA 1TNSA 4GO1A 4HQEA 2IPQX 2UZKA 4KDPA 3GFJA 2PI0A 1EH6A 3M8FA 5IT9K 2DTRA 1LDJA 2OZUA 2CFXA 1CGPA 1S3JA 2KIMA 4UUVA 2K27A 1JE8A 4I2OA 4AIHA 2HGCA 3WODF 5AIQA 1UHMA 3R4KA 4OU0A 4M74A 1JXSA 1I1SA 2PLYA 3BPXA 1Z91A 2FSWA 5HLGA 4ENJA 1SMYF 5F1RA 2Z5UA 5IT3A 1TW3A 4IRGA 1Z6RA 2RGVA 1R1UA 1FX7A 1HSTA 3WTYC 1TTYA 2HR3A 3HRSA 1I27A 4WWCA 2EFNA 1DUXC 4ZYHA 5H6RA 2Z99A 3BWGA 3RYRA 3EYYA 1YYVA 4NQWA 4XBFA 1R36A 4U0YA 1ONVA 5DCMA 1PDNC 1EV7A 4KUMA 5BPIA 2FNAA 4CDGA 2RDPA 2OU2A 3T8TA 1YO5C 4UVAA 3SQNA 4DQ2A 3IKTA 1DPRA 4BNCA 1ON2A 1AOYA 3ISPA 4CYDA 2RKHA 1ZREA 5LRRA 5D4SA 1P4XA 2PEXA 3NEUA 2JPCA 1RI7A 4A2UA 2L02A 3KETA 2GIVA 2Z3YA 3LQRA 3ECHA 4LD5A 2W24A 4HLXA 3T0YA 4M9SA 1JHFA 3MAJA 1YS6A 4L9JA 3J7AO 2HDCA 4YFXF 2CG4A 3E5QA 5IT9Z 1F1ZA 3E3VA 2FE3A 2VC1A 2V79A 6PAXA 4YIIA 2XUBA 3HTUA 4ZYDA 2ZNYA 3GO5A 1ZLJA 2FBKA 2QENA 2Y48A 5D8LB 2IT0A 1P4WA 5FD5A 1CF7B 1I5ZA 2NNNA 3F8MA 1KU3A 4I0BA 2CQKA 1HQCA 1P4AA 2J5PA 3RPUA 2EA2A 2KIFA 1BI2A 3QRFF 1RIOH 1H9TA 2ETHA 5LGNA 1BI0A 3O2PE 4LB6B 5JR3A 4RGXA 5H6QA 3G73A 3BJ6A 5HOOA 2LKPA 5ICCA 2X4HA 1MJBA 2DPDA 3R0AA 3CLOA 2LF7A 3QPTA 3ZMVA 3Q9VA 1HBXG 2F5EA 1JGSA 2DO7A 3TQNA 1WKMA 2P5LC 2QZ8A 2VBWA 1T6SA 5BMZA 2QQ9A 5DEQA 2EWNA 4OMZA 4ASNA 5K1YA 1QQIA 3C1DA 3WU1B 4R79A 2XAHA 2VOOA 1R22A 3K1MA 3W6JB 3JSOA 3GYHX 3FX3A 3K69A 1RZ4A 3NRVA 3O6BB 2IA2A 1B4AA 3HSEA 2VT3A 2MH2A 2HTSA 3TOBA 4A5NA 2VE9A 2V6CA 1B9MA 3FWEA 1QGPA 4EGYA 1KYWA 1FP2A 4CGZA 4YG2F 1IN7A 4ZYGA 4EJUA 1J9IA 4BXUA 3JTGA 4ESBA 4Q48A 4LMYA 5ERIA 1UFMA 3R0JA 3FXUA 2RNJA 4XLPF 2A68F 2F5DA 2YU3A 1XGNA 5HDGA 4L5JA 4PGHA 3T5XA 3QAHA 2J5OA 4EJOA 2F5FA 4M6YA 3L9FA 1XDSA 1BIAA 1IN4A 1Z7UA 2KJBA 2L54A 3ULQB 3BJAA 2XAGA 3JAMZ 4XRFA 1X3UA 4EJTA 5LRSA 1OMIA 4MTDA 4OOIA 1SD6A 2OD5A 1ZARA 2WC2A 1XD7A 4NB5A 1QZYA 2FU4A 2FQ3A 2FBHA 3P7NA 1XGOA 5LGTA 2HWVA 2V9VA 3HUGA 3K1PA 4LK1F 2NNYA 2JT1A 2OAZA 3JW4A 1U8RA 2D1HA 3FXRA 1O7FA 3TO6A 4LFUA 3KCCA 4U88A 2YX7A 3GUDA 4Y15A 3KZZA 4Y13A 3P9CA 1IUYA 2ZO4A 1IXSB 4KN4X 1XSDA 1Z1DA 1IZ1A 4GYIA 3IWFA 1MJAA 3BY6A 4IHSA 1T38A 5D8KB 1NHAA 2HQNA 2PJPA 3ERED 4G6QA 1B9NA 4FX0A 5BS6A 5D5XB 1LNWA 2BYVE 1HW5A 4RB1A 1ZGAA 5ED4A 4L0ZB 2AS5F 1R1TA 4KMUX 2XASA 3PQJA 2ZJ2A 4BQAA 2A6EF 5J8FA 1B1BA 3I53A 2VONA 3LA3A 2E1CA 3HRMA 4O6JA 1K78A 2X0LA 3JTHA 2MD5A 4HAMA 3GFMA 1KQ9A 1IAWA 4A6EA 4PCQA 1U78A 3I4PA 3MZYA 4LG0A 2VE8A 2VBYA 4AVPA 4K2EA 1I6XA 2VODA 3DXJF 3D0SA 2FOKA 1KGSA 3FMSA 3KP7A 2EFWA 1LEBA 1R1VA 3QOPA 2CYYA 2GQQA 5DD4A 2UXXA 2P5VA 4A0YA 3RKWA 3NQOA 3HTSB 2F2EA 1E17A 4G94A 4BHBA 3TGNA 2A69F 3TDZC 1PUEE 3CUQA 3ABTA 4S05A 1YS7A 2IW5A 2YX4A 2FBIA 3H92A 3F6OA 3F72A 4WF2A 2FEZA 4YIFA 1ZYRF 3V7SA 3CO7C 4G7ZF 4L9VA 3U9GA 4U7DA 3VOEA 3BPVA 2EV0A 1D3YA 4BYYA 2RVCA 3QU3A 2EFPA 4HBLA 2QLZA 2BEOA 5E8GA 2GWRA 5DV5A 4RGSA 1S7AA 2BV6A 1USSA 3QPHA 2FF4A 2E7XA 3RIRA 3BZ6A 5E1WA 3LFKA 4M6XA 4P9FA 4EM2A 1FBUA 5CVUA 1UCRA 3WU0A 3WGGA 3DP7A 3KLNA 3KP6A 4WCGA 3COAC 5ILVA 3GZ6A 1GHCA 2PMHA 1P2FA 4FX4A 1XB4A 1FWZA 1BI1A 4UVBA 1W5SA 2JPBA 5CVIA 5DCFA 5H20A 4ENNA 3J80Z 1SMTA 4RAYA 1RUNA 2ZMEA 1AWCA 3GWZA 2R7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSR A;  3F6V A;  5FLX K;  2M1B A;  2A61 A;  1UB9 A;  2CWE A;  4RS8 A;  2E7W A;  1QPM A;  4HF0 A;  1E2X A;  2WV0 A;  2JRT A;  3B02 A;  2B0L A;  5D5W B;  1LB2 A;  1BIB A;  2KJC A;  2XIG A;  2DK5 A;  1OR7 A;  2PN6 A;  3CTA A;  1HW2 A;  3DV8 A;  5CVR A;  2PMU A;  3F8B A;  4GXO A;  1R58 A;  4CIC A;  1HKQ A;  1TW2 A;  4MHG A;  3FMQ A;  3C7J A;  1O7L A;  4L9N A;  4ESF A;  2W57 A;  2HKO A;  3EYI A;  3SXY A;  4Q47 A;  1XMK A;  4MGR A;  5DUI A;  5D6F A;  3J81 Z;  1T2K A;  1P6R A;  4U0W A;  2WTE A;  1K79 A;  4OIQ F;  5BQT A;  4RGU A;  1REP C;  4QLC U;  3HOS A;  1ON1 A;  3E97 A;  3OOP A;  3RDI A;  1MJ9 A;  2A07 F;  3TDU C;  1KYZ A;  2VN2 A;  4G8X A;  2DBB A;  3DPL C;  1HKS A;  1TQM A;  2XKP A;  4UHT A;  2ESN A;  3E6B A;  5LGU A;  4RB0 A;  2H27 A;  5JI6 A;  3F23 A;  1GXQ A;  3EQL F;  1MDM B;  2BGC A;  4LLN A;  1FNN A;  3GFL A;  3G3Z A;  3LA7 A;  4AWX B;  5FLX Z;  1PP8 F;  1YW7 A;  4EMS A;  4PGG A;  1IF1 A;  2NYX A;  3GF2 A;  1TQP A;  2NAZ A;  3VEP A;  1SFE A;  2E1N A;  3MCZ A;  5D6E A;  4BHC A;  1MD0 A;  2IA1 A;  1I1G A;  3QU6 A;  4P96 A;  4H0E A;  5HS7 A;  5KK1 A;  5FFZ A;  3KZY A;  3GVA A;  1IW7 F;  1IN6 A;  3I0T A;  2VXZ A;  5LBQ A;  2GXG A;  2L3D A;  3KP3 A;  3MFK A;  1R7J A;  2WWY A;  4EJW A;  1U5T A;  5ILS A;  3ZQ7 A;  4B09 A;  3TO7 A;  4ZZL A;  1ZG3 A;  1J5Y A;  4IVN A;  1S6L A;  2VC0 A;  2QBY A;  4HF1 A;  3I5U A;  3DEU A;  3O3K A;  1SAX A;  4M9X A;  1SD4 A;  4MNU A;  2IRF G;  3KEQ A;  3HYI A;  2P6S A;  5BOX A;  3BRO A;  3JAM K;  4HA8 A;  1XMA A;  4CHU A;  4G7O F;  4KA4 A;  1XCB A;  2STW A;  1B6A A;  2DW4 A;  3FMR A;  5J6X A;  2DI3 A;  5E1Z B;  1J75 A;  2GA2 A;  3E6M A;  2EV5 A;  2Z33 A;  4OIN F;  2GA1 A;  5K5Q A;  2MLG A;  3F8N A;  1WWX A;  5TJJ A;  4U0V A;  3M1E A;  3SFZ A;  1S8N A;  1TBX A;  3HSF A;  3H3U A;  3RKY A;  3BDD A;  5LEJ A;  2MBF A;  3ZN0 A;  4WXD A;  3WTX C;  3T8R A;  2OA4 A;  4MEY F;  2DK8 A;  3FM5 A;  2HS5 A;  2XKO A;  4N0B A;  4CXF A;  1ZLK A;  4I7H A;  2P8T A;  3CDH A;  1D8K A;  4KYW A;  2H09 A;  2XGX A;  5J8C A;  2HZT A;  1FBQ A;  4KT5 C;  4GYG A;  5A2Q K;  4XLN F;  4RGR A;  1J2X A;  2XAF A;  3N97 A;  2QWW A;  1R5G A;  3TOA A;  2R3S A;  4EV0 A;  3VB2 A;  3WG9 A;  4ETS A;  4BAY A;  2QYO A;  4UV8 A;  4L5I A;  1YTY A;  2M45 A;  5D5V B;  3FM3 A;  3CUQ B;  2FNP A;  2R7D A;  3PQK A;  2ZKZ A;  2XAQ A;  4OIP F;  3M7G A;  5TRD A;  2RN7 A;  5AIP A;  3M8E A;  4KIC A;  5L3E A;  3WGH A;  2PFB A;  3V7C A;  5DUK A;  3REO A;  2EB7 A;  1FC3 A;  2HFH A;  3MEX A;  4JK1 X;  1FLI A;  1BC8 C;  3FHZ A;  3S2W A;  4UVC A;  4ENM A;  1FYL A;  1D5V A;  2XRN A;  3CUQ C;  4IXA A;  1T0F A;  1MZB A;  2A5Y B;  3R60 A;  3LAP A;  2HYF A;  5K5R A;  3PFI A;  1L3L A;  2MC3 A;  5DDG A;  1KU9 A;  5DD8 A;  4BHP A;  3GW2 A;  5HDK A;  4OIO F;  4D0P A;  4Q4Z F;  4OIR F;  2DLL A;  2QUF A;  2EFO A;  3L00 A;  2MA3 A;  1FSE A;  2Z9O A;  2XHK A;  2BE5 F;  1J59 A;  2Y0M A;  2BBY A;  5CVV A;  4A0X A;  3Q5F A;  1LDK B;  5A2Q Z;  1ZG1 A;  3H3Z A;  3F21 A;  2VBX A;  1Z9C A;  1ZN2 A;  3P9I A;  4EGZ A;  4HDV A;  4WK8 F;  4L18 B;  1FPQ A;  1BM9 A;  5BPD A;  3DKW A;  1G3S A;  2P7V B;  4CZZ A;  4F7Z A;  4KMF A;  3J80 K;  3Q9S A;  1OPC A;  2JTV A;  1STZ A;  2L4M A;  5E18 F;  4IPA A;  5D4R A;  2IA0 A;  3MWM A;  1ODD A;  3W6K B;  2A3S A;  2NRA C;  3MQ0 A;  1P92 A;  4KIF A;  5JHU A;  3V4G A;  3RPQ A;  2ZNZ A;  2ISZ A;  3IRQ A;  3GX4 X;  3FF5 A;  5DCM B;  1ZAO A;  1O3S A;  1EH8 A;  2DU9 A;  3I54 A;  4HYE A;  2Q2E A;  2O8X A;  4YFK F;  3ZMD A;  1XDU A;  4R1H A;  2ZCW A;  4BH9 A;  3M9A A;  5LHH A;  2GAU A;  2A6H F;  1ZG5 A;  2JSC A;  3J81 K;  4L0Y B;  2OQG A;  4M71 A;  1DPU A;  3CJN A;  5LHG A;  1U2W A;  3V8K A;  1XCV A;  4WX9 A;  4GCV A;  4ZZD A;  3WTW C;  4MEX F;  1JHH A;  5E8I A;  3ROU A;  3K2Z A;  4A12 A;  4IJA A;  4O5V A;  3WTT C;  4O3M A;  1A04 A;  4S04 A;  1QO0 D;  2V1X A;  4PZJ A;  3SHF A;  1WI9 A;  2Q0O A;  4WXC A;  1SD5 A;  1U5T B;  2QBY B;  2M8E A;  2OQR A;  3KP5 A;  1D8J A;  1SFX A;  1IXC A;  1KA8 A;  2GZW A;  3GLX A;  2P5K A;  2FML A;  4ZH4 F;  4P55 A;  5FD6 A;  4RAZ A;  5HDN A;  2K4J A;  4HX7 A;  4Y17 A;  3E6D A;  1WQ2 A;  1HXD A;  5E1X A;  5KVR A;  4KIG A;  1YQA A;  2ADU A;  1U5T C;  3DFG A;  4WXH A;  3L09 A;  1W7P A;  2HOE A;  1RUO A;  5HLI A;  4IF4 A;  2O03 A;  3BP8 A;  4A5M A;  4HF2 A;  1W5T A;  2H6B A;  1W7P D;  1LEA A;  1TNT A;  1IXR C;  1XN7 A;  5FB2 A;  2EA4 A;  1KQ0 A;  1ZGJ A;  1FYK A;  1ZH5 A;  3ZMZ A;  1T39 A;  1DP7 P;  5HVQ C;  4OMY A;  1PP7 U;  3I59 A;  2CGP A;  3GEZ A;  2K86 A;  4XSZ F;  3LST A;  5JVT A;  2LNB A;  5F64 A;  1F4K A;  2L01 A;  4EVI A;  4FT8 A;  2D45 A;  1ULY A;  5L3C A;  2G9W A;  1FBS A;  3GFI A;  3IL2 A;  2DQR A;  1S7O A;  3WTV C;  4CO8 A;  2H94 A;  4RB3 C;  5CLS A;  1QZZ A;  1ZRD A;  1IN8 A;  3IRR A;  1VTN C;  1XGM A;  4HZF A;  4LK0 F;  2Y75 A;  4GGG A;  4LGW A;  4U7B A;  1BBY A;  3IWZ A;  5FFX A;  2LF8 A;  3F8C A;  2DPU A;  2ISY A;  2P4W A;  3SZT A;  5FO5 A;  2MH9 A;  3C18 A;  1ZHF A;  3ABU A;  2M5W A;  1UHW A;  1YLF A;  1KU7 A;  2HKX A;  3BOQ A;  3U2R A;  4AIK A;  1YW8 A;  1ZRC A;  4PDK A;  4P5O A;  3EET A;  5JFR A;  1G3W A;  1QNT A;  4DNC A;  3AAF A;  2VOP A;  2UXN A;  4G7H F;  3RYP A;  1R5H A;  3VOD A;  1Z05 A;  1H9G A;  1UST A;  2ACJ A;  2STT A;  2W25 A;  2RV8 A;  2PG4 A;  1DDN A;  4MTE A;  4N9I A;  4HOB A;  1RNL A;  3LA2 A;  5K5O A;  2ESH A;  2G7H A;  2XAJ A;  1BJA A;  4JQF A;  5LHI A;  2DAO A;  1O3Q A;  3R6S A;  2K4B A;  1SD7 A;  4I09 A;  3E5U A;  4TV7 A;  3L2C A;  2TDX A;  3I71 A;  2ZXJ A;  4I98 B;  4ENK A;  4A0Z A;  2O0Y A;  4L9T A;  2PQ8 A;  2CO5 A;  2VT2 A;  2F5C A;  1KQ8 A;  3HRT A;  3FXQ A;  3LWF A;  2L4A A;  4QWQ A;  3U1D A;  3E5X A;  2HTJ A;  2CW0 F;  3K1N A;  1YG2 A;  1HKT A;  4HV6 A;  1OYW A;  3IC7 A;  4IRI A;  1Z6T A;  5L3D A;  3GXO A;  1K7A A;  3FZV A;  1F9N A;  3V8L A;  3KEO A;  1BN5 A;  1K78 B;  1W4M A;  2EFQ A;  3ZPL A;  5L3F A;  2O61 A;  2DFI A;  2IJL A;  3WE2 A;  2ELH A;  3ZN1 A;  3T1B A;  4XSX F;  4LG0 B;  3WTZ A;  3IHU A;  2OBP A;  5ICF A;  4P9U A;  2ZBK A;  1GVJ A;  1OKR A;  3DQV C;  2AXL A;  1R00 A;  4ZYE A;  3KFW X;  2HQR A;  4FHT A;  1FOK A;  1FSH A;  1LVA A;  2UWM A;  2DQL A;  1MDM A;  5E20 A;  2W84 A;  1C0W A;  1V3F A;  2FA5 A;  1U3E M;  1J0R A;  4HV5 A;  1MKM A;  2QQA A;  3WTU C;  3V7R A;  2D1V A;  1OYY A;  3ZMS A;  1G6N A;  4AD9 A;  3RKX A;  4RB2 C;  3ZMT A;  1XGS A;  2CSO A;  2M87 A;  4UNO A;  2GXB A;  3C3W A;  5FGM A;  2JZY A;  4LB5 A;  2M30 A;  2RC4 A;  1T98 A;  5LLQ A;  1ZRF A;  4HDU A;  3RI4 A;  2O3F A;  2HEO A;  3P9K A;  1O57 A;  1S29 A;  5L3G A;  2IP2 A;  2EK5 A;  4E70 A;  5CJ9 A;  4G9Y A;  4UXN A;  1G3Y A;  1F5T A;  4M9Z A;  3HOT A;  4EM1 A;  1IRG A;  2VBZ A;  5CVJ A;  5ICG A;  3B73 A;  1SFU A;  3VFZ A;  4ESJ A;  4LLL A;  1FYM A;  5HS8 A;  3CO6 C;  4HX8 A;  3DF8 A;  2QQB A;  4HW0 A;  4EJV A;  1CF7 A;  4LLG F;  1XSV A;  2MLK A;  3KP4 A;  2XVC A;  1B59 A;  2ZME B;  2KIU A;  1OYI A;  1U6G A;  1WSU A;  4HLY A;  3LAJ A;  1BC7 C;  3RJP A;  5HLH A;  1FP1 D;  1G4D A;  1EH7 A;  1TQI A;  1IRF A;  2V1U A;  2H6C A;  3F3X A;  1L0O C;  4HX4 A;  2HYG D;  4KNY A;  1LJ9 A;  1O3T A;  3QP6 A;  1V4R A;  2QM3 A;  3HRU A;  1BI3 A;  3WE3 A;  1WRJ A;  4MQV A;  1YIO A;  2KKO A;  1W7P B;  2YPR A;  2LDU A;  2FXA A;  5L3B A;  4ON0 A;  5EEG A;  2K02 A;  3HHG A;  1J7K A;  2K7L A;  5LEK A;  3ELK A;  4M73 A;  4HQM A;  1Q1H A;  2ZFW A;  5ILU A;  4R8H A;  2G7U A;  4NHJ A;  4Z2Y A;  1FZP B;  4MQ9 F;  2P7C B;  2Q8K A;  4M72 A;  3TO9 A;  4KIB A;  3I59 B;  3ECO A;  5AON A;  3QP5 A;  1BOA A;  4Q5S F;  5DYM A;  3F22 A;  4AIJ A;  2D2W A;  2O6G E;  1HW1 A;  1LQ1 A;  1K6O A;  4UV9 A;  2W85 A;  4KFC A;  2OZ6 A;  4EQQ A;  3EDP A;  1IN5 A;  4KN7 X;  3ML6 A;  1FY7 A;  4G6D A;  2IVM A;  3R61 A;  1MGT A;  3IKV A;  2RQP A;  3SZP A;  3BJO A;  4I0A A;  1QBJ A;  1GXP A;  3N4M A;  2FMY A;  3E6C C;  3I58 A;  5CYV A;  3KE2 A;  1Y0U A;  3CUO A;  3K0L A;  5EEH A;  2COM A;  3V8J A;  4A6D A;  1YW9 A;  3HHH A;  4EM0 B;  1XSX A;  3JSP A;  1YFH A;  3ZMU A;  3OV8 A;  5D5U B;  3L7W A;  3HIF A;  1KU2 A;  3K9T A;  3D5L A;  2NS0 A;  3ZP5 A;  4I01 A;  3I64 A;  4B8X A;  1R23 A;  3F8F A;  2V1D A;  2FRH A;  3TKY A;  3WTS C;  2YR2 A;  4IHT A;  4LJZ F;  2PBI A;  3WGI A;  1G3T A;  3KLO A;  1TLH B;  2QVO A;  4IRH A;  4N9H A;  2C6Y A;  2XRO A;  5HS9 A;  2P6T A;  4I02 A;  2EJR A;  3DPT A;  2YSR A;  2DT5 A;  4YFN F;  5ICE A;  1O3R A;  1HSJ A;  3RTR A;  4JBA A;  2XV4 S;  3LQQ A;  2LSO A;  5F6F A;  3EUH A;  1FT9 A;  2EV6 A;  3KP2 A;  3MZH A;  1LDD A;  1H0M A;  3GZ5 A;  5E17 F;  2KRF A;  1TNS A;  4GO1 A;  4HQE A;  2IPQ X;  2UZK A;  4KDP A;  3GFJ A;  2PI0 A;  1EH6 A;  3M8F A;  5IT9 K;  2DTR A;  1LDJ A;  2OZU A;  2CFX A;  1CGP A;  1S3J A;  2KIM A;  4UUV A;  2K27 A;  1JE8 A;  4I2O A;  4AIH A;  2HGC A;  3WOD F;  5AIQ A;  1UHM A;  3R4K A;  4OU0 A;  4M74 A;  1JXS A;  1I1S A;  2PLY A;  3BPX A;  1Z91 A;  2FSW A;  5HLG A;  4ENJ A;  1SMY F;  5F1R A;  2Z5U A;  5IT3 A;  1TW3 A;  4IRG A;  1Z6R A;  2RGV A;  1R1U A;  1FX7 A;  1HST A;  3WTY C;  1TTY A;  2HR3 A;  3HRS A;  1I27 A;  4WWC A;  2EFN A;  1DUX C;  4ZYH A;  5H6R A;  2Z99 A;  3BWG A;  3RYR A;  3EYY A;  1YYV A;  4NQW A;  4XBF A;  1R36 A;  4U0Y A;  1ONV A;  5DCM A;  1PDN C;  1EV7 A;  4KUM A;  5BPI A;  2FNA A;  4CDG A;  2RDP A;  2OU2 A;  3T8T A;  1YO5 C;  4UVA A;  3SQN A;  4DQ2 A;  3IKT A;  1DPR A;  4BNC A;  1ON2 A;  1AOY A;  3ISP A;  4CYD A;  2RKH A;  1ZRE A;  5LRR A;  5D4S A;  1P4X A;  2PEX A;  3NEU A;  2JPC A;  1RI7 A;  4A2U A;  2L02 A;  3KET A;  2GIV A;  2Z3Y A;  3LQR A;  3ECH A;  4LD5 A;  2W24 A;  4HLX A;  3T0Y A;  4M9S A;  1JHF A;  3MAJ A;  1YS6 A;  4L9J A;  3J7A O;  2HDC A;  4YFX F;  2CG4 A;  3E5Q A;  5IT9 Z;  1F1Z A;  3E3V A;  2FE3 A;  2VC1 A;  2V79 A;  6PAX A;  4YII A;  2XUB A;  3HTU A;  4ZYD A;  2ZNY A;  3GO5 A;  1ZLJ A;  2FBK A;  2QEN A;  2Y48 A;  5D8L B;  2IT0 A;  1P4W A;  5FD5 A;  1CF7 B;  1I5Z A;  2NNN A;  3F8M A;  1KU3 A;  4I0B A;  2CQK A;  1HQC A;  1P4A A;  2J5P A;  3RPU A;  2EA2 A;  2KIF A;  1BI2 A;  3QRF F;  1RIO H;  1H9T A;  2ETH A;  5LGN A;  1BI0 A;  3O2P E;  4LB6 B;  5JR3 A;  4RGX A;  5H6Q A;  3G73 A;  3BJ6 A;  5HOO A;  2LKP A;  5ICC A;  2X4H A;  1MJB A;  2DPD A;  3R0A A;  3CLO A;  2LF7 A;  3QPT A;  3ZMV A;  3Q9V A;  1HBX G;  2F5E A;  1JGS A;  2DO7 A;  3TQN A;  1WKM A;  2P5L C;  2QZ8 A;  2VBW A;  1T6S A;  5BMZ A;  2QQ9 A;  5DEQ A;  2EWN A;  4OMZ A;  4ASN A;  5K1Y A;  1QQI A;  3C1D A;  3WU1 B;  4R79 A;  2XAH A;  2VOO A;  1R22 A;  3K1M A;  3W6J B;  3JSO A;  3GYH X;  3FX3 A;  3K69 A;  1RZ4 A;  3NRV A;  3O6B B;  2IA2 A;  1B4A A;  3HSE A;  2VT3 A;  2MH2 A;  2HTS A;  3TOB A;  4A5N A;  2VE9 A;  2V6C A;  1B9M A;  3FWE A;  1QGP A;  4EGY A;  1KYW A;  1FP2 A;  4CGZ A;  4YG2 F;  1IN7 A;  4ZYG A;  4EJU A;  1J9I A;  4BXU A;  3JTG A;  4ESB A;  4Q48 A;  4LMY A;  5ERI A;  1UFM A;  3R0J A;  3FXU A;  2RNJ A;  4XLP F;  2A68 F;  2F5D A;  2YU3 A;  1XGN A;  5HDG A;  4L5J A;  4PGH A;  3T5X A;  3QAH A;  2J5O A;  4EJO A;  2F5F A;  4M6Y A;  3L9F A;  1XDS A;  1BIA A;  1IN4 A;  1Z7U A;  2KJB A;  2L54 A;  3ULQ B;  3BJA A;  2XAG A;  3JAM Z;  4XRF A;  1X3U A;  4EJT A;  5LRS A;  1OMI A;  4MTD A;  4OOI A;  1SD6 A;  2OD5 A;  1ZAR A;  2WC2 A;  1XD7 A;  4NB5 A;  1QZY A;  2FU4 A;  2FQ3 A;  2FBH A;  3P7N A;  1XGO A;  5LGT A;  2HWV A;  2V9V A;  3HUG A;  3K1P A;  4LK1 F;  2NNY A;  2JT1 A;  2OAZ A;  3JW4 A;  1U8R A;  2D1H A;  3FXR A;  1O7F A;  3TO6 A;  4LFU A;  3KCC A;  4U88 A;  2YX7 A;  3GUD A;  4Y15 A;  3KZZ A;  4Y13 A;  3P9C A;  1IUY A;  2ZO4 A;  1IXS B;  4KN4 X;  1XSD A;  1Z1D A;  1IZ1 A;  4GYI A;  3IWF A;  1MJA A;  3BY6 A;  4IHS A;  1T38 A;  5D8K B;  1NHA A;  2HQN A;  2PJP A;  3ERE D;  4G6Q A;  1B9N A;  4FX0 A;  5BS6 A;  5D5X B;  1LNW A;  2BYV E;  1HW5 A;  4RB1 A;  1ZGA A;  5ED4 A;  4L0Z B;  2AS5 F;  1R1T A;  4KMU X;  2XAS A;  3PQJ A;  2ZJ2 A;  4BQA A;  2A6E F;  5J8F A;  1B1B A;  3I53 A;  2VON A;  3LA3 A;  2E1C A;  3HRM A;  4O6J A;  1K78 A;  2X0L A;  3JTH A;  2MD5 A;  4HAM A;  3GFM A;  1KQ9 A;  1IAW A;  4A6E A;  4PCQ A;  1U78 A;  3I4P A;  3MZY A;  4LG0 A;  2VE8 A;  2VBY A;  4AVP A;  4K2E A;  1I6X A;  2VOD A;  3DXJ F;  3D0S A;  2FOK A;  1KGS A;  3FMS A;  3KP7 A;  2EFW A;  1LEB A;  1R1V A;  3QOP A;  2CYY A;  2GQQ A;  5DD4 A;  2UXX A;  2P5V A;  4A0Y A;  3RKW A;  3NQO A;  3HTS B;  2F2E A;  1E17 A;  4G94 A;  4BHB A;  3TGN A;  2A69 F;  3TDZ C;  1PUE E;  3CUQ A;  3ABT A;  4S05 A;  1YS7 A;  2IW5 A;  2YX4 A;  2FBI A;  3H92 A;  3F6O A;  3F72 A;  4WF2 A;  2FEZ A;  4YIF A;  1ZYR F;  3V7S A;  3CO7 C;  4G7Z F;  4L9V A;  3U9G A;  4U7D A;  3VOE A;  3BPV A;  2EV0 A;  1D3Y A;  4BYY A;  2RVC A;  3QU3 A;  2EFP A;  4HBL A;  2QLZ A;  2BEO A;  5E8G A;  2GWR A;  5DV5 A;  4RGS A;  1S7A A;  2BV6 A;  1USS A;  3QPH A;  2FF4 A;  2E7X A;  3RIR A;  3BZ6 A;  5E1W A;  3LFK A;  4M6X A;  4P9F A;  4EM2 A;  1FBU A;  5CVU A;  1UCR A;  3WU0 A;  3WGG A;  3DP7 A;  3KLN A;  3KP6 A;  4WCG A;  3COA C;  5ILV A;  3GZ6 A;  1GHC A;  2PMH A;  1P2F A;  4FX4 A;  1XB4 A;  1FWZ A;  1BI1 A;  4UVB A;  1W5S A;  2JPB A;  5CVI A;  5DCF A;  5H20 A;  4ENN A;  3J80 Z;  1SMT A;  4RAY A;  1RUN A;  2ZME A;  1AWC A;  3GWZ A;  2R7F A; 
#chains in the Genus database with same CATH topology
 2VKD A;  3HSR A;  3F6V A;  5FLX K;  2M1B A;  2A61 A;  1OLT A;  2W82 A;  1UB9 A;  2WAE A;  1YX3 A;  2CWE A;  2YUS A;  3KYC B;  3CMY A;  1N77 A;  4RS8 A;  1JUP A;  2E7W A;  3A4C A;  2CQN A;  1QPM A;  2XDV A;  3FK6 A;  1PYV A;  4M6V A;  4HF0 A;  5K7F A;  1WPK A;  1E2X A;  5KAF C;  3A0B C;  2WV0 A;  3QYB A;  2JRT A;  4JYK A;  3ZQL A;  4FET A;  1UJ8 A;  1WGX A;  3B02 A;  3LSR A;  2R93 J;  1BA5 A;  1ZR2 A;  2B0L A;  1FIA A;  2HOA A;  5D5W B;  1LB2 A;  2B63 J;  3VYU B;  1BIB A;  2KJC A;  3O8H A;  1BL0 A;  3WHB A;  3CLQ A;  1X4O A;  1Z3Y A;  4HST A;  1X3W B;  2XIG A;  3MZ8 A;  3IH4 A;  1YX5 A;  2DK5 A;  1OR7 A;  2PN6 A;  2K5C A;  3Q0U A;  5IY5 H;  3B6C A;  3CCV I;  1XPX A;  3CTA A;  4XK4 A;  5GAD J;  2M7A A;  4A69 C;  1HW2 A;  1UG2 A;  3DV8 A;  5CVR A;  2PMU A;  3F8B A;  4GXO A;  1R58 A;  1T8I A;  1RKT A;  3DEE A;  4Y3O A;  3FIS A;  1VQ6 I;  4CIC A;  2EZI A;  3FKI J;  1HKQ A;  1TW2 A;  1Y56 A;  4MHG A;  3WHC A;  3FMQ A;  3C7J A;  3BR1 A;  4DZP A;  3QQA A;  1G8X A;  1O7L A;  4FQG A;  2F6C A;  1SFK A;  2WY8 Q;  4L9N A;  5FLM J;  4ESF A;  2W57 A;  2HKO A;  4HNU A;  1SAN A;  3EYI A;  3SXY A;  2OF7 A;  4Q47 A;  5C4J J;  1XMK A;  2CQ7 A;  4MGR A;  1XTA A;  5BNG A;  2HXI A;  3CQZ J;  5DUI A;  2X1D A;  5D6F A;  2M3A A;  3J81 Z;  1T2K A;  1POG A;  1P6R A;  4U0W A;  2WTE A;  1K79 A;  2JA2 A;  1MMN A;  2R5Z B;  3L1P A;  2ICW G;  4BUP A;  4OIQ F;  5BQT A;  4RGU A;  1REP C;  4QLC U;  3HOS A;  1D1B A;  2DA7 A;  1ON1 A;  3E97 A;  3OOP A;  3RDI A;  1MJ9 A;  2A07 F;  3TDU C;  1F43 A;  2EIL H;  1RET A;  2EPF A;  2NVX J;  2LFB A;  5GAE J;  2QA4 I;  1KYZ A;  2MGQ A;  2VN2 A;  4G8X A;  2GOM A;  2DBB A;  3BQY A;  4NDL A;  1ZR4 A;  5GTI C;  3DPL C;  1HKS A;  1TQM A;  2XKP A;  2ZXH A;  4UHT A;  3GTG J;  2ESN A;  1PUF B;  3E6B A;  2NVT J;  2V7F A;  5LGU A;  2JA7 J;  2M7B A;  3K70 C;  4QTR A;  4RB0 A;  3RQ4 A;  2H27 A;  2LBF A;  5JI6 A;  2QKM B;  3F23 A;  4FCY A;  4BL0 B;  1GXQ A;  2XGE A;  1FTT A;  3EQL F;  1MDM B;  1W0T A;  2BW3 A;  2KL4 A;  3S1N J;  4W97 A;  5B1A H;  3QPS A;  2BGC A;  2Y9Z A;  3BTL A;  4LLN A;  2BY2 A;  1I50 J;  1FNN A;  1MNM C;  3VDX A;  2Y69 H;  2JA8 J;  4Y7N J;  2RAE A;  1ETK A;  3G6E I;  3F0C A;  3GFL A;  1PVE A;  3G3Z A;  1FOW A;  3LA7 A;  4F55 A;  4AWX B;  4BEH B;  5FLX Z;  1PP8 F;  5IP7 J;  1YW7 A;  4EMS A;  4PGG A;  1IF1 A;  2NYX A;  3GF2 A;  1HDP A;  1TQP A;  4GDF A;  3IAS 2;  2NAZ A;  4JOM A;  3VEP A;  5FKN A;  1SFE A;  2E1N A;  3CMM A;  3MCZ A;  1B8I A;  4BQQ A;  5D6E A;  1K6Y A;  4BHC A;  1N78 A;  4RM2 A;  1MD0 A;  2IA1 A;  1I1G A;  3QU6 A;  4P96 A;  4H0E A;  5HS7 A;  5KK1 A;  5FFZ A;  3KZY A;  2AQF A;  3GVA A;  2HVS A;  2DDA A;  1IW7 F;  3I3L A;  1IN6 A;  3I0T A;  4UB6 C;  3OSF A;  4ZDL A;  4IQ4 A;  2VXZ A;  3CES A;  1OJL A;  1ETW A;  5LBQ A;  2GXG A;  2L3D A;  3KP3 A;  1T08 B;  3MFK A;  4EAT A;  2HU9 A;  1R7J A;  1FOX A;  2WWY A;  2VJI A;  2L2O A;  4EJW A;  2CRG A;  4XRS A;  4RDU A;  1U5T A;  5ILS A;  4NBQ A;  3ZQ7 A;  3TO7 A;  1U9N A;  4B09 A;  1ZG3 A;  4E7Z A;  4ZZL A;  1J5Y A;  4IVN A;  1S6L A;  2VC0 A;  4RAF A;  2QBY A;  2HZD A;  3I5U A;  2VB6 A;  3DEU A;  3RQI A;  4HF1 A;  3HUG B;  3O3K A;  2E1M C;  1SAX A;  4M9X A;  3D5R C;  5JHF A;  1SD4 A;  4MNU A;  2K9S A;  5EGO A;  2HVR A;  2IRF G;  2IS2 A;  3KEQ A;  5DM7 F;  3HYI A;  2BY0 A;  1RRJ A;  2P6S A;  2F5V A;  1RR7 A;  4IHV A;  2ID3 A;  2WB1 N;  3A0H C;  4RMN A;  1LKX A;  3J7Z I;  4FE4 A;  5BOX A;  3GTJ J;  2L7K A;  3BRO A;  3JAM K;  4HA8 A;  1XMA A;  4CHU A;  4G7O F;  4KA4 A;  4BQO A;  1X1C A;  1XCB A;  2M8G X;  3QOD A;  4YEL A;  2STW A;  1B6A A;  4RM3 A;  4D9J A;  3K7A J;  2DW4 A;  3FMR A;  5C4X J;  4JX4 A;  5J6X A;  2DI3 A;  4II2 A;  2XC7 A;  5E1Z B;  4D5C A;  2I8D A;  1J75 A;  4D1Q A;  4XID A;  2XF7 A;  1BR2 A;  1A36 A;  2GA2 A;  3E6M A;  2EV5 A;  2KQR A;  3KEY A;  2DA3 A;  1JT0 A;  3ASN H;  3VYR B;  2Z33 A;  4OIN F;  2GA1 A;  3ZQI A;  5K5Q A;  2DMQ A;  1HF0 A;  2MLG A;  1BW5 A;  4A3F J;  3F8N A;  2DYR H;  2ZSI B;  3Q0W A;  1WWX A;  4UUT A;  5TJJ A;  4U0V A;  1E3O C;  4CCM A;  2TCT A;  2IGK A;  3M1E A;  3SFZ A;  1S8N A;  1TBX A;  3HSF A;  3BG3 A;  3H3U A;  3RKY A;  4AUX A;  5LFA A;  3BDD A;  5LEJ A;  5IYB J;  3PFY A;  2MBF A;  1IDZ A;  4XLF A;  3ZN0 A;  4WXD A;  3WTX C;  3T8R A;  5KHD A;  2OA4 A;  3G71 I;  4MEY F;  2DK8 A;  3Q0V A;  3FM5 A;  1JTX A;  2HS5 A;  4HNT A;  3BZK A;  3OY9 A;  3NWT A;  2XKO A;  4N0B A;  5C44 J;  2O7O A;  2W00 A;  2I5U A;  3ZQQ A;  5FRN A;  4CXF A;  2O5R A;  4C3H J;  4A3J J;  1ZLK A;  4I7H A;  2P8T A;  3CDH A;  3CP2 A;  1D8K A;  4KYW A;  2IS4 A;  1UAA A;  4XR6 A;  2H09 A;  2XGX A;  2ELJ A;  1K61 A;  5J8C A;  2L9N A;  4V19 K;  2HZT A;  3B6A A;  1FBQ A;  3DBL B;  2CS3 A;  5JLW A;  4KT5 C;  4GYG A;  5A2Q K;  2X85 A;  1HC8 A;  3IH3 A;  2LY2 A;  3A01 B;  4XLN F;  2XSJ C;  4RGR A;  1J2X A;  2DA4 A;  2XAF A;  3N97 A;  2COB A;  4XQF A;  2QWW A;  1R5G A;  3TOA A;  1RC9 A;  2A5W A;  2R3S A;  4EV0 A;  3HJE A;  1IGN A;  2LP0 A;  4PJJ A;  1MSE C;  3VB2 A;  2KDZ A;  2LR8 A;  3WG9 A;  4ETS A;  1KZH A;  4BAY A;  2QYO A;  4D7N A;  1AA7 A;  2Y0S A;  3BTI A;  4UV8 A;  2GOX B;  4L5I A;  3H3V K;  1YTY A;  2M45 A;  5D5V B;  3S16 J;  2DMN A;  3FM3 A;  3CUQ B;  3S32 A;  4AYB A;  2FNP A;  2IBD A;  4OAZ A;  4BGD A;  2G0E A;  2R7D A;  3PQK A;  4PFP A;  2ZKZ A;  2XAQ A;  4OIP F;  4IEJ A;  4DYC A;  2LMD A;  3M7G A;  2ZC2 A;  5TRD A;  1X1P A;  1K4S A;  1Y8R B;  1ITY A;  2RN7 A;  5AIP A;  2QSF X;  1K4T A;  3M8E A;  1LFP A;  3CDL A;  3KIO A;  4KIC A;  1FIP A;  4M3B A;  1GDT A;  5L3E A;  3WGH A;  2PFB A;  2JUC A;  5J4V A;  4X1E A;  4XRM A;  1VQO I;  3V7C A;  5DUK A;  3REO A;  1TWH J;  2E71 A;  2EB7 A;  1VQ7 I;  1FC3 A;  4ZC3 A;  2HFH A;  3MEX A;  4JK1 X;  2DXI A;  1FLI A;  1BC8 C;  3FHZ A;  2OV7 A;  3S2W A;  3LSM A;  4UVC A;  4ZTF A;  1V54 H;  4ENM A;  1FYL A;  1D5V A;  2FUG 2;  2XRN A;  1UG0 A;  3CUQ C;  4IXA A;  5KAI C;  1T0F A;  1X1A A;  4HPQ A;  3HZJ A;  3TW6 A;  1MZB A;  2A5Y B;  4XOP A;  1D0X A;  1EA3 A;  1UEL B;  3R60 A;  3LAP A;  2HYF A;  2ME6 A;  5K5R A;  4NC6 A;  3UNG C;  4PSX A;  3PFI A;  4IQJ A;  4PK4 A;  1L3L A;  1MBG A;  2MC3 A;  3E7L A;  5IOY A;  5DDG A;  1KU9 A;  5DD8 A;  2E2H J;  5CPR B;  4BHP A;  1ZEL A;  3GW2 A;  5HDK A;  1H88 C;  1MBF A;  1S9H A;  2RRE A;  3L2W A;  4OIO F;  3H9J A;  1AKH B;  4D0P A;  4Q4Z F;  4OIR F;  1BR1 A;  2DOD A;  2DLL A;  3M4O J;  2M34 A;  1XX5 A;  2QUF A;  2E5Z A;  1Y1V J;  2EFO A;  3OL4 A;  3L00 A;  2MA3 A;  2IGM A;  4BY7 J;  1FSE A;  2Z9O A;  3S3M A;  2KDO A;  1OCZ H;  1NG6 A;  3RZD J;  2XHK A;  1RES A;  4XMY A;  2BE5 F;  1J59 A;  1Z21 A;  2Y0M A;  4A3E J;  4DW6 A;  2BBY A;  1TP4 A;  5CVV A;  4BQN A;  1DQU A;  4A0X A;  3Q5F A;  1LDK B;  5A2Q Z;  2R7T A;  1ZG1 A;  3OMY A;  3CCQ I;  2E2I J;  2LH9 A;  2K3P A;  5J4Y A;  5DM6 F;  4B1R A;  3H3Z A;  3OYG A;  4RAG A;  3F21 A;  2DDB A;  2VBX A;  1Z9C A;  3LSG A;  1ZN2 A;  2E1O A;  3P9I A;  4EGZ A;  5HNH A;  4HDV A;  4N4N B;  4WK8 F;  2ZJQ F;  2JA6 J;  4L18 B;  1FPQ A;  1BM9 A;  5HNF A;  2ZME C;  1DU0 A;  1EF4 A;  5BPD A;  4F92 B;  4JX6 A;  1W1W E;  3DKW A;  4Y33 A;  1G3S A;  2P7V B;  4CZZ A;  4F7Z A;  4KMF A;  3J80 K;  3Q9S A;  1OPC A;  2JTV A;  3OOU A;  1STZ A;  2L4M A;  2Y30 A;  3MN2 A;  2DOE A;  2DFE A;  3FK7 A;  1R49 A;  3S3N A;  2UUZ A;  2ECB A;  5E18 F;  4IPA A;  2K9Q A;  4UY8 I;  5KCM A;  3OYE A;  2X48 A;  2GLO A;  5D4R A;  2JMW A;  2WAQ A;  3PNT A;  2K9N A;  2IA0 A;  3H0G J;  3MWM A;  2R4G A;  1ODD A;  3FXL A;  1MBE A;  3W6K B;  2A3S A;  2X6O A;  2NRA C;  3MQ0 A;  1P92 A;  1I39 A;  1JUM A;  3HGG A;  4KIF A;  5JHU A;  1OR7 C;  1X2N A;  3V4G A;  1VFC A;  3HDD A;  3DLL F;  2ZXW H;  5M5W J;  1H8A C;  1OQY A;  1YI2 I;  4Z6Y A;  3RPQ A;  2ZNZ A;  2ISZ A;  3OWT A;  1MMA A;  3IRQ A;  3N05 A;  2VQC A;  1YIT I;  3GX4 X;  2R5Y A;  3FF5 A;  5DCM B;  1ZAO A;  4F52 A;  5F0H A;  1O3S A;  3K6G A;  3K2A A;  1EH8 A;  1FMV A;  3PM1 A;  2DU9 A;  3I54 A;  4XIC A;  2E36 A;  2Q2E A;  4HYE A;  3FXO A;  1X58 A;  2O8X A;  4YFK F;  3HC7 A;  3PNY A;  3C2H A;  1QHH D;  3ZMD A;  1XDU A;  3VWB A;  4R1H A;  2IXS A;  3GTO J;  2BW3 B;  2ZCW A;  4BH9 A;  3M9A A;  5LHH A;  2GAU A;  4BJ6 C;  4B3X A;  2A6H F;  1ZG5 A;  2JSC A;  3J81 K;  4A3B J;  1N25 A;  4HRI A;  1SEU A;  4L0Y B;  2OQG A;  3RCO A;  4M71 A;  3PIO F;  1DPU A;  3CJN A;  5M3F J;  2KIQ A;  5LHG A;  3JRE A;  4L5E A;  1U2W A;  1VQL I;  2ZFU A;  2XPW A;  2M0M A;  3V8K A;  4CYC A;  4B4C A;  1XCV A;  2P81 A;  4WX9 A;  4GCV A;  1YIJ I;  1ACI A;  4ZZD A;  1B8I B;  3WTW C;  4I99 C;  1E0E A;  3AL0 B;  4MEX F;  1JHH A;  5E8I A;  1LFU P;  4PFO A;  1MIJ A;  3K4J A;  3W2V A;  3JRG A;  1R5I D;  2IGN A;  3ROU A;  3K2Z A;  4XN0 A;  4A12 A;  4IJA A;  1Y8Q B;  3DLA A;  4O5V A;  4X6A J;  3WTT C;  4O3M A;  1A04 A;  4S04 A;  1QO0 D;  3Q3S A;  2V1X A;  4PZJ A;  1MMS A;  3SHF A;  1WI9 A;  2Q0O A;  4WXC A;  1TZL A;  1SD5 A;  1U5T B;  4CSW A;  2QBY B;  3OL3 A;  2AO9 A;  1FEX A;  3HGY A;  4KT6 A;  2M8E A;  2OQR A;  3KP5 A;  2OPT A;  4MO7 A;  2BZT A;  3VSL A;  1VQK I;  1LE8 B;  1ETV A;  3ZQG A;  2L9R A;  1D8J A;  1SFX A;  3AFH A;  1IXC A;  3MKY B;  1KA8 A;  2GZW A;  3GLX A;  2P5K A;  3AL0 C;  2FML A;  4ZH4 F;  5EJC A;  4P55 A;  5FD6 A;  5EZG A;  4RAZ A;  3CCM I;  5HDN A;  2K4J A;  2Z16 A;  4MIM A;  3FDY A;  4HX7 A;  4Y17 A;  3E6D A;  1WQ2 A;  3L2Q A;  1VND A;  1HXD A;  5E1X A;  5KVR A;  4KIG A;  1HA8 A;  3SEQ A;  1ZKG A;  3OYM A;  2VJ5 A;  1YQA A;  2R7Z J;  2ZB9 A;  3AG4 H;  3LSK A;  2ADU A;  3GZN B;  1U5T C;  2CW7 A;  2QEX I;  3DFG A;  4WXH A;  3JRH A;  3L09 A;  1W7P A;  2ECC A;  2HOE A;  3HKZ N;  1RUO A;  5HLI A;  2WA0 A;  2H8R A;  3OYN A;  3G2B A;  4IF4 A;  2O03 A;  2Z2S B;  3G1L A;  3BP8 A;  4UUS A;  4A5M A;  1JKQ C;  4HF2 A;  1W5T A;  2H6B A;  1W7P D;  1LEA A;  2DT6 A;  3V42 A;  3HOY J;  3S2D J;  2KT0 A;  1TNT A;  1IXR C;  1XN7 A;  5FB2 A;  5M5X J;  2KLO A;  3ZR8 X;  4E7H A;  2EA4 A;  2JN6 A;  1KQ0 A;  2TRT A;  1ZGJ A;  1IJW C;  1FYK A;  5H2F C;  1ZH5 A;  3ZMZ A;  2LKS A;  1YJW I;  1ETY A;  5E3O A;  1T39 A;  1DP7 P;  1XG1 A;  5HVQ C;  4OMY A;  1PP7 U;  3I59 A;  2CGP A;  3GEZ A;  4IKF A;  2K86 A;  4MFD A;  4XSZ F;  2V9K A;  3KZI C;  2ZXI A;  3I4M J;  3JCU C;  4IZZ A;  1JI8 A;  2HDW A;  3LST A;  3PNV A;  5JVT A;  2LNB A;  4XLA A;  1WI3 A;  5F64 A;  1F4K A;  2L01 A;  4EVI A;  1B72 B;  4FT8 A;  2HOT A;  3TMO A;  2LY1 A;  2X6X A;  2D45 A;  1ULY A;  5L3C A;  2G9W A;  1FBS A;  1QA6 A;  4F93 B;  3GFI A;  3IL2 A;  2DQR A;  3CC7 I;  3CCR I;  2BY1 A;  1S7O A;  2DOA A;  3WTV C;  4CO8 A;  3M1C A;  1OCC H;  2H94 A;  2JA5 J;  2XB5 A;  4FTH A;  4RB3 C;  2K85 A;  4BXX J;  5CLS A;  5GTH C;  1QZZ A;  1ZRD A;  1IN8 A;  4BJ5 C;  3IRR A;  1MND A;  2MYS A;  4DYR A;  1VTN C;  1XGM A;  4UB8 C;  1Q1V A;  4CUG A;  4HZF A;  2PJR A;  3HOV J;  2VKV A;  4LK0 F;  5J40 A;  1X1B A;  2Y75 A;  1R4M B;  4GGG A;  4LGW A;  5FKM A;  2Z1D A;  4U7B A;  1BBY A;  2HPI A;  3DTK A;  3IWZ A;  3BR0 A;  5FFX A;  1A31 A;  2F4M B;  2LF8 A;  4LG3 A;  3F8C A;  1G2H A;  2KRC A;  2XRL A;  2DPU A;  3H9G A;  2FX0 A;  3EPZ A;  2BY3 A;  2LOO A;  2ISY A;  2P4W A;  1GT0 C;  3ABL H;  3SZT A;  2P0W A;  4MFE A;  1X4P A;  5FO5 A;  2E1M B;  2X6Y A;  2MH9 A;  3C18 A;  1ZHF A;  1WJ5 A;  2BXY A;  3ABU A;  2M5W A;  4ZYA A;  3ZQH A;  2NOJ B;  3OS0 A;  1UHW A;  1YLF A;  2FQ4 A;  3FXM A;  2HKX A;  5F0F A;  3BOQ A;  1KU7 A;  3M07 A;  3U2R A;  3OR2 C;  1ETX A;  3RSN A;  9ANT A;  4AIK A;  1YW8 A;  1ZRC A;  3K4L A;  5B1B H;  1K83 J;  4XOT A;  2VQL A;  2W4S A;  4PDK A;  4P5O A;  4LIV A;  4CCK A;  2LC2 A;  3TP3 A;  4NUB A;  1I6H J;  3EET A;  1ETQ A;  1HOM A;  5JFR A;  3BG7 A;  5EG0 A;  5FRM A;  1G3W A;  1QNT A;  3L2U A;  2EIN H;  4DNC A;  3AAF A;  2VOP A;  2UXN A;  4G7H F;  4ITV A;  3RYP A;  1R5H A;  2LRD A;  2EIM H;  1VQP I;  1HLV A;  4PJM A;  3VOD A;  4BBS J;  4IX7 A;  1Z05 A;  1H9G A;  1UST A;  2ACJ A;  5E3M A;  2STT A;  2W25 A;  3S8P A;  3BTJ A;  2RV8 A;  2JK3 A;  2PG4 A;  3HPH A;  4MTE A;  2WB1 A;  4XKB A;  1DDN A;  2HVQ A;  4N9I A;  4HOB A;  2WY7 Q;  1RNL A;  3LA2 A;  5K5O A;  4X0G A;  2LG4 A;  1D1A A;  2ESH A;  3GTM J;  2G7H A;  3OS1 A;  2XAJ A;  2E34 A;  2VQG A;  4AM3 A;  1TWG J;  1BJA A;  2VJ4 A;  3H1C A;  2LTP A;  1A6I A;  4JQF A;  3EUK L;  5LHI A;  3A03 A;  1MBK A;  2X51 A;  2DAO A;  4AU7 A;  1O3Q A;  1TWA J;  3R6S A;  2K4B A;  1ENH A;  2PMZ A;  2CJJ A;  1SD7 A;  2LY9 A;  4I09 A;  3E5U A;  4TV7 A;  4FIS A;  2TDX A;  3L2C A;  3I71 A;  1IUF A;  4LIU A;  2ZXJ A;  4I98 B;  4ENK A;  2EIK H;  1T0F C;  4A0Z A;  2O0Y A;  3S1Q J;  4L9T A;  3W2W A;  4XOR A;  1NK3 P;  2D5V A;  2PQ8 A;  2CO5 A;  2VT2 A;  1X3Z B;  4XLE A;  2F5C A;  2AXT C;  3HRT A;  3RPU D;  3FXQ A;  4HEA 2;  5F1J A;  3LWF A;  1KQ8 A;  2L4A A;  5B66 C;  4QWQ A;  3U1D A;  3E5X A;  5EEA A;  3S3O A;  1TWF J;  4Y4R A;  5EZH A;  3FXK A;  5K7Z A;  2HTJ A;  1BOB A;  2WAF A;  2CW0 F;  3K1N A;  2ZJP F;  1QZE A;  1YG2 A;  1SVL A;  1QU3 A;  1HKT A;  4HV6 A;  1OYW A;  3IC7 A;  3TP0 A;  5GAH J;  3AG1 H;  3S1M J;  4IRI A;  2MSY A;  3SEZ A;  1Z6T A;  5L3D A;  1Y39 A;  3GXO A;  1K7A A;  1JTY A;  3FZV A;  3A1Y A;  1JT6 A;  2DMU A;  3OYI A;  3FXJ A;  1F9N A;  4ABZ A;  3H35 A;  3CMA I;  3M8J A;  3KEO A;  3V8L A;  1BN5 A;  1K78 B;  1VF9 A;  1W4M A;  2EFQ A;  1OCP A;  2V9P A;  4V2G A;  3ZPL A;  5L3F A;  2O61 A;  2WBM A;  1D1C A;  2DFI A;  2IJL A;  4XKW A;  3WE2 A;  2CFO A;  2ELH A;  2KFD A;  3T1B A;  4XSX F;  3BR2 A;  2B7E A;  3ZN1 A;  3K70 D;  2O9L A;  4LG0 B;  4A93 J;  5CQE A;  1DP3 A;  3WTZ A;  5FLV A;  1TL8 A;  3IHU A;  3K4M A;  2OBP A;  3SDB A;  5ICF A;  4GRI A;  1BR4 A;  2JQ7 A;  4P9U A;  2ZBK A;  1MBJ A;  3CCS I;  1GVJ A;  1OKR A;  3DQV C;  5GP9 A;  4NC7 A;  2AXL A;  1M1E B;  1R00 A;  3OYK A;  3BG5 A;  4ZYE A;  1LPQ A;  3CCJ I;  3IH2 A;  1PUF A;  3KFW X;  1AHD P;  2HQR A;  3MKL A;  4CH7 A;  1WCM J;  1OCO H;  4FHT A;  2DA2 A;  2KZV A;  1FOK A;  4E7J A;  1FTZ A;  2QCO A;  1FSH A;  1LVA A;  2O8K A;  2UWM A;  2DQL A;  1MDM A;  2HQA A;  2F4O B;  5E20 A;  4IO9 F;  2W84 A;  4C2T A;  3OYB A;  1TT0 A;  1C0W A;  3UKG A;  1V3F A;  5J47 A;  4U87 A;  1MH3 A;  2FA5 A;  3DKY A;  1U3E M;  1J0R A;  4HV5 A;  2Q2E B;  1MKM A;  2QQA A;  3DU5 A;  3WTU C;  3V7R A;  3JR9 A;  2HQ5 A;  2D1V A;  1JJ6 C;  1OYY A;  1GVD A;  3ZMS A;  1G6N A;  1D5Y A;  4AD9 A;  3RKX A;  2KPM A;  4RB2 C;  1HDD C;  1QRY A;  3ZMT A;  1XGS A;  2RQQ A;  3OYC A;  2CSO A;  2M87 A;  4UNO A;  3QYE A;  1IRZ A;  2GXB A;  3C3W A;  2BHZ A;  2EZH A;  2MD0 A;  5FGM A;  2JZY A;  4LB5 A;  2M30 A;  2RC4 A;  1T98 A;  4ZDO A;  5LLQ A;  1ZRF A;  2VJJ A;  4HDU A;  3RI4 A;  2H1K A;  2O3F A;  2HEO A;  2VAS A;  2QSH X;  1QVT A;  3P9K A;  4I6Z A;  1O57 A;  1S29 A;  2EBI A;  5L3G A;  3D1N I;  2R7V A;  2IP2 A;  4BU2 A;  4XLH A;  1WHU A;  2EK5 A;  4E70 A;  4CYC B;  5CJ9 A;  4CCL A;  1SAU A;  2NXN B;  2UV1 A;  4G9Y A;  2DA1 A;  4DOZ A;  4UXN A;  1G3Y A;  2DA6 A;  1F5T A;  4M9Z A;  4QSH A;  1YRN A;  3HOT A;  4EM1 A;  1IRG A;  2MAB A;  2OCC H;  2VBZ A;  5TIS C;  5CVJ A;  5ICG A;  3B73 A;  1SFU A;  3JRC A;  3VFZ A;  4ESJ A;  2CUF A;  4LLL A;  1FYM A;  5HS8 A;  3CO6 C;  4E4H A;  4HX8 A;  1MNE A;  3DF8 A;  3I4N J;  2QQB A;  4HW0 A;  4AVZ A;  4EJV A;  1CF7 A;  2E19 A;  1T95 A;  1MH4 A;  4DBR A;  1T33 A;  3A02 A;  2GXA A;  4LLG F;  1JGG A;  3MVP A;  1XSV A;  2MLK A;  3KP4 A;  5LD2 C;  1WJA A;  2XVC A;  1B59 A;  3MMY B;  3ZCO A;  5FJ8 J;  2ZME B;  2KIU A;  1OYI A;  4N4O B;  1U6G A;  1WSU A;  4HLY A;  3LAJ A;  1ETO A;  1BC7 C;  3RJP A;  2VQH A;  2GM4 A;  2XGD A;  3H9Q A;  5HLH A;  1FP1 D;  1G4D A;  1EH7 A;  2IAI A;  1TQI A;  4DJA A;  3I55 I;  4B43 A;  4IOA F;  1IRF A;  3IUO A;  2V1U A;  2H6C A;  3F3X A;  4C30 A;  1V5E A;  4NNJ A;  4XON A;  1L0O C;  4HX4 A;  2HYG D;  3PUF A;  4KNY A;  5IYD J;  2KIS A;  1UZC A;  2R92 J;  1LJ9 A;  2LLK A;  1O3T A;  3ONQ A;  3QP6 A;  1YE9 A;  4W1U A;  1V4R A;  2DCE A;  2QM3 A;  2JVG A;  3BR6 A;  2CMP A;  3HRU A;  5FKO A;  1BI3 A;  1I3Q J;  4A3K J;  3WE3 A;  3OYD A;  1WRJ A;  2GIZ A;  1NG7 A;  4MQV A;  3LNQ A;  1YIO A;  3BC8 A;  4GFB A;  2KKO A;  5M3M J;  4RLF A;  2V6E A;  1Z77 A;  2N8G A;  3ZXS A;  4BS9 A;  1P9Q C;  1W7P B;  3CCL I;  1U8B A;  1AU7 A;  2YPR A;  2LDU A;  1Z7L A;  2FXA A;  2DN0 A;  3ASO H;  3LSP A;  5L3B A;  4ON0 A;  1FJL A;  5EEG A;  4UUS B;  2K02 A;  3HHG A;  1J7K A;  4YIR X;  1DU6 A;  2K7L A;  5LEK A;  3ELK A;  4BJT A;  4M73 A;  4HQM A;  1Q1H A;  5IOZ A;  3QWL A;  2ZFW A;  5ILU A;  4R8H A;  2G7U A;  1W5C C;  3CCU I;  2QSG X;  4Z2Y A;  2LRE A;  1FZP B;  2LYC A;  4BDZ A;  4NHJ A;  4MQ9 F;  1NH3 A;  2P7C B;  2FD5 A;  2R7S A;  2Q8K A;  4XLC A;  4M72 A;  3TO9 A;  3GLL A;  2L7Z A;  3I59 B;  3LSI A;  4KIB A;  1ZGW A;  3ECO A;  4PJN A;  5AON A;  3QP5 A;  1BOA A;  4Q5S F;  5DYM A;  3F22 A;  4AIJ A;  3NAR A;  2DOF A;  2D2W A;  2O6G E;  1HW1 A;  1W0U A;  1LQ1 A;  2XB0 X;  3W3C A;  1Z0X A;  1K6O A;  3BQZ A;  4UV9 A;  2W85 A;  2M9H A;  4KFC A;  2XPU A;  3L2R A;  2DFH A;  2OZ6 A;  4EQQ A;  3EDP A;  1IN5 A;  4KN7 X;  3ML6 A;  1IV8 A;  3ZQF A;  2NVQ J;  3A01 A;  1FY7 A;  1WJE A;  4G6D A;  1WJD A;  2KZG A;  1OIS A;  2IVM A;  2MG4 A;  3R61 A;  1MMG A;  2M0C A;  2CUE A;  2DMT A;  1MGT A;  3IKV A;  4A3I J;  2RQP A;  3SZP A;  3CDI A;  1GLN A;  3BJO A;  4I0A A;  1QBJ A;  1RKW A;  3C2G A;  1GXP A;  3N4M A;  2CW8 A;  1XS9 A;  4II3 A;  3PSF A;  2K3F A;  2FMY A;  3E6C C;  3I58 A;  3S2H J;  2LBF B;  2DA5 A;  5CYV A;  3KE2 A;  1Y0U A;  2W48 A;  3TL4 X;  3CUO A;  2KMU A;  3GBG A;  3BTC A;  3K0L A;  1VQ8 I;  1LFB A;  5EEH A;  4BBR J;  4BE2 A;  3S15 J;  4C3I J;  3DKX A;  2COM A;  3V8J A;  1TC3 C;  4A6D A;  1YW9 A;  2A05 A;  3HHH A;  5FRO A;  2ID6 A;  4EM0 B;  2FOW A;  1XSX A;  2X6W A;  3PO2 J;  5C3E J;  3JSP A;  1YFH A;  5IP6 A;  3P5J A;  3ZMU A;  3OV8 A;  4FE7 A;  2MW8 A;  5D5U B;  2ELK A;  3L7W A;  1ZTR A;  3HIF A;  3HOZ J;  3EUA A;  3AG2 H;  3OR1 C;  1KU2 A;  1JUS A;  3K9T A;  5KNL A;  1V55 H;  3BCB A;  3D5L A;  3TBI A;  2NS0 A;  3ZP5 A;  1V5G A;  4I01 A;  2CUJ A;  3S14 J;  2YU9 J;  3SYT A;  2AHQ A;  3CJR B;  1DGR M;  2BHY A;  3I64 A;  4B8X A;  3M3Y J;  1R23 A;  3S1R J;  1VQ9 I;  3F8F A;  1SVM A;  2V1D A;  1S5L C;  1NTC A;  4HSR A;  2FRH A;  5B5E C;  3TKY A;  3WTS C;  2YR2 A;  4IHT A;  4LJZ F;  3OS2 A;  2PBI A;  1WZ2 A;  3WGI A;  1G3T A;  3KLO A;  1TLH B;  2QVO A;  5EG0 B;  4XRS G;  3G1O A;  1QPI A;  4IRH A;  4N9H A;  2C6Y A;  1A5J A;  2XRO A;  3NWS A;  5HS9 A;  2JUG A;  3HOW J;  2CV2 A;  3L2V A;  5EGO B;  3E1S A;  1VQ4 I;  2P6T A;  1UMQ A;  1AKH A;  4I02 A;  4B48 A;  2EJR A;  1S72 I;  2ZJR F;  1G59 A;  3DPT A;  2VIX A;  2YSR A;  2CQX A;  4XKC A;  2DT5 A;  3WU2 C;  3QPL A;  1Y0N A;  3HOX J;  4YFN F;  1Z67 A;  3JRB A;  5ICE A;  1O3R A;  2VPL A;  1HSJ A;  3BZC A;  3HKZ A;  3RTR A;  4JBA A;  2XV4 S;  3PIP F;  3LQQ A;  1Z3X A;  4IOC F;  2LSO A;  5F6F A;  3EUH A;  1FT9 A;  2EV6 A;  3KP2 A;  3VPR A;  3MZH A;  4XNF A;  1LDD A;  4CCO A;  3K4N A;  4B44 A;  1H0M A;  1OCT C;  3GZ5 A;  5E17 F;  3W2A A;  2KRF A;  1TNS A;  2YS9 A;  4GO1 A;  3H5N A;  1CQT A;  3AKZ A;  4QPQ A;  2BXZ A;  4HQE A;  2IPQ X;  2FJ1 A;  1GV5 A;  4KIT B;  2UZK A;  3QYF A;  4KDP A;  1T56 A;  3GFJ A;  1EH6 A;  3M8F A;  1JKR C;  2PI0 A;  5J1U A;  5IT9 K;  3CC2 I;  2QF7 A;  2CH0 A;  3OIO A;  2DTR A;  1LDJ A;  2OZU A;  3OYL A;  2HI3 A;  2CFX A;  3SFI A;  1CGP A;  1S3J A;  2KIM A;  3KYD B;  4UUV A;  5IYC J;  4QIW N;  3K10 A;  1VQ5 I;  3CJQ B;  2K27 A;  1D0Z A;  5DTD A;  1JE8 A;  2VUM J;  4I2O A;  4AIH A;  3BG9 A;  2HGC A;  1E3H A;  2K9M A;  4IL6 C;  2AQE A;  3WOD F;  3OIP A;  1W36 D;  2K40 A;  5AIQ A;  1UHM A;  3R4K A;  4OU0 A;  4DGW B;  4M74 A;  1JXS A;  1I1S A;  2PLY A;  3HPG A;  3BPX A;  1SVO A;  1Z91 A;  2FSW A;  3LFU A;  5HLG A;  4ENJ A;  3ABK H;  3PO3 J;  1SMY F;  5F1R A;  2Z5U A;  5IT3 A;  1OCR H;  5DS9 A;  4IHX A;  1TW3 A;  2R7O A;  3I56 I;  3CP8 A;  4IRG A;  1JKO C;  1Z6R A;  2RGV A;  1R1U A;  1FX7 A;  1HST A;  3WTY C;  4ANJ A;  1TTY A;  2HR3 A;  3W6V A;  3HRS A;  3KX2 A;  1I27 A;  1WJC A;  2EFN A;  4WWC A;  1IO2 A;  3IV5 A;  1DUX C;  4ZYH A;  5H6R A;  2Z99 A;  3BWG A;  1MW7 A;  3RYR A;  3EYY A;  1YYV A;  4NQW A;  5TGT A;  4XBF A;  3GTK J;  4A3G J;  4PSW A;  1R36 A;  2L5Q A;  4DBQ A;  4U0Y A;  2DJI A;  4XN3 A;  3TW7 A;  1ONV A;  5DCM A;  1PDN C;  1EV7 A;  3OIQ A;  4KUM A;  5BPI A;  2IEK A;  2FNA A;  4CDG A;  2RDP A;  2OU2 A;  2CU7 A;  4MLO A;  4P1W A;  3T8T A;  1YO5 C;  4UVA A;  3SQN A;  4DQ2 A;  1XMX A;  3KYL A;  3IKT A;  1DPR A;  3PL8 A;  1JJ8 C;  4BNC A;  1ON2 A;  2LK2 A;  3K4C A;  1AOY A;  3ISP A;  4CYD A;  2RKH A;  1ZRE A;  2HPM A;  3VYS B;  5LRR A;  5D4S A;  1P4X A;  2PEX A;  3NEU A;  2KHM A;  2DTZ A;  2JPC A;  3MKW B;  2R0Q C;  1RI7 A;  2IGO A;  4A2U A;  1YJN I;  1U9O A;  5CKT A;  2L02 A;  4H4K C;  1E3P A;  3KET A;  2GIV A;  2Z3Y A;  3LQR A;  3ECH A;  4LD5 A;  2EIJ H;  2W24 A;  3C2B A;  3A2K A;  2E60 A;  3G1M A;  3DWL E;  4A3D J;  4RLQ A;  1A6Q A;  4HLX A;  3F9K A;  3T0Y A;  1X1D A;  1LVK A;  2ZSH B;  1WJB A;  4M9S A;  1JHF A;  1UHS A;  4BE1 A;  4J19 A;  4CCN A;  3G4S I;  3MAJ A;  1YS6 A;  2XF6 A;  4I76 A;  4L9J A;  3GTL J;  2LD5 A;  2LVS A;  3J7A O;  2HDC A;  4A3M J;  4YFX F;  2CG4 A;  3E5Q A;  4D5F A;  1GUU A;  4F91 B;  5EF6 A;  1DGW Y;  5IT9 Z;  3CZ6 A;  1F1Z A;  3CD6 I;  3E3V A;  2FE3 A;  3HBL A;  1Y1W J;  2VC1 A;  4KJZ A;  2V79 A;  6PAX A;  1ERD A;  4YII A;  2XUB A;  2JRM A;  1TWC J;  4DZJ A;  3CF5 F;  2OCE A;  4EEF G;  3HTU A;  4ZYD A;  1YJ9 I;  2ZNY A;  1LUJ B;  2XGC A;  3GO5 A;  1YRN B;  2VKH A;  2R7X A;  1ZLJ A;  2FBK A;  2JWT A;  2L7M P;  2QEN A;  2Y48 A;  3VYT B;  3DTE A;  5D8L B;  2EZL A;  4RBO A;  1LE8 A;  2IT0 A;  1P4W A;  3MD2 A;  2H8W A;  5FD5 A;  1CF7 B;  3ERM A;  1I5Z A;  2NNN A;  3F8M A;  1KU3 A;  3DCF A;  1WFX A;  2CQK A;  1HQC A;  1P4A A;  4I0B A;  1A35 A;  4IHW A;  1D0Y A;  2J5P A;  3RPU A;  2DFF A;  2EA2 A;  5CQG A;  4A3C J;  2KIF A;  1BI2 A;  4QPO A;  3QRF F;  1RIO H;  1H9T A;  2ETH A;  5E3N A;  5LGN A;  1BI0 A;  3J7A Y;  3O2P E;  3H5R A;  4LB6 B;  5JR3 A;  4RGX A;  5H6Q A;  3MKZ A;  2L0K A;  3SDG A;  4C2U A;  3G73 A;  5IPA A;  1IG7 A;  3BJ6 A;  4E6K G;  3GTQ J;  5HOO A;  2X9D A;  2LKP A;  5J3L A;  3LMM A;  5ICC A;  2X4H A;  1MJB A;  2DPD A;  1YHQ I;  3R0A A;  1FOY A;  3CLO A;  3S93 A;  2IS6 A;  2LF7 A;  3BR3 A;  2Y2Z A;  4M3F A;  3QPT A;  2PMZ N;  3ZMV A;  4RA2 A;  3H5A A;  3Q9V A;  1HBX G;  3BR5 A;  5F0C A;  1WH7 A;  4A3L J;  2F5E A;  1JGS A;  5HLT A;  2DO7 A;  4JX5 A;  3TQN A;  2OTL I;  1WKM A;  2P5L C;  2QZ8 A;  2VBW A;  1T6S A;  5BMZ A;  3BCA A;  1X19 A;  2QQ9 A;  3FIW A;  3WG7 H;  2F48 A;  3DBR B;  5DEQ A;  2EWN A;  4E7L A;  2CUZ A;  4OMZ A;  3H36 A;  4ASN A;  2GBY A;  4ZJZ A;  1EJ9 A;  5K1Y A;  1QQI A;  2L7F P;  3C1D A;  3WU1 B;  1P7I A;  2EZK A;  3ZQC A;  2CV1 A;  4R79 A;  2VLA A;  2Y9Y A;  4ZTJ A;  2R5Z A;  2E2J J;  2XAH A;  5JLX A;  2VOO A;  1R22 A;  3K1M A;  3W6J B;  1J09 A;  3JSO A;  3FX3 A;  3GYH X;  2HYJ A;  2B9S A;  1B72 A;  3K69 A;  1RZ4 A;  3NRV A;  3O6B B;  2IA2 A;  3LL7 A;  1WVR A;  3DBH B;  1B4A A;  1RPW A;  3HSE A;  5K7H A;  2VT3 A;  2MH2 A;  2HTS A;  3TOB A;  3U1K A;  1PJR A;  4A5N A;  2K9L A;  2MFZ A;  2E5N A;  3ZGK A;  2VE9 A;  2V6C A;  1B9M A;  3FWE A;  1VQM I;  1QGP A;  4EGY A;  1KYW A;  1FP2 A;  4CGZ A;  4BKX A;  4YG2 F;  1IN7 A;  4ZYG A;  4EJU A;  3ZOB A;  1J9I A;  3D5S C;  4BXU A;  2WAD A;  2VKE A;  3KPH A;  4ESB A;  3JTG A;  1TT5 B;  4Q48 A;  4LMY A;  1R6R A;  2R5Y B;  1U0J A;  5GPC A;  5ERI A;  1UFM A;  1H89 C;  3HB9 A;  3IAM 2;  3R0J A;  3FXU A;  2RNJ A;  4XLP F;  4CZC A;  2A68 F;  2F5D A;  2YU3 A;  2OUM A;  1XGN A;  5HDG A;  4L5J A;  3BG6 A;  3S17 J;  2NVY J;  1XC5 A;  2JSP A;  2X1E A;  4PGH A;  3TED A;  3T5X A;  2XAU A;  3QAH A;  4BEH A;  2J5O A;  2E35 A;  4EJO A;  2F5F A;  4C9Y A;  4LIT A;  4M6Y A;  2X1C A;  4BDY A;  3UR3 C;  3L9F A;  2QGU A;  1XDS A;  1BIA A;  3OSG A;  2LKX A;  1IN4 A;  2Y0S N;  1Z7U A;  4M3D A;  2KJB A;  2BVM A;  2L54 A;  4E7I A;  3GME A;  3ULQ B;  3BJA A;  4BE0 A;  2XAG A;  5E79 C;  3JAM Z;  4AYB N;  4XRF A;  1X3U A;  3CJT B;  2HXO A;  3PSI A;  5J1Y A;  3CCE I;  3FKJ A;  4EJT A;  1VZ0 A;  5LRS A;  1OMI A;  4MTD A;  4OOI A;  1SD6 A;  2OD5 A;  1ZAR A;  2WC2 A;  1XD7 A;  4NB5 A;  5GAG J;  1QZY A;  2FU4 A;  2OTJ I;  2JVH A;  2FQ3 A;  5F04 A;  2FBH A;  3P7N A;  3K4K A;  1HCR A;  1XGO A;  3QOE A;  5LGT A;  4CA0 A;  1VI0 A;  2HWV A;  2V9V A;  4DIQ A;  2IS1 A;  4C2M J;  2VL8 A;  3FBN B;  3HUG A;  3K1P A;  4LK1 F;  2VI6 A;  2R7R A;  4J01 A;  2NNY A;  4PUS A;  2JT1 A;  2R7W A;  4XM3 A;  1JKP C;  2OAZ A;  4ZDP A;  5EDN A;  3HG9 A;  1QVU A;  2W7N A;  3JW4 A;  3OYH A;  3AG3 H;  1U8R A;  3K4B A;  2D1H A;  3CME I;  1NK2 P;  3FXR A;  4BY1 J;  1QHG A;  3GCM A;  4F3Q A;  1N75 A;  1O7F A;  3TO6 A;  4LFU A;  3KCC A;  4PJL A;  4U88 A;  2YX7 A;  1X2M A;  2CQQ A;  5EYR A;  2NS7 A;  3GUD A;  4Y15 A;  2DMP A;  3KZZ A;  1IC8 A;  2BVL A;  3P9C A;  3HM5 A;  3U21 A;  4Y13 A;  1IUY A;  2ZO4 A;  1IXS B;  4KN4 X;  2V4J C;  1XSD A;  1Z1D A;  1IZ1 A;  2NOG A;  2Y31 A;  4G12 A;  4GYI A;  3IWF A;  1MJA A;  3BY6 A;  4OAY A;  4B47 A;  1T38 A;  4IHS A;  3H0D A;  3LSH A;  1MSF C;  5D8K B;  1ZQ3 P;  4E7S A;  1NHA A;  3JRD A;  2PX9 A;  4AID A;  2HQN A;  2PJP A;  4M3G A;  3HOU J;  4CCJ A;  3ERE D;  4G6Q A;  1B9N A;  5GPA A;  4FX0 A;  5BS6 A;  3JRI A;  2MC4 A;  2A6T A;  2JJ7 A;  5D5X B;  2NS8 A;  2L9S A;  4IHY A;  2L9V A;  1LNW A;  5FKL A;  3OYA A;  5JVG F;  2NVU B;  3CCY A;  4C3J J;  5E3L A;  2BYV E;  1HW5 A;  4RB1 A;  1ZGA A;  5ED4 A;  4L0Z B;  2AS5 F;  1R1T A;  4S0H B;  4KMU X;  2XAS A;  1BJZ A;  3SZG A;  3ESW B;  2ZJ2 A;  3PQJ A;  3ABM H;  1KON A;  2F4I A;  2M4K A;  3HL2 A;  4BQA A;  2A6E F;  4FAS D;  3BT9 A;  5J8F A;  1B1B A;  3I53 A;  2VON A;  3PJR A;  1I3A A;  3LA3 A;  3NAU A;  2EQR A;  2Q1Z B;  2E1C A;  1V5F A;  3HRM A;  4NC8 A;  2OJE D;  4JP0 A;  2CV0 A;  3EUH C;  4O6J A;  1K78 A;  2X0L A;  3ZRG A;  3JTH A;  2MD5 A;  4BAC A;  4LOC A;  4XL9 A;  4HAM A;  2HDD A;  2M2E A;  4HG2 A;  2XF5 A;  3GFM A;  4PJ0 C;  1KQ9 A;  4M3E A;  1IAW A;  4A6E A;  3JRF A;  3SJM A;  4PCQ A;  1U78 A;  3I4P A;  4YRV A;  2HOS A;  4KIS A;  3MZY A;  4LG0 A;  4DYQ A;  2VE8 A;  2VBY A;  3BLY A;  4AVP A;  3X2Q H;  4K2E A;  1I6X A;  3RZO J;  2R7U A;  2VOD A;  3DXJ F;  2V26 A;  1BW6 A;  3D0S A;  2FOK A;  1KGS A;  3DU6 A;  1VQN I;  1MBH A;  5F08 A;  3FMS A;  3KP7 A;  2EFW A;  2WAQ N;  1SFO J;  1R1V A;  1LEB A;  3O8G A;  2W1O A;  3QOP A;  2CYY A;  2GQQ A;  1W36 C;  5DD4 A;  2UXX A;  2P5V A;  5FKK A;  4A0Y A;  3RKW A;  3NQO A;  3HTS B;  2XPV A;  1APL C;  2F2E A;  2VXD A;  3HEF A;  1E17 A;  4G94 A;  1R4N B;  5IP9 J;  4BHB A;  2OC6 A;  3TGN A;  3CC4 I;  2A69 F;  4NQW B;  4XKV A;  5HOD A;  3DTI A;  2PJR B;  3TDZ C;  3LSJ A;  3FBI B;  3PUB A;  1WJF A;  1PUE E;  3CUQ A;  3CF2 A;  3ABT A;  4S05 A;  1YS7 A;  2IW5 A;  1R9T J;  2YX4 A;  2WV1 A;  2FBI A;  2QQ8 A;  3H92 A;  3F6O A;  1P7J A;  4HNV A;  3F72 A;  5J1R A;  4WF2 A;  2XSD C;  1Y6I A;  2FEZ A;  3OYJ A;  3FHN A;  4YIF A;  3E0J B;  1ZYR F;  3V7S A;  3CO7 C;  4V2F A;  4G7Z F;  4L9V A;  3U9G A;  5M5Y J;  4U7D A;  3VOE A;  2ME0 A;  5B3S H;  3BPV A;  5F27 A;  2EV0 A;  1ZK8 A;  4OWR B;  3J7Y J;  3OYF A;  1D3Y A;  4BYY A;  1FMW A;  1EKE A;  2RVC A;  1WH5 A;  3QU3 A;  1F36 A;  2EFP A;  4HBL A;  2V1N A;  1O4X A;  1IDY A;  2KRH A;  1SC7 A;  2DJN A;  1RR8 C;  1IV6 A;  2QLZ A;  2HNH A;  3JRA A;  4Y52 J;  1MMD A;  2BEO A;  4G6T B;  5E8G A;  2GWR A;  2R7Q A;  4B3A A;  1S7E A;  4AC0 A;  1OFC X;  5DV5 A;  4RGS A;  1S7A A;  2BV6 A;  1USS A;  3QPH A;  2FF4 A;  2E7X A;  3RIR A;  3BZ6 A;  2KP6 A;  3LFK A;  4M6X A;  5E1W A;  4P9F A;  4EM2 A;  1FBU A;  5CVU A;  2M4G A;  1UCR A;  4YEJ A;  3WU0 A;  3RKQ A;  3GTP J;  3LOC A;  3WGG A;  2I10 A;  2VPR A;  3DP7 A;  3KLN A;  3KP6 A;  4BXF A;  4WCG A;  5ILV A;  3COA C;  3GZ6 A;  2H1L A;  1GHC A;  2PMH A;  1P2F A;  4FX4 A;  1XB4 A;  2RNG A;  1FWZ A;  1BI1 A;  1IRX A;  4UVB A;  2EH3 A;  1YOV B;  2DT7 B;  1W5S A;  2JPB A;  3I9V 2;  4D7M A;  5CVI A;  5DCF A;  5H20 A;  4E7K A;  4ENN A;  4J00 A;  2DYS H;  3J80 Z;  3HXL A;  1SMT A;  4RAY A;  2QKL B;  3IP4 B;  1RUN A;  2ZME A;  2BOL A;  3DPU A;  1AWC A;  3DEW A;  3GWZ A;  1R71 A;  3VSK A;  2R7F A;  1ORK A;  1GV2 A; 
#chains in the Genus database with same CATH homology
 3HSR A;  3F6V A;  5FLX K;  2M1B A;  2A61 A;  1UB9 A;  2CWE A;  4RS8 A;  2E7W A;  1QPM A;  4HF0 A;  1E2X A;  2WV0 A;  2JRT A;  3B02 A;  2B0L A;  5D5W B;  1LB2 A;  1BIB A;  2KJC A;  2XIG A;  2DK5 A;  1OR7 A;  2PN6 A;  3CTA A;  1HW2 A;  3DV8 A;  5CVR A;  2PMU A;  3F8B A;  4GXO A;  1R58 A;  4CIC A;  1HKQ A;  1TW2 A;  4MHG A;  3FMQ A;  3C7J A;  1O7L A;  4L9N A;  4ESF A;  2W57 A;  2HKO A;  3EYI A;  3SXY A;  4Q47 A;  1XMK A;  4MGR A;  5DUI A;  5D6F A;  3J81 Z;  1T2K A;  1P6R A;  4U0W A;  2WTE A;  1K79 A;  4OIQ F;  5BQT A;  4RGU A;  1REP C;  4QLC U;  3HOS A;  1ON1 A;  3E97 A;  3OOP A;  3RDI A;  1MJ9 A;  2A07 F;  3TDU C;  1KYZ A;  2VN2 A;  4G8X A;  2DBB A;  3DPL C;  1HKS A;  1TQM A;  2XKP A;  4UHT A;  2ESN A;  3E6B A;  5LGU A;  4RB0 A;  2H27 A;  5JI6 A;  3F23 A;  1GXQ A;  3EQL F;  1MDM B;  2BGC A;  4LLN A;  1FNN A;  3GFL A;  3G3Z A;  3LA7 A;  4AWX B;  5FLX Z;  1PP8 F;  1YW7 A;  4EMS A;  4PGG A;  1IF1 A;  2NYX A;  3GF2 A;  1TQP A;  2NAZ A;  3VEP A;  1SFE A;  2E1N A;  3MCZ A;  5D6E A;  4BHC A;  1MD0 A;  2IA1 A;  1I1G A;  3QU6 A;  4P96 A;  4H0E A;  5HS7 A;  5KK1 A;  5FFZ A;  3KZY A;  3GVA A;  1IW7 F;  1IN6 A;  3I0T A;  2VXZ A;  5LBQ A;  2GXG A;  2L3D A;  3KP3 A;  3MFK A;  1R7J A;  2WWY A;  4EJW A;  1U5T A;  5ILS A;  3ZQ7 A;  4B09 A;  3TO7 A;  4ZZL A;  1ZG3 A;  1J5Y A;  4IVN A;  1S6L A;  2VC0 A;  2QBY A;  4HF1 A;  3I5U A;  3DEU A;  3O3K A;  1SAX A;  4M9X A;  1SD4 A;  4MNU A;  2IRF G;  3KEQ A;  3HYI A;  2P6S A;  5BOX A;  3BRO A;  3JAM K;  4HA8 A;  1XMA A;  4CHU A;  4G7O F;  4KA4 A;  1XCB A;  2STW A;  1B6A A;  2DW4 A;  3FMR A;  5J6X A;  2DI3 A;  5E1Z B;  1J75 A;  2GA2 A;  3E6M A;  2EV5 A;  2Z33 A;  4OIN F;  2GA1 A;  5K5Q A;  2MLG A;  3F8N A;  1WWX A;  5TJJ A;  4U0V A;  3M1E A;  3SFZ A;  1S8N A;  1TBX A;  3HSF A;  3H3U A;  3RKY A;  3BDD A;  5LEJ A;  2MBF A;  3ZN0 A;  4WXD A;  3WTX C;  3T8R A;  2OA4 A;  4MEY F;  2DK8 A;  3FM5 A;  2HS5 A;  2XKO A;  4N0B A;  4CXF A;  1ZLK A;  4I7H A;  2P8T A;  3CDH A;  1D8K A;  4KYW A;  2H09 A;  2XGX A;  5J8C A;  2HZT A;  1FBQ A;  4KT5 C;  4GYG A;  5A2Q K;  4XLN F;  4RGR A;  1J2X A;  2XAF A;  3N97 A;  2QWW A;  1R5G A;  3TOA A;  2R3S A;  4EV0 A;  3VB2 A;  3WG9 A;  4ETS A;  4BAY A;  2QYO A;  4UV8 A;  4L5I A;  1YTY A;  2M45 A;  5D5V B;  3FM3 A;  3CUQ B;  2FNP A;  2R7D A;  3PQK A;  2ZKZ A;  2XAQ A;  4OIP F;  3M7G A;  5TRD A;  2RN7 A;  5AIP A;  3M8E A;  4KIC A;  5L3E A;  3WGH A;  2PFB A;  3V7C A;  5DUK A;  3REO A;  2EB7 A;  1FC3 A;  2HFH A;  3MEX A;  4JK1 X;  1FLI A;  1BC8 C;  3FHZ A;  3S2W A;  4UVC A;  4ENM A;  1FYL A;  1D5V A;  2XRN A;  3CUQ C;  4IXA A;  1T0F A;  1MZB A;  2A5Y B;  3R60 A;  3LAP A;  2HYF A;  5K5R A;  3PFI A;  1L3L A;  2MC3 A;  5DDG A;  1KU9 A;  5DD8 A;  4BHP A;  3GW2 A;  5HDK A;  4OIO F;  4D0P A;  4Q4Z F;  4OIR F;  2DLL A;  2QUF A;  2EFO A;  3L00 A;  2MA3 A;  1FSE A;  2Z9O A;  2XHK A;  2BE5 F;  1J59 A;  2Y0M A;  2BBY A;  5CVV A;  4A0X A;  3Q5F A;  1LDK B;  5A2Q Z;  1ZG1 A;  3H3Z A;  3F21 A;  2VBX A;  1Z9C A;  1ZN2 A;  3P9I A;  4EGZ A;  4HDV A;  4WK8 F;  4L18 B;  1FPQ A;  1BM9 A;  5BPD A;  3DKW A;  1G3S A;  2P7V B;  4CZZ A;  4F7Z A;  4KMF A;  3J80 K;  3Q9S A;  1OPC A;  2JTV A;  1STZ A;  2L4M A;  5E18 F;  4IPA A;  5D4R A;  2IA0 A;  3MWM A;  1ODD A;  3W6K B;  2A3S A;  2NRA C;  3MQ0 A;  1P92 A;  4KIF A;  5JHU A;  3V4G A;  3RPQ A;  2ZNZ A;  2ISZ A;  3IRQ A;  3GX4 X;  3FF5 A;  5DCM B;  1ZAO A;  1O3S A;  1EH8 A;  2DU9 A;  3I54 A;  4HYE A;  2Q2E A;  2O8X A;  4YFK F;  3ZMD A;  1XDU A;  4R1H A;  2ZCW A;  4BH9 A;  3M9A A;  5LHH A;  2GAU A;  2A6H F;  1ZG5 A;  2JSC A;  3J81 K;  4L0Y B;  2OQG A;  4M71 A;  1DPU A;  3CJN A;  5LHG A;  1U2W A;  3V8K A;  1XCV A;  4WX9 A;  4GCV A;  4ZZD A;  3WTW C;  4MEX F;  1JHH A;  5E8I A;  3ROU A;  3K2Z A;  4A12 A;  4IJA A;  4O5V A;  3WTT C;  4O3M A;  1A04 A;  4S04 A;  1QO0 D;  2V1X A;  4PZJ A;  3SHF A;  1WI9 A;  2Q0O A;  4WXC A;  1SD5 A;  1U5T B;  2QBY B;  2M8E A;  2OQR A;  3KP5 A;  1D8J A;  1SFX A;  1IXC A;  1KA8 A;  2GZW A;  3GLX A;  2P5K A;  2FML A;  4ZH4 F;  4P55 A;  5FD6 A;  4RAZ A;  5HDN A;  2K4J A;  4HX7 A;  4Y17 A;  3E6D A;  1WQ2 A;  1HXD A;  5E1X A;  5KVR A;  4KIG A;  1YQA A;  2ADU A;  1U5T C;  3DFG A;  4WXH A;  3L09 A;  1W7P A;  2HOE A;  1RUO A;  5HLI A;  4IF4 A;  2O03 A;  3BP8 A;  4A5M A;  4HF2 A;  1W5T A;  2H6B A;  1W7P D;  1LEA A;  1TNT A;  1IXR C;  1XN7 A;  5FB2 A;  2EA4 A;  1KQ0 A;  1ZGJ A;  1FYK A;  1ZH5 A;  3ZMZ A;  1T39 A;  1DP7 P;  5HVQ C;  4OMY A;  1PP7 U;  3I59 A;  2CGP A;  3GEZ A;  2K86 A;  4XSZ F;  3LST A;  5JVT A;  2LNB A;  5F64 A;  1F4K A;  2L01 A;  4EVI A;  4FT8 A;  2D45 A;  1ULY A;  5L3C A;  2G9W A;  1FBS A;  3GFI A;  3IL2 A;  2DQR A;  1S7O A;  3WTV C;  4CO8 A;  2H94 A;  4RB3 C;  5CLS A;  1QZZ A;  1ZRD A;  1IN8 A;  3IRR A;  1VTN C;  1XGM A;  4HZF A;  4LK0 F;  2Y75 A;  4GGG A;  4LGW A;  4U7B A;  1BBY A;  3IWZ A;  5FFX A;  2LF8 A;  3F8C A;  2DPU A;  2ISY A;  2P4W A;  3SZT A;  5FO5 A;  2MH9 A;  3C18 A;  1ZHF A;  3ABU A;  2M5W A;  1UHW A;  1YLF A;  1KU7 A;  2HKX A;  3BOQ A;  3U2R A;  4AIK A;  1YW8 A;  1ZRC A;  4PDK A;  4P5O A;  3EET A;  5JFR A;  1G3W A;  1QNT A;  4DNC A;  3AAF A;  2VOP A;  2UXN A;  4G7H F;  3RYP A;  1R5H A;  3VOD A;  1Z05 A;  1H9G A;  1UST A;  2ACJ A;  2STT A;  2W25 A;  2RV8 A;  2PG4 A;  1DDN A;  4MTE A;  4N9I A;  4HOB A;  1RNL A;  3LA2 A;  5K5O A;  2ESH A;  2G7H A;  2XAJ A;  1BJA A;  4JQF A;  5LHI A;  2DAO A;  1O3Q A;  3R6S A;  2K4B A;  1SD7 A;  4I09 A;  3E5U A;  4TV7 A;  3L2C A;  2TDX A;  3I71 A;  2ZXJ A;  4I98 B;  4ENK A;  4A0Z A;  2O0Y A;  4L9T A;  2PQ8 A;  2CO5 A;  2VT2 A;  2F5C A;  1KQ8 A;  3HRT A;  3FXQ A;  3LWF A;  2L4A A;  4QWQ A;  3U1D A;  3E5X A;  2HTJ A;  2CW0 F;  3K1N A;  1YG2 A;  1HKT A;  4HV6 A;  1OYW A;  3IC7 A;  4IRI A;  1Z6T A;  5L3D A;  3GXO A;  1K7A A;  3FZV A;  1F9N A;  3V8L A;  3KEO A;  1BN5 A;  1K78 B;  1W4M A;  2EFQ A;  3ZPL A;  5L3F A;  2O61 A;  2DFI A;  2IJL A;  3WE2 A;  2ELH A;  3ZN1 A;  3T1B A;  4XSX F;  4LG0 B;  3WTZ A;  3IHU A;  2OBP A;  5ICF A;  4P9U A;  2ZBK A;  1GVJ A;  1OKR A;  3DQV C;  2AXL A;  1R00 A;  4ZYE A;  3KFW X;  2HQR A;  4FHT A;  1FOK A;  1FSH A;  1LVA A;  2UWM A;  2DQL A;  1MDM A;  5E20 A;  2W84 A;  1C0W A;  1V3F A;  2FA5 A;  1U3E M;  1J0R A;  4HV5 A;  1MKM A;  2QQA A;  3WTU C;  3V7R A;  2D1V A;  1OYY A;  3ZMS A;  1G6N A;  4AD9 A;  3RKX A;  4RB2 C;  3ZMT A;  1XGS A;  2CSO A;  2M87 A;  4UNO A;  2GXB A;  3C3W A;  5FGM A;  2JZY A;  4LB5 A;  2M30 A;  2RC4 A;  1T98 A;  5LLQ A;  1ZRF A;  4HDU A;  3RI4 A;  2O3F A;  2HEO A;  3P9K A;  1O57 A;  1S29 A;  5L3G A;  2IP2 A;  2EK5 A;  4E70 A;  5CJ9 A;  4G9Y A;  4UXN A;  1G3Y A;  1F5T A;  4M9Z A;  3HOT A;  4EM1 A;  1IRG A;  2VBZ A;  5CVJ A;  5ICG A;  3B73 A;  1SFU A;  3VFZ A;  4ESJ A;  4LLL A;  1FYM A;  5HS8 A;  3CO6 C;  4HX8 A;  3DF8 A;  2QQB A;  4HW0 A;  4EJV A;  1CF7 A;  4LLG F;  1XSV A;  2MLK A;  3KP4 A;  2XVC A;  1B59 A;  2ZME B;  2KIU A;  1OYI A;  1U6G A;  1WSU A;  4HLY A;  3LAJ A;  1BC7 C;  3RJP A;  5HLH A;  1FP1 D;  1G4D A;  1EH7 A;  1TQI A;  1IRF A;  2V1U A;  2H6C A;  3F3X A;  1L0O C;  4HX4 A;  2HYG D;  4KNY A;  1LJ9 A;  1O3T A;  3QP6 A;  1V4R A;  2QM3 A;  3HRU A;  1BI3 A;  3WE3 A;  1WRJ A;  4MQV A;  1YIO A;  2KKO A;  1W7P B;  2YPR A;  2LDU A;  2FXA A;  5L3B A;  4ON0 A;  5EEG A;  2K02 A;  3HHG A;  1J7K A;  2K7L A;  5LEK A;  3ELK A;  4M73 A;  4HQM A;  1Q1H A;  2ZFW A;  5ILU A;  4R8H A;  2G7U A;  4NHJ A;  4Z2Y A;  1FZP B;  4MQ9 F;  2P7C B;  2Q8K A;  4M72 A;  3TO9 A;  4KIB A;  3I59 B;  3ECO A;  5AON A;  3QP5 A;  1BOA A;  4Q5S F;  5DYM A;  3F22 A;  4AIJ A;  2D2W A;  2O6G E;  1HW1 A;  1LQ1 A;  1K6O A;  4UV9 A;  2W85 A;  4KFC A;  2OZ6 A;  4EQQ A;  3EDP A;  1IN5 A;  4KN7 X;  3ML6 A;  1FY7 A;  4G6D A;  2IVM A;  3R61 A;  1MGT A;  3IKV A;  2RQP A;  3SZP A;  3BJO A;  4I0A A;  1QBJ A;  1GXP A;  3N4M A;  2FMY A;  3E6C C;  3I58 A;  5CYV A;  3KE2 A;  1Y0U A;  3CUO A;  3K0L A;  5EEH A;  2COM A;  3V8J A;  4A6D A;  1YW9 A;  3HHH A;  4EM0 B;  1XSX A;  3JSP A;  1YFH A;  3ZMU A;  3OV8 A;  5D5U B;  3L7W A;  3HIF A;  1KU2 A;  3K9T A;  3D5L A;  2NS0 A;  3ZP5 A;  4I01 A;  3I64 A;  4B8X A;  1R23 A;  3F8F A;  2V1D A;  2FRH A;  3TKY A;  3WTS C;  2YR2 A;  4IHT A;  4LJZ F;  2PBI A;  3WGI A;  1G3T A;  3KLO A;  1TLH B;  2QVO A;  4IRH A;  4N9H A;  2C6Y A;  2XRO A;  5HS9 A;  2P6T A;  4I02 A;  2EJR A;  3DPT A;  2YSR A;  2DT5 A;  4YFN F;  5ICE A;  1O3R A;  1HSJ A;  3RTR A;  4JBA A;  2XV4 S;  3LQQ A;  2LSO A;  5F6F A;  3EUH A;  1FT9 A;  2EV6 A;  3KP2 A;  3MZH A;  1LDD A;  1H0M A;  3GZ5 A;  5E17 F;  2KRF A;  1TNS A;  4GO1 A;  4HQE A;  2IPQ X;  2UZK A;  4KDP A;  3GFJ A;  2PI0 A;  1EH6 A;  3M8F A;  5IT9 K;  2DTR A;  1LDJ A;  2OZU A;  2CFX A;  1CGP A;  1S3J A;  2KIM A;  4UUV A;  2K27 A;  1JE8 A;  4I2O A;  4AIH A;  2HGC A;  3WOD F;  5AIQ A;  1UHM A;  3R4K A;  4OU0 A;  4M74 A;  1JXS A;  1I1S A;  2PLY A;  3BPX A;  1Z91 A;  2FSW A;  5HLG A;  4ENJ A;  1SMY F;  5F1R A;  2Z5U A;  5IT3 A;  1TW3 A;  4IRG A;  1Z6R A;  2RGV A;  1R1U A;  1FX7 A;  1HST A;  3WTY C;  1TTY A;  2HR3 A;  3HRS A;  1I27 A;  4WWC A;  2EFN A;  1DUX C;  4ZYH A;  5H6R A;  2Z99 A;  3BWG A;  3RYR A;  3EYY A;  1YYV A;  4NQW A;  4XBF A;  1R36 A;  4U0Y A;  1ONV A;  5DCM A;  1PDN C;  1EV7 A;  4KUM A;  5BPI A;  2FNA A;  4CDG A;  2RDP A;  2OU2 A;  3T8T A;  1YO5 C;  4UVA A;  3SQN A;  4DQ2 A;  3IKT A;  1DPR A;  4BNC A;  1ON2 A;  1AOY A;  3ISP A;  4CYD A;  2RKH A;  1ZRE A;  5LRR A;  5D4S A;  1P4X A;  2PEX A;  3NEU A;  2JPC A;  1RI7 A;  4A2U A;  2L02 A;  3KET A;  2GIV A;  2Z3Y A;  3LQR A;  3ECH A;  4LD5 A;  2W24 A;  4HLX A;  3T0Y A;  4M9S A;  1JHF A;  3MAJ A;  1YS6 A;  4L9J A;  3J7A O;  2HDC A;  4YFX F;  2CG4 A;  3E5Q A;  5IT9 Z;  1F1Z A;  3E3V A;  2FE3 A;  2VC1 A;  2V79 A;  6PAX A;  4YII A;  2XUB A;  3HTU A;  4ZYD A;  2ZNY A;  3GO5 A;  1ZLJ A;  2FBK A;  2QEN A;  2Y48 A;  5D8L B;  2IT0 A;  1P4W A;  5FD5 A;  1CF7 B;  1I5Z A;  2NNN A;  3F8M A;  1KU3 A;  4I0B A;  2CQK A;  1HQC A;  1P4A A;  2J5P A;  3RPU A;  2EA2 A;  2KIF A;  1BI2 A;  3QRF F;  1RIO H;  1H9T A;  2ETH A;  5LGN A;  1BI0 A;  3O2P E;  4LB6 B;  5JR3 A;  4RGX A;  5H6Q A;  3G73 A;  3BJ6 A;  5HOO A;  2LKP A;  5ICC A;  2X4H A;  1MJB A;  2DPD A;  3R0A A;  3CLO A;  2LF7 A;  3QPT A;  3ZMV A;  3Q9V A;  1HBX G;  2F5E A;  1JGS A;  2DO7 A;  3TQN A;  1WKM A;  2P5L C;  2QZ8 A;  2VBW A;  1T6S A;  5BMZ A;  2QQ9 A;  5DEQ A;  2EWN A;  4OMZ A;  4ASN A;  5K1Y A;  1QQI A;  3C1D A;  3WU1 B;  4R79 A;  2XAH A;  2VOO A;  1R22 A;  3K1M A;  3W6J B;  3JSO A;  3GYH X;  3FX3 A;  3K69 A;  1RZ4 A;  3NRV A;  3O6B B;  2IA2 A;  1B4A A;  3HSE A;  2VT3 A;  2MH2 A;  2HTS A;  3TOB A;  4A5N A;  2VE9 A;  2V6C A;  1B9M A;  3FWE A;  1QGP A;  4EGY A;  1KYW A;  1FP2 A;  4CGZ A;  4YG2 F;  1IN7 A;  4ZYG A;  4EJU A;  1J9I A;  4BXU A;  3JTG A;  4ESB A;  4Q48 A;  4LMY A;  5ERI A;  1UFM A;  3R0J A;  3FXU A;  2RNJ A;  4XLP F;  2A68 F;  2F5D A;  2YU3 A;  1XGN A;  5HDG A;  4L5J A;  4PGH A;  3T5X A;  3QAH A;  2J5O A;  4EJO A;  2F5F A;  4M6Y A;  3L9F A;  1XDS A;  1BIA A;  1IN4 A;  1Z7U A;  2KJB A;  2L54 A;  3ULQ B;  3BJA A;  2XAG A;  3JAM Z;  4XRF A;  1X3U A;  4EJT A;  5LRS A;  1OMI A;  4MTD A;  4OOI A;  1SD6 A;  2OD5 A;  1ZAR A;  2WC2 A;  1XD7 A;  4NB5 A;  1QZY A;  2FU4 A;  2FQ3 A;  2FBH A;  3P7N A;  1XGO A;  5LGT A;  2HWV A;  2V9V A;  3HUG A;  3K1P A;  4LK1 F;  2NNY A;  2JT1 A;  2OAZ A;  3JW4 A;  1U8R A;  2D1H A;  3FXR A;  1O7F A;  3TO6 A;  4LFU A;  3KCC A;  4U88 A;  2YX7 A;  3GUD A;  4Y15 A;  3KZZ A;  4Y13 A;  3P9C A;  1IUY A;  2ZO4 A;  1IXS B;  4KN4 X;  1XSD A;  1Z1D A;  1IZ1 A;  4GYI A;  3IWF A;  1MJA A;  3BY6 A;  4IHS A;  1T38 A;  5D8K B;  1NHA A;  2HQN A;  2PJP A;  3ERE D;  4G6Q A;  1B9N A;  4FX0 A;  5BS6 A;  5D5X B;  1LNW A;  2BYV E;  1HW5 A;  4RB1 A;  1ZGA A;  5ED4 A;  4L0Z B;  2AS5 F;  1R1T A;  4KMU X;  2XAS A;  3PQJ A;  2ZJ2 A;  4BQA A;  2A6E F;  5J8F A;  1B1B A;  3I53 A;  2VON A;  3LA3 A;  2E1C A;  3HRM A;  4O6J A;  1K78 A;  2X0L A;  3JTH A;  2MD5 A;  4HAM A;  3GFM A;  1KQ9 A;  1IAW A;  4A6E A;  4PCQ A;  1U78 A;  3I4P A;  3MZY A;  4LG0 A;  2VE8 A;  2VBY A;  4AVP A;  4K2E A;  1I6X A;  2VOD A;  3DXJ F;  3D0S A;  2FOK A;  1KGS A;  3FMS A;  3KP7 A;  2EFW A;  1LEB A;  1R1V A;  3QOP A;  2CYY A;  2GQQ A;  5DD4 A;  2UXX A;  2P5V A;  4A0Y A;  3RKW A;  3NQO A;  3HTS B;  2F2E A;  1E17 A;  4G94 A;  4BHB A;  3TGN A;  2A69 F;  3TDZ C;  1PUE E;  3CUQ A;  3ABT A;  4S05 A;  1YS7 A;  2IW5 A;  2YX4 A;  2FBI A;  3H92 A;  3F6O A;  3F72 A;  4WF2 A;  2FEZ A;  4YIF A;  1ZYR F;  3V7S A;  3CO7 C;  4G7Z F;  4L9V A;  3U9G A;  4U7D A;  3VOE A;  3BPV A;  2EV0 A;  1D3Y A;  4BYY A;  2RVC A;  3QU3 A;  2EFP A;  4HBL A;  2QLZ A;  2BEO A;  5E8G A;  2GWR A;  5DV5 A;  4RGS A;  1S7A A;  2BV6 A;  1USS A;  3QPH A;  2FF4 A;  2E7X A;  3RIR A;  3BZ6 A;  5E1W A;  3LFK A;  4M6X A;  4P9F A;  4EM2 A;  1FBU A;  5CVU A;  1UCR A;  3WU0 A;  3WGG A;  3DP7 A;  3KLN A;  3KP6 A;  4WCG A;  3COA C;  5ILV A;  3GZ6 A;  1GHC A;  2PMH A;  1P2F A;  4FX4 A;  1XB4 A;  1FWZ A;  1BI1 A;  4UVB A;  1W5S A;  2JPB A;  5CVI A;  5DCF A;  5H20 A;  4ENN A;  3J80 Z;  1SMT A;  4RAY A;  1RUN A;  2ZME A;  1AWC A;  3GWZ A;  2R7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...