3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
4MEYF 2NRAC 1TW3A 1YQAA 5ILVA 5D8LB 3I53A 5FD6A 3TKYA 5IT9K 2EFQA 5CVJA 2JTVA 2OQGA 4WCGA 2G7HA 3HYIA 3QOPA 2HYFA 2J5PA 1IN8A 1U8RA 5BS6A 4M6XA 1RUNA 4LK1F 4ZYHA 3FM3A 1YS7A 4G94A 5DD8A 1K78B 1XDUA 3TQNA 1MJBA 3E6BA 3P7NA 2DQRA 1R23A 4UXNA 2FBKA 1ZGJA 2IW5A 3BY6A 1J7KA 1Y0UA 2RNJA 3O3KA 4N9HA 4JQFA 3ERED 2PBIA 1RUOA 1XMKA 5DCMA 2OZUA 2XASA 4BHBA 1S8NA 4HX8A 3WTSC 5JHUA 3TO6A 3N4MA 2WTEA 1MDMA 3E5XA 1YYVA 4HDVA 3KE2A 3LA2A 1K79A 4LLGF 4R79A 5D4RA 4A12A 3LSTA 2XIGA 2FU4A 2GQQA 4IHSA 4OIQF 4D0PA 1FSHA 4P9FA 3HHGA 4KMFA 4AIHA 3K69A 2D1VA 3DXJF 3CUOA 3HSEA 4PZJA 1T38A 3ABUA 1BN5A 2VT2A 4M71A 3ML6A 4EV0A 4WX9A 3FMQA 2CFXA 2J5OA 1ZYRF 3QP5A 2BYVE 2KKOA 1P6RA 3KZZA 4BNCA 2MH2A 1R5GA 4N0BA 3P9CA 5AONA 3WGHA 1IXSB 1QQIA 1G3YA 2W85A 2ZNYA 2ZO4A 4YG2F 2H6BA 3ZP5A 1AOYA 1ULYA 3FXRA 2FA5A 2M8EA 4HF0A 1B9MA 3V7CA 1D8KA 5BOXA 4IVNA 2NYXA 3P9KA 2CO5A 5L3CA 5E1WA 5BMZA 4HLXA 3J80K 1IF1A 2BE5F 2VC1A 1SFUA 3FHZA 4AWXB 1PP8F 3PQJA 3I59B 1U2WA 4HQEA 1BI0A 4YFNF 3RPUA 3C3WA 3L7WA 3LWFA 3WODF 2GZWA 3I5UA 3KFWX 2HEOA 1KGSA 4RGSA 3ZN1A 3H3UA 2QENA 3KP3A 2DLLA 4HLYA 3V8LA 4AIKA 3HHHA 2C6YA 4U0YA 3DP7A 5DEQA 3PQKA 3MAJA 2NNYA 1XB4A 3GX4X 3JSOA 2G7UA 3CTAA 2EK5A 3GYHX 4YIIA 2VOPA 4UV9A 2STWA 1XCVA 1TQIA 2IA2A 3EYYA 1UFMA 2KIMA 2HGCA 1JE8A 5FFXA 4Q4ZF 2JPCA 4RB0A 4CHUA 1P4WA 5CYVA 1IAWA 4YIFA 1Z91A 2HQNA 3TDUC 1JHHA 1ZG5A 2MA3A 2FXAA 2V1XA 2O61A 5DDGA 4BYYA 3U9GA 4PGHA 4GYIA 2VODA 1FLIA 2F5CA 4IF4A 4RB2C 4UVBA 4ZYDA 2EFPA 2VC0A 1OYIA 2JPBA 5J8FA 4M6YA 3I54A 4RGUA 2EV6A 2KIFA 4KFCA 1I1SA 4RGRA 4M9XA 4EGZA 4U0WA 2FEZA 4CO8A 3T1BA 1B6AA 5ICFA 4KIFA 1T98A 2UXNA 1XSVA 1T0FA 5K1YA 3FMSA 1EH7A 2VN2A 2HQRA 4G6DA 5A2QZ 5FLXK 2PQ8A 3CO7C 2ZBKA 1ON1A 3MZYA 5D6FA 3F22A 1GHCA 4U0VA 3B73A 5E8IA 4HQMA 1HSJA 2PLYA 2M87A 2TDXA 3RKYA 2F5DA 2QZ8A 2V6CA 3DPLC 1KA8A 1IN4A 1R7JA 4OIPF 2EV5A 4R1HA 3JTHA 1WKMA 3KEQA 2L01A 1HBXG 3SZTA 1FX7A 4G7ZF 2A6EF 5ILSA 4U7DA 4LFUA 1WI9A 3F8FA 1B4AA 3H3ZA 3FZVA 1YO5C 3IC7A 2Y0MA 4YFKF 1XSDA 4GGGA 4ZYEA 4MGRA 3RJPA 4XBFA 3F8MA 5K5RA 4A6DA 4FHTA 3F6VA 4KN7X 4M9SA 3VEPA 1OR7A 3BJOA 4Q48A 2XVCA 1PDNC 2P6TA 2RKHA 3GFLA 2Z33A 3FXQA 5D4SA 1L0OC 4KIBA 4WWCA 1I1GA 3DV8A 4S05A 4L9VA 1G3TA 3HOSA 2PN6A 2RQPA 4IRHA 5H20A 3RYPA 2P5LC 2QBYB 2H27A 3WU1B 3VFZA 4HF2A 1T2KA 3MQ0A 1FPQA 3QP6A 4RB3C 2A68F 3FM5A 1BIBA 2HYGD 4XLPF 3IL2A 3E6CC 3HTSB 1HKQA 2ZXJA 2VBZA 3E5QA 1U6GA 1SFEA 1GXPA 4I02A 1DUXC 1O3TA 2ESNA 1DPUA 4IHTA 4BH9A 4RGXA 2Z3YA 5FD5A 2L4MA 2WWYA 5DUIA 4RAZA 1HW1A 3RTRA 4OINF 5F6FA 4LMYA 3GFMA 1ZAOA 1VTNC 3L9FA 1ZH5A 2H09A 3QAHA 3T5XA 1TQPA 2P4WA 4OIRF 5E18F 2FMYA 5HLIA 2G9WA 2OBPA 4LLLA 1SD5A 5LGTA 1UCRA 4M72A 3KP4A 1J59A 2E7WA 3JTGA 3EDPA 4HX7A 1R00A 2CW0F 4XRFA 4OMYA 2D1HA 3GFIA 3OV8A 3ZMUA 4ENJA 2VONA 2COMA 3SFZA 4BAYA 1J5YA 1MKMA 4Q47A 4ESBA 4IJAA 2KIUA 3PFIA 2EA2A 3TOAA 2DBBA 1UHMA 1R58A 4ESFA 3DQVC 5IT9Z 3I64A 2CG4A 3HIFA 1FZPB 3KZYA 5JR3A 4YFXF 5D8KB 1ZLKA 1FBSA 3WU0A 3J81K 4ZZLA 1R1UA 1DPRA 5L3EA 3E3VA 4B09A 3CUQA 3RI4A 2R7FA 3W6JB 1PP7U 3LFKA 4ON0A 2BEOA 1H0MA 2RDPA 2FQ3A 3CLOA 1R36A 1TTYA 4Y15A 1BIAA 2W57A 3MZHA 3ZMVA 4OU0A 1FBUA 1J2XA 1LEAA 5L3FA 1RI7A 2RV8A 1UB9A 2GA1A 4DQ2A 5D5XB 4MNUA 2OD5A 5HOOA 3P9IA 3V8JA 5HVQC 2GXGA 4I0AA 2XAGA 2LKPA 3O6BB 1QBJA 4L18B 1OYYA 1SAXA 3TGNA 5H6RA 2EB7A 4CICA 4LD5A 5EEGA 3WGIA 5DUKA 3GO5A 2E7XA 1B59A 5TRDA 1ZN2A 3R60A 1V4RA 2ACJA 2IRFG 3C7JA 2VBXA 5LHGA 2RN7A 2EV0A 4HF1A 2UXXA 1LEBA 1HKTA 1XGMA 2IA0A 1OPCA 4WXCA 3EETA 5FFZA 3L2CA 4LG0B 2A69F 4EM1A 1K78A 2EFOA 4PDKA 1USTA 4NHJA 2RGVA 3GXOA 3JAMZ 4NQWA 5HS7A 2ZCWA 3RDIA 1IXCA 1EH8A 2QM3A 1B9NA 3Q9SA 4I09A 3E5UA 3ZN0A 2DFIA 2BV6A 1J75A 2M30A 2XROA 3J80Z 2O0YA 4KA4A 2H94A 1ON2A 4G7HF 2ADUA 4EM0B 2A3SA 3F8BA 1IZ1A 4Z2YA 2BGCA 1BI3A 5LGNA 1TW2A 1SD6A 4Q5SF 2QUFA 5BPIA 1K6OA 2IVMA 4ENMA 3KETA 3J7AO 1HKSA 1ZGAA 4KMUX 1D5VA 4M9ZA 5AIPA 1O3QA 2QWWA 1OKRA 4OMZA 1S7AA 4XSXF 3F6OA 3V7SA 2A5YB 4L5JA 4ASNA 2P7CB 4KYWA 3TDZC 4A0ZA 1PUEE 2CQKA 2HR3A 3BPVA 5DV5A 1S3JA 2UWMA 2MC3A 2GAUA 5ICCA 2YX7A 2P8TA 3BP8A 3WGGA 1AWCA 2K4JA 2M45A 4RS8A 4EJVA 3NRVA 1IN6A 2EA4A 5FO5A 5K5OA 5BQTA 1QO0D 3NQOA 1CF7B 5BPDA 3F8CA 3GZ6A 5HDNA 1NHAA 2STTA 2ZMEB 5ED4A 3BJAA 1UHWA 3BPXA 2E1CA 3F23A 4H0EA 4WXHA 3GZ5A 1U5TC 4HW0A 2VBYA 5E8GA 3HSFA 4DNCA 2HDCA 1XGSA 2A07F 3GVAA 2GWRA 3K1PA 3CO6C 3I59A 1FNNA 2QYOA 2P7VB 2DU9A 2HS5A 2IT0A 5E20A 2ZJ2A 3GLXA 5ERIA 1LB2A 2K7LA 2OZ6A 2F5FA 4U7BA 4PGGA 1YW9A 4MEXF 4TV7A 2JSCA 2KJCA 4XSZF 3HRSA 2ZFWA 3IRRA 5DD4A 2XUBA 2MD5A 5J8CA 1LDDA 1T39A 4UVCA 5KVRA 4I98B 1TBXA 3QPHA 1W5TA 4P55A 1A04A 1R1TA 3T8TA 1F9NA 4WK8F 2A61A 1SMTA 2JT1A 3DFGA 1V3FA 1KU3A 1IN5A 1XD7A 4N9IA 3M8FA 3TO7A 2ZKZA 1XGOA 1Z1DA 1XDSA 1KQ9A 2W24A 3QU3A 4BXUA 2WV0A 3M9AA 1QZYA 4G7OF 1Q1HA 4Y17A 5E1XA 1HW2A 1IXRC 2XAFA 4UNOA 1FOKA 1DDNA 4EMSA 2UZKA 2HKOA 1U5TB 1W7PB 1MD0A 1ZARA 4KNYA 2L54A 2XAJA 4HYEA 4E70A 3V4GA 4WF2A 2MLKA 4LLNA 3KCCA 4EJUA 1YFHA 3IWFA 2DT5A 3G3ZA 2DO7A 2CWEA 4O3MA 1GVJA 2EFWA 1C0WA 4G8XA 4HV6A 3AAFA 3GF2A 2XAQA 1Z05A 3DPTA 2V9VA 5TJJA 2LNBA 2D45A 2Z9OA 1ZRDA 2BBYA 4GXOA 5JI6A 2CGPA 3CUQC 3LA3A 1IUYA 3ABTA 1TQMA 3H92A 2VBWA 3L00A 3JSPA 4A0XA 3FX3A 2DW4A 3E6DA 3R0AA 4IRGA 2R7DA 1R1VA 2FE3A 2VT3A 5ILUA 2QQBA 2F2EA 2XKPA 2OAZA 4ETSA 5LRRA 2OU2A 2OQRA 4ESJA 3HTUA 3FMRA 1QPMA 3QRFF 4GO1A 4EJWA 3R6SA 2RVCA 1S6LA 3IHUA 2HTSA 1LQ1A 3KLNA 5HLHA 4EQQA 2XAHA 3BJ6A 4HA8A 1ZREA 4ZZDA 1TLHB 2Y75A 3LA7A 3K1NA 2YU3A 3O2PE 1HXDA 1EV7A 2PG4A 4G9YA 2VE8A 5LGUA 2QLZA 2DPDA 3ZMDA 2PEXA 1F4KA 4QWQA 1FBQA 2XKOA 2YX4A 2O03A 1STZA 3HOTA 1I5ZA 3BWGA 4PCQA 5L3BA 2FNPA 4XLNF 2HOEA 3IWZA 2V1DA 3ECOA 2QQ9A 3M1EA 4LB6B 1D3YA 3RIRA 3I58A 2WC2A 2LF7A 2FRHA 4S04A 4MQVA 3FXUA 2GA2A 4KICA 2QBYA 2FSWA 5D5UB 5DCFA 4ENKA 2PMHA 1BJAA 1LDKB 2V1UA 4EJTA 2ISZA 4I7HA 2IJLA 1YS6A 2RC4A 1G6NA 5FGMA 4BQAA 5DCMB 3WG9A 5CVRA 1E2XA 1SD4A 2EWNA 3ELKA 3C18A 3D0SA 4L9NA 3S2WA 1BI2A 1J9IA 2XGXA 2MLGA 3WE2A 1MDMB 3E6MA 2L4AA 2HWVA 2O6GE 1G3WA 3DF8A 2CSOA 1IW7F 3CDHA 4M74A 4CYDA 4AD9A 1H9GA 2MH9A 2PJPA 5LBQA 4L9JA 4I0BA 3BROA 3KLOA 3EQLF 2O3FA 1O3SA 3DKWA 3WTYC 5J6XA 4AVPA 1DP7P 3ISPA 4L9TA 3RKXA 2KJBA 3KP2A 4EM2A 2Q8KA 1F5TA 5EEHA 4KN4X 3GWZA 1I6XA 1E17A 5F64A 4K2EA 2LSOA 5LEJA 1KYZA 4CGZA 1FT9A 3M7GA 1QNTA 4MTDA 4ZH4F 3F21A 4BHPA 2OA4A 3IRQA 1SFXA 3MWMA 1S7OA 2ESHA 2IP2A 4FX4A 1KYWA 4L0ZB 2DAOA 2IPQX 1H9TA 1YW7A 1YLFA 5D5WB 2FBIA 2CYYA 5D6EA 2H6CA 5CJ9A 2M1BA 3WTUC 1O3RA 3SHFA 3GFJA 1MGTA 4A6EA 1FYLA 2PFBA 2JZYA 2XV4S 5LLQA 1O57A 1IRFA 5HDKA 2VOOA 2E1NA 3U1DA 5D5VB 3FF5A 1G3SA 3C1DA 2Y48A 4EJOA 2ETHA 2ISYA 4A2UA 1HSTA 2YSRA 3OOPA 2Z99A 3QPTA 5E17F 1S29A 3LAPA 4A0YA 3EUHA 3ECHA 4L0YB 3VOEA 4IPAA 1FSEA 1MJAA 3I0TA 3REOA 3ZMTA 3GEZA 3MEXA 3JAMK 3NEUA 2P5VA 2B0LA 3F8NA 2VXZA 1Z6RA 2X0LA 2ZNZA 1BC7C 4CDGA 1ONVA 1BOAA 5HDGA 3RYRA 1G4DA 5LHHA 3LQQA 3MFKA 4G6QA 4HAMA 1XN7A 3IKVA 2Q0OA 2GXBA 4A5MA 1B1BA 3RPQA 3KEOA 2GIVA 3DEUA 5L3GA 1LVAA 5L3DA 2HKXA 2JRTA 4LG0A 3ZQ7A 1RZ4A 3HRTA 3MCZA 4IXAA 2DQLA 1HW5A 4NB5A 1KU7A 1WRJA 1GXQA 1YG2A 1R5HA 5CVIA 1XMAA 2NNNA 3R61A 2FBHA 4GCVA 1YTYA 4FT8A 4KDPA 1TNTA 5HLGA 5KK1A 1D8JA 4CXFA 5AIQA 3KP7A 3FWEA 3F3XA 1WWXA 4I2OA 1JXSA 5ICGA 3HRUA 3ZMSA 4HX4A 3G73A 1L3LA 1BC8C 1LNWA 1XGNA 1O7LA 4HDUA 4GYGA 3ULQB 2L02A 1BBYA 2P5KA 2Z5UA 1K7AA 1O7FA 1X3UA 3L09A 2QVOA 4B8XA 2O8XA 2QQAA 3I71A 4MQ9F 3ROUA 4HBLA 5JVTA 2D2WA 4M73A 1KU2A 1W7PD 4JBAA 2PI0A 1QGPA 2FOKA 2EFNA 2L3DA 3K1MA 5FLXZ 4P5OA 1Z9CA 2M5WA 1ZG3A 1ODDA 1FYKA 2ELHA 1OYWA 2F5EA 5LHIA 2AXLA 2YR2A 1CF7A 2P6SA 3M8EA 4LK0F 4LGWA 3N97A 3QU6A 2V79A 2ZMEA 3HUGA 1LJ9A 4HOBA 1IN7A 4RB1A 1I27A 1KU9A 3LAJA 4OOIA 2VE9A 1CGPA 4U88A 3WTZA 3R0JA 1ZRFA 1FYMA 2PMUA 3ZMZA 5ICEA 2KRFA 1XCBA 1BM9A 5A2QK 3D5LA 5FB2A 2XHKA 2FNAA 2X4HA 4A5NA 4UVAA 3SQNA 4LJZF 3KP5A 2K27A 3SXYA 3V8KA 1FC3A 1FP2A 2FMLA 3WTTC 3COAC 1MZBA 1BI1A 2LF8A 2Q2EA 1USSA 2IA1A 4QLCU 2MBFA 2K02A 3TOBA 3Q9VA 1FWZA 5HS8A 3VB2A 5LEKA 3K0LA 3W6KB 5DYMA 1RNLA 4FX0A 2FF4A 4KIGA 1Z6TA 2LDUA 4UHTA 4R8HA 1RIOH 3EYIA 1YW8A 1U78A 3T8RA 1OMIA 4Y13A 1P92A 3R4KA 1F1ZA 2W25A 5CVVA 3WE3A 5LRSA 1TNSA 4BHCA 3V7RA 5JFRA 2K4BA 1FP1D 3BOQA 1MJ9A 4KUMA 4JK1X 2A6HF 1SMYF 3Q5FA 6PAXA 3K2ZA 2DK8A 4O6JA 1KQ8A 2HZTA 2HFHA 1U5TA 1W7PA 3GUDA 5HS9A 2AS5F 2W84A 4UUVA 5F1RA 2XRNA 4HV5A 3JW4A 1LDJA 2DPUA 1ZLJA 4OIOF 1Z7UA 5IT3A 4L5IA 3IKTA 4MTEA 3RKWA 3GW2A 3SZPA 2DK5A 4I01A 4RAYA 3BZ6A 3ZPLA 3F72A 1J0RA 4EVIA 1JGSA 1SD7A 4KT5C 3B02A 1P4XA 2YPRA 5E1ZB 2DI3A 4HZFA 4CZZA 1P4AA 3K9TA 1U3EM 1REPC 3WTWC 5CLSA 5K5QA 5H6QA 3VODA 1HQCA 3CUQB 1QZZA 1W5SA 4ZYGA 3WTVC 3T0YA 1P2FA 1ZRCA 4P96A 4AIJA 2NAZA 3HSRA 1FY7A 4IRIA 3CJNA 1ZHFA 3WTXC 4ENNA 4WXDA 1KQ0A 2K86A 4F7ZA 3U2RA 1R22A 2R3SA 2DTRA 1XSXA 4UV8A 3HRMA 2NS0A 3I4PA 1T6SA 3LQRA 2EJRA 3J81Z 3BDDA 1JHFA 1ZG1A 3E97A 1W4MA 4LB5A 3KP6A 1IRGA 4O5VA 1YIOA 1WQ2A 4P9UA 4EGYA 2HTJA 4MHGA 1EH6A 1WSUA 3TO9A 5CVUA
chains in the Genus database with same CATH superfamily
4MEYF 3BTCA 3A03A 2NRAC 1OISA 1TW3A 3IH2A 1YQAA 5ILVA 5F0FA 5D8LB 2V9KA 1MBHA 3I53A 4DYQA 5FD6A 3TKYA 5IT9K 2EFQA 5CVJA 1QRYA 2JTVA 2OQGA 3NARA 1MSEC 4WCGA 1TT5B 2G7HA 3HYIA 3QOPA 2HYFA 2J5PA 2K9SA 1IN8A 9ANTA 1S9HA 1U8RA 5BS6A 3FHNA 2CQ7A 4M6XA 1RUNA 2Z2SB 3GMEA 4LK1F 3VWBA 2O5RA 4ZYHA 3CCSI 1NG6A 3FM3A 1T8IA 3VPRA 1YS7A 4E7SA 4G94A 5DD8A 3RPUD 2R7WA 1K78B 1XDUA 3TQNA 1MJBA 1D0YA 3E6BA 3P7NA 4A93J 3DEWA 5IYBJ 2V4JC 4B43A 3GTJJ 2DQRA 4BJTA 3A0BC 1R23A 2I5UA 4UXNA 5KNLA 4NQWB 4JYKA 3OYHA 1Z0XA 1MSFC 1T56A 2VJIA 2WAQA 4B48A 2FBKA 1ZGJA 2IW5A 2R0QC 3BY6A 4NBQA 1J7KA 3S8PA 1Y0UA 3H0GJ 2RNJA 3O3KA 4JX4A 3A1YA 4N9HA 4JQFA 3ERED 2PBIA 1RUOA 2EIKH 1XMKA 1MBFA 5DCMA 2NVUB 3BC8A 2OZUA 2XASA 4BHBA 4KITB 3PSIA 1S8NA 2GBYA 3KZIC 5M3MJ 4HX8A 1N77A 3WTSC 5JHUA 2EBIA 3CZ6A 4CSWA 3TO6A 3CC7I 3IV5A 2F4IA 4M3GA 3N4MA 1KZHA 2WTEA 1MDMA 5KCMA 2EIJH 4C3JJ 1S5LC 3E5XA 1YYVA 4HDVA 1VQ5I 3KE2A 1SVMA 3LA2A 1F36A 1K79A 5GAHJ 2OUMA 4LLGF 4R79A 5D4RA 4A12A 5EYRA 3LSTA 2XIGA 1G59A 3RCOA 2FU4A 2E36A 5GTHC 3H3VK 2GQQA 4IHSA 4OIQF 4D0PA 3HKZN 1VQMI 1W0TA 1FSHA 4P9FA 1A6IA 2W4SA 3HHGA 4KMFA 4ZJZA 2VQHA 4AIHA 3K69A 5FKMA 2D1VA 2X6XA 2WV1A 3DXJF 2JA2A 2M34A 3CUOA 3HSEA 4PZJA 4XICA 1OQYA 3OL3A 3ZQQA 2PX9A 1T38A 3ABUA 1BN5A 2Y9YA 1RESA 2VT2A 2XRLA 3JRHA 4M71A 3HOYJ 4A3BJ 1VFCA 3ML6A 2QSFX 4EV0A 3FMQA 4WX9A 3G6EI 2CFXA 1MMNA 2J5OA 3O8GA 1ZYRF 3QP5A 2CQNA 2BYVE 3OWTA 2KKOA 1P6RA 3KZZA 4BNCA 2MH2A 2DA5A 1R5GA 2DOAA 3AKZA 5GAEJ 4EEFG 4N0BA 4PFPA 3FIWA 3P9CA 5DS9A 2ID6A 2HDWA 5AONA 3WGHA 1IXSB 1BR4A 1QQIA 3J7YJ 1G3YA 1NH3A 1WGXA 2W85A 2ZNYA 3CC4I 2ZO4A 3C2BA 4YG2F 1AU7A 2H6BA 3ZP5A 1AOYA 1ULYA 1R49A 3FXRA 2FA5A 2M8EA 3QYFA 5EG0B 4DGWB 5F0HA 1A31A 4HF0A 1B9MA 1W36C 4NC8A 3V7CA 4XN0A 3OSGA 1OCZH 1RPWA 1MNEA 1D8KA 1K83J 2QEXI 5BOXA 1FOYA 2CS3A 2LREA 1SAUA 4IVNA 2JA6J 1D0XA 2NYXA 3P9KA 2CO5A 3HBLA 5E1WA 5L3CA 3CMYA 5BMZA 4HLXA 2M0MA 4DBQA 1WZ2A 3J80K 1IF1A 3BTJA 5M3FJ 5EDNA 2BE5F 2VC1A 1SFUA 3FHZA 4AWXB 1PP8F 3PQJA 3VSLA 1Z3YA 2HDDA 3I59B 1U2WA 4HQEA 1BI0A 4B3XA 1Y0NA 1DU0A 4YFNF 2KFDA 3RPUA 2MSYA 3C3WA 4A3KJ 2E2HJ 3L7WA 3LWFA 2ME6A 1D0ZA 3WODF 2GZWA 2LRDA 4CCLA 3I5UA 4OAYA 3KFWX 2HEOA 4S0HB 4II3A 1KGSA 4RGSA 3ZN1A 4BJ5C 3PL8A 2Y2ZA 3MKWB 3H3UA 2QENA 3KP3A 2DLLA 4HLYA 2AHQA 1VZ0A 3V8LA 3ABMH 4C3HJ 4HNTA 4AIKA 3CDLA 3HHHA 4PK4A 2C6YA 3TMOA 1FJLA 2DCEA 4U0YA 3IUOA 3DP7A 5DEQA 3PQKA 3MAJA 1I3QJ 2NNYA 1Y8RB 1KONA 1T95A 1XB4A 4N4NB 2KISA 3W2WA 3GX4X 1Q1VA 4XKCA 3K4NA 4E7HA 4YIRX 2LY1A 3JSOA 4F55A 2G7UA 4FCYA 3S3MA 1IO2A 3D5RC 4OWRB 2V6EA 1X4PA 5C4XJ 3CTAA 4KT6A 2EK5A 2WA0A 4AVZA 3GYHX 2BZTA 4YIIA 1RR8C 2VOPA 4UV9A 2MD0A 2STWA 1XCVA 1TQIA 2IA2A 3EYYA 4BQNA 1UFMA 3G1LA 2KIMA 1GVDA 2HGCA 1JE8A 5FJ8J 3MKYB 5FFXA 4Q4ZF 4RM3A 2JPCA 1VQOI 5GPAA 5M5YJ 2WY8Q 3OIOA 1RC9A 4RB0A 4BXFA 4CHUA 1P4WA 4XL9A 5CYVA 1IAWA 4YIFA 4X0GA 1Z91A 2ME0A 1JGGA 2HQNA 3TDUC 4Y7NJ 3SJMA 1JHHA 1ZG5A 3BR0A 2KL4A 2MA3A 4HSTA 4F92B 5E3MA 2FXAA 2V1XA 5EGOA 2O61A 5DDGA 4BYYA 3U9GA 4DIQA 3H0DA 1X1PA 2OF7A 4PGHA 2KZVA 4GYIA 2NVXJ 3IP4B 2VODA 1FLIA 2E1MB 3DKYA 2QSGX 3OL4A 4BKXA 2F5CA 4IF4A 4RB2C 1GV5A 5IOYA 4BUPA 4KJZA 2X1EA 4UVBA 4ZYDA 2EFPA 2VC0A 3K4JA 1OYIA 2JPBA 3NWTA 1JJ6C 2E2IJ 2WADA 5J8FA 4M6YA 3I54A 2CW8A 1ZR4A 4RGUA 1U0JA 3Q0WA 3HL2A 2EV6A 3I4NJ 2KIFA 3SEZA 1QZEA 4KFCA 1I1SA 4RGRA 3DLAA 2IS2A 4M9XA 2R5YA 4IOAF 4EGZA 4XKVA 1JTYA 4U0WA 1MBKA 2FEZA 2XC7A 2B9SA 4CO8A 1VI0A 3T1BA 3CCRI 5IP6A 3K4BA 1B6AA 1MH3A 5ICFA 2KPMA 3M3YJ 4KIFA 3HOVJ 1T98A 1AA7A 2UXNA 1XSVA 1T0FA 4DYRA 3OYKA 5K1YA 3FMSA 3DBHB 1EH7A 4D5CA 3AG2H 2VN2A 2HQRA 4G6DA 5A2QZ 4C2UA 5FLXK 2PQ8A 3CO7C 1X1CA 2LD5A 4CUGA 5HNFA 2DJIA 2DN0A 5GADJ 2ZBKA 1ON1A 1U9NA 3MZYA 3OOUA 5D6FA 3F22A 3AFHA 4U0VA 1GHCA 2GOXB 3B73A 2V26A 3OR1C 5E8IA 1EA3A 3PIPF 1YRNB 4RMNA 4HQMA 1HSJA 3TP3A 5BNGA 1MBGA 2M87A 2PLYA 3S14J 3CCMI 4J19A 1TZLA 2TDXA 2MABA 4CCNA 1OCCH 3MKLA 3RKYA 2F5DA 2QZ8A 2V6CA 3DPLC 1KA8A 2FD5A 2HPMA 1IN4A 1R7JA 4OIPF 1LPQA 3M8JA 2EV5A 2Q1ZB 4R1HA 1JKOC 3JTHA 1R4MB 1WKMA 2QQ8A 3KEQA 2L01A 1HBXG 3SZTA 4XIDA 1FX7A 1BW6A 1QPIA 4G7ZF 2WBMA 2A6EF 5ILSA 3AL0C 1VQNI 1ACIA 4U7DA 4LFUA 3K70D 2DMTA 4XONA 1JKRC 4V2FA 3IH3A 1VQKI 3OYEA 1WI9A 3F8FA 1B4AA 2IGNA 3K4KA 4XN3A 4LIUA 3H3ZA 4XNFA 2VIXA 2XSJC 3FZVA 4RLFA 1MMGA 1QVTA 1YO5C 3IC7A 1K61A 2Y0MA 4YFKF 3H36A 1XSDA 2MYSA 2X6YA 1WHUA 3QYBA 2DOEA 4GGGA 4ABZA 4ZYEA 4MGRA 1ORKA 3RJPA 3IH4A 4XBFA 3F8MA 5K5RA 4DOZA 1XX5A 3K2AA 3CESA 4FHTA 4A6DA 3F6VA 3ASNH 1PUFB 4FETA 4KN7X 4M9SA 1FMWA 2L7KA 1IV6A 2O9LA 3VEPA 4D9JA 2R7QA 4HG2A 1OR7A 3BJOA 4Q48A 2XVCA 1PDNC 4IHVA 2P6TA 3O8HA 1PYVA 3GTMJ 2RKHA 3GFLA 4FISA 2NVTJ 2CQQA 2Z33A 1WVRA 3FXQA 5D4SA 1L0OC 4KIBA 5J3LA 4WWCA 1I1GA 3DV8A 4L9VA 2DMPA 2CJJA 4S05A 1G3TA 3LSPA 3HOSA 2PN6A 2QKMB 4CA0A 2RQPA 2LVSA 2R7VA 4IRHA 1QVUA 5H20A 4UUSB 1WJAA 3RYPA 2P5LC 3Q0UA 2QBYB 3W2AA 3PFYA 5DM7F 3DEEA 5B1BH 5E3LA 2H27A 3WU1B 3S32A 3VFZA 1V5GA 4HF2A 1T2KA 3S2HJ 3MQ0A 4ZDLA 1FPQA 1UG0A 1FTTA 2QF7A 4C3IJ 1IUFA 3QP6A 4RB3C 2A68F 3FM5A 4XLAA 1BIBA 4XKWA 2HYGD 4XLPF 3B6CA 4CCKA 3IL2A 1RRJA 3LSIA 3E6CC 1YE9A 3HTSB 3ZQFA 3QPLA 4A3FJ 3D1NI 1HKQA 3C2GA 4NUBA 2RQQA 4LG3A 2ZXJA 2VBZA 3OYAA 3E5QA 5F08A 1U6GA 1SFEA 2M7BA 1GXPA 4I02A 1DUXC 2Z1DA 1O3TA 3KIOA 2ESNA 2JK3A 3PM1A 1DPUA 3S1QJ 1UG2A 4IHTA 4BH9A 1I3AA 2XB5A 2Z3YA 4RGXA 5FD5A 2GIZA 2L4MA 2WWYA 2LTPA 5DUIA 4AU7A 4RAZA 1HW1A 3RTRA 5IYDJ 4OINF 3A01B 5F6FA 4DZPA 1Z21A 2CH0A 2HZDA 3BR3A 2XF5A 3GFMA 4LMYA 3DTKA 1ZAOA 1LFBA 1DP3A 3GCMA 5J1RA 1WH7A 2BHZA 2XPUA 1V55H 3L9FA 4BDZA 1VTNC 4XRSA 1ZH5A 1FOWA 2YS9A 2N8GA 2H09A 3QAHA 3T5XA 1TQPA 3ZXSA 2P4WA 2OV7A 4OIRF 5E18F 2FMYA 3FDYA 3A2KA 5HLIA 1VQ6I 2G9WA 3C2HA 2OBPA 3EPZA 4LITA 4LLLA 2ZC2A 1SD5A 1Z3XA 2WB1A 5LGTA 1QU3A 3QQAA 1UCRA 2M2EA 3KP4A 4M72A 2XPWA 1J59A 2E7WA 3JTGA 2VJ4A 3EDPA 3CC2I 4BU2A 4HX7A 1BW5A 1R00A 4E4HA 2CW0F 3UKGA 3HXLA 3EUHC 4XRFA 2WY7Q 4OMYA 2D1HA 1K6YA 3GFIA 5B5EC 2CQXA 2OCEA 3OV8A 3QWLA 3OY9A 3ZMUA 5H2FC 4YELA 4BQQA 2M4GA 4ENJA 2VONA 2COMA 2YUSA 3EUAA 3SFZA 4BAYA 1J5YA 1MKMA 4Q47A 1R6RA 4ESBA 4IJAA 2KIUA 3PFIA 2EA2A 4Y33A 3K7AJ 3TOAA 1ETWA 2VKHA 2K40A 2DBBA 1UHMA 1R58A 2BY3A 4FQGA 2K9LA 4YRVA 1LFPA 4I76A 4ESFA 1M1EB 1V5FA 4A3IJ 1AKHA 3DQVC 3GZNB 2DA1A 5IT9Z 3I64A 4QSHA 3J7AY 2CG4A 3HIFA 1FZPB 2GOMA 3KZYA 5JR3A 1OCTC 3K4CA 3DBLB 4YFXF 2XGCA 1MNMC 5D8KB 1ZLKA 1FBSA 2F4MB 3WU0A 3P5JA 4XOTA 3J81K 4XRMA 4ZZLA 2PJRB 3ABKH 1Z67A 1R1UA 1DPRA 1H88C 4M3BA 1JUMA 1Z7LA 5L3EA 3E3VA 4B09A 3CUQA 4BACA 3RI4A 2ELJA 4XLHA 3G4SI 2R7FA 2Y69H 1FMVA 3W6JB 1PP7U 1B8IA 3HPHA 1B72B 3OS2A 2ZXHA 3LFKA 3S1MJ 4G6TB 4QIWN 4ON0A 4AYBA 2BEOA 1H0MA 2E71A 1TL8A 2RDPA 2JRMA 5IOZA 3BG7A 2Y30A 2W82A 2FQ3A 3CLOA 1R36A 5EJCA 2UUZA 4FE7A 1TTYA 1V54H 4Y15A 1BIAA 2W57A 3DU6A 3MZHA 5HODA 3ZMVA 1ERDA 4OU0A 1AHDP 1FBUA 4IKFA 1HOMA 2L7ZA 1J2XA 4C9YA 1LEAA 3LFUA 1RI7A 2RV8A 5L3FA 4BGDA 1UB9A 2GA1A 4DQ2A 2BVLA 5D5XB 2RNGA 3FXMA 1LKXA 1MBEA 1A35A 4MNUA 1JT0A 5KAFC 2OD5A 3HGGA 3BR2A 4PFOA 4IHYA 5HOOA 1RR7A 4XM3A 4W1UA 2XSDC 5F0CA 1Y1VJ 3P9IA 3V8JA 5HVQC 2GXGA 2K9MA 4I0AA 1H89C 2MGQA 2XAGA 2LKPA 3O6BB 3HGYA 4BL0B 1QBJA 3BQYA 1OYYA 1EKEA 4L18B 4XLEA 1SAXA 3U1KA 2GXAA 3TGNA 3CF5F 5H6RA 5B1AH 5E3OA 2EB7A 4CICA 1XPXA 2LBFB 1TWCJ 2R93J 2HYJA 4LD5A 5EEGA 3MN2A 1NG7A 3WGIA 4IL6C 5DUKA 3GO5A 2M3AA 3JR9A 2E7XA 1B59A 5TRDA 1A6QA 4DW6A 1ZN2A 1YX5A 3H35A 3R60A 1V4RA 1W1WE 3HC7A 1MW7A 2ACJA 3FBNB 5GAGJ 2M4KA 2Z16A 2IRFG 2M8GX 3C7JA 2VBXA 5LHGA 2I10A 3OMYA 3MVPA 2RN7A 2EV0A 4HF1A 2MC4A 2UXXA 1LEBA 2QCOA 1U8BA 1HKTA 2FOWA 4BBRJ 1XGMA 2NS7A 4I99C 2IA0A 1OPCA 2ICWG 4PSXA 4WXCA 3EETA 5FFZA 1Y56A 1YJNI 3L1PA 3L2CA 2F4OB 4LG0B 2DDBA 2A69F 3ZQCA 5IPAA 4EM1A 1K78A 2LK2A 4NC7A 2EFOA 1S72I 4PDKA 2QGUA 2W00A 1USTA 4NHJA 2RGVA 3GXOA 4BS9A 5HS7A 4NQWA 3JAMZ 2ZCWA 3RDIA 3PNYA 1ZGWA 1IXCA 2KIQA 1JKPC 3QPSA 3NWSA 1EH8A 2QM3A 3DWLE 3RZDJ 4IHXA 1B9NA 2HQAA 1OCPA 3Q9SA 3E5UA 4I09A 3ZN0A 3H9JA 5M5XJ 2R92J 1IRXA 2KLOA 2HOTA 3TL4X 2DFIA 2BV6A 2ZMEC 1YI2I 3JCUC 1J75A 3FXJA 2L5QA 2M30A 3EUKL 3LSJA 4PUSA 2XROA 4N4OB 4BEHB 3J80Z 2VL8A 2O0YA 1X19A 2ECCA 4KA4A 2M0CA 1MMAA 2H94A 1ON2A 4G7HF 2Y0SA 2ADUA 4EM0B 2A3SA 3F8BA 2M9HA 1IZ1A 4Y4RA 2E1OA 4Z2YA 2L9NA 2BGCA 4IQJA 1BI3A 1TWAJ 5LGNA 1IG7A 2DYSH 1TW2A 3ASOH 3Q3SA 1SD6A 4Q5SF 2QUFA 4ZTFA 4X1EA 2DFEA 5BPIA 1K6OA 3LSRA 2IVMA 4RAFA 1FOXA 4ENMA 1N25A 3KETA 3J7AO 1HKSA 1ZGAA 4IO9F 4KMUX 1D5VA 4M9ZA 2CRGA 5AIPA 1O3QA 2QWWA 1OKRA 3CCEI 1DU6A 4DJAA 3OSFA 4OMZA 3G71I 3S2DJ 5M5WJ 2VQLA 3QYEA 2E5ZA 1S7AA 2VKVA 3S3OA 4XSXF 5TGTA 2VASA 3F6OA 3V7SA 1W36D 1BA5A 2A5YB 2NXNB 4L5JA 4ASNA 2XAUA 1BR2A 3OYDA 2P7CB 4KYWA 3TDZC 4A0ZA 1EF4A 2MG4A 1PUEE 3LSGA 2CQKA 5K7ZA 2HR3A 1BOBA 1VQPI 5LFAA 2QA4I 3BPVA 5DV5A 1S3JA 1IV8A 3W6VA 2UWMA 1MMDA 3HZJA 1VQ9I 2MC3A 5B3SH 2GAUA 5ICCA 2YX7A 2P8TA 3BP8A 3WGGA 1AWCA 2K4JA 4ZDPA 4RLQA 3L2VA 2Y9ZA 4C2MJ 1N78A 2CMPA 3LSMA 5FKOA 1HDDC 2M45A 4RS8A 4EJVA 3NRVA 4ZC3A 3NAUA 1IN6A 2EA4A 4FE4A 5FO5A 2BHYA 5K5OA 3CP2A 5BQTA 1IDYA 1QO0D 3NQOA 1A5JA 2DT7B 4JX6A 1CF7B 2VJ5A 5IY5H 5DTDA 5BPDA 3F8CA 2CUEA 3DTEA 1Y8QB 3VYSB 4HNUA 5EG0A 3GZ6A 5HDNA 1NHAA 1R4NB 2STTA 2ZMEB 3HUGB 5ED4A 3BJAA 1NK2P 1UHWA 3BPXA 3WU2C 3CLQA 2E1CA 2KQRA 5FKLA 3F23A 4H0EA 2BY2A 4WXHA 1FIPA 1Y1WJ 5FRMA 3GZ5A 1U5TC 4HW0A 1HA8A 2Y31A 5C3EJ 2VBYA 5E8GA 3U21A 3JRCA 5JLWA 3HSFA 2W1OA 5FRNA 4DNCA 2HDCA 2XF7A 2O7OA 1NTCA 3OIQA 1XGSA 2K85A 3GVAA 2A07F 2GWRA 3ERMA 3K1PA 3CO6C 3I59A 1JI8A 1FNNA 4E7LA 4M6VA 2JUCA 3FKIJ 2QYOA 3HOXJ 2P7VB 2DU9A 2D5VA 2HS5A 2IT0A 5E20A 3HJEA 3BG6A 2ZJ2A 3GLXA 5ERIA 1IC8A 1UZCA 2K5CA 2JUGA 1LB2A 2K7LA 1WJBA 2OZ6A 2F5FA 4AC0A 2LLKA 4U7BA 4PGGA 3W2VA 1ETYA 1YW9A 2DOFA 2Q2EB 4MEXF 2JSCA 4TV7A 2KJCA 4XSZF 3HRSA 2ZFWA 3IRRA 5DD4A 3M1CA 3A02A 2XUBA 2MD5A 3OS1A 5J8CA 4II2A 1LDDA 3OYMA 4UVCA 1T39A 3S16J 3CMEI 2IBDA 3L2RA 4ITVA 1LE8B 3GTOJ 3MKZA 2F5VA 2FUG2 2E35A 4Z6YA 5KVRA 4I98B 1TBXA 1XC5A 3QPHA 1UMQA 1W5TA 1DQUA 2K3PA 1WJEA 1E3HA 3FISA 4P55A 1A04A 2DJNA 1R1TA 3MD2A 4HNVA 2YU9J 3T8TA 3FK7A 1F9NA 4WK8F 2A61A 1SMTA 2JT1A 3DFGA 1V3FA 1KU3A 3JRGA 1IN5A 1XD7A 3KPHA 5J47A 4N9IA 3ZQGA 3M8FA 3TO7A 2ZKZA 1XGOA 3PO2J 4UUTA 3SEQA 1G2HA 1Z1DA 1XDSA 1KQ9A 1SVLA 2W24A 2ZXWH 1YX3A 1OCRH 3HKZA 2COBA 3QU3A 4BXUA 2WV0A 4D7NA 3M9AA 2HOAA 5K7HA 1QZYA 3GTKJ 4G7OF 2OTLI 1Q1HA 2HXIA 2OCCH 4Y3OA 4Y17A 5E1XA 1HW2A 2NS8A 1IXRC 2XAFA 4UNOA 1FOKA 1DDNA 4EMSA 1SFKA 3DLLF 2UZKA 1D1CA 2HKOA 1U5TB 1W7PB 1MD0A 1ZARA 2ZSIB 4KNYA 2LY9A 2L54A 2V7FA 4CCOA 1YITI 1HLVA 2DFHA 2XAJA 3OS0A 4BY1J 2DA7A 4HYEA 1CQTA 4B1RA 2VKDA 1JT6A 2K3FA 1OLTA 3GTQJ 4E70A 2H1KA 3V4GA 4WF2A 5JHFA 2MLKA 4LLNA 3KCCA 4EJUA 5C44J 2WAQN 1YFHA 3IWFA 5FLMJ 3CJQB 4DYCA 2DT5A 3G3ZA 2DO7A 4F93B 2CWEA 4O3MA 1GVJA 2EFWA 1C0WA 4G8XA 1EJ9A 1JUSA 4HV6A 3AAFA 3GF2A 2XAQA 2L9RA 2PMZN 1Z05A 2FQ4A 2JN6A 3WHBA 3DPTA 3OYLA 4E7JA 3ONQA 2V9VA 4RDUA 5TJJA 2LNBA 2D45A 3DBRB 2Z9OA 1VNDA 2X1CA 1ZRDA 2IGKA 2BBYA 4GXOA 3I9V2 4A3EJ 5JI6A 2CGPA 5DM6F 3BG9A 3CUQC 3MMYB 3LA3A 2EZKA 4ZTJA 1IUYA 3ABTA 5FLVA 1TQMA 3H92A 3GTPJ 2VBWA 3L00A 3JSPA 2GLOA 4A0XA 3FX3A 3VYUB 4CYCB 2G0EA 3OYIA 2ID3A 4C30A 5GP9A 2DW4A 2HU9A 2JVGA 2UV1A 3E6DA 3R0AA 4IRGA 2R7DA 4V2GA 2R7UA 1R1VA 2FE3A 2VT3A 5ILUA 2QQBA 1WCMJ 3AG3H 4A3LJ 2HPIA 2F2EA 1YRNA 2XKPA 1X4OA 3OYNA 2R5ZB 2OAZA 5JLXA 3E7LA 4ETSA 3HOUJ 1FIAA 3LSKA 5LRRA 5JVGF 2HVQA 3CCYA 2LKXA 1DGRM 3ABLH 1BJZA 4I6ZA 2OU2A 2OQRA 4ESJA 3HTUA 1WJCA 3FMRA 1IGNA 1QPMA 2BW3B 2ZJQF 3QRFF 3S1NJ 4GO1A 2X85A 4EJWA 3R6SA 2RVCA 4H4KC 1S6LA 2BXZA 3IHUA 2HTSA 5FKKA 2KMUA 1LQ1A 4Y52J 2L0KA 3KLNA 4PSWA 4EQQA 5HLHA 2XAHA 3AG4H 3BJ6A 3HB9A 3ESWB 4HA8A 2ZSHB 1ZREA 3AL0B 3CF2A 4ZZDA 4A3CJ 1TLHB 2A5WA 2Y75A 3F0CA 3LA7A 4BY7J 3K6GA 3K1NA 3FBIB 2YU3A 3K4LA 3O2PE 3BTIA 1HXDA 1EV7A 2X48A 2L2OA 2PG4A 1VQ8I 2ZJPF 2JVHA 4G9YA 2VE8A 4PJ0C 5LGUA 3BCAA 1ETQA 4PJMA 2QLZA 2DPDA 1TP4A 3ZMDA 2PEXA 2ZJRF 4F52A 3ZQLA 2VKEA 2EILH 1F4KA 3ZR8X 1MIJA 4QWQA 3PNTA 1FBQA 2GM4A 2XKOA 2BVMA 2YX4A 4JOMA 1PUFA 2O03A 4XORA 2KHMA 3CP8A 1STZA 3HOTA 2VQGA 1I5ZA 3TEDA 3BWGA 4PCQA 5L3BA 2RAEA 2R7XA 2FNPA 4XLNF 2HOEA 3IWZA 3CMMA 2V1DA 3ECOA 2W7NA 2QQ9A 3M1EA 2ZXIA 4ZYAA 4LB6B 1D3YA 3RIRA 2E60A 1ZTRA 3I58A 4HEA2 4XQFA 5F1JA 1U9OA 2WC2A 2LF7A 4F3QA 3UR3C 2FRHA 4S04A 4MQVA 1WJDA 3K10A 3FXUA 2GA2A 3G1OA 4KICA 2VB6A 1JTXA 2HOSA 4UUSA 3CCUI 1VQ4I 2QBYA 1UJ8A 4QTRA 1N75A 4J00A 2FSWA 5D5UB 2ZFUA 1R5ID 5DCFA 1UHSA 4ENKA 2PMHA 1BJAA 3OYFA 2TRTA 3GLLA 1LDKB 3BZKA 2V1UA 3V42A 4EJTA 2ISZA 4B44A 5GTIC 1APLC 4I7HA 2IJLA 2KZGA 3RSNA 4ANJA 5CKTA 1YS6A 2WAEA 1RETA 2RC4A 1LVKA 1G6NA 5FGMA 4BQAA 5DCMB 3H5RA 3WG9A 5CVRA 2BXYA 4MO7A 1E2XA 1SD4A 3BLYA 2CW7A 2EWNA 4P1WA 1Y39A 3ELKA 1Y6IA 3C18A 3D0SA 4L9NA 1ITYA 2WAFA 3S2WA 1BI2A 1J9IA 2XGXA 3I3LA 2O8KA 2MLGA 1ZKGA 2IEKA 3WE2A 4DBRA 3CCQI 1MDMB 1ENHA 3E6MA 2L4AA 2OTJI 5FKNA 2HWVA 2O6GE 1G3WA 3BG5A 1MMSA 1GLNA 2R7RA 3DF8A 3TBIA 2LOOA 2DA3A 2CSOA 1IW7F 3G1MA 3CDHA 4UB8C 2MFZA 1X1BA 4M74A 3AG1H 2JA5J 1IRZA 1Z77A 4XLCA 3A01A 4CYDA 2NOGA 1P9QC 4AD9A 4E7KA 5IP7J 4KISA 1H9GA 2MH9A 3JREA 4CH7A 3BCBA 2PJPA 2F48A 3LNQA 2HI3A 2OPTA 5LBQA 4L9JA 4I0BA 4OAZA 3BROA 3KLOA 1TWHJ 3EQLF 3L2UA 5KAIC 2O3FA 4M3FA 3IAM2 1O3SA 3DKWA 3LOCA 3WTYC 1ZK8A 5J6XA 2XB0X 3KYLA 2X51A 4F91B 4AVPA 3SDBA 2LP0A 1LUJB 3ZOBA 1DP7P 2EPFA 1GUUA 3BG3A 1YHQI 3H9QA 1RKWA 3ISPA 2EQRA 4L9TA 3RKXA 2KRCA 2KJBA 3KP2A 5HNHA 4EM2A 2Q8KA 5E3NA 1F5TA 5EEHA 4KN4X 3VYRB 2A05A 3GWZA 3BTLA 2XGEA 1I6XA 2BY1A 1E17A 2LG4A 5F64A 4IHWA 2CV2A 2JA7J 4K2EA 2LSOA 5LEJA 1X2NA 1KYZA 4CGZA 1FT9A 1O4XA 3M7GA 1QNTA 4MTDA 4L5EA 2IGMA 2LYCA 5EZHA 1JUPA 5TISC 3UNGC 1IJWC 4ZH4F 1ZELA 3F21A 3SZGA 4BHPA 4U87A 2PMZA 5FROA 1D1BA 3OYCA 2OA4A 1YOVB 2CUJA 4LOCA 3IRQA 1SFXA 3L2QA 1ZR2A 3OR2C 3MWMA 4QPOA 1S7OA 3PUFA 2ESHA 2IP2A 4FX4A 2TCTA 1KYWA 3H5NA 4M3DA 3H5AA 4L0ZB 2DAOA 2IPQX 1H9TA 1YW7A 1SC7A 4X6AJ 1I6HJ 1YLFA 4UB6C 5D5WB 2PJRA 1UELB 2CYYA 2FBIA 5D6EA 3JRIA 1QA6A 3LL7A 1J09A 2H6CA 5CJ9A 3OYJA 4BDYA 2M1BA 3FKJA 3WTUC 2E2JJ 3H1CA 1O3RA 2CV0A 3GBGA 3SHFA 1R9TJ 3GFJA 1MGTA 1B72A 4A6EA 1FYLA 2PFBA 2JZYA 3CQZJ 2CUFA 4G12A 2XV4S 1OFCX 2B63J 5CQGA 5LLQA 1O57A 1IRFA 5GPCA 5J40A 3GTLJ 1ETVA 2OC6A 5HDKA 2VOOA 5C4JJ 2E1NA 1HF0A 3U1DA 2VLAA 5D5VB 4RBOA 2HNHA 2EIMH 5CPRB 3FF5A 1G3SA 2R7TA 5K7FA 2JSPA 3C1DA 1SEUA 1POGA 2Y48A 2B7EA 3RQIA 3I56I 2L7FP 4A69C 1MH4A 4EJOA 2ETHA 1T0FC 2ISYA 4A2UA 1HSTA 2YSRA 1PVEA 3CD6I 3OOPA 2K9QA 2Z99A 3QPTA 5E17F 1S29A 2X6OA 4A0YA 3LAPA 3EUHA 3ECHA 4L0YB 3VOEA 2BOLA 3JRAA 2ECBA 4IPAA 1FSEA 1MJAA 2OJED 3K4MA 2EH3A 3I0TA 3REOA 3ZMTA 3GEZA 3MEXA 2DTZA 3DCFA 3JAMK 1YJWI 2LBFA 3NEUA 2IS6A 2P5VA 2B0LA 3F8NA 2VXZA 4C2TA 1YIJI 5E79C 3CCJI 1Z6RA 2X0LA 3A4CA 2ZNZA 1XTAA 3KYDB 4PJNA 3A0HC 3PNVA 1BR1A 1WPKA 3FK6A 1BC7C 4CDGA 1ONVA 1BOAA 4BBSJ 5HDGA 4XLFA 3RYRA 1G4DA 3HOZJ 5LHHA 2HXOA 3LQQA 5EGOB 3MFKA 1GV2A 1K4SA 4G6QA 2E1MC 4B47A 4HAMA 3HEFA 1X3WB 4CCJA 1XN7A 3IKVA 2CU7A 2DXIA 1YJ9I 2Q0OA 3MZ8A 2GXBA 4A5MA 1B1BA 1H8AC 3HDDA 3BR6A 3S15J 3RPQA 1P7IA 1S7EA 2GIVA 3KEOA 5B66C 3DEUA 5L3GA 2JMWA 1QHGA 1LVAA 1V5EA 5L3DA 2HKXA 2EZLA 2JRTA 4LG0A 4IEJA 3JRDA 3ZQ7A 4A3MJ 2EINH 1RZ4A 2H8RA 3HRTA 4XK4A 1W5CC 3MCZA 1ETXA 1P7JA 4IXAA 2DQLA 4EATA 4YEJA 2R5YB 3KEYA 1HW5A 2KT0A 4NB5A 1KU7A 1WRJA 1GXQA 1YG2A 4E6KG 1R5HA 3SFIA 5CVIA 2R7ZJ 1XMAA 2NNNA 3R61A 2FBHA 3DTIA 4A3JJ 1HC8A 2KP6A 4GCVA 2DA4A 3W3CA 3ZRGA 2I8DA 4FT8A 4AIDA 1YTYA 4BEHA 4KDPA 1DGWY 1OR7C 4V19K 2E5NA 1TNTA 5HLGA 5KK1A 4BE1A 3JRBA 4GFBA 1D8JA 4E7IA 4CXFA 3FXLA 5AIQA 5J1UA 1UAAA 3KP7A 3FWEA 4IX7A 1GDTA 3F3XA 1WWXA 4CZCA 4I2OA 1JXSA 5ICGA 2JQ7A 3HRUA 4IOCF 4BE0A 4E7ZA 2X9DA 3ZMSA 1ZQ3P 4HX4A 1X1AA 4W97A 4BJ6C 3G73A 1L3LA 4NDLA 1BC8C 1LNWA 3RKQA 1XGNA 3H9GA 4MLOA 2KDZA 3SDGA 1O7LA 1SANA 2LC2A 5LD2C 4HDUA 4NNJA 2LH9A 4GYGA 3ULQB 5KHDA 3S17J 2P81A 2L02A 3JRFA 1LFUP 1BBYA 2P5KA 2Z5UA 1K7AA 1O7FA 1X3UA 3FXOA 3SYTA 2IXSA 5J1YA 3G2BA 2K9NA 3L09A 2EZHA 2QVOA 2H1LA 4B8XA 2O8XA 1T08B 2WB1N 3CCLI 2X6WA 2CV1A 1HCRA 2QQAA 3I71A 4IQ4A 4MQ9F 2HVSA 3HPGA 1VQ7I 4HRIA 3ROUA 4HBLA 2JJ7A 5JVTA 2D2WA 1MBJA 2DA2A 1BL0A 4M73A 1KU2A 1W7PD 4JBAA 1X3ZB 2PI0A 3OYGA 1QGPA 2FOKA 1XS9A 3GTGJ 1W0UA 2EFNA 4D1QA 3ZGKA 2L3DA 2XPVA 3K1MA 2DODA 1NK3P 5FLXZ 2IS4A 3BQZA 4XMYA 4A3DJ 3F9KA 4P5OA 1Z9CA 2M5WA 3N05A 3BZCA 3PJRA 1TWFJ 1ZG3A 1ODDA 3CCVI 3VDXA 2ELHA 1FYKA 3J7ZI 1OYWA 2F5EA 5LHIA 2CUZA 2AXLA 3KX2A 5IYCJ 2YR2A 1CF7A 2P6SA 2LMDA 3M8EA 4LK0F 4LGWA 1SVOA 4B3AA 3N97A 2DT6A 4ZDOA 3QU6A 2V79A 2ZMEA 3HUGA 1LJ9A 4HOBA 1IN7A 3PUBA 1I27A 1KU9A 2P0WA 4OOIA 4RB1A 3LAJA 2VE9A 1E3OC 1CGPA 4U88A 3WTZA 3R0JA 1ZRFA 1FYMA 5EF6A 5EZGA 2PMUA 3K70C 1TC3C 4UY8I 3QOEA 3BR1A 3E1SA 3ZMZA 1K4TA 5EEAA 5ICEA 3BT9A 1D5YA 4CCMA 2KRFA 1XCBA 2A6TA 2MW8A 1BM9A 5A2QK 4AYBN 3D5LA 5FB2A 2VI6A 2DMNA 2XHKA 2FNAA 4PJLA 2NOJB 2X4HA 4A5NA 4UVAA 3X2QH 3S1RJ 3SQNA 4LJZF 3KP5A 2CFOA 2K27A 3HOWJ 2JA8J 3SXYA 4BXXJ 3L2WA 3V8KA 1FC3A 1FP2A 2FMLA 3WTTC 3COAC 1MZBA 2JWTA 1VQLI 1FTZA 1BI1A 2LF8A 2RREA 2Q2EA 3RZOJ 4PJJA 2NVYJ 1USSA 1IDZA 2DA6A 2IA1A 4QLCU 2MBFA 2K02A 3TOBA 3Q9VA 1FWZA 3PSFA 4D5FA 5HS8A 1D1AA 3CJTB 4GDFA 1X1DA 3VB2A 1WH5A 2X1DA 4XKBA 2M7AA 1LE8A 2EZIA 3B6AA 2R7SA 4MIMA 5LEKA 3K0LA 3W6KB 3BR5A 4RAGA 5DYMA 1RNLA 4DZJA 4FX0A 2FF4A 4KIGA 1Z6TA 3ZQIA 1JKQC 2LDUA 4XOPA 4UHTA 4R8HA 3OYBA 1RIOH 3EYIA 2IS1A 1YW8A 3DPUA 1U78A 3T8RA 1OMIA 4Y13A 1P92A 4D7MA 2R4GA 4M3EA 2HVRA 3R4KA 2FX0A 1F1ZA 2W25A 5CVVA 3WE3A 5LRSA 1HDPA 3TP0A 1TNSA 4BHCA 3V7RA 5JFRA 3S3NA 4AUXA 3OIPA 2K4BA 1FP1D 1X58A 1MJ9A 3BOQA 3LSHA 4FASD 1E0EA 3E0JB 3LMMA 2VXDA 2VQCA 4KUMA 4JK1X 2A6HF 1SMYF 3Q5FA 6PAXA 3K2ZA 2DK8A 1XMXA 2FJ1A 4O6JA 3DU5A 1KQ8A 2W48A 2HZTA 2HQ5A 1I39A 3I55I 1OCOH 2AO9A 2HFHA 1U5TA 1PJRA 2KDOA 1W7PA 2XDVA 1WFXA 3GUDA 2VPRA 2AXTC 3TW7A 5HS9A 2AS5F 1JJ8C 3ZQHA 2DMUA 2W84A 3QODA 2ZB9A 4UUVA 2DDAA 2NVQJ 4JX5A 3DKXA 2LKSA 4BQOA 5F1RA 5HLTA 2IGOA 2XRNA 4HV5A 1WJ5A 3JW4A 1LDJA 4A3GJ 3CDIA 2DPUA 1ZLJA 4OIOF 1Z7UA 5IT3A 2QSHX 2F6CA 4QPQA 2LFBA 2L9VA 5F04A 4RA2A 1I50J 2E34A 3KYCB 4L5IA 1FEXA 3IKTA 3TW6A 4MTEA 3RKWA 3GW2A 3SZPA 4XRSG 2DK5A 1OJLA 4I01A 4RAYA 3CMAI 3BZ6A 3ZPLA 2V1NA 3F72A 1J0RA 4EVIA 2V9PA 1JGSA 1SD7A 2DMQA 4KT5C 3VYTB 3B02A 1P4XA 5IP9J 1AKHB 2YPRA 5E1ZB 2DI3A 3CJRB 3WG7H 3M4OJ 2Y0SN 4HZFA 1F43A 4CZZA 5CQEA 1P4AA 3K9TA 1U3EM 4JP0A 1REPC 3WTWC 5CLSA 3VSKA 2VPLA 1SFOJ 5K5QA 5J4VA 5H6QA 1X2MA 2IAIA 3VODA 1WJFA 1HQCA 4CYCA 4HSRA 3CUQB 1QZZA 3S93A 1W5SA 3I4MJ 4ZYGA 2AQFA 3FXKA 1WI3A 3WTVC 1TT0A 1B8IB 3T0YA 5F27A 1P2FA 3HM5A 3PIOF 2ELKA 3WHCA 1XG1A 5J4YA 1ZRCA 2DFFA 4P96A 2R5ZA 4AIJA 3HG9A 2NAZA 3HSRA 1T33A 1FY7A 3ZCOA 4IRIA 3IAS2 3CJNA 1ZHFA 4AM3A 2L9SA 4J01A 2VUMJ 4FTHA 2LY2A 3WTXC 2KRHA 4XR6A 4ENNA 4WXDA 1RKTA 1VF9A 1KQ0A 3M07A 1QHHD 2K86A 2BW3A 4F7ZA 3PO3J 2E19A 3U2RA 1R22A 2R3SA 1MNDA 2DTRA 1TWGJ 4B4CA 2VJJA 1XSXA 4UV8A 4IZZA 3HRMA 2QKLB 2NS0A 3I4PA 1T6SA 1ETKA 2H8WA 3LQRA 2XF6A 2EJRA 2AQEA 3BDDA 3J81Z 1JHFA 1ZG1A 3E97A 1W4MA 4LB5A 3KP6A 4LIVA 1IRGA 1E3PA 2BY0A 3RQ4A 4BE2A 1GT0C 4O5VA 1YIOA 1WQ2A 2R7OA 2XGDA 4HPQA 1R71A 3Q0VA 4NC6A 4P9UA 4RM2A 4EGYA 2DYRH 4GRIA 3D5SC 4MFDA 1G8XA 2HTJA 4MHGA 2L7MP 2LR8A 1EH6A 1WSUA 1A36A 3TO9A 5CVUA 1ETOA 4MFEA
chains in the Genus database with same CATH topology
4MEYF 2NRAC 1TW3A 1YQAA 5ILVA 5D8LB 3I53A 5FD6A 3TKYA 5IT9K 2EFQA 5CVJA 2JTVA 2OQGA 4WCGA 2G7HA 3HYIA 3QOPA 2HYFA 2J5PA 1IN8A 1U8RA 5BS6A 4M6XA 1RUNA 4LK1F 4ZYHA 3FM3A 1YS7A 4G94A 5DD8A 1K78B 1XDUA 3TQNA 1MJBA 3E6BA 3P7NA 2DQRA 1R23A 4UXNA 2FBKA 1ZGJA 2IW5A 3BY6A 1J7KA 1Y0UA 2RNJA 3O3KA 4N9HA 4JQFA 3ERED 2PBIA 1RUOA 1XMKA 5DCMA 2OZUA 2XASA 4BHBA 1S8NA 4HX8A 3WTSC 5JHUA 3TO6A 3N4MA 2WTEA 1MDMA 3E5XA 1YYVA 4HDVA 3KE2A 3LA2A 1K79A 4LLGF 4R79A 5D4RA 4A12A 3LSTA 2XIGA 2FU4A 2GQQA 4IHSA 4OIQF 4D0PA 1FSHA 4P9FA 3HHGA 4KMFA 4AIHA 3K69A 2D1VA 3DXJF 3CUOA 3HSEA 4PZJA 1T38A 3ABUA 1BN5A 2VT2A 4M71A 3ML6A 4EV0A 4WX9A 3FMQA 2CFXA 2J5OA 1ZYRF 3QP5A 2BYVE 2KKOA 1P6RA 3KZZA 4BNCA 2MH2A 1R5GA 4N0BA 3P9CA 5AONA 3WGHA 1IXSB 1QQIA 1G3YA 2W85A 2ZNYA 2ZO4A 4YG2F 2H6BA 3ZP5A 1AOYA 1ULYA 3FXRA 2FA5A 2M8EA 4HF0A 1B9MA 3V7CA 1D8KA 5BOXA 4IVNA 2NYXA 3P9KA 2CO5A 5L3CA 5E1WA 5BMZA 4HLXA 3J80K 1IF1A 2BE5F 2VC1A 1SFUA 3FHZA 4AWXB 1PP8F 3PQJA 3I59B 1U2WA 4HQEA 1BI0A 4YFNF 3RPUA 3C3WA 3L7WA 3LWFA 3WODF 2GZWA 3I5UA 3KFWX 2HEOA 1KGSA 4RGSA 3ZN1A 3H3UA 2QENA 3KP3A 2DLLA 4HLYA 3V8LA 4AIKA 3HHHA 2C6YA 4U0YA 3DP7A 5DEQA 3PQKA 3MAJA 2NNYA 1XB4A 3GX4X 3JSOA 2G7UA 3CTAA 2EK5A 3GYHX 4YIIA 2VOPA 4UV9A 2STWA 1XCVA 1TQIA 2IA2A 3EYYA 1UFMA 2KIMA 2HGCA 1JE8A 5FFXA 4Q4ZF 2JPCA 4RB0A 4CHUA 1P4WA 5CYVA 1IAWA 4YIFA 1Z91A 2HQNA 3TDUC 1JHHA 1ZG5A 2MA3A 2FXAA 2V1XA 2O61A 5DDGA 4BYYA 3U9GA 4PGHA 4GYIA 2VODA 1FLIA 2F5CA 4IF4A 4RB2C 4UVBA 4ZYDA 2EFPA 2VC0A 1OYIA 2JPBA 5J8FA 4M6YA 3I54A 4RGUA 2EV6A 2KIFA 4KFCA 1I1SA 4RGRA 4M9XA 4EGZA 4U0WA 2FEZA 4CO8A 3T1BA 1B6AA 5ICFA 4KIFA 1T98A 2UXNA 1XSVA 1T0FA 5K1YA 3FMSA 1EH7A 2VN2A 2HQRA 4G6DA 5A2QZ 5FLXK 2PQ8A 3CO7C 2ZBKA 1ON1A 3MZYA 5D6FA 3F22A 1GHCA 4U0VA 3B73A 5E8IA 4HQMA 1HSJA 2PLYA 2M87A 2TDXA 3RKYA 2F5DA 2QZ8A 2V6CA 3DPLC 1KA8A 1IN4A 1R7JA 4OIPF 2EV5A 4R1HA 3JTHA 1WKMA 3KEQA 2L01A 1HBXG 3SZTA 1FX7A 4G7ZF 2A6EF 5ILSA 4U7DA 4LFUA 1WI9A 3F8FA 1B4AA 3H3ZA 3FZVA 1YO5C 3IC7A 2Y0MA 4YFKF 1XSDA 4GGGA 4ZYEA 4MGRA 3RJPA 4XBFA 3F8MA 5K5RA 4A6DA 4FHTA 3F6VA 4KN7X 4M9SA 3VEPA 1OR7A 3BJOA 4Q48A 2XVCA 1PDNC 2P6TA 2RKHA 3GFLA 2Z33A 3FXQA 5D4SA 1L0OC 4KIBA 4WWCA 1I1GA 3DV8A 4S05A 4L9VA 1G3TA 3HOSA 2PN6A 2RQPA 4IRHA 5H20A 3RYPA 2P5LC 2QBYB 2H27A 3WU1B 3VFZA 4HF2A 1T2KA 3MQ0A 1FPQA 3QP6A 4RB3C 2A68F 3FM5A 1BIBA 2HYGD 4XLPF 3IL2A 3E6CC 3HTSB 1HKQA 2ZXJA 2VBZA 3E5QA 1U6GA 1SFEA 1GXPA 4I02A 1DUXC 1O3TA 2ESNA 1DPUA 4IHTA 4BH9A 4RGXA 2Z3YA 5FD5A 2L4MA 2WWYA 5DUIA 4RAZA 1HW1A 3RTRA 4OINF 5F6FA 4LMYA 3GFMA 1ZAOA 1VTNC 3L9FA 1ZH5A 2H09A 3QAHA 3T5XA 1TQPA 2P4WA 4OIRF 5E18F 2FMYA 5HLIA 2G9WA 2OBPA 4LLLA 1SD5A 5LGTA 1UCRA 4M72A 3KP4A 1J59A 2E7WA 3JTGA 3EDPA 4HX7A 1R00A 2CW0F 4XRFA 4OMYA 2D1HA 3GFIA 3OV8A 3ZMUA 4ENJA 2VONA 2COMA 3SFZA 4BAYA 1J5YA 1MKMA 4Q47A 4ESBA 4IJAA 2KIUA 3PFIA 2EA2A 3TOAA 2DBBA 1UHMA 1R58A 4ESFA 3DQVC 5IT9Z 3I64A 2CG4A 3HIFA 1FZPB 3KZYA 5JR3A 4YFXF 5D8KB 1ZLKA 1FBSA 3WU0A 3J81K 4ZZLA 1R1UA 1DPRA 5L3EA 3E3VA 4B09A 3CUQA 3RI4A 2R7FA 3W6JB 1PP7U 3LFKA 4ON0A 2BEOA 1H0MA 2RDPA 2FQ3A 3CLOA 1R36A 1TTYA 4Y15A 1BIAA 2W57A 3MZHA 3ZMVA 4OU0A 1FBUA 1J2XA 1LEAA 5L3FA 1RI7A 2RV8A 1UB9A 2GA1A 4DQ2A 5D5XB 4MNUA 2OD5A 5HOOA 3P9IA 3V8JA 5HVQC 2GXGA 4I0AA 2XAGA 2LKPA 3O6BB 1QBJA 4L18B 1OYYA 1SAXA 3TGNA 5H6RA 2EB7A 4CICA 4LD5A 5EEGA 3WGIA 5DUKA 3GO5A 2E7XA 1B59A 5TRDA 1ZN2A 3R60A 1V4RA 2ACJA 2IRFG 3C7JA 2VBXA 5LHGA 2RN7A 2EV0A 4HF1A 2UXXA 1LEBA 1HKTA 1XGMA 2IA0A 1OPCA 4WXCA 3EETA 5FFZA 3L2CA 4LG0B 2A69F 4EM1A 1K78A 2EFOA 4PDKA 1USTA 4NHJA 2RGVA 3GXOA 3JAMZ 4NQWA 5HS7A 2ZCWA 3RDIA 1IXCA 1EH8A 2QM3A 1B9NA 3Q9SA 4I09A 3E5UA 3ZN0A 2DFIA 2BV6A 1J75A 2M30A 2XROA 3J80Z 2O0YA 4KA4A 2H94A 1ON2A 4G7HF 2ADUA 4EM0B 2A3SA 3F8BA 1IZ1A 4Z2YA 2BGCA 1BI3A 5LGNA 1TW2A 1SD6A 4Q5SF 2QUFA 5BPIA 1K6OA 2IVMA 4ENMA 3KETA 3J7AO 1HKSA 1ZGAA 4KMUX 1D5VA 4M9ZA 5AIPA 1O3QA 2QWWA 1OKRA 4OMZA 1S7AA 4XSXF 3F6OA 3V7SA 2A5YB 4L5JA 4ASNA 2P7CB 4KYWA 3TDZC 4A0ZA 1PUEE 2CQKA 2HR3A 3BPVA 5DV5A 1S3JA 2UWMA 2MC3A 2GAUA 5ICCA 2YX7A 2P8TA 3BP8A 3WGGA 1AWCA 2K4JA 2M45A 4RS8A 4EJVA 3NRVA 1IN6A 2EA4A 5FO5A 5K5OA 5BQTA 1QO0D 3NQOA 1CF7B 5BPDA 3F8CA 3GZ6A 5HDNA 1NHAA 2STTA 2ZMEB 5ED4A 3BJAA 1UHWA 3BPXA 2E1CA 3F23A 4H0EA 4WXHA 3GZ5A 1U5TC 4HW0A 2VBYA 5E8GA 3HSFA 4DNCA 2HDCA 1XGSA 2A07F 3GVAA 2GWRA 3K1PA 3CO6C 3I59A 1FNNA 2QYOA 2P7VB 2DU9A 2HS5A 2IT0A 5E20A 2ZJ2A 3GLXA 5ERIA 1LB2A 2K7LA 2OZ6A 2F5FA 4U7BA 4PGGA 1YW9A 4MEXF 4TV7A 2JSCA 2KJCA 4XSZF 3HRSA 2ZFWA 3IRRA 5DD4A 2XUBA 2MD5A 5J8CA 1LDDA 1T39A 4UVCA 5KVRA 4I98B 1TBXA 3QPHA 1W5TA 4P55A 1A04A 1R1TA 3T8TA 1F9NA 4WK8F 2A61A 1SMTA 2JT1A 3DFGA 1V3FA 1KU3A 1IN5A 1XD7A 4N9IA 3M8FA 3TO7A 2ZKZA 1XGOA 1Z1DA 1XDSA 1KQ9A 2W24A 3QU3A 4BXUA 2WV0A 3M9AA 1QZYA 4G7OF 1Q1HA 4Y17A 5E1XA 1HW2A 1IXRC 2XAFA 4UNOA 1FOKA 1DDNA 4EMSA 2UZKA 2HKOA 1U5TB 1W7PB 1MD0A 1ZARA 4KNYA 2L54A 2XAJA 4HYEA 4E70A 3V4GA 4WF2A 2MLKA 4LLNA 3KCCA 4EJUA 1YFHA 3IWFA 2DT5A 3G3ZA 2DO7A 2CWEA 4O3MA 1GVJA 2EFWA 1C0WA 4G8XA 4HV6A 3AAFA 3GF2A 2XAQA 1Z05A 3DPTA 2V9VA 5TJJA 2LNBA 2D45A 2Z9OA 1ZRDA 2BBYA 4GXOA 5JI6A 2CGPA 3CUQC 3LA3A 1IUYA 3ABTA 1TQMA 3H92A 2VBWA 3L00A 3JSPA 4A0XA 3FX3A 2DW4A 3E6DA 3R0AA 4IRGA 2R7DA 1R1VA 2FE3A 2VT3A 5ILUA 2QQBA 2F2EA 2XKPA 2OAZA 4ETSA 5LRRA 2OU2A 2OQRA 4ESJA 3HTUA 3FMRA 1QPMA 3QRFF 4GO1A 4EJWA 3R6SA 2RVCA 1S6LA 3IHUA 2HTSA 1LQ1A 3KLNA 5HLHA 4EQQA 2XAHA 3BJ6A 4HA8A 1ZREA 4ZZDA 1TLHB 2Y75A 3LA7A 3K1NA 2YU3A 3O2PE 1HXDA 1EV7A 2PG4A 4G9YA 2VE8A 5LGUA 2QLZA 2DPDA 3ZMDA 2PEXA 1F4KA 4QWQA 1FBQA 2XKOA 2YX4A 2O03A 1STZA 3HOTA 1I5ZA 3BWGA 4PCQA 5L3BA 2FNPA 4XLNF 2HOEA 3IWZA 2V1DA 3ECOA 2QQ9A 3M1EA 4LB6B 1D3YA 3RIRA 3I58A 2WC2A 2LF7A 2FRHA 4S04A 4MQVA 3FXUA 2GA2A 4KICA 2QBYA 2FSWA 5D5UB 5DCFA 4ENKA 2PMHA 1BJAA 1LDKB 2V1UA 4EJTA 2ISZA 4I7HA 2IJLA 1YS6A 2RC4A 1G6NA 5FGMA 4BQAA 5DCMB 3WG9A 5CVRA 1E2XA 1SD4A 2EWNA 3ELKA 3C18A 3D0SA 4L9NA 3S2WA 1BI2A 1J9IA 2XGXA 2MLGA 3WE2A 1MDMB 3E6MA 2L4AA 2HWVA 2O6GE 1G3WA 3DF8A 2CSOA 1IW7F 3CDHA 4M74A 4CYDA 4AD9A 1H9GA 2MH9A 2PJPA 5LBQA 4L9JA 4I0BA 3BROA 3KLOA 3EQLF 2O3FA 1O3SA 3DKWA 3WTYC 5J6XA 4AVPA 1DP7P 3ISPA 4L9TA 3RKXA 2KJBA 3KP2A 4EM2A 2Q8KA 1F5TA 5EEHA 4KN4X 3GWZA 1I6XA 1E17A 5F64A 4K2EA 2LSOA 5LEJA 1KYZA 4CGZA 1FT9A 3M7GA 1QNTA 4MTDA 4ZH4F 3F21A 4BHPA 2OA4A 3IRQA 1SFXA 3MWMA 1S7OA 2ESHA 2IP2A 4FX4A 1KYWA 4L0ZB 2DAOA 2IPQX 1H9TA 1YW7A 1YLFA 5D5WB 2FBIA 2CYYA 5D6EA 2H6CA 5CJ9A 2M1BA 3WTUC 1O3RA 3SHFA 3GFJA 1MGTA 4A6EA 1FYLA 2PFBA 2JZYA 2XV4S 5LLQA 1O57A 1IRFA 5HDKA 2VOOA 2E1NA 3U1DA 5D5VB 3FF5A 1G3SA 3C1DA 2Y48A 4EJOA 2ETHA 2ISYA 4A2UA 1HSTA 2YSRA 3OOPA 2Z99A 3QPTA 5E17F 1S29A 3LAPA 4A0YA 3EUHA 3ECHA 4L0YB 3VOEA 4IPAA 1FSEA 1MJAA 3I0TA 3REOA 3ZMTA 3GEZA 3MEXA 3JAMK 3NEUA 2P5VA 2B0LA 3F8NA 2VXZA 1Z6RA 2X0LA 2ZNZA 1BC7C 4CDGA 1ONVA 1BOAA 5HDGA 3RYRA 1G4DA 5LHHA 3LQQA 3MFKA 4G6QA 4HAMA 1XN7A 3IKVA 2Q0OA 2GXBA 4A5MA 1B1BA 3RPQA 3KEOA 2GIVA 3DEUA 5L3GA 1LVAA 5L3DA 2HKXA 2JRTA 4LG0A 3ZQ7A 1RZ4A 3HRTA 3MCZA 4IXAA 2DQLA 1HW5A 4NB5A 1KU7A 1WRJA 1GXQA 1YG2A 1R5HA 5CVIA 1XMAA 2NNNA 3R61A 2FBHA 4GCVA 1YTYA 4FT8A 4KDPA 1TNTA 5HLGA 5KK1A 1D8JA 4CXFA 5AIQA 3KP7A 3FWEA 3F3XA 1WWXA 4I2OA 1JXSA 5ICGA 3HRUA 3ZMSA 4HX4A 3G73A 1L3LA 1BC8C 1LNWA 1XGNA 1O7LA 4HDUA 4GYGA 3ULQB 2L02A 1BBYA 2P5KA 2Z5UA 1K7AA 1O7FA 1X3UA 3L09A 2QVOA 4B8XA 2O8XA 2QQAA 3I71A 4MQ9F 3ROUA 4HBLA 5JVTA 2D2WA 4M73A 1KU2A 1W7PD 4JBAA 2PI0A 1QGPA 2FOKA 2EFNA 2L3DA 3K1MA 5FLXZ 4P5OA 1Z9CA 2M5WA 1ZG3A 1ODDA 1FYKA 2ELHA 1OYWA 2F5EA 5LHIA 2AXLA 2YR2A 1CF7A 2P6SA 3M8EA 4LK0F 4LGWA 3N97A 3QU6A 2V79A 2ZMEA 3HUGA 1LJ9A 4HOBA 1IN7A 4RB1A 1I27A 1KU9A 3LAJA 4OOIA 2VE9A 1CGPA 4U88A 3WTZA 3R0JA 1ZRFA 1FYMA 2PMUA 3ZMZA 5ICEA 2KRFA 1XCBA 1BM9A 5A2QK 3D5LA 5FB2A 2XHKA 2FNAA 2X4HA 4A5NA 4UVAA 3SQNA 4LJZF 3KP5A 2K27A 3SXYA 3V8KA 1FC3A 1FP2A 2FMLA 3WTTC 3COAC 1MZBA 1BI1A 2LF8A 2Q2EA 1USSA 2IA1A 4QLCU 2MBFA 2K02A 3TOBA 3Q9VA 1FWZA 5HS8A 3VB2A 5LEKA 3K0LA 3W6KB 5DYMA 1RNLA 4FX0A 2FF4A 4KIGA 1Z6TA 2LDUA 4UHTA 4R8HA 1RIOH 3EYIA 1YW8A 1U78A 3T8RA 1OMIA 4Y13A 1P92A 3R4KA 1F1ZA 2W25A 5CVVA 3WE3A 5LRSA 1TNSA 4BHCA 3V7RA 5JFRA 2K4BA 1FP1D 3BOQA 1MJ9A 4KUMA 4JK1X 2A6HF 1SMYF 3Q5FA 6PAXA 3K2ZA 2DK8A 4O6JA 1KQ8A 2HZTA 2HFHA 1U5TA 1W7PA 3GUDA 5HS9A 2AS5F 2W84A 4UUVA 5F1RA 2XRNA 4HV5A 3JW4A 1LDJA 2DPUA 1ZLJA 4OIOF 1Z7UA 5IT3A 4L5IA 3IKTA 4MTEA 3RKWA 3GW2A 3SZPA 2DK5A 4I01A 4RAYA 3BZ6A 3ZPLA 3F72A 1J0RA 4EVIA 1JGSA 1SD7A 4KT5C 3B02A 1P4XA 2YPRA 5E1ZB 2DI3A 4HZFA 4CZZA 1P4AA 3K9TA 1U3EM 1REPC 3WTWC 5CLSA 5K5QA 5H6QA 3VODA 1HQCA 3CUQB 1QZZA 1W5SA 4ZYGA 3WTVC 3T0YA 1P2FA 1ZRCA 4P96A 4AIJA 2NAZA 3HSRA 1FY7A 4IRIA 3CJNA 1ZHFA 3WTXC 4ENNA 4WXDA 1KQ0A 2K86A 4F7ZA 3U2RA 1R22A 2R3SA 2DTRA 1XSXA 4UV8A 3HRMA 2NS0A 3I4PA 1T6SA 3LQRA 2EJRA 3J81Z 3BDDA 1JHFA 1ZG1A 3E97A 1W4MA 4LB5A 3KP6A 1IRGA 4O5VA 1YIOA 1WQ2A 4P9UA 4EGYA 2HTJA 4MHGA 1EH6A 1WSUA 3TO9A 5CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEY F;  2NRA C;  1TW3 A;  1YQA A;  5ILV A;  5D8L B;  3I53 A;  5FD6 A;  3TKY A;  5IT9 K;  2EFQ A;  5CVJ A;  2JTV A;  2OQG A;  4WCG A;  2G7H A;  3HYI A;  3QOP A;  2HYF A;  2J5P A;  1IN8 A;  1U8R A;  5BS6 A;  4M6X A;  1RUN A;  4LK1 F;  4ZYH A;  3FM3 A;  1YS7 A;  4G94 A;  5DD8 A;  1K78 B;  1XDU A;  3TQN A;  1MJB A;  3E6B A;  3P7N A;  2DQR A;  1R23 A;  4UXN A;  2FBK A;  1ZGJ A;  2IW5 A;  3BY6 A;  1J7K A;  1Y0U A;  2RNJ A;  3O3K A;  4N9H A;  4JQF A;  3ERE D;  2PBI A;  1RUO A;  1XMK A;  5DCM A;  2OZU A;  2XAS A;  4BHB A;  1S8N A;  4HX8 A;  3WTS C;  5JHU A;  3TO6 A;  3N4M A;  2WTE A;  1MDM A;  3E5X A;  1YYV A;  4HDV A;  3KE2 A;  3LA2 A;  1K79 A;  4LLG F;  4R79 A;  5D4R A;  4A12 A;  3LST A;  2XIG A;  2FU4 A;  2GQQ A;  4IHS A;  4OIQ F;  4D0P A;  1FSH A;  4P9F A;  3HHG A;  4KMF A;  4AIH A;  3K69 A;  2D1V A;  3DXJ F;  3CUO A;  3HSE A;  4PZJ A;  1T38 A;  3ABU A;  1BN5 A;  2VT2 A;  4M71 A;  3ML6 A;  4EV0 A;  4WX9 A;  3FMQ A;  2CFX A;  2J5O A;  1ZYR F;  3QP5 A;  2BYV E;  2KKO A;  1P6R A;  3KZZ A;  4BNC A;  2MH2 A;  1R5G A;  4N0B A;  3P9C A;  5AON A;  3WGH A;  1IXS B;  1QQI A;  1G3Y A;  2W85 A;  2ZNY A;  2ZO4 A;  4YG2 F;  2H6B A;  3ZP5 A;  1AOY A;  1ULY A;  3FXR A;  2FA5 A;  2M8E A;  4HF0 A;  1B9M A;  3V7C A;  1D8K A;  5BOX A;  4IVN A;  2NYX A;  3P9K A;  2CO5 A;  5L3C A;  5E1W A;  5BMZ A;  4HLX A;  3J80 K;  1IF1 A;  2BE5 F;  2VC1 A;  1SFU A;  3FHZ A;  4AWX B;  1PP8 F;  3PQJ A;  3I59 B;  1U2W A;  4HQE A;  1BI0 A;  4YFN F;  3RPU A;  3C3W A;  3L7W A;  3LWF A;  3WOD F;  2GZW A;  3I5U A;  3KFW X;  2HEO A;  1KGS A;  4RGS A;  3ZN1 A;  3H3U A;  2QEN A;  3KP3 A;  2DLL A;  4HLY A;  3V8L A;  4AIK A;  3HHH A;  2C6Y A;  4U0Y A;  3DP7 A;  5DEQ A;  3PQK A;  3MAJ A;  2NNY A;  1XB4 A;  3GX4 X;  3JSO A;  2G7U A;  3CTA A;  2EK5 A;  3GYH X;  4YII A;  2VOP A;  4UV9 A;  2STW A;  1XCV A;  1TQI A;  2IA2 A;  3EYY A;  1UFM A;  2KIM A;  2HGC A;  1JE8 A;  5FFX A;  4Q4Z F;  2JPC A;  4RB0 A;  4CHU A;  1P4W A;  5CYV A;  1IAW A;  4YIF A;  1Z91 A;  2HQN A;  3TDU C;  1JHH A;  1ZG5 A;  2MA3 A;  2FXA A;  2V1X A;  2O61 A;  5DDG A;  4BYY A;  3U9G A;  4PGH A;  4GYI A;  2VOD A;  1FLI A;  2F5C A;  4IF4 A;  4RB2 C;  4UVB A;  4ZYD A;  2EFP A;  2VC0 A;  1OYI A;  2JPB A;  5J8F A;  4M6Y A;  3I54 A;  4RGU A;  2EV6 A;  2KIF A;  4KFC A;  1I1S A;  4RGR A;  4M9X A;  4EGZ A;  4U0W A;  2FEZ A;  4CO8 A;  3T1B A;  1B6A A;  5ICF A;  4KIF A;  1T98 A;  2UXN A;  1XSV A;  1T0F A;  5K1Y A;  3FMS A;  1EH7 A;  2VN2 A;  2HQR A;  4G6D A;  5A2Q Z;  5FLX K;  2PQ8 A;  3CO7 C;  2ZBK A;  1ON1 A;  3MZY A;  5D6F A;  3F22 A;  1GHC A;  4U0V A;  3B73 A;  5E8I A;  4HQM A;  1HSJ A;  2PLY A;  2M87 A;  2TDX A;  3RKY A;  2F5D A;  2QZ8 A;  2V6C A;  3DPL C;  1KA8 A;  1IN4 A;  1R7J A;  4OIP F;  2EV5 A;  4R1H A;  3JTH A;  1WKM A;  3KEQ A;  2L01 A;  1HBX G;  3SZT A;  1FX7 A;  4G7Z F;  2A6E F;  5ILS A;  4U7D A;  4LFU A;  1WI9 A;  3F8F A;  1B4A A;  3H3Z A;  3FZV A;  1YO5 C;  3IC7 A;  2Y0M A;  4YFK F;  1XSD A;  4GGG A;  4ZYE A;  4MGR A;  3RJP A;  4XBF A;  3F8M A;  5K5R A;  4A6D A;  4FHT A;  3F6V A;  4KN7 X;  4M9S A;  3VEP A;  1OR7 A;  3BJO A;  4Q48 A;  2XVC A;  1PDN C;  2P6T A;  2RKH A;  3GFL A;  2Z33 A;  3FXQ A;  5D4S A;  1L0O C;  4KIB A;  4WWC A;  1I1G A;  3DV8 A;  4S05 A;  4L9V A;  1G3T A;  3HOS A;  2PN6 A;  2RQP A;  4IRH A;  5H20 A;  3RYP A;  2P5L C;  2QBY B;  2H27 A;  3WU1 B;  3VFZ A;  4HF2 A;  1T2K A;  3MQ0 A;  1FPQ A;  3QP6 A;  4RB3 C;  2A68 F;  3FM5 A;  1BIB A;  2HYG D;  4XLP F;  3IL2 A;  3E6C C;  3HTS B;  1HKQ A;  2ZXJ A;  2VBZ A;  3E5Q A;  1U6G A;  1SFE A;  1GXP A;  4I02 A;  1DUX C;  1O3T A;  2ESN A;  1DPU A;  4IHT A;  4BH9 A;  4RGX A;  2Z3Y A;  5FD5 A;  2L4M A;  2WWY A;  5DUI A;  4RAZ A;  1HW1 A;  3RTR A;  4OIN F;  5F6F A;  4LMY A;  3GFM A;  1ZAO A;  1VTN C;  3L9F A;  1ZH5 A;  2H09 A;  3QAH A;  3T5X A;  1TQP A;  2P4W A;  4OIR F;  5E18 F;  2FMY A;  5HLI A;  2G9W A;  2OBP A;  4LLL A;  1SD5 A;  5LGT A;  1UCR A;  4M72 A;  3KP4 A;  1J59 A;  2E7W A;  3JTG A;  3EDP A;  4HX7 A;  1R00 A;  2CW0 F;  4XRF A;  4OMY A;  2D1H A;  3GFI A;  3OV8 A;  3ZMU A;  4ENJ A;  2VON A;  2COM A;  3SFZ A;  4BAY A;  1J5Y A;  1MKM A;  4Q47 A;  4ESB A;  4IJA A;  2KIU A;  3PFI A;  2EA2 A;  3TOA A;  2DBB A;  1UHM A;  1R58 A;  4ESF A;  3DQV C;  5IT9 Z;  3I64 A;  2CG4 A;  3HIF A;  1FZP B;  3KZY A;  5JR3 A;  4YFX F;  5D8K B;  1ZLK A;  1FBS A;  3WU0 A;  3J81 K;  4ZZL A;  1R1U A;  1DPR A;  5L3E A;  3E3V A;  4B09 A;  3CUQ A;  3RI4 A;  2R7F A;  3W6J B;  1PP7 U;  3LFK A;  4ON0 A;  2BEO A;  1H0M A;  2RDP A;  2FQ3 A;  3CLO A;  1R36 A;  1TTY A;  4Y15 A;  1BIA A;  2W57 A;  3MZH A;  3ZMV A;  4OU0 A;  1FBU A;  1J2X A;  1LEA A;  5L3F A;  1RI7 A;  2RV8 A;  1UB9 A;  2GA1 A;  4DQ2 A;  5D5X B;  4MNU A;  2OD5 A;  5HOO A;  3P9I A;  3V8J A;  5HVQ C;  2GXG A;  4I0A A;  2XAG A;  2LKP A;  3O6B B;  1QBJ A;  4L18 B;  1OYY A;  1SAX A;  3TGN A;  5H6R A;  2EB7 A;  4CIC A;  4LD5 A;  5EEG A;  3WGI A;  5DUK A;  3GO5 A;  2E7X A;  1B59 A;  5TRD A;  1ZN2 A;  3R60 A;  1V4R A;  2ACJ A;  2IRF G;  3C7J A;  2VBX A;  5LHG A;  2RN7 A;  2EV0 A;  4HF1 A;  2UXX A;  1LEB A;  1HKT A;  1XGM A;  2IA0 A;  1OPC A;  4WXC A;  3EET A;  5FFZ A;  3L2C A;  4LG0 B;  2A69 F;  4EM1 A;  1K78 A;  2EFO A;  4PDK A;  1UST A;  4NHJ A;  2RGV A;  3GXO A;  3JAM Z;  4NQW A;  5HS7 A;  2ZCW A;  3RDI A;  1IXC A;  1EH8 A;  2QM3 A;  1B9N A;  3Q9S A;  4I09 A;  3E5U A;  3ZN0 A;  2DFI A;  2BV6 A;  1J75 A;  2M30 A;  2XRO A;  3J80 Z;  2O0Y A;  4KA4 A;  2H94 A;  1ON2 A;  4G7H F;  2ADU A;  4EM0 B;  2A3S A;  3F8B A;  1IZ1 A;  4Z2Y A;  2BGC A;  1BI3 A;  5LGN A;  1TW2 A;  1SD6 A;  4Q5S F;  2QUF A;  5BPI A;  1K6O A;  2IVM A;  4ENM A;  3KET A;  3J7A O;  1HKS A;  1ZGA A;  4KMU X;  1D5V A;  4M9Z A;  5AIP A;  1O3Q A;  2QWW A;  1OKR A;  4OMZ A;  1S7A A;  4XSX F;  3F6O A;  3V7S A;  2A5Y B;  4L5J A;  4ASN A;  2P7C B;  4KYW A;  3TDZ C;  4A0Z A;  1PUE E;  2CQK A;  2HR3 A;  3BPV A;  5DV5 A;  1S3J A;  2UWM A;  2MC3 A;  2GAU A;  5ICC A;  2YX7 A;  2P8T A;  3BP8 A;  3WGG A;  1AWC A;  2K4J A;  2M45 A;  4RS8 A;  4EJV A;  3NRV A;  1IN6 A;  2EA4 A;  5FO5 A;  5K5O A;  5BQT A;  1QO0 D;  3NQO A;  1CF7 B;  5BPD A;  3F8C A;  3GZ6 A;  5HDN A;  1NHA A;  2STT A;  2ZME B;  5ED4 A;  3BJA A;  1UHW A;  3BPX A;  2E1C A;  3F23 A;  4H0E A;  4WXH A;  3GZ5 A;  1U5T C;  4HW0 A;  2VBY A;  5E8G A;  3HSF A;  4DNC A;  2HDC A;  1XGS A;  2A07 F;  3GVA A;  2GWR A;  3K1P A;  3CO6 C;  3I59 A;  1FNN A;  2QYO A;  2P7V B;  2DU9 A;  2HS5 A;  2IT0 A;  5E20 A;  2ZJ2 A;  3GLX A;  5ERI A;  1LB2 A;  2K7L A;  2OZ6 A;  2F5F A;  4U7B A;  4PGG A;  1YW9 A;  4MEX F;  4TV7 A;  2JSC A;  2KJC A;  4XSZ F;  3HRS A;  2ZFW A;  3IRR A;  5DD4 A;  2XUB A;  2MD5 A;  5J8C A;  1LDD A;  1T39 A;  4UVC A;  5KVR A;  4I98 B;  1TBX A;  3QPH A;  1W5T A;  4P55 A;  1A04 A;  1R1T A;  3T8T A;  1F9N A;  4WK8 F;  2A61 A;  1SMT A;  2JT1 A;  3DFG A;  1V3F A;  1KU3 A;  1IN5 A;  1XD7 A;  4N9I A;  3M8F A;  3TO7 A;  2ZKZ A;  1XGO A;  1Z1D A;  1XDS A;  1KQ9 A;  2W24 A;  3QU3 A;  4BXU A;  2WV0 A;  3M9A A;  1QZY A;  4G7O F;  1Q1H A;  4Y17 A;  5E1X A;  1HW2 A;  1IXR C;  2XAF A;  4UNO A;  1FOK A;  1DDN A;  4EMS A;  2UZK A;  2HKO A;  1U5T B;  1W7P B;  1MD0 A;  1ZAR A;  4KNY A;  2L54 A;  2XAJ A;  4HYE A;  4E70 A;  3V4G A;  4WF2 A;  2MLK A;  4LLN A;  3KCC A;  4EJU A;  1YFH A;  3IWF A;  2DT5 A;  3G3Z A;  2DO7 A;  2CWE A;  4O3M A;  1GVJ A;  2EFW A;  1C0W A;  4G8X A;  4HV6 A;  3AAF A;  3GF2 A;  2XAQ A;  1Z05 A;  3DPT A;  2V9V A;  5TJJ A;  2LNB A;  2D45 A;  2Z9O A;  1ZRD A;  2BBY A;  4GXO A;  5JI6 A;  2CGP A;  3CUQ C;  3LA3 A;  1IUY A;  3ABT A;  1TQM A;  3H92 A;  2VBW A;  3L00 A;  3JSP A;  4A0X A;  3FX3 A;  2DW4 A;  3E6D A;  3R0A A;  4IRG A;  2R7D A;  1R1V A;  2FE3 A;  2VT3 A;  5ILU A;  2QQB A;  2F2E A;  2XKP A;  2OAZ A;  4ETS A;  5LRR A;  2OU2 A;  2OQR A;  4ESJ A;  3HTU A;  3FMR A;  1QPM A;  3QRF F;  4GO1 A;  4EJW A;  3R6S A;  2RVC A;  1S6L A;  3IHU A;  2HTS A;  1LQ1 A;  3KLN A;  5HLH A;  4EQQ A;  2XAH A;  3BJ6 A;  4HA8 A;  1ZRE A;  4ZZD A;  1TLH B;  2Y75 A;  3LA7 A;  3K1N A;  2YU3 A;  3O2P E;  1HXD A;  1EV7 A;  2PG4 A;  4G9Y A;  2VE8 A;  5LGU A;  2QLZ A;  2DPD A;  3ZMD A;  2PEX A;  1F4K A;  4QWQ A;  1FBQ A;  2XKO A;  2YX4 A;  2O03 A;  1STZ A;  3HOT A;  1I5Z A;  3BWG A;  4PCQ A;  5L3B A;  2FNP A;  4XLN F;  2HOE A;  3IWZ A;  2V1D A;  3ECO A;  2QQ9 A;  3M1E A;  4LB6 B;  1D3Y A;  3RIR A;  3I58 A;  2WC2 A;  2LF7 A;  2FRH A;  4S04 A;  4MQV A;  3FXU A;  2GA2 A;  4KIC A;  2QBY A;  2FSW A;  5D5U B;  5DCF A;  4ENK A;  2PMH A;  1BJA A;  1LDK B;  2V1U A;  4EJT A;  2ISZ A;  4I7H A;  2IJL A;  1YS6 A;  2RC4 A;  1G6N A;  5FGM A;  4BQA A;  5DCM B;  3WG9 A;  5CVR A;  1E2X A;  1SD4 A;  2EWN A;  3ELK A;  3C18 A;  3D0S A;  4L9N A;  3S2W A;  1BI2 A;  1J9I A;  2XGX A;  2MLG A;  3WE2 A;  1MDM B;  3E6M A;  2L4A A;  2HWV A;  2O6G E;  1G3W A;  3DF8 A;  2CSO A;  1IW7 F;  3CDH A;  4M74 A;  4CYD A;  4AD9 A;  1H9G A;  2MH9 A;  2PJP A;  5LBQ A;  4L9J A;  4I0B A;  3BRO A;  3KLO A;  3EQL F;  2O3F A;  1O3S A;  3DKW A;  3WTY C;  5J6X A;  4AVP A;  1DP7 P;  3ISP A;  4L9T A;  3RKX A;  2KJB A;  3KP2 A;  4EM2 A;  2Q8K A;  1F5T A;  5EEH A;  4KN4 X;  3GWZ A;  1I6X A;  1E17 A;  5F64 A;  4K2E A;  2LSO A;  5LEJ A;  1KYZ A;  4CGZ A;  1FT9 A;  3M7G A;  1QNT A;  4MTD A;  4ZH4 F;  3F21 A;  4BHP A;  2OA4 A;  3IRQ A;  1SFX A;  3MWM A;  1S7O A;  2ESH A;  2IP2 A;  4FX4 A;  1KYW A;  4L0Z B;  2DAO A;  2IPQ X;  1H9T A;  1YW7 A;  1YLF A;  5D5W B;  2FBI A;  2CYY A;  5D6E A;  2H6C A;  5CJ9 A;  2M1B A;  3WTU C;  1O3R A;  3SHF A;  3GFJ A;  1MGT A;  4A6E A;  1FYL A;  2PFB A;  2JZY A;  2XV4 S;  5LLQ A;  1O57 A;  1IRF A;  5HDK A;  2VOO A;  2E1N A;  3U1D A;  5D5V B;  3FF5 A;  1G3S A;  3C1D A;  2Y48 A;  4EJO A;  2ETH A;  2ISY A;  4A2U A;  1HST A;  2YSR A;  3OOP A;  2Z99 A;  3QPT A;  5E17 F;  1S29 A;  3LAP A;  4A0Y A;  3EUH A;  3ECH A;  4L0Y B;  3VOE A;  4IPA A;  1FSE A;  1MJA A;  3I0T A;  3REO A;  3ZMT A;  3GEZ A;  3MEX A;  3JAM K;  3NEU A;  2P5V A;  2B0L A;  3F8N A;  2VXZ A;  1Z6R A;  2X0L A;  2ZNZ A;  1BC7 C;  4CDG A;  1ONV A;  1BOA A;  5HDG A;  3RYR A;  1G4D A;  5LHH A;  3LQQ A;  3MFK A;  4G6Q A;  4HAM A;  1XN7 A;  3IKV A;  2Q0O A;  2GXB A;  4A5M A;  1B1B A;  3RPQ A;  3KEO A;  2GIV A;  3DEU A;  5L3G A;  1LVA A;  5L3D A;  2HKX A;  2JRT A;  4LG0 A;  3ZQ7 A;  1RZ4 A;  3HRT A;  3MCZ A;  4IXA A;  2DQL A;  1HW5 A;  4NB5 A;  1KU7 A;  1WRJ A;  1GXQ A;  1YG2 A;  1R5H A;  5CVI A;  1XMA A;  2NNN A;  3R61 A;  2FBH A;  4GCV A;  1YTY A;  4FT8 A;  4KDP A;  1TNT A;  5HLG A;  5KK1 A;  1D8J A;  4CXF A;  5AIQ A;  3KP7 A;  3FWE A;  3F3X A;  1WWX A;  4I2O A;  1JXS A;  5ICG A;  3HRU A;  3ZMS A;  4HX4 A;  3G73 A;  1L3L A;  1BC8 C;  1LNW A;  1XGN A;  1O7L A;  4HDU A;  4GYG A;  3ULQ B;  2L02 A;  1BBY A;  2P5K A;  2Z5U A;  1K7A A;  1O7F A;  1X3U A;  3L09 A;  2QVO A;  4B8X A;  2O8X A;  2QQA A;  3I71 A;  4MQ9 F;  3ROU A;  4HBL A;  5JVT A;  2D2W A;  4M73 A;  1KU2 A;  1W7P D;  4JBA A;  2PI0 A;  1QGP A;  2FOK A;  2EFN A;  2L3D A;  3K1M A;  5FLX Z;  4P5O A;  1Z9C A;  2M5W A;  1ZG3 A;  1ODD A;  1FYK A;  2ELH A;  1OYW A;  2F5E A;  5LHI A;  2AXL A;  2YR2 A;  1CF7 A;  2P6S A;  3M8E A;  4LK0 F;  4LGW A;  3N97 A;  3QU6 A;  2V79 A;  2ZME A;  3HUG A;  1LJ9 A;  4HOB A;  1IN7 A;  4RB1 A;  1I27 A;  1KU9 A;  3LAJ A;  4OOI A;  2VE9 A;  1CGP A;  4U88 A;  3WTZ A;  3R0J A;  1ZRF A;  1FYM A;  2PMU A;  3ZMZ A;  5ICE A;  2KRF A;  1XCB A;  1BM9 A;  5A2Q K;  3D5L A;  5FB2 A;  2XHK A;  2FNA A;  2X4H A;  4A5N A;  4UVA A;  3SQN A;  4LJZ F;  3KP5 A;  2K27 A;  3SXY A;  3V8K A;  1FC3 A;  1FP2 A;  2FML A;  3WTT C;  3COA C;  1MZB A;  1BI1 A;  2LF8 A;  2Q2E A;  1USS A;  2IA1 A;  4QLC U;  2MBF A;  2K02 A;  3TOB A;  3Q9V A;  1FWZ A;  5HS8 A;  3VB2 A;  5LEK A;  3K0L A;  3W6K B;  5DYM A;  1RNL A;  4FX0 A;  2FF4 A;  4KIG A;  1Z6T A;  2LDU A;  4UHT A;  4R8H A;  1RIO H;  3EYI A;  1YW8 A;  1U78 A;  3T8R A;  1OMI A;  4Y13 A;  1P92 A;  3R4K A;  1F1Z A;  2W25 A;  5CVV A;  3WE3 A;  5LRS A;  1TNS A;  4BHC A;  3V7R A;  5JFR A;  2K4B A;  1FP1 D;  3BOQ A;  1MJ9 A;  4KUM A;  4JK1 X;  2A6H F;  1SMY F;  3Q5F A;  6PAX A;  3K2Z A;  2DK8 A;  4O6J A;  1KQ8 A;  2HZT A;  2HFH A;  1U5T A;  1W7P A;  3GUD A;  5HS9 A;  2AS5 F;  2W84 A;  4UUV A;  5F1R A;  2XRN A;  4HV5 A;  3JW4 A;  1LDJ A;  2DPU A;  1ZLJ A;  4OIO F;  1Z7U A;  5IT3 A;  4L5I A;  3IKT A;  4MTE A;  3RKW A;  3GW2 A;  3SZP A;  2DK5 A;  4I01 A;  4RAY A;  3BZ6 A;  3ZPL A;  3F72 A;  1J0R A;  4EVI A;  1JGS A;  1SD7 A;  4KT5 C;  3B02 A;  1P4X A;  2YPR A;  5E1Z B;  2DI3 A;  4HZF A;  4CZZ A;  1P4A A;  3K9T A;  1U3E M;  1REP C;  3WTW C;  5CLS A;  5K5Q A;  5H6Q A;  3VOD A;  1HQC A;  3CUQ B;  1QZZ A;  1W5S A;  4ZYG A;  3WTV C;  3T0Y A;  1P2F A;  1ZRC A;  4P96 A;  4AIJ A;  2NAZ A;  3HSR A;  1FY7 A;  4IRI A;  3CJN A;  1ZHF A;  3WTX C;  4ENN A;  4WXD A;  1KQ0 A;  2K86 A;  4F7Z A;  3U2R A;  1R22 A;  2R3S A;  2DTR A;  1XSX A;  4UV8 A;  3HRM A;  2NS0 A;  3I4P A;  1T6S A;  3LQR A;  2EJR A;  3J81 Z;  3BDD A;  1JHF A;  1ZG1 A;  3E97 A;  1W4M A;  4LB5 A;  3KP6 A;  1IRG A;  4O5V A;  1YIO A;  1WQ2 A;  4P9U A;  4EGY A;  2HTJ A;  4MHG A;  1EH6 A;  1WSU A;  3TO9 A;  5CVU A; 
#chains in the Genus database with same CATH topology
 4MEY F;  3BTC A;  3A03 A;  2NRA C;  1OIS A;  1TW3 A;  3IH2 A;  1YQA A;  5ILV A;  5F0F A;  5D8L B;  2V9K A;  1MBH A;  3I53 A;  4DYQ A;  5FD6 A;  3TKY A;  5IT9 K;  2EFQ A;  5CVJ A;  1QRY A;  2JTV A;  2OQG A;  3NAR A;  1MSE C;  4WCG A;  1TT5 B;  2G7H A;  3HYI A;  3QOP A;  2HYF A;  2J5P A;  2K9S A;  1IN8 A;  9ANT A;  1S9H A;  1U8R A;  5BS6 A;  3FHN A;  2CQ7 A;  4M6X A;  1RUN A;  2Z2S B;  3GME A;  4LK1 F;  3VWB A;  2O5R A;  4ZYH A;  3CCS I;  1NG6 A;  3FM3 A;  1T8I A;  3VPR A;  1YS7 A;  4E7S A;  4G94 A;  5DD8 A;  3RPU D;  2R7W A;  1K78 B;  1XDU A;  3TQN A;  1MJB A;  1D0Y A;  3E6B A;  3P7N A;  4A93 J;  3DEW A;  5IYB J;  2V4J C;  4B43 A;  3GTJ J;  2DQR A;  4BJT A;  3A0B C;  1R23 A;  2I5U A;  4UXN A;  5KNL A;  4NQW B;  4JYK A;  3OYH A;  1Z0X A;  1MSF C;  1T56 A;  2VJI A;  2WAQ A;  4B48 A;  2FBK A;  1ZGJ A;  2IW5 A;  2R0Q C;  3BY6 A;  4NBQ A;  1J7K A;  3S8P A;  1Y0U A;  3H0G J;  2RNJ A;  3O3K A;  4JX4 A;  3A1Y A;  4N9H A;  4JQF A;  3ERE D;  2PBI A;  1RUO A;  2EIK H;  1XMK A;  1MBF A;  5DCM A;  2NVU B;  3BC8 A;  2OZU A;  2XAS A;  4BHB A;  4KIT B;  3PSI A;  1S8N A;  2GBY A;  3KZI C;  5M3M J;  4HX8 A;  1N77 A;  3WTS C;  5JHU A;  2EBI A;  3CZ6 A;  4CSW A;  3TO6 A;  3CC7 I;  3IV5 A;  2F4I A;  4M3G A;  3N4M A;  1KZH A;  2WTE A;  1MDM A;  5KCM A;  2EIJ H;  4C3J J;  1S5L C;  3E5X A;  1YYV A;  4HDV A;  1VQ5 I;  3KE2 A;  1SVM A;  3LA2 A;  1F36 A;  1K79 A;  5GAH J;  2OUM A;  4LLG F;  4R79 A;  5D4R A;  4A12 A;  5EYR A;  3LST A;  2XIG A;  1G59 A;  3RCO A;  2FU4 A;  2E36 A;  5GTH C;  3H3V K;  2GQQ A;  4IHS A;  4OIQ F;  4D0P A;  3HKZ N;  1VQM I;  1W0T A;  1FSH A;  4P9F A;  1A6I A;  2W4S A;  3HHG A;  4KMF A;  4ZJZ A;  2VQH A;  4AIH A;  3K69 A;  5FKM A;  2D1V A;  2X6X A;  2WV1 A;  3DXJ F;  2JA2 A;  2M34 A;  3CUO A;  3HSE A;  4PZJ A;  4XIC A;  1OQY A;  3OL3 A;  3ZQQ A;  2PX9 A;  1T38 A;  3ABU A;  1BN5 A;  2Y9Y A;  1RES A;  2VT2 A;  2XRL A;  3JRH A;  4M71 A;  3HOY J;  4A3B J;  1VFC A;  3ML6 A;  2QSF X;  4EV0 A;  3FMQ A;  4WX9 A;  3G6E I;  2CFX A;  1MMN A;  2J5O A;  3O8G A;  1ZYR F;  3QP5 A;  2CQN A;  2BYV E;  3OWT A;  2KKO A;  1P6R A;  3KZZ A;  4BNC A;  2MH2 A;  2DA5 A;  1R5G A;  2DOA A;  3AKZ A;  5GAE J;  4EEF G;  4N0B A;  4PFP A;  3FIW A;  3P9C A;  5DS9 A;  2ID6 A;  2HDW A;  5AON A;  3WGH A;  1IXS B;  1BR4 A;  1QQI A;  3J7Y J;  1G3Y A;  1NH3 A;  1WGX A;  2W85 A;  2ZNY A;  3CC4 I;  2ZO4 A;  3C2B A;  4YG2 F;  1AU7 A;  2H6B A;  3ZP5 A;  1AOY A;  1ULY A;  1R49 A;  3FXR A;  2FA5 A;  2M8E A;  3QYF A;  5EG0 B;  4DGW B;  5F0H A;  1A31 A;  4HF0 A;  1B9M A;  1W36 C;  4NC8 A;  3V7C A;  4XN0 A;  3OSG A;  1OCZ H;  1RPW A;  1MNE A;  1D8K A;  1K83 J;  2QEX I;  5BOX A;  1FOY A;  2CS3 A;  2LRE A;  1SAU A;  4IVN A;  2JA6 J;  1D0X A;  2NYX A;  3P9K A;  2CO5 A;  3HBL A;  5E1W A;  5L3C A;  3CMY A;  5BMZ A;  4HLX A;  2M0M A;  4DBQ A;  1WZ2 A;  3J80 K;  1IF1 A;  3BTJ A;  5M3F J;  5EDN A;  2BE5 F;  2VC1 A;  1SFU A;  3FHZ A;  4AWX B;  1PP8 F;  3PQJ A;  3VSL A;  1Z3Y A;  2HDD A;  3I59 B;  1U2W A;  4HQE A;  1BI0 A;  4B3X A;  1Y0N A;  1DU0 A;  4YFN F;  2KFD A;  3RPU A;  2MSY A;  3C3W A;  4A3K J;  2E2H J;  3L7W A;  3LWF A;  2ME6 A;  1D0Z A;  3WOD F;  2GZW A;  2LRD A;  4CCL A;  3I5U A;  4OAY A;  3KFW X;  2HEO A;  4S0H B;  4II3 A;  1KGS A;  4RGS A;  3ZN1 A;  4BJ5 C;  3PL8 A;  2Y2Z A;  3MKW B;  3H3U A;  2QEN A;  3KP3 A;  2DLL A;  4HLY A;  2AHQ A;  1VZ0 A;  3V8L A;  3ABM H;  4C3H J;  4HNT A;  4AIK A;  3CDL A;  3HHH A;  4PK4 A;  2C6Y A;  3TMO A;  1FJL A;  2DCE A;  4U0Y A;  3IUO A;  3DP7 A;  5DEQ A;  3PQK A;  3MAJ A;  1I3Q J;  2NNY A;  1Y8R B;  1KON A;  1T95 A;  1XB4 A;  4N4N B;  2KIS A;  3W2W A;  3GX4 X;  1Q1V A;  4XKC A;  3K4N A;  4E7H A;  4YIR X;  2LY1 A;  3JSO A;  4F55 A;  2G7U A;  4FCY A;  3S3M A;  1IO2 A;  3D5R C;  4OWR B;  2V6E A;  1X4P A;  5C4X J;  3CTA A;  4KT6 A;  2EK5 A;  2WA0 A;  4AVZ A;  3GYH X;  2BZT A;  4YII A;  1RR8 C;  2VOP A;  4UV9 A;  2MD0 A;  2STW A;  1XCV A;  1TQI A;  2IA2 A;  3EYY A;  4BQN A;  1UFM A;  3G1L A;  2KIM A;  1GVD A;  2HGC A;  1JE8 A;  5FJ8 J;  3MKY B;  5FFX A;  4Q4Z F;  4RM3 A;  2JPC A;  1VQO I;  5GPA A;  5M5Y J;  2WY8 Q;  3OIO A;  1RC9 A;  4RB0 A;  4BXF A;  4CHU A;  1P4W A;  4XL9 A;  5CYV A;  1IAW A;  4YIF A;  4X0G A;  1Z91 A;  2ME0 A;  1JGG A;  2HQN A;  3TDU C;  4Y7N J;  3SJM A;  1JHH A;  1ZG5 A;  3BR0 A;  2KL4 A;  2MA3 A;  4HST A;  4F92 B;  5E3M A;  2FXA A;  2V1X A;  5EGO A;  2O61 A;  5DDG A;  4BYY A;  3U9G A;  4DIQ A;  3H0D A;  1X1P A;  2OF7 A;  4PGH A;  2KZV A;  4GYI A;  2NVX J;  3IP4 B;  2VOD A;  1FLI A;  2E1M B;  3DKY A;  2QSG X;  3OL4 A;  4BKX A;  2F5C A;  4IF4 A;  4RB2 C;  1GV5 A;  5IOY A;  4BUP A;  4KJZ A;  2X1E A;  4UVB A;  4ZYD A;  2EFP A;  2VC0 A;  3K4J A;  1OYI A;  2JPB A;  3NWT A;  1JJ6 C;  2E2I J;  2WAD A;  5J8F A;  4M6Y A;  3I54 A;  2CW8 A;  1ZR4 A;  4RGU A;  1U0J A;  3Q0W A;  3HL2 A;  2EV6 A;  3I4N J;  2KIF A;  3SEZ A;  1QZE A;  4KFC A;  1I1S A;  4RGR A;  3DLA A;  2IS2 A;  4M9X A;  2R5Y A;  4IOA F;  4EGZ A;  4XKV A;  1JTY A;  4U0W A;  1MBK A;  2FEZ A;  2XC7 A;  2B9S A;  4CO8 A;  1VI0 A;  3T1B A;  3CCR I;  5IP6 A;  3K4B A;  1B6A A;  1MH3 A;  5ICF A;  2KPM A;  3M3Y J;  4KIF A;  3HOV J;  1T98 A;  1AA7 A;  2UXN A;  1XSV A;  1T0F A;  4DYR A;  3OYK A;  5K1Y A;  3FMS A;  3DBH B;  1EH7 A;  4D5C A;  3AG2 H;  2VN2 A;  2HQR A;  4G6D A;  5A2Q Z;  4C2U A;  5FLX K;  2PQ8 A;  3CO7 C;  1X1C A;  2LD5 A;  4CUG A;  5HNF A;  2DJI A;  2DN0 A;  5GAD J;  2ZBK A;  1ON1 A;  1U9N A;  3MZY A;  3OOU A;  5D6F A;  3F22 A;  3AFH A;  4U0V A;  1GHC A;  2GOX B;  3B73 A;  2V26 A;  3OR1 C;  5E8I A;  1EA3 A;  3PIP F;  1YRN B;  4RMN A;  4HQM A;  1HSJ A;  3TP3 A;  5BNG A;  1MBG A;  2M87 A;  2PLY A;  3S14 J;  3CCM I;  4J19 A;  1TZL A;  2TDX A;  2MAB A;  4CCN A;  1OCC H;  3MKL A;  3RKY A;  2F5D A;  2QZ8 A;  2V6C A;  3DPL C;  1KA8 A;  2FD5 A;  2HPM A;  1IN4 A;  1R7J A;  4OIP F;  1LPQ A;  3M8J A;  2EV5 A;  2Q1Z B;  4R1H A;  1JKO C;  3JTH A;  1R4M B;  1WKM A;  2QQ8 A;  3KEQ A;  2L01 A;  1HBX G;  3SZT A;  4XID A;  1FX7 A;  1BW6 A;  1QPI A;  4G7Z F;  2WBM A;  2A6E F;  5ILS A;  3AL0 C;  1VQN I;  1ACI A;  4U7D A;  4LFU A;  3K70 D;  2DMT A;  4XON A;  1JKR C;  4V2F A;  3IH3 A;  1VQK I;  3OYE A;  1WI9 A;  3F8F A;  1B4A A;  2IGN A;  3K4K A;  4XN3 A;  4LIU A;  3H3Z A;  4XNF A;  2VIX A;  2XSJ C;  3FZV A;  4RLF A;  1MMG A;  1QVT A;  1YO5 C;  3IC7 A;  1K61 A;  2Y0M A;  4YFK F;  3H36 A;  1XSD A;  2MYS A;  2X6Y A;  1WHU A;  3QYB A;  2DOE A;  4GGG A;  4ABZ A;  4ZYE A;  4MGR A;  1ORK A;  3RJP A;  3IH4 A;  4XBF A;  3F8M A;  5K5R A;  4DOZ A;  1XX5 A;  3K2A A;  3CES A;  4FHT A;  4A6D A;  3F6V A;  3ASN H;  1PUF B;  4FET A;  4KN7 X;  4M9S A;  1FMW A;  2L7K A;  1IV6 A;  2O9L A;  3VEP A;  4D9J A;  2R7Q A;  4HG2 A;  1OR7 A;  3BJO A;  4Q48 A;  2XVC A;  1PDN C;  4IHV A;  2P6T A;  3O8H A;  1PYV A;  3GTM J;  2RKH A;  3GFL A;  4FIS A;  2NVT J;  2CQQ A;  2Z33 A;  1WVR A;  3FXQ A;  5D4S A;  1L0O C;  4KIB A;  5J3L A;  4WWC A;  1I1G A;  3DV8 A;  4L9V A;  2DMP A;  2CJJ A;  4S05 A;  1G3T A;  3LSP A;  3HOS A;  2PN6 A;  2QKM B;  4CA0 A;  2RQP A;  2LVS A;  2R7V A;  4IRH A;  1QVU A;  5H20 A;  4UUS B;  1WJA A;  3RYP A;  2P5L C;  3Q0U A;  2QBY B;  3W2A A;  3PFY A;  5DM7 F;  3DEE A;  5B1B H;  5E3L A;  2H27 A;  3WU1 B;  3S32 A;  3VFZ A;  1V5G A;  4HF2 A;  1T2K A;  3S2H J;  3MQ0 A;  4ZDL A;  1FPQ A;  1UG0 A;  1FTT A;  2QF7 A;  4C3I J;  1IUF A;  3QP6 A;  4RB3 C;  2A68 F;  3FM5 A;  4XLA A;  1BIB A;  4XKW A;  2HYG D;  4XLP F;  3B6C A;  4CCK A;  3IL2 A;  1RRJ A;  3LSI A;  3E6C C;  1YE9 A;  3HTS B;  3ZQF A;  3QPL A;  4A3F J;  3D1N I;  1HKQ A;  3C2G A;  4NUB A;  2RQQ A;  4LG3 A;  2ZXJ A;  2VBZ A;  3OYA A;  3E5Q A;  5F08 A;  1U6G A;  1SFE A;  2M7B A;  1GXP A;  4I02 A;  1DUX C;  2Z1D A;  1O3T A;  3KIO A;  2ESN A;  2JK3 A;  3PM1 A;  1DPU A;  3S1Q J;  1UG2 A;  4IHT A;  4BH9 A;  1I3A A;  2XB5 A;  2Z3Y A;  4RGX A;  5FD5 A;  2GIZ A;  2L4M A;  2WWY A;  2LTP A;  5DUI A;  4AU7 A;  4RAZ A;  1HW1 A;  3RTR A;  5IYD J;  4OIN F;  3A01 B;  5F6F A;  4DZP A;  1Z21 A;  2CH0 A;  2HZD A;  3BR3 A;  2XF5 A;  3GFM A;  4LMY A;  3DTK A;  1ZAO A;  1LFB A;  1DP3 A;  3GCM A;  5J1R A;  1WH7 A;  2BHZ A;  2XPU A;  1V55 H;  3L9F A;  4BDZ A;  1VTN C;  4XRS A;  1ZH5 A;  1FOW A;  2YS9 A;  2N8G A;  2H09 A;  3QAH A;  3T5X A;  1TQP A;  3ZXS A;  2P4W A;  2OV7 A;  4OIR F;  5E18 F;  2FMY A;  3FDY A;  3A2K A;  5HLI A;  1VQ6 I;  2G9W A;  3C2H A;  2OBP A;  3EPZ A;  4LIT A;  4LLL A;  2ZC2 A;  1SD5 A;  1Z3X A;  2WB1 A;  5LGT A;  1QU3 A;  3QQA A;  1UCR A;  2M2E A;  3KP4 A;  4M72 A;  2XPW A;  1J59 A;  2E7W A;  3JTG A;  2VJ4 A;  3EDP A;  3CC2 I;  4BU2 A;  4HX7 A;  1BW5 A;  1R00 A;  4E4H A;  2CW0 F;  3UKG A;  3HXL A;  3EUH C;  4XRF A;  2WY7 Q;  4OMY A;  2D1H A;  1K6Y A;  3GFI A;  5B5E C;  2CQX A;  2OCE A;  3OV8 A;  3QWL A;  3OY9 A;  3ZMU A;  5H2F C;  4YEL A;  4BQQ A;  2M4G A;  4ENJ A;  2VON A;  2COM A;  2YUS A;  3EUA A;  3SFZ A;  4BAY A;  1J5Y A;  1MKM A;  4Q47 A;  1R6R A;  4ESB A;  4IJA A;  2KIU A;  3PFI A;  2EA2 A;  4Y33 A;  3K7A J;  3TOA A;  1ETW A;  2VKH A;  2K40 A;  2DBB A;  1UHM A;  1R58 A;  2BY3 A;  4FQG A;  2K9L A;  4YRV A;  1LFP A;  4I76 A;  4ESF A;  1M1E B;  1V5F A;  4A3I J;  1AKH A;  3DQV C;  3GZN B;  2DA1 A;  5IT9 Z;  3I64 A;  4QSH A;  3J7A Y;  2CG4 A;  3HIF A;  1FZP B;  2GOM A;  3KZY A;  5JR3 A;  1OCT C;  3K4C A;  3DBL B;  4YFX F;  2XGC A;  1MNM C;  5D8K B;  1ZLK A;  1FBS A;  2F4M B;  3WU0 A;  3P5J A;  4XOT A;  3J81 K;  4XRM A;  4ZZL A;  2PJR B;  3ABK H;  1Z67 A;  1R1U A;  1DPR A;  1H88 C;  4M3B A;  1JUM A;  1Z7L A;  5L3E A;  3E3V A;  4B09 A;  3CUQ A;  4BAC A;  3RI4 A;  2ELJ A;  4XLH A;  3G4S I;  2R7F A;  2Y69 H;  1FMV A;  3W6J B;  1PP7 U;  1B8I A;  3HPH A;  1B72 B;  3OS2 A;  2ZXH A;  3LFK A;  3S1M J;  4G6T B;  4QIW N;  4ON0 A;  4AYB A;  2BEO A;  1H0M A;  2E71 A;  1TL8 A;  2RDP A;  2JRM A;  5IOZ A;  3BG7 A;  2Y30 A;  2W82 A;  2FQ3 A;  3CLO A;  1R36 A;  5EJC A;  2UUZ A;  4FE7 A;  1TTY A;  1V54 H;  4Y15 A;  1BIA A;  2W57 A;  3DU6 A;  3MZH A;  5HOD A;  3ZMV A;  1ERD A;  4OU0 A;  1AHD P;  1FBU A;  4IKF A;  1HOM A;  2L7Z A;  1J2X A;  4C9Y A;  1LEA A;  3LFU A;  1RI7 A;  2RV8 A;  5L3F A;  4BGD A;  1UB9 A;  2GA1 A;  4DQ2 A;  2BVL A;  5D5X B;  2RNG A;  3FXM A;  1LKX A;  1MBE A;  1A35 A;  4MNU A;  1JT0 A;  5KAF C;  2OD5 A;  3HGG A;  3BR2 A;  4PFO A;  4IHY A;  5HOO A;  1RR7 A;  4XM3 A;  4W1U A;  2XSD C;  5F0C A;  1Y1V J;  3P9I A;  3V8J A;  5HVQ C;  2GXG A;  2K9M A;  4I0A A;  1H89 C;  2MGQ A;  2XAG A;  2LKP A;  3O6B B;  3HGY A;  4BL0 B;  1QBJ A;  3BQY A;  1OYY A;  1EKE A;  4L18 B;  4XLE A;  1SAX A;  3U1K A;  2GXA A;  3TGN A;  3CF5 F;  5H6R A;  5B1A H;  5E3O A;  2EB7 A;  4CIC A;  1XPX A;  2LBF B;  1TWC J;  2R93 J;  2HYJ A;  4LD5 A;  5EEG A;  3MN2 A;  1NG7 A;  3WGI A;  4IL6 C;  5DUK A;  3GO5 A;  2M3A A;  3JR9 A;  2E7X A;  1B59 A;  5TRD A;  1A6Q A;  4DW6 A;  1ZN2 A;  1YX5 A;  3H35 A;  3R60 A;  1V4R A;  1W1W E;  3HC7 A;  1MW7 A;  2ACJ A;  3FBN B;  5GAG J;  2M4K A;  2Z16 A;  2IRF G;  2M8G X;  3C7J A;  2VBX A;  5LHG A;  2I10 A;  3OMY A;  3MVP A;  2RN7 A;  2EV0 A;  4HF1 A;  2MC4 A;  2UXX A;  1LEB A;  2QCO A;  1U8B A;  1HKT A;  2FOW A;  4BBR J;  1XGM A;  2NS7 A;  4I99 C;  2IA0 A;  1OPC A;  2ICW G;  4PSX A;  4WXC A;  3EET A;  5FFZ A;  1Y56 A;  1YJN I;  3L1P A;  3L2C A;  2F4O B;  4LG0 B;  2DDB A;  2A69 F;  3ZQC A;  5IPA A;  4EM1 A;  1K78 A;  2LK2 A;  4NC7 A;  2EFO A;  1S72 I;  4PDK A;  2QGU A;  2W00 A;  1UST A;  4NHJ A;  2RGV A;  3GXO A;  4BS9 A;  5HS7 A;  4NQW A;  3JAM Z;  2ZCW A;  3RDI A;  3PNY A;  1ZGW A;  1IXC A;  2KIQ A;  1JKP C;  3QPS A;  3NWS A;  1EH8 A;  2QM3 A;  3DWL E;  3RZD J;  4IHX A;  1B9N A;  2HQA A;  1OCP A;  3Q9S A;  3E5U A;  4I09 A;  3ZN0 A;  3H9J A;  5M5X J;  2R92 J;  1IRX A;  2KLO A;  2HOT A;  3TL4 X;  2DFI A;  2BV6 A;  2ZME C;  1YI2 I;  3JCU C;  1J75 A;  3FXJ A;  2L5Q A;  2M30 A;  3EUK L;  3LSJ A;  4PUS A;  2XRO A;  4N4O B;  4BEH B;  3J80 Z;  2VL8 A;  2O0Y A;  1X19 A;  2ECC A;  4KA4 A;  2M0C A;  1MMA A;  2H94 A;  1ON2 A;  4G7H F;  2Y0S A;  2ADU A;  4EM0 B;  2A3S A;  3F8B A;  2M9H A;  1IZ1 A;  4Y4R A;  2E1O A;  4Z2Y A;  2L9N A;  2BGC A;  4IQJ A;  1BI3 A;  1TWA J;  5LGN A;  1IG7 A;  2DYS H;  1TW2 A;  3ASO H;  3Q3S A;  1SD6 A;  4Q5S F;  2QUF A;  4ZTF A;  4X1E A;  2DFE A;  5BPI A;  1K6O A;  3LSR A;  2IVM A;  4RAF A;  1FOX A;  4ENM A;  1N25 A;  3KET A;  3J7A O;  1HKS A;  1ZGA A;  4IO9 F;  4KMU X;  1D5V A;  4M9Z A;  2CRG A;  5AIP A;  1O3Q A;  2QWW A;  1OKR A;  3CCE I;  1DU6 A;  4DJA A;  3OSF A;  4OMZ A;  3G71 I;  3S2D J;  5M5W J;  2VQL A;  3QYE A;  2E5Z A;  1S7A A;  2VKV A;  3S3O A;  4XSX F;  5TGT A;  2VAS A;  3F6O A;  3V7S A;  1W36 D;  1BA5 A;  2A5Y B;  2NXN B;  4L5J A;  4ASN A;  2XAU A;  1BR2 A;  3OYD A;  2P7C B;  4KYW A;  3TDZ C;  4A0Z A;  1EF4 A;  2MG4 A;  1PUE E;  3LSG A;  2CQK A;  5K7Z A;  2HR3 A;  1BOB A;  1VQP I;  5LFA A;  2QA4 I;  3BPV A;  5DV5 A;  1S3J A;  1IV8 A;  3W6V A;  2UWM A;  1MMD A;  3HZJ A;  1VQ9 I;  2MC3 A;  5B3S H;  2GAU A;  5ICC A;  2YX7 A;  2P8T A;  3BP8 A;  3WGG A;  1AWC A;  2K4J A;  4ZDP A;  4RLQ A;  3L2V A;  2Y9Z A;  4C2M J;  1N78 A;  2CMP A;  3LSM A;  5FKO A;  1HDD C;  2M45 A;  4RS8 A;  4EJV A;  3NRV A;  4ZC3 A;  3NAU A;  1IN6 A;  2EA4 A;  4FE4 A;  5FO5 A;  2BHY A;  5K5O A;  3CP2 A;  5BQT A;  1IDY A;  1QO0 D;  3NQO A;  1A5J A;  2DT7 B;  4JX6 A;  1CF7 B;  2VJ5 A;  5IY5 H;  5DTD A;  5BPD A;  3F8C A;  2CUE A;  3DTE A;  1Y8Q B;  3VYS B;  4HNU A;  5EG0 A;  3GZ6 A;  5HDN A;  1NHA A;  1R4N B;  2STT A;  2ZME B;  3HUG B;  5ED4 A;  3BJA A;  1NK2 P;  1UHW A;  3BPX A;  3WU2 C;  3CLQ A;  2E1C A;  2KQR A;  5FKL A;  3F23 A;  4H0E A;  2BY2 A;  4WXH A;  1FIP A;  1Y1W J;  5FRM A;  3GZ5 A;  1U5T C;  4HW0 A;  1HA8 A;  2Y31 A;  5C3E J;  2VBY A;  5E8G A;  3U21 A;  3JRC A;  5JLW A;  3HSF A;  2W1O A;  5FRN A;  4DNC A;  2HDC A;  2XF7 A;  2O7O A;  1NTC A;  3OIQ A;  1XGS A;  2K85 A;  3GVA A;  2A07 F;  2GWR A;  3ERM A;  3K1P A;  3CO6 C;  3I59 A;  1JI8 A;  1FNN A;  4E7L A;  4M6V A;  2JUC A;  3FKI J;  2QYO A;  3HOX J;  2P7V B;  2DU9 A;  2D5V A;  2HS5 A;  2IT0 A;  5E20 A;  3HJE A;  3BG6 A;  2ZJ2 A;  3GLX A;  5ERI A;  1IC8 A;  1UZC A;  2K5C A;  2JUG A;  1LB2 A;  2K7L A;  1WJB A;  2OZ6 A;  2F5F A;  4AC0 A;  2LLK A;  4U7B A;  4PGG A;  3W2V A;  1ETY A;  1YW9 A;  2DOF A;  2Q2E B;  4MEX F;  2JSC A;  4TV7 A;  2KJC A;  4XSZ F;  3HRS A;  2ZFW A;  3IRR A;  5DD4 A;  3M1C A;  3A02 A;  2XUB A;  2MD5 A;  3OS1 A;  5J8C A;  4II2 A;  1LDD A;  3OYM A;  4UVC A;  1T39 A;  3S16 J;  3CME I;  2IBD A;  3L2R A;  4ITV A;  1LE8 B;  3GTO J;  3MKZ A;  2F5V A;  2FUG 2;  2E35 A;  4Z6Y A;  5KVR A;  4I98 B;  1TBX A;  1XC5 A;  3QPH A;  1UMQ A;  1W5T A;  1DQU A;  2K3P A;  1WJE A;  1E3H A;  3FIS A;  4P55 A;  1A04 A;  2DJN A;  1R1T A;  3MD2 A;  4HNV A;  2YU9 J;  3T8T A;  3FK7 A;  1F9N A;  4WK8 F;  2A61 A;  1SMT A;  2JT1 A;  3DFG A;  1V3F A;  1KU3 A;  3JRG A;  1IN5 A;  1XD7 A;  3KPH A;  5J47 A;  4N9I A;  3ZQG A;  3M8F A;  3TO7 A;  2ZKZ A;  1XGO A;  3PO2 J;  4UUT A;  3SEQ A;  1G2H A;  1Z1D A;  1XDS A;  1KQ9 A;  1SVL A;  2W24 A;  2ZXW H;  1YX3 A;  1OCR H;  3HKZ A;  2COB A;  3QU3 A;  4BXU A;  2WV0 A;  4D7N A;  3M9A A;  2HOA A;  5K7H A;  1QZY A;  3GTK J;  4G7O F;  2OTL I;  1Q1H A;  2HXI A;  2OCC H;  4Y3O A;  4Y17 A;  5E1X A;  1HW2 A;  2NS8 A;  1IXR C;  2XAF A;  4UNO A;  1FOK A;  1DDN A;  4EMS A;  1SFK A;  3DLL F;  2UZK A;  1D1C A;  2HKO A;  1U5T B;  1W7P B;  1MD0 A;  1ZAR A;  2ZSI B;  4KNY A;  2LY9 A;  2L54 A;  2V7F A;  4CCO A;  1YIT I;  1HLV A;  2DFH A;  2XAJ A;  3OS0 A;  4BY1 J;  2DA7 A;  4HYE A;  1CQT A;  4B1R A;  2VKD A;  1JT6 A;  2K3F A;  1OLT A;  3GTQ J;  4E70 A;  2H1K A;  3V4G A;  4WF2 A;  5JHF A;  2MLK A;  4LLN A;  3KCC A;  4EJU A;  5C44 J;  2WAQ N;  1YFH A;  3IWF A;  5FLM J;  3CJQ B;  4DYC A;  2DT5 A;  3G3Z A;  2DO7 A;  4F93 B;  2CWE A;  4O3M A;  1GVJ A;  2EFW A;  1C0W A;  4G8X A;  1EJ9 A;  1JUS A;  4HV6 A;  3AAF A;  3GF2 A;  2XAQ A;  2L9R A;  2PMZ N;  1Z05 A;  2FQ4 A;  2JN6 A;  3WHB A;  3DPT A;  3OYL A;  4E7J A;  3ONQ A;  2V9V A;  4RDU A;  5TJJ A;  2LNB A;  2D45 A;  3DBR B;  2Z9O A;  1VND A;  2X1C A;  1ZRD A;  2IGK A;  2BBY A;  4GXO A;  3I9V 2;  4A3E J;  5JI6 A;  2CGP A;  5DM6 F;  3BG9 A;  3CUQ C;  3MMY B;  3LA3 A;  2EZK A;  4ZTJ A;  1IUY A;  3ABT A;  5FLV A;  1TQM A;  3H92 A;  3GTP J;  2VBW A;  3L00 A;  3JSP A;  2GLO A;  4A0X A;  3FX3 A;  3VYU B;  4CYC B;  2G0E A;  3OYI A;  2ID3 A;  4C30 A;  5GP9 A;  2DW4 A;  2HU9 A;  2JVG A;  2UV1 A;  3E6D A;  3R0A A;  4IRG A;  2R7D A;  4V2G A;  2R7U A;  1R1V A;  2FE3 A;  2VT3 A;  5ILU A;  2QQB A;  1WCM J;  3AG3 H;  4A3L J;  2HPI A;  2F2E A;  1YRN A;  2XKP A;  1X4O A;  3OYN A;  2R5Z B;  2OAZ A;  5JLX A;  3E7L A;  4ETS A;  3HOU J;  1FIA A;  3LSK A;  5LRR A;  5JVG F;  2HVQ A;  3CCY A;  2LKX A;  1DGR M;  3ABL H;  1BJZ A;  4I6Z A;  2OU2 A;  2OQR A;  4ESJ A;  3HTU A;  1WJC A;  3FMR A;  1IGN A;  1QPM A;  2BW3 B;  2ZJQ F;  3QRF F;  3S1N J;  4GO1 A;  2X85 A;  4EJW A;  3R6S A;  2RVC A;  4H4K C;  1S6L A;  2BXZ A;  3IHU A;  2HTS A;  5FKK A;  2KMU A;  1LQ1 A;  4Y52 J;  2L0K A;  3KLN A;  4PSW A;  4EQQ A;  5HLH A;  2XAH A;  3AG4 H;  3BJ6 A;  3HB9 A;  3ESW B;  4HA8 A;  2ZSH B;  1ZRE A;  3AL0 B;  3CF2 A;  4ZZD A;  4A3C J;  1TLH B;  2A5W A;  2Y75 A;  3F0C A;  3LA7 A;  4BY7 J;  3K6G A;  3K1N A;  3FBI B;  2YU3 A;  3K4L A;  3O2P E;  3BTI A;  1HXD A;  1EV7 A;  2X48 A;  2L2O A;  2PG4 A;  1VQ8 I;  2ZJP F;  2JVH A;  4G9Y A;  2VE8 A;  4PJ0 C;  5LGU A;  3BCA A;  1ETQ A;  4PJM A;  2QLZ A;  2DPD A;  1TP4 A;  3ZMD A;  2PEX A;  2ZJR F;  4F52 A;  3ZQL A;  2VKE A;  2EIL H;  1F4K A;  3ZR8 X;  1MIJ A;  4QWQ A;  3PNT A;  1FBQ A;  2GM4 A;  2XKO A;  2BVM A;  2YX4 A;  4JOM A;  1PUF A;  2O03 A;  4XOR A;  2KHM A;  3CP8 A;  1STZ A;  3HOT A;  2VQG A;  1I5Z A;  3TED A;  3BWG A;  4PCQ A;  5L3B A;  2RAE A;  2R7X A;  2FNP A;  4XLN F;  2HOE A;  3IWZ A;  3CMM A;  2V1D A;  3ECO A;  2W7N A;  2QQ9 A;  3M1E A;  2ZXI A;  4ZYA A;  4LB6 B;  1D3Y A;  3RIR A;  2E60 A;  1ZTR A;  3I58 A;  4HEA 2;  4XQF A;  5F1J A;  1U9O A;  2WC2 A;  2LF7 A;  4F3Q A;  3UR3 C;  2FRH A;  4S04 A;  4MQV A;  1WJD A;  3K10 A;  3FXU A;  2GA2 A;  3G1O A;  4KIC A;  2VB6 A;  1JTX A;  2HOS A;  4UUS A;  3CCU I;  1VQ4 I;  2QBY A;  1UJ8 A;  4QTR A;  1N75 A;  4J00 A;  2FSW A;  5D5U B;  2ZFU A;  1R5I D;  5DCF A;  1UHS A;  4ENK A;  2PMH A;  1BJA A;  3OYF A;  2TRT A;  3GLL A;  1LDK B;  3BZK A;  2V1U A;  3V42 A;  4EJT A;  2ISZ A;  4B44 A;  5GTI C;  1APL C;  4I7H A;  2IJL A;  2KZG A;  3RSN A;  4ANJ A;  5CKT A;  1YS6 A;  2WAE A;  1RET A;  2RC4 A;  1LVK A;  1G6N A;  5FGM A;  4BQA A;  5DCM B;  3H5R A;  3WG9 A;  5CVR A;  2BXY A;  4MO7 A;  1E2X A;  1SD4 A;  3BLY A;  2CW7 A;  2EWN A;  4P1W A;  1Y39 A;  3ELK A;  1Y6I A;  3C18 A;  3D0S A;  4L9N A;  1ITY A;  2WAF A;  3S2W A;  1BI2 A;  1J9I A;  2XGX A;  3I3L A;  2O8K A;  2MLG A;  1ZKG A;  2IEK A;  3WE2 A;  4DBR A;  3CCQ I;  1MDM B;  1ENH A;  3E6M A;  2L4A A;  2OTJ I;  5FKN A;  2HWV A;  2O6G E;  1G3W A;  3BG5 A;  1MMS A;  1GLN A;  2R7R A;  3DF8 A;  3TBI A;  2LOO A;  2DA3 A;  2CSO A;  1IW7 F;  3G1M A;  3CDH A;  4UB8 C;  2MFZ A;  1X1B A;  4M74 A;  3AG1 H;  2JA5 J;  1IRZ A;  1Z77 A;  4XLC A;  3A01 A;  4CYD A;  2NOG A;  1P9Q C;  4AD9 A;  4E7K A;  5IP7 J;  4KIS A;  1H9G A;  2MH9 A;  3JRE A;  4CH7 A;  3BCB A;  2PJP A;  2F48 A;  3LNQ A;  2HI3 A;  2OPT A;  5LBQ A;  4L9J A;  4I0B A;  4OAZ A;  3BRO A;  3KLO A;  1TWH J;  3EQL F;  3L2U A;  5KAI C;  2O3F A;  4M3F A;  3IAM 2;  1O3S A;  3DKW A;  3LOC A;  3WTY C;  1ZK8 A;  5J6X A;  2XB0 X;  3KYL A;  2X51 A;  4F91 B;  4AVP A;  3SDB A;  2LP0 A;  1LUJ B;  3ZOB A;  1DP7 P;  2EPF A;  1GUU A;  3BG3 A;  1YHQ I;  3H9Q A;  1RKW A;  3ISP A;  2EQR A;  4L9T A;  3RKX A;  2KRC A;  2KJB A;  3KP2 A;  5HNH A;  4EM2 A;  2Q8K A;  5E3N A;  1F5T A;  5EEH A;  4KN4 X;  3VYR B;  2A05 A;  3GWZ A;  3BTL A;  2XGE A;  1I6X A;  2BY1 A;  1E17 A;  2LG4 A;  5F64 A;  4IHW A;  2CV2 A;  2JA7 J;  4K2E A;  2LSO A;  5LEJ A;  1X2N A;  1KYZ A;  4CGZ A;  1FT9 A;  1O4X A;  3M7G A;  1QNT A;  4MTD A;  4L5E A;  2IGM A;  2LYC A;  5EZH A;  1JUP A;  5TIS C;  3UNG C;  1IJW C;  4ZH4 F;  1ZEL A;  3F21 A;  3SZG A;  4BHP A;  4U87 A;  2PMZ A;  5FRO A;  1D1B A;  3OYC A;  2OA4 A;  1YOV B;  2CUJ A;  4LOC A;  3IRQ A;  1SFX A;  3L2Q A;  1ZR2 A;  3OR2 C;  3MWM A;  4QPO A;  1S7O A;  3PUF A;  2ESH A;  2IP2 A;  4FX4 A;  2TCT A;  1KYW A;  3H5N A;  4M3D A;  3H5A A;  4L0Z B;  2DAO A;  2IPQ X;  1H9T A;  1YW7 A;  1SC7 A;  4X6A J;  1I6H J;  1YLF A;  4UB6 C;  5D5W B;  2PJR A;  1UEL B;  2CYY A;  2FBI A;  5D6E A;  3JRI A;  1QA6 A;  3LL7 A;  1J09 A;  2H6C A;  5CJ9 A;  3OYJ A;  4BDY A;  2M1B A;  3FKJ A;  3WTU C;  2E2J J;  3H1C A;  1O3R A;  2CV0 A;  3GBG A;  3SHF A;  1R9T J;  3GFJ A;  1MGT A;  1B72 A;  4A6E A;  1FYL A;  2PFB A;  2JZY A;  3CQZ J;  2CUF A;  4G12 A;  2XV4 S;  1OFC X;  2B63 J;  5CQG A;  5LLQ A;  1O57 A;  1IRF A;  5GPC A;  5J40 A;  3GTL J;  1ETV A;  2OC6 A;  5HDK A;  2VOO A;  5C4J J;  2E1N A;  1HF0 A;  3U1D A;  2VLA A;  5D5V B;  4RBO A;  2HNH A;  2EIM H;  5CPR B;  3FF5 A;  1G3S A;  2R7T A;  5K7F A;  2JSP A;  3C1D A;  1SEU A;  1POG A;  2Y48 A;  2B7E A;  3RQI A;  3I56 I;  2L7F P;  4A69 C;  1MH4 A;  4EJO A;  2ETH A;  1T0F C;  2ISY A;  4A2U A;  1HST A;  2YSR A;  1PVE A;  3CD6 I;  3OOP A;  2K9Q A;  2Z99 A;  3QPT A;  5E17 F;  1S29 A;  2X6O A;  4A0Y A;  3LAP A;  3EUH A;  3ECH A;  4L0Y B;  3VOE A;  2BOL A;  3JRA A;  2ECB A;  4IPA A;  1FSE A;  1MJA A;  2OJE D;  3K4M A;  2EH3 A;  3I0T A;  3REO A;  3ZMT A;  3GEZ A;  3MEX A;  2DTZ A;  3DCF A;  3JAM K;  1YJW I;  2LBF A;  3NEU A;  2IS6 A;  2P5V A;  2B0L A;  3F8N A;  2VXZ A;  4C2T A;  1YIJ I;  5E79 C;  3CCJ I;  1Z6R A;  2X0L A;  3A4C A;  2ZNZ A;  1XTA A;  3KYD B;  4PJN A;  3A0H C;  3PNV A;  1BR1 A;  1WPK A;  3FK6 A;  1BC7 C;  4CDG A;  1ONV A;  1BOA A;  4BBS J;  5HDG A;  4XLF A;  3RYR A;  1G4D A;  3HOZ J;  5LHH A;  2HXO A;  3LQQ A;  5EGO B;  3MFK A;  1GV2 A;  1K4S A;  4G6Q A;  2E1M C;  4B47 A;  4HAM A;  3HEF A;  1X3W B;  4CCJ A;  1XN7 A;  3IKV A;  2CU7 A;  2DXI A;  1YJ9 I;  2Q0O A;  3MZ8 A;  2GXB A;  4A5M A;  1B1B A;  1H8A C;  3HDD A;  3BR6 A;  3S15 J;  3RPQ A;  1P7I A;  1S7E A;  2GIV A;  3KEO A;  5B66 C;  3DEU A;  5L3G A;  2JMW A;  1QHG A;  1LVA A;  1V5E A;  5L3D A;  2HKX A;  2EZL A;  2JRT A;  4LG0 A;  4IEJ A;  3JRD A;  3ZQ7 A;  4A3M J;  2EIN H;  1RZ4 A;  2H8R A;  3HRT A;  4XK4 A;  1W5C C;  3MCZ A;  1ETX A;  1P7J A;  4IXA A;  2DQL A;  4EAT A;  4YEJ A;  2R5Y B;  3KEY A;  1HW5 A;  2KT0 A;  4NB5 A;  1KU7 A;  1WRJ A;  1GXQ A;  1YG2 A;  4E6K G;  1R5H A;  3SFI A;  5CVI A;  2R7Z J;  1XMA A;  2NNN A;  3R61 A;  2FBH A;  3DTI A;  4A3J J;  1HC8 A;  2KP6 A;  4GCV A;  2DA4 A;  3W3C A;  3ZRG A;  2I8D A;  4FT8 A;  4AID A;  1YTY A;  4BEH A;  4KDP A;  1DGW Y;  1OR7 C;  4V19 K;  2E5N A;  1TNT A;  5HLG A;  5KK1 A;  4BE1 A;  3JRB A;  4GFB A;  1D8J A;  4E7I A;  4CXF A;  3FXL A;  5AIQ A;  5J1U A;  1UAA A;  3KP7 A;  3FWE A;  4IX7 A;  1GDT A;  3F3X A;  1WWX A;  4CZC A;  4I2O A;  1JXS A;  5ICG A;  2JQ7 A;  3HRU A;  4IOC F;  4BE0 A;  4E7Z A;  2X9D A;  3ZMS A;  1ZQ3 P;  4HX4 A;  1X1A A;  4W97 A;  4BJ6 C;  3G73 A;  1L3L A;  4NDL A;  1BC8 C;  1LNW A;  3RKQ A;  1XGN A;  3H9G A;  4MLO A;  2KDZ A;  3SDG A;  1O7L A;  1SAN A;  2LC2 A;  5LD2 C;  4HDU A;  4NNJ A;  2LH9 A;  4GYG A;  3ULQ B;  5KHD A;  3S17 J;  2P81 A;  2L02 A;  3JRF A;  1LFU P;  1BBY A;  2P5K A;  2Z5U A;  1K7A A;  1O7F A;  1X3U A;  3FXO A;  3SYT A;  2IXS A;  5J1Y A;  3G2B A;  2K9N A;  3L09 A;  2EZH A;  2QVO A;  2H1L A;  4B8X A;  2O8X A;  1T08 B;  2WB1 N;  3CCL I;  2X6W A;  2CV1 A;  1HCR A;  2QQA A;  3I71 A;  4IQ4 A;  4MQ9 F;  2HVS A;  3HPG A;  1VQ7 I;  4HRI A;  3ROU A;  4HBL A;  2JJ7 A;  5JVT A;  2D2W A;  1MBJ A;  2DA2 A;  1BL0 A;  4M73 A;  1KU2 A;  1W7P D;  4JBA A;  1X3Z B;  2PI0 A;  3OYG A;  1QGP A;  2FOK A;  1XS9 A;  3GTG J;  1W0U A;  2EFN A;  4D1Q A;  3ZGK A;  2L3D A;  2XPV A;  3K1M A;  2DOD A;  1NK3 P;  5FLX Z;  2IS4 A;  3BQZ A;  4XMY A;  4A3D J;  3F9K A;  4P5O A;  1Z9C A;  2M5W A;  3N05 A;  3BZC A;  3PJR A;  1TWF J;  1ZG3 A;  1ODD A;  3CCV I;  3VDX A;  2ELH A;  1FYK A;  3J7Z I;  1OYW A;  2F5E A;  5LHI A;  2CUZ A;  2AXL A;  3KX2 A;  5IYC J;  2YR2 A;  1CF7 A;  2P6S A;  2LMD A;  3M8E A;  4LK0 F;  4LGW A;  1SVO A;  4B3A A;  3N97 A;  2DT6 A;  4ZDO A;  3QU6 A;  2V79 A;  2ZME A;  3HUG A;  1LJ9 A;  4HOB A;  1IN7 A;  3PUB A;  1I27 A;  1KU9 A;  2P0W A;  4OOI A;  4RB1 A;  3LAJ A;  2VE9 A;  1E3O C;  1CGP A;  4U88 A;  3WTZ A;  3R0J A;  1ZRF A;  1FYM A;  5EF6 A;  5EZG A;  2PMU A;  3K70 C;  1TC3 C;  4UY8 I;  3QOE A;  3BR1 A;  3E1S A;  3ZMZ A;  1K4T A;  5EEA A;  5ICE A;  3BT9 A;  1D5Y A;  4CCM A;  2KRF A;  1XCB A;  2A6T A;  2MW8 A;  1BM9 A;  5A2Q K;  4AYB N;  3D5L A;  5FB2 A;  2VI6 A;  2DMN A;  2XHK A;  2FNA A;  4PJL A;  2NOJ B;  2X4H A;  4A5N A;  4UVA A;  3X2Q H;  3S1R J;  3SQN A;  4LJZ F;  3KP5 A;  2CFO A;  2K27 A;  3HOW J;  2JA8 J;  3SXY A;  4BXX J;  3L2W A;  3V8K A;  1FC3 A;  1FP2 A;  2FML A;  3WTT C;  3COA C;  1MZB A;  2JWT A;  1VQL I;  1FTZ A;  1BI1 A;  2LF8 A;  2RRE A;  2Q2E A;  3RZO J;  4PJJ A;  2NVY J;  1USS A;  1IDZ A;  2DA6 A;  2IA1 A;  4QLC U;  2MBF A;  2K02 A;  3TOB A;  3Q9V A;  1FWZ A;  3PSF A;  4D5F A;  5HS8 A;  1D1A A;  3CJT B;  4GDF A;  1X1D A;  3VB2 A;  1WH5 A;  2X1D A;  4XKB A;  2M7A A;  1LE8 A;  2EZI A;  3B6A A;  2R7S A;  4MIM A;  5LEK A;  3K0L A;  3W6K B;  3BR5 A;  4RAG A;  5DYM A;  1RNL A;  4DZJ A;  4FX0 A;  2FF4 A;  4KIG A;  1Z6T A;  3ZQI A;  1JKQ C;  2LDU A;  4XOP A;  4UHT A;  4R8H A;  3OYB A;  1RIO H;  3EYI A;  2IS1 A;  1YW8 A;  3DPU A;  1U78 A;  3T8R A;  1OMI A;  4Y13 A;  1P92 A;  4D7M A;  2R4G A;  4M3E A;  2HVR A;  3R4K A;  2FX0 A;  1F1Z A;  2W25 A;  5CVV A;  3WE3 A;  5LRS A;  1HDP A;  3TP0 A;  1TNS A;  4BHC A;  3V7R A;  5JFR A;  3S3N A;  4AUX A;  3OIP A;  2K4B A;  1FP1 D;  1X58 A;  1MJ9 A;  3BOQ A;  3LSH A;  4FAS D;  1E0E A;  3E0J B;  3LMM A;  2VXD A;  2VQC A;  4KUM A;  4JK1 X;  2A6H F;  1SMY F;  3Q5F A;  6PAX A;  3K2Z A;  2DK8 A;  1XMX A;  2FJ1 A;  4O6J A;  3DU5 A;  1KQ8 A;  2W48 A;  2HZT A;  2HQ5 A;  1I39 A;  3I55 I;  1OCO H;  2AO9 A;  2HFH A;  1U5T A;  1PJR A;  2KDO A;  1W7P A;  2XDV A;  1WFX A;  3GUD A;  2VPR A;  2AXT C;  3TW7 A;  5HS9 A;  2AS5 F;  1JJ8 C;  3ZQH A;  2DMU A;  2W84 A;  3QOD A;  2ZB9 A;  4UUV A;  2DDA A;  2NVQ J;  4JX5 A;  3DKX A;  2LKS A;  4BQO A;  5F1R A;  5HLT A;  2IGO A;  2XRN A;  4HV5 A;  1WJ5 A;  3JW4 A;  1LDJ A;  4A3G J;  3CDI A;  2DPU A;  1ZLJ A;  4OIO F;  1Z7U A;  5IT3 A;  2QSH X;  2F6C A;  4QPQ A;  2LFB A;  2L9V A;  5F04 A;  4RA2 A;  1I50 J;  2E34 A;  3KYC B;  4L5I A;  1FEX A;  3IKT A;  3TW6 A;  4MTE A;  3RKW A;  3GW2 A;  3SZP A;  4XRS G;  2DK5 A;  1OJL A;  4I01 A;  4RAY A;  3CMA I;  3BZ6 A;  3ZPL A;  2V1N A;  3F72 A;  1J0R A;  4EVI A;  2V9P A;  1JGS A;  1SD7 A;  2DMQ A;  4KT5 C;  3VYT B;  3B02 A;  1P4X A;  5IP9 J;  1AKH B;  2YPR A;  5E1Z B;  2DI3 A;  3CJR B;  3WG7 H;  3M4O J;  2Y0S N;  4HZF A;  1F43 A;  4CZZ A;  5CQE A;  1P4A A;  3K9T A;  1U3E M;  4JP0 A;  1REP C;  3WTW C;  5CLS A;  3VSK A;  2VPL A;  1SFO J;  5K5Q A;  5J4V A;  5H6Q A;  1X2M A;  2IAI A;  3VOD A;  1WJF A;  1HQC A;  4CYC A;  4HSR A;  3CUQ B;  1QZZ A;  3S93 A;  1W5S A;  3I4M J;  4ZYG A;  2AQF A;  3FXK A;  1WI3 A;  3WTV C;  1TT0 A;  1B8I B;  3T0Y A;  5F27 A;  1P2F A;  3HM5 A;  3PIO F;  2ELK A;  3WHC A;  1XG1 A;  5J4Y A;  1ZRC A;  2DFF A;  4P96 A;  2R5Z A;  4AIJ A;  3HG9 A;  2NAZ A;  3HSR A;  1T33 A;  1FY7 A;  3ZCO A;  4IRI A;  3IAS 2;  3CJN A;  1ZHF A;  4AM3 A;  2L9S A;  4J01 A;  2VUM J;  4FTH A;  2LY2 A;  3WTX C;  2KRH A;  4XR6 A;  4ENN A;  4WXD A;  1RKT A;  1VF9 A;  1KQ0 A;  3M07 A;  1QHH D;  2K86 A;  2BW3 A;  4F7Z A;  3PO3 J;  2E19 A;  3U2R A;  1R22 A;  2R3S A;  1MND A;  2DTR A;  1TWG J;  4B4C A;  2VJJ A;  1XSX A;  4UV8 A;  4IZZ A;  3HRM A;  2QKL B;  2NS0 A;  3I4P A;  1T6S A;  1ETK A;  2H8W A;  3LQR A;  2XF6 A;  2EJR A;  2AQE A;  3BDD A;  3J81 Z;  1JHF A;  1ZG1 A;  3E97 A;  1W4M A;  4LB5 A;  3KP6 A;  4LIV A;  1IRG A;  1E3P A;  2BY0 A;  3RQ4 A;  4BE2 A;  1GT0 C;  4O5V A;  1YIO A;  1WQ2 A;  2R7O A;  2XGD A;  4HPQ A;  1R71 A;  3Q0V A;  4NC6 A;  4P9U A;  4RM2 A;  4EGY A;  2DYR H;  4GRI A;  3D5S C;  4MFD A;  1G8X A;  2HTJ A;  4MHG A;  2L7M P;  2LR8 A;  1EH6 A;  1WSU A;  1A36 A;  3TO9 A;  5CVU A;  1ETO A;  4MFE A; 
#chains in the Genus database with same CATH homology
 4MEY F;  2NRA C;  1TW3 A;  1YQA A;  5ILV A;  5D8L B;  3I53 A;  5FD6 A;  3TKY A;  5IT9 K;  2EFQ A;  5CVJ A;  2JTV A;  2OQG A;  4WCG A;  2G7H A;  3HYI A;  3QOP A;  2HYF A;  2J5P A;  1IN8 A;  1U8R A;  5BS6 A;  4M6X A;  1RUN A;  4LK1 F;  4ZYH A;  3FM3 A;  1YS7 A;  4G94 A;  5DD8 A;  1K78 B;  1XDU A;  3TQN A;  1MJB A;  3E6B A;  3P7N A;  2DQR A;  1R23 A;  4UXN A;  2FBK A;  1ZGJ A;  2IW5 A;  3BY6 A;  1J7K A;  1Y0U A;  2RNJ A;  3O3K A;  4N9H A;  4JQF A;  3ERE D;  2PBI A;  1RUO A;  1XMK A;  5DCM A;  2OZU A;  2XAS A;  4BHB A;  1S8N A;  4HX8 A;  3WTS C;  5JHU A;  3TO6 A;  3N4M A;  2WTE A;  1MDM A;  3E5X A;  1YYV A;  4HDV A;  3KE2 A;  3LA2 A;  1K79 A;  4LLG F;  4R79 A;  5D4R A;  4A12 A;  3LST A;  2XIG A;  2FU4 A;  2GQQ A;  4IHS A;  4OIQ F;  4D0P A;  1FSH A;  4P9F A;  3HHG A;  4KMF A;  4AIH A;  3K69 A;  2D1V A;  3DXJ F;  3CUO A;  3HSE A;  4PZJ A;  1T38 A;  3ABU A;  1BN5 A;  2VT2 A;  4M71 A;  3ML6 A;  4EV0 A;  4WX9 A;  3FMQ A;  2CFX A;  2J5O A;  1ZYR F;  3QP5 A;  2BYV E;  2KKO A;  1P6R A;  3KZZ A;  4BNC A;  2MH2 A;  1R5G A;  4N0B A;  3P9C A;  5AON A;  3WGH A;  1IXS B;  1QQI A;  1G3Y A;  2W85 A;  2ZNY A;  2ZO4 A;  4YG2 F;  2H6B A;  3ZP5 A;  1AOY A;  1ULY A;  3FXR A;  2FA5 A;  2M8E A;  4HF0 A;  1B9M A;  3V7C A;  1D8K A;  5BOX A;  4IVN A;  2NYX A;  3P9K A;  2CO5 A;  5L3C A;  5E1W A;  5BMZ A;  4HLX A;  3J80 K;  1IF1 A;  2BE5 F;  2VC1 A;  1SFU A;  3FHZ A;  4AWX B;  1PP8 F;  3PQJ A;  3I59 B;  1U2W A;  4HQE A;  1BI0 A;  4YFN F;  3RPU A;  3C3W A;  3L7W A;  3LWF A;  3WOD F;  2GZW A;  3I5U A;  3KFW X;  2HEO A;  1KGS A;  4RGS A;  3ZN1 A;  3H3U A;  2QEN A;  3KP3 A;  2DLL A;  4HLY A;  3V8L A;  4AIK A;  3HHH A;  2C6Y A;  4U0Y A;  3DP7 A;  5DEQ A;  3PQK A;  3MAJ A;  2NNY A;  1XB4 A;  3GX4 X;  3JSO A;  2G7U A;  3CTA A;  2EK5 A;  3GYH X;  4YII A;  2VOP A;  4UV9 A;  2STW A;  1XCV A;  1TQI A;  2IA2 A;  3EYY A;  1UFM A;  2KIM A;  2HGC A;  1JE8 A;  5FFX A;  4Q4Z F;  2JPC A;  4RB0 A;  4CHU A;  1P4W A;  5CYV A;  1IAW A;  4YIF A;  1Z91 A;  2HQN A;  3TDU C;  1JHH A;  1ZG5 A;  2MA3 A;  2FXA A;  2V1X A;  2O61 A;  5DDG A;  4BYY A;  3U9G A;  4PGH A;  4GYI A;  2VOD A;  1FLI A;  2F5C A;  4IF4 A;  4RB2 C;  4UVB A;  4ZYD A;  2EFP A;  2VC0 A;  1OYI A;  2JPB A;  5J8F A;  4M6Y A;  3I54 A;  4RGU A;  2EV6 A;  2KIF A;  4KFC A;  1I1S A;  4RGR A;  4M9X A;  4EGZ A;  4U0W A;  2FEZ A;  4CO8 A;  3T1B A;  1B6A A;  5ICF A;  4KIF A;  1T98 A;  2UXN A;  1XSV A;  1T0F A;  5K1Y A;  3FMS A;  1EH7 A;  2VN2 A;  2HQR A;  4G6D A;  5A2Q Z;  5FLX K;  2PQ8 A;  3CO7 C;  2ZBK A;  1ON1 A;  3MZY A;  5D6F A;  3F22 A;  1GHC A;  4U0V A;  3B73 A;  5E8I A;  4HQM A;  1HSJ A;  2PLY A;  2M87 A;  2TDX A;  3RKY A;  2F5D A;  2QZ8 A;  2V6C A;  3DPL C;  1KA8 A;  1IN4 A;  1R7J A;  4OIP F;  2EV5 A;  4R1H A;  3JTH A;  1WKM A;  3KEQ A;  2L01 A;  1HBX G;  3SZT A;  1FX7 A;  4G7Z F;  2A6E F;  5ILS A;  4U7D A;  4LFU A;  1WI9 A;  3F8F A;  1B4A A;  3H3Z A;  3FZV A;  1YO5 C;  3IC7 A;  2Y0M A;  4YFK F;  1XSD A;  4GGG A;  4ZYE A;  4MGR A;  3RJP A;  4XBF A;  3F8M A;  5K5R A;  4A6D A;  4FHT A;  3F6V A;  4KN7 X;  4M9S A;  3VEP A;  1OR7 A;  3BJO A;  4Q48 A;  2XVC A;  1PDN C;  2P6T A;  2RKH A;  3GFL A;  2Z33 A;  3FXQ A;  5D4S A;  1L0O C;  4KIB A;  4WWC A;  1I1G A;  3DV8 A;  4S05 A;  4L9V A;  1G3T A;  3HOS A;  2PN6 A;  2RQP A;  4IRH A;  5H20 A;  3RYP A;  2P5L C;  2QBY B;  2H27 A;  3WU1 B;  3VFZ A;  4HF2 A;  1T2K A;  3MQ0 A;  1FPQ A;  3QP6 A;  4RB3 C;  2A68 F;  3FM5 A;  1BIB A;  2HYG D;  4XLP F;  3IL2 A;  3E6C C;  3HTS B;  1HKQ A;  2ZXJ A;  2VBZ A;  3E5Q A;  1U6G A;  1SFE A;  1GXP A;  4I02 A;  1DUX C;  1O3T A;  2ESN A;  1DPU A;  4IHT A;  4BH9 A;  4RGX A;  2Z3Y A;  5FD5 A;  2L4M A;  2WWY A;  5DUI A;  4RAZ A;  1HW1 A;  3RTR A;  4OIN F;  5F6F A;  4LMY A;  3GFM A;  1ZAO A;  1VTN C;  3L9F A;  1ZH5 A;  2H09 A;  3QAH A;  3T5X A;  1TQP A;  2P4W A;  4OIR F;  5E18 F;  2FMY A;  5HLI A;  2G9W A;  2OBP A;  4LLL A;  1SD5 A;  5LGT A;  1UCR A;  4M72 A;  3KP4 A;  1J59 A;  2E7W A;  3JTG A;  3EDP A;  4HX7 A;  1R00 A;  2CW0 F;  4XRF A;  4OMY A;  2D1H A;  3GFI A;  3OV8 A;  3ZMU A;  4ENJ A;  2VON A;  2COM A;  3SFZ A;  4BAY A;  1J5Y A;  1MKM A;  4Q47 A;  4ESB A;  4IJA A;  2KIU A;  3PFI A;  2EA2 A;  3TOA A;  2DBB A;  1UHM A;  1R58 A;  4ESF A;  3DQV C;  5IT9 Z;  3I64 A;  2CG4 A;  3HIF A;  1FZP B;  3KZY A;  5JR3 A;  4YFX F;  5D8K B;  1ZLK A;  1FBS A;  3WU0 A;  3J81 K;  4ZZL A;  1R1U A;  1DPR A;  5L3E A;  3E3V A;  4B09 A;  3CUQ A;  3RI4 A;  2R7F A;  3W6J B;  1PP7 U;  3LFK A;  4ON0 A;  2BEO A;  1H0M A;  2RDP A;  2FQ3 A;  3CLO A;  1R36 A;  1TTY A;  4Y15 A;  1BIA A;  2W57 A;  3MZH A;  3ZMV A;  4OU0 A;  1FBU A;  1J2X A;  1LEA A;  5L3F A;  1RI7 A;  2RV8 A;  1UB9 A;  2GA1 A;  4DQ2 A;  5D5X B;  4MNU A;  2OD5 A;  5HOO A;  3P9I A;  3V8J A;  5HVQ C;  2GXG A;  4I0A A;  2XAG A;  2LKP A;  3O6B B;  1QBJ A;  4L18 B;  1OYY A;  1SAX A;  3TGN A;  5H6R A;  2EB7 A;  4CIC A;  4LD5 A;  5EEG A;  3WGI A;  5DUK A;  3GO5 A;  2E7X A;  1B59 A;  5TRD A;  1ZN2 A;  3R60 A;  1V4R A;  2ACJ A;  2IRF G;  3C7J A;  2VBX A;  5LHG A;  2RN7 A;  2EV0 A;  4HF1 A;  2UXX A;  1LEB A;  1HKT A;  1XGM A;  2IA0 A;  1OPC A;  4WXC A;  3EET A;  5FFZ A;  3L2C A;  4LG0 B;  2A69 F;  4EM1 A;  1K78 A;  2EFO A;  4PDK A;  1UST A;  4NHJ A;  2RGV A;  3GXO A;  3JAM Z;  4NQW A;  5HS7 A;  2ZCW A;  3RDI A;  1IXC A;  1EH8 A;  2QM3 A;  1B9N A;  3Q9S A;  4I09 A;  3E5U A;  3ZN0 A;  2DFI A;  2BV6 A;  1J75 A;  2M30 A;  2XRO A;  3J80 Z;  2O0Y A;  4KA4 A;  2H94 A;  1ON2 A;  4G7H F;  2ADU A;  4EM0 B;  2A3S A;  3F8B A;  1IZ1 A;  4Z2Y A;  2BGC A;  1BI3 A;  5LGN A;  1TW2 A;  1SD6 A;  4Q5S F;  2QUF A;  5BPI A;  1K6O A;  2IVM A;  4ENM A;  3KET A;  3J7A O;  1HKS A;  1ZGA A;  4KMU X;  1D5V A;  4M9Z A;  5AIP A;  1O3Q A;  2QWW A;  1OKR A;  4OMZ A;  1S7A A;  4XSX F;  3F6O A;  3V7S A;  2A5Y B;  4L5J A;  4ASN A;  2P7C B;  4KYW A;  3TDZ C;  4A0Z A;  1PUE E;  2CQK A;  2HR3 A;  3BPV A;  5DV5 A;  1S3J A;  2UWM A;  2MC3 A;  2GAU A;  5ICC A;  2YX7 A;  2P8T A;  3BP8 A;  3WGG A;  1AWC A;  2K4J A;  2M45 A;  4RS8 A;  4EJV A;  3NRV A;  1IN6 A;  2EA4 A;  5FO5 A;  5K5O A;  5BQT A;  1QO0 D;  3NQO A;  1CF7 B;  5BPD A;  3F8C A;  3GZ6 A;  5HDN A;  1NHA A;  2STT A;  2ZME B;  5ED4 A;  3BJA A;  1UHW A;  3BPX A;  2E1C A;  3F23 A;  4H0E A;  4WXH A;  3GZ5 A;  1U5T C;  4HW0 A;  2VBY A;  5E8G A;  3HSF A;  4DNC A;  2HDC A;  1XGS A;  2A07 F;  3GVA A;  2GWR A;  3K1P A;  3CO6 C;  3I59 A;  1FNN A;  2QYO A;  2P7V B;  2DU9 A;  2HS5 A;  2IT0 A;  5E20 A;  2ZJ2 A;  3GLX A;  5ERI A;  1LB2 A;  2K7L A;  2OZ6 A;  2F5F A;  4U7B A;  4PGG A;  1YW9 A;  4MEX F;  4TV7 A;  2JSC A;  2KJC A;  4XSZ F;  3HRS A;  2ZFW A;  3IRR A;  5DD4 A;  2XUB A;  2MD5 A;  5J8C A;  1LDD A;  1T39 A;  4UVC A;  5KVR A;  4I98 B;  1TBX A;  3QPH A;  1W5T A;  4P55 A;  1A04 A;  1R1T A;  3T8T A;  1F9N A;  4WK8 F;  2A61 A;  1SMT A;  2JT1 A;  3DFG A;  1V3F A;  1KU3 A;  1IN5 A;  1XD7 A;  4N9I A;  3M8F A;  3TO7 A;  2ZKZ A;  1XGO A;  1Z1D A;  1XDS A;  1KQ9 A;  2W24 A;  3QU3 A;  4BXU A;  2WV0 A;  3M9A A;  1QZY A;  4G7O F;  1Q1H A;  4Y17 A;  5E1X A;  1HW2 A;  1IXR C;  2XAF A;  4UNO A;  1FOK A;  1DDN A;  4EMS A;  2UZK A;  2HKO A;  1U5T B;  1W7P B;  1MD0 A;  1ZAR A;  4KNY A;  2L54 A;  2XAJ A;  4HYE A;  4E70 A;  3V4G A;  4WF2 A;  2MLK A;  4LLN A;  3KCC A;  4EJU A;  1YFH A;  3IWF A;  2DT5 A;  3G3Z A;  2DO7 A;  2CWE A;  4O3M A;  1GVJ A;  2EFW A;  1C0W A;  4G8X A;  4HV6 A;  3AAF A;  3GF2 A;  2XAQ A;  1Z05 A;  3DPT A;  2V9V A;  5TJJ A;  2LNB A;  2D45 A;  2Z9O A;  1ZRD A;  2BBY A;  4GXO A;  5JI6 A;  2CGP A;  3CUQ C;  3LA3 A;  1IUY A;  3ABT A;  1TQM A;  3H92 A;  2VBW A;  3L00 A;  3JSP A;  4A0X A;  3FX3 A;  2DW4 A;  3E6D A;  3R0A A;  4IRG A;  2R7D A;  1R1V A;  2FE3 A;  2VT3 A;  5ILU A;  2QQB A;  2F2E A;  2XKP A;  2OAZ A;  4ETS A;  5LRR A;  2OU2 A;  2OQR A;  4ESJ A;  3HTU A;  3FMR A;  1QPM A;  3QRF F;  4GO1 A;  4EJW A;  3R6S A;  2RVC A;  1S6L A;  3IHU A;  2HTS A;  1LQ1 A;  3KLN A;  5HLH A;  4EQQ A;  2XAH A;  3BJ6 A;  4HA8 A;  1ZRE A;  4ZZD A;  1TLH B;  2Y75 A;  3LA7 A;  3K1N A;  2YU3 A;  3O2P E;  1HXD A;  1EV7 A;  2PG4 A;  4G9Y A;  2VE8 A;  5LGU A;  2QLZ A;  2DPD A;  3ZMD A;  2PEX A;  1F4K A;  4QWQ A;  1FBQ A;  2XKO A;  2YX4 A;  2O03 A;  1STZ A;  3HOT A;  1I5Z A;  3BWG A;  4PCQ A;  5L3B A;  2FNP A;  4XLN F;  2HOE A;  3IWZ A;  2V1D A;  3ECO A;  2QQ9 A;  3M1E A;  4LB6 B;  1D3Y A;  3RIR A;  3I58 A;  2WC2 A;  2LF7 A;  2FRH A;  4S04 A;  4MQV A;  3FXU A;  2GA2 A;  4KIC A;  2QBY A;  2FSW A;  5D5U B;  5DCF A;  4ENK A;  2PMH A;  1BJA A;  1LDK B;  2V1U A;  4EJT A;  2ISZ A;  4I7H A;  2IJL A;  1YS6 A;  2RC4 A;  1G6N A;  5FGM A;  4BQA A;  5DCM B;  3WG9 A;  5CVR A;  1E2X A;  1SD4 A;  2EWN A;  3ELK A;  3C18 A;  3D0S A;  4L9N A;  3S2W A;  1BI2 A;  1J9I A;  2XGX A;  2MLG A;  3WE2 A;  1MDM B;  3E6M A;  2L4A A;  2HWV A;  2O6G E;  1G3W A;  3DF8 A;  2CSO A;  1IW7 F;  3CDH A;  4M74 A;  4CYD A;  4AD9 A;  1H9G A;  2MH9 A;  2PJP A;  5LBQ A;  4L9J A;  4I0B A;  3BRO A;  3KLO A;  3EQL F;  2O3F A;  1O3S A;  3DKW A;  3WTY C;  5J6X A;  4AVP A;  1DP7 P;  3ISP A;  4L9T A;  3RKX A;  2KJB A;  3KP2 A;  4EM2 A;  2Q8K A;  1F5T A;  5EEH A;  4KN4 X;  3GWZ A;  1I6X A;  1E17 A;  5F64 A;  4K2E A;  2LSO A;  5LEJ A;  1KYZ A;  4CGZ A;  1FT9 A;  3M7G A;  1QNT A;  4MTD A;  4ZH4 F;  3F21 A;  4BHP A;  2OA4 A;  3IRQ A;  1SFX A;  3MWM A;  1S7O A;  2ESH A;  2IP2 A;  4FX4 A;  1KYW A;  4L0Z B;  2DAO A;  2IPQ X;  1H9T A;  1YW7 A;  1YLF A;  5D5W B;  2FBI A;  2CYY A;  5D6E A;  2H6C A;  5CJ9 A;  2M1B A;  3WTU C;  1O3R A;  3SHF A;  3GFJ A;  1MGT A;  4A6E A;  1FYL A;  2PFB A;  2JZY A;  2XV4 S;  5LLQ A;  1O57 A;  1IRF A;  5HDK A;  2VOO A;  2E1N A;  3U1D A;  5D5V B;  3FF5 A;  1G3S A;  3C1D A;  2Y48 A;  4EJO A;  2ETH A;  2ISY A;  4A2U A;  1HST A;  2YSR A;  3OOP A;  2Z99 A;  3QPT A;  5E17 F;  1S29 A;  3LAP A;  4A0Y A;  3EUH A;  3ECH A;  4L0Y B;  3VOE A;  4IPA A;  1FSE A;  1MJA A;  3I0T A;  3REO A;  3ZMT A;  3GEZ A;  3MEX A;  3JAM K;  3NEU A;  2P5V A;  2B0L A;  3F8N A;  2VXZ A;  1Z6R A;  2X0L A;  2ZNZ A;  1BC7 C;  4CDG A;  1ONV A;  1BOA A;  5HDG A;  3RYR A;  1G4D A;  5LHH A;  3LQQ A;  3MFK A;  4G6Q A;  4HAM A;  1XN7 A;  3IKV A;  2Q0O A;  2GXB A;  4A5M A;  1B1B A;  3RPQ A;  3KEO A;  2GIV A;  3DEU A;  5L3G A;  1LVA A;  5L3D A;  2HKX A;  2JRT A;  4LG0 A;  3ZQ7 A;  1RZ4 A;  3HRT A;  3MCZ A;  4IXA A;  2DQL A;  1HW5 A;  4NB5 A;  1KU7 A;  1WRJ A;  1GXQ A;  1YG2 A;  1R5H A;  5CVI A;  1XMA A;  2NNN A;  3R61 A;  2FBH A;  4GCV A;  1YTY A;  4FT8 A;  4KDP A;  1TNT A;  5HLG A;  5KK1 A;  1D8J A;  4CXF A;  5AIQ A;  3KP7 A;  3FWE A;  3F3X A;  1WWX A;  4I2O A;  1JXS A;  5ICG A;  3HRU A;  3ZMS A;  4HX4 A;  3G73 A;  1L3L A;  1BC8 C;  1LNW A;  1XGN A;  1O7L A;  4HDU A;  4GYG A;  3ULQ B;  2L02 A;  1BBY A;  2P5K A;  2Z5U A;  1K7A A;  1O7F A;  1X3U A;  3L09 A;  2QVO A;  4B8X A;  2O8X A;  2QQA A;  3I71 A;  4MQ9 F;  3ROU A;  4HBL A;  5JVT A;  2D2W A;  4M73 A;  1KU2 A;  1W7P D;  4JBA A;  2PI0 A;  1QGP A;  2FOK A;  2EFN A;  2L3D A;  3K1M A;  5FLX Z;  4P5O A;  1Z9C A;  2M5W A;  1ZG3 A;  1ODD A;  1FYK A;  2ELH A;  1OYW A;  2F5E A;  5LHI A;  2AXL A;  2YR2 A;  1CF7 A;  2P6S A;  3M8E A;  4LK0 F;  4LGW A;  3N97 A;  3QU6 A;  2V79 A;  2ZME A;  3HUG A;  1LJ9 A;  4HOB A;  1IN7 A;  4RB1 A;  1I27 A;  1KU9 A;  3LAJ A;  4OOI A;  2VE9 A;  1CGP A;  4U88 A;  3WTZ A;  3R0J A;  1ZRF A;  1FYM A;  2PMU A;  3ZMZ A;  5ICE A;  2KRF A;  1XCB A;  1BM9 A;  5A2Q K;  3D5L A;  5FB2 A;  2XHK A;  2FNA A;  2X4H A;  4A5N A;  4UVA A;  3SQN A;  4LJZ F;  3KP5 A;  2K27 A;  3SXY A;  3V8K A;  1FC3 A;  1FP2 A;  2FML A;  3WTT C;  3COA C;  1MZB A;  1BI1 A;  2LF8 A;  2Q2E A;  1USS A;  2IA1 A;  4QLC U;  2MBF A;  2K02 A;  3TOB A;  3Q9V A;  1FWZ A;  5HS8 A;  3VB2 A;  5LEK A;  3K0L A;  3W6K B;  5DYM A;  1RNL A;  4FX0 A;  2FF4 A;  4KIG A;  1Z6T A;  2LDU A;  4UHT A;  4R8H A;  1RIO H;  3EYI A;  1YW8 A;  1U78 A;  3T8R A;  1OMI A;  4Y13 A;  1P92 A;  3R4K A;  1F1Z A;  2W25 A;  5CVV A;  3WE3 A;  5LRS A;  1TNS A;  4BHC A;  3V7R A;  5JFR A;  2K4B A;  1FP1 D;  3BOQ A;  1MJ9 A;  4KUM A;  4JK1 X;  2A6H F;  1SMY F;  3Q5F A;  6PAX A;  3K2Z A;  2DK8 A;  4O6J A;  1KQ8 A;  2HZT A;  2HFH A;  1U5T A;  1W7P A;  3GUD A;  5HS9 A;  2AS5 F;  2W84 A;  4UUV A;  5F1R A;  2XRN A;  4HV5 A;  3JW4 A;  1LDJ A;  2DPU A;  1ZLJ A;  4OIO F;  1Z7U A;  5IT3 A;  4L5I A;  3IKT A;  4MTE A;  3RKW A;  3GW2 A;  3SZP A;  2DK5 A;  4I01 A;  4RAY A;  3BZ6 A;  3ZPL A;  3F72 A;  1J0R A;  4EVI A;  1JGS A;  1SD7 A;  4KT5 C;  3B02 A;  1P4X A;  2YPR A;  5E1Z B;  2DI3 A;  4HZF A;  4CZZ A;  1P4A A;  3K9T A;  1U3E M;  1REP C;  3WTW C;  5CLS A;  5K5Q A;  5H6Q A;  3VOD A;  1HQC A;  3CUQ B;  1QZZ A;  1W5S A;  4ZYG A;  3WTV C;  3T0Y A;  1P2F A;  1ZRC A;  4P96 A;  4AIJ A;  2NAZ A;  3HSR A;  1FY7 A;  4IRI A;  3CJN A;  1ZHF A;  3WTX C;  4ENN A;  4WXD A;  1KQ0 A;  2K86 A;  4F7Z A;  3U2R A;  1R22 A;  2R3S A;  2DTR A;  1XSX A;  4UV8 A;  3HRM A;  2NS0 A;  3I4P A;  1T6S A;  3LQR A;  2EJR A;  3J81 Z;  3BDD A;  1JHF A;  1ZG1 A;  3E97 A;  1W4M A;  4LB5 A;  3KP6 A;  1IRG A;  4O5V A;  1YIO A;  1WQ2 A;  4P9U A;  4EGY A;  2HTJ A;  4MHG A;  1EH6 A;  1WSU A;  3TO9 A;  5CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...