3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
2DW4A 3LWFA 3GFIA 2GA1A 4MTDA 4R1HA 1XB4A 1K6OA 3J81Z 2KIUA 3FF5A 2PJPA 4UHTA 3I64A 5E1WA 4G7ZF 3F8NA 1ZH5A 4DNCA 2VXZA 3JSOA 3ZMVA 2KJCA 3CUQA 2MC3A 4ENKA 2GIVA 3EQLF 4BNCA 4AVPA 2Z99A 3HHGA 2K27A 2TDXA 3JSPA 1MJBA 3TGNA 4UV9A 4HBLA 3FXUA 4OIRF 5L3FA 4L9NA 2EFOA 1R5HA 4LGWA 2XKPA 2QM3A 1TLHB 1JHHA 4A6EA 1B9MA 2L4MA 2O8XA 4L0ZB 1Q1HA 4KIBA 1HQCA 3EETA 3IWZA 2GWRA 3BROA 2HS5A 1HSJA 4NHJA 3BJOA 3R61A 3C3WA 3H3UA 5H6RA 2UZKA 2YR2A 3PQJA 3LFKA 2K7LA 1WI9A 4L5JA 2HTSA 1SFXA 3JTHA 4I01A 4M6YA 3NEUA 1T2KA 1D3YA 5CLSA 4ZZDA 4YIFA 1WRJA 4LMYA 3WU0A 1Z6RA 1U5TC 2GA2A 1ONVA 4CXFA 2H6BA 4XLNF 4NQWA 4UVCA 1IRGA 1ODDA 4OU0A 2IP2A 5AIPA 3RPQA 3I53A 2F5DA 5LRRA 1BI1A 1S6LA 3GFJA 1K78A 3P7NA 2G9WA 1IXSB 2KJBA 4GXOA 3CTAA 4A0ZA 4KDPA 3MFKA 2EFWA 3NQOA 2FF4A 1YLFA 5FLXZ 5LBQA 4YFXF 5J6XA 4BHCA 5E18F 1Z91A 2Q2EA 3O3KA 2FMYA 1TTYA 1W7PA 4KN7X 2XROA 3KP2A 2VBZA 2OAZA 4CHUA 1ZGAA 4WK8F 1I6XA 3R4KA 4M9ZA 4ENNA 1EH6A 3KZZA 2VN2A 4PCQA 5FB2A 5CVUA 3ZMSA 2J5PA 3COAC 1QQIA 1RNLA 2ZNYA 1IZ1A 3OOPA 4ZYGA 2BBYA 5DD4A 2VOOA 4IVNA 2H6CA 3V7RA 4UUVA 3TOBA 2DPDA 4XSZF 2E7WA 3E6CC 4QWQA 3ZMDA 2ZKZA 2OA4A 3EYIA 4U7DA 2EB7A 1LDKB 5L3EA 1E2XA 3RPUA 1ZARA 3V8KA 1QZZA 1PDNC 1PP7U 2HOEA 3QOPA 1WSUA 4OMZA 1RZ4A 3ZPLA 5ICGA 1MGTA 1FT9A 3KP4A 4LB5A 1HW5A 2ADUA 5K5QA 1Z1DA 2FQ3A 1ZYRF 5ILSA 3BY6A 4FHTA 2QYOA 3K2ZA 2XKOA 1XCVA 2HZTA 2XHKA 3I5UA 5DCMA 1I1GA 1R22A 1TW2A 4MEXF 3PQKA 3F8MA 4IRIA 3M8FA 1XSVA 3IKVA 2RNJA 3RJPA 4M71A 1R5GA 2RGVA 5AIQA 1BIAA 1ZLKA 4PDKA 3WTWC 3MWMA 3V7CA 1O3TA 1R58A 4ESBA 2IT0A 2G7UA 5DEQA 5ERIA 3WE2A 2K02A 4AIHA 2JPCA 3N4MA 3M9AA 4D0PA 1BI3A 3J80K 1F1ZA 3ZQ7A 4TV7A 1SFEA 2LKPA 5H20A 1V4RA 5FLXK 1YTYA 4ZYDA 4IHSA 4KYWA 3P9IA 2XV4S 1MJAA 2Q8KA 4H0EA 4PGHA 2E1CA 1LDDA 2QQBA 3JAMK 3HOSA 4GYIA 2ZMEA 1OR7A 2W85A 1YQAA 2M45A 2R7DA 3KLOA 3NRVA 1KA8A 1KU9A 2UXNA 1YIOA 3ABUA 2DBBA 4ON0A 2HR3A 1G3WA 2ZCWA 3WTZA 3U1DA 5IT9Z 3N97A 2P5LC 1B9NA 2HDCA 2JTVA 5JHUA 5DCFA 3ROUA 5E20A 2QUFA 5E1ZB 5HLHA 4Q4ZF 5F1RA 3WODF 4EM0B 4BAYA 2PLYA 5D5WB 2DAOA 2NS0A 4LLGF 2PFBA 1X3UA 3E5QA 3GFLA 3C7JA 4KICA 2JZYA 2VE8A 2DK5A 1SMTA 2YX4A 1BC8C 4WWCA 4HDUA 1KYWA 3SZTA 2GXGA 5CVJA 2F2EA 3SFZA 3WTSC 2V1DA 3QP6A 2IW5A 2HFHA 3IHUA 2DU9A 1IF1A 3CLOA 4KMFA 3ZMZA 1P92A 4IJAA 1T38A 4JBAA 1B1BA 1YW7A 2OZ6A 4M9SA 3D5LA 4MEYF 1YS7A 3ABTA 2P6SA 2FMLA 3OV8A 2V9VA 4RGRA 4Y15A 5KK1A 5IT3A 3SQNA 1XSDA 2FBIA 4HOBA 4KA4A 1DPRA 5BPDA 3G73A 3VOEA 4RB3C 2H09A 2JSCA 1U8RA 1P4WA 1OPCA 1ZLJA 4O5VA 2IRFG 3GZ5A 4GO1A 2XGXA 3FZVA 4LJZF 3QAHA 2PQ8A 2QWWA 3P9CA 1H9TA 4LK1F 4XRFA 1U5TA 2L3DA 1RUNA 3R0JA 4I02A 3F21A 2A61A 3FMQA 3DP7A 5FD6A 2CQKA 2XAFA 1R36A 4LFUA 1B6AA 2IA2A 4Z2YA 4HX7A 1T39A 1FX7A 2PN6A 4ZYEA 1VTNC 4HLYA 3KE2A 2VOPA 2OBPA 4U0VA 2M5WA 5ILVA 4G6QA 3F8FA 3FWEA 4EM2A 2FBHA 2OQGA 4EJWA 5HLIA 2P4WA 1ZREA 1BM9A 3WE3A 3DEUA 5FO5A 3ZN0A 4MQVA 1FBSA 1K79A 1ON2A 2BE5F 4FX4A 1RIOH 1JE8A 1RUOA 4M74A 3GFMA 2EA4A 4OMYA 2P5VA 2K4JA 2KRFA 4PGGA 3FHZA 2QVOA 2D45A 4EJOA 4A0XA 1U3EM 4BXUA 4ESJA 2Y75A 2O3FA 1XGSA 4L5IA 1MJ9A 3KETA 3I54A 5EEGA 3VEPA 4WXDA 2FU4A 1ZN2A 2FA5A 3ML6A 5K5OA 4OIQF 1P4AA 1BBYA 2OZUA 2ZO4A 2YX7A 4LK0F 1CF7A 5BPIA 3L7WA 1BN5A 1HKSA 3MCZA 4N0BA 3GF2A 1XDSA 1HXDA 5AONA 2YSRA 5HLGA 3QU3A 3E6BA 5E8GA 1KU2A 2WTEA 3J81K 3V4GA 3KCCA 4G9YA 1ZRCA 1B59A 5LGUA 1SMYF 4EVIA 1WKMA 2ESNA 4HLXA 3HRMA 1XN7A 3DPLC 3MEXA 4E70A 1R00A 2QZ8A 4OOIA 1GXQA 4JQFA 2NNYA 2DFIA 3M1EA 5BQTA 4ETSA 5D5UB 5K1YA 4RAYA 5DYMA 3MQ0A 2CSOA 4P5OA 1TW3A 2MD5A 1XSXA 2H27A 1XMAA 4XBFA 4MHGA 1AOYA 3KEOA 1FWZA 1KU7A 2EV6A 3ULQB 1FNNA 4HQMA 4G7OF 2A5YB 2L02A 3DFGA 2PG4A 1J2XA 5TJJA 5ED4A 2C6YA 1V3FA 3KP7A 3F3XA 2LF7A 4IRHA 5A2QK 5BMZA 1FP2A 4GYGA 3ZP5A 1SD6A 3QPTA 2MH9A 2PMUA 4S04A 3CUQB 5D6FA 4ZZLA 3IKTA 2V79A 4I98B 3V8LA 3P9KA 6PAXA 3VODA 5E1XA 2Y0MA 2JT1A 4L9JA 4UNOA 1BOAA 1TQIA 3DQVC 2VT3A 3HSFA 4KFCA 3FMRA 5LHIA 5LHGA 1IN6A 2CFXA 3MAJA 3E6DA 2V1UA 4KIFA 3F8BA 3W6KB 1BIBA 4ZYHA 2HYFA 3JTGA 4P55A 2E1NA 3HSRA 2A6EF 4I09A 1KGSA 2PMHA 3E5UA 3BPXA 1EH7A 3GEZA 4OIOF 1RI7A 3KP3A 1IXCA 4P9UA 4ZH4F 4MQ9F 5ILUA 3MZHA 3BDDA 1KQ0A 4M73A 1OYWA 1QGPA 2LSOA 4BQAA 3KP6A 4EM1A 3REOA 5ICEA 3CJNA 5D5VB 3HSEA 2PBIA 2VBWA 3T8RA 5DUKA 1UHWA 1REPC 3QRFF 2GZWA 4IPAA 1K78B 2FOKA 2HQRA 2STTA 2O03A 1BI2A 5JI6A 1O3QA 4L9VA 1U2WA 2FE3A 3HTSB 3GW2A 2EWNA 2HQNA 1LVAA 4U0YA 4HV6A 3EYYA 5DDGA 2IA0A 3SHFA 2Y48A 5HDKA 3K1MA 2FRHA 2A69F 3M8EA 2BGCA 2ETHA 3H92A 3O2PE 2ZFWA 4LD5A 1J5YA 5HDNA 3WGIA 4B8XA 3J7AO 3ECOA 4HF0A 3ISPA 3RYRA 1TNTA 2IPQX 4HF2A 3FXRA 5L3CA 1LJ9A 3E97A 3BOQA 3RYPA 1G3SA 1ZG3A 2VC0A 4A6DA 2COMA 3RDIA 4LLLA 5FGMA 5D8LB 1EH8A 1IXRC 5HVQC 2L4AA 4IRGA 5BOXA 1B4AA 3K1NA 1YW9A 1ZGJA 2VONA 3ELKA 2HGCA 2XAQA 3LA2A 1IN8A 4KNYA 1PUEE 5LGNA 1WWXA 3E3VA 3WGGA 1HSTA 5HS7A 3L09A 5LEKA 1IN5A 2X0LA 1ZG5A 1Z7UA 2W57A 1C0WA 2GXBA 5LRSA 5F6FA 3E6MA 1PP8F 1XGNA 1USSA 3MZYA 3QPHA 5TRDA 3WTTC 2STWA 1J75A 4LG0A 1J7KA 2CGPA 2V6CA 5FD5A 4KUMA 3E5XA 3ZMUA 2MA3A 2GQQA 1XD7A 2A3SA 2F5CA 2FBKA 1SAXA 1W7PD 1XCBA 2DK8A 2EV5A 1GHCA 5CVVA 1TBXA 1I27A 3M7GA 2HWVA 2O61A 4OINF 3GWZA 1NHAA 3R60A 2ELHA 4GGGA 4O3MA 2QENA 1QBJA 2XRNA 1LNWA 5BS6A 5JR3A 4M72A 2XUBA 2QQAA 4WXHA 1JHFA 4A5MA 2LF8A 2NAZA 3BZ6A 3HHHA 5HS9A 2XVCA 1D8KA 2BYVE 3L9FA 3HUGA 1MZBA 2E7XA 3GO5A 2RN7A 2MLGA 3H3ZA 4WF2A 1JXSA 1P4XA 4CO8A 3CUQC 1ZRDA 2QBYA 1YYVA 4MNUA 3TO6A 4ENJA 2P5KA 2EA2A 2OU2A 2AXLA 3EDPA 1O3RA 1IN4A 3R6SA 2V1XA 2IJLA 3L2CA 1MDMB 4HW0A 3GZ6A 4N9HA 3ZN1A 2UXXA 1J59A 2ISZA 1H9GA 3U9GA 5KVRA 2A6HF 4IHTA 3DF8A 1G6NA 4YFNF 2EFNA 3FM3A 5LHHA 3WTUC 2Z3YA 1KQ9A 3CO7C 5CYVA 4RS8A 3G3ZA 2XASA 3CO6C 3I4PA 2CG4A 1G3TA 3F6OA 2LNBA 3WG9A 5JFRA 2QQ9A 1IRFA 3I59B 4L9TA 2HKXA 2JRTA 1QNTA 1SD7A 2P6TA 5CVIA 4AD9A 4BYYA 1FOKA 4WXCA 1W7PB 1LB2A 1Y0UA 5JVTA 2QLZA 2DPUA 1IN7A 4RB2C 3C18A 2OD5A 4UV8A 2W84A 4EJTA 1Z6TA 2BV6A 2QBYB 5D6EA 3BP8A 4G94A 2Q0OA 3U2RA 4KT5C 2ZNZA 4ENMA 3FX3A 4HYEA 4R79A 1CF7B 1XGOA 1QPMA 3RKXA 5HDGA 3LA3A 1A04A 3F22A 4R8HA 1T98A 1FSHA 2GAUA 4HQEA 3Q9VA 1O7LA 4NB5A 2NRAC 5EEHA 1FSEA 1FYKA 2HKOA 1OYIA 1FYMA 4UXNA 1JGSA 2L54A 3WTYC 5L3DA 5LGTA 1QZYA 1TNSA 3VB2A 3L00A 1R1TA 1G3YA 3KP5A 3HYIA 2M30A 1L0OC 2XIGA 4YIIA 5DCMB 3J80Z 1P2FA 4UVBA 1O57A 4LG0B 1KQ8A 1QO0D 1HW2A 3ZMTA 4WX9A 1ZRFA 4CDGA 1FZPB 4HF1A 1EV7A 4AIKA 1R1UA 2PEXA 4O6JA 4DQ2A 2RDPA 3TKYA 4BHPA 1T6SA 3TO9A 5F64A 4LB6B 3EUHA 3F72A 1FBUA 4JK1X 3WGHA 5A2QZ 4S05A 2WWYA 2D1VA 3DV8A 3HIFA 1IUYA 2FSWA 1HBXG 4F7ZA 3C1DA 5D8KB 3HRUA 2O0YA 3RKYA 4EV0A 4EMSA 1J9IA 1S7OA 2XAHA 4A2UA 4HZFA 1U5TB 2FEZA 1GVJA 3RTRA 1YG2A 1HKQA 2M87A 4AIJA 5L3BA 1D8JA 4EQQA 1K7AA 3QP5A 4RB0A 5E8IA 2EJRA 2XAGA 3LA7A 1YO5C 3BPVA 2HEOA 1I5ZA 2DLLA 2K86A 3DXJF 3K9TA 4CICA 3I58A 2CWEA 2EK5A 3W6JB 3T1BA 2VE9A 3F23A 3HRTA 2EV0A 3IRRA 3LAJA 4ASNA 2W24A 4Q47A 4WCGA 1FLIA 2FNPA 3KEQA 2RKHA 1ZHFA 4ESFA 5J8FA 2DT5A 3TDZC 3WU1B 1S29A 3ERED 2DO7A 5FFXA 2L01A 2UWMA 4U7BA 3LAPA 3V8JA 1W5SA 4K2EA 2M1BA 3T0YA 2OQRA 3R0AA 1FYLA 3DPTA 5DD8A 3WTXC 2ESHA 1O3SA 5D4RA 2ZJ2A 5K5RA 1BJAA 3KLNA 1FPQA 1R7JA 2CW0F 2X4HA 2XAJA 1FBQA 5H6QA 4FX0A 4Y17A 2CYYA 2R7FA 3FMSA 4Q48A 1HKTA 1H0MA 4M6XA 3Q5FA 3I0TA 4RAZA 4HAMA 3S2WA 2MBFA 3GX4X 4UVAA 2Z9OA 2B0LA 2FXAA 4A0YA 5E17F 2AS5F 1Z05A 3GVAA 2RC4A 1GXPA 1F9NA 3K1PA 2EFQA 1L3LA 2FNAA 2HTJA 4CYDA 1LQ1A 2CO5A 1O7FA 3HRSA 2F5FA 4L18B 4LLNA 2ZMEB 4CGZA 3QU6A 2VODA 1G4DA 1LEBA 4RGXA 3IRQA 3BJAA 1I1SA 1TQPA 3I71A 4YG2F 1FP1D 2IA1A 4I7HA 1SD4A 3CDHA 4AWXB 4RB1A 4RGUA 4U88A 3K0LA 5DV5A 3GLXA 2VC1A 3JAMZ 1ULYA 1U6GA 1WQ2A 4BHBA 1UFMA 1XDUA 2R3SA 3TO7A 2BEOA 2MLKA 4RGSA 1DDNA 3B73A 3B02A 2LDUA 5J8CA 3SZPA 4B09A 1R23A 3PFIA 5DUIA 4YFKF 3IL2A 1F4KA 5FFZA 2P7CB 4MTEA 2WC2A 5LEJA 4HX4A 4Q5SF 1AWCA 1SFUA 4EJUA 4XLPF 1YFHA 3RKWA 3SXYA 4CZZA 4OIPF 3JW4A 1W5TA 4GCVA 2D1HA 1BC7C 4KN4X 4MGRA 1DP7P 1S7AA 2ISYA 2K4BA 3K69A 4A5NA 4BH9A 3RIRA 1P6RA 4L0YB 3BJ6A 3HOTA 4HV5A 1STZA 1J0RA 1Z9CA 3FXQA 1S8NA 1OKRA 2W25A 4I0AA 1IAWA 2DI3A 2Z5UA 1FY7A 4EJVA 2IVMA 1R1VA 1OMIA 1ON1A 3GYHX 3CUOA 3O6BB 5CVRA 2YPRA 1USTA 1ZG1A 2WV0A 3T5XA 1XGMA 3D0SA 1XMKA 1LEAA 5CJ9A 1CGPA 3KZYA 3ECHA 1KYZA 4HDVA 3VFZA 3I59A 3RI4A 1TQMA 4KIGA 3TOAA 2F5EA 4P9FA 4G8XA 2EFPA 1IW7F 1KU3A 4A12A 2O6GE 4I0BA 4G7HF 1W4MA 2VBYA 3WTVC 2MH2A 5HS8A 1YS6A 2VBXA 3FM5A 5HOOA 2YU3A 4N9IA 1ZAOA 1MDMA 2M8EA 2A68F 5L3GA 1D5VA 2Z33A 1SD5A 3GXOA 4Y13A 2NYXA 3LQQA 1FC3A 1MKMA 4XSXF 4IXAA 2JPBA 1OYYA 3IC7A 3BWGA 1S3JA 2DQRA 3KFWX 2ZXJA 1MD0A 4HX8A 2PI0A 4P96A 1UB9A 4FT8A 1E17A 1HW1A 3T8TA 2RQPA 3Q9SA 4M9XA 3GUDA 2DQLA 1T0FA 3IWFA 4I2OA 4IF4A 4QLCU 5ICFA 5IT9K 2NNNA 2P8TA 4KMUX 2HYGD 2H94A 1UHMA 2VT2A 2ACJA 3AAFA 2KIMA 1UCRA 2A07F 1DUXC 5D4SA 2KKOA 1BI0A 3F8CA 3DKWA 1DPUA 1F5TA 2KIFA 4U0WA 1YW8A 3F6VA 2D2WA 4PZJA 5ICCA 3TQNA 3V7SA 4HA8A 2G7HA 2RVCA 2P7VB 3HTUA 4EGZA 2RV8A 5D5XB 3LQRA 5LLQA 1U78A 2J5OA 4G6DA 4EGYA 2ZBKA 2DTRA 3LSTA 1LDJA 3TDUC
chains in the Genus database with same CATH superfamily
2BHYA 2VJJA 2DW4A 3LWFA 3GFIA 2GA1A 4MTDA 4R1HA 4ABZA 1XB4A 2VXDA 3BG9A 1K6OA 3J81Z 2DJIA 3HOWJ 2KIUA 3FF5A 2COBA 2PJPA 5J3LA 2NVTJ 2WAQA 4UHTA 3I64A 5E1WA 1P7JA 1X3WB 4G7ZF 2NOJB 4IQ4A 3F8NA 1K6YA 1OCRH 5B66C 1ZH5A 4DNCA 2VXZA 2L9SA 3PSIA 4XLHA 2QSHX 2CQQA 3JSOA 3ZMVA 2KJCA 3CUQA 2MC3A 1VQ9I 1Z3YA 3TP3A 4ENKA 2GIVA 1RC9A 2MABA 3EQLF 4BNCA 3SYTA 4AVPA 2IGOA 2ME0A 2OUMA 2Z99A 3HHGA 5C4XJ 2K27A 2OTLI 5B1BH 2TDXA 2E2IJ 3JSPA 3MKYB 1MMDA 1MJBA 3PFYA 4OAZA 4UV9A 4HBLA 3FXUA 3TGNA 4F52A 2HPMA 4OIRF 5L3FA 4L9NA 2EFOA 2VB6A 1R5HA 3WU2C 2QEXI 3CESA 1HLVA 4LGWA 2XKPA 2QM3A 3S1QJ 3HOXJ 1TLHB 1LE8B 4NBQA 4IHWA 1VQ8I 1UG2A 1JHHA 4A6EA 3BTJA 1QVTA 1B9MA 1Z77A 2L4MA 3SJMA 2O8XA 4JX6A 2LBFA 2L5QA 1Y1WJ 4L0ZB 1Q1HA 4KIBA 1HQCA 3EETA 3IWZA 2GWRA 3BROA 5KAFC 2HS5A 3FXMA 1HSJA 4NHJA 5BNGA 3BJOA 3R61A 1LUJB 2DA5A 1BL0A 3LSJA 2DOEA 2HDDA 1FEXA 3S93A 2E35A 1JI8A 4BL0B 3C3WA 3H3UA 5H6RA 2NVUB 1UG0A 4PUSA 2UZKA 1U9OA 1FOWA 4I6ZA 2YR2A 3PQJA 3LFKA 2K7LA 1NG6A 4LOCA 1WI9A 1WFXA 4L5JA 1SVOA 2HTSA 2WY7Q 3WHBA 3EUAA 1SFXA 2LYCA 4E7HA 1A5JA 3JTHA 5IP6A 3HDDA 1QPIA 3Q0VA 4I01A 4M6YA 3NEUA 1T2KA 4XLEA 5J1RA 2ME6A 1D3YA 5CLSA 4MO7A 4CYCB 4ZZDA 3BG5A 1WRJA 4LMYA 4YIFA 3WU0A 1Z6RA 1U5TC 3MVPA 4PJNA 2GA2A 3OYHA 5K7ZA 1ONVA 4CXFA 1AHDP 3FKIJ 1SEUA 2H6BA 1N77A 4XLNF 4NQWA 4BQNA 2XGEA 1HDDC 4UVCA 3OOUA 4CCLA 3FBIB 1R4NB 4BKXA 2KP6A 4ZDPA 3IH4A 3QYBA 4XKWA 1DGWY 1IRGA 1ODDA 2JN6A 4BBSJ 3QQAA 4OU0A 2IP2A 5AIPA 3RPQA 2WB1A 3I53A 1T56A 3FBNB 3W2WA 2F5DA 1VFCA 3A4CA 5LRRA 1BI1A 3PIPF 3S2DJ 1S6LA 3GFJA 3L2QA 1K78A 3P7NA 5E3MA 2G9WA 1IXSB 3DBLB 2KJBA 3J7AY 3LNQA 4GXOA 3CTAA 4A0ZA 3G71I 4KDPA 3MFKA 2EFWA 3NQOA 3J7ZI 4A3BJ 2FF4A 4II3A 3ABMH 1YLFA 5FLXZ 5LBQA 1VQOI 4YFXF 4NC7A 3GLLA 5J6XA 4BHCA 5E18F 1Z91A 2ELJA 2Q2EA 2HOAA 3O3KA 4M3BA 2FMYA 2V1NA 1TTYA 1W7PA 2EIKH 4KN7X 2XROA 3KP2A 2WADA 2VBZA 1H89C 3D1NI 3DEWA 1QA6A 2OAZA 4CHUA 3BR2A 3TBIA 1ZGAA 2K9QA 4WK8F 3HPGA 2JMWA 1I6XA 1MNDA 1TT5B 1VQ4I 3PSFA 3R4KA 4M9ZA 4ENNA 1EH6A 3KZZA 2VN2A 3PNVA 2OC6A 4M6VA 4PCQA 5FB2A 2CW8A 1MH4A 5CVUA 3S3NA 1MH3A 3ZMSA 2LY9A 2J5PA 5C44J 3COAC 4P1WA 2X6WA 2LH9A 3DTKA 2XAUA 1QQIA 4E7JA 5GTIC 2R5ZA 3L2VA 2DA1A 1RNLA 2ZNYA 5CQEA 1PJRA 4XRSA 1IZ1A 1Q1VA 2UUZA 4HNVA 2P81A 2VASA 3OOPA 4ZYGA 2BBYA 4D1QA 5DD4A 3BTCA 3TW7A 4HNTA 2MSYA 2VOOA 4IVNA 1BW5A 4MFEA 2H6CA 4E7LA 2E1MB 3V7RA 4PJ0C 2VPRA 4UUVA 3OYAA 3TOBA 2QF7A 2A6TA 2DPDA 4Y3OA 4XSZF 2DT6A 2E7WA 4XKCA 4XOTA 1W0TA 2LLKA 4IHXA 3E6CC 4D7MA 5JLWA 2IS1A 2EBIA 4PJMA 2ZJPF 3A02A 4F3QA 4MLOA 4QWQA 3ZMDA 2ZKZA 2OA4A 2P0WA 1ZELA 1B8IB 1LFPA 3OMYA 3EYIA 4U7DA 2EB7A 1LDKB 4G12A 5L3EA 1E2XA 3RPUA 3M4OJ 1X19A 1ZARA 2MFZA 3V8KA 2PJRA 3K4CA 2PMZA 3M07A 2UV1A 1QZZA 4E7IA 1PDNC 4LITA 3RQIA 3HKZA 1MSFC 2GXAA 2HOEA 3FK6A 3QOPA 3ZQHA 1PP7U 1WSUA 4OMZA 2EIJH 1RZ4A 3ZPLA 2NS7A 5ICGA 1MGTA 2DYRH 2WV1A 1V5EA 3GTGJ 1FT9A 2DT7B 2KT0A 1UELB 3KP4A 5HNFA 4LB5A 1HW5A 2ADUA 5K5QA 1YX5A 2R7QA 1JUPA 1Z1DA 2FQ3A 2KZVA 4RMNA 1ZYRF 1P9QC 1K4TA 5ILSA 3DLAA 1YJWI 4OAYA 4CCKA 1G8XA 3ASNH 3BY6A 1Y8RB 2VJ5A 4FHTA 2OJED 4BXXJ 2QYOA 1A6IA 1SC7A 5TISC 2R92J 3OYMA 3K2ZA 1FOYA 2XKOA 3OYGA 1XCVA 5J47A 3I4MJ 3LL7A 2HZTA 2XHKA 3I5UA 2ICWG 2QGUA 5DCMA 1I1GA 1R22A 1TW2A 4MEXF 1RR8C 3PQKA 4BEHA 2V26A 1A6QA 2EZHA 2MC4A 2OCEA 3F8MA 3M8FA 4IRIA 1XSVA 1MW7A 3IKVA 2ZJRF 2WAQN 5EF6A 2DMTA 2RNJA 3RJPA 2AHQA 2HXOA 2VKEA 2VQCA 2X85A 4M71A 3CC2I 1R5GA 3CCUI 2RGVA 1ETXA 5F0FA 5AIQA 2ZMEC 4YELA 2IBDA 4FE7A 4CCOA 5J1YA 9ANTA 3FDYA 1BIAA 1ZLKA 1V55H 3M8JA 1ETYA 4PDKA 3WTWC 3MWMA 3V7CA 2LKSA 1O3TA 1R58A 4B4CA 4ESBA 2GOMA 2G7UA 2IT0A 5DEQA 1Y6IA 5ERIA 3K2AA 5FRMA 3VSKA 3SZGA 3WE2A 3H0DA 2K02A 5F0HA 3HL2A 3CCLI 4AIHA 2JPCA 3N4MA 3M9AA 1XX5A 4D0PA 3QYEA 3MN2A 1BI3A 4A93J 2DMQA 3J80K 1F1ZA 3ZQIA 3ZQ7A 3VDXA 2CV2A 4TV7A 1R49A 1SFEA 2LKPA 5H20A 1V4RA 5FLXK 1YTYA 1D0ZA 2E1MC 3MKLA 2WA0A 3L2UA 3BT9A 3KZIC 4ZYDA 2QA4I 2FOWA 2B63J 4IHSA 4XMYA 4KYWA 3CD6I 4RDUA 5EYRA 3P9IA 2XV4S 1MJAA 2KZGA 3LMMA 2Q8KA 4H0EA 3HOYJ 3UKGA 2H8WA 4PGHA 2E1CA 3GMEA 1LDDA 2QQBA 3JAMK 1YI2I 3HOSA 4GYIA 2ZMEA 4DZJA 1OR7A 2W85A 2LREA 1YQAA 2M45A 2R7DA 1OISA 1XMXA 2XDVA 3KLOA 2KDOA 3NRVA 1KA8A 3BQYA 2VUMJ 4AIDA 1KU9A 2HVQA 2UXNA 4DW6A 2LC2A 3H5NA 5EGOB 1YIOA 3ABUA 4C9YA 2DBBA 2A05A 4ON0A 1H8AC 2HR3A 3LSRA 1G3WA 2ZCWA 5C3EJ 2ID6A 2M0MA 3WTZA 3U1DA 1MBGA 4IOCF 5IT9Z 5DM6F 1X1BA 3N97A 2LBFB 4DJAA 2P5LC 1B9NA 2HDCA 1VQNI 3PNYA 2JTVA 5JHUA 5DCFA 4PSWA 1OCZH 3ROUA 1HCRA 5E20A 2QUFA 3DBRB 1F36A 4E7KA 1I3AA 5E1ZB 2R7ZJ 4A3GJ 5HLHA 4Q4ZF 2HNHA 2KPMA 5F1RA 1IRXA 1T95A 2E71A 2KMUA 3WODF 4A69C 4EM0B 4BAYA 5D5WB 2PLYA 2DAOA 3MZ8A 1A31A 2NS0A 3H3VK 4LLGF 1IJWC 5M5WJ 2PFBA 3CQZJ 4EEFG 3DTIA 1X3UA 3Q0WA 3E5QA 2KIQA 3GFLA 3C7JA 3A03A 4KICA 2JZYA 2ZC2A 2VE8A 5E3LA 3TW6A 3EPZA 2M0CA 5M3MJ 1ETKA 3I9V2 3HJEA 2DK5A 1SMTA 2YX4A 1BC8C 4BQQA 4PK4A 2LRDA 4WWCA 1WH5A 4HDUA 1KYWA 3SZTA 2GXGA 5CVJA 2F2EA 3SFZA 2M8GX 1S72I 3WTSC 1JJ8C 2V1DA 3QP6A 5EZGA 4RBOA 1X1CA 1XPXA 3AL0B 2IW5A 2HFHA 3CDLA 2GLOA 3VYTB 4BY1J 3IHUA 2DU9A 2L7KA 1IF1A 3OYFA 3CLOA 4KMFA 4U87A 3ZMZA 1ERDA 2IGNA 1P92A 2O8KA 4D9JA 2R7VA 4IJAA 1WI3A 1ZQ3P 1T38A 3FXOA 3M3YJ 4JBAA 1B1BA 3OIQA 5M5XJ 2ZSHB 1RRJA 2X6OA 5FKNA 5DS9A 1A36A 1YW7A 2OZ6A 2E2HJ 1WVRA 1VNDA 4M9SA 3D5LA 4MEYF 1YS7A 2TRTA 3ABTA 3CCQI 4XKVA 2P6SA 2FMLA 3CJRB 3OYCA 3CP2A 2ZSIB 4BXFA 3HC7A 2V9VA 3OV8A 4YEJA 4RGRA 4Y15A 5M5YJ 5KK1A 2CV0A 1IRZA 1WJAA 2RAEA 2WB1N 5IT3A 3SQNA 1XSDA 1YX3A 3IAS2 4M3EA 2FBIA 4HOBA 4KA4A 2LOOA 3AG3H 1DPRA 5BPDA 4UUSB 2HVRA 1B72B 1WH7A 2LY1A 3G73A 3VOEA 3SDGA 4RB3C 3X2QH 1V54H 2H09A 3VSLA 2IS4A 2DCEA 2JSCA 1U8RA 1P4WA 1OPCA 4M3GA 2NVYJ 3KEYA 4FQGA 1ZLJA 2XPUA 4O5VA 2IRFG 3ZCOA 4B47A 1ZK8A 3GZ5A 4GO1A 1B72A 5HODA 2HOTA 2XGXA 3FZVA 1FMVA 1RPWA 4RM2A 4LJZF 4QPQA 4M3DA 3S32A 2JUGA 2RNGA 4ZJZA 3QAHA 1Z21A 2PQ8A 2JA7J 4RAFA 2QWWA 1SFKA 3P9CA 1S5LC 3JR9A 1ORKA 2DN0A 1DU6A 1H9TA 4LK1F 2DA2A 4MFDA 4XRFA 1U5TA 2L3DA 1ETWA 1RUNA 3AFHA 2DODA 3R0JA 3B6CA 4I02A 3F21A 1KZHA 2A61A 3FMQA 3DP7A 5FD6A 2CQKA 2BW3A 1X2NA 2XAFA 1R36A 4LFUA 2OF7A 4ZTJA 1B6AA 2IA2A 1WJ5A 4Z2YA 4HX7A 1T39A 1FX7A 3BTLA 2PN6A 2LG4A 2HPIA 2G0EA 5EZHA 4ZYEA 5CPRB 1VTNC 4HLYA 3JRAA 1DQUA 4DIQA 3KE2A 1E3PA 2IGKA 5FKKA 2VOPA 1ZTRA 1K83J 1TWFJ 4E4HA 3ESWB 2F6CA 2OBPA 4U0VA 5GADJ 2M5WA 5ILVA 4G6QA 3FISA 1MMNA 3F8FA 3FWEA 4EM2A 3DTEA 2EILH 2FBHA 5KAIC 3GBGA 1FIPA 2ECCA 2OQGA 5GPAA 4EJWA 5HLIA 2MGQA 2R0QC 3OYKA 2NVXJ 2P4WA 4QTRA 1ZREA 3HZJA 1BM9A 1IDYA 2W4SA 2TCTA 3WE3A 3DEUA 5FO5A 1XC5A 3ZN0A 4XRSG 1OCTC 2BXZA 4RLFA 2L7MP 4MQVA 5EGOA 1FBSA 1K79A 1BR4A 1QHGA 1ON2A 4PSXA 2BE5F 3RCOA 4FX4A 1RIOH 1JE8A 5F27A 3HOZJ 1RUOA 4M74A 4F92B 1LPQA 2DMNA 1JGGA 3GFMA 3C2HA 2EA4A 1TWCJ 4OMYA 5E79C 2P5VA 2K4JA 2KRFA 4PGGA 5H2FC 3CCVI 3FHZA 2DFHA 2EQRA 2QVOA 2D45A 1K4SA 4EJOA 4A0XA 1U3EM 4BXUA 4CCNA 4ESJA 2Y75A 2O3FA 3V42A 1XGSA 3D5SC 1JKRC 3PUFA 3ZQLA 3AG4H 1ETOA 2GIZA 3QPLA 5F0CA 3S17J 4L5IA 1MJ9A 2IEKA 3OS2A 4D5FA 3RPUD 3KETA 3MKWB 3I54A 1N25A 5EEGA 2V6EA 3VEPA 4XICA 4WXDA 2FU4A 1ZN2A 2LR8A 2NOGA 2W7NA 2FA5A 3K4LA 1FJLA 3ML6A 4A3FJ 2RQQA 2JJ7A 5K5OA 2PMZN 1MMAA 4OIQF 2L0KA 2K3PA 1P4AA 1BBYA 3HKZN 2OZUA 3GCMA 2XF6A 2F5VA 1VF9A 2OPTA 2YX7A 2ZO4A 4LK0F 3OY9A 1CF7A 5BPIA 2I5UA 3L7WA 1BN5A 1OJLA 4QSHA 1HKSA 3MCZA 3LOCA 4N0BA 3GF2A 1XDSA 1HXDA 5GAGJ 5AONA 2EZLA 1R9TJ 2YSRA 5HLGA 3JRHA 4S0HB 3LSPA 3QU3A 2VQLA 5LFAA 2KLOA 4PFOA 3E6BA 4ZTFA 5E8GA 1KU2A 2JRMA 1SVLA 2WTEA 3V4GA 4AYBN 1RKWA 3J81K 3KCCA 3HM5A 3NWSA 4G9YA 2L7ZA 1ZRCA 2CH0A 1B59A 1ENHA 3FKJA 1RESA 1SMYF 5LGUA 4EVIA 1WKMA 2CS3A 2ESNA 4HLXA 4N4NB 3HRMA 1XN7A 2KRHA 3DPLC 3MEXA 4E70A 1R00A 2DXIA 2M4KA 2QZ8A 2M2EA 4XR6A 1R71A 4OOIA 1GXQA 5GTHC 5K7FA 4JQFA 1PVEA 2NNYA 4A3JJ 2DFIA 1FTTA 1QU3A 4UUTA 1QRYA 2Z2SB 3M1EA 3LSMA 3BG7A 5BQTA 4ETSA 2CUZA 5IYBJ 3H9QA 5D5UB 5K1YA 1P7IA 4RAYA 5DYMA 2VKDA 3MQ0A 5JLXA 1LKXA 2ZFUA 2CSOA 4P5OA 1TW3A 2QQ8A 2MD5A 1XSXA 2H27A 1XMAA 3CJTB 4XBFA 4MHGA 2E1OA 4FCYA 1AOYA 4MIMA 5CKTA 3KEOA 4YRVA 1FWZA 2HYJA 3I56I 1KU7A 2EV6A 3ULQB 2X6XA 1FNNA 3FXJA 3QWLA 5B1AH 4HQMA 4G7OF 4OWRB 3RQ4A 1X58A 2A5YB 2L02A 4N4OB 4QPOA 4A3EJ 2CV1A 3DFGA 2PG4A 1J2XA 5TJJA 5ED4A 2C6YA 1V3FA 3KP7A 5IPAA 3F3XA 3MKZA 2LF7A 4IRHA 1WHUA 2BHZA 3HG9A 1TZLA 5A2QK 5BMZA 3S15J 3G4SI 3NAUA 3HBLA 1IGNA 1FP2A 4GYGA 3ZP5A 1SD6A 2CJJA 3QPTA 2MH9A 2PMUA 4I76A 4S04A 3CUQB 5D6FA 4Y52J 1Y39A 4X0GA 1ZKGA 2GBYA 5DTDA 4IO9F 4ZZLA 3IKTA 2V79A 4I98B 3V8LA 3P9KA 1PYVA 2YUSA 3KYDB 6PAXA 2DDAA 4XNFA 3VODA 3JRGA 4H4KC 1RR7A 4XLFA 5E1XA 1B8IA 1OFCX 2Y0MA 2JT1A 4L9JA 3L2WA 5F1JA 4LG3A 4UNOA 3TEDA 1BOAA 1TQIA 3HOUJ 3DPUA 3DQVC 2VT3A 3HSFA 4KFCA 3FMRA 5LHIA 5LHGA 2Z16A 1IN6A 2CFXA 3MAJA 1E3HA 3E6DA 4XN0A 1CQTA 2V1UA 1R6RA 4KIFA 3SEZA 3F8BA 3W6KB 5FLVA 3CZ6A 1BIBA 4ZYHA 3TDUC 4HEA2 2HYFA 3JTGA 3M1CA 1Z0XA 4P55A 2ID3A 2E1NA 3HSRA 2A6EF 1GV5A 4I09A 3SDBA 1KGSA 2O9LA 2X1EA 2PMHA 3E5UA 1BR2A 4KISA 3BC8A 4XLAA 3JRCA 3VYSB 3I55I 3BPXA 2I8DA 1EH7A 3GEZA 4OIOF 1IV6A 1RI7A 3KP3A 1IXCA 4P9UA 1UAAA 4M3FA 4AM3A 2JA5J 3TP0A 2OV7A 4ZH4F 4MQ9F 5ILUA 3MZHA 4UUSA 3BDDA 1XTAA 2ECBA 2VKVA 1KQ0A 4M73A 2OCCH 3CCSI 1OYWA 3QODA 1T08B 1QGPA 2D5VA 1ACIA 1QVUA 2R7OA 4BUPA 2LSOA 4BQAA 3KP6A 2CQNA 4W97A 2ZB9A 4EM1A 3REOA 1MBHA 3CJNA 5ICEA 5D5VB 3ERMA 3HSEA 3DU6A 1MBJA 2ZJQF 2FD5A 1W0UA 2PBIA 2VBWA 1WJDA 3H9GA 3T8RA 5DUKA 3SEQA 1UHWA 3K4JA 1REPC 1ETVA 3QRFF 2GZWA 4BY7J 4IPAA 1K78B 2FOKA 2HQRA 3IH3A 3L2RA 3CC7I 2Q1ZB 2STTA 2O03A 2BY0A 3LSHA 2E2JJ 3BLYA 2VIXA 1T33A 1BI2A 5JI6A 1O3QA 3VWBA 4L9VA 1U2WA 2FE3A 3HTSB 3GW2A 2EWNA 2HQNA 4BQOA 4E6KG 1LVAA 3A0BC 1Z7LA 3CMYA 2Y2ZA 4U0YA 1V5FA 3CCMI 4W1UA 4HV6A 3EYYA 5DDGA 3S1NJ 2IA0A 3SHFA 3MMYB 2Y48A 4UB6C 5HDKA 4J19A 1JJ6C 1ETQA 3K1MA 2FRHA 2CQ7A 4HG2A 1WGXA 2X1CA 2CUJA 4CYCA 2A69F 1JTXA 3I3LA 3M8EA 2BGCA 3JCUC 2ETHA 3H92A 2QKMB 2K9LA 3O2PE 1E0EA 4ZDOA 2ZFWA 4LD5A 1J5YA 5HDNA 1VQ7I 4B1RA 5FROA 3WGIA 4B8XA 3W2AA 3J7AO 3PO3J 4ITVA 3DKYA 5LD2C 3ECOA 4HF0A 1HDPA 3ISPA 3Q0UA 3RYRA 1TNTA 3CMEI 2IPQX 4HF2A 3FXRA 5L3CA 1LJ9A 3E97A 2XF5A 3BOQA 1TWGJ 3RYPA 1G3SA 1MBEA 1ZG3A 2V9PA 2VC0A 1I6HJ 4A6DA 2COMA 3RDIA 2X48A 4NC8A 4LLLA 3A2KA 4IHYA 3KYCB 5FGMA 4A3DJ 3K70D 5D8LB 1EH8A 1IXRC 3OS1A 5HVQC 2IS6A 2L4AA 4IX7A 3E7LA 5F08A 4IRGA 3CCYA 2A5WA 1VI0A 5BOXA 1B4AA 1JKQC 3K1NA 1YW9A 1ZGJA 3ZOBA 2VONA 1VQ5I 3ELKA 2HGCA 1LE8A 2XAQA 3LA2A 1IN8A 2N8GA 4KNYA 2EPFA 5LGNA 1PUEE 1WWXA 4XM3A 1U8BA 2LD5A 2R7XA 2DOFA 3E3VA 3WGGA 2NS8A 2BVLA 1HSTA 5HS7A 3L09A 5LEKA 1IN5A 2F4OB 2X0LA 1ZR2A 3CJQB 3BCBA 1ZG5A 2R7UA 1Z7UA 2W57A 1C0WA 2GXBA 5LRSA 2VQHA 1AU7A 1DP3A 3F0CA 5F6FA 2L2OA 2BW3B 3HXLA 1GLNA 3E6MA 1PP8F 5IOZA 3U21A 1QHHD 1XGNA 4BGDA 1USSA 3MZYA 3QPHA 4JOMA 5TRDA 3BR3A 1X4PA 3WTTC 2STWA 4A3IJ 1J75A 4LG0A 1J7KA 1EA3A 2CGPA 4RA2A 5J1UA 2V6CA 2WY8Q 3OR2C 5FD5A 4KUMA 4GDFA 3E5XA 3ZMUA 2MA3A 2GQQA 3EUHC 1XD7A 2A3SA 1OCOH 2F5CA 2NVQJ 2FBKA 3LFUA 5J4VA 1W7PD 1SAXA 1XCBA 1D1BA 2DK8A 3CDIA 3CCEI 2EV5A 3JRIA 4A3CJ 1GHCA 1VZ0A 5CVVA 1TBXA 1I27A 3M7GA 2HWVA 1G59A 2K9NA 4XRMA 2O61A 4OINF 4EATA 3GWZA 1NHAA 3R60A 3S3OA 1WPKA 4DOZA 3D5RC 2ELHA 4GGGA 4O3MA 2QENA 1QBJA 2XRNA 1LNWA 4C2MJ 5BS6A 5TGTA 1U9NA 5J40A 3O8GA 2JA2A 5JR3A 2VLAA 5IOYA 5IP9J 4PJLA 4M72A 2XUBA 1KONA 1SAUA 5HNHA 1NG7A 2QQAA 1UHSA 1X1AA 4WXHA 4DZPA 2K5CA 1DGRM 1JHFA 4B3XA 4A5MA 2AO9A 2LF8A 2NAZA 3BZ6A 3HHHA 1UZCA 3J7YJ 1H88C 5HS9A 3H5RA 2XVCA 3OIOA 5K7HA 1D8KA 2BYVE 5EG0B 3L9FA 2DFEA 3PUBA 3HUGA 1MZBA 2E7XA 3GO5A 2RN7A 2MLGA 3H3ZA 4WF2A 3RSNA 4D5CA 1VQMI 1JXSA 3H5AA 4BU2A 4ZYAA 2CMPA 1P4XA 4IQJA 4CO8A 3BR1A 3CUQC 3DBHB 3ZQQA 1WJEA 1POGA 1ZRDA 2QBYA 1YYVA 3BR5A 4MNUA 2M4GA 3TO6A 4C3HJ 4ENJA 2K40A 2P5KA 2EA2A 2HQ5A 2OU2A 2AXLA 3EDPA 5FLMJ 1O3RA 1IN4A 3R6SA 2CU7A 3BG3A 3P5JA 2V1XA 3AKZA 2IJLA 4C30A 3JRDA 3L2CA 1MDMB 4HW0A 4L5EA 3G1MA 4HSRA 3VYUB 1N78A 2F4MB 4IZZA 3GZ6A 2CW7A 2LK2A 3EUKL 3W6VA 4N9HA 1X1PA 4ZC3A 3ZN1A 2UXXA 1J59A 2YU9J 2ISZA 4DYRA 2XGDA 1H9GA 1PUFB 3U9GA 4BBRJ 2B7EA 5KVRA 1OR7C 1Z67A 4XL9A 3OS0A 2A6HF 3DKXA 4IHTA 3DF8A 1G6NA 4YFNF 2EFNA 4AU7A 1M1EB 3FM3A 5LHHA 3GTOJ 3OR1C 2PJRB 3QYFA 2R7RA 2DA6A 1MMSA 5FKLA 2KISA 4FISA 3WTUC 2Z3YA 2RREA 4XORA 2QCOA 1D0YA 1KQ9A 2HU9A 3CO7C 5CYVA 4RS8A 5KCMA 2KHMA 3G3ZA 2XASA 4DBRA 3CO6C 4BDYA 3I4PA 3O8HA 4LIUA 2XC7A 2CG4A 3S1MJ 2EIMH 1G3TA 3F6OA 5IP7J 2LNBA 3H9JA 3WG9A 2XRLA 5JFRA 2DTZA 3A01A 4IEJA 4NUBA 2QQ9A 1IRFA 2DYSH 4BACA 2L9RA 1R5ID 3A0HC 3I59B 2XSDC 4L9TA 3QPSA 2HKXA 2JRTA 1LFUP 1QNTA 2K9MA 1SD7A 2P6TA 5CVIA 2JWTA 4AD9A 3PL8A 3W3CA 2K3FA 4BYYA 3A1YA 1K61A 1FOKA 4WXCA 2DA3A 1W7PB 3E0JB 1LB2A 1Y0UA 2EZKA 5JVTA 2QLZA 2DPUA 1IN7A 2M7AA 4QIWN 4XOPA 4RB2C 3CC4I 3C18A 2OD5A 4UV8A 2W84A 4EJTA 3IUOA 1OCPA 1YIJI 1Z6TA 2BV6A 1T8IA 2QBYB 5D6EA 2E19A 3BP8A 1AA7A 2DMUA 4G94A 4UY8I 2Q0OA 2W82A 3U2RA 2LFBA 4KT5C 2ZNZA 2GM4A 2M3AA 4ENMA 3FX3A 1Z3XA 1RKTA 4HYEA 5EG0A 4R79A 1CF7B 3DCFA 1XGOA 2Q2EB 2X1DA 4AUXA 1E3OC 1QPMA 3RKXA 3DLLF 2EH3A 5HDGA 4HNUA 3OYNA 1X1DA 3AG2H 3BZKA 1MNMC 1OQYA 3LA3A 3S14J 1A04A 2KQRA 3PNTA 4AC0A 3KIOA 3F22A 1F43A 4R8HA 1T98A 1I3QJ 3UR3C 5HLTA 4GRIA 1FSHA 2GAUA 3K4MA 4HQEA 3Q9VA 2R93J 1O7LA 4NB5A 4E7ZA 2QSGX 4XKBA 1ITYA 4CCMA 2NRAC 5EEHA 1FSEA 1FYKA 4BJ6C 2IGMA 2ZXWH 3IH2A 4HSTA 1LVKA 4PJJA 2HKOA 1OYIA 1MSEC 2MW8A 1FYMA 3CCRI 3B6AA 2Y9ZA 4UXNA 4A3LJ 1JGSA 1YITI 2L54A 3CF2A 1NH3A 3WTYC 3GTKJ 5L3DA 2XB5A 5LGTA 2LY2A 1QZYA 1TNSA 3S8PA 1GV2A 3VB2A 3L00A 1R1TA 3VYRB 1G3YA 5CQGA 3IAM2 3KP5A 3LSKA 3HYIA 4BEHB 2M30A 1L0OC 2R5YA 3ZXSA 2FQ4A 4XN3A 2XIGA 3AG1H 2DFFA 4YIIA 5DCMB 3J80Z 1P2FA 4UVBA 2O7OA 2FX0A 4Y4RA 1O57A 4LG0B 1KQ8A 1QO0D 1HW2A 2VKHA 3ZMTA 2V7FA 4WX9A 1ZRFA 4CDGA 2BVMA 1FZPB 2ELKA 2AQFA 4HF1A 1EV7A 2VJ4A 4AIKA 1R1UA 2PEXA 4O6JA 4F93B 1NTCA 1ZR4A 4E7SA 3BTIA 2Y9YA 4FE4A 4HPQA 3DEEA 4DQ2A 4V19K 1OLTA 1GUUA 3RZDJ 2RDPA 3TKYA 4BHPA 1YRNB 1T6SA 3TO9A 4JP0A 4BJTA 4ZDLA 3S2HJ 3GTMJ 1D1AA 1Y8QB 5F64A 5E3OA 2O5RA 2DDBA 5J4YA 5IY5H 5FKOA 3K70C 4LB6B 2LMDA 3EUHA 3F72A 1FBUA 4JK1X 3WGHA 4B48A 5A2QZ 4S05A 3CMAI 5B3SH 4LIVA 4XQFA 2WWYA 2D1VA 3DV8A 3HIFA 1IUYA 2FSWA 1HF0A 1HBXG 2HDWA 1YRNA 4F7ZA 2KFDA 3C1DA 5D8KB 3BR6A 3OSFA 4KJZA 1FOXA 3HRUA 1HC8A 2M34A 2O0YA 2JVGA 3RKYA 3SFIA 4BE1A 3H1CA 4X6AJ 1MBKA 4EV0A 1YOVB 4EMSA 2DMPA 3G6EI 1J9IA 1S7OA 1TT0A 2XAHA 4A2UA 4HZFA 1U5TB 3K4BA 1O4XA 2FEZA 1APLC 1GVJA 2H1LA 3Q3SA 3ABKH 3RTRA 1YG2A 2B9SA 1EKEA 2AXTC 1N75A 1HKQA 2M87A 4AIJA 2E36A 2XSJC 5L3BA 1D8JA 2R5ZB 4EQQA 2VQGA 2E34A 3ZQFA 1K7AA 3QP5A 2HOSA 2NXNB 3KX2A 3ONQA 2EJRA 4RB0A 5E8IA 3OYIA 2XAGA 2BZTA 2AQEA 5GPCA 5F04A 2JVHA 4XK4A 2VI6A 3LA7A 1YO5C 3BPVA 2BY1A 2HEOA 1I5ZA 2DLLA 1SANA 2GOXB 4JX4A 3TL4X 2K86A 3DXJF 3K9TA 3LSGA 4CICA 2H1KA 1VQ6I 2L7FP 2CWEA 3I58A 4CH7A 2MYSA 2EK5A 3W6JB 4I99C 4IOAF 3T1BA 2VE9A 3F23A 1W5CC 2X9DA 3HRTA 1U0JA 5KNLA 1Y56A 2EV0A 3IRRA 1AKHA 3LAJA 1TWHJ 2W24A 4Y33A 4ASNA 4Q47A 4Y7NJ 2JK3A 4WCGA 2H8RA 1FLIA 2FNPA 3KEQA 2RKHA 1ZHFA 3ZQCA 4ESFA 5J8FA 2DT5A 2WAFA 2DJNA 3TDZC 4BS9A 1WCMJ 2BY2A 2XB0X 3WU1B 1S29A 3WG7H 3OYLA 3ERED 4AVZA 2EZIA 2W00A 2DO7A 5FFXA 3AL0C 4CZCA 2L01A 2UWMA 1SVMA 4U7BA 4DGWB 3LAPA 5FKMA 2HVSA 1S7EA 3V8JA 1W5SA 2DA4A 3IV5A 4K2EA 2M1BA 2PX9A 3T0YA 2OQRA 4NQWB 3S16J 4C3IJ 2Y31A 3R0AA 1MNEA 1FYLA 3RZOJ 3HPHA 3DPTA 1OCCH 5DD8A 1GT0C 1EF4A 1FMWA 3PO2J 3H0GJ 3PIOF 3WTXC 1W1WE 2ESHA 4GFBA 5B5EC 2XF7A 1O3SA 5D4RA 2ZJ2A 1AKHB 5K5RA 1BJAA 3DWLE 3HGYA 3WHCA 2KDZA 3KLNA 4IKFA 2BOLA 1LFBA 1FPQA 4DYCA 3OL4A 5GAHJ 1R7JA 1MIJA 2CW0F 2X4HA 2XAJA 1FBQA 1MMGA 5H6QA 1RETA 4V2GA 2W1OA 4FX0A 4Y17A 3OYBA 2CYYA 1FIAA 2R7FA 3FMSA 4Q48A 4B44A 4CA0A 4J01A 1H0MA 1HKTA 2R7SA 4M6XA 4IL6C 3Q5FA 3I0TA 3HB9A 4C3JJ 4RAZA 3ASOH 1Y1VJ 4HAMA 4YIRX 3S2WA 2MBFA 3GX4X 4UVAA 1WJFA 2FJ1A 4KT6A 2Z9OA 4JYKA 2B0LA 2FXAA 4A0YA 4JX5A 1D5YA 5DM7F 5E17F 2AS5F 1Z05A 3GVAA 2WAEA 2ZXIA 2Y69H 1IDZA 1JUSA 2RC4A 4F91B 1GXPA 2V9KA 1F9NA 3ZRGA 2LKXA 4IHVA 3K1PA 3CF5F 4D7NA 2VJIA 1FTZA 1ZGWA 2DA7A 3DU5A 3CCJI 2EFQA 4J00A 3BR0A 1L3LA 2FNAA 2HTJA 4CYDA 1LQ1A 2CQXA 2CO5A 2VPLA 3OYJA 3HOVJ 2IS2A 1IV8A 1O7FA 3HRSA 2F5FA 3LSIA 3JRFA 4L18B 4LLNA 2ZMEB 2E5NA 2LTPA 2BXYA 4CGZA 3QU6A 1TP4A 2VODA 1G4DA 1LEBA 3S3MA 4RGXA 3IRQA 5EDNA 3BJAA 1I1SA 1TQPA 3I71A 2XPVA 1FP1D 4YG2F 2IA1A 4I7HA 1GDTA 3JREA 2DOAA 1EJ9A 1SD4A 2CRGA 3CDHA 4AWXB 4RB1A 2FUG2 4NC6A 2F4IA 2LP0A 2K9SA 4RGUA 4U88A 5E3NA 5FRNA 3K0LA 4XLCA 5DV5A 4C2UA 3CMMA 3GLXA 2VC1A 3VPRA 3JAMZ 4FTHA 1ULYA 3K4KA 1U6GA 1YJ9I 3FIWA 1HA8A 1WQ2A 1VQLI 3GTQJ 1JUMA 4BHBA 4ANJA 3GTJJ 1UFMA 1XDUA 2R3SA 3HUGB 2KRCA 1TWAJ 3TO7A 2BEOA 3KYLA 2MLKA 4RGSA 2JA8J 1QZEA 3PM1A 1IUFA 1UMQA 1DDNA 3K4NA 4V2FA 3B73A 3B02A 3OYEA 3UNGC 2LDUA 1W36C 3OSGA 5J8CA 1BOBA 2XPWA 2IAIA 3SZPA 4B09A 1R23A 3PFIA 5DUIA 4YFKF 3IL2A 2CUEA 3CLQA 5FFZA 1F4KA 2P7CB 2R5YB 4MTEA 2WC2A 4RM3A 5LEJA 3OIPA 4HX4A 4Q5SF 4RAGA 1AWCA 1SFUA 4EJUA 1SFOJ 4XLPF 1YFHA 3E1SA 3RKWA 4BDZA 3SXYA 1BJZA 4CZZA 1NK3P 4OIPF 2E5ZA 2HXIA 3JW4A 1W5TA 4GCVA 1GVDA 2VL8A 2D1HA 3PJRA 1BC7C 1I39A 4KN4X 4G6TB 2BY3A 4MGRA 1DP7P 1S7AA 2ISYA 2K4BA 3K69A 4B43A 2MD0A 4A5NA 4FASD 1XS9A 4BH9A 2YS9A 3RIRA 1P6RA 4L0YB 4DBQA 2WBMA 2HQAA 3BJ6A 3HOTA 4HV5A 5EEAA 4A3MJ 1STZA 3HGGA 1J0RA 1YJNI 1Z9CA 3FXQA 1TC3C 1S9HA 4XIDA 3QOEA 1S8NA 1OKRA 2W25A 4I0AA 2MG4A 5EJCA 5IYDJ 3G2BA 5C4JJ 1TL8A 2JA6J 1J09A 1IAWA 2DI3A 1YE9A 4F55A 2HI3A 2Z5UA 3GTPJ 4NNJA 1FY7A 1DU0A 2M7BA 2W48A 4EJVA 2IVMA 1R1VA 1OMIA 1ON1A 4BJ5C 3GYHX 3CUOA 3O6BB 1V5GA 4B3AA 1WJCA 4DYQA 3L1PA 2Y0SA 5CVRA 3K7AJ 4II2A 3S1RJ 2HZDA 2YPRA 3W2VA 1USTA 1WZ2A 1ZG1A 1X4OA 2WV0A 1D0XA 3A01B 4KITB 4A3KJ 3T5XA 3N05A 1D1CA 1XGMA 5KHDA 3FK7A 3C2GA 5JVGF 4CCJA 3D0SA 1XMKA 1LEAA 3BZCA 5CJ9A 1CGPA 3KZYA 1G2HA 4PFPA 2Y30A 1IG7A 1JT0A 5IYCJ 4XONA 2KL4A 3K10A 1NK2P 3ECHA 1KYZA 4HDVA 1BA5A 2EINH 3VFZA 1T0FC 3I59A 1XG1A 1R4MB 3RI4A 1I50J 1TQMA 2F48A 4KIGA 1JKPC 3HEFA 3TOAA 2F5EA 2K85A 4P9FA 3FXKA 4G8XA 4Z6YA 2CUFA 2E60A 2EFPA 1IW7F 1KU3A 1MBFA 4A12A 2QSFX 3NARA 4C2TA 4BE0A 2O6GE 4I0BA 4G7HF 1JT6A 1W4MA 1PUFA 1YHQI 1JTYA 3IP4B 2VBYA 2ZXHA 4CUGA 3WTVC 2I10A 2MH2A 3G1LA 5HS8A 3CP8A 3KPHA 2M9HA 1YS6A 2LVSA 3U1KA 2VBXA 2XGCA 4HRIA 3ZR8X 3FM5A 5HOOA 2Z1DA 2YU3A 4N9IA 1X3ZB 1ZAOA 1MDMA 3C2BA 1BR1A 2M8EA 2A68F 3OL3A 4X1EA 5L3GA 1W36D 4FETA 3H35A 1D5VA 3JRBA 1SD5A 3GXOA 2Z33A 4Y13A 1WJBA 3FXLA 2CFOA 2NYXA 3LQQA 1FC3A 1MKMA 2R4GA 4XSXF 4IXAA 2IXSA 3ZQGA 2JPBA 1OYYA 3IC7A 2L9NA 1JKOC 3NWTA 3BWGA 1S3JA 2DQRA 3KFWX 2ZXJA 1MD0A 3MD2A 4HX8A 2PI0A 4P96A 1UB9A 3GZNB 4FT8A 1E17A 1HW1A 3T8TA 4CSWA 1VQPI 2RQPA 5M3FJ 3Q9SA 1UJ8A 4M9XA 3GUDA 5GP9A 3FHNA 4AYBA 5GAEJ 1IC8A 2DQLA 1T0FA 3IWFA 2QKLB 3K6GA 4I2OA 3F9KA 4IF4A 4QLCU 3GTLJ 5ICFA 5IT9K 2NNNA 3G1OA 2R7TA 1A35A 2P8TA 3OYDA 4KMUX 2HYGD 3BQZA 2H94A 3I4NJ 2R7WA 1BW6A 1UHMA 1HOMA 2X51A 4NDLA 2VT2A 3ZGKA 2ACJA 3AAFA 2KIMA 1UCRA 2L9VA 2A07F 1DUXC 5D4SA 3H36A 3OWTA 4RLQA 2KKOA 1BI0A 3F8CA 3BG6A 3DKWA 2Y0SN 1DPUA 1F5TA 1VQKI 2KIFA 3BCAA 2JQ7A 2JUCA 4U0WA 1YW8A 4UB8C 3F6VA 2D2WA 4PZJA 5ICCA 3RKQA 1IO2A 2X6YA 3TQNA 5JHFA 3V7SA 4HA8A 1Y0NA 2G7HA 2RVCA 4BE2A 1X2MA 2P7VB 3HTUA 2RV8A 5D5XB 4EGZA 3LQRA 5LLQA 1U78A 5FJ8J 2J5OA 4G6DA 4EGYA 2ZBKA 2DTRA 3LSTA 3TMOA 1LDJA 2JSPA 2V4JC 2OTJI 3ABLH
chains in the Genus database with same CATH topology
2DW4A 3LWFA 3GFIA 2GA1A 4MTDA 4R1HA 1XB4A 1K6OA 3J81Z 2KIUA 3FF5A 2PJPA 4UHTA 3I64A 5E1WA 4G7ZF 3F8NA 1ZH5A 4DNCA 2VXZA 3JSOA 3ZMVA 2KJCA 3CUQA 2MC3A 4ENKA 2GIVA 3EQLF 4BNCA 4AVPA 2Z99A 3HHGA 2K27A 2TDXA 3JSPA 1MJBA 3TGNA 4UV9A 4HBLA 3FXUA 4OIRF 5L3FA 4L9NA 2EFOA 1R5HA 4LGWA 2XKPA 2QM3A 1TLHB 1JHHA 4A6EA 1B9MA 2L4MA 2O8XA 4L0ZB 1Q1HA 4KIBA 1HQCA 3EETA 3IWZA 2GWRA 3BROA 2HS5A 1HSJA 4NHJA 3BJOA 3R61A 3C3WA 3H3UA 5H6RA 2UZKA 2YR2A 3PQJA 3LFKA 2K7LA 1WI9A 4L5JA 2HTSA 1SFXA 3JTHA 4I01A 4M6YA 3NEUA 1T2KA 1D3YA 5CLSA 4ZZDA 4YIFA 1WRJA 4LMYA 3WU0A 1Z6RA 1U5TC 2GA2A 1ONVA 4CXFA 2H6BA 4XLNF 4NQWA 4UVCA 1IRGA 1ODDA 4OU0A 2IP2A 5AIPA 3RPQA 3I53A 2F5DA 5LRRA 1BI1A 1S6LA 3GFJA 1K78A 3P7NA 2G9WA 1IXSB 2KJBA 4GXOA 3CTAA 4A0ZA 4KDPA 3MFKA 2EFWA 3NQOA 2FF4A 1YLFA 5FLXZ 5LBQA 4YFXF 5J6XA 4BHCA 5E18F 1Z91A 2Q2EA 3O3KA 2FMYA 1TTYA 1W7PA 4KN7X 2XROA 3KP2A 2VBZA 2OAZA 4CHUA 1ZGAA 4WK8F 1I6XA 3R4KA 4M9ZA 4ENNA 1EH6A 3KZZA 2VN2A 4PCQA 5FB2A 5CVUA 3ZMSA 2J5PA 3COAC 1QQIA 1RNLA 2ZNYA 1IZ1A 3OOPA 4ZYGA 2BBYA 5DD4A 2VOOA 4IVNA 2H6CA 3V7RA 4UUVA 3TOBA 2DPDA 4XSZF 2E7WA 3E6CC 4QWQA 3ZMDA 2ZKZA 2OA4A 3EYIA 4U7DA 2EB7A 1LDKB 5L3EA 1E2XA 3RPUA 1ZARA 3V8KA 1QZZA 1PDNC 1PP7U 2HOEA 3QOPA 1WSUA 4OMZA 1RZ4A 3ZPLA 5ICGA 1MGTA 1FT9A 3KP4A 4LB5A 1HW5A 2ADUA 5K5QA 1Z1DA 2FQ3A 1ZYRF 5ILSA 3BY6A 4FHTA 2QYOA 3K2ZA 2XKOA 1XCVA 2HZTA 2XHKA 3I5UA 5DCMA 1I1GA 1R22A 1TW2A 4MEXF 3PQKA 3F8MA 4IRIA 3M8FA 1XSVA 3IKVA 2RNJA 3RJPA 4M71A 1R5GA 2RGVA 5AIQA 1BIAA 1ZLKA 4PDKA 3WTWC 3MWMA 3V7CA 1O3TA 1R58A 4ESBA 2IT0A 2G7UA 5DEQA 5ERIA 3WE2A 2K02A 4AIHA 2JPCA 3N4MA 3M9AA 4D0PA 1BI3A 3J80K 1F1ZA 3ZQ7A 4TV7A 1SFEA 2LKPA 5H20A 1V4RA 5FLXK 1YTYA 4ZYDA 4IHSA 4KYWA 3P9IA 2XV4S 1MJAA 2Q8KA 4H0EA 4PGHA 2E1CA 1LDDA 2QQBA 3JAMK 3HOSA 4GYIA 2ZMEA 1OR7A 2W85A 1YQAA 2M45A 2R7DA 3KLOA 3NRVA 1KA8A 1KU9A 2UXNA 1YIOA 3ABUA 2DBBA 4ON0A 2HR3A 1G3WA 2ZCWA 3WTZA 3U1DA 5IT9Z 3N97A 2P5LC 1B9NA 2HDCA 2JTVA 5JHUA 5DCFA 3ROUA 5E20A 2QUFA 5E1ZB 5HLHA 4Q4ZF 5F1RA 3WODF 4EM0B 4BAYA 2PLYA 5D5WB 2DAOA 2NS0A 4LLGF 2PFBA 1X3UA 3E5QA 3GFLA 3C7JA 4KICA 2JZYA 2VE8A 2DK5A 1SMTA 2YX4A 1BC8C 4WWCA 4HDUA 1KYWA 3SZTA 2GXGA 5CVJA 2F2EA 3SFZA 3WTSC 2V1DA 3QP6A 2IW5A 2HFHA 3IHUA 2DU9A 1IF1A 3CLOA 4KMFA 3ZMZA 1P92A 4IJAA 1T38A 4JBAA 1B1BA 1YW7A 2OZ6A 4M9SA 3D5LA 4MEYF 1YS7A 3ABTA 2P6SA 2FMLA 3OV8A 2V9VA 4RGRA 4Y15A 5KK1A 5IT3A 3SQNA 1XSDA 2FBIA 4HOBA 4KA4A 1DPRA 5BPDA 3G73A 3VOEA 4RB3C 2H09A 2JSCA 1U8RA 1P4WA 1OPCA 1ZLJA 4O5VA 2IRFG 3GZ5A 4GO1A 2XGXA 3FZVA 4LJZF 3QAHA 2PQ8A 2QWWA 3P9CA 1H9TA 4LK1F 4XRFA 1U5TA 2L3DA 1RUNA 3R0JA 4I02A 3F21A 2A61A 3FMQA 3DP7A 5FD6A 2CQKA 2XAFA 1R36A 4LFUA 1B6AA 2IA2A 4Z2YA 4HX7A 1T39A 1FX7A 2PN6A 4ZYEA 1VTNC 4HLYA 3KE2A 2VOPA 2OBPA 4U0VA 2M5WA 5ILVA 4G6QA 3F8FA 3FWEA 4EM2A 2FBHA 2OQGA 4EJWA 5HLIA 2P4WA 1ZREA 1BM9A 3WE3A 3DEUA 5FO5A 3ZN0A 4MQVA 1FBSA 1K79A 1ON2A 2BE5F 4FX4A 1RIOH 1JE8A 1RUOA 4M74A 3GFMA 2EA4A 4OMYA 2P5VA 2K4JA 2KRFA 4PGGA 3FHZA 2QVOA 2D45A 4EJOA 4A0XA 1U3EM 4BXUA 4ESJA 2Y75A 2O3FA 1XGSA 4L5IA 1MJ9A 3KETA 3I54A 5EEGA 3VEPA 4WXDA 2FU4A 1ZN2A 2FA5A 3ML6A 5K5OA 4OIQF 1P4AA 1BBYA 2OZUA 2ZO4A 2YX7A 4LK0F 1CF7A 5BPIA 3L7WA 1BN5A 1HKSA 3MCZA 4N0BA 3GF2A 1XDSA 1HXDA 5AONA 2YSRA 5HLGA 3QU3A 3E6BA 5E8GA 1KU2A 2WTEA 3J81K 3V4GA 3KCCA 4G9YA 1ZRCA 1B59A 5LGUA 1SMYF 4EVIA 1WKMA 2ESNA 4HLXA 3HRMA 1XN7A 3DPLC 3MEXA 4E70A 1R00A 2QZ8A 4OOIA 1GXQA 4JQFA 2NNYA 2DFIA 3M1EA 5BQTA 4ETSA 5D5UB 5K1YA 4RAYA 5DYMA 3MQ0A 2CSOA 4P5OA 1TW3A 2MD5A 1XSXA 2H27A 1XMAA 4XBFA 4MHGA 1AOYA 3KEOA 1FWZA 1KU7A 2EV6A 3ULQB 1FNNA 4HQMA 4G7OF 2A5YB 2L02A 3DFGA 2PG4A 1J2XA 5TJJA 5ED4A 2C6YA 1V3FA 3KP7A 3F3XA 2LF7A 4IRHA 5A2QK 5BMZA 1FP2A 4GYGA 3ZP5A 1SD6A 3QPTA 2MH9A 2PMUA 4S04A 3CUQB 5D6FA 4ZZLA 3IKTA 2V79A 4I98B 3V8LA 3P9KA 6PAXA 3VODA 5E1XA 2Y0MA 2JT1A 4L9JA 4UNOA 1BOAA 1TQIA 3DQVC 2VT3A 3HSFA 4KFCA 3FMRA 5LHIA 5LHGA 1IN6A 2CFXA 3MAJA 3E6DA 2V1UA 4KIFA 3F8BA 3W6KB 1BIBA 4ZYHA 2HYFA 3JTGA 4P55A 2E1NA 3HSRA 2A6EF 4I09A 1KGSA 2PMHA 3E5UA 3BPXA 1EH7A 3GEZA 4OIOF 1RI7A 3KP3A 1IXCA 4P9UA 4ZH4F 4MQ9F 5ILUA 3MZHA 3BDDA 1KQ0A 4M73A 1OYWA 1QGPA 2LSOA 4BQAA 3KP6A 4EM1A 3REOA 5ICEA 3CJNA 5D5VB 3HSEA 2PBIA 2VBWA 3T8RA 5DUKA 1UHWA 1REPC 3QRFF 2GZWA 4IPAA 1K78B 2FOKA 2HQRA 2STTA 2O03A 1BI2A 5JI6A 1O3QA 4L9VA 1U2WA 2FE3A 3HTSB 3GW2A 2EWNA 2HQNA 1LVAA 4U0YA 4HV6A 3EYYA 5DDGA 2IA0A 3SHFA 2Y48A 5HDKA 3K1MA 2FRHA 2A69F 3M8EA 2BGCA 2ETHA 3H92A 3O2PE 2ZFWA 4LD5A 1J5YA 5HDNA 3WGIA 4B8XA 3J7AO 3ECOA 4HF0A 3ISPA 3RYRA 1TNTA 2IPQX 4HF2A 3FXRA 5L3CA 1LJ9A 3E97A 3BOQA 3RYPA 1G3SA 1ZG3A 2VC0A 4A6DA 2COMA 3RDIA 4LLLA 5FGMA 5D8LB 1EH8A 1IXRC 5HVQC 2L4AA 4IRGA 5BOXA 1B4AA 3K1NA 1YW9A 1ZGJA 2VONA 3ELKA 2HGCA 2XAQA 3LA2A 1IN8A 4KNYA 1PUEE 5LGNA 1WWXA 3E3VA 3WGGA 1HSTA 5HS7A 3L09A 5LEKA 1IN5A 2X0LA 1ZG5A 1Z7UA 2W57A 1C0WA 2GXBA 5LRSA 5F6FA 3E6MA 1PP8F 1XGNA 1USSA 3MZYA 3QPHA 5TRDA 3WTTC 2STWA 1J75A 4LG0A 1J7KA 2CGPA 2V6CA 5FD5A 4KUMA 3E5XA 3ZMUA 2MA3A 2GQQA 1XD7A 2A3SA 2F5CA 2FBKA 1SAXA 1W7PD 1XCBA 2DK8A 2EV5A 1GHCA 5CVVA 1TBXA 1I27A 3M7GA 2HWVA 2O61A 4OINF 3GWZA 1NHAA 3R60A 2ELHA 4GGGA 4O3MA 2QENA 1QBJA 2XRNA 1LNWA 5BS6A 5JR3A 4M72A 2XUBA 2QQAA 4WXHA 1JHFA 4A5MA 2LF8A 2NAZA 3BZ6A 3HHHA 5HS9A 2XVCA 1D8KA 2BYVE 3L9FA 3HUGA 1MZBA 2E7XA 3GO5A 2RN7A 2MLGA 3H3ZA 4WF2A 1JXSA 1P4XA 4CO8A 3CUQC 1ZRDA 2QBYA 1YYVA 4MNUA 3TO6A 4ENJA 2P5KA 2EA2A 2OU2A 2AXLA 3EDPA 1O3RA 1IN4A 3R6SA 2V1XA 2IJLA 3L2CA 1MDMB 4HW0A 3GZ6A 4N9HA 3ZN1A 2UXXA 1J59A 2ISZA 1H9GA 3U9GA 5KVRA 2A6HF 4IHTA 3DF8A 1G6NA 4YFNF 2EFNA 3FM3A 5LHHA 3WTUC 2Z3YA 1KQ9A 3CO7C 5CYVA 4RS8A 3G3ZA 2XASA 3CO6C 3I4PA 2CG4A 1G3TA 3F6OA 2LNBA 3WG9A 5JFRA 2QQ9A 1IRFA 3I59B 4L9TA 2HKXA 2JRTA 1QNTA 1SD7A 2P6TA 5CVIA 4AD9A 4BYYA 1FOKA 4WXCA 1W7PB 1LB2A 1Y0UA 5JVTA 2QLZA 2DPUA 1IN7A 4RB2C 3C18A 2OD5A 4UV8A 2W84A 4EJTA 1Z6TA 2BV6A 2QBYB 5D6EA 3BP8A 4G94A 2Q0OA 3U2RA 4KT5C 2ZNZA 4ENMA 3FX3A 4HYEA 4R79A 1CF7B 1XGOA 1QPMA 3RKXA 5HDGA 3LA3A 1A04A 3F22A 4R8HA 1T98A 1FSHA 2GAUA 4HQEA 3Q9VA 1O7LA 4NB5A 2NRAC 5EEHA 1FSEA 1FYKA 2HKOA 1OYIA 1FYMA 4UXNA 1JGSA 2L54A 3WTYC 5L3DA 5LGTA 1QZYA 1TNSA 3VB2A 3L00A 1R1TA 1G3YA 3KP5A 3HYIA 2M30A 1L0OC 2XIGA 4YIIA 5DCMB 3J80Z 1P2FA 4UVBA 1O57A 4LG0B 1KQ8A 1QO0D 1HW2A 3ZMTA 4WX9A 1ZRFA 4CDGA 1FZPB 4HF1A 1EV7A 4AIKA 1R1UA 2PEXA 4O6JA 4DQ2A 2RDPA 3TKYA 4BHPA 1T6SA 3TO9A 5F64A 4LB6B 3EUHA 3F72A 1FBUA 4JK1X 3WGHA 5A2QZ 4S05A 2WWYA 2D1VA 3DV8A 3HIFA 1IUYA 2FSWA 1HBXG 4F7ZA 3C1DA 5D8KB 3HRUA 2O0YA 3RKYA 4EV0A 4EMSA 1J9IA 1S7OA 2XAHA 4A2UA 4HZFA 1U5TB 2FEZA 1GVJA 3RTRA 1YG2A 1HKQA 2M87A 4AIJA 5L3BA 1D8JA 4EQQA 1K7AA 3QP5A 4RB0A 5E8IA 2EJRA 2XAGA 3LA7A 1YO5C 3BPVA 2HEOA 1I5ZA 2DLLA 2K86A 3DXJF 3K9TA 4CICA 3I58A 2CWEA 2EK5A 3W6JB 3T1BA 2VE9A 3F23A 3HRTA 2EV0A 3IRRA 3LAJA 4ASNA 2W24A 4Q47A 4WCGA 1FLIA 2FNPA 3KEQA 2RKHA 1ZHFA 4ESFA 5J8FA 2DT5A 3TDZC 3WU1B 1S29A 3ERED 2DO7A 5FFXA 2L01A 2UWMA 4U7BA 3LAPA 3V8JA 1W5SA 4K2EA 2M1BA 3T0YA 2OQRA 3R0AA 1FYLA 3DPTA 5DD8A 3WTXC 2ESHA 1O3SA 5D4RA 2ZJ2A 5K5RA 1BJAA 3KLNA 1FPQA 1R7JA 2CW0F 2X4HA 2XAJA 1FBQA 5H6QA 4FX0A 4Y17A 2CYYA 2R7FA 3FMSA 4Q48A 1HKTA 1H0MA 4M6XA 3Q5FA 3I0TA 4RAZA 4HAMA 3S2WA 2MBFA 3GX4X 4UVAA 2Z9OA 2B0LA 2FXAA 4A0YA 5E17F 2AS5F 1Z05A 3GVAA 2RC4A 1GXPA 1F9NA 3K1PA 2EFQA 1L3LA 2FNAA 2HTJA 4CYDA 1LQ1A 2CO5A 1O7FA 3HRSA 2F5FA 4L18B 4LLNA 2ZMEB 4CGZA 3QU6A 2VODA 1G4DA 1LEBA 4RGXA 3IRQA 3BJAA 1I1SA 1TQPA 3I71A 4YG2F 1FP1D 2IA1A 4I7HA 1SD4A 3CDHA 4AWXB 4RB1A 4RGUA 4U88A 3K0LA 5DV5A 3GLXA 2VC1A 3JAMZ 1ULYA 1U6GA 1WQ2A 4BHBA 1UFMA 1XDUA 2R3SA 3TO7A 2BEOA 2MLKA 4RGSA 1DDNA 3B73A 3B02A 2LDUA 5J8CA 3SZPA 4B09A 1R23A 3PFIA 5DUIA 4YFKF 3IL2A 1F4KA 5FFZA 2P7CB 4MTEA 2WC2A 5LEJA 4HX4A 4Q5SF 1AWCA 1SFUA 4EJUA 4XLPF 1YFHA 3RKWA 3SXYA 4CZZA 4OIPF 3JW4A 1W5TA 4GCVA 2D1HA 1BC7C 4KN4X 4MGRA 1DP7P 1S7AA 2ISYA 2K4BA 3K69A 4A5NA 4BH9A 3RIRA 1P6RA 4L0YB 3BJ6A 3HOTA 4HV5A 1STZA 1J0RA 1Z9CA 3FXQA 1S8NA 1OKRA 2W25A 4I0AA 1IAWA 2DI3A 2Z5UA 1FY7A 4EJVA 2IVMA 1R1VA 1OMIA 1ON1A 3GYHX 3CUOA 3O6BB 5CVRA 2YPRA 1USTA 1ZG1A 2WV0A 3T5XA 1XGMA 3D0SA 1XMKA 1LEAA 5CJ9A 1CGPA 3KZYA 3ECHA 1KYZA 4HDVA 3VFZA 3I59A 3RI4A 1TQMA 4KIGA 3TOAA 2F5EA 4P9FA 4G8XA 2EFPA 1IW7F 1KU3A 4A12A 2O6GE 4I0BA 4G7HF 1W4MA 2VBYA 3WTVC 2MH2A 5HS8A 1YS6A 2VBXA 3FM5A 5HOOA 2YU3A 4N9IA 1ZAOA 1MDMA 2M8EA 2A68F 5L3GA 1D5VA 2Z33A 1SD5A 3GXOA 4Y13A 2NYXA 3LQQA 1FC3A 1MKMA 4XSXF 4IXAA 2JPBA 1OYYA 3IC7A 3BWGA 1S3JA 2DQRA 3KFWX 2ZXJA 1MD0A 4HX8A 2PI0A 4P96A 1UB9A 4FT8A 1E17A 1HW1A 3T8TA 2RQPA 3Q9SA 4M9XA 3GUDA 2DQLA 1T0FA 3IWFA 4I2OA 4IF4A 4QLCU 5ICFA 5IT9K 2NNNA 2P8TA 4KMUX 2HYGD 2H94A 1UHMA 2VT2A 2ACJA 3AAFA 2KIMA 1UCRA 2A07F 1DUXC 5D4SA 2KKOA 1BI0A 3F8CA 3DKWA 1DPUA 1F5TA 2KIFA 4U0WA 1YW8A 3F6VA 2D2WA 4PZJA 5ICCA 3TQNA 3V7SA 4HA8A 2G7HA 2RVCA 2P7VB 3HTUA 4EGZA 2RV8A 5D5XB 3LQRA 5LLQA 1U78A 2J5OA 4G6DA 4EGYA 2ZBKA 2DTRA 3LSTA 1LDJA 3TDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DW4 A;  3LWF A;  3GFI A;  2GA1 A;  4MTD A;  4R1H A;  1XB4 A;  1K6O A;  3J81 Z;  2KIU A;  3FF5 A;  2PJP A;  4UHT A;  3I64 A;  5E1W A;  4G7Z F;  3F8N A;  1ZH5 A;  4DNC A;  2VXZ A;  3JSO A;  3ZMV A;  2KJC A;  3CUQ A;  2MC3 A;  4ENK A;  2GIV A;  3EQL F;  4BNC A;  4AVP A;  2Z99 A;  3HHG A;  2K27 A;  2TDX A;  3JSP A;  1MJB A;  3TGN A;  4UV9 A;  4HBL A;  3FXU A;  4OIR F;  5L3F A;  4L9N A;  2EFO A;  1R5H A;  4LGW A;  2XKP A;  2QM3 A;  1TLH B;  1JHH A;  4A6E A;  1B9M A;  2L4M A;  2O8X A;  4L0Z B;  1Q1H A;  4KIB A;  1HQC A;  3EET A;  3IWZ A;  2GWR A;  3BRO A;  2HS5 A;  1HSJ A;  4NHJ A;  3BJO A;  3R61 A;  3C3W A;  3H3U A;  5H6R A;  2UZK A;  2YR2 A;  3PQJ A;  3LFK A;  2K7L A;  1WI9 A;  4L5J A;  2HTS A;  1SFX A;  3JTH A;  4I01 A;  4M6Y A;  3NEU A;  1T2K A;  1D3Y A;  5CLS A;  4ZZD A;  4YIF A;  1WRJ A;  4LMY A;  3WU0 A;  1Z6R A;  1U5T C;  2GA2 A;  1ONV A;  4CXF A;  2H6B A;  4XLN F;  4NQW A;  4UVC A;  1IRG A;  1ODD A;  4OU0 A;  2IP2 A;  5AIP A;  3RPQ A;  3I53 A;  2F5D A;  5LRR A;  1BI1 A;  1S6L A;  3GFJ A;  1K78 A;  3P7N A;  2G9W A;  1IXS B;  2KJB A;  4GXO A;  3CTA A;  4A0Z A;  4KDP A;  3MFK A;  2EFW A;  3NQO A;  2FF4 A;  1YLF A;  5FLX Z;  5LBQ A;  4YFX F;  5J6X A;  4BHC A;  5E18 F;  1Z91 A;  2Q2E A;  3O3K A;  2FMY A;  1TTY A;  1W7P A;  4KN7 X;  2XRO A;  3KP2 A;  2VBZ A;  2OAZ A;  4CHU A;  1ZGA A;  4WK8 F;  1I6X A;  3R4K A;  4M9Z A;  4ENN A;  1EH6 A;  3KZZ A;  2VN2 A;  4PCQ A;  5FB2 A;  5CVU A;  3ZMS A;  2J5P A;  3COA C;  1QQI A;  1RNL A;  2ZNY A;  1IZ1 A;  3OOP A;  4ZYG A;  2BBY A;  5DD4 A;  2VOO A;  4IVN A;  2H6C A;  3V7R A;  4UUV A;  3TOB A;  2DPD A;  4XSZ F;  2E7W A;  3E6C C;  4QWQ A;  3ZMD A;  2ZKZ A;  2OA4 A;  3EYI A;  4U7D A;  2EB7 A;  1LDK B;  5L3E A;  1E2X A;  3RPU A;  1ZAR A;  3V8K A;  1QZZ A;  1PDN C;  1PP7 U;  2HOE A;  3QOP A;  1WSU A;  4OMZ A;  1RZ4 A;  3ZPL A;  5ICG A;  1MGT A;  1FT9 A;  3KP4 A;  4LB5 A;  1HW5 A;  2ADU A;  5K5Q A;  1Z1D A;  2FQ3 A;  1ZYR F;  5ILS A;  3BY6 A;  4FHT A;  2QYO A;  3K2Z A;  2XKO A;  1XCV A;  2HZT A;  2XHK A;  3I5U A;  5DCM A;  1I1G A;  1R22 A;  1TW2 A;  4MEX F;  3PQK A;  3F8M A;  4IRI A;  3M8F A;  1XSV A;  3IKV A;  2RNJ A;  3RJP A;  4M71 A;  1R5G A;  2RGV A;  5AIQ A;  1BIA A;  1ZLK A;  4PDK A;  3WTW C;  3MWM A;  3V7C A;  1O3T A;  1R58 A;  4ESB A;  2IT0 A;  2G7U A;  5DEQ A;  5ERI A;  3WE2 A;  2K02 A;  4AIH A;  2JPC A;  3N4M A;  3M9A A;  4D0P A;  1BI3 A;  3J80 K;  1F1Z A;  3ZQ7 A;  4TV7 A;  1SFE A;  2LKP A;  5H20 A;  1V4R A;  5FLX K;  1YTY A;  4ZYD A;  4IHS A;  4KYW A;  3P9I A;  2XV4 S;  1MJA A;  2Q8K A;  4H0E A;  4PGH A;  2E1C A;  1LDD A;  2QQB A;  3JAM K;  3HOS A;  4GYI A;  2ZME A;  1OR7 A;  2W85 A;  1YQA A;  2M45 A;  2R7D A;  3KLO A;  3NRV A;  1KA8 A;  1KU9 A;  2UXN A;  1YIO A;  3ABU A;  2DBB A;  4ON0 A;  2HR3 A;  1G3W A;  2ZCW A;  3WTZ A;  3U1D A;  5IT9 Z;  3N97 A;  2P5L C;  1B9N A;  2HDC A;  2JTV A;  5JHU A;  5DCF A;  3ROU A;  5E20 A;  2QUF A;  5E1Z B;  5HLH A;  4Q4Z F;  5F1R A;  3WOD F;  4EM0 B;  4BAY A;  2PLY A;  5D5W B;  2DAO A;  2NS0 A;  4LLG F;  2PFB A;  1X3U A;  3E5Q A;  3GFL A;  3C7J A;  4KIC A;  2JZY A;  2VE8 A;  2DK5 A;  1SMT A;  2YX4 A;  1BC8 C;  4WWC A;  4HDU A;  1KYW A;  3SZT A;  2GXG A;  5CVJ A;  2F2E A;  3SFZ A;  3WTS C;  2V1D A;  3QP6 A;  2IW5 A;  2HFH A;  3IHU A;  2DU9 A;  1IF1 A;  3CLO A;  4KMF A;  3ZMZ A;  1P92 A;  4IJA A;  1T38 A;  4JBA A;  1B1B A;  1YW7 A;  2OZ6 A;  4M9S A;  3D5L A;  4MEY F;  1YS7 A;  3ABT A;  2P6S A;  2FML A;  3OV8 A;  2V9V A;  4RGR A;  4Y15 A;  5KK1 A;  5IT3 A;  3SQN A;  1XSD A;  2FBI A;  4HOB A;  4KA4 A;  1DPR A;  5BPD A;  3G73 A;  3VOE A;  4RB3 C;  2H09 A;  2JSC A;  1U8R A;  1P4W A;  1OPC A;  1ZLJ A;  4O5V A;  2IRF G;  3GZ5 A;  4GO1 A;  2XGX A;  3FZV A;  4LJZ F;  3QAH A;  2PQ8 A;  2QWW A;  3P9C A;  1H9T A;  4LK1 F;  4XRF A;  1U5T A;  2L3D A;  1RUN A;  3R0J A;  4I02 A;  3F21 A;  2A61 A;  3FMQ A;  3DP7 A;  5FD6 A;  2CQK A;  2XAF A;  1R36 A;  4LFU A;  1B6A A;  2IA2 A;  4Z2Y A;  4HX7 A;  1T39 A;  1FX7 A;  2PN6 A;  4ZYE A;  1VTN C;  4HLY A;  3KE2 A;  2VOP A;  2OBP A;  4U0V A;  2M5W A;  5ILV A;  4G6Q A;  3F8F A;  3FWE A;  4EM2 A;  2FBH A;  2OQG A;  4EJW A;  5HLI A;  2P4W A;  1ZRE A;  1BM9 A;  3WE3 A;  3DEU A;  5FO5 A;  3ZN0 A;  4MQV A;  1FBS A;  1K79 A;  1ON2 A;  2BE5 F;  4FX4 A;  1RIO H;  1JE8 A;  1RUO A;  4M74 A;  3GFM A;  2EA4 A;  4OMY A;  2P5V A;  2K4J A;  2KRF A;  4PGG A;  3FHZ A;  2QVO A;  2D45 A;  4EJO A;  4A0X A;  1U3E M;  4BXU A;  4ESJ A;  2Y75 A;  2O3F A;  1XGS A;  4L5I A;  1MJ9 A;  3KET A;  3I54 A;  5EEG A;  3VEP A;  4WXD A;  2FU4 A;  1ZN2 A;  2FA5 A;  3ML6 A;  5K5O A;  4OIQ F;  1P4A A;  1BBY A;  2OZU A;  2ZO4 A;  2YX7 A;  4LK0 F;  1CF7 A;  5BPI A;  3L7W A;  1BN5 A;  1HKS A;  3MCZ A;  4N0B A;  3GF2 A;  1XDS A;  1HXD A;  5AON A;  2YSR A;  5HLG A;  3QU3 A;  3E6B A;  5E8G A;  1KU2 A;  2WTE A;  3J81 K;  3V4G A;  3KCC A;  4G9Y A;  1ZRC A;  1B59 A;  5LGU A;  1SMY F;  4EVI A;  1WKM A;  2ESN A;  4HLX A;  3HRM A;  1XN7 A;  3DPL C;  3MEX A;  4E70 A;  1R00 A;  2QZ8 A;  4OOI A;  1GXQ A;  4JQF A;  2NNY A;  2DFI A;  3M1E A;  5BQT A;  4ETS A;  5D5U B;  5K1Y A;  4RAY A;  5DYM A;  3MQ0 A;  2CSO A;  4P5O A;  1TW3 A;  2MD5 A;  1XSX A;  2H27 A;  1XMA A;  4XBF A;  4MHG A;  1AOY A;  3KEO A;  1FWZ A;  1KU7 A;  2EV6 A;  3ULQ B;  1FNN A;  4HQM A;  4G7O F;  2A5Y B;  2L02 A;  3DFG A;  2PG4 A;  1J2X A;  5TJJ A;  5ED4 A;  2C6Y A;  1V3F A;  3KP7 A;  3F3X A;  2LF7 A;  4IRH A;  5A2Q K;  5BMZ A;  1FP2 A;  4GYG A;  3ZP5 A;  1SD6 A;  3QPT A;  2MH9 A;  2PMU A;  4S04 A;  3CUQ B;  5D6F A;  4ZZL A;  3IKT A;  2V79 A;  4I98 B;  3V8L A;  3P9K A;  6PAX A;  3VOD A;  5E1X A;  2Y0M A;  2JT1 A;  4L9J A;  4UNO A;  1BOA A;  1TQI A;  3DQV C;  2VT3 A;  3HSF A;  4KFC A;  3FMR A;  5LHI A;  5LHG A;  1IN6 A;  2CFX A;  3MAJ A;  3E6D A;  2V1U A;  4KIF A;  3F8B A;  3W6K B;  1BIB A;  4ZYH A;  2HYF A;  3JTG A;  4P55 A;  2E1N A;  3HSR A;  2A6E F;  4I09 A;  1KGS A;  2PMH A;  3E5U A;  3BPX A;  1EH7 A;  3GEZ A;  4OIO F;  1RI7 A;  3KP3 A;  1IXC A;  4P9U A;  4ZH4 F;  4MQ9 F;  5ILU A;  3MZH A;  3BDD A;  1KQ0 A;  4M73 A;  1OYW A;  1QGP A;  2LSO A;  4BQA A;  3KP6 A;  4EM1 A;  3REO A;  5ICE A;  3CJN A;  5D5V B;  3HSE A;  2PBI A;  2VBW A;  3T8R A;  5DUK A;  1UHW A;  1REP C;  3QRF F;  2GZW A;  4IPA A;  1K78 B;  2FOK A;  2HQR A;  2STT A;  2O03 A;  1BI2 A;  5JI6 A;  1O3Q A;  4L9V A;  1U2W A;  2FE3 A;  3HTS B;  3GW2 A;  2EWN A;  2HQN A;  1LVA A;  4U0Y A;  4HV6 A;  3EYY A;  5DDG A;  2IA0 A;  3SHF A;  2Y48 A;  5HDK A;  3K1M A;  2FRH A;  2A69 F;  3M8E A;  2BGC A;  2ETH A;  3H92 A;  3O2P E;  2ZFW A;  4LD5 A;  1J5Y A;  5HDN A;  3WGI A;  4B8X A;  3J7A O;  3ECO A;  4HF0 A;  3ISP A;  3RYR A;  1TNT A;  2IPQ X;  4HF2 A;  3FXR A;  5L3C A;  1LJ9 A;  3E97 A;  3BOQ A;  3RYP A;  1G3S A;  1ZG3 A;  2VC0 A;  4A6D A;  2COM A;  3RDI A;  4LLL A;  5FGM A;  5D8L B;  1EH8 A;  1IXR C;  5HVQ C;  2L4A A;  4IRG A;  5BOX A;  1B4A A;  3K1N A;  1YW9 A;  1ZGJ A;  2VON A;  3ELK A;  2HGC A;  2XAQ A;  3LA2 A;  1IN8 A;  4KNY A;  1PUE E;  5LGN A;  1WWX A;  3E3V A;  3WGG A;  1HST A;  5HS7 A;  3L09 A;  5LEK A;  1IN5 A;  2X0L A;  1ZG5 A;  1Z7U A;  2W57 A;  1C0W A;  2GXB A;  5LRS A;  5F6F A;  3E6M A;  1PP8 F;  1XGN A;  1USS A;  3MZY A;  3QPH A;  5TRD A;  3WTT C;  2STW A;  1J75 A;  4LG0 A;  1J7K A;  2CGP A;  2V6C A;  5FD5 A;  4KUM A;  3E5X A;  3ZMU A;  2MA3 A;  2GQQ A;  1XD7 A;  2A3S A;  2F5C A;  2FBK A;  1SAX A;  1W7P D;  1XCB A;  2DK8 A;  2EV5 A;  1GHC A;  5CVV A;  1TBX A;  1I27 A;  3M7G A;  2HWV A;  2O61 A;  4OIN F;  3GWZ A;  1NHA A;  3R60 A;  2ELH A;  4GGG A;  4O3M A;  2QEN A;  1QBJ A;  2XRN A;  1LNW A;  5BS6 A;  5JR3 A;  4M72 A;  2XUB A;  2QQA A;  4WXH A;  1JHF A;  4A5M A;  2LF8 A;  2NAZ A;  3BZ6 A;  3HHH A;  5HS9 A;  2XVC A;  1D8K A;  2BYV E;  3L9F A;  3HUG A;  1MZB A;  2E7X A;  3GO5 A;  2RN7 A;  2MLG A;  3H3Z A;  4WF2 A;  1JXS A;  1P4X A;  4CO8 A;  3CUQ C;  1ZRD A;  2QBY A;  1YYV A;  4MNU A;  3TO6 A;  4ENJ A;  2P5K A;  2EA2 A;  2OU2 A;  2AXL A;  3EDP A;  1O3R A;  1IN4 A;  3R6S A;  2V1X A;  2IJL A;  3L2C A;  1MDM B;  4HW0 A;  3GZ6 A;  4N9H A;  3ZN1 A;  2UXX A;  1J59 A;  2ISZ A;  1H9G A;  3U9G A;  5KVR A;  2A6H F;  4IHT A;  3DF8 A;  1G6N A;  4YFN F;  2EFN A;  3FM3 A;  5LHH A;  3WTU C;  2Z3Y A;  1KQ9 A;  3CO7 C;  5CYV A;  4RS8 A;  3G3Z A;  2XAS A;  3CO6 C;  3I4P A;  2CG4 A;  1G3T A;  3F6O A;  2LNB A;  3WG9 A;  5JFR A;  2QQ9 A;  1IRF A;  3I59 B;  4L9T A;  2HKX A;  2JRT A;  1QNT A;  1SD7 A;  2P6T A;  5CVI A;  4AD9 A;  4BYY A;  1FOK A;  4WXC A;  1W7P B;  1LB2 A;  1Y0U A;  5JVT A;  2QLZ A;  2DPU A;  1IN7 A;  4RB2 C;  3C18 A;  2OD5 A;  4UV8 A;  2W84 A;  4EJT A;  1Z6T A;  2BV6 A;  2QBY B;  5D6E A;  3BP8 A;  4G94 A;  2Q0O A;  3U2R A;  4KT5 C;  2ZNZ A;  4ENM A;  3FX3 A;  4HYE A;  4R79 A;  1CF7 B;  1XGO A;  1QPM A;  3RKX A;  5HDG A;  3LA3 A;  1A04 A;  3F22 A;  4R8H A;  1T98 A;  1FSH A;  2GAU A;  4HQE A;  3Q9V A;  1O7L A;  4NB5 A;  2NRA C;  5EEH A;  1FSE A;  1FYK A;  2HKO A;  1OYI A;  1FYM A;  4UXN A;  1JGS A;  2L54 A;  3WTY C;  5L3D A;  5LGT A;  1QZY A;  1TNS A;  3VB2 A;  3L00 A;  1R1T A;  1G3Y A;  3KP5 A;  3HYI A;  2M30 A;  1L0O C;  2XIG A;  4YII A;  5DCM B;  3J80 Z;  1P2F A;  4UVB A;  1O57 A;  4LG0 B;  1KQ8 A;  1QO0 D;  1HW2 A;  3ZMT A;  4WX9 A;  1ZRF A;  4CDG A;  1FZP B;  4HF1 A;  1EV7 A;  4AIK A;  1R1U A;  2PEX A;  4O6J A;  4DQ2 A;  2RDP A;  3TKY A;  4BHP A;  1T6S A;  3TO9 A;  5F64 A;  4LB6 B;  3EUH A;  3F72 A;  1FBU A;  4JK1 X;  3WGH A;  5A2Q Z;  4S05 A;  2WWY A;  2D1V A;  3DV8 A;  3HIF A;  1IUY A;  2FSW A;  1HBX G;  4F7Z A;  3C1D A;  5D8K B;  3HRU A;  2O0Y A;  3RKY A;  4EV0 A;  4EMS A;  1J9I A;  1S7O A;  2XAH A;  4A2U A;  4HZF A;  1U5T B;  2FEZ A;  1GVJ A;  3RTR A;  1YG2 A;  1HKQ A;  2M87 A;  4AIJ A;  5L3B A;  1D8J A;  4EQQ A;  1K7A A;  3QP5 A;  4RB0 A;  5E8I A;  2EJR A;  2XAG A;  3LA7 A;  1YO5 C;  3BPV A;  2HEO A;  1I5Z A;  2DLL A;  2K86 A;  3DXJ F;  3K9T A;  4CIC A;  3I58 A;  2CWE A;  2EK5 A;  3W6J B;  3T1B A;  2VE9 A;  3F23 A;  3HRT A;  2EV0 A;  3IRR A;  3LAJ A;  4ASN A;  2W24 A;  4Q47 A;  4WCG A;  1FLI A;  2FNP A;  3KEQ A;  2RKH A;  1ZHF A;  4ESF A;  5J8F A;  2DT5 A;  3TDZ C;  3WU1 B;  1S29 A;  3ERE D;  2DO7 A;  5FFX A;  2L01 A;  2UWM A;  4U7B A;  3LAP A;  3V8J A;  1W5S A;  4K2E A;  2M1B A;  3T0Y A;  2OQR A;  3R0A A;  1FYL A;  3DPT A;  5DD8 A;  3WTX C;  2ESH A;  1O3S A;  5D4R A;  2ZJ2 A;  5K5R A;  1BJA A;  3KLN A;  1FPQ A;  1R7J A;  2CW0 F;  2X4H A;  2XAJ A;  1FBQ A;  5H6Q A;  4FX0 A;  4Y17 A;  2CYY A;  2R7F A;  3FMS A;  4Q48 A;  1HKT A;  1H0M A;  4M6X A;  3Q5F A;  3I0T A;  4RAZ A;  4HAM A;  3S2W A;  2MBF A;  3GX4 X;  4UVA A;  2Z9O A;  2B0L A;  2FXA A;  4A0Y A;  5E17 F;  2AS5 F;  1Z05 A;  3GVA A;  2RC4 A;  1GXP A;  1F9N A;  3K1P A;  2EFQ A;  1L3L A;  2FNA A;  2HTJ A;  4CYD A;  1LQ1 A;  2CO5 A;  1O7F A;  3HRS A;  2F5F A;  4L18 B;  4LLN A;  2ZME B;  4CGZ A;  3QU6 A;  2VOD A;  1G4D A;  1LEB A;  4RGX A;  3IRQ A;  3BJA A;  1I1S A;  1TQP A;  3I71 A;  4YG2 F;  1FP1 D;  2IA1 A;  4I7H A;  1SD4 A;  3CDH A;  4AWX B;  4RB1 A;  4RGU A;  4U88 A;  3K0L A;  5DV5 A;  3GLX A;  2VC1 A;  3JAM Z;  1ULY A;  1U6G A;  1WQ2 A;  4BHB A;  1UFM A;  1XDU A;  2R3S A;  3TO7 A;  2BEO A;  2MLK A;  4RGS A;  1DDN A;  3B73 A;  3B02 A;  2LDU A;  5J8C A;  3SZP A;  4B09 A;  1R23 A;  3PFI A;  5DUI A;  4YFK F;  3IL2 A;  1F4K A;  5FFZ A;  2P7C B;  4MTE A;  2WC2 A;  5LEJ A;  4HX4 A;  4Q5S F;  1AWC A;  1SFU A;  4EJU A;  4XLP F;  1YFH A;  3RKW A;  3SXY A;  4CZZ A;  4OIP F;  3JW4 A;  1W5T A;  4GCV A;  2D1H A;  1BC7 C;  4KN4 X;  4MGR A;  1DP7 P;  1S7A A;  2ISY A;  2K4B A;  3K69 A;  4A5N A;  4BH9 A;  3RIR A;  1P6R A;  4L0Y B;  3BJ6 A;  3HOT A;  4HV5 A;  1STZ A;  1J0R A;  1Z9C A;  3FXQ A;  1S8N A;  1OKR A;  2W25 A;  4I0A A;  1IAW A;  2DI3 A;  2Z5U A;  1FY7 A;  4EJV A;  2IVM A;  1R1V A;  1OMI A;  1ON1 A;  3GYH X;  3CUO A;  3O6B B;  5CVR A;  2YPR A;  1UST A;  1ZG1 A;  2WV0 A;  3T5X A;  1XGM A;  3D0S A;  1XMK A;  1LEA A;  5CJ9 A;  1CGP A;  3KZY A;  3ECH A;  1KYZ A;  4HDV A;  3VFZ A;  3I59 A;  3RI4 A;  1TQM A;  4KIG A;  3TOA A;  2F5E A;  4P9F A;  4G8X A;  2EFP A;  1IW7 F;  1KU3 A;  4A12 A;  2O6G E;  4I0B A;  4G7H F;  1W4M A;  2VBY A;  3WTV C;  2MH2 A;  5HS8 A;  1YS6 A;  2VBX A;  3FM5 A;  5HOO A;  2YU3 A;  4N9I A;  1ZAO A;  1MDM A;  2M8E A;  2A68 F;  5L3G A;  1D5V A;  2Z33 A;  1SD5 A;  3GXO A;  4Y13 A;  2NYX A;  3LQQ A;  1FC3 A;  1MKM A;  4XSX F;  4IXA A;  2JPB A;  1OYY A;  3IC7 A;  3BWG A;  1S3J A;  2DQR A;  3KFW X;  2ZXJ A;  1MD0 A;  4HX8 A;  2PI0 A;  4P96 A;  1UB9 A;  4FT8 A;  1E17 A;  1HW1 A;  3T8T A;  2RQP A;  3Q9S A;  4M9X A;  3GUD A;  2DQL A;  1T0F A;  3IWF A;  4I2O A;  4IF4 A;  4QLC U;  5ICF A;  5IT9 K;  2NNN A;  2P8T A;  4KMU X;  2HYG D;  2H94 A;  1UHM A;  2VT2 A;  2ACJ A;  3AAF A;  2KIM A;  1UCR A;  2A07 F;  1DUX C;  5D4S A;  2KKO A;  1BI0 A;  3F8C A;  3DKW A;  1DPU A;  1F5T A;  2KIF A;  4U0W A;  1YW8 A;  3F6V A;  2D2W A;  4PZJ A;  5ICC A;  3TQN A;  3V7S A;  4HA8 A;  2G7H A;  2RVC A;  2P7V B;  3HTU A;  4EGZ A;  2RV8 A;  5D5X B;  3LQR A;  5LLQ A;  1U78 A;  2J5O A;  4G6D A;  4EGY A;  2ZBK A;  2DTR A;  3LST A;  1LDJ A;  3TDU C; 
#chains in the Genus database with same CATH topology
 2BHY A;  2VJJ A;  2DW4 A;  3LWF A;  3GFI A;  2GA1 A;  4MTD A;  4R1H A;  4ABZ A;  1XB4 A;  2VXD A;  3BG9 A;  1K6O A;  3J81 Z;  2DJI A;  3HOW J;  2KIU A;  3FF5 A;  2COB A;  2PJP A;  5J3L A;  2NVT J;  2WAQ A;  4UHT A;  3I64 A;  5E1W A;  1P7J A;  1X3W B;  4G7Z F;  2NOJ B;  4IQ4 A;  3F8N A;  1K6Y A;  1OCR H;  5B66 C;  1ZH5 A;  4DNC A;  2VXZ A;  2L9S A;  3PSI A;  4XLH A;  2QSH X;  2CQQ A;  3JSO A;  3ZMV A;  2KJC A;  3CUQ A;  2MC3 A;  1VQ9 I;  1Z3Y A;  3TP3 A;  4ENK A;  2GIV A;  1RC9 A;  2MAB A;  3EQL F;  4BNC A;  3SYT A;  4AVP A;  2IGO A;  2ME0 A;  2OUM A;  2Z99 A;  3HHG A;  5C4X J;  2K27 A;  2OTL I;  5B1B H;  2TDX A;  2E2I J;  3JSP A;  3MKY B;  1MMD A;  1MJB A;  3PFY A;  4OAZ A;  4UV9 A;  4HBL A;  3FXU A;  3TGN A;  4F52 A;  2HPM A;  4OIR F;  5L3F A;  4L9N A;  2EFO A;  2VB6 A;  1R5H A;  3WU2 C;  2QEX I;  3CES A;  1HLV A;  4LGW A;  2XKP A;  2QM3 A;  3S1Q J;  3HOX J;  1TLH B;  1LE8 B;  4NBQ A;  4IHW A;  1VQ8 I;  1UG2 A;  1JHH A;  4A6E A;  3BTJ A;  1QVT A;  1B9M A;  1Z77 A;  2L4M A;  3SJM A;  2O8X A;  4JX6 A;  2LBF A;  2L5Q A;  1Y1W J;  4L0Z B;  1Q1H A;  4KIB A;  1HQC A;  3EET A;  3IWZ A;  2GWR A;  3BRO A;  5KAF C;  2HS5 A;  3FXM A;  1HSJ A;  4NHJ A;  5BNG A;  3BJO A;  3R61 A;  1LUJ B;  2DA5 A;  1BL0 A;  3LSJ A;  2DOE A;  2HDD A;  1FEX A;  3S93 A;  2E35 A;  1JI8 A;  4BL0 B;  3C3W A;  3H3U A;  5H6R A;  2NVU B;  1UG0 A;  4PUS A;  2UZK A;  1U9O A;  1FOW A;  4I6Z A;  2YR2 A;  3PQJ A;  3LFK A;  2K7L A;  1NG6 A;  4LOC A;  1WI9 A;  1WFX A;  4L5J A;  1SVO A;  2HTS A;  2WY7 Q;  3WHB A;  3EUA A;  1SFX A;  2LYC A;  4E7H A;  1A5J A;  3JTH A;  5IP6 A;  3HDD A;  1QPI A;  3Q0V A;  4I01 A;  4M6Y A;  3NEU A;  1T2K A;  4XLE A;  5J1R A;  2ME6 A;  1D3Y A;  5CLS A;  4MO7 A;  4CYC B;  4ZZD A;  3BG5 A;  1WRJ A;  4LMY A;  4YIF A;  3WU0 A;  1Z6R A;  1U5T C;  3MVP A;  4PJN A;  2GA2 A;  3OYH A;  5K7Z A;  1ONV A;  4CXF A;  1AHD P;  3FKI J;  1SEU A;  2H6B A;  1N77 A;  4XLN F;  4NQW A;  4BQN A;  2XGE A;  1HDD C;  4UVC A;  3OOU A;  4CCL A;  3FBI B;  1R4N B;  4BKX A;  2KP6 A;  4ZDP A;  3IH4 A;  3QYB A;  4XKW A;  1DGW Y;  1IRG A;  1ODD A;  2JN6 A;  4BBS J;  3QQA A;  4OU0 A;  2IP2 A;  5AIP A;  3RPQ A;  2WB1 A;  3I53 A;  1T56 A;  3FBN B;  3W2W A;  2F5D A;  1VFC A;  3A4C A;  5LRR A;  1BI1 A;  3PIP F;  3S2D J;  1S6L A;  3GFJ A;  3L2Q A;  1K78 A;  3P7N A;  5E3M A;  2G9W A;  1IXS B;  3DBL B;  2KJB A;  3J7A Y;  3LNQ A;  4GXO A;  3CTA A;  4A0Z A;  3G71 I;  4KDP A;  3MFK A;  2EFW A;  3NQO A;  3J7Z I;  4A3B J;  2FF4 A;  4II3 A;  3ABM H;  1YLF A;  5FLX Z;  5LBQ A;  1VQO I;  4YFX F;  4NC7 A;  3GLL A;  5J6X A;  4BHC A;  5E18 F;  1Z91 A;  2ELJ A;  2Q2E A;  2HOA A;  3O3K A;  4M3B A;  2FMY A;  2V1N A;  1TTY A;  1W7P A;  2EIK H;  4KN7 X;  2XRO A;  3KP2 A;  2WAD A;  2VBZ A;  1H89 C;  3D1N I;  3DEW A;  1QA6 A;  2OAZ A;  4CHU A;  3BR2 A;  3TBI A;  1ZGA A;  2K9Q A;  4WK8 F;  3HPG A;  2JMW A;  1I6X A;  1MND A;  1TT5 B;  1VQ4 I;  3PSF A;  3R4K A;  4M9Z A;  4ENN A;  1EH6 A;  3KZZ A;  2VN2 A;  3PNV A;  2OC6 A;  4M6V A;  4PCQ A;  5FB2 A;  2CW8 A;  1MH4 A;  5CVU A;  3S3N A;  1MH3 A;  3ZMS A;  2LY9 A;  2J5P A;  5C44 J;  3COA C;  4P1W A;  2X6W A;  2LH9 A;  3DTK A;  2XAU A;  1QQI A;  4E7J A;  5GTI C;  2R5Z A;  3L2V A;  2DA1 A;  1RNL A;  2ZNY A;  5CQE A;  1PJR A;  4XRS A;  1IZ1 A;  1Q1V A;  2UUZ A;  4HNV A;  2P81 A;  2VAS A;  3OOP A;  4ZYG A;  2BBY A;  4D1Q A;  5DD4 A;  3BTC A;  3TW7 A;  4HNT A;  2MSY A;  2VOO A;  4IVN A;  1BW5 A;  4MFE A;  2H6C A;  4E7L A;  2E1M B;  3V7R A;  4PJ0 C;  2VPR A;  4UUV A;  3OYA A;  3TOB A;  2QF7 A;  2A6T A;  2DPD A;  4Y3O A;  4XSZ F;  2DT6 A;  2E7W A;  4XKC A;  4XOT A;  1W0T A;  2LLK A;  4IHX A;  3E6C C;  4D7M A;  5JLW A;  2IS1 A;  2EBI A;  4PJM A;  2ZJP F;  3A02 A;  4F3Q A;  4MLO A;  4QWQ A;  3ZMD A;  2ZKZ A;  2OA4 A;  2P0W A;  1ZEL A;  1B8I B;  1LFP A;  3OMY A;  3EYI A;  4U7D A;  2EB7 A;  1LDK B;  4G12 A;  5L3E A;  1E2X A;  3RPU A;  3M4O J;  1X19 A;  1ZAR A;  2MFZ A;  3V8K A;  2PJR A;  3K4C A;  2PMZ A;  3M07 A;  2UV1 A;  1QZZ A;  4E7I A;  1PDN C;  4LIT A;  3RQI A;  3HKZ A;  1MSF C;  2GXA A;  2HOE A;  3FK6 A;  3QOP A;  3ZQH A;  1PP7 U;  1WSU A;  4OMZ A;  2EIJ H;  1RZ4 A;  3ZPL A;  2NS7 A;  5ICG A;  1MGT A;  2DYR H;  2WV1 A;  1V5E A;  3GTG J;  1FT9 A;  2DT7 B;  2KT0 A;  1UEL B;  3KP4 A;  5HNF A;  4LB5 A;  1HW5 A;  2ADU A;  5K5Q A;  1YX5 A;  2R7Q A;  1JUP A;  1Z1D A;  2FQ3 A;  2KZV A;  4RMN A;  1ZYR F;  1P9Q C;  1K4T A;  5ILS A;  3DLA A;  1YJW I;  4OAY A;  4CCK A;  1G8X A;  3ASN H;  3BY6 A;  1Y8R B;  2VJ5 A;  4FHT A;  2OJE D;  4BXX J;  2QYO A;  1A6I A;  1SC7 A;  5TIS C;  2R92 J;  3OYM A;  3K2Z A;  1FOY A;  2XKO A;  3OYG A;  1XCV A;  5J47 A;  3I4M J;  3LL7 A;  2HZT A;  2XHK A;  3I5U A;  2ICW G;  2QGU A;  5DCM A;  1I1G A;  1R22 A;  1TW2 A;  4MEX F;  1RR8 C;  3PQK A;  4BEH A;  2V26 A;  1A6Q A;  2EZH A;  2MC4 A;  2OCE A;  3F8M A;  3M8F A;  4IRI A;  1XSV A;  1MW7 A;  3IKV A;  2ZJR F;  2WAQ N;  5EF6 A;  2DMT A;  2RNJ A;  3RJP A;  2AHQ A;  2HXO A;  2VKE A;  2VQC A;  2X85 A;  4M71 A;  3CC2 I;  1R5G A;  3CCU I;  2RGV A;  1ETX A;  5F0F A;  5AIQ A;  2ZME C;  4YEL A;  2IBD A;  4FE7 A;  4CCO A;  5J1Y A;  9ANT A;  3FDY A;  1BIA A;  1ZLK A;  1V55 H;  3M8J A;  1ETY A;  4PDK A;  3WTW C;  3MWM A;  3V7C A;  2LKS A;  1O3T A;  1R58 A;  4B4C A;  4ESB A;  2GOM A;  2G7U A;  2IT0 A;  5DEQ A;  1Y6I A;  5ERI A;  3K2A A;  5FRM A;  3VSK A;  3SZG A;  3WE2 A;  3H0D A;  2K02 A;  5F0H A;  3HL2 A;  3CCL I;  4AIH A;  2JPC A;  3N4M A;  3M9A A;  1XX5 A;  4D0P A;  3QYE A;  3MN2 A;  1BI3 A;  4A93 J;  2DMQ A;  3J80 K;  1F1Z A;  3ZQI A;  3ZQ7 A;  3VDX A;  2CV2 A;  4TV7 A;  1R49 A;  1SFE A;  2LKP A;  5H20 A;  1V4R A;  5FLX K;  1YTY A;  1D0Z A;  2E1M C;  3MKL A;  2WA0 A;  3L2U A;  3BT9 A;  3KZI C;  4ZYD A;  2QA4 I;  2FOW A;  2B63 J;  4IHS A;  4XMY A;  4KYW A;  3CD6 I;  4RDU A;  5EYR A;  3P9I A;  2XV4 S;  1MJA A;  2KZG A;  3LMM A;  2Q8K A;  4H0E A;  3HOY J;  3UKG A;  2H8W A;  4PGH A;  2E1C A;  3GME A;  1LDD A;  2QQB A;  3JAM K;  1YI2 I;  3HOS A;  4GYI A;  2ZME A;  4DZJ A;  1OR7 A;  2W85 A;  2LRE A;  1YQA A;  2M45 A;  2R7D A;  1OIS A;  1XMX A;  2XDV A;  3KLO A;  2KDO A;  3NRV A;  1KA8 A;  3BQY A;  2VUM J;  4AID A;  1KU9 A;  2HVQ A;  2UXN A;  4DW6 A;  2LC2 A;  3H5N A;  5EGO B;  1YIO A;  3ABU A;  4C9Y A;  2DBB A;  2A05 A;  4ON0 A;  1H8A C;  2HR3 A;  3LSR A;  1G3W A;  2ZCW A;  5C3E J;  2ID6 A;  2M0M A;  3WTZ A;  3U1D A;  1MBG A;  4IOC F;  5IT9 Z;  5DM6 F;  1X1B A;  3N97 A;  2LBF B;  4DJA A;  2P5L C;  1B9N A;  2HDC A;  1VQN I;  3PNY A;  2JTV A;  5JHU A;  5DCF A;  4PSW A;  1OCZ H;  3ROU A;  1HCR A;  5E20 A;  2QUF A;  3DBR B;  1F36 A;  4E7K A;  1I3A A;  5E1Z B;  2R7Z J;  4A3G J;  5HLH A;  4Q4Z F;  2HNH A;  2KPM A;  5F1R A;  1IRX A;  1T95 A;  2E71 A;  2KMU A;  3WOD F;  4A69 C;  4EM0 B;  4BAY A;  5D5W B;  2PLY A;  2DAO A;  3MZ8 A;  1A31 A;  2NS0 A;  3H3V K;  4LLG F;  1IJW C;  5M5W J;  2PFB A;  3CQZ J;  4EEF G;  3DTI A;  1X3U A;  3Q0W A;  3E5Q A;  2KIQ A;  3GFL A;  3C7J A;  3A03 A;  4KIC A;  2JZY A;  2ZC2 A;  2VE8 A;  5E3L A;  3TW6 A;  3EPZ A;  2M0C A;  5M3M J;  1ETK A;  3I9V 2;  3HJE A;  2DK5 A;  1SMT A;  2YX4 A;  1BC8 C;  4BQQ A;  4PK4 A;  2LRD A;  4WWC A;  1WH5 A;  4HDU A;  1KYW A;  3SZT A;  2GXG A;  5CVJ A;  2F2E A;  3SFZ A;  2M8G X;  1S72 I;  3WTS C;  1JJ8 C;  2V1D A;  3QP6 A;  5EZG A;  4RBO A;  1X1C A;  1XPX A;  3AL0 B;  2IW5 A;  2HFH A;  3CDL A;  2GLO A;  3VYT B;  4BY1 J;  3IHU A;  2DU9 A;  2L7K A;  1IF1 A;  3OYF A;  3CLO A;  4KMF A;  4U87 A;  3ZMZ A;  1ERD A;  2IGN A;  1P92 A;  2O8K A;  4D9J A;  2R7V A;  4IJA A;  1WI3 A;  1ZQ3 P;  1T38 A;  3FXO A;  3M3Y J;  4JBA A;  1B1B A;  3OIQ A;  5M5X J;  2ZSH B;  1RRJ A;  2X6O A;  5FKN A;  5DS9 A;  1A36 A;  1YW7 A;  2OZ6 A;  2E2H J;  1WVR A;  1VND A;  4M9S A;  3D5L A;  4MEY F;  1YS7 A;  2TRT A;  3ABT A;  3CCQ I;  4XKV A;  2P6S A;  2FML A;  3CJR B;  3OYC A;  3CP2 A;  2ZSI B;  4BXF A;  3HC7 A;  2V9V A;  3OV8 A;  4YEJ A;  4RGR A;  4Y15 A;  5M5Y J;  5KK1 A;  2CV0 A;  1IRZ A;  1WJA A;  2RAE A;  2WB1 N;  5IT3 A;  3SQN A;  1XSD A;  1YX3 A;  3IAS 2;  4M3E A;  2FBI A;  4HOB A;  4KA4 A;  2LOO A;  3AG3 H;  1DPR A;  5BPD A;  4UUS B;  2HVR A;  1B72 B;  1WH7 A;  2LY1 A;  3G73 A;  3VOE A;  3SDG A;  4RB3 C;  3X2Q H;  1V54 H;  2H09 A;  3VSL A;  2IS4 A;  2DCE A;  2JSC A;  1U8R A;  1P4W A;  1OPC A;  4M3G A;  2NVY J;  3KEY A;  4FQG A;  1ZLJ A;  2XPU A;  4O5V A;  2IRF G;  3ZCO A;  4B47 A;  1ZK8 A;  3GZ5 A;  4GO1 A;  1B72 A;  5HOD A;  2HOT A;  2XGX A;  3FZV A;  1FMV A;  1RPW A;  4RM2 A;  4LJZ F;  4QPQ A;  4M3D A;  3S32 A;  2JUG A;  2RNG A;  4ZJZ A;  3QAH A;  1Z21 A;  2PQ8 A;  2JA7 J;  4RAF A;  2QWW A;  1SFK A;  3P9C A;  1S5L C;  3JR9 A;  1ORK A;  2DN0 A;  1DU6 A;  1H9T A;  4LK1 F;  2DA2 A;  4MFD A;  4XRF A;  1U5T A;  2L3D A;  1ETW A;  1RUN A;  3AFH A;  2DOD A;  3R0J A;  3B6C A;  4I02 A;  3F21 A;  1KZH A;  2A61 A;  3FMQ A;  3DP7 A;  5FD6 A;  2CQK A;  2BW3 A;  1X2N A;  2XAF A;  1R36 A;  4LFU A;  2OF7 A;  4ZTJ A;  1B6A A;  2IA2 A;  1WJ5 A;  4Z2Y A;  4HX7 A;  1T39 A;  1FX7 A;  3BTL A;  2PN6 A;  2LG4 A;  2HPI A;  2G0E A;  5EZH A;  4ZYE A;  5CPR B;  1VTN C;  4HLY A;  3JRA A;  1DQU A;  4DIQ A;  3KE2 A;  1E3P A;  2IGK A;  5FKK A;  2VOP A;  1ZTR A;  1K83 J;  1TWF J;  4E4H A;  3ESW B;  2F6C A;  2OBP A;  4U0V A;  5GAD J;  2M5W A;  5ILV A;  4G6Q A;  3FIS A;  1MMN A;  3F8F A;  3FWE A;  4EM2 A;  3DTE A;  2EIL H;  2FBH A;  5KAI C;  3GBG A;  1FIP A;  2ECC A;  2OQG A;  5GPA A;  4EJW A;  5HLI A;  2MGQ A;  2R0Q C;  3OYK A;  2NVX J;  2P4W A;  4QTR A;  1ZRE A;  3HZJ A;  1BM9 A;  1IDY A;  2W4S A;  2TCT A;  3WE3 A;  3DEU A;  5FO5 A;  1XC5 A;  3ZN0 A;  4XRS G;  1OCT C;  2BXZ A;  4RLF A;  2L7M P;  4MQV A;  5EGO A;  1FBS A;  1K79 A;  1BR4 A;  1QHG A;  1ON2 A;  4PSX A;  2BE5 F;  3RCO A;  4FX4 A;  1RIO H;  1JE8 A;  5F27 A;  3HOZ J;  1RUO A;  4M74 A;  4F92 B;  1LPQ A;  2DMN A;  1JGG A;  3GFM A;  3C2H A;  2EA4 A;  1TWC J;  4OMY A;  5E79 C;  2P5V A;  2K4J A;  2KRF A;  4PGG A;  5H2F C;  3CCV I;  3FHZ A;  2DFH A;  2EQR A;  2QVO A;  2D45 A;  1K4S A;  4EJO A;  4A0X A;  1U3E M;  4BXU A;  4CCN A;  4ESJ A;  2Y75 A;  2O3F A;  3V42 A;  1XGS A;  3D5S C;  1JKR C;  3PUF A;  3ZQL A;  3AG4 H;  1ETO A;  2GIZ A;  3QPL A;  5F0C A;  3S17 J;  4L5I A;  1MJ9 A;  2IEK A;  3OS2 A;  4D5F A;  3RPU D;  3KET A;  3MKW B;  3I54 A;  1N25 A;  5EEG A;  2V6E A;  3VEP A;  4XIC A;  4WXD A;  2FU4 A;  1ZN2 A;  2LR8 A;  2NOG A;  2W7N A;  2FA5 A;  3K4L A;  1FJL A;  3ML6 A;  4A3F J;  2RQQ A;  2JJ7 A;  5K5O A;  2PMZ N;  1MMA A;  4OIQ F;  2L0K A;  2K3P A;  1P4A A;  1BBY A;  3HKZ N;  2OZU A;  3GCM A;  2XF6 A;  2F5V A;  1VF9 A;  2OPT A;  2YX7 A;  2ZO4 A;  4LK0 F;  3OY9 A;  1CF7 A;  5BPI A;  2I5U A;  3L7W A;  1BN5 A;  1OJL A;  4QSH A;  1HKS A;  3MCZ A;  3LOC A;  4N0B A;  3GF2 A;  1XDS A;  1HXD A;  5GAG J;  5AON A;  2EZL A;  1R9T J;  2YSR A;  5HLG A;  3JRH A;  4S0H B;  3LSP A;  3QU3 A;  2VQL A;  5LFA A;  2KLO A;  4PFO A;  3E6B A;  4ZTF A;  5E8G A;  1KU2 A;  2JRM A;  1SVL A;  2WTE A;  3V4G A;  4AYB N;  1RKW A;  3J81 K;  3KCC A;  3HM5 A;  3NWS A;  4G9Y A;  2L7Z A;  1ZRC A;  2CH0 A;  1B59 A;  1ENH A;  3FKJ A;  1RES A;  1SMY F;  5LGU A;  4EVI A;  1WKM A;  2CS3 A;  2ESN A;  4HLX A;  4N4N B;  3HRM A;  1XN7 A;  2KRH A;  3DPL C;  3MEX A;  4E70 A;  1R00 A;  2DXI A;  2M4K A;  2QZ8 A;  2M2E A;  4XR6 A;  1R71 A;  4OOI A;  1GXQ A;  5GTH C;  5K7F A;  4JQF A;  1PVE A;  2NNY A;  4A3J J;  2DFI A;  1FTT A;  1QU3 A;  4UUT A;  1QRY A;  2Z2S B;  3M1E A;  3LSM A;  3BG7 A;  5BQT A;  4ETS A;  2CUZ A;  5IYB J;  3H9Q A;  5D5U B;  5K1Y A;  1P7I A;  4RAY A;  5DYM A;  2VKD A;  3MQ0 A;  5JLX A;  1LKX A;  2ZFU A;  2CSO A;  4P5O A;  1TW3 A;  2QQ8 A;  2MD5 A;  1XSX A;  2H27 A;  1XMA A;  3CJT B;  4XBF A;  4MHG A;  2E1O A;  4FCY A;  1AOY A;  4MIM A;  5CKT A;  3KEO A;  4YRV A;  1FWZ A;  2HYJ A;  3I56 I;  1KU7 A;  2EV6 A;  3ULQ B;  2X6X A;  1FNN A;  3FXJ A;  3QWL A;  5B1A H;  4HQM A;  4G7O F;  4OWR B;  3RQ4 A;  1X58 A;  2A5Y B;  2L02 A;  4N4O B;  4QPO A;  4A3E J;  2CV1 A;  3DFG A;  2PG4 A;  1J2X A;  5TJJ A;  5ED4 A;  2C6Y A;  1V3F A;  3KP7 A;  5IPA A;  3F3X A;  3MKZ A;  2LF7 A;  4IRH A;  1WHU A;  2BHZ A;  3HG9 A;  1TZL A;  5A2Q K;  5BMZ A;  3S15 J;  3G4S I;  3NAU A;  3HBL A;  1IGN A;  1FP2 A;  4GYG A;  3ZP5 A;  1SD6 A;  2CJJ A;  3QPT A;  2MH9 A;  2PMU A;  4I76 A;  4S04 A;  3CUQ B;  5D6F A;  4Y52 J;  1Y39 A;  4X0G A;  1ZKG A;  2GBY A;  5DTD A;  4IO9 F;  4ZZL A;  3IKT A;  2V79 A;  4I98 B;  3V8L A;  3P9K A;  1PYV A;  2YUS A;  3KYD B;  6PAX A;  2DDA A;  4XNF A;  3VOD A;  3JRG A;  4H4K C;  1RR7 A;  4XLF A;  5E1X A;  1B8I A;  1OFC X;  2Y0M A;  2JT1 A;  4L9J A;  3L2W A;  5F1J A;  4LG3 A;  4UNO A;  3TED A;  1BOA A;  1TQI A;  3HOU J;  3DPU A;  3DQV C;  2VT3 A;  3HSF A;  4KFC A;  3FMR A;  5LHI A;  5LHG A;  2Z16 A;  1IN6 A;  2CFX A;  3MAJ A;  1E3H A;  3E6D A;  4XN0 A;  1CQT A;  2V1U A;  1R6R A;  4KIF A;  3SEZ A;  3F8B A;  3W6K B;  5FLV A;  3CZ6 A;  1BIB A;  4ZYH A;  3TDU C;  4HEA 2;  2HYF A;  3JTG A;  3M1C A;  1Z0X A;  4P55 A;  2ID3 A;  2E1N A;  3HSR A;  2A6E F;  1GV5 A;  4I09 A;  3SDB A;  1KGS A;  2O9L A;  2X1E A;  2PMH A;  3E5U A;  1BR2 A;  4KIS A;  3BC8 A;  4XLA A;  3JRC A;  3VYS B;  3I55 I;  3BPX A;  2I8D A;  1EH7 A;  3GEZ A;  4OIO F;  1IV6 A;  1RI7 A;  3KP3 A;  1IXC A;  4P9U A;  1UAA A;  4M3F A;  4AM3 A;  2JA5 J;  3TP0 A;  2OV7 A;  4ZH4 F;  4MQ9 F;  5ILU A;  3MZH A;  4UUS A;  3BDD A;  1XTA A;  2ECB A;  2VKV A;  1KQ0 A;  4M73 A;  2OCC H;  3CCS I;  1OYW A;  3QOD A;  1T08 B;  1QGP A;  2D5V A;  1ACI A;  1QVU A;  2R7O A;  4BUP A;  2LSO A;  4BQA A;  3KP6 A;  2CQN A;  4W97 A;  2ZB9 A;  4EM1 A;  3REO A;  1MBH A;  3CJN A;  5ICE A;  5D5V B;  3ERM A;  3HSE A;  3DU6 A;  1MBJ A;  2ZJQ F;  2FD5 A;  1W0U A;  2PBI A;  2VBW A;  1WJD A;  3H9G A;  3T8R A;  5DUK A;  3SEQ A;  1UHW A;  3K4J A;  1REP C;  1ETV A;  3QRF F;  2GZW A;  4BY7 J;  4IPA A;  1K78 B;  2FOK A;  2HQR A;  3IH3 A;  3L2R A;  3CC7 I;  2Q1Z B;  2STT A;  2O03 A;  2BY0 A;  3LSH A;  2E2J J;  3BLY A;  2VIX A;  1T33 A;  1BI2 A;  5JI6 A;  1O3Q A;  3VWB A;  4L9V A;  1U2W A;  2FE3 A;  3HTS B;  3GW2 A;  2EWN A;  2HQN A;  4BQO A;  4E6K G;  1LVA A;  3A0B C;  1Z7L A;  3CMY A;  2Y2Z A;  4U0Y A;  1V5F A;  3CCM I;  4W1U A;  4HV6 A;  3EYY A;  5DDG A;  3S1N J;  2IA0 A;  3SHF A;  3MMY B;  2Y48 A;  4UB6 C;  5HDK A;  4J19 A;  1JJ6 C;  1ETQ A;  3K1M A;  2FRH A;  2CQ7 A;  4HG2 A;  1WGX A;  2X1C A;  2CUJ A;  4CYC A;  2A69 F;  1JTX A;  3I3L A;  3M8E A;  2BGC A;  3JCU C;  2ETH A;  3H92 A;  2QKM B;  2K9L A;  3O2P E;  1E0E A;  4ZDO A;  2ZFW A;  4LD5 A;  1J5Y A;  5HDN A;  1VQ7 I;  4B1R A;  5FRO A;  3WGI A;  4B8X A;  3W2A A;  3J7A O;  3PO3 J;  4ITV A;  3DKY A;  5LD2 C;  3ECO A;  4HF0 A;  1HDP A;  3ISP A;  3Q0U A;  3RYR A;  1TNT A;  3CME I;  2IPQ X;  4HF2 A;  3FXR A;  5L3C A;  1LJ9 A;  3E97 A;  2XF5 A;  3BOQ A;  1TWG J;  3RYP A;  1G3S A;  1MBE A;  1ZG3 A;  2V9P A;  2VC0 A;  1I6H J;  4A6D A;  2COM A;  3RDI A;  2X48 A;  4NC8 A;  4LLL A;  3A2K A;  4IHY A;  3KYC B;  5FGM A;  4A3D J;  3K70 D;  5D8L B;  1EH8 A;  1IXR C;  3OS1 A;  5HVQ C;  2IS6 A;  2L4A A;  4IX7 A;  3E7L A;  5F08 A;  4IRG A;  3CCY A;  2A5W A;  1VI0 A;  5BOX A;  1B4A A;  1JKQ C;  3K1N A;  1YW9 A;  1ZGJ A;  3ZOB A;  2VON A;  1VQ5 I;  3ELK A;  2HGC A;  1LE8 A;  2XAQ A;  3LA2 A;  1IN8 A;  2N8G A;  4KNY A;  2EPF A;  5LGN A;  1PUE E;  1WWX A;  4XM3 A;  1U8B A;  2LD5 A;  2R7X A;  2DOF A;  3E3V A;  3WGG A;  2NS8 A;  2BVL A;  1HST A;  5HS7 A;  3L09 A;  5LEK A;  1IN5 A;  2F4O B;  2X0L A;  1ZR2 A;  3CJQ B;  3BCB A;  1ZG5 A;  2R7U A;  1Z7U A;  2W57 A;  1C0W A;  2GXB A;  5LRS A;  2VQH A;  1AU7 A;  1DP3 A;  3F0C A;  5F6F A;  2L2O A;  2BW3 B;  3HXL A;  1GLN A;  3E6M A;  1PP8 F;  5IOZ A;  3U21 A;  1QHH D;  1XGN A;  4BGD A;  1USS A;  3MZY A;  3QPH A;  4JOM A;  5TRD A;  3BR3 A;  1X4P A;  3WTT C;  2STW A;  4A3I J;  1J75 A;  4LG0 A;  1J7K A;  1EA3 A;  2CGP A;  4RA2 A;  5J1U A;  2V6C A;  2WY8 Q;  3OR2 C;  5FD5 A;  4KUM A;  4GDF A;  3E5X A;  3ZMU A;  2MA3 A;  2GQQ A;  3EUH C;  1XD7 A;  2A3S A;  1OCO H;  2F5C A;  2NVQ J;  2FBK A;  3LFU A;  5J4V A;  1W7P D;  1SAX A;  1XCB A;  1D1B A;  2DK8 A;  3CDI A;  3CCE I;  2EV5 A;  3JRI A;  4A3C J;  1GHC A;  1VZ0 A;  5CVV A;  1TBX A;  1I27 A;  3M7G A;  2HWV A;  1G59 A;  2K9N A;  4XRM A;  2O61 A;  4OIN F;  4EAT A;  3GWZ A;  1NHA A;  3R60 A;  3S3O A;  1WPK A;  4DOZ A;  3D5R C;  2ELH A;  4GGG A;  4O3M A;  2QEN A;  1QBJ A;  2XRN A;  1LNW A;  4C2M J;  5BS6 A;  5TGT A;  1U9N A;  5J40 A;  3O8G A;  2JA2 A;  5JR3 A;  2VLA A;  5IOY A;  5IP9 J;  4PJL A;  4M72 A;  2XUB A;  1KON A;  1SAU A;  5HNH A;  1NG7 A;  2QQA A;  1UHS A;  1X1A A;  4WXH A;  4DZP A;  2K5C A;  1DGR M;  1JHF A;  4B3X A;  4A5M A;  2AO9 A;  2LF8 A;  2NAZ A;  3BZ6 A;  3HHH A;  1UZC A;  3J7Y J;  1H88 C;  5HS9 A;  3H5R A;  2XVC A;  3OIO A;  5K7H A;  1D8K A;  2BYV E;  5EG0 B;  3L9F A;  2DFE A;  3PUB A;  3HUG A;  1MZB A;  2E7X A;  3GO5 A;  2RN7 A;  2MLG A;  3H3Z A;  4WF2 A;  3RSN A;  4D5C A;  1VQM I;  1JXS A;  3H5A A;  4BU2 A;  4ZYA A;  2CMP A;  1P4X A;  4IQJ A;  4CO8 A;  3BR1 A;  3CUQ C;  3DBH B;  3ZQQ A;  1WJE A;  1POG A;  1ZRD A;  2QBY A;  1YYV A;  3BR5 A;  4MNU A;  2M4G A;  3TO6 A;  4C3H J;  4ENJ A;  2K40 A;  2P5K A;  2EA2 A;  2HQ5 A;  2OU2 A;  2AXL A;  3EDP A;  5FLM J;  1O3R A;  1IN4 A;  3R6S A;  2CU7 A;  3BG3 A;  3P5J A;  2V1X A;  3AKZ A;  2IJL A;  4C30 A;  3JRD A;  3L2C A;  1MDM B;  4HW0 A;  4L5E A;  3G1M A;  4HSR A;  3VYU B;  1N78 A;  2F4M B;  4IZZ A;  3GZ6 A;  2CW7 A;  2LK2 A;  3EUK L;  3W6V A;  4N9H A;  1X1P A;  4ZC3 A;  3ZN1 A;  2UXX A;  1J59 A;  2YU9 J;  2ISZ A;  4DYR A;  2XGD A;  1H9G A;  1PUF B;  3U9G A;  4BBR J;  2B7E A;  5KVR A;  1OR7 C;  1Z67 A;  4XL9 A;  3OS0 A;  2A6H F;  3DKX A;  4IHT A;  3DF8 A;  1G6N A;  4YFN F;  2EFN A;  4AU7 A;  1M1E B;  3FM3 A;  5LHH A;  3GTO J;  3OR1 C;  2PJR B;  3QYF A;  2R7R A;  2DA6 A;  1MMS A;  5FKL A;  2KIS A;  4FIS A;  3WTU C;  2Z3Y A;  2RRE A;  4XOR A;  2QCO A;  1D0Y A;  1KQ9 A;  2HU9 A;  3CO7 C;  5CYV A;  4RS8 A;  5KCM A;  2KHM A;  3G3Z A;  2XAS A;  4DBR A;  3CO6 C;  4BDY A;  3I4P A;  3O8H A;  4LIU A;  2XC7 A;  2CG4 A;  3S1M J;  2EIM H;  1G3T A;  3F6O A;  5IP7 J;  2LNB A;  3H9J A;  3WG9 A;  2XRL A;  5JFR A;  2DTZ A;  3A01 A;  4IEJ A;  4NUB A;  2QQ9 A;  1IRF A;  2DYS H;  4BAC A;  2L9R A;  1R5I D;  3A0H C;  3I59 B;  2XSD C;  4L9T A;  3QPS A;  2HKX A;  2JRT A;  1LFU P;  1QNT A;  2K9M A;  1SD7 A;  2P6T A;  5CVI A;  2JWT A;  4AD9 A;  3PL8 A;  3W3C A;  2K3F A;  4BYY A;  3A1Y A;  1K61 A;  1FOK A;  4WXC A;  2DA3 A;  1W7P B;  3E0J B;  1LB2 A;  1Y0U A;  2EZK A;  5JVT A;  2QLZ A;  2DPU A;  1IN7 A;  2M7A A;  4QIW N;  4XOP A;  4RB2 C;  3CC4 I;  3C18 A;  2OD5 A;  4UV8 A;  2W84 A;  4EJT A;  3IUO A;  1OCP A;  1YIJ I;  1Z6T A;  2BV6 A;  1T8I A;  2QBY B;  5D6E A;  2E19 A;  3BP8 A;  1AA7 A;  2DMU A;  4G94 A;  4UY8 I;  2Q0O A;  2W82 A;  3U2R A;  2LFB A;  4KT5 C;  2ZNZ A;  2GM4 A;  2M3A A;  4ENM A;  3FX3 A;  1Z3X A;  1RKT A;  4HYE A;  5EG0 A;  4R79 A;  1CF7 B;  3DCF A;  1XGO A;  2Q2E B;  2X1D A;  4AUX A;  1E3O C;  1QPM A;  3RKX A;  3DLL F;  2EH3 A;  5HDG A;  4HNU A;  3OYN A;  1X1D A;  3AG2 H;  3BZK A;  1MNM C;  1OQY A;  3LA3 A;  3S14 J;  1A04 A;  2KQR A;  3PNT A;  4AC0 A;  3KIO A;  3F22 A;  1F43 A;  4R8H A;  1T98 A;  1I3Q J;  3UR3 C;  5HLT A;  4GRI A;  1FSH A;  2GAU A;  3K4M A;  4HQE A;  3Q9V A;  2R93 J;  1O7L A;  4NB5 A;  4E7Z A;  2QSG X;  4XKB A;  1ITY A;  4CCM A;  2NRA C;  5EEH A;  1FSE A;  1FYK A;  4BJ6 C;  2IGM A;  2ZXW H;  3IH2 A;  4HST A;  1LVK A;  4PJJ A;  2HKO A;  1OYI A;  1MSE C;  2MW8 A;  1FYM A;  3CCR I;  3B6A A;  2Y9Z A;  4UXN A;  4A3L J;  1JGS A;  1YIT I;  2L54 A;  3CF2 A;  1NH3 A;  3WTY C;  3GTK J;  5L3D A;  2XB5 A;  5LGT A;  2LY2 A;  1QZY A;  1TNS A;  3S8P A;  1GV2 A;  3VB2 A;  3L00 A;  1R1T A;  3VYR B;  1G3Y A;  5CQG A;  3IAM 2;  3KP5 A;  3LSK A;  3HYI A;  4BEH B;  2M30 A;  1L0O C;  2R5Y A;  3ZXS A;  2FQ4 A;  4XN3 A;  2XIG A;  3AG1 H;  2DFF A;  4YII A;  5DCM B;  3J80 Z;  1P2F A;  4UVB A;  2O7O A;  2FX0 A;  4Y4R A;  1O57 A;  4LG0 B;  1KQ8 A;  1QO0 D;  1HW2 A;  2VKH A;  3ZMT A;  2V7F A;  4WX9 A;  1ZRF A;  4CDG A;  2BVM A;  1FZP B;  2ELK A;  2AQF A;  4HF1 A;  1EV7 A;  2VJ4 A;  4AIK A;  1R1U A;  2PEX A;  4O6J A;  4F93 B;  1NTC A;  1ZR4 A;  4E7S A;  3BTI A;  2Y9Y A;  4FE4 A;  4HPQ A;  3DEE A;  4DQ2 A;  4V19 K;  1OLT A;  1GUU A;  3RZD J;  2RDP A;  3TKY A;  4BHP A;  1YRN B;  1T6S A;  3TO9 A;  4JP0 A;  4BJT A;  4ZDL A;  3S2H J;  3GTM J;  1D1A A;  1Y8Q B;  5F64 A;  5E3O A;  2O5R A;  2DDB A;  5J4Y A;  5IY5 H;  5FKO A;  3K70 C;  4LB6 B;  2LMD A;  3EUH A;  3F72 A;  1FBU A;  4JK1 X;  3WGH A;  4B48 A;  5A2Q Z;  4S05 A;  3CMA I;  5B3S H;  4LIV A;  4XQF A;  2WWY A;  2D1V A;  3DV8 A;  3HIF A;  1IUY A;  2FSW A;  1HF0 A;  1HBX G;  2HDW A;  1YRN A;  4F7Z A;  2KFD A;  3C1D A;  5D8K B;  3BR6 A;  3OSF A;  4KJZ A;  1FOX A;  3HRU A;  1HC8 A;  2M34 A;  2O0Y A;  2JVG A;  3RKY A;  3SFI A;  4BE1 A;  3H1C A;  4X6A J;  1MBK A;  4EV0 A;  1YOV B;  4EMS A;  2DMP A;  3G6E I;  1J9I A;  1S7O A;  1TT0 A;  2XAH A;  4A2U A;  4HZF A;  1U5T B;  3K4B A;  1O4X A;  2FEZ A;  1APL C;  1GVJ A;  2H1L A;  3Q3S A;  3ABK H;  3RTR A;  1YG2 A;  2B9S A;  1EKE A;  2AXT C;  1N75 A;  1HKQ A;  2M87 A;  4AIJ A;  2E36 A;  2XSJ C;  5L3B A;  1D8J A;  2R5Z B;  4EQQ A;  2VQG A;  2E34 A;  3ZQF A;  1K7A A;  3QP5 A;  2HOS A;  2NXN B;  3KX2 A;  3ONQ A;  2EJR A;  4RB0 A;  5E8I A;  3OYI A;  2XAG A;  2BZT A;  2AQE A;  5GPC A;  5F04 A;  2JVH A;  4XK4 A;  2VI6 A;  3LA7 A;  1YO5 C;  3BPV A;  2BY1 A;  2HEO A;  1I5Z A;  2DLL A;  1SAN A;  2GOX B;  4JX4 A;  3TL4 X;  2K86 A;  3DXJ F;  3K9T A;  3LSG A;  4CIC A;  2H1K A;  1VQ6 I;  2L7F P;  2CWE A;  3I58 A;  4CH7 A;  2MYS A;  2EK5 A;  3W6J B;  4I99 C;  4IOA F;  3T1B A;  2VE9 A;  3F23 A;  1W5C C;  2X9D A;  3HRT A;  1U0J A;  5KNL A;  1Y56 A;  2EV0 A;  3IRR A;  1AKH A;  3LAJ A;  1TWH J;  2W24 A;  4Y33 A;  4ASN A;  4Q47 A;  4Y7N J;  2JK3 A;  4WCG A;  2H8R A;  1FLI A;  2FNP A;  3KEQ A;  2RKH A;  1ZHF A;  3ZQC A;  4ESF A;  5J8F A;  2DT5 A;  2WAF A;  2DJN A;  3TDZ C;  4BS9 A;  1WCM J;  2BY2 A;  2XB0 X;  3WU1 B;  1S29 A;  3WG7 H;  3OYL A;  3ERE D;  4AVZ A;  2EZI A;  2W00 A;  2DO7 A;  5FFX A;  3AL0 C;  4CZC A;  2L01 A;  2UWM A;  1SVM A;  4U7B A;  4DGW B;  3LAP A;  5FKM A;  2HVS A;  1S7E A;  3V8J A;  1W5S A;  2DA4 A;  3IV5 A;  4K2E A;  2M1B A;  2PX9 A;  3T0Y A;  2OQR A;  4NQW B;  3S16 J;  4C3I J;  2Y31 A;  3R0A A;  1MNE A;  1FYL A;  3RZO J;  3HPH A;  3DPT A;  1OCC H;  5DD8 A;  1GT0 C;  1EF4 A;  1FMW A;  3PO2 J;  3H0G J;  3PIO F;  3WTX C;  1W1W E;  2ESH A;  4GFB A;  5B5E C;  2XF7 A;  1O3S A;  5D4R A;  2ZJ2 A;  1AKH B;  5K5R A;  1BJA A;  3DWL E;  3HGY A;  3WHC A;  2KDZ A;  3KLN A;  4IKF A;  2BOL A;  1LFB A;  1FPQ A;  4DYC A;  3OL4 A;  5GAH J;  1R7J A;  1MIJ A;  2CW0 F;  2X4H A;  2XAJ A;  1FBQ A;  1MMG A;  5H6Q A;  1RET A;  4V2G A;  2W1O A;  4FX0 A;  4Y17 A;  3OYB A;  2CYY A;  1FIA A;  2R7F A;  3FMS A;  4Q48 A;  4B44 A;  4CA0 A;  4J01 A;  1H0M A;  1HKT A;  2R7S A;  4M6X A;  4IL6 C;  3Q5F A;  3I0T A;  3HB9 A;  4C3J J;  4RAZ A;  3ASO H;  1Y1V J;  4HAM A;  4YIR X;  3S2W A;  2MBF A;  3GX4 X;  4UVA A;  1WJF A;  2FJ1 A;  4KT6 A;  2Z9O A;  4JYK A;  2B0L A;  2FXA A;  4A0Y A;  4JX5 A;  1D5Y A;  5DM7 F;  5E17 F;  2AS5 F;  1Z05 A;  3GVA A;  2WAE A;  2ZXI A;  2Y69 H;  1IDZ A;  1JUS A;  2RC4 A;  4F91 B;  1GXP A;  2V9K A;  1F9N A;  3ZRG A;  2LKX A;  4IHV A;  3K1P A;  3CF5 F;  4D7N A;  2VJI A;  1FTZ A;  1ZGW A;  2DA7 A;  3DU5 A;  3CCJ I;  2EFQ A;  4J00 A;  3BR0 A;  1L3L A;  2FNA A;  2HTJ A;  4CYD A;  1LQ1 A;  2CQX A;  2CO5 A;  2VPL A;  3OYJ A;  3HOV J;  2IS2 A;  1IV8 A;  1O7F A;  3HRS A;  2F5F A;  3LSI A;  3JRF A;  4L18 B;  4LLN A;  2ZME B;  2E5N A;  2LTP A;  2BXY A;  4CGZ A;  3QU6 A;  1TP4 A;  2VOD A;  1G4D A;  1LEB A;  3S3M A;  4RGX A;  3IRQ A;  5EDN A;  3BJA A;  1I1S A;  1TQP A;  3I71 A;  2XPV A;  1FP1 D;  4YG2 F;  2IA1 A;  4I7H A;  1GDT A;  3JRE A;  2DOA A;  1EJ9 A;  1SD4 A;  2CRG A;  3CDH A;  4AWX B;  4RB1 A;  2FUG 2;  4NC6 A;  2F4I A;  2LP0 A;  2K9S A;  4RGU A;  4U88 A;  5E3N A;  5FRN A;  3K0L A;  4XLC A;  5DV5 A;  4C2U A;  3CMM A;  3GLX A;  2VC1 A;  3VPR A;  3JAM Z;  4FTH A;  1ULY A;  3K4K A;  1U6G A;  1YJ9 I;  3FIW A;  1HA8 A;  1WQ2 A;  1VQL I;  3GTQ J;  1JUM A;  4BHB A;  4ANJ A;  3GTJ J;  1UFM A;  1XDU A;  2R3S A;  3HUG B;  2KRC A;  1TWA J;  3TO7 A;  2BEO A;  3KYL A;  2MLK A;  4RGS A;  2JA8 J;  1QZE A;  3PM1 A;  1IUF A;  1UMQ A;  1DDN A;  3K4N A;  4V2F A;  3B73 A;  3B02 A;  3OYE A;  3UNG C;  2LDU A;  1W36 C;  3OSG A;  5J8C A;  1BOB A;  2XPW A;  2IAI A;  3SZP A;  4B09 A;  1R23 A;  3PFI A;  5DUI A;  4YFK F;  3IL2 A;  2CUE A;  3CLQ A;  5FFZ A;  1F4K A;  2P7C B;  2R5Y B;  4MTE A;  2WC2 A;  4RM3 A;  5LEJ A;  3OIP A;  4HX4 A;  4Q5S F;  4RAG A;  1AWC A;  1SFU A;  4EJU A;  1SFO J;  4XLP F;  1YFH A;  3E1S A;  3RKW A;  4BDZ A;  3SXY A;  1BJZ A;  4CZZ A;  1NK3 P;  4OIP F;  2E5Z A;  2HXI A;  3JW4 A;  1W5T A;  4GCV A;  1GVD A;  2VL8 A;  2D1H A;  3PJR A;  1BC7 C;  1I39 A;  4KN4 X;  4G6T B;  2BY3 A;  4MGR A;  1DP7 P;  1S7A A;  2ISY A;  2K4B A;  3K69 A;  4B43 A;  2MD0 A;  4A5N A;  4FAS D;  1XS9 A;  4BH9 A;  2YS9 A;  3RIR A;  1P6R A;  4L0Y B;  4DBQ A;  2WBM A;  2HQA A;  3BJ6 A;  3HOT A;  4HV5 A;  5EEA A;  4A3M J;  1STZ A;  3HGG A;  1J0R A;  1YJN I;  1Z9C A;  3FXQ A;  1TC3 C;  1S9H A;  4XID A;  3QOE A;  1S8N A;  1OKR A;  2W25 A;  4I0A A;  2MG4 A;  5EJC A;  5IYD J;  3G2B A;  5C4J J;  1TL8 A;  2JA6 J;  1J09 A;  1IAW A;  2DI3 A;  1YE9 A;  4F55 A;  2HI3 A;  2Z5U A;  3GTP J;  4NNJ A;  1FY7 A;  1DU0 A;  2M7B A;  2W48 A;  4EJV A;  2IVM A;  1R1V A;  1OMI A;  1ON1 A;  4BJ5 C;  3GYH X;  3CUO A;  3O6B B;  1V5G A;  4B3A A;  1WJC A;  4DYQ A;  3L1P A;  2Y0S A;  5CVR A;  3K7A J;  4II2 A;  3S1R J;  2HZD A;  2YPR A;  3W2V A;  1UST A;  1WZ2 A;  1ZG1 A;  1X4O A;  2WV0 A;  1D0X A;  3A01 B;  4KIT B;  4A3K J;  3T5X A;  3N05 A;  1D1C A;  1XGM A;  5KHD A;  3FK7 A;  3C2G A;  5JVG F;  4CCJ A;  3D0S A;  1XMK A;  1LEA A;  3BZC A;  5CJ9 A;  1CGP A;  3KZY A;  1G2H A;  4PFP A;  2Y30 A;  1IG7 A;  1JT0 A;  5IYC J;  4XON A;  2KL4 A;  3K10 A;  1NK2 P;  3ECH A;  1KYZ A;  4HDV A;  1BA5 A;  2EIN H;  3VFZ A;  1T0F C;  3I59 A;  1XG1 A;  1R4M B;  3RI4 A;  1I50 J;  1TQM A;  2F48 A;  4KIG A;  1JKP C;  3HEF A;  3TOA A;  2F5E A;  2K85 A;  4P9F A;  3FXK A;  4G8X A;  4Z6Y A;  2CUF A;  2E60 A;  2EFP A;  1IW7 F;  1KU3 A;  1MBF A;  4A12 A;  2QSF X;  3NAR A;  4C2T A;  4BE0 A;  2O6G E;  4I0B A;  4G7H F;  1JT6 A;  1W4M A;  1PUF A;  1YHQ I;  1JTY A;  3IP4 B;  2VBY A;  2ZXH A;  4CUG A;  3WTV C;  2I10 A;  2MH2 A;  3G1L A;  5HS8 A;  3CP8 A;  3KPH A;  2M9H A;  1YS6 A;  2LVS A;  3U1K A;  2VBX A;  2XGC A;  4HRI A;  3ZR8 X;  3FM5 A;  5HOO A;  2Z1D A;  2YU3 A;  4N9I A;  1X3Z B;  1ZAO A;  1MDM A;  3C2B A;  1BR1 A;  2M8E A;  2A68 F;  3OL3 A;  4X1E A;  5L3G A;  1W36 D;  4FET A;  3H35 A;  1D5V A;  3JRB A;  1SD5 A;  3GXO A;  2Z33 A;  4Y13 A;  1WJB A;  3FXL A;  2CFO A;  2NYX A;  3LQQ A;  1FC3 A;  1MKM A;  2R4G A;  4XSX F;  4IXA A;  2IXS A;  3ZQG A;  2JPB A;  1OYY A;  3IC7 A;  2L9N A;  1JKO C;  3NWT A;  3BWG A;  1S3J A;  2DQR A;  3KFW X;  2ZXJ A;  1MD0 A;  3MD2 A;  4HX8 A;  2PI0 A;  4P96 A;  1UB9 A;  3GZN B;  4FT8 A;  1E17 A;  1HW1 A;  3T8T A;  4CSW A;  1VQP I;  2RQP A;  5M3F J;  3Q9S A;  1UJ8 A;  4M9X A;  3GUD A;  5GP9 A;  3FHN A;  4AYB A;  5GAE J;  1IC8 A;  2DQL A;  1T0F A;  3IWF A;  2QKL B;  3K6G A;  4I2O A;  3F9K A;  4IF4 A;  4QLC U;  3GTL J;  5ICF A;  5IT9 K;  2NNN A;  3G1O A;  2R7T A;  1A35 A;  2P8T A;  3OYD A;  4KMU X;  2HYG D;  3BQZ A;  2H94 A;  3I4N J;  2R7W A;  1BW6 A;  1UHM A;  1HOM A;  2X51 A;  4NDL A;  2VT2 A;  3ZGK A;  2ACJ A;  3AAF A;  2KIM A;  1UCR A;  2L9V A;  2A07 F;  1DUX C;  5D4S A;  3H36 A;  3OWT A;  4RLQ A;  2KKO A;  1BI0 A;  3F8C A;  3BG6 A;  3DKW A;  2Y0S N;  1DPU A;  1F5T A;  1VQK I;  2KIF A;  3BCA A;  2JQ7 A;  2JUC A;  4U0W A;  1YW8 A;  4UB8 C;  3F6V A;  2D2W A;  4PZJ A;  5ICC A;  3RKQ A;  1IO2 A;  2X6Y A;  3TQN A;  5JHF A;  3V7S A;  4HA8 A;  1Y0N A;  2G7H A;  2RVC A;  4BE2 A;  1X2M A;  2P7V B;  3HTU A;  2RV8 A;  5D5X B;  4EGZ A;  3LQR A;  5LLQ A;  1U78 A;  5FJ8 J;  2J5O A;  4G6D A;  4EGY A;  2ZBK A;  2DTR A;  3LST A;  3TMO A;  1LDJ A;  2JSP A;  2V4J C;  2OTJ I;  3ABL H; 
#chains in the Genus database with same CATH homology
 2DW4 A;  3LWF A;  3GFI A;  2GA1 A;  4MTD A;  4R1H A;  1XB4 A;  1K6O A;  3J81 Z;  2KIU A;  3FF5 A;  2PJP A;  4UHT A;  3I64 A;  5E1W A;  4G7Z F;  3F8N A;  1ZH5 A;  4DNC A;  2VXZ A;  3JSO A;  3ZMV A;  2KJC A;  3CUQ A;  2MC3 A;  4ENK A;  2GIV A;  3EQL F;  4BNC A;  4AVP A;  2Z99 A;  3HHG A;  2K27 A;  2TDX A;  3JSP A;  1MJB A;  3TGN A;  4UV9 A;  4HBL A;  3FXU A;  4OIR F;  5L3F A;  4L9N A;  2EFO A;  1R5H A;  4LGW A;  2XKP A;  2QM3 A;  1TLH B;  1JHH A;  4A6E A;  1B9M A;  2L4M A;  2O8X A;  4L0Z B;  1Q1H A;  4KIB A;  1HQC A;  3EET A;  3IWZ A;  2GWR A;  3BRO A;  2HS5 A;  1HSJ A;  4NHJ A;  3BJO A;  3R61 A;  3C3W A;  3H3U A;  5H6R A;  2UZK A;  2YR2 A;  3PQJ A;  3LFK A;  2K7L A;  1WI9 A;  4L5J A;  2HTS A;  1SFX A;  3JTH A;  4I01 A;  4M6Y A;  3NEU A;  1T2K A;  1D3Y A;  5CLS A;  4ZZD A;  4YIF A;  1WRJ A;  4LMY A;  3WU0 A;  1Z6R A;  1U5T C;  2GA2 A;  1ONV A;  4CXF A;  2H6B A;  4XLN F;  4NQW A;  4UVC A;  1IRG A;  1ODD A;  4OU0 A;  2IP2 A;  5AIP A;  3RPQ A;  3I53 A;  2F5D A;  5LRR A;  1BI1 A;  1S6L A;  3GFJ A;  1K78 A;  3P7N A;  2G9W A;  1IXS B;  2KJB A;  4GXO A;  3CTA A;  4A0Z A;  4KDP A;  3MFK A;  2EFW A;  3NQO A;  2FF4 A;  1YLF A;  5FLX Z;  5LBQ A;  4YFX F;  5J6X A;  4BHC A;  5E18 F;  1Z91 A;  2Q2E A;  3O3K A;  2FMY A;  1TTY A;  1W7P A;  4KN7 X;  2XRO A;  3KP2 A;  2VBZ A;  2OAZ A;  4CHU A;  1ZGA A;  4WK8 F;  1I6X A;  3R4K A;  4M9Z A;  4ENN A;  1EH6 A;  3KZZ A;  2VN2 A;  4PCQ A;  5FB2 A;  5CVU A;  3ZMS A;  2J5P A;  3COA C;  1QQI A;  1RNL A;  2ZNY A;  1IZ1 A;  3OOP A;  4ZYG A;  2BBY A;  5DD4 A;  2VOO A;  4IVN A;  2H6C A;  3V7R A;  4UUV A;  3TOB A;  2DPD A;  4XSZ F;  2E7W A;  3E6C C;  4QWQ A;  3ZMD A;  2ZKZ A;  2OA4 A;  3EYI A;  4U7D A;  2EB7 A;  1LDK B;  5L3E A;  1E2X A;  3RPU A;  1ZAR A;  3V8K A;  1QZZ A;  1PDN C;  1PP7 U;  2HOE A;  3QOP A;  1WSU A;  4OMZ A;  1RZ4 A;  3ZPL A;  5ICG A;  1MGT A;  1FT9 A;  3KP4 A;  4LB5 A;  1HW5 A;  2ADU A;  5K5Q A;  1Z1D A;  2FQ3 A;  1ZYR F;  5ILS A;  3BY6 A;  4FHT A;  2QYO A;  3K2Z A;  2XKO A;  1XCV A;  2HZT A;  2XHK A;  3I5U A;  5DCM A;  1I1G A;  1R22 A;  1TW2 A;  4MEX F;  3PQK A;  3F8M A;  4IRI A;  3M8F A;  1XSV A;  3IKV A;  2RNJ A;  3RJP A;  4M71 A;  1R5G A;  2RGV A;  5AIQ A;  1BIA A;  1ZLK A;  4PDK A;  3WTW C;  3MWM A;  3V7C A;  1O3T A;  1R58 A;  4ESB A;  2IT0 A;  2G7U A;  5DEQ A;  5ERI A;  3WE2 A;  2K02 A;  4AIH A;  2JPC A;  3N4M A;  3M9A A;  4D0P A;  1BI3 A;  3J80 K;  1F1Z A;  3ZQ7 A;  4TV7 A;  1SFE A;  2LKP A;  5H20 A;  1V4R A;  5FLX K;  1YTY A;  4ZYD A;  4IHS A;  4KYW A;  3P9I A;  2XV4 S;  1MJA A;  2Q8K A;  4H0E A;  4PGH A;  2E1C A;  1LDD A;  2QQB A;  3JAM K;  3HOS A;  4GYI A;  2ZME A;  1OR7 A;  2W85 A;  1YQA A;  2M45 A;  2R7D A;  3KLO A;  3NRV A;  1KA8 A;  1KU9 A;  2UXN A;  1YIO A;  3ABU A;  2DBB A;  4ON0 A;  2HR3 A;  1G3W A;  2ZCW A;  3WTZ A;  3U1D A;  5IT9 Z;  3N97 A;  2P5L C;  1B9N A;  2HDC A;  2JTV A;  5JHU A;  5DCF A;  3ROU A;  5E20 A;  2QUF A;  5E1Z B;  5HLH A;  4Q4Z F;  5F1R A;  3WOD F;  4EM0 B;  4BAY A;  2PLY A;  5D5W B;  2DAO A;  2NS0 A;  4LLG F;  2PFB A;  1X3U A;  3E5Q A;  3GFL A;  3C7J A;  4KIC A;  2JZY A;  2VE8 A;  2DK5 A;  1SMT A;  2YX4 A;  1BC8 C;  4WWC A;  4HDU A;  1KYW A;  3SZT A;  2GXG A;  5CVJ A;  2F2E A;  3SFZ A;  3WTS C;  2V1D A;  3QP6 A;  2IW5 A;  2HFH A;  3IHU A;  2DU9 A;  1IF1 A;  3CLO A;  4KMF A;  3ZMZ A;  1P92 A;  4IJA A;  1T38 A;  4JBA A;  1B1B A;  1YW7 A;  2OZ6 A;  4M9S A;  3D5L A;  4MEY F;  1YS7 A;  3ABT A;  2P6S A;  2FML A;  3OV8 A;  2V9V A;  4RGR A;  4Y15 A;  5KK1 A;  5IT3 A;  3SQN A;  1XSD A;  2FBI A;  4HOB A;  4KA4 A;  1DPR A;  5BPD A;  3G73 A;  3VOE A;  4RB3 C;  2H09 A;  2JSC A;  1U8R A;  1P4W A;  1OPC A;  1ZLJ A;  4O5V A;  2IRF G;  3GZ5 A;  4GO1 A;  2XGX A;  3FZV A;  4LJZ F;  3QAH A;  2PQ8 A;  2QWW A;  3P9C A;  1H9T A;  4LK1 F;  4XRF A;  1U5T A;  2L3D A;  1RUN A;  3R0J A;  4I02 A;  3F21 A;  2A61 A;  3FMQ A;  3DP7 A;  5FD6 A;  2CQK A;  2XAF A;  1R36 A;  4LFU A;  1B6A A;  2IA2 A;  4Z2Y A;  4HX7 A;  1T39 A;  1FX7 A;  2PN6 A;  4ZYE A;  1VTN C;  4HLY A;  3KE2 A;  2VOP A;  2OBP A;  4U0V A;  2M5W A;  5ILV A;  4G6Q A;  3F8F A;  3FWE A;  4EM2 A;  2FBH A;  2OQG A;  4EJW A;  5HLI A;  2P4W A;  1ZRE A;  1BM9 A;  3WE3 A;  3DEU A;  5FO5 A;  3ZN0 A;  4MQV A;  1FBS A;  1K79 A;  1ON2 A;  2BE5 F;  4FX4 A;  1RIO H;  1JE8 A;  1RUO A;  4M74 A;  3GFM A;  2EA4 A;  4OMY A;  2P5V A;  2K4J A;  2KRF A;  4PGG A;  3FHZ A;  2QVO A;  2D45 A;  4EJO A;  4A0X A;  1U3E M;  4BXU A;  4ESJ A;  2Y75 A;  2O3F A;  1XGS A;  4L5I A;  1MJ9 A;  3KET A;  3I54 A;  5EEG A;  3VEP A;  4WXD A;  2FU4 A;  1ZN2 A;  2FA5 A;  3ML6 A;  5K5O A;  4OIQ F;  1P4A A;  1BBY A;  2OZU A;  2ZO4 A;  2YX7 A;  4LK0 F;  1CF7 A;  5BPI A;  3L7W A;  1BN5 A;  1HKS A;  3MCZ A;  4N0B A;  3GF2 A;  1XDS A;  1HXD A;  5AON A;  2YSR A;  5HLG A;  3QU3 A;  3E6B A;  5E8G A;  1KU2 A;  2WTE A;  3J81 K;  3V4G A;  3KCC A;  4G9Y A;  1ZRC A;  1B59 A;  5LGU A;  1SMY F;  4EVI A;  1WKM A;  2ESN A;  4HLX A;  3HRM A;  1XN7 A;  3DPL C;  3MEX A;  4E70 A;  1R00 A;  2QZ8 A;  4OOI A;  1GXQ A;  4JQF A;  2NNY A;  2DFI A;  3M1E A;  5BQT A;  4ETS A;  5D5U B;  5K1Y A;  4RAY A;  5DYM A;  3MQ0 A;  2CSO A;  4P5O A;  1TW3 A;  2MD5 A;  1XSX A;  2H27 A;  1XMA A;  4XBF A;  4MHG A;  1AOY A;  3KEO A;  1FWZ A;  1KU7 A;  2EV6 A;  3ULQ B;  1FNN A;  4HQM A;  4G7O F;  2A5Y B;  2L02 A;  3DFG A;  2PG4 A;  1J2X A;  5TJJ A;  5ED4 A;  2C6Y A;  1V3F A;  3KP7 A;  3F3X A;  2LF7 A;  4IRH A;  5A2Q K;  5BMZ A;  1FP2 A;  4GYG A;  3ZP5 A;  1SD6 A;  3QPT A;  2MH9 A;  2PMU A;  4S04 A;  3CUQ B;  5D6F A;  4ZZL A;  3IKT A;  2V79 A;  4I98 B;  3V8L A;  3P9K A;  6PAX A;  3VOD A;  5E1X A;  2Y0M A;  2JT1 A;  4L9J A;  4UNO A;  1BOA A;  1TQI A;  3DQV C;  2VT3 A;  3HSF A;  4KFC A;  3FMR A;  5LHI A;  5LHG A;  1IN6 A;  2CFX A;  3MAJ A;  3E6D A;  2V1U A;  4KIF A;  3F8B A;  3W6K B;  1BIB A;  4ZYH A;  2HYF A;  3JTG A;  4P55 A;  2E1N A;  3HSR A;  2A6E F;  4I09 A;  1KGS A;  2PMH A;  3E5U A;  3BPX A;  1EH7 A;  3GEZ A;  4OIO F;  1RI7 A;  3KP3 A;  1IXC A;  4P9U A;  4ZH4 F;  4MQ9 F;  5ILU A;  3MZH A;  3BDD A;  1KQ0 A;  4M73 A;  1OYW A;  1QGP A;  2LSO A;  4BQA A;  3KP6 A;  4EM1 A;  3REO A;  5ICE A;  3CJN A;  5D5V B;  3HSE A;  2PBI A;  2VBW A;  3T8R A;  5DUK A;  1UHW A;  1REP C;  3QRF F;  2GZW A;  4IPA A;  1K78 B;  2FOK A;  2HQR A;  2STT A;  2O03 A;  1BI2 A;  5JI6 A;  1O3Q A;  4L9V A;  1U2W A;  2FE3 A;  3HTS B;  3GW2 A;  2EWN A;  2HQN A;  1LVA A;  4U0Y A;  4HV6 A;  3EYY A;  5DDG A;  2IA0 A;  3SHF A;  2Y48 A;  5HDK A;  3K1M A;  2FRH A;  2A69 F;  3M8E A;  2BGC A;  2ETH A;  3H92 A;  3O2P E;  2ZFW A;  4LD5 A;  1J5Y A;  5HDN A;  3WGI A;  4B8X A;  3J7A O;  3ECO A;  4HF0 A;  3ISP A;  3RYR A;  1TNT A;  2IPQ X;  4HF2 A;  3FXR A;  5L3C A;  1LJ9 A;  3E97 A;  3BOQ A;  3RYP A;  1G3S A;  1ZG3 A;  2VC0 A;  4A6D A;  2COM A;  3RDI A;  4LLL A;  5FGM A;  5D8L B;  1EH8 A;  1IXR C;  5HVQ C;  2L4A A;  4IRG A;  5BOX A;  1B4A A;  3K1N A;  1YW9 A;  1ZGJ A;  2VON A;  3ELK A;  2HGC A;  2XAQ A;  3LA2 A;  1IN8 A;  4KNY A;  1PUE E;  5LGN A;  1WWX A;  3E3V A;  3WGG A;  1HST A;  5HS7 A;  3L09 A;  5LEK A;  1IN5 A;  2X0L A;  1ZG5 A;  1Z7U A;  2W57 A;  1C0W A;  2GXB A;  5LRS A;  5F6F A;  3E6M A;  1PP8 F;  1XGN A;  1USS A;  3MZY A;  3QPH A;  5TRD A;  3WTT C;  2STW A;  1J75 A;  4LG0 A;  1J7K A;  2CGP A;  2V6C A;  5FD5 A;  4KUM A;  3E5X A;  3ZMU A;  2MA3 A;  2GQQ A;  1XD7 A;  2A3S A;  2F5C A;  2FBK A;  1SAX A;  1W7P D;  1XCB A;  2DK8 A;  2EV5 A;  1GHC A;  5CVV A;  1TBX A;  1I27 A;  3M7G A;  2HWV A;  2O61 A;  4OIN F;  3GWZ A;  1NHA A;  3R60 A;  2ELH A;  4GGG A;  4O3M A;  2QEN A;  1QBJ A;  2XRN A;  1LNW A;  5BS6 A;  5JR3 A;  4M72 A;  2XUB A;  2QQA A;  4WXH A;  1JHF A;  4A5M A;  2LF8 A;  2NAZ A;  3BZ6 A;  3HHH A;  5HS9 A;  2XVC A;  1D8K A;  2BYV E;  3L9F A;  3HUG A;  1MZB A;  2E7X A;  3GO5 A;  2RN7 A;  2MLG A;  3H3Z A;  4WF2 A;  1JXS A;  1P4X A;  4CO8 A;  3CUQ C;  1ZRD A;  2QBY A;  1YYV A;  4MNU A;  3TO6 A;  4ENJ A;  2P5K A;  2EA2 A;  2OU2 A;  2AXL A;  3EDP A;  1O3R A;  1IN4 A;  3R6S A;  2V1X A;  2IJL A;  3L2C A;  1MDM B;  4HW0 A;  3GZ6 A;  4N9H A;  3ZN1 A;  2UXX A;  1J59 A;  2ISZ A;  1H9G A;  3U9G A;  5KVR A;  2A6H F;  4IHT A;  3DF8 A;  1G6N A;  4YFN F;  2EFN A;  3FM3 A;  5LHH A;  3WTU C;  2Z3Y A;  1KQ9 A;  3CO7 C;  5CYV A;  4RS8 A;  3G3Z A;  2XAS A;  3CO6 C;  3I4P A;  2CG4 A;  1G3T A;  3F6O A;  2LNB A;  3WG9 A;  5JFR A;  2QQ9 A;  1IRF A;  3I59 B;  4L9T A;  2HKX A;  2JRT A;  1QNT A;  1SD7 A;  2P6T A;  5CVI A;  4AD9 A;  4BYY A;  1FOK A;  4WXC A;  1W7P B;  1LB2 A;  1Y0U A;  5JVT A;  2QLZ A;  2DPU A;  1IN7 A;  4RB2 C;  3C18 A;  2OD5 A;  4UV8 A;  2W84 A;  4EJT A;  1Z6T A;  2BV6 A;  2QBY B;  5D6E A;  3BP8 A;  4G94 A;  2Q0O A;  3U2R A;  4KT5 C;  2ZNZ A;  4ENM A;  3FX3 A;  4HYE A;  4R79 A;  1CF7 B;  1XGO A;  1QPM A;  3RKX A;  5HDG A;  3LA3 A;  1A04 A;  3F22 A;  4R8H A;  1T98 A;  1FSH A;  2GAU A;  4HQE A;  3Q9V A;  1O7L A;  4NB5 A;  2NRA C;  5EEH A;  1FSE A;  1FYK A;  2HKO A;  1OYI A;  1FYM A;  4UXN A;  1JGS A;  2L54 A;  3WTY C;  5L3D A;  5LGT A;  1QZY A;  1TNS A;  3VB2 A;  3L00 A;  1R1T A;  1G3Y A;  3KP5 A;  3HYI A;  2M30 A;  1L0O C;  2XIG A;  4YII A;  5DCM B;  3J80 Z;  1P2F A;  4UVB A;  1O57 A;  4LG0 B;  1KQ8 A;  1QO0 D;  1HW2 A;  3ZMT A;  4WX9 A;  1ZRF A;  4CDG A;  1FZP B;  4HF1 A;  1EV7 A;  4AIK A;  1R1U A;  2PEX A;  4O6J A;  4DQ2 A;  2RDP A;  3TKY A;  4BHP A;  1T6S A;  3TO9 A;  5F64 A;  4LB6 B;  3EUH A;  3F72 A;  1FBU A;  4JK1 X;  3WGH A;  5A2Q Z;  4S05 A;  2WWY A;  2D1V A;  3DV8 A;  3HIF A;  1IUY A;  2FSW A;  1HBX G;  4F7Z A;  3C1D A;  5D8K B;  3HRU A;  2O0Y A;  3RKY A;  4EV0 A;  4EMS A;  1J9I A;  1S7O A;  2XAH A;  4A2U A;  4HZF A;  1U5T B;  2FEZ A;  1GVJ A;  3RTR A;  1YG2 A;  1HKQ A;  2M87 A;  4AIJ A;  5L3B A;  1D8J A;  4EQQ A;  1K7A A;  3QP5 A;  4RB0 A;  5E8I A;  2EJR A;  2XAG A;  3LA7 A;  1YO5 C;  3BPV A;  2HEO A;  1I5Z A;  2DLL A;  2K86 A;  3DXJ F;  3K9T A;  4CIC A;  3I58 A;  2CWE A;  2EK5 A;  3W6J B;  3T1B A;  2VE9 A;  3F23 A;  3HRT A;  2EV0 A;  3IRR A;  3LAJ A;  4ASN A;  2W24 A;  4Q47 A;  4WCG A;  1FLI A;  2FNP A;  3KEQ A;  2RKH A;  1ZHF A;  4ESF A;  5J8F A;  2DT5 A;  3TDZ C;  3WU1 B;  1S29 A;  3ERE D;  2DO7 A;  5FFX A;  2L01 A;  2UWM A;  4U7B A;  3LAP A;  3V8J A;  1W5S A;  4K2E A;  2M1B A;  3T0Y A;  2OQR A;  3R0A A;  1FYL A;  3DPT A;  5DD8 A;  3WTX C;  2ESH A;  1O3S A;  5D4R A;  2ZJ2 A;  5K5R A;  1BJA A;  3KLN A;  1FPQ A;  1R7J A;  2CW0 F;  2X4H A;  2XAJ A;  1FBQ A;  5H6Q A;  4FX0 A;  4Y17 A;  2CYY A;  2R7F A;  3FMS A;  4Q48 A;  1HKT A;  1H0M A;  4M6X A;  3Q5F A;  3I0T A;  4RAZ A;  4HAM A;  3S2W A;  2MBF A;  3GX4 X;  4UVA A;  2Z9O A;  2B0L A;  2FXA A;  4A0Y A;  5E17 F;  2AS5 F;  1Z05 A;  3GVA A;  2RC4 A;  1GXP A;  1F9N A;  3K1P A;  2EFQ A;  1L3L A;  2FNA A;  2HTJ A;  4CYD A;  1LQ1 A;  2CO5 A;  1O7F A;  3HRS A;  2F5F A;  4L18 B;  4LLN A;  2ZME B;  4CGZ A;  3QU6 A;  2VOD A;  1G4D A;  1LEB A;  4RGX A;  3IRQ A;  3BJA A;  1I1S A;  1TQP A;  3I71 A;  4YG2 F;  1FP1 D;  2IA1 A;  4I7H A;  1SD4 A;  3CDH A;  4AWX B;  4RB1 A;  4RGU A;  4U88 A;  3K0L A;  5DV5 A;  3GLX A;  2VC1 A;  3JAM Z;  1ULY A;  1U6G A;  1WQ2 A;  4BHB A;  1UFM A;  1XDU A;  2R3S A;  3TO7 A;  2BEO A;  2MLK A;  4RGS A;  1DDN A;  3B73 A;  3B02 A;  2LDU A;  5J8C A;  3SZP A;  4B09 A;  1R23 A;  3PFI A;  5DUI A;  4YFK F;  3IL2 A;  1F4K A;  5FFZ A;  2P7C B;  4MTE A;  2WC2 A;  5LEJ A;  4HX4 A;  4Q5S F;  1AWC A;  1SFU A;  4EJU A;  4XLP F;  1YFH A;  3RKW A;  3SXY A;  4CZZ A;  4OIP F;  3JW4 A;  1W5T A;  4GCV A;  2D1H A;  1BC7 C;  4KN4 X;  4MGR A;  1DP7 P;  1S7A A;  2ISY A;  2K4B A;  3K69 A;  4A5N A;  4BH9 A;  3RIR A;  1P6R A;  4L0Y B;  3BJ6 A;  3HOT A;  4HV5 A;  1STZ A;  1J0R A;  1Z9C A;  3FXQ A;  1S8N A;  1OKR A;  2W25 A;  4I0A A;  1IAW A;  2DI3 A;  2Z5U A;  1FY7 A;  4EJV A;  2IVM A;  1R1V A;  1OMI A;  1ON1 A;  3GYH X;  3CUO A;  3O6B B;  5CVR A;  2YPR A;  1UST A;  1ZG1 A;  2WV0 A;  3T5X A;  1XGM A;  3D0S A;  1XMK A;  1LEA A;  5CJ9 A;  1CGP A;  3KZY A;  3ECH A;  1KYZ A;  4HDV A;  3VFZ A;  3I59 A;  3RI4 A;  1TQM A;  4KIG A;  3TOA A;  2F5E A;  4P9F A;  4G8X A;  2EFP A;  1IW7 F;  1KU3 A;  4A12 A;  2O6G E;  4I0B A;  4G7H F;  1W4M A;  2VBY A;  3WTV C;  2MH2 A;  5HS8 A;  1YS6 A;  2VBX A;  3FM5 A;  5HOO A;  2YU3 A;  4N9I A;  1ZAO A;  1MDM A;  2M8E A;  2A68 F;  5L3G A;  1D5V A;  2Z33 A;  1SD5 A;  3GXO A;  4Y13 A;  2NYX A;  3LQQ A;  1FC3 A;  1MKM A;  4XSX F;  4IXA A;  2JPB A;  1OYY A;  3IC7 A;  3BWG A;  1S3J A;  2DQR A;  3KFW X;  2ZXJ A;  1MD0 A;  4HX8 A;  2PI0 A;  4P96 A;  1UB9 A;  4FT8 A;  1E17 A;  1HW1 A;  3T8T A;  2RQP A;  3Q9S A;  4M9X A;  3GUD A;  2DQL A;  1T0F A;  3IWF A;  4I2O A;  4IF4 A;  4QLC U;  5ICF A;  5IT9 K;  2NNN A;  2P8T A;  4KMU X;  2HYG D;  2H94 A;  1UHM A;  2VT2 A;  2ACJ A;  3AAF A;  2KIM A;  1UCR A;  2A07 F;  1DUX C;  5D4S A;  2KKO A;  1BI0 A;  3F8C A;  3DKW A;  1DPU A;  1F5T A;  2KIF A;  4U0W A;  1YW8 A;  3F6V A;  2D2W A;  4PZJ A;  5ICC A;  3TQN A;  3V7S A;  4HA8 A;  2G7H A;  2RVC A;  2P7V B;  3HTU A;  4EGZ A;  2RV8 A;  5D5X B;  3LQR A;  5LLQ A;  1U78 A;  2J5O A;  4G6D A;  4EGY A;  2ZBK A;  2DTR A;  3LST A;  1LDJ A;  3TDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...