3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
2EJRA 1R5GA 3BZ6A 5HS8A 2ISZA 3GZ6A 4KA4A 4G8XA 1XCBA 2EWNA 2V1XA 3R60A 1FYKA 2P5VA 3EETA 3SXYA 3ZPLA 3KZZA 1BM9A 5FGMA 1JGSA 3ZMTA 3K9TA 4RAYA 1XDUA 3DF8A 2IVMA 4K2EA 5L3EA 4MQ9F 2IP2A 3CUQC 3T1BA 3WTTC 4KICA 2GQQA 4G7ZF 1FLIA 3CO7C 2FRHA 4KFCA 2HEOA 1KQ8A 1LVAA 1P92A 4BAYA 3C1DA 2MLGA 2HDCA 1FSHA 4CDGA 5JHUA 3LAJA 2DI3A 2MD5A 2JTVA 1GXPA 4PZJA 2Y48A 2PJPA 2P4WA 2OBPA 3BPVA 1LDKB 2R7FA 1CF7B 2MH9A 2CFXA 5E1XA 4RB0A 1OKRA 1L3LA 1U8RA 4AD9A 4YIFA 4MGRA 1B9MA 4UVAA 3VOEA 3QU3A 1DUXC 3M9AA 1FYLA 4KDPA 2W25A 1G6NA 3W6JB 2VC0A 4HF0A 3ROUA 3G3ZA 4EM1A 3WGIA 3C3WA 1XB4A 3IL2A 2E1CA 2VT3A 2FE3A 1YW7A 1FOKA 2YSRA 1HKTA 3NRVA 3WTZA 1YS6A 2HKOA 2X4HA 5BPDA 3H92A 1O3QA 2JPBA 3FM5A 5JVTA 2CYYA 2TDXA 3EDPA 5K5OA 1G3TA 1FNNA 1Z6TA 5AONA 1PDNC 3WTUC 1W7PA 3JSPA 4A6DA 3R0JA 1LEBA 3LWFA 2DPDA 3BJ6A 1K6OA 4BH9A 3EUHA 5ILVA 3HOTA 1SFXA 3S2WA 5D5XB 2KIUA 2M30A 2ACJA 4NB5A 3HOSA 1FWZA 3BJAA 4LD5A 3WGHA 2QVOA 3JAMZ 2QM3A 1B1BA 3GXOA 2PN6A 4G94A 1ZRFA 5D8KB 2ZNZA 1S7AA 5LEKA 5IT9K 1LJ9A 5E18F 2CSOA 5H6QA 2P6TA 2ZO4A 3J7AO 1J0RA 2L3DA 4WXDA 1S29A 3LA7A 4Y13A 1KYWA 3KP6A 1MKMA 5HLHA 4AVPA 1ZG1A 1P4XA 3GO5A 4KIFA 4PCQA 4XBFA 3E6MA 4GGGA 3I4PA 3SFZA 1WRJA 2M45A 4DNCA 1YTYA 4RB3C 4ON0A 2GAUA 1R5HA 4A2UA 3R61A 4QLCU 4LG0B 4EJTA 5HDNA 3FHZA 2FF4A 2BV6A 2HQRA 2HFHA 4L9NA 5DEQA 2DU9A 3CJNA 3Q5FA 2JPCA 4KN7X 3B02A 2DO7A 2G7UA 2QZ8A 2L4MA 2XKPA 3WTYC 1YFHA 3L09A 2IT0A 2DK5A 2O8XA 3ZMVA 4RGUA 2R3SA 3ERED 3GZ5A 5DYMA 3SZPA 4ETSA 2RQPA 2BGCA 2O6GE 4IVNA 1WSUA 4IJAA 4LLNA 1R1UA 2ELHA 3J80Z 1WI9A 5L3CA 2O03A 3HTUA 2Q8KA 1IAWA 2DQRA 3G73A 1D8KA 4BXUA 3RDIA 4EQQA 3K1MA 4GO1A 3QPTA 5HOOA 4D0PA 2H6CA 2PQ8A 5BMZA 1WKMA 2QBYB 2FMYA 3L00A 4P55A 1E2XA 4IRHA 3VODA 1XGSA 4EJOA 3I64A 4IXAA 2O0YA 1H0MA 2C6YA 3WE3A 1XCVA 1FX7A 3K69A 4AIHA 3QPHA 1MDMB 2KJBA 2JZYA 4Q47A 2O3FA 3CUOA 1ZLKA 2FA5A 2DTRA 5LRSA 1ZHFA 4HF1A 4GYIA 3IWFA 5IT9Z 3HHHA 3F6OA 2LF7A 1ZH5A 1UFMA 1BIBA 3CUQB 3GW2A 2Z33A 2L4AA 5AIQA 1WWXA 2L02A 1FP1D 2STWA 3ZQ7A 5E17F 1FBSA 2ZFWA 4XLNF 1G3SA 1ZGAA 3VEPA 1ZGJA 1Q1HA 1RZ4A 3LQRA 1ZLJA 2EFWA 4XRFA 3N4MA 2XAHA 2AS5F 2H6BA 2D1VA 2YX7A 2VN2A 5K5QA 5D8LB 1BI1A 3FMQA 2J5OA 3J81K 3GX4X 3T0YA 3WTVC 4FHTA 4M9XA 2EFOA 2Q0OA 1FT9A 4IF4A 1KU7A 3ML6A 2QBYA 1R1TA 4KMUX 5TRDA 2RC4A 1Z9CA 2JSCA 4L9JA 4YG2F 3MEXA 3BDDA 4HW0A 1I5ZA 2XHKA 3U2RA 2IA1A 5DD4A 4AIKA 3RIRA 4ZYHA 2NNNA 5ICEA 2G7HA 4P9UA 4L5JA 2FU4A 1RUNA 2ZNYA 2QYOA 4HAMA 2HYFA 1HW2A 5E1WA 4G9YA 2QENA 1U2WA 1TLHB 2F5CA 4U7DA 4WWCA 3PFIA 4UVCA 2WC2A 4RB2C 4UVBA 2A07F 2JT1A 2W84A 1J2XA 4Y17A 3I54A 2VBWA 2GXBA 4ESBA 4JK1X 1T6SA 5F64A 5EEGA 2HS5A 5E8IA 3WTXC 4OIOF 3SZTA 1XSDA 1W5TA 3HHGA 2Z9OA 1PUEE 1BI3A 1AWCA 1EH7A 4QWQA 4PGGA 1W4MA 3QP5A 4KMFA 1U5TB 4L9VA 2VT2A 2CW0F 4WF2A 1IN6A 4A6EA 5FLXZ 2CWEA 3N97A 1DDNA 1S7OA 5CLSA 4LJZF 2Y75A 2V9VA 2DPUA 2HQNA 1IXRC 2J5PA 2Q2EA 2M87A 1O3TA 3K1NA 5HLIA 1FYMA 2NYXA 1BI0A 3P9CA 3CTAA 2L54A 3M8EA 1QGPA 2V79A 1P2FA 1K78B 1IXCA 5DCFA 5CVRA 2EV6A 3ULQB 4Q4ZF 3ECHA 1V4RA 2UXXA 3H3ZA 4XLPF 3RKWA 2RNJA 4WX9A 4R8HA 4MTEA 4RS8A 1Z7UA 4G7HF 3P7NA 2K7LA 3TDZC 3ZMZA 1S8NA 1JHHA 2FBHA 1IW7F 3EQLF 2QQ9A 2VC1A 1S6LA 5ILUA 4HX7A 1HKSA 2FQ3A 4HZFA 1P4WA 2PLYA 2HTSA 1QZYA 3EYYA 2ZCWA 4RGSA 2QLZA 4EJUA 3TO9A 4HLYA 4Y15A 2K4JA 5IT3A 3LAPA 4R1HA 5FFZA 2M5WA 2A6HF 3HSRA 1D3YA 3RJPA 3MWMA 1DP7P 3WU0A 4TV7A 4Z2YA 1R36A 2PEXA 4IRIA 5TJJA 1FP2A 2P6SA 1UB9A 3P9KA 3KFWX 3CO6C 2W57A 2XAGA 3DPTA 3L9FA 5D4SA 4OMZA 3FXRA 2K86A 1B9NA 2EA4A 4P5OA 1O3SA 3KP4A 4RB1A 2OU2A 5L3DA 1T2KA 3FZVA 4PGHA 3DFGA 1TW2A 5HDGA 2O61A 3IWZA 3MZYA 4ASNA 1P4AA 4Q48A 1YW9A 2XAJA 5CJ9A 1P6RA 4UV8A 1ZARA 3KP3A 1YIOA 3BJOA 4XSXF 3WE2A 1YO5C 5DUIA 1I1SA 4HF2A 4CO8A 3D0SA 3QOPA 3H3UA 1KA8A 3FMSA 2M1BA 2JRTA 2LF8A 4GXOA 5K5RA 3I53A 1D5VA 2RV8A 3K2ZA 2HYGD 1C0WA 1PP8F 4G6QA 3E5UA 1OYYA 2CO5A 4JQFA 6PAXA 2K27A 1XGNA 2VXZA 4RGRA 3DPLC 2HOEA 1IXSB 2OZ6A 3GUDA 5DUKA 2XUBA 4CHUA 2CG4A 3W6KB 3I71A 4EMSA 4N0BA 3V8LA 1RUOA 5E1ZB 4HDUA 3M1EA 3F3XA 4OMYA 2HKXA 3WU1B 2VE8A 4OIPF 4LK1F 2W85A 3F8FA 1BC7C 2KRFA 5FFXA 5DDGA 4OIRF 4ZYDA 3HYIA 2FNAA 2ETHA 4S04A 1R22A 3KLNA 4HDVA 5L3BA 1LQ1A 1FSEA 4FX0A 4HQEA 1S3JA 4B09A 1TQPA 1LDDA 1O3RA 3F23A 2A3SA 5FB2A 5DD8A 5FLXK 4I0BA 1HQCA 4N9HA 4S05A 1SD4A 2DQLA 4IHSA 5L3FA 1UCRA 2DT5A 3WGGA 1T38A 3EYIA 2IPQX 1ZN2A 4M71A 1FBQA 3BPXA 3OV8A 2NNYA 3PQKA 4KIGA 1F5TA 1B4AA 4OOIA 5HVQC 1Z05A 4B8XA 3I59A 4I2OA 2P7CB 5LGUA 1QBJA 1MDMA 2UXNA 1JHFA 2XAQA 5FO5A 3LA3A 3ZMUA 3DQVC 2WTEA 4HX8A 4F7ZA 4M9ZA 3BOQA 1REPC 2VODA 3ISPA 2K4BA 1TTYA 3Q9VA 2PI0A 1H9GA 2RKHA 1SD6A 5CVVA 3TOBA 5CVJA 1CGPA 4N9IA 2P5KA 1LNWA 3C7JA 3FWEA 1B59A 3QAHA 4HA8A 2GXGA 2FNPA 4HBLA 2E7XA 1J5YA 4I0AA 2IRFG 1BN5A 2LNBA 3HIFA 3KEOA 4EJWA 2HZTA 3MZHA 1LEAA 1O57A 2XKOA 4M9SA 3BY6A 1MJBA 4L18B 1U78A 2D2WA 1IN8A 1AOYA 1ONVA 1A04A 3R0AA 4KNYA 4BNCA 4EM0B 4NQWA 2EV5A 1OYIA 2CQKA 3CLOA 2F5DA 4BHBA 5ERIA 3TKYA 4ENKA 2F2EA 2HGCA 3J81Z 4EVIA 4LLLA 1YLFA 2EV0A 4A5MA 2OD5A 5ICCA 4HYEA 3RKXA 1Z6RA 2XV4S 3GWZA 3JTHA 3HSEA 2EFQA 2V1UA 1OPCA 2DBBA 1GHCA 4IRGA 4M74A 1I6XA 3M8FA 5CVUA 4LFUA 1STZA 2W24A 3ZN1A 1ON1A 4FX4A 4H0EA 5LGNA 2VBZA 2BE5F 3F21A 2MA3A 1HXDA 1KU9A 3ECOA 3E3VA 1YG2A 4U7BA 1W7PD 2HR3A 3LQQA 3BROA 3TDUC 3VFZA 4CICA 3RYPA 2LKPA 2BYVE 3C18A 5A2QZ 3F8MA 2QQAA 2VBYA 3KETA 3TOAA 1K7AA 1MJ9A 3DV8A 2VOPA 3F8BA 4ESJA 1QNTA 2QWWA 3MCZA 1K78A 4HOBA 2EFPA 3TQNA 5KVRA 3FF5A 3KP2A 4LB5A 4ENMA 3I0TA 4L0ZB 4FT8A 3RTRA 3V7CA 2YR2A 1BC8C 5JR3A 1ZRDA 3GFIA 4YFKF 3FXUA 1XDSA 2PBIA 2ISYA 4A0ZA 4Q5SF 2DK8A 4M72A 5AIPA 4ZZLA 3U9GA 1KU3A 5H20A 1G3WA 3B73A 4ESFA 4UXNA 2FOKA 4UNOA 1J59A 4CZZA 2ZMEB 4IHTA 3BP8A 3KEQA 4A0XA 5D5VB 1OYWA 5LLQA 1IF1A 4O3MA 4BYYA 2UZKA 3K0LA 1J75A 3ABUA 1T98A 4HLXA 1NHAA 2NRAC 2PMHA 3VB2A 1I27A 1HW5A 5LHHA 3BWGA 1UHMA 1RNLA 5F1RA 1PP7U 3CDHA 2WWYA 2L01A 2XAFA 3TGNA 1W5SA 1MD0A 3T5XA 5ED4A 2LSOA 4RGXA 1LB2A 5DCMA 3QU6A 2D1HA 4ZZDA 4MEXF 1QQIA 3DXJF 1TNTA 4BHPA 2LDUA 3WG9A 1YS7A 4LGWA 3K1PA 3IKTA 4ZH4F 4A0YA 4UHTA 5HS7A 2GWRA 4UV9A 2A5YB 1D8JA 2Y0MA 2COMA 4U88A 3E5XA 4EM2A 5HDKA 3TO7A 1IN5A 1ZRCA 5BOXA 1ON2A 4HX4A 2M8EA 3ZMSA 3MFKA 2IA0A 1XD7A 5E8GA 2STTA 3V8KA 1Z91A 4WK8F 4EV0A 1ZG3A 5F6FA 1YW8A 5E20A 1USTA 3JW4A 4YFXF 3O6BB 2H27A 3Q9SA 2FBKA 1XMAA 2GZWA 1UHWA 3JAMK 3E5QA 4DQ2A 1BJAA 2KJCA 5ICFA 2Z99A 4BQAA 3GFMA 1XSVA 1HKQA 2AXLA 4U0VA 4LB6B 2H09A 3PQJA 1YYVA 1I1GA 4MTDA 1TQIA 4KYWA 2ZBKA 1BOAA 3HRUA 2A61A 4IPAA 5LHIA 1V3FA 2MBFA 3RI4A 3IRRA 4OINF 3E6CC 2Z5UA 1XN7A 4AWXB 1XGOA 1QZZA 2EK5A 1HSTA 2IJLA 3CUQA 1SD5A 3RYRA 5H6RA 5J8FA 2VE9A 3JTGA 2MH2A 5LBQA 5LHGA 3KCCA 3KP5A 1W7PB 1MGTA 3GFJA 3R4KA 1ZREA 1ULYA 1BBYA 1HSJA 4WXCA 4R79A 3GLXA 3AAFA 3DEUA 5K1YA 4L9TA 1G4DA 4WXHA 1SD7A 3TO6A 2V1DA 2FXAA 2OQRA 3GFLA 4UUVA 1F4KA 2G9WA 4OU0A 4P9FA 4O5VA 4M6YA 2E7WA 4I98B 2YPRA 5ILSA 3P9IA 4I09A 4U0WA 3HRSA 2RN7A 1DPUA 1SFUA 3NEUA 1TW3A 2QUFA 3LFKA 2F5EA 3DP7A 1Z1DA 3HTSB 3IHUA 2CGPA 2RVCA 3WTSC 2NAZA 5CVIA 1J9IA 2OAZA 4MEYF 2GA2A 4XSZF 2YX4A 4CXFA 1XMKA 4KN4X 2GIVA 2EA2A 2XROA 3T8RA 2EB7A 2A6EF 4LG0A 4L0YB 2PMUA 2DW4A 4LLGF 4E70A 1KQ0A 4HQMA 4PDKA 5DV5A 3E6DA 5KK1A 1O7LA 2IA2A 2FEZA 3V7SA 1R1VA 2UWMA 4MHGA 2EFNA 5BQTA 3R6SA 3IRQA 1YQAA 5BPIA 4A12A 2V6CA 2ZXJA 3KLOA 1U3EM 4YFNF 5D5WB 5CYVA 1L0OC 2R7DA 1G3YA 4M73A 3I59B 3F22A 5ICGA 5BS6A 3GVAA 5FD6A 2GA1A 4ZYEA 2DFIA 3ZN0A 4CYDA 3F72A 2Z3YA 4EJVA 4ENJA 2DLLA 3O2PE 3HRTA 1B6AA 3QP6A 2RGVA 3E97A 4YIIA 3FXQA 1J7KA 1RI7A 2KIFA 1XGMA 5LEJA 3GEZA 1R00A 3L7WA 4KIBA 3WTWC 3FX3A 4O6JA 3HSFA 4LMYA 2X0LA 3O3KA 2FBIA 3I58A 1GXQA 1JXSA 1ODDA 1FZPB 4OIQF 1F1ZA 1FY7A 2BBYA 4RAZA 2P5LC 1EV7A 3GF2A 2XASA 1IN7A 3L2CA 5DCMB 3U1DA 4EGZA 4GCVA 1T39A 1TBXA 3MQ0A 4AIJA 2OA4A 2XRNA 2YU3A 5J8CA 4BHCA 1H9TA 1XSXA 4HV5A 1X3UA 3GYHX 3DKWA 1WQ2A 1U5TC 2ESHA 3MAJA 1BI2A 5JFRA 3KP7A 2KKOA 3V8JA 2IW5A 2ZKZA 1USSA 2VONA 1CF7A 4KUMA 1QO0D 4ENNA 1K79A 2RDPA 3FMRA 3E6BA 2ESNA 1FBUA 2MC3A 5JI6A 1VTNC 1IN4A 2OZUA 2H94A 3RPQA 2WV0A 1TQMA 3HUGA 3ABTA 4P96A 1U5TA 2XVCA 1FC3A 2KIMA 2A68F 1IRFA 5L3GA 1QPMA 1OMIA 2FMLA 1R23A 3F8NA 3LSTA 3KZYA 2P7VB 1KGSA 1KYZA 3RPUA 3D5LA 4NHJA 1R58A 3ZP5A 1HW1A 1SMTA 3KE2A 1E17A 4G6DA 4U0YA 3V4GA 1EH6A 2XGXA 1FPQA 3M7GA 4KT5C 2DAOA 5EEHA 1ZG5A 2QQBA 3FM3A 1BIAA 2PG4A 2ZJ2A 3SHFA 1IRGA 2B0LA 4LK0F 2XIGA 4I01A 2D45A 1ZYRF 2ZMEA 4GYGA 2P8TA 1RIOH 3LA2A 5J6XA 1F9NA 5LRRA 2HTJA 1ZAOA 2F5FA 2ADUA 3SQNA 4G7OF 1U6GA 4MNUA 4M6XA 3F8CA 3V7RA 4JBAA 3I5UA 3IC7A 5FD5A 1MZBA 3IKVA 4WCGA 1OR7A 1DPRA 1TNSA 4MQVA 5LGTA 1SAXA 3JSOA 2A69F 5A2QK 5D5UB 2MLKA 3T8TA 3WODF 4L5IA 3OOPA 3NQOA 3COAC 3RKYA 5D6EA 1IUYA 3ELKA 3ZMDA 1SMYF 2K02A 1MJAA 4HV6A 2VOOA 1GVJA 1EH8A 1R7JA 4I7HA 2HWVA 2NS0A 1Y0UA 1IZ1A 5HLGA 3HRMA 4EGYA 1HBXG 4I02A 1KU2A 5D4RA 1LDJA 3REOA 2OQGA 1SFEA 3F6VA 2E1NA 1T0FA 5D6FA 2PFBA 4CGZA 4ZYGA 2BEOA 3QRFF 1KQ9A 1O7FA 2FSWA 4A5NA 1JE8A 3J80K 5HS9A 2VBXA
chains in the Genus database with same CATH superfamily
2EJRA 1R5GA 2GLOA 3BC8A 3HOVJ 2KQRA 3BZ6A 5HS8A 5J1RA 1HLVA 2ISZA 1X1BA 3GZ6A 4CCMA 4KA4A 2W00A 3ABKH 2E1MB 4G8XA 4B3XA 3AG4H 1ITYA 4B1RA 5E3MA 3JRDA 4A93J 2OC6A 2L9NA 4UUTA 1XCBA 1O4XA 1X1AA 2BXZA 2EWNA 2V1XA 3R60A 1FYKA 4PFPA 2P5VA 3EETA 3SXYA 1G59A 2X1DA 3S1QJ 1TWGJ 3ZPLA 3KZZA 3OS1A 1BM9A 5FGMA 1JGSA 3ZMTA 5LFAA 3K9TA 4RAYA 3I56I 4YIRX 2L9SA 1XDUA 2L9RA 3OYLA 3CJQB 1N77A 3DF8A 2Z1DA 2IVMA 1MBHA 4HSRA 2R7VA 1FOXA 5DM6F 4K2EA 3HM5A 4F93B 5L3EA 2CUFA 4MQ9F 1B72B 1AKHA 3DKYA 2IP2A 3CUQC 3K6GA 3T1BA 3WTTC 4XRMA 3S93A 2VASA 4II2A 4KICA 1HA8A 2GQQA 3HPHA 4G7ZF 3MVPA 1FLIA 1ETWA 3CD6I 3CO7C 2FRHA 5JLWA 5CPRB 1PVEA 4KFCA 3C2BA 1D1CA 3BR5A 4IL6C 2L9VA 4OAYA 2HEOA 1LVAA 1P92A 1KQ8A 4BAYA 3C1DA 4HNUA 2MLGA 2R4GA 2VL8A 2HDCA 1FSHA 4CDGA 3IP4B 5JHUA 3LAJA 1YOVB 2DI3A 2MD5A 2JTVA 1RPWA 1GXPA 4PZJA 2Y48A 2PJPA 1HDPA 2P4WA 1P7IA 2OBPA 3A4CA 2QEXI 3BPVA 1LDKB 2R7FA 2IS1A 2WBMA 3AG1H 1CF7B 2MH9A 2CFXA 5LD2C 2R7TA 5E1XA 4RB0A 1OKRA 1T8IA 1L3LA 4AD9A 1BR1A 3Q0UA 3L2UA 1U8RA 4YIFA 3GTKJ 4MGRA 1B9MA 3HDDA 3AKZA 4UVAA 3VOEA 3QU3A 1DUXC 2NVXJ 1XC5A 3M9AA 1FYLA 4KDPA 2W25A 3PNYA 1VQ7I 1G6NA 3W6JB 4AVZA 4RDUA 5IP7J 3GTMJ 2VC0A 4HF0A 4QPQA 3G3ZA 3ROUA 5EGOA 4JX4A 1I39A 4EM1A 3WGIA 3C3WA 2VQHA 5JHFA 1XB4A 3UR3C 5IY5H 3IL2A 2DN0A 1SVMA 4CZCA 2E1CA 1OR7C 2VT3A 2FE3A 1WVRA 1YW7A 4CA0A 1FOKA 2NS7A 3JRIA 2ID6A 3CCVI 2F5VA 2YSRA 3VYTB 1HKTA 3NRVA 2VQLA 2HOAA 3WTZA 1YS6A 2VJ5A 2HKOA 1JKOC 2X4HA 1R71A 5BPDA 1GV2A 3H92A 1O3QA 2JPBA 3FM5A 5JVTA 2CYYA 2TDXA 2OTJI 4BXFA 3EDPA 5K5OA 4HG2A 1G3TA 5TISC 1FJLA 4BKXA 3I4NJ 3OIOA 1FNNA 1Y8QB 1Z6TA 4PSWA 1BR2A 2VKHA 5CQEA 2W48A 5AONA 3PM1A 4MFDA 4I6ZA 3CESA 1PDNC 4V2GA 3OYHA 2NVUB 1MMDA 3WTUC 2E2HJ 1W7PA 4HEA2 2LY1A 1X1PA 3JSPA 4A6DA 3R0JA 5FLVA 2FX0A 2X6YA 3EPZA 3LWFA 1LEBA 3CF5F 2DPDA 2B63J 1XPXA 3BJ6A 2R7WA 1K6OA 2ECBA 3K4LA 4BH9A 3EUHA 4XOTA 2HPIA 5ILVA 3HOTA 1G2HA 1SFXA 3S2WA 4AUXA 5D5XB 2JVHA 2KIUA 2M30A 2WY7Q 2ACJA 1JUSA 1K83J 2F6CA 4NB5A 5GTHC 3HOSA 2NVYJ 1FWZA 2A5WA 3BJAA 5E3NA 4LD5A 1MBKA 1VQOI 3F9KA 3WGHA 1SVLA 2LFBA 4XN3A 2QVOA 3JAMZ 2VIXA 2QM3A 1B1BA 2VPLA 3HXLA 5KCMA 3GXOA 2PN6A 1ZTRA 3L2QA 3IV5A 2Q2EB 4G94A 1ZRFA 3HC7A 2DMTA 5D8KB 2ZNZA 1BW6A 1S7AA 5LEKA 3OYDA 1LJ9A 5IT9K 1Z77A 2HYJA 5E18F 2CSOA 5H6QA 2KPMA 2P6TA 4BDZA 1TZLA 2ZO4A 3J7AO 1J0RA 3M1CA 4XRSA 2L3DA 3H36A 2QSGX 4LG3A 4WXDA 1JKPC 4QPOA 2GOMA 3K4JA 2PX9A 2YS9A 1S29A 3LA7A 2X6WA 4Y13A 1KYWA 2KMUA 4LITA 3KP6A 1MKMA 5HLHA 1OCCH 2R5YB 4G6TB 3ASNH 3HKZN 4AVPA 1ZG1A 3CC2I 1P4XA 2O8KA 4IOAF 2QSFX 3GO5A 4KIFA 4PCQA 4XBFA 3E6MA 4GGGA 3I4PA 3SFZA 1WRJA 2M45A 3FHNA 4DNCA 1YTYA 1IO2A 4ON0A 4RB3C 2DFEA 2GAUA 3PSFA 4XN0A 1VQNI 3L2VA 1R5HA 2P0WA 4A2UA 4X1EA 4XIDA 3R61A 2RQQA 4QLCU 3RZOJ 3QQAA 3Q0VA 3BG9A 4LG0B 1OISA 4EJTA 1VNDA 1LE8A 2KL4A 1QVTA 5J4YA 5HDNA 3FHZA 4F92B 2FF4A 2BV6A 2HQRA 2HFHA 4L9NA 5DEQA 2OCCH 3S17J 2DU9A 3KYCB 1WPKA 3CJNA 3Q5FA 3H0GJ 3A01B 2JPCA 3KYDB 4KN7X 3B02A 2BHZA 2DO7A 3HKZA 2G7UA 2IBDA 2QZ8A 1W36D 2L4MA 4UB6C 2M4GA 2XKPA 4BDYA 2FD5A 3G71I 3WTYC 2JVGA 1YFHA 1RESA 1TWCJ 3TEDA 3L09A 3V42A 2IT0A 1V55H 2LRDA 2DK5A 4D5FA 2X9DA 2O8XA 3ZMVA 2LOOA 4HNVA 4RGUA 2R3SA 3ERED 1MH3A 1I50J 3GZ5A 5DYMA 1D0YA 3SZPA 1U8BA 1PUFA 4ETSA 4ZDPA 1TWFJ 2RQPA 2BGCA 2V9PA 2O6GE 4IVNA 3LSHA 1F43A 2O9LA 4AC0A 1WSUA 4IJAA 1Z7LA 4LLNA 1R1UA 3RCOA 2VKDA 3A0HC 2ELHA 3HL2A 2BXYA 3J80Z 4BJ5C 1WI9A 2ZMEC 2KISA 2Z2SB 5L3CA 3TP0A 2O03A 3HTUA 2Q8KA 1E0EA 1IAWA 3LSMA 1A6IA 2CQ7A 2DQRA 3HOXJ 3G73A 1X2NA 3L1PA 2LBFB 1D8KA 2E2JJ 4PUSA 4BXUA 2L5QA 3RDIA 4EQQA 3K1MA 4GO1A 4GFBA 2KP6A 3QPTA 3MKLA 3G2BA 1S7EA 5HOOA 4D0PA 2H6CA 4DYRA 2PQ8A 5BMZA 1WKMA 2QBYB 2FMYA 3L00A 4P55A 1E2XA 5FLMJ 4IRHA 3VODA 1XGSA 4EJOA 3I64A 4IXAA 2O0YA 4CCLA 1H0MA 2C6YA 1YRNB 2EILH 3WE3A 4F52A 5M5XJ 1FOYA 3W3CA 3M07A 2HVQA 5GPAA 1PUFB 1E3OC 1XCVA 1FX7A 4A3KJ 3K69A 4AIHA 1IV6A 3FXLA 3QPHA 4NC6A 2DA4A 1MDMB 2KJBA 1X58A 2JZYA 4Q47A 2PJRA 3K2AA 2O3FA 2VJIA 3CUOA 1ZLKA 5B5EC 2FA5A 1DQUA 4CCNA 3ZXSA 2WAEA 2DTRA 1UAAA 1HC8A 5LRSA 1XMXA 2XF6A 2DTZA 1ZHFA 1VQ6I 2AQFA 5K7ZA 2ICWG 2M7BA 4IKFA 1ERDA 3K4NA 3CDLA 4HF1A 4GYIA 3IWFA 5IT9Z 2AXTC 3HHHA 3F6OA 2LF7A 3S1RJ 1ZH5A 1UFMA 1BIBA 3CUQB 5B66C 3GW2A 2Z33A 2L4AA 5AIQA 1WCMJ 1WWXA 2L02A 1FP1D 3FXOA 4E7IA 2STWA 2M0MA 3ZQ7A 4D5CA 5E17F 3K10A 3QYFA 3IAS2 3TW6A 2COBA 4Y7NJ 4IO9F 1MNMC 1FBSA 2ZFWA 4XLNF 1K61A 4A3LJ 1G3SA 2VUMJ 3ZQIA 1ZGAA 2QKMB 3FK6A 3VEPA 3W2WA 5FRNA 1ZGJA 1Q1HA 1RZ4A 2LTPA 3LQRA 1ZLJA 2VJ4A 2EFWA 3W2VA 4XRFA 2VI6A 3CLQA 3PUBA 3N4MA 4EATA 4PSXA 2R0QC 2XAHA 2RNGA 2AS5F 4BBSJ 2H6BA 2X1EA 2D1VA 2WADA 1B72A 2K9QA 3OS2A 4A3EJ 2R7UA 2YX7A 4XQFA 2VN2A 5K5QA 2WA0A 5D8LB 2BVLA 1BI1A 2FUG2 2J5OA 3FMQA 5IOYA 3J81K 3T0YA 3WTVC 3GX4X 1QU3A 3WHBA 4RLQA 1GT0C 4FHTA 1UZCA 2L7FP 1VQ9I 4M9XA 3NWTA 3H9GA 2EFOA 4BBRJ 2Q0OA 1FT9A 3C2HA 4XM3A 4IF4A 2JA2A 1KU7A 1X19A 3ML6A 3ZQHA 3M3YJ 2QBYA 2B9SA 3JREA 1R1TA 4KMUX 5TRDA 2RC4A 3J7ZI 1UELB 1W1WE 1Z9CA 1QHHD 2MYSA 2JSCA 3TL4X 1RC9A 3OYFA 4L9JA 4Y4RA 4YG2F 1OFCX 3MEXA 3BDDA 2W4SA 4IHVA 4HW0A 1I5ZA 1RETA 1X2MA 2KRCA 2XHKA 3U2RA 9ANTA 2CV1A 2ELJA 2JJ7A 2IA1A 1BA5A 3G1LA 5DD4A 4AIKA 5CKTA 3RIRA 1A36A 4ZYHA 5IP9J 2DYSH 2NNNA 5ICEA 2M3AA 2G7HA 4P9UA 4L5JA 2V1NA 5GTIC 2FU4A 3GLLA 1RUNA 5EG0B 3BTCA 2QSHX 2ZNYA 2QYOA 4HAMA 2HYFA 1YI2I 5GPCA 5HODA 1HW2A 1T56A 3SFIA 3FKIJ 5GAHJ 4I76A 4W97A 4QSHA 1QZEA 5E1WA 5IPAA 1IUFA 2QENA 4G9YA 1U2WA 4BU2A 1TLHB 2F5CA 4U7DA 4WWCA 4AM3A 3PFIA 4UVCA 2WC2A 1GV5A 4RB2C 2DOEA 1VQ8I 2R7ZJ 1TL8A 4UVBA 3KEYA 2A07F 3PJRA 4A3CJ 1ETOA 2JT1A 3DLAA 3J7AY 2W84A 1J2XA 4Y17A 2CMPA 4E7SA 3I54A 1OJLA 1QRYA 2VBWA 2GXBA 1LPQA 4UB8C 4ESBA 4JK1X 4MIMA 1JTXA 2K85A 1T6SA 3Q3SA 5F64A 5EEGA 2HS5A 4RAFA 4BQNA 1IJWC 2F4IA 5E8IA 3WTXC 3LFUA 4OIOF 3OYIA 4KJZA 4BS9A 3SZTA 3PSIA 1XSDA 1W5TA 2UV1A 3HHGA 2Z9OA 2YU9J 1PUEE 1BI3A 1AWCA 1EH7A 1ETXA 4DYQA 4QWQA 4PGGA 4V19K 3K7AJ 1W4MA 2XC7A 2PJRB 2Y30A 4B47A 3QP5A 4KMFA 1BJZA 1U5TB 2WAFA 4L9VA 2WB1A 3OYNA 1IDZA 2VT2A 2CW0F 2EPFA 5M5WJ 4WF2A 1IN6A 4A6EA 1OCZH 1FTTA 1ZGWA 3FIWA 2EZHA 2CWEA 5FLXZ 5KAIC 3K4BA 3IH2A 3N97A 1DDNA 4BEHB 3HJEA 1D0XA 2OJED 1S7OA 2Y69H 5CLSA 4LJZF 2ZJQF 4ITVA 2Y75A 2V9VA 3JRHA 2DPUA 2NOJB 2HDWA 1IXRC 2HQ5A 2HQNA 4BACA 2HXIA 3KIOA 4DZPA 2J5PA 2OV7A 2Q2EA 5F04A 2R7RA 1UMQA 2M87A 1O3TA 2XSJC 1ZKGA 3K1NA 5HLIA 2NYXA 1BI0A 1FYMA 2E2IJ 3S15J 1MBGA 3P9CA 3VYSB 2VPRA 5IOZA 3CTAA 2LG4A 4RM2A 2DDBA 3ZGKA 1B8IB 3UNGC 1UJ8A 2L54A 3M8EA 4XMYA 1QGPA 4FE4A 1H89C 2AO9A 2KFDA 2V79A 2X6XA 1P2FA 2JA8J 4DIQA 1K78B 1IXCA 5DCFA 5CVRA 2Y0SN 2EV6A 3VPRA 2BY1A 3ULQB 3D5SC 1LFBA 1Y0NA 4Q4ZF 2IGMA 3ECHA 3ZQQA 1V4RA 4GRIA 2UXXA 3S32A 3H3ZA 4UUSA 4XLPF 2NOGA 2OTLI 1NK2P 3RKWA 2CW8A 1YJNI 4C9YA 2RNJA 4WX9A 4R8HA 4MTEA 4RS8A 1MW7A 4XICA 2F48A 2DA2A 1Z7UA 3OYEA 4G7HF 2XB5A 3P7NA 2K7LA 3TDZC 3ZMZA 1S8NA 1JHHA 2FBHA 1IW7F 3EQLF 2QQ9A 4D1QA 2VC1A 1S6LA 5ILUA 4HX7A 3OYKA 4BE1A 2EZIA 1HKSA 2FQ3A 4HZFA 2HPMA 1PJRA 4D9JA 1P4WA 2VKVA 2CJJA 2PLYA 2HTSA 3OIPA 3OYJA 2XF5A 4ZTJA 1QZYA 3EYYA 2ZCWA 1V5EA 4RGSA 4II3A 4S0HB 3GTPJ 2QLZA 4EJUA 4C3JJ 5KHDA 4X6AJ 3TO9A 4KISA 4HLYA 3CDIA 2KZVA 4Y15A 3SDGA 4Y52J 2K4JA 4KITB 5IT3A 3SDBA 3LAPA 4R1HA 5FFZA 2M5WA 3GTGJ 2QA4I 2A6HF 1MH4A 3HSRA 3HPGA 1SAUA 3OL4A 1D3YA 2DT6A 3RJPA 3MWMA 1DP7P 3BCBA 3WU0A 4TV7A 4Z2YA 2X48A 1R36A 5EZHA 2PEXA 4IRIA 4PJLA 5TJJA 1T0FC 4I99C 5IP6A 1FP2A 3I55I 3D5RC 3L2WA 5J47A 2P6SA 2H1LA 3G6EI 1UB9A 3P9KA 3ERMA 3KFWX 3CO6C 2W57A 2XAGA 1RRJA 3LSGA 4IHXA 3DPTA 3DBLB 3L9FA 5D4SA 4OMZA 3FXRA 3CZ6A 2TCTA 2K86A 3PFYA 1B9NA 1X1DA 2EA4A 4P5OA 1O3SA 1AHDP 2CRGA 1SC7A 1IG7A 3MD2A 3KP4A 4RB1A 2OU2A 5L3DA 3S8PA 1T2KA 2LVSA 3FZVA 4PGHA 3DPUA 1D1BA 3DFGA 1TW2A 3DKXA 3VSKA 5HDGA 4BQQA 2O61A 3IWZA 3MZYA 3GTOJ 1MNEA 2M4KA 1VQMI 4E7ZA 3S3OA 4ASNA 1P4AA 5CQGA 3D1NI 4IQJA 3HB9A 4Q48A 2R7XA 4DZJA 1YW9A 4N4NB 2JUCA 4A3IJ 2XAJA 5CJ9A 4FE7A 3FKJA 2CUZA 1P6RA 4M6VA 4BE2A 5GAGJ 4BJTA 1VFCA 4UV8A 1GVDA 1ZARA 3KP3A 2L7KA 3MKWB 1YIOA 2VKEA 2ZFUA 4HSTA 2JUGA 4B4CA 1YE9A 3BJOA 4XSXF 1FEXA 3WE2A 1MIJA 2LKXA 1YO5C 1NG7A 3OIQA 3BG3A 1MBJA 4E6KG 5DUIA 1Y39A 1W0UA 1MMSA 1I1SA 4HF2A 4CO8A 3D0SA 3QOPA 4M3DA 2B7EA 2LR8A 3H3UA 3U1KA 4PJJA 1KA8A 4PJ0C 3FMSA 2Q1ZB 1T08B 2M1BA 4XRSG 2JRTA 2DT7B 2L0KA 3CCYA 2LF8A 3AG2H 1ZR4A 3BR3A 1A31A 4GXOA 1H8AC 2E19A 3ZCOA 2R7SA 4XLHA 3QWLA 3WU2C 5K5RA 3H9QA 4CYCB 4RBOA 3I53A 2ZXWH 1D5VA 2R93J 2XPUA 2RV8A 3K2ZA 4DW6A 1B8IA 2HYGD 1C0WA 4JX6A 1PP8F 4PK4A 3A1YA 4G6QA 3E5UA 2XDVA 4B43A 3FISA 1OYYA 2HQAA 2CO5A 4JQFA 4PJNA 6PAXA 2K27A 1XGNA 2VXZA 2KLOA 2NVQJ 4RGRA 3LSPA 2DOAA 1GLNA 3DPLC 4LIVA 2YUSA 3RKQA 2HOEA 5EGOB 1IXSB 2OZ6A 3GUDA 5DUKA 2XUBA 5JVGF 4CHUA 2ZSIB 2CG4A 3CMYA 3AG3H 2IS4A 3W6KB 1AA7A 2Y9YA 3ASOH 3I71A 4EMSA 1A6QA 3EUAA 3BR6A 4N0BA 3V8LA 1RUOA 4XORA 5E1ZB 3H0DA 1LFPA 4HDUA 2QKLB 3M1EA 2KDOA 2W82A 3F0CA 3DWLE 1MMNA 3F3XA 4XLAA 4OMYA 2BVMA 2HKXA 3WU1B 1QHGA 2VE8A 1S5LC 2PMZN 3ABMH 4OIPF 4LK1F 2W85A 3F8FA 2GXAA 2CQXA 1BC7C 2KRFA 5FFXA 5DDGA 2R92J 4OIRF 5DM7F 5GAEJ 4ZYDA 1Y1VJ 3HYIA 2DOFA 2FNAA 4RM3A 2ZJPF 2ETHA 3MN2A 4S04A 1MMAA 1R22A 3KLNA 4HDVA 5L3BA 1X4OA 1LQ1A 5F08A 1FSEA 4FX0A 2HVRA 3QODA 2QGUA 4HQEA 2F4OB 1S3JA 4B09A 2K3PA 1TQPA 2IS2A 1LDDA 4DJAA 1O3RA 2GM4A 3F23A 4QTRA 4CH7A 2A3SA 5FB2A 3OOUA 4RMNA 1Z3YA 5DD8A 4J01A 5FLXK 4B44A 4I0BA 1HQCA 4N9HA 2X51A 4S05A 3SZGA 1T95A 1SD4A 5F0HA 2DQLA 2HU9A 4IHSA 3DEEA 4D7MA 1R49A 5L3FA 1UCRA 4CCOA 2DT5A 3WGGA 1T38A 2E60A 1HF0A 2G0EA 3EYIA 2IPQX 2JMWA 2JQ7A 1ZN2A 5IYDJ 3BZCA 4DBRA 2NXNB 4M71A 2DA5A 1FBQA 3BPXA 2EBIA 1NH3A 3OV8A 2NNYA 2XPVA 5J1UA 3PQKA 4KIGA 1F5TA 1B4AA 4C2MJ 2Y9ZA 1HDDC 4OOIA 4DYCA 5HVQC 1Z05A 3B6AA 1ETVA 4B8XA 3FXMA 3I59A 4I2OA 4C30A 3CC4I 2P7CB 3DCFA 5LGUA 1MDMA 2UXNA 1JHFA 2XAQA 5FO5A 1QBJA 3LA3A 1JGGA 3ZMUA 3DQVC 2WTEA 4HX8A 4F7ZA 4M9ZA 3JR9A 2X6OA 3HBLA 4XNFA 3BOQA 1REPC 2VODA 3ISPA 1ETQA 1WJDA 4J19A 2K4BA 4DOZA 1TTYA 3Q9VA 2PI0A 1H9GA 2RKHA 1QA6A 1NK3P 2CS3A 4AU7A 2L2OA 1SD6A 5CVVA 2BY0A 2EIJH 1I3AA 3TOBA 2V26A 5CVJA 1CGPA 1OCRH 3A02A 4N9IA 4CSWA 2P5KA 1LNWA 3C7JA 3CCMI 3FWEA 2K40A 4CCJA 1B59A 3QAHA 4HA8A 1I3QJ 2GXGA 2FNPA 2XPWA 4HBLA 2E7XA 1J5YA 1R4MB 4I0AA 2IRFG 1BN5A 3TW7A 1XS9A 1M1EB 2LNBA 4OAZA 2R7QA 3HIFA 3GTJJ 3KEOA 1DP3A 4EJWA 2HZTA 3MZHA 4XK4A 1LEAA 5K7HA 1O57A 2XKOA 4M9SA 3BY6A 1MJBA 4L18B 3S1MJ 1U78A 1QPIA 2DMUA 3BTJA 2DJNA 5KAFC 2E35A 3GBGA 2MD0A 2D2WA 4JP0A 1IN8A 4CUGA 1AOYA 5C44J 1WZ2A 3OR2C 3P5JA 4GDFA 3DU5A 4KT6A 2JA6J 3E7LA 3PNTA 1ONVA 1A04A 1VI0A 4IOCF 4IQ4A 2KDZA 3R0AA 4IZZA 4KNYA 4XKVA 2V7FA 4RLFA 2ELKA 4BNCA 4EM0B 2AQEA 4NQWA 2EV5A 3BR0A 3FDYA 3NARA 1YX5A 1OYIA 3MKZA 3OMYA 2M8GX 2CQKA 2L7ZA 3CLOA 3BR1A 5M3FJ 3DTKA 2O7OA 2F5DA 1ORKA 2HZDA 4BHBA 5ERIA 3TKYA 4ENKA 2F2EA 2HGCA 3J81Z 1IRXA 5C3EJ 3H1CA 4HNTA 2R5ZA 3S2DJ 4FISA 4EVIA 3S3NA 1WHUA 4LLLA 3G4SI 1YLFA 2EV0A 3MMYB 2LLKA 4A5MA 2OD5A 5ICCA 4HYEA 3RKXA 1Z6RA 2XV4S 3GWZA 3LSRA 3JTHA 2JN6A 3HSEA 1EF4A 2EFQA 2BW3A 1OPCA 2V1UA 2DBBA 1SFOJ 3CMMA 5E3LA 1GHCA 3A03A 4IRGA 4M74A 1I6XA 1ZK8A 3M8FA 3BCAA 5CVUA 1JUMA 1WJ5A 3CP2A 4LFUA 1STZA 2W24A 2IXSA 3ZN1A 1ACIA 1ON1A 4FX4A 4C2TA 3S1NJ 2OUMA 3I3LA 4H0EA 2EINH 5LGNA 2VBZA 1QVUA 2BE5F 2ZC2A 2TRTA 4ZDOA 3F21A 2MA3A 5FJ8J 3PO2J 3CCLI 3BZKA 1HXDA 3HOWJ 1K6YA 1KU9A 3ECOA 3E3VA 1YG2A 4U7BA 3W6VA 3HOYJ 1W7PD 2HXOA 2HR3A 3LQQA 3BROA 5TGTA 3TDUC 3VFZA 4CICA 3CCJI 3RYPA 2LKPA 2BYVE 2MG4A 3C18A 4A3BJ 5A2QZ 3F8MA 2QQAA 2VBYA 4PFOA 3KETA 3TOAA 1K7AA 3OSGA 1MJ9A 3DV8A 4UY8I 2VOPA 3OWTA 3F8BA 4ESJA 3C2GA 4BXXJ 5IYBJ 4XKBA 1QNTA 2UUZA 2QWWA 3MCZA 1K78A 4HOBA 3H5NA 2EFPA 3TQNA 5KVRA 2M2EA 3FF5A 3KP2A 2E1OA 2K9MA 4LB5A 4ENMA 3I0TA 1IDYA 5FKKA 3OS0A 4L0ZB 1R4NB 2E5NA 4FT8A 3RTRA 3V7CA 4DBQA 2YR2A 1BC8C 5JR3A 4V2FA 2MSYA 4UUSB 1P9QC 2XAUA 3PL8A 5FKOA 3DEWA 3QYBA 4F3QA 2LKSA 1ZRDA 4XOPA 2XGEA 5IYCJ 4W1UA 3GFIA 4YRVA 2X85A 4YFKF 1V5GA 3FXUA 1G8XA 1XDSA 2PBIA 3ONQA 1TT0A 2ISYA 4A0ZA 4Q5SF 1FIAA 1MBFA 2DK8A 2I8DA 1F36A 4M72A 5AIPA 4ZZLA 5H2FC 3CCRI 3U9GA 1KU3A 3RQ4A 3G1OA 1G3WA 5H20A 3B73A 4ESFA 4FETA 3A2KA 4UXNA 3SYTA 2FOKA 4UNOA 5FKMA 1A35A 1N78A 1J59A 4CZZA 2ZMEB 4IHTA 4E7KA 3BP8A 2WY8Q 3KEQA 3S3MA 1K4TA 4A0XA 1JT6A 3OYBA 5D5VB 1OYWA 5LLQA 2P81A 1IF1A 4O3MA 4BYYA 2UZKA 4XR6A 3NAUA 3K0LA 1LUJB 3CCEI 1J75A 3ABUA 1T98A 4HLXA 1NHAA 2NRAC 1NTCA 4JX5A 2W1OA 1HOMA 2PMHA 3VB2A 1I27A 1VQPI 1HW5A 3SEZA 1W5CC 2EIMH 5LHHA 5GP9A 3BWGA 2E71A 2DYRH 3JRGA 1UHMA 1RNLA 5F1RA 1PP7U 3CDHA 2LH9A 2WWYA 2L01A 4XONA 2XAFA 3TGNA 3GTLJ 3QYEA 1W36C 1W5SA 2FQ4A 2L7MP 2IAIA 3BG6A 1X3ZB 1MD0A 1IC8A 3T5XA 5ED4A 2LSOA 1RR7A 4RGXA 3DU6A 3B6CA 3U21A 1LB2A 5DCMA 3QU6A 1WH7A 2D1HA 4ZZDA 5EF6A 4CYCA 4MEXF 1EA3A 1QQIA 3DXJF 5FKLA 1TNTA 4NBQA 4IHYA 4FTHA 2K9NA 2V6EA 4Y3OA 4XLFA 3CQZJ 4BHPA 4LIUA 3OL3A 2LDUA 2CUJA 2HVSA 2XRLA 3WG9A 3K70C 1YS7A 1SVOA 4LGWA 3ZQLA 3K1PA 2BHYA 3IKTA 4ZH4F 2VJJA 4BQOA 2DMQA 1TWAJ 4A0YA 3E1SA 3QOEA 4UHTA 3KPHA 2CUEA 5HS7A 4Y33A 3DTEA 2BY3A 2GWRA 4HPQA 4UV9A 2A5YB 3GTQJ 3CJTB 1IRZA 3K70D 1FMWA 1D8JA 3GZNB 3BG5A 2Y0MA 2COMA 4NUBA 4U88A 1DGWY 3MZ8A 3E5XA 4EM2A 4M3FA 3SEQA 5HDKA 1MSFC 3TO7A 1IN5A 3CMEI 3W2AA 3AFHA 1ZRCA 2VB6A 5BOXA 1ON2A 4HX4A 1JI8A 2M8EA 3EUHC 2CU7A 2CQQA 3ZMSA 1Z0XA 3MFKA 3PUFA 2IA0A 1XD7A 5E8GA 2STTA 3V8KA 1Z91A 4WK8F 2K3FA 4EEFG 4EV0A 1ZG3A 5F6FA 1YW8A 5E20A 1H88C 1USTA 2XGDA 1I6HJ 3BTIA 3JW4A 4YFXF 3O6BB 2H27A 3Q9SA 1PYVA 2FBKA 1XMAA 2ZSHB 2GZWA 1X4PA 2A05A 1UHWA 1VF9A 3JAMK 3E5QA 3M4OJ 4DQ2A 2R5YA 1BJAA 4A3JJ 2KJCA 5ICFA 2Z99A 4ZC3A 4BQAA 3GFMA 1XSVA 2EIKH 1ZR2A 4F55A 1HKQA 2AXLA 4XKWA 3JRAA 4U0VA 4LB6B 3K4CA 2H09A 3PQJA 5HNFA 1WGXA 1I1GA 1YYVA 4MTDA 5JLXA 1TQIA 4NQWB 4KYWA 3LSIA 4NC8A 2ZBKA 2NS8A 3EUKL 2X1CA 4FQGA 1BOAA 1YITI 3OYGA 1AU7A 3HRUA 2A61A 4IPAA 3CCQI 3DBHB 2ID3A 3TP3A 4C2UA 5LHIA 4B48A 1V3FA 2GBYA 2MBFA 3BT9A 3NWSA 3QPSA 2R5ZB 4NDLA 3RI4A 3IRRA 2KT0A 2BOLA 1TP4A 4A3GJ 2IS6A 5GADJ 4OINF 2W7NA 1J09A 4C3IJ 3FXJA 3E6CC 3A0BC 2Z5UA 1XN7A 4AWXB 1XGOA 3MKYB 5C4XJ 2ME0A 2JRMA 1QZZA 2EK5A 4BY7J 1HSTA 4PJMA 2IJLA 3CUQA 1SD5A 3RYRA 5H6RA 5J8FA 3LSJA 3JTGA 2VE9A 2MH2A 2DXIA 2IEKA 2DFFA 2I10A 5LBQA 5LHGA 2EQRA 4RA2A 2RREA 3KCCA 1MSEC 3HUGB 3KP5A 3IUOA 2KZGA 1W7PB 1YHQI 1ENHA 3KZIC 4CCKA 2WB1N 1MGTA 1NG6A 3GFJA 3ZR8X 3R4KA 1ZREA 2WAQA 4QIWN 1Y56A 1BW5A 1ULYA 4IHWA 1BBYA 1HSJA 3A01A 2WV1A 4WXCA 2H1KA 5FROA 4R79A 3GLXA 1FIPA 3AAFA 3DEUA 5K1YA 2FJ1A 2Y31A 4L9TA 1LVKA 1G4DA 5B1BH 4WXHA 1VQ4I 4X0GA 1SD7A 3TO6A 2DA7A 2JK3A 2V1DA 2LBFA 2QF7A 2FXAA 3VSLA 1W0TA 1TT5B 2OQRA 3GFLA 1WH5A 4UUVA 3OSFA 1DGRM 1F4KA 1MBEA 2VXDA 1U0JA 1CQTA 1EJ9A 1UHSA 2G9WA 4ZJZA 3HEFA 2O5RA 4OU0A 4P9FA 1R9TJ 1JJ8C 4O5VA 4M6YA 4A3DJ 2E7WA 2GOXB 4I98B 3UKGA 4M3EA 2YPRA 5ILSA 3P9IA 5DTDA 4I09A 4BUPA 4U0WA 3HRSA 2RN7A 3DTIA 4BY1J 1DPUA 1SFUA 3NEUA 1TW3A 2QUFA 1A5JA 3LFKA 2F5EA 4MO7A 4HRIA 3DP7A 1KONA 2K9SA 2DCEA 1Z1DA 2LK2A 3HTSB 3BQYA 1R6RA 2DMNA 3IHUA 3M8JA 2F4MB 2CGPA 2ECCA 2FOWA 2RVCA 3WTSC 3PIOF 3JRFA 2NAZA 2WAQN 3IAM2 2OPTA 3HGYA 2Y2ZA 5DS9A 5CVIA 4YEJA 1J9IA 2OAZA 3I9V2 2M7AA 3PIPF 4FASD 3BLYA 3VYRB 3ZQCA 4MEYF 2GA2A 4XSZF 2YX4A 4CXFA 2GIZA 1XMKA 4IX7A 5EJCA 3HZJA 3WG7H 4KN4X 2GIVA 3IH4A 2EA2A 1ZELA 2NVTJ 1FOWA 3ABLH 2XROA 2XF7A 4MLOA 3T8RA 5B3SH 3S2HJ 2EB7A 4ZYAA 1X1CA 3O8GA 1WJEA 3K4MA 2A6EF 3HOUJ 4LG0A 1YJ9I 4L0YB 2ZXHA 2PMUA 2DW4A 4LLGF 3CP8A 5EDNA 1E3PA 4E70A 1KQ0A 4HQMA 2LY2A 4PDKA 5DV5A 1V5FA 3E6DA 1R5ID 1Z21A 5KK1A 1X3WB 3H5RA 1O7LA 2HI3A 2IA2A 2FEZA 3V7SA 1R1VA 5EG0A 3KYLA 4U87A 2IGNA 4MHGA 1D5YA 2KRHA 2EFNA 2D5VA 2UWMA 2K9LA 5BQTA 4AYBA 2MFZA 1TC3C 5M5YJ 4MFEA 1IGNA 2KHMA 3BQZA 3CMAI 4IEJA 3R6SA 3IH3A 3IRQA 2LREA 1YQAA 1Y6IA 5BPIA 4A12A 3DLLF 2V6CA 2ZXJA 3KLOA 4N4OB 1U3EM 1MNDA 4G12A 3X2QH 4YFNF 5D5WB 3FXKA 3OYMA 2LYCA 5CYVA 2I5UA 2EH3A 1L0OC 3BTLA 4D7NA 3JRCA 2CV2A 2R7DA 2OCEA 3ZQGA 1WJBA 1G3YA 4M73A 3I59B 4F91B 4RAGA 3JCUC 2CQNA 4XKCA 1SANA 2LD5A 3F22A 5ICGA 2DA1A 5BS6A 3FBIB 3GVAA 5FD6A 4XLEA 3H3VK 2JSPA 2GA1A 4ZYEA 4BGDA 2DFIA 3ZN0A 4CYDA 2RAEA 3F72A 2Z3YA 4EJVA 4ENJA 2DLLA 1APLC 1VZ0A 3CF2A 1U9NA 1ETKA 2XSDC 3O2PE 2EZLA 1E3HA 1B6AA 3HRTA 3QP6A 2RGVA 4ZDLA 3I4MJ 1HCRA 3E97A 2HDDA 5EYRA 3HG9A 3FXQA 4YIIA 1J7KA 1RI7A 2KIFA 3KX2A 3SJMA 2DJIA 3CCUI 1XGMA 5LEJA 2DFHA 3GEZA 3BR2A 1R00A 1OLTA 3L7WA 4KIBA 3WTWC 3FX3A 4O6JA 3HSFA 1Q1VA 3FK7A 5F27A 4LMYA 1YIJI 3O8HA 2X0LA 3O3KA 2MGQA 2FBIA 2E1MC 3I58A 1GXQA 1JXSA 4E7LA 1ODDA 1FZPB 4OIQF 1F1ZA 1FY7A 1V54H 4ABZA 2M0CA 2BBYA 1MMGA 4RAZA 2P5LC 1EV7A 5E79C 3WHCA 5BNGA 5F0CA 3GF2A 2XASA 2MW8A 3CC7I 1JKRC 3BG7A 1D0ZA 1BR4A 2K5CA 5J3LA 1IN7A 1FTZA 4JOMA 1Z67A 3L2CA 1AKHB 3Q0WA 5DCMB 4A3FJ 3U1DA 4EGZA 4GCVA 2E34A 2HNHA 1T39A 4AYBN 1TBXA 3MQ0A 2CV0A 3LOCA 5J4VA 2DDAA 1JUPA 4NC7A 2CH0A 5K7FA 4AIJA 1LKXA 2OA4A 3S16J 3GMEA 2XRNA 2VQGA 2YU3A 5J1YA 4JYKA 1UG2A 1Y1WJ 3FBNB 5J8CA 4J00A 4BHCA 2R7OA 1H9TA 2CFOA 1Y8RB 2E36A 1XSXA 4HV5A 1RKTA 1X3UA 3RSNA 4E4HA 3GYHX 3DKWA 1WQ2A 2VQCA 1U5TC 1XTAA 2ESHA 5F0FA 3MAJA 1BI2A 5JFRA 3KP7A 1YRNA 2KKOA 3V8JA 2IW5A 5EZGA 2ZKZA 2DA6A 4BE0A 1USSA 2QCOA 3OYAA 2VONA 1CF7A 3S14J 1JKQC 1VQ5I 4KUMA 1QO0D 4L5EA 4ANJA 4ENNA 2E5ZA 2RDPA 3ESWB 1K79A 4A3MJ 3FMRA 3E6BA 4M3GA 2ESNA 1FBUA 2MC3A 5JI6A 1VTNC 1IN4A 3K4KA 2OZUA 1OCTC 1ZQ3P 2H94A 1VQLI 2M9HA 1D1AA 1S9HA 3RPQA 2JA5J 5FRMA 2DMPA 2WV0A 2MABA 1ETYA 4XL9A 4BL0B 3J7YJ 2LP0A 2BY2A 1TQMA 2VLAA 3HUGA 1WJFA 1WJCA 3ABTA 3DBRB 4P96A 1U5TA 2XVCA 2LY9A 2N8GA 3E0JB 1FC3A 2KIMA 1BOBA 2A68F 1U9OA 3L2RA 1IRFA 5L3GA 1QPMA 3PNVA 1OMIA 2BZTA 2FMLA 1R23A 3H9JA 3F8NA 3LSTA 3KZYA 5M3MJ 2ZJRF 4E7HA 1KZHA 2P7VB 1KGSA 1KYZA 2V4JC 4BJ6C 3RPUA 1WJAA 3CJRB 3D5LA 3ZRGA 1R58A 3ZP5A 2HOSA 4NHJA 3LMMA 2JWTA 3TMOA 3LNQA 1HW1A 2PMZA 1SMTA 3KE2A 5FKNA 3RPUD 1E17A 3LL7A 4XLCA 3OYCA 3OY9A 2A6TA 4G6DA 4U0YA 2CW7A 3V4GA 1VQKI 5E3OA 1JT0A 1EH6A 2IGOA 1RR8C 1GDTA 2XGXA 1DU0A 1FPQA 3M7GA 2XB0X 3RQIA 4KT5C 2DAOA 2XGCA 5EEHA 1ZG5A 4LOCA 1SFKA 2QQBA 3FM3A 1LFUP 1LE8B 1BIAA 3LSKA 1P7JA 4P1WA 2PG4A 2ZJ2A 3RZDJ 3SHFA 1IRGA 2AHQA 4AIDA 2B0LA 4LK0F 2XIGA 2LC2A 4I01A 3HGGA 2D45A 1ZYRF 2IGKA 2QQ8A 2H8WA 1S72I 2ZMEA 1K4SA 4GYGA 2P8TA 1N75A 2EZKA 1RIOH 3VYUB 3LA2A 1OCOH 2Y0SA 5J6XA 1F9NA 1T33A 5LRRA 5C4JJ 2HOTA 2MC4A 2HTJA 1WFXA 3VWBA 1DU6A 1ZAOA 1EKEA 2F5FA 2ADUA 3SQNA 4G7OF 1U6GA 4MNUA 4M6XA 3F8CA 3V7RA 4JBAA 3I5UA 4E7JA 1YX3A 3IC7A 1XX5A 5FD5A 5KNLA 4BEHA 1MZBA 2M34A 3IKVA 3ZQFA 4WCGA 1OR7A 1DPRA 1TNSA 2DA3A 4MQVA 2H8RA 5LGTA 1SAXA 3JSOA 2A69F 5A2QK 5D5UB 2MLKA 5EEAA 1GUUA 5B1AH 3T8TA 3WODF 3H35A 4L5IA 3OOPA 4H4KC 2ZB9A 3NQOA 3COAC 1POGA 3RKYA 5D6EA 1IV8A 3AL0C 1IUYA 2V9KA 3ELKA 3ZMDA 3H5AA 1SEUA 3G1MA 1JJ6C 1SMYF 2ME6A 3OR1C 4M3BA 2K02A 5J40A 1MJAA 4HV6A 2Z16A 3ZOBA 2VOOA 1GVJA 1Z3XA 1EH8A 1R7JA 3TBIA 1N25A 1OCPA 4I7HA 5HNHA 2HWVA 2NS0A 1Y0UA 1IZ1A 4OWRB 1YJWI 3PO3J 5HLGA 3HRMA 1XG1A 4EGYA 1HBXG 1JTYA 4I02A 1KU2A 2KIQA 5D4RA 3GCMA 1LDJA 2LMDA 3HOZJ 4A69C 3REOA 1WI3A 2OQGA 1SFEA 3F6VA 2E1NA 4B3AA 1RKWA 5F1JA 3QPLA 1T0FA 4C3HJ 1FMVA 5D6FA 4NNJA 3JRBA 3AL0B 4Z6YA 2DODA 3N05A 2PFBA 1UG0A 2OF7A 4CGZA 4ZYGA 2BEOA 3QRFF 1KQ9A 1O7FA 3VDXA 4YELA 4ZTFA 4DGWB 1OQYA 2FSWA 4A5NA 5HLTA 1BL0A 2JA7J 4FCYA 1JE8A 3J80K 2BW3B 2ZXIA 1TWHJ 5HS9A 3CCSI 2VBXA
chains in the Genus database with same CATH topology
2EJRA 1R5GA 3BZ6A 5HS8A 2ISZA 3GZ6A 4KA4A 4G8XA 1XCBA 2EWNA 2V1XA 3R60A 1FYKA 2P5VA 3EETA 3SXYA 3ZPLA 3KZZA 1BM9A 5FGMA 1JGSA 3ZMTA 3K9TA 4RAYA 1XDUA 3DF8A 2IVMA 4K2EA 5L3EA 4MQ9F 2IP2A 3CUQC 3T1BA 3WTTC 4KICA 2GQQA 4G7ZF 1FLIA 3CO7C 2FRHA 4KFCA 2HEOA 1KQ8A 1LVAA 1P92A 4BAYA 3C1DA 2MLGA 2HDCA 1FSHA 4CDGA 5JHUA 3LAJA 2DI3A 2MD5A 2JTVA 1GXPA 4PZJA 2Y48A 2PJPA 2P4WA 2OBPA 3BPVA 1LDKB 2R7FA 1CF7B 2MH9A 2CFXA 5E1XA 4RB0A 1OKRA 1L3LA 1U8RA 4AD9A 4YIFA 4MGRA 1B9MA 4UVAA 3VOEA 3QU3A 1DUXC 3M9AA 1FYLA 4KDPA 2W25A 1G6NA 3W6JB 2VC0A 4HF0A 3ROUA 3G3ZA 4EM1A 3WGIA 3C3WA 1XB4A 3IL2A 2E1CA 2VT3A 2FE3A 1YW7A 1FOKA 2YSRA 1HKTA 3NRVA 3WTZA 1YS6A 2HKOA 2X4HA 5BPDA 3H92A 1O3QA 2JPBA 3FM5A 5JVTA 2CYYA 2TDXA 3EDPA 5K5OA 1G3TA 1FNNA 1Z6TA 5AONA 1PDNC 3WTUC 1W7PA 3JSPA 4A6DA 3R0JA 1LEBA 3LWFA 2DPDA 3BJ6A 1K6OA 4BH9A 3EUHA 5ILVA 3HOTA 1SFXA 3S2WA 5D5XB 2KIUA 2M30A 2ACJA 4NB5A 3HOSA 1FWZA 3BJAA 4LD5A 3WGHA 2QVOA 3JAMZ 2QM3A 1B1BA 3GXOA 2PN6A 4G94A 1ZRFA 5D8KB 2ZNZA 1S7AA 5LEKA 5IT9K 1LJ9A 5E18F 2CSOA 5H6QA 2P6TA 2ZO4A 3J7AO 1J0RA 2L3DA 4WXDA 1S29A 3LA7A 4Y13A 1KYWA 3KP6A 1MKMA 5HLHA 4AVPA 1ZG1A 1P4XA 3GO5A 4KIFA 4PCQA 4XBFA 3E6MA 4GGGA 3I4PA 3SFZA 1WRJA 2M45A 4DNCA 1YTYA 4RB3C 4ON0A 2GAUA 1R5HA 4A2UA 3R61A 4QLCU 4LG0B 4EJTA 5HDNA 3FHZA 2FF4A 2BV6A 2HQRA 2HFHA 4L9NA 5DEQA 2DU9A 3CJNA 3Q5FA 2JPCA 4KN7X 3B02A 2DO7A 2G7UA 2QZ8A 2L4MA 2XKPA 3WTYC 1YFHA 3L09A 2IT0A 2DK5A 2O8XA 3ZMVA 4RGUA 2R3SA 3ERED 3GZ5A 5DYMA 3SZPA 4ETSA 2RQPA 2BGCA 2O6GE 4IVNA 1WSUA 4IJAA 4LLNA 1R1UA 2ELHA 3J80Z 1WI9A 5L3CA 2O03A 3HTUA 2Q8KA 1IAWA 2DQRA 3G73A 1D8KA 4BXUA 3RDIA 4EQQA 3K1MA 4GO1A 3QPTA 5HOOA 4D0PA 2H6CA 2PQ8A 5BMZA 1WKMA 2QBYB 2FMYA 3L00A 4P55A 1E2XA 4IRHA 3VODA 1XGSA 4EJOA 3I64A 4IXAA 2O0YA 1H0MA 2C6YA 3WE3A 1XCVA 1FX7A 3K69A 4AIHA 3QPHA 1MDMB 2KJBA 2JZYA 4Q47A 2O3FA 3CUOA 1ZLKA 2FA5A 2DTRA 5LRSA 1ZHFA 4HF1A 4GYIA 3IWFA 5IT9Z 3HHHA 3F6OA 2LF7A 1ZH5A 1UFMA 1BIBA 3CUQB 3GW2A 2Z33A 2L4AA 5AIQA 1WWXA 2L02A 1FP1D 2STWA 3ZQ7A 5E17F 1FBSA 2ZFWA 4XLNF 1G3SA 1ZGAA 3VEPA 1ZGJA 1Q1HA 1RZ4A 3LQRA 1ZLJA 2EFWA 4XRFA 3N4MA 2XAHA 2AS5F 2H6BA 2D1VA 2YX7A 2VN2A 5K5QA 5D8LB 1BI1A 3FMQA 2J5OA 3J81K 3GX4X 3T0YA 3WTVC 4FHTA 4M9XA 2EFOA 2Q0OA 1FT9A 4IF4A 1KU7A 3ML6A 2QBYA 1R1TA 4KMUX 5TRDA 2RC4A 1Z9CA 2JSCA 4L9JA 4YG2F 3MEXA 3BDDA 4HW0A 1I5ZA 2XHKA 3U2RA 2IA1A 5DD4A 4AIKA 3RIRA 4ZYHA 2NNNA 5ICEA 2G7HA 4P9UA 4L5JA 2FU4A 1RUNA 2ZNYA 2QYOA 4HAMA 2HYFA 1HW2A 5E1WA 4G9YA 2QENA 1U2WA 1TLHB 2F5CA 4U7DA 4WWCA 3PFIA 4UVCA 2WC2A 4RB2C 4UVBA 2A07F 2JT1A 2W84A 1J2XA 4Y17A 3I54A 2VBWA 2GXBA 4ESBA 4JK1X 1T6SA 5F64A 5EEGA 2HS5A 5E8IA 3WTXC 4OIOF 3SZTA 1XSDA 1W5TA 3HHGA 2Z9OA 1PUEE 1BI3A 1AWCA 1EH7A 4QWQA 4PGGA 1W4MA 3QP5A 4KMFA 1U5TB 4L9VA 2VT2A 2CW0F 4WF2A 1IN6A 4A6EA 5FLXZ 2CWEA 3N97A 1DDNA 1S7OA 5CLSA 4LJZF 2Y75A 2V9VA 2DPUA 2HQNA 1IXRC 2J5PA 2Q2EA 2M87A 1O3TA 3K1NA 5HLIA 1FYMA 2NYXA 1BI0A 3P9CA 3CTAA 2L54A 3M8EA 1QGPA 2V79A 1P2FA 1K78B 1IXCA 5DCFA 5CVRA 2EV6A 3ULQB 4Q4ZF 3ECHA 1V4RA 2UXXA 3H3ZA 4XLPF 3RKWA 2RNJA 4WX9A 4R8HA 4MTEA 4RS8A 1Z7UA 4G7HF 3P7NA 2K7LA 3TDZC 3ZMZA 1S8NA 1JHHA 2FBHA 1IW7F 3EQLF 2QQ9A 2VC1A 1S6LA 5ILUA 4HX7A 1HKSA 2FQ3A 4HZFA 1P4WA 2PLYA 2HTSA 1QZYA 3EYYA 2ZCWA 4RGSA 2QLZA 4EJUA 3TO9A 4HLYA 4Y15A 2K4JA 5IT3A 3LAPA 4R1HA 5FFZA 2M5WA 2A6HF 3HSRA 1D3YA 3RJPA 3MWMA 1DP7P 3WU0A 4TV7A 4Z2YA 1R36A 2PEXA 4IRIA 5TJJA 1FP2A 2P6SA 1UB9A 3P9KA 3KFWX 3CO6C 2W57A 2XAGA 3DPTA 3L9FA 5D4SA 4OMZA 3FXRA 2K86A 1B9NA 2EA4A 4P5OA 1O3SA 3KP4A 4RB1A 2OU2A 5L3DA 1T2KA 3FZVA 4PGHA 3DFGA 1TW2A 5HDGA 2O61A 3IWZA 3MZYA 4ASNA 1P4AA 4Q48A 1YW9A 2XAJA 5CJ9A 1P6RA 4UV8A 1ZARA 3KP3A 1YIOA 3BJOA 4XSXF 3WE2A 1YO5C 5DUIA 1I1SA 4HF2A 4CO8A 3D0SA 3QOPA 3H3UA 1KA8A 3FMSA 2M1BA 2JRTA 2LF8A 4GXOA 5K5RA 3I53A 1D5VA 2RV8A 3K2ZA 2HYGD 1C0WA 1PP8F 4G6QA 3E5UA 1OYYA 2CO5A 4JQFA 6PAXA 2K27A 1XGNA 2VXZA 4RGRA 3DPLC 2HOEA 1IXSB 2OZ6A 3GUDA 5DUKA 2XUBA 4CHUA 2CG4A 3W6KB 3I71A 4EMSA 4N0BA 3V8LA 1RUOA 5E1ZB 4HDUA 3M1EA 3F3XA 4OMYA 2HKXA 3WU1B 2VE8A 4OIPF 4LK1F 2W85A 3F8FA 1BC7C 2KRFA 5FFXA 5DDGA 4OIRF 4ZYDA 3HYIA 2FNAA 2ETHA 4S04A 1R22A 3KLNA 4HDVA 5L3BA 1LQ1A 1FSEA 4FX0A 4HQEA 1S3JA 4B09A 1TQPA 1LDDA 1O3RA 3F23A 2A3SA 5FB2A 5DD8A 5FLXK 4I0BA 1HQCA 4N9HA 4S05A 1SD4A 2DQLA 4IHSA 5L3FA 1UCRA 2DT5A 3WGGA 1T38A 3EYIA 2IPQX 1ZN2A 4M71A 1FBQA 3BPXA 3OV8A 2NNYA 3PQKA 4KIGA 1F5TA 1B4AA 4OOIA 5HVQC 1Z05A 4B8XA 3I59A 4I2OA 2P7CB 5LGUA 1QBJA 1MDMA 2UXNA 1JHFA 2XAQA 5FO5A 3LA3A 3ZMUA 3DQVC 2WTEA 4HX8A 4F7ZA 4M9ZA 3BOQA 1REPC 2VODA 3ISPA 2K4BA 1TTYA 3Q9VA 2PI0A 1H9GA 2RKHA 1SD6A 5CVVA 3TOBA 5CVJA 1CGPA 4N9IA 2P5KA 1LNWA 3C7JA 3FWEA 1B59A 3QAHA 4HA8A 2GXGA 2FNPA 4HBLA 2E7XA 1J5YA 4I0AA 2IRFG 1BN5A 2LNBA 3HIFA 3KEOA 4EJWA 2HZTA 3MZHA 1LEAA 1O57A 2XKOA 4M9SA 3BY6A 1MJBA 4L18B 1U78A 2D2WA 1IN8A 1AOYA 1ONVA 1A04A 3R0AA 4KNYA 4BNCA 4EM0B 4NQWA 2EV5A 1OYIA 2CQKA 3CLOA 2F5DA 4BHBA 5ERIA 3TKYA 4ENKA 2F2EA 2HGCA 3J81Z 4EVIA 4LLLA 1YLFA 2EV0A 4A5MA 2OD5A 5ICCA 4HYEA 3RKXA 1Z6RA 2XV4S 3GWZA 3JTHA 3HSEA 2EFQA 2V1UA 1OPCA 2DBBA 1GHCA 4IRGA 4M74A 1I6XA 3M8FA 5CVUA 4LFUA 1STZA 2W24A 3ZN1A 1ON1A 4FX4A 4H0EA 5LGNA 2VBZA 2BE5F 3F21A 2MA3A 1HXDA 1KU9A 3ECOA 3E3VA 1YG2A 4U7BA 1W7PD 2HR3A 3LQQA 3BROA 3TDUC 3VFZA 4CICA 3RYPA 2LKPA 2BYVE 3C18A 5A2QZ 3F8MA 2QQAA 2VBYA 3KETA 3TOAA 1K7AA 1MJ9A 3DV8A 2VOPA 3F8BA 4ESJA 1QNTA 2QWWA 3MCZA 1K78A 4HOBA 2EFPA 3TQNA 5KVRA 3FF5A 3KP2A 4LB5A 4ENMA 3I0TA 4L0ZB 4FT8A 3RTRA 3V7CA 2YR2A 1BC8C 5JR3A 1ZRDA 3GFIA 4YFKF 3FXUA 1XDSA 2PBIA 2ISYA 4A0ZA 4Q5SF 2DK8A 4M72A 5AIPA 4ZZLA 3U9GA 1KU3A 5H20A 1G3WA 3B73A 4ESFA 4UXNA 2FOKA 4UNOA 1J59A 4CZZA 2ZMEB 4IHTA 3BP8A 3KEQA 4A0XA 5D5VB 1OYWA 5LLQA 1IF1A 4O3MA 4BYYA 2UZKA 3K0LA 1J75A 3ABUA 1T98A 4HLXA 1NHAA 2NRAC 2PMHA 3VB2A 1I27A 1HW5A 5LHHA 3BWGA 1UHMA 1RNLA 5F1RA 1PP7U 3CDHA 2WWYA 2L01A 2XAFA 3TGNA 1W5SA 1MD0A 3T5XA 5ED4A 2LSOA 4RGXA 1LB2A 5DCMA 3QU6A 2D1HA 4ZZDA 4MEXF 1QQIA 3DXJF 1TNTA 4BHPA 2LDUA 3WG9A 1YS7A 4LGWA 3K1PA 3IKTA 4ZH4F 4A0YA 4UHTA 5HS7A 2GWRA 4UV9A 2A5YB 1D8JA 2Y0MA 2COMA 4U88A 3E5XA 4EM2A 5HDKA 3TO7A 1IN5A 1ZRCA 5BOXA 1ON2A 4HX4A 2M8EA 3ZMSA 3MFKA 2IA0A 1XD7A 5E8GA 2STTA 3V8KA 1Z91A 4WK8F 4EV0A 1ZG3A 5F6FA 1YW8A 5E20A 1USTA 3JW4A 4YFXF 3O6BB 2H27A 3Q9SA 2FBKA 1XMAA 2GZWA 1UHWA 3JAMK 3E5QA 4DQ2A 1BJAA 2KJCA 5ICFA 2Z99A 4BQAA 3GFMA 1XSVA 1HKQA 2AXLA 4U0VA 4LB6B 2H09A 3PQJA 1YYVA 1I1GA 4MTDA 1TQIA 4KYWA 2ZBKA 1BOAA 3HRUA 2A61A 4IPAA 5LHIA 1V3FA 2MBFA 3RI4A 3IRRA 4OINF 3E6CC 2Z5UA 1XN7A 4AWXB 1XGOA 1QZZA 2EK5A 1HSTA 2IJLA 3CUQA 1SD5A 3RYRA 5H6RA 5J8FA 2VE9A 3JTGA 2MH2A 5LBQA 5LHGA 3KCCA 3KP5A 1W7PB 1MGTA 3GFJA 3R4KA 1ZREA 1ULYA 1BBYA 1HSJA 4WXCA 4R79A 3GLXA 3AAFA 3DEUA 5K1YA 4L9TA 1G4DA 4WXHA 1SD7A 3TO6A 2V1DA 2FXAA 2OQRA 3GFLA 4UUVA 1F4KA 2G9WA 4OU0A 4P9FA 4O5VA 4M6YA 2E7WA 4I98B 2YPRA 5ILSA 3P9IA 4I09A 4U0WA 3HRSA 2RN7A 1DPUA 1SFUA 3NEUA 1TW3A 2QUFA 3LFKA 2F5EA 3DP7A 1Z1DA 3HTSB 3IHUA 2CGPA 2RVCA 3WTSC 2NAZA 5CVIA 1J9IA 2OAZA 4MEYF 2GA2A 4XSZF 2YX4A 4CXFA 1XMKA 4KN4X 2GIVA 2EA2A 2XROA 3T8RA 2EB7A 2A6EF 4LG0A 4L0YB 2PMUA 2DW4A 4LLGF 4E70A 1KQ0A 4HQMA 4PDKA 5DV5A 3E6DA 5KK1A 1O7LA 2IA2A 2FEZA 3V7SA 1R1VA 2UWMA 4MHGA 2EFNA 5BQTA 3R6SA 3IRQA 1YQAA 5BPIA 4A12A 2V6CA 2ZXJA 3KLOA 1U3EM 4YFNF 5D5WB 5CYVA 1L0OC 2R7DA 1G3YA 4M73A 3I59B 3F22A 5ICGA 5BS6A 3GVAA 5FD6A 2GA1A 4ZYEA 2DFIA 3ZN0A 4CYDA 3F72A 2Z3YA 4EJVA 4ENJA 2DLLA 3O2PE 3HRTA 1B6AA 3QP6A 2RGVA 3E97A 4YIIA 3FXQA 1J7KA 1RI7A 2KIFA 1XGMA 5LEJA 3GEZA 1R00A 3L7WA 4KIBA 3WTWC 3FX3A 4O6JA 3HSFA 4LMYA 2X0LA 3O3KA 2FBIA 3I58A 1GXQA 1JXSA 1ODDA 1FZPB 4OIQF 1F1ZA 1FY7A 2BBYA 4RAZA 2P5LC 1EV7A 3GF2A 2XASA 1IN7A 3L2CA 5DCMB 3U1DA 4EGZA 4GCVA 1T39A 1TBXA 3MQ0A 4AIJA 2OA4A 2XRNA 2YU3A 5J8CA 4BHCA 1H9TA 1XSXA 4HV5A 1X3UA 3GYHX 3DKWA 1WQ2A 1U5TC 2ESHA 3MAJA 1BI2A 5JFRA 3KP7A 2KKOA 3V8JA 2IW5A 2ZKZA 1USSA 2VONA 1CF7A 4KUMA 1QO0D 4ENNA 1K79A 2RDPA 3FMRA 3E6BA 2ESNA 1FBUA 2MC3A 5JI6A 1VTNC 1IN4A 2OZUA 2H94A 3RPQA 2WV0A 1TQMA 3HUGA 3ABTA 4P96A 1U5TA 2XVCA 1FC3A 2KIMA 2A68F 1IRFA 5L3GA 1QPMA 1OMIA 2FMLA 1R23A 3F8NA 3LSTA 3KZYA 2P7VB 1KGSA 1KYZA 3RPUA 3D5LA 4NHJA 1R58A 3ZP5A 1HW1A 1SMTA 3KE2A 1E17A 4G6DA 4U0YA 3V4GA 1EH6A 2XGXA 1FPQA 3M7GA 4KT5C 2DAOA 5EEHA 1ZG5A 2QQBA 3FM3A 1BIAA 2PG4A 2ZJ2A 3SHFA 1IRGA 2B0LA 4LK0F 2XIGA 4I01A 2D45A 1ZYRF 2ZMEA 4GYGA 2P8TA 1RIOH 3LA2A 5J6XA 1F9NA 5LRRA 2HTJA 1ZAOA 2F5FA 2ADUA 3SQNA 4G7OF 1U6GA 4MNUA 4M6XA 3F8CA 3V7RA 4JBAA 3I5UA 3IC7A 5FD5A 1MZBA 3IKVA 4WCGA 1OR7A 1DPRA 1TNSA 4MQVA 5LGTA 1SAXA 3JSOA 2A69F 5A2QK 5D5UB 2MLKA 3T8TA 3WODF 4L5IA 3OOPA 3NQOA 3COAC 3RKYA 5D6EA 1IUYA 3ELKA 3ZMDA 1SMYF 2K02A 1MJAA 4HV6A 2VOOA 1GVJA 1EH8A 1R7JA 4I7HA 2HWVA 2NS0A 1Y0UA 1IZ1A 5HLGA 3HRMA 4EGYA 1HBXG 4I02A 1KU2A 5D4RA 1LDJA 3REOA 2OQGA 1SFEA 3F6VA 2E1NA 1T0FA 5D6FA 2PFBA 4CGZA 4ZYGA 2BEOA 3QRFF 1KQ9A 1O7FA 2FSWA 4A5NA 1JE8A 3J80K 5HS9A 2VBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJR A;  1R5G A;  3BZ6 A;  5HS8 A;  2ISZ A;  3GZ6 A;  4KA4 A;  4G8X A;  1XCB A;  2EWN A;  2V1X A;  3R60 A;  1FYK A;  2P5V A;  3EET A;  3SXY A;  3ZPL A;  3KZZ A;  1BM9 A;  5FGM A;  1JGS A;  3ZMT A;  3K9T A;  4RAY A;  1XDU A;  3DF8 A;  2IVM A;  4K2E A;  5L3E A;  4MQ9 F;  2IP2 A;  3CUQ C;  3T1B A;  3WTT C;  4KIC A;  2GQQ A;  4G7Z F;  1FLI A;  3CO7 C;  2FRH A;  4KFC A;  2HEO A;  1KQ8 A;  1LVA A;  1P92 A;  4BAY A;  3C1D A;  2MLG A;  2HDC A;  1FSH A;  4CDG A;  5JHU A;  3LAJ A;  2DI3 A;  2MD5 A;  2JTV A;  1GXP A;  4PZJ A;  2Y48 A;  2PJP A;  2P4W A;  2OBP A;  3BPV A;  1LDK B;  2R7F A;  1CF7 B;  2MH9 A;  2CFX A;  5E1X A;  4RB0 A;  1OKR A;  1L3L A;  1U8R A;  4AD9 A;  4YIF A;  4MGR A;  1B9M A;  4UVA A;  3VOE A;  3QU3 A;  1DUX C;  3M9A A;  1FYL A;  4KDP A;  2W25 A;  1G6N A;  3W6J B;  2VC0 A;  4HF0 A;  3ROU A;  3G3Z A;  4EM1 A;  3WGI A;  3C3W A;  1XB4 A;  3IL2 A;  2E1C A;  2VT3 A;  2FE3 A;  1YW7 A;  1FOK A;  2YSR A;  1HKT A;  3NRV A;  3WTZ A;  1YS6 A;  2HKO A;  2X4H A;  5BPD A;  3H92 A;  1O3Q A;  2JPB A;  3FM5 A;  5JVT A;  2CYY A;  2TDX A;  3EDP A;  5K5O A;  1G3T A;  1FNN A;  1Z6T A;  5AON A;  1PDN C;  3WTU C;  1W7P A;  3JSP A;  4A6D A;  3R0J A;  1LEB A;  3LWF A;  2DPD A;  3BJ6 A;  1K6O A;  4BH9 A;  3EUH A;  5ILV A;  3HOT A;  1SFX A;  3S2W A;  5D5X B;  2KIU A;  2M30 A;  2ACJ A;  4NB5 A;  3HOS A;  1FWZ A;  3BJA A;  4LD5 A;  3WGH A;  2QVO A;  3JAM Z;  2QM3 A;  1B1B A;  3GXO A;  2PN6 A;  4G94 A;  1ZRF A;  5D8K B;  2ZNZ A;  1S7A A;  5LEK A;  5IT9 K;  1LJ9 A;  5E18 F;  2CSO A;  5H6Q A;  2P6T A;  2ZO4 A;  3J7A O;  1J0R A;  2L3D A;  4WXD A;  1S29 A;  3LA7 A;  4Y13 A;  1KYW A;  3KP6 A;  1MKM A;  5HLH A;  4AVP A;  1ZG1 A;  1P4X A;  3GO5 A;  4KIF A;  4PCQ A;  4XBF A;  3E6M A;  4GGG A;  3I4P A;  3SFZ A;  1WRJ A;  2M45 A;  4DNC A;  1YTY A;  4RB3 C;  4ON0 A;  2GAU A;  1R5H A;  4A2U A;  3R61 A;  4QLC U;  4LG0 B;  4EJT A;  5HDN A;  3FHZ A;  2FF4 A;  2BV6 A;  2HQR A;  2HFH A;  4L9N A;  5DEQ A;  2DU9 A;  3CJN A;  3Q5F A;  2JPC A;  4KN7 X;  3B02 A;  2DO7 A;  2G7U A;  2QZ8 A;  2L4M A;  2XKP A;  3WTY C;  1YFH A;  3L09 A;  2IT0 A;  2DK5 A;  2O8X A;  3ZMV A;  4RGU A;  2R3S A;  3ERE D;  3GZ5 A;  5DYM A;  3SZP A;  4ETS A;  2RQP A;  2BGC A;  2O6G E;  4IVN A;  1WSU A;  4IJA A;  4LLN A;  1R1U A;  2ELH A;  3J80 Z;  1WI9 A;  5L3C A;  2O03 A;  3HTU A;  2Q8K A;  1IAW A;  2DQR A;  3G73 A;  1D8K A;  4BXU A;  3RDI A;  4EQQ A;  3K1M A;  4GO1 A;  3QPT A;  5HOO A;  4D0P A;  2H6C A;  2PQ8 A;  5BMZ A;  1WKM A;  2QBY B;  2FMY A;  3L00 A;  4P55 A;  1E2X A;  4IRH A;  3VOD A;  1XGS A;  4EJO A;  3I64 A;  4IXA A;  2O0Y A;  1H0M A;  2C6Y A;  3WE3 A;  1XCV A;  1FX7 A;  3K69 A;  4AIH A;  3QPH A;  1MDM B;  2KJB A;  2JZY A;  4Q47 A;  2O3F A;  3CUO A;  1ZLK A;  2FA5 A;  2DTR A;  5LRS A;  1ZHF A;  4HF1 A;  4GYI A;  3IWF A;  5IT9 Z;  3HHH A;  3F6O A;  2LF7 A;  1ZH5 A;  1UFM A;  1BIB A;  3CUQ B;  3GW2 A;  2Z33 A;  2L4A A;  5AIQ A;  1WWX A;  2L02 A;  1FP1 D;  2STW A;  3ZQ7 A;  5E17 F;  1FBS A;  2ZFW A;  4XLN F;  1G3S A;  1ZGA A;  3VEP A;  1ZGJ A;  1Q1H A;  1RZ4 A;  3LQR A;  1ZLJ A;  2EFW A;  4XRF A;  3N4M A;  2XAH A;  2AS5 F;  2H6B A;  2D1V A;  2YX7 A;  2VN2 A;  5K5Q A;  5D8L B;  1BI1 A;  3FMQ A;  2J5O A;  3J81 K;  3GX4 X;  3T0Y A;  3WTV C;  4FHT A;  4M9X A;  2EFO A;  2Q0O A;  1FT9 A;  4IF4 A;  1KU7 A;  3ML6 A;  2QBY A;  1R1T A;  4KMU X;  5TRD A;  2RC4 A;  1Z9C A;  2JSC A;  4L9J A;  4YG2 F;  3MEX A;  3BDD A;  4HW0 A;  1I5Z A;  2XHK A;  3U2R A;  2IA1 A;  5DD4 A;  4AIK A;  3RIR A;  4ZYH A;  2NNN A;  5ICE A;  2G7H A;  4P9U A;  4L5J A;  2FU4 A;  1RUN A;  2ZNY A;  2QYO A;  4HAM A;  2HYF A;  1HW2 A;  5E1W A;  4G9Y A;  2QEN A;  1U2W A;  1TLH B;  2F5C A;  4U7D A;  4WWC A;  3PFI A;  4UVC A;  2WC2 A;  4RB2 C;  4UVB A;  2A07 F;  2JT1 A;  2W84 A;  1J2X A;  4Y17 A;  3I54 A;  2VBW A;  2GXB A;  4ESB A;  4JK1 X;  1T6S A;  5F64 A;  5EEG A;  2HS5 A;  5E8I A;  3WTX C;  4OIO F;  3SZT A;  1XSD A;  1W5T A;  3HHG A;  2Z9O A;  1PUE E;  1BI3 A;  1AWC A;  1EH7 A;  4QWQ A;  4PGG A;  1W4M A;  3QP5 A;  4KMF A;  1U5T B;  4L9V A;  2VT2 A;  2CW0 F;  4WF2 A;  1IN6 A;  4A6E A;  5FLX Z;  2CWE A;  3N97 A;  1DDN A;  1S7O A;  5CLS A;  4LJZ F;  2Y75 A;  2V9V A;  2DPU A;  2HQN A;  1IXR C;  2J5P A;  2Q2E A;  2M87 A;  1O3T A;  3K1N A;  5HLI A;  1FYM A;  2NYX A;  1BI0 A;  3P9C A;  3CTA A;  2L54 A;  3M8E A;  1QGP A;  2V79 A;  1P2F A;  1K78 B;  1IXC A;  5DCF A;  5CVR A;  2EV6 A;  3ULQ B;  4Q4Z F;  3ECH A;  1V4R A;  2UXX A;  3H3Z A;  4XLP F;  3RKW A;  2RNJ A;  4WX9 A;  4R8H A;  4MTE A;  4RS8 A;  1Z7U A;  4G7H F;  3P7N A;  2K7L A;  3TDZ C;  3ZMZ A;  1S8N A;  1JHH A;  2FBH A;  1IW7 F;  3EQL F;  2QQ9 A;  2VC1 A;  1S6L A;  5ILU A;  4HX7 A;  1HKS A;  2FQ3 A;  4HZF A;  1P4W A;  2PLY A;  2HTS A;  1QZY A;  3EYY A;  2ZCW A;  4RGS A;  2QLZ A;  4EJU A;  3TO9 A;  4HLY A;  4Y15 A;  2K4J A;  5IT3 A;  3LAP A;  4R1H A;  5FFZ A;  2M5W A;  2A6H F;  3HSR A;  1D3Y A;  3RJP A;  3MWM A;  1DP7 P;  3WU0 A;  4TV7 A;  4Z2Y A;  1R36 A;  2PEX A;  4IRI A;  5TJJ A;  1FP2 A;  2P6S A;  1UB9 A;  3P9K A;  3KFW X;  3CO6 C;  2W57 A;  2XAG A;  3DPT A;  3L9F A;  5D4S A;  4OMZ A;  3FXR A;  2K86 A;  1B9N A;  2EA4 A;  4P5O A;  1O3S A;  3KP4 A;  4RB1 A;  2OU2 A;  5L3D A;  1T2K A;  3FZV A;  4PGH A;  3DFG A;  1TW2 A;  5HDG A;  2O61 A;  3IWZ A;  3MZY A;  4ASN A;  1P4A A;  4Q48 A;  1YW9 A;  2XAJ A;  5CJ9 A;  1P6R A;  4UV8 A;  1ZAR A;  3KP3 A;  1YIO A;  3BJO A;  4XSX F;  3WE2 A;  1YO5 C;  5DUI A;  1I1S A;  4HF2 A;  4CO8 A;  3D0S A;  3QOP A;  3H3U A;  1KA8 A;  3FMS A;  2M1B A;  2JRT A;  2LF8 A;  4GXO A;  5K5R A;  3I53 A;  1D5V A;  2RV8 A;  3K2Z A;  2HYG D;  1C0W A;  1PP8 F;  4G6Q A;  3E5U A;  1OYY A;  2CO5 A;  4JQF A;  6PAX A;  2K27 A;  1XGN A;  2VXZ A;  4RGR A;  3DPL C;  2HOE A;  1IXS B;  2OZ6 A;  3GUD A;  5DUK A;  2XUB A;  4CHU A;  2CG4 A;  3W6K B;  3I71 A;  4EMS A;  4N0B A;  3V8L A;  1RUO A;  5E1Z B;  4HDU A;  3M1E A;  3F3X A;  4OMY A;  2HKX A;  3WU1 B;  2VE8 A;  4OIP F;  4LK1 F;  2W85 A;  3F8F A;  1BC7 C;  2KRF A;  5FFX A;  5DDG A;  4OIR F;  4ZYD A;  3HYI A;  2FNA A;  2ETH A;  4S04 A;  1R22 A;  3KLN A;  4HDV A;  5L3B A;  1LQ1 A;  1FSE A;  4FX0 A;  4HQE A;  1S3J A;  4B09 A;  1TQP A;  1LDD A;  1O3R A;  3F23 A;  2A3S A;  5FB2 A;  5DD8 A;  5FLX K;  4I0B A;  1HQC A;  4N9H A;  4S05 A;  1SD4 A;  2DQL A;  4IHS A;  5L3F A;  1UCR A;  2DT5 A;  3WGG A;  1T38 A;  3EYI A;  2IPQ X;  1ZN2 A;  4M71 A;  1FBQ A;  3BPX A;  3OV8 A;  2NNY A;  3PQK A;  4KIG A;  1F5T A;  1B4A A;  4OOI A;  5HVQ C;  1Z05 A;  4B8X A;  3I59 A;  4I2O A;  2P7C B;  5LGU A;  1QBJ A;  1MDM A;  2UXN A;  1JHF A;  2XAQ A;  5FO5 A;  3LA3 A;  3ZMU A;  3DQV C;  2WTE A;  4HX8 A;  4F7Z A;  4M9Z A;  3BOQ A;  1REP C;  2VOD A;  3ISP A;  2K4B A;  1TTY A;  3Q9V A;  2PI0 A;  1H9G A;  2RKH A;  1SD6 A;  5CVV A;  3TOB A;  5CVJ A;  1CGP A;  4N9I A;  2P5K A;  1LNW A;  3C7J A;  3FWE A;  1B59 A;  3QAH A;  4HA8 A;  2GXG A;  2FNP A;  4HBL A;  2E7X A;  1J5Y A;  4I0A A;  2IRF G;  1BN5 A;  2LNB A;  3HIF A;  3KEO A;  4EJW A;  2HZT A;  3MZH A;  1LEA A;  1O57 A;  2XKO A;  4M9S A;  3BY6 A;  1MJB A;  4L18 B;  1U78 A;  2D2W A;  1IN8 A;  1AOY A;  1ONV A;  1A04 A;  3R0A A;  4KNY A;  4BNC A;  4EM0 B;  4NQW A;  2EV5 A;  1OYI A;  2CQK A;  3CLO A;  2F5D A;  4BHB A;  5ERI A;  3TKY A;  4ENK A;  2F2E A;  2HGC A;  3J81 Z;  4EVI A;  4LLL A;  1YLF A;  2EV0 A;  4A5M A;  2OD5 A;  5ICC A;  4HYE A;  3RKX A;  1Z6R A;  2XV4 S;  3GWZ A;  3JTH A;  3HSE A;  2EFQ A;  2V1U A;  1OPC A;  2DBB A;  1GHC A;  4IRG A;  4M74 A;  1I6X A;  3M8F A;  5CVU A;  4LFU A;  1STZ A;  2W24 A;  3ZN1 A;  1ON1 A;  4FX4 A;  4H0E A;  5LGN A;  2VBZ A;  2BE5 F;  3F21 A;  2MA3 A;  1HXD A;  1KU9 A;  3ECO A;  3E3V A;  1YG2 A;  4U7B A;  1W7P D;  2HR3 A;  3LQQ A;  3BRO A;  3TDU C;  3VFZ A;  4CIC A;  3RYP A;  2LKP A;  2BYV E;  3C18 A;  5A2Q Z;  3F8M A;  2QQA A;  2VBY A;  3KET A;  3TOA A;  1K7A A;  1MJ9 A;  3DV8 A;  2VOP A;  3F8B A;  4ESJ A;  1QNT A;  2QWW A;  3MCZ A;  1K78 A;  4HOB A;  2EFP A;  3TQN A;  5KVR A;  3FF5 A;  3KP2 A;  4LB5 A;  4ENM A;  3I0T A;  4L0Z B;  4FT8 A;  3RTR A;  3V7C A;  2YR2 A;  1BC8 C;  5JR3 A;  1ZRD A;  3GFI A;  4YFK F;  3FXU A;  1XDS A;  2PBI A;  2ISY A;  4A0Z A;  4Q5S F;  2DK8 A;  4M72 A;  5AIP A;  4ZZL A;  3U9G A;  1KU3 A;  5H20 A;  1G3W A;  3B73 A;  4ESF A;  4UXN A;  2FOK A;  4UNO A;  1J59 A;  4CZZ A;  2ZME B;  4IHT A;  3BP8 A;  3KEQ A;  4A0X A;  5D5V B;  1OYW A;  5LLQ A;  1IF1 A;  4O3M A;  4BYY A;  2UZK A;  3K0L A;  1J75 A;  3ABU A;  1T98 A;  4HLX A;  1NHA A;  2NRA C;  2PMH A;  3VB2 A;  1I27 A;  1HW5 A;  5LHH A;  3BWG A;  1UHM A;  1RNL A;  5F1R A;  1PP7 U;  3CDH A;  2WWY A;  2L01 A;  2XAF A;  3TGN A;  1W5S A;  1MD0 A;  3T5X A;  5ED4 A;  2LSO A;  4RGX A;  1LB2 A;  5DCM A;  3QU6 A;  2D1H A;  4ZZD A;  4MEX F;  1QQI A;  3DXJ F;  1TNT A;  4BHP A;  2LDU A;  3WG9 A;  1YS7 A;  4LGW A;  3K1P A;  3IKT A;  4ZH4 F;  4A0Y A;  4UHT A;  5HS7 A;  2GWR A;  4UV9 A;  2A5Y B;  1D8J A;  2Y0M A;  2COM A;  4U88 A;  3E5X A;  4EM2 A;  5HDK A;  3TO7 A;  1IN5 A;  1ZRC A;  5BOX A;  1ON2 A;  4HX4 A;  2M8E A;  3ZMS A;  3MFK A;  2IA0 A;  1XD7 A;  5E8G A;  2STT A;  3V8K A;  1Z91 A;  4WK8 F;  4EV0 A;  1ZG3 A;  5F6F A;  1YW8 A;  5E20 A;  1UST A;  3JW4 A;  4YFX F;  3O6B B;  2H27 A;  3Q9S A;  2FBK A;  1XMA A;  2GZW A;  1UHW A;  3JAM K;  3E5Q A;  4DQ2 A;  1BJA A;  2KJC A;  5ICF A;  2Z99 A;  4BQA A;  3GFM A;  1XSV A;  1HKQ A;  2AXL A;  4U0V A;  4LB6 B;  2H09 A;  3PQJ A;  1YYV A;  1I1G A;  4MTD A;  1TQI A;  4KYW A;  2ZBK A;  1BOA A;  3HRU A;  2A61 A;  4IPA A;  5LHI A;  1V3F A;  2MBF A;  3RI4 A;  3IRR A;  4OIN F;  3E6C C;  2Z5U A;  1XN7 A;  4AWX B;  1XGO A;  1QZZ A;  2EK5 A;  1HST A;  2IJL A;  3CUQ A;  1SD5 A;  3RYR A;  5H6R A;  5J8F A;  2VE9 A;  3JTG A;  2MH2 A;  5LBQ A;  5LHG A;  3KCC A;  3KP5 A;  1W7P B;  1MGT A;  3GFJ A;  3R4K A;  1ZRE A;  1ULY A;  1BBY A;  1HSJ A;  4WXC A;  4R79 A;  3GLX A;  3AAF A;  3DEU A;  5K1Y A;  4L9T A;  1G4D A;  4WXH A;  1SD7 A;  3TO6 A;  2V1D A;  2FXA A;  2OQR A;  3GFL A;  4UUV A;  1F4K A;  2G9W A;  4OU0 A;  4P9F A;  4O5V A;  4M6Y A;  2E7W A;  4I98 B;  2YPR A;  5ILS A;  3P9I A;  4I09 A;  4U0W A;  3HRS A;  2RN7 A;  1DPU A;  1SFU A;  3NEU A;  1TW3 A;  2QUF A;  3LFK A;  2F5E A;  3DP7 A;  1Z1D A;  3HTS B;  3IHU A;  2CGP A;  2RVC A;  3WTS C;  2NAZ A;  5CVI A;  1J9I A;  2OAZ A;  4MEY F;  2GA2 A;  4XSZ F;  2YX4 A;  4CXF A;  1XMK A;  4KN4 X;  2GIV A;  2EA2 A;  2XRO A;  3T8R A;  2EB7 A;  2A6E F;  4LG0 A;  4L0Y B;  2PMU A;  2DW4 A;  4LLG F;  4E70 A;  1KQ0 A;  4HQM A;  4PDK A;  5DV5 A;  3E6D A;  5KK1 A;  1O7L A;  2IA2 A;  2FEZ A;  3V7S A;  1R1V A;  2UWM A;  4MHG A;  2EFN A;  5BQT A;  3R6S A;  3IRQ A;  1YQA A;  5BPI A;  4A12 A;  2V6C A;  2ZXJ A;  3KLO A;  1U3E M;  4YFN F;  5D5W B;  5CYV A;  1L0O C;  2R7D A;  1G3Y A;  4M73 A;  3I59 B;  3F22 A;  5ICG A;  5BS6 A;  3GVA A;  5FD6 A;  2GA1 A;  4ZYE A;  2DFI A;  3ZN0 A;  4CYD A;  3F72 A;  2Z3Y A;  4EJV A;  4ENJ A;  2DLL A;  3O2P E;  3HRT A;  1B6A A;  3QP6 A;  2RGV A;  3E97 A;  4YII A;  3FXQ A;  1J7K A;  1RI7 A;  2KIF A;  1XGM A;  5LEJ A;  3GEZ A;  1R00 A;  3L7W A;  4KIB A;  3WTW C;  3FX3 A;  4O6J A;  3HSF A;  4LMY A;  2X0L A;  3O3K A;  2FBI A;  3I58 A;  1GXQ A;  1JXS A;  1ODD A;  1FZP B;  4OIQ F;  1F1Z A;  1FY7 A;  2BBY A;  4RAZ A;  2P5L C;  1EV7 A;  3GF2 A;  2XAS A;  1IN7 A;  3L2C A;  5DCM B;  3U1D A;  4EGZ A;  4GCV A;  1T39 A;  1TBX A;  3MQ0 A;  4AIJ A;  2OA4 A;  2XRN A;  2YU3 A;  5J8C A;  4BHC A;  1H9T A;  1XSX A;  4HV5 A;  1X3U A;  3GYH X;  3DKW A;  1WQ2 A;  1U5T C;  2ESH A;  3MAJ A;  1BI2 A;  5JFR A;  3KP7 A;  2KKO A;  3V8J A;  2IW5 A;  2ZKZ A;  1USS A;  2VON A;  1CF7 A;  4KUM A;  1QO0 D;  4ENN A;  1K79 A;  2RDP A;  3FMR A;  3E6B A;  2ESN A;  1FBU A;  2MC3 A;  5JI6 A;  1VTN C;  1IN4 A;  2OZU A;  2H94 A;  3RPQ A;  2WV0 A;  1TQM A;  3HUG A;  3ABT A;  4P96 A;  1U5T A;  2XVC A;  1FC3 A;  2KIM A;  2A68 F;  1IRF A;  5L3G A;  1QPM A;  1OMI A;  2FML A;  1R23 A;  3F8N A;  3LST A;  3KZY A;  2P7V B;  1KGS A;  1KYZ A;  3RPU A;  3D5L A;  4NHJ A;  1R58 A;  3ZP5 A;  1HW1 A;  1SMT A;  3KE2 A;  1E17 A;  4G6D A;  4U0Y A;  3V4G A;  1EH6 A;  2XGX A;  1FPQ A;  3M7G A;  4KT5 C;  2DAO A;  5EEH A;  1ZG5 A;  2QQB A;  3FM3 A;  1BIA A;  2PG4 A;  2ZJ2 A;  3SHF A;  1IRG A;  2B0L A;  4LK0 F;  2XIG A;  4I01 A;  2D45 A;  1ZYR F;  2ZME A;  4GYG A;  2P8T A;  1RIO H;  3LA2 A;  5J6X A;  1F9N A;  5LRR A;  2HTJ A;  1ZAO A;  2F5F A;  2ADU A;  3SQN A;  4G7O F;  1U6G A;  4MNU A;  4M6X A;  3F8C A;  3V7R A;  4JBA A;  3I5U A;  3IC7 A;  5FD5 A;  1MZB A;  3IKV A;  4WCG A;  1OR7 A;  1DPR A;  1TNS A;  4MQV A;  5LGT A;  1SAX A;  3JSO A;  2A69 F;  5A2Q K;  5D5U B;  2MLK A;  3T8T A;  3WOD F;  4L5I A;  3OOP A;  3NQO A;  3COA C;  3RKY A;  5D6E A;  1IUY A;  3ELK A;  3ZMD A;  1SMY F;  2K02 A;  1MJA A;  4HV6 A;  2VOO A;  1GVJ A;  1EH8 A;  1R7J A;  4I7H A;  2HWV A;  2NS0 A;  1Y0U A;  1IZ1 A;  5HLG A;  3HRM A;  4EGY A;  1HBX G;  4I02 A;  1KU2 A;  5D4R A;  1LDJ A;  3REO A;  2OQG A;  1SFE A;  3F6V A;  2E1N A;  1T0F A;  5D6F A;  2PFB A;  4CGZ A;  4ZYG A;  2BEO A;  3QRF F;  1KQ9 A;  1O7F A;  2FSW A;  4A5N A;  1JE8 A;  3J80 K;  5HS9 A;  2VBX A; 
#chains in the Genus database with same CATH topology
 2EJR A;  1R5G A;  2GLO A;  3BC8 A;  3HOV J;  2KQR A;  3BZ6 A;  5HS8 A;  5J1R A;  1HLV A;  2ISZ A;  1X1B A;  3GZ6 A;  4CCM A;  4KA4 A;  2W00 A;  3ABK H;  2E1M B;  4G8X A;  4B3X A;  3AG4 H;  1ITY A;  4B1R A;  5E3M A;  3JRD A;  4A93 J;  2OC6 A;  2L9N A;  4UUT A;  1XCB A;  1O4X A;  1X1A A;  2BXZ A;  2EWN A;  2V1X A;  3R60 A;  1FYK A;  4PFP A;  2P5V A;  3EET A;  3SXY A;  1G59 A;  2X1D A;  3S1Q J;  1TWG J;  3ZPL A;  3KZZ A;  3OS1 A;  1BM9 A;  5FGM A;  1JGS A;  3ZMT A;  5LFA A;  3K9T A;  4RAY A;  3I56 I;  4YIR X;  2L9S A;  1XDU A;  2L9R A;  3OYL A;  3CJQ B;  1N77 A;  3DF8 A;  2Z1D A;  2IVM A;  1MBH A;  4HSR A;  2R7V A;  1FOX A;  5DM6 F;  4K2E A;  3HM5 A;  4F93 B;  5L3E A;  2CUF A;  4MQ9 F;  1B72 B;  1AKH A;  3DKY A;  2IP2 A;  3CUQ C;  3K6G A;  3T1B A;  3WTT C;  4XRM A;  3S93 A;  2VAS A;  4II2 A;  4KIC A;  1HA8 A;  2GQQ A;  3HPH A;  4G7Z F;  3MVP A;  1FLI A;  1ETW A;  3CD6 I;  3CO7 C;  2FRH A;  5JLW A;  5CPR B;  1PVE A;  4KFC A;  3C2B A;  1D1C A;  3BR5 A;  4IL6 C;  2L9V A;  4OAY A;  2HEO A;  1LVA A;  1P92 A;  1KQ8 A;  4BAY A;  3C1D A;  4HNU A;  2MLG A;  2R4G A;  2VL8 A;  2HDC A;  1FSH A;  4CDG A;  3IP4 B;  5JHU A;  3LAJ A;  1YOV B;  2DI3 A;  2MD5 A;  2JTV A;  1RPW A;  1GXP A;  4PZJ A;  2Y48 A;  2PJP A;  1HDP A;  2P4W A;  1P7I A;  2OBP A;  3A4C A;  2QEX I;  3BPV A;  1LDK B;  2R7F A;  2IS1 A;  2WBM A;  3AG1 H;  1CF7 B;  2MH9 A;  2CFX A;  5LD2 C;  2R7T A;  5E1X A;  4RB0 A;  1OKR A;  1T8I A;  1L3L A;  4AD9 A;  1BR1 A;  3Q0U A;  3L2U A;  1U8R A;  4YIF A;  3GTK J;  4MGR A;  1B9M A;  3HDD A;  3AKZ A;  4UVA A;  3VOE A;  3QU3 A;  1DUX C;  2NVX J;  1XC5 A;  3M9A A;  1FYL A;  4KDP A;  2W25 A;  3PNY A;  1VQ7 I;  1G6N A;  3W6J B;  4AVZ A;  4RDU A;  5IP7 J;  3GTM J;  2VC0 A;  4HF0 A;  4QPQ A;  3G3Z A;  3ROU A;  5EGO A;  4JX4 A;  1I39 A;  4EM1 A;  3WGI A;  3C3W A;  2VQH A;  5JHF A;  1XB4 A;  3UR3 C;  5IY5 H;  3IL2 A;  2DN0 A;  1SVM A;  4CZC A;  2E1C A;  1OR7 C;  2VT3 A;  2FE3 A;  1WVR A;  1YW7 A;  4CA0 A;  1FOK A;  2NS7 A;  3JRI A;  2ID6 A;  3CCV I;  2F5V A;  2YSR A;  3VYT B;  1HKT A;  3NRV A;  2VQL A;  2HOA A;  3WTZ A;  1YS6 A;  2VJ5 A;  2HKO A;  1JKO C;  2X4H A;  1R71 A;  5BPD A;  1GV2 A;  3H92 A;  1O3Q A;  2JPB A;  3FM5 A;  5JVT A;  2CYY A;  2TDX A;  2OTJ I;  4BXF A;  3EDP A;  5K5O A;  4HG2 A;  1G3T A;  5TIS C;  1FJL A;  4BKX A;  3I4N J;  3OIO A;  1FNN A;  1Y8Q B;  1Z6T A;  4PSW A;  1BR2 A;  2VKH A;  5CQE A;  2W48 A;  5AON A;  3PM1 A;  4MFD A;  4I6Z A;  3CES A;  1PDN C;  4V2G A;  3OYH A;  2NVU B;  1MMD A;  3WTU C;  2E2H J;  1W7P A;  4HEA 2;  2LY1 A;  1X1P A;  3JSP A;  4A6D A;  3R0J A;  5FLV A;  2FX0 A;  2X6Y A;  3EPZ A;  3LWF A;  1LEB A;  3CF5 F;  2DPD A;  2B63 J;  1XPX A;  3BJ6 A;  2R7W A;  1K6O A;  2ECB A;  3K4L A;  4BH9 A;  3EUH A;  4XOT A;  2HPI A;  5ILV A;  3HOT A;  1G2H A;  1SFX A;  3S2W A;  4AUX A;  5D5X B;  2JVH A;  2KIU A;  2M30 A;  2WY7 Q;  2ACJ A;  1JUS A;  1K83 J;  2F6C A;  4NB5 A;  5GTH C;  3HOS A;  2NVY J;  1FWZ A;  2A5W A;  3BJA A;  5E3N A;  4LD5 A;  1MBK A;  1VQO I;  3F9K A;  3WGH A;  1SVL A;  2LFB A;  4XN3 A;  2QVO A;  3JAM Z;  2VIX A;  2QM3 A;  1B1B A;  2VPL A;  3HXL A;  5KCM A;  3GXO A;  2PN6 A;  1ZTR A;  3L2Q A;  3IV5 A;  2Q2E B;  4G94 A;  1ZRF A;  3HC7 A;  2DMT A;  5D8K B;  2ZNZ A;  1BW6 A;  1S7A A;  5LEK A;  3OYD A;  1LJ9 A;  5IT9 K;  1Z77 A;  2HYJ A;  5E18 F;  2CSO A;  5H6Q A;  2KPM A;  2P6T A;  4BDZ A;  1TZL A;  2ZO4 A;  3J7A O;  1J0R A;  3M1C A;  4XRS A;  2L3D A;  3H36 A;  2QSG X;  4LG3 A;  4WXD A;  1JKP C;  4QPO A;  2GOM A;  3K4J A;  2PX9 A;  2YS9 A;  1S29 A;  3LA7 A;  2X6W A;  4Y13 A;  1KYW A;  2KMU A;  4LIT A;  3KP6 A;  1MKM A;  5HLH A;  1OCC H;  2R5Y B;  4G6T B;  3ASN H;  3HKZ N;  4AVP A;  1ZG1 A;  3CC2 I;  1P4X A;  2O8K A;  4IOA F;  2QSF X;  3GO5 A;  4KIF A;  4PCQ A;  4XBF A;  3E6M A;  4GGG A;  3I4P A;  3SFZ A;  1WRJ A;  2M45 A;  3FHN A;  4DNC A;  1YTY A;  1IO2 A;  4ON0 A;  4RB3 C;  2DFE A;  2GAU A;  3PSF A;  4XN0 A;  1VQN I;  3L2V A;  1R5H A;  2P0W A;  4A2U A;  4X1E A;  4XID A;  3R61 A;  2RQQ A;  4QLC U;  3RZO J;  3QQA A;  3Q0V A;  3BG9 A;  4LG0 B;  1OIS A;  4EJT A;  1VND A;  1LE8 A;  2KL4 A;  1QVT A;  5J4Y A;  5HDN A;  3FHZ A;  4F92 B;  2FF4 A;  2BV6 A;  2HQR A;  2HFH A;  4L9N A;  5DEQ A;  2OCC H;  3S17 J;  2DU9 A;  3KYC B;  1WPK A;  3CJN A;  3Q5F A;  3H0G J;  3A01 B;  2JPC A;  3KYD B;  4KN7 X;  3B02 A;  2BHZ A;  2DO7 A;  3HKZ A;  2G7U A;  2IBD A;  2QZ8 A;  1W36 D;  2L4M A;  4UB6 C;  2M4G A;  2XKP A;  4BDY A;  2FD5 A;  3G71 I;  3WTY C;  2JVG A;  1YFH A;  1RES A;  1TWC J;  3TED A;  3L09 A;  3V42 A;  2IT0 A;  1V55 H;  2LRD A;  2DK5 A;  4D5F A;  2X9D A;  2O8X A;  3ZMV A;  2LOO A;  4HNV A;  4RGU A;  2R3S A;  3ERE D;  1MH3 A;  1I50 J;  3GZ5 A;  5DYM A;  1D0Y A;  3SZP A;  1U8B A;  1PUF A;  4ETS A;  4ZDP A;  1TWF J;  2RQP A;  2BGC A;  2V9P A;  2O6G E;  4IVN A;  3LSH A;  1F43 A;  2O9L A;  4AC0 A;  1WSU A;  4IJA A;  1Z7L A;  4LLN A;  1R1U A;  3RCO A;  2VKD A;  3A0H C;  2ELH A;  3HL2 A;  2BXY A;  3J80 Z;  4BJ5 C;  1WI9 A;  2ZME C;  2KIS A;  2Z2S B;  5L3C A;  3TP0 A;  2O03 A;  3HTU A;  2Q8K A;  1E0E A;  1IAW A;  3LSM A;  1A6I A;  2CQ7 A;  2DQR A;  3HOX J;  3G73 A;  1X2N A;  3L1P A;  2LBF B;  1D8K A;  2E2J J;  4PUS A;  4BXU A;  2L5Q A;  3RDI A;  4EQQ A;  3K1M A;  4GO1 A;  4GFB A;  2KP6 A;  3QPT A;  3MKL A;  3G2B A;  1S7E A;  5HOO A;  4D0P A;  2H6C A;  4DYR A;  2PQ8 A;  5BMZ A;  1WKM A;  2QBY B;  2FMY A;  3L00 A;  4P55 A;  1E2X A;  5FLM J;  4IRH A;  3VOD A;  1XGS A;  4EJO A;  3I64 A;  4IXA A;  2O0Y A;  4CCL A;  1H0M A;  2C6Y A;  1YRN B;  2EIL H;  3WE3 A;  4F52 A;  5M5X J;  1FOY A;  3W3C A;  3M07 A;  2HVQ A;  5GPA A;  1PUF B;  1E3O C;  1XCV A;  1FX7 A;  4A3K J;  3K69 A;  4AIH A;  1IV6 A;  3FXL A;  3QPH A;  4NC6 A;  2DA4 A;  1MDM B;  2KJB A;  1X58 A;  2JZY A;  4Q47 A;  2PJR A;  3K2A A;  2O3F A;  2VJI A;  3CUO A;  1ZLK A;  5B5E C;  2FA5 A;  1DQU A;  4CCN A;  3ZXS A;  2WAE A;  2DTR A;  1UAA A;  1HC8 A;  5LRS A;  1XMX A;  2XF6 A;  2DTZ A;  1ZHF A;  1VQ6 I;  2AQF A;  5K7Z A;  2ICW G;  2M7B A;  4IKF A;  1ERD A;  3K4N A;  3CDL A;  4HF1 A;  4GYI A;  3IWF A;  5IT9 Z;  2AXT C;  3HHH A;  3F6O A;  2LF7 A;  3S1R J;  1ZH5 A;  1UFM A;  1BIB A;  3CUQ B;  5B66 C;  3GW2 A;  2Z33 A;  2L4A A;  5AIQ A;  1WCM J;  1WWX A;  2L02 A;  1FP1 D;  3FXO A;  4E7I A;  2STW A;  2M0M A;  3ZQ7 A;  4D5C A;  5E17 F;  3K10 A;  3QYF A;  3IAS 2;  3TW6 A;  2COB A;  4Y7N J;  4IO9 F;  1MNM C;  1FBS A;  2ZFW A;  4XLN F;  1K61 A;  4A3L J;  1G3S A;  2VUM J;  3ZQI A;  1ZGA A;  2QKM B;  3FK6 A;  3VEP A;  3W2W A;  5FRN A;  1ZGJ A;  1Q1H A;  1RZ4 A;  2LTP A;  3LQR A;  1ZLJ A;  2VJ4 A;  2EFW A;  3W2V A;  4XRF A;  2VI6 A;  3CLQ A;  3PUB A;  3N4M A;  4EAT A;  4PSX A;  2R0Q C;  2XAH A;  2RNG A;  2AS5 F;  4BBS J;  2H6B A;  2X1E A;  2D1V A;  2WAD A;  1B72 A;  2K9Q A;  3OS2 A;  4A3E J;  2R7U A;  2YX7 A;  4XQF A;  2VN2 A;  5K5Q A;  2WA0 A;  5D8L B;  2BVL A;  1BI1 A;  2FUG 2;  2J5O A;  3FMQ A;  5IOY A;  3J81 K;  3T0Y A;  3WTV C;  3GX4 X;  1QU3 A;  3WHB A;  4RLQ A;  1GT0 C;  4FHT A;  1UZC A;  2L7F P;  1VQ9 I;  4M9X A;  3NWT A;  3H9G A;  2EFO A;  4BBR J;  2Q0O A;  1FT9 A;  3C2H A;  4XM3 A;  4IF4 A;  2JA2 A;  1KU7 A;  1X19 A;  3ML6 A;  3ZQH A;  3M3Y J;  2QBY A;  2B9S A;  3JRE A;  1R1T A;  4KMU X;  5TRD A;  2RC4 A;  3J7Z I;  1UEL B;  1W1W E;  1Z9C A;  1QHH D;  2MYS A;  2JSC A;  3TL4 X;  1RC9 A;  3OYF A;  4L9J A;  4Y4R A;  4YG2 F;  1OFC X;  3MEX A;  3BDD A;  2W4S A;  4IHV A;  4HW0 A;  1I5Z A;  1RET A;  1X2M A;  2KRC A;  2XHK A;  3U2R A;  9ANT A;  2CV1 A;  2ELJ A;  2JJ7 A;  2IA1 A;  1BA5 A;  3G1L A;  5DD4 A;  4AIK A;  5CKT A;  3RIR A;  1A36 A;  4ZYH A;  5IP9 J;  2DYS H;  2NNN A;  5ICE A;  2M3A A;  2G7H A;  4P9U A;  4L5J A;  2V1N A;  5GTI C;  2FU4 A;  3GLL A;  1RUN A;  5EG0 B;  3BTC A;  2QSH X;  2ZNY A;  2QYO A;  4HAM A;  2HYF A;  1YI2 I;  5GPC A;  5HOD A;  1HW2 A;  1T56 A;  3SFI A;  3FKI J;  5GAH J;  4I76 A;  4W97 A;  4QSH A;  1QZE A;  5E1W A;  5IPA A;  1IUF A;  2QEN A;  4G9Y A;  1U2W A;  4BU2 A;  1TLH B;  2F5C A;  4U7D A;  4WWC A;  4AM3 A;  3PFI A;  4UVC A;  2WC2 A;  1GV5 A;  4RB2 C;  2DOE A;  1VQ8 I;  2R7Z J;  1TL8 A;  4UVB A;  3KEY A;  2A07 F;  3PJR A;  4A3C J;  1ETO A;  2JT1 A;  3DLA A;  3J7A Y;  2W84 A;  1J2X A;  4Y17 A;  2CMP A;  4E7S A;  3I54 A;  1OJL A;  1QRY A;  2VBW A;  2GXB A;  1LPQ A;  4UB8 C;  4ESB A;  4JK1 X;  4MIM A;  1JTX A;  2K85 A;  1T6S A;  3Q3S A;  5F64 A;  5EEG A;  2HS5 A;  4RAF A;  4BQN A;  1IJW C;  2F4I A;  5E8I A;  3WTX C;  3LFU A;  4OIO F;  3OYI A;  4KJZ A;  4BS9 A;  3SZT A;  3PSI A;  1XSD A;  1W5T A;  2UV1 A;  3HHG A;  2Z9O A;  2YU9 J;  1PUE E;  1BI3 A;  1AWC A;  1EH7 A;  1ETX A;  4DYQ A;  4QWQ A;  4PGG A;  4V19 K;  3K7A J;  1W4M A;  2XC7 A;  2PJR B;  2Y30 A;  4B47 A;  3QP5 A;  4KMF A;  1BJZ A;  1U5T B;  2WAF A;  4L9V A;  2WB1 A;  3OYN A;  1IDZ A;  2VT2 A;  2CW0 F;  2EPF A;  5M5W J;  4WF2 A;  1IN6 A;  4A6E A;  1OCZ H;  1FTT A;  1ZGW A;  3FIW A;  2EZH A;  2CWE A;  5FLX Z;  5KAI C;  3K4B A;  3IH2 A;  3N97 A;  1DDN A;  4BEH B;  3HJE A;  1D0X A;  2OJE D;  1S7O A;  2Y69 H;  5CLS A;  4LJZ F;  2ZJQ F;  4ITV A;  2Y75 A;  2V9V A;  3JRH A;  2DPU A;  2NOJ B;  2HDW A;  1IXR C;  2HQ5 A;  2HQN A;  4BAC A;  2HXI A;  3KIO A;  4DZP A;  2J5P A;  2OV7 A;  2Q2E A;  5F04 A;  2R7R A;  1UMQ A;  2M87 A;  1O3T A;  2XSJ C;  1ZKG A;  3K1N A;  5HLI A;  2NYX A;  1BI0 A;  1FYM A;  2E2I J;  3S15 J;  1MBG A;  3P9C A;  3VYS B;  2VPR A;  5IOZ A;  3CTA A;  2LG4 A;  4RM2 A;  2DDB A;  3ZGK A;  1B8I B;  3UNG C;  1UJ8 A;  2L54 A;  3M8E A;  4XMY A;  1QGP A;  4FE4 A;  1H89 C;  2AO9 A;  2KFD A;  2V79 A;  2X6X A;  1P2F A;  2JA8 J;  4DIQ A;  1K78 B;  1IXC A;  5DCF A;  5CVR A;  2Y0S N;  2EV6 A;  3VPR A;  2BY1 A;  3ULQ B;  3D5S C;  1LFB A;  1Y0N A;  4Q4Z F;  2IGM A;  3ECH A;  3ZQQ A;  1V4R A;  4GRI A;  2UXX A;  3S32 A;  3H3Z A;  4UUS A;  4XLP F;  2NOG A;  2OTL I;  1NK2 P;  3RKW A;  2CW8 A;  1YJN I;  4C9Y A;  2RNJ A;  4WX9 A;  4R8H A;  4MTE A;  4RS8 A;  1MW7 A;  4XIC A;  2F48 A;  2DA2 A;  1Z7U A;  3OYE A;  4G7H F;  2XB5 A;  3P7N A;  2K7L A;  3TDZ C;  3ZMZ A;  1S8N A;  1JHH A;  2FBH A;  1IW7 F;  3EQL F;  2QQ9 A;  4D1Q A;  2VC1 A;  1S6L A;  5ILU A;  4HX7 A;  3OYK A;  4BE1 A;  2EZI A;  1HKS A;  2FQ3 A;  4HZF A;  2HPM A;  1PJR A;  4D9J A;  1P4W A;  2VKV A;  2CJJ A;  2PLY A;  2HTS A;  3OIP A;  3OYJ A;  2XF5 A;  4ZTJ A;  1QZY A;  3EYY A;  2ZCW A;  1V5E A;  4RGS A;  4II3 A;  4S0H B;  3GTP J;  2QLZ A;  4EJU A;  4C3J J;  5KHD A;  4X6A J;  3TO9 A;  4KIS A;  4HLY A;  3CDI A;  2KZV A;  4Y15 A;  3SDG A;  4Y52 J;  2K4J A;  4KIT B;  5IT3 A;  3SDB A;  3LAP A;  4R1H A;  5FFZ A;  2M5W A;  3GTG J;  2QA4 I;  2A6H F;  1MH4 A;  3HSR A;  3HPG A;  1SAU A;  3OL4 A;  1D3Y A;  2DT6 A;  3RJP A;  3MWM A;  1DP7 P;  3BCB A;  3WU0 A;  4TV7 A;  4Z2Y A;  2X48 A;  1R36 A;  5EZH A;  2PEX A;  4IRI A;  4PJL A;  5TJJ A;  1T0F C;  4I99 C;  5IP6 A;  1FP2 A;  3I55 I;  3D5R C;  3L2W A;  5J47 A;  2P6S A;  2H1L A;  3G6E I;  1UB9 A;  3P9K A;  3ERM A;  3KFW X;  3CO6 C;  2W57 A;  2XAG A;  1RRJ A;  3LSG A;  4IHX A;  3DPT A;  3DBL B;  3L9F A;  5D4S A;  4OMZ A;  3FXR A;  3CZ6 A;  2TCT A;  2K86 A;  3PFY A;  1B9N A;  1X1D A;  2EA4 A;  4P5O A;  1O3S A;  1AHD P;  2CRG A;  1SC7 A;  1IG7 A;  3MD2 A;  3KP4 A;  4RB1 A;  2OU2 A;  5L3D A;  3S8P A;  1T2K A;  2LVS A;  3FZV A;  4PGH A;  3DPU A;  1D1B A;  3DFG A;  1TW2 A;  3DKX A;  3VSK A;  5HDG A;  4BQQ A;  2O61 A;  3IWZ A;  3MZY A;  3GTO J;  1MNE A;  2M4K A;  1VQM I;  4E7Z A;  3S3O A;  4ASN A;  1P4A A;  5CQG A;  3D1N I;  4IQJ A;  3HB9 A;  4Q48 A;  2R7X A;  4DZJ A;  1YW9 A;  4N4N B;  2JUC A;  4A3I J;  2XAJ A;  5CJ9 A;  4FE7 A;  3FKJ A;  2CUZ A;  1P6R A;  4M6V A;  4BE2 A;  5GAG J;  4BJT A;  1VFC A;  4UV8 A;  1GVD A;  1ZAR A;  3KP3 A;  2L7K A;  3MKW B;  1YIO A;  2VKE A;  2ZFU A;  4HST A;  2JUG A;  4B4C A;  1YE9 A;  3BJO A;  4XSX F;  1FEX A;  3WE2 A;  1MIJ A;  2LKX A;  1YO5 C;  1NG7 A;  3OIQ A;  3BG3 A;  1MBJ A;  4E6K G;  5DUI A;  1Y39 A;  1W0U A;  1MMS A;  1I1S A;  4HF2 A;  4CO8 A;  3D0S A;  3QOP A;  4M3D A;  2B7E A;  2LR8 A;  3H3U A;  3U1K A;  4PJJ A;  1KA8 A;  4PJ0 C;  3FMS A;  2Q1Z B;  1T08 B;  2M1B A;  4XRS G;  2JRT A;  2DT7 B;  2L0K A;  3CCY A;  2LF8 A;  3AG2 H;  1ZR4 A;  3BR3 A;  1A31 A;  4GXO A;  1H8A C;  2E19 A;  3ZCO A;  2R7S A;  4XLH A;  3QWL A;  3WU2 C;  5K5R A;  3H9Q A;  4CYC B;  4RBO A;  3I53 A;  2ZXW H;  1D5V A;  2R93 J;  2XPU A;  2RV8 A;  3K2Z A;  4DW6 A;  1B8I A;  2HYG D;  1C0W A;  4JX6 A;  1PP8 F;  4PK4 A;  3A1Y A;  4G6Q A;  3E5U A;  2XDV A;  4B43 A;  3FIS A;  1OYY A;  2HQA A;  2CO5 A;  4JQF A;  4PJN A;  6PAX A;  2K27 A;  1XGN A;  2VXZ A;  2KLO A;  2NVQ J;  4RGR A;  3LSP A;  2DOA A;  1GLN A;  3DPL C;  4LIV A;  2YUS A;  3RKQ A;  2HOE A;  5EGO B;  1IXS B;  2OZ6 A;  3GUD A;  5DUK A;  2XUB A;  5JVG F;  4CHU A;  2ZSI B;  2CG4 A;  3CMY A;  3AG3 H;  2IS4 A;  3W6K B;  1AA7 A;  2Y9Y A;  3ASO H;  3I71 A;  4EMS A;  1A6Q A;  3EUA A;  3BR6 A;  4N0B A;  3V8L A;  1RUO A;  4XOR A;  5E1Z B;  3H0D A;  1LFP A;  4HDU A;  2QKL B;  3M1E A;  2KDO A;  2W82 A;  3F0C A;  3DWL E;  1MMN A;  3F3X A;  4XLA A;  4OMY A;  2BVM A;  2HKX A;  3WU1 B;  1QHG A;  2VE8 A;  1S5L C;  2PMZ N;  3ABM H;  4OIP F;  4LK1 F;  2W85 A;  3F8F A;  2GXA A;  2CQX A;  1BC7 C;  2KRF A;  5FFX A;  5DDG A;  2R92 J;  4OIR F;  5DM7 F;  5GAE J;  4ZYD A;  1Y1V J;  3HYI A;  2DOF A;  2FNA A;  4RM3 A;  2ZJP F;  2ETH A;  3MN2 A;  4S04 A;  1MMA A;  1R22 A;  3KLN A;  4HDV A;  5L3B A;  1X4O A;  1LQ1 A;  5F08 A;  1FSE A;  4FX0 A;  2HVR A;  3QOD A;  2QGU A;  4HQE A;  2F4O B;  1S3J A;  4B09 A;  2K3P A;  1TQP A;  2IS2 A;  1LDD A;  4DJA A;  1O3R A;  2GM4 A;  3F23 A;  4QTR A;  4CH7 A;  2A3S A;  5FB2 A;  3OOU A;  4RMN A;  1Z3Y A;  5DD8 A;  4J01 A;  5FLX K;  4B44 A;  4I0B A;  1HQC A;  4N9H A;  2X51 A;  4S05 A;  3SZG A;  1T95 A;  1SD4 A;  5F0H A;  2DQL A;  2HU9 A;  4IHS A;  3DEE A;  4D7M A;  1R49 A;  5L3F A;  1UCR A;  4CCO A;  2DT5 A;  3WGG A;  1T38 A;  2E60 A;  1HF0 A;  2G0E A;  3EYI A;  2IPQ X;  2JMW A;  2JQ7 A;  1ZN2 A;  5IYD J;  3BZC A;  4DBR A;  2NXN B;  4M71 A;  2DA5 A;  1FBQ A;  3BPX A;  2EBI A;  1NH3 A;  3OV8 A;  2NNY A;  2XPV A;  5J1U A;  3PQK A;  4KIG A;  1F5T A;  1B4A A;  4C2M J;  2Y9Z A;  1HDD C;  4OOI A;  4DYC A;  5HVQ C;  1Z05 A;  3B6A A;  1ETV A;  4B8X A;  3FXM A;  3I59 A;  4I2O A;  4C30 A;  3CC4 I;  2P7C B;  3DCF A;  5LGU A;  1MDM A;  2UXN A;  1JHF A;  2XAQ A;  5FO5 A;  1QBJ A;  3LA3 A;  1JGG A;  3ZMU A;  3DQV C;  2WTE A;  4HX8 A;  4F7Z A;  4M9Z A;  3JR9 A;  2X6O A;  3HBL A;  4XNF A;  3BOQ A;  1REP C;  2VOD A;  3ISP A;  1ETQ A;  1WJD A;  4J19 A;  2K4B A;  4DOZ A;  1TTY A;  3Q9V A;  2PI0 A;  1H9G A;  2RKH A;  1QA6 A;  1NK3 P;  2CS3 A;  4AU7 A;  2L2O A;  1SD6 A;  5CVV A;  2BY0 A;  2EIJ H;  1I3A A;  3TOB A;  2V26 A;  5CVJ A;  1CGP A;  1OCR H;  3A02 A;  4N9I A;  4CSW A;  2P5K A;  1LNW A;  3C7J A;  3CCM I;  3FWE A;  2K40 A;  4CCJ A;  1B59 A;  3QAH A;  4HA8 A;  1I3Q J;  2GXG A;  2FNP A;  2XPW A;  4HBL A;  2E7X A;  1J5Y A;  1R4M B;  4I0A A;  2IRF G;  1BN5 A;  3TW7 A;  1XS9 A;  1M1E B;  2LNB A;  4OAZ A;  2R7Q A;  3HIF A;  3GTJ J;  3KEO A;  1DP3 A;  4EJW A;  2HZT A;  3MZH A;  4XK4 A;  1LEA A;  5K7H A;  1O57 A;  2XKO A;  4M9S A;  3BY6 A;  1MJB A;  4L18 B;  3S1M J;  1U78 A;  1QPI A;  2DMU A;  3BTJ A;  2DJN A;  5KAF C;  2E35 A;  3GBG A;  2MD0 A;  2D2W A;  4JP0 A;  1IN8 A;  4CUG A;  1AOY A;  5C44 J;  1WZ2 A;  3OR2 C;  3P5J A;  4GDF A;  3DU5 A;  4KT6 A;  2JA6 J;  3E7L A;  3PNT A;  1ONV A;  1A04 A;  1VI0 A;  4IOC F;  4IQ4 A;  2KDZ A;  3R0A A;  4IZZ A;  4KNY A;  4XKV A;  2V7F A;  4RLF A;  2ELK A;  4BNC A;  4EM0 B;  2AQE A;  4NQW A;  2EV5 A;  3BR0 A;  3FDY A;  3NAR A;  1YX5 A;  1OYI A;  3MKZ A;  3OMY A;  2M8G X;  2CQK A;  2L7Z A;  3CLO A;  3BR1 A;  5M3F J;  3DTK A;  2O7O A;  2F5D A;  1ORK A;  2HZD A;  4BHB A;  5ERI A;  3TKY A;  4ENK A;  2F2E A;  2HGC A;  3J81 Z;  1IRX A;  5C3E J;  3H1C A;  4HNT A;  2R5Z A;  3S2D J;  4FIS A;  4EVI A;  3S3N A;  1WHU A;  4LLL A;  3G4S I;  1YLF A;  2EV0 A;  3MMY B;  2LLK A;  4A5M A;  2OD5 A;  5ICC A;  4HYE A;  3RKX A;  1Z6R A;  2XV4 S;  3GWZ A;  3LSR A;  3JTH A;  2JN6 A;  3HSE A;  1EF4 A;  2EFQ A;  2BW3 A;  1OPC A;  2V1U A;  2DBB A;  1SFO J;  3CMM A;  5E3L A;  1GHC A;  3A03 A;  4IRG A;  4M74 A;  1I6X A;  1ZK8 A;  3M8F A;  3BCA A;  5CVU A;  1JUM A;  1WJ5 A;  3CP2 A;  4LFU A;  1STZ A;  2W24 A;  2IXS A;  3ZN1 A;  1ACI A;  1ON1 A;  4FX4 A;  4C2T A;  3S1N J;  2OUM A;  3I3L A;  4H0E A;  2EIN H;  5LGN A;  2VBZ A;  1QVU A;  2BE5 F;  2ZC2 A;  2TRT A;  4ZDO A;  3F21 A;  2MA3 A;  5FJ8 J;  3PO2 J;  3CCL I;  3BZK A;  1HXD A;  3HOW J;  1K6Y A;  1KU9 A;  3ECO A;  3E3V A;  1YG2 A;  4U7B A;  3W6V A;  3HOY J;  1W7P D;  2HXO A;  2HR3 A;  3LQQ A;  3BRO A;  5TGT A;  3TDU C;  3VFZ A;  4CIC A;  3CCJ I;  3RYP A;  2LKP A;  2BYV E;  2MG4 A;  3C18 A;  4A3B J;  5A2Q Z;  3F8M A;  2QQA A;  2VBY A;  4PFO A;  3KET A;  3TOA A;  1K7A A;  3OSG A;  1MJ9 A;  3DV8 A;  4UY8 I;  2VOP A;  3OWT A;  3F8B A;  4ESJ A;  3C2G A;  4BXX J;  5IYB J;  4XKB A;  1QNT A;  2UUZ A;  2QWW A;  3MCZ A;  1K78 A;  4HOB A;  3H5N A;  2EFP A;  3TQN A;  5KVR A;  2M2E A;  3FF5 A;  3KP2 A;  2E1O A;  2K9M A;  4LB5 A;  4ENM A;  3I0T A;  1IDY A;  5FKK A;  3OS0 A;  4L0Z B;  1R4N B;  2E5N A;  4FT8 A;  3RTR A;  3V7C A;  4DBQ A;  2YR2 A;  1BC8 C;  5JR3 A;  4V2F A;  2MSY A;  4UUS B;  1P9Q C;  2XAU A;  3PL8 A;  5FKO A;  3DEW A;  3QYB A;  4F3Q A;  2LKS A;  1ZRD A;  4XOP A;  2XGE A;  5IYC J;  4W1U A;  3GFI A;  4YRV A;  2X85 A;  4YFK F;  1V5G A;  3FXU A;  1G8X A;  1XDS A;  2PBI A;  3ONQ A;  1TT0 A;  2ISY A;  4A0Z A;  4Q5S F;  1FIA A;  1MBF A;  2DK8 A;  2I8D A;  1F36 A;  4M72 A;  5AIP A;  4ZZL A;  5H2F C;  3CCR I;  3U9G A;  1KU3 A;  3RQ4 A;  3G1O A;  1G3W A;  5H20 A;  3B73 A;  4ESF A;  4FET A;  3A2K A;  4UXN A;  3SYT A;  2FOK A;  4UNO A;  5FKM A;  1A35 A;  1N78 A;  1J59 A;  4CZZ A;  2ZME B;  4IHT A;  4E7K A;  3BP8 A;  2WY8 Q;  3KEQ A;  3S3M A;  1K4T A;  4A0X A;  1JT6 A;  3OYB A;  5D5V B;  1OYW A;  5LLQ A;  2P81 A;  1IF1 A;  4O3M A;  4BYY A;  2UZK A;  4XR6 A;  3NAU A;  3K0L A;  1LUJ B;  3CCE I;  1J75 A;  3ABU A;  1T98 A;  4HLX A;  1NHA A;  2NRA C;  1NTC A;  4JX5 A;  2W1O A;  1HOM A;  2PMH A;  3VB2 A;  1I27 A;  1VQP I;  1HW5 A;  3SEZ A;  1W5C C;  2EIM H;  5LHH A;  5GP9 A;  3BWG A;  2E71 A;  2DYR H;  3JRG A;  1UHM A;  1RNL A;  5F1R A;  1PP7 U;  3CDH A;  2LH9 A;  2WWY A;  2L01 A;  4XON A;  2XAF A;  3TGN A;  3GTL J;  3QYE A;  1W36 C;  1W5S A;  2FQ4 A;  2L7M P;  2IAI A;  3BG6 A;  1X3Z B;  1MD0 A;  1IC8 A;  3T5X A;  5ED4 A;  2LSO A;  1RR7 A;  4RGX A;  3DU6 A;  3B6C A;  3U21 A;  1LB2 A;  5DCM A;  3QU6 A;  1WH7 A;  2D1H A;  4ZZD A;  5EF6 A;  4CYC A;  4MEX F;  1EA3 A;  1QQI A;  3DXJ F;  5FKL A;  1TNT A;  4NBQ A;  4IHY A;  4FTH A;  2K9N A;  2V6E A;  4Y3O A;  4XLF A;  3CQZ J;  4BHP A;  4LIU A;  3OL3 A;  2LDU A;  2CUJ A;  2HVS A;  2XRL A;  3WG9 A;  3K70 C;  1YS7 A;  1SVO A;  4LGW A;  3ZQL A;  3K1P A;  2BHY A;  3IKT A;  4ZH4 F;  2VJJ A;  4BQO A;  2DMQ A;  1TWA J;  4A0Y A;  3E1S A;  3QOE A;  4UHT A;  3KPH A;  2CUE A;  5HS7 A;  4Y33 A;  3DTE A;  2BY3 A;  2GWR A;  4HPQ A;  4UV9 A;  2A5Y B;  3GTQ J;  3CJT B;  1IRZ A;  3K70 D;  1FMW A;  1D8J A;  3GZN B;  3BG5 A;  2Y0M A;  2COM A;  4NUB A;  4U88 A;  1DGW Y;  3MZ8 A;  3E5X A;  4EM2 A;  4M3F A;  3SEQ A;  5HDK A;  1MSF C;  3TO7 A;  1IN5 A;  3CME I;  3W2A A;  3AFH A;  1ZRC A;  2VB6 A;  5BOX A;  1ON2 A;  4HX4 A;  1JI8 A;  2M8E A;  3EUH C;  2CU7 A;  2CQQ A;  3ZMS A;  1Z0X A;  3MFK A;  3PUF A;  2IA0 A;  1XD7 A;  5E8G A;  2STT A;  3V8K A;  1Z91 A;  4WK8 F;  2K3F A;  4EEF G;  4EV0 A;  1ZG3 A;  5F6F A;  1YW8 A;  5E20 A;  1H88 C;  1UST A;  2XGD A;  1I6H J;  3BTI A;  3JW4 A;  4YFX F;  3O6B B;  2H27 A;  3Q9S A;  1PYV A;  2FBK A;  1XMA A;  2ZSH B;  2GZW A;  1X4P A;  2A05 A;  1UHW A;  1VF9 A;  3JAM K;  3E5Q A;  3M4O J;  4DQ2 A;  2R5Y A;  1BJA A;  4A3J J;  2KJC A;  5ICF A;  2Z99 A;  4ZC3 A;  4BQA A;  3GFM A;  1XSV A;  2EIK H;  1ZR2 A;  4F55 A;  1HKQ A;  2AXL A;  4XKW A;  3JRA A;  4U0V A;  4LB6 B;  3K4C A;  2H09 A;  3PQJ A;  5HNF A;  1WGX A;  1I1G A;  1YYV A;  4MTD A;  5JLX A;  1TQI A;  4NQW B;  4KYW A;  3LSI A;  4NC8 A;  2ZBK A;  2NS8 A;  3EUK L;  2X1C A;  4FQG A;  1BOA A;  1YIT I;  3OYG A;  1AU7 A;  3HRU A;  2A61 A;  4IPA A;  3CCQ I;  3DBH B;  2ID3 A;  3TP3 A;  4C2U A;  5LHI A;  4B48 A;  1V3F A;  2GBY A;  2MBF A;  3BT9 A;  3NWS A;  3QPS A;  2R5Z B;  4NDL A;  3RI4 A;  3IRR A;  2KT0 A;  2BOL A;  1TP4 A;  4A3G J;  2IS6 A;  5GAD J;  4OIN F;  2W7N A;  1J09 A;  4C3I J;  3FXJ A;  3E6C C;  3A0B C;  2Z5U A;  1XN7 A;  4AWX B;  1XGO A;  3MKY B;  5C4X J;  2ME0 A;  2JRM A;  1QZZ A;  2EK5 A;  4BY7 J;  1HST A;  4PJM A;  2IJL A;  3CUQ A;  1SD5 A;  3RYR A;  5H6R A;  5J8F A;  3LSJ A;  3JTG A;  2VE9 A;  2MH2 A;  2DXI A;  2IEK A;  2DFF A;  2I10 A;  5LBQ A;  5LHG A;  2EQR A;  4RA2 A;  2RRE A;  3KCC A;  1MSE C;  3HUG B;  3KP5 A;  3IUO A;  2KZG A;  1W7P B;  1YHQ I;  1ENH A;  3KZI C;  4CCK A;  2WB1 N;  1MGT A;  1NG6 A;  3GFJ A;  3ZR8 X;  3R4K A;  1ZRE A;  2WAQ A;  4QIW N;  1Y56 A;  1BW5 A;  1ULY A;  4IHW A;  1BBY A;  1HSJ A;  3A01 A;  2WV1 A;  4WXC A;  2H1K A;  5FRO A;  4R79 A;  3GLX A;  1FIP A;  3AAF A;  3DEU A;  5K1Y A;  2FJ1 A;  2Y31 A;  4L9T A;  1LVK A;  1G4D A;  5B1B H;  4WXH A;  1VQ4 I;  4X0G A;  1SD7 A;  3TO6 A;  2DA7 A;  2JK3 A;  2V1D A;  2LBF A;  2QF7 A;  2FXA A;  3VSL A;  1W0T A;  1TT5 B;  2OQR A;  3GFL A;  1WH5 A;  4UUV A;  3OSF A;  1DGR M;  1F4K A;  1MBE A;  2VXD A;  1U0J A;  1CQT A;  1EJ9 A;  1UHS A;  2G9W A;  4ZJZ A;  3HEF A;  2O5R A;  4OU0 A;  4P9F A;  1R9T J;  1JJ8 C;  4O5V A;  4M6Y A;  4A3D J;  2E7W A;  2GOX B;  4I98 B;  3UKG A;  4M3E A;  2YPR A;  5ILS A;  3P9I A;  5DTD A;  4I09 A;  4BUP A;  4U0W A;  3HRS A;  2RN7 A;  3DTI A;  4BY1 J;  1DPU A;  1SFU A;  3NEU A;  1TW3 A;  2QUF A;  1A5J A;  3LFK A;  2F5E A;  4MO7 A;  4HRI A;  3DP7 A;  1KON A;  2K9S A;  2DCE A;  1Z1D A;  2LK2 A;  3HTS B;  3BQY A;  1R6R A;  2DMN A;  3IHU A;  3M8J A;  2F4M B;  2CGP A;  2ECC A;  2FOW A;  2RVC A;  3WTS C;  3PIO F;  3JRF A;  2NAZ A;  2WAQ N;  3IAM 2;  2OPT A;  3HGY A;  2Y2Z A;  5DS9 A;  5CVI A;  4YEJ A;  1J9I A;  2OAZ A;  3I9V 2;  2M7A A;  3PIP F;  4FAS D;  3BLY A;  3VYR B;  3ZQC A;  4MEY F;  2GA2 A;  4XSZ F;  2YX4 A;  4CXF A;  2GIZ A;  1XMK A;  4IX7 A;  5EJC A;  3HZJ A;  3WG7 H;  4KN4 X;  2GIV A;  3IH4 A;  2EA2 A;  1ZEL A;  2NVT J;  1FOW A;  3ABL H;  2XRO A;  2XF7 A;  4MLO A;  3T8R A;  5B3S H;  3S2H J;  2EB7 A;  4ZYA A;  1X1C A;  3O8G A;  1WJE A;  3K4M A;  2A6E F;  3HOU J;  4LG0 A;  1YJ9 I;  4L0Y B;  2ZXH A;  2PMU A;  2DW4 A;  4LLG F;  3CP8 A;  5EDN A;  1E3P A;  4E70 A;  1KQ0 A;  4HQM A;  2LY2 A;  4PDK A;  5DV5 A;  1V5F A;  3E6D A;  1R5I D;  1Z21 A;  5KK1 A;  1X3W B;  3H5R A;  1O7L A;  2HI3 A;  2IA2 A;  2FEZ A;  3V7S A;  1R1V A;  5EG0 A;  3KYL A;  4U87 A;  2IGN A;  4MHG A;  1D5Y A;  2KRH A;  2EFN A;  2D5V A;  2UWM A;  2K9L A;  5BQT A;  4AYB A;  2MFZ A;  1TC3 C;  5M5Y J;  4MFE A;  1IGN A;  2KHM A;  3BQZ A;  3CMA I;  4IEJ A;  3R6S A;  3IH3 A;  3IRQ A;  2LRE A;  1YQA A;  1Y6I A;  5BPI A;  4A12 A;  3DLL F;  2V6C A;  2ZXJ A;  3KLO A;  4N4O B;  1U3E M;  1MND A;  4G12 A;  3X2Q H;  4YFN F;  5D5W B;  3FXK A;  3OYM A;  2LYC A;  5CYV A;  2I5U A;  2EH3 A;  1L0O C;  3BTL A;  4D7N A;  3JRC A;  2CV2 A;  2R7D A;  2OCE A;  3ZQG A;  1WJB A;  1G3Y A;  4M73 A;  3I59 B;  4F91 B;  4RAG A;  3JCU C;  2CQN A;  4XKC A;  1SAN A;  2LD5 A;  3F22 A;  5ICG A;  2DA1 A;  5BS6 A;  3FBI B;  3GVA A;  5FD6 A;  4XLE A;  3H3V K;  2JSP A;  2GA1 A;  4ZYE A;  4BGD A;  2DFI A;  3ZN0 A;  4CYD A;  2RAE A;  3F72 A;  2Z3Y A;  4EJV A;  4ENJ A;  2DLL A;  1APL C;  1VZ0 A;  3CF2 A;  1U9N A;  1ETK A;  2XSD C;  3O2P E;  2EZL A;  1E3H A;  1B6A A;  3HRT A;  3QP6 A;  2RGV A;  4ZDL A;  3I4M J;  1HCR A;  3E97 A;  2HDD A;  5EYR A;  3HG9 A;  3FXQ A;  4YII A;  1J7K A;  1RI7 A;  2KIF A;  3KX2 A;  3SJM A;  2DJI A;  3CCU I;  1XGM A;  5LEJ A;  2DFH A;  3GEZ A;  3BR2 A;  1R00 A;  1OLT A;  3L7W A;  4KIB A;  3WTW C;  3FX3 A;  4O6J A;  3HSF A;  1Q1V A;  3FK7 A;  5F27 A;  4LMY A;  1YIJ I;  3O8H A;  2X0L A;  3O3K A;  2MGQ A;  2FBI A;  2E1M C;  3I58 A;  1GXQ A;  1JXS A;  4E7L A;  1ODD A;  1FZP B;  4OIQ F;  1F1Z A;  1FY7 A;  1V54 H;  4ABZ A;  2M0C A;  2BBY A;  1MMG A;  4RAZ A;  2P5L C;  1EV7 A;  5E79 C;  3WHC A;  5BNG A;  5F0C A;  3GF2 A;  2XAS A;  2MW8 A;  3CC7 I;  1JKR C;  3BG7 A;  1D0Z A;  1BR4 A;  2K5C A;  5J3L A;  1IN7 A;  1FTZ A;  4JOM A;  1Z67 A;  3L2C A;  1AKH B;  3Q0W A;  5DCM B;  4A3F J;  3U1D A;  4EGZ A;  4GCV A;  2E34 A;  2HNH A;  1T39 A;  4AYB N;  1TBX A;  3MQ0 A;  2CV0 A;  3LOC A;  5J4V A;  2DDA A;  1JUP A;  4NC7 A;  2CH0 A;  5K7F A;  4AIJ A;  1LKX A;  2OA4 A;  3S16 J;  3GME A;  2XRN A;  2VQG A;  2YU3 A;  5J1Y A;  4JYK A;  1UG2 A;  1Y1W J;  3FBN B;  5J8C A;  4J00 A;  4BHC A;  2R7O A;  1H9T A;  2CFO A;  1Y8R B;  2E36 A;  1XSX A;  4HV5 A;  1RKT A;  1X3U A;  3RSN A;  4E4H A;  3GYH X;  3DKW A;  1WQ2 A;  2VQC A;  1U5T C;  1XTA A;  2ESH A;  5F0F A;  3MAJ A;  1BI2 A;  5JFR A;  3KP7 A;  1YRN A;  2KKO A;  3V8J A;  2IW5 A;  5EZG A;  2ZKZ A;  2DA6 A;  4BE0 A;  1USS A;  2QCO A;  3OYA A;  2VON A;  1CF7 A;  3S14 J;  1JKQ C;  1VQ5 I;  4KUM A;  1QO0 D;  4L5E A;  4ANJ A;  4ENN A;  2E5Z A;  2RDP A;  3ESW B;  1K79 A;  4A3M J;  3FMR A;  3E6B A;  4M3G A;  2ESN A;  1FBU A;  2MC3 A;  5JI6 A;  1VTN C;  1IN4 A;  3K4K A;  2OZU A;  1OCT C;  1ZQ3 P;  2H94 A;  1VQL I;  2M9H A;  1D1A A;  1S9H A;  3RPQ A;  2JA5 J;  5FRM A;  2DMP A;  2WV0 A;  2MAB A;  1ETY A;  4XL9 A;  4BL0 B;  3J7Y J;  2LP0 A;  2BY2 A;  1TQM A;  2VLA A;  3HUG A;  1WJF A;  1WJC A;  3ABT A;  3DBR B;  4P96 A;  1U5T A;  2XVC A;  2LY9 A;  2N8G A;  3E0J B;  1FC3 A;  2KIM A;  1BOB A;  2A68 F;  1U9O A;  3L2R A;  1IRF A;  5L3G A;  1QPM A;  3PNV A;  1OMI A;  2BZT A;  2FML A;  1R23 A;  3H9J A;  3F8N A;  3LST A;  3KZY A;  5M3M J;  2ZJR F;  4E7H A;  1KZH A;  2P7V B;  1KGS A;  1KYZ A;  2V4J C;  4BJ6 C;  3RPU A;  1WJA A;  3CJR B;  3D5L A;  3ZRG A;  1R58 A;  3ZP5 A;  2HOS A;  4NHJ A;  3LMM A;  2JWT A;  3TMO A;  3LNQ A;  1HW1 A;  2PMZ A;  1SMT A;  3KE2 A;  5FKN A;  3RPU D;  1E17 A;  3LL7 A;  4XLC A;  3OYC A;  3OY9 A;  2A6T A;  4G6D A;  4U0Y A;  2CW7 A;  3V4G A;  1VQK I;  5E3O A;  1JT0 A;  1EH6 A;  2IGO A;  1RR8 C;  1GDT A;  2XGX A;  1DU0 A;  1FPQ A;  3M7G A;  2XB0 X;  3RQI A;  4KT5 C;  2DAO A;  2XGC A;  5EEH A;  1ZG5 A;  4LOC A;  1SFK A;  2QQB A;  3FM3 A;  1LFU P;  1LE8 B;  1BIA A;  3LSK A;  1P7J A;  4P1W A;  2PG4 A;  2ZJ2 A;  3RZD J;  3SHF A;  1IRG A;  2AHQ A;  4AID A;  2B0L A;  4LK0 F;  2XIG A;  2LC2 A;  4I01 A;  3HGG A;  2D45 A;  1ZYR F;  2IGK A;  2QQ8 A;  2H8W A;  1S72 I;  2ZME A;  1K4S A;  4GYG A;  2P8T A;  1N75 A;  2EZK A;  1RIO H;  3VYU B;  3LA2 A;  1OCO H;  2Y0S A;  5J6X A;  1F9N A;  1T33 A;  5LRR A;  5C4J J;  2HOT A;  2MC4 A;  2HTJ A;  1WFX A;  3VWB A;  1DU6 A;  1ZAO A;  1EKE A;  2F5F A;  2ADU A;  3SQN A;  4G7O F;  1U6G A;  4MNU A;  4M6X A;  3F8C A;  3V7R A;  4JBA A;  3I5U A;  4E7J A;  1YX3 A;  3IC7 A;  1XX5 A;  5FD5 A;  5KNL A;  4BEH A;  1MZB A;  2M34 A;  3IKV A;  3ZQF A;  4WCG A;  1OR7 A;  1DPR A;  1TNS A;  2DA3 A;  4MQV A;  2H8R A;  5LGT A;  1SAX A;  3JSO A;  2A69 F;  5A2Q K;  5D5U B;  2MLK A;  5EEA A;  1GUU A;  5B1A H;  3T8T A;  3WOD F;  3H35 A;  4L5I A;  3OOP A;  4H4K C;  2ZB9 A;  3NQO A;  3COA C;  1POG A;  3RKY A;  5D6E A;  1IV8 A;  3AL0 C;  1IUY A;  2V9K A;  3ELK A;  3ZMD A;  3H5A A;  1SEU A;  3G1M A;  1JJ6 C;  1SMY F;  2ME6 A;  3OR1 C;  4M3B A;  2K02 A;  5J40 A;  1MJA A;  4HV6 A;  2Z16 A;  3ZOB A;  2VOO A;  1GVJ A;  1Z3X A;  1EH8 A;  1R7J A;  3TBI A;  1N25 A;  1OCP A;  4I7H A;  5HNH A;  2HWV A;  2NS0 A;  1Y0U A;  1IZ1 A;  4OWR B;  1YJW I;  3PO3 J;  5HLG A;  3HRM A;  1XG1 A;  4EGY A;  1HBX G;  1JTY A;  4I02 A;  1KU2 A;  2KIQ A;  5D4R A;  3GCM A;  1LDJ A;  2LMD A;  3HOZ J;  4A69 C;  3REO A;  1WI3 A;  2OQG A;  1SFE A;  3F6V A;  2E1N A;  4B3A A;  1RKW A;  5F1J A;  3QPL A;  1T0F A;  4C3H J;  1FMV A;  5D6F A;  4NNJ A;  3JRB A;  3AL0 B;  4Z6Y A;  2DOD A;  3N05 A;  2PFB A;  1UG0 A;  2OF7 A;  4CGZ A;  4ZYG A;  2BEO A;  3QRF F;  1KQ9 A;  1O7F A;  3VDX A;  4YEL A;  4ZTF A;  4DGW B;  1OQY A;  2FSW A;  4A5N A;  5HLT A;  1BL0 A;  2JA7 J;  4FCY A;  1JE8 A;  3J80 K;  2BW3 B;  2ZXI A;  1TWH J;  5HS9 A;  3CCS I;  2VBX A; 
#chains in the Genus database with same CATH homology
 2EJR A;  1R5G A;  3BZ6 A;  5HS8 A;  2ISZ A;  3GZ6 A;  4KA4 A;  4G8X A;  1XCB A;  2EWN A;  2V1X A;  3R60 A;  1FYK A;  2P5V A;  3EET A;  3SXY A;  3ZPL A;  3KZZ A;  1BM9 A;  5FGM A;  1JGS A;  3ZMT A;  3K9T A;  4RAY A;  1XDU A;  3DF8 A;  2IVM A;  4K2E A;  5L3E A;  4MQ9 F;  2IP2 A;  3CUQ C;  3T1B A;  3WTT C;  4KIC A;  2GQQ A;  4G7Z F;  1FLI A;  3CO7 C;  2FRH A;  4KFC A;  2HEO A;  1KQ8 A;  1LVA A;  1P92 A;  4BAY A;  3C1D A;  2MLG A;  2HDC A;  1FSH A;  4CDG A;  5JHU A;  3LAJ A;  2DI3 A;  2MD5 A;  2JTV A;  1GXP A;  4PZJ A;  2Y48 A;  2PJP A;  2P4W A;  2OBP A;  3BPV A;  1LDK B;  2R7F A;  1CF7 B;  2MH9 A;  2CFX A;  5E1X A;  4RB0 A;  1OKR A;  1L3L A;  1U8R A;  4AD9 A;  4YIF A;  4MGR A;  1B9M A;  4UVA A;  3VOE A;  3QU3 A;  1DUX C;  3M9A A;  1FYL A;  4KDP A;  2W25 A;  1G6N A;  3W6J B;  2VC0 A;  4HF0 A;  3ROU A;  3G3Z A;  4EM1 A;  3WGI A;  3C3W A;  1XB4 A;  3IL2 A;  2E1C A;  2VT3 A;  2FE3 A;  1YW7 A;  1FOK A;  2YSR A;  1HKT A;  3NRV A;  3WTZ A;  1YS6 A;  2HKO A;  2X4H A;  5BPD A;  3H92 A;  1O3Q A;  2JPB A;  3FM5 A;  5JVT A;  2CYY A;  2TDX A;  3EDP A;  5K5O A;  1G3T A;  1FNN A;  1Z6T A;  5AON A;  1PDN C;  3WTU C;  1W7P A;  3JSP A;  4A6D A;  3R0J A;  1LEB A;  3LWF A;  2DPD A;  3BJ6 A;  1K6O A;  4BH9 A;  3EUH A;  5ILV A;  3HOT A;  1SFX A;  3S2W A;  5D5X B;  2KIU A;  2M30 A;  2ACJ A;  4NB5 A;  3HOS A;  1FWZ A;  3BJA A;  4LD5 A;  3WGH A;  2QVO A;  3JAM Z;  2QM3 A;  1B1B A;  3GXO A;  2PN6 A;  4G94 A;  1ZRF A;  5D8K B;  2ZNZ A;  1S7A A;  5LEK A;  5IT9 K;  1LJ9 A;  5E18 F;  2CSO A;  5H6Q A;  2P6T A;  2ZO4 A;  3J7A O;  1J0R A;  2L3D A;  4WXD A;  1S29 A;  3LA7 A;  4Y13 A;  1KYW A;  3KP6 A;  1MKM A;  5HLH A;  4AVP A;  1ZG1 A;  1P4X A;  3GO5 A;  4KIF A;  4PCQ A;  4XBF A;  3E6M A;  4GGG A;  3I4P A;  3SFZ A;  1WRJ A;  2M45 A;  4DNC A;  1YTY A;  4RB3 C;  4ON0 A;  2GAU A;  1R5H A;  4A2U A;  3R61 A;  4QLC U;  4LG0 B;  4EJT A;  5HDN A;  3FHZ A;  2FF4 A;  2BV6 A;  2HQR A;  2HFH A;  4L9N A;  5DEQ A;  2DU9 A;  3CJN A;  3Q5F A;  2JPC A;  4KN7 X;  3B02 A;  2DO7 A;  2G7U A;  2QZ8 A;  2L4M A;  2XKP A;  3WTY C;  1YFH A;  3L09 A;  2IT0 A;  2DK5 A;  2O8X A;  3ZMV A;  4RGU A;  2R3S A;  3ERE D;  3GZ5 A;  5DYM A;  3SZP A;  4ETS A;  2RQP A;  2BGC A;  2O6G E;  4IVN A;  1WSU A;  4IJA A;  4LLN A;  1R1U A;  2ELH A;  3J80 Z;  1WI9 A;  5L3C A;  2O03 A;  3HTU A;  2Q8K A;  1IAW A;  2DQR A;  3G73 A;  1D8K A;  4BXU A;  3RDI A;  4EQQ A;  3K1M A;  4GO1 A;  3QPT A;  5HOO A;  4D0P A;  2H6C A;  2PQ8 A;  5BMZ A;  1WKM A;  2QBY B;  2FMY A;  3L00 A;  4P55 A;  1E2X A;  4IRH A;  3VOD A;  1XGS A;  4EJO A;  3I64 A;  4IXA A;  2O0Y A;  1H0M A;  2C6Y A;  3WE3 A;  1XCV A;  1FX7 A;  3K69 A;  4AIH A;  3QPH A;  1MDM B;  2KJB A;  2JZY A;  4Q47 A;  2O3F A;  3CUO A;  1ZLK A;  2FA5 A;  2DTR A;  5LRS A;  1ZHF A;  4HF1 A;  4GYI A;  3IWF A;  5IT9 Z;  3HHH A;  3F6O A;  2LF7 A;  1ZH5 A;  1UFM A;  1BIB A;  3CUQ B;  3GW2 A;  2Z33 A;  2L4A A;  5AIQ A;  1WWX A;  2L02 A;  1FP1 D;  2STW A;  3ZQ7 A;  5E17 F;  1FBS A;  2ZFW A;  4XLN F;  1G3S A;  1ZGA A;  3VEP A;  1ZGJ A;  1Q1H A;  1RZ4 A;  3LQR A;  1ZLJ A;  2EFW A;  4XRF A;  3N4M A;  2XAH A;  2AS5 F;  2H6B A;  2D1V A;  2YX7 A;  2VN2 A;  5K5Q A;  5D8L B;  1BI1 A;  3FMQ A;  2J5O A;  3J81 K;  3GX4 X;  3T0Y A;  3WTV C;  4FHT A;  4M9X A;  2EFO A;  2Q0O A;  1FT9 A;  4IF4 A;  1KU7 A;  3ML6 A;  2QBY A;  1R1T A;  4KMU X;  5TRD A;  2RC4 A;  1Z9C A;  2JSC A;  4L9J A;  4YG2 F;  3MEX A;  3BDD A;  4HW0 A;  1I5Z A;  2XHK A;  3U2R A;  2IA1 A;  5DD4 A;  4AIK A;  3RIR A;  4ZYH A;  2NNN A;  5ICE A;  2G7H A;  4P9U A;  4L5J A;  2FU4 A;  1RUN A;  2ZNY A;  2QYO A;  4HAM A;  2HYF A;  1HW2 A;  5E1W A;  4G9Y A;  2QEN A;  1U2W A;  1TLH B;  2F5C A;  4U7D A;  4WWC A;  3PFI A;  4UVC A;  2WC2 A;  4RB2 C;  4UVB A;  2A07 F;  2JT1 A;  2W84 A;  1J2X A;  4Y17 A;  3I54 A;  2VBW A;  2GXB A;  4ESB A;  4JK1 X;  1T6S A;  5F64 A;  5EEG A;  2HS5 A;  5E8I A;  3WTX C;  4OIO F;  3SZT A;  1XSD A;  1W5T A;  3HHG A;  2Z9O A;  1PUE E;  1BI3 A;  1AWC A;  1EH7 A;  4QWQ A;  4PGG A;  1W4M A;  3QP5 A;  4KMF A;  1U5T B;  4L9V A;  2VT2 A;  2CW0 F;  4WF2 A;  1IN6 A;  4A6E A;  5FLX Z;  2CWE A;  3N97 A;  1DDN A;  1S7O A;  5CLS A;  4LJZ F;  2Y75 A;  2V9V A;  2DPU A;  2HQN A;  1IXR C;  2J5P A;  2Q2E A;  2M87 A;  1O3T A;  3K1N A;  5HLI A;  1FYM A;  2NYX A;  1BI0 A;  3P9C A;  3CTA A;  2L54 A;  3M8E A;  1QGP A;  2V79 A;  1P2F A;  1K78 B;  1IXC A;  5DCF A;  5CVR A;  2EV6 A;  3ULQ B;  4Q4Z F;  3ECH A;  1V4R A;  2UXX A;  3H3Z A;  4XLP F;  3RKW A;  2RNJ A;  4WX9 A;  4R8H A;  4MTE A;  4RS8 A;  1Z7U A;  4G7H F;  3P7N A;  2K7L A;  3TDZ C;  3ZMZ A;  1S8N A;  1JHH A;  2FBH A;  1IW7 F;  3EQL F;  2QQ9 A;  2VC1 A;  1S6L A;  5ILU A;  4HX7 A;  1HKS A;  2FQ3 A;  4HZF A;  1P4W A;  2PLY A;  2HTS A;  1QZY A;  3EYY A;  2ZCW A;  4RGS A;  2QLZ A;  4EJU A;  3TO9 A;  4HLY A;  4Y15 A;  2K4J A;  5IT3 A;  3LAP A;  4R1H A;  5FFZ A;  2M5W A;  2A6H F;  3HSR A;  1D3Y A;  3RJP A;  3MWM A;  1DP7 P;  3WU0 A;  4TV7 A;  4Z2Y A;  1R36 A;  2PEX A;  4IRI A;  5TJJ A;  1FP2 A;  2P6S A;  1UB9 A;  3P9K A;  3KFW X;  3CO6 C;  2W57 A;  2XAG A;  3DPT A;  3L9F A;  5D4S A;  4OMZ A;  3FXR A;  2K86 A;  1B9N A;  2EA4 A;  4P5O A;  1O3S A;  3KP4 A;  4RB1 A;  2OU2 A;  5L3D A;  1T2K A;  3FZV A;  4PGH A;  3DFG A;  1TW2 A;  5HDG A;  2O61 A;  3IWZ A;  3MZY A;  4ASN A;  1P4A A;  4Q48 A;  1YW9 A;  2XAJ A;  5CJ9 A;  1P6R A;  4UV8 A;  1ZAR A;  3KP3 A;  1YIO A;  3BJO A;  4XSX F;  3WE2 A;  1YO5 C;  5DUI A;  1I1S A;  4HF2 A;  4CO8 A;  3D0S A;  3QOP A;  3H3U A;  1KA8 A;  3FMS A;  2M1B A;  2JRT A;  2LF8 A;  4GXO A;  5K5R A;  3I53 A;  1D5V A;  2RV8 A;  3K2Z A;  2HYG D;  1C0W A;  1PP8 F;  4G6Q A;  3E5U A;  1OYY A;  2CO5 A;  4JQF A;  6PAX A;  2K27 A;  1XGN A;  2VXZ A;  4RGR A;  3DPL C;  2HOE A;  1IXS B;  2OZ6 A;  3GUD A;  5DUK A;  2XUB A;  4CHU A;  2CG4 A;  3W6K B;  3I71 A;  4EMS A;  4N0B A;  3V8L A;  1RUO A;  5E1Z B;  4HDU A;  3M1E A;  3F3X A;  4OMY A;  2HKX A;  3WU1 B;  2VE8 A;  4OIP F;  4LK1 F;  2W85 A;  3F8F A;  1BC7 C;  2KRF A;  5FFX A;  5DDG A;  4OIR F;  4ZYD A;  3HYI A;  2FNA A;  2ETH A;  4S04 A;  1R22 A;  3KLN A;  4HDV A;  5L3B A;  1LQ1 A;  1FSE A;  4FX0 A;  4HQE A;  1S3J A;  4B09 A;  1TQP A;  1LDD A;  1O3R A;  3F23 A;  2A3S A;  5FB2 A;  5DD8 A;  5FLX K;  4I0B A;  1HQC A;  4N9H A;  4S05 A;  1SD4 A;  2DQL A;  4IHS A;  5L3F A;  1UCR A;  2DT5 A;  3WGG A;  1T38 A;  3EYI A;  2IPQ X;  1ZN2 A;  4M71 A;  1FBQ A;  3BPX A;  3OV8 A;  2NNY A;  3PQK A;  4KIG A;  1F5T A;  1B4A A;  4OOI A;  5HVQ C;  1Z05 A;  4B8X A;  3I59 A;  4I2O A;  2P7C B;  5LGU A;  1QBJ A;  1MDM A;  2UXN A;  1JHF A;  2XAQ A;  5FO5 A;  3LA3 A;  3ZMU A;  3DQV C;  2WTE A;  4HX8 A;  4F7Z A;  4M9Z A;  3BOQ A;  1REP C;  2VOD A;  3ISP A;  2K4B A;  1TTY A;  3Q9V A;  2PI0 A;  1H9G A;  2RKH A;  1SD6 A;  5CVV A;  3TOB A;  5CVJ A;  1CGP A;  4N9I A;  2P5K A;  1LNW A;  3C7J A;  3FWE A;  1B59 A;  3QAH A;  4HA8 A;  2GXG A;  2FNP A;  4HBL A;  2E7X A;  1J5Y A;  4I0A A;  2IRF G;  1BN5 A;  2LNB A;  3HIF A;  3KEO A;  4EJW A;  2HZT A;  3MZH A;  1LEA A;  1O57 A;  2XKO A;  4M9S A;  3BY6 A;  1MJB A;  4L18 B;  1U78 A;  2D2W A;  1IN8 A;  1AOY A;  1ONV A;  1A04 A;  3R0A A;  4KNY A;  4BNC A;  4EM0 B;  4NQW A;  2EV5 A;  1OYI A;  2CQK A;  3CLO A;  2F5D A;  4BHB A;  5ERI A;  3TKY A;  4ENK A;  2F2E A;  2HGC A;  3J81 Z;  4EVI A;  4LLL A;  1YLF A;  2EV0 A;  4A5M A;  2OD5 A;  5ICC A;  4HYE A;  3RKX A;  1Z6R A;  2XV4 S;  3GWZ A;  3JTH A;  3HSE A;  2EFQ A;  2V1U A;  1OPC A;  2DBB A;  1GHC A;  4IRG A;  4M74 A;  1I6X A;  3M8F A;  5CVU A;  4LFU A;  1STZ A;  2W24 A;  3ZN1 A;  1ON1 A;  4FX4 A;  4H0E A;  5LGN A;  2VBZ A;  2BE5 F;  3F21 A;  2MA3 A;  1HXD A;  1KU9 A;  3ECO A;  3E3V A;  1YG2 A;  4U7B A;  1W7P D;  2HR3 A;  3LQQ A;  3BRO A;  3TDU C;  3VFZ A;  4CIC A;  3RYP A;  2LKP A;  2BYV E;  3C18 A;  5A2Q Z;  3F8M A;  2QQA A;  2VBY A;  3KET A;  3TOA A;  1K7A A;  1MJ9 A;  3DV8 A;  2VOP A;  3F8B A;  4ESJ A;  1QNT A;  2QWW A;  3MCZ A;  1K78 A;  4HOB A;  2EFP A;  3TQN A;  5KVR A;  3FF5 A;  3KP2 A;  4LB5 A;  4ENM A;  3I0T A;  4L0Z B;  4FT8 A;  3RTR A;  3V7C A;  2YR2 A;  1BC8 C;  5JR3 A;  1ZRD A;  3GFI A;  4YFK F;  3FXU A;  1XDS A;  2PBI A;  2ISY A;  4A0Z A;  4Q5S F;  2DK8 A;  4M72 A;  5AIP A;  4ZZL A;  3U9G A;  1KU3 A;  5H20 A;  1G3W A;  3B73 A;  4ESF A;  4UXN A;  2FOK A;  4UNO A;  1J59 A;  4CZZ A;  2ZME B;  4IHT A;  3BP8 A;  3KEQ A;  4A0X A;  5D5V B;  1OYW A;  5LLQ A;  1IF1 A;  4O3M A;  4BYY A;  2UZK A;  3K0L A;  1J75 A;  3ABU A;  1T98 A;  4HLX A;  1NHA A;  2NRA C;  2PMH A;  3VB2 A;  1I27 A;  1HW5 A;  5LHH A;  3BWG A;  1UHM A;  1RNL A;  5F1R A;  1PP7 U;  3CDH A;  2WWY A;  2L01 A;  2XAF A;  3TGN A;  1W5S A;  1MD0 A;  3T5X A;  5ED4 A;  2LSO A;  4RGX A;  1LB2 A;  5DCM A;  3QU6 A;  2D1H A;  4ZZD A;  4MEX F;  1QQI A;  3DXJ F;  1TNT A;  4BHP A;  2LDU A;  3WG9 A;  1YS7 A;  4LGW A;  3K1P A;  3IKT A;  4ZH4 F;  4A0Y A;  4UHT A;  5HS7 A;  2GWR A;  4UV9 A;  2A5Y B;  1D8J A;  2Y0M A;  2COM A;  4U88 A;  3E5X A;  4EM2 A;  5HDK A;  3TO7 A;  1IN5 A;  1ZRC A;  5BOX A;  1ON2 A;  4HX4 A;  2M8E A;  3ZMS A;  3MFK A;  2IA0 A;  1XD7 A;  5E8G A;  2STT A;  3V8K A;  1Z91 A;  4WK8 F;  4EV0 A;  1ZG3 A;  5F6F A;  1YW8 A;  5E20 A;  1UST A;  3JW4 A;  4YFX F;  3O6B B;  2H27 A;  3Q9S A;  2FBK A;  1XMA A;  2GZW A;  1UHW A;  3JAM K;  3E5Q A;  4DQ2 A;  1BJA A;  2KJC A;  5ICF A;  2Z99 A;  4BQA A;  3GFM A;  1XSV A;  1HKQ A;  2AXL A;  4U0V A;  4LB6 B;  2H09 A;  3PQJ A;  1YYV A;  1I1G A;  4MTD A;  1TQI A;  4KYW A;  2ZBK A;  1BOA A;  3HRU A;  2A61 A;  4IPA A;  5LHI A;  1V3F A;  2MBF A;  3RI4 A;  3IRR A;  4OIN F;  3E6C C;  2Z5U A;  1XN7 A;  4AWX B;  1XGO A;  1QZZ A;  2EK5 A;  1HST A;  2IJL A;  3CUQ A;  1SD5 A;  3RYR A;  5H6R A;  5J8F A;  2VE9 A;  3JTG A;  2MH2 A;  5LBQ A;  5LHG A;  3KCC A;  3KP5 A;  1W7P B;  1MGT A;  3GFJ A;  3R4K A;  1ZRE A;  1ULY A;  1BBY A;  1HSJ A;  4WXC A;  4R79 A;  3GLX A;  3AAF A;  3DEU A;  5K1Y A;  4L9T A;  1G4D A;  4WXH A;  1SD7 A;  3TO6 A;  2V1D A;  2FXA A;  2OQR A;  3GFL A;  4UUV A;  1F4K A;  2G9W A;  4OU0 A;  4P9F A;  4O5V A;  4M6Y A;  2E7W A;  4I98 B;  2YPR A;  5ILS A;  3P9I A;  4I09 A;  4U0W A;  3HRS A;  2RN7 A;  1DPU A;  1SFU A;  3NEU A;  1TW3 A;  2QUF A;  3LFK A;  2F5E A;  3DP7 A;  1Z1D A;  3HTS B;  3IHU A;  2CGP A;  2RVC A;  3WTS C;  2NAZ A;  5CVI A;  1J9I A;  2OAZ A;  4MEY F;  2GA2 A;  4XSZ F;  2YX4 A;  4CXF A;  1XMK A;  4KN4 X;  2GIV A;  2EA2 A;  2XRO A;  3T8R A;  2EB7 A;  2A6E F;  4LG0 A;  4L0Y B;  2PMU A;  2DW4 A;  4LLG F;  4E70 A;  1KQ0 A;  4HQM A;  4PDK A;  5DV5 A;  3E6D A;  5KK1 A;  1O7L A;  2IA2 A;  2FEZ A;  3V7S A;  1R1V A;  2UWM A;  4MHG A;  2EFN A;  5BQT A;  3R6S A;  3IRQ A;  1YQA A;  5BPI A;  4A12 A;  2V6C A;  2ZXJ A;  3KLO A;  1U3E M;  4YFN F;  5D5W B;  5CYV A;  1L0O C;  2R7D A;  1G3Y A;  4M73 A;  3I59 B;  3F22 A;  5ICG A;  5BS6 A;  3GVA A;  5FD6 A;  2GA1 A;  4ZYE A;  2DFI A;  3ZN0 A;  4CYD A;  3F72 A;  2Z3Y A;  4EJV A;  4ENJ A;  2DLL A;  3O2P E;  3HRT A;  1B6A A;  3QP6 A;  2RGV A;  3E97 A;  4YII A;  3FXQ A;  1J7K A;  1RI7 A;  2KIF A;  1XGM A;  5LEJ A;  3GEZ A;  1R00 A;  3L7W A;  4KIB A;  3WTW C;  3FX3 A;  4O6J A;  3HSF A;  4LMY A;  2X0L A;  3O3K A;  2FBI A;  3I58 A;  1GXQ A;  1JXS A;  1ODD A;  1FZP B;  4OIQ F;  1F1Z A;  1FY7 A;  2BBY A;  4RAZ A;  2P5L C;  1EV7 A;  3GF2 A;  2XAS A;  1IN7 A;  3L2C A;  5DCM B;  3U1D A;  4EGZ A;  4GCV A;  1T39 A;  1TBX A;  3MQ0 A;  4AIJ A;  2OA4 A;  2XRN A;  2YU3 A;  5J8C A;  4BHC A;  1H9T A;  1XSX A;  4HV5 A;  1X3U A;  3GYH X;  3DKW A;  1WQ2 A;  1U5T C;  2ESH A;  3MAJ A;  1BI2 A;  5JFR A;  3KP7 A;  2KKO A;  3V8J A;  2IW5 A;  2ZKZ A;  1USS A;  2VON A;  1CF7 A;  4KUM A;  1QO0 D;  4ENN A;  1K79 A;  2RDP A;  3FMR A;  3E6B A;  2ESN A;  1FBU A;  2MC3 A;  5JI6 A;  1VTN C;  1IN4 A;  2OZU A;  2H94 A;  3RPQ A;  2WV0 A;  1TQM A;  3HUG A;  3ABT A;  4P96 A;  1U5T A;  2XVC A;  1FC3 A;  2KIM A;  2A68 F;  1IRF A;  5L3G A;  1QPM A;  1OMI A;  2FML A;  1R23 A;  3F8N A;  3LST A;  3KZY A;  2P7V B;  1KGS A;  1KYZ A;  3RPU A;  3D5L A;  4NHJ A;  1R58 A;  3ZP5 A;  1HW1 A;  1SMT A;  3KE2 A;  1E17 A;  4G6D A;  4U0Y A;  3V4G A;  1EH6 A;  2XGX A;  1FPQ A;  3M7G A;  4KT5 C;  2DAO A;  5EEH A;  1ZG5 A;  2QQB A;  3FM3 A;  1BIA A;  2PG4 A;  2ZJ2 A;  3SHF A;  1IRG A;  2B0L A;  4LK0 F;  2XIG A;  4I01 A;  2D45 A;  1ZYR F;  2ZME A;  4GYG A;  2P8T A;  1RIO H;  3LA2 A;  5J6X A;  1F9N A;  5LRR A;  2HTJ A;  1ZAO A;  2F5F A;  2ADU A;  3SQN A;  4G7O F;  1U6G A;  4MNU A;  4M6X A;  3F8C A;  3V7R A;  4JBA A;  3I5U A;  3IC7 A;  5FD5 A;  1MZB A;  3IKV A;  4WCG A;  1OR7 A;  1DPR A;  1TNS A;  4MQV A;  5LGT A;  1SAX A;  3JSO A;  2A69 F;  5A2Q K;  5D5U B;  2MLK A;  3T8T A;  3WOD F;  4L5I A;  3OOP A;  3NQO A;  3COA C;  3RKY A;  5D6E A;  1IUY A;  3ELK A;  3ZMD A;  1SMY F;  2K02 A;  1MJA A;  4HV6 A;  2VOO A;  1GVJ A;  1EH8 A;  1R7J A;  4I7H A;  2HWV A;  2NS0 A;  1Y0U A;  1IZ1 A;  5HLG A;  3HRM A;  4EGY A;  1HBX G;  4I02 A;  1KU2 A;  5D4R A;  1LDJ A;  3REO A;  2OQG A;  1SFE A;  3F6V A;  2E1N A;  1T0F A;  5D6F A;  2PFB A;  4CGZ A;  4ZYG A;  2BEO A;  3QRF F;  1KQ9 A;  1O7F A;  2FSW A;  4A5N A;  1JE8 A;  3J80 K;  5HS9 A;  2VBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...