3CO7C

Crystal structure of foxo1 dbd bound to dbe2 dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*D
publication title Structural Basis for DNA Recognition by FoxO1 and Its Regulation by Posttranslational Modification.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 87
sequence length 87
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3co7C00
5DUIA 2V79A 5E17F 2RV8A 2Z33A 1HKQA 1ZRCA 1RZ4A 3RJPA 3WODF 4KNYA 4PCQA 3C7JA 1RIOH 4UUVA 2DT5A 3TGNA 1YQAA 4LD5A 3WTWC 3C18A 3I53A 3BJOA 4KIFA 4Q5SF 2ADUA 2FF4A 2FE3A 5D8LB 3JAMZ 4A12A 5ICEA 4BHCA 1J59A 4AIJA 5FLXZ 1L3LA 4ZYEA 4HX4A 4I01A 2HTSA 4R79A 2E7WA 4GXOA 3TOBA 1WI9A 2M8EA 4O3MA 4XSXF 2R7DA 2EFNA 2IVMA 1XD7A 1JHHA 4EV0A 2YX7A 4WF2A 2CYYA 2P6SA 5F64A 4RGSA 4BQAA 3Q5FA 1U3EM 3DV8A 4YG2F 3L2CA 1MDMB 1W7PD 1LDDA 3WE2A 4UVBA 1FT9A 5LHHA 1XCBA 4FT8A 5BS6A 3TOAA 4EJVA 1IRFA 5FGMA 3TO6A 2K27A 1QO0D 4BYYA 1Z7UA 3WGGA 3WU0A 2X0LA 3D5LA 2FNAA 3J81Z 2EK5A 1WRJA 4UV8A 2LF8A 3FXRA 2ZCWA 4A6DA 4OINF 2QQAA 3V8JA 4GGGA 5ILVA 4RGRA 4K2EA 5CVIA 2OAZA 2DQRA 3DPTA 2EJRA 2IT0A 2P5LC 5EEGA 5HDNA 3IKVA 5ICCA 1TNTA 1GXPA 3KLOA 3ELKA 3WGHA 3M7GA 5D8KB 3QPHA 4OIPF 3EYIA 4LG0B 1C0WA 3KP5A 4S04A 2K4JA 3QP5A 2PBIA 1JE8A 4N9IA 3JSPA 3FHZA 1IXSB 1HXDA 1MZBA 3Q9VA 1BIBA 2G7HA 1REPC 5A2QZ 4MTDA 2MLGA 4L0ZB 4M73A 2FBKA 4I7HA 2EV6A 3EDPA 4MEYF 1V4RA 2EFOA 3RPQA 2XHKA 4M74A 5D5WB 4G6QA 4AIHA 4KT5C 1BBYA 3HSFA 2OQGA 2F5DA 1FX7A 3M8EA 4A5MA 1FNNA 3ERED 1O3RA 1BN5A 3FF5A 2Q8KA 5CVJA 4QLCU 3HTSB 2NNYA 4M71A 3R61A 1U6GA 3WTYC 4U0WA 1G3WA 3JW4A 5E20A 4IF4A 4XBFA 2L4MA 3E6MA 4IHSA 1R00A 1DPRA 4CHUA 2EA4A 4IRIA 1FYKA 3CUQB 1USTA 1XDUA 2F5EA 2W24A 1HBXG 3DXJF 4HDUA 4LB5A 3IL2A 1FOKA 5FB2A 4M9SA 4OIRF 2D1VA 3F21A 4RGXA 4ESFA 3PFIA 2GA1A 3KP4A 3SXYA 1YTYA 1QZYA 3I4PA 2K02A 4U7DA 2PG4A 2FOKA 1FY7A 5HLGA 4NQWA 2A6EF 1KGSA 2J5OA 2W84A 2YSRA 4GYIA 2STTA 2YX4A 3OOPA 5IT9K 4MNUA 1RUNA 4KUMA 3EETA 3NEUA 4RAYA 3DPLC 2HQRA 4GO1A 1JGSA 3GVAA 4OIQF 1PP7U 3IRRA 2P8TA 1S8NA 4Q4ZF 1ZLJA 1R1TA 2RKHA 3B02A 2ZNYA 1OYIA 5LRSA 2MH9A 1ZN2A 2HTJA 4WX9A 3LA3A 1SD4A 4L18B 3WTZA 4DQ2A 1WKMA 5EEHA 3P9IA 4P9UA 3JSOA 3O6BB 3BPVA 1J9IA 2E1CA 2JT1A 4LJZF 4BH9A 1IXCA 3BPXA 3NRVA 4HQEA 3L09A 3DQVC 4B8XA 3U1DA 2MC3A 4RGUA 2GXGA 1XMAA 2Y0MA 4EVIA 1F9NA 1J7KA 2QLZA 1P2FA 3K1MA 3HRMA 2V9VA 4EGZA 2ZXJA 5L3BA 2KRFA 2XV4S 2H94A 1MKMA 3E5QA 2UWMA 3P7NA 1F1ZA 2F5CA 3HRSA 3RPUA 3GWZA 4BAYA 2FXAA 2XRNA 3MAJA 3WG9A 1EH6A 2PQ8A 3RYRA 1Y0UA 3VB2A 2DBBA 5J8CA 1TQPA 2A07F 3CJNA 1OYYA 2LSOA 1BI2A 1FBUA 5ERIA 4BXUA 1TLHB 3O2PE 1K6OA 2COMA 1WQ2A 5L3FA 1B9NA 3K0LA 5H6QA 4IHTA 5HVQC 1MD0A 4I09A 4U0VA 3FMSA 1PUEE 4IVNA 1T38A 1IN4A 1XMKA 2FBIA 3ZN1A 2LNBA 1E17A 3V8LA 5KVRA 1R58A 1OPCA 2BEOA 1ZARA 1IUYA 3FXUA 3WU1B 3I58A 3F8MA 2XAGA 1V3FA 4EM2A 1K7AA 3PQKA 4RB2C 2JPBA 4N9HA 2O0YA 4JQFA 1J2XA 5D6FA 2CSOA 5KK1A 2IA0A 1IN8A 1BC7C 1CF7A 4EQQA 1LDKB 1FC3A 4MHGA 1Z91A 4A5NA 2IW5A 1O7LA 4A2UA 1R23A 3DP7A 1R22A 1QNTA 2FMYA 2L3DA 3RDIA 4IPAA 1S7AA 1PP8F 1KA8A 1R1VA 1E2XA 3N97A 1G3TA 2D45A 2M87A 2XVCA 2HWVA 2L01A 3GFMA 2RGVA 5HLHA 3BZ6A 2O6GE 2EA2A 5JHUA 2O3FA 3BOQA 3QU3A 5L3CA 4RB3C 4R8HA 3RIRA 4OOIA 3RTRA 4LLNA 4O5VA 3ULQB 2KJBA 1ZLKA 2QWWA 3T8RA 4U88A 2ZNZA 4L5JA 4Y17A 1IN7A 5LEKA 1J0RA 2ZFWA 5K1YA 3T1BA 5JR3A 2ESHA 4CO8A 1KU9A 2KIUA 2DU9A 2DO7A 3KP3A 4ZYDA 2L54A 1OMIA 2MD5A 4L9TA 1B59A 5K5RA 5TJJA 2EFQA 4MGRA 5E8IA 4UV9A 5BQTA 5LHGA 4LB6B 4FHTA 1XSDA 3FMQA 2Y48A 2XUBA 2DTRA 3GFLA 4EJTA 1KQ9A 3ZMTA 2M30A 2DQLA 3L00A 1T39A 1B6AA 3SQNA 2GQQA 1BC8C 3L9FA 5DD8A 5CYVA 2OA4A 3GFJA 1YYVA 4IXAA 1ZRFA 2RVCA 1B1BA 1LEBA 1TQMA 3KP2A 3F8CA 1FBQA 3LQRA 3HRTA 4E70A 2BGCA 4ESBA 5LGNA 4HAMA 1O57A 1XGNA 1IN6A 3KEOA 2EFPA 2VODA 1SD6A 2HYFA 2WV0A 5D5UB 4HX7A 2UXXA 3FM3A 4A0XA 1BIAA 2IPQX 3WTXC 4QWQA 3J7AO 3MZHA 2ZMEA 1YS7A 4Y15A 3V7SA 4PZJA 1UHMA 4CZZA 3F72A 5BOXA 2MLKA 2PMUA 3TKYA 3KCCA 3GF2A 1BOAA 1ZH5A 3WGIA 3J80Z 3BJAA 3IHUA 2HEOA 2VXZA 3GW2A 4G7ZF 1GXQA 3LQQA 3DEUA 3I5UA 1ON1A 2DI3A 2W25A 5AIPA 1QBJA 3WTUC 1O7FA 1JXSA 3R0AA 3R0JA 2L4AA 3W6KB 3CLOA 1JHFA 2FEZA 4IRGA 4PGGA 3TDUC 1KQ8A 1A04A 5LRRA 4P55A 1CGPA 3DFGA 2J5PA 4S05A 4AWXB 2E1NA 3F6OA 3KLNA 2LDUA 2LF7A 4YIFA 4KDPA 5IT3A 4UVAA 2HQNA 1ZG5A 4AIKA 4M72A 4UHTA 1S7OA 2FMLA 4HF1A 4L0YB 2OBPA 2XAQA 3JAMK 2Z3YA 2CG4A 3DKWA 1U5TA 4Y13A 3E97A 3T8TA 4L9NA 4ETSA 5JVTA 5FLXK 3JTGA 1ON2A 4RB0A 3EUHA 5DCMA 1UB9A 4WXCA 2RNJA 5D5XB 3FM5A 3O3KA 3U2RA 1SMTA 3DF8A 1BM9A 2OQRA 1I27A 4KYWA 1YO5C 2QYOA 3VODA 3T0YA 4YIIA 3ZMZA 3VFZA 4EM1A 4WXDA 4YFXF 2OZUA 5LGTA 4JK1X 2IJLA 2IP2A 3HTUA 4XLPF 2RC4A 3HYIA 2P7VB 1R36A 1P4AA 1FBSA 3G3ZA 4I2OA 4B09A 4M6YA 5DCFA 2DFIA 1MGTA 3RKYA 2MA3A 5DEQA 4P5OA 4MQ9F 2EV0A 1LEAA 3EQLF 5CJ9A 2HR3A 2YR2A 3NQOA 1T0FA 1H9GA 5L3DA 4WCGA 3ECOA 3F8NA 1O3QA 4P96A 5DV5A 5DUKA 5D4RA 3CDHA 4HW0A 3BWGA 3KEQA 2XKPA 2UZKA 3GZ6A 1SFXA 1BI0A 4UNOA 4EMSA 4CXFA 2ISZA 3J81K 4KMUX 4WXHA 2HS5A 2QQBA 2KIMA 5LBQA 4R1HA 1GVJA 4ZYGA 4HLYA 1O3SA 1TQIA 1D8JA 2E7XA 1LJ9A 1S6LA 2WC2A 1ULYA 3QPTA 1LQ1A 3KETA 3T5XA 1SFEA 3K69A 5D5VB 2KKOA 3ZMDA 4AD9A 2CQKA 2YPRA 2D1HA 3COAC 4HLXA 2ISYA 4TV7A 2VE8A 3MEXA 5J8FA 5ICFA 2PN6A 2NYXA 3H3ZA 4HV5A 4FX0A 2QVOA 2Z5UA 3JTHA 5HS8A 3WTSC 4CYDA 4HOBA 2F2EA 2EFWA 2ELHA 5DYMA 2BE5F 1SAXA 5CLSA 3IC7A 3ZMUA 3BROA 2RN7A 2BV6A 5A2QK 4A0YA 3QU6A 4ZH4F 2H27A 2PEXA 3LFKA 1O3TA 2FA5A 1J5YA 2B0LA 2HFHA 5J6XA 4KIBA 1SFUA 2RDPA 4ENKA 2OU2A 2KIFA 2GAUA 4ENMA 4U7BA 1XCVA 4HF2A 3K9TA 2VC0A 4L5IA 2CW0F 4JBAA 3MFKA 5JI6A 2H6CA 2Y75A 3ISPA 3GZ5A 3HRUA 2R3SA 3E5UA 1MJBA 1U2WA 3HHGA 1LB2A 3Q9SA 2A5YB 2FQ3A 5BPIA 2MH2A 4OU0A 1I1SA 3QRFF 1SD7A 1RNLA 3RKWA 2ZKZA 5HOOA 1XB4A 1S3JA 3HIFA 4KMFA 2VT2A 3HHHA 2PI0A 3I59A 2ESNA 3M9AA 5HS9A 2MBFA 2FRHA 4DNCA 2DLLA 2GA2A 1BJAA 3LSTA 1F4KA 5D4SA 1AWCA 1CF7B 1DDNA 1P4XA 1ONVA 3C1DA 3E6CC 2PMHA 1K79A 1EV7A 5HDGA 4LMYA 1QGPA 3BDDA 3CO6C 1P92A 1G6NA 4I98B 1R5GA 1B4AA 3SFZA 1W7PA 3RYPA 4HZFA 3HOSA 2QBYA 1FLIA 1KU2A 3HOTA 1HKSA 3ROUA 1K78A 4M6XA 2WWYA 3GXOA 4EJWA 1R7JA 5TRDA 5E1WA 1I1GA 1Z9CA 1R5HA 2O61A 2LKPA 1H0MA 3HSRA 3V7RA 3KE2A 3SZPA 1Z6TA 2OZ6A 2XGXA 2GIVA 2WTEA 5ICGA 2K86A 3WE3A 2W85A 2DPUA 3R60A 2NRAC 1RUOA 3BP8A 2IA1A 1FP2A 3F3XA 4WWCA 1F5TA 5HLIA 1ODDA 3QP6A 3MCZA 2HGCA 4HA8A 4A0ZA 2XASA 4RS8A 2XIGA 4BNCA 1YIOA 2Q2EA 4LLLA 3V7CA 1LDJA 4WK8F 4EJOA 1QPMA 3E6BA 4Z2YA 2C6YA 3WTVC 5AIQA 1QZZA 2UXNA 4ZYHA 1XGMA 5ILSA 3GLXA 4HQMA 2DK5A 1T6SA 3QAHA 3FXQA 4CDGA 5FD5A 1IW7F 4L9JA 5JFRA 4G8XA 3ZPLA 1ZG1A 3ZMSA 1YG2A 2NAZA 1RI7A 3GO5A 1OYWA 2NS0A 3PQJA 3F23A 1EH8A 3FMRA 1SD5A 4ZZDA 2QUFA 3ECHA 3GX4X 2Z99A 2XAHA 5L3GA 1XDSA 2ZMEB 5CVRA 2A61A 3E5XA 4KICA 1FYLA 4FX4A 2QENA 4D0PA 3FZVA 5HS7A 2M5WA 3CUQC 3QOPA 2HZTA 1PDNC 1W4MA 4G94A 1ZYRF 2H6BA 2A3SA 2JZYA 1XSXA 2TDXA 2VBZA 5F6FA 2STWA 1TW3A 2JRTA 3C3WA 5L3EA 1HW1A 4Q48A 1FSEA 5HDKA 2EWNA 2HKXA 1KQ0A 4M9ZA 5FD6A 5LLQA 1XN7A 1UFMA 1LVAA 4N0BA 1USSA 3KZZA 4NB5A 1T2KA 1HQCA 1HSJA 2VE9A 3F6VA 4KA4A 1IXRC 2VOOA 3HSEA 2VC1A 3TO9A 1WWXA 2PLYA 5LGUA 1W5TA 4BHBA 5E1ZB 3S2WA 2P4WA 1YFHA 5ED4A 4EJUA 1MDMA 5E18F 4U0YA 3LAJA 3I0TA 2V1UA 5IT9Z 1P4WA 3E6DA 3GFIA 2PJPA 5LEJA 1LNWA 1YW8A 3R4KA 1U5TB 4G7HF 3RI4A 3RKXA 3KP7A 1TBXA 4BHPA 2IA2A 3L7WA 6PAXA 2H09A 3ABTA 5DCMB 1B9MA 2CGPA 3F22A 2ACJA 2Z9OA 2A6HF 3B73A 1H9TA 3P9KA 1G3YA 3EYYA 1D8KA 1BI3A 2V6CA 3H3UA 4LFUA 4IJAA 3FX3A 3KFWX 4I02A 3AAFA 1ZG3A 5FFXA 5FO5A 4GCVA 3TDZC 4G7OF 1EH7A 1DP7P 4HX8A 1TNSA 5E8GA 1D3YA 4LG0A 4M9XA 1UCRA 1ZGAA 4ENJA 1FWZA 4CICA 2FBHA 4GYGA 1HKTA 1NHAA 1S29A 1G4DA 1IN5A 3V4GA 1OR7A 1R1UA 4IRHA 1WSUA 4HBLA 3U9GA 2A68F 3K2ZA 2AXLA 3ZQ7A 4P9FA 2A69F 2X4HA 3M1EA 1IRGA 2HKOA 2GXBA 1IAWA 2YU3A 2DW4A 4KFCA 1AOYA 3ZN0A 2P5KA 2CWEA 4LK1F 1DUXC 4L9VA 3CO7C 2XAFA 4H0EA 2PFBA 1Z6RA 3I71A 5BMZA 4ENNA 2HDCA 2O8XA 2M1BA 1UHWA 2VT3A 4AVPA 1W5SA 2KJCA 3LA2A 3TO7A 5K5QA 3CUQA 3N4MA 4PDKA 3CTAA 3F8BA 3KZYA 4XSZF 3IRQA 1SMYF 3J80K 3FWEA 4G6DA 1X3UA 2HOEA 2ETHA 2DPDA 3E3VA 3ZP5A 1Q1HA 2L02A 2R7FA 1YLFA 2G9WA 2EV5A 2FNPA 5CVUA 2AS5F 4CGZA 1XGOA 4HV6A 2QM3A 4PGHA 3G73A 1FYMA 4MTEA 4OIOF 2P7CB 3OV8A 4I0BA 4XLNF 4G9YA 4LGWA 3WTTC 2VN2A 4ASNA 1FPQA 5BPDA 2GWRA 2K7LA 2CFXA 3P9CA 4KIGA 5D6EA 3ZMVA 4XRFA 2XKOA 4KN7X 3KP6A 2VONA 5H6RA 2GZWA 1ZGJA 2VBYA 2W57A 4RB1A 3K1PA 2ZJ2A 2F5FA 1VTNC 1KYZA 4LK0F 4YFNF 4UXNA 1YS6A 3HUGA 2XAJA 1HSTA 4ON0A 2JPCA 5ILUA 2QQ9A 3ML6A 1STZA 1GHCA 4YFKF 2FSWA 1KYWA 2CO5A 1OKRA 1U78A 1ZRDA 3IWZA 3BY6A 4OMYA 3R6SA 2VBWA 1G3SA 3GEZA 1TTYA 1QQIA 4RAZA 2G7UA 4I0AA 5LHIA 5DDGA 2DK8A 1U8RA 1I6XA 3I59B 4HF0A 2V1DA 2P6TA 1Z1DA 2FU4A 3MQ0A 1KU3A 1FSHA 1T98A 1FP1D 3LA7A 1D5VA 4LLGF 2HYGD 1BI1A 2QZ8A 1P6RA 5K5OA 1IF1A 4EM0B 3I54A 1XGSA 2BYVE 5H20A 2NNNA 3REOA 2BBYA 2O03A 3LWFA 4ZZLA 1W7PB 2OD5A 3VEPA 3H92A 2QBYB 1I5ZA 3IKTA 1Z05A 1TW2A 1K78B 4O6JA 5DD4A 1FZPB 3ABUA 5CVVA 3SHFA 2XROA 2JSCA 4NHJA 3BJ6A 4F7ZA 1L0OC 4EGYA 4HYEA 1MJAA 4HDVA 4MEXF 3I64A 2ZO4A 2D2WA 4ESJA 1DPUA 4A6EA 1YW9A 1ZHFA 3M8FA 1J75A 3V8KA 1IZ1A 3D0SA 3TQNA 4OMZA 3GUDA 1ZAOA 2M45A 1KU7A 1HW2A 4KN4X 3VOEA 3SZTA 2JTVA 1ZREA 3LAPA 3GYHX 2IRFG 2K4BA 4Q47A 2DAOA 3CUOA 2EB7A 3MZYA 1YW7A 5AONA 3MWMA 2P5VA 2Q0OA 2ZBKA 3W6JB 2V1XA 3IWFA 2RQPA 2VBXA 5FFZA 5F1RA 1HW5A 4UVCA 1XSVA 1U5TC 3F8FA 4MQVA 3K1NA 2VOPA 5E1XA 1MJ9A
chains in the Genus database with same CATH superfamily
3S15J 5DUIA 3JRBA 2AXTC 3PL8A 2VQCA 2V79A 3DEWA 1X19A 2RV8A 2Z33A 5E17F 4BXFA 3OWTA 1HKQA 1ZRCA 1RZ4A 3RJPA 3WODF 4KNYA 3ASOH 3AL0B 4PCQA 3C7JA 1A6QA 4DYRA 2RAEA 1RIOH 4UUVA 4FE4A 2DT5A 3TGNA 1LKXA 1YQAA 1IRXA 1ITYA 4LD5A 2CV2A 3WTWC 3JRFA 3U1KA 3C18A 3I53A 1MBKA 3BJOA 4KIFA 2LK2A 4Q5SF 2ADUA 4PSXA 2FF4A 4G6TB 1WH5A 2FE3A 1UAAA 5D8LB 2E35A 3FXKA 3JAMZ 3ZGKA 2OCCH 4NC6A 4A12A 4A3EJ 2DMTA 1R49A 5GTIC 5ICEA 2VB6A 4BHCA 2OPTA 1J59A 4AIJA 5FLXZ 1L3LA 4XKBA 4BKXA 2KZGA 4ZYEA 4HX4A 4I01A 2D5VA 1SVLA 1ETWA 4IQJA 1TWCJ 1ETOA 2HTSA 3OYFA 4ZJZA 4R79A 3KZIC 2E7WA 4GXOA 3TOBA 4HNUA 1WI9A 1WGXA 2M8EA 2ZC2A 1F43A 1X3ZB 2HI3A 3FKIJ 3H9QA 4O3MA 4XSXF 3K4BA 1ETYA 2R7DA 2EFNA 2IVMA 3CMEI 1UG0A 1FMVA 5M3FJ 1YX5A 4IKFA 3SDBA 1XD7A 3DCFA 1JHHA 4EV0A 2YX7A 1SANA 4ZDOA 4WF2A 2O8KA 2CYYA 1IDYA 3DTKA 1T8IA 2P6SA 5F64A 4RGSA 4F91B 3ZQQA 3VYTB 4BQAA 4MIMA 3Q5FA 4BDYA 2QKMB 1FOXA 1U3EM 1ETVA 3DV8A 4YG2F 4B43A 3L2CA 1MDMB 4NC7A 1W7PD 2XF7A 1LDDA 3WE2A 4UVBA 1FT9A 5LHHA 3A03A 2W82A 1XCBA 2KRHA 2HQAA 3VDXA 4FT8A 5BS6A 3TOAA 4EJVA 1IRFA 5FGMA 3TO6A 3OS2A 2K27A 3K7AJ 1QO0D 4BYYA 4NDLA 3BLYA 1GT0C 3CMAI 2K9QA 1Z7UA 2DFEA 3WGGA 1VQKI 3WU0A 2X0LA 3D5LA 4C30A 2FNAA 3J81Z 2EK5A 1WRJA 4UV8A 2LF8A 1JKQC 3FXRA 2ZCWA 4V2FA 4A6DA 3QYBA 5FKNA 4OINF 2QQAA 2MGQA 4I76A 3V8JA 4BBSJ 2F6CA 1D1CA 4GDFA 5IP6A 3OR1C 4I6ZA 4GGGA 5ILVA 2WAQN 4RGRA 4AIDA 4ZC3A 4K2EA 5CVIA 2OAZA 2DQRA 2NOGA 3DPTA 2EJRA 4A3IJ 2IT0A 2DJIA 3SYTA 2P5LC 5EEGA 5HDNA 3Q3SA 1B72B 3IKVA 1XC5A 5ICCA 4CCOA 3TEDA 1TNTA 1S72I 3D5SC 2MG4A 3L1PA 3RCOA 1GXPA 1P7IA 2FD5A 3KLOA 3ELKA 3TP0A 3WGHA 2JA5J 3M7GA 5D8KB 3G1LA 3W2WA 2HZDA 2A05A 3QPHA 1JT0A 4OIPF 3EYIA 3BR2A 4LG0B 2DFHA 3PSIA 5CQEA 1C0WA 3KP5A 2NXNB 4S04A 3ZRGA 2LLKA 2K4JA 3QP5A 2PBIA 3OYDA 1JE8A 1TP4A 4N9IA 3JSPA 3FHZA 1K4TA 1IXSB 3S2HJ 1HXDA 1MZBA 3Q9VA 5F0FA 2VIXA 1QHGA 3BQZA 3PFYA 1BIBA 2G7HA 4ITVA 1REPC 1V5FA 3EUAA 1W0TA 4HG2A 3HDDA 5A2QZ 4MTDA 2MLGA 4L0ZB 1GV2A 4M73A 2FBKA 2EPFA 2CV0A 2DA7A 5FRMA 3RZOJ 4XKCA 4I7HA 2EV6A 3EDPA 4MEYF 1V4RA 2QEXI 2ELKA 2WBMA 2EFOA 3RPQA 2XHKA 4IEJA 4M74A 5D5WB 1MNDA 3GMEA 4G6QA 4AIHA 1V5EA 5EG0B 3CP2A 4KT5C 1BBYA 3HSFA 2OQGA 2F5DA 1FX7A 3C2GA 3M8EA 4A5MA 5KCMA 1YI2I 3J7AY 4BEHB 1FNNA 4UY8I 1RKTA 3ERED 1O3RA 3FHNA 1BN5A 3FF5A 2Q8KA 2YU9J 5CVJA 3D5RC 4QLCU 3WHBA 3HTSB 1UG2A 2NNYA 4BGDA 4FQGA 2R92J 1WJ5A 4XRSG 4M71A 3R61A 2VQGA 1U6GA 3H9GA 3WTYC 4U0WA 1G3WA 1XTAA 1DQUA 1YOVB 3JW4A 2IXSA 4ZTFA 5E20A 1Y39A 4IF4A 2PX9A 2M7AA 2VJJA 2AQFA 4XBFA 2L4MA 3E6MA 4IHSA 1R00A 1DPRA 4CHUA 2EA4A 4IRIA 4XLAA 1FYKA 3CUQB 3LSGA 1MMGA 1MSEC 1USTA 2QGUA 4BJ5C 4OAZA 4XR6A 4RM3A 1IUFA 1XDUA 2F5EA 2W24A 3A2KA 3KEYA 1LVKA 1AA7A 2KHMA 5J40A 1HBXG 3DXJF 3PIOF 4HDUA 1MBHA 1KZHA 4LB5A 3IL2A 1FOKA 3G6EI 4QIWN 5FB2A 1UELB 2Y0SN 4LG3A 4M3GA 4M9SA 4OIRF 2LKXA 2D1VA 1YJWI 3F21A 1VQ9I 2LC2A 4RGXA 4ESFA 1RRJA 2EZHA 3PFIA 2GA1A 3KP4A 3SXYA 1YTYA 1QZYA 3I4PA 3GTQJ 2DA5A 3HC7A 2IGOA 2K02A 1FOWA 4J00A 3ABKH 3K4CA 4A3CJ 5J1YA 4U7DA 2DYSH 1NG7A 1PUFA 2PG4A 1VFCA 1QRYA 2FOKA 3Q0UA 1FY7A 3A1YA 5HLGA 4NQWA 1XPXA 2A6EF 1KGSA 2CQQA 2J5OA 2W84A 2YSRA 4GYIA 2STTA 2YX4A 3OOPA 5IT9K 4MNUA 1M1EB 1RUNA 1FOYA 4KUMA 2K40A 3EETA 2QA4I 3CCYA 3NEUA 4RAYA 2R7VA 5LFAA 2VQHA 2X85A 4C2TA 2XPWA 3DPLC 4Y3OA 1D1BA 2HQRA 2LP0A 4GO1A 1JGSA 2KIQA 3GVAA 1R71A 2IS6A 4OIQF 1PP7U 1X3WB 3IRRA 3CJQB 2P8TA 1S8NA 4Q4ZF 1ZLJA 4XN0A 3LNQA 1R1TA 3OYKA 3B02A 2RKHA 2ZNYA 2A5WA 1OYIA 3HOUJ 3HUGB 1RC9A 5M3MJ 2MH9A 5LRSA 1TZLA 1ZN2A 2HTJA 4WX9A 3LA3A 1HDPA 1SD4A 5GAEJ 1JUPA 4L18B 3WTZA 1PJRA 5J1RA 2JQ7A 3BG9A 1ZR2A 4DQ2A 3IH3A 1WKMA 5EEHA 3P9IA 3WG7H 4P9UA 3JREA 2KPMA 5EF6A 4BY7J 3JSOA 3A01B 3O6BB 4XM3A 1YE9A 3BPVA 1J9IA 2PJRB 1DGWY 2E1CA 2JT1A 4LJZF 4BH9A 3MKZA 2NVXJ 1IXCA 4XONA 3S1NJ 3BPXA 1N78A 2ZFUA 3NRVA 2DMNA 5E79C 3AG3H 3L09A 4HQEA 1T33A 2HOSA 2E5ZA 2X1EA 3DQVC 1J09A 1WJAA 3K2AA 4B8XA 4CCMA 3U1DA 3SDGA 2CRGA 2MC3A 3DLAA 3GTLJ 4RGUA 3FISA 2GXGA 2P0WA 1XMAA 3NWSA 3RKQA 2Y0MA 1LE8B 4EVIA 1F9NA 3W6VA 1J7KA 2QLZA 1P2FA 2BXZA 4XN3A 3K1MA 2DFFA 3HRMA 2V9VA 2JK3A 4EGZA 2ZXJA 5F27A 2VLAA 2RREA 1N77A 1ZGWA 2E71A 5L3BA 2KRFA 2CFOA 1I39A 1P7JA 4IQ4A 3PNVA 2G0EA 3DU6A 2VKHA 2XV4S 4J01A 3RQ4A 2H94A 4A3BJ 1K83J 4RLFA 2DDBA 1MKMA 3E5QA 2UWMA 2GXAA 1BOBA 3P7NA 1F1ZA 2F5CA 3I4MJ 3HRSA 3RPUA 3GWZA 2OV7A 4BAYA 2FXAA 1IG7A 2XRNA 3MAJA 2M7BA 4OWRB 3OYJA 2BW3A 3E0JB 3BZKA 3CC2I 3WG9A 5JHFA 1EH6A 1TT0A 2PQ8A 5B1BH 3IAS2 1HCRA 3HG9A 2K9MA 2VKEA 1EF4A 1RR7A 2OCEA 2DN0A 3RYRA 1Y0UA 3VB2A 2DBBA 2OTLI 2JWTA 5J8CA 1IV8A 2M9HA 2W7NA 1TQPA 2A07F 3CJNA 3NAUA 1OYYA 2LSOA 2O9LA 1BI2A 3JRDA 2DT6A 3BTLA 3HM5A 2K9NA 1FBUA 3HOYJ 2V9PA 1H89C 4JX6A 3QYEA 1ETXA 2B9SA 4E7SA 1S5LC 2HPMA 5ERIA 4BXUA 1TLHB 5C44J 3O2PE 1K6OA 2COMA 1WQ2A 5L3FA 2ICWG 1B9NA 3K0LA 3LMMA 5H6QA 4IHTA 4HNVA 5DM6F 4D7NA 5HVQC 1MD0A 4I09A 4U0VA 3FMSA 2R5ZB 1PUEE 4BE1A 4IVNA 1Y0NA 1XMXA 2KMUA 3KIOA 1T38A 1IN4A 1XMKA 4P1WA 3BR6A 3PUBA 2FBIA 1MBGA 4CUGA 4XL9A 3ZN1A 1BL0A 2LNBA 1E17A 3V8LA 4BXXJ 5KVRA 1R58A 2R7UA 1OPCA 1F36A 2BEOA 5CQGA 2AHQA 2JVHA 1ZARA 1IUYA 3FXUA 3JCUC 3WU1B 3I58A 3F8MA 2XAGA 1Z67A 1WFXA 1V3FA 3DPUA 4EM2A 3C2BA 1K7AA 3PQKA 5IYBJ 4RB2C 1P9QC 1NH3A 2JPBA 2DYRH 3G4SI 4N9HA 2O0YA 3HL2A 4FETA 4N4OB 4JQFA 3OSFA 5FRNA 1J2XA 2IGKA 2CSOA 5D6FA 2V4JC 5KK1A 3BZCA 2IA0A 1IN8A 1BC7C 1CF7A 3OS0A 4M3FA 1LDKB 4EQQA 1FC3A 2JMWA 4MHGA 3C2HA 1Z91A 2R5YA 2L9RA 4A5NA 2IW5A 1O7LA 4A2UA 1VQLI 3S1RJ 1Y1VJ 3H1CA 3SEZA 1R23A 3DP7A 1R22A 1QNTA 2FMYA 2L3DA 3RDIA 4IPAA 1S7AA 1PP8F 1YITI 3FBNB 1KA8A 1R1VA 1E2XA 3N97A 1OCZH 1FMWA 1G3TA 2VASA 2D45A 2M87A 2XVCA 2HWVA 4BJTA 2VPRA 2L01A 3GFMA 2RGVA 1GDTA 2IBDA 4ZTJA 1RESA 5HLHA 3BZ6A 2O6GE 2EA2A 4QPOA 4PJLA 4LIUA 5JHUA 2OJED 3DLLF 2NOJB 2O3FA 4W97A 2DMUA 3BOQA 3QU3A 1X2MA 3VYRB 3A4CA 4YRVA 2CQNA 2H8WA 5L3CA 4RB3C 4R8HA 4F3QA 3RIRA 4OOIA 3S32A 3DTEA 3RTRA 4LLNA 4O5VA 1D0XA 2PMZN 2X1DA 3ULQB 4PK4A 2KJBA 3ZXSA 5GAGJ 1WPKA 1ZLKA 2QWWA 2KDOA 2P81A 1WJCA 2EZLA 3M07A 2X9DA 1ZKGA 4JP0A 4M3BA 4C3JJ 3T8RA 2O5RA 4U88A 2M4KA 2ZNZA 3EUHC 4L5JA 4Y17A 1IN7A 5LEKA 1J0RA 2ZFWA 5K1YA 2OC6A 3T1BA 5JR3A 4Y52J 2ESHA 4CO8A 2QSHX 1IC8A 1KU9A 1FEXA 2KIUA 2DU9A 1A36A 1E3HA 2HVQA 4RMNA 1XX5A 2DO7A 3KP3A 4XRMA 4ZYDA 2L54A 2JSPA 1OMIA 3HGGA 3TP3A 1AKHA 2MD5A 5CKTA 4L9TA 1B59A 2QSFX 3DBHB 3OIQA 5TJJA 5K5RA 2EFQA 4F52A 2M4GA 4MGRA 5E8IA 2E2JJ 1OR7C 4UV9A 2E5NA 1VQ5I 2W00A 1H8AC 3BR1A 5BQTA 5LHGA 1S7EA 2O7OA 4LB6B 4FHTA 1XSDA 3FMQA 3SZGA 2L7KA 3ZQFA 2Y48A 2XUBA 2CJJA 2DTRA 1LUJB 2MFZA 3GFLA 3LL7A 2BY2A 2ZJRF 2K5CA 3CCSI 2R7QA 4EJTA 1KQ9A 3ZMTA 2M30A 2DQLA 5FLVA 3HPGA 3HEFA 3L00A 2GIZA 2DMQA 5B3SH 2VPLA 1T39A 3CCEI 1B6AA 3K4LA 9ANTA 1T0FC 3AFHA 4N4NB 1RR8C 4NUBA 2HU9A 3SQNA 3W2VA 2JVGA 3A0BC 3WHCA 2GQQA 1BC8C 2Y30A 3L9FA 3IH4A 3M1CA 3LOCA 5DD8A 3M8JA 1LFUP 5CYVA 1VQ4I 2OA4A 3OMYA 3GFJA 1YYVA 3CLQA 4IXAA 2CH0A 4GFBA 1ZRFA 3CCUI 1X58A 2XSJC 3CP8A 2RVCA 1B1BA 1LEBA 3OSGA 1GV5A 1TQMA 3KP2A 3F8CA 1LFPA 1FBQA 3LQRA 3PUFA 4A3LJ 2EIMH 3HRTA 2X6WA 4E70A 3CCLI 3OYHA 1Y8QB 2X6YA 3SEQA 2BGCA 1QU3A 2QF7A 4ESBA 1VQ7I 3L2VA 5LGNA 3ZR8X 4F92B 2F48A 2ID3A 5IYCJ 4HAMA 1O57A 4XNFA 1XGNA 1IN6A 3KEOA 1WZ2A 2EFPA 2VODA 1SD6A 1X1CA 2HYFA 2WV0A 5D5UB 4HX7A 2UXXA 3FM3A 4BQQA 4A0XA 1BIAA 2IPQX 2K9LA 4QWQA 3WTXC 3MZHA 3J7AO 2ZMEA 1YS7A 4Y15A 1X1AA 1JTXA 4BL0B 3V7SA 4PZJA 1UZCA 1UHMA 4CZZA 1Z3XA 2PMZA 4Y7NJ 2WADA 3F72A 4C2MJ 5BOXA 2MLKA 1BA5A 2CUFA 2ZJPF 3DBRB 2PMUA 3TKYA 4PJMA 1I6HJ 1MBEA 3KCCA 3GF2A 1BOAA 2LTPA 1FJLA 1EKEA 3KYCB 1BJZA 4FE7A 3HBLA 1WVRA 3LSPA 1VQ8I 1ZH5A 1D0YA 2Y9YA 1HLVA 3WGIA 3B6AA 3J80Z 4E7HA 3BJAA 3IHUA 2BZTA 2HEOA 2VXZA 3GW2A 4MO7A 1V5GA 4G7ZF 1DGRM 1GXQA 3LQQA 1YHQI 3S2DJ 1OCTC 3DEUA 3I5UA 3BR3A 1AU7A 1ON1A 2DI3A 2W25A 5AIPA 1QBJA 3WTUC 2L9SA 1O7FA 1JXSA 1E3OC 3R0AA 5DS9A 4CYCA 3K70D 3R0JA 2L7MP 3E7LA 2L4AA 3W6KB 5IYDJ 3CLOA 5KAIC 1JHFA 1OCPA 2FEZA 4IRGA 4PGGA 3TDUC 1KQ8A 1A04A 3DKYA 3F0CA 2V9KA 3JRIA 4YIRX 2LBFA 5LRRA 4RDUA 4P55A 2R7RA 5FKMA 1CGPA 3DFGA 2J5PA 5GADJ 4AWXB 4S05A 2E1NA 1X1PA 3F6OA 3KLNA 2HDDA 2COBA 2LDUA 3ZQGA 1QVUA 4J19A 3FXLA 2LF7A 4YIFA 3P5JA 4KDPA 2JA7J 5IT3A 4UVAA 2HQNA 5IPAA 1ZG5A 1WH7A 4JOMA 5F08A 4AIKA 3PO2J 4M72A 3HZJA 4UHTA 1S7OA 2BY1A 4DZJA 2FMLA 5EYRA 4HF1A 4L0YB 2OBPA 2XAQA 2CUZA 5EZHA 2VJ4A 2Z3YA 3JAMK 2CG4A 3DKWA 2IGMA 1Y56A 4BU2A 1U5TA 3G2BA 4Y13A 3E97A 3T8TA 5IOZA 4L9NA 4ETSA 4DJAA 1BR2A 1BW5A 2VUMJ 5JVTA 3PNYA 5FLXK 2CQXA 5J4YA 4RA2A 3JTGA 1ON2A 4RB0A 3EUHA 5DCMA 1JI8A 3K4MA 1UB9A 1MMAA 4WXCA 3CCVI 2RNJA 5D5XB 3FM5A 3O3KA 3U2RA 1SMTA 3DF8A 1BM9A 2OQRA 1I27A 4KYWA 5LD2C 3BG3A 2I8DA 1YO5C 3PO3J 2QYOA 2LD5A 4AU7A 3VODA 3T0YA 1I3AA 4YIIA 4LIVA 3ZMZA 2LFBA 3VFZA 3S17J 4IHYA 4EM1A 1ZK8A 4WXDA 4YFXF 1WCMJ 2OZUA 5LGTA 3OYAA 4JK1X 2IJLA 2IP2A 3HTUA 4XLPF 2RC4A 3HYIA 2P7VB 1R36A 1P4AA 3WU2C 1FBSA 3G3ZA 4I2OA 3FIWA 4B09A 5K7FA 4BUPA 2E1MC 4M6YA 4XOPA 1Y1WJ 5DCFA 4YEJA 2DFIA 1MGTA 1I50J 2LG4A 2Q1ZB 3RKYA 2MA3A 3S3NA 3UKGA 5DEQA 4P5OA 4MQ9F 4V2GA 1PUFB 2EV0A 1LEAA 1JUMA 3EQLF 4JX4A 4NQWB 5CJ9A 2HR3A 2E60A 3H0GJ 2YR2A 3NQOA 1YJNI 1T0FA 2X6XA 2WAQA 2BVLA 4XORA 2B7EA 1H9GA 1QZEA 5L3DA 4WCGA 3ECOA 3KPHA 3F8NA 1O3QA 4YELA 3GLLA 1OCOH 4P96A 5DV5A 2GOXB 4IHWA 2R7XA 5DUKA 2KISA 4UB8C 5D4RA 3CDHA 4HW0A 4XLHA 5GTHC 3BWGA 3KEQA 2XKPA 3IAM2 2LRDA 2UZKA 3BTCA 3GZ6A 1SFXA 1BI0A 1ETQA 4UNOA 4EMSA 2L5QA 4CXFA 2Y31A 1QA6A 2ISZA 1T95A 3J81K 4KMUX 4WXHA 1YX3A 2HS5A 1TWGJ 4BY1J 1NK2P 2QQBA 2KIMA 2VI6A 2FUG2 5LBQA 2BOLA 1VQMI 4R1HA 1GVJA 4ZYGA 4HLYA 1O3SA 2E19A 2ME6A 1TQIA 4DYQA 4KJZA 3PNTA 1D8JA 2E7XA 1LJ9A 1S6LA 2L7ZA 1PYVA 1ULYA 1X4PA 2JUGA 2WC2A 4EATA 3QPTA 5KNLA 1LQ1A 3KETA 5IP9J 3T5XA 1SFEA 3FBIB 3K69A 5B5EC 2CMPA 1MMNA 5D5VB 2KKOA 3ZMDA 4AD9A 3AKZA 2CQKA 2YPRA 2JA8J 4ZDLA 4B47A 3OY9A 3OYBA 2D1HA 3COAC 3OL4A 3RZDJ 4HLXA 2K3PA 1WHUA 2ISYA 3G1MA 1YRNA 1BW6A 4TV7A 1JT6A 2DMPA 4C9YA 2VE8A 4BE2A 3FK6A 3MEXA 5J8FA 5ICFA 2PN6A 2ELJA 1EA3A 2NYXA 3H3ZA 1RETA 4HV5A 4XICA 3OYMA 4FX0A 2QVOA 2Z5UA 3JTHA 5HS8A 3WTSC 2JRMA 4JYKA 2OTJI 4CYDA 2AQEA 1IV6A 4HOBA 2F2EA 2EFWA 2ELHA 4D9JA 3K70C 3SJMA 5DYMA 2BE5F 3LSHA 1W0UA 1SAXA 2XB5A 4M6VA 1ERDA 1OFCX 5CLSA 3S3MA 4E7ZA 4B1RA 1YJ9I 3LSIA 4AYBN 3IC7A 3S16J 3ZMUA 2HOTA 4QPQA 1ZELA 1MMSA 4X6AJ 3BROA 2RN7A 3KX2A 2BV6A 5A2QK 3LSRA 4A3MJ 2EZIA 1TWFJ 4A0YA 3HOXJ 3QU6A 4MFEA 1OCRH 4ZH4F 4E6KG 5IP7J 3CCJI 2H27A 2PEXA 3LFKA 3L2QA 1O3TA 5IOYA 2FA5A 2R7SA 2NVTJ 1J5YA 2B0LA 2BW3B 3BCAA 2XSDC 2HFHA 1HDDC 3CESA 5J6XA 4UUSA 4KIBA 2IAIA 1SFUA 2RDPA 4ENKA 1D0ZA 2LVSA 2OU2A 2HYJA 2E34A 5K7HA 5F04A 2KIFA 4BBRJ 2Y0SA 2GAUA 4CCNA 4ENMA 4U7BA 1XCVA 4HF2A 4XLCA 3K9TA 3G71I 2VC0A 4L5IA 1VQPI 2CW0F 2RQQA 4JBAA 3MFKA 4RBOA 4BDZA 5JI6A 3H9JA 3VSKA 2I10A 2H6CA 2Y75A 4CCJA 5J4VA 3ISPA 3GZ5A 4D7MA 3HRUA 2XB0X 2K3FA 4PSWA 4XIDA 2R3SA 2TRTA 3E5UA 5IY5H 2X6OA 3IH2A 3MZ8A 2XGEA 2E2HJ 1MJBA 4AM3A 1Z7LA 1JJ6C 1U2WA 3HHGA 1MNEA 1W1WE 5EGOA 2WAFA 5HNFA 3AL0C 2ZB9A 4HSRA 2MW8A 4XKWA 4DYCA 5BNGA 3Q9SA 4F93B 2A5YB 2FQ3A 1LB2A 5BPIA 2MH2A 2M3AA 4OU0A 2DDAA 3TBIA 1I1SA 3QRFF 1U0JA 1SD7A 1PVEA 1RNLA 3K4KA 3RKWA 2E2IJ 2ZKZA 5HOOA 3H35A 1SEUA 1XB4A 3CCMI 1S3JA 1FIAA 3HIFA 4KMFA 2VT2A 3HHHA 3X2QH 5FKOA 3V42A 3FXOA 2PI0A 3I59A 2ESNA 3M9AA 5HS9A 4QTRA 3UR3C 2MBFA 2FRHA 4DNCA 2DLLA 2F4IA 2GA2A 2HOAA 3IV5A 1BJAA 3LSTA 1F4KA 5D4SA 1AWCA 2DJNA 3S1QJ 1CF7B 1DDNA 2R0QC 1IGNA 1P4XA 1ONVA 3C1DA 3E6CC 2R5YB 1O4XA 2PMHA 1K79A 1EV7A 3DU5A 5FKLA 3EUKL 4G12A 5HDGA 4CSWA 2LY9A 4CZCA 4LMYA 1SC7A 4XRSA 1QGPA 3BDDA 4EEFG 1P92A 3CO6C 2V6EA 3QWLA 1RKWA 1G6NA 3JRAA 3A02A 1MW7A 4I98B 1R5GA 5E3NA 1B4AA 3SFZA 1W7PA 3RYPA 3E1SA 4HZFA 5HLTA 1V54H 3HOSA 2QBYA 1FLIA 4II3A 1IJWC 1A31A 1E3PA 5F0HA 5FLMJ 1KU2A 4HPQA 3HOTA 3BTJA 1HKSA 2L0KA 3ROUA 3U21A 1K78A 1CQTA 3HJEA 5E3OA 4M6XA 2WWYA 3GXOA 4EJWA 3GTOJ 1R7JA 5TRDA 3MKWB 3BG7A 4KT6A 2XRLA 5E1WA 1I1GA 3W2AA 2EIKH 1BR4A 1Z9CA 3GTGJ 3JRGA 1X1BA 5J3LA 2CU7A 1R5HA 3QODA 4XQFA 2O61A 2LKPA 1H0MA 2XAUA 3HSRA 1Q1VA 2EINH 2W1OA 3V7RA 3KE2A 3ZQIA 1W5CC 3RSNA 4DW6A 1ZQ3P 1MBFA 2JUCA 3SZPA 3DEEA 1OJLA 3KYLA 1Z6TA 2UV1A 1FIPA 3GCMA 3Q0VA 2IGNA 2OZ6A 2XGXA 1R4MB 2BVMA 2GIVA 3OIOA 2WTEA 5E3LA 2K86A 5ICGA 1SFOJ 3WE3A 1TT5B 1U8BA 1Y8RB 2W85A 2DPUA 3R60A 2DTZA 1GLNA 2NRAC 3GTPJ 4Y4RA 3DKXA 1RUOA 3BP8A 1WJBA 2IA1A 3H36A 1FP2A 5H2FC 5GAHJ 2WAEA 3F3XA 1SAUA 4WWCA 2AO9A 4OAYA 5HLIA 3MD2A 2BHYA 1AKHB 1F5TA 1ODDA 3QP6A 3MCZA 1X2NA 1JKRC 2HGCA 4HA8A 4A0ZA 3DBLB 1VQ6I 2EZKA 2BHZA 2XASA 4RS8A 2XIGA 3I9V2 2N8GA 3S14J 4BNCA 1MIJA 2EBIA 1YIOA 2LR8A 3JRCA 3I3LA 2Q2EA 4LLLA 3V7CA 3K4JA 1ZTRA 2Y2ZA 1LDJA 2DA3A 4ZYAA 4WK8F 3CCRI 1B8IA 5JLXA 4EJOA 4IOAF 5B1AH 3DWLE 4XLEA 4RAFA 1QPMA 3E6BA 3TMOA 4Z2YA 2C6YA 3WTVC 5AIQA 4DBQA 2WB1N 1QZZA 2UXNA 2NVUB 4Y33A 4XKVA 2VJ5A 4ZYHA 3JRHA 1TC3C 2BXYA 3RPUD 4A93J 1XGMA 5ILSA 3GLXA 5J1UA 4BJ6C 5FKKA 4HQMA 2I5UA 2DK5A 1T6SA 1JJ8C 2CUEA 4IHXA 3QAHA 3FXQA 1D1AA 3HKZN 4CDGA 2OUMA 5FD5A 1IW7F 2HQ5A 4L9JA 2RNGA 5JFRA 3LSKA 3S8PA 2GBYA 4G8XA 2NVYJ 3BG6A 2Z2SB 3ZPLA 3I55I 1ZG1A 1YG2A 2NAZA 3GO5A 1RI7A 3ZMSA 3OYIA 1OYWA 2NS0A 3PQJA 3W3CA 3F23A 1EH8A 1Y6IA 1UJ8A 4FISA 2ZXWH 2M8GX 3FMRA 1SD5A 2ZSIB 4ZZDA 4H4KC 4E4HA 1JUSA 2XC7A 2QUFA 2R7WA 2DOAA 3QYFA 4W1UA 2LY1A 2B63J 3ECHA 3GX4X 2Z99A 1T56A 2XAHA 5L3GA 4A3FJ 1V55H 2KLOA 3GZNB 2R7TA 3CC4I 1XDSA 2ZMEB 1G59A 2HXIA 2A61A 1N25A 2IEKA 3E5XA 2JJ7A 5CVRA 4RLQA 4KICA 3O8GA 1FYLA 2QENA 4FX4A 4D0PA 4AVZA 3FZVA 1VZ0A 5HS7A 2Z1DA 2M5WA 3CUQC 3QOPA 1R6RA 2HZTA 1PDNC 1W4MA 1E0EA 4G94A 1MBJA 2QSGX 3ASNH 1ZYRF 2H6BA 4A3KJ 2A3SA 2JZYA 1WI3A 1XSXA 2TDXA 2VBZA 1JKOC 5F6FA 2STWA 4RAGA 3VWBA 1TW3A 3OS1A 2M0CA 3IUOA 2JRTA 2DA2A 1EJ9A 3C3WA 5L3EA 1HW1A 1WJDA 4Q48A 2Y9ZA 4KISA 1FSEA 5HDKA 3QOEA 2EWNA 2HKXA 1Z21A 1KQ0A 3K4NA 4II2A 2HVSA 1Z0XA 4M9ZA 1XG1A 5FD6A 5LLQA 1XN7A 4PJ0C 1UFMA 1AHDP 1A6IA 1LVAA 2H8RA 2V7FA 1ETKA 4N0BA 1USSA 2KQRA 3KZZA 4DIQA 2UUZA 4FCYA 3ZQLA 2XGCA 4CYCB 1G2HA 4NB5A 2NVQJ 1T2KA 1HQCA 2CV1A 1HSJA 2CW7A 4IX7A 1GUUA 2VE9A 3F6VA 3GBGA 4KITB 4KA4A 1IXRC 2VOOA 1T08B 3HSEA 2VC1A 2LBFB 3TO9A 3MVPA 1Z77A 3HB9A 3HOZJ 1WWXA 2PLYA 1W5TA 4BHBA 5LGUA 5E1ZB 3S2WA 4HRIA 4CA0A 2P4WA 4B3XA 1YFHA 2CQ7A 2XF5A 4EJUA 5ED4A 1RPWA 1X4OA 3OYGA 4ABZA 3BR0A 1MDMA 1R9TJ 3CDIA 1HA8A 3CQZJ 5E18F 3ZCOA 2ECCA 4U0YA 4DBRA 3MKYB 2WB1A 3LAJA 4A3GJ 3I0TA 2IS4A 1TL8A 2V1UA 5IT9Z 1DP3A 1P4WA 2HVRA 3E6DA 3IP4B 3GFIA 1QVTA 4E7IA 1NTCA 5M5WJ 2CW8A 2MABA 3J7YJ 2ZXHA 4M3DA 3S3OA 2VJIA 3HKZA 2PJPA 5LEJA 1LNWA 1YW8A 3AG1H 3R4KA 5GP9A 1U5TB 4G7HF 2KRCA 3RI4A 3RKXA 3KP7A 1TBXA 4MLOA 2LOOA 3Q0WA 3J7ZI 4BHPA 2IA2A 1DU0A 3L7WA 6PAXA 2H09A 2JN6A 2FX0A 2XGDA 3ABTA 5DCMB 5KHDA 3NWTA 3CC7I 3BR5A 1B9MA 2CGPA 3F22A 2IS2A 2ACJA 2Z9OA 2KT0A 4PFPA 2A6HF 3CZ6A 2L9NA 3L2UA 3B73A 1H9TA 3P9KA 1G3YA 2DCEA 3ONQA 5DTDA 2WY8Q 3TW7A 3EYYA 1D8KA 3H3VK 1Z3YA 1BI3A 2V6CA 3H3UA 3MKLA 4IJAA 4LFUA 1A35A 3FX3A 3TL4X 3KFWX 1B72A 4I02A 3AAFA 1S9HA 1ZG3A 4DOZA 5FFXA 5FO5A 1BR1A 2FJ1A 4GCVA 3TDZC 2W4SA 4G7OF 1EH7A 2E36A 3FDYA 2YS9A 4XMYA 1NG6A 1DP7P 4A3JJ 3GTJJ 2X1CA 3FK7A 4HX8A 2EQRA 1TNSA 5E8GA 5EDNA 4S0HB 1D3YA 1VNDA 4LG0A 4M9XA 1UCRA 3SFIA 1ZGAA 2NS8A 2ZXIA 1OCCH 4IOCF 4ENJA 2GM4A 1FWZA 4CICA 2K85A 2FBHA 4GYGA 1HKTA 1NHAA 2V26A 1U9NA 1S29A 1G4DA 1IN5A 1TWHJ 1OR7A 3V4GA 1R1UA 3I56I 4IRHA 4CCLA 3KYDB 1WSUA 4HBLA 2L2OA 1KONA 2ZJQF 2R93J 1A5JA 4XLFA 3U9GA 4HSTA 5GPAA 2A68F 1W36D 3NARA 3K2ZA 2FOWA 2AXLA 3VPRA 3ZQ7A 1K6YA 4XK4A 2LY2A 3DTIA 4P9FA 2A69F 2X4HA 3M1EA 1IRGA 2HKOA 2HXOA 3VSLA 3B6CA 2GXBA 1NK3P 4MFDA 1IAWA 2YU3A 5EG0A 2EIJH 2VL8A 1QPIA 2DW4A 5M5XJ 3L2RA 3ERMA 4BEHA 4KFCA 1FTZA 2KL4A 1AOYA 3ZN0A 1MH4A 2JA2A 2P5KA 3FXJA 1ACIA 1HOMA 2CWEA 4LK1F 1DUXC 4L9VA 3CO7C 3OIPA 2XAFA 4H0EA 2EILH 2PFBA 4FASD 4IO9F 1Z6RA 3I71A 2LMDA 1K61A 2M34A 5BMZA 4A3DJ 2LYCA 4BE0A 4ENNA 2HDCA 2O8XA 2H1KA 2M1BA 5TISC 1UHWA 2VT3A 3D1NI 1IO2A 2VKDA 4AVPA 1VQNI 1W5SA 2KP6A 5TGTA 4AC0A 3H0DA 1YRNB 3BC8A 2KJCA 3LA2A 3TO7A 3O8HA 5K5QA 3CUQA 1IDZA 3FKJA 3N4MA 5F0CA 4PDKA 3CTAA 3L2WA 1APLC 3F8BA 2BY0A 3KZYA 2M0MA 4XSZF 3IRQA 3OL3A 1SMYF 3AG2H 3EPZA 3J80K 3FWEA 4G6DA 4X1EA 3F9KA 4UB6C 2VQLA 1X3UA 3CMYA 2HOEA 2ETHA 2DPDA 3E3VA 3ZP5A 3GTKJ 1Q1HA 2L02A 2R7FA 1YLFA 5J47A 3OYCA 1ZR4A 2G9WA 2EV5A 1VQOI 3VYUB 2FNPA 2NS7A 2Z16A 5CVUA 3TW6A 2AS5F 4CGZA 1XGOA 4HV6A 2QM3A 4PGHA 3JR9A 3G73A 2GLOA 1FYMA 4MTEA 4OIOF 2HPIA 4BACA 2P7CB 3OV8A 4I0BA 4PJNA 4XLNF 4C2UA 3BTIA 4G9YA 4LGWA 3WTTC 1OQYA 1WJEA 2VN2A 4IL6C 4B44A 2ZSHB 3PJRA 4ASNA 1FPQA 5BPDA 2GWRA 2K7LA 4UUTA 2CFXA 1SFKA 2DODA 3P9CA 4KIGA 2A6TA 5D6EA 3MN2A 3HOWJ 1SVOA 4XOTA 4B4CA 4UUSB 4JX5A 3ZMVA 1HC8A 4XRFA 2XKOA 4KN7X 4C3HJ 3KP6A 2VONA 5H6RA 2GZWA 2DA6A 2IS1A 1ZGJA 2VBYA 2W57A 4RB1A 1SVMA 3OYEA 5CPRB 3K1PA 3BG5A 3H5RA 1LFBA 2ZJ2A 4Z6YA 1FTTA 2LKSA 1H88C 2L7FP 2FQ4A 2F5FA 4M3EA 3OR2C 3S93A 1KYZA 1VTNC 4LK0F 4YFNF 4UXNA 1WJFA 2DOEA 3RQIA 1YS6A 1DU6A 3HUGA 2XAJA 1HSTA 4ON0A 2JPCA 5ILUA 4HNTA 3HXLA 3CJRB 2QQ9A 1IRZA 4GRIA 3ML6A 5EGOB 1STZA 2XF6A 1GHCA 2MYSA 3M4OJ 4YFKF 2FSWA 2F4MB 5EEAA 3QQAA 1MSFC 2TCTA 1X1DA 1KYWA 2CO5A 3LSJA 1OKRA 1U78A 1ZRDA 3IWZA 5KAFC 5E3MA 2DXIA 3BY6A 3A01A 4OMYA 2XPUA 3FXMA 3R6SA 1MNMC 2QQ8A 2PJRA 1JTYA 2VBWA 5HODA 1G3SA 4BQOA 3QPLA 2DA1A 3GEZA 1G8XA 3I4NJ 2KZVA 1TTYA 3UNGC 4QSHA 1QQIA 4V19K 4E7JA 4RAZA 4BS9A 2G7UA 4I0AA 5LHIA 5DDGA 5HNHA 2DK8A 3HGYA 1U8RA 1GVDA 3K10A 1I6XA 3I59B 4BQNA 4HF0A 2V1DA 4FTHA 2P6TA 3CDLA 1Z1DA 2CS3A 2E1MB 2FU4A 2HNHA 3HPHA 3MQ0A 4I99C 4L5EA 4IZZA 3A0HC 1LE8A 5C3EJ 2H1LA 2F4OB 1KU3A 1FSHA 2X51A 1T98A 2V1NA 2E1OA 1FP1D 1UMQA 3BQYA 4E7LA 2M2EA 3LA7A 4D5FA 4LLGF 2HYGD 4DGWB 1BI1A 4NBQA 5GPCA 1W36C 5C4JJ 1D5VA 2QZ8A 2ID6A 1U9OA 1P6RA 5K5OA 4LOCA 1R5ID 1IF1A 4EM0B 2HDWA 3I54A 1XGSA 3OOUA 2BYVE 5H20A 2NNNA 5FJ8J 3S1MJ 3REOA 2BBYA 2O03A 2QCOA 3LWFA 2X48A 4ZZLA 1OISA 1W7PB 2KDZA 2OD5A 3VEPA 3H92A 5JLWA 2QBYB 1I3QJ 1I5ZA 3IKTA 5F1JA 1Z05A 2EH3A 1TW2A 1ENHA 2LH9A 1K78B 4O6JA 3ABMH 2YUSA 4B48A 5DD4A 5B66C 1FZPB 4X0GA 3M3YJ 5DM7F 3ABUA 5CVVA 5FROA 1QHHD 3SHFA 4AYBA 1MH3A 2XROA 4A69C 4AUXA 1JGGA 2XDVA 3MMYB 2JSCA 1XS9A 4NHJA 3BJ6A 4F7ZA 2W48A 1L0OC 2MC4A 1TWAJ 1VF9A 3CCQI 1K4SA 1N75A 4EGYA 4HYEA 2ZMEC 5JVGF 4E7KA 1D5YA 1MJAA 3ABLH 3CJTB 4D5CA 4CH7A 2R7OA 1MMDA 2WV1A 4HDVA 2ECBA 2DOFA 3BT9A 4MEXF 4NC8A 3I64A 2CUJA 4CCKA 2ZO4A 2D2WA 2DT7B 2WY7Q 4ESJA 5K7ZA 1DPUA 4A6EA 4ZDPA 1YW9A 3PIPF 5C4XJ 1ZHFA 3M8FA 2R5ZA 2R4GA 1J75A 3CF5F 3V8KA 3AG4H 2GOMA 2VXDA 3GTMJ 2KFDA 1IZ1A 3D0SA 4D1QA 3TQNA 3H5AA 3GUDA 4OMZA 1ZAOA 2M45A 3VYSB 2MSYA 4PJJA 3OYLA 4B3AA 1KU7A 1HW2A 2MD0A 4RM2A 4KN4X 4ANJA 3LSMA 3K6GA 3ZQHA 3VOEA 2F5VA 3SZTA 2ME0A 4U87A 2JTVA 1LPQA 1ZREA 3CD6I 3LAPA 3GYHX 2LREA 4PFOA 1HF0A 2IRFG 2K4BA 4F55A 1VI0A 2Q2EB 4Q47A 2DAOA 5EJCA 2R7ZJ 1B8IB 3OYNA 1YIJI 5EZGA 4NNJA 3BCBA 3ESWB 3CMMA 4IHVA 3CUOA 1OLTA 2EB7A 3MZYA 2L9VA 1YW7A 4PUSA 3ZQCA 5AONA 3N05A 4C3IJ 1UHSA 3HOVJ 3MWMA 2XPVA 3CF2A 3ZOBA 3LFUA 2P5VA 2Q0OA 3PM1A 3PSFA 2WA0A 3QPSA 2ZBKA 3H5NA 3W6JB 1ORKA 2V1XA 3IWFA 4HEA2 2RQPA 3G1OA 5M5YJ 2Y69H 2OF7A 2QKLB 2VBXA 5FFZA 2BY3A 4DZPA 5F1RA 4LITA 1HW5A 2VKVA 4UVCA 1XSVA 2JA6J 1U5TC 1JKPC 1R4NB 3F8FA 4MQVA 1POGA 2DA4A 3K1NA 2K9SA 2VOPA 5E1XA 1MJ9A
chains in the Genus database with same CATH topology
5DUIA 2V79A 5E17F 2RV8A 2Z33A 1HKQA 1ZRCA 1RZ4A 3RJPA 3WODF 4KNYA 4PCQA 3C7JA 1RIOH 4UUVA 2DT5A 3TGNA 1YQAA 4LD5A 3WTWC 3C18A 3I53A 3BJOA 4KIFA 4Q5SF 2ADUA 2FF4A 2FE3A 5D8LB 3JAMZ 4A12A 5ICEA 4BHCA 1J59A 4AIJA 5FLXZ 1L3LA 4ZYEA 4HX4A 4I01A 2HTSA 4R79A 2E7WA 4GXOA 3TOBA 1WI9A 2M8EA 4O3MA 4XSXF 2R7DA 2EFNA 2IVMA 1XD7A 1JHHA 4EV0A 2YX7A 4WF2A 2CYYA 2P6SA 5F64A 4RGSA 4BQAA 3Q5FA 1U3EM 3DV8A 4YG2F 3L2CA 1MDMB 1W7PD 1LDDA 3WE2A 4UVBA 1FT9A 5LHHA 1XCBA 4FT8A 5BS6A 3TOAA 4EJVA 1IRFA 5FGMA 3TO6A 2K27A 1QO0D 4BYYA 1Z7UA 3WGGA 3WU0A 2X0LA 3D5LA 2FNAA 3J81Z 2EK5A 1WRJA 4UV8A 2LF8A 3FXRA 2ZCWA 4A6DA 4OINF 2QQAA 3V8JA 4GGGA 5ILVA 4RGRA 4K2EA 5CVIA 2OAZA 2DQRA 3DPTA 2EJRA 2IT0A 2P5LC 5EEGA 5HDNA 3IKVA 5ICCA 1TNTA 1GXPA 3KLOA 3ELKA 3WGHA 3M7GA 5D8KB 3QPHA 4OIPF 3EYIA 4LG0B 1C0WA 3KP5A 4S04A 2K4JA 3QP5A 2PBIA 1JE8A 4N9IA 3JSPA 3FHZA 1IXSB 1HXDA 1MZBA 3Q9VA 1BIBA 2G7HA 1REPC 5A2QZ 4MTDA 2MLGA 4L0ZB 4M73A 2FBKA 4I7HA 2EV6A 3EDPA 4MEYF 1V4RA 2EFOA 3RPQA 2XHKA 4M74A 5D5WB 4G6QA 4AIHA 4KT5C 1BBYA 3HSFA 2OQGA 2F5DA 1FX7A 3M8EA 4A5MA 1FNNA 3ERED 1O3RA 1BN5A 3FF5A 2Q8KA 5CVJA 4QLCU 3HTSB 2NNYA 4M71A 3R61A 1U6GA 3WTYC 4U0WA 1G3WA 3JW4A 5E20A 4IF4A 4XBFA 2L4MA 3E6MA 4IHSA 1R00A 1DPRA 4CHUA 2EA4A 4IRIA 1FYKA 3CUQB 1USTA 1XDUA 2F5EA 2W24A 1HBXG 3DXJF 4HDUA 4LB5A 3IL2A 1FOKA 5FB2A 4M9SA 4OIRF 2D1VA 3F21A 4RGXA 4ESFA 3PFIA 2GA1A 3KP4A 3SXYA 1YTYA 1QZYA 3I4PA 2K02A 4U7DA 2PG4A 2FOKA 1FY7A 5HLGA 4NQWA 2A6EF 1KGSA 2J5OA 2W84A 2YSRA 4GYIA 2STTA 2YX4A 3OOPA 5IT9K 4MNUA 1RUNA 4KUMA 3EETA 3NEUA 4RAYA 3DPLC 2HQRA 4GO1A 1JGSA 3GVAA 4OIQF 1PP7U 3IRRA 2P8TA 1S8NA 4Q4ZF 1ZLJA 1R1TA 2RKHA 3B02A 2ZNYA 1OYIA 5LRSA 2MH9A 1ZN2A 2HTJA 4WX9A 3LA3A 1SD4A 4L18B 3WTZA 4DQ2A 1WKMA 5EEHA 3P9IA 4P9UA 3JSOA 3O6BB 3BPVA 1J9IA 2E1CA 2JT1A 4LJZF 4BH9A 1IXCA 3BPXA 3NRVA 4HQEA 3L09A 3DQVC 4B8XA 3U1DA 2MC3A 4RGUA 2GXGA 1XMAA 2Y0MA 4EVIA 1F9NA 1J7KA 2QLZA 1P2FA 3K1MA 3HRMA 2V9VA 4EGZA 2ZXJA 5L3BA 2KRFA 2XV4S 2H94A 1MKMA 3E5QA 2UWMA 3P7NA 1F1ZA 2F5CA 3HRSA 3RPUA 3GWZA 4BAYA 2FXAA 2XRNA 3MAJA 3WG9A 1EH6A 2PQ8A 3RYRA 1Y0UA 3VB2A 2DBBA 5J8CA 1TQPA 2A07F 3CJNA 1OYYA 2LSOA 1BI2A 1FBUA 5ERIA 4BXUA 1TLHB 3O2PE 1K6OA 2COMA 1WQ2A 5L3FA 1B9NA 3K0LA 5H6QA 4IHTA 5HVQC 1MD0A 4I09A 4U0VA 3FMSA 1PUEE 4IVNA 1T38A 1IN4A 1XMKA 2FBIA 3ZN1A 2LNBA 1E17A 3V8LA 5KVRA 1R58A 1OPCA 2BEOA 1ZARA 1IUYA 3FXUA 3WU1B 3I58A 3F8MA 2XAGA 1V3FA 4EM2A 1K7AA 3PQKA 4RB2C 2JPBA 4N9HA 2O0YA 4JQFA 1J2XA 5D6FA 2CSOA 5KK1A 2IA0A 1IN8A 1BC7C 1CF7A 4EQQA 1LDKB 1FC3A 4MHGA 1Z91A 4A5NA 2IW5A 1O7LA 4A2UA 1R23A 3DP7A 1R22A 1QNTA 2FMYA 2L3DA 3RDIA 4IPAA 1S7AA 1PP8F 1KA8A 1R1VA 1E2XA 3N97A 1G3TA 2D45A 2M87A 2XVCA 2HWVA 2L01A 3GFMA 2RGVA 5HLHA 3BZ6A 2O6GE 2EA2A 5JHUA 2O3FA 3BOQA 3QU3A 5L3CA 4RB3C 4R8HA 3RIRA 4OOIA 3RTRA 4LLNA 4O5VA 3ULQB 2KJBA 1ZLKA 2QWWA 3T8RA 4U88A 2ZNZA 4L5JA 4Y17A 1IN7A 5LEKA 1J0RA 2ZFWA 5K1YA 3T1BA 5JR3A 2ESHA 4CO8A 1KU9A 2KIUA 2DU9A 2DO7A 3KP3A 4ZYDA 2L54A 1OMIA 2MD5A 4L9TA 1B59A 5K5RA 5TJJA 2EFQA 4MGRA 5E8IA 4UV9A 5BQTA 5LHGA 4LB6B 4FHTA 1XSDA 3FMQA 2Y48A 2XUBA 2DTRA 3GFLA 4EJTA 1KQ9A 3ZMTA 2M30A 2DQLA 3L00A 1T39A 1B6AA 3SQNA 2GQQA 1BC8C 3L9FA 5DD8A 5CYVA 2OA4A 3GFJA 1YYVA 4IXAA 1ZRFA 2RVCA 1B1BA 1LEBA 1TQMA 3KP2A 3F8CA 1FBQA 3LQRA 3HRTA 4E70A 2BGCA 4ESBA 5LGNA 4HAMA 1O57A 1XGNA 1IN6A 3KEOA 2EFPA 2VODA 1SD6A 2HYFA 2WV0A 5D5UB 4HX7A 2UXXA 3FM3A 4A0XA 1BIAA 2IPQX 3WTXC 4QWQA 3J7AO 3MZHA 2ZMEA 1YS7A 4Y15A 3V7SA 4PZJA 1UHMA 4CZZA 3F72A 5BOXA 2MLKA 2PMUA 3TKYA 3KCCA 3GF2A 1BOAA 1ZH5A 3WGIA 3J80Z 3BJAA 3IHUA 2HEOA 2VXZA 3GW2A 4G7ZF 1GXQA 3LQQA 3DEUA 3I5UA 1ON1A 2DI3A 2W25A 5AIPA 1QBJA 3WTUC 1O7FA 1JXSA 3R0AA 3R0JA 2L4AA 3W6KB 3CLOA 1JHFA 2FEZA 4IRGA 4PGGA 3TDUC 1KQ8A 1A04A 5LRRA 4P55A 1CGPA 3DFGA 2J5PA 4S05A 4AWXB 2E1NA 3F6OA 3KLNA 2LDUA 2LF7A 4YIFA 4KDPA 5IT3A 4UVAA 2HQNA 1ZG5A 4AIKA 4M72A 4UHTA 1S7OA 2FMLA 4HF1A 4L0YB 2OBPA 2XAQA 3JAMK 2Z3YA 2CG4A 3DKWA 1U5TA 4Y13A 3E97A 3T8TA 4L9NA 4ETSA 5JVTA 5FLXK 3JTGA 1ON2A 4RB0A 3EUHA 5DCMA 1UB9A 4WXCA 2RNJA 5D5XB 3FM5A 3O3KA 3U2RA 1SMTA 3DF8A 1BM9A 2OQRA 1I27A 4KYWA 1YO5C 2QYOA 3VODA 3T0YA 4YIIA 3ZMZA 3VFZA 4EM1A 4WXDA 4YFXF 2OZUA 5LGTA 4JK1X 2IJLA 2IP2A 3HTUA 4XLPF 2RC4A 3HYIA 2P7VB 1R36A 1P4AA 1FBSA 3G3ZA 4I2OA 4B09A 4M6YA 5DCFA 2DFIA 1MGTA 3RKYA 2MA3A 5DEQA 4P5OA 4MQ9F 2EV0A 1LEAA 3EQLF 5CJ9A 2HR3A 2YR2A 3NQOA 1T0FA 1H9GA 5L3DA 4WCGA 3ECOA 3F8NA 1O3QA 4P96A 5DV5A 5DUKA 5D4RA 3CDHA 4HW0A 3BWGA 3KEQA 2XKPA 2UZKA 3GZ6A 1SFXA 1BI0A 4UNOA 4EMSA 4CXFA 2ISZA 3J81K 4KMUX 4WXHA 2HS5A 2QQBA 2KIMA 5LBQA 4R1HA 1GVJA 4ZYGA 4HLYA 1O3SA 1TQIA 1D8JA 2E7XA 1LJ9A 1S6LA 2WC2A 1ULYA 3QPTA 1LQ1A 3KETA 3T5XA 1SFEA 3K69A 5D5VB 2KKOA 3ZMDA 4AD9A 2CQKA 2YPRA 2D1HA 3COAC 4HLXA 2ISYA 4TV7A 2VE8A 3MEXA 5J8FA 5ICFA 2PN6A 2NYXA 3H3ZA 4HV5A 4FX0A 2QVOA 2Z5UA 3JTHA 5HS8A 3WTSC 4CYDA 4HOBA 2F2EA 2EFWA 2ELHA 5DYMA 2BE5F 1SAXA 5CLSA 3IC7A 3ZMUA 3BROA 2RN7A 2BV6A 5A2QK 4A0YA 3QU6A 4ZH4F 2H27A 2PEXA 3LFKA 1O3TA 2FA5A 1J5YA 2B0LA 2HFHA 5J6XA 4KIBA 1SFUA 2RDPA 4ENKA 2OU2A 2KIFA 2GAUA 4ENMA 4U7BA 1XCVA 4HF2A 3K9TA 2VC0A 4L5IA 2CW0F 4JBAA 3MFKA 5JI6A 2H6CA 2Y75A 3ISPA 3GZ5A 3HRUA 2R3SA 3E5UA 1MJBA 1U2WA 3HHGA 1LB2A 3Q9SA 2A5YB 2FQ3A 5BPIA 2MH2A 4OU0A 1I1SA 3QRFF 1SD7A 1RNLA 3RKWA 2ZKZA 5HOOA 1XB4A 1S3JA 3HIFA 4KMFA 2VT2A 3HHHA 2PI0A 3I59A 2ESNA 3M9AA 5HS9A 2MBFA 2FRHA 4DNCA 2DLLA 2GA2A 1BJAA 3LSTA 1F4KA 5D4SA 1AWCA 1CF7B 1DDNA 1P4XA 1ONVA 3C1DA 3E6CC 2PMHA 1K79A 1EV7A 5HDGA 4LMYA 1QGPA 3BDDA 3CO6C 1P92A 1G6NA 4I98B 1R5GA 1B4AA 3SFZA 1W7PA 3RYPA 4HZFA 3HOSA 2QBYA 1FLIA 1KU2A 3HOTA 1HKSA 3ROUA 1K78A 4M6XA 2WWYA 3GXOA 4EJWA 1R7JA 5TRDA 5E1WA 1I1GA 1Z9CA 1R5HA 2O61A 2LKPA 1H0MA 3HSRA 3V7RA 3KE2A 3SZPA 1Z6TA 2OZ6A 2XGXA 2GIVA 2WTEA 5ICGA 2K86A 3WE3A 2W85A 2DPUA 3R60A 2NRAC 1RUOA 3BP8A 2IA1A 1FP2A 3F3XA 4WWCA 1F5TA 5HLIA 1ODDA 3QP6A 3MCZA 2HGCA 4HA8A 4A0ZA 2XASA 4RS8A 2XIGA 4BNCA 1YIOA 2Q2EA 4LLLA 3V7CA 1LDJA 4WK8F 4EJOA 1QPMA 3E6BA 4Z2YA 2C6YA 3WTVC 5AIQA 1QZZA 2UXNA 4ZYHA 1XGMA 5ILSA 3GLXA 4HQMA 2DK5A 1T6SA 3QAHA 3FXQA 4CDGA 5FD5A 1IW7F 4L9JA 5JFRA 4G8XA 3ZPLA 1ZG1A 3ZMSA 1YG2A 2NAZA 1RI7A 3GO5A 1OYWA 2NS0A 3PQJA 3F23A 1EH8A 3FMRA 1SD5A 4ZZDA 2QUFA 3ECHA 3GX4X 2Z99A 2XAHA 5L3GA 1XDSA 2ZMEB 5CVRA 2A61A 3E5XA 4KICA 1FYLA 4FX4A 2QENA 4D0PA 3FZVA 5HS7A 2M5WA 3CUQC 3QOPA 2HZTA 1PDNC 1W4MA 4G94A 1ZYRF 2H6BA 2A3SA 2JZYA 1XSXA 2TDXA 2VBZA 5F6FA 2STWA 1TW3A 2JRTA 3C3WA 5L3EA 1HW1A 4Q48A 1FSEA 5HDKA 2EWNA 2HKXA 1KQ0A 4M9ZA 5FD6A 5LLQA 1XN7A 1UFMA 1LVAA 4N0BA 1USSA 3KZZA 4NB5A 1T2KA 1HQCA 1HSJA 2VE9A 3F6VA 4KA4A 1IXRC 2VOOA 3HSEA 2VC1A 3TO9A 1WWXA 2PLYA 5LGUA 1W5TA 4BHBA 5E1ZB 3S2WA 2P4WA 1YFHA 5ED4A 4EJUA 1MDMA 5E18F 4U0YA 3LAJA 3I0TA 2V1UA 5IT9Z 1P4WA 3E6DA 3GFIA 2PJPA 5LEJA 1LNWA 1YW8A 3R4KA 1U5TB 4G7HF 3RI4A 3RKXA 3KP7A 1TBXA 4BHPA 2IA2A 3L7WA 6PAXA 2H09A 3ABTA 5DCMB 1B9MA 2CGPA 3F22A 2ACJA 2Z9OA 2A6HF 3B73A 1H9TA 3P9KA 1G3YA 3EYYA 1D8KA 1BI3A 2V6CA 3H3UA 4LFUA 4IJAA 3FX3A 3KFWX 4I02A 3AAFA 1ZG3A 5FFXA 5FO5A 4GCVA 3TDZC 4G7OF 1EH7A 1DP7P 4HX8A 1TNSA 5E8GA 1D3YA 4LG0A 4M9XA 1UCRA 1ZGAA 4ENJA 1FWZA 4CICA 2FBHA 4GYGA 1HKTA 1NHAA 1S29A 1G4DA 1IN5A 3V4GA 1OR7A 1R1UA 4IRHA 1WSUA 4HBLA 3U9GA 2A68F 3K2ZA 2AXLA 3ZQ7A 4P9FA 2A69F 2X4HA 3M1EA 1IRGA 2HKOA 2GXBA 1IAWA 2YU3A 2DW4A 4KFCA 1AOYA 3ZN0A 2P5KA 2CWEA 4LK1F 1DUXC 4L9VA 3CO7C 2XAFA 4H0EA 2PFBA 1Z6RA 3I71A 5BMZA 4ENNA 2HDCA 2O8XA 2M1BA 1UHWA 2VT3A 4AVPA 1W5SA 2KJCA 3LA2A 3TO7A 5K5QA 3CUQA 3N4MA 4PDKA 3CTAA 3F8BA 3KZYA 4XSZF 3IRQA 1SMYF 3J80K 3FWEA 4G6DA 1X3UA 2HOEA 2ETHA 2DPDA 3E3VA 3ZP5A 1Q1HA 2L02A 2R7FA 1YLFA 2G9WA 2EV5A 2FNPA 5CVUA 2AS5F 4CGZA 1XGOA 4HV6A 2QM3A 4PGHA 3G73A 1FYMA 4MTEA 4OIOF 2P7CB 3OV8A 4I0BA 4XLNF 4G9YA 4LGWA 3WTTC 2VN2A 4ASNA 1FPQA 5BPDA 2GWRA 2K7LA 2CFXA 3P9CA 4KIGA 5D6EA 3ZMVA 4XRFA 2XKOA 4KN7X 3KP6A 2VONA 5H6RA 2GZWA 1ZGJA 2VBYA 2W57A 4RB1A 3K1PA 2ZJ2A 2F5FA 1VTNC 1KYZA 4LK0F 4YFNF 4UXNA 1YS6A 3HUGA 2XAJA 1HSTA 4ON0A 2JPCA 5ILUA 2QQ9A 3ML6A 1STZA 1GHCA 4YFKF 2FSWA 1KYWA 2CO5A 1OKRA 1U78A 1ZRDA 3IWZA 3BY6A 4OMYA 3R6SA 2VBWA 1G3SA 3GEZA 1TTYA 1QQIA 4RAZA 2G7UA 4I0AA 5LHIA 5DDGA 2DK8A 1U8RA 1I6XA 3I59B 4HF0A 2V1DA 2P6TA 1Z1DA 2FU4A 3MQ0A 1KU3A 1FSHA 1T98A 1FP1D 3LA7A 1D5VA 4LLGF 2HYGD 1BI1A 2QZ8A 1P6RA 5K5OA 1IF1A 4EM0B 3I54A 1XGSA 2BYVE 5H20A 2NNNA 3REOA 2BBYA 2O03A 3LWFA 4ZZLA 1W7PB 2OD5A 3VEPA 3H92A 2QBYB 1I5ZA 3IKTA 1Z05A 1TW2A 1K78B 4O6JA 5DD4A 1FZPB 3ABUA 5CVVA 3SHFA 2XROA 2JSCA 4NHJA 3BJ6A 4F7ZA 1L0OC 4EGYA 4HYEA 1MJAA 4HDVA 4MEXF 3I64A 2ZO4A 2D2WA 4ESJA 1DPUA 4A6EA 1YW9A 1ZHFA 3M8FA 1J75A 3V8KA 1IZ1A 3D0SA 3TQNA 4OMZA 3GUDA 1ZAOA 2M45A 1KU7A 1HW2A 4KN4X 3VOEA 3SZTA 2JTVA 1ZREA 3LAPA 3GYHX 2IRFG 2K4BA 4Q47A 2DAOA 3CUOA 2EB7A 3MZYA 1YW7A 5AONA 3MWMA 2P5VA 2Q0OA 2ZBKA 3W6JB 2V1XA 3IWFA 2RQPA 2VBXA 5FFZA 5F1RA 1HW5A 4UVCA 1XSVA 1U5TC 3F8FA 4MQVA 3K1NA 2VOPA 5E1XA 1MJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUI A;  2V79 A;  5E17 F;  2RV8 A;  2Z33 A;  1HKQ A;  1ZRC A;  1RZ4 A;  3RJP A;  3WOD F;  4KNY A;  4PCQ A;  3C7J A;  1RIO H;  4UUV A;  2DT5 A;  3TGN A;  1YQA A;  4LD5 A;  3WTW C;  3C18 A;  3I53 A;  3BJO A;  4KIF A;  4Q5S F;  2ADU A;  2FF4 A;  2FE3 A;  5D8L B;  3JAM Z;  4A12 A;  5ICE A;  4BHC A;  1J59 A;  4AIJ A;  5FLX Z;  1L3L A;  4ZYE A;  4HX4 A;  4I01 A;  2HTS A;  4R79 A;  2E7W A;  4GXO A;  3TOB A;  1WI9 A;  2M8E A;  4O3M A;  4XSX F;  2R7D A;  2EFN A;  2IVM A;  1XD7 A;  1JHH A;  4EV0 A;  2YX7 A;  4WF2 A;  2CYY A;  2P6S A;  5F64 A;  4RGS A;  4BQA A;  3Q5F A;  1U3E M;  3DV8 A;  4YG2 F;  3L2C A;  1MDM B;  1W7P D;  1LDD A;  3WE2 A;  4UVB A;  1FT9 A;  5LHH A;  1XCB A;  4FT8 A;  5BS6 A;  3TOA A;  4EJV A;  1IRF A;  5FGM A;  3TO6 A;  2K27 A;  1QO0 D;  4BYY A;  1Z7U A;  3WGG A;  3WU0 A;  2X0L A;  3D5L A;  2FNA A;  3J81 Z;  2EK5 A;  1WRJ A;  4UV8 A;  2LF8 A;  3FXR A;  2ZCW A;  4A6D A;  4OIN F;  2QQA A;  3V8J A;  4GGG A;  5ILV A;  4RGR A;  4K2E A;  5CVI A;  2OAZ A;  2DQR A;  3DPT A;  2EJR A;  2IT0 A;  2P5L C;  5EEG A;  5HDN A;  3IKV A;  5ICC A;  1TNT A;  1GXP A;  3KLO A;  3ELK A;  3WGH A;  3M7G A;  5D8K B;  3QPH A;  4OIP F;  3EYI A;  4LG0 B;  1C0W A;  3KP5 A;  4S04 A;  2K4J A;  3QP5 A;  2PBI A;  1JE8 A;  4N9I A;  3JSP A;  3FHZ A;  1IXS B;  1HXD A;  1MZB A;  3Q9V A;  1BIB A;  2G7H A;  1REP C;  5A2Q Z;  4MTD A;  2MLG A;  4L0Z B;  4M73 A;  2FBK A;  4I7H A;  2EV6 A;  3EDP A;  4MEY F;  1V4R A;  2EFO A;  3RPQ A;  2XHK A;  4M74 A;  5D5W B;  4G6Q A;  4AIH A;  4KT5 C;  1BBY A;  3HSF A;  2OQG A;  2F5D A;  1FX7 A;  3M8E A;  4A5M A;  1FNN A;  3ERE D;  1O3R A;  1BN5 A;  3FF5 A;  2Q8K A;  5CVJ A;  4QLC U;  3HTS B;  2NNY A;  4M71 A;  3R61 A;  1U6G A;  3WTY C;  4U0W A;  1G3W A;  3JW4 A;  5E20 A;  4IF4 A;  4XBF A;  2L4M A;  3E6M A;  4IHS A;  1R00 A;  1DPR A;  4CHU A;  2EA4 A;  4IRI A;  1FYK A;  3CUQ B;  1UST A;  1XDU A;  2F5E A;  2W24 A;  1HBX G;  3DXJ F;  4HDU A;  4LB5 A;  3IL2 A;  1FOK A;  5FB2 A;  4M9S A;  4OIR F;  2D1V A;  3F21 A;  4RGX A;  4ESF A;  3PFI A;  2GA1 A;  3KP4 A;  3SXY A;  1YTY A;  1QZY A;  3I4P A;  2K02 A;  4U7D A;  2PG4 A;  2FOK A;  1FY7 A;  5HLG A;  4NQW A;  2A6E F;  1KGS A;  2J5O A;  2W84 A;  2YSR A;  4GYI A;  2STT A;  2YX4 A;  3OOP A;  5IT9 K;  4MNU A;  1RUN A;  4KUM A;  3EET A;  3NEU A;  4RAY A;  3DPL C;  2HQR A;  4GO1 A;  1JGS A;  3GVA A;  4OIQ F;  1PP7 U;  3IRR A;  2P8T A;  1S8N A;  4Q4Z F;  1ZLJ A;  1R1T A;  2RKH A;  3B02 A;  2ZNY A;  1OYI A;  5LRS A;  2MH9 A;  1ZN2 A;  2HTJ A;  4WX9 A;  3LA3 A;  1SD4 A;  4L18 B;  3WTZ A;  4DQ2 A;  1WKM A;  5EEH A;  3P9I A;  4P9U A;  3JSO A;  3O6B B;  3BPV A;  1J9I A;  2E1C A;  2JT1 A;  4LJZ F;  4BH9 A;  1IXC A;  3BPX A;  3NRV A;  4HQE A;  3L09 A;  3DQV C;  4B8X A;  3U1D A;  2MC3 A;  4RGU A;  2GXG A;  1XMA A;  2Y0M A;  4EVI A;  1F9N A;  1J7K A;  2QLZ A;  1P2F A;  3K1M A;  3HRM A;  2V9V A;  4EGZ A;  2ZXJ A;  5L3B A;  2KRF A;  2XV4 S;  2H94 A;  1MKM A;  3E5Q A;  2UWM A;  3P7N A;  1F1Z A;  2F5C A;  3HRS A;  3RPU A;  3GWZ A;  4BAY A;  2FXA A;  2XRN A;  3MAJ A;  3WG9 A;  1EH6 A;  2PQ8 A;  3RYR A;  1Y0U A;  3VB2 A;  2DBB A;  5J8C A;  1TQP A;  2A07 F;  3CJN A;  1OYY A;  2LSO A;  1BI2 A;  1FBU A;  5ERI A;  4BXU A;  1TLH B;  3O2P E;  1K6O A;  2COM A;  1WQ2 A;  5L3F A;  1B9N A;  3K0L A;  5H6Q A;  4IHT A;  5HVQ C;  1MD0 A;  4I09 A;  4U0V A;  3FMS A;  1PUE E;  4IVN A;  1T38 A;  1IN4 A;  1XMK A;  2FBI A;  3ZN1 A;  2LNB A;  1E17 A;  3V8L A;  5KVR A;  1R58 A;  1OPC A;  2BEO A;  1ZAR A;  1IUY A;  3FXU A;  3WU1 B;  3I58 A;  3F8M A;  2XAG A;  1V3F A;  4EM2 A;  1K7A A;  3PQK A;  4RB2 C;  2JPB A;  4N9H A;  2O0Y A;  4JQF A;  1J2X A;  5D6F A;  2CSO A;  5KK1 A;  2IA0 A;  1IN8 A;  1BC7 C;  1CF7 A;  4EQQ A;  1LDK B;  1FC3 A;  4MHG A;  1Z91 A;  4A5N A;  2IW5 A;  1O7L A;  4A2U A;  1R23 A;  3DP7 A;  1R22 A;  1QNT A;  2FMY A;  2L3D A;  3RDI A;  4IPA A;  1S7A A;  1PP8 F;  1KA8 A;  1R1V A;  1E2X A;  3N97 A;  1G3T A;  2D45 A;  2M87 A;  2XVC A;  2HWV A;  2L01 A;  3GFM A;  2RGV A;  5HLH A;  3BZ6 A;  2O6G E;  2EA2 A;  5JHU A;  2O3F A;  3BOQ A;  3QU3 A;  5L3C A;  4RB3 C;  4R8H A;  3RIR A;  4OOI A;  3RTR A;  4LLN A;  4O5V A;  3ULQ B;  2KJB A;  1ZLK A;  2QWW A;  3T8R A;  4U88 A;  2ZNZ A;  4L5J A;  4Y17 A;  1IN7 A;  5LEK A;  1J0R A;  2ZFW A;  5K1Y A;  3T1B A;  5JR3 A;  2ESH A;  4CO8 A;  1KU9 A;  2KIU A;  2DU9 A;  2DO7 A;  3KP3 A;  4ZYD A;  2L54 A;  1OMI A;  2MD5 A;  4L9T A;  1B59 A;  5K5R A;  5TJJ A;  2EFQ A;  4MGR A;  5E8I A;  4UV9 A;  5BQT A;  5LHG A;  4LB6 B;  4FHT A;  1XSD A;  3FMQ A;  2Y48 A;  2XUB A;  2DTR A;  3GFL A;  4EJT A;  1KQ9 A;  3ZMT A;  2M30 A;  2DQL A;  3L00 A;  1T39 A;  1B6A A;  3SQN A;  2GQQ A;  1BC8 C;  3L9F A;  5DD8 A;  5CYV A;  2OA4 A;  3GFJ A;  1YYV A;  4IXA A;  1ZRF A;  2RVC A;  1B1B A;  1LEB A;  1TQM A;  3KP2 A;  3F8C A;  1FBQ A;  3LQR A;  3HRT A;  4E70 A;  2BGC A;  4ESB A;  5LGN A;  4HAM A;  1O57 A;  1XGN A;  1IN6 A;  3KEO A;  2EFP A;  2VOD A;  1SD6 A;  2HYF A;  2WV0 A;  5D5U B;  4HX7 A;  2UXX A;  3FM3 A;  4A0X A;  1BIA A;  2IPQ X;  3WTX C;  4QWQ A;  3J7A O;  3MZH A;  2ZME A;  1YS7 A;  4Y15 A;  3V7S A;  4PZJ A;  1UHM A;  4CZZ A;  3F72 A;  5BOX A;  2MLK A;  2PMU A;  3TKY A;  3KCC A;  3GF2 A;  1BOA A;  1ZH5 A;  3WGI A;  3J80 Z;  3BJA A;  3IHU A;  2HEO A;  2VXZ A;  3GW2 A;  4G7Z F;  1GXQ A;  3LQQ A;  3DEU A;  3I5U A;  1ON1 A;  2DI3 A;  2W25 A;  5AIP A;  1QBJ A;  3WTU C;  1O7F A;  1JXS A;  3R0A A;  3R0J A;  2L4A A;  3W6K B;  3CLO A;  1JHF A;  2FEZ A;  4IRG A;  4PGG A;  3TDU C;  1KQ8 A;  1A04 A;  5LRR A;  4P55 A;  1CGP A;  3DFG A;  2J5P A;  4S05 A;  4AWX B;  2E1N A;  3F6O A;  3KLN A;  2LDU A;  2LF7 A;  4YIF A;  4KDP A;  5IT3 A;  4UVA A;  2HQN A;  1ZG5 A;  4AIK A;  4M72 A;  4UHT A;  1S7O A;  2FML A;  4HF1 A;  4L0Y B;  2OBP A;  2XAQ A;  3JAM K;  2Z3Y A;  2CG4 A;  3DKW A;  1U5T A;  4Y13 A;  3E97 A;  3T8T A;  4L9N A;  4ETS A;  5JVT A;  5FLX K;  3JTG A;  1ON2 A;  4RB0 A;  3EUH A;  5DCM A;  1UB9 A;  4WXC A;  2RNJ A;  5D5X B;  3FM5 A;  3O3K A;  3U2R A;  1SMT A;  3DF8 A;  1BM9 A;  2OQR A;  1I27 A;  4KYW A;  1YO5 C;  2QYO A;  3VOD A;  3T0Y A;  4YII A;  3ZMZ A;  3VFZ A;  4EM1 A;  4WXD A;  4YFX F;  2OZU A;  5LGT A;  4JK1 X;  2IJL A;  2IP2 A;  3HTU A;  4XLP F;  2RC4 A;  3HYI A;  2P7V B;  1R36 A;  1P4A A;  1FBS A;  3G3Z A;  4I2O A;  4B09 A;  4M6Y A;  5DCF A;  2DFI A;  1MGT A;  3RKY A;  2MA3 A;  5DEQ A;  4P5O A;  4MQ9 F;  2EV0 A;  1LEA A;  3EQL F;  5CJ9 A;  2HR3 A;  2YR2 A;  3NQO A;  1T0F A;  1H9G A;  5L3D A;  4WCG A;  3ECO A;  3F8N A;  1O3Q A;  4P96 A;  5DV5 A;  5DUK A;  5D4R A;  3CDH A;  4HW0 A;  3BWG A;  3KEQ A;  2XKP A;  2UZK A;  3GZ6 A;  1SFX A;  1BI0 A;  4UNO A;  4EMS A;  4CXF A;  2ISZ A;  3J81 K;  4KMU X;  4WXH A;  2HS5 A;  2QQB A;  2KIM A;  5LBQ A;  4R1H A;  1GVJ A;  4ZYG A;  4HLY A;  1O3S A;  1TQI A;  1D8J A;  2E7X A;  1LJ9 A;  1S6L A;  2WC2 A;  1ULY A;  3QPT A;  1LQ1 A;  3KET A;  3T5X A;  1SFE A;  3K69 A;  5D5V B;  2KKO A;  3ZMD A;  4AD9 A;  2CQK A;  2YPR A;  2D1H A;  3COA C;  4HLX A;  2ISY A;  4TV7 A;  2VE8 A;  3MEX A;  5J8F A;  5ICF A;  2PN6 A;  2NYX A;  3H3Z A;  4HV5 A;  4FX0 A;  2QVO A;  2Z5U A;  3JTH A;  5HS8 A;  3WTS C;  4CYD A;  4HOB A;  2F2E A;  2EFW A;  2ELH A;  5DYM A;  2BE5 F;  1SAX A;  5CLS A;  3IC7 A;  3ZMU A;  3BRO A;  2RN7 A;  2BV6 A;  5A2Q K;  4A0Y A;  3QU6 A;  4ZH4 F;  2H27 A;  2PEX A;  3LFK A;  1O3T A;  2FA5 A;  1J5Y A;  2B0L A;  2HFH A;  5J6X A;  4KIB A;  1SFU A;  2RDP A;  4ENK A;  2OU2 A;  2KIF A;  2GAU A;  4ENM A;  4U7B A;  1XCV A;  4HF2 A;  3K9T A;  2VC0 A;  4L5I A;  2CW0 F;  4JBA A;  3MFK A;  5JI6 A;  2H6C A;  2Y75 A;  3ISP A;  3GZ5 A;  3HRU A;  2R3S A;  3E5U A;  1MJB A;  1U2W A;  3HHG A;  1LB2 A;  3Q9S A;  2A5Y B;  2FQ3 A;  5BPI A;  2MH2 A;  4OU0 A;  1I1S A;  3QRF F;  1SD7 A;  1RNL A;  3RKW A;  2ZKZ A;  5HOO A;  1XB4 A;  1S3J A;  3HIF A;  4KMF A;  2VT2 A;  3HHH A;  2PI0 A;  3I59 A;  2ESN A;  3M9A A;  5HS9 A;  2MBF A;  2FRH A;  4DNC A;  2DLL A;  2GA2 A;  1BJA A;  3LST A;  1F4K A;  5D4S A;  1AWC A;  1CF7 B;  1DDN A;  1P4X A;  1ONV A;  3C1D A;  3E6C C;  2PMH A;  1K79 A;  1EV7 A;  5HDG A;  4LMY A;  1QGP A;  3BDD A;  3CO6 C;  1P92 A;  1G6N A;  4I98 B;  1R5G A;  1B4A A;  3SFZ A;  1W7P A;  3RYP A;  4HZF A;  3HOS A;  2QBY A;  1FLI A;  1KU2 A;  3HOT A;  1HKS A;  3ROU A;  1K78 A;  4M6X A;  2WWY A;  3GXO A;  4EJW A;  1R7J A;  5TRD A;  5E1W A;  1I1G A;  1Z9C A;  1R5H A;  2O61 A;  2LKP A;  1H0M A;  3HSR A;  3V7R A;  3KE2 A;  3SZP A;  1Z6T A;  2OZ6 A;  2XGX A;  2GIV A;  2WTE A;  5ICG A;  2K86 A;  3WE3 A;  2W85 A;  2DPU A;  3R60 A;  2NRA C;  1RUO A;  3BP8 A;  2IA1 A;  1FP2 A;  3F3X A;  4WWC A;  1F5T A;  5HLI A;  1ODD A;  3QP6 A;  3MCZ A;  2HGC A;  4HA8 A;  4A0Z A;  2XAS A;  4RS8 A;  2XIG A;  4BNC A;  1YIO A;  2Q2E A;  4LLL A;  3V7C A;  1LDJ A;  4WK8 F;  4EJO A;  1QPM A;  3E6B A;  4Z2Y A;  2C6Y A;  3WTV C;  5AIQ A;  1QZZ A;  2UXN A;  4ZYH A;  1XGM A;  5ILS A;  3GLX A;  4HQM A;  2DK5 A;  1T6S A;  3QAH A;  3FXQ A;  4CDG A;  5FD5 A;  1IW7 F;  4L9J A;  5JFR A;  4G8X A;  3ZPL A;  1ZG1 A;  3ZMS A;  1YG2 A;  2NAZ A;  1RI7 A;  3GO5 A;  1OYW A;  2NS0 A;  3PQJ A;  3F23 A;  1EH8 A;  3FMR A;  1SD5 A;  4ZZD A;  2QUF A;  3ECH A;  3GX4 X;  2Z99 A;  2XAH A;  5L3G A;  1XDS A;  2ZME B;  5CVR A;  2A61 A;  3E5X A;  4KIC A;  1FYL A;  4FX4 A;  2QEN A;  4D0P A;  3FZV A;  5HS7 A;  2M5W A;  3CUQ C;  3QOP A;  2HZT A;  1PDN C;  1W4M A;  4G94 A;  1ZYR F;  2H6B A;  2A3S A;  2JZY A;  1XSX A;  2TDX A;  2VBZ A;  5F6F A;  2STW A;  1TW3 A;  2JRT A;  3C3W A;  5L3E A;  1HW1 A;  4Q48 A;  1FSE A;  5HDK A;  2EWN A;  2HKX A;  1KQ0 A;  4M9Z A;  5FD6 A;  5LLQ A;  1XN7 A;  1UFM A;  1LVA A;  4N0B A;  1USS A;  3KZZ A;  4NB5 A;  1T2K A;  1HQC A;  1HSJ A;  2VE9 A;  3F6V A;  4KA4 A;  1IXR C;  2VOO A;  3HSE A;  2VC1 A;  3TO9 A;  1WWX A;  2PLY A;  5LGU A;  1W5T A;  4BHB A;  5E1Z B;  3S2W A;  2P4W A;  1YFH A;  5ED4 A;  4EJU A;  1MDM A;  5E18 F;  4U0Y A;  3LAJ A;  3I0T A;  2V1U A;  5IT9 Z;  1P4W A;  3E6D A;  3GFI A;  2PJP A;  5LEJ A;  1LNW A;  1YW8 A;  3R4K A;  1U5T B;  4G7H F;  3RI4 A;  3RKX A;  3KP7 A;  1TBX A;  4BHP A;  2IA2 A;  3L7W A;  6PAX A;  2H09 A;  3ABT A;  5DCM B;  1B9M A;  2CGP A;  3F22 A;  2ACJ A;  2Z9O A;  2A6H F;  3B73 A;  1H9T A;  3P9K A;  1G3Y A;  3EYY A;  1D8K A;  1BI3 A;  2V6C A;  3H3U A;  4LFU A;  4IJA A;  3FX3 A;  3KFW X;  4I02 A;  3AAF A;  1ZG3 A;  5FFX A;  5FO5 A;  4GCV A;  3TDZ C;  4G7O F;  1EH7 A;  1DP7 P;  4HX8 A;  1TNS A;  5E8G A;  1D3Y A;  4LG0 A;  4M9X A;  1UCR A;  1ZGA A;  4ENJ A;  1FWZ A;  4CIC A;  2FBH A;  4GYG A;  1HKT A;  1NHA A;  1S29 A;  1G4D A;  1IN5 A;  3V4G A;  1OR7 A;  1R1U A;  4IRH A;  1WSU A;  4HBL A;  3U9G A;  2A68 F;  3K2Z A;  2AXL A;  3ZQ7 A;  4P9F A;  2A69 F;  2X4H A;  3M1E A;  1IRG A;  2HKO A;  2GXB A;  1IAW A;  2YU3 A;  2DW4 A;  4KFC A;  1AOY A;  3ZN0 A;  2P5K A;  2CWE A;  4LK1 F;  1DUX C;  4L9V A;  3CO7 C;  2XAF A;  4H0E A;  2PFB A;  1Z6R A;  3I71 A;  5BMZ A;  4ENN A;  2HDC A;  2O8X A;  2M1B A;  1UHW A;  2VT3 A;  4AVP A;  1W5S A;  2KJC A;  3LA2 A;  3TO7 A;  5K5Q A;  3CUQ A;  3N4M A;  4PDK A;  3CTA A;  3F8B A;  3KZY A;  4XSZ F;  3IRQ A;  1SMY F;  3J80 K;  3FWE A;  4G6D A;  1X3U A;  2HOE A;  2ETH A;  2DPD A;  3E3V A;  3ZP5 A;  1Q1H A;  2L02 A;  2R7F A;  1YLF A;  2G9W A;  2EV5 A;  2FNP A;  5CVU A;  2AS5 F;  4CGZ A;  1XGO A;  4HV6 A;  2QM3 A;  4PGH A;  3G73 A;  1FYM A;  4MTE A;  4OIO F;  2P7C B;  3OV8 A;  4I0B A;  4XLN F;  4G9Y A;  4LGW A;  3WTT C;  2VN2 A;  4ASN A;  1FPQ A;  5BPD A;  2GWR A;  2K7L A;  2CFX A;  3P9C A;  4KIG A;  5D6E A;  3ZMV A;  4XRF A;  2XKO A;  4KN7 X;  3KP6 A;  2VON A;  5H6R A;  2GZW A;  1ZGJ A;  2VBY A;  2W57 A;  4RB1 A;  3K1P A;  2ZJ2 A;  2F5F A;  1VTN C;  1KYZ A;  4LK0 F;  4YFN F;  4UXN A;  1YS6 A;  3HUG A;  2XAJ A;  1HST A;  4ON0 A;  2JPC A;  5ILU A;  2QQ9 A;  3ML6 A;  1STZ A;  1GHC A;  4YFK F;  2FSW A;  1KYW A;  2CO5 A;  1OKR A;  1U78 A;  1ZRD A;  3IWZ A;  3BY6 A;  4OMY A;  3R6S A;  2VBW A;  1G3S A;  3GEZ A;  1TTY A;  1QQI A;  4RAZ A;  2G7U A;  4I0A A;  5LHI A;  5DDG A;  2DK8 A;  1U8R A;  1I6X A;  3I59 B;  4HF0 A;  2V1D A;  2P6T A;  1Z1D A;  2FU4 A;  3MQ0 A;  1KU3 A;  1FSH A;  1T98 A;  1FP1 D;  3LA7 A;  1D5V A;  4LLG F;  2HYG D;  1BI1 A;  2QZ8 A;  1P6R A;  5K5O A;  1IF1 A;  4EM0 B;  3I54 A;  1XGS A;  2BYV E;  5H20 A;  2NNN A;  3REO A;  2BBY A;  2O03 A;  3LWF A;  4ZZL A;  1W7P B;  2OD5 A;  3VEP A;  3H92 A;  2QBY B;  1I5Z A;  3IKT A;  1Z05 A;  1TW2 A;  1K78 B;  4O6J A;  5DD4 A;  1FZP B;  3ABU A;  5CVV A;  3SHF A;  2XRO A;  2JSC A;  4NHJ A;  3BJ6 A;  4F7Z A;  1L0O C;  4EGY A;  4HYE A;  1MJA A;  4HDV A;  4MEX F;  3I64 A;  2ZO4 A;  2D2W A;  4ESJ A;  1DPU A;  4A6E A;  1YW9 A;  1ZHF A;  3M8F A;  1J75 A;  3V8K A;  1IZ1 A;  3D0S A;  3TQN A;  4OMZ A;  3GUD A;  1ZAO A;  2M45 A;  1KU7 A;  1HW2 A;  4KN4 X;  3VOE A;  3SZT A;  2JTV A;  1ZRE A;  3LAP A;  3GYH X;  2IRF G;  2K4B A;  4Q47 A;  2DAO A;  3CUO A;  2EB7 A;  3MZY A;  1YW7 A;  5AON A;  3MWM A;  2P5V A;  2Q0O A;  2ZBK A;  3W6J B;  2V1X A;  3IWF A;  2RQP A;  2VBX A;  5FFZ A;  5F1R A;  1HW5 A;  4UVC A;  1XSV A;  1U5T C;  3F8F A;  4MQV A;  3K1N A;  2VOP A;  5E1X A;  1MJ9 A; 
#chains in the Genus database with same CATH topology
 3S15 J;  5DUI A;  3JRB A;  2AXT C;  3PL8 A;  2VQC A;  2V79 A;  3DEW A;  1X19 A;  2RV8 A;  2Z33 A;  5E17 F;  4BXF A;  3OWT A;  1HKQ A;  1ZRC A;  1RZ4 A;  3RJP A;  3WOD F;  4KNY A;  3ASO H;  3AL0 B;  4PCQ A;  3C7J A;  1A6Q A;  4DYR A;  2RAE A;  1RIO H;  4UUV A;  4FE4 A;  2DT5 A;  3TGN A;  1LKX A;  1YQA A;  1IRX A;  1ITY A;  4LD5 A;  2CV2 A;  3WTW C;  3JRF A;  3U1K A;  3C18 A;  3I53 A;  1MBK A;  3BJO A;  4KIF A;  2LK2 A;  4Q5S F;  2ADU A;  4PSX A;  2FF4 A;  4G6T B;  1WH5 A;  2FE3 A;  1UAA A;  5D8L B;  2E35 A;  3FXK A;  3JAM Z;  3ZGK A;  2OCC H;  4NC6 A;  4A12 A;  4A3E J;  2DMT A;  1R49 A;  5GTI C;  5ICE A;  2VB6 A;  4BHC A;  2OPT A;  1J59 A;  4AIJ A;  5FLX Z;  1L3L A;  4XKB A;  4BKX A;  2KZG A;  4ZYE A;  4HX4 A;  4I01 A;  2D5V A;  1SVL A;  1ETW A;  4IQJ A;  1TWC J;  1ETO A;  2HTS A;  3OYF A;  4ZJZ A;  4R79 A;  3KZI C;  2E7W A;  4GXO A;  3TOB A;  4HNU A;  1WI9 A;  1WGX A;  2M8E A;  2ZC2 A;  1F43 A;  1X3Z B;  2HI3 A;  3FKI J;  3H9Q A;  4O3M A;  4XSX F;  3K4B A;  1ETY A;  2R7D A;  2EFN A;  2IVM A;  3CME I;  1UG0 A;  1FMV A;  5M3F J;  1YX5 A;  4IKF A;  3SDB A;  1XD7 A;  3DCF A;  1JHH A;  4EV0 A;  2YX7 A;  1SAN A;  4ZDO A;  4WF2 A;  2O8K A;  2CYY A;  1IDY A;  3DTK A;  1T8I A;  2P6S A;  5F64 A;  4RGS A;  4F91 B;  3ZQQ A;  3VYT B;  4BQA A;  4MIM A;  3Q5F A;  4BDY A;  2QKM B;  1FOX A;  1U3E M;  1ETV A;  3DV8 A;  4YG2 F;  4B43 A;  3L2C A;  1MDM B;  4NC7 A;  1W7P D;  2XF7 A;  1LDD A;  3WE2 A;  4UVB A;  1FT9 A;  5LHH A;  3A03 A;  2W82 A;  1XCB A;  2KRH A;  2HQA A;  3VDX A;  4FT8 A;  5BS6 A;  3TOA A;  4EJV A;  1IRF A;  5FGM A;  3TO6 A;  3OS2 A;  2K27 A;  3K7A J;  1QO0 D;  4BYY A;  4NDL A;  3BLY A;  1GT0 C;  3CMA I;  2K9Q A;  1Z7U A;  2DFE A;  3WGG A;  1VQK I;  3WU0 A;  2X0L A;  3D5L A;  4C30 A;  2FNA A;  3J81 Z;  2EK5 A;  1WRJ A;  4UV8 A;  2LF8 A;  1JKQ C;  3FXR A;  2ZCW A;  4V2F A;  4A6D A;  3QYB A;  5FKN A;  4OIN F;  2QQA A;  2MGQ A;  4I76 A;  3V8J A;  4BBS J;  2F6C A;  1D1C A;  4GDF A;  5IP6 A;  3OR1 C;  4I6Z A;  4GGG A;  5ILV A;  2WAQ N;  4RGR A;  4AID A;  4ZC3 A;  4K2E A;  5CVI A;  2OAZ A;  2DQR A;  2NOG A;  3DPT A;  2EJR A;  4A3I J;  2IT0 A;  2DJI A;  3SYT A;  2P5L C;  5EEG A;  5HDN A;  3Q3S A;  1B72 B;  3IKV A;  1XC5 A;  5ICC A;  4CCO A;  3TED A;  1TNT A;  1S72 I;  3D5S C;  2MG4 A;  3L1P A;  3RCO A;  1GXP A;  1P7I A;  2FD5 A;  3KLO A;  3ELK A;  3TP0 A;  3WGH A;  2JA5 J;  3M7G A;  5D8K B;  3G1L A;  3W2W A;  2HZD A;  2A05 A;  3QPH A;  1JT0 A;  4OIP F;  3EYI A;  3BR2 A;  4LG0 B;  2DFH A;  3PSI A;  5CQE A;  1C0W A;  3KP5 A;  2NXN B;  4S04 A;  3ZRG A;  2LLK A;  2K4J A;  3QP5 A;  2PBI A;  3OYD A;  1JE8 A;  1TP4 A;  4N9I A;  3JSP A;  3FHZ A;  1K4T A;  1IXS B;  3S2H J;  1HXD A;  1MZB A;  3Q9V A;  5F0F A;  2VIX A;  1QHG A;  3BQZ A;  3PFY A;  1BIB A;  2G7H A;  4ITV A;  1REP C;  1V5F A;  3EUA A;  1W0T A;  4HG2 A;  3HDD A;  5A2Q Z;  4MTD A;  2MLG A;  4L0Z B;  1GV2 A;  4M73 A;  2FBK A;  2EPF A;  2CV0 A;  2DA7 A;  5FRM A;  3RZO J;  4XKC A;  4I7H A;  2EV6 A;  3EDP A;  4MEY F;  1V4R A;  2QEX I;  2ELK A;  2WBM A;  2EFO A;  3RPQ A;  2XHK A;  4IEJ A;  4M74 A;  5D5W B;  1MND A;  3GME A;  4G6Q A;  4AIH A;  1V5E A;  5EG0 B;  3CP2 A;  4KT5 C;  1BBY A;  3HSF A;  2OQG A;  2F5D A;  1FX7 A;  3C2G A;  3M8E A;  4A5M A;  5KCM A;  1YI2 I;  3J7A Y;  4BEH B;  1FNN A;  4UY8 I;  1RKT A;  3ERE D;  1O3R A;  3FHN A;  1BN5 A;  3FF5 A;  2Q8K A;  2YU9 J;  5CVJ A;  3D5R C;  4QLC U;  3WHB A;  3HTS B;  1UG2 A;  2NNY A;  4BGD A;  4FQG A;  2R92 J;  1WJ5 A;  4XRS G;  4M71 A;  3R61 A;  2VQG A;  1U6G A;  3H9G A;  3WTY C;  4U0W A;  1G3W A;  1XTA A;  1DQU A;  1YOV B;  3JW4 A;  2IXS A;  4ZTF A;  5E20 A;  1Y39 A;  4IF4 A;  2PX9 A;  2M7A A;  2VJJ A;  2AQF A;  4XBF A;  2L4M A;  3E6M A;  4IHS A;  1R00 A;  1DPR A;  4CHU A;  2EA4 A;  4IRI A;  4XLA A;  1FYK A;  3CUQ B;  3LSG A;  1MMG A;  1MSE C;  1UST A;  2QGU A;  4BJ5 C;  4OAZ A;  4XR6 A;  4RM3 A;  1IUF A;  1XDU A;  2F5E A;  2W24 A;  3A2K A;  3KEY A;  1LVK A;  1AA7 A;  2KHM A;  5J40 A;  1HBX G;  3DXJ F;  3PIO F;  4HDU A;  1MBH A;  1KZH A;  4LB5 A;  3IL2 A;  1FOK A;  3G6E I;  4QIW N;  5FB2 A;  1UEL B;  2Y0S N;  4LG3 A;  4M3G A;  4M9S A;  4OIR F;  2LKX A;  2D1V A;  1YJW I;  3F21 A;  1VQ9 I;  2LC2 A;  4RGX A;  4ESF A;  1RRJ A;  2EZH A;  3PFI A;  2GA1 A;  3KP4 A;  3SXY A;  1YTY A;  1QZY A;  3I4P A;  3GTQ J;  2DA5 A;  3HC7 A;  2IGO A;  2K02 A;  1FOW A;  4J00 A;  3ABK H;  3K4C A;  4A3C J;  5J1Y A;  4U7D A;  2DYS H;  1NG7 A;  1PUF A;  2PG4 A;  1VFC A;  1QRY A;  2FOK A;  3Q0U A;  1FY7 A;  3A1Y A;  5HLG A;  4NQW A;  1XPX A;  2A6E F;  1KGS A;  2CQQ A;  2J5O A;  2W84 A;  2YSR A;  4GYI A;  2STT A;  2YX4 A;  3OOP A;  5IT9 K;  4MNU A;  1M1E B;  1RUN A;  1FOY A;  4KUM A;  2K40 A;  3EET A;  2QA4 I;  3CCY A;  3NEU A;  4RAY A;  2R7V A;  5LFA A;  2VQH A;  2X85 A;  4C2T A;  2XPW A;  3DPL C;  4Y3O A;  1D1B A;  2HQR A;  2LP0 A;  4GO1 A;  1JGS A;  2KIQ A;  3GVA A;  1R71 A;  2IS6 A;  4OIQ F;  1PP7 U;  1X3W B;  3IRR A;  3CJQ B;  2P8T A;  1S8N A;  4Q4Z F;  1ZLJ A;  4XN0 A;  3LNQ A;  1R1T A;  3OYK A;  3B02 A;  2RKH A;  2ZNY A;  2A5W A;  1OYI A;  3HOU J;  3HUG B;  1RC9 A;  5M3M J;  2MH9 A;  5LRS A;  1TZL A;  1ZN2 A;  2HTJ A;  4WX9 A;  3LA3 A;  1HDP A;  1SD4 A;  5GAE J;  1JUP A;  4L18 B;  3WTZ A;  1PJR A;  5J1R A;  2JQ7 A;  3BG9 A;  1ZR2 A;  4DQ2 A;  3IH3 A;  1WKM A;  5EEH A;  3P9I A;  3WG7 H;  4P9U A;  3JRE A;  2KPM A;  5EF6 A;  4BY7 J;  3JSO A;  3A01 B;  3O6B B;  4XM3 A;  1YE9 A;  3BPV A;  1J9I A;  2PJR B;  1DGW Y;  2E1C A;  2JT1 A;  4LJZ F;  4BH9 A;  3MKZ A;  2NVX J;  1IXC A;  4XON A;  3S1N J;  3BPX A;  1N78 A;  2ZFU A;  3NRV A;  2DMN A;  5E79 C;  3AG3 H;  3L09 A;  4HQE A;  1T33 A;  2HOS A;  2E5Z A;  2X1E A;  3DQV C;  1J09 A;  1WJA A;  3K2A A;  4B8X A;  4CCM A;  3U1D A;  3SDG A;  2CRG A;  2MC3 A;  3DLA A;  3GTL J;  4RGU A;  3FIS A;  2GXG A;  2P0W A;  1XMA A;  3NWS A;  3RKQ A;  2Y0M A;  1LE8 B;  4EVI A;  1F9N A;  3W6V A;  1J7K A;  2QLZ A;  1P2F A;  2BXZ A;  4XN3 A;  3K1M A;  2DFF A;  3HRM A;  2V9V A;  2JK3 A;  4EGZ A;  2ZXJ A;  5F27 A;  2VLA A;  2RRE A;  1N77 A;  1ZGW A;  2E71 A;  5L3B A;  2KRF A;  2CFO A;  1I39 A;  1P7J A;  4IQ4 A;  3PNV A;  2G0E A;  3DU6 A;  2VKH A;  2XV4 S;  4J01 A;  3RQ4 A;  2H94 A;  4A3B J;  1K83 J;  4RLF A;  2DDB A;  1MKM A;  3E5Q A;  2UWM A;  2GXA A;  1BOB A;  3P7N A;  1F1Z A;  2F5C A;  3I4M J;  3HRS A;  3RPU A;  3GWZ A;  2OV7 A;  4BAY A;  2FXA A;  1IG7 A;  2XRN A;  3MAJ A;  2M7B A;  4OWR B;  3OYJ A;  2BW3 A;  3E0J B;  3BZK A;  3CC2 I;  3WG9 A;  5JHF A;  1EH6 A;  1TT0 A;  2PQ8 A;  5B1B H;  3IAS 2;  1HCR A;  3HG9 A;  2K9M A;  2VKE A;  1EF4 A;  1RR7 A;  2OCE A;  2DN0 A;  3RYR A;  1Y0U A;  3VB2 A;  2DBB A;  2OTL I;  2JWT A;  5J8C A;  1IV8 A;  2M9H A;  2W7N A;  1TQP A;  2A07 F;  3CJN A;  3NAU A;  1OYY A;  2LSO A;  2O9L A;  1BI2 A;  3JRD A;  2DT6 A;  3BTL A;  3HM5 A;  2K9N A;  1FBU A;  3HOY J;  2V9P A;  1H89 C;  4JX6 A;  3QYE A;  1ETX A;  2B9S A;  4E7S A;  1S5L C;  2HPM A;  5ERI A;  4BXU A;  1TLH B;  5C44 J;  3O2P E;  1K6O A;  2COM A;  1WQ2 A;  5L3F A;  2ICW G;  1B9N A;  3K0L A;  3LMM A;  5H6Q A;  4IHT A;  4HNV A;  5DM6 F;  4D7N A;  5HVQ C;  1MD0 A;  4I09 A;  4U0V A;  3FMS A;  2R5Z B;  1PUE E;  4BE1 A;  4IVN A;  1Y0N A;  1XMX A;  2KMU A;  3KIO A;  1T38 A;  1IN4 A;  1XMK A;  4P1W A;  3BR6 A;  3PUB A;  2FBI A;  1MBG A;  4CUG A;  4XL9 A;  3ZN1 A;  1BL0 A;  2LNB A;  1E17 A;  3V8L A;  4BXX J;  5KVR A;  1R58 A;  2R7U A;  1OPC A;  1F36 A;  2BEO A;  5CQG A;  2AHQ A;  2JVH A;  1ZAR A;  1IUY A;  3FXU A;  3JCU C;  3WU1 B;  3I58 A;  3F8M A;  2XAG A;  1Z67 A;  1WFX A;  1V3F A;  3DPU A;  4EM2 A;  3C2B A;  1K7A A;  3PQK A;  5IYB J;  4RB2 C;  1P9Q C;  1NH3 A;  2JPB A;  2DYR H;  3G4S I;  4N9H A;  2O0Y A;  3HL2 A;  4FET A;  4N4O B;  4JQF A;  3OSF A;  5FRN A;  1J2X A;  2IGK A;  2CSO A;  5D6F A;  2V4J C;  5KK1 A;  3BZC A;  2IA0 A;  1IN8 A;  1BC7 C;  1CF7 A;  3OS0 A;  4M3F A;  1LDK B;  4EQQ A;  1FC3 A;  2JMW A;  4MHG A;  3C2H A;  1Z91 A;  2R5Y A;  2L9R A;  4A5N A;  2IW5 A;  1O7L A;  4A2U A;  1VQL I;  3S1R J;  1Y1V J;  3H1C A;  3SEZ A;  1R23 A;  3DP7 A;  1R22 A;  1QNT A;  2FMY A;  2L3D A;  3RDI A;  4IPA A;  1S7A A;  1PP8 F;  1YIT I;  3FBN B;  1KA8 A;  1R1V A;  1E2X A;  3N97 A;  1OCZ H;  1FMW A;  1G3T A;  2VAS A;  2D45 A;  2M87 A;  2XVC A;  2HWV A;  4BJT A;  2VPR A;  2L01 A;  3GFM A;  2RGV A;  1GDT A;  2IBD A;  4ZTJ A;  1RES A;  5HLH A;  3BZ6 A;  2O6G E;  2EA2 A;  4QPO A;  4PJL A;  4LIU A;  5JHU A;  2OJE D;  3DLL F;  2NOJ B;  2O3F A;  4W97 A;  2DMU A;  3BOQ A;  3QU3 A;  1X2M A;  3VYR B;  3A4C A;  4YRV A;  2CQN A;  2H8W A;  5L3C A;  4RB3 C;  4R8H A;  4F3Q A;  3RIR A;  4OOI A;  3S32 A;  3DTE A;  3RTR A;  4LLN A;  4O5V A;  1D0X A;  2PMZ N;  2X1D A;  3ULQ B;  4PK4 A;  2KJB A;  3ZXS A;  5GAG J;  1WPK A;  1ZLK A;  2QWW A;  2KDO A;  2P81 A;  1WJC A;  2EZL A;  3M07 A;  2X9D A;  1ZKG A;  4JP0 A;  4M3B A;  4C3J J;  3T8R A;  2O5R A;  4U88 A;  2M4K A;  2ZNZ A;  3EUH C;  4L5J A;  4Y17 A;  1IN7 A;  5LEK A;  1J0R A;  2ZFW A;  5K1Y A;  2OC6 A;  3T1B A;  5JR3 A;  4Y52 J;  2ESH A;  4CO8 A;  2QSH X;  1IC8 A;  1KU9 A;  1FEX A;  2KIU A;  2DU9 A;  1A36 A;  1E3H A;  2HVQ A;  4RMN A;  1XX5 A;  2DO7 A;  3KP3 A;  4XRM A;  4ZYD A;  2L54 A;  2JSP A;  1OMI A;  3HGG A;  3TP3 A;  1AKH A;  2MD5 A;  5CKT A;  4L9T A;  1B59 A;  2QSF X;  3DBH B;  3OIQ A;  5TJJ A;  5K5R A;  2EFQ A;  4F52 A;  2M4G A;  4MGR A;  5E8I A;  2E2J J;  1OR7 C;  4UV9 A;  2E5N A;  1VQ5 I;  2W00 A;  1H8A C;  3BR1 A;  5BQT A;  5LHG A;  1S7E A;  2O7O A;  4LB6 B;  4FHT A;  1XSD A;  3FMQ A;  3SZG A;  2L7K A;  3ZQF A;  2Y48 A;  2XUB A;  2CJJ A;  2DTR A;  1LUJ B;  2MFZ A;  3GFL A;  3LL7 A;  2BY2 A;  2ZJR F;  2K5C A;  3CCS I;  2R7Q A;  4EJT A;  1KQ9 A;  3ZMT A;  2M30 A;  2DQL A;  5FLV A;  3HPG A;  3HEF A;  3L00 A;  2GIZ A;  2DMQ A;  5B3S H;  2VPL A;  1T39 A;  3CCE I;  1B6A A;  3K4L A;  9ANT A;  1T0F C;  3AFH A;  4N4N B;  1RR8 C;  4NUB A;  2HU9 A;  3SQN A;  3W2V A;  2JVG A;  3A0B C;  3WHC A;  2GQQ A;  1BC8 C;  2Y30 A;  3L9F A;  3IH4 A;  3M1C A;  3LOC A;  5DD8 A;  3M8J A;  1LFU P;  5CYV A;  1VQ4 I;  2OA4 A;  3OMY A;  3GFJ A;  1YYV A;  3CLQ A;  4IXA A;  2CH0 A;  4GFB A;  1ZRF A;  3CCU I;  1X58 A;  2XSJ C;  3CP8 A;  2RVC A;  1B1B A;  1LEB A;  3OSG A;  1GV5 A;  1TQM A;  3KP2 A;  3F8C A;  1LFP A;  1FBQ A;  3LQR A;  3PUF A;  4A3L J;  2EIM H;  3HRT A;  2X6W A;  4E70 A;  3CCL I;  3OYH A;  1Y8Q B;  2X6Y A;  3SEQ A;  2BGC A;  1QU3 A;  2QF7 A;  4ESB A;  1VQ7 I;  3L2V A;  5LGN A;  3ZR8 X;  4F92 B;  2F48 A;  2ID3 A;  5IYC J;  4HAM A;  1O57 A;  4XNF A;  1XGN A;  1IN6 A;  3KEO A;  1WZ2 A;  2EFP A;  2VOD A;  1SD6 A;  1X1C A;  2HYF A;  2WV0 A;  5D5U B;  4HX7 A;  2UXX A;  3FM3 A;  4BQQ A;  4A0X A;  1BIA A;  2IPQ X;  2K9L A;  4QWQ A;  3WTX C;  3MZH A;  3J7A O;  2ZME A;  1YS7 A;  4Y15 A;  1X1A A;  1JTX A;  4BL0 B;  3V7S A;  4PZJ A;  1UZC A;  1UHM A;  4CZZ A;  1Z3X A;  2PMZ A;  4Y7N J;  2WAD A;  3F72 A;  4C2M J;  5BOX A;  2MLK A;  1BA5 A;  2CUF A;  2ZJP F;  3DBR B;  2PMU A;  3TKY A;  4PJM A;  1I6H J;  1MBE A;  3KCC A;  3GF2 A;  1BOA A;  2LTP A;  1FJL A;  1EKE A;  3KYC B;  1BJZ A;  4FE7 A;  3HBL A;  1WVR A;  3LSP A;  1VQ8 I;  1ZH5 A;  1D0Y A;  2Y9Y A;  1HLV A;  3WGI A;  3B6A A;  3J80 Z;  4E7H A;  3BJA A;  3IHU A;  2BZT A;  2HEO A;  2VXZ A;  3GW2 A;  4MO7 A;  1V5G A;  4G7Z F;  1DGR M;  1GXQ A;  3LQQ A;  1YHQ I;  3S2D J;  1OCT C;  3DEU A;  3I5U A;  3BR3 A;  1AU7 A;  1ON1 A;  2DI3 A;  2W25 A;  5AIP A;  1QBJ A;  3WTU C;  2L9S A;  1O7F A;  1JXS A;  1E3O C;  3R0A A;  5DS9 A;  4CYC A;  3K70 D;  3R0J A;  2L7M P;  3E7L A;  2L4A A;  3W6K B;  5IYD J;  3CLO A;  5KAI C;  1JHF A;  1OCP A;  2FEZ A;  4IRG A;  4PGG A;  3TDU C;  1KQ8 A;  1A04 A;  3DKY A;  3F0C A;  2V9K A;  3JRI A;  4YIR X;  2LBF A;  5LRR A;  4RDU A;  4P55 A;  2R7R A;  5FKM A;  1CGP A;  3DFG A;  2J5P A;  5GAD J;  4AWX B;  4S05 A;  2E1N A;  1X1P A;  3F6O A;  3KLN A;  2HDD A;  2COB A;  2LDU A;  3ZQG A;  1QVU A;  4J19 A;  3FXL A;  2LF7 A;  4YIF A;  3P5J A;  4KDP A;  2JA7 J;  5IT3 A;  4UVA A;  2HQN A;  5IPA A;  1ZG5 A;  1WH7 A;  4JOM A;  5F08 A;  4AIK A;  3PO2 J;  4M72 A;  3HZJ A;  4UHT A;  1S7O A;  2BY1 A;  4DZJ A;  2FML A;  5EYR A;  4HF1 A;  4L0Y B;  2OBP A;  2XAQ A;  2CUZ A;  5EZH A;  2VJ4 A;  2Z3Y A;  3JAM K;  2CG4 A;  3DKW A;  2IGM A;  1Y56 A;  4BU2 A;  1U5T A;  3G2B A;  4Y13 A;  3E97 A;  3T8T A;  5IOZ A;  4L9N A;  4ETS A;  4DJA A;  1BR2 A;  1BW5 A;  2VUM J;  5JVT A;  3PNY A;  5FLX K;  2CQX A;  5J4Y A;  4RA2 A;  3JTG A;  1ON2 A;  4RB0 A;  3EUH A;  5DCM A;  1JI8 A;  3K4M A;  1UB9 A;  1MMA A;  4WXC A;  3CCV I;  2RNJ A;  5D5X B;  3FM5 A;  3O3K A;  3U2R A;  1SMT A;  3DF8 A;  1BM9 A;  2OQR A;  1I27 A;  4KYW A;  5LD2 C;  3BG3 A;  2I8D A;  1YO5 C;  3PO3 J;  2QYO A;  2LD5 A;  4AU7 A;  3VOD A;  3T0Y A;  1I3A A;  4YII A;  4LIV A;  3ZMZ A;  2LFB A;  3VFZ A;  3S17 J;  4IHY A;  4EM1 A;  1ZK8 A;  4WXD A;  4YFX F;  1WCM J;  2OZU A;  5LGT A;  3OYA A;  4JK1 X;  2IJL A;  2IP2 A;  3HTU A;  4XLP F;  2RC4 A;  3HYI A;  2P7V B;  1R36 A;  1P4A A;  3WU2 C;  1FBS A;  3G3Z A;  4I2O A;  3FIW A;  4B09 A;  5K7F A;  4BUP A;  2E1M C;  4M6Y A;  4XOP A;  1Y1W J;  5DCF A;  4YEJ A;  2DFI A;  1MGT A;  1I50 J;  2LG4 A;  2Q1Z B;  3RKY A;  2MA3 A;  3S3N A;  3UKG A;  5DEQ A;  4P5O A;  4MQ9 F;  4V2G A;  1PUF B;  2EV0 A;  1LEA A;  1JUM A;  3EQL F;  4JX4 A;  4NQW B;  5CJ9 A;  2HR3 A;  2E60 A;  3H0G J;  2YR2 A;  3NQO A;  1YJN I;  1T0F A;  2X6X A;  2WAQ A;  2BVL A;  4XOR A;  2B7E A;  1H9G A;  1QZE A;  5L3D A;  4WCG A;  3ECO A;  3KPH A;  3F8N A;  1O3Q A;  4YEL A;  3GLL A;  1OCO H;  4P96 A;  5DV5 A;  2GOX B;  4IHW A;  2R7X A;  5DUK A;  2KIS A;  4UB8 C;  5D4R A;  3CDH A;  4HW0 A;  4XLH A;  5GTH C;  3BWG A;  3KEQ A;  2XKP A;  3IAM 2;  2LRD A;  2UZK A;  3BTC A;  3GZ6 A;  1SFX A;  1BI0 A;  1ETQ A;  4UNO A;  4EMS A;  2L5Q A;  4CXF A;  2Y31 A;  1QA6 A;  2ISZ A;  1T95 A;  3J81 K;  4KMU X;  4WXH A;  1YX3 A;  2HS5 A;  1TWG J;  4BY1 J;  1NK2 P;  2QQB A;  2KIM A;  2VI6 A;  2FUG 2;  5LBQ A;  2BOL A;  1VQM I;  4R1H A;  1GVJ A;  4ZYG A;  4HLY A;  1O3S A;  2E19 A;  2ME6 A;  1TQI A;  4DYQ A;  4KJZ A;  3PNT A;  1D8J A;  2E7X A;  1LJ9 A;  1S6L A;  2L7Z A;  1PYV A;  1ULY A;  1X4P A;  2JUG A;  2WC2 A;  4EAT A;  3QPT A;  5KNL A;  1LQ1 A;  3KET A;  5IP9 J;  3T5X A;  1SFE A;  3FBI B;  3K69 A;  5B5E C;  2CMP A;  1MMN A;  5D5V B;  2KKO A;  3ZMD A;  4AD9 A;  3AKZ A;  2CQK A;  2YPR A;  2JA8 J;  4ZDL A;  4B47 A;  3OY9 A;  3OYB A;  2D1H A;  3COA C;  3OL4 A;  3RZD J;  4HLX A;  2K3P A;  1WHU A;  2ISY A;  3G1M A;  1YRN A;  1BW6 A;  4TV7 A;  1JT6 A;  2DMP A;  4C9Y A;  2VE8 A;  4BE2 A;  3FK6 A;  3MEX A;  5J8F A;  5ICF A;  2PN6 A;  2ELJ A;  1EA3 A;  2NYX A;  3H3Z A;  1RET A;  4HV5 A;  4XIC A;  3OYM A;  4FX0 A;  2QVO A;  2Z5U A;  3JTH A;  5HS8 A;  3WTS C;  2JRM A;  4JYK A;  2OTJ I;  4CYD A;  2AQE A;  1IV6 A;  4HOB A;  2F2E A;  2EFW A;  2ELH A;  4D9J A;  3K70 C;  3SJM A;  5DYM A;  2BE5 F;  3LSH A;  1W0U A;  1SAX A;  2XB5 A;  4M6V A;  1ERD A;  1OFC X;  5CLS A;  3S3M A;  4E7Z A;  4B1R A;  1YJ9 I;  3LSI A;  4AYB N;  3IC7 A;  3S16 J;  3ZMU A;  2HOT A;  4QPQ A;  1ZEL A;  1MMS A;  4X6A J;  3BRO A;  2RN7 A;  3KX2 A;  2BV6 A;  5A2Q K;  3LSR A;  4A3M J;  2EZI A;  1TWF J;  4A0Y A;  3HOX J;  3QU6 A;  4MFE A;  1OCR H;  4ZH4 F;  4E6K G;  5IP7 J;  3CCJ I;  2H27 A;  2PEX A;  3LFK A;  3L2Q A;  1O3T A;  5IOY A;  2FA5 A;  2R7S A;  2NVT J;  1J5Y A;  2B0L A;  2BW3 B;  3BCA A;  2XSD C;  2HFH A;  1HDD C;  3CES A;  5J6X A;  4UUS A;  4KIB A;  2IAI A;  1SFU A;  2RDP A;  4ENK A;  1D0Z A;  2LVS A;  2OU2 A;  2HYJ A;  2E34 A;  5K7H A;  5F04 A;  2KIF A;  4BBR J;  2Y0S A;  2GAU A;  4CCN A;  4ENM A;  4U7B A;  1XCV A;  4HF2 A;  4XLC A;  3K9T A;  3G71 I;  2VC0 A;  4L5I A;  1VQP I;  2CW0 F;  2RQQ A;  4JBA A;  3MFK A;  4RBO A;  4BDZ A;  5JI6 A;  3H9J A;  3VSK A;  2I10 A;  2H6C A;  2Y75 A;  4CCJ A;  5J4V A;  3ISP A;  3GZ5 A;  4D7M A;  3HRU A;  2XB0 X;  2K3F A;  4PSW A;  4XID A;  2R3S A;  2TRT A;  3E5U A;  5IY5 H;  2X6O A;  3IH2 A;  3MZ8 A;  2XGE A;  2E2H J;  1MJB A;  4AM3 A;  1Z7L A;  1JJ6 C;  1U2W A;  3HHG A;  1MNE A;  1W1W E;  5EGO A;  2WAF A;  5HNF A;  3AL0 C;  2ZB9 A;  4HSR A;  2MW8 A;  4XKW A;  4DYC A;  5BNG A;  3Q9S A;  4F93 B;  2A5Y B;  2FQ3 A;  1LB2 A;  5BPI A;  2MH2 A;  2M3A A;  4OU0 A;  2DDA A;  3TBI A;  1I1S A;  3QRF F;  1U0J A;  1SD7 A;  1PVE A;  1RNL A;  3K4K A;  3RKW A;  2E2I J;  2ZKZ A;  5HOO A;  3H35 A;  1SEU A;  1XB4 A;  3CCM I;  1S3J A;  1FIA A;  3HIF A;  4KMF A;  2VT2 A;  3HHH A;  3X2Q H;  5FKO A;  3V42 A;  3FXO A;  2PI0 A;  3I59 A;  2ESN A;  3M9A A;  5HS9 A;  4QTR A;  3UR3 C;  2MBF A;  2FRH A;  4DNC A;  2DLL A;  2F4I A;  2GA2 A;  2HOA A;  3IV5 A;  1BJA A;  3LST A;  1F4K A;  5D4S A;  1AWC A;  2DJN A;  3S1Q J;  1CF7 B;  1DDN A;  2R0Q C;  1IGN A;  1P4X A;  1ONV A;  3C1D A;  3E6C C;  2R5Y B;  1O4X A;  2PMH A;  1K79 A;  1EV7 A;  3DU5 A;  5FKL A;  3EUK L;  4G12 A;  5HDG A;  4CSW A;  2LY9 A;  4CZC A;  4LMY A;  1SC7 A;  4XRS A;  1QGP A;  3BDD A;  4EEF G;  1P92 A;  3CO6 C;  2V6E A;  3QWL A;  1RKW A;  1G6N A;  3JRA A;  3A02 A;  1MW7 A;  4I98 B;  1R5G A;  5E3N A;  1B4A A;  3SFZ A;  1W7P A;  3RYP A;  3E1S A;  4HZF A;  5HLT A;  1V54 H;  3HOS A;  2QBY A;  1FLI A;  4II3 A;  1IJW C;  1A31 A;  1E3P A;  5F0H A;  5FLM J;  1KU2 A;  4HPQ A;  3HOT A;  3BTJ A;  1HKS A;  2L0K A;  3ROU A;  3U21 A;  1K78 A;  1CQT A;  3HJE A;  5E3O A;  4M6X A;  2WWY A;  3GXO A;  4EJW A;  3GTO J;  1R7J A;  5TRD A;  3MKW B;  3BG7 A;  4KT6 A;  2XRL A;  5E1W A;  1I1G A;  3W2A A;  2EIK H;  1BR4 A;  1Z9C A;  3GTG J;  3JRG A;  1X1B A;  5J3L A;  2CU7 A;  1R5H A;  3QOD A;  4XQF A;  2O61 A;  2LKP A;  1H0M A;  2XAU A;  3HSR A;  1Q1V A;  2EIN H;  2W1O A;  3V7R A;  3KE2 A;  3ZQI A;  1W5C C;  3RSN A;  4DW6 A;  1ZQ3 P;  1MBF A;  2JUC A;  3SZP A;  3DEE A;  1OJL A;  3KYL A;  1Z6T A;  2UV1 A;  1FIP A;  3GCM A;  3Q0V A;  2IGN A;  2OZ6 A;  2XGX A;  1R4M B;  2BVM A;  2GIV A;  3OIO A;  2WTE A;  5E3L A;  2K86 A;  5ICG A;  1SFO J;  3WE3 A;  1TT5 B;  1U8B A;  1Y8R B;  2W85 A;  2DPU A;  3R60 A;  2DTZ A;  1GLN A;  2NRA C;  3GTP J;  4Y4R A;  3DKX A;  1RUO A;  3BP8 A;  1WJB A;  2IA1 A;  3H36 A;  1FP2 A;  5H2F C;  5GAH J;  2WAE A;  3F3X A;  1SAU A;  4WWC A;  2AO9 A;  4OAY A;  5HLI A;  3MD2 A;  2BHY A;  1AKH B;  1F5T A;  1ODD A;  3QP6 A;  3MCZ A;  1X2N A;  1JKR C;  2HGC A;  4HA8 A;  4A0Z A;  3DBL B;  1VQ6 I;  2EZK A;  2BHZ A;  2XAS A;  4RS8 A;  2XIG A;  3I9V 2;  2N8G A;  3S14 J;  4BNC A;  1MIJ A;  2EBI A;  1YIO A;  2LR8 A;  3JRC A;  3I3L A;  2Q2E A;  4LLL A;  3V7C A;  3K4J A;  1ZTR A;  2Y2Z A;  1LDJ A;  2DA3 A;  4ZYA A;  4WK8 F;  3CCR I;  1B8I A;  5JLX A;  4EJO A;  4IOA F;  5B1A H;  3DWL E;  4XLE A;  4RAF A;  1QPM A;  3E6B A;  3TMO A;  4Z2Y A;  2C6Y A;  3WTV C;  5AIQ A;  4DBQ A;  2WB1 N;  1QZZ A;  2UXN A;  2NVU B;  4Y33 A;  4XKV A;  2VJ5 A;  4ZYH A;  3JRH A;  1TC3 C;  2BXY A;  3RPU D;  4A93 J;  1XGM A;  5ILS A;  3GLX A;  5J1U A;  4BJ6 C;  5FKK A;  4HQM A;  2I5U A;  2DK5 A;  1T6S A;  1JJ8 C;  2CUE A;  4IHX A;  3QAH A;  3FXQ A;  1D1A A;  3HKZ N;  4CDG A;  2OUM A;  5FD5 A;  1IW7 F;  2HQ5 A;  4L9J A;  2RNG A;  5JFR A;  3LSK A;  3S8P A;  2GBY A;  4G8X A;  2NVY J;  3BG6 A;  2Z2S B;  3ZPL A;  3I55 I;  1ZG1 A;  1YG2 A;  2NAZ A;  3GO5 A;  1RI7 A;  3ZMS A;  3OYI A;  1OYW A;  2NS0 A;  3PQJ A;  3W3C A;  3F23 A;  1EH8 A;  1Y6I A;  1UJ8 A;  4FIS A;  2ZXW H;  2M8G X;  3FMR A;  1SD5 A;  2ZSI B;  4ZZD A;  4H4K C;  4E4H A;  1JUS A;  2XC7 A;  2QUF A;  2R7W A;  2DOA A;  3QYF A;  4W1U A;  2LY1 A;  2B63 J;  3ECH A;  3GX4 X;  2Z99 A;  1T56 A;  2XAH A;  5L3G A;  4A3F J;  1V55 H;  2KLO A;  3GZN B;  2R7T A;  3CC4 I;  1XDS A;  2ZME B;  1G59 A;  2HXI A;  2A61 A;  1N25 A;  2IEK A;  3E5X A;  2JJ7 A;  5CVR A;  4RLQ A;  4KIC A;  3O8G A;  1FYL A;  2QEN A;  4FX4 A;  4D0P A;  4AVZ A;  3FZV A;  1VZ0 A;  5HS7 A;  2Z1D A;  2M5W A;  3CUQ C;  3QOP A;  1R6R A;  2HZT A;  1PDN C;  1W4M A;  1E0E A;  4G94 A;  1MBJ A;  2QSG X;  3ASN H;  1ZYR F;  2H6B A;  4A3K J;  2A3S A;  2JZY A;  1WI3 A;  1XSX A;  2TDX A;  2VBZ A;  1JKO C;  5F6F A;  2STW A;  4RAG A;  3VWB A;  1TW3 A;  3OS1 A;  2M0C A;  3IUO A;  2JRT A;  2DA2 A;  1EJ9 A;  3C3W A;  5L3E A;  1HW1 A;  1WJD A;  4Q48 A;  2Y9Z A;  4KIS A;  1FSE A;  5HDK A;  3QOE A;  2EWN A;  2HKX A;  1Z21 A;  1KQ0 A;  3K4N A;  4II2 A;  2HVS A;  1Z0X A;  4M9Z A;  1XG1 A;  5FD6 A;  5LLQ A;  1XN7 A;  4PJ0 C;  1UFM A;  1AHD P;  1A6I A;  1LVA A;  2H8R A;  2V7F A;  1ETK A;  4N0B A;  1USS A;  2KQR A;  3KZZ A;  4DIQ A;  2UUZ A;  4FCY A;  3ZQL A;  2XGC A;  4CYC B;  1G2H A;  4NB5 A;  2NVQ J;  1T2K A;  1HQC A;  2CV1 A;  1HSJ A;  2CW7 A;  4IX7 A;  1GUU A;  2VE9 A;  3F6V A;  3GBG A;  4KIT B;  4KA4 A;  1IXR C;  2VOO A;  1T08 B;  3HSE A;  2VC1 A;  2LBF B;  3TO9 A;  3MVP A;  1Z77 A;  3HB9 A;  3HOZ J;  1WWX A;  2PLY A;  1W5T A;  4BHB A;  5LGU A;  5E1Z B;  3S2W A;  4HRI A;  4CA0 A;  2P4W A;  4B3X A;  1YFH A;  2CQ7 A;  2XF5 A;  4EJU A;  5ED4 A;  1RPW A;  1X4O A;  3OYG A;  4ABZ A;  3BR0 A;  1MDM A;  1R9T J;  3CDI A;  1HA8 A;  3CQZ J;  5E18 F;  3ZCO A;  2ECC A;  4U0Y A;  4DBR A;  3MKY B;  2WB1 A;  3LAJ A;  4A3G J;  3I0T A;  2IS4 A;  1TL8 A;  2V1U A;  5IT9 Z;  1DP3 A;  1P4W A;  2HVR A;  3E6D A;  3IP4 B;  3GFI A;  1QVT A;  4E7I A;  1NTC A;  5M5W J;  2CW8 A;  2MAB A;  3J7Y J;  2ZXH A;  4M3D A;  3S3O A;  2VJI A;  3HKZ A;  2PJP A;  5LEJ A;  1LNW A;  1YW8 A;  3AG1 H;  3R4K A;  5GP9 A;  1U5T B;  4G7H F;  2KRC A;  3RI4 A;  3RKX A;  3KP7 A;  1TBX A;  4MLO A;  2LOO A;  3Q0W A;  3J7Z I;  4BHP A;  2IA2 A;  1DU0 A;  3L7W A;  6PAX A;  2H09 A;  2JN6 A;  2FX0 A;  2XGD A;  3ABT A;  5DCM B;  5KHD A;  3NWT A;  3CC7 I;  3BR5 A;  1B9M A;  2CGP A;  3F22 A;  2IS2 A;  2ACJ A;  2Z9O A;  2KT0 A;  4PFP A;  2A6H F;  3CZ6 A;  2L9N A;  3L2U A;  3B73 A;  1H9T A;  3P9K A;  1G3Y A;  2DCE A;  3ONQ A;  5DTD A;  2WY8 Q;  3TW7 A;  3EYY A;  1D8K A;  3H3V K;  1Z3Y A;  1BI3 A;  2V6C A;  3H3U A;  3MKL A;  4IJA A;  4LFU A;  1A35 A;  3FX3 A;  3TL4 X;  3KFW X;  1B72 A;  4I02 A;  3AAF A;  1S9H A;  1ZG3 A;  4DOZ A;  5FFX A;  5FO5 A;  1BR1 A;  2FJ1 A;  4GCV A;  3TDZ C;  2W4S A;  4G7O F;  1EH7 A;  2E36 A;  3FDY A;  2YS9 A;  4XMY A;  1NG6 A;  1DP7 P;  4A3J J;  3GTJ J;  2X1C A;  3FK7 A;  4HX8 A;  2EQR A;  1TNS A;  5E8G A;  5EDN A;  4S0H B;  1D3Y A;  1VND A;  4LG0 A;  4M9X A;  1UCR A;  3SFI A;  1ZGA A;  2NS8 A;  2ZXI A;  1OCC H;  4IOC F;  4ENJ A;  2GM4 A;  1FWZ A;  4CIC A;  2K85 A;  2FBH A;  4GYG A;  1HKT A;  1NHA A;  2V26 A;  1U9N A;  1S29 A;  1G4D A;  1IN5 A;  1TWH J;  1OR7 A;  3V4G A;  1R1U A;  3I56 I;  4IRH A;  4CCL A;  3KYD B;  1WSU A;  4HBL A;  2L2O A;  1KON A;  2ZJQ F;  2R93 J;  1A5J A;  4XLF A;  3U9G A;  4HST A;  5GPA A;  2A68 F;  1W36 D;  3NAR A;  3K2Z A;  2FOW A;  2AXL A;  3VPR A;  3ZQ7 A;  1K6Y A;  4XK4 A;  2LY2 A;  3DTI A;  4P9F A;  2A69 F;  2X4H A;  3M1E A;  1IRG A;  2HKO A;  2HXO A;  3VSL A;  3B6C A;  2GXB A;  1NK3 P;  4MFD A;  1IAW A;  2YU3 A;  5EG0 A;  2EIJ H;  2VL8 A;  1QPI A;  2DW4 A;  5M5X J;  3L2R A;  3ERM A;  4BEH A;  4KFC A;  1FTZ A;  2KL4 A;  1AOY A;  3ZN0 A;  1MH4 A;  2JA2 A;  2P5K A;  3FXJ A;  1ACI A;  1HOM A;  2CWE A;  4LK1 F;  1DUX C;  4L9V A;  3CO7 C;  3OIP A;  2XAF A;  4H0E A;  2EIL H;  2PFB A;  4FAS D;  4IO9 F;  1Z6R A;  3I71 A;  2LMD A;  1K61 A;  2M34 A;  5BMZ A;  4A3D J;  2LYC A;  4BE0 A;  4ENN A;  2HDC A;  2O8X A;  2H1K A;  2M1B A;  5TIS C;  1UHW A;  2VT3 A;  3D1N I;  1IO2 A;  2VKD A;  4AVP A;  1VQN I;  1W5S A;  2KP6 A;  5TGT A;  4AC0 A;  3H0D A;  1YRN B;  3BC8 A;  2KJC A;  3LA2 A;  3TO7 A;  3O8H A;  5K5Q A;  3CUQ A;  1IDZ A;  3FKJ A;  3N4M A;  5F0C A;  4PDK A;  3CTA A;  3L2W A;  1APL C;  3F8B A;  2BY0 A;  3KZY A;  2M0M A;  4XSZ F;  3IRQ A;  3OL3 A;  1SMY F;  3AG2 H;  3EPZ A;  3J80 K;  3FWE A;  4G6D A;  4X1E A;  3F9K A;  4UB6 C;  2VQL A;  1X3U A;  3CMY A;  2HOE A;  2ETH A;  2DPD A;  3E3V A;  3ZP5 A;  3GTK J;  1Q1H A;  2L02 A;  2R7F A;  1YLF A;  5J47 A;  3OYC A;  1ZR4 A;  2G9W A;  2EV5 A;  1VQO I;  3VYU B;  2FNP A;  2NS7 A;  2Z16 A;  5CVU A;  3TW6 A;  2AS5 F;  4CGZ A;  1XGO A;  4HV6 A;  2QM3 A;  4PGH A;  3JR9 A;  3G73 A;  2GLO A;  1FYM A;  4MTE A;  4OIO F;  2HPI A;  4BAC A;  2P7C B;  3OV8 A;  4I0B A;  4PJN A;  4XLN F;  4C2U A;  3BTI A;  4G9Y A;  4LGW A;  3WTT C;  1OQY A;  1WJE A;  2VN2 A;  4IL6 C;  4B44 A;  2ZSH B;  3PJR A;  4ASN A;  1FPQ A;  5BPD A;  2GWR A;  2K7L A;  4UUT A;  2CFX A;  1SFK A;  2DOD A;  3P9C A;  4KIG A;  2A6T A;  5D6E A;  3MN2 A;  3HOW J;  1SVO A;  4XOT A;  4B4C A;  4UUS B;  4JX5 A;  3ZMV A;  1HC8 A;  4XRF A;  2XKO A;  4KN7 X;  4C3H J;  3KP6 A;  2VON A;  5H6R A;  2GZW A;  2DA6 A;  2IS1 A;  1ZGJ A;  2VBY A;  2W57 A;  4RB1 A;  1SVM A;  3OYE A;  5CPR B;  3K1P A;  3BG5 A;  3H5R A;  1LFB A;  2ZJ2 A;  4Z6Y A;  1FTT A;  2LKS A;  1H88 C;  2L7F P;  2FQ4 A;  2F5F A;  4M3E A;  3OR2 C;  3S93 A;  1KYZ A;  1VTN C;  4LK0 F;  4YFN F;  4UXN A;  1WJF A;  2DOE A;  3RQI A;  1YS6 A;  1DU6 A;  3HUG A;  2XAJ A;  1HST A;  4ON0 A;  2JPC A;  5ILU A;  4HNT A;  3HXL A;  3CJR B;  2QQ9 A;  1IRZ A;  4GRI A;  3ML6 A;  5EGO B;  1STZ A;  2XF6 A;  1GHC A;  2MYS A;  3M4O J;  4YFK F;  2FSW A;  2F4M B;  5EEA A;  3QQA A;  1MSF C;  2TCT A;  1X1D A;  1KYW A;  2CO5 A;  3LSJ A;  1OKR A;  1U78 A;  1ZRD A;  3IWZ A;  5KAF C;  5E3M A;  2DXI A;  3BY6 A;  3A01 A;  4OMY A;  2XPU A;  3FXM A;  3R6S A;  1MNM C;  2QQ8 A;  2PJR A;  1JTY A;  2VBW A;  5HOD A;  1G3S A;  4BQO A;  3QPL A;  2DA1 A;  3GEZ A;  1G8X A;  3I4N J;  2KZV A;  1TTY A;  3UNG C;  4QSH A;  1QQI A;  4V19 K;  4E7J A;  4RAZ A;  4BS9 A;  2G7U A;  4I0A A;  5LHI A;  5DDG A;  5HNH A;  2DK8 A;  3HGY A;  1U8R A;  1GVD A;  3K10 A;  1I6X A;  3I59 B;  4BQN A;  4HF0 A;  2V1D A;  4FTH A;  2P6T A;  3CDL A;  1Z1D A;  2CS3 A;  2E1M B;  2FU4 A;  2HNH A;  3HPH A;  3MQ0 A;  4I99 C;  4L5E A;  4IZZ A;  3A0H C;  1LE8 A;  5C3E J;  2H1L A;  2F4O B;  1KU3 A;  1FSH A;  2X51 A;  1T98 A;  2V1N A;  2E1O A;  1FP1 D;  1UMQ A;  3BQY A;  4E7L A;  2M2E A;  3LA7 A;  4D5F A;  4LLG F;  2HYG D;  4DGW B;  1BI1 A;  4NBQ A;  5GPC A;  1W36 C;  5C4J J;  1D5V A;  2QZ8 A;  2ID6 A;  1U9O A;  1P6R A;  5K5O A;  4LOC A;  1R5I D;  1IF1 A;  4EM0 B;  2HDW A;  3I54 A;  1XGS A;  3OOU A;  2BYV E;  5H20 A;  2NNN A;  5FJ8 J;  3S1M J;  3REO A;  2BBY A;  2O03 A;  2QCO A;  3LWF A;  2X48 A;  4ZZL A;  1OIS A;  1W7P B;  2KDZ A;  2OD5 A;  3VEP A;  3H92 A;  5JLW A;  2QBY B;  1I3Q J;  1I5Z A;  3IKT A;  5F1J A;  1Z05 A;  2EH3 A;  1TW2 A;  1ENH A;  2LH9 A;  1K78 B;  4O6J A;  3ABM H;  2YUS A;  4B48 A;  5DD4 A;  5B66 C;  1FZP B;  4X0G A;  3M3Y J;  5DM7 F;  3ABU A;  5CVV A;  5FRO A;  1QHH D;  3SHF A;  4AYB A;  1MH3 A;  2XRO A;  4A69 C;  4AUX A;  1JGG A;  2XDV A;  3MMY B;  2JSC A;  1XS9 A;  4NHJ A;  3BJ6 A;  4F7Z A;  2W48 A;  1L0O C;  2MC4 A;  1TWA J;  1VF9 A;  3CCQ I;  1K4S A;  1N75 A;  4EGY A;  4HYE A;  2ZME C;  5JVG F;  4E7K A;  1D5Y A;  1MJA A;  3ABL H;  3CJT B;  4D5C A;  4CH7 A;  2R7O A;  1MMD A;  2WV1 A;  4HDV A;  2ECB A;  2DOF A;  3BT9 A;  4MEX F;  4NC8 A;  3I64 A;  2CUJ A;  4CCK A;  2ZO4 A;  2D2W A;  2DT7 B;  2WY7 Q;  4ESJ A;  5K7Z A;  1DPU A;  4A6E A;  4ZDP A;  1YW9 A;  3PIP F;  5C4X J;  1ZHF A;  3M8F A;  2R5Z A;  2R4G A;  1J75 A;  3CF5 F;  3V8K A;  3AG4 H;  2GOM A;  2VXD A;  3GTM J;  2KFD A;  1IZ1 A;  3D0S A;  4D1Q A;  3TQN A;  3H5A A;  3GUD A;  4OMZ A;  1ZAO A;  2M45 A;  3VYS B;  2MSY A;  4PJJ A;  3OYL A;  4B3A A;  1KU7 A;  1HW2 A;  2MD0 A;  4RM2 A;  4KN4 X;  4ANJ A;  3LSM A;  3K6G A;  3ZQH A;  3VOE A;  2F5V A;  3SZT A;  2ME0 A;  4U87 A;  2JTV A;  1LPQ A;  1ZRE A;  3CD6 I;  3LAP A;  3GYH X;  2LRE A;  4PFO A;  1HF0 A;  2IRF G;  2K4B A;  4F55 A;  1VI0 A;  2Q2E B;  4Q47 A;  2DAO A;  5EJC A;  2R7Z J;  1B8I B;  3OYN A;  1YIJ I;  5EZG A;  4NNJ A;  3BCB A;  3ESW B;  3CMM A;  4IHV A;  3CUO A;  1OLT A;  2EB7 A;  3MZY A;  2L9V A;  1YW7 A;  4PUS A;  3ZQC A;  5AON A;  3N05 A;  4C3I J;  1UHS A;  3HOV J;  3MWM A;  2XPV A;  3CF2 A;  3ZOB A;  3LFU A;  2P5V A;  2Q0O A;  3PM1 A;  3PSF A;  2WA0 A;  3QPS A;  2ZBK A;  3H5N A;  3W6J B;  1ORK A;  2V1X A;  3IWF A;  4HEA 2;  2RQP A;  3G1O A;  5M5Y J;  2Y69 H;  2OF7 A;  2QKL B;  2VBX A;  5FFZ A;  2BY3 A;  4DZP A;  5F1R A;  4LIT A;  1HW5 A;  2VKV A;  4UVC A;  1XSV A;  2JA6 J;  1U5T C;  1JKP C;  1R4N B;  3F8F A;  4MQV A;  1POG A;  2DA4 A;  3K1N A;  2K9S A;  2VOP A;  5E1X A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 5DUI A;  2V79 A;  5E17 F;  2RV8 A;  2Z33 A;  1HKQ A;  1ZRC A;  1RZ4 A;  3RJP A;  3WOD F;  4KNY A;  4PCQ A;  3C7J A;  1RIO H;  4UUV A;  2DT5 A;  3TGN A;  1YQA A;  4LD5 A;  3WTW C;  3C18 A;  3I53 A;  3BJO A;  4KIF A;  4Q5S F;  2ADU A;  2FF4 A;  2FE3 A;  5D8L B;  3JAM Z;  4A12 A;  5ICE A;  4BHC A;  1J59 A;  4AIJ A;  5FLX Z;  1L3L A;  4ZYE A;  4HX4 A;  4I01 A;  2HTS A;  4R79 A;  2E7W A;  4GXO A;  3TOB A;  1WI9 A;  2M8E A;  4O3M A;  4XSX F;  2R7D A;  2EFN A;  2IVM A;  1XD7 A;  1JHH A;  4EV0 A;  2YX7 A;  4WF2 A;  2CYY A;  2P6S A;  5F64 A;  4RGS A;  4BQA A;  3Q5F A;  1U3E M;  3DV8 A;  4YG2 F;  3L2C A;  1MDM B;  1W7P D;  1LDD A;  3WE2 A;  4UVB A;  1FT9 A;  5LHH A;  1XCB A;  4FT8 A;  5BS6 A;  3TOA A;  4EJV A;  1IRF A;  5FGM A;  3TO6 A;  2K27 A;  1QO0 D;  4BYY A;  1Z7U A;  3WGG A;  3WU0 A;  2X0L A;  3D5L A;  2FNA A;  3J81 Z;  2EK5 A;  1WRJ A;  4UV8 A;  2LF8 A;  3FXR A;  2ZCW A;  4A6D A;  4OIN F;  2QQA A;  3V8J A;  4GGG A;  5ILV A;  4RGR A;  4K2E A;  5CVI A;  2OAZ A;  2DQR A;  3DPT A;  2EJR A;  2IT0 A;  2P5L C;  5EEG A;  5HDN A;  3IKV A;  5ICC A;  1TNT A;  1GXP A;  3KLO A;  3ELK A;  3WGH A;  3M7G A;  5D8K B;  3QPH A;  4OIP F;  3EYI A;  4LG0 B;  1C0W A;  3KP5 A;  4S04 A;  2K4J A;  3QP5 A;  2PBI A;  1JE8 A;  4N9I A;  3JSP A;  3FHZ A;  1IXS B;  1HXD A;  1MZB A;  3Q9V A;  1BIB A;  2G7H A;  1REP C;  5A2Q Z;  4MTD A;  2MLG A;  4L0Z B;  4M73 A;  2FBK A;  4I7H A;  2EV6 A;  3EDP A;  4MEY F;  1V4R A;  2EFO A;  3RPQ A;  2XHK A;  4M74 A;  5D5W B;  4G6Q A;  4AIH A;  4KT5 C;  1BBY A;  3HSF A;  2OQG A;  2F5D A;  1FX7 A;  3M8E A;  4A5M A;  1FNN A;  3ERE D;  1O3R A;  1BN5 A;  3FF5 A;  2Q8K A;  5CVJ A;  4QLC U;  3HTS B;  2NNY A;  4M71 A;  3R61 A;  1U6G A;  3WTY C;  4U0W A;  1G3W A;  3JW4 A;  5E20 A;  4IF4 A;  4XBF A;  2L4M A;  3E6M A;  4IHS A;  1R00 A;  1DPR A;  4CHU A;  2EA4 A;  4IRI A;  1FYK A;  3CUQ B;  1UST A;  1XDU A;  2F5E A;  2W24 A;  1HBX G;  3DXJ F;  4HDU A;  4LB5 A;  3IL2 A;  1FOK A;  5FB2 A;  4M9S A;  4OIR F;  2D1V A;  3F21 A;  4RGX A;  4ESF A;  3PFI A;  2GA1 A;  3KP4 A;  3SXY A;  1YTY A;  1QZY A;  3I4P A;  2K02 A;  4U7D A;  2PG4 A;  2FOK A;  1FY7 A;  5HLG A;  4NQW A;  2A6E F;  1KGS A;  2J5O A;  2W84 A;  2YSR A;  4GYI A;  2STT A;  2YX4 A;  3OOP A;  5IT9 K;  4MNU A;  1RUN A;  4KUM A;  3EET A;  3NEU A;  4RAY A;  3DPL C;  2HQR A;  4GO1 A;  1JGS A;  3GVA A;  4OIQ F;  1PP7 U;  3IRR A;  2P8T A;  1S8N A;  4Q4Z F;  1ZLJ A;  1R1T A;  2RKH A;  3B02 A;  2ZNY A;  1OYI A;  5LRS A;  2MH9 A;  1ZN2 A;  2HTJ A;  4WX9 A;  3LA3 A;  1SD4 A;  4L18 B;  3WTZ A;  4DQ2 A;  1WKM A;  5EEH A;  3P9I A;  4P9U A;  3JSO A;  3O6B B;  3BPV A;  1J9I A;  2E1C A;  2JT1 A;  4LJZ F;  4BH9 A;  1IXC A;  3BPX A;  3NRV A;  4HQE A;  3L09 A;  3DQV C;  4B8X A;  3U1D A;  2MC3 A;  4RGU A;  2GXG A;  1XMA A;  2Y0M A;  4EVI A;  1F9N A;  1J7K A;  2QLZ A;  1P2F A;  3K1M A;  3HRM A;  2V9V A;  4EGZ A;  2ZXJ A;  5L3B A;  2KRF A;  2XV4 S;  2H94 A;  1MKM A;  3E5Q A;  2UWM A;  3P7N A;  1F1Z A;  2F5C A;  3HRS A;  3RPU A;  3GWZ A;  4BAY A;  2FXA A;  2XRN A;  3MAJ A;  3WG9 A;  1EH6 A;  2PQ8 A;  3RYR A;  1Y0U A;  3VB2 A;  2DBB A;  5J8C A;  1TQP A;  2A07 F;  3CJN A;  1OYY A;  2LSO A;  1BI2 A;  1FBU A;  5ERI A;  4BXU A;  1TLH B;  3O2P E;  1K6O A;  2COM A;  1WQ2 A;  5L3F A;  1B9N A;  3K0L A;  5H6Q A;  4IHT A;  5HVQ C;  1MD0 A;  4I09 A;  4U0V A;  3FMS A;  1PUE E;  4IVN A;  1T38 A;  1IN4 A;  1XMK A;  2FBI A;  3ZN1 A;  2LNB A;  1E17 A;  3V8L A;  5KVR A;  1R58 A;  1OPC A;  2BEO A;  1ZAR A;  1IUY A;  3FXU A;  3WU1 B;  3I58 A;  3F8M A;  2XAG A;  1V3F A;  4EM2 A;  1K7A A;  3PQK A;  4RB2 C;  2JPB A;  4N9H A;  2O0Y A;  4JQF A;  1J2X A;  5D6F A;  2CSO A;  5KK1 A;  2IA0 A;  1IN8 A;  1BC7 C;  1CF7 A;  4EQQ A;  1LDK B;  1FC3 A;  4MHG A;  1Z91 A;  4A5N A;  2IW5 A;  1O7L A;  4A2U A;  1R23 A;  3DP7 A;  1R22 A;  1QNT A;  2FMY A;  2L3D A;  3RDI A;  4IPA A;  1S7A A;  1PP8 F;  1KA8 A;  1R1V A;  1E2X A;  3N97 A;  1G3T A;  2D45 A;  2M87 A;  2XVC A;  2HWV A;  2L01 A;  3GFM A;  2RGV A;  5HLH A;  3BZ6 A;  2O6G E;  2EA2 A;  5JHU A;  2O3F A;  3BOQ A;  3QU3 A;  5L3C A;  4RB3 C;  4R8H A;  3RIR A;  4OOI A;  3RTR A;  4LLN A;  4O5V A;  3ULQ B;  2KJB A;  1ZLK A;  2QWW A;  3T8R A;  4U88 A;  2ZNZ A;  4L5J A;  4Y17 A;  1IN7 A;  5LEK A;  1J0R A;  2ZFW A;  5K1Y A;  3T1B A;  5JR3 A;  2ESH A;  4CO8 A;  1KU9 A;  2KIU A;  2DU9 A;  2DO7 A;  3KP3 A;  4ZYD A;  2L54 A;  1OMI A;  2MD5 A;  4L9T A;  1B59 A;  5K5R A;  5TJJ A;  2EFQ A;  4MGR A;  5E8I A;  4UV9 A;  5BQT A;  5LHG A;  4LB6 B;  4FHT A;  1XSD A;  3FMQ A;  2Y48 A;  2XUB A;  2DTR A;  3GFL A;  4EJT A;  1KQ9 A;  3ZMT A;  2M30 A;  2DQL A;  3L00 A;  1T39 A;  1B6A A;  3SQN A;  2GQQ A;  1BC8 C;  3L9F A;  5DD8 A;  5CYV A;  2OA4 A;  3GFJ A;  1YYV A;  4IXA A;  1ZRF A;  2RVC A;  1B1B A;  1LEB A;  1TQM A;  3KP2 A;  3F8C A;  1FBQ A;  3LQR A;  3HRT A;  4E70 A;  2BGC A;  4ESB A;  5LGN A;  4HAM A;  1O57 A;  1XGN A;  1IN6 A;  3KEO A;  2EFP A;  2VOD A;  1SD6 A;  2HYF A;  2WV0 A;  5D5U B;  4HX7 A;  2UXX A;  3FM3 A;  4A0X A;  1BIA A;  2IPQ X;  3WTX C;  4QWQ A;  3J7A O;  3MZH A;  2ZME A;  1YS7 A;  4Y15 A;  3V7S A;  4PZJ A;  1UHM A;  4CZZ A;  3F72 A;  5BOX A;  2MLK A;  2PMU A;  3TKY A;  3KCC A;  3GF2 A;  1BOA A;  1ZH5 A;  3WGI A;  3J80 Z;  3BJA A;  3IHU A;  2HEO A;  2VXZ A;  3GW2 A;  4G7Z F;  1GXQ A;  3LQQ A;  3DEU A;  3I5U A;  1ON1 A;  2DI3 A;  2W25 A;  5AIP A;  1QBJ A;  3WTU C;  1O7F A;  1JXS A;  3R0A A;  3R0J A;  2L4A A;  3W6K B;  3CLO A;  1JHF A;  2FEZ A;  4IRG A;  4PGG A;  3TDU C;  1KQ8 A;  1A04 A;  5LRR A;  4P55 A;  1CGP A;  3DFG A;  2J5P A;  4S05 A;  4AWX B;  2E1N A;  3F6O A;  3KLN A;  2LDU A;  2LF7 A;  4YIF A;  4KDP A;  5IT3 A;  4UVA A;  2HQN A;  1ZG5 A;  4AIK A;  4M72 A;  4UHT A;  1S7O A;  2FML A;  4HF1 A;  4L0Y B;  2OBP A;  2XAQ A;  3JAM K;  2Z3Y A;  2CG4 A;  3DKW A;  1U5T A;  4Y13 A;  3E97 A;  3T8T A;  4L9N A;  4ETS A;  5JVT A;  5FLX K;  3JTG A;  1ON2 A;  4RB0 A;  3EUH A;  5DCM A;  1UB9 A;  4WXC A;  2RNJ A;  5D5X B;  3FM5 A;  3O3K A;  3U2R A;  1SMT A;  3DF8 A;  1BM9 A;  2OQR A;  1I27 A;  4KYW A;  1YO5 C;  2QYO A;  3VOD A;  3T0Y A;  4YII A;  3ZMZ A;  3VFZ A;  4EM1 A;  4WXD A;  4YFX F;  2OZU A;  5LGT A;  4JK1 X;  2IJL A;  2IP2 A;  3HTU A;  4XLP F;  2RC4 A;  3HYI A;  2P7V B;  1R36 A;  1P4A A;  1FBS A;  3G3Z A;  4I2O A;  4B09 A;  4M6Y A;  5DCF A;  2DFI A;  1MGT A;  3RKY A;  2MA3 A;  5DEQ A;  4P5O A;  4MQ9 F;  2EV0 A;  1LEA A;  3EQL F;  5CJ9 A;  2HR3 A;  2YR2 A;  3NQO A;  1T0F A;  1H9G A;  5L3D A;  4WCG A;  3ECO A;  3F8N A;  1O3Q A;  4P96 A;  5DV5 A;  5DUK A;  5D4R A;  3CDH A;  4HW0 A;  3BWG A;  3KEQ A;  2XKP A;  2UZK A;  3GZ6 A;  1SFX A;  1BI0 A;  4UNO A;  4EMS A;  4CXF A;  2ISZ A;  3J81 K;  4KMU X;  4WXH A;  2HS5 A;  2QQB A;  2KIM A;  5LBQ A;  4R1H A;  1GVJ A;  4ZYG A;  4HLY A;  1O3S A;  1TQI A;  1D8J A;  2E7X A;  1LJ9 A;  1S6L A;  2WC2 A;  1ULY A;  3QPT A;  1LQ1 A;  3KET A;  3T5X A;  1SFE A;  3K69 A;  5D5V B;  2KKO A;  3ZMD A;  4AD9 A;  2CQK A;  2YPR A;  2D1H A;  3COA C;  4HLX A;  2ISY A;  4TV7 A;  2VE8 A;  3MEX A;  5J8F A;  5ICF A;  2PN6 A;  2NYX A;  3H3Z A;  4HV5 A;  4FX0 A;  2QVO A;  2Z5U A;  3JTH A;  5HS8 A;  3WTS C;  4CYD A;  4HOB A;  2F2E A;  2EFW A;  2ELH A;  5DYM A;  2BE5 F;  1SAX A;  5CLS A;  3IC7 A;  3ZMU A;  3BRO A;  2RN7 A;  2BV6 A;  5A2Q K;  4A0Y A;  3QU6 A;  4ZH4 F;  2H27 A;  2PEX A;  3LFK A;  1O3T A;  2FA5 A;  1J5Y A;  2B0L A;  2HFH A;  5J6X A;  4KIB A;  1SFU A;  2RDP A;  4ENK A;  2OU2 A;  2KIF A;  2GAU A;  4ENM A;  4U7B A;  1XCV A;  4HF2 A;  3K9T A;  2VC0 A;  4L5I A;  2CW0 F;  4JBA A;  3MFK A;  5JI6 A;  2H6C A;  2Y75 A;  3ISP A;  3GZ5 A;  3HRU A;  2R3S A;  3E5U A;  1MJB A;  1U2W A;  3HHG A;  1LB2 A;  3Q9S A;  2A5Y B;  2FQ3 A;  5BPI A;  2MH2 A;  4OU0 A;  1I1S A;  3QRF F;  1SD7 A;  1RNL A;  3RKW A;  2ZKZ A;  5HOO A;  1XB4 A;  1S3J A;  3HIF A;  4KMF A;  2VT2 A;  3HHH A;  2PI0 A;  3I59 A;  2ESN A;  3M9A A;  5HS9 A;  2MBF A;  2FRH A;  4DNC A;  2DLL A;  2GA2 A;  1BJA A;  3LST A;  1F4K A;  5D4S A;  1AWC A;  1CF7 B;  1DDN A;  1P4X A;  1ONV A;  3C1D A;  3E6C C;  2PMH A;  1K79 A;  1EV7 A;  5HDG A;  4LMY A;  1QGP A;  3BDD A;  3CO6 C;  1P92 A;  1G6N A;  4I98 B;  1R5G A;  1B4A A;  3SFZ A;  1W7P A;  3RYP A;  4HZF A;  3HOS A;  2QBY A;  1FLI A;  1KU2 A;  3HOT A;  1HKS A;  3ROU A;  1K78 A;  4M6X A;  2WWY A;  3GXO A;  4EJW A;  1R7J A;  5TRD A;  5E1W A;  1I1G A;  1Z9C A;  1R5H A;  2O61 A;  2LKP A;  1H0M A;  3HSR A;  3V7R A;  3KE2 A;  3SZP A;  1Z6T A;  2OZ6 A;  2XGX A;  2GIV A;  2WTE A;  5ICG A;  2K86 A;  3WE3 A;  2W85 A;  2DPU A;  3R60 A;  2NRA C;  1RUO A;  3BP8 A;  2IA1 A;  1FP2 A;  3F3X A;  4WWC A;  1F5T A;  5HLI A;  1ODD A;  3QP6 A;  3MCZ A;  2HGC A;  4HA8 A;  4A0Z A;  2XAS A;  4RS8 A;  2XIG A;  4BNC A;  1YIO A;  2Q2E A;  4LLL A;  3V7C A;  1LDJ A;  4WK8 F;  4EJO A;  1QPM A;  3E6B A;  4Z2Y A;  2C6Y A;  3WTV C;  5AIQ A;  1QZZ A;  2UXN A;  4ZYH A;  1XGM A;  5ILS A;  3GLX A;  4HQM A;  2DK5 A;  1T6S A;  3QAH A;  3FXQ A;  4CDG A;  5FD5 A;  1IW7 F;  4L9J A;  5JFR A;  4G8X A;  3ZPL A;  1ZG1 A;  3ZMS A;  1YG2 A;  2NAZ A;  1RI7 A;  3GO5 A;  1OYW A;  2NS0 A;  3PQJ A;  3F23 A;  1EH8 A;  3FMR A;  1SD5 A;  4ZZD A;  2QUF A;  3ECH A;  3GX4 X;  2Z99 A;  2XAH A;  5L3G A;  1XDS A;  2ZME B;  5CVR A;  2A61 A;  3E5X A;  4KIC A;  1FYL A;  4FX4 A;  2QEN A;  4D0P A;  3FZV A;  5HS7 A;  2M5W A;  3CUQ C;  3QOP A;  2HZT A;  1PDN C;  1W4M A;  4G94 A;  1ZYR F;  2H6B A;  2A3S A;  2JZY A;  1XSX A;  2TDX A;  2VBZ A;  5F6F A;  2STW A;  1TW3 A;  2JRT A;  3C3W A;  5L3E A;  1HW1 A;  4Q48 A;  1FSE A;  5HDK A;  2EWN A;  2HKX A;  1KQ0 A;  4M9Z A;  5FD6 A;  5LLQ A;  1XN7 A;  1UFM A;  1LVA A;  4N0B A;  1USS A;  3KZZ A;  4NB5 A;  1T2K A;  1HQC A;  1HSJ A;  2VE9 A;  3F6V A;  4KA4 A;  1IXR C;  2VOO A;  3HSE A;  2VC1 A;  3TO9 A;  1WWX A;  2PLY A;  5LGU A;  1W5T A;  4BHB A;  5E1Z B;  3S2W A;  2P4W A;  1YFH A;  5ED4 A;  4EJU A;  1MDM A;  5E18 F;  4U0Y A;  3LAJ A;  3I0T A;  2V1U A;  5IT9 Z;  1P4W A;  3E6D A;  3GFI A;  2PJP A;  5LEJ A;  1LNW A;  1YW8 A;  3R4K A;  1U5T B;  4G7H F;  3RI4 A;  3RKX A;  3KP7 A;  1TBX A;  4BHP A;  2IA2 A;  3L7W A;  6PAX A;  2H09 A;  3ABT A;  5DCM B;  1B9M A;  2CGP A;  3F22 A;  2ACJ A;  2Z9O A;  2A6H F;  3B73 A;  1H9T A;  3P9K A;  1G3Y A;  3EYY A;  1D8K A;  1BI3 A;  2V6C A;  3H3U A;  4LFU A;  4IJA A;  3FX3 A;  3KFW X;  4I02 A;  3AAF A;  1ZG3 A;  5FFX A;  5FO5 A;  4GCV A;  3TDZ C;  4G7O F;  1EH7 A;  1DP7 P;  4HX8 A;  1TNS A;  5E8G A;  1D3Y A;  4LG0 A;  4M9X A;  1UCR A;  1ZGA A;  4ENJ A;  1FWZ A;  4CIC A;  2FBH A;  4GYG A;  1HKT A;  1NHA A;  1S29 A;  1G4D A;  1IN5 A;  3V4G A;  1OR7 A;  1R1U A;  4IRH A;  1WSU A;  4HBL A;  3U9G A;  2A68 F;  3K2Z A;  2AXL A;  3ZQ7 A;  4P9F A;  2A69 F;  2X4H A;  3M1E A;  1IRG A;  2HKO A;  2GXB A;  1IAW A;  2YU3 A;  2DW4 A;  4KFC A;  1AOY A;  3ZN0 A;  2P5K A;  2CWE A;  4LK1 F;  1DUX C;  4L9V A;  3CO7 C;  2XAF A;  4H0E A;  2PFB A;  1Z6R A;  3I71 A;  5BMZ A;  4ENN A;  2HDC A;  2O8X A;  2M1B A;  1UHW A;  2VT3 A;  4AVP A;  1W5S A;  2KJC A;  3LA2 A;  3TO7 A;  5K5Q A;  3CUQ A;  3N4M A;  4PDK A;  3CTA A;  3F8B A;  3KZY A;  4XSZ F;  3IRQ A;  1SMY F;  3J80 K;  3FWE A;  4G6D A;  1X3U A;  2HOE A;  2ETH A;  2DPD A;  3E3V A;  3ZP5 A;  1Q1H A;  2L02 A;  2R7F A;  1YLF A;  2G9W A;  2EV5 A;  2FNP A;  5CVU A;  2AS5 F;  4CGZ A;  1XGO A;  4HV6 A;  2QM3 A;  4PGH A;  3G73 A;  1FYM A;  4MTE A;  4OIO F;  2P7C B;  3OV8 A;  4I0B A;  4XLN F;  4G9Y A;  4LGW A;  3WTT C;  2VN2 A;  4ASN A;  1FPQ A;  5BPD A;  2GWR A;  2K7L A;  2CFX A;  3P9C A;  4KIG A;  5D6E A;  3ZMV A;  4XRF A;  2XKO A;  4KN7 X;  3KP6 A;  2VON A;  5H6R A;  2GZW A;  1ZGJ A;  2VBY A;  2W57 A;  4RB1 A;  3K1P A;  2ZJ2 A;  2F5F A;  1VTN C;  1KYZ A;  4LK0 F;  4YFN F;  4UXN A;  1YS6 A;  3HUG A;  2XAJ A;  1HST A;  4ON0 A;  2JPC A;  5ILU A;  2QQ9 A;  3ML6 A;  1STZ A;  1GHC A;  4YFK F;  2FSW A;  1KYW A;  2CO5 A;  1OKR A;  1U78 A;  1ZRD A;  3IWZ A;  3BY6 A;  4OMY A;  3R6S A;  2VBW A;  1G3S A;  3GEZ A;  1TTY A;  1QQI A;  4RAZ A;  2G7U A;  4I0A A;  5LHI A;  5DDG A;  2DK8 A;  1U8R A;  1I6X A;  3I59 B;  4HF0 A;  2V1D A;  2P6T A;  1Z1D A;  2FU4 A;  3MQ0 A;  1KU3 A;  1FSH A;  1T98 A;  1FP1 D;  3LA7 A;  1D5V A;  4LLG F;  2HYG D;  1BI1 A;  2QZ8 A;  1P6R A;  5K5O A;  1IF1 A;  4EM0 B;  3I54 A;  1XGS A;  2BYV E;  5H20 A;  2NNN A;  3REO A;  2BBY A;  2O03 A;  3LWF A;  4ZZL A;  1W7P B;  2OD5 A;  3VEP A;  3H92 A;  2QBY B;  1I5Z A;  3IKT A;  1Z05 A;  1TW2 A;  1K78 B;  4O6J A;  5DD4 A;  1FZP B;  3ABU A;  5CVV A;  3SHF A;  2XRO A;  2JSC A;  4NHJ A;  3BJ6 A;  4F7Z A;  1L0O C;  4EGY A;  4HYE A;  1MJA A;  4HDV A;  4MEX F;  3I64 A;  2ZO4 A;  2D2W A;  4ESJ A;  1DPU A;  4A6E A;  1YW9 A;  1ZHF A;  3M8F A;  1J75 A;  3V8K A;  1IZ1 A;  3D0S A;  3TQN A;  4OMZ A;  3GUD A;  1ZAO A;  2M45 A;  1KU7 A;  1HW2 A;  4KN4 X;  3VOE A;  3SZT A;  2JTV A;  1ZRE A;  3LAP A;  3GYH X;  2IRF G;  2K4B A;  4Q47 A;  2DAO A;  3CUO A;  2EB7 A;  3MZY A;  1YW7 A;  5AON A;  3MWM A;  2P5V A;  2Q0O A;  2ZBK A;  3W6J B;  2V1X A;  3IWF A;  2RQP A;  2VBX A;  5FFZ A;  5F1R A;  1HW5 A;  4UVC A;  1XSV A;  1U5T C;  3F8F A;  4MQV A;  3K1N A;  2VOP A;  5E1X A;  1MJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...