1X4PA

Solution structure of surp domain in sfrs14 protei
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSSGSSGVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of SURP domain in SFRS14 protei
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Putative splicing factor, arginine/serine-rich 14
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1x4pA00
1X4OA 2E60A 1UG0A 2E5ZA 2DT6A 1X4PA 2DT7B 4DGWB
chains in the Genus database with same CATH superfamily
1ZR4A 2K85A 3QP6A 1E3PA 4FX4A 3OYCA 2L7FP 2HQNA 1TWAJ 1YJWI 2L4MA 3P9IA 2M0MA 5FRNA 2LD5A 1U9NA 2E1MB 2FE3A 4KYWA 1GLNA 1U5TC 1PUEE 1TC3C 4GGGA 1W7PB 2CW7A 3O8GA 3IRQA 2ZMEC 2W1OA 2O9LA 2XGEA 2R7XA 4P5OA 4BJ5C 3PUFA 2H1LA 5LGTA 3GFJA 2E1CA 2VONA 3SZPA 2QA4I 3D1NI 3VEPA 3A0HC 1YX5A 2BY2A 1Y8QB 4OIQF 3ZPLA 3V8KA 2UWMA 3BTLA 1ETXA 3GMEA 3K10A 1RIOH 2VT3A 4XNFA 2XGDA 4XSXF 3U2RA 2LG4A 3E3VA 4DJAA 1VQ7I 2DLLA 3VWBA 2R5YA 1UFMA 3E6CC 2GZWA 1RKTA 2FXAA 1FC3A 4XONA 5B3SH 3MEXA 4A6EA 4EGYA 3RKWA 1SFOJ 1MH3A 1Z05A 1TWFJ 3FBNB 1J59A 3LSMA 4IL6C 3J7AO 4CCLA 2GOXB 4QPQA 3BTIA 3K9TA 3AAFA 1X1CA 4LG0A 4PGGA 1NK2P 2WV1A 1ZLJA 3S1RJ 4V2FA 4A93J 2QBYA 2XF5A 4ENJA 1OQYA 3GBGA 1U78A 3OS0A 4FT8A 3HOTA 2JA6J 2RAEA 3TL4X 1G8XA 2LF8A 1OYIA 3F6OA 3WHBA 1IG7A 1FYMA 2OU2A 1MMDA 2DFHA 5J47A 3F72A 2WAEA 1BJAA 3UNGC 1FLIA 4F92B 3PIPF 1WPKA 3ABUA 4GYGA 2ZCWA 4IZZA 4NUBA 3FM5A 3RIRA 3HZJA 5LGNA 1OISA 1EH6A 1KA8A 2EV0A 4AIJA 2V6CA 1RZ4A 2P5KA 1STZA 2NRAC 1SVLA 2M45A 2AQEA 3CDHA 1QHHD 5K1YA 1Y0UA 2VXZA 4GRIA 4IKFA 4G6QA 3L1PA 1IDYA 2Z9OA 5CVRA 1JT6A 2OJED 1PDNC 4WX9A 1FSEA 2KDZA 3SZGA 1O3QA 1MIJA 2RGVA 1LVAA 1RR8C 5M5YJ 2HTSA 2EZIA 5HLIA 1VQ5I 3L2UA 3RPUD 1ULYA 4E70A 5BS6A 4MGRA 5HNFA 2A5WA 2VPRA 2JRTA 2Y48A 2KHMA 2HYFA 2LVSA 4UB8C 2PQ8A 3GCMA 4KNYA 4Y17A 1IV8A 4BDZA 3ZQLA 1T8IA 3OYAA 1TL8A 2FBIA 4XRSA 3KIOA 4EV0A 3JRBA 5ED4A 4L9JA 3QWLA 4RGXA 1R5HA 3F8MA 2ME6A 3RZOJ 2MC4A 2YU9J 3RKYA 2GAUA 3PSFA 2CQQA 3RI4A 3S3NA 2DT7B 4D5CA 1OR7C 3GZ5A 5ICEA 2HDCA 5J1YA 1LDKB 3GTGJ 2F4OB 4FX0A 3W2AA 2IS4A 1K83J 2XUBA 2R5ZB 2MGQA 3BQYA 4N4NB 5L3CA 2DT6A 3CQZJ 3REOA 1O3SA 3U21A 4V19K 4W97A 3DLLF 4YIFA 3S2WA 3NWTA 2ZJPF 4IHVA 2XASA 3E6DA 2LKXA 4Q5SF 3OYIA 4XKBA 4MFEA 1ZLKA 1X19A 4FQGA 1FNNA 4F7ZA 2FEZA 1BIAA 4OAZA 4LG0B 2BXYA 1W36D 4KICA 1MJAA 2HS5A 1ZG5A 2H8WA 4RLQA 3IRRA 1H8AC 2QLZA 5FLMJ 2WAQA 2LMDA 3BG9A 4E7ZA 3CCJI 3FM3A 3MN2A 3AL0C 4AD9A 4RGRA 3CC4I 4AVZA 3L2QA 3FXOA 2QKMB 3V8JA 2DPDA 4IXAA 2Y30A 3E0JB 1XGOA 3QAHA 5BMZA 2JRMA 1Y1VJ 3I5UA 2XDVA 4BUPA 2V1XA 5IT9K 2K3FA 4LOCA 3KP5A 1K78A 5JLXA 2DCEA 2HTJA 3NEUA 1JJ6C 3CLQA 3B02A 4IJAA 5K7HA 1H89C 2DDBA 2JTVA 4KJZA 3GTPJ 3HYIA 3BR3A 1MSEC 4CA0A 1WSUA 3BT9A 3K0LA 3WTYC 3BP8A 3IP4B 2E35A 2VOOA 2V1UA 3H9QA 4UUTA 3CMYA 3DLAA 2VQGA 5DCMB 2E2JJ 2JQ7A 1IXSB 1OCOH 3CDIA 3CTAA 4AYBA 3QOEA 2CQ7A 3LSPA 3HOUJ 5HS9A 4B1RA 5BQTA 3M3YJ 3SZTA 1UHWA 1Z7UA 4JX6A 1TT0A 1BBYA 4HQMA 1D3YA 5EG0B 1I6XA 2QSFX 2F5DA 4G9YA 1FZPB 1XB4A 3BZKA 5E18F 2FQ3A 2STWA 3GVAA 4M74A 1MBHA 4NHJA 2D5VA 4M73A 3J80Z 3CCUI 1V5FA 2K86A 3JRCA 1YJNI 1PP8F 2I10A 5DD8A 4NDLA 4G94A 1F1ZA 1FMVA 5KCMA 2BHYA 2IS1A 1UJ8A 2R7VA 4ETSA 1PUFA 2HPMA 2CV0A 4H0EA 1V4RA 4IF4A 3JRHA 1XSXA 3G1LA 3ZQGA 1D1AA 2IS6A 1TLHB 4XRFA 5EYRA 3OYMA 3GTLJ 5CVJA 1JUSA 3W6KB 3FKIJ 2IAIA 2DTZA 3HGGA 1OCZH 3LSKA 3DPUA 3BZCA 1F5TA 1O4XA 1R1TA 2P7VB 5M5XJ 2ICWG 3FXQA 4QWQA 2K9QA 1MNMC 4JX5A 1XCVA 1Y0NA 4LD5A 2VXDA 2M3AA 2V1DA 2IA2A 4L0YB 3VDXA 1WWXA 1KYZA 4HSTA 2E36A 4BBSJ 2IBDA 3M7GA 3WHCA 4RGSA 4XLHA 1OJLA 3BOQA 3CJQB 1HDDC 3PL8A 2JA5J 1RC9A 1ZR2A 2NS8A 4P96A 1B9MA 2PMZN 1VQOI 2XB0X 1E0EA 3W6VA 1LKXA 3GW2A 5E79C 2DTRA 5M5WJ 4ASNA 4DZPA 1FOYA 4XRSG 4I0AA 4R79A 5H2FC 1WCMJ 1DGWY 4H4KC 5J8CA 4QTRA 4U0YA 1Z9CA 2MFZA 3CMMA 3WGIA 2NOJB 4A3CJ 3QODA 3LAPA 3OYNA 1KU7A 2O7OA 4A12A 2WY7Q 1PP7U 2FF4A 3ZMZA 4MO7A 4BS9A 4A3IJ 2H6BA 4IO9F 2CQKA 2DI3A 2K9SA 4UVCA 3HXLA 4IRIA 5DUKA 3S2HJ 2H09A 2KMUA 1TNSA 2CYYA 4I02A 1IN7A 3OL4A 1KU9A 1MDMA 1YIOA 2ZNYA 4B8XA 5AONA 3K70D 2ESHA 4M9ZA 1D5YA 3I0TA 1HBXG 4Y4RA 3AG2H 2E7WA 2W25A 1BI0A 4UNOA 4PDKA 2O03A 2OQGA 2LKSA 3HRMA 3PO3J 1CF7B 1WJBA 3MVPA 3HTUA 4M6VA 4I6ZA 2VL8A 3OIQA 1QZYA 1X3UA 4LITA 3S3OA 2EB7A 5D5VB 1R9TJ 2DQLA 3BJOA 1DQUA 2FNAA 3VSLA 3WTXC 3BPVA 1ETYA 3TP0A 1K7AA 4RM3A 3S1NJ 1AKHA 4OWRB 4M6XA 1I1GA 3BR2A 5CVVA 1RUOA 1OYYA 3PNVA 3CCYA 4KIBA 2X6YA 3WTUC 3DKXA 2CFXA 1DP3A 5FB2A 3I53A 2A6EF 1YX3A 4HX4A 5JI6A 3NWSA 2BW3B 3J80K 3L09A 2BE5F 2R7UA 4PFOA 4Z2YA 1T39A 3FF5A 3ZQIA 5FKLA 4WCGA 2F5FA 2KFDA 3HSFA 4XN3A 1F9NA 4KMFA 3A0BC 1X58A 2Z2SB 1MBJA 2E71A 1KU3A 4ZZDA 1R7JA 4O3MA 1OR7A 2H6CA 3TO7A 2UV1A 3ABKH 1T0FA 5CVUA 4O6JA 5AIPA 2IT0A 2OV7A 3I64A 5LEKA 4UUSA 1OMIA 3ABLH 2V79A 3O3KA 5FD5A 3CZ6A 1D8JA 1BR4A 5KAIC 3BDDA 1Y39A 5D5UB 2R7TA 4NC6A 2ADUA 3KEYA 4U88A 3FXKA 1BN5A 1CF7A 4GDFA 4PSXA 3D5SC 2XSDC 4PJJA 4B09A 5A2QZ 4CYCA 3WU0A 1S3JA 1MMAA 3HPHA 1T98A 1XTAA 3RKXA 1FJLA 1IUFA 1SAUA 3BG3A 2KIQA 1Z7LA 2JSPA 1MSFC 2OCEA 3BCBA 2VJJA 2BYVE 3V4GA 1KYWA 1ON1A 2EQRA 5DM7F 2CV1A 5EGOB 3TMOA 4WK8F 1JGGA 2K7LA 3BQZA 3JRAA 3X2QH 3RJPA 2CG4A 3WG7H 4DYCA 5B1AH 2HVQA 3LSJA 4MQVA 4UVAA 4ZJZA 1U3EM 2COMA 2EFOA 4M3FA 4AUXA 2FA5A 3E97A 4DYRA 3F3XA 4GXOA 1LEBA 3HRUA 2L9SA 4XLPF 1LB2A 2EIJH 3WTTC 2DK8A 4BQAA 2QSHX 3FMQA 4U87A 4UXNA 1RPWA 4Y3OA 2DO7A 5F0HA 1WKMA 2WWYA 3KYDB 3IH3A 1GXQA 3G1OA 1QQIA 1Y6IA 3S1MJ 1XGSA 2DA3A 1P9QC 4P55A 3MKWB 2YPRA 1JGSA 2RV8A 4U7DA 4P1WA 2M2EA 4JX4A 1AKHB 3N4MA 2L9VA 2QYOA 3DKWA 2WC2A 2OZUA 1JJ8C 4HV5A 3PFYA 1J7KA 3CMEI 4E6KG 1LPQA 1JHHA 3IH2A 1O3TA 3TDUC 4PJLA 4HDVA 1WRJA 1LFBA 1VFCA 1YO5C 3TDZC 3NARA 5D8LB 5L3BA 2L9RA 2K4BA 3I55I 2JPCA 1E2XA 2FSWA 1ETOA 1X3WB 3ELKA 1OYWA 3E5UA 3O6BB 1EKEA 1RKWA 2I5UA 2KJCA 3HPGA 5D4SA 3K4KA 3I59A 4LLLA 5FJ8J 2ZXWH 4IOAF 1UHSA 3M1CA 5EDNA 3PSIA 2R5ZA 3BG6A 1QVTA 2G9WA 1AU7A 2ZJ2A 4LIUA 3ABMH 4B47A 3R0AA 4XBFA 2TDXA 1U2WA 3GYHX 4P9FA 3S16J 4RB0A 2V9VA 2ZO4A 3BY6A 1LE8A 3MKZA 1DPUA 2K02A 2OTJI 1I6HJ 4IHSA 3T1BA 2MBFA 5HDNA 5JVTA 2E2HJ 2R7ZJ 4LG3A 3CDLA 1SFUA 4RMNA 2BXZA 1QZZA 4HRIA 2EZKA 3ZCOA 2VOPA 2PMUA 5EEAA 1SFEA 1HXDA 5FKKA 2ECBA 3LNQA 3MAJA 2NS0A 3NRVA 4JQFA 5H20A 3W6JB 4K2EA 1MMSA 1AOYA 3OYHA 2R7FA 1VQ9I 1YI2I 4YFNF 3ERED 3CF5F 2F5VA 4GO1A 2KIUA 2CFOA 3M8EA 5F04A 2JZYA 1TTYA 1VNDA 1I3QJ 3CC7I 4XMYA 1ZARA 2YS9A 4JP0A 2EILH 1X1BA 1DU0A 3P7NA 2LF7A 1VQ4I 2LDUA 4BHBA 2OBPA 2QUFA 1AHDP 4DW6A 2Y31A 4BKXA 4IQ4A 4MTDA 1VQ8I 3T0YA 4A3GJ 2DA4A 2FJ1A 1SD4A 2HEOA 1FP1D 5DDGA 3CLOA 4PUSA 2MYSA 3GLLA 5H6QA 2JVHA 2A05A 3F8NA 1QRYA 3EUAA 1YW9A 4A0ZA 1UB9A 4U0WA 4HF0A 3H5NA 5FLXZ 4HBLA 3F23A 3EETA 3MFKA 4EATA 3I56I 2XRNA 1R36A 4EJVA 2L4AA 3KP2A 4KIGA 3ZMSA 5F1RA 2AQFA 2MD5A 2QENA 1BL0A 2X9DA 5ERIA 4AVPA 4B44A 1TW3A 5F64A 3GXOA 1YLFA 1SFXA 2D45A 1QPIA 4EM2A 2Z3YA 3OIPA 2LKPA 2ZXIA 1BR2A 1PJRA 4BU2A 1IZ1A 2CUJA 4IPAA 5LRRA 3OOUA 5DS9A 1N78A 1VQ6I 1VQPI 3DV8A 3K4BA 2GWRA 2DQRA 4E7LA 2NVXJ 2MA3A 1YW7A 3U9GA 3CUQB 3OV8A 4A69C 4HV6A 1ZQ3P 2KQRA 3SYTA 3BG7A 3OSGA 4EVIA 3EUHA 2PJRB 5DYMA 1Z77A 1VQLI 5M3FJ 3OS1A 1BOAA 2ETHA 5IP9J 2NVUB 3H0DA 4N0BA 1UMQA 2QSGX 3KCCA 1T6SA 1Z3XA 2AXLA 5E1ZB 1OCTC 4AC0A 2NVTJ 2KRHA 5C3EJ 2X4HA 1JT0A 3OYKA 3P9KA 1YFHA 3HUGA 1P4XA 3SEQA 3BROA 2QM3A 2A6HF 1W5TA 2WY8Q 1R71A 4A3DJ 5FLVA 1G59A 1K78B 3I59B 2R92J 3H1CA 3VYSB 3K1NA 3CJNA 2H8RA 3BG5A 2R0QC 2V4JC 3KYCB 5J3LA 4CXFA 2VBZA 1E3HA 1MNEA 2OZ6A 4IHWA 4UVBA 1AA7A 2X6OA 2Y9ZA 1X1AA 1ZGWA 4BJ6C 3H5RA 1XG1A 5J6XA 2BVMA 3FKJA 1GVJA 2P5VA 3MD2A 2CQNA 4CICA 3DWLE 1B1BA 4WXHA 2BY1A 3DTKA 3TBIA 5JLWA 2P4WA 3BR0A 4E7SA 3IL2A 5IOZA 3GEZA 4DIQA 1N25A 4N9IA 1ETWA 1REPC 4EJUA 4FASD 2V9KA 3HHHA 4L5IA 4KN4X 2IPQX 2YUSA 3EYYA 2ECCA 3LSIA 3HL2A 3HG9A 1FP2A 2VQHA 3RYRA 5HLHA 1USSA 3KYLA 3T5XA 4ANJA 2ZSIB 2L9NA 2QF7A 4JK1X 3W2VA 4YRVA 2HKOA 1MD0A 1LVKA 4MEXF 2N8GA 2L7KA 3IAS2 4D7NA 1S8NA 2OCCH 5BOXA 4YG2F 1IUYA 5D4RA 1ZKGA 2MD0A 4HLYA 2KP6A 2L7ZA 5CQGA 5EJCA 2JUGA 2FOKA 5KVRA 4A5MA 3BR6A 1XSDA 2HXOA 2VT2A 5F6FA 2O8KA 4BNCA 1Z6TA 3HM5A 1IN8A 2UXNA 3QYFA 3L00A 2VC1A 2R7SA 3MCZA 4XK4A 3HB9A 1WHUA 4BXUA 3UKGA 4XLEA 2XSJC 2YX7A 3LSHA 2CGPA 1ZH5A 1TZLA 4EMSA 1T0FC 3S17J 3RQ4A 2HVSA 4OOIA 1OFCX 3H3ZA 2EIMH 1YITI 1S9HA 1QA6A 4L0ZB 3FMRA 2IXSA 3U1KA 2LFBA 1W7PA 3BJAA 5CQEA 3FMSA 2HZDA 3R60A 4XORA 4A6DA 4EJWA 1VTNC 1G6NA 4XKVA 2VJ4A 3TOAA 4OAYA 3HC7A 3TO9A 3G4SI 3F21A 1IN4A 4BQOA 3IC7A 2M7BA 5KAFC 1VQMI 3K4MA 2KJBA 2BOLA 2W84A 2KL4A 1SD7A 3SDBA 3R6SA 1JTXA 2DMUA 4ZC3A 3HKZA 4F3QA 2MSYA 1ZG3A 3E6MA 5IP6A 1N77A 3HHGA 2DOAA 3DTEA 1B8IB 2HGCA 5J8FA 2L01A 2YR2A 4N9HA 4ZDPA 2EWNA 3KFWX 3OYGA 2TCTA 1U5TA 3A01A 2D1HA 2NOGA 3V7RA 1A31A 3PO2J 4D5FA 3GFLA 3QRFF 2CW8A 3LA2A 4BQNA 4A3EJ 1TWHJ 4WXDA 5DCMA 3FK7A 3QPTA 4BEHA 3C3WA 4E7JA 1SEUA 3CO6C 3SFZA 4CCOA 3S3MA 5FKNA 3MZYA 3CP2A 4L9NA 4Y33A 3H9GA 1EH8A 3LL7A 3ZMDA 2QQ9A 1L3LA 1FYKA 2QKLB 2OQRA 1RETA 2ZXHA 2HZTA 1XS9A 4B4CA 1U8RA 1WJFA 3S32A 3KETA 3SHFA 3FISA 2ELKA 2OTLI 3LFKA 3V42A 1QGPA 1FX7A 4BE2A 2RC4A 3CJTB 1K79A 5D6EA 1BIBA 2AHQA 4MTEA 5ICCA 2VB6A 2VUMJ 4HSRA 4G8XA 1MMGA 2ISZA 2XHKA 2Y75A 3V8LA 4BY7J 3B73A 3UR3C 4V2GA 4UUVA 3E6BA 5HODA 3ZN1A 3J7AY 2UUZA 4XR6A 2QVOA 1MDMB 5B66C 3J81K 2JVGA 1Q1VA 3KX2A 4HLXA 2EPFA 3T8RA 2XAHA 3ESWB 3RPUA 4ESJA 3S2DJ 5EEHA 5HDKA 1DU6A 3GWZA 4WF2A 3N05A 2X51A 5LRSA 1ZAOA 3WG9A 1S7AA 1GT0C 4ZDOA 1WI3A 5DV5A 1A6QA 3HRSA 2XVCA 1CGPA 2Y0SN 2M5WA 3Q0WA 2BV6A 2VBXA 4MNUA 2ZMEB 5LD2C 3C18A 4L5EA 4LJZF 4RB2C 1MBEA 1VQKI 4BEHB 3LMMA 3DXJF 4LB5A 2ISYA 3CF2A 3P5JA 3FXLA 4WWCA 2A3SA 2IEKA 4HAMA 3S15J 3M8JA 1WJEA 9ANTA 5D5XB 3K1PA 4C30A 2F6CA 2DOFA 2HYGD 2Z5UA 5HS7A 2O61A 4WXCA 3BR5A 2DMQA 1E17A 2ZJRF 2F4IA 2P5LC 3LSTA 2LREA 2XAJA 4XRMA 2DYRH 1R1VA 2HWVA 5HLTA 4UV8A 1ZTRA 2NNNA 1VF9A 5EZHA 1I27A 3K6GA 4O5VA 3KP7A 4A5NA 4KA4A 2CUFA 2DJNA 1HQCA 3KZIC 3R0JA 2Q8KA 2LR8A 3FZVA 2CSOA 1V54H 3VFZA 5LFAA 2M4KA 4AIDA 2M30A 2RREA 5IY5H 2VLAA 1W7PD 3OY9A 2BY0A 4U0VA 3OYFA 2PX9A 3BR1A 5E1WA 3FXMA 2DYSH 4R8HA 4A0YA 1ZRFA 1B72B 2KIFA 1SMTA 5IPAA 1F43A 1FEXA 3BTJA 1T33A 3GZNB 5D6FA 3KE2A 2YSRA 4AIHA 1IRZA 3COAC 3DKYA 2PEXA 1K6OA 2X1EA 1U6GA 5F1JA 5LEJA 3OYBA 2MH2A 1D1BA 4PJ0C 3K4LA 5D5WB 3ZR8X 2RQPA 2WB1N 5E3MA 3IWZA 4U7BA 2FD5A 5FFZA 4D1QA 3IKTA 3KEOA 4I99C 3F22A 4ITVA 1IO2A 3WGGA 3K4NA 2E5NA 3LWFA 4C3JJ 2AS5F 3W3CA 1CQTA 2QCOA 3QU3A 1G2HA 2L2OA 1EV7A 1HDPA 4I0BA 1JUPA 2HQ5A 4NQWB 3H3VK 5C4JJ 5CYVA 2PN6A 2Z99A 3LQQA 1TT5B 3ULQB 1WGXA 4HOBA 3ZMUA 3M1EA 4ZYHA 3RDIA 2DAOA 4N4OB 2OA4A 3MWMA 3CCEI 4B3XA 2J5OA 3EUHC 4PGHA 4RAFA 2P81A 1V55H 2KT0A 3DBRB 1IV6A 3QYEA 1R4MB 3ZGKA 1QPMA 2HPIA 2MW8A 1UHMA 3N97A 1S72I 2QGUA 5E8IA 2JJ7A 5EG0A 1UG0A 1WJCA 3BJ6A 4ZYEA 2PBIA 2ZMEA 4A3MJ 4A3LJ 3OYDA 3GF2A 3JAMK 4MLOA 4CYCB 2FUG2 2QWWA 2HOSA 1L0OC 1JKOC 3SXYA 4L9TA 1FTTA 4CCJA 3CCRI 3RTRA 1NK3P 5F08A 3DU5A 2JWTA 2A6TA 1WH5A 4I09A 1APLC 4G6TB 4XOTA 3K2ZA 4CSWA 5HVQC 1SD5A 3VOEA 4S0HB 2JT1A 1BW6A 1R00A 5EGOA 1SAXA 4X1EA 2VBWA 3FX3A 2R4GA 3M07A 4BY1J 5EF6A 3DQVC 2CQXA 1HLVA 1Y56A 4HX8A 1YRNA 2X48A 1ZELA 4LLNA 2FMLA 1YJ9I 1HF0A 1YS7A 4PK4A 3S93A 4CCMA 4ENKA 2VN2A 1J9IA 3HOXJ 4RGUA 1R1UA 4PJNA 4DGWB 2ZC2A 1GVDA 1FSHA 4ZYAA 1OCCH 5E17F 5EZGA 1JTYA 1ERDA 1D0YA 5DM6F 4EJTA 4ABZA 1NG6A 3FHNA 3IHUA 2R7OA 2OUMA 5DCFA 1R4NB 2PG4A 5FROA 4E7KA 3E7LA 1W4MA 5IT9Z 2M34A 2Q1ZB 4IRGA 1LEAA 4J01A 3DEWA 4BE0A 3WE3A 3BPXA 1EH7A 2VJ5A 5DEQA 2QQBA 3J7ZI 3DBHB 3ASNH 3HSRA 2NYXA 5HLGA 1Q1HA 4EEFG 1R58A 4C2MJ 2FBKA 5FKMA 4YFKF 2LK2A 5CJ9A 2D1VA 3DU6A 4DQ2A 1K4TA 4DBRA 4ZH4F 4JOMA 3PNYA 2DMTA 2VQLA 4RS8A 4A3FJ 4Q47A 5IYBJ 3CC2I 4J19A 1ON2A 2ZSHB 3WTVC 3TQNA 2XF6A 2XF7A 3AG3H 3ZXSA 1BI2A 3OR1C 3A1YA 3KZZA 4HQEA 1G3YA 1U8BA 2VI6A 4M6YA 2L02A 2MABA 2KLOA 3I3LA 2P8TA 1B72A 1LNWA 2E5ZA 2LTPA 4A2UA 5B1BH 3M8FA 1IW7F 4PSWA 2J5PA 4W1UA 1Z21A 2VKDA 4ESFA 4AYBN 4ESBA 3ABTA 1NG7A 4BYYA 4ENMA 5M3MJ 1XX5A 2MH9A 2QQAA 3Q9VA 2ELJA 1B59A 1P7JA 3TEDA 1IRXA 1A04A 2L0KA 2XKPA 3DFGA 4DNCA 3WTWC 1YS6A 4HF1A 4AM3A 2R7RA 4ZDLA 2ZBKA 4II2A 1I50J 4L5JA 1POGA 2K9LA 2XGCA 2ELHA 2LC2A 2E7XA 2KPMA 3L2VA 2XPVA 5JHUA 5FD6A 2W4SA 2R7QA 4KIFA 1KU2A 4Y15A 3HOSA 1TWCJ 3PNTA 1I5ZA 2ZFUA 4B3AA 1LDJA 1IC8A 4BAYA 1FOWA 1HKTA 3JRIA 2HOEA 1JE8A 3P9CA 4LIVA 1P7IA 2DA6A 3DF8A 5ILSA 4AIKA 2IS2A 1SD6A 1R22A 2CUEA 1BI1A 3LSGA 3ZQFA 2HI3A 4NBQA 2H94A 3U1DA 3EDPA 4B43A 1ZYRF 4HPQA 1TQMA 1ZREA 5B5EC 1DGRM 5LGUA 5LHHA 3JTGA 2K5CA 4RAGA 3R4KA 2E1NA 4BE1A 4HG2A 5GTIC 4X6AJ 2G0EA 2HU9A 1IRFA 2FOWA 3CMAI 3KEQA 4LLGF 1XPXA 1DUXC 1IGNA 2EJRA 4UY8I 5CVIA 4IX7A 2IGNA 2L5QA 4HYEA 2V6EA 3PQKA 2PMZA 4E7IA 3C1DA 3AG4H 3BCAA 3DPLC 3Q3SA 1UELB 2WAQN 2DMPA 3W2WA 1XCBA 2QBYB 2EH3A 4AU7A 2COBA 1KZHA 4LK1F 4XL9A 1Z67A 2XPUA 1BOBA 4Q4ZF 3S14J 5LBQA 1V5EA 4I98B 1FIAA 4I7HA 1MGTA 2LRDA 1Y8RB 3A2KA 4KDPA 2V7FA 1A35A 1JI8A 2BGCA 4LMYA 4D9JA 3FDYA 2IRFG 3VODA 3CESA 2VE8A 2HNHA 1T56A 2DBBA 2GBYA 3DTIA 2BY3A 2VKEA 3G1MA 5E3LA 1TW2A 3DBLB 3HDDA 1Y1WJ 3SQNA 2HQAA 3ML6A 5ICFA 3ZMVA 4BL0B 5TRDA 2IJLA 4RDUA 3FWEA 1GHCA 1J2XA 3LSRA 3HOWJ 2EZLA 3PM1A 1AWCA 4XLCA 2X6XA 2KZVA 4CCNA 4BH9A 2H27A 1WFXA 1MW7A 3OIOA 1U0JA 2M4GA 4G12A 1X3ZB 4RB1A 3JREA 2OPTA 2Q2EA 5J1UA 1NH3A 3GUDA 4YELA 5J40A 1YIJI 3I58A 2NAZA 1MBGA 3L2RA 5GADJ 2RNJA 3FXJA 2GA2A 4HX7A 1WQ2A 4L9VA 2KIMA 2EINH 1UCRA 2P0WA 3ZP5A 1SVOA 3GTMJ 2BEOA 4PJMA 1Z1DA 3HTSB 2B9SA 2B63J 2LYCA 4BQQA 3VSKA 3I9V2 4HZFA 4BGDA 1X4PA 2DW4A 3SJMA 3F0CA 3GLXA 4BDYA 2IP2A 1KGSA 4KFCA 4ENNA 2WAFA 2EIKH 5FLXK 1JUMA 4FE7A 2LY1A 5K7FA 4AWXB 3GO5A 2ZKZA 2LSOA 3M4OJ 5FFXA 2ZXJA 2LH9A 2VC0A 2HVRA 1XGNA 2X0LA 4OIOF 3IH4A 1X4OA 1GV2A 2CS3A 1DDNA 2CH0A 5CLSA 1EA3A 5KHDA 2A5YB 3TW6A 4C3IJ 1ODDA 3FBIB 1RNLA 4KT6A 1H9TA 3LAJA 3TGNA 1QNTA 1A5JA 4D7MA 1LUJB 3O2PE 1VZ0A 3H5AA 3QPSA 1FT9A 5L3FA 4EQQA 3MKYB 3WU2C 3MZHA 1T08B 3KP4A 3HGYA 5F27A 3CO7C 3LA3A 1KQ8A 3L7WA 5J1RA 2W00A 5BPIA 2P7CB 4RAYA 1NTCA 4XLFA 1RR7A 1WJ5A 3GTQJ 3O8HA 2ACJA 2STTA 1R49A 2GOMA 3B6CA 1T2KA 1RESA 2RNGA 3WE2A 4CZCA 4IRHA 4B48A 2G7UA 2X6WA 4BJTA 3ZOBA 2P6SA 1JXSA 2V26A 1F36A 1ZN2A 3CD6I 2O5RA 4HF2A 1W0TA 4IHYA 4FTHA 3I54A 2X1CA 4HNVA 3T8TA 3WTSC 2AO9A 2JSCA 2W82A 2PI0A 1LDDA 3HRTA 2Z1DA 1KQ9A 5FGMA 4L18B 3BC8A 1DP7P 3Q0VA 4OINF 4RB3C 2LP0A 1WH7A 2EZHA 5E1XA 4GCVA 3FHZA 2ZNZA 1SANA 2JUCA 3NQOA 2DFIA 3IKVA 3VYRB 2CMPA 1W5CC 5K5RA 2JA8J 4F91B 3CUQA 1MBFA 1S7OA 2IW5A 4C2UA 1PYVA 4NNJA 2PLYA 6PAXA 2IGKA 4MEYF 5IP7J 2R7WA 2XKOA 4KT5C 2EFNA 3F8CA 1IDZA 1D5VA 3ZRGA 1RI7A 1FTZA 4BACA 2M87A 5ILVA 4ZZLA 2XAUA 1B9NA 3SEZA 1BC8C 2HR3A 5L3GA 2E1OA 4M72A 1XMKA 4BXFA 2V1NA 3OWTA 1YQAA 4CO8A 3AFHA 4F52A 4Y52J 1LFPA 2XGXA 3WTZA 2R3SA 1JKRC 2Z33A 5DUIA 1X1PA 3A01B 5LHIA 2RN7A 4CH7A 1YHQI 1IAWA 1S6LA 4BHCA 5L3EA 4M3GA 3IAM2 2HKXA 1XGMA 2KDOA 1BI3A 4M3EA 2Y2ZA 3RZDJ 1UG2A 3M9AA 1S7EA 1DPRA 2TRTA 3VYTB 4EJOA 2F4MB 2XPWA 1YTYA 3L9FA 3DCFA 3C2HA 4PCQA 1HW2A 2DMNA 5KNLA 4FHTA 3KP6A 2DK5A 3ECOA 1HKSA 3D0SA 4GFBA 3DEEA 3LOCA 3AKZA 3H35A 3JCUC 3KZYA 5FRMA 3VPRA 2ZB9A 4CZZA 1ORKA 1J09A 2JK3A 2HDWA 2ZJQF 1QU3A 2G7HA 3A4CA 3ECHA 3ISPA 2QZ8A 1P4AA 4DBQA 1HKQA 1ZG1A 2LY2A 1ACIA 2IA1A 2XIGA 4JYKA 3TP3A 4EM0B 3OYLA 3OSFA 1OKRA 2DA1A 3C7JA 1HA8A 4Z6YA 2BW3A 5TGTA 2VODA 5K5OA 2BBYA 2W24A 3K4CA 4QLCU 1PVEA 1ZK8A 4M3BA 4OIRF 1XMXA 4YIRX 3D5LA 2K40A 4M9XA 2E19A 3F8BA 4RM2A 4Y13A 4J00A 1QBJA 1FBUA 2GIVA 2W48A 4I01A 4QIWN 1ETQA 3EYIA 5D8KB 5IYCJ 2KRCA 3GX4X 2M1BA 2ZFWA 1FMWA 3I4PA 1O7FA 1FBSA 1TNTA 3QU6A 1LJ9A 1XDSA 2F2EA 3KLNA 3JR9A 4PFPA 1Z0XA 2GXBA 1Z91A 1ZRDA 4FE4A 2Q0OA 2VKHA 2LOOA 4M3DA 2EA2A 4NB5A 3IV5A 4UUSB 1ETVA 1P4WA 2O8XA 4C3HJ 1J75A 3AG1H 1YYVA 3QYBA 4IHTA 2M0CA 2RKHA 1BW5A 3SDGA 2L3DA 3RPQA 3LFUA 2M8EA 4IQJA 4CYDA 3MMYB 3ZQHA 3K70C 3RCOA 1FY7A 3K2AA 3BWGA 4XQFA 4XN0A 3H0GJ 1HCRA 2IVMA 4Q48A 2PFBA 2CJJA 2XAFA 2XROA 3QQAA 4OU0A 5K7ZA 4CGZA 1G3WA 1RUNA 3K1MA 2VBYA 1I3AA 5GAHJ 2DFEA 2V9PA 3QOPA 2KKOA 4RBOA 2ESNA 2MC3A 3TKYA 3H9JA 1WVRA 2MLKA 2YU3A 4IOCF 2GXAA 2XAQA 2JMWA 3F8FA 3JRGA 2A07F 2WA0A 2NVQJ 1GUUA 1I39A 3GTJJ 1D0ZA 4JBAA 4IHXA 1BR1A 3S1QJ 2VIXA 5TJJA 1H88C 1YE9A 4IVNA 4ZYGA 2YX4A 3KPHA 3LA7A 1ZHFA 3JW4A 3WGHA 2DXIA 2XC7A 2A69F 3E5QA 2IGMA 4HDUA 3B6AA 4MQ9F 2VE9A 1ZGJA 1YW8A 4MHGA 4FCYA 2KRFA 3ZQQA 1GXPA 1T95A 1TWGJ 3QPHA 3I71A 3OYEA 2KISA 1ZGAA 1R23A 4XKCA 1EF4A 2ID3A 2F48A 5F0FA 1A6IA 1D1CA 2LBFA 5KK1A 2GLOA 4KISA 1B6AA 2B0LA 3HUGB 3PQJA 3WODF 2HQRA 2CW0F 5DTDA 5JVGF 1O57A 3HEFA 3OOPA 3S8PA 1SVMA 2CU7A 4RAZA 1P2FA 2OD5A 4YIIA 3J81Z 4G7OF 2D2WA 2IA0A 4F55A 2DDAA 3MZ8A 2GM4A 4OIPF 2B7EA 2PJPA 4CCKA 2GA1A 2F5EA 5EEGA 4GYIA 5AIQA 3K4JA 3GFMA 1B4AA 1MJ9A 4A3BJ 2EBIA 4LB6B 3HSEA 2DA7A 2QEXI 4HEA2 3ZN0A 5LHGA 3ONQA 4XSZF 1GV5A 3PUBA 1H0MA 1BC7C 5JFRA 5E20A 1G4DA 3OR2C 2CRGA 3VYUB 1ITYA 5JR3A 5E3NA 4NC7A 3CUOA 1LFUP 2X85A 4UV9A 1K61A 1R6RA 3ZQCA 1HW5A 1QHGA 1FYLA 4BXXJ 2W7NA 4MIMA 3RQIA 3HIFA 1K4SA 3V7CA 1H9GA 1V5GA 1M1EB 3QP5A 4XOPA 4HNUA 5CPRB 4CUGA 3Q0UA 2CO5A 2OAZA 2ME0A 2CWEA 3F6VA 1X2MA 4XLAA 1HOMA 5C44J 2XRLA 4EM1A 2QQ8A 3GTKJ 3FK6A 1Z3YA 2DPUA 2I8DA 2EFPA 2BHZA 3ZMTA 4R1HA 1N75A 1X2NA 2DT5A 2X1DA 1UAAA 2E34A 3G2BA 4LK0F 2A68F 3EUKL 4BBRJ 5HDGA 1R5GA 3ERMA 3BLYA 3K7AJ 4LFUA 1YOVB 3BZ6A 3KLOA 3VB2A 1FWZA 4D0PA 1LQ1A 1XMAA 1HC8A 2FU4A 3I4NJ 1KONA 1A36A 2UXXA 2M7AA 1MBKA 2L7MP 4A0XA 2DN0A 3MQ0A 5E3OA 1ENHA 2C6YA 4M71A 3G6EI 3D5RC 3SFIA 5HS8A 2JPBA 1SMYF 2XAGA 3OL3A 2FX0A 2DJIA 2ID6A 5F0CA 3TOBA 1TP4A 3L2WA 2BVLA 3RKQA 5LLQA 1FOKA 1W5SA 3EQLF 5E8GA 5GAGJ 4G7HF 2K4JA 1WJDA 3HJEA 4XKWA 5HNHA 1F4KA 3KP3A 1USTA 4RLFA 2PMHA 1WJAA 2K9MA 2VQCA 3E5XA 3TW7A 1X1DA 2LLKA 1UZCA 5GPAA 1PUFB 2K3PA 1S29A 2VKVA 1QO0D 1P92A 2GXGA 4I76A 4ZTFA 2K9NA 2FRHA 4A3JJ 2RQQA 3GTOJ 2KZGA 2RVCA 1W0UA 3HOYJ 3CUQC 1MH4A 2DODA 1W1WE 4G6DA 4KMUX 2AXTC 2OC6A 5GP9A 4I2OA 3EPZA 4M9SA 1QVUA 4II3A 5GTHC 2CV2A 1V3FA 3PIOF 4HW0A 1BM9A 1D8KA 5IYDJ 2JN6A 1IN5A 4UHTA 1MNDA 3FIWA 1LE8B 1Z6RA 5L3DA 2LBFB 2Y9YA 3OMYA 2EV6A 2IGOA 1IXCA 2DOEA 4S04A 2VJIA 4TV7A 3Q5FA 4ZYDA 4IEJA 2NNYA 4A3KJ 2WADA 2W57A 4DOZA 5FO5A 3JTHA 3CJRB 3A02A 1S5LC 1XSVA 5HOOA 2P6TA 3HBLA 4PZJA 2K27A 4NQWA 3CCLI 2E2IJ 3ROUA 3C2BA 2JA7J 3CCMI 3A03A 3JSPA 2E1MC 1I1SA 2F5CA 1MKMA 2GIZA 2M9HA 1YRNB 1FOXA 1J5YA 1HSJA 5JHFA 5IT3A 2WV0A 4P9UA 4KITB 1G3SA 4LGWA 1IXRC 2WBMA 4NC8A 5BNGA 1IJWC 3G71I 2R5YB 1O3RA 1K6YA 2XB5A 1OLTA 5K5QA 4E7HA 3L2CA 2R93J 4E4HA 4EGZA 3HOVJ 1R5ID 1MZBA 2NVYJ 1BJZA 4YFXF 1IF1A 2JA2A 3NAUA 3OS2A 1JKQC 1WI9A 1TQPA 2DA2A 1BA5A 3GFIA 3JRFA 2UZKA 4F93B 3H3UA 1ONVA 3AL0B 2EK5A 3R61A 4DZJA 3G3ZA 1C0WA 1G3TA 2XV4S 3JRDA 1XDUA 2PJRA 4YEJA 3H36A 5ICGA 3CCQI 1ZRCA 1E3OC 1XD7A 1KQ0A 5GPCA 4CHUA 1IN6A 1VI0A 1NHAA 2M8GX 3RSNA 4ZTJA 3WU1B 3LQRA 3PJRA 3HKZN 4XLNF 2HOTA 2LY9A 5CKTA 5ILUA 2FQ4A 3Q9SA 3JSOA 3OYJA 1OPCA 2O0YA 3K69A 4MFDA 4XIDA 1EJ9A 1VQNI 1FIPA 4XM3A 1W36C 4S05A 5DD4A 4BHPA 4C9YA 1P6RA 5GAEJ 1HW1A 2L54A 3CCVI 2A61A 4FISA 1JKPC 3QPLA 3I4MJ 1B8IA 1TBXA 3FXUA 4RA2A 3G73A 5J4VA 4OMYA 2E60A 5IOYA 4KUMA 2VPLA 2HXIA 4XICA 3C2GA 5J4YA 3F9KA 1D0XA 2DFFA 3DEUA 2EV5A 3RYPA 2MLGA 3DPTA 1SC7A 3FXRA 3V7SA 1XC5A 2H1KA 2Z16A 3MKLA 2VASA 1U9OA 2Q2EB 2W85A 4FETA 3ZQ7A 3JAMZ 5FKOA 2Y0MA 1FBQA 3HOZJ 1OCRH 3CP8A 1J0RA 2RDPA 2NS7A 3BTCA 4HNTA 1IRGA 4Y7NJ 2WTEA 1MJBA 2BZTA 3IUOA 5BPDA 2GQQA 2WB1A 2EFWA 2OF7A 1RRJA 4OMZA 1TQIA 5A2QK 4DYQA 4CDGA 2MG4A 2FNPA 4QPOA 2HOAA 3ASOH 2HDDA 3GZ6A 2FMYA 3CCSI 2O3FA 3H92A 2DA5A 5C4XJ 2EFQA 2NXNB 1FPQA 2R7DA 2DU9A 2Y69H 3TO6A 1GDTA 1HSTA 4HA8A 1XN7A 1ETKA 2LNBA 4UB6C 3J7YJ 2O6GE 2HYJA 2EA4A 3PFIA 1U5TB 2FBHA 1SFKA 1QZEA 1YG2A 4C2TA 3E1SA 3DP7A 1MMNA 1O7LA 1JHFA 4KN7X 1OCPA 4ON0A 4X0GA 5TISC 2Y0SA 1T38A 4G7ZF 3IWFA 2HFHA 2CUZA 5H6RA 1WZ2A 4QSHA
chains in the Genus database with same CATH topology
3DEEA 3AKZA 3OYCA 3H35A 1Y6IA 2M0MA 5FRMA 5FRNA 3DKYA 3MKWB 1P9QC 2E1MB 1J09A 2X1EA 2HDWA 4P1WA 1QU3A 1GLNA 3A4CA 3OYBA 2CW7A 1D1BA 2W1OA 3K4LA 4DBQA 2LY2A 3ZR8X 3PFYA 4U7BA 4D1QA 2R7XA 4P5OA 3OYLA 4E6KG 1HA8A 4ITVA 4BJ5C 3K4NA 2E5NA 2BW3A 4PJLA 5TGTA 3W3CA 1YX5A 3K4CA 2L2OA 3D5LA 2UWMA 4NQWB 4RM2A 3K10A 4J00A 4XNFA 2LG4A 4DJAA 2KRCA 3VWBA 3HPGA 4N4OB 1FMWA 3K4KA 4B3XA 3EUHC 4XONA 4PFPA 3QYEA 3M1CA 3PSIA 3BG6A 3ZGKA 3FBNB 2HPIA 2VKHA 2LOOA 3LSMA 1UG0A 1WJCA 4LIUA 4B47A 4CCLA 2GOXB 4QPQA 3OYDA 1X1CA 3QYBA 4MLOA 2FUG2 3MKZA 3LFUA 4IQJA 3MMYB 2XF5A 3K70C 4CCJA 3RCOA 4LG3A 3RTRA 3GBGA 3DU5A 4RMNA 4XQFA 4XN0A 3OS0A 3HOTA 2A6TA 4G6TB 4XOTA 1G8XA 3TL4X 4HRIA 3ZCOA 4CSWA 5HVQC 1MMDA 2WAEA 3UNGC 2R4GA 4JQFA 4F92B 3DQVC 4IZZA 1Y56A 4NUBA 3H9JA 3OYHA 1ZELA 2AQEA 4PK4A 3S93A 4CCMA 1QHHD 2VXZA 4GRIA 2WA0A 4IKFA 2F5VA 4PJNA 4DGWB 2CFOA 4ZYAA 1D0ZA 1BR1A 2VIXA 1YE9A 1ERDA 4XMYA 1D0YA 1X1BA 2DXIA 2XC7A 3FHNA 1NG6A 2R7OA 2IGMA 2OUMA 3SZGA 5FROA 4E7KA 3ZQQA 4IQ4A 3L2UA 2Q1ZB 3RPUD 1T95A 4J01A 3OYEA 4BE0A 4XKCA 5HNFA 2A5WA 2VJ5A 4PUSA 2KHMA 2MYSA 1D1CA 2LBFA 2JVHA 4BDZA 3EUAA 4KISA 3OYAA 3HUGB 3H5NA 3DU6A 4DBRA 4JOMA 3PNYA 3S8PA 4EATA 2VQLA 2MC4A 4F55A 3PSFA 3S3NA 2ZSHB 2DT7B 4CCKA 2XF6A 2AQFA 2XF7A 1OR7C 3ZXSA 1LDKB 3OR1C 3A1YA 3K4JA 4B44A 3W2AA 2IS4A 2MABA 2KLOA 3I3LA 4HEA2 3OIPA 2ZXIA 3ONQA 2E5ZA 1BR2A 2DT6A 1PJRA 3PUBA 4N4NB 2CUJA 3U21A 4BU2A 3OOUA 1N78A 4PSWA 3OR2C 1Z21A 2VKDA 3K4BA 3NWTA 3VYUB 4E7LA 1NG7A 3OYIA 4XKBA 4NC7A 1X19A 2X85A 2KQRA 3SYTA 3BG7A 2PJRB 2ELJA 4OAZA 1R6RA 1IRXA 1QHGA 2W7NA 2R7RA 1W36D 3OS1A 4ZDLA 3H0DA 4II2A 1V5GA 4RLQA 2K9LA 4HNUA 4XOPA 5CPRB 1Z3XA 2LC2A 2WAQA 4CUGA 2KPMA 3L2VA 4E7ZA 3AL0C 2W4SA 2KRHA 2R7QA 4AVZA 4XLAA 3L2QA 2QKMB 3OYKA 3HOSA 3PNTA 2ZFUA 3SEQA 1Z3YA 2WY8Q 2I8DA 3E0JB 1G59A 4BUPA 2XDVA 4LIVA 2IS2A 1N75A 2X1DA 1UAAA 2DCEA 3G2BA 3LSGA 3VYSB 3EUKL 2V4JC 3BLYA 4B43A 4KJZA 4HPQA 1DGRM 1MNEA 2K5CA 4CA0A 1AA7A 4BE1A 4HG2A 3IP4B 1X1AA 4BJ6C 3H9QA 3H5RA 2HU9A 3DLAA 2VQGA 1KONA 2BVMA 3FKJA 2M7AA 3MD2A 4AYBA 3QOEA 3DWLE 4IX7A 3DTKA 2IGNA 3TBIA 2L5QA 1TT0A 3D5RC 4E7SA 2V6EA 2PMZA 4E7IA 4DIQA 3OL3A 4FASD 2V9KA 3BCAA 2DJIA 3DPLC 3L2WA 2BVLA 3LSIA 3HL2A 1UELB 3HG9A 1V5FA 2VQHA 3W2WA 3KYLA 4AU7A 4ANJA 1FMVA 5KCMA 1WJDA 2L9NA 2ZSIB 4XKWA 5HNHA 4XL9A 4RLFA 3W2VA 4YRVA 2IS1A 2R7VA 1WJAA 2K9MA 2VQCA 1BOBA 1LVKA 2HPMA 2CV0A 2L7KA 1X1DA 1V5EA 3IAS2 2LRDA 2K3PA 3A2KA 1D1AA 2IS6A 2V7FA 3OYMA 2MD0A 4ZTFA 2KP6A 5CQGA 1JI8A 2JUGA 2RQQA 3FDYA 4D9JA 3CESA 3LSKA 2HNHA 3DPUA 3DTIA 2OC6A 3EPZA 2HQAA 3QYFA 4II3A 4BL0B 2R7SA 2CV2A 2VXDA 2M3AA 2XSJC 3LSHA 4XLEA 1TZLA 3VDXA 1T0FC 4HSTA 3RQ4A 2HVSA 1MNDA 4XLCA 1S9HA 4XLHA 2X6XA 3CJQB 2KZVA 2LBFB 2IXSA 4CCNA 3PL8A 3OMYA 5CQEA 2IGOA 2HZDA 1WFXA 4XORA 1MW7A 1U0JA 2M4GA 2VJIA 4XKVA 2VJ4A 4YELA 4OAYA 3HC7A 1E0EA 3L2RA 2WADA 1LKXA 4DOZA 4BQOA 2M7BA 3CJRB 3K4MA 2BOLA 4R79A 5HOOA 1DGWY 2P0WA 4H4KC 2KL4A 3SDBA 2MFZA 4PJMA 3CMMA 2NOJB 4ZC3A 3HKZA 4F3QA 3QODA 3OYNA 2LYCA 4BQQA 2WY7Q 3I9V2 3VSKA 2E1MC 1N77A 4BGDA 2DOAA 3DTEA 4BS9A 1X4PA 4BDYA 3HXLA 4ZDPA 5JHFA 2KMUA 3OYGA 2WAFA 3OL4A 2LY1A 3K70D 4KITB 2CW8A 2WBMA 4BQNA 2LH9A 4NC8A 4Y4RA 2HVRA 1K6YA 1X4OA 1OLTA 4BEHA 4E7HA 2CS3A 4E7JA 4E4HA 4CCOA 3S3MA 1WJBA 2CH0A 5KHDA 1EA3A 3CP2A 3FBIB 2VL8A 3OIQA 3H9GA 4LITA 4Y33A 3LL7A 4KT6A 3S3OA 3VSLA 1DQUA 2JA2A 2QKLB 3OS2A 2ZXHA 1VZ0A 3H5AA 4F93B 4RM3A 3AL0B 1WJFA 3MKYB 4OWRB 3S32A 2PJRA 4YEJA 3V42A 3PNVA 2X6YA 1DP3A 3DKXA 4BE2A 2W00A 1YX3A 4XLFA 3RSNA 4ZTJA 3NWSA 1WJ5A 2BW3B 2VB6A 4HSRA 1MMGA 3PJRA 2GOMA 5CKTA 3UR3C 2R7UA 4PFOA 3OYJA 2RNGA 4CZCA 4B48A 4BJTA 2X6WA 4XM3A 3J7AY 2UUZA 2V26A 4XR6A 1W36C 2O5RA 4C9YA 2JVGA 3KX2A 4XN3A 2X1CA 2Z2SB 3N05A 2X51A 2W82A 2Z1DA 4ZDOA 2E60A 3BC8A 2UV1A 2VPLA 2OV7A 3C2GA 3F9KA 1D0XA 3VYRB 5LD2C 2CMPA 3CZ6A 1BR4A 3DPTA 2R7TA 4BEHB 3LMMA 4F91B 3KEYA 1PYVA 2Z16A 2VASA 3CF2A 2Q2EB 4FETA 4NNJA 4C2UA 2IGKA 3D5SC 4PSXA 3M8JA 1WJEA 4PJJA 2R7WA 1MMAA 4C30A 2F6CA 3HPHA 3CP8A 3ZRGA 4HNTA 1SAUA 4BACA 1Z7LA 2JSPA 3IUOA 2XAUA 2WB1A 3BCBA 3SEZA 2F4IA 2VJJA 4QPOA 4BXFA 2V1NA 2LREA 3OWTA 3AFHA 4F52A 2CV1A 3TMOA 1LFPA 5HLTA 3K6GA 4CH7A 2HVQA 4ZJZA 3IAM2 2KDOA 5LFAA 1SFKA 2M4KA 4C2TA 2L9SA 3VYTB 2RREA 2VLAA 1MMNA 3E1SA 3OY9A 4X0GA 2Y0SA 3OYFA 4U87A 3C2HA 2CUZA 4Y3OA 5KNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4O A;  2E60 A;  1UG0 A;  2E5Z A;  2DT6 A;  1X4P A;  2DT7 B;  4DGW B; 
#chains in the Genus database with same CATH topology
 1ZR4 A;  2K85 A;  3QP6 A;  1E3P A;  4FX4 A;  3OYC A;  2L7F P;  2HQN A;  1TWA J;  1YJW I;  2L4M A;  3P9I A;  2M0M A;  5FRN A;  2LD5 A;  1U9N A;  2E1M B;  2FE3 A;  4KYW A;  1GLN A;  1U5T C;  1PUE E;  1TC3 C;  4GGG A;  1W7P B;  2CW7 A;  3O8G A;  3IRQ A;  2ZME C;  2W1O A;  2O9L A;  2XGE A;  2R7X A;  4P5O A;  4BJ5 C;  3PUF A;  2H1L A;  5LGT A;  3GFJ A;  2E1C A;  2VON A;  3SZP A;  2QA4 I;  3D1N I;  3VEP A;  3A0H C;  1YX5 A;  2BY2 A;  1Y8Q B;  4OIQ F;  3ZPL A;  3V8K A;  2UWM A;  3BTL A;  1ETX A;  3GME A;  3K10 A;  1RIO H;  2VT3 A;  4XNF A;  2XGD A;  4XSX F;  3U2R A;  2LG4 A;  3E3V A;  4DJA A;  1VQ7 I;  2DLL A;  3VWB A;  2R5Y A;  1UFM A;  3E6C C;  2GZW A;  1RKT A;  2FXA A;  1FC3 A;  4XON A;  5B3S H;  3MEX A;  4A6E A;  4EGY A;  3RKW A;  1SFO J;  1MH3 A;  1Z05 A;  1TWF J;  3FBN B;  1J59 A;  3LSM A;  4IL6 C;  3J7A O;  4CCL A;  2GOX B;  4QPQ A;  3BTI A;  3K9T A;  3AAF A;  1X1C A;  4LG0 A;  4PGG A;  1NK2 P;  2WV1 A;  1ZLJ A;  3S1R J;  4V2F A;  4A93 J;  2QBY A;  2XF5 A;  4ENJ A;  1OQY A;  3GBG A;  1U78 A;  3OS0 A;  4FT8 A;  3HOT A;  2JA6 J;  2RAE A;  3TL4 X;  1G8X A;  2LF8 A;  1OYI A;  3F6O A;  3WHB A;  1IG7 A;  1FYM A;  2OU2 A;  1MMD A;  2DFH A;  5J47 A;  3F72 A;  2WAE A;  1BJA A;  3UNG C;  1FLI A;  4F92 B;  3PIP F;  1WPK A;  3ABU A;  4GYG A;  2ZCW A;  4IZZ A;  4NUB A;  3FM5 A;  3RIR A;  3HZJ A;  5LGN A;  1OIS A;  1EH6 A;  1KA8 A;  2EV0 A;  4AIJ A;  2V6C A;  1RZ4 A;  2P5K A;  1STZ A;  2NRA C;  1SVL A;  2M45 A;  2AQE A;  3CDH A;  1QHH D;  5K1Y A;  1Y0U A;  2VXZ A;  4GRI A;  4IKF A;  4G6Q A;  3L1P A;  1IDY A;  2Z9O A;  5CVR A;  1JT6 A;  2OJE D;  1PDN C;  4WX9 A;  1FSE A;  2KDZ A;  3SZG A;  1O3Q A;  1MIJ A;  2RGV A;  1LVA A;  1RR8 C;  5M5Y J;  2HTS A;  2EZI A;  5HLI A;  1VQ5 I;  3L2U A;  3RPU D;  1ULY A;  4E70 A;  5BS6 A;  4MGR A;  5HNF A;  2A5W A;  2VPR A;  2JRT A;  2Y48 A;  2KHM A;  2HYF A;  2LVS A;  4UB8 C;  2PQ8 A;  3GCM A;  4KNY A;  4Y17 A;  1IV8 A;  4BDZ A;  3ZQL A;  1T8I A;  3OYA A;  1TL8 A;  2FBI A;  4XRS A;  3KIO A;  4EV0 A;  3JRB A;  5ED4 A;  4L9J A;  3QWL A;  4RGX A;  1R5H A;  3F8M A;  2ME6 A;  3RZO J;  2MC4 A;  2YU9 J;  3RKY A;  2GAU A;  3PSF A;  2CQQ A;  3RI4 A;  3S3N A;  2DT7 B;  4D5C A;  1OR7 C;  3GZ5 A;  5ICE A;  2HDC A;  5J1Y A;  1LDK B;  3GTG J;  2F4O B;  4FX0 A;  3W2A A;  2IS4 A;  1K83 J;  2XUB A;  2R5Z B;  2MGQ A;  3BQY A;  4N4N B;  5L3C A;  2DT6 A;  3CQZ J;  3REO A;  1O3S A;  3U21 A;  4V19 K;  4W97 A;  3DLL F;  4YIF A;  3S2W A;  3NWT A;  2ZJP F;  4IHV A;  2XAS A;  3E6D A;  2LKX A;  4Q5S F;  3OYI A;  4XKB A;  4MFE A;  1ZLK A;  1X19 A;  4FQG A;  1FNN A;  4F7Z A;  2FEZ A;  1BIA A;  4OAZ A;  4LG0 B;  2BXY A;  1W36 D;  4KIC A;  1MJA A;  2HS5 A;  1ZG5 A;  2H8W A;  4RLQ A;  3IRR A;  1H8A C;  2QLZ A;  5FLM J;  2WAQ A;  2LMD A;  3BG9 A;  4E7Z A;  3CCJ I;  3FM3 A;  3MN2 A;  3AL0 C;  4AD9 A;  4RGR A;  3CC4 I;  4AVZ A;  3L2Q A;  3FXO A;  2QKM B;  3V8J A;  2DPD A;  4IXA A;  2Y30 A;  3E0J B;  1XGO A;  3QAH A;  5BMZ A;  2JRM A;  1Y1V J;  3I5U A;  2XDV A;  4BUP A;  2V1X A;  5IT9 K;  2K3F A;  4LOC A;  3KP5 A;  1K78 A;  5JLX A;  2DCE A;  2HTJ A;  3NEU A;  1JJ6 C;  3CLQ A;  3B02 A;  4IJA A;  5K7H A;  1H89 C;  2DDB A;  2JTV A;  4KJZ A;  3GTP J;  3HYI A;  3BR3 A;  1MSE C;  4CA0 A;  1WSU A;  3BT9 A;  3K0L A;  3WTY C;  3BP8 A;  3IP4 B;  2E35 A;  2VOO A;  2V1U A;  3H9Q A;  4UUT A;  3CMY A;  3DLA A;  2VQG A;  5DCM B;  2E2J J;  2JQ7 A;  1IXS B;  1OCO H;  3CDI A;  3CTA A;  4AYB A;  3QOE A;  2CQ7 A;  3LSP A;  3HOU J;  5HS9 A;  4B1R A;  5BQT A;  3M3Y J;  3SZT A;  1UHW A;  1Z7U A;  4JX6 A;  1TT0 A;  1BBY A;  4HQM A;  1D3Y A;  5EG0 B;  1I6X A;  2QSF X;  2F5D A;  4G9Y A;  1FZP B;  1XB4 A;  3BZK A;  5E18 F;  2FQ3 A;  2STW A;  3GVA A;  4M74 A;  1MBH A;  4NHJ A;  2D5V A;  4M73 A;  3J80 Z;  3CCU I;  1V5F A;  2K86 A;  3JRC A;  1YJN I;  1PP8 F;  2I10 A;  5DD8 A;  4NDL A;  4G94 A;  1F1Z A;  1FMV A;  5KCM A;  2BHY A;  2IS1 A;  1UJ8 A;  2R7V A;  4ETS A;  1PUF A;  2HPM A;  2CV0 A;  4H0E A;  1V4R A;  4IF4 A;  3JRH A;  1XSX A;  3G1L A;  3ZQG A;  1D1A A;  2IS6 A;  1TLH B;  4XRF A;  5EYR A;  3OYM A;  3GTL J;  5CVJ A;  1JUS A;  3W6K B;  3FKI J;  2IAI A;  2DTZ A;  3HGG A;  1OCZ H;  3LSK A;  3DPU A;  3BZC A;  1F5T A;  1O4X A;  1R1T A;  2P7V B;  5M5X J;  2ICW G;  3FXQ A;  4QWQ A;  2K9Q A;  1MNM C;  4JX5 A;  1XCV A;  1Y0N A;  4LD5 A;  2VXD A;  2M3A A;  2V1D A;  2IA2 A;  4L0Y B;  3VDX A;  1WWX A;  1KYZ A;  4HST A;  2E36 A;  4BBS J;  2IBD A;  3M7G A;  3WHC A;  4RGS A;  4XLH A;  1OJL A;  3BOQ A;  3CJQ B;  1HDD C;  3PL8 A;  2JA5 J;  1RC9 A;  1ZR2 A;  2NS8 A;  4P96 A;  1B9M A;  2PMZ N;  1VQO I;  2XB0 X;  1E0E A;  3W6V A;  1LKX A;  3GW2 A;  5E79 C;  2DTR A;  5M5W J;  4ASN A;  4DZP A;  1FOY A;  4XRS G;  4I0A A;  4R79 A;  5H2F C;  1WCM J;  1DGW Y;  4H4K C;  5J8C A;  4QTR A;  4U0Y A;  1Z9C A;  2MFZ A;  3CMM A;  3WGI A;  2NOJ B;  4A3C J;  3QOD A;  3LAP A;  3OYN A;  1KU7 A;  2O7O A;  4A12 A;  2WY7 Q;  1PP7 U;  2FF4 A;  3ZMZ A;  4MO7 A;  4BS9 A;  4A3I J;  2H6B A;  4IO9 F;  2CQK A;  2DI3 A;  2K9S A;  4UVC A;  3HXL A;  4IRI A;  5DUK A;  3S2H J;  2H09 A;  2KMU A;  1TNS A;  2CYY A;  4I02 A;  1IN7 A;  3OL4 A;  1KU9 A;  1MDM A;  1YIO A;  2ZNY A;  4B8X A;  5AON A;  3K70 D;  2ESH A;  4M9Z A;  1D5Y A;  3I0T A;  1HBX G;  4Y4R A;  3AG2 H;  2E7W A;  2W25 A;  1BI0 A;  4UNO A;  4PDK A;  2O03 A;  2OQG A;  2LKS A;  3HRM A;  3PO3 J;  1CF7 B;  1WJB A;  3MVP A;  3HTU A;  4M6V A;  4I6Z A;  2VL8 A;  3OIQ A;  1QZY A;  1X3U A;  4LIT A;  3S3O A;  2EB7 A;  5D5V B;  1R9T J;  2DQL A;  3BJO A;  1DQU A;  2FNA A;  3VSL A;  3WTX C;  3BPV A;  1ETY A;  3TP0 A;  1K7A A;  4RM3 A;  3S1N J;  1AKH A;  4OWR B;  4M6X A;  1I1G A;  3BR2 A;  5CVV A;  1RUO A;  1OYY A;  3PNV A;  3CCY A;  4KIB A;  2X6Y A;  3WTU C;  3DKX A;  2CFX A;  1DP3 A;  5FB2 A;  3I53 A;  2A6E F;  1YX3 A;  4HX4 A;  5JI6 A;  3NWS A;  2BW3 B;  3J80 K;  3L09 A;  2BE5 F;  2R7U A;  4PFO A;  4Z2Y A;  1T39 A;  3FF5 A;  3ZQI A;  5FKL A;  4WCG A;  2F5F A;  2KFD A;  3HSF A;  4XN3 A;  1F9N A;  4KMF A;  3A0B C;  1X58 A;  2Z2S B;  1MBJ A;  2E71 A;  1KU3 A;  4ZZD A;  1R7J A;  4O3M A;  1OR7 A;  2H6C A;  3TO7 A;  2UV1 A;  3ABK H;  1T0F A;  5CVU A;  4O6J A;  5AIP A;  2IT0 A;  2OV7 A;  3I64 A;  5LEK A;  4UUS A;  1OMI A;  3ABL H;  2V79 A;  3O3K A;  5FD5 A;  3CZ6 A;  1D8J A;  1BR4 A;  5KAI C;  3BDD A;  1Y39 A;  5D5U B;  2R7T A;  4NC6 A;  2ADU A;  3KEY A;  4U88 A;  3FXK A;  1BN5 A;  1CF7 A;  4GDF A;  4PSX A;  3D5S C;  2XSD C;  4PJJ A;  4B09 A;  5A2Q Z;  4CYC A;  3WU0 A;  1S3J A;  1MMA A;  3HPH A;  1T98 A;  1XTA A;  3RKX A;  1FJL A;  1IUF A;  1SAU A;  3BG3 A;  2KIQ A;  1Z7L A;  2JSP A;  1MSF C;  2OCE A;  3BCB A;  2VJJ A;  2BYV E;  3V4G A;  1KYW A;  1ON1 A;  2EQR A;  5DM7 F;  2CV1 A;  5EGO B;  3TMO A;  4WK8 F;  1JGG A;  2K7L A;  3BQZ A;  3JRA A;  3X2Q H;  3RJP A;  2CG4 A;  3WG7 H;  4DYC A;  5B1A H;  2HVQ A;  3LSJ A;  4MQV A;  4UVA A;  4ZJZ A;  1U3E M;  2COM A;  2EFO A;  4M3F A;  4AUX A;  2FA5 A;  3E97 A;  4DYR A;  3F3X A;  4GXO A;  1LEB A;  3HRU A;  2L9S A;  4XLP F;  1LB2 A;  2EIJ H;  3WTT C;  2DK8 A;  4BQA A;  2QSH X;  3FMQ A;  4U87 A;  4UXN A;  1RPW A;  4Y3O A;  2DO7 A;  5F0H A;  1WKM A;  2WWY A;  3KYD B;  3IH3 A;  1GXQ A;  3G1O A;  1QQI A;  1Y6I A;  3S1M J;  1XGS A;  2DA3 A;  1P9Q C;  4P55 A;  3MKW B;  2YPR A;  1JGS A;  2RV8 A;  4U7D A;  4P1W A;  2M2E A;  4JX4 A;  1AKH B;  3N4M A;  2L9V A;  2QYO A;  3DKW A;  2WC2 A;  2OZU A;  1JJ8 C;  4HV5 A;  3PFY A;  1J7K A;  3CME I;  4E6K G;  1LPQ A;  1JHH A;  3IH2 A;  1O3T A;  3TDU C;  4PJL A;  4HDV A;  1WRJ A;  1LFB A;  1VFC A;  1YO5 C;  3TDZ C;  3NAR A;  5D8L B;  5L3B A;  2L9R A;  2K4B A;  3I55 I;  2JPC A;  1E2X A;  2FSW A;  1ETO A;  1X3W B;  3ELK A;  1OYW A;  3E5U A;  3O6B B;  1EKE A;  1RKW A;  2I5U A;  2KJC A;  3HPG A;  5D4S A;  3K4K A;  3I59 A;  4LLL A;  5FJ8 J;  2ZXW H;  4IOA F;  1UHS A;  3M1C A;  5EDN A;  3PSI A;  2R5Z A;  3BG6 A;  1QVT A;  2G9W A;  1AU7 A;  2ZJ2 A;  4LIU A;  3ABM H;  4B47 A;  3R0A A;  4XBF A;  2TDX A;  1U2W A;  3GYH X;  4P9F A;  3S16 J;  4RB0 A;  2V9V A;  2ZO4 A;  3BY6 A;  1LE8 A;  3MKZ A;  1DPU A;  2K02 A;  2OTJ I;  1I6H J;  4IHS A;  3T1B A;  2MBF A;  5HDN A;  5JVT A;  2E2H J;  2R7Z J;  4LG3 A;  3CDL A;  1SFU A;  4RMN A;  2BXZ A;  1QZZ A;  4HRI A;  2EZK A;  3ZCO A;  2VOP A;  2PMU A;  5EEA A;  1SFE A;  1HXD A;  5FKK A;  2ECB A;  3LNQ A;  3MAJ A;  2NS0 A;  3NRV A;  4JQF A;  5H20 A;  3W6J B;  4K2E A;  1MMS A;  1AOY A;  3OYH A;  2R7F A;  1VQ9 I;  1YI2 I;  4YFN F;  3ERE D;  3CF5 F;  2F5V A;  4GO1 A;  2KIU A;  2CFO A;  3M8E A;  5F04 A;  2JZY A;  1TTY A;  1VND A;  1I3Q J;  3CC7 I;  4XMY A;  1ZAR A;  2YS9 A;  4JP0 A;  2EIL H;  1X1B A;  1DU0 A;  3P7N A;  2LF7 A;  1VQ4 I;  2LDU A;  4BHB A;  2OBP A;  2QUF A;  1AHD P;  4DW6 A;  2Y31 A;  4BKX A;  4IQ4 A;  4MTD A;  1VQ8 I;  3T0Y A;  4A3G J;  2DA4 A;  2FJ1 A;  1SD4 A;  2HEO A;  1FP1 D;  5DDG A;  3CLO A;  4PUS A;  2MYS A;  3GLL A;  5H6Q A;  2JVH A;  2A05 A;  3F8N A;  1QRY A;  3EUA A;  1YW9 A;  4A0Z A;  1UB9 A;  4U0W A;  4HF0 A;  3H5N A;  5FLX Z;  4HBL A;  3F23 A;  3EET A;  3MFK A;  4EAT A;  3I56 I;  2XRN A;  1R36 A;  4EJV A;  2L4A A;  3KP2 A;  4KIG A;  3ZMS A;  5F1R A;  2AQF A;  2MD5 A;  2QEN A;  1BL0 A;  2X9D A;  5ERI A;  4AVP A;  4B44 A;  1TW3 A;  5F64 A;  3GXO A;  1YLF A;  1SFX A;  2D45 A;  1QPI A;  4EM2 A;  2Z3Y A;  3OIP A;  2LKP A;  2ZXI A;  1BR2 A;  1PJR A;  4BU2 A;  1IZ1 A;  2CUJ A;  4IPA A;  5LRR A;  3OOU A;  5DS9 A;  1N78 A;  1VQ6 I;  1VQP I;  3DV8 A;  3K4B A;  2GWR A;  2DQR A;  4E7L A;  2NVX J;  2MA3 A;  1YW7 A;  3U9G A;  3CUQ B;  3OV8 A;  4A69 C;  4HV6 A;  1ZQ3 P;  2KQR A;  3SYT A;  3BG7 A;  3OSG A;  4EVI A;  3EUH A;  2PJR B;  5DYM A;  1Z77 A;  1VQL I;  5M3F J;  3OS1 A;  1BOA A;  2ETH A;  5IP9 J;  2NVU B;  3H0D A;  4N0B A;  1UMQ A;  2QSG X;  3KCC A;  1T6S A;  1Z3X A;  2AXL A;  5E1Z B;  1OCT C;  4AC0 A;  2NVT J;  2KRH A;  5C3E J;  2X4H A;  1JT0 A;  3OYK A;  3P9K A;  1YFH A;  3HUG A;  1P4X A;  3SEQ A;  3BRO A;  2QM3 A;  2A6H F;  1W5T A;  2WY8 Q;  1R71 A;  4A3D J;  5FLV A;  1G59 A;  1K78 B;  3I59 B;  2R92 J;  3H1C A;  3VYS B;  3K1N A;  3CJN A;  2H8R A;  3BG5 A;  2R0Q C;  2V4J C;  3KYC B;  5J3L A;  4CXF A;  2VBZ A;  1E3H A;  1MNE A;  2OZ6 A;  4IHW A;  4UVB A;  1AA7 A;  2X6O A;  2Y9Z A;  1X1A A;  1ZGW A;  4BJ6 C;  3H5R A;  1XG1 A;  5J6X A;  2BVM A;  3FKJ A;  1GVJ A;  2P5V A;  3MD2 A;  2CQN A;  4CIC A;  3DWL E;  1B1B A;  4WXH A;  2BY1 A;  3DTK A;  3TBI A;  5JLW A;  2P4W A;  3BR0 A;  4E7S A;  3IL2 A;  5IOZ A;  3GEZ A;  4DIQ A;  1N25 A;  4N9I A;  1ETW A;  1REP C;  4EJU A;  4FAS D;  2V9K A;  3HHH A;  4L5I A;  4KN4 X;  2IPQ X;  2YUS A;  3EYY A;  2ECC A;  3LSI A;  3HL2 A;  3HG9 A;  1FP2 A;  2VQH A;  3RYR A;  5HLH A;  1USS A;  3KYL A;  3T5X A;  4ANJ A;  2ZSI B;  2L9N A;  2QF7 A;  4JK1 X;  3W2V A;  4YRV A;  2HKO A;  1MD0 A;  1LVK A;  4MEX F;  2N8G A;  2L7K A;  3IAS 2;  4D7N A;  1S8N A;  2OCC H;  5BOX A;  4YG2 F;  1IUY A;  5D4R A;  1ZKG A;  2MD0 A;  4HLY A;  2KP6 A;  2L7Z A;  5CQG A;  5EJC A;  2JUG A;  2FOK A;  5KVR A;  4A5M A;  3BR6 A;  1XSD A;  2HXO A;  2VT2 A;  5F6F A;  2O8K A;  4BNC A;  1Z6T A;  3HM5 A;  1IN8 A;  2UXN A;  3QYF A;  3L00 A;  2VC1 A;  2R7S A;  3MCZ A;  4XK4 A;  3HB9 A;  1WHU A;  4BXU A;  3UKG A;  4XLE A;  2XSJ C;  2YX7 A;  3LSH A;  2CGP A;  1ZH5 A;  1TZL A;  4EMS A;  1T0F C;  3S17 J;  3RQ4 A;  2HVS A;  4OOI A;  1OFC X;  3H3Z A;  2EIM H;  1YIT I;  1S9H A;  1QA6 A;  4L0Z B;  3FMR A;  2IXS A;  3U1K A;  2LFB A;  1W7P A;  3BJA A;  5CQE A;  3FMS A;  2HZD A;  3R60 A;  4XOR A;  4A6D A;  4EJW A;  1VTN C;  1G6N A;  4XKV A;  2VJ4 A;  3TOA A;  4OAY A;  3HC7 A;  3TO9 A;  3G4S I;  3F21 A;  1IN4 A;  4BQO A;  3IC7 A;  2M7B A;  5KAF C;  1VQM I;  3K4M A;  2KJB A;  2BOL A;  2W84 A;  2KL4 A;  1SD7 A;  3SDB A;  3R6S A;  1JTX A;  2DMU A;  4ZC3 A;  3HKZ A;  4F3Q A;  2MSY A;  1ZG3 A;  3E6M A;  5IP6 A;  1N77 A;  3HHG A;  2DOA A;  3DTE A;  1B8I B;  2HGC A;  5J8F A;  2L01 A;  2YR2 A;  4N9H A;  4ZDP A;  2EWN A;  3KFW X;  3OYG A;  2TCT A;  1U5T A;  3A01 A;  2D1H A;  2NOG A;  3V7R A;  1A31 A;  3PO2 J;  4D5F A;  3GFL A;  3QRF F;  2CW8 A;  3LA2 A;  4BQN A;  4A3E J;  1TWH J;  4WXD A;  5DCM A;  3FK7 A;  3QPT A;  4BEH A;  3C3W A;  4E7J A;  1SEU A;  3CO6 C;  3SFZ A;  4CCO A;  3S3M A;  5FKN A;  3MZY A;  3CP2 A;  4L9N A;  4Y33 A;  3H9G A;  1EH8 A;  3LL7 A;  3ZMD A;  2QQ9 A;  1L3L A;  1FYK A;  2QKL B;  2OQR A;  1RET A;  2ZXH A;  2HZT A;  1XS9 A;  4B4C A;  1U8R A;  1WJF A;  3S32 A;  3KET A;  3SHF A;  3FIS A;  2ELK A;  2OTL I;  3LFK A;  3V42 A;  1QGP A;  1FX7 A;  4BE2 A;  2RC4 A;  3CJT B;  1K79 A;  5D6E A;  1BIB A;  2AHQ A;  4MTE A;  5ICC A;  2VB6 A;  2VUM J;  4HSR A;  4G8X A;  1MMG A;  2ISZ A;  2XHK A;  2Y75 A;  3V8L A;  4BY7 J;  3B73 A;  3UR3 C;  4V2G A;  4UUV A;  3E6B A;  5HOD A;  3ZN1 A;  3J7A Y;  2UUZ A;  4XR6 A;  2QVO A;  1MDM B;  5B66 C;  3J81 K;  2JVG A;  1Q1V A;  3KX2 A;  4HLX A;  2EPF A;  3T8R A;  2XAH A;  3ESW B;  3RPU A;  4ESJ A;  3S2D J;  5EEH A;  5HDK A;  1DU6 A;  3GWZ A;  4WF2 A;  3N05 A;  2X51 A;  5LRS A;  1ZAO A;  3WG9 A;  1S7A A;  1GT0 C;  4ZDO A;  1WI3 A;  5DV5 A;  1A6Q A;  3HRS A;  2XVC A;  1CGP A;  2Y0S N;  2M5W A;  3Q0W A;  2BV6 A;  2VBX A;  4MNU A;  2ZME B;  5LD2 C;  3C18 A;  4L5E A;  4LJZ F;  4RB2 C;  1MBE A;  1VQK I;  4BEH B;  3LMM A;  3DXJ F;  4LB5 A;  2ISY A;  3CF2 A;  3P5J A;  3FXL A;  4WWC A;  2A3S A;  2IEK A;  4HAM A;  3S15 J;  3M8J A;  1WJE A;  9ANT A;  5D5X B;  3K1P A;  4C30 A;  2F6C A;  2DOF A;  2HYG D;  2Z5U A;  5HS7 A;  2O61 A;  4WXC A;  3BR5 A;  2DMQ A;  1E17 A;  2ZJR F;  2F4I A;  2P5L C;  3LST A;  2LRE A;  2XAJ A;  4XRM A;  2DYR H;  1R1V A;  2HWV A;  5HLT A;  4UV8 A;  1ZTR A;  2NNN A;  1VF9 A;  5EZH A;  1I27 A;  3K6G A;  4O5V A;  3KP7 A;  4A5N A;  4KA4 A;  2CUF A;  2DJN A;  1HQC A;  3KZI C;  3R0J A;  2Q8K A;  2LR8 A;  3FZV A;  2CSO A;  1V54 H;  3VFZ A;  5LFA A;  2M4K A;  4AID A;  2M30 A;  2RRE A;  5IY5 H;  2VLA A;  1W7P D;  3OY9 A;  2BY0 A;  4U0V A;  3OYF A;  2PX9 A;  3BR1 A;  5E1W A;  3FXM A;  2DYS H;  4R8H A;  4A0Y A;  1ZRF A;  1B72 B;  2KIF A;  1SMT A;  5IPA A;  1F43 A;  1FEX A;  3BTJ A;  1T33 A;  3GZN B;  5D6F A;  3KE2 A;  2YSR A;  4AIH A;  1IRZ A;  3COA C;  3DKY A;  2PEX A;  1K6O A;  2X1E A;  1U6G A;  5F1J A;  5LEJ A;  3OYB A;  2MH2 A;  1D1B A;  4PJ0 C;  3K4L A;  5D5W B;  3ZR8 X;  2RQP A;  2WB1 N;  5E3M A;  3IWZ A;  4U7B A;  2FD5 A;  5FFZ A;  4D1Q A;  3IKT A;  3KEO A;  4I99 C;  3F22 A;  4ITV A;  1IO2 A;  3WGG A;  3K4N A;  2E5N A;  3LWF A;  4C3J J;  2AS5 F;  3W3C A;  1CQT A;  2QCO A;  3QU3 A;  1G2H A;  2L2O A;  1EV7 A;  1HDP A;  4I0B A;  1JUP A;  2HQ5 A;  4NQW B;  3H3V K;  5C4J J;  5CYV A;  2PN6 A;  2Z99 A;  3LQQ A;  1TT5 B;  3ULQ B;  1WGX A;  4HOB A;  3ZMU A;  3M1E A;  4ZYH A;  3RDI A;  2DAO A;  4N4O B;  2OA4 A;  3MWM A;  3CCE I;  4B3X A;  2J5O A;  3EUH C;  4PGH A;  4RAF A;  2P81 A;  1V55 H;  2KT0 A;  3DBR B;  1IV6 A;  3QYE A;  1R4M B;  3ZGK A;  1QPM A;  2HPI A;  2MW8 A;  1UHM A;  3N97 A;  1S72 I;  2QGU A;  5E8I A;  2JJ7 A;  5EG0 A;  1UG0 A;  1WJC A;  3BJ6 A;  4ZYE A;  2PBI A;  2ZME A;  4A3M J;  4A3L J;  3OYD A;  3GF2 A;  3JAM K;  4MLO A;  4CYC B;  2FUG 2;  2QWW A;  2HOS A;  1L0O C;  1JKO C;  3SXY A;  4L9T A;  1FTT A;  4CCJ A;  3CCR I;  3RTR A;  1NK3 P;  5F08 A;  3DU5 A;  2JWT A;  2A6T A;  1WH5 A;  4I09 A;  1APL C;  4G6T B;  4XOT A;  3K2Z A;  4CSW A;  5HVQ C;  1SD5 A;  3VOE A;  4S0H B;  2JT1 A;  1BW6 A;  1R00 A;  5EGO A;  1SAX A;  4X1E A;  2VBW A;  3FX3 A;  2R4G A;  3M07 A;  4BY1 J;  5EF6 A;  3DQV C;  2CQX A;  1HLV A;  1Y56 A;  4HX8 A;  1YRN A;  2X48 A;  1ZEL A;  4LLN A;  2FML A;  1YJ9 I;  1HF0 A;  1YS7 A;  4PK4 A;  3S93 A;  4CCM A;  4ENK A;  2VN2 A;  1J9I A;  3HOX J;  4RGU A;  1R1U A;  4PJN A;  4DGW B;  2ZC2 A;  1GVD A;  1FSH A;  4ZYA A;  1OCC H;  5E17 F;  5EZG A;  1JTY A;  1ERD A;  1D0Y A;  5DM6 F;  4EJT A;  4ABZ A;  1NG6 A;  3FHN A;  3IHU A;  2R7O A;  2OUM A;  5DCF A;  1R4N B;  2PG4 A;  5FRO A;  4E7K A;  3E7L A;  1W4M A;  5IT9 Z;  2M34 A;  2Q1Z B;  4IRG A;  1LEA A;  4J01 A;  3DEW A;  4BE0 A;  3WE3 A;  3BPX A;  1EH7 A;  2VJ5 A;  5DEQ A;  2QQB A;  3J7Z I;  3DBH B;  3ASN H;  3HSR A;  2NYX A;  5HLG A;  1Q1H A;  4EEF G;  1R58 A;  4C2M J;  2FBK A;  5FKM A;  4YFK F;  2LK2 A;  5CJ9 A;  2D1V A;  3DU6 A;  4DQ2 A;  1K4T A;  4DBR A;  4ZH4 F;  4JOM A;  3PNY A;  2DMT A;  2VQL A;  4RS8 A;  4A3F J;  4Q47 A;  5IYB J;  3CC2 I;  4J19 A;  1ON2 A;  2ZSH B;  3WTV C;  3TQN A;  2XF6 A;  2XF7 A;  3AG3 H;  3ZXS A;  1BI2 A;  3OR1 C;  3A1Y A;  3KZZ A;  4HQE A;  1G3Y A;  1U8B A;  2VI6 A;  4M6Y A;  2L02 A;  2MAB A;  2KLO A;  3I3L A;  2P8T A;  1B72 A;  1LNW A;  2E5Z A;  2LTP A;  4A2U A;  5B1B H;  3M8F A;  1IW7 F;  4PSW A;  2J5P A;  4W1U A;  1Z21 A;  2VKD A;  4ESF A;  4AYB N;  4ESB A;  3ABT A;  1NG7 A;  4BYY A;  4ENM A;  5M3M J;  1XX5 A;  2MH9 A;  2QQA A;  3Q9V A;  2ELJ A;  1B59 A;  1P7J A;  3TED A;  1IRX A;  1A04 A;  2L0K A;  2XKP A;  3DFG A;  4DNC A;  3WTW C;  1YS6 A;  4HF1 A;  4AM3 A;  2R7R A;  4ZDL A;  2ZBK A;  4II2 A;  1I50 J;  4L5J A;  1POG A;  2K9L A;  2XGC A;  2ELH A;  2LC2 A;  2E7X A;  2KPM A;  3L2V A;  2XPV A;  5JHU A;  5FD6 A;  2W4S A;  2R7Q A;  4KIF A;  1KU2 A;  4Y15 A;  3HOS A;  1TWC J;  3PNT A;  1I5Z A;  2ZFU A;  4B3A A;  1LDJ A;  1IC8 A;  4BAY A;  1FOW A;  1HKT A;  3JRI A;  2HOE A;  1JE8 A;  3P9C A;  4LIV A;  1P7I A;  2DA6 A;  3DF8 A;  5ILS A;  4AIK A;  2IS2 A;  1SD6 A;  1R22 A;  2CUE A;  1BI1 A;  3LSG A;  3ZQF A;  2HI3 A;  4NBQ A;  2H94 A;  3U1D A;  3EDP A;  4B43 A;  1ZYR F;  4HPQ A;  1TQM A;  1ZRE A;  5B5E C;  1DGR M;  5LGU A;  5LHH A;  3JTG A;  2K5C A;  4RAG A;  3R4K A;  2E1N A;  4BE1 A;  4HG2 A;  5GTI C;  4X6A J;  2G0E A;  2HU9 A;  1IRF A;  2FOW A;  3CMA I;  3KEQ A;  4LLG F;  1XPX A;  1DUX C;  1IGN A;  2EJR A;  4UY8 I;  5CVI A;  4IX7 A;  2IGN A;  2L5Q A;  4HYE A;  2V6E A;  3PQK A;  2PMZ A;  4E7I A;  3C1D A;  3AG4 H;  3BCA A;  3DPL C;  3Q3S A;  1UEL B;  2WAQ N;  2DMP A;  3W2W A;  1XCB A;  2QBY B;  2EH3 A;  4AU7 A;  2COB A;  1KZH A;  4LK1 F;  4XL9 A;  1Z67 A;  2XPU A;  1BOB A;  4Q4Z F;  3S14 J;  5LBQ A;  1V5E A;  4I98 B;  1FIA A;  4I7H A;  1MGT A;  2LRD A;  1Y8R B;  3A2K A;  4KDP A;  2V7F A;  1A35 A;  1JI8 A;  2BGC A;  4LMY A;  4D9J A;  3FDY A;  2IRF G;  3VOD A;  3CES A;  2VE8 A;  2HNH A;  1T56 A;  2DBB A;  2GBY A;  3DTI A;  2BY3 A;  2VKE A;  3G1M A;  5E3L A;  1TW2 A;  3DBL B;  3HDD A;  1Y1W J;  3SQN A;  2HQA A;  3ML6 A;  5ICF A;  3ZMV A;  4BL0 B;  5TRD A;  2IJL A;  4RDU A;  3FWE A;  1GHC A;  1J2X A;  3LSR A;  3HOW J;  2EZL A;  3PM1 A;  1AWC A;  4XLC A;  2X6X A;  2KZV A;  4CCN A;  4BH9 A;  2H27 A;  1WFX A;  1MW7 A;  3OIO A;  1U0J A;  2M4G A;  4G12 A;  1X3Z B;  4RB1 A;  3JRE A;  2OPT A;  2Q2E A;  5J1U A;  1NH3 A;  3GUD A;  4YEL A;  5J40 A;  1YIJ I;  3I58 A;  2NAZ A;  1MBG A;  3L2R A;  5GAD J;  2RNJ A;  3FXJ A;  2GA2 A;  4HX7 A;  1WQ2 A;  4L9V A;  2KIM A;  2EIN H;  1UCR A;  2P0W A;  3ZP5 A;  1SVO A;  3GTM J;  2BEO A;  4PJM A;  1Z1D A;  3HTS B;  2B9S A;  2B63 J;  2LYC A;  4BQQ A;  3VSK A;  3I9V 2;  4HZF A;  4BGD A;  1X4P A;  2DW4 A;  3SJM A;  3F0C A;  3GLX A;  4BDY A;  2IP2 A;  1KGS A;  4KFC A;  4ENN A;  2WAF A;  2EIK H;  5FLX K;  1JUM A;  4FE7 A;  2LY1 A;  5K7F A;  4AWX B;  3GO5 A;  2ZKZ A;  2LSO A;  3M4O J;  5FFX A;  2ZXJ A;  2LH9 A;  2VC0 A;  2HVR A;  1XGN A;  2X0L A;  4OIO F;  3IH4 A;  1X4O A;  1GV2 A;  2CS3 A;  1DDN A;  2CH0 A;  5CLS A;  1EA3 A;  5KHD A;  2A5Y B;  3TW6 A;  4C3I J;  1ODD A;  3FBI B;  1RNL A;  4KT6 A;  1H9T A;  3LAJ A;  3TGN A;  1QNT A;  1A5J A;  4D7M A;  1LUJ B;  3O2P E;  1VZ0 A;  3H5A A;  3QPS A;  1FT9 A;  5L3F A;  4EQQ A;  3MKY B;  3WU2 C;  3MZH A;  1T08 B;  3KP4 A;  3HGY A;  5F27 A;  3CO7 C;  3LA3 A;  1KQ8 A;  3L7W A;  5J1R A;  2W00 A;  5BPI A;  2P7C B;  4RAY A;  1NTC A;  4XLF A;  1RR7 A;  1WJ5 A;  3GTQ J;  3O8H A;  2ACJ A;  2STT A;  1R49 A;  2GOM A;  3B6C A;  1T2K A;  1RES A;  2RNG A;  3WE2 A;  4CZC A;  4IRH A;  4B48 A;  2G7U A;  2X6W A;  4BJT A;  3ZOB A;  2P6S A;  1JXS A;  2V26 A;  1F36 A;  1ZN2 A;  3CD6 I;  2O5R A;  4HF2 A;  1W0T A;  4IHY A;  4FTH A;  3I54 A;  2X1C A;  4HNV A;  3T8T A;  3WTS C;  2AO9 A;  2JSC A;  2W82 A;  2PI0 A;  1LDD A;  3HRT A;  2Z1D A;  1KQ9 A;  5FGM A;  4L18 B;  3BC8 A;  1DP7 P;  3Q0V A;  4OIN F;  4RB3 C;  2LP0 A;  1WH7 A;  2EZH A;  5E1X A;  4GCV A;  3FHZ A;  2ZNZ A;  1SAN A;  2JUC A;  3NQO A;  2DFI A;  3IKV A;  3VYR B;  2CMP A;  1W5C C;  5K5R A;  2JA8 J;  4F91 B;  3CUQ A;  1MBF A;  1S7O A;  2IW5 A;  4C2U A;  1PYV A;  4NNJ A;  2PLY A;  6PAX A;  2IGK A;  4MEY F;  5IP7 J;  2R7W A;  2XKO A;  4KT5 C;  2EFN A;  3F8C A;  1IDZ A;  1D5V A;  3ZRG A;  1RI7 A;  1FTZ A;  4BAC A;  2M87 A;  5ILV A;  4ZZL A;  2XAU A;  1B9N A;  3SEZ A;  1BC8 C;  2HR3 A;  5L3G A;  2E1O A;  4M72 A;  1XMK A;  4BXF A;  2V1N A;  3OWT A;  1YQA A;  4CO8 A;  3AFH A;  4F52 A;  4Y52 J;  1LFP A;  2XGX A;  3WTZ A;  2R3S A;  1JKR C;  2Z33 A;  5DUI A;  1X1P A;  3A01 B;  5LHI A;  2RN7 A;  4CH7 A;  1YHQ I;  1IAW A;  1S6L A;  4BHC A;  5L3E A;  4M3G A;  3IAM 2;  2HKX A;  1XGM A;  2KDO A;  1BI3 A;  4M3E A;  2Y2Z A;  3RZD J;  1UG2 A;  3M9A A;  1S7E A;  1DPR A;  2TRT A;  3VYT B;  4EJO A;  2F4M B;  2XPW A;  1YTY A;  3L9F A;  3DCF A;  3C2H A;  4PCQ A;  1HW2 A;  2DMN A;  5KNL A;  4FHT A;  3KP6 A;  2DK5 A;  3ECO A;  1HKS A;  3D0S A;  4GFB A;  3DEE A;  3LOC A;  3AKZ A;  3H35 A;  3JCU C;  3KZY A;  5FRM A;  3VPR A;  2ZB9 A;  4CZZ A;  1ORK A;  1J09 A;  2JK3 A;  2HDW A;  2ZJQ F;  1QU3 A;  2G7H A;  3A4C A;  3ECH A;  3ISP A;  2QZ8 A;  1P4A A;  4DBQ A;  1HKQ A;  1ZG1 A;  2LY2 A;  1ACI A;  2IA1 A;  2XIG A;  4JYK A;  3TP3 A;  4EM0 B;  3OYL A;  3OSF A;  1OKR A;  2DA1 A;  3C7J A;  1HA8 A;  4Z6Y A;  2BW3 A;  5TGT A;  2VOD A;  5K5O A;  2BBY A;  2W24 A;  3K4C A;  4QLC U;  1PVE A;  1ZK8 A;  4M3B A;  4OIR F;  1XMX A;  4YIR X;  3D5L A;  2K40 A;  4M9X A;  2E19 A;  3F8B A;  4RM2 A;  4Y13 A;  4J00 A;  1QBJ A;  1FBU A;  2GIV A;  2W48 A;  4I01 A;  4QIW N;  1ETQ A;  3EYI A;  5D8K B;  5IYC J;  2KRC A;  3GX4 X;  2M1B A;  2ZFW A;  1FMW A;  3I4P A;  1O7F A;  1FBS A;  1TNT A;  3QU6 A;  1LJ9 A;  1XDS A;  2F2E A;  3KLN A;  3JR9 A;  4PFP A;  1Z0X A;  2GXB A;  1Z91 A;  1ZRD A;  4FE4 A;  2Q0O A;  2VKH A;  2LOO A;  4M3D A;  2EA2 A;  4NB5 A;  3IV5 A;  4UUS B;  1ETV A;  1P4W A;  2O8X A;  4C3H J;  1J75 A;  3AG1 H;  1YYV A;  3QYB A;  4IHT A;  2M0C A;  2RKH A;  1BW5 A;  3SDG A;  2L3D A;  3RPQ A;  3LFU A;  2M8E A;  4IQJ A;  4CYD A;  3MMY B;  3ZQH A;  3K70 C;  3RCO A;  1FY7 A;  3K2A A;  3BWG A;  4XQF A;  4XN0 A;  3H0G J;  1HCR A;  2IVM A;  4Q48 A;  2PFB A;  2CJJ A;  2XAF A;  2XRO A;  3QQA A;  4OU0 A;  5K7Z A;  4CGZ A;  1G3W A;  1RUN A;  3K1M A;  2VBY A;  1I3A A;  5GAH J;  2DFE A;  2V9P A;  3QOP A;  2KKO A;  4RBO A;  2ESN A;  2MC3 A;  3TKY A;  3H9J A;  1WVR A;  2MLK A;  2YU3 A;  4IOC F;  2GXA A;  2XAQ A;  2JMW A;  3F8F A;  3JRG A;  2A07 F;  2WA0 A;  2NVQ J;  1GUU A;  1I39 A;  3GTJ J;  1D0Z A;  4JBA A;  4IHX A;  1BR1 A;  3S1Q J;  2VIX A;  5TJJ A;  1H88 C;  1YE9 A;  4IVN A;  4ZYG A;  2YX4 A;  3KPH A;  3LA7 A;  1ZHF A;  3JW4 A;  3WGH A;  2DXI A;  2XC7 A;  2A69 F;  3E5Q A;  2IGM A;  4HDU A;  3B6A A;  4MQ9 F;  2VE9 A;  1ZGJ A;  1YW8 A;  4MHG A;  4FCY A;  2KRF A;  3ZQQ A;  1GXP A;  1T95 A;  1TWG J;  3QPH A;  3I71 A;  3OYE A;  2KIS A;  1ZGA A;  1R23 A;  4XKC A;  1EF4 A;  2ID3 A;  2F48 A;  5F0F A;  1A6I A;  1D1C A;  2LBF A;  5KK1 A;  2GLO A;  4KIS A;  1B6A A;  2B0L A;  3HUG B;  3PQJ A;  3WOD F;  2HQR A;  2CW0 F;  5DTD A;  5JVG F;  1O57 A;  3HEF A;  3OOP A;  3S8P A;  1SVM A;  2CU7 A;  4RAZ A;  1P2F A;  2OD5 A;  4YII A;  3J81 Z;  4G7O F;  2D2W A;  2IA0 A;  4F55 A;  2DDA A;  3MZ8 A;  2GM4 A;  4OIP F;  2B7E A;  2PJP A;  4CCK A;  2GA1 A;  2F5E A;  5EEG A;  4GYI A;  5AIQ A;  3K4J A;  3GFM A;  1B4A A;  1MJ9 A;  4A3B J;  2EBI A;  4LB6 B;  3HSE A;  2DA7 A;  2QEX I;  4HEA 2;  3ZN0 A;  5LHG A;  3ONQ A;  4XSZ F;  1GV5 A;  3PUB A;  1H0M A;  1BC7 C;  5JFR A;  5E20 A;  1G4D A;  3OR2 C;  2CRG A;  3VYU B;  1ITY A;  5JR3 A;  5E3N A;  4NC7 A;  3CUO A;  1LFU P;  2X85 A;  4UV9 A;  1K61 A;  1R6R A;  3ZQC A;  1HW5 A;  1QHG A;  1FYL A;  4BXX J;  2W7N A;  4MIM A;  3RQI A;  3HIF A;  1K4S A;  3V7C A;  1H9G A;  1V5G A;  1M1E B;  3QP5 A;  4XOP A;  4HNU A;  5CPR B;  4CUG A;  3Q0U A;  2CO5 A;  2OAZ A;  2ME0 A;  2CWE A;  3F6V A;  1X2M A;  4XLA A;  1HOM A;  5C44 J;  2XRL A;  4EM1 A;  2QQ8 A;  3GTK J;  3FK6 A;  1Z3Y A;  2DPU A;  2I8D A;  2EFP A;  2BHZ A;  3ZMT A;  4R1H A;  1N75 A;  1X2N A;  2DT5 A;  2X1D A;  1UAA A;  2E34 A;  3G2B A;  4LK0 F;  2A68 F;  3EUK L;  4BBR J;  5HDG A;  1R5G A;  3ERM A;  3BLY A;  3K7A J;  4LFU A;  1YOV B;  3BZ6 A;  3KLO A;  3VB2 A;  1FWZ A;  4D0P A;  1LQ1 A;  1XMA A;  1HC8 A;  2FU4 A;  3I4N J;  1KON A;  1A36 A;  2UXX A;  2M7A A;  1MBK A;  2L7M P;  4A0X A;  2DN0 A;  3MQ0 A;  5E3O A;  1ENH A;  2C6Y A;  4M71 A;  3G6E I;  3D5R C;  3SFI A;  5HS8 A;  2JPB A;  1SMY F;  2XAG A;  3OL3 A;  2FX0 A;  2DJI A;  2ID6 A;  5F0C A;  3TOB A;  1TP4 A;  3L2W A;  2BVL A;  3RKQ A;  5LLQ A;  1FOK A;  1W5S A;  3EQL F;  5E8G A;  5GAG J;  4G7H F;  2K4J A;  1WJD A;  3HJE A;  4XKW A;  5HNH A;  1F4K A;  3KP3 A;  1UST A;  4RLF A;  2PMH A;  1WJA A;  2K9M A;  2VQC A;  3E5X A;  3TW7 A;  1X1D A;  2LLK A;  1UZC A;  5GPA A;  1PUF B;  2K3P A;  1S29 A;  2VKV A;  1QO0 D;  1P92 A;  2GXG A;  4I76 A;  4ZTF A;  2K9N A;  2FRH A;  4A3J J;  2RQQ A;  3GTO J;  2KZG A;  2RVC A;  1W0U A;  3HOY J;  3CUQ C;  1MH4 A;  2DOD A;  1W1W E;  4G6D A;  4KMU X;  2AXT C;  2OC6 A;  5GP9 A;  4I2O A;  3EPZ A;  4M9S A;  1QVU A;  4II3 A;  5GTH C;  2CV2 A;  1V3F A;  3PIO F;  4HW0 A;  1BM9 A;  1D8K A;  5IYD J;  2JN6 A;  1IN5 A;  4UHT A;  1MND A;  3FIW A;  1LE8 B;  1Z6R A;  5L3D A;  2LBF B;  2Y9Y A;  3OMY A;  2EV6 A;  2IGO A;  1IXC A;  2DOE A;  4S04 A;  2VJI A;  4TV7 A;  3Q5F A;  4ZYD A;  4IEJ A;  2NNY A;  4A3K J;  2WAD A;  2W57 A;  4DOZ A;  5FO5 A;  3JTH A;  3CJR B;  3A02 A;  1S5L C;  1XSV A;  5HOO A;  2P6T A;  3HBL A;  4PZJ A;  2K27 A;  4NQW A;  3CCL I;  2E2I J;  3ROU A;  3C2B A;  2JA7 J;  3CCM I;  3A03 A;  3JSP A;  2E1M C;  1I1S A;  2F5C A;  1MKM A;  2GIZ A;  2M9H A;  1YRN B;  1FOX A;  1J5Y A;  1HSJ A;  5JHF A;  5IT3 A;  2WV0 A;  4P9U A;  4KIT B;  1G3S A;  4LGW A;  1IXR C;  2WBM A;  4NC8 A;  5BNG A;  1IJW C;  3G71 I;  2R5Y B;  1O3R A;  1K6Y A;  2XB5 A;  1OLT A;  5K5Q A;  4E7H A;  3L2C A;  2R93 J;  4E4H A;  4EGZ A;  3HOV J;  1R5I D;  1MZB A;  2NVY J;  1BJZ A;  4YFX F;  1IF1 A;  2JA2 A;  3NAU A;  3OS2 A;  1JKQ C;  1WI9 A;  1TQP A;  2DA2 A;  1BA5 A;  3GFI A;  3JRF A;  2UZK A;  4F93 B;  3H3U A;  1ONV A;  3AL0 B;  2EK5 A;  3R61 A;  4DZJ A;  3G3Z A;  1C0W A;  1G3T A;  2XV4 S;  3JRD A;  1XDU A;  2PJR A;  4YEJ A;  3H36 A;  5ICG A;  3CCQ I;  1ZRC A;  1E3O C;  1XD7 A;  1KQ0 A;  5GPC A;  4CHU A;  1IN6 A;  1VI0 A;  1NHA A;  2M8G X;  3RSN A;  4ZTJ A;  3WU1 B;  3LQR A;  3PJR A;  3HKZ N;  4XLN F;  2HOT A;  2LY9 A;  5CKT A;  5ILU A;  2FQ4 A;  3Q9S A;  3JSO A;  3OYJ A;  1OPC A;  2O0Y A;  3K69 A;  4MFD A;  4XID A;  1EJ9 A;  1VQN I;  1FIP A;  4XM3 A;  1W36 C;  4S05 A;  5DD4 A;  4BHP A;  4C9Y A;  1P6R A;  5GAE J;  1HW1 A;  2L54 A;  3CCV I;  2A61 A;  4FIS A;  1JKP C;  3QPL A;  3I4M J;  1B8I A;  1TBX A;  3FXU A;  4RA2 A;  3G73 A;  5J4V A;  4OMY A;  2E60 A;  5IOY A;  4KUM A;  2VPL A;  2HXI A;  4XIC A;  3C2G A;  5J4Y A;  3F9K A;  1D0X A;  2DFF A;  3DEU A;  2EV5 A;  3RYP A;  2MLG A;  3DPT A;  1SC7 A;  3FXR A;  3V7S A;  1XC5 A;  2H1K A;  2Z16 A;  3MKL A;  2VAS A;  1U9O A;  2Q2E B;  2W85 A;  4FET A;  3ZQ7 A;  3JAM Z;  5FKO A;  2Y0M A;  1FBQ A;  3HOZ J;  1OCR H;  3CP8 A;  1J0R A;  2RDP A;  2NS7 A;  3BTC A;  4HNT A;  1IRG A;  4Y7N J;  2WTE A;  1MJB A;  2BZT A;  3IUO A;  5BPD A;  2GQQ A;  2WB1 A;  2EFW A;  2OF7 A;  1RRJ A;  4OMZ A;  1TQI A;  5A2Q K;  4DYQ A;  4CDG A;  2MG4 A;  2FNP A;  4QPO A;  2HOA A;  3ASO H;  2HDD A;  3GZ6 A;  2FMY A;  3CCS I;  2O3F A;  3H92 A;  2DA5 A;  5C4X J;  2EFQ A;  2NXN B;  1FPQ A;  2R7D A;  2DU9 A;  2Y69 H;  3TO6 A;  1GDT A;  1HST A;  4HA8 A;  1XN7 A;  1ETK A;  2LNB A;  4UB6 C;  3J7Y J;  2O6G E;  2HYJ A;  2EA4 A;  3PFI A;  1U5T B;  2FBH A;  1SFK A;  1QZE A;  1YG2 A;  4C2T A;  3E1S A;  3DP7 A;  1MMN A;  1O7L A;  1JHF A;  4KN7 X;  1OCP A;  4ON0 A;  4X0G A;  5TIS C;  2Y0S A;  1T38 A;  4G7Z F;  3IWF A;  2HFH A;  2CUZ A;  5H6R A;  1WZ2 A;  4QSH A; 
#chains in the Genus database with same CATH homology
 3DEE A;  3AKZ A;  3OYC A;  3H35 A;  1Y6I A;  2M0M A;  5FRM A;  5FRN A;  3DKY A;  3MKW B;  1P9Q C;  2E1M B;  1J09 A;  2X1E A;  2HDW A;  4P1W A;  1QU3 A;  1GLN A;  3A4C A;  3OYB A;  2CW7 A;  1D1B A;  2W1O A;  3K4L A;  4DBQ A;  2LY2 A;  3ZR8 X;  3PFY A;  4U7B A;  4D1Q A;  2R7X A;  4P5O A;  3OYL A;  4E6K G;  1HA8 A;  4ITV A;  4BJ5 C;  3K4N A;  2E5N A;  2BW3 A;  4PJL A;  5TGT A;  3W3C A;  1YX5 A;  3K4C A;  2L2O A;  3D5L A;  2UWM A;  4NQW B;  4RM2 A;  3K10 A;  4J00 A;  4XNF A;  2LG4 A;  4DJA A;  2KRC A;  3VWB A;  3HPG A;  4N4O B;  1FMW A;  3K4K A;  4B3X A;  3EUH C;  4XON A;  4PFP A;  3QYE A;  3M1C A;  3PSI A;  3BG6 A;  3ZGK A;  3FBN B;  2HPI A;  2VKH A;  2LOO A;  3LSM A;  1UG0 A;  1WJC A;  4LIU A;  4B47 A;  4CCL A;  2GOX B;  4QPQ A;  3OYD A;  1X1C A;  3QYB A;  4MLO A;  2FUG 2;  3MKZ A;  3LFU A;  4IQJ A;  3MMY B;  2XF5 A;  3K70 C;  4CCJ A;  3RCO A;  4LG3 A;  3RTR A;  3GBG A;  3DU5 A;  4RMN A;  4XQF A;  4XN0 A;  3OS0 A;  3HOT A;  2A6T A;  4G6T B;  4XOT A;  1G8X A;  3TL4 X;  4HRI A;  3ZCO A;  4CSW A;  5HVQ C;  1MMD A;  2WAE A;  3UNG C;  2R4G A;  4JQF A;  4F92 B;  3DQV C;  4IZZ A;  1Y56 A;  4NUB A;  3H9J A;  3OYH A;  1ZEL A;  2AQE A;  4PK4 A;  3S93 A;  4CCM A;  1QHH D;  2VXZ A;  4GRI A;  2WA0 A;  4IKF A;  2F5V A;  4PJN A;  4DGW B;  2CFO A;  4ZYA A;  1D0Z A;  1BR1 A;  2VIX A;  1YE9 A;  1ERD A;  4XMY A;  1D0Y A;  1X1B A;  2DXI A;  2XC7 A;  3FHN A;  1NG6 A;  2R7O A;  2IGM A;  2OUM A;  3SZG A;  5FRO A;  4E7K A;  3ZQQ A;  4IQ4 A;  3L2U A;  2Q1Z B;  3RPU D;  1T95 A;  4J01 A;  3OYE A;  4BE0 A;  4XKC A;  5HNF A;  2A5W A;  2VJ5 A;  4PUS A;  2KHM A;  2MYS A;  1D1C A;  2LBF A;  2JVH A;  4BDZ A;  3EUA A;  4KIS A;  3OYA A;  3HUG B;  3H5N A;  3DU6 A;  4DBR A;  4JOM A;  3PNY A;  3S8P A;  4EAT A;  2VQL A;  2MC4 A;  4F55 A;  3PSF A;  3S3N A;  2ZSH B;  2DT7 B;  4CCK A;  2XF6 A;  2AQF A;  2XF7 A;  1OR7 C;  3ZXS A;  1LDK B;  3OR1 C;  3A1Y A;  3K4J A;  4B44 A;  3W2A A;  2IS4 A;  2MAB A;  2KLO A;  3I3L A;  4HEA 2;  3OIP A;  2ZXI A;  3ONQ A;  2E5Z A;  1BR2 A;  2DT6 A;  1PJR A;  3PUB A;  4N4N B;  2CUJ A;  3U21 A;  4BU2 A;  3OOU A;  1N78 A;  4PSW A;  3OR2 C;  1Z21 A;  2VKD A;  3K4B A;  3NWT A;  3VYU B;  4E7L A;  1NG7 A;  3OYI A;  4XKB A;  4NC7 A;  1X19 A;  2X85 A;  2KQR A;  3SYT A;  3BG7 A;  2PJR B;  2ELJ A;  4OAZ A;  1R6R A;  1IRX A;  1QHG A;  2W7N A;  2R7R A;  1W36 D;  3OS1 A;  4ZDL A;  3H0D A;  4II2 A;  1V5G A;  4RLQ A;  2K9L A;  4HNU A;  4XOP A;  5CPR B;  1Z3X A;  2LC2 A;  2WAQ A;  4CUG A;  2KPM A;  3L2V A;  4E7Z A;  3AL0 C;  2W4S A;  2KRH A;  2R7Q A;  4AVZ A;  4XLA A;  3L2Q A;  2QKM B;  3OYK A;  3HOS A;  3PNT A;  2ZFU A;  3SEQ A;  1Z3Y A;  2WY8 Q;  2I8D A;  3E0J B;  1G59 A;  4BUP A;  2XDV A;  4LIV A;  2IS2 A;  1N75 A;  2X1D A;  1UAA A;  2DCE A;  3G2B A;  3LSG A;  3VYS B;  3EUK L;  2V4J C;  3BLY A;  4B43 A;  4KJZ A;  4HPQ A;  1DGR M;  1MNE A;  2K5C A;  4CA0 A;  1AA7 A;  4BE1 A;  4HG2 A;  3IP4 B;  1X1A A;  4BJ6 C;  3H9Q A;  3H5R A;  2HU9 A;  3DLA A;  2VQG A;  1KON A;  2BVM A;  3FKJ A;  2M7A A;  3MD2 A;  4AYB A;  3QOE A;  3DWL E;  4IX7 A;  3DTK A;  2IGN A;  3TBI A;  2L5Q A;  1TT0 A;  3D5R C;  4E7S A;  2V6E A;  2PMZ A;  4E7I A;  4DIQ A;  3OL3 A;  4FAS D;  2V9K A;  3BCA A;  2DJI A;  3DPL C;  3L2W A;  2BVL A;  3LSI A;  3HL2 A;  1UEL B;  3HG9 A;  1V5F A;  2VQH A;  3W2W A;  3KYL A;  4AU7 A;  4ANJ A;  1FMV A;  5KCM A;  1WJD A;  2L9N A;  2ZSI B;  4XKW A;  5HNH A;  4XL9 A;  4RLF A;  3W2V A;  4YRV A;  2IS1 A;  2R7V A;  1WJA A;  2K9M A;  2VQC A;  1BOB A;  1LVK A;  2HPM A;  2CV0 A;  2L7K A;  1X1D A;  1V5E A;  3IAS 2;  2LRD A;  2K3P A;  3A2K A;  1D1A A;  2IS6 A;  2V7F A;  3OYM A;  2MD0 A;  4ZTF A;  2KP6 A;  5CQG A;  1JI8 A;  2JUG A;  2RQQ A;  3FDY A;  4D9J A;  3CES A;  3LSK A;  2HNH A;  3DPU A;  3DTI A;  2OC6 A;  3EPZ A;  2HQA A;  3QYF A;  4II3 A;  4BL0 B;  2R7S A;  2CV2 A;  2VXD A;  2M3A A;  2XSJ C;  3LSH A;  4XLE A;  1TZL A;  3VDX A;  1T0F C;  4HST A;  3RQ4 A;  2HVS A;  1MND A;  4XLC A;  1S9H A;  4XLH A;  2X6X A;  3CJQ B;  2KZV A;  2LBF B;  2IXS A;  4CCN A;  3PL8 A;  3OMY A;  5CQE A;  2IGO A;  2HZD A;  1WFX A;  4XOR A;  1MW7 A;  1U0J A;  2M4G A;  2VJI A;  4XKV A;  2VJ4 A;  4YEL A;  4OAY A;  3HC7 A;  1E0E A;  3L2R A;  2WAD A;  1LKX A;  4DOZ A;  4BQO A;  2M7B A;  3CJR B;  3K4M A;  2BOL A;  4R79 A;  5HOO A;  1DGW Y;  2P0W A;  4H4K C;  2KL4 A;  3SDB A;  2MFZ A;  4PJM A;  3CMM A;  2NOJ B;  4ZC3 A;  3HKZ A;  4F3Q A;  3QOD A;  3OYN A;  2LYC A;  4BQQ A;  2WY7 Q;  3I9V 2;  3VSK A;  2E1M C;  1N77 A;  4BGD A;  2DOA A;  3DTE A;  4BS9 A;  1X4P A;  4BDY A;  3HXL A;  4ZDP A;  5JHF A;  2KMU A;  3OYG A;  2WAF A;  3OL4 A;  2LY1 A;  3K70 D;  4KIT B;  2CW8 A;  2WBM A;  4BQN A;  2LH9 A;  4NC8 A;  4Y4R A;  2HVR A;  1K6Y A;  1X4O A;  1OLT A;  4BEH A;  4E7H A;  2CS3 A;  4E7J A;  4E4H A;  4CCO A;  3S3M A;  1WJB A;  2CH0 A;  5KHD A;  1EA3 A;  3CP2 A;  3FBI B;  2VL8 A;  3OIQ A;  3H9G A;  4LIT A;  4Y33 A;  3LL7 A;  4KT6 A;  3S3O A;  3VSL A;  1DQU A;  2JA2 A;  2QKL B;  3OS2 A;  2ZXH A;  1VZ0 A;  3H5A A;  4F93 B;  4RM3 A;  3AL0 B;  1WJF A;  3MKY B;  4OWR B;  3S32 A;  2PJR A;  4YEJ A;  3V42 A;  3PNV A;  2X6Y A;  1DP3 A;  3DKX A;  4BE2 A;  2W00 A;  1YX3 A;  4XLF A;  3RSN A;  4ZTJ A;  3NWS A;  1WJ5 A;  2BW3 B;  2VB6 A;  4HSR A;  1MMG A;  3PJR A;  2GOM A;  5CKT A;  3UR3 C;  2R7U A;  4PFO A;  3OYJ A;  2RNG A;  4CZC A;  4B48 A;  4BJT A;  2X6W A;  4XM3 A;  3J7A Y;  2UUZ A;  2V26 A;  4XR6 A;  1W36 C;  2O5R A;  4C9Y A;  2JVG A;  3KX2 A;  4XN3 A;  2X1C A;  2Z2S B;  3N05 A;  2X51 A;  2W82 A;  2Z1D A;  4ZDO A;  2E60 A;  3BC8 A;  2UV1 A;  2VPL A;  2OV7 A;  3C2G A;  3F9K A;  1D0X A;  3VYR B;  5LD2 C;  2CMP A;  3CZ6 A;  1BR4 A;  3DPT A;  2R7T A;  4BEH B;  3LMM A;  4F91 B;  3KEY A;  1PYV A;  2Z16 A;  2VAS A;  3CF2 A;  2Q2E B;  4FET A;  4NNJ A;  4C2U A;  2IGK A;  3D5S C;  4PSX A;  3M8J A;  1WJE A;  4PJJ A;  2R7W A;  1MMA A;  4C30 A;  2F6C A;  3HPH A;  3CP8 A;  3ZRG A;  4HNT A;  1SAU A;  4BAC A;  1Z7L A;  2JSP A;  3IUO A;  2XAU A;  2WB1 A;  3BCB A;  3SEZ A;  2F4I A;  2VJJ A;  4QPO A;  4BXF A;  2V1N A;  2LRE A;  3OWT A;  3AFH A;  4F52 A;  2CV1 A;  3TMO A;  1LFP A;  5HLT A;  3K6G A;  4CH7 A;  2HVQ A;  4ZJZ A;  3IAM 2;  2KDO A;  5LFA A;  1SFK A;  2M4K A;  4C2T A;  2L9S A;  3VYT B;  2RRE A;  2VLA A;  1MMN A;  3E1S A;  3OY9 A;  4X0G A;  2Y0S A;  3OYF A;  4U87 A;  3C2H A;  2CUZ A;  4Y3O A;  5KNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...