1X4PA

Solution structure of surp domain in sfrs14 protei
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
b'GSSGSSGVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative splicing factor, arginine/serine-rich 14
publication title Solution structure of SURP domain in SFRS14 protei
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1x4pA00
1UG0A 1X4OA 1X4PA 2E5ZA 4DGWB 2DT7B 2E60A 2DT6A
chains in the Genus database with same CATH superfamily
2PX9A 3CUQB 3GO5A 2ZO4A 3K4KA 4BE2A 1ON2A 4CZZA 3ZN1A 2CV1A 3ZN0A 1R4MB 1TZLA 3GMEA 4HZFA 4KT5C 4JK1X 2TCTA 5HDGA 3N05A 3SDBA 4DYCA 3KEYA 1AKHA 1JTYA 2XF6A 4EEFG 4B09A 2VPLA 2NXNB 3L2VA 2MBFA 2RREA 2HU9A 4F3QA 3IH4A 1UMQA 4A93J 1HW1A 2OTLI 1XGSA 3OMYA 1OLTA 3ABMH 2CGPA 3PO3J 2KMUA 5J3LA 4M6VA 4B3AA 3WG7H 1FZPB 1VTNC 4RGUA 4PGHA 4QIWN 1JUPA 4BUPA 1RR7A 5CQEA 2JA8J 2L01A 3UR3C 2FF4A 3B02A 4B1RA 2DW4A 3L1PA 1Y8RB 1ETYA 1T56A 5ICGA 4DOZA 1FOXA 4M71A 1N75A 5DM6F 1J7KA 1MH4A 1YTYA 5M5YJ 4OWRB 2DMTA 3MZHA 2KL4A 5L3DA 4BDYA 1TWHJ 1YOVB 3M3YJ 3FBNB 3ESWB 2R7TA 5KNLA 4ZYEA 2ELHA 2FA5A 1G3WA 3SFIA 4IRIA 2LMDA 3IKVA 2B0LA 2UXXA 2JVHA 4JX4A 1BA5A 3J80Z 4FCYA 5TJJA 3HOWJ 1IXRC 1XD7A 2HYJA 2DDAA 2XPWA 2HQAA 2WB1N 5BQTA 1K4TA 2M8EA 2IVMA 3RIRA 4FHTA 4NC8A 4M72A 4HLXA 2XKOA 3GTOJ 3ISPA 4LIVA 4U0YA 4MLOA 1XMKA 3GFLA 1WSUA 2HXIA 1W7PA 2VKVA 1QGPA 1U5TB 2KRFA 5ILSA 1I3AA 2IA2A 3BPXA 2AS5F 1ETQA 1O4XA 1ZG5A 3JAMK 2LF7A 2W57A 2EILH 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 3OYNA 2QEXI 2YX4A 1IV6A 2RGVA 1FJLA 2JN6A 4G6TB 4U88A 1Y6IA 2EJRA 3PSIA 1SVLA 3RKXA 3PIPF 1JKRC 2NVTJ 4PCQA 2QUFA 2NVUB 4XN3A 3RKYA 3H0DA 4HBLA 4E70A 2OZ6A 3IAM2 3WE3A 5ERIA 3DV8A 1FBUA 4R8HA 1O3SA 4CGZA 3PFYA 2CUFA 5K7FA 1IO2A 3S93A 1ZRCA 1LKXA 2NOJB 3BR0A 3E1SA 1BOAA 4V2GA 4PK4A 3CMEI 1VQ6I 3BDDA 2PJRA 3RZOJ 2VBYA 4XKCA 1YE9A 3LNQA 3FHNA 4RM3A 4N9HA 1FYMA 4M3FA 2LRDA 4O3MA 1WGXA 4A6DA 2EBIA 1MH3A 5JI6A 2HKXA 1U8BA 2IP2A 2GBYA 1T0FA 3I64A 4II2A 4DIQA 1F9NA 4G7OF 3K2ZA 2DYRH 2DMPA 2EV0A 5ILUA 5IT9K 2JTVA 3E0JB 3CF2A 3CUQC 2ZJRF 1QO0D 1LFBA 5D5UB 4M3DA 1ZN2A 3BCBA 4HQEA 1ZKGA 1USSA 2Z5UA 1M1EB 1MJBA 1ZREA 4ABZA 5TGTA 2MYSA 2GQQA 3K7AJ 3T5XA 1LFUP 3OR2C 4IPAA 2X6YA 4XICA 4B8XA 3K4JA 2G0EA 5DCMB 2I8DA 4DNCA 2LP0A 3CCYA 3D0SA 3MAJA 1UB9A 3ZGKA 3HJEA 5BS6A 3GF2A 4XLNF 4HA8A 1X2MA 4BHPA 3Q9VA 4LOCA 1Z3XA 4DBQA 4A3JJ 1W7PD 5IP6A 3EYIA 3FF5A 1R1TA 3M8FA 4BJ5C 5HNHA 3ZMDA 2V6CA 3P7NA 4LIUA 2DPUA 2H1KA 4S0HB 5JHFA 1QBJA 2BYVE 3MKWB 1X1AA 3COAC 3ABUA 1JHFA 3P9KA 2VC0A 3ZMSA 2ZXWH 1J09A 1QQIA 1X3ZB 2OU2A 2O5RA 2VL8A 3B6AA 2CUJA 2KJBA 4Y17A 2XC7A 3LSHA 1VQ5I 3FISA 3WE2A 2OC6A 4BEHA 4A3GJ 3BT9A 4HSTA 2ZC2A 3WHBA 2XB5A 5FKLA 1TWFJ 2ID6A 3SDGA 2K4JA 2Y0SN 1GT0C 1ETKA 3H3ZA 1ZGJA 2COMA 4AIDA 1SEUA 4Y52J 1LDKB 2UWMA 2V6EA 4KICA 5DDGA 1S7AA 2IGOA 4UUSB 5KAFC 2DTZA 2HPIA 3EETA 3TO9A 2K02A 4Z6YA 3HUGB 1QVTA 5M5WJ 4EGZA 3HKZN 1IRGA 3DU5A 1IN6A 1TNTA 3L09A 4YIFA 1KYWA 4Q47A 5DTDA 2PBIA 3F72A 4CSWA 1U5TC 2OZUA 1OISA 3QPTA 4XLFA 5FKKA 4BBRJ 3F8BA 3LSPA 2VXZA 3TOAA 3HSFA 3BWGA 5IP7J 4RB0A 1WPKA 3R0AA 4RGRA 2DOFA 2X6XA 1XGNA 2EFPA 2MC3A 1RKTA 2CQKA 3BTLA 2MLGA 4A3IJ 1F1ZA 5LEJA 3A03A 3MEXA 2F4OB 1Q1VA 4RS8A 5EF6A 4A3DJ 1K6YA 2JA2A 4HNUA 4ZZDA 2AXLA 2Y2ZA 2P7VB 2ID3A 2DA7A 2DT5A 2W24A 2W48A 4OU0A 1KA8A 1CGPA 4ITVA 1IZ1A 3E6BA 2K9NA 4EJVA 5FFXA 3K0LA 3M8EA 1R36A 3GTPJ 3KYDB 4ZYGA 4JP0A 5E8GA 2WV1A 1IN5A 1JGSA 4G6DA 1Z0XA 1FMVA 4P1WA 3LL7A 2ZSHB 3HOYJ 1ETXA 2NYXA 2VPRA 1UFMA 2JPBA 3VDXA 5K5QA 5FLXK 1KU2A 3P9CA 4XN0A 1OCTC 2BY3A 3QYEA 3DTKA 4AD9A 3W6VA 1O3QA 3Q0WA 3H0GJ 4PZJA 2DODA 3EUKL 5E1WA 4AYBN 2LTPA 2VJIA 2ESNA 2KFDA 4MHGA 2E71A 2R7DA 4S04A 4AM3A 3MCZA 4PJ0C 4ZYDA 3BCAA 1ZHFA 4IHYA 2WAFA 3E5QA 4J00A 3ZPLA 1OKRA 1WJEA 2E2HJ 4ZC3A 3L2WA 2MH2A 5LHHA 4HG2A 1FSEA 1KU3A 3HEFA 2CMPA 3TKYA 2YU9J 2ZXJA 1SD5A 2YS9A 4OIQF 1D1AA 3GLXA 2IGNA 4JOMA 3LA7A 2PMUA 2MD0A 3HGGA 4Y15A 1E3PA 1OYIA 4LB6B 2DTRA 3RSNA 4DW6A 3A01A 1HKQA 3I4MJ 1DDNA 1FIPA 2FMLA 1R22A 2GXBA 5FRMA 1EH6A 3G6EI 3TO7A 5IP9J 1X4PA 3RKWA 5JVGF 3JRGA 1KQ8A 1R9TJ 2VE9A 2VXDA 1LVKA 2VIXA 2CH0A 3TBIA 3BR2A 1SAXA 2DJNA 2GA2A 3PO2J 3K4BA 3VYSB 2M0MA 1I6HJ 1JI8A 4MEXF 4KDPA 2QQ8A 5LGUA 2XB0X 5DD8A 1IN4A 4I0BA 1X1CA 3K1MA 1K78A 3OR1C 4IOCF 2W7NA 5C3EJ 3LAJA 4HF2A 5JVTA 3VODA 3CDHA 1S6LA 3M07A 4LGWA 4JYKA 1VQLI 1ONVA 2KZGA 1YHQI 2IS2A 3AG2H 5IOYA 4FX0A 3BG3A 4IHWA 4HAMA 4RA2A 4CCLA 2VOPA 2JSCA 1OYYA 1J0RA 1V55H 1AA7A 4F92B 2ZCWA 4IJAA 2L9RA 1U9OA 4PFPA 4WCGA 5EEHA 2NS0A 4C2MJ 3DBRB 1F4KA 4M73A 2VJ5A 3JRIA 4MO7A 2F2EA 4IZZA 4GYGA 4U87A 2M5WA 2Q2EB 3H35A 1U8RA 4YELA 2FX0A 3TMOA 1OCZH 1IJWC 5EGOA 1W0UA 2R3SA 1P92A 3F6OA 1WH7A 3HRTA 1WJDA 3M1EA 2GAUA 2PQ8A 1PDNC 4MFDA 3JRAA 3CUQA 1HDDC 1QHGA 4O5VA 3F8NA 2BW3B 2KPMA 3EQLF 3K1NA 4G7ZF 2M9HA 2YSRA 1T2KA 2HKOA 3DKYA 4XRSA 4QTRA 2NS7A 1QZZA 2O3FA 3J7YJ 1K83J 1FEXA 1Y0UA 3HSRA 2G9WA 3WHCA 4UUVA 2VJJA 1XTAA 2PFBA 2KISA 3V7SA 3VB2A 3S2HJ 2K27A 2A61A 1ZGAA 3GW2A 1RR8C 2EWNA 3RDIA 4A3FJ 4HNVA 2EINH 2L7ZA 3KIOA 1J5YA 1SFXA 1Y8QB 3S8PA 5L3FA 2M7AA 4CYDA 3F22A 4E7SA 3DLLF 1FWZA 2R5YB 4MTDA 2E60A 5FD6A 4JX5A 3I5UA 4B47A 2FEZA 2HS5A 3KLOA 4N0BA 3CD6I 4LLGF 3ZRGA 5A2QZ 1D0ZA 1UHMA 2F48A 2R5ZB 4XKWA 5LBQA 1Z77A 3V7CA 3IAS2 2A6EF 1XCVA 4L5EA 1OQYA 1HC8A 4ETSA 2BHYA 3K4NA 1X3UA 1XGOA 1W5SA 3DKWA 3CO7C 4ENMA 3QQAA 4PGGA 2KRCA 2WTEA 2EIKH 3OYDA 3ZP5A 3CLOA 3HPGA 4BY7J 2QKMB 1Z91A 4C3IJ 3ZXSA 2X6OA 2XAGA 5LHIA 3TOBA 3BJOA 2XAHA 3SJMA 3K10A 4ENNA 4HQMA 2CQ7A 2HOTA 2WC2A 3S32A 2V9VA 2DFFA 2EIJH 4KIBA 4L9JA 3NARA 3F21A 4HEA2 1KU7A 2QQ9A 2Z9OA 2LY1A 3E5UA 4IRGA 2H09A 2WAQA 3CMMA 4LMYA 4I01A 2BXZA 2QZ8A 3BR5A 1SFKA 5F64A 3WU0A 2IEKA 4CCMA 5ILVA 2V1DA 3DBHB 2VQHA 1U5TA 2DFEA 1B8IB 5L3CA 1EH8A 4A0XA 4EGYA 2IGKA 2L7FP 5H6QA 1K61A 1Z1DA 4A3MJ 4CICA 5D6FA 4XRMA 2H27A 1S8NA 3CO6C 5K7ZA 2ECCA 2CJJA 3FKIJ 4C2UA 2LF8A 3C7JA 3BR1A 4GGGA 3KCCA 5F6FA 3PNVA 1QPIA 1XDSA 1YW9A 5E17F 1E3HA 4RAGA 2DMQA 3C2GA 2R7QA 5GAEJ 2AO9A 3I9V2 3H92A 2KIMA 3OYCA 1R49A 1JGGA 4I2OA 2ADUA 4FASD 1JUSA 2E1CA 3JSPA 2MW8A 3N4MA 1P6RA 2HDDA 1MJAA 5B3SH 2Y30A 3JRHA 2VOOA 2EV5A 4YFNF 4Z2YA 4RB1A 3ABKH 2R4GA 3C2BA 3GTKJ 2K9MA 3ERMA 4NC6A 5EG0B 3PM1A 3DXJF 1G6NA 3FMSA 4BL0B 5FKOA 2KT0A 1ZG1A 1P4AA 2NAZA 4KN4X 1RZ4A 2Z1DA 1ZH5A 2QSGX 3D5RC 3IWFA 5CJ9A 5FFZA 1IRZA 4UVCA 4LG0B 4UV8A 2FU4A 2EH3A 1H9GA 2OCCH 2STWA 1MMSA 1APLC 3ASOH 1B72B 1F36A 3R60A 4ON0A 2BBYA 2OUMA 4NUBA 4HOBA 4A12A 2IAIA 4U0VA 4XMYA 2E2IJ 3VYTB 1H88C 2D5VA 3BTJA 1A31A 4XM3A 3HDDA 4IVNA 2M3AA 1N77A 2KRHA 1MGTA 1SD7A 1GUUA 1MMDA 4D9JA 4MTEA 3LSRA 1TTYA 1MJ9A 3SEZA 2E5ZA 3K4LA 3E3VA 4HF0A 1JTXA 1TT0A 5KCMA 3BROA 5HDKA 3OYFA 1L0OC 2V9PA 2VE8A 3IWZA 2V7FA 3G73A 1YIJI 1E0EA 5EZGA 5J4VA 2V9KA 2KLOA 1KZHA 2F4IA 1P4XA 1S5LC 1SFEA 3H5RA 2HVSA 3OYEA 2ME6A 4C9YA 4UHTA 4XLEA 4BAYA 5F0FA 5FJ8J 2HPMA 2FQ4A 3CCLI 1GHCA 2W1OA 1WRJA 2IPQX 2HZDA 2HGCA 4L5IA 4NQWB 2YU3A 2H8WA 3HPHA 3J81Z 4ANJA 2EK5A 3ZQFA 3OS0A 2VI6A 1FP2A 2Y0MA 1MSFC 2Y69H 2Z16A 2EFQA 2K86A 4NC7A 5JFRA 1R58A 2MSYA 3F8FA 4ZTJA 2MLKA 3NQOA 4XL9A 2IS1A 1G8XA 3F6VA 4OINF 2A68F 1TC3C 2V79A 1BBYA 1BC8C 3SZTA 1PJRA 5D5WB 4YIRX 1IF1A 2X9DA 3QOPA 3PUFA 1MDMB 2I5UA 4CH7A 2WAEA 3S3NA 1U6GA 4AIJA 3HUGA 3KEOA 1SFUA 2JZYA 2IXSA 2JK3A 2DMNA 4P9UA 4XLAA 1SAUA 4CXFA 5B1AH 1D1CA 4IHTA 2HDCA 1OFCX 1W4MA 3GZ5A 4GYIA 1FPQA 3JREA 4GO1A 4IQ4A 1SVMA 1WI3A 4L9VA 2HOAA 4M3GA 5DUIA 2A69F 5GAGJ 1KGSA 2N8GA 2STTA 4KISA 1KQ9A 1GV2A 2P0WA 5D5XB 3W6KB 2Z2SB 2QKLB 3D1NI 3CF5F 3HGYA 5F1JA 5EEGA 2EA2A 2F5VA 4WK8F 5F08A 4HX4A 1MNMC 5LRRA 1MKMA 2K9QA 3OS2A 3CCJI 2ZFUA 2DFIA 4HNTA 4D0PA 3ZMTA 1K7AA 2CV0A 4MGRA 3R61A 2CWEA 3CP8A 1HW2A 3ZQIA 3GFIA 3IH2A 4EJUA 3CESA 3DKXA 3G71I 2JVGA 1Z7UA 2VQCA 1RKWA 2LKXA 3M7GA 4CDGA 4M74A 4OAZA 2LH9A 3Q3SA 1QZEA 2HTSA 1XSXA 3JTGA 3NWSA 5FB2A 2BY2A 4II3A 5ICFA 4G9YA 1JT0A 3DPTA 2CG4A 1QRYA 4M9SA 3WTYC 4I09A 4HDVA 1XC5A 1PUEE 4XORA 2R93J 2F6CA 2RKHA 3WGGA 3D5SC 1D0YA 3ZMUA 6PAXA 5ED4A 5J40A 3SFZA 3RQ4A 3PNYA 4EM1A 3VSKA 1H0MA 1VZ0A 1D1BA 3PSFA 1BI0A 3SEQA 4ZDPA 3V8JA 1JT6A 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 2ZMEB 3BJAA 1DP7P 1FC3A 2EV6A 3QODA 4ESJA 5E1XA 1HSTA 3U1DA 2LREA 1USTA 1Z6RA 5E79C 5HLTA 2QF7A 4HDUA 4BE1A 1V4RA 1IG7A 1FBQA 3BG9A 2D2WA 1YX3A 1S29A 3GTQJ 3LOCA 5H20A 2MGQA 3BG5A 2DOEA 2VN2A 5DS9A 1UAAA 4BU2A 5DV5A 3OS1A 1ZELA 3IRQA 3F8CA 3LMMA 3A0BC 4ZYHA 5C4XJ 3P9IA 4I98B 1DU6A 1S3JA 1Y0NA 3I59B 2OD5A 1LJ9A 2KJCA 1B59A 3HHHA 3FMQA 2QGUA 3GFMA 4IO9F 1WVRA 3QPSA 3GLLA 1XN7A 1IV8A 1LEAA 2EZIA 2Y31A 3VOEA 4BKXA 1Y1VJ 2CYYA 2F5FA 2JPCA 1I1GA 1TLHB 5EDNA 1KU9A 2KZVA 2ZFWA 1SVOA 3LSIA 4YFXF 3WTUC 1E17A 4IKFA 4HW0A 4DZPA 4AIHA 2Z99A 2NS8A 1OMIA 3LSKA 3VEPA 4TV7A 4P55A 4D5CA 4RB3C 2PN6A 1MBGA 4OAYA 1S9HA 2UUZA 2WV0A 3H1CA 2M0CA 4PJNA 5H6RA 2Y75A 2V1XA 1ETOA 2MG4A 4UVBA 5K1YA 3CC2I 3KPHA 1V3FA 1OCPA 4XOPA 5E18F 2TDXA 1R7JA 2XVCA 2ZJQF 3OV8A 1HF0A 2YR2A 4E6KG 1RETA 1MBHA 2DJIA 4DGWB 2EA4A 5B1BH 2NVYJ 3SZGA 3OL4A 5E1ZB 5EEAA 2Z3YA 1T98A 5H2FC 3HL2A 1WZ2A 1IRFA 3QPLA 4XONA 4BS9A 4OMYA 3I0TA 2DA3A 3IP4B 2BW3A 2IBDA 4XNFA 2JWTA 1R5GA 3RYRA 4RAYA 1YRNB 2DO7A 2XDVA 3KZIC 2HWVA 4RAFA 2QLZA 2XAFA 3QRFF 3CJRB 1IUFA 4F55A 1X19A 5FRNA 3FXJA 1KQ0A 1VQNI 1X1DA 3ABTA 1HOMA 2KDOA 1RRJA 1X1PA 1B9NA 3RYPA 3HRSA 2BVLA 3BQYA 2M2EA 1D8KA 3ELKA 4LK0F 3UNGC 3K70C 2WB1A 2KHMA 3G1MA 2ZNYA 3WTWC 1L3LA 4Y13A 4BY1J 1I39A 1W5TA 4UB6C 5M3MJ 4B48A 2R5YA 2D45A 5CYVA 2XROA 2GXAA 2LKPA 4U7BA 2L4MA 2YUSA 3ZQLA 3BC8A 3DWLE 2CFXA 1NK2P 2ZKZA 1RNLA 2R5ZA 1DU0A 2V26A 2AHQA 2VUMJ 4BACA 1ETWA 2IW5A 2QBYB 3KX2A 1JKPC 2A07F 4KYWA 3CZ6A 2O8KA 2F5CA 2GWRA 2HI3A 3HRMA 2BHZA 3JRBA 2CUEA 3A1YA 1YS7A 3JW4A 5IYCJ 2B9SA 3FX3A 4CA0A 1SMTA 3DF8A 2V4JC 1Z21A 1SMYF 2E34A 5D8LB 3TP3A 5GADJ 1Z7LA 3VSLA 3CTAA 3H5AA 2AXTC 3RQIA 3MFKA 2BGCA 1ZG3A 1Z9CA 2KIUA 3TQNA 2XRNA 2ZMEC 1RI7A 2FD5A 1HXDA 5FROA 1TBXA 1OJLA 1JKOC 4A3LJ 2VKDA 2O0YA 3H9GA 3P5JA 1GXQA 3S16J 2XPUA 3ZMVA 1VQKI 1IXSB 3LAPA 3A2KA 2DMUA 2RC4A 4XIDA 4Y7NJ 3QYFA 2VONA 2Y9ZA 3BZKA 4CHUA 2L0KA 4LK1F 4PFOA 5GTHC 2DK8A 4S05A 4N9IA 4IXAA 3H5NA 3ZOBA 2BVMA 3HBLA 1B8IA 2KDZA 4X1EA 4Q48A 3OIOA 4GRIA 1J9IA 1SC7A 1GVJA 2B7EA 2MABA 4E7HA 1ZARA 2E7WA 1PUFB 2K85A 3JAMZ 3HOUJ 2FNAA 4PSWA 2HOSA 2RV8A 3GWZA 1U9NA 2L9VA 4LB5A 3MN2A 3EYYA 5L3GA 1ZQ3P 1BN5A 1V5GA 3S2DJ 3T8RA 3QOEA 5GTIC 3MMYB 3PUBA 3IH3A 2XPVA 2A3SA 3CCEI 4J19A 1BJZA 2MD5A 2WAQN 3A02A 1YLFA 4A2UA 3TDZC 4DBRA 2KIFA 2FOKA 1FX7A 5CVJA 4E4HA 5F0CA 3IL2A 1REPC 4KNYA 2G7HA 5HOOA 1X3WB 2LVSA 2XUBA 5HS8A 2IT0A 5EG0A 1JHHA 4LJZF 3BZCA 1BI1A 4CCOA 3OYMA 4G6QA 1FMWA 2VC1A 1K4SA 1A6IA 4XBFA 2HR3A 3E7LA 1FBSA 1NH3A 4FQGA 4BXXJ 1LDJA 2E1NA 4I02A 3N97A 3NEUA 4PUSA 1Y39A 1W36C 1KONA 2JMWA 3OYKA 4LG0A 2K7LA 4BE0A 1WFXA 2P5LC 2LLKA 3B73A 3RKQA 1DPUA 2LK2A 1B72A 4DQ2A 4E7LA 3K4MA 4NHJA 3CQZJ 2UV1A 5IT9Z 5IT3A 2QSFX 1CF7A 4RM2A 1EJ9A 2RNJA 2XGCA 3HG9A 1YW8A 1JE8A 2HVRA 4FE4A 3KP3A 2ZXHA 1PP8F 2R7FA 5DCFA 2LD5A 1OCCH 5C4JJ 1MMNA 3HOVJ 1AWCA 3I54A 4RLFA 2CS3A 1R4NB 3V7RA 3I71A 4B3XA 4BQAA 4QPOA 3FXMA 1P9QC 3HZJA 2XRLA 4UB8C 1V5FA 4EQQA 3FIWA 3MVPA 2FXAA 5GPCA 3DU6A 3FDYA 3JCUC 1RC9A 2HYFA 3KP4A 4G94A 3GTMJ 4EV0A 3V42A 2WY7Q 2AQEA 1RUNA 3CC7I 2LYCA 3HOTA 5BOXA 2CO5A 1DQUA 3WU2C 2WBMA 3HOXJ 1FOWA 4I6ZA 2UXNA 3L7WA 4NQWA 1BR1A 4YFKF 3HTSB 3W2AA 1MZBA 1JKQC 4XQFA 1CQTA 2KQRA 2W4SA 2XV4S 2A6HF 3W2WA 1X58A 2XF5A 3KP6A 4KFCA 3GVAA 1TWGJ 2P5KA 4JQFA 5LLQA 2QWWA 2DA2A 1AOYA 3QP6A 1FTZA 1VQ7I 1G3TA 3WU1B 1UHWA 3JRCA 2CQQA 3PFIA 4F7ZA 2RNGA 1YJWI 3E97A 3EUAA 4BQNA 3MKZA 2RDPA 1T95A 3J80K 2ELJA 1R23A 1VNDA 4EMSA 3NWTA 1ON1A 2A5YB 2OBPA 3CLQA 2L9NA 2R7WA 2K9LA 2XSDC 4BJTA 4FISA 4AYBA 1ERDA 2DYSH 1EA3A 2P7CB 2BV6A 2W00A 2FUG2 1KYZA 2CQXA 3BG7A 1QA6A 2A05A 1SANA 1XSVA 3CJQB 1BM9A 3M1CA 4HV6A 2M4KA 3VFZA 4E7ZA 5JHUA 5LFAA 2JQ7A 4W97A 2L4AA 2L54A 3BOQA 2JA6J 2IJLA 1SD6A 2W82A 4NBQA 1LQ1A 5K5OA 1JJ8C 2CSOA 2DI3A 2DK5A 4I99C 3RTRA 3OYBA 1J59A 1UCRA 1WJ5A 3DQVC 5LD2C 1D8JA 3F3XA 3HOZJ 2EZHA 4L0YB 2QSHX 4BNCA 3W3CA 1UJ8A 1YFHA 2EQRA 5E3MA 1ITYA 2KIQA 1NK3P 3HHGA 4BYYA 5IPAA 4KMFA 2O6GE 2R7UA 3OIPA 3DTIA 2HQNA 3QP5A 4CCJA 3L2CA 2X1DA 5KK1A 1QHHD 2X0LA 3K6GA 3QAHA 1MMGA 5JR3A 1LE8B 3EPZA 4FETA 4HSRA 1BR4A 2IA0A 3J7AY 2G7UA 2TRTA 2WY8Q 3R6SA 1U3EM 2P8TA 2XASA 3OYHA 2WADA 3BTIA 2NNNA 2XGXA 1VFCA 3F8MA 5FLXZ 2R7VA 3IKTA 3L9FA 2LFBA 1FP1D 2H94A 2M34A 2VJ4A 2LKSA 4HV5A 4A5MA 2L2OA 1MMAA 2OF7A 4XLHA 3H3UA 4LLLA 4KN7X 3H9QA 3K9TA 3SHFA 2PJPA 2DCEA 3V8KA 2EPFA 2PMZA 4XSZF 5D5VB 2MA3A 2PG4A 5J1UA 3K1PA 3AAFA 4XRFA 2LNBA 4RLQA 3HYIA 3GX4X 3CCMI 1JJ6C 4UY8I 2IS4A 2DT6A 4WXCA 4XSXF 2I10A 4JBAA 4DYRA 1LVAA 3GTGJ 2QQAA 4BDZA 3JTHA 1PYVA 1BL0A 4RDUA 3VYUB 5TRDA 3F0CA 3ABLH 3O6BB 5AIPA 2ZMEA 3ECHA 3M4OJ 1V5EA 1XMXA 5HNFA 3IRRA 1A5JA 3TW6A 3M8JA 4IEJA 2JT1A 2QA4I 3OY9A 4HX8A 1VQ8I 5E20A 1RESA 2RVCA 1G59A 4G8XA 1WCMJ 4E7KA 3ONQA 1P7JA 1WH5A 2X4HA 1QVUA 3DPLC 1HA8A 1IUYA 2D1VA 2E36A 1JXSA 2FBHA 3QU3A 4F52A 2VQLA 1TQPA 2AQFA 2ICWG 1X2NA 3FXRA 4UV9A 4OIPF 1FOKA 1WJFA 1T33A 1AHDP 2LDUA 4U7DA 2VLAA 2X51A 1O3TA 3LSJA 5DCMA 4ZTFA 3L00A 3I59A 4IF4A 3FXQA 4ENKA 2VKHA 3FXLA 1U78A 2HZTA 1C0WA 5DM7F 3GYHX 4IOAF 4XRSG 4D7NA 1S7EA 1YJNI 4EVIA 1IDYA 1IN8A 2L02A 2OTJI 2EIMH 2O61A 4G7HF 5CKTA 2LBFB 3K70D 5LGTA 1ZYRF 4WXDA 5IOZA 5EGOB 1QNTA 3S14J 2A5WA 3JRDA 1YJ9I 3HTUA 3DP7A 1I27A 1A04A 2FRHA 5CPRB 2W84A 5J6XA 2L7KA 2X1EA 3QYBA 3WTZA 3H3VK 3EUHC 2E7XA 1WJCA 3DEWA 2F5EA 3G1LA 1IDZA 2CFOA 4HX7A 3O8HA 2DFHA 3OL3A 1SFOJ 4V19K 3FKJA 1B4AA 2Q1ZB 2DA6A 3AL0B 2DOAA 3FHZA 2GM4A 1FTTA 2HEOA 5FGMA 1BI3A 1XSDA 5CVRA 4KIFA 5L3BA 1T8IA 5FD5A 1B9MA 3AG4H 1BW5A 4MQVA 5BMZA 4OOIA 3Q0VA 3BR6A 3VWBA 4L18B 4XLPF 4QLCU 1DGWY 4CYCB 1YRNA 2NVQJ 2DAOA 3PQKA 4UUSA 3GXOA 3ZQQA 3TL4X 3DCFA 3SXYA 2ACJA 2CQNA 3FK7A 3QWLA 4ZDLA 4YG2F 5M3FJ 3OYIA 1XGMA 1MBKA 1VQMI 4A0YA 3J7AO 5AIQA 2JJ7A 1IAWA 3TP0A 3DPUA 1GDTA 2X85A 3LSMA 1TP4A 4D7MA 5L3EA 4I0AA 3KYLA 2UZKA 5BPDA 3WTTC 1R1VA 1FIAA 1ODDA 3L2UA 2O03A 2L5QA 1XCBA 2R7OA 2VT2A 3KP2A 3CCQI 3DLAA 3MZYA 2X6WA 4M6YA 1GV5A 4B44A 1TWAJ 4LG3A 1X4OA 2EZLA 3G4SI 1UG2A 4KT6A 4Y3OA 4A6EA 3R0JA 2VBZA 2A6TA 2FBKA 4IRHA 5E8IA 4BXUA 3V8LA 3ZQ7A 4KA4A 3U9GA 5IY5H 1O57A 2QBYA 4IX7A 1NG6A 3Q5FA 1IRXA 3KYCB 2YPRA 3MD2A 4L0ZB 1G3SA 3ASNH 1YW7A 1O7FA 1H89C 4A3CJ 4A3KJ 4OIOF 3ZQCA 3S1NJ 2ECBA 3AKZA 1R5HA 1WQ2A 2H1LA 1ZRDA 3ULQB 2JA7J 4M9XA 3NAUA 5C44J 4E7JA 2GXGA 5CVIA 1W0TA 4X6AJ 3GUDA 4U0WA 2WWYA 1FT9A 1MSEC 4AWXB 1EH7A 4XKVA 1EV7A 5M5XJ 5J1RA 1OR7C 3TEDA 5AONA 1NTCA 2E1OA 3KZYA 5DEQA 3PL8A 1W36D 1HQCA 3A0HC 3DFGA 3K69A 2PI0A 1MBEA 3BP8A 1QU3A 3GBGA 3ZQHA 2P6SA 3G3ZA 1B1BA 3OSGA 3ERED 2OPTA 2ZSIB 1PUFA 1NG7A 4RGSA 3LA3A 2JRTA 2HQRA 2K4BA 2RQPA 2DQRA 2ZXIA 2K40A 3I53A 4QSHA 4GFBA 5TISC 1RIOH 1VQ4I 2JA5J 2CUZA 5IYDJ 1VF9A 2OCEA 2FMYA 2W85A 5DUKA 4XKBA 1Z05A 4ZJZA 4NNJA 2R7ZJ 2ELKA 4ESBA 4HF1A 4ZH4F 5FKNA 1BOBA 3LFKA 4E7IA 2MFZA 3CJNA 2OAZA 1XS9A 2M7BA 2XKPA 3S1QJ 2COBA 2QYOA 2P5VA 2XAUA 4FTHA 4IHVA 2KKOA 3FWEA 1I6XA 4CCKA 3BZ6A 1YIOA 1RPWA 4L9NA 4ASNA 4R79A 2H6BA 1ACIA 5E3NA 2Q0OA 1U2WA 2EFNA 2D1HA 3W2VA 2LOOA 1MBFA 3AL0C 4N4NB 2WA0A 5J8FA 2BXYA 4ESFA 1R00A 5CQGA 3RPUA 2L3DA 4PSXA 1K79A 3C3WA 3OYAA 1DUXC 2VODA 5HVQC 4BQOA 2HVQA 3X2QH 3LSTA 2O7OA 5GAHJ 2NRAC 2RQQA 1OCOH 2K3FA 2Q2EA 1I1SA 2L9SA 4KIGA 3CDLA 5B5EC 3BLYA 1YG2A 4C3JJ 5HS9A 3CCRI 1XX5A 3GZ6A 2X48A 2FBIA 1G4DA 5D6EA 1VI0A 4RAZA 4ENJA 1AKHB 2HQ5A 2OV7A 2LG4A 2OQGA 2BOLA 4GDFA 5LRSA 1TW3A 2XSJC 2DA1A 4YRVA 3I4PA 3ECOA 3LQRA 4L5JA 4RBOA 3WTVC 1XG1A 1R5ID 1BW6A 1MBJA 1TQIA 3IUOA 2CRGA 1ZLJA 3ZCOA 2DA4A 1HKTA 1I3QJ 3BQZA 2M45A 2V1NA 1YX5A 5CVUA 1HW5A 4J01A 5J4YA 4WWCA 5A2QK 5GP9A 2NVXJ 3MWMA 3JRFA 1GVDA 2Y9YA 3D5LA 3OOPA 4CCNA 1NHAA 1Y56A 3TO6A 4I76A 2IS6A 4OMZA 2ZJ2A 2E19A 1O7LA 3HSEA 3F23A 4H4KC 4BJ6C 2ISYA 1Q1HA 1ZAOA 1F5TA 3BR3A 4YIIA 4MEYF 2IGMA 3EDPA 2GOMA 5BPIA 3ML6A 3PIOF 1LB2A 1ETVA 1R1UA 4MNUA 1DP3A 1ZR2A 3FZVA 1WJBA 1ULYA 2XAJA 3WG9A 4EATA 2BEOA 3OIQA 2DBBA 5KHDA 3WTSC 1Z6TA 4BQQA 3SYTA 3LA2A 2GLOA 3GCMA 1G3YA 1YI2I 3EUHA 1OPCA 1N78A 3S3OA 1T39A 3GTJJ 5E3LA 1UZCA 1K6OA 2R7RA 2JUCA 4BBSJ 3WTXC 3OYGA 1HDPA 5BNGA 2K9SA 3HIFA 2CU7A 4BXFA 3R4KA 5HLIA 4P96A 3H36A 3LSGA 4EJOA 3OSFA 3G2BA 1YQAA 2M8GX 4KUMA 1IXCA 1MNEA 1W7PB 3RI4A 1S72I 2HOEA 2H8RA 4DJAA 1IC8A 1LUJB 3E6MA 3I58A 3RPUD 4A3BJ 1WWXA 1XB4A 3CCVI 4UVAA 4LD5A 2BZTA 2RN7A 2R7XA 3OWTA 2JSPA 2ZBKA 1YO5C 1IW7F 4JX6A 1ZRFA 1FYLA 4KITB 5HLHA 4H0EA 2E1MB 4KJZA 4D5FA 3RZDJ 2KP6A 3AFHA 3I3LA 1W1WE 2HXOA 4MFEA 3CC4I 2RAEA 1TW2A 2VB6A 1IGNA 5E3OA 1WI9A 3JSOA 2EB7A 3K4CA 5HS7A 3CUOA 1A6QA 5JLXA 4WX9A 5D8KB 4NB5A 1TT5B 1PP7U 5J1YA 2ZJPF 1LE8A 4AUXA 3Q9SA 1H8AC 1VQ9I 2L7MP 2MH9A 1ZR4A 4AU7A 4F93B 1F43A 4RGXA 2J5PA 4EM2A 4PJLA 3HB9A 3E6CC 2PJRB 4D1QA 2BY1A 5GPAA 1T6SA 4R1HA 3DEUA 1FY7A 4XR6A 2X1CA 3OYLA 1MW7A 3FXOA 3UKGA 4ZYAA 2DU9A 3A4CA 5J8CA 1STZA 2LSOA 2CW8A 4OIRF 4A3EJ 4M3BA 1TNSA 3I55I 5FLMJ 3B6CA 4XOTA 4EJWA 3KLNA 2Q8KA 1Y1WJ 1J2XA 4Q4ZF 2J5OA 5IYBJ 3DEEA 1E2XA 2YX7A 3AG3H 4FX4A 2FJ1A 4BGDA 3FBIB 1XPXA 4XK4A 2DLLA 4X0GA 2ZNZA 1XMAA 5F27A 1E3OC 2R7SA 3S17J 2XAQA 5FKMA 2IA1A 3DBLB 5ICCA 3HXLA 4CUGA 3KP5A 2FE3A 2DDBA 3TW7A 5KAIC 1OR7A 3ZQGA 4EM0B 1SD4A 3QPHA 3CDIA 4O6JA 4QPQA 3HC7A 4DYQA 3FM3A 3BY6A 2Y0SA 2PMZN 1ENHA 1LEBA 2GA1A 1V54H 3ZR8X 3L2RA 4NDLA 1OCRH 2O8XA 3OOUA 2E2JJ 3M9AA 3HOSA 2DN0A 2M4GA 3ROUA 3DTEA 3HKZA 3Q0UA 1UELB 2ISZA 3TDUC 3MZ8A 4WXHA 3SZPA 3KE2A 3J81K 2OJED 2LBFA 1A36A 2DA5A 2DQLA 2FQ3A 2QVOA 3C2HA 2M1BA 4BEHB 1TL8A 2VT3A 1EF4A 2W25A 3WGHA 2CV2A 1BJAA 3FM5A 2V1UA 5J47A 4KMUX 3I4NJ 3VYRB 5F04A 3AG1H 1U0JA 2XGEA 1DPRA 4M3EA 3RPQA 1HBXG 1IN7A 2MC4A 1QPMA 2FOWA 5FO5A 1ZTRA 1DGRM 4UUTA 2QM3A 3PQJA 3O8GA 4ZZLA 2VBWA 1X1BA 1VQPI 1GXPA 3RCOA 2NOGA 1HCRA 1PVEA 3BPVA 1MNDA 1WKMA 2EFOA 1O3RA 2HYGD 4C2TA 3NRVA 5D4RA 9ANTA 4ZDOA 2K5CA 2VKEA 1W5CC 1EKEA 2XHKA 4V2FA 4Y4RA 4LFUA 4RB2C 2DXIA 3QU6A 3CCUI 3MKLA 2HNHA 2DT7B 2HTJA 2VBXA 3S2WA 2P81A 4CYCA 2M87A 3T1BA 1G2HA 3RJPA 1ZLKA 1MDMA 3E6DA 3HRUA 4IHSA 2GZWA 1N25A 2R0QC 4GCVA 1WHUA 1ZGWA 3C18A 4AVZA 3CP2A 2B63J 1GLNA 2XF7A 2GIZA 3OYJA 5B66C 1P4WA 1D5VA 1JUMA 3U2RA 3T0YA 5F1RA 1YITI 1P2FA 4AVPA 2E1MC 3IHUA 4DZJA 4GXOA 3U1KA 3O2PE 1Z3YA 3LFUA 1QZYA 3GZNB 2K3PA 1HLVA 3T8TA 2XGDA 1D5YA 4AIKA 1BR2A 4IQJA 3ZMZA 2R92J 1LPQA 1A35A 4PJJA 4EJTA 3KZZA 3U21A 4A0ZA 3WGIA 2QQBA 4IL6C 3CCSI 2ME0A 1HSJA 1I5ZA 3FK6A 1OYWA 5LHGA 2HDWA 2CW7A 3BG6A 1RUOA 1R6RA 4C30A 3K2AA 1I50J 2P4WA 5KVRA 5EZHA 2Z33A 4K2EA 5HODA 3GTLJ 1T0FC 3I56I 4FE7A 1T38A 2C6YA 1ZK8A 3FMRA 3PNTA 1LNWA 1VQOI 4BHCA 5LEKA 1FLIA 1WJAA 1LFPA 1Z67A 3MKYB 2O9LA 2ESHA 4Y33A 2HFHA 3CJTB 3WODF 4M9ZA 1YS6A 3HM5A 4WF2A 5CVVA 1TQMA 4F91B 2QCOA 1YYVA 2E35A 3BTCA 2FSWA 2F4MB 4HRIA 1XDUA 5EJCA 3FXKA 3VPRA 2CW0F 4BHBA 4MQ9F 1BI2A 1UG0A 2JUGA 2E5NA 2PMHA 2EZKA 4PDKA 4FT8A 1BIBA 2LY2A 2FNPA 1S7OA 1UHSA 3A01B 2EFWA 2XIGA 1B6AA 1POGA 2PLYA 4LLNA 1J75A 3GEZA 4UNOA 2DPDA 3E5XA 4M6XA 1D3YA 5FLVA 2JRMA 3PJRA 1TWCJ 2NNYA 1HKSA 4Q5SF 2OA4A 5CLSA 4MIMA 5F0HA 4HPQA 4AC0A 3KP7A 3V4GA 4B4CA 2H6CA 1BIAA 5K7HA 5D4SA 4LITA 2VASA 2LR8A 3CMYA 4L9TA 3S3MA 3G1OA 4B43A 1R71A 2P6TA 2BY0A 1P7IA 3JR9A 2LY9A 1D0XA 5JLWA 2OQRA 4UXNA 1K78B 3BJ6A 3J7ZI 4N4OB 5HLGA 4G12A 2ETHA 1MIJA 4HYEA 3S1MJ 3KFWX 5DYMA 3KETA 3GFJA 5K5RA 3L2QA 2BE5F 5HDNA 3F9KA 2GIVA 5DD4A 4PJMA 3CMAI 4IHXA 3KEQA 4HLYA 4W1UA 2QENA 1BC7C 2ZB9A 2Y48A 3IC7A 4YEJA 2LC2A 2VQGA 4P9FA 4XLCA 2PEXA 3REOA 1CF7B 3TGNA 1FOYA 2GOXB 3H9JA 1FSHA 4A5NA 4C3HJ 4CZCA 5EYRA 3O3KA 1ORKA 5LGNA 3FXUA 2IRFG 3IV5A 1LDDA 3C1DA 3S15J 1T08B 3LWFA 4A69C 5ICEA 1H9TA 4BH9A 1AU7A 1MD0A 4P5OA 3S1RJ 4RMNA 2M30A
chains in the Genus database with same CATH topology
2MFZA 3K4KA 4BE2A 2M7BA 3ZRGA 3A2KA 1D0ZA 3QYFA 2CV1A 4XKWA 2XAUA 3IAS2 4PFOA 1TZLA 3H5NA 2BVMA 4CCKA 3K4NA 4R79A 3N05A 3SDBA 3KEYA 4GRIA 2MABA 2XF6A 2KRCA 4E7HA 3OYDA 2VPLA 3HPGA 3L2VA 2QKMB 3W2VA 4PSWA 2RREA 2LOOA 2HU9A 3ZXSA 4F3QA 3AL0C 4N4NB 3K10A 2WA0A 3OMYA 1OLTA 3S32A 2KMUA 1V5GA 3QOEA 3MMYB 3PUBA 5CQGA 4HEA2 4BUPA 4PSXA 3OYAA 5HVQC 5CQEA 2LY1A 2WAQA 4BQOA 3CMMA 4E4HA 2HVQA 4DBRA 3UR3C 2RQQA 1SFKA 2L9SA 3BLYA 5HOOA 4DOZA 4CCMA 1N75A 2VQHA 4OWRB 4CCOA 3OYMA 1FMWA 2OV7A 2KL4A 2IGKA 2BOLA 2LG4A 4BDYA 3FBNB 4PUSA 2R7TA 5KNLA 1W36C 1KONA 2XSJC 3OYKA 4YRVA 4C2UA 4BE0A 1WFXA 3PNVA 3IUOA 3ZCOA 2JVHA 3C2GA 2R7QA 4E7LA 2V1NA 3K4MA 3I9V2 1YX5A 2UV1A 4J01A 3OYCA 4RM2A 4FASD 2HQAA 3HG9A 2HVRA 4NC8A 2ZXHA 3D5LA 4CCNA 1Y56A 4LIVA 1MMNA 4MLOA 2IS6A 2R4GA 2K9MA 4BL0B 4H4KC 4RLFA 4BJ6C 2CS3A 2Z1DA 2IGMA 3D5RC 2GOMA 4B3XA 4QPOA 1P9QC 1DP3A 3OYNA 1WJBA 1V5FA 4EATA 3OIQA 3DU6A 3FDYA 4G6TB 1Y6IA 5KHDA 4BQQA 3PSIA 3SYTA 2OUMA 4NUBA 4XN3A 3V42A 2WY7Q 2AQEA 3S3OA 3H0DA 1N78A 3IAM2 2R7RA 2LYCA 4XMYA 3VYTB 3HOTA 1DQUA 3OYGA 2WBMA 3PFYA 4XM3A 4BXFA 3S93A 1BR1A 1LKXA 2M3AA 2NOJB 3E1SA 3LSGA 1N77A 2KRHA 3G2BA 3W2AA 4PK4A 4XQFA 1MMDA 4D9JA 2KQRA 1MNEA 2W4SA 2PJRA 3SEZA 4DJAA 3W2WA 2E5ZA 3K4LA 2XF5A 4XKCA 3RPUD 1YE9A 4JQFA 3FHNA 4RM3A 1TT0A 5KCMA 2LRDA 3OYFA 2R7XA 2V7FA 2JSPA 3OWTA 4II2A 2RNGA 4DIQA 1E0EA 3EUAA 4BQNA 3MKZA 2V9KA 2KLOA 1T95A 4KITB 2ELJA 2F4IA 2E1MB 3E0JB 4KJZA 3CF2A 2KP6A 3NWTA 3AFHA 3I3LA 3H5RA 2HVSA 3OYEA 4C9YA 2VB6A 4XLEA 2HPMA 3BCBA 3K4CA 2R7WA 2L9NA 2W1OA 2K9LA 4BJTA 2HZDA 4AYBA 1ERDA 4NQWB 1EA3A 2MYSA 5TGTA 2W00A 2FUG2 3BG7A 4AU7A 4F93B 3OR2C 2X6YA 3CJQB 3HPHA 3M1CA 4E7ZA 2M4KA 4PJLA 5LFAA 3K4JA 4ANJA 3OS0A 2PJRB 2W82A 4D1QA 2I8DA 2Z16A 3RTRA 4NC7A 3OYBA 4XR6A 3ZGKA 4ZTJA 4XL9A 1WJ5A 2IS1A 1G8XA 2X1CA 3OYLA 1MW7A 3DQVC 5LD2C 4ZYAA 3A4CA 1Z3XA 3W3CA 1PJRA 4DBQA 2CW8A 4BJ5C 5HNHA 4XOTA 4LIUA 4CH7A 2WAEA 3S3NA 5JHFA 2R7UA 3OIPA 3DTIA 3MKWB 1X1AA 3DEEA 2IXSA 4CCJA 2X1DA 1QHHD 1J09A 4BGDA 3FBIB 4XLAA 1SAUA 2O5RA 3K6GA 4X0GA 1MMGA 2VL8A 1D1CA 3EPZA 4FETA 2CUJA 2R7SA 4HSRA 1BR4A 3J7AY 2XC7A 3LSHA 2OC6A 2WY8Q 3HXLA 4IQ4A 4BEHA 4CUGA 3OYHA 2WADA 4HSTA 2R7VA 4KISA 2P0WA 2VJ4A 4QPQA 2Z2SB 2QKLB 2L2OA 1MMAA 4XLHA 3HC7A 2Y0SA 3H9QA 2F5VA 2DCEA 2PMZA 3ZR8X 3L2RA 1LDKB 2UWMA 2V6EA 3OOUA 2IGOA 3OS2A 2ZFUA 4HNTA 4RLQA 2CV0A 2IS4A 3HOSA 2HPIA 2M4GA 2DT6A 3HUGB 3CP8A 3DU5A 3DTEA 4BDZA 3HKZA 1UELB 1PYVA 3CESA 3DKXA 3VYUB 2JVGA 2VQCA 4CSWA 4OAZA 2LH9A 1V5EA 4XLFA 2LBFA 3NWSA 5HNFA 3C2HA 2VXZA 3M8JA 4BEHB 4II3A 3OY9A 2X6XA 3DPTA 2CV2A 1G59A 4E7KA 3ONQA 3VYRB 3DPLC 1HA8A 1U0JA 4F52A 2VQLA 4XORA 1K6YA 2JA2A 2AQFA 2MC4A 4HNUA 2F6CA 1DGRM 1WJFA 3D5SC 1D0YA 2VLAA 1X1BA 2X51A 3RCOA 4ZTFA 4ITVA 1MNDA 3RQ4A 2VKHA 3PNYA 4C2TA 3VSKA 4ZDOA 2K5CA 1VZ0A 1D1BA 3PSFA 4Y4RA 3SEQA 2DXIA 4ZDPA 2HNHA 2DT7B 1FMVA 4P1WA 3LL7A 2ZSHB 5CKTA 3QODA 2LBFB 2LREA 5HLTA 3K70D 3VDXA 4BE1A 4XN0A 1YX3A 3QYEA 2A5WA 3DTKA 4AVZA 3CP2A 1GLNA 2XF7A 5CPRB 3EUKL 3OYJA 2VJIA 2L7KA 2X1EA 3QYBA 1UAAA 4BU2A 2E1MC 3BCAA 3EUHC 3OS1A 2WAFA 1Z3YA 1ZELA 3LFUA 2K3PA 1WJCA 3LMMA 4J00A 1WJEA 2CFOA 3OL3A 4ZC3A 3L2WA 3FKJA 1BR2A 2Q1ZB 4HG2A 4IQJA 3AL0B 2DOAA 4PJJA 2CMPA 3U21A 1D1AA 4JOMA 2IGNA 2MD0A 3VWBA 2KZVA 3RSNA 1DGWY 3LSIA 4IKFA 2HDWA 2CW7A 3ZQQA 3BG6A 3TL4X 1R6RA 5FRMA 4C30A 4ZDLA 1X4PA 3OYIA 3LSKA 1T0FC 2VXDA 1LVKA 2VIXA 3PNTA 2CH0A 3DPUA 1WJAA 1LFPA 2X85A 3TBIA 4OAYA 3LSMA 1S9HA 2UUZA 4PJNA 3KYLA 3MKYB 4Y33A 3L2UA 3K4BA 3VYSB 2M0MA 2L5QA 2R7OA 1JI8A 4XOPA 4F91B 3DLAA 2X6WA 4E6KG 1X1CA 4HRIA 2DJIA 4DGWB 3OR1C 4B44A 3SZGA 4LG3A 1UG0A 3OL4A 2W7NA 1X4OA 2JUGA 2E5NA 3HL2A 4KT6A 4Y3OA 4BS9A 4XONA 2A6TA 2LY2A 3IP4B 2BW3A 4XNFA 2IS2A 2XDVA 4IX7A 4CCLA 1NG6A 1IRXA 3CJRB 3MD2A 4F55A 1X19A 5FRNA 3PJRA 1X1DA 2KDOA 1AA7A 4F92B 2BVLA 4HPQA 4PFPA 3AKZA 2VJ5A 3UNGC 3K70C 2WB1A 2KHMA 4LITA 4IZZA 2VASA 4U87A 2Q2EB 3H35A 4E7JA 4YELA 3S3MA 4B43A 3TMOA 4B48A 1D0XA 1WJDA 4N4OB 4U7BA 4XKVA 3L2QA 3BC8A 1QHGA 3DWLE 1OR7C 2BW3B 2KPMA 3F9KA 4PJMA 2V26A 3PL8A 1W36D 4BACA 3DKYA 3KX2A 3CZ6A 4YEJA 2LC2A 2VQGA 1QU3A 3A1YA 3GBGA 4XLCA 2VJJA 4CA0A 2V4JC 1Z21A 2GOXB 2ZSIB 1NG7A 3H9JA 4CZCA 2ZXIA 1Z7LA 3VSLA 3H5AA 2CUZA 3S8PA 2M7AA 4E7SA 2E60A 4XKBA 4ZJZA 4NNJA 5FROA 2VKDA 4P5OA 4B47A 4RMNA 3H9GA 4E7IA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG0 A;  1X4O A;  1X4P A;  2E5Z A;  4DGW B;  2DT7 B;  2E60 A;  2DT6 A; 
#chains in the Genus database with same CATH topology
 2PX9 A;  3CUQ B;  3GO5 A;  2ZO4 A;  3K4K A;  4BE2 A;  1ON2 A;  4CZZ A;  3ZN1 A;  2CV1 A;  3ZN0 A;  1R4M B;  1TZL A;  3GME A;  4HZF A;  4KT5 C;  4JK1 X;  2TCT A;  5HDG A;  3N05 A;  3SDB A;  4DYC A;  3KEY A;  1AKH A;  1JTY A;  2XF6 A;  4EEF G;  4B09 A;  2VPL A;  2NXN B;  3L2V A;  2MBF A;  2RRE A;  2HU9 A;  4F3Q A;  3IH4 A;  1UMQ A;  4A93 J;  1HW1 A;  2OTL I;  1XGS A;  3OMY A;  1OLT A;  3ABM H;  2CGP A;  3PO3 J;  2KMU A;  5J3L A;  4M6V A;  4B3A A;  3WG7 H;  1FZP B;  1VTN C;  4RGU A;  4PGH A;  4QIW N;  1JUP A;  4BUP A;  1RR7 A;  5CQE A;  2JA8 J;  2L01 A;  3UR3 C;  2FF4 A;  3B02 A;  4B1R A;  2DW4 A;  3L1P A;  1Y8R B;  1ETY A;  1T56 A;  5ICG A;  4DOZ A;  1FOX A;  4M71 A;  1N75 A;  5DM6 F;  1J7K A;  1MH4 A;  1YTY A;  5M5Y J;  4OWR B;  2DMT A;  3MZH A;  2KL4 A;  5L3D A;  4BDY A;  1TWH J;  1YOV B;  3M3Y J;  3FBN B;  3ESW B;  2R7T A;  5KNL A;  4ZYE A;  2ELH A;  2FA5 A;  1G3W A;  3SFI A;  4IRI A;  2LMD A;  3IKV A;  2B0L A;  2UXX A;  2JVH A;  4JX4 A;  1BA5 A;  3J80 Z;  4FCY A;  5TJJ A;  3HOW J;  1IXR C;  1XD7 A;  2HYJ A;  2DDA A;  2XPW A;  2HQA A;  2WB1 N;  5BQT A;  1K4T A;  2M8E A;  2IVM A;  3RIR A;  4FHT A;  4NC8 A;  4M72 A;  4HLX A;  2XKO A;  3GTO J;  3ISP A;  4LIV A;  4U0Y A;  4MLO A;  1XMK A;  3GFL A;  1WSU A;  2HXI A;  1W7P A;  2VKV A;  1QGP A;  1U5T B;  2KRF A;  5ILS A;  1I3A A;  2IA2 A;  3BPX A;  2AS5 F;  1ETQ A;  1O4X A;  1ZG5 A;  3JAM K;  2LF7 A;  2W57 A;  2EIL H;  3W6J B;  2F5D A;  1FNN A;  3LQQ A;  4CO8 A;  3OYN A;  2QEX I;  2YX4 A;  1IV6 A;  2RGV A;  1FJL A;  2JN6 A;  4G6T B;  4U88 A;  1Y6I A;  2EJR A;  3PSI A;  1SVL A;  3RKX A;  3PIP F;  1JKR C;  2NVT J;  4PCQ A;  2QUF A;  2NVU B;  4XN3 A;  3RKY A;  3H0D A;  4HBL A;  4E70 A;  2OZ6 A;  3IAM 2;  3WE3 A;  5ERI A;  3DV8 A;  1FBU A;  4R8H A;  1O3S A;  4CGZ A;  3PFY A;  2CUF A;  5K7F A;  1IO2 A;  3S93 A;  1ZRC A;  1LKX A;  2NOJ B;  3BR0 A;  3E1S A;  1BOA A;  4V2G A;  4PK4 A;  3CME I;  1VQ6 I;  3BDD A;  2PJR A;  3RZO J;  2VBY A;  4XKC A;  1YE9 A;  3LNQ A;  3FHN A;  4RM3 A;  4N9H A;  1FYM A;  4M3F A;  2LRD A;  4O3M A;  1WGX A;  4A6D A;  2EBI A;  1MH3 A;  5JI6 A;  2HKX A;  1U8B A;  2IP2 A;  2GBY A;  1T0F A;  3I64 A;  4II2 A;  4DIQ A;  1F9N A;  4G7O F;  3K2Z A;  2DYR H;  2DMP A;  2EV0 A;  5ILU A;  5IT9 K;  2JTV A;  3E0J B;  3CF2 A;  3CUQ C;  2ZJR F;  1QO0 D;  1LFB A;  5D5U B;  4M3D A;  1ZN2 A;  3BCB A;  4HQE A;  1ZKG A;  1USS A;  2Z5U A;  1M1E B;  1MJB A;  1ZRE A;  4ABZ A;  5TGT A;  2MYS A;  2GQQ A;  3K7A J;  3T5X A;  1LFU P;  3OR2 C;  4IPA A;  2X6Y A;  4XIC A;  4B8X A;  3K4J A;  2G0E A;  5DCM B;  2I8D A;  4DNC A;  2LP0 A;  3CCY A;  3D0S A;  3MAJ A;  1UB9 A;  3ZGK A;  3HJE A;  5BS6 A;  3GF2 A;  4XLN F;  4HA8 A;  1X2M A;  4BHP A;  3Q9V A;  4LOC A;  1Z3X A;  4DBQ A;  4A3J J;  1W7P D;  5IP6 A;  3EYI A;  3FF5 A;  1R1T A;  3M8F A;  4BJ5 C;  5HNH A;  3ZMD A;  2V6C A;  3P7N A;  4LIU A;  2DPU A;  2H1K A;  4S0H B;  5JHF A;  1QBJ A;  2BYV E;  3MKW B;  1X1A A;  3COA C;  3ABU A;  1JHF A;  3P9K A;  2VC0 A;  3ZMS A;  2ZXW H;  1J09 A;  1QQI A;  1X3Z B;  2OU2 A;  2O5R A;  2VL8 A;  3B6A A;  2CUJ A;  2KJB A;  4Y17 A;  2XC7 A;  3LSH A;  1VQ5 I;  3FIS A;  3WE2 A;  2OC6 A;  4BEH A;  4A3G J;  3BT9 A;  4HST A;  2ZC2 A;  3WHB A;  2XB5 A;  5FKL A;  1TWF J;  2ID6 A;  3SDG A;  2K4J A;  2Y0S N;  1GT0 C;  1ETK A;  3H3Z A;  1ZGJ A;  2COM A;  4AID A;  1SEU A;  4Y52 J;  1LDK B;  2UWM A;  2V6E A;  4KIC A;  5DDG A;  1S7A A;  2IGO A;  4UUS B;  5KAF C;  2DTZ A;  2HPI A;  3EET A;  3TO9 A;  2K02 A;  4Z6Y A;  3HUG B;  1QVT A;  5M5W J;  4EGZ A;  3HKZ N;  1IRG A;  3DU5 A;  1IN6 A;  1TNT A;  3L09 A;  4YIF A;  1KYW A;  4Q47 A;  5DTD A;  2PBI A;  3F72 A;  4CSW A;  1U5T C;  2OZU A;  1OIS A;  3QPT A;  4XLF A;  5FKK A;  4BBR J;  3F8B A;  3LSP A;  2VXZ A;  3TOA A;  3HSF A;  3BWG A;  5IP7 J;  4RB0 A;  1WPK A;  3R0A A;  4RGR A;  2DOF A;  2X6X A;  1XGN A;  2EFP A;  2MC3 A;  1RKT A;  2CQK A;  3BTL A;  2MLG A;  4A3I J;  1F1Z A;  5LEJ A;  3A03 A;  3MEX A;  2F4O B;  1Q1V A;  4RS8 A;  5EF6 A;  4A3D J;  1K6Y A;  2JA2 A;  4HNU A;  4ZZD A;  2AXL A;  2Y2Z A;  2P7V B;  2ID3 A;  2DA7 A;  2DT5 A;  2W24 A;  2W48 A;  4OU0 A;  1KA8 A;  1CGP A;  4ITV A;  1IZ1 A;  3E6B A;  2K9N A;  4EJV A;  5FFX A;  3K0L A;  3M8E A;  1R36 A;  3GTP J;  3KYD B;  4ZYG A;  4JP0 A;  5E8G A;  2WV1 A;  1IN5 A;  1JGS A;  4G6D A;  1Z0X A;  1FMV A;  4P1W A;  3LL7 A;  2ZSH B;  3HOY J;  1ETX A;  2NYX A;  2VPR A;  1UFM A;  2JPB A;  3VDX A;  5K5Q A;  5FLX K;  1KU2 A;  3P9C A;  4XN0 A;  1OCT C;  2BY3 A;  3QYE A;  3DTK A;  4AD9 A;  3W6V A;  1O3Q A;  3Q0W A;  3H0G J;  4PZJ A;  2DOD A;  3EUK L;  5E1W A;  4AYB N;  2LTP A;  2VJI A;  2ESN A;  2KFD A;  4MHG A;  2E71 A;  2R7D A;  4S04 A;  4AM3 A;  3MCZ A;  4PJ0 C;  4ZYD A;  3BCA A;  1ZHF A;  4IHY A;  2WAF A;  3E5Q A;  4J00 A;  3ZPL A;  1OKR A;  1WJE A;  2E2H J;  4ZC3 A;  3L2W A;  2MH2 A;  5LHH A;  4HG2 A;  1FSE A;  1KU3 A;  3HEF A;  2CMP A;  3TKY A;  2YU9 J;  2ZXJ A;  1SD5 A;  2YS9 A;  4OIQ F;  1D1A A;  3GLX A;  2IGN A;  4JOM A;  3LA7 A;  2PMU A;  2MD0 A;  3HGG A;  4Y15 A;  1E3P A;  1OYI A;  4LB6 B;  2DTR A;  3RSN A;  4DW6 A;  3A01 A;  1HKQ A;  3I4M J;  1DDN A;  1FIP A;  2FML A;  1R22 A;  2GXB A;  5FRM A;  1EH6 A;  3G6E I;  3TO7 A;  5IP9 J;  1X4P A;  3RKW A;  5JVG F;  3JRG A;  1KQ8 A;  1R9T J;  2VE9 A;  2VXD A;  1LVK A;  2VIX A;  2CH0 A;  3TBI A;  3BR2 A;  1SAX A;  2DJN A;  2GA2 A;  3PO2 J;  3K4B A;  3VYS B;  2M0M A;  1I6H J;  1JI8 A;  4MEX F;  4KDP A;  2QQ8 A;  5LGU A;  2XB0 X;  5DD8 A;  1IN4 A;  4I0B A;  1X1C A;  3K1M A;  1K78 A;  3OR1 C;  4IOC F;  2W7N A;  5C3E J;  3LAJ A;  4HF2 A;  5JVT A;  3VOD A;  3CDH A;  1S6L A;  3M07 A;  4LGW A;  4JYK A;  1VQL I;  1ONV A;  2KZG A;  1YHQ I;  2IS2 A;  3AG2 H;  5IOY A;  4FX0 A;  3BG3 A;  4IHW A;  4HAM A;  4RA2 A;  4CCL A;  2VOP A;  2JSC A;  1OYY A;  1J0R A;  1V55 H;  1AA7 A;  4F92 B;  2ZCW A;  4IJA A;  2L9R A;  1U9O A;  4PFP A;  4WCG A;  5EEH A;  2NS0 A;  4C2M J;  3DBR B;  1F4K A;  4M73 A;  2VJ5 A;  3JRI A;  4MO7 A;  2F2E A;  4IZZ A;  4GYG A;  4U87 A;  2M5W A;  2Q2E B;  3H35 A;  1U8R A;  4YEL A;  2FX0 A;  3TMO A;  1OCZ H;  1IJW C;  5EGO A;  1W0U A;  2R3S A;  1P92 A;  3F6O A;  1WH7 A;  3HRT A;  1WJD A;  3M1E A;  2GAU A;  2PQ8 A;  1PDN C;  4MFD A;  3JRA A;  3CUQ A;  1HDD C;  1QHG A;  4O5V A;  3F8N A;  2BW3 B;  2KPM A;  3EQL F;  3K1N A;  4G7Z F;  2M9H A;  2YSR A;  1T2K A;  2HKO A;  3DKY A;  4XRS A;  4QTR A;  2NS7 A;  1QZZ A;  2O3F A;  3J7Y J;  1K83 J;  1FEX A;  1Y0U A;  3HSR A;  2G9W A;  3WHC A;  4UUV A;  2VJJ A;  1XTA A;  2PFB A;  2KIS A;  3V7S A;  3VB2 A;  3S2H J;  2K27 A;  2A61 A;  1ZGA A;  3GW2 A;  1RR8 C;  2EWN A;  3RDI A;  4A3F J;  4HNV A;  2EIN H;  2L7Z A;  3KIO A;  1J5Y A;  1SFX A;  1Y8Q B;  3S8P A;  5L3F A;  2M7A A;  4CYD A;  3F22 A;  4E7S A;  3DLL F;  1FWZ A;  2R5Y B;  4MTD A;  2E60 A;  5FD6 A;  4JX5 A;  3I5U A;  4B47 A;  2FEZ A;  2HS5 A;  3KLO A;  4N0B A;  3CD6 I;  4LLG F;  3ZRG A;  5A2Q Z;  1D0Z A;  1UHM A;  2F48 A;  2R5Z B;  4XKW A;  5LBQ A;  1Z77 A;  3V7C A;  3IAS 2;  2A6E F;  1XCV A;  4L5E A;  1OQY A;  1HC8 A;  4ETS A;  2BHY A;  3K4N A;  1X3U A;  1XGO A;  1W5S A;  3DKW A;  3CO7 C;  4ENM A;  3QQA A;  4PGG A;  2KRC A;  2WTE A;  2EIK H;  3OYD A;  3ZP5 A;  3CLO A;  3HPG A;  4BY7 J;  2QKM B;  1Z91 A;  4C3I J;  3ZXS A;  2X6O A;  2XAG A;  5LHI A;  3TOB A;  3BJO A;  2XAH A;  3SJM A;  3K10 A;  4ENN A;  4HQM A;  2CQ7 A;  2HOT A;  2WC2 A;  3S32 A;  2V9V A;  2DFF A;  2EIJ H;  4KIB A;  4L9J A;  3NAR A;  3F21 A;  4HEA 2;  1KU7 A;  2QQ9 A;  2Z9O A;  2LY1 A;  3E5U A;  4IRG A;  2H09 A;  2WAQ A;  3CMM A;  4LMY A;  4I01 A;  2BXZ A;  2QZ8 A;  3BR5 A;  1SFK A;  5F64 A;  3WU0 A;  2IEK A;  4CCM A;  5ILV A;  2V1D A;  3DBH B;  2VQH A;  1U5T A;  2DFE A;  1B8I B;  5L3C A;  1EH8 A;  4A0X A;  4EGY A;  2IGK A;  2L7F P;  5H6Q A;  1K61 A;  1Z1D A;  4A3M J;  4CIC A;  5D6F A;  4XRM A;  2H27 A;  1S8N A;  3CO6 C;  5K7Z A;  2ECC A;  2CJJ A;  3FKI J;  4C2U A;  2LF8 A;  3C7J A;  3BR1 A;  4GGG A;  3KCC A;  5F6F A;  3PNV A;  1QPI A;  1XDS A;  1YW9 A;  5E17 F;  1E3H A;  4RAG A;  2DMQ A;  3C2G A;  2R7Q A;  5GAE J;  2AO9 A;  3I9V 2;  3H92 A;  2KIM A;  3OYC A;  1R49 A;  1JGG A;  4I2O A;  2ADU A;  4FAS D;  1JUS A;  2E1C A;  3JSP A;  2MW8 A;  3N4M A;  1P6R A;  2HDD A;  1MJA A;  5B3S H;  2Y30 A;  3JRH A;  2VOO A;  2EV5 A;  4YFN F;  4Z2Y A;  4RB1 A;  3ABK H;  2R4G A;  3C2B A;  3GTK J;  2K9M A;  3ERM A;  4NC6 A;  5EG0 B;  3PM1 A;  3DXJ F;  1G6N A;  3FMS A;  4BL0 B;  5FKO A;  2KT0 A;  1ZG1 A;  1P4A A;  2NAZ A;  4KN4 X;  1RZ4 A;  2Z1D A;  1ZH5 A;  2QSG X;  3D5R C;  3IWF A;  5CJ9 A;  5FFZ A;  1IRZ A;  4UVC A;  4LG0 B;  4UV8 A;  2FU4 A;  2EH3 A;  1H9G A;  2OCC H;  2STW A;  1MMS A;  1APL C;  3ASO H;  1B72 B;  1F36 A;  3R60 A;  4ON0 A;  2BBY A;  2OUM A;  4NUB A;  4HOB A;  4A12 A;  2IAI A;  4U0V A;  4XMY A;  2E2I J;  3VYT B;  1H88 C;  2D5V A;  3BTJ A;  1A31 A;  4XM3 A;  3HDD A;  4IVN A;  2M3A A;  1N77 A;  2KRH A;  1MGT A;  1SD7 A;  1GUU A;  1MMD A;  4D9J A;  4MTE A;  3LSR A;  1TTY A;  1MJ9 A;  3SEZ A;  2E5Z A;  3K4L A;  3E3V A;  4HF0 A;  1JTX A;  1TT0 A;  5KCM A;  3BRO A;  5HDK A;  3OYF A;  1L0O C;  2V9P A;  2VE8 A;  3IWZ A;  2V7F A;  3G73 A;  1YIJ I;  1E0E A;  5EZG A;  5J4V A;  2V9K A;  2KLO A;  1KZH A;  2F4I A;  1P4X A;  1S5L C;  1SFE A;  3H5R A;  2HVS A;  3OYE A;  2ME6 A;  4C9Y A;  4UHT A;  4XLE A;  4BAY A;  5F0F A;  5FJ8 J;  2HPM A;  2FQ4 A;  3CCL I;  1GHC A;  2W1O A;  1WRJ A;  2IPQ X;  2HZD A;  2HGC A;  4L5I A;  4NQW B;  2YU3 A;  2H8W A;  3HPH A;  3J81 Z;  4ANJ A;  2EK5 A;  3ZQF A;  3OS0 A;  2VI6 A;  1FP2 A;  2Y0M A;  1MSF C;  2Y69 H;  2Z16 A;  2EFQ A;  2K86 A;  4NC7 A;  5JFR A;  1R58 A;  2MSY A;  3F8F A;  4ZTJ A;  2MLK A;  3NQO A;  4XL9 A;  2IS1 A;  1G8X A;  3F6V A;  4OIN F;  2A68 F;  1TC3 C;  2V79 A;  1BBY A;  1BC8 C;  3SZT A;  1PJR A;  5D5W B;  4YIR X;  1IF1 A;  2X9D A;  3QOP A;  3PUF A;  1MDM B;  2I5U A;  4CH7 A;  2WAE A;  3S3N A;  1U6G A;  4AIJ A;  3HUG A;  3KEO A;  1SFU A;  2JZY A;  2IXS A;  2JK3 A;  2DMN A;  4P9U A;  4XLA A;  1SAU A;  4CXF A;  5B1A H;  1D1C A;  4IHT A;  2HDC A;  1OFC X;  1W4M A;  3GZ5 A;  4GYI A;  1FPQ A;  3JRE A;  4GO1 A;  4IQ4 A;  1SVM A;  1WI3 A;  4L9V A;  2HOA A;  4M3G A;  5DUI A;  2A69 F;  5GAG J;  1KGS A;  2N8G A;  2STT A;  4KIS A;  1KQ9 A;  1GV2 A;  2P0W A;  5D5X B;  3W6K B;  2Z2S B;  2QKL B;  3D1N I;  3CF5 F;  3HGY A;  5F1J A;  5EEG A;  2EA2 A;  2F5V A;  4WK8 F;  5F08 A;  4HX4 A;  1MNM C;  5LRR A;  1MKM A;  2K9Q A;  3OS2 A;  3CCJ I;  2ZFU A;  2DFI A;  4HNT A;  4D0P A;  3ZMT A;  1K7A A;  2CV0 A;  4MGR A;  3R61 A;  2CWE A;  3CP8 A;  1HW2 A;  3ZQI A;  3GFI A;  3IH2 A;  4EJU A;  3CES A;  3DKX A;  3G71 I;  2JVG A;  1Z7U A;  2VQC A;  1RKW A;  2LKX A;  3M7G A;  4CDG A;  4M74 A;  4OAZ A;  2LH9 A;  3Q3S A;  1QZE A;  2HTS A;  1XSX A;  3JTG A;  3NWS A;  5FB2 A;  2BY2 A;  4II3 A;  5ICF A;  4G9Y A;  1JT0 A;  3DPT A;  2CG4 A;  1QRY A;  4M9S A;  3WTY C;  4I09 A;  4HDV A;  1XC5 A;  1PUE E;  4XOR A;  2R93 J;  2F6C A;  2RKH A;  3WGG A;  3D5S C;  1D0Y A;  3ZMU A;  6PAX A;  5ED4 A;  5J40 A;  3SFZ A;  3RQ4 A;  3PNY A;  4EM1 A;  3VSK A;  1H0M A;  1VZ0 A;  1D1B A;  3PSF A;  1BI0 A;  3SEQ A;  4ZDP A;  3V8J A;  1JT6 A;  4I7H A;  3MQ0 A;  3SQN A;  1FYK A;  4QWQ A;  2ZME B;  3BJA A;  1DP7 P;  1FC3 A;  2EV6 A;  3QOD A;  4ESJ A;  5E1X A;  1HST A;  3U1D A;  2LRE A;  1UST A;  1Z6R A;  5E79 C;  5HLT A;  2QF7 A;  4HDU A;  4BE1 A;  1V4R A;  1IG7 A;  1FBQ A;  3BG9 A;  2D2W A;  1YX3 A;  1S29 A;  3GTQ J;  3LOC A;  5H20 A;  2MGQ A;  3BG5 A;  2DOE A;  2VN2 A;  5DS9 A;  1UAA A;  4BU2 A;  5DV5 A;  3OS1 A;  1ZEL A;  3IRQ A;  3F8C A;  3LMM A;  3A0B C;  4ZYH A;  5C4X J;  3P9I A;  4I98 B;  1DU6 A;  1S3J A;  1Y0N A;  3I59 B;  2OD5 A;  1LJ9 A;  2KJC A;  1B59 A;  3HHH A;  3FMQ A;  2QGU A;  3GFM A;  4IO9 F;  1WVR A;  3QPS A;  3GLL A;  1XN7 A;  1IV8 A;  1LEA A;  2EZI A;  2Y31 A;  3VOE A;  4BKX A;  1Y1V J;  2CYY A;  2F5F A;  2JPC A;  1I1G A;  1TLH B;  5EDN A;  1KU9 A;  2KZV A;  2ZFW A;  1SVO A;  3LSI A;  4YFX F;  3WTU C;  1E17 A;  4IKF A;  4HW0 A;  4DZP A;  4AIH A;  2Z99 A;  2NS8 A;  1OMI A;  3LSK A;  3VEP A;  4TV7 A;  4P55 A;  4D5C A;  4RB3 C;  2PN6 A;  1MBG A;  4OAY A;  1S9H A;  2UUZ A;  2WV0 A;  3H1C A;  2M0C A;  4PJN A;  5H6R A;  2Y75 A;  2V1X A;  1ETO A;  2MG4 A;  4UVB A;  5K1Y A;  3CC2 I;  3KPH A;  1V3F A;  1OCP A;  4XOP A;  5E18 F;  2TDX A;  1R7J A;  2XVC A;  2ZJQ F;  3OV8 A;  1HF0 A;  2YR2 A;  4E6K G;  1RET A;  1MBH A;  2DJI A;  4DGW B;  2EA4 A;  5B1B H;  2NVY J;  3SZG A;  3OL4 A;  5E1Z B;  5EEA A;  2Z3Y A;  1T98 A;  5H2F C;  3HL2 A;  1WZ2 A;  1IRF A;  3QPL A;  4XON A;  4BS9 A;  4OMY A;  3I0T A;  2DA3 A;  3IP4 B;  2BW3 A;  2IBD A;  4XNF A;  2JWT A;  1R5G A;  3RYR A;  4RAY A;  1YRN B;  2DO7 A;  2XDV A;  3KZI C;  2HWV A;  4RAF A;  2QLZ A;  2XAF A;  3QRF F;  3CJR B;  1IUF A;  4F55 A;  1X19 A;  5FRN A;  3FXJ A;  1KQ0 A;  1VQN I;  1X1D A;  3ABT A;  1HOM A;  2KDO A;  1RRJ A;  1X1P A;  1B9N A;  3RYP A;  3HRS A;  2BVL A;  3BQY A;  2M2E A;  1D8K A;  3ELK A;  4LK0 F;  3UNG C;  3K70 C;  2WB1 A;  2KHM A;  3G1M A;  2ZNY A;  3WTW C;  1L3L A;  4Y13 A;  4BY1 J;  1I39 A;  1W5T A;  4UB6 C;  5M3M J;  4B48 A;  2R5Y A;  2D45 A;  5CYV A;  2XRO A;  2GXA A;  2LKP A;  4U7B A;  2L4M A;  2YUS A;  3ZQL A;  3BC8 A;  3DWL E;  2CFX A;  1NK2 P;  2ZKZ A;  1RNL A;  2R5Z A;  1DU0 A;  2V26 A;  2AHQ A;  2VUM J;  4BAC A;  1ETW A;  2IW5 A;  2QBY B;  3KX2 A;  1JKP C;  2A07 F;  4KYW A;  3CZ6 A;  2O8K A;  2F5C A;  2GWR A;  2HI3 A;  3HRM A;  2BHZ A;  3JRB A;  2CUE A;  3A1Y A;  1YS7 A;  3JW4 A;  5IYC J;  2B9S A;  3FX3 A;  4CA0 A;  1SMT A;  3DF8 A;  2V4J C;  1Z21 A;  1SMY F;  2E34 A;  5D8L B;  3TP3 A;  5GAD J;  1Z7L A;  3VSL A;  3CTA A;  3H5A A;  2AXT C;  3RQI A;  3MFK A;  2BGC A;  1ZG3 A;  1Z9C A;  2KIU A;  3TQN A;  2XRN A;  2ZME C;  1RI7 A;  2FD5 A;  1HXD A;  5FRO A;  1TBX A;  1OJL A;  1JKO C;  4A3L J;  2VKD A;  2O0Y A;  3H9G A;  3P5J A;  1GXQ A;  3S16 J;  2XPU A;  3ZMV A;  1VQK I;  1IXS B;  3LAP A;  3A2K A;  2DMU A;  2RC4 A;  4XID A;  4Y7N J;  3QYF A;  2VON A;  2Y9Z A;  3BZK A;  4CHU A;  2L0K A;  4LK1 F;  4PFO A;  5GTH C;  2DK8 A;  4S05 A;  4N9I A;  4IXA A;  3H5N A;  3ZOB A;  2BVM A;  3HBL A;  1B8I A;  2KDZ A;  4X1E A;  4Q48 A;  3OIO A;  4GRI A;  1J9I A;  1SC7 A;  1GVJ A;  2B7E A;  2MAB A;  4E7H A;  1ZAR A;  2E7W A;  1PUF B;  2K85 A;  3JAM Z;  3HOU J;  2FNA A;  4PSW A;  2HOS A;  2RV8 A;  3GWZ A;  1U9N A;  2L9V A;  4LB5 A;  3MN2 A;  3EYY A;  5L3G A;  1ZQ3 P;  1BN5 A;  1V5G A;  3S2D J;  3T8R A;  3QOE A;  5GTI C;  3MMY B;  3PUB A;  3IH3 A;  2XPV A;  2A3S A;  3CCE I;  4J19 A;  1BJZ A;  2MD5 A;  2WAQ N;  3A02 A;  1YLF A;  4A2U A;  3TDZ C;  4DBR A;  2KIF A;  2FOK A;  1FX7 A;  5CVJ A;  4E4H A;  5F0C A;  3IL2 A;  1REP C;  4KNY A;  2G7H A;  5HOO A;  1X3W B;  2LVS A;  2XUB A;  5HS8 A;  2IT0 A;  5EG0 A;  1JHH A;  4LJZ F;  3BZC A;  1BI1 A;  4CCO A;  3OYM A;  4G6Q A;  1FMW A;  2VC1 A;  1K4S A;  1A6I A;  4XBF A;  2HR3 A;  3E7L A;  1FBS A;  1NH3 A;  4FQG A;  4BXX J;  1LDJ A;  2E1N A;  4I02 A;  3N97 A;  3NEU A;  4PUS A;  1Y39 A;  1W36 C;  1KON A;  2JMW A;  3OYK A;  4LG0 A;  2K7L A;  4BE0 A;  1WFX A;  2P5L C;  2LLK A;  3B73 A;  3RKQ A;  1DPU A;  2LK2 A;  1B72 A;  4DQ2 A;  4E7L A;  3K4M A;  4NHJ A;  3CQZ J;  2UV1 A;  5IT9 Z;  5IT3 A;  2QSF X;  1CF7 A;  4RM2 A;  1EJ9 A;  2RNJ A;  2XGC A;  3HG9 A;  1YW8 A;  1JE8 A;  2HVR A;  4FE4 A;  3KP3 A;  2ZXH A;  1PP8 F;  2R7F A;  5DCF A;  2LD5 A;  1OCC H;  5C4J J;  1MMN A;  3HOV J;  1AWC A;  3I54 A;  4RLF A;  2CS3 A;  1R4N B;  3V7R A;  3I71 A;  4B3X A;  4BQA A;  4QPO A;  3FXM A;  1P9Q C;  3HZJ A;  2XRL A;  4UB8 C;  1V5F A;  4EQQ A;  3FIW A;  3MVP A;  2FXA A;  5GPC A;  3DU6 A;  3FDY A;  3JCU C;  1RC9 A;  2HYF A;  3KP4 A;  4G94 A;  3GTM J;  4EV0 A;  3V42 A;  2WY7 Q;  2AQE A;  1RUN A;  3CC7 I;  2LYC A;  3HOT A;  5BOX A;  2CO5 A;  1DQU A;  3WU2 C;  2WBM A;  3HOX J;  1FOW A;  4I6Z A;  2UXN A;  3L7W A;  4NQW A;  1BR1 A;  4YFK F;  3HTS B;  3W2A A;  1MZB A;  1JKQ C;  4XQF A;  1CQT A;  2KQR A;  2W4S A;  2XV4 S;  2A6H F;  3W2W A;  1X58 A;  2XF5 A;  3KP6 A;  4KFC A;  3GVA A;  1TWG J;  2P5K A;  4JQF A;  5LLQ A;  2QWW A;  2DA2 A;  1AOY A;  3QP6 A;  1FTZ A;  1VQ7 I;  1G3T A;  3WU1 B;  1UHW A;  3JRC A;  2CQQ A;  3PFI A;  4F7Z A;  2RNG A;  1YJW I;  3E97 A;  3EUA A;  4BQN A;  3MKZ A;  2RDP A;  1T95 A;  3J80 K;  2ELJ A;  1R23 A;  1VND A;  4EMS A;  3NWT A;  1ON1 A;  2A5Y B;  2OBP A;  3CLQ A;  2L9N A;  2R7W A;  2K9L A;  2XSD C;  4BJT A;  4FIS A;  4AYB A;  1ERD A;  2DYS H;  1EA3 A;  2P7C B;  2BV6 A;  2W00 A;  2FUG 2;  1KYZ A;  2CQX A;  3BG7 A;  1QA6 A;  2A05 A;  1SAN A;  1XSV A;  3CJQ B;  1BM9 A;  3M1C A;  4HV6 A;  2M4K A;  3VFZ A;  4E7Z A;  5JHU A;  5LFA A;  2JQ7 A;  4W97 A;  2L4A A;  2L54 A;  3BOQ A;  2JA6 J;  2IJL A;  1SD6 A;  2W82 A;  4NBQ A;  1LQ1 A;  5K5O A;  1JJ8 C;  2CSO A;  2DI3 A;  2DK5 A;  4I99 C;  3RTR A;  3OYB A;  1J59 A;  1UCR A;  1WJ5 A;  3DQV C;  5LD2 C;  1D8J A;  3F3X A;  3HOZ J;  2EZH A;  4L0Y B;  2QSH X;  4BNC A;  3W3C A;  1UJ8 A;  1YFH A;  2EQR A;  5E3M A;  1ITY A;  2KIQ A;  1NK3 P;  3HHG A;  4BYY A;  5IPA A;  4KMF A;  2O6G E;  2R7U A;  3OIP A;  3DTI A;  2HQN A;  3QP5 A;  4CCJ A;  3L2C A;  2X1D A;  5KK1 A;  1QHH D;  2X0L A;  3K6G A;  3QAH A;  1MMG A;  5JR3 A;  1LE8 B;  3EPZ A;  4FET A;  4HSR A;  1BR4 A;  2IA0 A;  3J7A Y;  2G7U A;  2TRT A;  2WY8 Q;  3R6S A;  1U3E M;  2P8T A;  2XAS A;  3OYH A;  2WAD A;  3BTI A;  2NNN A;  2XGX A;  1VFC A;  3F8M A;  5FLX Z;  2R7V A;  3IKT A;  3L9F A;  2LFB A;  1FP1 D;  2H94 A;  2M34 A;  2VJ4 A;  2LKS A;  4HV5 A;  4A5M A;  2L2O A;  1MMA A;  2OF7 A;  4XLH A;  3H3U A;  4LLL A;  4KN7 X;  3H9Q A;  3K9T A;  3SHF A;  2PJP A;  2DCE A;  3V8K A;  2EPF A;  2PMZ A;  4XSZ F;  5D5V B;  2MA3 A;  2PG4 A;  5J1U A;  3K1P A;  3AAF A;  4XRF A;  2LNB A;  4RLQ A;  3HYI A;  3GX4 X;  3CCM I;  1JJ6 C;  4UY8 I;  2IS4 A;  2DT6 A;  4WXC A;  4XSX F;  2I10 A;  4JBA A;  4DYR A;  1LVA A;  3GTG J;  2QQA A;  4BDZ A;  3JTH A;  1PYV A;  1BL0 A;  4RDU A;  3VYU B;  5TRD A;  3F0C A;  3ABL H;  3O6B B;  5AIP A;  2ZME A;  3ECH A;  3M4O J;  1V5E A;  1XMX A;  5HNF A;  3IRR A;  1A5J A;  3TW6 A;  3M8J A;  4IEJ A;  2JT1 A;  2QA4 I;  3OY9 A;  4HX8 A;  1VQ8 I;  5E20 A;  1RES A;  2RVC A;  1G59 A;  4G8X A;  1WCM J;  4E7K A;  3ONQ A;  1P7J A;  1WH5 A;  2X4H A;  1QVU A;  3DPL C;  1HA8 A;  1IUY A;  2D1V A;  2E36 A;  1JXS A;  2FBH A;  3QU3 A;  4F52 A;  2VQL A;  1TQP A;  2AQF A;  2ICW G;  1X2N A;  3FXR A;  4UV9 A;  4OIP F;  1FOK A;  1WJF A;  1T33 A;  1AHD P;  2LDU A;  4U7D A;  2VLA A;  2X51 A;  1O3T A;  3LSJ A;  5DCM A;  4ZTF A;  3L00 A;  3I59 A;  4IF4 A;  3FXQ A;  4ENK A;  2VKH A;  3FXL A;  1U78 A;  2HZT A;  1C0W A;  5DM7 F;  3GYH X;  4IOA F;  4XRS G;  4D7N A;  1S7E A;  1YJN I;  4EVI A;  1IDY A;  1IN8 A;  2L02 A;  2OTJ I;  2EIM H;  2O61 A;  4G7H F;  5CKT A;  2LBF B;  3K70 D;  5LGT A;  1ZYR F;  4WXD A;  5IOZ A;  5EGO B;  1QNT A;  3S14 J;  2A5W A;  3JRD A;  1YJ9 I;  3HTU A;  3DP7 A;  1I27 A;  1A04 A;  2FRH A;  5CPR B;  2W84 A;  5J6X A;  2L7K A;  2X1E A;  3QYB A;  3WTZ A;  3H3V K;  3EUH C;  2E7X A;  1WJC A;  3DEW A;  2F5E A;  3G1L A;  1IDZ A;  2CFO A;  4HX7 A;  3O8H A;  2DFH A;  3OL3 A;  1SFO J;  4V19 K;  3FKJ A;  1B4A A;  2Q1Z B;  2DA6 A;  3AL0 B;  2DOA A;  3FHZ A;  2GM4 A;  1FTT A;  2HEO A;  5FGM A;  1BI3 A;  1XSD A;  5CVR A;  4KIF A;  5L3B A;  1T8I A;  5FD5 A;  1B9M A;  3AG4 H;  1BW5 A;  4MQV A;  5BMZ A;  4OOI A;  3Q0V A;  3BR6 A;  3VWB A;  4L18 B;  4XLP F;  4QLC U;  1DGW Y;  4CYC B;  1YRN A;  2NVQ J;  2DAO A;  3PQK A;  4UUS A;  3GXO A;  3ZQQ A;  3TL4 X;  3DCF A;  3SXY A;  2ACJ A;  2CQN A;  3FK7 A;  3QWL A;  4ZDL A;  4YG2 F;  5M3F J;  3OYI A;  1XGM A;  1MBK A;  1VQM I;  4A0Y A;  3J7A O;  5AIQ A;  2JJ7 A;  1IAW A;  3TP0 A;  3DPU A;  1GDT A;  2X85 A;  3LSM A;  1TP4 A;  4D7M A;  5L3E A;  4I0A A;  3KYL A;  2UZK A;  5BPD A;  3WTT C;  1R1V A;  1FIA A;  1ODD A;  3L2U A;  2O03 A;  2L5Q A;  1XCB A;  2R7O A;  2VT2 A;  3KP2 A;  3CCQ I;  3DLA A;  3MZY A;  2X6W A;  4M6Y A;  1GV5 A;  4B44 A;  1TWA J;  4LG3 A;  1X4O A;  2EZL A;  3G4S I;  1UG2 A;  4KT6 A;  4Y3O A;  4A6E A;  3R0J A;  2VBZ A;  2A6T A;  2FBK A;  4IRH A;  5E8I A;  4BXU A;  3V8L A;  3ZQ7 A;  4KA4 A;  3U9G A;  5IY5 H;  1O57 A;  2QBY A;  4IX7 A;  1NG6 A;  3Q5F A;  1IRX A;  3KYC B;  2YPR A;  3MD2 A;  4L0Z B;  1G3S A;  3ASN H;  1YW7 A;  1O7F A;  1H89 C;  4A3C J;  4A3K J;  4OIO F;  3ZQC A;  3S1N J;  2ECB A;  3AKZ A;  1R5H A;  1WQ2 A;  2H1L A;  1ZRD A;  3ULQ B;  2JA7 J;  4M9X A;  3NAU A;  5C44 J;  4E7J A;  2GXG A;  5CVI A;  1W0T A;  4X6A J;  3GUD A;  4U0W A;  2WWY A;  1FT9 A;  1MSE C;  4AWX B;  1EH7 A;  4XKV A;  1EV7 A;  5M5X J;  5J1R A;  1OR7 C;  3TED A;  5AON A;  1NTC A;  2E1O A;  3KZY A;  5DEQ A;  3PL8 A;  1W36 D;  1HQC A;  3A0H C;  3DFG A;  3K69 A;  2PI0 A;  1MBE A;  3BP8 A;  1QU3 A;  3GBG A;  3ZQH A;  2P6S A;  3G3Z A;  1B1B A;  3OSG A;  3ERE D;  2OPT A;  2ZSI B;  1PUF A;  1NG7 A;  4RGS A;  3LA3 A;  2JRT A;  2HQR A;  2K4B A;  2RQP A;  2DQR A;  2ZXI A;  2K40 A;  3I53 A;  4QSH A;  4GFB A;  5TIS C;  1RIO H;  1VQ4 I;  2JA5 J;  2CUZ A;  5IYD J;  1VF9 A;  2OCE A;  2FMY A;  2W85 A;  5DUK A;  4XKB A;  1Z05 A;  4ZJZ A;  4NNJ A;  2R7Z J;  2ELK A;  4ESB A;  4HF1 A;  4ZH4 F;  5FKN A;  1BOB A;  3LFK A;  4E7I A;  2MFZ A;  3CJN A;  2OAZ A;  1XS9 A;  2M7B A;  2XKP A;  3S1Q J;  2COB A;  2QYO A;  2P5V A;  2XAU A;  4FTH A;  4IHV A;  2KKO A;  3FWE A;  1I6X A;  4CCK A;  3BZ6 A;  1YIO A;  1RPW A;  4L9N A;  4ASN A;  4R79 A;  2H6B A;  1ACI A;  5E3N A;  2Q0O A;  1U2W A;  2EFN A;  2D1H A;  3W2V A;  2LOO A;  1MBF A;  3AL0 C;  4N4N B;  2WA0 A;  5J8F A;  2BXY A;  4ESF A;  1R00 A;  5CQG A;  3RPU A;  2L3D A;  4PSX A;  1K79 A;  3C3W A;  3OYA A;  1DUX C;  2VOD A;  5HVQ C;  4BQO A;  2HVQ A;  3X2Q H;  3LST A;  2O7O A;  5GAH J;  2NRA C;  2RQQ A;  1OCO H;  2K3F A;  2Q2E A;  1I1S A;  2L9S A;  4KIG A;  3CDL A;  5B5E C;  3BLY A;  1YG2 A;  4C3J J;  5HS9 A;  3CCR I;  1XX5 A;  3GZ6 A;  2X48 A;  2FBI A;  1G4D A;  5D6E A;  1VI0 A;  4RAZ A;  4ENJ A;  1AKH B;  2HQ5 A;  2OV7 A;  2LG4 A;  2OQG A;  2BOL A;  4GDF A;  5LRS A;  1TW3 A;  2XSJ C;  2DA1 A;  4YRV A;  3I4P A;  3ECO A;  3LQR A;  4L5J A;  4RBO A;  3WTV C;  1XG1 A;  1R5I D;  1BW6 A;  1MBJ A;  1TQI A;  3IUO A;  2CRG A;  1ZLJ A;  3ZCO A;  2DA4 A;  1HKT A;  1I3Q J;  3BQZ A;  2M45 A;  2V1N A;  1YX5 A;  5CVU A;  1HW5 A;  4J01 A;  5J4Y A;  4WWC A;  5A2Q K;  5GP9 A;  2NVX J;  3MWM A;  3JRF A;  1GVD A;  2Y9Y A;  3D5L A;  3OOP A;  4CCN A;  1NHA A;  1Y56 A;  3TO6 A;  4I76 A;  2IS6 A;  4OMZ A;  2ZJ2 A;  2E19 A;  1O7L A;  3HSE A;  3F23 A;  4H4K C;  4BJ6 C;  2ISY A;  1Q1H A;  1ZAO A;  1F5T A;  3BR3 A;  4YII A;  4MEY F;  2IGM A;  3EDP A;  2GOM A;  5BPI A;  3ML6 A;  3PIO F;  1LB2 A;  1ETV A;  1R1U A;  4MNU A;  1DP3 A;  1ZR2 A;  3FZV A;  1WJB A;  1ULY A;  2XAJ A;  3WG9 A;  4EAT A;  2BEO A;  3OIQ A;  2DBB A;  5KHD A;  3WTS C;  1Z6T A;  4BQQ A;  3SYT A;  3LA2 A;  2GLO A;  3GCM A;  1G3Y A;  1YI2 I;  3EUH A;  1OPC A;  1N78 A;  3S3O A;  1T39 A;  3GTJ J;  5E3L A;  1UZC A;  1K6O A;  2R7R A;  2JUC A;  4BBS J;  3WTX C;  3OYG A;  1HDP A;  5BNG A;  2K9S A;  3HIF A;  2CU7 A;  4BXF A;  3R4K A;  5HLI A;  4P96 A;  3H36 A;  3LSG A;  4EJO A;  3OSF A;  3G2B A;  1YQA A;  2M8G X;  4KUM A;  1IXC A;  1MNE A;  1W7P B;  3RI4 A;  1S72 I;  2HOE A;  2H8R A;  4DJA A;  1IC8 A;  1LUJ B;  3E6M A;  3I58 A;  3RPU D;  4A3B J;  1WWX A;  1XB4 A;  3CCV I;  4UVA A;  4LD5 A;  2BZT A;  2RN7 A;  2R7X A;  3OWT A;  2JSP A;  2ZBK A;  1YO5 C;  1IW7 F;  4JX6 A;  1ZRF A;  1FYL A;  4KIT B;  5HLH A;  4H0E A;  2E1M B;  4KJZ A;  4D5F A;  3RZD J;  2KP6 A;  3AFH A;  3I3L A;  1W1W E;  2HXO A;  4MFE A;  3CC4 I;  2RAE A;  1TW2 A;  2VB6 A;  1IGN A;  5E3O A;  1WI9 A;  3JSO A;  2EB7 A;  3K4C A;  5HS7 A;  3CUO A;  1A6Q A;  5JLX A;  4WX9 A;  5D8K B;  4NB5 A;  1TT5 B;  1PP7 U;  5J1Y A;  2ZJP F;  1LE8 A;  4AUX A;  3Q9S A;  1H8A C;  1VQ9 I;  2L7M P;  2MH9 A;  1ZR4 A;  4AU7 A;  4F93 B;  1F43 A;  4RGX A;  2J5P A;  4EM2 A;  4PJL A;  3HB9 A;  3E6C C;  2PJR B;  4D1Q A;  2BY1 A;  5GPA A;  1T6S A;  4R1H A;  3DEU A;  1FY7 A;  4XR6 A;  2X1C A;  3OYL A;  1MW7 A;  3FXO A;  3UKG A;  4ZYA A;  2DU9 A;  3A4C A;  5J8C A;  1STZ A;  2LSO A;  2CW8 A;  4OIR F;  4A3E J;  4M3B A;  1TNS A;  3I55 I;  5FLM J;  3B6C A;  4XOT A;  4EJW A;  3KLN A;  2Q8K A;  1Y1W J;  1J2X A;  4Q4Z F;  2J5O A;  5IYB J;  3DEE A;  1E2X A;  2YX7 A;  3AG3 H;  4FX4 A;  2FJ1 A;  4BGD A;  3FBI B;  1XPX A;  4XK4 A;  2DLL A;  4X0G A;  2ZNZ A;  1XMA A;  5F27 A;  1E3O C;  2R7S A;  3S17 J;  2XAQ A;  5FKM A;  2IA1 A;  3DBL B;  5ICC A;  3HXL A;  4CUG A;  3KP5 A;  2FE3 A;  2DDB A;  3TW7 A;  5KAI C;  1OR7 A;  3ZQG A;  4EM0 B;  1SD4 A;  3QPH A;  3CDI A;  4O6J A;  4QPQ A;  3HC7 A;  4DYQ A;  3FM3 A;  3BY6 A;  2Y0S A;  2PMZ N;  1ENH A;  1LEB A;  2GA1 A;  1V54 H;  3ZR8 X;  3L2R A;  4NDL A;  1OCR H;  2O8X A;  3OOU A;  2E2J J;  3M9A A;  3HOS A;  2DN0 A;  2M4G A;  3ROU A;  3DTE A;  3HKZ A;  3Q0U A;  1UEL B;  2ISZ A;  3TDU C;  3MZ8 A;  4WXH A;  3SZP A;  3KE2 A;  3J81 K;  2OJE D;  2LBF A;  1A36 A;  2DA5 A;  2DQL A;  2FQ3 A;  2QVO A;  3C2H A;  2M1B A;  4BEH B;  1TL8 A;  2VT3 A;  1EF4 A;  2W25 A;  3WGH A;  2CV2 A;  1BJA A;  3FM5 A;  2V1U A;  5J47 A;  4KMU X;  3I4N J;  3VYR B;  5F04 A;  3AG1 H;  1U0J A;  2XGE A;  1DPR A;  4M3E A;  3RPQ A;  1HBX G;  1IN7 A;  2MC4 A;  1QPM A;  2FOW A;  5FO5 A;  1ZTR A;  1DGR M;  4UUT A;  2QM3 A;  3PQJ A;  3O8G A;  4ZZL A;  2VBW A;  1X1B A;  1VQP I;  1GXP A;  3RCO A;  2NOG A;  1HCR A;  1PVE A;  3BPV A;  1MND A;  1WKM A;  2EFO A;  1O3R A;  2HYG D;  4C2T A;  3NRV A;  5D4R A;  9ANT A;  4ZDO A;  2K5C A;  2VKE A;  1W5C C;  1EKE A;  2XHK A;  4V2F A;  4Y4R A;  4LFU A;  4RB2 C;  2DXI A;  3QU6 A;  3CCU I;  3MKL A;  2HNH A;  2DT7 B;  2HTJ A;  2VBX A;  3S2W A;  2P81 A;  4CYC A;  2M87 A;  3T1B A;  1G2H A;  3RJP A;  1ZLK A;  1MDM A;  3E6D A;  3HRU A;  4IHS A;  2GZW A;  1N25 A;  2R0Q C;  4GCV A;  1WHU A;  1ZGW A;  3C18 A;  4AVZ A;  3CP2 A;  2B63 J;  1GLN A;  2XF7 A;  2GIZ A;  3OYJ A;  5B66 C;  1P4W A;  1D5V A;  1JUM A;  3U2R A;  3T0Y A;  5F1R A;  1YIT I;  1P2F A;  4AVP A;  2E1M C;  3IHU A;  4DZJ A;  4GXO A;  3U1K A;  3O2P E;  1Z3Y A;  3LFU A;  1QZY A;  3GZN B;  2K3P A;  1HLV A;  3T8T A;  2XGD A;  1D5Y A;  4AIK A;  1BR2 A;  4IQJ A;  3ZMZ A;  2R92 J;  1LPQ A;  1A35 A;  4PJJ A;  4EJT A;  3KZZ A;  3U21 A;  4A0Z A;  3WGI A;  2QQB A;  4IL6 C;  3CCS I;  2ME0 A;  1HSJ A;  1I5Z A;  3FK6 A;  1OYW A;  5LHG A;  2HDW A;  2CW7 A;  3BG6 A;  1RUO A;  1R6R A;  4C30 A;  3K2A A;  1I50 J;  2P4W A;  5KVR A;  5EZH A;  2Z33 A;  4K2E A;  5HOD A;  3GTL J;  1T0F C;  3I56 I;  4FE7 A;  1T38 A;  2C6Y A;  1ZK8 A;  3FMR A;  3PNT A;  1LNW A;  1VQO I;  4BHC A;  5LEK A;  1FLI A;  1WJA A;  1LFP A;  1Z67 A;  3MKY B;  2O9L A;  2ESH A;  4Y33 A;  2HFH A;  3CJT B;  3WOD F;  4M9Z A;  1YS6 A;  3HM5 A;  4WF2 A;  5CVV A;  1TQM A;  4F91 B;  2QCO A;  1YYV A;  2E35 A;  3BTC A;  2FSW A;  2F4M B;  4HRI A;  1XDU A;  5EJC A;  3FXK A;  3VPR A;  2CW0 F;  4BHB A;  4MQ9 F;  1BI2 A;  1UG0 A;  2JUG A;  2E5N A;  2PMH A;  2EZK A;  4PDK A;  4FT8 A;  1BIB A;  2LY2 A;  2FNP A;  1S7O A;  1UHS A;  3A01 B;  2EFW A;  2XIG A;  1B6A A;  1POG A;  2PLY A;  4LLN A;  1J75 A;  3GEZ A;  4UNO A;  2DPD A;  3E5X A;  4M6X A;  1D3Y A;  5FLV A;  2JRM A;  3PJR A;  1TWC J;  2NNY A;  1HKS A;  4Q5S F;  2OA4 A;  5CLS A;  4MIM A;  5F0H A;  4HPQ A;  4AC0 A;  3KP7 A;  3V4G A;  4B4C A;  2H6C A;  1BIA A;  5K7H A;  5D4S A;  4LIT A;  2VAS A;  2LR8 A;  3CMY A;  4L9T A;  3S3M A;  3G1O A;  4B43 A;  1R71 A;  2P6T A;  2BY0 A;  1P7I A;  3JR9 A;  2LY9 A;  1D0X A;  5JLW A;  2OQR A;  4UXN A;  1K78 B;  3BJ6 A;  3J7Z I;  4N4O B;  5HLG A;  4G12 A;  2ETH A;  1MIJ A;  4HYE A;  3S1M J;  3KFW X;  5DYM A;  3KET A;  3GFJ A;  5K5R A;  3L2Q A;  2BE5 F;  5HDN A;  3F9K A;  2GIV A;  5DD4 A;  4PJM A;  3CMA I;  4IHX A;  3KEQ A;  4HLY A;  4W1U A;  2QEN A;  1BC7 C;  2ZB9 A;  2Y48 A;  3IC7 A;  4YEJ A;  2LC2 A;  2VQG A;  4P9F A;  4XLC A;  2PEX A;  3REO A;  1CF7 B;  3TGN A;  1FOY A;  2GOX B;  3H9J A;  1FSH A;  4A5N A;  4C3H J;  4CZC A;  5EYR A;  3O3K A;  1ORK A;  5LGN A;  3FXU A;  2IRF G;  3IV5 A;  1LDD A;  3C1D A;  3S15 J;  1T08 B;  3LWF A;  4A69 C;  5ICE A;  1H9T A;  4BH9 A;  1AU7 A;  1MD0 A;  4P5O A;  3S1R J;  4RMN A;  2M30 A; 
#chains in the Genus database with same CATH homology
 2MFZ A;  3K4K A;  4BE2 A;  2M7B A;  3ZRG A;  3A2K A;  1D0Z A;  3QYF A;  2CV1 A;  4XKW A;  2XAU A;  3IAS 2;  4PFO A;  1TZL A;  3H5N A;  2BVM A;  4CCK A;  3K4N A;  4R79 A;  3N05 A;  3SDB A;  3KEY A;  4GRI A;  2MAB A;  2XF6 A;  2KRC A;  4E7H A;  3OYD A;  2VPL A;  3HPG A;  3L2V A;  2QKM B;  3W2V A;  4PSW A;  2RRE A;  2LOO A;  2HU9 A;  3ZXS A;  4F3Q A;  3AL0 C;  4N4N B;  3K10 A;  2WA0 A;  3OMY A;  1OLT A;  3S32 A;  2KMU A;  1V5G A;  3QOE A;  3MMY B;  3PUB A;  5CQG A;  4HEA 2;  4BUP A;  4PSX A;  3OYA A;  5HVQ C;  5CQE A;  2LY1 A;  2WAQ A;  4BQO A;  3CMM A;  4E4H A;  2HVQ A;  4DBR A;  3UR3 C;  2RQQ A;  1SFK A;  2L9S A;  3BLY A;  5HOO A;  4DOZ A;  4CCM A;  1N75 A;  2VQH A;  4OWR B;  4CCO A;  3OYM A;  1FMW A;  2OV7 A;  2KL4 A;  2IGK A;  2BOL A;  2LG4 A;  4BDY A;  3FBN B;  4PUS A;  2R7T A;  5KNL A;  1W36 C;  1KON A;  2XSJ C;  3OYK A;  4YRV A;  4C2U A;  4BE0 A;  1WFX A;  3PNV A;  3IUO A;  3ZCO A;  2JVH A;  3C2G A;  2R7Q A;  4E7L A;  2V1N A;  3K4M A;  3I9V 2;  1YX5 A;  2UV1 A;  4J01 A;  3OYC A;  4RM2 A;  4FAS D;  2HQA A;  3HG9 A;  2HVR A;  4NC8 A;  2ZXH A;  3D5L A;  4CCN A;  1Y56 A;  4LIV A;  1MMN A;  4MLO A;  2IS6 A;  2R4G A;  2K9M A;  4BL0 B;  4H4K C;  4RLF A;  4BJ6 C;  2CS3 A;  2Z1D A;  2IGM A;  3D5R C;  2GOM A;  4B3X A;  4QPO A;  1P9Q C;  1DP3 A;  3OYN A;  1WJB A;  1V5F A;  4EAT A;  3OIQ A;  3DU6 A;  3FDY A;  4G6T B;  1Y6I A;  5KHD A;  4BQQ A;  3PSI A;  3SYT A;  2OUM A;  4NUB A;  4XN3 A;  3V42 A;  2WY7 Q;  2AQE A;  3S3O A;  3H0D A;  1N78 A;  3IAM 2;  2R7R A;  2LYC A;  4XMY A;  3VYT B;  3HOT A;  1DQU A;  3OYG A;  2WBM A;  3PFY A;  4XM3 A;  4BXF A;  3S93 A;  1BR1 A;  1LKX A;  2M3A A;  2NOJ B;  3E1S A;  3LSG A;  1N77 A;  2KRH A;  3G2B A;  3W2A A;  4PK4 A;  4XQF A;  1MMD A;  4D9J A;  2KQR A;  1MNE A;  2W4S A;  2PJR A;  3SEZ A;  4DJA A;  3W2W A;  2E5Z A;  3K4L A;  2XF5 A;  4XKC A;  3RPU D;  1YE9 A;  4JQF A;  3FHN A;  4RM3 A;  1TT0 A;  5KCM A;  2LRD A;  3OYF A;  2R7X A;  2V7F A;  2JSP A;  3OWT A;  4II2 A;  2RNG A;  4DIQ A;  1E0E A;  3EUA A;  4BQN A;  3MKZ A;  2V9K A;  2KLO A;  1T95 A;  4KIT B;  2ELJ A;  2F4I A;  2E1M B;  3E0J B;  4KJZ A;  3CF2 A;  2KP6 A;  3NWT A;  3AFH A;  3I3L A;  3H5R A;  2HVS A;  3OYE A;  4C9Y A;  2VB6 A;  4XLE A;  2HPM A;  3BCB A;  3K4C A;  2R7W A;  2L9N A;  2W1O A;  2K9L A;  4BJT A;  2HZD A;  4AYB A;  1ERD A;  4NQW B;  1EA3 A;  2MYS A;  5TGT A;  2W00 A;  2FUG 2;  3BG7 A;  4AU7 A;  4F93 B;  3OR2 C;  2X6Y A;  3CJQ B;  3HPH A;  3M1C A;  4E7Z A;  2M4K A;  4PJL A;  5LFA A;  3K4J A;  4ANJ A;  3OS0 A;  2PJR B;  2W82 A;  4D1Q A;  2I8D A;  2Z16 A;  3RTR A;  4NC7 A;  3OYB A;  4XR6 A;  3ZGK A;  4ZTJ A;  4XL9 A;  1WJ5 A;  2IS1 A;  1G8X A;  2X1C A;  3OYL A;  1MW7 A;  3DQV C;  5LD2 C;  4ZYA A;  3A4C A;  1Z3X A;  3W3C A;  1PJR A;  4DBQ A;  2CW8 A;  4BJ5 C;  5HNH A;  4XOT A;  4LIU A;  4CH7 A;  2WAE A;  3S3N A;  5JHF A;  2R7U A;  3OIP A;  3DTI A;  3MKW B;  1X1A A;  3DEE A;  2IXS A;  4CCJ A;  2X1D A;  1QHH D;  1J09 A;  4BGD A;  3FBI B;  4XLA A;  1SAU A;  2O5R A;  3K6G A;  4X0G A;  1MMG A;  2VL8 A;  1D1C A;  3EPZ A;  4FET A;  2CUJ A;  2R7S A;  4HSR A;  1BR4 A;  3J7A Y;  2XC7 A;  3LSH A;  2OC6 A;  2WY8 Q;  3HXL A;  4IQ4 A;  4BEH A;  4CUG A;  3OYH A;  2WAD A;  4HST A;  2R7V A;  4KIS A;  2P0W A;  2VJ4 A;  4QPQ A;  2Z2S B;  2QKL B;  2L2O A;  1MMA A;  4XLH A;  3HC7 A;  2Y0S A;  3H9Q A;  2F5V A;  2DCE A;  2PMZ A;  3ZR8 X;  3L2R A;  1LDK B;  2UWM A;  2V6E A;  3OOU A;  2IGO A;  3OS2 A;  2ZFU A;  4HNT A;  4RLQ A;  2CV0 A;  2IS4 A;  3HOS A;  2HPI A;  2M4G A;  2DT6 A;  3HUG B;  3CP8 A;  3DU5 A;  3DTE A;  4BDZ A;  3HKZ A;  1UEL B;  1PYV A;  3CES A;  3DKX A;  3VYU B;  2JVG A;  2VQC A;  4CSW A;  4OAZ A;  2LH9 A;  1V5E A;  4XLF A;  2LBF A;  3NWS A;  5HNF A;  3C2H A;  2VXZ A;  3M8J A;  4BEH B;  4II3 A;  3OY9 A;  2X6X A;  3DPT A;  2CV2 A;  1G59 A;  4E7K A;  3ONQ A;  3VYR B;  3DPL C;  1HA8 A;  1U0J A;  4F52 A;  2VQL A;  4XOR A;  1K6Y A;  2JA2 A;  2AQF A;  2MC4 A;  4HNU A;  2F6C A;  1DGR M;  1WJF A;  3D5S C;  1D0Y A;  2VLA A;  1X1B A;  2X51 A;  3RCO A;  4ZTF A;  4ITV A;  1MND A;  3RQ4 A;  2VKH A;  3PNY A;  4C2T A;  3VSK A;  4ZDO A;  2K5C A;  1VZ0 A;  1D1B A;  3PSF A;  4Y4R A;  3SEQ A;  2DXI A;  4ZDP A;  2HNH A;  2DT7 B;  1FMV A;  4P1W A;  3LL7 A;  2ZSH B;  5CKT A;  3QOD A;  2LBF B;  2LRE A;  5HLT A;  3K70 D;  3VDX A;  4BE1 A;  4XN0 A;  1YX3 A;  3QYE A;  2A5W A;  3DTK A;  4AVZ A;  3CP2 A;  1GLN A;  2XF7 A;  5CPR B;  3EUK L;  3OYJ A;  2VJI A;  2L7K A;  2X1E A;  3QYB A;  1UAA A;  4BU2 A;  2E1M C;  3BCA A;  3EUH C;  3OS1 A;  2WAF A;  1Z3Y A;  1ZEL A;  3LFU A;  2K3P A;  1WJC A;  3LMM A;  4J00 A;  1WJE A;  2CFO A;  3OL3 A;  4ZC3 A;  3L2W A;  3FKJ A;  1BR2 A;  2Q1Z B;  4HG2 A;  4IQJ A;  3AL0 B;  2DOA A;  4PJJ A;  2CMP A;  3U21 A;  1D1A A;  4JOM A;  2IGN A;  2MD0 A;  3VWB A;  2KZV A;  3RSN A;  1DGW Y;  3LSI A;  4IKF A;  2HDW A;  2CW7 A;  3ZQQ A;  3BG6 A;  3TL4 X;  1R6R A;  5FRM A;  4C30 A;  4ZDL A;  1X4P A;  3OYI A;  3LSK A;  1T0F C;  2VXD A;  1LVK A;  2VIX A;  3PNT A;  2CH0 A;  3DPU A;  1WJA A;  1LFP A;  2X85 A;  3TBI A;  4OAY A;  3LSM A;  1S9H A;  2UUZ A;  4PJN A;  3KYL A;  3MKY B;  4Y33 A;  3L2U A;  3K4B A;  3VYS B;  2M0M A;  2L5Q A;  2R7O A;  1JI8 A;  4XOP A;  4F91 B;  3DLA A;  2X6W A;  4E6K G;  1X1C A;  4HRI A;  2DJI A;  4DGW B;  3OR1 C;  4B44 A;  3SZG A;  4LG3 A;  1UG0 A;  3OL4 A;  2W7N A;  1X4O A;  2JUG A;  2E5N A;  3HL2 A;  4KT6 A;  4Y3O A;  4BS9 A;  4XON A;  2A6T A;  2LY2 A;  3IP4 B;  2BW3 A;  4XNF A;  2IS2 A;  2XDV A;  4IX7 A;  4CCL A;  1NG6 A;  1IRX A;  3CJR B;  3MD2 A;  4F55 A;  1X19 A;  5FRN A;  3PJR A;  1X1D A;  2KDO A;  1AA7 A;  4F92 B;  2BVL A;  4HPQ A;  4PFP A;  3AKZ A;  2VJ5 A;  3UNG C;  3K70 C;  2WB1 A;  2KHM A;  4LIT A;  4IZZ A;  2VAS A;  4U87 A;  2Q2E B;  3H35 A;  4E7J A;  4YEL A;  3S3M A;  4B43 A;  3TMO A;  4B48 A;  1D0X A;  1WJD A;  4N4O B;  4U7B A;  4XKV A;  3L2Q A;  3BC8 A;  1QHG A;  3DWL E;  1OR7 C;  2BW3 B;  2KPM A;  3F9K A;  4PJM A;  2V26 A;  3PL8 A;  1W36 D;  4BAC A;  3DKY A;  3KX2 A;  3CZ6 A;  4YEJ A;  2LC2 A;  2VQG A;  1QU3 A;  3A1Y A;  3GBG A;  4XLC A;  2VJJ A;  4CA0 A;  2V4J C;  1Z21 A;  2GOX B;  2ZSI B;  1NG7 A;  3H9J A;  4CZC A;  2ZXI A;  1Z7L A;  3VSL A;  3H5A A;  2CUZ A;  3S8P A;  2M7A A;  4E7S A;  2E60 A;  4XKB A;  4ZJZ A;  4NNJ A;  5FRO A;  2VKD A;  4P5O A;  4B47 A;  4RMN A;  3H9G A;  4E7I A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...