1X4PA

Solution structure of surp domain in sfrs14 protei
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSSGSSGVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative splicing factor, arginine/serine-rich 14
publication title Solution structure of SURP domain in SFRS14 protei
rcsb
source organism Homo sapiens
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1x4pA00
1X4OA 2E60A 4DGWB 1UG0A 2E5ZA 2DT7B 1X4PA 2DT6A
chains in the Genus database with same CATH superfamily
3VYTB 1HCRA 2XGCA 3MKYB 4F52A 1P9QC 4RGXA 3LA2A 3HRSA 3JCUC 2GXBA 2ZMEA 2MC4A 4FISA 1HDDC 2MC3A 2KRFA 1ZELA 5IP7J 2XPUA 4JX6A 3S1QJ 3COAC 2DW4A 2ELKA 3S1NJ 3KP2A 1HKSA 2Y2ZA 5LFAA 5K5QA 4ZYGA 2IVMA 1IDYA 2QGUA 2M8EA 3G73A 4M9SA 3J7ZI 2E60A 2CQXA 2MLGA 4MFEA 5EDNA 2STWA 1UELB 2DCEA 3PSIA 2FOKA 4RB3C 4HX7A 2F5VA 3KP3A 2Q1ZB 2JT1A 2LLKA 2CFOA 1SVLA 4V2FA 3GVAA 1T0FA 2W00A 2E1CA 3DFGA 1O4XA 4F93B 4PZJA 2V7FA 2IA2A 1YX3A 4WCGA 1FP2A 3ERMA 4N9IA 4PGGA 3GX4X 4AYBN 2O7OA 2WV1A 1JT0A 3QQAA 1FPQA 2R7TA 1QA6A 2WA0A 3BJOA 3A2KA 3JRHA 1VF9A 4XKVA 4HSRA 2O61A 2WBMA 3GTOJ 2KQRA 1FOXA 1DP3A 1VQ6I 3RQIA 3NWTA 4YFXF 2DQLA 5DYMA 1FBUA 2P6TA 3BR0A 3ML6A 2WAQN 2M5WA 4ASNA 4B4CA 3H35A 3LSTA 1ZGJA 2PFBA 1P2FA 5JVTA 2E35A 5J3LA 1MJAA 1N77A 2E5NA 1VQ9I 1B9MA 2LTPA 4XRSA 3ABLH 2G0EA 3CCEI 4L9JA 1PVEA 4ZYAA 4M73A 2CQ7A 4B44A 4IZZA 2W82A 1DU0A 2FSWA 2JTVA 3JRDA 1W4MA 4BY7J 4CZCA 4RS8A 4CICA 2DXIA 1U0JA 2V9PA 4A3GJ 2ZSHB 1JXSA 1SMTA 2DA1A 1IUFA 3EQLF 3D1NI 4F91B 5LGNA 3FHZA 1JJ8C 1P7JA 3QU3A 3WTUC 4BQQA 2FJ1A 2XIGA 4A93J 1UB9A 2QYOA 2V26A 3P9IA 2MBFA 5FKKA 5J8FA 1QVUA 2VC1A 1SFUA 2HKXA 4ENJA 2Y48A 3FBNB 2IGKA 2Y9YA 2A61A 2L7KA 3KYDB 4FTHA 4B1RA 1KQ8A 2FF4A 3MKZA 2K9LA 4EVIA 2MYSA 1FMWA 3CTAA 2TRTA 2JN6A 2ZJRF 2I10A 2X4HA 4KA4A 4A3BJ 4H4KC 3RKQA 4BJ5C 2BXYA 4HV5A 1R4NB 2NRAC 3SDGA 4KISA 4LK0F 4DYCA 5JI6A 3S2HJ 4HOBA 3PUFA 2E1MC 1V55H 3ZQ7A 1MBGA 4HF1A 3OYBA 3GZ5A 3KPHA 4Y33A 1DQUA 3A02A 3K1PA 4JOMA 2ISZA 2ZJPF 2KIQA 4C30A 1F9NA 4U0WA 1Z6TA 5D4SA 4BACA 2VT3A 2M45A 3B02A 1HW2A 2WADA 4KMFA 2LY1A 1PUFB 2VC0A 1PP7U 3C18A 4BHCA 2EIJH 3I9V2 5F08A 1T38A 4QPQA 4OIQF 1MGTA 1I1GA 2VBXA 1LEAA 1IW7F 1FYKA 1ITYA 2CWEA 2WV0A 4Z2YA 2VUMJ 2OQGA 3K1NA 1IN7A 5TJJA 3OYMA 4AIHA 2WAEA 1V5FA 2IGMA 3V7SA 1RNLA 2XASA 1Z6RA 3GTLJ 4E7HA 4KN7X 2AS5F 4BNCA 1U9NA 4JK1X 4V19K 4UB8C 1X1DA 4BBRJ 1UG0A 2CW7A 2F5DA 5KHDA 2FOWA 3CDHA 4PFPA 2H8RA 4WK8F 1I1SA 3CP8A 1IRZA 2D1VA 2WY7Q 5FB2A 2DAOA 5F1JA 1BOBA 1IDZA 1K78B 2LG4A 5E17F 1GV5A 3CMMA 1ZQ3P 4KT6A 3CCSI 3BT9A 2P0WA 3ZMSA 4ZTFA 2DMNA 2GAUA 5FLVA 5GAHJ 2NVTJ 4PJLA 1O7FA 4IOCF 2K9SA 4PSXA 4PJNA 4WXCA 1ZGWA 2V1DA 2FMLA 3HHGA 1ULYA 4R8HA 3OY9A 2JMWA 3ZN0A 5M3MJ 4UXNA 3VYUB 4N9HA 1ACIA 2XC7A 1A5JA 1E0EA 1R71A 5F27A 2E71A 4DBQA 2PMUA 3CQZJ 1SC7A 3R61A 3O8GA 4PJMA 4BHBA 3CESA 2G7HA 3CC7I 2DOEA 3U1KA 1SD7A 4UY8I 2E34A 3KP7A 2HI3A 5CVUA 5J4YA 3K70C 4A3DJ 1F4KA 4L0YB 4BQOA 2OTLI 3K4MA 5J6XA 1BN5A 1WH5A 5LRSA 2L02A 4RLFA 3K7AJ 1RI7A 1SFOJ 2QSGX 1FYMA 3FZVA 3ZPLA 1VTNC 5IYBJ 1FIPA 4QPOA 4LG0A 4J00A 5ICCA 1VQ7I 2DO7A 1K6YA 2COMA 2EA4A 2F4OB 2VKDA 1DPUA 1AOYA 1OYYA 4II3A 4CYDA 1UHMA 5IT3A 1TLHB 2QWWA 2OAZA 3G3ZA 2JWTA 4FHTA 4YRVA 2CQNA 4M9XA 3H3VK 1GHCA 5IOZA 2XHKA 5IPAA 3OYDA 3OYFA 2KDZA 4U88A 1MW7A 5B66C 1W36C 5HLIA 2CW8A 1GT0C 1JGGA 4YG2F 4WWCA 2L0KA 3IWFA 1FTTA 2IPQX 2VXZA 3H5RA 4KYWA 5HLGA 3WTVC 3R4KA 3CP2A 2WTEA 2PLYA 1DP7P 1T8IA 1PUFA 2O5RA 4L9TA 4DJAA 4F3QA 2NS7A 1X3UA 1D0XA 1REPC 3C2GA 4ON0A 2RV8A 2M2EA 4DIQA 2X1DA 3LSMA 2O8KA 3LSRA 3G4SI 5IYDJ 2FRHA 2GZWA 5FLXZ 4HRIA 4KJZA 3BG3A 2XAUA 5FD6A 1SD6A 2NOGA 3CCVI 2HTJA 5E79C 3AG1H 3AL0B 3JRBA 2M9HA 1KU2A 4MTDA 3REOA 4AYBA 3DU6A 4XKCA 1S7EA 4Y3OA 2B63J 3F6OA 4XOTA 4MEYF 2CU7A 1TQIA 2Z2SB 5IY5H 4EGYA 3KP5A 2BHYA 2DOAA 2VI6A 1IO2A 2XGDA 1I27A 1BIBA 2R7OA 1A6IA 1D1AA 1BR1A 1K78A 1B72B 2PMZA 3TGNA 2WAQA 1ENHA 5JHUA 1D8JA 2E7WA 4A5NA 2JJ7A 2ESHA 1LUJB 3KETA 3V8KA 3OOUA 1IN5A 2BVMA 3BTLA 5LEKA 3IH4A 1RUOA 3M8JA 2YUSA 2BBYA 3RDIA 4I7HA 1TQMA 3GCMA 2QLZA 4MLOA 4UVBA 3BJ6A 2L7ZA 2OUMA 2ZMEC 3BTIA 1MMGA 1XX5A 2HS5A 2VXDA 3GZNB 1VI0A 1K7AA 2PI0A 2DOFA 3KFWX 3J80Z 1JE8A 1S72I 4QSHA 2A07F 2X6OA 3K70D 2DU9A 2JZYA 3TP3A 2R5ZB 2JQ7A 2HQRA 2E1NA 2JVHA 2PQ8A 1P4AA 4IRGA 3I55I 3RI4A 2WAFA 5F1RA 3V8LA 3KLNA 3W2AA 5H6QA 3JRGA 4LB5A 3AG2H 3A01B 2JPCA 1Q1HA 1QPMA 1WRJA 5GTHC 2QBYB 4W1UA 4LJZF 5F04A 3WTTC 6PAXA 1ZG5A 1FOWA 3IC7A 1GVJA 4HQEA 2DA4A 1AA7A 5K5RA 2NAZA 1Y0UA 3OYJA 5J4VA 1W36D 4OIOF 2V1NA 1Y0NA 3FXMA 3LA7A 1G2HA 5DUIA 3HL2A 1FYLA 1XB4A 1GXQA 5C3EJ 3QP5A 3K4JA 1MJBA 2ISYA 3CD6I 2ZSIB 3V4GA 1R6RA 2FE3A 5IP9J 4P9FA 2CSOA 3R0JA 1NH3A 2X0LA 4I6ZA 2O03A 4B3XA 1OCOH 1XGOA 1S9HA 3A0BC 4AIDA 2RREA 2R5YB 1WVRA 3CCLI 2L4AA 3FXOA 5KCMA 1M1EB 4CCLA 1JTYA 1W5CC 1IN8A 1I50J 3CCMI 4BXUA 5E1WA 3IRQA 3OYIA 4HLYA 1YHQI 3FKIJ 4XSXF 1SEUA 1YS6A 3JRFA 3PUBA 1JHFA 3HUGB 4AWXB 3B73A 5KVRA 1B59A 2W7NA 1V4RA 3DKXA 3G1LA 4KIBA 2EZLA 1BI3A 3CF2A 1HSJA 4DBRA 2NNNA 4M6VA 4PFOA 5IT9Z 4I0BA 4BXXJ 3BPVA 4A12A 2ZXHA 2MSYA 4M74A 3J7AO 3TQNA 4ZC3A 1V54H 5L3CA 2DDBA 3BCBA 5JLWA 2MFZA 1MNDA 5DEQA 2VKHA 4PCQA 3W2WA 1QQIA 1BJAA 2EV6A 2ME6A 1AU7A 4DYRA 3DPTA 1EKEA 5F6FA 4ITVA 2GA1A 4D7NA 5EF6A 3OSGA 5CVVA 1USTA 3DKYA 2RC4A 1XPXA 1T95A 2EH3A 1Y1WJ 2CRGA 1I6XA 2Z99A 5LEJA 2DMUA 3RSNA 4Q4ZF 4XNFA 1Z3YA 3EDPA 1MH4A 5BMZA 2DQRA 5LHIA 5BNGA 5F64A 4GRIA 3OYLA 1WQ2A 2K86A 4LIVA 4XN0A 2DTZA 1VNDA 4KMUX 2R7XA 3BC8A 3TDUC 2L54A 2P8TA 1KZHA 3MKLA 3PFIA 1KU9A 4IX7A 1EV7A 1IC8A 3F23A 1CF7B 4AIKA 3RPQA 2HPIA 2JUGA 2EV5A 3BR3A 2ELJA 3P5JA 2ZMEB 1O7LA 2DMQA 1FJLA 3M07A 2HTSA 3K6GA 3ASOH 3FMRA 3GZ6A 2LH9A 2DTRA 3FIWA 5D8KB 3OS0A 1OCTC 1FBQA 1HA8A 2W24A 2R5ZA 3RKWA 3JTGA 1MDMB 5E8GA 3DBRB 5K7ZA 2EFWA 3EYYA 2XGXA 2W85A 3NWSA 2DLLA 4RA2A 2BEOA 3DEWA 3EUAA 5DUKA 3WTXC 4IHYA 1ONVA 2QQ8A 4NHJA 1HW1A 3A01A 3LSGA 3M1CA 1SFKA 3RJPA 1WSUA 2QBYA 1JT6A 5DCMB 2M30A 1ZREA 1OQYA 3NARA 3Q9VA 4BHPA 5J40A 3I4PA 5E3NA 1ZGAA 3FM3A 2OTJI 2XAFA 5GP9A 3SXYA 3F0CA 4E7JA 3NAUA 5FROA 4ZYHA 2GIVA 3SZPA 4NUBA 3I0TA 3QPTA 1XSVA 3ZGKA 1RKWA 3ONQA 5JVGF 2CGPA 5D5WB 2OBPA 3SEQA 2HQNA 3MFKA 4V2GA 5EYRA 4CH7A 1MIJA 3VODA 2IS2A 1W5SA 2XAJA 3HC7A 4RM2A 3E0JB 3KZZA 1QGPA 1R22A 1F43A 4LMYA 5A2QK 2UXNA 5LRRA 3VDXA 3L2QA 4M3BA 3JAMK 1Z7LA 2CUEA 2OPTA 2YU3A 1Z77A 1ZARA 3G6EI 1X58A 5D5UB 2L3DA 4D5CA 3HZJA 3PFYA 3KCCA 1WJEA 1OCCH 5TISC 4A3KJ 1OCRH 3HUGA 1RKTA 2R7SA 1KYWA 3SZTA 2ZXIA 2KISA 4MQ9F 1DUXC 2KIFA 1IRFA 2FQ4A 3CO7C 2FA5A 2W25A 3WGIA 3K1MA 1YW7A 2QVOA 3AG3H 3DEUA 3RYPA 3LSKA 1VQPI 2QZ8A 2DPUA 4AM3A 2G9WA 2QCOA 2WB1N 3ZXSA 4BGDA 1NK2P 2EA2A 3SEZA 4LD5A 2XSDC 3PNYA 2WWYA 2YX4A 5J1RA 2R7VA 4E7ZA 1R7JA 3GFJA 4ENNA 3FISA 1QNTA 1FWZA 3O8HA 2D5VA 3E5QA 4G8XA 3CCUI 3E6MA 1YW9A 2H6BA 2M34A 4B43A 1PYVA 3HKZA 5JLXA 5HDKA 2VQHA 5HLTA 3HSFA 2EIMH 3ZCOA 5FGMA 4EJUA 1ETVA 3JR9A 1HKTA 3JRAA 1J9IA 2JA7J 4Y7NJ 2VBZA 2YSRA 4M6YA 3RZOJ 3S8PA 4C2MJ 2HVQA 4U0VA 2FU4A 4C2TA 3HHHA 4KIFA 2DBBA 2Y0SN 3BG5A 2LDUA 2V9KA 3ECHA 1CF7A 2HOSA 1T33A 3S2WA 3ZQCA 5KK1A 1KQ9A 1GVDA 2EBIA 3WGHA 1OCZH 4FT8A 4LOCA 1H9TA 3O3KA 1FBSA 2CO5A 2VQLA 1S29A 3SFZA 1R49A 4XL9A 3L1PA 1XTAA 2OQRA 1IUYA 4M3GA 4RB2C 5C44J 1OLTA 2VPRA 1KYZA 4AIJA 3UKGA 1TQPA 1MDMA 3L9FA 1T6SA 5KNLA 3F8FA 3H0DA 1VQNI 1USSA 1Q1VA 3CUOA 2O3FA 2CQKA 2TCTA 3OS1A 5ILVA 3BY6A 4QTRA 3R0AA 1BM9A 1I5ZA 2X6WA 1Y8RB 2ZJ2A 3V7RA 3WHBA 3OIPA 2VE9A 3PIOF 4C2UA 5DCMA 1D5YA 5CPRB 1YJ9I 3MZ8A 2X51A 2IAIA 5HOOA 1XN7A 1GXPA 1B9NA 1XMXA 4XLNF 3CMAI 1N75A 1Z1DA 4BEHB 4ZZDA 3TBIA 1VQ4I 2CYYA 4U7BA 1MD0A 5ICEA 1LE8B 5IOYA 1RPWA 1UFMA 3JREA 1E3PA 1Z3XA 4GO1A 2XB0X 2HOAA 2HGCA 1WCMJ 2R4GA 2EPFA 2VASA 2CMPA 3EETA 4R79A 1QO0D 5DCFA 2D45A 1TL8A 2PMZN 3J7AY 4F7ZA 2CV0A 3HXLA 4I09A 2E2IJ 1ERDA 3CMYA 1R4MB 5M5YJ 1X1CA 2VKEA 1A31A 3WG9A 4XOPA 3PNVA 3IWZA 2V6EA 3S32A 3I56I 2QM3A 4G9YA 1JI8A 4ZJZA 4UVCA 3ZN1A 1G3YA 3L2RA 3ABUA 2VONA 2HR3A 2A3SA 4GFBA 4FE4A 3OWTA 2L5QA 2V9VA 3H9GA 4KN4X 1SFEA 3B6AA 1YW8A 4GCVA 4CSWA 3DTEA 5D5VB 2VN2A 3ZMTA 1TNTA 4A2UA 4L5JA 5D5XB 3HYIA 4LFUA 2ZFUA 3ZMZA 3QOPA 2KJCA 3KZYA 5EG0B 1JUPA 2VOPA 3CMEI 2UV1A 5ERIA 1G8XA 3MEXA 3I53A 2F6CA 5JR3A 3RZDJ 1ETYA 2MGQA 2M0CA 1WZ2A 1RESA 4LG0B 1SVOA 1XG1A 3L2VA 4E4HA 4YIRX 4EMSA 5K7FA 2DK5A 3OYHA 4ENKA 3DKWA 2DYRH 1ZRCA 1U8BA 2KP6A 2NS8A 2A68F 4XBFA 2F5EA 1J0RA 2YX7A 1P4WA 1R9TJ 2DFHA 2ZC2A 2ZO4A 4QIWN 1WWXA 3DBLB 3U2RA 3GTPJ 4FE7A 1X1AA 2BW3B 3MZYA 3IAM2 3WTWC 4KDPA 1HQCA 2IT0A 3GTJJ 4IRIA 5LBQA 5HDGA 1UHWA 1XCVA 1EH7A 5DS9A 2ESNA 3R6SA 3BCAA 3FX3A 2R7QA 4UV8A 5B1AH 3JSOA 3W6VA 2ZJQF 4GDFA 2ZBKA 5CVIA 4BY1J 3AL0C 4GGGA 4EJWA 1GLNA 3VYRB 2XSJC 3E5XA 3HDDA 3S1MJ 5BS6A 1FX7A 2UXXA 2ZFWA 3HPGA 1UZCA 4DGWB 1F1ZA 3HBLA 4HF0A 1QBJA 2IS6A 2HXOA 2P5VA 3HRMA 1K61A 1D0YA 4JYKA 2PJRB 3QRFF 3GXOA 3GFMA 2XVCA 2OC6A 4YEJA 2AQEA 2BE5F 3K4NA 2EB7A 4NQWB 4UUTA 2P81A 4I99C 3CUQB 4BEHA 2AXLA 2L2OA 1HW5A 2RKHA 2DA5A 5AIPA 2C6YA 2STTA 2PG4A 5E18F 1K4TA 4ESJA 1D3YA 2X85A 1LE8A 2EQRA 2NOJB 4LGWA 2RQQA 3SQNA 4MGRA 1FIAA 2ZB9A 3PQJA 1A36A 3DV8A 4ANJA 2XPVA 2Y31A 3R60A 4MTEA 4XRMA 4M71A 4NC6A 2WY8Q 2A5YB 5EEGA 4UUVA 2NVXJ 1XC5A 5E3MA 3EYIA 4UUSA 4S05A 5M5XJ 2M7BA 4DYQA 4E7IA 3F9KA 1D0ZA 3DQVC 2A6TA 5B1BH 4A3LJ 1Y1VJ 4EM0B 4F55A 1WH7A 4EJOA 3F8CA 2K85A 4G6DA 5E3LA 4BDYA 3QU6A 3T5XA 1RR8C 2R7DA 3S1RJ 3C2BA 4CUGA 4A3CJ 2WB1A 3S3NA 3BZKA 3LSIA 1S8NA 3K4CA 4N0BA 5CVRA 4XKWA 5EG0A 1TW3A 1FP1D 3BG6A 2DYSH 2XKOA 2F48A 2XKPA 4D7MA 5DM7F 3K4KA 1MMDA 2ECBA 2R93J 3T1BA 1AKHA 4EJTA 3CJQB 3WE3A 4M3EA 4G7OF 3BP8A 3WU2C 5EEAA 1Z21A 5CQGA 2LBFB 3CJTB 3GEZA 2EFOA 2DT6A 2XRNA 3BOQA 4EGZA 2Y0SA 3CCQI 4MO7A 1R5ID 3H0GJ 1FT9A 4QWQA 1ZLJA 4EATA 4I0AA 1KONA 1XSXA 2KMUA 3HJEA 1W7PB 3DLAA 1OISA 2DN0A 5C4JJ 2VJ5A 4RBOA 1ZKGA 5FLXK 3MKWB 2IA0A 2HOTA 1L3LA 4YELA 3L2CA 3KX2A 2VQCA 1U5TB 1ZTRA 2BW3A 3GYHX 1VFCA 2H6CA 2R7WA 2CUJA 2V1XA 3E6DA 5HVQC 2XGEA 5FFZA 1O57A 2X9DA 1Y39A 1IN6A 1QVTA 3OV8A 3OYCA 3AG4H 2P7CB 3FKJA 2OJED 2MH2A 1ZH5A 4IVNA 4IOAF 2JSPA 5ICFA 1YITI 1A35A 2IXSA 1H88C 1BOAA 2K4BA 2ZNYA 1W1WE 2K5CA 2K9QA 4Y4RA 3PIPF 4IEJA 5CKTA 2V6CA 2E2HJ 3OYNA 1BW5A 5TRDA 1WFXA 4JBAA 3S3MA 4L5EA 1S6LA 3FXJA 2K27A 1NG6A 4HA8A 1UAAA 4L5IA 2UWMA 1VZ0A 4O5VA 3IKVA 5H6RA 5LHHA 3L2UA 1E2XA 4XLHA 2OZ6A 4LLNA 2PJRA 4D1QA 4M3DA 2RN7A 3HGYA 2YR2A 2W57A 4HX8A 1APLC 4RGSA 5D6EA 3KYCB 2QQBA 4NQWA 4AD9A 3KLOA 4RGUA 3VEPA 4BU2A 3CUQA 3BR6A 3T0YA 1RUNA 2GXGA 3J80K 1OCPA 2KHMA 3I71A 4HQMA 4GYIA 5GPAA 3U9GA 2N8GA 5JFRA 1Z7UA 2K9NA 3SZGA 5FRMA 3M8EA 1LB2A 2HNHA 4N4NB 1XS9A 4CCJA 4HNVA 4BAYA 1E17A 3O2PE 4IHTA 1FTZA 1MSFC 3L09A 1ZG1A 2CUZA 4XLEA 4DNCA 3ZQHA 5FFXA 3HKZN 3G1OA 3I4NJ 3MVPA 3LWFA 2ZXJA 1YIOA 4XRFA 1VQKI 1IRGA 3F8MA 2R7RA 1H8AC 2FXAA 3QYFA 4FQGA 3I59B 2LKXA 2IW5A 1GV2A 3WODF 3ECOA 1LJ9A 3WE2A 3CDIA 3H36A 2HU9A 3K4BA 4IQ4A 5LLQA 2O9LA 2R92J 1X3WB 1XSDA 3FK6A 1VQOI 1XGMA 4LK1F 3DP7A 1IRXA 1XDSA 4IJAA 4EEFG 5AIQA 3S14J 2Y69H 2IBDA 2L9VA 2EFPA 3ZMVA 5D8LB 3ZOBA 1WGXA 2LSOA 2W1OA 4XMYA 4XRSG 5F0HA 2RAEA 3P9CA 4HDUA 4BDZA 2KL4A 1UHSA 2KPMA 4GXOA 1QRYA 1JKRC 2VKVA 1XGNA 3HOWJ 3CJRB 3LSJA 1FMVA 2LBFA 3PL8A 4AU7A 4FASD 5L3EA 3HOXJ 1X1BA 1NG7A 4L0ZB 2P5KA 4RB1A 5FD5A 4FCYA 1MKMA 4B47A 2GLOA 2LP0A 3PNTA 4HLXA 1W7PA 1ZAOA 4CGZA 3WTSC 3H5AA 1O3RA 4FX4A 2ACJA 4RM3A 1QZZA 1BC7C 3H9JA 3Q0VA 1SMYF 3LA3A 5IT9K 3LL7A 1U5TA 5E3OA 1FOYA 2GM4A 2DMPA 5DM6F 1DDNA 1UJ8A 1TT5B 4CZZA 1IV8A 2K9MA 2UZKA 1EH8A 2ELHA 4Z6YA 2XAGA 4X6AJ 3HIFA 4G7ZF 3BQYA 2BY0A 2VJ4A 1GUUA 3J81Z 1D1CA 3F8BA 3HM5A 2X6XA 3ZQGA 1V5EA 2FQ3A 3I3LA 2A6HF 1YIJI 3OS2A 4XK4A 4B09A 2L7MP 3S3OA 2AXTC 2BYVE 1XCBA 1DPRA 4RB0A 3TKYA 2HYFA 2KFDA 3PJRA 3DTIA 5FO5A 4YIFA 3U1DA 3VWBA 3GFIA 3F3XA 2GOXB 4HZFA 4HSTA 1EJ9A 3MMYB 4BQAA 3IAS2 2Q0OA 2KIUA 5GAEJ 1RR7A 4E70A 5E1XA 1HF0A 1V5GA 1R5HA 2XPWA 2A6EF 1TC3C 3PO2J 1UMQA 1DGRM 1YI2I 1OMIA 2ME0A 4OIPF 1CQTA 1MSEC 1YLFA 1E3OC 3E6CC 1MJ9A 2DFFA 2OV7A 5CLSA 3A4CA 3TL4X 1RRJA 4CA0A 2JRTA 2PMHA 3BZCA 1I39A 3U21A 4N4OB 3QODA 2KZGA 3ASNH 3JSPA 1MNEA 2FMYA 3QPSA 4OIRF 4RAGA 3WTYC 1JTXA 5FRNA 2HPMA 1ON1A 3IRRA 4XN3A 2EZIA 2RNJA 3SJMA 3HOYJ 2H1KA 3I59A 1N78A 2CFXA 1P4XA 1NTCA 2F4IA 3P9KA 4HDVA 4PDKA 3GFLA 1MZBA 2LREA 3F6VA 4LLLA 5L3DA 2KZVA 1FLIA 4RAYA 2RGVA 1ETOA 2HYJA 2JA8J 5DTDA 2K3FA 3SYTA 2QSHX 2HWVA 2XAHA 1J7KA 2X1EA 2XV4S 2DT5A 2R7FA 1OYIA 1QPIA 4BJTA 3ERED 2K3PA 2B9SA 4OMZA 1LNWA 4PK4A 3RPUA 4XIDA 2NVYJ 3EUHA 3ISPA 4D0PA 1U8RA 1HKQA 3UNGC 1QHGA 4AVPA 4P1WA 3G71I 1TT0A 2IRFG 3A03A 4BE0A 4A0YA 4RGRA 5K7HA 4E7KA 1O3TA 4I01A 1WHUA 2P6SA 3GTMJ 1R58A 1WJ5A 1POGA 4E7SA 3GMEA 3BJAA 2CH0A 3DU5A 3M8FA 5LD2C 4ZTJA 2DI3A 3BTCA 2CW0F 4OOIA 1TWCJ 4PSWA 3TDZC 1TW2A 4MQVA 3OOPA 1YE9A 2L9SA 2M7AA 3KEOA 2P5LC 4IHSA 2O0YA 3ABMH 4Q48A 1LFBA 2K4JA 4I02A 5AONA 3BR5A 2VB6A 2JRMA 2FNAA 3IH3A 2QEXI 2HEOA 2PEXA 4HYEA 2LVSA 4C3HJ 3KZIC 5HS9A 2COBA 5J1UA 4CCKA 3N4MA 4K2EA 3TOAA 2DODA 2VBYA 2EJRA 5JHFA 4XICA 1NK3P 4G7HF 1IXSB 5CVJA 1P7IA 3ZRGA 2K40A 4A3EJ 1HC8A 2R0QC 1X1PA 2H09A 2LK2A 4XKBA 2HKOA 2FNPA 1MNMC 1OJLA 4IF4A 2R7ZJ 1MMAA 1YRNB 2E36A 4Y52J 1F5TA 4YIIA 3AAFA 4EQQA 1WJAA 2HDWA 3T8TA 4JX4A 3OIQA 4BE2A 2BV6A 2QKMB 4KICA 3FWEA 3PQKA 4W97A 5TGTA 2E5ZA 3LFUA 1JUSA 2JUCA 3HOUJ 2HVSA 1FSEA 4AVZA 3ZQLA 2L9RA 3Q3SA 1S3JA 3LAJA 3CO6C 2E7XA 4CYCB 5L3FA 4BXFA 2DA2A 4IXAA 2LR8A 3M9AA 1PUEE 2ADUA 2OA4A 4I2OA 1YG2A 4OWRB 4HAMA 1NHAA 2FX0A 1MBJA 1MBKA 3OL3A 1W0TA 3JTHA 3FMSA 4MFDA 2MABA 5BQTA 2QKLB 1IZ1A 3DBHB 2XROA 5ILUA 2KJBA 3HG9A 3K4LA 1JGSA 3QYBA 4A3FJ 1TWFJ 1Z05A 3F22A 2F4MB 1PP8F 2YPRA 3GF2A 2OU2A 1BL0A 2OD5A 3C1DA 3LOCA 5K1YA 2AO9A 2L01A 4NB5A 5HDNA 4XONA 1EF4A 3BR2A 2VBWA 4AC0A 3SDBA 4OU0A 3ABTA 4RMNA 2XUBA 4S04A 4LG3A 3LSHA 4I98B 5B5EC 2VJJA 3W3CA 2UUZA 4MIMA 2G7UA 3CUQC 3Q9SA 2YU9J 1BBYA 3KEQA 4IL6C 4P5OA 1QZYA 4EM1A 5EZGA 2JVGA 1YQAA 1ZG3A 2ID6A 2PN6A 1WJCA 2RDPA 4MNUA 1JJ6C 1MH3A 3WG7H 2MD0A 3WHCA 2VLAA 2IP2A 3GTGJ 3DTKA 2YS9A 4P55A 4XLPF 3CCRI 4L18B 2DDAA 5EJCA 4PJ0C 2TDXA 4Y13A 4J19A 1FC3A 1IJWC 1WI9A 1F36A 3C2HA 4NDLA 3TW6A 2M3AA 2OF7A 1G3WA 3QAHA 4A5MA 2IS4A 5CQEA 3Q0WA 4B8XA 4KNYA 1YTYA 3CC4I 2VT2A 3K69A 4ENMA 1MBFA 4IPAA 2Y30A 4UUSB 1A04A 3LQQA 1LFUP 3TO9A 2BGCA 5HNFA 3OR2C 3HTUA 2IS1A 2W4SA 3BPXA 1OFCX 4NBQA 2HZDA 2DA3A 4FX0A 1A6QA 1ZN2A 3VOEA 2M8GX 5GAGJ 2XAQA 2VODA 1EA3A 1SD4A 4KIGA 2HZTA 2HFHA 3M1EA 3X2QH 2BY2A 3Q5FA 1S7AA 4WF2A 1S7OA 2H27A 4G6QA 3ESWB 4HNUA 1AKHB 4UB6C 4IHWA 1YRNA 1SANA 3MCZA 3TP0A 1G3TA 1H9GA 4HNTA 2HOEA 2QQAA 4YFKF 1Y56A 1JKOC 1LEBA 5FKMA 3OR1C 4OAYA 2VL8A 4MEXF 3HSRA 4U87A 1G3SA 2RVCA 1D1BA 3BLYA 4CYCA 4ZDLA 3D0SA 2GOMA 2CS3A 2JPBA 2KRCA 5FJ8J 3H1CA 1HDPA 5J47A 1VQ8I 1U5TC 2EIKH 3RCOA 4C9YA 1T2KA 3T8RA 4NC7A 4PGHA 1K79A 2Z3YA 3RYRA 1ZYRF 1WKMA 3IL2A 3DLLF 1SAXA 1YX5A 1J5YA 3GLXA 3GBGA 2BVLA 2DMTA 2LC2A 1FNNA 3MD2A 2OCCH 4CCOA 1IXCA 3FXUA 3KEYA 4L9VA 3M4OJ 1X2NA 4WXDA 1T98A 3IKTA 1ZHFA 3HB9A 1SVMA 2CV2A 1AWCA 5M3FJ 4MHGA 5D6FA 1BI1A 1RC9A 1JKPC 4IO9F 4XM3A 4U7DA 4XSZF 1I3QJ 1T08B 2X1CA 3BR1A 3H5NA 4KITB 5GPCA 3LAPA 3OL4A 3TEDA 1C0WA 2CG4A 2BZTA 1LFPA 4HV6A 3PSFA 5IYCJ 3PO3J 2KIMA 2VJIA 3KE2A 3A1YA 1BR2A 4BH9A 2NYXA 4ETSA 4ZDPA 1ZK8A 3HOTA 3MN2A 4HG2A 2KKOA 1E3HA 4ZYEA 2W84A 1BI2A 1ZRFA 1TTYA 2EV0A 5IP6A 4DZPA 2F5FA 3H9QA 2DJNA 3BG7A 3K9TA 2F2EA 1Z0XA 1U3EM 3TO6A 2M1BA 3IHUA 1ON2A 1VQ5I 2OZUA 2IJLA 2MH9A 1UCRA 1TWHJ 2VE8A 4A69C 5FKLA 2GBYA 3OMYA 3W2VA 1G6NA 5FLMJ 1IGNA 4XR6A 2M0MA 4EM2A 1OKRA 4G94A 2H94A 1XMKA 4P96A 1T56A 2NS0A 3CLOA 2QF7A 4QLCU 3IUOA 4OINF 4XLAA 1R36A 4A6EA 1U2WA 4BYYA 2M87A 1N25A 1KU3A 1XMAA 4PUSA 4C3JJ 2ID3A 2MLKA 1G59A 3GTQJ 2Z33A 1BC8C 2I5UA 2XF6A 3H92A 3K0LA 3O6BB 4HBLA 1R1VA 3CZ6A 3NRVA 1BR4A 1DGWY 1HLVA 3AKZA 2JK3A 1GDTA 2L7FP 1TP4A 1LDKB 2LY2A 2Q8KA 2GQQA 3EUHC 3P7NA 4H0EA 4P9UA 4M3FA 3ZR8X 2ZNZA 3KP6A 4XLCA 2DFEA 2Z1DA 3I54A 2BOLA 1W7PD 3GLLA 3MAJA 4BKXA 1CGPA 1OR7A 2VIXA 3W6KB 2LYCA 1PJRA 3OYAA 4JQFA 2LY9A 3C3WA 3I64A 2LD5A 1QZEA 1TNSA 3NQOA 3QYEA 4XLFA 4DW6A 4XQFA 1U78A 1HBXG 2PJPA 1O3QA 3S93A 2EK5A 2R3SA 4U0YA 3JRIA 1B6AA 4A3IJ 1X4OA 3CDLA 3F72A 4M72A 4CHUA 2IGNA 2RQPA 3S2DJ 2QQ9A 4J01A 3JW4A 4UV9A 1IV6A 3F8NA 2A5WA 3DXJF 3L7WA 1FY7A 5GADJ 3V42A 3FM5A 2V1UA 1ETXA 4HF2A 2MW8A 1HSTA 4ABZA 4M9ZA 4II2A 1J75A 1TBXA 1UG2A 1KA8A 2K02A 3HGGA 4CCNA 5D4RA 2DFIA 2E1MB 1BJZA 4E7LA 4KFCA 4ESFA 4HEA2 2HDCA 2V79A 1ETQA 1R00A 4C3IJ 1SAUA 2A69F 3E7LA 1WJBA 1XD7A 3KP4A 2QSFX 1MMNA 3N05A 4BS9A 3BWGA 4R1HA 1IN4A 5KAIC 3Q0UA 3RQ4A 3D5SC 1Y6IA 3GUDA 3QPHA 4FETA 4Y17A 3SFIA 4D5FA 1XGSA 2VOOA 3KYLA 5F0FA 2ZXWH 2E1OA 4Y15A 3OYEA 2LKSA 1J2XA 3WGGA 1YFHA 3V8JA 1LPQA 2Y0MA 3VYSB 1R5GA 4ZYDA 4BBSJ 2VQGA 4IHVA 2NVUB 4CCMA 3IV5A 2W48A 2Z16A 2K7LA 3FXQA 3RKXA 2QUFA 1H0MA 3LFKA 1DU6A 1QHHD 3HSEA 1ZR2A 1FSHA 5CJ9A 4GYGA 1K6OA 4A3MJ 1JHHA 3TOBA 3LNQA 1LDDA 1ORKA 2BY3A 2DK8A 4Q47A 4NNJA 1MBEA 1X19A 2JA2A 5HS8A 4PJJA 5H20A 1IG7A 2QA4I 2BHZA 5BPDA 4UHTA 3S15J 2JSCA 3FDYA 2O8XA 3D5LA 1ZRDA 3RPUD 2FBIA 4Q5SF 3MZHA 1KU7A 3K2AA 2GA2A 1RIOH 2X6YA 1BW6A 3N97A 1D5VA 3SHFA 5E1ZB 3M3YJ 2HYGD 1B8IB 2E19A 4B3AA 5L3GA 1U9OA 2KRHA 3CCJI 3CCYA 4BJ6C 4TV7A 4KT5C 3LSPA 2XDVA 3G2BA 3HRTA 3CJNA 2KLOA 5H2FC 1VQLI 1X3ZB 2FD5A 3FXRA 1T0FC 3ROUA 2P4WA 2DT7B 1ZLKA 3QP6A 3J81K 1H89C 4OMYA 4NC8A 2I8DA 4F92B 3KIOA 5FKOA 2X48A 4I76A 2L9NA 5LHGA 4YFNF 4RAZA 2IGOA 1IXRC 1ETWA 3DCFA 3ZMDA 1B1BA 4OAZA 3V7CA 2EFNA 1TWGJ 1BA5A 3ABKH 3ULQB 2NVQJ 2ICWG 5F0CA 2EZKA 2H8WA 1LVAA 1OYWA 4BUPA 3GTKJ 2Q2EB 2RNGA 4EV0A 4E6KG 5L3BA 2LFBA 5ED4A 4RLQA 4HX4A 3RIRA 1BI0A 2NNYA 3VSKA 5EGOB 3QWLA 5LGTA 1V3FA 3QOEA 4CXFA 2ZCWA 3E5UA 2CQQA 4RDUA 3I4MJ 1MBHA 3H3UA 5LGUA 4UVAA 2FBHA 4IHXA 3HTSB 1ODDA 3HOZJ 2ZKZA 4WX9A 3DPUA 4G6TB 2XB5A 1Z91A 2M4KA 2JA5J 2D1HA 1STZA 2MD5A 3VB2A 4S0HB 1W0UA 2ECCA 5J8CA 4X0GA 1WJFA 4X1EA 3FBIB 3HRUA 4IKFA 1D8KA 1P92A 4CO8A 3CF5F 3GWZA 3ZP5A 3HOSA 3DEEA 3HEFA 3VFZA 2CV1A 4L9NA 1K83J 1P6RA 2LMDA 3H3ZA 2CJJA 2Z9OA 3ZQFA 4RAFA 1R1UA 2VPLA 4O3MA 5EEHA 3VPRA 2FUG2 1FEXA 2B0LA 2LNBA 3PM1A 3E6BA 3L2WA 3BTJA 3S17J 2BXZA 2D2WA 2LOOA 3IH2A 3VSLA 1Y8QB 2J5PA 1RZ4A 2NXNB 5HLHA 3HOVJ 2FEZA 2LKPA 2J5OA 4HPQA 1QU3A 1SFXA 1YYVA 1S5LC 4M6XA 3DF8A 1U6GA 1T39A 1YJNI 1B72A 5HS7A 2XF7A 3C7JA 1L0OC 4A0XA 3BZ6A 1LVKA 3BG9A 2AQFA 1ETKA 2LRDA 2HQAA 2ETHA 4EJVA 3FF5A 5FKNA 3OSFA 4UNOA 3FHNA 3B6CA 4CDGA 1TZLA 1JKQC 1PDNC 4ZDOA 2MG4A 4ESBA 1YJWI 4AUXA 5CYVA 5E20A 2XRLA 4A3JJ 4KUMA 3TW7A 4A6DA 2GIZA 4BQNA 1AHDP 2AHQA 2DA7A 3OYGA 5C4XJ 1B8IA 1LDJA 1R23A 2Y9ZA 2P7VB 4D9JA 3F21A 3MQ0A 2Y75A 1ZR4A 1X2MA 2GWRA 2O6GE 2LF7A 3E1SA 3HPHA 5EZHA 4BL0B 1YO5C 1EH6A 9ANTA 4G12A 3ZMUA 5GTIC 2IA1A 1HXDA 3NEUA 3E3VA 3TO7A 4IQJA 1FOKA 1YS7A 1K4SA 2XF5A 1I3AA 5ICGA 2KT0A 5B3SH 1IAWA 2E2JJ 3CC2I 3BDDA 1LKXA 5DV5A 2IEKA 3E97A 2L4MA 3IP4B 1WJDA 5E8IA 1BIAA 4ZH4F 3W6JB 3M7GA 5K5OA 3OYKA 1X4PA 2JA6J 1B4AA 2M4GA 4JX5A 2A05A 2HQ5A 3RTRA 2EWNA 2EILH 1R1TA 2HXIA 2Q2EA 2CUFA 3DWLE 4WXHA 3QPLA 2DPDA 3I58A 1IF1A 4ZZLA 4DOZA 4IRHA 3FMQA 1OPCA 5EGOA 3WU1B 3EPZA 2HVRA 1YOVB 2FBKA 5BOXA 1WI3A 3K10A 4LIUA 3D5RC 3LMMA 3UR3C 1KGSA 3EUKL 4LLGF 3BQZA 3MWMA 2HDDA 1FZPB 2PBIA 4DQ2A 3LQRA 5BPIA 4BE1A 3WU0A 5KAFC 2R5YA 4A0ZA 3FK7A 5M5WJ 3TMOA 3ELKA 1I6HJ 2QENA 3JRCA 3AFHA 2V4JC 5DDGA 1JUMA 3BROA 1OR7C 1KQ0A 1SD5A 3GO5A 2DA6A 4DZJA 3S16J 2MA3A 5DD4A 3G1MA 2EFQA 1G4DA 3FXLA 4XORA 4LB6B 2WC2A 3GW2A 3L00A 5ILSA 3FXKA 1MMSA 2EINH 2LF8A 3J7YJ 5HODA 1HOMA 1RETA 1WPKA 5A2QZ 3JAMZ 3DPLC 2DJIA 2KDOA 3CLQA 3I5UA 4HW0A 1Z9CA 2H1LA 5DD8A 1J09A 1TWAJ 2F5CA 2PX9A 4O6JA 1W5TA 5J1YA 4LITA 5HNHA 3K2ZA 1J59A 3OIOA 2B7EA 2EZHA 3ZQQA 1Z67A 1O3SA 3WTZA 2GXAA 2OCEA 3A0HC 4B48A 1XDUA 2BY1A 2Z5UA 3RKYA 1LQ1A 4JP0A 1VQMI 2R7UA 3ZQIA
chains in the Genus database with same CATH topology
4BU2A 2VJIA 3VYTB 3OYLA 3A1YA 4LIVA 4XN0A 1BR2A 3MKYB 2R7XA 4ZDPA 1P9QC 3BC8A 4F52A 3HOTA 2KHMA 4HG2A 4IX7A 2MC4A 3SZGA 1ZELA 5FRMA 2HNHA 4N4NB 4CCJA 2HPIA 2JUGA 5LFAA 3H9QA 2ELJA 2CUZA 4XLEA 3BG7A 3K6GA 2E60A 2LH9A 3OS0A 2R7RA 1UELB 2DCEA 1HA8A 3PSIA 3QYFA 2F5VA 2Q1ZB 3OMYA 3W2VA 2CFOA 3NWSA 2M0MA 2W00A 3K4BA 2HU9A 3EUAA 4IQ4A 4XR6A 4F93B 3IUOA 4XLAA 2V7FA 1YX3A 3LSGA 3M1CA 1SFKA 1IRXA 4PUSA 2R7TA 2WA0A 1G59A 3A2KA 4XKVA 2W1OA 4XMYA 4HSRA 2XF6A 2WBMA 2KQRA 4E7JA 1DP3A 4BDZA 2KL4A 5FROA 3CZ6A 3NWTA 1BR4A 1DGWY 2KPMA 4NUBA 3AKZA 3ZGKA 1LDKB 2LY2A 3ONQA 3CJRB 3H35A 3EUHC 1FMVA 2LBFA 3PL8A 4AU7A 4FASD 3SEQA 1X1BA 1N77A 3ZR8X 1NG7A 2E5NA 4XLCA 4CH7A 2Z1DA 2BOLA 2IS2A 4B47A 2VIXA 4ZYAA 3HC7A 3PNTA 4RM2A 4B44A 4IZZA 2W82A 2LYCA 3E0JB 1PJRA 3OYAA 4JQFA 2DXIA 4XLFA 3QYEA 3VDXA 3H5AA 1U0JA 4XQFA 4CZCA 3L2QA 1Z7LA 4RM3A 2ZSHB 3S93A 3H9JA 3LL7A 4F91B 4BQQA 1X4OA 3PFYA 2IGNA 1WJEA 2K9MA 2V26A 4J01A 2R7SA 2ZXIA 2A5WA 3FBNB 3V42A 2IGKA 2L7KA 2VJ4A 1D1CA 3MKZA 2K9LA 2MYSA 1FMWA 2X6XA 1V5EA 3I3LA 3LSKA 4II2A 3OS2A 4H4KC 4BJ5C 3S3OA 4CCNA 3ZXSA 4BGDA 3SEZA 2E1MB 4E7LA 3PJRA 4KISA 3DTIA 3PNYA 4HEA2 2E1MC 2R7VA 4E7ZA 3VWBA 2GOXB 1SAUA 3OYBA 4Y33A 4HSTA 1WJBA 1DQUA 4JOMA 1MMNA 3MMYB 4B43A 3N05A 1PYVA 3HKZA 3IAS2 4C30A 2VQHA 4BS9A 5HLTA 3ZCOA 4BACA 3RQ4A 3D5SC 1Y6IA 4FETA 2WADA 1V5GA 2LY1A 1DGRM 3KYLA 3S8PA 2HVQA 4C2TA 3OYEA 3I9V2 2V9KA 4QPQA 2OV7A 3A4CA 3TL4X 3VYSB 4CA0A 3U21A 2VQGA 4N4OB 3QODA 4CCMA 1MNEA 2VQLA 3OYMA 2Z16A 2WAEA 1V5FA 4XL9A 2IGMA 1QHHD 5FRNA 2HPMA 4XN3A 4E7HA 1OLTA 1N78A 5KNLA 3H0DA 1X1DA 1UG0A 2CW7A 2F4IA 5KHDA 3OS1A 4PFPA 4NNJA 3CP8A 1X19A 2X6WA 2JA2A 2WY7Q 4PJJA 3OIPA 2LREA 4C2UA 2KZVA 5CPRB 1BOBA 2X51A 2LG4A 5HOOA 3FDYA 3CMMA 3SYTA 4KT6A 3D5LA 2P0WA 4ZTFA 2X1EA 1N75A 3RPUD 4BEHB 4PJLA 3TBIA 4BJTA 2K3PA 4PSXA 4U7BA 4PK4A 4PJNA 2X6YA 1Z3XA 2R4GA 3UNGC 1QHGA 2VASA 4P1WA 3OY9A 2CMPA 4R79A 1TT0A 4BE0A 3VYUB 2KRHA 4E7KA 2XC7A 3J7AY 2CV0A 1E0EA 1WJ5A 3HXLA 4BJ6C 4DBQA 1ERDA 2XDVA 3G2BA 4E7SA 2KLOA 4PJMA 2CH0A 3DU5A 1X1CA 3CESA 5LD2C 4XOPA 3PNVA 4ZTJA 1T0FC 2DT7B 2V6EA 3S32A 4PSWA 1YE9A 2L9SA 2M7AA 1JI8A 4ZJZA 3L2RA 4NC8A 2I8DA 4F92B 3K70C 3OWTA 2L5QA 4CSWA 3H9GA 4BQOA 2L9NA 3K4MA 3DTEA 2IGOA 4RLFA 2VB6A 4OAZA 4BUPA 2ZFUA 4QPOA 2Q2EB 2RNGA 4J00A 4E6KG 1K6YA 2VKDA 4RLQA 2UV1A 4CCKA 3VSKA 1G8XA 2F6CA 4II3A 3QOEA 5JHFA 3ZRGA 4YRVA 3L2VA 4E4HA 4XKBA 3OYDA 3OYFA 3OYHA 1MW7A 1W36C 1MMAA 3DPUA 4G6TB 2CW8A 2M4KA 1WJAA 2VXZA 2HDWA 3H5RA 2KP6A 3OIQA 4X0GA 4BE2A 2QKMB 1WJFA 3CP2A 3FBIB 5TGTA 2E5ZA 4IKFA 3LFUA 2HVSA 4AVZA 3HOSA 3DEEA 2O5RA 2CV1A 4DJAA 4F3QA 1D0XA 1X1AA 2BW3B 3IAM2 4BXFA 3C2GA 2VPLA 4DIQA 2X1DA 3LSMA 2FUG2 3BCAA 3L2WA 2R7QA 4HRIA 4KJZA 4OWRB 2XAUA 3AL0B 2LOOA 3VSLA 3OL3A 3AL0C 4AYBA 3DU6A 2MABA 4HPQA 4XKCA 1QU3A 2QKLB 1GLNA 4Y3OA 3VYRB 2XSJC 4XOTA 3K4LA 3HG9A 3QYBA 2Z2SB 3HPGA 2XF7A 4DGWB 2DOAA 1LVKA 2IS6A 2AQFA 2LRDA 2HQAA 2R7OA 1D0YA 1D1AA 4XONA 2PJRB 1BR1A 2PMZA 2WAQA 3SDBA 3FHNA 1TZLA 2OC6A 4YEJA 2AQEA 3K4NA 4RMNA 4NQWB 4ZDOA 4BEHA 3OOUA 4LG3A 2L2OA 3LSHA 2VJJA 2BVMA 3W3CA 2UUZA 3M8JA 2X85A 4BQNA 4P5OA 2NOJB 2JVGA 4MLOA 3OYGA 1WJCA 2OUMA 2RQQA 2MD0A 1MMGA 2VLAA 4D9JA 3DTKA 2VXDA 4ANJA 2WY8Q 3E1SA 3HPHA 4BL0B 3C2HA 2IS4A 2M3AA 3K70D 5CQEA 2M7BA 4E7IA 4IQJA 3F9KA 1D0ZA 3DQVC 2A6TA 2XF5A 2JVHA 1LKXA 4F55A 3IP4B 2WAFA 1WJDA 4BDYA 3W2AA 3OYKA 1X4PA 2M4GA 4CUGA 5HNFA 2WB1A 3RTRA 3S3NA 3OR2C 3LSIA 2IS1A 2W4SA 2HZDA 3K4CA 3DWLE 4XKWA 1AA7A 3BG6A 4DOZA 3EPZA 2HVRA 3K4KA 1MMDA 3OYJA 1W36D 1EA3A 2V1NA 3K10A 4LIUA 3D5RC 3LMMA 3UR3C 3HL2A 3CJQB 3EUKL 3K4JA 1Z21A 2ZSIB 5CQGA 4HNUA 1R6RA 2LBFB 4BE1A 2DT6A 4HNTA 3TMOA 2Y0SA 1Y56A 3AFHA 2V4JC 3OR1C 4OAYA 4B3XA 2VL8A 4EATA 1S9HA 1KONA 2RREA 2KMUA 1OR7C 3DLAA 4U87A 2VJ5A 5KCMA 3MKWB 4CCLA 4YELA 1D1BA 3KX2A 3BLYA 2VQCA 4ZDLA 3OYIA 2BW3A 2GOMA 2CS3A 2KRCA 4XORA 2R7WA 2CUJA 3RCOA 4C9YA 5HVQC 3PUBA 3HUGB 4NC7A 2W7NA 3OYCA 1YX5A 3DKXA 2DJIA 3DPLC 3FKJA 3GBGA 2BVLA 2LC2A 2JSPA 3CF2A 4DBRA 4PFOA 2KDOA 2IXSA 3MD2A 2ZXHA 2K5CA 4CCOA 3KEYA 4ZC3A 1J09A 4Y4RA 3BCBA 5CKTA 2MFZA 1MNDA 3OYNA 2VKHA 1WFXA 4LITA 3W2WA 5HNHA 3S3MA 2CV2A 3ZQQA 1NG6A 1UAAA 2UWMA 4B48A 3DPTA 4ITVA 4XM3A 3DKYA 1VZ0A 1T95A 3L2UA 4XLHA 2X1CA 2PJRA 3RSNA 4D1QA 4XNFA 3H5NA 1Z3YA 4KITB 3OL4A 1LFPA 3PSFA 2R7UA 4GRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4O A;  2E60 A;  4DGW B;  1UG0 A;  2E5Z A;  2DT7 B;  1X4P A;  2DT6 A; 
#chains in the Genus database with same CATH topology
 3VYT B;  1HCR A;  2XGC A;  3MKY B;  4F52 A;  1P9Q C;  4RGX A;  3LA2 A;  3HRS A;  3JCU C;  2GXB A;  2ZME A;  2MC4 A;  4FIS A;  1HDD C;  2MC3 A;  2KRF A;  1ZEL A;  5IP7 J;  2XPU A;  4JX6 A;  3S1Q J;  3COA C;  2DW4 A;  2ELK A;  3S1N J;  3KP2 A;  1HKS A;  2Y2Z A;  5LFA A;  5K5Q A;  4ZYG A;  2IVM A;  1IDY A;  2QGU A;  2M8E A;  3G73 A;  4M9S A;  3J7Z I;  2E60 A;  2CQX A;  2MLG A;  4MFE A;  5EDN A;  2STW A;  1UEL B;  2DCE A;  3PSI A;  2FOK A;  4RB3 C;  4HX7 A;  2F5V A;  3KP3 A;  2Q1Z B;  2JT1 A;  2LLK A;  2CFO A;  1SVL A;  4V2F A;  3GVA A;  1T0F A;  2W00 A;  2E1C A;  3DFG A;  1O4X A;  4F93 B;  4PZJ A;  2V7F A;  2IA2 A;  1YX3 A;  4WCG A;  1FP2 A;  3ERM A;  4N9I A;  4PGG A;  3GX4 X;  4AYB N;  2O7O A;  2WV1 A;  1JT0 A;  3QQA A;  1FPQ A;  2R7T A;  1QA6 A;  2WA0 A;  3BJO A;  3A2K A;  3JRH A;  1VF9 A;  4XKV A;  4HSR A;  2O61 A;  2WBM A;  3GTO J;  2KQR A;  1FOX A;  1DP3 A;  1VQ6 I;  3RQI A;  3NWT A;  4YFX F;  2DQL A;  5DYM A;  1FBU A;  2P6T A;  3BR0 A;  3ML6 A;  2WAQ N;  2M5W A;  4ASN A;  4B4C A;  3H35 A;  3LST A;  1ZGJ A;  2PFB A;  1P2F A;  5JVT A;  2E35 A;  5J3L A;  1MJA A;  1N77 A;  2E5N A;  1VQ9 I;  1B9M A;  2LTP A;  4XRS A;  3ABL H;  2G0E A;  3CCE I;  4L9J A;  1PVE A;  4ZYA A;  4M73 A;  2CQ7 A;  4B44 A;  4IZZ A;  2W82 A;  1DU0 A;  2FSW A;  2JTV A;  3JRD A;  1W4M A;  4BY7 J;  4CZC A;  4RS8 A;  4CIC A;  2DXI A;  1U0J A;  2V9P A;  4A3G J;  2ZSH B;  1JXS A;  1SMT A;  2DA1 A;  1IUF A;  3EQL F;  3D1N I;  4F91 B;  5LGN A;  3FHZ A;  1JJ8 C;  1P7J A;  3QU3 A;  3WTU C;  4BQQ A;  2FJ1 A;  2XIG A;  4A93 J;  1UB9 A;  2QYO A;  2V26 A;  3P9I A;  2MBF A;  5FKK A;  5J8F A;  1QVU A;  2VC1 A;  1SFU A;  2HKX A;  4ENJ A;  2Y48 A;  3FBN B;  2IGK A;  2Y9Y A;  2A61 A;  2L7K A;  3KYD B;  4FTH A;  4B1R A;  1KQ8 A;  2FF4 A;  3MKZ A;  2K9L A;  4EVI A;  2MYS A;  1FMW A;  3CTA A;  2TRT A;  2JN6 A;  2ZJR F;  2I10 A;  2X4H A;  4KA4 A;  4A3B J;  4H4K C;  3RKQ A;  4BJ5 C;  2BXY A;  4HV5 A;  1R4N B;  2NRA C;  3SDG A;  4KIS A;  4LK0 F;  4DYC A;  5JI6 A;  3S2H J;  4HOB A;  3PUF A;  2E1M C;  1V55 H;  3ZQ7 A;  1MBG A;  4HF1 A;  3OYB A;  3GZ5 A;  3KPH A;  4Y33 A;  1DQU A;  3A02 A;  3K1P A;  4JOM A;  2ISZ A;  2ZJP F;  2KIQ A;  4C30 A;  1F9N A;  4U0W A;  1Z6T A;  5D4S A;  4BAC A;  2VT3 A;  2M45 A;  3B02 A;  1HW2 A;  2WAD A;  4KMF A;  2LY1 A;  1PUF B;  2VC0 A;  1PP7 U;  3C18 A;  4BHC A;  2EIJ H;  3I9V 2;  5F08 A;  1T38 A;  4QPQ A;  4OIQ F;  1MGT A;  1I1G A;  2VBX A;  1LEA A;  1IW7 F;  1FYK A;  1ITY A;  2CWE A;  2WV0 A;  4Z2Y A;  2VUM J;  2OQG A;  3K1N A;  1IN7 A;  5TJJ A;  3OYM A;  4AIH A;  2WAE A;  1V5F A;  2IGM A;  3V7S A;  1RNL A;  2XAS A;  1Z6R A;  3GTL J;  4E7H A;  4KN7 X;  2AS5 F;  4BNC A;  1U9N A;  4JK1 X;  4V19 K;  4UB8 C;  1X1D A;  4BBR J;  1UG0 A;  2CW7 A;  2F5D A;  5KHD A;  2FOW A;  3CDH A;  4PFP A;  2H8R A;  4WK8 F;  1I1S A;  3CP8 A;  1IRZ A;  2D1V A;  2WY7 Q;  5FB2 A;  2DAO A;  5F1J A;  1BOB A;  1IDZ A;  1K78 B;  2LG4 A;  5E17 F;  1GV5 A;  3CMM A;  1ZQ3 P;  4KT6 A;  3CCS I;  3BT9 A;  2P0W A;  3ZMS A;  4ZTF A;  2DMN A;  2GAU A;  5FLV A;  5GAH J;  2NVT J;  4PJL A;  1O7F A;  4IOC F;  2K9S A;  4PSX A;  4PJN A;  4WXC A;  1ZGW A;  2V1D A;  2FML A;  3HHG A;  1ULY A;  4R8H A;  3OY9 A;  2JMW A;  3ZN0 A;  5M3M J;  4UXN A;  3VYU B;  4N9H A;  1ACI A;  2XC7 A;  1A5J A;  1E0E A;  1R71 A;  5F27 A;  2E71 A;  4DBQ A;  2PMU A;  3CQZ J;  1SC7 A;  3R61 A;  3O8G A;  4PJM A;  4BHB A;  3CES A;  2G7H A;  3CC7 I;  2DOE A;  3U1K A;  1SD7 A;  4UY8 I;  2E34 A;  3KP7 A;  2HI3 A;  5CVU A;  5J4Y A;  3K70 C;  4A3D J;  1F4K A;  4L0Y B;  4BQO A;  2OTL I;  3K4M A;  5J6X A;  1BN5 A;  1WH5 A;  5LRS A;  2L02 A;  4RLF A;  3K7A J;  1RI7 A;  1SFO J;  2QSG X;  1FYM A;  3FZV A;  3ZPL A;  1VTN C;  5IYB J;  1FIP A;  4QPO A;  4LG0 A;  4J00 A;  5ICC A;  1VQ7 I;  2DO7 A;  1K6Y A;  2COM A;  2EA4 A;  2F4O B;  2VKD A;  1DPU A;  1AOY A;  1OYY A;  4II3 A;  4CYD A;  1UHM A;  5IT3 A;  1TLH B;  2QWW A;  2OAZ A;  3G3Z A;  2JWT A;  4FHT A;  4YRV A;  2CQN A;  4M9X A;  3H3V K;  1GHC A;  5IOZ A;  2XHK A;  5IPA A;  3OYD A;  3OYF A;  2KDZ A;  4U88 A;  1MW7 A;  5B66 C;  1W36 C;  5HLI A;  2CW8 A;  1GT0 C;  1JGG A;  4YG2 F;  4WWC A;  2L0K A;  3IWF A;  1FTT A;  2IPQ X;  2VXZ A;  3H5R A;  4KYW A;  5HLG A;  3WTV C;  3R4K A;  3CP2 A;  2WTE A;  2PLY A;  1DP7 P;  1T8I A;  1PUF A;  2O5R A;  4L9T A;  4DJA A;  4F3Q A;  2NS7 A;  1X3U A;  1D0X A;  1REP C;  3C2G A;  4ON0 A;  2RV8 A;  2M2E A;  4DIQ A;  2X1D A;  3LSM A;  2O8K A;  3LSR A;  3G4S I;  5IYD J;  2FRH A;  2GZW A;  5FLX Z;  4HRI A;  4KJZ A;  3BG3 A;  2XAU A;  5FD6 A;  1SD6 A;  2NOG A;  3CCV I;  2HTJ A;  5E79 C;  3AG1 H;  3AL0 B;  3JRB A;  2M9H A;  1KU2 A;  4MTD A;  3REO A;  4AYB A;  3DU6 A;  4XKC A;  1S7E A;  4Y3O A;  2B63 J;  3F6O A;  4XOT A;  4MEY F;  2CU7 A;  1TQI A;  2Z2S B;  5IY5 H;  4EGY A;  3KP5 A;  2BHY A;  2DOA A;  2VI6 A;  1IO2 A;  2XGD A;  1I27 A;  1BIB A;  2R7O A;  1A6I A;  1D1A A;  1BR1 A;  1K78 A;  1B72 B;  2PMZ A;  3TGN A;  2WAQ A;  1ENH A;  5JHU A;  1D8J A;  2E7W A;  4A5N A;  2JJ7 A;  2ESH A;  1LUJ B;  3KET A;  3V8K A;  3OOU A;  1IN5 A;  2BVM A;  3BTL A;  5LEK A;  3IH4 A;  1RUO A;  3M8J A;  2YUS A;  2BBY A;  3RDI A;  4I7H A;  1TQM A;  3GCM A;  2QLZ A;  4MLO A;  4UVB A;  3BJ6 A;  2L7Z A;  2OUM A;  2ZME C;  3BTI A;  1MMG A;  1XX5 A;  2HS5 A;  2VXD A;  3GZN B;  1VI0 A;  1K7A A;  2PI0 A;  2DOF A;  3KFW X;  3J80 Z;  1JE8 A;  1S72 I;  4QSH A;  2A07 F;  2X6O A;  3K70 D;  2DU9 A;  2JZY A;  3TP3 A;  2R5Z B;  2JQ7 A;  2HQR A;  2E1N A;  2JVH A;  2PQ8 A;  1P4A A;  4IRG A;  3I55 I;  3RI4 A;  2WAF A;  5F1R A;  3V8L A;  3KLN A;  3W2A A;  5H6Q A;  3JRG A;  4LB5 A;  3AG2 H;  3A01 B;  2JPC A;  1Q1H A;  1QPM A;  1WRJ A;  5GTH C;  2QBY B;  4W1U A;  4LJZ F;  5F04 A;  3WTT C;  6PAX A;  1ZG5 A;  1FOW A;  3IC7 A;  1GVJ A;  4HQE A;  2DA4 A;  1AA7 A;  5K5R A;  2NAZ A;  1Y0U A;  3OYJ A;  5J4V A;  1W36 D;  4OIO F;  2V1N A;  1Y0N A;  3FXM A;  3LA7 A;  1G2H A;  5DUI A;  3HL2 A;  1FYL A;  1XB4 A;  1GXQ A;  5C3E J;  3QP5 A;  3K4J A;  1MJB A;  2ISY A;  3CD6 I;  2ZSI B;  3V4G A;  1R6R A;  2FE3 A;  5IP9 J;  4P9F A;  2CSO A;  3R0J A;  1NH3 A;  2X0L A;  4I6Z A;  2O03 A;  4B3X A;  1OCO H;  1XGO A;  1S9H A;  3A0B C;  4AID A;  2RRE A;  2R5Y B;  1WVR A;  3CCL I;  2L4A A;  3FXO A;  5KCM A;  1M1E B;  4CCL A;  1JTY A;  1W5C C;  1IN8 A;  1I50 J;  3CCM I;  4BXU A;  5E1W A;  3IRQ A;  3OYI A;  4HLY A;  1YHQ I;  3FKI J;  4XSX F;  1SEU A;  1YS6 A;  3JRF A;  3PUB A;  1JHF A;  3HUG B;  4AWX B;  3B73 A;  5KVR A;  1B59 A;  2W7N A;  1V4R A;  3DKX A;  3G1L A;  4KIB A;  2EZL A;  1BI3 A;  3CF2 A;  1HSJ A;  4DBR A;  2NNN A;  4M6V A;  4PFO A;  5IT9 Z;  4I0B A;  4BXX J;  3BPV A;  4A12 A;  2ZXH A;  2MSY A;  4M74 A;  3J7A O;  3TQN A;  4ZC3 A;  1V54 H;  5L3C A;  2DDB A;  3BCB A;  5JLW A;  2MFZ A;  1MND A;  5DEQ A;  2VKH A;  4PCQ A;  3W2W A;  1QQI A;  1BJA A;  2EV6 A;  2ME6 A;  1AU7 A;  4DYR A;  3DPT A;  1EKE A;  5F6F A;  4ITV A;  2GA1 A;  4D7N A;  5EF6 A;  3OSG A;  5CVV A;  1UST A;  3DKY A;  2RC4 A;  1XPX A;  1T95 A;  2EH3 A;  1Y1W J;  2CRG A;  1I6X A;  2Z99 A;  5LEJ A;  2DMU A;  3RSN A;  4Q4Z F;  4XNF A;  1Z3Y A;  3EDP A;  1MH4 A;  5BMZ A;  2DQR A;  5LHI A;  5BNG A;  5F64 A;  4GRI A;  3OYL A;  1WQ2 A;  2K86 A;  4LIV A;  4XN0 A;  2DTZ A;  1VND A;  4KMU X;  2R7X A;  3BC8 A;  3TDU C;  2L54 A;  2P8T A;  1KZH A;  3MKL A;  3PFI A;  1KU9 A;  4IX7 A;  1EV7 A;  1IC8 A;  3F23 A;  1CF7 B;  4AIK A;  3RPQ A;  2HPI A;  2JUG A;  2EV5 A;  3BR3 A;  2ELJ A;  3P5J A;  2ZME B;  1O7L A;  2DMQ A;  1FJL A;  3M07 A;  2HTS A;  3K6G A;  3ASO H;  3FMR A;  3GZ6 A;  2LH9 A;  2DTR A;  3FIW A;  5D8K B;  3OS0 A;  1OCT C;  1FBQ A;  1HA8 A;  2W24 A;  2R5Z A;  3RKW A;  3JTG A;  1MDM B;  5E8G A;  3DBR B;  5K7Z A;  2EFW A;  3EYY A;  2XGX A;  2W85 A;  3NWS A;  2DLL A;  4RA2 A;  2BEO A;  3DEW A;  3EUA A;  5DUK A;  3WTX C;  4IHY A;  1ONV A;  2QQ8 A;  4NHJ A;  1HW1 A;  3A01 A;  3LSG A;  3M1C A;  1SFK A;  3RJP A;  1WSU A;  2QBY A;  1JT6 A;  5DCM B;  2M30 A;  1ZRE A;  1OQY A;  3NAR A;  3Q9V A;  4BHP A;  5J40 A;  3I4P A;  5E3N A;  1ZGA A;  3FM3 A;  2OTJ I;  2XAF A;  5GP9 A;  3SXY A;  3F0C A;  4E7J A;  3NAU A;  5FRO A;  4ZYH A;  2GIV A;  3SZP A;  4NUB A;  3I0T A;  3QPT A;  1XSV A;  3ZGK A;  1RKW A;  3ONQ A;  5JVG F;  2CGP A;  5D5W B;  2OBP A;  3SEQ A;  2HQN A;  3MFK A;  4V2G A;  5EYR A;  4CH7 A;  1MIJ A;  3VOD A;  2IS2 A;  1W5S A;  2XAJ A;  3HC7 A;  4RM2 A;  3E0J B;  3KZZ A;  1QGP A;  1R22 A;  1F43 A;  4LMY A;  5A2Q K;  2UXN A;  5LRR A;  3VDX A;  3L2Q A;  4M3B A;  3JAM K;  1Z7L A;  2CUE A;  2OPT A;  2YU3 A;  1Z77 A;  1ZAR A;  3G6E I;  1X58 A;  5D5U B;  2L3D A;  4D5C A;  3HZJ A;  3PFY A;  3KCC A;  1WJE A;  1OCC H;  5TIS C;  4A3K J;  1OCR H;  3HUG A;  1RKT A;  2R7S A;  1KYW A;  3SZT A;  2ZXI A;  2KIS A;  4MQ9 F;  1DUX C;  2KIF A;  1IRF A;  2FQ4 A;  3CO7 C;  2FA5 A;  2W25 A;  3WGI A;  3K1M A;  1YW7 A;  2QVO A;  3AG3 H;  3DEU A;  3RYP A;  3LSK A;  1VQP I;  2QZ8 A;  2DPU A;  4AM3 A;  2G9W A;  2QCO A;  2WB1 N;  3ZXS A;  4BGD A;  1NK2 P;  2EA2 A;  3SEZ A;  4LD5 A;  2XSD C;  3PNY A;  2WWY A;  2YX4 A;  5J1R A;  2R7V A;  4E7Z A;  1R7J A;  3GFJ A;  4ENN A;  3FIS A;  1QNT A;  1FWZ A;  3O8H A;  2D5V A;  3E5Q A;  4G8X A;  3CCU I;  3E6M A;  1YW9 A;  2H6B A;  2M34 A;  4B43 A;  1PYV A;  3HKZ A;  5JLX A;  5HDK A;  2VQH A;  5HLT A;  3HSF A;  2EIM H;  3ZCO A;  5FGM A;  4EJU A;  1ETV A;  3JR9 A;  1HKT A;  3JRA A;  1J9I A;  2JA7 J;  4Y7N J;  2VBZ A;  2YSR A;  4M6Y A;  3RZO J;  3S8P A;  4C2M J;  2HVQ A;  4U0V A;  2FU4 A;  4C2T A;  3HHH A;  4KIF A;  2DBB A;  2Y0S N;  3BG5 A;  2LDU A;  2V9K A;  3ECH A;  1CF7 A;  2HOS A;  1T33 A;  3S2W A;  3ZQC A;  5KK1 A;  1KQ9 A;  1GVD A;  2EBI A;  3WGH A;  1OCZ H;  4FT8 A;  4LOC A;  1H9T A;  3O3K A;  1FBS A;  2CO5 A;  2VQL A;  1S29 A;  3SFZ A;  1R49 A;  4XL9 A;  3L1P A;  1XTA A;  2OQR A;  1IUY A;  4M3G A;  4RB2 C;  5C44 J;  1OLT A;  2VPR A;  1KYZ A;  4AIJ A;  3UKG A;  1TQP A;  1MDM A;  3L9F A;  1T6S A;  5KNL A;  3F8F A;  3H0D A;  1VQN I;  1USS A;  1Q1V A;  3CUO A;  2O3F A;  2CQK A;  2TCT A;  3OS1 A;  5ILV A;  3BY6 A;  4QTR A;  3R0A A;  1BM9 A;  1I5Z A;  2X6W A;  1Y8R B;  2ZJ2 A;  3V7R A;  3WHB A;  3OIP A;  2VE9 A;  3PIO F;  4C2U A;  5DCM A;  1D5Y A;  5CPR B;  1YJ9 I;  3MZ8 A;  2X51 A;  2IAI A;  5HOO A;  1XN7 A;  1GXP A;  1B9N A;  1XMX A;  4XLN F;  3CMA I;  1N75 A;  1Z1D A;  4BEH B;  4ZZD A;  3TBI A;  1VQ4 I;  2CYY A;  4U7B A;  1MD0 A;  5ICE A;  1LE8 B;  5IOY A;  1RPW A;  1UFM A;  3JRE A;  1E3P A;  1Z3X A;  4GO1 A;  2XB0 X;  2HOA A;  2HGC A;  1WCM J;  2R4G A;  2EPF A;  2VAS A;  2CMP A;  3EET A;  4R79 A;  1QO0 D;  5DCF A;  2D45 A;  1TL8 A;  2PMZ N;  3J7A Y;  4F7Z A;  2CV0 A;  3HXL A;  4I09 A;  2E2I J;  1ERD A;  3CMY A;  1R4M B;  5M5Y J;  1X1C A;  2VKE A;  1A31 A;  3WG9 A;  4XOP A;  3PNV A;  3IWZ A;  2V6E A;  3S32 A;  3I56 I;  2QM3 A;  4G9Y A;  1JI8 A;  4ZJZ A;  4UVC A;  3ZN1 A;  1G3Y A;  3L2R A;  3ABU A;  2VON A;  2HR3 A;  2A3S A;  4GFB A;  4FE4 A;  3OWT A;  2L5Q A;  2V9V A;  3H9G A;  4KN4 X;  1SFE A;  3B6A A;  1YW8 A;  4GCV A;  4CSW A;  3DTE A;  5D5V B;  2VN2 A;  3ZMT A;  1TNT A;  4A2U A;  4L5J A;  5D5X B;  3HYI A;  4LFU A;  2ZFU A;  3ZMZ A;  3QOP A;  2KJC A;  3KZY A;  5EG0 B;  1JUP A;  2VOP A;  3CME I;  2UV1 A;  5ERI A;  1G8X A;  3MEX A;  3I53 A;  2F6C A;  5JR3 A;  3RZD J;  1ETY A;  2MGQ A;  2M0C A;  1WZ2 A;  1RES A;  4LG0 B;  1SVO A;  1XG1 A;  3L2V A;  4E4H A;  4YIR X;  4EMS A;  5K7F A;  2DK5 A;  3OYH A;  4ENK A;  3DKW A;  2DYR H;  1ZRC A;  1U8B A;  2KP6 A;  2NS8 A;  2A68 F;  4XBF A;  2F5E A;  1J0R A;  2YX7 A;  1P4W A;  1R9T J;  2DFH A;  2ZC2 A;  2ZO4 A;  4QIW N;  1WWX A;  3DBL B;  3U2R A;  3GTP J;  4FE7 A;  1X1A A;  2BW3 B;  3MZY A;  3IAM 2;  3WTW C;  4KDP A;  1HQC A;  2IT0 A;  3GTJ J;  4IRI A;  5LBQ A;  5HDG A;  1UHW A;  1XCV A;  1EH7 A;  5DS9 A;  2ESN A;  3R6S A;  3BCA A;  3FX3 A;  2R7Q A;  4UV8 A;  5B1A H;  3JSO A;  3W6V A;  2ZJQ F;  4GDF A;  2ZBK A;  5CVI A;  4BY1 J;  3AL0 C;  4GGG A;  4EJW A;  1GLN A;  3VYR B;  2XSJ C;  3E5X A;  3HDD A;  3S1M J;  5BS6 A;  1FX7 A;  2UXX A;  2ZFW A;  3HPG A;  1UZC A;  4DGW B;  1F1Z A;  3HBL A;  4HF0 A;  1QBJ A;  2IS6 A;  2HXO A;  2P5V A;  3HRM A;  1K61 A;  1D0Y A;  4JYK A;  2PJR B;  3QRF F;  3GXO A;  3GFM A;  2XVC A;  2OC6 A;  4YEJ A;  2AQE A;  2BE5 F;  3K4N A;  2EB7 A;  4NQW B;  4UUT A;  2P81 A;  4I99 C;  3CUQ B;  4BEH A;  2AXL A;  2L2O A;  1HW5 A;  2RKH A;  2DA5 A;  5AIP A;  2C6Y A;  2STT A;  2PG4 A;  5E18 F;  1K4T A;  4ESJ A;  1D3Y A;  2X85 A;  1LE8 A;  2EQR A;  2NOJ B;  4LGW A;  2RQQ A;  3SQN A;  4MGR A;  1FIA A;  2ZB9 A;  3PQJ A;  1A36 A;  3DV8 A;  4ANJ A;  2XPV A;  2Y31 A;  3R60 A;  4MTE A;  4XRM A;  4M71 A;  4NC6 A;  2WY8 Q;  2A5Y B;  5EEG A;  4UUV A;  2NVX J;  1XC5 A;  5E3M A;  3EYI A;  4UUS A;  4S05 A;  5M5X J;  2M7B A;  4DYQ A;  4E7I A;  3F9K A;  1D0Z A;  3DQV C;  2A6T A;  5B1B H;  4A3L J;  1Y1V J;  4EM0 B;  4F55 A;  1WH7 A;  4EJO A;  3F8C A;  2K85 A;  4G6D A;  5E3L A;  4BDY A;  3QU6 A;  3T5X A;  1RR8 C;  2R7D A;  3S1R J;  3C2B A;  4CUG A;  4A3C J;  2WB1 A;  3S3N A;  3BZK A;  3LSI A;  1S8N A;  3K4C A;  4N0B A;  5CVR A;  4XKW A;  5EG0 A;  1TW3 A;  1FP1 D;  3BG6 A;  2DYS H;  2XKO A;  2F48 A;  2XKP A;  4D7M A;  5DM7 F;  3K4K A;  1MMD A;  2ECB A;  2R93 J;  3T1B A;  1AKH A;  4EJT A;  3CJQ B;  3WE3 A;  4M3E A;  4G7O F;  3BP8 A;  3WU2 C;  5EEA A;  1Z21 A;  5CQG A;  2LBF B;  3CJT B;  3GEZ A;  2EFO A;  2DT6 A;  2XRN A;  3BOQ A;  4EGZ A;  2Y0S A;  3CCQ I;  4MO7 A;  1R5I D;  3H0G J;  1FT9 A;  4QWQ A;  1ZLJ A;  4EAT A;  4I0A A;  1KON A;  1XSX A;  2KMU A;  3HJE A;  1W7P B;  3DLA A;  1OIS A;  2DN0 A;  5C4J J;  2VJ5 A;  4RBO A;  1ZKG A;  5FLX K;  3MKW B;  2IA0 A;  2HOT A;  1L3L A;  4YEL A;  3L2C A;  3KX2 A;  2VQC A;  1U5T B;  1ZTR A;  2BW3 A;  3GYH X;  1VFC A;  2H6C A;  2R7W A;  2CUJ A;  2V1X A;  3E6D A;  5HVQ C;  2XGE A;  5FFZ A;  1O57 A;  2X9D A;  1Y39 A;  1IN6 A;  1QVT A;  3OV8 A;  3OYC A;  3AG4 H;  2P7C B;  3FKJ A;  2OJE D;  2MH2 A;  1ZH5 A;  4IVN A;  4IOA F;  2JSP A;  5ICF A;  1YIT I;  1A35 A;  2IXS A;  1H88 C;  1BOA A;  2K4B A;  2ZNY A;  1W1W E;  2K5C A;  2K9Q A;  4Y4R A;  3PIP F;  4IEJ A;  5CKT A;  2V6C A;  2E2H J;  3OYN A;  1BW5 A;  5TRD A;  1WFX A;  4JBA A;  3S3M A;  4L5E A;  1S6L A;  3FXJ A;  2K27 A;  1NG6 A;  4HA8 A;  1UAA A;  4L5I A;  2UWM A;  1VZ0 A;  4O5V A;  3IKV A;  5H6R A;  5LHH A;  3L2U A;  1E2X A;  4XLH A;  2OZ6 A;  4LLN A;  2PJR A;  4D1Q A;  4M3D A;  2RN7 A;  3HGY A;  2YR2 A;  2W57 A;  4HX8 A;  1APL C;  4RGS A;  5D6E A;  3KYC B;  2QQB A;  4NQW A;  4AD9 A;  3KLO A;  4RGU A;  3VEP A;  4BU2 A;  3CUQ A;  3BR6 A;  3T0Y A;  1RUN A;  2GXG A;  3J80 K;  1OCP A;  2KHM A;  3I71 A;  4HQM A;  4GYI A;  5GPA A;  3U9G A;  2N8G A;  5JFR A;  1Z7U A;  2K9N A;  3SZG A;  5FRM A;  3M8E A;  1LB2 A;  2HNH A;  4N4N B;  1XS9 A;  4CCJ A;  4HNV A;  4BAY A;  1E17 A;  3O2P E;  4IHT A;  1FTZ A;  1MSF C;  3L09 A;  1ZG1 A;  2CUZ A;  4XLE A;  4DNC A;  3ZQH A;  5FFX A;  3HKZ N;  3G1O A;  3I4N J;  3MVP A;  3LWF A;  2ZXJ A;  1YIO A;  4XRF A;  1VQK I;  1IRG A;  3F8M A;  2R7R A;  1H8A C;  2FXA A;  3QYF A;  4FQG A;  3I59 B;  2LKX A;  2IW5 A;  1GV2 A;  3WOD F;  3ECO A;  1LJ9 A;  3WE2 A;  3CDI A;  3H36 A;  2HU9 A;  3K4B A;  4IQ4 A;  5LLQ A;  2O9L A;  2R92 J;  1X3W B;  1XSD A;  3FK6 A;  1VQO I;  1XGM A;  4LK1 F;  3DP7 A;  1IRX A;  1XDS A;  4IJA A;  4EEF G;  5AIQ A;  3S14 J;  2Y69 H;  2IBD A;  2L9V A;  2EFP A;  3ZMV A;  5D8L B;  3ZOB A;  1WGX A;  2LSO A;  2W1O A;  4XMY A;  4XRS G;  5F0H A;  2RAE A;  3P9C A;  4HDU A;  4BDZ A;  2KL4 A;  1UHS A;  2KPM A;  4GXO A;  1QRY A;  1JKR C;  2VKV A;  1XGN A;  3HOW J;  3CJR B;  3LSJ A;  1FMV A;  2LBF A;  3PL8 A;  4AU7 A;  4FAS D;  5L3E A;  3HOX J;  1X1B A;  1NG7 A;  4L0Z B;  2P5K A;  4RB1 A;  5FD5 A;  4FCY A;  1MKM A;  4B47 A;  2GLO A;  2LP0 A;  3PNT A;  4HLX A;  1W7P A;  1ZAO A;  4CGZ A;  3WTS C;  3H5A A;  1O3R A;  4FX4 A;  2ACJ A;  4RM3 A;  1QZZ A;  1BC7 C;  3H9J A;  3Q0V A;  1SMY F;  3LA3 A;  5IT9 K;  3LL7 A;  1U5T A;  5E3O A;  1FOY A;  2GM4 A;  2DMP A;  5DM6 F;  1DDN A;  1UJ8 A;  1TT5 B;  4CZZ A;  1IV8 A;  2K9M A;  2UZK A;  1EH8 A;  2ELH A;  4Z6Y A;  2XAG A;  4X6A J;  3HIF A;  4G7Z F;  3BQY A;  2BY0 A;  2VJ4 A;  1GUU A;  3J81 Z;  1D1C A;  3F8B A;  3HM5 A;  2X6X A;  3ZQG A;  1V5E A;  2FQ3 A;  3I3L A;  2A6H F;  1YIJ I;  3OS2 A;  4XK4 A;  4B09 A;  2L7M P;  3S3O A;  2AXT C;  2BYV E;  1XCB A;  1DPR A;  4RB0 A;  3TKY A;  2HYF A;  2KFD A;  3PJR A;  3DTI A;  5FO5 A;  4YIF A;  3U1D A;  3VWB A;  3GFI A;  3F3X A;  2GOX B;  4HZF A;  4HST A;  1EJ9 A;  3MMY B;  4BQA A;  3IAS 2;  2Q0O A;  2KIU A;  5GAE J;  1RR7 A;  4E70 A;  5E1X A;  1HF0 A;  1V5G A;  1R5H A;  2XPW A;  2A6E F;  1TC3 C;  3PO2 J;  1UMQ A;  1DGR M;  1YI2 I;  1OMI A;  2ME0 A;  4OIP F;  1CQT A;  1MSE C;  1YLF A;  1E3O C;  3E6C C;  1MJ9 A;  2DFF A;  2OV7 A;  5CLS A;  3A4C A;  3TL4 X;  1RRJ A;  4CA0 A;  2JRT A;  2PMH A;  3BZC A;  1I39 A;  3U21 A;  4N4O B;  3QOD A;  2KZG A;  3ASN H;  3JSP A;  1MNE A;  2FMY A;  3QPS A;  4OIR F;  4RAG A;  3WTY C;  1JTX A;  5FRN A;  2HPM A;  1ON1 A;  3IRR A;  4XN3 A;  2EZI A;  2RNJ A;  3SJM A;  3HOY J;  2H1K A;  3I59 A;  1N78 A;  2CFX A;  1P4X A;  1NTC A;  2F4I A;  3P9K A;  4HDV A;  4PDK A;  3GFL A;  1MZB A;  2LRE A;  3F6V A;  4LLL A;  5L3D A;  2KZV A;  1FLI A;  4RAY A;  2RGV A;  1ETO A;  2HYJ A;  2JA8 J;  5DTD A;  2K3F A;  3SYT A;  2QSH X;  2HWV A;  2XAH A;  1J7K A;  2X1E A;  2XV4 S;  2DT5 A;  2R7F A;  1OYI A;  1QPI A;  4BJT A;  3ERE D;  2K3P A;  2B9S A;  4OMZ A;  1LNW A;  4PK4 A;  3RPU A;  4XID A;  2NVY J;  3EUH A;  3ISP A;  4D0P A;  1U8R A;  1HKQ A;  3UNG C;  1QHG A;  4AVP A;  4P1W A;  3G71 I;  1TT0 A;  2IRF G;  3A03 A;  4BE0 A;  4A0Y A;  4RGR A;  5K7H A;  4E7K A;  1O3T A;  4I01 A;  1WHU A;  2P6S A;  3GTM J;  1R58 A;  1WJ5 A;  1POG A;  4E7S A;  3GME A;  3BJA A;  2CH0 A;  3DU5 A;  3M8F A;  5LD2 C;  4ZTJ A;  2DI3 A;  3BTC A;  2CW0 F;  4OOI A;  1TWC J;  4PSW A;  3TDZ C;  1TW2 A;  4MQV A;  3OOP A;  1YE9 A;  2L9S A;  2M7A A;  3KEO A;  2P5L C;  4IHS A;  2O0Y A;  3ABM H;  4Q48 A;  1LFB A;  2K4J A;  4I02 A;  5AON A;  3BR5 A;  2VB6 A;  2JRM A;  2FNA A;  3IH3 A;  2QEX I;  2HEO A;  2PEX A;  4HYE A;  2LVS A;  4C3H J;  3KZI C;  5HS9 A;  2COB A;  5J1U A;  4CCK A;  3N4M A;  4K2E A;  3TOA A;  2DOD A;  2VBY A;  2EJR A;  5JHF A;  4XIC A;  1NK3 P;  4G7H F;  1IXS B;  5CVJ A;  1P7I A;  3ZRG A;  2K40 A;  4A3E J;  1HC8 A;  2R0Q C;  1X1P A;  2H09 A;  2LK2 A;  4XKB A;  2HKO A;  2FNP A;  1MNM C;  1OJL A;  4IF4 A;  2R7Z J;  1MMA A;  1YRN B;  2E36 A;  4Y52 J;  1F5T A;  4YII A;  3AAF A;  4EQQ A;  1WJA A;  2HDW A;  3T8T A;  4JX4 A;  3OIQ A;  4BE2 A;  2BV6 A;  2QKM B;  4KIC A;  3FWE A;  3PQK A;  4W97 A;  5TGT A;  2E5Z A;  3LFU A;  1JUS A;  2JUC A;  3HOU J;  2HVS A;  1FSE A;  4AVZ A;  3ZQL A;  2L9R A;  3Q3S A;  1S3J A;  3LAJ A;  3CO6 C;  2E7X A;  4CYC B;  5L3F A;  4BXF A;  2DA2 A;  4IXA A;  2LR8 A;  3M9A A;  1PUE E;  2ADU A;  2OA4 A;  4I2O A;  1YG2 A;  4OWR B;  4HAM A;  1NHA A;  2FX0 A;  1MBJ A;  1MBK A;  3OL3 A;  1W0T A;  3JTH A;  3FMS A;  4MFD A;  2MAB A;  5BQT A;  2QKL B;  1IZ1 A;  3DBH B;  2XRO A;  5ILU A;  2KJB A;  3HG9 A;  3K4L A;  1JGS A;  3QYB A;  4A3F J;  1TWF J;  1Z05 A;  3F22 A;  2F4M B;  1PP8 F;  2YPR A;  3GF2 A;  2OU2 A;  1BL0 A;  2OD5 A;  3C1D A;  3LOC A;  5K1Y A;  2AO9 A;  2L01 A;  4NB5 A;  5HDN A;  4XON A;  1EF4 A;  3BR2 A;  2VBW A;  4AC0 A;  3SDB A;  4OU0 A;  3ABT A;  4RMN A;  2XUB A;  4S04 A;  4LG3 A;  3LSH A;  4I98 B;  5B5E C;  2VJJ A;  3W3C A;  2UUZ A;  4MIM A;  2G7U A;  3CUQ C;  3Q9S A;  2YU9 J;  1BBY A;  3KEQ A;  4IL6 C;  4P5O A;  1QZY A;  4EM1 A;  5EZG A;  2JVG A;  1YQA A;  1ZG3 A;  2ID6 A;  2PN6 A;  1WJC A;  2RDP A;  4MNU A;  1JJ6 C;  1MH3 A;  3WG7 H;  2MD0 A;  3WHC A;  2VLA A;  2IP2 A;  3GTG J;  3DTK A;  2YS9 A;  4P55 A;  4XLP F;  3CCR I;  4L18 B;  2DDA A;  5EJC A;  4PJ0 C;  2TDX A;  4Y13 A;  4J19 A;  1FC3 A;  1IJW C;  1WI9 A;  1F36 A;  3C2H A;  4NDL A;  3TW6 A;  2M3A A;  2OF7 A;  1G3W A;  3QAH A;  4A5M A;  2IS4 A;  5CQE A;  3Q0W A;  4B8X A;  4KNY A;  1YTY A;  3CC4 I;  2VT2 A;  3K69 A;  4ENM A;  1MBF A;  4IPA A;  2Y30 A;  4UUS B;  1A04 A;  3LQQ A;  1LFU P;  3TO9 A;  2BGC A;  5HNF A;  3OR2 C;  3HTU A;  2IS1 A;  2W4S A;  3BPX A;  1OFC X;  4NBQ A;  2HZD A;  2DA3 A;  4FX0 A;  1A6Q A;  1ZN2 A;  3VOE A;  2M8G X;  5GAG J;  2XAQ A;  2VOD A;  1EA3 A;  1SD4 A;  4KIG A;  2HZT A;  2HFH A;  3M1E A;  3X2Q H;  2BY2 A;  3Q5F A;  1S7A A;  4WF2 A;  1S7O A;  2H27 A;  4G6Q A;  3ESW B;  4HNU A;  1AKH B;  4UB6 C;  4IHW A;  1YRN A;  1SAN A;  3MCZ A;  3TP0 A;  1G3T A;  1H9G A;  4HNT A;  2HOE A;  2QQA A;  4YFK F;  1Y56 A;  1JKO C;  1LEB A;  5FKM A;  3OR1 C;  4OAY A;  2VL8 A;  4MEX F;  3HSR A;  4U87 A;  1G3S A;  2RVC A;  1D1B A;  3BLY A;  4CYC A;  4ZDL A;  3D0S A;  2GOM A;  2CS3 A;  2JPB A;  2KRC A;  5FJ8 J;  3H1C A;  1HDP A;  5J47 A;  1VQ8 I;  1U5T C;  2EIK H;  3RCO A;  4C9Y A;  1T2K A;  3T8R A;  4NC7 A;  4PGH A;  1K79 A;  2Z3Y A;  3RYR A;  1ZYR F;  1WKM A;  3IL2 A;  3DLL F;  1SAX A;  1YX5 A;  1J5Y A;  3GLX A;  3GBG A;  2BVL A;  2DMT A;  2LC2 A;  1FNN A;  3MD2 A;  2OCC H;  4CCO A;  1IXC A;  3FXU A;  3KEY A;  4L9V A;  3M4O J;  1X2N A;  4WXD A;  1T98 A;  3IKT A;  1ZHF A;  3HB9 A;  1SVM A;  2CV2 A;  1AWC A;  5M3F J;  4MHG A;  5D6F A;  1BI1 A;  1RC9 A;  1JKP C;  4IO9 F;  4XM3 A;  4U7D A;  4XSZ F;  1I3Q J;  1T08 B;  2X1C A;  3BR1 A;  3H5N A;  4KIT B;  5GPC A;  3LAP A;  3OL4 A;  3TED A;  1C0W A;  2CG4 A;  2BZT A;  1LFP A;  4HV6 A;  3PSF A;  5IYC J;  3PO3 J;  2KIM A;  2VJI A;  3KE2 A;  3A1Y A;  1BR2 A;  4BH9 A;  2NYX A;  4ETS A;  4ZDP A;  1ZK8 A;  3HOT A;  3MN2 A;  4HG2 A;  2KKO A;  1E3H A;  4ZYE A;  2W84 A;  1BI2 A;  1ZRF A;  1TTY A;  2EV0 A;  5IP6 A;  4DZP A;  2F5F A;  3H9Q A;  2DJN A;  3BG7 A;  3K9T A;  2F2E A;  1Z0X A;  1U3E M;  3TO6 A;  2M1B A;  3IHU A;  1ON2 A;  1VQ5 I;  2OZU A;  2IJL A;  2MH9 A;  1UCR A;  1TWH J;  2VE8 A;  4A69 C;  5FKL A;  2GBY A;  3OMY A;  3W2V A;  1G6N A;  5FLM J;  1IGN A;  4XR6 A;  2M0M A;  4EM2 A;  1OKR A;  4G94 A;  2H94 A;  1XMK A;  4P96 A;  1T56 A;  2NS0 A;  3CLO A;  2QF7 A;  4QLC U;  3IUO A;  4OIN F;  4XLA A;  1R36 A;  4A6E A;  1U2W A;  4BYY A;  2M87 A;  1N25 A;  1KU3 A;  1XMA A;  4PUS A;  4C3J J;  2ID3 A;  2MLK A;  1G59 A;  3GTQ J;  2Z33 A;  1BC8 C;  2I5U A;  2XF6 A;  3H92 A;  3K0L A;  3O6B B;  4HBL A;  1R1V A;  3CZ6 A;  3NRV A;  1BR4 A;  1DGW Y;  1HLV A;  3AKZ A;  2JK3 A;  1GDT A;  2L7F P;  1TP4 A;  1LDK B;  2LY2 A;  2Q8K A;  2GQQ A;  3EUH C;  3P7N A;  4H0E A;  4P9U A;  4M3F A;  3ZR8 X;  2ZNZ A;  3KP6 A;  4XLC A;  2DFE A;  2Z1D A;  3I54 A;  2BOL A;  1W7P D;  3GLL A;  3MAJ A;  4BKX A;  1CGP A;  1OR7 A;  2VIX A;  3W6K B;  2LYC A;  1PJR A;  3OYA A;  4JQF A;  2LY9 A;  3C3W A;  3I64 A;  2LD5 A;  1QZE A;  1TNS A;  3NQO A;  3QYE A;  4XLF A;  4DW6 A;  4XQF A;  1U78 A;  1HBX G;  2PJP A;  1O3Q A;  3S93 A;  2EK5 A;  2R3S A;  4U0Y A;  3JRI A;  1B6A A;  4A3I J;  1X4O A;  3CDL A;  3F72 A;  4M72 A;  4CHU A;  2IGN A;  2RQP A;  3S2D J;  2QQ9 A;  4J01 A;  3JW4 A;  4UV9 A;  1IV6 A;  3F8N A;  2A5W A;  3DXJ F;  3L7W A;  1FY7 A;  5GAD J;  3V42 A;  3FM5 A;  2V1U A;  1ETX A;  4HF2 A;  2MW8 A;  1HST A;  4ABZ A;  4M9Z A;  4II2 A;  1J75 A;  1TBX A;  1UG2 A;  1KA8 A;  2K02 A;  3HGG A;  4CCN A;  5D4R A;  2DFI A;  2E1M B;  1BJZ A;  4E7L A;  4KFC A;  4ESF A;  4HEA 2;  2HDC A;  2V79 A;  1ETQ A;  1R00 A;  4C3I J;  1SAU A;  2A69 F;  3E7L A;  1WJB A;  1XD7 A;  3KP4 A;  2QSF X;  1MMN A;  3N05 A;  4BS9 A;  3BWG A;  4R1H A;  1IN4 A;  5KAI C;  3Q0U A;  3RQ4 A;  3D5S C;  1Y6I A;  3GUD A;  3QPH A;  4FET A;  4Y17 A;  3SFI A;  4D5F A;  1XGS A;  2VOO A;  3KYL A;  5F0F A;  2ZXW H;  2E1O A;  4Y15 A;  3OYE A;  2LKS A;  1J2X A;  3WGG A;  1YFH A;  3V8J A;  1LPQ A;  2Y0M A;  3VYS B;  1R5G A;  4ZYD A;  4BBS J;  2VQG A;  4IHV A;  2NVU B;  4CCM A;  3IV5 A;  2W48 A;  2Z16 A;  2K7L A;  3FXQ A;  3RKX A;  2QUF A;  1H0M A;  3LFK A;  1DU6 A;  1QHH D;  3HSE A;  1ZR2 A;  1FSH A;  5CJ9 A;  4GYG A;  1K6O A;  4A3M J;  1JHH A;  3TOB A;  3LNQ A;  1LDD A;  1ORK A;  2BY3 A;  2DK8 A;  4Q47 A;  4NNJ A;  1MBE A;  1X19 A;  2JA2 A;  5HS8 A;  4PJJ A;  5H20 A;  1IG7 A;  2QA4 I;  2BHZ A;  5BPD A;  4UHT A;  3S15 J;  2JSC A;  3FDY A;  2O8X A;  3D5L A;  1ZRD A;  3RPU D;  2FBI A;  4Q5S F;  3MZH A;  1KU7 A;  3K2A A;  2GA2 A;  1RIO H;  2X6Y A;  1BW6 A;  3N97 A;  1D5V A;  3SHF A;  5E1Z B;  3M3Y J;  2HYG D;  1B8I B;  2E19 A;  4B3A A;  5L3G A;  1U9O A;  2KRH A;  3CCJ I;  3CCY A;  4BJ6 C;  4TV7 A;  4KT5 C;  3LSP A;  2XDV A;  3G2B A;  3HRT A;  3CJN A;  2KLO A;  5H2F C;  1VQL I;  1X3Z B;  2FD5 A;  3FXR A;  1T0F C;  3ROU A;  2P4W A;  2DT7 B;  1ZLK A;  3QP6 A;  3J81 K;  1H89 C;  4OMY A;  4NC8 A;  2I8D A;  4F92 B;  3KIO A;  5FKO A;  2X48 A;  4I76 A;  2L9N A;  5LHG A;  4YFN F;  4RAZ A;  2IGO A;  1IXR C;  1ETW A;  3DCF A;  3ZMD A;  1B1B A;  4OAZ A;  3V7C A;  2EFN A;  1TWG J;  1BA5 A;  3ABK H;  3ULQ B;  2NVQ J;  2ICW G;  5F0C A;  2EZK A;  2H8W A;  1LVA A;  1OYW A;  4BUP A;  3GTK J;  2Q2E B;  2RNG A;  4EV0 A;  4E6K G;  5L3B A;  2LFB A;  5ED4 A;  4RLQ A;  4HX4 A;  3RIR A;  1BI0 A;  2NNY A;  3VSK A;  5EGO B;  3QWL A;  5LGT A;  1V3F A;  3QOE A;  4CXF A;  2ZCW A;  3E5U A;  2CQQ A;  4RDU A;  3I4M J;  1MBH A;  3H3U A;  5LGU A;  4UVA A;  2FBH A;  4IHX A;  3HTS B;  1ODD A;  3HOZ J;  2ZKZ A;  4WX9 A;  3DPU A;  4G6T B;  2XB5 A;  1Z91 A;  2M4K A;  2JA5 J;  2D1H A;  1STZ A;  2MD5 A;  3VB2 A;  4S0H B;  1W0U A;  2ECC A;  5J8C A;  4X0G A;  1WJF A;  4X1E A;  3FBI B;  3HRU A;  4IKF A;  1D8K A;  1P92 A;  4CO8 A;  3CF5 F;  3GWZ A;  3ZP5 A;  3HOS A;  3DEE A;  3HEF A;  3VFZ A;  2CV1 A;  4L9N A;  1K83 J;  1P6R A;  2LMD A;  3H3Z A;  2CJJ A;  2Z9O A;  3ZQF A;  4RAF A;  1R1U A;  2VPL A;  4O3M A;  5EEH A;  3VPR A;  2FUG 2;  1FEX A;  2B0L A;  2LNB A;  3PM1 A;  3E6B A;  3L2W A;  3BTJ A;  3S17 J;  2BXZ A;  2D2W A;  2LOO A;  3IH2 A;  3VSL A;  1Y8Q B;  2J5P A;  1RZ4 A;  2NXN B;  5HLH A;  3HOV J;  2FEZ A;  2LKP A;  2J5O A;  4HPQ A;  1QU3 A;  1SFX A;  1YYV A;  1S5L C;  4M6X A;  3DF8 A;  1U6G A;  1T39 A;  1YJN I;  1B72 A;  5HS7 A;  2XF7 A;  3C7J A;  1L0O C;  4A0X A;  3BZ6 A;  1LVK A;  3BG9 A;  2AQF A;  1ETK A;  2LRD A;  2HQA A;  2ETH A;  4EJV A;  3FF5 A;  5FKN A;  3OSF A;  4UNO A;  3FHN A;  3B6C A;  4CDG A;  1TZL A;  1JKQ C;  1PDN C;  4ZDO A;  2MG4 A;  4ESB A;  1YJW I;  4AUX A;  5CYV A;  5E20 A;  2XRL A;  4A3J J;  4KUM A;  3TW7 A;  4A6D A;  2GIZ A;  4BQN A;  1AHD P;  2AHQ A;  2DA7 A;  3OYG A;  5C4X J;  1B8I A;  1LDJ A;  1R23 A;  2Y9Z A;  2P7V B;  4D9J A;  3F21 A;  3MQ0 A;  2Y75 A;  1ZR4 A;  1X2M A;  2GWR A;  2O6G E;  2LF7 A;  3E1S A;  3HPH A;  5EZH A;  4BL0 B;  1YO5 C;  1EH6 A;  9ANT A;  4G12 A;  3ZMU A;  5GTI C;  2IA1 A;  1HXD A;  3NEU A;  3E3V A;  3TO7 A;  4IQJ A;  1FOK A;  1YS7 A;  1K4S A;  2XF5 A;  1I3A A;  5ICG A;  2KT0 A;  5B3S H;  1IAW A;  2E2J J;  3CC2 I;  3BDD A;  1LKX A;  5DV5 A;  2IEK A;  3E97 A;  2L4M A;  3IP4 B;  1WJD A;  5E8I A;  1BIA A;  4ZH4 F;  3W6J B;  3M7G A;  5K5O A;  3OYK A;  1X4P A;  2JA6 J;  1B4A A;  2M4G A;  4JX5 A;  2A05 A;  2HQ5 A;  3RTR A;  2EWN A;  2EIL H;  1R1T A;  2HXI A;  2Q2E A;  2CUF A;  3DWL E;  4WXH A;  3QPL A;  2DPD A;  3I58 A;  1IF1 A;  4ZZL A;  4DOZ A;  4IRH A;  3FMQ A;  1OPC A;  5EGO A;  3WU1 B;  3EPZ A;  2HVR A;  1YOV B;  2FBK A;  5BOX A;  1WI3 A;  3K10 A;  4LIU A;  3D5R C;  3LMM A;  3UR3 C;  1KGS A;  3EUK L;  4LLG F;  3BQZ A;  3MWM A;  2HDD A;  1FZP B;  2PBI A;  4DQ2 A;  3LQR A;  5BPI A;  4BE1 A;  3WU0 A;  5KAF C;  2R5Y A;  4A0Z A;  3FK7 A;  5M5W J;  3TMO A;  3ELK A;  1I6H J;  2QEN A;  3JRC A;  3AFH A;  2V4J C;  5DDG A;  1JUM A;  3BRO A;  1OR7 C;  1KQ0 A;  1SD5 A;  3GO5 A;  2DA6 A;  4DZJ A;  3S16 J;  2MA3 A;  5DD4 A;  3G1M A;  2EFQ A;  1G4D A;  3FXL A;  4XOR A;  4LB6 B;  2WC2 A;  3GW2 A;  3L00 A;  5ILS A;  3FXK A;  1MMS A;  2EIN H;  2LF8 A;  3J7Y J;  5HOD A;  1HOM A;  1RET A;  1WPK A;  5A2Q Z;  3JAM Z;  3DPL C;  2DJI A;  2KDO A;  3CLQ A;  3I5U A;  4HW0 A;  1Z9C A;  2H1L A;  5DD8 A;  1J09 A;  1TWA J;  2F5C A;  2PX9 A;  4O6J A;  1W5T A;  5J1Y A;  4LIT A;  5HNH A;  3K2Z A;  1J59 A;  3OIO A;  2B7E A;  2EZH A;  3ZQQ A;  1Z67 A;  1O3S A;  3WTZ A;  2GXA A;  2OCE A;  3A0H C;  4B48 A;  1XDU A;  2BY1 A;  2Z5U A;  3RKY A;  1LQ1 A;  4JP0 A;  1VQM I;  2R7U A;  3ZQI A; 
#chains in the Genus database with same CATH homology
 4BU2 A;  2VJI A;  3VYT B;  3OYL A;  3A1Y A;  4LIV A;  4XN0 A;  1BR2 A;  3MKY B;  2R7X A;  4ZDP A;  1P9Q C;  3BC8 A;  4F52 A;  3HOT A;  2KHM A;  4HG2 A;  4IX7 A;  2MC4 A;  3SZG A;  1ZEL A;  5FRM A;  2HNH A;  4N4N B;  4CCJ A;  2HPI A;  2JUG A;  5LFA A;  3H9Q A;  2ELJ A;  2CUZ A;  4XLE A;  3BG7 A;  3K6G A;  2E60 A;  2LH9 A;  3OS0 A;  2R7R A;  1UEL B;  2DCE A;  1HA8 A;  3PSI A;  3QYF A;  2F5V A;  2Q1Z B;  3OMY A;  3W2V A;  2CFO A;  3NWS A;  2M0M A;  2W00 A;  3K4B A;  2HU9 A;  3EUA A;  4IQ4 A;  4XR6 A;  4F93 B;  3IUO A;  4XLA A;  2V7F A;  1YX3 A;  3LSG A;  3M1C A;  1SFK A;  1IRX A;  4PUS A;  2R7T A;  2WA0 A;  1G59 A;  3A2K A;  4XKV A;  2W1O A;  4XMY A;  4HSR A;  2XF6 A;  2WBM A;  2KQR A;  4E7J A;  1DP3 A;  4BDZ A;  2KL4 A;  5FRO A;  3CZ6 A;  3NWT A;  1BR4 A;  1DGW Y;  2KPM A;  4NUB A;  3AKZ A;  3ZGK A;  1LDK B;  2LY2 A;  3ONQ A;  3CJR B;  3H35 A;  3EUH C;  1FMV A;  2LBF A;  3PL8 A;  4AU7 A;  4FAS D;  3SEQ A;  1X1B A;  1N77 A;  3ZR8 X;  1NG7 A;  2E5N A;  4XLC A;  4CH7 A;  2Z1D A;  2BOL A;  2IS2 A;  4B47 A;  2VIX A;  4ZYA A;  3HC7 A;  3PNT A;  4RM2 A;  4B44 A;  4IZZ A;  2W82 A;  2LYC A;  3E0J B;  1PJR A;  3OYA A;  4JQF A;  2DXI A;  4XLF A;  3QYE A;  3VDX A;  3H5A A;  1U0J A;  4XQF A;  4CZC A;  3L2Q A;  1Z7L A;  4RM3 A;  2ZSH B;  3S93 A;  3H9J A;  3LL7 A;  4F91 B;  4BQQ A;  1X4O A;  3PFY A;  2IGN A;  1WJE A;  2K9M A;  2V26 A;  4J01 A;  2R7S A;  2ZXI A;  2A5W A;  3FBN B;  3V42 A;  2IGK A;  2L7K A;  2VJ4 A;  1D1C A;  3MKZ A;  2K9L A;  2MYS A;  1FMW A;  2X6X A;  1V5E A;  3I3L A;  3LSK A;  4II2 A;  3OS2 A;  4H4K C;  4BJ5 C;  3S3O A;  4CCN A;  3ZXS A;  4BGD A;  3SEZ A;  2E1M B;  4E7L A;  3PJR A;  4KIS A;  3DTI A;  3PNY A;  4HEA 2;  2E1M C;  2R7V A;  4E7Z A;  3VWB A;  2GOX B;  1SAU A;  3OYB A;  4Y33 A;  4HST A;  1WJB A;  1DQU A;  4JOM A;  1MMN A;  3MMY B;  4B43 A;  3N05 A;  1PYV A;  3HKZ A;  3IAS 2;  4C30 A;  2VQH A;  4BS9 A;  5HLT A;  3ZCO A;  4BAC A;  3RQ4 A;  3D5S C;  1Y6I A;  4FET A;  2WAD A;  1V5G A;  2LY1 A;  1DGR M;  3KYL A;  3S8P A;  2HVQ A;  4C2T A;  3OYE A;  3I9V 2;  2V9K A;  4QPQ A;  2OV7 A;  3A4C A;  3TL4 X;  3VYS B;  4CA0 A;  3U21 A;  2VQG A;  4N4O B;  3QOD A;  4CCM A;  1MNE A;  2VQL A;  3OYM A;  2Z16 A;  2WAE A;  1V5F A;  4XL9 A;  2IGM A;  1QHH D;  5FRN A;  2HPM A;  4XN3 A;  4E7H A;  1OLT A;  1N78 A;  5KNL A;  3H0D A;  1X1D A;  1UG0 A;  2CW7 A;  2F4I A;  5KHD A;  3OS1 A;  4PFP A;  4NNJ A;  3CP8 A;  1X19 A;  2X6W A;  2JA2 A;  2WY7 Q;  4PJJ A;  3OIP A;  2LRE A;  4C2U A;  2KZV A;  5CPR B;  1BOB A;  2X51 A;  2LG4 A;  5HOO A;  3FDY A;  3CMM A;  3SYT A;  4KT6 A;  3D5L A;  2P0W A;  4ZTF A;  2X1E A;  1N75 A;  3RPU D;  4BEH B;  4PJL A;  3TBI A;  4BJT A;  2K3P A;  4PSX A;  4U7B A;  4PK4 A;  4PJN A;  2X6Y A;  1Z3X A;  2R4G A;  3UNG C;  1QHG A;  2VAS A;  4P1W A;  3OY9 A;  2CMP A;  4R79 A;  1TT0 A;  4BE0 A;  3VYU B;  2KRH A;  4E7K A;  2XC7 A;  3J7A Y;  2CV0 A;  1E0E A;  1WJ5 A;  3HXL A;  4BJ6 C;  4DBQ A;  1ERD A;  2XDV A;  3G2B A;  4E7S A;  2KLO A;  4PJM A;  2CH0 A;  3DU5 A;  1X1C A;  3CES A;  5LD2 C;  4XOP A;  3PNV A;  4ZTJ A;  1T0F C;  2DT7 B;  2V6E A;  3S32 A;  4PSW A;  1YE9 A;  2L9S A;  2M7A A;  1JI8 A;  4ZJZ A;  3L2R A;  4NC8 A;  2I8D A;  4F92 B;  3K70 C;  3OWT A;  2L5Q A;  4CSW A;  3H9G A;  4BQO A;  2L9N A;  3K4M A;  3DTE A;  2IGO A;  4RLF A;  2VB6 A;  4OAZ A;  4BUP A;  2ZFU A;  4QPO A;  2Q2E B;  2RNG A;  4J00 A;  4E6K G;  1K6Y A;  2VKD A;  4RLQ A;  2UV1 A;  4CCK A;  3VSK A;  1G8X A;  2F6C A;  4II3 A;  3QOE A;  5JHF A;  3ZRG A;  4YRV A;  3L2V A;  4E4H A;  4XKB A;  3OYD A;  3OYF A;  3OYH A;  1MW7 A;  1W36 C;  1MMA A;  3DPU A;  4G6T B;  2CW8 A;  2M4K A;  1WJA A;  2VXZ A;  2HDW A;  3H5R A;  2KP6 A;  3OIQ A;  4X0G A;  4BE2 A;  2QKM B;  1WJF A;  3CP2 A;  3FBI B;  5TGT A;  2E5Z A;  4IKF A;  3LFU A;  2HVS A;  4AVZ A;  3HOS A;  3DEE A;  2O5R A;  2CV1 A;  4DJA A;  4F3Q A;  1D0X A;  1X1A A;  2BW3 B;  3IAM 2;  4BXF A;  3C2G A;  2VPL A;  4DIQ A;  2X1D A;  3LSM A;  2FUG 2;  3BCA A;  3L2W A;  2R7Q A;  4HRI A;  4KJZ A;  4OWR B;  2XAU A;  3AL0 B;  2LOO A;  3VSL A;  3OL3 A;  3AL0 C;  4AYB A;  3DU6 A;  2MAB A;  4HPQ A;  4XKC A;  1QU3 A;  2QKL B;  1GLN A;  4Y3O A;  3VYR B;  2XSJ C;  4XOT A;  3K4L A;  3HG9 A;  3QYB A;  2Z2S B;  3HPG A;  2XF7 A;  4DGW B;  2DOA A;  1LVK A;  2IS6 A;  2AQF A;  2LRD A;  2HQA A;  2R7O A;  1D0Y A;  1D1A A;  4XON A;  2PJR B;  1BR1 A;  2PMZ A;  2WAQ A;  3SDB A;  3FHN A;  1TZL A;  2OC6 A;  4YEJ A;  2AQE A;  3K4N A;  4RMN A;  4NQW B;  4ZDO A;  4BEH A;  3OOU A;  4LG3 A;  2L2O A;  3LSH A;  2VJJ A;  2BVM A;  3W3C A;  2UUZ A;  3M8J A;  2X85 A;  4BQN A;  4P5O A;  2NOJ B;  2JVG A;  4MLO A;  3OYG A;  1WJC A;  2OUM A;  2RQQ A;  2MD0 A;  1MMG A;  2VLA A;  4D9J A;  3DTK A;  2VXD A;  4ANJ A;  2WY8 Q;  3E1S A;  3HPH A;  4BL0 B;  3C2H A;  2IS4 A;  2M3A A;  3K70 D;  5CQE A;  2M7B A;  4E7I A;  4IQJ A;  3F9K A;  1D0Z A;  3DQV C;  2A6T A;  2XF5 A;  2JVH A;  1LKX A;  4F55 A;  3IP4 B;  2WAF A;  1WJD A;  4BDY A;  3W2A A;  3OYK A;  1X4P A;  2M4G A;  4CUG A;  5HNF A;  2WB1 A;  3RTR A;  3S3N A;  3OR2 C;  3LSI A;  2IS1 A;  2W4S A;  2HZD A;  3K4C A;  3DWL E;  4XKW A;  1AA7 A;  3BG6 A;  4DOZ A;  3EPZ A;  2HVR A;  3K4K A;  1MMD A;  3OYJ A;  1W36 D;  1EA3 A;  2V1N A;  3K10 A;  4LIU A;  3D5R C;  3LMM A;  3UR3 C;  3HL2 A;  3CJQ B;  3EUK L;  3K4J A;  1Z21 A;  2ZSI B;  5CQG A;  4HNU A;  1R6R A;  2LBF B;  4BE1 A;  2DT6 A;  4HNT A;  3TMO A;  2Y0S A;  1Y56 A;  3AFH A;  2V4J C;  3OR1 C;  4OAY A;  4B3X A;  2VL8 A;  4EAT A;  1S9H A;  1KON A;  2RRE A;  2KMU A;  1OR7 C;  3DLA A;  4U87 A;  2VJ5 A;  5KCM A;  3MKW B;  4CCL A;  4YEL A;  1D1B A;  3KX2 A;  3BLY A;  2VQC A;  4ZDL A;  3OYI A;  2BW3 A;  2GOM A;  2CS3 A;  2KRC A;  4XOR A;  2R7W A;  2CUJ A;  3RCO A;  4C9Y A;  5HVQ C;  3PUB A;  3HUG B;  4NC7 A;  2W7N A;  3OYC A;  1YX5 A;  3DKX A;  2DJI A;  3DPL C;  3FKJ A;  3GBG A;  2BVL A;  2LC2 A;  2JSP A;  3CF2 A;  4DBR A;  4PFO A;  2KDO A;  2IXS A;  3MD2 A;  2ZXH A;  2K5C A;  4CCO A;  3KEY A;  4ZC3 A;  1J09 A;  4Y4R A;  3BCB A;  5CKT A;  2MFZ A;  1MND A;  3OYN A;  2VKH A;  1WFX A;  4LIT A;  3W2W A;  5HNH A;  3S3M A;  2CV2 A;  3ZQQ A;  1NG6 A;  1UAA A;  2UWM A;  4B48 A;  3DPT A;  4ITV A;  4XM3 A;  3DKY A;  1VZ0 A;  1T95 A;  3L2U A;  4XLH A;  2X1C A;  2PJR A;  3RSN A;  4D1Q A;  4XNF A;  3H5N A;  1Z3Y A;  4KIT B;  3OL4 A;  1LFP A;  3PSF A;  2R7U A;  4GRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...