1X4PA

Solution structure of surp domain in sfrs14 protei
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSSGSSGVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of SURP domain in SFRS14 protei
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Putative splicing factor, arginine/serine-rich 14
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1x4pA00
2DT7B 2DT6A 2E60A 1X4OA 4DGWB 1X4PA 1UG0A 2E5ZA
chains in the Genus database with same CATH superfamily
5FGMA 4LGWA 2PFBA 2DT5A 4EJOA 4HQMA 4U0YA 3NRVA 3G1LA 3FHNA 2YU9J 1HKTA 3WU0A 2HZDA 2JMWA 2PLYA 3E6CC 5JVTA 4BHCA 3BG5A 1LQ1A 1SD5A 2F2EA 2PMHA 4N0BA 1I1GA 1OYWA 3KP5A 3I71A 2W48A 2XVCA 2X1EA 2BZTA 1MIJA 3BR5A 3RKQA 2H1LA 1YIJI 1HLVA 2O9LA 2LY9A 3DKYA 2KJBA 4HV6A 5K5OA 5FLMJ 5EDNA 1MJ9A 1K6OA 1YX3A 3JRFA 2AXLA 4BQAA 4PGGA 4A12A 3I4NJ 1W5CC 3QP5A 3E97A 2XGCA 4IZZA 3M7GA 4CYCB 1IDYA 2GQQA 3RKXA 4A3GJ 4S05A 3GXOA 1VNDA 4EGZA 2XAGA 1LFUP 1DUXC 2VBZA 3MCZA 4HQEA 2K9QA 1UG0A 2JUGA 4RGRA 2M8EA 2XAHA 3GX4X 1BJAA 3GCMA 2FOKA 4MIMA 4TV7A 4G7OF 1LFPA 3BROA 3O3KA 1T39A 3C7JA 4ESBA 1E3PA 5GAGJ 2BY0A 3CJRB 3IHUA 4OWRB 4EATA 1XCBA 3OYMA 1V54H 1U3EM 4M71A 1TP4A 3HRUA 2FMYA 1VQ4I 2PJRB 4ZYEA 4PCQA 3ZPLA 3EYYA 5IP9J 4RB1A 1MDMB 2JZYA 3TDZC 2E5ZA 3SHFA 2W84A 1QNTA 1I3QJ 1X1BA 3Q0WA 3PSFA 1TT5B 4R8HA 4BQNA 3DP7A 2CMPA 1USSA 2EFNA 3V8KA 1MMGA 2JN6A 1OCPA 2WA0A 2JA8J 3S1RJ 3FXKA 5E18F 4BUPA 1NK2P 4Y4RA 2LF8A 3FMRA 1QPIA 4BQQA 5CJ9A 3TMOA 4WXHA 2GXBA 3ZQCA 3KZZA 4LB6B 4A5MA 4NC8A 3W6JB 1BI2A 1TWFJ 4G94A 3H92A 2DPUA 1P7IA 4RB2C 1DQUA 4K2EA 3KYDB 3WTZA 5K7FA 4NUBA 1NTCA 3HIFA 2PQ8A 1H9TA 2AXTC 1BL0A 4GYIA 2A3SA 4KA4A 1BC8C 5J8CA 2JVHA 3MKWB 1OPCA 3PUBA 2WV0A 1NG6A 5GADJ 2IPQX 2OA4A 4RAGA 5DCMA 3WU2C 1FBUA 2XGXA 3M3YJ 2RNJA 2F4IA 2E2HJ 2XAFA 3U1KA 5FLXZ 5D8KB 3W6KB 1CQTA 2YPRA 1R1TA 2HTSA 2M7AA 4D5CA 3VODA 4HAMA 2ELKA 4IQ4A 3PNTA 2ADUA 4EJWA 1XGNA 4E4HA 1APLC 5LHHA 1R4NB 1Z3XA 5AIQA 3VFZA 5D5VB 3NAUA 2IJLA 2ISZA 4MGRA 3S2WA 1PP8F 2IGKA 4RM2A 3EYIA 1ONVA 2IRFG 3CJTB 3FXRA 2F5CA 3BG7A 3B02A 2HXOA 4HSRA 1KA8A 1ZYRF 4L18B 1U5TB 5DEQA 1MSEC 1YW7A 3O2PE 1IRFA 2FNAA 2V1NA 2LY2A 1Z21A 2IP2A 1ZREA 3WGIA 1LPQA 4ZYHA 1O7LA 5M5XJ 3DPLC 1FPQA 3OYDA 4EV0A 2R7RA 2Y9ZA 1BW6A 3ECHA 2GOXB 1A35A 4A3KJ 2MC3A 4L9NA 3QPLA 4HF1A 2KZGA 2MW8A 1FP1D 2QGUA 2R7SA 2VE8A 1MDMA 1F1ZA 3HC7A 3BTCA 3IKTA 4S04A 4XMYA 1WJAA 3BWGA 4M9SA 3K1MA 3HTSB 5IT9Z 3HGGA 2KMUA 1IV8A 3CP8A 3DEUA 3MKZA 1JKRC 2M45A 5J47A 2WAEA 3CZ6A 1MMDA 5IOYA 2EV6A 3V42A 1A6IA 1P4WA 2OQRA 4RB3C 1V5GA 1UHWA 1FOYA 1G2HA 4YELA 4XSZF 1XDSA 3FISA 3JRAA 2VQHA 3TBIA 3KE2A 5DD4A 1R49A 4PSWA 1FEXA 1VQ8I 2UUZA 3HPGA 3HJEA 3DF8A 4WCGA 1W7PD 4RAFA 3VYTB 1W5SA 2NS8A 3W2AA 4M3GA 3HL2A 2YS9A 4I0BA 2FU4A 1JKQC 2F6CA 3W6VA 3WTTC 2FF4A 2HKXA 5LRRA 4GXOA 2CO5A 4A3EJ 2ZMEC 4UY8I 1RI7A 5DTDA 3E6MA 1XS9A 3QRFF 3IRRA 4YG2F 2K5CA 4Q47A 1J0RA 2XROA 1T38A 3PO3J 2HNHA 1ZLJA 2QWWA 5LD2C 1ZH5A 2ECBA 1D8KA 2BXZA 2M4GA 2L9SA 2M0MA 3G1MA 3GW2A 5E8IA 4HBLA 3ABTA 4BH9A 3H5RA 1X1AA 2KP6A 2YU3A 2HPIA 1HSJA 4JX5A 2XKPA 1LE8B 1R71A 4DYQA 3OV8A 1D1BA 3N97A 1MNDA 3L2UA 3CUQA 2PJPA 4UB8C 1Z6TA 3FXUA 1ZG5A 1PDNC 2LRDA 5E1ZB 1FYLA 1EA3A 3DFGA 3OYIA 4LB5A 5EGOA 1RPWA 4G6TB 2NXNB 4XORA 1FY7A 1Z67A 2P8TA 2P5VA 3I9V2 1DGWY 2RC4A 1Y1VJ 2HFHA 4KIBA 4DZJA 3KFWX 1J5YA 3LSTA 3GFIA 3FMSA 2R7ZJ 2O3FA 3QAHA 2NAZA 1XGOA 5LBQA 2ZJ2A 3DEEA 3CO6C 4R79A 2R3SA 1STZA 2G7UA 1BM9A 2E71A 5LRSA 1WFXA 1TLHB 2P81A 1JE8A 4RB0A 2LYCA 1F43A 1K6YA 5M3FJ 3GTJJ 3IL2A 5HLTA 3OYHA 2F5FA 3FXOA 4HZFA 2M0CA 4BE1A 4HX7A 2O8XA 3HKZA 4FQGA 2B7EA 2W00A 1RKTA 4HA8A 1WJBA 5GAHJ 2XF5A 1DU0A 2DOAA 2A07F 2KDZA 2BGCA 1X58A 3BT9A 5J40A 1V55H 2DQRA 4A3IJ 1YITI 3GMEA 3H3ZA 4XK4A 5B1BH 2ZXHA 1FTZA 4A3CJ 2FOWA 3I59B 3J80K 2X0LA 3QWLA 3J7AO 1PP7U 1BR4A 2K4BA 4BJ5C 2RREA 1LKXA 2V1XA 2HVSA 3MFKA 1HKSA 3PUFA 2FRHA 3JAMZ 2EINH 2KPMA 3TQNA 1MNMC 1PYVA 3HYIA 4RAZA 1ZAOA 5IP7J 3JRDA 2COMA 4QLCU 2JTVA 3GTMJ 3AG2H 2VLAA 1ETOA 4F7ZA 1FBQA 5E1WA 1Y8QB 1HOMA 2QCOA 3F21A 4GFBA 1T08B 4Y17A 3ZQ7A 3DWLE 3G6EI 4B48A 3A2KA 1MH4A 1ON1A 2BVLA 3RYPA 3CMEI 3DU6A 1W0UA 3RZDJ 2JQ7A 3OYKA 2G9WA 4HF0A 2C6YA 5ERIA 2EILH 2STWA 4BXXJ 1D0ZA 5H20A 2R0QC 2EBIA 2JVGA 4MTDA 3TO9A 2GXGA 2COBA 3J81K 4DQ2A 1WI9A 2FQ3A 2XRNA 1I39A 1A31A 2G7HA 2KJCA 1FT9A 3RTRA 1ORKA 1MBJA 1FX7A 1K61A 1RUNA 1D1AA 2DMNA 3OOUA 1SD7A 3SZTA 1H8AC 4AVPA 1L0OC 2R4GA 3AL0C 3S16J 3G4SI 3ZQHA 4E7SA 1FBSA 2QENA 5ILSA 3HGYA 4F52A 1P4AA 1UB9A 3OYGA 4IO9F 4B09A 4RMNA 1XPXA 1OQYA 4ENMA 3KX2A 1HW5A 4KUMA 1WSUA 2M5WA 5JLWA 3EUKL 4IRHA 2DK8A 3FXMA 1BIBA 2Y75A 1ZG3A 3JSOA 1Z9CA 4RAYA 2D45A 4DIQA 1KQ8A 3F0CA 3A02A 1B9NA 2MG4A 5EGOB 4OOIA 2B0LA 2UZKA 3QU3A 2H8RA 3P7NA 3G73A 1LDJA 1MH3A 4H4KC 2ZO4A 2QBYA 5D5UB 4PJNA 4AUXA 1FIAA 1S7EA 1QVTA 2JPBA 2VIXA 2NOJB 2BY3A 4DBQA 3PQJA 1V5EA 2Q8KA 1RR7A 2CU7A 3GLXA 1WVRA 2QYOA 3ZQLA 4NNJA 2QSHX 2CW8A 3M8FA 2KQRA 1S8NA 4HX8A 1LNWA 2CUEA 1ODDA 4ZZDA 1SANA 1GUUA 4UNOA 1LVAA 3V4GA 1U9NA 2D2WA 1G3TA 4A6DA 1KYZA 2DFEA 1PUEE 3GO5A 2MLKA 2M8GX 2K4JA 1Z77A 3H5AA 2WTEA 2F4OB 2QKLB 2XHKA 5F0CA 3RIRA 3BLYA 2L3DA 4IEJA 2WWYA 3MEXA 3CCMI 1YE9A 3PIPF 2VJ5A 2OZ6A 1T98A 2ECCA 3K4LA 2K3PA 2O5RA 3MAJA 3RQIA 4WXCA 2CV2A 1DGRM 3IH4A 2R7FA 4HF2A 4MEXF 2L7FP 1ZRDA 1YS7A 1H88C 3OS1A 5B3SH 1JKPC 1QBJA 4OAYA 1WCMJ 2M4KA 3R0AA 3HRSA 1P2FA 4DYRA 1P92A 1V5FA 4UUTA 4MNUA 2NVYJ 2Z33A 1I3AA 1DP7P 1OYYA 2MC4A 4RM3A 4C2UA 1GVDA 1SFXA 1R23A 1B59A 4W97A 1D3YA 3T8RA 1J9IA 4A2UA 4AM3A 5CVVA 1HDDC 3FWEA 1GDTA 1VQ6I 2CUFA 4PFPA 2IBDA 3TDUC 2OC6A 3CF2A 5F0HA 1IGNA 2RQQA 2L02A 3KP3A 4KDPA 1H9GA 4F91B 2GM4A 4MHGA 4Y13A 1JUMA 2W24A 2X1DA 1S7OA 4XKCA 2MGQA 4HV5A 1O3QA 1UG2A 3ZMUA 1T2KA 2XAUA 4N9HA 4F92B 3AFHA 2ZXIA 4PFOA 3LSKA 5IT9K 4L5IA 4AIKA 3Q9VA 2XB5A 4YIFA 4UVCA 2ZSHB 4LLLA 3IV5A 3KP4A 2IA0A 3EPZA 4G6QA 2CUJA 4EM2A 1YHQI 4BJTA 3U9GA 4AYBN 2XSDC 4IHTA 5HNFA 3GTOJ 1MMSA 3K6GA 2DDAA 2CQNA 2P5KA 3BCAA 4U87A 4CCLA 5IP6A 4J00A 1QZYA 4XLFA 3L9FA 4WK8F 2K27A 3HTUA 3WU1B 3SFIA 4L9VA 4FE4A 3WE2A 2VXZA 5C44J 5E17F 4FE7A 1XGSA 1QZZA 1U5TC 1I6XA 4I6ZA 5B66C 2QA4I 4KT6A 4LFUA 1WJEA 5FKOA 5CVRA 2QEXI 1AU7A 1N25A 2E7XA 4O6JA 2KFDA 3HOZJ 2AHQA 1F9NA 2K3FA 2FXAA 3HKZN 2MSYA 3K2AA 3PL8A 3FHZA 1POGA 2A5YB 4IHXA 4E7HA 4EJUA 4Q48A 1T33A 2XGEA 1SVLA 4B44A 4I02A 2F5DA 4IRGA 4D1QA 2HOSA 3GTKJ 4PSXA 3LSRA 3F8CA 2K40A 4BE0A 1WJFA 2NVXJ 2R7VA 2DMUA 2JA7J 5CQEA 1XMAA 2JSCA 2X6XA 2YX7A 4U0WA 3LMMA 1YX5A 5EG0A 1X4PA 4OIPF 2ISYA 2HXIA 3ZMTA 2R7QA 5FB2A 2XPUA 5FKNA 1SAXA 1YW9A 4B1RA 3FZVA 3DKXA 3TW6A 1PUFA 4I2OA 1MMNA 2CW7A 2CG4A 2H1KA 1WRJA 4MQVA 3J7YJ 1FZPB 2Y0MA 3CCRI 2M7BA 3JAMK 2OCCH 3VOEA 2VODA 5K1YA 5H2FC 3GFMA 4V2GA 4P96A 3CCQI 2DN0A 1UCRA 1A04A 3QOPA 2K02A 3BPXA 5D5WB 1VQ7I 2HKOA 4PJJA 2LBFB 1G6NA 3L2CA 1IUYA 5JI6A 2Z99A 3K4NA 2VC1A 2L9VA 5ICGA 2CQKA 4ZTJA 5J6XA 1XSDA 2DAOA 1WWXA 2LF7A 3AKZA 2ZCWA 4KN4X 2ME6A 4ENNA 4XL9A 4HW0A 1UFMA 2R7OA 2W4SA 4X0GA 1IN4A 3HPHA 2QKMB 2XV4S 3GF2A 2XPVA 4E6KG 4YRVA 1VQ5I 4XKWA 1GV2A 4J19A 1HW1A 1TNTA 1R7JA 4V19K 3E7LA 3NWSA 2V9PA 5IYDJ 4F93B 1BJZA 1JJ8C 1WQ2A 3JRCA 1NG7A 2VPRA 2FMLA 4I98B 4HNUA 2QVOA 3IH3A 1ZGJA 3KYCB 3QPSA 2DI3A 3OIPA 5FKLA 2VQLA 3CJNA 1X4OA 4IHWA 4X6AJ 4BBSJ 3CC7I 4CICA 3MWMA 3PM1A 4KIFA 3LQRA 4DOZA 2KL4A 1Y0UA 2OUMA 5F64A 1TWHJ 2VJJA 4MTEA 4XBFA 1ON2A 3FMQA 4BGDA 1LUJB 5GPCA 4E7KA 1IV6A 3OSFA 1Z6RA 1QZEA 3J7ZI 3L2WA 5EG0B 2OU2A 3SDGA 4KIGA 1JKOC 2A6EF 1IN8A 2EA4A 4IOCF 3WGHA 2V7FA 4XLAA 3KCCA 4BDZA 2W82A 3V8JA 4NDLA 3LA3A 1QHHD 1S6LA 4IL6C 1SFEA 1R6RA 3PNYA 3KP6A 2LSOA 3TO7A 3M4OJ 4QPQA 1ZELA 4UB6C 1ERDA 1USTA 3MKLA 2BV6A 2HVQA 2AO9A 2DT6A 5E8GA 3VSLA 3IKVA 4CCNA 3ZN1A 2VJIA 5C3EJ 2LP0A 5M5YJ 3G71I 2P5LC 2HDCA 3K10A 3TO6A 1TL8A 4CA0A 4Y33A 1T0FC 2DPDA 3JTHA 2LY1A 4ANJA 1IJWC 3J81Z 3BTLA 4LIUA 1IN6A 4M73A 1U9OA 2DFIA 2JT1A 3G1OA 3TEDA 3P9KA 5E3LA 2ICWG 3ZGKA 5IPAA 1G3YA 2BW3A 1R36A 3REOA 3TGNA 1YRNB 2HOEA 5A2QK 1OCCH 4A0ZA 2X4HA 3HSRA 1B4AA 5IT3A 5K7ZA 3CD6I 2FA5A 4WF2A 2X85A 1K4SA 2ZXJA 2ELJA 3BP8A 1B6AA 3WTVC 3JCUC 3I55I 4E7JA 1XSXA 4RS8A 3L1PA 3G2BA 4AIDA 3IUOA 1QGPA 1BC7C 3CLQA 4XRFA 4RGXA 5LGTA 1T8IA 5F08A 4A3MJ 4YFKF 2CFOA 2B63J 3OR1C 1O4XA 2LTPA 1P4XA 1WJ5A 4ESJA 4C2MJ 3A1YA 4M9ZA 2DQLA 3BQZA 2EB7A 4XLHA 1XTAA 3OYBA 4M3DA 3F23A 2LKSA 3HOXJ 3WODF 3W2WA 1B1BA 5GP9A 2CQXA 1XX5A 2STTA 2P6TA 1ETKA 3FDYA 4CZZA 3I0TA 3OS0A 2JK3A 2DA5A 3HBLA 2FQ4A 1E3HA 2MD0A 4FX4A 2E60A 3K69A 4XONA 2DXIA 2M2EA 6PAXA 3GBGA 5CPRB 1JUPA 2E5NA 2VPLA 1FWZA 3M07A 4I01A 3LWFA 2W1OA 3LSHA 4W1UA 2UV1A 2B9SA 4AD9A 4F55A 1AKHA 3PO2J 5LHGA 3OR2C 3P9IA 4RGSA 2HYJA 3D0SA 2TCTA 3GTPJ 4XN3A 1W5TA 2EK5A 3CF5F 5IYBJ 3G3ZA 5BOXA 2XF7A 1GHCA 2XKOA 4IPAA 2JRMA 2ZJRF 4LIVA 3QYEA 3OL3A 2Z3YA 2P7VB 1X2MA 1ETYA 2K85A 3L00A 2PBIA 1UZCA 5FD5A 3L09A 3E6DA 3FM3A 1PJRA 1HKQA 4P9FA 2WB1N 1EH7A 2RN7A 3C2GA 2BYVE 2GZWA 3SYTA 1W7PB 4XICA 1YOVB 2L9RA 3F8FA 2ZMEA 2VXDA 4IQJA 4XKBA 3QP6A 1YJ9I 4QSHA 3RJPA 3HG9A 1U78A 3HDDA 5DDGA 5E3NA 2IS1A 4UVBA 1XC5A 1J7KA 1LEBA 3OYNA 4PJLA 5KAIC 3DLAA 3MQ0A 2D1VA 3X2QH 3GTQJ 2ZC2A 2KRFA 4L5JA 2DK5A 3OYFA 2Z1DA 4XLPF 1TBXA 1Y8RB 4ZC3A 3VYSB 1OFCX 2O03A 1YW8A 1LJ9A 3E0JB 2Z16A 9ANTA 5B5EC 2IA2A 3I53A 3NARA 4CH7A 3F6OA 3AL0B 2DOFA 4ZDLA 4A5NA 3HB9A 4I76A 3L2QA 1P7JA 2L01A 3H1CA 2L4AA 3E3VA 4EQQA 4RLQA 1G4DA 1LFBA 3ZMSA 4ZDOA 1WI3A 1XMKA 4BHBA 1IZ1A 3NWTA 2UXXA 4EEFG 1U5TA 3U21A 1XGMA 2TRTA 2W7NA 3K0LA 2FEZA 1LB2A 3K4CA 1R4MB 5BNGA 3HEFA 3RPQA 2DA7A 4MFDA 5IOZA 4IJAA 1YIOA 1XG1A 4ZZLA 4KMFA 4XRSG 2KHMA 3CDIA 3ABUA 5J1UA 2NVTJ 2KZVA 5GTIC 2CV1A 3QPHA 5K7HA 5HOOA 3DTIA 5LHIA 3WTYC 4G9YA 2GOMA 1V4RA 2X6WA 3OMYA 2XPWA 5D4RA 2VONA 1FP2A 1EH8A 2KT0A 4CCKA 1HF0A 3Q3SA 1KU9A 3BZKA 2NNNA 3M8EA 1IN7A 5FROA 3JW4A 2J5OA 1ZRFA 3IH2A 3DBLB 4YEJA 4HLYA 3C2BA 1Z1DA 1ZRCA 1KU7A 2EV0A 4BNCA 4C3IJ 1QQIA 5BPDA 1H0MA 3F3XA 3D5LA 5LEKA 4R1HA 5J1RA 2DBBA 4CXFA 4A3FJ 2BHYA 1S72I 2P4WA 3E6BA 1S29A 2KIUA 3H35A 1DPRA 2LH9A 5FO5A 3GZ5A 2VKDA 4RDUA 2L9NA 1HXDA 5H6QA 1TW3A 4DNCA 4RBOA 3BPVA 4PJ0C 3BG9A 1B72A 2CYYA 3H0DA 2F48A 1XMXA 3I54A 5CVIA 2R7UA 1YJNI 1EV7A 3R6SA 4H0EA 5HDKA 2TDXA 3WG7H 1GV5A 4AIHA 1W0TA 4ZDPA 3HM5A 2IAIA 1XSVA 3HUGB 4PZJA 4QWQA 1SVMA 2DOEA 3P5JA 3SDBA 2BVMA 1HBXG 4OIOF 4M74A 2HQNA 3QQAA 4C9YA 3OIQA 3RDIA 3WTXC 1YYVA 5L3FA 5FRNA 2DJIA 3K1NA 2IS2A 2BOLA 4EVIA 1BOBA 1TWGJ 5EJCA 2BXYA 3FF5A 2KKOA 3GFLA 5FKMA 5B1AH 4XRMA 1HQCA 5CKTA 2HDWA 5FFXA 1HDPA 4EGYA 2VJ4A 5C4XJ 5GTHC 3ABKH 4A3LJ 1PVEA 2ME0A 1BR2A 1ZGAA 5L3GA 1AWCA 1Y39A 2IT0A 4EM0B 5DS9A 3CDLA 2K9MA 2YUSA 3TOBA 4FTHA 2I8DA 2VQGA 1FSEA 3FKIJ 1TWAJ 4M3BA 4F3QA 2E36A 3K2ZA 1R1UA 4WWCA 3ASNH 1LE8A 1T0FA 2J5PA 4LMYA 1W7PA 3UNGC 4IX7A 3CCUI 1BBYA 1S7AA 2L4MA 1VQ9I 3BQYA 4BDYA 3S2DJ 2FX0A 1IRXA 3HRMA 3JSPA 2DCEA 2BHZA 3Q9SA 4O3MA 3AG4H 2KDOA 5ICCA 1ETXA 3BCBA 1E2XA 1X3WB 3ML6A 5FD6A 5EEGA 4ZJZA 3BJ6A 3GFJA 2OQGA 1OCRH 2Q0OA 3GZNB 4AVZA 5HDNA 1U8RA 3HZJA 3KP7A 1U0JA 4A0XA 1O3TA 2M3AA 4DYCA 2Y2ZA 4LD5A 4D0PA 4ENKA 3OOPA 1SFOJ 2A05A 5TISC 2XIGA 1VFCA 1OYIA 1FOXA 1JTXA 1OR7A 2HGCA 3DTKA 1UELB 1CGPA 1BW5A 1J75A 2N8GA 4FETA 3S32A 4N4OB 5JLXA 1IRZA 2IGMA 2HQRA 4U88A 2Z9OA 2R5ZA 4BEHB 2IS4A 1KZHA 2EIJH 1SFKA 3NQOA 2ESHA 3L2RA 3V7RA 4G7HF 2LLKA 2VUMJ 5EF6A 3R0JA 1Y0NA 4MFEA 2Y31A 1FMWA 2KIMA 3R60A 4II3A 3OWTA 3CC2I 3LSPA 1OKRA 3OSGA 2QSGX 3SXYA 1X1PA 2OAZA 4G8XA 3PIOF 3ZP5A 2E34A 3FX3A 4I0AA 2WB1A 4PJMA 2GIVA 3A03A 3MD2A 3BR0A 2L0KA 1O57A 3PSIA 3D1NI 1KU3A 1ZARA 2VBXA 2XC7A 4GCVA 4JBAA 4IOAF 5DM6F 2DA2A 5ICFA 1RIOH 2ZXWH 1VQKI 2XB0X 3H9GA 1O3RA 5HLHA 2LNBA 4S0HB 2R5ZB 2NS7A 2VC0A 2OZUA 3GEZA 1MBGA 3MZYA 3ELKA 3LSMA 4B4CA 2RQPA 5DV5A 5F6FA 1RUOA 3CCVI 4LG0B 3CUQC 2EA2A 1X1DA 3GTLJ 1TQIA 2A68F 2BE5F 4GGGA 3FBIB 4PUSA 3RCOA 2ZFUA 1O3SA 2VI6A 1TNSA 3F6VA 3RI4A 1OCZH 1MBEA 3C3WA 4DZPA 1X2NA 4BBRJ 4FHTA 2IW5A 2PX9A 1KYWA 1OMIA 1FMVA 1Z91A 1ZKGA 4HG2A 4NC7A 4X1EA 1GXPA 4A3DJ 1Y1WJ 4NQWB 3I4MJ 4KFCA 4NBQA 5IY5H 4E7LA 3KYLA 4LJZF 5DCMB 1V3FA 3DTEA 2PJRA 2NVQJ 2LVSA 1RETA 4B47A 3BC8A 5JVGF 2IEKA 3AAFA 3E5UA 5E20A 5D4SA 2MBFA 2O8KA 2W57A 2JPCA 2KLOA 1FTTA 1BIAA 3KEYA 3ZMDA 3H5NA 4XSXF 3OYAA 5EEAA 3COAC 2E1MC 1TW2A 1JHHA 4BQOA 4QTRA 3GUDA 4FASD 3PFIA 2CH0A 2F4MB 4XR6A 2LBFA 2PG4A 2YR2A 3K70C 2FE3A 2GBYA 4CSWA 3M1CA 4UUSB 4DBRA 2Y0SN 3KP2A 2VASA 4ABZA 4LK0F 2CGPA 3ABMH 2V6CA 2E19A 2I10A 2EV5A 1SEUA 4C30A 1DDNA 4HNVA 1I50J 4UV9A 1YLFA 4A0YA 1SMTA 2M34A 1JGSA 3U2RA 5ILVA 2UWMA 4GYGA 1LEAA 4QIWN 2HZTA 1YS6A 2DFHA 1YJWI 4P1WA 3QYFA 5D8LB 3KLOA 2K9SA 1S9HA 3I4PA 3HOSA 4XNFA 1OLTA 5DD8A 1T6SA 2LDUA 3BR1A 2OD5A 2V1DA 1F5TA 4XRSA 5J8FA 4HYEA 4A6EA 1VF9A 3CLOA 3CCJI 2JRTA 4UUSA 2NRAC 2NS0A 2E35A 1VTNC 2AS5F 3BDDA 2DMQA 4HSTA 2XF6A 3CO7C 4M3EA 2DTRA 2H09A 5BS6A 4AIJA 4XOPA 2DMPA 5DM7F 2GXAA 2PN6A 3JTGA 4IHVA 4HEA2 3E1SA 2FBHA 1LDKB 1WJDA 4XN0A 2HYFA 1F36A 4OINF 3F72A 5FRMA 5BQTA 2XDVA 4Y7NJ 3MMYB 1BI1A 1XD7A 2LC2A 1AA7A 3CCSI 2XAQA 3KEQA 5DUIA 2BY1A 1D0XA 1ZK8A 2F5VA 5GPAA 3OY9A 4BY1J 1DU6A 3IAM2 2ZKZA 4BXFA 1ETVA 3QU6A 1M1EB 4BYYA 2WY7Q 2VB6A 3SZGA 1D1CA 2CS3A 4CCJA 5KCMA 1B9MA 1FOWA 3TW7A 4ZH4F 4M3FA 3DCFA 3FKJA 4OAZA 2P7CB 3KPHA 2CQQA 3LAPA 1K4TA 3UKGA 1W36C 4XLNF 2R7DA 1VQPI 5C4JJ 1K78A 3HSEA 1UHMA 4YFXF 4E7IA 4L0YB 4XOTA 1K78B 2V1UA 3CCEI 1BOAA 1B72B 3ZQFA 1QO0D 3KZIC 3OL4A 2DT7B 3LA2A 4U0VA 2H8WA 2E2IJ 3S1MJ 5CVJA 3ULQB 3A01A 1JTYA 4PGHA 3S17J 2ZJPF 1Z7UA 2OTLI 5HLGA 1MGTA 2EFOA 3DLLF 1JI8A 3AG1H 3MKYB 1FOKA 2K9LA 2FJ1A 3VSKA 1Z0XA 3HXLA 2E1MB 2HQ5A 2MYSA 3GTGJ 4CCMA 5J4VA 2HQAA 1P6RA 2FBIA 2DO7A 3N05A 3JRHA 2VT2A 2H6BA 2GA1A 4CZCA 4I99C 2LOOA 1DPUA 1RKWA 2EFPA 3A4CA 2WV1A 3K7AJ 4P9UA 2FBKA 1DP3A 1MZBA 3NEUA 4U7DA 2LFBA 2ID3A 5HS8A 4OIQF 2HYGD 1QA6A 4Y15A 1HC8A 1Y56A 1MNEA 1ULYA 2E7WA 2QZ8A 4LG3A 4NB5A 2EZIA 4FISA 4Z6YA 2ID6A 4L9JA 3TP0A 1D5VA 2X51A 3OYEA 3BR2A 3PFYA 3R4KA 1FIPA 1KONA 4DW6A 2O61A 5D6EA 2V26A 5E1XA 4C3HJ 2XUBA 1WGXA 1YO5C 2EIKH 2JUCA 2K7LA 2WAQN 2DDBA 5JFRA 3MVPA 4O5VA 4AWXB 2Y48A 3SQNA 1X3ZB 1J2XA 3FM5A 1S5LC 1FNNA 2E1OA 3IAS2 1A6QA 2V79A 3E5XA 3HOTA 5IYCJ 1OISA 3A0BC 5E79C 2PMZN 2LR8A 2WADA 4D5FA 1FLIA 3K4BA 3K4MA 1JXSA 2MH9A 4E7ZA 4ON0A 5E3MA 1D0YA 3LNQA 2O0YA 3S1QJ 4FCYA 3VDXA 4ZYDA 4ENJA 4Z2YA 1MSFC 2L7ZA 3EETA 3T5XA 2LKPA 3S15J 5KNLA 3K9TA 4P5OA 3OYJA 2VKVA 5FJ8J 2HTJA 2I5UA 5F1RA 3CUOA 3DV8A 1W1WE 3P9CA 4BXUA 2MD5A 2H6CA 3RPUA 3VPRA 3S3NA 3CUQB 1UHSA 5CYVA 2HR3A 2PI0A 2GIZA 1B8IA 2HU9A 3LOCA 3ZQIA 1W4MA 3GWZA 3ZXSA 2DYSH 2DODA 5LFAA 1WZ2A 1EJ9A 2DA3A 2NVUB 4CO8A 3V7CA 5CQGA 1J59A 2XSJC 1VQNI 3DPUA 1N77A 4NHJA 4UV8A 2A6HF 2ACJA 1QVUA 1JUSA 2HWVA 3BG3A 3LSGA 5FKKA 2EWNA 1K79A 2JA6J 1KQ9A 5D6FA 3IWFA 3RKYA 5L3BA 4JQFA 3UR3C 2CFXA 3CMYA 3I64A 3IRQA 3ABLH 3LL7A 3H9QA 2RVCA 2MLGA 5F1JA 1ITYA 3M9AA 4JX6A 5AIPA 3O8HA 3VYRB 1HA8A 1I6HJ 2R7TA 2Y0SA 1LVKA 1TT0A 4XIDA 2JJ7A 1YRNA 2BW3B 2DA6A 3FXLA 1R00A 3EUAA 2OPTA 3DEWA 2YX4A 1I27A 1Z05A 2V9KA 3MN2A 3RKWA 2CRGA 4HNTA 5LEJA 1ZQ3P 5AONA 5JHUA 2WAQA 4B43A 2K86A 3B6AA 3ZRGA 2PEXA 3JRBA 1JJ6C 4RGUA 4M6VA 2MABA 3GZ6A 3FXJA 1E17A 3SZPA 2E1CA 1IF1A 2DA1A 4BU2A 3OS2A 2CUZA 2M1BA 2PMZA 1YFHA 1D8JA 2DYRH 2VKEA 4G6DA 3K4JA 2DU9A 2HI3A 1IO2A 1WHUA 2F5EA 4DGWB 3WHBA 2WAFA 2QSFX 4KMUX 3EUHC 1REPC 4GO1A 4N9IA 5HDGA 2CQ7A 1QPMA 4BL0B 1SD4A 3JRGA 1C0WA 3JR9A 2CV0A 5LGUA 2VOPA 1SFUA 2EZHA 4G12A 1IXRC 1IG7A 1BI0A 3ECOA 1G8XA 4JOMA 5K5QA 2FNPA 3KIOA 1MBKA 2QM3A 3D5RC 2QQ9A 4CUGA 5KAFC 1SC7A 3ZQQA 2ZSIB 4LITA 5TGTA 4ZYAA 3CMMA 5FLXK 2IGNA 2L54A 3K70D 2AQEA 2CJJA 3S1NJ 2G0EA 2QUFA 2O6GE 1ZG1A 1R1VA 2M9HA 2W85A 3WTUC 3T0YA 5J4YA 2V6EA 3PJRA 2CW0F 3EDPA 1QU3A 3SEZA 1GXQA 3SFZA 2FSWA 2LG4A 1NK3P 1R5ID 1X1CA 1WH7A 4IF4A 4ZTFA 3TL4X 4FT8A 3OIOA 1UJ8A 4NC6A 1HCRA 3GYHX 3CESA 2QQAA 2X6OA 4KYWA 5HODA 5JHFA 4OU0A 4I09A 4I7HA 2X9DA 4XQFA 3LFKA 3VB2A 2ZNYA 2KRHA 4WX9A 3B6CA 1U8BA 4ASNA 1GT0C 1NH3A 2GAUA 3BTJA 5GAEJ 3F9KA 2CSOA 2LD5A 1D5YA 1R22A 2BEOA 1RNLA 2IVMA 1VQMI 1WH5A 1CF7B 4BEHA 2ZMEB 3SEQA 3ZN0A 1MJAA 1OCTC 4RA2A 2XRLA 1NHAA 3H0GJ 3V8LA 3WGGA 3DPTA 5BMZA 3QPTA 3BOQA 1W36D 5ICEA 4M6XA 3LQQA 1EH6A 5F0FA 3MZHA 3ZMVA 4A3JJ 1E3OC 3EUHA 2GWRA 4D7MA 1A5JA 2AQFA 1BI3A 1BR1A 2IGOA 2EPFA 2DW4A 2Y69H 3HOYJ 2VL8A 4P55A 1VQOI 3F8NA 1ENHA 4A69C 3SJMA 4M6YA 2BBYA 3WTSC 3Q0UA 3HOVJ 3A0HC 2JWTA 2Q1ZB 1EKEA 2V4JC 2M87A 3S8PA 4N4NB 2ESNA 2HS5A 4XKVA 4UVAA 1IDZA 3GVAA 4HPQA 3CP2A 2OCEA 3I5UA 1KQ0A 3BZ6A 3K4KA 3PNVA 1I1SA 2ETHA 1SD6A 2X1CA 1ZR4A 2WC2A 1JT0A 3L7WA 5CLSA 3Q0VA 5JR3A 1TC3C 1U6GA 3J7AY 1O7FA 5LLQA 2Q2EB 3DXJF 5A2QZ 1QHGA 3RQ4A 4AYBA 2RV8A 3C2HA 3U1DA 1AOYA 1L3LA 2MH2A 1R5HA 4RLFA 1K83J 2HEOA 3FK6A 3IP4B 2XASA 2H27A 5D5XB 2HOAA 4EJVA 2R7WA 2RDPA 2R5YB 4HDVA 4FX0A 4KICA 3FK7A 3ROUA 4YIIA 1KGSA 1KU2A 4L5EA 3ZQGA 3M1EA 2EFQA 4CYCA 2ZJQF 3S2HJ 1EF4A 2EZKA 1MBHA 1FYMA 2JSPA 4BY7J 4M9XA 3O8GA 2L7MP 5TRDA 3KLNA 3H9JA 5FFZA 4G7ZF 3CCLI 1YQAA 2RKHA 3HOUJ 2W25A 3HUGA 1PUFB 1TQMA 2XAJA 4CHUA 1G3SA 4E70A 3VWBA 4C2TA 5HNHA 1LDDA 2ELHA 2O7OA 5KHDA 2DA4A 3CQZJ 3CJQB 4UXNA 5EZGA 4MLOA 3FXQA 3ZMZA 3S3MA 4LG0A 1FJLA 4II2A 4MO7A 2HVRA 2A69F 2OF7A 4KITB 3IWZA 2CWEA 5LGNA 4ETSA 1A36A 1CF7A 3GLLA 3N4MA 3WHCA 2R93J 2DTZA 1WPKA 2E2JJ 1IXCA 2JA5J 4OMYA 1ZLKA 5HS9A 3H3VK 1OCOH 3LA7A 4UUVA 3JREA 2DFFA 1N75A 3KEOA 1WJCA 2EZLA 2X48A 2KIFA 1JHFA 3ZR8X 3BJOA 1TWCJ 1N78A 1OJLA 2ZNZA 4AC0A 1VZ0A 1X3UA 2A6TA 5BPIA 5J1YA 3L2VA 2OTJI 3WTWC 4NQWA 5CVUA 3ESWB 5EZHA 1TQPA 5KK1A 2KRCA 5HS7A 2HPMA 1E0EA 4KJZA 2LMDA 2H94A 1ETWA 4M72A 4EJTA 5HVQC 2K9NA 1IN5A 5F04A 2IS6A 2RGVA 3E5QA 4EMSA 3DBHB 3EQLF 1XN7A 4IXAA 3KETA 3HHGA 3FBNB 2XGDA 3HSFA 3M8JA 5J3LA 1GLNA 3T1BA 1GVJA 3BR6A 2VT3A 1T95A 5F27A 4A3BJ 3BJAA 1T56A 3R61A 3I56I 2QF7A 3W3CA 3ZCOA 3K1PA 1RRJA 5DYMA 3JRIA 2A61A 4GRIA 2E1NA 4L9TA 4KN7X 3KZYA 1IW7F 4XLEA 1RC9A 2R7XA 2VBWA 4XLCA 4BHPA 2R92J 1MJBA 3DU5A 4BACA 1IRGA 3ONQA 5HLIA 2ZB9A 3H3UA 3HHHA 1FYKA 3J80Z 1G59A 2MA3A 2NNYA 2V9VA 4WXDA 3RSNA 2R5YA 2D5VA 4L0ZB 1G3WA 4HLXA 3OYLA 4IKFA 2L5QA 3BTIA 3CMAI 3RZOJ 4CGZA 2OV7A 2QQBA 1B8IB 1AKHB 1Q1VA 3ZOBA 4ITVA 2LK2A 1BN5A 3RYRA 2OJED 4YFNF 3PQKA 1YTYA 4HDUA 3TP3A 5DCFA 2Z5UA 2Q2EA 3ERMA 2HOTA 5E3OA 3TKYA 3CC4I 3DKWA 2WBMA 3ERED 3C1DA 5TJJA 4Q4ZF 1R9TJ 2M30A 4JP0A 3DBRB 1TZLA 1WKMA 1Q1HA 2VE9A 1I5ZA 1P9QC 2VKHA 4OIRF 4BE2A 4JK1X 1UMQA 5FLVA 3BZCA 2RAEA 4KISA 1X19A 3BG6A 4IVNA 3WG9A 2GLOA 1U2WA 4GDFA 4V2FA 3C18A 4BJ6C 2L2OA 4BKXA 1RESA 2KISA 3FIWA 3I58A 5ILUA 4B3XA 1OR7C 4UHTA 1MD0A 5H6RA 3D5SC 5EYRA 3CDHA 3H36A 3F8BA 1UAAA 2VQCA 4MQ9F 2X6YA 2EQRA 5KVRA 1F4KA 1Z3YA 4MEYF 2MFZA 3CCYA 3S3OA 3VEPA 4U7BA 1ZHFA 1QRYA 3ASOH 4CDGA 1JGGA 1AHDP 5L3EA 1MMAA 1MKMA 2WY8Q 2OBPA 1YI2I 1RZ4A 1ZGWA 2BY2A 2GA2A 4OMZA 2FD5A 2IA1A 1ZR2A 4CYDA 2QLZA 4HOBA 4PK4A 2LKXA 2QBYB 5DUKA 2KIQA 2HDDA 3F8MA 4LOCA 3B73A 1FC3A 3QODA 3AG3H 4HRIA 3F22A 1IAWA 1Y6IA 5L3DA 5L3CA 2ZFWA 2NYXA 3OYCA 1H89C 1FSHA 1R5GA 1K7AA 1HW2A 1ZN2A 4YIRX 2YSRA 5K5RA 1SMYF 1J09A 1VQLI 3RPUD 1BA5A 2EFWA 2DMTA 1XCVA 3LSJA 4ZYGA 3VYUB 4Y3OA 1MBFA 1TTYA 2P6SA 4DJAA 1RR8C 3I59A 4B8XA 2VOOA 4A93J 2DLLA 3HRTA 4IRIA 3O6BB 2PMUA 3T8TA 4BAYA 3A01B 3Q5FA 1HSTA 1ETQA 4B3AA 3V7SA 4BS9A 4HX4A 1VI0A 1YG2A 4EM1A 2D1HA 4IHSA 1IXSB 4KNYA 4LLNA 4D9JA 3S14J 1MW7A 2Y9YA 3W2VA 2NOGA 2JA2A 5ED4A 1IC8A 2A5WA 2IXSA 4CCOA 3TOAA 2P0WA 4Y52J 4LK1F 1SVOA 3MZ8A 2DJNA 1Z7LA 1SAUA 3HOWJ 2Z2SB 4JYKA 1ACIA 2QQ8A 3QYBA 4XM3A 2VN2A 2L7KA 4D7NA 2FUG2 4AU7A 1IUFA 3ISPA 2UXNA 3BR3A 4JX4A 4KT5C 1JT6A 1XDUA 1R58A 4PDKA 4C3JJ 3IC7A 3WE3A 4ESFA 3S93A 2Y30A 4J01A 4QPOA 2ZBKA 2EH3A 5EEHA 3LSIA 3CTAA 4IHYA 2RNGA 3DQVC 4Q5SF 1XB4A 1ZTRA 2EJRA 2EIMH 3QOEA 3BY6A 4LLGF 3LFUA 5M5WJ 2LREA 3I3LA 5M3MJ 2VBYA 1S3JA 3LAJA
chains in the Genus database with same CATH topology
3K4LA 3H35A 2K3PA 2LH9A 2O5RA 3FHNA 2CV2A 1DGRM 3VYRB 1HA8A 2VKDA 2R7TA 2Y0SA 1LVKA 1TT0A 2HZDA 2L9NA 2BW3B 3EUAA 3OS1A 2V9KA 4OAYA 4HNTA 2M4KA 3H0DA 2R7UA 2WAQA 2X1EA 4B43A 3ZRGA 1V5FA 2MABA 3DKYA 4ZDPA 2MC4A 3HUGB 4RM3A 4C2UA 1YX3A 3SDBA 2BVMA 4C9YA 3OIQA 4BU2A 3OS2A 2CUZA 5FRNA 2PMZA 2DJIA 2IS2A 3K4JA 2BOLA 4IZZA 4PFPA 1BOBA 2OC6A 4DGWB 3CF2A 2WAFA 2RQQA 3EUHC 5CKTA 2HDWA 4BL0B 4F91B 2CV0A 2VJ4A 2X1DA 1UG0A 2JUGA 4XKCA 1G8XA 2XAUA 4F92B 3AFHA 2ZXIA 1BR2A 3LSKA 1LFPA 4JOMA 4PFOA 3D5RC 2K9MA 2ZSHB 4CUGA 3CJRB 3ZQQA 2I8DA 2ZSIB 3EPZA 2VQGA 4OWRB 2CUJA 4LITA 4ZYAA 3CMMA 5TGTA 4BJTA 2IGNA 4F3QA 3K70D 5HNFA 4EATA 2AQEA 3OYMA 3K6GA 3BCAA 4U87A 4CCLA 4J00A 4XLFA 3UNGC 4IX7A 2V6EA 2PJRB 3PJRA 1QU3A 3SEZA 2LG4A 4BDYA 2VXZA 1IRXA 2DCEA 1X1CA 2E5ZA 2KDOA 4ZTFA 3TL4X 1X1BA 3BCBA 3PSFA 4KT6A 1WJEA 4ZJZA 4BQNA 3CESA 2CMPA 4AVZA 5JHFA 1U0JA 4XQFA 1MMGA 2KRHA 2M3AA 3PL8A 2WA0A 4E7HA 4BUPA 3F9KA 4Y4RA 4B44A 4BQQA 4D1QA 3TMOA 4PSXA 3DTKA 4BEHA 1UELB 4NC8A 3SEQA 4BE0A 1WJFA 4FETA 3S32A 4N4OB 2R7VA 2IGMA 5CQEA 3DPTA 1DQUA 4BEHB 2IS4A 2X6XA 3LMMA 1YX5A 1SFKA 3L2RA 4NUBA 1X4PA 1W36D 2R7QA 1FMWA 4II3A 3OWTA 3DKXA 2JVHA 1MMNA 2AQFA 3MKWB 2CW7A 3PUBA 1BR1A 1NG6A 2IGOA 2VL8A 2F4IA 2WB1A 4PJMA 2M7BA 3MD2A 3PSIA 2Q1ZB 2V4JC 3S8PA 2M7AA 4N4NB 2XC7A 4XKVA 4IQ4A 3PNTA 4E4HA 3H9GA 4HPQA 3CP2A 1Z3XA 3K4KA 3PNVA 3LSMA 2X1CA 4PJJA 2LBFB 2IGKA 4RM2A 3K4NA 4ZTJA 3J7AY 1X1DA 3BG7A 2Q2EB 3AKZA 3FBIB 4PUSA 4XL9A 3RCOA 1QHGA 2ZFUA 2R7OA 3RQ4A 2W4SA 3C2HA 4HSRA 4AYBA 4X0GA 2V1NA 3HPHA 2LY2A 1Z21A 2QKMB 4RLFA 3OYDA 3DPLC 3IP4B 2R7RA 4E6KG 4YRVA 4XKWA 2R7WA 1FMVA 2GOXB 3NWSA 4F93B 4HG2A 4NC7A 1NG7A 4NQWB 4HNUA 2JSPA 2R7SA 4E7LA 3OIPA 2VQLA 3HC7A 1X4OA 3KYLA 3H9JA 3DTEA 2PJRA 4DOZA 2KL4A 4XMYA 1WJAA 2OUMA 3BC8A 4B47A 2VJJA 2KMUA 3CP8A 4C2TA 3VWBA 5HNHA 3MKZA 4E7KA 4BGDA 2KLOA 3KEYA 2WAEA 5KHDA 3H5NA 3CZ6A 1MMDA 3OYAA 3V42A 3L2WA 3CJQB 2E1MC 1V5GA 4MLOA 4YELA 4BQOA 3S3MA 4FASD 2CH0A 4II2A 2VQHA 3TBIA 2HVRA 4XR6A 2LBFA 4KITB 3K70C 2V7FA 4PSWA 4XLAA 4CSWA 3M1CA 4BDZA 2W82A 4DBRA 2UUZA 3HPGA 2VASA 1QHHD 1R6RA 3PNYA 3VYTB 3W2AA 4C30A 3HL2A 4QPQA 1ZELA 1ERDA 2HVQA 2F6CA 2DT6A 3VSLA 1N75A 4CCNA 2VJIA 1WJCA 2UWMA 3ZR8X 1N78A 3K10A 4CA0A 1VZ0A 4Y33A 1T0FC 2A6TA 3QYFA 4P1WA 3L2VA 1S9HA 2LY1A 3HOSA 4XNFA 1OLTA 2K5CA 4ANJA 2HNHA 2KRCA 4LIUA 2HPMA 1E0EA 5LD2C 2M4GA 2L9SA 2M0MA 4KJZA 3ZGKA 3H5RA 1X1AA 2KP6A 2HPIA 5HVQC 2IS6A 4HSTA 2XF6A 2BW3A 4XOPA 1D1BA 1MNDA 4HEA2 3L2UA 3E1SA 1LDKB 1WJDA 4XN0A 3FBNB 2LRDA 2X85A 5FRMA 2ELJA 3M8JA 4E7JA 1GLNA 1EA3A 2XDVA 3MMYB 3OYIA 2LC2A 1AA7A 3G2BA 3IUOA 1T95A 4G6TB 3W3CA 3ZCOA 1D0XA 2CFOA 4XORA 2F5VA 3OR1C 4GRIA 3OY9A 4XLEA 3I9V2 2R7XA 3IAM2 1DGWY 4XLCA 1WJ5A 3DU5A 4BACA 3ONQA 4BXFA 3A1YA 2WY7Q 1G59A 3RSNA 2VB6A 3DEEA 3SZGA 4XLHA 1D1CA 2CS3A 4CCJA 4R79A 5KCMA 3OYBA 3OYLA 2L5QA 4IKFA 3FKJA 2OV7A 3W2WA 4OAZA 1WFXA 2LYCA 4ITVA 1K6YA 5HLTA 3FDYA 1W36C 3OYHA 3OS0A 4BE1A 3HKZA 2MD0A 4E7IA 2W00A 4XOTA 2E60A 4XONA 2DXIA 1WJBA 3GBGA 5CPRB 2WBMA 2E5NA 2XF5A 3OL4A 2VPLA 2DT7B 2W1OA 3LSHA 2UV1A 2DOAA 4F55A 3OR2C 1TZLA 2ZXHA 1P9QC 2VKHA 1JI8A 4BE2A 4XN3A 3MKYB 4KISA 2K9LA 1X19A 3BG6A 1BR4A 3VSKA 3HXLA 4BJ5C 2RREA 1LKXA 2XF7A 2E1MB 2MYSA 4BJ6C 2L2OA 4CCMA 2HVSA 2HQAA 3N05A 4LIVA 4B3XA 3QYEA 1OR7C 2KPMA 3OL3A 3D5SC 4CZCA 1PYVA 1UAAA 2VQCA 2LOOA 2X6YA 2VLAA 1PJRA 3A4CA 1Z3YA 2MFZA 3S3OA 4U7BA 3C2GA 1DP3A 1MMAA 3DWLE 4B48A 3A2KA 2WY8Q 3SYTA 2BVLA 1Y56A 1MNEA 3DU6A 4LG3A 2VXDA 3OYKA 4IQJA 4XKBA 2X51A 3OYEA 3PFYA 1KONA 1D0ZA 3HG9A 2V26A 4PK4A 2JVGA 2IS1A 3QODA 4HRIA 3OYNA 4PJLA 3DLAA 1Y6IA 3RTRA 3OYCA 1D1AA 3OOUA 3AL0C 2R4GA 3OYFA 2Z1DA 4E7SA 4ZC3A 1J09A 3VYSB 3IAS2 3RPUD 4F52A 3E0JB 2Z16A 3HOTA 3OYGA 4RMNA 3VYUB 2WADA 3KX2A 4Y3OA 3K4BA 3K4MA 4CH7A 4DJAA 4E7ZA 3AL0B 1D0YA 4ZDLA 3L2QA 3EUKL 3VDXA 4RLQA 5KNLA 4DIQA 4P5OA 3OYJA 4ZDOA 4BS9A 3NWTA 4D9JA 3U21A 1MW7A 2W7NA 3W2VA 2JA2A 2A5WA 2IXSA 4CCOA 3K4CA 2P0WA 4H4KC 3S3NA 1Z7LA 1SAUA 4PJNA 2Z2SB 2KHMA 2KZVA 3QYBA 2CV1A 4XM3A 2VIXA 2NOJB 2HU9A 2L7KA 2FUG2 5HOOA 3DTIA 4DBQA 3ZXSA 1V5EA 4AU7A 5LFAA 2GOMA 2X6WA 3OMYA 4NNJA 5CQGA 2XSJC 2CW8A 3DPUA 2KQRA 3S93A 4CCKA 1N77A 4J01A 4QPOA 5FROA 3LSGA 3LSIA 4YEJA 2RNGA 3DQVC 3H5AA 3QOEA 2QKLB 4JQFA 3BLYA 3UR3C 3LFUA 2LREA 3I3LA 3D5LA 3LL7A 3H9QA 1YE9A 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT7 B;  2DT6 A;  2E60 A;  1X4O A;  4DGW B;  1X4P A;  1UG0 A;  2E5Z A; 
#chains in the Genus database with same CATH topology
 5FGM A;  4LGW A;  2PFB A;  2DT5 A;  4EJO A;  4HQM A;  4U0Y A;  3NRV A;  3G1L A;  3FHN A;  2YU9 J;  1HKT A;  3WU0 A;  2HZD A;  2JMW A;  2PLY A;  3E6C C;  5JVT A;  4BHC A;  3BG5 A;  1LQ1 A;  1SD5 A;  2F2E A;  2PMH A;  4N0B A;  1I1G A;  1OYW A;  3KP5 A;  3I71 A;  2W48 A;  2XVC A;  2X1E A;  2BZT A;  1MIJ A;  3BR5 A;  3RKQ A;  2H1L A;  1YIJ I;  1HLV A;  2O9L A;  2LY9 A;  3DKY A;  2KJB A;  4HV6 A;  5K5O A;  5FLM J;  5EDN A;  1MJ9 A;  1K6O A;  1YX3 A;  3JRF A;  2AXL A;  4BQA A;  4PGG A;  4A12 A;  3I4N J;  1W5C C;  3QP5 A;  3E97 A;  2XGC A;  4IZZ A;  3M7G A;  4CYC B;  1IDY A;  2GQQ A;  3RKX A;  4A3G J;  4S05 A;  3GXO A;  1VND A;  4EGZ A;  2XAG A;  1LFU P;  1DUX C;  2VBZ A;  3MCZ A;  4HQE A;  2K9Q A;  1UG0 A;  2JUG A;  4RGR A;  2M8E A;  2XAH A;  3GX4 X;  1BJA A;  3GCM A;  2FOK A;  4MIM A;  4TV7 A;  4G7O F;  1LFP A;  3BRO A;  3O3K A;  1T39 A;  3C7J A;  4ESB A;  1E3P A;  5GAG J;  2BY0 A;  3CJR B;  3IHU A;  4OWR B;  4EAT A;  1XCB A;  3OYM A;  1V54 H;  1U3E M;  4M71 A;  1TP4 A;  3HRU A;  2FMY A;  1VQ4 I;  2PJR B;  4ZYE A;  4PCQ A;  3ZPL A;  3EYY A;  5IP9 J;  4RB1 A;  1MDM B;  2JZY A;  3TDZ C;  2E5Z A;  3SHF A;  2W84 A;  1QNT A;  1I3Q J;  1X1B A;  3Q0W A;  3PSF A;  1TT5 B;  4R8H A;  4BQN A;  3DP7 A;  2CMP A;  1USS A;  2EFN A;  3V8K A;  1MMG A;  2JN6 A;  1OCP A;  2WA0 A;  2JA8 J;  3S1R J;  3FXK A;  5E18 F;  4BUP A;  1NK2 P;  4Y4R A;  2LF8 A;  3FMR A;  1QPI A;  4BQQ A;  5CJ9 A;  3TMO A;  4WXH A;  2GXB A;  3ZQC A;  3KZZ A;  4LB6 B;  4A5M A;  4NC8 A;  3W6J B;  1BI2 A;  1TWF J;  4G94 A;  3H92 A;  2DPU A;  1P7I A;  4RB2 C;  1DQU A;  4K2E A;  3KYD B;  3WTZ A;  5K7F A;  4NUB A;  1NTC A;  3HIF A;  2PQ8 A;  1H9T A;  2AXT C;  1BL0 A;  4GYI A;  2A3S A;  4KA4 A;  1BC8 C;  5J8C A;  2JVH A;  3MKW B;  1OPC A;  3PUB A;  2WV0 A;  1NG6 A;  5GAD J;  2IPQ X;  2OA4 A;  4RAG A;  5DCM A;  3WU2 C;  1FBU A;  2XGX A;  3M3Y J;  2RNJ A;  2F4I A;  2E2H J;  2XAF A;  3U1K A;  5FLX Z;  5D8K B;  3W6K B;  1CQT A;  2YPR A;  1R1T A;  2HTS A;  2M7A A;  4D5C A;  3VOD A;  4HAM A;  2ELK A;  4IQ4 A;  3PNT A;  2ADU A;  4EJW A;  1XGN A;  4E4H A;  1APL C;  5LHH A;  1R4N B;  1Z3X A;  5AIQ A;  3VFZ A;  5D5V B;  3NAU A;  2IJL A;  2ISZ A;  4MGR A;  3S2W A;  1PP8 F;  2IGK A;  4RM2 A;  3EYI A;  1ONV A;  2IRF G;  3CJT B;  3FXR A;  2F5C A;  3BG7 A;  3B02 A;  2HXO A;  4HSR A;  1KA8 A;  1ZYR F;  4L18 B;  1U5T B;  5DEQ A;  1MSE C;  1YW7 A;  3O2P E;  1IRF A;  2FNA A;  2V1N A;  2LY2 A;  1Z21 A;  2IP2 A;  1ZRE A;  3WGI A;  1LPQ A;  4ZYH A;  1O7L A;  5M5X J;  3DPL C;  1FPQ A;  3OYD A;  4EV0 A;  2R7R A;  2Y9Z A;  1BW6 A;  3ECH A;  2GOX B;  1A35 A;  4A3K J;  2MC3 A;  4L9N A;  3QPL A;  4HF1 A;  2KZG A;  2MW8 A;  1FP1 D;  2QGU A;  2R7S A;  2VE8 A;  1MDM A;  1F1Z A;  3HC7 A;  3BTC A;  3IKT A;  4S04 A;  4XMY A;  1WJA A;  3BWG A;  4M9S A;  3K1M A;  3HTS B;  5IT9 Z;  3HGG A;  2KMU A;  1IV8 A;  3CP8 A;  3DEU A;  3MKZ A;  1JKR C;  2M45 A;  5J47 A;  2WAE A;  3CZ6 A;  1MMD A;  5IOY A;  2EV6 A;  3V42 A;  1A6I A;  1P4W A;  2OQR A;  4RB3 C;  1V5G A;  1UHW A;  1FOY A;  1G2H A;  4YEL A;  4XSZ F;  1XDS A;  3FIS A;  3JRA A;  2VQH A;  3TBI A;  3KE2 A;  5DD4 A;  1R49 A;  4PSW A;  1FEX A;  1VQ8 I;  2UUZ A;  3HPG A;  3HJE A;  3DF8 A;  4WCG A;  1W7P D;  4RAF A;  3VYT B;  1W5S A;  2NS8 A;  3W2A A;  4M3G A;  3HL2 A;  2YS9 A;  4I0B A;  2FU4 A;  1JKQ C;  2F6C A;  3W6V A;  3WTT C;  2FF4 A;  2HKX A;  5LRR A;  4GXO A;  2CO5 A;  4A3E J;  2ZME C;  4UY8 I;  1RI7 A;  5DTD A;  3E6M A;  1XS9 A;  3QRF F;  3IRR A;  4YG2 F;  2K5C A;  4Q47 A;  1J0R A;  2XRO A;  1T38 A;  3PO3 J;  2HNH A;  1ZLJ A;  2QWW A;  5LD2 C;  1ZH5 A;  2ECB A;  1D8K A;  2BXZ A;  2M4G A;  2L9S A;  2M0M A;  3G1M A;  3GW2 A;  5E8I A;  4HBL A;  3ABT A;  4BH9 A;  3H5R A;  1X1A A;  2KP6 A;  2YU3 A;  2HPI A;  1HSJ A;  4JX5 A;  2XKP A;  1LE8 B;  1R71 A;  4DYQ A;  3OV8 A;  1D1B A;  3N97 A;  1MND A;  3L2U A;  3CUQ A;  2PJP A;  4UB8 C;  1Z6T A;  3FXU A;  1ZG5 A;  1PDN C;  2LRD A;  5E1Z B;  1FYL A;  1EA3 A;  3DFG A;  3OYI A;  4LB5 A;  5EGO A;  1RPW A;  4G6T B;  2NXN B;  4XOR A;  1FY7 A;  1Z67 A;  2P8T A;  2P5V A;  3I9V 2;  1DGW Y;  2RC4 A;  1Y1V J;  2HFH A;  4KIB A;  4DZJ A;  3KFW X;  1J5Y A;  3LST A;  3GFI A;  3FMS A;  2R7Z J;  2O3F A;  3QAH A;  2NAZ A;  1XGO A;  5LBQ A;  2ZJ2 A;  3DEE A;  3CO6 C;  4R79 A;  2R3S A;  1STZ A;  2G7U A;  1BM9 A;  2E71 A;  5LRS A;  1WFX A;  1TLH B;  2P81 A;  1JE8 A;  4RB0 A;  2LYC A;  1F43 A;  1K6Y A;  5M3F J;  3GTJ J;  3IL2 A;  5HLT A;  3OYH A;  2F5F A;  3FXO A;  4HZF A;  2M0C A;  4BE1 A;  4HX7 A;  2O8X A;  3HKZ A;  4FQG A;  2B7E A;  2W00 A;  1RKT A;  4HA8 A;  1WJB A;  5GAH J;  2XF5 A;  1DU0 A;  2DOA A;  2A07 F;  2KDZ A;  2BGC A;  1X58 A;  3BT9 A;  5J40 A;  1V55 H;  2DQR A;  4A3I J;  1YIT I;  3GME A;  3H3Z A;  4XK4 A;  5B1B H;  2ZXH A;  1FTZ A;  4A3C J;  2FOW A;  3I59 B;  3J80 K;  2X0L A;  3QWL A;  3J7A O;  1PP7 U;  1BR4 A;  2K4B A;  4BJ5 C;  2RRE A;  1LKX A;  2V1X A;  2HVS A;  3MFK A;  1HKS A;  3PUF A;  2FRH A;  3JAM Z;  2EIN H;  2KPM A;  3TQN A;  1MNM C;  1PYV A;  3HYI A;  4RAZ A;  1ZAO A;  5IP7 J;  3JRD A;  2COM A;  4QLC U;  2JTV A;  3GTM J;  3AG2 H;  2VLA A;  1ETO A;  4F7Z A;  1FBQ A;  5E1W A;  1Y8Q B;  1HOM A;  2QCO A;  3F21 A;  4GFB A;  1T08 B;  4Y17 A;  3ZQ7 A;  3DWL E;  3G6E I;  4B48 A;  3A2K A;  1MH4 A;  1ON1 A;  2BVL A;  3RYP A;  3CME I;  3DU6 A;  1W0U A;  3RZD J;  2JQ7 A;  3OYK A;  2G9W A;  4HF0 A;  2C6Y A;  5ERI A;  2EIL H;  2STW A;  4BXX J;  1D0Z A;  5H20 A;  2R0Q C;  2EBI A;  2JVG A;  4MTD A;  3TO9 A;  2GXG A;  2COB A;  3J81 K;  4DQ2 A;  1WI9 A;  2FQ3 A;  2XRN A;  1I39 A;  1A31 A;  2G7H A;  2KJC A;  1FT9 A;  3RTR A;  1ORK A;  1MBJ A;  1FX7 A;  1K61 A;  1RUN A;  1D1A A;  2DMN A;  3OOU A;  1SD7 A;  3SZT A;  1H8A C;  4AVP A;  1L0O C;  2R4G A;  3AL0 C;  3S16 J;  3G4S I;  3ZQH A;  4E7S A;  1FBS A;  2QEN A;  5ILS A;  3HGY A;  4F52 A;  1P4A A;  1UB9 A;  3OYG A;  4IO9 F;  4B09 A;  4RMN A;  1XPX A;  1OQY A;  4ENM A;  3KX2 A;  1HW5 A;  4KUM A;  1WSU A;  2M5W A;  5JLW A;  3EUK L;  4IRH A;  2DK8 A;  3FXM A;  1BIB A;  2Y75 A;  1ZG3 A;  3JSO A;  1Z9C A;  4RAY A;  2D45 A;  4DIQ A;  1KQ8 A;  3F0C A;  3A02 A;  1B9N A;  2MG4 A;  5EGO B;  4OOI A;  2B0L A;  2UZK A;  3QU3 A;  2H8R A;  3P7N A;  3G73 A;  1LDJ A;  1MH3 A;  4H4K C;  2ZO4 A;  2QBY A;  5D5U B;  4PJN A;  4AUX A;  1FIA A;  1S7E A;  1QVT A;  2JPB A;  2VIX A;  2NOJ B;  2BY3 A;  4DBQ A;  3PQJ A;  1V5E A;  2Q8K A;  1RR7 A;  2CU7 A;  3GLX A;  1WVR A;  2QYO A;  3ZQL A;  4NNJ A;  2QSH X;  2CW8 A;  3M8F A;  2KQR A;  1S8N A;  4HX8 A;  1LNW A;  2CUE A;  1ODD A;  4ZZD A;  1SAN A;  1GUU A;  4UNO A;  1LVA A;  3V4G A;  1U9N A;  2D2W A;  1G3T A;  4A6D A;  1KYZ A;  2DFE A;  1PUE E;  3GO5 A;  2MLK A;  2M8G X;  2K4J A;  1Z77 A;  3H5A A;  2WTE A;  2F4O B;  2QKL B;  2XHK A;  5F0C A;  3RIR A;  3BLY A;  2L3D A;  4IEJ A;  2WWY A;  3MEX A;  3CCM I;  1YE9 A;  3PIP F;  2VJ5 A;  2OZ6 A;  1T98 A;  2ECC A;  3K4L A;  2K3P A;  2O5R A;  3MAJ A;  3RQI A;  4WXC A;  2CV2 A;  1DGR M;  3IH4 A;  2R7F A;  4HF2 A;  4MEX F;  2L7F P;  1ZRD A;  1YS7 A;  1H88 C;  3OS1 A;  5B3S H;  1JKP C;  1QBJ A;  4OAY A;  1WCM J;  2M4K A;  3R0A A;  3HRS A;  1P2F A;  4DYR A;  1P92 A;  1V5F A;  4UUT A;  4MNU A;  2NVY J;  2Z33 A;  1I3A A;  1DP7 P;  1OYY A;  2MC4 A;  4RM3 A;  4C2U A;  1GVD A;  1SFX A;  1R23 A;  1B59 A;  4W97 A;  1D3Y A;  3T8R A;  1J9I A;  4A2U A;  4AM3 A;  5CVV A;  1HDD C;  3FWE A;  1GDT A;  1VQ6 I;  2CUF A;  4PFP A;  2IBD A;  3TDU C;  2OC6 A;  3CF2 A;  5F0H A;  1IGN A;  2RQQ A;  2L02 A;  3KP3 A;  4KDP A;  1H9G A;  4F91 B;  2GM4 A;  4MHG A;  4Y13 A;  1JUM A;  2W24 A;  2X1D A;  1S7O A;  4XKC A;  2MGQ A;  4HV5 A;  1O3Q A;  1UG2 A;  3ZMU A;  1T2K A;  2XAU A;  4N9H A;  4F92 B;  3AFH A;  2ZXI A;  4PFO A;  3LSK A;  5IT9 K;  4L5I A;  4AIK A;  3Q9V A;  2XB5 A;  4YIF A;  4UVC A;  2ZSH B;  4LLL A;  3IV5 A;  3KP4 A;  2IA0 A;  3EPZ A;  4G6Q A;  2CUJ A;  4EM2 A;  1YHQ I;  4BJT A;  3U9G A;  4AYB N;  2XSD C;  4IHT A;  5HNF A;  3GTO J;  1MMS A;  3K6G A;  2DDA A;  2CQN A;  2P5K A;  3BCA A;  4U87 A;  4CCL A;  5IP6 A;  4J00 A;  1QZY A;  4XLF A;  3L9F A;  4WK8 F;  2K27 A;  3HTU A;  3WU1 B;  3SFI A;  4L9V A;  4FE4 A;  3WE2 A;  2VXZ A;  5C44 J;  5E17 F;  4FE7 A;  1XGS A;  1QZZ A;  1U5T C;  1I6X A;  4I6Z A;  5B66 C;  2QA4 I;  4KT6 A;  4LFU A;  1WJE A;  5FKO A;  5CVR A;  2QEX I;  1AU7 A;  1N25 A;  2E7X A;  4O6J A;  2KFD A;  3HOZ J;  2AHQ A;  1F9N A;  2K3F A;  2FXA A;  3HKZ N;  2MSY A;  3K2A A;  3PL8 A;  3FHZ A;  1POG A;  2A5Y B;  4IHX A;  4E7H A;  4EJU A;  4Q48 A;  1T33 A;  2XGE A;  1SVL A;  4B44 A;  4I02 A;  2F5D A;  4IRG A;  4D1Q A;  2HOS A;  3GTK J;  4PSX A;  3LSR A;  3F8C A;  2K40 A;  4BE0 A;  1WJF A;  2NVX J;  2R7V A;  2DMU A;  2JA7 J;  5CQE A;  1XMA A;  2JSC A;  2X6X A;  2YX7 A;  4U0W A;  3LMM A;  1YX5 A;  5EG0 A;  1X4P A;  4OIP F;  2ISY A;  2HXI A;  3ZMT A;  2R7Q A;  5FB2 A;  2XPU A;  5FKN A;  1SAX A;  1YW9 A;  4B1R A;  3FZV A;  3DKX A;  3TW6 A;  1PUF A;  4I2O A;  1MMN A;  2CW7 A;  2CG4 A;  2H1K A;  1WRJ A;  4MQV A;  3J7Y J;  1FZP B;  2Y0M A;  3CCR I;  2M7B A;  3JAM K;  2OCC H;  3VOE A;  2VOD A;  5K1Y A;  5H2F C;  3GFM A;  4V2G A;  4P96 A;  3CCQ I;  2DN0 A;  1UCR A;  1A04 A;  3QOP A;  2K02 A;  3BPX A;  5D5W B;  1VQ7 I;  2HKO A;  4PJJ A;  2LBF B;  1G6N A;  3L2C A;  1IUY A;  5JI6 A;  2Z99 A;  3K4N A;  2VC1 A;  2L9V A;  5ICG A;  2CQK A;  4ZTJ A;  5J6X A;  1XSD A;  2DAO A;  1WWX A;  2LF7 A;  3AKZ A;  2ZCW A;  4KN4 X;  2ME6 A;  4ENN A;  4XL9 A;  4HW0 A;  1UFM A;  2R7O A;  2W4S A;  4X0G A;  1IN4 A;  3HPH A;  2QKM B;  2XV4 S;  3GF2 A;  2XPV A;  4E6K G;  4YRV A;  1VQ5 I;  4XKW A;  1GV2 A;  4J19 A;  1HW1 A;  1TNT A;  1R7J A;  4V19 K;  3E7L A;  3NWS A;  2V9P A;  5IYD J;  4F93 B;  1BJZ A;  1JJ8 C;  1WQ2 A;  3JRC A;  1NG7 A;  2VPR A;  2FML A;  4I98 B;  4HNU A;  2QVO A;  3IH3 A;  1ZGJ A;  3KYC B;  3QPS A;  2DI3 A;  3OIP A;  5FKL A;  2VQL A;  3CJN A;  1X4O A;  4IHW A;  4X6A J;  4BBS J;  3CC7 I;  4CIC A;  3MWM A;  3PM1 A;  4KIF A;  3LQR A;  4DOZ A;  2KL4 A;  1Y0U A;  2OUM A;  5F64 A;  1TWH J;  2VJJ A;  4MTE A;  4XBF A;  1ON2 A;  3FMQ A;  4BGD A;  1LUJ B;  5GPC A;  4E7K A;  1IV6 A;  3OSF A;  1Z6R A;  1QZE A;  3J7Z I;  3L2W A;  5EG0 B;  2OU2 A;  3SDG A;  4KIG A;  1JKO C;  2A6E F;  1IN8 A;  2EA4 A;  4IOC F;  3WGH A;  2V7F A;  4XLA A;  3KCC A;  4BDZ A;  2W82 A;  3V8J A;  4NDL A;  3LA3 A;  1QHH D;  1S6L A;  4IL6 C;  1SFE A;  1R6R A;  3PNY A;  3KP6 A;  2LSO A;  3TO7 A;  3M4O J;  4QPQ A;  1ZEL A;  4UB6 C;  1ERD A;  1UST A;  3MKL A;  2BV6 A;  2HVQ A;  2AO9 A;  2DT6 A;  5E8G A;  3VSL A;  3IKV A;  4CCN A;  3ZN1 A;  2VJI A;  5C3E J;  2LP0 A;  5M5Y J;  3G71 I;  2P5L C;  2HDC A;  3K10 A;  3TO6 A;  1TL8 A;  4CA0 A;  4Y33 A;  1T0F C;  2DPD A;  3JTH A;  2LY1 A;  4ANJ A;  1IJW C;  3J81 Z;  3BTL A;  4LIU A;  1IN6 A;  4M73 A;  1U9O A;  2DFI A;  2JT1 A;  3G1O A;  3TED A;  3P9K A;  5E3L A;  2ICW G;  3ZGK A;  5IPA A;  1G3Y A;  2BW3 A;  1R36 A;  3REO A;  3TGN A;  1YRN B;  2HOE A;  5A2Q K;  1OCC H;  4A0Z A;  2X4H A;  3HSR A;  1B4A A;  5IT3 A;  5K7Z A;  3CD6 I;  2FA5 A;  4WF2 A;  2X85 A;  1K4S A;  2ZXJ A;  2ELJ A;  3BP8 A;  1B6A A;  3WTV C;  3JCU C;  3I55 I;  4E7J A;  1XSX A;  4RS8 A;  3L1P A;  3G2B A;  4AID A;  3IUO A;  1QGP A;  1BC7 C;  3CLQ A;  4XRF A;  4RGX A;  5LGT A;  1T8I A;  5F08 A;  4A3M J;  4YFK F;  2CFO A;  2B63 J;  3OR1 C;  1O4X A;  2LTP A;  1P4X A;  1WJ5 A;  4ESJ A;  4C2M J;  3A1Y A;  4M9Z A;  2DQL A;  3BQZ A;  2EB7 A;  4XLH A;  1XTA A;  3OYB A;  4M3D A;  3F23 A;  2LKS A;  3HOX J;  3WOD F;  3W2W A;  1B1B A;  5GP9 A;  2CQX A;  1XX5 A;  2STT A;  2P6T A;  1ETK A;  3FDY A;  4CZZ A;  3I0T A;  3OS0 A;  2JK3 A;  2DA5 A;  3HBL A;  2FQ4 A;  1E3H A;  2MD0 A;  4FX4 A;  2E60 A;  3K69 A;  4XON A;  2DXI A;  2M2E A;  6PAX A;  3GBG A;  5CPR B;  1JUP A;  2E5N A;  2VPL A;  1FWZ A;  3M07 A;  4I01 A;  3LWF A;  2W1O A;  3LSH A;  4W1U A;  2UV1 A;  2B9S A;  4AD9 A;  4F55 A;  1AKH A;  3PO2 J;  5LHG A;  3OR2 C;  3P9I A;  4RGS A;  2HYJ A;  3D0S A;  2TCT A;  3GTP J;  4XN3 A;  1W5T A;  2EK5 A;  3CF5 F;  5IYB J;  3G3Z A;  5BOX A;  2XF7 A;  1GHC A;  2XKO A;  4IPA A;  2JRM A;  2ZJR F;  4LIV A;  3QYE A;  3OL3 A;  2Z3Y A;  2P7V B;  1X2M A;  1ETY A;  2K85 A;  3L00 A;  2PBI A;  1UZC A;  5FD5 A;  3L09 A;  3E6D A;  3FM3 A;  1PJR A;  1HKQ A;  4P9F A;  2WB1 N;  1EH7 A;  2RN7 A;  3C2G A;  2BYV E;  2GZW A;  3SYT A;  1W7P B;  4XIC A;  1YOV B;  2L9R A;  3F8F A;  2ZME A;  2VXD A;  4IQJ A;  4XKB A;  3QP6 A;  1YJ9 I;  4QSH A;  3RJP A;  3HG9 A;  1U78 A;  3HDD A;  5DDG A;  5E3N A;  2IS1 A;  4UVB A;  1XC5 A;  1J7K A;  1LEB A;  3OYN A;  4PJL A;  5KAI C;  3DLA A;  3MQ0 A;  2D1V A;  3X2Q H;  3GTQ J;  2ZC2 A;  2KRF A;  4L5J A;  2DK5 A;  3OYF A;  2Z1D A;  4XLP F;  1TBX A;  1Y8R B;  4ZC3 A;  3VYS B;  1OFC X;  2O03 A;  1YW8 A;  1LJ9 A;  3E0J B;  2Z16 A;  9ANT A;  5B5E C;  2IA2 A;  3I53 A;  3NAR A;  4CH7 A;  3F6O A;  3AL0 B;  2DOF A;  4ZDL A;  4A5N A;  3HB9 A;  4I76 A;  3L2Q A;  1P7J A;  2L01 A;  3H1C A;  2L4A A;  3E3V A;  4EQQ A;  4RLQ A;  1G4D A;  1LFB A;  3ZMS A;  4ZDO A;  1WI3 A;  1XMK A;  4BHB A;  1IZ1 A;  3NWT A;  2UXX A;  4EEF G;  1U5T A;  3U21 A;  1XGM A;  2TRT A;  2W7N A;  3K0L A;  2FEZ A;  1LB2 A;  3K4C A;  1R4M B;  5BNG A;  3HEF A;  3RPQ A;  2DA7 A;  4MFD A;  5IOZ A;  4IJA A;  1YIO A;  1XG1 A;  4ZZL A;  4KMF A;  4XRS G;  2KHM A;  3CDI A;  3ABU A;  5J1U A;  2NVT J;  2KZV A;  5GTI C;  2CV1 A;  3QPH A;  5K7H A;  5HOO A;  3DTI A;  5LHI A;  3WTY C;  4G9Y A;  2GOM A;  1V4R A;  2X6W A;  3OMY A;  2XPW A;  5D4R A;  2VON A;  1FP2 A;  1EH8 A;  2KT0 A;  4CCK A;  1HF0 A;  3Q3S A;  1KU9 A;  3BZK A;  2NNN A;  3M8E A;  1IN7 A;  5FRO A;  3JW4 A;  2J5O A;  1ZRF A;  3IH2 A;  3DBL B;  4YEJ A;  4HLY A;  3C2B A;  1Z1D A;  1ZRC A;  1KU7 A;  2EV0 A;  4BNC A;  4C3I J;  1QQI A;  5BPD A;  1H0M A;  3F3X A;  3D5L A;  5LEK A;  4R1H A;  5J1R A;  2DBB A;  4CXF A;  4A3F J;  2BHY A;  1S72 I;  2P4W A;  3E6B A;  1S29 A;  2KIU A;  3H35 A;  1DPR A;  2LH9 A;  5FO5 A;  3GZ5 A;  2VKD A;  4RDU A;  2L9N A;  1HXD A;  5H6Q A;  1TW3 A;  4DNC A;  4RBO A;  3BPV A;  4PJ0 C;  3BG9 A;  1B72 A;  2CYY A;  3H0D A;  2F48 A;  1XMX A;  3I54 A;  5CVI A;  2R7U A;  1YJN I;  1EV7 A;  3R6S A;  4H0E A;  5HDK A;  2TDX A;  3WG7 H;  1GV5 A;  4AIH A;  1W0T A;  4ZDP A;  3HM5 A;  2IAI A;  1XSV A;  3HUG B;  4PZJ A;  4QWQ A;  1SVM A;  2DOE A;  3P5J A;  3SDB A;  2BVM A;  1HBX G;  4OIO F;  4M74 A;  2HQN A;  3QQA A;  4C9Y A;  3OIQ A;  3RDI A;  3WTX C;  1YYV A;  5L3F A;  5FRN A;  2DJI A;  3K1N A;  2IS2 A;  2BOL A;  4EVI A;  1BOB A;  1TWG J;  5EJC A;  2BXY A;  3FF5 A;  2KKO A;  3GFL A;  5FKM A;  5B1A H;  4XRM A;  1HQC A;  5CKT A;  2HDW A;  5FFX A;  1HDP A;  4EGY A;  2VJ4 A;  5C4X J;  5GTH C;  3ABK H;  4A3L J;  1PVE A;  2ME0 A;  1BR2 A;  1ZGA A;  5L3G A;  1AWC A;  1Y39 A;  2IT0 A;  4EM0 B;  5DS9 A;  3CDL A;  2K9M A;  2YUS A;  3TOB A;  4FTH A;  2I8D A;  2VQG A;  1FSE A;  3FKI J;  1TWA J;  4M3B A;  4F3Q A;  2E36 A;  3K2Z A;  1R1U A;  4WWC A;  3ASN H;  1LE8 A;  1T0F A;  2J5P A;  4LMY A;  1W7P A;  3UNG C;  4IX7 A;  3CCU I;  1BBY A;  1S7A A;  2L4M A;  1VQ9 I;  3BQY A;  4BDY A;  3S2D J;  2FX0 A;  1IRX A;  3HRM A;  3JSP A;  2DCE A;  2BHZ A;  3Q9S A;  4O3M A;  3AG4 H;  2KDO A;  5ICC A;  1ETX A;  3BCB A;  1E2X A;  1X3W B;  3ML6 A;  5FD6 A;  5EEG A;  4ZJZ A;  3BJ6 A;  3GFJ A;  2OQG A;  1OCR H;  2Q0O A;  3GZN B;  4AVZ A;  5HDN A;  1U8R A;  3HZJ A;  3KP7 A;  1U0J A;  4A0X A;  1O3T A;  2M3A A;  4DYC A;  2Y2Z A;  4LD5 A;  4D0P A;  4ENK A;  3OOP A;  1SFO J;  2A05 A;  5TIS C;  2XIG A;  1VFC A;  1OYI A;  1FOX A;  1JTX A;  1OR7 A;  2HGC A;  3DTK A;  1UEL B;  1CGP A;  1BW5 A;  1J75 A;  2N8G A;  4FET A;  3S32 A;  4N4O B;  5JLX A;  1IRZ A;  2IGM A;  2HQR A;  4U88 A;  2Z9O A;  2R5Z A;  4BEH B;  2IS4 A;  1KZH A;  2EIJ H;  1SFK A;  3NQO A;  2ESH A;  3L2R A;  3V7R A;  4G7H F;  2LLK A;  2VUM J;  5EF6 A;  3R0J A;  1Y0N A;  4MFE A;  2Y31 A;  1FMW A;  2KIM A;  3R60 A;  4II3 A;  3OWT A;  3CC2 I;  3LSP A;  1OKR A;  3OSG A;  2QSG X;  3SXY A;  1X1P A;  2OAZ A;  4G8X A;  3PIO F;  3ZP5 A;  2E34 A;  3FX3 A;  4I0A A;  2WB1 A;  4PJM A;  2GIV A;  3A03 A;  3MD2 A;  3BR0 A;  2L0K A;  1O57 A;  3PSI A;  3D1N I;  1KU3 A;  1ZAR A;  2VBX A;  2XC7 A;  4GCV A;  4JBA A;  4IOA F;  5DM6 F;  2DA2 A;  5ICF A;  1RIO H;  2ZXW H;  1VQK I;  2XB0 X;  3H9G A;  1O3R A;  5HLH A;  2LNB A;  4S0H B;  2R5Z B;  2NS7 A;  2VC0 A;  2OZU A;  3GEZ A;  1MBG A;  3MZY A;  3ELK A;  3LSM A;  4B4C A;  2RQP A;  5DV5 A;  5F6F A;  1RUO A;  3CCV I;  4LG0 B;  3CUQ C;  2EA2 A;  1X1D A;  3GTL J;  1TQI A;  2A68 F;  2BE5 F;  4GGG A;  3FBI B;  4PUS A;  3RCO A;  2ZFU A;  1O3S A;  2VI6 A;  1TNS A;  3F6V A;  3RI4 A;  1OCZ H;  1MBE A;  3C3W A;  4DZP A;  1X2N A;  4BBR J;  4FHT A;  2IW5 A;  2PX9 A;  1KYW A;  1OMI A;  1FMV A;  1Z91 A;  1ZKG A;  4HG2 A;  4NC7 A;  4X1E A;  1GXP A;  4A3D J;  1Y1W J;  4NQW B;  3I4M J;  4KFC A;  4NBQ A;  5IY5 H;  4E7L A;  3KYL A;  4LJZ F;  5DCM B;  1V3F A;  3DTE A;  2PJR A;  2NVQ J;  2LVS A;  1RET A;  4B47 A;  3BC8 A;  5JVG F;  2IEK A;  3AAF A;  3E5U A;  5E20 A;  5D4S A;  2MBF A;  2O8K A;  2W57 A;  2JPC A;  2KLO A;  1FTT A;  1BIA A;  3KEY A;  3ZMD A;  3H5N A;  4XSX F;  3OYA A;  5EEA A;  3COA C;  2E1M C;  1TW2 A;  1JHH A;  4BQO A;  4QTR A;  3GUD A;  4FAS D;  3PFI A;  2CH0 A;  2F4M B;  4XR6 A;  2LBF A;  2PG4 A;  2YR2 A;  3K70 C;  2FE3 A;  2GBY A;  4CSW A;  3M1C A;  4UUS B;  4DBR A;  2Y0S N;  3KP2 A;  2VAS A;  4ABZ A;  4LK0 F;  2CGP A;  3ABM H;  2V6C A;  2E19 A;  2I10 A;  2EV5 A;  1SEU A;  4C30 A;  1DDN A;  4HNV A;  1I50 J;  4UV9 A;  1YLF A;  4A0Y A;  1SMT A;  2M34 A;  1JGS A;  3U2R A;  5ILV A;  2UWM A;  4GYG A;  1LEA A;  4QIW N;  2HZT A;  1YS6 A;  2DFH A;  1YJW I;  4P1W A;  3QYF A;  5D8L B;  3KLO A;  2K9S A;  1S9H A;  3I4P A;  3HOS A;  4XNF A;  1OLT A;  5DD8 A;  1T6S A;  2LDU A;  3BR1 A;  2OD5 A;  2V1D A;  1F5T A;  4XRS A;  5J8F A;  4HYE A;  4A6E A;  1VF9 A;  3CLO A;  3CCJ I;  2JRT A;  4UUS A;  2NRA C;  2NS0 A;  2E35 A;  1VTN C;  2AS5 F;  3BDD A;  2DMQ A;  4HST A;  2XF6 A;  3CO7 C;  4M3E A;  2DTR A;  2H09 A;  5BS6 A;  4AIJ A;  4XOP A;  2DMP A;  5DM7 F;  2GXA A;  2PN6 A;  3JTG A;  4IHV A;  4HEA 2;  3E1S A;  2FBH A;  1LDK B;  1WJD A;  4XN0 A;  2HYF A;  1F36 A;  4OIN F;  3F72 A;  5FRM A;  5BQT A;  2XDV A;  4Y7N J;  3MMY B;  1BI1 A;  1XD7 A;  2LC2 A;  1AA7 A;  3CCS I;  2XAQ A;  3KEQ A;  5DUI A;  2BY1 A;  1D0X A;  1ZK8 A;  2F5V A;  5GPA A;  3OY9 A;  4BY1 J;  1DU6 A;  3IAM 2;  2ZKZ A;  4BXF A;  1ETV A;  3QU6 A;  1M1E B;  4BYY A;  2WY7 Q;  2VB6 A;  3SZG A;  1D1C A;  2CS3 A;  4CCJ A;  5KCM A;  1B9M A;  1FOW A;  3TW7 A;  4ZH4 F;  4M3F A;  3DCF A;  3FKJ A;  4OAZ A;  2P7C B;  3KPH A;  2CQQ A;  3LAP A;  1K4T A;  3UKG A;  1W36 C;  4XLN F;  2R7D A;  1VQP I;  5C4J J;  1K78 A;  3HSE A;  1UHM A;  4YFX F;  4E7I A;  4L0Y B;  4XOT A;  1K78 B;  2V1U A;  3CCE I;  1BOA A;  1B72 B;  3ZQF A;  1QO0 D;  3KZI C;  3OL4 A;  2DT7 B;  3LA2 A;  4U0V A;  2H8W A;  2E2I J;  3S1M J;  5CVJ A;  3ULQ B;  3A01 A;  1JTY A;  4PGH A;  3S17 J;  2ZJP F;  1Z7U A;  2OTL I;  5HLG A;  1MGT A;  2EFO A;  3DLL F;  1JI8 A;  3AG1 H;  3MKY B;  1FOK A;  2K9L A;  2FJ1 A;  3VSK A;  1Z0X A;  3HXL A;  2E1M B;  2HQ5 A;  2MYS A;  3GTG J;  4CCM A;  5J4V A;  2HQA A;  1P6R A;  2FBI A;  2DO7 A;  3N05 A;  3JRH A;  2VT2 A;  2H6B A;  2GA1 A;  4CZC A;  4I99 C;  2LOO A;  1DPU A;  1RKW A;  2EFP A;  3A4C A;  2WV1 A;  3K7A J;  4P9U A;  2FBK A;  1DP3 A;  1MZB A;  3NEU A;  4U7D A;  2LFB A;  2ID3 A;  5HS8 A;  4OIQ F;  2HYG D;  1QA6 A;  4Y15 A;  1HC8 A;  1Y56 A;  1MNE A;  1ULY A;  2E7W A;  2QZ8 A;  4LG3 A;  4NB5 A;  2EZI A;  4FIS A;  4Z6Y A;  2ID6 A;  4L9J A;  3TP0 A;  1D5V A;  2X51 A;  3OYE A;  3BR2 A;  3PFY A;  3R4K A;  1FIP A;  1KON A;  4DW6 A;  2O61 A;  5D6E A;  2V26 A;  5E1X A;  4C3H J;  2XUB A;  1WGX A;  1YO5 C;  2EIK H;  2JUC A;  2K7L A;  2WAQ N;  2DDB A;  5JFR A;  3MVP A;  4O5V A;  4AWX B;  2Y48 A;  3SQN A;  1X3Z B;  1J2X A;  3FM5 A;  1S5L C;  1FNN A;  2E1O A;  3IAS 2;  1A6Q A;  2V79 A;  3E5X A;  3HOT A;  5IYC J;  1OIS A;  3A0B C;  5E79 C;  2PMZ N;  2LR8 A;  2WAD A;  4D5F A;  1FLI A;  3K4B A;  3K4M A;  1JXS A;  2MH9 A;  4E7Z A;  4ON0 A;  5E3M A;  1D0Y A;  3LNQ A;  2O0Y A;  3S1Q J;  4FCY A;  3VDX A;  4ZYD A;  4ENJ A;  4Z2Y A;  1MSF C;  2L7Z A;  3EET A;  3T5X A;  2LKP A;  3S15 J;  5KNL A;  3K9T A;  4P5O A;  3OYJ A;  2VKV A;  5FJ8 J;  2HTJ A;  2I5U A;  5F1R A;  3CUO A;  3DV8 A;  1W1W E;  3P9C A;  4BXU A;  2MD5 A;  2H6C A;  3RPU A;  3VPR A;  3S3N A;  3CUQ B;  1UHS A;  5CYV A;  2HR3 A;  2PI0 A;  2GIZ A;  1B8I A;  2HU9 A;  3LOC A;  3ZQI A;  1W4M A;  3GWZ A;  3ZXS A;  2DYS H;  2DOD A;  5LFA A;  1WZ2 A;  1EJ9 A;  2DA3 A;  2NVU B;  4CO8 A;  3V7C A;  5CQG A;  1J59 A;  2XSJ C;  1VQN I;  3DPU A;  1N77 A;  4NHJ A;  4UV8 A;  2A6H F;  2ACJ A;  1QVU A;  1JUS A;  2HWV A;  3BG3 A;  3LSG A;  5FKK A;  2EWN A;  1K79 A;  2JA6 J;  1KQ9 A;  5D6F A;  3IWF A;  3RKY A;  5L3B A;  4JQF A;  3UR3 C;  2CFX A;  3CMY A;  3I64 A;  3IRQ A;  3ABL H;  3LL7 A;  3H9Q A;  2RVC A;  2MLG A;  5F1J A;  1ITY A;  3M9A A;  4JX6 A;  5AIP A;  3O8H A;  3VYR B;  1HA8 A;  1I6H J;  2R7T A;  2Y0S A;  1LVK A;  1TT0 A;  4XID A;  2JJ7 A;  1YRN A;  2BW3 B;  2DA6 A;  3FXL A;  1R00 A;  3EUA A;  2OPT A;  3DEW A;  2YX4 A;  1I27 A;  1Z05 A;  2V9K A;  3MN2 A;  3RKW A;  2CRG A;  4HNT A;  5LEJ A;  1ZQ3 P;  5AON A;  5JHU A;  2WAQ A;  4B43 A;  2K86 A;  3B6A A;  3ZRG A;  2PEX A;  3JRB A;  1JJ6 C;  4RGU A;  4M6V A;  2MAB A;  3GZ6 A;  3FXJ A;  1E17 A;  3SZP A;  2E1C A;  1IF1 A;  2DA1 A;  4BU2 A;  3OS2 A;  2CUZ A;  2M1B A;  2PMZ A;  1YFH A;  1D8J A;  2DYR H;  2VKE A;  4G6D A;  3K4J A;  2DU9 A;  2HI3 A;  1IO2 A;  1WHU A;  2F5E A;  4DGW B;  3WHB A;  2WAF A;  2QSF X;  4KMU X;  3EUH C;  1REP C;  4GO1 A;  4N9I A;  5HDG A;  2CQ7 A;  1QPM A;  4BL0 B;  1SD4 A;  3JRG A;  1C0W A;  3JR9 A;  2CV0 A;  5LGU A;  2VOP A;  1SFU A;  2EZH A;  4G12 A;  1IXR C;  1IG7 A;  1BI0 A;  3ECO A;  1G8X A;  4JOM A;  5K5Q A;  2FNP A;  3KIO A;  1MBK A;  2QM3 A;  3D5R C;  2QQ9 A;  4CUG A;  5KAF C;  1SC7 A;  3ZQQ A;  2ZSI B;  4LIT A;  5TGT A;  4ZYA A;  3CMM A;  5FLX K;  2IGN A;  2L54 A;  3K70 D;  2AQE A;  2CJJ A;  3S1N J;  2G0E A;  2QUF A;  2O6G E;  1ZG1 A;  1R1V A;  2M9H A;  2W85 A;  3WTU C;  3T0Y A;  5J4Y A;  2V6E A;  3PJR A;  2CW0 F;  3EDP A;  1QU3 A;  3SEZ A;  1GXQ A;  3SFZ A;  2FSW A;  2LG4 A;  1NK3 P;  1R5I D;  1X1C A;  1WH7 A;  4IF4 A;  4ZTF A;  3TL4 X;  4FT8 A;  3OIO A;  1UJ8 A;  4NC6 A;  1HCR A;  3GYH X;  3CES A;  2QQA A;  2X6O A;  4KYW A;  5HOD A;  5JHF A;  4OU0 A;  4I09 A;  4I7H A;  2X9D A;  4XQF A;  3LFK A;  3VB2 A;  2ZNY A;  2KRH A;  4WX9 A;  3B6C A;  1U8B A;  4ASN A;  1GT0 C;  1NH3 A;  2GAU A;  3BTJ A;  5GAE J;  3F9K A;  2CSO A;  2LD5 A;  1D5Y A;  1R22 A;  2BEO A;  1RNL A;  2IVM A;  1VQM I;  1WH5 A;  1CF7 B;  4BEH A;  2ZME B;  3SEQ A;  3ZN0 A;  1MJA A;  1OCT C;  4RA2 A;  2XRL A;  1NHA A;  3H0G J;  3V8L A;  3WGG A;  3DPT A;  5BMZ A;  3QPT A;  3BOQ A;  1W36 D;  5ICE A;  4M6X A;  3LQQ A;  1EH6 A;  5F0F A;  3MZH A;  3ZMV A;  4A3J J;  1E3O C;  3EUH A;  2GWR A;  4D7M A;  1A5J A;  2AQF A;  1BI3 A;  1BR1 A;  2IGO A;  2EPF A;  2DW4 A;  2Y69 H;  3HOY J;  2VL8 A;  4P55 A;  1VQO I;  3F8N A;  1ENH A;  4A69 C;  3SJM A;  4M6Y A;  2BBY A;  3WTS C;  3Q0U A;  3HOV J;  3A0H C;  2JWT A;  2Q1Z B;  1EKE A;  2V4J C;  2M87 A;  3S8P A;  4N4N B;  2ESN A;  2HS5 A;  4XKV A;  4UVA A;  1IDZ A;  3GVA A;  4HPQ A;  3CP2 A;  2OCE A;  3I5U A;  1KQ0 A;  3BZ6 A;  3K4K A;  3PNV A;  1I1S A;  2ETH A;  1SD6 A;  2X1C A;  1ZR4 A;  2WC2 A;  1JT0 A;  3L7W A;  5CLS A;  3Q0V A;  5JR3 A;  1TC3 C;  1U6G A;  3J7A Y;  1O7F A;  5LLQ A;  2Q2E B;  3DXJ F;  5A2Q Z;  1QHG A;  3RQ4 A;  4AYB A;  2RV8 A;  3C2H A;  3U1D A;  1AOY A;  1L3L A;  2MH2 A;  1R5H A;  4RLF A;  1K83 J;  2HEO A;  3FK6 A;  3IP4 B;  2XAS A;  2H27 A;  5D5X B;  2HOA A;  4EJV A;  2R7W A;  2RDP A;  2R5Y B;  4HDV A;  4FX0 A;  4KIC A;  3FK7 A;  3ROU A;  4YII A;  1KGS A;  1KU2 A;  4L5E A;  3ZQG A;  3M1E A;  2EFQ A;  4CYC A;  2ZJQ F;  3S2H J;  1EF4 A;  2EZK A;  1MBH A;  1FYM A;  2JSP A;  4BY7 J;  4M9X A;  3O8G A;  2L7M P;  5TRD A;  3KLN A;  3H9J A;  5FFZ A;  4G7Z F;  3CCL I;  1YQA A;  2RKH A;  3HOU J;  2W25 A;  3HUG A;  1PUF B;  1TQM A;  2XAJ A;  4CHU A;  1G3S A;  4E70 A;  3VWB A;  4C2T A;  5HNH A;  1LDD A;  2ELH A;  2O7O A;  5KHD A;  2DA4 A;  3CQZ J;  3CJQ B;  4UXN A;  5EZG A;  4MLO A;  3FXQ A;  3ZMZ A;  3S3M A;  4LG0 A;  1FJL A;  4II2 A;  4MO7 A;  2HVR A;  2A69 F;  2OF7 A;  4KIT B;  3IWZ A;  2CWE A;  5LGN A;  4ETS A;  1A36 A;  1CF7 A;  3GLL A;  3N4M A;  3WHC A;  2R93 J;  2DTZ A;  1WPK A;  2E2J J;  1IXC A;  2JA5 J;  4OMY A;  1ZLK A;  5HS9 A;  3H3V K;  1OCO H;  3LA7 A;  4UUV A;  3JRE A;  2DFF A;  1N75 A;  3KEO A;  1WJC A;  2EZL A;  2X48 A;  2KIF A;  1JHF A;  3ZR8 X;  3BJO A;  1TWC J;  1N78 A;  1OJL A;  2ZNZ A;  4AC0 A;  1VZ0 A;  1X3U A;  2A6T A;  5BPI A;  5J1Y A;  3L2V A;  2OTJ I;  3WTW C;  4NQW A;  5CVU A;  3ESW B;  5EZH A;  1TQP A;  5KK1 A;  2KRC A;  5HS7 A;  2HPM A;  1E0E A;  4KJZ A;  2LMD A;  2H94 A;  1ETW A;  4M72 A;  4EJT A;  5HVQ C;  2K9N A;  1IN5 A;  5F04 A;  2IS6 A;  2RGV A;  3E5Q A;  4EMS A;  3DBH B;  3EQL F;  1XN7 A;  4IXA A;  3KET A;  3HHG A;  3FBN B;  2XGD A;  3HSF A;  3M8J A;  5J3L A;  1GLN A;  3T1B A;  1GVJ A;  3BR6 A;  2VT3 A;  1T95 A;  5F27 A;  4A3B J;  3BJA A;  1T56 A;  3R61 A;  3I56 I;  2QF7 A;  3W3C A;  3ZCO A;  3K1P A;  1RRJ A;  5DYM A;  3JRI A;  2A61 A;  4GRI A;  2E1N A;  4L9T A;  4KN7 X;  3KZY A;  1IW7 F;  4XLE A;  1RC9 A;  2R7X A;  2VBW A;  4XLC A;  4BHP A;  2R92 J;  1MJB A;  3DU5 A;  4BAC A;  1IRG A;  3ONQ A;  5HLI A;  2ZB9 A;  3H3U A;  3HHH A;  1FYK A;  3J80 Z;  1G59 A;  2MA3 A;  2NNY A;  2V9V A;  4WXD A;  3RSN A;  2R5Y A;  2D5V A;  4L0Z B;  1G3W A;  4HLX A;  3OYL A;  4IKF A;  2L5Q A;  3BTI A;  3CMA I;  3RZO J;  4CGZ A;  2OV7 A;  2QQB A;  1B8I B;  1AKH B;  1Q1V A;  3ZOB A;  4ITV A;  2LK2 A;  1BN5 A;  3RYR A;  2OJE D;  4YFN F;  3PQK A;  1YTY A;  4HDU A;  3TP3 A;  5DCF A;  2Z5U A;  2Q2E A;  3ERM A;  2HOT A;  5E3O A;  3TKY A;  3CC4 I;  3DKW A;  2WBM A;  3ERE D;  3C1D A;  5TJJ A;  4Q4Z F;  1R9T J;  2M30 A;  4JP0 A;  3DBR B;  1TZL A;  1WKM A;  1Q1H A;  2VE9 A;  1I5Z A;  1P9Q C;  2VKH A;  4OIR F;  4BE2 A;  4JK1 X;  1UMQ A;  5FLV A;  3BZC A;  2RAE A;  4KIS A;  1X19 A;  3BG6 A;  4IVN A;  3WG9 A;  2GLO A;  1U2W A;  4GDF A;  4V2F A;  3C18 A;  4BJ6 C;  2L2O A;  4BKX A;  1RES A;  2KIS A;  3FIW A;  3I58 A;  5ILU A;  4B3X A;  1OR7 C;  4UHT A;  1MD0 A;  5H6R A;  3D5S C;  5EYR A;  3CDH A;  3H36 A;  3F8B A;  1UAA A;  2VQC A;  4MQ9 F;  2X6Y A;  2EQR A;  5KVR A;  1F4K A;  1Z3Y A;  4MEY F;  2MFZ A;  3CCY A;  3S3O A;  3VEP A;  4U7B A;  1ZHF A;  1QRY A;  3ASO H;  4CDG A;  1JGG A;  1AHD P;  5L3E A;  1MMA A;  1MKM A;  2WY8 Q;  2OBP A;  1YI2 I;  1RZ4 A;  1ZGW A;  2BY2 A;  2GA2 A;  4OMZ A;  2FD5 A;  2IA1 A;  1ZR2 A;  4CYD A;  2QLZ A;  4HOB A;  4PK4 A;  2LKX A;  2QBY B;  5DUK A;  2KIQ A;  2HDD A;  3F8M A;  4LOC A;  3B73 A;  1FC3 A;  3QOD A;  3AG3 H;  4HRI A;  3F22 A;  1IAW A;  1Y6I A;  5L3D A;  5L3C A;  2ZFW A;  2NYX A;  3OYC A;  1H89 C;  1FSH A;  1R5G A;  1K7A A;  1HW2 A;  1ZN2 A;  4YIR X;  2YSR A;  5K5R A;  1SMY F;  1J09 A;  1VQL I;  3RPU D;  1BA5 A;  2EFW A;  2DMT A;  1XCV A;  3LSJ A;  4ZYG A;  3VYU B;  4Y3O A;  1MBF A;  1TTY A;  2P6S A;  4DJA A;  1RR8 C;  3I59 A;  4B8X A;  2VOO A;  4A93 J;  2DLL A;  3HRT A;  4IRI A;  3O6B B;  2PMU A;  3T8T A;  4BAY A;  3A01 B;  3Q5F A;  1HST A;  1ETQ A;  4B3A A;  3V7S A;  4BS9 A;  4HX4 A;  1VI0 A;  1YG2 A;  4EM1 A;  2D1H A;  4IHS A;  1IXS B;  4KNY A;  4LLN A;  4D9J A;  3S14 J;  1MW7 A;  2Y9Y A;  3W2V A;  2NOG A;  2JA2 A;  5ED4 A;  1IC8 A;  2A5W A;  2IXS A;  4CCO A;  3TOA A;  2P0W A;  4Y52 J;  4LK1 F;  1SVO A;  3MZ8 A;  2DJN A;  1Z7L A;  1SAU A;  3HOW J;  2Z2S B;  4JYK A;  1ACI A;  2QQ8 A;  3QYB A;  4XM3 A;  2VN2 A;  2L7K A;  4D7N A;  2FUG 2;  4AU7 A;  1IUF A;  3ISP A;  2UXN A;  3BR3 A;  4JX4 A;  4KT5 C;  1JT6 A;  1XDU A;  1R58 A;  4PDK A;  4C3J J;  3IC7 A;  3WE3 A;  4ESF A;  3S93 A;  2Y30 A;  4J01 A;  4QPO A;  2ZBK A;  2EH3 A;  5EEH A;  3LSI A;  3CTA A;  4IHY A;  2RNG A;  3DQV C;  4Q5S F;  1XB4 A;  1ZTR A;  2EJR A;  2EIM H;  3QOE A;  3BY6 A;  4LLG F;  3LFU A;  5M5W J;  2LRE A;  3I3L A;  5M3M J;  2VBY A;  1S3J A;  3LAJ A; 
#chains in the Genus database with same CATH homology
 3K4L A;  3H35 A;  2K3P A;  2LH9 A;  2O5R A;  3FHN A;  2CV2 A;  1DGR M;  3VYR B;  1HA8 A;  2VKD A;  2R7T A;  2Y0S A;  1LVK A;  1TT0 A;  2HZD A;  2L9N A;  2BW3 B;  3EUA A;  3OS1 A;  2V9K A;  4OAY A;  4HNT A;  2M4K A;  3H0D A;  2R7U A;  2WAQ A;  2X1E A;  4B43 A;  3ZRG A;  1V5F A;  2MAB A;  3DKY A;  4ZDP A;  2MC4 A;  3HUG B;  4RM3 A;  4C2U A;  1YX3 A;  3SDB A;  2BVM A;  4C9Y A;  3OIQ A;  4BU2 A;  3OS2 A;  2CUZ A;  5FRN A;  2PMZ A;  2DJI A;  2IS2 A;  3K4J A;  2BOL A;  4IZZ A;  4PFP A;  1BOB A;  2OC6 A;  4DGW B;  3CF2 A;  2WAF A;  2RQQ A;  3EUH C;  5CKT A;  2HDW A;  4BL0 B;  4F91 B;  2CV0 A;  2VJ4 A;  2X1D A;  1UG0 A;  2JUG A;  4XKC A;  1G8X A;  2XAU A;  4F92 B;  3AFH A;  2ZXI A;  1BR2 A;  3LSK A;  1LFP A;  4JOM A;  4PFO A;  3D5R C;  2K9M A;  2ZSH B;  4CUG A;  3CJR B;  3ZQQ A;  2I8D A;  2ZSI B;  3EPZ A;  2VQG A;  4OWR B;  2CUJ A;  4LIT A;  4ZYA A;  3CMM A;  5TGT A;  4BJT A;  2IGN A;  4F3Q A;  3K70 D;  5HNF A;  4EAT A;  2AQE A;  3OYM A;  3K6G A;  3BCA A;  4U87 A;  4CCL A;  4J00 A;  4XLF A;  3UNG C;  4IX7 A;  2V6E A;  2PJR B;  3PJR A;  1QU3 A;  3SEZ A;  2LG4 A;  4BDY A;  2VXZ A;  1IRX A;  2DCE A;  1X1C A;  2E5Z A;  2KDO A;  4ZTF A;  3TL4 X;  1X1B A;  3BCB A;  3PSF A;  4KT6 A;  1WJE A;  4ZJZ A;  4BQN A;  3CES A;  2CMP A;  4AVZ A;  5JHF A;  1U0J A;  4XQF A;  1MMG A;  2KRH A;  2M3A A;  3PL8 A;  2WA0 A;  4E7H A;  4BUP A;  3F9K A;  4Y4R A;  4B44 A;  4BQQ A;  4D1Q A;  3TMO A;  4PSX A;  3DTK A;  4BEH A;  1UEL B;  4NC8 A;  3SEQ A;  4BE0 A;  1WJF A;  4FET A;  3S32 A;  4N4O B;  2R7V A;  2IGM A;  5CQE A;  3DPT A;  1DQU A;  4BEH B;  2IS4 A;  2X6X A;  3LMM A;  1YX5 A;  1SFK A;  3L2R A;  4NUB A;  1X4P A;  1W36 D;  2R7Q A;  1FMW A;  4II3 A;  3OWT A;  3DKX A;  2JVH A;  1MMN A;  2AQF A;  3MKW B;  2CW7 A;  3PUB A;  1BR1 A;  1NG6 A;  2IGO A;  2VL8 A;  2F4I A;  2WB1 A;  4PJM A;  2M7B A;  3MD2 A;  3PSI A;  2Q1Z B;  2V4J C;  3S8P A;  2M7A A;  4N4N B;  2XC7 A;  4XKV A;  4IQ4 A;  3PNT A;  4E4H A;  3H9G A;  4HPQ A;  3CP2 A;  1Z3X A;  3K4K A;  3PNV A;  3LSM A;  2X1C A;  4PJJ A;  2LBF B;  2IGK A;  4RM2 A;  3K4N A;  4ZTJ A;  3J7A Y;  1X1D A;  3BG7 A;  2Q2E B;  3AKZ A;  3FBI B;  4PUS A;  4XL9 A;  3RCO A;  1QHG A;  2ZFU A;  2R7O A;  3RQ4 A;  2W4S A;  3C2H A;  4HSR A;  4AYB A;  4X0G A;  2V1N A;  3HPH A;  2LY2 A;  1Z21 A;  2QKM B;  4RLF A;  3OYD A;  3DPL C;  3IP4 B;  2R7R A;  4E6K G;  4YRV A;  4XKW A;  2R7W A;  1FMV A;  2GOX B;  3NWS A;  4F93 B;  4HG2 A;  4NC7 A;  1NG7 A;  4NQW B;  4HNU A;  2JSP A;  2R7S A;  4E7L A;  3OIP A;  2VQL A;  3HC7 A;  1X4O A;  3KYL A;  3H9J A;  3DTE A;  2PJR A;  4DOZ A;  2KL4 A;  4XMY A;  1WJA A;  2OUM A;  3BC8 A;  4B47 A;  2VJJ A;  2KMU A;  3CP8 A;  4C2T A;  3VWB A;  5HNH A;  3MKZ A;  4E7K A;  4BGD A;  2KLO A;  3KEY A;  2WAE A;  5KHD A;  3H5N A;  3CZ6 A;  1MMD A;  3OYA A;  3V42 A;  3L2W A;  3CJQ B;  2E1M C;  1V5G A;  4MLO A;  4YEL A;  4BQO A;  3S3M A;  4FAS D;  2CH0 A;  4II2 A;  2VQH A;  3TBI A;  2HVR A;  4XR6 A;  2LBF A;  4KIT B;  3K70 C;  2V7F A;  4PSW A;  4XLA A;  4CSW A;  3M1C A;  4BDZ A;  2W82 A;  4DBR A;  2UUZ A;  3HPG A;  2VAS A;  1QHH D;  1R6R A;  3PNY A;  3VYT B;  3W2A A;  4C30 A;  3HL2 A;  4QPQ A;  1ZEL A;  1ERD A;  2HVQ A;  2F6C A;  2DT6 A;  3VSL A;  1N75 A;  4CCN A;  2VJI A;  1WJC A;  2UWM A;  3ZR8 X;  1N78 A;  3K10 A;  4CA0 A;  1VZ0 A;  4Y33 A;  1T0F C;  2A6T A;  3QYF A;  4P1W A;  3L2V A;  1S9H A;  2LY1 A;  3HOS A;  4XNF A;  1OLT A;  2K5C A;  4ANJ A;  2HNH A;  2KRC A;  4LIU A;  2HPM A;  1E0E A;  5LD2 C;  2M4G A;  2L9S A;  2M0M A;  4KJZ A;  3ZGK A;  3H5R A;  1X1A A;  2KP6 A;  2HPI A;  5HVQ C;  2IS6 A;  4HST A;  2XF6 A;  2BW3 A;  4XOP A;  1D1B A;  1MND A;  4HEA 2;  3L2U A;  3E1S A;  1LDK B;  1WJD A;  4XN0 A;  3FBN B;  2LRD A;  2X85 A;  5FRM A;  2ELJ A;  3M8J A;  4E7J A;  1GLN A;  1EA3 A;  2XDV A;  3MMY B;  3OYI A;  2LC2 A;  1AA7 A;  3G2B A;  3IUO A;  1T95 A;  4G6T B;  3W3C A;  3ZCO A;  1D0X A;  2CFO A;  4XOR A;  2F5V A;  3OR1 C;  4GRI A;  3OY9 A;  4XLE A;  3I9V 2;  2R7X A;  3IAM 2;  1DGW Y;  4XLC A;  1WJ5 A;  3DU5 A;  4BAC A;  3ONQ A;  4BXF A;  3A1Y A;  2WY7 Q;  1G59 A;  3RSN A;  2VB6 A;  3DEE A;  3SZG A;  4XLH A;  1D1C A;  2CS3 A;  4CCJ A;  4R79 A;  5KCM A;  3OYB A;  3OYL A;  2L5Q A;  4IKF A;  3FKJ A;  2OV7 A;  3W2W A;  4OAZ A;  1WFX A;  2LYC A;  4ITV A;  1K6Y A;  5HLT A;  3FDY A;  1W36 C;  3OYH A;  3OS0 A;  4BE1 A;  3HKZ A;  2MD0 A;  4E7I A;  2W00 A;  4XOT A;  2E60 A;  4XON A;  2DXI A;  1WJB A;  3GBG A;  5CPR B;  2WBM A;  2E5N A;  2XF5 A;  3OL4 A;  2VPL A;  2DT7 B;  2W1O A;  3LSH A;  2UV1 A;  2DOA A;  4F55 A;  3OR2 C;  1TZL A;  2ZXH A;  1P9Q C;  2VKH A;  1JI8 A;  4BE2 A;  4XN3 A;  3MKY B;  4KIS A;  2K9L A;  1X19 A;  3BG6 A;  1BR4 A;  3VSK A;  3HXL A;  4BJ5 C;  2RRE A;  1LKX A;  2XF7 A;  2E1M B;  2MYS A;  4BJ6 C;  2L2O A;  4CCM A;  2HVS A;  2HQA A;  3N05 A;  4LIV A;  4B3X A;  3QYE A;  1OR7 C;  2KPM A;  3OL3 A;  3D5S C;  4CZC A;  1PYV A;  1UAA A;  2VQC A;  2LOO A;  2X6Y A;  2VLA A;  1PJR A;  3A4C A;  1Z3Y A;  2MFZ A;  3S3O A;  4U7B A;  3C2G A;  1DP3 A;  1MMA A;  3DWL E;  4B48 A;  3A2K A;  2WY8 Q;  3SYT A;  2BVL A;  1Y56 A;  1MNE A;  3DU6 A;  4LG3 A;  2VXD A;  3OYK A;  4IQJ A;  4XKB A;  2X51 A;  3OYE A;  3PFY A;  1KON A;  1D0Z A;  3HG9 A;  2V26 A;  4PK4 A;  2JVG A;  2IS1 A;  3QOD A;  4HRI A;  3OYN A;  4PJL A;  3DLA A;  1Y6I A;  3RTR A;  3OYC A;  1D1A A;  3OOU A;  3AL0 C;  2R4G A;  3OYF A;  2Z1D A;  4E7S A;  4ZC3 A;  1J09 A;  3VYS B;  3IAS 2;  3RPU D;  4F52 A;  3E0J B;  2Z16 A;  3HOT A;  3OYG A;  4RMN A;  3VYU B;  2WAD A;  3KX2 A;  4Y3O A;  3K4B A;  3K4M A;  4CH7 A;  4DJA A;  4E7Z A;  3AL0 B;  1D0Y A;  4ZDL A;  3L2Q A;  3EUK L;  3VDX A;  4RLQ A;  5KNL A;  4DIQ A;  4P5O A;  3OYJ A;  4ZDO A;  4BS9 A;  3NWT A;  4D9J A;  3U21 A;  1MW7 A;  2W7N A;  3W2V A;  2JA2 A;  2A5W A;  2IXS A;  4CCO A;  3K4C A;  2P0W A;  4H4K C;  3S3N A;  1Z7L A;  1SAU A;  4PJN A;  2Z2S B;  2KHM A;  2KZV A;  3QYB A;  2CV1 A;  4XM3 A;  2VIX A;  2NOJ B;  2HU9 A;  2L7K A;  2FUG 2;  5HOO A;  3DTI A;  4DBQ A;  3ZXS A;  1V5E A;  4AU7 A;  5LFA A;  2GOM A;  2X6W A;  3OMY A;  4NNJ A;  5CQG A;  2XSJ C;  2CW8 A;  3DPU A;  2KQR A;  3S93 A;  4CCK A;  1N77 A;  4J01 A;  4QPO A;  5FRO A;  3LSG A;  3LSI A;  4YEJ A;  2RNG A;  3DQV C;  3H5A A;  3QOE A;  2QKL B;  4JQF A;  3BLY A;  3UR3 C;  3LFU A;  2LRE A;  3I3L A;  3D5L A;  3LL7 A;  3H9Q A;  1YE9 A;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...