3S14J

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s14J00
2CQQA 1GDTA 4EEFG 2JMWA 3BQYA 5FJ8J 2XGDA 4B4CA 5EGOA 2HOAA 3BTLA 3JRFA 5IP6A 3HEFA 1CQTA 4IEJA 4M3FA 2Y30A 3JRGA 2R5YA 4ABZA 4AC0A 1JTXA 4QSHA 5JLXA 3JRIA 3M3YJ 1YRNB 2E19A 3B6AA 2O7OA 2ME6A 3SJMA 1PUFB 5IYDJ 3MVPA 3FISA 3TW7A 2XSDC 4C2MJ 4LOCA 1POGA 5F0CA 3TP3A 4RDUA 2X9DA 3GTMJ 1TWAJ 2K40A 4I76A 1IRZA 1Q1VA 1FEXA 2ME0A 3QQAA 3S1RJ 3HKZN 2Y9YA 5IOZA 5FLMJ 4B3AA 1HDPA 3GTLJ 3G1OA 2P81A 3F0CA 1LFBA 5F1JA 3ZQIA 2ZB9A 1UMQA 1MBKA 3B6CA 3DEWA 1X2MA 2EQRA 1W0TA 2LY9A 4Y52J 3CQZJ 4MO7A 1HF0A 4CYCB 4W97A 1D5YA 1JTYA 3ZQHA 4FCYA 1XG1A 2EZIA 1ETQA 2EZKA 2GBYA 1ZR4A 1QVUA 2OPTA 1ZTRA 2DA6A 2CU7A 3GTQJ 3HBLA 3RQIA 1ETVA 2LK2A 2ID3A 2DMNA 4XICA 2GLOA 3GTJJ 4D7MA 1XS9A 4C3HJ 3HDDA 2TRTA 4XIDA 3A01B 1B72B 2E2JJ 1ZGWA 2E2HJ 4A3CJ 5EG0A 3IH2A 3LSPA 1TWCJ 5HODA 2VUMJ 2TCTA 3C2BA 2DA2A 5E3NA 4CYCA 4XRSA 3BQZA 2COBA 4M6VA 3NARA 2L7ZA 1RR7A 3FK6A 3PO2J 5DS9A 1B8IB 2LP0A 4I6ZA 4UUTA 1JKOC 3ZOBA 2NS7A 1JKPC 2FD5A 2JA8J 4MFDA 5C4XJ 2K9QA 4JX4A 3K2AA 4A3BJ 2LVSA 3BTCA 3QPLA 3OIOA 3A01A 3BR2A 1SFOJ 2JA5J 1VNDA 2XPUA 2FX0A 5K7HA 1FTTA 3HGGA 1DU0A 3S16J 4FE7A 5EZHA 2XGEA 4BBRJ 2QCOA 3E7LA 3OSGA 3RZDJ 3S1MJ 3CCYA 5EGOB 2CRGA 4L5EA 1B8IA 3BT9A 3IV5A 3BG9A 1A5JA 2VPRA 3JREA 1RETA 3GTPJ 1JJ8C 3LNQA 1HOMA 2M2EA 2NVQJ 2LTPA 3BG5A 3RKQA 3JRCA 5FLVA 2XB5A 4BY7J 2E1OA 5F0FA 3HOWJ 5EEAA 2K9SA 3JR9A 1JKQC 2W48A 4C3IJ 3MKLA 1MBGA 9ANTA 1K83J 5F27A 2IEKA 2M0CA 5EF6A 4UUSA 4QTRA 2E2IJ 3S17J 3ZQCA 4V2GA 5FKMA 4DW6A 1IV6A 1Z0XA 1WH5A 1QVTA 2DMQA 1H89C 1IGNA 2K9NA 1S7EA 3BR1A 2R92J 2EBIA 3FKIJ 3S15J 1F43A 5C3EJ 2ELKA 1T56A 3HGYA 2PMZN 2HQ5A 3OOUA 1EF4A 4IHYA 5DTDA 5F08A 5M3FJ 1JUPA 1UG2A 2R0QC 1GV5A 1WGXA 1FTZA 3HOXJ 3PM1A 4A3LJ 1K61A 5IP9J 2NS8A 3D1NI 1VF9A 1RKWA 2DA5A 1HDDC 5J3LA 3JRHA 2O9LA 2NOGA 1MBJA 3CDLA 5EZGA 3L1PA 1OJLA 2VKEA 4DZJA 1AKHA 2DJNA 3GTGJ 3HOZJ 5EG0B 2R93J 1WPKA 3HOUJ 1U8BA 4A3GJ 2H1KA 2Y31A 4AYBN 2JJ7A 2XB0X 1FJLA 3GTOJ 3SDGA 3A03A 2R5ZA 2EZLA 3BG3A 2MG4A 4QIWN 3Q0UA 3LSRA 5F0HA 1WH7A 1IJWC 1T33A 4JX6A 5JLWA 1Y1VJ 1IUFA 3LSJA 2JA7J 3IH4A 1JT6A 3LOCA 2FJ1A 5BNGA 3S2DJ 2NVYJ 1LFUP 2MSYA 3ZQFA 3FK7A 3G1LA 5M5XJ 2HDDA 4BXXJ 1I50J 1H8AC 1ETYA 2X6OA 1QPIA 4HNVA 4FTHA 2IAIA 1U9NA 1VFCA 1OCTC 1ORKA 1OCPA 1P7JA 4JX5A 4GFBA 3H0GJ 2XPWA 3G1MA 2DTZA 4A3IJ 2WB1N 5IYBJ 5IOYA 1LE8A 4A93J 1NTCA 1R9TJ 3LSGA 3JRBA 2MW8A 3HB9A 1NK2P 5C44J 2M8GX 2Y0SN 1BW5A 2ID6A 1ETWA 2XGCA 4Y7NJ 1W0UA 1ZKGA 3GBGA 4UUSB 1MSFC 2D5VA 2ECCA 5FKNA 1SANA 2L0KA 4D5CA 3TEDA 4BBSJ 2RAEA 3S1NJ 1ENHA 3W6VA 3GTKJ 1DU6A 2QF7A 4X1EA 3IH3A 2B63J 3S1QJ 2XPVA 2G0EA 5K7ZA 2Y9ZA 2CQXA 3S2HJ 2L7FP 2CUFA 2DA1A 2OF7A 5EDNA 1WCMJ 1ZK8A 1AHDP 1E3OC 5J1RA 2KDZA 3BR3A 4BY1J 4MFEA 4DYRA 4M3DA 1GT0C 1AU7A 1RPWA 1I6HJ 3PO3J 3BR5A 2I10A 3BR0A 3ZQLA 5J1UA 2M9HA 1RKTA 1MH4A 1F36A 1MH3A 2KT0A 2HOTA 5IYCJ 3DCFA 3O8GA 2MGQA 1AKHB 2L7MP 1TWGJ 1MBEA 4MIMA 4AUXA 5C4JJ 4D7NA 4C3JJ 1I3QJ 5F04A 4M3GA 2VKVA 4W1UA 4A3KJ 3MN2A 4J19A 2DA3A 1IG7A 1GUUA 1GV2A 1ETOA 2LLKA 2X48A 4BKXA 3TW6A 3JRAA 2LKXA 3M4OJ 4S0HB 1MBFA 2R5ZB 5GPCA 1U78A 1ETKA 1FIPA 4B1RA 4A3EJ 3RZOJ 3WHCA 1IC8A 2DN0A 2WAQN 2DMPA 1RESA 4D5FA 4IHWA 2EZHA 1BJZA 5IP7J 1TWHJ 3Q0WA 4JP0A 5IPAA 3HM5A 1ZR2A 2M34A 1JGGA 2R7ZJ 1NK3P 3BTJA 1OFCX 2LD5A 4A3JJ 1JUMA 4IHXA 5FKLA 5M5WJ 4JYKA 2YS9A 2CUEA 3CMYA 3S14J 4A3MJ 1JT0A 2FQ4A 2JN6A 1MSEC 2H8RA 1ITYA 2O8KA 2DA4A 2HXIA 1YRNA 2NVXJ 3OSFA 3FIWA 5GP9A 1LE8B 1PUFA 3HOYJ 2DMTA 4FISA 1U9OA 5J1YA 5EYRA 5K7FA 1VI0A 5M5YJ 5GPAA 1H88C 4FE4A 3I4NJ 1GVDA 2LFBA 4NDLA 1BW6A 4XRSG 3ZQGA 2AHQA 2HYJA 2IBDA 1IDYA 1MBHA 4XK4A 3BR6A 4M3BA 1HCRA 1IDZA 2LR8A 2ECBA 3O8HA 5FKOA 1QRYA 3BTIA 2JK3A 1Y1WJ 3TP0A 3A02A 1BA5A 2DMUA 1G2HA 1ZQ3P 2N8GA 3QPSA 1JJ6C 4A3FJ 1TC3C 3I4MJ 1TWFJ 2YU9J 4DYQA 2EH3A 5M3MJ 4X6AJ 3HOVJ 1BL0A 5E3LA 2HI3A 2YUSA 1A6IA 2AO9A 2HXOA 4DYCA 2Y2ZA 2DA7A 2L9RA 4M3EA 3SFIA 5E3MA 3Q3SA 1MNMC 2VI6A 2HOSA 3VPRA 1B72A 3WHBA 1FIAA 4XRMA 4G12A 4V2FA 3Q0VA 1X2NA 2WV1A 3NAUA 1ETXA 3UKGA 4A3DJ 1WI3A 3K7AJ 4DZPA 2JA6J 2NVTJ 2R5YB 2CJJA 2GM4A 2XRLA 3H3VK 5E3OA 2JWTA 4RBOA 1HLVA 3JRDA 1Z77A 1O4XA 1P7IA 4A69C 4IHVA 1X58A 4MLOA 1APLC 1XC5A 5FKKA 1JKRC 1JUSA 1UHSA
chains in the Genus database with same CATH superfamily
3M1CA 1GDTA 3J7AY 1WJFA 3ABTA 1ZG1A 2JMWA 2QENA 1SVLA 2DBBA 1D1CA 2H8WA 3I5UA 5FJ8J 5F64A 1VQNI 1YO5C 2DT5A 3M8EA 4CDGA 1ZREA 1JI8A 3EDPA 3FXLA 5HS8A 2MD5A 1MMGA 1VQ7I 4RLQA 1HKTA 2E19A 4IZZA 2O7OA 2ME6A 2DFEA 2UV1A 3BG6A 2LF8A 3D5LA 1Z6RA 4IHTA 3HTUA 2XSDC 4OIPF 4BQAA 4IQJA 1POGA 4Q48A 3TP3A 1R1UA 4RDUA 1FSEA 2IGKA 3OMYA 3EYIA 3HOSA 5B3SH 1BI1A 4OIQF 4FHTA 3ASNH 2XROA 2ME0A 3S1RJ 1U8RA 1ERDA 3EUHC 3HKZN 2Y9YA 1VQLI 5FLMJ 2H09A 4B3AA 3GLLA 1HDPA 2R7WA 3G1OA 5HLTA 5F1JA 1LFBA 1FBQA 5HLGA 4G7HF 1QBJA 5LRSA 4GCVA 3B6CA 1G3YA 4XR6A 1OPCA 1W0TA 3H9JA 2KDOA 1BOAA 2LY9A 3K9TA 2DK8A 3CQZJ 3J7AO 2HS5A 1P4AA 4PGGA 1RI7A 4W97A 1KU7A 3RIRA 3ZQHA 5GAEJ 1MIJA 3I3LA 2EZIA 2CW0F 3KZYA 5IY5H 3G3ZA 2EPFA 4AWXB 4RB1A 1ZHFA 3GTQJ 4FX0A 1ON2A 2E7XA 4LIVA 5KAIC 1L3LA 2LK2A 3VOEA 2ID3A 4MHGA 4OINF 3DPLC 3HDDA 1MJAA 1OR7A 2E2JJ 4HQEA 4CCJA 1ZGWA 1V5GA 1X4PA 5EG0A 2L5QA 2KL4A 4NC8A 5LBQA 3LSPA 2A6HF 2VXZA 5HVQC 1VQPI 3BQZA 3QP6A 2K4BA 2L3DA 2L7ZA 1RR7A 5D5UB 2LP0A 1JKOC 1FYKA 4M73A 1SFUA 1JKPC 2JA8J 3LSTA 2L02A 5C4XJ 2VT2A 1J7KA 3F8NA 5ICCA 1FLIA 1PYVA 3AL0C 2RQQA 3F6VA 4B09A 1ON1A 3A01A 2JA5J 2PJRA 1EJ9A 2OD5A 3P9CA 1YJNI 4KITB 4E7KA 2J5PA 3BJ6A 1IN4A 1VQ9I 5GADJ 1DU0A 2GZWA 3S16J 2Q8KA 4HYEA 5J47A 3E7LA 5LFAA 3RZDJ 1OYIA 1RC9A 5IT9Z 4L5EA 1PDNC 4G7OF 1ZLKA 3IV5A 1G3SA 2BW3A 3OV8A 3JREA 4LJZF 2O03A 1IZ1A 2JT1A 2JVHA 1JJ8C 1R00A 4E4HA 4G6QA 2M2EA 1HOMA 1ZGJA 4AD9A 5F0FA 5EEAA 2K9SA 1YS7A 2FBIA 4N4OB 2W48A 4YELA 1MBGA 3P5JA 9ANTA 4AIKA 2VKHA 5KCMA 2CFOA 3F21A 5F27A 3CZ6A 2IEKA 2O5RA 4YIRX 2E2IJ 4QTRA 2E71A 1SAUA 3S17J 2PJPA 2QM3A 1R4NB 1XSVA 4EM2A 1IV6A 5DM7F 2A5YB 2BGCA 3U1KA 3LA3A 3OL4A 1AA7A 1H89C 3KYDB 3QU6A 2EFWA 3BR1A 2ZJQF 3FKIJ 1F5TA 3S15J 3L09A 4HA8A 5AONA 2ELKA 4G7ZF 3HGYA 2MC3A 5FLXZ 2UXNA 2PMZN 4HLXA 1E3PA 3RSNA 5LLQA 5DUIA 3C18A 3PFIA 3V7SA 2R7FA 4V19K 3K70C 3LQQA 5ICGA 3RJPA 1V5EA 3DPTA 1QO0D 3DTKA 4TV7A 1RKWA 4A5MA 4U0YA 2XAQA 2O9LA 1LUJB 2HVQA 1MBJA 5EJCA 5CKTA 3PL8A 3TOBA 4IX7A 4KMFA 5L3BA 2VKEA 4DZJA 1DPRA 5TRDA 2DJNA 1QNTA 2JPCA 2V1DA 3K0LA 1DP3A 4U88A 3GTGJ 1VQOI 3HOZJ 5ILUA 5EG0B 2HVRA 2XAJA 1U8BA 3H36A 4NBQA 2QQ8A 3OY9A 2UXXA 1OISA 4AYBN 2JJ7A 2XB0X 3GTOJ 1R6RA 3QOEA 3OYNA 3RKXA 1KA8A 4RS8A 1Y39A 3A03A 1TTYA 3ZMVA 4XOTA 5ICFA 2LBFA 2RNGA 1WJAA 5JVTA 1FOKA 3LSRA 2CS3A 2DO7A 2X6XA 4XM3A 3E6MA 1WH7A 2CQNA 1IJWC 2ZMEA 1OLTA 3TL4X 1VQ4I 2DDAA 1Y1VJ 2VC0A 4PJNA 5LGTA 1Z05A 3LSJA 1B6AA 1TQMA 1JGSA 2GXGA 2FBHA 3L2UA 2NVYJ 2ISZA 2PJRB 3FK7A 3I55I 4L18B 2UWMA 5M5XJ 1DUXC 2K7LA 2EIJH 2V79A 3E0JB 3WE3A 3KYLA 1I50J 1XMXA 1H8AC 3RYRA 3DKYA 3I59A 2QBYA 2M8EA 4HNVA 3KP7A 1U9NA 4RB2C 1H9TA 2JPBA 1ORKA 2QZ8A 4JX5A 3H0GJ 3G1MA 4EGYA 3P9KA 2DOEA 5IOYA 1LE8A 3DF8A 4XLCA 1R22A 5DM6F 1A6QA 1FMWA 3ZXSA 3JRBA 1NH3A 1WZ2A 2MW8A 5E17F 5HDKA 5JI6A 2ID6A 1HA8A 3N4MA 2A05A 3FKJA 4K2EA 3DFGA 3W3CA 3KZZA 2D5VA 2MC4A 2ECCA 1T6SA 1E17A 2L0KA 4D5CA 4Y33A 2WBMA 2A69F 2W24A 3PNTA 3DEUA 4LLLA 3GTKJ 1YTYA 1CF7A 1BN5A 5EEHA 2G7HA 2B63J 2FOKA 3KIOA 2IS1A 3GUDA 3DU5A 2Y9ZA 2QWWA 3SZTA 2M4KA 4BYYA 1PP7U 1B9MA 3H1CA 1D3YA 3IC7A 2QGUA 2HQNA 2OF7A 1WCMJ 1AHDP 2JUCA 1E3OC 2XKPA 1OCOH 1TW2A 2XF5A 3E3VA 1XGOA 1Z3XA 2EJRA 2DDBA 1EA3A 1BBYA 2K27A 3EQLF 2M1BA 3R4KA 4PSWA 3BG7A 2ZXHA 5J1UA 2ZSIB 3GWZA 2CH0A 1RKTA 3H3ZA 1F36A 1S7OA 1TQIA 2KT0A 4P9UA 4IOAF 2HOTA 2XUBA 3O8GA 3TDZC 2RREA 2L7MP 4LG3A 4MIMA 4XN0A 5C4JJ 3ZN1A 4S04A 2XAUA 2A61A 4M3GA 2GXAA 1IXCA 3IWFA 2VL8A 1J9IA 4XRFA 4GYGA 1LKXA 1IG7A 1GUUA 1R5ID 2QSFX 2YX7A 4YG2F 4Y15A 4IPAA 2LBFB 3HJEA 4A3EJ 2PI0A 4OIRF 2O61A 4DGWB 2FE3A 2LMDA 5BOXA 2HPIA 1RESA 4D5FA 4J01A 1YW8A 4IHWA 4I99C 2EZHA 1NHAA 1BJZA 1IN6A 1U2WA 5H20A 2FNAA 2ZXWH 1NK3P 3BTJA 3GLXA 4QPQA 4IHXA 5M5WJ 2VB6A 2YS9A 1HW1A 3S14J 2F4IA 3I59B 4JQFA 2FQ4A 2QBYB 4L9JA 3WTWC 1B9NA 2FA5A 4RGUA 2DA4A 2WWYA 3M7GA 3HIFA 1YRNA 2NVXJ 3OSFA 1FOYA 1SD5A 1LE8B 2COMA 2DFHA 1PUFA 2CO5A 3AAFA 2YX4A 2P0WA 4OMZA 2F4MB 3CUQA 1AWCA 4KDPA 4UB8C 2XVCA 4EJUA 4BDZA 1M1EB 4E7ZA 2VKDA 4NDLA 2AS5F 1STZA 4HV6A 2EV0A 3ZQGA 1TT0A 4OAYA 1NG7A 3MZ8A 2HZDA 2OUMA 2OV7A 2HYJA 3M8FA 3ZMUA 1IDYA 4LK1F 1MBHA 4XK4A 3HSRA 3OIPA 3BR6A 4M3BA 4E7IA 1OCCH 3KP5A 1BM9A 4HX8A 2ECBA 1CF7B 3ML6A 5JFRA 2EIKH 1TBXA 4BAYA 3WTZA 4YFKF 3V8KA 3VYRB 4PUSA 1MMNA 2X1CA 1Y1WJ 2BZTA 3KP3A 1T95A 4XL9A 5D5WB 2Z9OA 2X6WA 1C0WA 3QPSA 1I5ZA 1YX5A 1HBXG 5FD5A 3I4MJ 4BUPA 2EH3A 4HX7A 5CVIA 3PQJA 1W7PA 3HOVJ 2MFZA 2YR2A 3JTHA 1A6IA 1GVJA 1YFHA 1GHCA 1UCRA 2OZ6A 5EEGA 1MW7A 3SFIA 1VQ8I 3Q3SA 1S9HA 3I53A 3OYHA 4LIUA 2WADA 2HZTA 4L5JA 1W36D 3BC8A 4I7HA 1ZYRF 3T0YA 3KX2A 3O2PE 5HLHA 3FBNB 2WV1A 1MZBA 4EQQA 2GIZA 1K6YA 1E3HA 1Z67A 1KQ8A 3BJAA 3L00A 3NWSA 3NAUA 1G3WA 5D6FA 1ETXA 4WXCA 5CPRB 2MYSA 4O6JA 3UKGA 2HKXA 1WI3A 3FDYA 4Q47A 4DZPA 4Y17A 1A04A 2NVTJ 2Y0SA 3H0DA 5CVUA 1BR2A 1MMSA 1O7LA 2JWTA 3IKVA 2Z16A 2IS6A 1BI0A 3KETA 1HLVA 4XOPA 2MBFA 4CCMA 1D8KA 2KP6A 4PDKA 3QYBA 4ZTJA 4G94A 2DJIA 2D2WA 1X58A 3Q9SA 4A2UA 2ACJA 2XAGA 1K4TA 3ECHA 4G6TB 4LFUA 3RKYA 4B44A 5FKKA 2HPMA 3WG7H 2V9VA 1UHSA 3JTGA 1D8JA 2FSWA 2O0YA 2QQ9A 3MWMA 2VT3A 2XAHA 1SFXA 1IN8A 2X85A 3BQYA 3ZRGA 4DBRA 2XGDA 5EGOA 2HOAA 3BTLA 3JRFA 4XLNF 5IP6A 2CV1A 4A0XA 1XDSA 3LA7A 2EINH 4ABZA 3F8FA 4QSHA 4XKVA 5K5OA 1YRNB 4S05A 3SJMA 5FRNA 1PUFB 3WTTC 4BHBA 1U5TC 3OYFA 3U21A 2FU4A 3CUQB 5CVVA 4LOCA 1HSJA 4RGXA 4BQQA 4P5OA 2HQAA 4EATA 3FXUA 3O6BB 4I76A 2BVMA 3CC2I 2IXSA 1HKSA 4XSXF 3Q9VA 1Z3YA 1KQ0A 2HWVA 1BC7C 1LDDA 3M1EA 2GAUA 3F0CA 4HNTA 5ERIA 4RLFA 2V6EA 4P55A 5BS6A 2ZB9A 4PJ0C 1MBKA 3ZQQA 3F3XA 2EQRA 3CJRB 3IRRA 4BE0A 4EJOA 1YJ9I 1U3EM 2R7VA 1UB9A 5E20A 5A2QZ 4XORA 4NB5A 5GTIC 4CYCB 1JTYA 2KZVA 2HYGD 4EVIA 4HRIA 1XG1A 2I8DA 1WJ5A 2BXZA 2GBYA 5CJ9A 1QVUA 1I27A 1W7PB 2DA6A 3U1DA 2CU7A 4YFXF 1ETVA 4XMYA 2DMNA 4CUGA 4P1WA 2GLOA 1ZLJA 2H1LA 1QGPA 2FBKA 2W85A 3A4CA 3CMAI 2TRTA 3R60A 3FMQA 2JZYA 3HKZA 3WGIA 2VLAA 2STTA 1D5VA 2E2HJ 3IH2A 5HODA 3CO7C 3DP7A 2TCTA 5E3NA 4I09A 1EH8A 3RYPA 2COBA 3NARA 2TDXA 4WWCA 3F8BA 3AFHA 3NRVA 2MA3A 3M8JA 3TO9A 2RN7A 4UUTA 4B48A 4MFDA 1IRFA 1D1BA 2L01A 2K9QA 3KZIC 3L2QA 2QLZA 3R0AA 3RKWA 3UR3C 2KRCA 4ESBA 3DLLF 3BTCA 3QPLA 3OIOA 2FOWA 4DNCA 3BR2A 2RC4A 3FMRA 3BPVA 3MKWB 1S3JA 4M6XA 3WE2A 1FC3A 1DQUA 1VNDA 2XPUA 1HW2A 4BXUA 2M5WA 5DYMA 5K7HA 2MLGA 2K3PA 4LG0B 3OSGA 2QCOA 3J7ZI 2BHYA 3BZKA 4BDYA 3S1MJ 5EGOB 2CRGA 3I64A 3QODA 3BT9A 4KA4A 1LDKB 4BACA 3E6CC 1RETA 2IRFG 3LNQA 2NVQJ 3BG5A 1HC8A 3I9V2 2E1OA 4ZJZA 3JR9A 1UAAA 2IW5A 1O3TA 1K83J 1LVKA 1H9GA 2RDPA 3CCSI 3M9AA 2L9NA 5EF6A 4BL0B 3D5SC 3K4CA 4V2GA 4ZYAA 1SVMA 4I0AA 4EM0B 5FKMA 4KN7X 4XBFA 1BC8C 2G9WA 3VODA 1YW9A 3VSLA 1R5HA 1D1AA 1ZGAA 2FF4A 3L9FA 2VJIA 4U87A 4R79A 2IT0A 1LQ1A 1X19A 1IF1A 1IGNA 4HSTA 2OZUA 5TGTA 1S7EA 4PK4A 4LB5A 1F43A 4A12A 2KLOA 4ZDOA 2NNNA 4O5VA 3LSIA 2HFHA 1SMTA 4BE1A 1LVAA 2HQ5A 1Z7UA 4N0BA 1EF4A 2M7AA 4F93B 3E6DA 2QQBA 1QZZA 3OIQA 3I0TA 1WWXA 1YOVB 3GO5A 3T5XA 3VYSB 1GV5A 1WGXA 1OR7C 2RV8A 2Q2EA 2DK5A 4ENNA 1T38A 3FWEA 2IGNA 1JE8A 4O3MA 1VF9A 3GMEA 3X2QH 4BJ6C 1VQKI 3CC7I 4HAMA 1VTNC 3BJOA 3S93A 3L1PA 1OJLA 4WX9A 3QU3A 5TISC 2H27A 1T0FC 5B1AH 1F1ZA 3AG4H 3GZ6A 1WPKA 2BXYA 4YFNF 4HF1A 2H1KA 2Y31A 2G7UA 1FJLA 2E1MB 1VQ6I 1TL8A 4YIFA 2PMZA 2R5ZA 1V54H 4IO9F 4WCGA 3BG3A 3DU6A 3CCEI 2MG4A 1XB4A 4QIWN 3Q0UA 1XSXA 4UVAA 3CCJI 5D8LB 2P6TA 1T33A 4MTDA 5J6XA 3RQ4A 4H0EA 3LOCA 3IL2A 2DQLA 1N75A 2FJ1A 2GOMA 3FM3A 1BR4A 2M3AA 4N4NB 2NS0A 4LLGF 2KQRA 1J75A 4IJAA 3H5RA 4NUBA 1ETYA 2HYFA 1S5LC 3BOQA 1QPIA 4FTHA 4ESJA 1LJ9A 1FYLA 3ELKA 1VFCA 4PFPA 3DTIA 2OQGA 1V3FA 2PLYA 2EK5A 4RB3C 2WB1N 1QQIA 4ZYDA 2QYOA 1Y8RB 2ZXJA 1R9TJ 3SDBA 2VQGA 3EUHA 1NK2P 2VOOA 2VONA 4HBLA 3LAPA 2QA4I 5LGNA 1ZKGA 1W0UA 1MSFC 1W7PD 3RCOA 2BOLA 2D45A 3QPTA 1SANA 3VFZA 2KRFA 3TEDA 2KZGA 2ZJ2A 3G4SI 5HDNA 1N77A 1ENHA 4LD5A 3H5NA 2OTLI 4L0ZB 5J4YA 4XLFA 1RUNA 1DU6A 2WC2A 2O3FA 3ZN0A 3LA2A 2V26A 3WU2C 3IH3A 5IT9K 1UZCA 5HNFA 1EKEA 2FRHA 1Y8QB 1HKQA 3C2GA 2JSCA 2L7FP 2CUFA 4CSWA 1YLFA 1ZK8A 2A3SA 1FP1D 5E8GA 5J1RA 3C3WA 3OS0A 1X3ZB 3BR3A 4RAFA 2OC6A 3R61A 3OYIA 3WTUC 5HS7A 2Z5UA 3A1YA 3BZ6A 2Q2EB 4KT6A 2XHKA 3E5XA 2OQRA 2XASA 2BY3A 1OMIA 3QYEA 1JHHA 2M9HA 1WQ2A 3IUOA 4F7ZA 2V9KA 4Z6YA 1P9QC 2VE8A 3GW2A 2MGQA 3K4MA 5TJJA 2CGPA 4CCKA 4MNUA 1I3AA 1B4AA 4QPOA 4C3JJ 4D7NA 3LWFA 3L2VA 4R8HA 4W1UA 2EFNA 5D4RA 2L2OA 2ZMEC 4B43A 3DWLE 1GV2A 5FROA 3A0BC 1ETOA 2X48A 5FLXK 4BKXA 3JRAA 3ZGKA 2DODA 2LKXA 3M4OJ 2R5ZB 1MBFA 1U78A 4ZYEA 3BY6A 3RZOJ 2NNYA 1ZRCA 3AG2H 4RA2A 2GOXB 2DMPA 1EV7A 2KIUA 2P5VA 3ESWB 4M9SA 1X1CA 2STWA 4ENMA 1KONA 1TWHJ 4ITVA 3OR1C 5HDGA 1ZR2A 2ZNYA 1JGGA 2LD5A 4XONA 1SD4A 5FKLA 4OMYA 1MMDA 2X0LA 4II2A 1D0ZA 2AXLA 3C1DA 2CUEA 2LKPA 5DUKA 3V7CA 4A3MJ 1JT0A 2LY1A 3TKYA 2E1CA 2JN6A 3EYYA 3KEQA 4RAYA 1MSEC 3BCAA 4XQFA 4ZZLA 1YIOA 3E5UA 3B02A 1W1WE 3J80Z 2HXIA 2W25A 3EUAA 1HSTA 2QSHX 4KISA 4CO8A 2XV4S 1WSUA 4A6DA 3OYBA 1FYMA 1ZARA 1UHMA 2LFBA 3DQVC 4KYWA 2LF7A 2Q0OA 2XDVA 2WA0A 3CJTB 2IBDA 3FXKA 4AVPA 1G59A 6PAXA 1HCRA 1IDZA 4LK0F 2EFPA 3O8HA 3D0SA 2L7KA 5JR3A 2D1VA 2GIVA 1HQCA 1QHGA 1BA5A 3ISPA 3PSFA 4P9FA 3K6GA 3WTVC 3HUGB 1ZQ3P 2N8GA 2JSPA 2EILH 1IN7A 4GRIA 2KHMA 1TWFJ 4RAZA 3W6KB 2YU9J 4DYQA 1VQMI 3CCQI 1BIBA 2PG4A 1B1BA 1TT5B 1X1PA 2YUSA 4IRHA 4XKBA 2AO9A 3GFIA 2Y2ZA 4M3EA 5FB2A 2VQHA 2QKLB 1MNMC 1IO2A 4B8XA 2HOSA 3MAJA 1QPMA 1FIAA 4LGWA 3F6OA 4G12A 2VJ5A 4V2FA 4ANJA 4MQVA 3CF5F 3IHUA 3CJQB 4CCOA 3BZCA 3OOPA 4MTEA 2KIMA 2M4GA 2PMHA 3E6BA 3HPGA 1WI9A 3BP8A 1Y56A 4Y13A 1O3QA 3F72A 2R5YB 3ZMTA 3H3VK 1ODDA 2K3FA 4BGDA 1UFMA 3QWLA 4B47A 3GVAA 2GA1A 1WJBA 3PSIA 1S29A 3JRDA 5GAGJ 3SZPA 4N9HA 1OCRH 4UV9A 2X51A 4XLAA 4CH7A 4ZDPA 5ED4A 1APLC 3ERMA 2E60A 2R7QA 3FHZA 3CD6I 4ESFA 4E7HA 2CG4A 2KKOA 1IV8A 4PJMA 2DXIA 3TBIA 2X1DA 1YJWI 2JVGA 3HRUA 2XIGA 3T8RA 3CUQC 1KYZA 3HEFA 1CQTA 1JXSA 1BOBA 2Y30A 3JRGA 4EV0A 1J2XA 5JLXA 3VDXA 3JRIA 5DCMA 3B6AA 4IQ4A 5IYDJ 3K1PA 2CSOA 3MVPA 4RM2A 4U0WA 4NQWA 4A0YA 1H0MA 2ZNZA 1UHWA 3E5QA 3QP5A 5DDGA 1YYVA 2W57A 2O6GE 1XGSA 4L9NA 3GF2A 1FP2A 2P7VB 3H9QA 5F0CA 2K4JA 1MGTA 1ONVA 4KT5C 3J81Z 4JBAA 4F52A 2E7WA 1R7JA 2IP2A 2VASA 3KP4A 1Q1VA 2FEZA 1KU3A 1IRZA 1T08B 3KEYA 3A0HC 2A5WA 4NC6A 5IOZA 1D0XA 3GTLJ 2YSRA 2R7UA 4IHSA 5D4SA 2JRMA 2AXTC 3ZQIA 2K9LA 1IUYA 1GXQA 4ZH4F 1UMQA 2BEOA 3DEWA 1ZG5A 3HSFA 1TNSA 3K1NA 1USTA 5DD8A 1KQ9A 4MO7A 1X3WB 4YEJA 4AM3A 1D5YA 3QRFF 1MDMA 1ACIA 4GYIA 5J4VA 1GLNA 2PQ8A 1ZR4A 3S3MA 3BDDA 5LHGA 1ZTRA 4DIQA 2HU9A 2JUGA 2NAZA 2PEXA 3RQIA 5H2FC 1OYWA 3GTJJ 2LRDA 4D7MA 1OQYA 1XS9A 4CXFA 3OYLA 4WK8F 4LMYA 2CV0A 4A3CJ 1XGMA 2GQQA 1TWCJ 4F55A 2VUMJ 3S8PA 3T8TA 4CYCA 2DA2A 3OYEA 4XRSA 1XPXA 4M6VA 4JOMA 1V55H 3FK6A 1Y0NA 3PO2J 3PQKA 1A31A 3MD2A 5DS9A 3MZYA 4BXFA 1B8IB 2GXBA 3ZOBA 2FD5A 5FGMA 2EIMH 3VYUB 2WAEA 2XRNA 1Z7LA 4NC7A 4JX4A 4HPQA 5AIQA 2ESHA 4Y3OA 4BJ5C 3DKWA 4A3BJ 3TO6A 1QA6A 2OJED 3FHNA 2L54A 2W7NA 4D0PA 1F9NA 2HGCA 2FX0A 3OWTA 3D5RC 1REPC 1FTTA 3DEEA 3M07A 4GXOA 3ZP5A 2V9PA 4FE7A 3K4LA 4GDFA 3NWTA 1UJ8A 1O57A 1L0OC 3SHFA 4G8XA 4EMSA 1O7FA 1ZG3A 2E5ZA 3BG9A 4BHPA 2VPRA 4AIJA 2VJJA 3BROA 2QEXI 4IKFA 2VPLA 2LTPA 5DCMB 1SD6A 5FLVA 2IA2A 3KPHA 2XB5A 4BY7J 3TMOA 3P9IA 4PFOA 1TW3A 2K86A 3MKLA 4NQWB 1J5YA 4N9IA 3F9KA 1S6LA 2M0CA 2B0LA 4HW0A 2Z3YA 4LG0A 2F5EA 3RPQA 4DW6A 4FX4A 1PP8F 1J09A 2BHZA 4L9VA 3H9GA 4XKCA 2AQFA 4AIDA 1Z0XA 3SXYA 2OA4A 2OBPA 1WH5A 1IRXA 4OU0A 3V8LA 5ILVA 2DMQA 3OYMA 3PIPF 3L2CA 4XLHA 2KIFA 3W2AA 2KRHA 2R92J 2EBIA 2LOOA 5C3EJ 1YI2I 2Z99A 5KAFC 2VXDA 2ZJPF 2CV2A 2M87A 3H35A 3F23A 2ZSHB 3G71I 1GXPA 5FRMA 2VOPA 5M3FJ 4KN4X 1JUPA 1UG2A 1MDMB 2LH9A 2Z1DA 2ZKZA 2BE5F 2DYRH 1YS6A 3D1NI 1DDNA 4ETSA 5E18F 1HDDC 3JRHA 1XGNA 1DGWY 1D0YA 2NOGA 2P5KA 3CCMI 2EWNA 4UXNA 3WGHA 3K4NA 4WF2A 1AKHA 4HV5A 1Z21A 2L9SA 1HW5A 1KU2A 1FBSA 2R93J 2DFIA 3I58A 3WTYC 2HDCA 3FXQA 1XCVA 3CCRI 2F5DA 2WAFA 2EA2A 2MABA 1PJRA 3IRQA 2LREA 3EPZA 3K4BA 3VEPA 3SDGA 2LYCA 1P4WA 4H4KC 2MLKA 2R7OA 3IAS2 5A2QK 2PMUA 2RNJA 4ZDLA 4PCQA 3OYKA 1LNWA 4XN3A 3MKZA 2PBIA 4E7LA 3DPUA 3KE2A 1VQ5I 4JX6A 5JLWA 3B73A 4IVNA 4QWQA 1IUFA 2Z2SB 1JT6A 2BY2A 2B7EA 5BNGA 3S2DJ 1LFUP 2DI3A 3ZQFA 1WHUA 1DP7P 3CP2A 1BIAA 4NNJA 3HYIA 2X6OA 1U5TA 1W4MA 4KJZA 2EFQA 4D1QA 4G6DA 5FO5A 1OCTC 3LQRA 2CW8A 4GFBA 4A3IJ 1XD7A 3R0JA 2P7CB 4BH9A 2DTRA 4C30A 2DYSH 3HHGA 3RTRA 3K70D 3LFKA 1J59A 5BPDA 1F4KA 1MMAA 4Q5SF 1YW7A 4IOCF 5C44J 4D9JA 2Y0SN 3F8MA 1PUEE 5JVGF 2XGCA 4Y7NJ 2ETHA 2MD0A 5FKNA 1LFPA 4IXAA 2ZFWA 3H92A 5DEQA 4CZZA 3PUFA 1Q1HA 4BNCA 2R7SA 2DU9A 2XC7A 2XGXA 4L0YB 3QPHA 2QF7A 4FT8A 4X1EA 3S1QJ 2QUFA 1V4RA 2KIQA 1OCZH 1XN7A 1Z91A 1R1TA 3S2HJ 5GAHJ 5L3EA 3KCCA 2R7XA 2WB1A 3WU1B 3VSKA 2OAZA 2M0MA 2KDZA 2RGVA 3KP2A 3GCMA 4MEXF 4BY1J 4MFEA 4A5NA 4DYRA 4M3DA 1I6HJ 2WY7Q 2DPUA 1K4SA 1P2FA 3MQ0A 4L9TA 3H5AA 2ZJRF 5KK1A 1RIOH 1J0RA 3IWZA 3FX3A 2V6CA 3MEXA 3BR5A 2I10A 3BR0A 3DBRB 3AG3H 2HVSA 1R58A 1MNDA 2W84A 1MH3A 3K69A 3DCFA 2ZCWA 1AKHB 2ADUA 1IW7F 3ROUA 3AKZA 1MBEA 5IT3A 1I3QJ 2Y0MA 4KIFA 2CUZA 5LGUA 2VKVA 3BPXA 4ON0A 1K78A 4A3KJ 3MN2A 3L2RA 1K79A 4J19A 2VQLA 1R1VA 3CDIA 1XMAA 3CO6C 4FQGA 4IRGA 5KVRA 5GTHC 1ETKA 1FIPA 3WHCA 5L3CA 4OWRB 2WAQN 2XSJC 4M72A 5L3GA 1ZN2A 1FBUA 2Y48A 3ZMZA 5IPAA 1LEBA 2M34A 4PSXA 2E5NA 2FMLA 3EETA 4HQMA 1OFCX 2CMPA 4RMNA 1IRGA 4A3JJ 2Y75A 3MMYB 4JYKA 1X1DA 4HOBA 1U5TB 3K1MA 1Z6TA 1USSA 3KEOA 5KHDA 5CYVA 2H8RA 2O8KA 1ITYA 1W36C 2H6CA 2H94A 1E2XA 4E7SA 3IKTA 3Q5FA 3FIWA 3HTSB 5GP9A 4CCNA 1E0EA 3HOYJ 2DMTA 1QHHD 2BY1A 4RB0A 2FXAA 5EYRA 1N25A 1VI0A 2VN2A 5ICEA 1WJEA 4FE4A 4XNFA 1GVDA 3PJRA 2X1EA 5E8IA 5E1XA 2F4OB 2E35A 4Y4RA 1T2KA 2X4HA 2K5CA 2AHQA 5LEKA 4FETA 1TZLA 2C6YA 2FUG2 3RI4A 1SAXA 1WJDA 2DFFA 1EH6A 3DBHB 3TDUC 5L3FA 2XAFA 2PX9A 2W00A 3KFWX 4AYBA 1LPQA 5BPIA 1SC7A 5FKOA 1QRYA 2CQKA 4DOZA 4A0ZA 3LAJA 4ZC3A 3JAMZ 2BBYA 3SZGA 4BS9A 4F3QA 5LEJA 1JJ6C 4RGRA 4HG2A 2Y69H 3W2VA 2NYXA 2K85A 3JAMK 1T0FA 4X6AJ 4XLEA 2MH2A 4XSZF 1BL0A 2HI3A 3T1BA 2DA7A 3ZMDA 5E3MA 4OAZA 1U6GA 3VPRA 2ELJA 1ULYA 3KYCB 1B72A 4Q4ZF 2W4SA 4HZFA 3U2RA 4XRMA 1YQAA 4UV8A 2L9VA 3Q0VA 3OR2C 3BWGA 1X2NA 4HDVA 1IXSB 4YIIA 1FX7A 3OYGA 3HUGA 3CCLI 1OKRA 1K78B 1QZYA 5F6FA 5HS9A 1ZAOA 1JHFA 3F8CA 4PJLA 4KNYA 2JA6J 3CC4I 2GM4A 5E1ZB 3WU0A 1N78A 3ECOA 1Z77A 1O4XA 2DCEA 2DOFA 1P7IA 4HF2A 4IHVA 2M30A 2V7FA 2HKOA 1XC5A 1JUSA 2GA2A 2CQQA 3HXLA 3I4PA 2ZXIA 4HNUA 4EEFG 3OS1A 1T39A 4GGGA 4B4CA 3GZ5A 1ZH5A 3DLAA 1QU3A 3K4KA 4BEHA 2LY2A 3EUKL 5CQEA 4Z2YA 4M74A 4IEJA 4M3FA 2OTJI 3K10A 2VIXA 2IA1A 2R5YA 5H6RA 3MCZA 1BI2A 1IXRC 1JTXA 4AC0A 2ZFUA 4A6EA 3N05A 5FD6A 3M3YJ 1K7AA 1TNTA 2LG4A 4L5IA 4DJAA 3WTXC 3FISA 3TW7A 1S72I 3PUBA 2VBYA 4C2MJ 2DT6A 5D8KB 3H3UA 4ASNA 3FZVA 4NHJA 1TP4A 2X9DA 4XLPF 3JCUC 3GTMJ 1TWAJ 2K40A 2HDWA 4M71A 5KNLA 2HQRA 1FEXA 3QQAA 1FZPB 5B5EC 1W5SA 4HSRA 4BJTA 1O3RA 2LSOA 2P81A 2E34A 3CP8A 2GWRA 1X2MA 3TO7A 2WV0A 4KMUX 5D5XB 3A2KA 4Y52J 1X1AA 3J80K 4E70A 3GX4X 2XKOA 1XX5A 1HF0A 2P4WA 3VYTB 3NQOA 4FCYA 2VJ4A 1I1SA 1FWZA 1ETQA 2DQRA 2CW7A 2EZKA 4KUMA 4UNOA 5LRRA 2OPTA 3BLYA 3I71A 3WODF 3FXOA 3HBLA 5F1RA 2K02A 4XICA 2XF6A 4UY8I 3PFYA 3KLNA 4E6KG 4UVBA 4HLYA 2YPRA 4C3HJ 4CYDA 1R49A 4LLNA 3S32A 4XIDA 3A01B 1B72B 1TLHB 3WTSC 2V4JC 4ENKA 2F5CA 3W6JB 2IPQX 3C2BA 5B1BH 1R71A 4IL6C 3IAM2 3SEZA 5CLSA 3ULQB 3ZMSA 1P92A 4BE2A 3MKYB 3ABMH 4I6ZA 1W5CC 5JHUA 2NS7A 4F91B 1Y0UA 2V1XA 3V8JA 2CYYA 2BW3B 4IF4A 2A07F 2CFXA 3ERED 4II3A 1MKMA 3K2AA 3FBIB 3IP4B 2LVSA 3P7NA 5DD4A 5E79C 4PGHA 1SFOJ 5DCFA 3GZNB 1W5TA 2M45A 3S3OA 1SVOA 1XCBA 1LEAA 2ZC2A 2ELHA 5K5RA 3CJNA 3DKXA 3HGGA 3HRSA 2BY0A 2DLLA 3AL0B 4AU7A 1Z9CA 1WKMA 5EZHA 2XGEA 4BBRJ 5LHHA 3CCYA 4U0VA 3QYFA 1B8IA 4PZJA 4I02A 4BEHB 1YE9A 1ZRFA 4X0GA 2LKSA 4M9XA 4ZYHA 1A5JA 4HX4A 3GTPJ 1MNEA 1T8IA 4AVZA 3RKQA 4LB6B 3JRCA 2RKHA 3HOWJ 3RPUA 4F92B 2I5UA 1S7AA 1RNLA 1JKQC 4C3IJ 3CF2A 4KIGA 3I56I 4UUSA 3ZQCA 4M9ZA 4CICA 4UUVA 2P5LC 1G8XA 4YRVA 2UUZA 5ILSA 4I98B 5HOOA 4I01A 3HHHA 1XTAA 1G3TA 3AG1H 4ZZDA 1QVTA 1B59A 1MJ9A 2K9NA 4BHCA 2KISA 4KFCA 2A6EF 1RZ4A 3OYAA 2HTSA 1T56A 2VODA 5AIPA 3OOUA 1R4MB 3DTEA 3VB2A 2F5VA 2FNPA 5HNHA 2EA4A 2R7RA 4IRIA 2HOEA 3L7WA 4IHYA 5DTDA 2ICWG 5F08A 2R0QC 2L4AA 1FTZA 3HOXJ 3PM1A 3LMMA 4U7DA 2OCEA 2EFOA 4I0BA 3WG9A 4A3LJ 1K61A 2LNBA 5IP9J 1MJBA 1S8NA 2NS8A 3HC7A 1EH7A 5JHFA 2IGMA 3LL7A 3COAC 2DA5A 2JTVA 1MD0A 5J3LA 2WY8Q 1V5FA 1YHQI 5EZGA 3J81K 3CDLA 2ZMEB 2V1UA 1I6XA 1YITI 3HL2A 1BI3A 4HF0A 3R6SA 3CUOA 4C2TA 4U7BA 5CVJA 3HOUJ 3DV8A 4A3GJ 1NG6A 2VE9A 3GEZA 1KYWA 2DW4A 2KJBA 1ZELA 3K4JA 4OIOF 1KZHA 2EZLA 3CLOA 4ENJA 5LHIA 3PNYA 1SEUA 2PN6A 3GFMA 4BQNA 1SMYF 1ZRDA 5F0HA 2CWEA 5J8CA 1A36A 3MZHA 1RUOA 3CLQA 3V42A 5BMZA 4CCLA 3IH4A 3HG9A 1IAWA 2CUJA 2R4GA 2E1NA 3OS2A 2MSYA 4RAGA 3G1LA 3TQNA 2W1OA 5DV5A 2HDDA 2QSGX 2VBZA 4MEYF 4BXXJ 2Z33A 3FM5A 2VBXA 4BQOA 2IAIA 3ABLH 3G2BA 2R3SA 1K6OA 1OCPA 1P7JA 3FXMA 2IA0A 5FFXA 4EM1A 3FF5A 3ZCOA 1FSHA 2XPWA 2DTZA 3S3NA 5IYBJ 4A93J 2AQEA 1NTCA 2E36A 2F5FA 4KICA 3LSGA 1FPQA 4UVCA 5CVRA 3HB9A 5E1WA 2IJLA 2M8GX 4OOIA 1BW5A 3ZPLA 5K5QA 5D5VB 1ETWA 2V1NA 4CA0A 3GBGA 4DBQA 4UUSB 1P6RA 2KPMA 1U0JA 1PVEA 1I39A 2ZO4A 1FT9A 2P8TA 4JK1X 3UNGC 3ZR8X 3HSEA 3E1SA 4BBSJ 2RAEA 2K9MA 4QLCU 1G4DA 3FMSA 1FY7A 3S1NJ 1BJAA 1OYYA 3W6VA 2BYVE 1VZ0A 4P96A 3LSKA 2CQ7A 2MH9A 2XPVA 2B9SA 3K2ZA 2G0EA 5K7ZA 2R7TA 1DPUA 2IS4A 2CQXA 1AOYA 3QAHA 1I1GA 2KFDA 2DA1A 3E97A 3GFJA 1RR8C 5EDNA 2EB7A 5HLIA 3OYDA 2KMUA 2DOAA 3HRTA 2BV6A 2F48A 1GT0C 1AU7A 2ESNA 1RPWA 3CCUI 3I54A 3PO3J 2HNHA 2HR3A 1LDJA 1FOXA 5K1YA 3REOA 5H6QA 3FXJA 3SQNA 3ZQLA 2BVLA 1MH4A 4FASD 1FMVA 2VBWA 5IYCJ 1CGPA 2A68F 1R36A 2OCCH 2YU3A 1TWGJ 4M6YA 1FOWA 2O8XA 4AUXA 5F04A 3OYCA 2RQPA 3JSOA 3HRMA 4WXDA 2LDUA 2NXNB 2DA3A 3ABUA 2LLKA 4HEA2 2WTEA 4ZYGA 3TW6A 4AIHA 2VC1A 4UHTA 2X6YA 3V7RA 4S0HB 2QKMB 5GPCA 3CCVI 3GFLA 2P6SA 4B1RA 2HTJA 4HDUA 3U9GA 1DGRM 2DN0A 3HZJA 4DQ2A 1SFEA 1IC8A 2VQCA 3L2WA 4I2OA 1T98A 3ABKH 5CQGA 2E1MC 4MQ9F 3JW4A 4KIBA 5IP7J 5D6EA 3Q0WA 1Y6IA 2FMYA 4JP0A 3HM5A 2F2EA 5L3DA 1XSDA 3VWBA 2R7ZJ 1IN5A 1JUMA 4CGZA 1WFXA 5B66C 3CMYA 3SEQA 4J00A 2XF7A 3NEUA 1A35A 3G6EI 4CHUA 2FQ3A 3DXJF 4LITA 1FNNA 4E7JA 4G9YA 2A6TA 4MGRA 4UB6C 3PIOF 2M7BA 1G6NA 3C2HA 1LB2A 3CMMA 4EJWA 1SD7A 4PJJA 2UZKA 1UELB 3TOAA 4EJTA 3SFZA 3GXOA 4FISA 2HEOA 1U9OA 1WVRA 5J1YA 4C9YA 1HXDA 5K7FA 2JQ7A 5M5YJ 5GPAA 1H88C 4CZCA 3I4NJ 2JA2A 1BW6A 4XRSG 2WAQA 4B3XA 1P4XA 3QOPA 3OL3A 4XKWA 1R23A 1KGSA 1WRJA 2RVCA 1UG0A 3WGGA 4BU2A 5J40A 3LSMA 2JRTA 3N97A 2L4MA 3LFUA 2DPDA 2ZBKA 2IGOA 3SYTA 3JSPA 1TQPA 2IS2A 3BCBA 2IVMA 2LR8A 2OU2A 3ONQA 1X1BA 1YIJI 3BTIA 3C7JA 2JK3A 3TP0A 2D1HA 3A02A 2DMUA 2LC2A 4ZTFA 1G2HA 3F22A 2PFBA 5J8FA 1X3UA 1BR1A 1XDUA 4EJVA 4A3FJ 1TC3C 3CTAA 3FXRA 2W82A 1KU9A 1X4OA 1XMKA 1RRJA 5M3MJ 2KJCA 3KP6A 2NVUB 1O3SA 5E3LA 2J5OA 2HXOA 2ISYA 4DYCA 1YX3A 2L9RA 2NRAC 5LD2C 2VI6A 2EV6A 3J7YJ 3G73A 3CESA 3WHBA 2NOJB 3PNVA 4GO1A 4RM3A 2H6BA 3GYHX 1R5GA 1YG2A 2R7DA 3O3KA 5BQTA 5FFZA 3OYJA 3HPHA 3CMEI 4A3DJ 3CDHA 3TGNA 3W2WA 3K7AJ 4EGZA 3KLOA 2DT7B 2CJJA 2DAOA 2XRLA 3ZQ7A 5E3OA 4RGSA 3RPUD 4WXHA 4RBOA 4R1HA 2QVOA 1SFKA 3MFKA 3LSHA 3RDIA 2F6CA 3ASOH 1WJCA 3V4GA 4A69C 2EV5A 3HOTA 4C2UA 3S2WA 2Q1ZB 4MLOA 3DBLB 1Z1DA 1QZEA 2QQAA 1JKRC 2JA7J
chains in the Genus database with same CATH topology
2CQQA 1GDTA 4EEFG 2JMWA 3BQYA 5FJ8J 2XGDA 4B4CA 5EGOA 2HOAA 3BTLA 3JRFA 5IP6A 3HEFA 1CQTA 4IEJA 4M3FA 2Y30A 3JRGA 2R5YA 4ABZA 4AC0A 1JTXA 4QSHA 5JLXA 3JRIA 3M3YJ 1YRNB 2E19A 3B6AA 2O7OA 2ME6A 3SJMA 1PUFB 5IYDJ 3MVPA 3FISA 3TW7A 2XSDC 4C2MJ 4LOCA 1POGA 5F0CA 3TP3A 4RDUA 2X9DA 3GTMJ 1TWAJ 2K40A 4I76A 1IRZA 1Q1VA 1FEXA 2ME0A 3QQAA 3S1RJ 3HKZN 2Y9YA 5IOZA 5FLMJ 4B3AA 1HDPA 3GTLJ 3G1OA 2P81A 3F0CA 1LFBA 5F1JA 3ZQIA 2ZB9A 1UMQA 1MBKA 3B6CA 3DEWA 1X2MA 2EQRA 1W0TA 2LY9A 4Y52J 3CQZJ 4MO7A 1HF0A 4CYCB 4W97A 1D5YA 1JTYA 3ZQHA 4FCYA 1XG1A 2EZIA 1ETQA 2EZKA 2GBYA 1ZR4A 1QVUA 2OPTA 1ZTRA 2DA6A 2CU7A 3GTQJ 3HBLA 3RQIA 1ETVA 2LK2A 2ID3A 2DMNA 4XICA 2GLOA 3GTJJ 4D7MA 1XS9A 4C3HJ 3HDDA 2TRTA 4XIDA 3A01B 1B72B 2E2JJ 1ZGWA 2E2HJ 4A3CJ 5EG0A 3IH2A 3LSPA 1TWCJ 5HODA 2VUMJ 2TCTA 3C2BA 2DA2A 5E3NA 4CYCA 4XRSA 3BQZA 2COBA 4M6VA 3NARA 2L7ZA 1RR7A 3FK6A 3PO2J 5DS9A 1B8IB 2LP0A 4I6ZA 4UUTA 1JKOC 3ZOBA 2NS7A 1JKPC 2FD5A 2JA8J 4MFDA 5C4XJ 2K9QA 4JX4A 3K2AA 4A3BJ 2LVSA 3BTCA 3QPLA 3OIOA 3A01A 3BR2A 1SFOJ 2JA5J 1VNDA 2XPUA 2FX0A 5K7HA 1FTTA 3HGGA 1DU0A 3S16J 4FE7A 5EZHA 2XGEA 4BBRJ 2QCOA 3E7LA 3OSGA 3RZDJ 3S1MJ 3CCYA 5EGOB 2CRGA 4L5EA 1B8IA 3BT9A 3IV5A 3BG9A 1A5JA 2VPRA 3JREA 1RETA 3GTPJ 1JJ8C 3LNQA 1HOMA 2M2EA 2NVQJ 2LTPA 3BG5A 3RKQA 3JRCA 5FLVA 2XB5A 4BY7J 2E1OA 5F0FA 3HOWJ 5EEAA 2K9SA 3JR9A 1JKQC 2W48A 4C3IJ 3MKLA 1MBGA 9ANTA 1K83J 5F27A 2IEKA 2M0CA 5EF6A 4UUSA 4QTRA 2E2IJ 3S17J 3ZQCA 4V2GA 5FKMA 4DW6A 1IV6A 1Z0XA 1WH5A 1QVTA 2DMQA 1H89C 1IGNA 2K9NA 1S7EA 3BR1A 2R92J 2EBIA 3FKIJ 3S15J 1F43A 5C3EJ 2ELKA 1T56A 3HGYA 2PMZN 2HQ5A 3OOUA 1EF4A 4IHYA 5DTDA 5F08A 5M3FJ 1JUPA 1UG2A 2R0QC 1GV5A 1WGXA 1FTZA 3HOXJ 3PM1A 4A3LJ 1K61A 5IP9J 2NS8A 3D1NI 1VF9A 1RKWA 2DA5A 1HDDC 5J3LA 3JRHA 2O9LA 2NOGA 1MBJA 3CDLA 5EZGA 3L1PA 1OJLA 2VKEA 4DZJA 1AKHA 2DJNA 3GTGJ 3HOZJ 5EG0B 2R93J 1WPKA 3HOUJ 1U8BA 4A3GJ 2H1KA 2Y31A 4AYBN 2JJ7A 2XB0X 1FJLA 3GTOJ 3SDGA 3A03A 2R5ZA 2EZLA 3BG3A 2MG4A 4QIWN 3Q0UA 3LSRA 5F0HA 1WH7A 1IJWC 1T33A 4JX6A 5JLWA 1Y1VJ 1IUFA 3LSJA 2JA7J 3IH4A 1JT6A 3LOCA 2FJ1A 5BNGA 3S2DJ 2NVYJ 1LFUP 2MSYA 3ZQFA 3FK7A 3G1LA 5M5XJ 2HDDA 4BXXJ 1I50J 1H8AC 1ETYA 2X6OA 1QPIA 4HNVA 4FTHA 2IAIA 1U9NA 1VFCA 1OCTC 1ORKA 1OCPA 1P7JA 4JX5A 4GFBA 3H0GJ 2XPWA 3G1MA 2DTZA 4A3IJ 2WB1N 5IYBJ 5IOYA 1LE8A 4A93J 1NTCA 1R9TJ 3LSGA 3JRBA 2MW8A 3HB9A 1NK2P 5C44J 2M8GX 2Y0SN 1BW5A 2ID6A 1ETWA 2XGCA 4Y7NJ 1W0UA 1ZKGA 3GBGA 4UUSB 1MSFC 2D5VA 2ECCA 5FKNA 1SANA 2L0KA 4D5CA 3TEDA 4BBSJ 2RAEA 3S1NJ 1ENHA 3W6VA 3GTKJ 1DU6A 2QF7A 4X1EA 3IH3A 2B63J 3S1QJ 2XPVA 2G0EA 5K7ZA 2Y9ZA 2CQXA 3S2HJ 2L7FP 2CUFA 2DA1A 2OF7A 5EDNA 1WCMJ 1ZK8A 1AHDP 1E3OC 5J1RA 2KDZA 3BR3A 4BY1J 4MFEA 4DYRA 4M3DA 1GT0C 1AU7A 1RPWA 1I6HJ 3PO3J 3BR5A 2I10A 3BR0A 3ZQLA 5J1UA 2M9HA 1RKTA 1MH4A 1F36A 1MH3A 2KT0A 2HOTA 5IYCJ 3DCFA 3O8GA 2MGQA 1AKHB 2L7MP 1TWGJ 1MBEA 4MIMA 4AUXA 5C4JJ 4D7NA 4C3JJ 1I3QJ 5F04A 4M3GA 2VKVA 4W1UA 4A3KJ 3MN2A 4J19A 2DA3A 1IG7A 1GUUA 1GV2A 1ETOA 2LLKA 2X48A 4BKXA 3TW6A 3JRAA 2LKXA 3M4OJ 4S0HB 1MBFA 2R5ZB 5GPCA 1U78A 1ETKA 1FIPA 4B1RA 4A3EJ 3RZOJ 3WHCA 1IC8A 2DN0A 2WAQN 2DMPA 1RESA 4D5FA 4IHWA 2EZHA 1BJZA 5IP7J 1TWHJ 3Q0WA 4JP0A 5IPAA 3HM5A 1ZR2A 2M34A 1JGGA 2R7ZJ 1NK3P 3BTJA 1OFCX 2LD5A 4A3JJ 1JUMA 4IHXA 5FKLA 5M5WJ 4JYKA 2YS9A 2CUEA 3CMYA 3S14J 4A3MJ 1JT0A 2FQ4A 2JN6A 1MSEC 2H8RA 1ITYA 2O8KA 2DA4A 2HXIA 1YRNA 2NVXJ 3OSFA 3FIWA 5GP9A 1LE8B 1PUFA 3HOYJ 2DMTA 4FISA 1U9OA 5J1YA 5EYRA 5K7FA 1VI0A 5M5YJ 5GPAA 1H88C 4FE4A 3I4NJ 1GVDA 2LFBA 4NDLA 1BW6A 4XRSG 3ZQGA 2AHQA 2HYJA 2IBDA 1IDYA 1MBHA 4XK4A 3BR6A 4M3BA 1HCRA 1IDZA 2LR8A 2ECBA 3O8HA 5FKOA 1QRYA 3BTIA 2JK3A 1Y1WJ 3TP0A 3A02A 1BA5A 2DMUA 1G2HA 1ZQ3P 2N8GA 3QPSA 1JJ6C 4A3FJ 1TC3C 3I4MJ 1TWFJ 2YU9J 4DYQA 2EH3A 5M3MJ 4X6AJ 3HOVJ 1BL0A 5E3LA 2HI3A 2YUSA 1A6IA 2AO9A 2HXOA 4DYCA 2Y2ZA 2DA7A 2L9RA 4M3EA 3SFIA 5E3MA 3Q3SA 1MNMC 2VI6A 2HOSA 3VPRA 1B72A 3WHBA 1FIAA 4XRMA 4G12A 4V2FA 3Q0VA 1X2NA 2WV1A 3NAUA 1ETXA 3UKGA 4A3DJ 1WI3A 3K7AJ 4DZPA 2JA6J 2NVTJ 2R5YB 2CJJA 2GM4A 2XRLA 3H3VK 5E3OA 2JWTA 4RBOA 1HLVA 3JRDA 1Z77A 1O4XA 1P7IA 4A69C 4IHVA 1X58A 4MLOA 1APLC 1XC5A 5FKKA 1JKRC 1JUSA 1UHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQQ A;  1GDT A;  4EEF G;  2JMW A;  3BQY A;  5FJ8 J;  2XGD A;  4B4C A;  5EGO A;  2HOA A;  3BTL A;  3JRF A;  5IP6 A;  3HEF A;  1CQT A;  4IEJ A;  4M3F A;  2Y30 A;  3JRG A;  2R5Y A;  4ABZ A;  4AC0 A;  1JTX A;  4QSH A;  5JLX A;  3JRI A;  3M3Y J;  1YRN B;  2E19 A;  3B6A A;  2O7O A;  2ME6 A;  3SJM A;  1PUF B;  5IYD J;  3MVP A;  3FIS A;  3TW7 A;  2XSD C;  4C2M J;  4LOC A;  1POG A;  5F0C A;  3TP3 A;  4RDU A;  2X9D A;  3GTM J;  1TWA J;  2K40 A;  4I76 A;  1IRZ A;  1Q1V A;  1FEX A;  2ME0 A;  3QQA A;  3S1R J;  3HKZ N;  2Y9Y A;  5IOZ A;  5FLM J;  4B3A A;  1HDP A;  3GTL J;  3G1O A;  2P81 A;  3F0C A;  1LFB A;  5F1J A;  3ZQI A;  2ZB9 A;  1UMQ A;  1MBK A;  3B6C A;  3DEW A;  1X2M A;  2EQR A;  1W0T A;  2LY9 A;  4Y52 J;  3CQZ J;  4MO7 A;  1HF0 A;  4CYC B;  4W97 A;  1D5Y A;  1JTY A;  3ZQH A;  4FCY A;  1XG1 A;  2EZI A;  1ETQ A;  2EZK A;  2GBY A;  1ZR4 A;  1QVU A;  2OPT A;  1ZTR A;  2DA6 A;  2CU7 A;  3GTQ J;  3HBL A;  3RQI A;  1ETV A;  2LK2 A;  2ID3 A;  2DMN A;  4XIC A;  2GLO A;  3GTJ J;  4D7M A;  1XS9 A;  4C3H J;  3HDD A;  2TRT A;  4XID A;  3A01 B;  1B72 B;  2E2J J;  1ZGW A;  2E2H J;  4A3C J;  5EG0 A;  3IH2 A;  3LSP A;  1TWC J;  5HOD A;  2VUM J;  2TCT A;  3C2B A;  2DA2 A;  5E3N A;  4CYC A;  4XRS A;  3BQZ A;  2COB A;  4M6V A;  3NAR A;  2L7Z A;  1RR7 A;  3FK6 A;  3PO2 J;  5DS9 A;  1B8I B;  2LP0 A;  4I6Z A;  4UUT A;  1JKO C;  3ZOB A;  2NS7 A;  1JKP C;  2FD5 A;  2JA8 J;  4MFD A;  5C4X J;  2K9Q A;  4JX4 A;  3K2A A;  4A3B J;  2LVS A;  3BTC A;  3QPL A;  3OIO A;  3A01 A;  3BR2 A;  1SFO J;  2JA5 J;  1VND A;  2XPU A;  2FX0 A;  5K7H A;  1FTT A;  3HGG A;  1DU0 A;  3S16 J;  4FE7 A;  5EZH A;  2XGE A;  4BBR J;  2QCO A;  3E7L A;  3OSG A;  3RZD J;  3S1M J;  3CCY A;  5EGO B;  2CRG A;  4L5E A;  1B8I A;  3BT9 A;  3IV5 A;  3BG9 A;  1A5J A;  2VPR A;  3JRE A;  1RET A;  3GTP J;  1JJ8 C;  3LNQ A;  1HOM A;  2M2E A;  2NVQ J;  2LTP A;  3BG5 A;  3RKQ A;  3JRC A;  5FLV A;  2XB5 A;  4BY7 J;  2E1O A;  5F0F A;  3HOW J;  5EEA A;  2K9S A;  3JR9 A;  1JKQ C;  2W48 A;  4C3I J;  3MKL A;  1MBG A;  9ANT A;  1K83 J;  5F27 A;  2IEK A;  2M0C A;  5EF6 A;  4UUS A;  4QTR A;  2E2I J;  3S17 J;  3ZQC A;  4V2G A;  5FKM A;  4DW6 A;  1IV6 A;  1Z0X A;  1WH5 A;  1QVT A;  2DMQ A;  1H89 C;  1IGN A;  2K9N A;  1S7E A;  3BR1 A;  2R92 J;  2EBI A;  3FKI J;  3S15 J;  1F43 A;  5C3E J;  2ELK A;  1T56 A;  3HGY A;  2PMZ N;  2HQ5 A;  3OOU A;  1EF4 A;  4IHY A;  5DTD A;  5F08 A;  5M3F J;  1JUP A;  1UG2 A;  2R0Q C;  1GV5 A;  1WGX A;  1FTZ A;  3HOX J;  3PM1 A;  4A3L J;  1K61 A;  5IP9 J;  2NS8 A;  3D1N I;  1VF9 A;  1RKW A;  2DA5 A;  1HDD C;  5J3L A;  3JRH A;  2O9L A;  2NOG A;  1MBJ A;  3CDL A;  5EZG A;  3L1P A;  1OJL A;  2VKE A;  4DZJ A;  1AKH A;  2DJN A;  3GTG J;  3HOZ J;  5EG0 B;  2R93 J;  1WPK A;  3HOU J;  1U8B A;  4A3G J;  2H1K A;  2Y31 A;  4AYB N;  2JJ7 A;  2XB0 X;  1FJL A;  3GTO J;  3SDG A;  3A03 A;  2R5Z A;  2EZL A;  3BG3 A;  2MG4 A;  4QIW N;  3Q0U A;  3LSR A;  5F0H A;  1WH7 A;  1IJW C;  1T33 A;  4JX6 A;  5JLW A;  1Y1V J;  1IUF A;  3LSJ A;  2JA7 J;  3IH4 A;  1JT6 A;  3LOC A;  2FJ1 A;  5BNG A;  3S2D J;  2NVY J;  1LFU P;  2MSY A;  3ZQF A;  3FK7 A;  3G1L A;  5M5X J;  2HDD A;  4BXX J;  1I50 J;  1H8A C;  1ETY A;  2X6O A;  1QPI A;  4HNV A;  4FTH A;  2IAI A;  1U9N A;  1VFC A;  1OCT C;  1ORK A;  1OCP A;  1P7J A;  4JX5 A;  4GFB A;  3H0G J;  2XPW A;  3G1M A;  2DTZ A;  4A3I J;  2WB1 N;  5IYB J;  5IOY A;  1LE8 A;  4A93 J;  1NTC A;  1R9T J;  3LSG A;  3JRB A;  2MW8 A;  3HB9 A;  1NK2 P;  5C44 J;  2M8G X;  2Y0S N;  1BW5 A;  2ID6 A;  1ETW A;  2XGC A;  4Y7N J;  1W0U A;  1ZKG A;  3GBG A;  4UUS B;  1MSF C;  2D5V A;  2ECC A;  5FKN A;  1SAN A;  2L0K A;  4D5C A;  3TED A;  4BBS J;  2RAE A;  3S1N J;  1ENH A;  3W6V A;  3GTK J;  1DU6 A;  2QF7 A;  4X1E A;  3IH3 A;  2B63 J;  3S1Q J;  2XPV A;  2G0E A;  5K7Z A;  2Y9Z A;  2CQX A;  3S2H J;  2L7F P;  2CUF A;  2DA1 A;  2OF7 A;  5EDN A;  1WCM J;  1ZK8 A;  1AHD P;  1E3O C;  5J1R A;  2KDZ A;  3BR3 A;  4BY1 J;  4MFE A;  4DYR A;  4M3D A;  1GT0 C;  1AU7 A;  1RPW A;  1I6H J;  3PO3 J;  3BR5 A;  2I10 A;  3BR0 A;  3ZQL A;  5J1U A;  2M9H A;  1RKT A;  1MH4 A;  1F36 A;  1MH3 A;  2KT0 A;  2HOT A;  5IYC J;  3DCF A;  3O8G A;  2MGQ A;  1AKH B;  2L7M P;  1TWG J;  1MBE A;  4MIM A;  4AUX A;  5C4J J;  4D7N A;  4C3J J;  1I3Q J;  5F04 A;  4M3G A;  2VKV A;  4W1U A;  4A3K J;  3MN2 A;  4J19 A;  2DA3 A;  1IG7 A;  1GUU A;  1GV2 A;  1ETO A;  2LLK A;  2X48 A;  4BKX A;  3TW6 A;  3JRA A;  2LKX A;  3M4O J;  4S0H B;  1MBF A;  2R5Z B;  5GPC A;  1U78 A;  1ETK A;  1FIP A;  4B1R A;  4A3E J;  3RZO J;  3WHC A;  1IC8 A;  2DN0 A;  2WAQ N;  2DMP A;  1RES A;  4D5F A;  4IHW A;  2EZH A;  1BJZ A;  5IP7 J;  1TWH J;  3Q0W A;  4JP0 A;  5IPA A;  3HM5 A;  1ZR2 A;  2M34 A;  1JGG A;  2R7Z J;  1NK3 P;  3BTJ A;  1OFC X;  2LD5 A;  4A3J J;  1JUM A;  4IHX A;  5FKL A;  5M5W J;  4JYK A;  2YS9 A;  2CUE A;  3CMY A;  3S14 J;  4A3M J;  1JT0 A;  2FQ4 A;  2JN6 A;  1MSE C;  2H8R A;  1ITY A;  2O8K A;  2DA4 A;  2HXI A;  1YRN A;  2NVX J;  3OSF A;  3FIW A;  5GP9 A;  1LE8 B;  1PUF A;  3HOY J;  2DMT A;  4FIS A;  1U9O A;  5J1Y A;  5EYR A;  5K7F A;  1VI0 A;  5M5Y J;  5GPA A;  1H88 C;  4FE4 A;  3I4N J;  1GVD A;  2LFB A;  4NDL A;  1BW6 A;  4XRS G;  3ZQG A;  2AHQ A;  2HYJ A;  2IBD A;  1IDY A;  1MBH A;  4XK4 A;  3BR6 A;  4M3B A;  1HCR A;  1IDZ A;  2LR8 A;  2ECB A;  3O8H A;  5FKO A;  1QRY A;  3BTI A;  2JK3 A;  1Y1W J;  3TP0 A;  3A02 A;  1BA5 A;  2DMU A;  1G2H A;  1ZQ3 P;  2N8G A;  3QPS A;  1JJ6 C;  4A3F J;  1TC3 C;  3I4M J;  1TWF J;  2YU9 J;  4DYQ A;  2EH3 A;  5M3M J;  4X6A J;  3HOV J;  1BL0 A;  5E3L A;  2HI3 A;  2YUS A;  1A6I A;  2AO9 A;  2HXO A;  4DYC A;  2Y2Z A;  2DA7 A;  2L9R A;  4M3E A;  3SFI A;  5E3M A;  3Q3S A;  1MNM C;  2VI6 A;  2HOS A;  3VPR A;  1B72 A;  3WHB A;  1FIA A;  4XRM A;  4G12 A;  4V2F A;  3Q0V A;  1X2N A;  2WV1 A;  3NAU A;  1ETX A;  3UKG A;  4A3D J;  1WI3 A;  3K7A J;  4DZP A;  2JA6 J;  2NVT J;  2R5Y B;  2CJJ A;  2GM4 A;  2XRL A;  3H3V K;  5E3O A;  2JWT A;  4RBO A;  1HLV A;  3JRD A;  1Z77 A;  1O4X A;  1P7I A;  4A69 C;  4IHV A;  1X58 A;  4MLO A;  1APL C;  1XC5 A;  5FKK A;  1JKR C;  1JUS A;  1UHS A; 
#chains in the Genus database with same CATH topology
 3M1C A;  1GDT A;  3J7A Y;  1WJF A;  3ABT A;  1ZG1 A;  2JMW A;  2QEN A;  1SVL A;  2DBB A;  1D1C A;  2H8W A;  3I5U A;  5FJ8 J;  5F64 A;  1VQN I;  1YO5 C;  2DT5 A;  3M8E A;  4CDG A;  1ZRE A;  1JI8 A;  3EDP A;  3FXL A;  5HS8 A;  2MD5 A;  1MMG A;  1VQ7 I;  4RLQ A;  1HKT A;  2E19 A;  4IZZ A;  2O7O A;  2ME6 A;  2DFE A;  2UV1 A;  3BG6 A;  2LF8 A;  3D5L A;  1Z6R A;  4IHT A;  3HTU A;  2XSD C;  4OIP F;  4BQA A;  4IQJ A;  1POG A;  4Q48 A;  3TP3 A;  1R1U A;  4RDU A;  1FSE A;  2IGK A;  3OMY A;  3EYI A;  3HOS A;  5B3S H;  1BI1 A;  4OIQ F;  4FHT A;  3ASN H;  2XRO A;  2ME0 A;  3S1R J;  1U8R A;  1ERD A;  3EUH C;  3HKZ N;  2Y9Y A;  1VQL I;  5FLM J;  2H09 A;  4B3A A;  3GLL A;  1HDP A;  2R7W A;  3G1O A;  5HLT A;  5F1J A;  1LFB A;  1FBQ A;  5HLG A;  4G7H F;  1QBJ A;  5LRS A;  4GCV A;  3B6C A;  1G3Y A;  4XR6 A;  1OPC A;  1W0T A;  3H9J A;  2KDO A;  1BOA A;  2LY9 A;  3K9T A;  2DK8 A;  3CQZ J;  3J7A O;  2HS5 A;  1P4A A;  4PGG A;  1RI7 A;  4W97 A;  1KU7 A;  3RIR A;  3ZQH A;  5GAE J;  1MIJ A;  3I3L A;  2EZI A;  2CW0 F;  3KZY A;  5IY5 H;  3G3Z A;  2EPF A;  4AWX B;  4RB1 A;  1ZHF A;  3GTQ J;  4FX0 A;  1ON2 A;  2E7X A;  4LIV A;  5KAI C;  1L3L A;  2LK2 A;  3VOE A;  2ID3 A;  4MHG A;  4OIN F;  3DPL C;  3HDD A;  1MJA A;  1OR7 A;  2E2J J;  4HQE A;  4CCJ A;  1ZGW A;  1V5G A;  1X4P A;  5EG0 A;  2L5Q A;  2KL4 A;  4NC8 A;  5LBQ A;  3LSP A;  2A6H F;  2VXZ A;  5HVQ C;  1VQP I;  3BQZ A;  3QP6 A;  2K4B A;  2L3D A;  2L7Z A;  1RR7 A;  5D5U B;  2LP0 A;  1JKO C;  1FYK A;  4M73 A;  1SFU A;  1JKP C;  2JA8 J;  3LST A;  2L02 A;  5C4X J;  2VT2 A;  1J7K A;  3F8N A;  5ICC A;  1FLI A;  1PYV A;  3AL0 C;  2RQQ A;  3F6V A;  4B09 A;  1ON1 A;  3A01 A;  2JA5 J;  2PJR A;  1EJ9 A;  2OD5 A;  3P9C A;  1YJN I;  4KIT B;  4E7K A;  2J5P A;  3BJ6 A;  1IN4 A;  1VQ9 I;  5GAD J;  1DU0 A;  2GZW A;  3S16 J;  2Q8K A;  4HYE A;  5J47 A;  3E7L A;  5LFA A;  3RZD J;  1OYI A;  1RC9 A;  5IT9 Z;  4L5E A;  1PDN C;  4G7O F;  1ZLK A;  3IV5 A;  1G3S A;  2BW3 A;  3OV8 A;  3JRE A;  4LJZ F;  2O03 A;  1IZ1 A;  2JT1 A;  2JVH A;  1JJ8 C;  1R00 A;  4E4H A;  4G6Q A;  2M2E A;  1HOM A;  1ZGJ A;  4AD9 A;  5F0F A;  5EEA A;  2K9S A;  1YS7 A;  2FBI A;  4N4O B;  2W48 A;  4YEL A;  1MBG A;  3P5J A;  9ANT A;  4AIK A;  2VKH A;  5KCM A;  2CFO A;  3F21 A;  5F27 A;  3CZ6 A;  2IEK A;  2O5R A;  4YIR X;  2E2I J;  4QTR A;  2E71 A;  1SAU A;  3S17 J;  2PJP A;  2QM3 A;  1R4N B;  1XSV A;  4EM2 A;  1IV6 A;  5DM7 F;  2A5Y B;  2BGC A;  3U1K A;  3LA3 A;  3OL4 A;  1AA7 A;  1H89 C;  3KYD B;  3QU6 A;  2EFW A;  3BR1 A;  2ZJQ F;  3FKI J;  1F5T A;  3S15 J;  3L09 A;  4HA8 A;  5AON A;  2ELK A;  4G7Z F;  3HGY A;  2MC3 A;  5FLX Z;  2UXN A;  2PMZ N;  4HLX A;  1E3P A;  3RSN A;  5LLQ A;  5DUI A;  3C18 A;  3PFI A;  3V7S A;  2R7F A;  4V19 K;  3K70 C;  3LQQ A;  5ICG A;  3RJP A;  1V5E A;  3DPT A;  1QO0 D;  3DTK A;  4TV7 A;  1RKW A;  4A5M A;  4U0Y A;  2XAQ A;  2O9L A;  1LUJ B;  2HVQ A;  1MBJ A;  5EJC A;  5CKT A;  3PL8 A;  3TOB A;  4IX7 A;  4KMF A;  5L3B A;  2VKE A;  4DZJ A;  1DPR A;  5TRD A;  2DJN A;  1QNT A;  2JPC A;  2V1D A;  3K0L A;  1DP3 A;  4U88 A;  3GTG J;  1VQO I;  3HOZ J;  5ILU A;  5EG0 B;  2HVR A;  2XAJ A;  1U8B A;  3H36 A;  4NBQ A;  2QQ8 A;  3OY9 A;  2UXX A;  1OIS A;  4AYB N;  2JJ7 A;  2XB0 X;  3GTO J;  1R6R A;  3QOE A;  3OYN A;  3RKX A;  1KA8 A;  4RS8 A;  1Y39 A;  3A03 A;  1TTY A;  3ZMV A;  4XOT A;  5ICF A;  2LBF A;  2RNG A;  1WJA A;  5JVT A;  1FOK A;  3LSR A;  2CS3 A;  2DO7 A;  2X6X A;  4XM3 A;  3E6M A;  1WH7 A;  2CQN A;  1IJW C;  2ZME A;  1OLT A;  3TL4 X;  1VQ4 I;  2DDA A;  1Y1V J;  2VC0 A;  4PJN A;  5LGT A;  1Z05 A;  3LSJ A;  1B6A A;  1TQM A;  1JGS A;  2GXG A;  2FBH A;  3L2U A;  2NVY J;  2ISZ A;  2PJR B;  3FK7 A;  3I55 I;  4L18 B;  2UWM A;  5M5X J;  1DUX C;  2K7L A;  2EIJ H;  2V79 A;  3E0J B;  3WE3 A;  3KYL A;  1I50 J;  1XMX A;  1H8A C;  3RYR A;  3DKY A;  3I59 A;  2QBY A;  2M8E A;  4HNV A;  3KP7 A;  1U9N A;  4RB2 C;  1H9T A;  2JPB A;  1ORK A;  2QZ8 A;  4JX5 A;  3H0G J;  3G1M A;  4EGY A;  3P9K A;  2DOE A;  5IOY A;  1LE8 A;  3DF8 A;  4XLC A;  1R22 A;  5DM6 F;  1A6Q A;  1FMW A;  3ZXS A;  3JRB A;  1NH3 A;  1WZ2 A;  2MW8 A;  5E17 F;  5HDK A;  5JI6 A;  2ID6 A;  1HA8 A;  3N4M A;  2A05 A;  3FKJ A;  4K2E A;  3DFG A;  3W3C A;  3KZZ A;  2D5V A;  2MC4 A;  2ECC A;  1T6S A;  1E17 A;  2L0K A;  4D5C A;  4Y33 A;  2WBM A;  2A69 F;  2W24 A;  3PNT A;  3DEU A;  4LLL A;  3GTK J;  1YTY A;  1CF7 A;  1BN5 A;  5EEH A;  2G7H A;  2B63 J;  2FOK A;  3KIO A;  2IS1 A;  3GUD A;  3DU5 A;  2Y9Z A;  2QWW A;  3SZT A;  2M4K A;  4BYY A;  1PP7 U;  1B9M A;  3H1C A;  1D3Y A;  3IC7 A;  2QGU A;  2HQN A;  2OF7 A;  1WCM J;  1AHD P;  2JUC A;  1E3O C;  2XKP A;  1OCO H;  1TW2 A;  2XF5 A;  3E3V A;  1XGO A;  1Z3X A;  2EJR A;  2DDB A;  1EA3 A;  1BBY A;  2K27 A;  3EQL F;  2M1B A;  3R4K A;  4PSW A;  3BG7 A;  2ZXH A;  5J1U A;  2ZSI B;  3GWZ A;  2CH0 A;  1RKT A;  3H3Z A;  1F36 A;  1S7O A;  1TQI A;  2KT0 A;  4P9U A;  4IOA F;  2HOT A;  2XUB A;  3O8G A;  3TDZ C;  2RRE A;  2L7M P;  4LG3 A;  4MIM A;  4XN0 A;  5C4J J;  3ZN1 A;  4S04 A;  2XAU A;  2A61 A;  4M3G A;  2GXA A;  1IXC A;  3IWF A;  2VL8 A;  1J9I A;  4XRF A;  4GYG A;  1LKX A;  1IG7 A;  1GUU A;  1R5I D;  2QSF X;  2YX7 A;  4YG2 F;  4Y15 A;  4IPA A;  2LBF B;  3HJE A;  4A3E J;  2PI0 A;  4OIR F;  2O61 A;  4DGW B;  2FE3 A;  2LMD A;  5BOX A;  2HPI A;  1RES A;  4D5F A;  4J01 A;  1YW8 A;  4IHW A;  4I99 C;  2EZH A;  1NHA A;  1BJZ A;  1IN6 A;  1U2W A;  5H20 A;  2FNA A;  2ZXW H;  1NK3 P;  3BTJ A;  3GLX A;  4QPQ A;  4IHX A;  5M5W J;  2VB6 A;  2YS9 A;  1HW1 A;  3S14 J;  2F4I A;  3I59 B;  4JQF A;  2FQ4 A;  2QBY B;  4L9J A;  3WTW C;  1B9N A;  2FA5 A;  4RGU A;  2DA4 A;  2WWY A;  3M7G A;  3HIF A;  1YRN A;  2NVX J;  3OSF A;  1FOY A;  1SD5 A;  1LE8 B;  2COM A;  2DFH A;  1PUF A;  2CO5 A;  3AAF A;  2YX4 A;  2P0W A;  4OMZ A;  2F4M B;  3CUQ A;  1AWC A;  4KDP A;  4UB8 C;  2XVC A;  4EJU A;  4BDZ A;  1M1E B;  4E7Z A;  2VKD A;  4NDL A;  2AS5 F;  1STZ A;  4HV6 A;  2EV0 A;  3ZQG A;  1TT0 A;  4OAY A;  1NG7 A;  3MZ8 A;  2HZD A;  2OUM A;  2OV7 A;  2HYJ A;  3M8F A;  3ZMU A;  1IDY A;  4LK1 F;  1MBH A;  4XK4 A;  3HSR A;  3OIP A;  3BR6 A;  4M3B A;  4E7I A;  1OCC H;  3KP5 A;  1BM9 A;  4HX8 A;  2ECB A;  1CF7 B;  3ML6 A;  5JFR A;  2EIK H;  1TBX A;  4BAY A;  3WTZ A;  4YFK F;  3V8K A;  3VYR B;  4PUS A;  1MMN A;  2X1C A;  1Y1W J;  2BZT A;  3KP3 A;  1T95 A;  4XL9 A;  5D5W B;  2Z9O A;  2X6W A;  1C0W A;  3QPS A;  1I5Z A;  1YX5 A;  1HBX G;  5FD5 A;  3I4M J;  4BUP A;  2EH3 A;  4HX7 A;  5CVI A;  3PQJ A;  1W7P A;  3HOV J;  2MFZ A;  2YR2 A;  3JTH A;  1A6I A;  1GVJ A;  1YFH A;  1GHC A;  1UCR A;  2OZ6 A;  5EEG A;  1MW7 A;  3SFI A;  1VQ8 I;  3Q3S A;  1S9H A;  3I53 A;  3OYH A;  4LIU A;  2WAD A;  2HZT A;  4L5J A;  1W36 D;  3BC8 A;  4I7H A;  1ZYR F;  3T0Y A;  3KX2 A;  3O2P E;  5HLH A;  3FBN B;  2WV1 A;  1MZB A;  4EQQ A;  2GIZ A;  1K6Y A;  1E3H A;  1Z67 A;  1KQ8 A;  3BJA A;  3L00 A;  3NWS A;  3NAU A;  1G3W A;  5D6F A;  1ETX A;  4WXC A;  5CPR B;  2MYS A;  4O6J A;  3UKG A;  2HKX A;  1WI3 A;  3FDY A;  4Q47 A;  4DZP A;  4Y17 A;  1A04 A;  2NVT J;  2Y0S A;  3H0D A;  5CVU A;  1BR2 A;  1MMS A;  1O7L A;  2JWT A;  3IKV A;  2Z16 A;  2IS6 A;  1BI0 A;  3KET A;  1HLV A;  4XOP A;  2MBF A;  4CCM A;  1D8K A;  2KP6 A;  4PDK A;  3QYB A;  4ZTJ A;  4G94 A;  2DJI A;  2D2W A;  1X58 A;  3Q9S A;  4A2U A;  2ACJ A;  2XAG A;  1K4T A;  3ECH A;  4G6T B;  4LFU A;  3RKY A;  4B44 A;  5FKK A;  2HPM A;  3WG7 H;  2V9V A;  1UHS A;  3JTG A;  1D8J A;  2FSW A;  2O0Y A;  2QQ9 A;  3MWM A;  2VT3 A;  2XAH A;  1SFX A;  1IN8 A;  2X85 A;  3BQY A;  3ZRG A;  4DBR A;  2XGD A;  5EGO A;  2HOA A;  3BTL A;  3JRF A;  4XLN F;  5IP6 A;  2CV1 A;  4A0X A;  1XDS A;  3LA7 A;  2EIN H;  4ABZ A;  3F8F A;  4QSH A;  4XKV A;  5K5O A;  1YRN B;  4S05 A;  3SJM A;  5FRN A;  1PUF B;  3WTT C;  4BHB A;  1U5T C;  3OYF A;  3U21 A;  2FU4 A;  3CUQ B;  5CVV A;  4LOC A;  1HSJ A;  4RGX A;  4BQQ A;  4P5O A;  2HQA A;  4EAT A;  3FXU A;  3O6B B;  4I76 A;  2BVM A;  3CC2 I;  2IXS A;  1HKS A;  4XSX F;  3Q9V A;  1Z3Y A;  1KQ0 A;  2HWV A;  1BC7 C;  1LDD A;  3M1E A;  2GAU A;  3F0C A;  4HNT A;  5ERI A;  4RLF A;  2V6E A;  4P55 A;  5BS6 A;  2ZB9 A;  4PJ0 C;  1MBK A;  3ZQQ A;  3F3X A;  2EQR A;  3CJR B;  3IRR A;  4BE0 A;  4EJO A;  1YJ9 I;  1U3E M;  2R7V A;  1UB9 A;  5E20 A;  5A2Q Z;  4XOR A;  4NB5 A;  5GTI C;  4CYC B;  1JTY A;  2KZV A;  2HYG D;  4EVI A;  4HRI A;  1XG1 A;  2I8D A;  1WJ5 A;  2BXZ A;  2GBY A;  5CJ9 A;  1QVU A;  1I27 A;  1W7P B;  2DA6 A;  3U1D A;  2CU7 A;  4YFX F;  1ETV A;  4XMY A;  2DMN A;  4CUG A;  4P1W A;  2GLO A;  1ZLJ A;  2H1L A;  1QGP A;  2FBK A;  2W85 A;  3A4C A;  3CMA I;  2TRT A;  3R60 A;  3FMQ A;  2JZY A;  3HKZ A;  3WGI A;  2VLA A;  2STT A;  1D5V A;  2E2H J;  3IH2 A;  5HOD A;  3CO7 C;  3DP7 A;  2TCT A;  5E3N A;  4I09 A;  1EH8 A;  3RYP A;  2COB A;  3NAR A;  2TDX A;  4WWC A;  3F8B A;  3AFH A;  3NRV A;  2MA3 A;  3M8J A;  3TO9 A;  2RN7 A;  4UUT A;  4B48 A;  4MFD A;  1IRF A;  1D1B A;  2L01 A;  2K9Q A;  3KZI C;  3L2Q A;  2QLZ A;  3R0A A;  3RKW A;  3UR3 C;  2KRC A;  4ESB A;  3DLL F;  3BTC A;  3QPL A;  3OIO A;  2FOW A;  4DNC A;  3BR2 A;  2RC4 A;  3FMR A;  3BPV A;  3MKW B;  1S3J A;  4M6X A;  3WE2 A;  1FC3 A;  1DQU A;  1VND A;  2XPU A;  1HW2 A;  4BXU A;  2M5W A;  5DYM A;  5K7H A;  2MLG A;  2K3P A;  4LG0 B;  3OSG A;  2QCO A;  3J7Z I;  2BHY A;  3BZK A;  4BDY A;  3S1M J;  5EGO B;  2CRG A;  3I64 A;  3QOD A;  3BT9 A;  4KA4 A;  1LDK B;  4BAC A;  3E6C C;  1RET A;  2IRF G;  3LNQ A;  2NVQ J;  3BG5 A;  1HC8 A;  3I9V 2;  2E1O A;  4ZJZ A;  3JR9 A;  1UAA A;  2IW5 A;  1O3T A;  1K83 J;  1LVK A;  1H9G A;  2RDP A;  3CCS I;  3M9A A;  2L9N A;  5EF6 A;  4BL0 B;  3D5S C;  3K4C A;  4V2G A;  4ZYA A;  1SVM A;  4I0A A;  4EM0 B;  5FKM A;  4KN7 X;  4XBF A;  1BC8 C;  2G9W A;  3VOD A;  1YW9 A;  3VSL A;  1R5H A;  1D1A A;  1ZGA A;  2FF4 A;  3L9F A;  2VJI A;  4U87 A;  4R79 A;  2IT0 A;  1LQ1 A;  1X19 A;  1IF1 A;  1IGN A;  4HST A;  2OZU A;  5TGT A;  1S7E A;  4PK4 A;  4LB5 A;  1F43 A;  4A12 A;  2KLO A;  4ZDO A;  2NNN A;  4O5V A;  3LSI A;  2HFH A;  1SMT A;  4BE1 A;  1LVA A;  2HQ5 A;  1Z7U A;  4N0B A;  1EF4 A;  2M7A A;  4F93 B;  3E6D A;  2QQB A;  1QZZ A;  3OIQ A;  3I0T A;  1WWX A;  1YOV B;  3GO5 A;  3T5X A;  3VYS B;  1GV5 A;  1WGX A;  1OR7 C;  2RV8 A;  2Q2E A;  2DK5 A;  4ENN A;  1T38 A;  3FWE A;  2IGN A;  1JE8 A;  4O3M A;  1VF9 A;  3GME A;  3X2Q H;  4BJ6 C;  1VQK I;  3CC7 I;  4HAM A;  1VTN C;  3BJO A;  3S93 A;  3L1P A;  1OJL A;  4WX9 A;  3QU3 A;  5TIS C;  2H27 A;  1T0F C;  5B1A H;  1F1Z A;  3AG4 H;  3GZ6 A;  1WPK A;  2BXY A;  4YFN F;  4HF1 A;  2H1K A;  2Y31 A;  2G7U A;  1FJL A;  2E1M B;  1VQ6 I;  1TL8 A;  4YIF A;  2PMZ A;  2R5Z A;  1V54 H;  4IO9 F;  4WCG A;  3BG3 A;  3DU6 A;  3CCE I;  2MG4 A;  1XB4 A;  4QIW N;  3Q0U A;  1XSX A;  4UVA A;  3CCJ I;  5D8L B;  2P6T A;  1T33 A;  4MTD A;  5J6X A;  3RQ4 A;  4H0E A;  3LOC A;  3IL2 A;  2DQL A;  1N75 A;  2FJ1 A;  2GOM A;  3FM3 A;  1BR4 A;  2M3A A;  4N4N B;  2NS0 A;  4LLG F;  2KQR A;  1J75 A;  4IJA A;  3H5R A;  4NUB A;  1ETY A;  2HYF A;  1S5L C;  3BOQ A;  1QPI A;  4FTH A;  4ESJ A;  1LJ9 A;  1FYL A;  3ELK A;  1VFC A;  4PFP A;  3DTI A;  2OQG A;  1V3F A;  2PLY A;  2EK5 A;  4RB3 C;  2WB1 N;  1QQI A;  4ZYD A;  2QYO A;  1Y8R B;  2ZXJ A;  1R9T J;  3SDB A;  2VQG A;  3EUH A;  1NK2 P;  2VOO A;  2VON A;  4HBL A;  3LAP A;  2QA4 I;  5LGN A;  1ZKG A;  1W0U A;  1MSF C;  1W7P D;  3RCO A;  2BOL A;  2D45 A;  3QPT A;  1SAN A;  3VFZ A;  2KRF A;  3TED A;  2KZG A;  2ZJ2 A;  3G4S I;  5HDN A;  1N77 A;  1ENH A;  4LD5 A;  3H5N A;  2OTL I;  4L0Z B;  5J4Y A;  4XLF A;  1RUN A;  1DU6 A;  2WC2 A;  2O3F A;  3ZN0 A;  3LA2 A;  2V26 A;  3WU2 C;  3IH3 A;  5IT9 K;  1UZC A;  5HNF A;  1EKE A;  2FRH A;  1Y8Q B;  1HKQ A;  3C2G A;  2JSC A;  2L7F P;  2CUF A;  4CSW A;  1YLF A;  1ZK8 A;  2A3S A;  1FP1 D;  5E8G A;  5J1R A;  3C3W A;  3OS0 A;  1X3Z B;  3BR3 A;  4RAF A;  2OC6 A;  3R61 A;  3OYI A;  3WTU C;  5HS7 A;  2Z5U A;  3A1Y A;  3BZ6 A;  2Q2E B;  4KT6 A;  2XHK A;  3E5X A;  2OQR A;  2XAS A;  2BY3 A;  1OMI A;  3QYE A;  1JHH A;  2M9H A;  1WQ2 A;  3IUO A;  4F7Z A;  2V9K A;  4Z6Y A;  1P9Q C;  2VE8 A;  3GW2 A;  2MGQ A;  3K4M A;  5TJJ A;  2CGP A;  4CCK A;  4MNU A;  1I3A A;  1B4A A;  4QPO A;  4C3J J;  4D7N A;  3LWF A;  3L2V A;  4R8H A;  4W1U A;  2EFN A;  5D4R A;  2L2O A;  2ZME C;  4B43 A;  3DWL E;  1GV2 A;  5FRO A;  3A0B C;  1ETO A;  2X48 A;  5FLX K;  4BKX A;  3JRA A;  3ZGK A;  2DOD A;  2LKX A;  3M4O J;  2R5Z B;  1MBF A;  1U78 A;  4ZYE A;  3BY6 A;  3RZO J;  2NNY A;  1ZRC A;  3AG2 H;  4RA2 A;  2GOX B;  2DMP A;  1EV7 A;  2KIU A;  2P5V A;  3ESW B;  4M9S A;  1X1C A;  2STW A;  4ENM A;  1KON A;  1TWH J;  4ITV A;  3OR1 C;  5HDG A;  1ZR2 A;  2ZNY A;  1JGG A;  2LD5 A;  4XON A;  1SD4 A;  5FKL A;  4OMY A;  1MMD A;  2X0L A;  4II2 A;  1D0Z A;  2AXL A;  3C1D A;  2CUE A;  2LKP A;  5DUK A;  3V7C A;  4A3M J;  1JT0 A;  2LY1 A;  3TKY A;  2E1C A;  2JN6 A;  3EYY A;  3KEQ A;  4RAY A;  1MSE C;  3BCA A;  4XQF A;  4ZZL A;  1YIO A;  3E5U A;  3B02 A;  1W1W E;  3J80 Z;  2HXI A;  2W25 A;  3EUA A;  1HST A;  2QSH X;  4KIS A;  4CO8 A;  2XV4 S;  1WSU A;  4A6D A;  3OYB A;  1FYM A;  1ZAR A;  1UHM A;  2LFB A;  3DQV C;  4KYW A;  2LF7 A;  2Q0O A;  2XDV A;  2WA0 A;  3CJT B;  2IBD A;  3FXK A;  4AVP A;  1G59 A;  6PAX A;  1HCR A;  1IDZ A;  4LK0 F;  2EFP A;  3O8H A;  3D0S A;  2L7K A;  5JR3 A;  2D1V A;  2GIV A;  1HQC A;  1QHG A;  1BA5 A;  3ISP A;  3PSF A;  4P9F A;  3K6G A;  3WTV C;  3HUG B;  1ZQ3 P;  2N8G A;  2JSP A;  2EIL H;  1IN7 A;  4GRI A;  2KHM A;  1TWF J;  4RAZ A;  3W6K B;  2YU9 J;  4DYQ A;  1VQM I;  3CCQ I;  1BIB A;  2PG4 A;  1B1B A;  1TT5 B;  1X1P A;  2YUS A;  4IRH A;  4XKB A;  2AO9 A;  3GFI A;  2Y2Z A;  4M3E A;  5FB2 A;  2VQH A;  2QKL B;  1MNM C;  1IO2 A;  4B8X A;  2HOS A;  3MAJ A;  1QPM A;  1FIA A;  4LGW A;  3F6O A;  4G12 A;  2VJ5 A;  4V2F A;  4ANJ A;  4MQV A;  3CF5 F;  3IHU A;  3CJQ B;  4CCO A;  3BZC A;  3OOP A;  4MTE A;  2KIM A;  2M4G A;  2PMH A;  3E6B A;  3HPG A;  1WI9 A;  3BP8 A;  1Y56 A;  4Y13 A;  1O3Q A;  3F72 A;  2R5Y B;  3ZMT A;  3H3V K;  1ODD A;  2K3F A;  4BGD A;  1UFM A;  3QWL A;  4B47 A;  3GVA A;  2GA1 A;  1WJB A;  3PSI A;  1S29 A;  3JRD A;  5GAG J;  3SZP A;  4N9H A;  1OCR H;  4UV9 A;  2X51 A;  4XLA A;  4CH7 A;  4ZDP A;  5ED4 A;  1APL C;  3ERM A;  2E60 A;  2R7Q A;  3FHZ A;  3CD6 I;  4ESF A;  4E7H A;  2CG4 A;  2KKO A;  1IV8 A;  4PJM A;  2DXI A;  3TBI A;  2X1D A;  1YJW I;  2JVG A;  3HRU A;  2XIG A;  3T8R A;  3CUQ C;  1KYZ A;  3HEF A;  1CQT A;  1JXS A;  1BOB A;  2Y30 A;  3JRG A;  4EV0 A;  1J2X A;  5JLX A;  3VDX A;  3JRI A;  5DCM A;  3B6A A;  4IQ4 A;  5IYD J;  3K1P A;  2CSO A;  3MVP A;  4RM2 A;  4U0W A;  4NQW A;  4A0Y A;  1H0M A;  2ZNZ A;  1UHW A;  3E5Q A;  3QP5 A;  5DDG A;  1YYV A;  2W57 A;  2O6G E;  1XGS A;  4L9N A;  3GF2 A;  1FP2 A;  2P7V B;  3H9Q A;  5F0C A;  2K4J A;  1MGT A;  1ONV A;  4KT5 C;  3J81 Z;  4JBA A;  4F52 A;  2E7W A;  1R7J A;  2IP2 A;  2VAS A;  3KP4 A;  1Q1V A;  2FEZ A;  1KU3 A;  1IRZ A;  1T08 B;  3KEY A;  3A0H C;  2A5W A;  4NC6 A;  5IOZ A;  1D0X A;  3GTL J;  2YSR A;  2R7U A;  4IHS A;  5D4S A;  2JRM A;  2AXT C;  3ZQI A;  2K9L A;  1IUY A;  1GXQ A;  4ZH4 F;  1UMQ A;  2BEO A;  3DEW A;  1ZG5 A;  3HSF A;  1TNS A;  3K1N A;  1UST A;  5DD8 A;  1KQ9 A;  4MO7 A;  1X3W B;  4YEJ A;  4AM3 A;  1D5Y A;  3QRF F;  1MDM A;  1ACI A;  4GYI A;  5J4V A;  1GLN A;  2PQ8 A;  1ZR4 A;  3S3M A;  3BDD A;  5LHG A;  1ZTR A;  4DIQ A;  2HU9 A;  2JUG A;  2NAZ A;  2PEX A;  3RQI A;  5H2F C;  1OYW A;  3GTJ J;  2LRD A;  4D7M A;  1OQY A;  1XS9 A;  4CXF A;  3OYL A;  4WK8 F;  4LMY A;  2CV0 A;  4A3C J;  1XGM A;  2GQQ A;  1TWC J;  4F55 A;  2VUM J;  3S8P A;  3T8T A;  4CYC A;  2DA2 A;  3OYE A;  4XRS A;  1XPX A;  4M6V A;  4JOM A;  1V55 H;  3FK6 A;  1Y0N A;  3PO2 J;  3PQK A;  1A31 A;  3MD2 A;  5DS9 A;  3MZY A;  4BXF A;  1B8I B;  2GXB A;  3ZOB A;  2FD5 A;  5FGM A;  2EIM H;  3VYU B;  2WAE A;  2XRN A;  1Z7L A;  4NC7 A;  4JX4 A;  4HPQ A;  5AIQ A;  2ESH A;  4Y3O A;  4BJ5 C;  3DKW A;  4A3B J;  3TO6 A;  1QA6 A;  2OJE D;  3FHN A;  2L54 A;  2W7N A;  4D0P A;  1F9N A;  2HGC A;  2FX0 A;  3OWT A;  3D5R C;  1REP C;  1FTT A;  3DEE A;  3M07 A;  4GXO A;  3ZP5 A;  2V9P A;  4FE7 A;  3K4L A;  4GDF A;  3NWT A;  1UJ8 A;  1O57 A;  1L0O C;  3SHF A;  4G8X A;  4EMS A;  1O7F A;  1ZG3 A;  2E5Z A;  3BG9 A;  4BHP A;  2VPR A;  4AIJ A;  2VJJ A;  3BRO A;  2QEX I;  4IKF A;  2VPL A;  2LTP A;  5DCM B;  1SD6 A;  5FLV A;  2IA2 A;  3KPH A;  2XB5 A;  4BY7 J;  3TMO A;  3P9I A;  4PFO A;  1TW3 A;  2K86 A;  3MKL A;  4NQW B;  1J5Y A;  4N9I A;  3F9K A;  1S6L A;  2M0C A;  2B0L A;  4HW0 A;  2Z3Y A;  4LG0 A;  2F5E A;  3RPQ A;  4DW6 A;  4FX4 A;  1PP8 F;  1J09 A;  2BHZ A;  4L9V A;  3H9G A;  4XKC A;  2AQF A;  4AID A;  1Z0X A;  3SXY A;  2OA4 A;  2OBP A;  1WH5 A;  1IRX A;  4OU0 A;  3V8L A;  5ILV A;  2DMQ A;  3OYM A;  3PIP F;  3L2C A;  4XLH A;  2KIF A;  3W2A A;  2KRH A;  2R92 J;  2EBI A;  2LOO A;  5C3E J;  1YI2 I;  2Z99 A;  5KAF C;  2VXD A;  2ZJP F;  2CV2 A;  2M87 A;  3H35 A;  3F23 A;  2ZSH B;  3G71 I;  1GXP A;  5FRM A;  2VOP A;  5M3F J;  4KN4 X;  1JUP A;  1UG2 A;  1MDM B;  2LH9 A;  2Z1D A;  2ZKZ A;  2BE5 F;  2DYR H;  1YS6 A;  3D1N I;  1DDN A;  4ETS A;  5E18 F;  1HDD C;  3JRH A;  1XGN A;  1DGW Y;  1D0Y A;  2NOG A;  2P5K A;  3CCM I;  2EWN A;  4UXN A;  3WGH A;  3K4N A;  4WF2 A;  1AKH A;  4HV5 A;  1Z21 A;  2L9S A;  1HW5 A;  1KU2 A;  1FBS A;  2R93 J;  2DFI A;  3I58 A;  3WTY C;  2HDC A;  3FXQ A;  1XCV A;  3CCR I;  2F5D A;  2WAF A;  2EA2 A;  2MAB A;  1PJR A;  3IRQ A;  2LRE A;  3EPZ A;  3K4B A;  3VEP A;  3SDG A;  2LYC A;  1P4W A;  4H4K C;  2MLK A;  2R7O A;  3IAS 2;  5A2Q K;  2PMU A;  2RNJ A;  4ZDL A;  4PCQ A;  3OYK A;  1LNW A;  4XN3 A;  3MKZ A;  2PBI A;  4E7L A;  3DPU A;  3KE2 A;  1VQ5 I;  4JX6 A;  5JLW A;  3B73 A;  4IVN A;  4QWQ A;  1IUF A;  2Z2S B;  1JT6 A;  2BY2 A;  2B7E A;  5BNG A;  3S2D J;  1LFU P;  2DI3 A;  3ZQF A;  1WHU A;  1DP7 P;  3CP2 A;  1BIA A;  4NNJ A;  3HYI A;  2X6O A;  1U5T A;  1W4M A;  4KJZ A;  2EFQ A;  4D1Q A;  4G6D A;  5FO5 A;  1OCT C;  3LQR A;  2CW8 A;  4GFB A;  4A3I J;  1XD7 A;  3R0J A;  2P7C B;  4BH9 A;  2DTR A;  4C30 A;  2DYS H;  3HHG A;  3RTR A;  3K70 D;  3LFK A;  1J59 A;  5BPD A;  1F4K A;  1MMA A;  4Q5S F;  1YW7 A;  4IOC F;  5C44 J;  4D9J A;  2Y0S N;  3F8M A;  1PUE E;  5JVG F;  2XGC A;  4Y7N J;  2ETH A;  2MD0 A;  5FKN A;  1LFP A;  4IXA A;  2ZFW A;  3H92 A;  5DEQ A;  4CZZ A;  3PUF A;  1Q1H A;  4BNC A;  2R7S A;  2DU9 A;  2XC7 A;  2XGX A;  4L0Y B;  3QPH A;  2QF7 A;  4FT8 A;  4X1E A;  3S1Q J;  2QUF A;  1V4R A;  2KIQ A;  1OCZ H;  1XN7 A;  1Z91 A;  1R1T A;  3S2H J;  5GAH J;  5L3E A;  3KCC A;  2R7X A;  2WB1 A;  3WU1 B;  3VSK A;  2OAZ A;  2M0M A;  2KDZ A;  2RGV A;  3KP2 A;  3GCM A;  4MEX F;  4BY1 J;  4MFE A;  4A5N A;  4DYR A;  4M3D A;  1I6H J;  2WY7 Q;  2DPU A;  1K4S A;  1P2F A;  3MQ0 A;  4L9T A;  3H5A A;  2ZJR F;  5KK1 A;  1RIO H;  1J0R A;  3IWZ A;  3FX3 A;  2V6C A;  3MEX A;  3BR5 A;  2I10 A;  3BR0 A;  3DBR B;  3AG3 H;  2HVS A;  1R58 A;  1MND A;  2W84 A;  1MH3 A;  3K69 A;  3DCF A;  2ZCW A;  1AKH B;  2ADU A;  1IW7 F;  3ROU A;  3AKZ A;  1MBE A;  5IT3 A;  1I3Q J;  2Y0M A;  4KIF A;  2CUZ A;  5LGU A;  2VKV A;  3BPX A;  4ON0 A;  1K78 A;  4A3K J;  3MN2 A;  3L2R A;  1K79 A;  4J19 A;  2VQL A;  1R1V A;  3CDI A;  1XMA A;  3CO6 C;  4FQG A;  4IRG A;  5KVR A;  5GTH C;  1ETK A;  1FIP A;  3WHC A;  5L3C A;  4OWR B;  2WAQ N;  2XSJ C;  4M72 A;  5L3G A;  1ZN2 A;  1FBU A;  2Y48 A;  3ZMZ A;  5IPA A;  1LEB A;  2M34 A;  4PSX A;  2E5N A;  2FML A;  3EET A;  4HQM A;  1OFC X;  2CMP A;  4RMN A;  1IRG A;  4A3J J;  2Y75 A;  3MMY B;  4JYK A;  1X1D A;  4HOB A;  1U5T B;  3K1M A;  1Z6T A;  1USS A;  3KEO A;  5KHD A;  5CYV A;  2H8R A;  2O8K A;  1ITY A;  1W36 C;  2H6C A;  2H94 A;  1E2X A;  4E7S A;  3IKT A;  3Q5F A;  3FIW A;  3HTS B;  5GP9 A;  4CCN A;  1E0E A;  3HOY J;  2DMT A;  1QHH D;  2BY1 A;  4RB0 A;  2FXA A;  5EYR A;  1N25 A;  1VI0 A;  2VN2 A;  5ICE A;  1WJE A;  4FE4 A;  4XNF A;  1GVD A;  3PJR A;  2X1E A;  5E8I A;  5E1X A;  2F4O B;  2E35 A;  4Y4R A;  1T2K A;  2X4H A;  2K5C A;  2AHQ A;  5LEK A;  4FET A;  1TZL A;  2C6Y A;  2FUG 2;  3RI4 A;  1SAX A;  1WJD A;  2DFF A;  1EH6 A;  3DBH B;  3TDU C;  5L3F A;  2XAF A;  2PX9 A;  2W00 A;  3KFW X;  4AYB A;  1LPQ A;  5BPI A;  1SC7 A;  5FKO A;  1QRY A;  2CQK A;  4DOZ A;  4A0Z A;  3LAJ A;  4ZC3 A;  3JAM Z;  2BBY A;  3SZG A;  4BS9 A;  4F3Q A;  5LEJ A;  1JJ6 C;  4RGR A;  4HG2 A;  2Y69 H;  3W2V A;  2NYX A;  2K85 A;  3JAM K;  1T0F A;  4X6A J;  4XLE A;  2MH2 A;  4XSZ F;  1BL0 A;  2HI3 A;  3T1B A;  2DA7 A;  3ZMD A;  5E3M A;  4OAZ A;  1U6G A;  3VPR A;  2ELJ A;  1ULY A;  3KYC B;  1B72 A;  4Q4Z F;  2W4S A;  4HZF A;  3U2R A;  4XRM A;  1YQA A;  4UV8 A;  2L9V A;  3Q0V A;  3OR2 C;  3BWG A;  1X2N A;  4HDV A;  1IXS B;  4YII A;  1FX7 A;  3OYG A;  3HUG A;  3CCL I;  1OKR A;  1K78 B;  1QZY A;  5F6F A;  5HS9 A;  1ZAO A;  1JHF A;  3F8C A;  4PJL A;  4KNY A;  2JA6 J;  3CC4 I;  2GM4 A;  5E1Z B;  3WU0 A;  1N78 A;  3ECO A;  1Z77 A;  1O4X A;  2DCE A;  2DOF A;  1P7I A;  4HF2 A;  4IHV A;  2M30 A;  2V7F A;  2HKO A;  1XC5 A;  1JUS A;  2GA2 A;  2CQQ A;  3HXL A;  3I4P A;  2ZXI A;  4HNU A;  4EEF G;  3OS1 A;  1T39 A;  4GGG A;  4B4C A;  3GZ5 A;  1ZH5 A;  3DLA A;  1QU3 A;  3K4K A;  4BEH A;  2LY2 A;  3EUK L;  5CQE A;  4Z2Y A;  4M74 A;  4IEJ A;  4M3F A;  2OTJ I;  3K10 A;  2VIX A;  2IA1 A;  2R5Y A;  5H6R A;  3MCZ A;  1BI2 A;  1IXR C;  1JTX A;  4AC0 A;  2ZFU A;  4A6E A;  3N05 A;  5FD6 A;  3M3Y J;  1K7A A;  1TNT A;  2LG4 A;  4L5I A;  4DJA A;  3WTX C;  3FIS A;  3TW7 A;  1S72 I;  3PUB A;  2VBY A;  4C2M J;  2DT6 A;  5D8K B;  3H3U A;  4ASN A;  3FZV A;  4NHJ A;  1TP4 A;  2X9D A;  4XLP F;  3JCU C;  3GTM J;  1TWA J;  2K40 A;  2HDW A;  4M71 A;  5KNL A;  2HQR A;  1FEX A;  3QQA A;  1FZP B;  5B5E C;  1W5S A;  4HSR A;  4BJT A;  1O3R A;  2LSO A;  2P81 A;  2E34 A;  3CP8 A;  2GWR A;  1X2M A;  3TO7 A;  2WV0 A;  4KMU X;  5D5X B;  3A2K A;  4Y52 J;  1X1A A;  3J80 K;  4E70 A;  3GX4 X;  2XKO A;  1XX5 A;  1HF0 A;  2P4W A;  3VYT B;  3NQO A;  4FCY A;  2VJ4 A;  1I1S A;  1FWZ A;  1ETQ A;  2DQR A;  2CW7 A;  2EZK A;  4KUM A;  4UNO A;  5LRR A;  2OPT A;  3BLY A;  3I71 A;  3WOD F;  3FXO A;  3HBL A;  5F1R A;  2K02 A;  4XIC A;  2XF6 A;  4UY8 I;  3PFY A;  3KLN A;  4E6K G;  4UVB A;  4HLY A;  2YPR A;  4C3H J;  4CYD A;  1R49 A;  4LLN A;  3S32 A;  4XID A;  3A01 B;  1B72 B;  1TLH B;  3WTS C;  2V4J C;  4ENK A;  2F5C A;  3W6J B;  2IPQ X;  3C2B A;  5B1B H;  1R71 A;  4IL6 C;  3IAM 2;  3SEZ A;  5CLS A;  3ULQ B;  3ZMS A;  1P92 A;  4BE2 A;  3MKY B;  3ABM H;  4I6Z A;  1W5C C;  5JHU A;  2NS7 A;  4F91 B;  1Y0U A;  2V1X A;  3V8J A;  2CYY A;  2BW3 B;  4IF4 A;  2A07 F;  2CFX A;  3ERE D;  4II3 A;  1MKM A;  3K2A A;  3FBI B;  3IP4 B;  2LVS A;  3P7N A;  5DD4 A;  5E79 C;  4PGH A;  1SFO J;  5DCF A;  3GZN B;  1W5T A;  2M45 A;  3S3O A;  1SVO A;  1XCB A;  1LEA A;  2ZC2 A;  2ELH A;  5K5R A;  3CJN A;  3DKX A;  3HGG A;  3HRS A;  2BY0 A;  2DLL A;  3AL0 B;  4AU7 A;  1Z9C A;  1WKM A;  5EZH A;  2XGE A;  4BBR J;  5LHH A;  3CCY A;  4U0V A;  3QYF A;  1B8I A;  4PZJ A;  4I02 A;  4BEH B;  1YE9 A;  1ZRF A;  4X0G A;  2LKS A;  4M9X A;  4ZYH A;  1A5J A;  4HX4 A;  3GTP J;  1MNE A;  1T8I A;  4AVZ A;  3RKQ A;  4LB6 B;  3JRC A;  2RKH A;  3HOW J;  3RPU A;  4F92 B;  2I5U A;  1S7A A;  1RNL A;  1JKQ C;  4C3I J;  3CF2 A;  4KIG A;  3I56 I;  4UUS A;  3ZQC A;  4M9Z A;  4CIC A;  4UUV A;  2P5L C;  1G8X A;  4YRV A;  2UUZ A;  5ILS A;  4I98 B;  5HOO A;  4I01 A;  3HHH A;  1XTA A;  1G3T A;  3AG1 H;  4ZZD A;  1QVT A;  1B59 A;  1MJ9 A;  2K9N A;  4BHC A;  2KIS A;  4KFC A;  2A6E F;  1RZ4 A;  3OYA A;  2HTS A;  1T56 A;  2VOD A;  5AIP A;  3OOU A;  1R4M B;  3DTE A;  3VB2 A;  2F5V A;  2FNP A;  5HNH A;  2EA4 A;  2R7R A;  4IRI A;  2HOE A;  3L7W A;  4IHY A;  5DTD A;  2ICW G;  5F08 A;  2R0Q C;  2L4A A;  1FTZ A;  3HOX J;  3PM1 A;  3LMM A;  4U7D A;  2OCE A;  2EFO A;  4I0B A;  3WG9 A;  4A3L J;  1K61 A;  2LNB A;  5IP9 J;  1MJB A;  1S8N A;  2NS8 A;  3HC7 A;  1EH7 A;  5JHF A;  2IGM A;  3LL7 A;  3COA C;  2DA5 A;  2JTV A;  1MD0 A;  5J3L A;  2WY8 Q;  1V5F A;  1YHQ I;  5EZG A;  3J81 K;  3CDL A;  2ZME B;  2V1U A;  1I6X A;  1YIT I;  3HL2 A;  1BI3 A;  4HF0 A;  3R6S A;  3CUO A;  4C2T A;  4U7B A;  5CVJ A;  3HOU J;  3DV8 A;  4A3G J;  1NG6 A;  2VE9 A;  3GEZ A;  1KYW A;  2DW4 A;  2KJB A;  1ZEL A;  3K4J A;  4OIO F;  1KZH A;  2EZL A;  3CLO A;  4ENJ A;  5LHI A;  3PNY A;  1SEU A;  2PN6 A;  3GFM A;  4BQN A;  1SMY F;  1ZRD A;  5F0H A;  2CWE A;  5J8C A;  1A36 A;  3MZH A;  1RUO A;  3CLQ A;  3V42 A;  5BMZ A;  4CCL A;  3IH4 A;  3HG9 A;  1IAW A;  2CUJ A;  2R4G A;  2E1N A;  3OS2 A;  2MSY A;  4RAG A;  3G1L A;  3TQN A;  2W1O A;  5DV5 A;  2HDD A;  2QSG X;  2VBZ A;  4MEY F;  4BXX J;  2Z33 A;  3FM5 A;  2VBX A;  4BQO A;  2IAI A;  3ABL H;  3G2B A;  2R3S A;  1K6O A;  1OCP A;  1P7J A;  3FXM A;  2IA0 A;  5FFX A;  4EM1 A;  3FF5 A;  3ZCO A;  1FSH A;  2XPW A;  2DTZ A;  3S3N A;  5IYB J;  4A93 J;  2AQE A;  1NTC A;  2E36 A;  2F5F A;  4KIC A;  3LSG A;  1FPQ A;  4UVC A;  5CVR A;  3HB9 A;  5E1W A;  2IJL A;  2M8G X;  4OOI A;  1BW5 A;  3ZPL A;  5K5Q A;  5D5V B;  1ETW A;  2V1N A;  4CA0 A;  3GBG A;  4DBQ A;  4UUS B;  1P6R A;  2KPM A;  1U0J A;  1PVE A;  1I39 A;  2ZO4 A;  1FT9 A;  2P8T A;  4JK1 X;  3UNG C;  3ZR8 X;  3HSE A;  3E1S A;  4BBS J;  2RAE A;  2K9M A;  4QLC U;  1G4D A;  3FMS A;  1FY7 A;  3S1N J;  1BJA A;  1OYY A;  3W6V A;  2BYV E;  1VZ0 A;  4P96 A;  3LSK A;  2CQ7 A;  2MH9 A;  2XPV A;  2B9S A;  3K2Z A;  2G0E A;  5K7Z A;  2R7T A;  1DPU A;  2IS4 A;  2CQX A;  1AOY A;  3QAH A;  1I1G A;  2KFD A;  2DA1 A;  3E97 A;  3GFJ A;  1RR8 C;  5EDN A;  2EB7 A;  5HLI A;  3OYD A;  2KMU A;  2DOA A;  3HRT A;  2BV6 A;  2F48 A;  1GT0 C;  1AU7 A;  2ESN A;  1RPW A;  3CCU I;  3I54 A;  3PO3 J;  2HNH A;  2HR3 A;  1LDJ A;  1FOX A;  5K1Y A;  3REO A;  5H6Q A;  3FXJ A;  3SQN A;  3ZQL A;  2BVL A;  1MH4 A;  4FAS D;  1FMV A;  2VBW A;  5IYC J;  1CGP A;  2A68 F;  1R36 A;  2OCC H;  2YU3 A;  1TWG J;  4M6Y A;  1FOW A;  2O8X A;  4AUX A;  5F04 A;  3OYC A;  2RQP A;  3JSO A;  3HRM A;  4WXD A;  2LDU A;  2NXN B;  2DA3 A;  3ABU A;  2LLK A;  4HEA 2;  2WTE A;  4ZYG A;  3TW6 A;  4AIH A;  2VC1 A;  4UHT A;  2X6Y A;  3V7R A;  4S0H B;  2QKM B;  5GPC A;  3CCV I;  3GFL A;  2P6S A;  4B1R A;  2HTJ A;  4HDU A;  3U9G A;  1DGR M;  2DN0 A;  3HZJ A;  4DQ2 A;  1SFE A;  1IC8 A;  2VQC A;  3L2W A;  4I2O A;  1T98 A;  3ABK H;  5CQG A;  2E1M C;  4MQ9 F;  3JW4 A;  4KIB A;  5IP7 J;  5D6E A;  3Q0W A;  1Y6I A;  2FMY A;  4JP0 A;  3HM5 A;  2F2E A;  5L3D A;  1XSD A;  3VWB A;  2R7Z J;  1IN5 A;  1JUM A;  4CGZ A;  1WFX A;  5B66 C;  3CMY A;  3SEQ A;  4J00 A;  2XF7 A;  3NEU A;  1A35 A;  3G6E I;  4CHU A;  2FQ3 A;  3DXJ F;  4LIT A;  1FNN A;  4E7J A;  4G9Y A;  2A6T A;  4MGR A;  4UB6 C;  3PIO F;  2M7B A;  1G6N A;  3C2H A;  1LB2 A;  3CMM A;  4EJW A;  1SD7 A;  4PJJ A;  2UZK A;  1UEL B;  3TOA A;  4EJT A;  3SFZ A;  3GXO A;  4FIS A;  2HEO A;  1U9O A;  1WVR A;  5J1Y A;  4C9Y A;  1HXD A;  5K7F A;  2JQ7 A;  5M5Y J;  5GPA A;  1H88 C;  4CZC A;  3I4N J;  2JA2 A;  1BW6 A;  4XRS G;  2WAQ A;  4B3X A;  1P4X A;  3QOP A;  3OL3 A;  4XKW A;  1R23 A;  1KGS A;  1WRJ A;  2RVC A;  1UG0 A;  3WGG A;  4BU2 A;  5J40 A;  3LSM A;  2JRT A;  3N97 A;  2L4M A;  3LFU A;  2DPD A;  2ZBK A;  2IGO A;  3SYT A;  3JSP A;  1TQP A;  2IS2 A;  3BCB A;  2IVM A;  2LR8 A;  2OU2 A;  3ONQ A;  1X1B A;  1YIJ I;  3BTI A;  3C7J A;  2JK3 A;  3TP0 A;  2D1H A;  3A02 A;  2DMU A;  2LC2 A;  4ZTF A;  1G2H A;  3F22 A;  2PFB A;  5J8F A;  1X3U A;  1BR1 A;  1XDU A;  4EJV A;  4A3F J;  1TC3 C;  3CTA A;  3FXR A;  2W82 A;  1KU9 A;  1X4O A;  1XMK A;  1RRJ A;  5M3M J;  2KJC A;  3KP6 A;  2NVU B;  1O3S A;  5E3L A;  2J5O A;  2HXO A;  2ISY A;  4DYC A;  1YX3 A;  2L9R A;  2NRA C;  5LD2 C;  2VI6 A;  2EV6 A;  3J7Y J;  3G73 A;  3CES A;  3WHB A;  2NOJ B;  3PNV A;  4GO1 A;  4RM3 A;  2H6B A;  3GYH X;  1R5G A;  1YG2 A;  2R7D A;  3O3K A;  5BQT A;  5FFZ A;  3OYJ A;  3HPH A;  3CME I;  4A3D J;  3CDH A;  3TGN A;  3W2W A;  3K7A J;  4EGZ A;  3KLO A;  2DT7 B;  2CJJ A;  2DAO A;  2XRL A;  3ZQ7 A;  5E3O A;  4RGS A;  3RPU D;  4WXH A;  4RBO A;  4R1H A;  2QVO A;  1SFK A;  3MFK A;  3LSH A;  3RDI A;  2F6C A;  3ASO H;  1WJC A;  3V4G A;  4A69 C;  2EV5 A;  3HOT A;  4C2U A;  3S2W A;  2Q1Z B;  4MLO A;  3DBL B;  1Z1D A;  1QZE A;  2QQA A;  1JKR C;  2JA7 J; 
#chains in the Genus database with same CATH homology
 2CQQ A;  1GDT A;  4EEF G;  2JMW A;  3BQY A;  5FJ8 J;  2XGD A;  4B4C A;  5EGO A;  2HOA A;  3BTL A;  3JRF A;  5IP6 A;  3HEF A;  1CQT A;  4IEJ A;  4M3F A;  2Y30 A;  3JRG A;  2R5Y A;  4ABZ A;  4AC0 A;  1JTX A;  4QSH A;  5JLX A;  3JRI A;  3M3Y J;  1YRN B;  2E19 A;  3B6A A;  2O7O A;  2ME6 A;  3SJM A;  1PUF B;  5IYD J;  3MVP A;  3FIS A;  3TW7 A;  2XSD C;  4C2M J;  4LOC A;  1POG A;  5F0C A;  3TP3 A;  4RDU A;  2X9D A;  3GTM J;  1TWA J;  2K40 A;  4I76 A;  1IRZ A;  1Q1V A;  1FEX A;  2ME0 A;  3QQA A;  3S1R J;  3HKZ N;  2Y9Y A;  5IOZ A;  5FLM J;  4B3A A;  1HDP A;  3GTL J;  3G1O A;  2P81 A;  3F0C A;  1LFB A;  5F1J A;  3ZQI A;  2ZB9 A;  1UMQ A;  1MBK A;  3B6C A;  3DEW A;  1X2M A;  2EQR A;  1W0T A;  2LY9 A;  4Y52 J;  3CQZ J;  4MO7 A;  1HF0 A;  4CYC B;  4W97 A;  1D5Y A;  1JTY A;  3ZQH A;  4FCY A;  1XG1 A;  2EZI A;  1ETQ A;  2EZK A;  2GBY A;  1ZR4 A;  1QVU A;  2OPT A;  1ZTR A;  2DA6 A;  2CU7 A;  3GTQ J;  3HBL A;  3RQI A;  1ETV A;  2LK2 A;  2ID3 A;  2DMN A;  4XIC A;  2GLO A;  3GTJ J;  4D7M A;  1XS9 A;  4C3H J;  3HDD A;  2TRT A;  4XID A;  3A01 B;  1B72 B;  2E2J J;  1ZGW A;  2E2H J;  4A3C J;  5EG0 A;  3IH2 A;  3LSP A;  1TWC J;  5HOD A;  2VUM J;  2TCT A;  3C2B A;  2DA2 A;  5E3N A;  4CYC A;  4XRS A;  3BQZ A;  2COB A;  4M6V A;  3NAR A;  2L7Z A;  1RR7 A;  3FK6 A;  3PO2 J;  5DS9 A;  1B8I B;  2LP0 A;  4I6Z A;  4UUT A;  1JKO C;  3ZOB A;  2NS7 A;  1JKP C;  2FD5 A;  2JA8 J;  4MFD A;  5C4X J;  2K9Q A;  4JX4 A;  3K2A A;  4A3B J;  2LVS A;  3BTC A;  3QPL A;  3OIO A;  3A01 A;  3BR2 A;  1SFO J;  2JA5 J;  1VND A;  2XPU A;  2FX0 A;  5K7H A;  1FTT A;  3HGG A;  1DU0 A;  3S16 J;  4FE7 A;  5EZH A;  2XGE A;  4BBR J;  2QCO A;  3E7L A;  3OSG A;  3RZD J;  3S1M J;  3CCY A;  5EGO B;  2CRG A;  4L5E A;  1B8I A;  3BT9 A;  3IV5 A;  3BG9 A;  1A5J A;  2VPR A;  3JRE A;  1RET A;  3GTP J;  1JJ8 C;  3LNQ A;  1HOM A;  2M2E A;  2NVQ J;  2LTP A;  3BG5 A;  3RKQ A;  3JRC A;  5FLV A;  2XB5 A;  4BY7 J;  2E1O A;  5F0F A;  3HOW J;  5EEA A;  2K9S A;  3JR9 A;  1JKQ C;  2W48 A;  4C3I J;  3MKL A;  1MBG A;  9ANT A;  1K83 J;  5F27 A;  2IEK A;  2M0C A;  5EF6 A;  4UUS A;  4QTR A;  2E2I J;  3S17 J;  3ZQC A;  4V2G A;  5FKM A;  4DW6 A;  1IV6 A;  1Z0X A;  1WH5 A;  1QVT A;  2DMQ A;  1H89 C;  1IGN A;  2K9N A;  1S7E A;  3BR1 A;  2R92 J;  2EBI A;  3FKI J;  3S15 J;  1F43 A;  5C3E J;  2ELK A;  1T56 A;  3HGY A;  2PMZ N;  2HQ5 A;  3OOU A;  1EF4 A;  4IHY A;  5DTD A;  5F08 A;  5M3F J;  1JUP A;  1UG2 A;  2R0Q C;  1GV5 A;  1WGX A;  1FTZ A;  3HOX J;  3PM1 A;  4A3L J;  1K61 A;  5IP9 J;  2NS8 A;  3D1N I;  1VF9 A;  1RKW A;  2DA5 A;  1HDD C;  5J3L A;  3JRH A;  2O9L A;  2NOG A;  1MBJ A;  3CDL A;  5EZG A;  3L1P A;  1OJL A;  2VKE A;  4DZJ A;  1AKH A;  2DJN A;  3GTG J;  3HOZ J;  5EG0 B;  2R93 J;  1WPK A;  3HOU J;  1U8B A;  4A3G J;  2H1K A;  2Y31 A;  4AYB N;  2JJ7 A;  2XB0 X;  1FJL A;  3GTO J;  3SDG A;  3A03 A;  2R5Z A;  2EZL A;  3BG3 A;  2MG4 A;  4QIW N;  3Q0U A;  3LSR A;  5F0H A;  1WH7 A;  1IJW C;  1T33 A;  4JX6 A;  5JLW A;  1Y1V J;  1IUF A;  3LSJ A;  2JA7 J;  3IH4 A;  1JT6 A;  3LOC A;  2FJ1 A;  5BNG A;  3S2D J;  2NVY J;  1LFU P;  2MSY A;  3ZQF A;  3FK7 A;  3G1L A;  5M5X J;  2HDD A;  4BXX J;  1I50 J;  1H8A C;  1ETY A;  2X6O A;  1QPI A;  4HNV A;  4FTH A;  2IAI A;  1U9N A;  1VFC A;  1OCT C;  1ORK A;  1OCP A;  1P7J A;  4JX5 A;  4GFB A;  3H0G J;  2XPW A;  3G1M A;  2DTZ A;  4A3I J;  2WB1 N;  5IYB J;  5IOY A;  1LE8 A;  4A93 J;  1NTC A;  1R9T J;  3LSG A;  3JRB A;  2MW8 A;  3HB9 A;  1NK2 P;  5C44 J;  2M8G X;  2Y0S N;  1BW5 A;  2ID6 A;  1ETW A;  2XGC A;  4Y7N J;  1W0U A;  1ZKG A;  3GBG A;  4UUS B;  1MSF C;  2D5V A;  2ECC A;  5FKN A;  1SAN A;  2L0K A;  4D5C A;  3TED A;  4BBS J;  2RAE A;  3S1N J;  1ENH A;  3W6V A;  3GTK J;  1DU6 A;  2QF7 A;  4X1E A;  3IH3 A;  2B63 J;  3S1Q J;  2XPV A;  2G0E A;  5K7Z A;  2Y9Z A;  2CQX A;  3S2H J;  2L7F P;  2CUF A;  2DA1 A;  2OF7 A;  5EDN A;  1WCM J;  1ZK8 A;  1AHD P;  1E3O C;  5J1R A;  2KDZ A;  3BR3 A;  4BY1 J;  4MFE A;  4DYR A;  4M3D A;  1GT0 C;  1AU7 A;  1RPW A;  1I6H J;  3PO3 J;  3BR5 A;  2I10 A;  3BR0 A;  3ZQL A;  5J1U A;  2M9H A;  1RKT A;  1MH4 A;  1F36 A;  1MH3 A;  2KT0 A;  2HOT A;  5IYC J;  3DCF A;  3O8G A;  2MGQ A;  1AKH B;  2L7M P;  1TWG J;  1MBE A;  4MIM A;  4AUX A;  5C4J J;  4D7N A;  4C3J J;  1I3Q J;  5F04 A;  4M3G A;  2VKV A;  4W1U A;  4A3K J;  3MN2 A;  4J19 A;  2DA3 A;  1IG7 A;  1GUU A;  1GV2 A;  1ETO A;  2LLK A;  2X48 A;  4BKX A;  3TW6 A;  3JRA A;  2LKX A;  3M4O J;  4S0H B;  1MBF A;  2R5Z B;  5GPC A;  1U78 A;  1ETK A;  1FIP A;  4B1R A;  4A3E J;  3RZO J;  3WHC A;  1IC8 A;  2DN0 A;  2WAQ N;  2DMP A;  1RES A;  4D5F A;  4IHW A;  2EZH A;  1BJZ A;  5IP7 J;  1TWH J;  3Q0W A;  4JP0 A;  5IPA A;  3HM5 A;  1ZR2 A;  2M34 A;  1JGG A;  2R7Z J;  1NK3 P;  3BTJ A;  1OFC X;  2LD5 A;  4A3J J;  1JUM A;  4IHX A;  5FKL A;  5M5W J;  4JYK A;  2YS9 A;  2CUE A;  3CMY A;  3S14 J;  4A3M J;  1JT0 A;  2FQ4 A;  2JN6 A;  1MSE C;  2H8R A;  1ITY A;  2O8K A;  2DA4 A;  2HXI A;  1YRN A;  2NVX J;  3OSF A;  3FIW A;  5GP9 A;  1LE8 B;  1PUF A;  3HOY J;  2DMT A;  4FIS A;  1U9O A;  5J1Y A;  5EYR A;  5K7F A;  1VI0 A;  5M5Y J;  5GPA A;  1H88 C;  4FE4 A;  3I4N J;  1GVD A;  2LFB A;  4NDL A;  1BW6 A;  4XRS G;  3ZQG A;  2AHQ A;  2HYJ A;  2IBD A;  1IDY A;  1MBH A;  4XK4 A;  3BR6 A;  4M3B A;  1HCR A;  1IDZ A;  2LR8 A;  2ECB A;  3O8H A;  5FKO A;  1QRY A;  3BTI A;  2JK3 A;  1Y1W J;  3TP0 A;  3A02 A;  1BA5 A;  2DMU A;  1G2H A;  1ZQ3 P;  2N8G A;  3QPS A;  1JJ6 C;  4A3F J;  1TC3 C;  3I4M J;  1TWF J;  2YU9 J;  4DYQ A;  2EH3 A;  5M3M J;  4X6A J;  3HOV J;  1BL0 A;  5E3L A;  2HI3 A;  2YUS A;  1A6I A;  2AO9 A;  2HXO A;  4DYC A;  2Y2Z A;  2DA7 A;  2L9R A;  4M3E A;  3SFI A;  5E3M A;  3Q3S A;  1MNM C;  2VI6 A;  2HOS A;  3VPR A;  1B72 A;  3WHB A;  1FIA A;  4XRM A;  4G12 A;  4V2F A;  3Q0V A;  1X2N A;  2WV1 A;  3NAU A;  1ETX A;  3UKG A;  4A3D J;  1WI3 A;  3K7A J;  4DZP A;  2JA6 J;  2NVT J;  2R5Y B;  2CJJ A;  2GM4 A;  2XRL A;  3H3V K;  5E3O A;  2JWT A;  4RBO A;  1HLV A;  3JRD A;  1Z77 A;  1O4X A;  1P7I A;  4A69 C;  4IHV A;  1X58 A;  4MLO A;  1APL C;  1XC5 A;  5FKK A;  1JKR C;  1JUS A;  1UHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...