3S14J

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s14J00
2EZLA 4A3CJ 3HM5A 4FTHA 5C44J 5E3MA 2NVYJ 5EGOB 3JR9A 1GVDA 1MBJA 2M9HA 4D5FA 2QF7A 3LOCA 2VI6A 5E3NA 1BW5A 3BG3A 1AHDP 2LFBA 4M3BA 4A3EJ 1TWFJ 2ME0A 1WGXA 4L5EA 1H88C 3M4OJ 2OPTA 1GV5A 1LE8B 2RAEA 3S17J 1GT0C 4BBSJ 1POGA 4FE4A 4W97A 2LTPA 3BG5A 3Q0UA 1E3OC 2H1KA 4XRSA 1ZR4A 2AO9A 3ZQGA 1P7IA 3TEDA 1BL0A 3VPRA 2DA5A 3A03A 4D7MA 1JUSA 3S1QJ 4A3KJ 1HOMA 1F36A 3RQIA 3RZOJ 3JRAA 1VI0A 1LFBA 2CUEA 3DEWA 2R0QC 2IAIA 3O8GA 2HYJA 2M34A 4LOCA 4X6AJ 2LP0A 2YUSA 2O7OA 4C3HJ 3ZQFA 5FLVA 5FJ8J 1U9OA 3QPSA 1OCTC 1CQTA 3PM1A 4B3AA 2CQQA 2MW8A 2ELKA 3JRDA 5F0FA 5J3LA 1P7JA 4V2GA 1Y1VJ 2E2JJ 4FISA 1JGGA 2L7FP 3W6VA 1JUPA 2XGEA 3JRGA 1QVUA 3HEFA 1I3QJ 3M3YJ 5GPCA 3IH2A 3HOVJ 1AKHB 2JA6J 2PMZN 2EZKA 5EG0B 2M0CA 2R7ZJ 2X9DA 1JUMA 2KT0A 1WH7A 3Q0VA 2QCOA 4DYCA 4Y52J 1A5JA 3BTCA 4A69C 2DN0A 3H0GJ 1A6IA 3HOXJ 1B72A 2R93J 5IOZA 3HOYJ 3B6AA 4S0HB 3BG9A 3BQYA 3K7AJ 2HXOA 3RZDJ 3CMYA 2DMUA 3G1OA 3LSPA 2L7MP 2HOTA 4A3BJ 2KDZA 4DZJA 5J1UA 4QTRA 4V2FA 3QQAA 3ZQCA 2HOAA 1ZR2A 2XB5A 1TWCJ 3Q3SA 2XGDA 3DCFA 4A3LJ 1R9TJ 1ETQA 2CQXA 2LY9A 2COBA 4A3IJ 3B6CA 3LSGA 2XSDC 2VKVA 2LD5A 2FD5A 3IH3A 1W0UA 4IEJA 4A93J 4IHVA 1IJWC 1MH3A 1FIAA 5M3FJ 1XS9A 5F04A 1X2NA 1OJLA 1U9NA 2AHQA 5EF6A 2DJNA 1IDZA 4A3DJ 2R5YA 1RKTA 3HGYA 3TP3A 5IP6A 1K83J 5M3MJ 3BR3A 4XRSG 2I10A 5K7FA 1NK2P 3GTJJ 1ETWA 4D7NA 2Y9ZA 2X6OA 4EEFG 2Y0SN 4M3FA 3HGGA 1HF0A 3S14J 2JMWA 4J19A 3L1PA 3LSRA 4I6ZA 2IEKA 4FE7A 5DS9A 2M2EA 2XPWA 1MBKA 1T56A 2NVXJ 1WPKA 2DMNA 1RETA 2M8GX 1RKWA 1RR7A 2NOGA 1IV6A 5IP7J 1GDTA 3JRHA 3S1RJ 1HDDC 5IYBJ 4JYKA 2DA4A 1W0TA 5EZGA 1OFCX 4MFDA 3FIWA 4W1UA 1B8IB 5DTDA 5JLXA 3A01A 2EBIA 2LKXA 2ECCA 3WHCA 5M5XJ 1UG2A 2R5ZB 2DA7A 3O8HA 2L9RA 3BR5A 1JJ6C 1NTCA 1UMQA 3UKGA 1DU0A 4CYCA 3OSGA 3FISA 2K9NA 1ENHA 1QPIA 5J1RA 3BT9A 1G2HA 5GPAA 2L7ZA 4A3GJ 1BJZA 3BTLA 2MGQA 1HCRA 1GV2A 3E7LA 1WCMJ 2ID6A 3G1LA 3OSFA 3GTPJ 5FKMA 1FJLA 3ZQIA 4MLOA 5F0CA 3BR2A 2FJ1A 2DMPA 3GTGJ 1FTZA 1HDPA 2YS9A 2DA2A 2R92J 4BXXJ 2MSYA 3OIOA 2JJ7A 2B63J 5JLWA 3GTLJ 2NS7A 3CQZJ 4JX5A 1X58A 3BTIA 1T33A 2X48A 1JTYA 1UHSA 5GP9A 1D5YA 2DA3A 2EZIA 3IV5A 1IC8A 2ID3A 5IYCJ 3I4MJ 1QRYA 2FQ4A 1Y1WJ 2EZHA 2H8RA 2WB1N 1PUFA 1LFUP 1OCPA 5C4XJ 1I50J 4D5CA 2K40A 2Y31A 1SFOJ 2K9QA 5EYRA 1YRNA 2E2IJ 2P81A 3NAUA 5E3LA 2WV1A 9ANTA 4B1RA 1ETVA 3JRBA 5F0HA 1GUUA 1WH5A 3NARA 3TW6A 5EGOA 1JKPC 1MSFC 2JA8J 4RBOA 2XGCA 5K7HA 1JKRC 2CUFA 4AYBN 5K7ZA 4DYRA 1Q1VA 2LLKA 4XK4A 4A3JJ 1ZTRA 3S1MJ 1JKQC 3GTKJ 4JX4A 2OF7A 5E3OA 2DMTA 3GTMJ 1LE8A 1APLC 4DZPA 3PO3J 2LR8A 2ME6A 4FCYA 1VF9A 4XICA 2JWTA 1Z77A 3S16J 2XPVA 2FX0A 1BW6A 3CDLA 2E1OA 2G0EA 2E2HJ 3MKLA 1NK3P 1B72B 1QVTA 4C3JJ 3SJMA 2Y30A 1O4XA 3OOUA 4I76A 3JREA 1IUFA 1RPWA 4UUTA 4AUXA 3JRIA 3HOUJ 4BY7J 4B4CA 4A3MJ 3HDDA 4ABZA 2JA5J 3S1NJ 1ETKA 2Y2ZA 4M3GA 2XRLA 1ZQ3P 3JRFA 4NDLA 3ZQLA 3S15J 2HI3A 1AU7A 3F0CA 2Y9YA 3S2HJ 3HBLA 1AKHA 1K61A 1WI3A 4XRMA 1BA5A 2ZB9A 5EG0A 4GFBA 4IHWA 1ETOA 4HNVA 1ZK8A 1TC3C 3HB9A 4UUSB 1HLVA 1MH4A 5IYDJ 3FK6A 1H89C 5EDNA 1ETYA 3I4NJ 2JK3A 3A02A 5M5WJ 3BR0A 4M3DA 1ETXA 3PO2J 2D5VA 5IOYA 2HXIA 5FKOA 4M6VA 2LK2A 1U78A 2NS8A 2CJJA 1FIPA 3CCYA 5FLMJ 5F08A 1RESA 3HKZN 2R5YB 1F43A 5EEAA 2E19A 5J1YA 3QPLA 2XPUA 1MBFA 1Z0XA 2TCTA 5IPAA 1FTTA 2IBDA 2YU9J 3HOZJ 5HODA 1JJ8C 4JP0A 4DW6A 3IH4A 3TP0A 3WHBA 4RDUA 1XC5A 2DMQA 4IHXA 4MFEA 2DA1A 2GLOA 1IRZA 2GM4A 2NVQJ 4C3IJ 3RKQA 2DA6A 3SDGA 1IG7A 4MO7A 3LSJA 1JTXA 5FKNA 1MBEA 4X1EA 3SFIA 5F27A 1MNMC 3A01B 1I6HJ 2CRGA 5EZHA 4DYQA 1U8BA 2CU7A 5C3EJ 2O8KA 2GBYA 1ZKGA 3K2AA 3G1MA 3ZOBA 4AC0A 1SANA 4CYCB 1JT0A 5FKLA 2LVSA 1S7EA 2EQRA 1VFCA 1TWHJ 1ITYA 5M5YJ 5C4JJ 3HOWJ 3GTOJ 1IDYA 1JKOC 2O9LA 5BNGA 3ZQHA 1JT6A 3H3VK 4QIWN 2WAQN 4Y7NJ 1VNDA 4A3FJ 2JA7J 4BY1J 3Q0WA 5IP9J 3JRCA 3GTQJ 1EF4A 1MBHA 2XB0X 3BQZA 4BBRJ 1XG1A 2VPRA 1B8IA 1TWAJ 2MG4A 3BR1A 1ORKA 2NVTJ 2W48A 3FKIJ 2DTZA 4IHYA 1TWGJ 4G12A 2R5ZA 4BKXA 3C2BA 1MSEC 1FEXA 4UUSA 1DU6A 4QSHA 3BR6A 2VUMJ 2HDDA 2ECBA 1H8AC 3MN2A 2L0KA 2N8GA 1ZGWA 3GBGA 4MIMA 3D1NI 4JX6A 4XIDA 3LNQA 2HOSA 2EH3A 5FKKA 1IGNA 1MBGA 1PUFB 2TRTA 3S2DJ 2HQ5A 3TW7A 2JN6A 4M3EA 2K9SA 3BTJA 5F1JA 3FK7A 1YRNB 2VKEA 1X2MA 3MVPA 4C2MJ
chains in the Genus database with same CATH superfamily
3M9AA 2HNHA 3ABTA 2F2EA 2VQLA 3Q5FA 1HC8A 3KIOA 4KFCA 4N0BA 4DIQA 4BAYA 4EV0A 4HX7A 1PJRA 2PLYA 5AIQA 5FD6A 2HQRA 4DBRA 1ZG1A 2VQHA 3JAMZ 4I01A 2KPMA 4MEYF 2OUMA 2M87A 2M7BA 4F55A 5KHDA 1HW5A 2WTEA 1LE8B 4PJ0C 2VJ4A 3PJRA 2FMLA 4W97A 3Q0UA 2WY8Q 4ESBA 1IN8A 1O57A 2WC2A 3HPGA 3ZQGA 3WU1B 3FF5A 4KISA 4G9YA 2L7KA 1T8IA 3V4GA 2FSWA 1TP4A 1JHHA 2DA5A 1B1BA 3A03A 5BS6A 4D7MA 1PYVA 4A3KJ 2QA4I 2Q8KA 1Y56A 2PI0A 2ZBKA 2XGXA 1BI1A 3CUOA 1IXRC 3MEXA 4P96A 3QODA 4LOCA 2O7OA 2X4HA 3KYDB 5FLVA 3FZVA 1UAAA 2GAUA 1TL8A 2PJPA 3GW2A 4I0AA 4BE2A 4B3AA 4BEHB 4V2GA 3WTYC 1MMGA 3F9KA 3HEFA 2MH2A 3JW4A 3K4LA 3K70C 5LGNA 3FM5A 1I3QJ 3RJPA 3IH2A 3BPVA 2CMPA 2W82A 5DEQA 2K4BA 5DM6F 2DXIA 4S04A 2X9DA 1FOYA 4A0XA 4LIVA 4CDGA 3HSRA 4A69C 2UUZA 1ZLKA 4B47A 2R7FA 3H0GJ 5L3CA 1S7OA 3OY9A 3CESA 2CV1A 2JTVA 3B6AA 3BJ6A 3RKYA 2A3SA 2QLZA 3BQYA 3E6MA 4IX7A 3K7AJ 3G1OA 3GWZA 5DD8A 1SD6A 2KFDA 1SAUA 3V8JA 4FASD 4BDYA 4D1QA 1OCRH 4P1WA 2DT6A 3OYMA 5K1YA 3LA2A 3VEPA 2F4OB 3GUDA 2BYVE 2VXDA 1VQLI 2LRDA 2A61A 2XGDA 1V5FA 2VKHA 3DCFA 4A5MA 1R9TJ 1STZA 1UFMA 3EYIA 4CH7A 3RPQA 3U2RA 1YW7A 1D1CA 2LG4A 2VKVA 2DCEA 3IH3A 3KYLA 3H9JA 4KJZA 3TDZC 2ZXHA 4RB0A 1X2NA 1F4KA 2R7RA 1U9NA 5EF6A 2DJNA 3K69A 5KCMA 3ZMTA 2R5YA 1HW2A 2VC1A 1YQAA 2P7VB 3BZ6A 3K4CA 1MMSA 1R1UA 2I10A 4XRSG 3PSIA 4GGGA 4A6EA 4IOCF 4E7LA 2FBHA 4I98B 1B4AA 3TOAA 4GXOA 2Y0SN 3CDHA 4O5VA 1WFXA 2KL4A 3DEUA 4J19A 1YJNI 1J09A 2XHKA 3L1PA 3LSRA 4FE7A 5IY5H 2XPWA 3H5RA 2X6WA 3M1EA 1KYZA 3RPUD 5H2FC 3KZYA 5CQGA 2D1VA 4YRVA 4ON0A 2KIFA 2DO7A 4QWQA 2VBWA 1S8NA 2ELJA 2Q2EB 3S1RJ 1B8IB 4LFUA 5DTDA 1ZHFA 2EBIA 2EPFA 2HQAA 2RV8A 3DPTA 4M71A 2ECCA 4LITA 3WHCA 1VQPI 1UG2A 1Y39A 3LSIA 3HPHA 2QBYA 3BCAA 2E7WA 1FMVA 1ZARA 5LLQA 2ACJA 1JJ6C 1NTCA 1UMQA 2K7LA 1BI0A 3CTAA 4UY8I 2K3FA 3A4CA 3OS1A 4HSTA 3OSGA 3KEYA 4MHGA 2E1NA 2DJIA 4IHTA 4EJTA 1Z7LA 2VBZA 4AU7A 1QPIA 3BT9A 2KRHA 1G2HA 2LY2A 4A3GJ 5D6EA 4RB3C 1IO2A 1ERDA 3ULQB 2L01A 5FKMA 3VDXA 1FJLA 1Z05A 2EWNA 2H09A 2V1UA 2O8XA 4MLOA 3BJOA 2DMPA 5IT9K 5AONA 4KITB 1ZRDA 3SZTA 1A36A 2R92J 2P8TA 2CQKA 3TL4X 5AIPA 3PQKA 1E2XA 3AG2H 1ZGJA 3IC7A 5E8GA 3HXLA 1X58A 2WBMA 1TQPA 2X1DA 4NQWA 5HLHA 3FM3A 3FWEA 3FXMA 1X19A 1Z6TA 2LMDA 3Q9VA 1T98A 2H8RA 2WB1N 2X1EA 5LGTA 1LFUP 5C4XJ 4UNOA 4D5CA 1CGPA 2K40A 3DPLC 4UVCA 1S9HA 2PMHA 2ZO4A 3OWTA 4XNFA 2LBFB 4MNUA 4Y4RA 4YFXF 4YEJA 5E3LA 9ANTA 2A5YB 2Y48A 1GUUA 1JKPC 1MSFC 5EGOA 1FOWA 5L3GA 4RGUA 4RS8A 4HF0A 4M9ZA 5K7ZA 4XK4A 1J0RA 3S1MJ 3EYYA 3SQNA 2YR2A 3CJQB 2HVQA 3IHUA 4KIGA 4UHTA 1HA8A 2BHZA 4OINF 2LKPA 3N4MA 3D5LA 2DMTA 3C18A 2PG4A 4M74A 1APLC 2PJRA 1ONVA 1XMKA 2DDBA 2Z33A 4M9SA 3P5JA 2FOKA 3U1KA 4H4KC 3DTKA 2ME6A 2OBPA 3LSKA 2E71A 5HDNA 2A6TA 1YS7A 3GZ6A 1R22A 2XPVA 1B59A 3DKYA 2IS6A 1BW6A 1KA8A 1JI8A 3ROUA 4E7IA 1A6QA 1EKEA 3LA3A 2E7XA 1USSA 4KNYA 3OR1C 2IS1A 3OOPA 3NQOA 5CVJA 2MABA 4IHSA 3QYEA 1QVTA 5ED4A 3DU6A 2Y30A 3W6JB 3DXJF 3JREA 1QU3A 1IUFA 1FYLA 1I1SA 4B4CA 5HS9A 1SD5A 1K4SA 3HDDA 3KP5A 3J80Z 3F6OA 4HDVA 4ZJZA 2TDXA 1VQNI 2BY1A 3HL2A 2JA2A 2DT5A 5E1XA 4NDLA 5FD5A 1L3LA 1R71A 5DD4A 1R58A 3KPHA 2H1LA 2Y9YA 3S2HJ 1GVJA 5LEJA 1YHQI 4E7HA 1AKHA 4WWCA 4MQVA 3OIQA 4KICA 3R0JA 4AM3A 5TISC 1BA5A 3P9IA 1XSXA 1Z7UA 2DFIA 4IHWA 1TC3C 3LSMA 1O3TA 3H9GA 1KGSA 2FRHA 2IW5A 5B3SH 1BR2A 4E7JA 4BU2A 1W7PD 4EJVA 4QLCU 1YFHA 3HJEA 2ZJPF 5HS8A 1XGNA 2QSHX 1X3UA 3IRQA 4R1HA 3BDDA 4M3DA 3RIRA 5IOYA 1OISA 2F5CA 2CUZA 2XAFA 4M6VA 1G6NA 1XGMA 2LREA 2L5QA 4ZYAA 5FLMJ 4XLPF 3HUGA 2LKSA 5E17F 1F43A 2YSRA 3FBNB 4AVZA 2O0YA 5EEAA 3LSTA 5ERIA 5F6FA 3ZMDA 1MBFA 3QPHA 4C30A 4A0ZA 3L2CA 5IPAA 1SMYF 1FYKA 4B44A 4GO1A 1MIJA 2P5LC 1VTNC 4JP0A 5BOXA 1MJAA 2OD5A 3ABUA 3GEZA 3TP0A 5F1RA 3REOA 4XKVA 1I3AA 1IN5A 2VE8A 4IHXA 2XAQA 1KU3A 5D8LB 4MFEA 3DEEA 1QA6A 3KLOA 1YE9A 1MGTA 1P6RA 1BR1A 3NWSA 4MO7A 3LSJA 1JTXA 2V9KA 5FKNA 3CCSI 1MBEA 3R60A 3I53A 2HGCA 2LF7A 1Z67A 1FYMA 3GFIA 1MJBA 1MNMC 3ZN0A 2BBYA 3O3KA 2WA0A 5HLIA 2K3PA 4Q5SF 2R3SA 2HYGD 4DYQA 4EQQA 1U8BA 2CU7A 3CC4I 2NS0A 1MNEA 4OAZA 5DDGA 5DUIA 3MZHA 3KE2A 4KIBA 1ZKGA 2E1CA 3G1MA 1YI2I 3IWFA 2ZNZA 2CW7A 1U3EM 5ILUA 2LVSA 1S7EA 2EQRA 2VPLA 1TT0A 5ILVA 1JKOC 3H5AA 2O9LA 5BNGA 3CMMA 5H6RA 2WAQN 4I02A 1D8JA 3NWTA 3Q0WA 2GQQA 4II3A 3WGIA 1G8XA 2VN2A 3FXJA 3K2ZA 4ENKA 1R5GA 3PUFA 2QQBA 4CCKA 3T8TA 4L9NA 1OLTA 3K6GA 4B09A 1FMWA 2NVTJ 4DJAA 3MZ8A 1IF1A 3AL0B 1X1DA 3EUHC 3OR2C 4YIRX 3BOQA 1SC7A 3OYBA 2R5ZA 3L00A 2E34A 2H6BA 2H94A 4QSHA 3BR6A 3ZR8X 4HOBA 3D5RC 3PQJA 3FXQA 2N8GA 2MD0A 4U0WA 4ZDPA 1FBUA 2WY7Q 3D1NI 5FO5A 1O3SA 1FP2A 1IN6A 2DQLA 5ICCA 2HOSA 1LPQA 5FKKA 2OQRA 1Z3YA 3X2QH 2ZCWA 2JSCA 2TRTA 3U9GA 1A31A 2QSGX 4O3MA 1GHCA 4LB6B 3CDIA 1YS6A 2L54A 2Z2SB 4M3EA 4F3QA 3SFZA 3MVPA 3QRFF 2EZLA 4A3CJ 3HM5A 4TV7A 3GZNB 5C44J 5E3MA 1V55H 4HLXA 4YIIA 1GVDA 2R7SA 2UZKA 4AYBA 3MD2A 4EMSA 1MDMB 1J75A 4E7ZA 1NG7A 2QF7A 2VI6A 3VYRB 2M0MA 2CO5A 3BG3A 1AHDP 4AVPA 4LMYA 4M3BA 2JUGA 1TWFJ 2P5VA 2BGCA 4OWRB 3OYEA 3IP4B 1Y8QB 2OPTA 3OV8A 1GV5A 5JFRA 4L18B 3DLLF 2RAEA 4FE4A 2LTPA 4N9IA 2AO9A 1P7IA 4PJNA 4AIKA 3TEDA 4IJAA 2KDOA 4KUMA 3VPRA 1K78B 2DFEA 3I56I 3FX3A 4HEA2 3RQIA 4LLLA 2OTLI 4ZTJA 1LFBA 2FE3A 3VSLA 2VOOA 2CQNA 3RPUA 2ESHA 2YUSA 4XOPA 3JTHA 2W00A 5CQEA 2F48A 3BZKA 2HVRA 2KJBA 4NC6A 5B1AH 3QPSA 2DYRH 4U7DA 1OCTC 1CQTA 3PM1A 1S5LC 3ZN1A 2JVHA 4KT6A 2HKXA 2O03A 1MZBA 4G94A 1RNLA 1BM9A 5F0FA 3ZGKA 4L0ZB 2UXXA 1LVAA 2E2JJ 4FISA 1JGGA 2R4GA 2L7FP 1N78A 2W1OA 1JUPA 3HG9A 4CCLA 2FMYA 5H6QA 3G3ZA 4J01A 5DCMA 5KAIC 2EA4A 3OMYA 4ESFA 4CCMA 2B7EA 1T95A 2JA6J 3QP5A 2PMZN 1IXCA 4PGHA 3CLOA 3WU2C 5EG0B 3PUBA 4KA4A 4OIOF 2M0CA 2HFHA 3MCZA 2HQNA 3MZYA 4Y52J 2LYCA 1X3WB 2OA4A 1TQMA 2VOPA 5GADJ 3VYSB 4RGXA 5IOZA 1TBXA 3HOYJ 3TKYA 1WQ2A 4LJZF 4S0HB 3BG9A 2XKOA 1MNDA 2K02A 3WU0A 4IO9F 1DP7P 1ZYRF 2DMUA 3CJNA 3BP8A 2H6CA 4HRIA 4IPAA 4OIPF 1BN5A 2JRMA 4JBAA 1SVOA 4J00A 2VBYA 1LVKA 2ISYA 4LGWA 2KDZA 4RAFA 1DGWY 4LB5A 4QTRA 3KP4A 2O5RA 4RA2A 4UB6C 3ESWB 3LSHA 1ZR2A 2XB5A 2GXAA 1V5EA 4YG2F 1TWCJ 2LH9A 3HOTA 3OYKA 2CQXA 5J8FA 2LY9A 3WG7H 3VODA 2COBA 3PFIA 2F6CA 2ZNYA 4FETA 3KX2A 2XSDC 1W0UA 2YX4A 4A93J 2K27A 3DU5A 5D8KB 4DBQA 3I59B 2VB6A 1IJWC 4HQEA 5JR3A 2K5CA 2KLOA 4X0GA 1FX7A 5JHFA 1OJLA 1OMIA 2Z3YA 2STTA 3FMQA 2PMZA 1IDZA 3HRSA 3IRRA 4A3DJ 1UB9A 3TP3A 1X1BA 3DBRB 3BR3A 1FOKA 4P9FA 4XL9A 1DDNA 1NG6A 1ETWA 4YFNF 2V79A 1JHFA 3IWZA 2KISA 3G6EI 1FNNA 2X6OA 2DQRA 1WVRA 4HX8A 4Q48A 5GAGJ 4EGYA 2JMWA 1T39A 4U88A 2IEKA 2JRTA 5DS9A 4RGSA 2NVXJ 1XB4A 1WPKA 1I39A 3K0LA 4P55A 5CVVA 1WJ5A 3GFJA 4XLFA 1RKWA 1ON2A 3ASOH 2XDVA 3A0BC 2E1MB 2L9SA 1IV6A 2V1NA 1GDTA 3JRHA 2GA1A 4MQ9F 4HYEA 3PIOF 1HDDC 4AIDA 4LG3A 1OFCX 3FIWA 4BGDA 3EETA 1HKQA 3C7JA 2XSJC 3A01A 1PUEE 2QYOA 4PJJA 3F72A 2RQPA 3RQ4A 5M5XJ 2BVLA 1LEAA 4BNCA 2M45A 1U5TA 4B3XA 3DV8A 2L3DA 1I27A 1I1GA 4HA8A 1OYIA 4CYCA 2HPIA 3S3OA 3CZ6A 4RB1A 2XKPA 1ZAOA 3FISA 4OOIA 3KEOA 1UJ8A 5IT9Z 3CMAI 2DK5A 2BXZA 2ZXJA 3DTIA 4EGZA 3CUQA 2EIMH 2L7ZA 2R7OA 1BJZA 5BPIA 2MGQA 3E7LA 2R7DA 1PP7U 1XGSA 3MAJA 4LK1F 3W2WA 3GMEA 2H27A 1WCMJ 4M73A 2VXZA 2GA2A 1WJFA 3ZQIA 3P7NA 4OU0A 4WK8F 2IPQX 2GIZA 3ABMH 1XPXA 4ENJA 4IOAF 2W85A 5GAHJ 1W7PA 2DA2A 1T0FC 2QZ8A 3EPZA 3PFYA 3OIOA 2L02A 4CSWA 3K1PA 3FXRA 4JX5A 3ZMZA 2XAGA 3BTIA 2X48A 3SXYA 3LFKA 2BY0A 4MTEA 4KIFA 3I4MJ 1AWCA 2DT7B 3ECOA 3UR3C 1PUFA 2PBIA 2A6HF 2HTJA 4OAYA 6PAXA 3RKWA 1TNSA 3BY6A 2RNJA 3EDPA 3GF2A 3NRVA 2K9QA 5EYRA 2IVMA 1ZELA 1UHMA 3NAUA 1N75A 2X6YA 2HOEA 2OAZA 3AL0C 2OV7A 5F0HA 1WH5A 3NARA 3PNYA 2X6XA 5CJ9A 2CFOA 2JA8J 5K7HA 1X4OA 1JKRC 2IS4A 3O6BB 2CUFA 5FFZA 2GIVA 4HSRA 2LLKA 4A3JJ 2ZJRF 3LQQA 5D5UB 3M8JA 3GTKJ 1HSJA 2E35A 1WJEA 3PNVA 4FX0A 3T1BA 1SFUA 2OF7A 4Q47A 1A04A 2KHMA 3H1CA 2QQAA 1H9TA 3J81K 3GTMJ 2HYFA 1LDJA 1ZLJA 4DZPA 3PO3J 4FCYA 5BMZA 1PDNC 2BHYA 3DKXA 3F8BA 2JWTA 3P9KA 2P7CB 3J7AO 2IP2A 3S16J 2P6TA 3MKWB 2FX0A 3QOEA 1RR8C 3CCEI 1MD0A 3U21A 1HKSA 2KQRA 2XF7A 4G6TB 1K79A 4HF1A 3OYDA 1YW9A 2E2HJ 2GXGA 2VIXA 5TJJA 3N97A 3CJRB 2A05A 4E7SA 3HHHA 2FNPA 4C3JJ 4I76A 2EK5A 4UUTA 2G7HA 4M6YA 3MQ0A 4BY7J 3JRIA 2EFOA 2OCCH 4LG0A 4A3MJ 4ABZA 4C2UA 4PSXA 3VWBA 1ETKA 1UZCA 1QPMA 2XRLA 4XR6A 1ZQ3P 1QZZA 3JRFA 1H9GA 3ZQLA 4CYDA 3S15J 1SFEA 2HI3A 4BQNA 4UVBA 2KKOA 1O3RA 4QPOA 2M5WA 4XRMA 1UCRA 2E5NA 1FP1D 4C2TA 2A5WA 2ZB9A 3CF5F 3FXUA 3HB9A 4UUSB 1TNTA 1TW3A 4CZCA 4BYYA 4L5IA 3WTXC 5J4YA 2Z1DA 2JK3A 2XAHA 3A02A 4ZZDA 4KDPA 4IRGA 2NYXA 5L3DA 5JVGF 5M5WJ 4L0YB 2HKOA 2K9LA 4IKFA 3F3XA 2HXIA 1LJ9A 1K7AA 1VQ7I 4BJ5C 4HQMA 3CCYA 2XROA 1RESA 2R5YB 2E19A 4UV8A 5J1YA 3K1MA 3HIFA 3QPLA 4V19K 1Z0XA 3JAMK 3LFUA 2TCTA 3VYUB 2O61A 2LBFA 2PEXA 3OIPA 1NHAA 3BPXA 2Y0SA 1FTTA 1OR7C 1LUJB 3EUKL 4NB5A 2YU9J 3HOZJ 1S29A 1JJ8C 3ZXSA 4DW6A 3IH4A 2WADA 3SZGA 1QZEA 4XSXF 3PNTA 2LC2A 4EJOA 1D0ZA 2DA1A 2VE9A 3R6SA 2GLOA 2LSOA 1BC7C 2GM4A 4WF2A 2NVQJ 4PJLA 1T08B 1FBQA 4E7KA 1R7JA 2CW8A 4CGZA 1G3YA 3SFIA 5F27A 2LOOA 1Y6IA 1Q1HA 5CYVA 2Q1ZB 1I6HJ 5HDKA 5FROA 2MLGA 4BXFA 3HHGA 1XCVA 1HXDA 3VFZA 2QBYB 1OYWA 2A68F 2VJJA 1WJDA 1MJ9A 2EV6A 3K2AA 4CO8A 4EM2A 5L3EA 3R0AA 2QENA 1JT0A 3GX4X 2RREA 4XLEA 4CCOA 1CF7A 1DPRA 1IDYA 2CUJA 1JT6A 3H3VK 3V8KA 1D5VA 3EQLF 4XKBA 4Y7NJ 4BL0B 2W25A 1G59A 4BY1J 2FU4A 2MA3A 2XAJA 4WXDA 3JRCA 3GTQJ 1W5SA 2XB0X 3FHZA 1SEUA 4BBRJ 2WAEA 3GFLA 1XG1A 4AWXB 2VPRA 4FHTA 2VL8A 3KZZA 4HG2A 4M72A 4ZYEA 2FNAA 1E3HA 2FEZA 2DTZA 5DM7F 4IHYA 4YIFA 1L0OC 4DGWB 5JHUA 3GYHX 2NVUB 5E8IA 1VQ9I 2PN6A 1MSEC 2OJED 1N25A 3I9V2 2HDDA 2ECBA 3OYIA 3OL3A 1V54H 4IRIA 2L0KA 2M1BA 2V6CA 4NQWB 2XV4S 4QPQA 1P4WA 1ZGWA 1YJ9I 4JX6A 1AOYA 4II2A 1RUOA 1H0MA 4JQFA 2EH3A 2WB1A 3H3UA 3J7ZI 5KK1A 2IS2A 4U87A 4NHJA 3E6BA 4I99C 2E1MC 2GOMA 2E5ZA 4ZDOA 2JN6A 3FK7A 4GYIA 5HNHA 1B6AA 2D45A 2VT3A 3SHFA 3M7GA 4RAGA 3KP3A 1Z9CA 3IAM2 5DV5A 4DOZA 2QQ9A 2VJ5A 5FLXK 4XLCA 1ON1A 3T5XA 5EGOB 3JR9A 2DOAA 1MBJA 4CUGA 2IT0A 2M9HA 2DW4A 1TZLA 4D5FA 3LOCA 3C2HA 5F64A 2NNYA 5E3NA 3CCQI 2OZUA 3DWLE 3WGGA 1S72I 2LFBA 3ERED 2ME0A 2ZC2A 1WGXA 4HAMA 4L5EA 5LHIA 2FOWA 3RSNA 2STWA 1H88C 2CSOA 5D4RA 4ZYHA 3M4OJ 1BOBA 2IA0A 4ASNA 3D5SC 2EFPA 4BBSJ 1YX5A 2ZSIB 3M07A 1E3OC 4XRSA 3DBHB 4PCQA 3WTSC 1ZRCA 2J5PA 2ZJ2A 2ZJQF 3ABLH 1BL0A 1KYWA 2RKHA 5GAEJ 5CLSA 1F36A 3L2WA 5E18F 1Z1DA 2FA5A 3DEWA 2IAIA 3O8GA 3C2GA 2FQ3A 2BE5F 3K4KA 4A0YA 2LP0A 4C3HJ 1J9IA 4BACA 2VBXA 3ZQFA 5FJ8J 4LLGF 1U9OA 4ENNA 3FDYA 4K2EA 1WSUA 4XMYA 1IAWA 4RAZA 2CQQA 3JSPA 2Z5UA 4CCJA 4L9JA 2NNNA 3KZIC 2AQEA 5J3LA 1G3WA 3JRDA 5EEHA 3CC2I 2XGEA 2VKDA 2D1HA 3ZMUA 3JRGA 4JK1X 2FBKA 3M3YJ 1U0JA 4XKCA 2X51A 4G7HF 2KIUA 1AKHB 2ELHA 4RM2A 2EZKA 1DQUA 4CA0A 1K6OA 1V5GA 1JUMA 3FXKA 1BIBA 3OYFA 1WH7A 3S8PA 1YX3A 2WAFA 3BTCA 3BG6A 1LNWA 4CXFA 3CCUI 1S7AA 1DUXC 1ODDA 3HOXJ 1A6IA 1B72A 2R93J 1XTAA 2F5EA 3J7YJ 3ZP5A 3C1DA 4PSWA 1VQOI 2MC4A 3EUAA 2QGUA 3E97A 5BPDA 5LFAA 3HUGB 3F6VA 3JSOA 4FX4A 3LSPA 3ONQA 1FZPB 2MYSA 3DKWA 1SD4A 2HVSA 1G4DA 3IKTA 2HOTA 4A3BJ 3GO5A 2DYSH 1O7FA 1K6YA 3SZPA 4EJWA 2ZSHB 3I58A 5D4SA 4NC7A 3QQAA 4MTDA 2HOAA 2V6EA 2NOJB 3QAHA 3Q3SA 2ICWG 1MDMA 1IW7F 3IL2A 4A3LJ 4C9YA 1F1ZA 2X1CA 4MGRA 2ISZA 4A3IJ 1HQCA 4IVNA 1XX5A 3I3LA 4IL6C 1I6XA 5KVRA 3B73A 3LAPA 3RTRA 2UXNA 4LIUA 3GZ5A 3V7SA 2LNBA 1MH3A 1FIAA 2PFBA 1XS9A 2VC0A 2ZKZA 2CWEA 3CO7C 1OKRA 2AHQA 4NC8A 1QGPA 4F91B 1E17A 3HGYA 3LMMA 5IP6A 2W57A 5LRSA 3AG3H 2HZTA 1UELB 4BJ6C 2V1DA 4PJMA 2Y9ZA 4I7HA 3H9QA 4EEFG 1HF0A 3HGGA 3DLAA 2EB7A 1WRJA 3S14J 1BIAA 4N4NB 2WAQA 1T56A 5HLGA 3SDBA 1GXQA 2BOLA 4WXHA 4XONA 2DMNA 1YG2A 3FXLA 3H3ZA 5FGMA 1RR7A 3M1CA 1SAXA 5IP7J 4U7BA 4RMNA 4UV9A 2DK8A 4BUPA 3K10A 5IYBJ 3HTUA 2M4KA 1W0TA 2QQ8A 4RLQA 4W1UA 3HTSB 1OR7A 1KU7A 2CV0A 1USTA 2R5ZB 2P6SA 5E20A 4BHBA 3O8HA 4KN4X 1A35A 4G6DA 4A6DA 4PK4A 3BR5A 4BQQA 1JE8A 3G2BA 2XVCA 1FWZA 3UKGA 2L4MA 4L5JA 4E4HA 1YTYA 3ML6A 2QVOA 2Q0OA 1OYYA 2G7UA 2EFNA 4YELA 4PUSA 4WCGA 1ENHA 3CLQA 3ERMA 1U6GA 5J1RA 1VQ6I 3JTGA 1HCRA 2K86A 2ZXIA 3ASNH 2ID6A 3G1LA 5KNLA 3OSFA 3GTPJ 2BVMA 1YOVB 3OYCA 4PFPA 1VQKI 2BEOA 5F0CA 3L2QA 2C6YA 4HLYA 1RZ4A 3BR2A 2HS5A 1F9NA 3Q9SA 3V7CA 3GTGJ 1WJCA 2KZVA 3TMOA 3O2PE 4XN3A 1BC8C 2JJ7A 1J7KA 2GXBA 2B63J 3H92A 1XSDA 3GTLJ 3DQVC 3CQZJ 5FRNA 5LGUA 2HEOA 1T33A 1UHSA 5GP9A 2BY2A 3WTUC 1D5YA 2A6EF 3I59A 4PDKA 3IV5A 1TW2A 5H20A 3OYJA 5GTIC 1IC8A 1IRGA 2DI3A 2ID3A 5IYCJ 1PP8F 3IUOA 2I5UA 3F22A 5FRMA 4ZDLA 3RYPA 2OU2A 2XF5A 5IT3A 4EJUA 1TTYA 1WJBA 1I50J 2R7QA 2Y31A 1SFOJ 1YRNA 3J7AY 2XRNA 5HNFA 5TGTA 3E6DA 4Y13A 2WV1A 1QNTA 1QHGA 1V4RA 4AD9A 3SEQA 3V42A 2Z9OA 2DPUA 2Y75A 2ZMEB 2EILH 1EA3A 3E5QA 3VYTB 1Q1VA 2UV1A 3DBLB 4DQ2A 1PVEA 5J4VA 4JX4A 1HKTA 3L7WA 2KZGA 3LL7A 2OC6A 3R4KA 3FHNA 4R8HA 3OYLA 1LE8A 1T6SA 3CD6I 2V26A 3H0DA 2XF6A 3ZQQA 2O6GE 1DP3A 2LR8A 3H36A 1VF9A 4G7OF 3KYCB 1Z77A 3RKXA 3WTTC 2NRAC 3P9CA 3CDLA 4ITVA 5E1ZB 5J6XA 4CZZA 3L2RA 3V8LA 2G0EA 1NK3P 3AG1H 3TBIA 2DOFA 1FOXA 3SJMA 2V7FA 1MMDA 2BW3B 1O4XA 4ETSA 4BE1A 3BZCA 1RRJA 5CVUA 3HOUJ 1P4AA 1XD7A 3S1NJ 4BEHA 4UXNA 2Y2ZA 4BH9A 1SVMA 5JVTA 5A2QK 1AA7A 2COMA 5DYMA 5JI6A 5LD2C 1UG0A 2HTSA 1GLNA 4F92B 3HBLA 3A2KA 4JOMA 2RN7A 1ZG3A 5CPRB 3SYTA 3TO7A 1DGRM 1EH6A 4GFBA 4HNVA 1ZK8A 1HLVA 4MEXF 1MH4A 3S2WA 3FK6A 2DDAA 1OQYA 2DODA 5EDNA 1KQ9A 2V4JC 2B0LA 1WHUA 2IA1A 1RI7A 2JQ7A 3CF2A 4A2UA 2MD5A 5FKOA 2LK2A 3JCUC 1U78A 2NS8A 1FIPA 2VJIA 5F08A 3S93A 1RUNA 4CHUA 3DFGA 1J5YA 3WE2A 1QZYA 2F4MB 3BROA 2ZXWH 2WWYA 4HZFA 2X85A 3QU6A 3GVAA 5BQTA 3BG7A 1OCCH 4D0PA 2AXTC 3I0TA 2DOEA 3FKJA 3U1DA 4R79A 3WHBA 2OCEA 2VODA 1XDUA 1P9QC 2AXLA 2XAUA 3TO6A 4Z6YA 4FQGA 1IRZA 2F5VA 2KIMA 3H5NA 2KRCA 3LA7A 4M6XA 4UUVA 1DPUA 2P5KA 3DP7A 1IG7A 2DA6A 3SDGA 4ESJA 3F8CA 1S6LA 2K85A 2Y69H 4X1EA 4F93B 4YFKF 4ENMA 2R7TA 1P92A 3A01B 2CRGA 3EUHA 1N77A 4N4OB 1XDSA 5C3EJ 2VQGA 1U5TB 3M8EA 2RDPA 3HSEA 4U0YA 1OCOH 2LF8A 4OMYA 1XCBA 1I5ZA 4WXCA 4WX9A 3OYNA 1LB2A 3PIPF 2V9PA 1G3SA 4CYCB 2QKLB 5FKLA 2X0LA 4I0BA 3QYBA 1EV7A 1Y8RB 3HRMA 3E6CC 5C4JJ 3COAC 1WZ2A 1FSHA 3GCMA 3ZQHA 3F23A 3CUQB 4QIWN 1XGOA 1J2XA 1VNDA 1FC3A 4A3FJ 1LKXA 2WV0A 3HZJA 2EIJH 2R7XA 1EF4A 3OS2A 2L9VA 3WG9A 1R36A 1X3ZB 1O3QA 5B66C 2P4WA 2Q2EA 2V9VA 1NH3A 3CC7I 5J40A 4B8XA 1B8IA 4P9UA 1D0YA 1TWAJ 2IJLA 1X1CA 1VQ4I 2EINH 2V1XA 3FKIJ 3QYFA 1XMXA 1TWGJ 1W7PB 4BKXA 3C2BA 4UUSA 3L09A 3OYAA 1R1VA 3MN2A 4XQFA 2JT1A 3ZQ7A 1YIJI 3CCMI 3DF8A 2IRFG 3RDIA 4KMUX 1T38A 2DTRA 5D5VB 5FLXZ 3TQNA 1IGNA 2L2OA 2A07F 1PUFB 4DNCA 1MKMA 1BI3A 2K9SA 3BTJA 5F1JA 2DU9A 4L9TA 2VKEA 3ISPA 1X2MA 5L3BA 4BJTA 5IYDJ 2BV6A 4FTHA 3KEQA 2NVYJ 1IUYA 4XORA 4ZH4F 2UWMA 5ICEA 3K4JA 1IXSB 3WTZA 2VQCA 1BW5A 3WODF 4A3EJ 1YJWI 3AFHA 1W5TA 3LWFA 2FBIA 2ESNA 1ZH5A 4D9JA 2EV0A 1YO5C 4XLNF 3S17J 3QP6A 1GT0C 2KJCA 1POGA 3F8NA 1LDKB 2Z16A 3BG5A 2H1KA 2M7AA 1ZR4A 2I8DA 4S05A 5CKTA 1KZHA 3I71A 1B9NA 1JUSA 3S1QJ 3K4MA 1HOMA 4NUBA 2AQFA 3RZOJ 3AG4H 3JRAA 1VI0A 3S32A 2CUEA 4Y17A 1ZRFA 3UNGC 2QUFA 3VOEA 2R0QC 2HYJA 2LY1A 2M34A 4X6AJ 3H35A 5CVRA 1BI2A 2ZFUA 3VB2A 5E79C 2ETHA 3MKYB 2CS3A 2RC4A 4LG0B 3MMYB 3E5XA 5LHGA 2MW8A 3K4NA 2ELKA 5D5XB 4GDFA 1X1AA 4RLFA 4XLHA 1P7JA 1Y1VJ 2Z99A 1QQIA 2HDCA 1Z6RA 2CYYA 3K4BA 3W6VA 2P0WA 2VASA 3WE3A 4G6QA 1QVUA 3HRUA 5HS7A 5GPCA 1R4NB 3HOVJ 2EV5A 2PX9A 3D0SA 3CCJI 1WKMA 2R7ZJ 2HWVA 5LRRA 3CCRI 1TQIA 2NXNB 2KT0A 3Q0VA 2QCOA 4DYCA 1A5JA 1IN7A 2JPBA 4Y3OA 2DN0A 5DUKA 2CV2A 3KLNA 1SVLA 3B02A 2FXAA 4P5OA 2ZMEC 1D3YA 2DLLA 3AAFA 4IZZA 4E70A 2IGKA 1Z91A 4AIJA 1F5TA 2LDUA 5GTHC 2HXOA 3RZDJ 3CMYA 2QKMB 1U2WA 2DFHA 2L7MP 3G73A 3NEUA 5CVIA 4DZJA 2JSPA 5J1UA 3TOBA 4E6KG 4V2FA 3ZQCA 2FUG2 2KIQA 3KCCA 1KU2A 1VQ5I 4KYWA 2YX7A 4HNUA 1ETQA 5B5EC 3B6CA 3G4SI 3QWLA 3LSGA 1YLFA 3N05A 3TO9A 2LD5A 2FD5A 4KT5C 4IEJA 4IHVA 3DTEA 3F8MA 2OQGA 5M3FJ 5F04A 1X4PA 3CP2A 2AS5F 3LQRA 5HLTA 1SFKA 3ELKA 1R49A 2FF4A 2R7UA 3MWMA 1W36D 1RKTA 2W4SA 1K83J 2GOXB 3C3WA 1W4MA 5M3MJ 4OIRF 1V3FA 5K7FA 1NK2P 3GTJJ 1JGSA 4D7NA 4RGRA 3CMEI 3E0JB 1KQ0A 4M3FA 1D1BA 2KMUA 5E1WA 3ZCOA 3MFKA 3KP6A 3DPUA 2F4IA 1CF7B 3HSFA 4I6ZA 5HVQC 2E60A 2M2EA 4XKWA 3FBIB 1OPCA 1MBKA 2CW0F 1R6RA 5LBQA 1RETA 2M8GX 4HNTA 1R5ID 2M30A 2NOGA 2XUBA 4BS9A 4NNJA 3BJAA 5K5RA 2PMUA 2RNGA 4JYKA 2DA4A 3BWGA 4XSZF 5EZGA 4MFDA 2PJRB 4ZZLA 4RAYA 2RGVA 4RM3A 5JLXA 1T2KA 1P2FA 2JPCA 2LKXA 4F7ZA 3I54A 2GZWA 4I09A 2M3AA 2DA7A 2F5DA 1T0FA 2L9RA 4PFOA 3AKZA 4ZTFA 2W7NA 5TRDA 4BQOA 1KONA 1K4TA 1DU0A 5L3FA 3ECHA 3V7RA 1RC9A 5ILSA 4BHPA 2K9NA 3FMSA 5ICFA 1Z3XA 2JZYA 3GLLA 2VT2A 4XBFA 5GPAA 3IAS2 2HPMA 3BTLA 2EFWA 2QSFX 1GV2A 3KFWX 3RCOA 5J8CA 4Y15A 4M9XA 3TGNA 3R61A 4XOTA 3ZPLA 1KQ8A 4EM0B 2CQ7A 1B9MA 3OYGA 2B9SA 4GCVA 1W36C 1R00A 3E5UA 2FJ1A 1XSVA 1S3JA 1FTZA 1HDPA 2YPRA 4HDUA 2R7WA 1ULYA 2YS9A 1QO0D 5EJCA 1RIOH 1U5TC 2MSYA 4HPQA 4BXXJ 3RI4A 4OMZA 3E1SA 4ZYDA 1IZ1A 5JLWA 1E0EA 2NS7A 1IRXA 1IV8A 1TLHB 3K9TA 1GXPA 1JTYA 4IRHA 2DA3A 3LAJA 1YW8A 2EZIA 5FB2A 3L2UA 5HOOA 2Y0MA 2IGOA 3CUQC 1QRYA 2FQ4A 1Y1WJ 4LLNA 1R5HA 3I55I 2EZHA 4GYGA 5D6FA 1FY7A 2M8EA 3W2AA 1SMTA 2MFZA 3W2VA 4IF4A 4NBQA 1OCPA 1SFXA 1VQMI 3E3VA 3T8RA 3L9FA 4F52A 2MH9A 2VONA 4BE0A 2E2IJ 2P81A 5LHHA 2BZTA 2EIKH 1FSEA 4IQ4A 3ABKH 4XLAA 1ETVA 4B1RA 5D5WB 3JRBA 3BC8A 3I4PA 3TW6A 2L4AA 2HR3A 3SEZA 4RBOA 2XGCA 4O6JA 4U0VA 3BCBA 4AYBN 4DYRA 1ZTRA 1R1TA 4ZYGA 1JKQC 4PZJA 1M1EB 5B1BH 2IGNA 2W84A 3MKZA 3CCVI 2RVCA 5FFXA 1ZN2A 1FPQA 2GWRA 5E3OA 2HZDA 2JUCA 3G71I 2HDWA 4G8XA 2NAZA 4CCNA 3HRTA 3T0YA 4A12A 4BDZA 2H8WA 1ZGAA 2VLAA 3WTVC 4HBLA 5J47A 2KRFA 4XICA 2JVGA 1D1AA 4XM3A 3S3MA 1G3TA 1HW1A 1K78A 2E1OA 5A2QZ 5DCFA 3MKLA 4CICA 3F21A 1B72B 2XASA 1LEBA 3OYHA 2MLKA 4UVAA 4BHCA 3OOUA 2OZ6A 1RPWA 4AUXA 2BY3A 4A5NA 1VQ8I 4GRIA 2JA5J 3CJTB 1FT9A 1WI9A 4M3GA 3ZMSA 4G7ZF 4XRFA 1P4XA 3RYRA 4KN7X 5LEKA 1IRFA 1EH7A 1LQ1A 2IXSA 3QPTA 4LD5A 2E36A 3GXOA 3F0CA 1Y0UA 3OL4A 2IGMA 1AU7A 4HF2A 1BOAA 1FLIA 1K61A 1WI3A 3HYIA 4BQAA 1WJAA 2KP6A 3QU3A 2D2WA 1D0XA 5HDGA 1W5CC 5EG0A 1EJ9A 1ETOA 3WTWC 3J80K 4L9VA 1XN7A 4B43A 4IXAA 1H89C 3F8FA 4EM1A 1C0WA 1ETYA 3I4NJ 4RB2C 1ACIA 3KETA 2K4JA 3BR0A 1ETXA 3PO2J 1R23A 3M8FA 1Y0NA 2DFFA 3WGHA 4AIHA 2D5VA 1QHHD 4I2OA 4B48A 2RQQA 4XN0A 2CJJA 1X1PA 2XC7A 2ADUA 1VZ0A 2W24A 2EFQA 3HKZN 5EEGA 1KU9A 3CCLI 3A1YA 2XPUA 4BXUA 1QBJA 2CGPA 2J5OA 1LFPA 2EA2A 2IBDA 4EATA 5HODA 3S3NA 3A0HC 3GFMA 4N9HA 2ZMEA 3KP2A 4RDUA 1XC5A 2DMQA 2IA2A 3IKVA 3CP8A 1YITI 1O7LA 2ZFWA 4HW0A 4EVIA 2R7VA 2DBBA 3VSKA 3CO6C 3KP7A 3ZMVA 4HV6A 4C3IJ 1Z21A 3RKQA 1YIOA 3I5UA 4Y33A 2QWWA 2L9NA 3FXOA 4Z2YA 4OIQF 4PGGA 3GLXA 5EZHA 5K5QA 1JXSA 1WWXA 2O8KA 2F5FA 3TDUC 2GBYA 4HX4A 3L2VA 1TT5B 3ZOBA 4AC0A 1SANA 3J81Z 1W1WE 2PQ8A 5K5OA 1ZG5A 4ANJA 1BR4A 3QOPA 2G9WA 1TWHJ 1VFCA 3K1NA 2HU9A 1MW7A 5M5YJ 3HOWJ 2BW3A 3GTOJ 1ITYA 2A69F 3OS0A 2XIGA 2JA7J 1U8RA 3HKZA 2QEXI 2M4GA 4FT8A 5IP9J 2CH0A 3I64A 1HBXG 1MBHA 2EJRA 2MBFA 3PSFA 3BQZA 1D8KA 4H0EA 3HC7A 4UB8C 1FBSA 3W3CA 4ZC3A 5ICGA 2MG4A 5DCMB 1UHWA 1ORKA 2CFXA 3BR1A 4IQJA 2W48A 1J59A 1MMAA 4LK0F 4G12A 2K9MA 1OCZH 1FEXA 2MC3A 1MMNA 3FMRA 1DU6A 2VUMJ 1H8AC 1REPC 1IN4A 4KMFA 1YYVA 2DAOA 1XMAA 2DPDA 3GBGA 4MIMA 2O3FA 2BXYA 2CG4A 4Q4ZF 4XIDA 3LNQA 2OTJI 2QM3A 3W6KB 1SD7A 5KAFC 1BBYA 1MBGA 3BLYA 3PL8A 3S2DJ 2HQ5A 3TW7A 1R4MB 1HSTA 1BJAA 1E3PA 1ZREA 4HV5A 1YRNB 2YU3A 3ZRGA 3K70D 1LDDA 3HOSA 4C2MJ 1EH8A
chains in the Genus database with same CATH topology
2EZLA 4A3CJ 3HM5A 4FTHA 5C44J 5E3MA 2NVYJ 5EGOB 3JR9A 1GVDA 1MBJA 2M9HA 4D5FA 2QF7A 3LOCA 2VI6A 5E3NA 1BW5A 3BG3A 1AHDP 2LFBA 4M3BA 4A3EJ 1TWFJ 2ME0A 1WGXA 4L5EA 1H88C 3M4OJ 2OPTA 1GV5A 1LE8B 2RAEA 3S17J 1GT0C 4BBSJ 1POGA 4FE4A 4W97A 2LTPA 3BG5A 3Q0UA 1E3OC 2H1KA 4XRSA 1ZR4A 2AO9A 3ZQGA 1P7IA 3TEDA 1BL0A 3VPRA 2DA5A 3A03A 4D7MA 1JUSA 3S1QJ 4A3KJ 1HOMA 1F36A 3RQIA 3RZOJ 3JRAA 1VI0A 1LFBA 2CUEA 3DEWA 2R0QC 2IAIA 3O8GA 2HYJA 2M34A 4LOCA 4X6AJ 2LP0A 2YUSA 2O7OA 4C3HJ 3ZQFA 5FLVA 5FJ8J 1U9OA 3QPSA 1OCTC 1CQTA 3PM1A 4B3AA 2CQQA 2MW8A 2ELKA 3JRDA 5F0FA 5J3LA 1P7JA 4V2GA 1Y1VJ 2E2JJ 4FISA 1JGGA 2L7FP 3W6VA 1JUPA 2XGEA 3JRGA 1QVUA 3HEFA 1I3QJ 3M3YJ 5GPCA 3IH2A 3HOVJ 1AKHB 2JA6J 2PMZN 2EZKA 5EG0B 2M0CA 2R7ZJ 2X9DA 1JUMA 2KT0A 1WH7A 3Q0VA 2QCOA 4DYCA 4Y52J 1A5JA 3BTCA 4A69C 2DN0A 3H0GJ 1A6IA 3HOXJ 1B72A 2R93J 5IOZA 3HOYJ 3B6AA 4S0HB 3BG9A 3BQYA 3K7AJ 2HXOA 3RZDJ 3CMYA 2DMUA 3G1OA 3LSPA 2L7MP 2HOTA 4A3BJ 2KDZA 4DZJA 5J1UA 4QTRA 4V2FA 3QQAA 3ZQCA 2HOAA 1ZR2A 2XB5A 1TWCJ 3Q3SA 2XGDA 3DCFA 4A3LJ 1R9TJ 1ETQA 2CQXA 2LY9A 2COBA 4A3IJ 3B6CA 3LSGA 2XSDC 2VKVA 2LD5A 2FD5A 3IH3A 1W0UA 4IEJA 4A93J 4IHVA 1IJWC 1MH3A 1FIAA 5M3FJ 1XS9A 5F04A 1X2NA 1OJLA 1U9NA 2AHQA 5EF6A 2DJNA 1IDZA 4A3DJ 2R5YA 1RKTA 3HGYA 3TP3A 5IP6A 1K83J 5M3MJ 3BR3A 4XRSG 2I10A 5K7FA 1NK2P 3GTJJ 1ETWA 4D7NA 2Y9ZA 2X6OA 4EEFG 2Y0SN 4M3FA 3HGGA 1HF0A 3S14J 2JMWA 4J19A 3L1PA 3LSRA 4I6ZA 2IEKA 4FE7A 5DS9A 2M2EA 2XPWA 1MBKA 1T56A 2NVXJ 1WPKA 2DMNA 1RETA 2M8GX 1RKWA 1RR7A 2NOGA 1IV6A 5IP7J 1GDTA 3JRHA 3S1RJ 1HDDC 5IYBJ 4JYKA 2DA4A 1W0TA 5EZGA 1OFCX 4MFDA 3FIWA 4W1UA 1B8IB 5DTDA 5JLXA 3A01A 2EBIA 2LKXA 2ECCA 3WHCA 5M5XJ 1UG2A 2R5ZB 2DA7A 3O8HA 2L9RA 3BR5A 1JJ6C 1NTCA 1UMQA 3UKGA 1DU0A 4CYCA 3OSGA 3FISA 2K9NA 1ENHA 1QPIA 5J1RA 3BT9A 1G2HA 5GPAA 2L7ZA 4A3GJ 1BJZA 3BTLA 2MGQA 1HCRA 1GV2A 3E7LA 1WCMJ 2ID6A 3G1LA 3OSFA 3GTPJ 5FKMA 1FJLA 3ZQIA 4MLOA 5F0CA 3BR2A 2FJ1A 2DMPA 3GTGJ 1FTZA 1HDPA 2YS9A 2DA2A 2R92J 4BXXJ 2MSYA 3OIOA 2JJ7A 2B63J 5JLWA 3GTLJ 2NS7A 3CQZJ 4JX5A 1X58A 3BTIA 1T33A 2X48A 1JTYA 1UHSA 5GP9A 1D5YA 2DA3A 2EZIA 3IV5A 1IC8A 2ID3A 5IYCJ 3I4MJ 1QRYA 2FQ4A 1Y1WJ 2EZHA 2H8RA 2WB1N 1PUFA 1LFUP 1OCPA 5C4XJ 1I50J 4D5CA 2K40A 2Y31A 1SFOJ 2K9QA 5EYRA 1YRNA 2E2IJ 2P81A 3NAUA 5E3LA 2WV1A 9ANTA 4B1RA 1ETVA 3JRBA 5F0HA 1GUUA 1WH5A 3NARA 3TW6A 5EGOA 1JKPC 1MSFC 2JA8J 4RBOA 2XGCA 5K7HA 1JKRC 2CUFA 4AYBN 5K7ZA 4DYRA 1Q1VA 2LLKA 4XK4A 4A3JJ 1ZTRA 3S1MJ 1JKQC 3GTKJ 4JX4A 2OF7A 5E3OA 2DMTA 3GTMJ 1LE8A 1APLC 4DZPA 3PO3J 2LR8A 2ME6A 4FCYA 1VF9A 4XICA 2JWTA 1Z77A 3S16J 2XPVA 2FX0A 1BW6A 3CDLA 2E1OA 2G0EA 2E2HJ 3MKLA 1NK3P 1B72B 1QVTA 4C3JJ 3SJMA 2Y30A 1O4XA 3OOUA 4I76A 3JREA 1IUFA 1RPWA 4UUTA 4AUXA 3JRIA 3HOUJ 4BY7J 4B4CA 4A3MJ 3HDDA 4ABZA 2JA5J 3S1NJ 1ETKA 2Y2ZA 4M3GA 2XRLA 1ZQ3P 3JRFA 4NDLA 3ZQLA 3S15J 2HI3A 1AU7A 3F0CA 2Y9YA 3S2HJ 3HBLA 1AKHA 1K61A 1WI3A 4XRMA 1BA5A 2ZB9A 5EG0A 4GFBA 4IHWA 1ETOA 4HNVA 1ZK8A 1TC3C 3HB9A 4UUSB 1HLVA 1MH4A 5IYDJ 3FK6A 1H89C 5EDNA 1ETYA 3I4NJ 2JK3A 3A02A 5M5WJ 3BR0A 4M3DA 1ETXA 3PO2J 2D5VA 5IOYA 2HXIA 5FKOA 4M6VA 2LK2A 1U78A 2NS8A 2CJJA 1FIPA 3CCYA 5FLMJ 5F08A 1RESA 3HKZN 2R5YB 1F43A 5EEAA 2E19A 5J1YA 3QPLA 2XPUA 1MBFA 1Z0XA 2TCTA 5IPAA 1FTTA 2IBDA 2YU9J 3HOZJ 5HODA 1JJ8C 4JP0A 4DW6A 3IH4A 3TP0A 3WHBA 4RDUA 1XC5A 2DMQA 4IHXA 4MFEA 2DA1A 2GLOA 1IRZA 2GM4A 2NVQJ 4C3IJ 3RKQA 2DA6A 3SDGA 1IG7A 4MO7A 3LSJA 1JTXA 5FKNA 1MBEA 4X1EA 3SFIA 5F27A 1MNMC 3A01B 1I6HJ 2CRGA 5EZHA 4DYQA 1U8BA 2CU7A 5C3EJ 2O8KA 2GBYA 1ZKGA 3K2AA 3G1MA 3ZOBA 4AC0A 1SANA 4CYCB 1JT0A 5FKLA 2LVSA 1S7EA 2EQRA 1VFCA 1TWHJ 1ITYA 5M5YJ 5C4JJ 3HOWJ 3GTOJ 1IDYA 1JKOC 2O9LA 5BNGA 3ZQHA 1JT6A 3H3VK 4QIWN 2WAQN 4Y7NJ 1VNDA 4A3FJ 2JA7J 4BY1J 3Q0WA 5IP9J 3JRCA 3GTQJ 1EF4A 1MBHA 2XB0X 3BQZA 4BBRJ 1XG1A 2VPRA 1B8IA 1TWAJ 2MG4A 3BR1A 1ORKA 2NVTJ 2W48A 3FKIJ 2DTZA 4IHYA 1TWGJ 4G12A 2R5ZA 4BKXA 3C2BA 1MSEC 1FEXA 4UUSA 1DU6A 4QSHA 3BR6A 2VUMJ 2HDDA 2ECBA 1H8AC 3MN2A 2L0KA 2N8GA 1ZGWA 3GBGA 4MIMA 3D1NI 4JX6A 4XIDA 3LNQA 2HOSA 2EH3A 5FKKA 1IGNA 1MBGA 1PUFB 2TRTA 3S2DJ 2HQ5A 3TW7A 2JN6A 4M3EA 2K9SA 3BTJA 5F1JA 3FK7A 1YRNB 2VKEA 1X2MA 3MVPA 4C2MJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZL A;  4A3C J;  3HM5 A;  4FTH A;  5C44 J;  5E3M A;  2NVY J;  5EGO B;  3JR9 A;  1GVD A;  1MBJ A;  2M9H A;  4D5F A;  2QF7 A;  3LOC A;  2VI6 A;  5E3N A;  1BW5 A;  3BG3 A;  1AHD P;  2LFB A;  4M3B A;  4A3E J;  1TWF J;  2ME0 A;  1WGX A;  4L5E A;  1H88 C;  3M4O J;  2OPT A;  1GV5 A;  1LE8 B;  2RAE A;  3S17 J;  1GT0 C;  4BBS J;  1POG A;  4FE4 A;  4W97 A;  2LTP A;  3BG5 A;  3Q0U A;  1E3O C;  2H1K A;  4XRS A;  1ZR4 A;  2AO9 A;  3ZQG A;  1P7I A;  3TED A;  1BL0 A;  3VPR A;  2DA5 A;  3A03 A;  4D7M A;  1JUS A;  3S1Q J;  4A3K J;  1HOM A;  1F36 A;  3RQI A;  3RZO J;  3JRA A;  1VI0 A;  1LFB A;  2CUE A;  3DEW A;  2R0Q C;  2IAI A;  3O8G A;  2HYJ A;  2M34 A;  4LOC A;  4X6A J;  2LP0 A;  2YUS A;  2O7O A;  4C3H J;  3ZQF A;  5FLV A;  5FJ8 J;  1U9O A;  3QPS A;  1OCT C;  1CQT A;  3PM1 A;  4B3A A;  2CQQ A;  2MW8 A;  2ELK A;  3JRD A;  5F0F A;  5J3L A;  1P7J A;  4V2G A;  1Y1V J;  2E2J J;  4FIS A;  1JGG A;  2L7F P;  3W6V A;  1JUP A;  2XGE A;  3JRG A;  1QVU A;  3HEF A;  1I3Q J;  3M3Y J;  5GPC A;  3IH2 A;  3HOV J;  1AKH B;  2JA6 J;  2PMZ N;  2EZK A;  5EG0 B;  2M0C A;  2R7Z J;  2X9D A;  1JUM A;  2KT0 A;  1WH7 A;  3Q0V A;  2QCO A;  4DYC A;  4Y52 J;  1A5J A;  3BTC A;  4A69 C;  2DN0 A;  3H0G J;  1A6I A;  3HOX J;  1B72 A;  2R93 J;  5IOZ A;  3HOY J;  3B6A A;  4S0H B;  3BG9 A;  3BQY A;  3K7A J;  2HXO A;  3RZD J;  3CMY A;  2DMU A;  3G1O A;  3LSP A;  2L7M P;  2HOT A;  4A3B J;  2KDZ A;  4DZJ A;  5J1U A;  4QTR A;  4V2F A;  3QQA A;  3ZQC A;  2HOA A;  1ZR2 A;  2XB5 A;  1TWC J;  3Q3S A;  2XGD A;  3DCF A;  4A3L J;  1R9T J;  1ETQ A;  2CQX A;  2LY9 A;  2COB A;  4A3I J;  3B6C A;  3LSG A;  2XSD C;  2VKV A;  2LD5 A;  2FD5 A;  3IH3 A;  1W0U A;  4IEJ A;  4A93 J;  4IHV A;  1IJW C;  1MH3 A;  1FIA A;  5M3F J;  1XS9 A;  5F04 A;  1X2N A;  1OJL A;  1U9N A;  2AHQ A;  5EF6 A;  2DJN A;  1IDZ A;  4A3D J;  2R5Y A;  1RKT A;  3HGY A;  3TP3 A;  5IP6 A;  1K83 J;  5M3M J;  3BR3 A;  4XRS G;  2I10 A;  5K7F A;  1NK2 P;  3GTJ J;  1ETW A;  4D7N A;  2Y9Z A;  2X6O A;  4EEF G;  2Y0S N;  4M3F A;  3HGG A;  1HF0 A;  3S14 J;  2JMW A;  4J19 A;  3L1P A;  3LSR A;  4I6Z A;  2IEK A;  4FE7 A;  5DS9 A;  2M2E A;  2XPW A;  1MBK A;  1T56 A;  2NVX J;  1WPK A;  2DMN A;  1RET A;  2M8G X;  1RKW A;  1RR7 A;  2NOG A;  1IV6 A;  5IP7 J;  1GDT A;  3JRH A;  3S1R J;  1HDD C;  5IYB J;  4JYK A;  2DA4 A;  1W0T A;  5EZG A;  1OFC X;  4MFD A;  3FIW A;  4W1U A;  1B8I B;  5DTD A;  5JLX A;  3A01 A;  2EBI A;  2LKX A;  2ECC A;  3WHC A;  5M5X J;  1UG2 A;  2R5Z B;  2DA7 A;  3O8H A;  2L9R A;  3BR5 A;  1JJ6 C;  1NTC A;  1UMQ A;  3UKG A;  1DU0 A;  4CYC A;  3OSG A;  3FIS A;  2K9N A;  1ENH A;  1QPI A;  5J1R A;  3BT9 A;  1G2H A;  5GPA A;  2L7Z A;  4A3G J;  1BJZ A;  3BTL A;  2MGQ A;  1HCR A;  1GV2 A;  3E7L A;  1WCM J;  2ID6 A;  3G1L A;  3OSF A;  3GTP J;  5FKM A;  1FJL A;  3ZQI A;  4MLO A;  5F0C A;  3BR2 A;  2FJ1 A;  2DMP A;  3GTG J;  1FTZ A;  1HDP A;  2YS9 A;  2DA2 A;  2R92 J;  4BXX J;  2MSY A;  3OIO A;  2JJ7 A;  2B63 J;  5JLW A;  3GTL J;  2NS7 A;  3CQZ J;  4JX5 A;  1X58 A;  3BTI A;  1T33 A;  2X48 A;  1JTY A;  1UHS A;  5GP9 A;  1D5Y A;  2DA3 A;  2EZI A;  3IV5 A;  1IC8 A;  2ID3 A;  5IYC J;  3I4M J;  1QRY A;  2FQ4 A;  1Y1W J;  2EZH A;  2H8R A;  2WB1 N;  1PUF A;  1LFU P;  1OCP A;  5C4X J;  1I50 J;  4D5C A;  2K40 A;  2Y31 A;  1SFO J;  2K9Q A;  5EYR A;  1YRN A;  2E2I J;  2P81 A;  3NAU A;  5E3L A;  2WV1 A;  9ANT A;  4B1R A;  1ETV A;  3JRB A;  5F0H A;  1GUU A;  1WH5 A;  3NAR A;  3TW6 A;  5EGO A;  1JKP C;  1MSF C;  2JA8 J;  4RBO A;  2XGC A;  5K7H A;  1JKR C;  2CUF A;  4AYB N;  5K7Z A;  4DYR A;  1Q1V A;  2LLK A;  4XK4 A;  4A3J J;  1ZTR A;  3S1M J;  1JKQ C;  3GTK J;  4JX4 A;  2OF7 A;  5E3O A;  2DMT A;  3GTM J;  1LE8 A;  1APL C;  4DZP A;  3PO3 J;  2LR8 A;  2ME6 A;  4FCY A;  1VF9 A;  4XIC A;  2JWT A;  1Z77 A;  3S16 J;  2XPV A;  2FX0 A;  1BW6 A;  3CDL A;  2E1O A;  2G0E A;  2E2H J;  3MKL A;  1NK3 P;  1B72 B;  1QVT A;  4C3J J;  3SJM A;  2Y30 A;  1O4X A;  3OOU A;  4I76 A;  3JRE A;  1IUF A;  1RPW A;  4UUT A;  4AUX A;  3JRI A;  3HOU J;  4BY7 J;  4B4C A;  4A3M J;  3HDD A;  4ABZ A;  2JA5 J;  3S1N J;  1ETK A;  2Y2Z A;  4M3G A;  2XRL A;  1ZQ3 P;  3JRF A;  4NDL A;  3ZQL A;  3S15 J;  2HI3 A;  1AU7 A;  3F0C A;  2Y9Y A;  3S2H J;  3HBL A;  1AKH A;  1K61 A;  1WI3 A;  4XRM A;  1BA5 A;  2ZB9 A;  5EG0 A;  4GFB A;  4IHW A;  1ETO A;  4HNV A;  1ZK8 A;  1TC3 C;  3HB9 A;  4UUS B;  1HLV A;  1MH4 A;  5IYD J;  3FK6 A;  1H89 C;  5EDN A;  1ETY A;  3I4N J;  2JK3 A;  3A02 A;  5M5W J;  3BR0 A;  4M3D A;  1ETX A;  3PO2 J;  2D5V A;  5IOY A;  2HXI A;  5FKO A;  4M6V A;  2LK2 A;  1U78 A;  2NS8 A;  2CJJ A;  1FIP A;  3CCY A;  5FLM J;  5F08 A;  1RES A;  3HKZ N;  2R5Y B;  1F43 A;  5EEA A;  2E19 A;  5J1Y A;  3QPL A;  2XPU A;  1MBF A;  1Z0X A;  2TCT A;  5IPA A;  1FTT A;  2IBD A;  2YU9 J;  3HOZ J;  5HOD A;  1JJ8 C;  4JP0 A;  4DW6 A;  3IH4 A;  3TP0 A;  3WHB A;  4RDU A;  1XC5 A;  2DMQ A;  4IHX A;  4MFE A;  2DA1 A;  2GLO A;  1IRZ A;  2GM4 A;  2NVQ J;  4C3I J;  3RKQ A;  2DA6 A;  3SDG A;  1IG7 A;  4MO7 A;  3LSJ A;  1JTX A;  5FKN A;  1MBE A;  4X1E A;  3SFI A;  5F27 A;  1MNM C;  3A01 B;  1I6H J;  2CRG A;  5EZH A;  4DYQ A;  1U8B A;  2CU7 A;  5C3E J;  2O8K A;  2GBY A;  1ZKG A;  3K2A A;  3G1M A;  3ZOB A;  4AC0 A;  1SAN A;  4CYC B;  1JT0 A;  5FKL A;  2LVS A;  1S7E A;  2EQR A;  1VFC A;  1TWH J;  1ITY A;  5M5Y J;  5C4J J;  3HOW J;  3GTO J;  1IDY A;  1JKO C;  2O9L A;  5BNG A;  3ZQH A;  1JT6 A;  3H3V K;  4QIW N;  2WAQ N;  4Y7N J;  1VND A;  4A3F J;  2JA7 J;  4BY1 J;  3Q0W A;  5IP9 J;  3JRC A;  3GTQ J;  1EF4 A;  1MBH A;  2XB0 X;  3BQZ A;  4BBR J;  1XG1 A;  2VPR A;  1B8I A;  1TWA J;  2MG4 A;  3BR1 A;  1ORK A;  2NVT J;  2W48 A;  3FKI J;  2DTZ A;  4IHY A;  1TWG J;  4G12 A;  2R5Z A;  4BKX A;  3C2B A;  1MSE C;  1FEX A;  4UUS A;  1DU6 A;  4QSH A;  3BR6 A;  2VUM J;  2HDD A;  2ECB A;  1H8A C;  3MN2 A;  2L0K A;  2N8G A;  1ZGW A;  3GBG A;  4MIM A;  3D1N I;  4JX6 A;  4XID A;  3LNQ A;  2HOS A;  2EH3 A;  5FKK A;  1IGN A;  1MBG A;  1PUF B;  2TRT A;  3S2D J;  2HQ5 A;  3TW7 A;  2JN6 A;  4M3E A;  2K9S A;  3BTJ A;  5F1J A;  3FK7 A;  1YRN B;  2VKE A;  1X2M A;  3MVP A;  4C2M J; 
#chains in the Genus database with same CATH topology
 3M9A A;  2HNH A;  3ABT A;  2F2E A;  2VQL A;  3Q5F A;  1HC8 A;  3KIO A;  4KFC A;  4N0B A;  4DIQ A;  4BAY A;  4EV0 A;  4HX7 A;  1PJR A;  2PLY A;  5AIQ A;  5FD6 A;  2HQR A;  4DBR A;  1ZG1 A;  2VQH A;  3JAM Z;  4I01 A;  2KPM A;  4MEY F;  2OUM A;  2M87 A;  2M7B A;  4F55 A;  5KHD A;  1HW5 A;  2WTE A;  1LE8 B;  4PJ0 C;  2VJ4 A;  3PJR A;  2FML A;  4W97 A;  3Q0U A;  2WY8 Q;  4ESB A;  1IN8 A;  1O57 A;  2WC2 A;  3HPG A;  3ZQG A;  3WU1 B;  3FF5 A;  4KIS A;  4G9Y A;  2L7K A;  1T8I A;  3V4G A;  2FSW A;  1TP4 A;  1JHH A;  2DA5 A;  1B1B A;  3A03 A;  5BS6 A;  4D7M A;  1PYV A;  4A3K J;  2QA4 I;  2Q8K A;  1Y56 A;  2PI0 A;  2ZBK A;  2XGX A;  1BI1 A;  3CUO A;  1IXR C;  3MEX A;  4P96 A;  3QOD A;  4LOC A;  2O7O A;  2X4H A;  3KYD B;  5FLV A;  3FZV A;  1UAA A;  2GAU A;  1TL8 A;  2PJP A;  3GW2 A;  4I0A A;  4BE2 A;  4B3A A;  4BEH B;  4V2G A;  3WTY C;  1MMG A;  3F9K A;  3HEF A;  2MH2 A;  3JW4 A;  3K4L A;  3K70 C;  5LGN A;  3FM5 A;  1I3Q J;  3RJP A;  3IH2 A;  3BPV A;  2CMP A;  2W82 A;  5DEQ A;  2K4B A;  5DM6 F;  2DXI A;  4S04 A;  2X9D A;  1FOY A;  4A0X A;  4LIV A;  4CDG A;  3HSR A;  4A69 C;  2UUZ A;  1ZLK A;  4B47 A;  2R7F A;  3H0G J;  5L3C A;  1S7O A;  3OY9 A;  3CES A;  2CV1 A;  2JTV A;  3B6A A;  3BJ6 A;  3RKY A;  2A3S A;  2QLZ A;  3BQY A;  3E6M A;  4IX7 A;  3K7A J;  3G1O A;  3GWZ A;  5DD8 A;  1SD6 A;  2KFD A;  1SAU A;  3V8J A;  4FAS D;  4BDY A;  4D1Q A;  1OCR H;  4P1W A;  2DT6 A;  3OYM A;  5K1Y A;  3LA2 A;  3VEP A;  2F4O B;  3GUD A;  2BYV E;  2VXD A;  1VQL I;  2LRD A;  2A61 A;  2XGD A;  1V5F A;  2VKH A;  3DCF A;  4A5M A;  1R9T J;  1STZ A;  1UFM A;  3EYI A;  4CH7 A;  3RPQ A;  3U2R A;  1YW7 A;  1D1C A;  2LG4 A;  2VKV A;  2DCE A;  3IH3 A;  3KYL A;  3H9J A;  4KJZ A;  3TDZ C;  2ZXH A;  4RB0 A;  1X2N A;  1F4K A;  2R7R A;  1U9N A;  5EF6 A;  2DJN A;  3K69 A;  5KCM A;  3ZMT A;  2R5Y A;  1HW2 A;  2VC1 A;  1YQA A;  2P7V B;  3BZ6 A;  3K4C A;  1MMS A;  1R1U A;  2I10 A;  4XRS G;  3PSI A;  4GGG A;  4A6E A;  4IOC F;  4E7L A;  2FBH A;  4I98 B;  1B4A A;  3TOA A;  4GXO A;  2Y0S N;  3CDH A;  4O5V A;  1WFX A;  2KL4 A;  3DEU A;  4J19 A;  1YJN I;  1J09 A;  2XHK A;  3L1P A;  3LSR A;  4FE7 A;  5IY5 H;  2XPW A;  3H5R A;  2X6W A;  3M1E A;  1KYZ A;  3RPU D;  5H2F C;  3KZY A;  5CQG A;  2D1V A;  4YRV A;  4ON0 A;  2KIF A;  2DO7 A;  4QWQ A;  2VBW A;  1S8N A;  2ELJ A;  2Q2E B;  3S1R J;  1B8I B;  4LFU A;  5DTD A;  1ZHF A;  2EBI A;  2EPF A;  2HQA A;  2RV8 A;  3DPT A;  4M71 A;  2ECC A;  4LIT A;  3WHC A;  1VQP I;  1UG2 A;  1Y39 A;  3LSI A;  3HPH A;  2QBY A;  3BCA A;  2E7W A;  1FMV A;  1ZAR A;  5LLQ A;  2ACJ A;  1JJ6 C;  1NTC A;  1UMQ A;  2K7L A;  1BI0 A;  3CTA A;  4UY8 I;  2K3F A;  3A4C A;  3OS1 A;  4HST A;  3OSG A;  3KEY A;  4MHG A;  2E1N A;  2DJI A;  4IHT A;  4EJT A;  1Z7L A;  2VBZ A;  4AU7 A;  1QPI A;  3BT9 A;  2KRH A;  1G2H A;  2LY2 A;  4A3G J;  5D6E A;  4RB3 C;  1IO2 A;  1ERD A;  3ULQ B;  2L01 A;  5FKM A;  3VDX A;  1FJL A;  1Z05 A;  2EWN A;  2H09 A;  2V1U A;  2O8X A;  4MLO A;  3BJO A;  2DMP A;  5IT9 K;  5AON A;  4KIT B;  1ZRD A;  3SZT A;  1A36 A;  2R92 J;  2P8T A;  2CQK A;  3TL4 X;  5AIP A;  3PQK A;  1E2X A;  3AG2 H;  1ZGJ A;  3IC7 A;  5E8G A;  3HXL A;  1X58 A;  2WBM A;  1TQP A;  2X1D A;  4NQW A;  5HLH A;  3FM3 A;  3FWE A;  3FXM A;  1X19 A;  1Z6T A;  2LMD A;  3Q9V A;  1T98 A;  2H8R A;  2WB1 N;  2X1E A;  5LGT A;  1LFU P;  5C4X J;  4UNO A;  4D5C A;  1CGP A;  2K40 A;  3DPL C;  4UVC A;  1S9H A;  2PMH A;  2ZO4 A;  3OWT A;  4XNF A;  2LBF B;  4MNU A;  4Y4R A;  4YFX F;  4YEJ A;  5E3L A;  9ANT A;  2A5Y B;  2Y48 A;  1GUU A;  1JKP C;  1MSF C;  5EGO A;  1FOW A;  5L3G A;  4RGU A;  4RS8 A;  4HF0 A;  4M9Z A;  5K7Z A;  4XK4 A;  1J0R A;  3S1M J;  3EYY A;  3SQN A;  2YR2 A;  3CJQ B;  2HVQ A;  3IHU A;  4KIG A;  4UHT A;  1HA8 A;  2BHZ A;  4OIN F;  2LKP A;  3N4M A;  3D5L A;  2DMT A;  3C18 A;  2PG4 A;  4M74 A;  1APL C;  2PJR A;  1ONV A;  1XMK A;  2DDB A;  2Z33 A;  4M9S A;  3P5J A;  2FOK A;  3U1K A;  4H4K C;  3DTK A;  2ME6 A;  2OBP A;  3LSK A;  2E71 A;  5HDN A;  2A6T A;  1YS7 A;  3GZ6 A;  1R22 A;  2XPV A;  1B59 A;  3DKY A;  2IS6 A;  1BW6 A;  1KA8 A;  1JI8 A;  3ROU A;  4E7I A;  1A6Q A;  1EKE A;  3LA3 A;  2E7X A;  1USS A;  4KNY A;  3OR1 C;  2IS1 A;  3OOP A;  3NQO A;  5CVJ A;  2MAB A;  4IHS A;  3QYE A;  1QVT A;  5ED4 A;  3DU6 A;  2Y30 A;  3W6J B;  3DXJ F;  3JRE A;  1QU3 A;  1IUF A;  1FYL A;  1I1S A;  4B4C A;  5HS9 A;  1SD5 A;  1K4S A;  3HDD A;  3KP5 A;  3J80 Z;  3F6O A;  4HDV A;  4ZJZ A;  2TDX A;  1VQN I;  2BY1 A;  3HL2 A;  2JA2 A;  2DT5 A;  5E1X A;  4NDL A;  5FD5 A;  1L3L A;  1R71 A;  5DD4 A;  1R58 A;  3KPH A;  2H1L A;  2Y9Y A;  3S2H J;  1GVJ A;  5LEJ A;  1YHQ I;  4E7H A;  1AKH A;  4WWC A;  4MQV A;  3OIQ A;  4KIC A;  3R0J A;  4AM3 A;  5TIS C;  1BA5 A;  3P9I A;  1XSX A;  1Z7U A;  2DFI A;  4IHW A;  1TC3 C;  3LSM A;  1O3T A;  3H9G A;  1KGS A;  2FRH A;  2IW5 A;  5B3S H;  1BR2 A;  4E7J A;  4BU2 A;  1W7P D;  4EJV A;  4QLC U;  1YFH A;  3HJE A;  2ZJP F;  5HS8 A;  1XGN A;  2QSH X;  1X3U A;  3IRQ A;  4R1H A;  3BDD A;  4M3D A;  3RIR A;  5IOY A;  1OIS A;  2F5C A;  2CUZ A;  2XAF A;  4M6V A;  1G6N A;  1XGM A;  2LRE A;  2L5Q A;  4ZYA A;  5FLM J;  4XLP F;  3HUG A;  2LKS A;  5E17 F;  1F43 A;  2YSR A;  3FBN B;  4AVZ A;  2O0Y A;  5EEA A;  3LST A;  5ERI A;  5F6F A;  3ZMD A;  1MBF A;  3QPH A;  4C30 A;  4A0Z A;  3L2C A;  5IPA A;  1SMY F;  1FYK A;  4B44 A;  4GO1 A;  1MIJ A;  2P5L C;  1VTN C;  4JP0 A;  5BOX A;  1MJA A;  2OD5 A;  3ABU A;  3GEZ A;  3TP0 A;  5F1R A;  3REO A;  4XKV A;  1I3A A;  1IN5 A;  2VE8 A;  4IHX A;  2XAQ A;  1KU3 A;  5D8L B;  4MFE A;  3DEE A;  1QA6 A;  3KLO A;  1YE9 A;  1MGT A;  1P6R A;  1BR1 A;  3NWS A;  4MO7 A;  3LSJ A;  1JTX A;  2V9K A;  5FKN A;  3CCS I;  1MBE A;  3R60 A;  3I53 A;  2HGC A;  2LF7 A;  1Z67 A;  1FYM A;  3GFI A;  1MJB A;  1MNM C;  3ZN0 A;  2BBY A;  3O3K A;  2WA0 A;  5HLI A;  2K3P A;  4Q5S F;  2R3S A;  2HYG D;  4DYQ A;  4EQQ A;  1U8B A;  2CU7 A;  3CC4 I;  2NS0 A;  1MNE A;  4OAZ A;  5DDG A;  5DUI A;  3MZH A;  3KE2 A;  4KIB A;  1ZKG A;  2E1C A;  3G1M A;  1YI2 I;  3IWF A;  2ZNZ A;  2CW7 A;  1U3E M;  5ILU A;  2LVS A;  1S7E A;  2EQR A;  2VPL A;  1TT0 A;  5ILV A;  1JKO C;  3H5A A;  2O9L A;  5BNG A;  3CMM A;  5H6R A;  2WAQ N;  4I02 A;  1D8J A;  3NWT A;  3Q0W A;  2GQQ A;  4II3 A;  3WGI A;  1G8X A;  2VN2 A;  3FXJ A;  3K2Z A;  4ENK A;  1R5G A;  3PUF A;  2QQB A;  4CCK A;  3T8T A;  4L9N A;  1OLT A;  3K6G A;  4B09 A;  1FMW A;  2NVT J;  4DJA A;  3MZ8 A;  1IF1 A;  3AL0 B;  1X1D A;  3EUH C;  3OR2 C;  4YIR X;  3BOQ A;  1SC7 A;  3OYB A;  2R5Z A;  3L00 A;  2E34 A;  2H6B A;  2H94 A;  4QSH A;  3BR6 A;  3ZR8 X;  4HOB A;  3D5R C;  3PQJ A;  3FXQ A;  2N8G A;  2MD0 A;  4U0W A;  4ZDP A;  1FBU A;  2WY7 Q;  3D1N I;  5FO5 A;  1O3S A;  1FP2 A;  1IN6 A;  2DQL A;  5ICC A;  2HOS A;  1LPQ A;  5FKK A;  2OQR A;  1Z3Y A;  3X2Q H;  2ZCW A;  2JSC A;  2TRT A;  3U9G A;  1A31 A;  2QSG X;  4O3M A;  1GHC A;  4LB6 B;  3CDI A;  1YS6 A;  2L54 A;  2Z2S B;  4M3E A;  4F3Q A;  3SFZ A;  3MVP A;  3QRF F;  2EZL A;  4A3C J;  3HM5 A;  4TV7 A;  3GZN B;  5C44 J;  5E3M A;  1V55 H;  4HLX A;  4YII A;  1GVD A;  2R7S A;  2UZK A;  4AYB A;  3MD2 A;  4EMS A;  1MDM B;  1J75 A;  4E7Z A;  1NG7 A;  2QF7 A;  2VI6 A;  3VYR B;  2M0M A;  2CO5 A;  3BG3 A;  1AHD P;  4AVP A;  4LMY A;  4M3B A;  2JUG A;  1TWF J;  2P5V A;  2BGC A;  4OWR B;  3OYE A;  3IP4 B;  1Y8Q B;  2OPT A;  3OV8 A;  1GV5 A;  5JFR A;  4L18 B;  3DLL F;  2RAE A;  4FE4 A;  2LTP A;  4N9I A;  2AO9 A;  1P7I A;  4PJN A;  4AIK A;  3TED A;  4IJA A;  2KDO A;  4KUM A;  3VPR A;  1K78 B;  2DFE A;  3I56 I;  3FX3 A;  4HEA 2;  3RQI A;  4LLL A;  2OTL I;  4ZTJ A;  1LFB A;  2FE3 A;  3VSL A;  2VOO A;  2CQN A;  3RPU A;  2ESH A;  2YUS A;  4XOP A;  3JTH A;  2W00 A;  5CQE A;  2F48 A;  3BZK A;  2HVR A;  2KJB A;  4NC6 A;  5B1A H;  3QPS A;  2DYR H;  4U7D A;  1OCT C;  1CQT A;  3PM1 A;  1S5L C;  3ZN1 A;  2JVH A;  4KT6 A;  2HKX A;  2O03 A;  1MZB A;  4G94 A;  1RNL A;  1BM9 A;  5F0F A;  3ZGK A;  4L0Z B;  2UXX A;  1LVA A;  2E2J J;  4FIS A;  1JGG A;  2R4G A;  2L7F P;  1N78 A;  2W1O A;  1JUP A;  3HG9 A;  4CCL A;  2FMY A;  5H6Q A;  3G3Z A;  4J01 A;  5DCM A;  5KAI C;  2EA4 A;  3OMY A;  4ESF A;  4CCM A;  2B7E A;  1T95 A;  2JA6 J;  3QP5 A;  2PMZ N;  1IXC A;  4PGH A;  3CLO A;  3WU2 C;  5EG0 B;  3PUB A;  4KA4 A;  4OIO F;  2M0C A;  2HFH A;  3MCZ A;  2HQN A;  3MZY A;  4Y52 J;  2LYC A;  1X3W B;  2OA4 A;  1TQM A;  2VOP A;  5GAD J;  3VYS B;  4RGX A;  5IOZ A;  1TBX A;  3HOY J;  3TKY A;  1WQ2 A;  4LJZ F;  4S0H B;  3BG9 A;  2XKO A;  1MND A;  2K02 A;  3WU0 A;  4IO9 F;  1DP7 P;  1ZYR F;  2DMU A;  3CJN A;  3BP8 A;  2H6C A;  4HRI A;  4IPA A;  4OIP F;  1BN5 A;  2JRM A;  4JBA A;  1SVO A;  4J00 A;  2VBY A;  1LVK A;  2ISY A;  4LGW A;  2KDZ A;  4RAF A;  1DGW Y;  4LB5 A;  4QTR A;  3KP4 A;  2O5R A;  4RA2 A;  4UB6 C;  3ESW B;  3LSH A;  1ZR2 A;  2XB5 A;  2GXA A;  1V5E A;  4YG2 F;  1TWC J;  2LH9 A;  3HOT A;  3OYK A;  2CQX A;  5J8F A;  2LY9 A;  3WG7 H;  3VOD A;  2COB A;  3PFI A;  2F6C A;  2ZNY A;  4FET A;  3KX2 A;  2XSD C;  1W0U A;  2YX4 A;  4A93 J;  2K27 A;  3DU5 A;  5D8K B;  4DBQ A;  3I59 B;  2VB6 A;  1IJW C;  4HQE A;  5JR3 A;  2K5C A;  2KLO A;  4X0G A;  1FX7 A;  5JHF A;  1OJL A;  1OMI A;  2Z3Y A;  2STT A;  3FMQ A;  2PMZ A;  1IDZ A;  3HRS A;  3IRR A;  4A3D J;  1UB9 A;  3TP3 A;  1X1B A;  3DBR B;  3BR3 A;  1FOK A;  4P9F A;  4XL9 A;  1DDN A;  1NG6 A;  1ETW A;  4YFN F;  2V79 A;  1JHF A;  3IWZ A;  2KIS A;  3G6E I;  1FNN A;  2X6O A;  2DQR A;  1WVR A;  4HX8 A;  4Q48 A;  5GAG J;  4EGY A;  2JMW A;  1T39 A;  4U88 A;  2IEK A;  2JRT A;  5DS9 A;  4RGS A;  2NVX J;  1XB4 A;  1WPK A;  1I39 A;  3K0L A;  4P55 A;  5CVV A;  1WJ5 A;  3GFJ A;  4XLF A;  1RKW A;  1ON2 A;  3ASO H;  2XDV A;  3A0B C;  2E1M B;  2L9S A;  1IV6 A;  2V1N A;  1GDT A;  3JRH A;  2GA1 A;  4MQ9 F;  4HYE A;  3PIO F;  1HDD C;  4AID A;  4LG3 A;  1OFC X;  3FIW A;  4BGD A;  3EET A;  1HKQ A;  3C7J A;  2XSJ C;  3A01 A;  1PUE E;  2QYO A;  4PJJ A;  3F72 A;  2RQP A;  3RQ4 A;  5M5X J;  2BVL A;  1LEA A;  4BNC A;  2M45 A;  1U5T A;  4B3X A;  3DV8 A;  2L3D A;  1I27 A;  1I1G A;  4HA8 A;  1OYI A;  4CYC A;  2HPI A;  3S3O A;  3CZ6 A;  4RB1 A;  2XKP A;  1ZAO A;  3FIS A;  4OOI A;  3KEO A;  1UJ8 A;  5IT9 Z;  3CMA I;  2DK5 A;  2BXZ A;  2ZXJ A;  3DTI A;  4EGZ A;  3CUQ A;  2EIM H;  2L7Z A;  2R7O A;  1BJZ A;  5BPI A;  2MGQ A;  3E7L A;  2R7D A;  1PP7 U;  1XGS A;  3MAJ A;  4LK1 F;  3W2W A;  3GME A;  2H27 A;  1WCM J;  4M73 A;  2VXZ A;  2GA2 A;  1WJF A;  3ZQI A;  3P7N A;  4OU0 A;  4WK8 F;  2IPQ X;  2GIZ A;  3ABM H;  1XPX A;  4ENJ A;  4IOA F;  2W85 A;  5GAH J;  1W7P A;  2DA2 A;  1T0F C;  2QZ8 A;  3EPZ A;  3PFY A;  3OIO A;  2L02 A;  4CSW A;  3K1P A;  3FXR A;  4JX5 A;  3ZMZ A;  2XAG A;  3BTI A;  2X48 A;  3SXY A;  3LFK A;  2BY0 A;  4MTE A;  4KIF A;  3I4M J;  1AWC A;  2DT7 B;  3ECO A;  3UR3 C;  1PUF A;  2PBI A;  2A6H F;  2HTJ A;  4OAY A;  6PAX A;  3RKW A;  1TNS A;  3BY6 A;  2RNJ A;  3EDP A;  3GF2 A;  3NRV A;  2K9Q A;  5EYR A;  2IVM A;  1ZEL A;  1UHM A;  3NAU A;  1N75 A;  2X6Y A;  2HOE A;  2OAZ A;  3AL0 C;  2OV7 A;  5F0H A;  1WH5 A;  3NAR A;  3PNY A;  2X6X A;  5CJ9 A;  2CFO A;  2JA8 J;  5K7H A;  1X4O A;  1JKR C;  2IS4 A;  3O6B B;  2CUF A;  5FFZ A;  2GIV A;  4HSR A;  2LLK A;  4A3J J;  2ZJR F;  3LQQ A;  5D5U B;  3M8J A;  3GTK J;  1HSJ A;  2E35 A;  1WJE A;  3PNV A;  4FX0 A;  3T1B A;  1SFU A;  2OF7 A;  4Q47 A;  1A04 A;  2KHM A;  3H1C A;  2QQA A;  1H9T A;  3J81 K;  3GTM J;  2HYF A;  1LDJ A;  1ZLJ A;  4DZP A;  3PO3 J;  4FCY A;  5BMZ A;  1PDN C;  2BHY A;  3DKX A;  3F8B A;  2JWT A;  3P9K A;  2P7C B;  3J7A O;  2IP2 A;  3S16 J;  2P6T A;  3MKW B;  2FX0 A;  3QOE A;  1RR8 C;  3CCE I;  1MD0 A;  3U21 A;  1HKS A;  2KQR A;  2XF7 A;  4G6T B;  1K79 A;  4HF1 A;  3OYD A;  1YW9 A;  2E2H J;  2GXG A;  2VIX A;  5TJJ A;  3N97 A;  3CJR B;  2A05 A;  4E7S A;  3HHH A;  2FNP A;  4C3J J;  4I76 A;  2EK5 A;  4UUT A;  2G7H A;  4M6Y A;  3MQ0 A;  4BY7 J;  3JRI A;  2EFO A;  2OCC H;  4LG0 A;  4A3M J;  4ABZ A;  4C2U A;  4PSX A;  3VWB A;  1ETK A;  1UZC A;  1QPM A;  2XRL A;  4XR6 A;  1ZQ3 P;  1QZZ A;  3JRF A;  1H9G A;  3ZQL A;  4CYD A;  3S15 J;  1SFE A;  2HI3 A;  4BQN A;  4UVB A;  2KKO A;  1O3R A;  4QPO A;  2M5W A;  4XRM A;  1UCR A;  2E5N A;  1FP1 D;  4C2T A;  2A5W A;  2ZB9 A;  3CF5 F;  3FXU A;  3HB9 A;  4UUS B;  1TNT A;  1TW3 A;  4CZC A;  4BYY A;  4L5I A;  3WTX C;  5J4Y A;  2Z1D A;  2JK3 A;  2XAH A;  3A02 A;  4ZZD A;  4KDP A;  4IRG A;  2NYX A;  5L3D A;  5JVG F;  5M5W J;  4L0Y B;  2HKO A;  2K9L A;  4IKF A;  3F3X A;  2HXI A;  1LJ9 A;  1K7A A;  1VQ7 I;  4BJ5 C;  4HQM A;  3CCY A;  2XRO A;  1RES A;  2R5Y B;  2E19 A;  4UV8 A;  5J1Y A;  3K1M A;  3HIF A;  3QPL A;  4V19 K;  1Z0X A;  3JAM K;  3LFU A;  2TCT A;  3VYU B;  2O61 A;  2LBF A;  2PEX A;  3OIP A;  1NHA A;  3BPX A;  2Y0S A;  1FTT A;  1OR7 C;  1LUJ B;  3EUK L;  4NB5 A;  2YU9 J;  3HOZ J;  1S29 A;  1JJ8 C;  3ZXS A;  4DW6 A;  3IH4 A;  2WAD A;  3SZG A;  1QZE A;  4XSX F;  3PNT A;  2LC2 A;  4EJO A;  1D0Z A;  2DA1 A;  2VE9 A;  3R6S A;  2GLO A;  2LSO A;  1BC7 C;  2GM4 A;  4WF2 A;  2NVQ J;  4PJL A;  1T08 B;  1FBQ A;  4E7K A;  1R7J A;  2CW8 A;  4CGZ A;  1G3Y A;  3SFI A;  5F27 A;  2LOO A;  1Y6I A;  1Q1H A;  5CYV A;  2Q1Z B;  1I6H J;  5HDK A;  5FRO A;  2MLG A;  4BXF A;  3HHG A;  1XCV A;  1HXD A;  3VFZ A;  2QBY B;  1OYW A;  2A68 F;  2VJJ A;  1WJD A;  1MJ9 A;  2EV6 A;  3K2A A;  4CO8 A;  4EM2 A;  5L3E A;  3R0A A;  2QEN A;  1JT0 A;  3GX4 X;  2RRE A;  4XLE A;  4CCO A;  1CF7 A;  1DPR A;  1IDY A;  2CUJ A;  1JT6 A;  3H3V K;  3V8K A;  1D5V A;  3EQL F;  4XKB A;  4Y7N J;  4BL0 B;  2W25 A;  1G59 A;  4BY1 J;  2FU4 A;  2MA3 A;  2XAJ A;  4WXD A;  3JRC A;  3GTQ J;  1W5S A;  2XB0 X;  3FHZ A;  1SEU A;  4BBR J;  2WAE A;  3GFL A;  1XG1 A;  4AWX B;  2VPR A;  4FHT A;  2VL8 A;  3KZZ A;  4HG2 A;  4M72 A;  4ZYE A;  2FNA A;  1E3H A;  2FEZ A;  2DTZ A;  5DM7 F;  4IHY A;  4YIF A;  1L0O C;  4DGW B;  5JHU A;  3GYH X;  2NVU B;  5E8I A;  1VQ9 I;  2PN6 A;  1MSE C;  2OJE D;  1N25 A;  3I9V 2;  2HDD A;  2ECB A;  3OYI A;  3OL3 A;  1V54 H;  4IRI A;  2L0K A;  2M1B A;  2V6C A;  4NQW B;  2XV4 S;  4QPQ A;  1P4W A;  1ZGW A;  1YJ9 I;  4JX6 A;  1AOY A;  4II2 A;  1RUO A;  1H0M A;  4JQF A;  2EH3 A;  2WB1 A;  3H3U A;  3J7Z I;  5KK1 A;  2IS2 A;  4U87 A;  4NHJ A;  3E6B A;  4I99 C;  2E1M C;  2GOM A;  2E5Z A;  4ZDO A;  2JN6 A;  3FK7 A;  4GYI A;  5HNH A;  1B6A A;  2D45 A;  2VT3 A;  3SHF A;  3M7G A;  4RAG A;  3KP3 A;  1Z9C A;  3IAM 2;  5DV5 A;  4DOZ A;  2QQ9 A;  2VJ5 A;  5FLX K;  4XLC A;  1ON1 A;  3T5X A;  5EGO B;  3JR9 A;  2DOA A;  1MBJ A;  4CUG A;  2IT0 A;  2M9H A;  2DW4 A;  1TZL A;  4D5F A;  3LOC A;  3C2H A;  5F64 A;  2NNY A;  5E3N A;  3CCQ I;  2OZU A;  3DWL E;  3WGG A;  1S72 I;  2LFB A;  3ERE D;  2ME0 A;  2ZC2 A;  1WGX A;  4HAM A;  4L5E A;  5LHI A;  2FOW A;  3RSN A;  2STW A;  1H88 C;  2CSO A;  5D4R A;  4ZYH A;  3M4O J;  1BOB A;  2IA0 A;  4ASN A;  3D5S C;  2EFP A;  4BBS J;  1YX5 A;  2ZSI B;  3M07 A;  1E3O C;  4XRS A;  3DBH B;  4PCQ A;  3WTS C;  1ZRC A;  2J5P A;  2ZJ2 A;  2ZJQ F;  3ABL H;  1BL0 A;  1KYW A;  2RKH A;  5GAE J;  5CLS A;  1F36 A;  3L2W A;  5E18 F;  1Z1D A;  2FA5 A;  3DEW A;  2IAI A;  3O8G A;  3C2G A;  2FQ3 A;  2BE5 F;  3K4K A;  4A0Y A;  2LP0 A;  4C3H J;  1J9I A;  4BAC A;  2VBX A;  3ZQF A;  5FJ8 J;  4LLG F;  1U9O A;  4ENN A;  3FDY A;  4K2E A;  1WSU A;  4XMY A;  1IAW A;  4RAZ A;  2CQQ A;  3JSP A;  2Z5U A;  4CCJ A;  4L9J A;  2NNN A;  3KZI C;  2AQE A;  5J3L A;  1G3W A;  3JRD A;  5EEH A;  3CC2 I;  2XGE A;  2VKD A;  2D1H A;  3ZMU A;  3JRG A;  4JK1 X;  2FBK A;  3M3Y J;  1U0J A;  4XKC A;  2X51 A;  4G7H F;  2KIU A;  1AKH B;  2ELH A;  4RM2 A;  2EZK A;  1DQU A;  4CA0 A;  1K6O A;  1V5G A;  1JUM A;  3FXK A;  1BIB A;  3OYF A;  1WH7 A;  3S8P A;  1YX3 A;  2WAF A;  3BTC A;  3BG6 A;  1LNW A;  4CXF A;  3CCU I;  1S7A A;  1DUX C;  1ODD A;  3HOX J;  1A6I A;  1B72 A;  2R93 J;  1XTA A;  2F5E A;  3J7Y J;  3ZP5 A;  3C1D A;  4PSW A;  1VQO I;  2MC4 A;  3EUA A;  2QGU A;  3E97 A;  5BPD A;  5LFA A;  3HUG B;  3F6V A;  3JSO A;  4FX4 A;  3LSP A;  3ONQ A;  1FZP B;  2MYS A;  3DKW A;  1SD4 A;  2HVS A;  1G4D A;  3IKT A;  2HOT A;  4A3B J;  3GO5 A;  2DYS H;  1O7F A;  1K6Y A;  3SZP A;  4EJW A;  2ZSH B;  3I58 A;  5D4S A;  4NC7 A;  3QQA A;  4MTD A;  2HOA A;  2V6E A;  2NOJ B;  3QAH A;  3Q3S A;  2ICW G;  1MDM A;  1IW7 F;  3IL2 A;  4A3L J;  4C9Y A;  1F1Z A;  2X1C A;  4MGR A;  2ISZ A;  4A3I J;  1HQC A;  4IVN A;  1XX5 A;  3I3L A;  4IL6 C;  1I6X A;  5KVR A;  3B73 A;  3LAP A;  3RTR A;  2UXN A;  4LIU A;  3GZ5 A;  3V7S A;  2LNB A;  1MH3 A;  1FIA A;  2PFB A;  1XS9 A;  2VC0 A;  2ZKZ A;  2CWE A;  3CO7 C;  1OKR A;  2AHQ A;  4NC8 A;  1QGP A;  4F91 B;  1E17 A;  3HGY A;  3LMM A;  5IP6 A;  2W57 A;  5LRS A;  3AG3 H;  2HZT A;  1UEL B;  4BJ6 C;  2V1D A;  4PJM A;  2Y9Z A;  4I7H A;  3H9Q A;  4EEF G;  1HF0 A;  3HGG A;  3DLA A;  2EB7 A;  1WRJ A;  3S14 J;  1BIA A;  4N4N B;  2WAQ A;  1T56 A;  5HLG A;  3SDB A;  1GXQ A;  2BOL A;  4WXH A;  4XON A;  2DMN A;  1YG2 A;  3FXL A;  3H3Z A;  5FGM A;  1RR7 A;  3M1C A;  1SAX A;  5IP7 J;  4U7B A;  4RMN A;  4UV9 A;  2DK8 A;  4BUP A;  3K10 A;  5IYB J;  3HTU A;  2M4K A;  1W0T A;  2QQ8 A;  4RLQ A;  4W1U A;  3HTS B;  1OR7 A;  1KU7 A;  2CV0 A;  1UST A;  2R5Z B;  2P6S A;  5E20 A;  4BHB A;  3O8H A;  4KN4 X;  1A35 A;  4G6D A;  4A6D A;  4PK4 A;  3BR5 A;  4BQQ A;  1JE8 A;  3G2B A;  2XVC A;  1FWZ A;  3UKG A;  2L4M A;  4L5J A;  4E4H A;  1YTY A;  3ML6 A;  2QVO A;  2Q0O A;  1OYY A;  2G7U A;  2EFN A;  4YEL A;  4PUS A;  4WCG A;  1ENH A;  3CLQ A;  3ERM A;  1U6G A;  5J1R A;  1VQ6 I;  3JTG A;  1HCR A;  2K86 A;  2ZXI A;  3ASN H;  2ID6 A;  3G1L A;  5KNL A;  3OSF A;  3GTP J;  2BVM A;  1YOV B;  3OYC A;  4PFP A;  1VQK I;  2BEO A;  5F0C A;  3L2Q A;  2C6Y A;  4HLY A;  1RZ4 A;  3BR2 A;  2HS5 A;  1F9N A;  3Q9S A;  3V7C A;  3GTG J;  1WJC A;  2KZV A;  3TMO A;  3O2P E;  4XN3 A;  1BC8 C;  2JJ7 A;  1J7K A;  2GXB A;  2B63 J;  3H92 A;  1XSD A;  3GTL J;  3DQV C;  3CQZ J;  5FRN A;  5LGU A;  2HEO A;  1T33 A;  1UHS A;  5GP9 A;  2BY2 A;  3WTU C;  1D5Y A;  2A6E F;  3I59 A;  4PDK A;  3IV5 A;  1TW2 A;  5H20 A;  3OYJ A;  5GTI C;  1IC8 A;  1IRG A;  2DI3 A;  2ID3 A;  5IYC J;  1PP8 F;  3IUO A;  2I5U A;  3F22 A;  5FRM A;  4ZDL A;  3RYP A;  2OU2 A;  2XF5 A;  5IT3 A;  4EJU A;  1TTY A;  1WJB A;  1I50 J;  2R7Q A;  2Y31 A;  1SFO J;  1YRN A;  3J7A Y;  2XRN A;  5HNF A;  5TGT A;  3E6D A;  4Y13 A;  2WV1 A;  1QNT A;  1QHG A;  1V4R A;  4AD9 A;  3SEQ A;  3V42 A;  2Z9O A;  2DPU A;  2Y75 A;  2ZME B;  2EIL H;  1EA3 A;  3E5Q A;  3VYT B;  1Q1V A;  2UV1 A;  3DBL B;  4DQ2 A;  1PVE A;  5J4V A;  4JX4 A;  1HKT A;  3L7W A;  2KZG A;  3LL7 A;  2OC6 A;  3R4K A;  3FHN A;  4R8H A;  3OYL A;  1LE8 A;  1T6S A;  3CD6 I;  2V26 A;  3H0D A;  2XF6 A;  3ZQQ A;  2O6G E;  1DP3 A;  2LR8 A;  3H36 A;  1VF9 A;  4G7O F;  3KYC B;  1Z77 A;  3RKX A;  3WTT C;  2NRA C;  3P9C A;  3CDL A;  4ITV A;  5E1Z B;  5J6X A;  4CZZ A;  3L2R A;  3V8L A;  2G0E A;  1NK3 P;  3AG1 H;  3TBI A;  2DOF A;  1FOX A;  3SJM A;  2V7F A;  1MMD A;  2BW3 B;  1O4X A;  4ETS A;  4BE1 A;  3BZC A;  1RRJ A;  5CVU A;  3HOU J;  1P4A A;  1XD7 A;  3S1N J;  4BEH A;  4UXN A;  2Y2Z A;  4BH9 A;  1SVM A;  5JVT A;  5A2Q K;  1AA7 A;  2COM A;  5DYM A;  5JI6 A;  5LD2 C;  1UG0 A;  2HTS A;  1GLN A;  4F92 B;  3HBL A;  3A2K A;  4JOM A;  2RN7 A;  1ZG3 A;  5CPR B;  3SYT A;  3TO7 A;  1DGR M;  1EH6 A;  4GFB A;  4HNV A;  1ZK8 A;  1HLV A;  4MEX F;  1MH4 A;  3S2W A;  3FK6 A;  2DDA A;  1OQY A;  2DOD A;  5EDN A;  1KQ9 A;  2V4J C;  2B0L A;  1WHU A;  2IA1 A;  1RI7 A;  2JQ7 A;  3CF2 A;  4A2U A;  2MD5 A;  5FKO A;  2LK2 A;  3JCU C;  1U78 A;  2NS8 A;  1FIP A;  2VJI A;  5F08 A;  3S93 A;  1RUN A;  4CHU A;  3DFG A;  1J5Y A;  3WE2 A;  1QZY A;  2F4M B;  3BRO A;  2ZXW H;  2WWY A;  4HZF A;  2X85 A;  3QU6 A;  3GVA A;  5BQT A;  3BG7 A;  1OCC H;  4D0P A;  2AXT C;  3I0T A;  2DOE A;  3FKJ A;  3U1D A;  4R79 A;  3WHB A;  2OCE A;  2VOD A;  1XDU A;  1P9Q C;  2AXL A;  2XAU A;  3TO6 A;  4Z6Y A;  4FQG A;  1IRZ A;  2F5V A;  2KIM A;  3H5N A;  2KRC A;  3LA7 A;  4M6X A;  4UUV A;  1DPU A;  2P5K A;  3DP7 A;  1IG7 A;  2DA6 A;  3SDG A;  4ESJ A;  3F8C A;  1S6L A;  2K85 A;  2Y69 H;  4X1E A;  4F93 B;  4YFK F;  4ENM A;  2R7T A;  1P92 A;  3A01 B;  2CRG A;  3EUH A;  1N77 A;  4N4O B;  1XDS A;  5C3E J;  2VQG A;  1U5T B;  3M8E A;  2RDP A;  3HSE A;  4U0Y A;  1OCO H;  2LF8 A;  4OMY A;  1XCB A;  1I5Z A;  4WXC A;  4WX9 A;  3OYN A;  1LB2 A;  3PIP F;  2V9P A;  1G3S A;  4CYC B;  2QKL B;  5FKL A;  2X0L A;  4I0B A;  3QYB A;  1EV7 A;  1Y8R B;  3HRM A;  3E6C C;  5C4J J;  3COA C;  1WZ2 A;  1FSH A;  3GCM A;  3ZQH A;  3F23 A;  3CUQ B;  4QIW N;  1XGO A;  1J2X A;  1VND A;  1FC3 A;  4A3F J;  1LKX A;  2WV0 A;  3HZJ A;  2EIJ H;  2R7X A;  1EF4 A;  3OS2 A;  2L9V A;  3WG9 A;  1R36 A;  1X3Z B;  1O3Q A;  5B66 C;  2P4W A;  2Q2E A;  2V9V A;  1NH3 A;  3CC7 I;  5J40 A;  4B8X A;  1B8I A;  4P9U A;  1D0Y A;  1TWA J;  2IJL A;  1X1C A;  1VQ4 I;  2EIN H;  2V1X A;  3FKI J;  3QYF A;  1XMX A;  1TWG J;  1W7P B;  4BKX A;  3C2B A;  4UUS A;  3L09 A;  3OYA A;  1R1V A;  3MN2 A;  4XQF A;  2JT1 A;  3ZQ7 A;  1YIJ I;  3CCM I;  3DF8 A;  2IRF G;  3RDI A;  4KMU X;  1T38 A;  2DTR A;  5D5V B;  5FLX Z;  3TQN A;  1IGN A;  2L2O A;  2A07 F;  1PUF B;  4DNC A;  1MKM A;  1BI3 A;  2K9S A;  3BTJ A;  5F1J A;  2DU9 A;  4L9T A;  2VKE A;  3ISP A;  1X2M A;  5L3B A;  4BJT A;  5IYD J;  2BV6 A;  4FTH A;  3KEQ A;  2NVY J;  1IUY A;  4XOR A;  4ZH4 F;  2UWM A;  5ICE A;  3K4J A;  1IXS B;  3WTZ A;  2VQC A;  1BW5 A;  3WOD F;  4A3E J;  1YJW I;  3AFH A;  1W5T A;  3LWF A;  2FBI A;  2ESN A;  1ZH5 A;  4D9J A;  2EV0 A;  1YO5 C;  4XLN F;  3S17 J;  3QP6 A;  1GT0 C;  2KJC A;  1POG A;  3F8N A;  1LDK B;  2Z16 A;  3BG5 A;  2H1K A;  2M7A A;  1ZR4 A;  2I8D A;  4S05 A;  5CKT A;  1KZH A;  3I71 A;  1B9N A;  1JUS A;  3S1Q J;  3K4M A;  1HOM A;  4NUB A;  2AQF A;  3RZO J;  3AG4 H;  3JRA A;  1VI0 A;  3S32 A;  2CUE A;  4Y17 A;  1ZRF A;  3UNG C;  2QUF A;  3VOE A;  2R0Q C;  2HYJ A;  2LY1 A;  2M34 A;  4X6A J;  3H35 A;  5CVR A;  1BI2 A;  2ZFU A;  3VB2 A;  5E79 C;  2ETH A;  3MKY B;  2CS3 A;  2RC4 A;  4LG0 B;  3MMY B;  3E5X A;  5LHG A;  2MW8 A;  3K4N A;  2ELK A;  5D5X B;  4GDF A;  1X1A A;  4RLF A;  4XLH A;  1P7J A;  1Y1V J;  2Z99 A;  1QQI A;  2HDC A;  1Z6R A;  2CYY A;  3K4B A;  3W6V A;  2P0W A;  2VAS A;  3WE3 A;  4G6Q A;  1QVU A;  3HRU A;  5HS7 A;  5GPC A;  1R4N B;  3HOV J;  2EV5 A;  2PX9 A;  3D0S A;  3CCJ I;  1WKM A;  2R7Z J;  2HWV A;  5LRR A;  3CCR I;  1TQI A;  2NXN B;  2KT0 A;  3Q0V A;  2QCO A;  4DYC A;  1A5J A;  1IN7 A;  2JPB A;  4Y3O A;  2DN0 A;  5DUK A;  2CV2 A;  3KLN A;  1SVL A;  3B02 A;  2FXA A;  4P5O A;  2ZME C;  1D3Y A;  2DLL A;  3AAF A;  4IZZ A;  4E70 A;  2IGK A;  1Z91 A;  4AIJ A;  1F5T A;  2LDU A;  5GTH C;  2HXO A;  3RZD J;  3CMY A;  2QKM B;  1U2W A;  2DFH A;  2L7M P;  3G73 A;  3NEU A;  5CVI A;  4DZJ A;  2JSP A;  5J1U A;  3TOB A;  4E6K G;  4V2F A;  3ZQC A;  2FUG 2;  2KIQ A;  3KCC A;  1KU2 A;  1VQ5 I;  4KYW A;  2YX7 A;  4HNU A;  1ETQ A;  5B5E C;  3B6C A;  3G4S I;  3QWL A;  3LSG A;  1YLF A;  3N05 A;  3TO9 A;  2LD5 A;  2FD5 A;  4KT5 C;  4IEJ A;  4IHV A;  3DTE A;  3F8M A;  2OQG A;  5M3F J;  5F04 A;  1X4P A;  3CP2 A;  2AS5 F;  3LQR A;  5HLT A;  1SFK A;  3ELK A;  1R49 A;  2FF4 A;  2R7U A;  3MWM A;  1W36 D;  1RKT A;  2W4S A;  1K83 J;  2GOX B;  3C3W A;  1W4M A;  5M3M J;  4OIR F;  1V3F A;  5K7F A;  1NK2 P;  3GTJ J;  1JGS A;  4D7N A;  4RGR A;  3CME I;  3E0J B;  1KQ0 A;  4M3F A;  1D1B A;  2KMU A;  5E1W A;  3ZCO A;  3MFK A;  3KP6 A;  3DPU A;  2F4I A;  1CF7 B;  3HSF A;  4I6Z A;  5HVQ C;  2E60 A;  2M2E A;  4XKW A;  3FBI B;  1OPC A;  1MBK A;  2CW0 F;  1R6R A;  5LBQ A;  1RET A;  2M8G X;  4HNT A;  1R5I D;  2M30 A;  2NOG A;  2XUB A;  4BS9 A;  4NNJ A;  3BJA A;  5K5R A;  2PMU A;  2RNG A;  4JYK A;  2DA4 A;  3BWG A;  4XSZ F;  5EZG A;  4MFD A;  2PJR B;  4ZZL A;  4RAY A;  2RGV A;  4RM3 A;  5JLX A;  1T2K A;  1P2F A;  2JPC A;  2LKX A;  4F7Z A;  3I54 A;  2GZW A;  4I09 A;  2M3A A;  2DA7 A;  2F5D A;  1T0F A;  2L9R A;  4PFO A;  3AKZ A;  4ZTF A;  2W7N A;  5TRD A;  4BQO A;  1KON A;  1K4T A;  1DU0 A;  5L3F A;  3ECH A;  3V7R A;  1RC9 A;  5ILS A;  4BHP A;  2K9N A;  3FMS A;  5ICF A;  1Z3X A;  2JZY A;  3GLL A;  2VT2 A;  4XBF A;  5GPA A;  3IAS 2;  2HPM A;  3BTL A;  2EFW A;  2QSF X;  1GV2 A;  3KFW X;  3RCO A;  5J8C A;  4Y15 A;  4M9X A;  3TGN A;  3R61 A;  4XOT A;  3ZPL A;  1KQ8 A;  4EM0 B;  2CQ7 A;  1B9M A;  3OYG A;  2B9S A;  4GCV A;  1W36 C;  1R00 A;  3E5U A;  2FJ1 A;  1XSV A;  1S3J A;  1FTZ A;  1HDP A;  2YPR A;  4HDU A;  2R7W A;  1ULY A;  2YS9 A;  1QO0 D;  5EJC A;  1RIO H;  1U5T C;  2MSY A;  4HPQ A;  4BXX J;  3RI4 A;  4OMZ A;  3E1S A;  4ZYD A;  1IZ1 A;  5JLW A;  1E0E A;  2NS7 A;  1IRX A;  1IV8 A;  1TLH B;  3K9T A;  1GXP A;  1JTY A;  4IRH A;  2DA3 A;  3LAJ A;  1YW8 A;  2EZI A;  5FB2 A;  3L2U A;  5HOO A;  2Y0M A;  2IGO A;  3CUQ C;  1QRY A;  2FQ4 A;  1Y1W J;  4LLN A;  1R5H A;  3I55 I;  2EZH A;  4GYG A;  5D6F A;  1FY7 A;  2M8E A;  3W2A A;  1SMT A;  2MFZ A;  3W2V A;  4IF4 A;  4NBQ A;  1OCP A;  1SFX A;  1VQM I;  3E3V A;  3T8R A;  3L9F A;  4F52 A;  2MH9 A;  2VON A;  4BE0 A;  2E2I J;  2P81 A;  5LHH A;  2BZT A;  2EIK H;  1FSE A;  4IQ4 A;  3ABK H;  4XLA A;  1ETV A;  4B1R A;  5D5W B;  3JRB A;  3BC8 A;  3I4P A;  3TW6 A;  2L4A A;  2HR3 A;  3SEZ A;  4RBO A;  2XGC A;  4O6J A;  4U0V A;  3BCB A;  4AYB N;  4DYR A;  1ZTR A;  1R1T A;  4ZYG A;  1JKQ C;  4PZJ A;  1M1E B;  5B1B H;  2IGN A;  2W84 A;  3MKZ A;  3CCV I;  2RVC A;  5FFX A;  1ZN2 A;  1FPQ A;  2GWR A;  5E3O A;  2HZD A;  2JUC A;  3G71 I;  2HDW A;  4G8X A;  2NAZ A;  4CCN A;  3HRT A;  3T0Y A;  4A12 A;  4BDZ A;  2H8W A;  1ZGA A;  2VLA A;  3WTV C;  4HBL A;  5J47 A;  2KRF A;  4XIC A;  2JVG A;  1D1A A;  4XM3 A;  3S3M A;  1G3T A;  1HW1 A;  1K78 A;  2E1O A;  5A2Q Z;  5DCF A;  3MKL A;  4CIC A;  3F21 A;  1B72 B;  2XAS A;  1LEB A;  3OYH A;  2MLK A;  4UVA A;  4BHC A;  3OOU A;  2OZ6 A;  1RPW A;  4AUX A;  2BY3 A;  4A5N A;  1VQ8 I;  4GRI A;  2JA5 J;  3CJT B;  1FT9 A;  1WI9 A;  4M3G A;  3ZMS A;  4G7Z F;  4XRF A;  1P4X A;  3RYR A;  4KN7 X;  5LEK A;  1IRF A;  1EH7 A;  1LQ1 A;  2IXS A;  3QPT A;  4LD5 A;  2E36 A;  3GXO A;  3F0C A;  1Y0U A;  3OL4 A;  2IGM A;  1AU7 A;  4HF2 A;  1BOA A;  1FLI A;  1K61 A;  1WI3 A;  3HYI A;  4BQA A;  1WJA A;  2KP6 A;  3QU3 A;  2D2W A;  1D0X A;  5HDG A;  1W5C C;  5EG0 A;  1EJ9 A;  1ETO A;  3WTW C;  3J80 K;  4L9V A;  1XN7 A;  4B43 A;  4IXA A;  1H89 C;  3F8F A;  4EM1 A;  1C0W A;  1ETY A;  3I4N J;  4RB2 C;  1ACI A;  3KET A;  2K4J A;  3BR0 A;  1ETX A;  3PO2 J;  1R23 A;  3M8F A;  1Y0N A;  2DFF A;  3WGH A;  4AIH A;  2D5V A;  1QHH D;  4I2O A;  4B48 A;  2RQQ A;  4XN0 A;  2CJJ A;  1X1P A;  2XC7 A;  2ADU A;  1VZ0 A;  2W24 A;  2EFQ A;  3HKZ N;  5EEG A;  1KU9 A;  3CCL I;  3A1Y A;  2XPU A;  4BXU A;  1QBJ A;  2CGP A;  2J5O A;  1LFP A;  2EA2 A;  2IBD A;  4EAT A;  5HOD A;  3S3N A;  3A0H C;  3GFM A;  4N9H A;  2ZME A;  3KP2 A;  4RDU A;  1XC5 A;  2DMQ A;  2IA2 A;  3IKV A;  3CP8 A;  1YIT I;  1O7L A;  2ZFW A;  4HW0 A;  4EVI A;  2R7V A;  2DBB A;  3VSK A;  3CO6 C;  3KP7 A;  3ZMV A;  4HV6 A;  4C3I J;  1Z21 A;  3RKQ A;  1YIO A;  3I5U A;  4Y33 A;  2QWW A;  2L9N A;  3FXO A;  4Z2Y A;  4OIQ F;  4PGG A;  3GLX A;  5EZH A;  5K5Q A;  1JXS A;  1WWX A;  2O8K A;  2F5F A;  3TDU C;  2GBY A;  4HX4 A;  3L2V A;  1TT5 B;  3ZOB A;  4AC0 A;  1SAN A;  3J81 Z;  1W1W E;  2PQ8 A;  5K5O A;  1ZG5 A;  4ANJ A;  1BR4 A;  3QOP A;  2G9W A;  1TWH J;  1VFC A;  3K1N A;  2HU9 A;  1MW7 A;  5M5Y J;  3HOW J;  2BW3 A;  3GTO J;  1ITY A;  2A69 F;  3OS0 A;  2XIG A;  2JA7 J;  1U8R A;  3HKZ A;  2QEX I;  2M4G A;  4FT8 A;  5IP9 J;  2CH0 A;  3I64 A;  1HBX G;  1MBH A;  2EJR A;  2MBF A;  3PSF A;  3BQZ A;  1D8K A;  4H0E A;  3HC7 A;  4UB8 C;  1FBS A;  3W3C A;  4ZC3 A;  5ICG A;  2MG4 A;  5DCM B;  1UHW A;  1ORK A;  2CFX A;  3BR1 A;  4IQJ A;  2W48 A;  1J59 A;  1MMA A;  4LK0 F;  4G12 A;  2K9M A;  1OCZ H;  1FEX A;  2MC3 A;  1MMN A;  3FMR A;  1DU6 A;  2VUM J;  1H8A C;  1REP C;  1IN4 A;  4KMF A;  1YYV A;  2DAO A;  1XMA A;  2DPD A;  3GBG A;  4MIM A;  2O3F A;  2BXY A;  2CG4 A;  4Q4Z F;  4XID A;  3LNQ A;  2OTJ I;  2QM3 A;  3W6K B;  1SD7 A;  5KAF C;  1BBY A;  1MBG A;  3BLY A;  3PL8 A;  3S2D J;  2HQ5 A;  3TW7 A;  1R4M B;  1HST A;  1BJA A;  1E3P A;  1ZRE A;  4HV5 A;  1YRN B;  2YU3 A;  3ZRG A;  3K70 D;  1LDD A;  3HOS A;  4C2M J;  1EH8 A; 
#chains in the Genus database with same CATH homology
 2EZL A;  4A3C J;  3HM5 A;  4FTH A;  5C44 J;  5E3M A;  2NVY J;  5EGO B;  3JR9 A;  1GVD A;  1MBJ A;  2M9H A;  4D5F A;  2QF7 A;  3LOC A;  2VI6 A;  5E3N A;  1BW5 A;  3BG3 A;  1AHD P;  2LFB A;  4M3B A;  4A3E J;  1TWF J;  2ME0 A;  1WGX A;  4L5E A;  1H88 C;  3M4O J;  2OPT A;  1GV5 A;  1LE8 B;  2RAE A;  3S17 J;  1GT0 C;  4BBS J;  1POG A;  4FE4 A;  4W97 A;  2LTP A;  3BG5 A;  3Q0U A;  1E3O C;  2H1K A;  4XRS A;  1ZR4 A;  2AO9 A;  3ZQG A;  1P7I A;  3TED A;  1BL0 A;  3VPR A;  2DA5 A;  3A03 A;  4D7M A;  1JUS A;  3S1Q J;  4A3K J;  1HOM A;  1F36 A;  3RQI A;  3RZO J;  3JRA A;  1VI0 A;  1LFB A;  2CUE A;  3DEW A;  2R0Q C;  2IAI A;  3O8G A;  2HYJ A;  2M34 A;  4LOC A;  4X6A J;  2LP0 A;  2YUS A;  2O7O A;  4C3H J;  3ZQF A;  5FLV A;  5FJ8 J;  1U9O A;  3QPS A;  1OCT C;  1CQT A;  3PM1 A;  4B3A A;  2CQQ A;  2MW8 A;  2ELK A;  3JRD A;  5F0F A;  5J3L A;  1P7J A;  4V2G A;  1Y1V J;  2E2J J;  4FIS A;  1JGG A;  2L7F P;  3W6V A;  1JUP A;  2XGE A;  3JRG A;  1QVU A;  3HEF A;  1I3Q J;  3M3Y J;  5GPC A;  3IH2 A;  3HOV J;  1AKH B;  2JA6 J;  2PMZ N;  2EZK A;  5EG0 B;  2M0C A;  2R7Z J;  2X9D A;  1JUM A;  2KT0 A;  1WH7 A;  3Q0V A;  2QCO A;  4DYC A;  4Y52 J;  1A5J A;  3BTC A;  4A69 C;  2DN0 A;  3H0G J;  1A6I A;  3HOX J;  1B72 A;  2R93 J;  5IOZ A;  3HOY J;  3B6A A;  4S0H B;  3BG9 A;  3BQY A;  3K7A J;  2HXO A;  3RZD J;  3CMY A;  2DMU A;  3G1O A;  3LSP A;  2L7M P;  2HOT A;  4A3B J;  2KDZ A;  4DZJ A;  5J1U A;  4QTR A;  4V2F A;  3QQA A;  3ZQC A;  2HOA A;  1ZR2 A;  2XB5 A;  1TWC J;  3Q3S A;  2XGD A;  3DCF A;  4A3L J;  1R9T J;  1ETQ A;  2CQX A;  2LY9 A;  2COB A;  4A3I J;  3B6C A;  3LSG A;  2XSD C;  2VKV A;  2LD5 A;  2FD5 A;  3IH3 A;  1W0U A;  4IEJ A;  4A93 J;  4IHV A;  1IJW C;  1MH3 A;  1FIA A;  5M3F J;  1XS9 A;  5F04 A;  1X2N A;  1OJL A;  1U9N A;  2AHQ A;  5EF6 A;  2DJN A;  1IDZ A;  4A3D J;  2R5Y A;  1RKT A;  3HGY A;  3TP3 A;  5IP6 A;  1K83 J;  5M3M J;  3BR3 A;  4XRS G;  2I10 A;  5K7F A;  1NK2 P;  3GTJ J;  1ETW A;  4D7N A;  2Y9Z A;  2X6O A;  4EEF G;  2Y0S N;  4M3F A;  3HGG A;  1HF0 A;  3S14 J;  2JMW A;  4J19 A;  3L1P A;  3LSR A;  4I6Z A;  2IEK A;  4FE7 A;  5DS9 A;  2M2E A;  2XPW A;  1MBK A;  1T56 A;  2NVX J;  1WPK A;  2DMN A;  1RET A;  2M8G X;  1RKW A;  1RR7 A;  2NOG A;  1IV6 A;  5IP7 J;  1GDT A;  3JRH A;  3S1R J;  1HDD C;  5IYB J;  4JYK A;  2DA4 A;  1W0T A;  5EZG A;  1OFC X;  4MFD A;  3FIW A;  4W1U A;  1B8I B;  5DTD A;  5JLX A;  3A01 A;  2EBI A;  2LKX A;  2ECC A;  3WHC A;  5M5X J;  1UG2 A;  2R5Z B;  2DA7 A;  3O8H A;  2L9R A;  3BR5 A;  1JJ6 C;  1NTC A;  1UMQ A;  3UKG A;  1DU0 A;  4CYC A;  3OSG A;  3FIS A;  2K9N A;  1ENH A;  1QPI A;  5J1R A;  3BT9 A;  1G2H A;  5GPA A;  2L7Z A;  4A3G J;  1BJZ A;  3BTL A;  2MGQ A;  1HCR A;  1GV2 A;  3E7L A;  1WCM J;  2ID6 A;  3G1L A;  3OSF A;  3GTP J;  5FKM A;  1FJL A;  3ZQI A;  4MLO A;  5F0C A;  3BR2 A;  2FJ1 A;  2DMP A;  3GTG J;  1FTZ A;  1HDP A;  2YS9 A;  2DA2 A;  2R92 J;  4BXX J;  2MSY A;  3OIO A;  2JJ7 A;  2B63 J;  5JLW A;  3GTL J;  2NS7 A;  3CQZ J;  4JX5 A;  1X58 A;  3BTI A;  1T33 A;  2X48 A;  1JTY A;  1UHS A;  5GP9 A;  1D5Y A;  2DA3 A;  2EZI A;  3IV5 A;  1IC8 A;  2ID3 A;  5IYC J;  3I4M J;  1QRY A;  2FQ4 A;  1Y1W J;  2EZH A;  2H8R A;  2WB1 N;  1PUF A;  1LFU P;  1OCP A;  5C4X J;  1I50 J;  4D5C A;  2K40 A;  2Y31 A;  1SFO J;  2K9Q A;  5EYR A;  1YRN A;  2E2I J;  2P81 A;  3NAU A;  5E3L A;  2WV1 A;  9ANT A;  4B1R A;  1ETV A;  3JRB A;  5F0H A;  1GUU A;  1WH5 A;  3NAR A;  3TW6 A;  5EGO A;  1JKP C;  1MSF C;  2JA8 J;  4RBO A;  2XGC A;  5K7H A;  1JKR C;  2CUF A;  4AYB N;  5K7Z A;  4DYR A;  1Q1V A;  2LLK A;  4XK4 A;  4A3J J;  1ZTR A;  3S1M J;  1JKQ C;  3GTK J;  4JX4 A;  2OF7 A;  5E3O A;  2DMT A;  3GTM J;  1LE8 A;  1APL C;  4DZP A;  3PO3 J;  2LR8 A;  2ME6 A;  4FCY A;  1VF9 A;  4XIC A;  2JWT A;  1Z77 A;  3S16 J;  2XPV A;  2FX0 A;  1BW6 A;  3CDL A;  2E1O A;  2G0E A;  2E2H J;  3MKL A;  1NK3 P;  1B72 B;  1QVT A;  4C3J J;  3SJM A;  2Y30 A;  1O4X A;  3OOU A;  4I76 A;  3JRE A;  1IUF A;  1RPW A;  4UUT A;  4AUX A;  3JRI A;  3HOU J;  4BY7 J;  4B4C A;  4A3M J;  3HDD A;  4ABZ A;  2JA5 J;  3S1N J;  1ETK A;  2Y2Z A;  4M3G A;  2XRL A;  1ZQ3 P;  3JRF A;  4NDL A;  3ZQL A;  3S15 J;  2HI3 A;  1AU7 A;  3F0C A;  2Y9Y A;  3S2H J;  3HBL A;  1AKH A;  1K61 A;  1WI3 A;  4XRM A;  1BA5 A;  2ZB9 A;  5EG0 A;  4GFB A;  4IHW A;  1ETO A;  4HNV A;  1ZK8 A;  1TC3 C;  3HB9 A;  4UUS B;  1HLV A;  1MH4 A;  5IYD J;  3FK6 A;  1H89 C;  5EDN A;  1ETY A;  3I4N J;  2JK3 A;  3A02 A;  5M5W J;  3BR0 A;  4M3D A;  1ETX A;  3PO2 J;  2D5V A;  5IOY A;  2HXI A;  5FKO A;  4M6V A;  2LK2 A;  1U78 A;  2NS8 A;  2CJJ A;  1FIP A;  3CCY A;  5FLM J;  5F08 A;  1RES A;  3HKZ N;  2R5Y B;  1F43 A;  5EEA A;  2E19 A;  5J1Y A;  3QPL A;  2XPU A;  1MBF A;  1Z0X A;  2TCT A;  5IPA A;  1FTT A;  2IBD A;  2YU9 J;  3HOZ J;  5HOD A;  1JJ8 C;  4JP0 A;  4DW6 A;  3IH4 A;  3TP0 A;  3WHB A;  4RDU A;  1XC5 A;  2DMQ A;  4IHX A;  4MFE A;  2DA1 A;  2GLO A;  1IRZ A;  2GM4 A;  2NVQ J;  4C3I J;  3RKQ A;  2DA6 A;  3SDG A;  1IG7 A;  4MO7 A;  3LSJ A;  1JTX A;  5FKN A;  1MBE A;  4X1E A;  3SFI A;  5F27 A;  1MNM C;  3A01 B;  1I6H J;  2CRG A;  5EZH A;  4DYQ A;  1U8B A;  2CU7 A;  5C3E J;  2O8K A;  2GBY A;  1ZKG A;  3K2A A;  3G1M A;  3ZOB A;  4AC0 A;  1SAN A;  4CYC B;  1JT0 A;  5FKL A;  2LVS A;  1S7E A;  2EQR A;  1VFC A;  1TWH J;  1ITY A;  5M5Y J;  5C4J J;  3HOW J;  3GTO J;  1IDY A;  1JKO C;  2O9L A;  5BNG A;  3ZQH A;  1JT6 A;  3H3V K;  4QIW N;  2WAQ N;  4Y7N J;  1VND A;  4A3F J;  2JA7 J;  4BY1 J;  3Q0W A;  5IP9 J;  3JRC A;  3GTQ J;  1EF4 A;  1MBH A;  2XB0 X;  3BQZ A;  4BBR J;  1XG1 A;  2VPR A;  1B8I A;  1TWA J;  2MG4 A;  3BR1 A;  1ORK A;  2NVT J;  2W48 A;  3FKI J;  2DTZ A;  4IHY A;  1TWG J;  4G12 A;  2R5Z A;  4BKX A;  3C2B A;  1MSE C;  1FEX A;  4UUS A;  1DU6 A;  4QSH A;  3BR6 A;  2VUM J;  2HDD A;  2ECB A;  1H8A C;  3MN2 A;  2L0K A;  2N8G A;  1ZGW A;  3GBG A;  4MIM A;  3D1N I;  4JX6 A;  4XID A;  3LNQ A;  2HOS A;  2EH3 A;  5FKK A;  1IGN A;  1MBG A;  1PUF B;  2TRT A;  3S2D J;  2HQ5 A;  3TW7 A;  2JN6 A;  4M3E A;  2K9S A;  3BTJ A;  5F1J A;  3FK7 A;  1YRN B;  2VKE A;  1X2M A;  3MVP A;  4C2M J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...