3S14J

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s14J00
1WH5A 1BW6A 3JRDA 3BTLA 1JJ8C 1RKWA 4D5CA 2XPVA 1IG7A 4J19A 1MH4A 2Y30A 1Q1VA 1B8IB 2VUMJ 3BR5A 4UUSA 1LFBA 2M9HA 3F0CA 2XB5A 1JJ6C 2XRLA 1XG1A 2DA3A 1DU6A 3HB9A 2OPTA 3OSFA 1YRNA 2NVQJ 1F43A 1ZR2A 1A6IA 5M3MJ 3GTOJ 2L7MP 5C4XJ 1MBGA 5J1RA 5BNGA 1F36A 3CMYA 3D1NI 1HDDC 1TWCJ 1XC5A 1OCPA 2EZKA 3BG9A 2M34A 3UKGA 1JKOC 2K9QA 3C2BA 2Y2ZA 1EF4A 1Z0XA 2LK2A 2LKXA 5IYDJ 4A3KJ 4UUTA 4DYCA 2HXOA 4Y7NJ 4HNVA 3S16J 2LY9A 2M0CA 5FKLA 4D7MA 2X9DA 3Q0WA 2O9LA 2WV1A 2H1KA 4FISA 2K9NA 1TWGJ 5EDNA 1HF0A 5M5XJ 1JTYA 5J1YA 5DS9A 2IAIA 3S1NJ 2IEKA 2FQ4A 5F1JA 3HKZN 3RQIA 2RAEA 2COBA 3BR2A 1MBKA 1SANA 4MFEA 1WI3A 1B72B 1FIPA 2E2JJ 4JYKA 3TP3A 1MBEA 3JRHA 4A3EJ 3RZDJ 1TWHJ 1AU7A 2NVXJ 3H3VK 3CCYA 2FJ1A 2XGCA 4JX4A 4D5FA 1Y1WJ 1WH7A 1MBHA 5M5YJ 1IJWC 2ID3A 2ECCA 3BR3A 4MLOA 3CDLA 3S14J 2DMPA 1WPKA 2TCTA 2LLKA 4G12A 1X2NA 2AO9A 2MGQA 2G0EA 1H89C 2Y9YA 2ME0A 4A3JJ 4C3JJ 2CUEA 3DCFA 2O7OA 4UUSB 4C2MJ 3WHCA 1VF9A 5JLWA 2R93J 3QPSA 4M3EA 5C4JJ 2VI6A 2EBIA 2DMTA 1X2MA 3DEWA 4W1UA 3HOVJ 5F0FA 1GV5A 2IBDA 2H8RA 1CQTA 2DA6A 1ZTRA 1ZQ3P 3G1OA 2JWTA 2R0QC 2R7ZJ 5IYCJ 3HM5A 5IOYA 5FKMA 1HLVA 2JJ7A 3BG5A 4QIWN 3I4NJ 1MSEC 1WCMJ 1D5YA 4L5EA 1S7EA 2EZLA 5IP6A 3GBGA 3L1PA 3ZOBA 5IPAA 3FISA 5K7ZA 2KDZA 1W0TA 2JMWA 2HYJA 4IHYA 2ECBA 3LSPA 5M5WJ 4B1RA 1ETKA 2VKVA 2LTPA 1TWAJ 3TP0A 4JX5A 1U78A 2MSYA 5M3FJ 1TWFJ 1IGNA 1RPWA 3RKQA 3GTGJ 2VKEA 2R5ZB 2NS7A 5GPAA 4V2FA 1K83J 3ZQIA 2XSDC 2DJNA 3PO3J 3PO2J 4IHVA 3S2HJ 4A3IJ 3HGGA 4IHXA 2LFBA 2L7FP 5EG0A 1ZK8A 5FKOA 3SDGA 2ZB9A 1FIAA 2DA5A 3FK7A 1LE8B 2YUSA 1JUSA 1GT0C 1MBJA 2TRTA 1ZKGA 3LSGA 4A3GJ 1GDTA 2DA2A 2JA7J 3W6VA 1AKHB 5IP9J 1JKRC 2NVYJ 4XRMA 4FTHA 3BG3A 4A3CJ 2HOAA 1T33A 1QVUA 3JRAA 3IH2A 1SFOJ 1R9TJ 3M4OJ 1G2HA 4M3FA 5JLXA 2DA4A 2E1OA 1VFCA 3MKLA 5F0CA 3JR9A 3I4MJ 1DU0A 2NS8A 2HI3A 2YS9A 3BT9A 2B63J 2XPUA 1UHSA 5FLMJ 1ENHA 1JUPA 5C44J 1IDYA 4DZPA 5F04A 3A03A 1NK3P 5IYBJ 1ETYA 4JP0A 3H0GJ 5IOZA 2P81A 1LFUP 3GTPJ 2MW8A 3BTIA 2R5ZA 1ETVA 1NK2P 2LR8A 2QCOA 3MVPA 3B6AA 1RESA 3ZQHA 4NDLA 4BKXA 2HOTA 5K7FA 2M8GX 3BQYA 4B4CA 4XIDA 1JKPC 5IP7J 3HOYJ 2K40A 1JT0A 1BA5A 2XGEA 3BR6A 1LE8A 1MSFC 3FKIJ 3JRCA 5EG0B 2K9SA 5EGOA 4AC0A 2CRGA 1AKHA 1RR7A 3FK6A 2WAQN 2R5YA 1ITYA 2JA6J 1ETOA 4BY7J 1HCRA 3NAUA 1U9NA 1VNDA 1MH3A 1AHDP 1T56A 2LVSA 4IHWA 2XPWA 3TEDA 5FKNA 1H8AC 1BW5A 4M3DA 3LNQA 1BJZA 2CQQA 1ETXA 3LSJA 1BL0A 4LOCA 5E3LA 4IEJA 4I76A 2WB1N 3HGYA 5K7HA 2PMZN 3GTKJ 2D5VA 4DZJA 5EEAA 2VPRA 2Y0SN 3O8HA 3LSRA 4M6VA 2OF7A 3S1MJ 1FEXA 3TW7A 1JKQC 4RDUA 3PM1A 3QPLA 4DYQA 1POGA 1IDZA 4CYCA 2W48A 5FKKA 3GTMJ 4BXXJ 4A69C 1GV2A 4XRSA 5J1UA 1IRZA 3JREA 2NVTJ 4BBSJ 2MG4A 1WGXA 2EQRA 1OJLA 5C3EJ 5EF6A 3Q0VA 3NARA 2XB0X 3SFIA 4RBOA 3SJMA 1MBFA 4MFDA 3JRGA 4MO7A 5F08A 5EZGA 1QPIA 3OIOA 3GTJJ 4MIMA 2E19A 1MNMC 2CJJA 3HOXJ 5EGOB 4ABZA 3BQZA 2DMNA 3ZQCA 1PUFB 3A02A 2LP0A 4M3BA 2R5YB 2KT0A 1FTTA 3OOUA 1UMQA 5HODA 2LD5A 1W0UA 1FJLA 4GFBA 4FE7A 3IH4A 4V2GA 1VI0A 3OSGA 1ZGWA 3B6CA 4Y52J 2GBYA 3A01B 3CQZJ 1K61A 2YU9J 2JN6A 4DW6A 5E3MA 1JGGA 4W97A 3IV5A 3RZOJ 2EZHA 1NTCA 3O8GA 2R92J 4C3HJ 5FLVA 1RKTA 5F27A 3ZQLA 3ZQGA 1ZR4A 1JT6A 2L0KA 3IH3A 3HEFA 1GUUA 1RETA 2GM4A 3ZQFA 5F0HA 2I10A 1U9OA 4BBRJ 4FCYA 3Q0UA 2ME6A 4I6ZA 4CYCB 1HDPA 4DYRA 2JK3A 3JRIA 4X1EA 2AHQA 5J3LA 3GTLJ 3M3YJ 1X58A 4B3AA 3K2AA 2FD5A 3JRBA 4A3DJ 2HXIA 2DMQA 3S1RJ 2Y31A 4XK4A 2ID6A 3VPRA 2JA5J 3BR0A 1Z77A 3HOUJ 1U8BA 3HOZJ 1I6HJ 2FX0A 1GVDA 3S15J 4A3BJ 3Q3SA 1PUFA 4JX6A 5E3OA 1A5JA 1QVTA 2CU7A 1H88C 3BTJA 5E3NA 2E2IJ 2CQXA 4A93J 1IUFA 4M3GA 1IV6A 3HBLA 1FTZA 1B8IA 2ELKA 3WHBA 4AYBN 4AUXA 4C3IJ 5FJ8J 2Y9ZA 1O4XA 2GLOA 3HOWJ 4XRSG 2QF7A 2DN0A 3A01A 5EYRA 3TW6A 3S17J 3FIWA 2DA7A 4BY1J 2EH3A 1UG2A 9ANTA 1OFCX 1IC8A 1HOMA 1I3QJ 3K7AJ 2HOSA 3QQAA 4D7NA 4A3FJ 3G1MA 1YRNB 2L9RA 5GPCA 2HDDA 1Y1VJ 2CUFA 2DA1A 4S0HB 4FE4A 1QRYA 2M2EA 3LOCA 4EEFG 2DTZA 2NOGA 4X6AJ 1E3OC 2N8GA 4QTRA 3HDDA 1ETWA 1JTXA 2EZIA 2L7ZA 3G1LA 5DTDA 2DMUA 4XICA 2X48A 1I50J 2X6OA 1P7JA 1P7IA 5EZHA 1ETQA 2HQ5A 3E7LA 3BR1A 1XS9A 5GP9A 4A3MJ 3S1QJ 2XGDA 3MN2A 4QSHA 3BTCA 1B72A 2JA8J 2E2HJ 3S2DJ 1APLC 3GTQJ 1TC3C 1OCTC 2O8KA 1JUMA 4A3LJ 1ORKA 3JRFA
chains in the Genus database with same CATH superfamily
3OYJA 3IWZA 5A2QK 2W82A 4L9NA 2XPVA 2DQLA 1B9NA 1Q1VA 4XN3A 2VUMJ 3COAC 2M9HA 3F0CA 4ZYHA 1SVOA 3ECHA 1WQ2A 3TL4X 3E97A 1S8NA 2OCEA 6PAXA 5HS8A 4LITA 4U0YA 3M8EA 2QUFA 3WG7H 4EJUA 2DFFA 3FF5A 2DPDA 3RPUD 4CCKA 1VQPI 3GTOJ 5C4XJ 2P6SA 1IN7A 3WGIA 3X2QH 1F36A 3CC4I 1S72I 1HDDC 3LAJA 3H5AA 4J00A 4EGYA 5E1ZB 4P9FA 2FU4A 3AFHA 3BG9A 2FSWA 2V9VA 2K9QA 1OR7C 3C2BA 1KU3A 2PMZA 1Z0XA 2LK2A 2IS4A 1RR8C 2LKXA 4KMUX 3HIFA 1X19A 2ZXHA 4UY8I 5FKLA 1N77A 2EV6A 3LSKA 4D7MA 2CYYA 2DOFA 1Z6RA 3Q0WA 3MKWB 2O9LA 5HNHA 1AOYA 2DFEA 2VBXA 2M4KA 4FISA 5EDNA 3OL4A 3WU1B 3HXLA 2WADA 5DS9A 2X1CA 1RIOH 3K4BA 5J8CA 1KU9A 2HQRA 3BR2A 3P9CA 3I58A 2RREA 3OL3A 2E2JJ 1OMIA 1YJ9I 4NHJA 2WAFA 1MIJA 2ZXJA 2DQRA 1F5TA 3CCYA 4DIQA 3H3VK 3OS2A 1U5TC 1ZELA 2ZFUA 3KP5A 3QP6A 5ICFA 4D5FA 3OY9A 4HNTA 2ECCA 2ACJA 5J47A 4EATA 1IJWC 1VQ5I 3S14J 2DMPA 4HX4A 1WPKA 2RVCA 3ERED 1RUOA 4E70A 5FFXA 5HVQC 2AO9A 4XLAA 2F5DA 1DPUA 1G3SA 1FNNA 2ME0A 1SFUA 5E1WA 1S3JA 4HW0A 2HOEA 5LGTA 2X0LA 5ILUA 2QENA 3DBRB 1P4AA 2X51A 2DDBA 4O6JA 2GA2A 1I6XA 2EILH 2EFOA 2D1HA 2L9VA 2E71A 3G2BA 2Q1ZB 3V8LA 3JAMK 2K27A 2H8RA 1ZQ3P 1ZTRA 3DPTA 3G1OA 3GCMA 2IT0A 2YX7A 3EETA 2FXAA 2JJ7A 1Z6TA 3H3ZA 3NWTA 2UUZA 2LBFB 2EZLA 2HQAA 3L1PA 3TDZC 4WK8F 1IRGA 1R5HA 5K7ZA 3QYBA 1IRXA 3LSPA 2PBIA 3DPUA 2W00A 4E7JA 3TQNA 2JSCA 4KN4X 4AIHA 1IN8A 3WTZA 4L5JA 5JI6A 5M3FJ 1IGNA 3LA3A 4G6QA 1RPWA 2EA2A 1KU7A 4LLGF 4L9VA 2R5ZB 2EFNA 4ZTFA 2ZXWH 1X1BA 4Y3OA 4V2FA 2V1XA 2QQBA 1Z7UA 3PO2J 2DJNA 2HPMA 2F5EA 3M1CA 3VSLA 3M8JA 2BY3A 1ZK8A 5FKOA 3SDGA 4RM2A 2DA5A 1QZEA 4ENKA 3F8BA 1LE8B 4AYBA 1MMAA 1YX3A 1REPC 3ZPLA 3EYIA 2TRTA 3HSRA 2HKOA 1ZKGA 2CQ7A 3GMEA 1LVAA 2DA2A 2JA7J 1YYVA 4YIFA 5IP9J 2BYVE 3D5LA 1JKRC 2NVYJ 4FTHA 1XTAA 4HV5A 3ISPA 2CV2A 3HC7A 4BQAA 3VYUB 2HOAA 2YX4A 2D2WA 1D1CA 3CP8A 1U0JA 5CQEA 3S3NA 4Y17A 4IHSA 3M4OJ 4M3FA 5JLXA 3WTWC 2VC0A 3M7GA 1K7AA 4IZZA 2E1OA 4NC6A 4CSWA 4ESBA 1ERDA 3JTHA 3PIOF 2BY1A 5ILVA 4IO9F 3CDHA 4O5VA 3ASOH 1EH7A 1FY7A 2HI3A 3TGNA 4HSRA 4FT8A 2B63J 4IXAA 3TBIA 3RDIA 2LF7A 5ICCA 3AL0C 1YITI 5F04A 1JGSA 2X6WA 3A03A 3ELKA 5CVRA 4F52A 2QSGX 4R8HA 1LUJB 2P81A 3GTPJ 4I98B 3BTIA 2R5ZA 2XAGA 4WCGA 1NK2P 5HDNA 1TNTA 1NH3A 1ZGJA 2AXTC 3K70C 1IF1A 3B6AA 1RESA 3AG1H 3ABTA 3ZQHA 2LG4A 1MMSA 2VKDA 4BKXA 2HOTA 3DV8A 4B4CA 3BJAA 4XIDA 1J7KA 2O61A 1YI2I 2BBYA 3EYYA 2ZJRF 1ZHFA 2XGEA 1LE8A 2VE8A 4G9YA 2RDPA 1Y56A 2O03A 3BCAA 3C1DA 4BDZA 2FBIA 3CZ6A 1RR7A 4M9SA 5JFRA 4OIPF 1HBXG 4EM2A 4HRIA 2WA0A 4XOTA 4BY7J 1HCRA 3NAUA 1U9NA 2M30A 4XQFA 1T38A 3RKYA 2L9NA 1AHDP 3I9V2 3CMEI 2XPWA 1WJ5A 1LPQA 3CUQB 3M1EA 3M07A 2AQEA 3VSKA 2L4MA 4E7KA 3S3OA 1TL8A 3CD6I 1BW5A 5KCMA 2UV1A 3LSJA 4KIBA 3C2HA 5JHUA 4RB3C 1BL0A 1O7LA 2HZDA 3E6BA 2F4MB 3IC7A 1KQ8A 1PVEA 2KISA 3H36A 3KP4A 2PMZN 2A5YB 5K7HA 4DZJA 4EJTA 3GTKJ 4FX4A 3LSRA 4B47A 4M6VA 4R79A 1JKQC 4DYQA 1DP3A 1IDZA 5CQGA 2CGPA 3GTMJ 2K4BA 4N9HA 1GV2A 1Q1HA 2ESNA 2OBPA 4M71A 3JREA 1YQAA 3F6VA 4L5IA 4I02A 4BBSJ 2KZVA 3DFGA 1WSUA 1T08B 1TW2A 3F9KA 3CC7I 3K4NA 1OJLA 2IA2A 2NOJB 1A36A 4N9IA 2KIMA 3Q0VA 3NARA 1L0OC 3KX2A 3OYHA 2K4JA 2MLKA 1YJNI 2VQGA 1FWZA 1S7OA 2VB6A 3RCOA 3QRFF 3IHUA 3GTJJ 2ISYA 4MIMA 2ZMEB 3C7JA 1PUEE 3CCJI 3J7ZI 2HTSA 1A04A 1FPQA 5DCMB 3FX3A 2DFIA 2ELHA 2TDXA 2XGXA 2EV5A 2MBFA 3C2GA 2DMNA 1PUFB 4IVNA 2VOPA 2FOWA 2LP0A 3HPHA 1IO2A 2VJ5A 5DDGA 2KT0A 2VKHA 2X1DA 5HODA 2LD5A 5FRNA 4FASD 3E6CC 3OYKA 5LRRA 4V2GA 1ZGWA 3P7NA 4OIQF 2HQNA 3FXKA 2NRAC 4XLNF 1WJBA 2JN6A 4NC8A 1GLNA 4DW6A 2KDOA 2NAZA 3ROUA 4KNYA 2EZHA 4RAYA 4C2TA 3C3WA 5FLVA 3ZQGA 1X3WB 1ZR4A 1VQOI 2R3SA 2L5QA 5KHDA 5L3BA 1A35A 4Q5SF 1GUUA 3DP7A 1RETA 2IVMA 2H6BA 2I10A 1U9OA 3IP4B 3CCLI 1XSVA 1HDPA 2W25A 2IGOA 2RNJA 5J3LA 3Q5FA 4UVBA 3ONQA 1FSHA 5B1AH 1XSXA 5DM7F 2L02A 2EIMH 3JRBA 2BVLA 3HOSA 1BOBA 4BL0B 1P92A 4MNUA 1VQ6I 3HOUJ 1TQIA 4CICA 1XGSA 3K0LA 2ETHA 1G4DA 3HOZJ 2W4SA 4PZJA 1I6HJ 4A3BJ 2Z33A 3Q3SA 1PUFA 2QQ9A 3MKZA 2BXYA 2W1OA 2CU7A 3BWGA 3RIRA 5LFAA 3BTJA 2CQNA 1FP2A 4A93J 3U21A 1IUFA 4M3GA 2XF7A 2CWEA 3HBLA 4A0ZA 4Q47A 5AONA 3R4KA 5FJ8J 4AYBN 3F8NA 4C3IJ 2Y9ZA 4M6XA 4RAFA 2M3AA 1QZZA 2IS6A 3DTEA 4XSXF 3CCRI 3S17J 2CW7A 3FIWA 5E79C 1BN5A 1P9QC 3FXRA 1HOMA 4AWXB 1YLFA 1ZH5A 1X3UA 3BDDA 3WTSC 2STWA 4CDGA 3LA7A 5D5VB 3G71I 1U8RA 5GPCA 5DM6F 3OOPA 3KZYA 3CMMA 2PFBA 2XC7A 2DA1A 4FE4A 2X1EA 3DBHB 1JHHA 1X3ZB 5CVJA 4DBRA 3EUHC 2NOGA 4BQOA 2W57A 3H92A 1E3OC 3KP3A 5LHGA 1ETWA 2R7DA 3AG2H 4PK4A 2EZIA 4CYDA 2IGNA 4OWRB 1KQ9A 1VQ8I 3V8JA 3MWMA 2W24A 4IX7A 3WTVC 1OLTA 2FUG2 1P7IA 2PJRB 2F2EA 2DJIA 5EZHA 3HTSB 4LG3A 1MD0A 1YO5C 4OAYA 4YIIA 3F8MA 1FOWA 5A2QZ 1FMVA 4F93B 2HKXA 3BTCA 1SC7A 4HF1A 3OMYA 2BOLA 2E2HJ 2Z2SB 3J80Z 3W2WA 1R5GA 3GFLA 4HNUA 3S2DJ 3FXUA 1VQ4I 1APLC 4P55A 4KYWA 1OCTC 3S93A 2QYOA 4G7OF 2D45A 4A3LJ 1ORKA 3H5RA 3ZMDA 4EV0A 2UZKA 3JRFA 1WJEA 1UAAA 1E3PA 4CHUA 3FXJA 4CXFA 1QO0D 2ZNZA 2V1UA 3BTLA 4Y13A 5J4YA 1RKWA 4D5CA 1IG7A 4J19A 1F1ZA 1MH4A 2M4GA 2VJIA 5L3CA 3K4KA 4BACA 4O3MA 1D8JA 1B8IB 1LDKB 4UUSA 1PYVA 2MC3A 3LSIA 1K6OA 1UCRA 1Z67A 3HB9A 2VQHA 4N4OB 4HA8A 3OSFA 3AG4H 2HDWA 1A6IA 5M3MJ 3F3XA 1Z3YA 4L0YB 3ZMTA 5J1RA 3CO6C 1L3LA 1Z7LA 5BNGA 3D1NI 3CCQI 4EJOA 1QA6A 3LAPA 1TWCJ 4L9TA 2AXLA 1OCPA 3OR2C 4U88A 2Z1DA 2VONA 2QQ8A 2HFHA 3UKGA 1TQMA 3HPGA 2WB1A 2Y2ZA 2Y48A 1EF4A 1WJFA 2L9SA 2Y0SA 5IYDJ 2CO5A 4DYCA 4Y7NJ 3ZMSA 3WTTC 3ABUA 2V1NA 2WBMA 3SEZA 1O3RA 2H1KA 4LG0B 2K9NA 1TWGJ 1IV8A 1HQCA 2IS1A 2GIVA 2E36A 1H0MA 2FEZA 1RUNA 5M5XJ 3IUOA 1UFMA 1JTYA 4IQ4A 5J1YA 2PLYA 5F1JA 3SXYA 1JE8A 2CSOA 4BEHB 1FIPA 3PQKA 5E1XA 3ZMZA 2KHMA 3TP3A 1MBEA 1OQYA 4A3EJ 3FM3A 2KIQA 2XGCA 4YIRX 2DO7A 2MLGA 1XGNA 5DCFA 1QNTA 3BR3A 5EJCA 4DGWB 1X4OA 2TCTA 1X2NA 2VASA 2Y0MA 3TMOA 2LY2A 2HYGD 5FGMA 3TO6A 1RNLA 3AAFA 3LSTA 2CUEA 4BS9A 2FA5A 3DCFA 1DPRA 4PCQA 3RSNA 5KNLA 3OYIA 3LSMA 1ZG5A 1DUXC 3CCSI 2OTLI 1OPCA 1XSDA 4ASNA 5C4JJ 1D1AA 4BHPA 2VI6A 2WY7Q 1EH8A 2Z5UA 3VYTB 3DEWA 4W1UA 1X1PA 3FBNB 1GV5A 5F0FA 3WGGA 3HOVJ 2EPFA 5B66C 4HSTA 4XKCA 1DDNA 2H1LA 3OYCA 2DXIA 2XIGA 1ACIA 3HM5A 1ZAOA 3J81K 1NHAA 5IOYA 1HLVA 3BG5A 1BBYA 4QIWN 2HU9A 2ZXIA 1IN5A 4ENNA 2DW4A 3E5XA 4LG0A 2XUBA 3K4LA 5L3DA 1D5YA 4L5EA 2HYFA 3NEUA 4RGUA 2KDZA 4EJWA 2JMWA 2HYJA 2DOAA 3J7YJ 4DQ2A 4ZDOA 5LEJA 4B48A 3DEEA 3IRQA 2JRMA 2FMYA 4JX5A 1Y6IA 3H0DA 1U78A 2M87A 4E7ZA 2MSYA 1Z21A 3CTAA 2HS5A 4X0GA 3N05A 1HW5A 3HSEA 4OAZA 2KLOA 3U9GA 4RGSA 2B7EA 2VKEA 2NS7A 3A4CA 4PDKA 2XSDC 3IKTA 2KIUA 2OAZA 3PO3J 2H6CA 3S2HJ 1IN4A 4A3IJ 1F4KA 4BJ6C 4IHXA 3H3UA 3JCUC 3J80K 5FD6A 5EG0A 1WKMA 4AM3A 1MKMA 3ZR8X 1FIAA 4MTEA 3FK7A 2VXZA 3L2RA 2QA4I 4E4HA 3CLOA 4TV7A 1KQ0A 4LJZF 1XMKA 3LSGA 3TO7A 4HF2A 4NQWB 4UUVA 1XDUA 2HGCA 4HQEA 3OWTA 3E6MA 5IY5H 3TKYA 3ECOA 1GVJA 5F1RA 1N78A 1T33A 2RGVA 2KFDA 1OCZH 1QVUA 3CCEI 2O0YA 2YSRA 5D6EA 1SFOJ 2G7HA 1G2HA 4S04A 5TISC 3R61A 4LLNA 3F22A 3MKLA 2ZKZA 5F0CA 5K5QA 3BOQA 3I4MJ 4XLPF 2A05A 1Z91A 2YS9A 1R1VA 3BT9A 4RMNA 5K5RA 4CCLA 3KE2A 3VEPA 5FLMJ 1W36D 1VTNC 1ENHA 1JUPA 5C44J 1IDYA 4AIDA 2IPQX 1NK3P 1ETYA 3L2CA 4JP0A 3H0GJ 1LFUP 3I55I 1VQ9I 1AA7A 4BH9A 3GZ5A 1ETVA 3LFKA 2VBZA 4PFOA 2ESHA 2QCOA 5TJJA 1R1TA 4ZDPA 4RB0A 3EDPA 5D5UB 4PUSA 5LEKA 1BR1A 3CJQB 2K40A 2KL4A 1G3YA 4KT5C 3BR6A 2DT5A 1MSFC 1BI2A 3J7AY 1VQNI 3OIQA 5AIQA 1SVLA 1BC8C 3O6BB 5EGOA 3JRCA 3WTXC 1BR4A 3G3ZA 4FHTA 4NQWA 2CRGA 4RAZA 2CUJA 4EVIA 2EFPA 4B3XA 4D9JA 2JVHA 4UHTA 5LGUA 3S2WA 2CW8A 4OOIA 3PIPF 3H35A 3CDIA 1VNDA 4NUBA 1MH3A 2LVSA 4I09A 4IHWA 2WC2A 4ENMA 2ZJ2A 1XGMA 2OCCH 1I27A 1ETXA 2OC6A 4UXNA 1V5GA 1D1BA 2NYXA 1LNWA 5E3LA 4IEJA 2JSPA 1W7PA 3I53A 3VOEA 2AS5F 2WB1N 2YPRA 2HPIA 3CF2A 3QAHA 3TO9A 2HEOA 3E5QA 5EEAA 2Y0SN 3O8HA 5KAIC 4U7DA 2LOOA 2OU2A 2GXBA 2OF7A 2HNHA 4BXFA 3LQRA 2VOOA 1P4XA 4CA0A 4CYCA 3EUKL 3CC2I 4BXXJ 1YW9A 2K3FA 2B9SA 3MFKA 1IRZA 2F5VA 5L3FA 2HVRA 4Q48A 1SFKA 2IGKA 1O3TA 2ISZA 3CUQC 3HKZA 1FMWA 2K3PA 2QWWA 3OYAA 2VJJA 2ZNYA 2NVUB 5C3EJ 5EF6A 3SFIA 4MFDA 1XMAA 2PN6A 1J09A 4MO7A 4PJ0C 1IUYA 2X4HA 3W6JB 3OIOA 5B3SH 5ERIA 2QSHX 5KK1A 1MJBA 1MNMC 2CJJA 3RKWA 4KDPA 4LMYA 3SDBA 5H20A 5HDGA 1QBJA 4ABZA 4LK1F 2CFOA 2IW5A 5FD5A 5JVTA 2ZSIB 4XNFA 1UZCA 4BQNA 3DTIA 4LGWA 4M3BA 1EKEA 1HKTA 2E34A 2KPMA 3MCZA 1U6GA 2GXAA 1UMQA 4GFBA 4IQJA 3FWEA 1S9HA 4FE7A 4PGHA 1R23A 4Y52J 3KEYA 3B6CA 1VQ7I 1YOVB 3R60A 4HX8A 2GBYA 3NRVA 3A01B 2A07F 4XBFA 1K61A 2YU9J 1JGGA 4W97A 3HUGB 3SHFA 3RZOJ 2ZMEC 1NTCA 2R92J 4C3HJ 2HR3A 2OUMA 2L3DA 5F27A 2ZCWA 5H2FC 4KJZA 4F3QA 1OYIA 2LRDA 3CJRB 2QM3A 3K70D 2GM4A 3ZQFA 2PJPA 1FYKA 2ZSHB 3GZ6A 4BBRJ 4YFXF 4GDFA 3Q0UA 3T5XA 4MQVA 2EJRA 1T98A 2QBYB 2KRCA 2XVCA 4I6ZA 3VYRB 2XAJA 1W5SA 3BZCA 4Y4RA 4DYRA 1X1CA 3GTLJ 1MJAA 1VZ0A 2VXDA 3OYBA 3M3YJ 4KIFA 1PP8F 2R7SA 3WU0A 1FBSA 2M45A 3KYCB 3WGHA 3P9IA 3S1RJ 4HAMA 2H8WA 1AWCA 1O57A 2JA5J 1Z77A 1V5EA 3FMRA 4BAYA 3KZZA 3S15J 1MMDA 2E1MB 1XPXA 2KRFA 4JX6A 3DF8A 5E8GA 2VBYA 4KIGA 3RPUA 1OR7A 3MAJA 3L9FA 1OCOH 1H88C 3OV8A 3I4PA 5E3NA 2HDCA 5HDKA 1U2WA 3KYLA 1JHFA 2ZO4A 3H5NA 2V79A 2R7OA 3DLLF 2GWRA 3WHBA 1O4XA 2GLOA 3E5UA 1PJRA 4XRSG 2QF7A 1KGSA 2DOEA 3A01A 4E6KG 1I1GA 3O3KA 1J59A 2EH3A 2BY0A 4EQQA 9ANTA 1OFCX 4QLCU 3HUGA 2EFWA 3K7AJ 1T2KA 3QQAA 2WWYA 2E5ZA 1TT5B 2GIZA 3E6DA 2OV7A 3DKXA 4MQ9F 2L9RA 2UXXA 3L2VA 2GQQA 2HDDA 2HVQA 4BE2A 5E18F 2CUFA 1QHGA 1QRYA 1U5TA 4X6AJ 2DTZA 2HWVA 1SFXA 3P5JA 4ZC3A 2QBYA 2N8GA 3HDDA 1TT0A 3GEZA 4LIVA 2E60A 2L7ZA 2KKOA 3G1LA 5DTDA 2DMUA 2E5NA 1ZREA 1RI7A 2A68F 1T39A 1SMTA 2K02A 3H1CA 1SFEA 5H6RA 2IA1A 2A6HF 2XSJC 4EMSA 4HYEA 1ON1A 3I64A 3BY6A 2C6YA 2P0WA 4A3MJ 4QSHA 1D8KA 2ELJA 3F23A 4PJNA 1K78A 4KA4A 1B72A 3E1SA 4L9JA 4WX9A 3EQLF 4CH7A 2R7RA 3GTQJ 2JUCA 2MFZA 2P8TA 4A5MA 2FQ3A 4CUGA 5HS7A 1FZPB 2VLAA 1OISA 4D0PA 2OA4A 3M8FA 1Y0UA 2KJCA 4Z2YA 4M72A 3LSHA 5GAHJ 3MZHA 2VT3A 1BI1A 2DCEA 1LFBA 3J7AO 3OYEA 3G73A 1MMGA 4M74A 2I8DA 1DGWY 2XAHA 3HHGA 2OPTA 3BG7A 1FBUA 3FMSA 1SAUA 3PNTA 5DEQA 1S5LC 3KZIC 5DUKA 1EH6A 1MBGA 2F5FA 4RB2C 4PJJA 3CMYA 3ZMVA 3HOTA 4XLCA 2VIXA 2M34A 4KT6A 3SFZA 3L09A 1X1AA 1MW7A 4XMYA 4WF2A 4A3KJ 3S16J 2LY9A 4F91B 2A6TA 1T0FC 4A2UA 3AG3H 2FOKA 4ENJA 3W6KB 3VODA 2X9DA 4HPQA 3N4MA 1J75A 3SZTA 2DYSH 1MJ9A 3B73A 2BY2A 3TOBA 4L0ZB 5DYMA 2RQQA 4MEXF 2DT6A 3H9JA 4U0VA 1SMYF 4AD9A 2RN7A 4ZH4F 3DPLC 1IRFA 3OYMA 1R6RA 3S1NJ 3HKZN 2E35A 2K5CA 4PJMA 3QP5A 4HZFA 1MBKA 2X6XA 2P7CB 1SAXA 1UHMA 5KVRA 2EFQA 5LGNA 1GXQA 4JYKA 3JRHA 2NVXJ 1AU7A 2LNBA 1S29A 2FJ1A 1FSEA 1Y1WJ 1HW2A 1WH7A 1MBHA 5M5YJ 3CDLA 4Y15A 4UNOA 4I2OA 4UV8A 4ZYDA 4BHCA 2FRHA 3I71A 3W3CA 3F21A 2F5CA 4IHTA 3KP6A 2MGQA 2XRNA 2GOXB 4CGZA 2G0EA 1USTA 5F64A 1H89C 2OZUA 2Y9YA 5GTHC 3CO7C 5ILSA 1KZHA 4C3JJ 3BP8A 1SD6A 2CV0A 4HLXA 2DT7B 3KETA 4UUSB 5D4SA 4C2MJ 1G8XA 3WHCA 3RKXA 3J81Z 2R93J 3W2VA 2GXGA 2L4AA 4EGZA 3QPSA 3I59B 1TTYA 1CF7B 1B1BA 1R00A 2DK5A 2EBIA 1DQUA 1ZLKA 4AU7A 1X2MA 3SYTA 1V54H 2EINH 2IBDA 3GXOA 2DK8A 2ZC2A 4RA2A 2KRHA 3DKWA 1VQLI 2DA6A 3SZGA 4QPOA 4CZCA 5LRSA 2WAEA 4RGXA 4H4KC 3LWFA 1HW1A 3I4NJ 1WHUA 1ZN2A 4M9XA 3RYPA 1MSEC 3DXJF 3DKYA 5IP6A 3GBGA 3FKJA 5CVVA 2Z99A 4F92B 2E1CA 5IPAA 3FISA 1W0TA 5HLIA 2DLLA 2ECBA 5M5WJ 3RI4A 1ETKA 2VKVA 1VQKI 2LTPA 4D1QA 1Y39A 1TWAJ 4RLQA 3K1NA 3R0AA 3OR1C 2W84A 1BC7C 3HG9A 4N0BA 4HOBA 3BPXA 4NC7A 1TWFJ 2FNAA 4E7LA 3RKQA 1QZYA 2V9PA 2DDAA 4ZTJA 1FOXA 4XKVA 2DI3A 4GXOA 1UELB 3JSPA 3ZQIA 3HTUA 3NQOA 4IHVA 3HGGA 5FRMA 4AIKA 5ED4A 4YFKF 1R4MB 2F48A 2LFBA 3EUAA 2L7FP 3PFYA 2MA3A 2JPCA 1WRJA 4GRIA 2XF5A 2PQ8A 2ZB9A 4XM3A 2RC4A 2MH9A 2YUSA 3I59A 3TOAA 1CF7A 3I56I 1GT0C 2OQRA 1MBJA 2L2OA 5K1YA 2GOMA 4M73A 1J9IA 3W6VA 1AKHB 3QPHA 2VC1A 5GTIC 1HC8A 2XHKA 4HX7A 1R22A 3PSIA 2V1DA 1KYWA 1PDNC 3BG3A 3OIPA 5CYVA 2O8XA 2VT2A 2WTEA 1UB9A 3FM5A 4DJAA 3GX4X 3RTRA 3IH2A 2NS0A 3ASNH 1I3AA 2JQ7A 3PFIA 3RJPA 1R9TJ 2NNYA 1JXSA 3BJOA 3CCUI 3MD2A 1ZRFA 1WI9A 1Y0NA 3IL2A 2QQAA 4IL6C 2NS8A 1IXCA 3D0SA 1ZG1A 2AQFA 1G6NA 5LLQA 5BPIA 2L7KA 2M1BA 4RB1A 2XPUA 1XCVA 2QZ8A 1B59A 2CW0F 4F55A 4DZPA 3L7WA 5IYBJ 5LHHA 3CCVI 3V4GA 3BC8A 4G7HF 1LEBA 2LR8A 1UG0A 3MVPA 4BE0A 1W4MA 4OMZA 3HYIA 4U87A 1LJ9A 4NDLA 3ZCOA 1ON2A 3ULQB 1SD4A 5K7FA 4JQFA 2M8GX 2Q0OA 3BQYA 4UV9A 3HOYJ 2X6YA 3VFZA 2YU3A 1YIJI 1BA5A 3GF2A 1ZRCA 2A69F 3FKIJ 3UNGC 4DBQA 2CQKA 3PJRA 5EG0B 2K9SA 2XAQA 4QWQA 3I0TA 2XASA 4AC0A 4C2UA 3SZPA 1AKHA 3MMYB 2FMLA 3FK6A 3ZQ7A 2R5YA 1X4PA 2JA6J 1HKSA 3TDUC 5IT3A 1FOKA 1J2XA 1V3FA 3V7RA 3K10A 2P5LC 4R1HA 1FYMA 3TEDA 1OKRA 1ZG3A 5FKNA 5LHIA 3PSFA 3LNQA 2CQQA 4AVPA 3ZXSA 2D1VA 3UR3C 4J01A 3DU5A 4FQGA 4LOCA 2CH0A 4HDUA 1BOAA 4GGGA 3IRRA 2D5VA 3FMQA 3S1MJ 4B43A 4RDUA 3WTUC 1POGA 3JW4A 4ESJA 2R7WA 3OS0A 4LFUA 4LD5A 1EJ9A 4A69C 3LFUA 3KP2A 3FHNA 2CG4A 2MG4A 3ZMUA 4CCNA 1W5CC 4JK1X 1O3SA 1WGXA 4GO1A 2EQRA 3KPHA 4RBOA 4P96A 3SJMA 1MBFA 3JRGA 5FFZA 5F08A 3G6EI 3GUDA 2E19A 4ANJA 3FZVA 3IWFA 4IF4A 5EGOB 2OD5A 1M1EB 4OIRF 4WXDA 5L3EA 3BQZA 1D0XA 3ZQCA 1R1UA 2LF8A 2B0LA 4II2A 1STZA 2BGCA 3OOUA 4M6YA 2XDVA 1FJLA 3HRSA 1EA3A 4LB6B 4WWCA 2CUZA 2VL8A 3IH4A 2RV8A 1S6LA 3OSGA 4H0EA 2M5WA 1RRJA 4G6DA 5E3MA 3T1BA 4YRVA 3IV5A 4XRFA 2E7WA 3KIOA 1ZGAA 3ZQLA 1W7PB 4QPQA 2FNPA 3BZ6A 1JT6A 2L0KA 3IH3A 2ZJQF 2A61A 3HEFA 5CVIA 2KQRA 5TGTA 1XDSA 1N25A 2MYSA 1BI3A 5F0HA 3D5RC 4XKWA 1HA8A 4FCYA 2ME6A 1RC9A 3L2QA 2O5RA 3A0HC 4CYCB 5TRDA 2LYCA 3ZGKA 4PGGA 2V6EA 2AHQA 2COMA 1WWXA 1LB2A 4UB8C 3WE2A 1X58A 1A6QA 4B3AA 2R7QA 1O3QA 2M7BA 3Q9VA 2EK5A 3KCCA 2HXIA 2DMQA 5E20A 3LQQA 3ESWB 2ID6A 2MH2A 3HL2A 4EM1A 1U8BA 4YFNF 4ZYEA 3WTYC 1IXSB 2P5KA 2FX0A 3V7SA 2UWMA 2MD5A 3FBIB 4KICA 4BDYA 1TNSA 5FLXZ 5HLGA 4S05A 2CMPA 1LFPA 3RPQA 1XGOA 1FTZA 2ELKA 4IOCF 4AUXA 4AVZA 2M8EA 3R0JA 4B09A 5F6FA 5EYRA 2CFXA 2DA7A 4BY1J 4FETA 2OJED 2FBHA 1WJCA 2YR2A 5CJ9A 2G9WA 2Q2EB 3KYDB 5BPDA 4XORA 2KIFA 1I39A 1YRNB 1BM9A 3G1MA 1V4RA 3ZN0A 5CVUA 1R49A 2E1MC 1YW8A 3T8RA 4A6EA 3GVAA 3L2UA 3K1PA 3MZYA 3KEOA 4CCOA 4ZYGA 3LOCA 4BJ5C 1R7JA 2JRTA 1ZRDA 1K79A 4QTRA 4GYIA 2DU9A 1JTXA 3OYGA 1K4TA 3G4SI 2PX9A 3D5SC 2X6OA 1RZ4A 1P7JA 1MZBA 1ETQA 3E7LA 5J40A 2XKPA 3BR1A 1XS9A 3QOEA 2CV1A 2LY1A 1E17A 2K9LA 2P5VA 2XGDA 3R6SA 3ZP5A 4YELA 3NWSA 2IXSA 2BEOA 3WU2C 5HNFA 2JA8J 4IOAF 3BLYA 2XF6A 3W2AA 3BG6A 1E3HA 3E0JB 3VYSB 1BIBA 3CLQA 1CGPA 3VWBA 1TC3C 2KJBA 4ZZLA 1MGTA 4DNCA 2ZFWA 2VN2A 1JUMA 2DAOA 3A1YA 1HKQA 1FLIA 1MDMB 1WH5A 1BW6A 1R5ID 4NBQA 2P4WA 3JRDA 2ADUA 2K86A 3OYDA 5EEGA 4Z6YA 4N4NB 1JJ8C 2ZBKA 2Y30A 3GZNB 2WAQA 2XV4S 3BR5A 4K2EA 2G7UA 2XB5A 1JJ6C 2XRLA 2Q2EA 1XG1A 2DA3A 1DU6A 1FC3A 1YRNA 2NVQJ 2QVOA 1F43A 1ZR2A 4NB5A 1UJ8A 1KONA 1T6SA 1TZLA 2BV6A 1FX7A 2L7MP 2JPBA 3HSFA 2V4JC 3GLLA 1VQMI 1D0ZA 1XC5A 5D8LB 1Z3XA 1SD7A 2F6CA 4PFPA 2O6GE 2EZKA 1XX5A 3QYFA 3QYEA 1JKOC 1LDDA 4CO8A 1U5TB 2V26A 1XCBA 2P6TA 4RGRA 1H9GA 2BE5F 2LBFA 5KAFC 1T95A 1QQIA 2HXOA 3MQ0A 4UUTA 4HNVA 5LD2C 1BJAA 1LVKA 4CCJA 2M0CA 2JVGA 2VQCA 1YW7A 4P1WA 4KITB 2FE3A 3I54A 2WV1A 3FXQA 2LKPA 2MABA 3GLXA 3OYFA 2W7NA 1HF0A 4ZDLA 2DPUA 4ESFA 2R7XA 3GWZA 2IAIA 2IEKA 1J5YA 2FQ4A 3RQIA 2RAEA 2COBA 2BZTA 1SANA 4MGRA 4MFEA 1K78B 1WI3A 3ML6A 1B72B 2VJ4A 3S32A 3RZDJ 2OZ6A 1TWHJ 1MDMA 3HRUA 4JX4A 1IZ1A 2ID3A 2LC2A 4MLOA 2IRFG 1YE9A 2LLKA 4G12A 4ETSA 4P5OA 1R4NB 4JBAA 2A5WA 1Y8RB 3PQJA 1B4AA 5FROA 3F72A 1YIOA 5J6XA 4A3JJ 4IKFA 1EV7A 3FXOA 3KLOA 4G94A 4RS8A 1S7AA 1XB4A 4B8XA 1FBQA 2O7OA 4BYYA 2LH9A 1N75A 1VF9A 5JLWA 2QKMB 2NXNB 3CJNA 5FLXK 4M3EA 2KMUA 2DMTA 3VB2A 3QWLA 1CQTA 2IGMA 2JWTA 2MD0A 2R0QC 5D5XB 4XLHA 2R7ZJ 5IYCJ 4XLFA 1WJAA 1W1WE 5FKMA 2E7XA 5DV5A 2VE9A 3QOPA 1XD7A 1QGPA 1WCMJ 3HRMA 1E0EA 3F8CA 3GO5A 5D8KB 2XKOA 5GAGJ 1S7EA 3V42A 1FOYA 4BGDA 3DU6A 3ZOBA 2XROA 2BXZA 3PNYA 1PP7U 4IHYA 5BS6A 4I0BA 2VPLA 2K9MA 3C18A 4B1RA 3FDYA 4XLEA 2EB7A 2WV0A 3CP2A 4MHGA 3T8TA 2XAFA 3TP0A 2RNGA 5JHFA 4PSXA 3H9GA 3KP7A 5J4VA 2BHYA 4JOMA 4L18B 4YG2F 1OYWA 3RYRA 3GTGJ 2DODA 4MEYF 2R7TA 2ICWG 3ABMH 4CCMA 4G7ZF 3IAM2 5GPAA 1K83J 3MZ8A 3ZQQA 4ZZDA 2EA4A 4BJTA 1I1SA 3N97A 1G3WA 1O7FA 1FP1D 4CZZA 1ZYRF 4AIJA 1UHWA 2GA1A 3M9AA 1X1DA 4HV6A 1YX5A 3DQVC 4XSZF 5EEHA 3K6GA 3U2RA 1P4WA 1TP4A 4KFCA 1V5FA 3CJTB 1JUSA 2M0MA 4IJAA 4IRHA 1JI8A 2QSFX 4XKBA 3JSOA 4A3GJ 1GDTA 4A5NA 3AL0B 4ZJZA 3K69A 1YG2A 4XRMA 3QPTA 4KISA 1WJDA 4XONA 3CUQA 2GAUA 2IJLA 1Y8QB 2VBWA 4DOZA 1A31A 1LQ1A 4A3CJ 3I3LA 4GYGA 1R71A 3JRAA 2L01A 1R36A 2JZYA 4ZYAA 1LKXA 3FXLA 2DA4A 3SQNA 4U0WA 1VFCA 4HDVA 3WG9A 2J5PA 1F9NA 2BW3B 2CS3A 1G59A 3JR9A 2L54A 3REOA 1DU0A 1FT9A 2LKSA 4B44A 4HBLA 5D6FA 3HRTA 2Z3YA 3L2WA 1UHSA 1K6YA 3E3VA 3DLAA 3DEUA 5IOZA 1YS6A 3BROA 5IT9Z 2EIJH 5DD4A 2F4IA 2MW8A 3ZRGA 2LMDA 3QU3A 2H94A 3LMMA 2PI0A 4RAGA 3PUFA 1QPMA 3OYNA 2JUGA 3K4MA 2HZTA 1MNEA 1NG6A 1R58A 2Z16A 3IAS2 2PG4A 2IP2A 4KUMA 4XN0A 4BNCA 1DGRM 2RKHA 1JKPC 5IP7J 3OYLA 2QEXI 3QU6A 2STTA 1DP7P 3K1MA 3GW2A 1JT0A 2E1NA 2VQLA 4IRIA 2O3FA 2ZMEA 4UB6C 2VODA 3KFWX 2JA2A 3H9QA 2OTJI 5DCMA 4E7IA 1K4SA 1W36C 1V55H 1IAWA 2KP6A 1OCCH 2WAQN 3Q9SA 4E7SA 4LK0F 1ITYA 4FX0A 4A12A 1ETOA 5DD8A 2LREA 2MC4A 2UXNA 3SEQA 1T56A 2DFHA 1BR2A 1SD5A 3PL8A 1WZ2A 4PSWA 4BXUA 1H8AC 4M3DA 1BJZA 3P9KA 1W5TA 1GXPA 5GADJ 4MTDA 1BI0A 4KMFA 4UVAA 1TLHB 3LL7A 2BW3A 3GYHX 1IN6A 2BHZA 1U3EM 2WY8Q 4I76A 3HGYA 2K85A 5CKTA 4XR6A 3S8PA 4A6DA 3ZN1A 2A3SA 3I5UA 2VPRA 5J8FA 5LBQA 3AKZA 2W85A 1FEXA 3IKVA 1I5ZA 3TW7A 3MKYB 1Z9CA 4II3A 3PM1A 3QPLA 1G3TA 1LDJA 1P2FA 1KYZA 1P6RA 2PMHA 1YS7A 2W48A 5FKKA 5JVGF 4NNJA 5CPRB 3KLNA 4XRSA 5J1UA 1YHQI 1E2XA 2Q8KA 2NVTJ 2R7VA 1XN7A 3DTKA 1TW3A 3CF5F 3V8KA 5AIPA 1H9TA 4Q4ZF 5BQTA 2XB0X 4Y33A 4I99C 4LIUA 5K5OA 1IW7F 2EV0A 3RQ4A 5EZGA 3K4JA 1QPIA 1B9MA 3FXMA 4BUPA 2V6CA 3BCBA 2A6EF 3ABLH 3JTGA 1OYYA 2QKLB 4BU2A 3HOXJ 2FF4A 1YFHA 2DBBA 4V19K 5D4RA 2LDUA 3A02A 5FB2A 3DBLB 2EIKH 3LA2A 1MNDA 5H6QA 2R5YB 4OINF 1FTTA 1W0UA 1LEAA 2R7UA 3EPZA 4I0AA 2R4GA 2F4OB 3CESA 5ICGA 1BIAA 5HOOA 5BMZA 3A2KA 1QHHD 1VI0A 1XMXA 2JTVA 3FHZA 4WXCA 1KA8A 4OU0A 2Z9OA 2DTRA 3HHHA 1ZARA 3CQZJ 3HZJA 4EM0B 5E17F 2XAUA 1FYLA 5L3GA 2OQGA 5B1BH 4BQQA 2PMUA 3O8GA 5GAEJ 3K2ZA 2X85A 2HVSA 1RKTA 1QU3A 4XL9A 4HLYA 3V7CA 5BOXA 1HSTA 1ONVA 5HS9A 4IPAA 2V9KA 4KN7X 1ZLJA 3KEQA 2P7VB 2Y75A 2PJRA 3K9TA 4C30A 3JRIA 2JK3A 4X1EA 3VDXA 1W7PD 4HF0A 3S3MA 3K2AA 2I5UA 5ICEA 2FD5A 5HLHA 3GFMA 4A3DJ 1YJWI 5IT9K 2NNNA 2Y31A 3F6OA 4XK4A 1D0YA 3VPRA 2DYRH 3BR0A 4RM3A 3CMAI 2V7FA 3ERMA 4A0XA 1Z1DA 1GVDA 4G6TB 2IS2A 3OS1A 3ABKH 5E3OA 1A5JA 1QVTA 4F7ZA 1IXRC 3CCMI 5B5EC 2E2IJ 1SVMA 2CQXA 3QODA 4BHBA 4HQMA 4BE1A 1T0FA 3F8FA 1IV6A 4OMYA 3A0BC 1B8IA 4LLLA 1KU2A 3DWLE 1WFXA 3PNVA 3HOWJ 2ZJPF 4GCVA 1ODDA 2HTJA 3JAMZ 2DN0A 2LSOA 3TW6A 1WVRA 1UG2A 5D5WB 1D5VA 1IC8A 3K4CA 1I3QJ 2HOSA 2RQPA 1USSA 2H27A 2GZWA 4D7NA 4UVCA 3HJEA 5CLSA 4E7HA 4LB5A 4A3FJ 4ITVA 5FO5A 2IA0A 1Y1VJ 2QGUA 3GFJA 2PEXA 1SEUA 3BZKA 4S0HB 1OCRH 4I7HA 4U7BA 4OIOF 2M2EA 4G8XA 4EEFG 1MMNA 4M9ZA 3U1DA 4C9YA 2K7LA 1TQPA 4YEJA 3WODF 3PUBA 4IRGA 1Z05A 4P9UA 4A0YA 1HXDA 2EWNA 2QLZA 4I01A 5HLTA 4XICA 1HSJA 2J5OA 5JR3A 1D3YA 2X48A 1I50J 1NG7A 3CUOA 4PJLA 4ON0A 3O2PE 4HEA2 4RLFA 2HQ5A 3T0YA 2R7FA 4HG2A 3GFIA 1T8IA 5GP9A 3L00A 1B6AA 3S1QJ 3MN2A 4BEHA 4WXHA 4XOPA 2FBKA 3MEXA 3WE3A 2JT1A 2KZGA 1ULYA 1TBXA 2M7AA 2Y69H 1C0WA 2O8KA 1J0RA 2H09A 3U1KA 3EUHA 4EJVA 5DUIA 3BJ6A 1YTYA 3B02A 2BVMA 3BPVA 1GHCA 5E8IA
chains in the Genus database with same CATH topology
1WH5A 1BW6A 3JRDA 3BTLA 1JJ8C 1RKWA 4D5CA 2XPVA 1IG7A 4J19A 1MH4A 2Y30A 1Q1VA 1B8IB 2VUMJ 3BR5A 4UUSA 1LFBA 2M9HA 3F0CA 2XB5A 1JJ6C 2XRLA 1XG1A 2DA3A 1DU6A 3HB9A 2OPTA 3OSFA 1YRNA 2NVQJ 1F43A 1ZR2A 1A6IA 5M3MJ 3GTOJ 2L7MP 5C4XJ 1MBGA 5J1RA 5BNGA 1F36A 3CMYA 3D1NI 1HDDC 1TWCJ 1XC5A 1OCPA 2EZKA 3BG9A 2M34A 3UKGA 1JKOC 2K9QA 3C2BA 2Y2ZA 1EF4A 1Z0XA 2LK2A 2LKXA 5IYDJ 4A3KJ 4UUTA 4DYCA 2HXOA 4Y7NJ 4HNVA 3S16J 2LY9A 2M0CA 5FKLA 4D7MA 2X9DA 3Q0WA 2O9LA 2WV1A 2H1KA 4FISA 2K9NA 1TWGJ 5EDNA 1HF0A 5M5XJ 1JTYA 5J1YA 5DS9A 2IAIA 3S1NJ 2IEKA 2FQ4A 5F1JA 3HKZN 3RQIA 2RAEA 2COBA 3BR2A 1MBKA 1SANA 4MFEA 1WI3A 1B72B 1FIPA 2E2JJ 4JYKA 3TP3A 1MBEA 3JRHA 4A3EJ 3RZDJ 1TWHJ 1AU7A 2NVXJ 3H3VK 3CCYA 2FJ1A 2XGCA 4JX4A 4D5FA 1Y1WJ 1WH7A 1MBHA 5M5YJ 1IJWC 2ID3A 2ECCA 3BR3A 4MLOA 3CDLA 3S14J 2DMPA 1WPKA 2TCTA 2LLKA 4G12A 1X2NA 2AO9A 2MGQA 2G0EA 1H89C 2Y9YA 2ME0A 4A3JJ 4C3JJ 2CUEA 3DCFA 2O7OA 4UUSB 4C2MJ 3WHCA 1VF9A 5JLWA 2R93J 3QPSA 4M3EA 5C4JJ 2VI6A 2EBIA 2DMTA 1X2MA 3DEWA 4W1UA 3HOVJ 5F0FA 1GV5A 2IBDA 2H8RA 1CQTA 2DA6A 1ZTRA 1ZQ3P 3G1OA 2JWTA 2R0QC 2R7ZJ 5IYCJ 3HM5A 5IOYA 5FKMA 1HLVA 2JJ7A 3BG5A 4QIWN 3I4NJ 1MSEC 1WCMJ 1D5YA 4L5EA 1S7EA 2EZLA 5IP6A 3GBGA 3L1PA 3ZOBA 5IPAA 3FISA 5K7ZA 2KDZA 1W0TA 2JMWA 2HYJA 4IHYA 2ECBA 3LSPA 5M5WJ 4B1RA 1ETKA 2VKVA 2LTPA 1TWAJ 3TP0A 4JX5A 1U78A 2MSYA 5M3FJ 1TWFJ 1IGNA 1RPWA 3RKQA 3GTGJ 2VKEA 2R5ZB 2NS7A 5GPAA 4V2FA 1K83J 3ZQIA 2XSDC 2DJNA 3PO3J 3PO2J 4IHVA 3S2HJ 4A3IJ 3HGGA 4IHXA 2LFBA 2L7FP 5EG0A 1ZK8A 5FKOA 3SDGA 2ZB9A 1FIAA 2DA5A 3FK7A 1LE8B 2YUSA 1JUSA 1GT0C 1MBJA 2TRTA 1ZKGA 3LSGA 4A3GJ 1GDTA 2DA2A 2JA7J 3W6VA 1AKHB 5IP9J 1JKRC 2NVYJ 4XRMA 4FTHA 3BG3A 4A3CJ 2HOAA 1T33A 1QVUA 3JRAA 3IH2A 1SFOJ 1R9TJ 3M4OJ 1G2HA 4M3FA 5JLXA 2DA4A 2E1OA 1VFCA 3MKLA 5F0CA 3JR9A 3I4MJ 1DU0A 2NS8A 2HI3A 2YS9A 3BT9A 2B63J 2XPUA 1UHSA 5FLMJ 1ENHA 1JUPA 5C44J 1IDYA 4DZPA 5F04A 3A03A 1NK3P 5IYBJ 1ETYA 4JP0A 3H0GJ 5IOZA 2P81A 1LFUP 3GTPJ 2MW8A 3BTIA 2R5ZA 1ETVA 1NK2P 2LR8A 2QCOA 3MVPA 3B6AA 1RESA 3ZQHA 4NDLA 4BKXA 2HOTA 5K7FA 2M8GX 3BQYA 4B4CA 4XIDA 1JKPC 5IP7J 3HOYJ 2K40A 1JT0A 1BA5A 2XGEA 3BR6A 1LE8A 1MSFC 3FKIJ 3JRCA 5EG0B 2K9SA 5EGOA 4AC0A 2CRGA 1AKHA 1RR7A 3FK6A 2WAQN 2R5YA 1ITYA 2JA6J 1ETOA 4BY7J 1HCRA 3NAUA 1U9NA 1VNDA 1MH3A 1AHDP 1T56A 2LVSA 4IHWA 2XPWA 3TEDA 5FKNA 1H8AC 1BW5A 4M3DA 3LNQA 1BJZA 2CQQA 1ETXA 3LSJA 1BL0A 4LOCA 5E3LA 4IEJA 4I76A 2WB1N 3HGYA 5K7HA 2PMZN 3GTKJ 2D5VA 4DZJA 5EEAA 2VPRA 2Y0SN 3O8HA 3LSRA 4M6VA 2OF7A 3S1MJ 1FEXA 3TW7A 1JKQC 4RDUA 3PM1A 3QPLA 4DYQA 1POGA 1IDZA 4CYCA 2W48A 5FKKA 3GTMJ 4BXXJ 4A69C 1GV2A 4XRSA 5J1UA 1IRZA 3JREA 2NVTJ 4BBSJ 2MG4A 1WGXA 2EQRA 1OJLA 5C3EJ 5EF6A 3Q0VA 3NARA 2XB0X 3SFIA 4RBOA 3SJMA 1MBFA 4MFDA 3JRGA 4MO7A 5F08A 5EZGA 1QPIA 3OIOA 3GTJJ 4MIMA 2E19A 1MNMC 2CJJA 3HOXJ 5EGOB 4ABZA 3BQZA 2DMNA 3ZQCA 1PUFB 3A02A 2LP0A 4M3BA 2R5YB 2KT0A 1FTTA 3OOUA 1UMQA 5HODA 2LD5A 1W0UA 1FJLA 4GFBA 4FE7A 3IH4A 4V2GA 1VI0A 3OSGA 1ZGWA 3B6CA 4Y52J 2GBYA 3A01B 3CQZJ 1K61A 2YU9J 2JN6A 4DW6A 5E3MA 1JGGA 4W97A 3IV5A 3RZOJ 2EZHA 1NTCA 3O8GA 2R92J 4C3HJ 5FLVA 1RKTA 5F27A 3ZQLA 3ZQGA 1ZR4A 1JT6A 2L0KA 3IH3A 3HEFA 1GUUA 1RETA 2GM4A 3ZQFA 5F0HA 2I10A 1U9OA 4BBRJ 4FCYA 3Q0UA 2ME6A 4I6ZA 4CYCB 1HDPA 4DYRA 2JK3A 3JRIA 4X1EA 2AHQA 5J3LA 3GTLJ 3M3YJ 1X58A 4B3AA 3K2AA 2FD5A 3JRBA 4A3DJ 2HXIA 2DMQA 3S1RJ 2Y31A 4XK4A 2ID6A 3VPRA 2JA5J 3BR0A 1Z77A 3HOUJ 1U8BA 3HOZJ 1I6HJ 2FX0A 1GVDA 3S15J 4A3BJ 3Q3SA 1PUFA 4JX6A 5E3OA 1A5JA 1QVTA 2CU7A 1H88C 3BTJA 5E3NA 2E2IJ 2CQXA 4A93J 1IUFA 4M3GA 1IV6A 3HBLA 1FTZA 1B8IA 2ELKA 3WHBA 4AYBN 4AUXA 4C3IJ 5FJ8J 2Y9ZA 1O4XA 2GLOA 3HOWJ 4XRSG 2QF7A 2DN0A 3A01A 5EYRA 3TW6A 3S17J 3FIWA 2DA7A 4BY1J 2EH3A 1UG2A 9ANTA 1OFCX 1IC8A 1HOMA 1I3QJ 3K7AJ 2HOSA 3QQAA 4D7NA 4A3FJ 3G1MA 1YRNB 2L9RA 5GPCA 2HDDA 1Y1VJ 2CUFA 2DA1A 4S0HB 4FE4A 1QRYA 2M2EA 3LOCA 4EEFG 2DTZA 2NOGA 4X6AJ 1E3OC 2N8GA 4QTRA 3HDDA 1ETWA 1JTXA 2EZIA 2L7ZA 3G1LA 5DTDA 2DMUA 4XICA 2X48A 1I50J 2X6OA 1P7JA 1P7IA 5EZHA 1ETQA 2HQ5A 3E7LA 3BR1A 1XS9A 5GP9A 4A3MJ 3S1QJ 2XGDA 3MN2A 4QSHA 3BTCA 1B72A 2JA8J 2E2HJ 3S2DJ 1APLC 3GTQJ 1TC3C 1OCTC 2O8KA 1JUMA 4A3LJ 1ORKA 3JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH5 A;  1BW6 A;  3JRD A;  3BTL A;  1JJ8 C;  1RKW A;  4D5C A;  2XPV A;  1IG7 A;  4J19 A;  1MH4 A;  2Y30 A;  1Q1V A;  1B8I B;  2VUM J;  3BR5 A;  4UUS A;  1LFB A;  2M9H A;  3F0C A;  2XB5 A;  1JJ6 C;  2XRL A;  1XG1 A;  2DA3 A;  1DU6 A;  3HB9 A;  2OPT A;  3OSF A;  1YRN A;  2NVQ J;  1F43 A;  1ZR2 A;  1A6I A;  5M3M J;  3GTO J;  2L7M P;  5C4X J;  1MBG A;  5J1R A;  5BNG A;  1F36 A;  3CMY A;  3D1N I;  1HDD C;  1TWC J;  1XC5 A;  1OCP A;  2EZK A;  3BG9 A;  2M34 A;  3UKG A;  1JKO C;  2K9Q A;  3C2B A;  2Y2Z A;  1EF4 A;  1Z0X A;  2LK2 A;  2LKX A;  5IYD J;  4A3K J;  4UUT A;  4DYC A;  2HXO A;  4Y7N J;  4HNV A;  3S16 J;  2LY9 A;  2M0C A;  5FKL A;  4D7M A;  2X9D A;  3Q0W A;  2O9L A;  2WV1 A;  2H1K A;  4FIS A;  2K9N A;  1TWG J;  5EDN A;  1HF0 A;  5M5X J;  1JTY A;  5J1Y A;  5DS9 A;  2IAI A;  3S1N J;  2IEK A;  2FQ4 A;  5F1J A;  3HKZ N;  3RQI A;  2RAE A;  2COB A;  3BR2 A;  1MBK A;  1SAN A;  4MFE A;  1WI3 A;  1B72 B;  1FIP A;  2E2J J;  4JYK A;  3TP3 A;  1MBE A;  3JRH A;  4A3E J;  3RZD J;  1TWH J;  1AU7 A;  2NVX J;  3H3V K;  3CCY A;  2FJ1 A;  2XGC A;  4JX4 A;  4D5F A;  1Y1W J;  1WH7 A;  1MBH A;  5M5Y J;  1IJW C;  2ID3 A;  2ECC A;  3BR3 A;  4MLO A;  3CDL A;  3S14 J;  2DMP A;  1WPK A;  2TCT A;  2LLK A;  4G12 A;  1X2N A;  2AO9 A;  2MGQ A;  2G0E A;  1H89 C;  2Y9Y A;  2ME0 A;  4A3J J;  4C3J J;  2CUE A;  3DCF A;  2O7O A;  4UUS B;  4C2M J;  3WHC A;  1VF9 A;  5JLW A;  2R93 J;  3QPS A;  4M3E A;  5C4J J;  2VI6 A;  2EBI A;  2DMT A;  1X2M A;  3DEW A;  4W1U A;  3HOV J;  5F0F A;  1GV5 A;  2IBD A;  2H8R A;  1CQT A;  2DA6 A;  1ZTR A;  1ZQ3 P;  3G1O A;  2JWT A;  2R0Q C;  2R7Z J;  5IYC J;  3HM5 A;  5IOY A;  5FKM A;  1HLV A;  2JJ7 A;  3BG5 A;  4QIW N;  3I4N J;  1MSE C;  1WCM J;  1D5Y A;  4L5E A;  1S7E A;  2EZL A;  5IP6 A;  3GBG A;  3L1P A;  3ZOB A;  5IPA A;  3FIS A;  5K7Z A;  2KDZ A;  1W0T A;  2JMW A;  2HYJ A;  4IHY A;  2ECB A;  3LSP A;  5M5W J;  4B1R A;  1ETK A;  2VKV A;  2LTP A;  1TWA J;  3TP0 A;  4JX5 A;  1U78 A;  2MSY A;  5M3F J;  1TWF J;  1IGN A;  1RPW A;  3RKQ A;  3GTG J;  2VKE A;  2R5Z B;  2NS7 A;  5GPA A;  4V2F A;  1K83 J;  3ZQI A;  2XSD C;  2DJN A;  3PO3 J;  3PO2 J;  4IHV A;  3S2H J;  4A3I J;  3HGG A;  4IHX A;  2LFB A;  2L7F P;  5EG0 A;  1ZK8 A;  5FKO A;  3SDG A;  2ZB9 A;  1FIA A;  2DA5 A;  3FK7 A;  1LE8 B;  2YUS A;  1JUS A;  1GT0 C;  1MBJ A;  2TRT A;  1ZKG A;  3LSG A;  4A3G J;  1GDT A;  2DA2 A;  2JA7 J;  3W6V A;  1AKH B;  5IP9 J;  1JKR C;  2NVY J;  4XRM A;  4FTH A;  3BG3 A;  4A3C J;  2HOA A;  1T33 A;  1QVU A;  3JRA A;  3IH2 A;  1SFO J;  1R9T J;  3M4O J;  1G2H A;  4M3F A;  5JLX A;  2DA4 A;  2E1O A;  1VFC A;  3MKL A;  5F0C A;  3JR9 A;  3I4M J;  1DU0 A;  2NS8 A;  2HI3 A;  2YS9 A;  3BT9 A;  2B63 J;  2XPU A;  1UHS A;  5FLM J;  1ENH A;  1JUP A;  5C44 J;  1IDY A;  4DZP A;  5F04 A;  3A03 A;  1NK3 P;  5IYB J;  1ETY A;  4JP0 A;  3H0G J;  5IOZ A;  2P81 A;  1LFU P;  3GTP J;  2MW8 A;  3BTI A;  2R5Z A;  1ETV A;  1NK2 P;  2LR8 A;  2QCO A;  3MVP A;  3B6A A;  1RES A;  3ZQH A;  4NDL A;  4BKX A;  2HOT A;  5K7F A;  2M8G X;  3BQY A;  4B4C A;  4XID A;  1JKP C;  5IP7 J;  3HOY J;  2K40 A;  1JT0 A;  1BA5 A;  2XGE A;  3BR6 A;  1LE8 A;  1MSF C;  3FKI J;  3JRC A;  5EG0 B;  2K9S A;  5EGO A;  4AC0 A;  2CRG A;  1AKH A;  1RR7 A;  3FK6 A;  2WAQ N;  2R5Y A;  1ITY A;  2JA6 J;  1ETO A;  4BY7 J;  1HCR A;  3NAU A;  1U9N A;  1VND A;  1MH3 A;  1AHD P;  1T56 A;  2LVS A;  4IHW A;  2XPW A;  3TED A;  5FKN A;  1H8A C;  1BW5 A;  4M3D A;  3LNQ A;  1BJZ A;  2CQQ A;  1ETX A;  3LSJ A;  1BL0 A;  4LOC A;  5E3L A;  4IEJ A;  4I76 A;  2WB1 N;  3HGY A;  5K7H A;  2PMZ N;  3GTK J;  2D5V A;  4DZJ A;  5EEA A;  2VPR A;  2Y0S N;  3O8H A;  3LSR A;  4M6V A;  2OF7 A;  3S1M J;  1FEX A;  3TW7 A;  1JKQ C;  4RDU A;  3PM1 A;  3QPL A;  4DYQ A;  1POG A;  1IDZ A;  4CYC A;  2W48 A;  5FKK A;  3GTM J;  4BXX J;  4A69 C;  1GV2 A;  4XRS A;  5J1U A;  1IRZ A;  3JRE A;  2NVT J;  4BBS J;  2MG4 A;  1WGX A;  2EQR A;  1OJL A;  5C3E J;  5EF6 A;  3Q0V A;  3NAR A;  2XB0 X;  3SFI A;  4RBO A;  3SJM A;  1MBF A;  4MFD A;  3JRG A;  4MO7 A;  5F08 A;  5EZG A;  1QPI A;  3OIO A;  3GTJ J;  4MIM A;  2E19 A;  1MNM C;  2CJJ A;  3HOX J;  5EGO B;  4ABZ A;  3BQZ A;  2DMN A;  3ZQC A;  1PUF B;  3A02 A;  2LP0 A;  4M3B A;  2R5Y B;  2KT0 A;  1FTT A;  3OOU A;  1UMQ A;  5HOD A;  2LD5 A;  1W0U A;  1FJL A;  4GFB A;  4FE7 A;  3IH4 A;  4V2G A;  1VI0 A;  3OSG A;  1ZGW A;  3B6C A;  4Y52 J;  2GBY A;  3A01 B;  3CQZ J;  1K61 A;  2YU9 J;  2JN6 A;  4DW6 A;  5E3M A;  1JGG A;  4W97 A;  3IV5 A;  3RZO J;  2EZH A;  1NTC A;  3O8G A;  2R92 J;  4C3H J;  5FLV A;  1RKT A;  5F27 A;  3ZQL A;  3ZQG A;  1ZR4 A;  1JT6 A;  2L0K A;  3IH3 A;  3HEF A;  1GUU A;  1RET A;  2GM4 A;  3ZQF A;  5F0H A;  2I10 A;  1U9O A;  4BBR J;  4FCY A;  3Q0U A;  2ME6 A;  4I6Z A;  4CYC B;  1HDP A;  4DYR A;  2JK3 A;  3JRI A;  4X1E A;  2AHQ A;  5J3L A;  3GTL J;  3M3Y J;  1X58 A;  4B3A A;  3K2A A;  2FD5 A;  3JRB A;  4A3D J;  2HXI A;  2DMQ A;  3S1R J;  2Y31 A;  4XK4 A;  2ID6 A;  3VPR A;  2JA5 J;  3BR0 A;  1Z77 A;  3HOU J;  1U8B A;  3HOZ J;  1I6H J;  2FX0 A;  1GVD A;  3S15 J;  4A3B J;  3Q3S A;  1PUF A;  4JX6 A;  5E3O A;  1A5J A;  1QVT A;  2CU7 A;  1H88 C;  3BTJ A;  5E3N A;  2E2I J;  2CQX A;  4A93 J;  1IUF A;  4M3G A;  1IV6 A;  3HBL A;  1FTZ A;  1B8I A;  2ELK A;  3WHB A;  4AYB N;  4AUX A;  4C3I J;  5FJ8 J;  2Y9Z A;  1O4X A;  2GLO A;  3HOW J;  4XRS G;  2QF7 A;  2DN0 A;  3A01 A;  5EYR A;  3TW6 A;  3S17 J;  3FIW A;  2DA7 A;  4BY1 J;  2EH3 A;  1UG2 A;  9ANT A;  1OFC X;  1IC8 A;  1HOM A;  1I3Q J;  3K7A J;  2HOS A;  3QQA A;  4D7N A;  4A3F J;  3G1M A;  1YRN B;  2L9R A;  5GPC A;  2HDD A;  1Y1V J;  2CUF A;  2DA1 A;  4S0H B;  4FE4 A;  1QRY A;  2M2E A;  3LOC A;  4EEF G;  2DTZ A;  2NOG A;  4X6A J;  1E3O C;  2N8G A;  4QTR A;  3HDD A;  1ETW A;  1JTX A;  2EZI A;  2L7Z A;  3G1L A;  5DTD A;  2DMU A;  4XIC A;  2X48 A;  1I50 J;  2X6O A;  1P7J A;  1P7I A;  5EZH A;  1ETQ A;  2HQ5 A;  3E7L A;  3BR1 A;  1XS9 A;  5GP9 A;  4A3M J;  3S1Q J;  2XGD A;  3MN2 A;  4QSH A;  3BTC A;  1B72 A;  2JA8 J;  2E2H J;  3S2D J;  1APL C;  3GTQ J;  1TC3 C;  1OCT C;  2O8K A;  1JUM A;  4A3L J;  1ORK A;  3JRF A; 
#chains in the Genus database with same CATH topology
 3OYJ A;  3IWZ A;  5A2Q K;  2W82 A;  4L9N A;  2XPV A;  2DQL A;  1B9N A;  1Q1V A;  4XN3 A;  2VUM J;  3COA C;  2M9H A;  3F0C A;  4ZYH A;  1SVO A;  3ECH A;  1WQ2 A;  3TL4 X;  3E97 A;  1S8N A;  2OCE A;  6PAX A;  5HS8 A;  4LIT A;  4U0Y A;  3M8E A;  2QUF A;  3WG7 H;  4EJU A;  2DFF A;  3FF5 A;  2DPD A;  3RPU D;  4CCK A;  1VQP I;  3GTO J;  5C4X J;  2P6S A;  1IN7 A;  3WGI A;  3X2Q H;  1F36 A;  3CC4 I;  1S72 I;  1HDD C;  3LAJ A;  3H5A A;  4J00 A;  4EGY A;  5E1Z B;  4P9F A;  2FU4 A;  3AFH A;  3BG9 A;  2FSW A;  2V9V A;  2K9Q A;  1OR7 C;  3C2B A;  1KU3 A;  2PMZ A;  1Z0X A;  2LK2 A;  2IS4 A;  1RR8 C;  2LKX A;  4KMU X;  3HIF A;  1X19 A;  2ZXH A;  4UY8 I;  5FKL A;  1N77 A;  2EV6 A;  3LSK A;  4D7M A;  2CYY A;  2DOF A;  1Z6R A;  3Q0W A;  3MKW B;  2O9L A;  5HNH A;  1AOY A;  2DFE A;  2VBX A;  2M4K A;  4FIS A;  5EDN A;  3OL4 A;  3WU1 B;  3HXL A;  2WAD A;  5DS9 A;  2X1C A;  1RIO H;  3K4B A;  5J8C A;  1KU9 A;  2HQR A;  3BR2 A;  3P9C A;  3I58 A;  2RRE A;  3OL3 A;  2E2J J;  1OMI A;  1YJ9 I;  4NHJ A;  2WAF A;  1MIJ A;  2ZXJ A;  2DQR A;  1F5T A;  3CCY A;  4DIQ A;  3H3V K;  3OS2 A;  1U5T C;  1ZEL A;  2ZFU A;  3KP5 A;  3QP6 A;  5ICF A;  4D5F A;  3OY9 A;  4HNT A;  2ECC A;  2ACJ A;  5J47 A;  4EAT A;  1IJW C;  1VQ5 I;  3S14 J;  2DMP A;  4HX4 A;  1WPK A;  2RVC A;  3ERE D;  1RUO A;  4E70 A;  5FFX A;  5HVQ C;  2AO9 A;  4XLA A;  2F5D A;  1DPU A;  1G3S A;  1FNN A;  2ME0 A;  1SFU A;  5E1W A;  1S3J A;  4HW0 A;  2HOE A;  5LGT A;  2X0L A;  5ILU A;  2QEN A;  3DBR B;  1P4A A;  2X51 A;  2DDB A;  4O6J A;  2GA2 A;  1I6X A;  2EIL H;  2EFO A;  2D1H A;  2L9V A;  2E71 A;  3G2B A;  2Q1Z B;  3V8L A;  3JAM K;  2K27 A;  2H8R A;  1ZQ3 P;  1ZTR A;  3DPT A;  3G1O A;  3GCM A;  2IT0 A;  2YX7 A;  3EET A;  2FXA A;  2JJ7 A;  1Z6T A;  3H3Z A;  3NWT A;  2UUZ A;  2LBF B;  2EZL A;  2HQA A;  3L1P A;  3TDZ C;  4WK8 F;  1IRG A;  1R5H A;  5K7Z A;  3QYB A;  1IRX A;  3LSP A;  2PBI A;  3DPU A;  2W00 A;  4E7J A;  3TQN A;  2JSC A;  4KN4 X;  4AIH A;  1IN8 A;  3WTZ A;  4L5J A;  5JI6 A;  5M3F J;  1IGN A;  3LA3 A;  4G6Q A;  1RPW A;  2EA2 A;  1KU7 A;  4LLG F;  4L9V A;  2R5Z B;  2EFN A;  4ZTF A;  2ZXW H;  1X1B A;  4Y3O A;  4V2F A;  2V1X A;  2QQB A;  1Z7U A;  3PO2 J;  2DJN A;  2HPM A;  2F5E A;  3M1C A;  3VSL A;  3M8J A;  2BY3 A;  1ZK8 A;  5FKO A;  3SDG A;  4RM2 A;  2DA5 A;  1QZE A;  4ENK A;  3F8B A;  1LE8 B;  4AYB A;  1MMA A;  1YX3 A;  1REP C;  3ZPL A;  3EYI A;  2TRT A;  3HSR A;  2HKO A;  1ZKG A;  2CQ7 A;  3GME A;  1LVA A;  2DA2 A;  2JA7 J;  1YYV A;  4YIF A;  5IP9 J;  2BYV E;  3D5L A;  1JKR C;  2NVY J;  4FTH A;  1XTA A;  4HV5 A;  3ISP A;  2CV2 A;  3HC7 A;  4BQA A;  3VYU B;  2HOA A;  2YX4 A;  2D2W A;  1D1C A;  3CP8 A;  1U0J A;  5CQE A;  3S3N A;  4Y17 A;  4IHS A;  3M4O J;  4M3F A;  5JLX A;  3WTW C;  2VC0 A;  3M7G A;  1K7A A;  4IZZ A;  2E1O A;  4NC6 A;  4CSW A;  4ESB A;  1ERD A;  3JTH A;  3PIO F;  2BY1 A;  5ILV A;  4IO9 F;  3CDH A;  4O5V A;  3ASO H;  1EH7 A;  1FY7 A;  2HI3 A;  3TGN A;  4HSR A;  4FT8 A;  2B63 J;  4IXA A;  3TBI A;  3RDI A;  2LF7 A;  5ICC A;  3AL0 C;  1YIT I;  5F04 A;  1JGS A;  2X6W A;  3A03 A;  3ELK A;  5CVR A;  4F52 A;  2QSG X;  4R8H A;  1LUJ B;  2P81 A;  3GTP J;  4I98 B;  3BTI A;  2R5Z A;  2XAG A;  4WCG A;  1NK2 P;  5HDN A;  1TNT A;  1NH3 A;  1ZGJ A;  2AXT C;  3K70 C;  1IF1 A;  3B6A A;  1RES A;  3AG1 H;  3ABT A;  3ZQH A;  2LG4 A;  1MMS A;  2VKD A;  4BKX A;  2HOT A;  3DV8 A;  4B4C A;  3BJA A;  4XID A;  1J7K A;  2O61 A;  1YI2 I;  2BBY A;  3EYY A;  2ZJR F;  1ZHF A;  2XGE A;  1LE8 A;  2VE8 A;  4G9Y A;  2RDP A;  1Y56 A;  2O03 A;  3BCA A;  3C1D A;  4BDZ A;  2FBI A;  3CZ6 A;  1RR7 A;  4M9S A;  5JFR A;  4OIP F;  1HBX G;  4EM2 A;  4HRI A;  2WA0 A;  4XOT A;  4BY7 J;  1HCR A;  3NAU A;  1U9N A;  2M30 A;  4XQF A;  1T38 A;  3RKY A;  2L9N A;  1AHD P;  3I9V 2;  3CME I;  2XPW A;  1WJ5 A;  1LPQ A;  3CUQ B;  3M1E A;  3M07 A;  2AQE A;  3VSK A;  2L4M A;  4E7K A;  3S3O A;  1TL8 A;  3CD6 I;  1BW5 A;  5KCM A;  2UV1 A;  3LSJ A;  4KIB A;  3C2H A;  5JHU A;  4RB3 C;  1BL0 A;  1O7L A;  2HZD A;  3E6B A;  2F4M B;  3IC7 A;  1KQ8 A;  1PVE A;  2KIS A;  3H36 A;  3KP4 A;  2PMZ N;  2A5Y B;  5K7H A;  4DZJ A;  4EJT A;  3GTK J;  4FX4 A;  3LSR A;  4B47 A;  4M6V A;  4R79 A;  1JKQ C;  4DYQ A;  1DP3 A;  1IDZ A;  5CQG A;  2CGP A;  3GTM J;  2K4B A;  4N9H A;  1GV2 A;  1Q1H A;  2ESN A;  2OBP A;  4M71 A;  3JRE A;  1YQA A;  3F6V A;  4L5I A;  4I02 A;  4BBS J;  2KZV A;  3DFG A;  1WSU A;  1T08 B;  1TW2 A;  3F9K A;  3CC7 I;  3K4N A;  1OJL A;  2IA2 A;  2NOJ B;  1A36 A;  4N9I A;  2KIM A;  3Q0V A;  3NAR A;  1L0O C;  3KX2 A;  3OYH A;  2K4J A;  2MLK A;  1YJN I;  2VQG A;  1FWZ A;  1S7O A;  2VB6 A;  3RCO A;  3QRF F;  3IHU A;  3GTJ J;  2ISY A;  4MIM A;  2ZME B;  3C7J A;  1PUE E;  3CCJ I;  3J7Z I;  2HTS A;  1A04 A;  1FPQ A;  5DCM B;  3FX3 A;  2DFI A;  2ELH A;  2TDX A;  2XGX A;  2EV5 A;  2MBF A;  3C2G A;  2DMN A;  1PUF B;  4IVN A;  2VOP A;  2FOW A;  2LP0 A;  3HPH A;  1IO2 A;  2VJ5 A;  5DDG A;  2KT0 A;  2VKH A;  2X1D A;  5HOD A;  2LD5 A;  5FRN A;  4FAS D;  3E6C C;  3OYK A;  5LRR A;  4V2G A;  1ZGW A;  3P7N A;  4OIQ F;  2HQN A;  3FXK A;  2NRA C;  4XLN F;  1WJB A;  2JN6 A;  4NC8 A;  1GLN A;  4DW6 A;  2KDO A;  2NAZ A;  3ROU A;  4KNY A;  2EZH A;  4RAY A;  4C2T A;  3C3W A;  5FLV A;  3ZQG A;  1X3W B;  1ZR4 A;  1VQO I;  2R3S A;  2L5Q A;  5KHD A;  5L3B A;  1A35 A;  4Q5S F;  1GUU A;  3DP7 A;  1RET A;  2IVM A;  2H6B A;  2I10 A;  1U9O A;  3IP4 B;  3CCL I;  1XSV A;  1HDP A;  2W25 A;  2IGO A;  2RNJ A;  5J3L A;  3Q5F A;  4UVB A;  3ONQ A;  1FSH A;  5B1A H;  1XSX A;  5DM7 F;  2L02 A;  2EIM H;  3JRB A;  2BVL A;  3HOS A;  1BOB A;  4BL0 B;  1P92 A;  4MNU A;  1VQ6 I;  3HOU J;  1TQI A;  4CIC A;  1XGS A;  3K0L A;  2ETH A;  1G4D A;  3HOZ J;  2W4S A;  4PZJ A;  1I6H J;  4A3B J;  2Z33 A;  3Q3S A;  1PUF A;  2QQ9 A;  3MKZ A;  2BXY A;  2W1O A;  2CU7 A;  3BWG A;  3RIR A;  5LFA A;  3BTJ A;  2CQN A;  1FP2 A;  4A93 J;  3U21 A;  1IUF A;  4M3G A;  2XF7 A;  2CWE A;  3HBL A;  4A0Z A;  4Q47 A;  5AON A;  3R4K A;  5FJ8 J;  4AYB N;  3F8N A;  4C3I J;  2Y9Z A;  4M6X A;  4RAF A;  2M3A A;  1QZZ A;  2IS6 A;  3DTE A;  4XSX F;  3CCR I;  3S17 J;  2CW7 A;  3FIW A;  5E79 C;  1BN5 A;  1P9Q C;  3FXR A;  1HOM A;  4AWX B;  1YLF A;  1ZH5 A;  1X3U A;  3BDD A;  3WTS C;  2STW A;  4CDG A;  3LA7 A;  5D5V B;  3G71 I;  1U8R A;  5GPC A;  5DM6 F;  3OOP A;  3KZY A;  3CMM A;  2PFB A;  2XC7 A;  2DA1 A;  4FE4 A;  2X1E A;  3DBH B;  1JHH A;  1X3Z B;  5CVJ A;  4DBR A;  3EUH C;  2NOG A;  4BQO A;  2W57 A;  3H92 A;  1E3O C;  3KP3 A;  5LHG A;  1ETW A;  2R7D A;  3AG2 H;  4PK4 A;  2EZI A;  4CYD A;  2IGN A;  4OWR B;  1KQ9 A;  1VQ8 I;  3V8J A;  3MWM A;  2W24 A;  4IX7 A;  3WTV C;  1OLT A;  2FUG 2;  1P7I A;  2PJR B;  2F2E A;  2DJI A;  5EZH A;  3HTS B;  4LG3 A;  1MD0 A;  1YO5 C;  4OAY A;  4YII A;  3F8M A;  1FOW A;  5A2Q Z;  1FMV A;  4F93 B;  2HKX A;  3BTC A;  1SC7 A;  4HF1 A;  3OMY A;  2BOL A;  2E2H J;  2Z2S B;  3J80 Z;  3W2W A;  1R5G A;  3GFL A;  4HNU A;  3S2D J;  3FXU A;  1VQ4 I;  1APL C;  4P55 A;  4KYW A;  1OCT C;  3S93 A;  2QYO A;  4G7O F;  2D45 A;  4A3L J;  1ORK A;  3H5R A;  3ZMD A;  4EV0 A;  2UZK A;  3JRF A;  1WJE A;  1UAA A;  1E3P A;  4CHU A;  3FXJ A;  4CXF A;  1QO0 D;  2ZNZ A;  2V1U A;  3BTL A;  4Y13 A;  5J4Y A;  1RKW A;  4D5C A;  1IG7 A;  4J19 A;  1F1Z A;  1MH4 A;  2M4G A;  2VJI A;  5L3C A;  3K4K A;  4BAC A;  4O3M A;  1D8J A;  1B8I B;  1LDK B;  4UUS A;  1PYV A;  2MC3 A;  3LSI A;  1K6O A;  1UCR A;  1Z67 A;  3HB9 A;  2VQH A;  4N4O B;  4HA8 A;  3OSF A;  3AG4 H;  2HDW A;  1A6I A;  5M3M J;  3F3X A;  1Z3Y A;  4L0Y B;  3ZMT A;  5J1R A;  3CO6 C;  1L3L A;  1Z7L A;  5BNG A;  3D1N I;  3CCQ I;  4EJO A;  1QA6 A;  3LAP A;  1TWC J;  4L9T A;  2AXL A;  1OCP A;  3OR2 C;  4U88 A;  2Z1D A;  2VON A;  2QQ8 A;  2HFH A;  3UKG A;  1TQM A;  3HPG A;  2WB1 A;  2Y2Z A;  2Y48 A;  1EF4 A;  1WJF A;  2L9S A;  2Y0S A;  5IYD J;  2CO5 A;  4DYC A;  4Y7N J;  3ZMS A;  3WTT C;  3ABU A;  2V1N A;  2WBM A;  3SEZ A;  1O3R A;  2H1K A;  4LG0 B;  2K9N A;  1TWG J;  1IV8 A;  1HQC A;  2IS1 A;  2GIV A;  2E36 A;  1H0M A;  2FEZ A;  1RUN A;  5M5X J;  3IUO A;  1UFM A;  1JTY A;  4IQ4 A;  5J1Y A;  2PLY A;  5F1J A;  3SXY A;  1JE8 A;  2CSO A;  4BEH B;  1FIP A;  3PQK A;  5E1X A;  3ZMZ A;  2KHM A;  3TP3 A;  1MBE A;  1OQY A;  4A3E J;  3FM3 A;  2KIQ A;  2XGC A;  4YIR X;  2DO7 A;  2MLG A;  1XGN A;  5DCF A;  1QNT A;  3BR3 A;  5EJC A;  4DGW B;  1X4O A;  2TCT A;  1X2N A;  2VAS A;  2Y0M A;  3TMO A;  2LY2 A;  2HYG D;  5FGM A;  3TO6 A;  1RNL A;  3AAF A;  3LST A;  2CUE A;  4BS9 A;  2FA5 A;  3DCF A;  1DPR A;  4PCQ A;  3RSN A;  5KNL A;  3OYI A;  3LSM A;  1ZG5 A;  1DUX C;  3CCS I;  2OTL I;  1OPC A;  1XSD A;  4ASN A;  5C4J J;  1D1A A;  4BHP A;  2VI6 A;  2WY7 Q;  1EH8 A;  2Z5U A;  3VYT B;  3DEW A;  4W1U A;  1X1P A;  3FBN B;  1GV5 A;  5F0F A;  3WGG A;  3HOV J;  2EPF A;  5B66 C;  4HST A;  4XKC A;  1DDN A;  2H1L A;  3OYC A;  2DXI A;  2XIG A;  1ACI A;  3HM5 A;  1ZAO A;  3J81 K;  1NHA A;  5IOY A;  1HLV A;  3BG5 A;  1BBY A;  4QIW N;  2HU9 A;  2ZXI A;  1IN5 A;  4ENN A;  2DW4 A;  3E5X A;  4LG0 A;  2XUB A;  3K4L A;  5L3D A;  1D5Y A;  4L5E A;  2HYF A;  3NEU A;  4RGU A;  2KDZ A;  4EJW A;  2JMW A;  2HYJ A;  2DOA A;  3J7Y J;  4DQ2 A;  4ZDO A;  5LEJ A;  4B48 A;  3DEE A;  3IRQ A;  2JRM A;  2FMY A;  4JX5 A;  1Y6I A;  3H0D A;  1U78 A;  2M87 A;  4E7Z A;  2MSY A;  1Z21 A;  3CTA A;  2HS5 A;  4X0G A;  3N05 A;  1HW5 A;  3HSE A;  4OAZ A;  2KLO A;  3U9G A;  4RGS A;  2B7E A;  2VKE A;  2NS7 A;  3A4C A;  4PDK A;  2XSD C;  3IKT A;  2KIU A;  2OAZ A;  3PO3 J;  2H6C A;  3S2H J;  1IN4 A;  4A3I J;  1F4K A;  4BJ6 C;  4IHX A;  3H3U A;  3JCU C;  3J80 K;  5FD6 A;  5EG0 A;  1WKM A;  4AM3 A;  1MKM A;  3ZR8 X;  1FIA A;  4MTE A;  3FK7 A;  2VXZ A;  3L2R A;  2QA4 I;  4E4H A;  3CLO A;  4TV7 A;  1KQ0 A;  4LJZ F;  1XMK A;  3LSG A;  3TO7 A;  4HF2 A;  4NQW B;  4UUV A;  1XDU A;  2HGC A;  4HQE A;  3OWT A;  3E6M A;  5IY5 H;  3TKY A;  3ECO A;  1GVJ A;  5F1R A;  1N78 A;  1T33 A;  2RGV A;  2KFD A;  1OCZ H;  1QVU A;  3CCE I;  2O0Y A;  2YSR A;  5D6E A;  1SFO J;  2G7H A;  1G2H A;  4S04 A;  5TIS C;  3R61 A;  4LLN A;  3F22 A;  3MKL A;  2ZKZ A;  5F0C A;  5K5Q A;  3BOQ A;  3I4M J;  4XLP F;  2A05 A;  1Z91 A;  2YS9 A;  1R1V A;  3BT9 A;  4RMN A;  5K5R A;  4CCL A;  3KE2 A;  3VEP A;  5FLM J;  1W36 D;  1VTN C;  1ENH A;  1JUP A;  5C44 J;  1IDY A;  4AID A;  2IPQ X;  1NK3 P;  1ETY A;  3L2C A;  4JP0 A;  3H0G J;  1LFU P;  3I55 I;  1VQ9 I;  1AA7 A;  4BH9 A;  3GZ5 A;  1ETV A;  3LFK A;  2VBZ A;  4PFO A;  2ESH A;  2QCO A;  5TJJ A;  1R1T A;  4ZDP A;  4RB0 A;  3EDP A;  5D5U B;  4PUS A;  5LEK A;  1BR1 A;  3CJQ B;  2K40 A;  2KL4 A;  1G3Y A;  4KT5 C;  3BR6 A;  2DT5 A;  1MSF C;  1BI2 A;  3J7A Y;  1VQN I;  3OIQ A;  5AIQ A;  1SVL A;  1BC8 C;  3O6B B;  5EGO A;  3JRC A;  3WTX C;  1BR4 A;  3G3Z A;  4FHT A;  4NQW A;  2CRG A;  4RAZ A;  2CUJ A;  4EVI A;  2EFP A;  4B3X A;  4D9J A;  2JVH A;  4UHT A;  5LGU A;  3S2W A;  2CW8 A;  4OOI A;  3PIP F;  3H35 A;  3CDI A;  1VND A;  4NUB A;  1MH3 A;  2LVS A;  4I09 A;  4IHW A;  2WC2 A;  4ENM A;  2ZJ2 A;  1XGM A;  2OCC H;  1I27 A;  1ETX A;  2OC6 A;  4UXN A;  1V5G A;  1D1B A;  2NYX A;  1LNW A;  5E3L A;  4IEJ A;  2JSP A;  1W7P A;  3I53 A;  3VOE A;  2AS5 F;  2WB1 N;  2YPR A;  2HPI A;  3CF2 A;  3QAH A;  3TO9 A;  2HEO A;  3E5Q A;  5EEA A;  2Y0S N;  3O8H A;  5KAI C;  4U7D A;  2LOO A;  2OU2 A;  2GXB A;  2OF7 A;  2HNH A;  4BXF A;  3LQR A;  2VOO A;  1P4X A;  4CA0 A;  4CYC A;  3EUK L;  3CC2 I;  4BXX J;  1YW9 A;  2K3F A;  2B9S A;  3MFK A;  1IRZ A;  2F5V A;  5L3F A;  2HVR A;  4Q48 A;  1SFK A;  2IGK A;  1O3T A;  2ISZ A;  3CUQ C;  3HKZ A;  1FMW A;  2K3P A;  2QWW A;  3OYA A;  2VJJ A;  2ZNY A;  2NVU B;  5C3E J;  5EF6 A;  3SFI A;  4MFD A;  1XMA A;  2PN6 A;  1J09 A;  4MO7 A;  4PJ0 C;  1IUY A;  2X4H A;  3W6J B;  3OIO A;  5B3S H;  5ERI A;  2QSH X;  5KK1 A;  1MJB A;  1MNM C;  2CJJ A;  3RKW A;  4KDP A;  4LMY A;  3SDB A;  5H20 A;  5HDG A;  1QBJ A;  4ABZ A;  4LK1 F;  2CFO A;  2IW5 A;  5FD5 A;  5JVT A;  2ZSI B;  4XNF A;  1UZC A;  4BQN A;  3DTI A;  4LGW A;  4M3B A;  1EKE A;  1HKT A;  2E34 A;  2KPM A;  3MCZ A;  1U6G A;  2GXA A;  1UMQ A;  4GFB A;  4IQJ A;  3FWE A;  1S9H A;  4FE7 A;  4PGH A;  1R23 A;  4Y52 J;  3KEY A;  3B6C A;  1VQ7 I;  1YOV B;  3R60 A;  4HX8 A;  2GBY A;  3NRV A;  3A01 B;  2A07 F;  4XBF A;  1K61 A;  2YU9 J;  1JGG A;  4W97 A;  3HUG B;  3SHF A;  3RZO J;  2ZME C;  1NTC A;  2R92 J;  4C3H J;  2HR3 A;  2OUM A;  2L3D A;  5F27 A;  2ZCW A;  5H2F C;  4KJZ A;  4F3Q A;  1OYI A;  2LRD A;  3CJR B;  2QM3 A;  3K70 D;  2GM4 A;  3ZQF A;  2PJP A;  1FYK A;  2ZSH B;  3GZ6 A;  4BBR J;  4YFX F;  4GDF A;  3Q0U A;  3T5X A;  4MQV A;  2EJR A;  1T98 A;  2QBY B;  2KRC A;  2XVC A;  4I6Z A;  3VYR B;  2XAJ A;  1W5S A;  3BZC A;  4Y4R A;  4DYR A;  1X1C A;  3GTL J;  1MJA A;  1VZ0 A;  2VXD A;  3OYB A;  3M3Y J;  4KIF A;  1PP8 F;  2R7S A;  3WU0 A;  1FBS A;  2M45 A;  3KYC B;  3WGH A;  3P9I A;  3S1R J;  4HAM A;  2H8W A;  1AWC A;  1O57 A;  2JA5 J;  1Z77 A;  1V5E A;  3FMR A;  4BAY A;  3KZZ A;  3S15 J;  1MMD A;  2E1M B;  1XPX A;  2KRF A;  4JX6 A;  3DF8 A;  5E8G A;  2VBY A;  4KIG A;  3RPU A;  1OR7 A;  3MAJ A;  3L9F A;  1OCO H;  1H88 C;  3OV8 A;  3I4P A;  5E3N A;  2HDC A;  5HDK A;  1U2W A;  3KYL A;  1JHF A;  2ZO4 A;  3H5N A;  2V79 A;  2R7O A;  3DLL F;  2GWR A;  3WHB A;  1O4X A;  2GLO A;  3E5U A;  1PJR A;  4XRS G;  2QF7 A;  1KGS A;  2DOE A;  3A01 A;  4E6K G;  1I1G A;  3O3K A;  1J59 A;  2EH3 A;  2BY0 A;  4EQQ A;  9ANT A;  1OFC X;  4QLC U;  3HUG A;  2EFW A;  3K7A J;  1T2K A;  3QQA A;  2WWY A;  2E5Z A;  1TT5 B;  2GIZ A;  3E6D A;  2OV7 A;  3DKX A;  4MQ9 F;  2L9R A;  2UXX A;  3L2V A;  2GQQ A;  2HDD A;  2HVQ A;  4BE2 A;  5E18 F;  2CUF A;  1QHG A;  1QRY A;  1U5T A;  4X6A J;  2DTZ A;  2HWV A;  1SFX A;  3P5J A;  4ZC3 A;  2QBY A;  2N8G A;  3HDD A;  1TT0 A;  3GEZ A;  4LIV A;  2E60 A;  2L7Z A;  2KKO A;  3G1L A;  5DTD A;  2DMU A;  2E5N A;  1ZRE A;  1RI7 A;  2A68 F;  1T39 A;  1SMT A;  2K02 A;  3H1C A;  1SFE A;  5H6R A;  2IA1 A;  2A6H F;  2XSJ C;  4EMS A;  4HYE A;  1ON1 A;  3I64 A;  3BY6 A;  2C6Y A;  2P0W A;  4A3M J;  4QSH A;  1D8K A;  2ELJ A;  3F23 A;  4PJN A;  1K78 A;  4KA4 A;  1B72 A;  3E1S A;  4L9J A;  4WX9 A;  3EQL F;  4CH7 A;  2R7R A;  3GTQ J;  2JUC A;  2MFZ A;  2P8T A;  4A5M A;  2FQ3 A;  4CUG A;  5HS7 A;  1FZP B;  2VLA A;  1OIS A;  4D0P A;  2OA4 A;  3M8F A;  1Y0U A;  2KJC A;  4Z2Y A;  4M72 A;  3LSH A;  5GAH J;  3MZH A;  2VT3 A;  1BI1 A;  2DCE A;  1LFB A;  3J7A O;  3OYE A;  3G73 A;  1MMG A;  4M74 A;  2I8D A;  1DGW Y;  2XAH A;  3HHG A;  2OPT A;  3BG7 A;  1FBU A;  3FMS A;  1SAU A;  3PNT A;  5DEQ A;  1S5L C;  3KZI C;  5DUK A;  1EH6 A;  1MBG A;  2F5F A;  4RB2 C;  4PJJ A;  3CMY A;  3ZMV A;  3HOT A;  4XLC A;  2VIX A;  2M34 A;  4KT6 A;  3SFZ A;  3L09 A;  1X1A A;  1MW7 A;  4XMY A;  4WF2 A;  4A3K J;  3S16 J;  2LY9 A;  4F91 B;  2A6T A;  1T0F C;  4A2U A;  3AG3 H;  2FOK A;  4ENJ A;  3W6K B;  3VOD A;  2X9D A;  4HPQ A;  3N4M A;  1J75 A;  3SZT A;  2DYS H;  1MJ9 A;  3B73 A;  2BY2 A;  3TOB A;  4L0Z B;  5DYM A;  2RQQ A;  4MEX F;  2DT6 A;  3H9J A;  4U0V A;  1SMY F;  4AD9 A;  2RN7 A;  4ZH4 F;  3DPL C;  1IRF A;  3OYM A;  1R6R A;  3S1N J;  3HKZ N;  2E35 A;  2K5C A;  4PJM A;  3QP5 A;  4HZF A;  1MBK A;  2X6X A;  2P7C B;  1SAX A;  1UHM A;  5KVR A;  2EFQ A;  5LGN A;  1GXQ A;  4JYK A;  3JRH A;  2NVX J;  1AU7 A;  2LNB A;  1S29 A;  2FJ1 A;  1FSE A;  1Y1W J;  1HW2 A;  1WH7 A;  1MBH A;  5M5Y J;  3CDL A;  4Y15 A;  4UNO A;  4I2O A;  4UV8 A;  4ZYD A;  4BHC A;  2FRH A;  3I71 A;  3W3C A;  3F21 A;  2F5C A;  4IHT A;  3KP6 A;  2MGQ A;  2XRN A;  2GOX B;  4CGZ A;  2G0E A;  1UST A;  5F64 A;  1H89 C;  2OZU A;  2Y9Y A;  5GTH C;  3CO7 C;  5ILS A;  1KZH A;  4C3J J;  3BP8 A;  1SD6 A;  2CV0 A;  4HLX A;  2DT7 B;  3KET A;  4UUS B;  5D4S A;  4C2M J;  1G8X A;  3WHC A;  3RKX A;  3J81 Z;  2R93 J;  3W2V A;  2GXG A;  2L4A A;  4EGZ A;  3QPS A;  3I59 B;  1TTY A;  1CF7 B;  1B1B A;  1R00 A;  2DK5 A;  2EBI A;  1DQU A;  1ZLK A;  4AU7 A;  1X2M A;  3SYT A;  1V54 H;  2EIN H;  2IBD A;  3GXO A;  2DK8 A;  2ZC2 A;  4RA2 A;  2KRH A;  3DKW A;  1VQL I;  2DA6 A;  3SZG A;  4QPO A;  4CZC A;  5LRS A;  2WAE A;  4RGX A;  4H4K C;  3LWF A;  1HW1 A;  3I4N J;  1WHU A;  1ZN2 A;  4M9X A;  3RYP A;  1MSE C;  3DXJ F;  3DKY A;  5IP6 A;  3GBG A;  3FKJ A;  5CVV A;  2Z99 A;  4F92 B;  2E1C A;  5IPA A;  3FIS A;  1W0T A;  5HLI A;  2DLL A;  2ECB A;  5M5W J;  3RI4 A;  1ETK A;  2VKV A;  1VQK I;  2LTP A;  4D1Q A;  1Y39 A;  1TWA J;  4RLQ A;  3K1N A;  3R0A A;  3OR1 C;  2W84 A;  1BC7 C;  3HG9 A;  4N0B A;  4HOB A;  3BPX A;  4NC7 A;  1TWF J;  2FNA A;  4E7L A;  3RKQ A;  1QZY A;  2V9P A;  2DDA A;  4ZTJ A;  1FOX A;  4XKV A;  2DI3 A;  4GXO A;  1UEL B;  3JSP A;  3ZQI A;  3HTU A;  3NQO A;  4IHV A;  3HGG A;  5FRM A;  4AIK A;  5ED4 A;  4YFK F;  1R4M B;  2F48 A;  2LFB A;  3EUA A;  2L7F P;  3PFY A;  2MA3 A;  2JPC A;  1WRJ A;  4GRI A;  2XF5 A;  2PQ8 A;  2ZB9 A;  4XM3 A;  2RC4 A;  2MH9 A;  2YUS A;  3I59 A;  3TOA A;  1CF7 A;  3I56 I;  1GT0 C;  2OQR A;  1MBJ A;  2L2O A;  5K1Y A;  2GOM A;  4M73 A;  1J9I A;  3W6V A;  1AKH B;  3QPH A;  2VC1 A;  5GTI C;  1HC8 A;  2XHK A;  4HX7 A;  1R22 A;  3PSI A;  2V1D A;  1KYW A;  1PDN C;  3BG3 A;  3OIP A;  5CYV A;  2O8X A;  2VT2 A;  2WTE A;  1UB9 A;  3FM5 A;  4DJA A;  3GX4 X;  3RTR A;  3IH2 A;  2NS0 A;  3ASN H;  1I3A A;  2JQ7 A;  3PFI A;  3RJP A;  1R9T J;  2NNY A;  1JXS A;  3BJO A;  3CCU I;  3MD2 A;  1ZRF A;  1WI9 A;  1Y0N A;  3IL2 A;  2QQA A;  4IL6 C;  2NS8 A;  1IXC A;  3D0S A;  1ZG1 A;  2AQF A;  1G6N A;  5LLQ A;  5BPI A;  2L7K A;  2M1B A;  4RB1 A;  2XPU A;  1XCV A;  2QZ8 A;  1B59 A;  2CW0 F;  4F55 A;  4DZP A;  3L7W A;  5IYB J;  5LHH A;  3CCV I;  3V4G A;  3BC8 A;  4G7H F;  1LEB A;  2LR8 A;  1UG0 A;  3MVP A;  4BE0 A;  1W4M A;  4OMZ A;  3HYI A;  4U87 A;  1LJ9 A;  4NDL A;  3ZCO A;  1ON2 A;  3ULQ B;  1SD4 A;  5K7F A;  4JQF A;  2M8G X;  2Q0O A;  3BQY A;  4UV9 A;  3HOY J;  2X6Y A;  3VFZ A;  2YU3 A;  1YIJ I;  1BA5 A;  3GF2 A;  1ZRC A;  2A69 F;  3FKI J;  3UNG C;  4DBQ A;  2CQK A;  3PJR A;  5EG0 B;  2K9S A;  2XAQ A;  4QWQ A;  3I0T A;  2XAS A;  4AC0 A;  4C2U A;  3SZP A;  1AKH A;  3MMY B;  2FML A;  3FK6 A;  3ZQ7 A;  2R5Y A;  1X4P A;  2JA6 J;  1HKS A;  3TDU C;  5IT3 A;  1FOK A;  1J2X A;  1V3F A;  3V7R A;  3K10 A;  2P5L C;  4R1H A;  1FYM A;  3TED A;  1OKR A;  1ZG3 A;  5FKN A;  5LHI A;  3PSF A;  3LNQ A;  2CQQ A;  4AVP A;  3ZXS A;  2D1V A;  3UR3 C;  4J01 A;  3DU5 A;  4FQG A;  4LOC A;  2CH0 A;  4HDU A;  1BOA A;  4GGG A;  3IRR A;  2D5V A;  3FMQ A;  3S1M J;  4B43 A;  4RDU A;  3WTU C;  1POG A;  3JW4 A;  4ESJ A;  2R7W A;  3OS0 A;  4LFU A;  4LD5 A;  1EJ9 A;  4A69 C;  3LFU A;  3KP2 A;  3FHN A;  2CG4 A;  2MG4 A;  3ZMU A;  4CCN A;  1W5C C;  4JK1 X;  1O3S A;  1WGX A;  4GO1 A;  2EQR A;  3KPH A;  4RBO A;  4P96 A;  3SJM A;  1MBF A;  3JRG A;  5FFZ A;  5F08 A;  3G6E I;  3GUD A;  2E19 A;  4ANJ A;  3FZV A;  3IWF A;  4IF4 A;  5EGO B;  2OD5 A;  1M1E B;  4OIR F;  4WXD A;  5L3E A;  3BQZ A;  1D0X A;  3ZQC A;  1R1U A;  2LF8 A;  2B0L A;  4II2 A;  1STZ A;  2BGC A;  3OOU A;  4M6Y A;  2XDV A;  1FJL A;  3HRS A;  1EA3 A;  4LB6 B;  4WWC A;  2CUZ A;  2VL8 A;  3IH4 A;  2RV8 A;  1S6L A;  3OSG A;  4H0E A;  2M5W A;  1RRJ A;  4G6D A;  5E3M A;  3T1B A;  4YRV A;  3IV5 A;  4XRF A;  2E7W A;  3KIO A;  1ZGA A;  3ZQL A;  1W7P B;  4QPQ A;  2FNP A;  3BZ6 A;  1JT6 A;  2L0K A;  3IH3 A;  2ZJQ F;  2A61 A;  3HEF A;  5CVI A;  2KQR A;  5TGT A;  1XDS A;  1N25 A;  2MYS A;  1BI3 A;  5F0H A;  3D5R C;  4XKW A;  1HA8 A;  4FCY A;  2ME6 A;  1RC9 A;  3L2Q A;  2O5R A;  3A0H C;  4CYC B;  5TRD A;  2LYC A;  3ZGK A;  4PGG A;  2V6E A;  2AHQ A;  2COM A;  1WWX A;  1LB2 A;  4UB8 C;  3WE2 A;  1X58 A;  1A6Q A;  4B3A A;  2R7Q A;  1O3Q A;  2M7B A;  3Q9V A;  2EK5 A;  3KCC A;  2HXI A;  2DMQ A;  5E20 A;  3LQQ A;  3ESW B;  2ID6 A;  2MH2 A;  3HL2 A;  4EM1 A;  1U8B A;  4YFN F;  4ZYE A;  3WTY C;  1IXS B;  2P5K A;  2FX0 A;  3V7S A;  2UWM A;  2MD5 A;  3FBI B;  4KIC A;  4BDY A;  1TNS A;  5FLX Z;  5HLG A;  4S05 A;  2CMP A;  1LFP A;  3RPQ A;  1XGO A;  1FTZ A;  2ELK A;  4IOC F;  4AUX A;  4AVZ A;  2M8E A;  3R0J A;  4B09 A;  5F6F A;  5EYR A;  2CFX A;  2DA7 A;  4BY1 J;  4FET A;  2OJE D;  2FBH A;  1WJC A;  2YR2 A;  5CJ9 A;  2G9W A;  2Q2E B;  3KYD B;  5BPD A;  4XOR A;  2KIF A;  1I39 A;  1YRN B;  1BM9 A;  3G1M A;  1V4R A;  3ZN0 A;  5CVU A;  1R49 A;  2E1M C;  1YW8 A;  3T8R A;  4A6E A;  3GVA A;  3L2U A;  3K1P A;  3MZY A;  3KEO A;  4CCO A;  4ZYG A;  3LOC A;  4BJ5 C;  1R7J A;  2JRT A;  1ZRD A;  1K79 A;  4QTR A;  4GYI A;  2DU9 A;  1JTX A;  3OYG A;  1K4T A;  3G4S I;  2PX9 A;  3D5S C;  2X6O A;  1RZ4 A;  1P7J A;  1MZB A;  1ETQ A;  3E7L A;  5J40 A;  2XKP A;  3BR1 A;  1XS9 A;  3QOE A;  2CV1 A;  2LY1 A;  1E17 A;  2K9L A;  2P5V A;  2XGD A;  3R6S A;  3ZP5 A;  4YEL A;  3NWS A;  2IXS A;  2BEO A;  3WU2 C;  5HNF A;  2JA8 J;  4IOA F;  3BLY A;  2XF6 A;  3W2A A;  3BG6 A;  1E3H A;  3E0J B;  3VYS B;  1BIB A;  3CLQ A;  1CGP A;  3VWB A;  1TC3 C;  2KJB A;  4ZZL A;  1MGT A;  4DNC A;  2ZFW A;  2VN2 A;  1JUM A;  2DAO A;  3A1Y A;  1HKQ A;  1FLI A;  1MDM B;  1WH5 A;  1BW6 A;  1R5I D;  4NBQ A;  2P4W A;  3JRD A;  2ADU A;  2K86 A;  3OYD A;  5EEG A;  4Z6Y A;  4N4N B;  1JJ8 C;  2ZBK A;  2Y30 A;  3GZN B;  2WAQ A;  2XV4 S;  3BR5 A;  4K2E A;  2G7U A;  2XB5 A;  1JJ6 C;  2XRL A;  2Q2E A;  1XG1 A;  2DA3 A;  1DU6 A;  1FC3 A;  1YRN A;  2NVQ J;  2QVO A;  1F43 A;  1ZR2 A;  4NB5 A;  1UJ8 A;  1KON A;  1T6S A;  1TZL A;  2BV6 A;  1FX7 A;  2L7M P;  2JPB A;  3HSF A;  2V4J C;  3GLL A;  1VQM I;  1D0Z A;  1XC5 A;  5D8L B;  1Z3X A;  1SD7 A;  2F6C A;  4PFP A;  2O6G E;  2EZK A;  1XX5 A;  3QYF A;  3QYE A;  1JKO C;  1LDD A;  4CO8 A;  1U5T B;  2V26 A;  1XCB A;  2P6T A;  4RGR A;  1H9G A;  2BE5 F;  2LBF A;  5KAF C;  1T95 A;  1QQI A;  2HXO A;  3MQ0 A;  4UUT A;  4HNV A;  5LD2 C;  1BJA A;  1LVK A;  4CCJ A;  2M0C A;  2JVG A;  2VQC A;  1YW7 A;  4P1W A;  4KIT B;  2FE3 A;  3I54 A;  2WV1 A;  3FXQ A;  2LKP A;  2MAB A;  3GLX A;  3OYF A;  2W7N A;  1HF0 A;  4ZDL A;  2DPU A;  4ESF A;  2R7X A;  3GWZ A;  2IAI A;  2IEK A;  1J5Y A;  2FQ4 A;  3RQI A;  2RAE A;  2COB A;  2BZT A;  1SAN A;  4MGR A;  4MFE A;  1K78 B;  1WI3 A;  3ML6 A;  1B72 B;  2VJ4 A;  3S32 A;  3RZD J;  2OZ6 A;  1TWH J;  1MDM A;  3HRU A;  4JX4 A;  1IZ1 A;  2ID3 A;  2LC2 A;  4MLO A;  2IRF G;  1YE9 A;  2LLK A;  4G12 A;  4ETS A;  4P5O A;  1R4N B;  4JBA A;  2A5W A;  1Y8R B;  3PQJ A;  1B4A A;  5FRO A;  3F72 A;  1YIO A;  5J6X A;  4A3J J;  4IKF A;  1EV7 A;  3FXO A;  3KLO A;  4G94 A;  4RS8 A;  1S7A A;  1XB4 A;  4B8X A;  1FBQ A;  2O7O A;  4BYY A;  2LH9 A;  1N75 A;  1VF9 A;  5JLW A;  2QKM B;  2NXN B;  3CJN A;  5FLX K;  4M3E A;  2KMU A;  2DMT A;  3VB2 A;  3QWL A;  1CQT A;  2IGM A;  2JWT A;  2MD0 A;  2R0Q C;  5D5X B;  4XLH A;  2R7Z J;  5IYC J;  4XLF A;  1WJA A;  1W1W E;  5FKM A;  2E7X A;  5DV5 A;  2VE9 A;  3QOP A;  1XD7 A;  1QGP A;  1WCM J;  3HRM A;  1E0E A;  3F8C A;  3GO5 A;  5D8K B;  2XKO A;  5GAG J;  1S7E A;  3V42 A;  1FOY A;  4BGD A;  3DU6 A;  3ZOB A;  2XRO A;  2BXZ A;  3PNY A;  1PP7 U;  4IHY A;  5BS6 A;  4I0B A;  2VPL A;  2K9M A;  3C18 A;  4B1R A;  3FDY A;  4XLE A;  2EB7 A;  2WV0 A;  3CP2 A;  4MHG A;  3T8T A;  2XAF A;  3TP0 A;  2RNG A;  5JHF A;  4PSX A;  3H9G A;  3KP7 A;  5J4V A;  2BHY A;  4JOM A;  4L18 B;  4YG2 F;  1OYW A;  3RYR A;  3GTG J;  2DOD A;  4MEY F;  2R7T A;  2ICW G;  3ABM H;  4CCM A;  4G7Z F;  3IAM 2;  5GPA A;  1K83 J;  3MZ8 A;  3ZQQ A;  4ZZD A;  2EA4 A;  4BJT A;  1I1S A;  3N97 A;  1G3W A;  1O7F A;  1FP1 D;  4CZZ A;  1ZYR F;  4AIJ A;  1UHW A;  2GA1 A;  3M9A A;  1X1D A;  4HV6 A;  1YX5 A;  3DQV C;  4XSZ F;  5EEH A;  3K6G A;  3U2R A;  1P4W A;  1TP4 A;  4KFC A;  1V5F A;  3CJT B;  1JUS A;  2M0M A;  4IJA A;  4IRH A;  1JI8 A;  2QSF X;  4XKB A;  3JSO A;  4A3G J;  1GDT A;  4A5N A;  3AL0 B;  4ZJZ A;  3K69 A;  1YG2 A;  4XRM A;  3QPT A;  4KIS A;  1WJD A;  4XON A;  3CUQ A;  2GAU A;  2IJL A;  1Y8Q B;  2VBW A;  4DOZ A;  1A31 A;  1LQ1 A;  4A3C J;  3I3L A;  4GYG A;  1R71 A;  3JRA A;  2L01 A;  1R36 A;  2JZY A;  4ZYA A;  1LKX A;  3FXL A;  2DA4 A;  3SQN A;  4U0W A;  1VFC A;  4HDV A;  3WG9 A;  2J5P A;  1F9N A;  2BW3 B;  2CS3 A;  1G59 A;  3JR9 A;  2L54 A;  3REO A;  1DU0 A;  1FT9 A;  2LKS A;  4B44 A;  4HBL A;  5D6F A;  3HRT A;  2Z3Y A;  3L2W A;  1UHS A;  1K6Y A;  3E3V A;  3DLA A;  3DEU A;  5IOZ A;  1YS6 A;  3BRO A;  5IT9 Z;  2EIJ H;  5DD4 A;  2F4I A;  2MW8 A;  3ZRG A;  2LMD A;  3QU3 A;  2H94 A;  3LMM A;  2PI0 A;  4RAG A;  3PUF A;  1QPM A;  3OYN A;  2JUG A;  3K4M A;  2HZT A;  1MNE A;  1NG6 A;  1R58 A;  2Z16 A;  3IAS 2;  2PG4 A;  2IP2 A;  4KUM A;  4XN0 A;  4BNC A;  1DGR M;  2RKH A;  1JKP C;  5IP7 J;  3OYL A;  2QEX I;  3QU6 A;  2STT A;  1DP7 P;  3K1M A;  3GW2 A;  1JT0 A;  2E1N A;  2VQL A;  4IRI A;  2O3F A;  2ZME A;  4UB6 C;  2VOD A;  3KFW X;  2JA2 A;  3H9Q A;  2OTJ I;  5DCM A;  4E7I A;  1K4S A;  1W36 C;  1V55 H;  1IAW A;  2KP6 A;  1OCC H;  2WAQ N;  3Q9S A;  4E7S A;  4LK0 F;  1ITY A;  4FX0 A;  4A12 A;  1ETO A;  5DD8 A;  2LRE A;  2MC4 A;  2UXN A;  3SEQ A;  1T56 A;  2DFH A;  1BR2 A;  1SD5 A;  3PL8 A;  1WZ2 A;  4PSW A;  4BXU A;  1H8A C;  4M3D A;  1BJZ A;  3P9K A;  1W5T A;  1GXP A;  5GAD J;  4MTD A;  1BI0 A;  4KMF A;  4UVA A;  1TLH B;  3LL7 A;  2BW3 A;  3GYH X;  1IN6 A;  2BHZ A;  1U3E M;  2WY8 Q;  4I76 A;  3HGY A;  2K85 A;  5CKT A;  4XR6 A;  3S8P A;  4A6D A;  3ZN1 A;  2A3S A;  3I5U A;  2VPR A;  5J8F A;  5LBQ A;  3AKZ A;  2W85 A;  1FEX A;  3IKV A;  1I5Z A;  3TW7 A;  3MKY B;  1Z9C A;  4II3 A;  3PM1 A;  3QPL A;  1G3T A;  1LDJ A;  1P2F A;  1KYZ A;  1P6R A;  2PMH A;  1YS7 A;  2W48 A;  5FKK A;  5JVG F;  4NNJ A;  5CPR B;  3KLN A;  4XRS A;  5J1U A;  1YHQ I;  1E2X A;  2Q8K A;  2NVT J;  2R7V A;  1XN7 A;  3DTK A;  1TW3 A;  3CF5 F;  3V8K A;  5AIP A;  1H9T A;  4Q4Z F;  5BQT A;  2XB0 X;  4Y33 A;  4I99 C;  4LIU A;  5K5O A;  1IW7 F;  2EV0 A;  3RQ4 A;  5EZG A;  3K4J A;  1QPI A;  1B9M A;  3FXM A;  4BUP A;  2V6C A;  3BCB A;  2A6E F;  3ABL H;  3JTG A;  1OYY A;  2QKL B;  4BU2 A;  3HOX J;  2FF4 A;  1YFH A;  2DBB A;  4V19 K;  5D4R A;  2LDU A;  3A02 A;  5FB2 A;  3DBL B;  2EIK H;  3LA2 A;  1MND A;  5H6Q A;  2R5Y B;  4OIN F;  1FTT A;  1W0U A;  1LEA A;  2R7U A;  3EPZ A;  4I0A A;  2R4G A;  2F4O B;  3CES A;  5ICG A;  1BIA A;  5HOO A;  5BMZ A;  3A2K A;  1QHH D;  1VI0 A;  1XMX A;  2JTV A;  3FHZ A;  4WXC A;  1KA8 A;  4OU0 A;  2Z9O A;  2DTR A;  3HHH A;  1ZAR A;  3CQZ J;  3HZJ A;  4EM0 B;  5E17 F;  2XAU A;  1FYL A;  5L3G A;  2OQG A;  5B1B H;  4BQQ A;  2PMU A;  3O8G A;  5GAE J;  3K2Z A;  2X85 A;  2HVS A;  1RKT A;  1QU3 A;  4XL9 A;  4HLY A;  3V7C A;  5BOX A;  1HST A;  1ONV A;  5HS9 A;  4IPA A;  2V9K A;  4KN7 X;  1ZLJ A;  3KEQ A;  2P7V B;  2Y75 A;  2PJR A;  3K9T A;  4C30 A;  3JRI A;  2JK3 A;  4X1E A;  3VDX A;  1W7P D;  4HF0 A;  3S3M A;  3K2A A;  2I5U A;  5ICE A;  2FD5 A;  5HLH A;  3GFM A;  4A3D J;  1YJW I;  5IT9 K;  2NNN A;  2Y31 A;  3F6O A;  4XK4 A;  1D0Y A;  3VPR A;  2DYR H;  3BR0 A;  4RM3 A;  3CMA I;  2V7F A;  3ERM A;  4A0X A;  1Z1D A;  1GVD A;  4G6T B;  2IS2 A;  3OS1 A;  3ABK H;  5E3O A;  1A5J A;  1QVT A;  4F7Z A;  1IXR C;  3CCM I;  5B5E C;  2E2I J;  1SVM A;  2CQX A;  3QOD A;  4BHB A;  4HQM A;  4BE1 A;  1T0F A;  3F8F A;  1IV6 A;  4OMY A;  3A0B C;  1B8I A;  4LLL A;  1KU2 A;  3DWL E;  1WFX A;  3PNV A;  3HOW J;  2ZJP F;  4GCV A;  1ODD A;  2HTJ A;  3JAM Z;  2DN0 A;  2LSO A;  3TW6 A;  1WVR A;  1UG2 A;  5D5W B;  1D5V A;  1IC8 A;  3K4C A;  1I3Q J;  2HOS A;  2RQP A;  1USS A;  2H27 A;  2GZW A;  4D7N A;  4UVC A;  3HJE A;  5CLS A;  4E7H A;  4LB5 A;  4A3F J;  4ITV A;  5FO5 A;  2IA0 A;  1Y1V J;  2QGU A;  3GFJ A;  2PEX A;  1SEU A;  3BZK A;  4S0H B;  1OCR H;  4I7H A;  4U7B A;  4OIO F;  2M2E A;  4G8X A;  4EEF G;  1MMN A;  4M9Z A;  3U1D A;  4C9Y A;  2K7L A;  1TQP A;  4YEJ A;  3WOD F;  3PUB A;  4IRG A;  1Z05 A;  4P9U A;  4A0Y A;  1HXD A;  2EWN A;  2QLZ A;  4I01 A;  5HLT A;  4XIC A;  1HSJ A;  2J5O A;  5JR3 A;  1D3Y A;  2X48 A;  1I50 J;  1NG7 A;  3CUO A;  4PJL A;  4ON0 A;  3O2P E;  4HEA 2;  4RLF A;  2HQ5 A;  3T0Y A;  2R7F A;  4HG2 A;  3GFI A;  1T8I A;  5GP9 A;  3L00 A;  1B6A A;  3S1Q J;  3MN2 A;  4BEH A;  4WXH A;  4XOP A;  2FBK A;  3MEX A;  3WE3 A;  2JT1 A;  2KZG A;  1ULY A;  1TBX A;  2M7A A;  2Y69 H;  1C0W A;  2O8K A;  1J0R A;  2H09 A;  3U1K A;  3EUH A;  4EJV A;  5DUI A;  3BJ6 A;  1YTY A;  3B02 A;  2BVM A;  3BPV A;  1GHC A;  5E8I A; 
#chains in the Genus database with same CATH homology
 1WH5 A;  1BW6 A;  3JRD A;  3BTL A;  1JJ8 C;  1RKW A;  4D5C A;  2XPV A;  1IG7 A;  4J19 A;  1MH4 A;  2Y30 A;  1Q1V A;  1B8I B;  2VUM J;  3BR5 A;  4UUS A;  1LFB A;  2M9H A;  3F0C A;  2XB5 A;  1JJ6 C;  2XRL A;  1XG1 A;  2DA3 A;  1DU6 A;  3HB9 A;  2OPT A;  3OSF A;  1YRN A;  2NVQ J;  1F43 A;  1ZR2 A;  1A6I A;  5M3M J;  3GTO J;  2L7M P;  5C4X J;  1MBG A;  5J1R A;  5BNG A;  1F36 A;  3CMY A;  3D1N I;  1HDD C;  1TWC J;  1XC5 A;  1OCP A;  2EZK A;  3BG9 A;  2M34 A;  3UKG A;  1JKO C;  2K9Q A;  3C2B A;  2Y2Z A;  1EF4 A;  1Z0X A;  2LK2 A;  2LKX A;  5IYD J;  4A3K J;  4UUT A;  4DYC A;  2HXO A;  4Y7N J;  4HNV A;  3S16 J;  2LY9 A;  2M0C A;  5FKL A;  4D7M A;  2X9D A;  3Q0W A;  2O9L A;  2WV1 A;  2H1K A;  4FIS A;  2K9N A;  1TWG J;  5EDN A;  1HF0 A;  5M5X J;  1JTY A;  5J1Y A;  5DS9 A;  2IAI A;  3S1N J;  2IEK A;  2FQ4 A;  5F1J A;  3HKZ N;  3RQI A;  2RAE A;  2COB A;  3BR2 A;  1MBK A;  1SAN A;  4MFE A;  1WI3 A;  1B72 B;  1FIP A;  2E2J J;  4JYK A;  3TP3 A;  1MBE A;  3JRH A;  4A3E J;  3RZD J;  1TWH J;  1AU7 A;  2NVX J;  3H3V K;  3CCY A;  2FJ1 A;  2XGC A;  4JX4 A;  4D5F A;  1Y1W J;  1WH7 A;  1MBH A;  5M5Y J;  1IJW C;  2ID3 A;  2ECC A;  3BR3 A;  4MLO A;  3CDL A;  3S14 J;  2DMP A;  1WPK A;  2TCT A;  2LLK A;  4G12 A;  1X2N A;  2AO9 A;  2MGQ A;  2G0E A;  1H89 C;  2Y9Y A;  2ME0 A;  4A3J J;  4C3J J;  2CUE A;  3DCF A;  2O7O A;  4UUS B;  4C2M J;  3WHC A;  1VF9 A;  5JLW A;  2R93 J;  3QPS A;  4M3E A;  5C4J J;  2VI6 A;  2EBI A;  2DMT A;  1X2M A;  3DEW A;  4W1U A;  3HOV J;  5F0F A;  1GV5 A;  2IBD A;  2H8R A;  1CQT A;  2DA6 A;  1ZTR A;  1ZQ3 P;  3G1O A;  2JWT A;  2R0Q C;  2R7Z J;  5IYC J;  3HM5 A;  5IOY A;  5FKM A;  1HLV A;  2JJ7 A;  3BG5 A;  4QIW N;  3I4N J;  1MSE C;  1WCM J;  1D5Y A;  4L5E A;  1S7E A;  2EZL A;  5IP6 A;  3GBG A;  3L1P A;  3ZOB A;  5IPA A;  3FIS A;  5K7Z A;  2KDZ A;  1W0T A;  2JMW A;  2HYJ A;  4IHY A;  2ECB A;  3LSP A;  5M5W J;  4B1R A;  1ETK A;  2VKV A;  2LTP A;  1TWA J;  3TP0 A;  4JX5 A;  1U78 A;  2MSY A;  5M3F J;  1TWF J;  1IGN A;  1RPW A;  3RKQ A;  3GTG J;  2VKE A;  2R5Z B;  2NS7 A;  5GPA A;  4V2F A;  1K83 J;  3ZQI A;  2XSD C;  2DJN A;  3PO3 J;  3PO2 J;  4IHV A;  3S2H J;  4A3I J;  3HGG A;  4IHX A;  2LFB A;  2L7F P;  5EG0 A;  1ZK8 A;  5FKO A;  3SDG A;  2ZB9 A;  1FIA A;  2DA5 A;  3FK7 A;  1LE8 B;  2YUS A;  1JUS A;  1GT0 C;  1MBJ A;  2TRT A;  1ZKG A;  3LSG A;  4A3G J;  1GDT A;  2DA2 A;  2JA7 J;  3W6V A;  1AKH B;  5IP9 J;  1JKR C;  2NVY J;  4XRM A;  4FTH A;  3BG3 A;  4A3C J;  2HOA A;  1T33 A;  1QVU A;  3JRA A;  3IH2 A;  1SFO J;  1R9T J;  3M4O J;  1G2H A;  4M3F A;  5JLX A;  2DA4 A;  2E1O A;  1VFC A;  3MKL A;  5F0C A;  3JR9 A;  3I4M J;  1DU0 A;  2NS8 A;  2HI3 A;  2YS9 A;  3BT9 A;  2B63 J;  2XPU A;  1UHS A;  5FLM J;  1ENH A;  1JUP A;  5C44 J;  1IDY A;  4DZP A;  5F04 A;  3A03 A;  1NK3 P;  5IYB J;  1ETY A;  4JP0 A;  3H0G J;  5IOZ A;  2P81 A;  1LFU P;  3GTP J;  2MW8 A;  3BTI A;  2R5Z A;  1ETV A;  1NK2 P;  2LR8 A;  2QCO A;  3MVP A;  3B6A A;  1RES A;  3ZQH A;  4NDL A;  4BKX A;  2HOT A;  5K7F A;  2M8G X;  3BQY A;  4B4C A;  4XID A;  1JKP C;  5IP7 J;  3HOY J;  2K40 A;  1JT0 A;  1BA5 A;  2XGE A;  3BR6 A;  1LE8 A;  1MSF C;  3FKI J;  3JRC A;  5EG0 B;  2K9S A;  5EGO A;  4AC0 A;  2CRG A;  1AKH A;  1RR7 A;  3FK6 A;  2WAQ N;  2R5Y A;  1ITY A;  2JA6 J;  1ETO A;  4BY7 J;  1HCR A;  3NAU A;  1U9N A;  1VND A;  1MH3 A;  1AHD P;  1T56 A;  2LVS A;  4IHW A;  2XPW A;  3TED A;  5FKN A;  1H8A C;  1BW5 A;  4M3D A;  3LNQ A;  1BJZ A;  2CQQ A;  1ETX A;  3LSJ A;  1BL0 A;  4LOC A;  5E3L A;  4IEJ A;  4I76 A;  2WB1 N;  3HGY A;  5K7H A;  2PMZ N;  3GTK J;  2D5V A;  4DZJ A;  5EEA A;  2VPR A;  2Y0S N;  3O8H A;  3LSR A;  4M6V A;  2OF7 A;  3S1M J;  1FEX A;  3TW7 A;  1JKQ C;  4RDU A;  3PM1 A;  3QPL A;  4DYQ A;  1POG A;  1IDZ A;  4CYC A;  2W48 A;  5FKK A;  3GTM J;  4BXX J;  4A69 C;  1GV2 A;  4XRS A;  5J1U A;  1IRZ A;  3JRE A;  2NVT J;  4BBS J;  2MG4 A;  1WGX A;  2EQR A;  1OJL A;  5C3E J;  5EF6 A;  3Q0V A;  3NAR A;  2XB0 X;  3SFI A;  4RBO A;  3SJM A;  1MBF A;  4MFD A;  3JRG A;  4MO7 A;  5F08 A;  5EZG A;  1QPI A;  3OIO A;  3GTJ J;  4MIM A;  2E19 A;  1MNM C;  2CJJ A;  3HOX J;  5EGO B;  4ABZ A;  3BQZ A;  2DMN A;  3ZQC A;  1PUF B;  3A02 A;  2LP0 A;  4M3B A;  2R5Y B;  2KT0 A;  1FTT A;  3OOU A;  1UMQ A;  5HOD A;  2LD5 A;  1W0U A;  1FJL A;  4GFB A;  4FE7 A;  3IH4 A;  4V2G A;  1VI0 A;  3OSG A;  1ZGW A;  3B6C A;  4Y52 J;  2GBY A;  3A01 B;  3CQZ J;  1K61 A;  2YU9 J;  2JN6 A;  4DW6 A;  5E3M A;  1JGG A;  4W97 A;  3IV5 A;  3RZO J;  2EZH A;  1NTC A;  3O8G A;  2R92 J;  4C3H J;  5FLV A;  1RKT A;  5F27 A;  3ZQL A;  3ZQG A;  1ZR4 A;  1JT6 A;  2L0K A;  3IH3 A;  3HEF A;  1GUU A;  1RET A;  2GM4 A;  3ZQF A;  5F0H A;  2I10 A;  1U9O A;  4BBR J;  4FCY A;  3Q0U A;  2ME6 A;  4I6Z A;  4CYC B;  1HDP A;  4DYR A;  2JK3 A;  3JRI A;  4X1E A;  2AHQ A;  5J3L A;  3GTL J;  3M3Y J;  1X58 A;  4B3A A;  3K2A A;  2FD5 A;  3JRB A;  4A3D J;  2HXI A;  2DMQ A;  3S1R J;  2Y31 A;  4XK4 A;  2ID6 A;  3VPR A;  2JA5 J;  3BR0 A;  1Z77 A;  3HOU J;  1U8B A;  3HOZ J;  1I6H J;  2FX0 A;  1GVD A;  3S15 J;  4A3B J;  3Q3S A;  1PUF A;  4JX6 A;  5E3O A;  1A5J A;  1QVT A;  2CU7 A;  1H88 C;  3BTJ A;  5E3N A;  2E2I J;  2CQX A;  4A93 J;  1IUF A;  4M3G A;  1IV6 A;  3HBL A;  1FTZ A;  1B8I A;  2ELK A;  3WHB A;  4AYB N;  4AUX A;  4C3I J;  5FJ8 J;  2Y9Z A;  1O4X A;  2GLO A;  3HOW J;  4XRS G;  2QF7 A;  2DN0 A;  3A01 A;  5EYR A;  3TW6 A;  3S17 J;  3FIW A;  2DA7 A;  4BY1 J;  2EH3 A;  1UG2 A;  9ANT A;  1OFC X;  1IC8 A;  1HOM A;  1I3Q J;  3K7A J;  2HOS A;  3QQA A;  4D7N A;  4A3F J;  3G1M A;  1YRN B;  2L9R A;  5GPC A;  2HDD A;  1Y1V J;  2CUF A;  2DA1 A;  4S0H B;  4FE4 A;  1QRY A;  2M2E A;  3LOC A;  4EEF G;  2DTZ A;  2NOG A;  4X6A J;  1E3O C;  2N8G A;  4QTR A;  3HDD A;  1ETW A;  1JTX A;  2EZI A;  2L7Z A;  3G1L A;  5DTD A;  2DMU A;  4XIC A;  2X48 A;  1I50 J;  2X6O A;  1P7J A;  1P7I A;  5EZH A;  1ETQ A;  2HQ5 A;  3E7L A;  3BR1 A;  1XS9 A;  5GP9 A;  4A3M J;  3S1Q J;  2XGD A;  3MN2 A;  4QSH A;  3BTC A;  1B72 A;  2JA8 J;  2E2H J;  3S2D J;  1APL C;  3GTQ J;  1TC3 C;  1OCT C;  2O8K A;  1JUM A;  4A3L J;  1ORK A;  3JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...