2WY7Q

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d revealing an alternative binding mode
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
66
structure length
66
Chain Sequence
VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1270 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2wy7Q00
2JVGA 2GOXB 2WY7Q 2GOMA 3D5SC 2JVHA 3D5RC 2NOJB 2WY8Q
chains in the Genus database with same CATH superfamily
1XGNA 1X3WB 4XLNF 4XLFA 3NAUA 1QZYA 2RC4A 2NNYA 3HG9A 1B9NA 1S5LC 3KEOA 2F2EA 4L9JA 1NHAA 1K4SA 4Q5SF 2E2JJ 2CO5A 2ZFWA 2O8XA 2DDAA 1IF1A 3IV5A 5IOYA 1R4MB 1K78B 1J75A 4RS8A 1I3QJ 2DQRA 2NVUB 2MGQA 4HDVA 1TWGJ 4BQOA 2NOJB 5A2QK 3H0DA 2K02A 4UUVA 2PI0A 3L9FA 2UXNA 4KDPA 3ZMDA 2P5LC 5J8FA 4X1EA 3BZKA 5CPRB 3CQZJ 3TGNA 3IRQA 1N77A 1S7AA 2FMYA 2GOXB 3FIWA 4G6QA 3S1QJ 2L9SA 4MO7A 2FOWA 2GIZA 1AU7A 2LBFA 3GW2A 2Y30A 1IW7F 3GTKJ 2NS7A 2HNHA 2CV2A 3GTQJ 2M87A 2O0YA 4DQ2A 5DD8A 2UV1A 3HYIA 4CHUA 3CP2A 4OAYA 2L7FP 4L9TA 5D4SA 1FSEA 1I6HJ 3OWTA 3FXKA 2PMZA 1K78A 1YRNA 5IP7J 2OCEA 4BHPA 4D9JA 2CUEA 2KZVA 1XMKA 4PGGA 3FHZA 1XS9A 1IGNA 3HKZA 1XC5A 4HX7A 2R3SA 1VZ0A 2VIXA 2P4WA 4EVIA 4M71A 1PP7U 2K4JA 1Z7LA 4IQ4A 5D6EA 5EYRA 4BHCA 2ZB9A 3BQYA 1CF7B 4ZZLA 2X0LA 4ANJA 2FNPA 5F0FA 3SHFA 2F5DA 5EG0A 1OCPA 3LSHA 1FMWA 4G7HF 4NBQA 5JVGF 4BEHA 1BL0A 2KPMA 4GRIA 1VQOI 3ZGKA 1ETWA 2QQBA 5J8CA 2XPWA 5GTHC 1D0YA 1YYVA 4L5IA 3GX4X 2P81A 1Z9CA 2OAZA 3KP3A 4KIGA 4YFNF 3CMMA 3RKWA 1SFKA 1IN6A 4N4NB 4XM3A 1J0RA 1Y39A 1VQ4I 3HOVJ 1MBGA 1BW5A 2M8GX 3QYEA 4AIHA 4I98B 2LR8A 3SZTA 3KZZA 3G1MA 2E1MC 1MBHA 1O7FA 2OUMA 2HQAA 1E3PA 4IKFA 2X85A 1HCRA 3GTLJ 2WY7Q 4A3GJ 2XAUA 2DTZA 4HLYA 1D0ZA 5ERIA 4J01A 4XQFA 3CJNA 2DFFA 3O8HA 3BQZA 1O3RA 3SXYA 5LEJA 2ID3A 1XSDA 3SDGA 2FJ1A 2F5FA 1OCRH 2WV0A 4IJAA 1NK2P 2HOSA 1FIPA 3FWEA 2L01A 3WTTC 4D7MA 2A68F 4DBRA 3OYMA 3MCZA 4ZYEA 2E7WA 2EZHA 2XUBA 4KN7X 1W5CC 4ZYGA 3N97A 4C2UA 1KU2A 2XAFA 3BROA 2DA7A 2D2WA 2AO9A 2QYOA 1WJBA 1VNDA 4AM3A 4M74A 4MQVA 2WAQN 1X1AA 4AUXA 1TQMA 4W97A 1X4OA 1HBXG 4BQAA 3ABTA 1F5TA 4AVPA 2XASA 2C6YA 5LEKA 2XIGA 2VBZA 5K5RA 5DV5A 2HOEA 4CCMA 3TMOA 3L2UA 1VQ5I 5FLXK 2YPRA 4EM2A 3ABMH 4E7KA 1KGSA 1AHDP 1QPIA 2XROA 1YX5A 1XSVA 4IPAA 1GT0C 1ZN2A 4TV7A 3VODA 4OINF 3K1NA 3T0YA 1WI3A 1XGOA 4CO8A 3HOTA 3RZDJ 2NVQJ 2KIFA 3J7ZI 1O57A 2HI3A 3WGHA 5F1JA 2EIJH 4FE7A 3HB9A 1BW6A 3HUGA 4HQEA 3DBHB 4AIJA 3CDIA 3WE3A 4XICA 2IT0A 1HLVA 3CCSI 1FBSA 3RQIA 3JRBA 1GV2A 1EA3A 1YS7A 3RPUD 1FBUA 4A3MJ 2DAOA 3S1MJ 3BP8A 4F3QA 4RAFA 5KVRA 4BH9A 4FISA 2QQ8A 4Y4RA 4RDUA 1OJLA 3BJ6A 4XONA 4MQ9F 1DP3A 3KE2A 2GLOA 3W6VA 2OBPA 5F04A 3VDXA 3GMEA 1A6IA 4F52A 1I1GA 2BV6A 3DEEA 3ABKH 4X6AJ 1W36C 2EJRA 1XX5A 2DLLA 3COAC 2KRCA 4XBFA 2NS0A 1ZR2A 3QP6A 3ECHA 4Y3OA 4RMNA 1H88C 1GDTA 1LUJB 4HF2A 2KFDA 3I54A 4CH7A 4IX7A 3K4BA 4Y52J 1BI2A 1CQTA 4OMYA 2IJLA 2M34A 3G1OA 5HOOA 5KAFC 1DU6A 1KU9A 4ZDPA 3KP2A 3OV8A 2CV0A 1T39A 1MMSA 1TT0A 3SFIA 4E6KG 1L0OC 3TOAA 3WU2C 2FQ4A 2V1NA 1UAAA 1VQ7I 3FXLA 1BR4A 4BJTA 3JTHA 3L2QA 1AKHA 3MZ8A 2HYGD 3KZYA 2VQLA 2GOMA 3AG3H 3OYJA 3OSGA 3HOUJ 4A0YA 3P9CA 1V5GA 3PNVA 5JR3A 4KMUX 2WB1N 3DCFA 1RRJA 3E6MA 2YX7A 1V4RA 4E7LA 1GXQA 4ZYHA 2Y0SN 3BTJA 2IS2A 4RAYA 3E6BA 1OYYA 5J1RA 3S17J 2HPMA 2DPUA 1G3SA 2H8RA 2JA8J 5L3BA 3GTOJ 3NARA 1MNDA 1IDYA 4E70A 1QZZA 2MFZA 4I76A 1IXRC 2M5WA 1VTNC 4JK1X 1MZBA 1IG7A 1C0WA 5HS8A 5J4YA 3DU6A 2IA1A 2LDUA 5HLHA 2M0MA 2M30A 2IS4A 5D8LB 2VXZA 1BI3A 1R49A 2EV0A 1A6QA 1XCBA 2QQ9A 3CESA 3SFZA 4L0YB 1F1ZA 1DGRM 2KRFA 1FC3A 2VN2A 1JKRC 4Y17A 3OYAA 2DCEA 2LKSA 3G1LA 2HVQA 3P5JA 3GFJA 2BHZA 3RJPA 2G7UA 3PIOF 3PSFA 4CUGA 3KP4A 3HHHA 5JI6A 2CUZA 2IPQX 1R4NB 1U5TC 1BN5A 2KHMA 3WG7H 2DFIA 4BL0B 4HQMA 1KU3A 3IH3A 4EJTA 2EA4A 3QU3A 3OMYA 3DU5A 1J7KA 5IYCJ 3W6JB 4Y7NJ 3LOCA 2FOKA 3GTJJ 4NB5A 1TT5B 2HZDA 5LLQA 4RGXA 1DGWY 2EIKH 4ZZDA 1KQ8A 1X58A 3C1DA 4I7HA 3J7AY 3DPTA 2XRLA 2H27A 4V2FA 3CCRI 5EZHA 3TP0A 5IYDJ 1FOXA 5FD5A 3V7RA 1RC9A 4HA8A 5FJ8J 2I8DA 3TL4X 3F23A 4M6VA 2F5VA 4J00A 2HZTA 4BGDA 2V1XA 3S15J 1FP1D 5GP9A 1TNTA 3R61A 4BKXA 2BW3B 2QGUA 4XN3A 4PFOA 4QSHA 1ZGWA 3NWSA 1LFPA 3BLYA 1XB4A 1SD7A 3ERED 1FYKA 3E5QA 4IVNA 3DKWA 1F36A 5B1BH 1OYWA 2E7XA 1UG2A 2MA3A 2CQKA 2X6OA 3X2QH 1E2XA 2D1VA 3LL7A 5BMZA 2KJCA 1U78A 2OQGA 2V1DA 1FSHA 3I64A 1D8JA 3OS2A 2XF7A 3ZPLA 1IRGA 3HRSA 1R71A 2E1MB 3ML6A 4E7SA 3HTSB 1TQIA 3QPSA 2DT7B 2WBMA 3OYKA 4N0BA 2IA2A 1MD0A 1O3TA 1L3LA 1P4AA 3DPLC 1LPQA 4KIFA 4JYKA 4I99C 4ZYAA 3HRMA 3MQ0A 3QYBA 1W5TA 1HA8A 1WJ5A 1GHCA 3E0JB 2O6GE 2XPVA 4JX4A 1YJNI 1YE9A 1OR7C 2FE3A 4QWQA 3H9JA 2QKLB 2KQRA 4B09A 1HW5A 2JWTA 1SEUA 2BZTA 4BU2A 1G3YA 2GBYA 3CO6C 2EPFA 2V7FA 1YI2I 4JBAA 3EYYA 3ASNH 3MVPA 3LAPA 2H1KA 1Z0XA 5E79C 2X4HA 2Q8KA 4EATA 3GYHX 3T8RA 3LA3A 2LF7A 2MC4A 2WAQA 1S9HA 5ILSA 2H6BA 1OFCX 4G9YA 5HVQC 3BCAA 1QHHD 1VF9A 4WXCA 1MDMB 3CUQC 3TEDA 2VL8A 1JTXA 1PYVA 4EV0A 1ETVA 2R5YB 4PJMA 4HPQA 3U1DA 4UUTA 3O6BB 4NQWB 2R4GA 2FBIA 3A01A 4NNJA 3RIRA 4M3FA 4BBRJ 3Q9VA 2LREA 1W1WE 2R7SA 3CJTB 5J40A 3ZMSA 2MBFA 3BG6A 1VQ6I 4M3BA 3F0CA 2EWNA 1R5HA 4LJZF 3RPQA 1SFUA 4LG0B 2PG4A 3QU6A 1LB2A 2QENA 3A4CA 3P7NA 3AL0C 2O3FA 3ZQHA 3TQNA 4AIDA 2DN0A 1J09A 3F6OA 3SDBA 3ERMA 5ICEA 2JPCA 2DMPA 1KU7A 2BOLA 2DO7A 2L9VA 3HC7A 2FXAA 3CMYA 2IGOA 3FBNB 4IL6C 1B72A 3L00A 5E3MA 1MMNA 3SEZA 4BE1A 2CV1A 1F9NA 4HG2A 3ROUA 1O7LA 3CJQB 3FF5A 2R5YA 3H0GJ 2Y75A 3HRUA 4D7NA 2VUMJ 4NC6A 3JAMK 1S7EA 3T8TA 3BR2A 5HS9A 1ZG5A 1ZLKA 1Y56A 1BR2A 3K2AA 2DMQA 5HLTA 4XOPA 2KIUA 2CFOA 5LD2C 3A2KA 1ETYA 4EEFG 4B44A 4DBQA 4IRGA 4XL9A 1W7PB 3K4JA 4A3EJ 2HYFA 1LKXA 1FT9A 2FBHA 4R79A 1SFXA 4LIUA 3B73A 2FMLA 2YUSA 2DOAA 3HRTA 1B8IA 1T2KA 3WU1B 4A0XA 3PM1A 3ULQB 3ABUA 1T6SA 3E5XA 5GPAA 4IOAF 1R1TA 2ZKZA 2O5RA 2HVSA 2EA2A 2L4MA 3MAJA 2AQEA 4A6EA 4PSXA 1BA5A 1R5GA 2DQLA 5CKTA 1HDDC 3LFUA 4GFBA 1WJEA 1KONA 5FRMA 1R36A 2OA4A 3K1PA 3BZ6A 3BR6A 3LSIA 4IHXA 4OIOF 2DFHA 1W0UA 3SJMA 1VFCA 4XKBA 2QM3A 2XB0X 3FK7A 1W5SA 2Z9OA 3KZIC 5EEAA 2LD5A 2WB1A 3JRDA 2LKXA 4YEJA 4U7BA 2WADA 2PMHA 5E1WA 5M5XJ 1MMAA 4BBSJ 1WGXA 2Y0SA 5EEHA 3ZN0A 2LY1A 1W7PA 4PSWA 5LBQA 4RLQA 3VPRA 5IT9K 4IZZA 2LTPA 1WJCA 4PJNA 3L2WA 2GZWA 4N9HA 2M7BA 3DLAA 4KITB 3BOQA 2R7RA 1HSJA 2O61A 3ONQA 4BDYA 2QBYA 4PDKA 1OCZH 4P55A 3IAS2 1FMVA 1D1BA 4RGRA 3JRHA 3FBIB 5GTIC 4HX8A 3VWBA 4A69C 3ZRGA 2G7HA 5LRRA 4L0ZB 5CQGA 4I0AA 3HOYJ 3DEWA 1B4AA 3GLLA 3ZMVA 5M3MJ 2HWVA 2BXYA 5JHUA 3VEPA 4CGZA 1U5TB 3D5SC 5TISC 5D5WB 2MC3A 2K5CA 2K3PA 2XKOA 4HSRA 3F8FA 2PX9A 2EV5A 3S3NA 3OYDA 2RNGA 3NQOA 4S0HB 4IHWA 5K7HA 3ZQQA 2ICWG 2ZJQF 3H9GA 2VJ5A 2COMA 3WE2A 2V79A 1A35A 4FETA 1ETQA 3BPVA 4Q47A 3RYPA 2K9QA 3H92A 3HJEA 3CC2I 4A3LJ 5FGMA 3KYCB 5F6FA 1LVAA 1U6GA 3WODF 2M7AA 2UUZA 3G71I 2R7UA 3H36A 2OPTA 3BPXA 2LBFB 2ECBA 4QPQA 2O03A 1PP8F 2JN6A 2B63J 3SQNA 2GM4A 3Q9SA 2DYSH 2IBDA 4G8XA 2NNNA 3CCUI 2EFNA 3F6VA 4LK1F 2KT0A 1U5TA 2A3SA 3GVAA 1B6AA 5DM7F 3J80K 4V19K 4Q48A 1YRNB 1DUXC 5FFXA 1FJLA 1SC7A 2E71A 4CICA 2VE9A 4LMYA 3MKZA 1R22A 3ZQFA 3VSLA 1T08B 4LITA 3BWGA 3CUOA 3RTRA 3DWLE 2JUCA 4I02A 1YW8A 1PUEE 1ZTRA 4XK4A 2LMDA 1ZRDA 4G6DA 5EG0B 3FXRA 2ID6A 4A5NA 4BEHB 4FX0A 3HBLA 2HQ5A 3H3ZA 3NRVA 4ASNA 3ECOA 4EJVA 5H2FC 3BC8A 5J3LA 3RKYA 3K2ZA 5C4XJ 4ZC3A 1Z6RA 4LB6B 3WU0A 3S3OA 2DA2A 1R1UA 3DTEA 3QP5A 4Z2YA 1HF0A 4IOCF 3AFHA 3BJOA 2MLKA 1HC8A 3FDYA 1BC7C 2VJJA 5H6QA 2DU9A 4RGSA 3I0TA 4I09A 2Q2EA 3ZP5A 4CZZA 4GGGA 3CTAA 2L54A 3HXLA 4LFUA 2EFQA 3LNQA 3OYLA 2BY2A 5BPIA 5D5UB 1DU0A 1X19A 5L3CA 4P5OA 4OMZA 2A69F 3C18A 1ON1A 3K4CA 5E17F 1WPKA 2OZ6A 2H6CA 2KL4A 2P7VB 4ITVA 1FTTA 4CCKA 2KIMA 3OIQA 2DA1A 3MMYB 3V8JA 4CSWA 3CMEI 1S29A 4WXHA 1IRZA 1Z05A 4A3BJ 4HYEA 3TO6A 5FD6A 2HTSA 1B59A 2CW0F 2QF7A 2VC0A 2FF4A 5D6FA 4RGUA 2OC6A 3FISA 5ILUA 4FHTA 5FKKA 2CRGA 3D1NI 1KQ9A 5TJJA 3ZXSA 4E7ZA 3B6CA 2FD5A 1TQPA 2EH3A 1I39A 2R7ZJ 5E18F 1I3AA 4XRSG 2F5EA 1ZGJA 1JJ6C 4HSTA 3RYRA 1MNEA 3L09A 3T5XA 4DNCA 1OR7A 3V4GA 2IGMA 2FQ3A 5F0CA 4ZJZA 2QSFX 5FLXZ 4BE0A 1YOVB 2DW4A 2YSRA 3LQRA 4KT6A 3S1RJ 4BY1J 2L2OA 3EPZA 1P7JA 2VXDA 4MTDA 1W36D 3R60A 1YHQI 4QTRA 2YX4A 4BHBA 3HUGB 5JLWA 2R7OA 3JSOA 3GFLA 3RQ4A 5C3EJ 1W7PD 3G73A 4I6ZA 1RETA 4HDUA 2L7ZA 2KRHA 3GTGJ 4LLNA 3A02A 4MFEA 2E60A 3FXQA 4O5VA 2XF5A 4KUMA 1H8AC 4RM3A 3PFIA 1J59A 5BNGA 1N25A 1VQNI 1SVOA 1U2WA 3PNTA 1TLHB 4KICA 4YRVA 3PUFA 1EF4A 3KCCA 2K7LA 4WF2A 3VFZA 3J81K 2CH0A 2Y69H 3E7LA 4XORA 2ESHA 2MG4A 4A6DA 1A31A 1MJAA 3LSMA 1HOMA 2FBKA 3JTGA 2E2HJ 2FX0A 2KMUA 5KNLA 2HXIA 1MBJA 2EZKA 1UCRA 5L3EA 1NK3P 1A5JA 3EUHA 5F1RA 2VBXA 3KPHA 2X1EA 4DZJA 3RI4A 2AXLA 4JQFA 2W1OA 2EILH 4PGHA 3CCJI 2ZXJA 3IWFA 2F6CA 2JK3A 1LFBA 1V5EA 3FKJA 1YQAA 4PUSA 3I55I 1OYIA 4BXXJ 2RREA 4G94A 3BY6A 1X2NA 3H5RA 3K4NA 2F5CA 2LSOA 4RA2A 1H9GA 2QQAA 1AKHB 1ZYRF 5LGNA 5D8KB 4RB3C 2DOEA 3OYGA 1K83J 3QRFF 4KISA 2VPRA 4JOMA 4PK4A 2W48A 1JE8A 2PLYA 3GBGA 2Z16A 2VQCA 3REOA 5D4RA 1JT0A 2O7OA 4A5MA 3CCMI 2V9KA 3KETA 1QBJA 3PNYA 4BE2A 3E6CC 1DDNA 3LWFA 3K10A 3M1CA 3VB2A 5F64A 2V26A 2CSOA 4IHSA 1ODDA 1ZLJA 2L9NA 3CJRB 1QHGA 3C3WA 4EJUA 4XLHA 1T0FC 3R0JA 3WGGA 4L9VA 4HNVA 3A0HC 2DMNA 4PCQA 4FTHA 3CF2A 2GWRA 4LK0F 1IV8A 2A6EF 4LLGF 3RSNA 3TDUC 1ITYA 4CDGA 1FBQA 3HHGA 3L7WA 2BY0A 3HIFA 3GTPJ 2Y0MA 2HGCA 1TC3C 2YS9A 3HPGA 2DXIA 4E4HA 3PQJA 4UY8I 4GDFA 2QEXI 3IWZA 2J5OA 2B0LA 3S32A 2ZJ2A 1G3WA 2L02A 2XSJC 1I6XA 3EDPA 2ADUA 1TWAJ 2CQNA 2VI6A 2X51A 1XDUA 3BTLA 3IP4B 1MJ9A 3UR3C 4I01A 1QQIA 4HV6A 3FXOA 3F8NA 1ZKGA 2VODA 2K85A 2PJRA 1PVEA 5EGOB 5IP9J 3CLQA 3IHUA 5C44J 2R7FA 3HL2A 3K1MA 1XN7A 2EFOA 2VLAA 2JA7J 2KJBA 2H8WA 4ESBA 5FRNA 1ENHA 1JXSA 5DCFA 1IC8A 2NVTJ 1YG2A 1AOYA 4IRHA 1A36A 3TOBA 4BXUA 3IUOA 4IEJA 1RR7A 4WCGA 4WWCA 4ENMA 2JQ7A 2CQQA 4UNOA 1PDNC 4BDZA 2E19A 2Y48A 3M4OJ 1TTYA 2RN7A 2L5QA 5IYBJ 3JCUC 3C7JA 3S1NJ 3SYTA 1XPXA 5FO5A 1IN7A 3DEUA 2ZJRF 2RDPA 1RUNA 1R7JA 2XGCA 3U21A 1WJFA 2VT3A 1R58A 2QWWA 3V7SA 5L3GA 4RAGA 2IP2A 1RESA 1WHUA 5EGOA 4GXOA 2HPIA 4UB6C 3W3CA 3PSIA 1WI9A 1JUSA 3GUDA 2K9SA 2HDWA 5HLIA 4CXFA 2R7VA 4D5FA 1ACIA 3IAM2 1WRJA 4KN4X 3ABLH 2CUFA 1NTCA 4ZDLA 3LAJA 4HRIA 2MD5A 3IH2A 1OPCA 4UV8A 2P5VA 3HGYA 2XSDC 1UB9A 2Z1DA 3BR1A 2PQ8A 1ZH5A 1X1DA 2CMPA 2HYJA 4M73A 4HNTA 1GXPA 3QPTA 3OR2C 2M4KA 2YU9J 4LB5A 3JREA 2ME0A 2GAUA 2VKDA 3NEUA 2I10A 1UHWA 2OQRA 3OIPA 2N8GA 1DPRA 2E5NA 2JMWA 4HF1A 5DTDA 1P4WA 1Y8RB 5FFZA 1DP7P 1OMIA 3I59A 4KNYA 2Z5UA 5DYMA 3ZQIA 5LHGA 1ZREA 4BXFA 5ED4A 2XPUA 1LVKA 4U7DA 1ZGAA 1BC8C 1IN8A 4II3A 2QZ8A 3CCEI 3TP3A 5KCMA 1IAWA 3Q0UA 4D0PA 4I2OA 3K0LA 3DBLB 5DD4A 3QAHA 4HZFA 1HSTA 3CD6I 3MD2A 4L5EA 3TO9A 5GPCA 5LFAA 5FLMJ 1G3TA 2JJ7A 3DQVC 2E2IJ 4CZCA 2EBIA 1TL8A 5JHFA 2IXSA 1E3HA 3D5LA 3ZQLA 3H3UA 2GA2A 4FQGA 4B4CA 1ZRFA 5TGTA 1UJ8A 1ZHFA 2ACJA 2CW7A 1U9NA 1PUFA 3VYSB 6PAXA 2IEKA 5GAEJ 3K4KA 2WAEA 1XTAA 5K5OA 5EF6A 2W00A 3HM5A 1XSXA 3A01B 1KQ0A 2R7XA 2H09A 2VKEA 2OZUA 1UFMA 1VQPI 2LLKA 2O9LA 1QNTA 2RQPA 3VYTB 2V9VA 4LG3A 1WCMJ 1JHFA 4XRMA 1LEAA 1FIAA 3H5AA 2VOPA 3HSFA 3DXJF 4MGRA 4ESFA 5BQTA 5M3FJ 2P8TA 2ZJPF 1V54H 1G2HA 1WVRA 3F72A 4I0BA 1H89C 3FK6A 3QYFA 2EFWA 2DPDA 2KP6A 2FEZA 3FMRA 2ELJA 2HDCA 2DJNA 5CJ9A 4C3HJ 1B72B 3KX2A 5DUIA 2LY2A 1P6RA 2BGCA 2ZCWA 2RNJA 2L0KA 2M3AA 5B66C 1TWHJ 1TWFJ 4G12A 3M9AA 5JLXA 1OISA 4QIWN 1D0XA 2LVSA 3SEQA 4S05A 2HKOA 2A5YB 2EB7A 3P9KA 2DK8A 3KEQA 2TRTA 4JP0A 1SMTA 1TW3A 2LKPA 1ZRCA 1ETOA 2CGPA 1B9MA 4UV9A 5D5VB 3JAMZ 3U2RA 2D45A 3CC7I 3TO7A 4AC0A 1JGSA 3C2GA 4PJJA 3ZOBA 3BG7A 3K70C 3EYIA 1MMDA 5EDNA 2JA5J 3GXOA 3UKGA 3DBRB 3Q0VA 2DA3A 2PBIA 3A0BC 1YFHA 1R5ID 2JT1A 4HW0A 1OLTA 4DOZA 1X3ZB 2IW5A 2VQHA 3FXJA 4KJZA 1D1AA 3PO2J 2IVMA 1QO0D 1B8IB 1OQYA 4EQQA 2B9SA 1Y0UA 2M8EA 3RCOA 4C30A 2QSGX 1MSFC 1ERDA 2OTLI 5L3DA 1GLNA 3HOXJ 2RVCA 3DLLF 1JJ8C 2PEXA 2ISZA 4YELA 3A03A 5DCMA 2JUGA 5EZGA 4B8XA 5J1UA 3IRRA 4FASD 5E20A 1SVMA 5DS9A 1U3EM 2R92J 2HQNA 3OS1A 2GQQA 5CVRA 5GAGJ 1ZR4A 4UHTA 2F48A 4KIBA 4CCLA 3C2BA 3CLOA 3LMMA 3QPLA 2HEOA 1LNWA 2K86A 1SMYF 4F55A 3S14J 2RKHA 4RBOA 2XC7A 2Y9ZA 2E34A 2KKOA 3MN2A 4D1QA 1RIOH 5FLVA 2JSPA 2VC1A 4BACA 5CLSA 3TBIA 2BYVE 2BY3A 2R7QA 3CCYA 1FOKA 1MSEC 2CG4A 2RV8A 3FHNA 3S2WA 1FP2A 1FX7A 1LDJA 3IC7A 5H6RA 3G6EI 1A04A 2VJIA 4M9XA 2QBYB 3WTUC 4UVCA 1N78A 3EUKL 3D5RC 2VJ4A 1O4XA 1AA7A 2RQQA 2MABA 1FY7A 5JFRA 4KA4A 3K6GA 1HDPA 1D5YA 3I9V2 4FE4A 3WTYC 2LF8A 2HTJA 1IRXA 4ENKA 1MBFA 4ZH4F 1BIBA 4U0YA 1AWCA 3H9QA 5AIQA 1WFXA 1BIAA 4L18B 5HODA 3QOPA 3W2AA 3FMSA 3Q0WA 4A0ZA 1FWZA 2VONA 3HOWJ 1Y1VJ 1T0FA 2R5ZB 1HW2A 4WX9A 3I56I 1G59A 4U87A 2MW8A 2K9NA 4HAMA 3O2PE 2A6TA 3K4LA 5DUKA 4W1UA 1RR8C 3LA2A 1LDKB 4LOCA 2IS1A 2HQRA 4KMFA 4BJ5C 4LD5A 2EZIA 1K6YA 2LY9A 4B48A 3L2CA 3KYDB 1Z3XA 2I5UA 3PL8A 3WG9A 3ZMZA 4GYIA 2CU7A 3J7YJ 1Y0NA 1BR1A 3FM5A 3ESWB 4KT5C 4A3FJ 1T95A 4F7ZA 1Z3YA 1TW2A 2JPBA 4LGWA 4HV5A 2ME6A 3L1PA 1LFUP 1FNNA 4ETSA 2W57A 4GO1A 2EK5A 3OYIA 3HPHA 3QPHA 1D3YA 1QVUA 2QCOA 3ZMTA 4A3JJ 2MH2A 1DPUA 4M9ZA 4UUSB 1JT6A 5FKOA 4N9IA 5BPDA 2JRMA 2R5ZA 3R0AA 4U88A 3C2HA 1GVJA 2VPLA 5J6XA 5A2QZ 2DODA 3M07A 1W0TA 1ZELA 5J47A 2G0EA 1R6RA 2XAQA 4ZTFA 3FKIJ 1JKQC 2ESNA 2LNBA 4HNUA 5DM6F 4DGWB 2QKMB 2VBWA 5ICCA 2VB6A 5F0HA 4LLLA 1Y8QB 3G3ZA 1ZG1A 5HNHA 2XRNA 4BS9A 3JW4A 4CCJA 4IHVA 3WHBA 1MH4A 3F8CA 3S8PA 3E6DA 4M3EA 4MHGA 1KYZA 2BHYA 2X48A 4ENNA 2NS8A 1X1CA 2JRTA 2Q2EB 2NRAC 4AU7A 2GIVA 4QPOA 2H1LA 2E35A 4AD9A 4O6JA 3CP8A 4ZDOA 2M0CA 3OSFA 4UUSA 3CZ6A 2QLZA 5KHDA 2VKHA 2V6CA 2ELKA 3ASOH 4XOTA 1KZHA 3BG9A 3KYLA 5J4VA 3G4SI 3OY9A 3I53A 2V4JC 1LQ1A 3AG1H 2ZMEC 5CQEA 2CJJA 1FYLA 3OYFA 3ZQGA 4P9FA 5LHIA 4F92B 2L7MP 4D5CA 2X1DA 5FROA 1TZLA 1E17A 1P7IA 1RUOA 1QPMA 2IGKA 5FKLA 2FUG2 3KP5A 3F22A 4A2UA 2CQXA 1IUYA 4EJOA 2F4MB 3CCLI 2QA4I 2X6XA 4NHJA 1UHMA 2JZYA 1WJAA 3H5NA 4U0WA 5HDGA 2A5WA 1OKRA 5K7ZA 4B47A 4DW6A 4GCVA 4B1RA 4NDLA 2CS3A 1VQMI 2M2EA 3BTIA 4ON0A 1USTA 2E36A 2KDOA 1Z77A 3E1SA 3U9GA 3VYUB 3DV8A 3OYCA 1HQCA 2BEOA 2Z2SB 1MH3A 3KEYA 3OR1C 4XRFA 3RDIA 3SZGA 4PJ0C 2Y2ZA 4CCNA 5IPAA 1S6LA 2DYRH 3JRCA 4J19A 3ZCOA 3MFKA 1D5VA 2HOAA 3RKXA 5CVIA 2V9PA 2L7KA 3GCMA 1ULYA 1OCCH 4UVBA 3OIOA 4JX6A 3R6SA 2WWYA 5GAHJ 1QVTA 1R23A 3QOEA 1IV6A 3PUBA 1ONVA 1Z7UA 3OL3A 2MLGA 3H35A 1Y6IA 2K40A 2EIMH 1VI0A 1QZEA 4ESJA 3CUQB 2LK2A 2ZSHB 2UZKA 2HOTA 4Y15A 3KFWX 2Z3YA 1SAUA 2M4GA 4S04A 4XKWA 3M8JA 5HDKA 1WJDA 3GZ6A 1P2FA 3FXMA 1ETXA 1WWXA 4C9YA 4MIMA 3F9KA 3WGIA 2XAJA 3VSKA 2QUFA 4B3XA 2HXOA 3OYHA 3CO7C 3GF2A 2R7WA 3HOSA 3T1BA 2ZNZA 3AL0B 1DQUA 3QWLA 2K9MA 4EM1A 4R1HA 2VOOA 3V7CA 4MEXF 1Z67A 1YJWI 5J1YA 3J81Z 2R7DA 1NG6A 4AIKA 5CVVA 5ICFA 4N4OB 3F8BA 1MKMA 2M45A 4ABZA 3BCBA 3LSKA 2LFBA 3CUQA 5F27A 5ILVA 1ZK8A 1CF7A 3LSGA 4HEA2 3E97A 4AYBN 1UZCA 2B7EA 1LJ9A 2KISA 2X6WA 2L4AA 4DYQA 3DF8A 1EJ9A 3GWZA 1E0EA 3MZHA 5LHHA 3RZOJ 4IF4A 5FB2A 2NVYJ 3CCVI 1EKEA 2XHKA 3V8KA 1XMAA 5E8GA 3WTSC 1SAXA 2ISYA 1S72I 1Q1VA 1WQ2A 1X1BA 2EQRA 1JGGA 3EUAA 5K7FA 3DKXA 4QLCU 3EETA 4BYYA 2PJPA 4C2TA 1XGSA 2E1CA 3W2VA 3VYRB 4G7ZF 4IHTA 5E8IA 2HR3A 4UB8C 2KIQA 4Y13A 2XKPA 1IUFA 2JTVA 3HEFA 3GO5A 4YIRX 4X0GA 2RGVA 3AKZA 3CMAI 1FOYA 1TP4A 2MH9A 1YLFA 4YFXF 4C3JJ 2QVOA 3DP7A 4XNFA 5LRSA 2E1OA 4XN0A 1IN5A 2OV7A 1ZARA 2ZFUA 3MKWB 3BTCA 3HOZJ 2Y9YA 3BG3A 1NH3A 3BR5A 2K9LA 4V2GA 4M3GA 1JKPC 4M9SA 5HNFA 1J2XA 3K4MA 2CQ7A 2ZXIA 3Q3SA 3D0SA 2AS5F 2XB5A 4MNUA 1BI1A 5DEQA 2CWEA 2D5VA 2BXZA 3I71A 1T56A 2DA5A 3OOUA 1PJRA 2NXNB 4RB0A 4XLEA 4EMSA 3PJRA 3AG2H 5GADJ 1YITI 4WK8F 4NC7A 2PJRB 1RNLA 2W82A 3KIOA 4Y33A 5FKNA 1E3OC 1UHSA 4II2A 3PFYA 1JI8A 3S2DJ 1IO2A 1M1EB 2KZGA 2R7TA 1EH6A 4EGZA 2ZXHA 3ZQ7A 1LE8B 1JHHA 1D1CA 4CCOA 1FZPB 3CDHA 5AONA 1QA6A 2K27A 4XIDA 3DTKA 1MNMC 2DA6A 1RZ4A 4BNCA 3S16J 2O8KA 3B6AA 4F93B 3PO3J 3ZN1A 1G8XA 1O3QA 2X9DA 2Y31A 2K3FA 9ANTA 1F43A 4A3DJ 2P5KA 1HXDA 1LDDA 2EINH 2HS5A 2Q1ZB 2CFXA 1FEXA 2X6YA 4YG2F 4OIRF 4MTEA 3I4NJ 1I1SA 3CF5F 3BR0A 5AIPA 3JRGA 4XSZF 2HDDA 3MWMA 2Z99A 5TRDA 4HF0A 3WHCA 1HKSA 1MW7A 1UMQA 1Y1WJ 4FCYA 1ON2A 1B1BA 4P9UA 4KYWA 1WZ2A 3G2BA 3DKYA 4IXAA 3OYNA 1T98A 1LE8A 2IA0A 4OIPF 1EH7A 2QSHX 2LP0A 4HX4A 3N05A 4NUBA 1GUUA 2EFPA 1REPC 5CVUA 3LSJA 3O8GA 2TCTA 3MEXA 1MIJA 5KAIC 3CCQI 3A1YA 3E3VA 1VQKI 1IZ1A 4PFPA 1I50J 5B3SH 2UXXA 1Q1HA 1IN4A 1RKWA 1VQLI 1WKMA 3QQAA 2AHQA 4C3IJ 4XLPF 3BR3A 2WTEA 1HKQA 3GEZA 4FX4A 2IAIA 4UXNA 1WH5A 5M5YJ 4AVZA 2ZBKA 1O3SA 4IO9F 1WSUA 1TBXA 4ENJA 2WV1A 4L9NA 4BUPA 4RB1A 1BI0A 1J9IA 3I59B 4ZTJA 2OU2A 3KLNA 5L3FA 2DI3A 1R9TJ 2DTRA 3LFKA 5HLGA 2D1HA 1P9QC 2XDVA 2ZMEB 1H9TA 5F08A 4Q4ZF 5IY5H 3IKVA 2LOOA 3IKTA 4G7OF 2VASA 3HTUA 2ZO4A 2LC2A 5K5QA 1U8RA 5JVTA 5BS6A 4EJWA 1JTYA 1X3UA 3KP7A 3B02A 5E1ZB 1S8NA 3U1KA 1YS6A 2OD5A 1RI7A 5D5XB 3MKYB 2F4OB 2A05A 2W25A 2K4BA 1F4KA 3I3LA 4ZYDA 3O3KA 2FA5A 1JKOC 3GTMJ 4XMYA 2EV6A 3KLOA 3DPUA 4P1WA 2CW8A 2NOGA 5LGTA 1PUFB 2FSWA 3ZMUA 3GFMA 1KA8A 1USSA 1G6NA 1OCOH 4PJLA 5B1AH 4F91B 3WTXC 5M5WJ 4DJAA 5KK1A 4XLCA 4E7IA 2KDZA 3JRIA 3RKQA 2WY8Q 3BZCA 5E3OA 1H0MA 2GXAA 2OTJI 1BOBA 1POGA 2ZMEA 2OF7A 2DBBA 4OWRB 4Z6YA 5IOZA 3WTVC 4KFCA 3N4MA 2BVMA 3AG4H 3QODA 3K70D 4B3AA 2DFEA 2DA4A 1K4TA 5K1YA 4IRIA 1I5ZA 2OCCH 2P6TA 3LA7A 1EH8A 1TNSA 4EM0B 1SFEA 2E5ZA 4A3CJ 1KYWA 5CYVA 1K6OA 2MYSA 4A93J 2L3DA 3M8EA 1S3JA 4M6XA 4XKCA 2XGXA 1BM9A 1U9OA 2Q0OA 3H3VK 1U8BA 2WA0A 1XMXA 2FNAA 4E7HA 1I27A 2GXBA 3BJAA 4L5JA 3W2WA 1BOAA 2DDBA 3HDDA 5CVJA 1G4DA 2P7CB 1ZQ3P 3F3XA 2ZSIB 2DMUA 1K61A 1FYMA 1YIOA 1XCVA 1VQ9I 1YTYA 3I4PA 1MBEA 1QRYA 4OIQF 1V55H 3JSPA 2H94A 2PMZN 5EJCA 3OL4A 2VQGA 2J5PA 2VE8A 4B43A 2GA1A 3HKZN 4OOIA 3LQQA 4C2MJ 4WXDA 2XF6A 2BW3A 3R4KA 4JX5A 5ICGA 2TDXA 4BQQA 3GFIA 3FXUA 1X1PA 5HS7A 2STTA 1QU3A 2LRDA 1XG1A 1YO5C 2DK5A 3L2VA 2PFBA 2JA2A 2A07F 2PN6A 2YR2A 1T38A 3GLXA 4RAZA 4FT8A 3UNGC 3S3MA 2LH9A 1VQ8I 2EZLA 4AYBA 2P6SA 2XAGA 3TDZC 3V8LA 1APLC 1FOWA 4BY7J 4DZPA 2WAFA 1SD5A 3ISPA 4CYCB 3M3YJ 5DCMB 3LSPA 1YX3A 3OYBA 2CYYA 1GVDA 1Z91A 2RAEA 1YW9A 3HSEA 4DIQA 3KP6A 2W24A 3P9IA 1FTZA 2A61A 4XSXF 3I58A 4H4KC 3F8MA 3OS0A 2BBYA 2JVGA 2NAZA 5E3LA 2A6HF 2G9WA 1RKTA 3E5UA 4XRSA 1J5YA 2OJED 2UWMA 1P92A 1Z1DA 4EGYA 4BJ6C 2L9RA 2XVCA 5FKMA 3ZR8X 2IRFG 3ZQCA 2FU4A 3K69A 4MFDA 2LG4A 3CDLA 2DOFA 2IGNA 2ZNYA 2F4IA 2W4SA 2AXTC 5C4JJ 2XGEA 3DFGA 4XKVA 4G6TB 5HDNA 1GV5A 4YIIA 4XR6A 4RM2A 2COBA 1XD7A 5IT3A 1T8IA 4CYCA 4RB2C 3BG5A 2P0WA 2JSCA 3GZ5A 3FZVA 3MKLA 3HZJA 2DJIA 3M1EA 1STZA 1S7OA 4PZJA 2MD0A 2HFHA 4GYGA 1XGMA 1SANA 4NC8A 4O3MA 3EUHC 1JUPA 1ZAOA 2MSYA 1MDMA 1OCTC 2W84A 1BJAA 2XV4S 1SD6A 1SVLA 1U0JA 5LGUA 2V1UA 4M3DA 2WC2A 1JUMA 3K9TA 4NQWA 4A3KJ 5BOXA 3VOEA 4IQJA 5IT9Z 3FM3A 2NVXJ 1IDZA 4XLAA 1K79A 2ELHA 2ZXWH 4LG0A 2M1BA 4IHYA 4CA0A 4RLFA 3LSTA 4OAZA 1ETKA 4A3IJ 3JRAA 3EQLF 2VT2A 4U0VA 1QGPA 4P96A 3WTZA 2ETHA 3AAFA 2ZC2A 3OOPA 3PQKA 2CUJA 2KLOA 2BVLA 2JA6J 1W4MA 5B5EC 2LYCA 1CGPA 1X2MA 3I4MJ 1YJ9I 2XAHA 1UG0A 2HKXA 4R8HA 1ORKA 4UVAA 3OYEA 3MZYA 1T33A 3HSRA 4HOBA 4M72A 2R0QC 1YIJI 3M8FA 1Z6TA 1IXCA 4MEYF 1HW1A 2DMTA 2R93J 2M9HA 2STWA 4BAYA 3DTIA 2JVHA 4YFKF 3F21A 4DYRA 4E7JA 2HVRA 1K7AA 2BE5F 2W85A 3TW6A 1LEBA 1D8KA 3WTWC 3BDDA 1XDSA 1R1VA 2FRHA 2DT6A 2XGDA 3K7AJ 3HGGA 1MGTA 3JRFA 1SD4A 1UELB 2ECCA 3I5UA 3W6KB 2YU3A 5DDGA 2DT5A 3J7AO 3L2RA 1V5FA 3PIPF 1BJZA 1NG7A 1MJBA 2IS6A 4AWXB 3J80Z 1HKTA 3ELKA 4HLXA 4H0EA 3JR9A 3FMQA 1V3FA 3NWTA 5E1XA 1YW7A 4K2EA 1WH7A 5E3NA 5IP6A 4M6YA 3SZPA 2Z33A 1P4XA 1MMGA 1FLIA 1EV7A 3S93A 3V42A 3M7GA 2AQFA 1N75A 4HBLA 5EEGA 2NYXA 3H1CA 4LIVA 1FPQA 2E1NA 2GXGA 4A12A 3FX3A 2BY1A 2X1CA 3IH4A 4YIFA 2VKVA 3RPUA 3CC4I 1SFOJ 4OU0A 2VBYA 1ZG3A 3GZNB 2V6EA 1BBYA 1IRFA 3BT9A 2W7NA 3S2HJ 4CYDA 1TWCJ 1Z21A 1IJWC 1RPWA 3TW7A 3TKYA 1MBKA 4MLOA 1R00A 3IL2A 1IXSB 2PMUA 1X4PA 4DYCA 3LSRA 5H20A 2HU9A 4BQNA 3Q5FA
chains in the Genus database with same CATH topology
2IGOA 3FBNB 4ZDLA 4XLFA 4HRIA 3HG9A 1MMNA 3SEZA 4BE1A 2CV1A 4HG2A 3AKZA 4X0GA 2Z1DA 3CJQB 1X1DA 2CMPA 4HNTA 3OR2C 2M4KA 4XNFA 4XN0A 2VKDA 4BQOA 2NOJB 2OV7A 3H0DA 2ZFUA 1Y56A 1BR2A 3OIPA 4XOPA 5HLTA 2CFOA 2E5NA 3MKWB 5LD2C 3A2KA 2K9LA 5CPRB 1N77A 4B44A 2GOXB 5HNFA 4DBQA 2L9SA 4XL9A 3K4JA 3K4MA 2ZXIA 1LKXA 2LBFA 4BXFA 4R79A 4LIUA 1LVKA 2DOAA 3OOUA 4II3A 1PJRA 4XLEA 3PJRA 2HNHA 5KCMA 2CV2A 2UV1A 4NC7A 2PJRB 3CP2A 2W82A 4OAYA 4Y33A 4II2A 3PFYA 1JI8A 2O5RA 2HVSA 3OWTA 3MD2A 2R7TA 2AQEA 5LFAA 2PMZA 4PSXA 2ZXHA 4D9JA 1D1CA 2KZVA 5CKTA 4CCOA 3DQVC 3HKZA 3LFUA 4CZCA 1WJEA 1KONA 5JHFA 5FRMA 2IXSA 3D5LA 3DTKA 1VZ0A 2VIXA 3LSIA 5TGTA 1Z7LA 2CW7A 4IQ4A 4XKBA 4F93B 3VYSB 1G8XA 2WB1A 4YEJA 4ANJA 2WADA 3K4KA 4U7BA 2WAEA 1MMAA 2Y0SA 2W00A 3LSHA 1FMWA 2LY1A 4PSWA 4BEHA 2KPMA 4GRIA 2Q1ZB 4RLQA 3ZGKA 4IZZA 2X6YA 2R7XA 1WJCA 4PJNA 3L2WA 1D0YA 2M7BA 3DLAA 3VYTB 4LG3A 4KITB 2R7RA 3CMMA 1SFKA 3ONQA 4N4NB 3H5AA 4XM3A 4BDYA 1MW7A 3QYEA 3IAS2 1FMVA 1D1BA 3G2BA 2E1MC 3FBIB 3DKYA 3QYFA 2KP6A 2OUMA 3OYNA 2HQAA 3ZRGA 3VWBA 4IKFA 2ELJA 2X85A 2WY7Q 5CQGA 2XAUA 3KX2A 3N05A 1D0ZA 2LY2A 4NUBA 2M3AA 4J01A 4XQFA 3A1YA 3D5SC 2K5CA 2K3PA 4HSRA 4PFPA 1D0XA 3SEQA 3S3NA 3OYDA 2RNGA 3ZQQA 4DBRA 3OYMA 3H9GA 2VJ5A 4FETA 4AVZA 4C2UA 3C2GA 4PJJA 3BG7A 3K70C 1MMDA 1WJBA 4BUPA 1X1AA 4ZTJA 1X4OA 1OLTA 2M7AA 2UUZA 4DOZA 2XDVA 1P9QC 2R7UA 2LBFB 2VQHA 4KJZA 1D1AA 2LOOA 4CCMA 3TMOA 4QPQA 2VASA 3L2UA 1ERDA 3RCOA 4C30A 4E7KA 2LC2A 1GLNA 1YX5A 4YELA 3MKYB 2JUGA 3HOTA 3I3LA 4FASD 4XMYA 3DPUA 4P1WA 2CW8A 3MKZA 3OS1A 3VSLA 4LITA 3RTRA 4CCLA 3DWLE 4F91B 4PJLA 3LMMA 4DJAA 4F55A 2XC7A 4XLCA 4D1QA 4E7IA 1EA3A 2JSPA 4BEHB 2WY8Q 4BACA 3TBIA 3RPUD 1BOBA 2R7QA 4OWRB 3BC8A 3FHNA 4ZC3A 4F3QA 2BVMA 3S3OA 3QODA 3DTEA 4Y4RA 3K70D 2VJIA 4XONA 3AFHA 1DP3A 3FDYA 2VJJA 3EUKL 1N78A 3VDXA 3D5RC 2VJ4A 4F52A 2E5ZA 1AA7A 2RQQA 3DEEA 1W36C 2MABA 2MYSA 3HXLA 2KRCA 3OYLA 4XKCA 1X19A 3K6GA 4P5OA 3I9V2 3K4CA 4Y3OA 2KL4A 4RMNA 1IRXA 4ITVA 2WA0A 4CCKA 4E7HA 3OIQA 3MMYB 4CSWA 4CH7A 4IX7A 3H9QA 3K4BA 1WFXA 3W2WA 3W2AA 2ZSIB 5HOOA 4ZDPA 2CV0A 2OC6A 1G59A 1TT0A 4U87A 4E6KG 3OL4A 3ZXSA 2VQGA 2V1NA 1UAAA 4B43A 2A6TA 3K4LA 1BR4A 4E7ZA 2XF6A 4BJTA 3L2QA 1LDKB 2IS1A 2BW3A 2GOMA 2VQLA 4BJ5C 3OYJA 4BQQA 1V5GA 3PNVA 1K6YA 1QU3A 2LRDA 3L2VA 4HSTA 2JA2A 1MNEA 4B48A 4E7LA 2IS2A 1Z3XA 3PL8A 3UNGC 3S3MA 2IGMA 2LH9A 4ZJZA 1BR1A 4AYBA 2HPMA 4BE0A 1T95A 2WAFA 1Z3YA 4KT6A 2L2OA 1MNDA 3EPZA 1YX3A 3OYBA 2VXDA 2MFZA 1W36D 3OYIA 3HPHA 4DIQA 3DU6A 2M0MA 2IS4A 3HUGB 2VXZA 2R7OA 4H4KC 3OS0A 2JVGA 3C2HA 2VPLA 3CESA 3RQ4A 1DGRM 1ZELA 3OYAA 2DCEA 1R6RA 2UWMA 4ZTFA 2KRHA 2HVQA 4BJ6C 3ZR8X 4HNUA 2E60A 2QKMB 4DGWB 3PSFA 4CUGA 2LG4A 2VB6A 2IGNA 2F4IA 2XF5A 5HNHA 4BS9A 2W4SA 4CCJA 2CUZA 4RM3A 4XKVA 4G6TB 3S8PA 2KHMA 4XR6A 4RM2A 4BL0B 3PNTA 4YRVA 1X1CA 2Q2EB 3OMYA 4AU7A 4QPOA 3DU5A 2P0WA 2CH0A 4XORA 3CP8A 4ZDOA 3LSMA 2DJIA 3CZ6A 5KHDA 2VKHA 2HZDA 2KMUA 1DGWY 2MD0A 5KNLA 4XOTA 4NC8A 3EUHC 3KYLA 3J7AY 3OY9A 3DPTA 2V4JC 2X1EA 4JQFA 2W1OA 1U0JA 5CQEA 3OYFA 2F6CA 1V5EA 3FKJA 2I8DA 4PUSA 3TL4X 4F92B 2X1DA 2F5VA 4J00A 4IQJA 5FROA 1TZLA 4BGDA 2RREA 3H5RA 3K4NA 2IGKA 2FUG2 4XLAA 2X6XA 2BW3B 3H5NA 1WJAA 4XN3A 4PFOA 2A5WA 4CA0A 4RLFA 3NWSA 4B47A 1LFPA 3OYGA 3BLYA 4KISA 4JOMA 4OAZA 4PK4A 2CS3A 3GBGA 2Z16A 2VQCA 2KDOA 3E1SA 2CUJA 2KLOA 2BVLA 2V9KA 3VYUB 3PNYA 4BE2A 3OYCA 2Z2SB 3KEYA 3OR1C 3K10A 2LYCA 3M1CA 3SZGA 3LL7A 2V26A 1UG0A 4CCNA 2L9NA 3CJRB 1QHGA 2XF7A 3OS2A 4XLHA 3ZCOA 1T0FC 3OYEA 2E1MB 4E7SA 2L7KA 2DT7B 2WBMA 3CF2A 3OYKA 3RSNA 3QOEA 3PUBA 3DPLC 3OL3A 3H35A 1Y6IA 3DTIA 4ZYAA 3QYBA 2JVHA 1HA8A 3HPGA 2ZSHB 2DXIA 4E4HA 1WJ5A 3E0JB 4E7JA 2HVRA 3S32A 1SAUA 2XSJC 2M4GA 1YE9A 1OR7C 4XKWA 3H9JA 2QKLB 3M8JA 2KQRA 1WJDA 2DT6A 2X51A 3IP4B 4C9YA 3UR3C 4BU2A 1UELB 3F9KA 2V7FA 3VSKA 2PJRA 3L2RA 1V5FA 4B3XA 3OYHA 2R7WA 3HOSA 1NG7A 3AL0B 1DQUA 2IS6A 2K9MA 3HL2A 2VLAA 5FRNA 4EATA 2MC4A 2WAQA 1NG6A 1S9HA 3NWTA 4N4OB 3BCAA 1QHHD 5HVQC 3IUOA 1MMGA 2VL8A 3BCBA 3LSKA 3S93A 3V42A 1PYVA 2AQFA 1N75A 3LSGA 4HEA2 4BDZA 4PJMA 4HPQA 4LIVA 4NQWB 2X6WA 2R4GA 4NNJA 2X1CA 1E0EA 2L5QA 2LREA 2R7SA 3SYTA 3BG6A 2V6EA 3U21A 1WJFA 2W7NA 3A4CA 1X1BA 1Z21A 3AL0C 3EUAA 2HPIA 4MLOA 3DKXA 1J09A 3SDBA 3W3CA 3PSIA 1X4PA 2R7VA 2HDWA 4C2TA 2HU9A 3IAM2 4BQNA 2BOLA 3HC7A 3W2VA 3VYRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVG A;  2GOX B;  2WY7 Q;  2GOM A;  3D5S C;  2JVH A;  3D5R C;  2NOJ B;  2WY8 Q; 
#chains in the Genus database with same CATH topology
 1XGN A;  1X3W B;  4XLN F;  4XLF A;  3NAU A;  1QZY A;  2RC4 A;  2NNY A;  3HG9 A;  1B9N A;  1S5L C;  3KEO A;  2F2E A;  4L9J A;  1NHA A;  1K4S A;  4Q5S F;  2E2J J;  2CO5 A;  2ZFW A;  2O8X A;  2DDA A;  1IF1 A;  3IV5 A;  5IOY A;  1R4M B;  1K78 B;  1J75 A;  4RS8 A;  1I3Q J;  2DQR A;  2NVU B;  2MGQ A;  4HDV A;  1TWG J;  4BQO A;  2NOJ B;  5A2Q K;  3H0D A;  2K02 A;  4UUV A;  2PI0 A;  3L9F A;  2UXN A;  4KDP A;  3ZMD A;  2P5L C;  5J8F A;  4X1E A;  3BZK A;  5CPR B;  3CQZ J;  3TGN A;  3IRQ A;  1N77 A;  1S7A A;  2FMY A;  2GOX B;  3FIW A;  4G6Q A;  3S1Q J;  2L9S A;  4MO7 A;  2FOW A;  2GIZ A;  1AU7 A;  2LBF A;  3GW2 A;  2Y30 A;  1IW7 F;  3GTK J;  2NS7 A;  2HNH A;  2CV2 A;  3GTQ J;  2M87 A;  2O0Y A;  4DQ2 A;  5DD8 A;  2UV1 A;  3HYI A;  4CHU A;  3CP2 A;  4OAY A;  2L7F P;  4L9T A;  5D4S A;  1FSE A;  1I6H J;  3OWT A;  3FXK A;  2PMZ A;  1K78 A;  1YRN A;  5IP7 J;  2OCE A;  4BHP A;  4D9J A;  2CUE A;  2KZV A;  1XMK A;  4PGG A;  3FHZ A;  1XS9 A;  1IGN A;  3HKZ A;  1XC5 A;  4HX7 A;  2R3S A;  1VZ0 A;  2VIX A;  2P4W A;  4EVI A;  4M71 A;  1PP7 U;  2K4J A;  1Z7L A;  4IQ4 A;  5D6E A;  5EYR A;  4BHC A;  2ZB9 A;  3BQY A;  1CF7 B;  4ZZL A;  2X0L A;  4ANJ A;  2FNP A;  5F0F A;  3SHF A;  2F5D A;  5EG0 A;  1OCP A;  3LSH A;  1FMW A;  4G7H F;  4NBQ A;  5JVG F;  4BEH A;  1BL0 A;  2KPM A;  4GRI A;  1VQO I;  3ZGK A;  1ETW A;  2QQB A;  5J8C A;  2XPW A;  5GTH C;  1D0Y A;  1YYV A;  4L5I A;  3GX4 X;  2P81 A;  1Z9C A;  2OAZ A;  3KP3 A;  4KIG A;  4YFN F;  3CMM A;  3RKW A;  1SFK A;  1IN6 A;  4N4N B;  4XM3 A;  1J0R A;  1Y39 A;  1VQ4 I;  3HOV J;  1MBG A;  1BW5 A;  2M8G X;  3QYE A;  4AIH A;  4I98 B;  2LR8 A;  3SZT A;  3KZZ A;  3G1M A;  2E1M C;  1MBH A;  1O7F A;  2OUM A;  2HQA A;  1E3P A;  4IKF A;  2X85 A;  1HCR A;  3GTL J;  2WY7 Q;  4A3G J;  2XAU A;  2DTZ A;  4HLY A;  1D0Z A;  5ERI A;  4J01 A;  4XQF A;  3CJN A;  2DFF A;  3O8H A;  3BQZ A;  1O3R A;  3SXY A;  5LEJ A;  2ID3 A;  1XSD A;  3SDG A;  2FJ1 A;  2F5F A;  1OCR H;  2WV0 A;  4IJA A;  1NK2 P;  2HOS A;  1FIP A;  3FWE A;  2L01 A;  3WTT C;  4D7M A;  2A68 F;  4DBR A;  3OYM A;  3MCZ A;  4ZYE A;  2E7W A;  2EZH A;  2XUB A;  4KN7 X;  1W5C C;  4ZYG A;  3N97 A;  4C2U A;  1KU2 A;  2XAF A;  3BRO A;  2DA7 A;  2D2W A;  2AO9 A;  2QYO A;  1WJB A;  1VND A;  4AM3 A;  4M74 A;  4MQV A;  2WAQ N;  1X1A A;  4AUX A;  1TQM A;  4W97 A;  1X4O A;  1HBX G;  4BQA A;  3ABT A;  1F5T A;  4AVP A;  2XAS A;  2C6Y A;  5LEK A;  2XIG A;  2VBZ A;  5K5R A;  5DV5 A;  2HOE A;  4CCM A;  3TMO A;  3L2U A;  1VQ5 I;  5FLX K;  2YPR A;  4EM2 A;  3ABM H;  4E7K A;  1KGS A;  1AHD P;  1QPI A;  2XRO A;  1YX5 A;  1XSV A;  4IPA A;  1GT0 C;  1ZN2 A;  4TV7 A;  3VOD A;  4OIN F;  3K1N A;  3T0Y A;  1WI3 A;  1XGO A;  4CO8 A;  3HOT A;  3RZD J;  2NVQ J;  2KIF A;  3J7Z I;  1O57 A;  2HI3 A;  3WGH A;  5F1J A;  2EIJ H;  4FE7 A;  3HB9 A;  1BW6 A;  3HUG A;  4HQE A;  3DBH B;  4AIJ A;  3CDI A;  3WE3 A;  4XIC A;  2IT0 A;  1HLV A;  3CCS I;  1FBS A;  3RQI A;  3JRB A;  1GV2 A;  1EA3 A;  1YS7 A;  3RPU D;  1FBU A;  4A3M J;  2DAO A;  3S1M J;  3BP8 A;  4F3Q A;  4RAF A;  5KVR A;  4BH9 A;  4FIS A;  2QQ8 A;  4Y4R A;  4RDU A;  1OJL A;  3BJ6 A;  4XON A;  4MQ9 F;  1DP3 A;  3KE2 A;  2GLO A;  3W6V A;  2OBP A;  5F04 A;  3VDX A;  3GME A;  1A6I A;  4F52 A;  1I1G A;  2BV6 A;  3DEE A;  3ABK H;  4X6A J;  1W36 C;  2EJR A;  1XX5 A;  2DLL A;  3COA C;  2KRC A;  4XBF A;  2NS0 A;  1ZR2 A;  3QP6 A;  3ECH A;  4Y3O A;  4RMN A;  1H88 C;  1GDT A;  1LUJ B;  4HF2 A;  2KFD A;  3I54 A;  4CH7 A;  4IX7 A;  3K4B A;  4Y52 J;  1BI2 A;  1CQT A;  4OMY A;  2IJL A;  2M34 A;  3G1O A;  5HOO A;  5KAF C;  1DU6 A;  1KU9 A;  4ZDP A;  3KP2 A;  3OV8 A;  2CV0 A;  1T39 A;  1MMS A;  1TT0 A;  3SFI A;  4E6K G;  1L0O C;  3TOA A;  3WU2 C;  2FQ4 A;  2V1N A;  1UAA A;  1VQ7 I;  3FXL A;  1BR4 A;  4BJT A;  3JTH A;  3L2Q A;  1AKH A;  3MZ8 A;  2HYG D;  3KZY A;  2VQL A;  2GOM A;  3AG3 H;  3OYJ A;  3OSG A;  3HOU J;  4A0Y A;  3P9C A;  1V5G A;  3PNV A;  5JR3 A;  4KMU X;  2WB1 N;  3DCF A;  1RRJ A;  3E6M A;  2YX7 A;  1V4R A;  4E7L A;  1GXQ A;  4ZYH A;  2Y0S N;  3BTJ A;  2IS2 A;  4RAY A;  3E6B A;  1OYY A;  5J1R A;  3S17 J;  2HPM A;  2DPU A;  1G3S A;  2H8R A;  2JA8 J;  5L3B A;  3GTO J;  3NAR A;  1MND A;  1IDY A;  4E70 A;  1QZZ A;  2MFZ A;  4I76 A;  1IXR C;  2M5W A;  1VTN C;  4JK1 X;  1MZB A;  1IG7 A;  1C0W A;  5HS8 A;  5J4Y A;  3DU6 A;  2IA1 A;  2LDU A;  5HLH A;  2M0M A;  2M30 A;  2IS4 A;  5D8L B;  2VXZ A;  1BI3 A;  1R49 A;  2EV0 A;  1A6Q A;  1XCB A;  2QQ9 A;  3CES A;  3SFZ A;  4L0Y B;  1F1Z A;  1DGR M;  2KRF A;  1FC3 A;  2VN2 A;  1JKR C;  4Y17 A;  3OYA A;  2DCE A;  2LKS A;  3G1L A;  2HVQ A;  3P5J A;  3GFJ A;  2BHZ A;  3RJP A;  2G7U A;  3PIO F;  3PSF A;  4CUG A;  3KP4 A;  3HHH A;  5JI6 A;  2CUZ A;  2IPQ X;  1R4N B;  1U5T C;  1BN5 A;  2KHM A;  3WG7 H;  2DFI A;  4BL0 B;  4HQM A;  1KU3 A;  3IH3 A;  4EJT A;  2EA4 A;  3QU3 A;  3OMY A;  3DU5 A;  1J7K A;  5IYC J;  3W6J B;  4Y7N J;  3LOC A;  2FOK A;  3GTJ J;  4NB5 A;  1TT5 B;  2HZD A;  5LLQ A;  4RGX A;  1DGW Y;  2EIK H;  4ZZD A;  1KQ8 A;  1X58 A;  3C1D A;  4I7H A;  3J7A Y;  3DPT A;  2XRL A;  2H27 A;  4V2F A;  3CCR I;  5EZH A;  3TP0 A;  5IYD J;  1FOX A;  5FD5 A;  3V7R A;  1RC9 A;  4HA8 A;  5FJ8 J;  2I8D A;  3TL4 X;  3F23 A;  4M6V A;  2F5V A;  4J00 A;  2HZT A;  4BGD A;  2V1X A;  3S15 J;  1FP1 D;  5GP9 A;  1TNT A;  3R61 A;  4BKX A;  2BW3 B;  2QGU A;  4XN3 A;  4PFO A;  4QSH A;  1ZGW A;  3NWS A;  1LFP A;  3BLY A;  1XB4 A;  1SD7 A;  3ERE D;  1FYK A;  3E5Q A;  4IVN A;  3DKW A;  1F36 A;  5B1B H;  1OYW A;  2E7X A;  1UG2 A;  2MA3 A;  2CQK A;  2X6O A;  3X2Q H;  1E2X A;  2D1V A;  3LL7 A;  5BMZ A;  2KJC A;  1U78 A;  2OQG A;  2V1D A;  1FSH A;  3I64 A;  1D8J A;  3OS2 A;  2XF7 A;  3ZPL A;  1IRG A;  3HRS A;  1R71 A;  2E1M B;  3ML6 A;  4E7S A;  3HTS B;  1TQI A;  3QPS A;  2DT7 B;  2WBM A;  3OYK A;  4N0B A;  2IA2 A;  1MD0 A;  1O3T A;  1L3L A;  1P4A A;  3DPL C;  1LPQ A;  4KIF A;  4JYK A;  4I99 C;  4ZYA A;  3HRM A;  3MQ0 A;  3QYB A;  1W5T A;  1HA8 A;  1WJ5 A;  1GHC A;  3E0J B;  2O6G E;  2XPV A;  4JX4 A;  1YJN I;  1YE9 A;  1OR7 C;  2FE3 A;  4QWQ A;  3H9J A;  2QKL B;  2KQR A;  4B09 A;  1HW5 A;  2JWT A;  1SEU A;  2BZT A;  4BU2 A;  1G3Y A;  2GBY A;  3CO6 C;  2EPF A;  2V7F A;  1YI2 I;  4JBA A;  3EYY A;  3ASN H;  3MVP A;  3LAP A;  2H1K A;  1Z0X A;  5E79 C;  2X4H A;  2Q8K A;  4EAT A;  3GYH X;  3T8R A;  3LA3 A;  2LF7 A;  2MC4 A;  2WAQ A;  1S9H A;  5ILS A;  2H6B A;  1OFC X;  4G9Y A;  5HVQ C;  3BCA A;  1QHH D;  1VF9 A;  4WXC A;  1MDM B;  3CUQ C;  3TED A;  2VL8 A;  1JTX A;  1PYV A;  4EV0 A;  1ETV A;  2R5Y B;  4PJM A;  4HPQ A;  3U1D A;  4UUT A;  3O6B B;  4NQW B;  2R4G A;  2FBI A;  3A01 A;  4NNJ A;  3RIR A;  4M3F A;  4BBR J;  3Q9V A;  2LRE A;  1W1W E;  2R7S A;  3CJT B;  5J40 A;  3ZMS A;  2MBF A;  3BG6 A;  1VQ6 I;  4M3B A;  3F0C A;  2EWN A;  1R5H A;  4LJZ F;  3RPQ A;  1SFU A;  4LG0 B;  2PG4 A;  3QU6 A;  1LB2 A;  2QEN A;  3A4C A;  3P7N A;  3AL0 C;  2O3F A;  3ZQH A;  3TQN A;  4AID A;  2DN0 A;  1J09 A;  3F6O A;  3SDB A;  3ERM A;  5ICE A;  2JPC A;  2DMP A;  1KU7 A;  2BOL A;  2DO7 A;  2L9V A;  3HC7 A;  2FXA A;  3CMY A;  2IGO A;  3FBN B;  4IL6 C;  1B72 A;  3L00 A;  5E3M A;  1MMN A;  3SEZ A;  4BE1 A;  2CV1 A;  1F9N A;  4HG2 A;  3ROU A;  1O7L A;  3CJQ B;  3FF5 A;  2R5Y A;  3H0G J;  2Y75 A;  3HRU A;  4D7N A;  2VUM J;  4NC6 A;  3JAM K;  1S7E A;  3T8T A;  3BR2 A;  5HS9 A;  1ZG5 A;  1ZLK A;  1Y56 A;  1BR2 A;  3K2A A;  2DMQ A;  5HLT A;  4XOP A;  2KIU A;  2CFO A;  5LD2 C;  3A2K A;  1ETY A;  4EEF G;  4B44 A;  4DBQ A;  4IRG A;  4XL9 A;  1W7P B;  3K4J A;  4A3E J;  2HYF A;  1LKX A;  1FT9 A;  2FBH A;  4R79 A;  1SFX A;  4LIU A;  3B73 A;  2FML A;  2YUS A;  2DOA A;  3HRT A;  1B8I A;  1T2K A;  3WU1 B;  4A0X A;  3PM1 A;  3ULQ B;  3ABU A;  1T6S A;  3E5X A;  5GPA A;  4IOA F;  1R1T A;  2ZKZ A;  2O5R A;  2HVS A;  2EA2 A;  2L4M A;  3MAJ A;  2AQE A;  4A6E A;  4PSX A;  1BA5 A;  1R5G A;  2DQL A;  5CKT A;  1HDD C;  3LFU A;  4GFB A;  1WJE A;  1KON A;  5FRM A;  1R36 A;  2OA4 A;  3K1P A;  3BZ6 A;  3BR6 A;  3LSI A;  4IHX A;  4OIO F;  2DFH A;  1W0U A;  3SJM A;  1VFC A;  4XKB A;  2QM3 A;  2XB0 X;  3FK7 A;  1W5S A;  2Z9O A;  3KZI C;  5EEA A;  2LD5 A;  2WB1 A;  3JRD A;  2LKX A;  4YEJ A;  4U7B A;  2WAD A;  2PMH A;  5E1W A;  5M5X J;  1MMA A;  4BBS J;  1WGX A;  2Y0S A;  5EEH A;  3ZN0 A;  2LY1 A;  1W7P A;  4PSW A;  5LBQ A;  4RLQ A;  3VPR A;  5IT9 K;  4IZZ A;  2LTP A;  1WJC A;  4PJN A;  3L2W A;  2GZW A;  4N9H A;  2M7B A;  3DLA A;  4KIT B;  3BOQ A;  2R7R A;  1HSJ A;  2O61 A;  3ONQ A;  4BDY A;  2QBY A;  4PDK A;  1OCZ H;  4P55 A;  3IAS 2;  1FMV A;  1D1B A;  4RGR A;  3JRH A;  3FBI B;  5GTI C;  4HX8 A;  3VWB A;  4A69 C;  3ZRG A;  2G7H A;  5LRR A;  4L0Z B;  5CQG A;  4I0A A;  3HOY J;  3DEW A;  1B4A A;  3GLL A;  3ZMV A;  5M3M J;  2HWV A;  2BXY A;  5JHU A;  3VEP A;  4CGZ A;  1U5T B;  3D5S C;  5TIS C;  5D5W B;  2MC3 A;  2K5C A;  2K3P A;  2XKO A;  4HSR A;  3F8F A;  2PX9 A;  2EV5 A;  3S3N A;  3OYD A;  2RNG A;  3NQO A;  4S0H B;  4IHW A;  5K7H A;  3ZQQ A;  2ICW G;  2ZJQ F;  3H9G A;  2VJ5 A;  2COM A;  3WE2 A;  2V79 A;  1A35 A;  4FET A;  1ETQ A;  3BPV A;  4Q47 A;  3RYP A;  2K9Q A;  3H92 A;  3HJE A;  3CC2 I;  4A3L J;  5FGM A;  3KYC B;  5F6F A;  1LVA A;  1U6G A;  3WOD F;  2M7A A;  2UUZ A;  3G71 I;  2R7U A;  3H36 A;  2OPT A;  3BPX A;  2LBF B;  2ECB A;  4QPQ A;  2O03 A;  1PP8 F;  2JN6 A;  2B63 J;  3SQN A;  2GM4 A;  3Q9S A;  2DYS H;  2IBD A;  4G8X A;  2NNN A;  3CCU I;  2EFN A;  3F6V A;  4LK1 F;  2KT0 A;  1U5T A;  2A3S A;  3GVA A;  1B6A A;  5DM7 F;  3J80 K;  4V19 K;  4Q48 A;  1YRN B;  1DUX C;  5FFX A;  1FJL A;  1SC7 A;  2E71 A;  4CIC A;  2VE9 A;  4LMY A;  3MKZ A;  1R22 A;  3ZQF A;  3VSL A;  1T08 B;  4LIT A;  3BWG A;  3CUO A;  3RTR A;  3DWL E;  2JUC A;  4I02 A;  1YW8 A;  1PUE E;  1ZTR A;  4XK4 A;  2LMD A;  1ZRD A;  4G6D A;  5EG0 B;  3FXR A;  2ID6 A;  4A5N A;  4BEH B;  4FX0 A;  3HBL A;  2HQ5 A;  3H3Z A;  3NRV A;  4ASN A;  3ECO A;  4EJV A;  5H2F C;  3BC8 A;  5J3L A;  3RKY A;  3K2Z A;  5C4X J;  4ZC3 A;  1Z6R A;  4LB6 B;  3WU0 A;  3S3O A;  2DA2 A;  1R1U A;  3DTE A;  3QP5 A;  4Z2Y A;  1HF0 A;  4IOC F;  3AFH A;  3BJO A;  2MLK A;  1HC8 A;  3FDY A;  1BC7 C;  2VJJ A;  5H6Q A;  2DU9 A;  4RGS A;  3I0T A;  4I09 A;  2Q2E A;  3ZP5 A;  4CZZ A;  4GGG A;  3CTA A;  2L54 A;  3HXL A;  4LFU A;  2EFQ A;  3LNQ A;  3OYL A;  2BY2 A;  5BPI A;  5D5U B;  1DU0 A;  1X19 A;  5L3C A;  4P5O A;  4OMZ A;  2A69 F;  3C18 A;  1ON1 A;  3K4C A;  5E17 F;  1WPK A;  2OZ6 A;  2H6C A;  2KL4 A;  2P7V B;  4ITV A;  1FTT A;  4CCK A;  2KIM A;  3OIQ A;  2DA1 A;  3MMY B;  3V8J A;  4CSW A;  3CME I;  1S29 A;  4WXH A;  1IRZ A;  1Z05 A;  4A3B J;  4HYE A;  3TO6 A;  5FD6 A;  2HTS A;  1B59 A;  2CW0 F;  2QF7 A;  2VC0 A;  2FF4 A;  5D6F A;  4RGU A;  2OC6 A;  3FIS A;  5ILU A;  4FHT A;  5FKK A;  2CRG A;  3D1N I;  1KQ9 A;  5TJJ A;  3ZXS A;  4E7Z A;  3B6C A;  2FD5 A;  1TQP A;  2EH3 A;  1I39 A;  2R7Z J;  5E18 F;  1I3A A;  4XRS G;  2F5E A;  1ZGJ A;  1JJ6 C;  4HST A;  3RYR A;  1MNE A;  3L09 A;  3T5X A;  4DNC A;  1OR7 A;  3V4G A;  2IGM A;  2FQ3 A;  5F0C A;  4ZJZ A;  2QSF X;  5FLX Z;  4BE0 A;  1YOV B;  2DW4 A;  2YSR A;  3LQR A;  4KT6 A;  3S1R J;  4BY1 J;  2L2O A;  3EPZ A;  1P7J A;  2VXD A;  4MTD A;  1W36 D;  3R60 A;  1YHQ I;  4QTR A;  2YX4 A;  4BHB A;  3HUG B;  5JLW A;  2R7O A;  3JSO A;  3GFL A;  3RQ4 A;  5C3E J;  1W7P D;  3G73 A;  4I6Z A;  1RET A;  4HDU A;  2L7Z A;  2KRH A;  3GTG J;  4LLN A;  3A02 A;  4MFE A;  2E60 A;  3FXQ A;  4O5V A;  2XF5 A;  4KUM A;  1H8A C;  4RM3 A;  3PFI A;  1J59 A;  5BNG A;  1N25 A;  1VQN I;  1SVO A;  1U2W A;  3PNT A;  1TLH B;  4KIC A;  4YRV A;  3PUF A;  1EF4 A;  3KCC A;  2K7L A;  4WF2 A;  3VFZ A;  3J81 K;  2CH0 A;  2Y69 H;  3E7L A;  4XOR A;  2ESH A;  2MG4 A;  4A6D A;  1A31 A;  1MJA A;  3LSM A;  1HOM A;  2FBK A;  3JTG A;  2E2H J;  2FX0 A;  2KMU A;  5KNL A;  2HXI A;  1MBJ A;  2EZK A;  1UCR A;  5L3E A;  1NK3 P;  1A5J A;  3EUH A;  5F1R A;  2VBX A;  3KPH A;  2X1E A;  4DZJ A;  3RI4 A;  2AXL A;  4JQF A;  2W1O A;  2EIL H;  4PGH A;  3CCJ I;  2ZXJ A;  3IWF A;  2F6C A;  2JK3 A;  1LFB A;  1V5E A;  3FKJ A;  1YQA A;  4PUS A;  3I55 I;  1OYI A;  4BXX J;  2RRE A;  4G94 A;  3BY6 A;  1X2N A;  3H5R A;  3K4N A;  2F5C A;  2LSO A;  4RA2 A;  1H9G A;  2QQA A;  1AKH B;  1ZYR F;  5LGN A;  5D8K B;  4RB3 C;  2DOE A;  3OYG A;  1K83 J;  3QRF F;  4KIS A;  2VPR A;  4JOM A;  4PK4 A;  2W48 A;  1JE8 A;  2PLY A;  3GBG A;  2Z16 A;  2VQC A;  3REO A;  5D4R A;  1JT0 A;  2O7O A;  4A5M A;  3CCM I;  2V9K A;  3KET A;  1QBJ A;  3PNY A;  4BE2 A;  3E6C C;  1DDN A;  3LWF A;  3K10 A;  3M1C A;  3VB2 A;  5F64 A;  2V26 A;  2CSO A;  4IHS A;  1ODD A;  1ZLJ A;  2L9N A;  3CJR B;  1QHG A;  3C3W A;  4EJU A;  4XLH A;  1T0F C;  3R0J A;  3WGG A;  4L9V A;  4HNV A;  3A0H C;  2DMN A;  4PCQ A;  4FTH A;  3CF2 A;  2GWR A;  4LK0 F;  1IV8 A;  2A6E F;  4LLG F;  3RSN A;  3TDU C;  1ITY A;  4CDG A;  1FBQ A;  3HHG A;  3L7W A;  2BY0 A;  3HIF A;  3GTP J;  2Y0M A;  2HGC A;  1TC3 C;  2YS9 A;  3HPG A;  2DXI A;  4E4H A;  3PQJ A;  4UY8 I;  4GDF A;  2QEX I;  3IWZ A;  2J5O A;  2B0L A;  3S32 A;  2ZJ2 A;  1G3W A;  2L02 A;  2XSJ C;  1I6X A;  3EDP A;  2ADU A;  1TWA J;  2CQN A;  2VI6 A;  2X51 A;  1XDU A;  3BTL A;  3IP4 B;  1MJ9 A;  3UR3 C;  4I01 A;  1QQI A;  4HV6 A;  3FXO A;  3F8N A;  1ZKG A;  2VOD A;  2K85 A;  2PJR A;  1PVE A;  5EGO B;  5IP9 J;  3CLQ A;  3IHU A;  5C44 J;  2R7F A;  3HL2 A;  3K1M A;  1XN7 A;  2EFO A;  2VLA A;  2JA7 J;  2KJB A;  2H8W A;  4ESB A;  5FRN A;  1ENH A;  1JXS A;  5DCF A;  1IC8 A;  2NVT J;  1YG2 A;  1AOY A;  4IRH A;  1A36 A;  3TOB A;  4BXU A;  3IUO A;  4IEJ A;  1RR7 A;  4WCG A;  4WWC A;  4ENM A;  2JQ7 A;  2CQQ A;  4UNO A;  1PDN C;  4BDZ A;  2E19 A;  2Y48 A;  3M4O J;  1TTY A;  2RN7 A;  2L5Q A;  5IYB J;  3JCU C;  3C7J A;  3S1N J;  3SYT A;  1XPX A;  5FO5 A;  1IN7 A;  3DEU A;  2ZJR F;  2RDP A;  1RUN A;  1R7J A;  2XGC A;  3U21 A;  1WJF A;  2VT3 A;  1R58 A;  2QWW A;  3V7S A;  5L3G A;  4RAG A;  2IP2 A;  1RES A;  1WHU A;  5EGO A;  4GXO A;  2HPI A;  4UB6 C;  3W3C A;  3PSI A;  1WI9 A;  1JUS A;  3GUD A;  2K9S A;  2HDW A;  5HLI A;  4CXF A;  2R7V A;  4D5F A;  1ACI A;  3IAM 2;  1WRJ A;  4KN4 X;  3ABL H;  2CUF A;  1NTC A;  4ZDL A;  3LAJ A;  4HRI A;  2MD5 A;  3IH2 A;  1OPC A;  4UV8 A;  2P5V A;  3HGY A;  2XSD C;  1UB9 A;  2Z1D A;  3BR1 A;  2PQ8 A;  1ZH5 A;  1X1D A;  2CMP A;  2HYJ A;  4M73 A;  4HNT A;  1GXP A;  3QPT A;  3OR2 C;  2M4K A;  2YU9 J;  4LB5 A;  3JRE A;  2ME0 A;  2GAU A;  2VKD A;  3NEU A;  2I10 A;  1UHW A;  2OQR A;  3OIP A;  2N8G A;  1DPR A;  2E5N A;  2JMW A;  4HF1 A;  5DTD A;  1P4W A;  1Y8R B;  5FFZ A;  1DP7 P;  1OMI A;  3I59 A;  4KNY A;  2Z5U A;  5DYM A;  3ZQI A;  5LHG A;  1ZRE A;  4BXF A;  5ED4 A;  2XPU A;  1LVK A;  4U7D A;  1ZGA A;  1BC8 C;  1IN8 A;  4II3 A;  2QZ8 A;  3CCE I;  3TP3 A;  5KCM A;  1IAW A;  3Q0U A;  4D0P A;  4I2O A;  3K0L A;  3DBL B;  5DD4 A;  3QAH A;  4HZF A;  1HST A;  3CD6 I;  3MD2 A;  4L5E A;  3TO9 A;  5GPC A;  5LFA A;  5FLM J;  1G3T A;  2JJ7 A;  3DQV C;  2E2I J;  4CZC A;  2EBI A;  1TL8 A;  5JHF A;  2IXS A;  1E3H A;  3D5L A;  3ZQL A;  3H3U A;  2GA2 A;  4FQG A;  4B4C A;  1ZRF A;  5TGT A;  1UJ8 A;  1ZHF A;  2ACJ A;  2CW7 A;  1U9N A;  1PUF A;  3VYS B;  6PAX A;  2IEK A;  5GAE J;  3K4K A;  2WAE A;  1XTA A;  5K5O A;  5EF6 A;  2W00 A;  3HM5 A;  1XSX A;  3A01 B;  1KQ0 A;  2R7X A;  2H09 A;  2VKE A;  2OZU A;  1UFM A;  1VQP I;  2LLK A;  2O9L A;  1QNT A;  2RQP A;  3VYT B;  2V9V A;  4LG3 A;  1WCM J;  1JHF A;  4XRM A;  1LEA A;  1FIA A;  3H5A A;  2VOP A;  3HSF A;  3DXJ F;  4MGR A;  4ESF A;  5BQT A;  5M3F J;  2P8T A;  2ZJP F;  1V54 H;  1G2H A;  1WVR A;  3F72 A;  4I0B A;  1H89 C;  3FK6 A;  3QYF A;  2EFW A;  2DPD A;  2KP6 A;  2FEZ A;  3FMR A;  2ELJ A;  2HDC A;  2DJN A;  5CJ9 A;  4C3H J;  1B72 B;  3KX2 A;  5DUI A;  2LY2 A;  1P6R A;  2BGC A;  2ZCW A;  2RNJ A;  2L0K A;  2M3A A;  5B66 C;  1TWH J;  1TWF J;  4G12 A;  3M9A A;  5JLX A;  1OIS A;  4QIW N;  1D0X A;  2LVS A;  3SEQ A;  4S05 A;  2HKO A;  2A5Y B;  2EB7 A;  3P9K A;  2DK8 A;  3KEQ A;  2TRT A;  4JP0 A;  1SMT A;  1TW3 A;  2LKP A;  1ZRC A;  1ETO A;  2CGP A;  1B9M A;  4UV9 A;  5D5V B;  3JAM Z;  3U2R A;  2D45 A;  3CC7 I;  3TO7 A;  4AC0 A;  1JGS A;  3C2G A;  4PJJ A;  3ZOB A;  3BG7 A;  3K70 C;  3EYI A;  1MMD A;  5EDN A;  2JA5 J;  3GXO A;  3UKG A;  3DBR B;  3Q0V A;  2DA3 A;  2PBI A;  3A0B C;  1YFH A;  1R5I D;  2JT1 A;  4HW0 A;  1OLT A;  4DOZ A;  1X3Z B;  2IW5 A;  2VQH A;  3FXJ A;  4KJZ A;  1D1A A;  3PO2 J;  2IVM A;  1QO0 D;  1B8I B;  1OQY A;  4EQQ A;  2B9S A;  1Y0U A;  2M8E A;  3RCO A;  4C30 A;  2QSG X;  1MSF C;  1ERD A;  2OTL I;  5L3D A;  1GLN A;  3HOX J;  2RVC A;  3DLL F;  1JJ8 C;  2PEX A;  2ISZ A;  4YEL A;  3A03 A;  5DCM A;  2JUG A;  5EZG A;  4B8X A;  5J1U A;  3IRR A;  4FAS D;  5E20 A;  1SVM A;  5DS9 A;  1U3E M;  2R92 J;  2HQN A;  3OS1 A;  2GQQ A;  5CVR A;  5GAG J;  1ZR4 A;  4UHT A;  2F48 A;  4KIB A;  4CCL A;  3C2B A;  3CLO A;  3LMM A;  3QPL A;  2HEO A;  1LNW A;  2K86 A;  1SMY F;  4F55 A;  3S14 J;  2RKH A;  4RBO A;  2XC7 A;  2Y9Z A;  2E34 A;  2KKO A;  3MN2 A;  4D1Q A;  1RIO H;  5FLV A;  2JSP A;  2VC1 A;  4BAC A;  5CLS A;  3TBI A;  2BYV E;  2BY3 A;  2R7Q A;  3CCY A;  1FOK A;  1MSE C;  2CG4 A;  2RV8 A;  3FHN A;  3S2W A;  1FP2 A;  1FX7 A;  1LDJ A;  3IC7 A;  5H6R A;  3G6E I;  1A04 A;  2VJI A;  4M9X A;  2QBY B;  3WTU C;  4UVC A;  1N78 A;  3EUK L;  3D5R C;  2VJ4 A;  1O4X A;  1AA7 A;  2RQQ A;  2MAB A;  1FY7 A;  5JFR A;  4KA4 A;  3K6G A;  1HDP A;  1D5Y A;  3I9V 2;  4FE4 A;  3WTY C;  2LF8 A;  2HTJ A;  1IRX A;  4ENK A;  1MBF A;  4ZH4 F;  1BIB A;  4U0Y A;  1AWC A;  3H9Q A;  5AIQ A;  1WFX A;  1BIA A;  4L18 B;  5HOD A;  3QOP A;  3W2A A;  3FMS A;  3Q0W A;  4A0Z A;  1FWZ A;  2VON A;  3HOW J;  1Y1V J;  1T0F A;  2R5Z B;  1HW2 A;  4WX9 A;  3I56 I;  1G59 A;  4U87 A;  2MW8 A;  2K9N A;  4HAM A;  3O2P E;  2A6T A;  3K4L A;  5DUK A;  4W1U A;  1RR8 C;  3LA2 A;  1LDK B;  4LOC A;  2IS1 A;  2HQR A;  4KMF A;  4BJ5 C;  4LD5 A;  2EZI A;  1K6Y A;  2LY9 A;  4B48 A;  3L2C A;  3KYD B;  1Z3X A;  2I5U A;  3PL8 A;  3WG9 A;  3ZMZ A;  4GYI A;  2CU7 A;  3J7Y J;  1Y0N A;  1BR1 A;  3FM5 A;  3ESW B;  4KT5 C;  4A3F J;  1T95 A;  4F7Z A;  1Z3Y A;  1TW2 A;  2JPB A;  4LGW A;  4HV5 A;  2ME6 A;  3L1P A;  1LFU P;  1FNN A;  4ETS A;  2W57 A;  4GO1 A;  2EK5 A;  3OYI A;  3HPH A;  3QPH A;  1D3Y A;  1QVU A;  2QCO A;  3ZMT A;  4A3J J;  2MH2 A;  1DPU A;  4M9Z A;  4UUS B;  1JT6 A;  5FKO A;  4N9I A;  5BPD A;  2JRM A;  2R5Z A;  3R0A A;  4U88 A;  3C2H A;  1GVJ A;  2VPL A;  5J6X A;  5A2Q Z;  2DOD A;  3M07 A;  1W0T A;  1ZEL A;  5J47 A;  2G0E A;  1R6R A;  2XAQ A;  4ZTF A;  3FKI J;  1JKQ C;  2ESN A;  2LNB A;  4HNU A;  5DM6 F;  4DGW B;  2QKM B;  2VBW A;  5ICC A;  2VB6 A;  5F0H A;  4LLL A;  1Y8Q B;  3G3Z A;  1ZG1 A;  5HNH A;  2XRN A;  4BS9 A;  3JW4 A;  4CCJ A;  4IHV A;  3WHB A;  1MH4 A;  3F8C A;  3S8P A;  3E6D A;  4M3E A;  4MHG A;  1KYZ A;  2BHY A;  2X48 A;  4ENN A;  2NS8 A;  1X1C A;  2JRT A;  2Q2E B;  2NRA C;  4AU7 A;  2GIV A;  4QPO A;  2H1L A;  2E35 A;  4AD9 A;  4O6J A;  3CP8 A;  4ZDO A;  2M0C A;  3OSF A;  4UUS A;  3CZ6 A;  2QLZ A;  5KHD A;  2VKH A;  2V6C A;  2ELK A;  3ASO H;  4XOT A;  1KZH A;  3BG9 A;  3KYL A;  5J4V A;  3G4S I;  3OY9 A;  3I53 A;  2V4J C;  1LQ1 A;  3AG1 H;  2ZME C;  5CQE A;  2CJJ A;  1FYL A;  3OYF A;  3ZQG A;  4P9F A;  5LHI A;  4F92 B;  2L7M P;  4D5C A;  2X1D A;  5FRO A;  1TZL A;  1E17 A;  1P7I A;  1RUO A;  1QPM A;  2IGK A;  5FKL A;  2FUG 2;  3KP5 A;  3F22 A;  4A2U A;  2CQX A;  1IUY A;  4EJO A;  2F4M B;  3CCL I;  2QA4 I;  2X6X A;  4NHJ A;  1UHM A;  2JZY A;  1WJA A;  3H5N A;  4U0W A;  5HDG A;  2A5W A;  1OKR A;  5K7Z A;  4B47 A;  4DW6 A;  4GCV A;  4B1R A;  4NDL A;  2CS3 A;  1VQM I;  2M2E A;  3BTI A;  4ON0 A;  1UST A;  2E36 A;  2KDO A;  1Z77 A;  3E1S A;  3U9G A;  3VYU B;  3DV8 A;  3OYC A;  1HQC A;  2BEO A;  2Z2S B;  1MH3 A;  3KEY A;  3OR1 C;  4XRF A;  3RDI A;  3SZG A;  4PJ0 C;  2Y2Z A;  4CCN A;  5IPA A;  1S6L A;  2DYR H;  3JRC A;  4J19 A;  3ZCO A;  3MFK A;  1D5V A;  2HOA A;  3RKX A;  5CVI A;  2V9P A;  2L7K A;  3GCM A;  1ULY A;  1OCC H;  4UVB A;  3OIO A;  4JX6 A;  3R6S A;  2WWY A;  5GAH J;  1QVT A;  1R23 A;  3QOE A;  1IV6 A;  3PUB A;  1ONV A;  1Z7U A;  3OL3 A;  2MLG A;  3H35 A;  1Y6I A;  2K40 A;  2EIM H;  1VI0 A;  1QZE A;  4ESJ A;  3CUQ B;  2LK2 A;  2ZSH B;  2UZK A;  2HOT A;  4Y15 A;  3KFW X;  2Z3Y A;  1SAU A;  2M4G A;  4S04 A;  4XKW A;  3M8J A;  5HDK A;  1WJD A;  3GZ6 A;  1P2F A;  3FXM A;  1ETX A;  1WWX A;  4C9Y A;  4MIM A;  3F9K A;  3WGI A;  2XAJ A;  3VSK A;  2QUF A;  4B3X A;  2HXO A;  3OYH A;  3CO7 C;  3GF2 A;  2R7W A;  3HOS A;  3T1B A;  2ZNZ A;  3AL0 B;  1DQU A;  3QWL A;  2K9M A;  4EM1 A;  4R1H A;  2VOO A;  3V7C A;  4MEX F;  1Z67 A;  1YJW I;  5J1Y A;  3J81 Z;  2R7D A;  1NG6 A;  4AIK A;  5CVV A;  5ICF A;  4N4O B;  3F8B A;  1MKM A;  2M45 A;  4ABZ A;  3BCB A;  3LSK A;  2LFB A;  3CUQ A;  5F27 A;  5ILV A;  1ZK8 A;  1CF7 A;  3LSG A;  4HEA 2;  3E97 A;  4AYB N;  1UZC A;  2B7E A;  1LJ9 A;  2KIS A;  2X6W A;  2L4A A;  4DYQ A;  3DF8 A;  1EJ9 A;  3GWZ A;  1E0E A;  3MZH A;  5LHH A;  3RZO J;  4IF4 A;  5FB2 A;  2NVY J;  3CCV I;  1EKE A;  2XHK A;  3V8K A;  1XMA A;  5E8G A;  3WTS C;  1SAX A;  2ISY A;  1S72 I;  1Q1V A;  1WQ2 A;  1X1B A;  2EQR A;  1JGG A;  3EUA A;  5K7F A;  3DKX A;  4QLC U;  3EET A;  4BYY A;  2PJP A;  4C2T A;  1XGS A;  2E1C A;  3W2V A;  3VYR B;  4G7Z F;  4IHT A;  5E8I A;  2HR3 A;  4UB8 C;  2KIQ A;  4Y13 A;  2XKP A;  1IUF A;  2JTV A;  3HEF A;  3GO5 A;  4YIR X;  4X0G A;  2RGV A;  3AKZ A;  3CMA I;  1FOY A;  1TP4 A;  2MH9 A;  1YLF A;  4YFX F;  4C3J J;  2QVO A;  3DP7 A;  4XNF A;  5LRS A;  2E1O A;  4XN0 A;  1IN5 A;  2OV7 A;  1ZAR A;  2ZFU A;  3MKW B;  3BTC A;  3HOZ J;  2Y9Y A;  3BG3 A;  1NH3 A;  3BR5 A;  2K9L A;  4V2G A;  4M3G A;  1JKP C;  4M9S A;  5HNF A;  1J2X A;  3K4M A;  2CQ7 A;  2ZXI A;  3Q3S A;  3D0S A;  2AS5 F;  2XB5 A;  4MNU A;  1BI1 A;  5DEQ A;  2CWE A;  2D5V A;  2BXZ A;  3I71 A;  1T56 A;  2DA5 A;  3OOU A;  1PJR A;  2NXN B;  4RB0 A;  4XLE A;  4EMS A;  3PJR A;  3AG2 H;  5GAD J;  1YIT I;  4WK8 F;  4NC7 A;  2PJR B;  1RNL A;  2W82 A;  3KIO A;  4Y33 A;  5FKN A;  1E3O C;  1UHS A;  4II2 A;  3PFY A;  1JI8 A;  3S2D J;  1IO2 A;  1M1E B;  2KZG A;  2R7T A;  1EH6 A;  4EGZ A;  2ZXH A;  3ZQ7 A;  1LE8 B;  1JHH A;  1D1C A;  4CCO A;  1FZP B;  3CDH A;  5AON A;  1QA6 A;  2K27 A;  4XID A;  3DTK A;  1MNM C;  2DA6 A;  1RZ4 A;  4BNC A;  3S16 J;  2O8K A;  3B6A A;  4F93 B;  3PO3 J;  3ZN1 A;  1G8X A;  1O3Q A;  2X9D A;  2Y31 A;  2K3F A;  9ANT A;  1F43 A;  4A3D J;  2P5K A;  1HXD A;  1LDD A;  2EIN H;  2HS5 A;  2Q1Z B;  2CFX A;  1FEX A;  2X6Y A;  4YG2 F;  4OIR F;  4MTE A;  3I4N J;  1I1S A;  3CF5 F;  3BR0 A;  5AIP A;  3JRG A;  4XSZ F;  2HDD A;  3MWM A;  2Z99 A;  5TRD A;  4HF0 A;  3WHC A;  1HKS A;  1MW7 A;  1UMQ A;  1Y1W J;  4FCY A;  1ON2 A;  1B1B A;  4P9U A;  4KYW A;  1WZ2 A;  3G2B A;  3DKY A;  4IXA A;  3OYN A;  1T98 A;  1LE8 A;  2IA0 A;  4OIP F;  1EH7 A;  2QSH X;  2LP0 A;  4HX4 A;  3N05 A;  4NUB A;  1GUU A;  2EFP A;  1REP C;  5CVU A;  3LSJ A;  3O8G A;  2TCT A;  3MEX A;  1MIJ A;  5KAI C;  3CCQ I;  3A1Y A;  3E3V A;  1VQK I;  1IZ1 A;  4PFP A;  1I50 J;  5B3S H;  2UXX A;  1Q1H A;  1IN4 A;  1RKW A;  1VQL I;  1WKM A;  3QQA A;  2AHQ A;  4C3I J;  4XLP F;  3BR3 A;  2WTE A;  1HKQ A;  3GEZ A;  4FX4 A;  2IAI A;  4UXN A;  1WH5 A;  5M5Y J;  4AVZ A;  2ZBK A;  1O3S A;  4IO9 F;  1WSU A;  1TBX A;  4ENJ A;  2WV1 A;  4L9N A;  4BUP A;  4RB1 A;  1BI0 A;  1J9I A;  3I59 B;  4ZTJ A;  2OU2 A;  3KLN A;  5L3F A;  2DI3 A;  1R9T J;  2DTR A;  3LFK A;  5HLG A;  2D1H A;  1P9Q C;  2XDV A;  2ZME B;  1H9T A;  5F08 A;  4Q4Z F;  5IY5 H;  3IKV A;  2LOO A;  3IKT A;  4G7O F;  2VAS A;  3HTU A;  2ZO4 A;  2LC2 A;  5K5Q A;  1U8R A;  5JVT A;  5BS6 A;  4EJW A;  1JTY A;  1X3U A;  3KP7 A;  3B02 A;  5E1Z B;  1S8N A;  3U1K A;  1YS6 A;  2OD5 A;  1RI7 A;  5D5X B;  3MKY B;  2F4O B;  2A05 A;  2W25 A;  2K4B A;  1F4K A;  3I3L A;  4ZYD A;  3O3K A;  2FA5 A;  1JKO C;  3GTM J;  4XMY A;  2EV6 A;  3KLO A;  3DPU A;  4P1W A;  2CW8 A;  2NOG A;  5LGT A;  1PUF B;  2FSW A;  3ZMU A;  3GFM A;  1KA8 A;  1USS A;  1G6N A;  1OCO H;  4PJL A;  5B1A H;  4F91 B;  3WTX C;  5M5W J;  4DJA A;  5KK1 A;  4XLC A;  4E7I A;  2KDZ A;  3JRI A;  3RKQ A;  2WY8 Q;  3BZC A;  5E3O A;  1H0M A;  2GXA A;  2OTJ I;  1BOB A;  1POG A;  2ZME A;  2OF7 A;  2DBB A;  4OWR B;  4Z6Y A;  5IOZ A;  3WTV C;  4KFC A;  3N4M A;  2BVM A;  3AG4 H;  3QOD A;  3K70 D;  4B3A A;  2DFE A;  2DA4 A;  1K4T A;  5K1Y A;  4IRI A;  1I5Z A;  2OCC H;  2P6T A;  3LA7 A;  1EH8 A;  1TNS A;  4EM0 B;  1SFE A;  2E5Z A;  4A3C J;  1KYW A;  5CYV A;  1K6O A;  2MYS A;  4A93 J;  2L3D A;  3M8E A;  1S3J A;  4M6X A;  4XKC A;  2XGX A;  1BM9 A;  1U9O A;  2Q0O A;  3H3V K;  1U8B A;  2WA0 A;  1XMX A;  2FNA A;  4E7H A;  1I27 A;  2GXB A;  3BJA A;  4L5J A;  3W2W A;  1BOA A;  2DDB A;  3HDD A;  5CVJ A;  1G4D A;  2P7C B;  1ZQ3 P;  3F3X A;  2ZSI B;  2DMU A;  1K61 A;  1FYM A;  1YIO A;  1XCV A;  1VQ9 I;  1YTY A;  3I4P A;  1MBE A;  1QRY A;  4OIQ F;  1V55 H;  3JSP A;  2H94 A;  2PMZ N;  5EJC A;  3OL4 A;  2VQG A;  2J5P A;  2VE8 A;  4B43 A;  2GA1 A;  3HKZ N;  4OOI A;  3LQQ A;  4C2M J;  4WXD A;  2XF6 A;  2BW3 A;  3R4K A;  4JX5 A;  5ICG A;  2TDX A;  4BQQ A;  3GFI A;  3FXU A;  1X1P A;  5HS7 A;  2STT A;  1QU3 A;  2LRD A;  1XG1 A;  1YO5 C;  2DK5 A;  3L2V A;  2PFB A;  2JA2 A;  2A07 F;  2PN6 A;  2YR2 A;  1T38 A;  3GLX A;  4RAZ A;  4FT8 A;  3UNG C;  3S3M A;  2LH9 A;  1VQ8 I;  2EZL A;  4AYB A;  2P6S A;  2XAG A;  3TDZ C;  3V8L A;  1APL C;  1FOW A;  4BY7 J;  4DZP A;  2WAF A;  1SD5 A;  3ISP A;  4CYC B;  3M3Y J;  5DCM B;  3LSP A;  1YX3 A;  3OYB A;  2CYY A;  1GVD A;  1Z91 A;  2RAE A;  1YW9 A;  3HSE A;  4DIQ A;  3KP6 A;  2W24 A;  3P9I A;  1FTZ A;  2A61 A;  4XSX F;  3I58 A;  4H4K C;  3F8M A;  3OS0 A;  2BBY A;  2JVG A;  2NAZ A;  5E3L A;  2A6H F;  2G9W A;  1RKT A;  3E5U A;  4XRS A;  1J5Y A;  2OJE D;  2UWM A;  1P92 A;  1Z1D A;  4EGY A;  4BJ6 C;  2L9R A;  2XVC A;  5FKM A;  3ZR8 X;  2IRF G;  3ZQC A;  2FU4 A;  3K69 A;  4MFD A;  2LG4 A;  3CDL A;  2DOF A;  2IGN A;  2ZNY A;  2F4I A;  2W4S A;  2AXT C;  5C4J J;  2XGE A;  3DFG A;  4XKV A;  4G6T B;  5HDN A;  1GV5 A;  4YII A;  4XR6 A;  4RM2 A;  2COB A;  1XD7 A;  5IT3 A;  1T8I A;  4CYC A;  4RB2 C;  3BG5 A;  2P0W A;  2JSC A;  3GZ5 A;  3FZV A;  3MKL A;  3HZJ A;  2DJI A;  3M1E A;  1STZ A;  1S7O A;  4PZJ A;  2MD0 A;  2HFH A;  4GYG A;  1XGM A;  1SAN A;  4NC8 A;  4O3M A;  3EUH C;  1JUP A;  1ZAO A;  2MSY A;  1MDM A;  1OCT C;  2W84 A;  1BJA A;  2XV4 S;  1SD6 A;  1SVL A;  1U0J A;  5LGU A;  2V1U A;  4M3D A;  2WC2 A;  1JUM A;  3K9T A;  4NQW A;  4A3K J;  5BOX A;  3VOE A;  4IQJ A;  5IT9 Z;  3FM3 A;  2NVX J;  1IDZ A;  4XLA A;  1K79 A;  2ELH A;  2ZXW H;  4LG0 A;  2M1B A;  4IHY A;  4CA0 A;  4RLF A;  3LST A;  4OAZ A;  1ETK A;  4A3I J;  3JRA A;  3EQL F;  2VT2 A;  4U0V A;  1QGP A;  4P96 A;  3WTZ A;  2ETH A;  3AAF A;  2ZC2 A;  3OOP A;  3PQK A;  2CUJ A;  2KLO A;  2BVL A;  2JA6 J;  1W4M A;  5B5E C;  2LYC A;  1CGP A;  1X2M A;  3I4M J;  1YJ9 I;  2XAH A;  1UG0 A;  2HKX A;  4R8H A;  1ORK A;  4UVA A;  3OYE A;  3MZY A;  1T33 A;  3HSR A;  4HOB A;  4M72 A;  2R0Q C;  1YIJ I;  3M8F A;  1Z6T A;  1IXC A;  4MEY F;  1HW1 A;  2DMT A;  2R93 J;  2M9H A;  2STW A;  4BAY A;  3DTI A;  2JVH A;  4YFK F;  3F21 A;  4DYR A;  4E7J A;  2HVR A;  1K7A A;  2BE5 F;  2W85 A;  3TW6 A;  1LEB A;  1D8K A;  3WTW C;  3BDD A;  1XDS A;  1R1V A;  2FRH A;  2DT6 A;  2XGD A;  3K7A J;  3HGG A;  1MGT A;  3JRF A;  1SD4 A;  1UEL B;  2ECC A;  3I5U A;  3W6K B;  2YU3 A;  5DDG A;  2DT5 A;  3J7A O;  3L2R A;  1V5F A;  3PIP F;  1BJZ A;  1NG7 A;  1MJB A;  2IS6 A;  4AWX B;  3J80 Z;  1HKT A;  3ELK A;  4HLX A;  4H0E A;  3JR9 A;  3FMQ A;  1V3F A;  3NWT A;  5E1X A;  1YW7 A;  4K2E A;  1WH7 A;  5E3N A;  5IP6 A;  4M6Y A;  3SZP A;  2Z33 A;  1P4X A;  1MMG A;  1FLI A;  1EV7 A;  3S93 A;  3V42 A;  3M7G A;  2AQF A;  1N75 A;  4HBL A;  5EEG A;  2NYX A;  3H1C A;  4LIV A;  1FPQ A;  2E1N A;  2GXG A;  4A12 A;  3FX3 A;  2BY1 A;  2X1C A;  3IH4 A;  4YIF A;  2VKV A;  3RPU A;  3CC4 I;  1SFO J;  4OU0 A;  2VBY A;  1ZG3 A;  3GZN B;  2V6E A;  1BBY A;  1IRF A;  3BT9 A;  2W7N A;  3S2H J;  4CYD A;  1TWC J;  1Z21 A;  1IJW C;  1RPW A;  3TW7 A;  3TKY A;  1MBK A;  4MLO A;  1R00 A;  3IL2 A;  1IXS B;  2PMU A;  1X4P A;  4DYC A;  3LSR A;  5H20 A;  2HU9 A;  4BQN A;  3Q5F A; 
#chains in the Genus database with same CATH homology
 2IGO A;  3FBN B;  4ZDL A;  4XLF A;  4HRI A;  3HG9 A;  1MMN A;  3SEZ A;  4BE1 A;  2CV1 A;  4HG2 A;  3AKZ A;  4X0G A;  2Z1D A;  3CJQ B;  1X1D A;  2CMP A;  4HNT A;  3OR2 C;  2M4K A;  4XNF A;  4XN0 A;  2VKD A;  4BQO A;  2NOJ B;  2OV7 A;  3H0D A;  2ZFU A;  1Y56 A;  1BR2 A;  3OIP A;  4XOP A;  5HLT A;  2CFO A;  2E5N A;  3MKW B;  5LD2 C;  3A2K A;  2K9L A;  5CPR B;  1N77 A;  4B44 A;  2GOX B;  5HNF A;  4DBQ A;  2L9S A;  4XL9 A;  3K4J A;  3K4M A;  2ZXI A;  1LKX A;  2LBF A;  4BXF A;  4R79 A;  4LIU A;  1LVK A;  2DOA A;  3OOU A;  4II3 A;  1PJR A;  4XLE A;  3PJR A;  2HNH A;  5KCM A;  2CV2 A;  2UV1 A;  4NC7 A;  2PJR B;  3CP2 A;  2W82 A;  4OAY A;  4Y33 A;  4II2 A;  3PFY A;  1JI8 A;  2O5R A;  2HVS A;  3OWT A;  3MD2 A;  2R7T A;  2AQE A;  5LFA A;  2PMZ A;  4PSX A;  2ZXH A;  4D9J A;  1D1C A;  2KZV A;  5CKT A;  4CCO A;  3DQV C;  3HKZ A;  3LFU A;  4CZC A;  1WJE A;  1KON A;  5JHF A;  5FRM A;  2IXS A;  3D5L A;  3DTK A;  1VZ0 A;  2VIX A;  3LSI A;  5TGT A;  1Z7L A;  2CW7 A;  4IQ4 A;  4XKB A;  4F93 B;  3VYS B;  1G8X A;  2WB1 A;  4YEJ A;  4ANJ A;  2WAD A;  3K4K A;  4U7B A;  2WAE A;  1MMA A;  2Y0S A;  2W00 A;  3LSH A;  1FMW A;  2LY1 A;  4PSW A;  4BEH A;  2KPM A;  4GRI A;  2Q1Z B;  4RLQ A;  3ZGK A;  4IZZ A;  2X6Y A;  2R7X A;  1WJC A;  4PJN A;  3L2W A;  1D0Y A;  2M7B A;  3DLA A;  3VYT B;  4LG3 A;  4KIT B;  2R7R A;  3CMM A;  1SFK A;  3ONQ A;  4N4N B;  3H5A A;  4XM3 A;  4BDY A;  1MW7 A;  3QYE A;  3IAS 2;  1FMV A;  1D1B A;  3G2B A;  2E1M C;  3FBI B;  3DKY A;  3QYF A;  2KP6 A;  2OUM A;  3OYN A;  2HQA A;  3ZRG A;  3VWB A;  4IKF A;  2ELJ A;  2X85 A;  2WY7 Q;  5CQG A;  2XAU A;  3KX2 A;  3N05 A;  1D0Z A;  2LY2 A;  4NUB A;  2M3A A;  4J01 A;  4XQF A;  3A1Y A;  3D5S C;  2K5C A;  2K3P A;  4HSR A;  4PFP A;  1D0X A;  3SEQ A;  3S3N A;  3OYD A;  2RNG A;  3ZQQ A;  4DBR A;  3OYM A;  3H9G A;  2VJ5 A;  4FET A;  4AVZ A;  4C2U A;  3C2G A;  4PJJ A;  3BG7 A;  3K70 C;  1MMD A;  1WJB A;  4BUP A;  1X1A A;  4ZTJ A;  1X4O A;  1OLT A;  2M7A A;  2UUZ A;  4DOZ A;  2XDV A;  1P9Q C;  2R7U A;  2LBF B;  2VQH A;  4KJZ A;  1D1A A;  2LOO A;  4CCM A;  3TMO A;  4QPQ A;  2VAS A;  3L2U A;  1ERD A;  3RCO A;  4C30 A;  4E7K A;  2LC2 A;  1GLN A;  1YX5 A;  4YEL A;  3MKY B;  2JUG A;  3HOT A;  3I3L A;  4FAS D;  4XMY A;  3DPU A;  4P1W A;  2CW8 A;  3MKZ A;  3OS1 A;  3VSL A;  4LIT A;  3RTR A;  4CCL A;  3DWL E;  4F91 B;  4PJL A;  3LMM A;  4DJA A;  4F55 A;  2XC7 A;  4XLC A;  4D1Q A;  4E7I A;  1EA3 A;  2JSP A;  4BEH B;  2WY8 Q;  4BAC A;  3TBI A;  3RPU D;  1BOB A;  2R7Q A;  4OWR B;  3BC8 A;  3FHN A;  4ZC3 A;  4F3Q A;  2BVM A;  3S3O A;  3QOD A;  3DTE A;  4Y4R A;  3K70 D;  2VJI A;  4XON A;  3AFH A;  1DP3 A;  3FDY A;  2VJJ A;  3EUK L;  1N78 A;  3VDX A;  3D5R C;  2VJ4 A;  4F52 A;  2E5Z A;  1AA7 A;  2RQQ A;  3DEE A;  1W36 C;  2MAB A;  2MYS A;  3HXL A;  2KRC A;  3OYL A;  4XKC A;  1X19 A;  3K6G A;  4P5O A;  3I9V 2;  3K4C A;  4Y3O A;  2KL4 A;  4RMN A;  1IRX A;  4ITV A;  2WA0 A;  4CCK A;  4E7H A;  3OIQ A;  3MMY B;  4CSW A;  4CH7 A;  4IX7 A;  3H9Q A;  3K4B A;  1WFX A;  3W2W A;  3W2A A;  2ZSI B;  5HOO A;  4ZDP A;  2CV0 A;  2OC6 A;  1G59 A;  1TT0 A;  4U87 A;  4E6K G;  3OL4 A;  3ZXS A;  2VQG A;  2V1N A;  1UAA A;  4B43 A;  2A6T A;  3K4L A;  1BR4 A;  4E7Z A;  2XF6 A;  4BJT A;  3L2Q A;  1LDK B;  2IS1 A;  2BW3 A;  2GOM A;  2VQL A;  4BJ5 C;  3OYJ A;  4BQQ A;  1V5G A;  3PNV A;  1K6Y A;  1QU3 A;  2LRD A;  3L2V A;  4HST A;  2JA2 A;  1MNE A;  4B48 A;  4E7L A;  2IS2 A;  1Z3X A;  3PL8 A;  3UNG C;  3S3M A;  2IGM A;  2LH9 A;  4ZJZ A;  1BR1 A;  4AYB A;  2HPM A;  4BE0 A;  1T95 A;  2WAF A;  1Z3Y A;  4KT6 A;  2L2O A;  1MND A;  3EPZ A;  1YX3 A;  3OYB A;  2VXD A;  2MFZ A;  1W36 D;  3OYI A;  3HPH A;  4DIQ A;  3DU6 A;  2M0M A;  2IS4 A;  3HUG B;  2VXZ A;  2R7O A;  4H4K C;  3OS0 A;  2JVG A;  3C2H A;  2VPL A;  3CES A;  3RQ4 A;  1DGR M;  1ZEL A;  3OYA A;  2DCE A;  1R6R A;  2UWM A;  4ZTF A;  2KRH A;  2HVQ A;  4BJ6 C;  3ZR8 X;  4HNU A;  2E60 A;  2QKM B;  4DGW B;  3PSF A;  4CUG A;  2LG4 A;  2VB6 A;  2IGN A;  2F4I A;  2XF5 A;  5HNH A;  4BS9 A;  2W4S A;  4CCJ A;  2CUZ A;  4RM3 A;  4XKV A;  4G6T B;  3S8P A;  2KHM A;  4XR6 A;  4RM2 A;  4BL0 B;  3PNT A;  4YRV A;  1X1C A;  2Q2E B;  3OMY A;  4AU7 A;  4QPO A;  3DU5 A;  2P0W A;  2CH0 A;  4XOR A;  3CP8 A;  4ZDO A;  3LSM A;  2DJI A;  3CZ6 A;  5KHD A;  2VKH A;  2HZD A;  2KMU A;  1DGW Y;  2MD0 A;  5KNL A;  4XOT A;  4NC8 A;  3EUH C;  3KYL A;  3J7A Y;  3OY9 A;  3DPT A;  2V4J C;  2X1E A;  4JQF A;  2W1O A;  1U0J A;  5CQE A;  3OYF A;  2F6C A;  1V5E A;  3FKJ A;  2I8D A;  4PUS A;  3TL4 X;  4F92 B;  2X1D A;  2F5V A;  4J00 A;  4IQJ A;  5FRO A;  1TZL A;  4BGD A;  2RRE A;  3H5R A;  3K4N A;  2IGK A;  2FUG 2;  4XLA A;  2X6X A;  2BW3 B;  3H5N A;  1WJA A;  4XN3 A;  4PFO A;  2A5W A;  4CA0 A;  4RLF A;  3NWS A;  4B47 A;  1LFP A;  3OYG A;  3BLY A;  4KIS A;  4JOM A;  4OAZ A;  4PK4 A;  2CS3 A;  3GBG A;  2Z16 A;  2VQC A;  2KDO A;  3E1S A;  2CUJ A;  2KLO A;  2BVL A;  2V9K A;  3VYU B;  3PNY A;  4BE2 A;  3OYC A;  2Z2S B;  3KEY A;  3OR1 C;  3K10 A;  2LYC A;  3M1C A;  3SZG A;  3LL7 A;  2V26 A;  1UG0 A;  4CCN A;  2L9N A;  3CJR B;  1QHG A;  2XF7 A;  3OS2 A;  4XLH A;  3ZCO A;  1T0F C;  3OYE A;  2E1M B;  4E7S A;  2L7K A;  2DT7 B;  2WBM A;  3CF2 A;  3OYK A;  3RSN A;  3QOE A;  3PUB A;  3DPL C;  3OL3 A;  3H35 A;  1Y6I A;  3DTI A;  4ZYA A;  3QYB A;  2JVH A;  1HA8 A;  3HPG A;  2ZSH B;  2DXI A;  4E4H A;  1WJ5 A;  3E0J B;  4E7J A;  2HVR A;  3S32 A;  1SAU A;  2XSJ C;  2M4G A;  1YE9 A;  1OR7 C;  4XKW A;  3H9J A;  2QKL B;  3M8J A;  2KQR A;  1WJD A;  2DT6 A;  2X51 A;  3IP4 B;  4C9Y A;  3UR3 C;  4BU2 A;  1UEL B;  3F9K A;  2V7F A;  3VSK A;  2PJR A;  3L2R A;  1V5F A;  4B3X A;  3OYH A;  2R7W A;  3HOS A;  1NG7 A;  3AL0 B;  1DQU A;  2IS6 A;  2K9M A;  3HL2 A;  2VLA A;  5FRN A;  4EAT A;  2MC4 A;  2WAQ A;  1NG6 A;  1S9H A;  3NWT A;  4N4O B;  3BCA A;  1QHH D;  5HVQ C;  3IUO A;  1MMG A;  2VL8 A;  3BCB A;  3LSK A;  3S93 A;  3V42 A;  1PYV A;  2AQF A;  1N75 A;  3LSG A;  4HEA 2;  4BDZ A;  4PJM A;  4HPQ A;  4LIV A;  4NQW B;  2X6W A;  2R4G A;  4NNJ A;  2X1C A;  1E0E A;  2L5Q A;  2LRE A;  2R7S A;  3SYT A;  3BG6 A;  2V6E A;  3U21 A;  1WJF A;  2W7N A;  3A4C A;  1X1B A;  1Z21 A;  3AL0 C;  3EUA A;  2HPI A;  4MLO A;  3DKX A;  1J09 A;  3SDB A;  3W3C A;  3PSI A;  1X4P A;  2R7V A;  2HDW A;  4C2T A;  2HU9 A;  3IAM 2;  4BQN A;  2BOL A;  3HC7 A;  3W2V A;  3VYR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...