1SD7A

Crystal structure of a semet derivative of meci at 2.65 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methicillin resistance regulatory protein mecI
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd7A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd7A02
2FE3A 5BS6A 5H6RA 4HAMA 1SD4A 4ZZLA 1P92A 1ON2A 3BZ6A 1DP7P 3WGIA 4ZYGA 5KK1A 3WTUC 1R7JA 3GFMA 1Y0UA 2JT1A 1MKMA 2IRFG 2EFOA 2G7UA 1P4WA 2QBYB 4KNYA 1SD5A 3P9KA 4PDKA 2CWEA 1OYIA 2P8TA 3ABTA 2PMHA 5K1YA 3L09A 4EJUA 3WTWC 5HVQC 2L3DA 3F8CA 1BI1A 1U78A 2A69F 1O3RA 1IRGA 2JTVA 3R0JA 3WODF 2KIFA 4A5MA 3EDPA 3Q9SA 1I1GA 1WKMA 1HW1A 1SMYF 2EB7A 4I02A 3HRUA 2ZNZA 3KLNA 2EWNA 4EGYA 4QWQA 2DW4A 1QGPA 3WU0A 2QQAA 2ZNYA 2EFPA 3TO6A 4MEYF 3F8BA 1GHCA 3TKYA 1XSVA 2MH9A 3EUHA 1I27A 3U1DA 2LKPA 5CLSA 4Q48A 3K2ZA 5HS9A 3GXOA 2HKXA 3Q5FA 4O6JA 1GVJA 5DCMA 1G3YA 1R22A 4MNUA 2ETHA 3TO9A 5D4RA 2MC3A 5IT9K 2JPBA 2M45A 3E6BA 2L4MA 2HS5A 3SFZA 1XGOA 1C0WA 3CDHA 3M7GA 2V9VA 2FQ3A 4UNOA 3JSPA 1XMAA 3E97A 4KIFA 3I58A 1Z91A 2KJCA 1T6SA 5HOOA 3F22A 3I53A 2V79A 2XAQA 1U2WA 4HX8A 3L7WA 5CVJA 4BXUA 3IRRA 4XLPF 1EH7A 1KU9A 1B6AA 3MCZA 3COAC 1HQCA 1K78A 3BPVA 4P96A 1SD7A 2ELHA 3W6KB 3IKTA 1R1TA 3SXYA 2K02A 3DEUA 1MJBA 1ZLKA 3G73A 1TNSA 2XAHA 1JHFA 5HS7A 1J59A 4D0PA 2E1CA 4IXAA 1D8JA 2DFIA 3FMQA 2M8EA 3VODA 2H6CA 2FMLA 4HLXA 3HTSB 2O0YA 3ELKA 1YS6A 3U2RA 3QP6A 3QU3A 1XN7A 1K79A 2A5YB 1J0RA 5F1RA 2EA4A 2FMYA 3C18A 1D5VA 3HOTA 2HGCA 1IXRC 3RI4A 3G3ZA 3JSOA 2MH2A 3BPXA 3LA7A 4ZH4F 1T39A 5FB2A 1USTA 4OMYA 2A6HF 3KP2A 2KIUA 4I7HA 3DV8A 1ONVA 4IJAA 4LMYA 3HYIA 3BJ6A 4JK1X 3CUQB 2CSOA 4BQAA 3KP7A 3H92A 5DV5A 3MEXA 3N97A 1ZAOA 2PG4A 2RVCA 2ZO4A 4PGHA 2QQ9A 4GYIA 4WXHA 4AIKA 3GVAA 3OOPA 3EYYA 4HZFA 4EJTA 1LEBA 4AD9A 2Y0MA 5CVUA 2HR3A 4EGZA 2L02A 1EH6A 4OMZA 1R36A 2XGXA 4A5NA 2HDCA 3HSFA 4WX9A 4EJWA 5ICCA 1L3LA 2NAZA 2VT3A 5D8LB 5FLXZ 3K1MA 1F5TA 4HYEA 2QLZA 4AWXB 3EETA 4CZZA 2K27A 3I4PA 2XKOA 4HBLA 4BNCA 1TW2A 3BY6A 2VONA 3HSEA 4YIFA 3TDZC 5EEHA 4L9NA 3T0YA 1TW3A 2V6CA 4ESJA 3BJOA 2EK5A 2E7XA 1A04A 3N4MA 2FSWA 2VC0A 3GFLA 2FBKA 2O03A 4RB1A 2UWMA 4N9HA 2J5PA 2H27A 2A3SA 3KP4A 3LQQA 2LSOA 2XROA 4EQQA 1XSXA 3GZ6A 5JFRA 2VOPA 1F9NA 4LJZF 1S8NA 1HXDA 2EFQA 3WU1B 1SFUA 1B59A 1FP1D 5LRSA 1LNWA 3ECOA 1RZ4A 3Q9VA 2FXAA 3NEUA 3SZPA 3EQLF 1TBXA 4B09A 1Q1HA 5ED4A 2MLGA 4EM1A 1W7PB 1FY7A 2RN7A 1R23A 4WXDA 4A6EA 2CG4A 3LSTA 3WE2A 2RGVA 3VB2A 2NS0A 4YFNF 2ZBKA 5A2QK 5DYMA 2E7WA 2YX7A 3QRFF 4YFKF 3GO5A 5KVRA 2F5EA 3DP7A 2BEOA 4KN7X 2RQPA 4OIOF 5HDNA 2X4HA 5L3DA 1HSTA 3KLOA 3LA2A 2P5KA 4AVPA 2FBIA 1DPRA 1G3WA 2MBFA 1L0OC 2BYVE 3ZMSA 1GXPA 4R1HA 1G3TA 1IN7A 1HKSA 1HSJA 4CHUA 1YS7A 3C7JA 2FOKA 3L00A 1CF7A 1I5ZA 6PAXA 4M9ZA 2PMUA 4CO8A 5LEKA 4P9FA 2EA2A 2ZJ2A 2ACJA 3GWZA 1MZBA 4LLNA 1H9TA 4OIPF 4RGRA 4Y15A 1O7LA 2JRTA 5BQTA 1FP2A 1R5HA 1O7FA 2ISYA 1IN6A 2PN6A 3HOSA 3BDDA 1T0FA 3J81Z 4S05A 1S29A 2K4BA 1ZGAA 5L3BA 1ON1A 1ZLJA 3F6VA 5AONA 1DUXC 3O3KA 4XLNF 3WGHA 3VFZA 1O3QA 2PBIA 3GZ5A 2OA4A 3IL2A 4LK1F 5J8FA 1ZARA 2QM3A 4MQVA 3ZP5A 1YG2A 4G94A 3V8LA 3AAFA 1LQ1A 1BI3A 2HTSA 4MEXF 2OU2A 4F7ZA 2JSCA 5ICFA 1P6RA 4A0YA 2H09A 1MJ9A 5D5XB 1S3JA 4ETSA 2VE8A 2QENA 3KP6A 3W6JB 3I64A 1R5GA 4AIJA 3DFGA 2DAOA 3JTGA 2WC2A 2Z9OA 4FX0A 2ZMEB 3KP3A 1BIAA 1LB2A 4O5VA 3K1NA 4PCQA 1EV7A 5L3EA 4I0AA 1YO5C 1MJAA 2A07F 4N9IA 5CVVA 3KCCA 2VBWA 3FM3A 2FRHA 4EJOA 3FHZA 2IA0A 4P55A 2IA2A 4KA4A 5E1XA 1FX7A 2OQRA 2OZ6A 2K4JA 1T2KA 1LDDA 1J9IA 4KIGA 1FBQA 5H20A 2EV5A 2DT5A 4Y13A 1ODDA 3H3ZA 2D1VA 4Q5SF 3E6DA 3HUGA 1W5TA 3M9AA 4CICA 5TJJA 3V7SA 3LAPA 4G9YA 2VT2A 4FX4A 3ZQ7A 2H94A 3ULQB 3WTYC 5DUKA 3HHHA 3BOQA 1ZHFA 2XAFA 4KT5C 3E6MA 3HRSA 2VBYA 3FF5A 4ESFA 4HLYA 2GAUA 2EV0A 1RUOA 2Z3YA 4LK0F 3ECHA 4HV6A 3ABUA 3P7NA 5EEGA 4XSXF 5JI6A 3K1PA 5ILVA 2O6GE 1TTYA 2GWRA 4RGXA 2W24A 4M72A 1U6GA 5LHIA 1D3YA 3PQKA 2DPUA 3KFWX 4CDGA 1FSEA 3S2WA 1KU2A 2ZKZA 3V7RA 4XRFA 4M6XA 1BIBA 5ILSA 1U5TC 2VN2A 5HLIA 3D5LA 3R4KA 3RJPA 3F8NA 4Q47A 3MQ0A 1U3EM 1BBYA 1P4XA 5E1ZB 2ESNA 4ON0A 1XDUA 4HQEA 4WF2A 5ERIA 2QZ8A 4HA8A 1SFEA 5DCMB 3ML6A 3RTRA 4KN4X 2XAJA 2P6TA 4TV7A 3GW2A 5LGTA 5F64A 2EV6A 1G4DA 5FFXA 2PI0A 2FEZA 4BHBA 4L9VA 2V1DA 3B02A 3SZTA 2PFBA 2J5OA 1RNLA 2VBXA 1R58A 2DO7A 5D5WB 2F2EA 3BWGA 4WXCA 4GO1A 1JXSA 5L3CA 1QZYA 3FWEA 4MTEA 1TQPA 1OKRA 1R1VA 3F21A 5K5RA 3MZYA 4RGSA 1PDNC 4GXOA 3CO7C 2ISZA 4U7BA 4RB2C 5E18F 2O61A 5D5VB 4MHGA 4L5IA 2DK5A 5JHUA 4H0EA 1HW2A 1BN5A 4NHJA 2BE5F 2QWWA 3JAMK 4RS8A 2L01A 4U88A 2MLKA 1U5TA 1KQ0A 3CUQA 4U7DA 4RGUA 4UUVA 3I71A 4L18B 3DPLC 2DBBA 3PFIA 3TOAA 2GQQA 2K86A 1BC7C 4HF1A 2RNJA 2NYXA 2CQKA 3VOEA 1FYMA 1FYLA 3J80Z 3LA3A 3FM5A 2YU3A 3KEQA 5LBQA 1T98A 1STZA 3L2CA 2HYGD 2UXXA 1XMKA 4IVNA 1XCBA 3M8FA 4HDVA 1QBJA 1XGSA 4IF4A 3ISPA 1P4AA 3TOBA 2DQRA 4G7ZF 1ZRDA 3JTHA 5K5QA 1LVAA 2Z99A 1FOKA 3K69A 5LRRA 1KA8A 5E17F 3RKYA 3TDUC 2Q8KA 2FF4A 4CYDA 1ZG3A 1ZN2A 4S04A 3NQOA 3HRTA 1QZZA 1UHWA 2NRAC 4LGWA 3CUOA 1OR7A 3HSRA 4ZYHA 4JQFA 3BJAA 3VEPA 5D5UB 1IAWA 1BI0A 3KETA 5E1WA 4OIQF 4PZJA 3ROUA 3HRMA 3I54A 2IW5A 2V1XA 1HW5A 1Z6TA 2WWYA 3ZMTA 2Z5UA 1PP8F 1MDMA 4IRHA 2XIGA 1UHMA 5E20A 1YW7A 5D4SA 1W7PA 2X0LA 1EH8A 3K9TA 1KU7A 2Y48A 1YW8A 3ZN1A 4G7HF 4M73A 3I5UA 3SHFA 4IHTA 2Y75A 4M9XA 1O3TA 1SAXA 4A6DA 4MGRA 1KYWA 2STWA 5BMZA 2P7CB 1XGNA 3RKWA 3IHUA 4KICA 2PQ8A 4CGZA 3L9FA 3KEOA 2DI3A 5DEQA 3WTSC 5F6FA 2R3SA 3LFKA 2XVCA 4A0XA 2BGCA 4U0VA 1ZRFA 1Z1DA 2KRFA 3WGGA 4CXFA 1FLIA 3FXRA 4LG0A 1KU3A 3TO7A 2WV0A 4UVBA 5IT9Z 2RDPA 3QOPA 2P5LC 1BC8C 3RKXA 3ZMVA 2DU9A 1FBUA 2JPCA 4JBAA 4Z2YA 5HLHA 2ADUA 4LB5A 2F5CA 2XHKA 2KIMA 5CJ9A 1MD0A 1I1SA 2GXBA 2KKOA 4G6DA 1FYKA 5LLQA 3IKVA 2A6EF 2XKPA 2P5VA 2O3FA 5DCFA 4I2OA 1W7PD 1F1ZA 2YX4A 1TLHB 3WTXC 1YFHA 2RKHA 5ILUA 4WWCA 1UB9A 3E3VA 1OYYA 3LWFA 3QPHA 4GYGA 3FMRA 3I59B 1LEAA 3V8KA 4FT8A 2HKOA 1BI2A 2TDXA 3C1DA 4ENNA 4A2UA 2IT0A 2A61A 2OBPA 2QUFA 3KZYA 1KGSA 5K5OA 2D1HA 4KYWA 1J2XA 1XD7A 5CYVA 1DDNA 3D0SA 3IWFA 3M8EA 5DUIA 2LF7A 3DF8A 1RIOH 1TQMA 3F8MA 1FT9A 4UVCA 4LB6B 2YPRA 2DK8A 2DLLA 3R61A 1OMIA 2HYFA 2GXGA 4ZYDA 3T5XA 2EJRA 1OYWA 4E70A 5L3FA 3GLXA 3TQNA 4M9SA 1IZ1A 1UFMA 4L0YB 5DD8A 1JE8A 1BM9A 2ZMEA 5FD6A 1IN5A 3EYIA 4EM2A 2LDUA 5E8GA 4RAYA 4L9TA 4WCGA 4RAZA 2L54A 1IUYA 1E2XA 2D45A 2GZWA 1B9NA 5FLXK 1ZG5A 2W85A 3FX3A 5LHGA 1LJ9A 2FBHA 3P9CA 3PQJA 4Q4ZF 4BH9A 4ZYEA 4XBFA 4N0BA 2O8XA 3QAHA 4RB0A 3R6SA 1Z7UA 2DQLA 2W57A 3ZMZA 1ZGJA 2QBYA 3CTAA 3FMSA 1JGSA 3O2PE 2GIVA 4U0WA 5J6XA 2VOOA 1B4AA 3REOA 3P9IA 1IN4A 4DQ2A 2HOEA 2XAGA 2KJBA 1WRJA 3ZN0A 2CW0F 4IPAA 4NQWA 3NRVA 1X3UA 1SD6A 4YIIA 3WTZA 3I0TA 3F72A 3RPQA 4R79A 2RC4A 3HHGA 3T8RA 3F23A 5J8CA 1AOYA 1PP7U 1W4MA 2VXZA 4ENJA 1R00A 2GA2A 2MA3A 1IW7F 4GCVA 2AS5F 4HDUA 3E6CC 4EM0B 3ZPLA 5D6EA 4OU0A 4BYYA 1QQIA 3CLOA 1O57A 1W5SA 2UXNA 2F5FA 2HEOA 1QO0D 1ZG1A 2P4WA 4HX7A 3J7AO 4EV0A 2IA1A 1WSUA 1E17A 4UVAA 1O3SA 3K0LA 4A12A 1PUEE 2L4AA 2HTJA 2ESHA 3CUQC 5H6QA 2QYOA 1KQ9A 4YFXF 3RYRA 5D8KB 2IVMA 5DD4A 4KDPA 4DNCA 2G7HA 5A2QZ 5ICEA 4ZZDA 2M30A 4R8HA 4UXNA 2C6YA 3GFJA 5CVIA 1S6LA 5AIQA 1B9MA 4UV8A 2M5WA 2HQRA 2COMA 3GUDA 3KP5A 4KUMA 4EVIA 5HDGA 2JZYA 1G6NA 4IRGA 3GF2A 3T8TA 3BROA 1J5YA 4MQ9F 5LHHA 3TGNA 2STTA 1TQIA 2CGPA 1SFXA 1VTNC 1K78B 2Q2EA 2DTRA 4FHTA 5FD5A 1G3SA 1Z6RA 3CO6C 1NHAA 2XV4S 3R60A 3J81K 1D8KA 2HZTA 4QLCU 4HF2A 2PEXA 4ESBA 2P7VB 2GA1A 2MD5A 1XSDA 3U9GA 3QPTA 2V1UA 1HKTA 2ZCWA 3WTTC 5LGUA 3GFIA 2YSRA 5IT3A 3FZVA 1I6XA 3DQVC 3RYPA 5FFZA 5BPIA 1H9GA 5ICGA 4ASNA 4OOIA 4L5JA 1S7OA 2IJLA 2M1BA 1IRFA 4KMFA 2Q0OA 2BV6A 1HBXG 2ZFWA 1IXSB 1U5TB 4NB5A 2R7DA 1AWCA 1Z9CA 3V7CA 3IC7A 4UHTA 3DKWA 5CVRA 3MZHA 4IRIA 2VE9A 1Z05A 4I01A 1UCRA 4EJVA 2XRNA 3FXQA 2OQGA 5BOXA 2D2WA 2Z33A 1LDKB 3E5QA 1KQ8A 1FPQA 4M74A 2CFXA 4Y17A 2QQBA 5FO5A 1IXCA 1WQ2A 1IF1A 5BPDA 4XSZF 1WI9A 4I98B 2EFNA 1ULYA 2K7LA 3R0AA 2FNPA 3MWMA 1F4KA 2FNAA 4L0ZB 2B0LA 2M87A 2HQNA 2UZKA 2VODA 3GYHX 2NNNA 2PLYA 2EFWA 1IN8A 1YYVA 2A68F 1TNTA 4KMUX 3RPUA 2DPDA 2RV8A 4O3MA 1V4RA 2OZUA 2NNYA 1BOAA 1RI7A 3HIFA 4L9JA 1YIOA 2OD5A 3F3XA 3LQRA 4YG2F 4UV9A 3RDIA 1J75A 4BHPA 3MAJA 5HLGA 1HKQA 1QNTA 2XUBA 1LDJA 1YQAA 1DPUA 4EMSA 4G6QA 1ZH5A 5HDKA 4M71A 1MDMB 2PJPA 1SMTA 3QU6A 4I0BA 3JW4A 4G7OF 3C3WA 4K2EA 2XASA 3MFKA 4I09A 4LD5A 3IWZA 2YR2A 4M6YA 4LFUA 3O6BB 5DDGA 3E5UA 3V8JA 1K6OA 3IRQA 1P2FA 1K7AA 1V3FA 2F5DA 1YW9A 3T1BA 4B8XA 3RIRA 2CO5A 4ENKA 4A0ZA 1H0MA 2W25A 4OIRF 1ZYRF 1FSHA 3QP5A 4HF0A 3V4GA 1J7KA 3E5XA 1FWZA 2W84A 3B73A 1FC3A 2LF8A 3WE3A 2R7FA 2FU4A 4ENMA 3H3UA 4HQMA 1ZREA 4LG0B 2VBZA 4RB3C 1FZPB 1S7AA 1QPMA 1T38A 4KIBA 4PGGA 5JVTA 1FBSA 2QVOA 1XDSA 2IP2A 2WTEA 2AXLA 5JR3A 4GGGA 1XCVA 3FXUA 5HS8A 4HW0A 3F6OA 1CF7B 1GXQA 3I59A 4HX4A 2BBYA 3WG9A 4HV5A 1R1UA 1REPC 1RUNA 2IPQX 3ZMDA 5L3GA 3WTVC 2H6BA 5TRDA 3DPTA 5FGMA 3LAJA 4KFCA 1MGTA 4G8XA 5LGNA 4AIHA 3KE2A 1WWXA 2E1NA 4IHSA 2G9WA 3ZMUA 1KYZA 4U0YA 3DXJF 3ERED 3GEZA 3CJNA 1XGMA 3OV8A 4P9UA 1CGPA 2VC1A 5LEJA 2LNBA 3HTUA 4P5OA 4MTDA 2HWVA 1YLFA 3JAMZ 5AIPA 2ZXJA 5D6FA 2CYYA 3J80K 1XB4A 1B1BA 4OINF 4HOBA 1U8RA 1JHHA 1USSA 3KZZA 4BHCA 5E8IA 2HFHA 2P6SA 3BP8A 3GX4X 1BJAA 4WK8F 1OPCA 2FA5A 4LLLA 4BAYA 1FNNA 3F8FA 1YTYA 2OAZA 1ZRCA 3M1EA 4LLGF 3SQNA
chains in the Genus database with same CATH superfamily
2FE3A 4BKXA 2CRGA 5BS6A 1D1AA 2DOAA 1P7IA 5H6RA 4HAMA 1SD4A 4ZZLA 4XK4A 5B1BH 4C2UA 4FTHA 1ETYA 5EDNA 1MSEC 1P92A 3AL0C 4C3HJ 2A6TA 1ON2A 1YJWI 2FQ4A 3BZ6A 1DP7P 2VQLA 4CCMA 3FBNB 2PMZN 1WI3A 3P5JA 5GP9A 4S0HB 3WGIA 2X48A 3LSJA 4ZYGA 4AM3A 5KK1A 3GTJJ 3WTUC 2HOTA 1R7JA 3GFMA 2RQQA 1Y0UA 2XGCA 2JT1A 1D0YA 1MKMA 2IRFG 2EFOA 3QQAA 2JWTA 1QZEA 3OYMA 2Y69H 2G7UA 1P4WA 2QBYB 4KNYA 1SD5A 3FHNA 3P9KA 4IQ4A 4PDKA 2CWEA 1OYIA 4XKBA 2P8TA 3ABTA 2OF7A 1R5ID 2PMHA 2FUG2 3L09A 5K1YA 4A3GJ 2VPLA 1JT0A 4EJUA 3WTWC 5HVQC 5EEAA 2EZKA 2L3DA 3F8CA 1BI1A 3HUGB 1IV8A 2OTLI 1U78A 2A69F 1OFCX 2MSYA 5K7FA 1O3RA 4BU2A 1IRGA 2JTVA 3R0JA 3WODF 3JRDA 3BG3A 2KIFA 4A5MA 3ZQFA 3EDPA 4NQWB 3A01B 3Q9SA 1P7JA 1I1GA 3I4NJ 2ZXHA 4CSWA 1WKMA 1HW1A 1AHDP 1SMYF 2EB7A 1FMWA 4I02A 3TL4X 3HRUA 1ZGWA 5J3LA 2V9KA 2HQ5A 2ZNZA 2Y0SA 1MMNA 2LY2A 3WHBA 3KLNA 2EWNA 3MVPA 4EGYA 4C2MJ 3PO2J 1FTZA 3OS0A 2Y2ZA 4QWQA 3BCBA 2DA5A 2DW4A 5FKNA 1JJ8C 4XRSA 1QGPA 5EG0A 3WU0A 1QVUA 2YU9J 3HXLA 2QQAA 2ZNYA 4D9JA 2EFPA 3TO6A 2VJJA 2QSHX 3D5RC 4RDUA 4MEYF 2W7NA 1DQUA 1UG0A 3F8BA 5J1UA 1GHCA 3TKYA 1XSVA 2NVUB 3S2DJ 2MH9A 2E1MC 3EUHA 3H36A 1I27A 3U1DA 2EIJH 2CMPA 2LKPA 3PUBA 5CLSA 2DA6A 4Q48A 3K2ZA 5HS9A 4JX4A 3GXOA 1S7EA 3GTOJ 2HKXA 3G71I 3Q5FA 2EIKH 3I56I 4O6JA 2GOXB 1GVJA 2I8DA 1LFUP 5DCMA 1G3YA 1R22A 4MNUA 2R7VA 2ETHA 5H2FC 3TO9A 5D4RA 2MC3A 2A5WA 5IT9K 2JPBA 2M45A 4FETA 1R4MB 4FQGA 5IYBJ 3NWTA 3E6BA 3A02A 4A93J 2BVMA 2L4MA 2HS5A 2WB1A 3SFZA 1XGOA 3FXJA 2X6WA 1N77A 4E7ZA 1IC8A 4UB6C 1MMAA 1C0WA 5LD2C 3CDHA 3M7GA 1YRNB 1E3OC 2KZVA 2V9VA 2FQ3A 1B72B 4UNOA 3S17J 2X9DA 2PJRB 3JSPA 1XMAA 3E97A 4A3KJ 3KX2A 2HVRA 4KIFA 2K5CA 3I58A 1BR4A 1TL8A 2F4OB 2BY0A 1Z91A 2KJCA 4RA2A 1BW5A 3HOXJ 1T6SA 2JJ7A 5HOOA 3F22A 1MMGA 2HOAA 2JVGA 2V79A 1U2WA 2XAQA 3I53A 4HX8A 3L7WA 4X0GA 1BW6A 1Q1VA 1V54H 3M3YJ 5CVJA 4BJ6C 4BXUA 3IRRA 1JUSA 2R93J 2CH0A 4XLPF 3WU2C 1EH7A 1QPIA 1KU9A 1B6AA 3MCZA 4NC6A 3COAC 2Q1ZB 1HQCA 1K78A 3BPVA 4NUBA 4P96A 3CCJI 4XONA 1SD7A 2ELHA 1PUFB 1DGWY 3W6KB 4GFBA 3IKTA 1R1TA 3SXYA 2K02A 1IRXA 3DEUA 2CQNA 3EUAA 3U21A 5JLWA 1YI2I 1MJBA 1ZLKA 1JKPC 3G73A 1TNSA 3OYEA 2VL8A 2XAHA 3KEYA 1MNDA 3S8PA 1JHFA 2M0CA 5HS7A 1J59A 2NVTJ 4D0PA 2E1CA 4IXAA 1D8JA 5FKKA 2DFIA 5GAGJ 3FMQA 1WH7A 5J1YA 2M8EA 2L9RA 2XGDA 3VODA 2H6CA 3DTIA 3H5AA 5C44J 2FMLA 4HLXA 2Q2EB 2BOLA 3HTSB 5M5XJ 2O0YA 4BQNA 2Y31A 3ELKA 1YS6A 3MKLA 1Y6IA 3U2RA 3QP6A 3CCUI 2AHQA 3QU3A 1XN7A 4CZCA 1K79A 2A5YB 1J0RA 3QYEA 3TW6A 3DBLB 5F1RA 2F5VA 5J4YA 4BBSJ 2EA4A 2FMYA 3C18A 1D5VA 3HOTA 2YS9A 4A3LJ 3OIPA 2HGCA 3A2KA 2AO9A 2M2EA 2KRHA 1IXRC 1VQNI 3RI4A 3S3MA 4XOTA 3G3ZA 3RKQA 3G1MA 5TISC 3JSOA 2MH2A 3BPXA 4B3XA 3LA7A 1XC5A 2DMNA 1HCRA 4ZH4F 3ONQA 2I5UA 1T39A 5FB2A 1USTA 4IHWA 4OMYA 2XPVA 3S2HJ 1E0EA 3K10A 2A6HF 3KP2A 2DFHA 2KIUA 3FISA 4I7HA 3DV8A 1HLVA 1LFBA 1ONVA 1G8XA 4IJAA 4LMYA 2LYCA 3HYIA 9ANTA 2X6OA 3RZOJ 4PJ0C 3BJ6A 4JK1X 4AUXA 1TP4A 3CUQB 2CSOA 4BQAA 1I3AA 3KP7A 1W36C 1XS9A 3H92A 5DV5A 3DBRB 3MEXA 1EJ9A 3N97A 3CCQI 4N4NB 1ZAOA 4E6KG 2R7XA 2PG4A 2RVCA 4C3JJ 1I3QJ 2G0EA 1VF9A 2ZO4A 1OJLA 3PIOF 4PGHA 3CLQA 2QQ9A 3AFHA 4GYIA 4WXHA 4AIKA 3GVAA 3OOPA 3EYYA 4HZFA 4BUPA 4EJTA 1LEBA 4AD9A 3Q0WA 2Y0MA 5M5YJ 4BE1A 3HB9A 5CVUA 2AQFA 2HR3A 4EGZA 2CUJA 1M1EB 4N4OB 2VI6A 2DFEA 4D7MA 2L02A 1EH6A 4OMZA 1R36A 2XGXA 3G1OA 4A5NA 3MN2A 2R0QC 2HDCA 3HSFA 4PJMA 2VPRA 5B1AH 3SEZA 4WX9A 4EJWA 5ICCA 2BW3A 1L3LA 1T56A 3TW7A 2NAZA 2VT3A 5D8LB 5FLXZ 3K1MA 4ZTFA 1F5TA 4HYEA 4Y4RA 2QLZA 4DYRA 2JSPA 4AWXB 4BGDA 1X1PA 1QVTA 4BEHB 3EETA 2K3PA 4CZZA 3TP0A 2K27A 3BCAA 3I4PA 3S14J 2XKOA 2WY8Q 4E4HA 3G2BA 4HBLA 3L1PA 4BNCA 2LBFB 1TW2A 3BY6A 2DOEA 3HSEA 2VONA 4YIFA 2KP6A 4XIDA 5EEHA 4L9NA 3TDZC 3HGGA 3T0YA 4F91B 1TW3A 1HC8A 1APLC 2B7EA 2V6CA 4ESJA 2QGUA 2IS6A 3IV5A 3H0DA 2DTZA 4NBQA 1QHHD 3BJOA 2EK5A 3K4MA 2E7XA 1A04A 4DOZA 4DJAA 3CD6I 3N4MA 2FSWA 2VC0A 3GFLA 2FBKA 2O03A 4HG2A 4RB1A 2UWMA 4N9HA 3HOUJ 1ETQA 2LP0A 2J5PA 4F3QA 2H27A 4E7SA 2A3SA 2R5YB 2NVQJ 3RQIA 3OYAA 3KP4A 3HOVJ 3LQQA 2LSOA 3OR2C 2XROA 2DA7A 4EEFG 4EQQA 1XSXA 2XAUA 1ZTRA 3OYKA 3GZ6A 1VQKI 1Z3YA 3GBGA 3FK7A 5JFRA 2VOPA 1F9NA 2VQGA 4LJZF 3L2UA 1S8NA 1HXDA 2EFQA 3VDXA 3WU1B 1SFUA 4J01A 4XORA 1B59A 1FP1D 1H88C 3OWTA 5LRSA 3OYFA 1LNWA 3DEWA 3ECOA 1LUJB 1RZ4A 4PJNA 2COBA 2FXAA 2LVSA 3EPZA 3NEUA 3Q9VA 3SZPA 3EQLF 4RLQA 1VQLI 1TBXA 1E3PA 1ZELA 3DWLE 1G59A 4B09A 1Q1HA 5JVGF 5ED4A 2PMZA 2MLGA 3PM1A 4EM1A 1W7PB 3ZQLA 2M7BA 1FY7A 2RN7A 1R23A 4WXDA 4A6EA 1OCRH 4C3IJ 2KMUA 2CG4A 3LSTA 1EKEA 3IH2A 3WE2A 2RGVA 1D1BA 3VB2A 1X1AA 2Y9YA 2NS0A 4HPQA 4YFNF 2DMPA 1LKXA 4DZPA 5GPAA 2ZBKA 1XPXA 1J09A 5A2QK 2OCEA 3I4MJ 3ZQQA 4RMNA 5DYMA 2E7WA 4A69C 4XKCA 4A3JJ 2YX7A 1SEUA 3QRFF 2M3AA 4YFKF 3GO5A 5KVRA 3K4KA 2F5EA 3ZXSA 2FJ1A 3DP7A 2BEOA 3OYBA 1WJ5A 3BR6A 4KN7X 1LVKA 5GAEJ 2E2JJ 2RQPA 4OIOF 4DZJA 2XF7A 4IOAF 5HDNA 2X4HA 5L3DA 3L2WA 2R7RA 1HSTA 3KLOA 3LA2A 1Y0NA 2EPFA 2CFOA 2R5ZA 2P5KA 4BQQA 2GXAA 4AVPA 2FBIA 1ACIA 5CQGA 1QA6A 4QPOA 2WBMA 1DPRA 1G3WA 3IAS2 1R71A 2MBFA 1L0OC 4D1QA 1FOYA 4AYBA 2BYVE 1IO2A 2DMQA 3ZMSA 4QSHA 1GXPA 4XLCA 4R1HA 3OYIA 3H3VK 1G3TA 1LE8B 2OC6A 4AIDA 1UG2A 3HM5A 1IN7A 1HKSA 2HQAA 1HSJA 4CHUA 3W6VA 1MNMC 1YS7A 3C7JA 2FOKA 3L00A 2R7QA 5B3SH 1CF7A 1YJNI 5HLTA 1I5ZA 6PAXA 4M9ZA 1I50J 2PMUA 2JK3A 4CO8A 5LEKA 4P9FA 2EA2A 2LREA 5KCMA 2P81A 2ZJ2A 2ACJA 3K6GA 2B63J 4F55A 3GWZA 1N78A 2X1CA 1MZBA 4LLNA 2BHYA 1VQ4I 2E19A 1Y1WJ 3JRHA 1H9TA 3BR1A 4OIPF 4RGRA 3K4CA 1O7LA 4Y15A 1W36D 2JRTA 1SVOA 5BQTA 1K61A 4B43A 4G12A 1FP2A 1R5HA 1O7FA 2ISYA 1A6QA 1OCCH 1MH3A 3ESWB 2M34A 1IN6A 4II3A 2PN6A 3HOSA 1BL0A 3BDDA 2CV2A 4H4KC 2P0WA 1T0FA 3KZIC 3J81Z 4S05A 1S29A 2VQCA 2K4BA 1ZGAA 5L3BA 4UUSB 1ON1A 5BNGA 4HEA2 2HZDA 1ZLJA 3F6VA 5AONA 1DUXC 1BA5A 3O3KA 4XLNF 1Z21A 1X2NA 3WGHA 3UR3C 3VFZA 1RPWA 4B48A 1O3QA 2PBIA 1UZCA 3GZ5A 3PNVA 2OA4A 2K40A 2LFBA 3IL2A 4FCYA 4RM2A 1R9TJ 4JX6A 4II2A 1RR8C 2LC2A 4LK1F 2BVLA 1AKHB 2H1KA 3OY9A 1RKTA 5J8FA 2R92J 1ZARA 2HXIA 2WAFA 3LSPA 2QM3A 4MQVA 3ZP5A 1YG2A 4G94A 3V8LA 3AAFA 1LPQA 2L7KA 1LQ1A 1BI3A 2HTSA 4MEXF 2OU2A 3BZKA 3ZCOA 1Y39A 4C2TA 4F7ZA 2JSCA 5F04A 5ICFA 1P6RA 1B8IB 1HOMA 1RR7A 3CJQB 4A0YA 1ITYA 1MBKA 2H09A 1FIAA 1MJ9A 1S3JA 2VE8A 5D5XB 2QENA 3KP6A 3W6JB 4AVZA 4ETSA 4XL9A 4MFEA 5FROA 1F43A 4OAYA 4CCJA 3I64A 3LSKA 3GLLA 4MIMA 1R5GA 4AIJA 2L9VA 3DFGA 2DAOA 2HOSA 3JTGA 1R6RA 2WC2A 2Z9OA 4FX0A 2HPIA 3MKWB 5K7HA 2LY9A 2ZMEB 3A4CA 4BXFA 3KP3A 1BIAA 2R7WA 1LB2A 1D5YA 3DPUA 3J7ZI 4O5VA 3CCMI 4DYCA 2K85A 1T33A 1X19A 4CCNA 3K1NA 1Z0XA 2L7FP 4PCQA 1EV7A 5L3EA 5EGOB 4A3BJ 4I0AA 4JYKA 1U8BA 1R49A 1SFKA 3HZJA 4JP0A 3LSRA 3KIOA 3PFYA 1YO5C 2EZLA 1MJAA 2A07F 4N9IA 5CVVA 3KCCA 1IJWC 3S3NA 2VBWA 3FM3A 3K70D 1XX5A 1QRYA 2FRHA 5E3MA 4EJOA 3FHZA 2D5VA 4IKFA 2IA0A 4P55A 3CCSI 2IA2A 1YOVB 4KA4A 4DBRA 2XC7A 5E1XA 1FX7A 2OQRA 2OZ6A 2K4JA 1YITI 1LDDA 1T2KA 1J9IA 2KISA 4KIGA 4CA0A 2XB5A 1FBQA 5H20A 2K9NA 2EV5A 2DT5A 4Y13A 2QKLB 1ODDA 3H3ZA 2D1VA 4Q5SF 3E6DA 3HUGA 4IHXA 2M0MA 2XPUA 1W5TA 4YIRX 3M9AA 1IDYA 1YE9A 3HKZN 1VQ7I 4CICA 3CCYA 4XLAA 5TJJA 3BQZA 3V7SA 4ZDLA 3LAPA 3A01A 1FOXA 4G9YA 2VT2A 3QOEA 3K2AA 5B5EC 4FX4A 1RC9A 3ZQ7A 3B6CA 4RBOA 2H94A 4X6AJ 3ULQB 3JRFA 3WTYC 4CCLA 2WADA 5DUKA 3HHHA 4UB8C 4B47A 3BOQA 4XMYA 1ZHFA 3ZR8X 1WGXA 1GVDA 1IG7A 3BR2A 2XAFA 4KT5C 3E6MA 3HRSA 3HOWJ 3JREA 2VBYA 3O8HA 3FF5A 2DOFA 4ESFA 2JUGA 2GAUA 4HLYA 2EV0A 4J19A 1RUOA 2OUMA 2Z3YA 3FXLA 3B6AA 4D7NA 4E7KA 4LK0F 4D5FA 2F4IA 1RETA 3ECHA 4HV6A 2KRCA 3ABUA 5C4XJ 4RAGA 3P7NA 5EEGA 4FE4A 4XSXF 5JI6A 3K1PA 4XRSG 1JKOC 5ILVA 1VQ8I 2O6GE 3QODA 1TTYA 3OL4A 3BR0A 4V2FA 4HRIA 2GWRA 4PFPA 4RGXA 3HG9A 2W24A 2H8RA 2KZGA 4M72A 1U6GA 5LHIA 1D3YA 2BY1A 3PQKA 4M3EA 2DPUA 2QSFX 3HDDA 5M3MJ 3VSKA 3K4BA 4KT6A 2HDDA 3KFWX 4CDGA 4BBRJ 1FSEA 2JA5J 1HA8A 3S2WA 1KU2A 2ZKZA 3V7RA 4XRFA 4M6XA 4CYCB 1BIBA 2DCEA 5ILSA 3HPHA 5IPAA 2ME0A 3G1LA 4J00A 1U5TC 2VN2A 5HLIA 2E36A 3A03A 3D5LA 2E5ZA 3R4KA 3I9V2 3RJPA 3F8NA 4Q47A 3MKYB 3MQ0A 4U87A 1U3EM 1BBYA 2XDVA 1P4XA 5E1ZB 5DTDA 2ESNA 3U1KA 3J7AY 1VQOI 3G4SI 2EZHA 4ON0A 1XDUA 1B72A 4HQEA 2PJRA 4WF2A 5ERIA 3ZQCA 2QZ8A 4HA8A 1T8IA 1SFEA 5DCMB 3S1RJ 1WCMJ 3ML6A 3HGYA 3S3OA 4GDFA 3L2RA 3AL0B 3RTRA 1F36A 4KN4X 1MMDA 4P1WA 2XAJA 2P6TA 4TV7A 3GW2A 4FASD 2DJIA 5LGTA 5F64A 2EV6A 2UV1A 1G4DA 5FFXA 2GM4A 4MO7A 3W2WA 4ZJZA 2JA8J 2PI0A 2FEZA 4NC8A 4X1EA 2BXZA 1UHSA 3PSFA 4BHBA 4RLFA 4L9VA 2V1DA 3B02A 4D5CA 3SZTA 2PFBA 2O8KA 2J5OA 1RNLA 2VBXA 1R58A 3OYCA 2B9SA 2DO7A 5D5WB 1X4PA 2F2EA 5J4VA 3BG9A 3BWGA 1A6IA 4WXCA 3GMEA 4GO1A 1TT0A 2CUEA 1JXSA 3E7LA 4NDLA 5L3CA 1QZYA 3FWEA 4MTEA 1MH4A 1TQPA 1OKRA 1R1VA 1WHUA 3PNTA 3MKZA 5EZGA 2EH3A 3IUOA 3F21A 2E35A 4IX7A 5K5RA 2L2OA 3PNYA 3NARA 5F0HA 3FXOA 2X1DA 3A0HC 3MZYA 3C2BA 4RGSA 3L2QA 1VQ6I 2OPTA 1HDDC 2ZFUA 1PDNC 4GXOA 3CO7C 2ISZA 3KPHA 3JR9A 4U7BA 1RKWA 4RB2C 1I6HJ 5E18F 2O61A 5D5VB 4MHGA 4L5IA 2DK5A 5JHUA 2RNGA 3SYTA 4H0EA 2L0KA 1HW2A 1BN5A 2CS3A 4NHJA 4XQFA 2DFFA 2BE5F 1GUUA 4QTRA 2MFZA 2QWWA 3JAMK 4RS8A 4BL0B 2L01A 4U88A 3VYUB 1D0XA 2MLKA 3IAM2 2EZIA 2JRMA 1U5TA 1X1CA 1XG1A 1KQ0A 3FK6A 3CUQA 4U7DA 2HI3A 4RGUA 4RM3A 4UUVA 5IY5H 2E1MB 2NVYJ 3I71A 4L18B 3DKXA 2ECCA 4UY8I 4IL6C 2ZSIB 3DPLC 2DBBA 2W4SA 3PFIA 3TOAA 3VWBA 2GQQA 4CUGA 2K86A 4LIVA 4XNFA 2W48A 1BC7C 2CUZA 4HF1A 1IDZA 2RNJA 2X6XA 1G2HA 2KFDA 2NYXA 3Q3SA 2CQKA 3VOEA 2E71A 1FYMA 3M07A 1FYLA 3J80Z 2IAIA 3LA3A 3FM5A 1GLNA 2YU3A 3CJTB 5GAHJ 1A31A 3KEQA 5LBQA 1D1CA 1T98A 1STZA 1BOBA 3L2CA 3NWSA 2HYGD 2UXXA 1MIJA 1ETOA 1VI0A 2CQ7A 3KYDB 1XMKA 4IVNA 2IGNA 4MLOA 1DU6A 1XCBA 3M8FA 2IGOA 3N05A 1TWAJ 4HDVA 1QBJA 2QEXI 1XGSA 4IF4A 5J1RA 3EUKL 2K3FA 3ISPA 1N75A 4BEHA 1P4AA 3TOBA 2DQRA 2LH9A 1JGGA 4G7ZF 1ZRDA 3JTHA 5KAIC 5K5QA 1LVAA 2W1OA 1OCTC 2JQ7A 1TWFJ 2Z99A 2HVSA 1FOKA 2VASA 3K69A 2E60A 5FLVA 5LRRA 1P9QC 1KA8A 5E17F 3RKYA 3F9KA 2ID3A 3OIQA 3TDUC 4B4CA 4RAFA 2XB0X 3BT9A 4QIWN 4ITVA 1ZK8A 2BW3B 2Q8KA 2FF4A 4CYDA 4DYQA 1TWGJ 4ZC3A 4BS9A 1ZG3A 1ZN2A 4S04A 3NQOA 4BACA 3HRTA 1QZZA 4F92B 1UHWA 1V5EA 2R5YA 2NRAC 4LGWA 1WJAA 1OR7A 3CUOA 3HSRA 2DMTA 3TP3A 4ZYHA 2LKXA 2VKVA 4JQFA 2EQRA 2OCCH 2L7MP 1WVRA 3BJAA 3AG1H 3TBIA 3VEPA 5D5UB 1IAWA 1BI0A 3KETA 2M8GX 5E1WA 1MBHA 3FDYA 3K4NA 4PZJA 4OIQF 3ROUA 3HRMA 3I54A 2IW5A 2V1XA 1HW5A 3QPLA 1Z6TA 2LKSA 4KJZA 3MZ8A 3JRIA 2WWYA 3ZMTA 3RSNA 2Z5UA 1Y56A 4AU7A 1PP8F 1MDMA 3HL2A 4IRHA 3CQZJ 1FJLA 2XIGA 1UHMA 3JRBA 1XMXA 3K70C 3CDIA 3RZDJ 2LMDA 4XRMA 1Z67A 4IHVA 5E20A 5IP9J 1YW7A 5D4SA 1JTXA 1W7PA 4Y52J 2V26A 2WB1N 4ZDPA 2L9NA 2X0LA 1T0FC 1EH8A 3K9TA 1KU7A 2FOWA 2DT7B 2Y48A 3F0CA 4CCOA 1YW8A 3ZN1A 4G7HF 4M73A 3I5UA 3SHFA 4V2GA 3ASNH 4IHTA 5E79C 2Y75A 4M9XA 4ABZA 1O3TA 1SAXA 4A6DA 4MGRA 2A05A 5JHFA 2JVHA 1KYWA 2STWA 5BMZA 2P7CB 1XGNA 3RKWA 2ZJPF 1QHGA 3IHUA 4KICA 2PQ8A 2KDOA 4HSTA 4CGZA 4DW6A 1ZR4A 3L9FA 3KEOA 2DI3A 2HPMA 1JKQC 1VQ9I 2EINH 1WPKA 5K7ZA 4UUTA 5DEQA 3WTSC 1WJEA 5F6FA 5E3OA 2R3SA 3LFKA 2XVCA 1XTAA 4A0XA 1W1WE 3CMMA 5EJCA 2BGCA 2KL4A 4U0VA 3CC4I 1ZRFA 1Z1DA 2KRFA 3WGGA 4CXFA 1UMQA 3MMYB 5IYDJ 3BG7A 3FXRA 4LG0A 1FLIA 1KU3A 3TO7A 4M6VA 2WV0A 4UVBA 2UUZA 5IT9Z 1EA3A 2RDPA 3QOPA 1GV2A 2P5LC 1BC8C 3OSFA 4Y33A 3RKXA 2R7SA 1ERDA 4B1RA 3ZMVA 1D0ZA 5J47A 2DU9A 1FBUA 2JPCA 1U0JA 3GCMA 1LE8A 4JBAA 4Z2YA 1MBFA 5HLHA 2ADUA 2K9SA 2MW8A 4LB5A 2F5CA 3S1QJ 2XHKA 4XN3A 1MSFC 2KIMA 2LRDA 5CJ9A 1MD0A 3LSIA 2GXBA 1BR1A 1VNDA 2KKOA 4G6DA 1FYKA 1I1SA 5LLQA 3IKVA 2A6EF 2HU9A 3CF5F 2XKPA 1W0UA 2P5VA 4ZDOA 2O3FA 2VIXA 2Z16A 3C2HA 4OAZA 5DM6F 2E1OA 2DA1A 2M4KA 1MBJA 5DCFA 4PJJA 4I2OA 3VSLA 3GZNB 1W7PD 2OTJI 1F1ZA 4C9YA 5TGTA 1MW7A 1TLHB 2YX4A 3V42A 2NS8A 4C30A 5FRMA 3WTXC 1YFHA 2RKHA 5ILUA 1W0TA 1TWCJ 2JMWA 2V7FA 4WWCA 1TZLA 1UB9A 1OYYA 3E3VA 3LWFA 1VFCA 3QPHA 4GYGA 2M4GA 2N8GA 2RREA 3FMRA 3I59B 3HEFA 2DA4A 1X3WB 2DT6A 4A3DJ 3VYTB 2VKHA 3CF2A 4UUSA 1LEAA 4BDYA 3H5NA 4FT8A 3V8KA 4F93B 2HKOA 2F4MB 1BI2A 2TDXA 3BTJA 2X6YA 3C1DA 4LG3A 4A2UA 4ENNA 2IT0A 2A61A 2IS4A 3DKYA 2OBPA 2QUFA 3KZYA 2E2HJ 3CCLI 1OCZH 1KGSA 1YX3A 4OWRB 5K5OA 2D1HA 2ECBA 3L2VA 4DIQA 2FX0A 4KYWA 1J2XA 1XD7A 4IO9F 5CYVA 1WFXA 3RQ4A 1UELB 2QKMB 3ABMH 1DDNA 3D0SA 3IWFA 3M8EA 1AKHA 2XF5A 5DUIA 4NNJA 3S16J 3PL8A 2LF7A 3DTKA 1H8AC 3DF8A 1FOWA 1RIOH 1TQMA 3F8MA 3SEQA 2GOMA 1FT9A 4UVCA 1X58A 1MBGA 3OYJA 1K4TA 4IZZA 5IYCJ 4LB6B 1NK2P 2YPRA 3H35A 2DK8A 1B8IA 2DLLA 3R61A 1A35A 1OMIA 1VQMI 3CESA 2IGKA 2HYFA 3PUFA 3D5SC 2GLOA 1GV5A 2GXGA 3JRCA 4ZYDA 5DS9A 3T5XA 2EJRA 1OYWA 4E70A 5L3FA 4HSRA 3BG5A 5F08A 3X2QH 2JA2A 3GLXA 3TQNA 1WJFA 2VLAA 4M9SA 1IZ1A 2ICWG 2V1NA 1UFMA 3BC8A 4L0YB 1Z3XA 2QA4I 2WV1A 5DD8A 3CMEI 1JE8A 1BM9A 2ZMEA 5FD6A 1IN5A 3EYIA 1S5LC 3BQYA 1YIJI 4EM2A 3OIOA 2LDUA 3H9GA 3SZGA 3UNGC 5HNFA 5E8GA 2ZJQF 1RESA 4RAYA 4E7HA 4L9TA 4WCGA 2EBIA 4RAZA 1X4OA 2L54A 1IUYA 2LLKA 1E2XA 2V9PA 5EGOA 2D45A 2GZWA 1B9NA 5FLXK 2PX9A 1ZG5A 2IBDA 2DMUA 3NAUA 2W85A 3FX3A 5LHGA 2VJIA 3VYSB 1LJ9A 4PSWA 3DLLF 3TEDA 2FBHA 1ETKA 4M3GA 1WZ2A 1YX5A 1S72I 3P9CA 3PQJA 4Q4ZF 3HOYJ 5JLXA 5E3LA 5EF6A 4BH9A 3PJRA 4ZYEA 4XBFA 4ZYAA 4N0BA 3CP2A 1JI8A 2O8XA 3QAHA 4RB0A 1MBEA 3ERMA 3R6SA 1WJBA 1Z7UA 3SFIA 2DQLA 3JRAA 2CV1A 2W57A 3ZMZA 1ZGJA 2R7OA 2XGEA 5IOZA 2QBYA 3SDBA 2R7TA 1K83J 3AG2H 2W82A 3DTEA 3CTAA 3FMSA 1JGSA 3O2PE 2CU7A 2GIVA 4U0WA 5J6XA 1T95A 2VOOA 1B4AA 3REOA 3P9IA 2XRLA 1IN4A 4DQ2A 1IGNA 2HOEA 1ZKGA 2XAGA 4EATA 2E5NA 2E34A 1WRJA 2KJBA 3ZN0A 4DGWB 2CW0F 4IPAA 4NQWA 4HNTA 2HVQA 2V6EA 3NRVA 1X3UA 2RAEA 1SD6A 3DEEA 2I10A 4YIIA 3WTZA 3I0TA 3F72A 3QWLA 4W1UA 3RPQA 4R79A 1LFPA 1BR2A 2RC4A 2QF7A 3HHGA 1OCPA 2GBYA 2CUFA 2R7ZJ 3T8RA 2DYRH 4YEJA 4E7IA 4XLHA 1ENHA 5F0CA 4QPQA 3F23A 1JJ6C 5J8CA 1AOYA 3HC7A 1PP7U 1ORKA 2CV0A 2ME6A 4XICA 5F0FA 5J40A 1W4MA 2VXZA 2XSJC 3OYGA 1R4NB 4ENJA 4JX5A 3BG6A 1R00A 2FD5A 2GA2A 3G6EI 2MA3A 2H8WA 1IW7F 4GCVA 3CMAI 3W2VA 1CQTA 2AS5F 1POGA 4HDUA 3OYDA 3E6CC 4XKVA 4EM0B 4KITB 3ZPLA 3ZOBA 5D6EA 4OU0A 4BYYA 1QQIA 3LL7A 2R4GA 3CLOA 2W00A 3BR5A 5GPCA 1O57A 1W5SA 5IOYA 2UXNA 5KHDA 4XOPA 2F5FA 5FKMA 1QO0D 2HEOA 1ZG1A 2P4WA 4HX7A 4A3MJ 3UKGA 3J7AO 4EV0A 3GTGJ 2E2IJ 2IA1A 1AA7A 3OL3A 1WSUA 4AYBN 1S9HA 2AXTC 3PSIA 3VYRB 5EG0B 4HNVA 3JRGA 1E17A 4YRVA 4UVAA 4MFDA 3ABLH 3KYCB 4CYCA 1I39A 1O3SA 2HXOA 3K0LA 4A12A 5FKLA 3OYHA 1PUEE 2L4AA 2HTJA 3FKIJ 4IOCF 2ESHA 3M1CA 3A0BC 1V55H 2QYOA 3CUQC 5H6QA 1NH3A 4BE0A 2KHMA 1KQ9A 2DA2A 1A5JA 4YFXF 3RYRA 5D8KB 5FKOA 2IVMA 5DD4A 4KDPA 2IS2A 1YRNA 2LTPA 4DNCA 3S15J 2G7HA 5LFAA 2VKEA 5A2QZ 1JKRC 5ICEA 3OYLA 4ZZDA 2M30A 2DXIA 4BJTA 4E7JA 4R8HA 3CCEI 4UXNA 2C6YA 3GFJA 1ZR2A 1FTTA 3BZCA 3WG7H 1NG6A 5CVIA 1S6LA 5AIQA 4XLEA 3CC2I 1T08B 4KISA 1ETVA 1B9MA 1X3ZB 4UV8A 2F6CA 2M5WA 2HQRA 5CKTA 2Y9ZA 2COMA 1X2MA 3GUDA 3OS2A 2VQHA 2V4JC 1PUFA 3KP5A 3FBIB 4KUMA 4EVIA 5HDGA 2JZYA 4GRIA 1G6NA 2O7OA 2K9LA 4IRGA 1VZ0A 3GF2A 3T8TA 4IHYA 2DODA 3BROA 1J5YA 2MYSA 4MQ9F 5LHHA 3HPGA 3TGNA 2NXNB 2STTA 2XSDC 1PYVA 1TQIA 2O9LA 3I55I 2CGPA 2JA7J 3CP8A 3IP4B 1SFXA 1VTNC 1K78B 1VQ5I 2M7AA 3C2GA 2Q2EA 4LIUA 1FEXA 3DLAA 2DTRA 3DCFA 5IP6A 4FHTA 5FD5A 1G3SA 1Z6RA 2JN6A 2ZXIA 3CO6C 1WJCA 1NHAA 4IEJA 1OCOH 4HNUA 2XV4S 4PK4A 3LSGA 3R60A 3J81K 4I6ZA 4BY1J 4XR6A 2LY1A 1OR7C 2MG4A 1KZHA 2ZB9A 1D8KA 2ELKA 2HZTA 4QLCU 4HF2A 1ZQ3P 2PEXA 3CMYA 1A36A 1EF4A 5CPRB 3FKJA 4IQJA 3AG4H 4ESBA 2LG4A 2P7VB 2WAQN 4PFOA 2DJNA 2GA1A 2MD5A 2IGMA 1U9OA 1XSDA 3U9GA 3QPTA 3OMYA 2YUSA 4BDZA 3ABKH 2V1UA 1HKTA 1VQPI 2LD5A 1SANA 2EIMH 2OV7A 2ZCWA 5F27A 3AKZA 4FE7A 3WTTC 2VB6A 1HF0A 1PVEA 5LGUA 2DN0A 3GFIA 2Y30A 2YSRA 5IT3A 3FZVA 2VJ5A 1I6XA 1V5FA 3DQVC 3OR1C 2F48A 5FFZA 3RYPA 1H9GA 5BPIA 2ELJA 4ASNA 5ICGA 4YELA 3W2AA 4XKWA 2ZSHB 4OOIA 4L5JA 1S7OA 5EYRA 2H1LA 2IJLA 2M1BA 2NVXJ 1IRFA 1OQYA 3K7AJ 4KMFA 3S1NJ 1MNEA 3OYNA 1MMSA 2Q0OA 2BV6A 1HBXG 4A3CJ 2ZFWA 1IXSB 1U5TB 2IEKA 3W3CA 1OISA 4NB5A 2R7DA 1AWCA 1Z9CA 3V7CA 3IC7A 2LOOA 2CQQA 3HBLA 4UHTA 3LFUA 1QU3A 3DKWA 5CVRA 2IXSA 3MZHA 2WA0A 4IRIA 2VE9A 1ETWA 1Z05A 2MABA 4I01A 4ZTJA 1UCRA 2ZJRF 4EJVA 5E3NA 5GTIC 2XRNA 3J7YJ 4E7LA 2LR8A 3FXQA 2OQGA 2JUCA 1H89C 1O4XA 5BOXA 3D1NI 2D2WA 2Z33A 4BQOA 1LDKB 2DDAA 2NOJB 3E5QA 4Z6YA 4FISA 1KQ8A 1FPQA 4M74A 4XLFA 2CFXA 3WHCA 4Y17A 1TT5B 2QQBA 5FO5A 1IXCA 1WQ2A 1IF1A 5BPDA 4XSZF 1WI9A 2LBFA 3H9JA 2DDBA 4I98B 2EFNA 3QYFA 2HNHA 4PUSA 2TCTA 2X1EA 2Y0SN 2XF6A 1ULYA 4I76A 2K7LA 3OOUA 3VPRA 3R0AA 1RRJA 2FNPA 3MWMA 1F4KA 2VKDA 1AU7A 1V5GA 1DGRM 1WJDA 2FNAA 4L0ZB 1FMVA 2B0LA 5FRNA 2M87A 3BTLA 2HQNA 2UZKA 2IS1A 2KPMA 4L5EA 1UJ8A 4LOCA 1DP3A 2KIQA 2VODA 4XM3A 2BZTA 3CJRB 3GYHX 2NNNA 2PLYA 3LNQA 1JUPA 2EFWA 2Z1DA 3ZQHA 3BTIA 4Y7NJ 1IN8A 1YYVA 4AC0A 2A68F 1TNTA 4KMUX 2BXYA 1SFOJ 4Y3OA 3RPUA 2DPDA 3HOZJ 2RV8A 4O3MA 1V4RA 2OZUA 2NNYA 1BOAA 1RI7A 1NTCA 1GDTA 3CCRI 5FLMJ 3HIFA 1NG7A 1YIOA 2OD5A 4L9JA 3F3XA 4M3BA 3LQRA 4YG2F 4UV9A 1Z7LA 3A1YA 3RDIA 1J75A 4BHPA 4DBQA 1OLTA 4A3EJ 1JTYA 2XPWA 3MAJA 4ANJA 5HLGA 1HKQA 5EZHA 1QNTA 2XUBA 1LDJA 3HJEA 1YQAA 2M9HA 5GTHC 1GT0C 1DPUA 4CCKA 4EMSA 4G6QA 1ZH5A 5HDKA 4M71A 5C3EJ 1MDMB 3OSGA 2PJPA 1SMTA 5IP7J 1SC7A 2OJED 3S93A 3ZQGA 3GTPJ 1X1DA 2DA3A 2VXDA 5HNHA 2LK2A 3QU6A 2DYSH 1TC3C 4I0BA 3JW4A 3SJMA 1BJZA 4W97A 4G7OF 2BY2A 4A3FJ 4PSXA 3C3WA 2ID6A 4M3DA 4G6TB 3HKZA 3PO3J 4K2EA 2XASA 3GTLJ 3IH3A 3M8JA 3MFKA 4I09A 4LD5A 3IWZA 2YR2A 3E0JB 1Y1VJ 2CW8A 3I3LA 4LFUA 3O6BB 4M6YA 5DDGA 1FIPA 2CW7A 3CC7I 4I99C 3E5UA 3V8JA 1X1BA 5GADJ 4B44A 1K6OA 2VJ4A 1IUFA 3IRQA 1P2FA 1K7AA 4LITA 1V3FA 1NK3P 2F5DA 1U9NA 4PJLA 3LSHA 3H5RA 1YW9A 4BJ5C 3T1BA 4B8XA 2MD0A 3BR3A 5CQEA 5DM7F 1PJRA 4A3IJ 3K4JA 2KT0A 3RIRA 2CO5A 4ENKA 2O5RA 4A0ZA 3GTMJ 1H0MA 2W25A 4OIRF 2HYJA 4NC7A 1ZYRF 5B66C 5M5WJ 2EILH 1FSHA 2ZMEC 1SVMA 3BLYA 3DU5A 3QP5A 4HF0A 1JT6A 3LSMA 3V4GA 1J7KA 2TRTA 3E5XA 1FWZA 2W84A 3B73A 1FC3A 5M3FJ 3JCUC 2LF8A 3WE3A 2MGQA 2R7FA 2FU4A 4ENMA 2KDZA 2QSGX 2L7ZA 3DBHB 3H3UA 2NS7A 4HQMA 1ZREA 3RPUD 4LG0B 3TMOA 2R5ZB 1WH5A 3S1MJ 2VBZA 4RB3C 1FZPB 1S7AA 3K4LA 1Z77A 2K9MA 1TWHJ 1QPMA 1T38A 2MC4A 3KYLA 4KIBA 2JA6J 3GTKJ 2L9SA 3CZ6A 4PGGA 2CJJA 3LMMA 3H9QA 5JVTA 1FBSA 2QVOA 1XDSA 2IP2A 2WTEA 4V19K 1SAUA 2AXLA 5JR3A 4GGGA 1XCVA 4B3AA 2CQXA 3FXUA 3BTCA 1YHQI 5HS8A 1E3HA 4HW0A 3PIPF 3E1SA 3F6OA 1CF7B 1GXQA 3I59A 3ZGKA 1DU0A 4HX4A 5HODA 2BBYA 3WG9A 3QYBA 4HV5A 1R1UA 5KNLA 1REPC 1RUNA 2ZC2A 2IPQX 3ZMDA 5L3GA 2Z2SB 3WTVC 3CDLA 2H6BA 5TRDA 3DPTA 5FGMA 3S32A 1UAAA 3LOCA 3LAJA 4KFCA 1MGTA 3SDGA 5C4JJ 2VUMJ 2X85A 4G8XA 3GTQJ 4XN0A 2QCOA 5LGNA 3AG3H 4AIHA 3KE2A 4CH7A 1SVLA 2ZXWH 3MD2A 1HDPA 1K6YA 1W5CC 1WWXA 2E1NA 1ETXA 2G9WA 4IHSA 4F52A 3H0GJ 3ZMUA 2X51A 4BY7J 1KYZA 4U0YA 2KQRA 3DXJF 3ERED 2AQEA 3GEZA 3CJNA 1XGMA 3OV8A 2NOGA 2QQ8A 4P9UA 3RCOA 2KLOA 1IRZA 1CGPA 2VC1A 5LEJA 2GIZA 1JUMA 4JOMA 2BY3A 1KONA 4BE2A 3FIWA 5F1JA 1N25A 2LNBA 3HTUA 3IH4A 4P5OA 4MTDA 2HWVA 3Q0VA 1YLFA 3JAMZ 3ZRGA 3H1CA 5AIPA 2ZXJA 5D6FA 3OS1A 2CYYA 3J80K 1XB4A 3O8GA 1B1BA 1Y8RB 4OINF 2R7UA 3FXMA 4HOBA 3ZQIA 1U8RA 1JHHA 1K4SA 5KAFC 1USSA 2L5QA 3M4OJ 3KZZA 2HDWA 3CCVI 2BHZA 4BHCA 5E8IA 1Y8QB 2HFHA 2P6SA 3BP8A 3GX4X 4M3FA 1BJAA 3Q0UA 1YJ9I 4WK8F 1OPCA 3EUHC 2FA5A 1IV6A 5FJ8J 4LLLA 4BAYA 3ASOH 1FNNA 3QPSA 2K9QA 3F8FA 2WAEA 2WY7Q 1YTYA 2OAZA 4BXXJ 1ZRCA 3M1EA 3DU6A 4LLGF 3SQNA 2WAQA 3FXKA
chains in the Genus database with same CATH topology
2FE3A 5BS6A 5H6RA 4HAMA 1SD4A 4ZZLA 1P92A 1ON2A 3BZ6A 1DP7P 3WGIA 4ZYGA 5KK1A 3WTUC 1R7JA 3GFMA 1Y0UA 2JT1A 1MKMA 2IRFG 2EFOA 2G7UA 1P4WA 2QBYB 4KNYA 1SD5A 3P9KA 4PDKA 2CWEA 1OYIA 2P8TA 3ABTA 2PMHA 5K1YA 3L09A 4EJUA 3WTWC 5HVQC 2L3DA 3F8CA 1BI1A 1U78A 2A69F 1O3RA 1IRGA 2JTVA 3R0JA 3WODF 2KIFA 4A5MA 3EDPA 3Q9SA 1I1GA 1WKMA 1HW1A 1SMYF 2EB7A 4I02A 3HRUA 2ZNZA 3KLNA 2EWNA 4EGYA 4QWQA 2DW4A 1QGPA 3WU0A 2QQAA 2ZNYA 2EFPA 3TO6A 4MEYF 3F8BA 1GHCA 3TKYA 1XSVA 2MH9A 3EUHA 1I27A 3U1DA 2LKPA 5CLSA 4Q48A 3K2ZA 5HS9A 3GXOA 2HKXA 3Q5FA 4O6JA 1GVJA 5DCMA 1G3YA 1R22A 4MNUA 2ETHA 3TO9A 5D4RA 2MC3A 5IT9K 2JPBA 2M45A 3E6BA 2L4MA 2HS5A 3SFZA 1XGOA 1C0WA 3CDHA 3M7GA 2V9VA 2FQ3A 4UNOA 3JSPA 1XMAA 3E97A 4KIFA 3I58A 1Z91A 2KJCA 1T6SA 5HOOA 3F22A 3I53A 2V79A 2XAQA 1U2WA 4HX8A 3L7WA 5CVJA 4BXUA 3IRRA 4XLPF 1EH7A 1KU9A 1B6AA 3MCZA 3COAC 1HQCA 1K78A 3BPVA 4P96A 1SD7A 2ELHA 3W6KB 3IKTA 1R1TA 3SXYA 2K02A 3DEUA 1MJBA 1ZLKA 3G73A 1TNSA 2XAHA 1JHFA 5HS7A 1J59A 4D0PA 2E1CA 4IXAA 1D8JA 2DFIA 3FMQA 2M8EA 3VODA 2H6CA 2FMLA 4HLXA 3HTSB 2O0YA 3ELKA 1YS6A 3U2RA 3QP6A 3QU3A 1XN7A 1K79A 2A5YB 1J0RA 5F1RA 2EA4A 2FMYA 3C18A 1D5VA 3HOTA 2HGCA 1IXRC 3RI4A 3G3ZA 3JSOA 2MH2A 3BPXA 3LA7A 4ZH4F 1T39A 5FB2A 1USTA 4OMYA 2A6HF 3KP2A 2KIUA 4I7HA 3DV8A 1ONVA 4IJAA 4LMYA 3HYIA 3BJ6A 4JK1X 3CUQB 2CSOA 4BQAA 3KP7A 3H92A 5DV5A 3MEXA 3N97A 1ZAOA 2PG4A 2RVCA 2ZO4A 4PGHA 2QQ9A 4GYIA 4WXHA 4AIKA 3GVAA 3OOPA 3EYYA 4HZFA 4EJTA 1LEBA 4AD9A 2Y0MA 5CVUA 2HR3A 4EGZA 2L02A 1EH6A 4OMZA 1R36A 2XGXA 4A5NA 2HDCA 3HSFA 4WX9A 4EJWA 5ICCA 1L3LA 2NAZA 2VT3A 5D8LB 5FLXZ 3K1MA 1F5TA 4HYEA 2QLZA 4AWXB 3EETA 4CZZA 2K27A 3I4PA 2XKOA 4HBLA 4BNCA 1TW2A 3BY6A 2VONA 3HSEA 4YIFA 3TDZC 5EEHA 4L9NA 3T0YA 1TW3A 2V6CA 4ESJA 3BJOA 2EK5A 2E7XA 1A04A 3N4MA 2FSWA 2VC0A 3GFLA 2FBKA 2O03A 4RB1A 2UWMA 4N9HA 2J5PA 2H27A 2A3SA 3KP4A 3LQQA 2LSOA 2XROA 4EQQA 1XSXA 3GZ6A 5JFRA 2VOPA 1F9NA 4LJZF 1S8NA 1HXDA 2EFQA 3WU1B 1SFUA 1B59A 1FP1D 5LRSA 1LNWA 3ECOA 1RZ4A 3Q9VA 2FXAA 3NEUA 3SZPA 3EQLF 1TBXA 4B09A 1Q1HA 5ED4A 2MLGA 4EM1A 1W7PB 1FY7A 2RN7A 1R23A 4WXDA 4A6EA 2CG4A 3LSTA 3WE2A 2RGVA 3VB2A 2NS0A 4YFNF 2ZBKA 5A2QK 5DYMA 2E7WA 2YX7A 3QRFF 4YFKF 3GO5A 5KVRA 2F5EA 3DP7A 2BEOA 4KN7X 2RQPA 4OIOF 5HDNA 2X4HA 5L3DA 1HSTA 3KLOA 3LA2A 2P5KA 4AVPA 2FBIA 1DPRA 1G3WA 2MBFA 1L0OC 2BYVE 3ZMSA 1GXPA 4R1HA 1G3TA 1IN7A 1HKSA 1HSJA 4CHUA 1YS7A 3C7JA 2FOKA 3L00A 1CF7A 1I5ZA 6PAXA 4M9ZA 2PMUA 4CO8A 5LEKA 4P9FA 2EA2A 2ZJ2A 2ACJA 3GWZA 1MZBA 4LLNA 1H9TA 4OIPF 4RGRA 4Y15A 1O7LA 2JRTA 5BQTA 1FP2A 1R5HA 1O7FA 2ISYA 1IN6A 2PN6A 3HOSA 3BDDA 1T0FA 3J81Z 4S05A 1S29A 2K4BA 1ZGAA 5L3BA 1ON1A 1ZLJA 3F6VA 5AONA 1DUXC 3O3KA 4XLNF 3WGHA 3VFZA 1O3QA 2PBIA 3GZ5A 2OA4A 3IL2A 4LK1F 5J8FA 1ZARA 2QM3A 4MQVA 3ZP5A 1YG2A 4G94A 3V8LA 3AAFA 1LQ1A 1BI3A 2HTSA 4MEXF 2OU2A 4F7ZA 2JSCA 5ICFA 1P6RA 4A0YA 2H09A 1MJ9A 5D5XB 1S3JA 4ETSA 2VE8A 2QENA 3KP6A 3W6JB 3I64A 1R5GA 4AIJA 3DFGA 2DAOA 3JTGA 2WC2A 2Z9OA 4FX0A 2ZMEB 3KP3A 1BIAA 1LB2A 4O5VA 3K1NA 4PCQA 1EV7A 5L3EA 4I0AA 1YO5C 1MJAA 2A07F 4N9IA 5CVVA 3KCCA 2VBWA 3FM3A 2FRHA 4EJOA 3FHZA 2IA0A 4P55A 2IA2A 4KA4A 5E1XA 1FX7A 2OQRA 2OZ6A 2K4JA 1T2KA 1LDDA 1J9IA 4KIGA 1FBQA 5H20A 2EV5A 2DT5A 4Y13A 1ODDA 3H3ZA 2D1VA 4Q5SF 3E6DA 3HUGA 1W5TA 3M9AA 4CICA 5TJJA 3V7SA 3LAPA 4G9YA 2VT2A 4FX4A 3ZQ7A 2H94A 3ULQB 3WTYC 5DUKA 3HHHA 3BOQA 1ZHFA 2XAFA 4KT5C 3E6MA 3HRSA 2VBYA 3FF5A 4ESFA 4HLYA 2GAUA 2EV0A 1RUOA 2Z3YA 4LK0F 3ECHA 4HV6A 3ABUA 3P7NA 5EEGA 4XSXF 5JI6A 3K1PA 5ILVA 2O6GE 1TTYA 2GWRA 4RGXA 2W24A 4M72A 1U6GA 5LHIA 1D3YA 3PQKA 2DPUA 3KFWX 4CDGA 1FSEA 3S2WA 1KU2A 2ZKZA 3V7RA 4XRFA 4M6XA 1BIBA 5ILSA 1U5TC 2VN2A 5HLIA 3D5LA 3R4KA 3RJPA 3F8NA 4Q47A 3MQ0A 1U3EM 1BBYA 1P4XA 5E1ZB 2ESNA 4ON0A 1XDUA 4HQEA 4WF2A 5ERIA 2QZ8A 4HA8A 1SFEA 5DCMB 3ML6A 3RTRA 4KN4X 2XAJA 2P6TA 4TV7A 3GW2A 5LGTA 5F64A 2EV6A 1G4DA 5FFXA 2PI0A 2FEZA 4BHBA 4L9VA 2V1DA 3B02A 3SZTA 2PFBA 2J5OA 1RNLA 2VBXA 1R58A 2DO7A 5D5WB 2F2EA 3BWGA 4WXCA 4GO1A 1JXSA 5L3CA 1QZYA 3FWEA 4MTEA 1TQPA 1OKRA 1R1VA 3F21A 5K5RA 3MZYA 4RGSA 1PDNC 4GXOA 3CO7C 2ISZA 4U7BA 4RB2C 5E18F 2O61A 5D5VB 4MHGA 4L5IA 2DK5A 5JHUA 4H0EA 1HW2A 1BN5A 4NHJA 2BE5F 2QWWA 3JAMK 4RS8A 2L01A 4U88A 2MLKA 1U5TA 1KQ0A 3CUQA 4U7DA 4RGUA 4UUVA 3I71A 4L18B 3DPLC 2DBBA 3PFIA 3TOAA 2GQQA 2K86A 1BC7C 4HF1A 2RNJA 2NYXA 2CQKA 3VOEA 1FYMA 1FYLA 3J80Z 3LA3A 3FM5A 2YU3A 3KEQA 5LBQA 1T98A 1STZA 3L2CA 2HYGD 2UXXA 1XMKA 4IVNA 1XCBA 3M8FA 4HDVA 1QBJA 1XGSA 4IF4A 3ISPA 1P4AA 3TOBA 2DQRA 4G7ZF 1ZRDA 3JTHA 5K5QA 1LVAA 2Z99A 1FOKA 3K69A 5LRRA 1KA8A 5E17F 3RKYA 3TDUC 2Q8KA 2FF4A 4CYDA 1ZG3A 1ZN2A 4S04A 3NQOA 3HRTA 1QZZA 1UHWA 2NRAC 4LGWA 3CUOA 1OR7A 3HSRA 4ZYHA 4JQFA 3BJAA 3VEPA 5D5UB 1IAWA 1BI0A 3KETA 5E1WA 4OIQF 4PZJA 3ROUA 3HRMA 3I54A 2IW5A 2V1XA 1HW5A 1Z6TA 2WWYA 3ZMTA 2Z5UA 1PP8F 1MDMA 4IRHA 2XIGA 1UHMA 5E20A 1YW7A 5D4SA 1W7PA 2X0LA 1EH8A 3K9TA 1KU7A 2Y48A 1YW8A 3ZN1A 4G7HF 4M73A 3I5UA 3SHFA 4IHTA 2Y75A 4M9XA 1O3TA 1SAXA 4A6DA 4MGRA 1KYWA 2STWA 5BMZA 2P7CB 1XGNA 3RKWA 3IHUA 4KICA 2PQ8A 4CGZA 3L9FA 3KEOA 2DI3A 5DEQA 3WTSC 5F6FA 2R3SA 3LFKA 2XVCA 4A0XA 2BGCA 4U0VA 1ZRFA 1Z1DA 2KRFA 3WGGA 4CXFA 1FLIA 3FXRA 4LG0A 1KU3A 3TO7A 2WV0A 4UVBA 5IT9Z 2RDPA 3QOPA 2P5LC 1BC8C 3RKXA 3ZMVA 2DU9A 1FBUA 2JPCA 4JBAA 4Z2YA 5HLHA 2ADUA 4LB5A 2F5CA 2XHKA 2KIMA 5CJ9A 1MD0A 1I1SA 2GXBA 2KKOA 4G6DA 1FYKA 5LLQA 3IKVA 2A6EF 2XKPA 2P5VA 2O3FA 5DCFA 4I2OA 1W7PD 1F1ZA 2YX4A 1TLHB 3WTXC 1YFHA 2RKHA 5ILUA 4WWCA 1UB9A 3E3VA 1OYYA 3LWFA 3QPHA 4GYGA 3FMRA 3I59B 1LEAA 3V8KA 4FT8A 2HKOA 1BI2A 2TDXA 3C1DA 4ENNA 4A2UA 2IT0A 2A61A 2OBPA 2QUFA 3KZYA 1KGSA 5K5OA 2D1HA 4KYWA 1J2XA 1XD7A 5CYVA 1DDNA 3D0SA 3IWFA 3M8EA 5DUIA 2LF7A 3DF8A 1RIOH 1TQMA 3F8MA 1FT9A 4UVCA 4LB6B 2YPRA 2DK8A 2DLLA 3R61A 1OMIA 2HYFA 2GXGA 4ZYDA 3T5XA 2EJRA 1OYWA 4E70A 5L3FA 3GLXA 3TQNA 4M9SA 1IZ1A 1UFMA 4L0YB 5DD8A 1JE8A 1BM9A 2ZMEA 5FD6A 1IN5A 3EYIA 4EM2A 2LDUA 5E8GA 4RAYA 4L9TA 4WCGA 4RAZA 2L54A 1IUYA 1E2XA 2D45A 2GZWA 1B9NA 5FLXK 1ZG5A 2W85A 3FX3A 5LHGA 1LJ9A 2FBHA 3P9CA 3PQJA 4Q4ZF 4BH9A 4ZYEA 4XBFA 4N0BA 2O8XA 3QAHA 4RB0A 3R6SA 1Z7UA 2DQLA 2W57A 3ZMZA 1ZGJA 2QBYA 3CTAA 3FMSA 1JGSA 3O2PE 2GIVA 4U0WA 5J6XA 2VOOA 1B4AA 3REOA 3P9IA 1IN4A 4DQ2A 2HOEA 2XAGA 2KJBA 1WRJA 3ZN0A 2CW0F 4IPAA 4NQWA 3NRVA 1X3UA 1SD6A 4YIIA 3WTZA 3I0TA 3F72A 3RPQA 4R79A 2RC4A 3HHGA 3T8RA 3F23A 5J8CA 1AOYA 1PP7U 1W4MA 2VXZA 4ENJA 1R00A 2GA2A 2MA3A 1IW7F 4GCVA 2AS5F 4HDUA 3E6CC 4EM0B 3ZPLA 5D6EA 4OU0A 4BYYA 1QQIA 3CLOA 1O57A 1W5SA 2UXNA 2F5FA 2HEOA 1QO0D 1ZG1A 2P4WA 4HX7A 3J7AO 4EV0A 2IA1A 1WSUA 1E17A 4UVAA 1O3SA 3K0LA 4A12A 1PUEE 2L4AA 2HTJA 2ESHA 3CUQC 5H6QA 2QYOA 1KQ9A 4YFXF 3RYRA 5D8KB 2IVMA 5DD4A 4KDPA 4DNCA 2G7HA 5A2QZ 5ICEA 4ZZDA 2M30A 4R8HA 4UXNA 2C6YA 3GFJA 5CVIA 1S6LA 5AIQA 1B9MA 4UV8A 2M5WA 2HQRA 2COMA 3GUDA 3KP5A 4KUMA 4EVIA 5HDGA 2JZYA 1G6NA 4IRGA 3GF2A 3T8TA 3BROA 1J5YA 4MQ9F 5LHHA 3TGNA 2STTA 1TQIA 2CGPA 1SFXA 1VTNC 1K78B 2Q2EA 2DTRA 4FHTA 5FD5A 1G3SA 1Z6RA 3CO6C 1NHAA 2XV4S 3R60A 3J81K 1D8KA 2HZTA 4QLCU 4HF2A 2PEXA 4ESBA 2P7VB 2GA1A 2MD5A 1XSDA 3U9GA 3QPTA 2V1UA 1HKTA 2ZCWA 3WTTC 5LGUA 3GFIA 2YSRA 5IT3A 3FZVA 1I6XA 3DQVC 3RYPA 5FFZA 5BPIA 1H9GA 5ICGA 4ASNA 4OOIA 4L5JA 1S7OA 2IJLA 2M1BA 1IRFA 4KMFA 2Q0OA 2BV6A 1HBXG 2ZFWA 1IXSB 1U5TB 4NB5A 2R7DA 1AWCA 1Z9CA 3V7CA 3IC7A 4UHTA 3DKWA 5CVRA 3MZHA 4IRIA 2VE9A 1Z05A 4I01A 1UCRA 4EJVA 2XRNA 3FXQA 2OQGA 5BOXA 2D2WA 2Z33A 1LDKB 3E5QA 1KQ8A 1FPQA 4M74A 2CFXA 4Y17A 2QQBA 5FO5A 1IXCA 1WQ2A 1IF1A 5BPDA 4XSZF 1WI9A 4I98B 2EFNA 1ULYA 2K7LA 3R0AA 2FNPA 3MWMA 1F4KA 2FNAA 4L0ZB 2B0LA 2M87A 2HQNA 2UZKA 2VODA 3GYHX 2NNNA 2PLYA 2EFWA 1IN8A 1YYVA 2A68F 1TNTA 4KMUX 3RPUA 2DPDA 2RV8A 4O3MA 1V4RA 2OZUA 2NNYA 1BOAA 1RI7A 3HIFA 4L9JA 1YIOA 2OD5A 3F3XA 3LQRA 4YG2F 4UV9A 3RDIA 1J75A 4BHPA 3MAJA 5HLGA 1HKQA 1QNTA 2XUBA 1LDJA 1YQAA 1DPUA 4EMSA 4G6QA 1ZH5A 5HDKA 4M71A 1MDMB 2PJPA 1SMTA 3QU6A 4I0BA 3JW4A 4G7OF 3C3WA 4K2EA 2XASA 3MFKA 4I09A 4LD5A 3IWZA 2YR2A 4M6YA 4LFUA 3O6BB 5DDGA 3E5UA 3V8JA 1K6OA 3IRQA 1P2FA 1K7AA 1V3FA 2F5DA 1YW9A 3T1BA 4B8XA 3RIRA 2CO5A 4ENKA 4A0ZA 1H0MA 2W25A 4OIRF 1ZYRF 1FSHA 3QP5A 4HF0A 3V4GA 1J7KA 3E5XA 1FWZA 2W84A 3B73A 1FC3A 2LF8A 3WE3A 2R7FA 2FU4A 4ENMA 3H3UA 4HQMA 1ZREA 4LG0B 2VBZA 4RB3C 1FZPB 1S7AA 1QPMA 1T38A 4KIBA 4PGGA 5JVTA 1FBSA 2QVOA 1XDSA 2IP2A 2WTEA 2AXLA 5JR3A 4GGGA 1XCVA 3FXUA 5HS8A 4HW0A 3F6OA 1CF7B 1GXQA 3I59A 4HX4A 2BBYA 3WG9A 4HV5A 1R1UA 1REPC 1RUNA 2IPQX 3ZMDA 5L3GA 3WTVC 2H6BA 5TRDA 3DPTA 5FGMA 3LAJA 4KFCA 1MGTA 4G8XA 5LGNA 4AIHA 3KE2A 1WWXA 2E1NA 4IHSA 2G9WA 3ZMUA 1KYZA 4U0YA 3DXJF 3ERED 3GEZA 3CJNA 1XGMA 3OV8A 4P9UA 1CGPA 2VC1A 5LEJA 2LNBA 3HTUA 4P5OA 4MTDA 2HWVA 1YLFA 3JAMZ 5AIPA 2ZXJA 5D6FA 2CYYA 3J80K 1XB4A 1B1BA 4OINF 4HOBA 1U8RA 1JHHA 1USSA 3KZZA 4BHCA 5E8IA 2HFHA 2P6SA 3BP8A 3GX4X 1BJAA 4WK8F 1OPCA 2FA5A 4LLLA 4BAYA 1FNNA 3F8FA 1YTYA 2OAZA 1ZRCA 3M1EA 4LLGF 3SQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE3 A;  5BS6 A;  5H6R A;  4HAM A;  1SD4 A;  4ZZL A;  1P92 A;  1ON2 A;  3BZ6 A;  1DP7 P;  3WGI A;  4ZYG A;  5KK1 A;  3WTU C;  1R7J A;  3GFM A;  1Y0U A;  2JT1 A;  1MKM A;  2IRF G;  2EFO A;  2G7U A;  1P4W A;  2QBY B;  4KNY A;  1SD5 A;  3P9K A;  4PDK A;  2CWE A;  1OYI A;  2P8T A;  3ABT A;  2PMH A;  5K1Y A;  3L09 A;  4EJU A;  3WTW C;  5HVQ C;  2L3D A;  3F8C A;  1BI1 A;  1U78 A;  2A69 F;  1O3R A;  1IRG A;  2JTV A;  3R0J A;  3WOD F;  2KIF A;  4A5M A;  3EDP A;  3Q9S A;  1I1G A;  1WKM A;  1HW1 A;  1SMY F;  2EB7 A;  4I02 A;  3HRU A;  2ZNZ A;  3KLN A;  2EWN A;  4EGY A;  4QWQ A;  2DW4 A;  1QGP A;  3WU0 A;  2QQA A;  2ZNY A;  2EFP A;  3TO6 A;  4MEY F;  3F8B A;  1GHC A;  3TKY A;  1XSV A;  2MH9 A;  3EUH A;  1I27 A;  3U1D A;  2LKP A;  5CLS A;  4Q48 A;  3K2Z A;  5HS9 A;  3GXO A;  2HKX A;  3Q5F A;  4O6J A;  1GVJ A;  5DCM A;  1G3Y A;  1R22 A;  4MNU A;  2ETH A;  3TO9 A;  5D4R A;  2MC3 A;  5IT9 K;  2JPB A;  2M45 A;  3E6B A;  2L4M A;  2HS5 A;  3SFZ A;  1XGO A;  1C0W A;  3CDH A;  3M7G A;  2V9V A;  2FQ3 A;  4UNO A;  3JSP A;  1XMA A;  3E97 A;  4KIF A;  3I58 A;  1Z91 A;  2KJC A;  1T6S A;  5HOO A;  3F22 A;  3I53 A;  2V79 A;  2XAQ A;  1U2W A;  4HX8 A;  3L7W A;  5CVJ A;  4BXU A;  3IRR A;  4XLP F;  1EH7 A;  1KU9 A;  1B6A A;  3MCZ A;  3COA C;  1HQC A;  1K78 A;  3BPV A;  4P96 A;  1SD7 A;  2ELH A;  3W6K B;  3IKT A;  1R1T A;  3SXY A;  2K02 A;  3DEU A;  1MJB A;  1ZLK A;  3G73 A;  1TNS A;  2XAH A;  1JHF A;  5HS7 A;  1J59 A;  4D0P A;  2E1C A;  4IXA A;  1D8J A;  2DFI A;  3FMQ A;  2M8E A;  3VOD A;  2H6C A;  2FML A;  4HLX A;  3HTS B;  2O0Y A;  3ELK A;  1YS6 A;  3U2R A;  3QP6 A;  3QU3 A;  1XN7 A;  1K79 A;  2A5Y B;  1J0R A;  5F1R A;  2EA4 A;  2FMY A;  3C18 A;  1D5V A;  3HOT A;  2HGC A;  1IXR C;  3RI4 A;  3G3Z A;  3JSO A;  2MH2 A;  3BPX A;  3LA7 A;  4ZH4 F;  1T39 A;  5FB2 A;  1UST A;  4OMY A;  2A6H F;  3KP2 A;  2KIU A;  4I7H A;  3DV8 A;  1ONV A;  4IJA A;  4LMY A;  3HYI A;  3BJ6 A;  4JK1 X;  3CUQ B;  2CSO A;  4BQA A;  3KP7 A;  3H92 A;  5DV5 A;  3MEX A;  3N97 A;  1ZAO A;  2PG4 A;  2RVC A;  2ZO4 A;  4PGH A;  2QQ9 A;  4GYI A;  4WXH A;  4AIK A;  3GVA A;  3OOP A;  3EYY A;  4HZF A;  4EJT A;  1LEB A;  4AD9 A;  2Y0M A;  5CVU A;  2HR3 A;  4EGZ A;  2L02 A;  1EH6 A;  4OMZ A;  1R36 A;  2XGX A;  4A5N A;  2HDC A;  3HSF A;  4WX9 A;  4EJW A;  5ICC A;  1L3L A;  2NAZ A;  2VT3 A;  5D8L B;  5FLX Z;  3K1M A;  1F5T A;  4HYE A;  2QLZ A;  4AWX B;  3EET A;  4CZZ A;  2K27 A;  3I4P A;  2XKO A;  4HBL A;  4BNC A;  1TW2 A;  3BY6 A;  2VON A;  3HSE A;  4YIF A;  3TDZ C;  5EEH A;  4L9N A;  3T0Y A;  1TW3 A;  2V6C A;  4ESJ A;  3BJO A;  2EK5 A;  2E7X A;  1A04 A;  3N4M A;  2FSW A;  2VC0 A;  3GFL A;  2FBK A;  2O03 A;  4RB1 A;  2UWM A;  4N9H A;  2J5P A;  2H27 A;  2A3S A;  3KP4 A;  3LQQ A;  2LSO A;  2XRO A;  4EQQ A;  1XSX A;  3GZ6 A;  5JFR A;  2VOP A;  1F9N A;  4LJZ F;  1S8N A;  1HXD A;  2EFQ A;  3WU1 B;  1SFU A;  1B59 A;  1FP1 D;  5LRS A;  1LNW A;  3ECO A;  1RZ4 A;  3Q9V A;  2FXA A;  3NEU A;  3SZP A;  3EQL F;  1TBX A;  4B09 A;  1Q1H A;  5ED4 A;  2MLG A;  4EM1 A;  1W7P B;  1FY7 A;  2RN7 A;  1R23 A;  4WXD A;  4A6E A;  2CG4 A;  3LST A;  3WE2 A;  2RGV A;  3VB2 A;  2NS0 A;  4YFN F;  2ZBK A;  5A2Q K;  5DYM A;  2E7W A;  2YX7 A;  3QRF F;  4YFK F;  3GO5 A;  5KVR A;  2F5E A;  3DP7 A;  2BEO A;  4KN7 X;  2RQP A;  4OIO F;  5HDN A;  2X4H A;  5L3D A;  1HST A;  3KLO A;  3LA2 A;  2P5K A;  4AVP A;  2FBI A;  1DPR A;  1G3W A;  2MBF A;  1L0O C;  2BYV E;  3ZMS A;  1GXP A;  4R1H A;  1G3T A;  1IN7 A;  1HKS A;  1HSJ A;  4CHU A;  1YS7 A;  3C7J A;  2FOK A;  3L00 A;  1CF7 A;  1I5Z A;  6PAX A;  4M9Z A;  2PMU A;  4CO8 A;  5LEK A;  4P9F A;  2EA2 A;  2ZJ2 A;  2ACJ A;  3GWZ A;  1MZB A;  4LLN A;  1H9T A;  4OIP F;  4RGR A;  4Y15 A;  1O7L A;  2JRT A;  5BQT A;  1FP2 A;  1R5H A;  1O7F A;  2ISY A;  1IN6 A;  2PN6 A;  3HOS A;  3BDD A;  1T0F A;  3J81 Z;  4S05 A;  1S29 A;  2K4B A;  1ZGA A;  5L3B A;  1ON1 A;  1ZLJ A;  3F6V A;  5AON A;  1DUX C;  3O3K A;  4XLN F;  3WGH A;  3VFZ A;  1O3Q A;  2PBI A;  3GZ5 A;  2OA4 A;  3IL2 A;  4LK1 F;  5J8F A;  1ZAR A;  2QM3 A;  4MQV A;  3ZP5 A;  1YG2 A;  4G94 A;  3V8L A;  3AAF A;  1LQ1 A;  1BI3 A;  2HTS A;  4MEX F;  2OU2 A;  4F7Z A;  2JSC A;  5ICF A;  1P6R A;  4A0Y A;  2H09 A;  1MJ9 A;  5D5X B;  1S3J A;  4ETS A;  2VE8 A;  2QEN A;  3KP6 A;  3W6J B;  3I64 A;  1R5G A;  4AIJ A;  3DFG A;  2DAO A;  3JTG A;  2WC2 A;  2Z9O A;  4FX0 A;  2ZME B;  3KP3 A;  1BIA A;  1LB2 A;  4O5V A;  3K1N A;  4PCQ A;  1EV7 A;  5L3E A;  4I0A A;  1YO5 C;  1MJA A;  2A07 F;  4N9I A;  5CVV A;  3KCC A;  2VBW A;  3FM3 A;  2FRH A;  4EJO A;  3FHZ A;  2IA0 A;  4P55 A;  2IA2 A;  4KA4 A;  5E1X A;  1FX7 A;  2OQR A;  2OZ6 A;  2K4J A;  1T2K A;  1LDD A;  1J9I A;  4KIG A;  1FBQ A;  5H20 A;  2EV5 A;  2DT5 A;  4Y13 A;  1ODD A;  3H3Z A;  2D1V A;  4Q5S F;  3E6D A;  3HUG A;  1W5T A;  3M9A A;  4CIC A;  5TJJ A;  3V7S A;  3LAP A;  4G9Y A;  2VT2 A;  4FX4 A;  3ZQ7 A;  2H94 A;  3ULQ B;  3WTY C;  5DUK A;  3HHH A;  3BOQ A;  1ZHF A;  2XAF A;  4KT5 C;  3E6M A;  3HRS A;  2VBY A;  3FF5 A;  4ESF A;  4HLY A;  2GAU A;  2EV0 A;  1RUO A;  2Z3Y A;  4LK0 F;  3ECH A;  4HV6 A;  3ABU A;  3P7N A;  5EEG A;  4XSX F;  5JI6 A;  3K1P A;  5ILV A;  2O6G E;  1TTY A;  2GWR A;  4RGX A;  2W24 A;  4M72 A;  1U6G A;  5LHI A;  1D3Y A;  3PQK A;  2DPU A;  3KFW X;  4CDG A;  1FSE A;  3S2W A;  1KU2 A;  2ZKZ A;  3V7R A;  4XRF A;  4M6X A;  1BIB A;  5ILS A;  1U5T C;  2VN2 A;  5HLI A;  3D5L A;  3R4K A;  3RJP A;  3F8N A;  4Q47 A;  3MQ0 A;  1U3E M;  1BBY A;  1P4X A;  5E1Z B;  2ESN A;  4ON0 A;  1XDU A;  4HQE A;  4WF2 A;  5ERI A;  2QZ8 A;  4HA8 A;  1SFE A;  5DCM B;  3ML6 A;  3RTR A;  4KN4 X;  2XAJ A;  2P6T A;  4TV7 A;  3GW2 A;  5LGT A;  5F64 A;  2EV6 A;  1G4D A;  5FFX A;  2PI0 A;  2FEZ A;  4BHB A;  4L9V A;  2V1D A;  3B02 A;  3SZT A;  2PFB A;  2J5O A;  1RNL A;  2VBX A;  1R58 A;  2DO7 A;  5D5W B;  2F2E A;  3BWG A;  4WXC A;  4GO1 A;  1JXS A;  5L3C A;  1QZY A;  3FWE A;  4MTE A;  1TQP A;  1OKR A;  1R1V A;  3F21 A;  5K5R A;  3MZY A;  4RGS A;  1PDN C;  4GXO A;  3CO7 C;  2ISZ A;  4U7B A;  4RB2 C;  5E18 F;  2O61 A;  5D5V B;  4MHG A;  4L5I A;  2DK5 A;  5JHU A;  4H0E A;  1HW2 A;  1BN5 A;  4NHJ A;  2BE5 F;  2QWW A;  3JAM K;  4RS8 A;  2L01 A;  4U88 A;  2MLK A;  1U5T A;  1KQ0 A;  3CUQ A;  4U7D A;  4RGU A;  4UUV A;  3I71 A;  4L18 B;  3DPL C;  2DBB A;  3PFI A;  3TOA A;  2GQQ A;  2K86 A;  1BC7 C;  4HF1 A;  2RNJ A;  2NYX A;  2CQK A;  3VOE A;  1FYM A;  1FYL A;  3J80 Z;  3LA3 A;  3FM5 A;  2YU3 A;  3KEQ A;  5LBQ A;  1T98 A;  1STZ A;  3L2C A;  2HYG D;  2UXX A;  1XMK A;  4IVN A;  1XCB A;  3M8F A;  4HDV A;  1QBJ A;  1XGS A;  4IF4 A;  3ISP A;  1P4A A;  3TOB A;  2DQR A;  4G7Z F;  1ZRD A;  3JTH A;  5K5Q A;  1LVA A;  2Z99 A;  1FOK A;  3K69 A;  5LRR A;  1KA8 A;  5E17 F;  3RKY A;  3TDU C;  2Q8K A;  2FF4 A;  4CYD A;  1ZG3 A;  1ZN2 A;  4S04 A;  3NQO A;  3HRT A;  1QZZ A;  1UHW A;  2NRA C;  4LGW A;  3CUO A;  1OR7 A;  3HSR A;  4ZYH A;  4JQF A;  3BJA A;  3VEP A;  5D5U B;  1IAW A;  1BI0 A;  3KET A;  5E1W A;  4OIQ F;  4PZJ A;  3ROU A;  3HRM A;  3I54 A;  2IW5 A;  2V1X A;  1HW5 A;  1Z6T A;  2WWY A;  3ZMT A;  2Z5U A;  1PP8 F;  1MDM A;  4IRH A;  2XIG A;  1UHM A;  5E20 A;  1YW7 A;  5D4S A;  1W7P A;  2X0L A;  1EH8 A;  3K9T A;  1KU7 A;  2Y48 A;  1YW8 A;  3ZN1 A;  4G7H F;  4M73 A;  3I5U A;  3SHF A;  4IHT A;  2Y75 A;  4M9X A;  1O3T A;  1SAX A;  4A6D A;  4MGR A;  1KYW A;  2STW A;  5BMZ A;  2P7C B;  1XGN A;  3RKW A;  3IHU A;  4KIC A;  2PQ8 A;  4CGZ A;  3L9F A;  3KEO A;  2DI3 A;  5DEQ A;  3WTS C;  5F6F A;  2R3S A;  3LFK A;  2XVC A;  4A0X A;  2BGC A;  4U0V A;  1ZRF A;  1Z1D A;  2KRF A;  3WGG A;  4CXF A;  1FLI A;  3FXR A;  4LG0 A;  1KU3 A;  3TO7 A;  2WV0 A;  4UVB A;  5IT9 Z;  2RDP A;  3QOP A;  2P5L C;  1BC8 C;  3RKX A;  3ZMV A;  2DU9 A;  1FBU A;  2JPC A;  4JBA A;  4Z2Y A;  5HLH A;  2ADU A;  4LB5 A;  2F5C A;  2XHK A;  2KIM A;  5CJ9 A;  1MD0 A;  1I1S A;  2GXB A;  2KKO A;  4G6D A;  1FYK A;  5LLQ A;  3IKV A;  2A6E F;  2XKP A;  2P5V A;  2O3F A;  5DCF A;  4I2O A;  1W7P D;  1F1Z A;  2YX4 A;  1TLH B;  3WTX C;  1YFH A;  2RKH A;  5ILU A;  4WWC A;  1UB9 A;  3E3V A;  1OYY A;  3LWF A;  3QPH A;  4GYG A;  3FMR A;  3I59 B;  1LEA A;  3V8K A;  4FT8 A;  2HKO A;  1BI2 A;  2TDX A;  3C1D A;  4ENN A;  4A2U A;  2IT0 A;  2A61 A;  2OBP A;  2QUF A;  3KZY A;  1KGS A;  5K5O A;  2D1H A;  4KYW A;  1J2X A;  1XD7 A;  5CYV A;  1DDN A;  3D0S A;  3IWF A;  3M8E A;  5DUI A;  2LF7 A;  3DF8 A;  1RIO H;  1TQM A;  3F8M A;  1FT9 A;  4UVC A;  4LB6 B;  2YPR A;  2DK8 A;  2DLL A;  3R61 A;  1OMI A;  2HYF A;  2GXG A;  4ZYD A;  3T5X A;  2EJR A;  1OYW A;  4E70 A;  5L3F A;  3GLX A;  3TQN A;  4M9S A;  1IZ1 A;  1UFM A;  4L0Y B;  5DD8 A;  1JE8 A;  1BM9 A;  2ZME A;  5FD6 A;  1IN5 A;  3EYI A;  4EM2 A;  2LDU A;  5E8G A;  4RAY A;  4L9T A;  4WCG A;  4RAZ A;  2L54 A;  1IUY A;  1E2X A;  2D45 A;  2GZW A;  1B9N A;  5FLX K;  1ZG5 A;  2W85 A;  3FX3 A;  5LHG A;  1LJ9 A;  2FBH A;  3P9C A;  3PQJ A;  4Q4Z F;  4BH9 A;  4ZYE A;  4XBF A;  4N0B A;  2O8X A;  3QAH A;  4RB0 A;  3R6S A;  1Z7U A;  2DQL A;  2W57 A;  3ZMZ A;  1ZGJ A;  2QBY A;  3CTA A;  3FMS A;  1JGS A;  3O2P E;  2GIV A;  4U0W A;  5J6X A;  2VOO A;  1B4A A;  3REO A;  3P9I A;  1IN4 A;  4DQ2 A;  2HOE A;  2XAG A;  2KJB A;  1WRJ A;  3ZN0 A;  2CW0 F;  4IPA A;  4NQW A;  3NRV A;  1X3U A;  1SD6 A;  4YII A;  3WTZ A;  3I0T A;  3F72 A;  3RPQ A;  4R79 A;  2RC4 A;  3HHG A;  3T8R A;  3F23 A;  5J8C A;  1AOY A;  1PP7 U;  1W4M A;  2VXZ A;  4ENJ A;  1R00 A;  2GA2 A;  2MA3 A;  1IW7 F;  4GCV A;  2AS5 F;  4HDU A;  3E6C C;  4EM0 B;  3ZPL A;  5D6E A;  4OU0 A;  4BYY A;  1QQI A;  3CLO A;  1O57 A;  1W5S A;  2UXN A;  2F5F A;  2HEO A;  1QO0 D;  1ZG1 A;  2P4W A;  4HX7 A;  3J7A O;  4EV0 A;  2IA1 A;  1WSU A;  1E17 A;  4UVA A;  1O3S A;  3K0L A;  4A12 A;  1PUE E;  2L4A A;  2HTJ A;  2ESH A;  3CUQ C;  5H6Q A;  2QYO A;  1KQ9 A;  4YFX F;  3RYR A;  5D8K B;  2IVM A;  5DD4 A;  4KDP A;  4DNC A;  2G7H A;  5A2Q Z;  5ICE A;  4ZZD A;  2M30 A;  4R8H A;  4UXN A;  2C6Y A;  3GFJ A;  5CVI A;  1S6L A;  5AIQ A;  1B9M A;  4UV8 A;  2M5W A;  2HQR A;  2COM A;  3GUD A;  3KP5 A;  4KUM A;  4EVI A;  5HDG A;  2JZY A;  1G6N A;  4IRG A;  3GF2 A;  3T8T A;  3BRO A;  1J5Y A;  4MQ9 F;  5LHH A;  3TGN A;  2STT A;  1TQI A;  2CGP A;  1SFX A;  1VTN C;  1K78 B;  2Q2E A;  2DTR A;  4FHT A;  5FD5 A;  1G3S A;  1Z6R A;  3CO6 C;  1NHA A;  2XV4 S;  3R60 A;  3J81 K;  1D8K A;  2HZT A;  4QLC U;  4HF2 A;  2PEX A;  4ESB A;  2P7V B;  2GA1 A;  2MD5 A;  1XSD A;  3U9G A;  3QPT A;  2V1U A;  1HKT A;  2ZCW A;  3WTT C;  5LGU A;  3GFI A;  2YSR A;  5IT3 A;  3FZV A;  1I6X A;  3DQV C;  3RYP A;  5FFZ A;  5BPI A;  1H9G A;  5ICG A;  4ASN A;  4OOI A;  4L5J A;  1S7O A;  2IJL A;  2M1B A;  1IRF A;  4KMF A;  2Q0O A;  2BV6 A;  1HBX G;  2ZFW A;  1IXS B;  1U5T B;  4NB5 A;  2R7D A;  1AWC A;  1Z9C A;  3V7C A;  3IC7 A;  4UHT A;  3DKW A;  5CVR A;  3MZH A;  4IRI A;  2VE9 A;  1Z05 A;  4I01 A;  1UCR A;  4EJV A;  2XRN A;  3FXQ A;  2OQG A;  5BOX A;  2D2W A;  2Z33 A;  1LDK B;  3E5Q A;  1KQ8 A;  1FPQ A;  4M74 A;  2CFX A;  4Y17 A;  2QQB A;  5FO5 A;  1IXC A;  1WQ2 A;  1IF1 A;  5BPD A;  4XSZ F;  1WI9 A;  4I98 B;  2EFN A;  1ULY A;  2K7L A;  3R0A A;  2FNP A;  3MWM A;  1F4K A;  2FNA A;  4L0Z B;  2B0L A;  2M87 A;  2HQN A;  2UZK A;  2VOD A;  3GYH X;  2NNN A;  2PLY A;  2EFW A;  1IN8 A;  1YYV A;  2A68 F;  1TNT A;  4KMU X;  3RPU A;  2DPD A;  2RV8 A;  4O3M A;  1V4R A;  2OZU A;  2NNY A;  1BOA A;  1RI7 A;  3HIF A;  4L9J A;  1YIO A;  2OD5 A;  3F3X A;  3LQR A;  4YG2 F;  4UV9 A;  3RDI A;  1J75 A;  4BHP A;  3MAJ A;  5HLG A;  1HKQ A;  1QNT A;  2XUB A;  1LDJ A;  1YQA A;  1DPU A;  4EMS A;  4G6Q A;  1ZH5 A;  5HDK A;  4M71 A;  1MDM B;  2PJP A;  1SMT A;  3QU6 A;  4I0B A;  3JW4 A;  4G7O F;  3C3W A;  4K2E A;  2XAS A;  3MFK A;  4I09 A;  4LD5 A;  3IWZ A;  2YR2 A;  4M6Y A;  4LFU A;  3O6B B;  5DDG A;  3E5U A;  3V8J A;  1K6O A;  3IRQ A;  1P2F A;  1K7A A;  1V3F A;  2F5D A;  1YW9 A;  3T1B A;  4B8X A;  3RIR A;  2CO5 A;  4ENK A;  4A0Z A;  1H0M A;  2W25 A;  4OIR F;  1ZYR F;  1FSH A;  3QP5 A;  4HF0 A;  3V4G A;  1J7K A;  3E5X A;  1FWZ A;  2W84 A;  3B73 A;  1FC3 A;  2LF8 A;  3WE3 A;  2R7F A;  2FU4 A;  4ENM A;  3H3U A;  4HQM A;  1ZRE A;  4LG0 B;  2VBZ A;  4RB3 C;  1FZP B;  1S7A A;  1QPM A;  1T38 A;  4KIB A;  4PGG A;  5JVT A;  1FBS A;  2QVO A;  1XDS A;  2IP2 A;  2WTE A;  2AXL A;  5JR3 A;  4GGG A;  1XCV A;  3FXU A;  5HS8 A;  4HW0 A;  3F6O A;  1CF7 B;  1GXQ A;  3I59 A;  4HX4 A;  2BBY A;  3WG9 A;  4HV5 A;  1R1U A;  1REP C;  1RUN A;  2IPQ X;  3ZMD A;  5L3G A;  3WTV C;  2H6B A;  5TRD A;  3DPT A;  5FGM A;  3LAJ A;  4KFC A;  1MGT A;  4G8X A;  5LGN A;  4AIH A;  3KE2 A;  1WWX A;  2E1N A;  4IHS A;  2G9W A;  3ZMU A;  1KYZ A;  4U0Y A;  3DXJ F;  3ERE D;  3GEZ A;  3CJN A;  1XGM A;  3OV8 A;  4P9U A;  1CGP A;  2VC1 A;  5LEJ A;  2LNB A;  3HTU A;  4P5O A;  4MTD A;  2HWV A;  1YLF A;  3JAM Z;  5AIP A;  2ZXJ A;  5D6F A;  2CYY A;  3J80 K;  1XB4 A;  1B1B A;  4OIN F;  4HOB A;  1U8R A;  1JHH A;  1USS A;  3KZZ A;  4BHC A;  5E8I A;  2HFH A;  2P6S A;  3BP8 A;  3GX4 X;  1BJA A;  4WK8 F;  1OPC A;  2FA5 A;  4LLL A;  4BAY A;  1FNN A;  3F8F A;  1YTY A;  2OAZ A;  1ZRC A;  3M1E A;  4LLG F;  3SQN A; 
#chains in the Genus database with same CATH topology
 2FE3 A;  4BKX A;  2CRG A;  5BS6 A;  1D1A A;  2DOA A;  1P7I A;  5H6R A;  4HAM A;  1SD4 A;  4ZZL A;  4XK4 A;  5B1B H;  4C2U A;  4FTH A;  1ETY A;  5EDN A;  1MSE C;  1P92 A;  3AL0 C;  4C3H J;  2A6T A;  1ON2 A;  1YJW I;  2FQ4 A;  3BZ6 A;  1DP7 P;  2VQL A;  4CCM A;  3FBN B;  2PMZ N;  1WI3 A;  3P5J A;  5GP9 A;  4S0H B;  3WGI A;  2X48 A;  3LSJ A;  4ZYG A;  4AM3 A;  5KK1 A;  3GTJ J;  3WTU C;  2HOT A;  1R7J A;  3GFM A;  2RQQ A;  1Y0U A;  2XGC A;  2JT1 A;  1D0Y A;  1MKM A;  2IRF G;  2EFO A;  3QQA A;  2JWT A;  1QZE A;  3OYM A;  2Y69 H;  2G7U A;  1P4W A;  2QBY B;  4KNY A;  1SD5 A;  3FHN A;  3P9K A;  4IQ4 A;  4PDK A;  2CWE A;  1OYI A;  4XKB A;  2P8T A;  3ABT A;  2OF7 A;  1R5I D;  2PMH A;  2FUG 2;  3L09 A;  5K1Y A;  4A3G J;  2VPL A;  1JT0 A;  4EJU A;  3WTW C;  5HVQ C;  5EEA A;  2EZK A;  2L3D A;  3F8C A;  1BI1 A;  3HUG B;  1IV8 A;  2OTL I;  1U78 A;  2A69 F;  1OFC X;  2MSY A;  5K7F A;  1O3R A;  4BU2 A;  1IRG A;  2JTV A;  3R0J A;  3WOD F;  3JRD A;  3BG3 A;  2KIF A;  4A5M A;  3ZQF A;  3EDP A;  4NQW B;  3A01 B;  3Q9S A;  1P7J A;  1I1G A;  3I4N J;  2ZXH A;  4CSW A;  1WKM A;  1HW1 A;  1AHD P;  1SMY F;  2EB7 A;  1FMW A;  4I02 A;  3TL4 X;  3HRU A;  1ZGW A;  5J3L A;  2V9K A;  2HQ5 A;  2ZNZ A;  2Y0S A;  1MMN A;  2LY2 A;  3WHB A;  3KLN A;  2EWN A;  3MVP A;  4EGY A;  4C2M J;  3PO2 J;  1FTZ A;  3OS0 A;  2Y2Z A;  4QWQ A;  3BCB A;  2DA5 A;  2DW4 A;  5FKN A;  1JJ8 C;  4XRS A;  1QGP A;  5EG0 A;  3WU0 A;  1QVU A;  2YU9 J;  3HXL A;  2QQA A;  2ZNY A;  4D9J A;  2EFP A;  3TO6 A;  2VJJ A;  2QSH X;  3D5R C;  4RDU A;  4MEY F;  2W7N A;  1DQU A;  1UG0 A;  3F8B A;  5J1U A;  1GHC A;  3TKY A;  1XSV A;  2NVU B;  3S2D J;  2MH9 A;  2E1M C;  3EUH A;  3H36 A;  1I27 A;  3U1D A;  2EIJ H;  2CMP A;  2LKP A;  3PUB A;  5CLS A;  2DA6 A;  4Q48 A;  3K2Z A;  5HS9 A;  4JX4 A;  3GXO A;  1S7E A;  3GTO J;  2HKX A;  3G71 I;  3Q5F A;  2EIK H;  3I56 I;  4O6J A;  2GOX B;  1GVJ A;  2I8D A;  1LFU P;  5DCM A;  1G3Y A;  1R22 A;  4MNU A;  2R7V A;  2ETH A;  5H2F C;  3TO9 A;  5D4R A;  2MC3 A;  2A5W A;  5IT9 K;  2JPB A;  2M45 A;  4FET A;  1R4M B;  4FQG A;  5IYB J;  3NWT A;  3E6B A;  3A02 A;  4A93 J;  2BVM A;  2L4M A;  2HS5 A;  2WB1 A;  3SFZ A;  1XGO A;  3FXJ A;  2X6W A;  1N77 A;  4E7Z A;  1IC8 A;  4UB6 C;  1MMA A;  1C0W A;  5LD2 C;  3CDH A;  3M7G A;  1YRN B;  1E3O C;  2KZV A;  2V9V A;  2FQ3 A;  1B72 B;  4UNO A;  3S17 J;  2X9D A;  2PJR B;  3JSP A;  1XMA A;  3E97 A;  4A3K J;  3KX2 A;  2HVR A;  4KIF A;  2K5C A;  3I58 A;  1BR4 A;  1TL8 A;  2F4O B;  2BY0 A;  1Z91 A;  2KJC A;  4RA2 A;  1BW5 A;  3HOX J;  1T6S A;  2JJ7 A;  5HOO A;  3F22 A;  1MMG A;  2HOA A;  2JVG A;  2V79 A;  1U2W A;  2XAQ A;  3I53 A;  4HX8 A;  3L7W A;  4X0G A;  1BW6 A;  1Q1V A;  1V54 H;  3M3Y J;  5CVJ A;  4BJ6 C;  4BXU A;  3IRR A;  1JUS A;  2R93 J;  2CH0 A;  4XLP F;  3WU2 C;  1EH7 A;  1QPI A;  1KU9 A;  1B6A A;  3MCZ A;  4NC6 A;  3COA C;  2Q1Z B;  1HQC A;  1K78 A;  3BPV A;  4NUB A;  4P96 A;  3CCJ I;  4XON A;  1SD7 A;  2ELH A;  1PUF B;  1DGW Y;  3W6K B;  4GFB A;  3IKT A;  1R1T A;  3SXY A;  2K02 A;  1IRX A;  3DEU A;  2CQN A;  3EUA A;  3U21 A;  5JLW A;  1YI2 I;  1MJB A;  1ZLK A;  1JKP C;  3G73 A;  1TNS A;  3OYE A;  2VL8 A;  2XAH A;  3KEY A;  1MND A;  3S8P A;  1JHF A;  2M0C A;  5HS7 A;  1J59 A;  2NVT J;  4D0P A;  2E1C A;  4IXA A;  1D8J A;  5FKK A;  2DFI A;  5GAG J;  3FMQ A;  1WH7 A;  5J1Y A;  2M8E A;  2L9R A;  2XGD A;  3VOD A;  2H6C A;  3DTI A;  3H5A A;  5C44 J;  2FML A;  4HLX A;  2Q2E B;  2BOL A;  3HTS B;  5M5X J;  2O0Y A;  4BQN A;  2Y31 A;  3ELK A;  1YS6 A;  3MKL A;  1Y6I A;  3U2R A;  3QP6 A;  3CCU I;  2AHQ A;  3QU3 A;  1XN7 A;  4CZC A;  1K79 A;  2A5Y B;  1J0R A;  3QYE A;  3TW6 A;  3DBL B;  5F1R A;  2F5V A;  5J4Y A;  4BBS J;  2EA4 A;  2FMY A;  3C18 A;  1D5V A;  3HOT A;  2YS9 A;  4A3L J;  3OIP A;  2HGC A;  3A2K A;  2AO9 A;  2M2E A;  2KRH A;  1IXR C;  1VQN I;  3RI4 A;  3S3M A;  4XOT A;  3G3Z A;  3RKQ A;  3G1M A;  5TIS C;  3JSO A;  2MH2 A;  3BPX A;  4B3X A;  3LA7 A;  1XC5 A;  2DMN A;  1HCR A;  4ZH4 F;  3ONQ A;  2I5U A;  1T39 A;  5FB2 A;  1UST A;  4IHW A;  4OMY A;  2XPV A;  3S2H J;  1E0E A;  3K10 A;  2A6H F;  3KP2 A;  2DFH A;  2KIU A;  3FIS A;  4I7H A;  3DV8 A;  1HLV A;  1LFB A;  1ONV A;  1G8X A;  4IJA A;  4LMY A;  2LYC A;  3HYI A;  9ANT A;  2X6O A;  3RZO J;  4PJ0 C;  3BJ6 A;  4JK1 X;  4AUX A;  1TP4 A;  3CUQ B;  2CSO A;  4BQA A;  1I3A A;  3KP7 A;  1W36 C;  1XS9 A;  3H92 A;  5DV5 A;  3DBR B;  3MEX A;  1EJ9 A;  3N97 A;  3CCQ I;  4N4N B;  1ZAO A;  4E6K G;  2R7X A;  2PG4 A;  2RVC A;  4C3J J;  1I3Q J;  2G0E A;  1VF9 A;  2ZO4 A;  1OJL A;  3PIO F;  4PGH A;  3CLQ A;  2QQ9 A;  3AFH A;  4GYI A;  4WXH A;  4AIK A;  3GVA A;  3OOP A;  3EYY A;  4HZF A;  4BUP A;  4EJT A;  1LEB A;  4AD9 A;  3Q0W A;  2Y0M A;  5M5Y J;  4BE1 A;  3HB9 A;  5CVU A;  2AQF A;  2HR3 A;  4EGZ A;  2CUJ A;  1M1E B;  4N4O B;  2VI6 A;  2DFE A;  4D7M A;  2L02 A;  1EH6 A;  4OMZ A;  1R36 A;  2XGX A;  3G1O A;  4A5N A;  3MN2 A;  2R0Q C;  2HDC A;  3HSF A;  4PJM A;  2VPR A;  5B1A H;  3SEZ A;  4WX9 A;  4EJW A;  5ICC A;  2BW3 A;  1L3L A;  1T56 A;  3TW7 A;  2NAZ A;  2VT3 A;  5D8L B;  5FLX Z;  3K1M A;  4ZTF A;  1F5T A;  4HYE A;  4Y4R A;  2QLZ A;  4DYR A;  2JSP A;  4AWX B;  4BGD A;  1X1P A;  1QVT A;  4BEH B;  3EET A;  2K3P A;  4CZZ A;  3TP0 A;  2K27 A;  3BCA A;  3I4P A;  3S14 J;  2XKO A;  2WY8 Q;  4E4H A;  3G2B A;  4HBL A;  3L1P A;  4BNC A;  2LBF B;  1TW2 A;  3BY6 A;  2DOE A;  3HSE A;  2VON A;  4YIF A;  2KP6 A;  4XID A;  5EEH A;  4L9N A;  3TDZ C;  3HGG A;  3T0Y A;  4F91 B;  1TW3 A;  1HC8 A;  1APL C;  2B7E A;  2V6C A;  4ESJ A;  2QGU A;  2IS6 A;  3IV5 A;  3H0D A;  2DTZ A;  4NBQ A;  1QHH D;  3BJO A;  2EK5 A;  3K4M A;  2E7X A;  1A04 A;  4DOZ A;  4DJA A;  3CD6 I;  3N4M A;  2FSW A;  2VC0 A;  3GFL A;  2FBK A;  2O03 A;  4HG2 A;  4RB1 A;  2UWM A;  4N9H A;  3HOU J;  1ETQ A;  2LP0 A;  2J5P A;  4F3Q A;  2H27 A;  4E7S A;  2A3S A;  2R5Y B;  2NVQ J;  3RQI A;  3OYA A;  3KP4 A;  3HOV J;  3LQQ A;  2LSO A;  3OR2 C;  2XRO A;  2DA7 A;  4EEF G;  4EQQ A;  1XSX A;  2XAU A;  1ZTR A;  3OYK A;  3GZ6 A;  1VQK I;  1Z3Y A;  3GBG A;  3FK7 A;  5JFR A;  2VOP A;  1F9N A;  2VQG A;  4LJZ F;  3L2U A;  1S8N A;  1HXD A;  2EFQ A;  3VDX A;  3WU1 B;  1SFU A;  4J01 A;  4XOR A;  1B59 A;  1FP1 D;  1H88 C;  3OWT A;  5LRS A;  3OYF A;  1LNW A;  3DEW A;  3ECO A;  1LUJ B;  1RZ4 A;  4PJN A;  2COB A;  2FXA A;  2LVS A;  3EPZ A;  3NEU A;  3Q9V A;  3SZP A;  3EQL F;  4RLQ A;  1VQL I;  1TBX A;  1E3P A;  1ZEL A;  3DWL E;  1G59 A;  4B09 A;  1Q1H A;  5JVG F;  5ED4 A;  2PMZ A;  2MLG A;  3PM1 A;  4EM1 A;  1W7P B;  3ZQL A;  2M7B A;  1FY7 A;  2RN7 A;  1R23 A;  4WXD A;  4A6E A;  1OCR H;  4C3I J;  2KMU A;  2CG4 A;  3LST A;  1EKE A;  3IH2 A;  3WE2 A;  2RGV A;  1D1B A;  3VB2 A;  1X1A A;  2Y9Y A;  2NS0 A;  4HPQ A;  4YFN F;  2DMP A;  1LKX A;  4DZP A;  5GPA A;  2ZBK A;  1XPX A;  1J09 A;  5A2Q K;  2OCE A;  3I4M J;  3ZQQ A;  4RMN A;  5DYM A;  2E7W A;  4A69 C;  4XKC A;  4A3J J;  2YX7 A;  1SEU A;  3QRF F;  2M3A A;  4YFK F;  3GO5 A;  5KVR A;  3K4K A;  2F5E A;  3ZXS A;  2FJ1 A;  3DP7 A;  2BEO A;  3OYB A;  1WJ5 A;  3BR6 A;  4KN7 X;  1LVK A;  5GAE J;  2E2J J;  2RQP A;  4OIO F;  4DZJ A;  2XF7 A;  4IOA F;  5HDN A;  2X4H A;  5L3D A;  3L2W A;  2R7R A;  1HST A;  3KLO A;  3LA2 A;  1Y0N A;  2EPF A;  2CFO A;  2R5Z A;  2P5K A;  4BQQ A;  2GXA A;  4AVP A;  2FBI A;  1ACI A;  5CQG A;  1QA6 A;  4QPO A;  2WBM A;  1DPR A;  1G3W A;  3IAS 2;  1R71 A;  2MBF A;  1L0O C;  4D1Q A;  1FOY A;  4AYB A;  2BYV E;  1IO2 A;  2DMQ A;  3ZMS A;  4QSH A;  1GXP A;  4XLC A;  4R1H A;  3OYI A;  3H3V K;  1G3T A;  1LE8 B;  2OC6 A;  4AID A;  1UG2 A;  3HM5 A;  1IN7 A;  1HKS A;  2HQA A;  1HSJ A;  4CHU A;  3W6V A;  1MNM C;  1YS7 A;  3C7J A;  2FOK A;  3L00 A;  2R7Q A;  5B3S H;  1CF7 A;  1YJN I;  5HLT A;  1I5Z A;  6PAX A;  4M9Z A;  1I50 J;  2PMU A;  2JK3 A;  4CO8 A;  5LEK A;  4P9F A;  2EA2 A;  2LRE A;  5KCM A;  2P81 A;  2ZJ2 A;  2ACJ A;  3K6G A;  2B63 J;  4F55 A;  3GWZ A;  1N78 A;  2X1C A;  1MZB A;  4LLN A;  2BHY A;  1VQ4 I;  2E19 A;  1Y1W J;  3JRH A;  1H9T A;  3BR1 A;  4OIP F;  4RGR A;  3K4C A;  1O7L A;  4Y15 A;  1W36 D;  2JRT A;  1SVO A;  5BQT A;  1K61 A;  4B43 A;  4G12 A;  1FP2 A;  1R5H A;  1O7F A;  2ISY A;  1A6Q A;  1OCC H;  1MH3 A;  3ESW B;  2M34 A;  1IN6 A;  4II3 A;  2PN6 A;  3HOS A;  1BL0 A;  3BDD A;  2CV2 A;  4H4K C;  2P0W A;  1T0F A;  3KZI C;  3J81 Z;  4S05 A;  1S29 A;  2VQC A;  2K4B A;  1ZGA A;  5L3B A;  4UUS B;  1ON1 A;  5BNG A;  4HEA 2;  2HZD A;  1ZLJ A;  3F6V A;  5AON A;  1DUX C;  1BA5 A;  3O3K A;  4XLN F;  1Z21 A;  1X2N A;  3WGH A;  3UR3 C;  3VFZ A;  1RPW A;  4B48 A;  1O3Q A;  2PBI A;  1UZC A;  3GZ5 A;  3PNV A;  2OA4 A;  2K40 A;  2LFB A;  3IL2 A;  4FCY A;  4RM2 A;  1R9T J;  4JX6 A;  4II2 A;  1RR8 C;  2LC2 A;  4LK1 F;  2BVL A;  1AKH B;  2H1K A;  3OY9 A;  1RKT A;  5J8F A;  2R92 J;  1ZAR A;  2HXI A;  2WAF A;  3LSP A;  2QM3 A;  4MQV A;  3ZP5 A;  1YG2 A;  4G94 A;  3V8L A;  3AAF A;  1LPQ A;  2L7K A;  1LQ1 A;  1BI3 A;  2HTS A;  4MEX F;  2OU2 A;  3BZK A;  3ZCO A;  1Y39 A;  4C2T A;  4F7Z A;  2JSC A;  5F04 A;  5ICF A;  1P6R A;  1B8I B;  1HOM A;  1RR7 A;  3CJQ B;  4A0Y A;  1ITY A;  1MBK A;  2H09 A;  1FIA A;  1MJ9 A;  1S3J A;  2VE8 A;  5D5X B;  2QEN A;  3KP6 A;  3W6J B;  4AVZ A;  4ETS A;  4XL9 A;  4MFE A;  5FRO A;  1F43 A;  4OAY A;  4CCJ A;  3I64 A;  3LSK A;  3GLL A;  4MIM A;  1R5G A;  4AIJ A;  2L9V A;  3DFG A;  2DAO A;  2HOS A;  3JTG A;  1R6R A;  2WC2 A;  2Z9O A;  4FX0 A;  2HPI A;  3MKW B;  5K7H A;  2LY9 A;  2ZME B;  3A4C A;  4BXF A;  3KP3 A;  1BIA A;  2R7W A;  1LB2 A;  1D5Y A;  3DPU A;  3J7Z I;  4O5V A;  3CCM I;  4DYC A;  2K85 A;  1T33 A;  1X19 A;  4CCN A;  3K1N A;  1Z0X A;  2L7F P;  4PCQ A;  1EV7 A;  5L3E A;  5EGO B;  4A3B J;  4I0A A;  4JYK A;  1U8B A;  1R49 A;  1SFK A;  3HZJ A;  4JP0 A;  3LSR A;  3KIO A;  3PFY A;  1YO5 C;  2EZL A;  1MJA A;  2A07 F;  4N9I A;  5CVV A;  3KCC A;  1IJW C;  3S3N A;  2VBW A;  3FM3 A;  3K70 D;  1XX5 A;  1QRY A;  2FRH A;  5E3M A;  4EJO A;  3FHZ A;  2D5V A;  4IKF A;  2IA0 A;  4P55 A;  3CCS I;  2IA2 A;  1YOV B;  4KA4 A;  4DBR A;  2XC7 A;  5E1X A;  1FX7 A;  2OQR A;  2OZ6 A;  2K4J A;  1YIT I;  1LDD A;  1T2K A;  1J9I A;  2KIS A;  4KIG A;  4CA0 A;  2XB5 A;  1FBQ A;  5H20 A;  2K9N A;  2EV5 A;  2DT5 A;  4Y13 A;  2QKL B;  1ODD A;  3H3Z A;  2D1V A;  4Q5S F;  3E6D A;  3HUG A;  4IHX A;  2M0M A;  2XPU A;  1W5T A;  4YIR X;  3M9A A;  1IDY A;  1YE9 A;  3HKZ N;  1VQ7 I;  4CIC A;  3CCY A;  4XLA A;  5TJJ A;  3BQZ A;  3V7S A;  4ZDL A;  3LAP A;  3A01 A;  1FOX A;  4G9Y A;  2VT2 A;  3QOE A;  3K2A A;  5B5E C;  4FX4 A;  1RC9 A;  3ZQ7 A;  3B6C A;  4RBO A;  2H94 A;  4X6A J;  3ULQ B;  3JRF A;  3WTY C;  4CCL A;  2WAD A;  5DUK A;  3HHH A;  4UB8 C;  4B47 A;  3BOQ A;  4XMY A;  1ZHF A;  3ZR8 X;  1WGX A;  1GVD A;  1IG7 A;  3BR2 A;  2XAF A;  4KT5 C;  3E6M A;  3HRS A;  3HOW J;  3JRE A;  2VBY A;  3O8H A;  3FF5 A;  2DOF A;  4ESF A;  2JUG A;  2GAU A;  4HLY A;  2EV0 A;  4J19 A;  1RUO A;  2OUM A;  2Z3Y A;  3FXL A;  3B6A A;  4D7N A;  4E7K A;  4LK0 F;  4D5F A;  2F4I A;  1RET A;  3ECH A;  4HV6 A;  2KRC A;  3ABU A;  5C4X J;  4RAG A;  3P7N A;  5EEG A;  4FE4 A;  4XSX F;  5JI6 A;  3K1P A;  4XRS G;  1JKO C;  5ILV A;  1VQ8 I;  2O6G E;  3QOD A;  1TTY A;  3OL4 A;  3BR0 A;  4V2F A;  4HRI A;  2GWR A;  4PFP A;  4RGX A;  3HG9 A;  2W24 A;  2H8R A;  2KZG A;  4M72 A;  1U6G A;  5LHI A;  1D3Y A;  2BY1 A;  3PQK A;  4M3E A;  2DPU A;  2QSF X;  3HDD A;  5M3M J;  3VSK A;  3K4B A;  4KT6 A;  2HDD A;  3KFW X;  4CDG A;  4BBR J;  1FSE A;  2JA5 J;  1HA8 A;  3S2W A;  1KU2 A;  2ZKZ A;  3V7R A;  4XRF A;  4M6X A;  4CYC B;  1BIB A;  2DCE A;  5ILS A;  3HPH A;  5IPA A;  2ME0 A;  3G1L A;  4J00 A;  1U5T C;  2VN2 A;  5HLI A;  2E36 A;  3A03 A;  3D5L A;  2E5Z A;  3R4K A;  3I9V 2;  3RJP A;  3F8N A;  4Q47 A;  3MKY B;  3MQ0 A;  4U87 A;  1U3E M;  1BBY A;  2XDV A;  1P4X A;  5E1Z B;  5DTD A;  2ESN A;  3U1K A;  3J7A Y;  1VQO I;  3G4S I;  2EZH A;  4ON0 A;  1XDU A;  1B72 A;  4HQE A;  2PJR A;  4WF2 A;  5ERI A;  3ZQC A;  2QZ8 A;  4HA8 A;  1T8I A;  1SFE A;  5DCM B;  3S1R J;  1WCM J;  3ML6 A;  3HGY A;  3S3O A;  4GDF A;  3L2R A;  3AL0 B;  3RTR A;  1F36 A;  4KN4 X;  1MMD A;  4P1W A;  2XAJ A;  2P6T A;  4TV7 A;  3GW2 A;  4FAS D;  2DJI A;  5LGT A;  5F64 A;  2EV6 A;  2UV1 A;  1G4D A;  5FFX A;  2GM4 A;  4MO7 A;  3W2W A;  4ZJZ A;  2JA8 J;  2PI0 A;  2FEZ A;  4NC8 A;  4X1E A;  2BXZ A;  1UHS A;  3PSF A;  4BHB A;  4RLF A;  4L9V A;  2V1D A;  3B02 A;  4D5C A;  3SZT A;  2PFB A;  2O8K A;  2J5O A;  1RNL A;  2VBX A;  1R58 A;  3OYC A;  2B9S A;  2DO7 A;  5D5W B;  1X4P A;  2F2E A;  5J4V A;  3BG9 A;  3BWG A;  1A6I A;  4WXC A;  3GME A;  4GO1 A;  1TT0 A;  2CUE A;  1JXS A;  3E7L A;  4NDL A;  5L3C A;  1QZY A;  3FWE A;  4MTE A;  1MH4 A;  1TQP A;  1OKR A;  1R1V A;  1WHU A;  3PNT A;  3MKZ A;  5EZG A;  2EH3 A;  3IUO A;  3F21 A;  2E35 A;  4IX7 A;  5K5R A;  2L2O A;  3PNY A;  3NAR A;  5F0H A;  3FXO A;  2X1D A;  3A0H C;  3MZY A;  3C2B A;  4RGS A;  3L2Q A;  1VQ6 I;  2OPT A;  1HDD C;  2ZFU A;  1PDN C;  4GXO A;  3CO7 C;  2ISZ A;  3KPH A;  3JR9 A;  4U7B A;  1RKW A;  4RB2 C;  1I6H J;  5E18 F;  2O61 A;  5D5V B;  4MHG A;  4L5I A;  2DK5 A;  5JHU A;  2RNG A;  3SYT A;  4H0E A;  2L0K A;  1HW2 A;  1BN5 A;  2CS3 A;  4NHJ A;  4XQF A;  2DFF A;  2BE5 F;  1GUU A;  4QTR A;  2MFZ A;  2QWW A;  3JAM K;  4RS8 A;  4BL0 B;  2L01 A;  4U88 A;  3VYU B;  1D0X A;  2MLK A;  3IAM 2;  2EZI A;  2JRM A;  1U5T A;  1X1C A;  1XG1 A;  1KQ0 A;  3FK6 A;  3CUQ A;  4U7D A;  2HI3 A;  4RGU A;  4RM3 A;  4UUV A;  5IY5 H;  2E1M B;  2NVY J;  3I71 A;  4L18 B;  3DKX A;  2ECC A;  4UY8 I;  4IL6 C;  2ZSI B;  3DPL C;  2DBB A;  2W4S A;  3PFI A;  3TOA A;  3VWB A;  2GQQ A;  4CUG A;  2K86 A;  4LIV A;  4XNF A;  2W48 A;  1BC7 C;  2CUZ A;  4HF1 A;  1IDZ A;  2RNJ A;  2X6X A;  1G2H A;  2KFD A;  2NYX A;  3Q3S A;  2CQK A;  3VOE A;  2E71 A;  1FYM A;  3M07 A;  1FYL A;  3J80 Z;  2IAI A;  3LA3 A;  3FM5 A;  1GLN A;  2YU3 A;  3CJT B;  5GAH J;  1A31 A;  3KEQ A;  5LBQ A;  1D1C A;  1T98 A;  1STZ A;  1BOB A;  3L2C A;  3NWS A;  2HYG D;  2UXX A;  1MIJ A;  1ETO A;  1VI0 A;  2CQ7 A;  3KYD B;  1XMK A;  4IVN A;  2IGN A;  4MLO A;  1DU6 A;  1XCB A;  3M8F A;  2IGO A;  3N05 A;  1TWA J;  4HDV A;  1QBJ A;  2QEX I;  1XGS A;  4IF4 A;  5J1R A;  3EUK L;  2K3F A;  3ISP A;  1N75 A;  4BEH A;  1P4A A;  3TOB A;  2DQR A;  2LH9 A;  1JGG A;  4G7Z F;  1ZRD A;  3JTH A;  5KAI C;  5K5Q A;  1LVA A;  2W1O A;  1OCT C;  2JQ7 A;  1TWF J;  2Z99 A;  2HVS A;  1FOK A;  2VAS A;  3K69 A;  2E60 A;  5FLV A;  5LRR A;  1P9Q C;  1KA8 A;  5E17 F;  3RKY A;  3F9K A;  2ID3 A;  3OIQ A;  3TDU C;  4B4C A;  4RAF A;  2XB0 X;  3BT9 A;  4QIW N;  4ITV A;  1ZK8 A;  2BW3 B;  2Q8K A;  2FF4 A;  4CYD A;  4DYQ A;  1TWG J;  4ZC3 A;  4BS9 A;  1ZG3 A;  1ZN2 A;  4S04 A;  3NQO A;  4BAC A;  3HRT A;  1QZZ A;  4F92 B;  1UHW A;  1V5E A;  2R5Y A;  2NRA C;  4LGW A;  1WJA A;  1OR7 A;  3CUO A;  3HSR A;  2DMT A;  3TP3 A;  4ZYH A;  2LKX A;  2VKV A;  4JQF A;  2EQR A;  2OCC H;  2L7M P;  1WVR A;  3BJA A;  3AG1 H;  3TBI A;  3VEP A;  5D5U B;  1IAW A;  1BI0 A;  3KET A;  2M8G X;  5E1W A;  1MBH A;  3FDY A;  3K4N A;  4PZJ A;  4OIQ F;  3ROU A;  3HRM A;  3I54 A;  2IW5 A;  2V1X A;  1HW5 A;  3QPL A;  1Z6T A;  2LKS A;  4KJZ A;  3MZ8 A;  3JRI A;  2WWY A;  3ZMT A;  3RSN A;  2Z5U A;  1Y56 A;  4AU7 A;  1PP8 F;  1MDM A;  3HL2 A;  4IRH A;  3CQZ J;  1FJL A;  2XIG A;  1UHM A;  3JRB A;  1XMX A;  3K70 C;  3CDI A;  3RZD J;  2LMD A;  4XRM A;  1Z67 A;  4IHV A;  5E20 A;  5IP9 J;  1YW7 A;  5D4S A;  1JTX A;  1W7P A;  4Y52 J;  2V26 A;  2WB1 N;  4ZDP A;  2L9N A;  2X0L A;  1T0F C;  1EH8 A;  3K9T A;  1KU7 A;  2FOW A;  2DT7 B;  2Y48 A;  3F0C A;  4CCO A;  1YW8 A;  3ZN1 A;  4G7H F;  4M73 A;  3I5U A;  3SHF A;  4V2G A;  3ASN H;  4IHT A;  5E79 C;  2Y75 A;  4M9X A;  4ABZ A;  1O3T A;  1SAX A;  4A6D A;  4MGR A;  2A05 A;  5JHF A;  2JVH A;  1KYW A;  2STW A;  5BMZ A;  2P7C B;  1XGN A;  3RKW A;  2ZJP F;  1QHG A;  3IHU A;  4KIC A;  2PQ8 A;  2KDO A;  4HST A;  4CGZ A;  4DW6 A;  1ZR4 A;  3L9F A;  3KEO A;  2DI3 A;  2HPM A;  1JKQ C;  1VQ9 I;  2EIN H;  1WPK A;  5K7Z A;  4UUT A;  5DEQ A;  3WTS C;  1WJE A;  5F6F A;  5E3O A;  2R3S A;  3LFK A;  2XVC A;  1XTA A;  4A0X A;  1W1W E;  3CMM A;  5EJC A;  2BGC A;  2KL4 A;  4U0V A;  3CC4 I;  1ZRF A;  1Z1D A;  2KRF A;  3WGG A;  4CXF A;  1UMQ A;  3MMY B;  5IYD J;  3BG7 A;  3FXR A;  4LG0 A;  1FLI A;  1KU3 A;  3TO7 A;  4M6V A;  2WV0 A;  4UVB A;  2UUZ A;  5IT9 Z;  1EA3 A;  2RDP A;  3QOP A;  1GV2 A;  2P5L C;  1BC8 C;  3OSF A;  4Y33 A;  3RKX A;  2R7S A;  1ERD A;  4B1R A;  3ZMV A;  1D0Z A;  5J47 A;  2DU9 A;  1FBU A;  2JPC A;  1U0J A;  3GCM A;  1LE8 A;  4JBA A;  4Z2Y A;  1MBF A;  5HLH A;  2ADU A;  2K9S A;  2MW8 A;  4LB5 A;  2F5C A;  3S1Q J;  2XHK A;  4XN3 A;  1MSF C;  2KIM A;  2LRD A;  5CJ9 A;  1MD0 A;  3LSI A;  2GXB A;  1BR1 A;  1VND A;  2KKO A;  4G6D A;  1FYK A;  1I1S A;  5LLQ A;  3IKV A;  2A6E F;  2HU9 A;  3CF5 F;  2XKP A;  1W0U A;  2P5V A;  4ZDO A;  2O3F A;  2VIX A;  2Z16 A;  3C2H A;  4OAZ A;  5DM6 F;  2E1O A;  2DA1 A;  2M4K A;  1MBJ A;  5DCF A;  4PJJ A;  4I2O A;  3VSL A;  3GZN B;  1W7P D;  2OTJ I;  1F1Z A;  4C9Y A;  5TGT A;  1MW7 A;  1TLH B;  2YX4 A;  3V42 A;  2NS8 A;  4C30 A;  5FRM A;  3WTX C;  1YFH A;  2RKH A;  5ILU A;  1W0T A;  1TWC J;  2JMW A;  2V7F A;  4WWC A;  1TZL A;  1UB9 A;  1OYY A;  3E3V A;  3LWF A;  1VFC A;  3QPH A;  4GYG A;  2M4G A;  2N8G A;  2RRE A;  3FMR A;  3I59 B;  3HEF A;  2DA4 A;  1X3W B;  2DT6 A;  4A3D J;  3VYT B;  2VKH A;  3CF2 A;  4UUS A;  1LEA A;  4BDY A;  3H5N A;  4FT8 A;  3V8K A;  4F93 B;  2HKO A;  2F4M B;  1BI2 A;  2TDX A;  3BTJ A;  2X6Y A;  3C1D A;  4LG3 A;  4A2U A;  4ENN A;  2IT0 A;  2A61 A;  2IS4 A;  3DKY A;  2OBP A;  2QUF A;  3KZY A;  2E2H J;  3CCL I;  1OCZ H;  1KGS A;  1YX3 A;  4OWR B;  5K5O A;  2D1H A;  2ECB A;  3L2V A;  4DIQ A;  2FX0 A;  4KYW A;  1J2X A;  1XD7 A;  4IO9 F;  5CYV A;  1WFX A;  3RQ4 A;  1UEL B;  2QKM B;  3ABM H;  1DDN A;  3D0S A;  3IWF A;  3M8E A;  1AKH A;  2XF5 A;  5DUI A;  4NNJ A;  3S16 J;  3PL8 A;  2LF7 A;  3DTK A;  1H8A C;  3DF8 A;  1FOW A;  1RIO H;  1TQM A;  3F8M A;  3SEQ A;  2GOM A;  1FT9 A;  4UVC A;  1X58 A;  1MBG A;  3OYJ A;  1K4T A;  4IZZ A;  5IYC J;  4LB6 B;  1NK2 P;  2YPR A;  3H35 A;  2DK8 A;  1B8I A;  2DLL A;  3R61 A;  1A35 A;  1OMI A;  1VQM I;  3CES A;  2IGK A;  2HYF A;  3PUF A;  3D5S C;  2GLO A;  1GV5 A;  2GXG A;  3JRC A;  4ZYD A;  5DS9 A;  3T5X A;  2EJR A;  1OYW A;  4E70 A;  5L3F A;  4HSR A;  3BG5 A;  5F08 A;  3X2Q H;  2JA2 A;  3GLX A;  3TQN A;  1WJF A;  2VLA A;  4M9S A;  1IZ1 A;  2ICW G;  2V1N A;  1UFM A;  3BC8 A;  4L0Y B;  1Z3X A;  2QA4 I;  2WV1 A;  5DD8 A;  3CME I;  1JE8 A;  1BM9 A;  2ZME A;  5FD6 A;  1IN5 A;  3EYI A;  1S5L C;  3BQY A;  1YIJ I;  4EM2 A;  3OIO A;  2LDU A;  3H9G A;  3SZG A;  3UNG C;  5HNF A;  5E8G A;  2ZJQ F;  1RES A;  4RAY A;  4E7H A;  4L9T A;  4WCG A;  2EBI A;  4RAZ A;  1X4O A;  2L54 A;  1IUY A;  2LLK A;  1E2X A;  2V9P A;  5EGO A;  2D45 A;  2GZW A;  1B9N A;  5FLX K;  2PX9 A;  1ZG5 A;  2IBD A;  2DMU A;  3NAU A;  2W85 A;  3FX3 A;  5LHG A;  2VJI A;  3VYS B;  1LJ9 A;  4PSW A;  3DLL F;  3TED A;  2FBH A;  1ETK A;  4M3G A;  1WZ2 A;  1YX5 A;  1S72 I;  3P9C A;  3PQJ A;  4Q4Z F;  3HOY J;  5JLX A;  5E3L A;  5EF6 A;  4BH9 A;  3PJR A;  4ZYE A;  4XBF A;  4ZYA A;  4N0B A;  3CP2 A;  1JI8 A;  2O8X A;  3QAH A;  4RB0 A;  1MBE A;  3ERM A;  3R6S A;  1WJB A;  1Z7U A;  3SFI A;  2DQL A;  3JRA A;  2CV1 A;  2W57 A;  3ZMZ A;  1ZGJ A;  2R7O A;  2XGE A;  5IOZ A;  2QBY A;  3SDB A;  2R7T A;  1K83 J;  3AG2 H;  2W82 A;  3DTE A;  3CTA A;  3FMS A;  1JGS A;  3O2P E;  2CU7 A;  2GIV A;  4U0W A;  5J6X A;  1T95 A;  2VOO A;  1B4A A;  3REO A;  3P9I A;  2XRL A;  1IN4 A;  4DQ2 A;  1IGN A;  2HOE A;  1ZKG A;  2XAG A;  4EAT A;  2E5N A;  2E34 A;  1WRJ A;  2KJB A;  3ZN0 A;  4DGW B;  2CW0 F;  4IPA A;  4NQW A;  4HNT A;  2HVQ A;  2V6E A;  3NRV A;  1X3U A;  2RAE A;  1SD6 A;  3DEE A;  2I10 A;  4YII A;  3WTZ A;  3I0T A;  3F72 A;  3QWL A;  4W1U A;  3RPQ A;  4R79 A;  1LFP A;  1BR2 A;  2RC4 A;  2QF7 A;  3HHG A;  1OCP A;  2GBY A;  2CUF A;  2R7Z J;  3T8R A;  2DYR H;  4YEJ A;  4E7I A;  4XLH A;  1ENH A;  5F0C A;  4QPQ A;  3F23 A;  1JJ6 C;  5J8C A;  1AOY A;  3HC7 A;  1PP7 U;  1ORK A;  2CV0 A;  2ME6 A;  4XIC A;  5F0F A;  5J40 A;  1W4M A;  2VXZ A;  2XSJ C;  3OYG A;  1R4N B;  4ENJ A;  4JX5 A;  3BG6 A;  1R00 A;  2FD5 A;  2GA2 A;  3G6E I;  2MA3 A;  2H8W A;  1IW7 F;  4GCV A;  3CMA I;  3W2V A;  1CQT A;  2AS5 F;  1POG A;  4HDU A;  3OYD A;  3E6C C;  4XKV A;  4EM0 B;  4KIT B;  3ZPL A;  3ZOB A;  5D6E A;  4OU0 A;  4BYY A;  1QQI A;  3LL7 A;  2R4G A;  3CLO A;  2W00 A;  3BR5 A;  5GPC A;  1O57 A;  1W5S A;  5IOY A;  2UXN A;  5KHD A;  4XOP A;  2F5F A;  5FKM A;  1QO0 D;  2HEO A;  1ZG1 A;  2P4W A;  4HX7 A;  4A3M J;  3UKG A;  3J7A O;  4EV0 A;  3GTG J;  2E2I J;  2IA1 A;  1AA7 A;  3OL3 A;  1WSU A;  4AYB N;  1S9H A;  2AXT C;  3PSI A;  3VYR B;  5EG0 B;  4HNV A;  3JRG A;  1E17 A;  4YRV A;  4UVA A;  4MFD A;  3ABL H;  3KYC B;  4CYC A;  1I39 A;  1O3S A;  2HXO A;  3K0L A;  4A12 A;  5FKL A;  3OYH A;  1PUE E;  2L4A A;  2HTJ A;  3FKI J;  4IOC F;  2ESH A;  3M1C A;  3A0B C;  1V55 H;  2QYO A;  3CUQ C;  5H6Q A;  1NH3 A;  4BE0 A;  2KHM A;  1KQ9 A;  2DA2 A;  1A5J A;  4YFX F;  3RYR A;  5D8K B;  5FKO A;  2IVM A;  5DD4 A;  4KDP A;  2IS2 A;  1YRN A;  2LTP A;  4DNC A;  3S15 J;  2G7H A;  5LFA A;  2VKE A;  5A2Q Z;  1JKR C;  5ICE A;  3OYL A;  4ZZD A;  2M30 A;  2DXI A;  4BJT A;  4E7J A;  4R8H A;  3CCE I;  4UXN A;  2C6Y A;  3GFJ A;  1ZR2 A;  1FTT A;  3BZC A;  3WG7 H;  1NG6 A;  5CVI A;  1S6L A;  5AIQ A;  4XLE A;  3CC2 I;  1T08 B;  4KIS A;  1ETV A;  1B9M A;  1X3Z B;  4UV8 A;  2F6C A;  2M5W A;  2HQR A;  5CKT A;  2Y9Z A;  2COM A;  1X2M A;  3GUD A;  3OS2 A;  2VQH A;  2V4J C;  1PUF A;  3KP5 A;  3FBI B;  4KUM A;  4EVI A;  5HDG A;  2JZY A;  4GRI A;  1G6N A;  2O7O A;  2K9L A;  4IRG A;  1VZ0 A;  3GF2 A;  3T8T A;  4IHY A;  2DOD A;  3BRO A;  1J5Y A;  2MYS A;  4MQ9 F;  5LHH A;  3HPG A;  3TGN A;  2NXN B;  2STT A;  2XSD C;  1PYV A;  1TQI A;  2O9L A;  3I55 I;  2CGP A;  2JA7 J;  3CP8 A;  3IP4 B;  1SFX A;  1VTN C;  1K78 B;  1VQ5 I;  2M7A A;  3C2G A;  2Q2E A;  4LIU A;  1FEX A;  3DLA A;  2DTR A;  3DCF A;  5IP6 A;  4FHT A;  5FD5 A;  1G3S A;  1Z6R A;  2JN6 A;  2ZXI A;  3CO6 C;  1WJC A;  1NHA A;  4IEJ A;  1OCO H;  4HNU A;  2XV4 S;  4PK4 A;  3LSG A;  3R60 A;  3J81 K;  4I6Z A;  4BY1 J;  4XR6 A;  2LY1 A;  1OR7 C;  2MG4 A;  1KZH A;  2ZB9 A;  1D8K A;  2ELK A;  2HZT A;  4QLC U;  4HF2 A;  1ZQ3 P;  2PEX A;  3CMY A;  1A36 A;  1EF4 A;  5CPR B;  3FKJ A;  4IQJ A;  3AG4 H;  4ESB A;  2LG4 A;  2P7V B;  2WAQ N;  4PFO A;  2DJN A;  2GA1 A;  2MD5 A;  2IGM A;  1U9O A;  1XSD A;  3U9G A;  3QPT A;  3OMY A;  2YUS A;  4BDZ A;  3ABK H;  2V1U A;  1HKT A;  1VQP I;  2LD5 A;  1SAN A;  2EIM H;  2OV7 A;  2ZCW A;  5F27 A;  3AKZ A;  4FE7 A;  3WTT C;  2VB6 A;  1HF0 A;  1PVE A;  5LGU A;  2DN0 A;  3GFI A;  2Y30 A;  2YSR A;  5IT3 A;  3FZV A;  2VJ5 A;  1I6X A;  1V5F A;  3DQV C;  3OR1 C;  2F48 A;  5FFZ A;  3RYP A;  1H9G A;  5BPI A;  2ELJ A;  4ASN A;  5ICG A;  4YEL A;  3W2A A;  4XKW A;  2ZSH B;  4OOI A;  4L5J A;  1S7O A;  5EYR A;  2H1L A;  2IJL A;  2M1B A;  2NVX J;  1IRF A;  1OQY A;  3K7A J;  4KMF A;  3S1N J;  1MNE A;  3OYN A;  1MMS A;  2Q0O A;  2BV6 A;  1HBX G;  4A3C J;  2ZFW A;  1IXS B;  1U5T B;  2IEK A;  3W3C A;  1OIS A;  4NB5 A;  2R7D A;  1AWC A;  1Z9C A;  3V7C A;  3IC7 A;  2LOO A;  2CQQ A;  3HBL A;  4UHT A;  3LFU A;  1QU3 A;  3DKW A;  5CVR A;  2IXS A;  3MZH A;  2WA0 A;  4IRI A;  2VE9 A;  1ETW A;  1Z05 A;  2MAB A;  4I01 A;  4ZTJ A;  1UCR A;  2ZJR F;  4EJV A;  5E3N A;  5GTI C;  2XRN A;  3J7Y J;  4E7L A;  2LR8 A;  3FXQ A;  2OQG A;  2JUC A;  1H89 C;  1O4X A;  5BOX A;  3D1N I;  2D2W A;  2Z33 A;  4BQO A;  1LDK B;  2DDA A;  2NOJ B;  3E5Q A;  4Z6Y A;  4FIS A;  1KQ8 A;  1FPQ A;  4M74 A;  4XLF A;  2CFX A;  3WHC A;  4Y17 A;  1TT5 B;  2QQB A;  5FO5 A;  1IXC A;  1WQ2 A;  1IF1 A;  5BPD A;  4XSZ F;  1WI9 A;  2LBF A;  3H9J A;  2DDB A;  4I98 B;  2EFN A;  3QYF A;  2HNH A;  4PUS A;  2TCT A;  2X1E A;  2Y0S N;  2XF6 A;  1ULY A;  4I76 A;  2K7L A;  3OOU A;  3VPR A;  3R0A A;  1RRJ A;  2FNP A;  3MWM A;  1F4K A;  2VKD A;  1AU7 A;  1V5G A;  1DGR M;  1WJD A;  2FNA A;  4L0Z B;  1FMV A;  2B0L A;  5FRN A;  2M87 A;  3BTL A;  2HQN A;  2UZK A;  2IS1 A;  2KPM A;  4L5E A;  1UJ8 A;  4LOC A;  1DP3 A;  2KIQ A;  2VOD A;  4XM3 A;  2BZT A;  3CJR B;  3GYH X;  2NNN A;  2PLY A;  3LNQ A;  1JUP A;  2EFW A;  2Z1D A;  3ZQH A;  3BTI A;  4Y7N J;  1IN8 A;  1YYV A;  4AC0 A;  2A68 F;  1TNT A;  4KMU X;  2BXY A;  1SFO J;  4Y3O A;  3RPU A;  2DPD A;  3HOZ J;  2RV8 A;  4O3M A;  1V4R A;  2OZU A;  2NNY A;  1BOA A;  1RI7 A;  1NTC A;  1GDT A;  3CCR I;  5FLM J;  3HIF A;  1NG7 A;  1YIO A;  2OD5 A;  4L9J A;  3F3X A;  4M3B A;  3LQR A;  4YG2 F;  4UV9 A;  1Z7L A;  3A1Y A;  3RDI A;  1J75 A;  4BHP A;  4DBQ A;  1OLT A;  4A3E J;  1JTY A;  2XPW A;  3MAJ A;  4ANJ A;  5HLG A;  1HKQ A;  5EZH A;  1QNT A;  2XUB A;  1LDJ A;  3HJE A;  1YQA A;  2M9H A;  5GTH C;  1GT0 C;  1DPU A;  4CCK A;  4EMS A;  4G6Q A;  1ZH5 A;  5HDK A;  4M71 A;  5C3E J;  1MDM B;  3OSG A;  2PJP A;  1SMT A;  5IP7 J;  1SC7 A;  2OJE D;  3S93 A;  3ZQG A;  3GTP J;  1X1D A;  2DA3 A;  2VXD A;  5HNH A;  2LK2 A;  3QU6 A;  2DYS H;  1TC3 C;  4I0B A;  3JW4 A;  3SJM A;  1BJZ A;  4W97 A;  4G7O F;  2BY2 A;  4A3F J;  4PSX A;  3C3W A;  2ID6 A;  4M3D A;  4G6T B;  3HKZ A;  3PO3 J;  4K2E A;  2XAS A;  3GTL J;  3IH3 A;  3M8J A;  3MFK A;  4I09 A;  4LD5 A;  3IWZ A;  2YR2 A;  3E0J B;  1Y1V J;  2CW8 A;  3I3L A;  4LFU A;  3O6B B;  4M6Y A;  5DDG A;  1FIP A;  2CW7 A;  3CC7 I;  4I99 C;  3E5U A;  3V8J A;  1X1B A;  5GAD J;  4B44 A;  1K6O A;  2VJ4 A;  1IUF A;  3IRQ A;  1P2F A;  1K7A A;  4LIT A;  1V3F A;  1NK3 P;  2F5D A;  1U9N A;  4PJL A;  3LSH A;  3H5R A;  1YW9 A;  4BJ5 C;  3T1B A;  4B8X A;  2MD0 A;  3BR3 A;  5CQE A;  5DM7 F;  1PJR A;  4A3I J;  3K4J A;  2KT0 A;  3RIR A;  2CO5 A;  4ENK A;  2O5R A;  4A0Z A;  3GTM J;  1H0M A;  2W25 A;  4OIR F;  2HYJ A;  4NC7 A;  1ZYR F;  5B66 C;  5M5W J;  2EIL H;  1FSH A;  2ZME C;  1SVM A;  3BLY A;  3DU5 A;  3QP5 A;  4HF0 A;  1JT6 A;  3LSM A;  3V4G A;  1J7K A;  2TRT A;  3E5X A;  1FWZ A;  2W84 A;  3B73 A;  1FC3 A;  5M3F J;  3JCU C;  2LF8 A;  3WE3 A;  2MGQ A;  2R7F A;  2FU4 A;  4ENM A;  2KDZ A;  2QSG X;  2L7Z A;  3DBH B;  3H3U A;  2NS7 A;  4HQM A;  1ZRE A;  3RPU D;  4LG0 B;  3TMO A;  2R5Z B;  1WH5 A;  3S1M J;  2VBZ A;  4RB3 C;  1FZP B;  1S7A A;  3K4L A;  1Z77 A;  2K9M A;  1TWH J;  1QPM A;  1T38 A;  2MC4 A;  3KYL A;  4KIB A;  2JA6 J;  3GTK J;  2L9S A;  3CZ6 A;  4PGG A;  2CJJ A;  3LMM A;  3H9Q A;  5JVT A;  1FBS A;  2QVO A;  1XDS A;  2IP2 A;  2WTE A;  4V19 K;  1SAU A;  2AXL A;  5JR3 A;  4GGG A;  1XCV A;  4B3A A;  2CQX A;  3FXU A;  3BTC A;  1YHQ I;  5HS8 A;  1E3H A;  4HW0 A;  3PIP F;  3E1S A;  3F6O A;  1CF7 B;  1GXQ A;  3I59 A;  3ZGK A;  1DU0 A;  4HX4 A;  5HOD A;  2BBY A;  3WG9 A;  3QYB A;  4HV5 A;  1R1U A;  5KNL A;  1REP C;  1RUN A;  2ZC2 A;  2IPQ X;  3ZMD A;  5L3G A;  2Z2S B;  3WTV C;  3CDL A;  2H6B A;  5TRD A;  3DPT A;  5FGM A;  3S32 A;  1UAA A;  3LOC A;  3LAJ A;  4KFC A;  1MGT A;  3SDG A;  5C4J J;  2VUM J;  2X85 A;  4G8X A;  3GTQ J;  4XN0 A;  2QCO A;  5LGN A;  3AG3 H;  4AIH A;  3KE2 A;  4CH7 A;  1SVL A;  2ZXW H;  3MD2 A;  1HDP A;  1K6Y A;  1W5C C;  1WWX A;  2E1N A;  1ETX A;  2G9W A;  4IHS A;  4F52 A;  3H0G J;  3ZMU A;  2X51 A;  4BY7 J;  1KYZ A;  4U0Y A;  2KQR A;  3DXJ F;  3ERE D;  2AQE A;  3GEZ A;  3CJN A;  1XGM A;  3OV8 A;  2NOG A;  2QQ8 A;  4P9U A;  3RCO A;  2KLO A;  1IRZ A;  1CGP A;  2VC1 A;  5LEJ A;  2GIZ A;  1JUM A;  4JOM A;  2BY3 A;  1KON A;  4BE2 A;  3FIW A;  5F1J A;  1N25 A;  2LNB A;  3HTU A;  3IH4 A;  4P5O A;  4MTD A;  2HWV A;  3Q0V A;  1YLF A;  3JAM Z;  3ZRG A;  3H1C A;  5AIP A;  2ZXJ A;  5D6F A;  3OS1 A;  2CYY A;  3J80 K;  1XB4 A;  3O8G A;  1B1B A;  1Y8R B;  4OIN F;  2R7U A;  3FXM A;  4HOB A;  3ZQI A;  1U8R A;  1JHH A;  1K4S A;  5KAF C;  1USS A;  2L5Q A;  3M4O J;  3KZZ A;  2HDW A;  3CCV I;  2BHZ A;  4BHC A;  5E8I A;  1Y8Q B;  2HFH A;  2P6S A;  3BP8 A;  3GX4 X;  4M3F A;  1BJA A;  3Q0U A;  1YJ9 I;  4WK8 F;  1OPC A;  3EUH C;  2FA5 A;  1IV6 A;  5FJ8 J;  4LLL A;  4BAY A;  3ASO H;  1FNN A;  3QPS A;  2K9Q A;  3F8F A;  2WAE A;  2WY7 Q;  1YTY A;  2OAZ A;  4BXX J;  1ZRC A;  3M1E A;  3DU6 A;  4LLG F;  3SQN A;  2WAQ A;  3FXK A; 
#chains in the Genus database with same CATH homology
 2FE3 A;  5BS6 A;  5H6R A;  4HAM A;  1SD4 A;  4ZZL A;  1P92 A;  1ON2 A;  3BZ6 A;  1DP7 P;  3WGI A;  4ZYG A;  5KK1 A;  3WTU C;  1R7J A;  3GFM A;  1Y0U A;  2JT1 A;  1MKM A;  2IRF G;  2EFO A;  2G7U A;  1P4W A;  2QBY B;  4KNY A;  1SD5 A;  3P9K A;  4PDK A;  2CWE A;  1OYI A;  2P8T A;  3ABT A;  2PMH A;  5K1Y A;  3L09 A;  4EJU A;  3WTW C;  5HVQ C;  2L3D A;  3F8C A;  1BI1 A;  1U78 A;  2A69 F;  1O3R A;  1IRG A;  2JTV A;  3R0J A;  3WOD F;  2KIF A;  4A5M A;  3EDP A;  3Q9S A;  1I1G A;  1WKM A;  1HW1 A;  1SMY F;  2EB7 A;  4I02 A;  3HRU A;  2ZNZ A;  3KLN A;  2EWN A;  4EGY A;  4QWQ A;  2DW4 A;  1QGP A;  3WU0 A;  2QQA A;  2ZNY A;  2EFP A;  3TO6 A;  4MEY F;  3F8B A;  1GHC A;  3TKY A;  1XSV A;  2MH9 A;  3EUH A;  1I27 A;  3U1D A;  2LKP A;  5CLS A;  4Q48 A;  3K2Z A;  5HS9 A;  3GXO A;  2HKX A;  3Q5F A;  4O6J A;  1GVJ A;  5DCM A;  1G3Y A;  1R22 A;  4MNU A;  2ETH A;  3TO9 A;  5D4R A;  2MC3 A;  5IT9 K;  2JPB A;  2M45 A;  3E6B A;  2L4M A;  2HS5 A;  3SFZ A;  1XGO A;  1C0W A;  3CDH A;  3M7G A;  2V9V A;  2FQ3 A;  4UNO A;  3JSP A;  1XMA A;  3E97 A;  4KIF A;  3I58 A;  1Z91 A;  2KJC A;  1T6S A;  5HOO A;  3F22 A;  3I53 A;  2V79 A;  2XAQ A;  1U2W A;  4HX8 A;  3L7W A;  5CVJ A;  4BXU A;  3IRR A;  4XLP F;  1EH7 A;  1KU9 A;  1B6A A;  3MCZ A;  3COA C;  1HQC A;  1K78 A;  3BPV A;  4P96 A;  1SD7 A;  2ELH A;  3W6K B;  3IKT A;  1R1T A;  3SXY A;  2K02 A;  3DEU A;  1MJB A;  1ZLK A;  3G73 A;  1TNS A;  2XAH A;  1JHF A;  5HS7 A;  1J59 A;  4D0P A;  2E1C A;  4IXA A;  1D8J A;  2DFI A;  3FMQ A;  2M8E A;  3VOD A;  2H6C A;  2FML A;  4HLX A;  3HTS B;  2O0Y A;  3ELK A;  1YS6 A;  3U2R A;  3QP6 A;  3QU3 A;  1XN7 A;  1K79 A;  2A5Y B;  1J0R A;  5F1R A;  2EA4 A;  2FMY A;  3C18 A;  1D5V A;  3HOT A;  2HGC A;  1IXR C;  3RI4 A;  3G3Z A;  3JSO A;  2MH2 A;  3BPX A;  3LA7 A;  4ZH4 F;  1T39 A;  5FB2 A;  1UST A;  4OMY A;  2A6H F;  3KP2 A;  2KIU A;  4I7H A;  3DV8 A;  1ONV A;  4IJA A;  4LMY A;  3HYI A;  3BJ6 A;  4JK1 X;  3CUQ B;  2CSO A;  4BQA A;  3KP7 A;  3H92 A;  5DV5 A;  3MEX A;  3N97 A;  1ZAO A;  2PG4 A;  2RVC A;  2ZO4 A;  4PGH A;  2QQ9 A;  4GYI A;  4WXH A;  4AIK A;  3GVA A;  3OOP A;  3EYY A;  4HZF A;  4EJT A;  1LEB A;  4AD9 A;  2Y0M A;  5CVU A;  2HR3 A;  4EGZ A;  2L02 A;  1EH6 A;  4OMZ A;  1R36 A;  2XGX A;  4A5N A;  2HDC A;  3HSF A;  4WX9 A;  4EJW A;  5ICC A;  1L3L A;  2NAZ A;  2VT3 A;  5D8L B;  5FLX Z;  3K1M A;  1F5T A;  4HYE A;  2QLZ A;  4AWX B;  3EET A;  4CZZ A;  2K27 A;  3I4P A;  2XKO A;  4HBL A;  4BNC A;  1TW2 A;  3BY6 A;  2VON A;  3HSE A;  4YIF A;  3TDZ C;  5EEH A;  4L9N A;  3T0Y A;  1TW3 A;  2V6C A;  4ESJ A;  3BJO A;  2EK5 A;  2E7X A;  1A04 A;  3N4M A;  2FSW A;  2VC0 A;  3GFL A;  2FBK A;  2O03 A;  4RB1 A;  2UWM A;  4N9H A;  2J5P A;  2H27 A;  2A3S A;  3KP4 A;  3LQQ A;  2LSO A;  2XRO A;  4EQQ A;  1XSX A;  3GZ6 A;  5JFR A;  2VOP A;  1F9N A;  4LJZ F;  1S8N A;  1HXD A;  2EFQ A;  3WU1 B;  1SFU A;  1B59 A;  1FP1 D;  5LRS A;  1LNW A;  3ECO A;  1RZ4 A;  3Q9V A;  2FXA A;  3NEU A;  3SZP A;  3EQL F;  1TBX A;  4B09 A;  1Q1H A;  5ED4 A;  2MLG A;  4EM1 A;  1W7P B;  1FY7 A;  2RN7 A;  1R23 A;  4WXD A;  4A6E A;  2CG4 A;  3LST A;  3WE2 A;  2RGV A;  3VB2 A;  2NS0 A;  4YFN F;  2ZBK A;  5A2Q K;  5DYM A;  2E7W A;  2YX7 A;  3QRF F;  4YFK F;  3GO5 A;  5KVR A;  2F5E A;  3DP7 A;  2BEO A;  4KN7 X;  2RQP A;  4OIO F;  5HDN A;  2X4H A;  5L3D A;  1HST A;  3KLO A;  3LA2 A;  2P5K A;  4AVP A;  2FBI A;  1DPR A;  1G3W A;  2MBF A;  1L0O C;  2BYV E;  3ZMS A;  1GXP A;  4R1H A;  1G3T A;  1IN7 A;  1HKS A;  1HSJ A;  4CHU A;  1YS7 A;  3C7J A;  2FOK A;  3L00 A;  1CF7 A;  1I5Z A;  6PAX A;  4M9Z A;  2PMU A;  4CO8 A;  5LEK A;  4P9F A;  2EA2 A;  2ZJ2 A;  2ACJ A;  3GWZ A;  1MZB A;  4LLN A;  1H9T A;  4OIP F;  4RGR A;  4Y15 A;  1O7L A;  2JRT A;  5BQT A;  1FP2 A;  1R5H A;  1O7F A;  2ISY A;  1IN6 A;  2PN6 A;  3HOS A;  3BDD A;  1T0F A;  3J81 Z;  4S05 A;  1S29 A;  2K4B A;  1ZGA A;  5L3B A;  1ON1 A;  1ZLJ A;  3F6V A;  5AON A;  1DUX C;  3O3K A;  4XLN F;  3WGH A;  3VFZ A;  1O3Q A;  2PBI A;  3GZ5 A;  2OA4 A;  3IL2 A;  4LK1 F;  5J8F A;  1ZAR A;  2QM3 A;  4MQV A;  3ZP5 A;  1YG2 A;  4G94 A;  3V8L A;  3AAF A;  1LQ1 A;  1BI3 A;  2HTS A;  4MEX F;  2OU2 A;  4F7Z A;  2JSC A;  5ICF A;  1P6R A;  4A0Y A;  2H09 A;  1MJ9 A;  5D5X B;  1S3J A;  4ETS A;  2VE8 A;  2QEN A;  3KP6 A;  3W6J B;  3I64 A;  1R5G A;  4AIJ A;  3DFG A;  2DAO A;  3JTG A;  2WC2 A;  2Z9O A;  4FX0 A;  2ZME B;  3KP3 A;  1BIA A;  1LB2 A;  4O5V A;  3K1N A;  4PCQ A;  1EV7 A;  5L3E A;  4I0A A;  1YO5 C;  1MJA A;  2A07 F;  4N9I A;  5CVV A;  3KCC A;  2VBW A;  3FM3 A;  2FRH A;  4EJO A;  3FHZ A;  2IA0 A;  4P55 A;  2IA2 A;  4KA4 A;  5E1X A;  1FX7 A;  2OQR A;  2OZ6 A;  2K4J A;  1T2K A;  1LDD A;  1J9I A;  4KIG A;  1FBQ A;  5H20 A;  2EV5 A;  2DT5 A;  4Y13 A;  1ODD A;  3H3Z A;  2D1V A;  4Q5S F;  3E6D A;  3HUG A;  1W5T A;  3M9A A;  4CIC A;  5TJJ A;  3V7S A;  3LAP A;  4G9Y A;  2VT2 A;  4FX4 A;  3ZQ7 A;  2H94 A;  3ULQ B;  3WTY C;  5DUK A;  3HHH A;  3BOQ A;  1ZHF A;  2XAF A;  4KT5 C;  3E6M A;  3HRS A;  2VBY A;  3FF5 A;  4ESF A;  4HLY A;  2GAU A;  2EV0 A;  1RUO A;  2Z3Y A;  4LK0 F;  3ECH A;  4HV6 A;  3ABU A;  3P7N A;  5EEG A;  4XSX F;  5JI6 A;  3K1P A;  5ILV A;  2O6G E;  1TTY A;  2GWR A;  4RGX A;  2W24 A;  4M72 A;  1U6G A;  5LHI A;  1D3Y A;  3PQK A;  2DPU A;  3KFW X;  4CDG A;  1FSE A;  3S2W A;  1KU2 A;  2ZKZ A;  3V7R A;  4XRF A;  4M6X A;  1BIB A;  5ILS A;  1U5T C;  2VN2 A;  5HLI A;  3D5L A;  3R4K A;  3RJP A;  3F8N A;  4Q47 A;  3MQ0 A;  1U3E M;  1BBY A;  1P4X A;  5E1Z B;  2ESN A;  4ON0 A;  1XDU A;  4HQE A;  4WF2 A;  5ERI A;  2QZ8 A;  4HA8 A;  1SFE A;  5DCM B;  3ML6 A;  3RTR A;  4KN4 X;  2XAJ A;  2P6T A;  4TV7 A;  3GW2 A;  5LGT A;  5F64 A;  2EV6 A;  1G4D A;  5FFX A;  2PI0 A;  2FEZ A;  4BHB A;  4L9V A;  2V1D A;  3B02 A;  3SZT A;  2PFB A;  2J5O A;  1RNL A;  2VBX A;  1R58 A;  2DO7 A;  5D5W B;  2F2E A;  3BWG A;  4WXC A;  4GO1 A;  1JXS A;  5L3C A;  1QZY A;  3FWE A;  4MTE A;  1TQP A;  1OKR A;  1R1V A;  3F21 A;  5K5R A;  3MZY A;  4RGS A;  1PDN C;  4GXO A;  3CO7 C;  2ISZ A;  4U7B A;  4RB2 C;  5E18 F;  2O61 A;  5D5V B;  4MHG A;  4L5I A;  2DK5 A;  5JHU A;  4H0E A;  1HW2 A;  1BN5 A;  4NHJ A;  2BE5 F;  2QWW A;  3JAM K;  4RS8 A;  2L01 A;  4U88 A;  2MLK A;  1U5T A;  1KQ0 A;  3CUQ A;  4U7D A;  4RGU A;  4UUV A;  3I71 A;  4L18 B;  3DPL C;  2DBB A;  3PFI A;  3TOA A;  2GQQ A;  2K86 A;  1BC7 C;  4HF1 A;  2RNJ A;  2NYX A;  2CQK A;  3VOE A;  1FYM A;  1FYL A;  3J80 Z;  3LA3 A;  3FM5 A;  2YU3 A;  3KEQ A;  5LBQ A;  1T98 A;  1STZ A;  3L2C A;  2HYG D;  2UXX A;  1XMK A;  4IVN A;  1XCB A;  3M8F A;  4HDV A;  1QBJ A;  1XGS A;  4IF4 A;  3ISP A;  1P4A A;  3TOB A;  2DQR A;  4G7Z F;  1ZRD A;  3JTH A;  5K5Q A;  1LVA A;  2Z99 A;  1FOK A;  3K69 A;  5LRR A;  1KA8 A;  5E17 F;  3RKY A;  3TDU C;  2Q8K A;  2FF4 A;  4CYD A;  1ZG3 A;  1ZN2 A;  4S04 A;  3NQO A;  3HRT A;  1QZZ A;  1UHW A;  2NRA C;  4LGW A;  3CUO A;  1OR7 A;  3HSR A;  4ZYH A;  4JQF A;  3BJA A;  3VEP A;  5D5U B;  1IAW A;  1BI0 A;  3KET A;  5E1W A;  4OIQ F;  4PZJ A;  3ROU A;  3HRM A;  3I54 A;  2IW5 A;  2V1X A;  1HW5 A;  1Z6T A;  2WWY A;  3ZMT A;  2Z5U A;  1PP8 F;  1MDM A;  4IRH A;  2XIG A;  1UHM A;  5E20 A;  1YW7 A;  5D4S A;  1W7P A;  2X0L A;  1EH8 A;  3K9T A;  1KU7 A;  2Y48 A;  1YW8 A;  3ZN1 A;  4G7H F;  4M73 A;  3I5U A;  3SHF A;  4IHT A;  2Y75 A;  4M9X A;  1O3T A;  1SAX A;  4A6D A;  4MGR A;  1KYW A;  2STW A;  5BMZ A;  2P7C B;  1XGN A;  3RKW A;  3IHU A;  4KIC A;  2PQ8 A;  4CGZ A;  3L9F A;  3KEO A;  2DI3 A;  5DEQ A;  3WTS C;  5F6F A;  2R3S A;  3LFK A;  2XVC A;  4A0X A;  2BGC A;  4U0V A;  1ZRF A;  1Z1D A;  2KRF A;  3WGG A;  4CXF A;  1FLI A;  3FXR A;  4LG0 A;  1KU3 A;  3TO7 A;  2WV0 A;  4UVB A;  5IT9 Z;  2RDP A;  3QOP A;  2P5L C;  1BC8 C;  3RKX A;  3ZMV A;  2DU9 A;  1FBU A;  2JPC A;  4JBA A;  4Z2Y A;  5HLH A;  2ADU A;  4LB5 A;  2F5C A;  2XHK A;  2KIM A;  5CJ9 A;  1MD0 A;  1I1S A;  2GXB A;  2KKO A;  4G6D A;  1FYK A;  5LLQ A;  3IKV A;  2A6E F;  2XKP A;  2P5V A;  2O3F A;  5DCF A;  4I2O A;  1W7P D;  1F1Z A;  2YX4 A;  1TLH B;  3WTX C;  1YFH A;  2RKH A;  5ILU A;  4WWC A;  1UB9 A;  3E3V A;  1OYY A;  3LWF A;  3QPH A;  4GYG A;  3FMR A;  3I59 B;  1LEA A;  3V8K A;  4FT8 A;  2HKO A;  1BI2 A;  2TDX A;  3C1D A;  4ENN A;  4A2U A;  2IT0 A;  2A61 A;  2OBP A;  2QUF A;  3KZY A;  1KGS A;  5K5O A;  2D1H A;  4KYW A;  1J2X A;  1XD7 A;  5CYV A;  1DDN A;  3D0S A;  3IWF A;  3M8E A;  5DUI A;  2LF7 A;  3DF8 A;  1RIO H;  1TQM A;  3F8M A;  1FT9 A;  4UVC A;  4LB6 B;  2YPR A;  2DK8 A;  2DLL A;  3R61 A;  1OMI A;  2HYF A;  2GXG A;  4ZYD A;  3T5X A;  2EJR A;  1OYW A;  4E70 A;  5L3F A;  3GLX A;  3TQN A;  4M9S A;  1IZ1 A;  1UFM A;  4L0Y B;  5DD8 A;  1JE8 A;  1BM9 A;  2ZME A;  5FD6 A;  1IN5 A;  3EYI A;  4EM2 A;  2LDU A;  5E8G A;  4RAY A;  4L9T A;  4WCG A;  4RAZ A;  2L54 A;  1IUY A;  1E2X A;  2D45 A;  2GZW A;  1B9N A;  5FLX K;  1ZG5 A;  2W85 A;  3FX3 A;  5LHG A;  1LJ9 A;  2FBH A;  3P9C A;  3PQJ A;  4Q4Z F;  4BH9 A;  4ZYE A;  4XBF A;  4N0B A;  2O8X A;  3QAH A;  4RB0 A;  3R6S A;  1Z7U A;  2DQL A;  2W57 A;  3ZMZ A;  1ZGJ A;  2QBY A;  3CTA A;  3FMS A;  1JGS A;  3O2P E;  2GIV A;  4U0W A;  5J6X A;  2VOO A;  1B4A A;  3REO A;  3P9I A;  1IN4 A;  4DQ2 A;  2HOE A;  2XAG A;  2KJB A;  1WRJ A;  3ZN0 A;  2CW0 F;  4IPA A;  4NQW A;  3NRV A;  1X3U A;  1SD6 A;  4YII A;  3WTZ A;  3I0T A;  3F72 A;  3RPQ A;  4R79 A;  2RC4 A;  3HHG A;  3T8R A;  3F23 A;  5J8C A;  1AOY A;  1PP7 U;  1W4M A;  2VXZ A;  4ENJ A;  1R00 A;  2GA2 A;  2MA3 A;  1IW7 F;  4GCV A;  2AS5 F;  4HDU A;  3E6C C;  4EM0 B;  3ZPL A;  5D6E A;  4OU0 A;  4BYY A;  1QQI A;  3CLO A;  1O57 A;  1W5S A;  2UXN A;  2F5F A;  2HEO A;  1QO0 D;  1ZG1 A;  2P4W A;  4HX7 A;  3J7A O;  4EV0 A;  2IA1 A;  1WSU A;  1E17 A;  4UVA A;  1O3S A;  3K0L A;  4A12 A;  1PUE E;  2L4A A;  2HTJ A;  2ESH A;  3CUQ C;  5H6Q A;  2QYO A;  1KQ9 A;  4YFX F;  3RYR A;  5D8K B;  2IVM A;  5DD4 A;  4KDP A;  4DNC A;  2G7H A;  5A2Q Z;  5ICE A;  4ZZD A;  2M30 A;  4R8H A;  4UXN A;  2C6Y A;  3GFJ A;  5CVI A;  1S6L A;  5AIQ A;  1B9M A;  4UV8 A;  2M5W A;  2HQR A;  2COM A;  3GUD A;  3KP5 A;  4KUM A;  4EVI A;  5HDG A;  2JZY A;  1G6N A;  4IRG A;  3GF2 A;  3T8T A;  3BRO A;  1J5Y A;  4MQ9 F;  5LHH A;  3TGN A;  2STT A;  1TQI A;  2CGP A;  1SFX A;  1VTN C;  1K78 B;  2Q2E A;  2DTR A;  4FHT A;  5FD5 A;  1G3S A;  1Z6R A;  3CO6 C;  1NHA A;  2XV4 S;  3R60 A;  3J81 K;  1D8K A;  2HZT A;  4QLC U;  4HF2 A;  2PEX A;  4ESB A;  2P7V B;  2GA1 A;  2MD5 A;  1XSD A;  3U9G A;  3QPT A;  2V1U A;  1HKT A;  2ZCW A;  3WTT C;  5LGU A;  3GFI A;  2YSR A;  5IT3 A;  3FZV A;  1I6X A;  3DQV C;  3RYP A;  5FFZ A;  5BPI A;  1H9G A;  5ICG A;  4ASN A;  4OOI A;  4L5J A;  1S7O A;  2IJL A;  2M1B A;  1IRF A;  4KMF A;  2Q0O A;  2BV6 A;  1HBX G;  2ZFW A;  1IXS B;  1U5T B;  4NB5 A;  2R7D A;  1AWC A;  1Z9C A;  3V7C A;  3IC7 A;  4UHT A;  3DKW A;  5CVR A;  3MZH A;  4IRI A;  2VE9 A;  1Z05 A;  4I01 A;  1UCR A;  4EJV A;  2XRN A;  3FXQ A;  2OQG A;  5BOX A;  2D2W A;  2Z33 A;  1LDK B;  3E5Q A;  1KQ8 A;  1FPQ A;  4M74 A;  2CFX A;  4Y17 A;  2QQB A;  5FO5 A;  1IXC A;  1WQ2 A;  1IF1 A;  5BPD A;  4XSZ F;  1WI9 A;  4I98 B;  2EFN A;  1ULY A;  2K7L A;  3R0A A;  2FNP A;  3MWM A;  1F4K A;  2FNA A;  4L0Z B;  2B0L A;  2M87 A;  2HQN A;  2UZK A;  2VOD A;  3GYH X;  2NNN A;  2PLY A;  2EFW A;  1IN8 A;  1YYV A;  2A68 F;  1TNT A;  4KMU X;  3RPU A;  2DPD A;  2RV8 A;  4O3M A;  1V4R A;  2OZU A;  2NNY A;  1BOA A;  1RI7 A;  3HIF A;  4L9J A;  1YIO A;  2OD5 A;  3F3X A;  3LQR A;  4YG2 F;  4UV9 A;  3RDI A;  1J75 A;  4BHP A;  3MAJ A;  5HLG A;  1HKQ A;  1QNT A;  2XUB A;  1LDJ A;  1YQA A;  1DPU A;  4EMS A;  4G6Q A;  1ZH5 A;  5HDK A;  4M71 A;  1MDM B;  2PJP A;  1SMT A;  3QU6 A;  4I0B A;  3JW4 A;  4G7O F;  3C3W A;  4K2E A;  2XAS A;  3MFK A;  4I09 A;  4LD5 A;  3IWZ A;  2YR2 A;  4M6Y A;  4LFU A;  3O6B B;  5DDG A;  3E5U A;  3V8J A;  1K6O A;  3IRQ A;  1P2F A;  1K7A A;  1V3F A;  2F5D A;  1YW9 A;  3T1B A;  4B8X A;  3RIR A;  2CO5 A;  4ENK A;  4A0Z A;  1H0M A;  2W25 A;  4OIR F;  1ZYR F;  1FSH A;  3QP5 A;  4HF0 A;  3V4G A;  1J7K A;  3E5X A;  1FWZ A;  2W84 A;  3B73 A;  1FC3 A;  2LF8 A;  3WE3 A;  2R7F A;  2FU4 A;  4ENM A;  3H3U A;  4HQM A;  1ZRE A;  4LG0 B;  2VBZ A;  4RB3 C;  1FZP B;  1S7A A;  1QPM A;  1T38 A;  4KIB A;  4PGG A;  5JVT A;  1FBS A;  2QVO A;  1XDS A;  2IP2 A;  2WTE A;  2AXL A;  5JR3 A;  4GGG A;  1XCV A;  3FXU A;  5HS8 A;  4HW0 A;  3F6O A;  1CF7 B;  1GXQ A;  3I59 A;  4HX4 A;  2BBY A;  3WG9 A;  4HV5 A;  1R1U A;  1REP C;  1RUN A;  2IPQ X;  3ZMD A;  5L3G A;  3WTV C;  2H6B A;  5TRD A;  3DPT A;  5FGM A;  3LAJ A;  4KFC A;  1MGT A;  4G8X A;  5LGN A;  4AIH A;  3KE2 A;  1WWX A;  2E1N A;  4IHS A;  2G9W A;  3ZMU A;  1KYZ A;  4U0Y A;  3DXJ F;  3ERE D;  3GEZ A;  3CJN A;  1XGM A;  3OV8 A;  4P9U A;  1CGP A;  2VC1 A;  5LEJ A;  2LNB A;  3HTU A;  4P5O A;  4MTD A;  2HWV A;  1YLF A;  3JAM Z;  5AIP A;  2ZXJ A;  5D6F A;  2CYY A;  3J80 K;  1XB4 A;  1B1B A;  4OIN F;  4HOB A;  1U8R A;  1JHH A;  1USS A;  3KZZ A;  4BHC A;  5E8I A;  2HFH A;  2P6S A;  3BP8 A;  3GX4 X;  1BJA A;  4WK8 F;  1OPC A;  2FA5 A;  4LLL A;  4BAY A;  1FNN A;  3F8F A;  1YTY A;  2OAZ A;  1ZRC A;  3M1E A;  4LLG F;  3SQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...