1SD7A

Crystal structure of a semet derivative of meci at 2.65 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd7A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd7A02
1JE8A 1K78A 3JW4A 2VBXA 3GFIA 2VBYA 3K2ZA 1ZLKA 2P6TA 4EJUA 1P4WA 4ESBA 5F6FA 3FHZA 2VC1A 2MH9A 1X3UA 3MCZA 3TO6A 1F1ZA 1BN5A 2DT5A 1U5TC 1STZA 3ROUA 4KNYA 4I0BA 1IN8A 2NNYA 4LLNA 1KGSA 3H3UA 2X0LA 5HDKA 1Z05A 3RI4A 4RGSA 1SMTA 2KJBA 1G3YA 3SZPA 3JTGA 1UHWA 1FSHA 2EJRA 5AIQA 4CHUA 4IRIA 2LDUA 3M7GA 4MEXF 1KU7A 2W24A 3V8LA 2HGCA 2CWEA 2M8EA 3BJOA 2B0LA 4ESJA 4UNOA 2MC3A 4PZJA 1LNWA 4R8HA 1R5HA 4OMZA 2WC2A 1FC3A 1ON1A 3ZMTA 3JSOA 5IT9Z 4HQEA 3BP8A 3ZP5A 1EH8A 4M6XA 3VB2A 3HOSA 3HUGA 1E17A 3WG9A 3TKYA 3HTSB 3J81K 4OIQF 3CUOA 5CVUA 1K6OA 3RKYA 5AIPA 3CO7C 4TV7A 5HS9A 5ILVA 2CGPA 5AONA 5EEHA 2X4HA 2VOPA 4L5JA 4P96A 2DAOA 3GFLA 3DQVC 2GXGA 1TNSA 1U78A 2CO5A 1BIBA 2PI0A 2P7VB 2BBYA 3J80Z 2NAZA 2VOOA 3K1PA 1HKQA 2BEOA 1HKTA 1KYWA 1PP8F 3KZZA 1Z6RA 4LLGF 4OMYA 1LJ9A 5FFXA 4KMFA 1MJ9A 3F8CA 3CO6C 3HRSA 4NQWA 2K27A 5H6RA 5LRSA 4EV0A 1BC8C 2PG4A 4LK1F 4Q47A 1P4AA 2UXXA 3OV8A 4M9SA 2FE3A 3ZQ7A 2UZKA 1TBXA 2A68F 3B02A 1WI9A 4UVBA 4AIKA 1O7LA 3ULQB 5JR3A 4Y15A 4CO8A 4K2EA 3D5LA 3F21A 4ZYHA 3I0TA 2L4MA 1IN4A 5D6FA 3I53A 1R36A 2A61A 2P5LC 1LEBA 1S29A 3T8RA 4GXOA 3PQKA 2EFPA 4RS8A 1HSJA 5ICFA 3R6SA 4ZZDA 3GX4X 4LFUA 1S7AA 2FNPA 1TQPA 4CZZA 3DEUA 3I59A 3IRRA 3REOA 1ZAOA 4EJTA 2K7LA 2QUFA 4A5NA 4ZYGA 2QYOA 3RJPA 2FBHA 1GVJA 3WU1B 3F3XA 1P2FA 3HRMA 4LMYA 1NHAA 1ON2A 3NEUA 1W4MA 5D4RA 2EK5A 3EUHA 3I59B 1QNTA 3K1NA 3WTVC 1RIOH 4UVCA 2BE5F 5J8CA 3LA7A 1TLHB 2FNAA 3MZYA 3Q5FA 4OINF 4G7ZF 4BAYA 4A6DA 4JK1X 1FYKA 1FT9A 4BYYA 2DK5A 3H3ZA 1XCBA 2M45A 1WKMA 4LLLA 3QP6A 4P9FA 3TQNA 2H6BA 2ELHA 3CUQC 1RUOA 3IL2A 5E1ZB 2OQGA 2ZXJA 5E8IA 2C6YA 5LRRA 4AWXB 2J5OA 1MD0A 2EB7A 2DBBA 2BGCA 2V6CA 1IXCA 3I5UA 4UVAA 2IW5A 3DPTA 3T8TA 3VODA 1V4RA 1KQ0A 3RYRA 4ENJA 2AS5F 4M71A 4CICA 4M9ZA 5KK1A 4JQFA 1YYVA 3FMSA 4WCGA 3GFMA 1P92A 1B9NA 2WWYA 4N0BA 4AD9A 2D1VA 3EYIA 1OR7A 1ZG3A 4I7HA 1XD7A 2TDXA 3NQOA 2DQLA 2JPCA 4HX8A 1BIAA 2FRHA 4G6QA 3M9AA 3LSTA 1Z7UA 2JTVA 1TW2A 4EM2A 2V1DA 4KIBA 5CYVA 4CDGA 5JFRA 2LKPA 1SFUA 2CQKA 1L0OC 2DK8A 2CSOA 2XKOA 4WWCA 4ASNA 3C18A 5E18F 4NHJA 2EA4A 4LG0A 3IWZA 2V9VA 4BHPA 4UV9A 4DQ2A 2A5YB 2PMUA 2AXLA 2RV8A 2GA2A 1QZYA 1BI2A 2OZUA 4EJWA 2XUBA 2OAZA 1YFHA 2W25A 2MD5A 3R0AA 1SMYF 3MFKA 1ZLJA 5D4SA 2GAUA 1U8RA 3RYPA 1FP2A 1SD4A 3KP3A 3U9GA 3M1EA 3T5XA 4LG0B 1R7JA 3I4PA 4R79A 2QZ8A 4F7ZA 2RGVA 4KUMA 1EH7A 3FXRA 4RB3C 2IA0A 5D6EA 4A6EA 2JT1A 1E2XA 3CUQA 3O6BB 1ZH5A 2K4BA 5K5OA 5K5QA 3V7CA 4UV8A 1IRFA 3MZHA 2F2EA 2F5CA 5LGNA 1Z91A 2OQRA 4IVNA 2QQ9A 5FB2A 1I1SA 2P6SA 2MH2A 1XSVA 3HRTA 4E70A 1ZG1A 2MLGA 1ZG5A 3TOAA 3DP7A 2F5FA 2QVOA 1RI7A 2VN2A 4HLXA 1ONVA 2G7HA 4L9NA 2PJPA 3WTZA 3ZMSA 3GO5A 2GIVA 3ZN0A 1TNTA 3HOTA 3R0JA 1D5VA 1TTYA 1XMKA 5E8GA 1IXRC 4U7DA 2A3SA 3KEQA 3SXYA 5CVJA 3RKWA 3DPLC 1YW9A 1RZ4A 2DI3A 1O3TA 1OYWA 2DO7A 5HOOA 1U5TA 5D5WB 2HWVA 1U2WA 4P9UA 3P9IA 4O6JA 4JBAA 5L3DA 2PMHA 3ZN1A 3COAC 3FMQA 1USTA 2EFQA 4HV5A 2ZNYA 2XHKA 1XGOA 2STTA 3MEXA 2EV5A 3QPHA 1J9IA 1K7AA 3P9KA 1BJAA 2P8TA 1G6NA 4EM1A 3R60A 1KA8A 2VBZA 3E6BA 1YQAA 2Z9OA 2D1HA 3MWMA 5J6XA 4ENNA 1HSTA 2F5DA 5A2QK 4RB0A 1ZREA 4IHSA 2K86A 2DPUA 3KETA 4HV6A 5FLXZ 3ISPA 1F5TA 3KE2A 2R3SA 4XBFA 4A2UA 4AIJA 1Q1HA 4L9VA 5HS8A 4FHTA 1RNLA 1R1VA 2Z3YA 3IKVA 1G4DA 1JXSA 1L3LA 4HF0A 1JHHA 4KT5C 2HDCA 2QQAA 3ABUA 4EVIA 2QM3A 1QBJA 2WTEA 4ENKA 2DLLA 5TJJA 2W57A 5BOXA 4B8XA 3GZ5A 2FF4A 4PCQA 1YS6A 3JAMK 3W6JB 1WSUA 2DW4A 1QQIA 3IHUA 1HW5A 4I0AA 4IRHA 3Q9SA 3WTXC 1HW1A 1LB2A 3Q9VA 5ERIA 4Q5SF 1I5ZA 3SZTA 2LF8A 2W84A 3WE2A 3P7NA 4EJVA 5ILSA 2O3FA 3E5QA 5DCMB 1HW2A 3HTUA 5E17F 4RB2C 4KIFA 1KQ8A 5LEKA 1ZRDA 2IPQX 4HAMA 3E3VA 3OOPA 5KVRA 4B09A 2CG4A 2D45A 3L00A 3BJAA 2M87A 2QBYB 2UWMA 2HTJA 4Q48A 4PGGA 1FNNA 3BPVA 2FBKA 4IJAA 3F8BA 3BY6A 3V4GA 1G3SA 4OOIA 5HVQC 2K4JA 4RAYA 1ZN2A 3BROA 2WV0A 4EMSA 4HA8A 3WTTC 3QU6A 3RTRA 1XGMA 4HW0A 3ZPLA 1B1BA 1R5GA 2FMLA 2L02A 3WTYC 2FBIA 5D5XB 3QU3A 1J5YA 4WXCA 5LBQA 5E1XA 2J5PA 2VT3A 2P5KA 4EM0B 5JI6A 1VTNC 2W85A 2ADUA 3VOEA 1LVAA 2OD5A 5LGTA 2V1XA 2R7DA 1QO0D 4XSXF 5CVIA 3IC7A 2L54A 2IT0A 1R22A 3FMRA 1DDNA 1I27A 4EGZA 4HF1A 4Y17A 3KP6A 3K9TA 1A04A 4O3MA 1AWCA 3F8FA 3GZ6A 4ZYDA 2DU9A 5HDGA 4HQMA 4YIIA 2Q0OA 1Z9CA 5J8FA 2LF7A 2XVCA 5LHIA 5L3GA 4S05A 4M6YA 1Z6TA 3DFGA 4M72A 4L18B 3EDPA 3BDDA 4U0VA 3E97A 1K79A 5FD5A 1O3RA 3MAJA 3K69A 1Y0UA 3LAPA 3QOPA 2Y75A 3ZMDA 2GWRA 1LDJA 2HR3A 1OPCA 3L7WA 1J59A 4MNUA 5BPIA 3E6DA 4GCVA 3V7RA 4OU0A 4GO1A 1FPQA 3O3KA 3PQJA 2IP2A 2HTSA 2XKPA 3E5UA 4YFNF 1O7FA 2P4WA 3S2WA 2KIUA 3TGNA 2E1NA 3VEPA 2ESHA 2NRAC 2ZMEA 3CJNA 3HIFA 4GGGA 5D5VB 2ISZA 4L0YB 1W5TA 2RKHA 3WTSC 4XLNF 4HX7A 3KEOA 1PUEE 4WX9A 5JHUA 2MLKA 2ZBKA 1B9MA 3FXQA 3I64A 2MBFA 4U7BA 4G94A 3WE3A 4KMUX 3EYYA 4Y13A 1LDDA 3FZVA 3U2RA 3IRQA 2KKOA 1IN7A 2NYXA 3ABTA 4I98B 3RPUA 3R61A 1K78B 1XMAA 4FX0A 3E5XA 2XAJA 4L5IA 3BZ6A 4ZZLA 4HYEA 3HYIA 2DPDA 2XAGA 3QP5A 1J7KA 5ILUA 2Q2EA 4EGYA 2OU2A 3EETA 3TO7A 1QGPA 3D0SA 5DCFA 1W7PA 1LDKB 2O61A 2Y0MA 1FBUA 1FP1D 4QLCU 3KZYA 5D8KB 1J0RA 2YR2A 3EQLF 1LQ1A 4AIHA 5HS7A 3DF8A 2PLYA 3GUDA 5DYMA 4L0ZB 3E6MA 1W7PB 4MTDA 2HYGD 2FOKA 1F4KA 3GF2A 1XDUA 3P9CA 4LB6B 3KLOA 3ZMZA 3WTUC 4NB5A 2A6HF 2V79A 1DPRA 1KU9A 1MKMA 1CF7A 5F64A 4BQAA 4RGXA 1H9TA 3QPTA 2V1UA 1FLIA 3T1BA 4IRGA 2GXBA 1OYIA 1ULYA 3G73A 1YS7A 2HQNA 5E20A 3JAMZ 1J2XA 3T0YA 4ETSA 4KDPA 4L9JA 2Q8KA 1XGSA 4XSZF 5BQTA 2ACJA 4HLYA 3KP7A 4PDKA 1SAXA 3BPXA 3KFWX 4BXUA 4WK8F 1O3QA 1MGTA 2PBIA 1R23A 2PN6A 2ZMEB 4P5OA 2L3DA 4RB1A 1W7PD 5L3FA 4UXNA 4XRFA 3KLNA 3ELKA 3LWFA 1IXSB 1I6XA 4FX4A 1GHCA 1V3FA 5CVRA 2VBWA 1MDMB 1R58A 5IT9K 2RDPA 5ED4A 4CYDA 1ZHFA 1YW7A 5IT3A 1Z1DA 3G3ZA 1BBYA 1T98A 2HOEA 3DXJF 3J7AO 4Z2YA 3B73A 3R4KA 4IXAA 2IA2A 1R1UA 1BI3A 1MDMA 5LLQA 1FOKA 3FX3A 3N97A 1FYMA 1KU3A 4M73A 2DFIA 2CFXA 3GW2A 1R1TA 1SD6A 4U0YA 1YIOA 4GYGA 3FF5A 2XAQA 2M30A 3ECOA 4WXHA 2KIFA 1OMIA 2FEZA 1IN6A 2YU3A 1T39A 4HX4A 3DKWA 3KP5A 2DTRA 2EA2A 3C1DA 1SFXA 1WWXA 5CLSA 3F8NA 2YPRA 4G7OF 2HFHA 4KFCA 2ZFWA 2JSCA 2RVCA 1FYLA 2P7CB 1AOYA 4KN4X 2VXZA 1T0FA 2HQRA 1S8NA 1JGSA 3F6VA 5H20A 5D8LB 3M8EA 2GA1A 2JRTA 2XGXA 1QZZA 4N9HA 4EJOA 5ICEA 3CTAA 3FWEA 1ZGAA 2RC4A 3C3WA 1FSEA 1ZARA 3ECHA 1HQCA 1ZRCA 1USSA 1IUYA 1TQIA 4MQVA 4KIGA 4A12A 5HDNA 2EFOA 1PDNC 1UB9A 2Z5UA 1YO5C 2K02A 3WTWC 1OKRA 2FU4A 2H09A 2UXNA 2XAFA 2MA3A 3HSEA 4KYWA 2EV6A 4A5MA 3FM3A 1D8JA 4HZFA 2EWNA 2VODA 4CXFA 2BYVE 3CDHA 3HSFA 1BM9A 1WRJA 4Q4ZF 5ICGA 4A0YA 3F8MA 3GEZA 2H94A 1D3YA 2IJLA 4DNCA 4U88A 1XB4A 4HDUA 1S7OA 2XV4S 4HBLA 4N9IA 4FT8A 2QENA 1P6RA 2FXAA 1BI0A 2LNBA 4KN7X 3J81Z 4BNCA 3HSRA 2LSOA 2ETHA 5JVTA 2GQQA 4UHTA 2JZYA 3F72A 2HYFA 4I09A 3KP2A 2NS0A 4L9TA 1XDSA 1F9NA 1OYYA 2PFBA 2E1CA 4ESFA 4G8XA 2NNNA 1P4XA 4MGRA 2A6EF 1MZBA 2QLZA 3M8FA 3LQQA 3DV8A 2VE9A 3ZMUA 2HZTA 1ZYRF 4G9YA 4RAZA 1B59A 3GXOA 3CUQB 5HLHA 1U6GA 2ZKZA 5DD4A 2Z99A 1XCVA 2O0YA 3HRUA 1YG2A 2M5WA 1FWZA 3IKTA 4GYIA 4YG2F 3O2PE 1YW8A 1DP7P 4S04A 2P5VA 3WODF 2XAHA 1MJBA 4LD5A 1G3WA 2IA1A 5K5RA 3JSPA 1H0MA 1IW7F 4OIPF 3RKXA 4H0EA 4I2OA 4OIOF 3LAJA 1SFEA 3WU0A 1H9GA 1J75A 4QWQA 4IHTA 2IVMA 2FMYA 4WF2A 4LK0F 2M1BA 3ML6A 3L9FA 4KICA 4RGRA 1GXQA 1SD5A 5BS6A 2KJCA 1T6SA 2IRFG 2XIGA 1GXPA 4HOBA 2H6CA 4BHCA 4HF2A 5ICCA 3GVAA 1T38A 3N4MA 3F22A 3V8KA 1KYZA 1CGPA 1S3JA 2RQPA 5LHGA 2ZCWA 3IWFA 1I1GA 1QPMA 1O57A 4MQ9F 2KRFA 4BH9A 2OBPA 2XRNA 1ZRFA 1MJAA 4YFXF 1JHFA 2KIMA 4O5VA 1ODDA 3KCCA 5CJ9A 3TDUC 3JTHA 3U1DA 1XN7A 3LA2A 5LHHA 1T2KA 1YTYA 2PQ8A 2OA4A 2XROA 4IPAA 1IZ1A 3ZMVA 2L01A 3I71A 1XSDA 3F6OA 5BPDA 2HKXA 3I54A 4LGWA 3K1MA 5TRDA 2VT2A 3BOQA 1IAWA 2Z33A 1UCRA 4M9XA 3H92A 2E7XA 5LGUA 3BWGA 3LFKA 3QAHA 3SQNA 3RPQA 5L3CA 3L09A 5FD6A 3WGGA 1EH6A 3E6CC 2F5EA 3KP4A 3CLOA 1SD7A 3GFJA 2ZO4A 1C0WA 2EFNA 4XLPF 1FBSA 1IRGA 3QRFF 5BMZA 3FM5A 1EV7A 1B4AA 4MHGA 2QQBA 1BI1A 2Y48A 2YX7A 4KA4A 4ZYEA 2ESNA 1KU2A 5E1WA 2PEXA 1LEAA 1ZGJA 2XASA 2VONA 4WXDA 3VFZA 1B6AA 1FY7A 3SFZA 2H27A 2VE8A 1HXDA 1REPC 5DUIA 3TOBA 3GYHX 4AVPA 2FSWA 4ON0A 4BHBA 5DD8A 5K1YA 2QBYA 2GZWA 3PFIA 1HBXG 1BC7C 1BOAA 5F1RA 2ISYA 5H6QA 1YLFA 1IN5A 4MEYF 2EV0A 3W6KB 5HLGA 5LEJA 2OZ6A 5DCMA 5DEQA 1G3TA 3GWZA 4U0WA 3SHFA 4G7HF 4ZH4F 2ZJ2A 1FZPB 2EFWA 3K0LA 4HDVA 1FX7A 5HLIA 1RUNA 2L4AA 2FQ3A 2ZNZA 3V8JA 5FLXK 3F23A 2E7WA 3LA3A 3BJ6A 1U5TB 5FFZA 2YSRA 4OIRF 1DPUA 3FXUA 2O03A 5DUKA 3C7JA 1TW3A 4YIFA 2YX4A 3HHHA 4P55A 5FO5A 4I01A 2BV6A 1O3SA 5EEGA 3I58A 1PP7U 3TO9A 3MQ0A 1WQ2A 2STWA 5A2QZ 3HHGA 2D2WA 4LJZF 2A07F 2O6GE 4A0XA 4YFKF 3GLXA 3J80K 2DQRA 4PGHA 3RDIA 1S6LA 2R7FA 4G6DA 5L3BA 4I02A 4UUVA 3LQRA 6PAXA 2HEOA 1XSXA 1IF1A 5L3EA 2G9WA 1CF7B 1XGNA 2JPBA 1D8KA 3TDZC 5CVVA 2HS5A 3WGHA 1W5SA 1R00A 5DDGA 4M74A 5DV5A 4R1HA 4IF4A 4ENMA 1UHMA 2FA5A 3V7SA 2RN7A 4MTEA 1DUXC 1FBQA 1UFMA 2RNJA 3L2CA 2CYYA 4LB5A 4RGUA 2G7UA 2QWWA 3NRVA 4A0ZA 2HKOA 4CGZA 2A69F 4EQQA 2O8XA 3WGIA 3AAFA 2COMA 3RIRA 3ERED 1HKSA 1U3EM 2CW0F 5FGMA 4D0PA 1TQMA 5D5UB 1KQ9A 2VC0A
chains in the Genus database with same CATH superfamily
1JE8A 1FIPA 1PUFA 3JW4A 1K78A 2M4KA 5C3EJ 2VBXA 5HODA 3GFIA 2VBYA 3K2ZA 1ZLKA 3LSHA 2G0EA 1D0ZA 3ONQA 2P6TA 4EJUA 1P4WA 2PX9A 4ESBA 3FK7A 5F6FA 1TWHJ 3PNVA 3FHZA 1ZKGA 2QKMB 2VC1A 2MH9A 1X3UA 4AC0A 3MCZA 1MNMC 3TO6A 2LRDA 1F1ZA 1BN5A 2DT5A 1NG7A 4XQFA 1U5TC 1STZA 2WV1A 3ROUA 2WAQN 4KITB 1E3OC 4KNYA 3J7ZI 3X2QH 4I0BA 4JX6A 1IN8A 2HPMA 2L9VA 2A05A 2NNYA 3VDXA 2RAEA 4A3DJ 2MC4A 1KGSA 2E2IJ 4LLNA 2VI6A 4DYQA 3H3UA 2X0LA 5HDKA 1Z05A 4E6KG 3RI4A 2K3PA 4RGSA 1SMTA 2KJBA 1G3YA 3SZPA 3JTGA 1UHWA 5C4XJ 1TL8A 4EATA 5IYBJ 1NK3P 1FSHA 2EJRA 5AIQA 2R7OA 4ZC3A 4CHUA 4IRIA 2LDUA 3M7GA 2EQRA 2XDVA 1KU7A 4MEXF 1T95A 3HJEA 3PNTA 2LY2A 2W24A 3ZQGA 3V8LA 2CFOA 3AL0C 2HGCA 2CWEA 3QYBA 4HPQA 2M8EA 3BJOA 1BR4A 2B0LA 2WY8Q 3MN2A 4ESJA 4UNOA 2MC3A 3OS1A 4PZJA 1LNWA 3QPSA 4R8HA 2HQAA 2IS1A 1R5HA 4OMZA 1EJ9A 1V5GA 2WC2A 2O9LA 1FC3A 1X19A 1ON1A 2KFDA 4MLOA 3ZMTA 2E60A 3BR3A 3JSOA 5IT9Z 1T0FC 2X6WA 4HQEA 2PJRA 1RR7A 3BP8A 3ZP5A 4AIDA 1EH8A 3FXJA 4M6XA 3VB2A 1VQMI 2MABA 4AYBN 1OFCX 3HOSA 3HUGA 1OJLA 1E17A 2YS9A 1LE8A 3WG9A 3TKYA 3HTSB 3J81K 4OIQF 3OOUA 3G1OA 3CUOA 5CVUA 1K6OA 3RKYA 5AIPA 4X1EA 3BG7A 2KQRA 2HU9A 2HOTA 3MKLA 2JA2A 4ZDPA 3CO7C 4TV7A 3OYCA 1WJCA 3H5NA 5HS9A 5ILVA 2CGPA 5AONA 5EEHA 1RR8C 3PO2J 2X4HA 1YHQI 5GAHJ 3AL0B 2VOPA 4L5JA 4P96A 5EEAA 1LE8B 2DAOA 3GFLA 4M3FA 3DQVC 2BVMA 3PFYA 2GXGA 1TNSA 3OS0A 2ZXIA 3BR2A 5CQGA 5B66C 5E3NA 1U78A 3DU6A 3VPRA 2CO5A 2XF6A 1BIBA 4PUSA 2PI0A 2VJIA 3RPUD 2P7VB 3CCLI 3OSFA 2ZFUA 2BBYA 3J80Z 2NAZA 5F04A 3UR3C 3K1PA 2VOOA 1HKQA 4N4OB 3OMYA 2BEOA 3A02A 3MKZA 3M1CA 2DA5A 1NK2P 1HKTA 1KYWA 1JUPA 1PP8F 2BY2A 4J00A 3KZZA 3JRAA 1MIJA 1FTZA 1Z6RA 2NS8A 4ZDLA 3PO3J 2MGQA 4LLGF 4OMYA 1LJ9A 5FFXA 4KMFA 1MJ9A 3F8CA 3ZQLA 4FE4A 3GTPJ 3HPHA 3CO6C 1ZTRA 2CW8A 3HRSA 4E4HA 4NQWA 1B72A 2K27A 2Q1ZB 1R5ID 5H6RA 5LRSA 2WY7Q 4D5FA 4EV0A 3OYHA 1BC8C 4XLAA 3TP3A 1PVEA 2PG4A 4RLQA 3QQAA 4LK1F 4XKVA 4BY1J 1WFXA 1P4AA 2UXXA 3OV8A 4Q47A 1G59A 4M9SA 2FE3A 3HL2A 4QTRA 3ZQ7A 2UZKA 1Z0XA 3QODA 5HNFA 1MMSA 3HZJA 2QKLB 1TBXA 2A68F 3B02A 1WI9A 4UVBA 4AIKA 3BTIA 1O7LA 3ULQB 1WJAA 5JR3A 5JLWA 4Y15A 3ABKH 3I4NJ 4A93J 4CO8A 4K2EA 3D5LA 3F21A 4ZYHA 3ABLH 3I0TA 2EIMH 4CCNA 2DYSH 2L4MA 1IN4A 5D6FA 1JJ6C 3I53A 1R36A 1ZK8A 2A61A 2L5QA 2L9SA 3GTMJ 2P5LC 2HXIA 1LEBA 4FE7A 1S29A 2N8GA 4GXOA 3T8RA 4F91B 2EPFA 3OL3A 3L2QA 2CQXA 3PQKA 2EFPA 3CJQB 5GPAA 4PFOA 4RS8A 1HSJA 2DT6A 2JUGA 3TP0A 4IQ4A 4A3GJ 5ICFA 3QPLA 3G4SI 3R6SA 4ZZDA 1D1BA 3GX4X 2RNGA 1AA7A 4LFUA 1NH3A 1S7AA 2LBFA 2FNPA 1TQPA 1J09A 3DEUA 4CCLA 4CZZA 4F3QA 3I59A 3IRRA 4DBRA 3REOA 1NTCA 1ZAOA 4EJTA 3KIOA 2K7LA 2QUFA 4A5NA 4ZYGA 3HEFA 2IGNA 2XGCA 2CJJA 3S32A 2QYOA 3RJPA 5GTHC 5J40A 3L1PA 2FBHA 1GVJA 1YJNI 1EKEA 4MO7A 4BDYA 1JTYA 3WU1B 3F3XA 4G6TB 1P2FA 3CMAI 2EINH 3HRMA 2CQ7A 1X2MA 3CQZJ 4LMYA 4XKBA 1NHAA 1ON2A 2LC2A 3NEUA 5C4JJ 1VFCA 1W4MA 5D4RA 1VQ4I 2EK5A 3EUHA 3OYDA 3I59B 1HF0A 1QNTA 3K1NA 3WTVC 1RIOH 4UVCA 2L0KA 2VL8A 3GTQJ 3JRGA 1SVMA 2BE5F 5HLTA 1R4NB 5J8CA 3LA7A 1ZELA 4B44A 1TLHB 1A31A 3A1YA 2FD5A 2FNAA 3MZYA 3CDLA 3Q5FA 4NNJA 4OINF 3HUGB 4XN0A 1FOYA 2CQNA 2AO9A 4G7ZF 4BAYA 3HG9A 3PUFA 4JK1X 4A6DA 1FYKA 1FT9A 1LKXA 4NUBA 4BYYA 2EIKH 2DK5A 2VIXA 4IHVA 2IS2A 3H3ZA 1XCBA 2M45A 1WKMA 4LLLA 3QP6A 2OF7A 4P9FA 3TQNA 2H6BA 2X6XA 4PJ0C 3S1NJ 1ORKA 4V19K 2K9NA 2L9RA 4KJZA 3W2AA 4XLFA 2ELHA 3CUQC 1RUOA 3BQZA 3IL2A 5E1ZB 2KDOA 3OYIA 2KIQA 2OQGA 2ZXJA 3FXLA 4XLCA 2DMNA 4IHYA 5E8IA 2C6YA 5LRRA 4AWXB 2J5OA 2XB5A 1MD0A 2EB7A 2DBBA 1KZHA 2DA6A 2BGCA 2V6CA 1IXCA 4RMNA 3L2RA 1MBFA 4ZTFA 3OYMA 3I5UA 4UVAA 2IW5A 3DPTA 3T8TA 2JA8J 3CMEI 3VODA 1V4RA 5M3FJ 1KQ0A 3RYRA 4ENJA 2AS5F 2WAQA 4M71A 3CLQA 4CICA 1D1AA 4M9ZA 2LKSA 4IL6C 4LG3A 3LNQA 4ZDOA 3H9GA 5KK1A 4JQFA 2P81A 1YYVA 3TBIA 3FMSA 3K4MA 1F36A 2PMZA 1WZ2A 4WCGA 1V54H 1N25A 3GFMA 1P92A 4NQWB 1B72B 1B9NA 2XSDC 2E71A 1MMGA 3CMYA 2WWYA 4II2A 1Y0NA 4N0BA 2ECBA 4AD9A 1JTXA 2D1VA 1GDTA 2EH3A 1N78A 3WHCA 1VQ5I 5KAFC 3EYIA 1WJEA 2V26A 1MBKA 2W1OA 2DA7A 4DGWB 1OR7A 1ZG3A 3C2HA 2DFHA 4I7HA 1XD7A 2DA4A 2VPLA 4P1WA 2TDXA 3S1MJ 3NQOA 5EG0A 3C2BA 3S15J 1ETYA 2DQLA 3L2UA 2JPCA 4HX8A 1BIAA 3ESWB 2FRHA 1Z3YA 4LIUA 4G6QA 3M9AA 4A3CJ 4DZJA 2E2HJ 4NC6A 1EA3A 2M34A 2W4SA 3LSTA 1Z7UA 2JTVA 1UAAA 1TWFJ 1TW2A 1V5FA 4EM2A 2V1DA 4KIBA 4C30A 5CYVA 1A36A 2XF7A 1XS9A 4CDGA 1XC5A 2F48A 3PNYA 2VPRA 2X1DA 5EG0B 5JFRA 1QPIA 3A03A 5DTDA 2LKPA 3SYTA 1SFUA 1SFKA 2CQKA 1L0OC 2DK8A 2CSOA 2XKOA 4WWCA 4ASNA 3GTJJ 1OCTC 4CCMA 1BR2A 2KL4A 3C18A 5IY5H 5E18F 4XIDA 4NHJA 2QF7A 3S14J 1DQUA 1V55H 2EA4A 2M7BA 4LG0A 3IWZA 1X2NA 2IGMA 2TCTA 2V9VA 3ASOH 1HDPA 2DDAA 2L2OA 4UV9A 1OCZH 4BHPA 4DQ2A 1IRZA 2A5YB 2PMUA 3ZOBA 4Y7NJ 1WI3A 2AXLA 3H0DA 3BR0A 2L7FP 2RV8A 2GA2A 3BCAA 4B48A 4IZZA 1QZYA 1BI2A 2OZUA 3CCVI 1N77A 3IP4B 2XUBA 2OAZA 4EJWA 1YFHA 2W25A 2MD5A 3R0AA 1SMYF 2VKVA 2E34A 1ZLJA 3ASNH 3MFKA 5D4SA 3CP8A 3CCMI 2GAUA 1U8RA 3RYPA 2XSJC 1FP2A 1SD4A 3KP3A 1IC8A 3U9GA 1I50J 3M1EA 4AU7A 2Y0SA 3T5XA 4LG0B 4HNTA 1R7JA 3I4PA 4R79A 2QZ8A 3A0BC 4F7ZA 4PK4A 2R5YA 3H9QA 2RGVA 4UB8C 2LYCA 4KUMA 1EH7A 2F6CA 3SEQA 2JA5J 2ZXWH 3FXRA 4RB3C 1CQTA 2IA0A 4GFBA 2LLKA 5D6EA 4QPQA 3IV5A 4A6EA 4XRSG 2JT1A 1E2XA 3CUQA 3O6BB 3H5RA 1V5EA 1ZH5A 2K4BA 3PJRA 4RM2A 5K5OA 5K5QA 3V7CA 3VYUB 4UV8A 1IRFA 3LSJA 3MZHA 3OYAA 4CCKA 2F2EA 1BOBA 1DU0A 2F5CA 3CZ6A 4DIQA 3PUBA 1MW7A 5LGNA 1VQKI 5J1RA 1Z91A 2OQRA 4IVNA 2QQ9A 4BQNA 5IP6A 5FB2A 2P6SA 5FJ8J 1I1SA 4HG2A 2MH2A 1XSVA 4M3BA 3HRTA 3NARA 4E70A 2QSGX 3OIOA 2DN0A 1ZG1A 3VYRB 2MLGA 1ZG5A 3TOAA 4DOZA 1TZLA 1W36D 3DP7A 4B1RA 3EPZA 5EF6A 4FQGA 5FKMA 4J19A 2F5FA 2QVOA 1RI7A 2VN2A 4HLXA 1ONVA 3FK6A 5IYDJ 2G7HA 4L9NA 2PJPA 3WTZA 3ZMSA 3ERMA 2IS6A 4XRSA 1GLNA 3GO5A 4HNUA 4YELA 2YU9J 2BXYA 2GIVA 1TNTA 3ZN0A 3HOTA 1T33A 2HVRA 2FOWA 3BR1A 3R0JA 1E0EA 1D5VA 1TTYA 1Y1VJ 1XMKA 5E8GA 5B1AH 1IXRC 4U7DA 2A3SA 3KEQA 2JA7J 3SXYA 3SZGA 5CVJA 3RKWA 3DPLC 1APLC 2JQ7A 1YW9A 1RZ4A 1JGGA 2DI3A 1O3TA 1POGA 1OYWA 5GAEJ 4RBOA 2DO7A 5HOOA 1U5TA 5D5WB 2HWVA 2V7FA 1U2WA 2X6OA 2LY1A 2W00A 4P9UA 3P9IA 3S2DJ 4BBSJ 2B63J 3CC7I 2BHYA 4O6JA 1IJWC 1K4SA 4JBAA 5L3DA 2PMHA 2R7ZJ 1QHHD 4B3XA 4D7NA 2Y69H 3ZN1A 4BQOA 3COAC 3FMQA 1USTA 2EFQA 3DBRB 1SFOJ 2MG4A 3MKYB 4HV5A 2ZNYA 2VXDA 2XHKA 1XMXA 1XGOA 2STTA 2CS3A 1R71A 3MEXA 2EV5A 2V4JC 3QPHA 3L2WA 4W1UA 1P7IA 1K7AA 1QRYA 3P9KA 1J9IA 3GTGJ 2KP6A 2R7XA 3SJMA 2KZVA 1BJAA 2VKDA 2P8TA 1G6NA 1XG1A 4M3GA 4EM1A 3R60A 2M0CA 1KA8A 2VBZA 2ZSHB 3E6BA 2H1KA 2H1LA 2Y9ZA 3MKWB 1YQAA 2Z9OA 2D1HA 3TL4X 3KYDB 3MWMA 5J6XA 4ENNA 3HOYJ 1HSTA 1RKTA 2LOOA 1IDYA 2F5DA 3M07A 5A2QK 2XGEA 1ITYA 4RB0A 1UJ8A 2GXAA 2X85A 3QOEA 1ZR2A 2RREA 1UHSA 1ZREA 5EGOB 4IHSA 2K86A 2DPUA 3KETA 4HV6A 4ITVA 3K70D 5FLXZ 2IS4A 3ISPA 1F5TA 3KE2A 4G12A 2LKXA 1U9OA 4OAYA 2KHMA 3FHNA 2R3SA 1U8BA 4OWRB 4XBFA 4A2UA 1E3PA 4AIJA 1Q1HA 2Z16A 2K3FA 4L9VA 5HS8A 4FHTA 1RNLA 1R1VA 1T56A 2Z3YA 2FQ4A 3IKVA 1G4DA 2OC6A 4JOMA 1JXSA 2GBYA 2JRMA 2MD0A 4RA2A 1L3LA 5DM6F 4HF0A 1JHHA 4KT5C 2HDCA 2QQAA 3ABUA 4EVIA 4BU2A 3BZCA 1DP3A 2QM3A 1QBJA 2WTEA 4ENKA 2DLLA 2GLOA 1G2HA 3G1MA 1UG2A 4BJ6C 1FOWA 5TJJA 2W57A 5BOXA 3N05A 4B8XA 3GZ5A 2FF4A 3BR6A 4PCQA 3CCRI 3BC8A 1YS6A 3JAMK 3EUHC 1Y8QB 1GT0C 3W6JB 1QA6A 1WSUA 2DW4A 3FBNB 1QQIA 3GBGA 3IHUA 1H8AC 3M8JA 2NS7A 1HW5A 2QGUA 3BTLA 4I0AA 4IRHA 3Q9SA 1X1BA 2F4OB 4XLHA 4M3DA 4E7HA 3WTXC 1HW1A 2M2EA 1LB2A 3Q9VA 1MH3A 5ERIA 3DKXA 2F4IA 5TGTA 3HOXJ 4Q5SF 1I5ZA 3A4CA 3SZTA 2LF8A 2W84A 4XORA 1H88C 3WE2A 3P7NA 4EJVA 3K4BA 5CKTA 5ILSA 2O3FA 3WU2C 2K9SA 3E5QA 5DCMB 1HW2A 2E1MC 3HTUA 3OYEA 5E79C 4RB2C 5E17F 2CRGA 1WVRA 3S3MA 4KIFA 1LFBA 4BE1A 4IOCF 1B8IB 1Y56A 3C2GA 1KQ8A 5LEKA 1VQ9I 1RC9A 4HEA2 1ZRDA 2DTZA 4BXXJ 1YJ9I 2IPQX 4HAMA 3E3VA 1UG0A 3OOPA 5KVRA 4B09A 2LH9A 3HOZJ 1IRXA 2HXOA 2OTJI 2OJED 2CG4A 2HOAA 2D45A 2DFEA 2Y31A 3BJAA 2M87A 3L00A 2QBYB 2UWMA 3LSPA 2ELKA 2HTJA 4Q48A 1R6RA 4PGGA 1FNNA 1IO2A 3BPVA 3H36A 2FBKA 4IJAA 2HQ5A 3H0GJ 3F8BA 2XAUA 1ETOA 3BY6A 3V4GA 3KYCB 5J1UA 1G3SA 1W0UA 5M5YJ 2K85A 3BT9A 4OOIA 4BGDA 2E1OA 5HVQC 2K4JA 4BE2A 4RAYA 1IUFA 1ZN2A 3IUOA 3BROA 2WV0A 4ABZA 4EMSA 1YX3A 4HA8A 3WTTC 3QU6A 3RTRA 1XGMA 3FXMA 3S3OA 4XONA 1H89C 1N75A 4HW0A 3ZPLA 3AG2H 2CUZA 3ZQFA 1M1EB 3H5AA 1B1BA 1R5GA 2FMLA 2L02A 4DYCA 2E5NA 3WTYC 2FBIA 1I6HJ 5D5XB 3QU3A 1J5YA 4WXCA 5K7FA 4XICA 3M3YJ 5LBQA 3VWBA 1JJ8C 5E1XA 2J5PA 2VT3A 2P5KA 2O7OA 4EM0B 3D1NI 5JI6A 2WA0A 5JLXA 2W85A 3VOEA 2ADUA 4BJ5C 1LVAA 2OD5A 2ELJA 5LGTA 2V1XA 1VTNC 2BXZA 3CCJI 2Z1DA 2R7DA 3K10A 1Q1VA 1QO0D 4XSXF 3LL7A 4AM3A 3AG4H 3JCUC 1SANA 4L5EA 1JT0A 2HVQA 2IGKA 1JT6A 5CVIA 3CD6I 3IC7A 4F55A 2L54A 2IT0A 2LVSA 4UUSB 1R22A 2ID6A 1JUMA 3FMRA 1DDNA 1FEXA 3OYFA 1I27A 4EGZA 4HF1A 4PJMA 4C3HJ 4Y17A 4RAGA 3IH3A 3KP6A 3K9TA 1A04A 4O3MA 1AWCA 3KPHA 2DA1A 3QYFA 3F8FA 1FMWA 3GZ6A 4U87A 4RDUA 5J1YA 1I3AA 3RSNA 2CUJA 3B6CA 4C2TA 2R7UA 4ZYDA 2VJ4A 2FX0A 3O8HA 2BHZA 2DU9A 2NOJB 5HDGA 4HQMA 4UUSA 4YIIA 2Q0OA 1X1AA 1Z9CA 5J8FA 1VQ8I 3DTKA 2LF7A 2XVCA 5LHIA 1GV5A 1SAUA 2K5CA 3NWTA 5L3GA 4BEHB 4S05A 4M6YA 4NC7A 1Z6TA 3DFGA 3H3VK 4M72A 4L18B 3EDPA 3BDDA 3HOUJ 1D0XA 4U0VA 2R0QC 3E97A 1K79A 5FD5A 3FIWA 1GV2A 1O3RA 3MAJA 2NOGA 3K69A 2M3AA 4UB6C 1Y0UA 3LAPA 4BL0B 5C44J 3QOPA 2Y75A 2GWRA 1LDJA 3L7WA 2HR3A 1OPCA 3DPUA 3ZMDA 1J59A 2X1CA 3CJRB 2H8RA 4A3LJ 4MNUA 2NVUB 1SC7A 5BPIA 3E6DA 4GCVA 3V7RA 4OU0A 4GO1A 1Z7LA 1FPQA 1MBGA 3OYKA 2KMUA 3O3KA 3PQJA 2IP2A 2HTSA 2XKPA 3E5UA 4YFNF 1O7FA 1RETA 2P4WA 4CYCB 4LITA 4XOTA 3S2WA 2KIUA 3TGNA 2E1NA 3VEPA 4AVZA 1LVKA 5F1JA 1LPQA 1JKOC 2ESHA 5EYRA 3V42A 4CH7A 4HSRA 3PM1A 3ZQHA 2NRAC 1K4TA 1QVUA 2ZMEA 3CJNA 3HIFA 1W36C 3CCSI 1Y1WJ 4GGGA 2IXSA 3OS2A 5EZHA 5D5VB 2ISZA 2IAIA 1W5TA 4JP0A 2RKHA 4L0YB 1VZ0A 3WTSC 2M7AA 4XLNF 3H1CA 4HX7A 3KEOA 2WAFA 1PUEE 4YIRX 4YEJA 3FKJA 4WX9A 4YRVA 2MLKA 5JHUA 3S17J 2ZBKA 3EUAA 1B9MA 2MSYA 1I39A 3W2WA 3K7AJ 4OAZA 5M5WJ 4ZYAA 2OTLI 4S0HB 3FXQA 3I64A 4PSXA 2BY3A 2O5RA 5JHFA 2R5ZB 4FCYA 2MBFA 4U7BA 1AKHB 2JMWA 4G94A 1OCPA 1Y39A 3WE3A 3S8PA 4KMUX 3EYYA 4Y13A 1LDDA 3FZVA 1R49A 1WH7A 2ID3A 3U2RA 3IRQA 2KKOA 2BW3A 1YIJI 1ETXA 2JVHA 2OPTA 1IN7A 5FKLA 2NYXA 3VSKA 2HVSA 3M4OJ 3ABTA 3TW6A 4I98B 3RPUA 5BNGA 3R61A 1K78B 1XMAA 5TISC 2KDZA 4FX0A 1WCMJ 3E5XA 2XAJA 4L5IA 3BZ6A 3ZGKA 2R5ZA 1AKHA 4ZZLA 2OCCH 4HYEA 3HYIA 2WB1N 3LSKA 2DDBA 2DPDA 3OR1C 5IOZA 2XAGA 5F0HA 2BW3B 2E5ZA 3QP5A 1J7KA 5ILUA 2KRHA 2Q2EA 2DYRH 4D1QA 2JJ7A 1F43A 4EGYA 1WPKA 1YOVB 2OU2A 1X1PA 2LK2A 2I10A 3EETA 1QGPA 3D0SA 3TO7A 5DCFA 1W7PA 1LDKB 2HPIA 4PJJA 5J47A 2O61A 2Y0MA 2EBIA 2BY0A 4XM3A 1HA8A 1FBUA 2ICWG 1FP1D 2MFZA 3DTEA 4QLCU 2VJJA 2O8KA 3KZYA 5D8KB 1J0RA 2YR2A 3EQLF 4CSWA 5IYCJ 1LQ1A 4XLEA 3HKZN 4AIHA 4RM3A 5HS7A 3MMYB 3Q0WA 3DF8A 3OSGA 4C2MJ 2PLYA 1JUSA 3GUDA 3HC7A 1JKQC 1BW6A 5DYMA 4L0ZB 2LTPA 1RKWA 3CC4I 3TMOA 3I56I 2M4GA 3E6MA 1W7PB 4Z6YA 1D0YA 3CCYA 2Y9YA 4MTDA 2K9QA 2KZGA 2CQQA 3UKGA 1PYVA 3LSRA 2HYGD 2FOKA 1F4KA 1YI2I 2L9NA 3GF2A 1XDUA 2BOLA 3F0CA 3P9CA 4LB6B 2XPVA 3KLOA 1TT5B 3ZMZA 3WTUC 4NB5A 4H4KC 2B7EA 1A35A 5E3OA 3OYGA 2A6HF 1Z67A 2V79A 4A3JJ 1AU7A 1EF4A 1DPRA 1KU9A 1FMVA 1MKMA 1X3WB 3TW7A 1CF7A 1HLVA 5F64A 2IEKA 3SEZA 4BJTA 2I5UA 4BQAA 2GOXB 3O8GA 4RGXA 3TEDA 3ABMH 2EZIA 3QPTA 1H9TA 4E7KA 4DBQA 2H8WA 4IQJA 2HYJA 2V1UA 2L7MP 1FLIA 4BEHA 1TWCJ 3T1BA 4IRGA 2GXBA 1OYIA 1ULYA 2EZKA 3D5SC 4PJNA 4A3EJ 3G73A 1YS7A 2HQNA 5DS9A 4V2GA 5E20A 3JAMZ 3HPGA 3BCBA 1J2XA 1VQOI 1OCRH 1AHDP 2CW7A 1OISA 2DT7B 3T0YA 4ETSA 1JI8A 2XB0X 4KDPA 2CV2A 4ZTJA 4XOPA 4L9JA 4E7SA 3MVPA 2Q8KA 1XGSA 3JRFA 4XSZF 3DWLE 3OIPA 5BQTA 2D5VA 2ACJA 3ZRGA 3KP7A 4PDKA 4HLYA 1SAXA 3SFIA 3BPXA 1R4MB 1YITI 2W48A 1IG7A 1TT0A 3KFWX 4BXUA 3BG6A 1VQLI 2E1MB 4WK8F 3IH2A 1O3QA 1MGTA 2PBIA 2E19A 3DU5A 1R23A 4A3MJ 3S93A 2PN6A 2ZMEB 4P5OA 2L3DA 4RB1A 1W7PD 2MW8A 5L3FA 1X1CA 4UXNA 5HNHA 4XRFA 1QU3A 2VASA 3JRBA 3KLNA 1TWAJ 3ELKA 1O4XA 1Z21A 2B9SA 3LWFA 4FISA 3OY9A 1IXSB 1I6XA 4FX4A 1FOXA 1GHCA 1V3FA 2DMQA 5CVRA 3S1QJ 2VBWA 4ZJZA 3K4LA 3OYLA 2BVLA 1MDMB 1R58A 3AKZA 5IT9K 2RDPA 5ED4A 4CYDA 2QA4I 1ZHFA 1YW7A 4A69C 5IT3A 1Z1DA 3G3ZA 1BBYA 1T98A 2HOEA 4IKFA 3DXJF 3J7AO 3SDBA 1MMDA 3BTJA 4B47A 4F52A 4Z2YA 1OLTA 2VQGA 3B73A 3R4KA 4IXAA 3LMMA 4E7JA 3HM5A 3U21A 2IA2A 2JK3A 3HGYA 1TP4A 1K83J 1R1UA 1BI3A 1ACIA 1MDMA 5FLMJ 2LFBA 1R9TJ 5LLQA 1FOKA 2FJ1A 2LP0A 3E0JB 3FX3A 3N97A 5J4YA 1FYMA 1W5CC 3OYNA 2I8DA 1MSEC 1KU3A 4M73A 2DFIA 2A6TA 2CFXA 3GW2A 4XRMA 1R1TA 3JRCA 2DA3A 2JSPA 1SD6A 4B43A 2Y2ZA 1YIOA 4U0YA 2Q2EB 1Y8RB 4UUTA 4N4NB 4CZCA 3K4CA 4GYGA 5M5XJ 1TWGJ 3FF5A 2XAQA 2M30A 3ECOA 3FISA 4I76A 3NAUA 4WXHA 2KIFA 1LFPA 4X6AJ 1OMIA 2FEZA 3NWSA 3GTLJ 1IN6A 2YU3A 2GM4A 1T39A 1SVOA 4HX4A 2CH0A 2DCEA 3DKWA 3BG9A 4PFPA 1JKPC 3J7AY 3AG1H 3KP5A 4MFEA 3ZQCA 3HOWJ 2W82A 2DTRA 2LREA 2EA2A 3C1DA 3CC2I 2VB6A 1UELB 4A3IJ 2PJRB 1SFXA 5GAGJ 4BBRJ 1WWXA 5CLSA 2ME6A 3F8NA 2YPRA 3CP2A 3WG7H 4G7OF 3ZXSA 2CMPA 3QWLA 2HFHA 4KFCA 5FKKA 2ZFWA 2QEXI 2JSCA 2RVCA 3MD2A 1FYLA 3AG3H 2P7CB 1AOYA 4KN4X 1BL0A 5H2FC 1P9QC 2VXZA 1T0FA 3PL8A 2HQRA 2LMDA 4PSWA 1S8NA 1JGSA 3F6VA 5H20A 5D8LB 4D9JA 1YJWI 4XL9A 3M8EA 2GA1A 2JRTA 1A6QA 2XGXA 2HDDA 1QZZA 4N9HA 4DJAA 4EJOA 3DEWA 3GCMA 3FXKA 5ICEA 3CTAA 5K7HA 2NVYJ 3FWEA 5J4VA 3LSGA 2TRTA 1ZGAA 2RC4A 3C3WA 4BQQA 3CDIA 4Y52J 1FSEA 1ZARA 1BA5A 3ECHA 2Y0SN 2WBMA 4E7IA 3OL4A 1HQCA 1ZRCA 1USSA 2P0WA 5F0FA 1IUYA 1TQIA 4MQVA 4BDZA 4KIGA 2HOSA 4A12A 5LD2C 5HDNA 5B5EC 3LFUA 2VQCA 2EFOA 1PDNC 1UB9A 2Z5UA 1YO5C 2K02A 3WTWC 1OKRA 2FU4A 2H09A 2UXNA 4C2UA 1DGWY 1ERDA 2XAFA 2MA3A 2UV1A 1VF9A 3RZOJ 2HI3A 3K4KA 1WJDA 5IP9J 2OUMA 3HSEA 5JVGF 4KYWA 2EV6A 4A5MA 2VKHA 3K4NA 1U9NA 3FM3A 1UZCA 1D8JA 4HZFA 2EWNA 2R7RA 4GDFA 2VODA 4CXFA 2BYVE 2JWTA 3CDHA 3HSFA 2XC7A 1BM9A 1WRJA 4Q4ZF 2GOMA 2NVQJ 5ICGA 1A6IA 3P5JA 4A0YA 3F8MA 3GEZA 2H94A 1D3YA 2IJLA 4DNCA 4U88A 4CA0A 1GVDA 4XKWA 2Y30A 1MNDA 1XB4A 1S7OA 4QPOA 4HDUA 2XV4S 5GPCA 5F08A 4HBLA 4JYKA 4N9IA 5GADJ 5FLVA 4FT8A 2QENA 1P6RA 3OIQA 2FXAA 1BI0A 2LNBA 4KN7X 3J81Z 4BNCA 3HSRA 3HGGA 2LSOA 3G71I 2ETHA 1T8IA 1MMAA 1XX5A 2EILH 5JVTA 2IGOA 2GQQA 1BW5A 4UHTA 2JZYA 3F72A 3KEYA 2HYFA 3GLLA 3GZNB 4XN3A 4DW6A 4I09A 4BS9A 1W1WE 3S3NA 2XPWA 2DMTA 2V6EA 2QSFX 5KCMA 3KP2A 2NS0A 4L9TA 1XDSA 4I99C 3CCUI 3BR5A 5J3LA 2ZJQF 1W0TA 1F9NA 1OYYA 2PFBA 2E1CA 1DU6A 4ESFA 4G8XA 2NNNA 2AQFA 1P4XA 3I3LA 4MGRA 4NBQA 4JX4A 2A6EF 1MZBA 2LBFB 2QLZA 1IV8A 3RQIA 3M8FA 2R7SA 3K4JA 3LQQA 3DV8A 1FIAA 3S16J 2VE9A 3J7YJ 3ZMUA 2HZTA 2ZB9A 1ZYRF 4G9YA 3DKYA 4IOAF 4Y4RA 4RAZA 1Z3XA 1B59A 3GXOA 2ZMEC 3OYBA 2DOAA 3CUQB 1OCOH 2DMPA 5HLHA 2LD5A 1U6GA 2ZKZA 5DD4A 2Z99A 1XCVA 2QCOA 4MFDA 1ETWA 1ZR4A 2O0YA 3HRUA 1YG2A 3LSMA 2M5WA 4FTHA 2ECCA 3Q0UA 1FWZA 3JREA 2CUEA 1MSFC 1QZEA 3IKTA 3DCFA 4GYIA 1ETVA 2IBDA 2V1NA 4YG2F 3O2PE 3BLYA 1YW8A 2X6YA 4S04A 2P5VA 3WODF 2R7WA 1DP7P 1IGNA 2XAHA 1MJBA 2A5WA 4LD5A 1G3WA 2IA1A 2PMZN 5K5RA 3JSPA 1H0MA 1IW7F 1I3QJ 4OIPF 3RKXA 4H0EA 3Q0VA 2DOFA 4I2OA 4OIOF 3BZKA 3LAJA 1YX5A 1SFEA 3WU0A 1H9GA 1J75A 4QWQA 4CUGA 4HSTA 3DLLF 4IHTA 2EIJH 1JKRC 4KT6A 2ZSIB 5KHDA 2IVMA 2FMYA 4WF2A 4LK0F 2M1BA 3ML6A 3L9FA 1ENHA 3E7LA 4KICA 1FTTA 3K70C 2R92J 4RGRA 3RQ4A 1GXQA 5KAIC 1SD5A 5BS6A 1WJBA 4HNVA 2KJCA 2FUG2 1T6SA 3CESA 1YRNA 2IRFG 2XIGA 4XR6A 4HOBA 1GXPA 2DJIA 4IEJA 3JRIA 2H6CA 1VNDA 2JUCA 4BHCA 4M6VA 4HF2A 4CCJA 5ICCA 4J01A 3GVAA 3RKQA 1T38A 3L2VA 2M0MA 3VYSB 4BKXA 3N4MA 4E7ZA 3F22A 3V8KA 1KYZA 4BXFA 1S3JA 2JVGA 3G1LA 1CGPA 5M3MJ 5F27A 4V2FA 1RESA 2ZXHA 5K7ZA 2RQPA 2VUMJ 5LHGA 2ZCWA 3CF5F 3UNGC 3IWFA 4BUPA 1I1GA 1QPMA 2BZTA 3BG3A 1O57A 4MIMA 4MQ9F 4AUXA 1S7EA 2KRFA 4BH9A 2OBPA 2XRNA 3LOCA 1MJAA 4YFXF 1ZRFA 1JHFA 2KIMA 2WAEA 4O5VA 1ODDA 3KCCA 1MBHA 5CJ9A 3TDUC 3RCOA 3JTHA 3U1DA 3W3CA 1XN7A 3LA2A 3GTKJ 2R7VA 5LHHA 2XGDA 1ETKA 3RZDJ 5EGOA 3DBLB 4XKCA 1T2KA 2HZDA 4NDLA 1YTYA 3Q3SA 2PQ8A 2OA4A 2CU7A 4BE0A 2LR8A 1HC8A 2XROA 2EZLA 4IPAA 1HCRA 2GIZA 1IZ1A 3ZMVA 3HXLA 3SDGA 4LIVA 2L01A 1QHGA 3I71A 5F0CA 2W7NA 1XSDA 3PIOF 5FRNA 5E3LA 4HRIA 3F6OA 4C3IJ 3DBHB 2AXTC 2HKXA 2L7KA 3I54A 4LGWA 4B4CA 3S1RJ 5BPDA 3K1MA 5TRDA 2VT2A 2K40A 3BOQA 1G8XA 1IAWA 2Z33A 1UCRA 4M9XA 3H92A 3JRDA 2XF5A 5LGUA 1WGXA 1MMNA 4IO9F 3G2BA 3W6VA 3BWGA 3LFKA 3A01A 2R7TA 4X0GA 2HNHA 1Z77A 2V9KA 3QAHA 1OQYA 3LSIA 3OYJA 3SQNA 3RPQA 3KX2A 5L3CA 3L09A 4I6ZA 5FD6A 1BR1A 1MNEA 3WGGA 4DYRA 1VQ7I 1X4PA 1EH6A 2AHQA 2OCEA 3DEEA 3E6CC 4Y33A 4CCOA 2F5EA 3KP4A 3CLOA 3GMEA 3K6GA 1SD7A 3GFJA 2ZO4A 1WJFA 1C0WA 3OWTA 2EFNA 3U1KA 4XLPF 2MYSA 1FBSA 1S5LC 3A01B 4A3FJ 1IRGA 3QYEA 3QRFF 5BMZA 3FM5A 3HDDA 1X1DA 2ZC2A 1KONA 1EV7A 2ZJPF 3F9KA 1B4AA 1PJRA 4IHXA 4MHGA 2QQBA 1OCCH 1BI1A 2Y48A 3D5RC 2R93J 2OV7A 2YX7A 3AFHA 4XK4A 2E35A 4KA4A 4ZYEA 2RQQA 3FKIJ 2ESNA 2QQ8A 1UMQA 4BACA 1KU2A 3OR2C 5E1WA 2PEXA 2Z2SB 2X1EA 2R5YB 1D5YA 2X9DA 3CMMA 3A0HC 5FKNA 1VQNI 4A3KJ 1LEAA 1ZGJA 2XASA 4AYBA 2VONA 1QVTA 2LY9A 4WXDA 3VFZA 1B8IA 4CYCA 1B6AA 1XPXA 2CUFA 3HKZA 3PSFA 2DMUA 1FY7A 2X48A 3SFZA 5IOYA 1RRJA 2KT0A 2F4MB 2H27A 2VE8A 2VKEA 1HXDA 1REPC 5DUIA 3TOBA 3HB9A 3GYHX 4AVPA 2FSWA 4ON0A 1T08B 4BHBA 1X58A 5DD8A 3CCEI 5K1YA 2QBYA 2GZWA 5E3MA 1BJZA 1K6YA 3PFIA 1X3ZB 1RPWA 1HBXG 2AQEA 1BC7C 3IAS2 2WADA 3S2HJ 3FBIB 1BOAA 4IHWA 1IDZA 1GUUA 4QIWN 1E3HA 5F1RA 2ISYA 5H6QA 1PUFB 1YLFA 2ZJRF 4KISA 1IN5A 4MEYF 2KPMA 1ETQA 3PIPF 2EV0A 3W6KB 1XTAA 5HLGA 3DLAA 5LEJA 2X51A 3W2VA 2OZ6A 1YRNB 4D7MA 5DCMA 1SVLA 5DEQA 1G3TA 3K2AA 3GWZA 4U0WA 3SHFA 4G7HF 2KLOA 3E1SA 4ZH4F 5FKOA 3A2KA 2ZJ2A 1FZPB 1ZGWA 5IP7J 2EFWA 1WH5A 3CCQI 3K0LA 2DFFA 2COBA 4B3AA 4HDVA 4Y3OA 3HBLA 1FX7A 4RLFA 5HLIA 4E7LA 5FROA 1RUNA 3H35A 2L4AA 2FQ3A 2ZNZA 4FETA 1K61A 1MBEA 3V8JA 5FLXK 2ME0A 3F23A 2E7WA 2K9LA 3LA3A 9ANTA 2QSHX 3PSIA 3BJ6A 1U5TB 5FFZA 2YSRA 3VYTB 3BG5A 4OIRF 4F92B 1DPUA 3FXUA 3ZQQA 2O03A 5DUKA 1S72I 3I4MJ 3C7JA 1TW3A 1WHUA 4YIFA 2YX4A 3CJTB 3HHHA 5EJCA 4P55A 5EDNA 5FO5A 4I01A 4II3A 2BV6A 2VQHA 2V9PA 2CV0A 5GP9A 5CQEA 1O3SA 4W97A 4JX5A 4C9YA 4D5CA 5EEGA 1OR7C 1IV6A 5B3SH 3I58A 2NXNB 5DM7F 1PP7U 2DODA 1MH4A 1VI0A 2VQLA 2DOEA 3TO9A 5GTIC 3MQ0A 1WQ2A 2L7ZA 1D1CA 2STWA 2NVTJ 5A2QZ 1LUJB 3KYLA 3G6EI 3HHGA 1WJ5A 2BY1A 2D2WA 4LJZF 2A07F 3HOVJ 2O6GE 4A0XA 1YE9A 4A3BJ 2WB1A 4YFKF 2F5VA 3GLXA 1NG6A 2KRCA 4NC8A 3JRHA 3J80K 4M3EA 4GRIA 1U0JA 2DQRA 4PGHA 3RDIA 3I55I 1ZQ3P 3GTOJ 2KISA 1S6LA 2R7FA 2XRLA 5FRMA 4FASD 2EZHA 4IX7A 4G6DA 5L3BA 2YUSA 1X4OA 1VQ6I 4I02A 5KNLA 4UUVA 3LQRA 4XMYA 6PAXA 2HEOA 1XSXA 2HDWA 4RAFA 1IF1A 1SEUA 5L3EA 2G9WA 1CF7B 4QSHA 1XGNA 3ZR8X 2JPBA 2CV1A 3JR9A 5EZGA 1D8KA 2VJ5A 3TDZC 5CVVA 2HS5A 3WGHA 2E2JJ 1W5SA 1R00A 3EUKL 4ANJA 2XPUA 1Y6IA 5DDGA 1FJLA 1KQ9A 4M74A 2UUZA 5DV5A 4R1HA 4EEFG 4IF4A 4ENMA 1VQPI 3ZQIA 3BTCA 5CPRB 5LFAA 1UHMA 2R4GA 1HDDC 1DGRM 3I9V2 4LOCA 3H9JA 3VSLA 2JA6J 3IAM2 2FA5A 2RN7A 3MZ8A 4MTEA 2K9MA 3V7SA 2M9HA 1DUXC 1FBQA 1S9HA 1UFMA 1MBJA 2RNJA 2M8GX 5IPAA 3L2CA 2E36A 2LG4A 2CYYA 4LB5A 4RGUA 4PJLA 2G7UA 2R7QA 3BQYA 2QWWA 1TC3C 3NRVA 3B6AA 3WHBA 4A0ZA 2HKOA 3IH4A 2A69F 4CGZA 4DZPA 3FXOA 2DJNA 4EQQA 1LFUP 5B1BH 1P7JA 2JN6A 2O8XA 3DTIA 4F93B 3KZIC 3WGIA 3ZCOA 2DA2A 3AAFA 2COMA 4BY7J 2VLAA 1HOMA 3RIRA 2DXIA 4XNFA 3ERED 1HKSA 1U3EM 2CW0F 5FGMA 4D0PA 1A5JA 1TQMA 4C3JJ 5D5UB 3FDYA 3CF2A 4UY8I 2E7XA 2NVXJ 2VC0A
chains in the Genus database with same CATH topology
1JE8A 1K78A 3JW4A 2VBXA 3GFIA 2VBYA 3K2ZA 1ZLKA 2P6TA 4EJUA 1P4WA 4ESBA 5F6FA 3FHZA 2VC1A 2MH9A 1X3UA 3MCZA 3TO6A 1F1ZA 1BN5A 2DT5A 1U5TC 1STZA 3ROUA 4KNYA 4I0BA 1IN8A 2NNYA 4LLNA 1KGSA 3H3UA 2X0LA 5HDKA 1Z05A 3RI4A 4RGSA 1SMTA 2KJBA 1G3YA 3SZPA 3JTGA 1UHWA 1FSHA 2EJRA 5AIQA 4CHUA 4IRIA 2LDUA 3M7GA 4MEXF 1KU7A 2W24A 3V8LA 2HGCA 2CWEA 2M8EA 3BJOA 2B0LA 4ESJA 4UNOA 2MC3A 4PZJA 1LNWA 4R8HA 1R5HA 4OMZA 2WC2A 1FC3A 1ON1A 3ZMTA 3JSOA 5IT9Z 4HQEA 3BP8A 3ZP5A 1EH8A 4M6XA 3VB2A 3HOSA 3HUGA 1E17A 3WG9A 3TKYA 3HTSB 3J81K 4OIQF 3CUOA 5CVUA 1K6OA 3RKYA 5AIPA 3CO7C 4TV7A 5HS9A 5ILVA 2CGPA 5AONA 5EEHA 2X4HA 2VOPA 4L5JA 4P96A 2DAOA 3GFLA 3DQVC 2GXGA 1TNSA 1U78A 2CO5A 1BIBA 2PI0A 2P7VB 2BBYA 3J80Z 2NAZA 2VOOA 3K1PA 1HKQA 2BEOA 1HKTA 1KYWA 1PP8F 3KZZA 1Z6RA 4LLGF 4OMYA 1LJ9A 5FFXA 4KMFA 1MJ9A 3F8CA 3CO6C 3HRSA 4NQWA 2K27A 5H6RA 5LRSA 4EV0A 1BC8C 2PG4A 4LK1F 4Q47A 1P4AA 2UXXA 3OV8A 4M9SA 2FE3A 3ZQ7A 2UZKA 1TBXA 2A68F 3B02A 1WI9A 4UVBA 4AIKA 1O7LA 3ULQB 5JR3A 4Y15A 4CO8A 4K2EA 3D5LA 3F21A 4ZYHA 3I0TA 2L4MA 1IN4A 5D6FA 3I53A 1R36A 2A61A 2P5LC 1LEBA 1S29A 3T8RA 4GXOA 3PQKA 2EFPA 4RS8A 1HSJA 5ICFA 3R6SA 4ZZDA 3GX4X 4LFUA 1S7AA 2FNPA 1TQPA 4CZZA 3DEUA 3I59A 3IRRA 3REOA 1ZAOA 4EJTA 2K7LA 2QUFA 4A5NA 4ZYGA 2QYOA 3RJPA 2FBHA 1GVJA 3WU1B 3F3XA 1P2FA 3HRMA 4LMYA 1NHAA 1ON2A 3NEUA 1W4MA 5D4RA 2EK5A 3EUHA 3I59B 1QNTA 3K1NA 3WTVC 1RIOH 4UVCA 2BE5F 5J8CA 3LA7A 1TLHB 2FNAA 3MZYA 3Q5FA 4OINF 4G7ZF 4BAYA 4A6DA 4JK1X 1FYKA 1FT9A 4BYYA 2DK5A 3H3ZA 1XCBA 2M45A 1WKMA 4LLLA 3QP6A 4P9FA 3TQNA 2H6BA 2ELHA 3CUQC 1RUOA 3IL2A 5E1ZB 2OQGA 2ZXJA 5E8IA 2C6YA 5LRRA 4AWXB 2J5OA 1MD0A 2EB7A 2DBBA 2BGCA 2V6CA 1IXCA 3I5UA 4UVAA 2IW5A 3DPTA 3T8TA 3VODA 1V4RA 1KQ0A 3RYRA 4ENJA 2AS5F 4M71A 4CICA 4M9ZA 5KK1A 4JQFA 1YYVA 3FMSA 4WCGA 3GFMA 1P92A 1B9NA 2WWYA 4N0BA 4AD9A 2D1VA 3EYIA 1OR7A 1ZG3A 4I7HA 1XD7A 2TDXA 3NQOA 2DQLA 2JPCA 4HX8A 1BIAA 2FRHA 4G6QA 3M9AA 3LSTA 1Z7UA 2JTVA 1TW2A 4EM2A 2V1DA 4KIBA 5CYVA 4CDGA 5JFRA 2LKPA 1SFUA 2CQKA 1L0OC 2DK8A 2CSOA 2XKOA 4WWCA 4ASNA 3C18A 5E18F 4NHJA 2EA4A 4LG0A 3IWZA 2V9VA 4BHPA 4UV9A 4DQ2A 2A5YB 2PMUA 2AXLA 2RV8A 2GA2A 1QZYA 1BI2A 2OZUA 4EJWA 2XUBA 2OAZA 1YFHA 2W25A 2MD5A 3R0AA 1SMYF 3MFKA 1ZLJA 5D4SA 2GAUA 1U8RA 3RYPA 1FP2A 1SD4A 3KP3A 3U9GA 3M1EA 3T5XA 4LG0B 1R7JA 3I4PA 4R79A 2QZ8A 4F7ZA 2RGVA 4KUMA 1EH7A 3FXRA 4RB3C 2IA0A 5D6EA 4A6EA 2JT1A 1E2XA 3CUQA 3O6BB 1ZH5A 2K4BA 5K5OA 5K5QA 3V7CA 4UV8A 1IRFA 3MZHA 2F2EA 2F5CA 5LGNA 1Z91A 2OQRA 4IVNA 2QQ9A 5FB2A 1I1SA 2P6SA 2MH2A 1XSVA 3HRTA 4E70A 1ZG1A 2MLGA 1ZG5A 3TOAA 3DP7A 2F5FA 2QVOA 1RI7A 2VN2A 4HLXA 1ONVA 2G7HA 4L9NA 2PJPA 3WTZA 3ZMSA 3GO5A 2GIVA 3ZN0A 1TNTA 3HOTA 3R0JA 1D5VA 1TTYA 1XMKA 5E8GA 1IXRC 4U7DA 2A3SA 3KEQA 3SXYA 5CVJA 3RKWA 3DPLC 1YW9A 1RZ4A 2DI3A 1O3TA 1OYWA 2DO7A 5HOOA 1U5TA 5D5WB 2HWVA 1U2WA 4P9UA 3P9IA 4O6JA 4JBAA 5L3DA 2PMHA 3ZN1A 3COAC 3FMQA 1USTA 2EFQA 4HV5A 2ZNYA 2XHKA 1XGOA 2STTA 3MEXA 2EV5A 3QPHA 1J9IA 1K7AA 3P9KA 1BJAA 2P8TA 1G6NA 4EM1A 3R60A 1KA8A 2VBZA 3E6BA 1YQAA 2Z9OA 2D1HA 3MWMA 5J6XA 4ENNA 1HSTA 2F5DA 5A2QK 4RB0A 1ZREA 4IHSA 2K86A 2DPUA 3KETA 4HV6A 5FLXZ 3ISPA 1F5TA 3KE2A 2R3SA 4XBFA 4A2UA 4AIJA 1Q1HA 4L9VA 5HS8A 4FHTA 1RNLA 1R1VA 2Z3YA 3IKVA 1G4DA 1JXSA 1L3LA 4HF0A 1JHHA 4KT5C 2HDCA 2QQAA 3ABUA 4EVIA 2QM3A 1QBJA 2WTEA 4ENKA 2DLLA 5TJJA 2W57A 5BOXA 4B8XA 3GZ5A 2FF4A 4PCQA 1YS6A 3JAMK 3W6JB 1WSUA 2DW4A 1QQIA 3IHUA 1HW5A 4I0AA 4IRHA 3Q9SA 3WTXC 1HW1A 1LB2A 3Q9VA 5ERIA 4Q5SF 1I5ZA 3SZTA 2LF8A 2W84A 3WE2A 3P7NA 4EJVA 5ILSA 2O3FA 3E5QA 5DCMB 1HW2A 3HTUA 5E17F 4RB2C 4KIFA 1KQ8A 5LEKA 1ZRDA 2IPQX 4HAMA 3E3VA 3OOPA 5KVRA 4B09A 2CG4A 2D45A 3L00A 3BJAA 2M87A 2QBYB 2UWMA 2HTJA 4Q48A 4PGGA 1FNNA 3BPVA 2FBKA 4IJAA 3F8BA 3BY6A 3V4GA 1G3SA 4OOIA 5HVQC 2K4JA 4RAYA 1ZN2A 3BROA 2WV0A 4EMSA 4HA8A 3WTTC 3QU6A 3RTRA 1XGMA 4HW0A 3ZPLA 1B1BA 1R5GA 2FMLA 2L02A 3WTYC 2FBIA 5D5XB 3QU3A 1J5YA 4WXCA 5LBQA 5E1XA 2J5PA 2VT3A 2P5KA 4EM0B 5JI6A 1VTNC 2W85A 2ADUA 3VOEA 1LVAA 2OD5A 5LGTA 2V1XA 2R7DA 1QO0D 4XSXF 5CVIA 3IC7A 2L54A 2IT0A 1R22A 3FMRA 1DDNA 1I27A 4EGZA 4HF1A 4Y17A 3KP6A 3K9TA 1A04A 4O3MA 1AWCA 3F8FA 3GZ6A 4ZYDA 2DU9A 5HDGA 4HQMA 4YIIA 2Q0OA 1Z9CA 5J8FA 2LF7A 2XVCA 5LHIA 5L3GA 4S05A 4M6YA 1Z6TA 3DFGA 4M72A 4L18B 3EDPA 3BDDA 4U0VA 3E97A 1K79A 5FD5A 1O3RA 3MAJA 3K69A 1Y0UA 3LAPA 3QOPA 2Y75A 3ZMDA 2GWRA 1LDJA 2HR3A 1OPCA 3L7WA 1J59A 4MNUA 5BPIA 3E6DA 4GCVA 3V7RA 4OU0A 4GO1A 1FPQA 3O3KA 3PQJA 2IP2A 2HTSA 2XKPA 3E5UA 4YFNF 1O7FA 2P4WA 3S2WA 2KIUA 3TGNA 2E1NA 3VEPA 2ESHA 2NRAC 2ZMEA 3CJNA 3HIFA 4GGGA 5D5VB 2ISZA 4L0YB 1W5TA 2RKHA 3WTSC 4XLNF 4HX7A 3KEOA 1PUEE 4WX9A 5JHUA 2MLKA 2ZBKA 1B9MA 3FXQA 3I64A 2MBFA 4U7BA 4G94A 3WE3A 4KMUX 3EYYA 4Y13A 1LDDA 3FZVA 3U2RA 3IRQA 2KKOA 1IN7A 2NYXA 3ABTA 4I98B 3RPUA 3R61A 1K78B 1XMAA 4FX0A 3E5XA 2XAJA 4L5IA 3BZ6A 4ZZLA 4HYEA 3HYIA 2DPDA 2XAGA 3QP5A 1J7KA 5ILUA 2Q2EA 4EGYA 2OU2A 3EETA 3TO7A 1QGPA 3D0SA 5DCFA 1W7PA 1LDKB 2O61A 2Y0MA 1FBUA 1FP1D 4QLCU 3KZYA 5D8KB 1J0RA 2YR2A 3EQLF 1LQ1A 4AIHA 5HS7A 3DF8A 2PLYA 3GUDA 5DYMA 4L0ZB 3E6MA 1W7PB 4MTDA 2HYGD 2FOKA 1F4KA 3GF2A 1XDUA 3P9CA 4LB6B 3KLOA 3ZMZA 3WTUC 4NB5A 2A6HF 2V79A 1DPRA 1KU9A 1MKMA 1CF7A 5F64A 4BQAA 4RGXA 1H9TA 3QPTA 2V1UA 1FLIA 3T1BA 4IRGA 2GXBA 1OYIA 1ULYA 3G73A 1YS7A 2HQNA 5E20A 3JAMZ 1J2XA 3T0YA 4ETSA 4KDPA 4L9JA 2Q8KA 1XGSA 4XSZF 5BQTA 2ACJA 4HLYA 3KP7A 4PDKA 1SAXA 3BPXA 3KFWX 4BXUA 4WK8F 1O3QA 1MGTA 2PBIA 1R23A 2PN6A 2ZMEB 4P5OA 2L3DA 4RB1A 1W7PD 5L3FA 4UXNA 4XRFA 3KLNA 3ELKA 3LWFA 1IXSB 1I6XA 4FX4A 1GHCA 1V3FA 5CVRA 2VBWA 1MDMB 1R58A 5IT9K 2RDPA 5ED4A 4CYDA 1ZHFA 1YW7A 5IT3A 1Z1DA 3G3ZA 1BBYA 1T98A 2HOEA 3DXJF 3J7AO 4Z2YA 3B73A 3R4KA 4IXAA 2IA2A 1R1UA 1BI3A 1MDMA 5LLQA 1FOKA 3FX3A 3N97A 1FYMA 1KU3A 4M73A 2DFIA 2CFXA 3GW2A 1R1TA 1SD6A 4U0YA 1YIOA 4GYGA 3FF5A 2XAQA 2M30A 3ECOA 4WXHA 2KIFA 1OMIA 2FEZA 1IN6A 2YU3A 1T39A 4HX4A 3DKWA 3KP5A 2DTRA 2EA2A 3C1DA 1SFXA 1WWXA 5CLSA 3F8NA 2YPRA 4G7OF 2HFHA 4KFCA 2ZFWA 2JSCA 2RVCA 1FYLA 2P7CB 1AOYA 4KN4X 2VXZA 1T0FA 2HQRA 1S8NA 1JGSA 3F6VA 5H20A 5D8LB 3M8EA 2GA1A 2JRTA 2XGXA 1QZZA 4N9HA 4EJOA 5ICEA 3CTAA 3FWEA 1ZGAA 2RC4A 3C3WA 1FSEA 1ZARA 3ECHA 1HQCA 1ZRCA 1USSA 1IUYA 1TQIA 4MQVA 4KIGA 4A12A 5HDNA 2EFOA 1PDNC 1UB9A 2Z5UA 1YO5C 2K02A 3WTWC 1OKRA 2FU4A 2H09A 2UXNA 2XAFA 2MA3A 3HSEA 4KYWA 2EV6A 4A5MA 3FM3A 1D8JA 4HZFA 2EWNA 2VODA 4CXFA 2BYVE 3CDHA 3HSFA 1BM9A 1WRJA 4Q4ZF 5ICGA 4A0YA 3F8MA 3GEZA 2H94A 1D3YA 2IJLA 4DNCA 4U88A 1XB4A 4HDUA 1S7OA 2XV4S 4HBLA 4N9IA 4FT8A 2QENA 1P6RA 2FXAA 1BI0A 2LNBA 4KN7X 3J81Z 4BNCA 3HSRA 2LSOA 2ETHA 5JVTA 2GQQA 4UHTA 2JZYA 3F72A 2HYFA 4I09A 3KP2A 2NS0A 4L9TA 1XDSA 1F9NA 1OYYA 2PFBA 2E1CA 4ESFA 4G8XA 2NNNA 1P4XA 4MGRA 2A6EF 1MZBA 2QLZA 3M8FA 3LQQA 3DV8A 2VE9A 3ZMUA 2HZTA 1ZYRF 4G9YA 4RAZA 1B59A 3GXOA 3CUQB 5HLHA 1U6GA 2ZKZA 5DD4A 2Z99A 1XCVA 2O0YA 3HRUA 1YG2A 2M5WA 1FWZA 3IKTA 4GYIA 4YG2F 3O2PE 1YW8A 1DP7P 4S04A 2P5VA 3WODF 2XAHA 1MJBA 4LD5A 1G3WA 2IA1A 5K5RA 3JSPA 1H0MA 1IW7F 4OIPF 3RKXA 4H0EA 4I2OA 4OIOF 3LAJA 1SFEA 3WU0A 1H9GA 1J75A 4QWQA 4IHTA 2IVMA 2FMYA 4WF2A 4LK0F 2M1BA 3ML6A 3L9FA 4KICA 4RGRA 1GXQA 1SD5A 5BS6A 2KJCA 1T6SA 2IRFG 2XIGA 1GXPA 4HOBA 2H6CA 4BHCA 4HF2A 5ICCA 3GVAA 1T38A 3N4MA 3F22A 3V8KA 1KYZA 1CGPA 1S3JA 2RQPA 5LHGA 2ZCWA 3IWFA 1I1GA 1QPMA 1O57A 4MQ9F 2KRFA 4BH9A 2OBPA 2XRNA 1ZRFA 1MJAA 4YFXF 1JHFA 2KIMA 4O5VA 1ODDA 3KCCA 5CJ9A 3TDUC 3JTHA 3U1DA 1XN7A 3LA2A 5LHHA 1T2KA 1YTYA 2PQ8A 2OA4A 2XROA 4IPAA 1IZ1A 3ZMVA 2L01A 3I71A 1XSDA 3F6OA 5BPDA 2HKXA 3I54A 4LGWA 3K1MA 5TRDA 2VT2A 3BOQA 1IAWA 2Z33A 1UCRA 4M9XA 3H92A 2E7XA 5LGUA 3BWGA 3LFKA 3QAHA 3SQNA 3RPQA 5L3CA 3L09A 5FD6A 3WGGA 1EH6A 3E6CC 2F5EA 3KP4A 3CLOA 1SD7A 3GFJA 2ZO4A 1C0WA 2EFNA 4XLPF 1FBSA 1IRGA 3QRFF 5BMZA 3FM5A 1EV7A 1B4AA 4MHGA 2QQBA 1BI1A 2Y48A 2YX7A 4KA4A 4ZYEA 2ESNA 1KU2A 5E1WA 2PEXA 1LEAA 1ZGJA 2XASA 2VONA 4WXDA 3VFZA 1B6AA 1FY7A 3SFZA 2H27A 2VE8A 1HXDA 1REPC 5DUIA 3TOBA 3GYHX 4AVPA 2FSWA 4ON0A 4BHBA 5DD8A 5K1YA 2QBYA 2GZWA 3PFIA 1HBXG 1BC7C 1BOAA 5F1RA 2ISYA 5H6QA 1YLFA 1IN5A 4MEYF 2EV0A 3W6KB 5HLGA 5LEJA 2OZ6A 5DCMA 5DEQA 1G3TA 3GWZA 4U0WA 3SHFA 4G7HF 4ZH4F 2ZJ2A 1FZPB 2EFWA 3K0LA 4HDVA 1FX7A 5HLIA 1RUNA 2L4AA 2FQ3A 2ZNZA 3V8JA 5FLXK 3F23A 2E7WA 3LA3A 3BJ6A 1U5TB 5FFZA 2YSRA 4OIRF 1DPUA 3FXUA 2O03A 5DUKA 3C7JA 1TW3A 4YIFA 2YX4A 3HHHA 4P55A 5FO5A 4I01A 2BV6A 1O3SA 5EEGA 3I58A 1PP7U 3TO9A 3MQ0A 1WQ2A 2STWA 5A2QZ 3HHGA 2D2WA 4LJZF 2A07F 2O6GE 4A0XA 4YFKF 3GLXA 3J80K 2DQRA 4PGHA 3RDIA 1S6LA 2R7FA 4G6DA 5L3BA 4I02A 4UUVA 3LQRA 6PAXA 2HEOA 1XSXA 1IF1A 5L3EA 2G9WA 1CF7B 1XGNA 2JPBA 1D8KA 3TDZC 5CVVA 2HS5A 3WGHA 1W5SA 1R00A 5DDGA 4M74A 5DV5A 4R1HA 4IF4A 4ENMA 1UHMA 2FA5A 3V7SA 2RN7A 4MTEA 1DUXC 1FBQA 1UFMA 2RNJA 3L2CA 2CYYA 4LB5A 4RGUA 2G7UA 2QWWA 3NRVA 4A0ZA 2HKOA 4CGZA 2A69F 4EQQA 2O8XA 3WGIA 3AAFA 2COMA 3RIRA 3ERED 1HKSA 1U3EM 2CW0F 5FGMA 4D0PA 1TQMA 5D5UB 1KQ9A 2VC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE8 A;  1K78 A;  3JW4 A;  2VBX A;  3GFI A;  2VBY A;  3K2Z A;  1ZLK A;  2P6T A;  4EJU A;  1P4W A;  4ESB A;  5F6F A;  3FHZ A;  2VC1 A;  2MH9 A;  1X3U A;  3MCZ A;  3TO6 A;  1F1Z A;  1BN5 A;  2DT5 A;  1U5T C;  1STZ A;  3ROU A;  4KNY A;  4I0B A;  1IN8 A;  2NNY A;  4LLN A;  1KGS A;  3H3U A;  2X0L A;  5HDK A;  1Z05 A;  3RI4 A;  4RGS A;  1SMT A;  2KJB A;  1G3Y A;  3SZP A;  3JTG A;  1UHW A;  1FSH A;  2EJR A;  5AIQ A;  4CHU A;  4IRI A;  2LDU A;  3M7G A;  4MEX F;  1KU7 A;  2W24 A;  3V8L A;  2HGC A;  2CWE A;  2M8E A;  3BJO A;  2B0L A;  4ESJ A;  4UNO A;  2MC3 A;  4PZJ A;  1LNW A;  4R8H A;  1R5H A;  4OMZ A;  2WC2 A;  1FC3 A;  1ON1 A;  3ZMT A;  3JSO A;  5IT9 Z;  4HQE A;  3BP8 A;  3ZP5 A;  1EH8 A;  4M6X A;  3VB2 A;  3HOS A;  3HUG A;  1E17 A;  3WG9 A;  3TKY A;  3HTS B;  3J81 K;  4OIQ F;  3CUO A;  5CVU A;  1K6O A;  3RKY A;  5AIP A;  3CO7 C;  4TV7 A;  5HS9 A;  5ILV A;  2CGP A;  5AON A;  5EEH A;  2X4H A;  2VOP A;  4L5J A;  4P96 A;  2DAO A;  3GFL A;  3DQV C;  2GXG A;  1TNS A;  1U78 A;  2CO5 A;  1BIB A;  2PI0 A;  2P7V B;  2BBY A;  3J80 Z;  2NAZ A;  2VOO A;  3K1P A;  1HKQ A;  2BEO A;  1HKT A;  1KYW A;  1PP8 F;  3KZZ A;  1Z6R A;  4LLG F;  4OMY A;  1LJ9 A;  5FFX A;  4KMF A;  1MJ9 A;  3F8C A;  3CO6 C;  3HRS A;  4NQW A;  2K27 A;  5H6R A;  5LRS A;  4EV0 A;  1BC8 C;  2PG4 A;  4LK1 F;  4Q47 A;  1P4A A;  2UXX A;  3OV8 A;  4M9S A;  2FE3 A;  3ZQ7 A;  2UZK A;  1TBX A;  2A68 F;  3B02 A;  1WI9 A;  4UVB A;  4AIK A;  1O7L A;  3ULQ B;  5JR3 A;  4Y15 A;  4CO8 A;  4K2E A;  3D5L A;  3F21 A;  4ZYH A;  3I0T A;  2L4M A;  1IN4 A;  5D6F A;  3I53 A;  1R36 A;  2A61 A;  2P5L C;  1LEB A;  1S29 A;  3T8R A;  4GXO A;  3PQK A;  2EFP A;  4RS8 A;  1HSJ A;  5ICF A;  3R6S A;  4ZZD A;  3GX4 X;  4LFU A;  1S7A A;  2FNP A;  1TQP A;  4CZZ A;  3DEU A;  3I59 A;  3IRR A;  3REO A;  1ZAO A;  4EJT A;  2K7L A;  2QUF A;  4A5N A;  4ZYG A;  2QYO A;  3RJP A;  2FBH A;  1GVJ A;  3WU1 B;  3F3X A;  1P2F A;  3HRM A;  4LMY A;  1NHA A;  1ON2 A;  3NEU A;  1W4M A;  5D4R A;  2EK5 A;  3EUH A;  3I59 B;  1QNT A;  3K1N A;  3WTV C;  1RIO H;  4UVC A;  2BE5 F;  5J8C A;  3LA7 A;  1TLH B;  2FNA A;  3MZY A;  3Q5F A;  4OIN F;  4G7Z F;  4BAY A;  4A6D A;  4JK1 X;  1FYK A;  1FT9 A;  4BYY A;  2DK5 A;  3H3Z A;  1XCB A;  2M45 A;  1WKM A;  4LLL A;  3QP6 A;  4P9F A;  3TQN A;  2H6B A;  2ELH A;  3CUQ C;  1RUO A;  3IL2 A;  5E1Z B;  2OQG A;  2ZXJ A;  5E8I A;  2C6Y A;  5LRR A;  4AWX B;  2J5O A;  1MD0 A;  2EB7 A;  2DBB A;  2BGC A;  2V6C A;  1IXC A;  3I5U A;  4UVA A;  2IW5 A;  3DPT A;  3T8T A;  3VOD A;  1V4R A;  1KQ0 A;  3RYR A;  4ENJ A;  2AS5 F;  4M71 A;  4CIC A;  4M9Z A;  5KK1 A;  4JQF A;  1YYV A;  3FMS A;  4WCG A;  3GFM A;  1P92 A;  1B9N A;  2WWY A;  4N0B A;  4AD9 A;  2D1V A;  3EYI A;  1OR7 A;  1ZG3 A;  4I7H A;  1XD7 A;  2TDX A;  3NQO A;  2DQL A;  2JPC A;  4HX8 A;  1BIA A;  2FRH A;  4G6Q A;  3M9A A;  3LST A;  1Z7U A;  2JTV A;  1TW2 A;  4EM2 A;  2V1D A;  4KIB A;  5CYV A;  4CDG A;  5JFR A;  2LKP A;  1SFU A;  2CQK A;  1L0O C;  2DK8 A;  2CSO A;  2XKO A;  4WWC A;  4ASN A;  3C18 A;  5E18 F;  4NHJ A;  2EA4 A;  4LG0 A;  3IWZ A;  2V9V A;  4BHP A;  4UV9 A;  4DQ2 A;  2A5Y B;  2PMU A;  2AXL A;  2RV8 A;  2GA2 A;  1QZY A;  1BI2 A;  2OZU A;  4EJW A;  2XUB A;  2OAZ A;  1YFH A;  2W25 A;  2MD5 A;  3R0A A;  1SMY F;  3MFK A;  1ZLJ A;  5D4S A;  2GAU A;  1U8R A;  3RYP A;  1FP2 A;  1SD4 A;  3KP3 A;  3U9G A;  3M1E A;  3T5X A;  4LG0 B;  1R7J A;  3I4P A;  4R79 A;  2QZ8 A;  4F7Z A;  2RGV A;  4KUM A;  1EH7 A;  3FXR A;  4RB3 C;  2IA0 A;  5D6E A;  4A6E A;  2JT1 A;  1E2X A;  3CUQ A;  3O6B B;  1ZH5 A;  2K4B A;  5K5O A;  5K5Q A;  3V7C A;  4UV8 A;  1IRF A;  3MZH A;  2F2E A;  2F5C A;  5LGN A;  1Z91 A;  2OQR A;  4IVN A;  2QQ9 A;  5FB2 A;  1I1S A;  2P6S A;  2MH2 A;  1XSV A;  3HRT A;  4E70 A;  1ZG1 A;  2MLG A;  1ZG5 A;  3TOA A;  3DP7 A;  2F5F A;  2QVO A;  1RI7 A;  2VN2 A;  4HLX A;  1ONV A;  2G7H A;  4L9N A;  2PJP A;  3WTZ A;  3ZMS A;  3GO5 A;  2GIV A;  3ZN0 A;  1TNT A;  3HOT A;  3R0J A;  1D5V A;  1TTY A;  1XMK A;  5E8G A;  1IXR C;  4U7D A;  2A3S A;  3KEQ A;  3SXY A;  5CVJ A;  3RKW A;  3DPL C;  1YW9 A;  1RZ4 A;  2DI3 A;  1O3T A;  1OYW A;  2DO7 A;  5HOO A;  1U5T A;  5D5W B;  2HWV A;  1U2W A;  4P9U A;  3P9I A;  4O6J A;  4JBA A;  5L3D A;  2PMH A;  3ZN1 A;  3COA C;  3FMQ A;  1UST A;  2EFQ A;  4HV5 A;  2ZNY A;  2XHK A;  1XGO A;  2STT A;  3MEX A;  2EV5 A;  3QPH A;  1J9I A;  1K7A A;  3P9K A;  1BJA A;  2P8T A;  1G6N A;  4EM1 A;  3R60 A;  1KA8 A;  2VBZ A;  3E6B A;  1YQA A;  2Z9O A;  2D1H A;  3MWM A;  5J6X A;  4ENN A;  1HST A;  2F5D A;  5A2Q K;  4RB0 A;  1ZRE A;  4IHS A;  2K86 A;  2DPU A;  3KET A;  4HV6 A;  5FLX Z;  3ISP A;  1F5T A;  3KE2 A;  2R3S A;  4XBF A;  4A2U A;  4AIJ A;  1Q1H A;  4L9V A;  5HS8 A;  4FHT A;  1RNL A;  1R1V A;  2Z3Y A;  3IKV A;  1G4D A;  1JXS A;  1L3L A;  4HF0 A;  1JHH A;  4KT5 C;  2HDC A;  2QQA A;  3ABU A;  4EVI A;  2QM3 A;  1QBJ A;  2WTE A;  4ENK A;  2DLL A;  5TJJ A;  2W57 A;  5BOX A;  4B8X A;  3GZ5 A;  2FF4 A;  4PCQ A;  1YS6 A;  3JAM K;  3W6J B;  1WSU A;  2DW4 A;  1QQI A;  3IHU A;  1HW5 A;  4I0A A;  4IRH A;  3Q9S A;  3WTX C;  1HW1 A;  1LB2 A;  3Q9V A;  5ERI A;  4Q5S F;  1I5Z A;  3SZT A;  2LF8 A;  2W84 A;  3WE2 A;  3P7N A;  4EJV A;  5ILS A;  2O3F A;  3E5Q A;  5DCM B;  1HW2 A;  3HTU A;  5E17 F;  4RB2 C;  4KIF A;  1KQ8 A;  5LEK A;  1ZRD A;  2IPQ X;  4HAM A;  3E3V A;  3OOP A;  5KVR A;  4B09 A;  2CG4 A;  2D45 A;  3L00 A;  3BJA A;  2M87 A;  2QBY B;  2UWM A;  2HTJ A;  4Q48 A;  4PGG A;  1FNN A;  3BPV A;  2FBK A;  4IJA A;  3F8B A;  3BY6 A;  3V4G A;  1G3S A;  4OOI A;  5HVQ C;  2K4J A;  4RAY A;  1ZN2 A;  3BRO A;  2WV0 A;  4EMS A;  4HA8 A;  3WTT C;  3QU6 A;  3RTR A;  1XGM A;  4HW0 A;  3ZPL A;  1B1B A;  1R5G A;  2FML A;  2L02 A;  3WTY C;  2FBI A;  5D5X B;  3QU3 A;  1J5Y A;  4WXC A;  5LBQ A;  5E1X A;  2J5P A;  2VT3 A;  2P5K A;  4EM0 B;  5JI6 A;  1VTN C;  2W85 A;  2ADU A;  3VOE A;  1LVA A;  2OD5 A;  5LGT A;  2V1X A;  2R7D A;  1QO0 D;  4XSX F;  5CVI A;  3IC7 A;  2L54 A;  2IT0 A;  1R22 A;  3FMR A;  1DDN A;  1I27 A;  4EGZ A;  4HF1 A;  4Y17 A;  3KP6 A;  3K9T A;  1A04 A;  4O3M A;  1AWC A;  3F8F A;  3GZ6 A;  4ZYD A;  2DU9 A;  5HDG A;  4HQM A;  4YII A;  2Q0O A;  1Z9C A;  5J8F A;  2LF7 A;  2XVC A;  5LHI A;  5L3G A;  4S05 A;  4M6Y A;  1Z6T A;  3DFG A;  4M72 A;  4L18 B;  3EDP A;  3BDD A;  4U0V A;  3E97 A;  1K79 A;  5FD5 A;  1O3R A;  3MAJ A;  3K69 A;  1Y0U A;  3LAP A;  3QOP A;  2Y75 A;  3ZMD A;  2GWR A;  1LDJ A;  2HR3 A;  1OPC A;  3L7W A;  1J59 A;  4MNU A;  5BPI A;  3E6D A;  4GCV A;  3V7R A;  4OU0 A;  4GO1 A;  1FPQ A;  3O3K A;  3PQJ A;  2IP2 A;  2HTS A;  2XKP A;  3E5U A;  4YFN F;  1O7F A;  2P4W A;  3S2W A;  2KIU A;  3TGN A;  2E1N A;  3VEP A;  2ESH A;  2NRA C;  2ZME A;  3CJN A;  3HIF A;  4GGG A;  5D5V B;  2ISZ A;  4L0Y B;  1W5T A;  2RKH A;  3WTS C;  4XLN F;  4HX7 A;  3KEO A;  1PUE E;  4WX9 A;  5JHU A;  2MLK A;  2ZBK A;  1B9M A;  3FXQ A;  3I64 A;  2MBF A;  4U7B A;  4G94 A;  3WE3 A;  4KMU X;  3EYY A;  4Y13 A;  1LDD A;  3FZV A;  3U2R A;  3IRQ A;  2KKO A;  1IN7 A;  2NYX A;  3ABT A;  4I98 B;  3RPU A;  3R61 A;  1K78 B;  1XMA A;  4FX0 A;  3E5X A;  2XAJ A;  4L5I A;  3BZ6 A;  4ZZL A;  4HYE A;  3HYI A;  2DPD A;  2XAG A;  3QP5 A;  1J7K A;  5ILU A;  2Q2E A;  4EGY A;  2OU2 A;  3EET A;  3TO7 A;  1QGP A;  3D0S A;  5DCF A;  1W7P A;  1LDK B;  2O61 A;  2Y0M A;  1FBU A;  1FP1 D;  4QLC U;  3KZY A;  5D8K B;  1J0R A;  2YR2 A;  3EQL F;  1LQ1 A;  4AIH A;  5HS7 A;  3DF8 A;  2PLY A;  3GUD A;  5DYM A;  4L0Z B;  3E6M A;  1W7P B;  4MTD A;  2HYG D;  2FOK A;  1F4K A;  3GF2 A;  1XDU A;  3P9C A;  4LB6 B;  3KLO A;  3ZMZ A;  3WTU C;  4NB5 A;  2A6H F;  2V79 A;  1DPR A;  1KU9 A;  1MKM A;  1CF7 A;  5F64 A;  4BQA A;  4RGX A;  1H9T A;  3QPT A;  2V1U A;  1FLI A;  3T1B A;  4IRG A;  2GXB A;  1OYI A;  1ULY A;  3G73 A;  1YS7 A;  2HQN A;  5E20 A;  3JAM Z;  1J2X A;  3T0Y A;  4ETS A;  4KDP A;  4L9J A;  2Q8K A;  1XGS A;  4XSZ F;  5BQT A;  2ACJ A;  4HLY A;  3KP7 A;  4PDK A;  1SAX A;  3BPX A;  3KFW X;  4BXU A;  4WK8 F;  1O3Q A;  1MGT A;  2PBI A;  1R23 A;  2PN6 A;  2ZME B;  4P5O A;  2L3D A;  4RB1 A;  1W7P D;  5L3F A;  4UXN A;  4XRF A;  3KLN A;  3ELK A;  3LWF A;  1IXS B;  1I6X A;  4FX4 A;  1GHC A;  1V3F A;  5CVR A;  2VBW A;  1MDM B;  1R58 A;  5IT9 K;  2RDP A;  5ED4 A;  4CYD A;  1ZHF A;  1YW7 A;  5IT3 A;  1Z1D A;  3G3Z A;  1BBY A;  1T98 A;  2HOE A;  3DXJ F;  3J7A O;  4Z2Y A;  3B73 A;  3R4K A;  4IXA A;  2IA2 A;  1R1U A;  1BI3 A;  1MDM A;  5LLQ A;  1FOK A;  3FX3 A;  3N97 A;  1FYM A;  1KU3 A;  4M73 A;  2DFI A;  2CFX A;  3GW2 A;  1R1T A;  1SD6 A;  4U0Y A;  1YIO A;  4GYG A;  3FF5 A;  2XAQ A;  2M30 A;  3ECO A;  4WXH A;  2KIF A;  1OMI A;  2FEZ A;  1IN6 A;  2YU3 A;  1T39 A;  4HX4 A;  3DKW A;  3KP5 A;  2DTR A;  2EA2 A;  3C1D A;  1SFX A;  1WWX A;  5CLS A;  3F8N A;  2YPR A;  4G7O F;  2HFH A;  4KFC A;  2ZFW A;  2JSC A;  2RVC A;  1FYL A;  2P7C B;  1AOY A;  4KN4 X;  2VXZ A;  1T0F A;  2HQR A;  1S8N A;  1JGS A;  3F6V A;  5H20 A;  5D8L B;  3M8E A;  2GA1 A;  2JRT A;  2XGX A;  1QZZ A;  4N9H A;  4EJO A;  5ICE A;  3CTA A;  3FWE A;  1ZGA A;  2RC4 A;  3C3W A;  1FSE A;  1ZAR A;  3ECH A;  1HQC A;  1ZRC A;  1USS A;  1IUY A;  1TQI A;  4MQV A;  4KIG A;  4A12 A;  5HDN A;  2EFO A;  1PDN C;  1UB9 A;  2Z5U A;  1YO5 C;  2K02 A;  3WTW C;  1OKR A;  2FU4 A;  2H09 A;  2UXN A;  2XAF A;  2MA3 A;  3HSE A;  4KYW A;  2EV6 A;  4A5M A;  3FM3 A;  1D8J A;  4HZF A;  2EWN A;  2VOD A;  4CXF A;  2BYV E;  3CDH A;  3HSF A;  1BM9 A;  1WRJ A;  4Q4Z F;  5ICG A;  4A0Y A;  3F8M A;  3GEZ A;  2H94 A;  1D3Y A;  2IJL A;  4DNC A;  4U88 A;  1XB4 A;  4HDU A;  1S7O A;  2XV4 S;  4HBL A;  4N9I A;  4FT8 A;  2QEN A;  1P6R A;  2FXA A;  1BI0 A;  2LNB A;  4KN7 X;  3J81 Z;  4BNC A;  3HSR A;  2LSO A;  2ETH A;  5JVT A;  2GQQ A;  4UHT A;  2JZY A;  3F72 A;  2HYF A;  4I09 A;  3KP2 A;  2NS0 A;  4L9T A;  1XDS A;  1F9N A;  1OYY A;  2PFB A;  2E1C A;  4ESF A;  4G8X A;  2NNN A;  1P4X A;  4MGR A;  2A6E F;  1MZB A;  2QLZ A;  3M8F A;  3LQQ A;  3DV8 A;  2VE9 A;  3ZMU A;  2HZT A;  1ZYR F;  4G9Y A;  4RAZ A;  1B59 A;  3GXO A;  3CUQ B;  5HLH A;  1U6G A;  2ZKZ A;  5DD4 A;  2Z99 A;  1XCV A;  2O0Y A;  3HRU A;  1YG2 A;  2M5W A;  1FWZ A;  3IKT A;  4GYI A;  4YG2 F;  3O2P E;  1YW8 A;  1DP7 P;  4S04 A;  2P5V A;  3WOD F;  2XAH A;  1MJB A;  4LD5 A;  1G3W A;  2IA1 A;  5K5R A;  3JSP A;  1H0M A;  1IW7 F;  4OIP F;  3RKX A;  4H0E A;  4I2O A;  4OIO F;  3LAJ A;  1SFE A;  3WU0 A;  1H9G A;  1J75 A;  4QWQ A;  4IHT A;  2IVM A;  2FMY A;  4WF2 A;  4LK0 F;  2M1B A;  3ML6 A;  3L9F A;  4KIC A;  4RGR A;  1GXQ A;  1SD5 A;  5BS6 A;  2KJC A;  1T6S A;  2IRF G;  2XIG A;  1GXP A;  4HOB A;  2H6C A;  4BHC A;  4HF2 A;  5ICC A;  3GVA A;  1T38 A;  3N4M A;  3F22 A;  3V8K A;  1KYZ A;  1CGP A;  1S3J A;  2RQP A;  5LHG A;  2ZCW A;  3IWF A;  1I1G A;  1QPM A;  1O57 A;  4MQ9 F;  2KRF A;  4BH9 A;  2OBP A;  2XRN A;  1ZRF A;  1MJA A;  4YFX F;  1JHF A;  2KIM A;  4O5V A;  1ODD A;  3KCC A;  5CJ9 A;  3TDU C;  3JTH A;  3U1D A;  1XN7 A;  3LA2 A;  5LHH A;  1T2K A;  1YTY A;  2PQ8 A;  2OA4 A;  2XRO A;  4IPA A;  1IZ1 A;  3ZMV A;  2L01 A;  3I71 A;  1XSD A;  3F6O A;  5BPD A;  2HKX A;  3I54 A;  4LGW A;  3K1M A;  5TRD A;  2VT2 A;  3BOQ A;  1IAW A;  2Z33 A;  1UCR A;  4M9X A;  3H92 A;  2E7X A;  5LGU A;  3BWG A;  3LFK A;  3QAH A;  3SQN A;  3RPQ A;  5L3C A;  3L09 A;  5FD6 A;  3WGG A;  1EH6 A;  3E6C C;  2F5E A;  3KP4 A;  3CLO A;  1SD7 A;  3GFJ A;  2ZO4 A;  1C0W A;  2EFN A;  4XLP F;  1FBS A;  1IRG A;  3QRF F;  5BMZ A;  3FM5 A;  1EV7 A;  1B4A A;  4MHG A;  2QQB A;  1BI1 A;  2Y48 A;  2YX7 A;  4KA4 A;  4ZYE A;  2ESN A;  1KU2 A;  5E1W A;  2PEX A;  1LEA A;  1ZGJ A;  2XAS A;  2VON A;  4WXD A;  3VFZ A;  1B6A A;  1FY7 A;  3SFZ A;  2H27 A;  2VE8 A;  1HXD A;  1REP C;  5DUI A;  3TOB A;  3GYH X;  4AVP A;  2FSW A;  4ON0 A;  4BHB A;  5DD8 A;  5K1Y A;  2QBY A;  2GZW A;  3PFI A;  1HBX G;  1BC7 C;  1BOA A;  5F1R A;  2ISY A;  5H6Q A;  1YLF A;  1IN5 A;  4MEY F;  2EV0 A;  3W6K B;  5HLG A;  5LEJ A;  2OZ6 A;  5DCM A;  5DEQ A;  1G3T A;  3GWZ A;  4U0W A;  3SHF A;  4G7H F;  4ZH4 F;  2ZJ2 A;  1FZP B;  2EFW A;  3K0L A;  4HDV A;  1FX7 A;  5HLI A;  1RUN A;  2L4A A;  2FQ3 A;  2ZNZ A;  3V8J A;  5FLX K;  3F23 A;  2E7W A;  3LA3 A;  3BJ6 A;  1U5T B;  5FFZ A;  2YSR A;  4OIR F;  1DPU A;  3FXU A;  2O03 A;  5DUK A;  3C7J A;  1TW3 A;  4YIF A;  2YX4 A;  3HHH A;  4P55 A;  5FO5 A;  4I01 A;  2BV6 A;  1O3S A;  5EEG A;  3I58 A;  1PP7 U;  3TO9 A;  3MQ0 A;  1WQ2 A;  2STW A;  5A2Q Z;  3HHG A;  2D2W A;  4LJZ F;  2A07 F;  2O6G E;  4A0X A;  4YFK F;  3GLX A;  3J80 K;  2DQR A;  4PGH A;  3RDI A;  1S6L A;  2R7F A;  4G6D A;  5L3B A;  4I02 A;  4UUV A;  3LQR A;  6PAX A;  2HEO A;  1XSX A;  1IF1 A;  5L3E A;  2G9W A;  1CF7 B;  1XGN A;  2JPB A;  1D8K A;  3TDZ C;  5CVV A;  2HS5 A;  3WGH A;  1W5S A;  1R00 A;  5DDG A;  4M74 A;  5DV5 A;  4R1H A;  4IF4 A;  4ENM A;  1UHM A;  2FA5 A;  3V7S A;  2RN7 A;  4MTE A;  1DUX C;  1FBQ A;  1UFM A;  2RNJ A;  3L2C A;  2CYY A;  4LB5 A;  4RGU A;  2G7U A;  2QWW A;  3NRV A;  4A0Z A;  2HKO A;  4CGZ A;  2A69 F;  4EQQ A;  2O8X A;  3WGI A;  3AAF A;  2COM A;  3RIR A;  3ERE D;  1HKS A;  1U3E M;  2CW0 F;  5FGM A;  4D0P A;  1TQM A;  5D5U B;  1KQ9 A;  2VC0 A; 
#chains in the Genus database with same CATH topology
 1JE8 A;  1FIP A;  1PUF A;  3JW4 A;  1K78 A;  2M4K A;  5C3E J;  2VBX A;  5HOD A;  3GFI A;  2VBY A;  3K2Z A;  1ZLK A;  3LSH A;  2G0E A;  1D0Z A;  3ONQ A;  2P6T A;  4EJU A;  1P4W A;  2PX9 A;  4ESB A;  3FK7 A;  5F6F A;  1TWH J;  3PNV A;  3FHZ A;  1ZKG A;  2QKM B;  2VC1 A;  2MH9 A;  1X3U A;  4AC0 A;  3MCZ A;  1MNM C;  3TO6 A;  2LRD A;  1F1Z A;  1BN5 A;  2DT5 A;  1NG7 A;  4XQF A;  1U5T C;  1STZ A;  2WV1 A;  3ROU A;  2WAQ N;  4KIT B;  1E3O C;  4KNY A;  3J7Z I;  3X2Q H;  4I0B A;  4JX6 A;  1IN8 A;  2HPM A;  2L9V A;  2A05 A;  2NNY A;  3VDX A;  2RAE A;  4A3D J;  2MC4 A;  1KGS A;  2E2I J;  4LLN A;  2VI6 A;  4DYQ A;  3H3U A;  2X0L A;  5HDK A;  1Z05 A;  4E6K G;  3RI4 A;  2K3P A;  4RGS A;  1SMT A;  2KJB A;  1G3Y A;  3SZP A;  3JTG A;  1UHW A;  5C4X J;  1TL8 A;  4EAT A;  5IYB J;  1NK3 P;  1FSH A;  2EJR A;  5AIQ A;  2R7O A;  4ZC3 A;  4CHU A;  4IRI A;  2LDU A;  3M7G A;  2EQR A;  2XDV A;  1KU7 A;  4MEX F;  1T95 A;  3HJE A;  3PNT A;  2LY2 A;  2W24 A;  3ZQG A;  3V8L A;  2CFO A;  3AL0 C;  2HGC A;  2CWE A;  3QYB A;  4HPQ A;  2M8E A;  3BJO A;  1BR4 A;  2B0L A;  2WY8 Q;  3MN2 A;  4ESJ A;  4UNO A;  2MC3 A;  3OS1 A;  4PZJ A;  1LNW A;  3QPS A;  4R8H A;  2HQA A;  2IS1 A;  1R5H A;  4OMZ A;  1EJ9 A;  1V5G A;  2WC2 A;  2O9L A;  1FC3 A;  1X19 A;  1ON1 A;  2KFD A;  4MLO A;  3ZMT A;  2E60 A;  3BR3 A;  3JSO A;  5IT9 Z;  1T0F C;  2X6W A;  4HQE A;  2PJR A;  1RR7 A;  3BP8 A;  3ZP5 A;  4AID A;  1EH8 A;  3FXJ A;  4M6X A;  3VB2 A;  1VQM I;  2MAB A;  4AYB N;  1OFC X;  3HOS A;  3HUG A;  1OJL A;  1E17 A;  2YS9 A;  1LE8 A;  3WG9 A;  3TKY A;  3HTS B;  3J81 K;  4OIQ F;  3OOU A;  3G1O A;  3CUO A;  5CVU A;  1K6O A;  3RKY A;  5AIP A;  4X1E A;  3BG7 A;  2KQR A;  2HU9 A;  2HOT A;  3MKL A;  2JA2 A;  4ZDP A;  3CO7 C;  4TV7 A;  3OYC A;  1WJC A;  3H5N A;  5HS9 A;  5ILV A;  2CGP A;  5AON A;  5EEH A;  1RR8 C;  3PO2 J;  2X4H A;  1YHQ I;  5GAH J;  3AL0 B;  2VOP A;  4L5J A;  4P96 A;  5EEA A;  1LE8 B;  2DAO A;  3GFL A;  4M3F A;  3DQV C;  2BVM A;  3PFY A;  2GXG A;  1TNS A;  3OS0 A;  2ZXI A;  3BR2 A;  5CQG A;  5B66 C;  5E3N A;  1U78 A;  3DU6 A;  3VPR A;  2CO5 A;  2XF6 A;  1BIB A;  4PUS A;  2PI0 A;  2VJI A;  3RPU D;  2P7V B;  3CCL I;  3OSF A;  2ZFU A;  2BBY A;  3J80 Z;  2NAZ A;  5F04 A;  3UR3 C;  3K1P A;  2VOO A;  1HKQ A;  4N4O B;  3OMY A;  2BEO A;  3A02 A;  3MKZ A;  3M1C A;  2DA5 A;  1NK2 P;  1HKT A;  1KYW A;  1JUP A;  1PP8 F;  2BY2 A;  4J00 A;  3KZZ A;  3JRA A;  1MIJ A;  1FTZ A;  1Z6R A;  2NS8 A;  4ZDL A;  3PO3 J;  2MGQ A;  4LLG F;  4OMY A;  1LJ9 A;  5FFX A;  4KMF A;  1MJ9 A;  3F8C A;  3ZQL A;  4FE4 A;  3GTP J;  3HPH A;  3CO6 C;  1ZTR A;  2CW8 A;  3HRS A;  4E4H A;  4NQW A;  1B72 A;  2K27 A;  2Q1Z B;  1R5I D;  5H6R A;  5LRS A;  2WY7 Q;  4D5F A;  4EV0 A;  3OYH A;  1BC8 C;  4XLA A;  3TP3 A;  1PVE A;  2PG4 A;  4RLQ A;  3QQA A;  4LK1 F;  4XKV A;  4BY1 J;  1WFX A;  1P4A A;  2UXX A;  3OV8 A;  4Q47 A;  1G59 A;  4M9S A;  2FE3 A;  3HL2 A;  4QTR A;  3ZQ7 A;  2UZK A;  1Z0X A;  3QOD A;  5HNF A;  1MMS A;  3HZJ A;  2QKL B;  1TBX A;  2A68 F;  3B02 A;  1WI9 A;  4UVB A;  4AIK A;  3BTI A;  1O7L A;  3ULQ B;  1WJA A;  5JR3 A;  5JLW A;  4Y15 A;  3ABK H;  3I4N J;  4A93 J;  4CO8 A;  4K2E A;  3D5L A;  3F21 A;  4ZYH A;  3ABL H;  3I0T A;  2EIM H;  4CCN A;  2DYS H;  2L4M A;  1IN4 A;  5D6F A;  1JJ6 C;  3I53 A;  1R36 A;  1ZK8 A;  2A61 A;  2L5Q A;  2L9S A;  3GTM J;  2P5L C;  2HXI A;  1LEB A;  4FE7 A;  1S29 A;  2N8G A;  4GXO A;  3T8R A;  4F91 B;  2EPF A;  3OL3 A;  3L2Q A;  2CQX A;  3PQK A;  2EFP A;  3CJQ B;  5GPA A;  4PFO A;  4RS8 A;  1HSJ A;  2DT6 A;  2JUG A;  3TP0 A;  4IQ4 A;  4A3G J;  5ICF A;  3QPL A;  3G4S I;  3R6S A;  4ZZD A;  1D1B A;  3GX4 X;  2RNG A;  1AA7 A;  4LFU A;  1NH3 A;  1S7A A;  2LBF A;  2FNP A;  1TQP A;  1J09 A;  3DEU A;  4CCL A;  4CZZ A;  4F3Q A;  3I59 A;  3IRR A;  4DBR A;  3REO A;  1NTC A;  1ZAO A;  4EJT A;  3KIO A;  2K7L A;  2QUF A;  4A5N A;  4ZYG A;  3HEF A;  2IGN A;  2XGC A;  2CJJ A;  3S32 A;  2QYO A;  3RJP A;  5GTH C;  5J40 A;  3L1P A;  2FBH A;  1GVJ A;  1YJN I;  1EKE A;  4MO7 A;  4BDY A;  1JTY A;  3WU1 B;  3F3X A;  4G6T B;  1P2F A;  3CMA I;  2EIN H;  3HRM A;  2CQ7 A;  1X2M A;  3CQZ J;  4LMY A;  4XKB A;  1NHA A;  1ON2 A;  2LC2 A;  3NEU A;  5C4J J;  1VFC A;  1W4M A;  5D4R A;  1VQ4 I;  2EK5 A;  3EUH A;  3OYD A;  3I59 B;  1HF0 A;  1QNT A;  3K1N A;  3WTV C;  1RIO H;  4UVC A;  2L0K A;  2VL8 A;  3GTQ J;  3JRG A;  1SVM A;  2BE5 F;  5HLT A;  1R4N B;  5J8C A;  3LA7 A;  1ZEL A;  4B44 A;  1TLH B;  1A31 A;  3A1Y A;  2FD5 A;  2FNA A;  3MZY A;  3CDL A;  3Q5F A;  4NNJ A;  4OIN F;  3HUG B;  4XN0 A;  1FOY A;  2CQN A;  2AO9 A;  4G7Z F;  4BAY A;  3HG9 A;  3PUF A;  4JK1 X;  4A6D A;  1FYK A;  1FT9 A;  1LKX A;  4NUB A;  4BYY A;  2EIK H;  2DK5 A;  2VIX A;  4IHV A;  2IS2 A;  3H3Z A;  1XCB A;  2M45 A;  1WKM A;  4LLL A;  3QP6 A;  2OF7 A;  4P9F A;  3TQN A;  2H6B A;  2X6X A;  4PJ0 C;  3S1N J;  1ORK A;  4V19 K;  2K9N A;  2L9R A;  4KJZ A;  3W2A A;  4XLF A;  2ELH A;  3CUQ C;  1RUO A;  3BQZ A;  3IL2 A;  5E1Z B;  2KDO A;  3OYI A;  2KIQ A;  2OQG A;  2ZXJ A;  3FXL A;  4XLC A;  2DMN A;  4IHY A;  5E8I A;  2C6Y A;  5LRR A;  4AWX B;  2J5O A;  2XB5 A;  1MD0 A;  2EB7 A;  2DBB A;  1KZH A;  2DA6 A;  2BGC A;  2V6C A;  1IXC A;  4RMN A;  3L2R A;  1MBF A;  4ZTF A;  3OYM A;  3I5U A;  4UVA A;  2IW5 A;  3DPT A;  3T8T A;  2JA8 J;  3CME I;  3VOD A;  1V4R A;  5M3F J;  1KQ0 A;  3RYR A;  4ENJ A;  2AS5 F;  2WAQ A;  4M71 A;  3CLQ A;  4CIC A;  1D1A A;  4M9Z A;  2LKS A;  4IL6 C;  4LG3 A;  3LNQ A;  4ZDO A;  3H9G A;  5KK1 A;  4JQF A;  2P81 A;  1YYV A;  3TBI A;  3FMS A;  3K4M A;  1F36 A;  2PMZ A;  1WZ2 A;  4WCG A;  1V54 H;  1N25 A;  3GFM A;  1P92 A;  4NQW B;  1B72 B;  1B9N A;  2XSD C;  2E71 A;  1MMG A;  3CMY A;  2WWY A;  4II2 A;  1Y0N A;  4N0B A;  2ECB A;  4AD9 A;  1JTX A;  2D1V A;  1GDT A;  2EH3 A;  1N78 A;  3WHC A;  1VQ5 I;  5KAF C;  3EYI A;  1WJE A;  2V26 A;  1MBK A;  2W1O A;  2DA7 A;  4DGW B;  1OR7 A;  1ZG3 A;  3C2H A;  2DFH A;  4I7H A;  1XD7 A;  2DA4 A;  2VPL A;  4P1W A;  2TDX A;  3S1M J;  3NQO A;  5EG0 A;  3C2B A;  3S15 J;  1ETY A;  2DQL A;  3L2U A;  2JPC A;  4HX8 A;  1BIA A;  3ESW B;  2FRH A;  1Z3Y A;  4LIU A;  4G6Q A;  3M9A A;  4A3C J;  4DZJ A;  2E2H J;  4NC6 A;  1EA3 A;  2M34 A;  2W4S A;  3LST A;  1Z7U A;  2JTV A;  1UAA A;  1TWF J;  1TW2 A;  1V5F A;  4EM2 A;  2V1D A;  4KIB A;  4C30 A;  5CYV A;  1A36 A;  2XF7 A;  1XS9 A;  4CDG A;  1XC5 A;  2F48 A;  3PNY A;  2VPR A;  2X1D A;  5EG0 B;  5JFR A;  1QPI A;  3A03 A;  5DTD A;  2LKP A;  3SYT A;  1SFU A;  1SFK A;  2CQK A;  1L0O C;  2DK8 A;  2CSO A;  2XKO A;  4WWC A;  4ASN A;  3GTJ J;  1OCT C;  4CCM A;  1BR2 A;  2KL4 A;  3C18 A;  5IY5 H;  5E18 F;  4XID A;  4NHJ A;  2QF7 A;  3S14 J;  1DQU A;  1V55 H;  2EA4 A;  2M7B A;  4LG0 A;  3IWZ A;  1X2N A;  2IGM A;  2TCT A;  2V9V A;  3ASO H;  1HDP A;  2DDA A;  2L2O A;  4UV9 A;  1OCZ H;  4BHP A;  4DQ2 A;  1IRZ A;  2A5Y B;  2PMU A;  3ZOB A;  4Y7N J;  1WI3 A;  2AXL A;  3H0D A;  3BR0 A;  2L7F P;  2RV8 A;  2GA2 A;  3BCA A;  4B48 A;  4IZZ A;  1QZY A;  1BI2 A;  2OZU A;  3CCV I;  1N77 A;  3IP4 B;  2XUB A;  2OAZ A;  4EJW A;  1YFH A;  2W25 A;  2MD5 A;  3R0A A;  1SMY F;  2VKV A;  2E34 A;  1ZLJ A;  3ASN H;  3MFK A;  5D4S A;  3CP8 A;  3CCM I;  2GAU A;  1U8R A;  3RYP A;  2XSJ C;  1FP2 A;  1SD4 A;  3KP3 A;  1IC8 A;  3U9G A;  1I50 J;  3M1E A;  4AU7 A;  2Y0S A;  3T5X A;  4LG0 B;  4HNT A;  1R7J A;  3I4P A;  4R79 A;  2QZ8 A;  3A0B C;  4F7Z A;  4PK4 A;  2R5Y A;  3H9Q A;  2RGV A;  4UB8 C;  2LYC A;  4KUM A;  1EH7 A;  2F6C A;  3SEQ A;  2JA5 J;  2ZXW H;  3FXR A;  4RB3 C;  1CQT A;  2IA0 A;  4GFB A;  2LLK A;  5D6E A;  4QPQ A;  3IV5 A;  4A6E A;  4XRS G;  2JT1 A;  1E2X A;  3CUQ A;  3O6B B;  3H5R A;  1V5E A;  1ZH5 A;  2K4B A;  3PJR A;  4RM2 A;  5K5O A;  5K5Q A;  3V7C A;  3VYU B;  4UV8 A;  1IRF A;  3LSJ A;  3MZH A;  3OYA A;  4CCK A;  2F2E A;  1BOB A;  1DU0 A;  2F5C A;  3CZ6 A;  4DIQ A;  3PUB A;  1MW7 A;  5LGN A;  1VQK I;  5J1R A;  1Z91 A;  2OQR A;  4IVN A;  2QQ9 A;  4BQN A;  5IP6 A;  5FB2 A;  2P6S A;  5FJ8 J;  1I1S A;  4HG2 A;  2MH2 A;  1XSV A;  4M3B A;  3HRT A;  3NAR A;  4E70 A;  2QSG X;  3OIO A;  2DN0 A;  1ZG1 A;  3VYR B;  2MLG A;  1ZG5 A;  3TOA A;  4DOZ A;  1TZL A;  1W36 D;  3DP7 A;  4B1R A;  3EPZ A;  5EF6 A;  4FQG A;  5FKM A;  4J19 A;  2F5F A;  2QVO A;  1RI7 A;  2VN2 A;  4HLX A;  1ONV A;  3FK6 A;  5IYD J;  2G7H A;  4L9N A;  2PJP A;  3WTZ A;  3ZMS A;  3ERM A;  2IS6 A;  4XRS A;  1GLN A;  3GO5 A;  4HNU A;  4YEL A;  2YU9 J;  2BXY A;  2GIV A;  1TNT A;  3ZN0 A;  3HOT A;  1T33 A;  2HVR A;  2FOW A;  3BR1 A;  3R0J A;  1E0E A;  1D5V A;  1TTY A;  1Y1V J;  1XMK A;  5E8G A;  5B1A H;  1IXR C;  4U7D A;  2A3S A;  3KEQ A;  2JA7 J;  3SXY A;  3SZG A;  5CVJ A;  3RKW A;  3DPL C;  1APL C;  2JQ7 A;  1YW9 A;  1RZ4 A;  1JGG A;  2DI3 A;  1O3T A;  1POG A;  1OYW A;  5GAE J;  4RBO A;  2DO7 A;  5HOO A;  1U5T A;  5D5W B;  2HWV A;  2V7F A;  1U2W A;  2X6O A;  2LY1 A;  2W00 A;  4P9U A;  3P9I A;  3S2D J;  4BBS J;  2B63 J;  3CC7 I;  2BHY A;  4O6J A;  1IJW C;  1K4S A;  4JBA A;  5L3D A;  2PMH A;  2R7Z J;  1QHH D;  4B3X A;  4D7N A;  2Y69 H;  3ZN1 A;  4BQO A;  3COA C;  3FMQ A;  1UST A;  2EFQ A;  3DBR B;  1SFO J;  2MG4 A;  3MKY B;  4HV5 A;  2ZNY A;  2VXD A;  2XHK A;  1XMX A;  1XGO A;  2STT A;  2CS3 A;  1R71 A;  3MEX A;  2EV5 A;  2V4J C;  3QPH A;  3L2W A;  4W1U A;  1P7I A;  1K7A A;  1QRY A;  3P9K A;  1J9I A;  3GTG J;  2KP6 A;  2R7X A;  3SJM A;  2KZV A;  1BJA A;  2VKD A;  2P8T A;  1G6N A;  1XG1 A;  4M3G A;  4EM1 A;  3R60 A;  2M0C A;  1KA8 A;  2VBZ A;  2ZSH B;  3E6B A;  2H1K A;  2H1L A;  2Y9Z A;  3MKW B;  1YQA A;  2Z9O A;  2D1H A;  3TL4 X;  3KYD B;  3MWM A;  5J6X A;  4ENN A;  3HOY J;  1HST A;  1RKT A;  2LOO A;  1IDY A;  2F5D A;  3M07 A;  5A2Q K;  2XGE A;  1ITY A;  4RB0 A;  1UJ8 A;  2GXA A;  2X85 A;  3QOE A;  1ZR2 A;  2RRE A;  1UHS A;  1ZRE A;  5EGO B;  4IHS A;  2K86 A;  2DPU A;  3KET A;  4HV6 A;  4ITV A;  3K70 D;  5FLX Z;  2IS4 A;  3ISP A;  1F5T A;  3KE2 A;  4G12 A;  2LKX A;  1U9O A;  4OAY A;  2KHM A;  3FHN A;  2R3S A;  1U8B A;  4OWR B;  4XBF A;  4A2U A;  1E3P A;  4AIJ A;  1Q1H A;  2Z16 A;  2K3F A;  4L9V A;  5HS8 A;  4FHT A;  1RNL A;  1R1V A;  1T56 A;  2Z3Y A;  2FQ4 A;  3IKV A;  1G4D A;  2OC6 A;  4JOM A;  1JXS A;  2GBY A;  2JRM A;  2MD0 A;  4RA2 A;  1L3L A;  5DM6 F;  4HF0 A;  1JHH A;  4KT5 C;  2HDC A;  2QQA A;  3ABU A;  4EVI A;  4BU2 A;  3BZC A;  1DP3 A;  2QM3 A;  1QBJ A;  2WTE A;  4ENK A;  2DLL A;  2GLO A;  1G2H A;  3G1M A;  1UG2 A;  4BJ6 C;  1FOW A;  5TJJ A;  2W57 A;  5BOX A;  3N05 A;  4B8X A;  3GZ5 A;  2FF4 A;  3BR6 A;  4PCQ A;  3CCR I;  3BC8 A;  1YS6 A;  3JAM K;  3EUH C;  1Y8Q B;  1GT0 C;  3W6J B;  1QA6 A;  1WSU A;  2DW4 A;  3FBN B;  1QQI A;  3GBG A;  3IHU A;  1H8A C;  3M8J A;  2NS7 A;  1HW5 A;  2QGU A;  3BTL A;  4I0A A;  4IRH A;  3Q9S A;  1X1B A;  2F4O B;  4XLH A;  4M3D A;  4E7H A;  3WTX C;  1HW1 A;  2M2E A;  1LB2 A;  3Q9V A;  1MH3 A;  5ERI A;  3DKX A;  2F4I A;  5TGT A;  3HOX J;  4Q5S F;  1I5Z A;  3A4C A;  3SZT A;  2LF8 A;  2W84 A;  4XOR A;  1H88 C;  3WE2 A;  3P7N A;  4EJV A;  3K4B A;  5CKT A;  5ILS A;  2O3F A;  3WU2 C;  2K9S A;  3E5Q A;  5DCM B;  1HW2 A;  2E1M C;  3HTU A;  3OYE A;  5E79 C;  4RB2 C;  5E17 F;  2CRG A;  1WVR A;  3S3M A;  4KIF A;  1LFB A;  4BE1 A;  4IOC F;  1B8I B;  1Y56 A;  3C2G A;  1KQ8 A;  5LEK A;  1VQ9 I;  1RC9 A;  4HEA 2;  1ZRD A;  2DTZ A;  4BXX J;  1YJ9 I;  2IPQ X;  4HAM A;  3E3V A;  1UG0 A;  3OOP A;  5KVR A;  4B09 A;  2LH9 A;  3HOZ J;  1IRX A;  2HXO A;  2OTJ I;  2OJE D;  2CG4 A;  2HOA A;  2D45 A;  2DFE A;  2Y31 A;  3BJA A;  2M87 A;  3L00 A;  2QBY B;  2UWM A;  3LSP A;  2ELK A;  2HTJ A;  4Q48 A;  1R6R A;  4PGG A;  1FNN A;  1IO2 A;  3BPV A;  3H36 A;  2FBK A;  4IJA A;  2HQ5 A;  3H0G J;  3F8B A;  2XAU A;  1ETO A;  3BY6 A;  3V4G A;  3KYC B;  5J1U A;  1G3S A;  1W0U A;  5M5Y J;  2K85 A;  3BT9 A;  4OOI A;  4BGD A;  2E1O A;  5HVQ C;  2K4J A;  4BE2 A;  4RAY A;  1IUF A;  1ZN2 A;  3IUO A;  3BRO A;  2WV0 A;  4ABZ A;  4EMS A;  1YX3 A;  4HA8 A;  3WTT C;  3QU6 A;  3RTR A;  1XGM A;  3FXM A;  3S3O A;  4XON A;  1H89 C;  1N75 A;  4HW0 A;  3ZPL A;  3AG2 H;  2CUZ A;  3ZQF A;  1M1E B;  3H5A A;  1B1B A;  1R5G A;  2FML A;  2L02 A;  4DYC A;  2E5N A;  3WTY C;  2FBI A;  1I6H J;  5D5X B;  3QU3 A;  1J5Y A;  4WXC A;  5K7F A;  4XIC A;  3M3Y J;  5LBQ A;  3VWB A;  1JJ8 C;  5E1X A;  2J5P A;  2VT3 A;  2P5K A;  2O7O A;  4EM0 B;  3D1N I;  5JI6 A;  2WA0 A;  5JLX A;  2W85 A;  3VOE A;  2ADU A;  4BJ5 C;  1LVA A;  2OD5 A;  2ELJ A;  5LGT A;  2V1X A;  1VTN C;  2BXZ A;  3CCJ I;  2Z1D A;  2R7D A;  3K10 A;  1Q1V A;  1QO0 D;  4XSX F;  3LL7 A;  4AM3 A;  3AG4 H;  3JCU C;  1SAN A;  4L5E A;  1JT0 A;  2HVQ A;  2IGK A;  1JT6 A;  5CVI A;  3CD6 I;  3IC7 A;  4F55 A;  2L54 A;  2IT0 A;  2LVS A;  4UUS B;  1R22 A;  2ID6 A;  1JUM A;  3FMR A;  1DDN A;  1FEX A;  3OYF A;  1I27 A;  4EGZ A;  4HF1 A;  4PJM A;  4C3H J;  4Y17 A;  4RAG A;  3IH3 A;  3KP6 A;  3K9T A;  1A04 A;  4O3M A;  1AWC A;  3KPH A;  2DA1 A;  3QYF A;  3F8F A;  1FMW A;  3GZ6 A;  4U87 A;  4RDU A;  5J1Y A;  1I3A A;  3RSN A;  2CUJ A;  3B6C A;  4C2T A;  2R7U A;  4ZYD A;  2VJ4 A;  2FX0 A;  3O8H A;  2BHZ A;  2DU9 A;  2NOJ B;  5HDG A;  4HQM A;  4UUS A;  4YII A;  2Q0O A;  1X1A A;  1Z9C A;  5J8F A;  1VQ8 I;  3DTK A;  2LF7 A;  2XVC A;  5LHI A;  1GV5 A;  1SAU A;  2K5C A;  3NWT A;  5L3G A;  4BEH B;  4S05 A;  4M6Y A;  4NC7 A;  1Z6T A;  3DFG A;  3H3V K;  4M72 A;  4L18 B;  3EDP A;  3BDD A;  3HOU J;  1D0X A;  4U0V A;  2R0Q C;  3E97 A;  1K79 A;  5FD5 A;  3FIW A;  1GV2 A;  1O3R A;  3MAJ A;  2NOG A;  3K69 A;  2M3A A;  4UB6 C;  1Y0U A;  3LAP A;  4BL0 B;  5C44 J;  3QOP A;  2Y75 A;  2GWR A;  1LDJ A;  3L7W A;  2HR3 A;  1OPC A;  3DPU A;  3ZMD A;  1J59 A;  2X1C A;  3CJR B;  2H8R A;  4A3L J;  4MNU A;  2NVU B;  1SC7 A;  5BPI A;  3E6D A;  4GCV A;  3V7R A;  4OU0 A;  4GO1 A;  1Z7L A;  1FPQ A;  1MBG A;  3OYK A;  2KMU A;  3O3K A;  3PQJ A;  2IP2 A;  2HTS A;  2XKP A;  3E5U A;  4YFN F;  1O7F A;  1RET A;  2P4W A;  4CYC B;  4LIT A;  4XOT A;  3S2W A;  2KIU A;  3TGN A;  2E1N A;  3VEP A;  4AVZ A;  1LVK A;  5F1J A;  1LPQ A;  1JKO C;  2ESH A;  5EYR A;  3V42 A;  4CH7 A;  4HSR A;  3PM1 A;  3ZQH A;  2NRA C;  1K4T A;  1QVU A;  2ZME A;  3CJN A;  3HIF A;  1W36 C;  3CCS I;  1Y1W J;  4GGG A;  2IXS A;  3OS2 A;  5EZH A;  5D5V B;  2ISZ A;  2IAI A;  1W5T A;  4JP0 A;  2RKH A;  4L0Y B;  1VZ0 A;  3WTS C;  2M7A A;  4XLN F;  3H1C A;  4HX7 A;  3KEO A;  2WAF A;  1PUE E;  4YIR X;  4YEJ A;  3FKJ A;  4WX9 A;  4YRV A;  2MLK A;  5JHU A;  3S17 J;  2ZBK A;  3EUA A;  1B9M A;  2MSY A;  1I39 A;  3W2W A;  3K7A J;  4OAZ A;  5M5W J;  4ZYA A;  2OTL I;  4S0H B;  3FXQ A;  3I64 A;  4PSX A;  2BY3 A;  2O5R A;  5JHF A;  2R5Z B;  4FCY A;  2MBF A;  4U7B A;  1AKH B;  2JMW A;  4G94 A;  1OCP A;  1Y39 A;  3WE3 A;  3S8P A;  4KMU X;  3EYY A;  4Y13 A;  1LDD A;  3FZV A;  1R49 A;  1WH7 A;  2ID3 A;  3U2R A;  3IRQ A;  2KKO A;  2BW3 A;  1YIJ I;  1ETX A;  2JVH A;  2OPT A;  1IN7 A;  5FKL A;  2NYX A;  3VSK A;  2HVS A;  3M4O J;  3ABT A;  3TW6 A;  4I98 B;  3RPU A;  5BNG A;  3R61 A;  1K78 B;  1XMA A;  5TIS C;  2KDZ A;  4FX0 A;  1WCM J;  3E5X A;  2XAJ A;  4L5I A;  3BZ6 A;  3ZGK A;  2R5Z A;  1AKH A;  4ZZL A;  2OCC H;  4HYE A;  3HYI A;  2WB1 N;  3LSK A;  2DDB A;  2DPD A;  3OR1 C;  5IOZ A;  2XAG A;  5F0H A;  2BW3 B;  2E5Z A;  3QP5 A;  1J7K A;  5ILU A;  2KRH A;  2Q2E A;  2DYR H;  4D1Q A;  2JJ7 A;  1F43 A;  4EGY A;  1WPK A;  1YOV B;  2OU2 A;  1X1P A;  2LK2 A;  2I10 A;  3EET A;  1QGP A;  3D0S A;  3TO7 A;  5DCF A;  1W7P A;  1LDK B;  2HPI A;  4PJJ A;  5J47 A;  2O61 A;  2Y0M A;  2EBI A;  2BY0 A;  4XM3 A;  1HA8 A;  1FBU A;  2ICW G;  1FP1 D;  2MFZ A;  3DTE A;  4QLC U;  2VJJ A;  2O8K A;  3KZY A;  5D8K B;  1J0R A;  2YR2 A;  3EQL F;  4CSW A;  5IYC J;  1LQ1 A;  4XLE A;  3HKZ N;  4AIH A;  4RM3 A;  5HS7 A;  3MMY B;  3Q0W A;  3DF8 A;  3OSG A;  4C2M J;  2PLY A;  1JUS A;  3GUD A;  3HC7 A;  1JKQ C;  1BW6 A;  5DYM A;  4L0Z B;  2LTP A;  1RKW A;  3CC4 I;  3TMO A;  3I56 I;  2M4G A;  3E6M A;  1W7P B;  4Z6Y A;  1D0Y A;  3CCY A;  2Y9Y A;  4MTD A;  2K9Q A;  2KZG A;  2CQQ A;  3UKG A;  1PYV A;  3LSR A;  2HYG D;  2FOK A;  1F4K A;  1YI2 I;  2L9N A;  3GF2 A;  1XDU A;  2BOL A;  3F0C A;  3P9C A;  4LB6 B;  2XPV A;  3KLO A;  1TT5 B;  3ZMZ A;  3WTU C;  4NB5 A;  4H4K C;  2B7E A;  1A35 A;  5E3O A;  3OYG A;  2A6H F;  1Z67 A;  2V79 A;  4A3J J;  1AU7 A;  1EF4 A;  1DPR A;  1KU9 A;  1FMV A;  1MKM A;  1X3W B;  3TW7 A;  1CF7 A;  1HLV A;  5F64 A;  2IEK A;  3SEZ A;  4BJT A;  2I5U A;  4BQA A;  2GOX B;  3O8G A;  4RGX A;  3TED A;  3ABM H;  2EZI A;  3QPT A;  1H9T A;  4E7K A;  4DBQ A;  2H8W A;  4IQJ A;  2HYJ A;  2V1U A;  2L7M P;  1FLI A;  4BEH A;  1TWC J;  3T1B A;  4IRG A;  2GXB A;  1OYI A;  1ULY A;  2EZK A;  3D5S C;  4PJN A;  4A3E J;  3G73 A;  1YS7 A;  2HQN A;  5DS9 A;  4V2G A;  5E20 A;  3JAM Z;  3HPG A;  3BCB A;  1J2X A;  1VQO I;  1OCR H;  1AHD P;  2CW7 A;  1OIS A;  2DT7 B;  3T0Y A;  4ETS A;  1JI8 A;  2XB0 X;  4KDP A;  2CV2 A;  4ZTJ A;  4XOP A;  4L9J A;  4E7S A;  3MVP A;  2Q8K A;  1XGS A;  3JRF A;  4XSZ F;  3DWL E;  3OIP A;  5BQT A;  2D5V A;  2ACJ A;  3ZRG A;  3KP7 A;  4PDK A;  4HLY A;  1SAX A;  3SFI A;  3BPX A;  1R4M B;  1YIT I;  2W48 A;  1IG7 A;  1TT0 A;  3KFW X;  4BXU A;  3BG6 A;  1VQL I;  2E1M B;  4WK8 F;  3IH2 A;  1O3Q A;  1MGT A;  2PBI A;  2E19 A;  3DU5 A;  1R23 A;  4A3M J;  3S93 A;  2PN6 A;  2ZME B;  4P5O A;  2L3D A;  4RB1 A;  1W7P D;  2MW8 A;  5L3F A;  1X1C A;  4UXN A;  5HNH A;  4XRF A;  1QU3 A;  2VAS A;  3JRB A;  3KLN A;  1TWA J;  3ELK A;  1O4X A;  1Z21 A;  2B9S A;  3LWF A;  4FIS A;  3OY9 A;  1IXS B;  1I6X A;  4FX4 A;  1FOX A;  1GHC A;  1V3F A;  2DMQ A;  5CVR A;  3S1Q J;  2VBW A;  4ZJZ A;  3K4L A;  3OYL A;  2BVL A;  1MDM B;  1R58 A;  3AKZ A;  5IT9 K;  2RDP A;  5ED4 A;  4CYD A;  2QA4 I;  1ZHF A;  1YW7 A;  4A69 C;  5IT3 A;  1Z1D A;  3G3Z A;  1BBY A;  1T98 A;  2HOE A;  4IKF A;  3DXJ F;  3J7A O;  3SDB A;  1MMD A;  3BTJ A;  4B47 A;  4F52 A;  4Z2Y A;  1OLT A;  2VQG A;  3B73 A;  3R4K A;  4IXA A;  3LMM A;  4E7J A;  3HM5 A;  3U21 A;  2IA2 A;  2JK3 A;  3HGY A;  1TP4 A;  1K83 J;  1R1U A;  1BI3 A;  1ACI A;  1MDM A;  5FLM J;  2LFB A;  1R9T J;  5LLQ A;  1FOK A;  2FJ1 A;  2LP0 A;  3E0J B;  3FX3 A;  3N97 A;  5J4Y A;  1FYM A;  1W5C C;  3OYN A;  2I8D A;  1MSE C;  1KU3 A;  4M73 A;  2DFI A;  2A6T A;  2CFX A;  3GW2 A;  4XRM A;  1R1T A;  3JRC A;  2DA3 A;  2JSP A;  1SD6 A;  4B43 A;  2Y2Z A;  1YIO A;  4U0Y A;  2Q2E B;  1Y8R B;  4UUT A;  4N4N B;  4CZC A;  3K4C A;  4GYG A;  5M5X J;  1TWG J;  3FF5 A;  2XAQ A;  2M30 A;  3ECO A;  3FIS A;  4I76 A;  3NAU A;  4WXH A;  2KIF A;  1LFP A;  4X6A J;  1OMI A;  2FEZ A;  3NWS A;  3GTL J;  1IN6 A;  2YU3 A;  2GM4 A;  1T39 A;  1SVO A;  4HX4 A;  2CH0 A;  2DCE A;  3DKW A;  3BG9 A;  4PFP A;  1JKP C;  3J7A Y;  3AG1 H;  3KP5 A;  4MFE A;  3ZQC A;  3HOW J;  2W82 A;  2DTR A;  2LRE A;  2EA2 A;  3C1D A;  3CC2 I;  2VB6 A;  1UEL B;  4A3I J;  2PJR B;  1SFX A;  5GAG J;  4BBR J;  1WWX A;  5CLS A;  2ME6 A;  3F8N A;  2YPR A;  3CP2 A;  3WG7 H;  4G7O F;  3ZXS A;  2CMP A;  3QWL A;  2HFH A;  4KFC A;  5FKK A;  2ZFW A;  2QEX I;  2JSC A;  2RVC A;  3MD2 A;  1FYL A;  3AG3 H;  2P7C B;  1AOY A;  4KN4 X;  1BL0 A;  5H2F C;  1P9Q C;  2VXZ A;  1T0F A;  3PL8 A;  2HQR A;  2LMD A;  4PSW A;  1S8N A;  1JGS A;  3F6V A;  5H20 A;  5D8L B;  4D9J A;  1YJW I;  4XL9 A;  3M8E A;  2GA1 A;  2JRT A;  1A6Q A;  2XGX A;  2HDD A;  1QZZ A;  4N9H A;  4DJA A;  4EJO A;  3DEW A;  3GCM A;  3FXK A;  5ICE A;  3CTA A;  5K7H A;  2NVY J;  3FWE A;  5J4V A;  3LSG A;  2TRT A;  1ZGA A;  2RC4 A;  3C3W A;  4BQQ A;  3CDI A;  4Y52 J;  1FSE A;  1ZAR A;  1BA5 A;  3ECH A;  2Y0S N;  2WBM A;  4E7I A;  3OL4 A;  1HQC A;  1ZRC A;  1USS A;  2P0W A;  5F0F A;  1IUY A;  1TQI A;  4MQV A;  4BDZ A;  4KIG A;  2HOS A;  4A12 A;  5LD2 C;  5HDN A;  5B5E C;  3LFU A;  2VQC A;  2EFO A;  1PDN C;  1UB9 A;  2Z5U A;  1YO5 C;  2K02 A;  3WTW C;  1OKR A;  2FU4 A;  2H09 A;  2UXN A;  4C2U A;  1DGW Y;  1ERD A;  2XAF A;  2MA3 A;  2UV1 A;  1VF9 A;  3RZO J;  2HI3 A;  3K4K A;  1WJD A;  5IP9 J;  2OUM A;  3HSE A;  5JVG F;  4KYW A;  2EV6 A;  4A5M A;  2VKH A;  3K4N A;  1U9N A;  3FM3 A;  1UZC A;  1D8J A;  4HZF A;  2EWN A;  2R7R A;  4GDF A;  2VOD A;  4CXF A;  2BYV E;  2JWT A;  3CDH A;  3HSF A;  2XC7 A;  1BM9 A;  1WRJ A;  4Q4Z F;  2GOM A;  2NVQ J;  5ICG A;  1A6I A;  3P5J A;  4A0Y A;  3F8M A;  3GEZ A;  2H94 A;  1D3Y A;  2IJL A;  4DNC A;  4U88 A;  4CA0 A;  1GVD A;  4XKW A;  2Y30 A;  1MND A;  1XB4 A;  1S7O A;  4QPO A;  4HDU A;  2XV4 S;  5GPC A;  5F08 A;  4HBL A;  4JYK A;  4N9I A;  5GAD J;  5FLV A;  4FT8 A;  2QEN A;  1P6R A;  3OIQ A;  2FXA A;  1BI0 A;  2LNB A;  4KN7 X;  3J81 Z;  4BNC A;  3HSR A;  3HGG A;  2LSO A;  3G71 I;  2ETH A;  1T8I A;  1MMA A;  1XX5 A;  2EIL H;  5JVT A;  2IGO A;  2GQQ A;  1BW5 A;  4UHT A;  2JZY A;  3F72 A;  3KEY A;  2HYF A;  3GLL A;  3GZN B;  4XN3 A;  4DW6 A;  4I09 A;  4BS9 A;  1W1W E;  3S3N A;  2XPW A;  2DMT A;  2V6E A;  2QSF X;  5KCM A;  3KP2 A;  2NS0 A;  4L9T A;  1XDS A;  4I99 C;  3CCU I;  3BR5 A;  5J3L A;  2ZJQ F;  1W0T A;  1F9N A;  1OYY A;  2PFB A;  2E1C A;  1DU6 A;  4ESF A;  4G8X A;  2NNN A;  2AQF A;  1P4X A;  3I3L A;  4MGR A;  4NBQ A;  4JX4 A;  2A6E F;  1MZB A;  2LBF B;  2QLZ A;  1IV8 A;  3RQI A;  3M8F A;  2R7S A;  3K4J A;  3LQQ A;  3DV8 A;  1FIA A;  3S16 J;  2VE9 A;  3J7Y J;  3ZMU A;  2HZT A;  2ZB9 A;  1ZYR F;  4G9Y A;  3DKY A;  4IOA F;  4Y4R A;  4RAZ A;  1Z3X A;  1B59 A;  3GXO A;  2ZME C;  3OYB A;  2DOA A;  3CUQ B;  1OCO H;  2DMP A;  5HLH A;  2LD5 A;  1U6G A;  2ZKZ A;  5DD4 A;  2Z99 A;  1XCV A;  2QCO A;  4MFD A;  1ETW A;  1ZR4 A;  2O0Y A;  3HRU A;  1YG2 A;  3LSM A;  2M5W A;  4FTH A;  2ECC A;  3Q0U A;  1FWZ A;  3JRE A;  2CUE A;  1MSF C;  1QZE A;  3IKT A;  3DCF A;  4GYI A;  1ETV A;  2IBD A;  2V1N A;  4YG2 F;  3O2P E;  3BLY A;  1YW8 A;  2X6Y A;  4S04 A;  2P5V A;  3WOD F;  2R7W A;  1DP7 P;  1IGN A;  2XAH A;  1MJB A;  2A5W A;  4LD5 A;  1G3W A;  2IA1 A;  2PMZ N;  5K5R A;  3JSP A;  1H0M A;  1IW7 F;  1I3Q J;  4OIP F;  3RKX A;  4H0E A;  3Q0V A;  2DOF A;  4I2O A;  4OIO F;  3BZK A;  3LAJ A;  1YX5 A;  1SFE A;  3WU0 A;  1H9G A;  1J75 A;  4QWQ A;  4CUG A;  4HST A;  3DLL F;  4IHT A;  2EIJ H;  1JKR C;  4KT6 A;  2ZSI B;  5KHD A;  2IVM A;  2FMY A;  4WF2 A;  4LK0 F;  2M1B A;  3ML6 A;  3L9F A;  1ENH A;  3E7L A;  4KIC A;  1FTT A;  3K70 C;  2R92 J;  4RGR A;  3RQ4 A;  1GXQ A;  5KAI C;  1SD5 A;  5BS6 A;  1WJB A;  4HNV A;  2KJC A;  2FUG 2;  1T6S A;  3CES A;  1YRN A;  2IRF G;  2XIG A;  4XR6 A;  4HOB A;  1GXP A;  2DJI A;  4IEJ A;  3JRI A;  2H6C A;  1VND A;  2JUC A;  4BHC A;  4M6V A;  4HF2 A;  4CCJ A;  5ICC A;  4J01 A;  3GVA A;  3RKQ A;  1T38 A;  3L2V A;  2M0M A;  3VYS B;  4BKX A;  3N4M A;  4E7Z A;  3F22 A;  3V8K A;  1KYZ A;  4BXF A;  1S3J A;  2JVG A;  3G1L A;  1CGP A;  5M3M J;  5F27 A;  4V2F A;  1RES A;  2ZXH A;  5K7Z A;  2RQP A;  2VUM J;  5LHG A;  2ZCW A;  3CF5 F;  3UNG C;  3IWF A;  4BUP A;  1I1G A;  1QPM A;  2BZT A;  3BG3 A;  1O57 A;  4MIM A;  4MQ9 F;  4AUX A;  1S7E A;  2KRF A;  4BH9 A;  2OBP A;  2XRN A;  3LOC A;  1MJA A;  4YFX F;  1ZRF A;  1JHF A;  2KIM A;  2WAE A;  4O5V A;  1ODD A;  3KCC A;  1MBH A;  5CJ9 A;  3TDU C;  3RCO A;  3JTH A;  3U1D A;  3W3C A;  1XN7 A;  3LA2 A;  3GTK J;  2R7V A;  5LHH A;  2XGD A;  1ETK A;  3RZD J;  5EGO A;  3DBL B;  4XKC A;  1T2K A;  2HZD A;  4NDL A;  1YTY A;  3Q3S A;  2PQ8 A;  2OA4 A;  2CU7 A;  4BE0 A;  2LR8 A;  1HC8 A;  2XRO A;  2EZL A;  4IPA A;  1HCR A;  2GIZ A;  1IZ1 A;  3ZMV A;  3HXL A;  3SDG A;  4LIV A;  2L01 A;  1QHG A;  3I71 A;  5F0C A;  2W7N A;  1XSD A;  3PIO F;  5FRN A;  5E3L A;  4HRI A;  3F6O A;  4C3I J;  3DBH B;  2AXT C;  2HKX A;  2L7K A;  3I54 A;  4LGW A;  4B4C A;  3S1R J;  5BPD A;  3K1M A;  5TRD A;  2VT2 A;  2K40 A;  3BOQ A;  1G8X A;  1IAW A;  2Z33 A;  1UCR A;  4M9X A;  3H92 A;  3JRD A;  2XF5 A;  5LGU A;  1WGX A;  1MMN A;  4IO9 F;  3G2B A;  3W6V A;  3BWG A;  3LFK A;  3A01 A;  2R7T A;  4X0G A;  2HNH A;  1Z77 A;  2V9K A;  3QAH A;  1OQY A;  3LSI A;  3OYJ A;  3SQN A;  3RPQ A;  3KX2 A;  5L3C A;  3L09 A;  4I6Z A;  5FD6 A;  1BR1 A;  1MNE A;  3WGG A;  4DYR A;  1VQ7 I;  1X4P A;  1EH6 A;  2AHQ A;  2OCE A;  3DEE A;  3E6C C;  4Y33 A;  4CCO A;  2F5E A;  3KP4 A;  3CLO A;  3GME A;  3K6G A;  1SD7 A;  3GFJ A;  2ZO4 A;  1WJF A;  1C0W A;  3OWT A;  2EFN A;  3U1K A;  4XLP F;  2MYS A;  1FBS A;  1S5L C;  3A01 B;  4A3F J;  1IRG A;  3QYE A;  3QRF F;  5BMZ A;  3FM5 A;  3HDD A;  1X1D A;  2ZC2 A;  1KON A;  1EV7 A;  2ZJP F;  3F9K A;  1B4A A;  1PJR A;  4IHX A;  4MHG A;  2QQB A;  1OCC H;  1BI1 A;  2Y48 A;  3D5R C;  2R93 J;  2OV7 A;  2YX7 A;  3AFH A;  4XK4 A;  2E35 A;  4KA4 A;  4ZYE A;  2RQQ A;  3FKI J;  2ESN A;  2QQ8 A;  1UMQ A;  4BAC A;  1KU2 A;  3OR2 C;  5E1W A;  2PEX A;  2Z2S B;  2X1E A;  2R5Y B;  1D5Y A;  2X9D A;  3CMM A;  3A0H C;  5FKN A;  1VQN I;  4A3K J;  1LEA A;  1ZGJ A;  2XAS A;  4AYB A;  2VON A;  1QVT A;  2LY9 A;  4WXD A;  3VFZ A;  1B8I A;  4CYC A;  1B6A A;  1XPX A;  2CUF A;  3HKZ A;  3PSF A;  2DMU A;  1FY7 A;  2X48 A;  3SFZ A;  5IOY A;  1RRJ A;  2KT0 A;  2F4M B;  2H27 A;  2VE8 A;  2VKE A;  1HXD A;  1REP C;  5DUI A;  3TOB A;  3HB9 A;  3GYH X;  4AVP A;  2FSW A;  4ON0 A;  1T08 B;  4BHB A;  1X58 A;  5DD8 A;  3CCE I;  5K1Y A;  2QBY A;  2GZW A;  5E3M A;  1BJZ A;  1K6Y A;  3PFI A;  1X3Z B;  1RPW A;  1HBX G;  2AQE A;  1BC7 C;  3IAS 2;  2WAD A;  3S2H J;  3FBI B;  1BOA A;  4IHW A;  1IDZ A;  1GUU A;  4QIW N;  1E3H A;  5F1R A;  2ISY A;  5H6Q A;  1PUF B;  1YLF A;  2ZJR F;  4KIS A;  1IN5 A;  4MEY F;  2KPM A;  1ETQ A;  3PIP F;  2EV0 A;  3W6K B;  1XTA A;  5HLG A;  3DLA A;  5LEJ A;  2X51 A;  3W2V A;  2OZ6 A;  1YRN B;  4D7M A;  5DCM A;  1SVL A;  5DEQ A;  1G3T A;  3K2A A;  3GWZ A;  4U0W A;  3SHF A;  4G7H F;  2KLO A;  3E1S A;  4ZH4 F;  5FKO A;  3A2K A;  2ZJ2 A;  1FZP B;  1ZGW A;  5IP7 J;  2EFW A;  1WH5 A;  3CCQ I;  3K0L A;  2DFF A;  2COB A;  4B3A A;  4HDV A;  4Y3O A;  3HBL A;  1FX7 A;  4RLF A;  5HLI A;  4E7L A;  5FRO A;  1RUN A;  3H35 A;  2L4A A;  2FQ3 A;  2ZNZ A;  4FET A;  1K61 A;  1MBE A;  3V8J A;  5FLX K;  2ME0 A;  3F23 A;  2E7W A;  2K9L A;  3LA3 A;  9ANT A;  2QSH X;  3PSI A;  3BJ6 A;  1U5T B;  5FFZ A;  2YSR A;  3VYT B;  3BG5 A;  4OIR F;  4F92 B;  1DPU A;  3FXU A;  3ZQQ A;  2O03 A;  5DUK A;  1S72 I;  3I4M J;  3C7J A;  1TW3 A;  1WHU A;  4YIF A;  2YX4 A;  3CJT B;  3HHH A;  5EJC A;  4P55 A;  5EDN A;  5FO5 A;  4I01 A;  4II3 A;  2BV6 A;  2VQH A;  2V9P A;  2CV0 A;  5GP9 A;  5CQE A;  1O3S A;  4W97 A;  4JX5 A;  4C9Y A;  4D5C A;  5EEG A;  1OR7 C;  1IV6 A;  5B3S H;  3I58 A;  2NXN B;  5DM7 F;  1PP7 U;  2DOD A;  1MH4 A;  1VI0 A;  2VQL A;  2DOE A;  3TO9 A;  5GTI C;  3MQ0 A;  1WQ2 A;  2L7Z A;  1D1C A;  2STW A;  2NVT J;  5A2Q Z;  1LUJ B;  3KYL A;  3G6E I;  3HHG A;  1WJ5 A;  2BY1 A;  2D2W A;  4LJZ F;  2A07 F;  3HOV J;  2O6G E;  4A0X A;  1YE9 A;  4A3B J;  2WB1 A;  4YFK F;  2F5V A;  3GLX A;  1NG6 A;  2KRC A;  4NC8 A;  3JRH A;  3J80 K;  4M3E A;  4GRI A;  1U0J A;  2DQR A;  4PGH A;  3RDI A;  3I55 I;  1ZQ3 P;  3GTO J;  2KIS A;  1S6L A;  2R7F A;  2XRL A;  5FRM A;  4FAS D;  2EZH A;  4IX7 A;  4G6D A;  5L3B A;  2YUS A;  1X4O A;  1VQ6 I;  4I02 A;  5KNL A;  4UUV A;  3LQR A;  4XMY A;  6PAX A;  2HEO A;  1XSX A;  2HDW A;  4RAF A;  1IF1 A;  1SEU A;  5L3E A;  2G9W A;  1CF7 B;  4QSH A;  1XGN A;  3ZR8 X;  2JPB A;  2CV1 A;  3JR9 A;  5EZG A;  1D8K A;  2VJ5 A;  3TDZ C;  5CVV A;  2HS5 A;  3WGH A;  2E2J J;  1W5S A;  1R00 A;  3EUK L;  4ANJ A;  2XPU A;  1Y6I A;  5DDG A;  1FJL A;  1KQ9 A;  4M74 A;  2UUZ A;  5DV5 A;  4R1H A;  4EEF G;  4IF4 A;  4ENM A;  1VQP I;  3ZQI A;  3BTC A;  5CPR B;  5LFA A;  1UHM A;  2R4G A;  1HDD C;  1DGR M;  3I9V 2;  4LOC A;  3H9J A;  3VSL A;  2JA6 J;  3IAM 2;  2FA5 A;  2RN7 A;  3MZ8 A;  4MTE A;  2K9M A;  3V7S A;  2M9H A;  1DUX C;  1FBQ A;  1S9H A;  1UFM A;  1MBJ A;  2RNJ A;  2M8G X;  5IPA A;  3L2C A;  2E36 A;  2LG4 A;  2CYY A;  4LB5 A;  4RGU A;  4PJL A;  2G7U A;  2R7Q A;  3BQY A;  2QWW A;  1TC3 C;  3NRV A;  3B6A A;  3WHB A;  4A0Z A;  2HKO A;  3IH4 A;  2A69 F;  4CGZ A;  4DZP A;  3FXO A;  2DJN A;  4EQQ A;  1LFU P;  5B1B H;  1P7J A;  2JN6 A;  2O8X A;  3DTI A;  4F93 B;  3KZI C;  3WGI A;  3ZCO A;  2DA2 A;  3AAF A;  2COM A;  4BY7 J;  2VLA A;  1HOM A;  3RIR A;  2DXI A;  4XNF A;  3ERE D;  1HKS A;  1U3E M;  2CW0 F;  5FGM A;  4D0P A;  1A5J A;  1TQM A;  4C3J J;  5D5U B;  3FDY A;  3CF2 A;  4UY8 I;  2E7X A;  2NVX J;  2VC0 A; 
#chains in the Genus database with same CATH homology
 1JE8 A;  1K78 A;  3JW4 A;  2VBX A;  3GFI A;  2VBY A;  3K2Z A;  1ZLK A;  2P6T A;  4EJU A;  1P4W A;  4ESB A;  5F6F A;  3FHZ A;  2VC1 A;  2MH9 A;  1X3U A;  3MCZ A;  3TO6 A;  1F1Z A;  1BN5 A;  2DT5 A;  1U5T C;  1STZ A;  3ROU A;  4KNY A;  4I0B A;  1IN8 A;  2NNY A;  4LLN A;  1KGS A;  3H3U A;  2X0L A;  5HDK A;  1Z05 A;  3RI4 A;  4RGS A;  1SMT A;  2KJB A;  1G3Y A;  3SZP A;  3JTG A;  1UHW A;  1FSH A;  2EJR A;  5AIQ A;  4CHU A;  4IRI A;  2LDU A;  3M7G A;  4MEX F;  1KU7 A;  2W24 A;  3V8L A;  2HGC A;  2CWE A;  2M8E A;  3BJO A;  2B0L A;  4ESJ A;  4UNO A;  2MC3 A;  4PZJ A;  1LNW A;  4R8H A;  1R5H A;  4OMZ A;  2WC2 A;  1FC3 A;  1ON1 A;  3ZMT A;  3JSO A;  5IT9 Z;  4HQE A;  3BP8 A;  3ZP5 A;  1EH8 A;  4M6X A;  3VB2 A;  3HOS A;  3HUG A;  1E17 A;  3WG9 A;  3TKY A;  3HTS B;  3J81 K;  4OIQ F;  3CUO A;  5CVU A;  1K6O A;  3RKY A;  5AIP A;  3CO7 C;  4TV7 A;  5HS9 A;  5ILV A;  2CGP A;  5AON A;  5EEH A;  2X4H A;  2VOP A;  4L5J A;  4P96 A;  2DAO A;  3GFL A;  3DQV C;  2GXG A;  1TNS A;  1U78 A;  2CO5 A;  1BIB A;  2PI0 A;  2P7V B;  2BBY A;  3J80 Z;  2NAZ A;  2VOO A;  3K1P A;  1HKQ A;  2BEO A;  1HKT A;  1KYW A;  1PP8 F;  3KZZ A;  1Z6R A;  4LLG F;  4OMY A;  1LJ9 A;  5FFX A;  4KMF A;  1MJ9 A;  3F8C A;  3CO6 C;  3HRS A;  4NQW A;  2K27 A;  5H6R A;  5LRS A;  4EV0 A;  1BC8 C;  2PG4 A;  4LK1 F;  4Q47 A;  1P4A A;  2UXX A;  3OV8 A;  4M9S A;  2FE3 A;  3ZQ7 A;  2UZK A;  1TBX A;  2A68 F;  3B02 A;  1WI9 A;  4UVB A;  4AIK A;  1O7L A;  3ULQ B;  5JR3 A;  4Y15 A;  4CO8 A;  4K2E A;  3D5L A;  3F21 A;  4ZYH A;  3I0T A;  2L4M A;  1IN4 A;  5D6F A;  3I53 A;  1R36 A;  2A61 A;  2P5L C;  1LEB A;  1S29 A;  3T8R A;  4GXO A;  3PQK A;  2EFP A;  4RS8 A;  1HSJ A;  5ICF A;  3R6S A;  4ZZD A;  3GX4 X;  4LFU A;  1S7A A;  2FNP A;  1TQP A;  4CZZ A;  3DEU A;  3I59 A;  3IRR A;  3REO A;  1ZAO A;  4EJT A;  2K7L A;  2QUF A;  4A5N A;  4ZYG A;  2QYO A;  3RJP A;  2FBH A;  1GVJ A;  3WU1 B;  3F3X A;  1P2F A;  3HRM A;  4LMY A;  1NHA A;  1ON2 A;  3NEU A;  1W4M A;  5D4R A;  2EK5 A;  3EUH A;  3I59 B;  1QNT A;  3K1N A;  3WTV C;  1RIO H;  4UVC A;  2BE5 F;  5J8C A;  3LA7 A;  1TLH B;  2FNA A;  3MZY A;  3Q5F A;  4OIN F;  4G7Z F;  4BAY A;  4A6D A;  4JK1 X;  1FYK A;  1FT9 A;  4BYY A;  2DK5 A;  3H3Z A;  1XCB A;  2M45 A;  1WKM A;  4LLL A;  3QP6 A;  4P9F A;  3TQN A;  2H6B A;  2ELH A;  3CUQ C;  1RUO A;  3IL2 A;  5E1Z B;  2OQG A;  2ZXJ A;  5E8I A;  2C6Y A;  5LRR A;  4AWX B;  2J5O A;  1MD0 A;  2EB7 A;  2DBB A;  2BGC A;  2V6C A;  1IXC A;  3I5U A;  4UVA A;  2IW5 A;  3DPT A;  3T8T A;  3VOD A;  1V4R A;  1KQ0 A;  3RYR A;  4ENJ A;  2AS5 F;  4M71 A;  4CIC A;  4M9Z A;  5KK1 A;  4JQF A;  1YYV A;  3FMS A;  4WCG A;  3GFM A;  1P92 A;  1B9N A;  2WWY A;  4N0B A;  4AD9 A;  2D1V A;  3EYI A;  1OR7 A;  1ZG3 A;  4I7H A;  1XD7 A;  2TDX A;  3NQO A;  2DQL A;  2JPC A;  4HX8 A;  1BIA A;  2FRH A;  4G6Q A;  3M9A A;  3LST A;  1Z7U A;  2JTV A;  1TW2 A;  4EM2 A;  2V1D A;  4KIB A;  5CYV A;  4CDG A;  5JFR A;  2LKP A;  1SFU A;  2CQK A;  1L0O C;  2DK8 A;  2CSO A;  2XKO A;  4WWC A;  4ASN A;  3C18 A;  5E18 F;  4NHJ A;  2EA4 A;  4LG0 A;  3IWZ A;  2V9V A;  4BHP A;  4UV9 A;  4DQ2 A;  2A5Y B;  2PMU A;  2AXL A;  2RV8 A;  2GA2 A;  1QZY A;  1BI2 A;  2OZU A;  4EJW A;  2XUB A;  2OAZ A;  1YFH A;  2W25 A;  2MD5 A;  3R0A A;  1SMY F;  3MFK A;  1ZLJ A;  5D4S A;  2GAU A;  1U8R A;  3RYP A;  1FP2 A;  1SD4 A;  3KP3 A;  3U9G A;  3M1E A;  3T5X A;  4LG0 B;  1R7J A;  3I4P A;  4R79 A;  2QZ8 A;  4F7Z A;  2RGV A;  4KUM A;  1EH7 A;  3FXR A;  4RB3 C;  2IA0 A;  5D6E A;  4A6E A;  2JT1 A;  1E2X A;  3CUQ A;  3O6B B;  1ZH5 A;  2K4B A;  5K5O A;  5K5Q A;  3V7C A;  4UV8 A;  1IRF A;  3MZH A;  2F2E A;  2F5C A;  5LGN A;  1Z91 A;  2OQR A;  4IVN A;  2QQ9 A;  5FB2 A;  1I1S A;  2P6S A;  2MH2 A;  1XSV A;  3HRT A;  4E70 A;  1ZG1 A;  2MLG A;  1ZG5 A;  3TOA A;  3DP7 A;  2F5F A;  2QVO A;  1RI7 A;  2VN2 A;  4HLX A;  1ONV A;  2G7H A;  4L9N A;  2PJP A;  3WTZ A;  3ZMS A;  3GO5 A;  2GIV A;  3ZN0 A;  1TNT A;  3HOT A;  3R0J A;  1D5V A;  1TTY A;  1XMK A;  5E8G A;  1IXR C;  4U7D A;  2A3S A;  3KEQ A;  3SXY A;  5CVJ A;  3RKW A;  3DPL C;  1YW9 A;  1RZ4 A;  2DI3 A;  1O3T A;  1OYW A;  2DO7 A;  5HOO A;  1U5T A;  5D5W B;  2HWV A;  1U2W A;  4P9U A;  3P9I A;  4O6J A;  4JBA A;  5L3D A;  2PMH A;  3ZN1 A;  3COA C;  3FMQ A;  1UST A;  2EFQ A;  4HV5 A;  2ZNY A;  2XHK A;  1XGO A;  2STT A;  3MEX A;  2EV5 A;  3QPH A;  1J9I A;  1K7A A;  3P9K A;  1BJA A;  2P8T A;  1G6N A;  4EM1 A;  3R60 A;  1KA8 A;  2VBZ A;  3E6B A;  1YQA A;  2Z9O A;  2D1H A;  3MWM A;  5J6X A;  4ENN A;  1HST A;  2F5D A;  5A2Q K;  4RB0 A;  1ZRE A;  4IHS A;  2K86 A;  2DPU A;  3KET A;  4HV6 A;  5FLX Z;  3ISP A;  1F5T A;  3KE2 A;  2R3S A;  4XBF A;  4A2U A;  4AIJ A;  1Q1H A;  4L9V A;  5HS8 A;  4FHT A;  1RNL A;  1R1V A;  2Z3Y A;  3IKV A;  1G4D A;  1JXS A;  1L3L A;  4HF0 A;  1JHH A;  4KT5 C;  2HDC A;  2QQA A;  3ABU A;  4EVI A;  2QM3 A;  1QBJ A;  2WTE A;  4ENK A;  2DLL A;  5TJJ A;  2W57 A;  5BOX A;  4B8X A;  3GZ5 A;  2FF4 A;  4PCQ A;  1YS6 A;  3JAM K;  3W6J B;  1WSU A;  2DW4 A;  1QQI A;  3IHU A;  1HW5 A;  4I0A A;  4IRH A;  3Q9S A;  3WTX C;  1HW1 A;  1LB2 A;  3Q9V A;  5ERI A;  4Q5S F;  1I5Z A;  3SZT A;  2LF8 A;  2W84 A;  3WE2 A;  3P7N A;  4EJV A;  5ILS A;  2O3F A;  3E5Q A;  5DCM B;  1HW2 A;  3HTU A;  5E17 F;  4RB2 C;  4KIF A;  1KQ8 A;  5LEK A;  1ZRD A;  2IPQ X;  4HAM A;  3E3V A;  3OOP A;  5KVR A;  4B09 A;  2CG4 A;  2D45 A;  3L00 A;  3BJA A;  2M87 A;  2QBY B;  2UWM A;  2HTJ A;  4Q48 A;  4PGG A;  1FNN A;  3BPV A;  2FBK A;  4IJA A;  3F8B A;  3BY6 A;  3V4G A;  1G3S A;  4OOI A;  5HVQ C;  2K4J A;  4RAY A;  1ZN2 A;  3BRO A;  2WV0 A;  4EMS A;  4HA8 A;  3WTT C;  3QU6 A;  3RTR A;  1XGM A;  4HW0 A;  3ZPL A;  1B1B A;  1R5G A;  2FML A;  2L02 A;  3WTY C;  2FBI A;  5D5X B;  3QU3 A;  1J5Y A;  4WXC A;  5LBQ A;  5E1X A;  2J5P A;  2VT3 A;  2P5K A;  4EM0 B;  5JI6 A;  1VTN C;  2W85 A;  2ADU A;  3VOE A;  1LVA A;  2OD5 A;  5LGT A;  2V1X A;  2R7D A;  1QO0 D;  4XSX F;  5CVI A;  3IC7 A;  2L54 A;  2IT0 A;  1R22 A;  3FMR A;  1DDN A;  1I27 A;  4EGZ A;  4HF1 A;  4Y17 A;  3KP6 A;  3K9T A;  1A04 A;  4O3M A;  1AWC A;  3F8F A;  3GZ6 A;  4ZYD A;  2DU9 A;  5HDG A;  4HQM A;  4YII A;  2Q0O A;  1Z9C A;  5J8F A;  2LF7 A;  2XVC A;  5LHI A;  5L3G A;  4S05 A;  4M6Y A;  1Z6T A;  3DFG A;  4M72 A;  4L18 B;  3EDP A;  3BDD A;  4U0V A;  3E97 A;  1K79 A;  5FD5 A;  1O3R A;  3MAJ A;  3K69 A;  1Y0U A;  3LAP A;  3QOP A;  2Y75 A;  3ZMD A;  2GWR A;  1LDJ A;  2HR3 A;  1OPC A;  3L7W A;  1J59 A;  4MNU A;  5BPI A;  3E6D A;  4GCV A;  3V7R A;  4OU0 A;  4GO1 A;  1FPQ A;  3O3K A;  3PQJ A;  2IP2 A;  2HTS A;  2XKP A;  3E5U A;  4YFN F;  1O7F A;  2P4W A;  3S2W A;  2KIU A;  3TGN A;  2E1N A;  3VEP A;  2ESH A;  2NRA C;  2ZME A;  3CJN A;  3HIF A;  4GGG A;  5D5V B;  2ISZ A;  4L0Y B;  1W5T A;  2RKH A;  3WTS C;  4XLN F;  4HX7 A;  3KEO A;  1PUE E;  4WX9 A;  5JHU A;  2MLK A;  2ZBK A;  1B9M A;  3FXQ A;  3I64 A;  2MBF A;  4U7B A;  4G94 A;  3WE3 A;  4KMU X;  3EYY A;  4Y13 A;  1LDD A;  3FZV A;  3U2R A;  3IRQ A;  2KKO A;  1IN7 A;  2NYX A;  3ABT A;  4I98 B;  3RPU A;  3R61 A;  1K78 B;  1XMA A;  4FX0 A;  3E5X A;  2XAJ A;  4L5I A;  3BZ6 A;  4ZZL A;  4HYE A;  3HYI A;  2DPD A;  2XAG A;  3QP5 A;  1J7K A;  5ILU A;  2Q2E A;  4EGY A;  2OU2 A;  3EET A;  3TO7 A;  1QGP A;  3D0S A;  5DCF A;  1W7P A;  1LDK B;  2O61 A;  2Y0M A;  1FBU A;  1FP1 D;  4QLC U;  3KZY A;  5D8K B;  1J0R A;  2YR2 A;  3EQL F;  1LQ1 A;  4AIH A;  5HS7 A;  3DF8 A;  2PLY A;  3GUD A;  5DYM A;  4L0Z B;  3E6M A;  1W7P B;  4MTD A;  2HYG D;  2FOK A;  1F4K A;  3GF2 A;  1XDU A;  3P9C A;  4LB6 B;  3KLO A;  3ZMZ A;  3WTU C;  4NB5 A;  2A6H F;  2V79 A;  1DPR A;  1KU9 A;  1MKM A;  1CF7 A;  5F64 A;  4BQA A;  4RGX A;  1H9T A;  3QPT A;  2V1U A;  1FLI A;  3T1B A;  4IRG A;  2GXB A;  1OYI A;  1ULY A;  3G73 A;  1YS7 A;  2HQN A;  5E20 A;  3JAM Z;  1J2X A;  3T0Y A;  4ETS A;  4KDP A;  4L9J A;  2Q8K A;  1XGS A;  4XSZ F;  5BQT A;  2ACJ A;  4HLY A;  3KP7 A;  4PDK A;  1SAX A;  3BPX A;  3KFW X;  4BXU A;  4WK8 F;  1O3Q A;  1MGT A;  2PBI A;  1R23 A;  2PN6 A;  2ZME B;  4P5O A;  2L3D A;  4RB1 A;  1W7P D;  5L3F A;  4UXN A;  4XRF A;  3KLN A;  3ELK A;  3LWF A;  1IXS B;  1I6X A;  4FX4 A;  1GHC A;  1V3F A;  5CVR A;  2VBW A;  1MDM B;  1R58 A;  5IT9 K;  2RDP A;  5ED4 A;  4CYD A;  1ZHF A;  1YW7 A;  5IT3 A;  1Z1D A;  3G3Z A;  1BBY A;  1T98 A;  2HOE A;  3DXJ F;  3J7A O;  4Z2Y A;  3B73 A;  3R4K A;  4IXA A;  2IA2 A;  1R1U A;  1BI3 A;  1MDM A;  5LLQ A;  1FOK A;  3FX3 A;  3N97 A;  1FYM A;  1KU3 A;  4M73 A;  2DFI A;  2CFX A;  3GW2 A;  1R1T A;  1SD6 A;  4U0Y A;  1YIO A;  4GYG A;  3FF5 A;  2XAQ A;  2M30 A;  3ECO A;  4WXH A;  2KIF A;  1OMI A;  2FEZ A;  1IN6 A;  2YU3 A;  1T39 A;  4HX4 A;  3DKW A;  3KP5 A;  2DTR A;  2EA2 A;  3C1D A;  1SFX A;  1WWX A;  5CLS A;  3F8N A;  2YPR A;  4G7O F;  2HFH A;  4KFC A;  2ZFW A;  2JSC A;  2RVC A;  1FYL A;  2P7C B;  1AOY A;  4KN4 X;  2VXZ A;  1T0F A;  2HQR A;  1S8N A;  1JGS A;  3F6V A;  5H20 A;  5D8L B;  3M8E A;  2GA1 A;  2JRT A;  2XGX A;  1QZZ A;  4N9H A;  4EJO A;  5ICE A;  3CTA A;  3FWE A;  1ZGA A;  2RC4 A;  3C3W A;  1FSE A;  1ZAR A;  3ECH A;  1HQC A;  1ZRC A;  1USS A;  1IUY A;  1TQI A;  4MQV A;  4KIG A;  4A12 A;  5HDN A;  2EFO A;  1PDN C;  1UB9 A;  2Z5U A;  1YO5 C;  2K02 A;  3WTW C;  1OKR A;  2FU4 A;  2H09 A;  2UXN A;  2XAF A;  2MA3 A;  3HSE A;  4KYW A;  2EV6 A;  4A5M A;  3FM3 A;  1D8J A;  4HZF A;  2EWN A;  2VOD A;  4CXF A;  2BYV E;  3CDH A;  3HSF A;  1BM9 A;  1WRJ A;  4Q4Z F;  5ICG A;  4A0Y A;  3F8M A;  3GEZ A;  2H94 A;  1D3Y A;  2IJL A;  4DNC A;  4U88 A;  1XB4 A;  4HDU A;  1S7O A;  2XV4 S;  4HBL A;  4N9I A;  4FT8 A;  2QEN A;  1P6R A;  2FXA A;  1BI0 A;  2LNB A;  4KN7 X;  3J81 Z;  4BNC A;  3HSR A;  2LSO A;  2ETH A;  5JVT A;  2GQQ A;  4UHT A;  2JZY A;  3F72 A;  2HYF A;  4I09 A;  3KP2 A;  2NS0 A;  4L9T A;  1XDS A;  1F9N A;  1OYY A;  2PFB A;  2E1C A;  4ESF A;  4G8X A;  2NNN A;  1P4X A;  4MGR A;  2A6E F;  1MZB A;  2QLZ A;  3M8F A;  3LQQ A;  3DV8 A;  2VE9 A;  3ZMU A;  2HZT A;  1ZYR F;  4G9Y A;  4RAZ A;  1B59 A;  3GXO A;  3CUQ B;  5HLH A;  1U6G A;  2ZKZ A;  5DD4 A;  2Z99 A;  1XCV A;  2O0Y A;  3HRU A;  1YG2 A;  2M5W A;  1FWZ A;  3IKT A;  4GYI A;  4YG2 F;  3O2P E;  1YW8 A;  1DP7 P;  4S04 A;  2P5V A;  3WOD F;  2XAH A;  1MJB A;  4LD5 A;  1G3W A;  2IA1 A;  5K5R A;  3JSP A;  1H0M A;  1IW7 F;  4OIP F;  3RKX A;  4H0E A;  4I2O A;  4OIO F;  3LAJ A;  1SFE A;  3WU0 A;  1H9G A;  1J75 A;  4QWQ A;  4IHT A;  2IVM A;  2FMY A;  4WF2 A;  4LK0 F;  2M1B A;  3ML6 A;  3L9F A;  4KIC A;  4RGR A;  1GXQ A;  1SD5 A;  5BS6 A;  2KJC A;  1T6S A;  2IRF G;  2XIG A;  1GXP A;  4HOB A;  2H6C A;  4BHC A;  4HF2 A;  5ICC A;  3GVA A;  1T38 A;  3N4M A;  3F22 A;  3V8K A;  1KYZ A;  1CGP A;  1S3J A;  2RQP A;  5LHG A;  2ZCW A;  3IWF A;  1I1G A;  1QPM A;  1O57 A;  4MQ9 F;  2KRF A;  4BH9 A;  2OBP A;  2XRN A;  1ZRF A;  1MJA A;  4YFX F;  1JHF A;  2KIM A;  4O5V A;  1ODD A;  3KCC A;  5CJ9 A;  3TDU C;  3JTH A;  3U1D A;  1XN7 A;  3LA2 A;  5LHH A;  1T2K A;  1YTY A;  2PQ8 A;  2OA4 A;  2XRO A;  4IPA A;  1IZ1 A;  3ZMV A;  2L01 A;  3I71 A;  1XSD A;  3F6O A;  5BPD A;  2HKX A;  3I54 A;  4LGW A;  3K1M A;  5TRD A;  2VT2 A;  3BOQ A;  1IAW A;  2Z33 A;  1UCR A;  4M9X A;  3H92 A;  2E7X A;  5LGU A;  3BWG A;  3LFK A;  3QAH A;  3SQN A;  3RPQ A;  5L3C A;  3L09 A;  5FD6 A;  3WGG A;  1EH6 A;  3E6C C;  2F5E A;  3KP4 A;  3CLO A;  1SD7 A;  3GFJ A;  2ZO4 A;  1C0W A;  2EFN A;  4XLP F;  1FBS A;  1IRG A;  3QRF F;  5BMZ A;  3FM5 A;  1EV7 A;  1B4A A;  4MHG A;  2QQB A;  1BI1 A;  2Y48 A;  2YX7 A;  4KA4 A;  4ZYE A;  2ESN A;  1KU2 A;  5E1W A;  2PEX A;  1LEA A;  1ZGJ A;  2XAS A;  2VON A;  4WXD A;  3VFZ A;  1B6A A;  1FY7 A;  3SFZ A;  2H27 A;  2VE8 A;  1HXD A;  1REP C;  5DUI A;  3TOB A;  3GYH X;  4AVP A;  2FSW A;  4ON0 A;  4BHB A;  5DD8 A;  5K1Y A;  2QBY A;  2GZW A;  3PFI A;  1HBX G;  1BC7 C;  1BOA A;  5F1R A;  2ISY A;  5H6Q A;  1YLF A;  1IN5 A;  4MEY F;  2EV0 A;  3W6K B;  5HLG A;  5LEJ A;  2OZ6 A;  5DCM A;  5DEQ A;  1G3T A;  3GWZ A;  4U0W A;  3SHF A;  4G7H F;  4ZH4 F;  2ZJ2 A;  1FZP B;  2EFW A;  3K0L A;  4HDV A;  1FX7 A;  5HLI A;  1RUN A;  2L4A A;  2FQ3 A;  2ZNZ A;  3V8J A;  5FLX K;  3F23 A;  2E7W A;  3LA3 A;  3BJ6 A;  1U5T B;  5FFZ A;  2YSR A;  4OIR F;  1DPU A;  3FXU A;  2O03 A;  5DUK A;  3C7J A;  1TW3 A;  4YIF A;  2YX4 A;  3HHH A;  4P55 A;  5FO5 A;  4I01 A;  2BV6 A;  1O3S A;  5EEG A;  3I58 A;  1PP7 U;  3TO9 A;  3MQ0 A;  1WQ2 A;  2STW A;  5A2Q Z;  3HHG A;  2D2W A;  4LJZ F;  2A07 F;  2O6G E;  4A0X A;  4YFK F;  3GLX A;  3J80 K;  2DQR A;  4PGH A;  3RDI A;  1S6L A;  2R7F A;  4G6D A;  5L3B A;  4I02 A;  4UUV A;  3LQR A;  6PAX A;  2HEO A;  1XSX A;  1IF1 A;  5L3E A;  2G9W A;  1CF7 B;  1XGN A;  2JPB A;  1D8K A;  3TDZ C;  5CVV A;  2HS5 A;  3WGH A;  1W5S A;  1R00 A;  5DDG A;  4M74 A;  5DV5 A;  4R1H A;  4IF4 A;  4ENM A;  1UHM A;  2FA5 A;  3V7S A;  2RN7 A;  4MTE A;  1DUX C;  1FBQ A;  1UFM A;  2RNJ A;  3L2C A;  2CYY A;  4LB5 A;  4RGU A;  2G7U A;  2QWW A;  3NRV A;  4A0Z A;  2HKO A;  4CGZ A;  2A69 F;  4EQQ A;  2O8X A;  3WGI A;  3AAF A;  2COM A;  3RIR A;  3ERE D;  1HKS A;  1U3E M;  2CW0 F;  5FGM A;  4D0P A;  1TQM A;  5D5U B;  1KQ9 A;  2VC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...