1SD7A

Crystal structure of a semet derivative of meci at 2.65 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd7A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd7A02
1PP7U 3J80K 5HS9A 1YW7A 2JPCA 1B1BA 3WGGA 2RC4A 1Z6TA 5L3BA 2ZJ2A 1SFXA 4Q5SF 4A5NA 3O2PE 4EJUA 1MKMA 3WU0A 1JHHA 3FZVA 2P5VA 2STTA 2M5WA 3CDHA 2M30A 3MFKA 1CGPA 4Q4ZF 4HAMA 3WTZA 3BY6A 2YX4A 2JPBA 2IW5A 2K4JA 4M72A 4CICA 2HQRA 5E1WA 4LG0B 4R79A 1SAXA 1R00A 2TDXA 1HKTA 4KT5C 3KEOA 1SD7A 4HBLA 4UXNA 2E1CA 1ZRFA 4M71A 2HFHA 5LEKA 1RNLA 3NRVA 2O3FA 4HDVA 1ODDA 3BZ6A 3C18A 2PBIA 3GFMA 3MWMA 3GXOA 3F6OA 3F8MA 2VBWA 2IA0A 1U5TC 4HA8A 2CGPA 1UHMA 4WXDA 3T5XA 4LB6B 4OU0A 2FBHA 4HZFA 1UCRA 4Y15A 5FLXZ 3ELKA 5ICFA 3R0JA 1P4AA 1WKMA 2FMYA 4EGZA 4UHTA 1K7AA 3PFIA 4PCQA 1YW9A 1STZA 4QLCU 3WTTC 4LLNA 3L7WA 1O3RA 3WTYC 2W57A 1ZRCA 5HVQC 2QQ9A 3WTVC 3HOSA 2IT0A 3IRRA 5DCFA 3KFWX 3IRQA 2M45A 5DUKA 3BOQA 2H27A 5ILUA 4FX4A 1MDMA 5DD8A 2E7XA 4MEXF 2NAZA 2PQ8A 5E8IA 4YIIA 3DFGA 2DLLA 3R61A 2F5EA 1ZAOA 4FT8A 1U5TA 4RAYA 5D6FA 1TNTA 1YG2A 2MD5A 1J9IA 3ECHA 3ULQB 4BHCA 3M9AA 1TQPA 4A0YA 3RYPA 3J81K 1B4AA 2A61A 3KETA 1PDNC 3FM3A 1HQCA 1MDMB 3MZYA 2ZNZA 4NB5A 4OMZA 4OIOF 2KIFA 4ASNA 2WV0A 2OZUA 1FPQA 4G9YA 2O6GE 1FP1D 3ZP5A 3E97A 3CLOA 3TDZC 3MEXA 1S7AA 4EM0B 1FBSA 3J7AO 1BBYA 1ULYA 1I5ZA 2V6CA 1KYZA 2PFBA 3WE2A 2ZMEB 5D5VB 3GVAA 4XRFA 3ZMSA 3Q5FA 5FLXK 5DYMA 1U5TB 2CSOA 2XASA 3K0LA 2KRFA 4HYEA 2JZYA 3SQNA 5LHHA 1SFEA 4S05A 4DQ2A 2UXNA 3KZZA 3WE3A 4HQMA 4TV7A 1P6RA 1EH6A 3Q9SA 3MAJA 1OR7A 4I0BA 1MD0A 3HUGA 4ZZLA 5F64A 2PN6A 4MGRA 3GO5A 3ZMZA 5CYVA 4KA4A 4KN4X 4KIFA 1T39A 2NNYA 2IRFG 2ETHA 2EFOA 2XUBA 2FQ3A 1SMTA 5J6XA 4KDPA 1BN5A 3FWEA 4CHUA 2OQRA 4FX0A 5L3CA 2QUFA 1BIAA 3RPQA 2WC2A 3C3WA 1S3JA 4JQFA 1OYIA 3IHUA 1HW5A 3RKWA 3JTGA 1DP7P 2H6CA 4M9SA 3ZMVA 4YG2F 1YYVA 1OMIA 2ELHA 3PQKA 3BPVA 2EK5A 1LEAA 1G4DA 3ZN0A 1R1UA 3T8TA 2ZXJA 4BXUA 3EQLF 3FXRA 1R23A 1DPUA 1GVJA 2FBIA 1LJ9A 2JT1A 1U2WA 1XGNA 1XD7A 2XAJA 2L3DA 3KP2A 3HOTA 1XCVA 1IRFA 5BPDA 2UZKA 1T2KA 3U2RA 5LGUA 2HTSA 2VC0A 2H6BA 3VEPA 4ENKA 2GQQA 3LQRA 4DNCA 2PI0A 2GXGA 2PLYA 4UUVA 1WQ2A 2P5KA 2VBYA 1XSDA 2VONA 3I0TA 3N4MA 1FSHA 1T0FA 4OMYA 3KP7A 2A68F 3E5QA 1QGPA 4M74A 1YW8A 4B09A 4HF1A 3VODA 3N97A 2FNAA 2NRAC 3I5UA 4L0YB 3I64A 3V7RA 3TO7A 4A0XA 2Z99A 1TQIA 2RVCA 3ISPA 4PGGA 5CVRA 3FXQA 2ISZA 3HSRA 1IZ1A 1KA8A 3IL2A 1RIOH 3E6MA 2VT2A 3TDUC 4ESBA 2A6HF 2Y0MA 2O61A 2YR2A 2K02A 1ZARA 4AIKA 3HIFA 4RS8A 5ILSA 3IWFA 5FD6A 2G7HA 4BHPA 3G3ZA 1ZH5A 3ABTA 4A6DA 1SD6A 3TO9A 2J5OA 1WSUA 4RB0A 4LG0A 1IRGA 1TQMA 4KMFA 3M8EA 3KP6A 4Y17A 1BI0A 1R5HA 4OIRF 2MLGA 4P5OA 2MBFA 3E6DA 2DAOA 4EM2A 2HGCA 2DPUA 3I59A 3DKWA 3JAMK 2QYOA 3ZN1A 3J81Z 4BH9A 1TW3A 3QP6A 1KQ0A 1R1VA 4A5MA 3VFZA 2K86A 1QZYA 3DP7A 3DEUA 5CVIA 1KGSA 1LB2A 1HSTA 4LK1F 3F72A 2FA5A 4EQQA 1V4RA 4WK8F 1F4KA 2DK5A 4R1HA 4HLYA 5LRRA 1G6NA 2IP2A 3E6BA 4GXOA 3J80Z 5TJJA 2DQLA 2W84A 1QNTA 1QO0D 1PP8F 5D5XB 1EH8A 3V8LA 2ZNYA 3TOAA 5CVJA 1FYKA 2XKPA 1W5SA 3AAFA 5HOOA 2VN2A 5JI6A 1G3SA 2YX7A 3F6VA 3KLNA 3M7GA 2R3SA 3P7NA 4YFNF 3F8NA 3WTWC 4OIQF 3GF2A 3MQ0A 3T0YA 1IXCA 5D8KB 2ZBKA 1P2FA 2HOEA 5JR3A 2OQGA 4XLNF 1IN5A 1LDKB 2FNPA 2CWEA 3K69A 2Q0OA 2D45A 1QZZA 2P8TA 3GFIA 5IT9K 4CDGA 2VE9A 2VBXA 2QM3A 5CLSA 4U88A 3FMRA 1OYYA 4PGHA 2JTVA 5H20A 3ROUA 1I27A 5K5OA 2YPRA 3PQJA 5IT3A 1NHAA 3JSPA 3T1BA 4RGXA 6PAXA 4BHBA 4RB3C 1A04A 2F2EA 2KIUA 4RAZA 2CQKA 3V7SA 4LJZF 4RB1A 1B9MA 2VOOA 2QVOA 3D0SA 1KQ8A 3I54A 3ZMUA 1REPC 2WTEA 3S2WA 4G8XA 1H9GA 5DUIA 3MZHA 4Y13A 5AONA 4G7OF 2LNBA 1IN6A 2BE5F 1HSJA 1KU7A 5HLGA 2PMUA 1JGSA 1U3EM 4O5VA 1RUNA 2XIGA 4M9ZA 1J2XA 2EFWA 2D2WA 1L3LA 3P9KA 2MLKA 5CVVA 3WGHA 4RGRA 3HRSA 1F1ZA 1FT9A 4I98B 1LVAA 3V7CA 2EV0A 4UVBA 5ICGA 4LMYA 5AIPA 5F1RA 1S7OA 3RDIA 1W4MA 3E5UA 3BPXA 4EJVA 2HKOA 1J59A 1BI3A 5BPIA 2AS5F 2KJCA 1O3SA 4M6YA 1BI2A 1O3QA 2P7VB 2CW0F 4G7HF 5DDGA 4YFXF 4U7BA 1FLIA 4IXAA 2Q8KA 2XVCA 3SXYA 2LF8A 3VB2A 1T38A 2FBKA 3K1MA 1P4WA 1H0MA 2XAHA 1XDUA 3KP4A 1OPCA 3WTUC 4HDUA 3E3VA 3L00A 4KICA 4GCVA 2HYFA 4BAYA 2STWA 1YS6A 3KEQA 3TGNA 1RUOA 2XAQA 2Y48A 2HZTA 4KNYA 1Z91A 3NQOA 1I1SA 1PUEE 3W6JB 1IXRC 2A5YB 1IW7F 4U0YA 4A6EA 1HXDA 5LGNA 2W24A 3F21A 4I0AA 4LB5A 4MNUA 3FM5A 1FBUA 3P9IA 1WRJA 4FHTA 2VT3A 5KVRA 4BQAA 2EA4A 2H09A 2FF4A 5HDNA 3CJNA 3F3XA 4K2EA 2RNJA 3HHGA 4ZYGA 3K2ZA 3FF5A 4HF2A 2EWNA 1T6SA 4AVPA 4HF0A 5HLIA 4U0VA 2BYVE 3GLXA 2V9VA 4CGZA 3EDPA 3CUOA 2VOPA 2DO7A 3WGIA 4XSXF 1XSXA 2GAUA 3EYYA 4U0WA 3R6SA 2QBYB 1D8KA 1ON1A 3DF8A 3EUHA 4JK1X 5F6FA 3ML6A 2RV8A 1V3FA 1VTNC 1W7PA 4EJWA 1USSA 4KMUX 5BS6A 1DUXC 4OOIA 3FMSA 2Z33A 2P7CB 2VODA 3LSTA 4WWCA 3KZYA 4KFCA 3KCCA 3HTUA 3CUQA 2W25A 2HQNA 1WWXA 1FOKA 1E17A 3B02A 3HHHA 1KU9A 2OZ6A 4WF2A 1YIOA 3F8FA 3B73A 5CJ9A 1OKRA 1BM9A 5A2QZ 1S29A 5DV5A 5A2QK 2QENA 1MJAA 2BBYA 5FB2A 1LQ1A 1R5GA 4A12A 4KIBA 5ED4A 4N9HA 5DD4A 2FRHA 1ZGJA 3WG9A 5FD5A 1K78A 5HDGA 3ERED 3HTSB 1X3UA 1BIBA 4CXFA 5JFRA 3WU1B 3QAHA 2QQAA 3GFLA 4HX7A 2IJLA 3D5LA 1U8RA 1W7PD 1GXQA 4L5JA 3FHZA 3SZPA 1C0WA 1CF7A 1B59A 4MQVA 2CO5A 4IVNA 2DU9A 1J7KA 3RYRA 5FFZA 3IC7A 4ZH4F 1D3YA 4WXHA 1ONVA 2XHKA 4IF4A 4IRHA 1IN8A 5KK1A 1QBJA 2FU4A 3TOBA 4P9FA 5EEGA 2R7DA 4LLGF 4N0BA 3ZMTA 1IUYA 2YU3A 4QWQA 1IN4A 3GFJA 4CO8A 3RKXA 1QQIA 1H9TA 1W7PB 1IN7A 2HDCA 2RQPA 1FY7A 1UHWA 3VOEA 4GO1A 3LFKA 2GWRA 1YTYA 3M1EA 3CO7C 4AIJA 1UB9A 2EJRA 2F5CA 4PDKA 1O57A 2Z3YA 1U6GA 4L9NA 2CG4A 2GZWA 3RPUA 5E18F 1XCBA 4MHGA 4MTEA 2XAGA 3V8KA 2Q2EA 4P55A 4MTDA 2QBYA 2ESHA 1XGOA 2A69F 1ZGAA 2UXXA 1TNSA 2OAZA 5H6RA 2E7WA 2G9WA 1S6LA 4EGYA 4I7HA 2MC3A 4KYWA 4HW0A 2HTJA 1B6AA 1ZG3A 2WWYA 2FXAA 2ISYA 2YSRA 4YIFA 5FO5A 5ERIA 2M1BA 1JE8A 5LRSA 3HSEA 5L3GA 3F8BA 4PZJA 3SHFA 2QLZA 1K78B 1IXSB 1ON2A 4HV5A 4ZYEA 4IRGA 2FEZA 5JHUA 2NS0A 2ZKZA 1GXPA 1MZBA 1BC7C 2C6YA 3EETA 1HBXG 4MEYF 1Z1DA 2F5DA 3I71A 1S8NA 4ON0A 2PG4A 1SMYF 1FYLA 3H3ZA 5E8GA 2X0LA 1KU2A 5LBQA 5EEHA 3CUQB 1P92A 1KYWA 2VC1A 4HQEA 1R22A 4R8HA 1G3WA 3I58A 1O7FA 4ZYHA 1IAWA 2V79A 1TTYA 3IKVA 1XDSA 4EM1A 2BV6A 2V1DA 2M87A 1FNNA 4XBFA 5HDKA 5LGTA 3EYIA 3DPTA 1L0OC 1EH7A 1P4XA 1HKSA 1CF7B 4RB2C 1HKQA 2HEOA 4G94A 1ZREA 4HX4A 2L54A 1EV7A 4OINF 2MH2A 2P6TA 4N9IA 2B0LA 2HYGD 4D0PA 2RKHA 2D1HA 3MCZA 4M9XA 3SZTA 1K79A 4S04A 4UVCA 2XGXA 1J5YA 4L9JA 4I01A 4ENJA 4L0ZB 1BJAA 2DW4A 5E20A 3HRUA 5FFXA 1IF1A 1XMAA 4HX8A 1SD4A 4Q48A 3G73A 3R0AA 2ZCWA 5D8LB 4G7ZF 5TRDA 1SFUA 2K4BA 4E70A 3U9GA 4EJOA 2FE3A 4LFUA 4EVIA 4P96A 1O7LA 3REOA 1OYWA 3RJPA 1JXSA 5D6EA 1Q1HA 4NHJA 1FZPB 1FX7A 3R4KA 5BQTA 1ZRDA 4BYYA 5L3FA 4H0EA 2K7LA 5ICEA 2HS5A 2CYYA 3JSOA 2DPDA 1Z05A 3CUQC 1BI1A 3HYIA 2DFIA 1XN7A 3JTHA 1YFHA 3V8JA 2LSOA 3BDDA 1J0RA 3KP3A 3RKYA 5JVTA 3LA2A 1O3TA 1LDDA 4XSZF 3C7JA 2ZFWA 3IKTA 3O6BB 3Q9VA 3T8RA 1UFMA 4F7ZA 5J8CA 2JRTA 4EV0A 3QPTA 1FWZA 5E1XA 4AIHA 5K5RA 1FYMA 2KJBA 2O8XA 5LEJA 1KQ9A 2XAFA 3QOPA 4Z2YA 1KU3A 3P9CA 5D5WB 2FMLA 3QP5A 4WX9A 1D8JA 1D5VA 2KKOA 2XKOA 4AD9A 2RN7A 5BOXA 4ENMA 2RDPA 5L3DA 3DXJF 1LNWA 2BGCA 3LAJA 4ZYDA 4UV9A 4JBAA 4LK0F 3K9TA 5D5UB 3OV8A 2HWVA 4YFKF 3WTSC 4IRIA 2O03A 3BJ6A 4HLXA 1G3TA 4WXCA 5ICCA 1LEBA 1FP2A 4O3MA 1MJBA 2QQBA 4BNCA 4UV8A 3V4GA 5K1YA 4O6JA 1F5TA 3TKYA 4B8XA 1BC8C 2BEOA 5HS8A 1YQAA 2EV5A 2HKXA 1YO5C 1DDNA 1XB4A 2GA2A 2ACJA 3RI4A 1ZG5A 5H6QA 1Y0UA 1ZHFA 1RI7A 1R58A 2EB7A 3K1NA 3I59B 2A07F 4IPAA 2ESNA 4HOBA 5E1ZB 2V1UA 3IWZA 1XSVA 2W85A 2A6EF 2XV4S 1JHFA 2Z5UA 3WODF 2P5LC 1K6OA 1MGTA 2OBPA 3LQQA 4EMSA 4P9UA 3ABUA 2DTRA 4Q47A 4LGWA 3LAPA 2LF7A 4L9VA 3JW4A 5HLHA 1B9NA 3E6CC 1ZLJA 4ETSA 4HV6A 1TBXA 2GXBA 3SFZA 5J8FA 1AWCA 3OOPA 3O3KA 1TW2A 2EV6A 2COMA 4L9TA 1I6XA 4ZZDA 2IA1A 1Z7UA 1F9NA 5IT9Z 1W5TA 5E17F 1G3YA 3K1PA 2L01A 2E1NA 3DPLC 3LA7A 2VBZA 1AOYA 5ILVA 3GZ5A 1FSEA 2RGVA 1SD5A 3DQVC 2CFXA 4CZZA 4LD5A 3F8CA 2FOKA 3JAMZ 2G7UA 2V1XA 3BJAA 4AWXB 4A2UA 4RGUA 5K5QA 3RTRA 3GYHX 3LA3A 3GX4X 1TLHB 2PJPA 2EFNA 3F22A 4KUMA 3GW2A 3HRTA 5LHGA 4ENNA 2QWWA 1GHCA 2HR3A 4KIGA 3QU3A 2NYXA 4U7DA 3FX3A 1FBQA 5D4RA 2K27A 2EA2A 1ZLKA 2J5PA 5DEQA 4G6QA 1HW1A 5CVUA 2MA3A 1ZG1A 2XROA 4IHTA 4LLLA 1I1GA 1WI9A 2R7FA 2ZMEA 3H3UA 2Z9OA 2L4MA 1MJ9A 1U78A 5AIQA 2D1VA 4GGGA 4I2OA 4A0ZA 1DPRA 2MH9A 3GWZA 3ZQ7A 5DCMA 4ESFA 3GUDA 4RGSA 2ZO4A 1RZ4A 4GYIA 3M8FA 3FXUA 2L4AA 2P6SA 2DK8A 2DQRA 2ADUA 3CTAA 1R1TA 2XRNA 4I09A 3GEZA 4XLPF 5D4SA 3LWFA 4MQ9F 3QRFF 3RIRA 5DCMB 3BROA 3H92A 1FC3A 2VE8A 2LKPA 2GIVA 4NQWA 2O0YA 2A3SA 1ZN2A 3BP8A 2OD5A 3BJOA 2M8EA 2IPQX 3KP5A 1XGMA 3I53A 3U1DA 3W6KB 3ZPLA 2GA1A 3COAC 1XMKA 4KN7X 1Z9CA 1YS7A 2KIMA 1J75A 2PMHA 4L5IA 4IJAA 3GZ6A 3TO6A 2JSCA 2DI3A 3I4PA 2IVMA 2LDUA 3WTXC 3L9FA 2VXZA 1ZYRF 2Y75A 4M6XA 2UWMA 2FSWA 1XGSA 1BOAA 2P4WA 1T98A 4M73A 3ZMDA 3TQNA 3R60A 5BMZA 1Z6RA 3KE2A 1E2XA 3L09A 2QZ8A 4UNOA 4CYDA 3QU6A 4I02A 2AXLA 2H94A 1QPMA 2OA4A 3ECOA 4ESJA 1YLFA 3NEUA 3C1DA 3KLOA 5FGMA 1R7JA 2EFPA 1USTA 5L3EA 1R36A 2PEXA 3BWGA 2X4HA 4GYGA 5LHIA 1LDJA 4UVAA 5LLQA 4G6DA 5HS7A 2NNNA 2L02A 1HW2A 4IHSA 2DT5A 4L18B 3HRMA 3E5XA 3F23A 2OU2A 4WCGA 3HSFA 2EFQA 2IA2A 4EJTA 4OIPF 2DBBA 3QPHA 3L2CA 3FMQA 3DV8A 3CO6C 2F5FA
chains in the Genus database with same CATH superfamily
3CCUI 1PP7U 3J80K 5HS9A 3VPRA 3JRDA 1YW7A 2CUFA 2JPCA 1B1BA 3M1CA 3WGGA 1APLC 2RC4A 2XPWA 3ERMA 1Z6TA 2IGOA 4E7KA 3S1RJ 2JA7J 5L3BA 2X6WA 1I3QJ 2A5WA 4RDUA 2ZJ2A 1SFXA 4Q5SF 4A5NA 3O2PE 4EJUA 1MKMA 2WAQA 3WU0A 1JHHA 3AG2H 3FZVA 2P5VA 2STTA 1MH3A 2M5WA 2VJ4A 4W97A 3CDHA 2KRHA 2M30A 3MFKA 1CGPA 1XS9A 4Q4ZF 5FKMA 5JLWA 2R7UA 4HAMA 3WTZA 3BY6A 2HI3A 2YX4A 4IQJA 2HOTA 2JPBA 2IW5A 2K4JA 2CQXA 4M72A 2HQRA 5E1WA 4CICA 5IYDJ 4MO7A 4LG0B 4R79A 3CC4I 2WBMA 2ELKA 3LSKA 5KCMA 2HPIA 1SAXA 1R00A 2ID6A 2TDXA 5CQEA 4F55A 1TT5B 1HKTA 3CF5F 2O8KA 4KT5C 2K3FA 3KEOA 4IX7A 3HKZA 1SD7A 4FTHA 3IUOA 4HBLA 4UXNA 3W3CA 1IDYA 2K9MA 2E1CA 1ZRFA 4M71A 2HFHA 5LEKA 1RNLA 2E5ZA 3NRVA 2O3FA 2QSHX 2Y30A 4HDVA 4BXXJ 1ODDA 2V7FA 3BZ6A 2L7FP 1IG7A 3HGYA 3CC7I 5KAFC 1HOMA 3C18A 2PBIA 3GFMA 3MWMA 3ASNH 2WB1A 1YX5A 1TWAJ 1BR4A 3GXOA 4GDFA 2KT0A 3F6OA 4UUSA 1GV5A 3F8MA 3GTLJ 3PNTA 2VBWA 2IA0A 3C2HA 1U5TC 4HA8A 2CGPA 3H9JA 1UHMA 4WXDA 3T5XA 4LB6B 4OU0A 1T08B 5JHFA 2FBHA 4HZFA 1UCRA 2M4KA 4Y15A 3G2BA 5FLXZ 3ELKA 3TW7A 5ICFA 3R0JA 1P4AA 2B9SA 3GTGJ 1WKMA 2FMYA 2FUG2 1YRNA 4EGZA 3FHNA 4UHTA 3IH3A 3A01B 1K7AA 3PFIA 4PCQA 4XLCA 4BXFA 1OISA 3CJTB 2KL4A 2R7XA 1YW9A 3I3LA 1WFXA 1STZA 4QLCU 4CZCA 3WTTC 1B72A 4LLNA 3L7WA 1HLVA 1O3RA 3WTYC 2W57A 9ANTA 1ZRCA 4G6TB 2L2OA 3TP0A 2OC6A 5HVQC 2QQ9A 1H88C 3WTVC 3HOSA 1SC7A 2IT0A 3VYUB 3H5AA 3IRRA 4V19K 5DCFA 4XONA 3KFWX 2HPMA 3ABLH 3IRQA 1R9TJ 2CW7A 2M45A 5DUKA 3BOQA 2FX0A 2H27A 5ILUA 4FX4A 1MDMA 4C3HJ 2MG4A 5DD8A 2E7XA 4MEXF 3DEWA 3F9KA 2NAZA 1BJZA 2PQ8A 1AHDP 5E8IA 5F08A 1LE8B 4YIIA 1ACIA 4RM3A 2DYRH 2ZSHB 3BZKA 3DFGA 3I4NJ 2DLLA 3R61A 4FISA 1D0YA 4YELA 1TL8A 1LFUP 2F5EA 1ZAOA 4BEHA 4FT8A 1U5TA 4RAYA 2VL8A 4BBSJ 5D6FA 2VJJA 5B5EC 1TNTA 1YG2A 2L7MP 2MD5A 3K4BA 1J9IA 3ECHA 3ULQB 1VQMI 3S1QJ 4BHCA 3M9AA 1K4SA 1WI3A 1TQPA 2FQ4A 4MFDA 4DBQA 3OYIA 4A0YA 2HOSA 1IJWC 2X51A 3ZQGA 3HGGA 5EG0B 3RYPA 3J81K 1B4AA 2PJRA 1HCRA 2EINH 2A61A 3PFYA 3H3VK 3KETA 1W36C 2E35A 2UUZA 3BR5A 4ABZA 1PDNC 3FM3A 1FMVA 1HQCA 4BY7J 4D7NA 3LSRA 1MNDA 1MDMB 4BACA 3MZYA 1ZR4A 1A35A 3C2BA 2ZNZA 4NB5A 4OMZA 4CUGA 3HJEA 3PSIA 1VZ0A 3HKZN 1ETOA 2BXZA 3BT9A 4RLQA 3DEEA 1H8AC 2H8WA 3CMMA 3BLYA 4D5CA 2VQLA 2FOWA 2D5VA 4OIOF 3B6AA 2M2EA 2KIFA 4ASNA 1FTZA 2WV0A 2OZUA 4JP0A 1FPQA 4G9YA 2O6GE 1Y56A 4B3AA 1FP1D 4E7JA 3O8GA 5E3LA 3ZP5A 2VPRA 3E97A 3CLOA 3TDZC 3MEXA 1S7AA 4EM0B 1ERDA 1FBSA 2XC7A 3J7AO 1BBYA 4BDZA 3AFHA 1ULYA 4IHXA 3LL7A 2O5RA 2Y9YA 3IH4A 2ZXWH 4NC6A 1I5ZA 2Z1DA 5GTIC 2LK2A 2V6EA 1AKHA 1W0UA 2V6CA 1KYZA 2PFBA 3UKGA 2K9NA 3WE2A 4HNUA 2ZMEB 4E7SA 1KONA 5D5VB 2DODA 3OIQA 3GVAA 4XRFA 3ZMSA 3Q5FA 5FLXK 5DYMA 1U5TB 2CSOA 2XASA 3K0LA 2KRFA 1X3WB 1VFCA 4HYEA 3HOWJ 2JZYA 4JX5A 3SQNA 2DOEA 3QWLA 5LHHA 3RQIA 1SFEA 3MN2A 4S05A 1DU0A 1TC3C 1LVKA 4XICA 4JOMA 4NDLA 3W2WA 2PMZA 2HDWA 3J7YJ 4DQ2A 2JJ7A 2UXNA 4HSTA 3KZZA 1W5CC 2EQRA 3WE3A 4HQMA 4KISA 4TV7A 1P6RA 1EH6A 2RREA 2OJED 2I10A 1V54H 1S72I 3M4OJ 3UNGC 3KZIC 3Q9SA 3MAJA 1OR7A 4I0BA 3RZOJ 1X2MA 1MD0A 3HUGA 4ZZLA 2XDVA 5F64A 2ID3A 4CCLA 2PN6A 4MGRA 4B44A 1MSFC 3GO5A 5LFAA 5J40A 3ZMZA 5CYVA 4BQOA 4KA4A 2CW8A 4KN4X 4KIFA 1T39A 2NNYA 2IRFG 2ETHA 2DMQA 3FXOA 2ZXHA 2E19A 2EFOA 2I8DA 2BOLA 2XUBA 2MC4A 2WY8Q 2FQ3A 4FETA 1A36A 2LKSA 1HDPA 5DM7F 1ZELA 1SMTA 5J6XA 4KDPA 5CPRB 3DTEA 3SZGA 1BN5A 3FWEA 3PSFA 1Y8RB 2JK3A 2WV1A 3RSNA 4CHUA 5IP6A 2GIZA 2DCEA 2OQRA 4FX0A 3CP2A 4M3FA 5L3CA 2QUFA 1BIAA 1IUFA 1UMQA 1FOXA 2XGCA 3RPQA 3ZCOA 2WC2A 4F93B 3C3WA 1S3JA 4JQFA 1OCZH 3OYCA 2VQGA 3GTQJ 4II3A 1U9OA 2E34A 3CD6I 1MBJA 4DJAA 4HNTA 1OCRH 1OYIA 3IHUA 1HW5A 2LY9A 4G12A 3RKWA 3JTGA 3QOEA 4CH7A 1PUFB 1AKHB 3Q0VA 4J00A 1MMDA 1Y8QB 1DP7P 4B48A 2H6CA 2LG4A 3LMMA 4M9SA 3ZMVA 3JREA 4OAYA 4YG2F 4NC8A 1YYVA 1S5LC 1OMIA 2ELHA 2ZMEC 3PQKA 4NUBA 3K4MA 3BPVA 2EK5A 3G1OA 1LEAA 3D5RC 2PX9A 2XGEA 1YJNI 1G4DA 2X48A 4QSHA 2R7WA 3ZN0A 1R1UA 3T8TA 2QGUA 2ZXJA 1VQ8I 2XPVA 1KZHA 4BXUA 3EQLF 3FXRA 1R23A 2RAEA 3ZQHA 4RA2A 3A0HC 4BEHB 1DPUA 1GVJA 2FBIA 2Y69H 1LJ9A 2JT1A 1VQOI 3VDXA 3H1CA 1U2WA 3FXKA 1VNDA 2E1MB 1XGNA 2X6XA 1E3PA 1XD7A 2XAJA 2L3DA 3KP2A 3HOTA 4A3FJ 1XCVA 1IRFA 2NOGA 3BG3A 5BPDA 2B63J 3K4JA 2UZKA 5F0HA 1ETYA 2IBDA 3DPUA 1BA5A 1T2KA 1MBGA 1X4OA 3U2RA 2HTSA 2VC0A 2H6BA 5LGUA 3VEPA 4ENKA 2GQQA 3LQRA 4DNCA 2PI0A 3IP4B 2GXGA 2IS4A 2PLYA 3CMYA 4UUVA 2L5QA 4XRMA 1OCPA 3CCRI 2R92J 1WQ2A 3CC2I 2P5KA 2VBYA 1XSDA 2JN6A 2NS7A 3I0TA 3QODA 3N4MA 4LIUA 2VONA 4AU7A 2LREA 1FSHA 1T0FA 3KP7A 4OMYA 2LFBA 3H0DA 2A68F 3E5QA 4FE4A 1QGPA 2EIKH 3SJMA 4A3IJ 2XGDA 1XMXA 3GMEA 4M74A 2IS6A 1YW8A 4B09A 4BGDA 4HF1A 3VODA 4AM3A 3N97A 2FNAA 4BJ6C 1SVMA 4P1WA 3ZQLA 2JUCA 1MBKA 5FKOA 3I4MJ 2NRAC 3I5UA 3HOYJ 3BR1A 4L0YB 3HOUJ 2M7BA 2UV1A 2DA7A 4PJMA 2WY7Q 3FKJA 3I64A 3S16J 3V7RA 3TO7A 2AO9A 4A0XA 2F4IA 2Z99A 3S1NJ 1WJFA 1TQIA 2RVCA 3ISPA 4PGGA 2R5ZA 5CVRA 3FXQA 4XNFA 2ISZA 1RC9A 2CQNA 3HSRA 1IZ1A 2O9LA 1KA8A 3WU2C 5EDNA 3IL2A 3K4KA 2R5YA 1RIOH 3E6MA 2VT2A 3TDUC 5IYBJ 3BR6A 1X2NA 4ESBA 2A6HF 2Y0MA 1YE9A 2O61A 4XKBA 2YR2A 3TEDA 2K02A 1ZARA 3C2GA 4AIKA 3CMEI 3HIFA 4RS8A 5ILSA 3VSLA 1YIJI 3IWFA 5FD6A 4IHWA 2LC2A 2G7HA 3HOXJ 4BHPA 3G3ZA 1ZH5A 3ABTA 1SFOJ 4A6DA 1SD6A 4NBQA 3TO9A 4HNVA 2J5OA 1WSUA 2M7AA 2EZKA 3A4CA 4X0GA 1EJ9A 4RB0A 3VYTB 1JI8A 2BY0A 4LG0A 1IRGA 1YHQI 1TQMA 2FD5A 4KMFA 2DFHA 4FCYA 2XB5A 3M8EA 1SVOA 3KP6A 1TWFJ 2HVRA 4Y17A 4UUTA 3K7AJ 1BI0A 3L2WA 1R5HA 4QPOA 2ME6A 4OIRF 2MLGA 3B6CA 1Z3XA 1H89C 2YU9J 4P5OA 2MBFA 1R5ID 3E6DA 3IAM2 4XKCA 2DAOA 1XC5A 2MGQA 3N05A 3FXMA 4ZJZA 3JRAA 4EM2A 1WH5A 1QHGA 2HGCA 2DPUA 3I59A 3DKWA 3JAMK 2QYOA 3LOCA 3ZN1A 1YX3A 3J81Z 2BHYA 3E0JB 2R4GA 4BH9A 3HEFA 2EIMH 1TW3A 3CCEI 2MD0A 3QP6A 1KQ0A 1R1VA 4A5MA 4BS9A 3VFZA 2K86A 2E5NA 1QZYA 3DP7A 3DEUA 5CVIA 1KGSA 1LB2A 2V9PA 1HSTA 2RQQA 3F72A 4LK1F 2FA5A 3PUBA 5GP9A 4EQQA 5GAHJ 3VYSB 2KFDA 1V4RA 4WK8F 1F4KA 2DK5A 4R1HA 4HLYA 5LRRA 1U8BA 1G6NA 2Q1ZB 2IP2A 4CYCA 3E6BA 3H5RA 4LG3A 3SEZA 1EA3A 4GXOA 4RBOA 3J80Z 5TJJA 1PJRA 2DQLA 2W84A 1QNTA 1QO0D 1PP8F 5D5XB 1EH8A 1MMGA 3V8LA 2ZNYA 3TOAA 1VI0A 2JVHA 5CVJA 1VQ5I 1FYKA 2XKPA 4IL6C 1X1AA 1W5SA 2L9SA 4HEA2 4S0HB 3JRBA 3CJQB 1D1BA 3AAFA 5HOOA 3OS2A 2VN2A 4BKXA 5JI6A 1G3SA 2YX7A 5F0CA 1JT6A 3F6VA 3KLNA 4ANJA 4C3IJ 3M7GA 2R3SA 3P7NA 1VQ6I 2W4SA 4Y52J 5IOYA 1RKTA 4YFNF 3F8NA 1LUJB 3BG6A 3WTWC 2Y0SA 3GF2A 4OIQF 3MQ0A 4CCOA 1E3HA 2IGNA 1I39A 2HQ5A 5IOZA 1FOYA 1Q1VA 3T0YA 1A6IA 2LVSA 1JKRC 4XRSA 2QKLB 1IXCA 5D8KB 4C30A 3OYBA 2KISA 1Y1VJ 2ZBKA 4AC0A 1P2FA 2HOEA 1UG2A 5JR3A 1N77A 4DZPA 2OQGA 4XLNF 3G6EI 1IN5A 1LDKB 1Z7LA 2F48A 2FNPA 2CWEA 3MKYB 3K69A 2Q0OA 1DGWY 4M3BA 2D45A 1QZZA 2P8TA 3JCUC 3GFIA 4A3BJ 4F3QA 2VPLA 1OR7C 4XR6A 5IT9K 4CDGA 1K83J 2E2JJ 3QQAA 3L2UA 3G71I 2M4GA 2VBXA 2VE9A 1NK3P 2QM3A 2LLKA 5CLSA 3D5SC 3CDIA 4U88A 2IS1A 1MBFA 3FMRA 4A3GJ 1OYYA 4PGHA 2JTVA 2Z2SB 5HODA 5HLTA 5H20A 3ROUA 2L0KA 3U21A 3K70D 2ZJRF 3H36A 1I27A 2K9QA 5K5OA 3VSKA 2YPRA 3PQJA 5IT3A 1NHAA 2RNGA 3T1BA 3JSPA 1T8IA 4RGXA 4JX6A 6PAXA 4BHBA 2HXOA 2K85A 5J3LA 1EF4A 1GVDA 4AVZA 2V4JC 3LNQA 1R49A 4RB3C 1A04A 4B4CA 2F2EA 2KIUA 2KQRA 4RAZA 3OSGA 2CQKA 4PSXA 3V7SA 4LJZF 4RB1A 3TW6A 5C4XJ 4A3EJ 1B9MA 2VOOA 3OY9A 1VQNI 4XN3A 2AXTC 2HXIA 2QVOA 3D0SA 1KQ8A 3I54A 4RAFA 1TZLA 4D7MA 1ENHA 3ZMUA 3S3OA 1REPC 2WTEA 3S2WA 2DOFA 1V5FA 2KLOA 4G8XA 2VKDA 3S17J 1H9GA 5DUIA 1FOWA 3MZHA 4Y13A 3KEYA 1SANA 5AONA 4G7OF 2LNBA 4PFPA 2AHQA 1IN6A 3KYLA 5TISC 2BE5F 1HSJA 4IO9F 3HG9A 1KU7A 4N4NB 4BL0B 3HPGA 3CQZJ 2L9NA 5EF6A 2BVMA 5HLGA 1FJLA 1QRYA 2NVXJ 2PMUA 1JGSA 1JKOC 1U3EM 2DT7B 4O5VA 2XF5A 1RUNA 3CESA 2F4OB 2GOXB 2XIGA 4M9ZA 3OL3A 5M3MJ 4YRVA 2VIXA 1I3AA 1J2XA 2EFWA 2D2WA 2CV0A 1L3LA 2LBFA 1YI2I 3P9KA 3OYFA 4XOPA 2MLKA 5CVVA 3WGHA 4RGRA 2E71A 4II2A 1K4TA 2IXSA 3HRSA 1F1ZA 1FT9A 2EH3A 4I98B 5GPCA 1LVAA 3V7CA 2EV0A 1FIPA 3LSHA 4UVBA 5ICGA 2QSFX 4LMYA 3PM1A 5AIPA 5F1RA 2QEXI 1W0TA 1S7OA 3RDIA 1W4MA 1R4MB 3E5UA 2TCTA 3BPXA 4EJVA 2E2IJ 3BTLA 4IHVA 2HKOA 2R0QC 1J59A 1Y6IA 1BI3A 2JA2A 5BPIA 4ZYAA 2HVSA 2AS5F 2F6CA 2DTZA 2KJCA 1O3SA 4M6YA 1BI2A 1O3QA 2AQFA 1MNEA 2CW0F 2P7VB 2QCOA 1JJ8C 4G7HF 5DDGA 4YFXF 4U7BA 5J4YA 3G4SI 1FLIA 4IXAA 2Q8KA 4ITVA 1ZR2A 2XVCA 2H1KA 2E1OA 1G2HA 2XF6A 3SXYA 2M0CA 3HBLA 1RETA 2LF8A 1T33A 3H9GA 3VB2A 1JTXA 3BQYA 1T38A 2FBKA 4HRIA 3K1MA 5GTHC 2F4MB 4NC7A 1P4WA 1H0MA 2F5VA 1N75A 2XAHA 1XDUA 3NWTA 1LE8A 1NG6A 3QYEA 1DGRM 1QVUA 3CDLA 3KP4A 4H4KC 1OPCA 1IV8A 3WTUC 4HDUA 2DA5A 3E3VA 4JX4A 3L00A 4I99C 4KICA 4GCVA 3BG9A 2HYFA 4BAYA 2STWA 3JRFA 1YS6A 3KEQA 3TGNA 2BVLA 1RUOA 2XAQA 2Y48A 2EZHA 4V2GA 2HZTA 1U0JA 2KRCA 2BW3A 5KHDA 2Z16A 4KNYA 3CF2A 2IEKA 2EILH 1JTYA 1Z91A 3ESWB 3KYDB 2JRMA 4HPQA 5EYRA 1GV2A 1LKXA 1X1CA 5JLXA 2LMDA 3NQOA 5FKNA 1I1SA 3OSFA 1PUEE 3W6JB 5M5XJ 1WJAA 1LPQA 1IXRC 3M3YJ 2Y0SN 1D5YA 2A5YB 2DA1A 2NVTJ 4XIDA 2LBFB 1IW7F 1FIAA 4U0YA 4FE7A 1IRZA 4A6EA 4UB6C 1HXDA 5LGNA 2W24A 3F21A 4I0AA 5FRMA 3OL4A 4LB5A 3L2QA 4MNUA 3FM5A 2Y2ZA 3OYAA 1FBUA 3P9IA 3RQ4A 1WRJA 4FHTA 5J1UA 3CCJI 2VT3A 3K70C 3ZRGA 5KVRA 4BQAA 3FXJA 3HM5A 3HOZJ 3FDYA 1X3ZB 1ZTRA 2EA4A 2H09A 3K4NA 2FF4A 5HDNA 1WGXA 2XPUA 1VQKI 3CJNA 3F3XA 2DA3A 1V55H 4K2EA 2RNJA 3O8HA 3HHGA 2M3AA 1EKEA 3K2ZA 3M8JA 4ZYGA 3FF5A 4CCJA 4HF2A 2EWNA 1T6SA 4CCMA 4AVPA 4HF0A 3PNYA 5HLIA 4E7LA 1UG0A 1DU6A 4JYKA 2JA5J 4U0VA 4DOZA 2BYVE 4IOCF 2R7TA 1MSEC 3GLXA 2V9VA 4XN0A 4CGZA 3EDPA 3CUOA 3GTKJ 2VOPA 2EPFA 4X1EA 2DO7A 1MW7A 3WGIA 4XSXF 3BCBA 4FQGA 4UUSB 2KIQA 2VKVA 2LP0A 1SFKA 2DMPA 1XSXA 2JA6J 3PO2J 2GAUA 3CP8A 3EYYA 4U0WA 4XLEA 3R6SA 2W1OA 2QBYB 3X2QH 2GM4A 1D8KA 1ON1A 3DF8A 3EUHA 3MKZA 3BCAA 4BE0A 4JK1X 1WJEA 5F6FA 3ML6A 2V26A 2WB1N 2RV8A 4I76A 4A3DJ 1V3FA 3MD2A 4AYBA 1VTNC 1R4NB 1W7PA 3Q0WA 4EJWA 1USSA 1P7JA 4KMUX 5BS6A 1Z3YA 1BOBA 2Y31A 3HC7A 1OCCH 1DUXC 4OOIA 3FMSA 2Z33A 2P7CB 2VODA 1MBEA 3LSTA 4WWCA 3KZYA 3ABKH 3A1YA 4KFCA 3KCCA 3HTUA 3CUQA 5FRNA 2CU7A 1IO2A 2R5YB 2X1DA 4QIWN 2W25A 3PNVA 2HQNA 2K9LA 1WWXA 4BBRJ 3ONQA 1FOKA 3CCVI 4ZDOA 1E17A 3B02A 3HHHA 1KU9A 2OZ6A 3LSGA 1YIOA 2VJIA 2ELJA 3B73A 3F8FA 4WF2A 5CJ9A 1OKRA 3AG4H 1BM9A 2CRGA 1PUFA 5A2QZ 2JVGA 1VQPI 1S29A 3M07A 5DV5A 5A2QK 3I55I 3ASOH 2ECCA 1VQLI 2QENA 1MJAA 2BBYA 3RPUD 1M1EB 1TWCJ 5F0FA 5GADJ 3S2HJ 5FB2A 5C44J 2R93J 1LQ1A 1R5GA 4A12A 4KIBA 3V42A 5ED4A 4N9HA 2OCEA 3LSMA 5DD4A 3HZJA 2FRHA 1V5EA 1ZGJA 5FD5A 3WG9A 1K78A 5HDGA 4CSWA 1X19A 3ERED 3G1LA 3OYNA 3HTSB 1X3UA 2P81A 4KJZA 1D0ZA 1BIBA 2P0WA 4CXFA 3U1KA 3DBLB 5JFRA 3WU1B 3QAHA 2QQAA 1VF9A 5J47A 3DU6A 4XOTA 3GFLA 3MVPA 3NARA 1MMSA 4HX7A 4RM2A 3SDBA 2WAQN 2IJLA 2NS8A 3D5LA 2HQAA 2B7EA 1U8RA 4BY1J 1X1DA 5GAEJ 1W7PD 1GXQA 4L5JA 3BR3A 5B1AH 3FHZA 3FXLA 3SZPA 1C0WA 2KZGA 1CF7A 1B59A 3ZQIA 5FLVA 4MQVA 2X1CA 2CO5A 1LFBA 4IVNA 2DU9A 1JUPA 2MW8A 1J7KA 1A5JA 4Y4RA 3RYRA 5FFZA 3IC7A 1SAUA 4ZH4F 1D3YA 2H8RA 2BW3B 4CA0A 4WXHA 1NH3A 1ONVA 3AG1H 1OJLA 2XHKA 4PUSA 2N8GA 4B43A 2GLOA 4ZTFA 2DMUA 4IF4A 4IRHA 4A3KJ 1IN8A 5KK1A 1QBJA 5FKLA 4KITB 2FU4A 3TOBA 1ZQ3P 3ZOBA 2OV7A 4IZZA 4P9FA 1RPWA 5EEGA 2R7DA 2XSJC 1QPIA 2V9KA 4LLGF 4N0BA 3ZMTA 1IUYA 2YU3A 1PVEA 4QPQA 4QWQA 1IN4A 3GFJA 4RAGA 4CO8A 3RKXA 1QQIA 4XK4A 1H9TA 3BR0A 1WZ2A 1W7PB 1OQYA 5EGOB 3H35A 1T56A 1IN7A 5LD2C 2HDCA 1TP4A 5IPAA 1WJBA 2RQPA 5KAIC 1FY7A 4Y7NJ 2AQEA 1UHWA 4GO1A 3Q3SA 3VOEA 1YJ9I 2BY3A 2CV2A 3LFKA 2GWRA 1YTYA 4BQQA 3G1MA 3M1EA 4LIVA 3P5JA 3CO7C 4AIJA 2HOAA 5EEAA 3S3NA 1UB9A 2EJRA 2F5CA 4E4HA 1F43A 4BE2A 2DMTA 4PDKA 1O57A 2Z3YA 1U6GA 3H9QA 1UELB 3ZQFA 2LY1A 4L9NA 4A3MJ 1D1AA 2BHZA 2CG4A 4CYCB 2GZWA 3RPUA 1UAAA 5E18F 2Y9ZA 1VQ4I 2W82A 1XCBA 4MHGA 1ITYA 4MTEA 4RMNA 3S32A 1ETVA 2XAGA 5FJ8J 1QVTA 3EPZA 3MZ8A 3V8KA 2X1EA 5HNFA 3L1PA 2ZJPF 2Q2EA 3TMOA 4P55A 4MTDA 3OIPA 4D1QA 3I56I 2NOJB 2I5UA 2WAFA 2QBYA 2ESHA 1XGOA 2A69F 5KNLA 1ZGAA 2UXXA 1TNSA 2LR8A 2OAZA 5H6RA 3OWTA 2E7WA 2ZXIA 2G9WA 1N78A 1S6LA 4EGYA 3S93A 4I7HA 3JRCA 2MC3A 4KYWA 4HW0A 1JKPC 2HTJA 3AG3H 1B6AA 1ZG3A 2WWYA 2FXAA 2ISYA 1OCTC 2YSRA 2JMWA 3JRHA 3WHCA 4QTRA 5BNGA 4YIFA 2CFOA 4NNJA 5FO5A 1MBHA 4Y33A 5ERIA 2M1BA 2M0MA 5LRSA 3HSEA 1JE8A 1G59A 3FK7A 1R6RA 5L3GA 5B66C 3F8BA 4PZJA 5J4VA 3SHFA 2QLZA 3BC8A 1K78B 1IXSB 5J1RA 2OTLI 1ON2A 4HV5A 1JJ6C 4ZYEA 4IRGA 4AIDA 1BR2A 3L2VA 2FEZA 5JHUA 4IHYA 1T95A 4A93J 4CCKA 2NVUB 2NS0A 2ZKZA 1GXPA 1MZBA 1HDDC 1BC7C 2C6YA 3OYLA 3EETA 5H2FC 4E7HA 1HBXG 5JVGF 3LSIA 4MEYF 1Z1DA 3JRIA 2F5DA 3K2AA 3I71A 1S8NA 5K7HA 4ON0A 3LFUA 1UHSA 2PG4A 1SMYF 1FYLA 3H3ZA 2NVYJ 4DYQA 5E8GA 2X0LA 1KU2A 2X6OA 1A6QA 5LBQA 5EEHA 3CUQB 1P92A 3RZDJ 1KYWA 2VC1A 4ZDPA 4HQEA 1R22A 4R8HA 5E3MA 1X58A 1B8IA 1G3WA 3I58A 1O7FA 4BUPA 4ZYHA 1PYVA 4BQNA 3A0BC 1T0FC 2DDAA 4E7ZA 3L2RA 2V79A 5GAGJ 1IAWA 2COBA 1TTYA 3A02A 3IKVA 1XDSA 4EM1A 2LTPA 1WJDA 1VQ7I 3BTCA 2W7NA 2BV6A 2DT6A 2M87A 1FNNA 2V1DA 3BG5A 4XLAA 4XBFA 5HDKA 5LGTA 3EYIA 3DPTA 1QZEA 1L0OC 1EH7A 1P4XA 2KDOA 1HKSA 1XPXA 3DTKA 4PJ0C 1CF7B 5F1JA 3OYMA 3LSJA 4RB2C 1HKQA 1FEXA 3CCLI 2HEOA 2CUEA 4G94A 1ZREA 5IP7J 4HX4A 3HDDA 2L54A 2DJIA 2JSPA 3EUAA 1EV7A 4OINF 2MH2A 2BY2A 1BW6A 2P6TA 4N9IA 2B0LA 2HYGD 4D0PA 3ZGKA 1IV6A 2RKHA 2D1HA 2ZJQF 1X1PA 3MCZA 4M9XA 3SZTA 1K79A 2DYSH 4S04A 2VKEA 4UVCA 2QA4I 2H1LA 2XGXA 4L5EA 1J5YA 4L9JA 4I01A 1UZCA 1ETWA 4ENJA 4L0ZB 1K6YA 1BJAA 2DW4A 3OYHA 3FBIB 5E20A 4Y3OA 3HRUA 5FFXA 1IF1A 1XMAA 2QSGX 4HX8A 5FLMJ 1SD4A 4Q48A 3G73A 3R0AA 2ZCWA 5D8LB 3ZXSA 1RR7A 4G7ZF 5TRDA 1SFUA 2K4BA 4UB8C 4E70A 1P7IA 2ICWG 1D0XA 2WAEA 3MKLA 2K40A 1IC8A 3U9GA 3F0CA 2Q2EB 2W48A 4EJOA 2FE3A 3QYBA 2HNHA 2ECBA 2CJJA 3CZ6A 3PIPF 1MNMC 4LFUA 3HOVJ 4EVIA 2CMPA 3EUHC 1O7LA 4P96A 3REOA 1XG1A 1GLNA 1OYWA 3RJPA 4BDYA 1JXSA 3A03A 2LH9A 1I6HJ 5D6EA 1VQ9I 1Q1HA 4NHJA 4HSRA 1FZPB 1FX7A 3R4KA 2JUGA 3DLAA 5BQTA 3J7ZI 3OYDA 1ZRDA 4BYYA 5L3FA 4H0EA 1WCMJ 3H5NA 2K7LA 5ICEA 2HS5A 3OR2C 1MH4A 2CYYA 1X1BA 1P9QC 3JSOA 3RCOA 2DPDA 3AL0C 3IH2A 5DS9A 1Z05A 3CUQC 3ZQQA 1BI1A 3HYIA 4EATA 2DFIA 1XN7A 3JTHA 4OWRB 5E3NA 3OS1A 1YFHA 1BL0A 3V8JA 3TL4X 1Z77A 2LSOA 3S8PA 3AL0B 3BDDA 2VI6A 1J0RA 5E79C 3KP3A 3RKYA 4IOAF 2LKXA 5JVTA 3LA2A 3ZQCA 1WJCA 4W1UA 1O3TA 1SVLA 1LDDA 1MMAA 3C7JA 2ZFWA 4XSZF 3IKTA 1B72B 3O6BB 1Y39A 1RKWA 3Q9VA 3T8RA 2BY1A 4XQFA 3S2DJ 1UFMA 3WHBA 4F7ZA 1RRJA 4UY8I 1YOVB 2E36A 5J8CA 2JRTA 2KDZA 4EV0A 3QPTA 2IAIA 1D1CA 1FWZA 5E1XA 4AIHA 5K5RA 1FYMA 2KJBA 2O8XA 2VXDA 5M5WJ 5LEJA 1KQ9A 4DBRA 2EZIA 2ZB9A 2XSDC 1LFPA 2XAFA 5IP9J 4XRSG 3QOPA 4Z2YA 1KU3A 3BTJA 3P9CA 1MMNA 2IGMA 2FMLA 2MSYA 2VB6A 3QP5A 5D5WB 4WX9A 1D5VA 3HL2A 1D8JA 2KKOA 3E7LA 3DU5A 2R5ZB 4PSWA 2OCCH 2XKOA 1YRNB 1JUSA 5M5YJ 4AD9A 2RN7A 5CKTA 5BOXA 4ENMA 2RDPA 5L3DA 3VYRB 3DXJF 3BZCA 1LNWA 2BGCA 3LAJA 4ZYDA 1NK2P 4C2MJ 3HUGB 3GZNB 2LOOA 4UV9A 1MIJA 3KPHA 4JBAA 1E3OC 4LK0F 3K9TA 4XL9A 5D5UB 2EZLA 3OV8A 2PMZN 1Y1WJ 2HWVA 2R7VA 1UJ8A 3K10A 3OYEA 4YFKF 4YIRX 3WTSC 5F27A 3BQZA 5M3FJ 4IRIA 2O03A 4E7IA 3A01A 4YEJA 3BJ6A 4BU2A 4HLXA 1G3TA 3OIOA 4WXCA 3LSPA 5ICCA 5DM6F 1AU7A 3CCMI 1LEBA 1FP2A 4O3MA 1MJBA 5J1YA 1TWHJ 2QQBA 4UV8A 3V4GA 4BNCA 2VLAA 5K1YA 4O6JA 1F5TA 3NWSA 4DGWB 2YS9A 3FISA 3TKYA 3I9V2 1V5GA 4B8XA 5IYCJ 1BW5A 2L9VA 4DZJA 1BC8C 2IS2A 2BEOA 4U87A 1XX5A 5HS8A 1YQAA 2EV5A 2HKXA 1YO5C 1DDNA 1XB4A 1OCOH 2GA2A 4ZTJA 2ACJA 1X4PA 1ZGWA 3RI4A 2XB0X 1ZG5A 3S3MA 1A31A 5H6QA 5K7ZA 1Y0UA 2V1NA 1ZHFA 1RI7A 2LYCA 2YUSA 3GTMJ 1R58A 3W2AA 4B47A 3SYTA 2X6YA 2EB7A 4J19A 1HC8A 3K1NA 4A3JJ 3I59B 2A07F 4IPAA 2ESNA 3WG7H 2OTJI 4HOBA 5E1ZB 2G0EA 2V1UA 1TWGJ 3QPSA 1WPKA 1XSVA 2W85A 3IWZA 4ZDLA 2A6EF 2XV4S 1JHFA 2Z5UA 3WODF 4BJTA 2P5LC 3KIOA 2CUJA 1K6OA 1MGTA 2OBPA 3LQQA 4EMSA 2CUZA 3ABUA 4P9UA 3GTJJ 2DTRA 4Q47A 2M9HA 4LGWA 2R7QA 3BTIA 3LAPA 1NG7A 4EEFG 2LF7A 4L9VA 3JW4A 5HLHA 1B9NA 2QKMB 3K4CA 2LRDA 1Z0XA 3S14J 3E6CC 1ZLJA 4ETSA 3CMAI 3OMYA 5EG0A 2PJRB 4HV6A 4F92B 2DJNA 4A69C 3HXLA 5C3EJ 2DFFA 3GTPJ 2M8GX 3MKWB 1TBXA 2GXBA 2VQCA 2BXYA 3SFZA 5J8FA 3UR3C 2R7SA 1AWCA 4BE1A 3OOPA 1JGGA 3O3KA 2KPMA 3GLLA 3AKZA 1TW2A 2EV6A 3SEQA 2COMA 4C3JJ 2KMUA 4L9TA 4N4OB 4F52A 3D1NI 1I6XA 3KX2A 4ZZDA 2DDBA 3ABMH 2IA1A 1Z7UA 1F9NA 2K9SA 5IT9Z 1W5TA 2DFEA 1HF0A 2DXIA 5E17F 1G3YA 2R7ZJ 3PJRA 1CQTA 1WH7A 2VKHA 3K1PA 2VASA 2L01A 5IY5H 2E1NA 3BR2A 3CCYA 3DPLC 3LA7A 2VBZA 1AOYA 4XKWA 3GZ5A 1FSEA 5ILVA 1ZKGA 2CH0A 2RGVA 1SD5A 3DQVC 2CFXA 2MABA 3EUKL 4CZZA 4LD5A 2DMNA 3F8CA 2GBYA 1B8IB 2FOKA 5E3OA 5EZHA 3JAMZ 2G7UA 2OF7A 2V1XA 3BJAA 4AWXB 2JWTA 3QPLA 4A2UA 3OR1C 3NAUA 3QYFA 1TT0A 4RGUA 3RTRA 5K5QA 2DA4A 1YJWI 3GYHX 1ETXA 3LA3A 1NTCA 3GX4X 4MIMA 2MFZA 4Z6YA 1TLHB 2PJPA 1Z67A 1OFCX 1IDZA 2EFNA 3F22A 4KUMA 3E1SA 3OYKA 3BG7A 2JA8J 4HG2A 3GW2A 3HRTA 4PFOA 5LHGA 1ORKA 4ENNA 2QWWA 1IGNA 2HYJA 1GDTA 1GHCA 4GFBA 2HR3A 2GOMA 1F36A 4IKFA 4KIGA 3JRGA 3QU3A 2CQ7A 2E60A 2NYXA 2CS3A 4U7DA 3FX3A 1FBQA 2WA0A 1QU3A 1ZK8A 5D4RA 2K27A 2EA2A 3MMYB 1ZLKA 2HZDA 2J5PA 5DEQA 4G6QA 1HW1A 2ZSIB 4LOCA 2OUMA 5CVUA 2MA3A 3TBIA 1ZG1A 3VWBA 2XROA 1Z21A 4IHTA 4LLLA 1I1GA 4KT6A 2X9DA 1WI9A 2R7FA 2DOAA 2ZMEA 3H3UA 3DCFA 4AUXA 4PJLA 2KP6A 3RKQA 3A2KA 2Z9OA 2L4MA 1MJ9A 2HDDA 1U78A 4FASD 5AIQA 1W36D 2D1VA 4GGGA 4I2OA 4XKVA 4A0ZA 1JUMA 4M3DA 4DW6A 2A05A 4C2TA 3OOUA 2E2HJ 1DPRA 2MH9A 3GWZA 3ZQ7A 3W2VA 2XAUA 5DCMA 4XM3A 4E6KG 4ESFA 1K61A 1SEUA 3GUDA 4RGSA 1JT0A 2XRLA 4F91B 2ZO4A 5HNHA 1RZ4A 4GYIA 4XLFA 3M8FA 3FXUA 2L4AA 2K5CA 4ZC3A 4DIQA 2P6SA 3CCSI 2DK8A 3OYJA 4NQWB 2DQRA 2ADUA 3CTAA 1DP3A 1XTAA 4M3EA 3IV5A 1R1TA 2XRNA 4I6ZA 4I09A 2K3PA 3GEZA 4XLPF 2MYSA 5D4SA 3LWFA 2L7ZA 1WVRA 2EIJH 3HPHA 2HU9A 4MQ9F 3QRFF 4V2FA 3RIRA 5DCMB 3BROA 3FBNB 5FKKA 3H92A 2DA2A 1FC3A 2VE8A 2LKPA 2GIVA 5EZGA 4PJNA 2X85A 4NQWA 4XLHA 2O0YA 2A3SA 1ZN2A 3BP8A 2OD5A 3BJOA 5GPAA 5C4JJ 2M8EA 2IPQX 3KP5A 1XGMA 3I53A 1W1WE 2KHMA 3U1DA 1BR1A 3W6KB 3DLLF 4MLOA 5DTDA 3CJRB 3ZPLA 2GA1A 3COAC 1XMKA 3K4LA 2R7OA 4KN7X 2W00A 1Z9CA 1HA8A 1Y0NA 1YS7A 2M34A 3K6GA 3TP3A 2KIMA 1J75A 3DBRB 2PMHA 2IGKA 4L5IA 4IJAA 4A3LJ 2OPTA 1IRXA 1FMWA 4M3GA 3GZ6A 1YITI 3TO6A 3DTIA 2JSCA 2VJ5A 2DI3A 4XORA 5B3SH 3I4PA 3DKXA 1POGA 2IVMA 4DYRA 4A3CJ 2LDUA 4IEJA 3WTXC 4RLFA 2VUMJ 3L9FA 4DYCA 2BZTA 5K7FA 2VXZA 1ZYRF 2XF7A 1WJ5A 2GXAA 2Y75A 2DN0A 4M6XA 3IAS2 2LD5A 2WADA 2NXNB 4MFEA 2UWMA 2CV1A 2KZVA 1JKQC 2A6TA 3FKIJ 2FSWA 1XGSA 1BOAA 1I50J 5CQGA 2P4WA 1T98A 1WHUA 4M73A 3ZMDA 3CLQA 2VQHA 4GRIA 3GCMA 3R60A 3TQNA 3DBHB 5BMZA 4BJ5C 1Z6RA 3KE2A 1S7EA 1G8XA 2EBIA 1DQUA 1E2XA 3L09A 5EJCA 2QZ8A 4UNOA 4CYDA 5F04A 3QU6A 4I02A 3FK6A 2AXLA 2H94A 1QPMA 5EGOA 4B1RA 1O4XA 2OA4A 1GUUA 2L7KA 3ECOA 3SDGA 4ESJA 4PJJA 4C2UA 1YLFA 3NEUA 1E0EA 4J01A 3FIWA 3W6VA 2ZC2A 3C1DA 3H0GJ 3KLOA 5FGMA 3JR9A 1R7JA 2EFPA 2FJ1A 1U9NA 3J7AY 4AYBN 1USTA 4PK4A 4CCNA 5L3EA 4IQ4A 2JQ7A 1QHHD 1RR8C 1R36A 2ME0A 2L9RA 2TRTA 3PL8A 2DA6A 4XMYA 2LY2A 3S1MJ 4D9JA 3PO3J 1FTTA 2PEXA 3BWGA 2X4HA 4GYGA 3PUFA 5LHIA 1LDJA 3Q0UA 4UVAA 5FROA 3S15J 3HB9A 5LLQA 1AA7A 4G6DA 2NVQJ 1ETKA 5HS7A 5B1BH 2NNNA 3GTOJ 2L02A 2O7OA 1HW2A 4OAZA 4IHSA 1OLTA 3DKYA 3CCQI 1R71A 1N25A 2DT5A 4L18B 3HRMA 3KYCB 1RESA 4M6VA 3E5XA 2CQQA 3OYGA 2HVQA 4B3XA 2OU2A 3F23A 4WCGA 3GBGA 3HSFA 2QF7A 1S9HA 2EFQA 2ZFUA 1GT0C 3DWLE 5TGTA 2IA2A 4EJTA 3PIOF 4C9YA 4OIPF 2DBBA 3OS0A 3QPHA 3ZR8X 3L2CA 3FMQA 4LITA 1QA6A 2E1MC 2QQ8A 3DV8A 3SFIA 2R7RA 4X6AJ 4D5FA 3CO6C 1ETQA 1J09A 2F5FA
chains in the Genus database with same CATH topology
1PP7U 3J80K 5HS9A 1YW7A 2JPCA 1B1BA 3WGGA 2RC4A 1Z6TA 5L3BA 2ZJ2A 1SFXA 4Q5SF 4A5NA 3O2PE 4EJUA 1MKMA 3WU0A 1JHHA 3FZVA 2P5VA 2STTA 2M5WA 3CDHA 2M30A 3MFKA 1CGPA 4Q4ZF 4HAMA 3WTZA 3BY6A 2YX4A 2JPBA 2IW5A 2K4JA 4M72A 4CICA 2HQRA 5E1WA 4LG0B 4R79A 1SAXA 1R00A 2TDXA 1HKTA 4KT5C 3KEOA 1SD7A 4HBLA 4UXNA 2E1CA 1ZRFA 4M71A 2HFHA 5LEKA 1RNLA 3NRVA 2O3FA 4HDVA 1ODDA 3BZ6A 3C18A 2PBIA 3GFMA 3MWMA 3GXOA 3F6OA 3F8MA 2VBWA 2IA0A 1U5TC 4HA8A 2CGPA 1UHMA 4WXDA 3T5XA 4LB6B 4OU0A 2FBHA 4HZFA 1UCRA 4Y15A 5FLXZ 3ELKA 5ICFA 3R0JA 1P4AA 1WKMA 2FMYA 4EGZA 4UHTA 1K7AA 3PFIA 4PCQA 1YW9A 1STZA 4QLCU 3WTTC 4LLNA 3L7WA 1O3RA 3WTYC 2W57A 1ZRCA 5HVQC 2QQ9A 3WTVC 3HOSA 2IT0A 3IRRA 5DCFA 3KFWX 3IRQA 2M45A 5DUKA 3BOQA 2H27A 5ILUA 4FX4A 1MDMA 5DD8A 2E7XA 4MEXF 2NAZA 2PQ8A 5E8IA 4YIIA 3DFGA 2DLLA 3R61A 2F5EA 1ZAOA 4FT8A 1U5TA 4RAYA 5D6FA 1TNTA 1YG2A 2MD5A 1J9IA 3ECHA 3ULQB 4BHCA 3M9AA 1TQPA 4A0YA 3RYPA 3J81K 1B4AA 2A61A 3KETA 1PDNC 3FM3A 1HQCA 1MDMB 3MZYA 2ZNZA 4NB5A 4OMZA 4OIOF 2KIFA 4ASNA 2WV0A 2OZUA 1FPQA 4G9YA 2O6GE 1FP1D 3ZP5A 3E97A 3CLOA 3TDZC 3MEXA 1S7AA 4EM0B 1FBSA 3J7AO 1BBYA 1ULYA 1I5ZA 2V6CA 1KYZA 2PFBA 3WE2A 2ZMEB 5D5VB 3GVAA 4XRFA 3ZMSA 3Q5FA 5FLXK 5DYMA 1U5TB 2CSOA 2XASA 3K0LA 2KRFA 4HYEA 2JZYA 3SQNA 5LHHA 1SFEA 4S05A 4DQ2A 2UXNA 3KZZA 3WE3A 4HQMA 4TV7A 1P6RA 1EH6A 3Q9SA 3MAJA 1OR7A 4I0BA 1MD0A 3HUGA 4ZZLA 5F64A 2PN6A 4MGRA 3GO5A 3ZMZA 5CYVA 4KA4A 4KN4X 4KIFA 1T39A 2NNYA 2IRFG 2ETHA 2EFOA 2XUBA 2FQ3A 1SMTA 5J6XA 4KDPA 1BN5A 3FWEA 4CHUA 2OQRA 4FX0A 5L3CA 2QUFA 1BIAA 3RPQA 2WC2A 3C3WA 1S3JA 4JQFA 1OYIA 3IHUA 1HW5A 3RKWA 3JTGA 1DP7P 2H6CA 4M9SA 3ZMVA 4YG2F 1YYVA 1OMIA 2ELHA 3PQKA 3BPVA 2EK5A 1LEAA 1G4DA 3ZN0A 1R1UA 3T8TA 2ZXJA 4BXUA 3EQLF 3FXRA 1R23A 1DPUA 1GVJA 2FBIA 1LJ9A 2JT1A 1U2WA 1XGNA 1XD7A 2XAJA 2L3DA 3KP2A 3HOTA 1XCVA 1IRFA 5BPDA 2UZKA 1T2KA 3U2RA 5LGUA 2HTSA 2VC0A 2H6BA 3VEPA 4ENKA 2GQQA 3LQRA 4DNCA 2PI0A 2GXGA 2PLYA 4UUVA 1WQ2A 2P5KA 2VBYA 1XSDA 2VONA 3I0TA 3N4MA 1FSHA 1T0FA 4OMYA 3KP7A 2A68F 3E5QA 1QGPA 4M74A 1YW8A 4B09A 4HF1A 3VODA 3N97A 2FNAA 2NRAC 3I5UA 4L0YB 3I64A 3V7RA 3TO7A 4A0XA 2Z99A 1TQIA 2RVCA 3ISPA 4PGGA 5CVRA 3FXQA 2ISZA 3HSRA 1IZ1A 1KA8A 3IL2A 1RIOH 3E6MA 2VT2A 3TDUC 4ESBA 2A6HF 2Y0MA 2O61A 2YR2A 2K02A 1ZARA 4AIKA 3HIFA 4RS8A 5ILSA 3IWFA 5FD6A 2G7HA 4BHPA 3G3ZA 1ZH5A 3ABTA 4A6DA 1SD6A 3TO9A 2J5OA 1WSUA 4RB0A 4LG0A 1IRGA 1TQMA 4KMFA 3M8EA 3KP6A 4Y17A 1BI0A 1R5HA 4OIRF 2MLGA 4P5OA 2MBFA 3E6DA 2DAOA 4EM2A 2HGCA 2DPUA 3I59A 3DKWA 3JAMK 2QYOA 3ZN1A 3J81Z 4BH9A 1TW3A 3QP6A 1KQ0A 1R1VA 4A5MA 3VFZA 2K86A 1QZYA 3DP7A 3DEUA 5CVIA 1KGSA 1LB2A 1HSTA 4LK1F 3F72A 2FA5A 4EQQA 1V4RA 4WK8F 1F4KA 2DK5A 4R1HA 4HLYA 5LRRA 1G6NA 2IP2A 3E6BA 4GXOA 3J80Z 5TJJA 2DQLA 2W84A 1QNTA 1QO0D 1PP8F 5D5XB 1EH8A 3V8LA 2ZNYA 3TOAA 5CVJA 1FYKA 2XKPA 1W5SA 3AAFA 5HOOA 2VN2A 5JI6A 1G3SA 2YX7A 3F6VA 3KLNA 3M7GA 2R3SA 3P7NA 4YFNF 3F8NA 3WTWC 4OIQF 3GF2A 3MQ0A 3T0YA 1IXCA 5D8KB 2ZBKA 1P2FA 2HOEA 5JR3A 2OQGA 4XLNF 1IN5A 1LDKB 2FNPA 2CWEA 3K69A 2Q0OA 2D45A 1QZZA 2P8TA 3GFIA 5IT9K 4CDGA 2VE9A 2VBXA 2QM3A 5CLSA 4U88A 3FMRA 1OYYA 4PGHA 2JTVA 5H20A 3ROUA 1I27A 5K5OA 2YPRA 3PQJA 5IT3A 1NHAA 3JSPA 3T1BA 4RGXA 6PAXA 4BHBA 4RB3C 1A04A 2F2EA 2KIUA 4RAZA 2CQKA 3V7SA 4LJZF 4RB1A 1B9MA 2VOOA 2QVOA 3D0SA 1KQ8A 3I54A 3ZMUA 1REPC 2WTEA 3S2WA 4G8XA 1H9GA 5DUIA 3MZHA 4Y13A 5AONA 4G7OF 2LNBA 1IN6A 2BE5F 1HSJA 1KU7A 5HLGA 2PMUA 1JGSA 1U3EM 4O5VA 1RUNA 2XIGA 4M9ZA 1J2XA 2EFWA 2D2WA 1L3LA 3P9KA 2MLKA 5CVVA 3WGHA 4RGRA 3HRSA 1F1ZA 1FT9A 4I98B 1LVAA 3V7CA 2EV0A 4UVBA 5ICGA 4LMYA 5AIPA 5F1RA 1S7OA 3RDIA 1W4MA 3E5UA 3BPXA 4EJVA 2HKOA 1J59A 1BI3A 5BPIA 2AS5F 2KJCA 1O3SA 4M6YA 1BI2A 1O3QA 2P7VB 2CW0F 4G7HF 5DDGA 4YFXF 4U7BA 1FLIA 4IXAA 2Q8KA 2XVCA 3SXYA 2LF8A 3VB2A 1T38A 2FBKA 3K1MA 1P4WA 1H0MA 2XAHA 1XDUA 3KP4A 1OPCA 3WTUC 4HDUA 3E3VA 3L00A 4KICA 4GCVA 2HYFA 4BAYA 2STWA 1YS6A 3KEQA 3TGNA 1RUOA 2XAQA 2Y48A 2HZTA 4KNYA 1Z91A 3NQOA 1I1SA 1PUEE 3W6JB 1IXRC 2A5YB 1IW7F 4U0YA 4A6EA 1HXDA 5LGNA 2W24A 3F21A 4I0AA 4LB5A 4MNUA 3FM5A 1FBUA 3P9IA 1WRJA 4FHTA 2VT3A 5KVRA 4BQAA 2EA4A 2H09A 2FF4A 5HDNA 3CJNA 3F3XA 4K2EA 2RNJA 3HHGA 4ZYGA 3K2ZA 3FF5A 4HF2A 2EWNA 1T6SA 4AVPA 4HF0A 5HLIA 4U0VA 2BYVE 3GLXA 2V9VA 4CGZA 3EDPA 3CUOA 2VOPA 2DO7A 3WGIA 4XSXF 1XSXA 2GAUA 3EYYA 4U0WA 3R6SA 2QBYB 1D8KA 1ON1A 3DF8A 3EUHA 4JK1X 5F6FA 3ML6A 2RV8A 1V3FA 1VTNC 1W7PA 4EJWA 1USSA 4KMUX 5BS6A 1DUXC 4OOIA 3FMSA 2Z33A 2P7CB 2VODA 3LSTA 4WWCA 3KZYA 4KFCA 3KCCA 3HTUA 3CUQA 2W25A 2HQNA 1WWXA 1FOKA 1E17A 3B02A 3HHHA 1KU9A 2OZ6A 4WF2A 1YIOA 3F8FA 3B73A 5CJ9A 1OKRA 1BM9A 5A2QZ 1S29A 5DV5A 5A2QK 2QENA 1MJAA 2BBYA 5FB2A 1LQ1A 1R5GA 4A12A 4KIBA 5ED4A 4N9HA 5DD4A 2FRHA 1ZGJA 3WG9A 5FD5A 1K78A 5HDGA 3ERED 3HTSB 1X3UA 1BIBA 4CXFA 5JFRA 3WU1B 3QAHA 2QQAA 3GFLA 4HX7A 2IJLA 3D5LA 1U8RA 1W7PD 1GXQA 4L5JA 3FHZA 3SZPA 1C0WA 1CF7A 1B59A 4MQVA 2CO5A 4IVNA 2DU9A 1J7KA 3RYRA 5FFZA 3IC7A 4ZH4F 1D3YA 4WXHA 1ONVA 2XHKA 4IF4A 4IRHA 1IN8A 5KK1A 1QBJA 2FU4A 3TOBA 4P9FA 5EEGA 2R7DA 4LLGF 4N0BA 3ZMTA 1IUYA 2YU3A 4QWQA 1IN4A 3GFJA 4CO8A 3RKXA 1QQIA 1H9TA 1W7PB 1IN7A 2HDCA 2RQPA 1FY7A 1UHWA 3VOEA 4GO1A 3LFKA 2GWRA 1YTYA 3M1EA 3CO7C 4AIJA 1UB9A 2EJRA 2F5CA 4PDKA 1O57A 2Z3YA 1U6GA 4L9NA 2CG4A 2GZWA 3RPUA 5E18F 1XCBA 4MHGA 4MTEA 2XAGA 3V8KA 2Q2EA 4P55A 4MTDA 2QBYA 2ESHA 1XGOA 2A69F 1ZGAA 2UXXA 1TNSA 2OAZA 5H6RA 2E7WA 2G9WA 1S6LA 4EGYA 4I7HA 2MC3A 4KYWA 4HW0A 2HTJA 1B6AA 1ZG3A 2WWYA 2FXAA 2ISYA 2YSRA 4YIFA 5FO5A 5ERIA 2M1BA 1JE8A 5LRSA 3HSEA 5L3GA 3F8BA 4PZJA 3SHFA 2QLZA 1K78B 1IXSB 1ON2A 4HV5A 4ZYEA 4IRGA 2FEZA 5JHUA 2NS0A 2ZKZA 1GXPA 1MZBA 1BC7C 2C6YA 3EETA 1HBXG 4MEYF 1Z1DA 2F5DA 3I71A 1S8NA 4ON0A 2PG4A 1SMYF 1FYLA 3H3ZA 5E8GA 2X0LA 1KU2A 5LBQA 5EEHA 3CUQB 1P92A 1KYWA 2VC1A 4HQEA 1R22A 4R8HA 1G3WA 3I58A 1O7FA 4ZYHA 1IAWA 2V79A 1TTYA 3IKVA 1XDSA 4EM1A 2BV6A 2V1DA 2M87A 1FNNA 4XBFA 5HDKA 5LGTA 3EYIA 3DPTA 1L0OC 1EH7A 1P4XA 1HKSA 1CF7B 4RB2C 1HKQA 2HEOA 4G94A 1ZREA 4HX4A 2L54A 1EV7A 4OINF 2MH2A 2P6TA 4N9IA 2B0LA 2HYGD 4D0PA 2RKHA 2D1HA 3MCZA 4M9XA 3SZTA 1K79A 4S04A 4UVCA 2XGXA 1J5YA 4L9JA 4I01A 4ENJA 4L0ZB 1BJAA 2DW4A 5E20A 3HRUA 5FFXA 1IF1A 1XMAA 4HX8A 1SD4A 4Q48A 3G73A 3R0AA 2ZCWA 5D8LB 4G7ZF 5TRDA 1SFUA 2K4BA 4E70A 3U9GA 4EJOA 2FE3A 4LFUA 4EVIA 4P96A 1O7LA 3REOA 1OYWA 3RJPA 1JXSA 5D6EA 1Q1HA 4NHJA 1FZPB 1FX7A 3R4KA 5BQTA 1ZRDA 4BYYA 5L3FA 4H0EA 2K7LA 5ICEA 2HS5A 2CYYA 3JSOA 2DPDA 1Z05A 3CUQC 1BI1A 3HYIA 2DFIA 1XN7A 3JTHA 1YFHA 3V8JA 2LSOA 3BDDA 1J0RA 3KP3A 3RKYA 5JVTA 3LA2A 1O3TA 1LDDA 4XSZF 3C7JA 2ZFWA 3IKTA 3O6BB 3Q9VA 3T8RA 1UFMA 4F7ZA 5J8CA 2JRTA 4EV0A 3QPTA 1FWZA 5E1XA 4AIHA 5K5RA 1FYMA 2KJBA 2O8XA 5LEJA 1KQ9A 2XAFA 3QOPA 4Z2YA 1KU3A 3P9CA 5D5WB 2FMLA 3QP5A 4WX9A 1D8JA 1D5VA 2KKOA 2XKOA 4AD9A 2RN7A 5BOXA 4ENMA 2RDPA 5L3DA 3DXJF 1LNWA 2BGCA 3LAJA 4ZYDA 4UV9A 4JBAA 4LK0F 3K9TA 5D5UB 3OV8A 2HWVA 4YFKF 3WTSC 4IRIA 2O03A 3BJ6A 4HLXA 1G3TA 4WXCA 5ICCA 1LEBA 1FP2A 4O3MA 1MJBA 2QQBA 4BNCA 4UV8A 3V4GA 5K1YA 4O6JA 1F5TA 3TKYA 4B8XA 1BC8C 2BEOA 5HS8A 1YQAA 2EV5A 2HKXA 1YO5C 1DDNA 1XB4A 2GA2A 2ACJA 3RI4A 1ZG5A 5H6QA 1Y0UA 1ZHFA 1RI7A 1R58A 2EB7A 3K1NA 3I59B 2A07F 4IPAA 2ESNA 4HOBA 5E1ZB 2V1UA 3IWZA 1XSVA 2W85A 2A6EF 2XV4S 1JHFA 2Z5UA 3WODF 2P5LC 1K6OA 1MGTA 2OBPA 3LQQA 4EMSA 4P9UA 3ABUA 2DTRA 4Q47A 4LGWA 3LAPA 2LF7A 4L9VA 3JW4A 5HLHA 1B9NA 3E6CC 1ZLJA 4ETSA 4HV6A 1TBXA 2GXBA 3SFZA 5J8FA 1AWCA 3OOPA 3O3KA 1TW2A 2EV6A 2COMA 4L9TA 1I6XA 4ZZDA 2IA1A 1Z7UA 1F9NA 5IT9Z 1W5TA 5E17F 1G3YA 3K1PA 2L01A 2E1NA 3DPLC 3LA7A 2VBZA 1AOYA 5ILVA 3GZ5A 1FSEA 2RGVA 1SD5A 3DQVC 2CFXA 4CZZA 4LD5A 3F8CA 2FOKA 3JAMZ 2G7UA 2V1XA 3BJAA 4AWXB 4A2UA 4RGUA 5K5QA 3RTRA 3GYHX 3LA3A 3GX4X 1TLHB 2PJPA 2EFNA 3F22A 4KUMA 3GW2A 3HRTA 5LHGA 4ENNA 2QWWA 1GHCA 2HR3A 4KIGA 3QU3A 2NYXA 4U7DA 3FX3A 1FBQA 5D4RA 2K27A 2EA2A 1ZLKA 2J5PA 5DEQA 4G6QA 1HW1A 5CVUA 2MA3A 1ZG1A 2XROA 4IHTA 4LLLA 1I1GA 1WI9A 2R7FA 2ZMEA 3H3UA 2Z9OA 2L4MA 1MJ9A 1U78A 5AIQA 2D1VA 4GGGA 4I2OA 4A0ZA 1DPRA 2MH9A 3GWZA 3ZQ7A 5DCMA 4ESFA 3GUDA 4RGSA 2ZO4A 1RZ4A 4GYIA 3M8FA 3FXUA 2L4AA 2P6SA 2DK8A 2DQRA 2ADUA 3CTAA 1R1TA 2XRNA 4I09A 3GEZA 4XLPF 5D4SA 3LWFA 4MQ9F 3QRFF 3RIRA 5DCMB 3BROA 3H92A 1FC3A 2VE8A 2LKPA 2GIVA 4NQWA 2O0YA 2A3SA 1ZN2A 3BP8A 2OD5A 3BJOA 2M8EA 2IPQX 3KP5A 1XGMA 3I53A 3U1DA 3W6KB 3ZPLA 2GA1A 3COAC 1XMKA 4KN7X 1Z9CA 1YS7A 2KIMA 1J75A 2PMHA 4L5IA 4IJAA 3GZ6A 3TO6A 2JSCA 2DI3A 3I4PA 2IVMA 2LDUA 3WTXC 3L9FA 2VXZA 1ZYRF 2Y75A 4M6XA 2UWMA 2FSWA 1XGSA 1BOAA 2P4WA 1T98A 4M73A 3ZMDA 3TQNA 3R60A 5BMZA 1Z6RA 3KE2A 1E2XA 3L09A 2QZ8A 4UNOA 4CYDA 3QU6A 4I02A 2AXLA 2H94A 1QPMA 2OA4A 3ECOA 4ESJA 1YLFA 3NEUA 3C1DA 3KLOA 5FGMA 1R7JA 2EFPA 1USTA 5L3EA 1R36A 2PEXA 3BWGA 2X4HA 4GYGA 5LHIA 1LDJA 4UVAA 5LLQA 4G6DA 5HS7A 2NNNA 2L02A 1HW2A 4IHSA 2DT5A 4L18B 3HRMA 3E5XA 3F23A 2OU2A 4WCGA 3HSFA 2EFQA 2IA2A 4EJTA 4OIPF 2DBBA 3QPHA 3L2CA 3FMQA 3DV8A 3CO6C 2F5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP7 U;  3J80 K;  5HS9 A;  1YW7 A;  2JPC A;  1B1B A;  3WGG A;  2RC4 A;  1Z6T A;  5L3B A;  2ZJ2 A;  1SFX A;  4Q5S F;  4A5N A;  3O2P E;  4EJU A;  1MKM A;  3WU0 A;  1JHH A;  3FZV A;  2P5V A;  2STT A;  2M5W A;  3CDH A;  2M30 A;  3MFK A;  1CGP A;  4Q4Z F;  4HAM A;  3WTZ A;  3BY6 A;  2YX4 A;  2JPB A;  2IW5 A;  2K4J A;  4M72 A;  4CIC A;  2HQR A;  5E1W A;  4LG0 B;  4R79 A;  1SAX A;  1R00 A;  2TDX A;  1HKT A;  4KT5 C;  3KEO A;  1SD7 A;  4HBL A;  4UXN A;  2E1C A;  1ZRF A;  4M71 A;  2HFH A;  5LEK A;  1RNL A;  3NRV A;  2O3F A;  4HDV A;  1ODD A;  3BZ6 A;  3C18 A;  2PBI A;  3GFM A;  3MWM A;  3GXO A;  3F6O A;  3F8M A;  2VBW A;  2IA0 A;  1U5T C;  4HA8 A;  2CGP A;  1UHM A;  4WXD A;  3T5X A;  4LB6 B;  4OU0 A;  2FBH A;  4HZF A;  1UCR A;  4Y15 A;  5FLX Z;  3ELK A;  5ICF A;  3R0J A;  1P4A A;  1WKM A;  2FMY A;  4EGZ A;  4UHT A;  1K7A A;  3PFI A;  4PCQ A;  1YW9 A;  1STZ A;  4QLC U;  3WTT C;  4LLN A;  3L7W A;  1O3R A;  3WTY C;  2W57 A;  1ZRC A;  5HVQ C;  2QQ9 A;  3WTV C;  3HOS A;  2IT0 A;  3IRR A;  5DCF A;  3KFW X;  3IRQ A;  2M45 A;  5DUK A;  3BOQ A;  2H27 A;  5ILU A;  4FX4 A;  1MDM A;  5DD8 A;  2E7X A;  4MEX F;  2NAZ A;  2PQ8 A;  5E8I A;  4YII A;  3DFG A;  2DLL A;  3R61 A;  2F5E A;  1ZAO A;  4FT8 A;  1U5T A;  4RAY A;  5D6F A;  1TNT A;  1YG2 A;  2MD5 A;  1J9I A;  3ECH A;  3ULQ B;  4BHC A;  3M9A A;  1TQP A;  4A0Y A;  3RYP A;  3J81 K;  1B4A A;  2A61 A;  3KET A;  1PDN C;  3FM3 A;  1HQC A;  1MDM B;  3MZY A;  2ZNZ A;  4NB5 A;  4OMZ A;  4OIO F;  2KIF A;  4ASN A;  2WV0 A;  2OZU A;  1FPQ A;  4G9Y A;  2O6G E;  1FP1 D;  3ZP5 A;  3E97 A;  3CLO A;  3TDZ C;  3MEX A;  1S7A A;  4EM0 B;  1FBS A;  3J7A O;  1BBY A;  1ULY A;  1I5Z A;  2V6C A;  1KYZ A;  2PFB A;  3WE2 A;  2ZME B;  5D5V B;  3GVA A;  4XRF A;  3ZMS A;  3Q5F A;  5FLX K;  5DYM A;  1U5T B;  2CSO A;  2XAS A;  3K0L A;  2KRF A;  4HYE A;  2JZY A;  3SQN A;  5LHH A;  1SFE A;  4S05 A;  4DQ2 A;  2UXN A;  3KZZ A;  3WE3 A;  4HQM A;  4TV7 A;  1P6R A;  1EH6 A;  3Q9S A;  3MAJ A;  1OR7 A;  4I0B A;  1MD0 A;  3HUG A;  4ZZL A;  5F64 A;  2PN6 A;  4MGR A;  3GO5 A;  3ZMZ A;  5CYV A;  4KA4 A;  4KN4 X;  4KIF A;  1T39 A;  2NNY A;  2IRF G;  2ETH A;  2EFO A;  2XUB A;  2FQ3 A;  1SMT A;  5J6X A;  4KDP A;  1BN5 A;  3FWE A;  4CHU A;  2OQR A;  4FX0 A;  5L3C A;  2QUF A;  1BIA A;  3RPQ A;  2WC2 A;  3C3W A;  1S3J A;  4JQF A;  1OYI A;  3IHU A;  1HW5 A;  3RKW A;  3JTG A;  1DP7 P;  2H6C A;  4M9S A;  3ZMV A;  4YG2 F;  1YYV A;  1OMI A;  2ELH A;  3PQK A;  3BPV A;  2EK5 A;  1LEA A;  1G4D A;  3ZN0 A;  1R1U A;  3T8T A;  2ZXJ A;  4BXU A;  3EQL F;  3FXR A;  1R23 A;  1DPU A;  1GVJ A;  2FBI A;  1LJ9 A;  2JT1 A;  1U2W A;  1XGN A;  1XD7 A;  2XAJ A;  2L3D A;  3KP2 A;  3HOT A;  1XCV A;  1IRF A;  5BPD A;  2UZK A;  1T2K A;  3U2R A;  5LGU A;  2HTS A;  2VC0 A;  2H6B A;  3VEP A;  4ENK A;  2GQQ A;  3LQR A;  4DNC A;  2PI0 A;  2GXG A;  2PLY A;  4UUV A;  1WQ2 A;  2P5K A;  2VBY A;  1XSD A;  2VON A;  3I0T A;  3N4M A;  1FSH A;  1T0F A;  4OMY A;  3KP7 A;  2A68 F;  3E5Q A;  1QGP A;  4M74 A;  1YW8 A;  4B09 A;  4HF1 A;  3VOD A;  3N97 A;  2FNA A;  2NRA C;  3I5U A;  4L0Y B;  3I64 A;  3V7R A;  3TO7 A;  4A0X A;  2Z99 A;  1TQI A;  2RVC A;  3ISP A;  4PGG A;  5CVR A;  3FXQ A;  2ISZ A;  3HSR A;  1IZ1 A;  1KA8 A;  3IL2 A;  1RIO H;  3E6M A;  2VT2 A;  3TDU C;  4ESB A;  2A6H F;  2Y0M A;  2O61 A;  2YR2 A;  2K02 A;  1ZAR A;  4AIK A;  3HIF A;  4RS8 A;  5ILS A;  3IWF A;  5FD6 A;  2G7H A;  4BHP A;  3G3Z A;  1ZH5 A;  3ABT A;  4A6D A;  1SD6 A;  3TO9 A;  2J5O A;  1WSU A;  4RB0 A;  4LG0 A;  1IRG A;  1TQM A;  4KMF A;  3M8E A;  3KP6 A;  4Y17 A;  1BI0 A;  1R5H A;  4OIR F;  2MLG A;  4P5O A;  2MBF A;  3E6D A;  2DAO A;  4EM2 A;  2HGC A;  2DPU A;  3I59 A;  3DKW A;  3JAM K;  2QYO A;  3ZN1 A;  3J81 Z;  4BH9 A;  1TW3 A;  3QP6 A;  1KQ0 A;  1R1V A;  4A5M A;  3VFZ A;  2K86 A;  1QZY A;  3DP7 A;  3DEU A;  5CVI A;  1KGS A;  1LB2 A;  1HST A;  4LK1 F;  3F72 A;  2FA5 A;  4EQQ A;  1V4R A;  4WK8 F;  1F4K A;  2DK5 A;  4R1H A;  4HLY A;  5LRR A;  1G6N A;  2IP2 A;  3E6B A;  4GXO A;  3J80 Z;  5TJJ A;  2DQL A;  2W84 A;  1QNT A;  1QO0 D;  1PP8 F;  5D5X B;  1EH8 A;  3V8L A;  2ZNY A;  3TOA A;  5CVJ A;  1FYK A;  2XKP A;  1W5S A;  3AAF A;  5HOO A;  2VN2 A;  5JI6 A;  1G3S A;  2YX7 A;  3F6V A;  3KLN A;  3M7G A;  2R3S A;  3P7N A;  4YFN F;  3F8N A;  3WTW C;  4OIQ F;  3GF2 A;  3MQ0 A;  3T0Y A;  1IXC A;  5D8K B;  2ZBK A;  1P2F A;  2HOE A;  5JR3 A;  2OQG A;  4XLN F;  1IN5 A;  1LDK B;  2FNP A;  2CWE A;  3K69 A;  2Q0O A;  2D45 A;  1QZZ A;  2P8T A;  3GFI A;  5IT9 K;  4CDG A;  2VE9 A;  2VBX A;  2QM3 A;  5CLS A;  4U88 A;  3FMR A;  1OYY A;  4PGH A;  2JTV A;  5H20 A;  3ROU A;  1I27 A;  5K5O A;  2YPR A;  3PQJ A;  5IT3 A;  1NHA A;  3JSP A;  3T1B A;  4RGX A;  6PAX A;  4BHB A;  4RB3 C;  1A04 A;  2F2E A;  2KIU A;  4RAZ A;  2CQK A;  3V7S A;  4LJZ F;  4RB1 A;  1B9M A;  2VOO A;  2QVO A;  3D0S A;  1KQ8 A;  3I54 A;  3ZMU A;  1REP C;  2WTE A;  3S2W A;  4G8X A;  1H9G A;  5DUI A;  3MZH A;  4Y13 A;  5AON A;  4G7O F;  2LNB A;  1IN6 A;  2BE5 F;  1HSJ A;  1KU7 A;  5HLG A;  2PMU A;  1JGS A;  1U3E M;  4O5V A;  1RUN A;  2XIG A;  4M9Z A;  1J2X A;  2EFW A;  2D2W A;  1L3L A;  3P9K A;  2MLK A;  5CVV A;  3WGH A;  4RGR A;  3HRS A;  1F1Z A;  1FT9 A;  4I98 B;  1LVA A;  3V7C A;  2EV0 A;  4UVB A;  5ICG A;  4LMY A;  5AIP A;  5F1R A;  1S7O A;  3RDI A;  1W4M A;  3E5U A;  3BPX A;  4EJV A;  2HKO A;  1J59 A;  1BI3 A;  5BPI A;  2AS5 F;  2KJC A;  1O3S A;  4M6Y A;  1BI2 A;  1O3Q A;  2P7V B;  2CW0 F;  4G7H F;  5DDG A;  4YFX F;  4U7B A;  1FLI A;  4IXA A;  2Q8K A;  2XVC A;  3SXY A;  2LF8 A;  3VB2 A;  1T38 A;  2FBK A;  3K1M A;  1P4W A;  1H0M A;  2XAH A;  1XDU A;  3KP4 A;  1OPC A;  3WTU C;  4HDU A;  3E3V A;  3L00 A;  4KIC A;  4GCV A;  2HYF A;  4BAY A;  2STW A;  1YS6 A;  3KEQ A;  3TGN A;  1RUO A;  2XAQ A;  2Y48 A;  2HZT A;  4KNY A;  1Z91 A;  3NQO A;  1I1S A;  1PUE E;  3W6J B;  1IXR C;  2A5Y B;  1IW7 F;  4U0Y A;  4A6E A;  1HXD A;  5LGN A;  2W24 A;  3F21 A;  4I0A A;  4LB5 A;  4MNU A;  3FM5 A;  1FBU A;  3P9I A;  1WRJ A;  4FHT A;  2VT3 A;  5KVR A;  4BQA A;  2EA4 A;  2H09 A;  2FF4 A;  5HDN A;  3CJN A;  3F3X A;  4K2E A;  2RNJ A;  3HHG A;  4ZYG A;  3K2Z A;  3FF5 A;  4HF2 A;  2EWN A;  1T6S A;  4AVP A;  4HF0 A;  5HLI A;  4U0V A;  2BYV E;  3GLX A;  2V9V A;  4CGZ A;  3EDP A;  3CUO A;  2VOP A;  2DO7 A;  3WGI A;  4XSX F;  1XSX A;  2GAU A;  3EYY A;  4U0W A;  3R6S A;  2QBY B;  1D8K A;  1ON1 A;  3DF8 A;  3EUH A;  4JK1 X;  5F6F A;  3ML6 A;  2RV8 A;  1V3F A;  1VTN C;  1W7P A;  4EJW A;  1USS A;  4KMU X;  5BS6 A;  1DUX C;  4OOI A;  3FMS A;  2Z33 A;  2P7C B;  2VOD A;  3LST A;  4WWC A;  3KZY A;  4KFC A;  3KCC A;  3HTU A;  3CUQ A;  2W25 A;  2HQN A;  1WWX A;  1FOK A;  1E17 A;  3B02 A;  3HHH A;  1KU9 A;  2OZ6 A;  4WF2 A;  1YIO A;  3F8F A;  3B73 A;  5CJ9 A;  1OKR A;  1BM9 A;  5A2Q Z;  1S29 A;  5DV5 A;  5A2Q K;  2QEN A;  1MJA A;  2BBY A;  5FB2 A;  1LQ1 A;  1R5G A;  4A12 A;  4KIB A;  5ED4 A;  4N9H A;  5DD4 A;  2FRH A;  1ZGJ A;  3WG9 A;  5FD5 A;  1K78 A;  5HDG A;  3ERE D;  3HTS B;  1X3U A;  1BIB A;  4CXF A;  5JFR A;  3WU1 B;  3QAH A;  2QQA A;  3GFL A;  4HX7 A;  2IJL A;  3D5L A;  1U8R A;  1W7P D;  1GXQ A;  4L5J A;  3FHZ A;  3SZP A;  1C0W A;  1CF7 A;  1B59 A;  4MQV A;  2CO5 A;  4IVN A;  2DU9 A;  1J7K A;  3RYR A;  5FFZ A;  3IC7 A;  4ZH4 F;  1D3Y A;  4WXH A;  1ONV A;  2XHK A;  4IF4 A;  4IRH A;  1IN8 A;  5KK1 A;  1QBJ A;  2FU4 A;  3TOB A;  4P9F A;  5EEG A;  2R7D A;  4LLG F;  4N0B A;  3ZMT A;  1IUY A;  2YU3 A;  4QWQ A;  1IN4 A;  3GFJ A;  4CO8 A;  3RKX A;  1QQI A;  1H9T A;  1W7P B;  1IN7 A;  2HDC A;  2RQP A;  1FY7 A;  1UHW A;  3VOE A;  4GO1 A;  3LFK A;  2GWR A;  1YTY A;  3M1E A;  3CO7 C;  4AIJ A;  1UB9 A;  2EJR A;  2F5C A;  4PDK A;  1O57 A;  2Z3Y A;  1U6G A;  4L9N A;  2CG4 A;  2GZW A;  3RPU A;  5E18 F;  1XCB A;  4MHG A;  4MTE A;  2XAG A;  3V8K A;  2Q2E A;  4P55 A;  4MTD A;  2QBY A;  2ESH A;  1XGO A;  2A69 F;  1ZGA A;  2UXX A;  1TNS A;  2OAZ A;  5H6R A;  2E7W A;  2G9W A;  1S6L A;  4EGY A;  4I7H A;  2MC3 A;  4KYW A;  4HW0 A;  2HTJ A;  1B6A A;  1ZG3 A;  2WWY A;  2FXA A;  2ISY A;  2YSR A;  4YIF A;  5FO5 A;  5ERI A;  2M1B A;  1JE8 A;  5LRS A;  3HSE A;  5L3G A;  3F8B A;  4PZJ A;  3SHF A;  2QLZ A;  1K78 B;  1IXS B;  1ON2 A;  4HV5 A;  4ZYE A;  4IRG A;  2FEZ A;  5JHU A;  2NS0 A;  2ZKZ A;  1GXP A;  1MZB A;  1BC7 C;  2C6Y A;  3EET A;  1HBX G;  4MEY F;  1Z1D A;  2F5D A;  3I71 A;  1S8N A;  4ON0 A;  2PG4 A;  1SMY F;  1FYL A;  3H3Z A;  5E8G A;  2X0L A;  1KU2 A;  5LBQ A;  5EEH A;  3CUQ B;  1P92 A;  1KYW A;  2VC1 A;  4HQE A;  1R22 A;  4R8H A;  1G3W A;  3I58 A;  1O7F A;  4ZYH A;  1IAW A;  2V79 A;  1TTY A;  3IKV A;  1XDS A;  4EM1 A;  2BV6 A;  2V1D A;  2M87 A;  1FNN A;  4XBF A;  5HDK A;  5LGT A;  3EYI A;  3DPT A;  1L0O C;  1EH7 A;  1P4X A;  1HKS A;  1CF7 B;  4RB2 C;  1HKQ A;  2HEO A;  4G94 A;  1ZRE A;  4HX4 A;  2L54 A;  1EV7 A;  4OIN F;  2MH2 A;  2P6T A;  4N9I A;  2B0L A;  2HYG D;  4D0P A;  2RKH A;  2D1H A;  3MCZ A;  4M9X A;  3SZT A;  1K79 A;  4S04 A;  4UVC A;  2XGX A;  1J5Y A;  4L9J A;  4I01 A;  4ENJ A;  4L0Z B;  1BJA A;  2DW4 A;  5E20 A;  3HRU A;  5FFX A;  1IF1 A;  1XMA A;  4HX8 A;  1SD4 A;  4Q48 A;  3G73 A;  3R0A A;  2ZCW A;  5D8L B;  4G7Z F;  5TRD A;  1SFU A;  2K4B A;  4E70 A;  3U9G A;  4EJO A;  2FE3 A;  4LFU A;  4EVI A;  4P96 A;  1O7L A;  3REO A;  1OYW A;  3RJP A;  1JXS A;  5D6E A;  1Q1H A;  4NHJ A;  1FZP B;  1FX7 A;  3R4K A;  5BQT A;  1ZRD A;  4BYY A;  5L3F A;  4H0E A;  2K7L A;  5ICE A;  2HS5 A;  2CYY A;  3JSO A;  2DPD A;  1Z05 A;  3CUQ C;  1BI1 A;  3HYI A;  2DFI A;  1XN7 A;  3JTH A;  1YFH A;  3V8J A;  2LSO A;  3BDD A;  1J0R A;  3KP3 A;  3RKY A;  5JVT A;  3LA2 A;  1O3T A;  1LDD A;  4XSZ F;  3C7J A;  2ZFW A;  3IKT A;  3O6B B;  3Q9V A;  3T8R A;  1UFM A;  4F7Z A;  5J8C A;  2JRT A;  4EV0 A;  3QPT A;  1FWZ A;  5E1X A;  4AIH A;  5K5R A;  1FYM A;  2KJB A;  2O8X A;  5LEJ A;  1KQ9 A;  2XAF A;  3QOP A;  4Z2Y A;  1KU3 A;  3P9C A;  5D5W B;  2FML A;  3QP5 A;  4WX9 A;  1D8J A;  1D5V A;  2KKO A;  2XKO A;  4AD9 A;  2RN7 A;  5BOX A;  4ENM A;  2RDP A;  5L3D A;  3DXJ F;  1LNW A;  2BGC A;  3LAJ A;  4ZYD A;  4UV9 A;  4JBA A;  4LK0 F;  3K9T A;  5D5U B;  3OV8 A;  2HWV A;  4YFK F;  3WTS C;  4IRI A;  2O03 A;  3BJ6 A;  4HLX A;  1G3T A;  4WXC A;  5ICC A;  1LEB A;  1FP2 A;  4O3M A;  1MJB A;  2QQB A;  4BNC A;  4UV8 A;  3V4G A;  5K1Y A;  4O6J A;  1F5T A;  3TKY A;  4B8X A;  1BC8 C;  2BEO A;  5HS8 A;  1YQA A;  2EV5 A;  2HKX A;  1YO5 C;  1DDN A;  1XB4 A;  2GA2 A;  2ACJ A;  3RI4 A;  1ZG5 A;  5H6Q A;  1Y0U A;  1ZHF A;  1RI7 A;  1R58 A;  2EB7 A;  3K1N A;  3I59 B;  2A07 F;  4IPA A;  2ESN A;  4HOB A;  5E1Z B;  2V1U A;  3IWZ A;  1XSV A;  2W85 A;  2A6E F;  2XV4 S;  1JHF A;  2Z5U A;  3WOD F;  2P5L C;  1K6O A;  1MGT A;  2OBP A;  3LQQ A;  4EMS A;  4P9U A;  3ABU A;  2DTR A;  4Q47 A;  4LGW A;  3LAP A;  2LF7 A;  4L9V A;  3JW4 A;  5HLH A;  1B9N A;  3E6C C;  1ZLJ A;  4ETS A;  4HV6 A;  1TBX A;  2GXB A;  3SFZ A;  5J8F A;  1AWC A;  3OOP A;  3O3K A;  1TW2 A;  2EV6 A;  2COM A;  4L9T A;  1I6X A;  4ZZD A;  2IA1 A;  1Z7U A;  1F9N A;  5IT9 Z;  1W5T A;  5E17 F;  1G3Y A;  3K1P A;  2L01 A;  2E1N A;  3DPL C;  3LA7 A;  2VBZ A;  1AOY A;  5ILV A;  3GZ5 A;  1FSE A;  2RGV A;  1SD5 A;  3DQV C;  2CFX A;  4CZZ A;  4LD5 A;  3F8C A;  2FOK A;  3JAM Z;  2G7U A;  2V1X A;  3BJA A;  4AWX B;  4A2U A;  4RGU A;  5K5Q A;  3RTR A;  3GYH X;  3LA3 A;  3GX4 X;  1TLH B;  2PJP A;  2EFN A;  3F22 A;  4KUM A;  3GW2 A;  3HRT A;  5LHG A;  4ENN A;  2QWW A;  1GHC A;  2HR3 A;  4KIG A;  3QU3 A;  2NYX A;  4U7D A;  3FX3 A;  1FBQ A;  5D4R A;  2K27 A;  2EA2 A;  1ZLK A;  2J5P A;  5DEQ A;  4G6Q A;  1HW1 A;  5CVU A;  2MA3 A;  1ZG1 A;  2XRO A;  4IHT A;  4LLL A;  1I1G A;  1WI9 A;  2R7F A;  2ZME A;  3H3U A;  2Z9O A;  2L4M A;  1MJ9 A;  1U78 A;  5AIQ A;  2D1V A;  4GGG A;  4I2O A;  4A0Z A;  1DPR A;  2MH9 A;  3GWZ A;  3ZQ7 A;  5DCM A;  4ESF A;  3GUD A;  4RGS A;  2ZO4 A;  1RZ4 A;  4GYI A;  3M8F A;  3FXU A;  2L4A A;  2P6S A;  2DK8 A;  2DQR A;  2ADU A;  3CTA A;  1R1T A;  2XRN A;  4I09 A;  3GEZ A;  4XLP F;  5D4S A;  3LWF A;  4MQ9 F;  3QRF F;  3RIR A;  5DCM B;  3BRO A;  3H92 A;  1FC3 A;  2VE8 A;  2LKP A;  2GIV A;  4NQW A;  2O0Y A;  2A3S A;  1ZN2 A;  3BP8 A;  2OD5 A;  3BJO A;  2M8E A;  2IPQ X;  3KP5 A;  1XGM A;  3I53 A;  3U1D A;  3W6K B;  3ZPL A;  2GA1 A;  3COA C;  1XMK A;  4KN7 X;  1Z9C A;  1YS7 A;  2KIM A;  1J75 A;  2PMH A;  4L5I A;  4IJA A;  3GZ6 A;  3TO6 A;  2JSC A;  2DI3 A;  3I4P A;  2IVM A;  2LDU A;  3WTX C;  3L9F A;  2VXZ A;  1ZYR F;  2Y75 A;  4M6X A;  2UWM A;  2FSW A;  1XGS A;  1BOA A;  2P4W A;  1T98 A;  4M73 A;  3ZMD A;  3TQN A;  3R60 A;  5BMZ A;  1Z6R A;  3KE2 A;  1E2X A;  3L09 A;  2QZ8 A;  4UNO A;  4CYD A;  3QU6 A;  4I02 A;  2AXL A;  2H94 A;  1QPM A;  2OA4 A;  3ECO A;  4ESJ A;  1YLF A;  3NEU A;  3C1D A;  3KLO A;  5FGM A;  1R7J A;  2EFP A;  1UST A;  5L3E A;  1R36 A;  2PEX A;  3BWG A;  2X4H A;  4GYG A;  5LHI A;  1LDJ A;  4UVA A;  5LLQ A;  4G6D A;  5HS7 A;  2NNN A;  2L02 A;  1HW2 A;  4IHS A;  2DT5 A;  4L18 B;  3HRM A;  3E5X A;  3F23 A;  2OU2 A;  4WCG A;  3HSF A;  2EFQ A;  2IA2 A;  4EJT A;  4OIP F;  2DBB A;  3QPH A;  3L2C A;  3FMQ A;  3DV8 A;  3CO6 C;  2F5F A; 
#chains in the Genus database with same CATH topology
 3CCU I;  1PP7 U;  3J80 K;  5HS9 A;  3VPR A;  3JRD A;  1YW7 A;  2CUF A;  2JPC A;  1B1B A;  3M1C A;  3WGG A;  1APL C;  2RC4 A;  2XPW A;  3ERM A;  1Z6T A;  2IGO A;  4E7K A;  3S1R J;  2JA7 J;  5L3B A;  2X6W A;  1I3Q J;  2A5W A;  4RDU A;  2ZJ2 A;  1SFX A;  4Q5S F;  4A5N A;  3O2P E;  4EJU A;  1MKM A;  2WAQ A;  3WU0 A;  1JHH A;  3AG2 H;  3FZV A;  2P5V A;  2STT A;  1MH3 A;  2M5W A;  2VJ4 A;  4W97 A;  3CDH A;  2KRH A;  2M30 A;  3MFK A;  1CGP A;  1XS9 A;  4Q4Z F;  5FKM A;  5JLW A;  2R7U A;  4HAM A;  3WTZ A;  3BY6 A;  2HI3 A;  2YX4 A;  4IQJ A;  2HOT A;  2JPB A;  2IW5 A;  2K4J A;  2CQX A;  4M72 A;  2HQR A;  5E1W A;  4CIC A;  5IYD J;  4MO7 A;  4LG0 B;  4R79 A;  3CC4 I;  2WBM A;  2ELK A;  3LSK A;  5KCM A;  2HPI A;  1SAX A;  1R00 A;  2ID6 A;  2TDX A;  5CQE A;  4F55 A;  1TT5 B;  1HKT A;  3CF5 F;  2O8K A;  4KT5 C;  2K3F A;  3KEO A;  4IX7 A;  3HKZ A;  1SD7 A;  4FTH A;  3IUO A;  4HBL A;  4UXN A;  3W3C A;  1IDY A;  2K9M A;  2E1C A;  1ZRF A;  4M71 A;  2HFH A;  5LEK A;  1RNL A;  2E5Z A;  3NRV A;  2O3F A;  2QSH X;  2Y30 A;  4HDV A;  4BXX J;  1ODD A;  2V7F A;  3BZ6 A;  2L7F P;  1IG7 A;  3HGY A;  3CC7 I;  5KAF C;  1HOM A;  3C18 A;  2PBI A;  3GFM A;  3MWM A;  3ASN H;  2WB1 A;  1YX5 A;  1TWA J;  1BR4 A;  3GXO A;  4GDF A;  2KT0 A;  3F6O A;  4UUS A;  1GV5 A;  3F8M A;  3GTL J;  3PNT A;  2VBW A;  2IA0 A;  3C2H A;  1U5T C;  4HA8 A;  2CGP A;  3H9J A;  1UHM A;  4WXD A;  3T5X A;  4LB6 B;  4OU0 A;  1T08 B;  5JHF A;  2FBH A;  4HZF A;  1UCR A;  2M4K A;  4Y15 A;  3G2B A;  5FLX Z;  3ELK A;  3TW7 A;  5ICF A;  3R0J A;  1P4A A;  2B9S A;  3GTG J;  1WKM A;  2FMY A;  2FUG 2;  1YRN A;  4EGZ A;  3FHN A;  4UHT A;  3IH3 A;  3A01 B;  1K7A A;  3PFI A;  4PCQ A;  4XLC A;  4BXF A;  1OIS A;  3CJT B;  2KL4 A;  2R7X A;  1YW9 A;  3I3L A;  1WFX A;  1STZ A;  4QLC U;  4CZC A;  3WTT C;  1B72 A;  4LLN A;  3L7W A;  1HLV A;  1O3R A;  3WTY C;  2W57 A;  9ANT A;  1ZRC A;  4G6T B;  2L2O A;  3TP0 A;  2OC6 A;  5HVQ C;  2QQ9 A;  1H88 C;  3WTV C;  3HOS A;  1SC7 A;  2IT0 A;  3VYU B;  3H5A A;  3IRR A;  4V19 K;  5DCF A;  4XON A;  3KFW X;  2HPM A;  3ABL H;  3IRQ A;  1R9T J;  2CW7 A;  2M45 A;  5DUK A;  3BOQ A;  2FX0 A;  2H27 A;  5ILU A;  4FX4 A;  1MDM A;  4C3H J;  2MG4 A;  5DD8 A;  2E7X A;  4MEX F;  3DEW A;  3F9K A;  2NAZ A;  1BJZ A;  2PQ8 A;  1AHD P;  5E8I A;  5F08 A;  1LE8 B;  4YII A;  1ACI A;  4RM3 A;  2DYR H;  2ZSH B;  3BZK A;  3DFG A;  3I4N J;  2DLL A;  3R61 A;  4FIS A;  1D0Y A;  4YEL A;  1TL8 A;  1LFU P;  2F5E A;  1ZAO A;  4BEH A;  4FT8 A;  1U5T A;  4RAY A;  2VL8 A;  4BBS J;  5D6F A;  2VJJ A;  5B5E C;  1TNT A;  1YG2 A;  2L7M P;  2MD5 A;  3K4B A;  1J9I A;  3ECH A;  3ULQ B;  1VQM I;  3S1Q J;  4BHC A;  3M9A A;  1K4S A;  1WI3 A;  1TQP A;  2FQ4 A;  4MFD A;  4DBQ A;  3OYI A;  4A0Y A;  2HOS A;  1IJW C;  2X51 A;  3ZQG A;  3HGG A;  5EG0 B;  3RYP A;  3J81 K;  1B4A A;  2PJR A;  1HCR A;  2EIN H;  2A61 A;  3PFY A;  3H3V K;  3KET A;  1W36 C;  2E35 A;  2UUZ A;  3BR5 A;  4ABZ A;  1PDN C;  3FM3 A;  1FMV A;  1HQC A;  4BY7 J;  4D7N A;  3LSR A;  1MND A;  1MDM B;  4BAC A;  3MZY A;  1ZR4 A;  1A35 A;  3C2B A;  2ZNZ A;  4NB5 A;  4OMZ A;  4CUG A;  3HJE A;  3PSI A;  1VZ0 A;  3HKZ N;  1ETO A;  2BXZ A;  3BT9 A;  4RLQ A;  3DEE A;  1H8A C;  2H8W A;  3CMM A;  3BLY A;  4D5C A;  2VQL A;  2FOW A;  2D5V A;  4OIO F;  3B6A A;  2M2E A;  2KIF A;  4ASN A;  1FTZ A;  2WV0 A;  2OZU A;  4JP0 A;  1FPQ A;  4G9Y A;  2O6G E;  1Y56 A;  4B3A A;  1FP1 D;  4E7J A;  3O8G A;  5E3L A;  3ZP5 A;  2VPR A;  3E97 A;  3CLO A;  3TDZ C;  3MEX A;  1S7A A;  4EM0 B;  1ERD A;  1FBS A;  2XC7 A;  3J7A O;  1BBY A;  4BDZ A;  3AFH A;  1ULY A;  4IHX A;  3LL7 A;  2O5R A;  2Y9Y A;  3IH4 A;  2ZXW H;  4NC6 A;  1I5Z A;  2Z1D A;  5GTI C;  2LK2 A;  2V6E A;  1AKH A;  1W0U A;  2V6C A;  1KYZ A;  2PFB A;  3UKG A;  2K9N A;  3WE2 A;  4HNU A;  2ZME B;  4E7S A;  1KON A;  5D5V B;  2DOD A;  3OIQ A;  3GVA A;  4XRF A;  3ZMS A;  3Q5F A;  5FLX K;  5DYM A;  1U5T B;  2CSO A;  2XAS A;  3K0L A;  2KRF A;  1X3W B;  1VFC A;  4HYE A;  3HOW J;  2JZY A;  4JX5 A;  3SQN A;  2DOE A;  3QWL A;  5LHH A;  3RQI A;  1SFE A;  3MN2 A;  4S05 A;  1DU0 A;  1TC3 C;  1LVK A;  4XIC A;  4JOM A;  4NDL A;  3W2W A;  2PMZ A;  2HDW A;  3J7Y J;  4DQ2 A;  2JJ7 A;  2UXN A;  4HST A;  3KZZ A;  1W5C C;  2EQR A;  3WE3 A;  4HQM A;  4KIS A;  4TV7 A;  1P6R A;  1EH6 A;  2RRE A;  2OJE D;  2I10 A;  1V54 H;  1S72 I;  3M4O J;  3UNG C;  3KZI C;  3Q9S A;  3MAJ A;  1OR7 A;  4I0B A;  3RZO J;  1X2M A;  1MD0 A;  3HUG A;  4ZZL A;  2XDV A;  5F64 A;  2ID3 A;  4CCL A;  2PN6 A;  4MGR A;  4B44 A;  1MSF C;  3GO5 A;  5LFA A;  5J40 A;  3ZMZ A;  5CYV A;  4BQO A;  4KA4 A;  2CW8 A;  4KN4 X;  4KIF A;  1T39 A;  2NNY A;  2IRF G;  2ETH A;  2DMQ A;  3FXO A;  2ZXH A;  2E19 A;  2EFO A;  2I8D A;  2BOL A;  2XUB A;  2MC4 A;  2WY8 Q;  2FQ3 A;  4FET A;  1A36 A;  2LKS A;  1HDP A;  5DM7 F;  1ZEL A;  1SMT A;  5J6X A;  4KDP A;  5CPR B;  3DTE A;  3SZG A;  1BN5 A;  3FWE A;  3PSF A;  1Y8R B;  2JK3 A;  2WV1 A;  3RSN A;  4CHU A;  5IP6 A;  2GIZ A;  2DCE A;  2OQR A;  4FX0 A;  3CP2 A;  4M3F A;  5L3C A;  2QUF A;  1BIA A;  1IUF A;  1UMQ A;  1FOX A;  2XGC A;  3RPQ A;  3ZCO A;  2WC2 A;  4F93 B;  3C3W A;  1S3J A;  4JQF A;  1OCZ H;  3OYC A;  2VQG A;  3GTQ J;  4II3 A;  1U9O A;  2E34 A;  3CD6 I;  1MBJ A;  4DJA A;  4HNT A;  1OCR H;  1OYI A;  3IHU A;  1HW5 A;  2LY9 A;  4G12 A;  3RKW A;  3JTG A;  3QOE A;  4CH7 A;  1PUF B;  1AKH B;  3Q0V A;  4J00 A;  1MMD A;  1Y8Q B;  1DP7 P;  4B48 A;  2H6C A;  2LG4 A;  3LMM A;  4M9S A;  3ZMV A;  3JRE A;  4OAY A;  4YG2 F;  4NC8 A;  1YYV A;  1S5L C;  1OMI A;  2ELH A;  2ZME C;  3PQK A;  4NUB A;  3K4M A;  3BPV A;  2EK5 A;  3G1O A;  1LEA A;  3D5R C;  2PX9 A;  2XGE A;  1YJN I;  1G4D A;  2X48 A;  4QSH A;  2R7W A;  3ZN0 A;  1R1U A;  3T8T A;  2QGU A;  2ZXJ A;  1VQ8 I;  2XPV A;  1KZH A;  4BXU A;  3EQL F;  3FXR A;  1R23 A;  2RAE A;  3ZQH A;  4RA2 A;  3A0H C;  4BEH B;  1DPU A;  1GVJ A;  2FBI A;  2Y69 H;  1LJ9 A;  2JT1 A;  1VQO I;  3VDX A;  3H1C A;  1U2W A;  3FXK A;  1VND A;  2E1M B;  1XGN A;  2X6X A;  1E3P A;  1XD7 A;  2XAJ A;  2L3D A;  3KP2 A;  3HOT A;  4A3F J;  1XCV A;  1IRF A;  2NOG A;  3BG3 A;  5BPD A;  2B63 J;  3K4J A;  2UZK A;  5F0H A;  1ETY A;  2IBD A;  3DPU A;  1BA5 A;  1T2K A;  1MBG A;  1X4O A;  3U2R A;  2HTS A;  2VC0 A;  2H6B A;  5LGU A;  3VEP A;  4ENK A;  2GQQ A;  3LQR A;  4DNC A;  2PI0 A;  3IP4 B;  2GXG A;  2IS4 A;  2PLY A;  3CMY A;  4UUV A;  2L5Q A;  4XRM A;  1OCP A;  3CCR I;  2R92 J;  1WQ2 A;  3CC2 I;  2P5K A;  2VBY A;  1XSD A;  2JN6 A;  2NS7 A;  3I0T A;  3QOD A;  3N4M A;  4LIU A;  2VON A;  4AU7 A;  2LRE A;  1FSH A;  1T0F A;  3KP7 A;  4OMY A;  2LFB A;  3H0D A;  2A68 F;  3E5Q A;  4FE4 A;  1QGP A;  2EIK H;  3SJM A;  4A3I J;  2XGD A;  1XMX A;  3GME A;  4M74 A;  2IS6 A;  1YW8 A;  4B09 A;  4BGD A;  4HF1 A;  3VOD A;  4AM3 A;  3N97 A;  2FNA A;  4BJ6 C;  1SVM A;  4P1W A;  3ZQL A;  2JUC A;  1MBK A;  5FKO A;  3I4M J;  2NRA C;  3I5U A;  3HOY J;  3BR1 A;  4L0Y B;  3HOU J;  2M7B A;  2UV1 A;  2DA7 A;  4PJM A;  2WY7 Q;  3FKJ A;  3I64 A;  3S16 J;  3V7R A;  3TO7 A;  2AO9 A;  4A0X A;  2F4I A;  2Z99 A;  3S1N J;  1WJF A;  1TQI A;  2RVC A;  3ISP A;  4PGG A;  2R5Z A;  5CVR A;  3FXQ A;  4XNF A;  2ISZ A;  1RC9 A;  2CQN A;  3HSR A;  1IZ1 A;  2O9L A;  1KA8 A;  3WU2 C;  5EDN A;  3IL2 A;  3K4K A;  2R5Y A;  1RIO H;  3E6M A;  2VT2 A;  3TDU C;  5IYB J;  3BR6 A;  1X2N A;  4ESB A;  2A6H F;  2Y0M A;  1YE9 A;  2O61 A;  4XKB A;  2YR2 A;  3TED A;  2K02 A;  1ZAR A;  3C2G A;  4AIK A;  3CME I;  3HIF A;  4RS8 A;  5ILS A;  3VSL A;  1YIJ I;  3IWF A;  5FD6 A;  4IHW A;  2LC2 A;  2G7H A;  3HOX J;  4BHP A;  3G3Z A;  1ZH5 A;  3ABT A;  1SFO J;  4A6D A;  1SD6 A;  4NBQ A;  3TO9 A;  4HNV A;  2J5O A;  1WSU A;  2M7A A;  2EZK A;  3A4C A;  4X0G A;  1EJ9 A;  4RB0 A;  3VYT B;  1JI8 A;  2BY0 A;  4LG0 A;  1IRG A;  1YHQ I;  1TQM A;  2FD5 A;  4KMF A;  2DFH A;  4FCY A;  2XB5 A;  3M8E A;  1SVO A;  3KP6 A;  1TWF J;  2HVR A;  4Y17 A;  4UUT A;  3K7A J;  1BI0 A;  3L2W A;  1R5H A;  4QPO A;  2ME6 A;  4OIR F;  2MLG A;  3B6C A;  1Z3X A;  1H89 C;  2YU9 J;  4P5O A;  2MBF A;  1R5I D;  3E6D A;  3IAM 2;  4XKC A;  2DAO A;  1XC5 A;  2MGQ A;  3N05 A;  3FXM A;  4ZJZ A;  3JRA A;  4EM2 A;  1WH5 A;  1QHG A;  2HGC A;  2DPU A;  3I59 A;  3DKW A;  3JAM K;  2QYO A;  3LOC A;  3ZN1 A;  1YX3 A;  3J81 Z;  2BHY A;  3E0J B;  2R4G A;  4BH9 A;  3HEF A;  2EIM H;  1TW3 A;  3CCE I;  2MD0 A;  3QP6 A;  1KQ0 A;  1R1V A;  4A5M A;  4BS9 A;  3VFZ A;  2K86 A;  2E5N A;  1QZY A;  3DP7 A;  3DEU A;  5CVI A;  1KGS A;  1LB2 A;  2V9P A;  1HST A;  2RQQ A;  3F72 A;  4LK1 F;  2FA5 A;  3PUB A;  5GP9 A;  4EQQ A;  5GAH J;  3VYS B;  2KFD A;  1V4R A;  4WK8 F;  1F4K A;  2DK5 A;  4R1H A;  4HLY A;  5LRR A;  1U8B A;  1G6N A;  2Q1Z B;  2IP2 A;  4CYC A;  3E6B A;  3H5R A;  4LG3 A;  3SEZ A;  1EA3 A;  4GXO A;  4RBO A;  3J80 Z;  5TJJ A;  1PJR A;  2DQL A;  2W84 A;  1QNT A;  1QO0 D;  1PP8 F;  5D5X B;  1EH8 A;  1MMG A;  3V8L A;  2ZNY A;  3TOA A;  1VI0 A;  2JVH A;  5CVJ A;  1VQ5 I;  1FYK A;  2XKP A;  4IL6 C;  1X1A A;  1W5S A;  2L9S A;  4HEA 2;  4S0H B;  3JRB A;  3CJQ B;  1D1B A;  3AAF A;  5HOO A;  3OS2 A;  2VN2 A;  4BKX A;  5JI6 A;  1G3S A;  2YX7 A;  5F0C A;  1JT6 A;  3F6V A;  3KLN A;  4ANJ A;  4C3I J;  3M7G A;  2R3S A;  3P7N A;  1VQ6 I;  2W4S A;  4Y52 J;  5IOY A;  1RKT A;  4YFN F;  3F8N A;  1LUJ B;  3BG6 A;  3WTW C;  2Y0S A;  3GF2 A;  4OIQ F;  3MQ0 A;  4CCO A;  1E3H A;  2IGN A;  1I39 A;  2HQ5 A;  5IOZ A;  1FOY A;  1Q1V A;  3T0Y A;  1A6I A;  2LVS A;  1JKR C;  4XRS A;  2QKL B;  1IXC A;  5D8K B;  4C30 A;  3OYB A;  2KIS A;  1Y1V J;  2ZBK A;  4AC0 A;  1P2F A;  2HOE A;  1UG2 A;  5JR3 A;  1N77 A;  4DZP A;  2OQG A;  4XLN F;  3G6E I;  1IN5 A;  1LDK B;  1Z7L A;  2F48 A;  2FNP A;  2CWE A;  3MKY B;  3K69 A;  2Q0O A;  1DGW Y;  4M3B A;  2D45 A;  1QZZ A;  2P8T A;  3JCU C;  3GFI A;  4A3B J;  4F3Q A;  2VPL A;  1OR7 C;  4XR6 A;  5IT9 K;  4CDG A;  1K83 J;  2E2J J;  3QQA A;  3L2U A;  3G71 I;  2M4G A;  2VBX A;  2VE9 A;  1NK3 P;  2QM3 A;  2LLK A;  5CLS A;  3D5S C;  3CDI A;  4U88 A;  2IS1 A;  1MBF A;  3FMR A;  4A3G J;  1OYY A;  4PGH A;  2JTV A;  2Z2S B;  5HOD A;  5HLT A;  5H20 A;  3ROU A;  2L0K A;  3U21 A;  3K70 D;  2ZJR F;  3H36 A;  1I27 A;  2K9Q A;  5K5O A;  3VSK A;  2YPR A;  3PQJ A;  5IT3 A;  1NHA A;  2RNG A;  3T1B A;  3JSP A;  1T8I A;  4RGX A;  4JX6 A;  6PAX A;  4BHB A;  2HXO A;  2K85 A;  5J3L A;  1EF4 A;  1GVD A;  4AVZ A;  2V4J C;  3LNQ A;  1R49 A;  4RB3 C;  1A04 A;  4B4C A;  2F2E A;  2KIU A;  2KQR A;  4RAZ A;  3OSG A;  2CQK A;  4PSX A;  3V7S A;  4LJZ F;  4RB1 A;  3TW6 A;  5C4X J;  4A3E J;  1B9M A;  2VOO A;  3OY9 A;  1VQN I;  4XN3 A;  2AXT C;  2HXI A;  2QVO A;  3D0S A;  1KQ8 A;  3I54 A;  4RAF A;  1TZL A;  4D7M A;  1ENH A;  3ZMU A;  3S3O A;  1REP C;  2WTE A;  3S2W A;  2DOF A;  1V5F A;  2KLO A;  4G8X A;  2VKD A;  3S17 J;  1H9G A;  5DUI A;  1FOW A;  3MZH A;  4Y13 A;  3KEY A;  1SAN A;  5AON A;  4G7O F;  2LNB A;  4PFP A;  2AHQ A;  1IN6 A;  3KYL A;  5TIS C;  2BE5 F;  1HSJ A;  4IO9 F;  3HG9 A;  1KU7 A;  4N4N B;  4BL0 B;  3HPG A;  3CQZ J;  2L9N A;  5EF6 A;  2BVM A;  5HLG A;  1FJL A;  1QRY A;  2NVX J;  2PMU A;  1JGS A;  1JKO C;  1U3E M;  2DT7 B;  4O5V A;  2XF5 A;  1RUN A;  3CES A;  2F4O B;  2GOX B;  2XIG A;  4M9Z A;  3OL3 A;  5M3M J;  4YRV A;  2VIX A;  1I3A A;  1J2X A;  2EFW A;  2D2W A;  2CV0 A;  1L3L A;  2LBF A;  1YI2 I;  3P9K A;  3OYF A;  4XOP A;  2MLK A;  5CVV A;  3WGH A;  4RGR A;  2E71 A;  4II2 A;  1K4T A;  2IXS A;  3HRS A;  1F1Z A;  1FT9 A;  2EH3 A;  4I98 B;  5GPC A;  1LVA A;  3V7C A;  2EV0 A;  1FIP A;  3LSH A;  4UVB A;  5ICG A;  2QSF X;  4LMY A;  3PM1 A;  5AIP A;  5F1R A;  2QEX I;  1W0T A;  1S7O A;  3RDI A;  1W4M A;  1R4M B;  3E5U A;  2TCT A;  3BPX A;  4EJV A;  2E2I J;  3BTL A;  4IHV A;  2HKO A;  2R0Q C;  1J59 A;  1Y6I A;  1BI3 A;  2JA2 A;  5BPI A;  4ZYA A;  2HVS A;  2AS5 F;  2F6C A;  2DTZ A;  2KJC A;  1O3S A;  4M6Y A;  1BI2 A;  1O3Q A;  2AQF A;  1MNE A;  2CW0 F;  2P7V B;  2QCO A;  1JJ8 C;  4G7H F;  5DDG A;  4YFX F;  4U7B A;  5J4Y A;  3G4S I;  1FLI A;  4IXA A;  2Q8K A;  4ITV A;  1ZR2 A;  2XVC A;  2H1K A;  2E1O A;  1G2H A;  2XF6 A;  3SXY A;  2M0C A;  3HBL A;  1RET A;  2LF8 A;  1T33 A;  3H9G A;  3VB2 A;  1JTX A;  3BQY A;  1T38 A;  2FBK A;  4HRI A;  3K1M A;  5GTH C;  2F4M B;  4NC7 A;  1P4W A;  1H0M A;  2F5V A;  1N75 A;  2XAH A;  1XDU A;  3NWT A;  1LE8 A;  1NG6 A;  3QYE A;  1DGR M;  1QVU A;  3CDL A;  3KP4 A;  4H4K C;  1OPC A;  1IV8 A;  3WTU C;  4HDU A;  2DA5 A;  3E3V A;  4JX4 A;  3L00 A;  4I99 C;  4KIC A;  4GCV A;  3BG9 A;  2HYF A;  4BAY A;  2STW A;  3JRF A;  1YS6 A;  3KEQ A;  3TGN A;  2BVL A;  1RUO A;  2XAQ A;  2Y48 A;  2EZH A;  4V2G A;  2HZT A;  1U0J A;  2KRC A;  2BW3 A;  5KHD A;  2Z16 A;  4KNY A;  3CF2 A;  2IEK A;  2EIL H;  1JTY A;  1Z91 A;  3ESW B;  3KYD B;  2JRM A;  4HPQ A;  5EYR A;  1GV2 A;  1LKX A;  1X1C A;  5JLX A;  2LMD A;  3NQO A;  5FKN A;  1I1S A;  3OSF A;  1PUE E;  3W6J B;  5M5X J;  1WJA A;  1LPQ A;  1IXR C;  3M3Y J;  2Y0S N;  1D5Y A;  2A5Y B;  2DA1 A;  2NVT J;  4XID A;  2LBF B;  1IW7 F;  1FIA A;  4U0Y A;  4FE7 A;  1IRZ A;  4A6E A;  4UB6 C;  1HXD A;  5LGN A;  2W24 A;  3F21 A;  4I0A A;  5FRM A;  3OL4 A;  4LB5 A;  3L2Q A;  4MNU A;  3FM5 A;  2Y2Z A;  3OYA A;  1FBU A;  3P9I A;  3RQ4 A;  1WRJ A;  4FHT A;  5J1U A;  3CCJ I;  2VT3 A;  3K70 C;  3ZRG A;  5KVR A;  4BQA A;  3FXJ A;  3HM5 A;  3HOZ J;  3FDY A;  1X3Z B;  1ZTR A;  2EA4 A;  2H09 A;  3K4N A;  2FF4 A;  5HDN A;  1WGX A;  2XPU A;  1VQK I;  3CJN A;  3F3X A;  2DA3 A;  1V55 H;  4K2E A;  2RNJ A;  3O8H A;  3HHG A;  2M3A A;  1EKE A;  3K2Z A;  3M8J A;  4ZYG A;  3FF5 A;  4CCJ A;  4HF2 A;  2EWN A;  1T6S A;  4CCM A;  4AVP A;  4HF0 A;  3PNY A;  5HLI A;  4E7L A;  1UG0 A;  1DU6 A;  4JYK A;  2JA5 J;  4U0V A;  4DOZ A;  2BYV E;  4IOC F;  2R7T A;  1MSE C;  3GLX A;  2V9V A;  4XN0 A;  4CGZ A;  3EDP A;  3CUO A;  3GTK J;  2VOP A;  2EPF A;  4X1E A;  2DO7 A;  1MW7 A;  3WGI A;  4XSX F;  3BCB A;  4FQG A;  4UUS B;  2KIQ A;  2VKV A;  2LP0 A;  1SFK A;  2DMP A;  1XSX A;  2JA6 J;  3PO2 J;  2GAU A;  3CP8 A;  3EYY A;  4U0W A;  4XLE A;  3R6S A;  2W1O A;  2QBY B;  3X2Q H;  2GM4 A;  1D8K A;  1ON1 A;  3DF8 A;  3EUH A;  3MKZ A;  3BCA A;  4BE0 A;  4JK1 X;  1WJE A;  5F6F A;  3ML6 A;  2V26 A;  2WB1 N;  2RV8 A;  4I76 A;  4A3D J;  1V3F A;  3MD2 A;  4AYB A;  1VTN C;  1R4N B;  1W7P A;  3Q0W A;  4EJW A;  1USS A;  1P7J A;  4KMU X;  5BS6 A;  1Z3Y A;  1BOB A;  2Y31 A;  3HC7 A;  1OCC H;  1DUX C;  4OOI A;  3FMS A;  2Z33 A;  2P7C B;  2VOD A;  1MBE A;  3LST A;  4WWC A;  3KZY A;  3ABK H;  3A1Y A;  4KFC A;  3KCC A;  3HTU A;  3CUQ A;  5FRN A;  2CU7 A;  1IO2 A;  2R5Y B;  2X1D A;  4QIW N;  2W25 A;  3PNV A;  2HQN A;  2K9L A;  1WWX A;  4BBR J;  3ONQ A;  1FOK A;  3CCV I;  4ZDO A;  1E17 A;  3B02 A;  3HHH A;  1KU9 A;  2OZ6 A;  3LSG A;  1YIO A;  2VJI A;  2ELJ A;  3B73 A;  3F8F A;  4WF2 A;  5CJ9 A;  1OKR A;  3AG4 H;  1BM9 A;  2CRG A;  1PUF A;  5A2Q Z;  2JVG A;  1VQP I;  1S29 A;  3M07 A;  5DV5 A;  5A2Q K;  3I55 I;  3ASO H;  2ECC A;  1VQL I;  2QEN A;  1MJA A;  2BBY A;  3RPU D;  1M1E B;  1TWC J;  5F0F A;  5GAD J;  3S2H J;  5FB2 A;  5C44 J;  2R93 J;  1LQ1 A;  1R5G A;  4A12 A;  4KIB A;  3V42 A;  5ED4 A;  4N9H A;  2OCE A;  3LSM A;  5DD4 A;  3HZJ A;  2FRH A;  1V5E A;  1ZGJ A;  5FD5 A;  3WG9 A;  1K78 A;  5HDG A;  4CSW A;  1X19 A;  3ERE D;  3G1L A;  3OYN A;  3HTS B;  1X3U A;  2P81 A;  4KJZ A;  1D0Z A;  1BIB A;  2P0W A;  4CXF A;  3U1K A;  3DBL B;  5JFR A;  3WU1 B;  3QAH A;  2QQA A;  1VF9 A;  5J47 A;  3DU6 A;  4XOT A;  3GFL A;  3MVP A;  3NAR A;  1MMS A;  4HX7 A;  4RM2 A;  3SDB A;  2WAQ N;  2IJL A;  2NS8 A;  3D5L A;  2HQA A;  2B7E A;  1U8R A;  4BY1 J;  1X1D A;  5GAE J;  1W7P D;  1GXQ A;  4L5J A;  3BR3 A;  5B1A H;  3FHZ A;  3FXL A;  3SZP A;  1C0W A;  2KZG A;  1CF7 A;  1B59 A;  3ZQI A;  5FLV A;  4MQV A;  2X1C A;  2CO5 A;  1LFB A;  4IVN A;  2DU9 A;  1JUP A;  2MW8 A;  1J7K A;  1A5J A;  4Y4R A;  3RYR A;  5FFZ A;  3IC7 A;  1SAU A;  4ZH4 F;  1D3Y A;  2H8R A;  2BW3 B;  4CA0 A;  4WXH A;  1NH3 A;  1ONV A;  3AG1 H;  1OJL A;  2XHK A;  4PUS A;  2N8G A;  4B43 A;  2GLO A;  4ZTF A;  2DMU A;  4IF4 A;  4IRH A;  4A3K J;  1IN8 A;  5KK1 A;  1QBJ A;  5FKL A;  4KIT B;  2FU4 A;  3TOB A;  1ZQ3 P;  3ZOB A;  2OV7 A;  4IZZ A;  4P9F A;  1RPW A;  5EEG A;  2R7D A;  2XSJ C;  1QPI A;  2V9K A;  4LLG F;  4N0B A;  3ZMT A;  1IUY A;  2YU3 A;  1PVE A;  4QPQ A;  4QWQ A;  1IN4 A;  3GFJ A;  4RAG A;  4CO8 A;  3RKX A;  1QQI A;  4XK4 A;  1H9T A;  3BR0 A;  1WZ2 A;  1W7P B;  1OQY A;  5EGO B;  3H35 A;  1T56 A;  1IN7 A;  5LD2 C;  2HDC A;  1TP4 A;  5IPA A;  1WJB A;  2RQP A;  5KAI C;  1FY7 A;  4Y7N J;  2AQE A;  1UHW A;  4GO1 A;  3Q3S A;  3VOE A;  1YJ9 I;  2BY3 A;  2CV2 A;  3LFK A;  2GWR A;  1YTY A;  4BQQ A;  3G1M A;  3M1E A;  4LIV A;  3P5J A;  3CO7 C;  4AIJ A;  2HOA A;  5EEA A;  3S3N A;  1UB9 A;  2EJR A;  2F5C A;  4E4H A;  1F43 A;  4BE2 A;  2DMT A;  4PDK A;  1O57 A;  2Z3Y A;  1U6G A;  3H9Q A;  1UEL B;  3ZQF A;  2LY1 A;  4L9N A;  4A3M J;  1D1A A;  2BHZ A;  2CG4 A;  4CYC B;  2GZW A;  3RPU A;  1UAA A;  5E18 F;  2Y9Z A;  1VQ4 I;  2W82 A;  1XCB A;  4MHG A;  1ITY A;  4MTE A;  4RMN A;  3S32 A;  1ETV A;  2XAG A;  5FJ8 J;  1QVT A;  3EPZ A;  3MZ8 A;  3V8K A;  2X1E A;  5HNF A;  3L1P A;  2ZJP F;  2Q2E A;  3TMO A;  4P55 A;  4MTD A;  3OIP A;  4D1Q A;  3I56 I;  2NOJ B;  2I5U A;  2WAF A;  2QBY A;  2ESH A;  1XGO A;  2A69 F;  5KNL A;  1ZGA A;  2UXX A;  1TNS A;  2LR8 A;  2OAZ A;  5H6R A;  3OWT A;  2E7W A;  2ZXI A;  2G9W A;  1N78 A;  1S6L A;  4EGY A;  3S93 A;  4I7H A;  3JRC A;  2MC3 A;  4KYW A;  4HW0 A;  1JKP C;  2HTJ A;  3AG3 H;  1B6A A;  1ZG3 A;  2WWY A;  2FXA A;  2ISY A;  1OCT C;  2YSR A;  2JMW A;  3JRH A;  3WHC A;  4QTR A;  5BNG A;  4YIF A;  2CFO A;  4NNJ A;  5FO5 A;  1MBH A;  4Y33 A;  5ERI A;  2M1B A;  2M0M A;  5LRS A;  3HSE A;  1JE8 A;  1G59 A;  3FK7 A;  1R6R A;  5L3G A;  5B66 C;  3F8B A;  4PZJ A;  5J4V A;  3SHF A;  2QLZ A;  3BC8 A;  1K78 B;  1IXS B;  5J1R A;  2OTL I;  1ON2 A;  4HV5 A;  1JJ6 C;  4ZYE A;  4IRG A;  4AID A;  1BR2 A;  3L2V A;  2FEZ A;  5JHU A;  4IHY A;  1T95 A;  4A93 J;  4CCK A;  2NVU B;  2NS0 A;  2ZKZ A;  1GXP A;  1MZB A;  1HDD C;  1BC7 C;  2C6Y A;  3OYL A;  3EET A;  5H2F C;  4E7H A;  1HBX G;  5JVG F;  3LSI A;  4MEY F;  1Z1D A;  3JRI A;  2F5D A;  3K2A A;  3I71 A;  1S8N A;  5K7H A;  4ON0 A;  3LFU A;  1UHS A;  2PG4 A;  1SMY F;  1FYL A;  3H3Z A;  2NVY J;  4DYQ A;  5E8G A;  2X0L A;  1KU2 A;  2X6O A;  1A6Q A;  5LBQ A;  5EEH A;  3CUQ B;  1P92 A;  3RZD J;  1KYW A;  2VC1 A;  4ZDP A;  4HQE A;  1R22 A;  4R8H A;  5E3M A;  1X58 A;  1B8I A;  1G3W A;  3I58 A;  1O7F A;  4BUP A;  4ZYH A;  1PYV A;  4BQN A;  3A0B C;  1T0F C;  2DDA A;  4E7Z A;  3L2R A;  2V79 A;  5GAG J;  1IAW A;  2COB A;  1TTY A;  3A02 A;  3IKV A;  1XDS A;  4EM1 A;  2LTP A;  1WJD A;  1VQ7 I;  3BTC A;  2W7N A;  2BV6 A;  2DT6 A;  2M87 A;  1FNN A;  2V1D A;  3BG5 A;  4XLA A;  4XBF A;  5HDK A;  5LGT A;  3EYI A;  3DPT A;  1QZE A;  1L0O C;  1EH7 A;  1P4X A;  2KDO A;  1HKS A;  1XPX A;  3DTK A;  4PJ0 C;  1CF7 B;  5F1J A;  3OYM A;  3LSJ A;  4RB2 C;  1HKQ A;  1FEX A;  3CCL I;  2HEO A;  2CUE A;  4G94 A;  1ZRE A;  5IP7 J;  4HX4 A;  3HDD A;  2L54 A;  2DJI A;  2JSP A;  3EUA A;  1EV7 A;  4OIN F;  2MH2 A;  2BY2 A;  1BW6 A;  2P6T A;  4N9I A;  2B0L A;  2HYG D;  4D0P A;  3ZGK A;  1IV6 A;  2RKH A;  2D1H A;  2ZJQ F;  1X1P A;  3MCZ A;  4M9X A;  3SZT A;  1K79 A;  2DYS H;  4S04 A;  2VKE A;  4UVC A;  2QA4 I;  2H1L A;  2XGX A;  4L5E A;  1J5Y A;  4L9J A;  4I01 A;  1UZC A;  1ETW A;  4ENJ A;  4L0Z B;  1K6Y A;  1BJA A;  2DW4 A;  3OYH A;  3FBI B;  5E20 A;  4Y3O A;  3HRU A;  5FFX A;  1IF1 A;  1XMA A;  2QSG X;  4HX8 A;  5FLM J;  1SD4 A;  4Q48 A;  3G73 A;  3R0A A;  2ZCW A;  5D8L B;  3ZXS A;  1RR7 A;  4G7Z F;  5TRD A;  1SFU A;  2K4B A;  4UB8 C;  4E70 A;  1P7I A;  2ICW G;  1D0X A;  2WAE A;  3MKL A;  2K40 A;  1IC8 A;  3U9G A;  3F0C A;  2Q2E B;  2W48 A;  4EJO A;  2FE3 A;  3QYB A;  2HNH A;  2ECB A;  2CJJ A;  3CZ6 A;  3PIP F;  1MNM C;  4LFU A;  3HOV J;  4EVI A;  2CMP A;  3EUH C;  1O7L A;  4P96 A;  3REO A;  1XG1 A;  1GLN A;  1OYW A;  3RJP A;  4BDY A;  1JXS A;  3A03 A;  2LH9 A;  1I6H J;  5D6E A;  1VQ9 I;  1Q1H A;  4NHJ A;  4HSR A;  1FZP B;  1FX7 A;  3R4K A;  2JUG A;  3DLA A;  5BQT A;  3J7Z I;  3OYD A;  1ZRD A;  4BYY A;  5L3F A;  4H0E A;  1WCM J;  3H5N A;  2K7L A;  5ICE A;  2HS5 A;  3OR2 C;  1MH4 A;  2CYY A;  1X1B A;  1P9Q C;  3JSO A;  3RCO A;  2DPD A;  3AL0 C;  3IH2 A;  5DS9 A;  1Z05 A;  3CUQ C;  3ZQQ A;  1BI1 A;  3HYI A;  4EAT A;  2DFI A;  1XN7 A;  3JTH A;  4OWR B;  5E3N A;  3OS1 A;  1YFH A;  1BL0 A;  3V8J A;  3TL4 X;  1Z77 A;  2LSO A;  3S8P A;  3AL0 B;  3BDD A;  2VI6 A;  1J0R A;  5E79 C;  3KP3 A;  3RKY A;  4IOA F;  2LKX A;  5JVT A;  3LA2 A;  3ZQC A;  1WJC A;  4W1U A;  1O3T A;  1SVL A;  1LDD A;  1MMA A;  3C7J A;  2ZFW A;  4XSZ F;  3IKT A;  1B72 B;  3O6B B;  1Y39 A;  1RKW A;  3Q9V A;  3T8R A;  2BY1 A;  4XQF A;  3S2D J;  1UFM A;  3WHB A;  4F7Z A;  1RRJ A;  4UY8 I;  1YOV B;  2E36 A;  5J8C A;  2JRT A;  2KDZ A;  4EV0 A;  3QPT A;  2IAI A;  1D1C A;  1FWZ A;  5E1X A;  4AIH A;  5K5R A;  1FYM A;  2KJB A;  2O8X A;  2VXD A;  5M5W J;  5LEJ A;  1KQ9 A;  4DBR A;  2EZI A;  2ZB9 A;  2XSD C;  1LFP A;  2XAF A;  5IP9 J;  4XRS G;  3QOP A;  4Z2Y A;  1KU3 A;  3BTJ A;  3P9C A;  1MMN A;  2IGM A;  2FML A;  2MSY A;  2VB6 A;  3QP5 A;  5D5W B;  4WX9 A;  1D5V A;  3HL2 A;  1D8J A;  2KKO A;  3E7L A;  3DU5 A;  2R5Z B;  4PSW A;  2OCC H;  2XKO A;  1YRN B;  1JUS A;  5M5Y J;  4AD9 A;  2RN7 A;  5CKT A;  5BOX A;  4ENM A;  2RDP A;  5L3D A;  3VYR B;  3DXJ F;  3BZC A;  1LNW A;  2BGC A;  3LAJ A;  4ZYD A;  1NK2 P;  4C2M J;  3HUG B;  3GZN B;  2LOO A;  4UV9 A;  1MIJ A;  3KPH A;  4JBA A;  1E3O C;  4LK0 F;  3K9T A;  4XL9 A;  5D5U B;  2EZL A;  3OV8 A;  2PMZ N;  1Y1W J;  2HWV A;  2R7V A;  1UJ8 A;  3K10 A;  3OYE A;  4YFK F;  4YIR X;  3WTS C;  5F27 A;  3BQZ A;  5M3F J;  4IRI A;  2O03 A;  4E7I A;  3A01 A;  4YEJ A;  3BJ6 A;  4BU2 A;  4HLX A;  1G3T A;  3OIO A;  4WXC A;  3LSP A;  5ICC A;  5DM6 F;  1AU7 A;  3CCM I;  1LEB A;  1FP2 A;  4O3M A;  1MJB A;  5J1Y A;  1TWH J;  2QQB A;  4UV8 A;  3V4G A;  4BNC A;  2VLA A;  5K1Y A;  4O6J A;  1F5T A;  3NWS A;  4DGW B;  2YS9 A;  3FIS A;  3TKY A;  3I9V 2;  1V5G A;  4B8X A;  5IYC J;  1BW5 A;  2L9V A;  4DZJ A;  1BC8 C;  2IS2 A;  2BEO A;  4U87 A;  1XX5 A;  5HS8 A;  1YQA A;  2EV5 A;  2HKX A;  1YO5 C;  1DDN A;  1XB4 A;  1OCO H;  2GA2 A;  4ZTJ A;  2ACJ A;  1X4P A;  1ZGW A;  3RI4 A;  2XB0 X;  1ZG5 A;  3S3M A;  1A31 A;  5H6Q A;  5K7Z A;  1Y0U A;  2V1N A;  1ZHF A;  1RI7 A;  2LYC A;  2YUS A;  3GTM J;  1R58 A;  3W2A A;  4B47 A;  3SYT A;  2X6Y A;  2EB7 A;  4J19 A;  1HC8 A;  3K1N A;  4A3J J;  3I59 B;  2A07 F;  4IPA A;  2ESN A;  3WG7 H;  2OTJ I;  4HOB A;  5E1Z B;  2G0E A;  2V1U A;  1TWG J;  3QPS A;  1WPK A;  1XSV A;  2W85 A;  3IWZ A;  4ZDL A;  2A6E F;  2XV4 S;  1JHF A;  2Z5U A;  3WOD F;  4BJT A;  2P5L C;  3KIO A;  2CUJ A;  1K6O A;  1MGT A;  2OBP A;  3LQQ A;  4EMS A;  2CUZ A;  3ABU A;  4P9U A;  3GTJ J;  2DTR A;  4Q47 A;  2M9H A;  4LGW A;  2R7Q A;  3BTI A;  3LAP A;  1NG7 A;  4EEF G;  2LF7 A;  4L9V A;  3JW4 A;  5HLH A;  1B9N A;  2QKM B;  3K4C A;  2LRD A;  1Z0X A;  3S14 J;  3E6C C;  1ZLJ A;  4ETS A;  3CMA I;  3OMY A;  5EG0 A;  2PJR B;  4HV6 A;  4F92 B;  2DJN A;  4A69 C;  3HXL A;  5C3E J;  2DFF A;  3GTP J;  2M8G X;  3MKW B;  1TBX A;  2GXB A;  2VQC A;  2BXY A;  3SFZ A;  5J8F A;  3UR3 C;  2R7S A;  1AWC A;  4BE1 A;  3OOP A;  1JGG A;  3O3K A;  2KPM A;  3GLL A;  3AKZ A;  1TW2 A;  2EV6 A;  3SEQ A;  2COM A;  4C3J J;  2KMU A;  4L9T A;  4N4O B;  4F52 A;  3D1N I;  1I6X A;  3KX2 A;  4ZZD A;  2DDB A;  3ABM H;  2IA1 A;  1Z7U A;  1F9N A;  2K9S A;  5IT9 Z;  1W5T A;  2DFE A;  1HF0 A;  2DXI A;  5E17 F;  1G3Y A;  2R7Z J;  3PJR A;  1CQT A;  1WH7 A;  2VKH A;  3K1P A;  2VAS A;  2L01 A;  5IY5 H;  2E1N A;  3BR2 A;  3CCY A;  3DPL C;  3LA7 A;  2VBZ A;  1AOY A;  4XKW A;  3GZ5 A;  1FSE A;  5ILV A;  1ZKG A;  2CH0 A;  2RGV A;  1SD5 A;  3DQV C;  2CFX A;  2MAB A;  3EUK L;  4CZZ A;  4LD5 A;  2DMN A;  3F8C A;  2GBY A;  1B8I B;  2FOK A;  5E3O A;  5EZH A;  3JAM Z;  2G7U A;  2OF7 A;  2V1X A;  3BJA A;  4AWX B;  2JWT A;  3QPL A;  4A2U A;  3OR1 C;  3NAU A;  3QYF A;  1TT0 A;  4RGU A;  3RTR A;  5K5Q A;  2DA4 A;  1YJW I;  3GYH X;  1ETX A;  3LA3 A;  1NTC A;  3GX4 X;  4MIM A;  2MFZ A;  4Z6Y A;  1TLH B;  2PJP A;  1Z67 A;  1OFC X;  1IDZ A;  2EFN A;  3F22 A;  4KUM A;  3E1S A;  3OYK A;  3BG7 A;  2JA8 J;  4HG2 A;  3GW2 A;  3HRT A;  4PFO A;  5LHG A;  1ORK A;  4ENN A;  2QWW A;  1IGN A;  2HYJ A;  1GDT A;  1GHC A;  4GFB A;  2HR3 A;  2GOM A;  1F36 A;  4IKF A;  4KIG A;  3JRG A;  3QU3 A;  2CQ7 A;  2E60 A;  2NYX A;  2CS3 A;  4U7D A;  3FX3 A;  1FBQ A;  2WA0 A;  1QU3 A;  1ZK8 A;  5D4R A;  2K27 A;  2EA2 A;  3MMY B;  1ZLK A;  2HZD A;  2J5P A;  5DEQ A;  4G6Q A;  1HW1 A;  2ZSI B;  4LOC A;  2OUM A;  5CVU A;  2MA3 A;  3TBI A;  1ZG1 A;  3VWB A;  2XRO A;  1Z21 A;  4IHT A;  4LLL A;  1I1G A;  4KT6 A;  2X9D A;  1WI9 A;  2R7F A;  2DOA A;  2ZME A;  3H3U A;  3DCF A;  4AUX A;  4PJL A;  2KP6 A;  3RKQ A;  3A2K A;  2Z9O A;  2L4M A;  1MJ9 A;  2HDD A;  1U78 A;  4FAS D;  5AIQ A;  1W36 D;  2D1V A;  4GGG A;  4I2O A;  4XKV A;  4A0Z A;  1JUM A;  4M3D A;  4DW6 A;  2A05 A;  4C2T A;  3OOU A;  2E2H J;  1DPR A;  2MH9 A;  3GWZ A;  3ZQ7 A;  3W2V A;  2XAU A;  5DCM A;  4XM3 A;  4E6K G;  4ESF A;  1K61 A;  1SEU A;  3GUD A;  4RGS A;  1JT0 A;  2XRL A;  4F91 B;  2ZO4 A;  5HNH A;  1RZ4 A;  4GYI A;  4XLF A;  3M8F A;  3FXU A;  2L4A A;  2K5C A;  4ZC3 A;  4DIQ A;  2P6S A;  3CCS I;  2DK8 A;  3OYJ A;  4NQW B;  2DQR A;  2ADU A;  3CTA A;  1DP3 A;  1XTA A;  4M3E A;  3IV5 A;  1R1T A;  2XRN A;  4I6Z A;  4I09 A;  2K3P A;  3GEZ A;  4XLP F;  2MYS A;  5D4S A;  3LWF A;  2L7Z A;  1WVR A;  2EIJ H;  3HPH A;  2HU9 A;  4MQ9 F;  3QRF F;  4V2F A;  3RIR A;  5DCM B;  3BRO A;  3FBN B;  5FKK A;  3H92 A;  2DA2 A;  1FC3 A;  2VE8 A;  2LKP A;  2GIV A;  5EZG A;  4PJN A;  2X85 A;  4NQW A;  4XLH A;  2O0Y A;  2A3S A;  1ZN2 A;  3BP8 A;  2OD5 A;  3BJO A;  5GPA A;  5C4J J;  2M8E A;  2IPQ X;  3KP5 A;  1XGM A;  3I53 A;  1W1W E;  2KHM A;  3U1D A;  1BR1 A;  3W6K B;  3DLL F;  4MLO A;  5DTD A;  3CJR B;  3ZPL A;  2GA1 A;  3COA C;  1XMK A;  3K4L A;  2R7O A;  4KN7 X;  2W00 A;  1Z9C A;  1HA8 A;  1Y0N A;  1YS7 A;  2M34 A;  3K6G A;  3TP3 A;  2KIM A;  1J75 A;  3DBR B;  2PMH A;  2IGK A;  4L5I A;  4IJA A;  4A3L J;  2OPT A;  1IRX A;  1FMW A;  4M3G A;  3GZ6 A;  1YIT I;  3TO6 A;  3DTI A;  2JSC A;  2VJ5 A;  2DI3 A;  4XOR A;  5B3S H;  3I4P A;  3DKX A;  1POG A;  2IVM A;  4DYR A;  4A3C J;  2LDU A;  4IEJ A;  3WTX C;  4RLF A;  2VUM J;  3L9F A;  4DYC A;  2BZT A;  5K7F A;  2VXZ A;  1ZYR F;  2XF7 A;  1WJ5 A;  2GXA A;  2Y75 A;  2DN0 A;  4M6X A;  3IAS 2;  2LD5 A;  2WAD A;  2NXN B;  4MFE A;  2UWM A;  2CV1 A;  2KZV A;  1JKQ C;  2A6T A;  3FKI J;  2FSW A;  1XGS A;  1BOA A;  1I50 J;  5CQG A;  2P4W A;  1T98 A;  1WHU A;  4M73 A;  3ZMD A;  3CLQ A;  2VQH A;  4GRI A;  3GCM A;  3R60 A;  3TQN A;  3DBH B;  5BMZ A;  4BJ5 C;  1Z6R A;  3KE2 A;  1S7E A;  1G8X A;  2EBI A;  1DQU A;  1E2X A;  3L09 A;  5EJC A;  2QZ8 A;  4UNO A;  4CYD A;  5F04 A;  3QU6 A;  4I02 A;  3FK6 A;  2AXL A;  2H94 A;  1QPM A;  5EGO A;  4B1R A;  1O4X A;  2OA4 A;  1GUU A;  2L7K A;  3ECO A;  3SDG A;  4ESJ A;  4PJJ A;  4C2U A;  1YLF A;  3NEU A;  1E0E A;  4J01 A;  3FIW A;  3W6V A;  2ZC2 A;  3C1D A;  3H0G J;  3KLO A;  5FGM A;  3JR9 A;  1R7J A;  2EFP A;  2FJ1 A;  1U9N A;  3J7A Y;  4AYB N;  1UST A;  4PK4 A;  4CCN A;  5L3E A;  4IQ4 A;  2JQ7 A;  1QHH D;  1RR8 C;  1R36 A;  2ME0 A;  2L9R A;  2TRT A;  3PL8 A;  2DA6 A;  4XMY A;  2LY2 A;  3S1M J;  4D9J A;  3PO3 J;  1FTT A;  2PEX A;  3BWG A;  2X4H A;  4GYG A;  3PUF A;  5LHI A;  1LDJ A;  3Q0U A;  4UVA A;  5FRO A;  3S15 J;  3HB9 A;  5LLQ A;  1AA7 A;  4G6D A;  2NVQ J;  1ETK A;  5HS7 A;  5B1B H;  2NNN A;  3GTO J;  2L02 A;  2O7O A;  1HW2 A;  4OAZ A;  4IHS A;  1OLT A;  3DKY A;  3CCQ I;  1R71 A;  1N25 A;  2DT5 A;  4L18 B;  3HRM A;  3KYC B;  1RES A;  4M6V A;  3E5X A;  2CQQ A;  3OYG A;  2HVQ A;  4B3X A;  2OU2 A;  3F23 A;  4WCG A;  3GBG A;  3HSF A;  2QF7 A;  1S9H A;  2EFQ A;  2ZFU A;  1GT0 C;  3DWL E;  5TGT A;  2IA2 A;  4EJT A;  3PIO F;  4C9Y A;  4OIP F;  2DBB A;  3OS0 A;  3QPH A;  3ZR8 X;  3L2C A;  3FMQ A;  4LIT A;  1QA6 A;  2E1M C;  2QQ8 A;  3DV8 A;  3SFI A;  2R7R A;  4X6A J;  4D5F A;  3CO6 C;  1ETQ A;  1J09 A;  2F5F A; 
#chains in the Genus database with same CATH homology
 1PP7 U;  3J80 K;  5HS9 A;  1YW7 A;  2JPC A;  1B1B A;  3WGG A;  2RC4 A;  1Z6T A;  5L3B A;  2ZJ2 A;  1SFX A;  4Q5S F;  4A5N A;  3O2P E;  4EJU A;  1MKM A;  3WU0 A;  1JHH A;  3FZV A;  2P5V A;  2STT A;  2M5W A;  3CDH A;  2M30 A;  3MFK A;  1CGP A;  4Q4Z F;  4HAM A;  3WTZ A;  3BY6 A;  2YX4 A;  2JPB A;  2IW5 A;  2K4J A;  4M72 A;  4CIC A;  2HQR A;  5E1W A;  4LG0 B;  4R79 A;  1SAX A;  1R00 A;  2TDX A;  1HKT A;  4KT5 C;  3KEO A;  1SD7 A;  4HBL A;  4UXN A;  2E1C A;  1ZRF A;  4M71 A;  2HFH A;  5LEK A;  1RNL A;  3NRV A;  2O3F A;  4HDV A;  1ODD A;  3BZ6 A;  3C18 A;  2PBI A;  3GFM A;  3MWM A;  3GXO A;  3F6O A;  3F8M A;  2VBW A;  2IA0 A;  1U5T C;  4HA8 A;  2CGP A;  1UHM A;  4WXD A;  3T5X A;  4LB6 B;  4OU0 A;  2FBH A;  4HZF A;  1UCR A;  4Y15 A;  5FLX Z;  3ELK A;  5ICF A;  3R0J A;  1P4A A;  1WKM A;  2FMY A;  4EGZ A;  4UHT A;  1K7A A;  3PFI A;  4PCQ A;  1YW9 A;  1STZ A;  4QLC U;  3WTT C;  4LLN A;  3L7W A;  1O3R A;  3WTY C;  2W57 A;  1ZRC A;  5HVQ C;  2QQ9 A;  3WTV C;  3HOS A;  2IT0 A;  3IRR A;  5DCF A;  3KFW X;  3IRQ A;  2M45 A;  5DUK A;  3BOQ A;  2H27 A;  5ILU A;  4FX4 A;  1MDM A;  5DD8 A;  2E7X A;  4MEX F;  2NAZ A;  2PQ8 A;  5E8I A;  4YII A;  3DFG A;  2DLL A;  3R61 A;  2F5E A;  1ZAO A;  4FT8 A;  1U5T A;  4RAY A;  5D6F A;  1TNT A;  1YG2 A;  2MD5 A;  1J9I A;  3ECH A;  3ULQ B;  4BHC A;  3M9A A;  1TQP A;  4A0Y A;  3RYP A;  3J81 K;  1B4A A;  2A61 A;  3KET A;  1PDN C;  3FM3 A;  1HQC A;  1MDM B;  3MZY A;  2ZNZ A;  4NB5 A;  4OMZ A;  4OIO F;  2KIF A;  4ASN A;  2WV0 A;  2OZU A;  1FPQ A;  4G9Y A;  2O6G E;  1FP1 D;  3ZP5 A;  3E97 A;  3CLO A;  3TDZ C;  3MEX A;  1S7A A;  4EM0 B;  1FBS A;  3J7A O;  1BBY A;  1ULY A;  1I5Z A;  2V6C A;  1KYZ A;  2PFB A;  3WE2 A;  2ZME B;  5D5V B;  3GVA A;  4XRF A;  3ZMS A;  3Q5F A;  5FLX K;  5DYM A;  1U5T B;  2CSO A;  2XAS A;  3K0L A;  2KRF A;  4HYE A;  2JZY A;  3SQN A;  5LHH A;  1SFE A;  4S05 A;  4DQ2 A;  2UXN A;  3KZZ A;  3WE3 A;  4HQM A;  4TV7 A;  1P6R A;  1EH6 A;  3Q9S A;  3MAJ A;  1OR7 A;  4I0B A;  1MD0 A;  3HUG A;  4ZZL A;  5F64 A;  2PN6 A;  4MGR A;  3GO5 A;  3ZMZ A;  5CYV A;  4KA4 A;  4KN4 X;  4KIF A;  1T39 A;  2NNY A;  2IRF G;  2ETH A;  2EFO A;  2XUB A;  2FQ3 A;  1SMT A;  5J6X A;  4KDP A;  1BN5 A;  3FWE A;  4CHU A;  2OQR A;  4FX0 A;  5L3C A;  2QUF A;  1BIA A;  3RPQ A;  2WC2 A;  3C3W A;  1S3J A;  4JQF A;  1OYI A;  3IHU A;  1HW5 A;  3RKW A;  3JTG A;  1DP7 P;  2H6C A;  4M9S A;  3ZMV A;  4YG2 F;  1YYV A;  1OMI A;  2ELH A;  3PQK A;  3BPV A;  2EK5 A;  1LEA A;  1G4D A;  3ZN0 A;  1R1U A;  3T8T A;  2ZXJ A;  4BXU A;  3EQL F;  3FXR A;  1R23 A;  1DPU A;  1GVJ A;  2FBI A;  1LJ9 A;  2JT1 A;  1U2W A;  1XGN A;  1XD7 A;  2XAJ A;  2L3D A;  3KP2 A;  3HOT A;  1XCV A;  1IRF A;  5BPD A;  2UZK A;  1T2K A;  3U2R A;  5LGU A;  2HTS A;  2VC0 A;  2H6B A;  3VEP A;  4ENK A;  2GQQ A;  3LQR A;  4DNC A;  2PI0 A;  2GXG A;  2PLY A;  4UUV A;  1WQ2 A;  2P5K A;  2VBY A;  1XSD A;  2VON A;  3I0T A;  3N4M A;  1FSH A;  1T0F A;  4OMY A;  3KP7 A;  2A68 F;  3E5Q A;  1QGP A;  4M74 A;  1YW8 A;  4B09 A;  4HF1 A;  3VOD A;  3N97 A;  2FNA A;  2NRA C;  3I5U A;  4L0Y B;  3I64 A;  3V7R A;  3TO7 A;  4A0X A;  2Z99 A;  1TQI A;  2RVC A;  3ISP A;  4PGG A;  5CVR A;  3FXQ A;  2ISZ A;  3HSR A;  1IZ1 A;  1KA8 A;  3IL2 A;  1RIO H;  3E6M A;  2VT2 A;  3TDU C;  4ESB A;  2A6H F;  2Y0M A;  2O61 A;  2YR2 A;  2K02 A;  1ZAR A;  4AIK A;  3HIF A;  4RS8 A;  5ILS A;  3IWF A;  5FD6 A;  2G7H A;  4BHP A;  3G3Z A;  1ZH5 A;  3ABT A;  4A6D A;  1SD6 A;  3TO9 A;  2J5O A;  1WSU A;  4RB0 A;  4LG0 A;  1IRG A;  1TQM A;  4KMF A;  3M8E A;  3KP6 A;  4Y17 A;  1BI0 A;  1R5H A;  4OIR F;  2MLG A;  4P5O A;  2MBF A;  3E6D A;  2DAO A;  4EM2 A;  2HGC A;  2DPU A;  3I59 A;  3DKW A;  3JAM K;  2QYO A;  3ZN1 A;  3J81 Z;  4BH9 A;  1TW3 A;  3QP6 A;  1KQ0 A;  1R1V A;  4A5M A;  3VFZ A;  2K86 A;  1QZY A;  3DP7 A;  3DEU A;  5CVI A;  1KGS A;  1LB2 A;  1HST A;  4LK1 F;  3F72 A;  2FA5 A;  4EQQ A;  1V4R A;  4WK8 F;  1F4K A;  2DK5 A;  4R1H A;  4HLY A;  5LRR A;  1G6N A;  2IP2 A;  3E6B A;  4GXO A;  3J80 Z;  5TJJ A;  2DQL A;  2W84 A;  1QNT A;  1QO0 D;  1PP8 F;  5D5X B;  1EH8 A;  3V8L A;  2ZNY A;  3TOA A;  5CVJ A;  1FYK A;  2XKP A;  1W5S A;  3AAF A;  5HOO A;  2VN2 A;  5JI6 A;  1G3S A;  2YX7 A;  3F6V A;  3KLN A;  3M7G A;  2R3S A;  3P7N A;  4YFN F;  3F8N A;  3WTW C;  4OIQ F;  3GF2 A;  3MQ0 A;  3T0Y A;  1IXC A;  5D8K B;  2ZBK A;  1P2F A;  2HOE A;  5JR3 A;  2OQG A;  4XLN F;  1IN5 A;  1LDK B;  2FNP A;  2CWE A;  3K69 A;  2Q0O A;  2D45 A;  1QZZ A;  2P8T A;  3GFI A;  5IT9 K;  4CDG A;  2VE9 A;  2VBX A;  2QM3 A;  5CLS A;  4U88 A;  3FMR A;  1OYY A;  4PGH A;  2JTV A;  5H20 A;  3ROU A;  1I27 A;  5K5O A;  2YPR A;  3PQJ A;  5IT3 A;  1NHA A;  3JSP A;  3T1B A;  4RGX A;  6PAX A;  4BHB A;  4RB3 C;  1A04 A;  2F2E A;  2KIU A;  4RAZ A;  2CQK A;  3V7S A;  4LJZ F;  4RB1 A;  1B9M A;  2VOO A;  2QVO A;  3D0S A;  1KQ8 A;  3I54 A;  3ZMU A;  1REP C;  2WTE A;  3S2W A;  4G8X A;  1H9G A;  5DUI A;  3MZH A;  4Y13 A;  5AON A;  4G7O F;  2LNB A;  1IN6 A;  2BE5 F;  1HSJ A;  1KU7 A;  5HLG A;  2PMU A;  1JGS A;  1U3E M;  4O5V A;  1RUN A;  2XIG A;  4M9Z A;  1J2X A;  2EFW A;  2D2W A;  1L3L A;  3P9K A;  2MLK A;  5CVV A;  3WGH A;  4RGR A;  3HRS A;  1F1Z A;  1FT9 A;  4I98 B;  1LVA A;  3V7C A;  2EV0 A;  4UVB A;  5ICG A;  4LMY A;  5AIP A;  5F1R A;  1S7O A;  3RDI A;  1W4M A;  3E5U A;  3BPX A;  4EJV A;  2HKO A;  1J59 A;  1BI3 A;  5BPI A;  2AS5 F;  2KJC A;  1O3S A;  4M6Y A;  1BI2 A;  1O3Q A;  2P7V B;  2CW0 F;  4G7H F;  5DDG A;  4YFX F;  4U7B A;  1FLI A;  4IXA A;  2Q8K A;  2XVC A;  3SXY A;  2LF8 A;  3VB2 A;  1T38 A;  2FBK A;  3K1M A;  1P4W A;  1H0M A;  2XAH A;  1XDU A;  3KP4 A;  1OPC A;  3WTU C;  4HDU A;  3E3V A;  3L00 A;  4KIC A;  4GCV A;  2HYF A;  4BAY A;  2STW A;  1YS6 A;  3KEQ A;  3TGN A;  1RUO A;  2XAQ A;  2Y48 A;  2HZT A;  4KNY A;  1Z91 A;  3NQO A;  1I1S A;  1PUE E;  3W6J B;  1IXR C;  2A5Y B;  1IW7 F;  4U0Y A;  4A6E A;  1HXD A;  5LGN A;  2W24 A;  3F21 A;  4I0A A;  4LB5 A;  4MNU A;  3FM5 A;  1FBU A;  3P9I A;  1WRJ A;  4FHT A;  2VT3 A;  5KVR A;  4BQA A;  2EA4 A;  2H09 A;  2FF4 A;  5HDN A;  3CJN A;  3F3X A;  4K2E A;  2RNJ A;  3HHG A;  4ZYG A;  3K2Z A;  3FF5 A;  4HF2 A;  2EWN A;  1T6S A;  4AVP A;  4HF0 A;  5HLI A;  4U0V A;  2BYV E;  3GLX A;  2V9V A;  4CGZ A;  3EDP A;  3CUO A;  2VOP A;  2DO7 A;  3WGI A;  4XSX F;  1XSX A;  2GAU A;  3EYY A;  4U0W A;  3R6S A;  2QBY B;  1D8K A;  1ON1 A;  3DF8 A;  3EUH A;  4JK1 X;  5F6F A;  3ML6 A;  2RV8 A;  1V3F A;  1VTN C;  1W7P A;  4EJW A;  1USS A;  4KMU X;  5BS6 A;  1DUX C;  4OOI A;  3FMS A;  2Z33 A;  2P7C B;  2VOD A;  3LST A;  4WWC A;  3KZY A;  4KFC A;  3KCC A;  3HTU A;  3CUQ A;  2W25 A;  2HQN A;  1WWX A;  1FOK A;  1E17 A;  3B02 A;  3HHH A;  1KU9 A;  2OZ6 A;  4WF2 A;  1YIO A;  3F8F A;  3B73 A;  5CJ9 A;  1OKR A;  1BM9 A;  5A2Q Z;  1S29 A;  5DV5 A;  5A2Q K;  2QEN A;  1MJA A;  2BBY A;  5FB2 A;  1LQ1 A;  1R5G A;  4A12 A;  4KIB A;  5ED4 A;  4N9H A;  5DD4 A;  2FRH A;  1ZGJ A;  3WG9 A;  5FD5 A;  1K78 A;  5HDG A;  3ERE D;  3HTS B;  1X3U A;  1BIB A;  4CXF A;  5JFR A;  3WU1 B;  3QAH A;  2QQA A;  3GFL A;  4HX7 A;  2IJL A;  3D5L A;  1U8R A;  1W7P D;  1GXQ A;  4L5J A;  3FHZ A;  3SZP A;  1C0W A;  1CF7 A;  1B59 A;  4MQV A;  2CO5 A;  4IVN A;  2DU9 A;  1J7K A;  3RYR A;  5FFZ A;  3IC7 A;  4ZH4 F;  1D3Y A;  4WXH A;  1ONV A;  2XHK A;  4IF4 A;  4IRH A;  1IN8 A;  5KK1 A;  1QBJ A;  2FU4 A;  3TOB A;  4P9F A;  5EEG A;  2R7D A;  4LLG F;  4N0B A;  3ZMT A;  1IUY A;  2YU3 A;  4QWQ A;  1IN4 A;  3GFJ A;  4CO8 A;  3RKX A;  1QQI A;  1H9T A;  1W7P B;  1IN7 A;  2HDC A;  2RQP A;  1FY7 A;  1UHW A;  3VOE A;  4GO1 A;  3LFK A;  2GWR A;  1YTY A;  3M1E A;  3CO7 C;  4AIJ A;  1UB9 A;  2EJR A;  2F5C A;  4PDK A;  1O57 A;  2Z3Y A;  1U6G A;  4L9N A;  2CG4 A;  2GZW A;  3RPU A;  5E18 F;  1XCB A;  4MHG A;  4MTE A;  2XAG A;  3V8K A;  2Q2E A;  4P55 A;  4MTD A;  2QBY A;  2ESH A;  1XGO A;  2A69 F;  1ZGA A;  2UXX A;  1TNS A;  2OAZ A;  5H6R A;  2E7W A;  2G9W A;  1S6L A;  4EGY A;  4I7H A;  2MC3 A;  4KYW A;  4HW0 A;  2HTJ A;  1B6A A;  1ZG3 A;  2WWY A;  2FXA A;  2ISY A;  2YSR A;  4YIF A;  5FO5 A;  5ERI A;  2M1B A;  1JE8 A;  5LRS A;  3HSE A;  5L3G A;  3F8B A;  4PZJ A;  3SHF A;  2QLZ A;  1K78 B;  1IXS B;  1ON2 A;  4HV5 A;  4ZYE A;  4IRG A;  2FEZ A;  5JHU A;  2NS0 A;  2ZKZ A;  1GXP A;  1MZB A;  1BC7 C;  2C6Y A;  3EET A;  1HBX G;  4MEY F;  1Z1D A;  2F5D A;  3I71 A;  1S8N A;  4ON0 A;  2PG4 A;  1SMY F;  1FYL A;  3H3Z A;  5E8G A;  2X0L A;  1KU2 A;  5LBQ A;  5EEH A;  3CUQ B;  1P92 A;  1KYW A;  2VC1 A;  4HQE A;  1R22 A;  4R8H A;  1G3W A;  3I58 A;  1O7F A;  4ZYH A;  1IAW A;  2V79 A;  1TTY A;  3IKV A;  1XDS A;  4EM1 A;  2BV6 A;  2V1D A;  2M87 A;  1FNN A;  4XBF A;  5HDK A;  5LGT A;  3EYI A;  3DPT A;  1L0O C;  1EH7 A;  1P4X A;  1HKS A;  1CF7 B;  4RB2 C;  1HKQ A;  2HEO A;  4G94 A;  1ZRE A;  4HX4 A;  2L54 A;  1EV7 A;  4OIN F;  2MH2 A;  2P6T A;  4N9I A;  2B0L A;  2HYG D;  4D0P A;  2RKH A;  2D1H A;  3MCZ A;  4M9X A;  3SZT A;  1K79 A;  4S04 A;  4UVC A;  2XGX A;  1J5Y A;  4L9J A;  4I01 A;  4ENJ A;  4L0Z B;  1BJA A;  2DW4 A;  5E20 A;  3HRU A;  5FFX A;  1IF1 A;  1XMA A;  4HX8 A;  1SD4 A;  4Q48 A;  3G73 A;  3R0A A;  2ZCW A;  5D8L B;  4G7Z F;  5TRD A;  1SFU A;  2K4B A;  4E70 A;  3U9G A;  4EJO A;  2FE3 A;  4LFU A;  4EVI A;  4P96 A;  1O7L A;  3REO A;  1OYW A;  3RJP A;  1JXS A;  5D6E A;  1Q1H A;  4NHJ A;  1FZP B;  1FX7 A;  3R4K A;  5BQT A;  1ZRD A;  4BYY A;  5L3F A;  4H0E A;  2K7L A;  5ICE A;  2HS5 A;  2CYY A;  3JSO A;  2DPD A;  1Z05 A;  3CUQ C;  1BI1 A;  3HYI A;  2DFI A;  1XN7 A;  3JTH A;  1YFH A;  3V8J A;  2LSO A;  3BDD A;  1J0R A;  3KP3 A;  3RKY A;  5JVT A;  3LA2 A;  1O3T A;  1LDD A;  4XSZ F;  3C7J A;  2ZFW A;  3IKT A;  3O6B B;  3Q9V A;  3T8R A;  1UFM A;  4F7Z A;  5J8C A;  2JRT A;  4EV0 A;  3QPT A;  1FWZ A;  5E1X A;  4AIH A;  5K5R A;  1FYM A;  2KJB A;  2O8X A;  5LEJ A;  1KQ9 A;  2XAF A;  3QOP A;  4Z2Y A;  1KU3 A;  3P9C A;  5D5W B;  2FML A;  3QP5 A;  4WX9 A;  1D8J A;  1D5V A;  2KKO A;  2XKO A;  4AD9 A;  2RN7 A;  5BOX A;  4ENM A;  2RDP A;  5L3D A;  3DXJ F;  1LNW A;  2BGC A;  3LAJ A;  4ZYD A;  4UV9 A;  4JBA A;  4LK0 F;  3K9T A;  5D5U B;  3OV8 A;  2HWV A;  4YFK F;  3WTS C;  4IRI A;  2O03 A;  3BJ6 A;  4HLX A;  1G3T A;  4WXC A;  5ICC A;  1LEB A;  1FP2 A;  4O3M A;  1MJB A;  2QQB A;  4BNC A;  4UV8 A;  3V4G A;  5K1Y A;  4O6J A;  1F5T A;  3TKY A;  4B8X A;  1BC8 C;  2BEO A;  5HS8 A;  1YQA A;  2EV5 A;  2HKX A;  1YO5 C;  1DDN A;  1XB4 A;  2GA2 A;  2ACJ A;  3RI4 A;  1ZG5 A;  5H6Q A;  1Y0U A;  1ZHF A;  1RI7 A;  1R58 A;  2EB7 A;  3K1N A;  3I59 B;  2A07 F;  4IPA A;  2ESN A;  4HOB A;  5E1Z B;  2V1U A;  3IWZ A;  1XSV A;  2W85 A;  2A6E F;  2XV4 S;  1JHF A;  2Z5U A;  3WOD F;  2P5L C;  1K6O A;  1MGT A;  2OBP A;  3LQQ A;  4EMS A;  4P9U A;  3ABU A;  2DTR A;  4Q47 A;  4LGW A;  3LAP A;  2LF7 A;  4L9V A;  3JW4 A;  5HLH A;  1B9N A;  3E6C C;  1ZLJ A;  4ETS A;  4HV6 A;  1TBX A;  2GXB A;  3SFZ A;  5J8F A;  1AWC A;  3OOP A;  3O3K A;  1TW2 A;  2EV6 A;  2COM A;  4L9T A;  1I6X A;  4ZZD A;  2IA1 A;  1Z7U A;  1F9N A;  5IT9 Z;  1W5T A;  5E17 F;  1G3Y A;  3K1P A;  2L01 A;  2E1N A;  3DPL C;  3LA7 A;  2VBZ A;  1AOY A;  5ILV A;  3GZ5 A;  1FSE A;  2RGV A;  1SD5 A;  3DQV C;  2CFX A;  4CZZ A;  4LD5 A;  3F8C A;  2FOK A;  3JAM Z;  2G7U A;  2V1X A;  3BJA A;  4AWX B;  4A2U A;  4RGU A;  5K5Q A;  3RTR A;  3GYH X;  3LA3 A;  3GX4 X;  1TLH B;  2PJP A;  2EFN A;  3F22 A;  4KUM A;  3GW2 A;  3HRT A;  5LHG A;  4ENN A;  2QWW A;  1GHC A;  2HR3 A;  4KIG A;  3QU3 A;  2NYX A;  4U7D A;  3FX3 A;  1FBQ A;  5D4R A;  2K27 A;  2EA2 A;  1ZLK A;  2J5P A;  5DEQ A;  4G6Q A;  1HW1 A;  5CVU A;  2MA3 A;  1ZG1 A;  2XRO A;  4IHT A;  4LLL A;  1I1G A;  1WI9 A;  2R7F A;  2ZME A;  3H3U A;  2Z9O A;  2L4M A;  1MJ9 A;  1U78 A;  5AIQ A;  2D1V A;  4GGG A;  4I2O A;  4A0Z A;  1DPR A;  2MH9 A;  3GWZ A;  3ZQ7 A;  5DCM A;  4ESF A;  3GUD A;  4RGS A;  2ZO4 A;  1RZ4 A;  4GYI A;  3M8F A;  3FXU A;  2L4A A;  2P6S A;  2DK8 A;  2DQR A;  2ADU A;  3CTA A;  1R1T A;  2XRN A;  4I09 A;  3GEZ A;  4XLP F;  5D4S A;  3LWF A;  4MQ9 F;  3QRF F;  3RIR A;  5DCM B;  3BRO A;  3H92 A;  1FC3 A;  2VE8 A;  2LKP A;  2GIV A;  4NQW A;  2O0Y A;  2A3S A;  1ZN2 A;  3BP8 A;  2OD5 A;  3BJO A;  2M8E A;  2IPQ X;  3KP5 A;  1XGM A;  3I53 A;  3U1D A;  3W6K B;  3ZPL A;  2GA1 A;  3COA C;  1XMK A;  4KN7 X;  1Z9C A;  1YS7 A;  2KIM A;  1J75 A;  2PMH A;  4L5I A;  4IJA A;  3GZ6 A;  3TO6 A;  2JSC A;  2DI3 A;  3I4P A;  2IVM A;  2LDU A;  3WTX C;  3L9F A;  2VXZ A;  1ZYR F;  2Y75 A;  4M6X A;  2UWM A;  2FSW A;  1XGS A;  1BOA A;  2P4W A;  1T98 A;  4M73 A;  3ZMD A;  3TQN A;  3R60 A;  5BMZ A;  1Z6R A;  3KE2 A;  1E2X A;  3L09 A;  2QZ8 A;  4UNO A;  4CYD A;  3QU6 A;  4I02 A;  2AXL A;  2H94 A;  1QPM A;  2OA4 A;  3ECO A;  4ESJ A;  1YLF A;  3NEU A;  3C1D A;  3KLO A;  5FGM A;  1R7J A;  2EFP A;  1UST A;  5L3E A;  1R36 A;  2PEX A;  3BWG A;  2X4H A;  4GYG A;  5LHI A;  1LDJ A;  4UVA A;  5LLQ A;  4G6D A;  5HS7 A;  2NNN A;  2L02 A;  1HW2 A;  4IHS A;  2DT5 A;  4L18 B;  3HRM A;  3E5X A;  3F23 A;  2OU2 A;  4WCG A;  3HSF A;  2EFQ A;  2IA2 A;  4EJT A;  4OIP F;  2DBB A;  3QPH A;  3L2C A;  3FMQ A;  3DV8 A;  3CO6 C;  2F5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...