1SD7A

Crystal structure of a semet derivative of meci at 2.65 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd7A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd7A02
3WTTC 3FZVA 3HIFA 2OZUA 3BOQA 4L9TA 4Q48A 4ON0A 5DD8A 2R7FA 2Y75A 4Z2YA 2GA1A 2E1CA 1R5GA 4GGGA 2X0LA 2JSCA 2LDUA 1B1BA 3QPTA 4CYDA 4LLGF 1XGOA 3RKWA 2ZNZA 2ADUA 5ICCA 1TQPA 2Z5UA 1YTYA 4M71A 3IC7A 2K4BA 3FX3A 1OYYA 4BYYA 2LKPA 3F22A 1SAXA 2GZWA 4CZZA 4HLXA 4UXNA 4YG2F 5DCMA 1BI3A 1U5TB 1ZREA 4EGYA 3FMQA 3KFWX 2LNBA 1T38A 1BIBA 3F8NA 1PDNC 4CICA 3RPQA 5DDGA 4JQFA 4L0ZB 4HQMA 3HSRA 1HSJA 2J5OA 2W24A 2VT3A 2A6HF 3I53A 1Z9CA 4KN4X 2XAFA 1TTYA 1PP7U 4KT5C 4G6DA 3C1DA 1XDUA 3JTGA 1PUEE 4HAMA 5D5WB 4L9VA 3P9CA 2IA0A 3WTSC 3PQKA 2HFHA 1ZG5A 5CJ9A 3GVAA 3F8MA 5JVTA 4EGZA 2XIGA 2E7XA 4UUVA 1T6SA 4M73A 1XGMA 3MCZA 5FFXA 4I2OA 4R8HA 5J6XA 4G7ZF 4KMUX 4L5JA 4HZFA 2Q0OA 3GX4X 2RNJA 4ZYEA 2PEXA 3I54A 1FBUA 2V6CA 3SXYA 5LGTA 4MEXF 2OA4A 3W6KB 5FFZA 4G7HF 2VE9A 2Y0MA 3GUDA 4WCGA 2OU2A 2W84A 3M8FA 4LK1F 5D6EA 4R1HA 3E5UA 3N4MA 4FHTA 5HS8A 2CGPA 1Z7UA 3RPUA 3NQOA 1G6NA 1EH7A 4AWXB 2D45A 4N9HA 2IT0A 2PLYA 1YW9A 1B9NA 1W5SA 3CO6C 1MGTA 1Z1DA 3BP8A 4G8XA 5LHIA 2AXLA 3FMRA 1P6RA 5J8FA 1MZBA 1ZN2A 1O3QA 1FBQA 5EEGA 1YW7A 3BWGA 3CLOA 4EM0B 1P4AA 2HGCA 3TGNA 3J80K 1SFEA 3LWFA 2H94A 1BM9A 4ESBA 3ZP5A 4YIFA 1BC7C 3DEUA 4O5VA 4A2UA 5K5OA 2P8TA 5A2QZ 2CQKA 2BV6A 2PMUA 4F7ZA 4IHSA 3WTWC 1FNNA 4XRFA 4YIIA 2E7WA 3TOBA 2GA2A 3GYHX 5F64A 5CVIA 5LLQA 4LG0B 3SQNA 2YX4A 5BQTA 3GXOA 2F5CA 2VN2A 2MD5A 1LDJA 3AAFA 5CVUA 4XSXF 3VFZA 2GXBA 3IWFA 2NAZA 1ZG3A 2DTRA 4QWQA 3ZMTA 2J5PA 1E17A 2ISYA 1FYKA 3LQQA 4UV8A 2CO5A 4BHPA 3L09A 2O8XA 5H6QA 3CTAA 1ULYA 2NNNA 1JHFA 4MNUA 5JI6A 1XD7A 4BNCA 2XGXA 3QAHA 2VOOA 3D0SA 3K1PA 2FSWA 5E8GA 1EV7A 3REOA 3ZN1A 2EV6A 2PQ8A 1LQ1A 4RGSA 1QZZA 1MDMB 3V7RA 3T5XA 1CGPA 4OIPF 3IL2A 1IUYA 2WTEA 4B09A 1IN8A 3J7AO 3Q5FA 3ISPA 4UVCA 3WE3A 1Q1HA 2FA5A 3E5XA 3I5UA 1HQCA 4G94A 3E5QA 1WQ2A 4D0PA 1GVJA 2P6SA 4BAYA 3ULQB 2ZFWA 3KEOA 4HDVA 3R61A 3ROUA 2K4JA 2HDCA 2CSOA 4XLPF 2MH2A 3ERED 1TNTA 2XROA 2NS0A 1XSVA 2DK8A 3R60A 2NRAC 4LFUA 1HW5A 1SD4A 1FX7A 2VODA 1W7PA 3DXJF 4IRIA 5ICGA 4CGZA 5H20A 2BBYA 4OMYA 1WI9A 1O57A 1SFXA 3FXQA 1LB2A 3DV8A 2YPRA 1RUOA 4L18B 4HF2A 1Z91A 4ESFA 2L02A 1USTA 4U7BA 2UZKA 2QZ8A 3F8CA 2OBPA 2L3DA 1KU7A 3U9GA 3L00A 4P5OA 4FX4A 4BH9A 1E2XA 2O0YA 5DD4A 4LLNA 2A3SA 3K1MA 1OYIA 1MJ9A 3HYIA 4WX9A 2MH9A 2FE3A 4ZZDA 2FBKA 2O3FA 2F5EA 1K78B 2L4MA 3BPXA 1G3SA 5D5XB 1B4AA 3OOPA 2DPDA 1STZA 4Y17A 4BHBA 1KU9A 5TJJA 2ETHA 2P5LC 4XBFA 4R79A 4EJUA 2DQLA 3OV8A 4BXUA 2F2EA 3F6OA 2WV0A 4MHGA 4RGXA 2Z3YA 1Z05A 1XMAA 2Q2EA 4OOIA 2P5VA 3KP5A 1PP8F 1ON1A 3RJPA 2CFXA 2AS5F 5DUKA 1WKMA 3C18A 1UCRA 2PBIA 2P4WA 1D5VA 3IRRA 2EV0A 1ZLJA 3GW2A 3KZYA 3KLOA 4P96A 5DYMA 1W7PD 2FNPA 2VC1A 3TKYA 3KP4A 3EDPA 3KZZA 2EJRA 4PZJA 2YSRA 1SFUA 3I64A 2DO7A 4PDKA 4A0ZA 4N0BA 1OR7A 1FBSA 1UHMA 2IVMA 3MEXA 2OZ6A 1FY7A 3HOTA 2RVCA 4E70A 4Q4ZF 4UNOA 4I09A 1X3UA 3F8BA 2XASA 2D2WA 3IWZA 4KDPA 1QO0D 4ENNA 4HQEA 3WODF 2BEOA 1ZHFA 4WXCA 5AIPA 2QLZA 3F3XA 5FGMA 3CUQC 3I58A 2ISZA 1R7JA 5AONA 5DCMB 2MBFA 4WWCA 2G7UA 2DI3A 4IRGA 1LVAA 3BJOA 3GEZA 1SD5A 3HTUA 1TNSA 2HEOA 3HRMA 3V7CA 3ZMVA 1L3LA 2A6EF 5LEJA 4GXOA 1TQMA 2FF4A 1W4MA 4CHUA 3CO7C 4WK8F 3LAJA 3IKVA 2QYOA 1S6LA 1IN7A 4I7HA 2YX7A 3L9FA 1K7AA 2ZKZA 5JFRA 1U2WA 2OAZA 1A04A 1XGNA 4LGWA 2QUFA 5D6FA 2A07F 1K79A 3S2WA 3V4GA 3ECHA 3DPLC 2EA2A 3ZMZA 2IP2A 4JBAA 4ZYDA 3DKWA 4GYIA 1BOAA 1KQ0A 4RAZA 4Y13A 3WTUC 1B6AA 5L3CA 3WTYC 1S7OA 3KCCA 2QBYA 1RNLA 2XAGA 4LD5A 5HS7A 1T0FA 3WTZA 3GFLA 4HDUA 2TDXA 2H27A 2XRNA 1TW2A 1U6GA 5J8CA 3TDUC 4WXHA 1D8JA 4ENJA 1BC8C 2V1DA 1QNTA 4AIJA 3E6CC 5IT9Z 4EJWA 4U0YA 4YFXF 2IA1A 4ENMA 2GQQA 1RUNA 1LDDA 4U0VA 1IW7F 4OU0A 2D1HA 4MQ9F 4AVPA 3P7NA 2FBHA 5E17F 2JTVA 4FT8A 4RB3C 3R6SA 3CJNA 1FZPB 1FT9A 1FC3A 3J81Z 1R58A 4IF4A 3CUQA 1ZRCA 2P6TA 3JW4A 5A2QK 4KIBA 3EQLF 4NB5A 1BI0A 2XKOA 1IAWA 1H9GA 3HSEA 5TRDA 3M9AA 4U0WA 4N9IA 2RV8A 6PAXA 1R00A 2JPBA 3BJ6A 5D4RA 3JTHA 5HVQC 4Q47A 2A69F 4M9SA 4G9YA 4KNYA 2IRFG 2B0LA 3ZN0A 1YLFA 4RB0A 4KICA 1S3JA 2DW4A 2KKOA 2VT2A 2L01A 5HDNA 4MGRA 3GZ6A 2E1NA 1O3SA 4EJOA 3K69A 2DLLA 3WTXC 2QENA 3GO5A 4EJTA 1BN5A 3KLNA 3H3UA 1R22A 2VC0A 1RI7A 1F5TA 5D4SA 2EFOA 1KGSA 2MLKA 3G3ZA 5FD6A 2V9VA 2ACJA 5ILUA 3IKTA 2EV5A 1FSEA 3GFMA 3EYYA 4ZZLA 1P92A 2KJCA 2OQRA 2NNYA 2KRFA 4HLYA 1B9MA 2WWYA 4HX4A 4BHCA 5BPIA 2PG4A 1IRGA 1S8NA 2M45A 3JSOA 5L3BA 4OIOF 2ELHA 2HKXA 1BJAA 1KQ8A 5CVRA 4NQWA 2COMA 3D5LA 2FU4A 3Q9VA 2XAJA 1MJAA 2LF7A 3E97A 5LGUA 5E1WA 2WC2A 3O6BB 5ERIA 3U2RA 1CF7B 5H6RA 1TLHB 5LEKA 2DU9A 1YYVA 2XUBA 2RC4A 4LK0F 4H0EA 2UXNA 5ICEA 4DNCA 3I59A 5ILVA 3F8FA 3QRFF 1KYZA 3GZ5A 4UHTA 4UVAA 2OD5A 1FYMA 2ZMEA 4LG0A 3QU3A 1U8RA 1L0OC 1J5YA 4LLLA 3VODA 1F1ZA 4A0YA 2F5FA 2O03A 3VEPA 1IXCA 2ESNA 3RI4A 3V8KA 5CVVA 1AWCA 1MD0A 1FPQA 1LJ9A 3KEQA 2DK5A 1KYWA 4IXAA 4K2EA 1W7PB 1HW2A 3BDDA 5HLHA 5FD5A 1FOKA 4PGGA 2GAUA 1REPC 3U1DA 5E20A 1H0MA 2XV4S 4GYGA 4L9JA 3B02A 3WGGA 5E8IA 1ZG1A 4QLCU 1IN5A 1V3FA 4ZH4F 3K2ZA 1I27A 1O3TA 2RDPA 1G4DA 4L0YB 2ZXJA 5L3DA 2CWEA 3HRSA 3HUGA 4KFCA 1G3YA 5FO5A 4AIHA 1JHHA 3EETA 3DQVC 1R5HA 4OMZA 1DUXC 1B59A 3NEUA 2P5KA 2EFWA 2STTA 2A61A 4Y15A 2GWRA 4KIFA 3TO9A 3WG9A 2FQ3A 2DPUA 1R36A 2CW0F 2HR3A 4OIRF 2O6GE 1MJBA 3E6MA 3CDHA 4JK1X 2DT5A 1J0RA 4HW0A 2FRHA 2VBXA 1FWZA 2IW5A 1XDSA 4P55A 1UB9A 1K6OA 3VB2A 5D8KB 4IPAA 2M5WA 1R1VA 3DFGA 4A12A 4M6YA 3RIRA 2Z9OA 3GFJA 4PCQA 1TQIA 4CDGA 4DQ2A 1OMIA 2RQPA 3O2PE 4MEYF 5HDGA 3QU6A 5CVJA 3R0AA 1ZARA 1OYWA 4HX7A 1ZYRF 5F1RA 1LDKB 3MAJA 1YIOA 1IF1A 2W85A 1ZLKA 5LRRA 4ETSA 2HYFA 1Z6TA 1WWXA 3WGHA 3F23A 2L54A 2MA3A 1P4WA 1OKRA 2BYVE 3ZMDA 1H9TA 3B73A 2PMHA 4P9FA 3KP7A 2Y48A 1U5TC 2DQRA 1YW8A 2DFIA 3MZHA 3FM5A 1ZGAA 1I1SA 4PGHA 2CYYA 4UV9A 3EYIA 5E18F 1WRJA 3QP6A 2VONA 3T8RA 1ONVA 2R3SA 5D5VB 3L7WA 2H09A 1WSUA 2RN7A 3VOEA 1ZRFA 5BS6A 3WGIA 4ASNA 2FXAA 1T98A 4EQQA 2HQNA 3ECOA 4P9UA 1XCVA 3LQRA 2QQAA 2EB7A 5L3EA 3L2CA 4OIQF 1ZAOA 1XB4A 3F72A 3PQJA 4RGRA 4HBLA 3TO7A 4IRHA 4LJZF 5CYVA 1XSDA 2JPCA 5ED4A 4LB5A 3P9KA 1HW1A 3KP6A 4ZYGA 2IPQX 1QPMA 3BPVA 2HTSA 3WU0A 1O7FA 3ABUA 3T1BA 2G9WA 4YFNF 1LEBA 1YS6A 2STWA 1TBXA 2HS5A 1LNWA 1C0WA 1XCBA 4I02A 2CG4A 4G7OF 3R4KA 3LSTA 3DP7A 3FMSA 2EK5A 3C3WA 1JGSA 2XHKA 5IT9K 4KIGA 5LHHA 3M1EA 4HX8A 2V1XA 2GXGA 1J7KA 1O3RA 2PI0A 4M74A 2K7LA 3QP5A 1XMKA 5KVRA 1BIAA 5HLGA 4FX0A 4EVIA 3H3ZA 2QBYB 4YFKF 1QGPA 4HOBA 1KU3A 2FEZA 5HLIA 3GLXA 4A0XA 2JRTA 2HZTA 3E6BA 5K5RA 4KA4A 3J81K 5DEQA 2Z33A 1DDNA 3WE2A 1ON2A 4GCVA 1QZYA 4M9ZA 1P2FA 2P7CB 1Y0UA 4I0BA 1KQ9A 2JZYA 1U5TA 2MC3A 2Q8KA 2D1VA 2JT1A 4IHTA 4U88A 1YG2A 5IT3A 1T39A 4AIKA 5AIQA 4S05A 4L5IA 2QVOA 2HKOA 4G6QA 1F4KA 4EMSA 2RKHA 3QOPA 4M6XA 1SMTA 3CUQB 1YQAA 5DUIA 2ZNYA 2HTJA 1J75A 2XAQA 3TDZC 2KIMA 3LA2A 1BI1A 3IHUA 4OINF 3QPHA 3H92A 3NRVA 1S29A 4GO1A 2VOPA 3DF8A 2LF8A 3RKYA 1D3YA 3RYPA 4A5NA 5EEHA 2V79A 1DPRA 1XN7A 2H6BA 1I1GA 3KP3A 1ODDA 3R0JA 1AOYA 5F6FA 1U78A 2M1BA 2P7VB 1P4XA 1YFHA 1IXRC 2YU3A 4KN7X 3SHFA 1IZ1A 1SD6A 1G3WA 3ZQ7A 1SD7A 2VBWA 3FF5A 5DCFA 4AD9A 2UWMA 2K86A 4TV7A 4RGUA 1F9NA 1XGSA 3ZPLA 4A6DA 3F6VA 3FWEA 3KP2A 2YR2A 2M8EA 2L4AA 4EJVA 4Q5SF 4L9NA 2O61A 5FB2A 3C7JA 4HF1A 5LRSA 5ILSA 3F21A 3Q9SA 2W57A 3V8LA 3I4PA 3M8EA 1J59A 3EUHA 1G3TA 2LSOA 4KYWA 3RDIA 3RTRA 2G7HA 4EM2A 1EH8A 2ESHA 3FXUA 4LB6B 1LEAA 1D8KA 2NYXA 5JHUA 4MTEA 2FMLA 4I0AA 3ML6A 2QM3A 5HS9A 3I71A 4B8XA 1DPUA 1FYLA 1JXSA 2Z99A 1I6XA 1FLIA 4U7DA 2K27A 2EFQA 3GF2A 1ZGJA 2XKPA 1T2KA 3I59B 4KMFA 2HWVA 1ZRDA 5KK1A 2HYGD 2KJBA 3RKXA 1HSTA 2ZMEB 3DPTA 4IVNA 3BY6A 2PJPA 1QQIA 3E6DA 3K1NA 3LA7A 4HV5A 4RB2C 2V1UA 5BMZA 2A68F 1R23A 5BPDA 1XSXA 4HV6A 5LBQA 2ZO4A 3J80Z 4RS8A 3T0YA 5K5QA 1RZ4A 1GXQA 1FP2A 2KIUA 1HKSA 1S7AA 2EWNA 3MQ0A 2EFPA 2A5YB 1W5TA 2X4HA 2XVCA 4HA8A 2R7DA 5HOOA 1R1UA 1FP1D 1IRFA 2FNAA 3HHGA 4A6EA 3SZPA 1TW3A 5D5UB 1USSA 2KIFA 1R1TA 1CF7A 2EA4A 3ZMUA 3PFIA 3HSFA 3LFKA 3HTSB 2DBBA 4ZYHA 4I01A 3N97A 3T8TA 3KE2A 4XSZF 1UHWA 4BQAA 2PN6A 3HHHA 2FMYA 3HRUA 1BI2A 3GWZA 3O3KA 4MQVA 1MDMA 4WXDA 3MWMA 3ZMSA 4ENKA 4NHJA 1V4RA 2VE8A 3IRQA 3JAMK 2IJLA 2VBZA 5E1ZB 4XLNF 3MZYA 1J9IA 3CUOA 4A5MA 1J2XA 1IN6A 2BE5F 2PFBA 4MTDA 2DAOA 2MLGA 3BROA 1YS7A 5JR3A 5LGNA 2UXXA 4LMYA 4M9XA 3TO6A 1QBJA 4RB1A 3LA3A 5DV5A 4O3MA 2W25A 2EFNA 1HKTA 3FM3A 2H6CA 1Z6RA 1IN4A 4ESJA 3HRTA 2HQRA 4M72A 4RAYA 3FXRA 2M30A 2VBYA 5CLSA 5FLXK 2F5DA 1U3EM 2GIVA 1RIOH 3SZTA 3V7SA 3V8JA 1FSHA 3JAMZ 2QQBA 3MFKA 1UFMA 1IXSB 3SFZA 2M87A 5E1XA 2FBIA 2BGCA 4IJAA 4HYEA 4HF0A 3FHZA 1OPCA 2C6YA 3BZ6A 1HBXG 4EM1A 1EH6A 1MKMA 3K0LA 3P9IA 3WU1B 5ICFA 3TOAA 2FOKA 4CO8A 1GXPA 1ZH5A 2QQ9A 1DP7P 4CXFA 4I98B 1K78A 4WF2A 3WTVC 1KA8A 5HDKA 1BBYA 1JE8A 3KETA 5D8LB 5FLXZ 4EV0A 3I0TA 2VXZA 3M7GA 2IA2A 4UVBA 2OQGA 5L3GA 2ZBKA 1I5ZA 1HXDA 2ZCWA 1HKQA 2ZJ2A 4KUMA 1O7LA 2QWWA 2XAHA 3GFIA 2HOEA 3JSPA 1KU2A 1SMYF 3ELKA 3RYRA 5L3FA 3LAPA 1VTNC 4S04A 5BOXA 1YO5C 3HOSA 5K1YA 3COAC 1GHCA 3TQNA 2RGVA 3BJAA 3ABTA 3G73A 3E3VA 3K9TA 4O6JA 5LHGA 1NHAA 2K02A 3W6JB
chains in the Genus database with same CATH superfamily
2DA1A 3WTTC 4W97A 3FZVA 3HIFA 4PJ0C 2HQAA 3S1NJ 2OZUA 2GXAA 2CUJA 3BOQA 2M4KA 5J40A 4L9TA 4Q48A 4ON0A 3BT9A 5DD8A 1TC3C 1HC8A 2R7FA 2L9RA 2MABA 2EBIA 2Y75A 4Z2YA 2GA1A 2E1CA 5GAHJ 2BHZA 3TP0A 1WJCA 1T33A 3PSIA 1R5GA 2KQRA 4GGGA 3M8JA 1UZCA 4XLCA 2X0LA 4PJNA 2M4GA 2CMPA 2NVXJ 2JSCA 2ME0A 5FRNA 2LDUA 4BJTA 3JRIA 1B1BA 5M3FJ 5F0CA 3DWLE 3QPTA 4PSXA 4D7MA 4CYDA 4LLGF 3CMEI 1XGOA 3RKWA 4F91B 2ZNZA 2G0EA 2R7WA 1ETXA 1H89C 2ADUA 5ICCA 1TQPA 2KMUA 2Z5UA 1YTYA 4M71A 3IC7A 4MFEA 4ZTFA 3WG7H 3QOEA 2K4BA 1WH5A 2KISA 3FX3A 1OYYA 4ZC3A 3FK7A 4BYYA 2LKPA 3F22A 3H3VK 1DGRM 1SAXA 2GZWA 2L7MP 4CZZA 1MW7A 3KIOA 4HLXA 4UXNA 1ZELA 5HODA 4YG2F 5DCMA 1BI3A 1U5TB 3ZQFA 1DU6A 1HF0A 1ZREA 4EGYA 1R4NB 2W00A 3FMQA 3KFWX 3UNGC 2LNBA 3CC4I 3OYAA 2IGKA 2H8WA 3DBLB 1W0UA 1T38A 1BIBA 3A02A 3F8NA 1PDNC 4CICA 3RPQA 5DDGA 4JQFA 4L0ZB 4HQMA 1LFUP 3HSRA 3EUHC 4EEFG 3S16J 1HSJA 3ERMA 3FXMA 2J5OA 2R7XA 4NDLA 2W24A 4F92B 2VT3A 4M3EA 2A6HF 3I53A 3CF2A 3DEWA 2WB1A 2W1OA 5IOZA 2VB6A 4Y4RA 1QHHD 1YJ9I 2ZXHA 4KN4X 1Z9CA 2XAFA 3BTIA 1GDTA 2PMZA 4E7IA 4Y52J 3VSLA 3U21A 1TTYA 1PP7U 1A6QA 4KT5C 1JJ6C 4G6DA 2DODA 3C1DA 1XDUA 3JTGA 3FISA 1PUEE 4HAMA 2VJIA 4XKWA 4BEHB 2XPWA 5D5WB 1XTAA 4L9VA 3P9CA 1MMSA 4CH7A 2FUG2 2F4OB 2IA0A 4B4CA 3WTSC 5J1RA 3PQKA 2HFHA 3LSGA 3S32A 4DOZA 1ZG5A 1N78A 5CJ9A 3GVAA 4HEA2 2CUEA 3F8MA 2VJ4A 5JVTA 4EGZA 2R7QA 2XIGA 2Z1DA 4BDZA 4ZDOA 2E7XA 4AYBN 3Q3SA 4UUVA 1T6SA 1LE8B 3SEQA 4M73A 1XGMA 3MCZA 2EILH 5FFXA 4I2OA 4CSWA 1FTTA 4R8HA 1MBFA 5J6XA 4G7ZF 4KMUX 2I8DA 4L5JA 4HZFA 4XNFA 2E2HJ 2Q0OA 5IP9J 3GX4X 2RNJA 4ZYEA 5J4VA 2PEXA 3I54A 1FBUA 1QVTA 2V6CA 5J47A 5EYRA 3NWSA 2V1NA 3SXYA 4QSHA 1W1WE 1AKHB 5LGTA 4MEXF 2M7BA 2OA4A 5EGOB 3HKZN 2DT7B 3W6KB 5FFZA 4G7HF 2K9NA 2VE9A 1HA8A 2Y0MA 3GUDA 4WCGA 2OU2A 1WJFA 1TL8A 4LIUA 2WAQN 1MMAA 4DYQA 1Y0NA 2W84A 3FXJA 1TT5B 3M8FA 4LK1F 2CV1A 5D6EA 4R1HA 2DN0A 3E5UA 3N4MA 3ZR8X 2NVQJ 4FHTA 5HS8A 5EDNA 2CGPA 1Z7UA 3RPUA 4XLEA 2GIZA 3NQOA 1G6NA 4PJMA 1EH7A 1KZHA 4AWXB 2D45A 5K7HA 1K4SA 4N9HA 1Z67A 2NS8A 3KPHA 2IT0A 1TWFJ 3GTJJ 2PLYA 1YW9A 1B9NA 1W5SA 3CO6C 1I39A 5EF6A 1MGTA 1Z1DA 3BP8A 1FOWA 1X4OA 4G8XA 1EF4A 3E1SA 5LHIA 2AXLA 3CC7I 2JN6A 2DT6A 3FMRA 1P6RA 3G71I 5J8FA 1MZBA 2E1MB 2DXIA 2HVQA 1ZN2A 3SDGA 1WGXA 1P7JA 1X3WB 3W3CA 1O3QA 1FBQA 5EEGA 1YW7A 2BXYA 3BWGA 2LFBA 1H8AC 3DTKA 3CLOA 4EM0B 1P4AA 2JQ7A 1UELB 2HGCA 2XAUA 2E5ZA 2WV1A 2R93J 3HB9A 2V9KA 4PK4A 3TGNA 4ANJA 2DA5A 5IYCJ 3J80K 1DU0A 3GTMJ 1BR2A 3ZQGA 1SFEA 2K9MA 4IHVA 3LWFA 2X9DA 1TWGJ 2DA6A 2E2JJ 3LSHA 2VXDA 3GTPJ 1Y39A 2VJ5A 2LMDA 2H94A 3Q0WA 4IOCF 2B9SA 1BM9A 5HLTA 1PYVA 2LY9A 3S1QJ 2R0QC 4ESBA 3ZP5A 4YIFA 4AU7A 1BC7C 4MFDA 3OYFA 3DEUA 4O5VA 4A2UA 5K5OA 1IUFA 1BR4A 2P8TA 3BCBA 1G8XA 5A2QZ 2UV1A 4RBOA 2CQKA 2DMUA 1AHDP 1FEXA 2BV6A 2PMUA 3I9V2 4F7ZA 4IHSA 1YIJI 3WTWC 1FNNA 1V5FA 2R5ZB 4XRFA 5M3MJ 2ICWG 2LRDA 1VF9A 4YIIA 4V2GA 3Q0UA 2E7WA 3TOBA 2W4SA 3ZRGA 2GA2A 3GYHX 1Y56A 2P0WA 2E35A 3ASOH 5F64A 3BG7A 1JTXA 1POGA 1SAUA 2HQ5A 3JRDA 3MKZA 4I99C 2L7ZA 5CVIA 2ZXIA 5LLQA 2L7FP 2XRLA 4LG0B 3SQNA 2YX4A 5BQTA 1F43A 3GXOA 2F5CA 2NS7A 1BR1A 2QGUA 2VN2A 2MD5A 1LDJA 1JI8A 3AAFA 1HCRA 1X2NA 5KHDA 3A01A 5CVUA 4XSXF 3VFZA 1K6YA 1AA7A 4C3IJ 1WJDA 2GXBA 1ZKGA 3OSFA 1IJWC 3IWFA 2NAZA 4CCLA 1ZG3A 2DTRA 3D5RC 2KP6A 3M1CA 4F55A 4QWQA 3ZMTA 2J5PA 3C2HA 1E17A 2ISYA 1Y1VJ 1FYKA 3RQIA 3LQQA 4UV8A 2CO5A 4BHPA 3L09A 2O8XA 5H6QA 4FTHA 1UMQA 3CTAA 1ULYA 4DYRA 2NNNA 1R49A 3C2GA 1JHFA 4MNUA 5JI6A 1XD7A 4BNCA 2XGXA 2Y9YA 3QAHA 2JA5J 2VOOA 4XK4A 3VYRB 3D0SA 3K1PA 2FSWA 3TW7A 5E8GA 1EV7A 5EEAA 2LG4A 3REOA 3ZN1A 3OY9A 1OCPA 2EV6A 1K4TA 2PQ8A 2RREA 1LQ1A 3HM5A 4RGSA 4XOPA 1QZZA 1MDMB 3V7RA 3T5XA 1CGPA 1V55H 3OYIA 4OIPF 3IL2A 1EA3A 1IUYA 2WTEA 1JKRC 4U87A 3X2QH 4B09A 3EUAA 1IN8A 5TGTA 3G4SI 5F04A 3J7AO 3NARA 4I76A 1Z0XA 3AFHA 2LKXA 3Q5FA 3ISPA 4MLOA 3AL0C 1PUFB 3MMYB 4UVCA 2R7TA 3EUKL 1Q1HA 3WE3A 2FA5A 3E5XA 3I5UA 2IS6A 1HQCA 4G94A 3E5QA 2LVSA 1WQ2A 4BBRJ 4D0PA 1GVJA 4RA2A 2P6SA 4BAYA 3ULQB 1VQ8I 3DKYA 2ZFWA 3KEOA 4HDVA 4IZZA 4E7KA 3R61A 4CUGA 3ROUA 3K4CA 2K4JA 4HSRA 4CYCB 2N8GA 2EIKH 2R7ZJ 2QKLB 2KDZA 2HDCA 2CSOA 4XLPF 4RLQA 2MH2A 3ERED 1TNTA 2XROA 2NS0A 2XF6A 3K10A 3VSKA 4C3JJ 1XSVA 2DK8A 3CDIA 3K4KA 3R60A 2R4GA 1TT0A 2NRAC 1OR7C 1K61A 4LFUA 2RNGA 3PUFA 3PIPF 1HW5A 1SD4A 4MIMA 2EZLA 2JA2A 1FX7A 2VODA 4IL6C 1W7PA 3DXJF 4GDFA 4BY1J 4IRIA 5ICGA 4CGZA 5H20A 2LBFB 2BBYA 2LOOA 4M3BA 4OMYA 4CCMA 1WI9A 1O57A 1SFXA 3FXQA 3OYDA 1RR8C 3DV8A 1WCMJ 2NOJB 1LB2A 2LY1A 2YPRA 3G6EI 4QIWN 2VQLA 1RUOA 4L18B 4HF2A 3PIOF 1Z91A 4D9JA 4ESFA 2L02A 1USTA 4U7BA 4F52A 3S3OA 3S1RJ 2UZKA 2QZ8A 3F8CA 3K6GA 2OBPA 4RAFA 2L3DA 1SANA 1YOVB 2HZDA 1KU7A 3U9GA 3DKXA 1N75A 2WADA 3L00A 2DJNA 4P5OA 4FX4A 3H9QA 2ME6A 3MZ8A 4II3A 3I3LA 3CMAI 2M7AA 3DEEA 4Y33A 3HOWJ 4BH9A 1E2XA 2O0YA 3FKJA 5DD4A 4BJ6C 4LLNA 3A0BC 1WJAA 2A3SA 3K1MA 3PO3J 2CQNA 1OYIA 1MJ9A 3HYIA 2DYRH 4WX9A 1VQPI 2MH9A 2FE3A 3PNYA 3CESA 4ZZDA 3BG6A 2RQQA 2FBKA 1VNDA 2KZGA 2O3FA 3I4NJ 3MD2A 2F5EA 1MBHA 3OYCA 1K78B 2L4MA 3BPXA 2PJRA 1G3SA 5D5XB 1U0JA 1B4AA 2IEKA 1OCCH 2M0MA 3OOPA 3Q0VA 1STZA 2JSPA 4Y17A 1KU9A 4BHBA 5TJJA 2DPDA 2ETHA 2P5LC 4XBFA 4BE0A 3OYBA 2AQEA 2B63J 4R79A 2GLOA 2F4MB 4EJUA 3FBIB 1OQYA 2DQLA 2XGDA 3LSMA 3OV8A 4BXUA 2F2EA 2EH3A 2JRMA 3F6OA 3TL4X 1D1BA 2WV0A 5EZGA 3CCQI 4MHGA 4RGXA 2Z3YA 1Z05A 1XMAA 4C2TA 4E7ZA 2HYJA 1FIAA 4CCNA 4YIRX 1A5JA 1BW5A 2Q2EA 4OOIA 2P5VA 3KP5A 3O8GA 2KLOA 2CUFA 1PP8F 1ON1A 3RJPA 2CFXA 2AS5F 3LNQA 5DUKA 1WKMA 1IG7A 4DJAA 5IY5H 3C18A 1UCRA 2PBIA 2P4WA 4N4OB 2HXOA 4YELA 2EINH 5TISC 3FIWA 3I56I 1D5VA 4Y3OA 1ETWA 1WJEA 2QCOA 3IRRA 3RKQA 4G6TB 3OWTA 2EV0A 1V5GA 1D1AA 1NG7A 1ZLJA 1X2MA 3CC2I 2IAIA 3HL2A 2K9LA 2K40A 1XC5A 3GW2A 3KZYA 1S5LC 3CD6I 1WJ5A 2QQ8A 3K4NA 3KLOA 4DYCA 3GLLA 1X58A 2M2EA 1GUUA 3KYDB 4P96A 5DYMA 1W7PD 2FNPA 2VC1A 3TKYA 4DBQA 3W2AA 4NC8A 3CLQA 3EDPA 3FXKA 3KP4A 3KZZA 2EJRA 3BZKA 4PZJA 2CV0A 2CUZA 2YSRA 3H35A 1SFUA 3I64A 2WBMA 2DO7A 2LK2A 4PDKA 4A0ZA 3F9KA 4N0BA 3FKIJ 1OR7A 1FBSA 4XN3A 1UHMA 2IVMA 3CJQB 3MEXA 2DMTA 4YEJA 2L2OA 2XGCA 1FMWA 2JK3A 1FY7A 2OZ6A 5DTDA 2HDWA 1MMGA 3J7AY 3HOTA 2RVCA 5IYBJ 4E70A 3CCRI 4Q4ZF 1RESA 2X6XA 4UNOA 4I09A 1X3UA 3F8BA 2JMWA 2XASA 3BTCA 2DOEA 5FLMJ 1W0TA 2D2WA 3IWZA 2E5NA 5E3MA 4KDPA 3ZOBA 3BR5A 1QO0D 2ELJA 4HQEA 4ENNA 4OWRB 3WODF 2BEOA 1YRNA 2VJJA 3S2HJ 3BCAA 1ZHFA 4WXCA 2XF5A 2WB1N 3OYHA 5AIPA 3VPRA 2QLZA 3CP2A 2LH9A 3K70C 4A3MJ 1QA6A 3F3XA 5FGMA 3CUQC 2XPUA 4KITB 3I58A 4E7JA 1VQOI 5JLXA 1R7JA 5AONA 2PMZN 1ZQ3P 2ISZA 5DCMB 2MBFA 5KAFC 3NAUA 2L7KA 2LY2A 3DBHB 4WWCA 2G7UA 2DI3A 4IRGA 1LVAA 4QPQA 3BJOA 2HU9A 3GEZA 1SD5A 3HTUA 1X1AA 1TNSA 2HEOA 3HRMA 3V7CA 3ZMVA 1L3LA 3IAS2 2KRCA 3E0JB 2A6EF 3VYTB 3N05A 3RZOJ 1Z3XA 1VQ6I 2IGOA 5LEJA 4GXOA 1TQMA 2VQGA 3HOVJ 2XB5A 1DQUA 2FF4A 3TW6A 2VIXA 5J1YA 2DMNA 5EG0B 3EPZA 1P9QC 1W4MA 4A3EJ 4CHUA 2JUGA 3CO7C 4DZJA 4WK8F 1T8IA 3LAJA 5EZHA 5FKLA 1ACIA 2ID6A 4XKCA 3IKVA 3L2RA 2QYOA 1S6LA 1WPKA 5C3EJ 4X0GA 4BDYA 1IN7A 1ZR2A 4FQGA 4IHYA 2A6TA 4I7HA 3PFYA 2YX7A 3QPLA 3PNTA 3BTLA 3L9FA 1K7AA 2Y0SA 3W2VA 3FXLA 2ZKZA 2XC7A 4ZTJA 5GAEJ 5JFRA 1U2WA 2OAZA 1JKOC 1A04A 3IUOA 4XLFA 1XGNA 4E7LA 1GLNA 4UUSA 4XR6A 4LGWA 1LKXA 2E36A 2QUFA 5D6FA 4E6KG 2A07F 1WHUA 3BG9A 1K79A 3S2WA 3V4GA 3ECHA 2JA7J 2VPRA 3DPLC 2EA2A 1VQ7I 3ZMZA 2IP2A 4B3AA 4JBAA 3BG3A 4ZYDA 2WAFA 3DKWA 4GYIA 1BOAA 4XM3A 5IYDJ 2EZKA 1KQ0A 4RAZA 4Y13A 4NBQA 2HOAA 3WTUC 1B6AA 5L3CA 2YUSA 3WTYC 1S7OA 3KCCA 2QBYA 1RNLA 2XAGA 4LD5A 4B48A 1LFPA 3QYEA 4JX6A 1T0FA 2Q1ZB 5HS7A 3WTZA 5DM7F 3GFLA 1XS9A 3A4CA 3A0HC 4HDUA 2TDXA 1ETVA 2H27A 2XRNA 1TW2A 2XGEA 4MO7A 3V42A 1U6GA 2WY7Q 3AG4H 5IP7J 5J8CA 3TDUC 2MD0A 4WXHA 1D8JA 4M3DA 4ENJA 2X1CA 3PNVA 2V1DA 1BC8C 3BG5A 1QNTA 4H4KC 4AIJA 3E6CC 5IT9Z 1IRZA 4EJWA 4U0YA 1OLTA 4YFXF 4B1RA 1WZ2A 2IA1A 2Z2SB 3H1CA 3S1MJ 1IV6A 4ENMA 2GQQA 1AU7A 1RUNA 1LDDA 4U0VA 1IW7F 2FJ1A 2K9QA 4OU0A 4DGWB 2D1HA 1VQKI 4IOAF 3ESWB 5F0HA 4MQ9F 4AVPA 3P7NA 2FBHA 1Y6IA 1SFOJ 5E17F 2JTVA 4XICA 4RM2A 4FT8A 2WY8Q 4B47A 4RB3C 3R6SA 1TP4A 3S3NA 3VDXA 3CJNA 3D5SC 1X19A 1FZPB 2FOWA 1FT9A 1FC3A 3J81Z 1R58A 4IF4A 3CUQA 1ZRCA 2P6TA 3JW4A 5A2QK 3RCOA 4KIBA 5M5YJ 3EQLF 1A6IA 1OISA 4NB5A 1ZGWA 2VASA 3CJTB 1WI3A 1BI0A 2KZVA 3FXOA 3HOYJ 1WVRA 2XKOA 5JVGF 4A69C 1I6HJ 1IAWA 1XMXA 2QSFX 2NVYJ 1H9GA 3HSEA 5TRDA 3M9AA 2V26A 3HOZJ 5LFAA 1MH4A 2L9NA 4U0WA 2CQ7A 4N9IA 2RV8A 3OIQA 1R00A 1VFCA 6PAXA 1GV5A 2JPBA 2DFHA 4BL0B 3BJ6A 5D4RA 3JTHA 3HPHA 5HVQC 4Q47A 2A69F 3HJEA 1ORKA 4A3BJ 2HOSA 3OL3A 2HVSA 4M9SA 4G9YA 4KNYA 2IRFG 2JUCA 2B0LA 2ELKA 3ZN0A 1SVMA 2X48A 2OJED 1YLFA 2DFEA 4RB0A 4KICA 1IRXA 5F1JA 1S3JA 1VQNI 3CCUI 2DW4A 4IX7A 2KKOA 4UUTA 2VT2A 2L01A 2Y69H 5HDNA 4MGRA 3ZQIA 3GZ6A 2E1NA 1EJ9A 1O3SA 4EJOA 3K69A 2DLLA 3WTXC 3M07A 1JGGA 1D0ZA 1TWAJ 2QENA 4XRMA 3GO5A 4EJTA 1ETYA 1BN5A 2NOGA 3KLNA 3H3UA 1R22A 3KZIC 1RC9A 2VC0A 3OL4A 1RI7A 4LIVA 4XL9A 1IV8A 3GBGA 1F5TA 2R5YA 5D4SA 4LG3A 2EFOA 3KYLA 1KGSA 2MLKA 3G3ZA 1MH3A 4CCJA 5FD6A 2MFZA 4S0HB 4BACA 2V9VA 3HKZA 2ACJA 4C2MJ 5ILUA 3IKTA 2QEXI 2EV5A 1FSEA 3GFMA 2Y2ZA 1D0XA 4HSTA 3LSPA 3EYYA 4ZZLA 1P92A 2KJCA 1ENHA 3H0DA 2OQRA 1R5ID 3C2BA 3CCMI 4IHWA 1S7EA 2KRFA 2NNYA 2HNHA 2E71A 4E7HA 5LD2C 3H5RA 2WAQA 4HLYA 2MW8A 1MMNA 4ZDLA 2HVRA 1B9MA 2VQHA 4NC6A 2WWYA 4HX4A 3MKWB 4BHCA 3OR2C 5BPIA 2PG4A 1IRGA 4JX4A 1IC8A 3FDYA 1S8NA 2M45A 3JSOA 3DTEA 3L2QA 5L3BA 4OIOF 2ELHA 2F48A 1ITYA 2HKXA 4UB6C 1BJAA 1KQ8A 5CVRA 2M34A 1D5YA 4RM3A 2NXNB 4NQWA 2IXSA 2COMA 1QVUA 4BU2A 3D5LA 2FU4A 1NH3A 3PJRA 3GTQJ 3Q9VA 2XAJA 1NK2P 1MJAA 1WFXA 3L1PA 2LF7A 3E97A 5B1AH 5LGUA 5E1WA 3ZQQA 2ZFUA 1YHQI 2WC2A 1I50J 3K70D 1MBJA 1JT6A 3O6BB 3HBLA 5FKMA 5ERIA 2JA8J 3U2RA 1S72I 1T56A 3FK6A 2VLAA 1CF7B 5H6RA 1TLHB 5LEKA 5M5XJ 3ZQLA 1X1CA 3H0GJ 2DU9A 1YYVA 2CRGA 2XUBA 1YITI 2RC4A 3G2BA 1FTZA 3RPUD 4LK0F 4H0EA 2UXNA 5ICEA 1YJNI 3IV5A 4DNCA 5J1UA 5JLWA 1VZ0A 1MNMC 2MSYA 2A5WA 3I59A 1NG6A 1W36C 5FKKA 4IEJA 3F8FA 5ILVA 3QRFF 1KYZA 1Z77A 2EZIA 3GZ5A 4UHTA 3HGGA 4UVAA 2HI3A 5E3OA 2OD5A 3PUBA 2V9PA 1FYMA 4YRVA 2ZMEA 5K7ZA 3U1KA 1G59A 4LG0A 5CKTA 3QU3A 2R7SA 1U8RA 3HXLA 1L0OC 3LFUA 1J5YA 4LLLA 3VODA 1F1ZA 2NVUB 2D5VA 3PM1A 4A0YA 2F5FA 1VQMI 2O03A 1ZTRA 4A3KJ 3VEPA 1N25A 1IXCA 2ESNA 1YI2I 2QF7A 3CCYA 3RI4A 3V8KA 1BA5A 5CVVA 5EJCA 1GV2A 1AWCA 1MD0A 1FPQA 1LJ9A 3KEQA 2DK5A 3E7LA 2IBDA 3BR0A 3G1MA 4NUBA 1KYWA 2K3PA 4IXAA 4K2EA 1W7PB 2R7RA 3CF5F 4JP0A 3SZGA 1HW2A 4IQ4A 3BDDA 2R7VA 4JOMA 5HLHA 4HG2A 5FD5A 1FOKA 4PGGA 2GAUA 1REPC 1R9TJ 4HPQA 3U1DA 5E20A 2UUZA 4BXFA 4XOTA 3BR1A 1YE9A 1H0MA 2XV4S 3CDLA 1TZLA 4GYGA 4AUXA 4L9JA 3HOUJ 4BQQA 3B02A 3WGGA 4A3DJ 5IP6A 2V6EA 5E8IA 2EIMH 1ZG1A 3QQAA 3DU6A 4RLFA 2F4IA 2TCTA 2X51A 4QLCU 2O9LA 1IN5A 1V3FA 5J3LA 4ZH4F 2X6WA 3K2ZA 4D1QA 1OCTC 3OYJA 1I27A 4M3GA 1O3TA 3PO2J 1RPWA 5BNGA 2RDPA 1R4MB 1G4DA 1YX5A 3BQYA 4L0YB 1Z3YA 4BS9A 1OCRH 2ZXJA 3HC7A 5L3DA 2CWEA 3OR1C 3HRSA 1MIJA 3HUGA 4A3JJ 4KFCA 1G3YA 5FO5A 3ZGKA 3MN2A 4AIHA 1JHHA 3EETA 2KT0A 3DQVC 4FCYA 1VI0A 1R5HA 2XF7A 4OMZA 4HNVA 1RKWA 2JVGA 1DUXC 1B59A 3NEUA 2P5KA 2EFWA 1X4PA 2STTA 1X1PA 2A61A 1B8IA 2OUMA 4Y15A 2GWRA 4KIFA 4RAGA 3TO9A 3WG9A 2FQ3A 2XB0X 5FROA 2XSDC 5E3LA 3OMYA 5GADJ 2DPUA 2YS9A 3CCLI 3OYNA 1R36A 2CW0F 2H1LA 2HR3A 4A93J 4OIRF 2O6GE 1MJBA 2AO9A 3E6MA 1S9HA 3CDHA 4JK1X 2DT5A 4NNJA 1J0RA 2L9SA 3RZDJ 1QPIA 3RSNA 1A35A 4HW0A 2FRHA 1M1EB 2VBXA 3DLAA 1E3HA 1FWZA 1UHSA 2IW5A 3CQZJ 1XDSA 5C44J 3OYLA 4J00A 4P55A 1UB9A 1K6OA 3VB2A 5D8KB 2CQXA 1RETA 4IPAA 2M5WA 1DGWY 4CCKA 2Q2EB 1R1VA 2XPVA 3DFGA 3CJRB 4A12A 2CQQA 4M6YA 3RIRA 5J4YA 2Z9OA 3GTOJ 3G1LA 3GTGJ 4JYKA 2VKVA 3GFJA 2V4JC 1ETOA 1UG2A 4PCQA 3AL0B 1TQIA 4CDGA 4DQ2A 1OMIA 5K7FA 2RQPA 3BZCA 4N4NB 3BLYA 3O2PE 4BE2A 2R92J 1XG1A 4MEYF 5HDGA 3H5NA 3QU6A 5CVJA 2L9VA 3R0AA 3K4JA 4B3XA 1ZARA 3DBRB 1OYWA 4HX7A 1ZYRF 5F1RA 1SVLA 1G2HA 1LDKB 3MAJA 1GT0C 1YIOA 1IF1A 3IH2A 3CCJI 1K83J 2W85A 3KX2A 4BQOA 3DTIA 1PJRA 1ZLKA 5LRRA 1BJZA 3UR3C 3GTLJ 4ETSA 2HYFA 3CMYA 1V54H 4XLHA 1Z6TA 1WWXA 5B3SH 3WGHA 3F23A 2IS2A 2L54A 2HDDA 2MA3A 2X6OA 3VYSB 2KIQA 1P4WA 3QYBA 1OKRA 2BYVE 3ZMDA 2CH0A 3B73A 1H9TA 2PMHA 4P9FA 2M3AA 2EQRA 3OS1A 3MVPA 1MBKA 3KP7A 2LYCA 2Y48A 1U5TC 2DA7A 2GOXB 2K5CA 5GTIC 3OS0A 1YJWI 1T08B 2DQRA 1HLVA 1YW8A 3TP3A 2DFIA 3AG3H 4BUPA 3MZHA 2Y9ZA 1WJBA 1X1BA 3FM5A 5B1BH 1ZGAA 2BOLA 5FJ8J 1T0FC 2VKEA 1I1SA 1MBGA 2KPMA 4PGHA 1PVEA 2CYYA 3L2WA 4UV9A 1YRNB 3S14J 3ONQA 4J01A 3EYIA 5FRMA 2B7EA 4HNUA 5E18F 2EZHA 5F27A 1WRJA 3QP6A 2JVHA 2VONA 3T8RA 1ONVA 2R3SA 5D5VB 3L7WA 2LC2A 1D1CA 2H09A 1WSUA 2JA6J 2RN7A 3S2DJ 1CQTA 2CS3A 3VOEA 5B66C 1ZRFA 5BS6A 2XDVA 3WGIA 4ASNA 2FXAA 1T98A 2W7NA 4EQQA 2E34A 3B6CA 2HQNA 2MG4A 3ECOA 4P9UA 3JRHA 1XCVA 3LQRA 2QQAA 3ZQCA 4DBRA 2Y0SN 1XX5A 3HOXJ 4XORA 2EB7A 5L3EA 3L2CA 3G1OA 4OIQF 1ZAOA 1XB4A 3F72A 2KDOA 3ASNH 3PQJA 5GTHC 4RGRA 4HBLA 3TO7A 1B72A 2BY0A 4IRHA 4LJZF 5CYVA 1XSDA 4A3CJ 4UY8I 5CQGA 2JPCA 1OCZH 2FQ4A 1HOMA 2OV7A 5ED4A 4LB5A 3P9KA 2EIJH 4NC7A 1HW1A 1X3ZB 3KP6A 4ZYGA 2IPQX 1QPMA 2X85A 3BPVA 2HTSA 3WU0A 4F93B 1O7FA 3ABUA 4W1UA 3T1BA 2G9WA 4A3IJ 1JT0A 1MBEA 4M3FA 4YFNF 4KJZA 4XMYA 2CV2A 1LEBA 3LMMA 1YS6A 1SVOA 3QWLA 2BZTA 4FE7A 2BW3A 2L0KA 4B43A 1LVKA 1UG0A 4HRIA 1EKEA 1W36D 2STWA 1F36A 1TBXA 2HS5A 1LNWA 3RQ4A 4PFOA 1BOBA 4FETA 1C0WA 1JUPA 1XCBA 4UUSB 4I02A 2CG4A 4G7OF 3VWBA 3R4KA 3LOCA 3DP7A 3FMSA 3LSTA 2E2IJ 2EK5A 3C3WA 1JGSA 2DJIA 3QYFA 2XHKA 4C9YA 3JRGA 2CW7A 2OC6A 5IT9K 4KIGA 5LHHA 2I10A 1V5EA 3ABKH 3M1EA 3BTJA 4II2A 4HX8A 2V1XA 2GXGA 1J7KA 1O3RA 2PI0A 4M74A 3WHCA 2DMPA 2K7LA 3QP5A 2LKSA 4BBSJ 1XMKA 5KVRA 2ZJRF 5IOYA 4I6ZA 1BIAA 5HLGA 4FX0A 4EVIA 3H3ZA 3SFIA 2JJ7A 2LP0A 3IH3A 2IS4A 1P7IA 2QBYB 4YFKF 1QGPA 4HOBA 5HNFA 1KU3A 2FEZA 5HLIA 2ZJQF 2M9HA 2X1DA 4KT6A 3GLXA 3GMEA 4A0XA 2JRTA 2HZTA 3E6BA 5K5RA 4KA4A 2OTJI 3J81K 5DEQA 2Z33A 1DDNA 3WE2A 2IGNA 1ON2A 2ZXWH 2BY1A 4GCVA 4BQNA 1QZYA 5KCMA 4M9ZA 2ZSIB 1P2FA 2M8GX 2P7CB 2RAEA 4QTRA 1Y0UA 5EG0A 1NK3P 2E1MC 4I0BA 4L5EA 1KQ9A 1FOXA 2JZYA 1U5TA 2MC3A 2Q8KA 2O5RA 2D1VA 3BR2A 3CP8A 4BY7J 2JT1A 4IHTA 4U88A 4IHXA 1YG2A 2LLKA 2VKDA 2AHQA 5IT3A 1T39A 1OJLA 3D1NI 4AIKA 3NWTA 3JRCA 5AIQA 4CZCA 2K9SA 4S05A 4L5IA 2QVOA 2DCEA 1Z21A 3J7ZI 1O4XA 2HKOA 4G6QA 3FHNA 1F4KA 4EMSA 2RKHA 3SYTA 3CCEI 3QOPA 4M6XA 1SMTA 2O7OA 3CUQB 1YQAA 3H5AA 4E4HA 3I4MJ 5DUIA 2ZNYA 1ETQA 2A05A 2F5VA 2KHMA 3GZNB 2HTJA 1J75A 2XAQA 2JWTA 3TDZC 4EATA 2KIMA 4FASD 3LA2A 4PJLA 1BI1A 3F0CA 2QA4I 3OYEA 2DDBA 2F6CA 4BEHA 3IHUA 4OINF 4Z6YA 3QPHA 3H92A 1T95A 3NRVA 1S29A 2KFDA 4GO1A 5H2FC 1RR7A 2VOPA 4BE1A 3H36A 3DF8A 1A36A 1NTCA 2LREA 1A31A 3OYGA 2LF8A 3RKYA 1D3YA 2K3FA 3AG2H 2VI6A 3RYPA 2QSHX 1BW6A 3DPUA 4A5NA 3L2UA 3WHBA 1R71A 5EEHA 2V79A 1DPRA 1XN7A 2H6BA 2E19A 1APLC 1ERDA 1QRYA 2ZMEC 1I1GA 1LE8A 5KAIC 3KP3A 1ODDA 3TMOA 4D7NA 3I55I 3R0JA 1AOYA 2VPLA 5IPAA 5F6FA 1ETKA 1SC7A 1U78A 3W2WA 3MKYB 3ZXSA 2M1BA 4IKFA 2COBA 2P7VB 1P4XA 4FE4A 5FKNA 4ABZA 5GAGJ 1YFHA 1IXRC 2YU3A 4KN7X 2Y31A 2L5QA 2ZC2A 3OOUA 3SHFA 3KYCB 1IZ1A 2ID3A 2BXZA 1SD6A 5CQEA 1G3WA 3ZQ7A 2R5YB 1AKHA 3QPSA 1SD7A 3QODA 2VBWA 4M6VA 5EGOA 2PX9A 3FF5A 5DCFA 4AD9A 2UWMA 4AYBA 4G12A 1FOYA 2GOMA 2K86A 2IS1A 2QKMB 4TV7A 2VQCA 4RGUA 1F9NA 4PJJA 2HOTA 2R7UA 2DYSH 1XGSA 4IO9F 3ZPLA 4A6DA 3F6VA 3FWEA 3HPGA 3KP2A 2YR2A 4A3GJ 4XONA 5FKOA 5GPAA 2Y30A 2M8EA 2L4AA 4C3HJ 4EJVA 1FIPA 5HNHA 4L9NA 4Q5SF 2O61A 3JRAA 5FB2A 3C7JA 4HF1A 5JHFA 5LRSA 5ILSA 3F21A 3Q9SA 4NQWB 2W57A 4F3QA 1FJLA 2QSGX 3GTKJ 2CFOA 3V8LA 4C30A 4IQJA 2HPIA 3I4PA 3M8EA 1J59A 3EUHA 3JRBA 3K4MA 4B44A 1G3TA 2NVTJ 3A1YA 2LSOA 2DOAA 4KYWA 1HDPA 2ZSHB 3A01B 4C2UA 1SEUA 1LFBA 3RDIA 3RTRA 2G7HA 4EM2A 3JCUC 1EH8A 2ESHA 4AIDA 3FXUA 3ZQHA 2WA0A 4LB6B 1LEAA 1D8KA 2NYXA 5JHUA 4MTEA 2FMLA 4I0AA 3ML6A 2QM3A 5HS9A 4BJ5C 3IP4B 3I71A 4B8XA 3M4OJ 1DP3A 2OCCH 1DPUA 4KISA 1OFCX 3K4BA 3BR3A 1FYLA 2EPFA 1JXSA 3ABMH 2Z99A 1I6XA 3OIPA 3K4LA 2CW8A 4U7DA 1Y1WJ 3HZJA 1FLIA 3MKLA 2K27A 2EFQA 2OPTA 3GF2A 2VUMJ 1OCOH 1ZGJA 2XKPA 1T2KA 3I59B 4KMFA 2HWVA 1ZRDA 1IGNA 5KK1A 2HYGD 2FX0A 1BL0A 2KJBA 3RKXA 1R6RA 4XKBA 1U9OA 1IDYA 1HSTA 1QU3A 2OF7A 2ZMEB 3DPTA 4IVNA 3VYUB 3BY6A 2PJPA 1QQIA 3E6DA 3K1NA 2DOFA 2FD5A 1JUSA 3LA7A 4HV5A 4A3LJ 4RB2C 1IO2A 2H8RA 2R5ZA 3S17J 3W6VA 2V1UA 5BMZA 2A68F 1R23A 4V2FA 3S8PA 2MC4A 3PSFA 5BPDA 1XSXA 3H9JA 5GP9A 4HV6A 5LBQA 1Q1VA 2ZO4A 3J80Z 4RS8A 2BY3A 3T0YA 5K5QA 1RRJA 4XLAA 1VQ5I 3JREA 1RZ4A 3IH4A 1GXQA 4ZYAA 3ZCOA 1FP2A 2KRHA 2KIUA 1HKSA 2OTLI 3K7AJ 3CCVI 3A03A 2P81A 3LSJA 1S7AA 2EWNA 2LTPA 3MQ0A 1U9NA 2EFPA 1VQLI 1LPQA 2A5YB 1W5TA 2X4HA 2DA2A 2XVCA 4HA8A 2R7DA 5HOOA 1R1UA 1FP1D 2E60A 2HXIA 1IRFA 4PFPA 2FNAA 3HHGA 5F08A 4A6EA 3SZPA 1SFKA 1TW3A 5D5UB 4ITVA 1USSA 3BR6A 2KIFA 3OYKA 3JR9A 1R1TA 3ABLH 5F0FA 1CF7A 2EA4A 1I3AA 4BKXA 2R7OA 3ZMUA 4HNTA 4DZPA 3PFIA 3HSFA 3LFKA 1MSFC 3HTSB 2DBBA 3H9GA 3HUGB 2MYSA 5M5WJ 4ZYHA 3IAM2 2ECCA 4I01A 3N97A 1TWHJ 3T8TA 3KE2A 3CMMA 1KONA 4E7SA 4XSZF 1UHWA 4BQAA 2PN6A 2X1EA 3HHHA 2DTZA 2FMYA 3HRUA 2WAEA 1B8IB 1BI2A 1UAAA 3UKGA 3HEFA 3GWZA 3O3KA 1JKQC 4MQVA 4DIQA 1E3PA 1MDMA 4XRSA 4WXDA 4AVZA 3MWMA 1E3OC 2Z16A 3ZMSA 3SJMA 3S15J 4P1WA 4ENKA 4NHJA 2ECBA 1V4RA 3AG1H 2VE8A 3IRQA 3JRFA 4UB8C 2AQFA 3JAMK 2LD5A 2DDAA 1FMVA 2E1OA 2IJLA 3PL8A 2VBZA 3BQZA 5E1ZB 4XLNF 1PUFA 3S3MA 3A2KA 3MZYA 1J9IA 2DMQA 3CUOA 5C4XJ 4XQFA 4LOCA 4A5MA 5CPRB 1J2XA 1U8BA 2GBYA 2BHYA 2IGMA 3OSGA 1IN6A 2BE5F 5DM6F 2PFBA 1W5CC 4MTDA 3K2AA 1QZEA 4AM3A 2DAOA 3CZ6A 3SEZA 2MLGA 4CYCA 2DFFA 3BROA 1X1DA 3LSKA 1YS7A 5JR3A 2PJRB 5LGNA 1MNEA 4AC0A 2UXXA 4LMYA 3AKZA 4M9XA 3TO6A 1QBJA 2K85A 4RB1A 3LA3A 5DV5A 4CA0A 4O3MA 2W25A 2EFNA 4ZJZA 4XN0A 1HKTA 2XSJC 3FM3A 2H6CA 1Z6RA 1H88C 1XPXA 1IN4A 4ESJA 3HRTA 2MGQA 1JTYA 2HQRA 4M72A 3DLLF 2CU7A 2YU9J 4RDUA 3P5JA 2TRTA 4RAYA 3FXRA 4OAZA 2M30A 2LBFA 3OYMA 1I3QJ 4PSWA 2DA4A 4FISA 2VBYA 5CLSA 5FLXK 3L2VA 2F5DA 1U3EM 2GIVA 1RIOH 4BGDA 1JKPC 9ANTA 1Z7LA 3SZTA 2M0CA 3V7SA 3TEDA 4CCOA 1N77A 3M3YJ 3V8JA 2ZB9A 1FSHA 1J09A 3JAMZ 1ZR4A 2QQBA 3MFKA 3FBNB 1TWCJ 1UFMA 1IXSB 3HG9A 1UJ8A 4X1EA 3SFZA 2M87A 3SDBA 5E1XA 2ZJPF 1E0EA 1GVDA 2BVMA 4V19K 2AXTC 2FBIA 2BGCA 4IJAA 4XKVA 4BXXJ 1LUJB 3GCMA 4LITA 4HYEA 3CCSI 1QHGA 1WH7A 4HF0A 2LR8A 5B5EC 2DA3A 1JJ8C 3FHZA 3HGYA 1MNDA 1OPCA 2CJJA 3B6AA 2C6YA 3BZ6A 2I5UA 2BVLA 1HBXG 2KL4A 4EM1A 1EH6A 1MKMA 3K0LA 3P9IA 3OIOA 3WU1B 2HPMA 5ICFA 3TOAA 2FOKA 4CO8A 1GXPA 1ZH5A 3WU2C 2QQ9A 3S93A 1VQ9I 3LSRA 1DP7P 1Y8QB 1VQ4I 2BY2A 4CXFA 4Y7NJ 5KNLA 4I98B 1Y8RB 3J7YJ 1K78A 4WF2A 3WTVC 1KA8A 2OCEA 5HDKA 3OS2A 4JX5A 5DS9A 1BBYA 4GRIA 1D0YA 1JE8A 3KETA 5D8LB 1ZK8A 4J19A 4DW6A 5FLXZ 1JUMA 4EV0A 3I0TA 2X6YA 1YX3A 2VXZA 2IA2A 3M7GA 4D5FA 4X6AJ 3TBIA 4UVBA 5FLVA 2GM4A 2VKHA 3LSIA 2W82A 1B72B 2OQGA 5L3GA 2ZBKA 5E3NA 1I5ZA 5E79C 1HXDA 4D5CA 2ZCWA 1HKQA 4OAYA 2ZJ2A 4XIDA 4GFBA 1RKTA 3BC8A 3O8HA 4RMNA 1MMDA 3DU5A 4KUMA 3HDDA 1O7LA 2QWWA 2XAHA 5C4JJ 2O8KA 4PUSA 2W48A 3GFIA 2HOEA 3DCFA 3JSPA 4ZDPA 1IDZA 1KU2A 1SMYF 3ELKA 3RYRA 5L3FA 3LAPA 5GPCA 1VTNC 4S04A 4A3FJ 5BOXA 1YO5C 3HOSA 4QPOA 3KEYA 5K1YA 3LL7A 4XRSG 3COAC 3TQNA 1GHCA 1MSEC 2RGVA 3BJAA 2BW3B 3ABTA 3E3VA 3K9TA 4O6JA 2V7FA 3G73A 5LHGA 1HDDC 1NHAA 2K02A 3W6JB 2H1KA 2VL8A
chains in the Genus database with same CATH topology
3WTTC 3FZVA 3HIFA 2OZUA 3BOQA 4L9TA 4Q48A 4ON0A 5DD8A 2R7FA 2Y75A 4Z2YA 2GA1A 2E1CA 1R5GA 4GGGA 2X0LA 2JSCA 2LDUA 1B1BA 3QPTA 4CYDA 4LLGF 1XGOA 3RKWA 2ZNZA 2ADUA 5ICCA 1TQPA 2Z5UA 1YTYA 4M71A 3IC7A 2K4BA 3FX3A 1OYYA 4BYYA 2LKPA 3F22A 1SAXA 2GZWA 4CZZA 4HLXA 4UXNA 4YG2F 5DCMA 1BI3A 1U5TB 1ZREA 4EGYA 3FMQA 3KFWX 2LNBA 1T38A 1BIBA 3F8NA 1PDNC 4CICA 3RPQA 5DDGA 4JQFA 4L0ZB 4HQMA 3HSRA 1HSJA 2J5OA 2W24A 2VT3A 2A6HF 3I53A 1Z9CA 4KN4X 2XAFA 1TTYA 1PP7U 4KT5C 4G6DA 3C1DA 1XDUA 3JTGA 1PUEE 4HAMA 5D5WB 4L9VA 3P9CA 2IA0A 3WTSC 3PQKA 2HFHA 1ZG5A 5CJ9A 3GVAA 3F8MA 5JVTA 4EGZA 2XIGA 2E7XA 4UUVA 1T6SA 4M73A 1XGMA 3MCZA 5FFXA 4I2OA 4R8HA 5J6XA 4G7ZF 4KMUX 4L5JA 4HZFA 2Q0OA 3GX4X 2RNJA 4ZYEA 2PEXA 3I54A 1FBUA 2V6CA 3SXYA 5LGTA 4MEXF 2OA4A 3W6KB 5FFZA 4G7HF 2VE9A 2Y0MA 3GUDA 4WCGA 2OU2A 2W84A 3M8FA 4LK1F 5D6EA 4R1HA 3E5UA 3N4MA 4FHTA 5HS8A 2CGPA 1Z7UA 3RPUA 3NQOA 1G6NA 1EH7A 4AWXB 2D45A 4N9HA 2IT0A 2PLYA 1YW9A 1B9NA 1W5SA 3CO6C 1MGTA 1Z1DA 3BP8A 4G8XA 5LHIA 2AXLA 3FMRA 1P6RA 5J8FA 1MZBA 1ZN2A 1O3QA 1FBQA 5EEGA 1YW7A 3BWGA 3CLOA 4EM0B 1P4AA 2HGCA 3TGNA 3J80K 1SFEA 3LWFA 2H94A 1BM9A 4ESBA 3ZP5A 4YIFA 1BC7C 3DEUA 4O5VA 4A2UA 5K5OA 2P8TA 5A2QZ 2CQKA 2BV6A 2PMUA 4F7ZA 4IHSA 3WTWC 1FNNA 4XRFA 4YIIA 2E7WA 3TOBA 2GA2A 3GYHX 5F64A 5CVIA 5LLQA 4LG0B 3SQNA 2YX4A 5BQTA 3GXOA 2F5CA 2VN2A 2MD5A 1LDJA 3AAFA 5CVUA 4XSXF 3VFZA 2GXBA 3IWFA 2NAZA 1ZG3A 2DTRA 4QWQA 3ZMTA 2J5PA 1E17A 2ISYA 1FYKA 3LQQA 4UV8A 2CO5A 4BHPA 3L09A 2O8XA 5H6QA 3CTAA 1ULYA 2NNNA 1JHFA 4MNUA 5JI6A 1XD7A 4BNCA 2XGXA 3QAHA 2VOOA 3D0SA 3K1PA 2FSWA 5E8GA 1EV7A 3REOA 3ZN1A 2EV6A 2PQ8A 1LQ1A 4RGSA 1QZZA 1MDMB 3V7RA 3T5XA 1CGPA 4OIPF 3IL2A 1IUYA 2WTEA 4B09A 1IN8A 3J7AO 3Q5FA 3ISPA 4UVCA 3WE3A 1Q1HA 2FA5A 3E5XA 3I5UA 1HQCA 4G94A 3E5QA 1WQ2A 4D0PA 1GVJA 2P6SA 4BAYA 3ULQB 2ZFWA 3KEOA 4HDVA 3R61A 3ROUA 2K4JA 2HDCA 2CSOA 4XLPF 2MH2A 3ERED 1TNTA 2XROA 2NS0A 1XSVA 2DK8A 3R60A 2NRAC 4LFUA 1HW5A 1SD4A 1FX7A 2VODA 1W7PA 3DXJF 4IRIA 5ICGA 4CGZA 5H20A 2BBYA 4OMYA 1WI9A 1O57A 1SFXA 3FXQA 1LB2A 3DV8A 2YPRA 1RUOA 4L18B 4HF2A 1Z91A 4ESFA 2L02A 1USTA 4U7BA 2UZKA 2QZ8A 3F8CA 2OBPA 2L3DA 1KU7A 3U9GA 3L00A 4P5OA 4FX4A 4BH9A 1E2XA 2O0YA 5DD4A 4LLNA 2A3SA 3K1MA 1OYIA 1MJ9A 3HYIA 4WX9A 2MH9A 2FE3A 4ZZDA 2FBKA 2O3FA 2F5EA 1K78B 2L4MA 3BPXA 1G3SA 5D5XB 1B4AA 3OOPA 2DPDA 1STZA 4Y17A 4BHBA 1KU9A 5TJJA 2ETHA 2P5LC 4XBFA 4R79A 4EJUA 2DQLA 3OV8A 4BXUA 2F2EA 3F6OA 2WV0A 4MHGA 4RGXA 2Z3YA 1Z05A 1XMAA 2Q2EA 4OOIA 2P5VA 3KP5A 1PP8F 1ON1A 3RJPA 2CFXA 2AS5F 5DUKA 1WKMA 3C18A 1UCRA 2PBIA 2P4WA 1D5VA 3IRRA 2EV0A 1ZLJA 3GW2A 3KZYA 3KLOA 4P96A 5DYMA 1W7PD 2FNPA 2VC1A 3TKYA 3KP4A 3EDPA 3KZZA 2EJRA 4PZJA 2YSRA 1SFUA 3I64A 2DO7A 4PDKA 4A0ZA 4N0BA 1OR7A 1FBSA 1UHMA 2IVMA 3MEXA 2OZ6A 1FY7A 3HOTA 2RVCA 4E70A 4Q4ZF 4UNOA 4I09A 1X3UA 3F8BA 2XASA 2D2WA 3IWZA 4KDPA 1QO0D 4ENNA 4HQEA 3WODF 2BEOA 1ZHFA 4WXCA 5AIPA 2QLZA 3F3XA 5FGMA 3CUQC 3I58A 2ISZA 1R7JA 5AONA 5DCMB 2MBFA 4WWCA 2G7UA 2DI3A 4IRGA 1LVAA 3BJOA 3GEZA 1SD5A 3HTUA 1TNSA 2HEOA 3HRMA 3V7CA 3ZMVA 1L3LA 2A6EF 5LEJA 4GXOA 1TQMA 2FF4A 1W4MA 4CHUA 3CO7C 4WK8F 3LAJA 3IKVA 2QYOA 1S6LA 1IN7A 4I7HA 2YX7A 3L9FA 1K7AA 2ZKZA 5JFRA 1U2WA 2OAZA 1A04A 1XGNA 4LGWA 2QUFA 5D6FA 2A07F 1K79A 3S2WA 3V4GA 3ECHA 3DPLC 2EA2A 3ZMZA 2IP2A 4JBAA 4ZYDA 3DKWA 4GYIA 1BOAA 1KQ0A 4RAZA 4Y13A 3WTUC 1B6AA 5L3CA 3WTYC 1S7OA 3KCCA 2QBYA 1RNLA 2XAGA 4LD5A 5HS7A 1T0FA 3WTZA 3GFLA 4HDUA 2TDXA 2H27A 2XRNA 1TW2A 1U6GA 5J8CA 3TDUC 4WXHA 1D8JA 4ENJA 1BC8C 2V1DA 1QNTA 4AIJA 3E6CC 5IT9Z 4EJWA 4U0YA 4YFXF 2IA1A 4ENMA 2GQQA 1RUNA 1LDDA 4U0VA 1IW7F 4OU0A 2D1HA 4MQ9F 4AVPA 3P7NA 2FBHA 5E17F 2JTVA 4FT8A 4RB3C 3R6SA 3CJNA 1FZPB 1FT9A 1FC3A 3J81Z 1R58A 4IF4A 3CUQA 1ZRCA 2P6TA 3JW4A 5A2QK 4KIBA 3EQLF 4NB5A 1BI0A 2XKOA 1IAWA 1H9GA 3HSEA 5TRDA 3M9AA 4U0WA 4N9IA 2RV8A 6PAXA 1R00A 2JPBA 3BJ6A 5D4RA 3JTHA 5HVQC 4Q47A 2A69F 4M9SA 4G9YA 4KNYA 2IRFG 2B0LA 3ZN0A 1YLFA 4RB0A 4KICA 1S3JA 2DW4A 2KKOA 2VT2A 2L01A 5HDNA 4MGRA 3GZ6A 2E1NA 1O3SA 4EJOA 3K69A 2DLLA 3WTXC 2QENA 3GO5A 4EJTA 1BN5A 3KLNA 3H3UA 1R22A 2VC0A 1RI7A 1F5TA 5D4SA 2EFOA 1KGSA 2MLKA 3G3ZA 5FD6A 2V9VA 2ACJA 5ILUA 3IKTA 2EV5A 1FSEA 3GFMA 3EYYA 4ZZLA 1P92A 2KJCA 2OQRA 2NNYA 2KRFA 4HLYA 1B9MA 2WWYA 4HX4A 4BHCA 5BPIA 2PG4A 1IRGA 1S8NA 2M45A 3JSOA 5L3BA 4OIOF 2ELHA 2HKXA 1BJAA 1KQ8A 5CVRA 4NQWA 2COMA 3D5LA 2FU4A 3Q9VA 2XAJA 1MJAA 2LF7A 3E97A 5LGUA 5E1WA 2WC2A 3O6BB 5ERIA 3U2RA 1CF7B 5H6RA 1TLHB 5LEKA 2DU9A 1YYVA 2XUBA 2RC4A 4LK0F 4H0EA 2UXNA 5ICEA 4DNCA 3I59A 5ILVA 3F8FA 3QRFF 1KYZA 3GZ5A 4UHTA 4UVAA 2OD5A 1FYMA 2ZMEA 4LG0A 3QU3A 1U8RA 1L0OC 1J5YA 4LLLA 3VODA 1F1ZA 4A0YA 2F5FA 2O03A 3VEPA 1IXCA 2ESNA 3RI4A 3V8KA 5CVVA 1AWCA 1MD0A 1FPQA 1LJ9A 3KEQA 2DK5A 1KYWA 4IXAA 4K2EA 1W7PB 1HW2A 3BDDA 5HLHA 5FD5A 1FOKA 4PGGA 2GAUA 1REPC 3U1DA 5E20A 1H0MA 2XV4S 4GYGA 4L9JA 3B02A 3WGGA 5E8IA 1ZG1A 4QLCU 1IN5A 1V3FA 4ZH4F 3K2ZA 1I27A 1O3TA 2RDPA 1G4DA 4L0YB 2ZXJA 5L3DA 2CWEA 3HRSA 3HUGA 4KFCA 1G3YA 5FO5A 4AIHA 1JHHA 3EETA 3DQVC 1R5HA 4OMZA 1DUXC 1B59A 3NEUA 2P5KA 2EFWA 2STTA 2A61A 4Y15A 2GWRA 4KIFA 3TO9A 3WG9A 2FQ3A 2DPUA 1R36A 2CW0F 2HR3A 4OIRF 2O6GE 1MJBA 3E6MA 3CDHA 4JK1X 2DT5A 1J0RA 4HW0A 2FRHA 2VBXA 1FWZA 2IW5A 1XDSA 4P55A 1UB9A 1K6OA 3VB2A 5D8KB 4IPAA 2M5WA 1R1VA 3DFGA 4A12A 4M6YA 3RIRA 2Z9OA 3GFJA 4PCQA 1TQIA 4CDGA 4DQ2A 1OMIA 2RQPA 3O2PE 4MEYF 5HDGA 3QU6A 5CVJA 3R0AA 1ZARA 1OYWA 4HX7A 1ZYRF 5F1RA 1LDKB 3MAJA 1YIOA 1IF1A 2W85A 1ZLKA 5LRRA 4ETSA 2HYFA 1Z6TA 1WWXA 3WGHA 3F23A 2L54A 2MA3A 1P4WA 1OKRA 2BYVE 3ZMDA 1H9TA 3B73A 2PMHA 4P9FA 3KP7A 2Y48A 1U5TC 2DQRA 1YW8A 2DFIA 3MZHA 3FM5A 1ZGAA 1I1SA 4PGHA 2CYYA 4UV9A 3EYIA 5E18F 1WRJA 3QP6A 2VONA 3T8RA 1ONVA 2R3SA 5D5VB 3L7WA 2H09A 1WSUA 2RN7A 3VOEA 1ZRFA 5BS6A 3WGIA 4ASNA 2FXAA 1T98A 4EQQA 2HQNA 3ECOA 4P9UA 1XCVA 3LQRA 2QQAA 2EB7A 5L3EA 3L2CA 4OIQF 1ZAOA 1XB4A 3F72A 3PQJA 4RGRA 4HBLA 3TO7A 4IRHA 4LJZF 5CYVA 1XSDA 2JPCA 5ED4A 4LB5A 3P9KA 1HW1A 3KP6A 4ZYGA 2IPQX 1QPMA 3BPVA 2HTSA 3WU0A 1O7FA 3ABUA 3T1BA 2G9WA 4YFNF 1LEBA 1YS6A 2STWA 1TBXA 2HS5A 1LNWA 1C0WA 1XCBA 4I02A 2CG4A 4G7OF 3R4KA 3LSTA 3DP7A 3FMSA 2EK5A 3C3WA 1JGSA 2XHKA 5IT9K 4KIGA 5LHHA 3M1EA 4HX8A 2V1XA 2GXGA 1J7KA 1O3RA 2PI0A 4M74A 2K7LA 3QP5A 1XMKA 5KVRA 1BIAA 5HLGA 4FX0A 4EVIA 3H3ZA 2QBYB 4YFKF 1QGPA 4HOBA 1KU3A 2FEZA 5HLIA 3GLXA 4A0XA 2JRTA 2HZTA 3E6BA 5K5RA 4KA4A 3J81K 5DEQA 2Z33A 1DDNA 3WE2A 1ON2A 4GCVA 1QZYA 4M9ZA 1P2FA 2P7CB 1Y0UA 4I0BA 1KQ9A 2JZYA 1U5TA 2MC3A 2Q8KA 2D1VA 2JT1A 4IHTA 4U88A 1YG2A 5IT3A 1T39A 4AIKA 5AIQA 4S05A 4L5IA 2QVOA 2HKOA 4G6QA 1F4KA 4EMSA 2RKHA 3QOPA 4M6XA 1SMTA 3CUQB 1YQAA 5DUIA 2ZNYA 2HTJA 1J75A 2XAQA 3TDZC 2KIMA 3LA2A 1BI1A 3IHUA 4OINF 3QPHA 3H92A 3NRVA 1S29A 4GO1A 2VOPA 3DF8A 2LF8A 3RKYA 1D3YA 3RYPA 4A5NA 5EEHA 2V79A 1DPRA 1XN7A 2H6BA 1I1GA 3KP3A 1ODDA 3R0JA 1AOYA 5F6FA 1U78A 2M1BA 2P7VB 1P4XA 1YFHA 1IXRC 2YU3A 4KN7X 3SHFA 1IZ1A 1SD6A 1G3WA 3ZQ7A 1SD7A 2VBWA 3FF5A 5DCFA 4AD9A 2UWMA 2K86A 4TV7A 4RGUA 1F9NA 1XGSA 3ZPLA 4A6DA 3F6VA 3FWEA 3KP2A 2YR2A 2M8EA 2L4AA 4EJVA 4Q5SF 4L9NA 2O61A 5FB2A 3C7JA 4HF1A 5LRSA 5ILSA 3F21A 3Q9SA 2W57A 3V8LA 3I4PA 3M8EA 1J59A 3EUHA 1G3TA 2LSOA 4KYWA 3RDIA 3RTRA 2G7HA 4EM2A 1EH8A 2ESHA 3FXUA 4LB6B 1LEAA 1D8KA 2NYXA 5JHUA 4MTEA 2FMLA 4I0AA 3ML6A 2QM3A 5HS9A 3I71A 4B8XA 1DPUA 1FYLA 1JXSA 2Z99A 1I6XA 1FLIA 4U7DA 2K27A 2EFQA 3GF2A 1ZGJA 2XKPA 1T2KA 3I59B 4KMFA 2HWVA 1ZRDA 5KK1A 2HYGD 2KJBA 3RKXA 1HSTA 2ZMEB 3DPTA 4IVNA 3BY6A 2PJPA 1QQIA 3E6DA 3K1NA 3LA7A 4HV5A 4RB2C 2V1UA 5BMZA 2A68F 1R23A 5BPDA 1XSXA 4HV6A 5LBQA 2ZO4A 3J80Z 4RS8A 3T0YA 5K5QA 1RZ4A 1GXQA 1FP2A 2KIUA 1HKSA 1S7AA 2EWNA 3MQ0A 2EFPA 2A5YB 1W5TA 2X4HA 2XVCA 4HA8A 2R7DA 5HOOA 1R1UA 1FP1D 1IRFA 2FNAA 3HHGA 4A6EA 3SZPA 1TW3A 5D5UB 1USSA 2KIFA 1R1TA 1CF7A 2EA4A 3ZMUA 3PFIA 3HSFA 3LFKA 3HTSB 2DBBA 4ZYHA 4I01A 3N97A 3T8TA 3KE2A 4XSZF 1UHWA 4BQAA 2PN6A 3HHHA 2FMYA 3HRUA 1BI2A 3GWZA 3O3KA 4MQVA 1MDMA 4WXDA 3MWMA 3ZMSA 4ENKA 4NHJA 1V4RA 2VE8A 3IRQA 3JAMK 2IJLA 2VBZA 5E1ZB 4XLNF 3MZYA 1J9IA 3CUOA 4A5MA 1J2XA 1IN6A 2BE5F 2PFBA 4MTDA 2DAOA 2MLGA 3BROA 1YS7A 5JR3A 5LGNA 2UXXA 4LMYA 4M9XA 3TO6A 1QBJA 4RB1A 3LA3A 5DV5A 4O3MA 2W25A 2EFNA 1HKTA 3FM3A 2H6CA 1Z6RA 1IN4A 4ESJA 3HRTA 2HQRA 4M72A 4RAYA 3FXRA 2M30A 2VBYA 5CLSA 5FLXK 2F5DA 1U3EM 2GIVA 1RIOH 3SZTA 3V7SA 3V8JA 1FSHA 3JAMZ 2QQBA 3MFKA 1UFMA 1IXSB 3SFZA 2M87A 5E1XA 2FBIA 2BGCA 4IJAA 4HYEA 4HF0A 3FHZA 1OPCA 2C6YA 3BZ6A 1HBXG 4EM1A 1EH6A 1MKMA 3K0LA 3P9IA 3WU1B 5ICFA 3TOAA 2FOKA 4CO8A 1GXPA 1ZH5A 2QQ9A 1DP7P 4CXFA 4I98B 1K78A 4WF2A 3WTVC 1KA8A 5HDKA 1BBYA 1JE8A 3KETA 5D8LB 5FLXZ 4EV0A 3I0TA 2VXZA 3M7GA 2IA2A 4UVBA 2OQGA 5L3GA 2ZBKA 1I5ZA 1HXDA 2ZCWA 1HKQA 2ZJ2A 4KUMA 1O7LA 2QWWA 2XAHA 3GFIA 2HOEA 3JSPA 1KU2A 1SMYF 3ELKA 3RYRA 5L3FA 3LAPA 1VTNC 4S04A 5BOXA 1YO5C 3HOSA 5K1YA 3COAC 1GHCA 3TQNA 2RGVA 3BJAA 3ABTA 3G73A 3E3VA 3K9TA 4O6JA 5LHGA 1NHAA 2K02A 3W6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTT C;  3FZV A;  3HIF A;  2OZU A;  3BOQ A;  4L9T A;  4Q48 A;  4ON0 A;  5DD8 A;  2R7F A;  2Y75 A;  4Z2Y A;  2GA1 A;  2E1C A;  1R5G A;  4GGG A;  2X0L A;  2JSC A;  2LDU A;  1B1B A;  3QPT A;  4CYD A;  4LLG F;  1XGO A;  3RKW A;  2ZNZ A;  2ADU A;  5ICC A;  1TQP A;  2Z5U A;  1YTY A;  4M71 A;  3IC7 A;  2K4B A;  3FX3 A;  1OYY A;  4BYY A;  2LKP A;  3F22 A;  1SAX A;  2GZW A;  4CZZ A;  4HLX A;  4UXN A;  4YG2 F;  5DCM A;  1BI3 A;  1U5T B;  1ZRE A;  4EGY A;  3FMQ A;  3KFW X;  2LNB A;  1T38 A;  1BIB A;  3F8N A;  1PDN C;  4CIC A;  3RPQ A;  5DDG A;  4JQF A;  4L0Z B;  4HQM A;  3HSR A;  1HSJ A;  2J5O A;  2W24 A;  2VT3 A;  2A6H F;  3I53 A;  1Z9C A;  4KN4 X;  2XAF A;  1TTY A;  1PP7 U;  4KT5 C;  4G6D A;  3C1D A;  1XDU A;  3JTG A;  1PUE E;  4HAM A;  5D5W B;  4L9V A;  3P9C A;  2IA0 A;  3WTS C;  3PQK A;  2HFH A;  1ZG5 A;  5CJ9 A;  3GVA A;  3F8M A;  5JVT A;  4EGZ A;  2XIG A;  2E7X A;  4UUV A;  1T6S A;  4M73 A;  1XGM A;  3MCZ A;  5FFX A;  4I2O A;  4R8H A;  5J6X A;  4G7Z F;  4KMU X;  4L5J A;  4HZF A;  2Q0O A;  3GX4 X;  2RNJ A;  4ZYE A;  2PEX A;  3I54 A;  1FBU A;  2V6C A;  3SXY A;  5LGT A;  4MEX F;  2OA4 A;  3W6K B;  5FFZ A;  4G7H F;  2VE9 A;  2Y0M A;  3GUD A;  4WCG A;  2OU2 A;  2W84 A;  3M8F A;  4LK1 F;  5D6E A;  4R1H A;  3E5U A;  3N4M A;  4FHT A;  5HS8 A;  2CGP A;  1Z7U A;  3RPU A;  3NQO A;  1G6N A;  1EH7 A;  4AWX B;  2D45 A;  4N9H A;  2IT0 A;  2PLY A;  1YW9 A;  1B9N A;  1W5S A;  3CO6 C;  1MGT A;  1Z1D A;  3BP8 A;  4G8X A;  5LHI A;  2AXL A;  3FMR A;  1P6R A;  5J8F A;  1MZB A;  1ZN2 A;  1O3Q A;  1FBQ A;  5EEG A;  1YW7 A;  3BWG A;  3CLO A;  4EM0 B;  1P4A A;  2HGC A;  3TGN A;  3J80 K;  1SFE A;  3LWF A;  2H94 A;  1BM9 A;  4ESB A;  3ZP5 A;  4YIF A;  1BC7 C;  3DEU A;  4O5V A;  4A2U A;  5K5O A;  2P8T A;  5A2Q Z;  2CQK A;  2BV6 A;  2PMU A;  4F7Z A;  4IHS A;  3WTW C;  1FNN A;  4XRF A;  4YII A;  2E7W A;  3TOB A;  2GA2 A;  3GYH X;  5F64 A;  5CVI A;  5LLQ A;  4LG0 B;  3SQN A;  2YX4 A;  5BQT A;  3GXO A;  2F5C A;  2VN2 A;  2MD5 A;  1LDJ A;  3AAF A;  5CVU A;  4XSX F;  3VFZ A;  2GXB A;  3IWF A;  2NAZ A;  1ZG3 A;  2DTR A;  4QWQ A;  3ZMT A;  2J5P A;  1E17 A;  2ISY A;  1FYK A;  3LQQ A;  4UV8 A;  2CO5 A;  4BHP A;  3L09 A;  2O8X A;  5H6Q A;  3CTA A;  1ULY A;  2NNN A;  1JHF A;  4MNU A;  5JI6 A;  1XD7 A;  4BNC A;  2XGX A;  3QAH A;  2VOO A;  3D0S A;  3K1P A;  2FSW A;  5E8G A;  1EV7 A;  3REO A;  3ZN1 A;  2EV6 A;  2PQ8 A;  1LQ1 A;  4RGS A;  1QZZ A;  1MDM B;  3V7R A;  3T5X A;  1CGP A;  4OIP F;  3IL2 A;  1IUY A;  2WTE A;  4B09 A;  1IN8 A;  3J7A O;  3Q5F A;  3ISP A;  4UVC A;  3WE3 A;  1Q1H A;  2FA5 A;  3E5X A;  3I5U A;  1HQC A;  4G94 A;  3E5Q A;  1WQ2 A;  4D0P A;  1GVJ A;  2P6S A;  4BAY A;  3ULQ B;  2ZFW A;  3KEO A;  4HDV A;  3R61 A;  3ROU A;  2K4J A;  2HDC A;  2CSO A;  4XLP F;  2MH2 A;  3ERE D;  1TNT A;  2XRO A;  2NS0 A;  1XSV A;  2DK8 A;  3R60 A;  2NRA C;  4LFU A;  1HW5 A;  1SD4 A;  1FX7 A;  2VOD A;  1W7P A;  3DXJ F;  4IRI A;  5ICG A;  4CGZ A;  5H20 A;  2BBY A;  4OMY A;  1WI9 A;  1O57 A;  1SFX A;  3FXQ A;  1LB2 A;  3DV8 A;  2YPR A;  1RUO A;  4L18 B;  4HF2 A;  1Z91 A;  4ESF A;  2L02 A;  1UST A;  4U7B A;  2UZK A;  2QZ8 A;  3F8C A;  2OBP A;  2L3D A;  1KU7 A;  3U9G A;  3L00 A;  4P5O A;  4FX4 A;  4BH9 A;  1E2X A;  2O0Y A;  5DD4 A;  4LLN A;  2A3S A;  3K1M A;  1OYI A;  1MJ9 A;  3HYI A;  4WX9 A;  2MH9 A;  2FE3 A;  4ZZD A;  2FBK A;  2O3F A;  2F5E A;  1K78 B;  2L4M A;  3BPX A;  1G3S A;  5D5X B;  1B4A A;  3OOP A;  2DPD A;  1STZ A;  4Y17 A;  4BHB A;  1KU9 A;  5TJJ A;  2ETH A;  2P5L C;  4XBF A;  4R79 A;  4EJU A;  2DQL A;  3OV8 A;  4BXU A;  2F2E A;  3F6O A;  2WV0 A;  4MHG A;  4RGX A;  2Z3Y A;  1Z05 A;  1XMA A;  2Q2E A;  4OOI A;  2P5V A;  3KP5 A;  1PP8 F;  1ON1 A;  3RJP A;  2CFX A;  2AS5 F;  5DUK A;  1WKM A;  3C18 A;  1UCR A;  2PBI A;  2P4W A;  1D5V A;  3IRR A;  2EV0 A;  1ZLJ A;  3GW2 A;  3KZY A;  3KLO A;  4P96 A;  5DYM A;  1W7P D;  2FNP A;  2VC1 A;  3TKY A;  3KP4 A;  3EDP A;  3KZZ A;  2EJR A;  4PZJ A;  2YSR A;  1SFU A;  3I64 A;  2DO7 A;  4PDK A;  4A0Z A;  4N0B A;  1OR7 A;  1FBS A;  1UHM A;  2IVM A;  3MEX A;  2OZ6 A;  1FY7 A;  3HOT A;  2RVC A;  4E70 A;  4Q4Z F;  4UNO A;  4I09 A;  1X3U A;  3F8B A;  2XAS A;  2D2W A;  3IWZ A;  4KDP A;  1QO0 D;  4ENN A;  4HQE A;  3WOD F;  2BEO A;  1ZHF A;  4WXC A;  5AIP A;  2QLZ A;  3F3X A;  5FGM A;  3CUQ C;  3I58 A;  2ISZ A;  1R7J A;  5AON A;  5DCM B;  2MBF A;  4WWC A;  2G7U A;  2DI3 A;  4IRG A;  1LVA A;  3BJO A;  3GEZ A;  1SD5 A;  3HTU A;  1TNS A;  2HEO A;  3HRM A;  3V7C A;  3ZMV A;  1L3L A;  2A6E F;  5LEJ A;  4GXO A;  1TQM A;  2FF4 A;  1W4M A;  4CHU A;  3CO7 C;  4WK8 F;  3LAJ A;  3IKV A;  2QYO A;  1S6L A;  1IN7 A;  4I7H A;  2YX7 A;  3L9F A;  1K7A A;  2ZKZ A;  5JFR A;  1U2W A;  2OAZ A;  1A04 A;  1XGN A;  4LGW A;  2QUF A;  5D6F A;  2A07 F;  1K79 A;  3S2W A;  3V4G A;  3ECH A;  3DPL C;  2EA2 A;  3ZMZ A;  2IP2 A;  4JBA A;  4ZYD A;  3DKW A;  4GYI A;  1BOA A;  1KQ0 A;  4RAZ A;  4Y13 A;  3WTU C;  1B6A A;  5L3C A;  3WTY C;  1S7O A;  3KCC A;  2QBY A;  1RNL A;  2XAG A;  4LD5 A;  5HS7 A;  1T0F A;  3WTZ A;  3GFL A;  4HDU A;  2TDX A;  2H27 A;  2XRN A;  1TW2 A;  1U6G A;  5J8C A;  3TDU C;  4WXH A;  1D8J A;  4ENJ A;  1BC8 C;  2V1D A;  1QNT A;  4AIJ A;  3E6C C;  5IT9 Z;  4EJW A;  4U0Y A;  4YFX F;  2IA1 A;  4ENM A;  2GQQ A;  1RUN A;  1LDD A;  4U0V A;  1IW7 F;  4OU0 A;  2D1H A;  4MQ9 F;  4AVP A;  3P7N A;  2FBH A;  5E17 F;  2JTV A;  4FT8 A;  4RB3 C;  3R6S A;  3CJN A;  1FZP B;  1FT9 A;  1FC3 A;  3J81 Z;  1R58 A;  4IF4 A;  3CUQ A;  1ZRC A;  2P6T A;  3JW4 A;  5A2Q K;  4KIB A;  3EQL F;  4NB5 A;  1BI0 A;  2XKO A;  1IAW A;  1H9G A;  3HSE A;  5TRD A;  3M9A A;  4U0W A;  4N9I A;  2RV8 A;  6PAX A;  1R00 A;  2JPB A;  3BJ6 A;  5D4R A;  3JTH A;  5HVQ C;  4Q47 A;  2A69 F;  4M9S A;  4G9Y A;  4KNY A;  2IRF G;  2B0L A;  3ZN0 A;  1YLF A;  4RB0 A;  4KIC A;  1S3J A;  2DW4 A;  2KKO A;  2VT2 A;  2L01 A;  5HDN A;  4MGR A;  3GZ6 A;  2E1N A;  1O3S A;  4EJO A;  3K69 A;  2DLL A;  3WTX C;  2QEN A;  3GO5 A;  4EJT A;  1BN5 A;  3KLN A;  3H3U A;  1R22 A;  2VC0 A;  1RI7 A;  1F5T A;  5D4S A;  2EFO A;  1KGS A;  2MLK A;  3G3Z A;  5FD6 A;  2V9V A;  2ACJ A;  5ILU A;  3IKT A;  2EV5 A;  1FSE A;  3GFM A;  3EYY A;  4ZZL A;  1P92 A;  2KJC A;  2OQR A;  2NNY A;  2KRF A;  4HLY A;  1B9M A;  2WWY A;  4HX4 A;  4BHC A;  5BPI A;  2PG4 A;  1IRG A;  1S8N A;  2M45 A;  3JSO A;  5L3B A;  4OIO F;  2ELH A;  2HKX A;  1BJA A;  1KQ8 A;  5CVR A;  4NQW A;  2COM A;  3D5L A;  2FU4 A;  3Q9V A;  2XAJ A;  1MJA A;  2LF7 A;  3E97 A;  5LGU A;  5E1W A;  2WC2 A;  3O6B B;  5ERI A;  3U2R A;  1CF7 B;  5H6R A;  1TLH B;  5LEK A;  2DU9 A;  1YYV A;  2XUB A;  2RC4 A;  4LK0 F;  4H0E A;  2UXN A;  5ICE A;  4DNC A;  3I59 A;  5ILV A;  3F8F A;  3QRF F;  1KYZ A;  3GZ5 A;  4UHT A;  4UVA A;  2OD5 A;  1FYM A;  2ZME A;  4LG0 A;  3QU3 A;  1U8R A;  1L0O C;  1J5Y A;  4LLL A;  3VOD A;  1F1Z A;  4A0Y A;  2F5F A;  2O03 A;  3VEP A;  1IXC A;  2ESN A;  3RI4 A;  3V8K A;  5CVV A;  1AWC A;  1MD0 A;  1FPQ A;  1LJ9 A;  3KEQ A;  2DK5 A;  1KYW A;  4IXA A;  4K2E A;  1W7P B;  1HW2 A;  3BDD A;  5HLH A;  5FD5 A;  1FOK A;  4PGG A;  2GAU A;  1REP C;  3U1D A;  5E20 A;  1H0M A;  2XV4 S;  4GYG A;  4L9J A;  3B02 A;  3WGG A;  5E8I A;  1ZG1 A;  4QLC U;  1IN5 A;  1V3F A;  4ZH4 F;  3K2Z A;  1I27 A;  1O3T A;  2RDP A;  1G4D A;  4L0Y B;  2ZXJ A;  5L3D A;  2CWE A;  3HRS A;  3HUG A;  4KFC A;  1G3Y A;  5FO5 A;  4AIH A;  1JHH A;  3EET A;  3DQV C;  1R5H A;  4OMZ A;  1DUX C;  1B59 A;  3NEU A;  2P5K A;  2EFW A;  2STT A;  2A61 A;  4Y15 A;  2GWR A;  4KIF A;  3TO9 A;  3WG9 A;  2FQ3 A;  2DPU A;  1R36 A;  2CW0 F;  2HR3 A;  4OIR F;  2O6G E;  1MJB A;  3E6M A;  3CDH A;  4JK1 X;  2DT5 A;  1J0R A;  4HW0 A;  2FRH A;  2VBX A;  1FWZ A;  2IW5 A;  1XDS A;  4P55 A;  1UB9 A;  1K6O A;  3VB2 A;  5D8K B;  4IPA A;  2M5W A;  1R1V A;  3DFG A;  4A12 A;  4M6Y A;  3RIR A;  2Z9O A;  3GFJ A;  4PCQ A;  1TQI A;  4CDG A;  4DQ2 A;  1OMI A;  2RQP A;  3O2P E;  4MEY F;  5HDG A;  3QU6 A;  5CVJ A;  3R0A A;  1ZAR A;  1OYW A;  4HX7 A;  1ZYR F;  5F1R A;  1LDK B;  3MAJ A;  1YIO A;  1IF1 A;  2W85 A;  1ZLK A;  5LRR A;  4ETS A;  2HYF A;  1Z6T A;  1WWX A;  3WGH A;  3F23 A;  2L54 A;  2MA3 A;  1P4W A;  1OKR A;  2BYV E;  3ZMD A;  1H9T A;  3B73 A;  2PMH A;  4P9F A;  3KP7 A;  2Y48 A;  1U5T C;  2DQR A;  1YW8 A;  2DFI A;  3MZH A;  3FM5 A;  1ZGA A;  1I1S A;  4PGH A;  2CYY A;  4UV9 A;  3EYI A;  5E18 F;  1WRJ A;  3QP6 A;  2VON A;  3T8R A;  1ONV A;  2R3S A;  5D5V B;  3L7W A;  2H09 A;  1WSU A;  2RN7 A;  3VOE A;  1ZRF A;  5BS6 A;  3WGI A;  4ASN A;  2FXA A;  1T98 A;  4EQQ A;  2HQN A;  3ECO A;  4P9U A;  1XCV A;  3LQR A;  2QQA A;  2EB7 A;  5L3E A;  3L2C A;  4OIQ F;  1ZAO A;  1XB4 A;  3F72 A;  3PQJ A;  4RGR A;  4HBL A;  3TO7 A;  4IRH A;  4LJZ F;  5CYV A;  1XSD A;  2JPC A;  5ED4 A;  4LB5 A;  3P9K A;  1HW1 A;  3KP6 A;  4ZYG A;  2IPQ X;  1QPM A;  3BPV A;  2HTS A;  3WU0 A;  1O7F A;  3ABU A;  3T1B A;  2G9W A;  4YFN F;  1LEB A;  1YS6 A;  2STW A;  1TBX A;  2HS5 A;  1LNW A;  1C0W A;  1XCB A;  4I02 A;  2CG4 A;  4G7O F;  3R4K A;  3LST A;  3DP7 A;  3FMS A;  2EK5 A;  3C3W A;  1JGS A;  2XHK A;  5IT9 K;  4KIG A;  5LHH A;  3M1E A;  4HX8 A;  2V1X A;  2GXG A;  1J7K A;  1O3R A;  2PI0 A;  4M74 A;  2K7L A;  3QP5 A;  1XMK A;  5KVR A;  1BIA A;  5HLG A;  4FX0 A;  4EVI A;  3H3Z A;  2QBY B;  4YFK F;  1QGP A;  4HOB A;  1KU3 A;  2FEZ A;  5HLI A;  3GLX A;  4A0X A;  2JRT A;  2HZT A;  3E6B A;  5K5R A;  4KA4 A;  3J81 K;  5DEQ A;  2Z33 A;  1DDN A;  3WE2 A;  1ON2 A;  4GCV A;  1QZY A;  4M9Z A;  1P2F A;  2P7C B;  1Y0U A;  4I0B A;  1KQ9 A;  2JZY A;  1U5T A;  2MC3 A;  2Q8K A;  2D1V A;  2JT1 A;  4IHT A;  4U88 A;  1YG2 A;  5IT3 A;  1T39 A;  4AIK A;  5AIQ A;  4S05 A;  4L5I A;  2QVO A;  2HKO A;  4G6Q A;  1F4K A;  4EMS A;  2RKH A;  3QOP A;  4M6X A;  1SMT A;  3CUQ B;  1YQA A;  5DUI A;  2ZNY A;  2HTJ A;  1J75 A;  2XAQ A;  3TDZ C;  2KIM A;  3LA2 A;  1BI1 A;  3IHU A;  4OIN F;  3QPH A;  3H92 A;  3NRV A;  1S29 A;  4GO1 A;  2VOP A;  3DF8 A;  2LF8 A;  3RKY A;  1D3Y A;  3RYP A;  4A5N A;  5EEH A;  2V79 A;  1DPR A;  1XN7 A;  2H6B A;  1I1G A;  3KP3 A;  1ODD A;  3R0J A;  1AOY A;  5F6F A;  1U78 A;  2M1B A;  2P7V B;  1P4X A;  1YFH A;  1IXR C;  2YU3 A;  4KN7 X;  3SHF A;  1IZ1 A;  1SD6 A;  1G3W A;  3ZQ7 A;  1SD7 A;  2VBW A;  3FF5 A;  5DCF A;  4AD9 A;  2UWM A;  2K86 A;  4TV7 A;  4RGU A;  1F9N A;  1XGS A;  3ZPL A;  4A6D A;  3F6V A;  3FWE A;  3KP2 A;  2YR2 A;  2M8E A;  2L4A A;  4EJV A;  4Q5S F;  4L9N A;  2O61 A;  5FB2 A;  3C7J A;  4HF1 A;  5LRS A;  5ILS A;  3F21 A;  3Q9S A;  2W57 A;  3V8L A;  3I4P A;  3M8E A;  1J59 A;  3EUH A;  1G3T A;  2LSO A;  4KYW A;  3RDI A;  3RTR A;  2G7H A;  4EM2 A;  1EH8 A;  2ESH A;  3FXU A;  4LB6 B;  1LEA A;  1D8K A;  2NYX A;  5JHU A;  4MTE A;  2FML A;  4I0A A;  3ML6 A;  2QM3 A;  5HS9 A;  3I71 A;  4B8X A;  1DPU A;  1FYL A;  1JXS A;  2Z99 A;  1I6X A;  1FLI A;  4U7D A;  2K27 A;  2EFQ A;  3GF2 A;  1ZGJ A;  2XKP A;  1T2K A;  3I59 B;  4KMF A;  2HWV A;  1ZRD A;  5KK1 A;  2HYG D;  2KJB A;  3RKX A;  1HST A;  2ZME B;  3DPT A;  4IVN A;  3BY6 A;  2PJP A;  1QQI A;  3E6D A;  3K1N A;  3LA7 A;  4HV5 A;  4RB2 C;  2V1U A;  5BMZ A;  2A68 F;  1R23 A;  5BPD A;  1XSX A;  4HV6 A;  5LBQ A;  2ZO4 A;  3J80 Z;  4RS8 A;  3T0Y A;  5K5Q A;  1RZ4 A;  1GXQ A;  1FP2 A;  2KIU A;  1HKS A;  1S7A A;  2EWN A;  3MQ0 A;  2EFP A;  2A5Y B;  1W5T A;  2X4H A;  2XVC A;  4HA8 A;  2R7D A;  5HOO A;  1R1U A;  1FP1 D;  1IRF A;  2FNA A;  3HHG A;  4A6E A;  3SZP A;  1TW3 A;  5D5U B;  1USS A;  2KIF A;  1R1T A;  1CF7 A;  2EA4 A;  3ZMU A;  3PFI A;  3HSF A;  3LFK A;  3HTS B;  2DBB A;  4ZYH A;  4I01 A;  3N97 A;  3T8T A;  3KE2 A;  4XSZ F;  1UHW A;  4BQA A;  2PN6 A;  3HHH A;  2FMY A;  3HRU A;  1BI2 A;  3GWZ A;  3O3K A;  4MQV A;  1MDM A;  4WXD A;  3MWM A;  3ZMS A;  4ENK A;  4NHJ A;  1V4R A;  2VE8 A;  3IRQ A;  3JAM K;  2IJL A;  2VBZ A;  5E1Z B;  4XLN F;  3MZY A;  1J9I A;  3CUO A;  4A5M A;  1J2X A;  1IN6 A;  2BE5 F;  2PFB A;  4MTD A;  2DAO A;  2MLG A;  3BRO A;  1YS7 A;  5JR3 A;  5LGN A;  2UXX A;  4LMY A;  4M9X A;  3TO6 A;  1QBJ A;  4RB1 A;  3LA3 A;  5DV5 A;  4O3M A;  2W25 A;  2EFN A;  1HKT A;  3FM3 A;  2H6C A;  1Z6R A;  1IN4 A;  4ESJ A;  3HRT A;  2HQR A;  4M72 A;  4RAY A;  3FXR A;  2M30 A;  2VBY A;  5CLS A;  5FLX K;  2F5D A;  1U3E M;  2GIV A;  1RIO H;  3SZT A;  3V7S A;  3V8J A;  1FSH A;  3JAM Z;  2QQB A;  3MFK A;  1UFM A;  1IXS B;  3SFZ A;  2M87 A;  5E1X A;  2FBI A;  2BGC A;  4IJA A;  4HYE A;  4HF0 A;  3FHZ A;  1OPC A;  2C6Y A;  3BZ6 A;  1HBX G;  4EM1 A;  1EH6 A;  1MKM A;  3K0L A;  3P9I A;  3WU1 B;  5ICF A;  3TOA A;  2FOK A;  4CO8 A;  1GXP A;  1ZH5 A;  2QQ9 A;  1DP7 P;  4CXF A;  4I98 B;  1K78 A;  4WF2 A;  3WTV C;  1KA8 A;  5HDK A;  1BBY A;  1JE8 A;  3KET A;  5D8L B;  5FLX Z;  4EV0 A;  3I0T A;  2VXZ A;  3M7G A;  2IA2 A;  4UVB A;  2OQG A;  5L3G A;  2ZBK A;  1I5Z A;  1HXD A;  2ZCW A;  1HKQ A;  2ZJ2 A;  4KUM A;  1O7L A;  2QWW A;  2XAH A;  3GFI A;  2HOE A;  3JSP A;  1KU2 A;  1SMY F;  3ELK A;  3RYR A;  5L3F A;  3LAP A;  1VTN C;  4S04 A;  5BOX A;  1YO5 C;  3HOS A;  5K1Y A;  3COA C;  1GHC A;  3TQN A;  2RGV A;  3BJA A;  3ABT A;  3G73 A;  3E3V A;  3K9T A;  4O6J A;  5LHG A;  1NHA A;  2K02 A;  3W6J B; 
#chains in the Genus database with same CATH topology
 2DA1 A;  3WTT C;  4W97 A;  3FZV A;  3HIF A;  4PJ0 C;  2HQA A;  3S1N J;  2OZU A;  2GXA A;  2CUJ A;  3BOQ A;  2M4K A;  5J40 A;  4L9T A;  4Q48 A;  4ON0 A;  3BT9 A;  5DD8 A;  1TC3 C;  1HC8 A;  2R7F A;  2L9R A;  2MAB A;  2EBI A;  2Y75 A;  4Z2Y A;  2GA1 A;  2E1C A;  5GAH J;  2BHZ A;  3TP0 A;  1WJC A;  1T33 A;  3PSI A;  1R5G A;  2KQR A;  4GGG A;  3M8J A;  1UZC A;  4XLC A;  2X0L A;  4PJN A;  2M4G A;  2CMP A;  2NVX J;  2JSC A;  2ME0 A;  5FRN A;  2LDU A;  4BJT A;  3JRI A;  1B1B A;  5M3F J;  5F0C A;  3DWL E;  3QPT A;  4PSX A;  4D7M A;  4CYD A;  4LLG F;  3CME I;  1XGO A;  3RKW A;  4F91 B;  2ZNZ A;  2G0E A;  2R7W A;  1ETX A;  1H89 C;  2ADU A;  5ICC A;  1TQP A;  2KMU A;  2Z5U A;  1YTY A;  4M71 A;  3IC7 A;  4MFE A;  4ZTF A;  3WG7 H;  3QOE A;  2K4B A;  1WH5 A;  2KIS A;  3FX3 A;  1OYY A;  4ZC3 A;  3FK7 A;  4BYY A;  2LKP A;  3F22 A;  3H3V K;  1DGR M;  1SAX A;  2GZW A;  2L7M P;  4CZZ A;  1MW7 A;  3KIO A;  4HLX A;  4UXN A;  1ZEL A;  5HOD A;  4YG2 F;  5DCM A;  1BI3 A;  1U5T B;  3ZQF A;  1DU6 A;  1HF0 A;  1ZRE A;  4EGY A;  1R4N B;  2W00 A;  3FMQ A;  3KFW X;  3UNG C;  2LNB A;  3CC4 I;  3OYA A;  2IGK A;  2H8W A;  3DBL B;  1W0U A;  1T38 A;  1BIB A;  3A02 A;  3F8N A;  1PDN C;  4CIC A;  3RPQ A;  5DDG A;  4JQF A;  4L0Z B;  4HQM A;  1LFU P;  3HSR A;  3EUH C;  4EEF G;  3S16 J;  1HSJ A;  3ERM A;  3FXM A;  2J5O A;  2R7X A;  4NDL A;  2W24 A;  4F92 B;  2VT3 A;  4M3E A;  2A6H F;  3I53 A;  3CF2 A;  3DEW A;  2WB1 A;  2W1O A;  5IOZ A;  2VB6 A;  4Y4R A;  1QHH D;  1YJ9 I;  2ZXH A;  4KN4 X;  1Z9C A;  2XAF A;  3BTI A;  1GDT A;  2PMZ A;  4E7I A;  4Y52 J;  3VSL A;  3U21 A;  1TTY A;  1PP7 U;  1A6Q A;  4KT5 C;  1JJ6 C;  4G6D A;  2DOD A;  3C1D A;  1XDU A;  3JTG A;  3FIS A;  1PUE E;  4HAM A;  2VJI A;  4XKW A;  4BEH B;  2XPW A;  5D5W B;  1XTA A;  4L9V A;  3P9C A;  1MMS A;  4CH7 A;  2FUG 2;  2F4O B;  2IA0 A;  4B4C A;  3WTS C;  5J1R A;  3PQK A;  2HFH A;  3LSG A;  3S32 A;  4DOZ A;  1ZG5 A;  1N78 A;  5CJ9 A;  3GVA A;  4HEA 2;  2CUE A;  3F8M A;  2VJ4 A;  5JVT A;  4EGZ A;  2R7Q A;  2XIG A;  2Z1D A;  4BDZ A;  4ZDO A;  2E7X A;  4AYB N;  3Q3S A;  4UUV A;  1T6S A;  1LE8 B;  3SEQ A;  4M73 A;  1XGM A;  3MCZ A;  2EIL H;  5FFX A;  4I2O A;  4CSW A;  1FTT A;  4R8H A;  1MBF A;  5J6X A;  4G7Z F;  4KMU X;  2I8D A;  4L5J A;  4HZF A;  4XNF A;  2E2H J;  2Q0O A;  5IP9 J;  3GX4 X;  2RNJ A;  4ZYE A;  5J4V A;  2PEX A;  3I54 A;  1FBU A;  1QVT A;  2V6C A;  5J47 A;  5EYR A;  3NWS A;  2V1N A;  3SXY A;  4QSH A;  1W1W E;  1AKH B;  5LGT A;  4MEX F;  2M7B A;  2OA4 A;  5EGO B;  3HKZ N;  2DT7 B;  3W6K B;  5FFZ A;  4G7H F;  2K9N A;  2VE9 A;  1HA8 A;  2Y0M A;  3GUD A;  4WCG A;  2OU2 A;  1WJF A;  1TL8 A;  4LIU A;  2WAQ N;  1MMA A;  4DYQ A;  1Y0N A;  2W84 A;  3FXJ A;  1TT5 B;  3M8F A;  4LK1 F;  2CV1 A;  5D6E A;  4R1H A;  2DN0 A;  3E5U A;  3N4M A;  3ZR8 X;  2NVQ J;  4FHT A;  5HS8 A;  5EDN A;  2CGP A;  1Z7U A;  3RPU A;  4XLE A;  2GIZ A;  3NQO A;  1G6N A;  4PJM A;  1EH7 A;  1KZH A;  4AWX B;  2D45 A;  5K7H A;  1K4S A;  4N9H A;  1Z67 A;  2NS8 A;  3KPH A;  2IT0 A;  1TWF J;  3GTJ J;  2PLY A;  1YW9 A;  1B9N A;  1W5S A;  3CO6 C;  1I39 A;  5EF6 A;  1MGT A;  1Z1D A;  3BP8 A;  1FOW A;  1X4O A;  4G8X A;  1EF4 A;  3E1S A;  5LHI A;  2AXL A;  3CC7 I;  2JN6 A;  2DT6 A;  3FMR A;  1P6R A;  3G71 I;  5J8F A;  1MZB A;  2E1M B;  2DXI A;  2HVQ A;  1ZN2 A;  3SDG A;  1WGX A;  1P7J A;  1X3W B;  3W3C A;  1O3Q A;  1FBQ A;  5EEG A;  1YW7 A;  2BXY A;  3BWG A;  2LFB A;  1H8A C;  3DTK A;  3CLO A;  4EM0 B;  1P4A A;  2JQ7 A;  1UEL B;  2HGC A;  2XAU A;  2E5Z A;  2WV1 A;  2R93 J;  3HB9 A;  2V9K A;  4PK4 A;  3TGN A;  4ANJ A;  2DA5 A;  5IYC J;  3J80 K;  1DU0 A;  3GTM J;  1BR2 A;  3ZQG A;  1SFE A;  2K9M A;  4IHV A;  3LWF A;  2X9D A;  1TWG J;  2DA6 A;  2E2J J;  3LSH A;  2VXD A;  3GTP J;  1Y39 A;  2VJ5 A;  2LMD A;  2H94 A;  3Q0W A;  4IOC F;  2B9S A;  1BM9 A;  5HLT A;  1PYV A;  2LY9 A;  3S1Q J;  2R0Q C;  4ESB A;  3ZP5 A;  4YIF A;  4AU7 A;  1BC7 C;  4MFD A;  3OYF A;  3DEU A;  4O5V A;  4A2U A;  5K5O A;  1IUF A;  1BR4 A;  2P8T A;  3BCB A;  1G8X A;  5A2Q Z;  2UV1 A;  4RBO A;  2CQK A;  2DMU A;  1AHD P;  1FEX A;  2BV6 A;  2PMU A;  3I9V 2;  4F7Z A;  4IHS A;  1YIJ I;  3WTW C;  1FNN A;  1V5F A;  2R5Z B;  4XRF A;  5M3M J;  2ICW G;  2LRD A;  1VF9 A;  4YII A;  4V2G A;  3Q0U A;  2E7W A;  3TOB A;  2W4S A;  3ZRG A;  2GA2 A;  3GYH X;  1Y56 A;  2P0W A;  2E35 A;  3ASO H;  5F64 A;  3BG7 A;  1JTX A;  1POG A;  1SAU A;  2HQ5 A;  3JRD A;  3MKZ A;  4I99 C;  2L7Z A;  5CVI A;  2ZXI A;  5LLQ A;  2L7F P;  2XRL A;  4LG0 B;  3SQN A;  2YX4 A;  5BQT A;  1F43 A;  3GXO A;  2F5C A;  2NS7 A;  1BR1 A;  2QGU A;  2VN2 A;  2MD5 A;  1LDJ A;  1JI8 A;  3AAF A;  1HCR A;  1X2N A;  5KHD A;  3A01 A;  5CVU A;  4XSX F;  3VFZ A;  1K6Y A;  1AA7 A;  4C3I J;  1WJD A;  2GXB A;  1ZKG A;  3OSF A;  1IJW C;  3IWF A;  2NAZ A;  4CCL A;  1ZG3 A;  2DTR A;  3D5R C;  2KP6 A;  3M1C A;  4F55 A;  4QWQ A;  3ZMT A;  2J5P A;  3C2H A;  1E17 A;  2ISY A;  1Y1V J;  1FYK A;  3RQI A;  3LQQ A;  4UV8 A;  2CO5 A;  4BHP A;  3L09 A;  2O8X A;  5H6Q A;  4FTH A;  1UMQ A;  3CTA A;  1ULY A;  4DYR A;  2NNN A;  1R49 A;  3C2G A;  1JHF A;  4MNU A;  5JI6 A;  1XD7 A;  4BNC A;  2XGX A;  2Y9Y A;  3QAH A;  2JA5 J;  2VOO A;  4XK4 A;  3VYR B;  3D0S A;  3K1P A;  2FSW A;  3TW7 A;  5E8G A;  1EV7 A;  5EEA A;  2LG4 A;  3REO A;  3ZN1 A;  3OY9 A;  1OCP A;  2EV6 A;  1K4T A;  2PQ8 A;  2RRE A;  1LQ1 A;  3HM5 A;  4RGS A;  4XOP A;  1QZZ A;  1MDM B;  3V7R A;  3T5X A;  1CGP A;  1V55 H;  3OYI A;  4OIP F;  3IL2 A;  1EA3 A;  1IUY A;  2WTE A;  1JKR C;  4U87 A;  3X2Q H;  4B09 A;  3EUA A;  1IN8 A;  5TGT A;  3G4S I;  5F04 A;  3J7A O;  3NAR A;  4I76 A;  1Z0X A;  3AFH A;  2LKX A;  3Q5F A;  3ISP A;  4MLO A;  3AL0 C;  1PUF B;  3MMY B;  4UVC A;  2R7T A;  3EUK L;  1Q1H A;  3WE3 A;  2FA5 A;  3E5X A;  3I5U A;  2IS6 A;  1HQC A;  4G94 A;  3E5Q A;  2LVS A;  1WQ2 A;  4BBR J;  4D0P A;  1GVJ A;  4RA2 A;  2P6S A;  4BAY A;  3ULQ B;  1VQ8 I;  3DKY A;  2ZFW A;  3KEO A;  4HDV A;  4IZZ A;  4E7K A;  3R61 A;  4CUG A;  3ROU A;  3K4C A;  2K4J A;  4HSR A;  4CYC B;  2N8G A;  2EIK H;  2R7Z J;  2QKL B;  2KDZ A;  2HDC A;  2CSO A;  4XLP F;  4RLQ A;  2MH2 A;  3ERE D;  1TNT A;  2XRO A;  2NS0 A;  2XF6 A;  3K10 A;  3VSK A;  4C3J J;  1XSV A;  2DK8 A;  3CDI A;  3K4K A;  3R60 A;  2R4G A;  1TT0 A;  2NRA C;  1OR7 C;  1K61 A;  4LFU A;  2RNG A;  3PUF A;  3PIP F;  1HW5 A;  1SD4 A;  4MIM A;  2EZL A;  2JA2 A;  1FX7 A;  2VOD A;  4IL6 C;  1W7P A;  3DXJ F;  4GDF A;  4BY1 J;  4IRI A;  5ICG A;  4CGZ A;  5H20 A;  2LBF B;  2BBY A;  2LOO A;  4M3B A;  4OMY A;  4CCM A;  1WI9 A;  1O57 A;  1SFX A;  3FXQ A;  3OYD A;  1RR8 C;  3DV8 A;  1WCM J;  2NOJ B;  1LB2 A;  2LY1 A;  2YPR A;  3G6E I;  4QIW N;  2VQL A;  1RUO A;  4L18 B;  4HF2 A;  3PIO F;  1Z91 A;  4D9J A;  4ESF A;  2L02 A;  1UST A;  4U7B A;  4F52 A;  3S3O A;  3S1R J;  2UZK A;  2QZ8 A;  3F8C A;  3K6G A;  2OBP A;  4RAF A;  2L3D A;  1SAN A;  1YOV B;  2HZD A;  1KU7 A;  3U9G A;  3DKX A;  1N75 A;  2WAD A;  3L00 A;  2DJN A;  4P5O A;  4FX4 A;  3H9Q A;  2ME6 A;  3MZ8 A;  4II3 A;  3I3L A;  3CMA I;  2M7A A;  3DEE A;  4Y33 A;  3HOW J;  4BH9 A;  1E2X A;  2O0Y A;  3FKJ A;  5DD4 A;  4BJ6 C;  4LLN A;  3A0B C;  1WJA A;  2A3S A;  3K1M A;  3PO3 J;  2CQN A;  1OYI A;  1MJ9 A;  3HYI A;  2DYR H;  4WX9 A;  1VQP I;  2MH9 A;  2FE3 A;  3PNY A;  3CES A;  4ZZD A;  3BG6 A;  2RQQ A;  2FBK A;  1VND A;  2KZG A;  2O3F A;  3I4N J;  3MD2 A;  2F5E A;  1MBH A;  3OYC A;  1K78 B;  2L4M A;  3BPX A;  2PJR A;  1G3S A;  5D5X B;  1U0J A;  1B4A A;  2IEK A;  1OCC H;  2M0M A;  3OOP A;  3Q0V A;  1STZ A;  2JSP A;  4Y17 A;  1KU9 A;  4BHB A;  5TJJ A;  2DPD A;  2ETH A;  2P5L C;  4XBF A;  4BE0 A;  3OYB A;  2AQE A;  2B63 J;  4R79 A;  2GLO A;  2F4M B;  4EJU A;  3FBI B;  1OQY A;  2DQL A;  2XGD A;  3LSM A;  3OV8 A;  4BXU A;  2F2E A;  2EH3 A;  2JRM A;  3F6O A;  3TL4 X;  1D1B A;  2WV0 A;  5EZG A;  3CCQ I;  4MHG A;  4RGX A;  2Z3Y A;  1Z05 A;  1XMA A;  4C2T A;  4E7Z A;  2HYJ A;  1FIA A;  4CCN A;  4YIR X;  1A5J A;  1BW5 A;  2Q2E A;  4OOI A;  2P5V A;  3KP5 A;  3O8G A;  2KLO A;  2CUF A;  1PP8 F;  1ON1 A;  3RJP A;  2CFX A;  2AS5 F;  3LNQ A;  5DUK A;  1WKM A;  1IG7 A;  4DJA A;  5IY5 H;  3C18 A;  1UCR A;  2PBI A;  2P4W A;  4N4O B;  2HXO A;  4YEL A;  2EIN H;  5TIS C;  3FIW A;  3I56 I;  1D5V A;  4Y3O A;  1ETW A;  1WJE A;  2QCO A;  3IRR A;  3RKQ A;  4G6T B;  3OWT A;  2EV0 A;  1V5G A;  1D1A A;  1NG7 A;  1ZLJ A;  1X2M A;  3CC2 I;  2IAI A;  3HL2 A;  2K9L A;  2K40 A;  1XC5 A;  3GW2 A;  3KZY A;  1S5L C;  3CD6 I;  1WJ5 A;  2QQ8 A;  3K4N A;  3KLO A;  4DYC A;  3GLL A;  1X58 A;  2M2E A;  1GUU A;  3KYD B;  4P96 A;  5DYM A;  1W7P D;  2FNP A;  2VC1 A;  3TKY A;  4DBQ A;  3W2A A;  4NC8 A;  3CLQ A;  3EDP A;  3FXK A;  3KP4 A;  3KZZ A;  2EJR A;  3BZK A;  4PZJ A;  2CV0 A;  2CUZ A;  2YSR A;  3H35 A;  1SFU A;  3I64 A;  2WBM A;  2DO7 A;  2LK2 A;  4PDK A;  4A0Z A;  3F9K A;  4N0B A;  3FKI J;  1OR7 A;  1FBS A;  4XN3 A;  1UHM A;  2IVM A;  3CJQ B;  3MEX A;  2DMT A;  4YEJ A;  2L2O A;  2XGC A;  1FMW A;  2JK3 A;  1FY7 A;  2OZ6 A;  5DTD A;  2HDW A;  1MMG A;  3J7A Y;  3HOT A;  2RVC A;  5IYB J;  4E70 A;  3CCR I;  4Q4Z F;  1RES A;  2X6X A;  4UNO A;  4I09 A;  1X3U A;  3F8B A;  2JMW A;  2XAS A;  3BTC A;  2DOE A;  5FLM J;  1W0T A;  2D2W A;  3IWZ A;  2E5N A;  5E3M A;  4KDP A;  3ZOB A;  3BR5 A;  1QO0 D;  2ELJ A;  4HQE A;  4ENN A;  4OWR B;  3WOD F;  2BEO A;  1YRN A;  2VJJ A;  3S2H J;  3BCA A;  1ZHF A;  4WXC A;  2XF5 A;  2WB1 N;  3OYH A;  5AIP A;  3VPR A;  2QLZ A;  3CP2 A;  2LH9 A;  3K70 C;  4A3M J;  1QA6 A;  3F3X A;  5FGM A;  3CUQ C;  2XPU A;  4KIT B;  3I58 A;  4E7J A;  1VQO I;  5JLX A;  1R7J A;  5AON A;  2PMZ N;  1ZQ3 P;  2ISZ A;  5DCM B;  2MBF A;  5KAF C;  3NAU A;  2L7K A;  2LY2 A;  3DBH B;  4WWC A;  2G7U A;  2DI3 A;  4IRG A;  1LVA A;  4QPQ A;  3BJO A;  2HU9 A;  3GEZ A;  1SD5 A;  3HTU A;  1X1A A;  1TNS A;  2HEO A;  3HRM A;  3V7C A;  3ZMV A;  1L3L A;  3IAS 2;  2KRC A;  3E0J B;  2A6E F;  3VYT B;  3N05 A;  3RZO J;  1Z3X A;  1VQ6 I;  2IGO A;  5LEJ A;  4GXO A;  1TQM A;  2VQG A;  3HOV J;  2XB5 A;  1DQU A;  2FF4 A;  3TW6 A;  2VIX A;  5J1Y A;  2DMN A;  5EG0 B;  3EPZ A;  1P9Q C;  1W4M A;  4A3E J;  4CHU A;  2JUG A;  3CO7 C;  4DZJ A;  4WK8 F;  1T8I A;  3LAJ A;  5EZH A;  5FKL A;  1ACI A;  2ID6 A;  4XKC A;  3IKV A;  3L2R A;  2QYO A;  1S6L A;  1WPK A;  5C3E J;  4X0G A;  4BDY A;  1IN7 A;  1ZR2 A;  4FQG A;  4IHY A;  2A6T A;  4I7H A;  3PFY A;  2YX7 A;  3QPL A;  3PNT A;  3BTL A;  3L9F A;  1K7A A;  2Y0S A;  3W2V A;  3FXL A;  2ZKZ A;  2XC7 A;  4ZTJ A;  5GAE J;  5JFR A;  1U2W A;  2OAZ A;  1JKO C;  1A04 A;  3IUO A;  4XLF A;  1XGN A;  4E7L A;  1GLN A;  4UUS A;  4XR6 A;  4LGW A;  1LKX A;  2E36 A;  2QUF A;  5D6F A;  4E6K G;  2A07 F;  1WHU A;  3BG9 A;  1K79 A;  3S2W A;  3V4G A;  3ECH A;  2JA7 J;  2VPR A;  3DPL C;  2EA2 A;  1VQ7 I;  3ZMZ A;  2IP2 A;  4B3A A;  4JBA A;  3BG3 A;  4ZYD A;  2WAF A;  3DKW A;  4GYI A;  1BOA A;  4XM3 A;  5IYD J;  2EZK A;  1KQ0 A;  4RAZ A;  4Y13 A;  4NBQ A;  2HOA A;  3WTU C;  1B6A A;  5L3C A;  2YUS A;  3WTY C;  1S7O A;  3KCC A;  2QBY A;  1RNL A;  2XAG A;  4LD5 A;  4B48 A;  1LFP A;  3QYE A;  4JX6 A;  1T0F A;  2Q1Z B;  5HS7 A;  3WTZ A;  5DM7 F;  3GFL A;  1XS9 A;  3A4C A;  3A0H C;  4HDU A;  2TDX A;  1ETV A;  2H27 A;  2XRN A;  1TW2 A;  2XGE A;  4MO7 A;  3V42 A;  1U6G A;  2WY7 Q;  3AG4 H;  5IP7 J;  5J8C A;  3TDU C;  2MD0 A;  4WXH A;  1D8J A;  4M3D A;  4ENJ A;  2X1C A;  3PNV A;  2V1D A;  1BC8 C;  3BG5 A;  1QNT A;  4H4K C;  4AIJ A;  3E6C C;  5IT9 Z;  1IRZ A;  4EJW A;  4U0Y A;  1OLT A;  4YFX F;  4B1R A;  1WZ2 A;  2IA1 A;  2Z2S B;  3H1C A;  3S1M J;  1IV6 A;  4ENM A;  2GQQ A;  1AU7 A;  1RUN A;  1LDD A;  4U0V A;  1IW7 F;  2FJ1 A;  2K9Q A;  4OU0 A;  4DGW B;  2D1H A;  1VQK I;  4IOA F;  3ESW B;  5F0H A;  4MQ9 F;  4AVP A;  3P7N A;  2FBH A;  1Y6I A;  1SFO J;  5E17 F;  2JTV A;  4XIC A;  4RM2 A;  4FT8 A;  2WY8 Q;  4B47 A;  4RB3 C;  3R6S A;  1TP4 A;  3S3N A;  3VDX A;  3CJN A;  3D5S C;  1X19 A;  1FZP B;  2FOW A;  1FT9 A;  1FC3 A;  3J81 Z;  1R58 A;  4IF4 A;  3CUQ A;  1ZRC A;  2P6T A;  3JW4 A;  5A2Q K;  3RCO A;  4KIB A;  5M5Y J;  3EQL F;  1A6I A;  1OIS A;  4NB5 A;  1ZGW A;  2VAS A;  3CJT B;  1WI3 A;  1BI0 A;  2KZV A;  3FXO A;  3HOY J;  1WVR A;  2XKO A;  5JVG F;  4A69 C;  1I6H J;  1IAW A;  1XMX A;  2QSF X;  2NVY J;  1H9G A;  3HSE A;  5TRD A;  3M9A A;  2V26 A;  3HOZ J;  5LFA A;  1MH4 A;  2L9N A;  4U0W A;  2CQ7 A;  4N9I A;  2RV8 A;  3OIQ A;  1R00 A;  1VFC A;  6PAX A;  1GV5 A;  2JPB A;  2DFH A;  4BL0 B;  3BJ6 A;  5D4R A;  3JTH A;  3HPH A;  5HVQ C;  4Q47 A;  2A69 F;  3HJE A;  1ORK A;  4A3B J;  2HOS A;  3OL3 A;  2HVS A;  4M9S A;  4G9Y A;  4KNY A;  2IRF G;  2JUC A;  2B0L A;  2ELK A;  3ZN0 A;  1SVM A;  2X48 A;  2OJE D;  1YLF A;  2DFE A;  4RB0 A;  4KIC A;  1IRX A;  5F1J A;  1S3J A;  1VQN I;  3CCU I;  2DW4 A;  4IX7 A;  2KKO A;  4UUT A;  2VT2 A;  2L01 A;  2Y69 H;  5HDN A;  4MGR A;  3ZQI A;  3GZ6 A;  2E1N A;  1EJ9 A;  1O3S A;  4EJO A;  3K69 A;  2DLL A;  3WTX C;  3M07 A;  1JGG A;  1D0Z A;  1TWA J;  2QEN A;  4XRM A;  3GO5 A;  4EJT A;  1ETY A;  1BN5 A;  2NOG A;  3KLN A;  3H3U A;  1R22 A;  3KZI C;  1RC9 A;  2VC0 A;  3OL4 A;  1RI7 A;  4LIV A;  4XL9 A;  1IV8 A;  3GBG A;  1F5T A;  2R5Y A;  5D4S A;  4LG3 A;  2EFO A;  3KYL A;  1KGS A;  2MLK A;  3G3Z A;  1MH3 A;  4CCJ A;  5FD6 A;  2MFZ A;  4S0H B;  4BAC A;  2V9V A;  3HKZ A;  2ACJ A;  4C2M J;  5ILU A;  3IKT A;  2QEX I;  2EV5 A;  1FSE A;  3GFM A;  2Y2Z A;  1D0X A;  4HST A;  3LSP A;  3EYY A;  4ZZL A;  1P92 A;  2KJC A;  1ENH A;  3H0D A;  2OQR A;  1R5I D;  3C2B A;  3CCM I;  4IHW A;  1S7E A;  2KRF A;  2NNY A;  2HNH A;  2E71 A;  4E7H A;  5LD2 C;  3H5R A;  2WAQ A;  4HLY A;  2MW8 A;  1MMN A;  4ZDL A;  2HVR A;  1B9M A;  2VQH A;  4NC6 A;  2WWY A;  4HX4 A;  3MKW B;  4BHC A;  3OR2 C;  5BPI A;  2PG4 A;  1IRG A;  4JX4 A;  1IC8 A;  3FDY A;  1S8N A;  2M45 A;  3JSO A;  3DTE A;  3L2Q A;  5L3B A;  4OIO F;  2ELH A;  2F48 A;  1ITY A;  2HKX A;  4UB6 C;  1BJA A;  1KQ8 A;  5CVR A;  2M34 A;  1D5Y A;  4RM3 A;  2NXN B;  4NQW A;  2IXS A;  2COM A;  1QVU A;  4BU2 A;  3D5L A;  2FU4 A;  1NH3 A;  3PJR A;  3GTQ J;  3Q9V A;  2XAJ A;  1NK2 P;  1MJA A;  1WFX A;  3L1P A;  2LF7 A;  3E97 A;  5B1A H;  5LGU A;  5E1W A;  3ZQQ A;  2ZFU A;  1YHQ I;  2WC2 A;  1I50 J;  3K70 D;  1MBJ A;  1JT6 A;  3O6B B;  3HBL A;  5FKM A;  5ERI A;  2JA8 J;  3U2R A;  1S72 I;  1T56 A;  3FK6 A;  2VLA A;  1CF7 B;  5H6R A;  1TLH B;  5LEK A;  5M5X J;  3ZQL A;  1X1C A;  3H0G J;  2DU9 A;  1YYV A;  2CRG A;  2XUB A;  1YIT I;  2RC4 A;  3G2B A;  1FTZ A;  3RPU D;  4LK0 F;  4H0E A;  2UXN A;  5ICE A;  1YJN I;  3IV5 A;  4DNC A;  5J1U A;  5JLW A;  1VZ0 A;  1MNM C;  2MSY A;  2A5W A;  3I59 A;  1NG6 A;  1W36 C;  5FKK A;  4IEJ A;  3F8F A;  5ILV A;  3QRF F;  1KYZ A;  1Z77 A;  2EZI A;  3GZ5 A;  4UHT A;  3HGG A;  4UVA A;  2HI3 A;  5E3O A;  2OD5 A;  3PUB A;  2V9P A;  1FYM A;  4YRV A;  2ZME A;  5K7Z A;  3U1K A;  1G59 A;  4LG0 A;  5CKT A;  3QU3 A;  2R7S A;  1U8R A;  3HXL A;  1L0O C;  3LFU A;  1J5Y A;  4LLL A;  3VOD A;  1F1Z A;  2NVU B;  2D5V A;  3PM1 A;  4A0Y A;  2F5F A;  1VQM I;  2O03 A;  1ZTR A;  4A3K J;  3VEP A;  1N25 A;  1IXC A;  2ESN A;  1YI2 I;  2QF7 A;  3CCY A;  3RI4 A;  3V8K A;  1BA5 A;  5CVV A;  5EJC A;  1GV2 A;  1AWC A;  1MD0 A;  1FPQ A;  1LJ9 A;  3KEQ A;  2DK5 A;  3E7L A;  2IBD A;  3BR0 A;  3G1M A;  4NUB A;  1KYW A;  2K3P A;  4IXA A;  4K2E A;  1W7P B;  2R7R A;  3CF5 F;  4JP0 A;  3SZG A;  1HW2 A;  4IQ4 A;  3BDD A;  2R7V A;  4JOM A;  5HLH A;  4HG2 A;  5FD5 A;  1FOK A;  4PGG A;  2GAU A;  1REP C;  1R9T J;  4HPQ A;  3U1D A;  5E20 A;  2UUZ A;  4BXF A;  4XOT A;  3BR1 A;  1YE9 A;  1H0M A;  2XV4 S;  3CDL A;  1TZL A;  4GYG A;  4AUX A;  4L9J A;  3HOU J;  4BQQ A;  3B02 A;  3WGG A;  4A3D J;  5IP6 A;  2V6E A;  5E8I A;  2EIM H;  1ZG1 A;  3QQA A;  3DU6 A;  4RLF A;  2F4I A;  2TCT A;  2X51 A;  4QLC U;  2O9L A;  1IN5 A;  1V3F A;  5J3L A;  4ZH4 F;  2X6W A;  3K2Z A;  4D1Q A;  1OCT C;  3OYJ A;  1I27 A;  4M3G A;  1O3T A;  3PO2 J;  1RPW A;  5BNG A;  2RDP A;  1R4M B;  1G4D A;  1YX5 A;  3BQY A;  4L0Y B;  1Z3Y A;  4BS9 A;  1OCR H;  2ZXJ A;  3HC7 A;  5L3D A;  2CWE A;  3OR1 C;  3HRS A;  1MIJ A;  3HUG A;  4A3J J;  4KFC A;  1G3Y A;  5FO5 A;  3ZGK A;  3MN2 A;  4AIH A;  1JHH A;  3EET A;  2KT0 A;  3DQV C;  4FCY A;  1VI0 A;  1R5H A;  2XF7 A;  4OMZ A;  4HNV A;  1RKW A;  2JVG A;  1DUX C;  1B59 A;  3NEU A;  2P5K A;  2EFW A;  1X4P A;  2STT A;  1X1P A;  2A61 A;  1B8I A;  2OUM A;  4Y15 A;  2GWR A;  4KIF A;  4RAG A;  3TO9 A;  3WG9 A;  2FQ3 A;  2XB0 X;  5FRO A;  2XSD C;  5E3L A;  3OMY A;  5GAD J;  2DPU A;  2YS9 A;  3CCL I;  3OYN A;  1R36 A;  2CW0 F;  2H1L A;  2HR3 A;  4A93 J;  4OIR F;  2O6G E;  1MJB A;  2AO9 A;  3E6M A;  1S9H A;  3CDH A;  4JK1 X;  2DT5 A;  4NNJ A;  1J0R A;  2L9S A;  3RZD J;  1QPI A;  3RSN A;  1A35 A;  4HW0 A;  2FRH A;  1M1E B;  2VBX A;  3DLA A;  1E3H A;  1FWZ A;  1UHS A;  2IW5 A;  3CQZ J;  1XDS A;  5C44 J;  3OYL A;  4J00 A;  4P55 A;  1UB9 A;  1K6O A;  3VB2 A;  5D8K B;  2CQX A;  1RET A;  4IPA A;  2M5W A;  1DGW Y;  4CCK A;  2Q2E B;  1R1V A;  2XPV A;  3DFG A;  3CJR B;  4A12 A;  2CQQ A;  4M6Y A;  3RIR A;  5J4Y A;  2Z9O A;  3GTO J;  3G1L A;  3GTG J;  4JYK A;  2VKV A;  3GFJ A;  2V4J C;  1ETO A;  1UG2 A;  4PCQ A;  3AL0 B;  1TQI A;  4CDG A;  4DQ2 A;  1OMI A;  5K7F A;  2RQP A;  3BZC A;  4N4N B;  3BLY A;  3O2P E;  4BE2 A;  2R92 J;  1XG1 A;  4MEY F;  5HDG A;  3H5N A;  3QU6 A;  5CVJ A;  2L9V A;  3R0A A;  3K4J A;  4B3X A;  1ZAR A;  3DBR B;  1OYW A;  4HX7 A;  1ZYR F;  5F1R A;  1SVL A;  1G2H A;  1LDK B;  3MAJ A;  1GT0 C;  1YIO A;  1IF1 A;  3IH2 A;  3CCJ I;  1K83 J;  2W85 A;  3KX2 A;  4BQO A;  3DTI A;  1PJR A;  1ZLK A;  5LRR A;  1BJZ A;  3UR3 C;  3GTL J;  4ETS A;  2HYF A;  3CMY A;  1V54 H;  4XLH A;  1Z6T A;  1WWX A;  5B3S H;  3WGH A;  3F23 A;  2IS2 A;  2L54 A;  2HDD A;  2MA3 A;  2X6O A;  3VYS B;  2KIQ A;  1P4W A;  3QYB A;  1OKR A;  2BYV E;  3ZMD A;  2CH0 A;  3B73 A;  1H9T A;  2PMH A;  4P9F A;  2M3A A;  2EQR A;  3OS1 A;  3MVP A;  1MBK A;  3KP7 A;  2LYC A;  2Y48 A;  1U5T C;  2DA7 A;  2GOX B;  2K5C A;  5GTI C;  3OS0 A;  1YJW I;  1T08 B;  2DQR A;  1HLV A;  1YW8 A;  3TP3 A;  2DFI A;  3AG3 H;  4BUP A;  3MZH A;  2Y9Z A;  1WJB A;  1X1B A;  3FM5 A;  5B1B H;  1ZGA A;  2BOL A;  5FJ8 J;  1T0F C;  2VKE A;  1I1S A;  1MBG A;  2KPM A;  4PGH A;  1PVE A;  2CYY A;  3L2W A;  4UV9 A;  1YRN B;  3S14 J;  3ONQ A;  4J01 A;  3EYI A;  5FRM A;  2B7E A;  4HNU A;  5E18 F;  2EZH A;  5F27 A;  1WRJ A;  3QP6 A;  2JVH A;  2VON A;  3T8R A;  1ONV A;  2R3S A;  5D5V B;  3L7W A;  2LC2 A;  1D1C A;  2H09 A;  1WSU A;  2JA6 J;  2RN7 A;  3S2D J;  1CQT A;  2CS3 A;  3VOE A;  5B66 C;  1ZRF A;  5BS6 A;  2XDV A;  3WGI A;  4ASN A;  2FXA A;  1T98 A;  2W7N A;  4EQQ A;  2E34 A;  3B6C A;  2HQN A;  2MG4 A;  3ECO A;  4P9U A;  3JRH A;  1XCV A;  3LQR A;  2QQA A;  3ZQC A;  4DBR A;  2Y0S N;  1XX5 A;  3HOX J;  4XOR A;  2EB7 A;  5L3E A;  3L2C A;  3G1O A;  4OIQ F;  1ZAO A;  1XB4 A;  3F72 A;  2KDO A;  3ASN H;  3PQJ A;  5GTH C;  4RGR A;  4HBL A;  3TO7 A;  1B72 A;  2BY0 A;  4IRH A;  4LJZ F;  5CYV A;  1XSD A;  4A3C J;  4UY8 I;  5CQG A;  2JPC A;  1OCZ H;  2FQ4 A;  1HOM A;  2OV7 A;  5ED4 A;  4LB5 A;  3P9K A;  2EIJ H;  4NC7 A;  1HW1 A;  1X3Z B;  3KP6 A;  4ZYG A;  2IPQ X;  1QPM A;  2X85 A;  3BPV A;  2HTS A;  3WU0 A;  4F93 B;  1O7F A;  3ABU A;  4W1U A;  3T1B A;  2G9W A;  4A3I J;  1JT0 A;  1MBE A;  4M3F A;  4YFN F;  4KJZ A;  4XMY A;  2CV2 A;  1LEB A;  3LMM A;  1YS6 A;  1SVO A;  3QWL A;  2BZT A;  4FE7 A;  2BW3 A;  2L0K A;  4B43 A;  1LVK A;  1UG0 A;  4HRI A;  1EKE A;  1W36 D;  2STW A;  1F36 A;  1TBX A;  2HS5 A;  1LNW A;  3RQ4 A;  4PFO A;  1BOB A;  4FET A;  1C0W A;  1JUP A;  1XCB A;  4UUS B;  4I02 A;  2CG4 A;  4G7O F;  3VWB A;  3R4K A;  3LOC A;  3DP7 A;  3FMS A;  3LST A;  2E2I J;  2EK5 A;  3C3W A;  1JGS A;  2DJI A;  3QYF A;  2XHK A;  4C9Y A;  3JRG A;  2CW7 A;  2OC6 A;  5IT9 K;  4KIG A;  5LHH A;  2I10 A;  1V5E A;  3ABK H;  3M1E A;  3BTJ A;  4II2 A;  4HX8 A;  2V1X A;  2GXG A;  1J7K A;  1O3R A;  2PI0 A;  4M74 A;  3WHC A;  2DMP A;  2K7L A;  3QP5 A;  2LKS A;  4BBS J;  1XMK A;  5KVR A;  2ZJR F;  5IOY A;  4I6Z A;  1BIA A;  5HLG A;  4FX0 A;  4EVI A;  3H3Z A;  3SFI A;  2JJ7 A;  2LP0 A;  3IH3 A;  2IS4 A;  1P7I A;  2QBY B;  4YFK F;  1QGP A;  4HOB A;  5HNF A;  1KU3 A;  2FEZ A;  5HLI A;  2ZJQ F;  2M9H A;  2X1D A;  4KT6 A;  3GLX A;  3GME A;  4A0X A;  2JRT A;  2HZT A;  3E6B A;  5K5R A;  4KA4 A;  2OTJ I;  3J81 K;  5DEQ A;  2Z33 A;  1DDN A;  3WE2 A;  2IGN A;  1ON2 A;  2ZXW H;  2BY1 A;  4GCV A;  4BQN A;  1QZY A;  5KCM A;  4M9Z A;  2ZSI B;  1P2F A;  2M8G X;  2P7C B;  2RAE A;  4QTR A;  1Y0U A;  5EG0 A;  1NK3 P;  2E1M C;  4I0B A;  4L5E A;  1KQ9 A;  1FOX A;  2JZY A;  1U5T A;  2MC3 A;  2Q8K A;  2O5R A;  2D1V A;  3BR2 A;  3CP8 A;  4BY7 J;  2JT1 A;  4IHT A;  4U88 A;  4IHX A;  1YG2 A;  2LLK A;  2VKD A;  2AHQ A;  5IT3 A;  1T39 A;  1OJL A;  3D1N I;  4AIK A;  3NWT A;  3JRC A;  5AIQ A;  4CZC A;  2K9S A;  4S05 A;  4L5I A;  2QVO A;  2DCE A;  1Z21 A;  3J7Z I;  1O4X A;  2HKO A;  4G6Q A;  3FHN A;  1F4K A;  4EMS A;  2RKH A;  3SYT A;  3CCE I;  3QOP A;  4M6X A;  1SMT A;  2O7O A;  3CUQ B;  1YQA A;  3H5A A;  4E4H A;  3I4M J;  5DUI A;  2ZNY A;  1ETQ A;  2A05 A;  2F5V A;  2KHM A;  3GZN B;  2HTJ A;  1J75 A;  2XAQ A;  2JWT A;  3TDZ C;  4EAT A;  2KIM A;  4FAS D;  3LA2 A;  4PJL A;  1BI1 A;  3F0C A;  2QA4 I;  3OYE A;  2DDB A;  2F6C A;  4BEH A;  3IHU A;  4OIN F;  4Z6Y A;  3QPH A;  3H92 A;  1T95 A;  3NRV A;  1S29 A;  2KFD A;  4GO1 A;  5H2F C;  1RR7 A;  2VOP A;  4BE1 A;  3H36 A;  3DF8 A;  1A36 A;  1NTC A;  2LRE A;  1A31 A;  3OYG A;  2LF8 A;  3RKY A;  1D3Y A;  2K3F A;  3AG2 H;  2VI6 A;  3RYP A;  2QSH X;  1BW6 A;  3DPU A;  4A5N A;  3L2U A;  3WHB A;  1R71 A;  5EEH A;  2V79 A;  1DPR A;  1XN7 A;  2H6B A;  2E19 A;  1APL C;  1ERD A;  1QRY A;  2ZME C;  1I1G A;  1LE8 A;  5KAI C;  3KP3 A;  1ODD A;  3TMO A;  4D7N A;  3I55 I;  3R0J A;  1AOY A;  2VPL A;  5IPA A;  5F6F A;  1ETK A;  1SC7 A;  1U78 A;  3W2W A;  3MKY B;  3ZXS A;  2M1B A;  4IKF A;  2COB A;  2P7V B;  1P4X A;  4FE4 A;  5FKN A;  4ABZ A;  5GAG J;  1YFH A;  1IXR C;  2YU3 A;  4KN7 X;  2Y31 A;  2L5Q A;  2ZC2 A;  3OOU A;  3SHF A;  3KYC B;  1IZ1 A;  2ID3 A;  2BXZ A;  1SD6 A;  5CQE A;  1G3W A;  3ZQ7 A;  2R5Y B;  1AKH A;  3QPS A;  1SD7 A;  3QOD A;  2VBW A;  4M6V A;  5EGO A;  2PX9 A;  3FF5 A;  5DCF A;  4AD9 A;  2UWM A;  4AYB A;  4G12 A;  1FOY A;  2GOM A;  2K86 A;  2IS1 A;  2QKM B;  4TV7 A;  2VQC A;  4RGU A;  1F9N A;  4PJJ A;  2HOT A;  2R7U A;  2DYS H;  1XGS A;  4IO9 F;  3ZPL A;  4A6D A;  3F6V A;  3FWE A;  3HPG A;  3KP2 A;  2YR2 A;  4A3G J;  4XON A;  5FKO A;  5GPA A;  2Y30 A;  2M8E A;  2L4A A;  4C3H J;  4EJV A;  1FIP A;  5HNH A;  4L9N A;  4Q5S F;  2O61 A;  3JRA A;  5FB2 A;  3C7J A;  4HF1 A;  5JHF A;  5LRS A;  5ILS A;  3F21 A;  3Q9S A;  4NQW B;  2W57 A;  4F3Q A;  1FJL A;  2QSG X;  3GTK J;  2CFO A;  3V8L A;  4C30 A;  4IQJ A;  2HPI A;  3I4P A;  3M8E A;  1J59 A;  3EUH A;  3JRB A;  3K4M A;  4B44 A;  1G3T A;  2NVT J;  3A1Y A;  2LSO A;  2DOA A;  4KYW A;  1HDP A;  2ZSH B;  3A01 B;  4C2U A;  1SEU A;  1LFB A;  3RDI A;  3RTR A;  2G7H A;  4EM2 A;  3JCU C;  1EH8 A;  2ESH A;  4AID A;  3FXU A;  3ZQH A;  2WA0 A;  4LB6 B;  1LEA A;  1D8K A;  2NYX A;  5JHU A;  4MTE A;  2FML A;  4I0A A;  3ML6 A;  2QM3 A;  5HS9 A;  4BJ5 C;  3IP4 B;  3I71 A;  4B8X A;  3M4O J;  1DP3 A;  2OCC H;  1DPU A;  4KIS A;  1OFC X;  3K4B A;  3BR3 A;  1FYL A;  2EPF A;  1JXS A;  3ABM H;  2Z99 A;  1I6X A;  3OIP A;  3K4L A;  2CW8 A;  4U7D A;  1Y1W J;  3HZJ A;  1FLI A;  3MKL A;  2K27 A;  2EFQ A;  2OPT A;  3GF2 A;  2VUM J;  1OCO H;  1ZGJ A;  2XKP A;  1T2K A;  3I59 B;  4KMF A;  2HWV A;  1ZRD A;  1IGN A;  5KK1 A;  2HYG D;  2FX0 A;  1BL0 A;  2KJB A;  3RKX A;  1R6R A;  4XKB A;  1U9O A;  1IDY A;  1HST A;  1QU3 A;  2OF7 A;  2ZME B;  3DPT A;  4IVN A;  3VYU B;  3BY6 A;  2PJP A;  1QQI A;  3E6D A;  3K1N A;  2DOF A;  2FD5 A;  1JUS A;  3LA7 A;  4HV5 A;  4A3L J;  4RB2 C;  1IO2 A;  2H8R A;  2R5Z A;  3S17 J;  3W6V A;  2V1U A;  5BMZ A;  2A68 F;  1R23 A;  4V2F A;  3S8P A;  2MC4 A;  3PSF A;  5BPD A;  1XSX A;  3H9J A;  5GP9 A;  4HV6 A;  5LBQ A;  1Q1V A;  2ZO4 A;  3J80 Z;  4RS8 A;  2BY3 A;  3T0Y A;  5K5Q A;  1RRJ A;  4XLA A;  1VQ5 I;  3JRE A;  1RZ4 A;  3IH4 A;  1GXQ A;  4ZYA A;  3ZCO A;  1FP2 A;  2KRH A;  2KIU A;  1HKS A;  2OTL I;  3K7A J;  3CCV I;  3A03 A;  2P81 A;  3LSJ A;  1S7A A;  2EWN A;  2LTP A;  3MQ0 A;  1U9N A;  2EFP A;  1VQL I;  1LPQ A;  2A5Y B;  1W5T A;  2X4H A;  2DA2 A;  2XVC A;  4HA8 A;  2R7D A;  5HOO A;  1R1U A;  1FP1 D;  2E60 A;  2HXI A;  1IRF A;  4PFP A;  2FNA A;  3HHG A;  5F08 A;  4A6E A;  3SZP A;  1SFK A;  1TW3 A;  5D5U B;  4ITV A;  1USS A;  3BR6 A;  2KIF A;  3OYK A;  3JR9 A;  1R1T A;  3ABL H;  5F0F A;  1CF7 A;  2EA4 A;  1I3A A;  4BKX A;  2R7O A;  3ZMU A;  4HNT A;  4DZP A;  3PFI A;  3HSF A;  3LFK A;  1MSF C;  3HTS B;  2DBB A;  3H9G A;  3HUG B;  2MYS A;  5M5W J;  4ZYH A;  3IAM 2;  2ECC A;  4I01 A;  3N97 A;  1TWH J;  3T8T A;  3KE2 A;  3CMM A;  1KON A;  4E7S A;  4XSZ F;  1UHW A;  4BQA A;  2PN6 A;  2X1E A;  3HHH A;  2DTZ A;  2FMY A;  3HRU A;  2WAE A;  1B8I B;  1BI2 A;  1UAA A;  3UKG A;  3HEF A;  3GWZ A;  3O3K A;  1JKQ C;  4MQV A;  4DIQ A;  1E3P A;  1MDM A;  4XRS A;  4WXD A;  4AVZ A;  3MWM A;  1E3O C;  2Z16 A;  3ZMS A;  3SJM A;  3S15 J;  4P1W A;  4ENK A;  4NHJ A;  2ECB A;  1V4R A;  3AG1 H;  2VE8 A;  3IRQ A;  3JRF A;  4UB8 C;  2AQF A;  3JAM K;  2LD5 A;  2DDA A;  1FMV A;  2E1O A;  2IJL A;  3PL8 A;  2VBZ A;  3BQZ A;  5E1Z B;  4XLN F;  1PUF A;  3S3M A;  3A2K A;  3MZY A;  1J9I A;  2DMQ A;  3CUO A;  5C4X J;  4XQF A;  4LOC A;  4A5M A;  5CPR B;  1J2X A;  1U8B A;  2GBY A;  2BHY A;  2IGM A;  3OSG A;  1IN6 A;  2BE5 F;  5DM6 F;  2PFB A;  1W5C C;  4MTD A;  3K2A A;  1QZE A;  4AM3 A;  2DAO A;  3CZ6 A;  3SEZ A;  2MLG A;  4CYC A;  2DFF A;  3BRO A;  1X1D A;  3LSK A;  1YS7 A;  5JR3 A;  2PJR B;  5LGN A;  1MNE A;  4AC0 A;  2UXX A;  4LMY A;  3AKZ A;  4M9X A;  3TO6 A;  1QBJ A;  2K85 A;  4RB1 A;  3LA3 A;  5DV5 A;  4CA0 A;  4O3M A;  2W25 A;  2EFN A;  4ZJZ A;  4XN0 A;  1HKT A;  2XSJ C;  3FM3 A;  2H6C A;  1Z6R A;  1H88 C;  1XPX A;  1IN4 A;  4ESJ A;  3HRT A;  2MGQ A;  1JTY A;  2HQR A;  4M72 A;  3DLL F;  2CU7 A;  2YU9 J;  4RDU A;  3P5J A;  2TRT A;  4RAY A;  3FXR A;  4OAZ A;  2M30 A;  2LBF A;  3OYM A;  1I3Q J;  4PSW A;  2DA4 A;  4FIS A;  2VBY A;  5CLS A;  5FLX K;  3L2V A;  2F5D A;  1U3E M;  2GIV A;  1RIO H;  4BGD A;  1JKP C;  9ANT A;  1Z7L A;  3SZT A;  2M0C A;  3V7S A;  3TED A;  4CCO A;  1N77 A;  3M3Y J;  3V8J A;  2ZB9 A;  1FSH A;  1J09 A;  3JAM Z;  1ZR4 A;  2QQB A;  3MFK A;  3FBN B;  1TWC J;  1UFM A;  1IXS B;  3HG9 A;  1UJ8 A;  4X1E A;  3SFZ A;  2M87 A;  3SDB A;  5E1X A;  2ZJP F;  1E0E A;  1GVD A;  2BVM A;  4V19 K;  2AXT C;  2FBI A;  2BGC A;  4IJA A;  4XKV A;  4BXX J;  1LUJ B;  3GCM A;  4LIT A;  4HYE A;  3CCS I;  1QHG A;  1WH7 A;  4HF0 A;  2LR8 A;  5B5E C;  2DA3 A;  1JJ8 C;  3FHZ A;  3HGY A;  1MND A;  1OPC A;  2CJJ A;  3B6A A;  2C6Y A;  3BZ6 A;  2I5U A;  2BVL A;  1HBX G;  2KL4 A;  4EM1 A;  1EH6 A;  1MKM A;  3K0L A;  3P9I A;  3OIO A;  3WU1 B;  2HPM A;  5ICF A;  3TOA A;  2FOK A;  4CO8 A;  1GXP A;  1ZH5 A;  3WU2 C;  2QQ9 A;  3S93 A;  1VQ9 I;  3LSR A;  1DP7 P;  1Y8Q B;  1VQ4 I;  2BY2 A;  4CXF A;  4Y7N J;  5KNL A;  4I98 B;  1Y8R B;  3J7Y J;  1K78 A;  4WF2 A;  3WTV C;  1KA8 A;  2OCE A;  5HDK A;  3OS2 A;  4JX5 A;  5DS9 A;  1BBY A;  4GRI A;  1D0Y A;  1JE8 A;  3KET A;  5D8L B;  1ZK8 A;  4J19 A;  4DW6 A;  5FLX Z;  1JUM A;  4EV0 A;  3I0T A;  2X6Y A;  1YX3 A;  2VXZ A;  2IA2 A;  3M7G A;  4D5F A;  4X6A J;  3TBI A;  4UVB A;  5FLV A;  2GM4 A;  2VKH A;  3LSI A;  2W82 A;  1B72 B;  2OQG A;  5L3G A;  2ZBK A;  5E3N A;  1I5Z A;  5E79 C;  1HXD A;  4D5C A;  2ZCW A;  1HKQ A;  4OAY A;  2ZJ2 A;  4XID A;  4GFB A;  1RKT A;  3BC8 A;  3O8H A;  4RMN A;  1MMD A;  3DU5 A;  4KUM A;  3HDD A;  1O7L A;  2QWW A;  2XAH A;  5C4J J;  2O8K A;  4PUS A;  2W48 A;  3GFI A;  2HOE A;  3DCF A;  3JSP A;  4ZDP A;  1IDZ A;  1KU2 A;  1SMY F;  3ELK A;  3RYR A;  5L3F A;  3LAP A;  5GPC A;  1VTN C;  4S04 A;  4A3F J;  5BOX A;  1YO5 C;  3HOS A;  4QPO A;  3KEY A;  5K1Y A;  3LL7 A;  4XRS G;  3COA C;  3TQN A;  1GHC A;  1MSE C;  2RGV A;  3BJA A;  2BW3 B;  3ABT A;  3E3V A;  3K9T A;  4O6J A;  2V7F A;  3G73 A;  5LHG A;  1HDD C;  1NHA A;  2K02 A;  3W6J B;  2H1K A;  2VL8 A; 
#chains in the Genus database with same CATH homology
 3WTT C;  3FZV A;  3HIF A;  2OZU A;  3BOQ A;  4L9T A;  4Q48 A;  4ON0 A;  5DD8 A;  2R7F A;  2Y75 A;  4Z2Y A;  2GA1 A;  2E1C A;  1R5G A;  4GGG A;  2X0L A;  2JSC A;  2LDU A;  1B1B A;  3QPT A;  4CYD A;  4LLG F;  1XGO A;  3RKW A;  2ZNZ A;  2ADU A;  5ICC A;  1TQP A;  2Z5U A;  1YTY A;  4M71 A;  3IC7 A;  2K4B A;  3FX3 A;  1OYY A;  4BYY A;  2LKP A;  3F22 A;  1SAX A;  2GZW A;  4CZZ A;  4HLX A;  4UXN A;  4YG2 F;  5DCM A;  1BI3 A;  1U5T B;  1ZRE A;  4EGY A;  3FMQ A;  3KFW X;  2LNB A;  1T38 A;  1BIB A;  3F8N A;  1PDN C;  4CIC A;  3RPQ A;  5DDG A;  4JQF A;  4L0Z B;  4HQM A;  3HSR A;  1HSJ A;  2J5O A;  2W24 A;  2VT3 A;  2A6H F;  3I53 A;  1Z9C A;  4KN4 X;  2XAF A;  1TTY A;  1PP7 U;  4KT5 C;  4G6D A;  3C1D A;  1XDU A;  3JTG A;  1PUE E;  4HAM A;  5D5W B;  4L9V A;  3P9C A;  2IA0 A;  3WTS C;  3PQK A;  2HFH A;  1ZG5 A;  5CJ9 A;  3GVA A;  3F8M A;  5JVT A;  4EGZ A;  2XIG A;  2E7X A;  4UUV A;  1T6S A;  4M73 A;  1XGM A;  3MCZ A;  5FFX A;  4I2O A;  4R8H A;  5J6X A;  4G7Z F;  4KMU X;  4L5J A;  4HZF A;  2Q0O A;  3GX4 X;  2RNJ A;  4ZYE A;  2PEX A;  3I54 A;  1FBU A;  2V6C A;  3SXY A;  5LGT A;  4MEX F;  2OA4 A;  3W6K B;  5FFZ A;  4G7H F;  2VE9 A;  2Y0M A;  3GUD A;  4WCG A;  2OU2 A;  2W84 A;  3M8F A;  4LK1 F;  5D6E A;  4R1H A;  3E5U A;  3N4M A;  4FHT A;  5HS8 A;  2CGP A;  1Z7U A;  3RPU A;  3NQO A;  1G6N A;  1EH7 A;  4AWX B;  2D45 A;  4N9H A;  2IT0 A;  2PLY A;  1YW9 A;  1B9N A;  1W5S A;  3CO6 C;  1MGT A;  1Z1D A;  3BP8 A;  4G8X A;  5LHI A;  2AXL A;  3FMR A;  1P6R A;  5J8F A;  1MZB A;  1ZN2 A;  1O3Q A;  1FBQ A;  5EEG A;  1YW7 A;  3BWG A;  3CLO A;  4EM0 B;  1P4A A;  2HGC A;  3TGN A;  3J80 K;  1SFE A;  3LWF A;  2H94 A;  1BM9 A;  4ESB A;  3ZP5 A;  4YIF A;  1BC7 C;  3DEU A;  4O5V A;  4A2U A;  5K5O A;  2P8T A;  5A2Q Z;  2CQK A;  2BV6 A;  2PMU A;  4F7Z A;  4IHS A;  3WTW C;  1FNN A;  4XRF A;  4YII A;  2E7W A;  3TOB A;  2GA2 A;  3GYH X;  5F64 A;  5CVI A;  5LLQ A;  4LG0 B;  3SQN A;  2YX4 A;  5BQT A;  3GXO A;  2F5C A;  2VN2 A;  2MD5 A;  1LDJ A;  3AAF A;  5CVU A;  4XSX F;  3VFZ A;  2GXB A;  3IWF A;  2NAZ A;  1ZG3 A;  2DTR A;  4QWQ A;  3ZMT A;  2J5P A;  1E17 A;  2ISY A;  1FYK A;  3LQQ A;  4UV8 A;  2CO5 A;  4BHP A;  3L09 A;  2O8X A;  5H6Q A;  3CTA A;  1ULY A;  2NNN A;  1JHF A;  4MNU A;  5JI6 A;  1XD7 A;  4BNC A;  2XGX A;  3QAH A;  2VOO A;  3D0S A;  3K1P A;  2FSW A;  5E8G A;  1EV7 A;  3REO A;  3ZN1 A;  2EV6 A;  2PQ8 A;  1LQ1 A;  4RGS A;  1QZZ A;  1MDM B;  3V7R A;  3T5X A;  1CGP A;  4OIP F;  3IL2 A;  1IUY A;  2WTE A;  4B09 A;  1IN8 A;  3J7A O;  3Q5F A;  3ISP A;  4UVC A;  3WE3 A;  1Q1H A;  2FA5 A;  3E5X A;  3I5U A;  1HQC A;  4G94 A;  3E5Q A;  1WQ2 A;  4D0P A;  1GVJ A;  2P6S A;  4BAY A;  3ULQ B;  2ZFW A;  3KEO A;  4HDV A;  3R61 A;  3ROU A;  2K4J A;  2HDC A;  2CSO A;  4XLP F;  2MH2 A;  3ERE D;  1TNT A;  2XRO A;  2NS0 A;  1XSV A;  2DK8 A;  3R60 A;  2NRA C;  4LFU A;  1HW5 A;  1SD4 A;  1FX7 A;  2VOD A;  1W7P A;  3DXJ F;  4IRI A;  5ICG A;  4CGZ A;  5H20 A;  2BBY A;  4OMY A;  1WI9 A;  1O57 A;  1SFX A;  3FXQ A;  1LB2 A;  3DV8 A;  2YPR A;  1RUO A;  4L18 B;  4HF2 A;  1Z91 A;  4ESF A;  2L02 A;  1UST A;  4U7B A;  2UZK A;  2QZ8 A;  3F8C A;  2OBP A;  2L3D A;  1KU7 A;  3U9G A;  3L00 A;  4P5O A;  4FX4 A;  4BH9 A;  1E2X A;  2O0Y A;  5DD4 A;  4LLN A;  2A3S A;  3K1M A;  1OYI A;  1MJ9 A;  3HYI A;  4WX9 A;  2MH9 A;  2FE3 A;  4ZZD A;  2FBK A;  2O3F A;  2F5E A;  1K78 B;  2L4M A;  3BPX A;  1G3S A;  5D5X B;  1B4A A;  3OOP A;  2DPD A;  1STZ A;  4Y17 A;  4BHB A;  1KU9 A;  5TJJ A;  2ETH A;  2P5L C;  4XBF A;  4R79 A;  4EJU A;  2DQL A;  3OV8 A;  4BXU A;  2F2E A;  3F6O A;  2WV0 A;  4MHG A;  4RGX A;  2Z3Y A;  1Z05 A;  1XMA A;  2Q2E A;  4OOI A;  2P5V A;  3KP5 A;  1PP8 F;  1ON1 A;  3RJP A;  2CFX A;  2AS5 F;  5DUK A;  1WKM A;  3C18 A;  1UCR A;  2PBI A;  2P4W A;  1D5V A;  3IRR A;  2EV0 A;  1ZLJ A;  3GW2 A;  3KZY A;  3KLO A;  4P96 A;  5DYM A;  1W7P D;  2FNP A;  2VC1 A;  3TKY A;  3KP4 A;  3EDP A;  3KZZ A;  2EJR A;  4PZJ A;  2YSR A;  1SFU A;  3I64 A;  2DO7 A;  4PDK A;  4A0Z A;  4N0B A;  1OR7 A;  1FBS A;  1UHM A;  2IVM A;  3MEX A;  2OZ6 A;  1FY7 A;  3HOT A;  2RVC A;  4E70 A;  4Q4Z F;  4UNO A;  4I09 A;  1X3U A;  3F8B A;  2XAS A;  2D2W A;  3IWZ A;  4KDP A;  1QO0 D;  4ENN A;  4HQE A;  3WOD F;  2BEO A;  1ZHF A;  4WXC A;  5AIP A;  2QLZ A;  3F3X A;  5FGM A;  3CUQ C;  3I58 A;  2ISZ A;  1R7J A;  5AON A;  5DCM B;  2MBF A;  4WWC A;  2G7U A;  2DI3 A;  4IRG A;  1LVA A;  3BJO A;  3GEZ A;  1SD5 A;  3HTU A;  1TNS A;  2HEO A;  3HRM A;  3V7C A;  3ZMV A;  1L3L A;  2A6E F;  5LEJ A;  4GXO A;  1TQM A;  2FF4 A;  1W4M A;  4CHU A;  3CO7 C;  4WK8 F;  3LAJ A;  3IKV A;  2QYO A;  1S6L A;  1IN7 A;  4I7H A;  2YX7 A;  3L9F A;  1K7A A;  2ZKZ A;  5JFR A;  1U2W A;  2OAZ A;  1A04 A;  1XGN A;  4LGW A;  2QUF A;  5D6F A;  2A07 F;  1K79 A;  3S2W A;  3V4G A;  3ECH A;  3DPL C;  2EA2 A;  3ZMZ A;  2IP2 A;  4JBA A;  4ZYD A;  3DKW A;  4GYI A;  1BOA A;  1KQ0 A;  4RAZ A;  4Y13 A;  3WTU C;  1B6A A;  5L3C A;  3WTY C;  1S7O A;  3KCC A;  2QBY A;  1RNL A;  2XAG A;  4LD5 A;  5HS7 A;  1T0F A;  3WTZ A;  3GFL A;  4HDU A;  2TDX A;  2H27 A;  2XRN A;  1TW2 A;  1U6G A;  5J8C A;  3TDU C;  4WXH A;  1D8J A;  4ENJ A;  1BC8 C;  2V1D A;  1QNT A;  4AIJ A;  3E6C C;  5IT9 Z;  4EJW A;  4U0Y A;  4YFX F;  2IA1 A;  4ENM A;  2GQQ A;  1RUN A;  1LDD A;  4U0V A;  1IW7 F;  4OU0 A;  2D1H A;  4MQ9 F;  4AVP A;  3P7N A;  2FBH A;  5E17 F;  2JTV A;  4FT8 A;  4RB3 C;  3R6S A;  3CJN A;  1FZP B;  1FT9 A;  1FC3 A;  3J81 Z;  1R58 A;  4IF4 A;  3CUQ A;  1ZRC A;  2P6T A;  3JW4 A;  5A2Q K;  4KIB A;  3EQL F;  4NB5 A;  1BI0 A;  2XKO A;  1IAW A;  1H9G A;  3HSE A;  5TRD A;  3M9A A;  4U0W A;  4N9I A;  2RV8 A;  6PAX A;  1R00 A;  2JPB A;  3BJ6 A;  5D4R A;  3JTH A;  5HVQ C;  4Q47 A;  2A69 F;  4M9S A;  4G9Y A;  4KNY A;  2IRF G;  2B0L A;  3ZN0 A;  1YLF A;  4RB0 A;  4KIC A;  1S3J A;  2DW4 A;  2KKO A;  2VT2 A;  2L01 A;  5HDN A;  4MGR A;  3GZ6 A;  2E1N A;  1O3S A;  4EJO A;  3K69 A;  2DLL A;  3WTX C;  2QEN A;  3GO5 A;  4EJT A;  1BN5 A;  3KLN A;  3H3U A;  1R22 A;  2VC0 A;  1RI7 A;  1F5T A;  5D4S A;  2EFO A;  1KGS A;  2MLK A;  3G3Z A;  5FD6 A;  2V9V A;  2ACJ A;  5ILU A;  3IKT A;  2EV5 A;  1FSE A;  3GFM A;  3EYY A;  4ZZL A;  1P92 A;  2KJC A;  2OQR A;  2NNY A;  2KRF A;  4HLY A;  1B9M A;  2WWY A;  4HX4 A;  4BHC A;  5BPI A;  2PG4 A;  1IRG A;  1S8N A;  2M45 A;  3JSO A;  5L3B A;  4OIO F;  2ELH A;  2HKX A;  1BJA A;  1KQ8 A;  5CVR A;  4NQW A;  2COM A;  3D5L A;  2FU4 A;  3Q9V A;  2XAJ A;  1MJA A;  2LF7 A;  3E97 A;  5LGU A;  5E1W A;  2WC2 A;  3O6B B;  5ERI A;  3U2R A;  1CF7 B;  5H6R A;  1TLH B;  5LEK A;  2DU9 A;  1YYV A;  2XUB A;  2RC4 A;  4LK0 F;  4H0E A;  2UXN A;  5ICE A;  4DNC A;  3I59 A;  5ILV A;  3F8F A;  3QRF F;  1KYZ A;  3GZ5 A;  4UHT A;  4UVA A;  2OD5 A;  1FYM A;  2ZME A;  4LG0 A;  3QU3 A;  1U8R A;  1L0O C;  1J5Y A;  4LLL A;  3VOD A;  1F1Z A;  4A0Y A;  2F5F A;  2O03 A;  3VEP A;  1IXC A;  2ESN A;  3RI4 A;  3V8K A;  5CVV A;  1AWC A;  1MD0 A;  1FPQ A;  1LJ9 A;  3KEQ A;  2DK5 A;  1KYW A;  4IXA A;  4K2E A;  1W7P B;  1HW2 A;  3BDD A;  5HLH A;  5FD5 A;  1FOK A;  4PGG A;  2GAU A;  1REP C;  3U1D A;  5E20 A;  1H0M A;  2XV4 S;  4GYG A;  4L9J A;  3B02 A;  3WGG A;  5E8I A;  1ZG1 A;  4QLC U;  1IN5 A;  1V3F A;  4ZH4 F;  3K2Z A;  1I27 A;  1O3T A;  2RDP A;  1G4D A;  4L0Y B;  2ZXJ A;  5L3D A;  2CWE A;  3HRS A;  3HUG A;  4KFC A;  1G3Y A;  5FO5 A;  4AIH A;  1JHH A;  3EET A;  3DQV C;  1R5H A;  4OMZ A;  1DUX C;  1B59 A;  3NEU A;  2P5K A;  2EFW A;  2STT A;  2A61 A;  4Y15 A;  2GWR A;  4KIF A;  3TO9 A;  3WG9 A;  2FQ3 A;  2DPU A;  1R36 A;  2CW0 F;  2HR3 A;  4OIR F;  2O6G E;  1MJB A;  3E6M A;  3CDH A;  4JK1 X;  2DT5 A;  1J0R A;  4HW0 A;  2FRH A;  2VBX A;  1FWZ A;  2IW5 A;  1XDS A;  4P55 A;  1UB9 A;  1K6O A;  3VB2 A;  5D8K B;  4IPA A;  2M5W A;  1R1V A;  3DFG A;  4A12 A;  4M6Y A;  3RIR A;  2Z9O A;  3GFJ A;  4PCQ A;  1TQI A;  4CDG A;  4DQ2 A;  1OMI A;  2RQP A;  3O2P E;  4MEY F;  5HDG A;  3QU6 A;  5CVJ A;  3R0A A;  1ZAR A;  1OYW A;  4HX7 A;  1ZYR F;  5F1R A;  1LDK B;  3MAJ A;  1YIO A;  1IF1 A;  2W85 A;  1ZLK A;  5LRR A;  4ETS A;  2HYF A;  1Z6T A;  1WWX A;  3WGH A;  3F23 A;  2L54 A;  2MA3 A;  1P4W A;  1OKR A;  2BYV E;  3ZMD A;  1H9T A;  3B73 A;  2PMH A;  4P9F A;  3KP7 A;  2Y48 A;  1U5T C;  2DQR A;  1YW8 A;  2DFI A;  3MZH A;  3FM5 A;  1ZGA A;  1I1S A;  4PGH A;  2CYY A;  4UV9 A;  3EYI A;  5E18 F;  1WRJ A;  3QP6 A;  2VON A;  3T8R A;  1ONV A;  2R3S A;  5D5V B;  3L7W A;  2H09 A;  1WSU A;  2RN7 A;  3VOE A;  1ZRF A;  5BS6 A;  3WGI A;  4ASN A;  2FXA A;  1T98 A;  4EQQ A;  2HQN A;  3ECO A;  4P9U A;  1XCV A;  3LQR A;  2QQA A;  2EB7 A;  5L3E A;  3L2C A;  4OIQ F;  1ZAO A;  1XB4 A;  3F72 A;  3PQJ A;  4RGR A;  4HBL A;  3TO7 A;  4IRH A;  4LJZ F;  5CYV A;  1XSD A;  2JPC A;  5ED4 A;  4LB5 A;  3P9K A;  1HW1 A;  3KP6 A;  4ZYG A;  2IPQ X;  1QPM A;  3BPV A;  2HTS A;  3WU0 A;  1O7F A;  3ABU A;  3T1B A;  2G9W A;  4YFN F;  1LEB A;  1YS6 A;  2STW A;  1TBX A;  2HS5 A;  1LNW A;  1C0W A;  1XCB A;  4I02 A;  2CG4 A;  4G7O F;  3R4K A;  3LST A;  3DP7 A;  3FMS A;  2EK5 A;  3C3W A;  1JGS A;  2XHK A;  5IT9 K;  4KIG A;  5LHH A;  3M1E A;  4HX8 A;  2V1X A;  2GXG A;  1J7K A;  1O3R A;  2PI0 A;  4M74 A;  2K7L A;  3QP5 A;  1XMK A;  5KVR A;  1BIA A;  5HLG A;  4FX0 A;  4EVI A;  3H3Z A;  2QBY B;  4YFK F;  1QGP A;  4HOB A;  1KU3 A;  2FEZ A;  5HLI A;  3GLX A;  4A0X A;  2JRT A;  2HZT A;  3E6B A;  5K5R A;  4KA4 A;  3J81 K;  5DEQ A;  2Z33 A;  1DDN A;  3WE2 A;  1ON2 A;  4GCV A;  1QZY A;  4M9Z A;  1P2F A;  2P7C B;  1Y0U A;  4I0B A;  1KQ9 A;  2JZY A;  1U5T A;  2MC3 A;  2Q8K A;  2D1V A;  2JT1 A;  4IHT A;  4U88 A;  1YG2 A;  5IT3 A;  1T39 A;  4AIK A;  5AIQ A;  4S05 A;  4L5I A;  2QVO A;  2HKO A;  4G6Q A;  1F4K A;  4EMS A;  2RKH A;  3QOP A;  4M6X A;  1SMT A;  3CUQ B;  1YQA A;  5DUI A;  2ZNY A;  2HTJ A;  1J75 A;  2XAQ A;  3TDZ C;  2KIM A;  3LA2 A;  1BI1 A;  3IHU A;  4OIN F;  3QPH A;  3H92 A;  3NRV A;  1S29 A;  4GO1 A;  2VOP A;  3DF8 A;  2LF8 A;  3RKY A;  1D3Y A;  3RYP A;  4A5N A;  5EEH A;  2V79 A;  1DPR A;  1XN7 A;  2H6B A;  1I1G A;  3KP3 A;  1ODD A;  3R0J A;  1AOY A;  5F6F A;  1U78 A;  2M1B A;  2P7V B;  1P4X A;  1YFH A;  1IXR C;  2YU3 A;  4KN7 X;  3SHF A;  1IZ1 A;  1SD6 A;  1G3W A;  3ZQ7 A;  1SD7 A;  2VBW A;  3FF5 A;  5DCF A;  4AD9 A;  2UWM A;  2K86 A;  4TV7 A;  4RGU A;  1F9N A;  1XGS A;  3ZPL A;  4A6D A;  3F6V A;  3FWE A;  3KP2 A;  2YR2 A;  2M8E A;  2L4A A;  4EJV A;  4Q5S F;  4L9N A;  2O61 A;  5FB2 A;  3C7J A;  4HF1 A;  5LRS A;  5ILS A;  3F21 A;  3Q9S A;  2W57 A;  3V8L A;  3I4P A;  3M8E A;  1J59 A;  3EUH A;  1G3T A;  2LSO A;  4KYW A;  3RDI A;  3RTR A;  2G7H A;  4EM2 A;  1EH8 A;  2ESH A;  3FXU A;  4LB6 B;  1LEA A;  1D8K A;  2NYX A;  5JHU A;  4MTE A;  2FML A;  4I0A A;  3ML6 A;  2QM3 A;  5HS9 A;  3I71 A;  4B8X A;  1DPU A;  1FYL A;  1JXS A;  2Z99 A;  1I6X A;  1FLI A;  4U7D A;  2K27 A;  2EFQ A;  3GF2 A;  1ZGJ A;  2XKP A;  1T2K A;  3I59 B;  4KMF A;  2HWV A;  1ZRD A;  5KK1 A;  2HYG D;  2KJB A;  3RKX A;  1HST A;  2ZME B;  3DPT A;  4IVN A;  3BY6 A;  2PJP A;  1QQI A;  3E6D A;  3K1N A;  3LA7 A;  4HV5 A;  4RB2 C;  2V1U A;  5BMZ A;  2A68 F;  1R23 A;  5BPD A;  1XSX A;  4HV6 A;  5LBQ A;  2ZO4 A;  3J80 Z;  4RS8 A;  3T0Y A;  5K5Q A;  1RZ4 A;  1GXQ A;  1FP2 A;  2KIU A;  1HKS A;  1S7A A;  2EWN A;  3MQ0 A;  2EFP A;  2A5Y B;  1W5T A;  2X4H A;  2XVC A;  4HA8 A;  2R7D A;  5HOO A;  1R1U A;  1FP1 D;  1IRF A;  2FNA A;  3HHG A;  4A6E A;  3SZP A;  1TW3 A;  5D5U B;  1USS A;  2KIF A;  1R1T A;  1CF7 A;  2EA4 A;  3ZMU A;  3PFI A;  3HSF A;  3LFK A;  3HTS B;  2DBB A;  4ZYH A;  4I01 A;  3N97 A;  3T8T A;  3KE2 A;  4XSZ F;  1UHW A;  4BQA A;  2PN6 A;  3HHH A;  2FMY A;  3HRU A;  1BI2 A;  3GWZ A;  3O3K A;  4MQV A;  1MDM A;  4WXD A;  3MWM A;  3ZMS A;  4ENK A;  4NHJ A;  1V4R A;  2VE8 A;  3IRQ A;  3JAM K;  2IJL A;  2VBZ A;  5E1Z B;  4XLN F;  3MZY A;  1J9I A;  3CUO A;  4A5M A;  1J2X A;  1IN6 A;  2BE5 F;  2PFB A;  4MTD A;  2DAO A;  2MLG A;  3BRO A;  1YS7 A;  5JR3 A;  5LGN A;  2UXX A;  4LMY A;  4M9X A;  3TO6 A;  1QBJ A;  4RB1 A;  3LA3 A;  5DV5 A;  4O3M A;  2W25 A;  2EFN A;  1HKT A;  3FM3 A;  2H6C A;  1Z6R A;  1IN4 A;  4ESJ A;  3HRT A;  2HQR A;  4M72 A;  4RAY A;  3FXR A;  2M30 A;  2VBY A;  5CLS A;  5FLX K;  2F5D A;  1U3E M;  2GIV A;  1RIO H;  3SZT A;  3V7S A;  3V8J A;  1FSH A;  3JAM Z;  2QQB A;  3MFK A;  1UFM A;  1IXS B;  3SFZ A;  2M87 A;  5E1X A;  2FBI A;  2BGC A;  4IJA A;  4HYE A;  4HF0 A;  3FHZ A;  1OPC A;  2C6Y A;  3BZ6 A;  1HBX G;  4EM1 A;  1EH6 A;  1MKM A;  3K0L A;  3P9I A;  3WU1 B;  5ICF A;  3TOA A;  2FOK A;  4CO8 A;  1GXP A;  1ZH5 A;  2QQ9 A;  1DP7 P;  4CXF A;  4I98 B;  1K78 A;  4WF2 A;  3WTV C;  1KA8 A;  5HDK A;  1BBY A;  1JE8 A;  3KET A;  5D8L B;  5FLX Z;  4EV0 A;  3I0T A;  2VXZ A;  3M7G A;  2IA2 A;  4UVB A;  2OQG A;  5L3G A;  2ZBK A;  1I5Z A;  1HXD A;  2ZCW A;  1HKQ A;  2ZJ2 A;  4KUM A;  1O7L A;  2QWW A;  2XAH A;  3GFI A;  2HOE A;  3JSP A;  1KU2 A;  1SMY F;  3ELK A;  3RYR A;  5L3F A;  3LAP A;  1VTN C;  4S04 A;  5BOX A;  1YO5 C;  3HOS A;  5K1Y A;  3COA C;  1GHC A;  3TQN A;  2RGV A;  3BJA A;  3ABT A;  3G73 A;  3E3V A;  3K9T A;  4O6J A;  5LHG A;  1NHA A;  2K02 A;  3W6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...