1SD7A

Crystal structure of a semet derivative of meci at 2.65 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd7A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd7A02
1SFEA 3DFGA 5E8GA 1SMTA 3ZMUA 4BAYA 4KIBA 5JI6A 1MJBA 2MLGA 4PGHA 1I1GA 2FE3A 1KYWA 3HSEA 3ZP5A 2QZ8A 1FZPB 2WC2A 1IZ1A 5FB2A 1REPC 3HOSA 2OZ6A 4ESFA 3H92A 3KP2A 4U0WA 1ZGAA 2EJRA 2PQ8A 4CGZA 3GWZA 3U2RA 3E5XA 4ENNA 3HIFA 1FNNA 3HHHA 1U5TC 4LLGF 4S05A 2EB7A 2VN2A 1BIBA 1D8JA 4ZYGA 2Z3YA 3LA7A 1MJAA 2E1NA 3RYRA 2ZNYA 4JBAA 1ZN2A 5ICFA 5DV5A 3R61A 3I4PA 2ZJ2A 2VBWA 1RIOH 2ZCWA 3DKWA 1KA8A 1QQIA 1MDMB 3MFKA 3DQVC 2FBIA 3KP6A 4WF2A 2J5OA 2GZWA 2L02A 5ED4A 3IWZA 2GAUA 1TQPA 1DDNA 1MKMA 3ABTA 2HFHA 3F8FA 4DQ2A 5BPIA 4HDVA 2CQKA 5JR3A 5BS6A 3J81Z 4KIFA 3RKYA 2NYXA 1BBYA 1ZG3A 5D4SA 4EJWA 1Z6RA 1FP2A 1XD7A 4O6JA 4Q48A 2EFNA 2H6CA 1T98A 4YG2F 2PJPA 1AWCA 3KFWX 1IF1A 1P4XA 4A6DA 3V8JA 3ELKA 2L01A 1GXQA 2V9VA 4XRFA 4ENJA 4HBLA 5AONA 1TQMA 3V7SA 2O3FA 2DLLA 2LF7A 2M5WA 3HRMA 2L3DA 3JTGA 1IXRC 2LSOA 3RIRA 3GFLA 1GVJA 2A3SA 1ZRDA 2VBZA 3JSOA 2KIUA 1U8RA 1XCVA 2E1CA 5CVUA 3O6BB 3HSRA 1EH6A 4RAYA 2RC4A 5HDGA 3CO6C 4M74A 2QBYB 1YG2A 2XKOA 5BPDA 3E6DA 3L09A 3BPVA 3HRSA 3FM3A 4I02A 2FOKA 1BIAA 2LF8A 4EVIA 2G9WA 1T6SA 3PQKA 2VOPA 2D1HA 3BJ6A 4MNUA 4YIFA 1Z05A 5E1ZB 4UNOA 1U2WA 3CDHA 1PP8F 2GXBA 4HF1A 2LDUA 3M7GA 4FT8A 1ZRCA 5DYMA 1QZZA 5LRRA 1U78A 1T39A 1K6OA 5FFXA 3BP8A 3HTSB 5K1YA 2JSCA 1Q1HA 2DPDA 3SZTA 2NAZA 3EUHA 3E6MA 1ZAOA 5E20A 4KNYA 3JSPA 5D5VB 4R1HA 2Q0OA 1SD4A 1PUEE 2RKHA 3MWMA 3GYHX 1KU7A 1V3FA 3WGIA 5HLGA 3MCZA 5TRDA 4CYDA 1ZYRF 4NQWA 3IRQA 1RI7A 3F8MA 4KUMA 2PFBA 1ULYA 1LB2A 4IRGA 2KJBA 2PN6A 2C6YA 1XB4A 3OOPA 1B1BA 3IRRA 2Y48A 3F6VA 2PMUA 3TOAA 3KZYA 3MAJA 1WKMA 2XGXA 1QBJA 1TLHB 3W6JB 5DCMA 3ERED 1J59A 4BYYA 3P7NA 2G7HA 1E2XA 2EV6A 2DW4A 4L9TA 2K7LA 2P6SA 1OMIA 1G4DA 2QUFA 2MD5A 1JE8A 4GXOA 5ILVA 3ZQ7A 1WSUA 4EM1A 3D5LA 1JHHA 3DV8A 2MA3A 3E5QA 2HOEA 3IHUA 5A2QZ 2FU4A 3LSTA 4KN4X 1IUYA 1ON2A 3KEQA 4M9XA 2A69F 3ZN0A 2PEXA 3WE3A 1BI3A 1YYVA 1KQ9A 1O3QA 4IRHA 1R7JA 2NNYA 3EQLF 2DU9A 4HF0A 5D5WB 2OQRA 4CO8A 3PQJA 3FF5A 1FBSA 4OIPF 4XLPF 2FXAA 2A6EF 2KIFA 5L3FA 3WG9A 1WI9A 1G3YA 4PCQA 3GZ6A 2FF4A 2QM3A 4Q47A 1IN5A 2HTJA 1HW2A 2STWA 4BHPA 4L9JA 3GFIA 2PMHA 2FBHA 5L3GA 2VONA 3ULQB 1JXSA 1RUOA 3KP4A 2HTSA 3SQNA 2HEOA 3CUQB 5E17F 2F5CA 1K7AA 3IKTA 4G6DA 1YIOA 3R6SA 1IW7F 3CJNA 3HYIA 2V1UA 4OMYA 2A68F 5D5UB 4UVAA 1UCRA 4EJOA 3TO7A 2HZTA 5ICGA 1W7PA 4H0EA 1ZLJA 4O5VA 1B9NA 2YX4A 4LG0A 2O6GE 1LVAA 3E97A 1IN8A 2M30A 1CF7B 4WXHA 3FHZA 2R7FA 4RGSA 2DFIA 3E6BA 3G3ZA 1XSDA 4P9UA 1S3JA 3ZN1A 4XSZF 3C18A 3E5UA 3KETA 2BYVE 2XASA 3NEUA 3WE2A 3KEOA 1SD6A 2QQ9A 1XDSA 1HKQA 4RGUA 1KQ0A 3J80Z 3R0AA 5J8FA 5LEJA 4MQ9F 3JAMZ 5DD8A 4KMUX 1F5TA 1R1TA 3HHGA 1YS7A 1LEAA 2F5DA 2R3SA 2IW5A 3S2WA 3IKVA 3WU0A 4EMSA 3O2PE 4M6YA 4EJUA 2NNNA 4QWQA 6PAXA 2GXGA 2HKOA 4OINF 2JPCA 2XAHA 2VT3A 2L4AA 5DD4A 4PDKA 2K4JA 3U1DA 2M1BA 4KICA 4AIHA 2DQLA 4EQQA 2R7DA 1YW9A 3ML6A 4G9YA 1PDNC 2FNPA 3DPTA 4HOBA 1SD5A 2V1XA 2RV8A 4G7OF 2EFWA 2A6HF 1FY7A 4P9FA 1CF7A 3HOTA 5FGMA 4HX8A 2GQQA 4KA4A 4OIQF 1TNSA 1B6AA 1FP1D 3FMRA 3JAMK 1ZGJA 3BDDA 4IF4A 3KE2A 1FX7A 4WK8F 3QU6A 5D6FA 3K1NA 1BJAA 4R79A 5LHGA 4U7DA 1ODDA 1A04A 4HA8A 2IA0A 2UXXA 1R5HA 4FHTA 4G7ZF 3F72A 2ZKZA 3CLOA 1OYIA 4K2EA 2FQ3A 3TGNA 1KU9A 3Q5FA 1MZBA 5HDKA 2JT1A 2ZNZA 3BOQA 3LFKA 2VE8A 1DUXC 5H20A 4Y15A 2VBYA 3LWFA 1YO5C 2XROA 2IA1A 2P5KA 5CLSA 3HTUA 2WTEA 2HS5A 2FSWA 2VOOA 2EA4A 3JTHA 1F9NA 4A0XA 1CGPA 4KIGA 5LHIA 5F6FA 5J6XA 1HW1A 5D5XB 2FRHA 2DAOA 1TTYA 2ZMEB 2L54A 4WXCA 1SAXA 1XMKA 3EDPA 4IXAA 2Z5UA 2K86A 2IA2A 5CVRA 1HQCA 2ETHA 2D2WA 2OZUA 1OYYA 4FX4A 1J2XA 1FYLA 3BROA 5CVVA 2HQRA 2OQGA 3K1MA 4LD5A 4EJTA 4NHJA 2IPQX 4U0VA 1F4KA 3K69A 1LDDA 3DP7A 2AXLA 1R00A 1DPUA 3P9CA 5CYVA 1JGSA 2QWWA 2PBIA 1EV7A 4AD9A 1O3SA 1BI0A 3IWFA 1IRFA 3CUQC 2DBBA 4RB3C 3KP5A 3C7JA 4UHTA 5LHHA 1SFUA 4GYIA 4I01A 2B0LA 3F21A 2XAGA 2RN7A 1R22A 5FO5A 4P96A 2GA1A 5L3BA 4RGRA 2VC1A 1ZH5A 2ZBKA 3WGHA 2V1DA 3U9GA 2YR2A 5FFZA 1MD0A 2RVCA 3FXRA 4RGXA 1K78B 2OBPA 4G6QA 3N97A 2O8XA 2FMLA 2RGVA 2DPUA 2OU2A 1H9TA 1O7LA 4AVPA 3LA2A 2FBKA 3FX3A 1X3UA 3E6CC 2FA5A 2GIVA 3WTUC 3KP3A 3BY6A 4MEYF 5HVQC 2Z9OA 3H3UA 1D8KA 1G6NA 5IT9K 1KU3A 4OMZA 3L7WA 2EFQA 2IRFG 4L9VA 1H9GA 3K0LA 3VEPA 3DPLC 5JHUA 4I7HA 3ZPLA 2ISYA 4P55A 3QU3A 1DPRA 1XSVA 5F64A 4IRIA 2K02A 3KP7A 5BMZA 3TKYA 5H6RA 2QQBA 4LB6B 1GHCA 2ELHA 3RPUA 4MHGA 2A61A 3J80K 1SD7A 2HYGD 2OD5A 3K9TA 5LEKA 4AIJA 1FSHA 3I5UA 1I5ZA 1ZRFA 3RKWA 1Z1DA 3GO5A 1OYWA 1KYZA 1P6RA 1KU2A 1G3SA 3QOPA 4GCVA 5IT3A 4EV0A 1I27A 1XCBA 1YFHA 4OIOF 5HS7A 2CFXA 4BQAA 2EWNA 3F8CA 1S29A 4CICA 4YFNF 4OU0A 3VOEA 2CYYA 4M9ZA 2ZO4A 3WTXC 1Y0UA 2UZKA 2J5PA 3R4KA 4LMYA 2BV6A 1FLIA 1FOKA 3PFIA 3LQQA 3QAHA 2DK8A 2VBXA 3GF2A 2M8EA 5HDNA 2BEOA 4ON0A 3VODA 1UFMA 2KJCA 3QP5A 4RS8A 1S7OA 3LQRA 5CVIA 2XKPA 3RDIA 3W6KB 1YW8A 1ONVA 4JQFA 3TOBA 2NRAC 2CSOA 2X0LA 1LDKB 4M73A 2HDCA 2A5YB 4JK1X 3Q9SA 1RNLA 4MTEA 1IN6A 4Z2YA 5EEGA 3GEZA 1J0RA 1BOAA 3GVAA 4L9NA 4ZH4F 3G73A 3R60A 1STZA 1VTNC 1ZHFA 1U6GA 1QO0D 3JW4A 3VB2A 2MH2A 1IAWA 3P9IA 5ICEA 5LLQA 2Q8KA 5E1WA 2W84A 2PI0A 3FM5A 2ZMEA 1XDUA 2CO5A 2DQRA 3I0TA 2QYOA 5JFRA 2H94A 2P6TA 3FXUA 2MC3A 3D0SA 1R58A 5A2QK 3J7AO 3QP6A 1ZG1A 1BI1A 3T1BA 2P7CB 3EYYA 2EV0A 2BGCA 2HGCA 3QPHA 4G94A 1Z91A 3K1PA 2ZFWA 3ABUA 4RB0A 5F1RA 4M71A 4MGRA 4UXNA 4ASNA 2PLYA 3WTSC 5ERIA 1YQAA 2EV5A 4HDUA 2BBYA 3TDZC 1TBXA 2K27A 4KFCA 4L18B 5L3EA 2H6BA 1IXCA 5D8LB 4NB5A 4LLNA 2P4WA 1EH7A 4MTDA 2P5LC 2HQNA 3BJAA 1USTA 2IT0A 4WX9A 5HS9A 3I71A 4LK0F 3MEXA 3N4MA 2QBYA 3SZPA 1FPQA 4CHUA 5DDGA 5LGUA 4LGWA 3I59B 1J9IA 2VT2A 1FBQA 3EETA 1J5YA 4UV8A 4R8HA 3FMQA 4UV9A 2XAJA 2O0YA 3MZYA 2XAQA 1MGTA 1ZARA 2FNAA 3BWGA 4ZYDA 1S8NA 4ZZLA 2RDPA 1KGSA 2M87A 5BOXA 1SFXA 2JRTA 3ZMVA 2COMA 1D3YA 1UHMA 2QVOA 3CUQA 1ZREA 1USSA 4GYGA 1ZG5A 3EYIA 4IHTA 1Z9CA 3RTRA 5LGTA 1NHAA 5E8IA 2Y75A 3KLOA 1I1SA 1YLFA 2HYFA 2X4HA 3T0YA 4ETSA 2F5FA 5HOOA 4UUVA 2P8TA 3V8LA 4EM0B 3V4GA 1IRGA 5ILUA 4A0ZA 1WRJA 3ROUA 4QLCU 3SHFA 2GA2A 3GZ5A 1T2KA 1S7AA 3V7CA 4HW0A 4N0BA 2UWMA 1U5TA 1K79A 1XN7A 1QNTA 2RNJA 4RAZA 1HBXG 3V7RA 5BQTA 3GX4X 4G7HF 1QPMA 2ACJA 2XHKA 5IT9Z 1R1UA 2O03A 3GFMA 2HR3A 1U5TB 4Y17A 4KN7X 3T8RA 1R5GA 1O57A 4BHCA 5LGNA 2Z99A 2LNBA 2OAZA 1RUNA 2YPRA 4I0BA 4HQMA 4IPAA 4LLLA 2DT5A 1IN4A 1P92A 2CW0F 3DXJF 4B09A 3MQ0A 5L3DA 4CXFA 1J75A 2CGPA 1K78A 3NRVA 2QENA 2VE9A 1BC8C 3IC7A 2MH9A 1FWZA 3T8TA 1B9MA 2E7XA 2CG4A 1W5SA 2VC0A 3C1DA 4DNCA 3F23A 3F8NA 2A07F 3QRFF 5DCMB 3M8FA 1LJ9A 1XGOA 5HLIA 3REOA 1UHWA 1JHFA 4YIIA 2IVMA 2IJLA 2HKXA 5FD5A 4M9SA 4LB5A 2XVCA 4CZZA 4IVNA 1I6XA 4A6EA 4LFUA 1FBUA 1O7FA 3M1EA 4Q4ZF 1E17A 3RI4A 2E7WA 5K5RA 3LA3A 4EGZA 4L0YB 2EK5A 4HYEA 4LJZF 1G3WA 4HF2A 3IL2A 5DUKA 1AOYA 5LRSA 5D8KB 4XBFA 1P4AA 4FX0A 4YFKF 2G7UA 1OKRA 4Q5SF 3I64A 3I58A 4ENKA 3SFZA 3FMSA 1UB9A 1MJ9A 3WODF 4L5IA 4I2OA 2KKOA 4IHSA 1XGSA 1Z6TA 2V6CA 2V79A 3F8BA 1MDMA 4M6XA 4TV7A 2WV0A 4UVBA 2BE5F 5CJ9A 5FD6A 1FT9A 2GWRA 5FLXK 3HSFA 1WWXA 1G3TA 4KDPA 2F5EA 4MEXF 1DP7P 2P5VA 3BPXA 2FEZA 1B4AA 4I98B 4KT5C 4Y13A 4P5OA 1W4MA 2QLZA 2D1VA 4A5MA 1ON1A 2RQPA 5DEQA 2EA2A 2W25A 1TW3A 2IP2A 3DEUA 2WWYA 3CUOA 3WTTC 4PZJA 1HXDA 5E18F 1LQ1A 5KK1A 2MLKA 3GLXA 1YTYA 1T0FA 1S6LA 1U3EM 2DO7A 2K4BA 5DUIA 3L00A 4EM2A 3ZMDA 1T38A 1HSTA 1YS6A 2XAFA 2H27A 1WQ2A 4HZFA 3C3WA 5L3CA 3M8EA 3WTWC 1IN7A 2JZYA 4PGGA 3VFZA 3ECOA 4XSXF 4CDGA 4HAMA 3Q9VA 3I53A 4L0ZB 1R1VA 3TO9A 3COAC 4WWCA 4YFXF 3J81K 4ZZDA 3T5XA 1SMYF 3QPTA 4WCGA 3WTZA 4ESBA 5J8CA 2XUBA 3R0JA 1XSXA 2NS0A 4ZYEA 3O3KA 2L4MA 4BH9A 2STTA 2VODA 1B59A 1RZ4A 1FC3A 2Y0MA 3B02A 4AIKA 5HLHA 2W85A 4HLXA 5EEHA 3B73A 1O3RA 3FZVA 4HX7A 4I0AA 2PG4A 1F1ZA 1C0WA 4A2UA 4A5NA 1HKTA 1BC7C 3LAPA 2FMYA 2VXZA 4E70A 4KMFA 3DF8A 1BM9A 4HV5A 3KCCA 1TW2A 4N9IA 3TQNA 2ADUA 3WGGA 1GXPA 2O61A 3F3XA 1QZYA 2EFOA 4OIRF 3LAJA 2CWEA 1P4WA 1R23A 1EH8A 3GFJA 3I59A 2ESNA 5FLXZ 5AIPA 3ISPA 4GO1A 2OA4A 4A0YA 5AIQA 1BN5A 1W7PD 3RKXA 2TDXA 2W57A 3ZMTA 4ENMA 2F2EA 4EJVA 3M9AA 3ZMSA 4IJAA 2LKPA 5LBQA 3F22A 4RB2C 3WU1B 3MZHA 3HRUA 2KRFA 3E3VA 4MQVA 5E1XA 2YX7A 1XGNA 3NQOA 2YSRA 4HQEA 3BZ6A 2JPBA 4EGYA 3CTAA 2QQAA 2DTRA 5ICCA 1HW5A 2H09A 2ZXJA 2DI3A 4ESJA 4O3MA 3L2CA 4S04A 3P9KA 4UVCA 2P7VB 1IXSB 5DCFA 1D5VA 4B8XA 1LDJA 5KVRA 3WTVC 2JTVA 1L3LA 3V8KA 4LK1F 1PP7U 1XMAA 5K5QA 2ISZA 5TJJA 2W24A 4WXDA 3L9FA 1TQIA 1OR7A 1R36A 4XLNF 3OV8A 1V4RA 3GXOA 4HV6A 1BI2A 5ILSA 1O3TA 3I54A 1QGPA 4L5JA 3H3ZA 4F7ZA 1YW7A 4LG0B 1OPCA 2KIMA 1H0MA 2M45A 3AAFA 2Z33A 2XRNA 1LNWA 5H6QA 4BHBA 1LEBA 3FXQA 1HKSA 4N9HA 4HLYA 4BNCA 5JVTA 2MBFA 2ESHA 4GGGA 1HSJA 4AWXB 3ZMZA 3TO6A 2D45A 1FSEA 1J7KA 2XIGA 3K2ZA 4HX4A 3KZZA 3GUDA 3HUGA 2YU3A 3RYPA 3GW2A 3TDUC 3RJPA 4BXUA 1L0OC 2AS5F 3SXYA 5D4RA 3CO7C 4U0YA 3BJOA 3HRTA 4KYWA 3FWEA 2UXNA 4U88A 4G8XA 1FYMA 1ZLKA 3RPQA 4ZYHA 3F6OA 5HS8A 5D6EA 4U7BA 5CVJA 4I09A 1W7PB 2DK5A 4A12A 5K5OA 1P2FA 1KQ8A 1FYKA 4RB1A 3WTYC 2HWVA 3ECHA 1XGMA 2EFPA 2XV4S 4OOIA 3KLNA 4M72A 1Z7UA 1W5TA 1TNTA 2Q2EA 4D0PA
chains in the Genus database with same CATH superfamily
1SFEA 3SZGA 1K4SA 2EZHA 2JUCA 3DFGA 5E8GA 1SMTA 2QKMB 3GTJJ 3ZMUA 4MFDA 4BAYA 4KIBA 5JI6A 2BW3B 1MJBA 4II2A 2MLGA 3OL3A 3DBHB 1I50J 1I1GA 4PGHA 4ANJA 2FE3A 1LFUP 4OAZA 1KYWA 1UG2A 3HSEA 2EIJH 2QZ8A 3ZP5A 1FZPB 2E5ZA 5EZGA 2WC2A 2I10A 2WAQA 4BDYA 1ZQ3P 1SEUA 1UJ8A 3BR0A 4UUSB 1IZ1A 2JVHA 5FB2A 1X4PA 1Z77A 3H9JA 1REPC 1NH3A 3HOSA 4A3EJ 2F6CA 1W5CC 2OZ6A 5B1AH 4ESFA 3H92A 1JJ6C 3KP2A 1MMDA 3C2GA 4U0WA 4E7HA 1ZGAA 2EJRA 2PQ8A 4CGZA 2V9PA 5B5EC 2WBMA 3GWZA 3U2RA 4XOTA 3E5XA 4ENNA 1UELB 3HIFA 1FNNA 3HHHA 1U5TC 4CCKA 2E1MC 3PUBA 3L2VA 2KDOA 4LLGF 4S05A 5KHDA 1V54H 2EB7A 1DGWY 1XS9A 1S5LC 1WJFA 2VN2A 1BIBA 3CCMI 3GTPJ 1D8JA 2FX0A 2K9QA 4PJLA 4ZYGA 2Z3YA 2CH0A 2GLOA 3F9KA 3LA7A 2ID3A 1MJAA 1RKWA 2E1NA 3S15J 3PFYA 2XF5A 2NS7A 1IDYA 3RYRA 5GADJ 4AYBN 2ZNYA 4JBAA 3GTGJ 1ZN2A 5ICFA 2E5NA 2QEXI 5DV5A 3RZDJ 3R61A 3I4PA 4DBQA 2ZJ2A 1RKTA 3UNGC 5E3LA 3HOXJ 2VBWA 2Z16A 3DTKA 4PFPA 5TISC 2ZCWA 1RIOH 3DKWA 2BHYA 2CU7A 4B4CA 1JTYA 1KA8A 1QQIA 1PVEA 1MDMB 3MFKA 3DQVC 3BQYA 3HOZJ 1BJZA 5EGOA 2FBIA 2ECBA 3BZCA 3KP6A 4WF2A 2J5OA 2GZWA 2L02A 5ED4A 3IWZA 4YEJA 2NOJB 2GAUA 4CCJA 1TQPA 1DDNA 3M8JA 1IG7A 1MKMA 3DEEA 2ELJA 4EEFG 2IEKA 3PO3J 3ABTA 2HFHA 1EKEA 3F8FA 4DQ2A 1FTTA 5BPIA 1SFKA 4HDVA 2EIKH 2CQKA 5JR3A 5BS6A 4A3CJ 3GTOJ 3J81Z 1JKQC 4CYCB 4KIFA 3MD2A 3RKYA 2NYXA 1BBYA 4FCYA 3S16J 2L7MP 1ZG3A 4I99C 5D4SA 4EJWA 1MMNA 1Z6RA 3JRHA 3PM1A 1MMSA 2K5CA 2HVQA 1FP2A 3PIOF 3K4CA 4FE7A 3BCBA 1XD7A 2ZXWH 1AKHB 2WB1N 4O6JA 4ZTJA 1B72B 4Q48A 2EFNA 2H6CA 1T98A 2EIMH 2JJ7A 4YG2F 2PJPA 1AWCA 3KFWX 4M3BA 1IF1A 1P4XA 4A6DA 2LRDA 2L7ZA 3V8JA 3ELKA 2L01A 5FKLA 2CQXA 1GXQA 2V9VA 4XRFA 5JVGF 3X2QH 4ENJA 3OR2C 2K9NA 4HBLA 5AONA 1TQMA 3V7SA 2O3FA 1RPWA 2DLLA 2LF7A 2M5WA 3HRMA 3SYTA 2L3DA 3JTGA 4IO9F 2E1MB 1IXRC 2LSOA 1EJ9A 3RIRA 3GFLA 1GVJA 2A3SA 3LSMA 2VBZA 3OYJA 1ZRDA 3S1QJ 3JSOA 4CCOA 1YOVB 2KIUA 1U8RA 1XCVA 3VPRA 2E1CA 5CVUA 2IS1A 3O6BB 1TP4A 3HSRA 3Q0VA 1EH6A 4A3BJ 4RAYA 3RQIA 1TT0A 2CV0A 2RC4A 2DDBA 4BJ6C 4F92B 5HDGA 1JTXA 4RM3A 3CO6C 3V42A 4E7IA 4M74A 2QBYB 3K7AJ 3CCSI 4LG3A 1BL0A 2DMNA 1G59A 1RR8C 3K70C 1YG2A 2XKOA 1DU6A 1IV6A 5BPDA 3E6DA 1DQUA 1WFXA 3C2BA 3L09A 3BPVA 3HRSA 3FM3A 3CZ6A 4I02A 2FOKA 1BIAA 2KFDA 2LF8A 4OWRB 4BJ5C 4EVIA 5IP6A 2OTLI 2G9WA 1T6SA 3PQKA 2VOPA 2VASA 4XLCA 1O4XA 2D1HA 2VL8A 3BJ6A 4MNUA 4YIFA 3I4MJ 3VSLA 1Z05A 1Q1VA 1U2WA 5E1ZB 4UNOA 3CDHA 1PP8F 4BE1A 2GXBA 4DJAA 3OR1C 2AXTC 4HF1A 3BTIA 2LDUA 3M7GA 4DBRA 3TP3A 4FT8A 1ZRCA 1BR2A 2HNHA 5DYMA 3JR9A 2VPRA 1Z3YA 3W2AA 1QZZA 3WHBA 2XF6A 5F27A 1N25A 5LRRA 5HNHA 3MKYB 1U78A 1T39A 5IOYA 1K6OA 3QYFA 5FFXA 2IAIA 4PFOA 1IO2A 2LR8A 1TC3C 4BE2A 3BP8A 3HTSB 5K1YA 1MSFC 2BY1A 3QODA 3OY9A 3PJRA 2JSCA 1Q1HA 2DPDA 3SZTA 3M07A 2NAZA 3EUHA 3E6MA 3H0DA 1ZAOA 4XONA 2LD5A 5E20A 1VQ7I 4KNYA 3GTMJ 3P5JA 4CSWA 2EH3A 1A6QA 3FDYA 3JSPA 1V55H 3DKYA 1G8XA 5J40A 4JP0A 4BE0A 1R4MB 5HLTA 4R1HA 5D5VB 3ZQLA 2M0MA 3K4BA 1QVTA 5IYDJ 2LK2A 2Q0OA 2HPMA 1SD4A 2RKHA 1PUEE 1X19A 3MWMA 4XRMA 3GYHX 3DU6A 4D1QA 1KU7A 2LBFA 3OYIA 1V3FA 5F0CA 2X1CA 4E6KG 3WGIA 3IAS2 2PMZA 3LSKA 5HLGA 3MCZA 4HSRA 4FE4A 5TRDA 4CYDA 1WJAA 2MC4A 1ZYRF 1D0XA 4NQWA 1YJ9I 3IRQA 1P7JA 2IXSA 2R5YB 5GPAA 2DA4A 1RI7A 2YS9A 3H5RA 2GM4A 3F8MA 4KUMA 2PFBA 1ULYA 1LB2A 4AC0A 3CCRI 4IRGA 2KJBA 4OAYA 4QPOA 4JX5A 2PN6A 4Z6YA 2CW7A 2C6YA 4B3AA 4DGWB 1XB4A 3OOPA 1B1BA 3IRRA 2Y48A 3F6VA 2E2JJ 2PMUA 3TOAA 2X6YA 3VYSB 3KZYA 3MAJA 1SVMA 2EILH 1WKMA 3M4OJ 4C30A 2XGXA 2HVRA 2X85A 1TLHB 5C3EJ 1QBJA 3W6JB 1WJDA 1OCCH 1WVRA 5DCMA 4BJTA 3O8GA 3ERED 1YITI 1J59A 4BYYA 3ZQFA 3P7NA 2G7HA 1E2XA 2EV6A 2DW4A 2QA4I 2LY1A 1K83J 4L9TA 4AVZA 2K7LA 4X0GA 1IC8A 1MMGA 4XK4A 2P6SA 3H5AA 1OMIA 1G4DA 2R92J 1SVOA 2JWTA 3OWTA 5K7ZA 2QUFA 1UG0A 2MD5A 5GP9A 1TWFJ 3H1CA 1JE8A 4XN0A 3IV5A 4GXOA 5ILVA 3W3CA 5GPCA 5IYBJ 3ZQ7A 1WSUA 4EM1A 3D5LA 2XSDC 1H88C 1JHHA 3DV8A 5EJCA 2M7AA 1HOMA 1MIJA 1YHQI 2VJIA 2MA3A 3E5QA 2VXDA 3OL4A 2HOEA 3NAUA 3IHUA 4RBOA 3BG7A 3CMMA 5A2QZ 2FU4A 3LSTA 5HODA 1HC8A 4KN4X 1X2MA 1IUYA 1ON2A 1JKPC 3KEQA 1A31A 4M9XA 2A69F 3ZN0A 5E3NA 2PEXA 4F91B 4NUBA 3WE3A 3OYNA 1BI3A 1XC5A 4J00A 4RMNA 1N78A 1QPIA 1YYVA 1KQ9A 3PUFA 4PSXA 2ZXIA 1O3QA 4IRHA 1R7JA 2O9LA 2NNYA 2LLKA 3EQLF 4P1WA 4JYKA 3ZQGA 1WJEA 2CS3A 4XLHA 3TEDA 1FOXA 1X1PA 2DU9A 1TWCJ 4X6AJ 4HF0A 1OCZH 3ZR8X 5D5WB 2OQRA 3J7YJ 4BQQA 3EUKL 4CO8A 1XMXA 2KRHA 4IOCF 3LSGA 2HOAA 3PQJA 3FF5A 1FBSA 2VKHA 4OIPF 4XLPF 3H9QA 1UZCA 4NC6A 2V9KA 5LD2C 2FXAA 2A6EF 2KIFA 5L3FA 3WG9A 3AL0B 1WI9A 2W7NA 2MYSA 4BS9A 1G3YA 1WH5A 2X6XA 2LTPA 2DFEA 4PCQA 3GZ6A 3FKIJ 3S3NA 2FF4A 2QM3A 3GZNB 4H4KC 2Y9ZA 2BXYA 3HG9A 4Q47A 1ZGWA 1IN5A 1ZK8A 3L2QA 2R7VA 1T33A 2HTJA 2CQNA 1HW2A 3I55I 2NXNB 4BHPA 2STWA 5F08A 1HF0A 4L9JA 3GFIA 2PMHA 2FBHA 2NS8A 5L3GA 2VONA 3ULQB 1JXSA 1RUOA 4BKXA 3G4SI 4XM3A 2XB5A 3KP4A 1MSEC 2HTSA 3DLLF 3MKZA 3SQNA 1ORKA 2HEOA 2XSJC 3OSFA 2L9SA 3CUQB 5E17F 2F5CA 1MH4A 1K7AA 3JRAA 1X1AA 4ZDOA 2O7OA 5EF6A 3IKTA 2JK3A 3H35A 3G71I 4G6DA 2H8RA 2LYCA 2E34A 1YIOA 3QQAA 3R6SA 1IW7F 3FBNB 3CJNA 3HYIA 2V1UA 2HDWA 4OMYA 5CPRB 3L2WA 4FETA 2A68F 4D9JA 2CV1A 2M0CA 1IRZA 5D5UB 2DMPA 4UVAA 1UCRA 4EJOA 3TO7A 1LFBA 1DGRM 1GLNA 5KAIC 2HZTA 3FXLA 2NVXJ 3W2WA 3A0HC 1T08B 3CCEI 1BA5A 5ICGA 5GTIC 2VQLA 1W7PA 2X6OA 4H0EA 1ZLJA 3O8HA 1WGXA 4O5VA 2H1KA 1B9NA 4XQFA 4F52A 3JRBA 2YX4A 4LG0A 2O6GE 1LVAA 4II3A 2NVTJ 3E97A 1IN8A 3WG7H 2M30A 1K61A 1CF7B 1YRNA 3MZ8A 4WXHA 3FHZA 2R7FA 3CMEI 4RGSA 2DFIA 3E6BA 3G3ZA 1XSDA 4P9UA 1S3JA 2QCOA 3ZN1A 4XSZF 2R7OA 3A01A 3C18A 3E5UA 3SDBA 2MW8A 3KETA 3KIOA 2BYVE 2L9VA 2XASA 2AO9A 3NEUA 4NC8A 3FBIB 3G1LA 3WE2A 2R7TA 3KEOA 5FKKA 3ZCOA 1VQKI 1X58A 1SD6A 3HM5A 2QQ9A 4PK4A 1XDSA 2DTZA 5EDNA 1HKQA 4RGUA 4ZYAA 1KQ0A 3Q3SA 3A01B 3J80Z 2M8GX 3R0AA 3OYBA 5J8FA 4D7MA 2AQEA 2W82A 3BR1A 1ETKA 5LEJA 3AL0C 4MQ9F 3BQZA 2ELKA 3JAMZ 1X1BA 5DD8A 4KMUX 3H3VK 5TGTA 1F5TA 1PJRA 3ASNH 4Y3OA 3OYCA 1R1TA 2VPLA 3HHGA 2OJED 3LSPA 1YS7A 4B43A 1LEAA 2F5DA 4B47A 2R3SA 2IW5A 3LSIA 3HC7A 2VI6A 3S2WA 1U0JA 4Y7NJ 3IKVA 3QOEA 1JUSA 3WU0A 4B44A 3CCVI 4EMSA 3O2PE 2Y31A 1YX3A 4M6YA 4EJUA 4FTHA 5JLXA 2R93J 4AIDA 2R7SA 2NNNA 3PNYA 5J4YA 2F4OB 4PSWA 4QWQA 6PAXA 2GXGA 2HKOA 4OINF 3BCAA 1U9NA 2JPCA 2H8WA 2CRGA 2R7QA 2XAHA 3CP8A 1Y39A 1BOBA 3RCOA 1BW6A 2VT3A 2L4AA 1SAUA 4PDKA 5DD4A 2K4JA 3U1DA 2M1BA 2ZSHB 4KICA 5J1UA 4AIHA 2DQLA 4EQQA 5DM7F 3EUAA 1RETA 4JOMA 5J1YA 2R7DA 3LL7A 2IS6A 1ZR2A 5J3LA 1YW9A 3ML6A 4G9YA 1PDNC 2DDAA 1OFCX 2FNPA 3DPTA 1JGGA 1T95A 4HOBA 1SD5A 2V1XA 2RV8A 4B48A 4G7OF 2EFWA 2A6HF 1FY7A 2BW3A 4P9FA 2DA5A 1CF7A 1POGA 3HOTA 2RNGA 1LKXA 4V2GA 1VQ4I 5FGMA 2Z1DA 3ERMA 4I6ZA 3CCLI 3S1MJ 1OISA 4HX8A 2GQQA 2QQ8A 3CCJI 4KA4A 1QHHD 1TWHJ 2M3AA 4OIQF 1TNSA 1B6AA 1FP1D 3FMRA 4RLFA 3JAMK 1ZGJA 3ZQCA 3BDDA 4IF4A 3KE2A 1FX7A 2B9SA 2Y0SN 2LH9A 3QU6A 5D6FA 4WK8F 3K1NA 1BJAA 4R79A 5EYRA 4ABZA 5LHGA 2K85A 4UUTA 3GLLA 4U7DA 3NWSA 3S3OA 4LITA 1ODDA 2LC2A 4IKFA 1A04A 5EZHA 4HA8A 2IA0A 4XOPA 2UXXA 1K6YA 1R5HA 4FHTA 2COBA 4G7ZF 2GOXB 2ME0A 3F72A 2ZKZA 3CLOA 1OYIA 3FXJA 4K2EA 2FQ3A 3TGNA 1KU9A 3C2HA 1V5FA 3Q5FA 4FISA 1MZBA 4M6VA 4CCNA 5HDKA 3SEZA 4BXFA 2JT1A 3LNQA 1SC7A 2ZNZA 2CUEA 3BOQA 4CYCA 3LFKA 1GV2A 2VE8A 1LUJB 3DU5A 2HOSA 1DUXC 5H20A 2EPFA 4Y15A 4BBSJ 2DODA 2VBYA 3LWFA 4Y33A 1YO5C 2LP0A 2OCEA 2V7FA 2XROA 2KHMA 1BR1A 2YUSA 2IA1A 4N4OB 2Y9YA 2P5KA 3BT9A 4N4NB 5CLSA 3UKGA 1BW5A 2XGEA 5IP9J 2K3PA 2F4IA 2HYJA 3HTUA 5M5YJ 1VF9A 4RA2A 2WTEA 3OS2A 1VZ0A 2HS5A 2FSWA 2VOOA 2AHQA 2EA4A 3A1YA 3JTHA 4BBRJ 1F9NA 4A0XA 3OYDA 4XIDA 4DYRA 1CGPA 1ACIA 4KIGA 3K2AA 4NQWB 5LHIA 4JX4A 3HJEA 5F6FA 2PJRB 2A05A 3OS1A 5J6XA 1HW1A 5D5XB 3S14J 2FRHA 2DAOA 2GOMA 1IV8A 1JKRC 1MBKA 1TTYA 2ZMEB 1ETXA 4W97A 2L54A 4WXCA 4B3XA 1SAXA 1ETQA 2QSGX 1XMKA 3OSGA 2CW8A 2DFHA 3EDPA 4IXAA 4NDLA 3HUGB 4CCLA 1Y0NA 3RZOJ 1X1CA 3HOWJ 4QPQA 2L9RA 2Z5UA 2K86A 5EEAA 2IA2A 5CVRA 1HQCA 2ETHA 4E7JA 2D2WA 2OZUA 2KT0A 1OYYA 4FX4A 3KPHA 2OCCH 3OYHA 1J2XA 1FYLA 2X51A 1V5EA 3S3MA 3BROA 5CVVA 1X2NA 5LFAA 2HDDA 4J01A 4HSTA 1Y56A 1R5ID 2HQRA 1ETYA 3FXKA 2LG4A 2OQGA 4U87A 3K1MA 4LD5A 4EJTA 2VKVA 4NHJA 2BXZA 5E3OA 4DZPA 2IPQX 4U0VA 4A3JJ 3K69A 1F4KA 1LDDA 2NOGA 2AXLA 2QKLB 2DN0A 3DP7A 1IJWC 1R00A 1MBHA 1DPUA 2DMQA 1F43A 3P9CA 4IEJA 1ZELA 3DCFA 5CYVA 4ITVA 1JGSA 3A02A 3BR5A 2QWWA 2L9NA 2PBIA 1EV7A 4AD9A 1O3SA 3A2KA 1BI0A 1S9HA 3IWFA 3LSJA 2JA7J 1OCPA 1D1CA 3HKZA 2I8DA 1IRFA 2KIQA 3ZRGA 3CUQC 4DYQA 1KONA 1JT6A 2DBBA 2M4GA 5F0HA 4RB3C 3KP5A 3C7JA 3IUOA 4UHTA 5LHHA 2FOWA 1VNDA 1SFUA 5GAHJ 4XKVA 4GYIA 4I01A 2B0LA 3F21A 2XAGA 3M1CA 2RN7A 1R22A 3L2UA 2VQHA 5FO5A 4P96A 2GA1A 2XGDA 5L3BA 1YIJI 2KL4A 4RGRA 2VC1A 1ZH5A 2ZBKA 3S93A 3WGHA 2V1DA 3N05A 2YR2A 4G12A 5FFZA 3U9GA 3KX2A 1MD0A 2RVCA 1SANA 5M3MJ 2XAUA 3FXRA 2E60A 2HU9A 1IUFA 2JVGA 3RPUD 2M34A 1F36A 4RGXA 1K78B 2OBPA 4XRSG 4G6QA 2HVSA 3N97A 3K4NA 2O8XA 2FMLA 2PMZN 3K4KA 2RGVA 3FIWA 2DPUA 2OU2A 1U9OA 4C3JJ 3W2VA 3D1NI 1H9TA 2R5YA 1O7LA 3L1PA 2XC7A 3QYEA 4AVPA 2JRMA 4DOZA 3LA2A 4S0HB 3U21A 2M7BA 1FMVA 2FBKA 2WA0A 4L5EA 3FX3A 1WZ2A 3DLAA 1D0ZA 5IP7J 3HEFA 3G1OA 1X3UA 3E6CC 2FA5A 1AHDP 1APLC 2EINH 4IQ4A 2GIVA 1VQNI 1FMWA 3WTUC 3KP3A 4ZTFA 1GVDA 2BZTA 3BY6A 4MEYF 5HVQC 2Z9OA 3H3UA 1TL8A 1D8KA 1G6NA 5IT9K 3ZOBA 5FJ8J 3PSIA 1KU3A 4OMZA 3DEWA 3L7WA 4XICA 2HQ5A 2EFQA 2IRFG 4L9VA 1W1WE 1H9GA 3E1SA 1ETVA 3K0LA 3VEPA 5M5XJ 2CFOA 3DPLC 5JHUA 1W0UA 2WB1A 4I7HA 3CJTB 3ZPLA 2ISYA 4P55A 1N77A 3QU3A 2QGUA 3B6AA 1DPRA 1XSVA 5F64A 4IRIA 4AM3A 4E4HA 2R7RA 4XLAA 2K02A 5F1JA 3KP7A 1E3OC 5BMZA 2R7XA 1LE8A 3D5SC 3FXOA 2A6TA 2JSPA 4KJZA 3TKYA 3KYDB 5H6RA 2QQBA 4LB6B 4KT6A 1GHCA 2UV1A 2DMUA 1JT0A 3BC8A 2ELHA 3RPUA 4PJJA 1A36A 4MHGA 2Y0SA 2A61A 3J80K 1YJWI 1SD7A 2ZJRF 1U8BA 1RC9A 4PUSA 1OQYA 2WAQN 1B72A 1VFCA 2HYGD 2OD5A 3K9TA 5J1RA 5LEKA 2D5VA 5FRMA 4A3IJ 4IHVA 4BL0B 3CF5F 2E2HJ 3DTIA 2BOLA 2W4SA 3NARA 4AIJA 1FSHA 2MD0A 3I5UA 3ZQQA 1I5ZA 1NG6A 1WCMJ 1ZRFA 3RKWA 3HBLA 2ECCA 1Z1DA 3GO5A 3ONQA 3QWLA 1Z21A 1OYWA 1KYZA 1P6RA 1KU2A 3E0JB 1G3SA 2M9HA 2VB6A 3QOPA 4GCVA 4IHXA 3DBLB 5IT3A 4EV0A 1I27A 1XCBA 4IL6C 1YFHA 4OIOF 4CZCA 5HS7A 2CFXA 4BQAA 3EUHC 2EWNA 1X4OA 3F8CA 1S29A 3FHNA 4CICA 4YFNF 4OU0A 1HCRA 3VOEA 1VQ6I 3S2DJ 2CYYA 1UHSA 4M9ZA 3CC4I 2ZO4A 3WTXC 1UAAA 1VQ5I 1Y0UA 3DWLE 3A03A 1XPXA 2UZKA 2J5PA 3R4KA 4LMYA 2BV6A 2BVLA 1FLIA 3A0BC 1FOKA 2DJNA 5FLVA 3PFIA 3LQQA 3QAHA 2DK8A 2VBXA 3GF2A 2M8EA 2LBFB 5HDNA 2BEOA 2LREA 4GDFA 3ZGKA 4ON0A 3VODA 1UFMA 2KJCA 2ME6A 3TMOA 2DOFA 3BG5A 3QP5A 4XMYA 3CCYA 4RS8A 3HGYA 2R5ZB 1QA6A 1S7OA 2DA1A 3LQRA 1JJ8C 2E1OA 2XGCA 3CLQA 1WHUA 5KAFC 5CVIA 2XKPA 5HNFA 3OYGA 3BTLA 3RDIA 3W6KB 1ETOA 3S2HJ 1YW8A 1ONVA 4JQFA 5GAEJ 3TOBA 3CC7I 2I5UA 2NRAC 1CQTA 2Y69H 2CSOA 2G0EA 3K6GA 2X0LA 3ZXSA 3DKXA 4GFBA 1LPQA 1LDKB 4M73A 2HDCA 2A5YB 3LSHA 2R4GA 3BG9A 3AKZA 4JK1X 3Q9SA 4LIVA 3VYRB 1RNLA 1DP3A 4MTEA 1IN6A 4Z2YA 5EEGA 4MFEA 2L7FP 3GEZA 1XG1A 1J0RA 1BOAA 3GVAA 4L9NA 4D7NA 4ZH4F 3G73A 2O8KA 3R60A 2K40A 3JRFA 4HG2A 1IDZA 4HNTA 4CH7A 1STZA 3CP2A 4G6TB 1GDTA 2CUFA 1VTNC 4YRVA 1ZHFA 1U6GA 4HPQA 3SEQA 1S72I 1QO0D 3JW4A 3VB2A 3H5NA 3HPHA 1RESA 5J47A 5FLMJ 1JUPA 2MH2A 1IAWA 4IHWA 3P9IA 1QHGA 2QF7A 5ICEA 5LLQA 4X1EA 2Q8KA 2LY9A 2WADA 5E1WA 2W84A 1BR4A 2PI0A 2CUJA 3JRCA 3FM5A 5EG0B 2Q2EB 2ZMEA 1ITYA 2JMWA 1XDUA 3Q0UA 2CO5A 4C2MJ 3CJQB 2DQRA 3I0TA 2QYOA 2JA6J 5JFRA 2H94A 4F55A 2LKSA 2BHZA 1V5GA 2P6TA 3RKQA 1I3AA 1EA3A 3VYTB 3FXUA 2MC3A 3D0SA 1R58A 3UR3C 3TW7A 3QP6A 5A2QK 3J7AO 1ZG1A 1W0TA 1QZEA 3MKLA 4DZJA 2DA3A 3M3YJ 3VWBA 1OCOH 4A3KJ 1A5JA 1BI1A 4E7LA 2DFFA 3T1BA 2OUMA 4NBQA 2P7CB 1XX5A 1EF4A 3EYYA 2EV0A 1TT5B 2BGCA 1M1EB 3FKJA 3MVPA 2HGCA 2ZB9A 1X3ZB 3QPHA 3G2BA 4G94A 2B7EA 4LIUA 1B8IB 3S17J 1Z91A 3K1PA 2ZFWA 3PIPF 2NVQJ 3ABUA 1LE8B 4RB0A 5F1RA 2WAEA 3K4JA 4M71A 4MGRA 3WU2C 4UXNA 4ASNA 3OYLA 2BY3A 2PLYA 3WTSC 2X9DA 1YQAA 2EV5A 5ERIA 4HDUA 2XB0X 2X6WA 2BBYA 1VQMI 2DCEA 3NWTA 3TDZC 3K4MA 5K7HA 1TBXA 1A35A 2K27A 4KFCA 1GT0C 4L18B 3U1KA 5L3EA 2H6BA 9ANTA 2VIXA 1IXCA 4BY7J 5D8LB 4NB5A 1FTZA 4LLNA 2ID6A 4AU7A 2K9LA 2P4WA 3OYMA 5C44J 3H0GJ 2DXIA 4YIRX 3PNTA 1EH7A 2KDZA 4IZZA 4MTDA 4A3LJ 2P5LC 3CESA 4XLFA 2HQNA 3BJAA 1USTA 2IT0A 2JN6A 2EQRA 4WX9A 5HS9A 3I71A 1X1DA 4LK0F 1T56A 2PJRA 3PSFA 4DW6A 1ZR4A 2VKDA 1WJCA 4M3FA 3MEXA 3N4MA 2QBYA 3SZPA 1FPQA 4XKCA 4CHUA 5DDGA 1R4NB 5LGUA 4LGWA 3I59B 1J9IA 2VT2A 4J19A 1FJLA 1FBQA 3EETA 2O5RA 2CMPA 3DPUA 3TL4X 1J5YA 4UV8A 4R8HA 3FMQA 2JA8J 2DJIA 2EBIA 5DTDA 4UV9A 2E35A 3OIOA 2XAJA 2LFBA 2O0YA 3MZYA 2X1DA 2XAQA 1MGTA 1ZARA 4PJ0C 4BDZA 2FNAA 4V19K 3BWGA 4ZYDA 3I4NJ 1S8NA 4CA0A 4ZZLA 1JKOC 3GTQJ 2RDPA 1KGSA 4XRSA 2M87A 1ENHA 2DA7A 5BOXA 1SFXA 2JRTA 2KZVA 3ZMVA 2DYSH 2HZDA 2COMA 1D3YA 1UHMA 2QVOA 1D1AA 3CUQA 3SJMA 2M4KA 2M2EA 2XF7A 1ZREA 1USSA 4GRIA 5FROA 4QSHA 1VI0A 4GYGA 1ZG5A 3EYIA 3ESWB 4XKBA 2ZFUA 1KZHA 4IHTA 1Z9CA 4BY1J 3RTRA 2BVMA 1E3PA 5LGTA 1NHAA 2VJJA 3OYKA 5E8IA 4E7ZA 2Y75A 3KLOA 1I1SA 1YLFA 2HYFA 2X4HA 3KZIC 3T0YA 4ETSA 2F5FA 5GAGJ 3HOVJ 5HOOA 4D5FA 4RAGA 4UUVA 2KLOA 2P8TA 3V8LA 5H2FC 1JI8A 4EM0B 3V4GA 1IRGA 1ETWA 5ILUA 3VYUB 1WRJA 3ROUA 4A0ZA 3AG3H 4QLCU 3SHFA 2GA2A 3GZ5A 1T2KA 1I39A 1S7AA 4F93B 3IP4B 5EGOB 2JQ7A 2XPVA 3V7CA 3PO2J 4HW0A 4N0BA 3OS0A 2UWMA 1U5TA 1K79A 1XN7A 1QNTA 2RNJA 4RAZA 2ZXHA 1HBXG 3V7RA 4C2TA 5BQTA 3GX4X 4G7HF 5E79C 1QPMA 2ACJA 1HDPA 2XHKA 2DT6A 1ERDA 5IT9Z 4I76A 1R1UA 2O03A 1Y6IA 3GFMA 2HR3A 2VKEA 1U5TB 4Y17A 4KN7X 1MBEA 3T8RA 4HRIA 1R5GA 1IRXA 1O57A 3IH3A 4BHCA 2RQQA 5LGNA 2Z99A 2B63J 5IOZA 2ZJQF 2LNBA 3QPLA 2OPTA 1LVKA 1RRJA 2OAZA 1HA8A 1RUNA 1N75A 2YPRA 4I0BA 4HQMA 3J7AY 2K9MA 4IPAA 3CCQI 3GBGA 3S8PA 4LLLA 2DA6A 4HEA2 2DT5A 4XKWA 1FOWA 1IN4A 1P92A 2CW0F 1MBFA 3DXJF 4B09A 3MQ0A 5L3DA 4CXFA 1J75A 1NTCA 2LMDA 2CGPA 3OIPA 2V4JC 5C4JJ 1K78A 3NRVA 2QENA 2VE9A 3HOUJ 1BC8C 3IC7A 2MH9A 1FWZA 3TP0A 4E7SA 3T8TA 2BY2A 1B9MA 2E7XA 4BGDA 1P7IA 2CG4A 2CV2A 1W5SA 2VC0A 4E7KA 1T0FC 3C1DA 4DNCA 5B66C 3F23A 3F8NA 2F4MB 3ABLH 2A07F 2PX9A 3QRFF 2WV1A 2L7KA 5DCMB 1J09A 2FUG2 3M8FA 3GTLJ 1LJ9A 1XGOA 5HLIA 3REOA 1FEXA 4RM2A 1UHWA 4BEHA 4BUPA 3HDDA 5M5WJ 1JHFA 2XPUA 4YIIA 3B6CA 3HXLA 2IVMA 2IJLA 1JUMA 2HKXA 2LOOA 2E36A 5FD5A 4M9SA 3RQ4A 4LB5A 2E71A 2VLAA 3BR6A 2XVCA 1HDDC 4KITB 4CZZA 4IVNA 3HKZN 4BEHB 4NNJA 1I6XA 4A6EA 4LFUA 1FBUA 3HOYJ 1Z7LA 1O7FA 2W1OA 1VQ8I 3A4CA 1MBGA 3M1EA 4C3IJ 4Q4ZF 4BQOA 3K70D 1E17A 3RI4A 2Z2SB 3IH4A 3JRGA 3HL2A 1AKHA 2X48A 2E7WA 3CDLA 3LOCA 3DTEA 3LA3A 5K5RA 2R7ZJ 4MLOA 4EGZA 4PJNA 4XORA 2XPWA 4L0YB 2EK5A 4RLQA 4HYEA 4LJZF 1PUFA 1G3WA 1ZKGA 2NVYJ 4HF2A 2V1NA 3IL2A 5DUKA 4NC7A 1AOYA 4B1RA 5LRSA 1MNMC 3BG3A 5F04A 5D8KB 4RDUA 2KP6A 2VQCA 1XTAA 3BG6A 4XBFA 1P4AA 3QPSA 3W6VA 2XRLA 2HPIA 4FX0A 4YFKF 2G7UA 1G2HA 4PJMA 1OKRA 3I3LA 4Q5SF 3I64A 2FD5A 4A3FJ 2VJ5A 1WPKA 3I58A 3D5RC 4ENKA 3SFZA 3FMSA 1UB9A 1MJ9A 3WODF 1NK2P 2KZGA 1NK3P 2FJ1A 3CD6I 4L5IA 3CMYA 4I2OA 2X1EA 3TBIA 4DIQA 2KKOA 3Q0WA 4FASD 4IHSA 1XGSA 1Z6TA 2R7WA 1DU0A 2V6CA 3BTJA 3JREA 2V79A 3F8BA 3SFIA 2QSHX 2ZSIB 2QSFX 1MDMA 2E2IJ 2ICWG 4M6XA 4TV7A 2WY7Q 2WV0A 3JRIA 3JCUC 4UVBA 5CQEA 4A3DJ 2BE5F 1OLTA 3H9GA 5CJ9A 5DM6F 3FK7A 3FXMA 3VSKA 1WJBA 5FD6A 1FT9A 3GTKJ 2GWRA 5FLXK 5K7FA 3HSFA 1WWXA 1G3TA 4KDPA 2JA5J 3S1NJ 3LSRA 2KPMA 1TWAJ 2F5EA 3MMYB 4MO7A 4MEXF 1DP7P 2P5VA 4ZDLA 1D5YA 3BPXA 2FEZA 5KNLA 1B4AA 4I98B 2MGQA 4KT5C 2R0QC 2EZKA 4Y13A 4P5OA 1W4MA 1MBJA 2QLZA 2KRCA 1LFPA 1R71A 2GXAA 2D1VA 4A5MA 4D5CA 1ON1A 2RQPA 5DEQA 3FISA 4QIWN 2EA2A 1E0EA 2W25A 2XDVA 1X3WB 5IY5H 1TW3A 2IP2A 1R6RA 5M3FJ 1HLVA 1WH7A 3DEUA 2WWYA 3CUOA 4C9YA 3VDXA 2F5VA 2A5WA 3WTTC 4PZJA 2DA2A 3CMAI 3CQZJ 4LOCA 1Y1VJ 1HXDA 2ZC2A 3MKWB 4HNUA 5E18F 2VUMJ 3CDIA 4IX7A 1LQ1A 5KK1A 4IHYA 3ZQIA 2MLKA 3BTCA 1H89C 2IGMA 2ZMEC 1MW7A 3GLXA 2P0WA 5KCMA 1YTYA 1T0FA 2IGKA 4A3GJ 1S6LA 1U3EM 2LY2A 2DO7A 2K4BA 5DUIA 2EZIA 3L00A 3BLYA 3I56I 4EM2A 2R5ZA 3ZMDA 5CKTA 1T38A 1VQOI 2CQQA 3BR3A 5CQGA 3BZKA 1HSTA 1YS6A 2XAFA 2MG4A 2H27A 1WQ2A 4HZFA 3C3WA 2UUZA 4QTRA 5L3CA 1D1BA 1A6IA 3M8EA 2WY8Q 3WTWC 3E7LA 5FKOA 4BACA 1IN7A 2JZYA 4PGGA 3CJRB 3VFZA 2HQAA 3ECOA 4XSXF 3IAM2 4CDGA 1QU3A 4HAMA 2HI3A 3Q9VA 3I53A 4L0ZB 1R1VA 1YRNB 3TO9A 1GUUA 3AG2H 4WWCA 3COAC 5FRNA 4YFXF 3JRDA 3J81K 4ZZDA 3T5XA 1PYVA 1SMYF 1WI3A 2VJ4A 2VQGA 3QPTA 4WCGA 3WTZA 4ESBA 5J8CA 4BXXJ 2XUBA 3CF2A 3R0JA 5IYCJ 1XSXA 2NS0A 4ZYEA 2Y2ZA 3O3KA 2KQRA 2L4MA 4BH9A 2STTA 5EG0A 2VODA 5FKNA 1B59A 1RZ4A 1K4TA 1FC3A 2Y0MA 1D0YA 3B02A 4AIKA 3HGGA 1NG7A 2RAEA 4XN3A 5HLHA 4A93J 2W85A 4HLXA 5EEHA 3OMYA 3B73A 1O3RA 3FZVA 4HX7A 4I0AA 2DOAA 2PG4A 3H36A 3GMEA 1F1ZA 1C0WA 4CUGA 4A2UA 4A5NA 1E3HA 5B1BH 1HKTA 1BC7C 3LAPA 2FMYA 1Z67A 2VXZA 3MN2A 4E70A 1Y1WJ 4KMFA 3DF8A 5IPAA 2R7UA 4ZDPA 1BM9A 4Y4RA 4HV5A 3KCCA 1TW2A 4N9IA 3TQNA 2ADUA 2MFZA 4XR6A 2AQFA 2CJJA 1OCRH 1QVUA 3WGGA 4EATA 1GXPA 1FIPA 5E3MA 3F3XA 1Z3XA 1QZYA 2O61A 2EFOA 2OV7A 4OIRF 3KEYA 3LAJA 2BY0A 2JUGA 2MSYA 2CWEA 1P4WA 3AG4H 1VQ9I 1R23A 2OTJI 1PUFB 5JHFA 2L2OA 1EH8A 1QRYA 3GFJA 3SDGA 5GTHC 3AFHA 4BQNA 4F3QA 3I59A 2ESNA 5FLXZ 4JX6A 2HXOA 5AIPA 3ISPA 4GO1A 2OA4A 3S32A 1AA7A 3OYFA 4A0YA 1ZTRA 5AIQA 1BN5A 1W7PD 3RKXA 2TDXA 2W57A 3HB9A 3ZMTA 4ENMA 2F2EA 4EJVA 3ABKH 3TW6A 3M9AA 3ZMSA 4IJAA 2LKPA 3OOUA 3CCUI 5LBQA 4YELA 2DMTA 2IGOA 3ABMH 2E19A 3F22A 3BR2A 4W1UA 4RB2C 3WU1B 2F48A 3MZHA 4UY8I 3HRUA 3LMMA 2KRFA 3E3VA 4MQVA 1S7EA 5E1XA 1RR7A 1TZLA 2YX7A 4KISA 1XGNA 3NQOA 2YSRA 3F0CA 4HQEA 3BZ6A 2JPBA 4EGYA 2HOTA 3CTAA 2FQ4A 2RREA 2QQAA 2DTRA 1Z0XA 2V26A 3QYBA 1I6HJ 5C4XJ 5ICCA 4A3MJ 5F0FA 1HW5A 5JLWA 2H09A 2ZXJA 2LVSA 3ZQHA 3OIQA 2L5QA 2DI3A 4ESJA 3PL8A 4O3MA 3L2CA 4S04A 4AYBA 3EPZA 3KYCB 3PNVA 3P9KA 3KYLA 1R9TJ 1IGNA 4UVCA 4MIMA 2P7VB 1IXSB 5DCFA 1D5VA 4B8XA 4UUSA 1LDJA 4HNVA 3S1RJ 5KVRA 3WTVC 2JTVA 1L3LA 3V8KA 4LK1F 1PP7U 1XMAA 1OJLA 5K5QA 2ISZA 5TJJA 4XL9A 1AU7A 2W24A 1Y8QB 4WXDA 1T8IA 3I9V2 1MNDA 4FQGA 3L9FA 1TQIA 4UB6C 2LKXA 3G6EI 1OR7A 1R36A 4XLNF 3OV8A 1I3QJ 4A69C 1OR7C 1V4RA 3GXOA 4HV6A 1BI2A 5ILSA 1YE9A 1O3TA 3ASOH 3I54A 3AG1H 4RAFA 2DYRH 3WHCA 4IQJA 2K3FA 4BU2A 3GCMA 4M3EA 1QGPA 2JA2A 4L5JA 3H3ZA 3G1MA 2DT7B 4F7ZA 1YW7A 4V2FA 4LG0B 1OPCA 2KIMA 1YI2I 1H0MA 2M45A 3AAFA 2Z33A 3J7ZI 2XRNA 2CQ7A 3HZJA 1LNWA 5H6QA 2TRTA 1MMAA 2GIZA 4BHBA 1YJNI 1LEBA 4AUXA 3FXQA 1OCTC 1SFOJ 2OC6A 1HKSA 4Y52J 3OYEA 4N9HA 1FOYA 4HLYA 4BNCA 3K4LA 2OF7A 2GBYA 5JVTA 2MBFA 2ESHA 4GGGA 1WJ5A 1H8AC 1HSJA 4AWXB 1R49A 1W36D 1YX5A 3ZMZA 3LFUA 3TO6A 2D45A 5BNGA 2TCTA 4IOAF 1SVLA 1FSEA 1J7KA 2XIGA 2Y30A 3K2ZA 4HX4A 3DBRB 2NVUB 1VQPI 2YU9J 2MABA 2IGNA 3KZZA 3GUDA 3HUGA 2K9SA 2YU3A 3IH2A 3RYPA 2HXIA 3GW2A 1UMQA 4XLEA 3K10A 4M3DA 2IS2A 1VQLI 3RSNA 5B3SH 3TDUC 2IS4A 3CC2I 1TWGJ 2W48A 2KMUA 2H1LA 3RJPA 4BXUA 1L0OC 4C3HJ 3SXYA 5D4RA 2AS5F 3CO7C 2N8GA 4U0YA 1MH3A 3HRTA 3BJOA 5DS9A 3FWEA 4KYWA 3OYAA 2UXNA 5FKMA 1FIAA 4U88A 4G8XA 4ZJZA 1FYMA 1ZLKA 2ZJPF 2KISA 3FK6A 2W00A 3RPQA 4ZYHA 4M3GA 2V6EA 2IBDA 2WAFA 3F6OA 5HS8A 5D6EA 3L2RA 4U7BA 1W36C 5CVJA 1MNEA 2DOEA 2EZLA 4ZC3A 4I09A 1W7PB 1GV5A 2DK5A 3HPGA 4A12A 4DYCA 1P9QC 5K5OA 5J4VA 1P2FA 4XNFA 4UB8C 1KQ8A 1FYKA 4RB1A 3WTYC 2HWVA 3ECHA 1XGMA 2EFPA 2CUZA 2XV4S 1B8IA 4OOIA 3KLNA 4CCMA 2L0KA 4M72A 4C2UA 1Z7UA 1W5TA 2P81A 2Q1ZB 1TNTA 1Y8RB 2Q2EA 4D0PA
chains in the Genus database with same CATH topology
1SFEA 3DFGA 5E8GA 1SMTA 3ZMUA 4BAYA 4KIBA 5JI6A 1MJBA 2MLGA 4PGHA 1I1GA 2FE3A 1KYWA 3HSEA 3ZP5A 2QZ8A 1FZPB 2WC2A 1IZ1A 5FB2A 1REPC 3HOSA 2OZ6A 4ESFA 3H92A 3KP2A 4U0WA 1ZGAA 2EJRA 2PQ8A 4CGZA 3GWZA 3U2RA 3E5XA 4ENNA 3HIFA 1FNNA 3HHHA 1U5TC 4LLGF 4S05A 2EB7A 2VN2A 1BIBA 1D8JA 4ZYGA 2Z3YA 3LA7A 1MJAA 2E1NA 3RYRA 2ZNYA 4JBAA 1ZN2A 5ICFA 5DV5A 3R61A 3I4PA 2ZJ2A 2VBWA 1RIOH 2ZCWA 3DKWA 1KA8A 1QQIA 1MDMB 3MFKA 3DQVC 2FBIA 3KP6A 4WF2A 2J5OA 2GZWA 2L02A 5ED4A 3IWZA 2GAUA 1TQPA 1DDNA 1MKMA 3ABTA 2HFHA 3F8FA 4DQ2A 5BPIA 4HDVA 2CQKA 5JR3A 5BS6A 3J81Z 4KIFA 3RKYA 2NYXA 1BBYA 1ZG3A 5D4SA 4EJWA 1Z6RA 1FP2A 1XD7A 4O6JA 4Q48A 2EFNA 2H6CA 1T98A 4YG2F 2PJPA 1AWCA 3KFWX 1IF1A 1P4XA 4A6DA 3V8JA 3ELKA 2L01A 1GXQA 2V9VA 4XRFA 4ENJA 4HBLA 5AONA 1TQMA 3V7SA 2O3FA 2DLLA 2LF7A 2M5WA 3HRMA 2L3DA 3JTGA 1IXRC 2LSOA 3RIRA 3GFLA 1GVJA 2A3SA 1ZRDA 2VBZA 3JSOA 2KIUA 1U8RA 1XCVA 2E1CA 5CVUA 3O6BB 3HSRA 1EH6A 4RAYA 2RC4A 5HDGA 3CO6C 4M74A 2QBYB 1YG2A 2XKOA 5BPDA 3E6DA 3L09A 3BPVA 3HRSA 3FM3A 4I02A 2FOKA 1BIAA 2LF8A 4EVIA 2G9WA 1T6SA 3PQKA 2VOPA 2D1HA 3BJ6A 4MNUA 4YIFA 1Z05A 5E1ZB 4UNOA 1U2WA 3CDHA 1PP8F 2GXBA 4HF1A 2LDUA 3M7GA 4FT8A 1ZRCA 5DYMA 1QZZA 5LRRA 1U78A 1T39A 1K6OA 5FFXA 3BP8A 3HTSB 5K1YA 2JSCA 1Q1HA 2DPDA 3SZTA 2NAZA 3EUHA 3E6MA 1ZAOA 5E20A 4KNYA 3JSPA 5D5VB 4R1HA 2Q0OA 1SD4A 1PUEE 2RKHA 3MWMA 3GYHX 1KU7A 1V3FA 3WGIA 5HLGA 3MCZA 5TRDA 4CYDA 1ZYRF 4NQWA 3IRQA 1RI7A 3F8MA 4KUMA 2PFBA 1ULYA 1LB2A 4IRGA 2KJBA 2PN6A 2C6YA 1XB4A 3OOPA 1B1BA 3IRRA 2Y48A 3F6VA 2PMUA 3TOAA 3KZYA 3MAJA 1WKMA 2XGXA 1QBJA 1TLHB 3W6JB 5DCMA 3ERED 1J59A 4BYYA 3P7NA 2G7HA 1E2XA 2EV6A 2DW4A 4L9TA 2K7LA 2P6SA 1OMIA 1G4DA 2QUFA 2MD5A 1JE8A 4GXOA 5ILVA 3ZQ7A 1WSUA 4EM1A 3D5LA 1JHHA 3DV8A 2MA3A 3E5QA 2HOEA 3IHUA 5A2QZ 2FU4A 3LSTA 4KN4X 1IUYA 1ON2A 3KEQA 4M9XA 2A69F 3ZN0A 2PEXA 3WE3A 1BI3A 1YYVA 1KQ9A 1O3QA 4IRHA 1R7JA 2NNYA 3EQLF 2DU9A 4HF0A 5D5WB 2OQRA 4CO8A 3PQJA 3FF5A 1FBSA 4OIPF 4XLPF 2FXAA 2A6EF 2KIFA 5L3FA 3WG9A 1WI9A 1G3YA 4PCQA 3GZ6A 2FF4A 2QM3A 4Q47A 1IN5A 2HTJA 1HW2A 2STWA 4BHPA 4L9JA 3GFIA 2PMHA 2FBHA 5L3GA 2VONA 3ULQB 1JXSA 1RUOA 3KP4A 2HTSA 3SQNA 2HEOA 3CUQB 5E17F 2F5CA 1K7AA 3IKTA 4G6DA 1YIOA 3R6SA 1IW7F 3CJNA 3HYIA 2V1UA 4OMYA 2A68F 5D5UB 4UVAA 1UCRA 4EJOA 3TO7A 2HZTA 5ICGA 1W7PA 4H0EA 1ZLJA 4O5VA 1B9NA 2YX4A 4LG0A 2O6GE 1LVAA 3E97A 1IN8A 2M30A 1CF7B 4WXHA 3FHZA 2R7FA 4RGSA 2DFIA 3E6BA 3G3ZA 1XSDA 4P9UA 1S3JA 3ZN1A 4XSZF 3C18A 3E5UA 3KETA 2BYVE 2XASA 3NEUA 3WE2A 3KEOA 1SD6A 2QQ9A 1XDSA 1HKQA 4RGUA 1KQ0A 3J80Z 3R0AA 5J8FA 5LEJA 4MQ9F 3JAMZ 5DD8A 4KMUX 1F5TA 1R1TA 3HHGA 1YS7A 1LEAA 2F5DA 2R3SA 2IW5A 3S2WA 3IKVA 3WU0A 4EMSA 3O2PE 4M6YA 4EJUA 2NNNA 4QWQA 6PAXA 2GXGA 2HKOA 4OINF 2JPCA 2XAHA 2VT3A 2L4AA 5DD4A 4PDKA 2K4JA 3U1DA 2M1BA 4KICA 4AIHA 2DQLA 4EQQA 2R7DA 1YW9A 3ML6A 4G9YA 1PDNC 2FNPA 3DPTA 4HOBA 1SD5A 2V1XA 2RV8A 4G7OF 2EFWA 2A6HF 1FY7A 4P9FA 1CF7A 3HOTA 5FGMA 4HX8A 2GQQA 4KA4A 4OIQF 1TNSA 1B6AA 1FP1D 3FMRA 3JAMK 1ZGJA 3BDDA 4IF4A 3KE2A 1FX7A 4WK8F 3QU6A 5D6FA 3K1NA 1BJAA 4R79A 5LHGA 4U7DA 1ODDA 1A04A 4HA8A 2IA0A 2UXXA 1R5HA 4FHTA 4G7ZF 3F72A 2ZKZA 3CLOA 1OYIA 4K2EA 2FQ3A 3TGNA 1KU9A 3Q5FA 1MZBA 5HDKA 2JT1A 2ZNZA 3BOQA 3LFKA 2VE8A 1DUXC 5H20A 4Y15A 2VBYA 3LWFA 1YO5C 2XROA 2IA1A 2P5KA 5CLSA 3HTUA 2WTEA 2HS5A 2FSWA 2VOOA 2EA4A 3JTHA 1F9NA 4A0XA 1CGPA 4KIGA 5LHIA 5F6FA 5J6XA 1HW1A 5D5XB 2FRHA 2DAOA 1TTYA 2ZMEB 2L54A 4WXCA 1SAXA 1XMKA 3EDPA 4IXAA 2Z5UA 2K86A 2IA2A 5CVRA 1HQCA 2ETHA 2D2WA 2OZUA 1OYYA 4FX4A 1J2XA 1FYLA 3BROA 5CVVA 2HQRA 2OQGA 3K1MA 4LD5A 4EJTA 4NHJA 2IPQX 4U0VA 1F4KA 3K69A 1LDDA 3DP7A 2AXLA 1R00A 1DPUA 3P9CA 5CYVA 1JGSA 2QWWA 2PBIA 1EV7A 4AD9A 1O3SA 1BI0A 3IWFA 1IRFA 3CUQC 2DBBA 4RB3C 3KP5A 3C7JA 4UHTA 5LHHA 1SFUA 4GYIA 4I01A 2B0LA 3F21A 2XAGA 2RN7A 1R22A 5FO5A 4P96A 2GA1A 5L3BA 4RGRA 2VC1A 1ZH5A 2ZBKA 3WGHA 2V1DA 3U9GA 2YR2A 5FFZA 1MD0A 2RVCA 3FXRA 4RGXA 1K78B 2OBPA 4G6QA 3N97A 2O8XA 2FMLA 2RGVA 2DPUA 2OU2A 1H9TA 1O7LA 4AVPA 3LA2A 2FBKA 3FX3A 1X3UA 3E6CC 2FA5A 2GIVA 3WTUC 3KP3A 3BY6A 4MEYF 5HVQC 2Z9OA 3H3UA 1D8KA 1G6NA 5IT9K 1KU3A 4OMZA 3L7WA 2EFQA 2IRFG 4L9VA 1H9GA 3K0LA 3VEPA 3DPLC 5JHUA 4I7HA 3ZPLA 2ISYA 4P55A 3QU3A 1DPRA 1XSVA 5F64A 4IRIA 2K02A 3KP7A 5BMZA 3TKYA 5H6RA 2QQBA 4LB6B 1GHCA 2ELHA 3RPUA 4MHGA 2A61A 3J80K 1SD7A 2HYGD 2OD5A 3K9TA 5LEKA 4AIJA 1FSHA 3I5UA 1I5ZA 1ZRFA 3RKWA 1Z1DA 3GO5A 1OYWA 1KYZA 1P6RA 1KU2A 1G3SA 3QOPA 4GCVA 5IT3A 4EV0A 1I27A 1XCBA 1YFHA 4OIOF 5HS7A 2CFXA 4BQAA 2EWNA 3F8CA 1S29A 4CICA 4YFNF 4OU0A 3VOEA 2CYYA 4M9ZA 2ZO4A 3WTXC 1Y0UA 2UZKA 2J5PA 3R4KA 4LMYA 2BV6A 1FLIA 1FOKA 3PFIA 3LQQA 3QAHA 2DK8A 2VBXA 3GF2A 2M8EA 5HDNA 2BEOA 4ON0A 3VODA 1UFMA 2KJCA 3QP5A 4RS8A 1S7OA 3LQRA 5CVIA 2XKPA 3RDIA 3W6KB 1YW8A 1ONVA 4JQFA 3TOBA 2NRAC 2CSOA 2X0LA 1LDKB 4M73A 2HDCA 2A5YB 4JK1X 3Q9SA 1RNLA 4MTEA 1IN6A 4Z2YA 5EEGA 3GEZA 1J0RA 1BOAA 3GVAA 4L9NA 4ZH4F 3G73A 3R60A 1STZA 1VTNC 1ZHFA 1U6GA 1QO0D 3JW4A 3VB2A 2MH2A 1IAWA 3P9IA 5ICEA 5LLQA 2Q8KA 5E1WA 2W84A 2PI0A 3FM5A 2ZMEA 1XDUA 2CO5A 2DQRA 3I0TA 2QYOA 5JFRA 2H94A 2P6TA 3FXUA 2MC3A 3D0SA 1R58A 5A2QK 3J7AO 3QP6A 1ZG1A 1BI1A 3T1BA 2P7CB 3EYYA 2EV0A 2BGCA 2HGCA 3QPHA 4G94A 1Z91A 3K1PA 2ZFWA 3ABUA 4RB0A 5F1RA 4M71A 4MGRA 4UXNA 4ASNA 2PLYA 3WTSC 5ERIA 1YQAA 2EV5A 4HDUA 2BBYA 3TDZC 1TBXA 2K27A 4KFCA 4L18B 5L3EA 2H6BA 1IXCA 5D8LB 4NB5A 4LLNA 2P4WA 1EH7A 4MTDA 2P5LC 2HQNA 3BJAA 1USTA 2IT0A 4WX9A 5HS9A 3I71A 4LK0F 3MEXA 3N4MA 2QBYA 3SZPA 1FPQA 4CHUA 5DDGA 5LGUA 4LGWA 3I59B 1J9IA 2VT2A 1FBQA 3EETA 1J5YA 4UV8A 4R8HA 3FMQA 4UV9A 2XAJA 2O0YA 3MZYA 2XAQA 1MGTA 1ZARA 2FNAA 3BWGA 4ZYDA 1S8NA 4ZZLA 2RDPA 1KGSA 2M87A 5BOXA 1SFXA 2JRTA 3ZMVA 2COMA 1D3YA 1UHMA 2QVOA 3CUQA 1ZREA 1USSA 4GYGA 1ZG5A 3EYIA 4IHTA 1Z9CA 3RTRA 5LGTA 1NHAA 5E8IA 2Y75A 3KLOA 1I1SA 1YLFA 2HYFA 2X4HA 3T0YA 4ETSA 2F5FA 5HOOA 4UUVA 2P8TA 3V8LA 4EM0B 3V4GA 1IRGA 5ILUA 4A0ZA 1WRJA 3ROUA 4QLCU 3SHFA 2GA2A 3GZ5A 1T2KA 1S7AA 3V7CA 4HW0A 4N0BA 2UWMA 1U5TA 1K79A 1XN7A 1QNTA 2RNJA 4RAZA 1HBXG 3V7RA 5BQTA 3GX4X 4G7HF 1QPMA 2ACJA 2XHKA 5IT9Z 1R1UA 2O03A 3GFMA 2HR3A 1U5TB 4Y17A 4KN7X 3T8RA 1R5GA 1O57A 4BHCA 5LGNA 2Z99A 2LNBA 2OAZA 1RUNA 2YPRA 4I0BA 4HQMA 4IPAA 4LLLA 2DT5A 1IN4A 1P92A 2CW0F 3DXJF 4B09A 3MQ0A 5L3DA 4CXFA 1J75A 2CGPA 1K78A 3NRVA 2QENA 2VE9A 1BC8C 3IC7A 2MH9A 1FWZA 3T8TA 1B9MA 2E7XA 2CG4A 1W5SA 2VC0A 3C1DA 4DNCA 3F23A 3F8NA 2A07F 3QRFF 5DCMB 3M8FA 1LJ9A 1XGOA 5HLIA 3REOA 1UHWA 1JHFA 4YIIA 2IVMA 2IJLA 2HKXA 5FD5A 4M9SA 4LB5A 2XVCA 4CZZA 4IVNA 1I6XA 4A6EA 4LFUA 1FBUA 1O7FA 3M1EA 4Q4ZF 1E17A 3RI4A 2E7WA 5K5RA 3LA3A 4EGZA 4L0YB 2EK5A 4HYEA 4LJZF 1G3WA 4HF2A 3IL2A 5DUKA 1AOYA 5LRSA 5D8KB 4XBFA 1P4AA 4FX0A 4YFKF 2G7UA 1OKRA 4Q5SF 3I64A 3I58A 4ENKA 3SFZA 3FMSA 1UB9A 1MJ9A 3WODF 4L5IA 4I2OA 2KKOA 4IHSA 1XGSA 1Z6TA 2V6CA 2V79A 3F8BA 1MDMA 4M6XA 4TV7A 2WV0A 4UVBA 2BE5F 5CJ9A 5FD6A 1FT9A 2GWRA 5FLXK 3HSFA 1WWXA 1G3TA 4KDPA 2F5EA 4MEXF 1DP7P 2P5VA 3BPXA 2FEZA 1B4AA 4I98B 4KT5C 4Y13A 4P5OA 1W4MA 2QLZA 2D1VA 4A5MA 1ON1A 2RQPA 5DEQA 2EA2A 2W25A 1TW3A 2IP2A 3DEUA 2WWYA 3CUOA 3WTTC 4PZJA 1HXDA 5E18F 1LQ1A 5KK1A 2MLKA 3GLXA 1YTYA 1T0FA 1S6LA 1U3EM 2DO7A 2K4BA 5DUIA 3L00A 4EM2A 3ZMDA 1T38A 1HSTA 1YS6A 2XAFA 2H27A 1WQ2A 4HZFA 3C3WA 5L3CA 3M8EA 3WTWC 1IN7A 2JZYA 4PGGA 3VFZA 3ECOA 4XSXF 4CDGA 4HAMA 3Q9VA 3I53A 4L0ZB 1R1VA 3TO9A 3COAC 4WWCA 4YFXF 3J81K 4ZZDA 3T5XA 1SMYF 3QPTA 4WCGA 3WTZA 4ESBA 5J8CA 2XUBA 3R0JA 1XSXA 2NS0A 4ZYEA 3O3KA 2L4MA 4BH9A 2STTA 2VODA 1B59A 1RZ4A 1FC3A 2Y0MA 3B02A 4AIKA 5HLHA 2W85A 4HLXA 5EEHA 3B73A 1O3RA 3FZVA 4HX7A 4I0AA 2PG4A 1F1ZA 1C0WA 4A2UA 4A5NA 1HKTA 1BC7C 3LAPA 2FMYA 2VXZA 4E70A 4KMFA 3DF8A 1BM9A 4HV5A 3KCCA 1TW2A 4N9IA 3TQNA 2ADUA 3WGGA 1GXPA 2O61A 3F3XA 1QZYA 2EFOA 4OIRF 3LAJA 2CWEA 1P4WA 1R23A 1EH8A 3GFJA 3I59A 2ESNA 5FLXZ 5AIPA 3ISPA 4GO1A 2OA4A 4A0YA 5AIQA 1BN5A 1W7PD 3RKXA 2TDXA 2W57A 3ZMTA 4ENMA 2F2EA 4EJVA 3M9AA 3ZMSA 4IJAA 2LKPA 5LBQA 3F22A 4RB2C 3WU1B 3MZHA 3HRUA 2KRFA 3E3VA 4MQVA 5E1XA 2YX7A 1XGNA 3NQOA 2YSRA 4HQEA 3BZ6A 2JPBA 4EGYA 3CTAA 2QQAA 2DTRA 5ICCA 1HW5A 2H09A 2ZXJA 2DI3A 4ESJA 4O3MA 3L2CA 4S04A 3P9KA 4UVCA 2P7VB 1IXSB 5DCFA 1D5VA 4B8XA 1LDJA 5KVRA 3WTVC 2JTVA 1L3LA 3V8KA 4LK1F 1PP7U 1XMAA 5K5QA 2ISZA 5TJJA 2W24A 4WXDA 3L9FA 1TQIA 1OR7A 1R36A 4XLNF 3OV8A 1V4RA 3GXOA 4HV6A 1BI2A 5ILSA 1O3TA 3I54A 1QGPA 4L5JA 3H3ZA 4F7ZA 1YW7A 4LG0B 1OPCA 2KIMA 1H0MA 2M45A 3AAFA 2Z33A 2XRNA 1LNWA 5H6QA 4BHBA 1LEBA 3FXQA 1HKSA 4N9HA 4HLYA 4BNCA 5JVTA 2MBFA 2ESHA 4GGGA 1HSJA 4AWXB 3ZMZA 3TO6A 2D45A 1FSEA 1J7KA 2XIGA 3K2ZA 4HX4A 3KZZA 3GUDA 3HUGA 2YU3A 3RYPA 3GW2A 3TDUC 3RJPA 4BXUA 1L0OC 2AS5F 3SXYA 5D4RA 3CO7C 4U0YA 3BJOA 3HRTA 4KYWA 3FWEA 2UXNA 4U88A 4G8XA 1FYMA 1ZLKA 3RPQA 4ZYHA 3F6OA 5HS8A 5D6EA 4U7BA 5CVJA 4I09A 1W7PB 2DK5A 4A12A 5K5OA 1P2FA 1KQ8A 1FYKA 4RB1A 3WTYC 2HWVA 3ECHA 1XGMA 2EFPA 2XV4S 4OOIA 3KLNA 4M72A 1Z7UA 1W5TA 1TNTA 2Q2EA 4D0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFE A;  3DFG A;  5E8G A;  1SMT A;  3ZMU A;  4BAY A;  4KIB A;  5JI6 A;  1MJB A;  2MLG A;  4PGH A;  1I1G A;  2FE3 A;  1KYW A;  3HSE A;  3ZP5 A;  2QZ8 A;  1FZP B;  2WC2 A;  1IZ1 A;  5FB2 A;  1REP C;  3HOS A;  2OZ6 A;  4ESF A;  3H92 A;  3KP2 A;  4U0W A;  1ZGA A;  2EJR A;  2PQ8 A;  4CGZ A;  3GWZ A;  3U2R A;  3E5X A;  4ENN A;  3HIF A;  1FNN A;  3HHH A;  1U5T C;  4LLG F;  4S05 A;  2EB7 A;  2VN2 A;  1BIB A;  1D8J A;  4ZYG A;  2Z3Y A;  3LA7 A;  1MJA A;  2E1N A;  3RYR A;  2ZNY A;  4JBA A;  1ZN2 A;  5ICF A;  5DV5 A;  3R61 A;  3I4P A;  2ZJ2 A;  2VBW A;  1RIO H;  2ZCW A;  3DKW A;  1KA8 A;  1QQI A;  1MDM B;  3MFK A;  3DQV C;  2FBI A;  3KP6 A;  4WF2 A;  2J5O A;  2GZW A;  2L02 A;  5ED4 A;  3IWZ A;  2GAU A;  1TQP A;  1DDN A;  1MKM A;  3ABT A;  2HFH A;  3F8F A;  4DQ2 A;  5BPI A;  4HDV A;  2CQK A;  5JR3 A;  5BS6 A;  3J81 Z;  4KIF A;  3RKY A;  2NYX A;  1BBY A;  1ZG3 A;  5D4S A;  4EJW A;  1Z6R A;  1FP2 A;  1XD7 A;  4O6J A;  4Q48 A;  2EFN A;  2H6C A;  1T98 A;  4YG2 F;  2PJP A;  1AWC A;  3KFW X;  1IF1 A;  1P4X A;  4A6D A;  3V8J A;  3ELK A;  2L01 A;  1GXQ A;  2V9V A;  4XRF A;  4ENJ A;  4HBL A;  5AON A;  1TQM A;  3V7S A;  2O3F A;  2DLL A;  2LF7 A;  2M5W A;  3HRM A;  2L3D A;  3JTG A;  1IXR C;  2LSO A;  3RIR A;  3GFL A;  1GVJ A;  2A3S A;  1ZRD A;  2VBZ A;  3JSO A;  2KIU A;  1U8R A;  1XCV A;  2E1C A;  5CVU A;  3O6B B;  3HSR A;  1EH6 A;  4RAY A;  2RC4 A;  5HDG A;  3CO6 C;  4M74 A;  2QBY B;  1YG2 A;  2XKO A;  5BPD A;  3E6D A;  3L09 A;  3BPV A;  3HRS A;  3FM3 A;  4I02 A;  2FOK A;  1BIA A;  2LF8 A;  4EVI A;  2G9W A;  1T6S A;  3PQK A;  2VOP A;  2D1H A;  3BJ6 A;  4MNU A;  4YIF A;  1Z05 A;  5E1Z B;  4UNO A;  1U2W A;  3CDH A;  1PP8 F;  2GXB A;  4HF1 A;  2LDU A;  3M7G A;  4FT8 A;  1ZRC A;  5DYM A;  1QZZ A;  5LRR A;  1U78 A;  1T39 A;  1K6O A;  5FFX A;  3BP8 A;  3HTS B;  5K1Y A;  2JSC A;  1Q1H A;  2DPD A;  3SZT A;  2NAZ A;  3EUH A;  3E6M A;  1ZAO A;  5E20 A;  4KNY A;  3JSP A;  5D5V B;  4R1H A;  2Q0O A;  1SD4 A;  1PUE E;  2RKH A;  3MWM A;  3GYH X;  1KU7 A;  1V3F A;  3WGI A;  5HLG A;  3MCZ A;  5TRD A;  4CYD A;  1ZYR F;  4NQW A;  3IRQ A;  1RI7 A;  3F8M A;  4KUM A;  2PFB A;  1ULY A;  1LB2 A;  4IRG A;  2KJB A;  2PN6 A;  2C6Y A;  1XB4 A;  3OOP A;  1B1B A;  3IRR A;  2Y48 A;  3F6V A;  2PMU A;  3TOA A;  3KZY A;  3MAJ A;  1WKM A;  2XGX A;  1QBJ A;  1TLH B;  3W6J B;  5DCM A;  3ERE D;  1J59 A;  4BYY A;  3P7N A;  2G7H A;  1E2X A;  2EV6 A;  2DW4 A;  4L9T A;  2K7L A;  2P6S A;  1OMI A;  1G4D A;  2QUF A;  2MD5 A;  1JE8 A;  4GXO A;  5ILV A;  3ZQ7 A;  1WSU A;  4EM1 A;  3D5L A;  1JHH A;  3DV8 A;  2MA3 A;  3E5Q A;  2HOE A;  3IHU A;  5A2Q Z;  2FU4 A;  3LST A;  4KN4 X;  1IUY A;  1ON2 A;  3KEQ A;  4M9X A;  2A69 F;  3ZN0 A;  2PEX A;  3WE3 A;  1BI3 A;  1YYV A;  1KQ9 A;  1O3Q A;  4IRH A;  1R7J A;  2NNY A;  3EQL F;  2DU9 A;  4HF0 A;  5D5W B;  2OQR A;  4CO8 A;  3PQJ A;  3FF5 A;  1FBS A;  4OIP F;  4XLP F;  2FXA A;  2A6E F;  2KIF A;  5L3F A;  3WG9 A;  1WI9 A;  1G3Y A;  4PCQ A;  3GZ6 A;  2FF4 A;  2QM3 A;  4Q47 A;  1IN5 A;  2HTJ A;  1HW2 A;  2STW A;  4BHP A;  4L9J A;  3GFI A;  2PMH A;  2FBH A;  5L3G A;  2VON A;  3ULQ B;  1JXS A;  1RUO A;  3KP4 A;  2HTS A;  3SQN A;  2HEO A;  3CUQ B;  5E17 F;  2F5C A;  1K7A A;  3IKT A;  4G6D A;  1YIO A;  3R6S A;  1IW7 F;  3CJN A;  3HYI A;  2V1U A;  4OMY A;  2A68 F;  5D5U B;  4UVA A;  1UCR A;  4EJO A;  3TO7 A;  2HZT A;  5ICG A;  1W7P A;  4H0E A;  1ZLJ A;  4O5V A;  1B9N A;  2YX4 A;  4LG0 A;  2O6G E;  1LVA A;  3E97 A;  1IN8 A;  2M30 A;  1CF7 B;  4WXH A;  3FHZ A;  2R7F A;  4RGS A;  2DFI A;  3E6B A;  3G3Z A;  1XSD A;  4P9U A;  1S3J A;  3ZN1 A;  4XSZ F;  3C18 A;  3E5U A;  3KET A;  2BYV E;  2XAS A;  3NEU A;  3WE2 A;  3KEO A;  1SD6 A;  2QQ9 A;  1XDS A;  1HKQ A;  4RGU A;  1KQ0 A;  3J80 Z;  3R0A A;  5J8F A;  5LEJ A;  4MQ9 F;  3JAM Z;  5DD8 A;  4KMU X;  1F5T A;  1R1T A;  3HHG A;  1YS7 A;  1LEA A;  2F5D A;  2R3S A;  2IW5 A;  3S2W A;  3IKV A;  3WU0 A;  4EMS A;  3O2P E;  4M6Y A;  4EJU A;  2NNN A;  4QWQ A;  6PAX A;  2GXG A;  2HKO A;  4OIN F;  2JPC A;  2XAH A;  2VT3 A;  2L4A A;  5DD4 A;  4PDK A;  2K4J A;  3U1D A;  2M1B A;  4KIC A;  4AIH A;  2DQL A;  4EQQ A;  2R7D A;  1YW9 A;  3ML6 A;  4G9Y A;  1PDN C;  2FNP A;  3DPT A;  4HOB A;  1SD5 A;  2V1X A;  2RV8 A;  4G7O F;  2EFW A;  2A6H F;  1FY7 A;  4P9F A;  1CF7 A;  3HOT A;  5FGM A;  4HX8 A;  2GQQ A;  4KA4 A;  4OIQ F;  1TNS A;  1B6A A;  1FP1 D;  3FMR A;  3JAM K;  1ZGJ A;  3BDD A;  4IF4 A;  3KE2 A;  1FX7 A;  4WK8 F;  3QU6 A;  5D6F A;  3K1N A;  1BJA A;  4R79 A;  5LHG A;  4U7D A;  1ODD A;  1A04 A;  4HA8 A;  2IA0 A;  2UXX A;  1R5H A;  4FHT A;  4G7Z F;  3F72 A;  2ZKZ A;  3CLO A;  1OYI A;  4K2E A;  2FQ3 A;  3TGN A;  1KU9 A;  3Q5F A;  1MZB A;  5HDK A;  2JT1 A;  2ZNZ A;  3BOQ A;  3LFK A;  2VE8 A;  1DUX C;  5H20 A;  4Y15 A;  2VBY A;  3LWF A;  1YO5 C;  2XRO A;  2IA1 A;  2P5K A;  5CLS A;  3HTU A;  2WTE A;  2HS5 A;  2FSW A;  2VOO A;  2EA4 A;  3JTH A;  1F9N A;  4A0X A;  1CGP A;  4KIG A;  5LHI A;  5F6F A;  5J6X A;  1HW1 A;  5D5X B;  2FRH A;  2DAO A;  1TTY A;  2ZME B;  2L54 A;  4WXC A;  1SAX A;  1XMK A;  3EDP A;  4IXA A;  2Z5U A;  2K86 A;  2IA2 A;  5CVR A;  1HQC A;  2ETH A;  2D2W A;  2OZU A;  1OYY A;  4FX4 A;  1J2X A;  1FYL A;  3BRO A;  5CVV A;  2HQR A;  2OQG A;  3K1M A;  4LD5 A;  4EJT A;  4NHJ A;  2IPQ X;  4U0V A;  1F4K A;  3K69 A;  1LDD A;  3DP7 A;  2AXL A;  1R00 A;  1DPU A;  3P9C A;  5CYV A;  1JGS A;  2QWW A;  2PBI A;  1EV7 A;  4AD9 A;  1O3S A;  1BI0 A;  3IWF A;  1IRF A;  3CUQ C;  2DBB A;  4RB3 C;  3KP5 A;  3C7J A;  4UHT A;  5LHH A;  1SFU A;  4GYI A;  4I01 A;  2B0L A;  3F21 A;  2XAG A;  2RN7 A;  1R22 A;  5FO5 A;  4P96 A;  2GA1 A;  5L3B A;  4RGR A;  2VC1 A;  1ZH5 A;  2ZBK A;  3WGH A;  2V1D A;  3U9G A;  2YR2 A;  5FFZ A;  1MD0 A;  2RVC A;  3FXR A;  4RGX A;  1K78 B;  2OBP A;  4G6Q A;  3N97 A;  2O8X A;  2FML A;  2RGV A;  2DPU A;  2OU2 A;  1H9T A;  1O7L A;  4AVP A;  3LA2 A;  2FBK A;  3FX3 A;  1X3U A;  3E6C C;  2FA5 A;  2GIV A;  3WTU C;  3KP3 A;  3BY6 A;  4MEY F;  5HVQ C;  2Z9O A;  3H3U A;  1D8K A;  1G6N A;  5IT9 K;  1KU3 A;  4OMZ A;  3L7W A;  2EFQ A;  2IRF G;  4L9V A;  1H9G A;  3K0L A;  3VEP A;  3DPL C;  5JHU A;  4I7H A;  3ZPL A;  2ISY A;  4P55 A;  3QU3 A;  1DPR A;  1XSV A;  5F64 A;  4IRI A;  2K02 A;  3KP7 A;  5BMZ A;  3TKY A;  5H6R A;  2QQB A;  4LB6 B;  1GHC A;  2ELH A;  3RPU A;  4MHG A;  2A61 A;  3J80 K;  1SD7 A;  2HYG D;  2OD5 A;  3K9T A;  5LEK A;  4AIJ A;  1FSH A;  3I5U A;  1I5Z A;  1ZRF A;  3RKW A;  1Z1D A;  3GO5 A;  1OYW A;  1KYZ A;  1P6R A;  1KU2 A;  1G3S A;  3QOP A;  4GCV A;  5IT3 A;  4EV0 A;  1I27 A;  1XCB A;  1YFH A;  4OIO F;  5HS7 A;  2CFX A;  4BQA A;  2EWN A;  3F8C A;  1S29 A;  4CIC A;  4YFN F;  4OU0 A;  3VOE A;  2CYY A;  4M9Z A;  2ZO4 A;  3WTX C;  1Y0U A;  2UZK A;  2J5P A;  3R4K A;  4LMY A;  2BV6 A;  1FLI A;  1FOK A;  3PFI A;  3LQQ A;  3QAH A;  2DK8 A;  2VBX A;  3GF2 A;  2M8E A;  5HDN A;  2BEO A;  4ON0 A;  3VOD A;  1UFM A;  2KJC A;  3QP5 A;  4RS8 A;  1S7O A;  3LQR A;  5CVI A;  2XKP A;  3RDI A;  3W6K B;  1YW8 A;  1ONV A;  4JQF A;  3TOB A;  2NRA C;  2CSO A;  2X0L A;  1LDK B;  4M73 A;  2HDC A;  2A5Y B;  4JK1 X;  3Q9S A;  1RNL A;  4MTE A;  1IN6 A;  4Z2Y A;  5EEG A;  3GEZ A;  1J0R A;  1BOA A;  3GVA A;  4L9N A;  4ZH4 F;  3G73 A;  3R60 A;  1STZ A;  1VTN C;  1ZHF A;  1U6G A;  1QO0 D;  3JW4 A;  3VB2 A;  2MH2 A;  1IAW A;  3P9I A;  5ICE A;  5LLQ A;  2Q8K A;  5E1W A;  2W84 A;  2PI0 A;  3FM5 A;  2ZME A;  1XDU A;  2CO5 A;  2DQR A;  3I0T A;  2QYO A;  5JFR A;  2H94 A;  2P6T A;  3FXU A;  2MC3 A;  3D0S A;  1R58 A;  5A2Q K;  3J7A O;  3QP6 A;  1ZG1 A;  1BI1 A;  3T1B A;  2P7C B;  3EYY A;  2EV0 A;  2BGC A;  2HGC A;  3QPH A;  4G94 A;  1Z91 A;  3K1P A;  2ZFW A;  3ABU A;  4RB0 A;  5F1R A;  4M71 A;  4MGR A;  4UXN A;  4ASN A;  2PLY A;  3WTS C;  5ERI A;  1YQA A;  2EV5 A;  4HDU A;  2BBY A;  3TDZ C;  1TBX A;  2K27 A;  4KFC A;  4L18 B;  5L3E A;  2H6B A;  1IXC A;  5D8L B;  4NB5 A;  4LLN A;  2P4W A;  1EH7 A;  4MTD A;  2P5L C;  2HQN A;  3BJA A;  1UST A;  2IT0 A;  4WX9 A;  5HS9 A;  3I71 A;  4LK0 F;  3MEX A;  3N4M A;  2QBY A;  3SZP A;  1FPQ A;  4CHU A;  5DDG A;  5LGU A;  4LGW A;  3I59 B;  1J9I A;  2VT2 A;  1FBQ A;  3EET A;  1J5Y A;  4UV8 A;  4R8H A;  3FMQ A;  4UV9 A;  2XAJ A;  2O0Y A;  3MZY A;  2XAQ A;  1MGT A;  1ZAR A;  2FNA A;  3BWG A;  4ZYD A;  1S8N A;  4ZZL A;  2RDP A;  1KGS A;  2M87 A;  5BOX A;  1SFX A;  2JRT A;  3ZMV A;  2COM A;  1D3Y A;  1UHM A;  2QVO A;  3CUQ A;  1ZRE A;  1USS A;  4GYG A;  1ZG5 A;  3EYI A;  4IHT A;  1Z9C A;  3RTR A;  5LGT A;  1NHA A;  5E8I A;  2Y75 A;  3KLO A;  1I1S A;  1YLF A;  2HYF A;  2X4H A;  3T0Y A;  4ETS A;  2F5F A;  5HOO A;  4UUV A;  2P8T A;  3V8L A;  4EM0 B;  3V4G A;  1IRG A;  5ILU A;  4A0Z A;  1WRJ A;  3ROU A;  4QLC U;  3SHF A;  2GA2 A;  3GZ5 A;  1T2K A;  1S7A A;  3V7C A;  4HW0 A;  4N0B A;  2UWM A;  1U5T A;  1K79 A;  1XN7 A;  1QNT A;  2RNJ A;  4RAZ A;  1HBX G;  3V7R A;  5BQT A;  3GX4 X;  4G7H F;  1QPM A;  2ACJ A;  2XHK A;  5IT9 Z;  1R1U A;  2O03 A;  3GFM A;  2HR3 A;  1U5T B;  4Y17 A;  4KN7 X;  3T8R A;  1R5G A;  1O57 A;  4BHC A;  5LGN A;  2Z99 A;  2LNB A;  2OAZ A;  1RUN A;  2YPR A;  4I0B A;  4HQM A;  4IPA A;  4LLL A;  2DT5 A;  1IN4 A;  1P92 A;  2CW0 F;  3DXJ F;  4B09 A;  3MQ0 A;  5L3D A;  4CXF A;  1J75 A;  2CGP A;  1K78 A;  3NRV A;  2QEN A;  2VE9 A;  1BC8 C;  3IC7 A;  2MH9 A;  1FWZ A;  3T8T A;  1B9M A;  2E7X A;  2CG4 A;  1W5S A;  2VC0 A;  3C1D A;  4DNC A;  3F23 A;  3F8N A;  2A07 F;  3QRF F;  5DCM B;  3M8F A;  1LJ9 A;  1XGO A;  5HLI A;  3REO A;  1UHW A;  1JHF A;  4YII A;  2IVM A;  2IJL A;  2HKX A;  5FD5 A;  4M9S A;  4LB5 A;  2XVC A;  4CZZ A;  4IVN A;  1I6X A;  4A6E A;  4LFU A;  1FBU A;  1O7F A;  3M1E A;  4Q4Z F;  1E17 A;  3RI4 A;  2E7W A;  5K5R A;  3LA3 A;  4EGZ A;  4L0Y B;  2EK5 A;  4HYE A;  4LJZ F;  1G3W A;  4HF2 A;  3IL2 A;  5DUK A;  1AOY A;  5LRS A;  5D8K B;  4XBF A;  1P4A A;  4FX0 A;  4YFK F;  2G7U A;  1OKR A;  4Q5S F;  3I64 A;  3I58 A;  4ENK A;  3SFZ A;  3FMS A;  1UB9 A;  1MJ9 A;  3WOD F;  4L5I A;  4I2O A;  2KKO A;  4IHS A;  1XGS A;  1Z6T A;  2V6C A;  2V79 A;  3F8B A;  1MDM A;  4M6X A;  4TV7 A;  2WV0 A;  4UVB A;  2BE5 F;  5CJ9 A;  5FD6 A;  1FT9 A;  2GWR A;  5FLX K;  3HSF A;  1WWX A;  1G3T A;  4KDP A;  2F5E A;  4MEX F;  1DP7 P;  2P5V A;  3BPX A;  2FEZ A;  1B4A A;  4I98 B;  4KT5 C;  4Y13 A;  4P5O A;  1W4M A;  2QLZ A;  2D1V A;  4A5M A;  1ON1 A;  2RQP A;  5DEQ A;  2EA2 A;  2W25 A;  1TW3 A;  2IP2 A;  3DEU A;  2WWY A;  3CUO A;  3WTT C;  4PZJ A;  1HXD A;  5E18 F;  1LQ1 A;  5KK1 A;  2MLK A;  3GLX A;  1YTY A;  1T0F A;  1S6L A;  1U3E M;  2DO7 A;  2K4B A;  5DUI A;  3L00 A;  4EM2 A;  3ZMD A;  1T38 A;  1HST A;  1YS6 A;  2XAF A;  2H27 A;  1WQ2 A;  4HZF A;  3C3W A;  5L3C A;  3M8E A;  3WTW C;  1IN7 A;  2JZY A;  4PGG A;  3VFZ A;  3ECO A;  4XSX F;  4CDG A;  4HAM A;  3Q9V A;  3I53 A;  4L0Z B;  1R1V A;  3TO9 A;  3COA C;  4WWC A;  4YFX F;  3J81 K;  4ZZD A;  3T5X A;  1SMY F;  3QPT A;  4WCG A;  3WTZ A;  4ESB A;  5J8C A;  2XUB A;  3R0J A;  1XSX A;  2NS0 A;  4ZYE A;  3O3K A;  2L4M A;  4BH9 A;  2STT A;  2VOD A;  1B59 A;  1RZ4 A;  1FC3 A;  2Y0M A;  3B02 A;  4AIK A;  5HLH A;  2W85 A;  4HLX A;  5EEH A;  3B73 A;  1O3R A;  3FZV A;  4HX7 A;  4I0A A;  2PG4 A;  1F1Z A;  1C0W A;  4A2U A;  4A5N A;  1HKT A;  1BC7 C;  3LAP A;  2FMY A;  2VXZ A;  4E70 A;  4KMF A;  3DF8 A;  1BM9 A;  4HV5 A;  3KCC A;  1TW2 A;  4N9I A;  3TQN A;  2ADU A;  3WGG A;  1GXP A;  2O61 A;  3F3X A;  1QZY A;  2EFO A;  4OIR F;  3LAJ A;  2CWE A;  1P4W A;  1R23 A;  1EH8 A;  3GFJ A;  3I59 A;  2ESN A;  5FLX Z;  5AIP A;  3ISP A;  4GO1 A;  2OA4 A;  4A0Y A;  5AIQ A;  1BN5 A;  1W7P D;  3RKX A;  2TDX A;  2W57 A;  3ZMT A;  4ENM A;  2F2E A;  4EJV A;  3M9A A;  3ZMS A;  4IJA A;  2LKP A;  5LBQ A;  3F22 A;  4RB2 C;  3WU1 B;  3MZH A;  3HRU A;  2KRF A;  3E3V A;  4MQV A;  5E1X A;  2YX7 A;  1XGN A;  3NQO A;  2YSR A;  4HQE A;  3BZ6 A;  2JPB A;  4EGY A;  3CTA A;  2QQA A;  2DTR A;  5ICC A;  1HW5 A;  2H09 A;  2ZXJ A;  2DI3 A;  4ESJ A;  4O3M A;  3L2C A;  4S04 A;  3P9K A;  4UVC A;  2P7V B;  1IXS B;  5DCF A;  1D5V A;  4B8X A;  1LDJ A;  5KVR A;  3WTV C;  2JTV A;  1L3L A;  3V8K A;  4LK1 F;  1PP7 U;  1XMA A;  5K5Q A;  2ISZ A;  5TJJ A;  2W24 A;  4WXD A;  3L9F A;  1TQI A;  1OR7 A;  1R36 A;  4XLN F;  3OV8 A;  1V4R A;  3GXO A;  4HV6 A;  1BI2 A;  5ILS A;  1O3T A;  3I54 A;  1QGP A;  4L5J A;  3H3Z A;  4F7Z A;  1YW7 A;  4LG0 B;  1OPC A;  2KIM A;  1H0M A;  2M45 A;  3AAF A;  2Z33 A;  2XRN A;  1LNW A;  5H6Q A;  4BHB A;  1LEB A;  3FXQ A;  1HKS A;  4N9H A;  4HLY A;  4BNC A;  5JVT A;  2MBF A;  2ESH A;  4GGG A;  1HSJ A;  4AWX B;  3ZMZ A;  3TO6 A;  2D45 A;  1FSE A;  1J7K A;  2XIG A;  3K2Z A;  4HX4 A;  3KZZ A;  3GUD A;  3HUG A;  2YU3 A;  3RYP A;  3GW2 A;  3TDU C;  3RJP A;  4BXU A;  1L0O C;  2AS5 F;  3SXY A;  5D4R A;  3CO7 C;  4U0Y A;  3BJO A;  3HRT A;  4KYW A;  3FWE A;  2UXN A;  4U88 A;  4G8X A;  1FYM A;  1ZLK A;  3RPQ A;  4ZYH A;  3F6O A;  5HS8 A;  5D6E A;  4U7B A;  5CVJ A;  4I09 A;  1W7P B;  2DK5 A;  4A12 A;  5K5O A;  1P2F A;  1KQ8 A;  1FYK A;  4RB1 A;  3WTY C;  2HWV A;  3ECH A;  1XGM A;  2EFP A;  2XV4 S;  4OOI A;  3KLN A;  4M72 A;  1Z7U A;  1W5T A;  1TNT A;  2Q2E A;  4D0P A; 
#chains in the Genus database with same CATH topology
 1SFE A;  3SZG A;  1K4S A;  2EZH A;  2JUC A;  3DFG A;  5E8G A;  1SMT A;  2QKM B;  3GTJ J;  3ZMU A;  4MFD A;  4BAY A;  4KIB A;  5JI6 A;  2BW3 B;  1MJB A;  4II2 A;  2MLG A;  3OL3 A;  3DBH B;  1I50 J;  1I1G A;  4PGH A;  4ANJ A;  2FE3 A;  1LFU P;  4OAZ A;  1KYW A;  1UG2 A;  3HSE A;  2EIJ H;  2QZ8 A;  3ZP5 A;  1FZP B;  2E5Z A;  5EZG A;  2WC2 A;  2I10 A;  2WAQ A;  4BDY A;  1ZQ3 P;  1SEU A;  1UJ8 A;  3BR0 A;  4UUS B;  1IZ1 A;  2JVH A;  5FB2 A;  1X4P A;  1Z77 A;  3H9J A;  1REP C;  1NH3 A;  3HOS A;  4A3E J;  2F6C A;  1W5C C;  2OZ6 A;  5B1A H;  4ESF A;  3H92 A;  1JJ6 C;  3KP2 A;  1MMD A;  3C2G A;  4U0W A;  4E7H A;  1ZGA A;  2EJR A;  2PQ8 A;  4CGZ A;  2V9P A;  5B5E C;  2WBM A;  3GWZ A;  3U2R A;  4XOT A;  3E5X A;  4ENN A;  1UEL B;  3HIF A;  1FNN A;  3HHH A;  1U5T C;  4CCK A;  2E1M C;  3PUB A;  3L2V A;  2KDO A;  4LLG F;  4S05 A;  5KHD A;  1V54 H;  2EB7 A;  1DGW Y;  1XS9 A;  1S5L C;  1WJF A;  2VN2 A;  1BIB A;  3CCM I;  3GTP J;  1D8J A;  2FX0 A;  2K9Q A;  4PJL A;  4ZYG A;  2Z3Y A;  2CH0 A;  2GLO A;  3F9K A;  3LA7 A;  2ID3 A;  1MJA A;  1RKW A;  2E1N A;  3S15 J;  3PFY A;  2XF5 A;  2NS7 A;  1IDY A;  3RYR A;  5GAD J;  4AYB N;  2ZNY A;  4JBA A;  3GTG J;  1ZN2 A;  5ICF A;  2E5N A;  2QEX I;  5DV5 A;  3RZD J;  3R61 A;  3I4P A;  4DBQ A;  2ZJ2 A;  1RKT A;  3UNG C;  5E3L A;  3HOX J;  2VBW A;  2Z16 A;  3DTK A;  4PFP A;  5TIS C;  2ZCW A;  1RIO H;  3DKW A;  2BHY A;  2CU7 A;  4B4C A;  1JTY A;  1KA8 A;  1QQI A;  1PVE A;  1MDM B;  3MFK A;  3DQV C;  3BQY A;  3HOZ J;  1BJZ A;  5EGO A;  2FBI A;  2ECB A;  3BZC A;  3KP6 A;  4WF2 A;  2J5O A;  2GZW A;  2L02 A;  5ED4 A;  3IWZ A;  4YEJ A;  2NOJ B;  2GAU A;  4CCJ A;  1TQP A;  1DDN A;  3M8J A;  1IG7 A;  1MKM A;  3DEE A;  2ELJ A;  4EEF G;  2IEK A;  3PO3 J;  3ABT A;  2HFH A;  1EKE A;  3F8F A;  4DQ2 A;  1FTT A;  5BPI A;  1SFK A;  4HDV A;  2EIK H;  2CQK A;  5JR3 A;  5BS6 A;  4A3C J;  3GTO J;  3J81 Z;  1JKQ C;  4CYC B;  4KIF A;  3MD2 A;  3RKY A;  2NYX A;  1BBY A;  4FCY A;  3S16 J;  2L7M P;  1ZG3 A;  4I99 C;  5D4S A;  4EJW A;  1MMN A;  1Z6R A;  3JRH A;  3PM1 A;  1MMS A;  2K5C A;  2HVQ A;  1FP2 A;  3PIO F;  3K4C A;  4FE7 A;  3BCB A;  1XD7 A;  2ZXW H;  1AKH B;  2WB1 N;  4O6J A;  4ZTJ A;  1B72 B;  4Q48 A;  2EFN A;  2H6C A;  1T98 A;  2EIM H;  2JJ7 A;  4YG2 F;  2PJP A;  1AWC A;  3KFW X;  4M3B A;  1IF1 A;  1P4X A;  4A6D A;  2LRD A;  2L7Z A;  3V8J A;  3ELK A;  2L01 A;  5FKL A;  2CQX A;  1GXQ A;  2V9V A;  4XRF A;  5JVG F;  3X2Q H;  4ENJ A;  3OR2 C;  2K9N A;  4HBL A;  5AON A;  1TQM A;  3V7S A;  2O3F A;  1RPW A;  2DLL A;  2LF7 A;  2M5W A;  3HRM A;  3SYT A;  2L3D A;  3JTG A;  4IO9 F;  2E1M B;  1IXR C;  2LSO A;  1EJ9 A;  3RIR A;  3GFL A;  1GVJ A;  2A3S A;  3LSM A;  2VBZ A;  3OYJ A;  1ZRD A;  3S1Q J;  3JSO A;  4CCO A;  1YOV B;  2KIU A;  1U8R A;  1XCV A;  3VPR A;  2E1C A;  5CVU A;  2IS1 A;  3O6B B;  1TP4 A;  3HSR A;  3Q0V A;  1EH6 A;  4A3B J;  4RAY A;  3RQI A;  1TT0 A;  2CV0 A;  2RC4 A;  2DDB A;  4BJ6 C;  4F92 B;  5HDG A;  1JTX A;  4RM3 A;  3CO6 C;  3V42 A;  4E7I A;  4M74 A;  2QBY B;  3K7A J;  3CCS I;  4LG3 A;  1BL0 A;  2DMN A;  1G59 A;  1RR8 C;  3K70 C;  1YG2 A;  2XKO A;  1DU6 A;  1IV6 A;  5BPD A;  3E6D A;  1DQU A;  1WFX A;  3C2B A;  3L09 A;  3BPV A;  3HRS A;  3FM3 A;  3CZ6 A;  4I02 A;  2FOK A;  1BIA A;  2KFD A;  2LF8 A;  4OWR B;  4BJ5 C;  4EVI A;  5IP6 A;  2OTL I;  2G9W A;  1T6S A;  3PQK A;  2VOP A;  2VAS A;  4XLC A;  1O4X A;  2D1H A;  2VL8 A;  3BJ6 A;  4MNU A;  4YIF A;  3I4M J;  3VSL A;  1Z05 A;  1Q1V A;  1U2W A;  5E1Z B;  4UNO A;  3CDH A;  1PP8 F;  4BE1 A;  2GXB A;  4DJA A;  3OR1 C;  2AXT C;  4HF1 A;  3BTI A;  2LDU A;  3M7G A;  4DBR A;  3TP3 A;  4FT8 A;  1ZRC A;  1BR2 A;  2HNH A;  5DYM A;  3JR9 A;  2VPR A;  1Z3Y A;  3W2A A;  1QZZ A;  3WHB A;  2XF6 A;  5F27 A;  1N25 A;  5LRR A;  5HNH A;  3MKY B;  1U78 A;  1T39 A;  5IOY A;  1K6O A;  3QYF A;  5FFX A;  2IAI A;  4PFO A;  1IO2 A;  2LR8 A;  1TC3 C;  4BE2 A;  3BP8 A;  3HTS B;  5K1Y A;  1MSF C;  2BY1 A;  3QOD A;  3OY9 A;  3PJR A;  2JSC A;  1Q1H A;  2DPD A;  3SZT A;  3M07 A;  2NAZ A;  3EUH A;  3E6M A;  3H0D A;  1ZAO A;  4XON A;  2LD5 A;  5E20 A;  1VQ7 I;  4KNY A;  3GTM J;  3P5J A;  4CSW A;  2EH3 A;  1A6Q A;  3FDY A;  3JSP A;  1V55 H;  3DKY A;  1G8X A;  5J40 A;  4JP0 A;  4BE0 A;  1R4M B;  5HLT A;  4R1H A;  5D5V B;  3ZQL A;  2M0M A;  3K4B A;  1QVT A;  5IYD J;  2LK2 A;  2Q0O A;  2HPM A;  1SD4 A;  2RKH A;  1PUE E;  1X19 A;  3MWM A;  4XRM A;  3GYH X;  3DU6 A;  4D1Q A;  1KU7 A;  2LBF A;  3OYI A;  1V3F A;  5F0C A;  2X1C A;  4E6K G;  3WGI A;  3IAS 2;  2PMZ A;  3LSK A;  5HLG A;  3MCZ A;  4HSR A;  4FE4 A;  5TRD A;  4CYD A;  1WJA A;  2MC4 A;  1ZYR F;  1D0X A;  4NQW A;  1YJ9 I;  3IRQ A;  1P7J A;  2IXS A;  2R5Y B;  5GPA A;  2DA4 A;  1RI7 A;  2YS9 A;  3H5R A;  2GM4 A;  3F8M A;  4KUM A;  2PFB A;  1ULY A;  1LB2 A;  4AC0 A;  3CCR I;  4IRG A;  2KJB A;  4OAY A;  4QPO A;  4JX5 A;  2PN6 A;  4Z6Y A;  2CW7 A;  2C6Y A;  4B3A A;  4DGW B;  1XB4 A;  3OOP A;  1B1B A;  3IRR A;  2Y48 A;  3F6V A;  2E2J J;  2PMU A;  3TOA A;  2X6Y A;  3VYS B;  3KZY A;  3MAJ A;  1SVM A;  2EIL H;  1WKM A;  3M4O J;  4C30 A;  2XGX A;  2HVR A;  2X85 A;  1TLH B;  5C3E J;  1QBJ A;  3W6J B;  1WJD A;  1OCC H;  1WVR A;  5DCM A;  4BJT A;  3O8G A;  3ERE D;  1YIT I;  1J59 A;  4BYY A;  3ZQF A;  3P7N A;  2G7H A;  1E2X A;  2EV6 A;  2DW4 A;  2QA4 I;  2LY1 A;  1K83 J;  4L9T A;  4AVZ A;  2K7L A;  4X0G A;  1IC8 A;  1MMG A;  4XK4 A;  2P6S A;  3H5A A;  1OMI A;  1G4D A;  2R92 J;  1SVO A;  2JWT A;  3OWT A;  5K7Z A;  2QUF A;  1UG0 A;  2MD5 A;  5GP9 A;  1TWF J;  3H1C A;  1JE8 A;  4XN0 A;  3IV5 A;  4GXO A;  5ILV A;  3W3C A;  5GPC A;  5IYB J;  3ZQ7 A;  1WSU A;  4EM1 A;  3D5L A;  2XSD C;  1H88 C;  1JHH A;  3DV8 A;  5EJC A;  2M7A A;  1HOM A;  1MIJ A;  1YHQ I;  2VJI A;  2MA3 A;  3E5Q A;  2VXD A;  3OL4 A;  2HOE A;  3NAU A;  3IHU A;  4RBO A;  3BG7 A;  3CMM A;  5A2Q Z;  2FU4 A;  3LST A;  5HOD A;  1HC8 A;  4KN4 X;  1X2M A;  1IUY A;  1ON2 A;  1JKP C;  3KEQ A;  1A31 A;  4M9X A;  2A69 F;  3ZN0 A;  5E3N A;  2PEX A;  4F91 B;  4NUB A;  3WE3 A;  3OYN A;  1BI3 A;  1XC5 A;  4J00 A;  4RMN A;  1N78 A;  1QPI A;  1YYV A;  1KQ9 A;  3PUF A;  4PSX A;  2ZXI A;  1O3Q A;  4IRH A;  1R7J A;  2O9L A;  2NNY A;  2LLK A;  3EQL F;  4P1W A;  4JYK A;  3ZQG A;  1WJE A;  2CS3 A;  4XLH A;  3TED A;  1FOX A;  1X1P A;  2DU9 A;  1TWC J;  4X6A J;  4HF0 A;  1OCZ H;  3ZR8 X;  5D5W B;  2OQR A;  3J7Y J;  4BQQ A;  3EUK L;  4CO8 A;  1XMX A;  2KRH A;  4IOC F;  3LSG A;  2HOA A;  3PQJ A;  3FF5 A;  1FBS A;  2VKH A;  4OIP F;  4XLP F;  3H9Q A;  1UZC A;  4NC6 A;  2V9K A;  5LD2 C;  2FXA A;  2A6E F;  2KIF A;  5L3F A;  3WG9 A;  3AL0 B;  1WI9 A;  2W7N A;  2MYS A;  4BS9 A;  1G3Y A;  1WH5 A;  2X6X A;  2LTP A;  2DFE A;  4PCQ A;  3GZ6 A;  3FKI J;  3S3N A;  2FF4 A;  2QM3 A;  3GZN B;  4H4K C;  2Y9Z A;  2BXY A;  3HG9 A;  4Q47 A;  1ZGW A;  1IN5 A;  1ZK8 A;  3L2Q A;  2R7V A;  1T33 A;  2HTJ A;  2CQN A;  1HW2 A;  3I55 I;  2NXN B;  4BHP A;  2STW A;  5F08 A;  1HF0 A;  4L9J A;  3GFI A;  2PMH A;  2FBH A;  2NS8 A;  5L3G A;  2VON A;  3ULQ B;  1JXS A;  1RUO A;  4BKX A;  3G4S I;  4XM3 A;  2XB5 A;  3KP4 A;  1MSE C;  2HTS A;  3DLL F;  3MKZ A;  3SQN A;  1ORK A;  2HEO A;  2XSJ C;  3OSF A;  2L9S A;  3CUQ B;  5E17 F;  2F5C A;  1MH4 A;  1K7A A;  3JRA A;  1X1A A;  4ZDO A;  2O7O A;  5EF6 A;  3IKT A;  2JK3 A;  3H35 A;  3G71 I;  4G6D A;  2H8R A;  2LYC A;  2E34 A;  1YIO A;  3QQA A;  3R6S A;  1IW7 F;  3FBN B;  3CJN A;  3HYI A;  2V1U A;  2HDW A;  4OMY A;  5CPR B;  3L2W A;  4FET A;  2A68 F;  4D9J A;  2CV1 A;  2M0C A;  1IRZ A;  5D5U B;  2DMP A;  4UVA A;  1UCR A;  4EJO A;  3TO7 A;  1LFB A;  1DGR M;  1GLN A;  5KAI C;  2HZT A;  3FXL A;  2NVX J;  3W2W A;  3A0H C;  1T08 B;  3CCE I;  1BA5 A;  5ICG A;  5GTI C;  2VQL A;  1W7P A;  2X6O A;  4H0E A;  1ZLJ A;  3O8H A;  1WGX A;  4O5V A;  2H1K A;  1B9N A;  4XQF A;  4F52 A;  3JRB A;  2YX4 A;  4LG0 A;  2O6G E;  1LVA A;  4II3 A;  2NVT J;  3E97 A;  1IN8 A;  3WG7 H;  2M30 A;  1K61 A;  1CF7 B;  1YRN A;  3MZ8 A;  4WXH A;  3FHZ A;  2R7F A;  3CME I;  4RGS A;  2DFI A;  3E6B A;  3G3Z A;  1XSD A;  4P9U A;  1S3J A;  2QCO A;  3ZN1 A;  4XSZ F;  2R7O A;  3A01 A;  3C18 A;  3E5U A;  3SDB A;  2MW8 A;  3KET A;  3KIO A;  2BYV E;  2L9V A;  2XAS A;  2AO9 A;  3NEU A;  4NC8 A;  3FBI B;  3G1L A;  3WE2 A;  2R7T A;  3KEO A;  5FKK A;  3ZCO A;  1VQK I;  1X58 A;  1SD6 A;  3HM5 A;  2QQ9 A;  4PK4 A;  1XDS A;  2DTZ A;  5EDN A;  1HKQ A;  4RGU A;  4ZYA A;  1KQ0 A;  3Q3S A;  3A01 B;  3J80 Z;  2M8G X;  3R0A A;  3OYB A;  5J8F A;  4D7M A;  2AQE A;  2W82 A;  3BR1 A;  1ETK A;  5LEJ A;  3AL0 C;  4MQ9 F;  3BQZ A;  2ELK A;  3JAM Z;  1X1B A;  5DD8 A;  4KMU X;  3H3V K;  5TGT A;  1F5T A;  1PJR A;  3ASN H;  4Y3O A;  3OYC A;  1R1T A;  2VPL A;  3HHG A;  2OJE D;  3LSP A;  1YS7 A;  4B43 A;  1LEA A;  2F5D A;  4B47 A;  2R3S A;  2IW5 A;  3LSI A;  3HC7 A;  2VI6 A;  3S2W A;  1U0J A;  4Y7N J;  3IKV A;  3QOE A;  1JUS A;  3WU0 A;  4B44 A;  3CCV I;  4EMS A;  3O2P E;  2Y31 A;  1YX3 A;  4M6Y A;  4EJU A;  4FTH A;  5JLX A;  2R93 J;  4AID A;  2R7S A;  2NNN A;  3PNY A;  5J4Y A;  2F4O B;  4PSW A;  4QWQ A;  6PAX A;  2GXG A;  2HKO A;  4OIN F;  3BCA A;  1U9N A;  2JPC A;  2H8W A;  2CRG A;  2R7Q A;  2XAH A;  3CP8 A;  1Y39 A;  1BOB A;  3RCO A;  1BW6 A;  2VT3 A;  2L4A A;  1SAU A;  4PDK A;  5DD4 A;  2K4J A;  3U1D A;  2M1B A;  2ZSH B;  4KIC A;  5J1U A;  4AIH A;  2DQL A;  4EQQ A;  5DM7 F;  3EUA A;  1RET A;  4JOM A;  5J1Y A;  2R7D A;  3LL7 A;  2IS6 A;  1ZR2 A;  5J3L A;  1YW9 A;  3ML6 A;  4G9Y A;  1PDN C;  2DDA A;  1OFC X;  2FNP A;  3DPT A;  1JGG A;  1T95 A;  4HOB A;  1SD5 A;  2V1X A;  2RV8 A;  4B48 A;  4G7O F;  2EFW A;  2A6H F;  1FY7 A;  2BW3 A;  4P9F A;  2DA5 A;  1CF7 A;  1POG A;  3HOT A;  2RNG A;  1LKX A;  4V2G A;  1VQ4 I;  5FGM A;  2Z1D A;  3ERM A;  4I6Z A;  3CCL I;  3S1M J;  1OIS A;  4HX8 A;  2GQQ A;  2QQ8 A;  3CCJ I;  4KA4 A;  1QHH D;  1TWH J;  2M3A A;  4OIQ F;  1TNS A;  1B6A A;  1FP1 D;  3FMR A;  4RLF A;  3JAM K;  1ZGJ A;  3ZQC A;  3BDD A;  4IF4 A;  3KE2 A;  1FX7 A;  2B9S A;  2Y0S N;  2LH9 A;  3QU6 A;  5D6F A;  4WK8 F;  3K1N A;  1BJA A;  4R79 A;  5EYR A;  4ABZ A;  5LHG A;  2K85 A;  4UUT A;  3GLL A;  4U7D A;  3NWS A;  3S3O A;  4LIT A;  1ODD A;  2LC2 A;  4IKF A;  1A04 A;  5EZH A;  4HA8 A;  2IA0 A;  4XOP A;  2UXX A;  1K6Y A;  1R5H A;  4FHT A;  2COB A;  4G7Z F;  2GOX B;  2ME0 A;  3F72 A;  2ZKZ A;  3CLO A;  1OYI A;  3FXJ A;  4K2E A;  2FQ3 A;  3TGN A;  1KU9 A;  3C2H A;  1V5F A;  3Q5F A;  4FIS A;  1MZB A;  4M6V A;  4CCN A;  5HDK A;  3SEZ A;  4BXF A;  2JT1 A;  3LNQ A;  1SC7 A;  2ZNZ A;  2CUE A;  3BOQ A;  4CYC A;  3LFK A;  1GV2 A;  2VE8 A;  1LUJ B;  3DU5 A;  2HOS A;  1DUX C;  5H20 A;  2EPF A;  4Y15 A;  4BBS J;  2DOD A;  2VBY A;  3LWF A;  4Y33 A;  1YO5 C;  2LP0 A;  2OCE A;  2V7F A;  2XRO A;  2KHM A;  1BR1 A;  2YUS A;  2IA1 A;  4N4O B;  2Y9Y A;  2P5K A;  3BT9 A;  4N4N B;  5CLS A;  3UKG A;  1BW5 A;  2XGE A;  5IP9 J;  2K3P A;  2F4I A;  2HYJ A;  3HTU A;  5M5Y J;  1VF9 A;  4RA2 A;  2WTE A;  3OS2 A;  1VZ0 A;  2HS5 A;  2FSW A;  2VOO A;  2AHQ A;  2EA4 A;  3A1Y A;  3JTH A;  4BBR J;  1F9N A;  4A0X A;  3OYD A;  4XID A;  4DYR A;  1CGP A;  1ACI A;  4KIG A;  3K2A A;  4NQW B;  5LHI A;  4JX4 A;  3HJE A;  5F6F A;  2PJR B;  2A05 A;  3OS1 A;  5J6X A;  1HW1 A;  5D5X B;  3S14 J;  2FRH A;  2DAO A;  2GOM A;  1IV8 A;  1JKR C;  1MBK A;  1TTY A;  2ZME B;  1ETX A;  4W97 A;  2L54 A;  4WXC A;  4B3X A;  1SAX A;  1ETQ A;  2QSG X;  1XMK A;  3OSG A;  2CW8 A;  2DFH A;  3EDP A;  4IXA A;  4NDL A;  3HUG B;  4CCL A;  1Y0N A;  3RZO J;  1X1C A;  3HOW J;  4QPQ A;  2L9R A;  2Z5U A;  2K86 A;  5EEA A;  2IA2 A;  5CVR A;  1HQC A;  2ETH A;  4E7J A;  2D2W A;  2OZU A;  2KT0 A;  1OYY A;  4FX4 A;  3KPH A;  2OCC H;  3OYH A;  1J2X A;  1FYL A;  2X51 A;  1V5E A;  3S3M A;  3BRO A;  5CVV A;  1X2N A;  5LFA A;  2HDD A;  4J01 A;  4HST A;  1Y56 A;  1R5I D;  2HQR A;  1ETY A;  3FXK A;  2LG4 A;  2OQG A;  4U87 A;  3K1M A;  4LD5 A;  4EJT A;  2VKV A;  4NHJ A;  2BXZ A;  5E3O A;  4DZP A;  2IPQ X;  4U0V A;  4A3J J;  3K69 A;  1F4K A;  1LDD A;  2NOG A;  2AXL A;  2QKL B;  2DN0 A;  3DP7 A;  1IJW C;  1R00 A;  1MBH A;  1DPU A;  2DMQ A;  1F43 A;  3P9C A;  4IEJ A;  1ZEL A;  3DCF A;  5CYV A;  4ITV A;  1JGS A;  3A02 A;  3BR5 A;  2QWW A;  2L9N A;  2PBI A;  1EV7 A;  4AD9 A;  1O3S A;  3A2K A;  1BI0 A;  1S9H A;  3IWF A;  3LSJ A;  2JA7 J;  1OCP A;  1D1C A;  3HKZ A;  2I8D A;  1IRF A;  2KIQ A;  3ZRG A;  3CUQ C;  4DYQ A;  1KON A;  1JT6 A;  2DBB A;  2M4G A;  5F0H A;  4RB3 C;  3KP5 A;  3C7J A;  3IUO A;  4UHT A;  5LHH A;  2FOW A;  1VND A;  1SFU A;  5GAH J;  4XKV A;  4GYI A;  4I01 A;  2B0L A;  3F21 A;  2XAG A;  3M1C A;  2RN7 A;  1R22 A;  3L2U A;  2VQH A;  5FO5 A;  4P96 A;  2GA1 A;  2XGD A;  5L3B A;  1YIJ I;  2KL4 A;  4RGR A;  2VC1 A;  1ZH5 A;  2ZBK A;  3S93 A;  3WGH A;  2V1D A;  3N05 A;  2YR2 A;  4G12 A;  5FFZ A;  3U9G A;  3KX2 A;  1MD0 A;  2RVC A;  1SAN A;  5M3M J;  2XAU A;  3FXR A;  2E60 A;  2HU9 A;  1IUF A;  2JVG A;  3RPU D;  2M34 A;  1F36 A;  4RGX A;  1K78 B;  2OBP A;  4XRS G;  4G6Q A;  2HVS A;  3N97 A;  3K4N A;  2O8X A;  2FML A;  2PMZ N;  3K4K A;  2RGV A;  3FIW A;  2DPU A;  2OU2 A;  1U9O A;  4C3J J;  3W2V A;  3D1N I;  1H9T A;  2R5Y A;  1O7L A;  3L1P A;  2XC7 A;  3QYE A;  4AVP A;  2JRM A;  4DOZ A;  3LA2 A;  4S0H B;  3U21 A;  2M7B A;  1FMV A;  2FBK A;  2WA0 A;  4L5E A;  3FX3 A;  1WZ2 A;  3DLA A;  1D0Z A;  5IP7 J;  3HEF A;  3G1O A;  1X3U A;  3E6C C;  2FA5 A;  1AHD P;  1APL C;  2EIN H;  4IQ4 A;  2GIV A;  1VQN I;  1FMW A;  3WTU C;  3KP3 A;  4ZTF A;  1GVD A;  2BZT A;  3BY6 A;  4MEY F;  5HVQ C;  2Z9O A;  3H3U A;  1TL8 A;  1D8K A;  1G6N A;  5IT9 K;  3ZOB A;  5FJ8 J;  3PSI A;  1KU3 A;  4OMZ A;  3DEW A;  3L7W A;  4XIC A;  2HQ5 A;  2EFQ A;  2IRF G;  4L9V A;  1W1W E;  1H9G A;  3E1S A;  1ETV A;  3K0L A;  3VEP A;  5M5X J;  2CFO A;  3DPL C;  5JHU A;  1W0U A;  2WB1 A;  4I7H A;  3CJT B;  3ZPL A;  2ISY A;  4P55 A;  1N77 A;  3QU3 A;  2QGU A;  3B6A A;  1DPR A;  1XSV A;  5F64 A;  4IRI A;  4AM3 A;  4E4H A;  2R7R A;  4XLA A;  2K02 A;  5F1J A;  3KP7 A;  1E3O C;  5BMZ A;  2R7X A;  1LE8 A;  3D5S C;  3FXO A;  2A6T A;  2JSP A;  4KJZ A;  3TKY A;  3KYD B;  5H6R A;  2QQB A;  4LB6 B;  4KT6 A;  1GHC A;  2UV1 A;  2DMU A;  1JT0 A;  3BC8 A;  2ELH A;  3RPU A;  4PJJ A;  1A36 A;  4MHG A;  2Y0S A;  2A61 A;  3J80 K;  1YJW I;  1SD7 A;  2ZJR F;  1U8B A;  1RC9 A;  4PUS A;  1OQY A;  2WAQ N;  1B72 A;  1VFC A;  2HYG D;  2OD5 A;  3K9T A;  5J1R A;  5LEK A;  2D5V A;  5FRM A;  4A3I J;  4IHV A;  4BL0 B;  3CF5 F;  2E2H J;  3DTI A;  2BOL A;  2W4S A;  3NAR A;  4AIJ A;  1FSH A;  2MD0 A;  3I5U A;  3ZQQ A;  1I5Z A;  1NG6 A;  1WCM J;  1ZRF A;  3RKW A;  3HBL A;  2ECC A;  1Z1D A;  3GO5 A;  3ONQ A;  3QWL A;  1Z21 A;  1OYW A;  1KYZ A;  1P6R A;  1KU2 A;  3E0J B;  1G3S A;  2M9H A;  2VB6 A;  3QOP A;  4GCV A;  4IHX A;  3DBL B;  5IT3 A;  4EV0 A;  1I27 A;  1XCB A;  4IL6 C;  1YFH A;  4OIO F;  4CZC A;  5HS7 A;  2CFX A;  4BQA A;  3EUH C;  2EWN A;  1X4O A;  3F8C A;  1S29 A;  3FHN A;  4CIC A;  4YFN F;  4OU0 A;  1HCR A;  3VOE A;  1VQ6 I;  3S2D J;  2CYY A;  1UHS A;  4M9Z A;  3CC4 I;  2ZO4 A;  3WTX C;  1UAA A;  1VQ5 I;  1Y0U A;  3DWL E;  3A03 A;  1XPX A;  2UZK A;  2J5P A;  3R4K A;  4LMY A;  2BV6 A;  2BVL A;  1FLI A;  3A0B C;  1FOK A;  2DJN A;  5FLV A;  3PFI A;  3LQQ A;  3QAH A;  2DK8 A;  2VBX A;  3GF2 A;  2M8E A;  2LBF B;  5HDN A;  2BEO A;  2LRE A;  4GDF A;  3ZGK A;  4ON0 A;  3VOD A;  1UFM A;  2KJC A;  2ME6 A;  3TMO A;  2DOF A;  3BG5 A;  3QP5 A;  4XMY A;  3CCY A;  4RS8 A;  3HGY A;  2R5Z B;  1QA6 A;  1S7O A;  2DA1 A;  3LQR A;  1JJ8 C;  2E1O A;  2XGC A;  3CLQ A;  1WHU A;  5KAF C;  5CVI A;  2XKP A;  5HNF A;  3OYG A;  3BTL A;  3RDI A;  3W6K B;  1ETO A;  3S2H J;  1YW8 A;  1ONV A;  4JQF A;  5GAE J;  3TOB A;  3CC7 I;  2I5U A;  2NRA C;  1CQT A;  2Y69 H;  2CSO A;  2G0E A;  3K6G A;  2X0L A;  3ZXS A;  3DKX A;  4GFB A;  1LPQ A;  1LDK B;  4M73 A;  2HDC A;  2A5Y B;  3LSH A;  2R4G A;  3BG9 A;  3AKZ A;  4JK1 X;  3Q9S A;  4LIV A;  3VYR B;  1RNL A;  1DP3 A;  4MTE A;  1IN6 A;  4Z2Y A;  5EEG A;  4MFE A;  2L7F P;  3GEZ A;  1XG1 A;  1J0R A;  1BOA A;  3GVA A;  4L9N A;  4D7N A;  4ZH4 F;  3G73 A;  2O8K A;  3R60 A;  2K40 A;  3JRF A;  4HG2 A;  1IDZ A;  4HNT A;  4CH7 A;  1STZ A;  3CP2 A;  4G6T B;  1GDT A;  2CUF A;  1VTN C;  4YRV A;  1ZHF A;  1U6G A;  4HPQ A;  3SEQ A;  1S72 I;  1QO0 D;  3JW4 A;  3VB2 A;  3H5N A;  3HPH A;  1RES A;  5J47 A;  5FLM J;  1JUP A;  2MH2 A;  1IAW A;  4IHW A;  3P9I A;  1QHG A;  2QF7 A;  5ICE A;  5LLQ A;  4X1E A;  2Q8K A;  2LY9 A;  2WAD A;  5E1W A;  2W84 A;  1BR4 A;  2PI0 A;  2CUJ A;  3JRC A;  3FM5 A;  5EG0 B;  2Q2E B;  2ZME A;  1ITY A;  2JMW A;  1XDU A;  3Q0U A;  2CO5 A;  4C2M J;  3CJQ B;  2DQR A;  3I0T A;  2QYO A;  2JA6 J;  5JFR A;  2H94 A;  4F55 A;  2LKS A;  2BHZ A;  1V5G A;  2P6T A;  3RKQ A;  1I3A A;  1EA3 A;  3VYT B;  3FXU A;  2MC3 A;  3D0S A;  1R58 A;  3UR3 C;  3TW7 A;  3QP6 A;  5A2Q K;  3J7A O;  1ZG1 A;  1W0T A;  1QZE A;  3MKL A;  4DZJ A;  2DA3 A;  3M3Y J;  3VWB A;  1OCO H;  4A3K J;  1A5J A;  1BI1 A;  4E7L A;  2DFF A;  3T1B A;  2OUM A;  4NBQ A;  2P7C B;  1XX5 A;  1EF4 A;  3EYY A;  2EV0 A;  1TT5 B;  2BGC A;  1M1E B;  3FKJ A;  3MVP A;  2HGC A;  2ZB9 A;  1X3Z B;  3QPH A;  3G2B A;  4G94 A;  2B7E A;  4LIU A;  1B8I B;  3S17 J;  1Z91 A;  3K1P A;  2ZFW A;  3PIP F;  2NVQ J;  3ABU A;  1LE8 B;  4RB0 A;  5F1R A;  2WAE A;  3K4J A;  4M71 A;  4MGR A;  3WU2 C;  4UXN A;  4ASN A;  3OYL A;  2BY3 A;  2PLY A;  3WTS C;  2X9D A;  1YQA A;  2EV5 A;  5ERI A;  4HDU A;  2XB0 X;  2X6W A;  2BBY A;  1VQM I;  2DCE A;  3NWT A;  3TDZ C;  3K4M A;  5K7H A;  1TBX A;  1A35 A;  2K27 A;  4KFC A;  1GT0 C;  4L18 B;  3U1K A;  5L3E A;  2H6B A;  9ANT A;  2VIX A;  1IXC A;  4BY7 J;  5D8L B;  4NB5 A;  1FTZ A;  4LLN A;  2ID6 A;  4AU7 A;  2K9L A;  2P4W A;  3OYM A;  5C44 J;  3H0G J;  2DXI A;  4YIR X;  3PNT A;  1EH7 A;  2KDZ A;  4IZZ A;  4MTD A;  4A3L J;  2P5L C;  3CES A;  4XLF A;  2HQN A;  3BJA A;  1UST A;  2IT0 A;  2JN6 A;  2EQR A;  4WX9 A;  5HS9 A;  3I71 A;  1X1D A;  4LK0 F;  1T56 A;  2PJR A;  3PSF A;  4DW6 A;  1ZR4 A;  2VKD A;  1WJC A;  4M3F A;  3MEX A;  3N4M A;  2QBY A;  3SZP A;  1FPQ A;  4XKC A;  4CHU A;  5DDG A;  1R4N B;  5LGU A;  4LGW A;  3I59 B;  1J9I A;  2VT2 A;  4J19 A;  1FJL A;  1FBQ A;  3EET A;  2O5R A;  2CMP A;  3DPU A;  3TL4 X;  1J5Y A;  4UV8 A;  4R8H A;  3FMQ A;  2JA8 J;  2DJI A;  2EBI A;  5DTD A;  4UV9 A;  2E35 A;  3OIO A;  2XAJ A;  2LFB A;  2O0Y A;  3MZY A;  2X1D A;  2XAQ A;  1MGT A;  1ZAR A;  4PJ0 C;  4BDZ A;  2FNA A;  4V19 K;  3BWG A;  4ZYD A;  3I4N J;  1S8N A;  4CA0 A;  4ZZL A;  1JKO C;  3GTQ J;  2RDP A;  1KGS A;  4XRS A;  2M87 A;  1ENH A;  2DA7 A;  5BOX A;  1SFX A;  2JRT A;  2KZV A;  3ZMV A;  2DYS H;  2HZD A;  2COM A;  1D3Y A;  1UHM A;  2QVO A;  1D1A A;  3CUQ A;  3SJM A;  2M4K A;  2M2E A;  2XF7 A;  1ZRE A;  1USS A;  4GRI A;  5FRO A;  4QSH A;  1VI0 A;  4GYG A;  1ZG5 A;  3EYI A;  3ESW B;  4XKB A;  2ZFU A;  1KZH A;  4IHT A;  1Z9C A;  4BY1 J;  3RTR A;  2BVM A;  1E3P A;  5LGT A;  1NHA A;  2VJJ A;  3OYK A;  5E8I A;  4E7Z A;  2Y75 A;  3KLO A;  1I1S A;  1YLF A;  2HYF A;  2X4H A;  3KZI C;  3T0Y A;  4ETS A;  2F5F A;  5GAG J;  3HOV J;  5HOO A;  4D5F A;  4RAG A;  4UUV A;  2KLO A;  2P8T A;  3V8L A;  5H2F C;  1JI8 A;  4EM0 B;  3V4G A;  1IRG A;  1ETW A;  5ILU A;  3VYU B;  1WRJ A;  3ROU A;  4A0Z A;  3AG3 H;  4QLC U;  3SHF A;  2GA2 A;  3GZ5 A;  1T2K A;  1I39 A;  1S7A A;  4F93 B;  3IP4 B;  5EGO B;  2JQ7 A;  2XPV A;  3V7C A;  3PO2 J;  4HW0 A;  4N0B A;  3OS0 A;  2UWM A;  1U5T A;  1K79 A;  1XN7 A;  1QNT A;  2RNJ A;  4RAZ A;  2ZXH A;  1HBX G;  3V7R A;  4C2T A;  5BQT A;  3GX4 X;  4G7H F;  5E79 C;  1QPM A;  2ACJ A;  1HDP A;  2XHK A;  2DT6 A;  1ERD A;  5IT9 Z;  4I76 A;  1R1U A;  2O03 A;  1Y6I A;  3GFM A;  2HR3 A;  2VKE A;  1U5T B;  4Y17 A;  4KN7 X;  1MBE A;  3T8R A;  4HRI A;  1R5G A;  1IRX A;  1O57 A;  3IH3 A;  4BHC A;  2RQQ A;  5LGN A;  2Z99 A;  2B63 J;  5IOZ A;  2ZJQ F;  2LNB A;  3QPL A;  2OPT A;  1LVK A;  1RRJ A;  2OAZ A;  1HA8 A;  1RUN A;  1N75 A;  2YPR A;  4I0B A;  4HQM A;  3J7A Y;  2K9M A;  4IPA A;  3CCQ I;  3GBG A;  3S8P A;  4LLL A;  2DA6 A;  4HEA 2;  2DT5 A;  4XKW A;  1FOW A;  1IN4 A;  1P92 A;  2CW0 F;  1MBF A;  3DXJ F;  4B09 A;  3MQ0 A;  5L3D A;  4CXF A;  1J75 A;  1NTC A;  2LMD A;  2CGP A;  3OIP A;  2V4J C;  5C4J J;  1K78 A;  3NRV A;  2QEN A;  2VE9 A;  3HOU J;  1BC8 C;  3IC7 A;  2MH9 A;  1FWZ A;  3TP0 A;  4E7S A;  3T8T A;  2BY2 A;  1B9M A;  2E7X A;  4BGD A;  1P7I A;  2CG4 A;  2CV2 A;  1W5S A;  2VC0 A;  4E7K A;  1T0F C;  3C1D A;  4DNC A;  5B66 C;  3F23 A;  3F8N A;  2F4M B;  3ABL H;  2A07 F;  2PX9 A;  3QRF F;  2WV1 A;  2L7K A;  5DCM B;  1J09 A;  2FUG 2;  3M8F A;  3GTL J;  1LJ9 A;  1XGO A;  5HLI A;  3REO A;  1FEX A;  4RM2 A;  1UHW A;  4BEH A;  4BUP A;  3HDD A;  5M5W J;  1JHF A;  2XPU A;  4YII A;  3B6C A;  3HXL A;  2IVM A;  2IJL A;  1JUM A;  2HKX A;  2LOO A;  2E36 A;  5FD5 A;  4M9S A;  3RQ4 A;  4LB5 A;  2E71 A;  2VLA A;  3BR6 A;  2XVC A;  1HDD C;  4KIT B;  4CZZ A;  4IVN A;  3HKZ N;  4BEH B;  4NNJ A;  1I6X A;  4A6E A;  4LFU A;  1FBU A;  3HOY J;  1Z7L A;  1O7F A;  2W1O A;  1VQ8 I;  3A4C A;  1MBG A;  3M1E A;  4C3I J;  4Q4Z F;  4BQO A;  3K70 D;  1E17 A;  3RI4 A;  2Z2S B;  3IH4 A;  3JRG A;  3HL2 A;  1AKH A;  2X48 A;  2E7W A;  3CDL A;  3LOC A;  3DTE A;  3LA3 A;  5K5R A;  2R7Z J;  4MLO A;  4EGZ A;  4PJN A;  4XOR A;  2XPW A;  4L0Y B;  2EK5 A;  4RLQ A;  4HYE A;  4LJZ F;  1PUF A;  1G3W A;  1ZKG A;  2NVY J;  4HF2 A;  2V1N A;  3IL2 A;  5DUK A;  4NC7 A;  1AOY A;  4B1R A;  5LRS A;  1MNM C;  3BG3 A;  5F04 A;  5D8K B;  4RDU A;  2KP6 A;  2VQC A;  1XTA A;  3BG6 A;  4XBF A;  1P4A A;  3QPS A;  3W6V A;  2XRL A;  2HPI A;  4FX0 A;  4YFK F;  2G7U A;  1G2H A;  4PJM A;  1OKR A;  3I3L A;  4Q5S F;  3I64 A;  2FD5 A;  4A3F J;  2VJ5 A;  1WPK A;  3I58 A;  3D5R C;  4ENK A;  3SFZ A;  3FMS A;  1UB9 A;  1MJ9 A;  3WOD F;  1NK2 P;  2KZG A;  1NK3 P;  2FJ1 A;  3CD6 I;  4L5I A;  3CMY A;  4I2O A;  2X1E A;  3TBI A;  4DIQ A;  2KKO A;  3Q0W A;  4FAS D;  4IHS A;  1XGS A;  1Z6T A;  2R7W A;  1DU0 A;  2V6C A;  3BTJ A;  3JRE A;  2V79 A;  3F8B A;  3SFI A;  2QSH X;  2ZSI B;  2QSF X;  1MDM A;  2E2I J;  2ICW G;  4M6X A;  4TV7 A;  2WY7 Q;  2WV0 A;  3JRI A;  3JCU C;  4UVB A;  5CQE A;  4A3D J;  2BE5 F;  1OLT A;  3H9G A;  5CJ9 A;  5DM6 F;  3FK7 A;  3FXM A;  3VSK A;  1WJB A;  5FD6 A;  1FT9 A;  3GTK J;  2GWR A;  5FLX K;  5K7F A;  3HSF A;  1WWX A;  1G3T A;  4KDP A;  2JA5 J;  3S1N J;  3LSR A;  2KPM A;  1TWA J;  2F5E A;  3MMY B;  4MO7 A;  4MEX F;  1DP7 P;  2P5V A;  4ZDL A;  1D5Y A;  3BPX A;  2FEZ A;  5KNL A;  1B4A A;  4I98 B;  2MGQ A;  4KT5 C;  2R0Q C;  2EZK A;  4Y13 A;  4P5O A;  1W4M A;  1MBJ A;  2QLZ A;  2KRC A;  1LFP A;  1R71 A;  2GXA A;  2D1V A;  4A5M A;  4D5C A;  1ON1 A;  2RQP A;  5DEQ A;  3FIS A;  4QIW N;  2EA2 A;  1E0E A;  2W25 A;  2XDV A;  1X3W B;  5IY5 H;  1TW3 A;  2IP2 A;  1R6R A;  5M3F J;  1HLV A;  1WH7 A;  3DEU A;  2WWY A;  3CUO A;  4C9Y A;  3VDX A;  2F5V A;  2A5W A;  3WTT C;  4PZJ A;  2DA2 A;  3CMA I;  3CQZ J;  4LOC A;  1Y1V J;  1HXD A;  2ZC2 A;  3MKW B;  4HNU A;  5E18 F;  2VUM J;  3CDI A;  4IX7 A;  1LQ1 A;  5KK1 A;  4IHY A;  3ZQI A;  2MLK A;  3BTC A;  1H89 C;  2IGM A;  2ZME C;  1MW7 A;  3GLX A;  2P0W A;  5KCM A;  1YTY A;  1T0F A;  2IGK A;  4A3G J;  1S6L A;  1U3E M;  2LY2 A;  2DO7 A;  2K4B A;  5DUI A;  2EZI A;  3L00 A;  3BLY A;  3I56 I;  4EM2 A;  2R5Z A;  3ZMD A;  5CKT A;  1T38 A;  1VQO I;  2CQQ A;  3BR3 A;  5CQG A;  3BZK A;  1HST A;  1YS6 A;  2XAF A;  2MG4 A;  2H27 A;  1WQ2 A;  4HZF A;  3C3W A;  2UUZ A;  4QTR A;  5L3C A;  1D1B A;  1A6I A;  3M8E A;  2WY8 Q;  3WTW C;  3E7L A;  5FKO A;  4BAC A;  1IN7 A;  2JZY A;  4PGG A;  3CJR B;  3VFZ A;  2HQA A;  3ECO A;  4XSX F;  3IAM 2;  4CDG A;  1QU3 A;  4HAM A;  2HI3 A;  3Q9V A;  3I53 A;  4L0Z B;  1R1V A;  1YRN B;  3TO9 A;  1GUU A;  3AG2 H;  4WWC A;  3COA C;  5FRN A;  4YFX F;  3JRD A;  3J81 K;  4ZZD A;  3T5X A;  1PYV A;  1SMY F;  1WI3 A;  2VJ4 A;  2VQG A;  3QPT A;  4WCG A;  3WTZ A;  4ESB A;  5J8C A;  4BXX J;  2XUB A;  3CF2 A;  3R0J A;  5IYC J;  1XSX A;  2NS0 A;  4ZYE A;  2Y2Z A;  3O3K A;  2KQR A;  2L4M A;  4BH9 A;  2STT A;  5EG0 A;  2VOD A;  5FKN A;  1B59 A;  1RZ4 A;  1K4T A;  1FC3 A;  2Y0M A;  1D0Y A;  3B02 A;  4AIK A;  3HGG A;  1NG7 A;  2RAE A;  4XN3 A;  5HLH A;  4A93 J;  2W85 A;  4HLX A;  5EEH A;  3OMY A;  3B73 A;  1O3R A;  3FZV A;  4HX7 A;  4I0A A;  2DOA A;  2PG4 A;  3H36 A;  3GME A;  1F1Z A;  1C0W A;  4CUG A;  4A2U A;  4A5N A;  1E3H A;  5B1B H;  1HKT A;  1BC7 C;  3LAP A;  2FMY A;  1Z67 A;  2VXZ A;  3MN2 A;  4E70 A;  1Y1W J;  4KMF A;  3DF8 A;  5IPA A;  2R7U A;  4ZDP A;  1BM9 A;  4Y4R A;  4HV5 A;  3KCC A;  1TW2 A;  4N9I A;  3TQN A;  2ADU A;  2MFZ A;  4XR6 A;  2AQF A;  2CJJ A;  1OCR H;  1QVU A;  3WGG A;  4EAT A;  1GXP A;  1FIP A;  5E3M A;  3F3X A;  1Z3X A;  1QZY A;  2O61 A;  2EFO A;  2OV7 A;  4OIR F;  3KEY A;  3LAJ A;  2BY0 A;  2JUG A;  2MSY A;  2CWE A;  1P4W A;  3AG4 H;  1VQ9 I;  1R23 A;  2OTJ I;  1PUF B;  5JHF A;  2L2O A;  1EH8 A;  1QRY A;  3GFJ A;  3SDG A;  5GTH C;  3AFH A;  4BQN A;  4F3Q A;  3I59 A;  2ESN A;  5FLX Z;  4JX6 A;  2HXO A;  5AIP A;  3ISP A;  4GO1 A;  2OA4 A;  3S32 A;  1AA7 A;  3OYF A;  4A0Y A;  1ZTR A;  5AIQ A;  1BN5 A;  1W7P D;  3RKX A;  2TDX A;  2W57 A;  3HB9 A;  3ZMT A;  4ENM A;  2F2E A;  4EJV A;  3ABK H;  3TW6 A;  3M9A A;  3ZMS A;  4IJA A;  2LKP A;  3OOU A;  3CCU I;  5LBQ A;  4YEL A;  2DMT A;  2IGO A;  3ABM H;  2E19 A;  3F22 A;  3BR2 A;  4W1U A;  4RB2 C;  3WU1 B;  2F48 A;  3MZH A;  4UY8 I;  3HRU A;  3LMM A;  2KRF A;  3E3V A;  4MQV A;  1S7E A;  5E1X A;  1RR7 A;  1TZL A;  2YX7 A;  4KIS A;  1XGN A;  3NQO A;  2YSR A;  3F0C A;  4HQE A;  3BZ6 A;  2JPB A;  4EGY A;  2HOT A;  3CTA A;  2FQ4 A;  2RRE A;  2QQA A;  2DTR A;  1Z0X A;  2V26 A;  3QYB A;  1I6H J;  5C4X J;  5ICC A;  4A3M J;  5F0F A;  1HW5 A;  5JLW A;  2H09 A;  2ZXJ A;  2LVS A;  3ZQH A;  3OIQ A;  2L5Q A;  2DI3 A;  4ESJ A;  3PL8 A;  4O3M A;  3L2C A;  4S04 A;  4AYB A;  3EPZ A;  3KYC B;  3PNV A;  3P9K A;  3KYL A;  1R9T J;  1IGN A;  4UVC A;  4MIM A;  2P7V B;  1IXS B;  5DCF A;  1D5V A;  4B8X A;  4UUS A;  1LDJ A;  4HNV A;  3S1R J;  5KVR A;  3WTV C;  2JTV A;  1L3L A;  3V8K A;  4LK1 F;  1PP7 U;  1XMA A;  1OJL A;  5K5Q A;  2ISZ A;  5TJJ A;  4XL9 A;  1AU7 A;  2W24 A;  1Y8Q B;  4WXD A;  1T8I A;  3I9V 2;  1MND A;  4FQG A;  3L9F A;  1TQI A;  4UB6 C;  2LKX A;  3G6E I;  1OR7 A;  1R36 A;  4XLN F;  3OV8 A;  1I3Q J;  4A69 C;  1OR7 C;  1V4R A;  3GXO A;  4HV6 A;  1BI2 A;  5ILS A;  1YE9 A;  1O3T A;  3ASO H;  3I54 A;  3AG1 H;  4RAF A;  2DYR H;  3WHC A;  4IQJ A;  2K3F A;  4BU2 A;  3GCM A;  4M3E A;  1QGP A;  2JA2 A;  4L5J A;  3H3Z A;  3G1M A;  2DT7 B;  4F7Z A;  1YW7 A;  4V2F A;  4LG0 B;  1OPC A;  2KIM A;  1YI2 I;  1H0M A;  2M45 A;  3AAF A;  2Z33 A;  3J7Z I;  2XRN A;  2CQ7 A;  3HZJ A;  1LNW A;  5H6Q A;  2TRT A;  1MMA A;  2GIZ A;  4BHB A;  1YJN I;  1LEB A;  4AUX A;  3FXQ A;  1OCT C;  1SFO J;  2OC6 A;  1HKS A;  4Y52 J;  3OYE A;  4N9H A;  1FOY A;  4HLY A;  4BNC A;  3K4L A;  2OF7 A;  2GBY A;  5JVT A;  2MBF A;  2ESH A;  4GGG A;  1WJ5 A;  1H8A C;  1HSJ A;  4AWX B;  1R49 A;  1W36 D;  1YX5 A;  3ZMZ A;  3LFU A;  3TO6 A;  2D45 A;  5BNG A;  2TCT A;  4IOA F;  1SVL A;  1FSE A;  1J7K A;  2XIG A;  2Y30 A;  3K2Z A;  4HX4 A;  3DBR B;  2NVU B;  1VQP I;  2YU9 J;  2MAB A;  2IGN A;  3KZZ A;  3GUD A;  3HUG A;  2K9S A;  2YU3 A;  3IH2 A;  3RYP A;  2HXI A;  3GW2 A;  1UMQ A;  4XLE A;  3K10 A;  4M3D A;  2IS2 A;  1VQL I;  3RSN A;  5B3S H;  3TDU C;  2IS4 A;  3CC2 I;  1TWG J;  2W48 A;  2KMU A;  2H1L A;  3RJP A;  4BXU A;  1L0O C;  4C3H J;  3SXY A;  5D4R A;  2AS5 F;  3CO7 C;  2N8G A;  4U0Y A;  1MH3 A;  3HRT A;  3BJO A;  5DS9 A;  3FWE A;  4KYW A;  3OYA A;  2UXN A;  5FKM A;  1FIA A;  4U88 A;  4G8X A;  4ZJZ A;  1FYM A;  1ZLK A;  2ZJP F;  2KIS A;  3FK6 A;  2W00 A;  3RPQ A;  4ZYH A;  4M3G A;  2V6E A;  2IBD A;  2WAF A;  3F6O A;  5HS8 A;  5D6E A;  3L2R A;  4U7B A;  1W36 C;  5CVJ A;  1MNE A;  2DOE A;  2EZL A;  4ZC3 A;  4I09 A;  1W7P B;  1GV5 A;  2DK5 A;  3HPG A;  4A12 A;  4DYC A;  1P9Q C;  5K5O A;  5J4V A;  1P2F A;  4XNF A;  4UB8 C;  1KQ8 A;  1FYK A;  4RB1 A;  3WTY C;  2HWV A;  3ECH A;  1XGM A;  2EFP A;  2CUZ A;  2XV4 S;  1B8I A;  4OOI A;  3KLN A;  4CCM A;  2L0K A;  4M72 A;  4C2U A;  1Z7U A;  1W5T A;  2P81 A;  2Q1Z B;  1TNT A;  1Y8R B;  2Q2E A;  4D0P A; 
#chains in the Genus database with same CATH homology
 1SFE A;  3DFG A;  5E8G A;  1SMT A;  3ZMU A;  4BAY A;  4KIB A;  5JI6 A;  1MJB A;  2MLG A;  4PGH A;  1I1G A;  2FE3 A;  1KYW A;  3HSE A;  3ZP5 A;  2QZ8 A;  1FZP B;  2WC2 A;  1IZ1 A;  5FB2 A;  1REP C;  3HOS A;  2OZ6 A;  4ESF A;  3H92 A;  3KP2 A;  4U0W A;  1ZGA A;  2EJR A;  2PQ8 A;  4CGZ A;  3GWZ A;  3U2R A;  3E5X A;  4ENN A;  3HIF A;  1FNN A;  3HHH A;  1U5T C;  4LLG F;  4S05 A;  2EB7 A;  2VN2 A;  1BIB A;  1D8J A;  4ZYG A;  2Z3Y A;  3LA7 A;  1MJA A;  2E1N A;  3RYR A;  2ZNY A;  4JBA A;  1ZN2 A;  5ICF A;  5DV5 A;  3R61 A;  3I4P A;  2ZJ2 A;  2VBW A;  1RIO H;  2ZCW A;  3DKW A;  1KA8 A;  1QQI A;  1MDM B;  3MFK A;  3DQV C;  2FBI A;  3KP6 A;  4WF2 A;  2J5O A;  2GZW A;  2L02 A;  5ED4 A;  3IWZ A;  2GAU A;  1TQP A;  1DDN A;  1MKM A;  3ABT A;  2HFH A;  3F8F A;  4DQ2 A;  5BPI A;  4HDV A;  2CQK A;  5JR3 A;  5BS6 A;  3J81 Z;  4KIF A;  3RKY A;  2NYX A;  1BBY A;  1ZG3 A;  5D4S A;  4EJW A;  1Z6R A;  1FP2 A;  1XD7 A;  4O6J A;  4Q48 A;  2EFN A;  2H6C A;  1T98 A;  4YG2 F;  2PJP A;  1AWC A;  3KFW X;  1IF1 A;  1P4X A;  4A6D A;  3V8J A;  3ELK A;  2L01 A;  1GXQ A;  2V9V A;  4XRF A;  4ENJ A;  4HBL A;  5AON A;  1TQM A;  3V7S A;  2O3F A;  2DLL A;  2LF7 A;  2M5W A;  3HRM A;  2L3D A;  3JTG A;  1IXR C;  2LSO A;  3RIR A;  3GFL A;  1GVJ A;  2A3S A;  1ZRD A;  2VBZ A;  3JSO A;  2KIU A;  1U8R A;  1XCV A;  2E1C A;  5CVU A;  3O6B B;  3HSR A;  1EH6 A;  4RAY A;  2RC4 A;  5HDG A;  3CO6 C;  4M74 A;  2QBY B;  1YG2 A;  2XKO A;  5BPD A;  3E6D A;  3L09 A;  3BPV A;  3HRS A;  3FM3 A;  4I02 A;  2FOK A;  1BIA A;  2LF8 A;  4EVI A;  2G9W A;  1T6S A;  3PQK A;  2VOP A;  2D1H A;  3BJ6 A;  4MNU A;  4YIF A;  1Z05 A;  5E1Z B;  4UNO A;  1U2W A;  3CDH A;  1PP8 F;  2GXB A;  4HF1 A;  2LDU A;  3M7G A;  4FT8 A;  1ZRC A;  5DYM A;  1QZZ A;  5LRR A;  1U78 A;  1T39 A;  1K6O A;  5FFX A;  3BP8 A;  3HTS B;  5K1Y A;  2JSC A;  1Q1H A;  2DPD A;  3SZT A;  2NAZ A;  3EUH A;  3E6M A;  1ZAO A;  5E20 A;  4KNY A;  3JSP A;  5D5V B;  4R1H A;  2Q0O A;  1SD4 A;  1PUE E;  2RKH A;  3MWM A;  3GYH X;  1KU7 A;  1V3F A;  3WGI A;  5HLG A;  3MCZ A;  5TRD A;  4CYD A;  1ZYR F;  4NQW A;  3IRQ A;  1RI7 A;  3F8M A;  4KUM A;  2PFB A;  1ULY A;  1LB2 A;  4IRG A;  2KJB A;  2PN6 A;  2C6Y A;  1XB4 A;  3OOP A;  1B1B A;  3IRR A;  2Y48 A;  3F6V A;  2PMU A;  3TOA A;  3KZY A;  3MAJ A;  1WKM A;  2XGX A;  1QBJ A;  1TLH B;  3W6J B;  5DCM A;  3ERE D;  1J59 A;  4BYY A;  3P7N A;  2G7H A;  1E2X A;  2EV6 A;  2DW4 A;  4L9T A;  2K7L A;  2P6S A;  1OMI A;  1G4D A;  2QUF A;  2MD5 A;  1JE8 A;  4GXO A;  5ILV A;  3ZQ7 A;  1WSU A;  4EM1 A;  3D5L A;  1JHH A;  3DV8 A;  2MA3 A;  3E5Q A;  2HOE A;  3IHU A;  5A2Q Z;  2FU4 A;  3LST A;  4KN4 X;  1IUY A;  1ON2 A;  3KEQ A;  4M9X A;  2A69 F;  3ZN0 A;  2PEX A;  3WE3 A;  1BI3 A;  1YYV A;  1KQ9 A;  1O3Q A;  4IRH A;  1R7J A;  2NNY A;  3EQL F;  2DU9 A;  4HF0 A;  5D5W B;  2OQR A;  4CO8 A;  3PQJ A;  3FF5 A;  1FBS A;  4OIP F;  4XLP F;  2FXA A;  2A6E F;  2KIF A;  5L3F A;  3WG9 A;  1WI9 A;  1G3Y A;  4PCQ A;  3GZ6 A;  2FF4 A;  2QM3 A;  4Q47 A;  1IN5 A;  2HTJ A;  1HW2 A;  2STW A;  4BHP A;  4L9J A;  3GFI A;  2PMH A;  2FBH A;  5L3G A;  2VON A;  3ULQ B;  1JXS A;  1RUO A;  3KP4 A;  2HTS A;  3SQN A;  2HEO A;  3CUQ B;  5E17 F;  2F5C A;  1K7A A;  3IKT A;  4G6D A;  1YIO A;  3R6S A;  1IW7 F;  3CJN A;  3HYI A;  2V1U A;  4OMY A;  2A68 F;  5D5U B;  4UVA A;  1UCR A;  4EJO A;  3TO7 A;  2HZT A;  5ICG A;  1W7P A;  4H0E A;  1ZLJ A;  4O5V A;  1B9N A;  2YX4 A;  4LG0 A;  2O6G E;  1LVA A;  3E97 A;  1IN8 A;  2M30 A;  1CF7 B;  4WXH A;  3FHZ A;  2R7F A;  4RGS A;  2DFI A;  3E6B A;  3G3Z A;  1XSD A;  4P9U A;  1S3J A;  3ZN1 A;  4XSZ F;  3C18 A;  3E5U A;  3KET A;  2BYV E;  2XAS A;  3NEU A;  3WE2 A;  3KEO A;  1SD6 A;  2QQ9 A;  1XDS A;  1HKQ A;  4RGU A;  1KQ0 A;  3J80 Z;  3R0A A;  5J8F A;  5LEJ A;  4MQ9 F;  3JAM Z;  5DD8 A;  4KMU X;  1F5T A;  1R1T A;  3HHG A;  1YS7 A;  1LEA A;  2F5D A;  2R3S A;  2IW5 A;  3S2W A;  3IKV A;  3WU0 A;  4EMS A;  3O2P E;  4M6Y A;  4EJU A;  2NNN A;  4QWQ A;  6PAX A;  2GXG A;  2HKO A;  4OIN F;  2JPC A;  2XAH A;  2VT3 A;  2L4A A;  5DD4 A;  4PDK A;  2K4J A;  3U1D A;  2M1B A;  4KIC A;  4AIH A;  2DQL A;  4EQQ A;  2R7D A;  1YW9 A;  3ML6 A;  4G9Y A;  1PDN C;  2FNP A;  3DPT A;  4HOB A;  1SD5 A;  2V1X A;  2RV8 A;  4G7O F;  2EFW A;  2A6H F;  1FY7 A;  4P9F A;  1CF7 A;  3HOT A;  5FGM A;  4HX8 A;  2GQQ A;  4KA4 A;  4OIQ F;  1TNS A;  1B6A A;  1FP1 D;  3FMR A;  3JAM K;  1ZGJ A;  3BDD A;  4IF4 A;  3KE2 A;  1FX7 A;  4WK8 F;  3QU6 A;  5D6F A;  3K1N A;  1BJA A;  4R79 A;  5LHG A;  4U7D A;  1ODD A;  1A04 A;  4HA8 A;  2IA0 A;  2UXX A;  1R5H A;  4FHT A;  4G7Z F;  3F72 A;  2ZKZ A;  3CLO A;  1OYI A;  4K2E A;  2FQ3 A;  3TGN A;  1KU9 A;  3Q5F A;  1MZB A;  5HDK A;  2JT1 A;  2ZNZ A;  3BOQ A;  3LFK A;  2VE8 A;  1DUX C;  5H20 A;  4Y15 A;  2VBY A;  3LWF A;  1YO5 C;  2XRO A;  2IA1 A;  2P5K A;  5CLS A;  3HTU A;  2WTE A;  2HS5 A;  2FSW A;  2VOO A;  2EA4 A;  3JTH A;  1F9N A;  4A0X A;  1CGP A;  4KIG A;  5LHI A;  5F6F A;  5J6X A;  1HW1 A;  5D5X B;  2FRH A;  2DAO A;  1TTY A;  2ZME B;  2L54 A;  4WXC A;  1SAX A;  1XMK A;  3EDP A;  4IXA A;  2Z5U A;  2K86 A;  2IA2 A;  5CVR A;  1HQC A;  2ETH A;  2D2W A;  2OZU A;  1OYY A;  4FX4 A;  1J2X A;  1FYL A;  3BRO A;  5CVV A;  2HQR A;  2OQG A;  3K1M A;  4LD5 A;  4EJT A;  4NHJ A;  2IPQ X;  4U0V A;  1F4K A;  3K69 A;  1LDD A;  3DP7 A;  2AXL A;  1R00 A;  1DPU A;  3P9C A;  5CYV A;  1JGS A;  2QWW A;  2PBI A;  1EV7 A;  4AD9 A;  1O3S A;  1BI0 A;  3IWF A;  1IRF A;  3CUQ C;  2DBB A;  4RB3 C;  3KP5 A;  3C7J A;  4UHT A;  5LHH A;  1SFU A;  4GYI A;  4I01 A;  2B0L A;  3F21 A;  2XAG A;  2RN7 A;  1R22 A;  5FO5 A;  4P96 A;  2GA1 A;  5L3B A;  4RGR A;  2VC1 A;  1ZH5 A;  2ZBK A;  3WGH A;  2V1D A;  3U9G A;  2YR2 A;  5FFZ A;  1MD0 A;  2RVC A;  3FXR A;  4RGX A;  1K78 B;  2OBP A;  4G6Q A;  3N97 A;  2O8X A;  2FML A;  2RGV A;  2DPU A;  2OU2 A;  1H9T A;  1O7L A;  4AVP A;  3LA2 A;  2FBK A;  3FX3 A;  1X3U A;  3E6C C;  2FA5 A;  2GIV A;  3WTU C;  3KP3 A;  3BY6 A;  4MEY F;  5HVQ C;  2Z9O A;  3H3U A;  1D8K A;  1G6N A;  5IT9 K;  1KU3 A;  4OMZ A;  3L7W A;  2EFQ A;  2IRF G;  4L9V A;  1H9G A;  3K0L A;  3VEP A;  3DPL C;  5JHU A;  4I7H A;  3ZPL A;  2ISY A;  4P55 A;  3QU3 A;  1DPR A;  1XSV A;  5F64 A;  4IRI A;  2K02 A;  3KP7 A;  5BMZ A;  3TKY A;  5H6R A;  2QQB A;  4LB6 B;  1GHC A;  2ELH A;  3RPU A;  4MHG A;  2A61 A;  3J80 K;  1SD7 A;  2HYG D;  2OD5 A;  3K9T A;  5LEK A;  4AIJ A;  1FSH A;  3I5U A;  1I5Z A;  1ZRF A;  3RKW A;  1Z1D A;  3GO5 A;  1OYW A;  1KYZ A;  1P6R A;  1KU2 A;  1G3S A;  3QOP A;  4GCV A;  5IT3 A;  4EV0 A;  1I27 A;  1XCB A;  1YFH A;  4OIO F;  5HS7 A;  2CFX A;  4BQA A;  2EWN A;  3F8C A;  1S29 A;  4CIC A;  4YFN F;  4OU0 A;  3VOE A;  2CYY A;  4M9Z A;  2ZO4 A;  3WTX C;  1Y0U A;  2UZK A;  2J5P A;  3R4K A;  4LMY A;  2BV6 A;  1FLI A;  1FOK A;  3PFI A;  3LQQ A;  3QAH A;  2DK8 A;  2VBX A;  3GF2 A;  2M8E A;  5HDN A;  2BEO A;  4ON0 A;  3VOD A;  1UFM A;  2KJC A;  3QP5 A;  4RS8 A;  1S7O A;  3LQR A;  5CVI A;  2XKP A;  3RDI A;  3W6K B;  1YW8 A;  1ONV A;  4JQF A;  3TOB A;  2NRA C;  2CSO A;  2X0L A;  1LDK B;  4M73 A;  2HDC A;  2A5Y B;  4JK1 X;  3Q9S A;  1RNL A;  4MTE A;  1IN6 A;  4Z2Y A;  5EEG A;  3GEZ A;  1J0R A;  1BOA A;  3GVA A;  4L9N A;  4ZH4 F;  3G73 A;  3R60 A;  1STZ A;  1VTN C;  1ZHF A;  1U6G A;  1QO0 D;  3JW4 A;  3VB2 A;  2MH2 A;  1IAW A;  3P9I A;  5ICE A;  5LLQ A;  2Q8K A;  5E1W A;  2W84 A;  2PI0 A;  3FM5 A;  2ZME A;  1XDU A;  2CO5 A;  2DQR A;  3I0T A;  2QYO A;  5JFR A;  2H94 A;  2P6T A;  3FXU A;  2MC3 A;  3D0S A;  1R58 A;  5A2Q K;  3J7A O;  3QP6 A;  1ZG1 A;  1BI1 A;  3T1B A;  2P7C B;  3EYY A;  2EV0 A;  2BGC A;  2HGC A;  3QPH A;  4G94 A;  1Z91 A;  3K1P A;  2ZFW A;  3ABU A;  4RB0 A;  5F1R A;  4M71 A;  4MGR A;  4UXN A;  4ASN A;  2PLY A;  3WTS C;  5ERI A;  1YQA A;  2EV5 A;  4HDU A;  2BBY A;  3TDZ C;  1TBX A;  2K27 A;  4KFC A;  4L18 B;  5L3E A;  2H6B A;  1IXC A;  5D8L B;  4NB5 A;  4LLN A;  2P4W A;  1EH7 A;  4MTD A;  2P5L C;  2HQN A;  3BJA A;  1UST A;  2IT0 A;  4WX9 A;  5HS9 A;  3I71 A;  4LK0 F;  3MEX A;  3N4M A;  2QBY A;  3SZP A;  1FPQ A;  4CHU A;  5DDG A;  5LGU A;  4LGW A;  3I59 B;  1J9I A;  2VT2 A;  1FBQ A;  3EET A;  1J5Y A;  4UV8 A;  4R8H A;  3FMQ A;  4UV9 A;  2XAJ A;  2O0Y A;  3MZY A;  2XAQ A;  1MGT A;  1ZAR A;  2FNA A;  3BWG A;  4ZYD A;  1S8N A;  4ZZL A;  2RDP A;  1KGS A;  2M87 A;  5BOX A;  1SFX A;  2JRT A;  3ZMV A;  2COM A;  1D3Y A;  1UHM A;  2QVO A;  3CUQ A;  1ZRE A;  1USS A;  4GYG A;  1ZG5 A;  3EYI A;  4IHT A;  1Z9C A;  3RTR A;  5LGT A;  1NHA A;  5E8I A;  2Y75 A;  3KLO A;  1I1S A;  1YLF A;  2HYF A;  2X4H A;  3T0Y A;  4ETS A;  2F5F A;  5HOO A;  4UUV A;  2P8T A;  3V8L A;  4EM0 B;  3V4G A;  1IRG A;  5ILU A;  4A0Z A;  1WRJ A;  3ROU A;  4QLC U;  3SHF A;  2GA2 A;  3GZ5 A;  1T2K A;  1S7A A;  3V7C A;  4HW0 A;  4N0B A;  2UWM A;  1U5T A;  1K79 A;  1XN7 A;  1QNT A;  2RNJ A;  4RAZ A;  1HBX G;  3V7R A;  5BQT A;  3GX4 X;  4G7H F;  1QPM A;  2ACJ A;  2XHK A;  5IT9 Z;  1R1U A;  2O03 A;  3GFM A;  2HR3 A;  1U5T B;  4Y17 A;  4KN7 X;  3T8R A;  1R5G A;  1O57 A;  4BHC A;  5LGN A;  2Z99 A;  2LNB A;  2OAZ A;  1RUN A;  2YPR A;  4I0B A;  4HQM A;  4IPA A;  4LLL A;  2DT5 A;  1IN4 A;  1P92 A;  2CW0 F;  3DXJ F;  4B09 A;  3MQ0 A;  5L3D A;  4CXF A;  1J75 A;  2CGP A;  1K78 A;  3NRV A;  2QEN A;  2VE9 A;  1BC8 C;  3IC7 A;  2MH9 A;  1FWZ A;  3T8T A;  1B9M A;  2E7X A;  2CG4 A;  1W5S A;  2VC0 A;  3C1D A;  4DNC A;  3F23 A;  3F8N A;  2A07 F;  3QRF F;  5DCM B;  3M8F A;  1LJ9 A;  1XGO A;  5HLI A;  3REO A;  1UHW A;  1JHF A;  4YII A;  2IVM A;  2IJL A;  2HKX A;  5FD5 A;  4M9S A;  4LB5 A;  2XVC A;  4CZZ A;  4IVN A;  1I6X A;  4A6E A;  4LFU A;  1FBU A;  1O7F A;  3M1E A;  4Q4Z F;  1E17 A;  3RI4 A;  2E7W A;  5K5R A;  3LA3 A;  4EGZ A;  4L0Y B;  2EK5 A;  4HYE A;  4LJZ F;  1G3W A;  4HF2 A;  3IL2 A;  5DUK A;  1AOY A;  5LRS A;  5D8K B;  4XBF A;  1P4A A;  4FX0 A;  4YFK F;  2G7U A;  1OKR A;  4Q5S F;  3I64 A;  3I58 A;  4ENK A;  3SFZ A;  3FMS A;  1UB9 A;  1MJ9 A;  3WOD F;  4L5I A;  4I2O A;  2KKO A;  4IHS A;  1XGS A;  1Z6T A;  2V6C A;  2V79 A;  3F8B A;  1MDM A;  4M6X A;  4TV7 A;  2WV0 A;  4UVB A;  2BE5 F;  5CJ9 A;  5FD6 A;  1FT9 A;  2GWR A;  5FLX K;  3HSF A;  1WWX A;  1G3T A;  4KDP A;  2F5E A;  4MEX F;  1DP7 P;  2P5V A;  3BPX A;  2FEZ A;  1B4A A;  4I98 B;  4KT5 C;  4Y13 A;  4P5O A;  1W4M A;  2QLZ A;  2D1V A;  4A5M A;  1ON1 A;  2RQP A;  5DEQ A;  2EA2 A;  2W25 A;  1TW3 A;  2IP2 A;  3DEU A;  2WWY A;  3CUO A;  3WTT C;  4PZJ A;  1HXD A;  5E18 F;  1LQ1 A;  5KK1 A;  2MLK A;  3GLX A;  1YTY A;  1T0F A;  1S6L A;  1U3E M;  2DO7 A;  2K4B A;  5DUI A;  3L00 A;  4EM2 A;  3ZMD A;  1T38 A;  1HST A;  1YS6 A;  2XAF A;  2H27 A;  1WQ2 A;  4HZF A;  3C3W A;  5L3C A;  3M8E A;  3WTW C;  1IN7 A;  2JZY A;  4PGG A;  3VFZ A;  3ECO A;  4XSX F;  4CDG A;  4HAM A;  3Q9V A;  3I53 A;  4L0Z B;  1R1V A;  3TO9 A;  3COA C;  4WWC A;  4YFX F;  3J81 K;  4ZZD A;  3T5X A;  1SMY F;  3QPT A;  4WCG A;  3WTZ A;  4ESB A;  5J8C A;  2XUB A;  3R0J A;  1XSX A;  2NS0 A;  4ZYE A;  3O3K A;  2L4M A;  4BH9 A;  2STT A;  2VOD A;  1B59 A;  1RZ4 A;  1FC3 A;  2Y0M A;  3B02 A;  4AIK A;  5HLH A;  2W85 A;  4HLX A;  5EEH A;  3B73 A;  1O3R A;  3FZV A;  4HX7 A;  4I0A A;  2PG4 A;  1F1Z A;  1C0W A;  4A2U A;  4A5N A;  1HKT A;  1BC7 C;  3LAP A;  2FMY A;  2VXZ A;  4E70 A;  4KMF A;  3DF8 A;  1BM9 A;  4HV5 A;  3KCC A;  1TW2 A;  4N9I A;  3TQN A;  2ADU A;  3WGG A;  1GXP A;  2O61 A;  3F3X A;  1QZY A;  2EFO A;  4OIR F;  3LAJ A;  2CWE A;  1P4W A;  1R23 A;  1EH8 A;  3GFJ A;  3I59 A;  2ESN A;  5FLX Z;  5AIP A;  3ISP A;  4GO1 A;  2OA4 A;  4A0Y A;  5AIQ A;  1BN5 A;  1W7P D;  3RKX A;  2TDX A;  2W57 A;  3ZMT A;  4ENM A;  2F2E A;  4EJV A;  3M9A A;  3ZMS A;  4IJA A;  2LKP A;  5LBQ A;  3F22 A;  4RB2 C;  3WU1 B;  3MZH A;  3HRU A;  2KRF A;  3E3V A;  4MQV A;  5E1X A;  2YX7 A;  1XGN A;  3NQO A;  2YSR A;  4HQE A;  3BZ6 A;  2JPB A;  4EGY A;  3CTA A;  2QQA A;  2DTR A;  5ICC A;  1HW5 A;  2H09 A;  2ZXJ A;  2DI3 A;  4ESJ A;  4O3M A;  3L2C A;  4S04 A;  3P9K A;  4UVC A;  2P7V B;  1IXS B;  5DCF A;  1D5V A;  4B8X A;  1LDJ A;  5KVR A;  3WTV C;  2JTV A;  1L3L A;  3V8K A;  4LK1 F;  1PP7 U;  1XMA A;  5K5Q A;  2ISZ A;  5TJJ A;  2W24 A;  4WXD A;  3L9F A;  1TQI A;  1OR7 A;  1R36 A;  4XLN F;  3OV8 A;  1V4R A;  3GXO A;  4HV6 A;  1BI2 A;  5ILS A;  1O3T A;  3I54 A;  1QGP A;  4L5J A;  3H3Z A;  4F7Z A;  1YW7 A;  4LG0 B;  1OPC A;  2KIM A;  1H0M A;  2M45 A;  3AAF A;  2Z33 A;  2XRN A;  1LNW A;  5H6Q A;  4BHB A;  1LEB A;  3FXQ A;  1HKS A;  4N9H A;  4HLY A;  4BNC A;  5JVT A;  2MBF A;  2ESH A;  4GGG A;  1HSJ A;  4AWX B;  3ZMZ A;  3TO6 A;  2D45 A;  1FSE A;  1J7K A;  2XIG A;  3K2Z A;  4HX4 A;  3KZZ A;  3GUD A;  3HUG A;  2YU3 A;  3RYP A;  3GW2 A;  3TDU C;  3RJP A;  4BXU A;  1L0O C;  2AS5 F;  3SXY A;  5D4R A;  3CO7 C;  4U0Y A;  3BJO A;  3HRT A;  4KYW A;  3FWE A;  2UXN A;  4U88 A;  4G8X A;  1FYM A;  1ZLK A;  3RPQ A;  4ZYH A;  3F6O A;  5HS8 A;  5D6E A;  4U7B A;  5CVJ A;  4I09 A;  1W7P B;  2DK5 A;  4A12 A;  5K5O A;  1P2F A;  1KQ8 A;  1FYK A;  4RB1 A;  3WTY C;  2HWV A;  3ECH A;  1XGM A;  2EFP A;  2XV4 S;  4OOI A;  3KLN A;  4M72 A;  1Z7U A;  1W5T A;  1TNT A;  2Q2E A;  4D0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...