1MBKA

Mouse c-myb dna-binding domain repeat 3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
VKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
total genus 13
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbkA00
2NVYJ 4L5EA 2H8RA 3ZQHA 2RAEA 2Y9ZA 4XRSG 1APLC 3Q0UA 1ETKA 3BT9A 3GTLJ 1MH4A 5E3NA 4HNVA 1ZK8A 1RESA 2FJ1A 1LE8B 1F43A 1P7IA 4QIWN 3GTKJ 1HDPA 2YU9J 1YRNA 5J1YA 4CYCA 2IEKA 1XS9A 1JTYA 4M3EA 2R5ZB 4DZJA 1AKHA 2GLOA 3PM1A 3BG5A 3BR6A 1JT6A 4BBRJ 5JLXA 4A3FJ 1ETYA 2O9LA 2LY9A 2CRGA 2KDZA 2R7ZJ 1MNMC 1Z0XA 2L7FP 1ZR4A 2DTZA 5FLMJ 1JJ8C 4V2GA 2YUSA 3JRBA 1IGNA 3CDLA 5IOYA 3CCYA 4FE4A 4FE7A 5C3EJ 1JKOC 1WCMJ 2R92J 4A3KJ 3BG9A 3LNQA 3OSFA 3ZOBA 1TWFJ 1SANA 3BG3A 4RBOA 4D5FA 2E19A 5FKMA 2JA6J 2NVTJ 4A69C 3GTQJ 1NTCA 1LFBA 3D1NI 4FCYA 1MBHA 1OJLA 3Q3SA 1WH5A 4MFEA 1B72A 1AU7A 1LFUP 3GTGJ 5C44J 1SFOJ 5J1UA 4A3CJ 3LOCA 1ZQ3P 3W6VA 2JN6A 2HOSA 1OFCX 2EBIA 4C2MJ 2XB5A 5IYCJ 4BXXJ 2DA3A 4A3LJ 1RPWA 2JWTA 4V2FA 2PMZN 2WV1A 3IV5A 3LSJA 4JX5A 2X9DA 3S1MJ 2NOGA 2LKXA 4A3GJ 2Y9YA 4JP0A 1WH7A 3ZQCA 4UUSB 1ZTRA 2GM4A 3CMYA 2HI3A 4A93J 2M8GX 5M5XJ 1ZR2A 2E2HJ 3BQZA 2FQ4A 3K2AA 1HF0A 3O8HA 3GBGA 4DZPA 1UG2A 3OSGA 5GPCA 5F0CA 1IDZA 4A3IJ 3DEWA 2HXIA 4A3BJ 2B63J 3DCFA 5GPAA 3TW7A 2R0QC 1WPKA 3ZQLA 1R9TJ 2H1KA 4C3JJ 2XGEA 1HDDC 1POGA 2DMQA 3BR5A 3M3YJ 1YRNB 4M3BA 4UUTA 3BR2A 5BNGA 4D7MA 4CYCB 1FEXA 3UKGA 1GT0C 1MSEC 2EZKA 1AKHB 2MSYA 2XB0X 5K7HA 1CQTA 1B8IA 1TWHJ 2FX0A 3IH3A 5F0FA 2XPVA 4MIMA 1FTTA 1P7JA 4XRSA 2O7OA 5J3LA 1TWCJ 1X2NA 2JA5J 4M3FA 2OPTA 5M3FJ 2HDDA 3GTPJ 1MBGA 1JTXA 2DA6A 5EGOA 4X1EA 2DA2A 4Y52J 1OCTC 3JREA 2NS8A 1RETA 2VKEA 2MW8A 3A02A 3BR1A 2Y30A 5FKNA 1HCRA 1BW5A 1AHDP 5F27A 3LSRA 3I4NJ 4IHYA 3HGYA 5IYDJ 3RKQA 1B72B 2HQ5A 2IAIA 1DU0A 1ORKA 1BL0A 4DYRA 3FK6A 2X48A 5M3MJ 5M5YJ 2LVSA 3PO3J 3PO2J 2NS7A 3LSPA 2DJNA 3FISA 4MFDA 2QCOA 1OCPA 3SJMA 3HDDA 3QQAA 4AC0A 2L7ZA 2MGQA 1PUFA 5J1RA 3ZQGA 5GP9A 2K9SA 3ZQIA 2R5YA 4A3EJ 2IBDA 3MKLA 2DA7A 5EG0A 4M6VA 3HOYJ 2VKVA 3K7AJ 1IUFA 2ID6A 2L0KA 1FJLA 2O8KA 1VFCA 1FIAA 2X6OA 4XRMA 2L9RA 3A01A 1TWGJ 1NK3P 9ANTA 1H89C 4X6AJ 4JX6A 1W0UA 2DA5A 1IJWC 4I76A 1WI3A 1H88C 3BTCA 1XG1A 3GTJJ 1BA5A 4M3GA 2EZHA 3HOVJ 3BTJA 4W1UA 2VI6A 3TP0A 2DMPA 1QPIA 1IG7A 2W48A 5E3OA 5F04A 5FKOA 2DA1A 2CU7A 2Y0SN 3TEDA 5IYBJ 3S16J 2DN0A 3S17J 1RR7A 1U78A 3TP3A 2DMUA 3RZDJ 2K9QA 2QF7A 4M3DA 3JRFA 5DTDA 4D7NA 1ETQA 1K83J 3BTIA 3B6CA 1B8IB 5EZHA 3HOUJ 4B3AA 1JGGA 2R93J 3MN2A 2Y31A 1JKQC 1JT0A 1TC3C 4MLOA 1U8BA 2CJJA 2LP0A 1JUPA 1TWAJ 4FISA 1FIPA 2EZLA 5EGOB 2G0EA 2P81A 5IP7J 4RDUA 1ETOA 2M0CA 4BBSJ 1IRZA 4I6ZA 3BR3A 3NARA 1RKTA 4XK4A 1QVUA 3JRHA 3BR0A 1ETVA 2K9NA 3JRGA 1W0TA 3S2HJ 2NVXJ 3SDGA 3ZQFA 5F0HA 2K40A 3S1RJ 4GFBA 3RZOJ 2DA4A 3QPSA 2YS9A 1ETXA 4D5CA 3HOWJ 3A03A 3HM5A 3BQYA 1S7EA 4NDLA 3NAUA 5EDNA 2MG4A 2HYJA 3MVPA 4B4CA 1PUFB 3OOUA 4QTRA 1QVTA 2NVQJ 2R5YB 5M5WJ 1JJ6C 3HBLA 1GV2A 5EF6A 5EG0B 2ECCA 4S0HB 4MO7A 3RQIA 2VUMJ 3IH2A 1QRYA 4FTHA 3JRDA 2WB1N 1D5YA 1JKPC 4DW6A 1UHSA 2JK3A 5K7FA 1GUUA 3A01B 2LFBA 3HOXJ 3I4MJ 1I50J 2XPUA 4DYCA 2M2EA 5C4XJ 1Z77A 2JJ7A 1XC5A 4XICA 1MBEA 1MBJA 1X58A 3IH4A 5HODA 2JA8J 4A3DJ 3VPRA 1MSFC 1EF4A 1FTZA 3O8GA 3JR9A 1T56A 4IHXA 3H0GJ 4AUXA 3SFIA 5E3MA 1WGXA 1E3OC 3B6AA 2TCTA 1Y1WJ 1MBFA 4B1RA 2EH3A 3C2BA 2EQRA 1T33A 1X2MA 1HOMA 2E1OA 1HLVA 2XRLA 5JLWA 1ITYA 2ELKA 1O4XA 3WHBA 3GTOJ 1JUMA 3WHCA 4IHWA 5IOZA 1NK2P 1U9NA 4Y7NJ 5C4JJ 4J19A 2ZB9A 4AYBN 3JRIA 2CUEA 4A3JJ 3JRCA 3S1QJ 1IDYA 1GDTA 1U9OA 1Y1VJ 2XGDA 1MBKA 2L7MP 1BJZA 1MH3A 3E7LA 3HOZJ 2HXOA 3LSGA 5IP9J 2HOTA 1LE8A 2ME0A 4W97A 5EEAA 2E2IJ 5FKKA 2LR8A 2XPWA 2CQXA 2WAQN 1ZKGA 3HGGA 1IV6A 4BY1J 3OIOA 5EZGA 4ABZA 2JA7J 3S2DJ 1A6IA 2HOAA 2FD5A 3F0CA 2XSDC 3JRAA 1JUSA 2R5ZA 1I6HJ 1G2HA 1ETWA 4A3MJ 1VI0A 2JMWA 2LK2A 5EYRA 2ID3A 3S14J 3HEFA 4C3IJ 1BW6A 5K7ZA 2N8GA 1H8AC 1RKWA 5E3LA 3L1PA 2COBA 2OF7A 4G12A 4DYQA 3G1OA 2I10A 4C3HJ 4BKXA 2M34A 2AO9A 4LOCA 1F36A 2EZIA 3Q0VA 1GV5A 1Q1VA 5F08A 1DU6A 1GVDA 2AHQA 5IP6A 3HKZN 2ECBA 1UMQA 3G1MA 3FIWA 3Q0WA 3G1LA 2M9HA 1IC8A 5F1JA 2VPRA 1JKRC 1ENHA 3S1NJ 2KT0A 3BTLA 4IEJA 4QSHA 2ME6A 3H3VK 2LTPA 2D5VA 1VF9A 2LD5A 4JYKA 1ZGWA 5FLVA 2DMNA 1I3QJ 5FJ8J 5FKLA 4EEFG 4JX4A 3S15J 2Y2ZA 4XIDA 2TRTA 4IHVA 2E2JJ 2XGCA 3GTMJ 4UUSA 5DS9A 4BY7J 2LLKA 3FKIJ 3M4OJ 2CQQA 3CQZJ 3HB9A 3TW6A 2CUFA 3FK7A 5IPAA 1A5JA 2DMTA 2GBYA 3QPLA 1VNDA 1K61A
chains in the Genus database with same CATH superfamily
2OU2A 4XMYA 5DV5A 3ZN0A 2H8RA 3FBIB 2Y9ZA 5HLTA 1XMXA 2LREA 2HPIA 5AIQA 1I5ZA 3KCCA 4JQFA 4A6EA 3FXRA 3BT9A 4RGSA 3GTLJ 2JVHA 4E7HA 5E3NA 1PP7U 1ZK8A 3DBRB 3NRVA 3RIRA 1R00A 3CJQB 3RPUA 3P9KA 3LFUA 2WADA 2FJ1A 2ZFUA 4DIQA 4ZZLA 3G71I 1R49A 3CDIA 1YRNA 4XRFA 4H0EA 4MQVA 2PJPA 2EK5A 3GF2A 1IW7F 2BOLA 2JPCA 4E4HA 4DZJA 5A2QK 3KPHA 1AKHA 1K78B 1WJEA 1V5EA 3BG5A 4HQMA 5D8LB 4BBRJ 3K4KA 3IL2A 1Z9CA 1X1BA 2KDZA 2DYSH 3SEZA 1MNMC 4JK1X 4RMNA 1MZBA 3OIQA 4N0BA 1I6XA 5DD8A 1YITI 1IGNA 3MKZA 3RI4A 3CC4I 2J5OA 4IPAA 2R92J 4FE4A 1FOYA 1WCMJ 4HEA2 2DYRH 3OSFA 5F64A 2IS1A 3OS0A 1T0FA 3CCMI 2E19A 2CV1A 2HTJA 2QQ9A 5D5VB 2XF7A 2GQQA 1J5YA 3I71A 3FHNA 1WH5A 5D4RA 5TISC 1B72A 2P5VA 3U1DA 5JFRA 1AU7A 1LFUP 3P9IA 4R8HA 3SZGA 1EJ9A 2IRFG 3GTGJ 4G6QA 4RLFA 2V6CA 1ZQ3P 3W6VA 3ERMA 2HOSA 1OFCX 2F6CA 5FLXK 4AIHA 3J7ZI 4BXXJ 4HNUA 4A3LJ 4CCOA 2JWTA 3WGHA 1MMAA 2E1MC 3CCLI 4S04A 3IV5A 4BHPA 1TQPA 4JX5A 4Y15A 1LB2A 1YIOA 3IAS2 4BQOA 4WCGA 2VJ4A 3MZHA 3S1MJ 3MWMA 3K4JA 1YQAA 5LRSA 1ZTRA 3D5LA 5L3EA 2GM4A 1XTAA 4IKFA 2UZKA 2M8GX 2PEXA 4NC7A 2FQ4A 3K2AA 3LSHA 3BG7A 3DKXA 2F48A 4HW0A 5DM6F 3O8HA 1O7FA 3K4LA 1XMKA 2G9WA 3GBGA 4DZPA 3DPLC 3HSRA 2FMLA 5F0CA 4A3IJ 3ESWB 1IUYA 2EB7A 3MEXA 2MABA 5GPAA 2V7FA 1YO5C 2R0QC 3H92A 2Z9OA 1YYVA 3ZQLA 4A0ZA 5FGMA 2LF7A 1B4AA 4IF4A 2XGEA 4UB8C 1POGA 2EILH 1TT0A 1J7KA 3HPGA 4UUTA 1QPMA 2KRHA 5J47A 4D7MA 1F4KA 2BVMA 5J40A 3G2BA 2MSYA 2KLOA 5K7HA 4XNFA 4MTEA 5E18F 2WAEA 4HSTA 1D8JA 2R7OA 2FX0A 1BI2A 3WE2A 2V1NA 2CQNA 1P7JA 3COAC 5J3LA 3FWEA 3M7GA 4MEXF 1Z91A 3P5JA 1D3YA 3QU6A 2CFOA 2RREA 3C3WA 2UUZA 4E7SA 3QP5A 2DA2A 4Y4RA 3CO7C 4BE0A 3P7NA 5LGUA 4BHCA 4CZZA 2IA2A 4ON0A 2DODA 2R7XA 3GZ5A 1KU9A 3RDIA 3FXUA 1BW5A 1AHDP 3NWSA 4L0YB 1NHAA 3F6OA 4AYBA 2A3SA 4BE1A 4XQFA 4KYWA 5J4VA 2R7VA 2HDWA 4N9IA 2FE3A 4EJTA 3PO2J 4HDUA 2QSFX 4M73A 2EPFA 3FISA 4B09A 3BJOA 3FX3A 2KRFA 2K3PA 2L7ZA 2MGQA 1PUFA 2R5YA 2IBDA 4KFCA 4LGWA 4M6VA 3HOYJ 4PK4A 5BPIA 2M5WA 1R23A 5J8FA 1OCCH 1VQ9I 2HOEA 2X6OA 1FBSA 2OD5A 5L3GA 4ZYHA 4M9SA 5KVRA 1HC8A 4LIVA 5TGTA 1TWGJ 3I55I 3CCJI 4NQWA 9ANTA 3GFJA 1RUOA 3PIOF 2HPMA 3DFGA 1Y56A 2QGUA 1ULYA 1ODDA 2M4KA 1P4WA 4XLCA 4F3QA 3OIPA 3BTJA 1WQ2A 2BXZA 2DMPA 4OIRF 2IA0A 1P9QC 2NS0A 3VDXA 2DA1A 4N4NB 1OYIA 2TDXA 2Y0SN 4ZC3A 1BOBA 1XSDA 4FASD 3S17J 1RR7A 3HPHA 1D0ZA 4IRIA 3RZDJ 5IT9K 2H8WA 1VQPI 1KU3A 1IRXA 2FBKA 3WTXC 4BH9A 3JRFA 1LEBA 1V54H 1ETQA 4CXFA 5JR3A 3S3MA 3EPZA 4EJUA 2V1XA 1A6QA 2R93J 2DT5A 1JT0A 1R36A 3JW4A 4U0YA 5B3SH 3WGGA 1IN4A 2LP0A 1U5TA 4CA0A 4LK0F 1JUPA 5E17F 4FISA 2PI0A 2FNPA 3RYPA 2P81A 2FSWA 3QAHA 2VQHA 2E1NA 1B59A 1X4OA 4BBSJ 2XASA 3FHZA 3NARA 2M4GA 3ZMDA 3JRHA 3FF5A 1ETVA 4EQQA 3JRGA 1W0TA 5FO5A 2X1CA 2NVXJ 3BWGA 3PNVA 3SDGA 4EATA 2VC1A 5F0HA 5CQGA 2LKPA 2RGVA 4P55A 3RZOJ 3BDDA 3JCUC 1V5GA 2L4AA 4IRHA 1WZ2A 1W5SA 1XB4A 1CF7A 5LHGA 3HYIA 1V5FA 2CW0F 3NAUA 1FT9A 2ZCWA 1ONVA 3MVPA 4OMYA 1Z21A 3OOUA 1T39A 1QVTA 1R1VA 3QOEA 1QO0D 3I53A 1O57A 5M5WJ 4OIPF 1JJ6C 4Q47A 1T2KA 5EF6A 2D1HA 1SVLA 3SDBA 2MD5A 2H94A 3ISPA 1OYYA 3RYRA 3HSFA 3KZYA 1EA3A 4AIJA 4CHUA 1T38A 1UHSA 2A61A 1GUUA 3I4MJ 2LFBA 1I50J 5D8KB 3EUHA 1SFXA 2JJ7A 3LSIA 4MGRA 4WXCA 5KAIC 4XICA 3J80Z 3WTUC 1HW5A 3IH4A 3I4PA 4PJ0C 3LMMA 4EV0A 1MW7A 1LEAA 4EJOA 1Z7UA 1EF4A 3MFKA 1FTZA 3FXMA 2NNNA 3DP7A 4IVNA 4CCJA 4ESJA 3DTKA 3J7YJ 1D0YA 4CICA 4BU2A 2BY1A 1B1BA 2OV7A 3REOA 4AUXA 3SFIA 5AIPA 2WAQA 3VB2A 1WGXA 4DOZA 1E3OC 4MEYF 2DQRA 3WG9A 1YS7A 2EA4A 3K4BA 3MZYA 2DQLA 3R0JA 2DAOA 2FU4A 3SHFA 1MBFA 4Q5SF 2ISYA 3KP5A 1X2MA 1HOMA 2L2OA 2WAFA 3CDHA 4IRGA 2VN2A 2ZSHB 1HLVA 1DPRA 3IRRA 5LEKA 2UXXA 3CUQB 5HDNA 3CCUI 2HVSA 1ITYA 1O4XA 2O6GE 2V1UA 1HXDA 3J7AY 4XR6A 3EETA 3EYYA 5IOZA 4Y7NJ 5C4JJ 4J19A 2COMA 4R1HA 2HQRA 2V26A 3GMEA 3IP4B 4A3JJ 3TKYA 2XGDA 1BJZA 2DT7B 3E7LA 4XORA 2J5PA 1QZYA 3X2QH 1T6SA 1WJCA 3LSGA 4FX0A 5CVVA 4F55A 3TDZC 3LQQA 2ME0A 4W97A 2ADUA 5FKKA 2E2IJ 2XPWA 4BY1J 1JI8A 4KIBA 2HOAA 2V9VA 1JUSA 3L2CA 3OYLA 1ETWA 2BEOA 4EJWA 1K78A 4KICA 3CCVI 3S93A 5H6RA 2LK2A 3OYIA 2ID3A 2HZTA 3HRTA 4ANJA 2R7QA 1Z05A 1WI9A 1R5HA 1WJBA 1OPCA 3V7RA 5K7ZA 1BW6A 2XHKA 2N8GA 1H8AC 1UJ8A 3L1PA 1S6LA 1G3WA 2MC4A 4DYQA 3VSKA 1RRJA 3E6MA 1HKSA 3F22A 1F9NA 1FC3A 2X85A 3D5SC 3DEUA 1MJBA 2NYXA 5B5EC 2DOEA 1N25A 1SC7A 1BBYA 3PSFA 2K9MA 2QUFA 1Z6RA 2CW7A 1DP7P 4ENMA 5IP6A 2Y48A 2ECBA 1UMQA 3Q0WA 2E7WA 2BZTA 1IC8A 2VPRA 2VJJA 1ZREA 5BMZA 1JKRC 4CO8A 2NRAC 3S1NJ 1XPXA 4HLYA 1DPUA 2BVLA 2ME6A 4IEJA 3A2KA 3H3VK 2XIGA 4Q48A 5J6XA 5FLVA 4EEFG 5HDKA 4XIDA 1T08B 2P6TA 3VFZA 4AM3A 1SD6A 2E60A 3C18A 4C9YA 2KMUA 2WY8Q 4DNCA 4OIQF 3EDPA 2L54A 3AAFA 2W25A 2XAQA 1U0JA 4B48A 3FKIJ 2CQQA 3CQZJ 3TW6A 3H36A 1Z3YA 2DMTA 2GBYA 3ROUA 1KQ8A 4M74A 3OY9A 5ILUA 4BXFA 4CZCA 2VT2A 1HA8A 3BZKA 3CCEI 3KIOA 2IXSA 4Y33A 2OBPA 1ETKA 2XAFA 2MD0A 4HNVA 1ZH5A 4OU0A 1FY7A 1G8XA 2QEXI 4PCQA 4EMSA 3K4MA 2GXBA 2AS5F 3E1SA 3MZ8A 3RKYA 1P7IA 1SFEA 2K5CA 3GLLA 5GAGJ 1WJDA 4HF0A 4QIWN 1W5TA 4IHSA 2YU9J 5HS9A 1S5LC 5J1YA 2QBYB 2IEKA 4A12A 1D5VA 1XS9A 3V8LA 2K4JA 2F5VA 4M3EA 3BG6A 1Z1DA 2ZKZA 3PM1A 2VL8A 1V55H 4A5NA 2HQNA 3BR6A 4A3FJ 1XGMA 2PMZA 1ETYA 2O9LA 3QWLA 4CDGA 3J81Z 4IQ4A 3H1CA 4KMUX 3NEUA 1DGWY 3RKXA 3K2ZA 3DLAA 1JJ8C 3AKZA 1IAWA 4V2GA 1TQIA 1TT5B 2EFQA 5FB2A 3TMOA 1FMWA 4FE7A 5IOYA 3HIFA 4RAYA 3BC8A 5BOXA 1QQIA 1TWFJ 1UZCA 1I27A 4GO1A 4P5OA 3OWTA 3ZMZA 4CCKA 2DTRA 4NB5A 3KYCB 2MYSA 2RC4A 1BIBA 2BBYA 5FKMA 3K6GA 3D5RC 3GTQJ 2K7LA 1ERDA 2AQEA 5H6QA 1OJLA 4MFEA 4O5VA 2L02A 1MD0A 1SFOJ 5J1UA 4A3CJ 2LBFB 2JN6A 3LFKA 1HKQA 4N9HA 2EBIA 2XB5A 2A69F 4EM2A 2QM3A 2A68F 3A1YA 3OR1C 1LJ9A 4KT5C 2A05A 4RB0A 2GIZA 1E3PA 1VTNC 1RI7A 3OR2C 1Y0NA 2E5ZA 4KISA 4JBAA 2IVMA 3ML6A 4UHTA 1G59A 3ABMH 3KEOA 3CJRB 1X3UA 3LQRA 3P9CA 1IF1A 4LIUA 3I9V2 3OS1A 2CS3A 1TL8A 2X6YA 4GYIA 5M5XJ 1XGNA 1KONA 1ZAOA 3E6DA 1OR7C 4DQ2A 1B9NA 1TNTA 2JRTA 2DOAA 1YHQI 1O3TA 2EINH 3L2VA 1VQ6I 1UG2A 3GW2A 4HQEA 2EIMH 2VONA 4UV9A 4BQAA 4IOCF 1FYKA 5GPCA 2ZNYA 1IDZA 2KPMA 5E8GA 2B63J 2PX9A 4KIFA 2W57A 1J0RA 2K02A 4M72A 3H0DA 1R9TJ 2H1KA 4AVZA 5BS6A 1KQ9A 2W24A 2VJIA 1HDDC 2DMQA 1BC8C 2H27A 2MC3A 1R22A 3JAMK 2O3FA 3BR2A 4CYCB 3I64A 1E3HA 2K4BA 4G6DA 5A2QZ 2XB0X 4ESBA 1R4NB 1TW3A 2R7TA 3HHGA 1FSHA 2BY3A 5F0FA 2XPVA 3V4GA 2A5YB 1LFPA 4ENJA 3OYJA 1W36C 1XMAA 4NC8A 1PDNC 5ICFA 1H0MA 1YX3A 3KX2A 2JA5J 1O7LA 4M3FA 2DOFA 2GA1A 2CO5A 2LDUA 1LPQA 3OL3A 3GTPJ 1MBGA 2P8TA 2QWWA 3MKWB 2DA6A 2YR2A 3KYLA 1XX5A 2YSRA 3PUBA 2NS8A 3K10A 2H09A 2VT3A 3IKTA 3JREA 3A02A 2RDPA 1N75A 2Y30A 3LA2A 1LDJA 1LKXA 4PSXA 3I4NJ 2ZNZA 4WK8F 2YPRA 5IYDJ 2B9SA 1DU0A 2IAIA 3RTRA 3U9GA 2VOOA 1YX5A 1P2FA 2JTVA 2EIJH 2X48A 2VJ5A 4OINF 5M5YJ 4RGUA 1XCBA 5K1YA 1JGSA 2GAUA 2KIFA 3DV8A 4IJAA 3JSOA 5FLXZ 2DJNA 1T8IA 3CP2A 4HRIA 3LAJA 1OCPA 3SJMA 1J9IA 3KEQA 3C2HA 3HDDA 4AC0A 5GP9A 2DPDA 3GVAA 2K9SA 3ZQIA 2I8DA 3MKLA 3BPVA 3T0YA 2DA7A 4RGXA 3CCQI 3K69A 4M9ZA 1BR2A 3FXJA 4XSXF 3ECHA 3K7AJ 2ID6A 1FJLA 1ON1A 3K1PA 3ABTA 3IAM2 4MTDA 4F52A 3HTUA 4OIOF 3TL4X 3W2WA 3S3NA 2PJRB 1R58A 4I0AA 2DA5A 4ZYAA 1IJWC 4U7DA 1WI3A 2LOOA 4A6DA 2V4JC 3CC7I 1A04A 1TLHB 1XG1A 1U6GA 1E0EA 4E7ZA 1MMDA 4HG2A 4L9NA 3IRQA 2HVQA 3PFIA 1NG7A 4HZFA 4Y3OA 3LAPA 3UNGC 1IG7A 5DM7F 1BIAA 2W48A 5DUIA 1VQOI 3OYFA 4PJLA 5F04A 3F9KA 5BPDA 3OYCA 3TEDA 2M1BA 1XGSA 3S16J 4BEHB 3Q9SA 2CGPA 4PGHA 2IW5A 3TP3A 4PGGA 2LG4A 4BL0B 2FOWA 3WU0A 4PFPA 2BGCA 1B8IB 1K83J 3BTIA 1VQNI 1T0FC 3B6CA 5FFZA 1RNLA 3HOUJ 1FP1D 4B3AA 3MN2A 3JTHA 3V8JA 1JKQC 3CUQA 1GXPA 4MLOA 3M9AA 2DK8A 2CJJA 1ON2A 4LJZF 1PP8F 2WB1A 2KZVA 1TWAJ 2ZO4A 2R3SA 3F3XA 4N4OB 5IP7J 3ASOH 1GXQA 4DBQA 4ETSA 4HX7A 3FKJA 2VKDA 2VASA 4HV5A 2GXGA 2CV2A 1OISA 4XK4A 3BR0A 1BC7C 4BDZA 1WJ5A 1VQLI 4YG2F 3ZQFA 3TBIA 4R79A 1X1CA 4DJAA 1ETXA 3BP8A 1RC9A 1ZARA 3L9FA 2ZMEC 4AVPA 2CMPA 4ZDOA 2DJIA 3HM5A 1XN7A 3M1EA 1LNWA 3C7JA 5EDNA 1ZRCA 2RQPA 3OYMA 2VC0A 3G73A 1BJAA 2X1DA 3KE2A 4XL9A 4ZDLA 4BJ6C 4U0VA 1H9GA 4LB6B 2HYFA 2CG4A 5E20A 5EG0B 3PNTA 3SEQA 2W7NA 1HQCA 1QU3A 2ECCA 1X3ZB 4MO7A 1Y8RB 2VUMJ 1QRYA 4FTHA 1KU2A 3ZP5A 5JI6A 2V1DA 1Y0UA 3ZMVA 5LHIA 1EH6A 2OJED 1D5YA 3HRMA 4QLCU 1JKPC 2QENA 2JK3A 5K5RA 2VBXA 2IP2A 4B44A 3Q9VA 3A01B 4LD5A 3HOXJ 1R5GA 3SFZA 3I3LA 2M2EA 5C4XJ 1X1AA 3F23A 1Z77A 2KQRA 4PJJA 4XLAA 3L09A 1LDKB 2G7HA 4XKCA 2PBIA 1QHHD 3KP6A 1MMSA 2ELJA 1FLIA 3MD2A 2C6YA 1V3FA 3VPRA 5DD4A 1HKTA 2LRDA 4RM2A 1GVJA 1MGTA 3JR9A 2MH2A 2DK5A 4CCMA 5D6EA 1R5ID 3H0GJ 3FDYA 3LSMA 1EV7A 2P4WA 4L9VA 4XONA 1IXRC 5HNFA 2A6HF 4RGRA 1S72I 4LB5A 1HSJA 5IT9Z 2AXTC 3BZCA 5K5OA 2E35A 3RQ4A 4B1RA 1YTYA 3WTSC 2JT1A 3QOPA 1W7PB 1EH8A 4HX4A 2DDBA 4ZYGA 2JRMA 2E1OA 1BN5A 1ZLJA 2W1OA 4II3A 1SAXA 2BHYA 2IGKA 2XRLA 3BROA 2DBBA 4M71A 5JLWA 2ELKA 4G8XA 3PUFA 4UUVA 3WHBA 4CUGA 3GTOJ 3B02A 2OTLI 4M6YA 1NK2P 5LHHA 2PMHA 2UV1A 1IN7A 4P9FA 3L2RA 2FA5A 2STTA 5LD2C 2XF5A 4CH7A 4LG0B 4BS9A 1MNEA 2XVCA 1U2WA 3S1QJ 2KHMA 1U9OA 1YJ9I 2NVUB 2WWYA 4NC6A 1MBKA 5CLSA 3N4MA 1FBUA 3LWFA 2HXOA 2ESHA 5KAFC 2RV8A 3J7AO 5LGNA 1HBXG 2EFWA 2CQXA 3H35A 3HGGA 4LK1F 1BOAA 3F8NA 4ABZA 3S8PA 2QBYA 2Y75A 3S2DJ 1I6HJ 2XSDC 1IV8A 1WJFA 2WC2A 1JE8A 3TO7A 1L0OC 3HHHA 4A3MJ 2GXAA 2E36A 1OKRA 2X6XA 3GO5A 4GCVA 3BLYA 4UVAA 4EGYA 4IQJA 2FBHA 4UY8I 4QPQA 2H6BA 3TO6A 4C2TA 4HF2A 3WGIA 3S14J 3GXOA 1XDUA 4D0PA 4PFOA 1RKWA 3GZNB 1YFHA 4S05A 5E3LA 3OYHA 3G1OA 3VYUB 1BI3A 2CFXA 3KZIC 3PJRA 3GCMA 4C3HJ 4BKXA 3EYIA 2M45A 2OZ6A 4EVIA 5H2FC 2JSCA 3BZ6A 5LRRA 2B0LA 4RA2A 3GUDA 1Q1VA 1G6NA 1WVRA 1TP4A 5F08A 1FPQA 2AHQA 3A4CA 3FXLA 3HL2A 3HKZN 4YIFA 3OYKA 3G1MA 3FIWA 3HC7A 4KUMA 3K1MA 3HTSB 1GHCA 3G1LA 1O3SA 1E17A 2XDVA 4A2UA 1N78A 2KT0A 3BTLA 2ZFWA 3HUGB 4QSHA 2LBFA 2D5VA 5GADJ 1KGSA 1VF9A 2HNHA 3C1DA 2LD5A 3L2UA 3LSTA 3CF2A 1ZGWA 1I3QJ 1SVMA 1WWXA 2BW3B 5GAHJ 2QSHX 4EM0B 3L2QA 4JX4A 3S15J 3CMAI 5GTHC 1MIJA 2OC6A 4IHVA 1Q1HA 5DDGA 2E2JJ 3W3CA 3OOPA 2Z99A 3GTMJ 1YG2A 1KQ0A 1J59A 1X1PA 1DUXC 1OCZH 2IPQX 4BY7J 3U2RA 4EM1A 3M4OJ 5FFXA 2QQBA 5B1BH 1YJNI 3FK7A 1ZYRF 1W1WE 1RR8C 3V7SA 3H9JA 2O61A 5HS8A 2E1MB 1K7AA 3QYEA 2NVYJ 4L5EA 4PUSA 3ZQHA 2L9SA 5F6FA 1UFMA 2MLKA 3ELKA 2ZBKA 4XRSG 4KITB 1APLC 1KU7A 2Z3YA 3Q0UA 1KYZA 3U21A 5ICEA 1MH4A 4UB6C 2VBZA 1RESA 2EFNA 4E7JA 4F7ZA 1F43A 1EKEA 1HDPA 3QRFF 4CYCA 3CLQA 1JTYA 1VQ5I 2R5ZB 1O3RA 5E1WA 2GLOA 3H9QA 2PN6A 5JLXA 1ZELA 2LY9A 3EUHC 2BE5F 2RNGA 2XC7A 1Z0XA 2L7FP 2VIXA 3BOQA 2DTZA 3UR3C 1FSEA 2OCCH 3KP7A 2K27A 2YUSA 3H9GA 2ZXIA 2VPLA 3AL0C 3CDLA 4KJZA 4A3KJ 5KHDA 2VXDA 5TJJA 3BG9A 1E2XA 2ZMEB 3LNQA 1LQ1A 4KMFA 1DQUA 1SANA 4A0YA 3BG3A 4RBOA 4D5FA 2NVTJ 2ZXHA 2JA6J 3FBNB 1USSA 3D1NI 2Z33A 4RS8A 4HYEA 3TQNA 1LDDA 3GX4X 2PQ8A 2L9NA 3HXLA 1WSUA 1WHUA 2FRHA 2ISZA 3I54A 3ZQQA 3OYBA 4FHTA 4C2MJ 5IYCJ 5CJ9A 2XAUA 2L4MA 1RPWA 5DCFA 4PZJA 2F4MB 4CGZA 2Q2EB 4OOIA 2GOMA 4ESFA 2IGMA 4V2FA 5FRMA 2E34A 3F8MA 2WV1A 3R6SA 2G7UA 3I59B 4GXOA 5HLHA 3LSJA 1W4MA 3I56I 1RZ4A 2X4HA 2NOGA 2KDOA 4A3GJ 4UVBA 1KYWA 3GFMA 5K5QA 4UUSB 2IA1A 3EUAA 1ZHFA 4EJVA 2DW4A 3CMYA 1IRGA 5ERIA 2PJRA 3IHUA 2OQGA 3U1KA 1ZR2A 4RB1A 4X0GA 3GEZA 2HWVA 4V19K 2XSJC 5LBQA 5JHFA 2X6WA 1K79A 2JUCA 2BY2A 4CCNA 2IJLA 3CLOA 2QYOA 3DEWA 1D1CA 4NUBA 3CJNA 2KIQA 2H1LA 2F4OB 1WPKA 4ZH4F 5ILVA 3E6CC 5IT3A 4D9JA 1UAAA 4J01A 3L2WA 4C3JJ 1SD4A 2RVCA 3FM5A 3HG9A 4BEHA 1BI1A 1FOWA 4M3BA 4BJ5C 3M3YJ 4B8XA 3KETA 5BNGA 4GYGA 1FEXA 2FQ3A 3H5AA 3UKGA 3CMEI 1MSEC 1PYVA 1I39A 1TQMA 1D1BA 1GLNA 2JPBA 3ONQA 4I99C 1CQTA 4PJMA 1B8IA 4CYDA 2ZXJA 2QVOA 4MIMA 1O3QA 1EH7A 5F1RA 2YU3A 4BYYA 2O7OA 4HLXA 1G3SA 2QQAA 1X2NA 2R4GA 2HDDA 2GA2A 2DT6A 3FM3A 1UCRA 4HSRA 2BHZA 3E3VA 4QWQA 4X1EA 3SXYA 1RETA 1ZG3A 3BR1A 3ZGKA 2PLYA 2M0MA 2D2WA 2KISA 2F5CA 5F27A 2IGOA 3LSRA 4IHYA 2MA3A 3HGYA 4RAZA 3AG1H 2OTJI 4WWCA 2ZJQF 2HQ5A 1L3LA 2UXNA 1BL0A 2FOKA 4DYRA 2NOJB 4O3MA 3FK6A 2KFDA 2VB6A 5M3MJ 2LVSA 2DFHA 5JHUA 2DFFA 2IGNA 2NS7A 3LSPA 3CF5F 3A0HC 2Y0SA 2Z16A 4MFDA 2QCOA 2FMYA 4BQQA 4XSZF 3QQAA 1XSXA 5J1RA 4A3EJ 3ZMTA 3I5UA 2OUMA 2CYYA 1VQMI 2MH9A 3WTZA 1TTYA 5EG0A 1R6RA 3F21A 2VKVA 3QPHA 1IUFA 2L0KA 5FD5A 2CSOA 2O8KA 2A07F 3OYDA 4Z6YA 1R1UA 1VFCA 2L9RA 2MBFA 3A01A 2DI3A 1NK3P 2CH0A 1H89C 4ZTJA 4X6AJ 2V79A 3LSKA 3L7WA 1A36A 4I76A 2O03A 3FZVA 3BTCA 1IN6A 4C30A 5KCMA 1VQKI 3CD6I 3K9TA 3GTJJ 1BA5A 1IXSB 4M3GA 3ZMUA 3HOVJ 4W1UA 1JHFA 4K2EA 1QPIA 1T98A 2JVGA 4ZJZA 3WU1B 5E3OA 3W6JB 1XD7A 2P7CB 4HPQA 5FKOA 5E8IA 1X19A 4XKVA 4D1QA 2VE9A 5IYBJ 3EUKL 3KP4A 1YI2I 5H20A 3JAMZ 1BM9A 4FETA 4RB2C 1U78A 2LMDA 1AA7A 4Q4ZF 3BCAA 4LITA 3S2WA 2K9QA 2QF7A 4HOBA 2EJRA 4UVCA 5DTDA 4FQGA 2P5LC 2I5UA 1W7PA 3WU2C 4M6XA 5L3BA 3B73A 2XGXA 2Q1ZB 2L01A 4WXHA 4LLLA 3ERED 3PL8A 2E7XA 1JGGA 2Y31A 1USTA 1TC3C 2DLLA 1TBXA 1H9TA 3N97A 2VBWA 4KDPA 2FEZA 4P1WA 1HW1A 3VEPA 2XAJA 2EZLA 5EGOB 2G0EA 1Y39A 4LG0A 4RDUA 4RM3A 1ZRFA 2STWA 1Y6IA 1IRZA 2VXZA 2Y69H 3LA7A 5B1AH 1OQYA 1QVUA 1Y8QB 2RQQA 3L00A 1FOKA 3ZQ7A 4RLQA 4L5JA 2XF6A 3HOWJ 2NNYA 4XLNF 3BJ6A 3BQYA 4BAYA 1S7EA 2LNBA 4LLGF 4XKBA 2MG4A 1QA6A 5TRDA 1MKMA 2R7WA 1FZPB 1WFXA 2QZ8A 4QTRA 5CQEA 5CVUA 1WKMA 3HOSA 3K70D 2DXIA 3HBLA 1GV2A 1G3TA 3WTYC 4ASNA 2IT0A 1SD5A 2EV5A 5D5XB 1T95A 1S29A 4OAYA 3DU6A 3FMRA 3ZPLA 3RPQA 3CZ6A 3W2VA 2FUG2 4ZTFA 3E6BA 3V42A 2XPUA 1XC5A 2A6TA 1MBEA 1X58A 2X0LA 4XOPA 3DF8A 5HODA 5L3CA 4A3DJ 2HU9A 1MSFC 2DFEA 1YJWI 3O8GA 3VYTB 5EEGA 1NH3A 3GFLA 3HUGA 4IHXA 3K1NA 1I3AA 1KA8A 4DBRA 1SFKA 2ZJPF 5CYVA 5J4YA 4G94A 5E3MA 2BW3A 2M7BA 3H3ZA 3M8EA 3B6AA 3W6KB 1FOXA 2YX4A 2XKOA 3VSLA 5AONA 1Y1WJ 4BGDA 1SEUA 4I02A 2EH3A 5HDGA 3C2BA 2EQRA 4XLFA 4M9XA 2B7EA 2GWRA 3BJAA 4MQ9F 2NXNB 4WXDA 4I09A 4IZZA 2R7RA 2ZXWH 5DEQA 4YFNF 1JUMA 3WHCA 2L7KA 3FXOA 4HA8A 1LUJB 3JRIA 1FYMA 4BXUA 1M1EB 1ZRDA 3RKWA 4LMYA 2HQAA 4XKWA 2R7SA 4G6TB 1P4XA 6PAXA 3HOZJ 4HDVA 3M1CA 1B9MA 1UHWA 3ZN1A 4U87A 2EFOA 4L9TA 4AIDA 3TGNA 4XLPF 3TOBA 2WAQN 1ZKGA 5KNLA 4EGZA 1IV6A 3OIOA 3E5UA 1YLFA 5J8CA 2JA7J 3DEEA 2CV0A 2A6EF 3JRAA 4BACA 2HR3A 2R5ZA 2JSPA 3O3KA 3R61A 2JQ7A 1R4MB 2QLZA 4OMZA 1VI0A 3ABKH 2CW8A 2BYVE 5EJCA 4I0BA 3H5RA 3HEFA 4C3IJ 5HS7A 3WTWC 4E6KG 4PSWA 2COBA 2OF7A 4G12A 4I2OA 3WTVC 3PQJA 3R60A 3GFIA 3QPTA 3T8TA 5D5UB 5E79C 2M34A 2RN7A 2AO9A 2ZMEA 3RSNA 2E5NA 2EZIA 3Q0VA 1R7JA 3WTTC 3K0LA 4HX8A 3C2GA 3CUOA 2K9LA 4ZDPA 4XOTA 4JOMA 3MMYB 1IZ1A 1UELB 1K6YA 1VQ4I 1W7PD 2W00A 2KIMA 4UXNA 5HNHA 3NWTA 1YS6A 3ABLH 2F4IA 1D1AA 2Q0OA 3HRUA 2M3AA 2LTPA 5ICCA 4YFKF 4GGGA 3CUQC 1S7OA 3BPXA 4HBLA 2H6CA 2DMNA 4XN0A 2KRCA 3R0AA 2Q2EA 2Y2ZA 3NQOA 2TRTA 3I59A 2JUGA 1YW9A 2XV4S 2F5EA 2FNAA 3QYBA 2XROA 2IS2A 2QSGX 2XGCA 2Z1DA 4KT6A 4UUSA 1W36D 3FMQA 2LLKA 1X3WB 1IN8A 5IPAA 2CUFA 1AWCA 3QPLA 3SZPA 1VNDA 4IO9F 4LG3A 3KFWX 1JXSA 3PFYA 2RAEA 2VODA 1QGPA 3S32A 3WODF 1IXCA 2JZYA 4F91B 1I1SA 2O5RA 3DWLE 5KK1A 3GYHX 1S8NA 1MNDA 3H3UA 2XUBA 4XLEA 2OCEA 1LE8B 2K3FA 2HVRA 2XAGA 4KIGA 2LKSA 5IY5H 3DBLB 4YEJA 3GTKJ 1OCRH 2P6SA 2F5FA 5DCMB 1FWZA 4XM3A 5ED4A 2HTSA 1JT6A 5D6FA 1K4SA 1KZHA 3DTIA 3H5NA 4IHTA 1MDMB 4RAFA 2CRGA 2R7ZJ 3IUOA 3DLLF 2QKMB 1ZR4A 2X1EA 5DUKA 5FLMJ 2LC2A 2WA0A 3DPUA 4IXAA 4F92B 3JRBA 3M8JA 2M87A 3CCYA 3N05A 5C3EJ 1JKOC 5HOOA 3D0SA 3RPUD 3MAJA 3CJTB 2QKLB 3GLXA 3LA3A 3ZOBA 2VQLA 3E5XA 1IO2A 2AQFA 2HKOA 5L3FA 3FXKA 4E7KA 4ENKA 1X1DA 4A69C 1NTCA 4AU7A 1LFBA 4FCYA 1DP3A 1MBHA 5LGTA 3Q3SA 2LY2A 3KLNA 3IC7A 5C44J 5ILSA 1F5TA 3W2AA 3LOCA 1MJAA 2M8EA 2XAHA 4KA4A 2DA3A 3QU3A 4ZYDA 2A5WA 3CCRI 2VE8A 2VLAA 4BDYA 2PMZN 1JHHA 1FP2A 2V6EA 5CVJA 4IL6C 2AXLA 1ZG1A 5FRNA 3KZZA 2YX7A 2X9DA 4YFXF 2LKXA 2Y9YA 4JP0A 1SVOA 1WH7A 3HRSA 3ZRGA 4BJTA 3ZQCA 3ABUA 3SYTA 3ULQB 5CVIA 4CCLA 2Z5UA 4ZZDA 1ZGAA 2CQKA 2HI3A 1PJRA 4A93J 2V9KA 1G3YA 2E2HJ 3BQZA 1S9HA 5D5WB 1HF0A 1FX7A 2VBYA 2DU9A 1ZG5A 3JTGA 3DKYA 1F1ZA 3OSGA 2VQCA 5HLIA 2CUZA 3G4SI 1J09A 1FBQA 2HXIA 4P96A 4A3BJ 3AG2H 3DCFA 1XSVA 1Z3XA 5JVTA 3TW7A 3VYRB 1LVAA 5E1XA 3WG7H 4YRVA 4AIKA 2NAZA 1U5TC 2LY1A 5LEJA 1J2XA 5EEHA 3BR5A 1YRNB 2F2EA 1P92A 4LLNA 5LFAA 4DGWB 1GT0C 2VQGA 3F8CA 2EZKA 1AKHB 1RUNA 5L3DA 1VQ7I 1OLTA 1TWHJ 2OAZA 2WY7Q 4BUPA 3IH3A 1FTTA 2KP6A 3AFHA 5CVRA 4XRSA 4KNYA 4UV8A 5HLGA 3OL4A 1TWCJ 2QA4I 1P4AA 2M30A 3ASNH 3PIPF 4BE2A 1BR4A 2OPTA 1MMNA 5M3FJ 3VWBA 1HSTA 2KIUA 1I1GA 1JTXA 1SD7A 5EGOA 4Y52J 2Y0MA 4XBFA 1OCTC 1ZGJA 2VKEA 2MW8A 1Z7LA 4OWRB 5FKNA 1QBJA 1TZLA 1CGPA 3PNYA 1HCRA 4C2UA 3LL7A 1BI0A 1FNNA 3E0JB 5CKTA 3TDUC 3RKQA 4FT8A 1B72B 4AD9A 1U3EM 3VODA 1ORKA 3SQNA 2ACJA 1ZLKA 5FROA 2KKOA 4B3XA 3RJPA 2P0WA 3PO3J 2ZSIB 4Z2YA 3ZMSA 1PUEE 3VYSB 1SMTA 2EWNA 2O0YA 2F5DA 3PSIA 3ZQGA 2K85A 3A0BC 2KL4A 4RB3C 4L9JA 2L5QA 3CCSI 3Q5FA 1SFUA 2OZUA 4TV7A 2HEOA 1W5CC 2GZWA 3OS2A 3T5XA 2D1VA 4H4KC 2EIKH 3T8RA 1QZZA 2LF8A 4U88A 4CSWA 1FIAA 1YIJI 1S7AA 3KP2A 4XRMA 4II2A 3GZ6A 3E97A 1D0XA 4JX6A 1W0UA 3WE3A 4O6JA 2IS4A 3ECOA 4U0WA 3J80K 1H88C 3M07A 1REPC 1VQ8I 4MHGA 2EZHA 3TP0A 2VI6A 2FXAA 4F93B 3EQLF 1TW2A 1A31A 4WX9A 2CU7A 3TO9A 1DDNA 3G3ZA 4A0XA 1MMGA 1BR1A 2ELHA 2EV0A 2DN0A 2KZGA 2OQRA 2HYGD 2ESNA 2O8XA 2XRNA 3DKWA 4HV6A 4L0ZB 2DMUA 3V8KA 2Z2SB 3HSEA 3DBHB 1RIOH 5E1ZB 4M3DA 4D7NA 5EZHA 1FMVA 1OCOH 4OAZA 4E7LA 2IS6A 2MLGA 3CTAA 4I01A 4LFUA 3R4KA 4FX4A 3BY6A 1U8BA 1C0WA 2ZC2A 1ACIA 1QZEA 1UB9A 4KN4X 3OYNA 1FIPA 3RCOA 1ETOA 2PFBA 4RAGA 3HOTA 1XCVA 3M8FA 4IOAF 1QNTA 2M0CA 2HFHA 1MJ9A 4I6ZA 3BR3A 4GDFA 1RKTA 3AG4H 2BY0A 4I98B 2E1CA 2E71A 2K9NA 4NBQA 1K4TA 3S2HJ 4AWXB 3V7CA 2BXYA 2K40A 2BV6A 3S1RJ 4GFBA 4G7ZF 1IN5A 2DA4A 3AG3H 2YS9A 3QPSA 1K6OA 2L9VA 4D5CA 2ETHA 4P9UA 1R71A 3A03A 2ZJ2A 1SMYF 3S3OA 2HS5A 4NDLA 2GIVA 5B66C 3DU5A 2HYJA 2KJCA 3DTEA 4B4CA 1PUFB 4BQNA 1HW2A 4NHJA 2NVQJ 2R5YB 2PG4A 3MQ0A 4HNTA 4S0HB 3K70C 3OYAA 4YIIA 3RQIA 3IH2A 3JRDA 2WBMA 3HJEA 5ICGA 2WB1N 4BHBA 4BNCA 3F6VA 4DW6A 4XLHA 3F8FA 3I58A 3OYEA 3O2PE 1OMIA 1YW7A 1R1TA 3T1BA 5K7FA 2FBIA 4NQWB 4DYCA 3DPTA 2R7UA 3E5QA 1P6RA 3ZR8X 1G4DA 1MBJA 2LH9A 2JA8J 2ICWG 3KYDB 5DYMA 2P7VB 4U7BA 2HKXA 4KN7X 5LLQA 1J75A 2W82A 1T56A 2D45A 4YELA 2EV6A 2WV0A 2XKPA 3DQVC 3IKVA 2KJBA 3GWZA 3CC2I 4Y13A 2TCTA 4MNUA 1WJAA 2DFIA 2VOPA 3K4NA 4HAMA 2GOXB 2EFPA 3F72A 3JSPA 5CPRB 3F8BA 2CUJA 2ZJRF 3CESA 1T33A 4PJNA 4QPOA 1YE9A 3QYFA 1IRFA 2W85A 1QHGA 1AOYA 2M7AA 3CMMA 4IX7A 5D4SA 3QP6A 3KEYA 2RKHA 1U5TB 3MKYB 4IHWA 1U9NA 1TNSA 2ZB9A 4I7HA 4G9YA 3ZXSA 4AYBN 2CUEA 5HVQC 3TOAA 1IDYA 3JRCA 1GDTA 1Y1VJ 4B47A 3HKZA 2L7MP 1MH3A 4WF2A 2RNJA 2Q8KA 4B43A 3FXQA 1UG0A 4E70A 2DO7A 5IP9J 3BCBA 2HGCA 3MCZA 3CO6C 1LVKA 3FMSA 2HOTA 4UNOA 1STZA 2DCEA 1LE8A 5EEAA 1UHMA 3OYGA 2LR8A 3G6EI 2R7FA 2L3DA 2UWMA 1OR7A 5EZGA 1CF7B 1A35A 2HDCA 1A6IA 1B6AA 1OYWA 1XDSA 3IWFA 5DCMA 1YOVB 2FD5A 3F0CA 4G7HF 1G2HA 1X4PA 4NNJA 1DGRM 4ZYEA 4XN3A 1D8KA 4ITVA 3CP8A 2JMWA 5EYRA 1MDMA 3J81K 4PDKA 1Z67A 1XGOA 1U8RA 3KP3A 4E7IA 2I10A 1NG6A 3PQKA 2K86A 2LSOA 4LOCA 1F36A 3KLOA 2CQ7A 1GV5A 1Z6TA 1DU6A 1GVDA 2CWEA 3HZJA 3OMYA 1FYLA 1S3JA 4GRIA 3K4CA 2M9HA 2HZDA 2X51A 5F1JA 1V4RA 1ENHA 2VKHA 2LYCA 1YW8A 2FF4A 3O6BB 5JVGF 3OV8A 3AL0B 2WTEA 3VOEA 2W84A 5GAEJ 4YIRX 4Y17A 4ENNA 5BQTA 4JYKA 2W4SA 5FJ8J 5FKLA 2DPUA 3I0TA 5GTIC 2OA4A 2QQ8A 3SZTA 1PVEA 3IWZA 4G7OF 3DXJF 4HF1A 2V9PA 3QODA 3ZCOA 4A5MA 2JA2A 5DS9A 1VZ0A 2PMUA 1ZN2A 5FD6A 1WRJA 2EA2A 4L5IA 4L18B 3HB9A 1A5JA 1SAUA 4J00A 2MFZA 2P5KA 2DDAA 1K61A 1N77A 2R7DA
chains in the Genus database with same CATH topology
2NVYJ 4L5EA 2H8RA 3ZQHA 2RAEA 2Y9ZA 4XRSG 1APLC 3Q0UA 1ETKA 3BT9A 3GTLJ 1MH4A 5E3NA 4HNVA 1ZK8A 1RESA 2FJ1A 1LE8B 1F43A 1P7IA 4QIWN 3GTKJ 1HDPA 2YU9J 1YRNA 5J1YA 4CYCA 2IEKA 1XS9A 1JTYA 4M3EA 2R5ZB 4DZJA 1AKHA 2GLOA 3PM1A 3BG5A 3BR6A 1JT6A 4BBRJ 5JLXA 4A3FJ 1ETYA 2O9LA 2LY9A 2CRGA 2KDZA 2R7ZJ 1MNMC 1Z0XA 2L7FP 1ZR4A 2DTZA 5FLMJ 1JJ8C 4V2GA 2YUSA 3JRBA 1IGNA 3CDLA 5IOYA 3CCYA 4FE4A 4FE7A 5C3EJ 1JKOC 1WCMJ 2R92J 4A3KJ 3BG9A 3LNQA 3OSFA 3ZOBA 1TWFJ 1SANA 3BG3A 4RBOA 4D5FA 2E19A 5FKMA 2JA6J 2NVTJ 4A69C 3GTQJ 1NTCA 1LFBA 3D1NI 4FCYA 1MBHA 1OJLA 3Q3SA 1WH5A 4MFEA 1B72A 1AU7A 1LFUP 3GTGJ 5C44J 1SFOJ 5J1UA 4A3CJ 3LOCA 1ZQ3P 3W6VA 2JN6A 2HOSA 1OFCX 2EBIA 4C2MJ 2XB5A 5IYCJ 4BXXJ 2DA3A 4A3LJ 1RPWA 2JWTA 4V2FA 2PMZN 2WV1A 3IV5A 3LSJA 4JX5A 2X9DA 3S1MJ 2NOGA 2LKXA 4A3GJ 2Y9YA 4JP0A 1WH7A 3ZQCA 4UUSB 1ZTRA 2GM4A 3CMYA 2HI3A 4A93J 2M8GX 5M5XJ 1ZR2A 2E2HJ 3BQZA 2FQ4A 3K2AA 1HF0A 3O8HA 3GBGA 4DZPA 1UG2A 3OSGA 5GPCA 5F0CA 1IDZA 4A3IJ 3DEWA 2HXIA 4A3BJ 2B63J 3DCFA 5GPAA 3TW7A 2R0QC 1WPKA 3ZQLA 1R9TJ 2H1KA 4C3JJ 2XGEA 1HDDC 1POGA 2DMQA 3BR5A 3M3YJ 1YRNB 4M3BA 4UUTA 3BR2A 5BNGA 4D7MA 4CYCB 1FEXA 3UKGA 1GT0C 1MSEC 2EZKA 1AKHB 2MSYA 2XB0X 5K7HA 1CQTA 1B8IA 1TWHJ 2FX0A 3IH3A 5F0FA 2XPVA 4MIMA 1FTTA 1P7JA 4XRSA 2O7OA 5J3LA 1TWCJ 1X2NA 2JA5J 4M3FA 2OPTA 5M3FJ 2HDDA 3GTPJ 1MBGA 1JTXA 2DA6A 5EGOA 4X1EA 2DA2A 4Y52J 1OCTC 3JREA 2NS8A 1RETA 2VKEA 2MW8A 3A02A 3BR1A 2Y30A 5FKNA 1HCRA 1BW5A 1AHDP 5F27A 3LSRA 3I4NJ 4IHYA 3HGYA 5IYDJ 3RKQA 1B72B 2HQ5A 2IAIA 1DU0A 1ORKA 1BL0A 4DYRA 3FK6A 2X48A 5M3MJ 5M5YJ 2LVSA 3PO3J 3PO2J 2NS7A 3LSPA 2DJNA 3FISA 4MFDA 2QCOA 1OCPA 3SJMA 3HDDA 3QQAA 4AC0A 2L7ZA 2MGQA 1PUFA 5J1RA 3ZQGA 5GP9A 2K9SA 3ZQIA 2R5YA 4A3EJ 2IBDA 3MKLA 2DA7A 5EG0A 4M6VA 3HOYJ 2VKVA 3K7AJ 1IUFA 2ID6A 2L0KA 1FJLA 2O8KA 1VFCA 1FIAA 2X6OA 4XRMA 2L9RA 3A01A 1TWGJ 1NK3P 9ANTA 1H89C 4X6AJ 4JX6A 1W0UA 2DA5A 1IJWC 4I76A 1WI3A 1H88C 3BTCA 1XG1A 3GTJJ 1BA5A 4M3GA 2EZHA 3HOVJ 3BTJA 4W1UA 2VI6A 3TP0A 2DMPA 1QPIA 1IG7A 2W48A 5E3OA 5F04A 5FKOA 2DA1A 2CU7A 2Y0SN 3TEDA 5IYBJ 3S16J 2DN0A 3S17J 1RR7A 1U78A 3TP3A 2DMUA 3RZDJ 2K9QA 2QF7A 4M3DA 3JRFA 5DTDA 4D7NA 1ETQA 1K83J 3BTIA 3B6CA 1B8IB 5EZHA 3HOUJ 4B3AA 1JGGA 2R93J 3MN2A 2Y31A 1JKQC 1JT0A 1TC3C 4MLOA 1U8BA 2CJJA 2LP0A 1JUPA 1TWAJ 4FISA 1FIPA 2EZLA 5EGOB 2G0EA 2P81A 5IP7J 4RDUA 1ETOA 2M0CA 4BBSJ 1IRZA 4I6ZA 3BR3A 3NARA 1RKTA 4XK4A 1QVUA 3JRHA 3BR0A 1ETVA 2K9NA 3JRGA 1W0TA 3S2HJ 2NVXJ 3SDGA 3ZQFA 5F0HA 2K40A 3S1RJ 4GFBA 3RZOJ 2DA4A 3QPSA 2YS9A 1ETXA 4D5CA 3HOWJ 3A03A 3HM5A 3BQYA 1S7EA 4NDLA 3NAUA 5EDNA 2MG4A 2HYJA 3MVPA 4B4CA 1PUFB 3OOUA 4QTRA 1QVTA 2NVQJ 2R5YB 5M5WJ 1JJ6C 3HBLA 1GV2A 5EF6A 5EG0B 2ECCA 4S0HB 4MO7A 3RQIA 2VUMJ 3IH2A 1QRYA 4FTHA 3JRDA 2WB1N 1D5YA 1JKPC 4DW6A 1UHSA 2JK3A 5K7FA 1GUUA 3A01B 2LFBA 3HOXJ 3I4MJ 1I50J 2XPUA 4DYCA 2M2EA 5C4XJ 1Z77A 2JJ7A 1XC5A 4XICA 1MBEA 1MBJA 1X58A 3IH4A 5HODA 2JA8J 4A3DJ 3VPRA 1MSFC 1EF4A 1FTZA 3O8GA 3JR9A 1T56A 4IHXA 3H0GJ 4AUXA 3SFIA 5E3MA 1WGXA 1E3OC 3B6AA 2TCTA 1Y1WJ 1MBFA 4B1RA 2EH3A 3C2BA 2EQRA 1T33A 1X2MA 1HOMA 2E1OA 1HLVA 2XRLA 5JLWA 1ITYA 2ELKA 1O4XA 3WHBA 3GTOJ 1JUMA 3WHCA 4IHWA 5IOZA 1NK2P 1U9NA 4Y7NJ 5C4JJ 4J19A 2ZB9A 4AYBN 3JRIA 2CUEA 4A3JJ 3JRCA 3S1QJ 1IDYA 1GDTA 1U9OA 1Y1VJ 2XGDA 1MBKA 2L7MP 1BJZA 1MH3A 3E7LA 3HOZJ 2HXOA 3LSGA 5IP9J 2HOTA 1LE8A 2ME0A 4W97A 5EEAA 2E2IJ 5FKKA 2LR8A 2XPWA 2CQXA 2WAQN 1ZKGA 3HGGA 1IV6A 4BY1J 3OIOA 5EZGA 4ABZA 2JA7J 3S2DJ 1A6IA 2HOAA 2FD5A 3F0CA 2XSDC 3JRAA 1JUSA 2R5ZA 1I6HJ 1G2HA 1ETWA 4A3MJ 1VI0A 2JMWA 2LK2A 5EYRA 2ID3A 3S14J 3HEFA 4C3IJ 1BW6A 5K7ZA 2N8GA 1H8AC 1RKWA 5E3LA 3L1PA 2COBA 2OF7A 4G12A 4DYQA 3G1OA 2I10A 4C3HJ 4BKXA 2M34A 2AO9A 4LOCA 1F36A 2EZIA 3Q0VA 1GV5A 1Q1VA 5F08A 1DU6A 1GVDA 2AHQA 5IP6A 3HKZN 2ECBA 1UMQA 3G1MA 3FIWA 3Q0WA 3G1LA 2M9HA 1IC8A 5F1JA 2VPRA 1JKRC 1ENHA 3S1NJ 2KT0A 3BTLA 4IEJA 4QSHA 2ME6A 3H3VK 2LTPA 2D5VA 1VF9A 2LD5A 4JYKA 1ZGWA 5FLVA 2DMNA 1I3QJ 5FJ8J 5FKLA 4EEFG 4JX4A 3S15J 2Y2ZA 4XIDA 2TRTA 4IHVA 2E2JJ 2XGCA 3GTMJ 4UUSA 5DS9A 4BY7J 2LLKA 3FKIJ 3M4OJ 2CQQA 3CQZJ 3HB9A 3TW6A 2CUFA 3FK7A 5IPAA 1A5JA 2DMTA 2GBYA 3QPLA 1VNDA 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY J;  4L5E A;  2H8R A;  3ZQH A;  2RAE A;  2Y9Z A;  4XRS G;  1APL C;  3Q0U A;  1ETK A;  3BT9 A;  3GTL J;  1MH4 A;  5E3N A;  4HNV A;  1ZK8 A;  1RES A;  2FJ1 A;  1LE8 B;  1F43 A;  1P7I A;  4QIW N;  3GTK J;  1HDP A;  2YU9 J;  1YRN A;  5J1Y A;  4CYC A;  2IEK A;  1XS9 A;  1JTY A;  4M3E A;  2R5Z B;  4DZJ A;  1AKH A;  2GLO A;  3PM1 A;  3BG5 A;  3BR6 A;  1JT6 A;  4BBR J;  5JLX A;  4A3F J;  1ETY A;  2O9L A;  2LY9 A;  2CRG A;  2KDZ A;  2R7Z J;  1MNM C;  1Z0X A;  2L7F P;  1ZR4 A;  2DTZ A;  5FLM J;  1JJ8 C;  4V2G A;  2YUS A;  3JRB A;  1IGN A;  3CDL A;  5IOY A;  3CCY A;  4FE4 A;  4FE7 A;  5C3E J;  1JKO C;  1WCM J;  2R92 J;  4A3K J;  3BG9 A;  3LNQ A;  3OSF A;  3ZOB A;  1TWF J;  1SAN A;  3BG3 A;  4RBO A;  4D5F A;  2E19 A;  5FKM A;  2JA6 J;  2NVT J;  4A69 C;  3GTQ J;  1NTC A;  1LFB A;  3D1N I;  4FCY A;  1MBH A;  1OJL A;  3Q3S A;  1WH5 A;  4MFE A;  1B72 A;  1AU7 A;  1LFU P;  3GTG J;  5C44 J;  1SFO J;  5J1U A;  4A3C J;  3LOC A;  1ZQ3 P;  3W6V A;  2JN6 A;  2HOS A;  1OFC X;  2EBI A;  4C2M J;  2XB5 A;  5IYC J;  4BXX J;  2DA3 A;  4A3L J;  1RPW A;  2JWT A;  4V2F A;  2PMZ N;  2WV1 A;  3IV5 A;  3LSJ A;  4JX5 A;  2X9D A;  3S1M J;  2NOG A;  2LKX A;  4A3G J;  2Y9Y A;  4JP0 A;  1WH7 A;  3ZQC A;  4UUS B;  1ZTR A;  2GM4 A;  3CMY A;  2HI3 A;  4A93 J;  2M8G X;  5M5X J;  1ZR2 A;  2E2H J;  3BQZ A;  2FQ4 A;  3K2A A;  1HF0 A;  3O8H A;  3GBG A;  4DZP A;  1UG2 A;  3OSG A;  5GPC A;  5F0C A;  1IDZ A;  4A3I J;  3DEW A;  2HXI A;  4A3B J;  2B63 J;  3DCF A;  5GPA A;  3TW7 A;  2R0Q C;  1WPK A;  3ZQL A;  1R9T J;  2H1K A;  4C3J J;  2XGE A;  1HDD C;  1POG A;  2DMQ A;  3BR5 A;  3M3Y J;  1YRN B;  4M3B A;  4UUT A;  3BR2 A;  5BNG A;  4D7M A;  4CYC B;  1FEX A;  3UKG A;  1GT0 C;  1MSE C;  2EZK A;  1AKH B;  2MSY A;  2XB0 X;  5K7H A;  1CQT A;  1B8I A;  1TWH J;  2FX0 A;  3IH3 A;  5F0F A;  2XPV A;  4MIM A;  1FTT A;  1P7J A;  4XRS A;  2O7O A;  5J3L A;  1TWC J;  1X2N A;  2JA5 J;  4M3F A;  2OPT A;  5M3F J;  2HDD A;  3GTP J;  1MBG A;  1JTX A;  2DA6 A;  5EGO A;  4X1E A;  2DA2 A;  4Y52 J;  1OCT C;  3JRE A;  2NS8 A;  1RET A;  2VKE A;  2MW8 A;  3A02 A;  3BR1 A;  2Y30 A;  5FKN A;  1HCR A;  1BW5 A;  1AHD P;  5F27 A;  3LSR A;  3I4N J;  4IHY A;  3HGY A;  5IYD J;  3RKQ A;  1B72 B;  2HQ5 A;  2IAI A;  1DU0 A;  1ORK A;  1BL0 A;  4DYR A;  3FK6 A;  2X48 A;  5M3M J;  5M5Y J;  2LVS A;  3PO3 J;  3PO2 J;  2NS7 A;  3LSP A;  2DJN A;  3FIS A;  4MFD A;  2QCO A;  1OCP A;  3SJM A;  3HDD A;  3QQA A;  4AC0 A;  2L7Z A;  2MGQ A;  1PUF A;  5J1R A;  3ZQG A;  5GP9 A;  2K9S A;  3ZQI A;  2R5Y A;  4A3E J;  2IBD A;  3MKL A;  2DA7 A;  5EG0 A;  4M6V A;  3HOY J;  2VKV A;  3K7A J;  1IUF A;  2ID6 A;  2L0K A;  1FJL A;  2O8K A;  1VFC A;  1FIA A;  2X6O A;  4XRM A;  2L9R A;  3A01 A;  1TWG J;  1NK3 P;  9ANT A;  1H89 C;  4X6A J;  4JX6 A;  1W0U A;  2DA5 A;  1IJW C;  4I76 A;  1WI3 A;  1H88 C;  3BTC A;  1XG1 A;  3GTJ J;  1BA5 A;  4M3G A;  2EZH A;  3HOV J;  3BTJ A;  4W1U A;  2VI6 A;  3TP0 A;  2DMP A;  1QPI A;  1IG7 A;  2W48 A;  5E3O A;  5F04 A;  5FKO A;  2DA1 A;  2CU7 A;  2Y0S N;  3TED A;  5IYB J;  3S16 J;  2DN0 A;  3S17 J;  1RR7 A;  1U78 A;  3TP3 A;  2DMU A;  3RZD J;  2K9Q A;  2QF7 A;  4M3D A;  3JRF A;  5DTD A;  4D7N A;  1ETQ A;  1K83 J;  3BTI A;  3B6C A;  1B8I B;  5EZH A;  3HOU J;  4B3A A;  1JGG A;  2R93 J;  3MN2 A;  2Y31 A;  1JKQ C;  1JT0 A;  1TC3 C;  4MLO A;  1U8B A;  2CJJ A;  2LP0 A;  1JUP A;  1TWA J;  4FIS A;  1FIP A;  2EZL A;  5EGO B;  2G0E A;  2P81 A;  5IP7 J;  4RDU A;  1ETO A;  2M0C A;  4BBS J;  1IRZ A;  4I6Z A;  3BR3 A;  3NAR A;  1RKT A;  4XK4 A;  1QVU A;  3JRH A;  3BR0 A;  1ETV A;  2K9N A;  3JRG A;  1W0T A;  3S2H J;  2NVX J;  3SDG A;  3ZQF A;  5F0H A;  2K40 A;  3S1R J;  4GFB A;  3RZO J;  2DA4 A;  3QPS A;  2YS9 A;  1ETX A;  4D5C A;  3HOW J;  3A03 A;  3HM5 A;  3BQY A;  1S7E A;  4NDL A;  3NAU A;  5EDN A;  2MG4 A;  2HYJ A;  3MVP A;  4B4C A;  1PUF B;  3OOU A;  4QTR A;  1QVT A;  2NVQ J;  2R5Y B;  5M5W J;  1JJ6 C;  3HBL A;  1GV2 A;  5EF6 A;  5EG0 B;  2ECC A;  4S0H B;  4MO7 A;  3RQI A;  2VUM J;  3IH2 A;  1QRY A;  4FTH A;  3JRD A;  2WB1 N;  1D5Y A;  1JKP C;  4DW6 A;  1UHS A;  2JK3 A;  5K7F A;  1GUU A;  3A01 B;  2LFB A;  3HOX J;  3I4M J;  1I50 J;  2XPU A;  4DYC A;  2M2E A;  5C4X J;  1Z77 A;  2JJ7 A;  1XC5 A;  4XIC A;  1MBE A;  1MBJ A;  1X58 A;  3IH4 A;  5HOD A;  2JA8 J;  4A3D J;  3VPR A;  1MSF C;  1EF4 A;  1FTZ A;  3O8G A;  3JR9 A;  1T56 A;  4IHX A;  3H0G J;  4AUX A;  3SFI A;  5E3M A;  1WGX A;  1E3O C;  3B6A A;  2TCT A;  1Y1W J;  1MBF A;  4B1R A;  2EH3 A;  3C2B A;  2EQR A;  1T33 A;  1X2M A;  1HOM A;  2E1O A;  1HLV A;  2XRL A;  5JLW A;  1ITY A;  2ELK A;  1O4X A;  3WHB A;  3GTO J;  1JUM A;  3WHC A;  4IHW A;  5IOZ A;  1NK2 P;  1U9N A;  4Y7N J;  5C4J J;  4J19 A;  2ZB9 A;  4AYB N;  3JRI A;  2CUE A;  4A3J J;  3JRC A;  3S1Q J;  1IDY A;  1GDT A;  1U9O A;  1Y1V J;  2XGD A;  1MBK A;  2L7M P;  1BJZ A;  1MH3 A;  3E7L A;  3HOZ J;  2HXO A;  3LSG A;  5IP9 J;  2HOT A;  1LE8 A;  2ME0 A;  4W97 A;  5EEA A;  2E2I J;  5FKK A;  2LR8 A;  2XPW A;  2CQX A;  2WAQ N;  1ZKG A;  3HGG A;  1IV6 A;  4BY1 J;  3OIO A;  5EZG A;  4ABZ A;  2JA7 J;  3S2D J;  1A6I A;  2HOA A;  2FD5 A;  3F0C A;  2XSD C;  3JRA A;  1JUS A;  2R5Z A;  1I6H J;  1G2H A;  1ETW A;  4A3M J;  1VI0 A;  2JMW A;  2LK2 A;  5EYR A;  2ID3 A;  3S14 J;  3HEF A;  4C3I J;  1BW6 A;  5K7Z A;  2N8G A;  1H8A C;  1RKW A;  5E3L A;  3L1P A;  2COB A;  2OF7 A;  4G12 A;  4DYQ A;  3G1O A;  2I10 A;  4C3H J;  4BKX A;  2M34 A;  2AO9 A;  4LOC A;  1F36 A;  2EZI A;  3Q0V A;  1GV5 A;  1Q1V A;  5F08 A;  1DU6 A;  1GVD A;  2AHQ A;  5IP6 A;  3HKZ N;  2ECB A;  1UMQ A;  3G1M A;  3FIW A;  3Q0W A;  3G1L A;  2M9H A;  1IC8 A;  5F1J A;  2VPR A;  1JKR C;  1ENH A;  3S1N J;  2KT0 A;  3BTL A;  4IEJ A;  4QSH A;  2ME6 A;  3H3V K;  2LTP A;  2D5V A;  1VF9 A;  2LD5 A;  4JYK A;  1ZGW A;  5FLV A;  2DMN A;  1I3Q J;  5FJ8 J;  5FKL A;  4EEF G;  4JX4 A;  3S15 J;  2Y2Z A;  4XID A;  2TRT A;  4IHV A;  2E2J J;  2XGC A;  3GTM J;  4UUS A;  5DS9 A;  4BY7 J;  2LLK A;  3FKI J;  3M4O J;  2CQQ A;  3CQZ J;  3HB9 A;  3TW6 A;  2CUF A;  3FK7 A;  5IPA A;  1A5J A;  2DMT A;  2GBY A;  3QPL A;  1VND A;  1K61 A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  4XMY A;  5DV5 A;  3ZN0 A;  2H8R A;  3FBI B;  2Y9Z A;  5HLT A;  1XMX A;  2LRE A;  2HPI A;  5AIQ A;  1I5Z A;  3KCC A;  4JQF A;  4A6E A;  3FXR A;  3BT9 A;  4RGS A;  3GTL J;  2JVH A;  4E7H A;  5E3N A;  1PP7 U;  1ZK8 A;  3DBR B;  3NRV A;  3RIR A;  1R00 A;  3CJQ B;  3RPU A;  3P9K A;  3LFU A;  2WAD A;  2FJ1 A;  2ZFU A;  4DIQ A;  4ZZL A;  3G71 I;  1R49 A;  3CDI A;  1YRN A;  4XRF A;  4H0E A;  4MQV A;  2PJP A;  2EK5 A;  3GF2 A;  1IW7 F;  2BOL A;  2JPC A;  4E4H A;  4DZJ A;  5A2Q K;  3KPH A;  1AKH A;  1K78 B;  1WJE A;  1V5E A;  3BG5 A;  4HQM A;  5D8L B;  4BBR J;  3K4K A;  3IL2 A;  1Z9C A;  1X1B A;  2KDZ A;  2DYS H;  3SEZ A;  1MNM C;  4JK1 X;  4RMN A;  1MZB A;  3OIQ A;  4N0B A;  1I6X A;  5DD8 A;  1YIT I;  1IGN A;  3MKZ A;  3RI4 A;  3CC4 I;  2J5O A;  4IPA A;  2R92 J;  4FE4 A;  1FOY A;  1WCM J;  4HEA 2;  2DYR H;  3OSF A;  5F64 A;  2IS1 A;  3OS0 A;  1T0F A;  3CCM I;  2E19 A;  2CV1 A;  2HTJ A;  2QQ9 A;  5D5V B;  2XF7 A;  2GQQ A;  1J5Y A;  3I71 A;  3FHN A;  1WH5 A;  5D4R A;  5TIS C;  1B72 A;  2P5V A;  3U1D A;  5JFR A;  1AU7 A;  1LFU P;  3P9I A;  4R8H A;  3SZG A;  1EJ9 A;  2IRF G;  3GTG J;  4G6Q A;  4RLF A;  2V6C A;  1ZQ3 P;  3W6V A;  3ERM A;  2HOS A;  1OFC X;  2F6C A;  5FLX K;  4AIH A;  3J7Z I;  4BXX J;  4HNU A;  4A3L J;  4CCO A;  2JWT A;  3WGH A;  1MMA A;  2E1M C;  3CCL I;  4S04 A;  3IV5 A;  4BHP A;  1TQP A;  4JX5 A;  4Y15 A;  1LB2 A;  1YIO A;  3IAS 2;  4BQO A;  4WCG A;  2VJ4 A;  3MZH A;  3S1M J;  3MWM A;  3K4J A;  1YQA A;  5LRS A;  1ZTR A;  3D5L A;  5L3E A;  2GM4 A;  1XTA A;  4IKF A;  2UZK A;  2M8G X;  2PEX A;  4NC7 A;  2FQ4 A;  3K2A A;  3LSH A;  3BG7 A;  3DKX A;  2F48 A;  4HW0 A;  5DM6 F;  3O8H A;  1O7F A;  3K4L A;  1XMK A;  2G9W A;  3GBG A;  4DZP A;  3DPL C;  3HSR A;  2FML A;  5F0C A;  4A3I J;  3ESW B;  1IUY A;  2EB7 A;  3MEX A;  2MAB A;  5GPA A;  2V7F A;  1YO5 C;  2R0Q C;  3H92 A;  2Z9O A;  1YYV A;  3ZQL A;  4A0Z A;  5FGM A;  2LF7 A;  1B4A A;  4IF4 A;  2XGE A;  4UB8 C;  1POG A;  2EIL H;  1TT0 A;  1J7K A;  3HPG A;  4UUT A;  1QPM A;  2KRH A;  5J47 A;  4D7M A;  1F4K A;  2BVM A;  5J40 A;  3G2B A;  2MSY A;  2KLO A;  5K7H A;  4XNF A;  4MTE A;  5E18 F;  2WAE A;  4HST A;  1D8J A;  2R7O A;  2FX0 A;  1BI2 A;  3WE2 A;  2V1N A;  2CQN A;  1P7J A;  3COA C;  5J3L A;  3FWE A;  3M7G A;  4MEX F;  1Z91 A;  3P5J A;  1D3Y A;  3QU6 A;  2CFO A;  2RRE A;  3C3W A;  2UUZ A;  4E7S A;  3QP5 A;  2DA2 A;  4Y4R A;  3CO7 C;  4BE0 A;  3P7N A;  5LGU A;  4BHC A;  4CZZ A;  2IA2 A;  4ON0 A;  2DOD A;  2R7X A;  3GZ5 A;  1KU9 A;  3RDI A;  3FXU A;  1BW5 A;  1AHD P;  3NWS A;  4L0Y B;  1NHA A;  3F6O A;  4AYB A;  2A3S A;  4BE1 A;  4XQF A;  4KYW A;  5J4V A;  2R7V A;  2HDW A;  4N9I A;  2FE3 A;  4EJT A;  3PO2 J;  4HDU A;  2QSF X;  4M73 A;  2EPF A;  3FIS A;  4B09 A;  3BJO A;  3FX3 A;  2KRF A;  2K3P A;  2L7Z A;  2MGQ A;  1PUF A;  2R5Y A;  2IBD A;  4KFC A;  4LGW A;  4M6V A;  3HOY J;  4PK4 A;  5BPI A;  2M5W A;  1R23 A;  5J8F A;  1OCC H;  1VQ9 I;  2HOE A;  2X6O A;  1FBS A;  2OD5 A;  5L3G A;  4ZYH A;  4M9S A;  5KVR A;  1HC8 A;  4LIV A;  5TGT A;  1TWG J;  3I55 I;  3CCJ I;  4NQW A;  9ANT A;  3GFJ A;  1RUO A;  3PIO F;  2HPM A;  3DFG A;  1Y56 A;  2QGU A;  1ULY A;  1ODD A;  2M4K A;  1P4W A;  4XLC A;  4F3Q A;  3OIP A;  3BTJ A;  1WQ2 A;  2BXZ A;  2DMP A;  4OIR F;  2IA0 A;  1P9Q C;  2NS0 A;  3VDX A;  2DA1 A;  4N4N B;  1OYI A;  2TDX A;  2Y0S N;  4ZC3 A;  1BOB A;  1XSD A;  4FAS D;  3S17 J;  1RR7 A;  3HPH A;  1D0Z A;  4IRI A;  3RZD J;  5IT9 K;  2H8W A;  1VQP I;  1KU3 A;  1IRX A;  2FBK A;  3WTX C;  4BH9 A;  3JRF A;  1LEB A;  1V54 H;  1ETQ A;  4CXF A;  5JR3 A;  3S3M A;  3EPZ A;  4EJU A;  2V1X A;  1A6Q A;  2R93 J;  2DT5 A;  1JT0 A;  1R36 A;  3JW4 A;  4U0Y A;  5B3S H;  3WGG A;  1IN4 A;  2LP0 A;  1U5T A;  4CA0 A;  4LK0 F;  1JUP A;  5E17 F;  4FIS A;  2PI0 A;  2FNP A;  3RYP A;  2P81 A;  2FSW A;  3QAH A;  2VQH A;  2E1N A;  1B59 A;  1X4O A;  4BBS J;  2XAS A;  3FHZ A;  3NAR A;  2M4G A;  3ZMD A;  3JRH A;  3FF5 A;  1ETV A;  4EQQ A;  3JRG A;  1W0T A;  5FO5 A;  2X1C A;  2NVX J;  3BWG A;  3PNV A;  3SDG A;  4EAT A;  2VC1 A;  5F0H A;  5CQG A;  2LKP A;  2RGV A;  4P55 A;  3RZO J;  3BDD A;  3JCU C;  1V5G A;  2L4A A;  4IRH A;  1WZ2 A;  1W5S A;  1XB4 A;  1CF7 A;  5LHG A;  3HYI A;  1V5F A;  2CW0 F;  3NAU A;  1FT9 A;  2ZCW A;  1ONV A;  3MVP A;  4OMY A;  1Z21 A;  3OOU A;  1T39 A;  1QVT A;  1R1V A;  3QOE A;  1QO0 D;  3I53 A;  1O57 A;  5M5W J;  4OIP F;  1JJ6 C;  4Q47 A;  1T2K A;  5EF6 A;  2D1H A;  1SVL A;  3SDB A;  2MD5 A;  2H94 A;  3ISP A;  1OYY A;  3RYR A;  3HSF A;  3KZY A;  1EA3 A;  4AIJ A;  4CHU A;  1T38 A;  1UHS A;  2A61 A;  1GUU A;  3I4M J;  2LFB A;  1I50 J;  5D8K B;  3EUH A;  1SFX A;  2JJ7 A;  3LSI A;  4MGR A;  4WXC A;  5KAI C;  4XIC A;  3J80 Z;  3WTU C;  1HW5 A;  3IH4 A;  3I4P A;  4PJ0 C;  3LMM A;  4EV0 A;  1MW7 A;  1LEA A;  4EJO A;  1Z7U A;  1EF4 A;  3MFK A;  1FTZ A;  3FXM A;  2NNN A;  3DP7 A;  4IVN A;  4CCJ A;  4ESJ A;  3DTK A;  3J7Y J;  1D0Y A;  4CIC A;  4BU2 A;  2BY1 A;  1B1B A;  2OV7 A;  3REO A;  4AUX A;  3SFI A;  5AIP A;  2WAQ A;  3VB2 A;  1WGX A;  4DOZ A;  1E3O C;  4MEY F;  2DQR A;  3WG9 A;  1YS7 A;  2EA4 A;  3K4B A;  3MZY A;  2DQL A;  3R0J A;  2DAO A;  2FU4 A;  3SHF A;  1MBF A;  4Q5S F;  2ISY A;  3KP5 A;  1X2M A;  1HOM A;  2L2O A;  2WAF A;  3CDH A;  4IRG A;  2VN2 A;  2ZSH B;  1HLV A;  1DPR A;  3IRR A;  5LEK A;  2UXX A;  3CUQ B;  5HDN A;  3CCU I;  2HVS A;  1ITY A;  1O4X A;  2O6G E;  2V1U A;  1HXD A;  3J7A Y;  4XR6 A;  3EET A;  3EYY A;  5IOZ A;  4Y7N J;  5C4J J;  4J19 A;  2COM A;  4R1H A;  2HQR A;  2V26 A;  3GME A;  3IP4 B;  4A3J J;  3TKY A;  2XGD A;  1BJZ A;  2DT7 B;  3E7L A;  4XOR A;  2J5P A;  1QZY A;  3X2Q H;  1T6S A;  1WJC A;  3LSG A;  4FX0 A;  5CVV A;  4F55 A;  3TDZ C;  3LQQ A;  2ME0 A;  4W97 A;  2ADU A;  5FKK A;  2E2I J;  2XPW A;  4BY1 J;  1JI8 A;  4KIB A;  2HOA A;  2V9V A;  1JUS A;  3L2C A;  3OYL A;  1ETW A;  2BEO A;  4EJW A;  1K78 A;  4KIC A;  3CCV I;  3S93 A;  5H6R A;  2LK2 A;  3OYI A;  2ID3 A;  2HZT A;  3HRT A;  4ANJ A;  2R7Q A;  1Z05 A;  1WI9 A;  1R5H A;  1WJB A;  1OPC A;  3V7R A;  5K7Z A;  1BW6 A;  2XHK A;  2N8G A;  1H8A C;  1UJ8 A;  3L1P A;  1S6L A;  1G3W A;  2MC4 A;  4DYQ A;  3VSK A;  1RRJ A;  3E6M A;  1HKS A;  3F22 A;  1F9N A;  1FC3 A;  2X85 A;  3D5S C;  3DEU A;  1MJB A;  2NYX A;  5B5E C;  2DOE A;  1N25 A;  1SC7 A;  1BBY A;  3PSF A;  2K9M A;  2QUF A;  1Z6R A;  2CW7 A;  1DP7 P;  4ENM A;  5IP6 A;  2Y48 A;  2ECB A;  1UMQ A;  3Q0W A;  2E7W A;  2BZT A;  1IC8 A;  2VPR A;  2VJJ A;  1ZRE A;  5BMZ A;  1JKR C;  4CO8 A;  2NRA C;  3S1N J;  1XPX A;  4HLY A;  1DPU A;  2BVL A;  2ME6 A;  4IEJ A;  3A2K A;  3H3V K;  2XIG A;  4Q48 A;  5J6X A;  5FLV A;  4EEF G;  5HDK A;  4XID A;  1T08 B;  2P6T A;  3VFZ A;  4AM3 A;  1SD6 A;  2E60 A;  3C18 A;  4C9Y A;  2KMU A;  2WY8 Q;  4DNC A;  4OIQ F;  3EDP A;  2L54 A;  3AAF A;  2W25 A;  2XAQ A;  1U0J A;  4B48 A;  3FKI J;  2CQQ A;  3CQZ J;  3TW6 A;  3H36 A;  1Z3Y A;  2DMT A;  2GBY A;  3ROU A;  1KQ8 A;  4M74 A;  3OY9 A;  5ILU A;  4BXF A;  4CZC A;  2VT2 A;  1HA8 A;  3BZK A;  3CCE I;  3KIO A;  2IXS A;  4Y33 A;  2OBP A;  1ETK A;  2XAF A;  2MD0 A;  4HNV A;  1ZH5 A;  4OU0 A;  1FY7 A;  1G8X A;  2QEX I;  4PCQ A;  4EMS A;  3K4M A;  2GXB A;  2AS5 F;  3E1S A;  3MZ8 A;  3RKY A;  1P7I A;  1SFE A;  2K5C A;  3GLL A;  5GAG J;  1WJD A;  4HF0 A;  4QIW N;  1W5T A;  4IHS A;  2YU9 J;  5HS9 A;  1S5L C;  5J1Y A;  2QBY B;  2IEK A;  4A12 A;  1D5V A;  1XS9 A;  3V8L A;  2K4J A;  2F5V A;  4M3E A;  3BG6 A;  1Z1D A;  2ZKZ A;  3PM1 A;  2VL8 A;  1V55 H;  4A5N A;  2HQN A;  3BR6 A;  4A3F J;  1XGM A;  2PMZ A;  1ETY A;  2O9L A;  3QWL A;  4CDG A;  3J81 Z;  4IQ4 A;  3H1C A;  4KMU X;  3NEU A;  1DGW Y;  3RKX A;  3K2Z A;  3DLA A;  1JJ8 C;  3AKZ A;  1IAW A;  4V2G A;  1TQI A;  1TT5 B;  2EFQ A;  5FB2 A;  3TMO A;  1FMW A;  4FE7 A;  5IOY A;  3HIF A;  4RAY A;  3BC8 A;  5BOX A;  1QQI A;  1TWF J;  1UZC A;  1I27 A;  4GO1 A;  4P5O A;  3OWT A;  3ZMZ A;  4CCK A;  2DTR A;  4NB5 A;  3KYC B;  2MYS A;  2RC4 A;  1BIB A;  2BBY A;  5FKM A;  3K6G A;  3D5R C;  3GTQ J;  2K7L A;  1ERD A;  2AQE A;  5H6Q A;  1OJL A;  4MFE A;  4O5V A;  2L02 A;  1MD0 A;  1SFO J;  5J1U A;  4A3C J;  2LBF B;  2JN6 A;  3LFK A;  1HKQ A;  4N9H A;  2EBI A;  2XB5 A;  2A69 F;  4EM2 A;  2QM3 A;  2A68 F;  3A1Y A;  3OR1 C;  1LJ9 A;  4KT5 C;  2A05 A;  4RB0 A;  2GIZ A;  1E3P A;  1VTN C;  1RI7 A;  3OR2 C;  1Y0N A;  2E5Z A;  4KIS A;  4JBA A;  2IVM A;  3ML6 A;  4UHT A;  1G59 A;  3ABM H;  3KEO A;  3CJR B;  1X3U A;  3LQR A;  3P9C A;  1IF1 A;  4LIU A;  3I9V 2;  3OS1 A;  2CS3 A;  1TL8 A;  2X6Y A;  4GYI A;  5M5X J;  1XGN A;  1KON A;  1ZAO A;  3E6D A;  1OR7 C;  4DQ2 A;  1B9N A;  1TNT A;  2JRT A;  2DOA A;  1YHQ I;  1O3T A;  2EIN H;  3L2V A;  1VQ6 I;  1UG2 A;  3GW2 A;  4HQE A;  2EIM H;  2VON A;  4UV9 A;  4BQA A;  4IOC F;  1FYK A;  5GPC A;  2ZNY A;  1IDZ A;  2KPM A;  5E8G A;  2B63 J;  2PX9 A;  4KIF A;  2W57 A;  1J0R A;  2K02 A;  4M72 A;  3H0D A;  1R9T J;  2H1K A;  4AVZ A;  5BS6 A;  1KQ9 A;  2W24 A;  2VJI A;  1HDD C;  2DMQ A;  1BC8 C;  2H27 A;  2MC3 A;  1R22 A;  3JAM K;  2O3F A;  3BR2 A;  4CYC B;  3I64 A;  1E3H A;  2K4B A;  4G6D A;  5A2Q Z;  2XB0 X;  4ESB A;  1R4N B;  1TW3 A;  2R7T A;  3HHG A;  1FSH A;  2BY3 A;  5F0F A;  2XPV A;  3V4G A;  2A5Y B;  1LFP A;  4ENJ A;  3OYJ A;  1W36 C;  1XMA A;  4NC8 A;  1PDN C;  5ICF A;  1H0M A;  1YX3 A;  3KX2 A;  2JA5 J;  1O7L A;  4M3F A;  2DOF A;  2GA1 A;  2CO5 A;  2LDU A;  1LPQ A;  3OL3 A;  3GTP J;  1MBG A;  2P8T A;  2QWW A;  3MKW B;  2DA6 A;  2YR2 A;  3KYL A;  1XX5 A;  2YSR A;  3PUB A;  2NS8 A;  3K10 A;  2H09 A;  2VT3 A;  3IKT A;  3JRE A;  3A02 A;  2RDP A;  1N75 A;  2Y30 A;  3LA2 A;  1LDJ A;  1LKX A;  4PSX A;  3I4N J;  2ZNZ A;  4WK8 F;  2YPR A;  5IYD J;  2B9S A;  1DU0 A;  2IAI A;  3RTR A;  3U9G A;  2VOO A;  1YX5 A;  1P2F A;  2JTV A;  2EIJ H;  2X48 A;  2VJ5 A;  4OIN F;  5M5Y J;  4RGU A;  1XCB A;  5K1Y A;  1JGS A;  2GAU A;  2KIF A;  3DV8 A;  4IJA A;  3JSO A;  5FLX Z;  2DJN A;  1T8I A;  3CP2 A;  4HRI A;  3LAJ A;  1OCP A;  3SJM A;  1J9I A;  3KEQ A;  3C2H A;  3HDD A;  4AC0 A;  5GP9 A;  2DPD A;  3GVA A;  2K9S A;  3ZQI A;  2I8D A;  3MKL A;  3BPV A;  3T0Y A;  2DA7 A;  4RGX A;  3CCQ I;  3K69 A;  4M9Z A;  1BR2 A;  3FXJ A;  4XSX F;  3ECH A;  3K7A J;  2ID6 A;  1FJL A;  1ON1 A;  3K1P A;  3ABT A;  3IAM 2;  4MTD A;  4F52 A;  3HTU A;  4OIO F;  3TL4 X;  3W2W A;  3S3N A;  2PJR B;  1R58 A;  4I0A A;  2DA5 A;  4ZYA A;  1IJW C;  4U7D A;  1WI3 A;  2LOO A;  4A6D A;  2V4J C;  3CC7 I;  1A04 A;  1TLH B;  1XG1 A;  1U6G A;  1E0E A;  4E7Z A;  1MMD A;  4HG2 A;  4L9N A;  3IRQ A;  2HVQ A;  3PFI A;  1NG7 A;  4HZF A;  4Y3O A;  3LAP A;  3UNG C;  1IG7 A;  5DM7 F;  1BIA A;  2W48 A;  5DUI A;  1VQO I;  3OYF A;  4PJL A;  5F04 A;  3F9K A;  5BPD A;  3OYC A;  3TED A;  2M1B A;  1XGS A;  3S16 J;  4BEH B;  3Q9S A;  2CGP A;  4PGH A;  2IW5 A;  3TP3 A;  4PGG A;  2LG4 A;  4BL0 B;  2FOW A;  3WU0 A;  4PFP A;  2BGC A;  1B8I B;  1K83 J;  3BTI A;  1VQN I;  1T0F C;  3B6C A;  5FFZ A;  1RNL A;  3HOU J;  1FP1 D;  4B3A A;  3MN2 A;  3JTH A;  3V8J A;  1JKQ C;  3CUQ A;  1GXP A;  4MLO A;  3M9A A;  2DK8 A;  2CJJ A;  1ON2 A;  4LJZ F;  1PP8 F;  2WB1 A;  2KZV A;  1TWA J;  2ZO4 A;  2R3S A;  3F3X A;  4N4O B;  5IP7 J;  3ASO H;  1GXQ A;  4DBQ A;  4ETS A;  4HX7 A;  3FKJ A;  2VKD A;  2VAS A;  4HV5 A;  2GXG A;  2CV2 A;  1OIS A;  4XK4 A;  3BR0 A;  1BC7 C;  4BDZ A;  1WJ5 A;  1VQL I;  4YG2 F;  3ZQF A;  3TBI A;  4R79 A;  1X1C A;  4DJA A;  1ETX A;  3BP8 A;  1RC9 A;  1ZAR A;  3L9F A;  2ZME C;  4AVP A;  2CMP A;  4ZDO A;  2DJI A;  3HM5 A;  1XN7 A;  3M1E A;  1LNW A;  3C7J A;  5EDN A;  1ZRC A;  2RQP A;  3OYM A;  2VC0 A;  3G73 A;  1BJA A;  2X1D A;  3KE2 A;  4XL9 A;  4ZDL A;  4BJ6 C;  4U0V A;  1H9G A;  4LB6 B;  2HYF A;  2CG4 A;  5E20 A;  5EG0 B;  3PNT A;  3SEQ A;  2W7N A;  1HQC A;  1QU3 A;  2ECC A;  1X3Z B;  4MO7 A;  1Y8R B;  2VUM J;  1QRY A;  4FTH A;  1KU2 A;  3ZP5 A;  5JI6 A;  2V1D A;  1Y0U A;  3ZMV A;  5LHI A;  1EH6 A;  2OJE D;  1D5Y A;  3HRM A;  4QLC U;  1JKP C;  2QEN A;  2JK3 A;  5K5R A;  2VBX A;  2IP2 A;  4B44 A;  3Q9V A;  3A01 B;  4LD5 A;  3HOX J;  1R5G A;  3SFZ A;  3I3L A;  2M2E A;  5C4X J;  1X1A A;  3F23 A;  1Z77 A;  2KQR A;  4PJJ A;  4XLA A;  3L09 A;  1LDK B;  2G7H A;  4XKC A;  2PBI A;  1QHH D;  3KP6 A;  1MMS A;  2ELJ A;  1FLI A;  3MD2 A;  2C6Y A;  1V3F A;  3VPR A;  5DD4 A;  1HKT A;  2LRD A;  4RM2 A;  1GVJ A;  1MGT A;  3JR9 A;  2MH2 A;  2DK5 A;  4CCM A;  5D6E A;  1R5I D;  3H0G J;  3FDY A;  3LSM A;  1EV7 A;  2P4W A;  4L9V A;  4XON A;  1IXR C;  5HNF A;  2A6H F;  4RGR A;  1S72 I;  4LB5 A;  1HSJ A;  5IT9 Z;  2AXT C;  3BZC A;  5K5O A;  2E35 A;  3RQ4 A;  4B1R A;  1YTY A;  3WTS C;  2JT1 A;  3QOP A;  1W7P B;  1EH8 A;  4HX4 A;  2DDB A;  4ZYG A;  2JRM A;  2E1O A;  1BN5 A;  1ZLJ A;  2W1O A;  4II3 A;  1SAX A;  2BHY A;  2IGK A;  2XRL A;  3BRO A;  2DBB A;  4M71 A;  5JLW A;  2ELK A;  4G8X A;  3PUF A;  4UUV A;  3WHB A;  4CUG A;  3GTO J;  3B02 A;  2OTL I;  4M6Y A;  1NK2 P;  5LHH A;  2PMH A;  2UV1 A;  1IN7 A;  4P9F A;  3L2R A;  2FA5 A;  2STT A;  5LD2 C;  2XF5 A;  4CH7 A;  4LG0 B;  4BS9 A;  1MNE A;  2XVC A;  1U2W A;  3S1Q J;  2KHM A;  1U9O A;  1YJ9 I;  2NVU B;  2WWY A;  4NC6 A;  1MBK A;  5CLS A;  3N4M A;  1FBU A;  3LWF A;  2HXO A;  2ESH A;  5KAF C;  2RV8 A;  3J7A O;  5LGN A;  1HBX G;  2EFW A;  2CQX A;  3H35 A;  3HGG A;  4LK1 F;  1BOA A;  3F8N A;  4ABZ A;  3S8P A;  2QBY A;  2Y75 A;  3S2D J;  1I6H J;  2XSD C;  1IV8 A;  1WJF A;  2WC2 A;  1JE8 A;  3TO7 A;  1L0O C;  3HHH A;  4A3M J;  2GXA A;  2E36 A;  1OKR A;  2X6X A;  3GO5 A;  4GCV A;  3BLY A;  4UVA A;  4EGY A;  4IQJ A;  2FBH A;  4UY8 I;  4QPQ A;  2H6B A;  3TO6 A;  4C2T A;  4HF2 A;  3WGI A;  3S14 J;  3GXO A;  1XDU A;  4D0P A;  4PFO A;  1RKW A;  3GZN B;  1YFH A;  4S05 A;  5E3L A;  3OYH A;  3G1O A;  3VYU B;  1BI3 A;  2CFX A;  3KZI C;  3PJR A;  3GCM A;  4C3H J;  4BKX A;  3EYI A;  2M45 A;  2OZ6 A;  4EVI A;  5H2F C;  2JSC A;  3BZ6 A;  5LRR A;  2B0L A;  4RA2 A;  3GUD A;  1Q1V A;  1G6N A;  1WVR A;  1TP4 A;  5F08 A;  1FPQ A;  2AHQ A;  3A4C A;  3FXL A;  3HL2 A;  3HKZ N;  4YIF A;  3OYK A;  3G1M A;  3FIW A;  3HC7 A;  4KUM A;  3K1M A;  3HTS B;  1GHC A;  3G1L A;  1O3S A;  1E17 A;  2XDV A;  4A2U A;  1N78 A;  2KT0 A;  3BTL A;  2ZFW A;  3HUG B;  4QSH A;  2LBF A;  2D5V A;  5GAD J;  1KGS A;  1VF9 A;  2HNH A;  3C1D A;  2LD5 A;  3L2U A;  3LST A;  3CF2 A;  1ZGW A;  1I3Q J;  1SVM A;  1WWX A;  2BW3 B;  5GAH J;  2QSH X;  4EM0 B;  3L2Q A;  4JX4 A;  3S15 J;  3CMA I;  5GTH C;  1MIJ A;  2OC6 A;  4IHV A;  1Q1H A;  5DDG A;  2E2J J;  3W3C A;  3OOP A;  2Z99 A;  3GTM J;  1YG2 A;  1KQ0 A;  1J59 A;  1X1P A;  1DUX C;  1OCZ H;  2IPQ X;  4BY7 J;  3U2R A;  4EM1 A;  3M4O J;  5FFX A;  2QQB A;  5B1B H;  1YJN I;  3FK7 A;  1ZYR F;  1W1W E;  1RR8 C;  3V7S A;  3H9J A;  2O61 A;  5HS8 A;  2E1M B;  1K7A A;  3QYE A;  2NVY J;  4L5E A;  4PUS A;  3ZQH A;  2L9S A;  5F6F A;  1UFM A;  2MLK A;  3ELK A;  2ZBK A;  4XRS G;  4KIT B;  1APL C;  1KU7 A;  2Z3Y A;  3Q0U A;  1KYZ A;  3U21 A;  5ICE A;  1MH4 A;  4UB6 C;  2VBZ A;  1RES A;  2EFN A;  4E7J A;  4F7Z A;  1F43 A;  1EKE A;  1HDP A;  3QRF F;  4CYC A;  3CLQ A;  1JTY A;  1VQ5 I;  2R5Z B;  1O3R A;  5E1W A;  2GLO A;  3H9Q A;  2PN6 A;  5JLX A;  1ZEL A;  2LY9 A;  3EUH C;  2BE5 F;  2RNG A;  2XC7 A;  1Z0X A;  2L7F P;  2VIX A;  3BOQ A;  2DTZ A;  3UR3 C;  1FSE A;  2OCC H;  3KP7 A;  2K27 A;  2YUS A;  3H9G A;  2ZXI A;  2VPL A;  3AL0 C;  3CDL A;  4KJZ A;  4A3K J;  5KHD A;  2VXD A;  5TJJ A;  3BG9 A;  1E2X A;  2ZME B;  3LNQ A;  1LQ1 A;  4KMF A;  1DQU A;  1SAN A;  4A0Y A;  3BG3 A;  4RBO A;  4D5F A;  2NVT J;  2ZXH A;  2JA6 J;  3FBN B;  1USS A;  3D1N I;  2Z33 A;  4RS8 A;  4HYE A;  3TQN A;  1LDD A;  3GX4 X;  2PQ8 A;  2L9N A;  3HXL A;  1WSU A;  1WHU A;  2FRH A;  2ISZ A;  3I54 A;  3ZQQ A;  3OYB A;  4FHT A;  4C2M J;  5IYC J;  5CJ9 A;  2XAU A;  2L4M A;  1RPW A;  5DCF A;  4PZJ A;  2F4M B;  4CGZ A;  2Q2E B;  4OOI A;  2GOM A;  4ESF A;  2IGM A;  4V2F A;  5FRM A;  2E34 A;  3F8M A;  2WV1 A;  3R6S A;  2G7U A;  3I59 B;  4GXO A;  5HLH A;  3LSJ A;  1W4M A;  3I56 I;  1RZ4 A;  2X4H A;  2NOG A;  2KDO A;  4A3G J;  4UVB A;  1KYW A;  3GFM A;  5K5Q A;  4UUS B;  2IA1 A;  3EUA A;  1ZHF A;  4EJV A;  2DW4 A;  3CMY A;  1IRG A;  5ERI A;  2PJR A;  3IHU A;  2OQG A;  3U1K A;  1ZR2 A;  4RB1 A;  4X0G A;  3GEZ A;  2HWV A;  4V19 K;  2XSJ C;  5LBQ A;  5JHF A;  2X6W A;  1K79 A;  2JUC A;  2BY2 A;  4CCN A;  2IJL A;  3CLO A;  2QYO A;  3DEW A;  1D1C A;  4NUB A;  3CJN A;  2KIQ A;  2H1L A;  2F4O B;  1WPK A;  4ZH4 F;  5ILV A;  3E6C C;  5IT3 A;  4D9J A;  1UAA A;  4J01 A;  3L2W A;  4C3J J;  1SD4 A;  2RVC A;  3FM5 A;  3HG9 A;  4BEH A;  1BI1 A;  1FOW A;  4M3B A;  4BJ5 C;  3M3Y J;  4B8X A;  3KET A;  5BNG A;  4GYG A;  1FEX A;  2FQ3 A;  3H5A A;  3UKG A;  3CME I;  1MSE C;  1PYV A;  1I39 A;  1TQM A;  1D1B A;  1GLN A;  2JPB A;  3ONQ A;  4I99 C;  1CQT A;  4PJM A;  1B8I A;  4CYD A;  2ZXJ A;  2QVO A;  4MIM A;  1O3Q A;  1EH7 A;  5F1R A;  2YU3 A;  4BYY A;  2O7O A;  4HLX A;  1G3S A;  2QQA A;  1X2N A;  2R4G A;  2HDD A;  2GA2 A;  2DT6 A;  3FM3 A;  1UCR A;  4HSR A;  2BHZ A;  3E3V A;  4QWQ A;  4X1E A;  3SXY A;  1RET A;  1ZG3 A;  3BR1 A;  3ZGK A;  2PLY A;  2M0M A;  2D2W A;  2KIS A;  2F5C A;  5F27 A;  2IGO A;  3LSR A;  4IHY A;  2MA3 A;  3HGY A;  4RAZ A;  3AG1 H;  2OTJ I;  4WWC A;  2ZJQ F;  2HQ5 A;  1L3L A;  2UXN A;  1BL0 A;  2FOK A;  4DYR A;  2NOJ B;  4O3M A;  3FK6 A;  2KFD A;  2VB6 A;  5M3M J;  2LVS A;  2DFH A;  5JHU A;  2DFF A;  2IGN A;  2NS7 A;  3LSP A;  3CF5 F;  3A0H C;  2Y0S A;  2Z16 A;  4MFD A;  2QCO A;  2FMY A;  4BQQ A;  4XSZ F;  3QQA A;  1XSX A;  5J1R A;  4A3E J;  3ZMT A;  3I5U A;  2OUM A;  2CYY A;  1VQM I;  2MH9 A;  3WTZ A;  1TTY A;  5EG0 A;  1R6R A;  3F21 A;  2VKV A;  3QPH A;  1IUF A;  2L0K A;  5FD5 A;  2CSO A;  2O8K A;  2A07 F;  3OYD A;  4Z6Y A;  1R1U A;  1VFC A;  2L9R A;  2MBF A;  3A01 A;  2DI3 A;  1NK3 P;  2CH0 A;  1H89 C;  4ZTJ A;  4X6A J;  2V79 A;  3LSK A;  3L7W A;  1A36 A;  4I76 A;  2O03 A;  3FZV A;  3BTC A;  1IN6 A;  4C30 A;  5KCM A;  1VQK I;  3CD6 I;  3K9T A;  3GTJ J;  1BA5 A;  1IXS B;  4M3G A;  3ZMU A;  3HOV J;  4W1U A;  1JHF A;  4K2E A;  1QPI A;  1T98 A;  2JVG A;  4ZJZ A;  3WU1 B;  5E3O A;  3W6J B;  1XD7 A;  2P7C B;  4HPQ A;  5FKO A;  5E8I A;  1X19 A;  4XKV A;  4D1Q A;  2VE9 A;  5IYB J;  3EUK L;  3KP4 A;  1YI2 I;  5H20 A;  3JAM Z;  1BM9 A;  4FET A;  4RB2 C;  1U78 A;  2LMD A;  1AA7 A;  4Q4Z F;  3BCA A;  4LIT A;  3S2W A;  2K9Q A;  2QF7 A;  4HOB A;  2EJR A;  4UVC A;  5DTD A;  4FQG A;  2P5L C;  2I5U A;  1W7P A;  3WU2 C;  4M6X A;  5L3B A;  3B73 A;  2XGX A;  2Q1Z B;  2L01 A;  4WXH A;  4LLL A;  3ERE D;  3PL8 A;  2E7X A;  1JGG A;  2Y31 A;  1UST A;  1TC3 C;  2DLL A;  1TBX A;  1H9T A;  3N97 A;  2VBW A;  4KDP A;  2FEZ A;  4P1W A;  1HW1 A;  3VEP A;  2XAJ A;  2EZL A;  5EGO B;  2G0E A;  1Y39 A;  4LG0 A;  4RDU A;  4RM3 A;  1ZRF A;  2STW A;  1Y6I A;  1IRZ A;  2VXZ A;  2Y69 H;  3LA7 A;  5B1A H;  1OQY A;  1QVU A;  1Y8Q B;  2RQQ A;  3L00 A;  1FOK A;  3ZQ7 A;  4RLQ A;  4L5J A;  2XF6 A;  3HOW J;  2NNY A;  4XLN F;  3BJ6 A;  3BQY A;  4BAY A;  1S7E A;  2LNB A;  4LLG F;  4XKB A;  2MG4 A;  1QA6 A;  5TRD A;  1MKM A;  2R7W A;  1FZP B;  1WFX A;  2QZ8 A;  4QTR A;  5CQE A;  5CVU A;  1WKM A;  3HOS A;  3K70 D;  2DXI A;  3HBL A;  1GV2 A;  1G3T A;  3WTY C;  4ASN A;  2IT0 A;  1SD5 A;  2EV5 A;  5D5X B;  1T95 A;  1S29 A;  4OAY A;  3DU6 A;  3FMR A;  3ZPL A;  3RPQ A;  3CZ6 A;  3W2V A;  2FUG 2;  4ZTF A;  3E6B A;  3V42 A;  2XPU A;  1XC5 A;  2A6T A;  1MBE A;  1X58 A;  2X0L A;  4XOP A;  3DF8 A;  5HOD A;  5L3C A;  4A3D J;  2HU9 A;  1MSF C;  2DFE A;  1YJW I;  3O8G A;  3VYT B;  5EEG A;  1NH3 A;  3GFL A;  3HUG A;  4IHX A;  3K1N A;  1I3A A;  1KA8 A;  4DBR A;  1SFK A;  2ZJP F;  5CYV A;  5J4Y A;  4G94 A;  5E3M A;  2BW3 A;  2M7B A;  3H3Z A;  3M8E A;  3B6A A;  3W6K B;  1FOX A;  2YX4 A;  2XKO A;  3VSL A;  5AON A;  1Y1W J;  4BGD A;  1SEU A;  4I02 A;  2EH3 A;  5HDG A;  3C2B A;  2EQR A;  4XLF A;  4M9X A;  2B7E A;  2GWR A;  3BJA A;  4MQ9 F;  2NXN B;  4WXD A;  4I09 A;  4IZZ A;  2R7R A;  2ZXW H;  5DEQ A;  4YFN F;  1JUM A;  3WHC A;  2L7K A;  3FXO A;  4HA8 A;  1LUJ B;  3JRI A;  1FYM A;  4BXU A;  1M1E B;  1ZRD A;  3RKW A;  4LMY A;  2HQA A;  4XKW A;  2R7S A;  4G6T B;  1P4X A;  6PAX A;  3HOZ J;  4HDV A;  3M1C A;  1B9M A;  1UHW A;  3ZN1 A;  4U87 A;  2EFO A;  4L9T A;  4AID A;  3TGN A;  4XLP F;  3TOB A;  2WAQ N;  1ZKG A;  5KNL A;  4EGZ A;  1IV6 A;  3OIO A;  3E5U A;  1YLF A;  5J8C A;  2JA7 J;  3DEE A;  2CV0 A;  2A6E F;  3JRA A;  4BAC A;  2HR3 A;  2R5Z A;  2JSP A;  3O3K A;  3R61 A;  2JQ7 A;  1R4M B;  2QLZ A;  4OMZ A;  1VI0 A;  3ABK H;  2CW8 A;  2BYV E;  5EJC A;  4I0B A;  3H5R A;  3HEF A;  4C3I J;  5HS7 A;  3WTW C;  4E6K G;  4PSW A;  2COB A;  2OF7 A;  4G12 A;  4I2O A;  3WTV C;  3PQJ A;  3R60 A;  3GFI A;  3QPT A;  3T8T A;  5D5U B;  5E79 C;  2M34 A;  2RN7 A;  2AO9 A;  2ZME A;  3RSN A;  2E5N A;  2EZI A;  3Q0V A;  1R7J A;  3WTT C;  3K0L A;  4HX8 A;  3C2G A;  3CUO A;  2K9L A;  4ZDP A;  4XOT A;  4JOM A;  3MMY B;  1IZ1 A;  1UEL B;  1K6Y A;  1VQ4 I;  1W7P D;  2W00 A;  2KIM A;  4UXN A;  5HNH A;  3NWT A;  1YS6 A;  3ABL H;  2F4I A;  1D1A A;  2Q0O A;  3HRU A;  2M3A A;  2LTP A;  5ICC A;  4YFK F;  4GGG A;  3CUQ C;  1S7O A;  3BPX A;  4HBL A;  2H6C A;  2DMN A;  4XN0 A;  2KRC A;  3R0A A;  2Q2E A;  2Y2Z A;  3NQO A;  2TRT A;  3I59 A;  2JUG A;  1YW9 A;  2XV4 S;  2F5E A;  2FNA A;  3QYB A;  2XRO A;  2IS2 A;  2QSG X;  2XGC A;  2Z1D A;  4KT6 A;  4UUS A;  1W36 D;  3FMQ A;  2LLK A;  1X3W B;  1IN8 A;  5IPA A;  2CUF A;  1AWC A;  3QPL A;  3SZP A;  1VND A;  4IO9 F;  4LG3 A;  3KFW X;  1JXS A;  3PFY A;  2RAE A;  2VOD A;  1QGP A;  3S32 A;  3WOD F;  1IXC A;  2JZY A;  4F91 B;  1I1S A;  2O5R A;  3DWL E;  5KK1 A;  3GYH X;  1S8N A;  1MND A;  3H3U A;  2XUB A;  4XLE A;  2OCE A;  1LE8 B;  2K3F A;  2HVR A;  2XAG A;  4KIG A;  2LKS A;  5IY5 H;  3DBL B;  4YEJ A;  3GTK J;  1OCR H;  2P6S A;  2F5F A;  5DCM B;  1FWZ A;  4XM3 A;  5ED4 A;  2HTS A;  1JT6 A;  5D6F A;  1K4S A;  1KZH A;  3DTI A;  3H5N A;  4IHT A;  1MDM B;  4RAF A;  2CRG A;  2R7Z J;  3IUO A;  3DLL F;  2QKM B;  1ZR4 A;  2X1E A;  5DUK A;  5FLM J;  2LC2 A;  2WA0 A;  3DPU A;  4IXA A;  4F92 B;  3JRB A;  3M8J A;  2M87 A;  3CCY A;  3N05 A;  5C3E J;  1JKO C;  5HOO A;  3D0S A;  3RPU D;  3MAJ A;  3CJT B;  2QKL B;  3GLX A;  3LA3 A;  3ZOB A;  2VQL A;  3E5X A;  1IO2 A;  2AQF A;  2HKO A;  5L3F A;  3FXK A;  4E7K A;  4ENK A;  1X1D A;  4A69 C;  1NTC A;  4AU7 A;  1LFB A;  4FCY A;  1DP3 A;  1MBH A;  5LGT A;  3Q3S A;  2LY2 A;  3KLN A;  3IC7 A;  5C44 J;  5ILS A;  1F5T A;  3W2A A;  3LOC A;  1MJA A;  2M8E A;  2XAH A;  4KA4 A;  2DA3 A;  3QU3 A;  4ZYD A;  2A5W A;  3CCR I;  2VE8 A;  2VLA A;  4BDY A;  2PMZ N;  1JHH A;  1FP2 A;  2V6E A;  5CVJ A;  4IL6 C;  2AXL A;  1ZG1 A;  5FRN A;  3KZZ A;  2YX7 A;  2X9D A;  4YFX F;  2LKX A;  2Y9Y A;  4JP0 A;  1SVO A;  1WH7 A;  3HRS A;  3ZRG A;  4BJT A;  3ZQC A;  3ABU A;  3SYT A;  3ULQ B;  5CVI A;  4CCL A;  2Z5U A;  4ZZD A;  1ZGA A;  2CQK A;  2HI3 A;  1PJR A;  4A93 J;  2V9K A;  1G3Y A;  2E2H J;  3BQZ A;  1S9H A;  5D5W B;  1HF0 A;  1FX7 A;  2VBY A;  2DU9 A;  1ZG5 A;  3JTG A;  3DKY A;  1F1Z A;  3OSG A;  2VQC A;  5HLI A;  2CUZ A;  3G4S I;  1J09 A;  1FBQ A;  2HXI A;  4P96 A;  4A3B J;  3AG2 H;  3DCF A;  1XSV A;  1Z3X A;  5JVT A;  3TW7 A;  3VYR B;  1LVA A;  5E1X A;  3WG7 H;  4YRV A;  4AIK A;  2NAZ A;  1U5T C;  2LY1 A;  5LEJ A;  1J2X A;  5EEH A;  3BR5 A;  1YRN B;  2F2E A;  1P92 A;  4LLN A;  5LFA A;  4DGW B;  1GT0 C;  2VQG A;  3F8C A;  2EZK A;  1AKH B;  1RUN A;  5L3D A;  1VQ7 I;  1OLT A;  1TWH J;  2OAZ A;  2WY7 Q;  4BUP A;  3IH3 A;  1FTT A;  2KP6 A;  3AFH A;  5CVR A;  4XRS A;  4KNY A;  4UV8 A;  5HLG A;  3OL4 A;  1TWC J;  2QA4 I;  1P4A A;  2M30 A;  3ASN H;  3PIP F;  4BE2 A;  1BR4 A;  2OPT A;  1MMN A;  5M3F J;  3VWB A;  1HST A;  2KIU A;  1I1G A;  1JTX A;  1SD7 A;  5EGO A;  4Y52 J;  2Y0M A;  4XBF A;  1OCT C;  1ZGJ A;  2VKE A;  2MW8 A;  1Z7L A;  4OWR B;  5FKN A;  1QBJ A;  1TZL A;  1CGP A;  3PNY A;  1HCR A;  4C2U A;  3LL7 A;  1BI0 A;  1FNN A;  3E0J B;  5CKT A;  3TDU C;  3RKQ A;  4FT8 A;  1B72 B;  4AD9 A;  1U3E M;  3VOD A;  1ORK A;  3SQN A;  2ACJ A;  1ZLK A;  5FRO A;  2KKO A;  4B3X A;  3RJP A;  2P0W A;  3PO3 J;  2ZSI B;  4Z2Y A;  3ZMS A;  1PUE E;  3VYS B;  1SMT A;  2EWN A;  2O0Y A;  2F5D A;  3PSI A;  3ZQG A;  2K85 A;  3A0B C;  2KL4 A;  4RB3 C;  4L9J A;  2L5Q A;  3CCS I;  3Q5F A;  1SFU A;  2OZU A;  4TV7 A;  2HEO A;  1W5C C;  2GZW A;  3OS2 A;  3T5X A;  2D1V A;  4H4K C;  2EIK H;  3T8R A;  1QZZ A;  2LF8 A;  4U88 A;  4CSW A;  1FIA A;  1YIJ I;  1S7A A;  3KP2 A;  4XRM A;  4II2 A;  3GZ6 A;  3E97 A;  1D0X A;  4JX6 A;  1W0U A;  3WE3 A;  4O6J A;  2IS4 A;  3ECO A;  4U0W A;  3J80 K;  1H88 C;  3M07 A;  1REP C;  1VQ8 I;  4MHG A;  2EZH A;  3TP0 A;  2VI6 A;  2FXA A;  4F93 B;  3EQL F;  1TW2 A;  1A31 A;  4WX9 A;  2CU7 A;  3TO9 A;  1DDN A;  3G3Z A;  4A0X A;  1MMG A;  1BR1 A;  2ELH A;  2EV0 A;  2DN0 A;  2KZG A;  2OQR A;  2HYG D;  2ESN A;  2O8X A;  2XRN A;  3DKW A;  4HV6 A;  4L0Z B;  2DMU A;  3V8K A;  2Z2S B;  3HSE A;  3DBH B;  1RIO H;  5E1Z B;  4M3D A;  4D7N A;  5EZH A;  1FMV A;  1OCO H;  4OAZ A;  4E7L A;  2IS6 A;  2MLG A;  3CTA A;  4I01 A;  4LFU A;  3R4K A;  4FX4 A;  3BY6 A;  1U8B A;  1C0W A;  2ZC2 A;  1ACI A;  1QZE A;  1UB9 A;  4KN4 X;  3OYN A;  1FIP A;  3RCO A;  1ETO A;  2PFB A;  4RAG A;  3HOT A;  1XCV A;  3M8F A;  4IOA F;  1QNT A;  2M0C A;  2HFH A;  1MJ9 A;  4I6Z A;  3BR3 A;  4GDF A;  1RKT A;  3AG4 H;  2BY0 A;  4I98 B;  2E1C A;  2E71 A;  2K9N A;  4NBQ A;  1K4T A;  3S2H J;  4AWX B;  3V7C A;  2BXY A;  2K40 A;  2BV6 A;  3S1R J;  4GFB A;  4G7Z F;  1IN5 A;  2DA4 A;  3AG3 H;  2YS9 A;  3QPS A;  1K6O A;  2L9V A;  4D5C A;  2ETH A;  4P9U A;  1R71 A;  3A03 A;  2ZJ2 A;  1SMY F;  3S3O A;  2HS5 A;  4NDL A;  2GIV A;  5B66 C;  3DU5 A;  2HYJ A;  2KJC A;  3DTE A;  4B4C A;  1PUF B;  4BQN A;  1HW2 A;  4NHJ A;  2NVQ J;  2R5Y B;  2PG4 A;  3MQ0 A;  4HNT A;  4S0H B;  3K70 C;  3OYA A;  4YII A;  3RQI A;  3IH2 A;  3JRD A;  2WBM A;  3HJE A;  5ICG A;  2WB1 N;  4BHB A;  4BNC A;  3F6V A;  4DW6 A;  4XLH A;  3F8F A;  3I58 A;  3OYE A;  3O2P E;  1OMI A;  1YW7 A;  1R1T A;  3T1B A;  5K7F A;  2FBI A;  4NQW B;  4DYC A;  3DPT A;  2R7U A;  3E5Q A;  1P6R A;  3ZR8 X;  1G4D A;  1MBJ A;  2LH9 A;  2JA8 J;  2ICW G;  3KYD B;  5DYM A;  2P7V B;  4U7B A;  2HKX A;  4KN7 X;  5LLQ A;  1J75 A;  2W82 A;  1T56 A;  2D45 A;  4YEL A;  2EV6 A;  2WV0 A;  2XKP A;  3DQV C;  3IKV A;  2KJB A;  3GWZ A;  3CC2 I;  4Y13 A;  2TCT A;  4MNU A;  1WJA A;  2DFI A;  2VOP A;  3K4N A;  4HAM A;  2GOX B;  2EFP A;  3F72 A;  3JSP A;  5CPR B;  3F8B A;  2CUJ A;  2ZJR F;  3CES A;  1T33 A;  4PJN A;  4QPO A;  1YE9 A;  3QYF A;  1IRF A;  2W85 A;  1QHG A;  1AOY A;  2M7A A;  3CMM A;  4IX7 A;  5D4S A;  3QP6 A;  3KEY A;  2RKH A;  1U5T B;  3MKY B;  4IHW A;  1U9N A;  1TNS A;  2ZB9 A;  4I7H A;  4G9Y A;  3ZXS A;  4AYB N;  2CUE A;  5HVQ C;  3TOA A;  1IDY A;  3JRC A;  1GDT A;  1Y1V J;  4B47 A;  3HKZ A;  2L7M P;  1MH3 A;  4WF2 A;  2RNJ A;  2Q8K A;  4B43 A;  3FXQ A;  1UG0 A;  4E70 A;  2DO7 A;  5IP9 J;  3BCB A;  2HGC A;  3MCZ A;  3CO6 C;  1LVK A;  3FMS A;  2HOT A;  4UNO A;  1STZ A;  2DCE A;  1LE8 A;  5EEA A;  1UHM A;  3OYG A;  2LR8 A;  3G6E I;  2R7F A;  2L3D A;  2UWM A;  1OR7 A;  5EZG A;  1CF7 B;  1A35 A;  2HDC A;  1A6I A;  1B6A A;  1OYW A;  1XDS A;  3IWF A;  5DCM A;  1YOV B;  2FD5 A;  3F0C A;  4G7H F;  1G2H A;  1X4P A;  4NNJ A;  1DGR M;  4ZYE A;  4XN3 A;  1D8K A;  4ITV A;  3CP8 A;  2JMW A;  5EYR A;  1MDM A;  3J81 K;  4PDK A;  1Z67 A;  1XGO A;  1U8R A;  3KP3 A;  4E7I A;  2I10 A;  1NG6 A;  3PQK A;  2K86 A;  2LSO A;  4LOC A;  1F36 A;  3KLO A;  2CQ7 A;  1GV5 A;  1Z6T A;  1DU6 A;  1GVD A;  2CWE A;  3HZJ A;  3OMY A;  1FYL A;  1S3J A;  4GRI A;  3K4C A;  2M9H A;  2HZD A;  2X51 A;  5F1J A;  1V4R A;  1ENH A;  2VKH A;  2LYC A;  1YW8 A;  2FF4 A;  3O6B B;  5JVG F;  3OV8 A;  3AL0 B;  2WTE A;  3VOE A;  2W84 A;  5GAE J;  4YIR X;  4Y17 A;  4ENN A;  5BQT A;  4JYK A;  2W4S A;  5FJ8 J;  5FKL A;  2DPU A;  3I0T A;  5GTI C;  2OA4 A;  2QQ8 A;  3SZT A;  1PVE A;  3IWZ A;  4G7O F;  3DXJ F;  4HF1 A;  2V9P A;  3QOD A;  3ZCO A;  4A5M A;  2JA2 A;  5DS9 A;  1VZ0 A;  2PMU A;  1ZN2 A;  5FD6 A;  1WRJ A;  2EA2 A;  4L5I A;  4L18 B;  3HB9 A;  1A5J A;  1SAU A;  4J00 A;  2MFZ A;  2P5K A;  2DDA A;  1K61 A;  1N77 A;  2R7D A; 
#chains in the Genus database with same CATH homology
 2NVY J;  4L5E A;  2H8R A;  3ZQH A;  2RAE A;  2Y9Z A;  4XRS G;  1APL C;  3Q0U A;  1ETK A;  3BT9 A;  3GTL J;  1MH4 A;  5E3N A;  4HNV A;  1ZK8 A;  1RES A;  2FJ1 A;  1LE8 B;  1F43 A;  1P7I A;  4QIW N;  3GTK J;  1HDP A;  2YU9 J;  1YRN A;  5J1Y A;  4CYC A;  2IEK A;  1XS9 A;  1JTY A;  4M3E A;  2R5Z B;  4DZJ A;  1AKH A;  2GLO A;  3PM1 A;  3BG5 A;  3BR6 A;  1JT6 A;  4BBR J;  5JLX A;  4A3F J;  1ETY A;  2O9L A;  2LY9 A;  2CRG A;  2KDZ A;  2R7Z J;  1MNM C;  1Z0X A;  2L7F P;  1ZR4 A;  2DTZ A;  5FLM J;  1JJ8 C;  4V2G A;  2YUS A;  3JRB A;  1IGN A;  3CDL A;  5IOY A;  3CCY A;  4FE4 A;  4FE7 A;  5C3E J;  1JKO C;  1WCM J;  2R92 J;  4A3K J;  3BG9 A;  3LNQ A;  3OSF A;  3ZOB A;  1TWF J;  1SAN A;  3BG3 A;  4RBO A;  4D5F A;  2E19 A;  5FKM A;  2JA6 J;  2NVT J;  4A69 C;  3GTQ J;  1NTC A;  1LFB A;  3D1N I;  4FCY A;  1MBH A;  1OJL A;  3Q3S A;  1WH5 A;  4MFE A;  1B72 A;  1AU7 A;  1LFU P;  3GTG J;  5C44 J;  1SFO J;  5J1U A;  4A3C J;  3LOC A;  1ZQ3 P;  3W6V A;  2JN6 A;  2HOS A;  1OFC X;  2EBI A;  4C2M J;  2XB5 A;  5IYC J;  4BXX J;  2DA3 A;  4A3L J;  1RPW A;  2JWT A;  4V2F A;  2PMZ N;  2WV1 A;  3IV5 A;  3LSJ A;  4JX5 A;  2X9D A;  3S1M J;  2NOG A;  2LKX A;  4A3G J;  2Y9Y A;  4JP0 A;  1WH7 A;  3ZQC A;  4UUS B;  1ZTR A;  2GM4 A;  3CMY A;  2HI3 A;  4A93 J;  2M8G X;  5M5X J;  1ZR2 A;  2E2H J;  3BQZ A;  2FQ4 A;  3K2A A;  1HF0 A;  3O8H A;  3GBG A;  4DZP A;  1UG2 A;  3OSG A;  5GPC A;  5F0C A;  1IDZ A;  4A3I J;  3DEW A;  2HXI A;  4A3B J;  2B63 J;  3DCF A;  5GPA A;  3TW7 A;  2R0Q C;  1WPK A;  3ZQL A;  1R9T J;  2H1K A;  4C3J J;  2XGE A;  1HDD C;  1POG A;  2DMQ A;  3BR5 A;  3M3Y J;  1YRN B;  4M3B A;  4UUT A;  3BR2 A;  5BNG A;  4D7M A;  4CYC B;  1FEX A;  3UKG A;  1GT0 C;  1MSE C;  2EZK A;  1AKH B;  2MSY A;  2XB0 X;  5K7H A;  1CQT A;  1B8I A;  1TWH J;  2FX0 A;  3IH3 A;  5F0F A;  2XPV A;  4MIM A;  1FTT A;  1P7J A;  4XRS A;  2O7O A;  5J3L A;  1TWC J;  1X2N A;  2JA5 J;  4M3F A;  2OPT A;  5M3F J;  2HDD A;  3GTP J;  1MBG A;  1JTX A;  2DA6 A;  5EGO A;  4X1E A;  2DA2 A;  4Y52 J;  1OCT C;  3JRE A;  2NS8 A;  1RET A;  2VKE A;  2MW8 A;  3A02 A;  3BR1 A;  2Y30 A;  5FKN A;  1HCR A;  1BW5 A;  1AHD P;  5F27 A;  3LSR A;  3I4N J;  4IHY A;  3HGY A;  5IYD J;  3RKQ A;  1B72 B;  2HQ5 A;  2IAI A;  1DU0 A;  1ORK A;  1BL0 A;  4DYR A;  3FK6 A;  2X48 A;  5M3M J;  5M5Y J;  2LVS A;  3PO3 J;  3PO2 J;  2NS7 A;  3LSP A;  2DJN A;  3FIS A;  4MFD A;  2QCO A;  1OCP A;  3SJM A;  3HDD A;  3QQA A;  4AC0 A;  2L7Z A;  2MGQ A;  1PUF A;  5J1R A;  3ZQG A;  5GP9 A;  2K9S A;  3ZQI A;  2R5Y A;  4A3E J;  2IBD A;  3MKL A;  2DA7 A;  5EG0 A;  4M6V A;  3HOY J;  2VKV A;  3K7A J;  1IUF A;  2ID6 A;  2L0K A;  1FJL A;  2O8K A;  1VFC A;  1FIA A;  2X6O A;  4XRM A;  2L9R A;  3A01 A;  1TWG J;  1NK3 P;  9ANT A;  1H89 C;  4X6A J;  4JX6 A;  1W0U A;  2DA5 A;  1IJW C;  4I76 A;  1WI3 A;  1H88 C;  3BTC A;  1XG1 A;  3GTJ J;  1BA5 A;  4M3G A;  2EZH A;  3HOV J;  3BTJ A;  4W1U A;  2VI6 A;  3TP0 A;  2DMP A;  1QPI A;  1IG7 A;  2W48 A;  5E3O A;  5F04 A;  5FKO A;  2DA1 A;  2CU7 A;  2Y0S N;  3TED A;  5IYB J;  3S16 J;  2DN0 A;  3S17 J;  1RR7 A;  1U78 A;  3TP3 A;  2DMU A;  3RZD J;  2K9Q A;  2QF7 A;  4M3D A;  3JRF A;  5DTD A;  4D7N A;  1ETQ A;  1K83 J;  3BTI A;  3B6C A;  1B8I B;  5EZH A;  3HOU J;  4B3A A;  1JGG A;  2R93 J;  3MN2 A;  2Y31 A;  1JKQ C;  1JT0 A;  1TC3 C;  4MLO A;  1U8B A;  2CJJ A;  2LP0 A;  1JUP A;  1TWA J;  4FIS A;  1FIP A;  2EZL A;  5EGO B;  2G0E A;  2P81 A;  5IP7 J;  4RDU A;  1ETO A;  2M0C A;  4BBS J;  1IRZ A;  4I6Z A;  3BR3 A;  3NAR A;  1RKT A;  4XK4 A;  1QVU A;  3JRH A;  3BR0 A;  1ETV A;  2K9N A;  3JRG A;  1W0T A;  3S2H J;  2NVX J;  3SDG A;  3ZQF A;  5F0H A;  2K40 A;  3S1R J;  4GFB A;  3RZO J;  2DA4 A;  3QPS A;  2YS9 A;  1ETX A;  4D5C A;  3HOW J;  3A03 A;  3HM5 A;  3BQY A;  1S7E A;  4NDL A;  3NAU A;  5EDN A;  2MG4 A;  2HYJ A;  3MVP A;  4B4C A;  1PUF B;  3OOU A;  4QTR A;  1QVT A;  2NVQ J;  2R5Y B;  5M5W J;  1JJ6 C;  3HBL A;  1GV2 A;  5EF6 A;  5EG0 B;  2ECC A;  4S0H B;  4MO7 A;  3RQI A;  2VUM J;  3IH2 A;  1QRY A;  4FTH A;  3JRD A;  2WB1 N;  1D5Y A;  1JKP C;  4DW6 A;  1UHS A;  2JK3 A;  5K7F A;  1GUU A;  3A01 B;  2LFB A;  3HOX J;  3I4M J;  1I50 J;  2XPU A;  4DYC A;  2M2E A;  5C4X J;  1Z77 A;  2JJ7 A;  1XC5 A;  4XIC A;  1MBE A;  1MBJ A;  1X58 A;  3IH4 A;  5HOD A;  2JA8 J;  4A3D J;  3VPR A;  1MSF C;  1EF4 A;  1FTZ A;  3O8G A;  3JR9 A;  1T56 A;  4IHX A;  3H0G J;  4AUX A;  3SFI A;  5E3M A;  1WGX A;  1E3O C;  3B6A A;  2TCT A;  1Y1W J;  1MBF A;  4B1R A;  2EH3 A;  3C2B A;  2EQR A;  1T33 A;  1X2M A;  1HOM A;  2E1O A;  1HLV A;  2XRL A;  5JLW A;  1ITY A;  2ELK A;  1O4X A;  3WHB A;  3GTO J;  1JUM A;  3WHC A;  4IHW A;  5IOZ A;  1NK2 P;  1U9N A;  4Y7N J;  5C4J J;  4J19 A;  2ZB9 A;  4AYB N;  3JRI A;  2CUE A;  4A3J J;  3JRC A;  3S1Q J;  1IDY A;  1GDT A;  1U9O A;  1Y1V J;  2XGD A;  1MBK A;  2L7M P;  1BJZ A;  1MH3 A;  3E7L A;  3HOZ J;  2HXO A;  3LSG A;  5IP9 J;  2HOT A;  1LE8 A;  2ME0 A;  4W97 A;  5EEA A;  2E2I J;  5FKK A;  2LR8 A;  2XPW A;  2CQX A;  2WAQ N;  1ZKG A;  3HGG A;  1IV6 A;  4BY1 J;  3OIO A;  5EZG A;  4ABZ A;  2JA7 J;  3S2D J;  1A6I A;  2HOA A;  2FD5 A;  3F0C A;  2XSD C;  3JRA A;  1JUS A;  2R5Z A;  1I6H J;  1G2H A;  1ETW A;  4A3M J;  1VI0 A;  2JMW A;  2LK2 A;  5EYR A;  2ID3 A;  3S14 J;  3HEF A;  4C3I J;  1BW6 A;  5K7Z A;  2N8G A;  1H8A C;  1RKW A;  5E3L A;  3L1P A;  2COB A;  2OF7 A;  4G12 A;  4DYQ A;  3G1O A;  2I10 A;  4C3H J;  4BKX A;  2M34 A;  2AO9 A;  4LOC A;  1F36 A;  2EZI A;  3Q0V A;  1GV5 A;  1Q1V A;  5F08 A;  1DU6 A;  1GVD A;  2AHQ A;  5IP6 A;  3HKZ N;  2ECB A;  1UMQ A;  3G1M A;  3FIW A;  3Q0W A;  3G1L A;  2M9H A;  1IC8 A;  5F1J A;  2VPR A;  1JKR C;  1ENH A;  3S1N J;  2KT0 A;  3BTL A;  4IEJ A;  4QSH A;  2ME6 A;  3H3V K;  2LTP A;  2D5V A;  1VF9 A;  2LD5 A;  4JYK A;  1ZGW A;  5FLV A;  2DMN A;  1I3Q J;  5FJ8 J;  5FKL A;  4EEF G;  4JX4 A;  3S15 J;  2Y2Z A;  4XID A;  2TRT A;  4IHV A;  2E2J J;  2XGC A;  3GTM J;  4UUS A;  5DS9 A;  4BY7 J;  2LLK A;  3FKI J;  3M4O J;  2CQQ A;  3CQZ J;  3HB9 A;  3TW6 A;  2CUF A;  3FK7 A;  5IPA A;  1A5J A;  2DMT A;  2GBY A;  3QPL A;  1VND A;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...