2IT0A

Crystal structure of a two-domain ider-dna complex crystal form ii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
ELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
molecule keywords mbtA/mbtB operator strand 1
total genus 48
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2it0A01
4L5JA 5HLIA 1FPQA 2TDXA 2L01A 5DDGA 2PFBA 2FEZA 3Q9VA 4L9JA 2VT3A 3RKYA 1H9TA 1PP8F 5CLSA 1SFEA 3MFKA 5E1WA 4RGRA 1XGSA 3CTAA 1QO0D 1TQMA 4S04A 2FBKA 1CF7A 2OZUA 3WTZA 4HX4A 4A6EA 3ZMDA 1OYYA 5AONA 2IRFG 3KETA 1O3QA 2OAZA 3RI4A 1XSVA 3R0AA 1O3TA 2HKOA 2ZCWA 3WTTC 3CO6C 5H6QA 2WWYA 1FWZA 2CGPA 2FNPA 1FYKA 1EH8A 1QNTA 3VODA 1K79A 2XIGA 4A2UA 2PG4A 2R3SA 4Q47A 1RI7A 5FLXZ 1ZYRF 1BOAA 2MC3A 3H3UA 2ISYA 4U7DA 1FBUA 1ZRCA 1FOKA 2BGCA 1LNWA 4KIGA 2FBIA 1OYWA 3I58A 4OU0A 1R58A 5ICFA 5ERIA 2GAUA 1KQ9A 2AXLA 3KP2A 3JAMZ 5E8IA 2V1XA 3KCCA 2E7WA 1WWXA 2IA2A 4GXOA 3TOBA 5HDGA 1KGSA 2QVOA 2D45A 4A12A 2JZYA 1LJ9A 4Q48A 3J7AO 4L5IA 1S6LA 2KJBA 5H20A 1Z05A 4HZFA 3AAFA 4HA8A 1AWCA 3HRMA 1BI0A 2RGVA 2HTJA 1ZGJA 1HQCA 2DQLA 4M9SA 1UB9A 4EM0B 1RIOH 5AIQA 4ZH4F 2CQKA 3F21A 4RGSA 1ZN2A 2W24A 3TDZC 1G3SA 3I5UA 1EH7A 4JK1X 2KIMA 1IRGA 1YYVA 3M1EA 2EFPA 2FBHA 4WF2A 1D8KA 1YFHA 1XDUA 2ESHA 2M5WA 2KIUA 2F5FA 3C1DA 2ZNZA 4CZZA 1XD7A 3P9IA 1IZ1A 3T1BA 5HDKA 5F1RA 5CJ9A 1XMAA 4HV5A 1O57A 3E5QA 3K0LA 4P55A 5HDNA 3ZN1A 2G7HA 1J59A 3E6DA 2ADUA 1ZG5A 4YFXF 3ZQ7A 1YO5C 4LFUA 2HFHA 3REOA 2M1BA 2M87A 2VOOA 2HDCA 2OD5A 4UV8A 4OMYA 4ON0A 1DP7P 2QUFA 1IN5A 1B9MA 3PFIA 4AD9A 4BHCA 2W57A 3SXYA 4G9YA 4KIFA 1MKMA 2W85A 2MH2A 4EJOA 1MDMB 4Q5SF 2FRHA 2V79A 5LGUA 3R6SA 2QYOA 3LSTA 3R4KA 4BNCA 2ESNA 2QQAA 3FM3A 2P5KA 3DKWA 2VONA 3NQOA 4ZZLA 1G3YA 2OZ6A 2M30A 4XLPF 2FNAA 3JSOA 4BAYA 1W7PB 1Z7UA 3MQ0A 4ENNA 2H6BA 2HR3A 2HQRA 2XASA 3KFWX 3RDIA 4PCQA 1SD4A 2VBZA 1FSHA 4MQ9F 2DO7A 3KZZA 5BS6A 4ENJA 1TNSA 4GO1A 3TQNA 4K2EA 2DAOA 4LLLA 2GA2A 4FX4A 4ZYDA 1XCVA 1B9NA 3IC7A 4MEXF 2UWMA 3M7GA 3WGIA 3EQLF 1IXRC 2L4MA 2PMUA 3JSPA 5DCMB 2NYXA 3CO7C 3I64A 4PGGA 3RTRA 3E5XA 5DYMA 1J7KA 4RS8A 4BHBA 3ULQB 3EUHA 5F64A 5DUIA 3ISPA 4LB6B 3L09A 3V7CA 3COAC 1Z1DA 1BIBA 1WRJA 1LQ1A 4TV7A 2LF8A 2HYFA 4R8HA 4GYIA 2RKHA 2CSOA 2LNBA 5A2QK 2KKOA 4L18B 4LK1F 1R1VA 4BH9A 2E7XA 5BPIA 4LLGF 1HSJA 2DT5A 1R1TA 5DUKA 4IRGA 3IL2A 2FU4A 1D3YA 4OINF 1FX7A 1IN7A 1MJAA 2H27A 2FA5A 3QP6A 1ONVA 1T0FA 4P9FA 2VC1A 4U88A 1USSA 1ZREA 1OPCA 3GFJA 4QLCU 4PGHA 3HUGA 1DUXC 2VE8A 2RDPA 2VBYA 4Y15A 1TNTA 2K27A 4H0EA 4OIQF 5HLGA 3KE2A 1GHCA 4MNUA 3HOTA 1P92A 5LHGA 1K78B 4L0YB 4EMSA 4ENKA 2M45A 1P2FA 2L02A 4U7BA 2EFWA 5L3EA 2PI0A 4YFKF 1T6SA 1ZHFA 2XRNA 2VN2A 5D6FA 2PEXA 1G4DA 2F5EA 2XAGA 2D1VA 3V8JA 4EJUA 2XAFA 3P9CA 3OV8A 2HWVA 4ETSA 4L0ZB 3LAPA 4UV9A 4EGYA 2JPCA 3G73A 2XAHA 4Q4ZF 1BI2A 1J0RA 2GQQA 4ASNA 2QQBA 4HDUA 4ESJA 3ZPLA 3ROUA 2R7FA 3E6CC 2GXBA 1XGMA 3BY6A 1IRFA 2FOKA 2A69F 5D5XB 3BOQA 2OQRA 1AOYA 4P5OA 3FF5A 4HX8A 2BYVE 5E1XA 2Q0OA 3WTWC 2RV8A 1FSEA 3G3ZA 2GIVA 4WXDA 5ILUA 3O3KA 3MAJA 4LG0B 2FXAA 2FQ3A 5JFRA 3DEUA 3K1PA 1E17A 3L00A 4HF2A 1LEAA 3WU1B 4GCVA 1HKQA 1XDSA 2PJPA 4M6XA 1EH6A 1HBXG 4I7HA 1KQ8A 1FBSA 3K1MA 3CLOA 3TGNA 2A07F 1Z9CA 1R5HA 6PAXA 3K2ZA 3V8LA 2XAQA 1OMIA 3I0TA 1WI9A 3T8RA 3K69A 1UHWA 2XKPA 5L3DA 1QBJA 5L3BA 1R1UA 1P4AA 3HHGA 3N4MA 1S29A 4L9TA 3V7RA 1JGSA 3KEQA 3ZMTA 3ZN0A 3KP4A 4LG0A 1TQIA 4GYGA 3LWFA 4KDPA 2XV4S 4ZYGA 3HSRA 2ZMEB 1L0OC 3O2PE 2M8EA 3F3XA 1CGPA 5D5UB 4N9HA 5LRRA 2YX7A 3GUDA 2QBYB 5HLHA 1SD5A 4D0PA 2EV6A 2O0YA 3LQRA 1I1SA 1P6RA 4XSXF 2V1DA 1FYMA 5A2QZ 4UHTA 4FX0A 5LBQA 2PBIA 4KN7X 2ETHA 2UZKA 2VOPA 2A5YB 4AIKA 2E1NA 1OKRA 3H92A 4WK8F 2XAJA 3TO6A 3SQNA 5K5OA 2GWRA 1F1ZA 2LSOA 1YW7A 3DPLC 3DP7A 3DFGA 5TJJA 3WTXC 3ECHA 4UXNA 5BMZA 4IF4A 5FFXA 1F9NA 3MCZA 1ODDA 5ILSA 3GO5A 5HS9A 1ZG3A 1ZAOA 2LF7A 2DW4A 2QZ8A 3LA7A 3JTGA 4G94A 1D8JA 3DF8A 1YS6A 2RQPA 4WX9A 2IVMA 4HLYA 1ULYA 3FMRA 4KT5C 4Z2YA 3EYYA 4BHPA 2D1HA 1P4WA 2QBYA 4N0BA 4XBFA 1D5VA 3ZMSA 3V8KA 4EJWA 3MZHA 3CDHA 2EA2A 4UNOA 1W7PD 1QQIA 3FM5A 3HRTA 2HEOA 4FT8A 1V4RA 1FC3A 3E3VA 5K1YA 1YW9A 4R1HA 2HKXA 4BXUA 4N9IA 1HKSA 3V7SA 3WTSC 2DK8A 1WQ2A 3MWMA 1MZBA 4OIRF 4QWQA 3F8MA 3I54A 2L54A 4RB3C 4RB1A 1JXSA 2STWA 1IN4A 1ZGAA 4YIFA 3I4PA 3EETA 1PUEE 2Z9OA 3WG9A 3BDDA 2EK5A 4EM1A 4U0YA 1HW1A 2HGCA 4I09A 1KU9A 2UXXA 4P9UA 3LA3A 2P7CB 2CFXA 2R7DA 4UVCA 1ZLKA 2QENA 3I59B 2FMLA 1W7PA 2EJRA 2A3SA 3F8BA 2JPBA 2V6CA 1MJBA 4G7OF 2DU9A 1U5TA 2IA1A 2K4JA 4MGRA 2BBYA 1K7AA 3KP6A 5CVRA 1B4AA 3FXQA 1BI3A 2RNJA 5BQTA 4CHUA 3TKYA 4MHGA 1U5TB 3HRSA 5JR3A 4G6QA 4XLNF 5FFZA 4EJVA 2RC4A 3LQQA 3PQJA 4ESBA 5JVTA 1L3LA 2YR2A 4UVBA 2Q8KA 1HSTA 3P7NA 4KN4X 3BWGA 4CYDA 4Y17A 3NEUA 5ICCA 2STTA 1ZRDA 1O3SA 1K78A 3LA2A 3GF2A 5KVRA 3GZ6A 4S05A 3DV8A 3GFMA 4OIPF 1B6AA 2IW5A 1HW2A 1QZZA 4CICA 1ON2A 2ZBKA 1BI1A 4HYEA 4ENMA 3R0JA 3M8EA 4AWXB 2CG4A 1YG2A 4RGUA 3J80K 2DK5A 1YIOA 3OOPA 5FB2A 1FNNA 1STZA 2MLKA 1I5ZA 1FY7A 1DPRA 5BOXA 2X0LA 2XUBA 4WCGA 1IXSB 5EEHA 3WU0A 4HQMA 1G6NA 4XSZF 5HVQC 4ZZDA 2F5CA 4UUVA 2DI3A 4CDGA 4ZYEA 5LGTA 3IHUA 1T2KA 1R00A 3QU3A 4M71A 3EDPA 1SAXA 2E1CA 4YG2F 4OOIA 2PLYA 4M9XA 4O6JA 3GX4X 4XRFA 5J6XA 1J75A 2CWEA 2ZNYA 3HIFA 1SD7A 5JI6A 3WE3A 2BEOA 1J5YA 4A0ZA 5LHHA 2VXZA 4IRIA 1W5SA 3Q5FA 2DLLA 2QM3A 3WTUC 4E70A 5CYVA 3SHFA 2ZKZA 4G7ZF 2Z33A 4KICA 4I0AA 4RGXA 4RAZA 4HX7A 2QWWA 3O6BB 2W84A 4WWCA 3JAMK 4LJZF 2YSRA 4MTDA 1SMYF 3HRUA 5EEGA 1HW5A 2H09A 2XGXA 4HW0A 2L3DA 2YX4A 3J80Z 2NRAC 5LGNA 4UVAA 3J81K 1BM9A 1LDDA 2IP2A 2C6YA 3CJNA 2NS0A 3J81Z 3JTHA 1IF1A 3MZYA 2NAZA 1PDNC 5HS7A 3CUOA 2O03A 5DD4A 5ED4A 2EB7A 2Y0MA 1Z6RA 2RN7A 1KYZA 2D2WA 2JRTA 4WXHA 5K5RA 4HF1A 1MJ9A 2AS5F 3F23A 5D8LB 3GFLA 1SFUA 1ZARA 3N97A 3M8FA 4EV0A 2MBFA 4ESFA 3S2WA 4LD5A 4GGGA 1IXCA 2Y48A 3F6VA 4HBLA 3P9KA 1XB4A 2CO5A 2OQGA 2RVCA 2MLGA 1J2XA 5CVUA 1IN8A 4R79A 3C3WA 2HS5A 2OA4A 2ZJ2A 2A6EF 3RIRA 5E20A 4KMUX 2KJCA 2IJLA 1TW2A 2KRFA 5FD5A 4M73A 3I71A 2H6CA 4I98B 1LDJA 3GFIA 3DXJF 4EM2A 2QQ9A 5ICEA 2JT1A 5K5QA 2FF4A 4U0VA 2VODA 2HZTA 1B1BA 5TRDA 1A04A 2BE5F 2Z99A 3PQKA 1XSDA 3I53A 4BQAA 2O3FA 3WGHA 4NB5A 2W25A 3ABUA 5E1ZB 2QLZA 3WE2A 3ZMZA 1YW8A 3TO9A 2XROA 1TQPA 5IT3A 1FP1D 2EFOA 1RUOA 3T5XA 1S7AA 3F8CA 5E8GA 4M6YA 2P8TA 3R61A 5AIPA 1G3WA 3RYRA 5DV5A 1IAWA 1DPUA 5LLQA 1WKMA 1I27A 3KP3A 5D8KB 2HQNA 2MA3A 3KLNA 4YIIA 1OR7A 5ILVA 3LFKA 2ISZA 4AIJA 1QZYA 3JW4A 3CUQC 5LEKA 3KP7A 1U2WA 1XCBA 1O7FA 5H6RA 2BV6A 1SMTA 4JBAA 4NQWA 3KP5A 4I2OA 2JTVA 1FBQA 3FZVA 2VE9A 3SFZA 1MD0A 5D5WB 2DPDA 2PMHA 2WTEA 3HSEA 3F8NA 1W5TA 1KU2A 1C0WA 1TW3A 3RJPA 4F7ZA 2ZMEA 1LDKB 2Q2EA 5CVVA 2K7LA 4AIHA 1BIAA 3GLXA 1XN7A 1YTYA 4DNCA 1R5GA 1TTYA 1MDMA 2G9WA 4I0BA 1FLIA 3RPUA 3TOAA 1BBYA 4CO8A 3WODF 1SFXA 1BC8C 2HTSA 5D4RA 1DDNA 4EGZA 1IW7F 3BROA 4KFCA 2WC2A 2F5DA 4A5MA 4EJTA 4LLNA 2J5PA 4IHTA 2DQRA 5D5VB 3Q9SA 2GA1A 4M9ZA 3FX3A 3BJOA 3IKTA 1IN6A 2EFQA 3VB2A 3RPQA 1RNLA 2XHKA 3HOSA 3QPHA 4HDVA 4EVIA 4ZYHA 1P4XA 4BYYA 4NHJA 2KIFA 3WTYC 3BPVA 1VTNC 1LEBA 1CF7B 2A61A 1QPMA 2A6HF 3IKVA 3LAJA 4PZJA 1X3UA 1R23A 4M74A 2G7UA 3U9GA 1ZRFA 5L3CA 4OMZA 3F22A 2VC0A 2P7VB 1FT9A 2ZO4A 5CVJA 2PQ8A 3F6OA 1O3RA 1O7LA 3IRQA 2GXGA 4CXFA 3E6MA 1H0MA 3DPTA 4RAYA 1SD6A 3GW2A 1USTA 3FMSA 4P96A 3BPXA 4MTEA 4EQQA 1RUNA 2V9VA 2K86A 4LMYA 4A0XA 2ELHA 2EWNA 3K9TA 1F5TA 1S7OA 5JHUA 2HOEA 1UHMA 3VFZA 5E17F 3BP8A 4HAMA 2B0LA 3D0SA 1Q1HA 1YLFA 3HSFA 5LEJA 1GXPA 1FYLA 4MEYF 3ERED 1JE8A 2Y75A 3ZMUA 5FGMA 5L3GA 4G6DA 5DEQA 3GXOA 2IA0A 3RKXA 2VBXA 2DFIA 5F6FA 3CUQA 2FSWA 1UCRA 2VBWA 3B73A 1U3EM 2Z5UA 2WV0A 4G7HF 1B59A 1HKTA 3ZMVA 4IXAA 4KUMA 2XVCA 1I6XA 1NHAA 3I59A 2OBPA 1UFMA 1ON1A 2Z3YA 4HF0A 1ZG1A 1S8NA 3FHZA 3QU6A 4CGZA 1R22A 1HXDA 1KYWA 3GEZA 4KMFA 1RZ4A 3HTUA 5E18F 4A0YA 4HQEA 4I01A 5DCMA 2K02A 5D4SA 3VEPA 5J8CA 1XGOA 1V3FA 3F8FA 1W4MA 4MQVA 5J8FA 3V4GA 2ZXJA 5DD8A 1U78A 2CYYA 3EYIA 5IT9K 4YFNF 5FD6A 3E5UA 5CVIA 1T98A 5L3FA 3MEXA 3QAHA 4L9VA 2COMA 3KLOA 3C18A 4PDKA 3R60A 2L4AA 1LB2A 1PP7U 2VT2A 3WGGA 3QOPA 3SZPA 1KU3A 2P5VA 1U6GA 2LKPA 3ML6A 4IRHA 2JSCA 3U2RA 2O8XA 1U5TC 2P4WA 4KYWA 4HLXA 2OU2A 3QPTA 3TO7A 3B02A 2P6TA 2X4HA 3K1NA 2H94A 5KK1A 4RB2C 3HHHA 1LVAA 4Y13A 3QP5A 1XGNA 1G3TA 3U1DA 4WXCA 1BN5A 3WTVC 1QGPA 3KEOA 5BPDA 3FXUA 2F2EA 5ICGA 1KU7A 2MD5A 1MGTA 1XSXA 1Y0UA 1Z91A 4B8XA 3T0YA 3CUQB 4LB5A 1ZLJA 1IUYA 5LRSA 2EA4A 3ABTA 2J5OA 2V1UA 1Z6TA 2DPUA 4KA4A 4JQFA 3TDUC 4LGWA 5LHIA 3ECOA 3KZYA 1H9GA 4M72A 1JHHA 3GYHX 3W6KB 3ELKA 2PN6A 3C7JA 4A5NA 1S3JA 2EV5A 4LK0F 1TBXA 1YS7A 3GWZA 1OYIA 3HYIA 2EFNA 3D5LA 1KQ0A 3ZP5A 4O5VA 5DCFA 3E97A 4KIBA 2MH9A 3SZTA 3IWZA 3H3ZA 1T38A 4FHTA 4I02A 2LDUA 3M9AA 4G8XA 1FZPB 3F72A 3W6JB 2EV0A 4OIOF 5D6EA 3L7WA 1BC7C 2P5LC 2O6GE 3HTSB 3NRVA 4A6DA 3BZ6A 4U0WA 1J9IA 5FO5A 2DTRA 2O61A 3RYPA 4L9NA 3BJ6A 1KA8A 1TLHB 1REPC 1R7JA 2NNNA 1EV7A 4DQ2A 2FMYA 3T8TA 4KNYA 5HS8A 3IRRA 2A68F 3QRFF 3VOEA 4IJAA 1F4KA 1XMKA 3BJAA 3L2CA 2UXNA 1GXQA 2ACJA 5FLXK 4O3MA 1WSUA 1ZH5A 2FE3A 2YPRA 1BJAA 5HOOA 3FMQA 3E6BA 4HOBA 4IHSA 1GVJA 5IT9Z 2XKOA 1YQAA 2P6SA 2IPQX 1E2XA 3GZ5A 2YU3A 2ZFWA 1FP2A 3DQVC 2DBBA 3L9FA 2CW0F 1K6OA 2HYGD 2K4BA 1R36A 1T39A 4AVPA 2IT0A 2GZWA 2NNYA 4B09A 3FWEA 3RKWA 4HV6A 1I1GA 3GVAA 4IPAA 1U8RA 3IWFA 4RB0A 4IVNA 1JHFA 3FXRA
chains in the Genus database with same CATH superfamily
3H0DA 2FQ4A 4L5JA 5HLIA 1FPQA 2VQHA 2DDAA 2L01A 2TDXA 1NTCA 4PJMA 1IO2A 4E6KG 4KISA 5DDGA 2EINH 2PFBA 2FEZA 4BE2A 2JA7J 4RA2A 3Q9VA 4L9JA 4XNFA 2VT3A 3RKYA 1H9TA 2IGOA 2CFOA 2K9SA 1PP8F 5CLSA 5F0FA 1AHDP 1SFEA 3MFKA 4A3JJ 5E1WA 4ZDOA 4RGRA 1XGSA 3CTAA 1QO0D 1TQMA 3S93A 4S04A 2FBKA 1G59A 1CF7A 1MBHA 4ZC3A 2X51A 2OZUA 3WTZA 4HX4A 4A6EA 4UUTA 1R4MB 3ZMDA 3PNYA 1OCPA 1OYYA 2KPMA 5AONA 2IRFG 2B63J 2LP0A 3KETA 2H8WA 2R7TA 1Y56A 2KT0A 2GOMA 1O3QA 2OAZA 2PMZA 3RI4A 1XSVA 1Y8QB 1LFBA 3R0AA 1O3TA 2HKOA 2ZCWA 3WTTC 3CO6C 2FUG2 1BW6A 5H6QA 1LE8A 1QHGA 1ETQA 4ABZA 2WWYA 1RKWA 2WADA 1FWZA 4DYRA 2CGPA 2FNPA 1D0XA 1FYKA 1EH8A 2X6XA 1HC8A 3PNTA 4NDLA 1QNTA 3VODA 1MSEC 1K79A 3HXLA 2XIGA 4A2UA 2DFFA 3BG7A 3MKZA 1MBKA 2CUZA 2PG4A 2VQCA 3JRBA 2R3SA 4Q47A 1RI7A 5FLXZ 3X2QH 1IGNA 1ZYRF 1P7JA 1BOAA 3GBGA 2MC3A 2NVTJ 3H3UA 2ISYA 2LFBA 4U7DA 3S1QJ 4XORA 2LC2A 1FBUA 4PUSA 1ZRCA 2VJJA 1D0ZA 1S5LC 2EPFA 1H88C 1K83J 1FOKA 2XB0X 2BGCA 2JVHA 1LNWA 1HDPA 1RPWA 3DLAA 4N4NB 4KIGA 2FBIA 3TBIA 3M07A 3S14J 4NUBA 1OYWA 3I58A 3OSGA 4OU0A 3RSNA 1X2NA 3CCSI 1UJ8A 4I6ZA 1R58A 5ICFA 1I3AA 5DTDA 5ERIA 2GAUA 1KQ9A 2M2EA 3A2KA 2AXLA 3KP2A 3JAMZ 1QVTA 2V1XA 5E8IA 4A3MJ 3HOUJ 3KCCA 1X3ZB 2E7WA 2MC4A 1WWXA 2IA2A 1JUPA 1WGXA 2KLOA 4GXOA 3TOBA 2EZLA 1X3WB 5HDGA 1D1AA 4DZJA 1KGSA 3JRAA 2LRDA 2QVOA 4A69C 2L9VA 2D45A 4RMNA 4A12A 2JZYA 2MFZA 1LJ9A 4Q48A 5M3MJ 2V7FA 1APLC 3M4OJ 2KQRA 3GTLJ 2R7UA 2Y30A 2ZB9A 3J7AO 4L5IA 1QZEA 1S6LA 3BT9A 2KJBA 5H20A 3ZQGA 4A3BJ 3F0CA 4UB8C 2MABA 1Z05A 2UUZA 2K3PA 4HZFA 3AAFA 4HA8A 3ZR8X 1AWCA 3W2VA 4IL6C 2WB1N 3HRMA 1EJ9A 1MMGA 1BI0A 2RGVA 2HTJA 2HPIA 2DA4A 3CCMI 2HDDA 1EKEA 3A0BC 1Y39A 1ZGJA 4PJLA 3DBRB 1HQCA 1MMDA 3RPUD 5CQGA 1Y1WJ 3PJRA 2DQLA 4M9SA 1YJWI 1UB9A 1KZHA 4EM0B 1FJLA 5FKMA 4XONA 3HOZJ 2WAQA 3LSIA 1RIOH 2VI6A 5AIQA 4ZH4F 2CQKA 3GTMJ 3F21A 4RGSA 2LY2A 3S32A 2IS4A 1ZN2A 2W24A 3TDZC 1G3SA 3I5UA 5HODA 1EH7A 5FKNA 3CMMA 4JK1X 3OYIA 2KIMA 3NARA 1IRGA 1YYVA 2LBFB 3M1EA 2DMPA 4RLQA 3BTCA 2EFPA 2FBHA 3ZQIA 4WF2A 2RREA 4A3KJ 1D8KA 2DA7A 5B1AH 1YFHA 1XDUA 2ESHA 2M5WA 2KIUA 2QCOA 2F5FA 3O8GA 5FKOA 1SVOA 3M3YJ 3K4KA 3C1DA 4J01A 1CQTA 2ZNZA 4CZZA 1XD7A 3P9IA 1IZ1A 3T1BA 5H2FC 5HDKA 5F1RA 2F6CA 5CJ9A 1XMAA 4HV5A 2Y0SA 1O57A 3E5QA 3K0LA 2RAEA 4P55A 5HDNA 3ZN1A 1PYVA 2G7HA 3H9QA 3CCUI 3OYKA 3E6DA 1J59A 2ADUA 2DOAA 1ZG5A 4C9YA 4YFXF 4JOMA 3ZQ7A 5IP6A 3Q0WA 1YO5C 2XPWA 4LFUA 2HFHA 3REOA 3HEFA 2M1BA 2M87A 2VOOA 2HDCA 1UELB 2OD5A 2H8RA 1HDDC 1OCCH 1YI2I 2W00A 2BOLA 4ZJZA 4UV8A 4BJ6C 1GLNA 2V6EA 4OMYA 3DKYA 1ZR2A 1OISA 1XMXA 4ON0A 3DU5A 1DP7P 2QUFA 2VB6A 1IN5A 2QA4I 3IH2A 1B9MA 5GPAA 3D5RC 2R0QC 3PFIA 5EEAA 4AD9A 3ABKH 4CH7A 4BHCA 2W57A 3SXYA 1MH3A 3L2RA 4G9YA 4KIFA 4Y7NJ 4NNJA 3L2VA 5GTHC 3VYUB 3VDXA 1MKMA 4XKVA 2DA2A 2JA6J 2W85A 2MH2A 4EJOA 1MDMB 4Q5SF 2W4SA 3GZNB 2JMWA 2FRHA 1YOVB 2V79A 5LGUA 3R6SA 1MBFA 2QYOA 3FBNB 3MKLA 3LSTA 1IUFA 1VQLI 4JP0A 3R4KA 4BNCA 3RZOJ 2G0EA 3CF2A 2ESNA 3FXMA 1Y0NA 2QQAA 2B7EA 5GTIC 3KEYA 2BZTA 3FM3A 2MG4A 2P5KA 3DKWA 3HM5A 5DS9A 2F4IA 1XG1A 3VSKA 1RRJA 2VONA 3S1MJ 3NQOA 2Y9ZA 1IDZA 4ZZLA 1G3YA 3C2BA 2ZJPF 2OZ6A 2M30A 2X9DA 1S9HA 4XLPF 2FNAA 3JSOA 1BR1A 4BAYA 1DU6A 1W7PB 1Z7UA 2JWTA 3MQ0A 4ENNA 2Y69H 2H6BA 2HR3A 2HQRA 4XIDA 2XASA 2I5UA 1PJRA 3KFWX 3DU6A 3BTIA 4E7HA 3RDIA 4PCQA 1I39A 1SD4A 2VBZA 1FSHA 2HQAA 4BS9A 3OMYA 4MQ9F 4NQWB 2DO7A 3KZZA 5BS6A 2ECBA 1TNSA 4ENJA 1V5EA 1LFUP 4GO1A 3TQNA 4K2EA 2RNGA 3ABLH 2DAOA 2DFEA 1HCRA 4LLLA 2GA2A 4XLFA 1VQ7I 4FX4A 4ZYDA 3JCUC 2BY3A 3PUFA 1XCVA 2QKLB 1B9NA 9ANTA 2DPDA 2X85A 3IC7A 4MEXF 2UWMA 3M7GA 1BJZA 2R7QA 3WGIA 4FISA 3EQLF 3OYJA 1IXRC 3DEWA 2R93J 2L4MA 2PMUA 2M0MA 3JSPA 5DCMB 2NYXA 3CO7C 3I64A 4PGGA 3RTRA 3KIOA 3E5XA 3CC4I 5DYMA 3TW6A 1J7KA 4RS8A 3F9KA 4BHBA 3BZKA 3ULQB 3EUHA 5F64A 3CCJI 2OJED 2ZXWH 5DUIA 3ISPA 1YX5A 2NOGA 4HNVA 3S3OA 1XX5A 4LB6B 1QA6A 2TRTA 4JX6A 4A3DJ 2AO9A 1MBJA 2LKXA 3L09A 2NVUB 2QSGX 2E19A 3V7CA 4B1RA 3COAC 1Z1DA 1BIBA 3G4SI 1WRJA 5KAIC 4TV7A 1LQ1A 2LF8A 4XLEA 2HYFA 4CCNA 2HNHA 2VKHA 1GT0C 4HEA2 2LLKA 4DW6A 3CDLA 1ETVA 4CCMA 2OF7A 4R8HA 4GYIA 3CESA 2RKHA 2CSOA 2LNBA 5A2QK 1W36C 4E4HA 1UG2A 2KKOA 3ZQLA 1HOMA 4L18B 4LK1F 1R1VA 3C2GA 4BH9A 4H4KC 1XTAA 2E7XA 5BPIA 4LLGF 2GXAA 1HSJA 2DT5A 1R1TA 5DUKA 5TGTA 5B5EC 1R5ID 4IRGA 3IL2A 2FU4A 1D3YA 4CCKA 4OINF 2KDOA 1VQ8I 1FX7A 1ENHA 2WB1A 1ITYA 3TP3A 1IN7A 4IEJA 4BEHA 5HNHA 1MJAA 4CZCA 2FA5A 3QP6A 2H27A 3GTGJ 1AA7A 2ZC2A 1SAUA 3S1RJ 5GPCA 3PFYA 4X6AJ 2KDZA 3VWBA 1ONVA 4D7MA 1T0FA 4P9FA 1OFCX 2VC1A 4U88A 1USSA 1UMQA 2VXDA 1OPCA 2GIZA 4CSWA 1X19A 3GFJA 1ZREA 2DYSH 4QLCU 4PGHA 4F93B 4AYBA 3HUGA 3VYRB 2LG4A 1PUFA 2K3FA 1DUXC 2VE8A 1VQOI 2M7AA 2RDPA 3BZCA 2VBYA 4Y15A 1TNTA 2K27A 4E7KA 4H0EA 4OIQF 1SC7A 1EA3A 2X1EA 5HLGA 4CCOA 3KE2A 3UR3C 3CF5F 1F36A 3U21A 1GHCA 3ZRGA 2XF7A 4MNUA 5J4VA 4BJTA 2HXOA 4XRMA 2DCEA 1X1DA 4XKCA 3ASNH 3IAM2 3HOTA 4C3IJ 1P92A 5LHGA 2ZMEC 2VKEA 2R7WA 2JUGA 3UKGA 1K78B 1FOXA 1WI3A 4L0YB 4EMSA 4ENKA 2M45A 2R5ZA 1P2FA 2L02A 4U7BA 2BW3B 1KONA 2EFWA 3EUKL 3KYLA 5L3EA 3JRCA 3BG5A 2PI0A 4Y52J 4PFPA 4YFKF 5M5WJ 1T6SA 2QSFX 2M4KA 1Z0XA 1ZHFA 2XRNA 2KZGA 2VN2A 5D6FA 3G71I 3FDYA 2PEXA 1FIAA 2F4OB 5IYBJ 4DZPA 1G4DA 2F5EA 4F92B 2V9PA 1ETKA 2XAGA 2D1VA 3V8JA 4EJUA 3LFUA 1WJDA 2VASA 2XAFA 3P9CA 4PK4A 3OV8A 2KRCA 1IRZA 3H5NA 2EILH 4KJZA 2HWVA 4ETSA 4L0ZB 3LAPA 4UV9A 4EGYA 2I10A 1W5CC 1Q1VA 2JPCA 3G73A 2XAHA 5K7HA 2M34A 3L2QA 4Q4ZF 2JA5J 3HOXJ 1BI2A 2QSHX 1RR7A 2JRMA 1J0RA 1MSFC 2GQQA 3JRHA 4ASNA 2QQBA 1YJNI 4HDUA 4ESJA 3ZPLA 3ROUA 2R7FA 2P81A 3RCOA 4PSXA 3E6CC 4XKBA 2GXBA 1ERDA 1XGMA 3BY6A 2CS3A 3H36A 1IRFA 3K4MA 4JX4A 2FOKA 3HPGA 3WG7H 1H89C 2A69F 4LIVA 4E7IA 5D5XB 2V4JC 3BOQA 4QIWN 2OQRA 1Z21A 1AOYA 4P5OA 5CKTA 1TP4A 1BA5A 2CV0A 2MYSA 2OTLI 3FF5A 1FOWA 5JLXA 4HX8A 3IH4A 2BYVE 3K4CA 2Q0OA 5E1XA 3WTWC 2RV8A 1FSEA 1TWAJ 3G3ZA 2K9NA 5E3LA 4HPQA 2MSYA 2GIVA 4RAFA 4WXDA 5ILUA 3AL0C 2WBMA 1JGGA 3O3KA 1W0TA 1YE9A 3MAJA 4LG0B 1WCMJ 2FJ1A 2FXAA 3FKJA 2FQ3A 5JFRA 5KHDA 1RESA 3DEUA 1ZKGA 3K1PA 2DA3A 1E17A 4NC6A 3M8JA 1LFPA 1NG6A 3L00A 4HF2A 1W1WE 1LEAA 1X2MA 4I99C 3WU1B 2PMZN 4GCVA 5EGOB 1QHHD 1HKQA 5JHFA 1XDSA 2O8KA 2XRLA 2PJPA 1IV6A 2VJ4A 4M6XA 1EH6A 3K4JA 4I7HA 1HBXG 3AKZA 3HOVJ 1KQ8A 4M3GA 4XLCA 1FBSA 3HJEA 3K1MA 3CLOA 3TGNA 2A07F 2HOSA 1Z9CA 1R5HA 4NC8A 2IS6A 2DOEA 6PAXA 3K2ZA 1YIJI 3V8LA 2XAQA 1X4OA 1OMIA 3I0TA 1ZR4A 1WI9A 4XR6A 2IBDA 3T8RA 4NBQA 3K69A 1UHWA 2NS7A 2XKPA 3HB9A 5L3DA 5L3BA 4F3QA 1QBJA 1R1UA 3CP2A 2XAUA 1P4AA 3H35A 3MN2A 4HSTA 4W97A 3HHGA 4CUGA 1Y6IA 1JKRC 3N4MA 2R5YB 1S29A 4L9TA 3V7RA 2QKMB 3KYCB 3FXOA 3CCQI 1JGSA 3KEQA 3ZMTA 4ZDPA 3ZN0A 4DGWB 3KP4A 4LG0A 1TQIA 4GYGA 3LWFA 5B66C 4KDPA 2XV4S 4ZYGA 3S2HJ 3HSRA 2ZMEB 4LIUA 1MH4A 1L0OC 3O2PE 4XK4A 2M8EA 3F3XA 3LSMA 1CGPA 3OIOA 1Z3XA 2Z16A 1JT6A 2L9SA 5D5UB 4M3EA 4N9HA 2AQFA 2QEXI 3GTQJ 5LRRA 2YX7A 1IDYA 1SFKA 3GUDA 4IQ4A 3RZDJ 2VUMJ 1S72I 3PSIA 1W0UA 2QBYB 4U87A 5HLHA 3BG3A 3A4CA 1SD5A 2JUCA 4D0PA 3VYSB 1ORKA 3VYTB 2PJRA 2OUMA 2E35A 3CP8A 2EV6A 2O0YA 3LQRA 1DGWY 1P6RA 1I1SA 4XSXF 2E2IJ 1DQUA 2V1DA 1FYMA 5A2QZ 4UHTA 3MKWB 4FX0A 4MFDA 2JVGA 2DJIA 4BU2A 2PBIA 2BY0A 4KN7X 2K9LA 3EPZA 5LBQA 2ETHA 2UZKA 2VOPA 2A5YB 4YEJA 5IYCJ 4AIKA 2E1NA 4BXXJ 1OKRA 2M4GA 3H92A 4WK8F 2Y2ZA 2XAJA 3DPUA 4A3FJ 1XS9A 2XSJC 3TO6A 3D1NI 3SQNA 3G1OA 2X1DA 5K5OA 1LVKA 4RAGA 5J1UA 2GWRA 1F1ZA 4FCYA 1E3OC 5LFAA 2HYJA 2LSOA 1YW7A 2YS9A 3DPLC 3DP7A 3ESWB 3DFGA 5TJJA 3WTXC 5IY5H 3ECHA 4UXNA 3GTKJ 5BMZA 3LMMA 4IF4A 5FFXA 1F9NA 3MCZA 2K85A 1ODDA 2E5NA 5ILSA 3RKQA 2EZKA 3GO5A 4D5CA 2VLAA 2EBIA 2N8GA 4XM3A 3DKXA 5HS9A 1A5JA 2XGEA 1HA8A 3FXKA 1VFCA 2XGDA 1ZG3A 1ZAOA 3NWSA 3AG4H 5FRMA 2F48A 2LF7A 5F1JA 2DW4A 2QZ8A 3LA7A 3JTGA 4AVZA 4G94A 4E7JA 4AU7A 1YJ9I 1D8JA 1UZCA 1VI0A 3DF8A 1YS6A 3BCAA 2RQPA 4WX9A 1MBGA 2IVMA 4HLYA 1ULYA 1OCOH 3FMRA 2EH3A 1MIJA 2KMUA 4KT5C 4Z2YA 5F27A 3EYYA 2QGUA 4BHPA 2VIXA 5BNGA 1MMSA 2D1HA 1P4WA 2QBYA 4N0BA 2EIMH 4XBFA 3PO3J 3G2BA 1JKPC 5FJ8J 1D5VA 3DTEA 3ZMSA 3V8KA 2CQ7A 1SVMA 4EJWA 3MZHA 3CDHA 2EA2A 1Z3YA 4UNOA 1W7PD 4MO7A 1QQIA 2R4GA 3OS0A 3FM5A 3HRTA 2HEOA 1Y8RB 2ZSHB 4FT8A 3QYFA 3BQYA 4IHWA 1V4RA 1FC3A 3H5AA 1A31A 2O9LA 3E3VA 1TT5B 5F08A 5K1YA 3OSFA 1YW9A 4HNUA 2V26A 4R1HA 1A36A 3HUGB 2M8GX 3DLLF 2HKXA 4KT6A 3IH3A 4BXUA 5KNLA 2E71A 4N9IA 1HKSA 4II3A 3BR0A 3V7SA 3WTSC 1VNDA 2D5VA 2DK8A 1WQ2A 3MWMA 4XLHA 1MZBA 1XC5A 2M7BA 4OIRF 4KITB 1GV5A 1MBEA 4J19A 3RQIA 4QWQA 4M3DA 3F8MA 2LTPA 3I54A 2L54A 4RB3C 3HDDA 4RB1A 1JXSA 2ZJRF 2STWA 2R7ZJ 1IN4A 3LSRA 1ZGAA 4YIFA 3I4PA 2LY9A 3EETA 4B43A 1PUEE 2Z9OA 4BQOA 2L7KA 3WG9A 3S15J 3M1CA 1T33A 3CDIA 3BDDA 2XGCA 2EK5A 4EM1A 4U0YA 2LOOA 3FBIB 2X6YA 4V2FA 5C3EJ 1HW1A 1WFXA 2HGCA 4I09A 1VQPI 1KU9A 2UXXA 4P9UA 3SYTA 3LA3A 4B3XA 1BL0A 4BL0B 2CFXA 2R7DA 4UVCA 2P7CB 1ZLKA 2QENA 4CCLA 3I59B 2FMLA 3ZQHA 1W7PA 3FK6A 2EJRA 1WZ2A 1EF4A 2BW3A 3GLLA 1X4PA 2A3SA 3F8BA 2LK2A 2XDVA 4DIQA 2XF5A 4CCJA 2JPBA 2V6CA 1MJBA 2WA0A 3H1CA 3A01B 2GM4A 4G7OF 1X58A 2DU9A 1U5TA 2IA1A 2K4JA 4MGRA 2BBYA 1PVEA 1K7AA 5HNFA 3O8HA 3KP6A 5CVRA 5IPAA 1B4AA 2OV7A 2O7OA 3FXQA 3KX2A 1BI3A 4ITVA 2RNJA 5BQTA 4HSRA 2WAFA 4CHUA 1JUSA 1U0JA 1RKTA 2Z1DA 3TKYA 2VPLA 4MHGA 1U5TB 2Q1ZB 4PJ0C 1AKHA 1NG7A 5C4XJ 1VQKI 3H5RA 3HRSA 2WY8Q 5JR3A 5GP9A 3S3NA 4G6QA 4XLNF 5FFZA 4EJVA 2RC4A 1B72A 1X1BA 3LQQA 2IS1A 3PQJA 2VJIA 2XPVA 1N78A 2E34A 4MFEA 1SEUA 5KCMA 4ESBA 5JVTA 2BY2A 1X1AA 1L3LA 1HLVA 4OAYA 3J7ZI 2YR2A 3K70D 4UVBA 3CMAI 5EYRA 4JX5A 2Q8KA 1I50J 1OR7C 3BR2A 3A01A 1HSTA 3P7NA 1JT0A 4KN4X 3BWGA 4B47A 4CYDA 4Y17A 3LL7A 4HNTA 5HLTA 3NEUA 5ICCA 1Z7LA 3TEDA 2STTA 1ZRDA 3HOYJ 1O3SA 1D1BA 1I6HJ 1K78A 1MNDA 2R7RA 2P0WA 2QQ8A 3LA2A 3SFIA 3GF2A 5KVRA 3GZ6A 4S05A 3DV8A 3GFMA 4OIPF 4BGDA 3ZGKA 2HOTA 1B6AA 4II2A 3QYBA 5EG0A 3PO2J 4BDYA 2IW5A 2VQGA 3SZGA 1HW2A 1QZZA 4CICA 3Q0UA 1R4NB 1ON2A 2ZBKA 1BI1A 4HYEA 3DTKA 4ENMA 4ZTFA 3S3MA 1GUUA 2IGMA 3C2HA 3R0JA 3M8EA 3ONQA 4AWXB 2CG4A 3K7AJ 3WHCA 4XICA 1PUFB 1YG2A 2W82A 4RGUA 3AL0B 3LSJA 3MD2A 4BDZA 5E3OA 5IYDJ 3J80K 2JJ7A 2DK5A 1UG0A 3ZOBA 1YIOA 1VQNI 3IP4B 4IHVA 1OJLA 1YX3A 3W3CA 3I4MJ 3OOPA 5FB2A 2K9MA 2H1LA 1FNNA 2BY1A 1STZA 1HF0A 2L2OA 2MLKA 5FRNA 4PSWA 2K9QA 1I5ZA 4C2TA 1FY7A 1DPRA 3BTJA 5BOXA 2X0LA 4BE0A 2XUBA 2JSPA 1T95A 2E1MC 3QPSA 4WCGA 1IXSB 5EEHA 3WU0A 2ECCA 4HQMA 3OYCA 1G6NA 4XSZF 4CYCA 5HVQC 1ZQ3P 2CV1A 4HRIA 4ZZDA 4BE1A 1T08B 3CQZJ 2F5CA 4UUVA 2DI3A 4CDGA 3IUOA 4ZYEA 5LGTA 2ZSIB 1E3PA 3FKIJ 3IHUA 3Q3SA 1T8IA 1T2KA 1R00A 3QU3A 4E7SA 2KISA 4M71A 3EDPA 1ETXA 2L9RA 1SAXA 1D1CA 3OYDA 2E1CA 1VQ4I 2HQ5A 1RC9A 4BUPA 4YG2F 4A3IJ 2OCCH 5JVGF 4W1UA 4OOIA 1JJ8C 3BQZA 2JQ7A 2PLYA 4M9XA 1WJCA 3BCBA 2HVRA 1LUJB 4O6JA 3GX4X 3K4LA 4XRFA 3QODA 5J6XA 1J75A 2CWEA 3RQ4A 2ZNYA 2DMQA 3HIFA 3I4NJ 1SD7A 1ETYA 2YUSA 5JI6A 2H1KA 4BQQA 3WE3A 2BEOA 1J5YA 4A0ZA 5J47A 5LHHA 3CD6I 2VXZA 4F55A 4RLFA 4IRIA 1W5SA 3Q5FA 2DLLA 2QM3A 3WTUC 4QTRA 3S2DJ 3J7YJ 4E70A 5CYVA 3SHFA 2ZKZA 4BACA 4G7ZF 2Z33A 3GMEA 2ZFUA 4BXFA 4F52A 1R9TJ 3BR1A 4KICA 2CUEA 2IS2A 2NVYJ 3I3LA 3GTPJ 2UV1A 4OWRB 1OLTA 2A5WA 5GAHJ 4DBRA 2HXIA 4I0AA 3CZ6A 1H8AC 1OCTC 4RGXA 4RAZA 4HX7A 3OYNA 2QWWA 1Z67A 3O6BB 2W84A 1VQ9I 4WWCA 2O5RA 3JAMK 4LJZF 2YSRA 4MTDA 2XB5A 3JRIA 1SMYF 3HRUA 5EEGA 1HW5A 2H09A 2XGXA 1TWFJ 4J00A 3BTLA 4HW0A 3GCMA 2F4MB 1DGRM 2L3DA 2LH9A 2YX4A 3J80Z 4XOTA 1U8BA 1IG7A 5LGNA 4UVAA 3J81K 2NRAC 1FIPA 1WJ5A 1BM9A 1LDDA 2XPUA 5KAFC 1B8IA 4Y33A 3OYAA 2IP2A 2C6YA 3CJNA 2NS0A 3J81Z 3JTHA 4Z6YA 1FMVA 1IF1A 3FHNA 3K4BA 4XOPA 1AU7A 3MZYA 2NAZA 1PDNC 3FXJA 5HS7A 3CUOA 2NS8A 3DTIA 2O03A 5DD4A 1IJWC 4CA0A 1WJEA 5B3SH 5ED4A 3H3VK 2EB7A 2Y0MA 4DOZA 3OYLA 3S1NJ 1NK3P 3DWLE 2R5ZB 1Z6RA 1LE8B 2RN7A 1KYZA 4B3AA 2E2HJ 2DODA 2D2WA 2JRTA 5CQEA 4WXHA 5K5RA 2BXYA 4DYQA 4HF1A 2Z2SB 2M9HA 1MJ9A 2AS5F 2VKDA 2PJRB 4DYCA 4AM3A 3F23A 5D8LB 2DMTA 3GFLA 1SFUA 1ZARA 3MKYB 4XMYA 2BXZA 2WY7Q 4Y4RA 3N97A 3M8FA 4EV0A 2MBFA 1W36D 4ESFA 2ZXIA 3S2WA 3CC7I 2AXTC 4XLAA 3JRGA 2CQQA 4LD5A 1BR2A 2X1CA 1DP3A 4L5EA 4GGGA 1IXCA 2Y48A 3E0JB 3F6VA 4HBLA 3P9KA 3K4NA 1XB4A 2CO5A 2OQGA 1TZLA 2RVCA 2MLGA 4QPQA 1J2XA 5CVUA 1IN8A 4R79A 5J3LA 1MMNA 3C3WA 2HS5A 2OA4A 2ZJ2A 1YITI 3LOCA 4D5FA 2A6EF 3RIRA 5E20A 4KMUX 2KJCA 2IJLA 5GADJ 2R5YA 1TW2A 2KRFA 5FD5A 2R7VA 1YRNB 5IP7J 1TC3C 4M73A 3I71A 2H6CA 2E1OA 4I98B 1I3QJ 1LDJA 4QPOA 3GFIA 2VKVA 3I56I 2IXSA 3DXJF 4XRSA 1VQMI 4EM2A 2QQ9A 1O4XA 3OYHA 5ICEA 2JT1A 3GTJJ 5K5QA 2FF4A 5FROA 2DMUA 4U0VA 3JRFA 1RR8C 2VODA 2HZTA 3JR9A 1B1BA 5TRDA 1A04A 2BE5F 1XPXA 5FLVA 2Z99A 4RBOA 1R49A 3HZJA 1X1PA 3PQKA 2ID6A 1XSDA 3I53A 4I76A 4BQAA 4RDUA 2ME0A 2CUJA 3SDGA 2O3FA 3WGHA 4IQJA 2GOXB 4NB5A 2W25A 3B6AA 4Y3OA 3K2AA 2M0CA 1N77A 2TCTA 3V42A 3ABUA 2BVLA 2E60A 2KRHA 5E1ZB 2QLZA 4DJAA 4PFOA 1JKQC 3WE2A 3JRDA 2LREA 3ZMZA 1YW8A 5E79C 3TO9A 4GFBA 1WH5A 2XROA 1TQPA 5M3FJ 5IT3A 4IO9F 1FP1D 2EFOA 4PJNA 1RUOA 4FASD 3T5XA 1S7AA 3F8CA 5E8GA 4M6YA 2P8TA 3R61A 5AIPA 1G3WA 3RYRA 3QYEA 5DV5A 1IAWA 3OIQA 1DPUA 5LLQA 1WKMA 1I27A 1POGA 1AKHB 3BR6A 3KP3A 3CCRI 5D8KB 2NXNB 3G1LA 2HQNA 2ELJA 2MA3A 3KLNA 2RQQA 5F04A 4YIIA 3MMYB 1OR7A 3E1SA 5ILVA 3LFKA 1QZYA 1WH7A 3HGGA 3JW4A 4AIJA 2ISZA 5EDNA 4MLOA 3CUQC 5LEKA 3KP7A 1V54H 1TT0A 2JN6A 1T56A 1U2WA 3ERMA 1XCBA 1O7FA 5H6RA 2BV6A 1SMTA 4JBAA 4NQWA 2NOJB 3OYFA 3KP5A 4IKFA 3OYMA 4I2OA 2JTVA 1FBQA 3FZVA 2BVMA 4JYKA 3SFZA 1MD0A 1IRXA 5D5WB 2VE9A 2L7FP 3CCLI 5JLWA 2K5CA 1UAAA 3P5JA 1TWHJ 2K40A 2PMHA 2WTEA 3KYDB 4C3HJ 5E3NA 2HPMA 4XQFA 2ELKA 3HSEA 3F8NA 1W5TA 1KU2A 2BHZA 2X6OA 3H0GJ 2KL4A 4A93J 3OIPA 4XN0A 5C44J 3FXLA 2EIJH 3A1YA 4EATA 1TW3A 2HOAA 1C0WA 3QOEA 5GAGJ 3RJPA 3PIOF 2LD5A 2PX9A 3HL2A 4V19K 2F5VA 4F7ZA 2ZMEA 1LDKB 3CCEI 2KIQA 2A6TA 2Q2EA 4B44A 2HU9A 5CVVA 2K7LA 4AIHA 1BIAA 2R7OA 2JA2A 3GLXA 3PL8A 1XN7A 1A6QA 1YTYA 4DNCA 3K10A 1R5GA 1TTYA 3MZ8A 1MDMA 3H9JA 2G9WA 4I0BA 3Q0VA 4IOCF 1FLIA 3HG9A 1SVLA 3RPUA 4FE4A 5K7FA 3A03A 5F0HA 5J1YA 3TOAA 2MD0A 2WAQN 3HBLA 3K70C 1BBYA 4V2GA 4CO8A 2EQRA 1SFXA 3U1KA 3WODF 2HTSA 1BC8C 2ID3A 3NAUA 5D4RA 1DDNA 1G2HA 4EGZA 1IW7F 2E36A 3BROA 2AHQA 5J40A 2DA1A 4KFCA 2WC2A 2F5DA 4FE7A 4A5MA 5J1RA 4EJTA 4LLNA 2J5PA 5FKLA 5EZGA 4BEHB 4IHYA 2DXIA 4IHTA 4LITA 2DQRA 4ZTJA 3WHBA 4G6TB 2CH0A 3ZXSA 3VSLA 5D5VB 3Q9SA 4DBQA 2GA1A 4M9ZA 3FX3A 3BJOA 4MIMA 3IKTA 1IN6A 1V5GA 2KFDA 3OL4A 2EFQA 1G8XA 2JA8J 3VB2A 3RPQA 1RNLA 4G12A 2Y31A 1FTTA 4ZYAA 3FISA 2FOWA 1ZGWA 3W6VA 2XHKA 3HOSA 3QPHA 5EG0B 4HDVA 4ANJA 1MNMC 4EVIA 4ZYHA 1JUMA 1P4XA 4D9JA 4BYYA 4E7LA 4NHJA 4E7ZA 3A0HC 2HZDA 2KIFA 3WTYC 3BPVA 1VTNC 2CQNA 5TISC 1LEBA 1CF7B 2DMNA 3H9GA 2A61A 2W1OA 1QPMA 4RM2A 1TL8A 2A6HF 3PSFA 4EEFG 2MW8A 4BJ5C 1K4TA 2LMDA 3IKVA 3LAJA 4C30A 1P9QC 4PZJA 5E3MA 3OYEA 1WJAA 1X3UA 2NVXJ 3NWTA 1R23A 4M74A 1J09A 2G7UA 2COBA 2FD5A 3QPLA 3U9GA 1ZRFA 3OY9A 2ICWG 5L3CA 4OMZA 3F22A 2VC0A 1JTYA 2P7VB 1FT9A 4BBRJ 2GBYA 2ZO4A 3A02A 5CVJA 2PQ8A 3GTOJ 2E2JJ 4BBSJ 3F6OA 1O3RA 4YRVA 4BY1J 4ZDLA 2DN0A 3SDBA 3WU2C 3TP0A 1QVUA 1O7LA 1MMAA 2M3AA 2DA6A 3IRQA 5F0CA 2DOFA 2GXGA 4CXFA 3E6MA 2KHMA 4UUSB 3DPTA 4RAYA 1H0MA 1SD6A 3GW2A 1USTA 3OS1A 3S17J 4FETA 2OCEA 4M6VA 2DYRH 3FMSA 4P96A 3BPXA 4MTEA 3VPRA 4EQQA 1K4SA 2FX0A 1ETOA 4XL9A 1RUNA 2V9VA 2K86A 4OAZA 4LMYA 4A0XA 2CUFA 2ELHA 2EWNA 3K9TA 1F5TA 2IGKA 4XKWA 1DU0A 1S7OA 3SEQA 2CU7A 2A05A 5JHUA 2HOEA 2QF7A 1UHMA 3D5SC 4XRSG 4N4OB 1MNEA 2E1MB 3VFZA 4C2UA 3PM1A 5E17F 3BP8A 4HAMA 3QWLA 1D5YA 2B0LA 2JK3A 3D0SA 1LPQA 1Q1HA 1YLFA 2CMPA 4IX7A 3HSFA 3L2UA 4X1EA 2IAIA 5LEJA 1GXPA 1FYLA 1WJBA 4MEYF 3ERED 1JE8A 2Y75A 3ZMUA 5FGMA 1Z77A 5L3GA 1R71A 2E5ZA 4G6DA 2L5QA 5DEQA 3GXOA 4LG3A 4CYCB 2IA0A 3RKXA 4QSHA 2VBXA 1V5FA 2DFIA 3CMEI 5F6FA 3OWTA 3CUQA 2R7SA 2FSWA 1UCRA 2VBWA 4C3JJ 2DTZA 3B73A 3L1PA 2R7XA 1U3EM 2I8DA 2L0KA 3AG1H 3QQAA 1ZK8A 1JI8A 2Z5UA 2WV0A 4G7HF 1B59A 1N25A 1HKTA 3ZMVA 2NVQJ 1FTZA 4IXAA 1JTXA 1SANA 2DT6A 4KUMA 3SJMA 3OS2A 2EZIA 2XVCA 2OPTA 1I6XA 1NHAA 2CW7A 1FOYA 4LOCA 3I59A 2OBPA 3S8PA 3FK7A 1UFMA 1ON1A 2Z3YA 1QU3A 4HF0A 3TMOA 1WPKA 3BG9A 1FEXA 2ME6A 3W2WA 5C4JJ 1ZG1A 1S8NA 3FHZA 3QU6A 2B9SA 4CGZA 3KZIC 3PUBA 1R22A 5B1BH 3HKZA 4AIDA 1HXDA 1KYWA 3GEZA 3OR1C 4KMFA 1RZ4A 2LY1A 3HTUA 5E18F 1OCRH 4AC0A 4M3BA 4A0YA 4HQEA 4I01A 3I9V2 5DCMA 2YU9J 2K02A 5D4SA 3J7AY 3VEPA 2XC7A 3EUHC 3SEZA 5J8CA 1XGOA 1V3FA 3F8FA 1W4MA 4MQVA 5J8FA 3V4GA 1GDTA 4RM3A 2ZXJA 3OYBA 3OR2C 1VQ6I 2IEKA 3EUAA 3MVPA 5DD8A 3L2WA 1U78A 2CYYA 3EYIA 5IT9K 4YFNF 3IV5A 5FD6A 3G6EI 3E5UA 5CVIA 2EIKH 2V1NA 4A3GJ 1T98A 3CJQB 3G1MA 5L3FA 3MEXA 3QAHA 5IOYA 4L9VA 3ZQQA 4X0GA 2Y0SN 1WHUA 2COMA 3KLOA 2AQEA 3JREA 1B72B 3C18A 4PDKA 2HVQA 2L4AA 3R60A 4A3EJ 1LB2A 3HC7A 3CLQA 5J4YA 4FQGA 1PP7U 3BR3A 2VT2A 3WGGA 2XF6A 1QPIA 3QOPA 2KP6A 2VQLA 3AG3H 4NC7A 3SZPA 1KU3A 2P5VA 4AUXA 1P7IA 2CRGA 1U6GA 3AG2H 3DBLB 2LKPA 3KPHA 3ML6A 2WV1A 1A6IA 4IRHA 2JSCA 4P1WA 1NK2P 5IOZA 2Q2EB 5CPRB 3U2RA 2O8XA 4UY8I 1GVDA 1U5TC 2P4WA 4KYWA 4HLXA 2OU2A 4B4CA 3QPTA 3TO7A 3B02A 1OCZH 1RETA 2P6TA 3LNQA 4UUSA 1WJFA 2HDWA 3ABMH 1E0EA 2X4HA 2L7MP 2H94A 2VPRA 3K1NA 5KK1A 3TL4X 3HKZN 2DT7B 4RB2C 3HHHA 2BHYA 2CW8A 1QRYA 2V9KA 1LVAA 2DDBA 4Y13A 2CV2A 3QP5A 2EZHA 2ZXHA 1XGNA 2X6WA 3FIWA 2CJJA 1G3TA 3U1DA 4HG2A 4WXCA 1BN5A 1T0FC 1UHSA 3WTVC 1BW5A 1QGPA 3KEOA 3CCYA 3FXUA 5BPDA 2KZVA 4B48A 1Y1VJ 2XSDC 2CQXA 2F2EA 5ICGA 5FLMJ 1KU7A 3K6GA 2R92J 2MD5A 3AFHA 2Y9YA 1VF9A 1MGTA 2GLOA 4PJJA 1XSXA 2L7ZA 1Y0UA 3E7LA 5M5YJ 1Z91A 3S16J 4B8XA 5M5XJ 5DM6F 3HGYA 3T0YA 3CUQB 4LB5A 1ZLJA 1IUYA 2IGNA 1WVRA 5LRSA 2EA4A 3ABTA 4D1QA 2J5OA 2V1UA 1Z6TA 4BKXA 2OC6A 2DPUA 4KA4A 4JQFA 3TDUC 4S0HB 4LGWA 5EF6A 2LR8A 3ZQCA 5LHIA 3I55I 3TW7A 3ECOA 4YIRX 2OTJI 3KZYA 1U9NA 1H9GA 4M72A 1JHHA 3GYHX 5IP9J 3PNVA 3LSKA 3W6KB 1SFOJ 4IHXA 1S7EA 3ELKA 3ASOH 3CCVI 2PN6A 3C7JA 4A5NA 5GAEJ 1JKOC 1S3JA 2EV5A 4LK0F 1TBXA 2MGQA 3N05A 1ZTRA 1YS7A 3GWZA 2ZJQF 1F43A 1OYIA 2W48A 3HYIA 4GDFA 2EFNA 3D5LA 3OOUA 1KQ0A 1VZ0A 3ZP5A 4O5VA 5DCFA 3E97A 3PIPF 4KIBA 2MH9A 3SZTA 5LD2C 3IWZA 3H3ZA 1T38A 4BQNA 4FHTA 4I02A 3LSHA 2LDUA 4XN3A 3M9AA 4G8XA 3F72A 1FZPB 3LSPA 3W2AA 1E3HA 3ZCOA 4YELA 4IOAF 3W6JB 2EV0A 4OIOF 3UNGC 5D6EA 4IZZA 3L7WA 1K61A 1BC7C 3BR5A 2P5LC 2O6GE 5EJCA 1N75A 1B8IB 4A6DA 3NRVA 3HTSB 4D7NA 5K7ZA 5EGOA 3B6CA 3OYGA 3BZ6A 3DBHB 3CJRB 4U0WA 5FO5A 1IC8A 1J9IA 2DTRA 3DEEA 3OL3A 2O61A 3BG6A 5DM7F 3BC8A 3RYPA 1OQYA 4L9NA 4UB6C 3BJ6A 1K6YA 2X48A 1TLHB 1KA8A 4A3CJ 1REPC 1R7JA 1TWCJ 1VQ5I 1YHQI 2NNNA 1NH3A 3DCFA 1ZELA 1EV7A 1M1EB 2L9NA 2DFHA 2LVSA 1GV2A 4DQ2A 2FMYA 3T8TA 1LKXA 2VL8A 4KNYA 1ETWA 2HVSA 5HS8A 3IRRA 2WAEA 2LBFA 2A68F 3QRFF 4A3LJ 3VOEA 3CMYA 4IJAA 1F4KA 1A35A 1XMKA 1MW7A 3BLYA 1FMWA 3BJAA 2LYCA 3L2CA 2UXNA 1GXQA 2ACJA 3LSGA 1R6RA 5FLXK 4O3MA 1WSUA 4M3FA 1ZH5A 1V55H 2FE3A 2YPRA 3HOWJ 1TWGJ 1BJAA 5HOOA 4C2MJ 3FMQA 3E6BA 4HOBA 4IHSA 1GVJA 5IT9Z 2XKOA 2VJ5A 1YQAA 2P6SA 1ACIA 1IV8A 1BR4A 3IAS2 2IPQX 1E2XA 3GZ5A 2YU3A 2ZFWA 1FP2A 4AYBN 3DQVC 2HI3A 2DBBA 3L9FA 2CW0F 4F91B 2W7NA 2DA5A 1JJ6C 5EZHA 1YRNA 1K6OA 2HYGD 2DJNA 1R36A 2K4BA 3HPHA 1T39A 3CJTB 4AVPA 2LKSA 2IT0A 2GZWA 1BOBA 3CC2I 2NNYA 1U9OA 3ZQFA 1X1CA 4B09A 4FTHA 3FWEA 4BY7J 3RKWA 4HV6A 4GRIA 1I1GA 3GVAA 4IPAA 1U8RA 3IWFA 4RB0A 4IVNA 1JHFA 5FKKA 1D0YA 3FXRA
chains in the Genus database with same CATH topology
4L5JA 5HLIA 1FPQA 2TDXA 2L01A 5DDGA 2PFBA 2FEZA 3Q9VA 4L9JA 2VT3A 3RKYA 1H9TA 1PP8F 5CLSA 1SFEA 3MFKA 5E1WA 4RGRA 1XGSA 3CTAA 1QO0D 1TQMA 4S04A 2FBKA 1CF7A 2OZUA 3WTZA 4HX4A 4A6EA 3ZMDA 1OYYA 5AONA 2IRFG 3KETA 1O3QA 2OAZA 3RI4A 1XSVA 3R0AA 1O3TA 2HKOA 2ZCWA 3WTTC 3CO6C 5H6QA 2WWYA 1FWZA 2CGPA 2FNPA 1FYKA 1EH8A 1QNTA 3VODA 1K79A 2XIGA 4A2UA 2PG4A 2R3SA 4Q47A 1RI7A 5FLXZ 1ZYRF 1BOAA 2MC3A 3H3UA 2ISYA 4U7DA 1FBUA 1ZRCA 1FOKA 2BGCA 1LNWA 4KIGA 2FBIA 1OYWA 3I58A 4OU0A 1R58A 5ICFA 5ERIA 2GAUA 1KQ9A 2AXLA 3KP2A 3JAMZ 5E8IA 2V1XA 3KCCA 2E7WA 1WWXA 2IA2A 4GXOA 3TOBA 5HDGA 1KGSA 2QVOA 2D45A 4A12A 2JZYA 1LJ9A 4Q48A 3J7AO 4L5IA 1S6LA 2KJBA 5H20A 1Z05A 4HZFA 3AAFA 4HA8A 1AWCA 3HRMA 1BI0A 2RGVA 2HTJA 1ZGJA 1HQCA 2DQLA 4M9SA 1UB9A 4EM0B 1RIOH 5AIQA 4ZH4F 2CQKA 3F21A 4RGSA 1ZN2A 2W24A 3TDZC 1G3SA 3I5UA 1EH7A 4JK1X 2KIMA 1IRGA 1YYVA 3M1EA 2EFPA 2FBHA 4WF2A 1D8KA 1YFHA 1XDUA 2ESHA 2M5WA 2KIUA 2F5FA 3C1DA 2ZNZA 4CZZA 1XD7A 3P9IA 1IZ1A 3T1BA 5HDKA 5F1RA 5CJ9A 1XMAA 4HV5A 1O57A 3E5QA 3K0LA 4P55A 5HDNA 3ZN1A 2G7HA 1J59A 3E6DA 2ADUA 1ZG5A 4YFXF 3ZQ7A 1YO5C 4LFUA 2HFHA 3REOA 2M1BA 2M87A 2VOOA 2HDCA 2OD5A 4UV8A 4OMYA 4ON0A 1DP7P 2QUFA 1IN5A 1B9MA 3PFIA 4AD9A 4BHCA 2W57A 3SXYA 4G9YA 4KIFA 1MKMA 2W85A 2MH2A 4EJOA 1MDMB 4Q5SF 2FRHA 2V79A 5LGUA 3R6SA 2QYOA 3LSTA 3R4KA 4BNCA 2ESNA 2QQAA 3FM3A 2P5KA 3DKWA 2VONA 3NQOA 4ZZLA 1G3YA 2OZ6A 2M30A 4XLPF 2FNAA 3JSOA 4BAYA 1W7PB 1Z7UA 3MQ0A 4ENNA 2H6BA 2HR3A 2HQRA 2XASA 3KFWX 3RDIA 4PCQA 1SD4A 2VBZA 1FSHA 4MQ9F 2DO7A 3KZZA 5BS6A 4ENJA 1TNSA 4GO1A 3TQNA 4K2EA 2DAOA 4LLLA 2GA2A 4FX4A 4ZYDA 1XCVA 1B9NA 3IC7A 4MEXF 2UWMA 3M7GA 3WGIA 3EQLF 1IXRC 2L4MA 2PMUA 3JSPA 5DCMB 2NYXA 3CO7C 3I64A 4PGGA 3RTRA 3E5XA 5DYMA 1J7KA 4RS8A 4BHBA 3ULQB 3EUHA 5F64A 5DUIA 3ISPA 4LB6B 3L09A 3V7CA 3COAC 1Z1DA 1BIBA 1WRJA 1LQ1A 4TV7A 2LF8A 2HYFA 4R8HA 4GYIA 2RKHA 2CSOA 2LNBA 5A2QK 2KKOA 4L18B 4LK1F 1R1VA 4BH9A 2E7XA 5BPIA 4LLGF 1HSJA 2DT5A 1R1TA 5DUKA 4IRGA 3IL2A 2FU4A 1D3YA 4OINF 1FX7A 1IN7A 1MJAA 2H27A 2FA5A 3QP6A 1ONVA 1T0FA 4P9FA 2VC1A 4U88A 1USSA 1ZREA 1OPCA 3GFJA 4QLCU 4PGHA 3HUGA 1DUXC 2VE8A 2RDPA 2VBYA 4Y15A 1TNTA 2K27A 4H0EA 4OIQF 5HLGA 3KE2A 1GHCA 4MNUA 3HOTA 1P92A 5LHGA 1K78B 4L0YB 4EMSA 4ENKA 2M45A 1P2FA 2L02A 4U7BA 2EFWA 5L3EA 2PI0A 4YFKF 1T6SA 1ZHFA 2XRNA 2VN2A 5D6FA 2PEXA 1G4DA 2F5EA 2XAGA 2D1VA 3V8JA 4EJUA 2XAFA 3P9CA 3OV8A 2HWVA 4ETSA 4L0ZB 3LAPA 4UV9A 4EGYA 2JPCA 3G73A 2XAHA 4Q4ZF 1BI2A 1J0RA 2GQQA 4ASNA 2QQBA 4HDUA 4ESJA 3ZPLA 3ROUA 2R7FA 3E6CC 2GXBA 1XGMA 3BY6A 1IRFA 2FOKA 2A69F 5D5XB 3BOQA 2OQRA 1AOYA 4P5OA 3FF5A 4HX8A 2BYVE 5E1XA 2Q0OA 3WTWC 2RV8A 1FSEA 3G3ZA 2GIVA 4WXDA 5ILUA 3O3KA 3MAJA 4LG0B 2FXAA 2FQ3A 5JFRA 3DEUA 3K1PA 1E17A 3L00A 4HF2A 1LEAA 3WU1B 4GCVA 1HKQA 1XDSA 2PJPA 4M6XA 1EH6A 1HBXG 4I7HA 1KQ8A 1FBSA 3K1MA 3CLOA 3TGNA 2A07F 1Z9CA 1R5HA 6PAXA 3K2ZA 3V8LA 2XAQA 1OMIA 3I0TA 1WI9A 3T8RA 3K69A 1UHWA 2XKPA 5L3DA 1QBJA 5L3BA 1R1UA 1P4AA 3HHGA 3N4MA 1S29A 4L9TA 3V7RA 1JGSA 3KEQA 3ZMTA 3ZN0A 3KP4A 4LG0A 1TQIA 4GYGA 3LWFA 4KDPA 2XV4S 4ZYGA 3HSRA 2ZMEB 1L0OC 3O2PE 2M8EA 3F3XA 1CGPA 5D5UB 4N9HA 5LRRA 2YX7A 3GUDA 2QBYB 5HLHA 1SD5A 4D0PA 2EV6A 2O0YA 3LQRA 1I1SA 1P6RA 4XSXF 2V1DA 1FYMA 5A2QZ 4UHTA 4FX0A 5LBQA 2PBIA 4KN7X 2ETHA 2UZKA 2VOPA 2A5YB 4AIKA 2E1NA 1OKRA 3H92A 4WK8F 2XAJA 3TO6A 3SQNA 5K5OA 2GWRA 1F1ZA 2LSOA 1YW7A 3DPLC 3DP7A 3DFGA 5TJJA 3WTXC 3ECHA 4UXNA 5BMZA 4IF4A 5FFXA 1F9NA 3MCZA 1ODDA 5ILSA 3GO5A 5HS9A 1ZG3A 1ZAOA 2LF7A 2DW4A 2QZ8A 3LA7A 3JTGA 4G94A 1D8JA 3DF8A 1YS6A 2RQPA 4WX9A 2IVMA 4HLYA 1ULYA 3FMRA 4KT5C 4Z2YA 3EYYA 4BHPA 2D1HA 1P4WA 2QBYA 4N0BA 4XBFA 1D5VA 3ZMSA 3V8KA 4EJWA 3MZHA 3CDHA 2EA2A 4UNOA 1W7PD 1QQIA 3FM5A 3HRTA 2HEOA 4FT8A 1V4RA 1FC3A 3E3VA 5K1YA 1YW9A 4R1HA 2HKXA 4BXUA 4N9IA 1HKSA 3V7SA 3WTSC 2DK8A 1WQ2A 3MWMA 1MZBA 4OIRF 4QWQA 3F8MA 3I54A 2L54A 4RB3C 4RB1A 1JXSA 2STWA 1IN4A 1ZGAA 4YIFA 3I4PA 3EETA 1PUEE 2Z9OA 3WG9A 3BDDA 2EK5A 4EM1A 4U0YA 1HW1A 2HGCA 4I09A 1KU9A 2UXXA 4P9UA 3LA3A 2P7CB 2CFXA 2R7DA 4UVCA 1ZLKA 2QENA 3I59B 2FMLA 1W7PA 2EJRA 2A3SA 3F8BA 2JPBA 2V6CA 1MJBA 4G7OF 2DU9A 1U5TA 2IA1A 2K4JA 4MGRA 2BBYA 1K7AA 3KP6A 5CVRA 1B4AA 3FXQA 1BI3A 2RNJA 5BQTA 4CHUA 3TKYA 4MHGA 1U5TB 3HRSA 5JR3A 4G6QA 4XLNF 5FFZA 4EJVA 2RC4A 3LQQA 3PQJA 4ESBA 5JVTA 1L3LA 2YR2A 4UVBA 2Q8KA 1HSTA 3P7NA 4KN4X 3BWGA 4CYDA 4Y17A 3NEUA 5ICCA 2STTA 1ZRDA 1O3SA 1K78A 3LA2A 3GF2A 5KVRA 3GZ6A 4S05A 3DV8A 3GFMA 4OIPF 1B6AA 2IW5A 1HW2A 1QZZA 4CICA 1ON2A 2ZBKA 1BI1A 4HYEA 4ENMA 3R0JA 3M8EA 4AWXB 2CG4A 1YG2A 4RGUA 3J80K 2DK5A 1YIOA 3OOPA 5FB2A 1FNNA 1STZA 2MLKA 1I5ZA 1FY7A 1DPRA 5BOXA 2X0LA 2XUBA 4WCGA 1IXSB 5EEHA 3WU0A 4HQMA 1G6NA 4XSZF 5HVQC 4ZZDA 2F5CA 4UUVA 2DI3A 4CDGA 4ZYEA 5LGTA 3IHUA 1T2KA 1R00A 3QU3A 4M71A 3EDPA 1SAXA 2E1CA 4YG2F 4OOIA 2PLYA 4M9XA 4O6JA 3GX4X 4XRFA 5J6XA 1J75A 2CWEA 2ZNYA 3HIFA 1SD7A 5JI6A 3WE3A 2BEOA 1J5YA 4A0ZA 5LHHA 2VXZA 4IRIA 1W5SA 3Q5FA 2DLLA 2QM3A 3WTUC 4E70A 5CYVA 3SHFA 2ZKZA 4G7ZF 2Z33A 4KICA 4I0AA 4RGXA 4RAZA 4HX7A 2QWWA 3O6BB 2W84A 4WWCA 3JAMK 4LJZF 2YSRA 4MTDA 1SMYF 3HRUA 5EEGA 1HW5A 2H09A 2XGXA 4HW0A 2L3DA 2YX4A 3J80Z 2NRAC 5LGNA 4UVAA 3J81K 1BM9A 1LDDA 2IP2A 2C6YA 3CJNA 2NS0A 3J81Z 3JTHA 1IF1A 3MZYA 2NAZA 1PDNC 5HS7A 3CUOA 2O03A 5DD4A 5ED4A 2EB7A 2Y0MA 1Z6RA 2RN7A 1KYZA 2D2WA 2JRTA 4WXHA 5K5RA 4HF1A 1MJ9A 2AS5F 3F23A 5D8LB 3GFLA 1SFUA 1ZARA 3N97A 3M8FA 4EV0A 2MBFA 4ESFA 3S2WA 4LD5A 4GGGA 1IXCA 2Y48A 3F6VA 4HBLA 3P9KA 1XB4A 2CO5A 2OQGA 2RVCA 2MLGA 1J2XA 5CVUA 1IN8A 4R79A 3C3WA 2HS5A 2OA4A 2ZJ2A 2A6EF 3RIRA 5E20A 4KMUX 2KJCA 2IJLA 1TW2A 2KRFA 5FD5A 4M73A 3I71A 2H6CA 4I98B 1LDJA 3GFIA 3DXJF 4EM2A 2QQ9A 5ICEA 2JT1A 5K5QA 2FF4A 4U0VA 2VODA 2HZTA 1B1BA 5TRDA 1A04A 2BE5F 2Z99A 3PQKA 1XSDA 3I53A 4BQAA 2O3FA 3WGHA 4NB5A 2W25A 3ABUA 5E1ZB 2QLZA 3WE2A 3ZMZA 1YW8A 3TO9A 2XROA 1TQPA 5IT3A 1FP1D 2EFOA 1RUOA 3T5XA 1S7AA 3F8CA 5E8GA 4M6YA 2P8TA 3R61A 5AIPA 1G3WA 3RYRA 5DV5A 1IAWA 1DPUA 5LLQA 1WKMA 1I27A 3KP3A 5D8KB 2HQNA 2MA3A 3KLNA 4YIIA 1OR7A 5ILVA 3LFKA 2ISZA 4AIJA 1QZYA 3JW4A 3CUQC 5LEKA 3KP7A 1U2WA 1XCBA 1O7FA 5H6RA 2BV6A 1SMTA 4JBAA 4NQWA 3KP5A 4I2OA 2JTVA 1FBQA 3FZVA 2VE9A 3SFZA 1MD0A 5D5WB 2DPDA 2PMHA 2WTEA 3HSEA 3F8NA 1W5TA 1KU2A 1C0WA 1TW3A 3RJPA 4F7ZA 2ZMEA 1LDKB 2Q2EA 5CVVA 2K7LA 4AIHA 1BIAA 3GLXA 1XN7A 1YTYA 4DNCA 1R5GA 1TTYA 1MDMA 2G9WA 4I0BA 1FLIA 3RPUA 3TOAA 1BBYA 4CO8A 3WODF 1SFXA 1BC8C 2HTSA 5D4RA 1DDNA 4EGZA 1IW7F 3BROA 4KFCA 2WC2A 2F5DA 4A5MA 4EJTA 4LLNA 2J5PA 4IHTA 2DQRA 5D5VB 3Q9SA 2GA1A 4M9ZA 3FX3A 3BJOA 3IKTA 1IN6A 2EFQA 3VB2A 3RPQA 1RNLA 2XHKA 3HOSA 3QPHA 4HDVA 4EVIA 4ZYHA 1P4XA 4BYYA 4NHJA 2KIFA 3WTYC 3BPVA 1VTNC 1LEBA 1CF7B 2A61A 1QPMA 2A6HF 3IKVA 3LAJA 4PZJA 1X3UA 1R23A 4M74A 2G7UA 3U9GA 1ZRFA 5L3CA 4OMZA 3F22A 2VC0A 2P7VB 1FT9A 2ZO4A 5CVJA 2PQ8A 3F6OA 1O3RA 1O7LA 3IRQA 2GXGA 4CXFA 3E6MA 1H0MA 3DPTA 4RAYA 1SD6A 3GW2A 1USTA 3FMSA 4P96A 3BPXA 4MTEA 4EQQA 1RUNA 2V9VA 2K86A 4LMYA 4A0XA 2ELHA 2EWNA 3K9TA 1F5TA 1S7OA 5JHUA 2HOEA 1UHMA 3VFZA 5E17F 3BP8A 4HAMA 2B0LA 3D0SA 1Q1HA 1YLFA 3HSFA 5LEJA 1GXPA 1FYLA 4MEYF 3ERED 1JE8A 2Y75A 3ZMUA 5FGMA 5L3GA 4G6DA 5DEQA 3GXOA 2IA0A 3RKXA 2VBXA 2DFIA 5F6FA 3CUQA 2FSWA 1UCRA 2VBWA 3B73A 1U3EM 2Z5UA 2WV0A 4G7HF 1B59A 1HKTA 3ZMVA 4IXAA 4KUMA 2XVCA 1I6XA 1NHAA 3I59A 2OBPA 1UFMA 1ON1A 2Z3YA 4HF0A 1ZG1A 1S8NA 3FHZA 3QU6A 4CGZA 1R22A 1HXDA 1KYWA 3GEZA 4KMFA 1RZ4A 3HTUA 5E18F 4A0YA 4HQEA 4I01A 5DCMA 2K02A 5D4SA 3VEPA 5J8CA 1XGOA 1V3FA 3F8FA 1W4MA 4MQVA 5J8FA 3V4GA 2ZXJA 5DD8A 1U78A 2CYYA 3EYIA 5IT9K 4YFNF 5FD6A 3E5UA 5CVIA 1T98A 5L3FA 3MEXA 3QAHA 4L9VA 2COMA 3KLOA 3C18A 4PDKA 3R60A 2L4AA 1LB2A 1PP7U 2VT2A 3WGGA 3QOPA 3SZPA 1KU3A 2P5VA 1U6GA 2LKPA 3ML6A 4IRHA 2JSCA 3U2RA 2O8XA 1U5TC 2P4WA 4KYWA 4HLXA 2OU2A 3QPTA 3TO7A 3B02A 2P6TA 2X4HA 3K1NA 2H94A 5KK1A 4RB2C 3HHHA 1LVAA 4Y13A 3QP5A 1XGNA 1G3TA 3U1DA 4WXCA 1BN5A 3WTVC 1QGPA 3KEOA 5BPDA 3FXUA 2F2EA 5ICGA 1KU7A 2MD5A 1MGTA 1XSXA 1Y0UA 1Z91A 4B8XA 3T0YA 3CUQB 4LB5A 1ZLJA 1IUYA 5LRSA 2EA4A 3ABTA 2J5OA 2V1UA 1Z6TA 2DPUA 4KA4A 4JQFA 3TDUC 4LGWA 5LHIA 3ECOA 3KZYA 1H9GA 4M72A 1JHHA 3GYHX 3W6KB 3ELKA 2PN6A 3C7JA 4A5NA 1S3JA 2EV5A 4LK0F 1TBXA 1YS7A 3GWZA 1OYIA 3HYIA 2EFNA 3D5LA 1KQ0A 3ZP5A 4O5VA 5DCFA 3E97A 4KIBA 2MH9A 3SZTA 3IWZA 3H3ZA 1T38A 4FHTA 4I02A 2LDUA 3M9AA 4G8XA 1FZPB 3F72A 3W6JB 2EV0A 4OIOF 5D6EA 3L7WA 1BC7C 2P5LC 2O6GE 3HTSB 3NRVA 4A6DA 3BZ6A 4U0WA 1J9IA 5FO5A 2DTRA 2O61A 3RYPA 4L9NA 3BJ6A 1KA8A 1TLHB 1REPC 1R7JA 2NNNA 1EV7A 4DQ2A 2FMYA 3T8TA 4KNYA 5HS8A 3IRRA 2A68F 3QRFF 3VOEA 4IJAA 1F4KA 1XMKA 3BJAA 3L2CA 2UXNA 1GXQA 2ACJA 5FLXK 4O3MA 1WSUA 1ZH5A 2FE3A 2YPRA 1BJAA 5HOOA 3FMQA 3E6BA 4HOBA 4IHSA 1GVJA 5IT9Z 2XKOA 1YQAA 2P6SA 2IPQX 1E2XA 3GZ5A 2YU3A 2ZFWA 1FP2A 3DQVC 2DBBA 3L9FA 2CW0F 1K6OA 2HYGD 2K4BA 1R36A 1T39A 4AVPA 2IT0A 2GZWA 2NNYA 4B09A 3FWEA 3RKWA 4HV6A 1I1GA 3GVAA 4IPAA 1U8RA 3IWFA 4RB0A 4IVNA 1JHFA 3FXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5J A;  5HLI A;  1FPQ A;  2TDX A;  2L01 A;  5DDG A;  2PFB A;  2FEZ A;  3Q9V A;  4L9J A;  2VT3 A;  3RKY A;  1H9T A;  1PP8 F;  5CLS A;  1SFE A;  3MFK A;  5E1W A;  4RGR A;  1XGS A;  3CTA A;  1QO0 D;  1TQM A;  4S04 A;  2FBK A;  1CF7 A;  2OZU A;  3WTZ A;  4HX4 A;  4A6E A;  3ZMD A;  1OYY A;  5AON A;  2IRF G;  3KET A;  1O3Q A;  2OAZ A;  3RI4 A;  1XSV A;  3R0A A;  1O3T A;  2HKO A;  2ZCW A;  3WTT C;  3CO6 C;  5H6Q A;  2WWY A;  1FWZ A;  2CGP A;  2FNP A;  1FYK A;  1EH8 A;  1QNT A;  3VOD A;  1K79 A;  2XIG A;  4A2U A;  2PG4 A;  2R3S A;  4Q47 A;  1RI7 A;  5FLX Z;  1ZYR F;  1BOA A;  2MC3 A;  3H3U A;  2ISY A;  4U7D A;  1FBU A;  1ZRC A;  1FOK A;  2BGC A;  1LNW A;  4KIG A;  2FBI A;  1OYW A;  3I58 A;  4OU0 A;  1R58 A;  5ICF A;  5ERI A;  2GAU A;  1KQ9 A;  2AXL A;  3KP2 A;  3JAM Z;  5E8I A;  2V1X A;  3KCC A;  2E7W A;  1WWX A;  2IA2 A;  4GXO A;  3TOB A;  5HDG A;  1KGS A;  2QVO A;  2D45 A;  4A12 A;  2JZY A;  1LJ9 A;  4Q48 A;  3J7A O;  4L5I A;  1S6L A;  2KJB A;  5H20 A;  1Z05 A;  4HZF A;  3AAF A;  4HA8 A;  1AWC A;  3HRM A;  1BI0 A;  2RGV A;  2HTJ A;  1ZGJ A;  1HQC A;  2DQL A;  4M9S A;  1UB9 A;  4EM0 B;  1RIO H;  5AIQ A;  4ZH4 F;  2CQK A;  3F21 A;  4RGS A;  1ZN2 A;  2W24 A;  3TDZ C;  1G3S A;  3I5U A;  1EH7 A;  4JK1 X;  2KIM A;  1IRG A;  1YYV A;  3M1E A;  2EFP A;  2FBH A;  4WF2 A;  1D8K A;  1YFH A;  1XDU A;  2ESH A;  2M5W A;  2KIU A;  2F5F A;  3C1D A;  2ZNZ A;  4CZZ A;  1XD7 A;  3P9I A;  1IZ1 A;  3T1B A;  5HDK A;  5F1R A;  5CJ9 A;  1XMA A;  4HV5 A;  1O57 A;  3E5Q A;  3K0L A;  4P55 A;  5HDN A;  3ZN1 A;  2G7H A;  1J59 A;  3E6D A;  2ADU A;  1ZG5 A;  4YFX F;  3ZQ7 A;  1YO5 C;  4LFU A;  2HFH A;  3REO A;  2M1B A;  2M87 A;  2VOO A;  2HDC A;  2OD5 A;  4UV8 A;  4OMY A;  4ON0 A;  1DP7 P;  2QUF A;  1IN5 A;  1B9M A;  3PFI A;  4AD9 A;  4BHC A;  2W57 A;  3SXY A;  4G9Y A;  4KIF A;  1MKM A;  2W85 A;  2MH2 A;  4EJO A;  1MDM B;  4Q5S F;  2FRH A;  2V79 A;  5LGU A;  3R6S A;  2QYO A;  3LST A;  3R4K A;  4BNC A;  2ESN A;  2QQA A;  3FM3 A;  2P5K A;  3DKW A;  2VON A;  3NQO A;  4ZZL A;  1G3Y A;  2OZ6 A;  2M30 A;  4XLP F;  2FNA A;  3JSO A;  4BAY A;  1W7P B;  1Z7U A;  3MQ0 A;  4ENN A;  2H6B A;  2HR3 A;  2HQR A;  2XAS A;  3KFW X;  3RDI A;  4PCQ A;  1SD4 A;  2VBZ A;  1FSH A;  4MQ9 F;  2DO7 A;  3KZZ A;  5BS6 A;  4ENJ A;  1TNS A;  4GO1 A;  3TQN A;  4K2E A;  2DAO A;  4LLL A;  2GA2 A;  4FX4 A;  4ZYD A;  1XCV A;  1B9N A;  3IC7 A;  4MEX F;  2UWM A;  3M7G A;  3WGI A;  3EQL F;  1IXR C;  2L4M A;  2PMU A;  3JSP A;  5DCM B;  2NYX A;  3CO7 C;  3I64 A;  4PGG A;  3RTR A;  3E5X A;  5DYM A;  1J7K A;  4RS8 A;  4BHB A;  3ULQ B;  3EUH A;  5F64 A;  5DUI A;  3ISP A;  4LB6 B;  3L09 A;  3V7C A;  3COA C;  1Z1D A;  1BIB A;  1WRJ A;  1LQ1 A;  4TV7 A;  2LF8 A;  2HYF A;  4R8H A;  4GYI A;  2RKH A;  2CSO A;  2LNB A;  5A2Q K;  2KKO A;  4L18 B;  4LK1 F;  1R1V A;  4BH9 A;  2E7X A;  5BPI A;  4LLG F;  1HSJ A;  2DT5 A;  1R1T A;  5DUK A;  4IRG A;  3IL2 A;  2FU4 A;  1D3Y A;  4OIN F;  1FX7 A;  1IN7 A;  1MJA A;  2H27 A;  2FA5 A;  3QP6 A;  1ONV A;  1T0F A;  4P9F A;  2VC1 A;  4U88 A;  1USS A;  1ZRE A;  1OPC A;  3GFJ A;  4QLC U;  4PGH A;  3HUG A;  1DUX C;  2VE8 A;  2RDP A;  2VBY A;  4Y15 A;  1TNT A;  2K27 A;  4H0E A;  4OIQ F;  5HLG A;  3KE2 A;  1GHC A;  4MNU A;  3HOT A;  1P92 A;  5LHG A;  1K78 B;  4L0Y B;  4EMS A;  4ENK A;  2M45 A;  1P2F A;  2L02 A;  4U7B A;  2EFW A;  5L3E A;  2PI0 A;  4YFK F;  1T6S A;  1ZHF A;  2XRN A;  2VN2 A;  5D6F A;  2PEX A;  1G4D A;  2F5E A;  2XAG A;  2D1V A;  3V8J A;  4EJU A;  2XAF A;  3P9C A;  3OV8 A;  2HWV A;  4ETS A;  4L0Z B;  3LAP A;  4UV9 A;  4EGY A;  2JPC A;  3G73 A;  2XAH A;  4Q4Z F;  1BI2 A;  1J0R A;  2GQQ A;  4ASN A;  2QQB A;  4HDU A;  4ESJ A;  3ZPL A;  3ROU A;  2R7F A;  3E6C C;  2GXB A;  1XGM A;  3BY6 A;  1IRF A;  2FOK A;  2A69 F;  5D5X B;  3BOQ A;  2OQR A;  1AOY A;  4P5O A;  3FF5 A;  4HX8 A;  2BYV E;  5E1X A;  2Q0O A;  3WTW C;  2RV8 A;  1FSE A;  3G3Z A;  2GIV A;  4WXD A;  5ILU A;  3O3K A;  3MAJ A;  4LG0 B;  2FXA A;  2FQ3 A;  5JFR A;  3DEU A;  3K1P A;  1E17 A;  3L00 A;  4HF2 A;  1LEA A;  3WU1 B;  4GCV A;  1HKQ A;  1XDS A;  2PJP A;  4M6X A;  1EH6 A;  1HBX G;  4I7H A;  1KQ8 A;  1FBS A;  3K1M A;  3CLO A;  3TGN A;  2A07 F;  1Z9C A;  1R5H A;  6PAX A;  3K2Z A;  3V8L A;  2XAQ A;  1OMI A;  3I0T A;  1WI9 A;  3T8R A;  3K69 A;  1UHW A;  2XKP A;  5L3D A;  1QBJ A;  5L3B A;  1R1U A;  1P4A A;  3HHG A;  3N4M A;  1S29 A;  4L9T A;  3V7R A;  1JGS A;  3KEQ A;  3ZMT A;  3ZN0 A;  3KP4 A;  4LG0 A;  1TQI A;  4GYG A;  3LWF A;  4KDP A;  2XV4 S;  4ZYG A;  3HSR A;  2ZME B;  1L0O C;  3O2P E;  2M8E A;  3F3X A;  1CGP A;  5D5U B;  4N9H A;  5LRR A;  2YX7 A;  3GUD A;  2QBY B;  5HLH A;  1SD5 A;  4D0P A;  2EV6 A;  2O0Y A;  3LQR A;  1I1S A;  1P6R A;  4XSX F;  2V1D A;  1FYM A;  5A2Q Z;  4UHT A;  4FX0 A;  5LBQ A;  2PBI A;  4KN7 X;  2ETH A;  2UZK A;  2VOP A;  2A5Y B;  4AIK A;  2E1N A;  1OKR A;  3H92 A;  4WK8 F;  2XAJ A;  3TO6 A;  3SQN A;  5K5O A;  2GWR A;  1F1Z A;  2LSO A;  1YW7 A;  3DPL C;  3DP7 A;  3DFG A;  5TJJ A;  3WTX C;  3ECH A;  4UXN A;  5BMZ A;  4IF4 A;  5FFX A;  1F9N A;  3MCZ A;  1ODD A;  5ILS A;  3GO5 A;  5HS9 A;  1ZG3 A;  1ZAO A;  2LF7 A;  2DW4 A;  2QZ8 A;  3LA7 A;  3JTG A;  4G94 A;  1D8J A;  3DF8 A;  1YS6 A;  2RQP A;  4WX9 A;  2IVM A;  4HLY A;  1ULY A;  3FMR A;  4KT5 C;  4Z2Y A;  3EYY A;  4BHP A;  2D1H A;  1P4W A;  2QBY A;  4N0B A;  4XBF A;  1D5V A;  3ZMS A;  3V8K A;  4EJW A;  3MZH A;  3CDH A;  2EA2 A;  4UNO A;  1W7P D;  1QQI A;  3FM5 A;  3HRT A;  2HEO A;  4FT8 A;  1V4R A;  1FC3 A;  3E3V A;  5K1Y A;  1YW9 A;  4R1H A;  2HKX A;  4BXU A;  4N9I A;  1HKS A;  3V7S A;  3WTS C;  2DK8 A;  1WQ2 A;  3MWM A;  1MZB A;  4OIR F;  4QWQ A;  3F8M A;  3I54 A;  2L54 A;  4RB3 C;  4RB1 A;  1JXS A;  2STW A;  1IN4 A;  1ZGA A;  4YIF A;  3I4P A;  3EET A;  1PUE E;  2Z9O A;  3WG9 A;  3BDD A;  2EK5 A;  4EM1 A;  4U0Y A;  1HW1 A;  2HGC A;  4I09 A;  1KU9 A;  2UXX A;  4P9U A;  3LA3 A;  2P7C B;  2CFX A;  2R7D A;  4UVC A;  1ZLK A;  2QEN A;  3I59 B;  2FML A;  1W7P A;  2EJR A;  2A3S A;  3F8B A;  2JPB A;  2V6C A;  1MJB A;  4G7O F;  2DU9 A;  1U5T A;  2IA1 A;  2K4J A;  4MGR A;  2BBY A;  1K7A A;  3KP6 A;  5CVR A;  1B4A A;  3FXQ A;  1BI3 A;  2RNJ A;  5BQT A;  4CHU A;  3TKY A;  4MHG A;  1U5T B;  3HRS A;  5JR3 A;  4G6Q A;  4XLN F;  5FFZ A;  4EJV A;  2RC4 A;  3LQQ A;  3PQJ A;  4ESB A;  5JVT A;  1L3L A;  2YR2 A;  4UVB A;  2Q8K A;  1HST A;  3P7N A;  4KN4 X;  3BWG A;  4CYD A;  4Y17 A;  3NEU A;  5ICC A;  2STT A;  1ZRD A;  1O3S A;  1K78 A;  3LA2 A;  3GF2 A;  5KVR A;  3GZ6 A;  4S05 A;  3DV8 A;  3GFM A;  4OIP F;  1B6A A;  2IW5 A;  1HW2 A;  1QZZ A;  4CIC A;  1ON2 A;  2ZBK A;  1BI1 A;  4HYE A;  4ENM A;  3R0J A;  3M8E A;  4AWX B;  2CG4 A;  1YG2 A;  4RGU A;  3J80 K;  2DK5 A;  1YIO A;  3OOP A;  5FB2 A;  1FNN A;  1STZ A;  2MLK A;  1I5Z A;  1FY7 A;  1DPR A;  5BOX A;  2X0L A;  2XUB A;  4WCG A;  1IXS B;  5EEH A;  3WU0 A;  4HQM A;  1G6N A;  4XSZ F;  5HVQ C;  4ZZD A;  2F5C A;  4UUV A;  2DI3 A;  4CDG A;  4ZYE A;  5LGT A;  3IHU A;  1T2K A;  1R00 A;  3QU3 A;  4M71 A;  3EDP A;  1SAX A;  2E1C A;  4YG2 F;  4OOI A;  2PLY A;  4M9X A;  4O6J A;  3GX4 X;  4XRF A;  5J6X A;  1J75 A;  2CWE A;  2ZNY A;  3HIF A;  1SD7 A;  5JI6 A;  3WE3 A;  2BEO A;  1J5Y A;  4A0Z A;  5LHH A;  2VXZ A;  4IRI A;  1W5S A;  3Q5F A;  2DLL A;  2QM3 A;  3WTU C;  4E70 A;  5CYV A;  3SHF A;  2ZKZ A;  4G7Z F;  2Z33 A;  4KIC A;  4I0A A;  4RGX A;  4RAZ A;  4HX7 A;  2QWW A;  3O6B B;  2W84 A;  4WWC A;  3JAM K;  4LJZ F;  2YSR A;  4MTD A;  1SMY F;  3HRU A;  5EEG A;  1HW5 A;  2H09 A;  2XGX A;  4HW0 A;  2L3D A;  2YX4 A;  3J80 Z;  2NRA C;  5LGN A;  4UVA A;  3J81 K;  1BM9 A;  1LDD A;  2IP2 A;  2C6Y A;  3CJN A;  2NS0 A;  3J81 Z;  3JTH A;  1IF1 A;  3MZY A;  2NAZ A;  1PDN C;  5HS7 A;  3CUO A;  2O03 A;  5DD4 A;  5ED4 A;  2EB7 A;  2Y0M A;  1Z6R A;  2RN7 A;  1KYZ A;  2D2W A;  2JRT A;  4WXH A;  5K5R A;  4HF1 A;  1MJ9 A;  2AS5 F;  3F23 A;  5D8L B;  3GFL A;  1SFU A;  1ZAR A;  3N97 A;  3M8F A;  4EV0 A;  2MBF A;  4ESF A;  3S2W A;  4LD5 A;  4GGG A;  1IXC A;  2Y48 A;  3F6V A;  4HBL A;  3P9K A;  1XB4 A;  2CO5 A;  2OQG A;  2RVC A;  2MLG A;  1J2X A;  5CVU A;  1IN8 A;  4R79 A;  3C3W A;  2HS5 A;  2OA4 A;  2ZJ2 A;  2A6E F;  3RIR A;  5E20 A;  4KMU X;  2KJC A;  2IJL A;  1TW2 A;  2KRF A;  5FD5 A;  4M73 A;  3I71 A;  2H6C A;  4I98 B;  1LDJ A;  3GFI A;  3DXJ F;  4EM2 A;  2QQ9 A;  5ICE A;  2JT1 A;  5K5Q A;  2FF4 A;  4U0V A;  2VOD A;  2HZT A;  1B1B A;  5TRD A;  1A04 A;  2BE5 F;  2Z99 A;  3PQK A;  1XSD A;  3I53 A;  4BQA A;  2O3F A;  3WGH A;  4NB5 A;  2W25 A;  3ABU A;  5E1Z B;  2QLZ A;  3WE2 A;  3ZMZ A;  1YW8 A;  3TO9 A;  2XRO A;  1TQP A;  5IT3 A;  1FP1 D;  2EFO A;  1RUO A;  3T5X A;  1S7A A;  3F8C A;  5E8G A;  4M6Y A;  2P8T A;  3R61 A;  5AIP A;  1G3W A;  3RYR A;  5DV5 A;  1IAW A;  1DPU A;  5LLQ A;  1WKM A;  1I27 A;  3KP3 A;  5D8K B;  2HQN A;  2MA3 A;  3KLN A;  4YII A;  1OR7 A;  5ILV A;  3LFK A;  2ISZ A;  4AIJ A;  1QZY A;  3JW4 A;  3CUQ C;  5LEK A;  3KP7 A;  1U2W A;  1XCB A;  1O7F A;  5H6R A;  2BV6 A;  1SMT A;  4JBA A;  4NQW A;  3KP5 A;  4I2O A;  2JTV A;  1FBQ A;  3FZV A;  2VE9 A;  3SFZ A;  1MD0 A;  5D5W B;  2DPD A;  2PMH A;  2WTE A;  3HSE A;  3F8N A;  1W5T A;  1KU2 A;  1C0W A;  1TW3 A;  3RJP A;  4F7Z A;  2ZME A;  1LDK B;  2Q2E A;  5CVV A;  2K7L A;  4AIH A;  1BIA A;  3GLX A;  1XN7 A;  1YTY A;  4DNC A;  1R5G A;  1TTY A;  1MDM A;  2G9W A;  4I0B A;  1FLI A;  3RPU A;  3TOA A;  1BBY A;  4CO8 A;  3WOD F;  1SFX A;  1BC8 C;  2HTS A;  5D4R A;  1DDN A;  4EGZ A;  1IW7 F;  3BRO A;  4KFC A;  2WC2 A;  2F5D A;  4A5M A;  4EJT A;  4LLN A;  2J5P A;  4IHT A;  2DQR A;  5D5V B;  3Q9S A;  2GA1 A;  4M9Z A;  3FX3 A;  3BJO A;  3IKT A;  1IN6 A;  2EFQ A;  3VB2 A;  3RPQ A;  1RNL A;  2XHK A;  3HOS A;  3QPH A;  4HDV A;  4EVI A;  4ZYH A;  1P4X A;  4BYY A;  4NHJ A;  2KIF A;  3WTY C;  3BPV A;  1VTN C;  1LEB A;  1CF7 B;  2A61 A;  1QPM A;  2A6H F;  3IKV A;  3LAJ A;  4PZJ A;  1X3U A;  1R23 A;  4M74 A;  2G7U A;  3U9G A;  1ZRF A;  5L3C A;  4OMZ A;  3F22 A;  2VC0 A;  2P7V B;  1FT9 A;  2ZO4 A;  5CVJ A;  2PQ8 A;  3F6O A;  1O3R A;  1O7L A;  3IRQ A;  2GXG A;  4CXF A;  3E6M A;  1H0M A;  3DPT A;  4RAY A;  1SD6 A;  3GW2 A;  1UST A;  3FMS A;  4P96 A;  3BPX A;  4MTE A;  4EQQ A;  1RUN A;  2V9V A;  2K86 A;  4LMY A;  4A0X A;  2ELH A;  2EWN A;  3K9T A;  1F5T A;  1S7O A;  5JHU A;  2HOE A;  1UHM A;  3VFZ A;  5E17 F;  3BP8 A;  4HAM A;  2B0L A;  3D0S A;  1Q1H A;  1YLF A;  3HSF A;  5LEJ A;  1GXP A;  1FYL A;  4MEY F;  3ERE D;  1JE8 A;  2Y75 A;  3ZMU A;  5FGM A;  5L3G A;  4G6D A;  5DEQ A;  3GXO A;  2IA0 A;  3RKX A;  2VBX A;  2DFI A;  5F6F A;  3CUQ A;  2FSW A;  1UCR A;  2VBW A;  3B73 A;  1U3E M;  2Z5U A;  2WV0 A;  4G7H F;  1B59 A;  1HKT A;  3ZMV A;  4IXA A;  4KUM A;  2XVC A;  1I6X A;  1NHA A;  3I59 A;  2OBP A;  1UFM A;  1ON1 A;  2Z3Y A;  4HF0 A;  1ZG1 A;  1S8N A;  3FHZ A;  3QU6 A;  4CGZ A;  1R22 A;  1HXD A;  1KYW A;  3GEZ A;  4KMF A;  1RZ4 A;  3HTU A;  5E18 F;  4A0Y A;  4HQE A;  4I01 A;  5DCM A;  2K02 A;  5D4S A;  3VEP A;  5J8C A;  1XGO A;  1V3F A;  3F8F A;  1W4M A;  4MQV A;  5J8F A;  3V4G A;  2ZXJ A;  5DD8 A;  1U78 A;  2CYY A;  3EYI A;  5IT9 K;  4YFN F;  5FD6 A;  3E5U A;  5CVI A;  1T98 A;  5L3F A;  3MEX A;  3QAH A;  4L9V A;  2COM A;  3KLO A;  3C18 A;  4PDK A;  3R60 A;  2L4A A;  1LB2 A;  1PP7 U;  2VT2 A;  3WGG A;  3QOP A;  3SZP A;  1KU3 A;  2P5V A;  1U6G A;  2LKP A;  3ML6 A;  4IRH A;  2JSC A;  3U2R A;  2O8X A;  1U5T C;  2P4W A;  4KYW A;  4HLX A;  2OU2 A;  3QPT A;  3TO7 A;  3B02 A;  2P6T A;  2X4H A;  3K1N A;  2H94 A;  5KK1 A;  4RB2 C;  3HHH A;  1LVA A;  4Y13 A;  3QP5 A;  1XGN A;  1G3T A;  3U1D A;  4WXC A;  1BN5 A;  3WTV C;  1QGP A;  3KEO A;  5BPD A;  3FXU A;  2F2E A;  5ICG A;  1KU7 A;  2MD5 A;  1MGT A;  1XSX A;  1Y0U A;  1Z91 A;  4B8X A;  3T0Y A;  3CUQ B;  4LB5 A;  1ZLJ A;  1IUY A;  5LRS A;  2EA4 A;  3ABT A;  2J5O A;  2V1U A;  1Z6T A;  2DPU A;  4KA4 A;  4JQF A;  3TDU C;  4LGW A;  5LHI A;  3ECO A;  3KZY A;  1H9G A;  4M72 A;  1JHH A;  3GYH X;  3W6K B;  3ELK A;  2PN6 A;  3C7J A;  4A5N A;  1S3J A;  2EV5 A;  4LK0 F;  1TBX A;  1YS7 A;  3GWZ A;  1OYI A;  3HYI A;  2EFN A;  3D5L A;  1KQ0 A;  3ZP5 A;  4O5V A;  5DCF A;  3E97 A;  4KIB A;  2MH9 A;  3SZT A;  3IWZ A;  3H3Z A;  1T38 A;  4FHT A;  4I02 A;  2LDU A;  3M9A A;  4G8X A;  1FZP B;  3F72 A;  3W6J B;  2EV0 A;  4OIO F;  5D6E A;  3L7W A;  1BC7 C;  2P5L C;  2O6G E;  3HTS B;  3NRV A;  4A6D A;  3BZ6 A;  4U0W A;  1J9I A;  5FO5 A;  2DTR A;  2O61 A;  3RYP A;  4L9N A;  3BJ6 A;  1KA8 A;  1TLH B;  1REP C;  1R7J A;  2NNN A;  1EV7 A;  4DQ2 A;  2FMY A;  3T8T A;  4KNY A;  5HS8 A;  3IRR A;  2A68 F;  3QRF F;  3VOE A;  4IJA A;  1F4K A;  1XMK A;  3BJA A;  3L2C A;  2UXN A;  1GXQ A;  2ACJ A;  5FLX K;  4O3M A;  1WSU A;  1ZH5 A;  2FE3 A;  2YPR A;  1BJA A;  5HOO A;  3FMQ A;  3E6B A;  4HOB A;  4IHS A;  1GVJ A;  5IT9 Z;  2XKO A;  1YQA A;  2P6S A;  2IPQ X;  1E2X A;  3GZ5 A;  2YU3 A;  2ZFW A;  1FP2 A;  3DQV C;  2DBB A;  3L9F A;  2CW0 F;  1K6O A;  2HYG D;  2K4B A;  1R36 A;  1T39 A;  4AVP A;  2IT0 A;  2GZW A;  2NNY A;  4B09 A;  3FWE A;  3RKW A;  4HV6 A;  1I1G A;  3GVA A;  4IPA A;  1U8R A;  3IWF A;  4RB0 A;  4IVN A;  1JHF A;  3FXR A; 
#chains in the Genus database with same CATH topology
 3H0D A;  2FQ4 A;  4L5J A;  5HLI A;  1FPQ A;  2VQH A;  2DDA A;  2L01 A;  2TDX A;  1NTC A;  4PJM A;  1IO2 A;  4E6K G;  4KIS A;  5DDG A;  2EIN H;  2PFB A;  2FEZ A;  4BE2 A;  2JA7 J;  4RA2 A;  3Q9V A;  4L9J A;  4XNF A;  2VT3 A;  3RKY A;  1H9T A;  2IGO A;  2CFO A;  2K9S A;  1PP8 F;  5CLS A;  5F0F A;  1AHD P;  1SFE A;  3MFK A;  4A3J J;  5E1W A;  4ZDO A;  4RGR A;  1XGS A;  3CTA A;  1QO0 D;  1TQM A;  3S93 A;  4S04 A;  2FBK A;  1G59 A;  1CF7 A;  1MBH A;  4ZC3 A;  2X51 A;  2OZU A;  3WTZ A;  4HX4 A;  4A6E A;  4UUT A;  1R4M B;  3ZMD A;  3PNY A;  1OCP A;  1OYY A;  2KPM A;  5AON A;  2IRF G;  2B63 J;  2LP0 A;  3KET A;  2H8W A;  2R7T A;  1Y56 A;  2KT0 A;  2GOM A;  1O3Q A;  2OAZ A;  2PMZ A;  3RI4 A;  1XSV A;  1Y8Q B;  1LFB A;  3R0A A;  1O3T A;  2HKO A;  2ZCW A;  3WTT C;  3CO6 C;  2FUG 2;  1BW6 A;  5H6Q A;  1LE8 A;  1QHG A;  1ETQ A;  4ABZ A;  2WWY A;  1RKW A;  2WAD A;  1FWZ A;  4DYR A;  2CGP A;  2FNP A;  1D0X A;  1FYK A;  1EH8 A;  2X6X A;  1HC8 A;  3PNT A;  4NDL A;  1QNT A;  3VOD A;  1MSE C;  1K79 A;  3HXL A;  2XIG A;  4A2U A;  2DFF A;  3BG7 A;  3MKZ A;  1MBK A;  2CUZ A;  2PG4 A;  2VQC A;  3JRB A;  2R3S A;  4Q47 A;  1RI7 A;  5FLX Z;  3X2Q H;  1IGN A;  1ZYR F;  1P7J A;  1BOA A;  3GBG A;  2MC3 A;  2NVT J;  3H3U A;  2ISY A;  2LFB A;  4U7D A;  3S1Q J;  4XOR A;  2LC2 A;  1FBU A;  4PUS A;  1ZRC A;  2VJJ A;  1D0Z A;  1S5L C;  2EPF A;  1H88 C;  1K83 J;  1FOK A;  2XB0 X;  2BGC A;  2JVH A;  1LNW A;  1HDP A;  1RPW A;  3DLA A;  4N4N B;  4KIG A;  2FBI A;  3TBI A;  3M07 A;  3S14 J;  4NUB A;  1OYW A;  3I58 A;  3OSG A;  4OU0 A;  3RSN A;  1X2N A;  3CCS I;  1UJ8 A;  4I6Z A;  1R58 A;  5ICF A;  1I3A A;  5DTD A;  5ERI A;  2GAU A;  1KQ9 A;  2M2E A;  3A2K A;  2AXL A;  3KP2 A;  3JAM Z;  1QVT A;  2V1X A;  5E8I A;  4A3M J;  3HOU J;  3KCC A;  1X3Z B;  2E7W A;  2MC4 A;  1WWX A;  2IA2 A;  1JUP A;  1WGX A;  2KLO A;  4GXO A;  3TOB A;  2EZL A;  1X3W B;  5HDG A;  1D1A A;  4DZJ A;  1KGS A;  3JRA A;  2LRD A;  2QVO A;  4A69 C;  2L9V A;  2D45 A;  4RMN A;  4A12 A;  2JZY A;  2MFZ A;  1LJ9 A;  4Q48 A;  5M3M J;  2V7F A;  1APL C;  3M4O J;  2KQR A;  3GTL J;  2R7U A;  2Y30 A;  2ZB9 A;  3J7A O;  4L5I A;  1QZE A;  1S6L A;  3BT9 A;  2KJB A;  5H20 A;  3ZQG A;  4A3B J;  3F0C A;  4UB8 C;  2MAB A;  1Z05 A;  2UUZ A;  2K3P A;  4HZF A;  3AAF A;  4HA8 A;  3ZR8 X;  1AWC A;  3W2V A;  4IL6 C;  2WB1 N;  3HRM A;  1EJ9 A;  1MMG A;  1BI0 A;  2RGV A;  2HTJ A;  2HPI A;  2DA4 A;  3CCM I;  2HDD A;  1EKE A;  3A0B C;  1Y39 A;  1ZGJ A;  4PJL A;  3DBR B;  1HQC A;  1MMD A;  3RPU D;  5CQG A;  1Y1W J;  3PJR A;  2DQL A;  4M9S A;  1YJW I;  1UB9 A;  1KZH A;  4EM0 B;  1FJL A;  5FKM A;  4XON A;  3HOZ J;  2WAQ A;  3LSI A;  1RIO H;  2VI6 A;  5AIQ A;  4ZH4 F;  2CQK A;  3GTM J;  3F21 A;  4RGS A;  2LY2 A;  3S32 A;  2IS4 A;  1ZN2 A;  2W24 A;  3TDZ C;  1G3S A;  3I5U A;  5HOD A;  1EH7 A;  5FKN A;  3CMM A;  4JK1 X;  3OYI A;  2KIM A;  3NAR A;  1IRG A;  1YYV A;  2LBF B;  3M1E A;  2DMP A;  4RLQ A;  3BTC A;  2EFP A;  2FBH A;  3ZQI A;  4WF2 A;  2RRE A;  4A3K J;  1D8K A;  2DA7 A;  5B1A H;  1YFH A;  1XDU A;  2ESH A;  2M5W A;  2KIU A;  2QCO A;  2F5F A;  3O8G A;  5FKO A;  1SVO A;  3M3Y J;  3K4K A;  3C1D A;  4J01 A;  1CQT A;  2ZNZ A;  4CZZ A;  1XD7 A;  3P9I A;  1IZ1 A;  3T1B A;  5H2F C;  5HDK A;  5F1R A;  2F6C A;  5CJ9 A;  1XMA A;  4HV5 A;  2Y0S A;  1O57 A;  3E5Q A;  3K0L A;  2RAE A;  4P55 A;  5HDN A;  3ZN1 A;  1PYV A;  2G7H A;  3H9Q A;  3CCU I;  3OYK A;  3E6D A;  1J59 A;  2ADU A;  2DOA A;  1ZG5 A;  4C9Y A;  4YFX F;  4JOM A;  3ZQ7 A;  5IP6 A;  3Q0W A;  1YO5 C;  2XPW A;  4LFU A;  2HFH A;  3REO A;  3HEF A;  2M1B A;  2M87 A;  2VOO A;  2HDC A;  1UEL B;  2OD5 A;  2H8R A;  1HDD C;  1OCC H;  1YI2 I;  2W00 A;  2BOL A;  4ZJZ A;  4UV8 A;  4BJ6 C;  1GLN A;  2V6E A;  4OMY A;  3DKY A;  1ZR2 A;  1OIS A;  1XMX A;  4ON0 A;  3DU5 A;  1DP7 P;  2QUF A;  2VB6 A;  1IN5 A;  2QA4 I;  3IH2 A;  1B9M A;  5GPA A;  3D5R C;  2R0Q C;  3PFI A;  5EEA A;  4AD9 A;  3ABK H;  4CH7 A;  4BHC A;  2W57 A;  3SXY A;  1MH3 A;  3L2R A;  4G9Y A;  4KIF A;  4Y7N J;  4NNJ A;  3L2V A;  5GTH C;  3VYU B;  3VDX A;  1MKM A;  4XKV A;  2DA2 A;  2JA6 J;  2W85 A;  2MH2 A;  4EJO A;  1MDM B;  4Q5S F;  2W4S A;  3GZN B;  2JMW A;  2FRH A;  1YOV B;  2V79 A;  5LGU A;  3R6S A;  1MBF A;  2QYO A;  3FBN B;  3MKL A;  3LST A;  1IUF A;  1VQL I;  4JP0 A;  3R4K A;  4BNC A;  3RZO J;  2G0E A;  3CF2 A;  2ESN A;  3FXM A;  1Y0N A;  2QQA A;  2B7E A;  5GTI C;  3KEY A;  2BZT A;  3FM3 A;  2MG4 A;  2P5K A;  3DKW A;  3HM5 A;  5DS9 A;  2F4I A;  1XG1 A;  3VSK A;  1RRJ A;  2VON A;  3S1M J;  3NQO A;  2Y9Z A;  1IDZ A;  4ZZL A;  1G3Y A;  3C2B A;  2ZJP F;  2OZ6 A;  2M30 A;  2X9D A;  1S9H A;  4XLP F;  2FNA A;  3JSO A;  1BR1 A;  4BAY A;  1DU6 A;  1W7P B;  1Z7U A;  2JWT A;  3MQ0 A;  4ENN A;  2Y69 H;  2H6B A;  2HR3 A;  2HQR A;  4XID A;  2XAS A;  2I5U A;  1PJR A;  3KFW X;  3DU6 A;  3BTI A;  4E7H A;  3RDI A;  4PCQ A;  1I39 A;  1SD4 A;  2VBZ A;  1FSH A;  2HQA A;  4BS9 A;  3OMY A;  4MQ9 F;  4NQW B;  2DO7 A;  3KZZ A;  5BS6 A;  2ECB A;  1TNS A;  4ENJ A;  1V5E A;  1LFU P;  4GO1 A;  3TQN A;  4K2E A;  2RNG A;  3ABL H;  2DAO A;  2DFE A;  1HCR A;  4LLL A;  2GA2 A;  4XLF A;  1VQ7 I;  4FX4 A;  4ZYD A;  3JCU C;  2BY3 A;  3PUF A;  1XCV A;  2QKL B;  1B9N A;  9ANT A;  2DPD A;  2X85 A;  3IC7 A;  4MEX F;  2UWM A;  3M7G A;  1BJZ A;  2R7Q A;  3WGI A;  4FIS A;  3EQL F;  3OYJ A;  1IXR C;  3DEW A;  2R93 J;  2L4M A;  2PMU A;  2M0M A;  3JSP A;  5DCM B;  2NYX A;  3CO7 C;  3I64 A;  4PGG A;  3RTR A;  3KIO A;  3E5X A;  3CC4 I;  5DYM A;  3TW6 A;  1J7K A;  4RS8 A;  3F9K A;  4BHB A;  3BZK A;  3ULQ B;  3EUH A;  5F64 A;  3CCJ I;  2OJE D;  2ZXW H;  5DUI A;  3ISP A;  1YX5 A;  2NOG A;  4HNV A;  3S3O A;  1XX5 A;  4LB6 B;  1QA6 A;  2TRT A;  4JX6 A;  4A3D J;  2AO9 A;  1MBJ A;  2LKX A;  3L09 A;  2NVU B;  2QSG X;  2E19 A;  3V7C A;  4B1R A;  3COA C;  1Z1D A;  1BIB A;  3G4S I;  1WRJ A;  5KAI C;  4TV7 A;  1LQ1 A;  2LF8 A;  4XLE A;  2HYF A;  4CCN A;  2HNH A;  2VKH A;  1GT0 C;  4HEA 2;  2LLK A;  4DW6 A;  3CDL A;  1ETV A;  4CCM A;  2OF7 A;  4R8H A;  4GYI A;  3CES A;  2RKH A;  2CSO A;  2LNB A;  5A2Q K;  1W36 C;  4E4H A;  1UG2 A;  2KKO A;  3ZQL A;  1HOM A;  4L18 B;  4LK1 F;  1R1V A;  3C2G A;  4BH9 A;  4H4K C;  1XTA A;  2E7X A;  5BPI A;  4LLG F;  2GXA A;  1HSJ A;  2DT5 A;  1R1T A;  5DUK A;  5TGT A;  5B5E C;  1R5I D;  4IRG A;  3IL2 A;  2FU4 A;  1D3Y A;  4CCK A;  4OIN F;  2KDO A;  1VQ8 I;  1FX7 A;  1ENH A;  2WB1 A;  1ITY A;  3TP3 A;  1IN7 A;  4IEJ A;  4BEH A;  5HNH A;  1MJA A;  4CZC A;  2FA5 A;  3QP6 A;  2H27 A;  3GTG J;  1AA7 A;  2ZC2 A;  1SAU A;  3S1R J;  5GPC A;  3PFY A;  4X6A J;  2KDZ A;  3VWB A;  1ONV A;  4D7M A;  1T0F A;  4P9F A;  1OFC X;  2VC1 A;  4U88 A;  1USS A;  1UMQ A;  2VXD A;  1OPC A;  2GIZ A;  4CSW A;  1X19 A;  3GFJ A;  1ZRE A;  2DYS H;  4QLC U;  4PGH A;  4F93 B;  4AYB A;  3HUG A;  3VYR B;  2LG4 A;  1PUF A;  2K3F A;  1DUX C;  2VE8 A;  1VQO I;  2M7A A;  2RDP A;  3BZC A;  2VBY A;  4Y15 A;  1TNT A;  2K27 A;  4E7K A;  4H0E A;  4OIQ F;  1SC7 A;  1EA3 A;  2X1E A;  5HLG A;  4CCO A;  3KE2 A;  3UR3 C;  3CF5 F;  1F36 A;  3U21 A;  1GHC A;  3ZRG A;  2XF7 A;  4MNU A;  5J4V A;  4BJT A;  2HXO A;  4XRM A;  2DCE A;  1X1D A;  4XKC A;  3ASN H;  3IAM 2;  3HOT A;  4C3I J;  1P92 A;  5LHG A;  2ZME C;  2VKE A;  2R7W A;  2JUG A;  3UKG A;  1K78 B;  1FOX A;  1WI3 A;  4L0Y B;  4EMS A;  4ENK A;  2M45 A;  2R5Z A;  1P2F A;  2L02 A;  4U7B A;  2BW3 B;  1KON A;  2EFW A;  3EUK L;  3KYL A;  5L3E A;  3JRC A;  3BG5 A;  2PI0 A;  4Y52 J;  4PFP A;  4YFK F;  5M5W J;  1T6S A;  2QSF X;  2M4K A;  1Z0X A;  1ZHF A;  2XRN A;  2KZG A;  2VN2 A;  5D6F A;  3G71 I;  3FDY A;  2PEX A;  1FIA A;  2F4O B;  5IYB J;  4DZP A;  1G4D A;  2F5E A;  4F92 B;  2V9P A;  1ETK A;  2XAG A;  2D1V A;  3V8J A;  4EJU A;  3LFU A;  1WJD A;  2VAS A;  2XAF A;  3P9C A;  4PK4 A;  3OV8 A;  2KRC A;  1IRZ A;  3H5N A;  2EIL H;  4KJZ A;  2HWV A;  4ETS A;  4L0Z B;  3LAP A;  4UV9 A;  4EGY A;  2I10 A;  1W5C C;  1Q1V A;  2JPC A;  3G73 A;  2XAH A;  5K7H A;  2M34 A;  3L2Q A;  4Q4Z F;  2JA5 J;  3HOX J;  1BI2 A;  2QSH X;  1RR7 A;  2JRM A;  1J0R A;  1MSF C;  2GQQ A;  3JRH A;  4ASN A;  2QQB A;  1YJN I;  4HDU A;  4ESJ A;  3ZPL A;  3ROU A;  2R7F A;  2P81 A;  3RCO A;  4PSX A;  3E6C C;  4XKB A;  2GXB A;  1ERD A;  1XGM A;  3BY6 A;  2CS3 A;  3H36 A;  1IRF A;  3K4M A;  4JX4 A;  2FOK A;  3HPG A;  3WG7 H;  1H89 C;  2A69 F;  4LIV A;  4E7I A;  5D5X B;  2V4J C;  3BOQ A;  4QIW N;  2OQR A;  1Z21 A;  1AOY A;  4P5O A;  5CKT A;  1TP4 A;  1BA5 A;  2CV0 A;  2MYS A;  2OTL I;  3FF5 A;  1FOW A;  5JLX A;  4HX8 A;  3IH4 A;  2BYV E;  3K4C A;  2Q0O A;  5E1X A;  3WTW C;  2RV8 A;  1FSE A;  1TWA J;  3G3Z A;  2K9N A;  5E3L A;  4HPQ A;  2MSY A;  2GIV A;  4RAF A;  4WXD A;  5ILU A;  3AL0 C;  2WBM A;  1JGG A;  3O3K A;  1W0T A;  1YE9 A;  3MAJ A;  4LG0 B;  1WCM J;  2FJ1 A;  2FXA A;  3FKJ A;  2FQ3 A;  5JFR A;  5KHD A;  1RES A;  3DEU A;  1ZKG A;  3K1P A;  2DA3 A;  1E17 A;  4NC6 A;  3M8J A;  1LFP A;  1NG6 A;  3L00 A;  4HF2 A;  1W1W E;  1LEA A;  1X2M A;  4I99 C;  3WU1 B;  2PMZ N;  4GCV A;  5EGO B;  1QHH D;  1HKQ A;  5JHF A;  1XDS A;  2O8K A;  2XRL A;  2PJP A;  1IV6 A;  2VJ4 A;  4M6X A;  1EH6 A;  3K4J A;  4I7H A;  1HBX G;  3AKZ A;  3HOV J;  1KQ8 A;  4M3G A;  4XLC A;  1FBS A;  3HJE A;  3K1M A;  3CLO A;  3TGN A;  2A07 F;  2HOS A;  1Z9C A;  1R5H A;  4NC8 A;  2IS6 A;  2DOE A;  6PAX A;  3K2Z A;  1YIJ I;  3V8L A;  2XAQ A;  1X4O A;  1OMI A;  3I0T A;  1ZR4 A;  1WI9 A;  4XR6 A;  2IBD A;  3T8R A;  4NBQ A;  3K69 A;  1UHW A;  2NS7 A;  2XKP A;  3HB9 A;  5L3D A;  5L3B A;  4F3Q A;  1QBJ A;  1R1U A;  3CP2 A;  2XAU A;  1P4A A;  3H35 A;  3MN2 A;  4HST A;  4W97 A;  3HHG A;  4CUG A;  1Y6I A;  1JKR C;  3N4M A;  2R5Y B;  1S29 A;  4L9T A;  3V7R A;  2QKM B;  3KYC B;  3FXO A;  3CCQ I;  1JGS A;  3KEQ A;  3ZMT A;  4ZDP A;  3ZN0 A;  4DGW B;  3KP4 A;  4LG0 A;  1TQI A;  4GYG A;  3LWF A;  5B66 C;  4KDP A;  2XV4 S;  4ZYG A;  3S2H J;  3HSR A;  2ZME B;  4LIU A;  1MH4 A;  1L0O C;  3O2P E;  4XK4 A;  2M8E A;  3F3X A;  3LSM A;  1CGP A;  3OIO A;  1Z3X A;  2Z16 A;  1JT6 A;  2L9S A;  5D5U B;  4M3E A;  4N9H A;  2AQF A;  2QEX I;  3GTQ J;  5LRR A;  2YX7 A;  1IDY A;  1SFK A;  3GUD A;  4IQ4 A;  3RZD J;  2VUM J;  1S72 I;  3PSI A;  1W0U A;  2QBY B;  4U87 A;  5HLH A;  3BG3 A;  3A4C A;  1SD5 A;  2JUC A;  4D0P A;  3VYS B;  1ORK A;  3VYT B;  2PJR A;  2OUM A;  2E35 A;  3CP8 A;  2EV6 A;  2O0Y A;  3LQR A;  1DGW Y;  1P6R A;  1I1S A;  4XSX F;  2E2I J;  1DQU A;  2V1D A;  1FYM A;  5A2Q Z;  4UHT A;  3MKW B;  4FX0 A;  4MFD A;  2JVG A;  2DJI A;  4BU2 A;  2PBI A;  2BY0 A;  4KN7 X;  2K9L A;  3EPZ A;  5LBQ A;  2ETH A;  2UZK A;  2VOP A;  2A5Y B;  4YEJ A;  5IYC J;  4AIK A;  2E1N A;  4BXX J;  1OKR A;  2M4G A;  3H92 A;  4WK8 F;  2Y2Z A;  2XAJ A;  3DPU A;  4A3F J;  1XS9 A;  2XSJ C;  3TO6 A;  3D1N I;  3SQN A;  3G1O A;  2X1D A;  5K5O A;  1LVK A;  4RAG A;  5J1U A;  2GWR A;  1F1Z A;  4FCY A;  1E3O C;  5LFA A;  2HYJ A;  2LSO A;  1YW7 A;  2YS9 A;  3DPL C;  3DP7 A;  3ESW B;  3DFG A;  5TJJ A;  3WTX C;  5IY5 H;  3ECH A;  4UXN A;  3GTK J;  5BMZ A;  3LMM A;  4IF4 A;  5FFX A;  1F9N A;  3MCZ A;  2K85 A;  1ODD A;  2E5N A;  5ILS A;  3RKQ A;  2EZK A;  3GO5 A;  4D5C A;  2VLA A;  2EBI A;  2N8G A;  4XM3 A;  3DKX A;  5HS9 A;  1A5J A;  2XGE A;  1HA8 A;  3FXK A;  1VFC A;  2XGD A;  1ZG3 A;  1ZAO A;  3NWS A;  3AG4 H;  5FRM A;  2F48 A;  2LF7 A;  5F1J A;  2DW4 A;  2QZ8 A;  3LA7 A;  3JTG A;  4AVZ A;  4G94 A;  4E7J A;  4AU7 A;  1YJ9 I;  1D8J A;  1UZC A;  1VI0 A;  3DF8 A;  1YS6 A;  3BCA A;  2RQP A;  4WX9 A;  1MBG A;  2IVM A;  4HLY A;  1ULY A;  1OCO H;  3FMR A;  2EH3 A;  1MIJ A;  2KMU A;  4KT5 C;  4Z2Y A;  5F27 A;  3EYY A;  2QGU A;  4BHP A;  2VIX A;  5BNG A;  1MMS A;  2D1H A;  1P4W A;  2QBY A;  4N0B A;  2EIM H;  4XBF A;  3PO3 J;  3G2B A;  1JKP C;  5FJ8 J;  1D5V A;  3DTE A;  3ZMS A;  3V8K A;  2CQ7 A;  1SVM A;  4EJW A;  3MZH A;  3CDH A;  2EA2 A;  1Z3Y A;  4UNO A;  1W7P D;  4MO7 A;  1QQI A;  2R4G A;  3OS0 A;  3FM5 A;  3HRT A;  2HEO A;  1Y8R B;  2ZSH B;  4FT8 A;  3QYF A;  3BQY A;  4IHW A;  1V4R A;  1FC3 A;  3H5A A;  1A31 A;  2O9L A;  3E3V A;  1TT5 B;  5F08 A;  5K1Y A;  3OSF A;  1YW9 A;  4HNU A;  2V26 A;  4R1H A;  1A36 A;  3HUG B;  2M8G X;  3DLL F;  2HKX A;  4KT6 A;  3IH3 A;  4BXU A;  5KNL A;  2E71 A;  4N9I A;  1HKS A;  4II3 A;  3BR0 A;  3V7S A;  3WTS C;  1VND A;  2D5V A;  2DK8 A;  1WQ2 A;  3MWM A;  4XLH A;  1MZB A;  1XC5 A;  2M7B A;  4OIR F;  4KIT B;  1GV5 A;  1MBE A;  4J19 A;  3RQI A;  4QWQ A;  4M3D A;  3F8M A;  2LTP A;  3I54 A;  2L54 A;  4RB3 C;  3HDD A;  4RB1 A;  1JXS A;  2ZJR F;  2STW A;  2R7Z J;  1IN4 A;  3LSR A;  1ZGA A;  4YIF A;  3I4P A;  2LY9 A;  3EET A;  4B43 A;  1PUE E;  2Z9O A;  4BQO A;  2L7K A;  3WG9 A;  3S15 J;  3M1C A;  1T33 A;  3CDI A;  3BDD A;  2XGC A;  2EK5 A;  4EM1 A;  4U0Y A;  2LOO A;  3FBI B;  2X6Y A;  4V2F A;  5C3E J;  1HW1 A;  1WFX A;  2HGC A;  4I09 A;  1VQP I;  1KU9 A;  2UXX A;  4P9U A;  3SYT A;  3LA3 A;  4B3X A;  1BL0 A;  4BL0 B;  2CFX A;  2R7D A;  4UVC A;  2P7C B;  1ZLK A;  2QEN A;  4CCL A;  3I59 B;  2FML A;  3ZQH A;  1W7P A;  3FK6 A;  2EJR A;  1WZ2 A;  1EF4 A;  2BW3 A;  3GLL A;  1X4P A;  2A3S A;  3F8B A;  2LK2 A;  2XDV A;  4DIQ A;  2XF5 A;  4CCJ A;  2JPB A;  2V6C A;  1MJB A;  2WA0 A;  3H1C A;  3A01 B;  2GM4 A;  4G7O F;  1X58 A;  2DU9 A;  1U5T A;  2IA1 A;  2K4J A;  4MGR A;  2BBY A;  1PVE A;  1K7A A;  5HNF A;  3O8H A;  3KP6 A;  5CVR A;  5IPA A;  1B4A A;  2OV7 A;  2O7O A;  3FXQ A;  3KX2 A;  1BI3 A;  4ITV A;  2RNJ A;  5BQT A;  4HSR A;  2WAF A;  4CHU A;  1JUS A;  1U0J A;  1RKT A;  2Z1D A;  3TKY A;  2VPL A;  4MHG A;  1U5T B;  2Q1Z B;  4PJ0 C;  1AKH A;  1NG7 A;  5C4X J;  1VQK I;  3H5R A;  3HRS A;  2WY8 Q;  5JR3 A;  5GP9 A;  3S3N A;  4G6Q A;  4XLN F;  5FFZ A;  4EJV A;  2RC4 A;  1B72 A;  1X1B A;  3LQQ A;  2IS1 A;  3PQJ A;  2VJI A;  2XPV A;  1N78 A;  2E34 A;  4MFE A;  1SEU A;  5KCM A;  4ESB A;  5JVT A;  2BY2 A;  1X1A A;  1L3L A;  1HLV A;  4OAY A;  3J7Z I;  2YR2 A;  3K70 D;  4UVB A;  3CMA I;  5EYR A;  4JX5 A;  2Q8K A;  1I50 J;  1OR7 C;  3BR2 A;  3A01 A;  1HST A;  3P7N A;  1JT0 A;  4KN4 X;  3BWG A;  4B47 A;  4CYD A;  4Y17 A;  3LL7 A;  4HNT A;  5HLT A;  3NEU A;  5ICC A;  1Z7L A;  3TED A;  2STT A;  1ZRD A;  3HOY J;  1O3S A;  1D1B A;  1I6H J;  1K78 A;  1MND A;  2R7R A;  2P0W A;  2QQ8 A;  3LA2 A;  3SFI A;  3GF2 A;  5KVR A;  3GZ6 A;  4S05 A;  3DV8 A;  3GFM A;  4OIP F;  4BGD A;  3ZGK A;  2HOT A;  1B6A A;  4II2 A;  3QYB A;  5EG0 A;  3PO2 J;  4BDY A;  2IW5 A;  2VQG A;  3SZG A;  1HW2 A;  1QZZ A;  4CIC A;  3Q0U A;  1R4N B;  1ON2 A;  2ZBK A;  1BI1 A;  4HYE A;  3DTK A;  4ENM A;  4ZTF A;  3S3M A;  1GUU A;  2IGM A;  3C2H A;  3R0J A;  3M8E A;  3ONQ A;  4AWX B;  2CG4 A;  3K7A J;  3WHC A;  4XIC A;  1PUF B;  1YG2 A;  2W82 A;  4RGU A;  3AL0 B;  3LSJ A;  3MD2 A;  4BDZ A;  5E3O A;  5IYD J;  3J80 K;  2JJ7 A;  2DK5 A;  1UG0 A;  3ZOB A;  1YIO A;  1VQN I;  3IP4 B;  4IHV A;  1OJL A;  1YX3 A;  3W3C A;  3I4M J;  3OOP A;  5FB2 A;  2K9M A;  2H1L A;  1FNN A;  2BY1 A;  1STZ A;  1HF0 A;  2L2O A;  2MLK A;  5FRN A;  4PSW A;  2K9Q A;  1I5Z A;  4C2T A;  1FY7 A;  1DPR A;  3BTJ A;  5BOX A;  2X0L A;  4BE0 A;  2XUB A;  2JSP A;  1T95 A;  2E1M C;  3QPS A;  4WCG A;  1IXS B;  5EEH A;  3WU0 A;  2ECC A;  4HQM A;  3OYC A;  1G6N A;  4XSZ F;  4CYC A;  5HVQ C;  1ZQ3 P;  2CV1 A;  4HRI A;  4ZZD A;  4BE1 A;  1T08 B;  3CQZ J;  2F5C A;  4UUV A;  2DI3 A;  4CDG A;  3IUO A;  4ZYE A;  5LGT A;  2ZSI B;  1E3P A;  3FKI J;  3IHU A;  3Q3S A;  1T8I A;  1T2K A;  1R00 A;  3QU3 A;  4E7S A;  2KIS A;  4M71 A;  3EDP A;  1ETX A;  2L9R A;  1SAX A;  1D1C A;  3OYD A;  2E1C A;  1VQ4 I;  2HQ5 A;  1RC9 A;  4BUP A;  4YG2 F;  4A3I J;  2OCC H;  5JVG F;  4W1U A;  4OOI A;  1JJ8 C;  3BQZ A;  2JQ7 A;  2PLY A;  4M9X A;  1WJC A;  3BCB A;  2HVR A;  1LUJ B;  4O6J A;  3GX4 X;  3K4L A;  4XRF A;  3QOD A;  5J6X A;  1J75 A;  2CWE A;  3RQ4 A;  2ZNY A;  2DMQ A;  3HIF A;  3I4N J;  1SD7 A;  1ETY A;  2YUS A;  5JI6 A;  2H1K A;  4BQQ A;  3WE3 A;  2BEO A;  1J5Y A;  4A0Z A;  5J47 A;  5LHH A;  3CD6 I;  2VXZ A;  4F55 A;  4RLF A;  4IRI A;  1W5S A;  3Q5F A;  2DLL A;  2QM3 A;  3WTU C;  4QTR A;  3S2D J;  3J7Y J;  4E70 A;  5CYV A;  3SHF A;  2ZKZ A;  4BAC A;  4G7Z F;  2Z33 A;  3GME A;  2ZFU A;  4BXF A;  4F52 A;  1R9T J;  3BR1 A;  4KIC A;  2CUE A;  2IS2 A;  2NVY J;  3I3L A;  3GTP J;  2UV1 A;  4OWR B;  1OLT A;  2A5W A;  5GAH J;  4DBR A;  2HXI A;  4I0A A;  3CZ6 A;  1H8A C;  1OCT C;  4RGX A;  4RAZ A;  4HX7 A;  3OYN A;  2QWW A;  1Z67 A;  3O6B B;  2W84 A;  1VQ9 I;  4WWC A;  2O5R A;  3JAM K;  4LJZ F;  2YSR A;  4MTD A;  2XB5 A;  3JRI A;  1SMY F;  3HRU A;  5EEG A;  1HW5 A;  2H09 A;  2XGX A;  1TWF J;  4J00 A;  3BTL A;  4HW0 A;  3GCM A;  2F4M B;  1DGR M;  2L3D A;  2LH9 A;  2YX4 A;  3J80 Z;  4XOT A;  1U8B A;  1IG7 A;  5LGN A;  4UVA A;  3J81 K;  2NRA C;  1FIP A;  1WJ5 A;  1BM9 A;  1LDD A;  2XPU A;  5KAF C;  1B8I A;  4Y33 A;  3OYA A;  2IP2 A;  2C6Y A;  3CJN A;  2NS0 A;  3J81 Z;  3JTH A;  4Z6Y A;  1FMV A;  1IF1 A;  3FHN A;  3K4B A;  4XOP A;  1AU7 A;  3MZY A;  2NAZ A;  1PDN C;  3FXJ A;  5HS7 A;  3CUO A;  2NS8 A;  3DTI A;  2O03 A;  5DD4 A;  1IJW C;  4CA0 A;  1WJE A;  5B3S H;  5ED4 A;  3H3V K;  2EB7 A;  2Y0M A;  4DOZ A;  3OYL A;  3S1N J;  1NK3 P;  3DWL E;  2R5Z B;  1Z6R A;  1LE8 B;  2RN7 A;  1KYZ A;  4B3A A;  2E2H J;  2DOD A;  2D2W A;  2JRT A;  5CQE A;  4WXH A;  5K5R A;  2BXY A;  4DYQ A;  4HF1 A;  2Z2S B;  2M9H A;  1MJ9 A;  2AS5 F;  2VKD A;  2PJR B;  4DYC A;  4AM3 A;  3F23 A;  5D8L B;  2DMT A;  3GFL A;  1SFU A;  1ZAR A;  3MKY B;  4XMY A;  2BXZ A;  2WY7 Q;  4Y4R A;  3N97 A;  3M8F A;  4EV0 A;  2MBF A;  1W36 D;  4ESF A;  2ZXI A;  3S2W A;  3CC7 I;  2AXT C;  4XLA A;  3JRG A;  2CQQ A;  4LD5 A;  1BR2 A;  2X1C A;  1DP3 A;  4L5E A;  4GGG A;  1IXC A;  2Y48 A;  3E0J B;  3F6V A;  4HBL A;  3P9K A;  3K4N A;  1XB4 A;  2CO5 A;  2OQG A;  1TZL A;  2RVC A;  2MLG A;  4QPQ A;  1J2X A;  5CVU A;  1IN8 A;  4R79 A;  5J3L A;  1MMN A;  3C3W A;  2HS5 A;  2OA4 A;  2ZJ2 A;  1YIT I;  3LOC A;  4D5F A;  2A6E F;  3RIR A;  5E20 A;  4KMU X;  2KJC A;  2IJL A;  5GAD J;  2R5Y A;  1TW2 A;  2KRF A;  5FD5 A;  2R7V A;  1YRN B;  5IP7 J;  1TC3 C;  4M73 A;  3I71 A;  2H6C A;  2E1O A;  4I98 B;  1I3Q J;  1LDJ A;  4QPO A;  3GFI A;  2VKV A;  3I56 I;  2IXS A;  3DXJ F;  4XRS A;  1VQM I;  4EM2 A;  2QQ9 A;  1O4X A;  3OYH A;  5ICE A;  2JT1 A;  3GTJ J;  5K5Q A;  2FF4 A;  5FRO A;  2DMU A;  4U0V A;  3JRF A;  1RR8 C;  2VOD A;  2HZT A;  3JR9 A;  1B1B A;  5TRD A;  1A04 A;  2BE5 F;  1XPX A;  5FLV A;  2Z99 A;  4RBO A;  1R49 A;  3HZJ A;  1X1P A;  3PQK A;  2ID6 A;  1XSD A;  3I53 A;  4I76 A;  4BQA A;  4RDU A;  2ME0 A;  2CUJ A;  3SDG A;  2O3F A;  3WGH A;  4IQJ A;  2GOX B;  4NB5 A;  2W25 A;  3B6A A;  4Y3O A;  3K2A A;  2M0C A;  1N77 A;  2TCT A;  3V42 A;  3ABU A;  2BVL A;  2E60 A;  2KRH A;  5E1Z B;  2QLZ A;  4DJA A;  4PFO A;  1JKQ C;  3WE2 A;  3JRD A;  2LRE A;  3ZMZ A;  1YW8 A;  5E79 C;  3TO9 A;  4GFB A;  1WH5 A;  2XRO A;  1TQP A;  5M3F J;  5IT3 A;  4IO9 F;  1FP1 D;  2EFO A;  4PJN A;  1RUO A;  4FAS D;  3T5X A;  1S7A A;  3F8C A;  5E8G A;  4M6Y A;  2P8T A;  3R61 A;  5AIP A;  1G3W A;  3RYR A;  3QYE A;  5DV5 A;  1IAW A;  3OIQ A;  1DPU A;  5LLQ A;  1WKM A;  1I27 A;  1POG A;  1AKH B;  3BR6 A;  3KP3 A;  3CCR I;  5D8K B;  2NXN B;  3G1L A;  2HQN A;  2ELJ A;  2MA3 A;  3KLN A;  2RQQ A;  5F04 A;  4YII A;  3MMY B;  1OR7 A;  3E1S A;  5ILV A;  3LFK A;  1QZY A;  1WH7 A;  3HGG A;  3JW4 A;  4AIJ A;  2ISZ A;  5EDN A;  4MLO A;  3CUQ C;  5LEK A;  3KP7 A;  1V54 H;  1TT0 A;  2JN6 A;  1T56 A;  1U2W A;  3ERM A;  1XCB A;  1O7F A;  5H6R A;  2BV6 A;  1SMT A;  4JBA A;  4NQW A;  2NOJ B;  3OYF A;  3KP5 A;  4IKF A;  3OYM A;  4I2O A;  2JTV A;  1FBQ A;  3FZV A;  2BVM A;  4JYK A;  3SFZ A;  1MD0 A;  1IRX A;  5D5W B;  2VE9 A;  2L7F P;  3CCL I;  5JLW A;  2K5C A;  1UAA A;  3P5J A;  1TWH J;  2K40 A;  2PMH A;  2WTE A;  3KYD B;  4C3H J;  5E3N A;  2HPM A;  4XQF A;  2ELK A;  3HSE A;  3F8N A;  1W5T A;  1KU2 A;  2BHZ A;  2X6O A;  3H0G J;  2KL4 A;  4A93 J;  3OIP A;  4XN0 A;  5C44 J;  3FXL A;  2EIJ H;  3A1Y A;  4EAT A;  1TW3 A;  2HOA A;  1C0W A;  3QOE A;  5GAG J;  3RJP A;  3PIO F;  2LD5 A;  2PX9 A;  3HL2 A;  4V19 K;  2F5V A;  4F7Z A;  2ZME A;  1LDK B;  3CCE I;  2KIQ A;  2A6T A;  2Q2E A;  4B44 A;  2HU9 A;  5CVV A;  2K7L A;  4AIH A;  1BIA A;  2R7O A;  2JA2 A;  3GLX A;  3PL8 A;  1XN7 A;  1A6Q A;  1YTY A;  4DNC A;  3K10 A;  1R5G A;  1TTY A;  3MZ8 A;  1MDM A;  3H9J A;  2G9W A;  4I0B A;  3Q0V A;  4IOC F;  1FLI A;  3HG9 A;  1SVL A;  3RPU A;  4FE4 A;  5K7F A;  3A03 A;  5F0H A;  5J1Y A;  3TOA A;  2MD0 A;  2WAQ N;  3HBL A;  3K70 C;  1BBY A;  4V2G A;  4CO8 A;  2EQR A;  1SFX A;  3U1K A;  3WOD F;  2HTS A;  1BC8 C;  2ID3 A;  3NAU A;  5D4R A;  1DDN A;  1G2H A;  4EGZ A;  1IW7 F;  2E36 A;  3BRO A;  2AHQ A;  5J40 A;  2DA1 A;  4KFC A;  2WC2 A;  2F5D A;  4FE7 A;  4A5M A;  5J1R A;  4EJT A;  4LLN A;  2J5P A;  5FKL A;  5EZG A;  4BEH B;  4IHY A;  2DXI A;  4IHT A;  4LIT A;  2DQR A;  4ZTJ A;  3WHB A;  4G6T B;  2CH0 A;  3ZXS A;  3VSL A;  5D5V B;  3Q9S A;  4DBQ A;  2GA1 A;  4M9Z A;  3FX3 A;  3BJO A;  4MIM A;  3IKT A;  1IN6 A;  1V5G A;  2KFD A;  3OL4 A;  2EFQ A;  1G8X A;  2JA8 J;  3VB2 A;  3RPQ A;  1RNL A;  4G12 A;  2Y31 A;  1FTT A;  4ZYA A;  3FIS A;  2FOW A;  1ZGW A;  3W6V A;  2XHK A;  3HOS A;  3QPH A;  5EG0 B;  4HDV A;  4ANJ A;  1MNM C;  4EVI A;  4ZYH A;  1JUM A;  1P4X A;  4D9J A;  4BYY A;  4E7L A;  4NHJ A;  4E7Z A;  3A0H C;  2HZD A;  2KIF A;  3WTY C;  3BPV A;  1VTN C;  2CQN A;  5TIS C;  1LEB A;  1CF7 B;  2DMN A;  3H9G A;  2A61 A;  2W1O A;  1QPM A;  4RM2 A;  1TL8 A;  2A6H F;  3PSF A;  4EEF G;  2MW8 A;  4BJ5 C;  1K4T A;  2LMD A;  3IKV A;  3LAJ A;  4C30 A;  1P9Q C;  4PZJ A;  5E3M A;  3OYE A;  1WJA A;  1X3U A;  2NVX J;  3NWT A;  1R23 A;  4M74 A;  1J09 A;  2G7U A;  2COB A;  2FD5 A;  3QPL A;  3U9G A;  1ZRF A;  3OY9 A;  2ICW G;  5L3C A;  4OMZ A;  3F22 A;  2VC0 A;  1JTY A;  2P7V B;  1FT9 A;  4BBR J;  2GBY A;  2ZO4 A;  3A02 A;  5CVJ A;  2PQ8 A;  3GTO J;  2E2J J;  4BBS J;  3F6O A;  1O3R A;  4YRV A;  4BY1 J;  4ZDL A;  2DN0 A;  3SDB A;  3WU2 C;  3TP0 A;  1QVU A;  1O7L A;  1MMA A;  2M3A A;  2DA6 A;  3IRQ A;  5F0C A;  2DOF A;  2GXG A;  4CXF A;  3E6M A;  2KHM A;  4UUS B;  3DPT A;  4RAY A;  1H0M A;  1SD6 A;  3GW2 A;  1UST A;  3OS1 A;  3S17 J;  4FET A;  2OCE A;  4M6V A;  2DYR H;  3FMS A;  4P96 A;  3BPX A;  4MTE A;  3VPR A;  4EQQ A;  1K4S A;  2FX0 A;  1ETO A;  4XL9 A;  1RUN A;  2V9V A;  2K86 A;  4OAZ A;  4LMY A;  4A0X A;  2CUF A;  2ELH A;  2EWN A;  3K9T A;  1F5T A;  2IGK A;  4XKW A;  1DU0 A;  1S7O A;  3SEQ A;  2CU7 A;  2A05 A;  5JHU A;  2HOE A;  2QF7 A;  1UHM A;  3D5S C;  4XRS G;  4N4O B;  1MNE A;  2E1M B;  3VFZ A;  4C2U A;  3PM1 A;  5E17 F;  3BP8 A;  4HAM A;  3QWL A;  1D5Y A;  2B0L A;  2JK3 A;  3D0S A;  1LPQ A;  1Q1H A;  1YLF A;  2CMP A;  4IX7 A;  3HSF A;  3L2U A;  4X1E A;  2IAI A;  5LEJ A;  1GXP A;  1FYL A;  1WJB A;  4MEY F;  3ERE D;  1JE8 A;  2Y75 A;  3ZMU A;  5FGM A;  1Z77 A;  5L3G A;  1R71 A;  2E5Z A;  4G6D A;  2L5Q A;  5DEQ A;  3GXO A;  4LG3 A;  4CYC B;  2IA0 A;  3RKX A;  4QSH A;  2VBX A;  1V5F A;  2DFI A;  3CME I;  5F6F A;  3OWT A;  3CUQ A;  2R7S A;  2FSW A;  1UCR A;  2VBW A;  4C3J J;  2DTZ A;  3B73 A;  3L1P A;  2R7X A;  1U3E M;  2I8D A;  2L0K A;  3AG1 H;  3QQA A;  1ZK8 A;  1JI8 A;  2Z5U A;  2WV0 A;  4G7H F;  1B59 A;  1N25 A;  1HKT A;  3ZMV A;  2NVQ J;  1FTZ A;  4IXA A;  1JTX A;  1SAN A;  2DT6 A;  4KUM A;  3SJM A;  3OS2 A;  2EZI A;  2XVC A;  2OPT A;  1I6X A;  1NHA A;  2CW7 A;  1FOY A;  4LOC A;  3I59 A;  2OBP A;  3S8P A;  3FK7 A;  1UFM A;  1ON1 A;  2Z3Y A;  1QU3 A;  4HF0 A;  3TMO A;  1WPK A;  3BG9 A;  1FEX A;  2ME6 A;  3W2W A;  5C4J J;  1ZG1 A;  1S8N A;  3FHZ A;  3QU6 A;  2B9S A;  4CGZ A;  3KZI C;  3PUB A;  1R22 A;  5B1B H;  3HKZ A;  4AID A;  1HXD A;  1KYW A;  3GEZ A;  3OR1 C;  4KMF A;  1RZ4 A;  2LY1 A;  3HTU A;  5E18 F;  1OCR H;  4AC0 A;  4M3B A;  4A0Y A;  4HQE A;  4I01 A;  3I9V 2;  5DCM A;  2YU9 J;  2K02 A;  5D4S A;  3J7A Y;  3VEP A;  2XC7 A;  3EUH C;  3SEZ A;  5J8C A;  1XGO A;  1V3F A;  3F8F A;  1W4M A;  4MQV A;  5J8F A;  3V4G A;  1GDT A;  4RM3 A;  2ZXJ A;  3OYB A;  3OR2 C;  1VQ6 I;  2IEK A;  3EUA A;  3MVP A;  5DD8 A;  3L2W A;  1U78 A;  2CYY A;  3EYI A;  5IT9 K;  4YFN F;  3IV5 A;  5FD6 A;  3G6E I;  3E5U A;  5CVI A;  2EIK H;  2V1N A;  4A3G J;  1T98 A;  3CJQ B;  3G1M A;  5L3F A;  3MEX A;  3QAH A;  5IOY A;  4L9V A;  3ZQQ A;  4X0G A;  2Y0S N;  1WHU A;  2COM A;  3KLO A;  2AQE A;  3JRE A;  1B72 B;  3C18 A;  4PDK A;  2HVQ A;  2L4A A;  3R60 A;  4A3E J;  1LB2 A;  3HC7 A;  3CLQ A;  5J4Y A;  4FQG A;  1PP7 U;  3BR3 A;  2VT2 A;  3WGG A;  2XF6 A;  1QPI A;  3QOP A;  2KP6 A;  2VQL A;  3AG3 H;  4NC7 A;  3SZP A;  1KU3 A;  2P5V A;  4AUX A;  1P7I A;  2CRG A;  1U6G A;  3AG2 H;  3DBL B;  2LKP A;  3KPH A;  3ML6 A;  2WV1 A;  1A6I A;  4IRH A;  2JSC A;  4P1W A;  1NK2 P;  5IOZ A;  2Q2E B;  5CPR B;  3U2R A;  2O8X A;  4UY8 I;  1GVD A;  1U5T C;  2P4W A;  4KYW A;  4HLX A;  2OU2 A;  4B4C A;  3QPT A;  3TO7 A;  3B02 A;  1OCZ H;  1RET A;  2P6T A;  3LNQ A;  4UUS A;  1WJF A;  2HDW A;  3ABM H;  1E0E A;  2X4H A;  2L7M P;  2H94 A;  2VPR A;  3K1N A;  5KK1 A;  3TL4 X;  3HKZ N;  2DT7 B;  4RB2 C;  3HHH A;  2BHY A;  2CW8 A;  1QRY A;  2V9K A;  1LVA A;  2DDB A;  4Y13 A;  2CV2 A;  3QP5 A;  2EZH A;  2ZXH A;  1XGN A;  2X6W A;  3FIW A;  2CJJ A;  1G3T A;  3U1D A;  4HG2 A;  4WXC A;  1BN5 A;  1T0F C;  1UHS A;  3WTV C;  1BW5 A;  1QGP A;  3KEO A;  3CCY A;  3FXU A;  5BPD A;  2KZV A;  4B48 A;  1Y1V J;  2XSD C;  2CQX A;  2F2E A;  5ICG A;  5FLM J;  1KU7 A;  3K6G A;  2R92 J;  2MD5 A;  3AFH A;  2Y9Y A;  1VF9 A;  1MGT A;  2GLO A;  4PJJ A;  1XSX A;  2L7Z A;  1Y0U A;  3E7L A;  5M5Y J;  1Z91 A;  3S16 J;  4B8X A;  5M5X J;  5DM6 F;  3HGY A;  3T0Y A;  3CUQ B;  4LB5 A;  1ZLJ A;  1IUY A;  2IGN A;  1WVR A;  5LRS A;  2EA4 A;  3ABT A;  4D1Q A;  2J5O A;  2V1U A;  1Z6T A;  4BKX A;  2OC6 A;  2DPU A;  4KA4 A;  4JQF A;  3TDU C;  4S0H B;  4LGW A;  5EF6 A;  2LR8 A;  3ZQC A;  5LHI A;  3I55 I;  3TW7 A;  3ECO A;  4YIR X;  2OTJ I;  3KZY A;  1U9N A;  1H9G A;  4M72 A;  1JHH A;  3GYH X;  5IP9 J;  3PNV A;  3LSK A;  3W6K B;  1SFO J;  4IHX A;  1S7E A;  3ELK A;  3ASO H;  3CCV I;  2PN6 A;  3C7J A;  4A5N A;  5GAE J;  1JKO C;  1S3J A;  2EV5 A;  4LK0 F;  1TBX A;  2MGQ A;  3N05 A;  1ZTR A;  1YS7 A;  3GWZ A;  2ZJQ F;  1F43 A;  1OYI A;  2W48 A;  3HYI A;  4GDF A;  2EFN A;  3D5L A;  3OOU A;  1KQ0 A;  1VZ0 A;  3ZP5 A;  4O5V A;  5DCF A;  3E97 A;  3PIP F;  4KIB A;  2MH9 A;  3SZT A;  5LD2 C;  3IWZ A;  3H3Z A;  1T38 A;  4BQN A;  4FHT A;  4I02 A;  3LSH A;  2LDU A;  4XN3 A;  3M9A A;  4G8X A;  3F72 A;  1FZP B;  3LSP A;  3W2A A;  1E3H A;  3ZCO A;  4YEL A;  4IOA F;  3W6J B;  2EV0 A;  4OIO F;  3UNG C;  5D6E A;  4IZZ A;  3L7W A;  1K61 A;  1BC7 C;  3BR5 A;  2P5L C;  2O6G E;  5EJC A;  1N75 A;  1B8I B;  4A6D A;  3NRV A;  3HTS B;  4D7N A;  5K7Z A;  5EGO A;  3B6C A;  3OYG A;  3BZ6 A;  3DBH B;  3CJR B;  4U0W A;  5FO5 A;  1IC8 A;  1J9I A;  2DTR A;  3DEE A;  3OL3 A;  2O61 A;  3BG6 A;  5DM7 F;  3BC8 A;  3RYP A;  1OQY A;  4L9N A;  4UB6 C;  3BJ6 A;  1K6Y A;  2X48 A;  1TLH B;  1KA8 A;  4A3C J;  1REP C;  1R7J A;  1TWC J;  1VQ5 I;  1YHQ I;  2NNN A;  1NH3 A;  3DCF A;  1ZEL A;  1EV7 A;  1M1E B;  2L9N A;  2DFH A;  2LVS A;  1GV2 A;  4DQ2 A;  2FMY A;  3T8T A;  1LKX A;  2VL8 A;  4KNY A;  1ETW A;  2HVS A;  5HS8 A;  3IRR A;  2WAE A;  2LBF A;  2A68 F;  3QRF F;  4A3L J;  3VOE A;  3CMY A;  4IJA A;  1F4K A;  1A35 A;  1XMK A;  1MW7 A;  3BLY A;  1FMW A;  3BJA A;  2LYC A;  3L2C A;  2UXN A;  1GXQ A;  2ACJ A;  3LSG A;  1R6R A;  5FLX K;  4O3M A;  1WSU A;  4M3F A;  1ZH5 A;  1V55 H;  2FE3 A;  2YPR A;  3HOW J;  1TWG J;  1BJA A;  5HOO A;  4C2M J;  3FMQ A;  3E6B A;  4HOB A;  4IHS A;  1GVJ A;  5IT9 Z;  2XKO A;  2VJ5 A;  1YQA A;  2P6S A;  1ACI A;  1IV8 A;  1BR4 A;  3IAS 2;  2IPQ X;  1E2X A;  3GZ5 A;  2YU3 A;  2ZFW A;  1FP2 A;  4AYB N;  3DQV C;  2HI3 A;  2DBB A;  3L9F A;  2CW0 F;  4F91 B;  2W7N A;  2DA5 A;  1JJ6 C;  5EZH A;  1YRN A;  1K6O A;  2HYG D;  2DJN A;  1R36 A;  2K4B A;  3HPH A;  1T39 A;  3CJT B;  4AVP A;  2LKS A;  2IT0 A;  2GZW A;  1BOB A;  3CC2 I;  2NNY A;  1U9O A;  3ZQF A;  1X1C A;  4B09 A;  4FTH A;  3FWE A;  4BY7 J;  3RKW A;  4HV6 A;  4GRI A;  1I1G A;  3GVA A;  4IPA A;  1U8R A;  3IWF A;  4RB0 A;  4IVN A;  1JHF A;  5FKK A;  1D0Y A;  3FXR A; 
#chains in the Genus database with same CATH homology
 4L5J A;  5HLI A;  1FPQ A;  2TDX A;  2L01 A;  5DDG A;  2PFB A;  2FEZ A;  3Q9V A;  4L9J A;  2VT3 A;  3RKY A;  1H9T A;  1PP8 F;  5CLS A;  1SFE A;  3MFK A;  5E1W A;  4RGR A;  1XGS A;  3CTA A;  1QO0 D;  1TQM A;  4S04 A;  2FBK A;  1CF7 A;  2OZU A;  3WTZ A;  4HX4 A;  4A6E A;  3ZMD A;  1OYY A;  5AON A;  2IRF G;  3KET A;  1O3Q A;  2OAZ A;  3RI4 A;  1XSV A;  3R0A A;  1O3T A;  2HKO A;  2ZCW A;  3WTT C;  3CO6 C;  5H6Q A;  2WWY A;  1FWZ A;  2CGP A;  2FNP A;  1FYK A;  1EH8 A;  1QNT A;  3VOD A;  1K79 A;  2XIG A;  4A2U A;  2PG4 A;  2R3S A;  4Q47 A;  1RI7 A;  5FLX Z;  1ZYR F;  1BOA A;  2MC3 A;  3H3U A;  2ISY A;  4U7D A;  1FBU A;  1ZRC A;  1FOK A;  2BGC A;  1LNW A;  4KIG A;  2FBI A;  1OYW A;  3I58 A;  4OU0 A;  1R58 A;  5ICF A;  5ERI A;  2GAU A;  1KQ9 A;  2AXL A;  3KP2 A;  3JAM Z;  5E8I A;  2V1X A;  3KCC A;  2E7W A;  1WWX A;  2IA2 A;  4GXO A;  3TOB A;  5HDG A;  1KGS A;  2QVO A;  2D45 A;  4A12 A;  2JZY A;  1LJ9 A;  4Q48 A;  3J7A O;  4L5I A;  1S6L A;  2KJB A;  5H20 A;  1Z05 A;  4HZF A;  3AAF A;  4HA8 A;  1AWC A;  3HRM A;  1BI0 A;  2RGV A;  2HTJ A;  1ZGJ A;  1HQC A;  2DQL A;  4M9S A;  1UB9 A;  4EM0 B;  1RIO H;  5AIQ A;  4ZH4 F;  2CQK A;  3F21 A;  4RGS A;  1ZN2 A;  2W24 A;  3TDZ C;  1G3S A;  3I5U A;  1EH7 A;  4JK1 X;  2KIM A;  1IRG A;  1YYV A;  3M1E A;  2EFP A;  2FBH A;  4WF2 A;  1D8K A;  1YFH A;  1XDU A;  2ESH A;  2M5W A;  2KIU A;  2F5F A;  3C1D A;  2ZNZ A;  4CZZ A;  1XD7 A;  3P9I A;  1IZ1 A;  3T1B A;  5HDK A;  5F1R A;  5CJ9 A;  1XMA A;  4HV5 A;  1O57 A;  3E5Q A;  3K0L A;  4P55 A;  5HDN A;  3ZN1 A;  2G7H A;  1J59 A;  3E6D A;  2ADU A;  1ZG5 A;  4YFX F;  3ZQ7 A;  1YO5 C;  4LFU A;  2HFH A;  3REO A;  2M1B A;  2M87 A;  2VOO A;  2HDC A;  2OD5 A;  4UV8 A;  4OMY A;  4ON0 A;  1DP7 P;  2QUF A;  1IN5 A;  1B9M A;  3PFI A;  4AD9 A;  4BHC A;  2W57 A;  3SXY A;  4G9Y A;  4KIF A;  1MKM A;  2W85 A;  2MH2 A;  4EJO A;  1MDM B;  4Q5S F;  2FRH A;  2V79 A;  5LGU A;  3R6S A;  2QYO A;  3LST A;  3R4K A;  4BNC A;  2ESN A;  2QQA A;  3FM3 A;  2P5K A;  3DKW A;  2VON A;  3NQO A;  4ZZL A;  1G3Y A;  2OZ6 A;  2M30 A;  4XLP F;  2FNA A;  3JSO A;  4BAY A;  1W7P B;  1Z7U A;  3MQ0 A;  4ENN A;  2H6B A;  2HR3 A;  2HQR A;  2XAS A;  3KFW X;  3RDI A;  4PCQ A;  1SD4 A;  2VBZ A;  1FSH A;  4MQ9 F;  2DO7 A;  3KZZ A;  5BS6 A;  4ENJ A;  1TNS A;  4GO1 A;  3TQN A;  4K2E A;  2DAO A;  4LLL A;  2GA2 A;  4FX4 A;  4ZYD A;  1XCV A;  1B9N A;  3IC7 A;  4MEX F;  2UWM A;  3M7G A;  3WGI A;  3EQL F;  1IXR C;  2L4M A;  2PMU A;  3JSP A;  5DCM B;  2NYX A;  3CO7 C;  3I64 A;  4PGG A;  3RTR A;  3E5X A;  5DYM A;  1J7K A;  4RS8 A;  4BHB A;  3ULQ B;  3EUH A;  5F64 A;  5DUI A;  3ISP A;  4LB6 B;  3L09 A;  3V7C A;  3COA C;  1Z1D A;  1BIB A;  1WRJ A;  1LQ1 A;  4TV7 A;  2LF8 A;  2HYF A;  4R8H A;  4GYI A;  2RKH A;  2CSO A;  2LNB A;  5A2Q K;  2KKO A;  4L18 B;  4LK1 F;  1R1V A;  4BH9 A;  2E7X A;  5BPI A;  4LLG F;  1HSJ A;  2DT5 A;  1R1T A;  5DUK A;  4IRG A;  3IL2 A;  2FU4 A;  1D3Y A;  4OIN F;  1FX7 A;  1IN7 A;  1MJA A;  2H27 A;  2FA5 A;  3QP6 A;  1ONV A;  1T0F A;  4P9F A;  2VC1 A;  4U88 A;  1USS A;  1ZRE A;  1OPC A;  3GFJ A;  4QLC U;  4PGH A;  3HUG A;  1DUX C;  2VE8 A;  2RDP A;  2VBY A;  4Y15 A;  1TNT A;  2K27 A;  4H0E A;  4OIQ F;  5HLG A;  3KE2 A;  1GHC A;  4MNU A;  3HOT A;  1P92 A;  5LHG A;  1K78 B;  4L0Y B;  4EMS A;  4ENK A;  2M45 A;  1P2F A;  2L02 A;  4U7B A;  2EFW A;  5L3E A;  2PI0 A;  4YFK F;  1T6S A;  1ZHF A;  2XRN A;  2VN2 A;  5D6F A;  2PEX A;  1G4D A;  2F5E A;  2XAG A;  2D1V A;  3V8J A;  4EJU A;  2XAF A;  3P9C A;  3OV8 A;  2HWV A;  4ETS A;  4L0Z B;  3LAP A;  4UV9 A;  4EGY A;  2JPC A;  3G73 A;  2XAH A;  4Q4Z F;  1BI2 A;  1J0R A;  2GQQ A;  4ASN A;  2QQB A;  4HDU A;  4ESJ A;  3ZPL A;  3ROU A;  2R7F A;  3E6C C;  2GXB A;  1XGM A;  3BY6 A;  1IRF A;  2FOK A;  2A69 F;  5D5X B;  3BOQ A;  2OQR A;  1AOY A;  4P5O A;  3FF5 A;  4HX8 A;  2BYV E;  5E1X A;  2Q0O A;  3WTW C;  2RV8 A;  1FSE A;  3G3Z A;  2GIV A;  4WXD A;  5ILU A;  3O3K A;  3MAJ A;  4LG0 B;  2FXA A;  2FQ3 A;  5JFR A;  3DEU A;  3K1P A;  1E17 A;  3L00 A;  4HF2 A;  1LEA A;  3WU1 B;  4GCV A;  1HKQ A;  1XDS A;  2PJP A;  4M6X A;  1EH6 A;  1HBX G;  4I7H A;  1KQ8 A;  1FBS A;  3K1M A;  3CLO A;  3TGN A;  2A07 F;  1Z9C A;  1R5H A;  6PAX A;  3K2Z A;  3V8L A;  2XAQ A;  1OMI A;  3I0T A;  1WI9 A;  3T8R A;  3K69 A;  1UHW A;  2XKP A;  5L3D A;  1QBJ A;  5L3B A;  1R1U A;  1P4A A;  3HHG A;  3N4M A;  1S29 A;  4L9T A;  3V7R A;  1JGS A;  3KEQ A;  3ZMT A;  3ZN0 A;  3KP4 A;  4LG0 A;  1TQI A;  4GYG A;  3LWF A;  4KDP A;  2XV4 S;  4ZYG A;  3HSR A;  2ZME B;  1L0O C;  3O2P E;  2M8E A;  3F3X A;  1CGP A;  5D5U B;  4N9H A;  5LRR A;  2YX7 A;  3GUD A;  2QBY B;  5HLH A;  1SD5 A;  4D0P A;  2EV6 A;  2O0Y A;  3LQR A;  1I1S A;  1P6R A;  4XSX F;  2V1D A;  1FYM A;  5A2Q Z;  4UHT A;  4FX0 A;  5LBQ A;  2PBI A;  4KN7 X;  2ETH A;  2UZK A;  2VOP A;  2A5Y B;  4AIK A;  2E1N A;  1OKR A;  3H92 A;  4WK8 F;  2XAJ A;  3TO6 A;  3SQN A;  5K5O A;  2GWR A;  1F1Z A;  2LSO A;  1YW7 A;  3DPL C;  3DP7 A;  3DFG A;  5TJJ A;  3WTX C;  3ECH A;  4UXN A;  5BMZ A;  4IF4 A;  5FFX A;  1F9N A;  3MCZ A;  1ODD A;  5ILS A;  3GO5 A;  5HS9 A;  1ZG3 A;  1ZAO A;  2LF7 A;  2DW4 A;  2QZ8 A;  3LA7 A;  3JTG A;  4G94 A;  1D8J A;  3DF8 A;  1YS6 A;  2RQP A;  4WX9 A;  2IVM A;  4HLY A;  1ULY A;  3FMR A;  4KT5 C;  4Z2Y A;  3EYY A;  4BHP A;  2D1H A;  1P4W A;  2QBY A;  4N0B A;  4XBF A;  1D5V A;  3ZMS A;  3V8K A;  4EJW A;  3MZH A;  3CDH A;  2EA2 A;  4UNO A;  1W7P D;  1QQI A;  3FM5 A;  3HRT A;  2HEO A;  4FT8 A;  1V4R A;  1FC3 A;  3E3V A;  5K1Y A;  1YW9 A;  4R1H A;  2HKX A;  4BXU A;  4N9I A;  1HKS A;  3V7S A;  3WTS C;  2DK8 A;  1WQ2 A;  3MWM A;  1MZB A;  4OIR F;  4QWQ A;  3F8M A;  3I54 A;  2L54 A;  4RB3 C;  4RB1 A;  1JXS A;  2STW A;  1IN4 A;  1ZGA A;  4YIF A;  3I4P A;  3EET A;  1PUE E;  2Z9O A;  3WG9 A;  3BDD A;  2EK5 A;  4EM1 A;  4U0Y A;  1HW1 A;  2HGC A;  4I09 A;  1KU9 A;  2UXX A;  4P9U A;  3LA3 A;  2P7C B;  2CFX A;  2R7D A;  4UVC A;  1ZLK A;  2QEN A;  3I59 B;  2FML A;  1W7P A;  2EJR A;  2A3S A;  3F8B A;  2JPB A;  2V6C A;  1MJB A;  4G7O F;  2DU9 A;  1U5T A;  2IA1 A;  2K4J A;  4MGR A;  2BBY A;  1K7A A;  3KP6 A;  5CVR A;  1B4A A;  3FXQ A;  1BI3 A;  2RNJ A;  5BQT A;  4CHU A;  3TKY A;  4MHG A;  1U5T B;  3HRS A;  5JR3 A;  4G6Q A;  4XLN F;  5FFZ A;  4EJV A;  2RC4 A;  3LQQ A;  3PQJ A;  4ESB A;  5JVT A;  1L3L A;  2YR2 A;  4UVB A;  2Q8K A;  1HST A;  3P7N A;  4KN4 X;  3BWG A;  4CYD A;  4Y17 A;  3NEU A;  5ICC A;  2STT A;  1ZRD A;  1O3S A;  1K78 A;  3LA2 A;  3GF2 A;  5KVR A;  3GZ6 A;  4S05 A;  3DV8 A;  3GFM A;  4OIP F;  1B6A A;  2IW5 A;  1HW2 A;  1QZZ A;  4CIC A;  1ON2 A;  2ZBK A;  1BI1 A;  4HYE A;  4ENM A;  3R0J A;  3M8E A;  4AWX B;  2CG4 A;  1YG2 A;  4RGU A;  3J80 K;  2DK5 A;  1YIO A;  3OOP A;  5FB2 A;  1FNN A;  1STZ A;  2MLK A;  1I5Z A;  1FY7 A;  1DPR A;  5BOX A;  2X0L A;  2XUB A;  4WCG A;  1IXS B;  5EEH A;  3WU0 A;  4HQM A;  1G6N A;  4XSZ F;  5HVQ C;  4ZZD A;  2F5C A;  4UUV A;  2DI3 A;  4CDG A;  4ZYE A;  5LGT A;  3IHU A;  1T2K A;  1R00 A;  3QU3 A;  4M71 A;  3EDP A;  1SAX A;  2E1C A;  4YG2 F;  4OOI A;  2PLY A;  4M9X A;  4O6J A;  3GX4 X;  4XRF A;  5J6X A;  1J75 A;  2CWE A;  2ZNY A;  3HIF A;  1SD7 A;  5JI6 A;  3WE3 A;  2BEO A;  1J5Y A;  4A0Z A;  5LHH A;  2VXZ A;  4IRI A;  1W5S A;  3Q5F A;  2DLL A;  2QM3 A;  3WTU C;  4E70 A;  5CYV A;  3SHF A;  2ZKZ A;  4G7Z F;  2Z33 A;  4KIC A;  4I0A A;  4RGX A;  4RAZ A;  4HX7 A;  2QWW A;  3O6B B;  2W84 A;  4WWC A;  3JAM K;  4LJZ F;  2YSR A;  4MTD A;  1SMY F;  3HRU A;  5EEG A;  1HW5 A;  2H09 A;  2XGX A;  4HW0 A;  2L3D A;  2YX4 A;  3J80 Z;  2NRA C;  5LGN A;  4UVA A;  3J81 K;  1BM9 A;  1LDD A;  2IP2 A;  2C6Y A;  3CJN A;  2NS0 A;  3J81 Z;  3JTH A;  1IF1 A;  3MZY A;  2NAZ A;  1PDN C;  5HS7 A;  3CUO A;  2O03 A;  5DD4 A;  5ED4 A;  2EB7 A;  2Y0M A;  1Z6R A;  2RN7 A;  1KYZ A;  2D2W A;  2JRT A;  4WXH A;  5K5R A;  4HF1 A;  1MJ9 A;  2AS5 F;  3F23 A;  5D8L B;  3GFL A;  1SFU A;  1ZAR A;  3N97 A;  3M8F A;  4EV0 A;  2MBF A;  4ESF A;  3S2W A;  4LD5 A;  4GGG A;  1IXC A;  2Y48 A;  3F6V A;  4HBL A;  3P9K A;  1XB4 A;  2CO5 A;  2OQG A;  2RVC A;  2MLG A;  1J2X A;  5CVU A;  1IN8 A;  4R79 A;  3C3W A;  2HS5 A;  2OA4 A;  2ZJ2 A;  2A6E F;  3RIR A;  5E20 A;  4KMU X;  2KJC A;  2IJL A;  1TW2 A;  2KRF A;  5FD5 A;  4M73 A;  3I71 A;  2H6C A;  4I98 B;  1LDJ A;  3GFI A;  3DXJ F;  4EM2 A;  2QQ9 A;  5ICE A;  2JT1 A;  5K5Q A;  2FF4 A;  4U0V A;  2VOD A;  2HZT A;  1B1B A;  5TRD A;  1A04 A;  2BE5 F;  2Z99 A;  3PQK A;  1XSD A;  3I53 A;  4BQA A;  2O3F A;  3WGH A;  4NB5 A;  2W25 A;  3ABU A;  5E1Z B;  2QLZ A;  3WE2 A;  3ZMZ A;  1YW8 A;  3TO9 A;  2XRO A;  1TQP A;  5IT3 A;  1FP1 D;  2EFO A;  1RUO A;  3T5X A;  1S7A A;  3F8C A;  5E8G A;  4M6Y A;  2P8T A;  3R61 A;  5AIP A;  1G3W A;  3RYR A;  5DV5 A;  1IAW A;  1DPU A;  5LLQ A;  1WKM A;  1I27 A;  3KP3 A;  5D8K B;  2HQN A;  2MA3 A;  3KLN A;  4YII A;  1OR7 A;  5ILV A;  3LFK A;  2ISZ A;  4AIJ A;  1QZY A;  3JW4 A;  3CUQ C;  5LEK A;  3KP7 A;  1U2W A;  1XCB A;  1O7F A;  5H6R A;  2BV6 A;  1SMT A;  4JBA A;  4NQW A;  3KP5 A;  4I2O A;  2JTV A;  1FBQ A;  3FZV A;  2VE9 A;  3SFZ A;  1MD0 A;  5D5W B;  2DPD A;  2PMH A;  2WTE A;  3HSE A;  3F8N A;  1W5T A;  1KU2 A;  1C0W A;  1TW3 A;  3RJP A;  4F7Z A;  2ZME A;  1LDK B;  2Q2E A;  5CVV A;  2K7L A;  4AIH A;  1BIA A;  3GLX A;  1XN7 A;  1YTY A;  4DNC A;  1R5G A;  1TTY A;  1MDM A;  2G9W A;  4I0B A;  1FLI A;  3RPU A;  3TOA A;  1BBY A;  4CO8 A;  3WOD F;  1SFX A;  1BC8 C;  2HTS A;  5D4R A;  1DDN A;  4EGZ A;  1IW7 F;  3BRO A;  4KFC A;  2WC2 A;  2F5D A;  4A5M A;  4EJT A;  4LLN A;  2J5P A;  4IHT A;  2DQR A;  5D5V B;  3Q9S A;  2GA1 A;  4M9Z A;  3FX3 A;  3BJO A;  3IKT A;  1IN6 A;  2EFQ A;  3VB2 A;  3RPQ A;  1RNL A;  2XHK A;  3HOS A;  3QPH A;  4HDV A;  4EVI A;  4ZYH A;  1P4X A;  4BYY A;  4NHJ A;  2KIF A;  3WTY C;  3BPV A;  1VTN C;  1LEB A;  1CF7 B;  2A61 A;  1QPM A;  2A6H F;  3IKV A;  3LAJ A;  4PZJ A;  1X3U A;  1R23 A;  4M74 A;  2G7U A;  3U9G A;  1ZRF A;  5L3C A;  4OMZ A;  3F22 A;  2VC0 A;  2P7V B;  1FT9 A;  2ZO4 A;  5CVJ A;  2PQ8 A;  3F6O A;  1O3R A;  1O7L A;  3IRQ A;  2GXG A;  4CXF A;  3E6M A;  1H0M A;  3DPT A;  4RAY A;  1SD6 A;  3GW2 A;  1UST A;  3FMS A;  4P96 A;  3BPX A;  4MTE A;  4EQQ A;  1RUN A;  2V9V A;  2K86 A;  4LMY A;  4A0X A;  2ELH A;  2EWN A;  3K9T A;  1F5T A;  1S7O A;  5JHU A;  2HOE A;  1UHM A;  3VFZ A;  5E17 F;  3BP8 A;  4HAM A;  2B0L A;  3D0S A;  1Q1H A;  1YLF A;  3HSF A;  5LEJ A;  1GXP A;  1FYL A;  4MEY F;  3ERE D;  1JE8 A;  2Y75 A;  3ZMU A;  5FGM A;  5L3G A;  4G6D A;  5DEQ A;  3GXO A;  2IA0 A;  3RKX A;  2VBX A;  2DFI A;  5F6F A;  3CUQ A;  2FSW A;  1UCR A;  2VBW A;  3B73 A;  1U3E M;  2Z5U A;  2WV0 A;  4G7H F;  1B59 A;  1HKT A;  3ZMV A;  4IXA A;  4KUM A;  2XVC A;  1I6X A;  1NHA A;  3I59 A;  2OBP A;  1UFM A;  1ON1 A;  2Z3Y A;  4HF0 A;  1ZG1 A;  1S8N A;  3FHZ A;  3QU6 A;  4CGZ A;  1R22 A;  1HXD A;  1KYW A;  3GEZ A;  4KMF A;  1RZ4 A;  3HTU A;  5E18 F;  4A0Y A;  4HQE A;  4I01 A;  5DCM A;  2K02 A;  5D4S A;  3VEP A;  5J8C A;  1XGO A;  1V3F A;  3F8F A;  1W4M A;  4MQV A;  5J8F A;  3V4G A;  2ZXJ A;  5DD8 A;  1U78 A;  2CYY A;  3EYI A;  5IT9 K;  4YFN F;  5FD6 A;  3E5U A;  5CVI A;  1T98 A;  5L3F A;  3MEX A;  3QAH A;  4L9V A;  2COM A;  3KLO A;  3C18 A;  4PDK A;  3R60 A;  2L4A A;  1LB2 A;  1PP7 U;  2VT2 A;  3WGG A;  3QOP A;  3SZP A;  1KU3 A;  2P5V A;  1U6G A;  2LKP A;  3ML6 A;  4IRH A;  2JSC A;  3U2R A;  2O8X A;  1U5T C;  2P4W A;  4KYW A;  4HLX A;  2OU2 A;  3QPT A;  3TO7 A;  3B02 A;  2P6T A;  2X4H A;  3K1N A;  2H94 A;  5KK1 A;  4RB2 C;  3HHH A;  1LVA A;  4Y13 A;  3QP5 A;  1XGN A;  1G3T A;  3U1D A;  4WXC A;  1BN5 A;  3WTV C;  1QGP A;  3KEO A;  5BPD A;  3FXU A;  2F2E A;  5ICG A;  1KU7 A;  2MD5 A;  1MGT A;  1XSX A;  1Y0U A;  1Z91 A;  4B8X A;  3T0Y A;  3CUQ B;  4LB5 A;  1ZLJ A;  1IUY A;  5LRS A;  2EA4 A;  3ABT A;  2J5O A;  2V1U A;  1Z6T A;  2DPU A;  4KA4 A;  4JQF A;  3TDU C;  4LGW A;  5LHI A;  3ECO A;  3KZY A;  1H9G A;  4M72 A;  1JHH A;  3GYH X;  3W6K B;  3ELK A;  2PN6 A;  3C7J A;  4A5N A;  1S3J A;  2EV5 A;  4LK0 F;  1TBX A;  1YS7 A;  3GWZ A;  1OYI A;  3HYI A;  2EFN A;  3D5L A;  1KQ0 A;  3ZP5 A;  4O5V A;  5DCF A;  3E97 A;  4KIB A;  2MH9 A;  3SZT A;  3IWZ A;  3H3Z A;  1T38 A;  4FHT A;  4I02 A;  2LDU A;  3M9A A;  4G8X A;  1FZP B;  3F72 A;  3W6J B;  2EV0 A;  4OIO F;  5D6E A;  3L7W A;  1BC7 C;  2P5L C;  2O6G E;  3HTS B;  3NRV A;  4A6D A;  3BZ6 A;  4U0W A;  1J9I A;  5FO5 A;  2DTR A;  2O61 A;  3RYP A;  4L9N A;  3BJ6 A;  1KA8 A;  1TLH B;  1REP C;  1R7J A;  2NNN A;  1EV7 A;  4DQ2 A;  2FMY A;  3T8T A;  4KNY A;  5HS8 A;  3IRR A;  2A68 F;  3QRF F;  3VOE A;  4IJA A;  1F4K A;  1XMK A;  3BJA A;  3L2C A;  2UXN A;  1GXQ A;  2ACJ A;  5FLX K;  4O3M A;  1WSU A;  1ZH5 A;  2FE3 A;  2YPR A;  1BJA A;  5HOO A;  3FMQ A;  3E6B A;  4HOB A;  4IHS A;  1GVJ A;  5IT9 Z;  2XKO A;  1YQA A;  2P6S A;  2IPQ X;  1E2X A;  3GZ5 A;  2YU3 A;  2ZFW A;  1FP2 A;  3DQV C;  2DBB A;  3L9F A;  2CW0 F;  1K6O A;  2HYG D;  2K4B A;  1R36 A;  1T39 A;  4AVP A;  2IT0 A;  2GZW A;  2NNY A;  4B09 A;  3FWE A;  3RKW A;  4HV6 A;  1I1G A;  3GVA A;  4IPA A;  1U8R A;  3IWF A;  4RB0 A;  4IVN A;  1JHF A;  3FXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...