2IT0A

Crystal structure of a two-domain ider-dna complex crystal form ii
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
ELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mbtA/mbtB operator strand 1
publication title Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/dna
total genus 48
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2it0A01
3FXQA 4HAMA 1CGPA 1ON1A 2EFQA 4UXNA 1XGSA 2EA2A 3ABUA 1HBXG 1QNTA 4CXFA 2RKHA 1IUYA 2A6EF 1V4RA 2HOEA 4L0YB 2V1XA 4L5JA 1GHCA 1BI0A 1SD6A 1U5TB 5EEGA 3RIRA 3K9TA 3MWMA 2XAJA 2Q8KA 2E1CA 1S6LA 4I02A 1IF1A 4EJUA 4EM0B 3CLOA 3EYIA 4RGUA 3MEXA 4I01A 1MDMB 2A6HF 4L9JA 3GEZA 4UUVA 4WCGA 3TDUC 3K1PA 3GO5A 3QPTA 3BY6A 4HYEA 4S05A 2OAZA 5D5VB 2QBYA 2GAUA 1I27A 1HSTA 4LK0F 3BPXA 3K0LA 4B09A 1FSHA 2FU4A 4OU0A 4BNCA 3BJAA 4A0ZA 2P6SA 2O3FA 3SXYA 1S29A 1MJ9A 1I1GA 1U6GA 2QQBA 2AXLA 4A2UA 2H27A 5H20A 1H0MA 5DYMA 4HOBA 3ZMDA 2KJCA 2A61A 4E70A 3KP5A 3ISPA 2NAZA 5ILSA 2MLKA 2CO5A 3WGGA 2O6GE 1WQ2A 1S7OA 1RUNA 1OPCA 3KCCA 3QAHA 5DDGA 2LDUA 2IRFG 4ZZLA 4LB5A 2Q0OA 2WWYA 2P5VA 2PFBA 1YLFA 2OQRA 1A04A 2XKPA 4FT8A 4ESJA 1KU7A 4HV6A 5EEHA 3T0YA 2D45A 1EV7A 1FZPB 1J5YA 2A5YB 1D3YA 4BHBA 1J9IA 1YS7A 4PDKA 1YTYA 5A2QZ 5AIPA 1OYIA 1P4XA 4Y13A 5JHUA 3IL2A 4RAYA 2HQRA 3WGIA 5LRRA 4AVPA 2DFIA 1TW2A 3E6DA 5E18F 3K1NA 1W7PD 3TO7A 1R00A 1JE8A 3ABTA 4G6DA 3DPTA 3GLXA 4A5NA 4MHGA 3HSFA 1G4DA 4WXCA 1JHFA 1YYVA 1E17A 4IHTA 3P9CA 1ODDA 3LFKA 1QZZA 2CG4A 3F3XA 1SAXA 1J75A 1LDKB 5FLXK 3RKWA 3JTHA 1IZ1A 1P92A 3E3VA 1JHHA 2FF4A 2YU3A 2FBHA 1SD5A 3HHHA 2UWMA 3IKTA 5D8KB 3CUOA 3KP6A 1UHWA 4KFCA 2W57A 5FFXA 4BXUA 3NRVA 4HF2A 2CGPA 1GVJA 4QWQA 4HF1A 2M1BA 3LAJA 4JQFA 1OKRA 4K2EA 1L3LA 4HBLA 2NS0A 2Z99A 3DF8A 2XRNA 4NB5A 5D4RA 2RGVA 4PZJA 1G3WA 1EH8A 1Z6RA 1LVAA 3LA3A 1RUOA 2HZTA 4ZZDA 2H6CA 4GGGA 4O6JA 4YG2F 1B1BA 4ASNA 2P5LC 2XAGA 1DUXC 4G7ZF 4HZFA 4ESFA 3T1BA 4F7ZA 5E20A 3F72A 1MD0A 3EUHA 1KQ0A 1QQIA 3Q9VA 1FBSA 3I4PA 3LA2A 4LB6B 3HIFA 3GXOA 2ZO4A 1LQ1A 3ECHA 1IN7A 2FA5A 4L18B 1U8RA 2XAFA 3ULQB 5FLXZ 1WKMA 3VODA 3GFMA 1MZBA 2MD5A 2FQ3A 1RZ4A 5DCMA 1LDJA 3M8EA 1OMIA 1R5GA 2PMHA 2BGCA 1EH6A 4R79A 2Z33A 4IF4A 2DLLA 1ZH5A 3HYIA 3QU3A 3RYPA 3CTAA 1G3YA 3FMSA 2RC4A 1R1TA 3KLOA 3C1DA 3WTWC 2VE8A 4DNCA 5LRSA 3GZ5A 3N4MA 4HX8A 4ENKA 3M9AA 2XAQA 3DFGA 3JSPA 3R61A 1G3SA 2ADUA 3ZMZA 5D5WB 5BMZA 2ISZA 4EGYA 2EWNA 2P7CB 2J5OA 4BAYA 2IA1A 1S3JA 4YIFA 1TLHB 4HW0A 1KYWA 1KQ8A 3JTGA 2DK8A 1O7FA 1F9NA 1YQAA 4JBAA 2MH2A 3BJOA 2GZWA 2R7DA 1USTA 4O5VA 2W85A 2KIUA 2EJRA 2ZNYA 2TDXA 2HTSA 2QLZA 1O3RA 1WI9A 2M45A 2L3DA 4ETSA 3ZP5A 3I71A 2IJLA 2EFNA 1HXDA 1VTNC 3SQNA 4I2OA 1IRFA 5K5QA 3I54A 1HW1A 4OMYA 3QU6A 3KZYA 4DQ2A 1I6XA 5K5OA 1TTYA 4UHTA 2HS5A 4YFXF 3IWFA 1FX7A 2VT3A 4M6XA 1S8NA 1XB4A 2DPUA 3QP6A 1FT9A 4YFNF 3ZN1A 2GXBA 1MDMA 2BBYA 3U2RA 4I0AA 1GXQA 2PEXA 5DUKA 5FFZA 1FOKA 1AOYA 2PQ8A 1G3TA 3HHGA 2JZYA 4AIKA 3J81Z 5ICGA 3I53A 5KK1A 1O3SA 3HOSA 1FYLA 4ZYHA 5BPDA 3RKYA 4RGSA 1UCRA 5LLQA 2VE9A 4BH9A 1OYYA 4O3MA 5E1ZB 1W7PA 1Z1DA 2IA0A 3ZMTA 2QVOA 1R22A 4WXDA 1P2FA 2WC2A 2VODA 2XROA 4ZYEA 2D1HA 3F23A 1BBYA 2WTEA 3BDDA 4UVCA 2JTVA 3F8CA 4PCQA 2GXGA 5FO5A 4L9VA 3WE3A 3GZ6A 2O03A 1D8KA 1O57A 4KA4A 3ZMSA 3ZPLA 5DD8A 3I5UA 1BM9A 3BP8A 4EJWA 2P5KA 3KFWX 2IP2A 3GVAA 5DUIA 3F8FA 3LQRA 3PQJA 1ZN2A 4WWCA 2VXZA 5DV5A 3Q5FA 4KT5C 1AWCA 3EDPA 3E6MA 4Z2YA 1STZA 4U88A 2STTA 2G7HA 3DPLC 4RB1A 4RB2C 4XRFA 1JXSA 1Z7UA 5H6RA 4CDGA 1RI7A 3FM5A 5A2QK 3WG9A 4Q47A 1XGNA 3DV8A 3RKXA 1T98A 2OQGA 1ZGAA 2LNBA 4XBFA 3CO6C 3IKVA 3H3ZA 1DPUA 3ECOA 3L00A 4ESBA 2JSCA 2FNPA 1S7AA 3T8TA 2JRTA 4G94A 5E8GA 3DP7A 3M1EA 1W7PB 5CVUA 2MLGA 3CJNA 3KETA 4U0WA 1FSEA 2CQKA 1BI2A 5ILVA 2VC0A 3COAC 1TNTA 5HVQC 3D0SA 3I0TA 4MTDA 4ZYDA 1W5SA 1PP8F 3I59A 1IXRC 1Q1HA 4EM1A 4ZH4F 4ENMA 4KNYA 1XMKA 4B8XA 4HQMA 2DQRA 1XGMA 3WTUC 1O7LA 5HOOA 4KDPA 4PGGA 1ZLJA 1P4WA 3LWFA 3REOA 1G6NA 4IHSA 4OIPF 5HS7A 3HSEA 4WX9A 1U2WA 3K1MA 3GW2A 2HGCA 3CO7C 3MZHA 2FBIA 1Z91A 2FE3A 3KP7A 1TQIA 3DEUA 1FYKA 6PAXA 1V3FA 5CYVA 2QENA 5D6FA 4P9UA 1ZRCA 3GFIA 1LEAA 3IHUA 3F8MA 2COMA 1MJAA 1ULYA 3SZPA 4LLLA 4IRHA 3T8RA 3FX3A 3FM3A 1R1VA 4P5OA 4GO1A 1YW7A 4P96A 5D5XB 5L3FA 4KUMA 4ZYGA 4RGRA 3HRMA 2A07F 4N9IA 4RB0A 3OOPA 3NQOA 4RAZA 2MH9A 4YIIA 4KICA 4YFKF 4A0YA 1BC8C 4UNOA 3R0AA 4OIOF 2RDPA 2M5WA 5TRDA 1HKSA 1XN7A 1U78A 3IWZA 2O8XA 1QZYA 2FRHA 3ZMVA 1XCVA 4AWXB 2H94A 2EFOA 2HKOA 4UV9A 2IA2A 3J80Z 3I59B 2JPCA 1KU2A 3JAMZ 3W6JB 3V7CA 1ZRFA 1HQCA 1R58A 1PDNC 4U0VA 5HLIA 3KEQA 1P4AA 1XSXA 3V8KA 4G9YA 1IN4A 5CVVA 2CWEA 2QM3A 3FMQA 5L3CA 3WU1B 2P7VB 5J8FA 4GYGA 5TJJA 2XGXA 2FMLA 4L9NA 2UXNA 1XCBA 2ZMEB 1R5HA 5ERIA 4NHJA 3GFLA 4G6QA 3B73A 4M72A 1FP2A 2ETHA 1EH7A 5K5RA 1FC3A 1QO0D 1IXSB 4XSXF 2BE5F 2YSRA 2ELHA 3BJ6A 4KN4X 1H9GA 2E7XA 1F1ZA 4IXAA 3AAFA 1ZG3A 1ZAOA 4Q4ZF 2VOPA 5JR3A 3GYHX 1LNWA 3V8JA 3DQVC 1UB9A 2XV4S 2RN7A 3HOTA 5ICFA 3BOQA 1ZHFA 4MTEA 5HLGA 3E5XA 1UHMA 1SMTA 3I58A 4IPAA 1BN5A 3T5XA 2Y48A 2ZBKA 3FXUA 2OBPA 1FWZA 4U7DA 3V8LA 1XSDA 4FHTA 3PQKA 4A6EA 1BJAA 3O6BB 2P8TA 5DEQA 3HSRA 1T39A 2DU9A 2D2WA 2K27A 4Y15A 5E17F 3J81K 2RNJA 3ZN0A 2LKPA 5F6FA 3KP2A 2QZ8A 2GA2A 1FLIA 3U1DA 2E7WA 3BPVA 2DK5A 2V79A 1T0FA 5FD6A 3HUGA 1K79A 1R36A 3I64A 3HRUA 2KRFA 2DO7A 3WTXC 4LG0B 1ZLKA 1ZREA 4RGXA 4LLGF 2ESNA 4IVNA 1KU3A 2AS5F 4BQAA 5AIQA 3R4KA 4EGZA 2H09A 1QPMA 3BWGA 4Q48A 3ROUA 2XIGA 3TDZC 2MBFA 1TNSA 3E97A 3WTTC 3IRQA 4A5MA 3K69A 2OZUA 2HQNA 3FMRA 2YX4A 2XASA 3R60A 3KP4A 1ZGJA 3HRTA 2V6CA 4OIQF 1MGTA 1XDUA 2NNNA 1DP7P 3IC7A 4QLCU 2H6BA 2M87A 1XD7A 1FP1D 3QRFF 4CGZA 3BZ6A 3GF2A 3M7GA 1USSA 1WRJA 4XSZF 1O3QA 1QGPA 2K4BA 3QPHA 2VBZA 1QBJA 1WSUA 5DCFA 5L3DA 5HDNA 4I98B 5DD4A 1F5TA 4LK1F 1X3UA 1XGOA 4CZZA 4EJVA 2BEOA 4LLNA 4RS8A 2DI3A 2L4AA 2F5EA 1C0WA 3KZZA 5HS9A 2RV8A 2PJPA 2JT1A 2B0LA 1KU9A 5L3EA 5LHIA 2K02A 5K1YA 1U3EM 3RYRA 1LB2A 1ONVA 3VEPA 2DQLA 1B9MA 3ELKA 3CUQB 4GCVA 5ICCA 1HW2A 3G3ZA 3HRSA 4H0EA 1DDNA 1TW3A 3CUQC 4OIRF 4JK1X 2DBBA 1FYMA 3L09A 4EJOA 3P9KA 3G73A 4M74A 3IRRA 2O61A 2HYGD 1FNNA 1ZG5A 2X0LA 2P4WA 3FWEA 3GFJA 1BIAA 3L2CA 1XMAA 1KQ9A 4WXHA 5J6XA 1SFEA 1CF7A 2RVCA 3LSTA 4FX4A 1K6OA 2VBWA 3LQQA 3C7JA 2NYXA 4Q5SF 4M71A 1W4MA 3F6OA 2FEZA 2PG4A 4KIFA 2LSOA 1YS6A 2DPDA 1R23A 1WWXA 4WK8F 5HS8A 4KN7X 4ON0A 4ENJA 2GIVA 2M8EA 2ZKZA 3FHZA 3P9IA 5CVRA 2V1UA 5IT9Z 2YPRA 2VBYA 5AONA 5HLHA 1TBXA 4CYDA 4LD5A 2GA1A 2ACJA 3BROA 1Z9CA 4OINF 2KKOA 3HTUA 4IRGA 1K78B 2IW5A 2QYOA 3Q9SA 4M9ZA 1FPQA 1PUEE 5FD5A 5LEJA 1B4AA 1U5TC 2FOKA 2ZXJA 4BHPA 4LGWA 4HV5A 3F8NA 1IN5A 2XAHA 4MEXF 1LJ9A 4RB3C 1OR7A 3MCZA 4LMYA 2HTJA 2W84A 2F5FA 2OU2A 2A68F 1FY7A 4MQVA 4N0BA 1KGSA 1E2XA 5E8IA 2J5PA 2F2EA 2YX7A 3TO9A 3SZTA 2KIMA 3R0JA 3TQNA 1SFXA 4EV0A 2VBXA 5D5UB 3CDHA 3WTZA 3J80K 3SHFA 3VOEA 3L9FA 2UZKA 3ZQ7A 1SD4A 3H92A 4LJZF 3DXJF 1D5VA 5JVTA 3JAMK 4IJAA 2V9VA 5LGNA 1ON2A 2VONA 4I09A 3TO6A 2DW4A 2KJBA 5E1XA 4UVAA 2W25A 4HLXA 1PP7U 4EM2A 1CF7B 1D8JA 5IT3A 2ZNZA 5LBQA 2ZMEA 4KIGA 2F5DA 2GWRA 3OV8A 5E1WA 4A6DA 4I0BA 3EQLF 1T2KA 1Z05A 2XHKA 4OOIA 1HKQA 4HX7A 2FMYA 2Q2EA 3QP5A 3M8FA 3KEOA 2QQAA 2ZJ2A 1GXPA 4EQQA 2FBKA 2PLYA 3VFZA 2CFXA 2LF7A 2EV0A 4KYWA 4XLNF 3GUDA 3KE2A 4AIJA 5D8LB 2QUFA 3F6VA 3N97A 5HDKA 2PMUA 4IRIA 2NNYA 1YG2A 1NHAA 2K4JA 4MEYF 1BC7C 5CVJA 3O3KA 3KP3A 5L3GA 3ML6A 4M6YA 1IW7F 3V7RA 5BPIA 3KLNA 3D5LA 2ZCWA 4L0ZB 2BV6A 5LHHA 5D4SA 2XVCA 4R1HA 4MNUA 4U0YA 3ERED 1HSJA 2FSWA 1LEBA 2QQ9A 5F1RA 2QBYB 3RTRA 2E1NA 4CHUA 5ED4A 2MC3A 2VC1A 5FGMA 1MKMA 5J8CA 3TKYA 4LFUA 3ZMUA 3R6SA 3FF5A 3RDIA 1L0OC 3WTVC 2Z3YA 4PGHA 4HA8A 1JGSA 3B02A 3QOPA 2EA4A 2ISYA 2M30A 4U7BA 3E5UA 1Y0UA 3WU0A 1ZYRF 4P55A 1REPC 2FXAA 3LAPA 2VOOA 3WODF 1UFMA 4I7HA 4GXOA 4LG0A 3O2PE 2NRAC 4KIBA 1OYWA 1R7JA 1FBQA 1IRGA 3RPQA 4G7HF 2RQPA 4FX0A 2W24A 4KMUX 2VT2A 2HFHA 1BIBA 5HDGA 5JFRA 5F64A 4EJTA 1F4KA 1Z6TA 3F8BA 2HR3A 3HTSB 1T6SA 2HKXA 4AIHA 1FBUA 2DT5A 2HYFA 1W5TA 1YIOA 3K2ZA 1B6AA 2R7FA 4TV7A 4UV8A 3JW4A 1J59A 5CLSA 2A69F 2Z5UA 3C3WA 2EB7A 4HDUA 2D1VA 5BS6A 2HEOA 4R8HA 2F5CA 1BI1A 3MZYA 4M9SA 1B59A 4CICA 1T38A 1K7AA 2CW0F 2JPBA 4G7OF 5BOXA 2UXXA 2OA4A 3GWZA 4HQEA 2EFPA 2K86A 1BOAA 2L54A 4ENNA 3H3UA 2MA3A 3RJPA 4UVBA 3U9GA 3RI4A 2XKOA 1YO5C 1RNLA 1B9NA 3MAJA 1XDSA 4HDVA 5CVIA 2FNAA 3E6CC 2V1DA 3E5QA 4GYIA 4M9XA 2L01A 3V7SA 2G7UA 3CUQA 1R1UA 2HDCA 4KMFA 2Z9OA 2K7LA 2OZ6A 1KA8A 4P9FA 3NEUA 3J7AO 2ZFWA 3FZVA 2EV6A 4HX4A 3SFZA 2KIFA 4M73A 2R3SA 3JSOA 2PBIA 3WGHA 1J2XA 3VB2A 4XLPF 3WE2A 3W6KB 2PN6A 5ILUA 2O0YA 4BHCA 4HF0A 5D6EA 5LEKA 3C18A 4EMSA 1BI3A 2C6YA 3L7WA 2QWWA 2BYVE 2OD5A 2L02A 1P6RA 2WV0A 2YR2A 3WTSC 3MQ0A 3DKWA 3F21A 5LHGA 3TGNA 2Y0MA 3FXRA 3WTYC 3LA7A 1H9TA 1IN6A 4N9HA 1U5TA 1I1SA 4S04A 5ICEA 2CSOA 1HKTA 4AD9A 1K78A 2ESHA 4G8XA 4A0XA 5IT9K 1HW5A 3EYYA 2DTRA 2G9WA 1DPRA 5DCMB 1RIOH 1LDDA 2X4HA 1IXCA 4A12A 2HWVA 1KYZA 2P6TA 4Y17A 5LGUA 2LF8A 2A3SA 5CJ9A 5H6QA 4WF2A 1MJBA 1XSVA 1J7KA 1SMYF 4D0PA 2STWA 5LGTA 5BQTA 5JI6A 3EETA 4OMZA 2IT0A 1TQPA 2DAOA 3S2WA 3E6BA 1TQMA 2VN2A 4L9TA 1SD7A 1I5ZA 1YFHA 4HLYA 2Y75A 2IVMA 4EVIA 2CYYA 1ZG1A 4CO8A 4L5IA 3TOBA 1IAWA 4MQ9F 3PFIA 4NQWA 2XUBA 2EFWA 1ZRDA 5L3BA 5KVRA 1SFUA 3TOAA 3MFKA 4BYYA 4MGRA 2IPQX 2L4MA 1ZARA 1YW9A 3V4GA 2GQQA 3RPUA 2EK5A 1O3TA 3F22A 2PI0A 2EV5A 3GX4X 5FB2A 1YW8A 3P7NA 1IN8A 1J0RA
chains in the Genus database with same CATH superfamily
3FXQA 4HAMA 1CGPA 1ON1A 2EFQA 4UXNA 5B1BH 5IYCJ 1XGSA 2EA2A 3I4MJ 3ABUA 3QYEA 1QNTA 4BDZA 1HBXG 4CXFA 2RKHA 2CW7A 5JHFA 1IUYA 2LC2A 1FOWA 1V4RA 2A6EF 2HOEA 4IL6C 4L0YB 3PJRA 2V1XA 4L5JA 4BKXA 4DYQA 1GHCA 1BI0A 4UUSA 1SD6A 1U5TB 5EEGA 3RIRA 3K9TA 3MWMA 2NVUB 2XAJA 5FRMA 2Q8KA 2E1CA 2X51A 1S6LA 4J19A 4I02A 4V2FA 1IF1A 4EJUA 1WPKA 2L9VA 4EM0B 3CLOA 3BQYA 3EYIA 1P9QC 4RGUA 3RQ4A 2KT0A 2VB6A 3P5JA 4A3GJ 2P0WA 3MEXA 2BY3A 4I01A 5CPRB 1MDMB 3H9GA 3PIOF 2A6HF 4L9JA 3GEZA 4UUVA 3S3NA 1S5LC 4WCGA 3H5RA 1MMGA 3TDUC 3JREA 3K1PA 2KHMA 3GO5A 2IBDA 3QPTA 2EZHA 3BTLA 3J7AY 2R7ZJ 3BY6A 1VF9A 4HYEA 4S05A 2OAZA 2R5ZA 5D5VB 3AL0B 4PJNA 3WG7H 4CYCA 2QBYA 1Z21A 4QTRA 2GAUA 1I27A 1HSTA 4LK0F 3BPXA 3MKZA 3L2WA 3Q0UA 2DMPA 3OYIA 3V42A 3H36A 3AL0C 2OJED 3K0LA 3IUOA 2KLOA 2LREA 4B09A 1FSHA 4DZJA 2FU4A 4OU0A 1GV5A 4BNCA 3L2UA 3BJAA 3IV5A 4LITA 5E3NA 4A0ZA 2P6SA 2O3FA 3SXYA 2E34A 1S29A 1MJ9A 1I1GA 1U6GA 1N75A 4ZJZA 2DOAA 2QQBA 3K70C 2ID3A 1RR7A 4XKBA 2AXLA 1PVEA 1HA8A 4A2UA 2RAEA 5C4XJ 2H27A 5H20A 1VQLI 1H0MA 1XX5A 2XPWA 2X1CA 5DYMA 4HOBA 3ZMDA 4BJ5C 2KJCA 2A61A 1U9NA 4E70A 3KP5A 3ISPA 5F04A 1TT0A 2NAZA 5ILSA 4A3BJ 2MLKA 5H2FC 2CO5A 2OTJI 3WGGA 5EZGA 2O6GE 1WQ2A 1UG2A 3L2QA 1S7OA 1UZCA 4PK4A 1RUNA 4A3FJ 1OPCA 3FIWA 2F4MB 3KCCA 4M3FA 5DTDA 4E4HA 3DWLE 3QAHA 5DDGA 2LDUA 2IRFG 1R6RA 4ZZLA 4LB5A 1I6HJ 1AA7A 3HBLA 3BZKA 2Q0OA 2WWYA 2ELJA 2P5VA 1YLFA 2PFBA 2K9NA 2M8GX 2B7EA 3CMYA 2V9PA 1T08B 3A0BC 2OQRA 1A04A 2JUGA 2XKPA 4PJJA 4FT8A 3NAUA 3A0HC 4ESJA 1KU7A 3GTJJ 4E7LA 1X58A 4HV6A 4A3LJ 2A5WA 5EEHA 3T0YA 2D45A 1EV7A 1FZPB 1J5YA 2A5YB 3PO3J 2R7XA 1D3YA 3S8PA 4ZTJA 4BHBA 3OYBA 1J9IA 4HNTA 1YS7A 1NK2P 4PDKA 1YTYA 2E1MB 4LIUA 1JKQC 2CFOA 4IZZA 2ECBA 4UUSB 5A2QZ 5AIPA 1OYIA 1P4XA 1FJLA 4Y13A 5JHUA 3IL2A 4RAYA 4II2A 2HQRA 3U21A 2E1MC 3WGIA 5LRRA 4AVPA 5F27A 2DFIA 2K40A 1TW2A 3OR1C 3E6DA 1DGRM 1ETQA 4XL9A 5E18F 2F4IA 3K1NA 2LMDA 2L7ZA 1W7PD 1X1AA 3TO7A 1R00A 3K70D 1JE8A 3ABTA 1VQ4I 4XORA 4G6DA 3DPTA 3GLXA 4A5NA 1NTCA 5HLTA 4MHGA 3HSFA 4B47A 1SVMA 2HDWA 1OCZH 2AO9A 1G4DA 4WXCA 1JHFA 2LKSA 4EATA 1YYVA 1E17A 1QVTA 2ICWG 1SVLA 4IHTA 3HKZA 3P9CA 1ODDA 1TP4A 3LFKA 1QZZA 3K7AJ 5KAIC 2CG4A 2NOGA 2GOXB 3F3XA 1SAXA 2DDAA 4F52A 1FIPA 1J75A 1LDKB 2K5CA 2KPMA 5FLXK 3RKWA 3JTHA 1IZ1A 3AKZA 1P92A 3CP2A 1ETXA 3E3VA 4PJLA 1Y8RB 1JHHA 2FF4A 2YU3A 3BZCA 4DZPA 4MO7A 1T95A 1SD5A 2FBHA 4D1QA 3HHHA 3MN2A 2R4GA 4IHYA 4CCLA 2IS4A 1GVDA 2PX9A 2BHYA 4BBSJ 3IKTA 2UWMA 5D8KB 3CUOA 3CCQI 3KP6A 5B5EC 1UHWA 4KFCA 2W57A 2GOMA 1U8BA 5FFXA 1ETOA 4BXUA 5GAHJ 1MH4A 1TWFJ 2ZC2A 3FXLA 2CQQA 3NRVA 3CJTB 1Z0XA 4D9JA 2HOTA 5B1AH 4HF2A 2IEKA 2CGPA 3BC8A 1GVJA 4QWQA 4HF1A 2M1BA 3LAJA 4JQFA 2VQGA 1OKRA 4K2EA 1L3LA 2JUCA 4HBLA 3PSIA 2NS0A 3TP0A 2Z99A 3BG9A 3DF8A 2XRNA 4NB5A 2QA4I 5D4RA 4ZDLA 3L2VA 2HDDA 2LY2A 2RGVA 4GDFA 4PZJA 1G3WA 1EH8A 1VQMI 1Z6RA 1LVAA 3LA3A 5HNFA 4KJZA 2V7FA 1RUOA 4RAGA 2HZTA 4ZZDA 1WJCA 3LNQA 3D5RC 2H6CA 1LFBA 2EH3A 4GGGA 4O6JA 4YG2F 4CCKA 1B1BA 4ASNA 1WGXA 5KHDA 2QSFX 3IH4A 4D7NA 2VQLA 4QSHA 2P5LC 1APLC 2XAGA 1DUXC 4G7ZF 4HZFA 4ESFA 4J01A 3T1BA 4XN0A 5FLVA 1VQOI 2O5RA 2ZJQF 3TL4X 4JYKA 4F7ZA 3PO2J 1MMDA 2Z2SB 5E20A 4XICA 3F72A 2BY2A 2EZKA 1MD0A 3EUHA 4E7JA 1KQ0A 1QQIA 3Q9VA 1FBSA 1ZTRA 5EJCA 3I4PA 3BTJA 3JR9A 3LA2A 4LB6B 3ZQQA 4ZDOA 1JKRC 3HIFA 3DKYA 4X1EA 3NARA 2FD5A 3CC7I 5FLMJ 1OLTA 4C2TA 3GXOA 2ZO4A 4B48A 3GTOJ 2ID6A 4D7MA 3RQIA 1LQ1A 1MNMC 3ECHA 1IN7A 2FA5A 3QOEA 4L18B 1U8RA 2XAFA 3KZIC 1EKEA 5EYRA 3N05A 4PJ0C 3ULQB 4U87A 5FLXZ 4FE4A 1WKMA 4YELA 3VODA 3S14J 4QPQA 2LY1A 3GFMA 4KT6A 2WB1A 1MZBA 2X6YA 2MD5A 1UJ8A 2FQ3A 1RZ4A 5DCMA 1XG1A 5IYDJ 3J7YJ 1LDJA 3M8EA 3EUKL 3LSJA 1JJ8C 3IAM2 2WBMA 3HGYA 1OMIA 1R5GA 1UELB 1UHSA 1W1WE 2BXYA 4UB6C 5GTHC 5DM7F 1U9OA 2EPFA 2PMHA 2BGCA 1EH6A 4R79A 2Z33A 4IF4A 2DLLA 1ZH5A 2QKLB 3HYIA 3QU3A 4UB8C 3OIOA 2QGUA 2A05A 1R4NB 3BR5A 3RYPA 2Z1DA 3CTAA 4MFEA 4JP0A 2WB1N 1G3YA 4N4NB 1HDDC 3FMSA 4IO9F 2RC4A 5FJ8J 1R1TA 4FCYA 3KLOA 2CQNA 5EF6A 3C1DA 3WTWC 3BLYA 2VE8A 4DNCA 5LRSA 4F92B 3GZ5A 3N4MA 1TWCJ 4HX8A 4ENKA 2HQ5A 3M9AA 2XAQA 3DFGA 3QYFA 3JSPA 3R61A 1G3SA 4BJ6C 1EF4A 5EGOA 4BQNA 3LSPA 3HOZJ 2ADUA 3ZMZA 5D5WB 5BMZA 2ISZA 2EWNA 4EGYA 3CDLA 2P7CB 2J5OA 4OAYA 2IA1A 4BAYA 1S3JA 2L9NA 2ZFUA 3IP4B 5J40A 3SDGA 5E3OA 2TCTA 4YIFA 1TLHB 2ZSHB 4HW0A 1KYWA 3QYBA 4E7ZA 2GXAA 5J1RA 2CV0A 1KQ8A 3JTGA 2DK8A 1O7FA 1F9NA 3CMAI 1YQAA 2HPIA 2R7QA 1YIJI 5GTIC 4JBAA 2MH2A 3BJOA 4H4KC 2GZWA 3DCFA 2XSDC 2DDBA 3BG7A 3CCVI 2E5NA 2R7DA 1USTA 2BW3B 4O5VA 4DBQA 2W85A 2CW8A 2KIUA 2EJRA 2ZNYA 1WHUA 3IH3A 2TDXA 2HTSA 2QLZA 1O3RA 3O8GA 1WI9A 2M45A 2QEXI 2L3DA 4ETSA 3ZP5A 3MD2A 3LOCA 3I71A 2VKVA 1E3PA 1E3HA 2IJLA 2EFNA 1HXDA 3L2RA 1VTNC 3SQNA 1X3ZB 3ABMH 2LVSA 3TW6A 3OYHA 2DT7B 3GMEA 4I2OA 1IRFA 4I6ZA 5K5QA 2MD0A 3I54A 1GUUA 3GBGA 1F36A 1HW1A 4PFPA 4E7IA 4BQQA 1IO2A 2HYJA 4OMYA 3QU6A 2CH0A 3KZYA 3G6EI 4DQ2A 2E1OA 1I6XA 2L7MP 5K5OA 1TTYA 4UHTA 2HS5A 4YFXF 5JLXA 3CF2A 2OCCH 3ZXSA 2LP0A 1BW5A 3TW7A 3IWFA 2V26A 2F6CA 1FX7A 3OYCA 3CC2I 2VT3A 2G0EA 4M6XA 1S8NA 1XB4A 2K3PA 3QP6A 5KAFC 3CJRB 2DPUA 4D5CA 1FT9A 3OIPA 5E79C 2BY0A 4YFNF 2BVMA 3ZN1A 2GXBA 1EA3A 1MDMA 4BQOA 1RPWA 2P81A 3DTKA 3ESWB 2BBYA 3U2RA 1H8AC 1X19A 1QA6A 4I0AA 3K6GA 1GXQA 2W00A 1QHGA 3GTKJ 2PEXA 5DUKA 2DFFA 5FFZA 1FOKA 2EBIA 1AOYA 3MKWB 2PQ8A 1G3TA 3CCUI 1R49A 3HHGA 2JZYA 3DLAA 4AIKA 2DA6A 3J81Z 3QWLA 5ICGA 3I53A 5KK1A 1O3SA 4XLEA 3HOSA 1HDPA 1IV6A 1FYLA 1QU3A 3BR6A 5EDNA 4F93B 2H8WA 4ZYHA 5BPDA 1LVKA 3RKYA 1PYVA 4RGSA 1UCRA 2HNHA 5LLQA 2VE9A 3MVPA 3SDBA 2OTLI 2QSHX 3X2QH 1SFKA 1BR2A 4BH9A 1OYYA 4O3MA 5E1ZB 1W7PA 1Z1DA 4BL0B 2IA0A 3ZMTA 2QVOA 1H89C 1E0EA 3LSHA 3MZ8A 3J7ZI 1IDYA 3RZDJ 3KYDB 1R22A 4WXDA 3G2BA 3JRCA 4E7SA 1P2FA 3DEWA 2WC2A 3G1LA 2VODA 3RSNA 4GFBA 2HPMA 3QPLA 1FMVA 2R93J 3F9KA 2XROA 3HL2A 4ZYEA 2D1HA 4IQ4A 3F23A 1BBYA 5K7HA 3I55I 1HOMA 2WY8Q 2VI6A 2WTEA 2VXDA 2W82A 3B6CA 2DMQA 3BDDA 4ABZA 4CSWA 4UVCA 2W48A 4BBRJ 2JTVA 3M8JA 3F8CA 1XS9A 4PCQA 4B43A 1I39A 2GXGA 5FO5A 1Y6IA 4L9VA 3WE3A 3GZ6A 5FKNA 3KEYA 2O03A 1TWGJ 4HSRA 1D8KA 1O57A 3PUBA 4KA4A 1JUSA 3DBHB 3DBLB 2ZJRF 3ZMSA 3ZPLA 3JRDA 2JA8J 1SEUA 2WAQA 5DD8A 4LG3A 3I5UA 3FXJA 1BM9A 3OWTA 3BP8A 1FTTA 3AG3H 4EJWA 2P5KA 3KFWX 1ZELA 2IP2A 3GVAA 4ZYAA 3H1CA 2H8RA 5DUIA 3F8FA 3LQRA 3PQJA 1ZN2A 2COBA 4WWCA 5IP7J 3ABKH 2VXZA 4BUPA 4MFDA 3S16J 5DV5A 3Q5FA 4KT5C 3OMYA 4XKVA 1AWCA 3EDPA 2XGEA 3E6MA 4Z2YA 1STZA 4U88A 2STTA 2G7HA 2BY1A 3DPLC 3LMMA 4RB1A 1JT0A 1RRJA 4RB2C 4XRFA 2UV1A 2H1KA 4GRIA 4IEJA 4BGDA 1IRZA 3MKYB 3D1NI 4XLHA 2XF6A 1JXSA 1Z7UA 5H6RA 4ZTFA 1XPXA 4CDGA 2XB0X 1RI7A 3FM5A 1Y0NA 5A2QK 2NVXJ 1B8IA 1T56A 4XLAA 2VJ4A 3WG9A 4Q47A 1XGNA 4B1RA 5BNGA 1OJLA 1Z67A 3DV8A 2MFZA 1T98A 3RKXA 2DA1A 2OQGA 1ZGAA 1K4TA 2HZDA 4CA0A 2LNBA 4XBFA 3CO6C 3IKVA 3H3ZA 1DPUA 3ECOA 1PUFB 3VDXA 3OYLA 3L00A 2DFHA 4ESBA 2JSPA 2JSCA 2FNPA 2HOAA 1S7AA 3T8TA 5GADJ 5FKMA 3LSMA 3NWTA 2W7NA 2JRTA 4G94A 3SFIA 2XGDA 4XRSA 1V5GA 5E8GA 3DP7A 1JGGA 1VNDA 2HQAA 4XIDA 3ZQIA 2KRHA 4FQGA 3M1EA 1W7PB 3OYAA 4ZC3A 2FQ4A 4RMNA 1YOVB 5CVUA 1R9TJ 2FX0A 4P1WA 2MLGA 3CJNA 3HM5A 3KETA 4U0WA 4D5FA 1Y1WJ 5GAGJ 4YEJA 2LRDA 2DYSH 1ITYA 2GLOA 2V6EA 1FSEA 2CQKA 1BI2A 5ILVA 4OWRB 2VC0A 3OYDA 3COAC 4A3MJ 1TNTA 5HVQC 3D0SA 3I0TA 2IXSA 4ZYDA 4MTDA 1W5SA 1AKHB 1MNDA 2DOEA 1PP8F 3I59A 1IXRC 2AHQA 1Q1HA 2CMPA 2VASA 4W1UA 4EM1A 5EZHA 4ZH4F 4ENMA 1R4MB 4KNYA 1XMKA 4B8XA 1Z3YA 2NS7A 4PSXA 4HQMA 3I9V2 2IAIA 1WI3A 2LYCA 2DQRA 1XGMA 3WTUC 1O7LA 5HOOA 4DYCA 4PGGA 4KDPA 1ZLJA 1P4WA 3LWFA 3REOA 1G6NA 4IHSA 3TMOA 2L9SA 4OIPF 5HS7A 1IUFA 3MMYB 2ME0A 3HSEA 2DMTA 1Y8QB 2R7TA 4WX9A 1U2WA 3K1MA 3BT9A 3GW2A 2Y9YA 1BJZA 2HGCA 3CO7C 3MZHA 3ZOBA 2DMNA 1DQUA 3A4CA 2FBIA 3DU5A 1Z91A 2FE3A 3KP7A 1HLVA 2X1DA 1TQIA 2IGMA 3CDIA 3DEUA 1A36A 2MGQA 1FYKA 2M4GA 2X85A 6PAXA 1V3FA 4CUGA 5CYVA 2M0CA 2QENA 3EPZA 1I3QJ 5D6FA 3ZRGA 2H1LA 2PMZA 4P9UA 1ZRCA 3GFIA 1V5FA 2DA3A 1LEAA 3PSFA 3IHUA 3F8MA 2COMA 3JRFA 3CCSI 1MJAA 2MG4A 1YE9A 2K9SA 1VZ0A 1ULYA 3SZPA 1ENHA 4LLLA 4IRHA 3T8RA 4DYRA 2VUMJ 3FX3A 1B8IB 3FM3A 3H9QA 1R1VA 2DFEA 1IDZA 1YRNB 2LTPA 1MMAA 1OCOH 4P5OA 3M1CA 4S0HB 4GO1A 5CKTA 1YW7A 3SYTA 4P96A 5D5XB 1IG7A 4PJMA 5L3FA 2R5YA 3G1MA 1QZEA 2BHZA 2LFBA 2XF5A 4KUMA 4ZYGA 3S2DJ 4RGRA 3HRMA 2A07F 4N9IA 1RC9A 4RB0A 3OOPA 4XONA 4I99C 3RKQA 3CP8A 3NQOA 4RAZA 1YJWI 2LR8A 2MH9A 3H5AA 2KIQA 4YIIA 4KICA 4YFKF 3K4MA 1S72I 4A0YA 4XKWA 1Z3XA 4HNUA 1BC8C 4UNOA 3R0AA 4DBRA 1ETWA 2VJJA 3CJQB 4OIOF 2RDPA 5HNHA 4CCJA 3O8HA 3VSLA 2M5WA 2HI3A 2VJ5A 5TRDA 3HKZN 2IS2A 4XRSG 1HKSA 1XN7A 3K4JA 1U78A 4CCMA 3IWZA 2O8XA 1QZYA 2FRHA 3ZMVA 1XCVA 4AWXB 1OR7C 2H94A 4I76A 4A3CJ 1MH3A 2EFOA 2HKOA 1Y39A 4UV9A 2IA2A 4PUSA 4BE0A 3J80Z 3OYMA 4M3EA 2WAEA 3I59B 2JPCA 1KU2A 1WCMJ 3JAMZ 3CZ6A 3W6JB 1GLNA 1JI8A 3V7CA 2X9DA 1ZRFA 1HQCA 2RQQA 1R58A 2HVQA 4ITVA 1PDNC 1SAUA 4U0VA 4NUBA 5HLIA 2XPUA 2FJ1A 3KEQA 1MSEC 1P4AA 1XSXA 4HRIA 4FISA 3V8KA 2DA2A 2Q1ZB 4G9YA 1IN4A 5F0FA 5CVVA 2CWEA 4NDLA 1G59A 2QM3A 1RESA 3FMQA 3BG5A 5L3CA 2LKXA 2LK2A 2P7VB 3WU1B 3H35A 5J8FA 1MBKA 3WHBA 2RNGA 3B6AA 3MKLA 2XGXA 3BR0A 4GYGA 5TJJA 2BW3A 2FMLA 1X1PA 4L9NA 2UXNA 2ZMEB 1XCBA 1R5HA 5ERIA 4NHJA 4AVZA 3GFLA 4G6QA 3B73A 3JRBA 4M72A 2HVSA 4A3DJ 2ZJPF 2ZMEC 1FP2A 2ETHA 1EH7A 2KZGA 3S1MJ 5K5RA 4RAFA 1FC3A 5EG0B 3K4KA 1QO0D 5FKLA 1IXSB 1WH5A 1ZR4A 4XSXF 1W0TA 4RM2A 2BE5F 3PUFA 1TWHJ 3DTIA 3TEDA 2TRTA 1FMWA 2YSRA 2ELHA 2K9QA 3FKJA 4OAZA 3JRIA 3BJ6A 4KN4X 1H9GA 3HB9A 2E7XA 5E3LA 1F1ZA 4IXAA 4AM3A 3PL8A 3AAFA 4MLOA 1V5EA 2WV1A 1ZG3A 2E5ZA 3JRGA 4EEFG 1ZAOA 4XN3A 2ME6A 5FROA 2M34A 4AIDA 4Q4ZF 4CCNA 2VOPA 2R5YB 5JR3A 3GYHX 1LNWA 3V8JA 3DQVC 1UB9A 2IGKA 4JX6A 1D1AA 2XV4S 2RN7A 3HOTA 5ICFA 1VFCA 3SEQA 3BOQA 3TP3A 1VQ7I 3HJEA 4DJAA 4IOAF 1ZHFA 4MTEA 5HLGA 3E5XA 2MSYA 4IKFA 1UHMA 1SMTA 3I58A 3DTEA 4IPAA 1BN5A 4JX5A 5F08A 3GLLA 3T5XA 2QSGX 2F4OB 2Y48A 2ZBKA 3FXUA 2OBPA 3E0JB 1FWZA 4U7DA 2V1NA 3V8LA 1XSDA 4FHTA 4HG2A 4XLFA 2K85A 3PQKA 4A6EA 2E71A 1X4OA 3KYLA 3JRHA 1BJAA 4BXXJ 3O6BB 2P8TA 5DEQA 3HSRA 2LG4A 2OCEA 1T39A 4DW6A 3OR2C 2DU9A 3VYTB 4BS9A 2JA6J 2D2WA 2K27A 4Y15A 3A01B 1TC3C 3A2KA 1H88C 3FK7A 5E17F 3J81K 2RNJA 3ZN0A 3FISA 5M3FJ 1DGWY 2JWTA 2LKPA 4UY8I 5F6FA 3KP2A 3GZNB 2QZ8A 2GA2A 2NVYJ 1FLIA 4M3DA 3U1DA 2E2HJ 2E7WA 2JK3A 2KP6A 2VQCA 3BPVA 4XRMA 1FOYA 2DJNA 1MW7A 2DK5A 2V79A 2R7VA 4C3HJ 3BCAA 1T0FA 2EILH 5FD6A 3WHCA 3HUGA 1K79A 3G1OA 1UMQA 1R36A 3I64A 3LSKA 3HRUA 4XM3A 1WH7A 2KRFA 4CH7A 2OUMA 1D5YA 3S3MA 2B63J 2DO7A 1POGA 3WTXC 4LG0B 2EZLA 1VI0A 1ZLKA 1ZREA 4RGXA 2DYRH 4LLGF 3HZJA 2ESNA 2JRMA 4BU2A 4IVNA 4RM3A 2L9RA 2IS6A 1KU3A 3HC7A 2AS5F 4BQAA 4F55A 5AIQA 3R4KA 4EGZA 3FHNA 2H09A 3H3VK 1QPMA 3BWGA 4Q48A 3ROUA 2XIGA 3TDZC 2MBFA 1TNSA 5GPAA 3SZGA 3E97A 1NH3A 4XOPA 3S1RJ 3WTTC 3IRQA 2X6WA 4A93J 4A5MA 3K69A 2OZUA 3ABLH 2ELKA 2HQNA 3FMRA 1ZR2A 2YX4A 2XASA 1MBHA 3R60A 3KIOA 5FRNA 5J1YA 3KP4A 1ZGJA 4AYBA 2AXTC 3HRTA 2NVTJ 2M2EA 2V6CA 4OIQF 1MGTA 1VQNI 3H9JA 1XDUA 3QPSA 2NNNA 1DP7P 3IC7A 4N4OB 4QLCU 3W2WA 2H6BA 5M5WJ 1U0JA 2M87A 5B66C 1XD7A 1FP1D 3QRFF 4CGZA 2E36A 3BZ6A 3GTPJ 2OPTA 3GF2A 3BCBA 3M7GA 1USSA 1WRJA 4XSZF 1O3QA 1QGPA 4Y7NJ 2K4BA 3OYJA 3QPHA 2VBZA 1QBJA 1FTZA 3SEZA 1WSUA 5DCFA 5L3DA 3UNGC 4I98B 5HDNA 4AYBN 5DD4A 4C3JJ 1MMNA 1F5TA 4LK1F 2L5QA 1X3UA 1XGOA 4FTHA 4CZZA 2GIZA 4XR6A 4EJVA 2BEOA 4LLNA 1ERDA 1RKTA 4RS8A 2DI3A 2L4AA 1D0XA 2M0MA 3Q0WA 3RZOJ 2E2JJ 9ANTA 3E7LA 2X48A 5CQEA 1PUFA 3VYUB 3ZQCA 2MYSA 1GT0C 1VQ8I 2F5EA 5IP9J 1YJ9I 1C0WA 3KZZA 5HS9A 1KONA 3A02A 2RV8A 2L0KA 2PJPA 1MNEA 2LH9A 4BY1J 2JT1A 2B0LA 1KU9A 5L3EA 5LHIA 2F5VA 2K02A 4BJTA 5K1YA 1U3EM 5LFAA 4CCOA 1SC7A 4BE1A 3FXKA 2ZXHA 3CD6I 3GCMA 4NC8A 3RYRA 1ACIA 5J4YA 4L5EA 1LB2A 1DU0A 1ONVA 3QQAA 3ZQGA 3VEPA 2E60A 2L7KA 1RR8C 3HGGA 2DQLA 2AQEA 1B9MA 4BEHA 3ELKA 3CUQB 4GCVA 4X6AJ 5ICCA 1HW2A 3G3ZA 3HUGB 1OCTC 1R5ID 2ZXWH 3HRSA 4H0EA 1VQPI 2VKDA 1DDNA 1AKHA 1X1BA 1TW3A 2XAUA 3CUQC 3GTMJ 1T0FC 3U1KA 4OIRF 4JK1X 2VQHA 2DBBA 1FYMA 3L09A 4EJOA 3P9KA 3G73A 4M74A 3VYRB 3IRRA 2JQ7A 1N78A 2DCEA 5TISC 5IY5H 4JOMA 2O61A 2JJ7A 2HYGD 1Q1VA 1FNNA 1BA5A 1ZG5A 3FK6A 4XQFA 2DA5A 4IHXA 1LKXA 2X0LA 2P4WA 3FWEA 3GFJA 2CUFA 1BIAA 3L2CA 1TWAJ 2JA2A 1XMAA 1UG0A 1KQ9A 4WXHA 5J6XA 1JKPC 2N8GA 2VPRA 1SFEA 2MW8A 1CF7A 3CMMA 4IQJA 2RVCA 3AFHA 3LSTA 4FX4A 5J3LA 2YS9A 2VBWA 1K6OA 2CV1A 3LQQA 3C7JA 1WZ2A 2NYXA 4Q5SF 4M71A 2X6OA 4DGWB 1W4MA 3F6OA 1NG6A 2FEZA 2PG4A 2MABA 3OYKA 4KIFA 1LE8B 1B72B 2LSOA 5C3EJ 1NG7A 1YS6A 2Y2ZA 3BG6A 2DPDA 2WAQN 1R23A 1WWXA 4WK8F 3M07A 5HS8A 5IPAA 4KN7X 4C2UA 2KZVA 2V9KA 4ON0A 4ENJA 2GIVA 3S2HJ 2M8EA 1DP3A 2ZKZA 3FHZA 1X1DA 2RREA 2DN0A 3P9IA 5CVRA 2V1UA 5IT9Z 2YPRA 2VBYA 3OIQA 2CRGA 5AONA 1YRNA 4W97A 5HLHA 1TBXA 4CYDA 5K7ZA 2XSJC 4LD5A 2GA1A 3K4LA 2ACJA 1FEXA 4C2MJ 1M1EB 3BROA 1Z9CA 4OINF 2HXOA 2KKOA 3GTGJ 3HTUA 4IRGA 5E3MA 1K78B 2IW5A 2QYOA 3E1SA 3Q9SA 1FPQA 4M9ZA 3CCLI 1PUEE 1WJDA 1FIAA 5FD5A 1ZKGA 5LEJA 1B4AA 1U5TC 1WFXA 2FOKA 2ZXJA 4BHPA 2XF7A 4LGWA 4HV5A 3F8NA 1IN5A 5IYBJ 2K9LA 2XAHA 4MEXF 1VQ5I 4A3IJ 3K4CA 2QKMB 2EIMH 2W4SA 4MIMA 1N77A 5GP9A 2LD5A 1LJ9A 4RB3C 2LBFB 4G12A 2IGOA 5FKOA 2KISA 1LPQA 3Q3SA 1OR7A 3MCZA 4LMYA 4HSTA 2HTJA 2W84A 3BTIA 2F5FA 2M4KA 2XRLA 2OU2A 1JKOC 4BEHB 4J00A 1ORKA 3ZQLA 1A35A 3AG2H 1O4XA 2A68F 3HPGA 1FY7A 1Z77A 4MQVA 4N0BA 1KGSA 1E2XA 5E8IA 2ZB9A 2E2IJ 3H5NA 2J5PA 2EIJH 2CUJA 4Z6YA 2F2EA 1K6YA 3I3LA 2JVGA 2XGCA 3A03A 2YX7A 2KDOA 4V19K 1MBGA 3HOXJ 3TO9A 3SZTA 4IHWA 2NVQJ 2KIMA 3R0JA 3TQNA 1SFXA 4EV0A 2VBXA 5D5UB 1RETA 3CDHA 3WTZA 1N25A 3J80K 1T33A 3SHFA 3OS2A 3VOEA 4IHVA 3L9FA 1Y1VJ 2UZKA 3ZQ7A 1SD4A 2OC6A 3H92A 4LJZF 3DXJF 1D5VA 5JVTA 3CCEI 3DLLF 4NQWB 3JAMK 1AHDP 3TBIA 4HEA2 2VL8A 3BQZA 5DM6F 2L7FP 4IJAA 2V9VA 5LGNA 1ON2A 2L2OA 4NC6A 2VONA 4I09A 2O7OA 3TO6A 1D0ZA 2DW4A 3D5SC 2KJBA 5E1XA 4UVAA 2DA4A 3CF5F 2W25A 3S1QJ 4RBOA 3OYNA 1YX3A 3K10A 4HLXA 1PP7U 1MBEA 4EM2A 1CF7B 2PJRB 1D8JA 5IT3A 4E7KA 1XTAA 1JTYA 2ZNZA 5LBQA 2ZMEA 4KIGA 2F5DA 2GWRA 1TZLA 2VKEA 1YI2I 3OV8A 5E1WA 4A6DA 4I0BA 3EQLF 1T2KA 1G2HA 4HPQA 4B44A 2LY9A 2XHKA 1Z05A 2GM4A 4OOIA 2HU9A 2BVLA 1HKQA 4HX7A 4XOTA 2FMYA 1IGNA 2Q2EA 3QP5A 4CZCA 1XMXA 3M8FA 2OV7A 3KEOA 2QQAA 2ZJ2A 3ZGKA 4EQQA 5HODA 2FBKA 2R7OA 1GXPA 2PLYA 4Y4RA 1F43A 2VPLA 5EG0A 4NNJA 3LSGA 3VFZA 2CFXA 2ECCA 2R0QC 2LF7A 2EV0A 4KYWA 2NS8A 4XLNF 3GUDA 3S3OA 3KE2A 4AIJA 4PSWA 5D8LB 2QUFA 2M7AA 3F6VA 4X0GA 3N97A 1IRXA 2PMUA 5HDKA 3Q0VA 4IRIA 3DU6A 1A5JA 4DIQA 1TL8A 2NNYA 4G6TB 1YG2A 3S1NJ 2PMZN 1V54H 1NHAA 2K4JA 2EINH 1OISA 4MEYF 3RCOA 5CVJA 1BC7C 3O3KA 1CQTA 3OS0A 3KP3A 2NOJB 3ZQFA 3H0GJ 4M6VA 3BG3A 2B9SA 3DKXA 5L3GA 4JX4A 2HOSA 3ML6A 2M9HA 4M6YA 3S17J 1QRYA 5EEAA 1IW7F 3V7RA 2E35A 5BPIA 4A3EJ 2A6TA 3KLNA 3D5LA 5M5YJ 2ZCWA 2DJIA 3ZR8X 2YUSA 1WVRA 4L0ZB 2BV6A 5LHHA 5D4SA 2XVCA 1MBJA 4R1HA 4MNUA 2KDZA 4U0YA 3UR3C 3ERED 1HSJA 2FSWA 2UUZA 3S32A 2R5ZB 1LEBA 2QQ9A 5M3MJ 5F1RA 4CYCB 4HNVA 1BL0A 1PJRA 2QBYB 3RTRA 2R7UA 2E1NA 5TGTA 4A69C 4CHUA 1I3AA 2HXIA 2MC3A 5ED4A 5B3SH 4C3IJ 2VC1A 5FGMA 3HOVJ 2O8KA 4XKCA 1MKMA 4C30A 5J8CA 3TKYA 1TT5B 3CQZJ 4LFUA 3ZMUA 3CLQA 1V55H 3A01A 1JT6A 3R6SA 4RLFA 3S93A 3FF5A 3IAS2 1D1BA 2DMUA 3RDIA 1WJBA 1L0OC 1BW6A 3WTVC 2JA7J 2Z3YA 3RPUD 1GDTA 4BXFA 4PGHA 3GTQJ 2K9MA 4HA8A 1ETVA 3BR2A 5J47A 1LFUP 1JGSA 3B02A 3QOPA 2EA4A 2MC4A 4FETA 5J4VA 1EJ9A 1P7JA 2ISYA 2M30A 4U7BA 1VQ6I 1VQ9I 3E5UA 3G4SI 2KFDA 5IOZA 1Y0UA 3DEEA 4XK4A 1X2NA 3WU0A 1ZYRF 3FXMA 4P55A 3CC4I 2VKHA 1REPC 2FXAA 3LAPA 2VOOA 3WODF 3EUAA 2X6XA 1UFMA 4I7HA 3C2BA 2V4JC 4ANJA 4GXOA 2KRCA 4LG0A 2X1EA 3O2PE 1OCCH 2YU9J 2NRAC 4KIBA 1YX5A 1OYWA 1R7JA 1FBQA 3ASNH 1W5CC 1IRGA 4XMYA 3RPQA 4G7HF 2CV2A 3CMEI 1S9HA 5FKKA 3BR1A 2Q2EB 2RQPA 4FX0A 2W24A 4KMUX 2VT2A 2HFHA 2I5UA 1IJWC 1W36C 1BIBA 3PNVA 2DODA 2CS3A 5HDGA 5JFRA 1MMSA 4XLCA 5F64A 4EJTA 4KISA 2GBYA 2FUG2 1F4KA 1Z6TA 3F8BA 1DU6A 2HR3A 1ZGWA 2XPVA 1ETYA 3HTSB 1T6SA 1JUMA 3FDYA 2HKXA 4AIHA 1FBUA 2DT5A 3ZCOA 1GV2A 4DOZA 2HYFA 2XB5A 2DA7A 2R92J 1W5TA 3OSFA 3AG4H 2BOLA 1YIOA 3K2ZA 1X2MA 3PNTA 4BY7J 1B6AA 5KNLA 2R7FA 4TV7A 4UV8A 3JW4A 1J59A 3ERMA 5CLSA 2A69F 2Z5UA 3C3WA 2EB7A 4HDUA 2DT6A 3GTLJ 2VJIA 2D1VA 4LOCA 3CCJI 5BS6A 2HEOA 3S15J 3CCMI 4QPOA 4R8HA 2F5CA 1WJAA 1BI1A 1X3WB 4AU7A 4BACA 3MZYA 4M9SA 1B59A 4CICA 1T38A 1K7AA 2CW0F 2JPBA 1X1CA 4G7OF 5BOXA 1MBFA 3KPHA 1OCRH 2Y30A 2QCOA 2UXXA 1OCPA 4RA2A 2DXIA 2OA4A 1HC8A 3GWZA 4HQEA 2R7WA 1NK3P 2EFPA 3LSIA 3C2GA 2JMWA 2K86A 3PFYA 5CQGA 1BOAA 4AUXA 2QQ8A 2L54A 2E19A 4ENNA 2FOWA 3H3UA 3OL4A 2MA3A 1QPIA 1ZK8A 3RJPA 2JN6A 4UVBA 3U9GA 2ZXIA 2XKOA 3RI4A 4F3QA 4ZDPA 5KCMA 1YO5C 1RNLA 1B9NA 3L1PA 3MAJA 4BDYA 5M5XJ 1XDSA 4HDVA 2QF7A 5CVIA 2FNAA 3HOWJ 5IOYA 3OY9A 2V1DA 3E6CC 3E5QA 4GYIA 5F1JA 1K4SA 4M9XA 2L01A 2WAFA 1W36D 4UUTA 1QVUA 3OYEA 3V7SA 1R71A 3FXOA 2G7UA 3CUQA 1WJ5A 1R1UA 4IX7A 2F48A 3DPUA 1D1CA 2HDCA 4KMFA 1IC8A 3W2AA 2Z9OA 2Z16A 2K7LA 1XC5A 2OZ6A 3W2VA 1KA8A 4P9FA 4F91B 4YIRX 1BR4A 3NEUA 5GPCA 3J7AO 4V2GA 2ZFWA 3FZVA 2EV6A 4HX4A 2CUZA 4NBQA 3SFZA 3M4OJ 2BZTA 2KIFA 4M73A 2R3SA 3HEFA 2PBIA 3JSOA 3ASOH 2R7SA 3WGHA 2LOOA 3WU2C 1J2XA 3HXLA 1OQYA 3VSKA 3VB2A 4XLPF 3OOUA 3KX2A 3PIPF 3WE2A 3W6KB 5K7FA 3HOYJ 2PN6A 5JLWA 4Y3OA 3VWBA 5ILUA 2EQRA 3HDDA 2O0YA 1SANA 4Y33A 1K61A 1ETKA 3VYSB 4II3A 2WY7Q 4BHCA 4RDUA 4HF0A 5D6EA 5LEKA 4B3XA 3C18A 1WJFA 4EMSA 1BI3A 5GAEJ 2C6YA 5F0HA 1HF0A 2D5VA 3OYFA 3L7WA 3I4NJ 2QWWA 1YHQI 4NC7A 2BYVE 2KL4A 2OD5A 1LE8A 1B72A 2L02A 1JJ6C 2R7RA 2BXZA 1P6RA 1BOBA 2Y69H 2WV0A 3W6VA 1G8XA 1FOXA 2YR2A 2ZSIB 3WTSC 3MQ0A 3EUHC 1UAAA 3FBNB 3DKWA 4LIVA 3F21A 4M3GA 2KMUA 5LHGA 3TGNA 1VQKI 2Y0MA 3FXRA 3WTYC 2JVHA 2AQFA 3F0CA 3LA7A 1H9TA 4A3KJ 2M7BA 1LFPA 2NXNB 1IN6A 1LUJB 4N9HA 1E3OC 1U5TA 4FASD 1I1SA 5DS9A 4S04A 1P7IA 5ICEA 2CSOA 3C2HA 4IOCF 2Y0SA 1HKTA 4AD9A 4A3JJ 1K78A 2ESHA 2WA0A 4G8XA 2VLAA 4A0XA 3HOUJ 5IT9K 5JVGF 1MIJA 1HW5A 3EYYA 3BTCA 5J1UA 3AG1H 2DTRA 2I10A 4PFOA 2G9WA 1DPRA 5DCMB 2HVRA 1RIOH 4C9YA 1S7EA 3QODA 1ZQ3P 1LDDA 3CCYA 5C44J 2X4HA 1IXCA 4AC0A 3ZQHA 2CQ7A 1QHHD 3JRAA 4A12A 1AU7A 1RKWA 2DOFA 1Y56A 1X4PA 5LD2C 3SJMA 2LLKA 2HWVA 2LBFA 1SFOJ 5F0CA 4E7HA 1KYZA 2P6TA 4Y17A 5LGUA 3OS1A 1T8IA 1KZHA 2LF8A 2A3SA 2Y0SN 5CJ9A 5H6QA 1SVOA 4WF2A 2CUEA 3FBIB 1MJBA 1XSVA 3CESA 3CCRI 3K4BA 1J7KA 3M3YJ 1MSFC 2IGNA 1YITI 4M3BA 4Y52J 1SMYF 4D0PA 2STWA 2WADA 5LGTA 2W1OA 3OL3A 2I8DA 5BQTA 3HPHA 1W0UA 5JI6A 4QIWN 3EETA 1Z7LA 4OMZA 2IT0A 4XNFA 1TQPA 2KQRA 1JTXA 2DAOA 3G71I 2M3AA 3S2WA 3E6BA 1TQMA 2JA5J 2XC7A 2O9LA 5EGOB 2VN2A 4L9TA 1SD7A 3H0DA 3LFUA 1I5ZA 1D0YA 2CU7A 1YFHA 5C4JJ 2CJJA 3PNYA 4KITB 2DTZA 4HLYA 3ONQA 2Y75A 2IVMA 4EVIA 2CYYA 1ZG1A 1OFCX 4CO8A 4RLQA 4L5IA 3LSRA 1K83J 3TOBA 1IAWA 4MQ9F 3PFIA 4NQWA 2XUBA 2EFWA 3BR3A 1ZRDA 1JUPA 3PM1A 3LL7A 2CQXA 5IP6A 5L3BA 5KVRA 3FKIJ 4E6KG 3I56I 2OF7A 3A1YA 1SFUA 2IS1A 3KYCB 3K2AA 2XDVA 4B3AA 1YJNI 3TOAA 3OSGA 3MFKA 1I50J 4BYYA 4MGRA 2IPQX 3JCUC 2L4MA 3W3CA 2PJRA 1ZARA 2VIXA 3VPRA 1YW9A 2EZIA 4YRVA 3OYGA 3V4GA 2Y9ZA 2GQQA 3RPUA 2EK5A 1J09A 1A6IA 2K3FA 3K4NA 1O3TA 3F22A 1IV8A 2PI0A 1WJEA 3NWSA 2EV5A 3DBRB 3GX4X 5FB2A 1A31A 2Y31A 4FE7A 1YW8A 1A6QA 1BR1A 3HG9A 4B4CA 3P7NA 1IN8A 1J0RA 4BE2A 3UKGA 1HCRA 2EIKH 3IH2A
chains in the Genus database with same CATH topology
3FXQA 4HAMA 1CGPA 1ON1A 2EFQA 4UXNA 1XGSA 2EA2A 3ABUA 1HBXG 1QNTA 4CXFA 2RKHA 1IUYA 2A6EF 1V4RA 2HOEA 4L0YB 2V1XA 4L5JA 1GHCA 1BI0A 1SD6A 1U5TB 5EEGA 3RIRA 3K9TA 3MWMA 2XAJA 2Q8KA 2E1CA 1S6LA 4I02A 1IF1A 4EJUA 4EM0B 3CLOA 3EYIA 4RGUA 3MEXA 4I01A 1MDMB 2A6HF 4L9JA 3GEZA 4UUVA 4WCGA 3TDUC 3K1PA 3GO5A 3QPTA 3BY6A 4HYEA 4S05A 2OAZA 5D5VB 2QBYA 2GAUA 1I27A 1HSTA 4LK0F 3BPXA 3K0LA 4B09A 1FSHA 2FU4A 4OU0A 4BNCA 3BJAA 4A0ZA 2P6SA 2O3FA 3SXYA 1S29A 1MJ9A 1I1GA 1U6GA 2QQBA 2AXLA 4A2UA 2H27A 5H20A 1H0MA 5DYMA 4HOBA 3ZMDA 2KJCA 2A61A 4E70A 3KP5A 3ISPA 2NAZA 5ILSA 2MLKA 2CO5A 3WGGA 2O6GE 1WQ2A 1S7OA 1RUNA 1OPCA 3KCCA 3QAHA 5DDGA 2LDUA 2IRFG 4ZZLA 4LB5A 2Q0OA 2WWYA 2P5VA 2PFBA 1YLFA 2OQRA 1A04A 2XKPA 4FT8A 4ESJA 1KU7A 4HV6A 5EEHA 3T0YA 2D45A 1EV7A 1FZPB 1J5YA 2A5YB 1D3YA 4BHBA 1J9IA 1YS7A 4PDKA 1YTYA 5A2QZ 5AIPA 1OYIA 1P4XA 4Y13A 5JHUA 3IL2A 4RAYA 2HQRA 3WGIA 5LRRA 4AVPA 2DFIA 1TW2A 3E6DA 5E18F 3K1NA 1W7PD 3TO7A 1R00A 1JE8A 3ABTA 4G6DA 3DPTA 3GLXA 4A5NA 4MHGA 3HSFA 1G4DA 4WXCA 1JHFA 1YYVA 1E17A 4IHTA 3P9CA 1ODDA 3LFKA 1QZZA 2CG4A 3F3XA 1SAXA 1J75A 1LDKB 5FLXK 3RKWA 3JTHA 1IZ1A 1P92A 3E3VA 1JHHA 2FF4A 2YU3A 2FBHA 1SD5A 3HHHA 2UWMA 3IKTA 5D8KB 3CUOA 3KP6A 1UHWA 4KFCA 2W57A 5FFXA 4BXUA 3NRVA 4HF2A 2CGPA 1GVJA 4QWQA 4HF1A 2M1BA 3LAJA 4JQFA 1OKRA 4K2EA 1L3LA 4HBLA 2NS0A 2Z99A 3DF8A 2XRNA 4NB5A 5D4RA 2RGVA 4PZJA 1G3WA 1EH8A 1Z6RA 1LVAA 3LA3A 1RUOA 2HZTA 4ZZDA 2H6CA 4GGGA 4O6JA 4YG2F 1B1BA 4ASNA 2P5LC 2XAGA 1DUXC 4G7ZF 4HZFA 4ESFA 3T1BA 4F7ZA 5E20A 3F72A 1MD0A 3EUHA 1KQ0A 1QQIA 3Q9VA 1FBSA 3I4PA 3LA2A 4LB6B 3HIFA 3GXOA 2ZO4A 1LQ1A 3ECHA 1IN7A 2FA5A 4L18B 1U8RA 2XAFA 3ULQB 5FLXZ 1WKMA 3VODA 3GFMA 1MZBA 2MD5A 2FQ3A 1RZ4A 5DCMA 1LDJA 3M8EA 1OMIA 1R5GA 2PMHA 2BGCA 1EH6A 4R79A 2Z33A 4IF4A 2DLLA 1ZH5A 3HYIA 3QU3A 3RYPA 3CTAA 1G3YA 3FMSA 2RC4A 1R1TA 3KLOA 3C1DA 3WTWC 2VE8A 4DNCA 5LRSA 3GZ5A 3N4MA 4HX8A 4ENKA 3M9AA 2XAQA 3DFGA 3JSPA 3R61A 1G3SA 2ADUA 3ZMZA 5D5WB 5BMZA 2ISZA 4EGYA 2EWNA 2P7CB 2J5OA 4BAYA 2IA1A 1S3JA 4YIFA 1TLHB 4HW0A 1KYWA 1KQ8A 3JTGA 2DK8A 1O7FA 1F9NA 1YQAA 4JBAA 2MH2A 3BJOA 2GZWA 2R7DA 1USTA 4O5VA 2W85A 2KIUA 2EJRA 2ZNYA 2TDXA 2HTSA 2QLZA 1O3RA 1WI9A 2M45A 2L3DA 4ETSA 3ZP5A 3I71A 2IJLA 2EFNA 1HXDA 1VTNC 3SQNA 4I2OA 1IRFA 5K5QA 3I54A 1HW1A 4OMYA 3QU6A 3KZYA 4DQ2A 1I6XA 5K5OA 1TTYA 4UHTA 2HS5A 4YFXF 3IWFA 1FX7A 2VT3A 4M6XA 1S8NA 1XB4A 2DPUA 3QP6A 1FT9A 4YFNF 3ZN1A 2GXBA 1MDMA 2BBYA 3U2RA 4I0AA 1GXQA 2PEXA 5DUKA 5FFZA 1FOKA 1AOYA 2PQ8A 1G3TA 3HHGA 2JZYA 4AIKA 3J81Z 5ICGA 3I53A 5KK1A 1O3SA 3HOSA 1FYLA 4ZYHA 5BPDA 3RKYA 4RGSA 1UCRA 5LLQA 2VE9A 4BH9A 1OYYA 4O3MA 5E1ZB 1W7PA 1Z1DA 2IA0A 3ZMTA 2QVOA 1R22A 4WXDA 1P2FA 2WC2A 2VODA 2XROA 4ZYEA 2D1HA 3F23A 1BBYA 2WTEA 3BDDA 4UVCA 2JTVA 3F8CA 4PCQA 2GXGA 5FO5A 4L9VA 3WE3A 3GZ6A 2O03A 1D8KA 1O57A 4KA4A 3ZMSA 3ZPLA 5DD8A 3I5UA 1BM9A 3BP8A 4EJWA 2P5KA 3KFWX 2IP2A 3GVAA 5DUIA 3F8FA 3LQRA 3PQJA 1ZN2A 4WWCA 2VXZA 5DV5A 3Q5FA 4KT5C 1AWCA 3EDPA 3E6MA 4Z2YA 1STZA 4U88A 2STTA 2G7HA 3DPLC 4RB1A 4RB2C 4XRFA 1JXSA 1Z7UA 5H6RA 4CDGA 1RI7A 3FM5A 5A2QK 3WG9A 4Q47A 1XGNA 3DV8A 3RKXA 1T98A 2OQGA 1ZGAA 2LNBA 4XBFA 3CO6C 3IKVA 3H3ZA 1DPUA 3ECOA 3L00A 4ESBA 2JSCA 2FNPA 1S7AA 3T8TA 2JRTA 4G94A 5E8GA 3DP7A 3M1EA 1W7PB 5CVUA 2MLGA 3CJNA 3KETA 4U0WA 1FSEA 2CQKA 1BI2A 5ILVA 2VC0A 3COAC 1TNTA 5HVQC 3D0SA 3I0TA 4MTDA 4ZYDA 1W5SA 1PP8F 3I59A 1IXRC 1Q1HA 4EM1A 4ZH4F 4ENMA 4KNYA 1XMKA 4B8XA 4HQMA 2DQRA 1XGMA 3WTUC 1O7LA 5HOOA 4KDPA 4PGGA 1ZLJA 1P4WA 3LWFA 3REOA 1G6NA 4IHSA 4OIPF 5HS7A 3HSEA 4WX9A 1U2WA 3K1MA 3GW2A 2HGCA 3CO7C 3MZHA 2FBIA 1Z91A 2FE3A 3KP7A 1TQIA 3DEUA 1FYKA 6PAXA 1V3FA 5CYVA 2QENA 5D6FA 4P9UA 1ZRCA 3GFIA 1LEAA 3IHUA 3F8MA 2COMA 1MJAA 1ULYA 3SZPA 4LLLA 4IRHA 3T8RA 3FX3A 3FM3A 1R1VA 4P5OA 4GO1A 1YW7A 4P96A 5D5XB 5L3FA 4KUMA 4ZYGA 4RGRA 3HRMA 2A07F 4N9IA 4RB0A 3OOPA 3NQOA 4RAZA 2MH9A 4YIIA 4KICA 4YFKF 4A0YA 1BC8C 4UNOA 3R0AA 4OIOF 2RDPA 2M5WA 5TRDA 1HKSA 1XN7A 1U78A 3IWZA 2O8XA 1QZYA 2FRHA 3ZMVA 1XCVA 4AWXB 2H94A 2EFOA 2HKOA 4UV9A 2IA2A 3J80Z 3I59B 2JPCA 1KU2A 3JAMZ 3W6JB 3V7CA 1ZRFA 1HQCA 1R58A 1PDNC 4U0VA 5HLIA 3KEQA 1P4AA 1XSXA 3V8KA 4G9YA 1IN4A 5CVVA 2CWEA 2QM3A 3FMQA 5L3CA 3WU1B 2P7VB 5J8FA 4GYGA 5TJJA 2XGXA 2FMLA 4L9NA 2UXNA 1XCBA 2ZMEB 1R5HA 5ERIA 4NHJA 3GFLA 4G6QA 3B73A 4M72A 1FP2A 2ETHA 1EH7A 5K5RA 1FC3A 1QO0D 1IXSB 4XSXF 2BE5F 2YSRA 2ELHA 3BJ6A 4KN4X 1H9GA 2E7XA 1F1ZA 4IXAA 3AAFA 1ZG3A 1ZAOA 4Q4ZF 2VOPA 5JR3A 3GYHX 1LNWA 3V8JA 3DQVC 1UB9A 2XV4S 2RN7A 3HOTA 5ICFA 3BOQA 1ZHFA 4MTEA 5HLGA 3E5XA 1UHMA 1SMTA 3I58A 4IPAA 1BN5A 3T5XA 2Y48A 2ZBKA 3FXUA 2OBPA 1FWZA 4U7DA 3V8LA 1XSDA 4FHTA 3PQKA 4A6EA 1BJAA 3O6BB 2P8TA 5DEQA 3HSRA 1T39A 2DU9A 2D2WA 2K27A 4Y15A 5E17F 3J81K 2RNJA 3ZN0A 2LKPA 5F6FA 3KP2A 2QZ8A 2GA2A 1FLIA 3U1DA 2E7WA 3BPVA 2DK5A 2V79A 1T0FA 5FD6A 3HUGA 1K79A 1R36A 3I64A 3HRUA 2KRFA 2DO7A 3WTXC 4LG0B 1ZLKA 1ZREA 4RGXA 4LLGF 2ESNA 4IVNA 1KU3A 2AS5F 4BQAA 5AIQA 3R4KA 4EGZA 2H09A 1QPMA 3BWGA 4Q48A 3ROUA 2XIGA 3TDZC 2MBFA 1TNSA 3E97A 3WTTC 3IRQA 4A5MA 3K69A 2OZUA 2HQNA 3FMRA 2YX4A 2XASA 3R60A 3KP4A 1ZGJA 3HRTA 2V6CA 4OIQF 1MGTA 1XDUA 2NNNA 1DP7P 3IC7A 4QLCU 2H6BA 2M87A 1XD7A 1FP1D 3QRFF 4CGZA 3BZ6A 3GF2A 3M7GA 1USSA 1WRJA 4XSZF 1O3QA 1QGPA 2K4BA 3QPHA 2VBZA 1QBJA 1WSUA 5DCFA 5L3DA 5HDNA 4I98B 5DD4A 1F5TA 4LK1F 1X3UA 1XGOA 4CZZA 4EJVA 2BEOA 4LLNA 4RS8A 2DI3A 2L4AA 2F5EA 1C0WA 3KZZA 5HS9A 2RV8A 2PJPA 2JT1A 2B0LA 1KU9A 5L3EA 5LHIA 2K02A 5K1YA 1U3EM 3RYRA 1LB2A 1ONVA 3VEPA 2DQLA 1B9MA 3ELKA 3CUQB 4GCVA 5ICCA 1HW2A 3G3ZA 3HRSA 4H0EA 1DDNA 1TW3A 3CUQC 4OIRF 4JK1X 2DBBA 1FYMA 3L09A 4EJOA 3P9KA 3G73A 4M74A 3IRRA 2O61A 2HYGD 1FNNA 1ZG5A 2X0LA 2P4WA 3FWEA 3GFJA 1BIAA 3L2CA 1XMAA 1KQ9A 4WXHA 5J6XA 1SFEA 1CF7A 2RVCA 3LSTA 4FX4A 1K6OA 2VBWA 3LQQA 3C7JA 2NYXA 4Q5SF 4M71A 1W4MA 3F6OA 2FEZA 2PG4A 4KIFA 2LSOA 1YS6A 2DPDA 1R23A 1WWXA 4WK8F 5HS8A 4KN7X 4ON0A 4ENJA 2GIVA 2M8EA 2ZKZA 3FHZA 3P9IA 5CVRA 2V1UA 5IT9Z 2YPRA 2VBYA 5AONA 5HLHA 1TBXA 4CYDA 4LD5A 2GA1A 2ACJA 3BROA 1Z9CA 4OINF 2KKOA 3HTUA 4IRGA 1K78B 2IW5A 2QYOA 3Q9SA 4M9ZA 1FPQA 1PUEE 5FD5A 5LEJA 1B4AA 1U5TC 2FOKA 2ZXJA 4BHPA 4LGWA 4HV5A 3F8NA 1IN5A 2XAHA 4MEXF 1LJ9A 4RB3C 1OR7A 3MCZA 4LMYA 2HTJA 2W84A 2F5FA 2OU2A 2A68F 1FY7A 4MQVA 4N0BA 1KGSA 1E2XA 5E8IA 2J5PA 2F2EA 2YX7A 3TO9A 3SZTA 2KIMA 3R0JA 3TQNA 1SFXA 4EV0A 2VBXA 5D5UB 3CDHA 3WTZA 3J80K 3SHFA 3VOEA 3L9FA 2UZKA 3ZQ7A 1SD4A 3H92A 4LJZF 3DXJF 1D5VA 5JVTA 3JAMK 4IJAA 2V9VA 5LGNA 1ON2A 2VONA 4I09A 3TO6A 2DW4A 2KJBA 5E1XA 4UVAA 2W25A 4HLXA 1PP7U 4EM2A 1CF7B 1D8JA 5IT3A 2ZNZA 5LBQA 2ZMEA 4KIGA 2F5DA 2GWRA 3OV8A 5E1WA 4A6DA 4I0BA 3EQLF 1T2KA 1Z05A 2XHKA 4OOIA 1HKQA 4HX7A 2FMYA 2Q2EA 3QP5A 3M8FA 3KEOA 2QQAA 2ZJ2A 1GXPA 4EQQA 2FBKA 2PLYA 3VFZA 2CFXA 2LF7A 2EV0A 4KYWA 4XLNF 3GUDA 3KE2A 4AIJA 5D8LB 2QUFA 3F6VA 3N97A 5HDKA 2PMUA 4IRIA 2NNYA 1YG2A 1NHAA 2K4JA 4MEYF 1BC7C 5CVJA 3O3KA 3KP3A 5L3GA 3ML6A 4M6YA 1IW7F 3V7RA 5BPIA 3KLNA 3D5LA 2ZCWA 4L0ZB 2BV6A 5LHHA 5D4SA 2XVCA 4R1HA 4MNUA 4U0YA 3ERED 1HSJA 2FSWA 1LEBA 2QQ9A 5F1RA 2QBYB 3RTRA 2E1NA 4CHUA 5ED4A 2MC3A 2VC1A 5FGMA 1MKMA 5J8CA 3TKYA 4LFUA 3ZMUA 3R6SA 3FF5A 3RDIA 1L0OC 3WTVC 2Z3YA 4PGHA 4HA8A 1JGSA 3B02A 3QOPA 2EA4A 2ISYA 2M30A 4U7BA 3E5UA 1Y0UA 3WU0A 1ZYRF 4P55A 1REPC 2FXAA 3LAPA 2VOOA 3WODF 1UFMA 4I7HA 4GXOA 4LG0A 3O2PE 2NRAC 4KIBA 1OYWA 1R7JA 1FBQA 1IRGA 3RPQA 4G7HF 2RQPA 4FX0A 2W24A 4KMUX 2VT2A 2HFHA 1BIBA 5HDGA 5JFRA 5F64A 4EJTA 1F4KA 1Z6TA 3F8BA 2HR3A 3HTSB 1T6SA 2HKXA 4AIHA 1FBUA 2DT5A 2HYFA 1W5TA 1YIOA 3K2ZA 1B6AA 2R7FA 4TV7A 4UV8A 3JW4A 1J59A 5CLSA 2A69F 2Z5UA 3C3WA 2EB7A 4HDUA 2D1VA 5BS6A 2HEOA 4R8HA 2F5CA 1BI1A 3MZYA 4M9SA 1B59A 4CICA 1T38A 1K7AA 2CW0F 2JPBA 4G7OF 5BOXA 2UXXA 2OA4A 3GWZA 4HQEA 2EFPA 2K86A 1BOAA 2L54A 4ENNA 3H3UA 2MA3A 3RJPA 4UVBA 3U9GA 3RI4A 2XKOA 1YO5C 1RNLA 1B9NA 3MAJA 1XDSA 4HDVA 5CVIA 2FNAA 3E6CC 2V1DA 3E5QA 4GYIA 4M9XA 2L01A 3V7SA 2G7UA 3CUQA 1R1UA 2HDCA 4KMFA 2Z9OA 2K7LA 2OZ6A 1KA8A 4P9FA 3NEUA 3J7AO 2ZFWA 3FZVA 2EV6A 4HX4A 3SFZA 2KIFA 4M73A 2R3SA 3JSOA 2PBIA 3WGHA 1J2XA 3VB2A 4XLPF 3WE2A 3W6KB 2PN6A 5ILUA 2O0YA 4BHCA 4HF0A 5D6EA 5LEKA 3C18A 4EMSA 1BI3A 2C6YA 3L7WA 2QWWA 2BYVE 2OD5A 2L02A 1P6RA 2WV0A 2YR2A 3WTSC 3MQ0A 3DKWA 3F21A 5LHGA 3TGNA 2Y0MA 3FXRA 3WTYC 3LA7A 1H9TA 1IN6A 4N9HA 1U5TA 1I1SA 4S04A 5ICEA 2CSOA 1HKTA 4AD9A 1K78A 2ESHA 4G8XA 4A0XA 5IT9K 1HW5A 3EYYA 2DTRA 2G9WA 1DPRA 5DCMB 1RIOH 1LDDA 2X4HA 1IXCA 4A12A 2HWVA 1KYZA 2P6TA 4Y17A 5LGUA 2LF8A 2A3SA 5CJ9A 5H6QA 4WF2A 1MJBA 1XSVA 1J7KA 1SMYF 4D0PA 2STWA 5LGTA 5BQTA 5JI6A 3EETA 4OMZA 2IT0A 1TQPA 2DAOA 3S2WA 3E6BA 1TQMA 2VN2A 4L9TA 1SD7A 1I5ZA 1YFHA 4HLYA 2Y75A 2IVMA 4EVIA 2CYYA 1ZG1A 4CO8A 4L5IA 3TOBA 1IAWA 4MQ9F 3PFIA 4NQWA 2XUBA 2EFWA 1ZRDA 5L3BA 5KVRA 1SFUA 3TOAA 3MFKA 4BYYA 4MGRA 2IPQX 2L4MA 1ZARA 1YW9A 3V4GA 2GQQA 3RPUA 2EK5A 1O3TA 3F22A 2PI0A 2EV5A 3GX4X 5FB2A 1YW8A 3P7NA 1IN8A 1J0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXQ A;  4HAM A;  1CGP A;  1ON1 A;  2EFQ A;  4UXN A;  1XGS A;  2EA2 A;  3ABU A;  1HBX G;  1QNT A;  4CXF A;  2RKH A;  1IUY A;  2A6E F;  1V4R A;  2HOE A;  4L0Y B;  2V1X A;  4L5J A;  1GHC A;  1BI0 A;  1SD6 A;  1U5T B;  5EEG A;  3RIR A;  3K9T A;  3MWM A;  2XAJ A;  2Q8K A;  2E1C A;  1S6L A;  4I02 A;  1IF1 A;  4EJU A;  4EM0 B;  3CLO A;  3EYI A;  4RGU A;  3MEX A;  4I01 A;  1MDM B;  2A6H F;  4L9J A;  3GEZ A;  4UUV A;  4WCG A;  3TDU C;  3K1P A;  3GO5 A;  3QPT A;  3BY6 A;  4HYE A;  4S05 A;  2OAZ A;  5D5V B;  2QBY A;  2GAU A;  1I27 A;  1HST A;  4LK0 F;  3BPX A;  3K0L A;  4B09 A;  1FSH A;  2FU4 A;  4OU0 A;  4BNC A;  3BJA A;  4A0Z A;  2P6S A;  2O3F A;  3SXY A;  1S29 A;  1MJ9 A;  1I1G A;  1U6G A;  2QQB A;  2AXL A;  4A2U A;  2H27 A;  5H20 A;  1H0M A;  5DYM A;  4HOB A;  3ZMD A;  2KJC A;  2A61 A;  4E70 A;  3KP5 A;  3ISP A;  2NAZ A;  5ILS A;  2MLK A;  2CO5 A;  3WGG A;  2O6G E;  1WQ2 A;  1S7O A;  1RUN A;  1OPC A;  3KCC A;  3QAH A;  5DDG A;  2LDU A;  2IRF G;  4ZZL A;  4LB5 A;  2Q0O A;  2WWY A;  2P5V A;  2PFB A;  1YLF A;  2OQR A;  1A04 A;  2XKP A;  4FT8 A;  4ESJ A;  1KU7 A;  4HV6 A;  5EEH A;  3T0Y A;  2D45 A;  1EV7 A;  1FZP B;  1J5Y A;  2A5Y B;  1D3Y A;  4BHB A;  1J9I A;  1YS7 A;  4PDK A;  1YTY A;  5A2Q Z;  5AIP A;  1OYI A;  1P4X A;  4Y13 A;  5JHU A;  3IL2 A;  4RAY A;  2HQR A;  3WGI A;  5LRR A;  4AVP A;  2DFI A;  1TW2 A;  3E6D A;  5E18 F;  3K1N A;  1W7P D;  3TO7 A;  1R00 A;  1JE8 A;  3ABT A;  4G6D A;  3DPT A;  3GLX A;  4A5N A;  4MHG A;  3HSF A;  1G4D A;  4WXC A;  1JHF A;  1YYV A;  1E17 A;  4IHT A;  3P9C A;  1ODD A;  3LFK A;  1QZZ A;  2CG4 A;  3F3X A;  1SAX A;  1J75 A;  1LDK B;  5FLX K;  3RKW A;  3JTH A;  1IZ1 A;  1P92 A;  3E3V A;  1JHH A;  2FF4 A;  2YU3 A;  2FBH A;  1SD5 A;  3HHH A;  2UWM A;  3IKT A;  5D8K B;  3CUO A;  3KP6 A;  1UHW A;  4KFC A;  2W57 A;  5FFX A;  4BXU A;  3NRV A;  4HF2 A;  2CGP A;  1GVJ A;  4QWQ A;  4HF1 A;  2M1B A;  3LAJ A;  4JQF A;  1OKR A;  4K2E A;  1L3L A;  4HBL A;  2NS0 A;  2Z99 A;  3DF8 A;  2XRN A;  4NB5 A;  5D4R A;  2RGV A;  4PZJ A;  1G3W A;  1EH8 A;  1Z6R A;  1LVA A;  3LA3 A;  1RUO A;  2HZT A;  4ZZD A;  2H6C A;  4GGG A;  4O6J A;  4YG2 F;  1B1B A;  4ASN A;  2P5L C;  2XAG A;  1DUX C;  4G7Z F;  4HZF A;  4ESF A;  3T1B A;  4F7Z A;  5E20 A;  3F72 A;  1MD0 A;  3EUH A;  1KQ0 A;  1QQI A;  3Q9V A;  1FBS A;  3I4P A;  3LA2 A;  4LB6 B;  3HIF A;  3GXO A;  2ZO4 A;  1LQ1 A;  3ECH A;  1IN7 A;  2FA5 A;  4L18 B;  1U8R A;  2XAF A;  3ULQ B;  5FLX Z;  1WKM A;  3VOD A;  3GFM A;  1MZB A;  2MD5 A;  2FQ3 A;  1RZ4 A;  5DCM A;  1LDJ A;  3M8E A;  1OMI A;  1R5G A;  2PMH A;  2BGC A;  1EH6 A;  4R79 A;  2Z33 A;  4IF4 A;  2DLL A;  1ZH5 A;  3HYI A;  3QU3 A;  3RYP A;  3CTA A;  1G3Y A;  3FMS A;  2RC4 A;  1R1T A;  3KLO A;  3C1D A;  3WTW C;  2VE8 A;  4DNC A;  5LRS A;  3GZ5 A;  3N4M A;  4HX8 A;  4ENK A;  3M9A A;  2XAQ A;  3DFG A;  3JSP A;  3R61 A;  1G3S A;  2ADU A;  3ZMZ A;  5D5W B;  5BMZ A;  2ISZ A;  4EGY A;  2EWN A;  2P7C B;  2J5O A;  4BAY A;  2IA1 A;  1S3J A;  4YIF A;  1TLH B;  4HW0 A;  1KYW A;  1KQ8 A;  3JTG A;  2DK8 A;  1O7F A;  1F9N A;  1YQA A;  4JBA A;  2MH2 A;  3BJO A;  2GZW A;  2R7D A;  1UST A;  4O5V A;  2W85 A;  2KIU A;  2EJR A;  2ZNY A;  2TDX A;  2HTS A;  2QLZ A;  1O3R A;  1WI9 A;  2M45 A;  2L3D A;  4ETS A;  3ZP5 A;  3I71 A;  2IJL A;  2EFN A;  1HXD A;  1VTN C;  3SQN A;  4I2O A;  1IRF A;  5K5Q A;  3I54 A;  1HW1 A;  4OMY A;  3QU6 A;  3KZY A;  4DQ2 A;  1I6X A;  5K5O A;  1TTY A;  4UHT A;  2HS5 A;  4YFX F;  3IWF A;  1FX7 A;  2VT3 A;  4M6X A;  1S8N A;  1XB4 A;  2DPU A;  3QP6 A;  1FT9 A;  4YFN F;  3ZN1 A;  2GXB A;  1MDM A;  2BBY A;  3U2R A;  4I0A A;  1GXQ A;  2PEX A;  5DUK A;  5FFZ A;  1FOK A;  1AOY A;  2PQ8 A;  1G3T A;  3HHG A;  2JZY A;  4AIK A;  3J81 Z;  5ICG A;  3I53 A;  5KK1 A;  1O3S A;  3HOS A;  1FYL A;  4ZYH A;  5BPD A;  3RKY A;  4RGS A;  1UCR A;  5LLQ A;  2VE9 A;  4BH9 A;  1OYY A;  4O3M A;  5E1Z B;  1W7P A;  1Z1D A;  2IA0 A;  3ZMT A;  2QVO A;  1R22 A;  4WXD A;  1P2F A;  2WC2 A;  2VOD A;  2XRO A;  4ZYE A;  2D1H A;  3F23 A;  1BBY A;  2WTE A;  3BDD A;  4UVC A;  2JTV A;  3F8C A;  4PCQ A;  2GXG A;  5FO5 A;  4L9V A;  3WE3 A;  3GZ6 A;  2O03 A;  1D8K A;  1O57 A;  4KA4 A;  3ZMS A;  3ZPL A;  5DD8 A;  3I5U A;  1BM9 A;  3BP8 A;  4EJW A;  2P5K A;  3KFW X;  2IP2 A;  3GVA A;  5DUI A;  3F8F A;  3LQR A;  3PQJ A;  1ZN2 A;  4WWC A;  2VXZ A;  5DV5 A;  3Q5F A;  4KT5 C;  1AWC A;  3EDP A;  3E6M A;  4Z2Y A;  1STZ A;  4U88 A;  2STT A;  2G7H A;  3DPL C;  4RB1 A;  4RB2 C;  4XRF A;  1JXS A;  1Z7U A;  5H6R A;  4CDG A;  1RI7 A;  3FM5 A;  5A2Q K;  3WG9 A;  4Q47 A;  1XGN A;  3DV8 A;  3RKX A;  1T98 A;  2OQG A;  1ZGA A;  2LNB A;  4XBF A;  3CO6 C;  3IKV A;  3H3Z A;  1DPU A;  3ECO A;  3L00 A;  4ESB A;  2JSC A;  2FNP A;  1S7A A;  3T8T A;  2JRT A;  4G94 A;  5E8G A;  3DP7 A;  3M1E A;  1W7P B;  5CVU A;  2MLG A;  3CJN A;  3KET A;  4U0W A;  1FSE A;  2CQK A;  1BI2 A;  5ILV A;  2VC0 A;  3COA C;  1TNT A;  5HVQ C;  3D0S A;  3I0T A;  4MTD A;  4ZYD A;  1W5S A;  1PP8 F;  3I59 A;  1IXR C;  1Q1H A;  4EM1 A;  4ZH4 F;  4ENM A;  4KNY A;  1XMK A;  4B8X A;  4HQM A;  2DQR A;  1XGM A;  3WTU C;  1O7L A;  5HOO A;  4KDP A;  4PGG A;  1ZLJ A;  1P4W A;  3LWF A;  3REO A;  1G6N A;  4IHS A;  4OIP F;  5HS7 A;  3HSE A;  4WX9 A;  1U2W A;  3K1M A;  3GW2 A;  2HGC A;  3CO7 C;  3MZH A;  2FBI A;  1Z91 A;  2FE3 A;  3KP7 A;  1TQI A;  3DEU A;  1FYK A;  6PAX A;  1V3F A;  5CYV A;  2QEN A;  5D6F A;  4P9U A;  1ZRC A;  3GFI A;  1LEA A;  3IHU A;  3F8M A;  2COM A;  1MJA A;  1ULY A;  3SZP A;  4LLL A;  4IRH A;  3T8R A;  3FX3 A;  3FM3 A;  1R1V A;  4P5O A;  4GO1 A;  1YW7 A;  4P96 A;  5D5X B;  5L3F A;  4KUM A;  4ZYG A;  4RGR A;  3HRM A;  2A07 F;  4N9I A;  4RB0 A;  3OOP A;  3NQO A;  4RAZ A;  2MH9 A;  4YII A;  4KIC A;  4YFK F;  4A0Y A;  1BC8 C;  4UNO A;  3R0A A;  4OIO F;  2RDP A;  2M5W A;  5TRD A;  1HKS A;  1XN7 A;  1U78 A;  3IWZ A;  2O8X A;  1QZY A;  2FRH A;  3ZMV A;  1XCV A;  4AWX B;  2H94 A;  2EFO A;  2HKO A;  4UV9 A;  2IA2 A;  3J80 Z;  3I59 B;  2JPC A;  1KU2 A;  3JAM Z;  3W6J B;  3V7C A;  1ZRF A;  1HQC A;  1R58 A;  1PDN C;  4U0V A;  5HLI A;  3KEQ A;  1P4A A;  1XSX A;  3V8K A;  4G9Y A;  1IN4 A;  5CVV A;  2CWE A;  2QM3 A;  3FMQ A;  5L3C A;  3WU1 B;  2P7V B;  5J8F A;  4GYG A;  5TJJ A;  2XGX A;  2FML A;  4L9N A;  2UXN A;  1XCB A;  2ZME B;  1R5H A;  5ERI A;  4NHJ A;  3GFL A;  4G6Q A;  3B73 A;  4M72 A;  1FP2 A;  2ETH A;  1EH7 A;  5K5R A;  1FC3 A;  1QO0 D;  1IXS B;  4XSX F;  2BE5 F;  2YSR A;  2ELH A;  3BJ6 A;  4KN4 X;  1H9G A;  2E7X A;  1F1Z A;  4IXA A;  3AAF A;  1ZG3 A;  1ZAO A;  4Q4Z F;  2VOP A;  5JR3 A;  3GYH X;  1LNW A;  3V8J A;  3DQV C;  1UB9 A;  2XV4 S;  2RN7 A;  3HOT A;  5ICF A;  3BOQ A;  1ZHF A;  4MTE A;  5HLG A;  3E5X A;  1UHM A;  1SMT A;  3I58 A;  4IPA A;  1BN5 A;  3T5X A;  2Y48 A;  2ZBK A;  3FXU A;  2OBP A;  1FWZ A;  4U7D A;  3V8L A;  1XSD A;  4FHT A;  3PQK A;  4A6E A;  1BJA A;  3O6B B;  2P8T A;  5DEQ A;  3HSR A;  1T39 A;  2DU9 A;  2D2W A;  2K27 A;  4Y15 A;  5E17 F;  3J81 K;  2RNJ A;  3ZN0 A;  2LKP A;  5F6F A;  3KP2 A;  2QZ8 A;  2GA2 A;  1FLI A;  3U1D A;  2E7W A;  3BPV A;  2DK5 A;  2V79 A;  1T0F A;  5FD6 A;  3HUG A;  1K79 A;  1R36 A;  3I64 A;  3HRU A;  2KRF A;  2DO7 A;  3WTX C;  4LG0 B;  1ZLK A;  1ZRE A;  4RGX A;  4LLG F;  2ESN A;  4IVN A;  1KU3 A;  2AS5 F;  4BQA A;  5AIQ A;  3R4K A;  4EGZ A;  2H09 A;  1QPM A;  3BWG A;  4Q48 A;  3ROU A;  2XIG A;  3TDZ C;  2MBF A;  1TNS A;  3E97 A;  3WTT C;  3IRQ A;  4A5M A;  3K69 A;  2OZU A;  2HQN A;  3FMR A;  2YX4 A;  2XAS A;  3R60 A;  3KP4 A;  1ZGJ A;  3HRT A;  2V6C A;  4OIQ F;  1MGT A;  1XDU A;  2NNN A;  1DP7 P;  3IC7 A;  4QLC U;  2H6B A;  2M87 A;  1XD7 A;  1FP1 D;  3QRF F;  4CGZ A;  3BZ6 A;  3GF2 A;  3M7G A;  1USS A;  1WRJ A;  4XSZ F;  1O3Q A;  1QGP A;  2K4B A;  3QPH A;  2VBZ A;  1QBJ A;  1WSU A;  5DCF A;  5L3D A;  5HDN A;  4I98 B;  5DD4 A;  1F5T A;  4LK1 F;  1X3U A;  1XGO A;  4CZZ A;  4EJV A;  2BEO A;  4LLN A;  4RS8 A;  2DI3 A;  2L4A A;  2F5E A;  1C0W A;  3KZZ A;  5HS9 A;  2RV8 A;  2PJP A;  2JT1 A;  2B0L A;  1KU9 A;  5L3E A;  5LHI A;  2K02 A;  5K1Y A;  1U3E M;  3RYR A;  1LB2 A;  1ONV A;  3VEP A;  2DQL A;  1B9M A;  3ELK A;  3CUQ B;  4GCV A;  5ICC A;  1HW2 A;  3G3Z A;  3HRS A;  4H0E A;  1DDN A;  1TW3 A;  3CUQ C;  4OIR F;  4JK1 X;  2DBB A;  1FYM A;  3L09 A;  4EJO A;  3P9K A;  3G73 A;  4M74 A;  3IRR A;  2O61 A;  2HYG D;  1FNN A;  1ZG5 A;  2X0L A;  2P4W A;  3FWE A;  3GFJ A;  1BIA A;  3L2C A;  1XMA A;  1KQ9 A;  4WXH A;  5J6X A;  1SFE A;  1CF7 A;  2RVC A;  3LST A;  4FX4 A;  1K6O A;  2VBW A;  3LQQ A;  3C7J A;  2NYX A;  4Q5S F;  4M71 A;  1W4M A;  3F6O A;  2FEZ A;  2PG4 A;  4KIF A;  2LSO A;  1YS6 A;  2DPD A;  1R23 A;  1WWX A;  4WK8 F;  5HS8 A;  4KN7 X;  4ON0 A;  4ENJ A;  2GIV A;  2M8E A;  2ZKZ A;  3FHZ A;  3P9I A;  5CVR A;  2V1U A;  5IT9 Z;  2YPR A;  2VBY A;  5AON A;  5HLH A;  1TBX A;  4CYD A;  4LD5 A;  2GA1 A;  2ACJ A;  3BRO A;  1Z9C A;  4OIN F;  2KKO A;  3HTU A;  4IRG A;  1K78 B;  2IW5 A;  2QYO A;  3Q9S A;  4M9Z A;  1FPQ A;  1PUE E;  5FD5 A;  5LEJ A;  1B4A A;  1U5T C;  2FOK A;  2ZXJ A;  4BHP A;  4LGW A;  4HV5 A;  3F8N A;  1IN5 A;  2XAH A;  4MEX F;  1LJ9 A;  4RB3 C;  1OR7 A;  3MCZ A;  4LMY A;  2HTJ A;  2W84 A;  2F5F A;  2OU2 A;  2A68 F;  1FY7 A;  4MQV A;  4N0B A;  1KGS A;  1E2X A;  5E8I A;  2J5P A;  2F2E A;  2YX7 A;  3TO9 A;  3SZT A;  2KIM A;  3R0J A;  3TQN A;  1SFX A;  4EV0 A;  2VBX A;  5D5U B;  3CDH A;  3WTZ A;  3J80 K;  3SHF A;  3VOE A;  3L9F A;  2UZK A;  3ZQ7 A;  1SD4 A;  3H92 A;  4LJZ F;  3DXJ F;  1D5V A;  5JVT A;  3JAM K;  4IJA A;  2V9V A;  5LGN A;  1ON2 A;  2VON A;  4I09 A;  3TO6 A;  2DW4 A;  2KJB A;  5E1X A;  4UVA A;  2W25 A;  4HLX A;  1PP7 U;  4EM2 A;  1CF7 B;  1D8J A;  5IT3 A;  2ZNZ A;  5LBQ A;  2ZME A;  4KIG A;  2F5D A;  2GWR A;  3OV8 A;  5E1W A;  4A6D A;  4I0B A;  3EQL F;  1T2K A;  1Z05 A;  2XHK A;  4OOI A;  1HKQ A;  4HX7 A;  2FMY A;  2Q2E A;  3QP5 A;  3M8F A;  3KEO A;  2QQA A;  2ZJ2 A;  1GXP A;  4EQQ A;  2FBK A;  2PLY A;  3VFZ A;  2CFX A;  2LF7 A;  2EV0 A;  4KYW A;  4XLN F;  3GUD A;  3KE2 A;  4AIJ A;  5D8L B;  2QUF A;  3F6V A;  3N97 A;  5HDK A;  2PMU A;  4IRI A;  2NNY A;  1YG2 A;  1NHA A;  2K4J A;  4MEY F;  1BC7 C;  5CVJ A;  3O3K A;  3KP3 A;  5L3G A;  3ML6 A;  4M6Y A;  1IW7 F;  3V7R A;  5BPI A;  3KLN A;  3D5L A;  2ZCW A;  4L0Z B;  2BV6 A;  5LHH A;  5D4S A;  2XVC A;  4R1H A;  4MNU A;  4U0Y A;  3ERE D;  1HSJ A;  2FSW A;  1LEB A;  2QQ9 A;  5F1R A;  2QBY B;  3RTR A;  2E1N A;  4CHU A;  5ED4 A;  2MC3 A;  2VC1 A;  5FGM A;  1MKM A;  5J8C A;  3TKY A;  4LFU A;  3ZMU A;  3R6S A;  3FF5 A;  3RDI A;  1L0O C;  3WTV C;  2Z3Y A;  4PGH A;  4HA8 A;  1JGS A;  3B02 A;  3QOP A;  2EA4 A;  2ISY A;  2M30 A;  4U7B A;  3E5U A;  1Y0U A;  3WU0 A;  1ZYR F;  4P55 A;  1REP C;  2FXA A;  3LAP A;  2VOO A;  3WOD F;  1UFM A;  4I7H A;  4GXO A;  4LG0 A;  3O2P E;  2NRA C;  4KIB A;  1OYW A;  1R7J A;  1FBQ A;  1IRG A;  3RPQ A;  4G7H F;  2RQP A;  4FX0 A;  2W24 A;  4KMU X;  2VT2 A;  2HFH A;  1BIB A;  5HDG A;  5JFR A;  5F64 A;  4EJT A;  1F4K A;  1Z6T A;  3F8B A;  2HR3 A;  3HTS B;  1T6S A;  2HKX A;  4AIH A;  1FBU A;  2DT5 A;  2HYF A;  1W5T A;  1YIO A;  3K2Z A;  1B6A A;  2R7F A;  4TV7 A;  4UV8 A;  3JW4 A;  1J59 A;  5CLS A;  2A69 F;  2Z5U A;  3C3W A;  2EB7 A;  4HDU A;  2D1V A;  5BS6 A;  2HEO A;  4R8H A;  2F5C A;  1BI1 A;  3MZY A;  4M9S A;  1B59 A;  4CIC A;  1T38 A;  1K7A A;  2CW0 F;  2JPB A;  4G7O F;  5BOX A;  2UXX A;  2OA4 A;  3GWZ A;  4HQE A;  2EFP A;  2K86 A;  1BOA A;  2L54 A;  4ENN A;  3H3U A;  2MA3 A;  3RJP A;  4UVB A;  3U9G A;  3RI4 A;  2XKO A;  1YO5 C;  1RNL A;  1B9N A;  3MAJ A;  1XDS A;  4HDV A;  5CVI A;  2FNA A;  3E6C C;  2V1D A;  3E5Q A;  4GYI A;  4M9X A;  2L01 A;  3V7S A;  2G7U A;  3CUQ A;  1R1U A;  2HDC A;  4KMF A;  2Z9O A;  2K7L A;  2OZ6 A;  1KA8 A;  4P9F A;  3NEU A;  3J7A O;  2ZFW A;  3FZV A;  2EV6 A;  4HX4 A;  3SFZ A;  2KIF A;  4M73 A;  2R3S A;  3JSO A;  2PBI A;  3WGH A;  1J2X A;  3VB2 A;  4XLP F;  3WE2 A;  3W6K B;  2PN6 A;  5ILU A;  2O0Y A;  4BHC A;  4HF0 A;  5D6E A;  5LEK A;  3C18 A;  4EMS A;  1BI3 A;  2C6Y A;  3L7W A;  2QWW A;  2BYV E;  2OD5 A;  2L02 A;  1P6R A;  2WV0 A;  2YR2 A;  3WTS C;  3MQ0 A;  3DKW A;  3F21 A;  5LHG A;  3TGN A;  2Y0M A;  3FXR A;  3WTY C;  3LA7 A;  1H9T A;  1IN6 A;  4N9H A;  1U5T A;  1I1S A;  4S04 A;  5ICE A;  2CSO A;  1HKT A;  4AD9 A;  1K78 A;  2ESH A;  4G8X A;  4A0X A;  5IT9 K;  1HW5 A;  3EYY A;  2DTR A;  2G9W A;  1DPR A;  5DCM B;  1RIO H;  1LDD A;  2X4H A;  1IXC A;  4A12 A;  2HWV A;  1KYZ A;  2P6T A;  4Y17 A;  5LGU A;  2LF8 A;  2A3S A;  5CJ9 A;  5H6Q A;  4WF2 A;  1MJB A;  1XSV A;  1J7K A;  1SMY F;  4D0P A;  2STW A;  5LGT A;  5BQT A;  5JI6 A;  3EET A;  4OMZ A;  2IT0 A;  1TQP A;  2DAO A;  3S2W A;  3E6B A;  1TQM A;  2VN2 A;  4L9T A;  1SD7 A;  1I5Z A;  1YFH A;  4HLY A;  2Y75 A;  2IVM A;  4EVI A;  2CYY A;  1ZG1 A;  4CO8 A;  4L5I A;  3TOB A;  1IAW A;  4MQ9 F;  3PFI A;  4NQW A;  2XUB A;  2EFW A;  1ZRD A;  5L3B A;  5KVR A;  1SFU A;  3TOA A;  3MFK A;  4BYY A;  4MGR A;  2IPQ X;  2L4M A;  1ZAR A;  1YW9 A;  3V4G A;  2GQQ A;  3RPU A;  2EK5 A;  1O3T A;  3F22 A;  2PI0 A;  2EV5 A;  3GX4 X;  5FB2 A;  1YW8 A;  3P7N A;  1IN8 A;  1J0R A; 
#chains in the Genus database with same CATH topology
 3FXQ A;  4HAM A;  1CGP A;  1ON1 A;  2EFQ A;  4UXN A;  5B1B H;  5IYC J;  1XGS A;  2EA2 A;  3I4M J;  3ABU A;  3QYE A;  1QNT A;  4BDZ A;  1HBX G;  4CXF A;  2RKH A;  2CW7 A;  5JHF A;  1IUY A;  2LC2 A;  1FOW A;  1V4R A;  2A6E F;  2HOE A;  4IL6 C;  4L0Y B;  3PJR A;  2V1X A;  4L5J A;  4BKX A;  4DYQ A;  1GHC A;  1BI0 A;  4UUS A;  1SD6 A;  1U5T B;  5EEG A;  3RIR A;  3K9T A;  3MWM A;  2NVU B;  2XAJ A;  5FRM A;  2Q8K A;  2E1C A;  2X51 A;  1S6L A;  4J19 A;  4I02 A;  4V2F A;  1IF1 A;  4EJU A;  1WPK A;  2L9V A;  4EM0 B;  3CLO A;  3BQY A;  3EYI A;  1P9Q C;  4RGU A;  3RQ4 A;  2KT0 A;  2VB6 A;  3P5J A;  4A3G J;  2P0W A;  3MEX A;  2BY3 A;  4I01 A;  5CPR B;  1MDM B;  3H9G A;  3PIO F;  2A6H F;  4L9J A;  3GEZ A;  4UUV A;  3S3N A;  1S5L C;  4WCG A;  3H5R A;  1MMG A;  3TDU C;  3JRE A;  3K1P A;  2KHM A;  3GO5 A;  2IBD A;  3QPT A;  2EZH A;  3BTL A;  3J7A Y;  2R7Z J;  3BY6 A;  1VF9 A;  4HYE A;  4S05 A;  2OAZ A;  2R5Z A;  5D5V B;  3AL0 B;  4PJN A;  3WG7 H;  4CYC A;  2QBY A;  1Z21 A;  4QTR A;  2GAU A;  1I27 A;  1HST A;  4LK0 F;  3BPX A;  3MKZ A;  3L2W A;  3Q0U A;  2DMP A;  3OYI A;  3V42 A;  3H36 A;  3AL0 C;  2OJE D;  3K0L A;  3IUO A;  2KLO A;  2LRE A;  4B09 A;  1FSH A;  4DZJ A;  2FU4 A;  4OU0 A;  1GV5 A;  4BNC A;  3L2U A;  3BJA A;  3IV5 A;  4LIT A;  5E3N A;  4A0Z A;  2P6S A;  2O3F A;  3SXY A;  2E34 A;  1S29 A;  1MJ9 A;  1I1G A;  1U6G A;  1N75 A;  4ZJZ A;  2DOA A;  2QQB A;  3K70 C;  2ID3 A;  1RR7 A;  4XKB A;  2AXL A;  1PVE A;  1HA8 A;  4A2U A;  2RAE A;  5C4X J;  2H27 A;  5H20 A;  1VQL I;  1H0M A;  1XX5 A;  2XPW A;  2X1C A;  5DYM A;  4HOB A;  3ZMD A;  4BJ5 C;  2KJC A;  2A61 A;  1U9N A;  4E70 A;  3KP5 A;  3ISP A;  5F04 A;  1TT0 A;  2NAZ A;  5ILS A;  4A3B J;  2MLK A;  5H2F C;  2CO5 A;  2OTJ I;  3WGG A;  5EZG A;  2O6G E;  1WQ2 A;  1UG2 A;  3L2Q A;  1S7O A;  1UZC A;  4PK4 A;  1RUN A;  4A3F J;  1OPC A;  3FIW A;  2F4M B;  3KCC A;  4M3F A;  5DTD A;  4E4H A;  3DWL E;  3QAH A;  5DDG A;  2LDU A;  2IRF G;  1R6R A;  4ZZL A;  4LB5 A;  1I6H J;  1AA7 A;  3HBL A;  3BZK A;  2Q0O A;  2WWY A;  2ELJ A;  2P5V A;  1YLF A;  2PFB A;  2K9N A;  2M8G X;  2B7E A;  3CMY A;  2V9P A;  1T08 B;  3A0B C;  2OQR A;  1A04 A;  2JUG A;  2XKP A;  4PJJ A;  4FT8 A;  3NAU A;  3A0H C;  4ESJ A;  1KU7 A;  3GTJ J;  4E7L A;  1X58 A;  4HV6 A;  4A3L J;  2A5W A;  5EEH A;  3T0Y A;  2D45 A;  1EV7 A;  1FZP B;  1J5Y A;  2A5Y B;  3PO3 J;  2R7X A;  1D3Y A;  3S8P A;  4ZTJ A;  4BHB A;  3OYB A;  1J9I A;  4HNT A;  1YS7 A;  1NK2 P;  4PDK A;  1YTY A;  2E1M B;  4LIU A;  1JKQ C;  2CFO A;  4IZZ A;  2ECB A;  4UUS B;  5A2Q Z;  5AIP A;  1OYI A;  1P4X A;  1FJL A;  4Y13 A;  5JHU A;  3IL2 A;  4RAY A;  4II2 A;  2HQR A;  3U21 A;  2E1M C;  3WGI A;  5LRR A;  4AVP A;  5F27 A;  2DFI A;  2K40 A;  1TW2 A;  3OR1 C;  3E6D A;  1DGR M;  1ETQ A;  4XL9 A;  5E18 F;  2F4I A;  3K1N A;  2LMD A;  2L7Z A;  1W7P D;  1X1A A;  3TO7 A;  1R00 A;  3K70 D;  1JE8 A;  3ABT A;  1VQ4 I;  4XOR A;  4G6D A;  3DPT A;  3GLX A;  4A5N A;  1NTC A;  5HLT A;  4MHG A;  3HSF A;  4B47 A;  1SVM A;  2HDW A;  1OCZ H;  2AO9 A;  1G4D A;  4WXC A;  1JHF A;  2LKS A;  4EAT A;  1YYV A;  1E17 A;  1QVT A;  2ICW G;  1SVL A;  4IHT A;  3HKZ A;  3P9C A;  1ODD A;  1TP4 A;  3LFK A;  1QZZ A;  3K7A J;  5KAI C;  2CG4 A;  2NOG A;  2GOX B;  3F3X A;  1SAX A;  2DDA A;  4F52 A;  1FIP A;  1J75 A;  1LDK B;  2K5C A;  2KPM A;  5FLX K;  3RKW A;  3JTH A;  1IZ1 A;  3AKZ A;  1P92 A;  3CP2 A;  1ETX A;  3E3V A;  4PJL A;  1Y8R B;  1JHH A;  2FF4 A;  2YU3 A;  3BZC A;  4DZP A;  4MO7 A;  1T95 A;  1SD5 A;  2FBH A;  4D1Q A;  3HHH A;  3MN2 A;  2R4G A;  4IHY A;  4CCL A;  2IS4 A;  1GVD A;  2PX9 A;  2BHY A;  4BBS J;  3IKT A;  2UWM A;  5D8K B;  3CUO A;  3CCQ I;  3KP6 A;  5B5E C;  1UHW A;  4KFC A;  2W57 A;  2GOM A;  1U8B A;  5FFX A;  1ETO A;  4BXU A;  5GAH J;  1MH4 A;  1TWF J;  2ZC2 A;  3FXL A;  2CQQ A;  3NRV A;  3CJT B;  1Z0X A;  4D9J A;  2HOT A;  5B1A H;  4HF2 A;  2IEK A;  2CGP A;  3BC8 A;  1GVJ A;  4QWQ A;  4HF1 A;  2M1B A;  3LAJ A;  4JQF A;  2VQG A;  1OKR A;  4K2E A;  1L3L A;  2JUC A;  4HBL A;  3PSI A;  2NS0 A;  3TP0 A;  2Z99 A;  3BG9 A;  3DF8 A;  2XRN A;  4NB5 A;  2QA4 I;  5D4R A;  4ZDL A;  3L2V A;  2HDD A;  2LY2 A;  2RGV A;  4GDF A;  4PZJ A;  1G3W A;  1EH8 A;  1VQM I;  1Z6R A;  1LVA A;  3LA3 A;  5HNF A;  4KJZ A;  2V7F A;  1RUO A;  4RAG A;  2HZT A;  4ZZD A;  1WJC A;  3LNQ A;  3D5R C;  2H6C A;  1LFB A;  2EH3 A;  4GGG A;  4O6J A;  4YG2 F;  4CCK A;  1B1B A;  4ASN A;  1WGX A;  5KHD A;  2QSF X;  3IH4 A;  4D7N A;  2VQL A;  4QSH A;  2P5L C;  1APL C;  2XAG A;  1DUX C;  4G7Z F;  4HZF A;  4ESF A;  4J01 A;  3T1B A;  4XN0 A;  5FLV A;  1VQO I;  2O5R A;  2ZJQ F;  3TL4 X;  4JYK A;  4F7Z A;  3PO2 J;  1MMD A;  2Z2S B;  5E20 A;  4XIC A;  3F72 A;  2BY2 A;  2EZK A;  1MD0 A;  3EUH A;  4E7J A;  1KQ0 A;  1QQI A;  3Q9V A;  1FBS A;  1ZTR A;  5EJC A;  3I4P A;  3BTJ A;  3JR9 A;  3LA2 A;  4LB6 B;  3ZQQ A;  4ZDO A;  1JKR C;  3HIF A;  3DKY A;  4X1E A;  3NAR A;  2FD5 A;  3CC7 I;  5FLM J;  1OLT A;  4C2T A;  3GXO A;  2ZO4 A;  4B48 A;  3GTO J;  2ID6 A;  4D7M A;  3RQI A;  1LQ1 A;  1MNM C;  3ECH A;  1IN7 A;  2FA5 A;  3QOE A;  4L18 B;  1U8R A;  2XAF A;  3KZI C;  1EKE A;  5EYR A;  3N05 A;  4PJ0 C;  3ULQ B;  4U87 A;  5FLX Z;  4FE4 A;  1WKM A;  4YEL A;  3VOD A;  3S14 J;  4QPQ A;  2LY1 A;  3GFM A;  4KT6 A;  2WB1 A;  1MZB A;  2X6Y A;  2MD5 A;  1UJ8 A;  2FQ3 A;  1RZ4 A;  5DCM A;  1XG1 A;  5IYD J;  3J7Y J;  1LDJ A;  3M8E A;  3EUK L;  3LSJ A;  1JJ8 C;  3IAM 2;  2WBM A;  3HGY A;  1OMI A;  1R5G A;  1UEL B;  1UHS A;  1W1W E;  2BXY A;  4UB6 C;  5GTH C;  5DM7 F;  1U9O A;  2EPF A;  2PMH A;  2BGC A;  1EH6 A;  4R79 A;  2Z33 A;  4IF4 A;  2DLL A;  1ZH5 A;  2QKL B;  3HYI A;  3QU3 A;  4UB8 C;  3OIO A;  2QGU A;  2A05 A;  1R4N B;  3BR5 A;  3RYP A;  2Z1D A;  3CTA A;  4MFE A;  4JP0 A;  2WB1 N;  1G3Y A;  4N4N B;  1HDD C;  3FMS A;  4IO9 F;  2RC4 A;  5FJ8 J;  1R1T A;  4FCY A;  3KLO A;  2CQN A;  5EF6 A;  3C1D A;  3WTW C;  3BLY A;  2VE8 A;  4DNC A;  5LRS A;  4F92 B;  3GZ5 A;  3N4M A;  1TWC J;  4HX8 A;  4ENK A;  2HQ5 A;  3M9A A;  2XAQ A;  3DFG A;  3QYF A;  3JSP A;  3R61 A;  1G3S A;  4BJ6 C;  1EF4 A;  5EGO A;  4BQN A;  3LSP A;  3HOZ J;  2ADU A;  3ZMZ A;  5D5W B;  5BMZ A;  2ISZ A;  2EWN A;  4EGY A;  3CDL A;  2P7C B;  2J5O A;  4OAY A;  2IA1 A;  4BAY A;  1S3J A;  2L9N A;  2ZFU A;  3IP4 B;  5J40 A;  3SDG A;  5E3O A;  2TCT A;  4YIF A;  1TLH B;  2ZSH B;  4HW0 A;  1KYW A;  3QYB A;  4E7Z A;  2GXA A;  5J1R A;  2CV0 A;  1KQ8 A;  3JTG A;  2DK8 A;  1O7F A;  1F9N A;  3CMA I;  1YQA A;  2HPI A;  2R7Q A;  1YIJ I;  5GTI C;  4JBA A;  2MH2 A;  3BJO A;  4H4K C;  2GZW A;  3DCF A;  2XSD C;  2DDB A;  3BG7 A;  3CCV I;  2E5N A;  2R7D A;  1UST A;  2BW3 B;  4O5V A;  4DBQ A;  2W85 A;  2CW8 A;  2KIU A;  2EJR A;  2ZNY A;  1WHU A;  3IH3 A;  2TDX A;  2HTS A;  2QLZ A;  1O3R A;  3O8G A;  1WI9 A;  2M45 A;  2QEX I;  2L3D A;  4ETS A;  3ZP5 A;  3MD2 A;  3LOC A;  3I71 A;  2VKV A;  1E3P A;  1E3H A;  2IJL A;  2EFN A;  1HXD A;  3L2R A;  1VTN C;  3SQN A;  1X3Z B;  3ABM H;  2LVS A;  3TW6 A;  3OYH A;  2DT7 B;  3GME A;  4I2O A;  1IRF A;  4I6Z A;  5K5Q A;  2MD0 A;  3I54 A;  1GUU A;  3GBG A;  1F36 A;  1HW1 A;  4PFP A;  4E7I A;  4BQQ A;  1IO2 A;  2HYJ A;  4OMY A;  3QU6 A;  2CH0 A;  3KZY A;  3G6E I;  4DQ2 A;  2E1O A;  1I6X A;  2L7M P;  5K5O A;  1TTY A;  4UHT A;  2HS5 A;  4YFX F;  5JLX A;  3CF2 A;  2OCC H;  3ZXS A;  2LP0 A;  1BW5 A;  3TW7 A;  3IWF A;  2V26 A;  2F6C A;  1FX7 A;  3OYC A;  3CC2 I;  2VT3 A;  2G0E A;  4M6X A;  1S8N A;  1XB4 A;  2K3P A;  3QP6 A;  5KAF C;  3CJR B;  2DPU A;  4D5C A;  1FT9 A;  3OIP A;  5E79 C;  2BY0 A;  4YFN F;  2BVM A;  3ZN1 A;  2GXB A;  1EA3 A;  1MDM A;  4BQO A;  1RPW A;  2P81 A;  3DTK A;  3ESW B;  2BBY A;  3U2R A;  1H8A C;  1X19 A;  1QA6 A;  4I0A A;  3K6G A;  1GXQ A;  2W00 A;  1QHG A;  3GTK J;  2PEX A;  5DUK A;  2DFF A;  5FFZ A;  1FOK A;  2EBI A;  1AOY A;  3MKW B;  2PQ8 A;  1G3T A;  3CCU I;  1R49 A;  3HHG A;  2JZY A;  3DLA A;  4AIK A;  2DA6 A;  3J81 Z;  3QWL A;  5ICG A;  3I53 A;  5KK1 A;  1O3S A;  4XLE A;  3HOS A;  1HDP A;  1IV6 A;  1FYL A;  1QU3 A;  3BR6 A;  5EDN A;  4F93 B;  2H8W A;  4ZYH A;  5BPD A;  1LVK A;  3RKY A;  1PYV A;  4RGS A;  1UCR A;  2HNH A;  5LLQ A;  2VE9 A;  3MVP A;  3SDB A;  2OTL I;  2QSH X;  3X2Q H;  1SFK A;  1BR2 A;  4BH9 A;  1OYY A;  4O3M A;  5E1Z B;  1W7P A;  1Z1D A;  4BL0 B;  2IA0 A;  3ZMT A;  2QVO A;  1H89 C;  1E0E A;  3LSH A;  3MZ8 A;  3J7Z I;  1IDY A;  3RZD J;  3KYD B;  1R22 A;  4WXD A;  3G2B A;  3JRC A;  4E7S A;  1P2F A;  3DEW A;  2WC2 A;  3G1L A;  2VOD A;  3RSN A;  4GFB A;  2HPM A;  3QPL A;  1FMV A;  2R93 J;  3F9K A;  2XRO A;  3HL2 A;  4ZYE A;  2D1H A;  4IQ4 A;  3F23 A;  1BBY A;  5K7H A;  3I55 I;  1HOM A;  2WY8 Q;  2VI6 A;  2WTE A;  2VXD A;  2W82 A;  3B6C A;  2DMQ A;  3BDD A;  4ABZ A;  4CSW A;  4UVC A;  2W48 A;  4BBR J;  2JTV A;  3M8J A;  3F8C A;  1XS9 A;  4PCQ A;  4B43 A;  1I39 A;  2GXG A;  5FO5 A;  1Y6I A;  4L9V A;  3WE3 A;  3GZ6 A;  5FKN A;  3KEY A;  2O03 A;  1TWG J;  4HSR A;  1D8K A;  1O57 A;  3PUB A;  4KA4 A;  1JUS A;  3DBH B;  3DBL B;  2ZJR F;  3ZMS A;  3ZPL A;  3JRD A;  2JA8 J;  1SEU A;  2WAQ A;  5DD8 A;  4LG3 A;  3I5U A;  3FXJ A;  1BM9 A;  3OWT A;  3BP8 A;  1FTT A;  3AG3 H;  4EJW A;  2P5K A;  3KFW X;  1ZEL A;  2IP2 A;  3GVA A;  4ZYA A;  3H1C A;  2H8R A;  5DUI A;  3F8F A;  3LQR A;  3PQJ A;  1ZN2 A;  2COB A;  4WWC A;  5IP7 J;  3ABK H;  2VXZ A;  4BUP A;  4MFD A;  3S16 J;  5DV5 A;  3Q5F A;  4KT5 C;  3OMY A;  4XKV A;  1AWC A;  3EDP A;  2XGE A;  3E6M A;  4Z2Y A;  1STZ A;  4U88 A;  2STT A;  2G7H A;  2BY1 A;  3DPL C;  3LMM A;  4RB1 A;  1JT0 A;  1RRJ A;  4RB2 C;  4XRF A;  2UV1 A;  2H1K A;  4GRI A;  4IEJ A;  4BGD A;  1IRZ A;  3MKY B;  3D1N I;  4XLH A;  2XF6 A;  1JXS A;  1Z7U A;  5H6R A;  4ZTF A;  1XPX A;  4CDG A;  2XB0 X;  1RI7 A;  3FM5 A;  1Y0N A;  5A2Q K;  2NVX J;  1B8I A;  1T56 A;  4XLA A;  2VJ4 A;  3WG9 A;  4Q47 A;  1XGN A;  4B1R A;  5BNG A;  1OJL A;  1Z67 A;  3DV8 A;  2MFZ A;  1T98 A;  3RKX A;  2DA1 A;  2OQG A;  1ZGA A;  1K4T A;  2HZD A;  4CA0 A;  2LNB A;  4XBF A;  3CO6 C;  3IKV A;  3H3Z A;  1DPU A;  3ECO A;  1PUF B;  3VDX A;  3OYL A;  3L00 A;  2DFH A;  4ESB A;  2JSP A;  2JSC A;  2FNP A;  2HOA A;  1S7A A;  3T8T A;  5GAD J;  5FKM A;  3LSM A;  3NWT A;  2W7N A;  2JRT A;  4G94 A;  3SFI A;  2XGD A;  4XRS A;  1V5G A;  5E8G A;  3DP7 A;  1JGG A;  1VND A;  2HQA A;  4XID A;  3ZQI A;  2KRH A;  4FQG A;  3M1E A;  1W7P B;  3OYA A;  4ZC3 A;  2FQ4 A;  4RMN A;  1YOV B;  5CVU A;  1R9T J;  2FX0 A;  4P1W A;  2MLG A;  3CJN A;  3HM5 A;  3KET A;  4U0W A;  4D5F A;  1Y1W J;  5GAG J;  4YEJ A;  2LRD A;  2DYS H;  1ITY A;  2GLO A;  2V6E A;  1FSE A;  2CQK A;  1BI2 A;  5ILV A;  4OWR B;  2VC0 A;  3OYD A;  3COA C;  4A3M J;  1TNT A;  5HVQ C;  3D0S A;  3I0T A;  2IXS A;  4ZYD A;  4MTD A;  1W5S A;  1AKH B;  1MND A;  2DOE A;  1PP8 F;  3I59 A;  1IXR C;  2AHQ A;  1Q1H A;  2CMP A;  2VAS A;  4W1U A;  4EM1 A;  5EZH A;  4ZH4 F;  4ENM A;  1R4M B;  4KNY A;  1XMK A;  4B8X A;  1Z3Y A;  2NS7 A;  4PSX A;  4HQM A;  3I9V 2;  2IAI A;  1WI3 A;  2LYC A;  2DQR A;  1XGM A;  3WTU C;  1O7L A;  5HOO A;  4DYC A;  4PGG A;  4KDP A;  1ZLJ A;  1P4W A;  3LWF A;  3REO A;  1G6N A;  4IHS A;  3TMO A;  2L9S A;  4OIP F;  5HS7 A;  1IUF A;  3MMY B;  2ME0 A;  3HSE A;  2DMT A;  1Y8Q B;  2R7T A;  4WX9 A;  1U2W A;  3K1M A;  3BT9 A;  3GW2 A;  2Y9Y A;  1BJZ A;  2HGC A;  3CO7 C;  3MZH A;  3ZOB A;  2DMN A;  1DQU A;  3A4C A;  2FBI A;  3DU5 A;  1Z91 A;  2FE3 A;  3KP7 A;  1HLV A;  2X1D A;  1TQI A;  2IGM A;  3CDI A;  3DEU A;  1A36 A;  2MGQ A;  1FYK A;  2M4G A;  2X85 A;  6PAX A;  1V3F A;  4CUG A;  5CYV A;  2M0C A;  2QEN A;  3EPZ A;  1I3Q J;  5D6F A;  3ZRG A;  2H1L A;  2PMZ A;  4P9U A;  1ZRC A;  3GFI A;  1V5F A;  2DA3 A;  1LEA A;  3PSF A;  3IHU A;  3F8M A;  2COM A;  3JRF A;  3CCS I;  1MJA A;  2MG4 A;  1YE9 A;  2K9S A;  1VZ0 A;  1ULY A;  3SZP A;  1ENH A;  4LLL A;  4IRH A;  3T8R A;  4DYR A;  2VUM J;  3FX3 A;  1B8I B;  3FM3 A;  3H9Q A;  1R1V A;  2DFE A;  1IDZ A;  1YRN B;  2LTP A;  1MMA A;  1OCO H;  4P5O A;  3M1C A;  4S0H B;  4GO1 A;  5CKT A;  1YW7 A;  3SYT A;  4P96 A;  5D5X B;  1IG7 A;  4PJM A;  5L3F A;  2R5Y A;  3G1M A;  1QZE A;  2BHZ A;  2LFB A;  2XF5 A;  4KUM A;  4ZYG A;  3S2D J;  4RGR A;  3HRM A;  2A07 F;  4N9I A;  1RC9 A;  4RB0 A;  3OOP A;  4XON A;  4I99 C;  3RKQ A;  3CP8 A;  3NQO A;  4RAZ A;  1YJW I;  2LR8 A;  2MH9 A;  3H5A A;  2KIQ A;  4YII A;  4KIC A;  4YFK F;  3K4M A;  1S72 I;  4A0Y A;  4XKW A;  1Z3X A;  4HNU A;  1BC8 C;  4UNO A;  3R0A A;  4DBR A;  1ETW A;  2VJJ A;  3CJQ B;  4OIO F;  2RDP A;  5HNH A;  4CCJ A;  3O8H A;  3VSL A;  2M5W A;  2HI3 A;  2VJ5 A;  5TRD A;  3HKZ N;  2IS2 A;  4XRS G;  1HKS A;  1XN7 A;  3K4J A;  1U78 A;  4CCM A;  3IWZ A;  2O8X A;  1QZY A;  2FRH A;  3ZMV A;  1XCV A;  4AWX B;  1OR7 C;  2H94 A;  4I76 A;  4A3C J;  1MH3 A;  2EFO A;  2HKO A;  1Y39 A;  4UV9 A;  2IA2 A;  4PUS A;  4BE0 A;  3J80 Z;  3OYM A;  4M3E A;  2WAE A;  3I59 B;  2JPC A;  1KU2 A;  1WCM J;  3JAM Z;  3CZ6 A;  3W6J B;  1GLN A;  1JI8 A;  3V7C A;  2X9D A;  1ZRF A;  1HQC A;  2RQQ A;  1R58 A;  2HVQ A;  4ITV A;  1PDN C;  1SAU A;  4U0V A;  4NUB A;  5HLI A;  2XPU A;  2FJ1 A;  3KEQ A;  1MSE C;  1P4A A;  1XSX A;  4HRI A;  4FIS A;  3V8K A;  2DA2 A;  2Q1Z B;  4G9Y A;  1IN4 A;  5F0F A;  5CVV A;  2CWE A;  4NDL A;  1G59 A;  2QM3 A;  1RES A;  3FMQ A;  3BG5 A;  5L3C A;  2LKX A;  2LK2 A;  2P7V B;  3WU1 B;  3H35 A;  5J8F A;  1MBK A;  3WHB A;  2RNG A;  3B6A A;  3MKL A;  2XGX A;  3BR0 A;  4GYG A;  5TJJ A;  2BW3 A;  2FML A;  1X1P A;  4L9N A;  2UXN A;  2ZME B;  1XCB A;  1R5H A;  5ERI A;  4NHJ A;  4AVZ A;  3GFL A;  4G6Q A;  3B73 A;  3JRB A;  4M72 A;  2HVS A;  4A3D J;  2ZJP F;  2ZME C;  1FP2 A;  2ETH A;  1EH7 A;  2KZG A;  3S1M J;  5K5R A;  4RAF A;  1FC3 A;  5EG0 B;  3K4K A;  1QO0 D;  5FKL A;  1IXS B;  1WH5 A;  1ZR4 A;  4XSX F;  1W0T A;  4RM2 A;  2BE5 F;  3PUF A;  1TWH J;  3DTI A;  3TED A;  2TRT A;  1FMW A;  2YSR A;  2ELH A;  2K9Q A;  3FKJ A;  4OAZ A;  3JRI A;  3BJ6 A;  4KN4 X;  1H9G A;  3HB9 A;  2E7X A;  5E3L A;  1F1Z A;  4IXA A;  4AM3 A;  3PL8 A;  3AAF A;  4MLO A;  1V5E A;  2WV1 A;  1ZG3 A;  2E5Z A;  3JRG A;  4EEF G;  1ZAO A;  4XN3 A;  2ME6 A;  5FRO A;  2M34 A;  4AID A;  4Q4Z F;  4CCN A;  2VOP A;  2R5Y B;  5JR3 A;  3GYH X;  1LNW A;  3V8J A;  3DQV C;  1UB9 A;  2IGK A;  4JX6 A;  1D1A A;  2XV4 S;  2RN7 A;  3HOT A;  5ICF A;  1VFC A;  3SEQ A;  3BOQ A;  3TP3 A;  1VQ7 I;  3HJE A;  4DJA A;  4IOA F;  1ZHF A;  4MTE A;  5HLG A;  3E5X A;  2MSY A;  4IKF A;  1UHM A;  1SMT A;  3I58 A;  3DTE A;  4IPA A;  1BN5 A;  4JX5 A;  5F08 A;  3GLL A;  3T5X A;  2QSG X;  2F4O B;  2Y48 A;  2ZBK A;  3FXU A;  2OBP A;  3E0J B;  1FWZ A;  4U7D A;  2V1N A;  3V8L A;  1XSD A;  4FHT A;  4HG2 A;  4XLF A;  2K85 A;  3PQK A;  4A6E A;  2E71 A;  1X4O A;  3KYL A;  3JRH A;  1BJA A;  4BXX J;  3O6B B;  2P8T A;  5DEQ A;  3HSR A;  2LG4 A;  2OCE A;  1T39 A;  4DW6 A;  3OR2 C;  2DU9 A;  3VYT B;  4BS9 A;  2JA6 J;  2D2W A;  2K27 A;  4Y15 A;  3A01 B;  1TC3 C;  3A2K A;  1H88 C;  3FK7 A;  5E17 F;  3J81 K;  2RNJ A;  3ZN0 A;  3FIS A;  5M3F J;  1DGW Y;  2JWT A;  2LKP A;  4UY8 I;  5F6F A;  3KP2 A;  3GZN B;  2QZ8 A;  2GA2 A;  2NVY J;  1FLI A;  4M3D A;  3U1D A;  2E2H J;  2E7W A;  2JK3 A;  2KP6 A;  2VQC A;  3BPV A;  4XRM A;  1FOY A;  2DJN A;  1MW7 A;  2DK5 A;  2V79 A;  2R7V A;  4C3H J;  3BCA A;  1T0F A;  2EIL H;  5FD6 A;  3WHC A;  3HUG A;  1K79 A;  3G1O A;  1UMQ A;  1R36 A;  3I64 A;  3LSK A;  3HRU A;  4XM3 A;  1WH7 A;  2KRF A;  4CH7 A;  2OUM A;  1D5Y A;  3S3M A;  2B63 J;  2DO7 A;  1POG A;  3WTX C;  4LG0 B;  2EZL A;  1VI0 A;  1ZLK A;  1ZRE A;  4RGX A;  2DYR H;  4LLG F;  3HZJ A;  2ESN A;  2JRM A;  4BU2 A;  4IVN A;  4RM3 A;  2L9R A;  2IS6 A;  1KU3 A;  3HC7 A;  2AS5 F;  4BQA A;  4F55 A;  5AIQ A;  3R4K A;  4EGZ A;  3FHN A;  2H09 A;  3H3V K;  1QPM A;  3BWG A;  4Q48 A;  3ROU A;  2XIG A;  3TDZ C;  2MBF A;  1TNS A;  5GPA A;  3SZG A;  3E97 A;  1NH3 A;  4XOP A;  3S1R J;  3WTT C;  3IRQ A;  2X6W A;  4A93 J;  4A5M A;  3K69 A;  2OZU A;  3ABL H;  2ELK A;  2HQN A;  3FMR A;  1ZR2 A;  2YX4 A;  2XAS A;  1MBH A;  3R60 A;  3KIO A;  5FRN A;  5J1Y A;  3KP4 A;  1ZGJ A;  4AYB A;  2AXT C;  3HRT A;  2NVT J;  2M2E A;  2V6C A;  4OIQ F;  1MGT A;  1VQN I;  3H9J A;  1XDU A;  3QPS A;  2NNN A;  1DP7 P;  3IC7 A;  4N4O B;  4QLC U;  3W2W A;  2H6B A;  5M5W J;  1U0J A;  2M87 A;  5B66 C;  1XD7 A;  1FP1 D;  3QRF F;  4CGZ A;  2E36 A;  3BZ6 A;  3GTP J;  2OPT A;  3GF2 A;  3BCB A;  3M7G A;  1USS A;  1WRJ A;  4XSZ F;  1O3Q A;  1QGP A;  4Y7N J;  2K4B A;  3OYJ A;  3QPH A;  2VBZ A;  1QBJ A;  1FTZ A;  3SEZ A;  1WSU A;  5DCF A;  5L3D A;  3UNG C;  4I98 B;  5HDN A;  4AYB N;  5DD4 A;  4C3J J;  1MMN A;  1F5T A;  4LK1 F;  2L5Q A;  1X3U A;  1XGO A;  4FTH A;  4CZZ A;  2GIZ A;  4XR6 A;  4EJV A;  2BEO A;  4LLN A;  1ERD A;  1RKT A;  4RS8 A;  2DI3 A;  2L4A A;  1D0X A;  2M0M A;  3Q0W A;  3RZO J;  2E2J J;  9ANT A;  3E7L A;  2X48 A;  5CQE A;  1PUF A;  3VYU B;  3ZQC A;  2MYS A;  1GT0 C;  1VQ8 I;  2F5E A;  5IP9 J;  1YJ9 I;  1C0W A;  3KZZ A;  5HS9 A;  1KON A;  3A02 A;  2RV8 A;  2L0K A;  2PJP A;  1MNE A;  2LH9 A;  4BY1 J;  2JT1 A;  2B0L A;  1KU9 A;  5L3E A;  5LHI A;  2F5V A;  2K02 A;  4BJT A;  5K1Y A;  1U3E M;  5LFA A;  4CCO A;  1SC7 A;  4BE1 A;  3FXK A;  2ZXH A;  3CD6 I;  3GCM A;  4NC8 A;  3RYR A;  1ACI A;  5J4Y A;  4L5E A;  1LB2 A;  1DU0 A;  1ONV A;  3QQA A;  3ZQG A;  3VEP A;  2E60 A;  2L7K A;  1RR8 C;  3HGG A;  2DQL A;  2AQE A;  1B9M A;  4BEH A;  3ELK A;  3CUQ B;  4GCV A;  4X6A J;  5ICC A;  1HW2 A;  3G3Z A;  3HUG B;  1OCT C;  1R5I D;  2ZXW H;  3HRS A;  4H0E A;  1VQP I;  2VKD A;  1DDN A;  1AKH A;  1X1B A;  1TW3 A;  2XAU A;  3CUQ C;  3GTM J;  1T0F C;  3U1K A;  4OIR F;  4JK1 X;  2VQH A;  2DBB A;  1FYM A;  3L09 A;  4EJO A;  3P9K A;  3G73 A;  4M74 A;  3VYR B;  3IRR A;  2JQ7 A;  1N78 A;  2DCE A;  5TIS C;  5IY5 H;  4JOM A;  2O61 A;  2JJ7 A;  2HYG D;  1Q1V A;  1FNN A;  1BA5 A;  1ZG5 A;  3FK6 A;  4XQF A;  2DA5 A;  4IHX A;  1LKX A;  2X0L A;  2P4W A;  3FWE A;  3GFJ A;  2CUF A;  1BIA A;  3L2C A;  1TWA J;  2JA2 A;  1XMA A;  1UG0 A;  1KQ9 A;  4WXH A;  5J6X A;  1JKP C;  2N8G A;  2VPR A;  1SFE A;  2MW8 A;  1CF7 A;  3CMM A;  4IQJ A;  2RVC A;  3AFH A;  3LST A;  4FX4 A;  5J3L A;  2YS9 A;  2VBW A;  1K6O A;  2CV1 A;  3LQQ A;  3C7J A;  1WZ2 A;  2NYX A;  4Q5S F;  4M71 A;  2X6O A;  4DGW B;  1W4M A;  3F6O A;  1NG6 A;  2FEZ A;  2PG4 A;  2MAB A;  3OYK A;  4KIF A;  1LE8 B;  1B72 B;  2LSO A;  5C3E J;  1NG7 A;  1YS6 A;  2Y2Z A;  3BG6 A;  2DPD A;  2WAQ N;  1R23 A;  1WWX A;  4WK8 F;  3M07 A;  5HS8 A;  5IPA A;  4KN7 X;  4C2U A;  2KZV A;  2V9K A;  4ON0 A;  4ENJ A;  2GIV A;  3S2H J;  2M8E A;  1DP3 A;  2ZKZ A;  3FHZ A;  1X1D A;  2RRE A;  2DN0 A;  3P9I A;  5CVR A;  2V1U A;  5IT9 Z;  2YPR A;  2VBY A;  3OIQ A;  2CRG A;  5AON A;  1YRN A;  4W97 A;  5HLH A;  1TBX A;  4CYD A;  5K7Z A;  2XSJ C;  4LD5 A;  2GA1 A;  3K4L A;  2ACJ A;  1FEX A;  4C2M J;  1M1E B;  3BRO A;  1Z9C A;  4OIN F;  2HXO A;  2KKO A;  3GTG J;  3HTU A;  4IRG A;  5E3M A;  1K78 B;  2IW5 A;  2QYO A;  3E1S A;  3Q9S A;  1FPQ A;  4M9Z A;  3CCL I;  1PUE E;  1WJD A;  1FIA A;  5FD5 A;  1ZKG A;  5LEJ A;  1B4A A;  1U5T C;  1WFX A;  2FOK A;  2ZXJ A;  4BHP A;  2XF7 A;  4LGW A;  4HV5 A;  3F8N A;  1IN5 A;  5IYB J;  2K9L A;  2XAH A;  4MEX F;  1VQ5 I;  4A3I J;  3K4C A;  2QKM B;  2EIM H;  2W4S A;  4MIM A;  1N77 A;  5GP9 A;  2LD5 A;  1LJ9 A;  4RB3 C;  2LBF B;  4G12 A;  2IGO A;  5FKO A;  2KIS A;  1LPQ A;  3Q3S A;  1OR7 A;  3MCZ A;  4LMY A;  4HST A;  2HTJ A;  2W84 A;  3BTI A;  2F5F A;  2M4K A;  2XRL A;  2OU2 A;  1JKO C;  4BEH B;  4J00 A;  1ORK A;  3ZQL A;  1A35 A;  3AG2 H;  1O4X A;  2A68 F;  3HPG A;  1FY7 A;  1Z77 A;  4MQV A;  4N0B A;  1KGS A;  1E2X A;  5E8I A;  2ZB9 A;  2E2I J;  3H5N A;  2J5P A;  2EIJ H;  2CUJ A;  4Z6Y A;  2F2E A;  1K6Y A;  3I3L A;  2JVG A;  2XGC A;  3A03 A;  2YX7 A;  2KDO A;  4V19 K;  1MBG A;  3HOX J;  3TO9 A;  3SZT A;  4IHW A;  2NVQ J;  2KIM A;  3R0J A;  3TQN A;  1SFX A;  4EV0 A;  2VBX A;  5D5U B;  1RET A;  3CDH A;  3WTZ A;  1N25 A;  3J80 K;  1T33 A;  3SHF A;  3OS2 A;  3VOE A;  4IHV A;  3L9F A;  1Y1V J;  2UZK A;  3ZQ7 A;  1SD4 A;  2OC6 A;  3H92 A;  4LJZ F;  3DXJ F;  1D5V A;  5JVT A;  3CCE I;  3DLL F;  4NQW B;  3JAM K;  1AHD P;  3TBI A;  4HEA 2;  2VL8 A;  3BQZ A;  5DM6 F;  2L7F P;  4IJA A;  2V9V A;  5LGN A;  1ON2 A;  2L2O A;  4NC6 A;  2VON A;  4I09 A;  2O7O A;  3TO6 A;  1D0Z A;  2DW4 A;  3D5S C;  2KJB A;  5E1X A;  4UVA A;  2DA4 A;  3CF5 F;  2W25 A;  3S1Q J;  4RBO A;  3OYN A;  1YX3 A;  3K10 A;  4HLX A;  1PP7 U;  1MBE A;  4EM2 A;  1CF7 B;  2PJR B;  1D8J A;  5IT3 A;  4E7K A;  1XTA A;  1JTY A;  2ZNZ A;  5LBQ A;  2ZME A;  4KIG A;  2F5D A;  2GWR A;  1TZL A;  2VKE A;  1YI2 I;  3OV8 A;  5E1W A;  4A6D A;  4I0B A;  3EQL F;  1T2K A;  1G2H A;  4HPQ A;  4B44 A;  2LY9 A;  2XHK A;  1Z05 A;  2GM4 A;  4OOI A;  2HU9 A;  2BVL A;  1HKQ A;  4HX7 A;  4XOT A;  2FMY A;  1IGN A;  2Q2E A;  3QP5 A;  4CZC A;  1XMX A;  3M8F A;  2OV7 A;  3KEO A;  2QQA A;  2ZJ2 A;  3ZGK A;  4EQQ A;  5HOD A;  2FBK A;  2R7O A;  1GXP A;  2PLY A;  4Y4R A;  1F43 A;  2VPL A;  5EG0 A;  4NNJ A;  3LSG A;  3VFZ A;  2CFX A;  2ECC A;  2R0Q C;  2LF7 A;  2EV0 A;  4KYW A;  2NS8 A;  4XLN F;  3GUD A;  3S3O A;  3KE2 A;  4AIJ A;  4PSW A;  5D8L B;  2QUF A;  2M7A A;  3F6V A;  4X0G A;  3N97 A;  1IRX A;  2PMU A;  5HDK A;  3Q0V A;  4IRI A;  3DU6 A;  1A5J A;  4DIQ A;  1TL8 A;  2NNY A;  4G6T B;  1YG2 A;  3S1N J;  2PMZ N;  1V54 H;  1NHA A;  2K4J A;  2EIN H;  1OIS A;  4MEY F;  3RCO A;  5CVJ A;  1BC7 C;  3O3K A;  1CQT A;  3OS0 A;  3KP3 A;  2NOJ B;  3ZQF A;  3H0G J;  4M6V A;  3BG3 A;  2B9S A;  3DKX A;  5L3G A;  4JX4 A;  2HOS A;  3ML6 A;  2M9H A;  4M6Y A;  3S17 J;  1QRY A;  5EEA A;  1IW7 F;  3V7R A;  2E35 A;  5BPI A;  4A3E J;  2A6T A;  3KLN A;  3D5L A;  5M5Y J;  2ZCW A;  2DJI A;  3ZR8 X;  2YUS A;  1WVR A;  4L0Z B;  2BV6 A;  5LHH A;  5D4S A;  2XVC A;  1MBJ A;  4R1H A;  4MNU A;  2KDZ A;  4U0Y A;  3UR3 C;  3ERE D;  1HSJ A;  2FSW A;  2UUZ A;  3S32 A;  2R5Z B;  1LEB A;  2QQ9 A;  5M3M J;  5F1R A;  4CYC B;  4HNV A;  1BL0 A;  1PJR A;  2QBY B;  3RTR A;  2R7U A;  2E1N A;  5TGT A;  4A69 C;  4CHU A;  1I3A A;  2HXI A;  2MC3 A;  5ED4 A;  5B3S H;  4C3I J;  2VC1 A;  5FGM A;  3HOV J;  2O8K A;  4XKC A;  1MKM A;  4C30 A;  5J8C A;  3TKY A;  1TT5 B;  3CQZ J;  4LFU A;  3ZMU A;  3CLQ A;  1V55 H;  3A01 A;  1JT6 A;  3R6S A;  4RLF A;  3S93 A;  3FF5 A;  3IAS 2;  1D1B A;  2DMU A;  3RDI A;  1WJB A;  1L0O C;  1BW6 A;  3WTV C;  2JA7 J;  2Z3Y A;  3RPU D;  1GDT A;  4BXF A;  4PGH A;  3GTQ J;  2K9M A;  4HA8 A;  1ETV A;  3BR2 A;  5J47 A;  1LFU P;  1JGS A;  3B02 A;  3QOP A;  2EA4 A;  2MC4 A;  4FET A;  5J4V A;  1EJ9 A;  1P7J A;  2ISY A;  2M30 A;  4U7B A;  1VQ6 I;  1VQ9 I;  3E5U A;  3G4S I;  2KFD A;  5IOZ A;  1Y0U A;  3DEE A;  4XK4 A;  1X2N A;  3WU0 A;  1ZYR F;  3FXM A;  4P55 A;  3CC4 I;  2VKH A;  1REP C;  2FXA A;  3LAP A;  2VOO A;  3WOD F;  3EUA A;  2X6X A;  1UFM A;  4I7H A;  3C2B A;  2V4J C;  4ANJ A;  4GXO A;  2KRC A;  4LG0 A;  2X1E A;  3O2P E;  1OCC H;  2YU9 J;  2NRA C;  4KIB A;  1YX5 A;  1OYW A;  1R7J A;  1FBQ A;  3ASN H;  1W5C C;  1IRG A;  4XMY A;  3RPQ A;  4G7H F;  2CV2 A;  3CME I;  1S9H A;  5FKK A;  3BR1 A;  2Q2E B;  2RQP A;  4FX0 A;  2W24 A;  4KMU X;  2VT2 A;  2HFH A;  2I5U A;  1IJW C;  1W36 C;  1BIB A;  3PNV A;  2DOD A;  2CS3 A;  5HDG A;  5JFR A;  1MMS A;  4XLC A;  5F64 A;  4EJT A;  4KIS A;  2GBY A;  2FUG 2;  1F4K A;  1Z6T A;  3F8B A;  1DU6 A;  2HR3 A;  1ZGW A;  2XPV A;  1ETY A;  3HTS B;  1T6S A;  1JUM A;  3FDY A;  2HKX A;  4AIH A;  1FBU A;  2DT5 A;  3ZCO A;  1GV2 A;  4DOZ A;  2HYF A;  2XB5 A;  2DA7 A;  2R92 J;  1W5T A;  3OSF A;  3AG4 H;  2BOL A;  1YIO A;  3K2Z A;  1X2M A;  3PNT A;  4BY7 J;  1B6A A;  5KNL A;  2R7F A;  4TV7 A;  4UV8 A;  3JW4 A;  1J59 A;  3ERM A;  5CLS A;  2A69 F;  2Z5U A;  3C3W A;  2EB7 A;  4HDU A;  2DT6 A;  3GTL J;  2VJI A;  2D1V A;  4LOC A;  3CCJ I;  5BS6 A;  2HEO A;  3S15 J;  3CCM I;  4QPO A;  4R8H A;  2F5C A;  1WJA A;  1BI1 A;  1X3W B;  4AU7 A;  4BAC A;  3MZY A;  4M9S A;  1B59 A;  4CIC A;  1T38 A;  1K7A A;  2CW0 F;  2JPB A;  1X1C A;  4G7O F;  5BOX A;  1MBF A;  3KPH A;  1OCR H;  2Y30 A;  2QCO A;  2UXX A;  1OCP A;  4RA2 A;  2DXI A;  2OA4 A;  1HC8 A;  3GWZ A;  4HQE A;  2R7W A;  1NK3 P;  2EFP A;  3LSI A;  3C2G A;  2JMW A;  2K86 A;  3PFY A;  5CQG A;  1BOA A;  4AUX A;  2QQ8 A;  2L54 A;  2E19 A;  4ENN A;  2FOW A;  3H3U A;  3OL4 A;  2MA3 A;  1QPI A;  1ZK8 A;  3RJP A;  2JN6 A;  4UVB A;  3U9G A;  2ZXI A;  2XKO A;  3RI4 A;  4F3Q A;  4ZDP A;  5KCM A;  1YO5 C;  1RNL A;  1B9N A;  3L1P A;  3MAJ A;  4BDY A;  5M5X J;  1XDS A;  4HDV A;  2QF7 A;  5CVI A;  2FNA A;  3HOW J;  5IOY A;  3OY9 A;  2V1D A;  3E6C C;  3E5Q A;  4GYI A;  5F1J A;  1K4S A;  4M9X A;  2L01 A;  2WAF A;  1W36 D;  4UUT A;  1QVU A;  3OYE A;  3V7S A;  1R71 A;  3FXO A;  2G7U A;  3CUQ A;  1WJ5 A;  1R1U A;  4IX7 A;  2F48 A;  3DPU A;  1D1C A;  2HDC A;  4KMF A;  1IC8 A;  3W2A A;  2Z9O A;  2Z16 A;  2K7L A;  1XC5 A;  2OZ6 A;  3W2V A;  1KA8 A;  4P9F A;  4F91 B;  4YIR X;  1BR4 A;  3NEU A;  5GPC A;  3J7A O;  4V2G A;  2ZFW A;  3FZV A;  2EV6 A;  4HX4 A;  2CUZ A;  4NBQ A;  3SFZ A;  3M4O J;  2BZT A;  2KIF A;  4M73 A;  2R3S A;  3HEF A;  2PBI A;  3JSO A;  3ASO H;  2R7S A;  3WGH A;  2LOO A;  3WU2 C;  1J2X A;  3HXL A;  1OQY A;  3VSK A;  3VB2 A;  4XLP F;  3OOU A;  3KX2 A;  3PIP F;  3WE2 A;  3W6K B;  5K7F A;  3HOY J;  2PN6 A;  5JLW A;  4Y3O A;  3VWB A;  5ILU A;  2EQR A;  3HDD A;  2O0Y A;  1SAN A;  4Y33 A;  1K61 A;  1ETK A;  3VYS B;  4II3 A;  2WY7 Q;  4BHC A;  4RDU A;  4HF0 A;  5D6E A;  5LEK A;  4B3X A;  3C18 A;  1WJF A;  4EMS A;  1BI3 A;  5GAE J;  2C6Y A;  5F0H A;  1HF0 A;  2D5V A;  3OYF A;  3L7W A;  3I4N J;  2QWW A;  1YHQ I;  4NC7 A;  2BYV E;  2KL4 A;  2OD5 A;  1LE8 A;  1B72 A;  2L02 A;  1JJ6 C;  2R7R A;  2BXZ A;  1P6R A;  1BOB A;  2Y69 H;  2WV0 A;  3W6V A;  1G8X A;  1FOX A;  2YR2 A;  2ZSI B;  3WTS C;  3MQ0 A;  3EUH C;  1UAA A;  3FBN B;  3DKW A;  4LIV A;  3F21 A;  4M3G A;  2KMU A;  5LHG A;  3TGN A;  1VQK I;  2Y0M A;  3FXR A;  3WTY C;  2JVH A;  2AQF A;  3F0C A;  3LA7 A;  1H9T A;  4A3K J;  2M7B A;  1LFP A;  2NXN B;  1IN6 A;  1LUJ B;  4N9H A;  1E3O C;  1U5T A;  4FAS D;  1I1S A;  5DS9 A;  4S04 A;  1P7I A;  5ICE A;  2CSO A;  3C2H A;  4IOC F;  2Y0S A;  1HKT A;  4AD9 A;  4A3J J;  1K78 A;  2ESH A;  2WA0 A;  4G8X A;  2VLA A;  4A0X A;  3HOU J;  5IT9 K;  5JVG F;  1MIJ A;  1HW5 A;  3EYY A;  3BTC A;  5J1U A;  3AG1 H;  2DTR A;  2I10 A;  4PFO A;  2G9W A;  1DPR A;  5DCM B;  2HVR A;  1RIO H;  4C9Y A;  1S7E A;  3QOD A;  1ZQ3 P;  1LDD A;  3CCY A;  5C44 J;  2X4H A;  1IXC A;  4AC0 A;  3ZQH A;  2CQ7 A;  1QHH D;  3JRA A;  4A12 A;  1AU7 A;  1RKW A;  2DOF A;  1Y56 A;  1X4P A;  5LD2 C;  3SJM A;  2LLK A;  2HWV A;  2LBF A;  1SFO J;  5F0C A;  4E7H A;  1KYZ A;  2P6T A;  4Y17 A;  5LGU A;  3OS1 A;  1T8I A;  1KZH A;  2LF8 A;  2A3S A;  2Y0S N;  5CJ9 A;  5H6Q A;  1SVO A;  4WF2 A;  2CUE A;  3FBI B;  1MJB A;  1XSV A;  3CES A;  3CCR I;  3K4B A;  1J7K A;  3M3Y J;  1MSF C;  2IGN A;  1YIT I;  4M3B A;  4Y52 J;  1SMY F;  4D0P A;  2STW A;  2WAD A;  5LGT A;  2W1O A;  3OL3 A;  2I8D A;  5BQT A;  3HPH A;  1W0U A;  5JI6 A;  4QIW N;  3EET A;  1Z7L A;  4OMZ A;  2IT0 A;  4XNF A;  1TQP A;  2KQR A;  1JTX A;  2DAO A;  3G71 I;  2M3A A;  3S2W A;  3E6B A;  1TQM A;  2JA5 J;  2XC7 A;  2O9L A;  5EGO B;  2VN2 A;  4L9T A;  1SD7 A;  3H0D A;  3LFU A;  1I5Z A;  1D0Y A;  2CU7 A;  1YFH A;  5C4J J;  2CJJ A;  3PNY A;  4KIT B;  2DTZ A;  4HLY A;  3ONQ A;  2Y75 A;  2IVM A;  4EVI A;  2CYY A;  1ZG1 A;  1OFC X;  4CO8 A;  4RLQ A;  4L5I A;  3LSR A;  1K83 J;  3TOB A;  1IAW A;  4MQ9 F;  3PFI A;  4NQW A;  2XUB A;  2EFW A;  3BR3 A;  1ZRD A;  1JUP A;  3PM1 A;  3LL7 A;  2CQX A;  5IP6 A;  5L3B A;  5KVR A;  3FKI J;  4E6K G;  3I56 I;  2OF7 A;  3A1Y A;  1SFU A;  2IS1 A;  3KYC B;  3K2A A;  2XDV A;  4B3A A;  1YJN I;  3TOA A;  3OSG A;  3MFK A;  1I50 J;  4BYY A;  4MGR A;  2IPQ X;  3JCU C;  2L4M A;  3W3C A;  2PJR A;  1ZAR A;  2VIX A;  3VPR A;  1YW9 A;  2EZI A;  4YRV A;  3OYG A;  3V4G A;  2Y9Z A;  2GQQ A;  3RPU A;  2EK5 A;  1J09 A;  1A6I A;  2K3F A;  3K4N A;  1O3T A;  3F22 A;  1IV8 A;  2PI0 A;  1WJE A;  3NWS A;  2EV5 A;  3DBR B;  3GX4 X;  5FB2 A;  1A31 A;  2Y31 A;  4FE7 A;  1YW8 A;  1A6Q A;  1BR1 A;  3HG9 A;  4B4C A;  3P7N A;  1IN8 A;  1J0R A;  4BE2 A;  3UKG A;  1HCR A;  2EIK H;  3IH2 A; 
#chains in the Genus database with same CATH homology
 3FXQ A;  4HAM A;  1CGP A;  1ON1 A;  2EFQ A;  4UXN A;  1XGS A;  2EA2 A;  3ABU A;  1HBX G;  1QNT A;  4CXF A;  2RKH A;  1IUY A;  2A6E F;  1V4R A;  2HOE A;  4L0Y B;  2V1X A;  4L5J A;  1GHC A;  1BI0 A;  1SD6 A;  1U5T B;  5EEG A;  3RIR A;  3K9T A;  3MWM A;  2XAJ A;  2Q8K A;  2E1C A;  1S6L A;  4I02 A;  1IF1 A;  4EJU A;  4EM0 B;  3CLO A;  3EYI A;  4RGU A;  3MEX A;  4I01 A;  1MDM B;  2A6H F;  4L9J A;  3GEZ A;  4UUV A;  4WCG A;  3TDU C;  3K1P A;  3GO5 A;  3QPT A;  3BY6 A;  4HYE A;  4S05 A;  2OAZ A;  5D5V B;  2QBY A;  2GAU A;  1I27 A;  1HST A;  4LK0 F;  3BPX A;  3K0L A;  4B09 A;  1FSH A;  2FU4 A;  4OU0 A;  4BNC A;  3BJA A;  4A0Z A;  2P6S A;  2O3F A;  3SXY A;  1S29 A;  1MJ9 A;  1I1G A;  1U6G A;  2QQB A;  2AXL A;  4A2U A;  2H27 A;  5H20 A;  1H0M A;  5DYM A;  4HOB A;  3ZMD A;  2KJC A;  2A61 A;  4E70 A;  3KP5 A;  3ISP A;  2NAZ A;  5ILS A;  2MLK A;  2CO5 A;  3WGG A;  2O6G E;  1WQ2 A;  1S7O A;  1RUN A;  1OPC A;  3KCC A;  3QAH A;  5DDG A;  2LDU A;  2IRF G;  4ZZL A;  4LB5 A;  2Q0O A;  2WWY A;  2P5V A;  2PFB A;  1YLF A;  2OQR A;  1A04 A;  2XKP A;  4FT8 A;  4ESJ A;  1KU7 A;  4HV6 A;  5EEH A;  3T0Y A;  2D45 A;  1EV7 A;  1FZP B;  1J5Y A;  2A5Y B;  1D3Y A;  4BHB A;  1J9I A;  1YS7 A;  4PDK A;  1YTY A;  5A2Q Z;  5AIP A;  1OYI A;  1P4X A;  4Y13 A;  5JHU A;  3IL2 A;  4RAY A;  2HQR A;  3WGI A;  5LRR A;  4AVP A;  2DFI A;  1TW2 A;  3E6D A;  5E18 F;  3K1N A;  1W7P D;  3TO7 A;  1R00 A;  1JE8 A;  3ABT A;  4G6D A;  3DPT A;  3GLX A;  4A5N A;  4MHG A;  3HSF A;  1G4D A;  4WXC A;  1JHF A;  1YYV A;  1E17 A;  4IHT A;  3P9C A;  1ODD A;  3LFK A;  1QZZ A;  2CG4 A;  3F3X A;  1SAX A;  1J75 A;  1LDK B;  5FLX K;  3RKW A;  3JTH A;  1IZ1 A;  1P92 A;  3E3V A;  1JHH A;  2FF4 A;  2YU3 A;  2FBH A;  1SD5 A;  3HHH A;  2UWM A;  3IKT A;  5D8K B;  3CUO A;  3KP6 A;  1UHW A;  4KFC A;  2W57 A;  5FFX A;  4BXU A;  3NRV A;  4HF2 A;  2CGP A;  1GVJ A;  4QWQ A;  4HF1 A;  2M1B A;  3LAJ A;  4JQF A;  1OKR A;  4K2E A;  1L3L A;  4HBL A;  2NS0 A;  2Z99 A;  3DF8 A;  2XRN A;  4NB5 A;  5D4R A;  2RGV A;  4PZJ A;  1G3W A;  1EH8 A;  1Z6R A;  1LVA A;  3LA3 A;  1RUO A;  2HZT A;  4ZZD A;  2H6C A;  4GGG A;  4O6J A;  4YG2 F;  1B1B A;  4ASN A;  2P5L C;  2XAG A;  1DUX C;  4G7Z F;  4HZF A;  4ESF A;  3T1B A;  4F7Z A;  5E20 A;  3F72 A;  1MD0 A;  3EUH A;  1KQ0 A;  1QQI A;  3Q9V A;  1FBS A;  3I4P A;  3LA2 A;  4LB6 B;  3HIF A;  3GXO A;  2ZO4 A;  1LQ1 A;  3ECH A;  1IN7 A;  2FA5 A;  4L18 B;  1U8R A;  2XAF A;  3ULQ B;  5FLX Z;  1WKM A;  3VOD A;  3GFM A;  1MZB A;  2MD5 A;  2FQ3 A;  1RZ4 A;  5DCM A;  1LDJ A;  3M8E A;  1OMI A;  1R5G A;  2PMH A;  2BGC A;  1EH6 A;  4R79 A;  2Z33 A;  4IF4 A;  2DLL A;  1ZH5 A;  3HYI A;  3QU3 A;  3RYP A;  3CTA A;  1G3Y A;  3FMS A;  2RC4 A;  1R1T A;  3KLO A;  3C1D A;  3WTW C;  2VE8 A;  4DNC A;  5LRS A;  3GZ5 A;  3N4M A;  4HX8 A;  4ENK A;  3M9A A;  2XAQ A;  3DFG A;  3JSP A;  3R61 A;  1G3S A;  2ADU A;  3ZMZ A;  5D5W B;  5BMZ A;  2ISZ A;  4EGY A;  2EWN A;  2P7C B;  2J5O A;  4BAY A;  2IA1 A;  1S3J A;  4YIF A;  1TLH B;  4HW0 A;  1KYW A;  1KQ8 A;  3JTG A;  2DK8 A;  1O7F A;  1F9N A;  1YQA A;  4JBA A;  2MH2 A;  3BJO A;  2GZW A;  2R7D A;  1UST A;  4O5V A;  2W85 A;  2KIU A;  2EJR A;  2ZNY A;  2TDX A;  2HTS A;  2QLZ A;  1O3R A;  1WI9 A;  2M45 A;  2L3D A;  4ETS A;  3ZP5 A;  3I71 A;  2IJL A;  2EFN A;  1HXD A;  1VTN C;  3SQN A;  4I2O A;  1IRF A;  5K5Q A;  3I54 A;  1HW1 A;  4OMY A;  3QU6 A;  3KZY A;  4DQ2 A;  1I6X A;  5K5O A;  1TTY A;  4UHT A;  2HS5 A;  4YFX F;  3IWF A;  1FX7 A;  2VT3 A;  4M6X A;  1S8N A;  1XB4 A;  2DPU A;  3QP6 A;  1FT9 A;  4YFN F;  3ZN1 A;  2GXB A;  1MDM A;  2BBY A;  3U2R A;  4I0A A;  1GXQ A;  2PEX A;  5DUK A;  5FFZ A;  1FOK A;  1AOY A;  2PQ8 A;  1G3T A;  3HHG A;  2JZY A;  4AIK A;  3J81 Z;  5ICG A;  3I53 A;  5KK1 A;  1O3S A;  3HOS A;  1FYL A;  4ZYH A;  5BPD A;  3RKY A;  4RGS A;  1UCR A;  5LLQ A;  2VE9 A;  4BH9 A;  1OYY A;  4O3M A;  5E1Z B;  1W7P A;  1Z1D A;  2IA0 A;  3ZMT A;  2QVO A;  1R22 A;  4WXD A;  1P2F A;  2WC2 A;  2VOD A;  2XRO A;  4ZYE A;  2D1H A;  3F23 A;  1BBY A;  2WTE A;  3BDD A;  4UVC A;  2JTV A;  3F8C A;  4PCQ A;  2GXG A;  5FO5 A;  4L9V A;  3WE3 A;  3GZ6 A;  2O03 A;  1D8K A;  1O57 A;  4KA4 A;  3ZMS A;  3ZPL A;  5DD8 A;  3I5U A;  1BM9 A;  3BP8 A;  4EJW A;  2P5K A;  3KFW X;  2IP2 A;  3GVA A;  5DUI A;  3F8F A;  3LQR A;  3PQJ A;  1ZN2 A;  4WWC A;  2VXZ A;  5DV5 A;  3Q5F A;  4KT5 C;  1AWC A;  3EDP A;  3E6M A;  4Z2Y A;  1STZ A;  4U88 A;  2STT A;  2G7H A;  3DPL C;  4RB1 A;  4RB2 C;  4XRF A;  1JXS A;  1Z7U A;  5H6R A;  4CDG A;  1RI7 A;  3FM5 A;  5A2Q K;  3WG9 A;  4Q47 A;  1XGN A;  3DV8 A;  3RKX A;  1T98 A;  2OQG A;  1ZGA A;  2LNB A;  4XBF A;  3CO6 C;  3IKV A;  3H3Z A;  1DPU A;  3ECO A;  3L00 A;  4ESB A;  2JSC A;  2FNP A;  1S7A A;  3T8T A;  2JRT A;  4G94 A;  5E8G A;  3DP7 A;  3M1E A;  1W7P B;  5CVU A;  2MLG A;  3CJN A;  3KET A;  4U0W A;  1FSE A;  2CQK A;  1BI2 A;  5ILV A;  2VC0 A;  3COA C;  1TNT A;  5HVQ C;  3D0S A;  3I0T A;  4MTD A;  4ZYD A;  1W5S A;  1PP8 F;  3I59 A;  1IXR C;  1Q1H A;  4EM1 A;  4ZH4 F;  4ENM A;  4KNY A;  1XMK A;  4B8X A;  4HQM A;  2DQR A;  1XGM A;  3WTU C;  1O7L A;  5HOO A;  4KDP A;  4PGG A;  1ZLJ A;  1P4W A;  3LWF A;  3REO A;  1G6N A;  4IHS A;  4OIP F;  5HS7 A;  3HSE A;  4WX9 A;  1U2W A;  3K1M A;  3GW2 A;  2HGC A;  3CO7 C;  3MZH A;  2FBI A;  1Z91 A;  2FE3 A;  3KP7 A;  1TQI A;  3DEU A;  1FYK A;  6PAX A;  1V3F A;  5CYV A;  2QEN A;  5D6F A;  4P9U A;  1ZRC A;  3GFI A;  1LEA A;  3IHU A;  3F8M A;  2COM A;  1MJA A;  1ULY A;  3SZP A;  4LLL A;  4IRH A;  3T8R A;  3FX3 A;  3FM3 A;  1R1V A;  4P5O A;  4GO1 A;  1YW7 A;  4P96 A;  5D5X B;  5L3F A;  4KUM A;  4ZYG A;  4RGR A;  3HRM A;  2A07 F;  4N9I A;  4RB0 A;  3OOP A;  3NQO A;  4RAZ A;  2MH9 A;  4YII A;  4KIC A;  4YFK F;  4A0Y A;  1BC8 C;  4UNO A;  3R0A A;  4OIO F;  2RDP A;  2M5W A;  5TRD A;  1HKS A;  1XN7 A;  1U78 A;  3IWZ A;  2O8X A;  1QZY A;  2FRH A;  3ZMV A;  1XCV A;  4AWX B;  2H94 A;  2EFO A;  2HKO A;  4UV9 A;  2IA2 A;  3J80 Z;  3I59 B;  2JPC A;  1KU2 A;  3JAM Z;  3W6J B;  3V7C A;  1ZRF A;  1HQC A;  1R58 A;  1PDN C;  4U0V A;  5HLI A;  3KEQ A;  1P4A A;  1XSX A;  3V8K A;  4G9Y A;  1IN4 A;  5CVV A;  2CWE A;  2QM3 A;  3FMQ A;  5L3C A;  3WU1 B;  2P7V B;  5J8F A;  4GYG A;  5TJJ A;  2XGX A;  2FML A;  4L9N A;  2UXN A;  1XCB A;  2ZME B;  1R5H A;  5ERI A;  4NHJ A;  3GFL A;  4G6Q A;  3B73 A;  4M72 A;  1FP2 A;  2ETH A;  1EH7 A;  5K5R A;  1FC3 A;  1QO0 D;  1IXS B;  4XSX F;  2BE5 F;  2YSR A;  2ELH A;  3BJ6 A;  4KN4 X;  1H9G A;  2E7X A;  1F1Z A;  4IXA A;  3AAF A;  1ZG3 A;  1ZAO A;  4Q4Z F;  2VOP A;  5JR3 A;  3GYH X;  1LNW A;  3V8J A;  3DQV C;  1UB9 A;  2XV4 S;  2RN7 A;  3HOT A;  5ICF A;  3BOQ A;  1ZHF A;  4MTE A;  5HLG A;  3E5X A;  1UHM A;  1SMT A;  3I58 A;  4IPA A;  1BN5 A;  3T5X A;  2Y48 A;  2ZBK A;  3FXU A;  2OBP A;  1FWZ A;  4U7D A;  3V8L A;  1XSD A;  4FHT A;  3PQK A;  4A6E A;  1BJA A;  3O6B B;  2P8T A;  5DEQ A;  3HSR A;  1T39 A;  2DU9 A;  2D2W A;  2K27 A;  4Y15 A;  5E17 F;  3J81 K;  2RNJ A;  3ZN0 A;  2LKP A;  5F6F A;  3KP2 A;  2QZ8 A;  2GA2 A;  1FLI A;  3U1D A;  2E7W A;  3BPV A;  2DK5 A;  2V79 A;  1T0F A;  5FD6 A;  3HUG A;  1K79 A;  1R36 A;  3I64 A;  3HRU A;  2KRF A;  2DO7 A;  3WTX C;  4LG0 B;  1ZLK A;  1ZRE A;  4RGX A;  4LLG F;  2ESN A;  4IVN A;  1KU3 A;  2AS5 F;  4BQA A;  5AIQ A;  3R4K A;  4EGZ A;  2H09 A;  1QPM A;  3BWG A;  4Q48 A;  3ROU A;  2XIG A;  3TDZ C;  2MBF A;  1TNS A;  3E97 A;  3WTT C;  3IRQ A;  4A5M A;  3K69 A;  2OZU A;  2HQN A;  3FMR A;  2YX4 A;  2XAS A;  3R60 A;  3KP4 A;  1ZGJ A;  3HRT A;  2V6C A;  4OIQ F;  1MGT A;  1XDU A;  2NNN A;  1DP7 P;  3IC7 A;  4QLC U;  2H6B A;  2M87 A;  1XD7 A;  1FP1 D;  3QRF F;  4CGZ A;  3BZ6 A;  3GF2 A;  3M7G A;  1USS A;  1WRJ A;  4XSZ F;  1O3Q A;  1QGP A;  2K4B A;  3QPH A;  2VBZ A;  1QBJ A;  1WSU A;  5DCF A;  5L3D A;  5HDN A;  4I98 B;  5DD4 A;  1F5T A;  4LK1 F;  1X3U A;  1XGO A;  4CZZ A;  4EJV A;  2BEO A;  4LLN A;  4RS8 A;  2DI3 A;  2L4A A;  2F5E A;  1C0W A;  3KZZ A;  5HS9 A;  2RV8 A;  2PJP A;  2JT1 A;  2B0L A;  1KU9 A;  5L3E A;  5LHI A;  2K02 A;  5K1Y A;  1U3E M;  3RYR A;  1LB2 A;  1ONV A;  3VEP A;  2DQL A;  1B9M A;  3ELK A;  3CUQ B;  4GCV A;  5ICC A;  1HW2 A;  3G3Z A;  3HRS A;  4H0E A;  1DDN A;  1TW3 A;  3CUQ C;  4OIR F;  4JK1 X;  2DBB A;  1FYM A;  3L09 A;  4EJO A;  3P9K A;  3G73 A;  4M74 A;  3IRR A;  2O61 A;  2HYG D;  1FNN A;  1ZG5 A;  2X0L A;  2P4W A;  3FWE A;  3GFJ A;  1BIA A;  3L2C A;  1XMA A;  1KQ9 A;  4WXH A;  5J6X A;  1SFE A;  1CF7 A;  2RVC A;  3LST A;  4FX4 A;  1K6O A;  2VBW A;  3LQQ A;  3C7J A;  2NYX A;  4Q5S F;  4M71 A;  1W4M A;  3F6O A;  2FEZ A;  2PG4 A;  4KIF A;  2LSO A;  1YS6 A;  2DPD A;  1R23 A;  1WWX A;  4WK8 F;  5HS8 A;  4KN7 X;  4ON0 A;  4ENJ A;  2GIV A;  2M8E A;  2ZKZ A;  3FHZ A;  3P9I A;  5CVR A;  2V1U A;  5IT9 Z;  2YPR A;  2VBY A;  5AON A;  5HLH A;  1TBX A;  4CYD A;  4LD5 A;  2GA1 A;  2ACJ A;  3BRO A;  1Z9C A;  4OIN F;  2KKO A;  3HTU A;  4IRG A;  1K78 B;  2IW5 A;  2QYO A;  3Q9S A;  4M9Z A;  1FPQ A;  1PUE E;  5FD5 A;  5LEJ A;  1B4A A;  1U5T C;  2FOK A;  2ZXJ A;  4BHP A;  4LGW A;  4HV5 A;  3F8N A;  1IN5 A;  2XAH A;  4MEX F;  1LJ9 A;  4RB3 C;  1OR7 A;  3MCZ A;  4LMY A;  2HTJ A;  2W84 A;  2F5F A;  2OU2 A;  2A68 F;  1FY7 A;  4MQV A;  4N0B A;  1KGS A;  1E2X A;  5E8I A;  2J5P A;  2F2E A;  2YX7 A;  3TO9 A;  3SZT A;  2KIM A;  3R0J A;  3TQN A;  1SFX A;  4EV0 A;  2VBX A;  5D5U B;  3CDH A;  3WTZ A;  3J80 K;  3SHF A;  3VOE A;  3L9F A;  2UZK A;  3ZQ7 A;  1SD4 A;  3H92 A;  4LJZ F;  3DXJ F;  1D5V A;  5JVT A;  3JAM K;  4IJA A;  2V9V A;  5LGN A;  1ON2 A;  2VON A;  4I09 A;  3TO6 A;  2DW4 A;  2KJB A;  5E1X A;  4UVA A;  2W25 A;  4HLX A;  1PP7 U;  4EM2 A;  1CF7 B;  1D8J A;  5IT3 A;  2ZNZ A;  5LBQ A;  2ZME A;  4KIG A;  2F5D A;  2GWR A;  3OV8 A;  5E1W A;  4A6D A;  4I0B A;  3EQL F;  1T2K A;  1Z05 A;  2XHK A;  4OOI A;  1HKQ A;  4HX7 A;  2FMY A;  2Q2E A;  3QP5 A;  3M8F A;  3KEO A;  2QQA A;  2ZJ2 A;  1GXP A;  4EQQ A;  2FBK A;  2PLY A;  3VFZ A;  2CFX A;  2LF7 A;  2EV0 A;  4KYW A;  4XLN F;  3GUD A;  3KE2 A;  4AIJ A;  5D8L B;  2QUF A;  3F6V A;  3N97 A;  5HDK A;  2PMU A;  4IRI A;  2NNY A;  1YG2 A;  1NHA A;  2K4J A;  4MEY F;  1BC7 C;  5CVJ A;  3O3K A;  3KP3 A;  5L3G A;  3ML6 A;  4M6Y A;  1IW7 F;  3V7R A;  5BPI A;  3KLN A;  3D5L A;  2ZCW A;  4L0Z B;  2BV6 A;  5LHH A;  5D4S A;  2XVC A;  4R1H A;  4MNU A;  4U0Y A;  3ERE D;  1HSJ A;  2FSW A;  1LEB A;  2QQ9 A;  5F1R A;  2QBY B;  3RTR A;  2E1N A;  4CHU A;  5ED4 A;  2MC3 A;  2VC1 A;  5FGM A;  1MKM A;  5J8C A;  3TKY A;  4LFU A;  3ZMU A;  3R6S A;  3FF5 A;  3RDI A;  1L0O C;  3WTV C;  2Z3Y A;  4PGH A;  4HA8 A;  1JGS A;  3B02 A;  3QOP A;  2EA4 A;  2ISY A;  2M30 A;  4U7B A;  3E5U A;  1Y0U A;  3WU0 A;  1ZYR F;  4P55 A;  1REP C;  2FXA A;  3LAP A;  2VOO A;  3WOD F;  1UFM A;  4I7H A;  4GXO A;  4LG0 A;  3O2P E;  2NRA C;  4KIB A;  1OYW A;  1R7J A;  1FBQ A;  1IRG A;  3RPQ A;  4G7H F;  2RQP A;  4FX0 A;  2W24 A;  4KMU X;  2VT2 A;  2HFH A;  1BIB A;  5HDG A;  5JFR A;  5F64 A;  4EJT A;  1F4K A;  1Z6T A;  3F8B A;  2HR3 A;  3HTS B;  1T6S A;  2HKX A;  4AIH A;  1FBU A;  2DT5 A;  2HYF A;  1W5T A;  1YIO A;  3K2Z A;  1B6A A;  2R7F A;  4TV7 A;  4UV8 A;  3JW4 A;  1J59 A;  5CLS A;  2A69 F;  2Z5U A;  3C3W A;  2EB7 A;  4HDU A;  2D1V A;  5BS6 A;  2HEO A;  4R8H A;  2F5C A;  1BI1 A;  3MZY A;  4M9S A;  1B59 A;  4CIC A;  1T38 A;  1K7A A;  2CW0 F;  2JPB A;  4G7O F;  5BOX A;  2UXX A;  2OA4 A;  3GWZ A;  4HQE A;  2EFP A;  2K86 A;  1BOA A;  2L54 A;  4ENN A;  3H3U A;  2MA3 A;  3RJP A;  4UVB A;  3U9G A;  3RI4 A;  2XKO A;  1YO5 C;  1RNL A;  1B9N A;  3MAJ A;  1XDS A;  4HDV A;  5CVI A;  2FNA A;  3E6C C;  2V1D A;  3E5Q A;  4GYI A;  4M9X A;  2L01 A;  3V7S A;  2G7U A;  3CUQ A;  1R1U A;  2HDC A;  4KMF A;  2Z9O A;  2K7L A;  2OZ6 A;  1KA8 A;  4P9F A;  3NEU A;  3J7A O;  2ZFW A;  3FZV A;  2EV6 A;  4HX4 A;  3SFZ A;  2KIF A;  4M73 A;  2R3S A;  3JSO A;  2PBI A;  3WGH A;  1J2X A;  3VB2 A;  4XLP F;  3WE2 A;  3W6K B;  2PN6 A;  5ILU A;  2O0Y A;  4BHC A;  4HF0 A;  5D6E A;  5LEK A;  3C18 A;  4EMS A;  1BI3 A;  2C6Y A;  3L7W A;  2QWW A;  2BYV E;  2OD5 A;  2L02 A;  1P6R A;  2WV0 A;  2YR2 A;  3WTS C;  3MQ0 A;  3DKW A;  3F21 A;  5LHG A;  3TGN A;  2Y0M A;  3FXR A;  3WTY C;  3LA7 A;  1H9T A;  1IN6 A;  4N9H A;  1U5T A;  1I1S A;  4S04 A;  5ICE A;  2CSO A;  1HKT A;  4AD9 A;  1K78 A;  2ESH A;  4G8X A;  4A0X A;  5IT9 K;  1HW5 A;  3EYY A;  2DTR A;  2G9W A;  1DPR A;  5DCM B;  1RIO H;  1LDD A;  2X4H A;  1IXC A;  4A12 A;  2HWV A;  1KYZ A;  2P6T A;  4Y17 A;  5LGU A;  2LF8 A;  2A3S A;  5CJ9 A;  5H6Q A;  4WF2 A;  1MJB A;  1XSV A;  1J7K A;  1SMY F;  4D0P A;  2STW A;  5LGT A;  5BQT A;  5JI6 A;  3EET A;  4OMZ A;  2IT0 A;  1TQP A;  2DAO A;  3S2W A;  3E6B A;  1TQM A;  2VN2 A;  4L9T A;  1SD7 A;  1I5Z A;  1YFH A;  4HLY A;  2Y75 A;  2IVM A;  4EVI A;  2CYY A;  1ZG1 A;  4CO8 A;  4L5I A;  3TOB A;  1IAW A;  4MQ9 F;  3PFI A;  4NQW A;  2XUB A;  2EFW A;  1ZRD A;  5L3B A;  5KVR A;  1SFU A;  3TOA A;  3MFK A;  4BYY A;  4MGR A;  2IPQ X;  2L4M A;  1ZAR A;  1YW9 A;  3V4G A;  2GQQ A;  3RPU A;  2EK5 A;  1O3T A;  3F22 A;  2PI0 A;  2EV5 A;  3GX4 X;  5FB2 A;  1YW8 A;  3P7N A;  1IN8 A;  1J0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...