1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HP0162
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
1K6YA 3HPGA 1WJBA 1WJEA 1KONA 4F3QA 1E0EA 1WJAA 3HPHA 1MW7A 1WJCA 1WJDA 1LFPA 3F9KA 1WJFA
chains in the Genus database with same CATH superfamily
2ID6A 5KAFC 1ULRA 4I1TA 3J7A1 3FMSA 2CVIA 1UVIA 1QNTA 5LGNA 4NXMJ 4BE2A 3PKMA 2QX0A 3ZZPA 2Q1LA 4DUTA 3A0HC 2R7RA 1HLWA 2DMNA 2XULA 3BR1A 3G6XA 2HLTA 5F41A 1ZHFA 3NGTA 5TRDA 1IN5A 2QBYB 2DT6A 4QPQA 2HRUA 1G6NA 2KT0A 2HDCA 2V2KA 1OCZH 3A02A 1ZTWA 4LRDA 1X1AA 2ZJ2A 1T7PA 3BTCA 3BR2A 1G4DA 2PJRA 4OZ0A 3DHWC 2F5GA 1RTJA 4E7HA 5CAAA 3FEYB 4IUFA 5L3EA 3WTUC 1U26A 2XCAA 4UUTA 4YFKF 3OFEA 2R2RA 5DDRC 4MK8A 2ZMEA 5GAHU 3IO1A 4LF7F 1HF0A 2AYBA 2I5UA 1QSYA 2PGCA 3MM5B 2DA7A 4ED2A 2R7QA 5ETRA 5LRRA 1FNMA 1AYEA 3ZMDA 3BG6A 4YG2F 3I4HX 4MTPA 3EZOA 4P55A 3GJSB 3DN9A 2B9YA 2HAIA 3U27A 1TUGB 3IBFB 1DP3A 3NOCA 4PJMA 2Z8QA 3IS9A 4UF4A 3T8RA 5HANA 3J81j 1KRPA 1S7OA 3JSBA 3CW2C 1D3WA 1Q53A 3OS2A 2ZJPF 2LECA 4ZMMA 1KDNA 5CQGA 4LF4J 2DMPA 2XAJA 4I2PA 2I9SA 4M6YA 3DI6A 3RYLA 3KEOA 2CJKA 1SPBP 2AT1B 4HTIA 4MH8A 3RKWA 1YTYA 4MYUA 3KUHA 3M3YJ 4R0EA 2VOOA 3GTPJ 1LJ9A 5LFAA 2BY0A 4M3BA 3ET6B 1TU0B 4BNCA 5DV5A 4OX8A 5I42B 4KHPJ 3MM6A 1VQYA 1SC1B 1FJ7A 1R36A 3IAM9 1IBKJ 5FDLA 1SH3A 2VG5B 3AOBA 2HIQA 1G2EA 4JI7F 1VCTA 1QM9A 3V8JA 1I6JA 2K06A 4QWDA 1STZA 2CKWA 3UNGC 1SL0A 3THTA 4KITB 5M2PA 2E36A 4GO5X 2QG9B 2B4VA 3H3VK 2KT2A 1PBUA 4BHCA 3C6UB 3COAC 5KCMA 3OYNA 2DYAA 2YUSA 3TX8A 1HNWJ 1MDMB 4PXCA 4NCGA 1K1SA 4X6AJ 3LA7A 1S1WA 5IC4B 3LP0B 2G2ZA 1YK9A 2ZJRF 4LIVA 2OEMA 4AYBA 3BY6A 1WJ5A 3PFEA 1HFEL 4PRFA 2VJUA 3HO1A 4PSWA 3DHXA 3V6JA 2HHHF 5AE3A 4PG5A 1JMTA 4PJ0C 3GW2A 2R2UA 5D8LB 2BV6A 4DU7A 5HO4A 1U09A 4HRIA 3W3SA 3O8HA 3IRRA 1ZR2A 2BJ1A 4NC7A 4ZITA 4L6V3 3E6MA 4EV0A 2V1DA 4IRIA 4OYWA 4IOAQ 2CO5A 3ZQQA 1F2HA 4CM2A 4DUZJ 3W61A 4JYKA 1MN7A 4X1EA 4EMDA 1U1KA 2UU9F 2A5YB 1C0UB 1HKAA 4C8OA 4HDGA 2POKA 3JS9A 5BPDA 4DSEA 3EDQB 4K4TA 4DGWB 2HS5A 3JSMB 4K2EA 3ZQLA 1ZM4A 2Y1JA 3D3BJ 5L3GA 5KVRA 3FZ2A 1WJFA 1I6XA 4HEA9 1VDHA 3R1HA 5MLCV 4DR1J 5F8NA 3PJ9A 3CCSS 2V8VA 2G0IA 1Y5LB 3R60A 1UW9A 3QP5A 5KK1A 1RT4B 3B6CA 2BM0A 2VG6A 2LOOA 5FLVA 1HI8A 4IFVB 2RAEA 2VQEJ 1RT5B 1TL7A 2QLFB 3WIUA 3UVJB 1JTYA 3GTLJ 1X1CA 2FZKB 3ELHA 1NDPA 3BBBA 3OWTA 1E3OC 3DXBA 3GF2A 2P6SA 4ECZA 1X4GA 1IKVA 1L3UA 3M8FA 5TJJA 4F26A 4MIAA 2EIMH 1GLNA 1ZG3A 3BS9A 2B8QA 2YKQA 3G6EI 1ZELA 2ZXIA 1MJAA 3JTNA 2MA3A 3LSTA 5EYRA 5KFUA 4HSTA 1XR7A 2IM2A 3RB0A 2X4HA 3CGIA 2L7KA 4XRFA 2CNOB 1VQ9S 2QIFA 4W4MA 2ZKUA 4A69C 2BKNA 1MWYA 2IA6A 3RSNA 5DDQC 1Z6TA 4I09A 3KJFB 5HK4A 4NQWA 1YVFA 2PJRB 2DNYA 1UVJA 1X4DA 4RUHA 5K8NA 3VWBA 5L3BA 1RTJB 3GR1A 1S29A 3BKUA 3VAGA 5A0YA 4Z6YA 2J7WA 1AA7A 4FF4A 3LGNA 2ZMEB 1G1XA 1PUEE 1S8NA 1U78A 2R3SA 4OYMA 2IM1A 5FLXU 4GVBA 4DR5F 4GRIA 3K5LA 3BJYA 1BOBA 1I94F 2YPYA 2DYSH 5L39A 5D4SA 3W8PA 2CFOA 5D0EA 3IS9B 2AWZA 4FKXA 1WD6A 4R25A 2VXDA 1VLOA 4I2PB 3K5NA 4QYZJ 3DI6B 3BQ1A 3PIPF 1MSFC 2G0CA 4WK8F 2RQMA 2Z56B 3AL0B 4HHJA 4B3MJ 4QW9A 3M7VA 3M8PA 3TUJC 1J27A 2CNNB 1U0SA 4LBHA 5KFOA 3AQPA 2HBZB 3IGNA 1USSA 3MEDA 4LIWA 1C0TA 5KFYA 3BR6A 5FDLB 4B9TA 1NB7A 5GMEA 2EIJH 4GKKF 2PEBA 2W85A 1X19A 3UR0A 2C2ZB 2GIVA 2E34A 2Y8YA 4UUXA 3SXLA 2V8DA 1A6LA 5LMNF 3L7UA 4RLEA 2W7OA 2HMIA 2UVWA 3FDSA 1L5UA 3NWGA 3KHLA 3PNYA 3LP2A 3I55I 4NCGB 4FPIA 1XPXA 3I5UA 1IJEB 1S1WB 3S2HJ 4EI2A 3BKTA 3I96A 2L7ZA 5KFGA 1R5HA 3GTQJ 1RT1A 1FSEA 2BXZA 4DYRA 3T1HF 2EFGA 2FBHA 3NCQA 1PKUA 2D41A 3K5MA 3K1MA 3FEZA 3GFJA 1G7CB 1T11A 4WTYA 1D5VA 3GXOA 4S0HB 2E1RA 2HVRA 2Y69H 3SZPA 2WBRA 4AFFA 1A0OB 3OFHA 2FY8A 2KZZA 1RAEB 3TQ1A 1VQ5S 2Y0BB 3HL2A 4QIVA 5HLTA 2YXLA 3MI7X 2PN6A 3CESA 1PSDA 4AD9A 1X4FA 2LQ8A 1W36D 4OI0A 2HTJA 2VJ5A 1XGSA 2KT3A 3BO3A 2K3KA 4A93J 2NS0A 1GMVA 4EEYA 1ZAWA 1IF1A 2HRTA 4CUGA 3BP8A 3LSMA 2ACMA 2CQHA 1JXEA 3A3OB 3IWFA 1MZBA 1I5ZA 5IT4A 2DGXA 1LWCA 2WB1N 3HIFA 4A6EA 3PJXA 2YKMA 1UFMA 3BSAA 2V50A 3C6TA 2K85A 3J80U 1UEVA 3PW7A 2GA2A 2HHTA 3EE3A 2E5LJ 2UZKA 5GADU 1R0AA 3BPXA 2VG6B 4H4KC 5ETQA 1TL7B 1PJ5A 3BV8A 4WF9Q 3PYDA 5HLHA 1FIAA 2WB1D 4B9LA 3X1LB 1HQCA 4DOZA 3WTTC 1MMNA 3J81Y 1R6VA 2PEXA 1ZA2B 2D7SA 3JRBA 3M32A 2JRMA 1IKVB 1UW4A 4WTOB 5K20B 2M8GX 1PILA 3PCOB 5D0HA 1FP2A 4OIOF 4EJOA 1OCOH 1KFSA 1WOOA 2KI2A 3DLGA 3E97A 2IS1A 2XMUA 4F91B 3V6KA 3N6NA 4ZK7M 2XM3A 1BQNA 4KPYA 5LSRA 4B9SA 1KU2A 1S9HA 4E7SA 1Z2LA 4OZ2A 3CJ0A 4A3MJ 5FKOA 3FM3A 4KUMA 1EP4A 4NQWB 2FD5A 1JNRB 5M5XJ 2RGVA 4BQNA 2LY9A 5B3SH 1RWOB 4ZZDA 2DNLA 2XWYA 2UXBJ 2EG1A 4FF2A 1DQUA 5M2RA 5IV3A 1RA7A 4AM3A 1NDKA 3LSRA 1WUUA 3UCGA 1HSTA 3ZNJ1 3QLHA 2I0XA 4H54A 4HYKA 3H9QA 3BJ6A 2JN6A 1GV2A 2MQNA 4GVBB 1ACMB 3M8QA 4KR0B 1YE9A 4WFAQ 3OYEA 2AJ2A 4HQEA 3HOVJ 1KFDA 3UI3A 2QA4I 2ZVSA 2FU4A 4KICA 2W8KA 3QMQA 3QAEA 3OYMA 4P75A 2FIUA 1B4SA 2BQUA 2VL1A 3KETA 2JLGA 2KM8B 3VGTA 3LGHA 2DK8A 2M52A 2FUG2 2RQCA 4NBQA 4ZN1A 5IXUA 4XL9A 1U1QA 1KOOA 3FX3A 1CF7A 2DU9A 2LREA 1T0FC 1PJRA 2LP4A 4W1UA 1XSDA 1APLC 3EUHC 3M8PB 1ZAXA 2FJAB 5D4LA 4C0HA 3GPAA 2VOPA 3S1MJ 2AX1A 3C2GA 1SL2A 3MEDB 1Z7UA 1C0TB 1V5IB 2OELA 3KTQA 2HBRB 2OTLS 4TQRA 3PO5A 3CO9A 1F36A 1U9OA 3NGKA 2IA2A 2LMIA 2CGPA 2XRLA 2B56A 3LFKA 3EXYA 4LF6F 4OZ5A 3E5UA 1S79A 5KT6A 4IRKA 2I2YA 2HMIB 2LH9A 3BREA 1JLBA 2JFDA 3LP2B 1IUYA 4F7ZA 2IDEA 2PFBA 4OL8A 4TYBA 2FDNA 4PUOA 1DP7P 3SFGA 4DF8A 4LOCA 4OYOA 4U8YA 4JBAA 1BQXA 2J9CA 2E1NA 4XSXF 3K5OA 1RT1B 3NRVA 2HK2A 2K5CA 3NS6A 2OMLA 2E2HJ 2DNPA 4LR7A 2P9EA 1S76D 2O03A 2B0LA 2C2OB 3D6MB 5F64A 1JK9B 3HGGA 3R3TA 5KG5A 1RWUA 1FRIA 1WKKA 1XD7A 3I9ZA 3OL8A 4WZMA 2J5AA 5ETSA 1FDDA 4KE5A 1NSQA 1W2IA 1WC6A 4A8KA 1OIAA 5CA5A 2F5FA 1IN6A 3E6BA 4Y65A 3T9NA 2QZ8A 4C97A 4EYIB 4Y0FA 1UG0A 3H5AA 3U1NA 3TARA 4DV3J 3HX9A 4RUCA 1FLIA 1AWCA 1O8BA 2ESHA 3IAS2 4GVLA 5LJ3Y 2MLYA 2PI0A 3C19A 2LKXA 2MMYA 1U5TC 2F8HA 2VD3A 3TW7A 2KIUA 2VC0A 2ZCWA 1YHQS 3P5TL 2JT1A 2XZWA 2GQCA 1RYSA 2Z4PA 1LWCB 3NEUA 4ID8A 3JSPA 2BRLA 2YKMB 1BM9A 2RRBA 3C6TB 5FJ8J 4XKWA 1S9EA 3AA9A 2GA1A 1SD6A 3KX2A 1BL0A 1M5VC 3MOZA 1R0AB 1FTRA 2WAFA 1FXDA 3CUQA 3HHLD 1MMGA 4DR4F 4O3PA 2M7SA 3DPLC 2DNOA 4PDKA 4II2A 1W5TA 2C1EB 1R8CA 3M32B 4HX8A 1UHSA 2O5RA 5ETOA 3OYHA 4C2MA 2YNHA 4YIRX 1H2VZ 5HROA 1S1VA 4U96A 4IRDA 4DSKA 3DLGB 2K8GA 4HLBA 2CQ0A 2YU9J 1FK9A 4NLSA 5IZHA 1BQNB 2M8DB 1F9NA 1FSHA 1FHTA 3P4UB 5DM6F 5D0RA 5K8OA 1LK7A 2VDHA 2MW8A 4LJMA 1EP4B 4OLPA 1Q79A 3QWLA 2BE7D 4NXNF 2P8TA 2JZ5A 3KZZA 5GAGJ 5EZGA 4OI2A 1NH7A 5LT5A 3BGRA 4A8YA 2FXAA 2CQGA 3TAPA 2DBBA 3KKFA 3CCSI 2VV5A 2AW0A 3TMOA 4HH0A 3CJKA 1JXLA 3SDBA 2G0JA 2COLA 4XKVA 4NA1A 1Y7PA 2FB0A 3QLHB 1WJ9A 1WEZA 3PDNA 1BR4A 3QPLA 1XGMA 1ETYA 1U0JA 4G6QA 2LF8A 3N5FA 1WEYA 1U1NA 2MKJA 1OLTA 2O0YA 2KRHA 2RIJA 2GMHA 2DGVA 2IJLA 1FWLA 4IQJA 1LQ1A 2ZH7A 4J9UE 1DZ5A 2LBFA 3R0JA 2P9CA 3CO7C 4RMNA 1RBLA 4LF7J 3NWTA 4FZVA 5ITHA 5CYMA 4CT8A 4Q7AA 3QJPA 4KT0C 3JAMY 3QAHA 2HXOA 3CDAA 3OUYA 1X58A 4PQAA 3K2AA 1CF7B 3DCFA 2OH2A 1AT1B 4F4AA 3QPSA 4S05A 5MAOA 1VQ9I 3DKXA 1N5SA 3LPEA 1TFYA 1N48A 4JOUA 4LLNA 4TQSA 1WI8A 2CNKB 4DSLA 1N36F 2E71A 2OHDA 1H38A 3AJ1A 3T41A 4CI0B 2Y0MA 1ZPWX 1Z9CA 2ADBA 4PG7A 3IBWA 2GA7A 3TO9A 4XSZF 1BQMA 1TQPA 1JLGA 3OVAA 1KONA 3GIKA 4ZVSB 4UUSA 1HWIA 1JLBB 4MTDA 4U7CA 3A12A 5KFSA 4J00A 1KU9A 1ONVA 3PSIA 4XN0A 4D3GA 3R8YA 1QUVA 2GC8A 5HVFA 2JVGA 5L46A 1JJCB 2BE5F 4BXXJ 1X3ZB 3RPUD 2VPYB 4JI7J 4E7IA 5DETA 4MKBA 3HHDA 4JQFA 5FO5A 1AB8A 1D1AA 3FGVA 4I0BA 5E79C 1U2CA 2R8KA 1EZZB 2QEXS 1PJ7A 2KVQE 2B8PA 4L3KA 4ECVA 4K4VA 4UOCA 1OJ4A 3ZQ7A 2XYGB 1TK5A 4ILRA 1JJ4A 2XSFA 5IWAF 2OTJS 1JJHA 2ZSIB 2E29A 3TRGA 1D0XA 4UOHA 3OTBA 2IA1A 3H59A 3QYBA 4ZLPA 3SZTA 3DM2A 4WP8A 3Q83A 4B3SJ 1XWLA 4XRSG 1UJ8A 3NAIA 5F9NA 1QA6A 3R5BA 2VICA 2EA4A 2VLAA 2KIFA 3G1OA 4MKAA 1FNOA 1FOWA 3W60A 2NCKL 2A6TA 3QRFF 3ZMSA 1S9EB 1LXNA 3MM7A 4TU8A 1KWMA 3BTLA 1W1WE 1N6QA 2DA3A 4FQGA 3GSIA 1WG1A 3CUQB 1U1LA 2GHVC 1H9GA 4LG3A 1Y11A 1L3VA 2CQ1A 4P96A 4AWXB 1KYZA 1FOXA 2VG7A 4ERDA 4WWSA 1CPZA 3I4PA 2FYXA 3H2UB 3OXGA 4KV8B 4OHXA 1TT5B 2HQFA 2KJWA 3K0LA 2YNHB 1VQ5I 2KJVA 5HROB 1S1VB 5FLMJ 1FK9B 4UW2A 4M8LA 3AJDA 1J5YA 3IC7A 4MK9A 1LDKB 1S5ZA 4X0GA 3HRMA 4IHWA 1MNDA 4LG0A 3ITHA 4C3KA 2KLOA 5J2MA 1F1ZA 1HW5A 1NJZA 2UUAF 2V94A 4E6KG 2NNNA 1D8JA 4G7HF 4IOAF 3BQYA 1ZAOA 2XLKA 3BGRB 3P49B 4XLHA 3J7AN 1LWFA 2NSBA 2Q2EA 4YELA 1S0VA 3DRSA 4BACA 2LKZA 3WQPA 2RHQB 4HBLA 1IAWA 3LQRA 4JUZA 4AL6A 1W5SA 1SAUA 1B99A 4A46A 5IOYA 1CQMA 3OOUA 2NRAC 1ULYA 4EMSA 2D45A 1TWHJ 4HR2A 4M5GA 4M5HA 1WH5A 1J5EF 3SYTA 4DV0F 2AYMA 1T02A 1HDDC 1FRKA 2GXAA 3S3MA 4Y13A 2VFSA 3JXOA 3T8TA 1FVSA 4FNHA 1BWVA 4N41A 5JHUA 3Q8QB 2G9OA 3ZNUA 1IW7F 5K5OA 2LBFB 2QENA 2CQPA 4HH1A 1IKYA 2AKWB 2XBPA 5CYMB 3WIVA 1XJWB 2EV5A 1OCRH 3OUYB 5K1YA 1RQ0A 1JI8A 1B0VA 2B51A 2DB1A 2CW7A 2OIHA 4QWCA 3MCOA 4M5DA 2XI3A 5ADZA 3DRXA 2IS6A 3HKZN 2R7UA 4F67A 1I94J 1ZRCA 3BN7A 3W6KB 3WE3A 3VB2A 1TVRA 3R97A 1KLMB 5AE1A 1VRTA 4ED3A 2WVEA 4IYQA 3RKYA 5FLXK 1UPMB 4KGMA 1F5TA 1KR4A 1SKRA 5KT7A 5B0AA 4HVZA 2G2YA 5ERIA 1JLGB 4JI1F 3ASOH 3H20A 2PT0A 1JKQC 5DLFA 4UUSB 2E2IJ 1R7JA 2V4QA 2AXTC 3ZQFA 2FOWA 5E1XA 4F25A 3TJ8A 1VC5A 5D4OA 2UXDF 4GYGA 3FJ2A 2W00A 1FRHA 4O3MA 5BQTA 4H4OA 1RU1A 3CB4A 1GTEA 3UN5A 1QSLA 2IMOA 1FBQA 1V3FA 1W7PA 4A3BJ 1V3ZA 1WI3A 2HW3A 2NUHA 3A8EA 2LDYA 1WC0A 1JX4A 3OFGA 3HJVA 4LSZB 3S32A 2EB7A 2HU9A 2B7BB 1T95A 1LW0A 3RTRA 3KLVA 4O0NA 5CYQA 2DA6A 4NLRA 1Y5IB 1FOKA 1UEKA 2P7CB 1DPUA 4F92B 4FHTA 4OLOA 1RHQB 4JP8A 2NYXA 4A3JJ 3HHHA 4I2QA 2ME6A 2XMWA 3E3XA 1CC7A 1W2BR 4ZCMA 5ETLA 4DL2A 2ZJQQ 1JJ6C 3AQOA 3OSFA 2XNQA 5IY5H 2A1BA 4BAYA 5EF6A 3BDDA 4WFNQ 1O3TA 2UXCJ 1XR6A 4DCJB 2OTLI 3C16A 4YEAA 5TISC 5HMYA 1PBAA 2P5LC 4BS2A 3PNIA 4KJZA 3DM2B 4L3NA 4G8XA 1PP8F 3VYSB 2HSEB 2PDAA 4B1RA 2KTQA 3KDNA 3VZIA 1R6RA 3JSOA 4UZCA 3MM7B 4DPYA 2BVMA 3ESWB 3H5YA 2G7HA 1N6QB 2P0WA 1DAXA 3CCQS 1RESA 4P9UA 3FBIB 2ALZA 2HYFA 2HVHA 4YHHJ 3F0CA 5E17F 5D3GA 2Y1RI 2VG7B 2UVRA 2XWXA 1YBUA 4XLNF 1BN5A 3GTJJ 4ZP6A 3QATA 1P1LA 4RW4A 3UCZP 3GFZA 1K4SA 3M8RA 5C5JA 4A8WA 2VASA 4NLQA 3PRVA 2VQGA 1A5JA 5CZVA 4ZIVA 2GW8A 2MJUA 1B72B 3TW0A 2GXBA 3PW5A 1K47A 5KFBA 4LG0B 3EVWA 3ITHB 3ZXSA 3FXLA 5J2MB 1HOMA 4ETXA 1V5GA 3G87A 4FBTA 2VJ4A 2Q43A 3J80K 3VAJA 1OPZA 2LYCA 2QLXA 4ZYAA 2Q2EB 3DRSB 3MTJA 2IVFB 2LKSA 1IXRC 5HLFA 1QD1A 1FE0A 1BXNA 1XS9A 4DPUA 5LM7E 1JUSA 2IM0A 4ECXA 4DI6A 3NNCA 2LQJA 1XGOA 4MGRA 2F8MA 1BIAA 2EXUA 4A8MP 2M4GA 4A12A 3A4TA 1MSWD 2DR6A 3R9LA 5HQMA 2IPQX 3T3FA 5DQGA 4B47A 1P4WA 1MLAA 2OPPA 3Q0WA 3KLIA 1OQ3A 1IKYB 2QTWA 4D5CA 3DMJA 3HDDA 1O0PA 4IZZA 5HBMA 2F4MB 3MQ0A 2HNDA 4A3FJ 3GYNA 4IFYA 2R7TA 3PX0A 2B43A 5LEJA 4M63A 2K2PA 3R7SB 3H9JA 3HHGA 1YW7A 2OAZA 4M5DB 1H6KX 2M9KA 5ED4A 4LITA 3MR5A 1KU7A 4ETZA 2L5QA 2VJIA 2HWTA 3ML6A 1LDDA 5JLXA 2F7VA 4KO0A 4NWBA 2RSQA 3BOQA 5LL6d 1VRTB 1HNZJ 3HPGA 3J7YI 1VQ7S 5B1BH 4AUKA 3U02A 3W5ZA 2XS7A 4EJVA 3GTGJ 4M5MA 4P2MA 1MMDA 3BGUA 1IKXA 5A8RA 1RLCL 2CW0F 4MIBA 5E0OA 5F04A 4H4OB 3BM7A 1MH3A 4ZCIA 1X4BA 1NLKL 4WXCA 2FVQA 1W7PB 3E6DA 4HV5A 2Z3YA 4ID5A 3DLEA 2J0SD 1OYDA 1MWQA 2W48A 3VVUA 4Q8EA 3Q8PB 5GAGU 2CPIA 1EQ0A 3LGMA 2JA2A 2PMZA 3MCMA 2DNMA 3VSLA 1SVDA 4G12A 5FKKA 3MAAA 5CYQB 3IRWP 3H7HB 2L0KA 4O3RA 2ROPA 1U9NA 2OZUA 3ZN1A 1RJJA 4MFBA 1Z1ZA 2NYHA 2CPJA 5KOXA 2QSFA 2L01A 5K7FA 1ETVA 4XKBA 1WHYA 2ZC3A 2XSDC 4I2QB 3JRHA 1BW5A 3UDVA 4OV6A 1X3WB 1RTZA 1P2FA 4JI4J 2NUUG 3OTOF 3C16B 4RAFA 3D5MA 3TEDA 1HKTA 4U9RA 1ZQ3P 3RW7A 1AKHA 4YRVA 2FBKA 1CSJA 2L9DA 3OFFA 4XPCA 4AYBN 1VQKS 5M5WJ 1YJ7A 4R8UB 3HVTA 4OJGA 2CFXA 3LOUA 3BROA 3C18A 5L1IA 5BS6A 1GXQA 2HQDA 3BGFA 2K7LA 2VIHA 2X6XA 2IJNA 3M05A 2A6HF 1DLOA 2M8EA 3ZRGA 1RWNB 2ZWPA 3R6LB 1QZYA 3HP6A 2LYVA 2FOKA 3BR9A 1BJAA 5DDOC 5D3GB 4C0OC 2P8IA 1YX2A 1G8XA 4AVPA 3GTKJ 5JXSA 4YOEA 2AZ3A 5IOLA 5F3ZA 1J2XA 3NARA 4RNFA 1IQTA 4ICLA 5LOQA 3I9V2 3CMAI 4V19X 4RW4B 4RW7A 3ONQA 3GWZA 1XEZA 2HNYA 3CNQP 4DV2J 3K58A 3ZMTA 3CCEI 2STTA 3BYPA 4WXOA 2V0NA 1T3NA 1PC4A 2OTJI 3VAMA 2HQNA 4YUDA 4KGXB 1BUXA 1WH7A 2FGCA 4C4WA 2RNGA 4C6AA 1C1BA 5GPCA 3OTDA 4BDZA 1TWGJ 4EK2A 1Q82T 4DCOB 5IYDJ 3PW2A 5HLFB 3IV5A 1A6QA 2YH1A 1DJ0A 1U3EM 4ZVGA 1HYSA 2EV0A 1X2MA 1CULA 3CSKA 3IMQJ 2HI3A 4K4XA 1H3DA 1L0OC 5G4DA 4RWXA 4JV5F 2OPQA 3BBCA 1VZ0A 3CE8A 4CXFA 1ZOTA 1WRJA 4X66F 3ZCOA 2OPPB 3KLIB 1IBMJ 2CUFA 4PJNA 3DMJB 3EVOA 1Y6IA 5HBMB 2HNDB 2VHGA 4IFYB 3OBIA 4QR0A 1F9FA 4WFZA 1UA1A 2DOAA 4W98A 4L74A 5FD1A 3CCMI 3J81Z 2C2NA 4I68A 1FMVA 3KOAA 4CLZA 3LSGA 1HQEA 2FHJD 4RGRA 6FD1A 5ILUA 1U2WA 4E7KA 5IYCJ 1UETA 2DLLA 4KO0B 4NLGA 1XMXA 3QP6A 1FT8A 2IJRA 3PW0A 1NK6A 2FQ4A 1D9AA 1WORA 2FQ3A 4BHBA 1B9NA 1WCMJ 2KZGA 1T03A 2R5ZA 2JC1A 2VKRA 4BDPA 4M6VA 1S9FA 1RTDA 2IRYA 4NYZA 1IKXB 3E01A 2R8JA 5A8RB 3HT3A 1HW9A 2VKZG 1GXPA 2VT3A 2EJRA 3IBCB 1HCRA 2A61A 2N82B 1RUSA 4ID5B 3DLEB 3MKZA 2BABA 1NB2A 4K8RA 2VKEA 1R89A 3WX8A 4IG3A 2BEFA 1N36J 1MU2A 3ABUA 3MMAA 1YLXA 5KT2A 5EN1A 3QSYB 2XSJC 1U4BA 2P81A 2LRDA 2B6AB 3KIOA 2EA2A 3VGUA 4QJVA 3EMTA 4ED7A 2DFEA 3MAAB 2ZVIA 2UV1A 3DGVA 4J01A 1Q78A 1BC6A 3GCXP 4MFBB 1U1PA 1MWZA 5DG9A 2VH7A 5HDNA 4FBUA 3RQIA 3K8VA 1VQPS 4J9PA 2R3VA 1B59A 2QM3A 2QA4G 3FVYA 3KNAA 2M45A 4N9IA 5EGOA 1AKHB 2LQ9A 4BCAA 3QIPA 2B3TB 1KD1T 4CLLA 3HYIA 3UE2A 2CPYA 2JPCA 3HVTB 4WCGA 3PJWA 2V5HG 1U48A 3QGIA 3QZ7A 1LW2A 1OISA 4A3DJ 1WC1A 1OKRA 4RO0A 4ZS6A 3G1LA 1Y0HA 1KNZA 1WFXA 4KMUX 1JKRC 1A9NB 2H1YA 2XF5A 1LV5A 3Q22A 3BZKA 2LC2A 4EM1A 3H90A 4NMXA 1DLOB 2XGPA 4WXWA 3D6FB 4X62F 1JLAA 4O3SA 1RHUB 4N8NA 3K69A 5ICCA 3GIRA 3FZVA 2OCEA 5KFHA 2ICWG 3W63A 5F27A 3O3LA 4CZCA 4HT5A 4B9VA 1FDNA 3L3CA 4ICLB 4X65F 1SQFA 3RYRA 1TK8A 3H0GJ 1PYTA 4RW7B 3M7GA 4K59A 2MZSA 1FE4A 4X4PA 2HNYB 2ZITA 4QYZK 4WK3A 4URQU 2ESNA 2VF3A 1FEXA 5GTIC 1Q4RA 2MXYA 3U21A 1Q8BA 5E1ZB 2G1HA 3H1CA 1C1BB 1BMQB 1K8AT 3CULA 3POTA 3Q9SA 1RABB 1P9YA 1NHAA 3WGIA 2KG1A 2QL7B 3CQZJ 2YH0A 2F4OB 2FMYA 3MEKA 3QU3A 4OQJA 5IT0A 1WWXA 3M9MB 2IEKA 1FYLA 4G65A 1FEEA 1SMTA 3W64A 4BLGA 1HYSB 1Q8IA 3F44A 1CULB 3CCQI 2HGMA 3T5XA 2HR3A 2PBIA 4B48A 2OPQB 2G13A 4Y34A 2NNYA 4YR0A 1VQSA 1M0SA 2BXYA 1FWPA 3BQZA 5J2PA 4ALZA 2NOGA 4OYXA 2KZVA 3ZMZA 1OY9A 1O7FA 2M88A 4P71A 1GT8A 4LF8F 4F02A 2CV1A 1HR0J 1X9MA 2XMAA 4QR2A 2QCOA 3NGRA 3BPDA 2BGCA 3W62A 1KS2A 3GJTB 1Q86T 3QOEA 3DDKA 3VAFA 2C3OA 1J5EJ 2X3DA 4ZN3A 3CJ8A 3UD3P 2XROA 5H1SV 1JGGA 4J9VA 4NHJA 2K4JA 1S7IA 1HQEB 4O0IA 1QSSA 1SD5A 3PZPA 3D2WA 4A0XA 3EGZA 3I71A 3M8ZA 2JA6J 3K70C 3SQNA 1VRQC 2YU3A 3RIRA 3A8KA 1T03B 2R5ZB 5L3FA 1RTDB 2CRGA 1BC7C 5AJ3F 1WF1A 3MAHA 2XYPB 3E01B 5GTHC 2KFYA 2HHSA 1V3RA 3VSKA 3SJMA 1U6ZA 3BJAA 1HWJA 3HSJA 3C2BA 1JHFA 2MLGA 4K0KF 5HLGA 4OI1A 4UY8T 4RM3A 2OSQA 3BYRA 2BKPA 5B0EA 3ULHA 1RKJA 3ETOA 4U88A 3MAJA 4IG3B 4OOIA 4W92B 4LQ9A 3WC2A 1MU2B 2Y1IA 5HS9A 3MMAB 1RT3A 4ZYHA 3KUGA 4V2GA 4LF1A 1XTAA 5KG2A 3HRUA 4P9FA 1MW7A 2JVOA 4DLEA 1RCOB 1M5PC 1N33J 4DV5F 2DTZA 3TO8A 2KB2A 2DJNA 2QT7A 2BOPA 4ZP7A 2QV6A 1EB0A 4XONA 3GVAA 3VF0B 4AL5A 3V5RA 1LKZA 4GKJJ 3CMEI 2OJED 2QL9B 1HKQA 5HDKA 4DQQA 3NAUA 3DYAA 3IH3A 3L2VA 2HPUA 2GGPA 3MKYB 1E2XA 2E5NA 2P4WA 4J91A 5D78A 4KYWA 1SQEA 2AYEA 1AHDP 1I39A 2E1MB 3M2VA 1SJ3P 1VQ7I 2D3OR 5EGOB 3JYTA 3QIPB 1XN7A 4I64A 2VKHA 2Z33A 3DLKA 2CJXB 2B4UA 4B4CA 5DZ7A 3FXRA 4HOBA 1RWKB 2QUFA 1NPPA 1RNLA 1OSDA 1RAGB 3H4DA 3HFVA 5C44J 4F4YA 2AHQA 4IHYA 1RZ4A 1LFWA 2DH9A 2NZCA 2YX4A 3CCJS 2V9PA 3TOQA 1SVOA 3MEGA 3JW4A 4XN3A 5F0CA 5IFMA 2WB1A 1HW2A 3H3ZA 2V7FA 4CH1A 1JLAB 4EFAC 4LRCA 5H9EJ 5EDNA 4PCQA 4AT1B 1FXRA 2PQ8A 3DLAA 2O67A 1SJFA 4DPTA 3JREA 2FJXA 1NDLA 5CD4H 3GEZA 3NGUA 2HVSA 2Y75A 3SDGA 3TGNA 5BR8F 3TZXA 3OL3A 1O3RA 1WZ2A 2ZFHA 5HNHA 4L73A 5ILSA 4BC7A 3HFKA 2LEPA 1K73T 3S1NJ 3BG7A 2W8LA 2EFOA 3FF5A 2WV0A 5KOWA 3I31A 2XB0X 4YIIA 3RJPA 3AY0A 4IQMA 3MPUB 3OQ2A 3KEYA 5D5VB 2JA7J 4LR8A 2XAGA 5AXKA 2K7KA 3NEKA 1BI1A 4KJIA 3POTB 3RB3A 3PX4A 2WTFA 4ZZLA 1VQKI 4RAZA 1R27B 1NEEA 4NRTA 2GWRA 1FP1D 3QIDA 4LF5J 4LMYA 3TP2A 3V81A 2LK2A 4M5JA 1FNXH 1VQ6S 4CNZA 2ASLA 3DEEA 3TEGA 2ZJPQ 1UCRA 1FKPA 2VFTA 1APSA 3UPFA 4EYHB 1YRUA 1JLQA 4FF1A 1AXQA 3HVRA 4L9TA 1IN0A 4FISA 4ZPWR 1U6GA 3WTVC 4LIRA 4LQ3A 5C4JJ 3K0JA 2O8KA 4ES1A 2QSGX 4NNJA 1ZPVA 3LNQA 3OVBA 3CJSA 3T6BA 3EXCX 1R8AA 5J2PB 1YLFA 1WKLA 2AJFE 2XY6A 4MQVA 2GJFA 2B9SA 2B0GA 4X4SA 2MKSA 3V4MA 1S4EA 1HXDA 3ELKA 2BOAA 1GUUA 3UO0A 2RHSB 4OX7A 4U67Q 3TUPA 5BYSA 5E8GA 2MGZA 1TAUA 1QBJA 4DX5A 3NBPA 2BE9B 4BS9A 1UVLA 3FFIA 1Q1KA 2FJBB 4KQZA 3MZHA 3OSPA 1OCTC 2F8EX 5L38A 2W4PA 1ROFA 3PHTA 1NSAA 1Q1HA 2ZJRQ 2OSRA 2FUG9 2F4FA 4XO0A 5DS9A 3SQGA 1HI1A 2OLWA 1N32J 1FYKA 3Q86A 1FTZA 5KFPA 2DR8A 1UTAA 3PEHA 4M5KA 4PWWA 3PYFA 4BJ5C 2PG4A 2V1NA 4BHPA 2FD2A 3LA2A 1WEXA 4NYPA 2RILA 1U25A 1S77D 1J59A 2K3PA 4QWQA 2B4PA 2BJDA 5B0FA 1CJVA 1RBOB 2LXUA 1IRXA 1RT3B 3G71S 1ZAVA 3CDUA 5D0GA 2HFSA 3AXMA 4TY9A 4JX5A 4OMYA 4ZIWA 1KBRA 2DY9A 2QF7A 2CQKA 4NE9C 2QA2A 3DLLF 4MJKA 2DIVA 1RT2A 2X1GA 1KOHA 3O3KA 2XMTA 3RPQA 3QBCA 4RAGA 5IYBJ 2L9RA 4KSEB 4A8FA 2UV8A 2HHWA 4UB6C 1UVKA 4LF9J 3PJRA 2B63J 1DURA 4C11A 3OIPA 3S17J 2I5JA 1W5CC 4YY3J 2RDIA 3DYAB 4XKCA 3A03A 2GGPB 4L0ZB 5HJXA 2GVDA 1X9WA 5E3LA 3FBNB 4L5IA 2UUWA 5A8WA 3GZNB 3CZ6A 4DR7F 3M2VB 2VBYA 4C3LA 3JYTB 2V8PA 3EPGA 3DLHA 4KH0B 2H51B 2ASJA 3DLKB 4LFAF 5CVRA 1KEKA 2CIMA 5E3OA 2XO7A 3BR3A 3BCBA 1N75A 1YZ7A 4ZH4F 5HS8A 1Q5VA 2RU9A 4UVBA 5ICGA 1IDYA 3HHLA 3MEGB 2MH2A 1IJFB 1POGA 3H25A 1MKMA 3IXQA 3Q8VA 1H7WA 3IAS9 1XTZA 2JUGA 2FRHA 3REOA 3JRCA 3BLYA 4O44A 2DISA 4DR3F 2CS3A 5LSLA 3G6YA 4CA0A 2G9WA 2VE8A 1FBSA 5GAHJ 2ZH4A 2DN0A 1YJTA 3TUIC 4NZ7A 2L9VA 5ILVA 2DHAA 4X2BA 1P27B 4Q5SF 4LREA 1KQ9A 5K14A 4F36A 4EVIA 2CWKA 2I10A 3T0YA 3WDOA 4I01A 1VQPI 2LLZA 2ZH6A 2RNEA 1HC8A 3L9ZA 3CCTA 4RA2A 1YWXA 3HOXJ 4X64J 4XORA 4K7QA 1WHWA 2DGWA 2R7VA 2W82A 1GEHA 3DWLE 1BE4A 4LFCF 2DTJA 5HVQC 4JI0F 4DWIA 3A01A 1LK5A 3I0RA 3V81B 2AEMA 1YFHA 3SEZA 4PSXA 1Y5NB 1FKPB 4Q4ZF 3PIPQ 4DV4J 1JLQB 2RVCA 4EO6A 1PG5B 3D5SC 3GUDA 2JUCA 3TW6A 1HL6A 2HQRA 1GQEA 2PMHA 2VA2A 1X8DA 3ZZYA 4IPAA 2QE5A 2UZAA 2NS7A 3H2VE 4HNTA 2VC1A 4A0ZA 5F0FA 3ISPA 3DEWA 4RW9A 1TKDA 4B3RJ 3RGIA 1A7GE 4DL6A 2FZGB 1RHMB 4C8ZA 2MG4A 2KJCA 4PFOA 2VE9A 1X5OA 2NQPA 2DCEA 3JQMA 1SXLA 1G59A 4M3GA 3JQKA 4CTAB 2GNKA 2MGZB 1FX2A 1UL3A 1I1GA 4ECWA 3TYTA 4HYEA 2B9WA 2NXJA 5KG1A 3NBPB 4JV5J 2P6TA 2VBWA 4KPCA 1B7YB 1Y1WJ 3N05A 2LDIA 1HD1A 2C2KB 2DT9A 2E7WA 1T8IA 3ZC4A 1PYVA 2WB4A 1ZKGA 2ABYA 1ELOA 4I69A 4NZ0A 3TNVA 2W2NP 3E51A 4K50A 2W4DA 2DMTA 3SQGB 1J9IA 2IAJA 4CCOA 3R5JB 4X4RA 2V4RA 4LVOP 2HVZA 3L2WA 7AT1B 2OCCH 2GAUA 3RPUA 1Z7LA 4NB5A 5DQIA 3D0SA 1KLNA 4XK8C 2MTLA 2O01C 5E3RA 3I58A 4CLFA 1CJVB 3D6HB 2NVYJ 4NA3A 2ZSHB 2EK1A 1KQSR 3ZQGA 3CD5A 4KAIA 1JLCA 4BXFA 3EETA 5D4NA 1XNRF 1OR7A 3FBEA 3R5AA 3S16J 1RT2B 2F4VJ 2OPSA 2CW8A 3N6LA 1EX8A 1K83J 5IT9Y 3D7SB 4ECUA 3H2LA 3H3UA 4C11B 3KNGA 3BDPA 3P9CA 1B8IA 4LFBJ 3TO7A 1LUJB 5CYJA 2I5JB 4AQYF 2TDXA 3OPKA 1V6HA 3TI0A 1YRNA 2GVDB 4OINF 1WACA 3E6CC 1MROA 3MZ8A 5A8WB 4F52A 3R27A 1NO8A 3OL9A 3S14J 3RRKA 1M1EB 5I4MA 3ETMA 1FY7A 4PWUA 2QMWA 4P2SA 4G3IA 1BD6A 4P2FA 4DV6F 5J4YA 4Q44A 2ZBPA 4XIUA 4OZ3A 3GTOJ 5E3CA 5BJRA 1VNDA 5IM0A 3HHLB 3ZTSA 2BUNA 3K4NA 1GV5A 3ASNH 4IJAA 1U6BA 2J9DA 1GMWD 1S6QA 3K10A 2AQEA 3RJMB 4USIA 1TL1A 1TP7A 2XO6A 5KFXA 4J9RA 1D1BA 4O44B 1H9TA 4AXIA 4G1QA 4OU0A 3BZCA 4IOCQ 3QT8A 4DNCA 1SBRA 3LSJA 4E8UA 4QCLA 2W25A 4G9YA 4OHZA 5ICFA 3T5KA 4K2XA 4NMLA 5K14B 2XG8A 1YI2S 1B64A 2DA4A 2BKOA 4DS4A 4NPOA 4FYDA 4TU7A 2W24A 2FX0A 1MMSA 2CQQA 1S6UA 4RJVA 2VQFJ 2Y0SD 3KG4A 4OAZA 3OYJA 1VOMA 1NK9A 4RWWA 2W1BA 1HBNA 4OHYA 3EICA 5GAEJ 3A01B 2C3MA 3KP7A 3I0RB 4HI1A 5SUHA 3RDIA 1WPKA 4HDUA 4ANCA 4PQUA 3HZGA 3CCJI 1LXJA 4QSHA 3L1PA 1FRMA 3GMEA 2EK5A 3LPYA 2EZKA 1M1KT 2DR5A 1BC8C 3OXLA 2R7WA 3OR2A 4JOMA 2NXEA 3MD3A 2FJVA 4E7LA 4RU9A 4RW9B 1N0VC 2KYXA 2AF6A 5T14A 1ENHA 2H48B 4I0AA 5EG0A 3QWPA 2L08A 3K4KA 4AU7A 2XC7A 1RBAA 4CCLA 1XMQF 1HARA 1E17A 3SV3A 2UUBF 2JPBA 2LDUA 4JI3J 1T33A 3M4XA 2AGOA 1T9UA 1P9QC 2CZ4A 2DNKA 4URSA 4N5SA 2IJFA 3KHGA 2Y48A 3CCWA 1TK0A 1G6BA 2EFQA 4XPEA 2A6EF 2ZM6F 3QZ8A 4C2MJ 2PIIA 2Q1ZB 1HIYA 3M6XA 2IAJB 1VQ6I 2X6WA 4EM2A 2K9NA 1VQMS 4IF4A 2BYCA 1FD8A 3NNAA 1T94A 3C2HA 2JRTA 2AO9A 2E5GA 4B3AA 3JQJA 1N34F 4EU0A 3IH4A 4C3HJ 3VALA 5KFCA 3GP9A 3GV7B 1U47A 2MQLA 2CUYA 2QQ8A 4O3OA 5A2QU 4NC8A 4E98A 2CPZA 2KMUA 1ZLKA 3OXFA 1JLCB 2Z2MA 2DODA 5THWA 2K3IA 1VC6A 4IHTA 2M0MA 2WZ1A 1T9XA 4YP3A 3CPWR 3CC4S 2OPSB 4DX7A 2E9RX 1XN9A 4ZPTR 1L3TA 1O7LA 1YSJA 2HGCA 2BJEA 3H36A 3OR1A 3HSGA 3RBEA 1B8IB 1N5YA 4ZPDA 5GADJ 3G73A 2WADA 5JHFA 2VQCA 2E1AA 4QYRA 3ZTOA 2V6EA 3WU1B 2FQQB 4HQMA 1YRNB 3KLFA 1NJYA 1MROB 3CJNA 3L2QA 4RLFA 4Q0BA 3LAJA 5KG7A 4DV1F 5CJ9A 2FBIA 3R6SA 4A47A 1YX5A 3EQLF 2LKPA 4CLWA 4NC6A 4I6WA 2HQCA 1RWMB 1KVKA 5K5RA 4CP5A 2CPEA 5J3LA 2J8AA 3HM5A 2JH3A 3JRFA 1XQIA 4P10A 3C46A 4IOBA 4U7BA 2HKXA 3O2PE 1FRJA 3D1OA 5IM0B 2ZKZA 3CO6C 2BQRA 3FRYA 1I6HJ 4FKYA 2MBFA 1S6QB 3DEUA 1TL1B 3K6GA 5C24A 1UVNA 3IL2A 3R5CA 2QLBB 5LXYA 3CCRS 1MJBA 1NK2P 4G1QB 3JTGA 4F50A 4MFEA 4ATNA 4QW8A 2F40A 5DM6Q 1PDNC 3BGLA 5A6WA 1SIWB 5DJBA 1WJEA 2YPRA 2EWNA 4MHGA 5LMUF 4QU7A 1EHWA 3HCXA 1LNWA 1JWWA 5CH7B 1TWCJ 3BCAA 2O66A 2V1UA 3L4BC 2DRDA 3DLJA 4PXBA 2QA1A 2BVLA 3T1YJ 2CDRB 5KFLA 2JNJA 1IBLJ 2H6BA 3BN4A 3TVYA 4YB5A 2OFHX 2MH9A 4JI2J 2JC0A 2E1OA 5KT5A 1HBNB 1S48A 4ECYA 2DGUA 2Z0GA 2Y2ZA 1UJ6A 2DO0A 2JMWA 4A48A 3EGNA 3TDUC 4QWEA 4PQUB 5E3QA 1RB0A 4WBFA 3NAHA 2AD9A 2OO4A 4J9QA 2Z2YB 2AS5F 1LQ9A 4CLYA 1N5QA 4DR6F 3QRQA 2K7JA 4NLOA 2K9QA 1N78A 3OR2B 3HPOA 1QRYA 4A5NA 4CO4A 5A76A 1XGNA 2OD5A 3F6OA 4WX9A 1Q16B 4GC7A 2MQMA 4ZTFA 2FJEB 4B09A 2NXUA 4N4NB 3MMYB 2ISYA 3EYYA 2DHXA 3QNWB 4RU2A 3W1YC 3MTKA 4I56A 1NKBA 4A5MA 5EG0B 1OYYA 3WX4A 3RW6A 1E3HA 3M1EA 1BBYA 4OJ3A 3OW2R 3LQVA 4WYWA 3F3XA 2HHPA 1C4CA 1FXLA 2R5YA 2MDAA 3RI4A 2BY2A 1LEOA 4LD5A 5EEHA 4USKA 4B3TF 2J6TA 3GFLA 3KHHA 2V9VA 2EKNA 2XI2A 3DPTA 5F8GA 4QZVB 1LWEA 2NPIA 4O23A 5LBQA 1NK8A 2KJBA 3SHFA 2HWIA 3MM9A 2ZB9A 4IL6C 1YG2A 2RJZA 3RYPA 4ZVFA 1FD2A 1FCAA 3CCVS 1YW8A 1VJQA 3N0VA 2JQ7A 3R7NB 3R5DA 3EZ5A 2BHYA 3NP5A 3OYFA 4NEYA 3GZ6A 3CD0A 4C3MA 2F4IA 3DBLB 4ZP9A 3MFHA 2D9OA 5E20A 3PYGA 2W7PA 3G2BA 3SFIA 3AHPA 3RRHA 1U45A 1X4AA 4Q2MA 3C1DA 1QPIA 1IR1A 4DUYJ 3FHZA 2QQBA 3AAWB 4J9OA 1YITS 1UZDA 1H8AC 2AEFA 4FT8A 2I38A 3OR1B 3QYFA 1Y0NA 3KP2A 3BQ0A 1AW0A 3GILA 1YJ9S 1N5YB 4LLLA 2M30A 3W3CA 3TO6A 4M6XA 3TBIA 4CO3A 2XGCA 2Z57B 4NL5A 2EI5A 3KLFB 1RHJB 5G0RA 1O5JA 3P96A 3AD8C 2OC6A 4Q0BB 1NBEB 2E9ZA 2FLLA 4OX9F 2GOXB 1H73A 2ZOFA 1Z0XA 4J9MA 4A3IJ 2IXSA 3FMRA 7FDRA 4JX6A 4UV8A 4R8HA 1RA6A 1TR0A 3DPUA 2K40A 2UUZA 5FRNA 3D0IE 3L7PA 2VPXB 4ZYEA 4OYPA 2VPLA 3GYGA 4LRFA 2HRYA 3ENQA 3OY9A 4IKAA 1OY6A 2Z16A 3S1RJ 2OUGA 3TX0A 1HBUA 3SV4A 1R6YA 5C24B 2B9EA 2MSYA 1M5HA 2Z58B 4RPFA 2PD1A 1VBYA 1OFCX 4UOFA 1NZAA 2FSWA 2RQPA 3CJ5A 4WXDA 4OYZA 3SIPB 5DO2A 3OYDA 4GDFA 1TL3A 4QIWN 4DZJA 3VAKA 3GTMJ 4RNMA 4RM2A 1J75A 3B4MA 1FJLA 3BSNA 3H5XA 1IQZA 1K6YA 4L76A 4F3QA 3B73A 4FTHA 1P4AA 1FWKA 2QMXA 1R8HA 1RXOB 5CYVA 5LRSA 2YX1A 4OZ1A 2JVHA 5H6RA 1Y1VJ 3ICLA 2FJ1A 3I9V9 3UDCA 4QIWD 5BYQA 4O6JA 1PCAA 5IS2A 3FKIJ 4YFUA 4M1KA 4PJLA 2DHHA 2PO4A 1M90T 2Z2LA 1VQOS 2NYIA 5FFXA 4Y33A 4ENKA 3EX7B 3HT0A 2ACYA 2ZUAA 1YX3A 3X3UA 3MGJA 4N76A 2DAOA 2HDDA 1T98A 3AB4B 3LH2S 5LD2C 1RAHB 3BT9A 1U24A 3CC2S 1VI7A 2XV4S 1CBKA 2I8EA 4IR9A 4LVNP 1M5OC 2HZVA 2DFFA 4GFBA 2U1AA 1T39A 2N3LA 4BGDA 2D74B 3OL7A 4LJZF 2GZOA 2M3AA 1OQ6A 2FTRA 3NMRA 3M9NB 4OI3A 3QJLA 3P7NA 1ZG1A 3LSIA 4XLFA 5D5UB 2FHJA 3GU0A 3IR5B 1YI2I 1QAIA 3I0TA 3FMBA 2O61A 1HD0A 3N6MA 1QAXA 2R5YB 1V54H 2YNFA 1AFIA 4BWMA 2HBQB 2HQAA 2ZNZA 4XOTA 4Y4RA 3T9ZA 1R23A 3MWBA 3KLGA 4UVCA 4DBRA 2CZ9A 1LWEB 5KAKA 1VQ4S 1PJ6A 1TV6A 2CQ3A 3MM9B 4KIFA 5GPAA 2BR0A 1BR2A 3GX4X 4NLUA 2BRKA 2OUMA 1RDRA 2L3DA 3B4DA 2GIQA 1O57A 3S1TA 3CJRB 4WP9A 3HTSB 3VFZA 4ZVHA 3VGVA 2ALYB 1IKWA 2V4JC 3FXJA 4CLSA 4XAKA 1WKJA 4LSLA 1V9OA 1YDLA 2GFFA 3HOWJ 1CLFA 4BBRJ 1NSKL 1MBKA 2BBYA 4CSWA 4YDXA 2R9LA 1RT6A 4J9NA 2TCTA 1RCXB 3CCZA 1Q0NA 1E0EA 5GAEU 2UXXA 4NCAA 4XQFA 2KQRA 2ME0A 3HJEA 3MCZA 3P8BB 2MQPA 3DDIA 3ECOA 3LP1A 4DSJA 3LAKA 2OQGA 2RV8A 2YNGA 4ZA1A 5F8IA 2IDLA 1MH4A 3TOAA 2G1DA 2PI5A 1S0MA 2EBIA 1DGRM 4ANEA 3S8SA 1DTQA 1XMOJ 2CUZA 3BPVA 5G0RB 3DCAA 4XOPA 2VL8A 3W2AA 4C3IJ 2WSFC 2MD0A 3F56A 4HHUA 3R4KA 5E2QA 3MPYA 4B43A 1JB0C 3IM8A 5EDWA 1Y9OA 1VQMI 2IBKA 3EUAA 3UD5A 4GO7X 5E7OB 4W97A 2CUJA 2VBXA 3V7RA 3OLBA 3MFKA 2RF2A 3VQTA 4AQYJ 1U1OA 2DK2A 2PA8D 2BA9A 1VQNI 1DQAA 4KIGA 4QWAA 3OOPA 1S97A 3KZYA 4CYUA 4ZJOA 1WSVA 2QYGA 1DU6A 1MMLA 4LF4F 2WAEA 1HBUB 2KHCA 2Y8WA 3OIOA 2CPHA 2OEJA 3MCNA 4BY1J 2GBYA 4KFCA 3EGVA 1BY9A 2X1EA 1FYMA 4XR6A 3RG6A 1NK7A 3NNHA 3SSSA 3J7YU 3N5BA 1B4AA 1JT6A 4YQWA 2GOMA 2XUBA 2IGNA 4MIMA 1NUEA 2ZC2A 4CZZA 3OHAA 4KHPF 3VVTA 4PWDA 4YB6A 1TL3B 2HZAA 1IBKF 1VK3A 1WHXA 3R0AA 2X48A 5BNGA 2NZ4A 2PX9A 2YWGA 2YBVA 3TZZA 3IG1A 3KPHA 3S01A 2C22A 1F1BB 3RKXA 7FD1A 1RAOA 3OD2A 4DCPB 2YKPA 5I3PA 1HNWF 2JJ7A 3MN2A 5CCMA 4USWA 4E2FB 1K7AA 3UDEA 4F2SA 4RGXA 1QVUA 1SMYF 1FFSB 2HFOA 1GNKA 5HP1A 3HD1A 5CLSA 4HF2A 3PYEA 1MN9A 1H0HB 1QAYA 3SXYA 5CPRB 2NSCA 3CWJA 5KFEA 3WHBA 3VCDA 1I50J 1IM4A 2R8GA 1BLUA 2RMLA 1YBAA 3OYAA 3CCRI 4DL7A 3ZTQA 2CAJA 3VEPA 4AC0A 4IX7A 3IC1A 3MM8A 4CNYA 5C4XJ 2UUTA 3T6JA 4JYAJ 1TL4A 4PK4A 1NU4A 2Q3PA 1R49A 3MUVP 4DUZF 4DYCA 1TLHB 1OCPA 4CLUA 1MMAA 1R8PA 2LLKA 2R8IA 2AJ0A 5KFMA 4NUBA 4ZJZA 3LAPA 2HYGD 3BG3A 5JI6A 4IOCF 3FSXA 4F4XA 2YS9A 2AMCB 2HZCA 2OKQA 2YWWA 2YNFB 3TA2A 2DPJA 3ZZZA 4Q48A 4G6DA 3CDWA 5GMKa 4DR1F 2B4OA 3U2RA 2QFIA 4DQ2A 3KLGB 4HPQA 1WTBA 3SCLE 1JXVA 1JLFA 4OIXA 2F9DA 1WDDA 5T7LA 1TV6B 3LW5C 3BKFA 4ZVRB 4ZLNA 4DW6A 4IO1A 3HM9A 1S6PA 2VQEF 2AXLA 4J19A 1ZBTA 1HNXJ 3FZBA 1XMQJ 1UWBA 1X4HA 2XAQA 1IKWB 2UUBJ 3TQNA 1Q7LB 2HK3A 4LSLB 3O8GA 3CVKA 3M9OB 3LL7A 2HHUA 3Q3SA 3CIZA 5GVQA 4WF2A 3H35A 3M8WA 1RT6B 1S6OA 3I59B 4AIDA 3L2RA 2RDDA 4XNFA 5FROA 3DFGA 3HGYA 4LSNA 3K2ZA 2W01A 2IS2A 5F1RA 2YY3A 5HMXA 1D0EA 3VZHA 5M2UA 2I1RA 2EBGA 1X0FA 1E6VA 3UCUP 3LP1B 1Y3KA 5H9EK 3Q9VA 2YNGB 3QO9A 2GHPA 1YQAA 2LP0A 1N52B 2F5EA 1JXSA 1RAFB 4G1IA 3EVMA 2C3UA 1GXLA 1DTQB 5ETKA 5JJBA 1MBEA 4ZPVR 2ZBQA 4I99C 3SDEA 3US5A 1SD7A 2DNGA 4DL5A 1XDUA 2A05A 5HQ8A 2HLUA 5L9NA 8AT1B 3IH2A 3CF5F 2H5EA 1OS5A 3R5GA 3CCVI 2VKVA 5GAGI 3KK2A 2XMKA 2KYZA 2YWFA 2C28A 4D5FA 5A2QK 4M5NA 5HJYA 4C30A 5J40A 2D5VA 3B54A 2QLJB 2RF2B 4HW0A 3ZN0A 2FJDB 4WK1A 2FLOA 4HDVA 2CWXA 4CYUB 4CCJA 2EIKH 4JI8J 3D1NI 3GIMA 3PG9A 4CT9A 3PY8A 1RU2A 1H2UX 3PHEA 1UHWA 2AV5A 4DN0A 3K70D 2A6OA 3HOZJ 3QQCD 1YITI 1WNEA 2RDPA 3BSCA 1LOUA 1YJ9I 1FOYA 1UVMA 4PWDB 2HGLA 5L1JA 2VXZA 2D69A 4H4MA 3VGSA 2E5JA 1B3TA 1D8ZA 1FBUA 3IG1B 3PVXA 1U1RA 3ISNC 3K7AJ 3DKWA 5IT9Z 2EPFA 3HHNB 1FJCA 3VAHA 4G7ZF 2COBA 3D0HE 3W2VA 4F2RA 3V6DA 1VC0A 3KWMA 1HNVA 3CCUS 3PQKA 2QGUA 2HXIA 2ELKA 1CJTA 3GIIA 2XAFA 3P9KA 3A2KA 3ZR8X 4LB5A 5ETNA 4DDFA 1NTCA 1W26A 5HP1B 3K2YA 2F65A 1AU7A 3AXKA 3OHBA 2ZDPA 3X2QH 2NXCA 4U87A 3KYLA 2KH9A 3FIWA 2ILZA 1AZSA 3MM8B 2GM4A 1A35A 1QU3A 2OPRA 2J6SA 4KV8A 2Q66A 3WG7H 4E0DA 4D7MA 2J76E 1HBMA 1J2VA 3WU2C 2CH0A 3CDEA 1SQGA 4ILMA 1RAJA 1D1UA 3VAIA 4B9UA 2VONA 1GFWB 4NLDA 4OJ1A 1J09A 1VHFA 3UN2A 1D8YA 1VTNC 3IKTA 4H4KA 2YQ1A 2KIMA 3D4JA 4CO5A 2M1BA 2ASDA 1U8SA 2C3PA 5C2CA 2FHOB 2CPXA 1U8RA 1GMUA 1RADB 5DGAA 2JX2A 1ETQA 3C15B 1IDZA 4QPTA 1X5TA 1JLFB 1R0BG 1XIQA 3G6ES 5T7LB 2DCUB 5L1LA 1IVZA 1NK5A 3PKYA 4WYLA 2RD5C 2F63A 3CJ2A 1T08B 1RKIA 3V4IA 4G94A 1J7KA 4X4VA 2F5VA 3O6QA 1S6PB 1VQOI 1KVJA 3KFWX 1M1HA 5DD8A 1UWBB 2BXJA 4HF1A 1EARA 1T2KA 3W5XA 4L9JA 4JP0A 2DK5A 3P5JA 2B7EA 3ZZUA 1U49A 2E7VA 1X31C 2DPUA 3CC2I 2XF7A 3N4MA 3DRRA 3CJ4A 1LFBA 5JVTA 4NLXA 3DDNA 3A4CA 4LSNB 2CZVC 4N47A 3HI9A 2CJQA 4IDKA 3VYUB 3QYYA 1FNNA 3TP3A 1E6VB 4OHVA 2VU5A 4UT4A 3RCOA 3LALA 2ZEJA 1ON2A 3QO9B 3I54A 3HOYJ 3O6BB 2HPIA 1WDTA 1R1UA 1XNQF 2C6YA 4ANJA 1KLMA 2LF7A 2OEKA 1SC4B 2UXBF 2ZMEC 2BM1A 3J81U 4PG6A 3FCWA 3SDEB 2AGQA 4YN3B 1KN6A 2X1AA 1VMBA 2KISA 3DOLA 4B44A 1FO1A 2DH7A 3QRRA 3GFIA 4DSFA 3RB6A 4G7OF 3S1QJ 1H89C 3QJJA 1DARA 5J1RA 4EJTA 1FKOA 2VFVA 2MYSA 3KK2B 1CQTA 1NAQA 3GMGA 1T0FA 2BBEA 3EUHA 3CXCR 1WJCA 1Z6RA 1TMMA 3KLEB 3FEXB 3OMYA 1AA1B 3SZGA 1N4LA 3DOMA 1XMKA 3FXUA 1RWWB 4F0MA 2BDPA 1HW8A 2Y31A 3AL0C 2CJ9A 4ENJA 2RQKA 2WW4A 3FBBA 2KXNB 3W6VA 1UHMA 2IGKA 4OYAA 1QZZA 1TW3A 3T1BA 5C2GA 1D3YA 1VRUA 1S0NA 4CYDA 3OL6A 2CWEA 1CS4A 2KL4A 4RBOA 2D1VA 4BQQA 4UZBA 1X5PA 3H8YA 4JB8B 1UELB 5E18F 2BANA 3L9FA 3QYEA 2Y9ZA 4H4MB 4CCHA 1RPWA 4N8OA 2HHHJ 3ISZA 5D6EA 1TP4A 3O44A 2CQNA 4MYTA 1FTCA 1UWAA 4P74A 4ZCKA 2CRLA 3ULQB 3W2VB 2B9XA 3QSIA 3V6DB 3BH7B 2ZBRA 3ZZRA 5HL7Q 1SFOJ 1HNVB 4LIUA 2VB6A 5HI7A 1DUXC 3QFWA 4DIQA 5ETPA 1TUWA 5J2QA 1CJTB 4NRUA 1V5FA 4I7FA 4Y7NJ 2QKMB 3OYIA 3N97A 5KFIA 5ETTA 5KG3A 1ITPA 3AODA 3CJQA 2UU9J 4K4YA 2EBEA 4ECTA 4KMFA 1QZEA 2HQGA 2K02A 4ED4A 4GC6A 2HKEA 4ZLJA 1IXSB 5J8FA 1VF9A 3DXJF 3PFYA 1GXTA 2FNAA 1UPPA 1U5TA 1AZSB 5JFRA 5TGTA 1XC9A 2PI4A 1ZGJA 2IRUA 2OPRB 3DOKA 3SQOP 2CJJA 1VQ8S 9ATCB 1HBMB 1ACIA 2H1LA 4QBUA 4BBYA 3QFHA 2IAIA 2CDQA 4F4KA 4OWRB 4TLQA 4ZVOB 4B3OA 3U9GA 5DS7A 1IM6A 3BR8A 3F8NA 2HVQA 2JK3A 4NLTA 2C42A 5CD4A 3MAQA 1B72A 3K1NA 3KJQB 4Y3CA 4RDUA 4F93B 1IC8A 2DOFA 4Y2CA 1S7AA 2GHWA 1KA8A 4G6VB 4ZVEA 3LUYA 2LA6A 1RKWA 1OMIA 1V55H 5CVVA 1XCBA 2MPUA 2NOJB 4AIKA 4KIAA 2AIRB 2EG2A 5K9FA 2Q79A 3ZQIA 1ZM2A 5FLXY 3JSYA 3V4IB 1S1TA 1DTTA 1O6XA 4M72A 2P7VB 4USMA 3PUFA 3BQ2A 2PJPA 4DJAA 1GHCA 2WK4A 1DHMA 5JMNA 3WGHA 4PGHA 4MEXF 2RH3A 1SB6A 4ESJA 5U47A 4KH1B 4PXEA 3UN3A 6PAXA 2KKOA 1FT9A 2ZZMA 2UV8G 2D1CA 1R31A 2K4BA 3P9IA 4ZYGA 2GIZA 2BE2A 3DRRB 5J47A 3DTIA 1WKMA 1H74A 4PZJA 3D67A 2ZNYA 3GWCA 5CQEA 2DNHA 3S93A 2AJ1A 3PRDA 1K78A 3ZP5A 4NLWA 4IDKB 3G3ZA 3NS7B 4DR5J 4K4SA 4ZHRA 4MFDA 2QC3A 2EZIA 2W2MP 2ZKTA 5L3CA 2VDIA 1BIBA 2RREA 2Z9OA 5KTQA 4AVZA 1ZGAA 4TNOA 5B0GA 2W9BA 2GMJA 2FMLA 2R4FA 2PMUA 1Y4ZB 1KQ0A 2V9WA 2YQ0A 3S2WA 3LSPA 3CO0P 2G4BA 2EK6A 1ITYA 2HS0A 4Z7CA 3DOLB 5SZTA 3WODF 1HA8A 3RAQA 3I53A 2YKAA 4CM0A 2AQ4A 4IHSA 1FKOB 4M71A 1X4EA 4KC5A 3RUBL 2AU0A 5LGTA 2CQIA 1UAAA 1SVMA 1GMWA 2FNPA 2H8WA 4XBFA 4C48A 2KM8C 3WTZA 1UMJA 2LD5A 4QTRA 3IR6B 1ZRFA 2JFKA 4M3FA 3RR8A 4KFBA 2X51A 2H4WB 3DOMB 2W1OA 4GKKJ 1X1PA 2IIHA 4NDLA 3NS5A 2ADCA 2DGSA 1T9TA 1LE8A 2GQQA 2Z99A 5LMNJ 1N88A 3VR1A 1WSRA 4LRAA 4R79A 4DPOA 1EF4A 1VRUB 3K59A 1REGX 4OIRF 1CS4B 2QYOA 1NSPA 3NMAA 4KISA 4IQXA 2Y3YA 4IR1A 4A8QA 2EFNA 1RI7A 4R1HA 4RNOA 2HWHA 2BANB 1Z21A 1ZYQA 2V6CA 1SFUA 1XSXA 4ECSA 2I8DA 3T1HJ 1RK8A 2Y0SA 1EKSA 1FERA 2ZH2A 1JUMA 4OAYA 1HSJA 2M87A 4LMZA 4DFPA 2Y9HA 5FRMA 5FKMA 2JLFA 4MNUA 2VZ9A 4R8UA 3M2UA 1B70B 3J80Y 1YYVA 2LR8A 3GLLA 3AJ2A 1C4AA 3JAMU 3FQLA 5J2QB 4I7FB 1TZ0A 1PYOB 3G8TA 3OJSA 4E7JA 3MEEB 5EWFA 2BZTA 3CJQB 3HBLA 1ETWA 5DM7Q 2GO9A 1AFJA 1ZGWA 1YKWA 2GIFA 3LWLA 1KU3A 2A0FB 3BR5A 3HB9A 2FF4A 3THVA 2X85A 2Q8KA 4EEFG 5KFQA 2JDJA 3BPSP 5KT3A 1U5TB 4WKYA 2ZXWH 3AA8A 1S99A 1ETXA 2XGXA 3WE2A 1A36A 4J9SA 5DEQA 3DOKB 4DQPA 5FGMA 4YB1P 1BHNA 1HMVA 2NREA 1F2GA 4ESBA 1O3SA 2ROGA 2FJWA 2YVSA 2DQRA 3GV8B 1XMBA 4B3OB 2KKHA 4NA2A 2X7IA 4Q2LA 1U2FA 3ADAC 2F3JA 2JJ4D 3FSYA 1U02A 5EEGA 1OYEA 4M9ZA 2Z5UA 2HPMA 5LJ5Y 4B3SF 1HQUA 4Z2YA 3A8JA 2MLZA 5KT4A 3FHNA 1YHQI 3JB9k 2OQRA 4JX4A 3L2UA 2V26A 3H98A 2MFZA 5J1UA 3CCUI 1EJ9A 2CG4A 4U7UD 2GO8A 5F9LA 3NKYA 3IP4B 2AYGA 1HNIA 5CABA 3HXMA 4LF2A 1S1TB 2MGQA 3PIOQ 1DTTB 5DLGA 2XKOA 2RRNA 2R7DA 4EJUA 3BGOP 3DLLQ 2WVFA 3F73A 3KK3A 5F3TA 3MR6A 4DQIA 1BWEA 2J0WA 5C25A 3V8LA 2L3MA 4KA4A 5JLWA 2GIRA 2K86A 2YWEA 3FK4A 4ZDLA 3PXGa 2BE2B 3K89A 2XDVA 4AUXA 3GZ7A 2V1XA 1IR2A 2ZUGA 1H98A 4NCBA 2DJWA 1REPC 1N5VA 1TELA 3AG1H 1K78B 4U6PA 1P7IA 2DMQA 2GJ2A 3D0GE 2R4GA 5LHHA 5B7WA 4ZHRB 1H0MA 2XZDB 5AONA 3MR7A 2HZDA 4CCKA 4AIHA 2IP2A 2N8GA 2W9BB 1UA0A 3S8PA 1HHSA 3OSGA 2HEKA 1WOSA 3PO2J 1H72C 2DT7B 2K27A 1ZARA 2A5WA 2ACJA 4ZJLA 4NYOA 1SH0A 3UDLA 1YJWS 1R00A 1I3OB 1T9WA 2OZ6A 4OI6A 1FVQA 2D3ZA 1YJNS 4NLVA 3SI8A 2L7MP 3RZDJ 1JQGA 1XB4A 1RYRA 3TOBA 1T0TV 2YTCA 2BJ8A 4Y2IA 3WG9A 4ECQA 1FZPB 5J1PA 5HOOA 2Y1LB 2CNLB 5DG8A 3PV8A 3ZTRA 4KFBB 3T1AA 3E8OA 3OL4A 5IP6A 2B6AA 5F8HA 3HPHA 4LF6J 4AE5A 3GB0A 4BBSJ 2J6UA 1LE8B 4Q8FA 2B7CB 3KYCB 2COMA 3OTCA 1KZHA 3QODA 1IZ1A 4F7VA 2ZE2A 5L3DA 5KFVA 1FTTA 1WELA 3HRTA 1RUOA 1WF0A 2DXFA 6AT1B 1YW9A 2L2OA 2ELHA 2MC4A 2JSPA 3F9KA 2ZXJA 4P52A 4Y2KA 2RKIA 2GAHC 3HZJA 3HKWA 2XPWA 4S04A 3SCJE 4CLKA 4TLRA 3M2UB 1GXUA 5E3PA 3JRAA 2U2FA 2RU3A 3H5RA 3Q0VA 1IRFA 2DD8S 2E2JJ 1D0ZA 1OMSA 1SFKA 3MM6B 4KY3A 1KQKA 1YS7A 4FXVA 2HHQA 3KG1A 1K0TA 5M3MJ 2HVDA 2VBZA 2XLIA 1ON1A 3D1HA 1IRZA 4BH9A 1RAIB 3DBHB 5HQLA 2I6WA 3WTSC 4NX9A 3N28A 1F4KA 2DR7A 1FPQA 2QRRA 2TRTA 1HMVB 2MSSA 3HF5A 2QEXI 2HQ3A 3GV5B 1WHVA 3BO2A 3Q5FA 2UXCF 5D8KB 1FRLA 3M8SA 1JJ2R 1RR7A 9ANTA 2ZBCA 2KFDA 1MGTA 4FYYB 4DR4J 2VPZB 3Q8RB 1GX6A 3TJ9A 1HQUB 5F8LA 4LR9A 2GVZA 5DRKA 1T9YA 2HWVA 5DD4A 4K5SA 4K2JA 3I3LA 4KNYA 5KG0A 2NVTJ 3LAMA 3VWSA 4ENOA 5HDGA 3ENAA 1YOVB 4I67A 1VBZA 3MMCA 2RS2A 4L0YB 1ZH5A 1HNIB 2NLWA 3C3LA 2MY8A 3CUQC 4I2OA 4V2FA 3TL4X 3I4NJ 4FS1A 3AKZA 4DQSA 1PVEA 3TA0A 3H9GA 3EGWB 3KK3B 3ILJA 4YHHF 3OSNA 3Q24A 3SFUA 5C25B 5IOZA 3OT9A 2ZFWA 4NXNJ 1SVLA 4P1WA 3F6VA 1BJZA 1G3TA 4R0JA 4Z37A 4P2XA 2BVZA 4A3EJ 4WE1A 2M4MA 3DKDA 2KXHA 1BGXT 3MEXA 1VQ8I 2MZRA 5DQHA 2QQ9A 4B08A 4U8VA 4I76A 2DGTA 4JV2A 4Z7YA 1AUSL 3RRGA 2MD5A 2E5HA 4J9LA 3BBFA 4MK7A 2HKOA 1K4TA 4WFYA 1NZ8A 3M6WA 4O3QA 2EV6A 2A68F 1I3QJ 3AD7C 3Q0UA 2H94A 3K8WA 5HMZA 1BR1A 1YJVA 2R7OA 2DHGA 2FPHX 1R7IA 3D28A 3FM5A 2LSOA 2F2EA 5KAIC 4QOTA 1F43A 1TL8A 5KNLA 8RUCA 3P45B 5IPAA 5HODA 1E6YA 2LEBA 2WOMA 3H5SA 3V7CA 2QFJA 4C8KA 3CC7S 2DEIA 2W2OP 5ICEA 5FB2A 1NK0A 4BL0B 4PABA 1RISA 3QQAA 2IY5B 2CQ4A 3Q89A 1C2PA 4MKYA 1XNQJ 3G4SS 2O7OA 2MHNA 1BOAA 1MBJA 5A0YB 2G7UA 1UMQA 4D7NA 4MO7A 2HQ5A 2M7AA 3LA3A 2HFUA 3MKWB 2PFDA 1L3KA 4RW8A 3MXHP 4B02A 1Z67A 1VFJA 4XMYA 4B8XA 2MHEA 1QAJA 2M34A 2ZE2B 5HVHA 1WG5A 5A2QZ 3F41A 3CP8A 5F0UA 1PYSB 2W2QP 3J81K 1BI2A 5L9XA 1RACB 2N7YA 1CJKA 1RWXB 2AGPA 1DY3A 3CDHA 4RNHA 2R42A 1S7HA 1Y8RB 2OFGX 1HNZF 1EQMA 2R0QC 4I98B 3W7BA 3FBFA 2RKIB 4RW6A 2YWKA 3DU6A 2ETHA 3DKYA 4UTGA 1ZR4A 1XMAA 5DZ6A 4F3MA 3NWSA 4KHRA 3IKVA 2XS5A 5DCFA 5FKNA 4DFKA 4N7TA 3QPIA 4ZDOA 4PYDA 4N9HA 5IP9J 2KN4A 2VQLA 2ECBA 2DFHA 3RAMA 5F0WA 3TVKA 4DFJA 1CGPA 1IN7A 5IWAJ 4E70A 2VA3A 4CWBA 4LBIA 3M1VA 3G6VA 1X9SA 4CLPA 3L09A 3L2CA 4PXDA 4UVAA 2QMUB 3GFMA 1NHVA 2BV3A 4RB2C 4FX4A 2KRBA 4Y00A 2ILYA 1I1SA 2WTEA 1S4FA 1B1BA 1TNSA 2HYIB 2KL8A 3CD7A 4JI4F 4O4RA 1GTHA 4D0PA 2E66A 4HAMA 4LUBA 1VI0A 2N4CA 4D9JA 3VYTB 3SEOA 4FYVB 1OQYA 3ZFVA 2FA5A 1EA3A 4HLXA 4FVMA 3D66A 2UUCF 1NH3A 3GFHA 3D5LA 2GVZB 2KFZA 1X1BA 3AAFA 2J9DE 2V68A 3J7AO 2J8SA 4OI4A 4P7VA 2L9NA 2J9EA 1QPMA 3MMCB 4ILLA 1NJIT 4AIJA 1SCJB 1S72S 2NAZA 4HTJA 2ZWOA 1HI0P 2AHOB 3FWEA 5KFZA 4KYZA 1ZYRF 2RAQA 2UUAJ 1ZM3A 5C3EJ 1V5VA 2BHZA 3KP3A 2RE1A 5LEKA 3U1LA 2H65B 1NKCA 4DZPA 1P7JA 4WE1B 3PRBA 1ZM9A 5K5MA 1QLNA 4MMOA 4HT7A 3GO5A 1KTVA 4I0WA 4DV2F 1QGPA 2WWYA 3RBDA 3HVAA 2XY5A 1FRXA 1E3PA 1CVJA 1NXIA 3HSDA 1RRJA 4A8XA 2MKCA 1VK8A 2CXEA 3FRZA 1EKEA 2GZWA 2J7KA 2Q6CA 3CUOA 1N77A 3KYDB 3BC8A 3A3NB 4DV0J 1DGWY 3D6TB 4ECRA 1YQHA 1ZREA 3ABLH 2A3SA 1LNQA 3W6JB 4K4WA 1X4PA 3TP0A 3S2DJ 1WF2A 1RHRB 1ZZFA 3DP7A 2JRSA 5CVIA 1IO2A 2ZH9A 3T5JA 2EFWA 5BOXA 4RBTA 1F0XA 3SSRA 1PAUB 3LSHA 4RBVA 1E6YB 3KLHA 2WOMB 1SC7A 3MF5A 4EATA 2DFIA 3H0PA 5GP9A 3M9AA 5DGBA 2MC3A 1U0HA 4K4ZA 4TY8A 3ERMA 1SC6A 3HVWA 4F8RA 2VN2A 3KLNA 1BI3A 3D9BA 3MOJB 3PQJA 3CDIA 4L9NA 4WKRA 1SFEA 2OV7A 2ZZTA 1LEBA 4OZNA 4RX6A 1KQ8A 1IBMF 4ED5A 2Z2SB 4ON0A 4Y2MA 3R1LA 1GH8A 3IUOA 4RW8B 1WI9A 1Y10A 2V6AA 4JI1J 3S3NA 2RKHA 2DJIA 3M8QB 2UXDJ 4PKDB 2ID3A 2AEJA 2E7XA 2QSWA 5AIQA 2CYYA 2RDJA 2M0CA 5HATA 3CP2A 3TAQA 1VIOA 3ECHA 1CJKB 3MKLA 3ROUA 2M4KA 2RUSA 1N25A 1XDSA 5B08A 4IO9Q 2KT5A 2HIYA 2OA4A 2MZ1A 3E2EA 3Q0AA 4X4QA 4RW6B 1TNTA 4BU2A 2XSJA 3PSFA 3UD4P 2R7ZJ 4BWJA 3ZMVA 5JUMA 1IXCA 2XASA 5EZHA 2NR0A 1YJWI 1S12A 4OJHA 1TKXA 3QT6A 1BW6A 1TFWA 1YJNI 3Q2SC 2HNZA 3C2PA 2C2EA 3B6AA 1XX5A 4YR2A 2WY8Q 1KGSA 2EC2A 2EINH 3NLCA 2GV1A 1PGZA 1ETKA 1URNA 1F5AA 2DNRA 3HRSA 1FJGF 3M1VB 1MBHA 3VYRB 3MMBA 5F1JA 1KQFB 5AE2A 3TVZA 1R3NA 3NCPA 4FX0A 4USTA 3HD2A 4DMZA 5HSPA 4BXUA 3KZIC 5E3NA 4M3DA 4WWCA 3PNVA 4FVCA 4BQAA 2E19A 2L9SA 1SV5A 4PEOA 3BTIA 2HHVA 3CCLS 3ENVA 1M5KC 5J6XA 2MQOA 4PUOB 3TUZC 1LWXA 2K1RA 8ATCB 3FBCA 1MD0A 2MLXA 3HXLA 3K57A 2ERRA 5CKTA 1NHUA 4ER8A 2RS8A 3JRIA 1VS3A 4K5RA 2MQQA 2IM3A 4N4OB 3MURP 4DEZA 3JAMK 1SJ4P 1Y0UA 4PR6A 3R6GB 3DBRB 2F6CA 3KMSA 3G96A 5BPIA 1K0VA 4KT5C 4HL9A 4KBIA 1S10A 2L02A 3CMAS 3SCIE 4P5OA 1TKTA 4IG0A 2JTVA 2IVMA 4KB7A 5BMZA 3CCES 1WG4A 1EKRA 3J7ZI 2DDAA 3MDFA 1KC8T 2J5PA 2LY2A 1RGVA 2WVDA 2AZ1A 1TUVA 1HA1A 2DA1A 3KP4A 3GE9A 3EWGA 1I5OB 1XG1A 2ZXHA 4WCEQ 3E5XA 3LWFA 4BUPA 1WTFA 4A0YA 3OYKA 3HHEA 2LCWA 2IT0A 1SKWA 1VBXA 1X0PA 4RUBA 3HOTA 3CMQA 5DM7F 4JV1A 1F5CA 2MEWA 1R5GA 3WTWC 1JT0A 3Q2TC 4MLOA 1QY7A 2YKOA 4DX8H 2UVVA 5L1KA 3MZYA 2VODA 3J7ZT 2IBDA 1SIZA 4CTAA 1M5SA 1V3SA 2R7FA 5GAHI 1Z91A 1Q5YA 1NPRA 4EQQA 2XY7A 1NNDA 4JBCA 3UR3C 2UVUA 1KTQA 4BJ6C 3ILLA 1UAWA 4I6AA 4EGYA 1TWFJ 3AG3H 1QHGA 2LY1A 3S3OA 2MJNA 3LA0A 1NRKA 4BQOA 2DGQA 4F04B 2CG8A 4V19J 1NHKL 3BZ6A 1QVFR 3I4MJ 5KFJA 3KLHB 3M8EA 3G9CA 4FF3A 1RUNA 4NEZA 4P73A 3CCMS 4P9SA 2JEGA 4OIQF 2BW7A 4ED8A 2YR2A 5LSOA 1U0HB 4TY8B 3L00A 1SJQA 3U1MA 3S15J 3TEHB 4RS8A 2CJBA 2HOEA 3THPA 4FN5A 1YIJS 5DUIA 5B5EC 2AQFA 3JTHA 5FLXZ 1JHHA 1XCVA 2KZMA 4PFPA 3CJKB 3ZO7A 4Z2XA 3PIOF 2MKHA 1HR0F 2X1DA 2W7AA 2EH3A 2FVSA 2ZBKA 1CQNA 2E60A 4ETSA 3I5CA 3ZMUA 2ZD1A 1FKAF 4RL1A 4PZVA 1UFKA 4HACA 4RUAA 2KRCA 3MUTP 2HNHA 4FYXB 3RR7A 1HHTP 5E8IA 2FZCB 1AOYA 5ETVA 3GJQB 4JV0A 5CVJA 2AP6A 2A18A 3W9JA 1Q8KA 1Y56A 2WSEC 1P4XA 3EDPA 4ENMA 3AT1B 3V7SA 1P6TA 4KGVB 2XSJB 2WAQN 1B7FA 2XKPA 3VQSA 1Q8LA 3GG0A 1USTA 2PFFB 4DL3A 4II3A 2RN7A 3R2CJ 4I4BA 2D1HA 1FX4A 1TKXB 2QKLB 2HGNA 4Q47A 2HNZB 3CC7I 2DDBA 4L18B 1LVAA 3TZWA 4ED1A 2R7SA 2WSCC 2EFPA 1ZTTA 3CDLA 2HFNA 2JSXA 9RUBA 3H4BA 3G4SI 4BY7J 2WAQD 5JVGQ 1G3WA 1P6RA 3OTOJ 3MMBB 4E4HA 4OV1A 2J7UA 2MYFA 1N33F 4B17A 3GJRB 5E1WA 2CV0A 3F8FA 1BQMB 4DQRA 4DL0C 2VJJA 5KFNA 5E5NA 4U0VA 4DBQA 3ZTPA 4XM3A 2DO7A 1G4CA 3HKZD 2XHCA 4CO8A 1IXKA 3WBZA 1SV5B 4MT1A 1NJXA 4GKJF 3F23A 2JEFA 5H9FK 3Q8YA 2K1RB 4M74A 4YFXF 1KHVA 5AT1B 3F8BA 1N54B 4DXLA 3H42A 1SANA 3VPRA 1HKSA 1ZS6A 3QT7A 5EX0A 2WONA 2HVIA 3FISA 3OIQA 3GR0A 5LHGA 3WTXC 3NG8A 1G3SA 4A3KJ 4C0BA 2H4YB 3CD6S 2W9AA 4TXSA 4LK0F 2IPOB 2NVQJ 4EBEA 1TKTB 4IG0B 3TWZA 4NLPA 3RZAA 1LFPA 1X1DA 2YPZA 2KDOA 2SXLA 5EGYA 4NI2A 3EPZA 4LK1F 1T56A 2O5DA 5RUBA 2DYRH 4HLYA 3B78A 3I56S 2H09A 1FJEB 2ZHBA 2O6GE 3J80Z 4JI6F 4FE7A 4UQTA 1Y8QB 3OLAA 3MCSA 2HHXA 2MZJA 1DPRA 5LLQA 3PFOA 2LU1A 2FVRA 4ZPAA 1BA5A 3LQQA 3I64A 3ISND 5B1AH 2IC3A 3KEQA 4EBCA 2GQ2A 3DNCA 4F0KA 3QGPA 2M70A 1ZLJA 2AJ4A 2R2TA 1ODDA 2DMUA 2JA5J 4X4OA 1F9HA 3F0NA 5DG7A 2V9KA 1NG7A 3MPWA 5D6FA 1DBDA 2DY1A 5B0BA 3D3CJ 3RBXA 3G8SA 1EETA 4A3CJ 4X66J 4EGZA 2DPIA 5CHCB 2JSCA 2HS3A 2VPWB 3O1LA 2Z1DA 4LF5F 3VTIA 4IHXA 4YB7A 1T3OA 2XGEA 1YG0A 1FEHA 2XMVA 2V2ZA 3H5NA 1KHWA 1RAAB 3M30A 2C2DA 2OPTA 5HAOA 2DR9A 1S72I 1CJUA 4C8YA 2DH8A 3DLBA 2VT2A 2BW2A 3K17A 3SEQA 1HHQA 4QIEA 4HI2A 4XLCA 5GAEI 2H9ZA 2VPRA 4RAYA 3TR5A 2HEOA 4C8NA 2MKYA 3WTYC 4KTQA 1IR0A 1LWFB 2H6CA 2K3FA 2K9LA 3BJOA 3EUKL 3IRXA 2M5YA 3CEDA 4IVNA 2EPIA 2WBMA 3HC7A 3G8QA 1YBTA 1S1XA 4FNIA 1Q81T 1GVDA 2PEHA 1W25A 2ZD1B 3ZZTA 3RZOJ 2CQDA 4HACB 1UJ4A 2DRBA 4PG4A 5CXTA 5K8PA 2STWA 2OGUA 2EILH 4ELVA 4M9XA 4ZJQA 4ES2A 1BI0A 3C7JA 4BE1A 4HX7A 4RZRA 3ILIA 5F0HA 3FMWA 4M94A 3PNTA 4ED0A 5J1EA 3IP0A 2OAUA 2RC4A 2ZH8A 4AXJA 4GYIA 1ERDA 1EH6A 1JNZB 1N32F 3M07A 3P6YC 1WVRA 2RQQA 3FK7A 1MBFA 3PEJA 1FDAA 2XGQA 2C2MB 2Q0OA 3CDBA 2YX7A 1U7LA 3CMES 3PACA 2H8RA 3W66A 3DF8A 2NVXJ 1TT0A 3AOAA 3GONA 3IHUA 4CDGA 3KP6A 1IRGA 1TVRB 1EAYC 2EEYA 3RTVA 3OYCA 1D09B 1R4MB 5E3MA 2MY7A 2DGOA 3N01A 4RR5A 2CUEA 3CMMA 1X4CA 2N4DA 2V8GA 2RB7A 3E0JB 2M7BA 2DNNA 3HSRA 1MIJA 1M1GA 4LF9F 1NJWA 2WV1A 3S7RA 2KHMA 2F5DA 2Y0SN 4XTTA 2HOAA 1B0TA 4YY3F 5KFDA 4F3OA 2BJ7A 1QTMA 4UNOA 2DKOB 4QWBA 3IAM2 2E1MC 3KP5A 1ZTRA 1V5EA 1OSCA 2A2CA 1WGXA 3WHCA 3AH6A 5KFFA 3F72A 2WONB 1LW0B 3GG1A 4X62J 2LEAA 5T41A 3DRPA 5GADI 3FMQA 2VKDA 3CJTA 1T6SA 2XZTB 1X7VA 1PC5A 1HWKA 3W9IA 3EPIA 2J0QD 3N9UC 3OYLA 3HK2A 4X65J 1ZZNA 3SFZA 3WU0A 5J1YA 1UEUA 2JLEA 4Y28C 1JGSA 4M3EA 1LVKA 2APOA 1YGYA 1ZRDA 4NI2B 2LTPA 1IN8A 3A1YG 3P3DA 4ZCL