1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN HP0162
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
1WJBA 3HPGA 1MW7A 1WJEA 3HPHA 4F3QA 1K6YA 1WJFA 1LFPA 1WJAA 1KONA 1WJDA 1WJCA 1E0EA 3F9KA
chains in the Genus database with same CATH superfamily
1NUEA 3CJNA 1SQGA 1DPUA 2GXAA 3PW0A 2OLWA 1UHWA 2DNKA 3IC1A 2OD4A 3M3YJ 4TYBA 3PJRA 2AT1B 1YBAA 3D0IE 4D7MA 5E1XA 3G82B 3OYCA 4NASA 2FNPA 3EMTA 2DXEA 2YKOA 3FM3A 2JEIA 4CYCA 1CJTB 2W01A 1FJLA 3BGOP 1WD6A 4F25A 5JVTA 1LXJA 3CZ6A 3VPRA 1SXLA 2Z3YA 3TO7A 3CLOA 4Q43A 2FZCB 2LMDA 4WFYA 4J5OA 1TL3A 4CTAB 1KQSR 1OCRH 1NK4A 3FBBA 2CPFA 1MMGA 1RXOB 3DOKA 2Y30A 5DUIA 2R8JA 1KP6A 3FMBA 3DN9A 4XKCA 2QWWA 4L76A 2DQRA 1WF1A 3ITHB 5GAHI 3G2BA 1O0PA 2QO3A 2NS0A 3ZP5A 1ETKA 1C1CB 1OCZH 1TWCJ 3NAIA 1RAGB 1OS5A 2BX6A 4A12A 1JX4A 3DOMB 4B3OB 2CWKA 1OCTC 2B56A 3BCAA 3AOAA 1RU2A 4R8UA 3GJSB 1XQIA 5KFWA 1VF9A 1RU1A 3J7A1 4LFCF 5DZ6A 4XICA 1YLFA 1S1XB 5EG0B 4YHHF 5GAEI 2VQHA 2CPEA 2CSOA 2RKIB 3A01B 1MN9A 2VKRA 3GCXP 2GIRA 4CO4A 1MMLA 3NAUA 2UVRA 4OYIA 2IBKA 2F4FA 3HB9A 3NG8A 2OELA 1WI8A 5GADI 1HSJA 5IQ6A 4RJVA 4EMDA 1SJ1A 4ETZA 3BSOA 1P4WA 3M6WA 5JLWA 1DFDA 4WXDA 1IKWA 4GO5X 1CQNA 5HNFA 3Q5FA 3JTNA 4O44A 3V2UC 3NOGA 5B66C 2VA2A 3JRGA 1MMSA 2EV6A 4X65J 2G4BA 2DY9A 3HJEA 3GONA 1PAEX 4PR6A 3FCVA 2HGNA 4Y2KA 2KH9A 7FD1A 3CEDA 3NRVA 4BE0A 3AOCA 5HP1B 4PFPA 3PRDA 2C2ZB 4XLEA 4RW4A 4NMLA 2EWNA 2LSOA 1YW9A 3G4SS 2ZH7A 4U7CA 3LSPA 5DM6F 2AZ1A 3ML6A 1RTIB 3RGIA 2AYMA 4N5SA 2A3JA 2ZBPA 5J47A 2IM2A 3JQJA 3BZQA 2KZMA 3S1TA 3F6OA 1IF1A 4BXFA 4C2TA 1HBUA 4AL7A 1U5TC 2B9WA 2W25A 1U02A 5BYQA 1FKOB 3HMJG 1GXPA 2HBQB 3R4KA 2FU4A 2J6SA 5E8GA 1MSEC 5CKTA 1XMAA 1WHYA 3PVXA 3A4CA 1F36A 4L18B 1IZ1A 1PVEA 3UNYA 3V81B 3MF5A 5A8RB 1Q1VA 4OOIA 2VUGA 2WB4A 2DJNA 4IFYA 2VPWB 3HRUA 4ZCMA 2G0CA 1UFKA 3G4SI 1IKXA 2LC2A 1WWXA 3I4PA 2DTZA 4LIRA 3I55S 4EJOA 1P2FA 1Z1DA 4RGUA 4ED1A 3HIFA 3C6UB 3ZCOA 1OPCA 2OA4A 1R0AB 3NWSA 1MWZA 2HHHJ 4NXMJ 1P1TA 1JT6A 2K3PA 2CPZA 5A6WA 4BLGA 3T3FA 1UFMA 3K2AA 4EUVA 3Q0AA 4AIHA 1YDLA 5C3EJ 4F04B 3B4MA 3IAM9 3SCKE 2ACYA 4L72B 3QPTA 4NCAA 4ECXA 4KHRA 1J5EJ 3VDXA 2ISYA 1D5VA 3KLOA 1EJ9A 3LSGA 1KQGB 2HBZB 3SDBA 3T9ZA 3LAJA 3KDOA 5H9FJ 2B7CB 1I5ZA 3OY9A 3I55I 4II3A 3ENVA 6AT1B 2Y1JA 3GTQJ 3MM9A 2B9SA 4B3SF 1Z21A 4A46A 2W84A 3K1MA 3BG7A 1T0FC 3GLJA 2KM8B 3I64A 2GIQA 1T9TA 2R3VA 2XHWA 2CUFA 3ULHA 3TDZC 2UWMA 3MFHA 1F0XA 2OTLS 4L0ZB 2IPOB 2ZH3A 1ZAWA 2C2EA 3O2IA 1AHDP 4LB5A 4GMKA 3KYDB 3UD5A 2DRAA 3EXYA 4P6QA 3M1VB 3LP1B 3CCSS 2FJAB 2ZITA 2FA5A 2XO7A 1IM4A 3D5LA 1EETB 3MD1A 2DTJA 3OBIA 4D0PA 5J1YA 4OX6A 1D0ZA 3CCWA 3ZMTA 4M1KA 2CV2A 1DUXC 3MM6A 2CUYA 3FBEA 5LSRA 3MEEB 4W97A 2J9CA 3LP2A 2J6TA 2YWEA 1WC5A 2EPFA 3MMJA 2W48A 2GJ2A 1WOPA 3OUYA 1ZARA 4LD5A 3QQCD 1ZREA 4ECWA 3HFKA 3G9CA 3FRZA 3MOZA 2DA2A 4AQYJ 4W1UA 1XMBA 2BM1A 2OTLI 5IOZA 1T0FA 2R8HA 3GFJA 3JRAA 2W7PA 3C19A 2W8LA 4PEOA 2G0EA 5C25B 4QPOA 3OYMA 3CCSI 2DB1A 5L8RC 1WEZA 3WX4A 1HKTA 5IV3A 3EUNA 3HOZJ 2JUGA 3MTJA 3ET6B 3NXZA 1F2HA 1RJJA 2OBPA 1CULA 2C42A 1ODDA 3CDHA 3MZIA 3QQAA 4WXWA 4PABA 5A76A 1YJNS 4XBFA 2NREA 2LF8A 2OAZA 2DHXA 3CJ5A 4DF8A 3OFFA 2L4AA 1BW6A 2R7ZJ 3CCJS 3TX0A 1RUSA 4R5PA 1U9OA 1HLVA 4CLYA 5F0HA 1RT5A 1L3UA 4KMUX 5KFPA 5KHDA 1WOSA 3DDNA 2XYGB 1V9OA 1NLKL 1RT6B 2AGQA 1MZBA 4K50A 4HOBA 2XF7A 1H89C 4MT1A 3THTA 2DK2A 4F7VA 1S0NA 1HYSB 3BH7B 2QZ8A 3QO9A 4JI6F 4IX7A 3VAMA 4LT6A 2J0QD 4NHJA 3CUQB 1BMQB 1GMVA 3VQTA 1SIZA 5DGAA 2GZWA 2WVDA 5EX0A 2HNHA 1YJNI 2OPRB 5H6RA 3KJVB 1BR2A 1CQTA 3RZOJ 3UI3A 2WONA 3H5XA 2MHEA 4J9KA 3WX8A 4AD6A 2WB1A 4BJ6C 2Q1ZB 1XMQF 2FIUA 3CCJI 2RNGA 2BV6A 4A4JA 5EWEA 3P9KA 1Y11A 2H4YB 1W7WA 1VQ5S 4DYRA 1XDSA 5D6FA 4HQEA 4KISA 3L09A 4JYAF 2E7XA 3GV5B 3LH2S 1YYVA 2GM4A 4X62J 4XR6A 2TDXA 5L9NA 2EIMH 4IDKA 3ZQHA 1P9QC 3MD2A 4ZLLA 3V6KA 4K4VA 2IGOA 4JI0J 3HULA 3AD9C 1CJTA 3NWRA 4ECYA 2L01A 4ZPAA 3IA0A 1MMAA 3CVKA 4OHXA 5C4XJ 4U8YA 4OHVA 2ZDOA 1JB0C 1RTJB 3ILIA 4P2FA 1KTVA 1BIAA 5LEJA 2Q66A 2DY1A 4TY8B 1EZZB 2YKAA 1YW8A 1YTYA 4CTAA 3Q3SA 2XPVA 2YTCA 4J9SA 1R22A 1KVJA 5JR3A 5E3LA 5E1ZB 2Y0BB 3BQYA 1OR7C 3BO4A 2ZC4A 1TVRB 2ME6A 3ITHA 2JA2A 1MJ9A 1FVSA 1C1CA 1VQ5I 3M05A 2ZMEB 3OYGA 2HOEA 1AYEA 3PEJA 4A3CJ 4XOTA 1LFWA 1SD7A 2Y48A 2AD9A 2H5JB 1K47A 4DSKA 3DOMA 1UVJA 4B3OA 5ITHA 4KHPF 3FCWA 3GXOA 4YR3A 3D0SA 4UVBA 3CDLA 1QAIA 2Q6CA 2NYIA 3G3ZA 4H0EA 1IRXA 2X9DA 4F4XA 4AT1B 1S1XA 5EG0A 3GTJJ 2LEBA 2ICWG 3A01A 9ANTA 3FWEA 3ZTRA 4P55A 4WCEQ 5JLXA 3ILLA 4YY3J 2Y2ZA 1ZG3A 4HBLA 1I6XA 1Q81T 2BE5F 1D09B 2APOA 3M7GA 2ESHA 4XPCA 2LF7A 3QT5A 4CLTA 1JKOC 4NLYA 5ICEA 1OR7A 1XPXA 4ETSA 5J4YA 3MQ0A 2K7JA 3R97A 1Y10A 5BR8F 4LF8F 3R5BA 4ZA1A 1ZTTA 2A6EF 3CCTA 1KQ8A 2HYGD 1U1KA 3KJFB 2AP6A 4DYCA 3DLGB 1GMWA 3FXKA 1VJQA 3IWFA 4MMOA 5F27A 3TQEA 2CVEA 2HHPA 5E5NA 4ECTA 1SIWB 4RLQA 5HP1A 1HQCA 4OX9J 3R3TA 2HSEB 2OP5A 3S32A 1QUVA 4O3OA 3K10A 3CMAS 3NCRA 4LGWA 1SJFA 3U21A 3JTHA 3FKIJ 3DPTA 5ICCA 2HLTA 1RTIA 3M30B 4C7QA 1YIOA 3C16B 2EA4A 3V6DB 1WDTA 2EFNA 3QP5A 2CAJA 1Q5YA 4XO0A 3B6AA 4XLFA 2VJVA 1FKOA 4N8NA 3V6HA 3QGGA 3HSDA 3EDPA 2LQ9A 2G2YA 1KA8A 1VI7A 3ASOH 5FROA 3V81A 3RR7A 5A8RA 1XEZA 1EX8A 5L9XA 2I9SA 4Y6IA 1F5AA 4LRBA 1JXVA 1IJEB 4CCKA 2BM0A 3GYGA 5THWA 2FHMA 2W2NP 4A3MJ 1FX7A 3JRBA 3DLEB 4KA4A 2WB1N 3QYFA 3I5CA 3AJDA 3NEUA 2WAQA 2IVYA 1RR8C 2O1PA 1MNDA 1XS9A 4M72A 3C6UA 5FLVA 4H4KC 4N9IA 3S7RA 4Y65A 1R0AA 2J6UA 2OFHX 4FP9A 2HQRA 1S4FA 5HSPA 5HOOA 4HX7A 3K7AJ 4CICA 2WVCA 2CO5A 4JI1J 1ZN2A 3TVKA 2DN0A 1B3TA 3MTKA 1RLDA 2A18A 3VAFA 3ZQFA 4UF4A 2KZZA 4C2UA 2QFJA 2W8KA 1NXIA 5K5RA 3DMJB 2OMOA 2W4CA 4A3IJ 1RHMB 3DOLB 4AXIA 1S1UB 3PCOB 5F1RA 2LMIA 2A69F 2F8EX 4MTDA 4IOCQ 3GV8B 1OSCA 2YWGA 4C9YA 2V8DA 3G8TA 4IOAQ 4DQSA 4P52A 3IGVA 1DRZA 3F72A 3KG4A 5L3CA 1VOMA 5D5WB 2XF5A 5J1PA 1ZK8A 2QENA 1J5OB 2HOAA 4NMXA 3SZGA 1BQMB 3FKBA 3SDEB 5DDQC 1U24A 3V5RA 2KVIA 4H4KA 2BJ3A 3F8BA 2YKNB 2GA2A 1BI3A 3M1VA 1PBUA 2VJIA 1B7FA 4DPYA 1JKQC 1K79A 1VQ8S 1DARA 1EETA 1W2IA 1IN5A 3M07A 3BDDA 4A0ZA 3MEEA 2ZH9A 3EYYA 2AXLA 2KRHA 3PRVA 3QGPA 1NPKA 2MLGA 2R7QA 3NY0A 4R1HA 1S4EA 1FYMA 4OZ0A 3H2VE 1S7AA 4M9SA 4ZK7M 1WHUA 1VHFA 2MH9A 2K8GA 4N9HA 2L9WA 3HSJA 3CDEA 1ENHA 3UR0A 3OXFA 2FC8A 3DTIA 4M3DA 5E3NA 4DV4J 4PRFA 3PO3J 4DR6J 3ISNC 1WNEA 2MKYA 2Z5UA 1ZGJA 5C25A 1X5PA 1HARA 1GX5A 1Z2ZA 1VQ8I 4UOFA 4WK8F 1EV7A 3ET6A 1Z05A 4ENOA 4DI6A 2G0JA 3CE8A 4JI3J 4GYGA 2ELKA 4B9NA 2JVGA 4WTOB 2J9DA 3WTTC 2OEKA 3F23A 4MYUA 5KFBA 2W85A 1KGSA 2HOSA 3GX4X 3HD2A 1ZM9A 1L3KA 1L3TA 1ZRCA 2HHTA 4FCYA 3T1BA 2DVIA 3GFXA 5HQLA 2A05A 1R5GA 2EFVA 2V8PA 3U1KA 3GG1A 1YWXA 3GCWP 2IBDA 4M5LA 4B3RF 2HHUA 5JVHQ 4ZPDA 2DDBA 2KFZA 1Z77A 4OJ1A 1XN9A 1RT6A 2RV8A 4DX8H 2ZFUA 1HYSA 4ZVPB 3Q89A 4G6TB 1VGYA 2UUBF 4WKRA 1WZ2A 4QIVA 3H1CA 3CUQA 1POGA 3PUFA 2KKHA 2MBFA 2N3OA 2F2EA 1N52B 2VJ5A 3CIZA 4N76A 2CDQA 2M8DB 4IH5A 3JSMB 2OPRA 4A2UA 4ZDPA 3KJVA 1XR5A 1JUMA 1ZBTA 2ADBA 1ZYRF 2K1RB 3ELKA 2ZNZA 4KKOB 1YX5A 4KIFA 5HANA 2VJJA 1RTZA 3I9ZA 1HOMA 1NH7A 4Y4RA 1I51B 4M5HA 1VQYA 2WAQN 1YLXA 2ZMEC 1BJZA 4NZ6A 3IKTA 2LEPA 2EPIA 1R6YA 4N77A 1NK9A 3CCMS 1LWFB 1XMXA 5H9FK 1F3VA 1ICEB 4ZIVA 7AT1B 4BQQA 1TU0B 4ZCLA 3OYAA 4E2FB 1TT0A 3GPAA 1HNIA 1TZ0A 3N01A 4PJMA 3U7JA 4XL9A 1GVJA 1NKEA 2R7FA 2FVPA 1F1ZA 1RTJA 1K1SA 2M87A 3BR6A 2KJVA 1T8IA 3BGFA 1MJBA 4DGWB 4TY8A 4YR0A 4E0DA 1XNRJ 1HWKA 2V26A 4LLGF 3TQNA 3M9MB 3DI6B 1XX5A 3MCZA 1U6GA 1D9AA 1H3DA 3Q23A 4B9TA 2PJRB 3UWTA 2VKEA 3GYXB 1Z6TA 1BHNA 2Z58B 1N5SA 1SL0A 1TVRA 5ETRA 4Q5VA 1Q5VA 2ZMEA 4R0EA 4OI1A 3PO4A 3MR6A 1X3WB 1F60B 4D5FA 3DF8A 1D0EA 2HWVA 4J9UE 3L2VA 4WXHA 2AGPA 4TLQA 1HI8A 2GA7A 5HMXA 1MBFA 4ZP7A 5M5XJ 1FSEA 2LD5A 1HFEL 1XCVA 2NZCA 2VUMJ 2VBZA 4C8KA 1FTZA 3QJPA 3GTMJ 2DXFA 2HVQA 3BBCA 4ZPCA 2O66A 1T6SA 2W7NA 2XGDA 3L1PA 4K4UA 2R7TA 3H7HB 3ENWA 2F4VJ 4BC9A 4M94A 4OFZA 3F8NA 1T39A 3EGNA 1LEAA 1SAXA 3OXLA 3PRBA 4ANJA 1KOOA 1DTTB 4ES2A 2Q1LA 1BE4A 1HNVB 4BBSJ 1FRXA 3G73A 4MIAA 1SFXA 1FPQA 1KVKA 5D0GA 3D3BJ 4K2XA 4RNNA 4BQOA 3VR1A 3J7YU 2H27A 5AE1A 1Y56A 2CNNB 3OL8A 3K57A 4OU0A 3PHTA 2MKKA 5CHCB 1E6VA 1Q53A 2BRKA 4IOAF 2MQLA 2R3SA 3DLGA 1FK9B 1TWFJ 4JV1A 5KNLA 3RG6A 5M2UA 3S1RJ 2VH7A 3AG2H 1U8WA 2NXJA 1HR0F 4OAYA 3TJAA 3V4MA 4NLSA 2C28A 4HQMA 4NYOA 5EGYA 3K5PA 2LRDA 4UUTA 1R6RA 3HZJA 4P75A 3DP7A 2GMLA 4ED4A 4GO1A 1J7KA 1RAOA 2DITA 1WG5A 1DQAA 2FD2A 4RL1A 4FE4A 3DKXA 3M30A 4KITB 1W5CC 4CM0A 4USWA 4S0HB 4YIFA 2VQGA 5H6QA 3C16A 1RHJB 3DDIA 3PFOA 2RU3A 5L1LA 4ZPTR 3ZPLA 3V6DA 5F8GA 2UXNA 2CQ2A 2EK1A 1C4AA 4CO8A 4N41A 2ID6A 1T3NA 3MECB 2HDDA 4QU7A 3FC9A 1Q1KA 1ZAXA 4OL8A 1B0PA 4WP9A 4ES3A 1SJ4P 1URRA 3D1NI 2VPRA 3OVAA 5BJRA 5IOLA 4JUZA 4A8MP 1SB6A 4F7ZA 4HH1A 3CF5Q 2MDAA 4DUZJ 2GOMA 4OMZA 4J7CA 3DLEA 1LKXA 3A2KA 2VIXA 3M8RA 3RB6A 5GP9A 2M3DA 1U3EM 4WFXA 1ZHFA 5I3UB 4ILRA 3CJ8A 1JLBB 2HIYA 5E33A 2O3DA 5FDLB 2DNNA 5IYCJ 3OL9A 3WU0A 2WCXA 3NAHA 3PTWA 2ZEJA 1Y00A 4MNUA 1SH2A 2XZDB 4FE7A 4MFBB 1AU7A 3I96A 3DMJA 5GAGJ 2AWZA 4F3QA 5IY5H 3DOLA 1RA6A 1S1UA 3FZVA 3MWMA 4I6WA 4DR4J 3OOUA 2A5YB 2W9BB 3BQZA 3ZZYA 2IA1A 1IR1A 1UPMB 1REGX 2HEOA 3VGSA 1VHIA 2KHCA 3EWGA 5HNHA 3ZMVA 1U0HB 2YQ0A 4F36A 3IWXA 3O6QA 3E3VA 1FKPB 3N28A 1J5OA 3NMRA 1OY6A 1H72C 1BQMA 4ASNA 3DXSX 3V7SA 3SDEA 5G0RB 5K8OA 1N36F 3HP6A 4E7LA 2JDJA 3N6NA 1WEYA 3JS9A 4DUYF 1QU3A 5BOXA 3G6XA 2YKNA 2HXIA 3TA2A 1MSFC 4P73A 2HW3A 2K27A 3RDIA 2F40A 3DCAA 5HMZA 4LLLA 4ES1A 2HK3A 4RW6A 3K4JA 3FBCA 4BWMA 2CKWA 2LXUA 4M73A 4BXXJ 4WYLA 2B7BB 4RW7B 4Y0FA 3R7NB 1X1DA 3ERMA 2MJNA 3UN3A 2QUFA 2AIRB 3K5OA 3J80U 5F04A 4V2FA 3QYBA 4ZP6A 3MKWB 3EVMA 3A12A 2VJ4A 4ED7A 4G6DA 4ANDA 1IJFB 1GEHA 3HKZA 2PEBA 4UVAA 4Y3OA 1RLCL 2FTRA 1BM9A 2E5LJ 1GH8A 5EJCA 2JJ7A 2LP0A 2PX9A 1G3OA 1VNDA 3NGDA 2V9WA 3SQOP 5GTIC 1HXDA 3S2WA 4GKKF 1K61A 3D28A 1YW7A 5ILVA 3ABTA 3U02A 2LBFB 3BG9A 3RKXA 4P5OA 3R5GA 4JI4F 1HW8A 2XAQA 3FXQA 2VV5A 3PIPQ 1JJ8C 3GIJA 1M5VC 2L41A 2GBYA 2AJ2A 3MPVA 2D7SA 3KMQA 2DODA 1NBEB 5J1RA 4KAIA 4QYZJ 1X8DA 2XHKA 4DQPA 1HD1A 2AYBA 1YBTA 2EIKH 3IKVA 3LWMA 2VQEJ 4CZCA 3I4MJ 4JV5F 2CW0F 1IGNA 1KLNA 1OPIA 4ECVA 4X64J 5FFZA 1HQ2A 4ECRA 4ZVEA 9RUBA 2VE8A 2XGQA 1S9GB 2V79A 1XMKA 4PG6A 2VHGA 2IRYA 4YB1P 2RDIA 3I87A 2MGZB 2LY9A 4BY1J 3ZC4A 4KGKA 5EHHA 2WTFA 1WSUA 2OV7A 4DG1B 1R7JA 3OYDA 3NS6A 2QX0A 4L73A 4EATA 4NL5A 3I5UA 3SXLA 5DLGA 2F8HA 3C15B 2EW9A 4NB5A 1JNRB 3JSMA 3WODF 3TDUC 5KG4A 4IG3B 1A5JA 4JX6A 2CUJA 3TRGA 2K1RA 1CS4B 2JFDA 5FO5A 4KKOA 4ZVSB 3K70C 4Q44A 2W1OA 4I01A 2ZOMA 2PBIA 2G2OA 2XY7A 1S72S 3CP8A 2QT7A 2WAFA 1NB2A 2CXEA 5HQ8A 1ZAOA 5C2GA 3H5AA 4CCMA 1LWFA 2V6EA 2ADUA 2VICA 3GVAA 3Q0VA 5DGBA 1WJBA 3CJSA 1TWGJ 5B1AH 2X6YA 3WHCA 4OV1A 4Y2IA 3O3KA 1PBAA 2DR7A 2NS1B 3JSBA 5AIPA 4HG2A 4LR8A 1CEZA 4IRDA 1UW4A 5CYQB 2ZSIB 3A1YG 4HX8A 1LQ9A 4I2OA 4ECSA 1Y5NB 2LQ8A 1AFIA 1RKWA 1LOUA 4UVCA 3DI6A 2PJRA 1S72I 1A35A 3Q2TC 2VQLA 2ESNA 1GX6A 1IM6A 3DBRB 5KT2A 2FSWA 3GLLA 5F8LA 3CTRA 4RGXA 4CLUA 2CPYA 4HV5A 2FE3A 3CF5F 2CWEA 2XF6A 2WZ1A 1FMVA 4LMYA 3B54A 4ZN1A 2RKHA 3CJ2A 1DHMA 1OQ3A 4ZH4F 2Z1DA 3O8GA 3A8KA 3F73A 1H0MA 5LGNA 1X9MA 3VYUB 5KAFC 3HGGA 4NLVA 4DL4A 3QRFF 2DHGA 4HH0A 2XI2A 2W1BA 2JN6A 5I3PA 3KP3A 2R7RA 1SUQB 4EM0B 3LA2A 4QIWN 4DUTA 3D7SB 4CNYA 3H5SA 4QYRA 4CLKA 1DTTA 1HNVA 3HKZN 2H65B 1OFCX 2XTJP 1ZG1A 1M0SA 1ZS6A 4UZBA 3L95X 2HKEA 4Q8EA 4LRCA 5EGOB 4A69C 1D5YA 1HW1A 3TZXA 3WQPA 2MQ8A 2DNQA 1LDJA 2CQIA 5F8MA 1FK9A 4DN9A 4RO0A 3J7ZI 2HKOA 2DKOB 1QHGA 2A6TA 4C2MJ 4DV7F 2CUEA 3OV7A 1UCRA 2BKNA 4JI2J 2QLBB 3G6ES 2IAJB 1K4TA 2DH9A 1G2EA 1IG7A 3O3LA 2E1RA 4S04A 3P9CA 1PDNC 3TUZC 4OIOF 1WACA 4XLHA 1X1BA 4M63A 3ZFVA 2COLA 3V4GA 1EH7A 4CH7A 4E70A 2QL9B 2ZZTA 3N0VA 4X66J 1QUPA 2CJKA 5KVRA 4OIRF 1R0CB 1TUVA 3JYTA 3BO2A 5IT9U 3SJMA 1YK9A 3KLHB 1MDMB 1RWOB 1C0TB 3MECA 2P7VB 3CDBA 1O4XA 3MR3A 1RZ4A 2Y69H 1UG2A 3DQVC 5IOYA 2DT7B 2KLOA 5KFZA 2F65A 4HDHA 2F8MA 2RMLA 3AD8C 3K6GA 5DG9A 2KL8A 5HL7Q 5J40A 3TMOA 3G6EI 1CSJA 4C0OC 1P4AA 3ZR8X 2XAUA 1X4HA 1KD1T 3PIPF 3H35A 2MZQA 1Y5LB 2RS2A 3PX4A 2M7AA 5KG3A 1RTHB 1FERA 2M9KA 2R93J 3QIPB 1YX3A 3F3XA 1PJ7A 3W63A 3CCRS 5I3UA 1JLBA 3CGIA 5FDLA 4J19A 1IBKF 3R27A 2QJ3A 2B5JB 4K59A 1IBMJ 2J0SD 1MMDA 2BY0A 4IHVA 2L4MA 2M52A 5BYRA 1JJHA 3BR0A 3U9GA 2Y9ZA 4L9JA 1RC9A 4CT9A 4B3MF 3K5LA 2W9BA 4DN0A 1ON2A 1X5TA 1H88C 1V5EA 1OYWA 1FJGJ 1SH0A 4D5CA 4NLPA 2RIJA 2OD5A 5KFJA 5KFFA 5E2QA 4KFBB 3IXQA 3DV8A 1C4CA 2UXDF 1E6YB 4QU6A 1U0HA 1XDUA 1KQ9A 3VVTA 5B0DA 1UPPA 2M34A 4NEZA 1FKPA 2AEJA 4C2MA 3CCRI 1IXKA 5DQIA 4GDFA 2P4WA 1VRQC 3OSFA 3E97A 1UMJA 2JLGA 1SC1B 5FKOA 1I94F 1N25A 5G0RA 4A6EA 2UU9F 1UJ8A 2WWYA 1BGXT 4OAZA 3HO1A 2KFDA 4ZYDA 1M1KT 1IUFA 4M6YA 3FMSA 2QA1A 5ETLA 2XY5A 3QZ7A 1ORKA 1AOYA 4QR1A 4P9FA 2ASYA 4NA1A 4LIUA 1U45A 1R36A 4RW7A 2ASLA 3B4DA 1P7IA 3M8PB 2MKHA 2CJQA 1IN0A 4BQNA 3K2ZA 3HL2A 3GU0A 1FYKA 2UXCF 5J8FA 3WTWC 1X4AA 2CG8A 4FTHA 1VQ4S 3D0HE 4EQQA 4USUA 1GQEA 3HZGA 3LA7A 3D6FB 3X3UA 2IS2A 3HSFA 1P8GA 1J0RA 3RBZA 4BE2A 3N97A 2Z33A 2AEMA 3RU0A 5C2CA 2LBFA 3H2UB 4CP5A 1KONA 1I6JA 3CD5A 3D3CJ 1FNNA 5L3EA 4KC5A 2XBPA 4XAKA 4J00A 4MEYF 3FF5A 3KKFA 2UVVA 1EB0A 3U27A 4USIA 3TX8A 2AKWB 2KO1A 2DK5A 3BTIA 2BRLA 2O7OA 2Y1RI 3R60A 2AQ4A 3LAPA 3D5MA 2MZTA 1JJCB 1R5ID 2XZWA 5HDGA 3DLBA 4NX9A 4HNVA 1BN5A 1RPWA 2M4MA 4F26A 2XMUA 1S9GA 1GK8A 4I0AA 3BBFA 4ZTFA 1K0TA 5A2QY 1K7AA 3DEWA 4RM3A 2F5GA 1IN8A 4EJVA 3ZQQA 2U2FA 2MGZA 2AJ4A 1QNTA 3V7RA 4TN2A 3BQ2A 3QNWB 1XD7A 1FRHA 3Q0UA 4BKXA 1XMOF 3CCES 4PUOB 1TTHB 3HOTA 2ZM6F 5J2PB 3S15J 2FGOA 1HSTA 2CQKA 1W36C 5J8CA 4DG1A 2ZKZA 2K7LA 2V2VA 4NXNJ 4CDGA 1E17A 1AXQA 1GV5A 3MAJA 3R61A 1NHUA 3C15A 4M5DB 2AQFA 1VRTB 3R0AA 3VSKA 3DGPA 4F4ZA 5LLQA 4IG3A 2FBIA 2DGUA 2DA4A 1CS4A 2AGOA 3DLHA 1WC1A 5M5WJ 3W8GA 4N8OA 3S3OA 4WF9Q 3LWLA 3OIPA 2HU9A 2CMPA 3KK3A 2CNOB 2WB1D 4CO3A 3M6UA 4FPRA 2HRYA 3FXOA 1RUOA 1XG1A 3FBFA 1ZZFA 3D1HA 3RZDJ 4LVNP 1NJWA 4B02A 3HTSB 5LHIA 3QPLA 1X1AA 1FRKA 1V54H 4WIIA 3KG0A 3A3OB 3ZTPA 1WVRA 2GVZB 3CCEI 4J91A 1U6FA 3QU6A 2FVCA 2RGVA 2I10A 3I5AA 3DM2B 3NL0A 5EWFA 2NNYA 2IBOA 3SIPB 5CYQA 4FX0A 3TP3A 4HR2A 1IBLF 4LRDA 2W24A 1JTXA 3S3NA 3R2DJ 3VOEA 2F48A 4XLNF 3BBBA 3CCYA 1JK9B 1XGOA 3UFCX 3DBHB 2DHHA 2F63A 3H59A 2YKPA 2TRTA 3CCVS 2GXBA 1JKHB 1W0UA 3ENQA 4XLCA 4DV2F 1S5ZA 5E3CA 3K4BA 3CJ4A 1SQEA 2X6WA 4C8MA 4QWCA 1KYWA 2AMCB 1D9DA 3NNCA 1WTBA 2HHQA 3OTEA 4FZVA 3F8CA 4LF6J 3A0HC 1UVKA 4B1RA 1GXQA 3TWZA 4BAYA 2VQFJ 4F92B 4J9VA 1DQUA 2QVOA 1XK8A 1KN6A 3AJ2A 3OW2R 3E6MA 2OCEA 5A2QK 2SXLA 2WW4A 3H5UA 4LFBF 2OD6A 2RVCA 2FJVA 1JKRC 1HWIA 2L9DA 4GC6A 5GAEJ 3H3VK 1SUQA 4EBDA 2MLXA 4MEXF 5TJJA 3A8IA 4NNJA 3MEKA 1CPZA 2L0KA 3CCVI 2F3JA 2ABYA 4AL6A 2BJ7A 4J9NA 1RWMB 3THVA 2PD1A 1Q16B 4QYZK 1JXEA 1VMBA 5K5MA 3TEDA 2VDIA 4TVAB 1KC8T 5EGOA 4HVZA 4PYDA 3GIMA 2E66A 3CDIA 2P6TA 2H6CA 1XWLA 1P7JA 1SI9A 3VVUA 2WOMB 3WZ0A 4IRCA 2CRGA 1IXSB 2EZLA 3GUDA 1ZM3A 1GMWD 2WVEA 4WE1B 1T9WA 4WBFA 4JOUA 1TNSA 2P9EA 2FLOA 4JQFA 2IAJA 4MFEA 2WV0A 3T1HF 3DEEA 4DZPA 3BZ6A 2F9DA 1RA7A 2I38A 2EH3A 1NSQA 2WVBA 1NEEA 2KYZA 2M30A 4DQ2A 1S5LC 3ZNUA 2UZKA 3DYAB 2KRBA 5IZHA 3HRMA 2UVUA 2Y0SA 5HS9A 4ERDA 1UEVA 1REVB 3GZ5A 4OIPF 1WGXA 2LDIA 3KLHA 3BM7A 1K73T 2HAIA 3GZ6A 2C3YA 4NYZA 1XBWA 3FEZA 1C0TA 3BR2A 2PIIA 2GAGC 1O3TA 3RYRA 2IRFG 4ZVFA 3ZMZA 3PEHA 2L7MP 3QRRA 3GEZA 3FSXA 2LEAA 5CZVA 2FJEB 4LFCJ 1XTZA 2UP1A 3K59A 2GQQA 4YHHJ 4LFAJ 2GVDB 3CLQA 3QT7A 3L2CA 5K8PA 5HS7A 2CQ3A 2XSJC 2VD3A 1BOBA 1WPKA 2E29A 1RTHA 1KDNA 3K5NA 3QIPA 1ETXA 1R8BA 2OHDA 4OX8A 5E3RA 1OSDA 4CWBA 4FF1A 5EF6A 4NLTA 1Z6RA 5H20A 2BOAA 2W4DA 1ZRDA 2ETHA 4J9QA 3EPIA 2B7EA 3KLFA 2B5JA 3DLKB 2RC4A 3F8FA 4M71A 4X4PA 4IJAA 5LD2C 1DY3A 5LJ5Y 4KYWA 2UUZA 5D4PA 2E1NA 3I82A 4D3HA 3SDGA 3EVWA 2KT0A 1DURA 4HZFA 2CZ4A 2J7WA 3L7PA 3Q0WA 3LSKA 2NRAC 1VBXA 3GFMA 4KFBA 1TK0A 2XAFA 2AHQA 1E6YA 3LW5C 1AT1B 1WJ9A 1RAEB 3E8OA 3HPHA 5DG8A 1R00A 4A47A 3H8YA 3FNNA 1E2XA 1N5VA 2HHWA 3ENAA 1SANA 1MN7A 3UE2A 4CCHA 3KPHA 2K9LA 2DFHA 2XKPA 2FLNA 4ZDOA 3U1DA 4DR5F 1FE4A 3GZ7A 5ETPA 3ISPA 5C24B 2KXFA 2VZ9A 2B8PA 3BG5A 3OFHA 1OCCH 2B51A 4OZLA 3B78A 1Z0XA 5DDRC 4A5MA 1FNXH 3IP4B 5L46A 2ZVSA 4P7TA 1KS2A 4RWWA 4GRIA 1PUFB 1HBNB 2B9YA 4LRFA 1MSWD 4L5IA 3BY6A 1FYLA 4DIQA 3M8PA 2D3OR 5DG7A 4RW8B 2HFNA 4JX5A 1LWEB 3RW7A 2GV1A 2AO9A 1F3FA 5F64A 1D3YA 4U87A 2RNEA 2H1KA 1WEXA 4RDUA 1Z1ZA 3ZZUA 3LSJA 3GIKA 3ILOA 3T9NA 4HTIA 2OFGX 2PFFB 3AFHA 2PI5A 1Y0NA 2R5YB 1V5FA 4LBPA 4U8VA 1KOHA 5DRKA 3MGJA 2CDRB 2L9VA 1DQ8A 1UELB 3JRIA 1U78A 4Q2LA 2V4JB 4RU2A 2CWXA 3RQ4A 1CBKA 3V8JA 3GWZA 2IA2A 3HSGA 3MKLA 1NDPA 3CB4A 2BA9A 4HLBA 1TC3C 3D6HB 5C42A 1Y4ZB 5T14A 2MD0A 2DCLA 3CJRB 4YIRX 2V9KA 5J2NB 2JRMA 2DGSA 1NK2P 2R92J 4L5EA 1DGRM 1VQKS 4USMA 1NJXA 2HZVA 1I1GA 3HVWA 2BE9B 2K3IA 3LTOA 4A8YA 1SV5B 4NZ0A 4YFNF 2QL5B 3V8LA 3CJKB 1UETA 2FX0A 3QLHB 4GVLA 1SMYF 2XO6A 3MURP 2Z2LA 4B3SJ 2C3PA 2XKOA 3ONQA 1S6OA 2I5JA 1HDPA 3OS1A 3R6SA 1HPZB 3MCNA 4FNIA 2STWA 4MTEA 3HOWJ 3EETA 1HBOB 4PUOA 1ZA1B 3NLCA 2VU5A 3GR0A 5J2PA 3FHNA 2NXCA 4DCPB 3NNHA 3LQQA 4M5DA 4DFJA 2PGCA 2PI4A 1GUUA 1VRTA 2GLOA 3PSFA 2QG9B 1VQKI 1MU2B 2MQQA 1RABB 3MUVP 2LH9A 1NM2A 2YNHB 4L75A 1FT9A 3PX6A 5J4VA 3ZZ0A 2RU9A 2V8HA 1MNMC 3JRDA 2M45A 2V7FA 3HOUJ 1KEKA 1T9YA 5IWAF 3HXLA 4N56A 4LF1A 3O2PE 3NQOA 4RPFA 4DV5F 3BZKA 1EKSA 2CW7A 1NKCA 2EFPA 1DJ0A 1NDCA 1RUNA 2DMTA 2GGPB 3OSPA 3K5MA 1WJFA 2W57A 1D1BA 2GVZA 5CA5A 4UXNA 1ZTRA 4ZYAA 5KOWA 1YQAA 2W7OA 2YH0A 3BS9A 3VWSA 3DM2A 3CJ3A 3VZIA 4PXCA 2DFFA 4UV8A 3A3NB 2OEMA 1HQUB 1WORA 1XCBA 4LF7F 3HI9A 4FYXB 2IFXA 2VG5B 4K5RA 4I99C 1FDDA 4FXVA 2FUG2 3RPQA 2L5QA 2BQ3A 1SFEA 2VB6A 3EYIA 2ZBRA 4IXAA 3KUHA 4K4ZA 5DLFA 5J1NA 1OYDA 5HLFB 4O0IA 2QC3A 4OLOA 4TV7A 2V63A 4X2BA 2MYFA 1JKHA 5LGTA 1ETYA 5K14B 3W2AA 4ETXA 2ZBQA 1U47A 1S59A 1ZOTA 2GQCA 3CPWR 2X1BA 2K06A 3ROUA 4D7NA 3UD4P 4UY8T 2RN7A 4F4YA 2ZVIA 3RW6A 4NA2A 1T33A 2CS3A 2C22A 5HLGA 1F1BB 1J5EF 1TMJA 2GMHA 1N32F 4HHHA 4JI6J 5ILSA 3S8PA 4XDCA 2JWNA 1JNZB 5E18F 5K7FA 1R8PA 3IMQJ 3BTJA 4ZTJA 3IR6B 5M2RA 1SH3A 5FRNA 4RUBA 2BMBA 2ISZA 3PQJA 3J7AY 4EJWA 3IS9B 3MAHA 4ZHRB 5KT5A 4DS4A 5B1BH 4PG5A 3HRSA 1XMQJ 3GTLJ 4F52A 2NXNB 4UT4A 1AUDA 1RESA 1YGYA 4K2JA 3WTYC 1FDBA 2XNRA 1GT0C 2QYGA 1KZHA 3M4OJ 4JYAJ 4NZ7A 2EK5A 3T0YA 1V3ZA 1PYSB 2DLLA 2WOMA 5EZGA 2QMUB 2DBBA 1YQHA 1X9SA 1LDDA 4NLOA 2PMUA 4L3KA 4WE1A 1G2HA 5E3QA 5E1WA 2XGPA 1K6OA 3I3LA 1FWZA 2DGVA 2D45A 2G9OA 5KFRA 4AU7A 1X4CA 3I53A 5CABA 3P96A 3BPSP 3DYAA 3HRTA 2PO4A 4LR9A 3SQNA 1NJZA 3HVAA 3H5YA 2IHR1 4U67Q 3H4DA 4NQWB 3D68A 1REVA 3UW1A 2AF6A 1TQLA 2J7KA 3L9ZA 1PILA 2YU3A 2ZHBA 3KNGA 2DR9A 4KY3A 4KHPJ 3BN7A 5KFNA 3ECHA 2XNQA 1FF2A 2CQCA 5CYVA 4DQIA 1ZETA 2G1HA 1JJ2R 5IP6A 2DTRA 4DZ6A 1U1NA 4RMNA 4HF2A 3RB4A 2OQRA 2GVDA 3S1NJ 2IC3B 1X58A 2JJ4D 1B4AA 4JI7F 1KU2A 4PDKA 2ZXJA 3TYTA 1KSPA 3BGLA 4EYHB 4A8XA 2HFOA 3PQKA 2IJRA 3C1DA 3GE9A 4XSZF 2LLKA 3MPWA 3DNCA 2EBIA 1G4CA 5LOQA 1VISA 3MCOA 3DLKA 2O01C 5BR8J 4LF8J 2O5DA 1Q4RA 3L2QA 4LG3A 4BC7A 1N78A 3OS0A 1SKUB 3JQMA 1FI4A 5EZHA 1F5TA 4DBRA 2W4PA 3JTPA 4ZOSA 5IYBJ 2MKIA 4ZLJA 1YS7A 1ETQA 2IM1A 3RTVA 2GHPA 1QSYA 3HT0A 3CD6S 5DO2A 2ZB9A 3QIDA 1SKWA 2XCAA 3OS2A 3ETMA 3HJFA 1X7VA 1HBMA 3NOCA 3R7BB 4ZP9A 3BP8A 2V4JC 2R7UA 3NGKA 5CCMA 1MH4A 3OYHA 5C24A 4FHTA 3AD7C 2KHDA 2D1CA 2CQBA 2OTJS 5F08A 3QYYA 2ZUAA 1LUJB 4D1QA 1T2KA 1LW2B 2BQRA 4S05A 3K8VA 1HBNA 3QFWA 2XI3A 1B6AA 1LJ9A 4AUXA 1N48A 3PW7A 1NJIT 5AONA 4HNUA 2D5VA 1N56A 3VFZA 4RW8A 2ZBIA 3PM9A 4WZQA 2I5UA 3OV8A 1LWEA 1WUUA 1NZAA 2IRXA 3X1LB 3RCOA 3ESWB 1R1UA 2HPMA 1T11A 3LFKA 3CD6I 1DZ5A 4C4WA 4KJZA 3OL6A 4KDPA 1MLAA 1RWUA 1FBUA 3ABKH 4QIWD 1RACB 4BBYA 3D67A 1TQIA 2QLJB 4ED3A 4AYBD 4YUDA 3HG9A 4BCAA 2KZGA 4LJZF 3OYEA 2R5YA 4G7HF 3HKZD 3OTCA 2AHOB 2PFDA 1K44A 1BA5A 2QQ8A 3R1HA 4RLEA 1YO5C 3LQVA 2V4JA 3AOBA 1Y0UA 2OTJI 2PMHA 2J7UA 3I0RB 1QVTA 4CGZA 1TKZA 3JSPA 1LFUP 1FX2A 1I27A 2XS2A 4EBEA 5HDKA 1QY7A 3OXGA 3CJRA 5J2NA 4I76A 5K9FA 2XDVA 2G0IA 1G3YA 3MXHP 1B9MA 1JUSA 2LDYA 3FZBA 3W9JA 3MN2A 3PYDA 4TLRA 3MOJB 3ZQCA 5EX3A 1N5TA 1Q86T 1EQ0A 3FQKA 5FLMJ 1SV5A 4C3KA 5ADZA 1B8IA 3SFGA 1ZA2B 3CDWA 3CJKA 4URQU 2MC4A 2BE7D 1F4KA 3QLHA 2NVYJ 1CC7A 4RW9B 4EO8A 3VODA 4G65A 4C6AA 4N4NB 3GLXA 2OAUA 3T1YF 2E5ZA 3UPFA 3FRYA 4EWTA 4LSZB 2BXJA 3IO1A 1HPZA 4OMFG 1K6YA 1ZGAA 1HBOA 1TK8A 3B02A 2Z2YB 3OYKA 1WJDA 2QRRA 2DA5A 4CCOA 4OJGA 1TL5A 5KFVA 1OMIA 4PK4A 3SHFA 2DIUA 2HNZB 3R8YA 2VC1A 3VAJA 4AWXB 2YNHA 3EQLF 1WDDA 2DNPA 2HS5A 4KJIA 2ADCA 2G7HA 3HD1A 5F0WA 2OO4A 2K9MA 2FNAA 3DTEA 3QMQA 2BVZA 3JB9k 2ZFWA 5KFKA 1B9NA 4EM1A 1H9TA 2RE1A 3QWPA 2HDCA 2GGPA 4ID5A 1O5JA 1JJ6C 3KETA 4ZPVR 2ID3A 4USKA 1IDZA 4DJAA 5LRSA 3L9FA 3MI7X 1R8CA 1JGGA 3OVBA 4LR7A 3DRRB 2LXIA 1HQUA 3C18A 2ZWPA 3ADAC 2XQCA 3OYLA 2VG5A 3O8WA 3AL0B 4OHZA 2VBWA 2KXNB 3VGTA 4CHUA 1ZR4A 4ENMA 2GHVC 2HQFA 1U1PA 2EBEA 2FD5A 5FKMA 5HLFA 1VQ9S 5GTHC 1V6HA 5CVIA 3TAMB 2ZNYA 5K14A 3RR8A 3B6CA 3PYFA 2DH7A 4X4QA 1RHRB 4HSTA 4B3RJ 5GAHU 2FJWA 2ASDA 4X1EA 5GPCA 3O6BB 3S1MJ 1YIJS 1YJRA 4LJMA 3D66A 1ZYQA 2JSCA 1SMTA 1B99A 4HLXA 2UUBJ 3QGHA 1HW5A 1UJ5A 5FLXU 1H38A 2XAGA 3PW4A 2ZH2A 3KHLA 4D3GA 1XC5A 2H4WB 1D0XA 3BR3A 2YR2A 3WG7H 3E5UA 1HI0P 4KGMA 1VQ9I 3IRXB 3IS9A 4ZHRA 5KFYA 4QLCU 4G7OF 3SCJE 5GADU 1DLOB 3HSEA 3CTAA 3UKGA 2NXNA 4G6QA 1L5UA 1DQ9A 2LQBA 2OGUA 2BJ8A 4AE5A 1YIJI 4DPTA 2W00A 1QZZA 4E7JA 3M6VA 3SV3A 2KJBA 4DS5A 1G6NA 4F91B 4MHGA 3UDVA 2MY7A 2GO8A 2Y1LB 2EC0A 3C3WA 3PNYA 3HTUA 1Q78A 1VQ6S 4ZZDA 3GJTB 2CG4A 2EINH 3FX3A 2N4CA 1FO1A 2XMVA 2DK8A 2XSDC 4DR1F 2M0MA 1Y39A 2J9DE 4FT8A 5E3MA 1TT5B 3DRPB 3EUAA 2RQ4A 3FVYA 5G4DA 1M5KC 2R4FA 3GZNB 2CGPA 3QT6A 1N6QB 2NLWA 2DFEA 4K4WA 4NQWA 2HHVA 1UB9A 1VQ7S 5CVUA 1ACMB 4QWDA 1T94A 4TYAA 5KFEA 4IL6C 1T0TV 2LCWA 2HZAA 3CMES 3FJ2A 3KP7A 4ZJZA 3ZQIA 3SZ2A 1FIAA 1KU3A 3ZZPA 3JW4A 2YUSA 2QEXS 1VQ6I 1VBZA 3IRWP 4WXOA 1GNKA 5KCMA 1RBAA 4P2XA 3KWMA 2JK3A 1LWCB 1X9WA 1ZM4A 2MZJA 2IC3A 2LA6A 2NUUG 2HVIA 4BWJA 3AG1H 4I4BA 2BANB 2MJUA 3W5ZA 1VC6A 3VAGA 1Q7LB 4Q45A 1YJTA 3BYRA 2WA0A 1IW7F 5BS6A 2O8XA 3KK2B 1W5TA 3OWTA 4L74A 2IY5B 3Q8QB 1VQ7I 2OZ6A 3HXMA 1EP4B 3TW7A 5HMYA 4BJTA 5IT3A 3CMEI 3HHGA 1HD0A 1RWNB 1ZH5A 2CQPA 2XY6A 3KP5A 2QEXI 2MQNA 2YKQA 4PJ0C 3G2XA 3F0CA 5IP9J 1BC6A 2JUCA 1HR0J 3BH6B 1W26A 2L02A 4P74A 4DL2A 4X4UA 2YS9A 3KZIC 3LA0A 2VPZB 1MBGA 3IBWA 1X19A 4M6VA 1K78B 3SBMA 2CW8A 1RAJA 2BW3A 3GMGA 2Q43A 3BJ6A 3UN2A 5HLHA 3J7YJ 3X2QH 2QM3A 4RBTA 1PKUA 3FFIB 4KBIA 4PZJA 3WE3A 1S8NA 2D3ZA 5DETA 4C3IJ 5HQMA 3CD0A 4NI2B 1PG5B 5DCFA 3BJOA 1QM9A 1ZPVA 4CO0A 4A3BJ 4QIFA 3Q22A 1LW2A 2M5WA 4IYQA 3D5RC 2ZXHA 5K5QA 1R4MB 5H9EJ 3P3DA 1R4NB 1J9IA 1FOYA 3N79A 4HT5A 3ZN1A 3I4NJ 2DYRH 1QRYA 2OQGA 2HQ5A 1HNZF 1X3ZB 1ZRFA 4I7FB 3I0TA 4YELA 3TO9A 5KFTA 3NWTA 4JV2A 4DL5A 1YG2A 3HOVJ 4RBUA 4ZYEA 4U7UK 1VQPS 2HQIA 2ZJ2A 3C2PA 4FF3A 1RCOB 3L4BC 1VTNC 3BPVA 1UZHA 1Y5IB 1LE8A 3FZ2A 5HI7A 1QTNB 2DT6A 2OKQA 2JRTA 5KAIC 4ZYHA 4C8NA 1YJWS 1TUWA 2QLZA 1GXUA 1USTA 2L48A 4HW0A 3I0RA 2ZE2B 4XLPF 1RWPB 1WSVA 4DPOA 3A02A 1FKAF 1TW3A 4Q5SF 2Q3PA 5ETMA 4AVZA 4BGDA 2P7CB 3NEKA 3OYBA 3TEHB 2B9XA 1H2VZ 2KMUA 4OZJA 4WKYA 4PXBA 2L54A 3ZQLA 1T9XA 2QIFA 1D8JA 1I6HJ 2FJXA 2V4QA 4ED6A 1B7YB 2A6MA 1VQPI 2ROEA 1HWUA 1LV5A 2JEJA 3M8WA 2E36A 4KHMA 1FLIA 4RW9A 2Q79A 2X1GA 3MAAB 3AODA 2BXYA 3PKYA 2BYCA 3WG9A 1FFWB 4NLUA 2VC0A 2V1DA 1YJWI 1VDHA 4XDDA 1U5TA 1UVIA 1SKRA 2MLKA 3VHQA 1N36J 2ZH6A 2Y31A 1NRKA 1RB0A 4DSLA 1SD6A 4DUYJ 3FBNB 2GW8A 2XYPB 3EVOA 4IO1A 1FIPA 4PAAA 3G1LA 1A36A 3AL0C 2ACJA 2MHNA 3PSIA 1MG7A 3H4BA 2YPYA 4XQFA 1TTYA 3BF4A 4PG7A 5CCLA 2COMA 1NDKA 2HK2A 2HNZA 3VQSA 3K4KA 3BV8A 5EEHA 2JVHA 4NLGA 2PLYA 3S93A 2R7SA 4NLXA 4ESBA 3Q8YA 2IGMA 1OISA 2ERRA 2X85A 2KIMA 1BC8C 2IJLA 2CU7A 2AJQA 3QRQA 2R8KA 1ROFA 4MKAA 1UA1A 4B4CA 4RAGA 2KIUA 4XRSA 2RB7A 1H73A 1VQOS 1FDNA 2N8GA 5L1IA 3EYZA 3ZTOA 3E3XA 2ECBA 2FVQA 4KICA 1FOKA 4PXDA 4GKKJ 4DMZA 4OZ1A 3PYEA 1Y9OA 1LWXA 4F2RA 4ZVRB 3H36A 5GAGU 2KT3A 3DRRA 1P9YA 4XKBA 3JSRA 1T08B 4LF4F 4KIGA 1W0TA 4PG4A 3AG4H 5F0CA 2BQUA 1S0VA 2X0LA 5C4JJ 2D41A 3GW2A 1RKJA 4ZJQA 1W36D 3VZHA 1RT7B 2PMZD 1TKDA 3UDLA 1HNWF 3JSOA 1OMSA 4JV5J 2YXLA 2DR5A 4JP0A 3TAMA 4KH1B 4EEYA 4XM3A 3HVTB 3CDAA 1H9GA 3W1YC 1VQOI 2NYHA 5KG1A 1HA1A 1U1LA 4H4OB 2H5IB 2GXGA 1H6KX 2X1AA 3PW2A 4WXCA 2GC8A 5KG2A 1R31A 5IT9Z 3TW0A 1FY7A 4Y17A 3QJJA 4AIDA 3G87A 4FVMA 4FF2A 1WKKA 1YHQS 4DV1F 4P2SA 3J7Z5 2ALYB 1X5OA 2OEJA 3IH2A 1PJ5A 1KFSA 1JXSA 1BJAA 3H0GJ 3RB3A 3WE2A 2XLIA 2A2DA 4QWAA 2IW5A 4KIBA 1X60A 3BC8A 1UW9A 2QFIA 3AQOA 3MDFA 3CW2C 3KJQB 2DXIA 2J5PA 3IRXA 1OO0B 2HQNA 4XK4A 4C8ZA 5FJ8J 2KN4A 5CPRB 4N47A 1X4PA 3EZ5A 4HV6A 2IA0A 1R7IA 1S49A 1DLOA 3RQIA 2X1FA 2HS3A 2QSWA 1WI6A 2CV1A 2CFXA 3UCZP 4A48A 3FDSA 1LVKA 3K69A 3FSYA 3O1LA 3OTOF 3R2CJ 2NVTJ 1RAHB 1H7XA 2B9EA 1WWHA 1IWAA 1YHQI 2YSRA 1B0TA 4A8KA 1FJ7A 4EBCA 2DI3A 1PCAA 2NOGA 2ZC2A 1OWXA 4YR2A 1USSA 4DLEA 3IH4A 3M9NB 2RQPA 3HK2A 5I3QA 2FMLA 5KFGA 3OJUA 3DRPA 2E5LF 3RPUA 2NSBA 1YRNA 4ZLPA 2DXDA 4XKVA 3PNTA 3NBPB 2IDEA 4DQRA 3V6JA 4MKVA 2KFYA 1HF0A 2D9PA 4QIGA 1W7PD 1S6PB 4Z2YA 4KT0C 3F8MA 1N6QA 4O0NA 4XTTA 4MIMA 4J9OA 2D3UA 4Y7NJ 2ATCB 4XK8C 1U2FA 2XV4S 3N4MA 3G82A 4LIVA 2IAIA 1YI2S 4OYMA 3EUHC 5GAGI 5CZXA 3AKZA 2FZGB 3RYPA 4A3EJ 1PUEE 2P8IA 4X4TA 4ZVHA 3H5NA 2V9PA 2XVCA 2EFGA 3PUBA 2UZAA 1S29A 1N33F 1FP1D 1OQYA 1ONVA 2VQEF 2ALZA 1ETOA 4B9MA 1LWCA 1O7LA 2CJ9A 2DOEA 1DPRA 4FKXA 1QVUA 1G3SA 2X1DA 1GVDA 4KN7X 4BXUA 2HFVA 2H54B 2BANA 2RREA 2RSQA 4I02A 3F0NA 4ED8A 1T98A 2VFVA 3PFIA 4ELTA 1S10A 2DO7A 3TZWA 3BLYA 2N3LA 5D4RA 4RBVA 4TQSA 1EH6A 1EKEA 4LQ3A 1EP4A 3CULA 5EUHA 2CNKB 1M5PC 1CG2A 3BR8A 1TR0A 4XRFA 1IO2A 1MIJA 1HDDC 2V4RA 3D2WA 1BD6A 5HVQC 1RTDB 3I4HX 3EUHA 4K4TA 2AW0A 4TKTA 3FHZA 3JRCA 4NLRA 2RKIA 2KRFA 5D78A 5HROB 4GCVA 2NVQJ 2G13A 2YWFA 3AY0A 3WC0A 1S77D 3Q8RB 2L2OA 4EM2A 2XPWA 5DCMB 5ICFA 2JPBA 1RT2B 2CJXB 4DR2F 2C2RA 2F5DA 1K78A 4DR7F 1RHUB 2HQCA 5B0GA 2UUCF 5TRDA 4HYKA 4ELUA 2F9JA 2RS8A 4F2SA 3K4CA 1YJVA 4LF2A 1MD0A 1JIHA 1O3SA 2YQ1A 2AJ0A 2DGXA 1HWJA 1ZAVA 4V2GA 3FFIA 4DL6A 2H94A 3T5KA 2K9NA 4FISA 2QV6A 1U1MA 3G1MA 4TY9A 4NI2A 2VFRA 1TKXB 3DKWA 3TA1A 4TU8A 3OVSA 2XLJA 2L7FP 3HBLA 5L3GA 2IGNA 3ABMH 1KU9A 2VFSA 2BKOA 4I7FA 2OUMA 4MH8A 3JAMU 4ALZA 2XB0X 3KE2A 1KQKA 2Q2EB 2YNGB 3US5A 5LXYA 2NSCA 3WTUC 1LEBA 4UQGA 2HXOA 4RKUC 4K4YA 1B64A 3GMEA 1OLTA 2FLLA 3FEXB 1FTRA 3R6LB 4CI0B 1G8XA 2HI3A 4K0KF 1GAOA 1SJQA 2DA3A 1XR6A 1IBKJ 1J09A 5U47A 3UDCA 4Z7YA 2ZE2A 2X1CA 2MMYA 3ZZOA 3GTYX 2ZD1B 5CLSA 1I3AA 3WC2A 3M8SA 1EA3A 2BY1A 4UUWA 2CA9A 4DHVA 4E8UA 3CMAI 3LSTA 3S01A 4FXDA 4B3MJ 4RB2C 3SEQA 3E51A 3DRSB 5DD8A 4HKQA 2RHQB 1WG4A 1U49A 4QPQA 2A3SA 2QTWA 3DCFA 5H2FC 2QA4G 4BACA 2UXDJ 3EDQB 4DV0J 4CCLA 5LJ3Y 2BJ9A 1XSXA 2J8SA 5HMWA 3HF5A 3TVYA 5AJ3F 1XN7A 2Z2MA 3EGWB 3C46A 2VT2A 5EN1A 1I94J 2UU9J 2EG2A 2M0GB 5D8KB 5F8IA 3RBDA 4Z37A 2VL8A 1Q95G 3B82A 2O6GE 3Q2SC 3WGGA 1H0HB 4YFUA 1NK7A 3SCLE 2Z0GA 4K7QA 3EPGA 4MK8A 3GB0A 4Y00A 4C8YA 1IDYA 2W2OP 3V8KA 1FEEA 4KIAA 2VXDA 4B9VA 3Q24A 2C2MB 2EV5A 2O67A 3NMAA 4F4WA 4X4OA 2H8WA 1IJWC 3CF2A 3ZO7A 4O6JA 3HVRA 2VJUA 1NPPA 3DWLE 4FYYB 2UXCJ 1DP3A 1BY9A 1ZELA 1FRIA 4F55A 4RM2A 2W9AA 3LANA 3DLJA 3BCBA 4DL3A 2GA1A 4HDVA 2HZCA 2EWHA 1UFLA 2EFWA 1MW7A 3WTVC 2Y8YA 3DRXA 3BQ1A 3JRFA 1VK3A 1QSLA 2UXBF 4KNYA 3LP1A 5KFMA 5D8HB 5J3LA 2XPUA 1WCMJ 4OLPA 1KNZA 4CDIA 3WU2C 1JUPA 3OSGA 3KNAA 1HNXF 2WAEA 2IYGA 2RUSA 4UUSB 2ZXIA 5EDNA 4DCJB 2OI2A 2LKXA 3DGVA 2KG0A 3Q9SA 5KT6A 4ESFA 2B43A 1RT1B 2JSPA 2VT3A 1RT7A 4IRGA 2E7VA 3QAUA 3BR1A 4ZC3A 2GAUA 3I6PA 3T6JA 2AEFA 4A3DJ 4IUFA 5H9EK 2MEWA 2LQ5A 3W60A 2ZXWH 2CPXA 2CQHA 3TARA 2WW8A 3HVTA 4YB5A 4XIDA 4YEAA 2YPRA 2R2UA 3GSIA 4H4OA 2C3MA 4K5SA 5D0EA 2HWHA 4B9UA 4DV3F 1HLWA 5HO4A 2MC3A 1WFXA 5C44J 4O44B 3PDNA 3EM1A 1YBUA 3AA8A 2CRLA 2OC6A 3C2BA 1A6LA 2KJWA 5T7LB 3S6EA 1XMOJ 2IS6A 1WKMA 4C3JJ 2ZM6J 2BGCA 1UG0A 4KFCA 1LNWA 2CZVC 2LQJA 5IQQA 4RW4B 5KG0A 3J80Y 2WC2A 4EJUA 1PC4A 2BKPA 1S6QB 2BV3A 1B70B 2ACMA 2LNBA 5AXMA 4QWEA 2OPTA 4NC8A 4YDXA 3TUJC 2HNYB 2E1PA 2DQLA 5KOXA 5L39A 2DA7A 1W2BR 2E1MB 1JHFA 3J81Y 2FEZA 3K89A 1V5GA 1VLOA 3LWFA 4NOHA 4AFFA 4WFZA 4X84A 5FB2A 1ITYA 4MKBA 4WFBQ 3LSMA 2KU7A 2LU1A 2RQQA 8RUCA 3BZCA 1SFKA 2MW8A 3CC2S 4JI5F 3ISZA 4A5NA 2CPJA 5AE3A 5SZTA 3HPOA 1PAUB 2MPUA 1Y1WJ 3IFEA 5CD4A 1CF7B 4ECUA 2EI5A 2D69A 4QW8A 2BW7A 1IBLJ 1VQNS 1JLAB 4DPWA 1VQLS 4QBUA 6FDRA 4KN4X 3NBPA 3A13A 3MKZA 1S6PA 4HACB 1U2CA 2J8AA 5D6EA 5GMDA 4DV2J 2ZKUA 4F4AA 2QKLB 4F02A 5HK4A 1MJAA 1UZDA 2E19A 3COAC 5E20A 1UVNA 4CXFA 3TZYA 1KKHA 1S48A 1WJAA 3E6DA 1HQEB 4USTA 1GTEA 5AXNA 4Z7CA 3CC2I 3HJVA 1VQSA 3H98A 2MGQA 1QA6A 3VV2B 1FXRA 4UB8C 1QQIA 3RIRA 4NRTA 4LFBJ 4WU2A 3LAKA 2IM0A 1VQNI 1WJ5A 2GQ2A 2BVLA 1LVAA 1VQLI 2RVJA 1T02A 4K4XA 4CCJA 2DRDA 1O8BA 2WK4A 3O8HA 3OL4A 1KTQA 3E7LA 4MKYA 5RUBA 2AZ3A 2XWXA 2B4UA 1N8RT 3DXJF 2DIVA 1YE9A 4P71A 1P1LA 3CCMI 2BJEA 4DF4A 1JT0A 2KVQE 5A2QZ 3Q8VA 4MAKA 2M70A 4RS8A 3LPEA 1R49A 1VZ0A 1BL0A 1UKUA 2OSRA 3O44A 3M1EA 4NLWA 2V9VA 4MK9A 4BDPA 2DNOA 4U6PA 2R7VA 4I64A 1RTDA 3NS7B 3AG3H 1YRTA 3C14B 1IR2A 2P8TA 3HZEA 1HKSA 1LDKB 5HROA 3L2UA 5E3OA 2M5YA 1F9EB 1IXRC 5DCMA 5BXIA 5HVGA 2P5LC 1DDNA 1RT2A 3T1HJ 1NH8A 4YB7A 3ULQB 5J2QB 2GNKA 1WF2A 1WOOA 2JEFA 3R5DA 1XGMA 2KG1A 2DMNA 2F6CA 4U7UD 1IAWA 4I09A 3PYGA 2CADA 3JTOA 4UTGA 1TW2A 2IT0A 1PYVA 1YOVB 1FZPB 3TJ9A 3KMSA 2DDAA 2O8KA 2J5AA 2XEXA 3BEGB 3F56A 1TKXA 4X4RA 4FYDA 1GT8A 2M4KA 2GCFA 3HHNB 5KG5A 4MJKA 3IAM2 2JFKA 4O3PA 4A93J 2VG7B 2JMWA 1FRLA 3DTKA 1BI0A 4BHCA 1E0EA 1RRJA 2J76E 1A0OB 5M5YJ 2IYIA 1YKWA 3PR4A 2CYYA 2Q2EA 2YNGA 4XN3A 2O0YA 4QSHA 2N82B 2I6WA 2A10A 2GZOA 1RT5B 2CNLB 1UWBB 1V5IB 2RT3A 4A3JJ 3KYLA 2LP4A 3QOEA 4NDLA 3T8RA 2VE9A 5F6FA 3M9AA 2UUAF 4O5VA 2FJ1A 1MWYA 2LKSA 2BHYA 3MMCB 4ZVOB 3W64A 2ZD1A 3HHLD 2MTLA 1QGPA 3IR5B 3TQ1A 1LFBA 3C2HA 3KFWX 2C2DA 5KG7A 2A6HF 4WP8A 3K58A 2AYGA 1NMEB 3AJ1A 3B8HA 2RRBA 4ZCKA 2NYXA 1IWGA 4L3NA 4BYYA 1U0JA 1PP7U 4DV6J 2HFSA 2L9NA 4WWSA 2HVRA 3DRSA 5KG6A 2H8RA 4CLWA 2DJIA 2X6XA 3AAWB 3OL7A 5JUMA 2VFTA 2AYEA 2Y0MA 1PIEA 2QSFA 4DCOB 3DLLQ 3K8WA 4P72A 4DR3F 5IT9Y 1XNQJ 1R43A 2CQNA 5IM0B 3RAXA 1QPIA 4B17A 4DR5J 4UB6C 3C7JA 4O23A 4IDKB 4TNOA 3TJ8A 3RI4A 4RNFA 3WGHA 5K7ZA 3SQGB 2ZBCA 3KOAA 2FOKA 1MBHA 2ZWOA 4C48A 3UD3P 1LK7A 4Q2MA 1P92A 1I1SA 3NCPA 3FKJA 2FQ4A 1MGTA 4OHWA 2BVMA 2OJED 4CIOA 2M2EA 2YX7A 2QSFX 3ZZRA 1Z91A 2JWTA 3G8SA 2WY7Q 5LRRA 3P7NA 4FX4A 1FSHA 4HRIA 2LYVA 4X4NA 2FJBB 3K0JA 1EIYB 2R4GA 4G6VB 1NZ8A 1NTCA 3VYRB 4A3LJ 1S1WB 2HVEA 2FJDB 1ZGWA 2WTEA 3DBLB 5D5XB 4JK1X 4DFPA 2BE2B 2DNHA 2J0XA 4I6YA 2OPSB 1MMNA 4N7TA 2L9RA 4V19J 4UUSA 1X31C 2CQ1A 3SCIE 4IQ4A 4I2QB 1TK5A 4LFAF 2E9TA 1SBRA 3TNVA 1M5SA 4M5IA 4KYZA 1RT1A 4FASD 4O3NA 4F3MA 5KFHA 2BJ1A 2JX2A 1L3SA 5LMUF 4UQTA 1PP8F 2RAEA 4LF5F 2E1MC 4EU0A 4B48A 2WSEC 2NZ4A 1Q8KA 4OMYA 3BTCA 4F50A 4KGXB 2XMKA 2MZ1A 3J81U 2M8HA 4G94A 2M7SA 3MMBB 3JREA 2PJPA 2BY3A 3C8YA 1TELA 1NKBA 3I0SB 2MKSA 3ERED 5SUHA 3RRKA 3KEOA 5KFXA 3T5JA 2QLWA 2K7KA 5T7LA 5EDWA 3H42A 3UN5A 1W5SA 4B08A 5HVFA 2C1EB 3FDYA 3PL8A 5D8LB 5IT9K 1S6QA 3Q8PB 2E5IA 5KFCA 3O5TB 5E3PA 2I8EA 2F1FA 2R7DA 2HNYA 2P2CB 3H0PA 3M8FA 2H48B 3OHBA 1SC6A 2HVSA 2EKYA 5IWAJ 1TL1B 5AT1B 3W2VB 1D9FA 2ZJQQ 1Z4UA 3VAIA 2QBYB 4DV5J 1TP7A 3E1SA 1MBKA 4J01A 2K9SA 4NPOA 2QQ9A 1FCAA 3WGIA 3W7BA 3MMYB 1QLNA 2WRMA 4ENJA 3T5XA 5IPAA 3F9KA 2B8QA 2XCPA 3HOYJ 4WFAQ 4CSWA 1JLQB 2HRUA 1R23A 5CJ9A 3U1LA 1CF7A 1OPZA 2MQPA 3MZ8A 4LF7J 4A8SA 3OJSA 1Z7LA 2R2RA 1X0PA 1JLAA 2A0FB 5HDNA 2HHXA 1QVGR 2VASA 2VPLA 1U4BA 2V6CA 3HHDA 5D77A 4IG0B 4IFVB 2DHSA 1FX4A 4HACA 3GIIA 3F21A 3QJLA 2FHKA 1YRXA 4NC6A 4KV8B 2R7OA 2Z4PA 2GFFA 3L00A 1SJ3P 2B0LA 3UCGA 2C2OB 4OI6A 3SFUA 5T41A 1SC4B 1YJ7A 1TAUA 3JRHA 4BS2A 4H4MB 1FBSA 1SFOJ 2NQPA 2VPYB 4MQVA 3N4WA 1HQEA 4QW9A 3OPKA 4BHQA 3IWNC 3OT9A 1N32J 4HF1A 3CMYA 4FS1A 1BI2A 4B9LA 2OMLA 4ZJLA 4B3TF 4KMFA 1Y8QB 4V19X 1IKVB 3DLAA 4USVA 3K4LA 4M9ZA 3BSNA 4OI0A 1WI3A 2W2PP 3FM5A 2E7WA 2YPZA 4GC7A 1JMTA 4G1IA 4RZRA 2G2ZA 2WHOA 2MZSA 1HKQA 3TOBA 1R89A 1QZYA 2WADA 4LSNB 1M5OC 5M2PA 5KFLA 4J9MA 4C8OA 2R2TA 3W9IA 2MSTA 1UJ6A 2DYSH 3E0JB 4OYPA 2WBRA 2OZUA 3CO0P 4FNHA 2OPQB 2VA3A 1OY9A 4M6XA 2CJAA 4ICLB 4BS9A 3I58A 4OYZA 3C14A 5DYMA 1YJUA 5CYMB 1IUYA 1OYIA 3QODA 3DLLF 3BGRB 3FEYB 4JYKA 4WJBA 4R0JA 3VAKA 3D5SC 2O03A 5DM7Q 4MLOA 5D5VB 1O51A 2MQMA 2BYVE 3T5HA 2XAHA 2ZBKA 1MNEA 4OJHA 3PKMA 4UNOA 3HFZB 2V8VA 4GKJF 4WCGA 2HVHA 2XULA 5J2QA 2ZH1A 1N34F 2CJJA 3S1QJ 5IT0A 4M9XA 1IN4A 3S2DJ 2DNGA 1F9HA 3UR3C 5DQGA 1T95A 2NXEA 1JJ4A 2XG8A 5IFMA 4F0HA 1TLHB 3OD2A 1B72B 4A3FJ 5F9LA 3PJWA 3R5AA 1BUXA 3DFGA 4FDFA 1QE1B 4YIIA 4Z6YA 1VI0A 4U0VA 4EVIA 2VG7A 2KXHA 2HQAA 4P9SA 4ATNA 2G7UA 4QTRA 2FYXA 1N0UA 3DKYA 1R1TA 2O9LA 4CA0A 3OFGA 3ZNJ1 3OMYA 1BI1A 3L7UA 4XPEA 3L2WA 4X6AJ 1G3TA 3LGHA 1LPQA 3ZQ7A 5CXTA 2R5ZB 5IV4A 4WZMA 3QGIA 2YWWA 4Y2CA 4JI7J 1UWBA 2VIHA 2XGXA 2JZ5A 2HAFA 2I8DA 2ZJRQ 3IRQA 1WSRA 2RDPA 2B6AB 3KEQA 2HBRB 5E0OA 4EGZA 4EZ9A 4HAMA 3M32B 4NCBA 2RJZA 1UFWA 2GWRA 3CJQB 3MMCA 5CH7B 1R3NA 4RB1A 1IUJA 2HZDA 5DV5A 4KQZA 4IQXA 2J5OA 2OUGA 2DPDA 1NB7A 1B4SA 3ZTQA 3G71S 3ICLA 4OX7A 5DUKA 3VCDA 1RBLA 5M3FJ 3ZMDA 3GO5A 2EQRA 1KWMA 3RKQA 4RR5A 5GVQA 2M1BA 1HBXG 3T19A 2QMWA 2X7IA 3HX9A 4AL5A 3IGNA 4RX6A 3I9V9 1RSCA 3BN4A 1L3LA 3FMQA 3OIOA 3GR1A 4YN3B 2XRNA 4KPYA 5IXUA 5IM0A 1IQTA 2BR0A 1IR0A 4IVNA 1TL7B 4MFBA 2BEOA 1NNDA 4BDYA 3WIVA 2FHOB 5CVRA 1MWQA 3D6MB 2X3GA 1Q79A 4G9YA 3HOSA 1HNIB 3KX2A 1Y7PA 2PEHA 5JJBA 3SQGA 2LECA 3D6TB 4FF4A 2DEJA 5DJBA 1JTYA 4MO7A 2UV1A 5FLXZ 4JB8B 2ZJQF 1RKTA 3G71I 2JVOA 1JXLA 5L3FA 1X4BA 4DLGA 3MFIA 3Q8SB 4CLSA 3N9UC 4I67A 3P45B 1ETVA 2DOFA 4BE1A 5LMNF 2XSJB 4EEFG 4BBRJ 2IPQX 4CLLA 3GP9A 1FTTA 1XERA 2VONA 3MZYA 1ITPA 2HFZA 4I0WA 3HSZA 2ILZA 1FA0A 3P6YC 5K1YA 5KFDA 1S1WA 3RAQA 3T41A 4CO1A 2HYJA 4IHSA 4IEJA 2BE2A 2UVWA 2OPSA 4PWUA 4BNCA 4WK1A 4BHPA 4I2QA 4U0WA 2HVDA 1VC5A 2YBVA 3AXKA 4RNOA 3SI8A 4TQRA 3CIMA 4CLZA 1M1HA 2IIHA 3QFHA 2EZHA 2ZOFA 4YDDB 3CCLS 5L3DA 1RT3B 4DNCA 4CH0S 1S12A 3MPDA 1Y6IA 2BUNA 3FIWA 4WFNQ 4Y13A 1WELA 3CSKA 1BW5A 1SC3B 4Q48A 3MPUB 1UHSA 3NS5A 4OYOA 4LMZA 2H9ZA 3I54A 4MGRA 1Z9CA 2HLUA 2KI2A 3MUMP 1D1AA 3J7AO 2KL4A 1VCTA 1YS6A 3MMBA 3ETOA 1FTCA 3T1YJ 1E6VB 1ZKGA 4ABZA 2K3KA 2JL9A 1X4DA 3I0SA 2PEXA 1UWAA 2N7CA 4FYVB 3W8PA 1J75A 2PSZA 1X3UA 4KGVB 1D8YA 4IRIA 5JHUA 3EXCX 2BZTA 2IRUA 2FBKA 1H8AC 1WHXA 1RAAB 3UDEA 1VBYA 2LFBA 2JEGA 4FPIA 4MK7A 2JPCA 2KDOA 3TR5A 3VGUA 1VQ4I 2MZRA 3CCLI 1C0UB 1OIAA 4ZDNA 1VC0A 2BHZA 1D0YA 3QPHA 1X4GA 4M74A 4LG0B 2D1VA 2EZIA 2DO0A 3ZN0A 2AV5A 4RGSA 1TL1A 5D5UB 3GQCA 3W2VA 3PO5A 5DM7F 1X4OA 1N5YB 2QBYA 3OSNA 3KP4A 2ZFHA 4USHA 4FVCA 2VLAA 1SEUA 3FGVA 1B0VA 3RBEA 3FMRA 3BPDA 3RUBL 2FGCA 2L3MA 2HOTA 4A8FA 3CCQS 1JLQA 3ZXSA 1U0SA 4E7ZA 5CVVA 1S1TB 5ETOA 1RAIB 4OZNA 3DPUA 2DPIA 2B63J 3HDDA 4OIQF 2KM8C 3A1YA 1XC9A 3SEOA 4LF9F 2H09A 5CVJA 1C2PA 4OJ3A 1BWEA 4IG0A 4IFVA 2XHCA 3UO0A 2IDLA 4LBIA 2ZSHB 2H6BA 3RPUD 2JA7J 5F3ZA 4KV8A 4LITA 6PAXA 5DTDA 3U2RA 3M8EA 3ASNH 4USJC 5LSLA 1SFUA 4G3IA 2VG6B 3RYLA 2LLZA 1FRJA 4H4MA 3ZRGA 1R1VA 4ZJOA 1RYRA 2CQ4A 2QLXA 1LNQA 4HL9A 4DL7A 1APLC 1Q8IA 3CP2A 3KLIB 2KTQA 4NCGB 3CCQI 3QAEA 3PO2J 3MEDB 2XASA 2V6AA 2ZJRF 4OIXA 3MWBA 2Q6BA 1SAUA 3V42A 3IL2A 5K8NA 1IKVA 1KQ0A 2HQGA 4QPXA 2EA2A 2YNIB 1HIYA 4L9TA 2MB0B 2EK6A 4RAZA 4DSIA 1WHVA 1RE1B 1UVLA 2FF4A 2MKCA 4V19K 2LA4A 3KHHA 5DZ7A 1U26A 2RQKA 5GAHJ 3KYCB 4LSNA 2RQMA 5D0RA 3P5TL 1J59A 2GS8A 5LSOA 2COBA 4ZIWA 2OPQA 2DT9A 1FXDA 4Q47A 1X5SA 1JE8A 4ICLA 2LREA 2YX1A 3TP2A 4NYPA 4RW6B 4OI4A 3W62A 3R1LA 3LUYA 3QSIA 3FXRA 5F3TA 1FMWA 2XMWA 5CYMA 3AAFA 1OQ6A 2HR3A 2C3OA 3BGRA 4N4OB 3BT9A 4CCNA 5B7WA 1S9EB 1O3QA 2UV8G 3H25A 3EJMA 3UQSA 2A5WA 4PQUB 4E7SA 2VL1A 2MLZA 4PSXA 2XB2D 2HPUA 3F22A 3MUTP 4DR1J 4JOMA 5GADJ 4IKFA 1T03B 5ED4A 4NLQA 2E71A 1RZMA 1EHWA 1T38A 2W2MP 3M6XA 3NGRA 5IYDJ 1HL6A 4HF0A 4PKDB 4UY8I 3S16J 4ESJA 2LY1A 2RUGA 2KT2A 3CUQC 4U95A 1B72A 3TAQA 1X2MA 1Y3JA 4U9RA 2EVZA 2D9OA 1S97A 1GDTA 1H74A 1QZEA 5CD4H 1KLMB 5CQGA 4IF4A 1QE1A 2DU9A 4JI8F 4IR1A 3HGYA 1Z2LA 2X51A 2NXUA 3DU6A 5CYJA 4C30A 2PDAA 3TA0A 3CUNA 1LFPA 4B3XA 2RHSB 3AA9A 2ZUGA 2ECCA 3TUIC 4NBQA 1FD2A 5J2MB 4DJBA 4FXWA 1FFGB 1ZPWX 2R5ZA 2CQGA 2LVSA 4OI3A 1U1RA 4E7HA 4IPAA 2GOXB 2G9WA 3GIRA 3LP0B 3M2RB 3D1OA 4P7VA 4B47A 2ZO4A 4YFXF 5EWGA 2NPIA 1MDMA 1HA8A 2GHWA 2B6AA 3W5XA 3RRHA 1D3WA 3M32A 2PC6A 2VXZA 2DT5A 3H92A 1X1CA 1F5BA 3CJQA 2B4OA 3FXMA 3CC4S 2DNMA 3HPGA 2LDUA 1HI1A 4HHJA 3KP6A 1L0OC 1UJ4A 3BGUA 4B44A 3M2VB 1F6TA 2V94A 4ZVQB 2DA1A 5HLTA 2KP6A 2AQEA 3BROA 2HGLA 2TCTA 2VKZG 1RK8A 2MSSA 2EIJH 2Z9OA 4WYWA 5DS7A 2ZC3A 3UCUP 4XSXF 4CZZA 3DRYA 2Q0OA 2WAQD 4PWDB 2OF7A 2I2YA 3QT8A 8ATCB 3Q9VA 1K8AT 2MG4A 2QSGX 4KRWA 4XORA 3PFYA 3DC2A 5JI6A 1TL7A 3I32A 4OI2A 3LL7A 2NNNA 1LK5A 1VIXA 1HKAA 3CC4I 4EMSA 1F9FA 1YVFA 1URNA 2Z30B 5BPIA 2MH2A 4WK3A 4O3RA 1RAFB 3M4XA 4DZJA 4IH7A 3GV7B 4C98A 1NG6A 2IS4A 3M9OB 1TKTB 1HHSA 3K7RA 5F8JA 2LY2A 1HNZJ 2KHMA 4GVBB 2F4OB 4MIBA 1K83J 3TI0A 2XSJA 4OV6A 4XMYA 3OFEA 3C66A 2JA6J 1QD1A 3LGMA 2DMUA 4BHBA 2W82A 4GXOA 3WTSC 2YWHA 5E8IA 2QYCA 1TZLA 2HMIB 2CPDA 2L7KA 2XLKA 2KPMA 2V1UA 3BTLA 3I56S 4DU8A 3OTBA 1BBYA 3HOXJ 4I2PB 2HTJA 4WF2A 1R8HA 2F5VA 2ELJA 4LK0F 1RIOH 2B3TB 4DDFA 5KFUA 1FC3A 4J9RA 1RR7A 3LMMA 4A0XA 5JMNA 3G1OA 1AWCA 3GFHA 4FS2A 1T9UA 4RAYA 2CIMA 4C8LA 1FBQA 1U09A 2V68A 1JLFB 1KHWA 2VFUA 1Q0NA 2HBYB 1VFCA 1NK8A 4NWBA 1RT3A 2FY1A 3MEGB 2RDJA 2FZKB 4L6V3 4EZ6A 1G3WA 1WKLA 4ZN3A 2IMWP 2FLPA 2DPJA 2MFZA 2WSFC 3D0GE 1E3HA 4DPXA 4G7ZF 3R5CA 2K2PA 4TU7A 3FQLA 2K3FA 3PY8A 4IOCF 1U25A 3QRPA 4PGHA 3I56I 4PGGA 3TBIA 4ENKA 4WWCA 4BY7J 4MYTA 1BC7C 3PFEA 2VKHA 5L38A 4BJ5C 3IM9A 3CJTB 1S7EA 2R7WA 1FJCA 2E5NA 4O3MA 4BU2A 5K8MA 2RH3A 5HN0A 3H9GA 1Y3KA 3NGUA 1C0UA 1JLGB 3TO6A 5HLIA 4F93B 2JLEA 4LG0A 2DW4A 2ZH4A 2K86A 2BBYA 5FD1A 2E9RX 1J2XA 3IN5A 2Y0SN 1ULRA 4QOTA 2DNLA 4C9DA 4X65F 2A6OA 1I50J 1N5YA 4YP3A 3JYTB 3AHPA 5EYRA 4DOZA 2D2WA 3DHWC 3VB2A 2JQ7A 2RDDA 3HM9A 4ZMMA 3J7AN 3QPSA 1ZTWA 1RKIA 4NLDA 2HYIB 3BSCA 1KRPA 2FHJA 3BOQA 5AIQA 3ISND 8AT1B 2HFUA 1ZLKA 2DMQA 3E2EA 1VIOA 4IR9A 1S1TA 4LF4J 2DGOA 3OTDA 3NRBA 1JQGA 4RUCA 4CO2A 1C1BB 1I5OB 1IV6A 4ZVGA 4OINF 4IHXA 1YFHA 2E44A 4YS2A 3GILA 1HNWJ 4O4GB 3BG3A 3IG1B 2X1EA 1RHQB 2MLYA 4DYQA 2Z8QA 4QCLA 4EGYA 1XSDA 1NK3P 2Z2ZA 2KIQA 3EZUA 2V2ZA 4OYWA 4A8QA 2YX4A 4I69A 2FVSA 1I39A 1VR6A 2VG6A 3QYEA 3THPA 5E7OB 4CUGA 2ASJA 1IC8A 2CUZA 3KLIA 2CQ7A 4NCGA 1M1GA 3HKWA 3VSLA 4DV1J 2CQDA 2OU2A 3MEDA 4M95A 1Z3XA 5A0YB 1LKZA 4EYIB 3SYZA 2PA8D 4XNFA 4PWWA 4OYAA 3RKWA 3BKUA 1KQFB 4EFAC 3IWLA 3JAMZ 2BACA 2YNIA 2HHHF 1FNOA 4NXMF 5K7HA 2E5JA 1S6LA 1YZ6A 3J7YI 5D3GB 2A2CA 4I6AA 1D1UA 2UV8A 4RUAA 2JSXA 3EGZA 1UEUA 1V3FA 5TGTA 1IXCA 4AVPA 1REPC 2QN6B 4BH9A 4IOBA 2VKVA 5FKLA 3PNVA 3OYIA 2EJRA 5E79C 4JP8A 3OTOJ 2QYOA 1FESA 3AFGA 1TNTA 4M3GA 2WY8Q 3H20A 3PJ9A 2N7YA 4QWBA 2FC9A 3FK6A 3IWZA 4IRHA 5E3AA 2R9LA 2HPIA 2RF2B 1RWVB 5JHFA 2CH0A 1S9EA 2L3DA 3GBGA 1ZQ3P 5D4OA 2XWYA 3FK7A 3BKFA 2E1CA 2W4SA 1GXTA 3LGNA 1SD5A 4HLYA 2QA2A 1G4DA 4PQUA 2A68F 1CC8A 4AYBA 4HEA9 1IRGA 4IKAA 4HI2A 2FMYA 1PO6A 3MMAB 1M1EB 1T9VA 1T03A 3RSNA 3MHYA 5K20B 4U88A 5CQEA 2HIQA 2F7VA 5DDGA 2X6OA 4N0BA 3I9V2 1CVJA 1QDUB 5GPAA 3M8ZA 4OHYA 3EX7B 2WV1A 3GFLA 3SZPA 2P9CA 3EUKL 1AB8A 4GFBA 2W2QP 4JBAA 5KFIA 1KLMA 2CFOA 3HUGB 5FLXY 4NA3A 3OR1B 1U48A 3N6LA 1U8RA 2R8GA 4L0YB 2P9GA 1D8KA 2DGQA 2JA5J 4PJNA 3M2UB 5DQHA 4U7DA 1N33J 1GV2A 2XB5A 2KRRA 5J2MA 4DU7A 3S3MA 3BREA 1QJHA 1XTAA 3IV5A 1S1VB 3W2WB 1QTMA 4AQYF 2DCUB 4LREA 1RQ0A 1WRJA 1W4MA 4QR0A 4Q7AA 3EPZA 1WJEA 3LP0A 3M2RA 1N54B 1WI9A 4UUVA 3OLBA 2Y9HA 4Q0BB 4F0MA 3P4UB 2KISA 1XGSA 5D0HA 4G8XA 3TOQA 1Q8LA 3GF2A 1RWXB 2GJIA 2EILH 4RGRA 3LA3A 2VKDA 3M2VA 1KYZA 1PGZA 4RBOA 1Y0HA 3LQRA 3RJPA 5CAAA 3DGPB 2V8GA 1OCOH 3SSRA 4X0GA 1CLFA 2P5KA 4KTQA 5D4LA 2I1RA 2EXUA 2HEKA 4RNMA 5HBMB 4CYDA 4DR2J 4DR7J 4CLPA 3KK3B 3A3PB 2UUCJ 2HRTA 1ZR2A 1RI7A 4W4MA 4PWDA 4ZVUB 4RAFA 3QPIA 4YEJA 3CXCR 3IH3A 4B8XA 5KTQA 1VLYA 1RNLA 1DU0A 4RB0A 4KUMA 2LOOA 1ELOA 4XIUA 5LL6d 2POKA 3AT1B 3HYIA 4C3HJ 2ZH8A 1FEHA 3ABUA 1HHQA 2HS0A 3LOUA 1VYAA 3V7CA 3E6BA 2FOWA 2NAZA 4PQAA 2BY2A 4M8LA 1TKTA 1FXLA 5HAOA 2V67A 2DH8A 2GIVA 3CO9A 4YOEA 4ED0A 3TOAA 4GVBA 3ZOBA 1P6RA 3I5BA 2G1DA 4DXLA 2JNJA 4LVOP 4FN5A 3PV8A 3G86A 3VGVA 5FLXK 4XOPA 5D6GA 2NVUB 3MCSA 3QZ8A 2Z99A 3MD3A 2LFVA 2LKPA 3Q86A 4AXJA 3TANA 4X62F 3FCHA 1IN7A 5KFSA 4JX4A 2HMIA 1YZ7A 3BJYA 3NGSA 2IP2A 2Z16A 4JI0F 3LAMA 3CCZA 4DBQA 3GTOJ 1WG1A 3GG0A 9ATCB 2H1LA 2P6SA 4TXSA 1U8BA 4K0KJ 3K4NA 3L7OA 4I2PA