1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HP0162
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
1WJBA 1MW7A 1KONA 1WJFA 4F3QA 1WJDA 3F9KA 1WJCA 1WJAA 1LFPA 1E0EA 3HPHA 1WJEA 1K6YA 3HPGA
chains in the Genus database with same CATH superfamily
2KYXA 1Z3XA 3KP2A 1UMJA 2YWKA 3DRSA 3FISA 1Z4UA 2HZTA 3TQ1A 1DQAA 4MYUA 2MZRA 1UG0A 3UNYA 4B9UA 5E2QA 3VEPA 3SZGA 3TX0A 2L0KA 1Y8RB 2HQ3A 3ML6A 5DJBA 4C8LA 3W3CA 1ELOA 4NLWA 3QFWA 4X65F 1NK5A 1ACIA 3TYTA 4P75A 4IL6C 3QRFF 4USVA 5L3CA 3BSAA 4NXNJ 3US5A 5JI6A 3RYLA 2MC3A 3KK2A 3MEEA 5KFIA 1H72C 2IRUA 5C42B 4C0HA 3J7YJ 4A46A 1V5IB 2V50A 3ASOH 1QO0D 4F4AA 3WG7H 2EBEA 3D3BJ 5KFTA 3VWBA 3DQVC 3BGRB 4P52A 1U5TC 4ZPBA 3NGDA 2FY8A 5J2NB 4DSJA 2WB1N 1X58A 2R9LA 2BVMA 1SC4B 4XMYA 4JX6A 4PZVA 4HSRA 3RQIA 2OEMA 1VF9A 5CYQA 1UCNA 4USJC 1CPZA 4PGHA 3HPHA 4NLDA 1QPMA 1I51B 3A2KA 4EO8A 5F6FA 1YX5A 4BQOA 4E4HA 3MM5B 1FP2A 3E5XA 2C3OA 2I1RA 4LSZB 4OQJA 1WF0A 1YI2S 2VKVA 3JRAA 2R7OA 4NMLA 1NDKA 1UCRA 3W64A 4TVAB 3RI4A 1MZBA 4W1UA 3VGUA 1B9MA 3IWFA 4ERDA 3DOMA 3HLUA 3UVJB 1TK0A 1HI1A 3IC1A 3LP0B 4O44B 5CQEA 3VAGA 3UR3C 4ELUA 4NYPA 2JA7J 3MN2A 2L7ZA 2R7ZJ 1RBOB 3GSIA 1Z91A 2Z56B 2QLXA 1ZRFA 3TUIC 4LF1A 1ENHA 2I38A 3GILA 3DLGA 1KYZA 4KHPF 1XNRJ 3WTXC 1VK3A 3L7OA 1B72B 3FUYA 4NX9A 1KOOA 1AKHB 1PJRA 1D8KA 4N77A 3N79A 2KL4A 5B0EA 1XN9A 4JI5F 5D78A 3M9OB 1SANA 2HOAA 3SCLE 2M9KA 2TRTA 3I0SB 1LK5A 4FP9A 2W24A 4CO8A 5LGUA 4S0MA 3CCYA 3GFHA 4QIWD 2DA5A 2A1BA 2R7VA 3FF5A 1KTQA 5LSRA 1UJ6A 3DU6A 4DHVA 1HW8A 3MURP 2RRBA 1V5GA 2AQFA 1T56A 4KITB 3CJKA 4IDKA 3H4DA 1IKVB 1DPRA 1W5TA 4YEAA 4JV0A 4E0DA 2DR9A 1ZRDA 2H54B 4KGZB 1Z1DA 3UKGA 5B1BH 3KHHA 2JUCA 4C3JJ 3JR9A 3CMEI 1NJWA 1CVJA 4CO5A 2QBYA 2GM4A 1PIEA 3OT9A 2XPVA 1APLC 1G59A 3H2LA 2Y30A 4A3IJ 2GGPA 3T3FA 3MAHA 5FDLA 3MEDA 4AWXB 3R5JB 3M7VA 2B51A 2AQEA 2V0NA 1LWEB 4EM0B 2BM1A 3SDBA 1X7VA 4DV0J 4D5CA 3DRPB 1Y0NA 4ON0A 2MY7A 4F92B 4MTPA 1HKQA 1XCBA 3MMAA 2FUG2 2AEMA 2EZLA 3JTHA 3Q24A 2O1PA 1YJ9I 2F4MB 1DQ9A 1HW1A 2AJ0A 5CYMA 5ETQA 1SEUA 2MXYA 2WAQD 1Y0HA 2XIGA 4OYOA 1ZG3A 2E1RA 6PAXA 2K5CA 5L1LA 4UUSA 1K4SA 4NMXA 4ZPCA 1O4XA 4DR2F 1PYOB 4HEA9 1S4FA 4LRDA 3G1MA 3C6UA 4USHA 3M6XA 1N5QA 2EG1A 3V6JA 2M4KA 2NVTJ 2UVUA 4DF8A 2MQNA 2LU2A 4B09A 4NZ0A 2D7SA 1N33J 3QODA 1IRFA 4KJIA 1WRJA 1SMYF 2CFXA 4FQGA 1RHMB 2VUGA 4GO1A 3I5BA 1S9GA 5B7WA 3GWZA 3NLCA 2A6OA 5HLHA 4WKRA 1RKJA 4L3KA 1UP1A 3MM6B 2VQCA 4C3LA 2XMTA 4O3PA 3QT5A 3KUGA 4RBTA 5ETOA 3MCSA 3C2GA 1VI7A 3B54A 1WF2A 2DO4A 3E0JB 1IUFA 4IRIA 4ENOA 1QSSA 1Z2LA 5LT5A 4L73A 3NCQA 3RW6A 1FNOA 4H54A 5A0YA 1JXVA 4ZYEA 1W7WA 4UY8I 3IP4B 1U6ZA 2AKWB 2NXUA 3CJNA 2HS3A 4DR7J 3EDQB 5K20B 4CRJA 1XK8A 5D4NA 1SFXA 3OVBA 1UMQA 3TUPA 3JRGA 3CXCR 2JJ4D 3C16B 3AH6A 5C2CA 1KA8A 3NEKA 3KLVA 2G9OA 4XR6A 4MO7A 1WHVA 4Q4ZF 5L39A 2RHSB 5L3EA 2J0SD 2GOMA 2CQQA 1GMUA 1VIXA 4WCGA 1D5YA 4IHSA 1QM9A 3AJDA 2HHUA 3WTSC 1N36F 1D5VA 3PY8A 3OJSA 4J9VA 1M5OC 5GPAA 3HOYJ 3WODF 1WPKA 2ZD1B 3SMZA 4CQ1A 1LKZA 3F44A 1PYVA 1V5FA 4UHTA 4HNTA 1REGX 1RCXB 3GTGJ 4EYIB 1XPXA 4I76A 4CICA 2HFHA 5KFPA 1BXNA 4MYTA 2HZCA 4OI4A 3AAFA 4XLFA 5DG9A 4PJNA 5KFMA 3R6GB 3F41A 4GDFA 3ETMA 2JEFA 1Y5NB 2KXHA 1F9FA 2B4UA 4LRAA 4X4QA 1KDNA 4P2SA 1YOVB 2MSSA 3UN5A 3T6BA 4A8MP 1G3YA 4Y6IA 3PZPA 5JJBA 4B9SA 3H4BA 2K9QA 2ZH3A 1CULA 1R7IA 1YGYA 4M5KA 4F7VA 3I4HX 2DFHA 1J5OB 2LNBA 5C24B 1LFUP 3W60A 3SZTA 5B1AH 5DZ6A 1I39A 2AV5A 2C2ZB 1QHHD 4LB6B 1FNMA 1Z0XA 3JRIA 3FZ2A 4DPXA 5EYRA 1D3WA 1P92A 1BI0A 1FFSB 2VPZB 4U8YA 1WKKA 3PX0A 5KOWA 3FMWA 1X9SA 4ZZLA 3OTEA 3K5OA 2VFUA 2IBDA 3JRCA 4C30A 2ZBKA 2BANA 4CYUA 2IS4A 5L3GA 1T8IA 5A6WA 4I6WA 1XTZA 3GW2A 1XNQJ 4F4YA 3I55I 1CJUB 1DGRM 1F36A 4PRFA 3O8WA 3ENAA 2PG4A 4ZVFA 2IRFG 2LY9A 3OV7A 4USUA 3CTRA 3DHWC 2LDYA 4XK8C 2Y8YA 3DOKB 1U1OA 3H92A 2ELKA 2P6TA 3FEYB 2KRFA 4FPRA 2OH2A 2HEOA 2XRNA 2LKPA 5JVGQ 3TUZC 3GUDA 1WTBA 2LY1A 2HBZB 1YWXA 2DGXA 3QIPA 2W9BB 4RUCA 4RX6A 3IC7A 3CO9A 2K8GA 4LSNB 3FXOA 3JRHA 4M3FA 1PJ7A 1NK7A 1XGSA 2QIFA 2HOSA 3FHNA 1YRXA 5GAEU 2B6AA 5T41A 3TVYA 1MSWD 1C1BA 4DZDA 2GNKA 1NSKL 4I56A 2CPEA 4BDPA 1U3EM 5GP9A 1UPMB 5B08A 2E1MC 3CMQA 2M8GX 4N0BA 1D9FA 4R1HA 1WI8A 5AJ3J 1DLOA 2ECCA 4FISA 1WHXA 2RRAA 4DLEA 1RR8C 4MKYA 4RBOA 5CLSA 5LBQA 4USIA 4KIGA 3O8HA 2O5DA 1C4CA 5F9NA 2LF8A 3LAJA 2WZ1A 2HTSA 1HBUA 2IGMA 4KUMA 1HF0A 1MDMA 3D6MB 2G0JA 1S7HA 2ZH9A 5F8JA 2LFVA 3PTWA 2AJQA 5I42A 3TWZA 1IKWA 4AFFA 2IAIA 2OV7A 3P9CA 2AJ2A 1D0YA 1QVUA 4LRBA 2L48A 4TXSA 4KIAA 3V7SA 3QYEA 4BHBA 3BV8A 3BR9A 4FNHA 5D3GA 1O7FA 2VQHA 1I50J 1HW5A 2GBYA 4X84A 1SFUA 4KNYA 4DCPB 1UTAA 2CQGA 2MQLA 2W48A 2QX0A 1K6OA 4CLLA 4OX8A 3IRRA 1HWKA 5LMUJ 1XMOF 5DM7Q 1FRMA 1HBNA 1TWHJ 2ESHA 1RSCA 5L46A 1FTZA 2DMQA 3J7A1 1RZ4A 3DRRA 2MABA 1YJNS 2IC3B 1RBAA 3T5LA 2IRXA 2DITA 1HC8A 2G9WA 4DV1F 5IYDJ 5JHFA 4E7KA 2YNFA 1G3WA 3JCUC 3UO0A 5D5UB 1QU3A 1LOUA 2HEKA 2OLWA 4N7TA 2CO5A 2EA4A 1F9EB 2FLOA 5MLCV 5BR8J 4PPZA 2OSQA 3K5NA 1QLNA 1G4CA 2LEPA 4ECSA 2BE2A 2FSWA 3UCGA 4OHWA 1WHWA 5DUIA 2IDLA 3GB0A 2YKNB 5IOLA 1BWVA 3VVUA 5A8RB 1LV5A 1WDDA 5JFRA 4M5JA 1RWXB 3IG1B 3IBFB 1WZ2A 3Q0AA 1APSA 3KKFA 1RTZA 4MKVA 1XQIA 4A2UA 1RA6A 4XNFA 3Q5FA 2YWWA 3J80Y 2WAEA 4GXOA 3LH2S 4B47A 5IQQA 4C11A 3M1EA 1WDTA 4U6PA 4OOIA 2EVZA 2D69A 1ZZNA 5H2FC 3MKLA 4YUDA 1KD1T 2XB2D 2VBYA 4EFAC 1BW6A 4IRDA 2W85A 4WWCA 5M2UA 2JEIA 1SQEA 2C3YA 1RA7A 4D7MA 2CJXB 2EW9A 3JSYA 1RETA 3EDRB 4B43A 4EJTA 1IQZA 3CJQB 1S12A 2YKMB 2Z2MA 1Q7LB 4A8YA 3NG8A 1HQCA 3QZ7A 3C14A 1BC7C 1V3ZA 4ECTA 3CCTA 1OYIA 1WWXA 4NC7A 1T95A 2A6MA 2MBFA 3A8IA 5C2GA 5HS9A 1Z6TA 4GKKF 1K61A 1H3DA 1BA5A 3T9NA 1EQMA 1TKXB 3RKWA 3BPVA 2XGXA 5LXYA 2FBIA 1YBUA 1NKBA 4CO2A 1M1GA 4I98B 3EVMA 4F04B 1TUWA 1NG7A 2AQ4A 4CZCA 1YBTA 3D5SC 5C42A 2A61A 2GIQA 4DUZF 3SI8A 4CLYA 2W8KA 1L5UA 1VI0A 4XK4A 1HNXJ 2L5QA 1K44A 2FHOB 4BHQA 2NQPA 1G6NA 1Y5LB 2JSCA 3R6LB 4ZN3A 5T7LB 5J1EB 2FY1A 3BGRA 5ETVA 3TJ9A 2PC6A 4M5DB 3G2BA 4A4JA 2EKNA 3KHRA 4R5PB 4JI6J 5J2NA 4BGDA 2YQ0A 4U9RA 1FXDA 1VQ4S 2N4CA 4Y0FA 3CCSS 3QYYA 2OPPB 3AB4B 3LALA 4NLGA 3GZ5A 3DKYA 5J4YA 4OX9J 4UTGA 2YPRA 2XZWA 1NPRA 2I6WA 2G2YA 1UVKA 2ZMEB 4YP3A 1XDSA 3A8KA 2HVRA 5CVJA 5A6PA 3HM9A 3MM5A 2HW3A 1TL4A 1EARA 1UG2A 1IDZA 4NLXA 2DYAA 4U7UD 3HC7A 3M1VB 4X0GA 3K9TA 3R0AA 3ZZPA 2HI3A 1EJ7L 1TWCJ 1RHQB 5BXIA 3CJ0A 2FVQA 2R7TA 3WZ0A 2I10A 1XSVA 4DXLA 2W9AA 4LREA 2N7CA 3UVJA 3P3DA 2Z30B 3KG1A 3LWLA 2B8QA 3PO5A 4X6AJ 2GZWA 3LP0A 4O44A 5CXTA 1JJCB 3VFZA 2LQJA 2COLA 4LD5A 2ELJA 2FDNA 2XMJA 1U25A 3UWTA 3A1YA 4GO7X 3RAMA 1TL7B 4IFYB 2O0YA 2WAQA 2WB4A 3IMQJ 1XSXA 5ERIA 1S9FA 2K9SA 2D3O1 1J27A 2BY0A 4AYBD 2K3FA 3TEGA 4HH0A 1J09A 3DF8A 1VQ8I 1PGZA 1R27B 3GYNA 1ZGAA 1SL0A 2GMJA 4LIRA 1B72A 3GFXA 1UHWA 1AKHA 2Z33A 3CCVI 3M8JA 3GTYX 4CM0A 2XLKA 4WK3A 2DI3A 1X1PA 3S8PA 1SD4A 4WFAQ 2L4AA 5G4DA 2D3OR 3I0SA 4PUOB 2JC1A 5GADI 4F3QA 4RLFA 3FHZA 3MDFA 2HVQA 4WXWA 4IRCA 3C46A 3PHEA 2E1CA 1NBEB 1RAAB 1VZ0A 1RWNB 3K6GA 4XPCA 1PP8F 2F5GA 4BY1J 1MN9A 1NJZA 1IKVA 2Q3PA 1DQ8A 3F8CA 4MQVA 3BN4A 2F4VF 3QRPA 3DPTA 5HANA 3DLLQ 2H09A 4Y2IA 4A3EJ 3ULQB 5B0DA 1XX5A 4CLZA 2QO3A 1VQOI 2DMNA 5CHCB 2DH7A 4JP0A 3JTNA 1PYTA 5KFFA 3KLGA 2CV2A 1RAHB 3H5RA 3KYCB 4G1QB 3IWNC 2AP6A 4KKOB 3G6EI 2V6CA 1O5JA 2PBIA 4A8FA 4KPCA 2WONB 3MUMP 3DRPA 1LEBA 1Q4RA 1UHSA 4E7LA 5D5XB 2CSOA 2BRLA 3OLAA 3DMJB 3OYGA 3ZZ0A 4ZPDA 1UW9A 4I67A 4NZ6A 3I56I 4Q5SF 4DDFA 4NBQA 1S5ZA 4F0HA 2KB2A 5F0WA 4F8RA 3PX6A 5ETTA 4OX7A 4HDUA 3IR6B 1VGYA 4B44A 5DGAA 5FFXA 2B9SA 4HTJA 4UZCA 5TRDA 2B63J 2KO1A 4EM1A 2HHWA 2GJ2A 2IA1A 2AYEA 2F3JA 3BY6A 2IM1A 3HHEA 4C6AA 3AT1B 1U1KA 1VQNS 1N77A 3K89A 3TO9A 2PGCA 2HHHJ 3NGKA 4LF7J 1FNNA 4M5NA 5EZHA 3CC2I 4IEJA 2BHYA 5HDKA 1TTYA 3CJTB 3MM6A 3GLJA 2WW4A 2QYCA 3LL7A 4WFYA 1IV8A 5F8LA 2MKHA 4WIQA 4NXMJ 4DV3J 4AVPA 2NXCA 1R7JA 3IS9A 1K6YA 4B02A 2XLJA 3A02A 2UUBJ 3OL7A 3IAS9 3MECB 4KIBA 2UU9J 2EIJH 4M6VA 4YR0A 3RUBL 3IGVA 2X1FA 3LUYA 2RS2A 2WK4A 1WEXA 2ICWG 1FVQA 1WJEA 4LR9A 1UZCA 2X6XA 3QU3A 2HRTA 3MWBA 3HXMA 3C16A 1WVRA 4BXUA 2EV6A 3EYYA 3FX3A 3MWMA 3SSQA 3D5MA 5CD4A 3HTUA 2RQPA 3BDPA 1VQMI 1NDLA 3H3VK 3CVKA 3S1QJ 2CU7A 1HBXG 5B0FA 4CWBA 2H5EA 5DDOC 2O01C 5KFUA 3OTBA 3QPSA 5TGTA 2DHGA 3HMJG 1FO1A 4CNZA 4V19J 2W7PA 2GVZB 2ZD1A 4JV5F 2NUHA 3CCES 1FERA 3NS6A 1K73T 2DISA 5K7FA 1S7AA 2HOTA 3RGIA 2XO7A 3ZMZA 3PYFA 3LNQA 3S01A 3NGRA 1R5GA 2J8SA 1ON2A 1LE8B 4RB2C 1FSHA 5FKNA 2E5ZA 2NYIA 3SDGA 2OI2A 1VC5A 2XYHB 1HNIB 1SI9A 2DFFA 3QPHA 4GYIA 1NLKL 2JVRA 2HURA 1MWZA 2X3GA 3QT6A 1BJAA 4HH1A 2UVWA 1ZAWA 3FXRA 3HJEA 4MK8A 1UEVA 1LW0B 1AU7A 3GJTB 4NDLA 4DZJA 2ACJA 2VJJA 4DUYF 3T6JA 1J5OA 1W0UA 5C24A 3VODA 4RNMA 5HP1B 1ETYA 1NM2A 1R4MB 3BCBA 3P45B 1FE0A 4W4MA 3SFGA 3FSXA 2ELHA 4U88A 3NWSA 4AQYF 1IG7A 2F5DA 2CJQA 3HVTB 4KTQA 2MQMA 2KH9A 2UXDJ 1BY9A 1E2XA 4AIKA 1N54B 2ISYA 1YW9A 4M9XA 2HS4A 2HKEA 1X9WA 2KZZA 4P5OA 1ZG5A 1NNDA 2HG4A 3RBDA 3BS9A 1RGVA 5KFZA 1BE4A 2JHEA 4I01A 1CJUA 4I7FA 4GVBB 2OPRB 5IWAJ 4NXNF 4WXOA 3JS9A 2JPBA 1Y4ZB 3GTMJ 1NHVA 1RC9A 3TW0A 3SCIE 4UZBA 2DNLA 4IOAQ 2F9JA 1R3NA 3DOKA 1IN4A 4Z2XA 4DCOB 3HI9A 1SFEA 4ECZA 4DL7A 1VQ5I 2BKNA 3KLIB 4NQWB 2DHSA 3E7LA 2YU9J 1VQSA 2DNQA 1N34J 1DZ5A 2PJRB 2FNAA 2ZC3A 4IQMA 1ULYA 4UY85 1KQ9A 4I69A 4Y2CA 1A04A 1HR0F 1H89C 2W9BA 1U24A 1YITI 4KDPA 1WWHA 5J8CA 4LSNA 1SFKA 3D66A 3SSSA 2HFUA 1K0TA 4ZVTB 1IR1A 2XMMA 1BBYA 3D9BA 3ZQHA 2BKOA 1WFXA 3CC4S 4KYWA 5C4XJ 3FBFA 3P9IA 3CJ3A 5KAKA 1KHWA 3RPQA 1U1QA 1A36A 4BAYA 2P5KA 4AIHA 2W9CB 3KEQA 4DPTA 4XL9A 5J3LA 1RB0A 5H20A 4ZVSB 3I6PA 2DMUA 2LY2A 3HPGA 2BA9A 1TK5A 4KE5A 3F21A 3FBCA 2P9CA 5D4SA 4WE1B 3KHGA 1UVLA 3CF2A 3HHHA 3BH6B 4JV2A 2BJ8A 1R0BG 2IA0A 1L3KA 5T14A 2M2EA 2LKSA 1OPIA 2ZSHB 2OEJA 1XNRF 4H0EA 4IRHA 1JXSA 5F0FA 2MQ8A 3R6SA 3BPSP 4WYWA 1KHVA 4QWCA 4KMFA 2ZKTA 3LTOA 2M4MA 1CGPA 2UV8G 1LFWA 5HQ8A 4TY8B 2RGVA 2C2NA 2NYHA 1K8AT 1ODDA 1XD7A 3WGIA 4ZA1A 4LF5J 2UUAJ 1P9QC 4U95A 1CLFA 2XF6A 3HSGA 3QT8A 1YKWA 4QBUA 1E6VB 2ZXWH 2IC3A 3LOCA 2MKJA 1RBLA 4J90A 2HMIB 1ZH5A 1HPZB 3K17A 1R8PA 1S3JA 3H7HB 2LTPA 3OXGA 1X4OA 1K0VA 5D4LA 4BE0A 3HOTA 4FX0A 3VYRB 4OX6A 3JQJA 1I1SA 1WUUA 3MMBB 2ZH4A 4A12A 2AS5F 3E97A 1Z3YA 5FROA 5SZTA 5BPIA 2NZ4A 4RPFA 5DG8A 3Q8VA 4FXDA 4ECUA 5HLTA 1SD6A 2DA3A 3AG3H 4ZVUB 5K5MA 2FQ3A 1AWCA 3LGHA 2QZ8A 4ED4A 3A01B 2PEHA 1IKXB 4KT6A 2FVSA 2AMCB 1IN0A 3JSPA 4BCAA 3UN3A 2YKNA 4ANDA 5A8RA 2LQ8A 2RS8A 2E35A 1T9XA 4URSA 1DJ0A 3IG1A 4NEZA 4ZPVR 4LJMA 3MF5A 4DL3A 2HOEA 2OD4A 2DT7B 3DLBA 2CW7A 2F5EA 1NAQA 2CWXA 3CW2C 1M90T 3RCOA 1J2XA 2XF7A 2G13A 2W4SA 3CJ4A 1QAJA 4JI7J 2Y0MA 2AW0A 2H5IB 2UXBF 4LBIA 3VOEA 4L6V3 4CUGA 1FBSA 1GV5A 1QTMA 3K4LA 3KFWX 4OU0A 2UZKA 1D9AA 1OY9A 2KG0A 3HOVJ 1NK2P 3P5TL 1GMVA 1HI8A 4NWBA 1BUXA 3C18A 1IXRC 2EEYA 2V2KA 2N82B 2QL9B 5ITHA 4Z7CA 3BG9A 3CJQA 3I9V9 2YKMA 2ZFHA 3GWCA 1Y10A 4NUBA 2L4MA 3FEZA 3J80Z 1P7IA 1SJ3P 1YX3A 4X2BA 3S2WA 3K69A 2KM8C 1I94J 3RBXA 1HBOB 4QU6A 4HV6A 1B70B 1FHTA 1NH7A 4YDDB 2NNNA 1T0FA 4JBAA 5E79C 2QJ3A 5KFHA 1TKXA 3UCZP 4C2TA 1ZTTA 3E3VA 4UW2A 1SJFA 4KGMA 1SQGA 5LGNA 2KIFA 3W5YA 4ZCIA 2ROGA 2BVZA 3SZPA 5BJRA 5EJCA 5C44J 1TC3C 1WJFA 3H3UA 1VMBA 4DR7F 4YIFA 1RLCL 4Y3OA 2QFJA 2JUGA 1CC8A 3AG1H 3WC2A 1YLFA 3TVZA 3F22A 1GX6A 4RKUC 5T7LA 5J1EA 4AL5A 2ADUA 5HI7A 4M5DA 2LF7A 3M8WA 3KK3B 1ZR4A 3BR8A 4R5PA 2Y3YA 3CULA 3GJQB 2XSDC 4G6TB 3TA1A 1JKQC 2OPPA 2BZ2A 3GR0A 1URNA 4UB8C 4NRUA 2E5IA 4PWUA 5THWA 2ZMEA 2Z16A 1UZHA 3N6MA 4WF9Q 2YTCA 2KFDA 1NH3A 2M52A 4ED6A 2DY9A 2CPDA 2BJ9A 2FJWA 3FFIB 2HBYB 3B82A 2LD5A 4OMYA 2AX1A 5F9LA 1N32F 5M5YJ 2GAGC 3M1VA 5LFAA 2X1DA 2IGNA 1JE8A 4KR0B 4ANJA 4JI0J 3E6DA 4K0KJ 4C0OC 2IGKA 4YEJA 4OZLA 2EJRA 4H4MB 3S1RJ 2BM0A 1TL7A 2DPUA 4IFYA 1YQHA 3OV8A 5IT0A 1XB4A 3I96A 3K4KA 5FLXK 3IO1A 3H36A 2QQAA 1RWWB 3MTJA 2H6BA 1W4MA 1EHWA 1Z05A 2XNQA 5HMXA 3OLBA 1YRNB 3H2VE 1RT1B 2B4VA 4EI2A 1NZ8A 2ZE2B 4OHZA 4A93J 5A2QK 2QWWA 1SVDA 2RQMA 1KQGB 5D0EA 1OYEA 1FI4A 2R4GA 4PQAA 2E5LJ 5M5WJ 2E2HJ 5E20A 1RIOH 2R92J 1I5ZA 2A2DA 5KFQA 2CKWA 3OYBA 1BR2A 1I6JA 1Z7UA 2F5CA 2VPRA 4EK2A 4R8UB 2APOA 2FMLA 3K4MA 2CGPA 4CTAB 3OMYA 2ZM6J 2RQQA 2NS8A 2QL7B 2C3PA 1VBKA 2WSCC 5EUHA 4BUPA 1P27B 2K7JA 3BGFA 4U7BA 3DI6B 2ECBA 3IM9A 2FQQB 3PEJA 4C8NA 2Y0BB 2OP5A 3F0CA 3QATA 1JMTA 3Q83A 3OL8A 4FF4A 2PLYA 3G4SS 4LMYA 3ZRGA 5J1PA 1HNZF 4G1QA 2N7YA 1IRZA 1XSDA 4XLAA 2PMHA 1B1BA 2D9PA 1DP3A 4KKOA 1FEHA 4NC8A 3DLKB 4QW8A 3CUOA 1FJ7A 4RAYA 4WFZA 4X62F 4QPOA 2WONA 4DLGA 3MPWA 1C0UB 4YIRX 5CCLA 2YPYA 2ZC2A 1ROFA 1Q86T 3L7WA 3DMJA 3R60A 4IQJA 2HIQA 2YKOA 4ZLJA 1EX8A 4MIWA 1BQXA 4ZHRB 3DKXA 2IMWP 1QQIA 2JWNA 1QAXA 2J9DE 4N8OA 3DPLC 2XAHA 3KDOA 3TRGA 3W6KB 5AJ3F 4HLYA 1MU2A 5DYMA 4H4KA 1FK9A 4ED1A 2LRDA 2D1CA 4I6YA 4C3KA 3D3CJ 3T1BA 5F8GA 3N01A 2DEJA 3TOQA 3CNQP 2MYSA 2HK3A 4UV8A 1KQ8A 1HD0A 3IAM9 2R93J 2P7VB 3S3NA 5JVTA 1V54H 4M6YA 4HDHA 4OIPF 1RT6B 3PX4A 4NLTA 1OJLA 2ZXJA 3RKXA 1RQ0A 2OMOA 1J5EJ 5FD5A 2HVHA 3CJTA 2VD3A 3TAPA 1O57A 3KMSA 1EA3A 1H7XA 2IFXA 4MH8A 3C66A 4L5JA 1UETA 4ZYAA 5CABA 5DD8A 4X4OA 2RC4A 3R61A 2HRYA 2CQXA 2ZWPA 4IFVB 2R7DA 5GAGJ 4C0BA 3MECA 4WWSA 5AE2A 3G73A 3CIMA 2Q2EB 2Y2ZA 1FFGB 2O3DA 4K4WA 2KISA 4Y2KA 2F1FA 1W2BR 3KLOA 4RAZA 4ZH4F 4C8ZA 2QSGX 4K5SA 3DLAA 1RAGB 2HQIA 2MFZA 3SFIA 5U47A 2XRLA 1PUFB 4QZVB 4A3GJ 2CMPA 2KJCA 4K4YA 5K1YA 1CQTA 4LIVA 5BR8F 3PM9A 1HLVA 4EGYA 2MD5A 5E3OA 1PP7U 1LEAA 3HVWA 4YB6A 2OQGA 3W2AA 2IDEA 3P7NA 4RO0A 4EO6A 5IT9U 3VGTA 1EKEA 2ZB9A 2L9NA 4ZVGA 3V4MA 3M7GA 3T1YJ 3T19A 1LE8A 2IPOB 1RI7A 2VL1A 1PG5B 1D8JA 1S99A 2KRBA 2R3VA 4HYEA 2ETHA 4U8VA 2DAOA 3UW1A 4DQQA 5D6EA 4YRVA 3QYBA 1HNIA 1RT5B 3I64A 1KU2A 2D1HA 2JEGA 1VISA 1ZR2A 5IZHA 2MH2A 1P9YA 1TNSA 3T1AA 3BCAA 4OI1A 3BG3A 3I82A 1LW0A 4IZZA 2WW8A 1RAJA 1W26A 3IWXA 5KFYA 4X64J 1QD1A 2M7AA 3LA0A 5JMNA 2BW3B 4CP5A 2R7SA 1B9NA 1W25A 5HP1A 2M70A 4HVZA 3PRDA 3MPUB 2M0MA 2LDIA 3HVTA 3QGIA 3R5BA 4JI5J 1HNVB 3AFGA 2KFNA 4M73A 3EVOA 3KP4A 4TNOA 1LQ9A 1FC3A 1QE1B 4PAAA 4JUZA 1EETB 2LKZA 2HNDB 2BBYA 3VGVA 3KZZA 4QIWN 2PIIA 1ZYQA 4OZNA 4ES1A 5ICEA 3BJAA 1XIQA 4F4KA 2YSRA 5K8PA 3KLNA 2BE9B 3HJVA 2XUBA 5CQGA 4GVBA 1YIJI 4KMUX 3BB5A 2OPRA 2XBPA 2WVEA 1XMAA 1Z1ZA 2VU5A 3LWMA 1QSYA 2DY1A 1EB0A 1N48A 5AIPA 2AWZA 3OHAA 4E7SA 3L09A 1H8AC 1HNXF 3AXMA 1WTFA 2RQKA 3CCLS 2Z2ZA 3KLIA 4NQWA 2RDJA 2OKQA 1W36D 3M8YA 2FJBB 1PJ6A 2PJRA 2HYJA 1DHMA 3HSRA 4QWBA 2XO6A 4JI6F 3PM1A 1VQ6I 1S97A 4PG8A 4A0ZA 1PJ5A 5KT5A 1G2HA 2XCAA 5CZVA 3IGNA 1NUEA 1MW7A 1NK6A 3DLJA 4URGA 3NMRA 1K47A 4HX4A 3BF4A 1X1DA 2H6CA 2KQRA 4OX9F 4HHJA 4KISA 1JLFB 2AHQA 4IR9A 2STTA 2I2YA 1KU3A 3OJUA 1MMGA 1NG6A 2VT3A 4MEXF 2OF7A 2WAQN 1REPC 2X1EA 4G6QA 2W9CA 3RRHA 2DHAA 2IVMA 3WTVC 1IBKJ 3ZN1A 2KDZA 2MKCA 4DFMA 2CPXA 2QQ8A 3EUKL 2M4GA 5DCMB 2QTWA 2IHR1 4V1Ak 1BIAA 4G8XA 1P4XA 4ZVPB 3CMAS 1GHCA 3HF5A 4WE1A 3HHGA 4C8OA 5J2PA 1OCCH 1GNKA 4RUBA 1I1GA 3JRBA 2I0XA 4ZITA 3CEDA 5GADU 1WI3A 4L0ZB 1V4RA 2DXEA 1FZPB 5M2PA 1SMTA 3ZQFA 1TQPA 3GTPJ 1RT7B 3D0GE 1U48A 2HRUA 2VOOA 3FWEA 1FX4A 1RHUB 3DXSX 2DT6A 1U2RA 4Y13A 2AGQA 2CIMA 3MOJB 5A76A 1SIZA 2LLKA 3ISND 2GMHA 4TU9A 3L2QA 1NK4A 1P4AA 4A3MJ 3T5JA 3LP1B 1FD8A 4PJ0C 2WBRA 4UNOA 1JXEA 2FD2A 2F5FA 4OHXA 4LRFA 1DPUA 3CD6S 1F0XA 4TY8A 4L9NA 4RGSA 2RREA 1WSRA 4UT4A 1D09B 4RLQA 2L9WA 2ASLA 2JLEA 3P5BP 1FTRA 3VQTA 4ENJA 2FHJD 2QKLB 1GLNA 4QWDA 3R5DA 1RT3B 1E6VA 1Q78A 3RPUA 3QO9B 3AXKA 2HMIA 1RHRB 1HPZA 1MLAA 3J7YU 4KBIA 1BD6A 5DO2A 1IUJA 1G3SA 5F8MA 1T0TV 4WK8F 4BDYA 3M8PB 2RKHA 2DH9A 4QWEA 3BO2A 4ZKAA 5FLXU 4USTA 4WJBA 1NO8A 3F6OA 1X1CA 1NK9A 3MMBA 3OL9A 4OI2A 2XZTB 2CQ7A 4CYCB 4ZJLA 3M2UB 2QLJB 2FZGB 2MLKA 3A01A 1TUVA 2DXFA 3IHUA 1SL2A 1IKXA 5A2QU 4GGGA 4XAKA 4S05A 3DGVA 3HFVA 3TEDA 4TKTA 3VYSB 3GV8B 2CAJA 2YR2A 5CVIA 2IGOA 1VQYA 2DHXA 5J4VA 3Q8QB 4TN2A 2UUWA 5JLXA 3TJAA 2GQCA 3WHBA 1P7JA 1RAOA 1B0TA 1UFMA 3BJ6A 3DC2A 5B0AA 2ZCWA 4IH6A 2BQ3A 1FA0A 1OQYA 1V5EA 4E7HA 1IC8A 1HSJA 3J81K 5CKTA 1JI8A 1VQ4I 3CCSI 1SUQB 2K2PA 3IM8A 4I6ZA 4IYQA 5K8MA 1H73A 3M2RB 4HQMA 4QQBA 4F67A 1YQAA 3HSFA 3NWTA 4ZCMA 3QIDA 3OOUA 3PJWA 1AROP 4I99C 1KFSA 5DTDA 3OSGA 4BNCA 4WXCA 4ZJOA 4OZ1A 5EGOB 1SC6A 1BC8C 4D7NA 3PVXA 4RMNA 5ICFA 1A6LA 5E8GA 4L76A 3VQSA 2COMA 3LWFA 4C2MJ 1QZZA 1RCOB 2EK5A 4LF7F 1HBOA 4M9SA 3K1MA 1PCAA 4PG6A 2L54A 2HLUA 2KRCA 3H98A 1UA0A 2WV1A 2ILZA 2HBRB 3IKTA 4ER8A 2KDOA 1UFWA 3TKYA 3G6YA 1JGSA 2E7WA 5ILVA 3R5CA 1S5LC 1WC5A 3LAMA 5E33A 5F04A 2MKYA 1MSEC 4NXMF 3M4OJ 3MEEB 3OYJA 1JKOC 3N4WA 2VBZA 4DV6J 5ETNA 3BJOA 2UUBF 3LSRA 3U27A 3F3XA 2UU9F 1TU0B 3EPZA 6AT1B 5HDGA 3W7BA 3M4XA 3CCJI 4DJBA 5KAIC 1WC6A 2HNHA 2Z2YB 4FVCA 2O66A 4D0PA 3K2AA 5EZGA 3KK3A 3PNVA 3OYNA 5LHIA 2VJIA 4XKVA 5A8KB 3LAKA 3Q9SA 2IVYA 2WVBA 3W2VB 2DPIA 1RAEB 3QLHB 4Q45A 1POGA 4OYBA 1G3TA 3SYZA 5HMWA 3H5YA 5KFDA 3TGNA 5DGBA 2ERRA 1TWFJ 3FFIA 4PYDA 4Z2YA 1VLOA 5J2QB 1LK7A 3L2WA 1GT0C 4CCKA 2E1PA 3UCUP 3MCZA 3K0JA 1VQ9S 3DPUA 4AVZA 4Y15A 4ZLLA 3M32B 3R8YA 5J6XA 1ZTRA 1XBWA 3LSIA 2GA2A 3NXZA 4FE7A 1A9NB 3I5CA 5C3EJ 1LQ1A 3OFEA 4ZLNA 1PC5A 3KX2A 5F8HA 4RUHA 6FD1A 2DPDA 1FRKA 2HIYA 5GAEI 4X4NA 4H4MA 4W98A 2BOAA 2R8KA 3TNVA 3IH2A 3LPEA 4WYLA 2HHSA 2QL5B 3G82B 3I9V2 4O3MA 3KEYA 4QIEA 2YX1A 4OLPA 1BQMB 4B3MF 3LAPA 3ICLA 4I68A 2HYFA 3NARA 1IBLJ 2VB6A 1AZSB 5E3MA 1YRNA 1YS7A 3TP3A 1XR7A 4M5GA 1F1ZA 1RT1A 2ILYA 5F8NA 1S0NA 5M2RA 4HX8A 2KJWA 4BLGA 1FLIA 4HR2A 2FBKA 4DYCA 2W57A 1S7OA 4GC6A 3K4JA 1S7EA 3WTTC 2FBHA 9RUBA 4W92B 5EEGA 3CJ2A 1QPIA 3PIPQ 4LQ9A 1YZ7A 2XS5A 2WSFC 4KIFA 4UXNA 2AYBA 3SZ2A 2N4DA 1CJTB 4PWWA 1TL1B 2XAQA 4R8UA 4DZPA 1JUSA 2EC2A 4KHMA 4MNUA 4U87A 3TA2A 5IWAF 4JB8B 4PG7A 4CTAA 1IAWA 1HWJA 3HPOA 1IWGA 2FA5A 4OJ1A 5K5QA 3DI6A 3OIPA 3PEHA 2YU3A 4ZVHA 1DRZA 2M30A 1OS5A 2JA5J 2DNNA 4KSEB 3QRRA 2C2DA 3SFUA 1T9UA 1TAUA 1N34F 3F8MA 3WE3A 2P8TA 4BWJA 3M8EA 4FS2A 2MLYA 1Q5VA 3WBZA 2L01A 1YIOA 2IM0A 3DYAB 1NMEB 5D6GA 3KIOA 4LF8J 2DK5A 1IZ1A 3DLKA 1N56A 1OCPA 5BYRA 2M9HA 1H38A 3MPVA 3V6DB 2X9DA 2CWEA 2DRDA 1IJWC 2ID6A 4RM3A 2BXZA 1NRKA 3TZXA 3ZXWA 1QZYA 2OPTA 5JVGF 3AQOA 2XMWA 2HVIA 1T9VA 1WNEA 2Z5UA 4ZHRA 3ILOA 3IR7B 4ECVA 1J7KA 2HQGA 2M3DA 2CJJA 1FIAA 1BMQB 2Z57B 3BR6A 3BGUA 1Y3JA 2XGDA 2DFEA 4DGWB 1GXLA 2OD6A 1XC9A 4M5HA 4OIQF 4UB6C 3RJPA 4L72B 4K50A 5IPAA 1OCZH 3N28A 3RZDJ 3KNAA 3EGNA 3DNCA 1SJ4P 3NAHA 4LMZA 2NXNB 2J9DA 2XMVA 4QSHA 3CCEI 3W1YC 1IGNA 2QVOA 2CWKA 5KT2A 2L02A 2ID3A 2XASA 2WC2A 4KGKA 1QZEA 2AXLA 1G2EA 1RT6A 4FBTA 2FJ1A 1ZYRF 4A8KA 2RKIB 5FLMJ 4GKKJ 1G1XA 3S17J 1VBYA 1UPPA 1BOAA 4NL5A 2XYGB 3K7RA 2PI0A 1ZA1B 3H5AA 1P1TA 3MR3A 4BS9A 3G3ZA 1DY3A 2OPSB 3DHXA 2GJFA 4RBUA 1FY7A 5E5NA 1QJHA 2KHCA 3KNGA 4EZ9A 4BJTA 3FDSA 4DR5J 2MW8A 4EJVA 3J81j 1WI6A 4IXAA 2HBQB 2UUAF 2XDVA 3GJRB 3H5XA 3KWMA 1P1LA 3L4BC 1SD7A 3U1NA 4M1KA 1IXKA 3O2PE 5K8OA 2MLGA 3E6BA 4B9VA 2F8HA 2YKAA 4LLGF 3ZZTA 2Q2EA 2EWNA 3H0GJ 2OCEA 2V1NA 3QQAA 2CDRB 4LK1F 1MWYA 4ED3A 2RT3A 2XAUA 3Q86A 4XIDA 2AYMA 2LBFB 5DM7F 1PUFA 4V2GA 2ZC4A 2HGLA 1U1LA 4RBVA 4RW4B 2VKEA 4WBFA 1Y11A 3HULA 3ECHA 1HBMB 3V8KA 1JK9B 5HNHA 4CLPA 2O9LA 1TL8A 2HQCA 2CQBA 3BH7B 2A2CA 1R5ID 5BYSA 4U96A 1J59A 3HM5A 3O3KA 1IR2A 4OIXA 5E3LA 2QMWA 4QYZK 1W2IA 2KIUA 2CNNB 1ETOA 4JQFA 4C97A 3GLXA 3BDEA 2AJFE 2XS2A 2E1MB 2XGCA 1RT5A 4JI7F 2CQPA 1MSFC 3HD1A 2V8GA 5EX3A 4B1RA 4ESBA 3FK4A 4QR0A 1CQNA 2LQ5A 4TLRA 2MC4A 4MHGA 2LXIA 3I9ZA 4RW9A 4HW0A 3CC4I 2BW3A 1MBGA 2AXTC 1S6OA 2Q43A 3DM2B 1ZAOA 5D8KB 1PO6A 3EUAA 2XROA 2K9LA 1SKSA 2H3EB 4C7QA 2G0CA 4EV0A 3I4MJ 1VS3A 2CADA 1RT4B 3B4MA 1HNVA 1DTQB 3D0HE 3PW4A 1Y3KA 3OSNA 1C0TB 1QE1A 4AC0A 1GDTA 2FNPA 3GIIA 2K9NA 4BU2A 1EETA 4D5FA 2HNDA 1JLAB 2HS0A 1J2VA 3PFOA 1M1EB 3J81U 1OISA 4DG1B 2B7BB 1S76D 2J0XA 1LNQA 3B02A 2MH9A 3IL2A 1Q0NA 4BQAA 3MM7B 2E5JA 4DR4J 2GJIA 4BKXA 1HIYA 4KYZA 4DL0C 4QCLA 2HHVA 3OS1A 2KJVA 2PT0A 2KT5A 1DAXA 5H9FK 5EGYA 2ADCA 4MFBB 4ZMMA 2R2TA 3KEOA 3MZIA 4CLFA 2FHJA 2BQUA 1R36A 5IYCJ 2MGZB 3B6BA 3FXQA 2ZJQQ 4UQTA 3S2DJ 3RYRA 1X5OA 2BYCA 2AGPA 3PUBA 1VQKS 1NK3P 3WIUA 3W2WA 2OPQB 1FRHA 1WSUA 2FJEB 2G1DA 2IM3A 2ZEJA 2F4IA 4GVLA 3CB4A 1L0OC 5IQ6A 3EUHA 3TAMB 3GIJA 1JLFA 3ET6B 2M5WA 3QWUA 5ED4A 5F1RA 1L3LA 2YPZA 3H90A 4GRIA 2DNRA 3D0IE 1RUSA 2Z2SB 1FCAA 3UD4P 3PNTA 4KGVB 3SV4A 2POKA 1JLEB 4UUXA 4ES2A 1TKZB 3GU0A 3G86A 2LU1A 2V1UA 5FKOA 1ACMB 1OY6A 2HPIA 4DI6A 3K1PA 7FDRA 2VA3A 2ZZTA 4LRCA 1T7PA 2LH9A 2PQ8A 5KFOA 3BR1A 5DCMA 1S6QB 2JEJA 1VCTA 4YR2A 2W2NP 4JI0F 3VB2A 1RTJB 4BE2A 2VASA 2OA4A 5DQHA 4TLQA 2ZHOA 4X4VA 5F64A 2YVSA 2GQ2A 3ZNUA 2QG9B 1XCVA 4RJVA 2G2OA 3I3LA 4G6VB 4CA0A 1QSLA 2ZOMA 1T0FC 4HG2A 4UOCA 1RT7A 3MEGB 2WY7Q 2ZWOA 3VAHA 2RILA 3AG4H 2HQRA 2FVPA 1V5VA 4MEYF 4DFPA 2V9VA 3EICA 3D1QA 5BS6A 2PN6A 1IW7F 3HRMA 3LP1A 1LDKB 4OYZA 2QA4I 3F8NA 4WZMA 1GK8A 1SKRA 2KZGA 1P2FA 4NLSA 2FJVA 1D0EA 3PW2A 2JFKA 3Q23A 4IHWA 1CC7A 4HSTA 2E5LF 1TMMA 4ATNA 4XKWA 1OQ6A 1RT3A 1R71A 2VQFF 2FXAA 1MBKA 3QO9A 2KPMA 1T05B 5HO4A 3C2PA 2O8KA 2O03A 1YJ7A 3UDLA 1ZQ3P 2OMLA 4N4OB 2VG6B 3HOSA 2WV0A 2ZMEC 2ZM6F 3M8PA 1MBJA 4Q7AA 4NLPA 2Z4PA 3IA0A 1W7PB 2VE9A 3BKFA 3ZNJ1 3PJRA 2FJAB 2Y75A 2A68F 2IJNA 3HOXJ 4OIRF 2F7VA 3D1OA 5LSOA 4CYCA 4IHYA 3M2UA 5KFSA 1IUYA 5C25B 1M5SA 3M1CA 4B9LA 4JV5J 4ZTJA 1JJHA 5E3PA 4L74A 4PABA 3RZAA 2LOOA 2EIMH 3ISZA 3R7NB 2E9ZA 2A69F 3S1NJ 2HDWA 4M95A 2DGWA 2UV8A 2AEJA 4F02A 4LR8A 3BBBA 2ZZNA 1HQUB 2VKZG 5DDRC 2QF7A 4GFBA 3RKYA 1B6AA 4F25A 1XWLA 1F5AA 3PYDA 4IO9Q 3M2VB 2JQ7A 1A5JA 2LR8A 3R5AA 2LC2A 2DQRA 3E01B 1BR1A 1SUQA 3BPDA 3MD1A 3M2RA 2V9PA 4UVBA 3SQGB 4J19A 1FEEA 4K2JA 2JRMA 2RRNA 1ICEB 3VSKA 2F9DA 5DM6Q 1SPBP 4Z7YA 4ECWA 3M8ZA 4EBDA 5KVRA 4RM2A 4CHUA 3THPA 3SYTA 4AQYJ 3OTCA 5K5RA 3GG0A 3CMES 5EGOA 4B8XA 3KZYA 3R9LA 3V6HA 3HOWJ 3BTCA 4BEHA 4IKFA 5HMZA 4KRWA 3F8FA 4I09A 4WZQA 2XMKA 4KT0C 2P7CB 4LSLB 4DU8A 2FQ4A 2BBEA 4LFBJ 1GXPA 1J5EF 4Y2AA 1R8BA 3QBCA 2NZCA 3SDEB 5CA5A 3EGVA 3W9IA 1D9DA 4DV7J 3BTLA 2HVEA 2ATCB 1JT6A 2LVWA 1YJ9S 1ZHFA 3TMOA 1W7PD 2BGCA 4UOFA 3AOBA 1XR6A 2MLXA 2ZH2A 5BPDA 3PCOB 2DOFA 3WU0A 3MM8B 4DV4J 5DUKA 1R5HA 1WC0A 1I6XA 1Q53A 2ABYA 2Y31A 2MB0B 1BM9A 1FOYA 4CNYA 4QPXA 2IYGA 2R0QC 1WD6A 1VRTB 4NPOA 3FIWA 2BJ7A 1H88C 1TWGJ 3ABLH 4RA2A 4FKYA 2ZJPQ 3T0YA 3FZBA 4NA3A 4LIWA 2NUUG 1HR0J 4F2RA 4BACA 5KT6A 1JUMA 3MCNA 5D0HA 4WPAA 3FVYA 5A8KA 3C3WA 3E5UA 2KFYA 4U0YA 3W2VA 2DK2A 1KNZA 1RWKB 3QLHA 3MUTP 4Y7NJ 2CZ9A 2M8EA 3MZYA 4CCMA 3G71I 2QMXA 1WJDA 2KIMA 5D5VB 3AA9A 3TA0A 1TP7A 2DNYA 5J2QA 1AFJA 3H3ZA 2K9MA 3T1YF 3M32A 4RL1A 1KTVA 4BHCA 4PR6A 3N5FA 1OPCA 3GCXP 4J9MA 5FB2A 2KLOA 1KGSA 2IY5B 1CF7B 2D2WA 2B5JB 2NPIA 3ECOA 1Q16B 2YNHB 2EFNA 1B7FA 4HZFA 3ILIA 4UOGA 3UN2A 2AYGA 4EQQA 5IP6A 1IBMF 3ZZRA 4QPQA 4FVMA 2JVHA 1X1AA 5HVGA 4OV6A 3G82A 1K1QA 4J9KA 3UE2A 3CSKA 3PR5B 4X64F 2BY2A 1BQMA 1FXLA 1X0PA 4CM2A 1RU1A 3EPGA 4YG2F 2BE7D 2XQCA 1AZSA 2IW5A 3G8SA 1JKRC 3KG4A 3UDCA 2E19A 5HLGA 1YHQI 2VG5B 3GF2A 3BJYA 1Y6IA 2FHKA 3O6QA 3NOCA 3PW5A 2WTEA 4A0YA 4ECYA 1ON1A 3VYTB 2UWMA 2ZFUA 1JKPC 3DN9A 3CUQB 2KMUA 1ETQA 3H0DA 4PSXA 4O6JA 3R7BB 2GIVA 2VF3A 4G7OF 2ZH1A 1A7GE 1CJTA 1Y00A 4R79A 1Z21A 1TL1A 5ETPA 4M74A 2LMIA 1E3HA 2A6TA 5J1RA 1C4AA 2J76E 2QYOA 1QNTA 3U2RA 1N75A 2Y9HA 2UZAA 4ECRA 2NNYA 3OL6A 2DGTA 1F2GA 3GZ7A 1MBFA 2HYGD 1RKIA 3SEZA 1FD2A 2DGOA 5ETMA 2KT3A 1NHUA 1V9OA 1ZN2A 2CQ1A 4WCEQ 2PI5A 2NLWA 3KLGB 1FWLA 1RRJA 1AB8A 1OYYA 2FE3A 2IXSA 5IV3A 3DYAA 2DNMA 4IOAF 4CT9A 4FHTA 2G7UA 1SQFA 3V6DA 2EV0A 2PI4A 1FDAA 4CO3A 5F0HA 2JSXA 2UV1A 2V68A 4G1PA 3S32A 1IVZA 3MR2A 2QEXI 2DO0A 4F3OA 4PXCA 3S8SA 5D6FA 3BKUA 3VTIA 5C4JJ 1NJYA 3LP2A 2UXBJ 3DTKA 3ROUA 2BJ1A 1IBKF 4MTEA 1RWPB 4E7ZA 1Y1VJ 2EZIA 3IV5A 3I4PA 4ANCA 1FWZA 3P4UB 1SJRA 4YFXF 4A6EA 1FWKA 4KN4X 1OR7A 2ME6A 4QIVA 1EJ9A 2NXNA 2MZ1A 3WGGA 1UJ8A 4J37A 2NS1B 3OYFA 2CVEA 1YJTA 5HROB 4EJOA 2XC9A 2NREA 2P6SA 2ZNYA 2FX0A 4DYRA 1VLYA 1JNRB 1R1UA 2F4OB 2H65B 2RKIA 5HL7Q 1WG1A 3L2VA 2VKHA 5E1ZB 1XERA 3NS5A 1VQLS 1N0VC 1JJ2R 2BY3A 2OPSA 2Y9ZA 3J7ZT 5EWEA 2XZDB 2XSJB 2MHNA 2DGUA 3CUNA 4O3QA 2DYSH 3IS9B 1T03B 2IAJB 3CCQI 1D8ZA 1X4PA 2NYXA 4DBRA 3MR7A 3BLYA 2X48A 1LPQA 1FRJA 3W62A 2HGCA 2MJNA 3LFKA 2DR6A 1STZA 2WY8Q 3FKIJ 4M3DA 3WHCA 4PCQA 1KR4A 1V3RA 2N3OA 2PE8A 4HDVA 4IVNA 3QP6A 3L95X 2BOLA 3F0NA 2HDCA 1VR6A 2ESNA 1NU4A 1TV6B 4F3MA 4QLCU 2O5RA 1OCTC 3ZTSA 3VZIA 2LBFA 3H0PA 2HDDA 3CLOA 3TO6A 5KG5A 3CCMI 4RW4A 2ALYB 4UUWA 1U1RA 2C1EB 4QR2A 2JLGA 1HBMA 1RWUA 1R43A 2G4BA 2VL8A 2J5AA 1GMWD 4OJGA 3PIOQ 1PKUA 1HQEB 2CJ9A 2FIUA 5L1KA 1N32J 3I31A 2HNZB 2ZJRQ 4AL6A 5H9EK 2DMTA 3CCLI 1UW4A 2FGCA 1AXQA 4XLHA 2ZITA 5H6QA 2OZUA 2OFGX 3MI7X 3IRWP 1G4DA 3EZOA 2DEIA 2IIHA 2VICA 4ILLA 2BE5F 3AG2H 4I1TA 2VPWB 2VE8A 2EZKA 2FYXA 4K7QA 2ZH7A 2PJPA 4A5NA 3OSPA 4ZCKA 1WEYA 2ZO4A 3ABUA 2B43A 1B4SA 2DQLA 3WQPA 4X1EA 2DR7A 2MKKA 2H5JB 1QGPA 4DPYA 2ZNZA 4E8UA 3CJ5A 2A6HF 2VT2A 3DM2A 4DPOA 3R5GA 2MZSA 1FRXA 3MXHP 1IWAA 1F2HA 1BGXT 1X4GA 3Q2SC 3NMAA 3QP5A 1RT4A 1DTQA 3HGYA 2HQDA 4ZS6A 1EKSA 1FKOB 3BSNA 1C0TA 4DR3J 1FT8A 1IF1A 3HUGB 5E3NA 2HXIA 5BNGA 1JLAA 2G0IA 3BREA 5LRRA 4PSWA 4I7FB 2V5HG 4DG1A 4OJHA 5KFEA 1LWCA 3GO5A 4CT8A 4I6AA 5AXLA 2A07F 2LA6A 3MM7A 5HDNA 1XGNA 3IBWA 4DV6F 2DIVA 4L5IA 5BQTA 2KT0A 3CO6C 1X4EA 5EHHA 1KKHA 3ILLA 1O51A 1MMLA 4NLYA 3R0JA 4MFBA 4ZPTR 1OY8A 3L3CA 2HQ5A 2GXGA 3CGIA 5KOXA 3JTGA 4HQEA 4J9UE 2MGZA 1PC4A 4BH9A 1IR0A 3GJSB 2N8GA 2RN7A 2IYIA 3ZZZA 1HNZJ 3S2HJ 2O3FA 4QYRA 2R8IA 4KJZA 3LO3A 3UDEA 3CP8A 2OPQA 4Y52J 1GFWB 3D7SB 4OZJA 2OCCH 4QTRA 4X62J 2R5ZB 2Q6BA 2DFIA 2V9WA 4P1WA 4Q43A 4RNHA 2K3PA 2WVDA 3ADAC 3TAMA 2DXIA 3VAKA 3HHLC 3ET6A 4B3OB 1TNTA 1JGGA 1HA1A 3Q8PB 2ZBQA 2I5UA 4HTIA 1X19A 4YR3A 2AF6A 3OOPA 1JLEA 1TKZA 3CC7S 3TDZC 1R4NB 3FC9A 5FLXY 1WC1A 1AA1B 3KXDA 1DP7P 3OVAA 5LGTA 4ZVQB 1S6QA 1RTJA 2R42A 3LANA 1QVGR 4DL6A 2NOJB 5I4MA 4LG0B 2LYCA 2IP2A 4W97A 5A2QY 4A3CJ 4DWIA 1M5PC 2XI3A 1PAUB 3M05A 1T9TA 3S3MA 3EX7B 3BYPA 1FJLA 5KFGA 2VG7B 3ZXSA 3MEGA 1NK0A 2J6TA 2YUSA 5B3SH 3HDDA 1IBLF 2VQLA 3L2UA 3CE8A 4ID8A 3W8GA 3R1HA 2CPHA 2B3TB 2W2MP 3W66A 4PJLA 3VAMA 4K8RA 2E60A 4DOZA 1ULRA 3H25A 3CDWA 4TYAA 3TR5A 1N8RT 1NKEA 3HYIA 2JSPA 1AW0A 3MCMA 4TQRA 2J0QD 2UUCJ 3B78A 2DCEA 4RU2A 4JI1J 5D8HB 3CJRA 1MJBA 2MD0A 3LA2A 1AA7A 3F73A 5FRMA 3KLHB 4ENMA 1QVTA 1T05A 3WGHA 5HJXA 5LD2C 3T8RA 1Q8KA 2VG6A 4CH7A 2EQRA 3LGNA 2JTVA 3K2ZA 3HZEA 5ETSA 2M88A 2JA8J 5HMYA 4IR1A 1W7PA 4USWA 1R89A 2Z9OA 1P8GA 2XGEA 5J8FA 2R5YA 2EG2A 4EGZA 4BWMA 1RAFB 1JHHA 3HSDA 2KIQA 1OYWA 4LB5A 1VQ8S 3DXBA 5C25A 1XEZA 1RADB 2JVGA 4LF8F 5EX0A 2G1HA 3H59A 3GTKJ 3CCVS 4LF9F 2WVFA 4I2PB 4B17A 3PFEA 2VJUA 2V67A 3F56A 5ICCA 5LLQA 1BJZA 1HQUA 4WXDA 1Y56A 3ILJA 3TANA 1JT0A 1TLHB 1OYDA 4B9MA 4FS1A 2XVCA 4IRKA 1H9TA 3QT7A 2QT7A 2CJBA 2ZH6A 1FDNA 2OHDA 3BG7A 3UDVA 3DDKA 3M2VA 4P10A 3TX8A 4RB1A 1HHTP 1ETWA 3E01A 3A8JA 4HBLA 3AJ1A 1N78A 3MHYA 3BR5A 1AUSL 3QOEA 3JTPA 1FXRA 5J40A 3N6NA 3SQGA 1T9WA 3U21A 4Q47A 3KUEA 3D68A 1T6SA 2LKXA 3MAAB 4N9IA 4RGRA 1FJCA 4IG0B 2MZQA 1H0HB 4DQPA 2CPFA 4A8QA 3IFEA 5ETLA 5ETRA 1ZTWA 4IHTA 1H6KX 3HSEA 4M9ZA 3CDBA 2EFOA 3AKZA 1VQOS 1A6IA 1VQ9I 4HACB 2HGNA 1U9NA 3L1PA 4CO4A 4LSLA 2VDIA 1F43A 4FYXB 3T1HJ 1JXLA 1ITPA 1RUNA 3PKYA 3G6ES 4XOPA 2DXDA 3E51A 1XS9A 2F2EA 2JL9A 2MMYA 3QU6A 4DYQA 1G7CB 4DV2F 3K70D 3G96A 3SDEA 4C48A 4JK1X 1WJBA 4LFUA 4DR5F 4X4PA 5LMNJ 3U1LA 3D2WA 2XNRA 3GFZA 4DX5A 2QLWA 2E5NA 2R2RA 3MM8A 4ZIWA 2XMAA 3DKWA 3HFKA 4BXXJ 2P0WA 2ADBA 5GAHJ 2G0EA 3D6FB 3ESWB 4KH0B 2AO9A 2P2CB 4TQSA 4BS2A 1VRTA 2MHEA 3GYGA 3D1NI 4QOTA 3CCRS 2VQEJ 3WDOA 2I5JB 1S72I 2KHMA 4A3DJ 2HQFA 2HHTA 3AY0A 1ZK8A 3A3NB 4ZJQA 3R97A 3W5ZA 2FTRA 3REOA 2CW0F 3KYDB 2GLOA 1TAQA 1SV5B 2Y0SA 1KC8T 4RGXA 5LM7E 1LVKA 5HS8A 4M71A 5D8LB 5IP7J 2XMUA 3M9AA 1TMJA 4C98A 1FBQA 1GVDA 2F6CA 3B6CA 1FKPB 4DBQA 3FBEA 3GSDA 3ZR8X 3LSGA 3MUVP 4WFNQ 2Y1RI 1RABB 3PACA 3BGLA 2DNGA 4X4TA 5F3TA 4CCLA 2GMLA 1FOKA 2YX7A 3OR1B 3GIRA 1QHGA 3FDYA 4M6XA 1FF2A 5H6RA 2FJDB 1Z77A 1C2PA 2RSQA 5ICGA 1CF7A 2B5JA 4LVOP 2R3SA 3RQ4A 2YNHA 2VLAA 1MBEA 1Y39A 2HQAA 4OJ3A 3G8TA 4ZOSA 5E0OA 1VRUB 4K4SA 5EWGA 1RTDB 3JTOA 3QSYB 4ETZA 1RHJB 4DNCA 2ZH8A 2AJ4A 4WU3A 2CQ2A 2M34A 3T5XA 1VQMS 2ALZA 3Q8YA 2HFVA 4I0AA 2QV6A 1MJAA 4OYIA 5JR3A 2YQ1A 2OBPA 1MNDA 5FKLA 2K85A 2VG5A 4JI3F 3RBEA 2JK3A 2LP4A 4I2QB 2XYPB 1J75A 4JBCA 4HYKA 4GC7A 4ZDLA 1KWMA 3KETA 1DU6A 4N5SA 3E1SA 5J1UA 4G9YA 1S48A 5LEKA 1V3SA 2VBWA 2B9WA 4B3TJ 3VHQA 3ELKA 4XORA 2VODA 3BQ1A 2QSFA 3CUQA 3QQCD 4DQ2A 1YO5C 4M72A 2MQOA 3GCMA 4OI6A 1FOXA 4XIUA 5HQMA 4YB5A 2WVCA 2YNGB 5GAGU 4HNVA 2KHDA 2CFOA 4A3LJ 3QJJA 2YKQA 4DR4F 1I27A 5FLVA 3KJQB 5KG7A 3V6KA 3V7CA 5L8RC 3KJNB 5HBMB 1KQSR 3KP7A 4DFKA 1D1BA 1W36C 3SXLA 3M6VA 2RNGA 1ZGWA 1W1WE 2M87A 2WRMA 1ZG1A 1IRGA 2FLNA 2R8GA 4CH0S 4IRGA 4DV5J 4Q5VA 2GO9A 2H4YB 4EWTA 2KZVA 2RAQA 1YJWI 2BW2A 2UVVA 4ZYHA 2M3AA 5H1SV 2QSWA 3I4NJ 2Z99A 4IOBA 5KT3A 1H2TZ 2CUZA 3J7YI 2R7RA 2VQGA 4E6KG 4O0IA 3ABKH 2XHCA 4DX8H 3K57A 3QGGA 4FZVA 3HSJA 3RB0A 4X4RA 1YW7A 1GMWA 4FASD 2HPUA 4J7CA 4AXJA 3I53A 5L9NA 1MU2B 4A8SA 1P6RA 2KRRA 1FK9B 1SC7A 2BJDA 2V2QA 5I3QA 1VJQA 2L9VA 2DW4A 1M0SA 3RAQA 4DZ6A 4FYDA 1FJEB 2NVUB 3Q89A 3GX4X 3SEOA 5CAAA 2K86A 4A3KJ 4KAIA 4CO0A 1WHYA 4UUTA 2EZHA 5HROA 3IRXB 3LFUA 2VZ9A 2ME0A 3ISNC 2UVRA 4ID5B 4KC5A 5IT3A 4JX4A 4A8XA 3HKZD 3E2EA 1YK9A 3D4JA 4RUAA 1VHFA 1T2KA 2BV6A 2DO7A 1R0CB 4MFEA 1UVMA 2ACYA 3PDNA 2XSJA 1A0OB 1FTTA 3DGPB 3RB4A 2VKRA 3TZZA 4QW9A 1T03A 2IAJA 4L3NA 4FE4A 2EFPA 2CQ4A 1U9OA 1MMDA 2ZBRA 4A3BJ 4U67Q 4RLEA 5LOQA 2Z58B 3V8LA 3M8RA 5HS7A 4ZLPA 1L3UA 7FD1A 3CWJA 3P5JA 5AXNA 2CQHA 3RTRA 4MGRA 4Q2LA 3HHNB 3N97A 4AL7A 3BR2A 4IF4A 3KLFB 1HD1A 2MG4A 3EUHC 1FEXA 1K4TA 1TV6A 1HDPA 5FFZA 3ZTQA 4N76A 1LW2B 1KS2A 4J9NA 3OL4A 4YHHJ 2A0FB 1L3VA 4R0EA 5IY5H 2XWYA 3NGTA 2EA2A 3H5NA 5KHDA 4BXFA 3J81Y 1ETKA 2FU4A 2MLZA 5LHHA 1WC3A 2L9RA 5HJYA 4B08A 3J7AN 1HQEA 3QMQA 2GOXB 2IEKA 1WGXA 3HZGA 2OTJS 1OCOH 2MZJA 3CDUA 3P8BB 2NSBA 2PO4A 2HNZA 4PWDB 4BBYA 1D8YA 4P6QA 4PZJA 4DJAA 2L9DA 1A31A 4P71A 1FVSA 3FSIA 4HAMA 5D4OA 2OJED 5DD4A 3ZQQA 4D3GA 2Z0GA 1IN8A 1VQKI 4NA1A 2KRHA 2XI2A 5D15A 2M2BA 1PBUA 4HEA2 3JYTB 3ZMDA 3BTIA 1TELA 2J7WA 3GP9A 1V55H 1DARA 3EXYA 1S0MA 3UD5A 3SQNA 2W7NA 2MJUA 3LSHA 2ACMA 1WJCA 2W1OA 2ATLA 3KOAA 1MBHA 5AIQA 4B3MJ 4CLUA 2VHGA 3CO7C 4KICA 3RTVA 4L75A 1WORA 2EC0A 3K4NA 4NLUA 2DNPA 2FPHX 3CDEA 2H1KA 2QA1A 2R2SA 4YFNF 2YWEA 2A10A 3ENWA 4F91B 3DCFA 1BLUA 3KYLA 5E1XA 4DMZA 2GHWA 2E66A 2V4RA 1FKOA 2OAZA 2EH3A 5FJ4A 3HUGA 4LFBF 3OFFA 3ENQA 4LFAF 2MYFA 4IPAA 2VBXA 5IOYA 2D74B 3EVWA 3R4KA 4IQ4A 2FZKB 3WTYC 3KK1B 4GO5X 2KG1A 2K1RB 3MD2A 4DV7F 4CSWA 3D5RC 1F1BB 2STWA 1VC6A 3EQLF 1IN5A 2HGMA 1Q82T 5E8IA 2BEOA 2P4WA 1M5KC 2QSHX 4DV4F 2OIHA 3QZ8A 2DNKA 2CRGA 5HNFA 2J9CA 4NLVA 1BW5A 4HF2A 3RB6A 5KNLA 4ZIVA 2JFDA 1CG2A 3TDUC 2BACA 2W25A 3KHLA 1I3OB 2XSFA 4Y3CA 2R5ZA 3IBCB 1JUPA 3QGPA 1KVKA 2MZTA 2RDDA 4OAZA 4B3OA 3ETOA 1M1HA 3H5UA 2OTLI 2UXCJ 2Z8QA 2A05A 1FKAF 3LF0A 2JNJA 3D54A 2O61A 2MSTA 4O23A 1Y8QB 4NC6A 5I3UB 5LSLA 4HHHA 4ZVOB 3HL2A 3NCPA 1FYKA 2VDHA 1KYWA 5J2PB 2ZBCA 3V7RA 2KL8A 1YYVA 3G87A 3NCRA 3HVAA 4LG0A 4NA2A 4UQGA 4HA8A 4E98A 4ZPAA 3W3SA 4ZC3A 3L9FA 2VG7A 3FNNA 3X3UA 3JAMK 3CQZJ 3ULHA 1TW2A 4BC7A 2LG4A 5FLXZ 4NB5A 2VXZA 3DLEB 2BQRA 2V26A 4FBUA 1ZPVA 2FRHA 1SC1B 4RB0A 3JQKA 5F0CA 4ZN1A 3PW7A 5KFCA 1EIYB 5CPRB 1J5YA 2CPIA 3GR1A 2BDPA 3VV2B 3ZP5A 3FKBA 3A12A 5A2QZ 1FDBA 3UPFA 1FDDA 1IJEB 2F40A 4C8KA 4RS8A 5IT9K 4J9QA 1HW9A 5AE3A 2IBOA 1R0AB 3NNCA 2CQKA 3KJVB 5EDWA 1U26A 2X6YA 1M1KT 3F9KA 1NDPA 2H27A 1ZREA 3KLHA 3AL0B 3VAFA 1URRA 1PVEA 1AYEA 1NCLA 1RPWA 1LB2A 5B09A 4ENNA 1IN6A 5LJ3Y 2XHWA 4YS2A 1IQTA 2J7KA 3PIPF 2H1YA 2OO4A 4NZ7A 4V2FA 3DKDA 3C2BA 1YS6A 4UVCA 2TDXA 3DFGA 4ANEA 2GVDB 5DDQC 2RH3A 2DR5A 3OD2A 3GFIA 2D45A 4LR7A 2Q8KA 1P6TA 4E7JA 3PO3J 3S93A 3E5QA 4C2UA 1NHKL 1S6PB 4I2PA 1QAYA 3MFHA 2XC7A 3GG1A 2XAFA 2GZOA 2NPFA 1R23A 1AHDP 4USMA 4URQU 1JWWA 2DVIA 3ZCOA 2W2OP 1F9NA 2DR8A 3MEXA 1FP1D 1XMQF 1X0FA 2EBGA 1F5CA 2NR0A 3MPDA 2PMUA 1KSPA 2VPYB 3HT3A 2J5PA 4OFZA 5K8NA 4RU9A 2RHQB 3CF5Q 3MAAA 3HHKA 1OKRA 4ED0A 1EF4A 3CO0P 4IG0A 4YIIA 3TOBA 1YI2I 3OTOJ 2FOKA 3ZOBA 3JXOA 1X3ZB 1HXDA 2AX0A 3HEFA 2RNEA 4ECQA 3EM1A 3I54A 4HACA 5F41A 2DA2A 2RDPA 2DGVA 3GONA 2F8MA 3OY9A 1YFHA 2VPXB 3RPUD 5LHGA 1R31A 4XPEA 2LMDA 1JLBB 4Y4RA 4B3RJ 4PG5A 3GTJJ 2QGUA 4NNJA 3OYLA 5L3FA 3HRUA 4Q2MA 4II2A 4ICLB 4XONA 3R3TA 3ZQIA 2VOPA 4G12A 4CDIA 2BABA 3NGUA 4RW8B 3U1MA 4M3BA 2HZAA 3EGWB 3I59A 3POTB 4KY3A 3PJ9A 3K0LA 3KP6A 4U7CA 5MAOA 2BOPA 3GXOA 1SXLA 1GXQA 1MKMA 4GYGA 4OINF 1H98A 2OFHX 3W6VA 2C2EA 3P6YC 3AOCA 5J1NA 4XDCA 4XKBA 2EBIA 3T5HA 3B4DA 2I5JA 2DOAA 1H2VZ 4HPQA 3KP3A 4LF2A 4ZVEA 2QUFA 1HL6A 4M5MA 5AONA 2XF5A 3JSBA 5ILSA 1SV5A 4XRSG 2XHKA 2ZHBA 3J7ZI 3BG5A 4CLKA 2JRSA 5KFLA 5KG2A 1SJQA 3DEUA 2HWTA 3GFYA 4BBSJ 4FPIA 2BX6A 2MDAA 3DWLE 1Q1VA 1Q81T 1FKPA 4LITA 4PKDB 4ED5A 1OR7C 1U0SA 3NWGA 4XLEA 1B0VA 3Q8RB 1WF1A 4J9LA 1VBXA 4B48A 1DGWY 4BYYA 3OR1A 3HO1A 4LVNP 2E29A 3S6EA 1RAIB 3NEUA 3F72A 1B7YB 2X3DA 2V69A 1S9EA 2X1CA 4NCAA 3RR8A 4ZP6A 1X2MA 1D1AA 2EKYA 1UVNA 2EFQA 1VRUA 2BYVE 2D5VA 2C2RA 1RTDA 4B3AA 3BWGA 2J7UA 3ZZYA 2CJYB 3ERED 2HWHA 1N6QB 4K2XA 4LJZF 2R4FA 2BXYA 4PJJA 4DX7A 3D6HB 2JH3A 2GIZA 1B3TA 5DG7A 2KKOA 3BOQA 2R2UA 4I2QA 3CCWA 2E5GA 2AIRB 1U45A 5HVFA 1EZZB 1ZBTA 4RAGA 2ZKZA 3VYUB 3GQCA 3I5UA 4UOHA 4DR3F 1TVRB 4EMDA 5KFJA 1X4BA 2XY5A 1VQ7S 3LOUA 2WHOA 3CIZA 2FEZA 4HRIA 2LFBA 3HKZA 2V4JB 2DA7A 2VQFJ 5A8WA 2R7WA 1VQPS 8ATCB 3AFHA 1JJ8C 3BSOA 4B3XA 1XDUA 1X3WB 2QA2A 2E1AA 4P9UA 2YNGA 3TZWA 1KU9A 2ZBPA 4HX7A 3Q3SA 3PG9A 3VWSA 4JV1A 1X60A 2K4BA 2EI5A 2DMPA 3FK7A 2CPYA 2NAZA 5CVRA 1WG5A 5I3PA 1UVJA 5HBMA 1DTTB 3PO4A 1HQ2A 2HS5A 1K7AA 4TV7A 5D5WB 2BR0A 3I5AA 1VQLI 1QDUB 4HOBA 3HX9A 4K5RA 1E0EA 2DT5A 5HVHA 3BPXA 3V4GA 1T9YA 2Q1LA 1U1PA 1S7IA 1FWPA 1EKRA 3COAC 3PUFA 3VF0B 3A13A 1U8WA 4XSZF 4XN0A 2K4JA 2DD8S 5CVUA 2CNKB 3BP8A 4ITSA 2XKPA 2M5YA 5DLGA 4HT5A 1S49A 3V2UC 2AU0A 1RYSA 1Z6RA 1X4DA 1LWXA 3QYFA 1HSTA 5E3RA 5LEJA 4WP8A 4O3SA 4K4ZA 2ZJQF 5GAHI 2L7MP 3MFIA 2DT9A 4CCHA 3HZJA 4BL0B 3LPYA 4G65A 2YH1A 1HWIA 4A5MA 4IO1A 3FK6A 2W7AA 4Q48A 2QE5A 2C2MB 1YIJS 2VC0A 4PK4A 1R58A 1R8HA 2IS6A 2HHQA 4U7DA 2E36A 4KPYA 1KEKA 5IOZA 4C4WA 4NLQA 4OYXA 3F8BA 2IA6A 4MFDA 3CJ8A 2R7QA 2WWYA 2QMUB 4LBPA 3H2UB 3IRXA 1CQMA 5RUBA 2DTZA 2B9EA 2VN2A 4AD6A 4ID5A 1YJVA 3R1LA 1N25A 1VQ6S 2KXNB 1WH7A 2V6EA 1X2NA 3GTOJ 3O5TB 4KHRA 2DLLA 5DRKA 2QSFX 1GTEA 3AJ2A 3FMRA 3MZ8A 3QJLA 3FMBA 2WOMB 4I02A 2E1OA 2HSEB 2DA1A 3SHFA 4X66J 3L7PA 2QQBA 3DGPA 1TBXA 2WAFA 3OWTA 4TY9A 4K4UA 3VCDA 2K06A 3OIOA 4AM3A 4O4GB 1NPPA 1CJKA 2B7EA 3NQOA 3CMYA 2UUCF 1HI0P 2F8EX 3PSFA 3FQLA 1KQFB 3ZO7A 2F48A 4JI1F 2ZXHA 2CQDA 5CCMA 5GMEA 4QWAA 3P96A 1UWBB 4NRTA 2UUTA 5DQIA 3QJPA 3KLFA 2DK8A 1CJVB 3JAMU 4ZYGA 4LF4F 1LW2A 4FXVA 1NKCA 3S1TA 1FX7A 1JX4A 2F65A 1Y0UA 1HWUA 2W2QP 4N41A 2NOGA 1IM6A 2D3ZA 2C42A 1SIWB 1B64A 5J47A 2FJXA 3ITHB 2BEFA 2WBMA 1RLDA 3BZCA 2QLFB 1U1NA 2ZFWA 1P4WA 1I3QJ 4B4CA 5HLIA 3CD0A 3MD3A 4PWDA 1MROA 5E17F 2HQNA 4WIIA 2MGQA 3RRKA 1N5VA 1T3OA 2CZ4A 4ES3A 2DGQA 4I0BA 3DU5A 4F7ZA 1YVFA 3NRVA 3KUHA 2C3MA 3JYTA 3J81Z 4Y17A 1T94A 1IBMJ 4HL9A 4I2OA 2W82A 4RGUA 2CNLB 2VKDA 3H40A 3SXYA 4MLOA 4RW9B 3BGOP 4G3IA 3HB9A 2IJRA 2Y48A 3K4CA 3RB3A 4IO9F 2HVDA 3CC7I 3WIVA 4XSXF 3OR2B 1BI3A 2LLZA 3CCUS 1EAYC 2KU7A 4J9RA 5B66C 2W4CA 2JT1A 2RF2B 3AD8C 3T1HF 4DL2A 4J9SA 2I8DA 2R7XA 2GHVC 1ZM9A 2HZVA 2BXJA 2F4FA 4C8YA 4LG3A 4CH1A 1D3YA 5DM6F 3NOGA 4DUTA 2Y8WA 3MTKA 2XGQA 3IAS2 1RUOA 1TL3B 1BC6A 4O3OA 3KK1A 3RR7A 2K1RA 2ASDA 1L3TA 1RTHB 5LMNF 4IKAA 4NLOA 5HSPA 2GHPA 1IO2A 2H94A 3LSJA 2EK6A 2Y0SN 2KN4A 4EGLA 3FRYA 3GPAA 4DR6F 3O3LA 4ZCLA 4BY7J 1XMBA 5FD6A 5DS7A 3GIKA 4ETSA 4ZVRB 2H4WB 3OVSA 2Y1IA 2VQEF 2HHPA 2LXUA 4DN9A 3W2WB 4AUXA 3EZUA 4BQQA 2MA3A 1PYSB 2GC8A 3CP2A 2BV3A 2O6GE 3M8SA 1YJNI 2M8HA 1TT5B 1HYSB 4CO1A 4JYAJ 3FMQA 4U0WA 1CBKA 1BQNB 3FEXB 4TYBA 2H48B 3JQMA 1ZA2B 1A35A 2ISZA 4IOCQ 1F3FA 2MSYA 2ZJPF 2C3UA 1FT9A 3OYEA 3R7SB 2FF4A 3MKZA 2HWIA 2YS9A 4WFBQ 3MR6A 4OWRB 2HYIB 5E3CA 2M45A 5I3UA 9ANTA 1Y9OA 3DFEA 2GAHC 4G6DA 1O3QA 2DGSA 1PBAA 5DZ7A 4PDKA 1SL1A 3MMYB 2H8RA 2PEXA 2IBKA 5K5OA 1OSDA 1SAUA 3CCJS 1ZGJA 2O7OA 1NSAA 1WACA 2VFTA 1D0ZA 3SSRA 2PMZD 2HZDA 3MKYB 2XGPA 2VV5A 2RVJA 4ESJA 3G9CA 3DLEA 3PFYA 2ZH5A 2DOEA 5FKMA 2DDBA 4YOEA 4NCGB 4N8NA 4OHVA 3OSFA 1X31C 1R6YA 1KVJA 4YELA 4NEYA 2PA8D 3FKJA 1U0HB 5KCMA 2JLFA 4J00A 1NSQA 1OMIA 2OSRA 4J9OA 5HN0A 4NASA 4B3TF 4YMEA 3MFKA 5G0RB 1R0AA 3BBFA 3KJVA 3NAIA 3DDNA 1ZM3A 2GS8A 1SH2A 4Q8FA 3GTQJ 2EPFA 2ZDPA 4LF6J 1OJ4A 2P9GA 1RWOB 2RD5C 4A48A 4K4VA 3G2XA 5AT1B 5TISC 3G8QA 3L7UA 1Q5YA 1B59A 4MIBA 3I0RB 2CH0A 1S10A 1AUDA 3C7JA 4XN3A 3IH4A 4MKAA 4WTYA 3ZTRA 1LWEA 3A8EA 1U5TB 2V34A 2NRAC 3AHPA 3K1NA 1U8SA 4OZ5A 1J9IA 2X4HA 3X2QH 2CQCA 4QR1A 3MQ0A 4XLCA 3H42A 3K5PA 4DV5F 4JI2J 2GVDA 3PQJA 4O3RA 2HVSA 3JSMB 4MT1A 3DOLB 3CDIA 3ZGKA 1K9MT 2VFSA 3D0SA 4MTDA 3AOAA 4G94A 4OI3A 1S6PA 5B0BA 2HFZA 2G7HA 3A0BC 3KLEB 4OMFG 4A3JJ 4UVAA 1S59A 3FSYA 3U9GA 1JLQB 1XN7A 3CCRI 2DJWA 3DLHA 4HI2A 1VDHA 2AHOB 1X8DA 2XB0X 5KK1A 5EDNA 3E6CC 2DBBA 1AOYA 3HGGA 3M9NB 3DXJF 2XCPA 3I58A 2B9XA 5KFVA 3WHIA 4S04A 3FBIB 1TQLA 3M8QB 4HI1A 2ZOGA 1FMVA 4JI4J 3OYCA 1O6XA 2QRRA 3OL3A 4QYZJ 2EB7A 1JIHA 1N88A 4WKYA 3FQKA 2V1XA 3ZQLA 5M3MJ 4BEHB 1QAIA 3CUQC 2XULA 4DN0A 3GE9A 2E71A 1PUEE 2HWVA 3BQZA 3D6TB 1BI2A 5DETA 1W0TA 4LLLA 3I32A 3S3OA 3GMGA 1I5OB 5D4PA 3BQ0A 4RNOA 1SKUB 5DV5A 1JLBA 2VFRA 3B8HA 2JN6A 1D0XA 2YBVA 1F6TA 2V2ZA 2R7UA 1JNZB 1N5YB 4ICLA 2JA6J 2RIJA 3CPWR 2BJ3A 4RW8A 2KI2A 5L1JA 1EH7A 4XLPF 3POTA 1KN6A 4N47A 3TJ8A 4PFPA 1SC3B 1USTA 5IS2A 1BN5A 4FYYB 2QKMB 1BI1A 4EJWA 2HVZA 1SCJB 3WX4A 3FJ2A 1U2FA 2A18A 4NE9C 1JJ6C 2E5HA 1KQ0A 1PDNC 4F4WA 3MM9B 4DS5A 2DJNA 4PEOA 4DU7A 4EBEA 4OHYA 3HD2A 4HNUA 3CTAA 4YHHF 1FNXH 2V8HA 3THVA 5HLFB 3FCHA 2XPWA 1R6RA 1XTAA 4KH1B 1B99A 3CLQA 2DCLA 1ZM2A 5H9FJ 1Q1HA 4MK9A 3ISPA 2HPMA 2YKPA 2XPUA 1S4EA 1S6UA 2RNJA 1O8BA 2NVQJ 2CUEA 5HVQC 3BQYA 2CUFA 1WELA 4FNIA 4H4OB 4AU7A 3PIOF 1AFIA 3S15J 4MIAA 2ZHAA 1S0VA 2HNYB 2XLIA 4OZ0A 4LQ3A 3T41A 2ZJRF 5JXSA 4N9HA 3U1DA 1ZRCA 4B3SJ 4F36A 2ZOFA 4CIOA 4QU7A 2YY3A 1NTCA 2A3SA 2XSJC 4XRMA 2QA4G 3HP6A 2CQ3A 1N6QA 2KYZA 2OEKA 2ZVSA 2Q79A 2CQNA 2QFIA 2X0LA 1FSEA 4GMKA 1NZAA 1W5SA 1S1UB 5D77A 1MMNA 5KFBA 5C7PA 3SIPB 2PFDA 4IHVA 1XC5A 2ZBIA 1TVRA 1ZS6A 1NH8A 4I0WA 1T08B 1NSPA 1YTYA 1K79A 3QNWB 1HNWJ 2V4JA 3G6XA 3ZTOA 1VQNI 1RR7A 1UELB 1JKHB 3FXJA 2R8JA 2DRAA 3OYDA 3TBIA 4ZK7M 4R8HA 1H74A 1S1XB 2KKHA 3TVKA 1XGOA 3OBIA 5B5EC 4RNFA 4ABZA 1DQUA 3JSRA 1GT8A 2WB1D 1DTTA 2R7FA 2B9YA 5AE1A 2VJVA 3MAJA 4FXWA 2E7VA 5M5XJ 3Q8UA 3A3OB 5KFAA 1ETXA 5CYJA 1VJWA 3M3YJ 3IRQA 4OZ2A 1LJ9A 4PG4A 5IC6B 2CPJA 3MZHA 3U1KA 3BKTA 2C28A 4LF9J 1IBCB 3GVAA 2FC8A 3ZQGA 3D5LA 1G6BA 2OAUA 3L9ZA 1F4KA 1BR4A 1SD5A 1RISA 7AT1B 3AD7C 2J5OA 1HKAA 1UKUA 3IWLA 2CZVC 3S7RA 1JTXA 2XG8A 2D1VA 4YB1P 1NK8A 3S14J 4X4SA 3EZ5A 2RUSA 2LECA 3BROA 3MMCB 3V81B 2UXCF 3IUOA 3K5MA 2V63A 2E34A 3LP2B 3OXFA 4FCYA 4XM3A 3VDXA 4LFCJ 2VPLA 3PHTA 3N5BA 3J7Z5 4RDUA 3I0TA 3A03A 3R27A 4L9JA 4QJVA 1NHAA 2RU3A 4AIDA 1S9HA 1B8IB 2LSOA 4Q8EA 2Y1JA 2YNIB 1Q79A 2B0GA 3WTZA 3OIQA 4PPDA 2LP0A 2GW8A 2M0CA 1HFEL 1UFKA 2P5VA 4XDDA 3BYRA 2KZMA 1U09A 2OTJI 3HHDA 4Z37A 4KA4A 3PL8A 2MKIA 2HR3A 2OU2A 2RAEA 1WG4A 1TTHB 1U4BA 3FBNB 3W9HA 1Y5IB 2X85A 2HAFA 4M3EA 1RXOB 3EE3A 2WTFA 4OAYA 4KN7X 3PNYA 1HLWA 5L38A 1HMVB 5IM0B 2PEBA 4DV2J 2CNOB 2HAIA 1JHFA 2RJZA 2WOMA 4R25A 2K7KA 1FJGJ 4OI0A 4JX5A 3BZ6A 2MY8A 2FGOA 1LKXA 1MWQA 3L00A 4O4GA 3HT0A 2HHXA 4LUBA 4NYOA 3MMJA 3HVRA 3HJFA 4GKJJ 4ZP8A 3J7AY 1OO0B 1Z7LA 2ZKUA 2Z2LA 4IHXA 4L9TA 4IG3B 1JTYA 6FDRA 2MQPA 1UWBA 1YBAA 2CUYA 4KB7A 3W61A 5GAEJ 2NSCA 1CJVA 2LCWA 2OUGA 4RAFA 1Z67A 4CDGA 2B4PA 3M8FA 1Q8LA 1UEUA 2Q6CA 2J6UA 4DQSA 1KZHA 4ZJZA 2NXJA 2R8HA 4DV0F 3HIFA 5E41A 5KG1A 3IWZA 3GEZA 1U6BA 1U6GA 1ZLJA 3RBZA 4YFKF 3FM3A 1XG1A 2RU9A 4P72A 3ITHA 4C8MA 3VR1A 1T8EA 3IN5A 3ABTA 3NBPB 4F0MA 3CD7A 4MAKA 2NS0A 3W8PA 2L7KA 3HHLB 3HG9A 1QUPA 2QA4S 2L9SA 1YLXA 3H20A 1HHQA 3R2DJ 2Y69H 3QAUA 5DS9A 1WOOA 3W63A 4CLTA 3T8TA 3TW7A 2XY7A 4B9TA 2VJ5A 2XAGA 3UQSA 1I6HJ 1UEKA 1N33F 2ZJ2A 5DDGA 5HOOA 1FESA 1T11A 2KFZA 3PXGa 1R9TJ 2X6OA 3ZMUA 4QIGA 3TQNA 4J5OA 3IAM2 4JOUA 2M8DB 3T5KA 2X51A 4FTHA 2JZYA 4YY3J 1EP4B 1SBRA 4L18B 4AYBA 1MGTA 3HFZB 2H1LA 2EFWA 3ZMVA 1RTIB 2JWTA 3OTOF 1F9HA 5CYVA 3TQEA 4PYAA 4C3HJ 4RWWA 3Q9VA 3K4BA 2VUMJ 2RQCA 3ASNH 3OR2A 4JI3J 3N05A 1E6YB 1RP5A 1SKWA 2VC1A 1OMSA 1O0PA 2RF2A 1IKYB 5F0UA 2X1BA 4K59A 1EH6A 2PMZA 3K70C 3ZMTA 1GH8A 4V19K 4B3RF 1JLCB 1ZZFA 4CXFA 4P7VA 4DR1J 1VFJ