1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
b'KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN HP0162
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
4F3QA 1K6YA 1KONA 3F9KA 1LFPA 1MW7A 1WJBA 3HPHA 1WJFA 3HPGA 1E0EA 1WJAA 1WJDA 1WJEA 1WJCA
chains in the Genus database with same CATH superfamily
4ED5A 4DIQA 5ETRA 3W8PA 1RU1A 3QPLA 3OTOF 3V4IA 5E41A 1X58A 3BR3A 3J80K 2VOOA 3BS9A 3BH7B 4G9YA 1K9MT 3VHQA 1YJWS 4F7ZA 5ILUA 1EP4A 3M1VB 4MKAA 3R0JA 1YQAA 1MLAA 4CTAB 4IHXA 4Q44A 5E33A 1ZAXA 3IV5A 1VIOA 4A3KJ 4C8ZA 3K4LA 3ITHA 4YUDA 1F9HA 2V9VA 5CVIA 4LR9A 3B54A 5HSPA 4CCNA 2ILZA 5CZXA 2FOWA 1N0VC 2JWNA 5BYRA 2XO6A 4BUPA 5EG0B 4CO2A 3NGTA 3ZMDA 4LF7J 3FCHA 1Y0HA 5DJBA 3DI6A 3VALA 4GYIA 3WGIA 4PPZA 3KLFA 1FZPB 5JVTA 4CO4A 3EX7B 3J81U 3QSIA 1SH2A 2PA8D 4ECVA 2CQBA 5JMNA 1WSRA 4MIAA 4B47A 4R0EA 2LY9A 2GIFA 1N8RT 2IBDA 3JRHA 2OAUA 3HOWJ 3WTVC 1FWKA 2PX9A 4PXBA 3S1MJ 1IBMF 4YDXA 1H7XA 1OSCA 1IXKA 4QZVB 3QZ8A 2CQ4A 4LITA 4RNFA 4PUOA 4IJAA 2J5PA 4G3IA 2W9CB 4EO6A 1HWJA 1N77A 4XM3A 2LKPA 3FBEA 1MSFC 1UB9A 3PY8A 4UT4A 4BHBA 2OEMA 3W2VA 1QUVA 1VQYA 4ETXA 4IOCQ 4KQZA 1RNLA 3AOCA 5BR8J 2HGLA 3CJ0A 3O8GA 2YR2A 3WU2C 2AU0A 4C8KA 1KQKA 1DLOB 1RTJA 4G6QA 1KYZA 1NDPA 4TY8A 2KB2A 3M2UA 5FD1A 1R27B 2QLJB 1OCOH 1SIWB 1U8RA 4DPXA 2B6AA 3KUEA 1B59A 3AD7C 1D8JA 1U0HB 2JA8J 1AOYA 3GCWP 2ZH6A 1G4CA 2LNBA 3IRWP 2ZJQF 1VQMI 1PJ5A 2RH3A 5A6PA 3MEEA 2BEFA 1T0FC 4MGRA 1C0WA 1WFXA 1S59A 2ZBKA 4CLYA 4OI0A 4B3MF 2HVSA 2BANA 2J9DA 4WIIA 5IY5H 2DA4A 5TRDA 3V42A 4Y34A 4CP5A 1VF9A 2HGNA 1HBUA 1IN8A 4DN9A 1FFWB 3CJQB 3KE2A 1G6NA 4AIJA 1UW4A 2HYJA 1WEYA 1FJCA 3TP0A 1TKDA 3GX4X 4DV0J 4ERDA 4XKCA 1N32F 1HSJA 1ZM4A 4BS9A 1QJHA 1VQNS 4DQPA 4OL8A 2LYCA 1NJXA 1RAOA 3K2ZA 1CF7A 2OPRB 3OIPA 3E01B 3QT7A 4MIMA 3F23A 1KQ8A 1O8BA 2XO7A 4LF4F 1JXEA 3MKWB 4G1QA 4HX4A 4XO0A 3HUGA 3RYRA 3JTHA 3WE2A 4XK8C 3PQJA 2RAEA 3H1CA 2KVQE 4IHYA 2VF3A 4KH0B 2WVEA 1FKOA 2K7KA 4GCVA 4LBPA 1SUQB 2QBYA 4K2JA 2FHKA 2B7BB 2MKKA 2MY7A 1ZPVA 4JI1J 5IYBJ 2QC3A 1XMQF 1XD7A 2HQRA 5LSOA 1ZREA 3F8CA 2E2IJ 3PW0A 2GQQA 5IM0B 2VOPA 2W4CA 4LMZA 4DQQA 3L2UA 1YG0A 4B3SJ 4CO0A 3M9OB 4EJWA 4UOGA 2R8GA 1NHVA 2BBYA 1ETWA 1T7PA 1HYSB 5HODA 2DHAA 5DDGA 5KFPA 3GG1A 3OHBA 1HNVA 2A0FB 4RS8A 4IQXA 1X4AA 1XQIA 1STZA 4JBAA 4XLEA 4M5KA 4OI3A 4ALZA 4RWWA 2MGQA 2X51A 4CM2A 3MTKA 2ZDPA 3SQOP 4WE1A 3Q86A 1LNQA 2DO4A 4NXNJ 2BQRA 4N8OA 4NNJA 2J9CA 1TMMA 2DNNA 3PJ9A 3GZNB 3GF2A 1K61A 2BVZA 3D5SC 3KK3A 2DNHA 3AH6A 4HDHA 4EEYA 2V5HG 3K9TA 3ZTOA 3D1HA 3VGTA 5IYDJ 2XAFA 1GXQA 3OYIA 3F73A 3P49B 1OYWA 2KRCA 1ZTWA 1RAFB 5DM6Q 3V8JA 1YQHA 1E6VB 4ZIWA 3S17J 1VQNI 5AE3A 3ETOA 1K7AA 1V55H 2QMWA 4M8LA 4RGSA 1IBCB 2OP5A 1DGRM 3DM2B 2R4GA 3R8YA 3I5CA 4ZPTR 2RDPA 2YNGA 3G1OA 1TL1B 4X65J 4CO5A 1R49A 3LA0A 2IHR1 3OL7A 3A3NB 1MJBA 4PWUA 2CJXB 3B4DA 1XNQJ 3HHLD 3OR2B 3DGPB 3DHXA 1HQCA 3H5YA 1X1DA 2X1DA 1K0TA 2CW8A 2JC1A 4XKVA 3U9GA 1DJ0A 4XRFA 2G1HA 3LAKA 4AQYF 1SAUA 5LXRA 1ETQA 4D7NA 1UELB 2ILYA 1QE1A 3OLAA 4RNHA 3TW7A 3TVKA 3OIQA 2BKNA 2WADA 3M8EA 1HQUA 3JXOA 4ICLB 4A12A 2QJ3A 1NB2A 3NY0A 5IPAA 2JVGA 3L7UA 3R1HA 1YYVA 2CJYB 1NZAA 2B43A 3EGZA 3V8LA 4ILMA 3CC4I 1PIEA 1OFCX 4B3OA 3GTGJ 1FNNA 1Y10A 1HLWA 3EUHC 3RR8A 2DNKA 1CBKA 2AYMA 5LGUA 4Y2IA 2XGPA 1OCZH 2Y48A 3LPEA 1J5YA 3DLLQ 2DRAA 2CJ9A 1RLCL 1R43A 4YELA 5K9FA 2UUWA 1R6RA 3MWBA 3T1YJ 2EEYA 3LW5C 5CH7B 4C0HA 2DOFA 2IDEA 3RAQA 2N7CA 2CQHA 1SVDA 2D74B 4TXSA 4RZRA 5EHHA 4HR2A 2QL7B 3WU0A 3LUYA 5C44J 1DY3A 2VKEA 5E8IA 2KIQA 1U78A 1MMNA 4DMZA 4A3IJ 5E3LA 4CXFA 2HLTA 2C2DA 3PRVA 3R6GB 5CCLA 3ERED 4B48A 3T5JA 2K3FA 1H9TA 5A6WA 4BEHA 3FXRA 4NLWA 2BY0A 4BYYA 1MMLA 5CYMB 5E2QA 2DH9A 2QWWA 3SIPB 3TX0A 1RDRA 2H5EA 4LFAF 2EZIA 4IFYA 4XKWA 3CGIA 4I68A 4ED0A 4B3TJ 2OCCH 1TWHJ 1S7AA 3Q83A 3UNYA 4PEOA 1RT6A 1WOSA 4KC5A 2FLLA 1NK9A 3PNIA 1A6QA 4QR2A 1UA0A 2DITA 2H1LA 2ZSHB 1VQKS 2GMJA 4KGZB 3K4BA 1I5ZA 2MABA 4Z2XA 1R31A 2RF2B 4ZVTB 4Y6IA 1N33J 2UZAA 2E5LJ 2MKSA 2F4OB 1BW6A 5A8WB 1XTAA 1R5HA 3ABLH 2V4JB 2XB0X 1YJ9I 3RRGA 3CJTA 1HHSA 3RB4A 4L18B 5EUHA 4DR6F 3UCUP 3A01A 4J00A 2FHOB 2XHCA 4HAMA 2HURA 2JFKA 3W5YA 1B4SA 3M8QA 1H2UX 1LKXA 2BOAA 4UVCA 4OWRB 1FRIA 2NSBA 4X66J 4NEZA 4I0WA 3BZQA 2CJJA 2DQRA 4ID5A 2STTA 3M8SA 4ZYGA 2FJ1A 1D9AA 2OTJI 4XN0A 2CNLB 4R25A 3TANA 3QP5A 3KXDA 1XPXA 1IXCA 2MQNA 4C0BA 3RGIA 3D5MA 2OJED 2PI5A 2W8KA 4MFBA 3MM8A 4YB6A 3SBMA 4A3MJ 2FMLA 2K86A 4E7IA 1BD6A 4N77A 2IM1A 5FDLB 4DX7A 2VN2A 3LL7A 4FHTA 2BJ7A 3GFYA 5ETPA 1U45A 1FHTA 1TC3C 1S72I 2CW0F 4LF8F 3RAXA 3ELHA 3DLHA 4CICA 2VQFF 2J0QD 1TAQA 2KRFA 2V8DA 3TKYA 5B1AH 1ZGAA 1KGSA 3SDEA 3RR7A 2W4PA 4N7TA 5L9XA 2RQKA 4HH0A 2X4HA 2HDCA 2A6TA 1IN0A 2E5IA 3KLIA 4F8RA 4OZJA 1U3EM 1CULB 1Q8BA 3KDOA 1FEHA 4AUKA 5CCMA 5CLSA 4PG8A 1M0SA 3WHIA 4USVA 4AVZA 2JUCA 3FBCA 1QZZA 3BQ2A 3BQZA 3BP8A 3W3SA 1ZAWA 3C2BA 3MPWA 3L1PA 1RB0A 3PFIA 3FSIA 3OFFA 2J0WA 2CWKA 3IM9A 2QSHX 2JL9A 2WAQD 1FD2A 1WSUA 1ELOA 3POTB 5J2NB 3MR7A 1TZ0A 4BDYA 4ZP9A 2CYYA 1SD5A 5D5WB 3EWGA 2YNIA 2FZKB 3MFHA 4W97A 1NH3A 2CMPA 3MM9A 4NC7A 3UR0A 2V79A 2I0XA 3TI0A 3RCOA 2E19A 5EZGA 2EFWA 4G94A 1NH7A 3D7SB 2QE5A 2IVFB 4WP8A 1NK4A 2J7KA 3MHYA 4RNMA 3W63A 5J2MB 5KFCA 4YR2A 2VE9A 5D6GA 3CW2C 3HT0A 4DI6A 4OI1A 2NNYA 1OYDA 2BKPA 1MWZA 4ZJQA 3RKYA 4UQTA 3HX9A 1T8EA 4K4XA 2OELA 4I99C 4P72A 3JRCA 2XWXA 2OGUA 5HLHA 1HNWJ 4LSLB 4I56A 3EXCX 3ZZRA 1QZEA 1H0HB 2ZXHA 4YMEA 4MH8A 3CCMS 5GADJ 1RKJA 4RL1A 2ELHA 3T5LA 6PAXA 3CJ4A 3BWGA 5HLTA 2MD0A 4IFVA 1BR1A 4RUBA 2VIXA 4RW9B 5F8LA 4W90B 3OL3A 1MNMC 2H5IB 4HRIA 2VJIA 5ICGA 5EYRA 2QA4S 1RT7B 1NH8A 1HMVA 4NZ7A 1X3ZB 1QLNA 4CI0B 3K89A 1FJGF 1VRUA 2UUAJ 4O3QA 2UUZA 4OIXA 3IRXB 4CO8A 4UW2A 2VBZA 2FQ4A 3C2HA 2F1FA 4WFXA 4IO9Q 2FB0A 4ZPCA 1AUDA 4ELVA 1T95A 3VOEA 3ECHA 4PKDB 2HNDB 3MPVA 2HTSA 3G6EI 1TFWA 3H5RA 2JQ7A 1TL3A 2NVTJ 1FXRA 2Y31A 1ICEB 3FRZA 2B7CB 3T5KA 3VB2A 3HFZB 4IG0A 1JX4A 2JJ7A 3R2CJ 3IHUA 3ZPLA 3VGVA 2D1CA 2KHMA 3BKTA 1LDKB 2KFZA 2R8KA 2W9CA 2LQ5A 5HMYA 4GC7A 5IT9Z 3PJWA 4JOMA 1KZHA 2CG4A 3ABTA 2E71A 3J7AN 2BJ8A 4HQMA 3FK4A 2UXNA 1R5GA 4I98B 3B02A 4OYZA 5E3MA 4F4XA 2L9DA 1X4DA 1LWFA 1HQEA 4LRFA 2KI2A 3QWLA 3RU0A 4RA2A 2DK8A 4YS2A 4IHTA 1DLOA 2HGCA 5KG3A 2R7SA 1T9XA 3IH3A 2OV7A 1LE8B 1QGPA 5DG8A 3FEXB 2O0YA 1AXQA 2YX7A 4O6JA 2EI5A 4RUHA 2QVOA 4O4RA 4P52A 1SV5A 2XROA 1VRTB 2FLOA 3DKWA 2QQAA 3NGDA 4PPDA 1L3VA 2B8QA 1MN7A 3F44A 3DLGB 2V34A 1WTFA 1U9OA 3I32A 4GO5X 4II3A 2XSJA 1UFMA 3U1KA 4B4CA 2P81A 4MK7A 3P9CA 2YH1A 2A18A 3C15B 3UNGC 5I4MA 1GMWA 2MLXA 4MQVA 2IT0A 1J2XA 1FX7A 1CC7A 2VXZA 3I3LA 4QW8A 1RWNB 4AYBD 2B4PA 3HGGA 1FE4A 4U8YA 5E3PA 2ZBIA 3OYMA 3W7BA 5D6EA 5DV5A 3V6DB 3J7YJ 2L48A 2H6CA 3I0RB 3A03A 2LG4A 1N75A 5J1UA 2IA1A 2IXSA 5CAAA 1J59A 4FYYB 3AG2H 2QYCA 2KXNB 1UVNA 1L3UA 2MH2A 4R1HA 4EGZA 1EIYB 1Q95G 4A3JJ 2ATLA 2Y1IA 3MAHA 3PIPQ 1F9NA 3E01A 1WG5A 5M5XJ 2IDLA 1YOVB 3H2VE 3OTCA 1WF0A 4OYXA 1U6FA 4J01A 4LR7A 1ZA1B 2DA5A 1FJ7A 1IKYB 2HWVA 1G59A 3ZMZA 2DGVA 3HI9A 2XB2D 1F43A 1SUQA 4O0NA 4P75A 1U1PA 2IA6A 2NVQJ 1F9EB 3NNAA 1ZLKA 4OYMA 3EYYA 4IRHA 3N4MA 3HOZJ 3G71S 2WV1A 2FF4A 3A12A 3CMEI 1NDLA 2NYXA 4Z2YA 2W00A 2M70A 1X9SA 1HYSA 1R4MB 1C1BB 2R7XA 3RYLA 2J0XA 4ECZA 2ETHA 3C2GA 1P2FA 3JQJA 1SFKA 3H5NA 1HNIB 3GBGA 5F3TA 2CQ3A 1DRZA 3M05A 1TW3A 4QIWN 5GADU 2EBIA 4RLQA 3O44A 3PRBA 3CC7S 1LQ9A 2G0JA 4FYVB 2VDIA 2WVCA 2H54B 5KG1A 5DQHA 4J37A 3BF4A 4QBUA 4F2SA 1F6TA 3WBZA 1KLNA 3G87A 4NC8A 5LBQA 5DZ6A 4UUWA 2XDVA 4A8YA 2FIUA 4HYKA 3CT9A 5AT1B 3LOCA 3TP2A 3QPTA 1H2TZ 4M6YA 4NLUA 1RBOB 3GZ7A 2EA2A 1Y00A 4KBIA 4E7ZA 4C6AA 2LFVA 1RAGB 1P1LA 1UAWA 3A8KA 3P6YC 1LB2A 2HRUA 4IHVA 3K4JA 4D5FA 4HHJA 3DLKB 3HOXJ 1VISA 1KD1T 3DM2A 1S6PB 3I6PA 1IXSB 4WKRA 4ZHRA 3ZP5A 1RT3A 2LU1A 4K4SA 2CRGA 3DEWA 5I3PA 3VSKA 1XMOJ 3UKGA 3S2HJ 4JI6F 4UV8A 3Q0UA 2O7OA 5CA5A 4HYEA 3DGPA 2VJ4A 2KL4A 1JLQB 4LG0A 2FU4A 2B5JB 4F0KA 4A2UA 2MA3A 1DTQB 3IRRA 3TUIC 3PO5A 4W4MA 5A8KB 2VL8A 2HVQA 5BS6A 3CO6C 3MF5A 3C14B 4O4GB 4ASNA 4DX5A 4F25A 3NS7B 4ENMA 2OD6A 1N52B 3PDNA 5LT5A 4FE7A 2QO3A 2BE7D 3H40A 4ICLA 2OFHX 3IWNC 1BQMB 3D0HE 2BY3A 3S3OA 4PXCA 2C2OB 3LFKA 1XB4A 1PCAA 4HI1A 3R5BA 1N25A 1DQUA 4B08A 1VFJA 4B3AA 3MURP 1Q8KA 5DD8A 2GQCA 2AWZA 1K78A 1IDYA 3NGSA 3A1YG 1SFEA 1N56A 4DSJA 2N8GA 4K8RA 4CDIA 5LMNF 4YR0A 4LJMA 4E7LA 3RW6A 1GV2A 4FXDA 3L09A 4DV4F 1MBKA 5CD4H 1M5VC 1NEEA 4YHHF 1LKZA 1VHFA 2FJAB 3W66A 4M5NA 3IA0A 5JFRA 5L38A 1IKWA 1NU4A 2FDNA 4IH6A 1IM6A 1ETKA 2C1EB 1S7IA 1BC6A 1R0CB 3EYIA 3NXZA 1U49A 2RQQA 2QFJA 3HHNB 5JI6A 3IRQA 1XSXA 1WJDA 3MAAA 1L0OC 4KGMA 1FP1D 2DT6A 1JLEA 3M3YJ 4EI2A 2NR0A 1KRPA 2BX6A 3ZO7A 3GUDA 3MM7B 4WK8F 3KLHB 5L1LA 3W65A 1MDMA 3FZVA 4KT5C 1HW1A 2C3PA 3LQQA 4B3XA 2K7JA 2XMJA 2FC9A 1K83J 1YW8A 4RGUA 3PXGa 4JYKA 2RNEA 3I0TA 4K4VA 3CJRB 1UETA 2KYXA 1RR7A 1IJFB 2XZTB 4Q4ZF 4KV8B 1R8PA 1IN7A 3CCJI 4GO7X 2A6MA 1FTCA 4KPCA 4UOFA 1LQ1A 2DK5A 3T5XA 1FFSB 1TAUA 4BU2A 1QAJA 2DDAA 2BM0A 2GMHA 1R36A 2MKHA 4PWWA 4BL0B 2VKRA 2V4JA 2KZVA 4OZ5A 4ZCIA 1F0XA 2XWYA 3SFGA 3Q22A 4QCLA 1SI9A 2XAJA 4G65A 4I0BA 3D68A 2DI3A 3OY9A 5BPDA 1KFSA 3A8JA 2E1OA 4MKYA 5KFDA 1CJKB 4EJVA 3H20A 3ZTQA 3I82A 3OIOA 5DQGA 5ICFA 2YKNB 4K0KJ 2GZWA 1MSEC 2AGQA 2Y0MA 3J7AY 2CUJA 3QPSA 2Y30A 1OY6A 3CJKA 3FQLA 3WGGA 2YKQA 3T5HA 4DJBA 4KIBA 3HMJG 2HYGD 4N9IA 3K70C 2DNMA 3O3KA 1JLAB 3IMQJ 4P7TA 2VKDA 4KHMA 3TMOA 5FB2A 4C2TA 1U24A 3CDWA 2HWIA 3OV7A 2K3KA 3K10A 2LKSA 1N5TA 4OIRF 1BQNB 5B0GA 3NL0A 4LVOP 1F9FA 4NCBA 3G4SI 4KIAA 4DCPB 4I64A 4AIKA 1S7OA 3M6UA 5I42A 1DZ5A 4LF5F 2JLEA 1GQEA 1TUWA 1TL7A 2PN6A 2ZHOA 2XSJC 4YEJA 1CULA 1IQTA 4PUSA 3CMQA 3QODA 4RW6A 4OLOA 4EM2A 5LGNA 2WB1A 3WGHA 1TK8A 1V54H 2GXBA 4C48A 1CS4B 2NZ4A 5F8IA 2M8GX 4H54A 1D1BA 4DR2J 2ZNZA 3ENAA 2ZH8A 2DNLA 5AE2A 2MH9A 2Y3YA 2BHZA 2BYCA 4KT0C 1VC6A 2VG6B 5LHIA 1TNTA 2BMBA 3DBHB 2L01A 4HSRA 2JX2A 2KG0A 2BKOA 5J2NA 3POTA 2YPRA 1R89A 2H09A 2W9AA 1VQ7I 1D1UA 2IGKA 4IHWA 4QIFA 2F2EA 2WY7Q 2MLKA 4IEJA 4A8KA 4R5PB 3GJTB 4OAZA 1XNRF 4ZVGA 1AFIA 3IC1A 3PG9A 4HACB 4MFDA 2M45A 4ZC3A 4LG3A 3PO4A 4OINF 2DW4A 5J2MA 2PI0A 4LJZF 3AOBA 3CCLS 3PIOF 2FGOA 3S14J 3BR5A 4DBRA 3HSRA 3M9MB 1F2HA 2UV8A 4AIHA 5HN0A 5DEQA 3ZZTA 3HPHA 5M3MJ 2IA0A 1M1HA 1GXLA 3JAMZ 1FSHA 1KQFB 1YRNB 5IP6A 1RC9A 3HYIA 1B0TA 3PFEA 5F8MA 1BOBA 3FQKA 1I6HJ 3OYEA 3S16J 2FY8A 4BXUA 4WU3A 3C16A 4NLPA 2ALZA 5HVFA 4UF4A 1TT0A 2KJVA 1YJ7A 1JNZB 1VQ4S 3F0CA 1IBKF 1UVLA 2HPUA 3F41A 3CD6S 1Q1HA 1TV6B 4QWEA 2FBIA 2FRHA 5KFIA 1Z21A 1X2NA 1VI7A 2CPXA 2A10A 3IS9A 3MEDA 3W6JB 2R2TA 1E0EA 5FD6A 1UWAA 1W5SA 5F08A 3GJRB 2EZKA 4O0IA 5IT3A 3H2LA 3S6EA 2MC3A 2W2NP 3EDPA 1USSA 4HZFA 3IRXA 1XR6A 2F9JA 3IFEA 1U2RA 1RESA 5ICEA 1MKMA 3EMTA 3NLCA 3LP0A 1J5EJ 4MNUA 4X64J 4MTPA 2JLFA 2MQQA 2HNDA 5ETVA 4A3BJ 2MYFA 5KT2A 4IOAF 5K14B 4ES2A 1KHVA 3HP6A 1E6YA 1X7VA 2FZCB 1YSJA 3BBCA 1SC1B 5JJBA 2IVMA 3KLOA 2PEBA 4TU9A 2A6OA 5J1YA 2PIIA 4LIUA 4XOPA 1A0OB 2GLOA 1IC8A 3KJVB 1AHDP 5KT6A 2IVYA 2R42A 1LOUA 1HBNA 2CRLA 5DGAA 4DSLA 3MOJB 2ZH9A 3CCVS 1Q78A 2DA2A 2HAFA 2CAJA 4FYXB 2RU9A 2AX1A 4CH0S 4KYZA 3RZDJ 3ZZUA 2LK2A 3T8RA 2WA0A 5CKTA 2UXDJ 1MJ9A 4OMYA 2YNFB 1LE8A 3S1TA 3TX8A 4CO3A 1NJWA 1X19A 3SCIE 2ERRA 1VRTA 3KG4A 1VBXA 1TKXA 4MMOA 1IKXB 2IYGA 3LP2B 2KU7A 3MEGB 3DLGA 2M7BA 1UPPA 2WRMA 3HZEA 3GJSB 3KZZA 2XIGA 3Q8YA 2KFNA 2G7HA 1VQ4I 4LOCA 4OFZA 3VCDA 3CD6I 2QGUA 3MR2A 1TFYA 2E5ZA 1SFOJ 3JRDA 1VMBA 5KFWA 4A8QA 4USJC 4DV2F 3M9AA 3UN5A 1S9HA 3V6DA 3LMMA 2R5YB 3I0RA 3GV8B 4AL7A 2QYOA 4LF1A 2XMMA 4XONA 4ZP8A 2MFZA 3PZPA 2FVCA 4DZ6A 3ZRGA 1EKSA 3W2AA 1V5VA 2QA1A 4BNCA 2ZC2A 3K7RA 1BXNA 1N5VA 3TUZC 3OL8A 2ZUAA 2BXJA 3N9UC 4C2MJ 3COAC 4L0YB 2HIQA 1W2BR 4DQIA 4IXAA 1KQGB 5SZTA 1JMTA 2XPVA 5KHDA 1UMQA 2K1RB 1GT0C 5KNLA 3SQGB 3W3CA 5HANA 3HRTA 1WG1A 4UNOA 3TR5A 2XC7A 2JNJA 4I2PA 3ZQFA 4CLTA 4HVZA 3P96A 3BLYA 3UWTA 4BBSJ 5FFZA 4MTEA 1DU6A 3ULQB 3NEKA 5J1RA 4IRKA 3ZGKA 4RBOA 4IRIA 3N5BA 2UVRA 1W7PB 4NMXA 3FMWA 3KHHA 4F50A 3TEHB 4H0EA 2O67A 2MPUA 4LIWA 4NE9C 2V8VA 4ZVFA 3RB6A 3D5RC 5LMUF 1ONVA 1X31C 1N6QA 2RS8A 4Q8EA 3DLJA 1G4DA 1HNIA 4DX6A 1IN4A 2FQ3A 3CCSS 1D5VA 3ROUA 4AVPA 4L76A 4A69C 3C8YA 1U2FA 4QSHA 3D5LA 3HHEA 5LLQA 4WWSA 2IYIA 3QYEA 2M8HA 3JRFA 2ECCA 4ON0A 2FSWA 1I6XA 2DIVA 2CKWA 2XCPA 1UJ5A 4IDKB 3WG7H 3LSKA 2GJFA 2HQDA 3L3CA 1QPIA 2DIUA 2ZJRF 2YH0A 5C5JA 4X84A 1JJCB 3M7GA 4OQJA 2VI6A 5KT7A 2Y8YA 4PFPA 5GAGJ 2DYAA 2O61A 3RPUD 1Q4RA 3DLKA 3BKFA 1S6PA 5K8OA 4B3SF 3H9GA 4ANEA 4RGRA 4PRFA 5B0AA 4Q7AA 1GVDA 2A05A 2XPWA 2X1AA 3I87A 2CV0A 5M2UA 4PXEA 4EM1A 4DX8H 2Y1LB 2XC9A 1LEOA 3AXKA 1VLOA 2WVDA 4QQBA 2VT2A 1FXDA 4QPOA 4N5SA 3I96A 4LUBA 3NNHA 2AYGA 3Q24A 3ZOBA 4KMUX 1TR0A 2HHSA 2LBFA 4O4GA 1IZ1A 1AROP 2Z2LA 1ZYRF 4NA2A 3VYSB 3M1CA 2Q6BA 2V26A 2R7DA 5IT9U 1VZ0A 4ZYAA 4BH9A 3MDFA 2LVSA 2XQCA 3I9V2 8RUCA 3I0SB 3VODA 1BHNA 1S97A 3H4DA 4FPRA 5HJXA 4NDLA 1VQSA 4TN2A 2FYXA 5CYJA 3RPQA 4XAKA 3SFZA 2Q2EB 1ZA2B 4XDDA 4LREA 4DPYA 2C2NA 1P4WA 4X65F 3HG9A 1WF2A 3SZ2A 3GTPJ 2IY5B 2LKXA 2K40A 3UE2A 1JJ8C 2CQXA 2G2OA 1R8HA 4B9VA 4JI7J 1VYAA 4NLYA 3FBBA 3QO9A 3NOCA 4K4TA 2O66A 2WSCC 4Y2AA 2M4KA 3IR5B 4LT6A 4BDZA 4I2QA 1R3NA 4EZ9A 1SFUA 3UCZP 4L73A 4LLNA 1BW5A 3Q8SB 5T7LB 3FC9A 4DPUA 5JHUA 2Z58B 1FERA 4WXOA 1ENHA 2YUSA 2W8LA 4WF9Q 2XAHA 5LRSA 4DL3A 2L3DA 4MYTA 5E3CA 1MBGA 2B8PA 3MM7A 3G2XA 5K7ZA 4NLGA 1NKEA 3QP6A 2E1AA 4MK9A 4KNYA 4II2A 1P92A 3CD5A 2Z2SB 4X4UA 1JHHA 1IKVB 3SI8A 4GKKF 2L7ZA 5GMEA 2OPPA 1BY9A 3H7HB 4DHVA 4Z6YA 1EJ7L 3CJRA 4PJJA 3AL0C 4M3EA 2DYSH 3RRKA 3GG0A 3T1YF 3PTWA 1WJAA 4A47A 5FKLA 1I3OB 2EVZA 4DL0C 4KB7A 3LSPA 4DU8A 4V19X 4KDPA 3LTOA 1R0AA 3TO7A 1LXJA 4I7FB 2E34A 2UXCJ 2VQCA 2HHWA 2APOA 3V4MA 4BDPA 1S79A 4F4KA 1WDDA 3NCPA 2UV1A 3TARA 1R1VA 1RSCA 3H9QA 4Q45A 3RKQA 5KG5A 4WK3A 2OI2A 2F48A 1K1QA 3QAEA 2V50A 4GRSA 3CDIA 2DH7A 2D69A 1LWCB 2O01C 3BM7A 1FVSA 2YU9J 2W85A 2FJXA 1F1ZA 2NS8A 4MJKA 1HA8A 3OS1A 3MKYB 3ZXSA 2IFXA 3TOAA 2V4RA 1F5CA 2DT9A 2DJNA 2YKNA 3ABMH 4OIOF 2AJQA 4IOCF 4RNOA 4XRSA 5J6XA 5E20A 4E0DA 1AU7A 3EPZA 2F4MB 5F1JA 2QL5B 1WC0A 1SCJB 1U1LA 3UVJB 5E79C 2HHUA 4CYUB 1PAUB 1HI0P 3Q9VA 3SEZA 2QEXS 2ZOGA 3MAJA 3L2QA 4C0OC 4O3NA 4CCHA 1JLAA 1AKHB 2M3DA 5KG7A 4DV6F 1A6IA 3PKYA 3UD5A 1G3OA 3QAHA 1Q8LA 1N5QA 2ALYB 3FBIB 1U5TA 2BW7A 5G0RB 2OQGA 2VG7B 5CQEA 2IM2A 4U0WA 2K9SA 2V6AA 4M5LA 4Q48A 1YTYA 2PMUA 2XTJP 3QJLA 3TOBA 3THTA 2AMCB 3N0VA 2RQCA 4GO1A 3GTOJ 5IT9K 3TJ8A 3BYRA 4WP9A 1OY8A 3H42A 4KN7X 1BE4A 5FD5A 2LQ9A 3J81Z 3CIMA 2HRYA 3GXOA 4M5DA 5LFAA 2H94A 1ACIA 4NPOA 2LRDA 1YW9A 2DBBA 2MW8A 3M8JA 1E3HA 1WI6A 1FOYA 3DPTA 2J9DE 3L2RA 1S48A 2HSEB 2LKZA 3ZTSA 2HMIA 2EG1A 4X66F 1J5OB 1DAXA 2RV8A 4LFUA 1DTTA 4DPOA 2BV3A 1KQ9A 2LDIA 5J8FA 1T05A 4UUTA 1X4GA 3GB0A 1CS4A 3V4GA 5E0OA 1OQ3A 3CD0A 1F5AA 4RMNA 1S5ZA 2XF5A 1NO8A 5KFZA 3SEQA 1Y3KA 1Z91A 2YTCA 3KWMA 4BQAA 3V7CA 2QF7A 1CJTA 5L46A 1CJVB 1WWHA 5F27A 3UQSA 1HNXJ 1NHAA 3U21A 2QL9B 1YJRA 4Y15A 1GV5A 4YY3J 2R7UA 4R5PA 1U4BA 3HO1A 1GK8A 1URNA 1A7GE 3FNNA 3UCGA 4LF6J 4X4QA 2ASLA 2RKIA 1OCTC 1KQ0A 3KYCB 1XC5A 2IBKA 2AQEA 5DDQC 4PQUA 1RRJA 2HHTA 3CCRS 4ES3A 1ZAVA 3HDSA 2BQUA 3DU6A 2FEZA 1XS9A 1ZZFA 4AUXA 2CDQA 1D3YA 1PC4A 5C25B 1TTHB 2Z2MA 1JLGA 1SB6A 2VT3A 1ZZNA 3VQTA 4ZH4F 1SL2A 4DZPA 2XMAA 4F3QA 3W9HA 1HNZJ 1CJUB 3CUNA 1XGOA 4LRBA 5D8KB 3BG6A 3CMAI 3N05A 2X3DA 2LQJA 3TRGA 2KT5A 2ZSIB 4H4MB 1F3FA 3IGVA 5T14A 1VK3A 5KFSA 4JI0F 2LQBA 5A8RB 1P6RA 4HA8A 5F0WA 2JA7J 4BCAA 5BMZA 1ACMB 3IUOA 2DXFA 5FKNA 2YKAA 1GEHA 2LF8A 2VBWA 2AX0A 3MCOA 2B4VA 4PFOA 4M95A 3PYDA 2N3LA 4NQWA 3R4KA 1XJWB 3M6XA 4FVMA 5KK1A 1OSDA 4NOHA 4TNOA 1XTZA 1JWWA 2P7CB 4LSNB 4RW4B 5C2GA 2DA7A 4G1PA 3N6MA 1R4NB 1FRHA 1ZELA 3H36A 1HNWF 2P6TA 3MR3A 5DDPC 1JGSA 3TNVA 3PFYA 3C18A 1H3DA 3GIRA 2W2QP 1SD7A 3O8WA 4C9DA 3CC2I 3AFGA 3P5JA 2HQFA 3KJVA 2CPFA 2QX0A 4L9TA 1FI4A 2ROPA 2IAJB 1MROB 2MB0B 3WC2A 1QO0D 1NKCA 1XR7A 6FD1A 3SQNA 2JEJA 2KIFA 2EFQA 3S8PA 1U6ZA 4RBVA 6FDRA 1HBMB 2XHKA 2ZC3A 1UWBB 4EBEA 3SFIA 1OR7A 4DL6A 3DLEA 2RQMA 4S05A 4J9NA 4AC0A 4XR6A 1Z3YA 4P71A 2DHGA 2G13A 4P96A 3HOSA 2CFXA 2D9OA 3QMQA 2FJBB 5B5EC 1RUNA 4BJTA 2YNFA 4BHQA 3KLEA 1X5OA 2FD2A 1JLBA 1MNEA 1BWVA 1U2CA 1WORA 1VQLS 3KG0A 3QYFA 1QD1A 1EP4B 2ZXJA 3OWTA 4MAKA 1QHHD 2MZQA 1R00A 2PC6A 4CLFA 1BOAA 2GGPB 2HHHJ 3IAM2 4ZDPA 4G12A 3I55S 3BN4A 3DLLF 2RUGA 3KKFA 4AD6A 4ZLLA 4FYDA 1KC8T 1TP4A 4CCOA 4WWCA 4PYDA 1X5SA 3NMRA 1Y9OA 2Y1RI 5ETOA 4DLEA 3DRSB 2XS2A 1Q16B 3DMJA 5A0YA 2BJDA 5HOOA 1WJFA 3V6HA 3DI6B 3T0YA 4EUVA 2PD1A 2MBFA 2AQ4A 4M5JA 4I76A 5M2PA 1VQ8I 4F36A 3P5BP 5L1IA 2EFPA 2F4VF 2OU2A 2F5FA 4ZOSA 3GIMA 1RT2A 3DEUA 4JV0A 2CDRB 2IS4A 2CWEA 3HFKA 2XY7A 1JLCB 4XIDA 4F93B 4XLAA 1GXUA 2JUGA 1WC3A 2GZOA 4DN0A 1HC8A 2V63A 3SQGA 5DRKA 4S0MA 2JN6A 4U67Q 1R22A 3ZTPA 2MZJA 5RUBA 1XSVA 2KRRA 2NZCA 4NZ0A 3KUHA 4KYWA 4A4JA 2XGQA 2W2OP 3F6OA 2DNZA 3W2VB 4LBHA 1AA1B 2H27A 1EARA 1YBUA 2GVZB 3FKIJ 2LU2A 1X3UA 1W7PA 4HLYA 1RTJB 1RBLA 3RRHA 2E7XA 2V1NA 1R1UA 2ASJA 1Z1DA 2HDWA 1ZBTA 2VPXB 2OEKA 1OYIA 5M5WJ 2W9BB 2ZFUA 1YWXA 3L2CA 2H8WA 2B9YA 1B0PA 2A3SA 3SCLE 1IVZA 1D0ZA 5CXTA 4OHWA 3B6AA 1UJ8A 2ZKUA 2L9NA 2ZCWA 1JK9B 1NSPA 2F4FA 1GLNA 1F36A 2OA4A 3UO0A 2BR0A 1JTYA 3I55I 5KFVA 2R7OA 1WPKA 2DNRA 4ZPDA 4F04B 3HHKA 3I53A 3IAS2 1FDNA 3K58A 3JQKA 2ZM6F 3DPUA 3KDNA 1SPBP 2DGSA 2OSQA 3V8KA 3ILLA 2XS7A 5KT4A 4YOEA 4IQ4A 3K5PA 5HBMA 1FRJA 4MKVA 2LR8A 5GAEJ 4EFAC 2XHWA 1TKZB 3P4UB 2EV0A 3OD2A 2W7NA 3EICA 4YQWA 4EO8A 1WOOA 1JQGA 5HQLA 3RYPA 1CF7B 1U7LA 3K5NA 1Q86T 1RTZA 3H0PA 5EJCA 3CCUS 5H9FJ 4A46A 3X1LB 1YJTA 3KMQA 4S0HB 1VR6A 1U5TC 2XZWA 4G1QB 4DU7A 2ID3A 3DXJF 4RDUA 1UZCA 3I59B 1X5TA 4RNNA 1P6TA 5KFXA 2B3TB 1TL4A 2NXCA 2ZXIA 1X60A 1XN7A 4WX9A 1FKOB 2LEAA 3OFGA 2OZUA 3RW7A 5JXSA 2W1BA 3BROA 5E3QA 2QBYB 3ISPA 4BBRJ 4C8LA 1H9GA 5CHCB 2WBMA 1B9NA 2DTZA 3CCYA 2OJ3A 3CDUA 4L74A 2MKIA 5J4VA 2RNJA 4FX0A 4JI4J 2Q8KA 3W6KB 3EE3A 2Q6CA 3HSDA 4OZ2A 3R9LA 4DPWA 2PLYA 4KY3A 4RLEA 2QLWA 3FM5A 5E3NA 2H48B 1YITS 3D9BA 4V19J 2CW7A 1YVFA 2DPIA 1N48A 2MD5A 2FC8A 3DGVA 2WTFA 1D09B 3ETMA 3IC7A 2K27A 5AJ3J 3KHLA 2ZO4A 1TT5B 1U1NA 3VWSA 1XMOF 3MZHA 4Y65A 4JV1A 4A8MP 2E2HJ 4M3GA 1SC4B 2WAEA 1DP7P 1Z4UA 2QIFA 1H2VZ 2RQPA 2DXIA 4GKJF 3IWXA 4EGYA 3KP5A 2RVJA 3RDIA 1SD6A 1NLKL 2OTLI 1IUFA 2AO9A 1E3PA 1N36J 1HHQA 3BO3A 4EJTA 2DQLA 4V2GA 2HFHA 2OCEA 1PKUA 2P7VB 4LQ3A 2A61A 3AAFA 3OMYA 3A3PB 1YHQS 3EETA 2DHSA 4FT8A 2DN0A 4Y17A 3WG9A 1RAAB 3FEZA 4WYWA 2PA3A 1ZARA 2DXEA 2R7RA 3THPA 2L4AA 2OD4A 1FWLA 3A8EA 1W25A 4TY9A 2AEFA 3CCUI 2X1EA 4EATA 2ESHA 3FIWA 3A4CA 2FNPA 3W9JA 3QFWA 1L5UA 4XLNF 2HOSA 1KLMA 4OYPA 1IKVA 4IUFA 2JOQA 3OTDA 4B9UA 2BVMA 3KEOA 2PMZD 1JE8A 3OSGA 2LXIA 4Q2LA 2GHVC 2JVOA 4DSFA 2EJRA 3JAMK 2Y9HA 3M8PA 4IO9F 1NK0A 3E5QA 1QE1B 4W92B 5F9NA 3OTOJ 1JNRB 4F2RA 3CULA 1F5BA 1KNZA 2EB7A 1HQUB 1FESA 1O4XA 4L3NA 4HT7A 2HWTA 1OMIA 5JLWA 2QGFB 3GTJJ 4AYBN 4B3OB 4WFAQ 4RKUC 2GA7A 4HOBA 5J2QB 3ENWA 3OUYA 3PVXA 3WTSC 1TMJA 1X1CA 1K8AT 1RUOA 2ZHBA 3LALA 2WAQA 4WJBA 1KN6A 3C6TA 2IBOA 3DDIA 3IP0A 4K50A 4U0YA 2QLFB 2JA6J 2WY8Q 4ECRA 3L4BC 4NL5A 1ZRFA 3UVJA 3MPDA 3O2PE 1TW2A 1VCTA 1XR5A 4CYUA 4JK1X 1OYEA 4IKFA 4I0AA 2PI4A 5ADZA 3E6DA 3OJUA 3OFEA 1IQZA 2M9HA 2O1PA 4E98A 4KHPF 2YKOA 1OR7C 1ZK8A 3G82A 2NXUA 3ZTRA 4CT9A 3D1QA 4X62F 1WJ9A 4PDKA 4EMDA 2R2SA 1RWOB 3Q8PB 4DUYJ 1S0OA 5G0RA 3NWRA 4DG1A 2HQIA 2LXUA 1YHQI 5K7FA 4ECUA 5EX0A 3HTUA 3JTGA 2UZKA 4BEHB 2I1RA 3GONA 2VUGA 4GRIA 1UEUA 3CCZA 2CXEA 1DU0A 4FPIA 3SJMA 3UFCX 4A3LJ 1EH7A 1RTDB 3JTNA 2EC2A 1FBSA 4FTHA 4ILLA 3KPHA 2OUMA 1PBAA 1NUEA 4WCEQ 1Y39A 2Z0GA 4NRUA 2CZ9A 9ATCB 3M07A 1HCRA 1Q1VA 4ESBA 1RT6B 2V68A 2OPQA 4M63A 1V5FA 4F7VA 5KFNA 2RB7A 2CIMA 3DF8A 3L2WA 3BZ6A 1MWYA 1FKPA 2ACYA 4I4BA 4OJ1A 3TJAA 4FS1A 1HW9A 3VGUA 3TBIA 1U1RA 5J1PA 2RDDA 3QGIA 1HPZA 3CJTB 1UMJA 2GO8A 1Q81T 1R23A 2DO7A 1KU7A 4DQRA 3JRAA 1KTQA 2QN6B 5KTQA 5F0HA 4ZTFA 3O1LA 4HW0A 1YE9A 1SMTA 2OAZA 2LY1A 1F5TA 3B6BA 3Q8RB 3E6BA 2XGDA 1K6OA 1HR0F 1TL8A 3GPAA 1NB7A 1Y3JA 2VBXA 3VAMA 2E5HA 4ID5B 1OCRH 1WH5A 1RP5A 4K2XA 4YEAA 3C3WA 4B3MJ 3BPXA 2HQCA 4F02A 3IH4A 4HF1A 3WTZA 3TO6A 3IKVA 1W1WE 4CUGA 4KICA 2XY6A 3NQOA 2LECA 5CYQA 5D4PA 4QTRA 1BI0A 1W5CC 5E3RA 4MTDA 1X4FA 3OTBA 4FKXA 2H1KA 4MFBB 1CPZA 2V6CA 1N32J 3QJPA 2W24A 1VQ6S 4HNTA 3PM9A 3H5SA 2VUMJ 1YJNS 1O3RA 4OYOA 5GPCA 2HRTA 3HHLC 2UUTA 1M5HA 3EYZA 4LF4J 2VXDA 3BT9A 1TQIA 4C8MA 2NLWA 1B72A 3VZIA 4H4MA 5BPIA 3SDEB 1OKRA 2JPCA 1X4BA 4AXIA 4ETSA 1Y0NA 2C3MA 4G6TB 3KLIB 5HI7A 1NK3P 3KCCA 1BIBA 3GTYX 5F6FA 3V2UC 1UVIA 4PK4A 1UZHA 2AGPA 3CEDA 1RWKB 5D0EA 2DU9A 1XMQJ 1B64A 4C3KA 2ZBRA 4ED1A 1PC5A 4BGDA 2J8SA 4J9UE 2KMUA 2RNGA 4RAFA 3K17A 4RW7A 1UVMA 2W2MP 3NNCA 3E7LA 1ZN2A 5BNGA 1UG2A 4N47A 8ATCB 2DEIA 2HFOA 1GTHA 4CDGA 4YR3A 4AYBA 2XV4S 4DF4A 4DL5A 4N4NB 2GAUA 2I5JA 4NMLA 2JEGA 1C0TA 3WC0A 2HQ3A 1PSDA 3QQAA 2HZCA 2YNIB 2D9PA 2EQRA 3OYBA 1IBLJ 3MM9B 1JXSA 5IQQA 1MROA 4DL7A 3F8NA 1D3WA 1NXIA 4ED6A 2DGWA 1C4AA 3DHWC 3WZ0A 4WFNQ 1R8BA 2ZHAA 1OIAA 3BJAA 1R58A 4XQFA 3D6MB 4A0YA 2CNNB 2CJAA 2G9OA 1NM2A 2RDIA 1RA7A 2D1VA 1R8CA 5KFGA 3F6VA 3A2KA 4NHJA 3M30B 1RAIB 4A3GJ 1JT6A 1RKTA 3TOQA 2MHNA 5H9FK 4FS2A 4Y3OA 2DKOB 2UU9F 1J5EF 5H20A 4E6KG 4OX9J 3HIFA 4UUVA 3B8HA 2CZVC 3IM8A 4X64F 3X2QH 4IFVB 1S5LC 1S6QB 2GGPA 4BY7J 1W5TA 3CO0P 5M5YJ 1YDLA 1GMWD 3I9ZA 3V6JA 2X1FA 3HBLA 2RREA 1R6YA 2CPYA 5F0FA 2Y1JA 1T2KA 4IG3B 1V3ZA 3GQCA 1HMVB 3WTYC 2JK3A 4ZS6A 3DOKB 5EEHA 3GJQB 2FPHX 3DRSA 2O5DA 1VRUB 3HRMA 2MHEA 1MGTA 2BVLA 3A1YA 5HLIA 3N6NA 3L2VA 1LNWA 4U6PA 2F63A 4HEA2 1NSKL 2XRNA 3I5AA 2BXZA 3GFLA 3BCAA 3BYPA 3RBXA 3P9KA 5I3UB 4Q47A 2FUG2 4TV7A 3PR4A 1LXNA 5DYMA 2W25A 2DY9A 2A1BA 2ZITA 4QWAA 3E6CC 3K1PA 1TL3B 4A5MA 4V19K 2GC8A 1JT0A 3ICLA 1WJCA 1OYYA 1JLCA 4Y52J 4IG0B 5HAOA 3VWBA 2N7YA 2GXGA 1ZG5A 3KYDB 4RJVA 4C30A 1ZG1A 1WKLA 1B3TA 3WHBA 1S76D 5CVRA 2W4SA 4DV1J 4QPXA 1HDDC 3C19A 2XCAA 2E1MC 1MJAA 2LFBA 3TAMA 4YIFA 1T9VA 2RRAA 5KFBA 3OW2R 2X85A 2DGXA 4RB1A 3OYHA 4CYCA 3QPHA 3S1RJ 3CJSA 1S1VA 3T8TA 3IBCB 4ZVOB 1HD1A 1LWFB 2XGCA 1HQEB 4JOUA 2GVZA 1WHXA 3CDBA 1T56A 2EG2A 2X6YA 3ASNH 3HOUJ 3HSZA 5ETSA 3B73A 2Z30B 4JB8B 4LIVA 3DYAA 4XORA 3A4TA 5DQIA 2RS2A 1U8WA 2OH2A 2JPBA 2XNRA 1SV5B 3G3ZA 5IP9J 3B6CA 2W9BA 1LEAA 4J9PA 1YJWI 1UCNA 4UTGA 4L72B 1HKQA 4FCYA 4USIA 4HLXA 4MO7A 5HLGA 5FLXY 2M0GB 1Z6TA 1SJQA 4JV5F 3ENQA 1KHWA 2LREA 3S3NA 2XSJB 4TYAA 2Z3YA 3LWMA 2MQMA 3W6VA 4LFAJ 4L5IA 3ML6A 4K4WA 4Q8FA 4JI8F 1NZ8A 4BC9A 4Y28C 1XGSA 4I02A 2MGZA 3L7WA 4M6XA 4DL2A 1NCLA 4K2EA 3THVA 2CQIA 2BACA 1DDNA 3A0HC 3BTJA 4CLZA 1G7CB 2DJIA 2K5CA 3JSMA 1X8DA 4ZN1A 5DG7A 3CF5Q 1DHMA 1TKZA 2FBKA 1VJQA 3BCBA 3R7BB 4Q5SF 2IW5A 3R2DJ 2VC1A 2IP2A 5E3OA 4EYIB 4RM3A 2VKZG 3QFHA 2GWRA 5KFHA 3GO5A 4RW8A 2KN4A 3CUQC 1SVMA 2A5YB 3GLJA 2ZH5A 4JP0A 2VODA 2XF7A 1Q0NA 2IGOA 2L08A 1UFKA 1NK6A 3W8GA 5L3DA 2XI2A 3BB5A 1WI3A 3I59A 3F3XA 4JUZA 3TVZA 2AXLA 3C1DA 1AB8A 1HA1A 4IRCA 1LWXA 3V5RA 4A8WA 3RBEA 3WX4A 3NWSA 4CYDA 1FEXA 2E1PA 4LR8A 3OPKA 2HFNA 2LF7A 4KMFA 1I50J 3NGRA 1VQ9S 4HV6A 1EQMA 3GE9A 3QIPA 3BDPA 1LW0B 2BW3B 3AJ1A 5C7PA 2H51B 4ETZA 2AF6A 5LL6d 1NG6A 1DPUA 2O5RA 4KFBA 3J81K 1OQ6A 1REVA 2VQFJ 2EXUA 1SL1A 1J0RA 3PUFA 1D5YA 3K1MA 4OX7A 1K6YA 2FHJA 4CRJA 2E60A 1QVFR 3BGRB 4ZJOA 1S3JA 3RIRA 5IC4B 3D54A 2BYVE 1IJWC 3KNAA 2FD5A 4LB6B 4PR6A 3F8MA 4IF4A 4AIDA 5J1EB 2LQ8A 4RR5A 1SJ1A 4UB8C 4E7KA 4ED4A 1S1WB 5ETMA 4M73A 1M1EB 2CPHA 1RYRA 5IWAJ 3BZCA 1ZTTA 3QRQA 2W7PA 4PG6A 3PHEA 3V81A 4L0ZB 3FSXA 2EILH 4BKXA 1P4XA 2JTVA 4NLRA 3B78A 2BZTA 3BSOA 2V8HA 3GYXB 1GTEA 1LK7A 3LA3A 2VH7A 1W26A 1NTCA 4IH5A 3U27A 3QSYB 3AOAA 3R5JB 1QUPA 4ZHRB 1HW5A 2JT1A 2JHEA 2ZD1B 3FKJA 1Z9CA 5B1BH 1RT3B 2CWXA 4PJ0C 1RUSA 1CQMA 4L5EA 1APSA 3ZZ0A 3VDXA 3CF2A 1FT9A 2B4OA 4RO0A 2NVYJ 1P8GA 5D0GA 3TDUC 2MDAA 4UOCA 3QNWB 4LG0B 2J9EA 4OLPA 2G0IA 2CQNA 1AUSL 2DGOA 4X4PA 2HPIA 4KRWA 1P1TA 4PG5A 4N41A 1VDHA 4ZPBA 5IV3A 4OIQF 3B82A 3N97A 3WE3A 2V4QA 3LSJA 5F3ZA 4NB5A 3CSKA 2KT0A 2C3OA 4QIWD 3ZNUA 1I3AA 2BJ1A 1NJZA 4ZMMA 2R8HA 1QRYA 3ISND 1XWLA 1VQ9I 1FIAA 4YG2F 5E3AA 3GFMA 5HS9A 3FMSA 2F5EA 1YFHA 2PFFB 3QPIA 4F67A 3DRRA 1UHWA 2BHYA 5DG9A 2FJVA 4JYAF 1RWUA 1FWZA 5D0RA 1T3NA 1N34F 2PEHA 4PXDA 2KXHA 2OIHA 5J2QA 2E35A 1W0UA 4QU6A 2FOKA 4J9KA 2W01A 2ZH3A 1K78B 3PW2A 4TYBA 3P45B 1RIOH 3HRUA 3RG6A 3OYDA 4AWXB 2HG4A 4FNIA 2HQGA 3EZ5A 4IVNA 1I27A 3TZXA 1O3TA 1O7LA 1FK9A 2PFDA 3BR1A 3VAJA 2V9WA 4I1TA 5D8LB 5DS7A 2GIQA 4WCGA 5IOZA 1Y6IA 3H5UA 1IKWB 4O3RA 5KT5A 3FXKA 4A5NA 4E8UA 2LCWA 3F22A 3AJDA 4WBFA 3C46A 5B3SH 5LSLA 1WJBA 4KJZA 4G7ZF 1S29A 1UG0A 2XASA 2BDPA 4URSA 1R7JA 3F8FA 4R79A 3PNTA 3SSRA 1JJ4A 3PM1A 2P6SA 1DUXC 4UXNA 4QIEA 4R8UB 2E7WA 3MAAB 4CIOA 1G3WA 3OXFA 5DLFA 1JLEB 4IO1A 1MH3A 1ETOA 2Q1ZB 4HF0A 3TDZC 4QPTA 5ETLA 1RTDA 1VTNC 2ZKZA 3I56S 3BQ0A 3J7A1 3KTQA 5A2QY 2WK4A 1MDMB 1IN6A 1XCVA 1TQLA 5CPRB 2CQ7A 1JJHA 4CZZA 1BGXT 1VS3A 4CLLA 3FCVA 1GAOA 2GAGC 1S9GA 1MMGA 2VDHA 4ZTJA 2WBRA 3TVYA 3HD2A 5A76A 1YG2A 1K1SA 2VPYB 2KZZA 3DP7A 5HNHA 3TZZA 3G9CA 1FX4A 3OSFA 2B63J 3G86A 4E2FB 3PEHA 3J80Y 2YQ1A 4QOTA 1GX6A 2E5NA 2HEKA 3DFEA 4JX5A 2GXAA 4P9FA 4O5VA 2MKJA 3BJ6A 2DTJA 2PBIA 4Y00A 3G8TA 4A3CJ 1XMBA 2FGCA 4BXFA 4FZVA 2ELJA 1JIHA 4USTA 1YGYA 1RHRB 1YX3A 1HBOA 3E0JB 1FEEA 5KFOA 3FJ2A 3OYFA 4DW6A 4U96A 1JLFA 3ZMSA 4WP3A 2QQ9A 3DBRB 2DY1A 3ZXWA 3F9KA 1WQ2A 3CJKB 1HARA 2BA9A 2IAIA 3IH2A 2W7AA 2G9WA 1FTZA 4ANJA 2DO0A 4PABA 4ZJZA 4C3JJ 1S49A 2OKQA 4OI6A 5F1RA 4FX4A 2KT3A 2AXTC 4ECQA 1A5JA 4LD5A 3RTVA 3C66A 5FLXU 1Y1WJ 2RN7A 1WCMJ 3BQ1A 4MLOA 5D6FA 2LY2A 4DR5F 1BMQB 4ECXA 2VQEF 4LBIA 2CJQA 1YRXA 2C2KB 4Q5VA 1DURA 2M2BA 4AU7A 2EA4A 4XBFA 3JSRA 4ES1A 2N4CA 2DR9A 4XLFA 5I42B 3JSBA 3PV8A 3M6VA 4YY3F 1TL7B 5BYQA 1M5SA 3K1NA 2B0LA 1VBKA 2MZTA 4MYUA 2DD8S 4RBUA 2C3YA 3BR8A 3RKWA 1IM4A 4RW6B 2D3OR 2XNQA 1YS6A 1FKAF 4P6QA 1XIQA 2GOXB 4LF6F 2UUBJ 5DM7Q 2QKMB 1VQKI 2ZKTA 4K7QA 2NXNA 4ZPWR 2G0CA 4X2BA 3MZ8A 4XSZF 4A3FJ 2IGNA 3AAWB 2X6XA 2JA2A 2HVIA 5D4RA 2K4BA 3EGVA 4TKTA 4IRGA 2R7ZJ 1HLVA 1LWEB 2B9WA 5ED4A 4F3OA 4B3RF 4O3MA 2LSOA 4G6VB 2NOJB 3AQOA 5CVUA 4XLPF 4RB0A 1PUFA 4P2XA 3CO9A 3HPOA 1XCBA 2WOMA 3RQ4A 1GHCA 2HWHA 4M1KA 1UAAA 2O9LA 1FBUA 2PJRA 2Y0SD 2HS0A 1P7IA 5AE1A 5F8JA 1WJ5A 2JDJA 1PG5B 3IGNA 4DLGA 2XAGA 1S1XB 2J5OA 3HVRA 4NC6A 2JSCA 4OJGA 4Y2CA 1LPQA 3MAQA 1BL0A 4C8NA 3K8WA 4I01A 5E8GA 3M30A 2PSZA 4G7OF 1G3SA 4F52A 2HBYB 5G4DA 2DVIA 2K02A 4FF4A 3PX0A 2XGEA 4MFEA 2MZSA 2XAQA 5KG6A 4TLQA 2STWA 3BV8A 4DV7J 4R8HA 4DWIA 1T03B 1YX2A 2K06A 2NVXJ 1Z7LA 1T94A 2BOLA 4IQMA 1IRFA 1S6QA 4WFYA 2BY2A 1BJAA 2COMA 3GR0A 3MMBA 3VV2B 2VIHA 3BEGB 4DFKA 2UXBF 3C16B 1FNXH 3MVPA 4DEZA 1D8KA 1FRLA 1YIJS 5GP9A 3GYNA 4OV6A 2DNGA 4JI6J 4DUZJ 1UW9A 2LVWA 4IG3A 5C42B 1OPCA 3AL0B 4ZLPA 3O5TB 3K69A 2YSRA 2UUCJ 2XRLA 3IS9B 3DOKA 4FVCA 3MEDB 2BEOA 1T9YA 1W7WA 2KLOA 2CV2A 1OS5A 4ZA1A 2DT5A 2E1NA 4KGVB 4DFJA 3HZGA 4FDFA 3ZN1A 4GYGA 3BY6A 1GMVA 3CP8A 1Q5VA 4NWBA 1ZM2A 2HPMA 1KA8A 2VHGA 2QZ8A 4ED8A 4BQOA 3QBCA 4LRAA 3LP0B 1HDPA 5I3UA 1RI7A 1FDBA 5FIIA 3BSAA 2F6CA 1U26A 1TELA 2GFFA 2W1OA 3NAHA 4DUTA 4Z7YA 1MU2A 2EIMH 2H6BA 1NNDA 3OQ2A 4B09A 1KEKA 2Q66A 3H3UA 1FOKA 1E6YB 4DF8A 1D0EA 5KFTA 5DCMA 4CCLA 1N0UA 3ZFVA 3GCXP 4RAGA 4HBLA 1R1TA 2FHMA 3FHZA 5KFKA 2IRYA 3OXLA 3R61A 2E9TA 2HHHF 1IUYA 3BC8A 2RKHA 2AHOB 1TK5A 1IWGA 3RPUA 5HMZA 5LMNJ 1HBNB 1D9FA 3CCES 2VU5A 3FXOA 3BGFA 5F0UA 1FTTA 4J9RA 4DV4J 3NGUA 2ZUGA 1NK5A 2PE8A 2XF6A 3DLAA 1HD0A 1M1GA 2J0SD 3DRXA 1VC0A 2WHOA 3HSJA 2DHHA 5EWGA 1TU0B 3KK1A 1WEXA 1SKRA 5GVQA 1WOPA 1ZETA 5KFJA 1SKUB 5FLMJ 2YWWA 3HXLA 4ZYDA 3GTQJ 3CCMI 1TKXB 3EUNA 4X4TA 3FXMA 1UVKA 3OTEA 1SQGA 2VFSA 4U7UK 5F8GA 2HK2A 1ITPA 5HL7Q 3J7AO 4A8XA 4F3MA 2HK3A 2OFGX 2JFDA 3OV8A 3TO9A 2ICWG 3EVMA 1QY7A 4L9JA 3K8VA 2QMUB 3FXLA 2QA4I 2AYEA 1GX5A 3BBBA 4O3OA 4QWBA 2FVQA 3EPGA 2F8EX 4CLKA 3DN9A 5LRRA 3DRPA 3A13A 4JI2F 2RRBA 1FRKA 2QSFA 5H2FC 2F5DA 4PAAA 4DR1F 4UZBA 2ZMEB 4N76A 3IKTA 3OYJA 3MTJA 2F40A 2V1DA 2J7WA 5E1ZB 4XIUA 1YK9A 4USHA 3OXGA 4NLXA 1Q1KA 2HVHA 1KFDA 3DOMB 4QWCA 2CPEA 2XMKA 4BJ6C 1RJJA 1I6JA 2HS3A 1QAYA 2KQRA 1Y8QB 1E17A 4ZCKA 5C4JJ 2KVIA 3OVAA 2IS1A 5KFEA 4RX6A 3HHHA 3J81j 3BBFA 1GT8A 4I2PB 2DISA 4W1UA 2WB4A 2GIVA 4ZVHA 2QSGX 5EDNA 2CUYA 1RAHB 4BE2A 3Q2SC 4FKYA 3ENVA 2DOEA 3PR5B 2L9VA 3U1MA 1FF2A 2D7SA 3OL4A 3PO2J 1RKIA 1G8XA 5K8MA 4NRTA 1RISA 5L3FA 2HU9A 5GTIC 4UB6C 3FISA 2DPDA 3N28A 3H0GJ 4U95A 2AV5A 1HOMA 8AT1B 1LW0A 2BW3A 3FXJA 3AFHA 2K9LA 2HKXA 2RAQA 1WNEA 1N6QB 3MWMA 1TWCJ 1T39A 1U25A 5AXLA 3R6SA 4HX7A 4DCOB 3NAUA 3UD4P 5HLFB 2WSEC 3RJPA 3BGRA 2E44A 4M5HA 3M8ZA 1K73T 4KT6A 2GVDA 3CCQS 1PDNC 2KRHA 4FF3A 1RK8A 2EWNA 3GV5B 5HMXA 4OI4A 1EHWA 4OI2A 1S1TB 1Q79A 4QYRA 4Q43A 1T02A 4YB1P 5GPAA 3WTWC 2LEPA 2R2UA 5J1EA 1KDNA 3HPGA 1K0VA 3BJYA 1S1WA 5FGMA 2ZOMA 4XPEA 2X3GA 2HOEA 4IHSA 2Z1DA 1S9EA 2VASA 1UFLA 3ESWB 2KJBA 2V1XA 2JZ5A 1H8AC 4ABZA 4OX6A 4NXMF 2LP0A 2QSWA 3PQKA 2AQFA 4OAYA 4F92B 1ETYA 3CDLA 1SD4A 2RILA 1H98A 4A8FA 2EFGA 2LLKA 1JB0C 3TQEA 1KKHA 2ZD1A 2M3AA 2D1HA 1YBAA 3U7JA 1FX2A 2E9ZA 5L1JA 4DR7F 1XNRJ 1JI8A 3FK7A 5EGOA 1NBEB 4DDFA 3T6BA 3HCXA 2M34A 3J7ZI 3PL8A 1FBQA 1I94J 2FJEB 1YIOA 2M88A 1A35A 1YJUA 4OYIA 5AXKA 2ZE2A 1S0MA 4OZNA 4J9VA 1TL5A 2HHVA 2MLZA 2LBFB 2E1CA 5FROA 4ATNA 2DHXA 3FCWA 1P9YA 3D67A 2WB1N 2YXLA 4DOZA 5K5QA 1EETB 2WCXA 3KHGA 3G8SA 1MBHA 2H9ZA 2N82B 4M3DA 1OPIA 3G71I 2DMUA 3I4MJ 2G4BA 2DR7A 5TJJA 2VLAA 4P2FA 1Z6RA 5I3QA 3VAGA 2G2ZA 4Y2MA 3Q2TC 1JKHA 1UPMB 3SFUA 2QRRA 2MQLA 3LQRA 3KYLA 1LVAA 1VHIA 1Y4ZB 4B9MA 3DLBA 3HOYJ 2EFVA 3U02A 3BKUA 3PEJA 3SHFA 5AIQA 3BGLA 2XG8A 1WRJA 1DP3A 1KONA 3IWZA 1C1CA 3TA2A 4P73A 3CC7I 4KH1B 3QO9B 2IA2A 1XGMA 1PJ6A 1LDDA 2AJ2A 4LB5A 1T98A 3FF5A 2GW8A 3KP6A 4RPFA 3BR0A 2J6SA 4X4VA 4I2QB 2ECBA 3FDSA 2U2FA 3MD1A 4NEYA 2WV0A 1VLYA 4LF9J 5ERIA 3G2BA 4XN3A 3MKLA 2VFRA 3MEKA 3OBIA 4CGZA 2XMVA 4R8UA 3QOPA 1SBRA 3S1QJ 1VOMA 2YX4A 2L3MA 4HI2A 2R7WA 3OHAA 2RGVA 2Z56B 3VAIA 1O3QA 5HROA 1VQMS 2W7OA 1QQIA 2R0QC 3UPFA 4ZN3A 1U2WA 2D45A 2LA4A 2OPPB 2RMLA 3HB9A 3W2WA 2Y9ZA 2Z9OA 3PYEA 5KT3A 4J90A 4U9RA 3I9V9 5GAHI 1HW2A 1W36D 5HVQC 4TVAB 4BC7A 1APLC 2QQ8A 3TGNA 2ADUA 2VKHA 2I10A 2BJ3A 5EF6A 1R0AB 4FN5A 4HL9A 2D3ZA 4GDFA 5E1WA 2IPQX 2HQNA 1LFWA 2O3DA 5CQGA 3FXUA 5BQTA 2EBGA 3MMJA 2X6WA 4L9VA 3GFIA 4F55A 1FVQA 4DUYF 2RHQB 4I6WA 2IMOA 4NYOA 3FM3A 1WGXA 1K79A 1XMKA 3DPLC 4FNHA 2XYGB 3H5AA 4D3GA 3DOLB 4XRSG 2IJFA 2VZ9A 2HVDA 1D1CA 1UL3A 4DV2J 2DAOA 4A6EA 4ENOA 2KM8C 2OF7A 4ZVSB 4FF2A 1OQYA 2NVUB 3UN3A 2ZBPA 4JI3J 3SEOA 3N79A 4XK4A 3KLGB 4DV5F 2GMLA 1MBFA 2M2EA 1IRGA 1WC5A 2EINH 2D5VA 1USTA 1YRTA 3HKZD 2Y69H 4RWXA 2XY5A 1XMAA 5HMWA 3DV8A 1U5TB 4WKYA 3TQNA 1HWLA 1B0VA 1AT1B 1JTXA 2XLJA 4LFCJ 1MWQA 4I67A 5SUHA 3AB2B 2DR6A 3TQ1A 1G3TA 4N8NA 2KZGA 5GAHJ 3FDYA 1LFPA 3FFIA 2HHPA 1XX5A 4M5DB 4A8OA 2VQGA 1U1OA 4EBCA 4PGGA 4LIRA 1KVKA 3N5FA 4OHVA 3GYGA 1Z77A 1BQXA 3N01A 2CQGA 2HMIB 2WC2A 3BSCA 1U0SA 1DTTB 1GUUA 1RT1B 4DR4J 1JUPA 2H5JB 1T05B 1BC8C 3GFJA 4XSXF 2EK1A 1UP1A 5BJRA 1SH3A 2B56A 4OHZA 4CCKA 1GVJA 4FISA 3SDBA 3E8OA 4ANDA 3LWFA 1SJ4P 4K4ZA 3EGNA 3HEFA 1NK2P 5LMUJ 1AWCA 4FBUA 2C2EA 4BE1A 3LA7A 2DRBA 4OJHA 1CJTB 2ROGA 3KETA 1X2MA 2KYZA 3VR1A 2QLZA 1LWEA 2FA5A 1WACA 3VAHA 1P9QC 3JTPA 4PJLA 2C42A 5LSRA 4CZCA 3IG1B 3HLUA 2HLUA 4MQ9F 2L5QA 5DO2A 3AG1H 2EWHA 1PGZA 4DFPA 1N78A 3Q8QB 3ET6A 3D4JA 4WXWA 3NCQA 4NX9A 5IOYA 4Q0BB 2MSYA 3T1AA 1U1MA 2RKIB 1S1XA 3UDCA 1IDZA 3HJFA 2XSFA 4PQUB 3PUBA 3RSNA 3E1SA 3I31A 1B4AA 2Z8QA 1KTVA 1XK8A 4ILRA 1OCPA 4OHXA 2C3UA 3R7SB 3X3UA 1XC9A 2R4FA 2AZ3A 4QJVA 1XERA 2V6EA 4N56A 3ONQA 2VPZB 1JLGB 1T03A 2EC0A 5IQ6A 3VSLA 2RSQA 4NZ6A 1WSVA 2LEBA 2D2WA 2PMZN 5IFMA 2L54A 3MMCA 1A31A 3CC4S 2KPMA 2V7FA 4GVLA 1R71A 1C2PA 3CLQA 1KU2A 5C42A 2CV1A 2HYFA 1CEZA 2CVIA 2GQ2A 2R2RA 1Z0XA 3MFIA 4A48A 3MZYA 1EKRA 3LSRA 1IBLF 2HOAA 5U47A 3EDQB 3US5A 4CLPA 5DDOC 5F04A 1AA7A 3TAQA 5B0BA 2K3IA 4A6DA 3ZR8X 5DZ7A 5THWA 3J7Z5 4OU0A 3DEEA 2ZXWH 2FX0A 4NQWB 2O3FA 2UWMA 4C4WA 4B02A 1RWXB 1V4RA 4ZYEA 2D3UA 1AW0A 1WI9A 1FNOA 3MCZA 3MZIA 4U0VA 3QRPA 4CM0A 1FT8A 2K7LA 5D4OA 2VG5A 2DK2A 4N0BA 4OX9F 3CE8A 2V2QA 1SJRA 3A8IA 2VFTA 2FJDB 1YZ6A 4DSIA 3IWLA 5F8HA 1NDKA 4Y0FA 2U1AA 2XGXA 2CNKB 1MBEA 2ME0A 2OPTA 2DGQA 2R3SA 3HD1A 1MBJA 1FXLA 1TK0A 1Y5NB 1W7PD 5JR3A 3FHNA 3DLEB 5E17F 3HVTA 1NK8A 3T9ZA 3TA0A 3CCLI 4LFBJ 4HTIA 4USUA 5CVVA 2JSPA 3Q8UA 2RUSA 2LDUA 4BWMA 4KE5A 4LF7F 2EIJH 2WW8A 3KLEB 1Z05A 1JLBB 4XPCA 2VJ5A 3OYCA 1B1BA 3E97A 1N5YA 1QHGA 2M87A 1YJ9S 3KX2A 3TJ9A 1T6SA 3T1HJ 2OPSA 4IX7A 3OL9A 1XDUA 3MQ0A 1SIZA 3HF5A 3N6LA 3KP4A 4USKA 2IC3B 5LXYA 4GKKJ 3SV4A 3MR5A 2QKLB 1WF1A 3B4MA 3UI3A 4DV1F 3AD8C 1RACB 3TW0A 3QRRA 1S77D 5FO5A 3DMJB 5A0YB 2OTJS 4BS2A 3FKBA 5GAHU 5KFQA 2CJKA 3HSGA 5M2RA 2CUEA 2ZMEA 1PP8F 3NGKA 5BR8F 2HBZB 3CZ6A 1WHWA 4XTTA 1IUJA 4E7JA 4C11B 2KFYA 1ZTRA 1RT2B 1K4SA 1FY7A 1HL6A 3U1LA 3M4OJ 3DOMA 3GTLJ 4WIQA 2VPRA 1S0VA 3PX6A 1S72S 3F56A 2CVEA 3OR1A 2HR3A 1WKJA 3HVAA 2CPJA 5B0EA 4ED3A 2P5VA 1ZOTA 2IMWP 2OQRA 3LP1A 3BQYA 1ZRCA 3EVOA 3RB3A 1U0JA 3REOA 4OZLA 9RUBA 1ERDA 2VQHA 1D0XA 4JX6A 2HKEA 5IOLA 2H65B 2CQKA 3CCVI 3CTAA 3SDGA 4NLSA 1TQPA 2M52A 1BI2A 2WONB 3JRIA 4DV6J 1B7YB 3IAM9 4C97A 1L3LA 2JRMA 3BH6B 3HHLB 1TWAJ 4RUAA 5C3EJ 2PMZA 3NRVA 5IP7J 4NLOA 4OV1A 2JVRA 3W60A 2HOTA 1QDUB 3K7AJ 5ICCA 4IZZA 4DV0F 4USMA 5E5NA 3GSIA 2AEMA 3DXSX 2XYHB 2MQPA 2WTEA 2VA2A 4LGWA 1JUMA 2V67A 3GVAA 3K4MA 2YNHB 3CJ2A 5HLFA 3HGYA 2NNNA 1GXTA 3I54A 3KK2B 4QW9A 3E5XA 1PYVA 5D5UB 4I6ZA 2I9SA 2HAIA 2YBVA 4UUSB 4AM3A 2HVEA 3HVWA 1B7FA 1S1TA 4DV3J 2YKPA 1RLDA 2KJWA 5EGYA 2CPZA 4I09A 2KXFA 3MCSA 2HXOA 2HEOA 1RT5B 3WIUA 1I39A 2PMHA 1X4HA 1U8SA 5HBMB 3CJ3A 3U1DA 2JRTA 3QYBA 2Q79A 4JI1F 3VEPA 4M5IA 1R8AA 1RETA 1VNDA 1QSYA 2XB5A 2KISA 2E66A 1G1XA 1T0TV 5CVJA 1JKQC 2QM3A 3PW5A 2DFIA 1JUSA 3S3MA 1TBXA 3VYRB 2BE9B 2J6TA 1H38A 5IS2A 1HKTA 2CZ4A 2DGTA 1FP2A 2VFUA 2K3PA 2L7FP 1P27B 4ZVQB 1BJZA 4RAYA 4ED2A 4GMKA 1GMUA 5GADI 3KEYA 4OHYA 2B4UA 3ZQGA 5CJ9A 2L4MA 2JEIA 2DA3A 1WHYA 4WPAA 3ILOA 2M8EA 3MUMP 3H35A 3NWTA 3GTMJ 2IJLA 3R60A 4NXNF 3NBPB 1J7KA 4BY1J 3W62A 1EETA 3KP2A 3PSFA 3CDEA 2GA2A 4F0MA 2VB6A 2E2JJ 5IWAF 4NLTA 4KFCA 4LLGF 3G6ES 2POKA 2OUGA 4ECWA 2CJBA 4HDGA 3IAS9 5H6RA 4E7HA 2KIUA 2YKMB 3H90A 1YBTA 5HP1A 1NHUA 3Q89A 2HVRA 3NAIA 1M90T 4JI0J 4A0XA 1D8ZA 2LD5A 2BJEA 3JYTA 2DA1A 3CCSI 4OYWA 1SJFA 1IW7F 4MIBA 3PCOB 5LEKA 2DB1A 1O3SA 4KO0A 4FXWA 2ZEJA 5BXIA 1S4FA 4J9OA 2F8HA 4KITB 3G73A 3EM1A 1U6BA 4PYAA 2BM1A 1XNQF 3JSPA 5M3FJ 3MMAB 5FKMA 3GYHX 3WQPA 2LH9A 3RTRA 2EZLA 3PHTA 3QT6A 3K5LA 1PAEX 4EZ6A 2FZGB 5L3BA 1FOWA 4PGHA 2O8XA 2QFIA 4B44A 3QRFF 2IRUA 1ZS6A 1B9MA 3HHDA 3M1VA 4P1WA 2GBYA 1OJ4A 4CTAA 5B0CA 5HVHA 3BOQA 1VRQC 4IYQA 2E1MB 2V9PA 4A93J 3RAMA 4CNZA 3ZMTA 5F8NA 1WKMA 1JKOC 1X5PA 4ZITA 1XDSA 1KLMB 3F8BA 1EQ0A 2BBEA 1XG1A 2F5VA 2HZDA 4ZDNA 4DR3J 4M74A 4YFXF 4ANCA 1F60B 4KGKA 1FCAA 3QATA 1BC7C 1URRA 2ABYA 1FMWA 3G96A 5JVGQ 2C6YA 2Y2ZA 5EG0A 4U7DA 3M8PB 2FVPA 1T9TA 2JLGA 1G2HA 1UZDA 3H5XA 1TWFJ 2QCOA 3SSSA 3LNQA 3VYTB 4BQNA 3VAFA 3MCMA 1ZM3A 4KTQA 3VVUA 2VPLA 2EKYA 2R7QA 3ZMVA 3UN2A 3ZZYA 4B17A 3GLLA 3BPSP 2CU7A 3BGOP 3P9IA 1RTIB 2A2CA 1NRKA 2R5ZB 2O8KA 3DU5A 3J7YI 4JI5J 2XUBA 4M6VA 4ITVA 2AZ1A 3HKWA 3HSEA 3OUYB 3SXYA 4HKQA 4UVAA 2Z2ZA 3DOLA 5LM7E 2CUFA 1CC8A 3BR6A 3C6TB 4CWBA 3SZPA 3LSHA 4RU9A 4V1Ak 3I71A 4AFFA 4AD9A 4B3TF 3HRSA 3Q9SA 2EKNA 4YFKF 1R9TJ 3KLGA 5D5XB 3HOTA 3H98A 4Y2KA 2F4VJ 3IL2A 4NASA 3CUQB 4IPAA 2KFDA 3G82B 2ZH4A 3K0JA 2NPIA 4IOBA 4ZLJA 3QT5A 3OJSA 3CMES 4KUMA 4KSEB 3RBZA 3M2RB 3BTCA 2DFEA 4DG1B 2JMWA 4DL4A 1N33F 2WSFC 4EWTA 4RU2A 2E5LF 1IJEB 1R7IA 4NCAA 2QLBB 2DODA 1Y0UA 3H4BA 1J2VA 5B0FA 1FOXA 2AEJA 5HDGA 2GNKA 4ZK7M 1U0HA 3LAJA 4A3EJ 2QT7A 3D2WA 5EWEA 4O3SA 3IP4B 1PUEE 3KLNA 1RWVB 2ID6A 4MKBA 1LJ9A 3MPUB 3GIJA 4KGXB 3I4NJ 4OZ3A 3K59A 2KDZA 3IO1A 3D1OA 5LEJA 4IKAA 5D77A 4ZZLA 4F0HA 3CPWR 1TUVA 2I6WA 3TZYA 2ATCB 2CQCA 1D9DA 3J7ZT 1WUUA 1UCRA 2OPQB 1RPWA 1RT1A 2MQ8A 3ELKA 3MR6A 3CF5F 2XS5A 4LMYA 1KOHA 3O6BB 2IRXA 1X1PA 1VJWA 3SYTA 2E5JA 3AD9C 2VICA 2GHPA 1FKPB 2COLA 3CJQA 4JV2A 3DFGA 1NJIT 3MM5B 5F9LA 4XRMA 3M1EA 2X0LA 2MTLA 1PYOB 1RR8C 2ZMEC 1HPZB 1HFEL 4J19A 1UJ6A 1S0NA 1YRUA 4ID8A 5FKKA 2J7UA 1TKTB 2HYIB 3VFZA 4AL5A 2OPRA 5J1NA 1Y8RB 3LPYA 3SZGA 1EH6A 3IG1A 1QZYA 5DETA 3WX8A 1Y7PA 1KVIA 3JW4A 2MY8A 2M7AA 4QWQA 3OR1C 3KP7A 3JRBA 2C2MB 2ZM6J 4Q0BA 1VQPS 3F21A 1PILA 4U7UD 1TNSA 4CCMA 5J4YA 3WODF 5CYQB 1VBYA 4ED7A 2F7VA 4PG4A 3QLHB 2DCLA 1M1KT 2QEXI 2MJUA 4WFBQ 1BR4A 2IGMA 1CSJA 3GIKA 4ELTA 3GW2A 4HSTA 3VVTA 1E3OC 5ETTA 2VFVA 3HXMA 2UUBF 2FXAA 5IM0A 3NMAA 3MECB 4M71A 3OYLA 1RA6A 3KJQB 3K2AA 2GO9A 2DPJA 3GZ5A 2WZ1A 3MXHP 1B72B 1EB0A 2Z5UA 4CLWA 1S1UB 2FBHA 1O5JA 1MNDA 2VBYA 5D5VB 2NQPA 3C3LA 5B08A 2CQDA 1MD0A 3OOUA 3LSGA 2M30A 5CABA 4BHCA 4U87A 1E2XA 4C9YA 2GS8A 1EAYC 1F3VA 4N9HA 3RBDA 2LC2A 2CQ1A 2Z4PA 3EZOA 3L9ZA 3I5BA 4RW7B 4CA0A 3PO3J 4P9UA 2BGCA 3AXMA 3EXYA 2ELKA 1GNKA 4OYAA 1WELA 2L9RA 1CG2A 4ENJA 2I5JB 4KPYA 1C0TB 3LGMA 3D0SA 1N4LA 4DV7F 2VQLA 1E6VA 3FGVA 1RHUB 3PFOA 4BJ5C 4F26A 4WK1A 1WC4A 1IRXA 1MMSA 1TL1A 3SYZA 2LXFA 2YQ0A 3DXBA 2HHQA 2XMWA 2ZJPQ 3JSYA 1WD6A 4DUZF 2DLLA 1FLIA 1GH8A 3JS9A 3OR2A 4GKJJ 2UUCF 1VQPI 4FBTA 2UUAF 4M9XA 1I3QJ 3CCTA 2KL8A 3CCJS 3D6TB 4OMZA 3CCRI 1KS2A 2N4DA 3ZQIA 1RYSA 2A6EF 4IH7A 4EMSA 4ZPAA 3UR3C 1S57A 2OBPA 3WTUC 2TCTA 5BYSA 1I1GA 3CMMA 2HW3A 4CH1A 2KHDA 3FMBA 3AT1B 4MK8A 3DCFA 1ZH5A 1YO5C 1U47A 1CGPA 1JJ6C 4I2OA 2QTWA 4ELUA 3ADAC 2IC3A 2CADA 1B8IB 1Y1VJ 4H4KA 2CGPA 1S6UA 1RT4B 5E18F 1SC3B 3AKZA 5L8RC 3FX3A 2HNYB 3JB9k 5FFXA 3PJXA 1ORKA 3JSOA 2DR8A 1M5OC 2FTRA 1QVGR 1SANA 2YWEA 4YB5A 5LJ3Y 4HG2A 4PZVA 2FVSA 3SMZA 3NG8A 4B8XA 4LVNP 2VJUA 3GV7B 4C11A 1PJRA 4WZQA 2OLWA 2ISYA 2F5GA 4GFBA 4BACA 4FE4A 2RDJA 2B9XA 3DWLE 5KVRA 4QIVA 3A02A 2BJ9A 4IQJA 1EV7A 2ZVIA 3FVYA 5DUIA 1ZRDA 3PX4A 2VA3A 1V6HA 3M8WA 5C2CA 3J7YU 3G4SS 2HGMA 2ADBA 2GX8A 3MOZA 2DNQA 2AJ4A 2YY3A 4DNCA 3HFVA 2IRFG 3KHRA 5K5MA 5E7OB 2A3JA 3GMEA 2PQ8A 5CYMA 1T11A 4M9SA 1IAWA 4IR9A 2AJ1A 4I6AA 2DA6A 4WFZA 2BRKA 3TAMB 2ZH1A 1IO2A 3EJMA 3BG5A 2ZB9A 3BJOA 4CT8A 3QQCD 4AXJA 2L9SA 2KKOA 4CYCB 2GM4A 1OJLA 1S1VB 3G8QA 3MUTP 3QJJA 2OEJA 2VV5A 3LWLA 4U8VA 2WONA 4KHPJ 2EIKH 2FLNA 1FYKA 3T19A 5DUKA 4DS5A 3HHLA 2NS7A 2JH3A 4P2MA 4X62J 1PVEA 3DYAB 2FHJD 2HNZB 4M9ZA 2RF2A 1VQLI 1LVKA 1UJ4A 5A8WA 4B9SA 5HDKA 3M32B 3LQVA 3QU6A 2B9SA 3NOGA 5D8HB 3NARA 1VQ7S 1FE0A 2YNHA 4YIIA 2E1RA 3EUKL 1B70B 2VPWB 2XMUA 3KK2A 3GFZA 4HEA9 4P9SA 5K8PA 1H6KX 2R93J 4BE0A 3U1NA 3H0DA 2XYPB 1SAXA 3MN2A 3QAUA 4UQGA 2MGZB 4UUSA 4YIRX 3BPVA 2FUG9 1YKWA 1D0YA 4D1QA 1SXLA 3EQLF 2KG1A 2ZJQQ 1U9NA 1C0UB 3N4WA 3DTKA 4ZCLA 4H4OB 4J5OA 5IC6B 2WAQN 3HM9A 4C2MA 1RT5A 1SKSA 4PCQA 4KJIA 3DC2A 4U88A 3JSMB 2DCEA 5ITHA 3W1YC 2HVZA 4QR1A 4NBQA 2BV6A 1W4MA 2H8RA 2ZZTA 1U1KA 1ZGJA 2HFZA 1WWXA 1OWXA 3KNGA 4WTYA 2MMYA 2Y0SN 5FDLA 1GDTA 5LHHA 3FBNB 4RW8B 2K9MA 2DPUA 1R6VA 4ER8A 3JRGA 2GCFA 4UHTA 1S8NA 1N88A 2HXIA 3OYAA 2XMTA 3AY0A 2DGUA 2XSDC 1HR0J 2XLKA 3R0AA 4AL6A 1UEVA 3PW4A 3OYNA 4YDDB 1TLHB 2M4MA 3HSFA 3AQPA 1VIXA 2BE2B 3AG4H 4NA3A 3RZAA 1RZ4A 2NXJA 1BWEA 2R7FA 2V2VA 4BBYA 2DJWA 2ZC4A 4YFUA 3O8HA 1BI3A 3T41A 4CLUA 5DM7F 3RZOJ 4TLRA 1V5EA 5HQ8A 3CLOA 1V5GA 3NBPA 2NOGA 1FRXA 2M0MA 4ECSA 2COBA 4O44B 2FE3A 3QIPB 2F8MA 1QA6A 3AG3H 2AYBA 1PO6A 1T33A 1U09A 4RUCA 2M4GA 5D0HA 1VI0A 1T08B 4KFBB 3OLBA 1REVB 4MT1A 2RT3A 5IT9Y 4ZVUB 1WHVA 2YKMA 4KAIA 1IR2A 3KMSA 3G1LA 3K5OA 3JTOA 3TP3A 2J76E 4ENNA 1DQ9A 3R3TA 4CQ1A 1X9MA 3FXQA 2DMQA 2DNPA 2M5YA 5EN1A 2B51A 4P7VA 2P5KA 5AIPA 3S2DJ 1FO1A 2PO4A 1J75A 2KDOA 5EX3A 5FLXZ 1TWGJ 1ITYA 5FJ8J 1YW7A 1I94F 3MMAA 4OYBA 2R9LA 1KBRA 2GIRA 2BZ2A 2DEJA 2KTQA 1NHKL 2R8IA 3ILIA 1Z7UA 2VJJA 2A2DA 3V81B 2K9NA 3CMYA 3HTSB 3G6YA 1MIJA 4LSLA 4A3DJ 2WAFA 3LAMA 2EV5A 4IRDA 2A07F 1RAEB 1AFJA 1FTRA 3E6MA 3ERMA 2R92J 3KFWX 4QPQA 3W64A 3OVSA 1GFWB 4DPTA 4EU0A 1FD8A 4RW9A 5KFMA 5EZHA 1Q7YT 2P2CB 4HPQA 2XVCA 4UY8I 4DCJB 2BOPA 5J2PB 1RT7A 1H89C 1JXVA 1NKBA 4XICA 4X4OA 1IR1A 2HZVA 4HH1A 2BXYA 4BLGA 3IR7B 4W98A 2H1YA 3L9FA 3DDNA 1TZLA 1HIYA 3S01A 2H4YB 4DQ2A 3IR6B 2MYSA 2DMTA 3R5CA 3MPYA 3T9NA 2PFBA 3S8SA 5K8NA 2TRTA 1UKUA 3K57A 4NI2B 2UU9J 2BUNA 5F41A 2J8AA 2ROEA 2UXXA 1HBXG 1KYWA 1ULYA 4LF9F 2NYHA 5L3CA 3DRRB 1RTIA 5MLCV 2R5ZA 3D3BJ 4ITSA 4KIGA 3DNCA 1ZPWX 4YP3A 1YITI 3LAPA 4YRVA 1SEUA 2F4IA 4XLCA 2KKHA 4HNUA 2Z2YB 3CB4A 1RGVA 4FYWB 4LF2A 4I6YA 1FC3A 1WVRA 3K4NA 3K5MA 1EH8A 1I5OB 1FK9B 2DXDA 2O6GE 2ESNA 2XLIA 5LGTA 2AW0A 2OMOA 2M7SA 2E36A 2Y0SA 3OR2C 2M1BA 1X4EA 2LP4A 3BPDA 3CUQA 4PJNA 4EYHB 1UEKA 3HJEA 3GR1A 5H9EJ 3BZKA 3M2RA 2BRLA 3QIDA