1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN HP0162
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
3HPGA 1K6YA 3HPHA 1LFPA 1WJCA 4F3QA 1WJDA 3F9KA 1MW7A 1WJFA 1WJBA 1WJAA 1WJEA 1E0EA 1KONA
chains in the Genus database with same CATH superfamily
1ZAOA 1F43A 2BXYA 4ZVEA 2RT3A 2G0CA 2Z99A 4Y65A 2XHCA 2BOPA 3FISA 1O4XA 3CP8A 2WRMA 3MFKA 1W7PA 2C2ZB 3MOJB 2XBPA 4ZYEA 3HD1A 2MDAA 3HDSA 2RE1A 4I2QB 2BKOA 4OV6A 3RZOJ 4UXNA 3EUHA 4NL5A 3T5HA 4EZ6A 5K1YA 3DLGB 3MPDA 4BE2A 2O1PA 4ZIVA 3ZRGA 2L0KA 2YS9A 4M9SA 4J9PA 3UNYA 5L9NA 1YGYA 1HI0P 4AL6A 2DPIA 2KL8A 3PEJA 1HLVA 1RZ4A 1XMOJ 2XS2A 3UD5A 3BEGB 1HQUB 2ZXJA 2HIQA 4DV6J 3E5UA 3FRZA 3ILJA 3B73A 2X4HA 1C0WA 4QYRA 3ADAC 2LSOA 2AYGA 2Y1RI 3KG4A 4Q2LA 3I5BA 3S3NA 5LJ3Y 2UU9J 1TFWA 2IS1A 1S7OA 3FK7A 2OPQA 5K5RA 1RXOB 2HYJA 3I5AA 2JC0A 1U0JA 1TUVA 4LFCF 4C8MA 2ZVSA 1DTQA 4ZP6A 2OUMA 1JKPC 4NEYA 3LFKA 3MVPA 1Q7LB 4ED4A 5L3EA 4O3QA 1IR2A 4B9TA 2FE3A 4F4ZA 3IAS9 3ITHB 1S7EA 2GV1A 4A0YA 2Z4PA 3CCRS 4QR1A 3W7BA 4F4YA 4G3IA 4MEXF 5DQGA 2XHWA 2Y30A 3HPGA 3I96A 4QIWN 2IMWP 3N5FA 4PYDA 1F4KA 2F9JA 3B6CA 1K4TA 2AJ0A 2F5FA 3TEHB 4GKJF 1OQ3A 3I4NJ 2BJ9A 1FDBA 4M5NA 1B4SA 3LWMA 1WHVA 2MFZA 5DV5A 1SJRA 3C2HA 2I8EA 3K4CA 2W9BB 3Q0UA 4FCYA 3BOQA 4P2FA 2JEIA 1P4XA 2XLJA 4M95A 1X4PA 4BY7J 2QJ3A 3MI7X 3RYPA 1P1LA 2HWHA 2DK5A 2E29A 4K5RA 3VOEA 2D45A 3V81B 1PBAA 2OPPA 3JYTA 1X9MA 1IQTA 3LWFA 2X51A 4M5DB 3PYFA 1LK5A 3VPRA 4ZITA 4B17A 2ZH7A 2F2EA 2RQMA 3BG7A 1V3FA 2XF7A 1WJ5A 1OY9A 2DOEA 3GFYA 2D69A 2Y69H 2OPQB 2B3TB 2FLPA 1B99A 3O3KA 4YUDA 4ED2A 5D3GA 3PM9A 4WFYA 4CO1A 3RCOA 4M5HA 3MUMP 3T8TA 3QNWB 5CZXA 2FQQB 2DA4A 4OI0A 2CPHA 3RBXA 1N8RT 2FEZA 3VAJA 3SCIE 2Q1LA 2M70A 3TUPA 2V9VA 4U67Q 2U2FA 1F5BA 1SVMA 3I3LA 1SH2A 1IO2A 3K5LA 3DLLF 3R5BA 1PO6A 4UVBA 4DV3F 4QIFA 2QFJA 2CJJA 4JI8J 2HAFA 3JRBA 4L6V3 2OCEA 4ZYDA 5J1RA 1JJCB 2VE8A 1NKBA 5T14A 4EATA 5C3EJ 3N4WA 1FBUA 1Y0HA 4BGDA 3M05A 2P0WA 3K2YA 2DIUA 1MW7A 4F36A 3KJVA 2M8DB 3FXMA 4OMYA 5H9FJ 1UVLA 1VK8A 4UOGA 1UFLA 2F65A 3ZTRA 1D0EA 3DU6A 1SJFA 1YJWS 1PJ5A 1VHIA 4KNYA 1YJTA 1Q8BA 1KQSR 5CVVA 1G4CA 3CMQA 2W9AA 1B4AA 3D5MA 5D78A 5LMUF 2L9WA 4C7QA 1U8WA 4QPOA 4FX0A 5FFXA 2O03A 3HG9A 3EPIA 4A3LJ 2VV5A 3LSKA 3X2QH 1F0XA 4NYPA 3GFMA 5LRSA 3HD2A 3HOYJ 4BBYA 1N6QB 4NOHA 2WA0A 1HARA 3MECA 3TZWA 3PUBA 4C2TA 3OFHA 2LF8A 2IY5B 1Q0NA 2A68F 1TKXB 2DA5A 2Z58B 2YSRA 3GFJA 4XKWA 4KUMA 1USTA 1TL1B 3JTGA 2MKJA 1R58A 1ZAXA 3VYRB 2FRHA 1W2IA 2HHUA 2OZUA 5K7ZA 2HVRA 2HURA 1QTNB 4DJBA 2STWA 3ZZRA 1LEAA 4LR9A 2V4QA 1FHTA 3CCLS 3Q9VA 2K85A 2R4FA 4B9NA 4FYXB 4HLXA 5KHDA 2UUAF 5C24B 1ZBTA 4LFCJ 3MR5A 2DNZA 2UUTA 3IGVA 2ZBKA 2L7FP 2OCCH 1SBRA 1D1BA 2R92J 3FBFA 2DOFA 3W65A 1SPBP 3MZYA 1XNRF 1D9AA 3M8EA 2MKSA 3GYHX 1FJ7A 5LMNJ 2BANB 3J7ZI 2R7XA 2HFZA 2RAEA 3ZZUA 3MKWB 4M6VA 1PJ6A 4UUTA 1VHFA 1MBEA 4J5OA 1PYOB 2H51B 3GIKA 2X0LA 3CMAI 8RUCA 1ON2A 4RLQA 2VC0A 5DM7F 2ABYA 4NLXA 2KQRA 2Z2YB 2ZBIA 2YKMA 4JX4A 1C2PA 2RIJA 4PWDB 3NGDA 1KQ8A 2WADA 3KK3A 3WTZA 2O8KA 4ZP9A 4X6AJ 3M8QB 4WCEQ 2FJVA 3W8GA 1SANA 3RTVA 3H1CA 4MLOA 2OD4A 2LOOA 2NRAC 1H74A 1OIAA 3Q3SA 3MMBA 4QWEA 1OSDA 1BWEA 3OV8A 2DNNA 2FBIA 2J0XA 3N79A 2VHGA 2LDIA 2P4WA 3ABTA 1NBEB 4QIEA 1S1WB 4FS1A 2PJRB 4CLLA 4A3EJ 3KP3A 5C4XJ 2GIFA 3WTUC 1CSJA 2QMXA 2RUSA 2E5JA 5H6RA 2I5JB 2HEOA 5AJ3F 4B48A 4KAIA 4WWCA 1FXDA 3ZMDA 4II2A 3KUGA 5DG7A 1CVJA 2VKRA 1S79A 4BQNA 1YJ9I 1HKSA 3OR2C 2YKQA 5A0YB 1FVSA 3GB0A 1VIOA 3IWNC 3FKBA 1E0EA 2XGCA 3NWTA 4OI4A 1SUQA 3M1VA 1YWXA 3GILA 5HS9A 4HA8A 2FHJA 3OW2R 2AGPA 4K2EA 3HVWA 2HNYA 3BSCA 3P7NA 3MPVA 2R8JA 2A3SA 2JEJA 3LFUA 4RM2A 4RLFA 3V7RA 2JOQA 4YR2A 4PSWA 2HBRB 5AXLA 4P2XA 2PI4A 4KPYA 4X4PA 2LQ5A 1JLFA 3HPHA 5EX3A 4YR3A 2GAGC 4KO0A 1KFSA 2DYSH 2MHNA 1KQKA 3UFCX 4A8QA 1FX2A 2UP1A 2VONA 3G82A 1BI0A 4RBTA 3M8QA 3U7JA 2I6WA 1HD0A 1SH0A 2FPHX 5FRMA 5ADZA 4P9SA 1QAYA 2G2OA 2DNOA 5KFUA 2YKNB 2RRBA 5ETSA 2BZTA 1RWWB 3VVUA 1T3OA 2HHHJ 2XMMA 2QA4S 4CYDA 2OPRA 3RB3A 3HT0A 1TUGB 2JJ4D 4X4OA 4WIQA 2XGXA 5LLQA 4B43A 2HVZA 1IBMJ 1RU1A 1UFWA 2FGOA 3V6HA 1YITI 4OZ2A 3IAS2 3DPLC 3D6FB 1V55H 3D6HB 2E34A 2YXLA 3CDIA 4OI6A 1G3WA 1OMIA 3BJ6A 1NH3A 1VBXA 1KLNA 5E3RA 1IRGA 4QIGA 3C19A 1J27A 5HANA 3HF5A 3GFZA 2NQPA 5HROA 4N9HA 1WI3A 3HHLC 3PW5A 1FP2A 3KDNA 3DTIA 2G4BA 3SQGA 4FNHA 3D5RC 3RQIA 1H88C 1CS4A 3GONA 4JV5F 4BJTA 5HLGA 3MM5B 4A69C 4LRCA 3B4DA 3DOKB 5HODA 2NUHA 3UR3C 3ZQFA 4DV3J 1TLHB 1FRJA 5JHUA 1CLFA 1MIJA 4YDXA 5KFTA 3R5GA 3OTOJ 3IRQA 1TWAJ 3JRAA 3NMRA 4KO0B 3E5XA 4H4KA 2E44A 1BWVA 4G6TB 2DH7A 2UXDF 2QT7A 3GTOJ 3FFIA 3KFWX 1VQOS 1BMQB 4ZOSA 1VQ5I 4DL3A 2QV6A 3QPLA 2HLUA 1W26A 4KY3A 1JKHB 3BT9A 2O66A 3PO4A 4J9VA 5B08A 4PRFA 3QP5A 1OR7A 1PAUB 2NOGA 2GHWA 3AD8C 2W9CA 3CCUS 5FFZA 2LKZA 2G9WA 4B09A 3WHBA 5KTQA 2W00A 1CC7A 1OS5A 3LP0B 1UW4A 5IT9Z 4AWXB 1B64A 3CUQB 1LE8A 4LLGF 2E7WA 4C0OC 1ZN2A 3LAJA 2Q0OA 1VR6A 2XMVA 3KLVA 1LKXA 1YE9A 2XNQA 2DGQA 5JUMA 4URGA 2RS2A 4OV1A 1NLKL 4RW4B 5IOLA 4ZDPA 5D8KB 3HXLA 2BUNA 4S0MA 3CCMI 1X3UA 1REPC 2VG6B 2LH9A 2FVCA 2CQKA 3VAMA 1DZ5A 1X1BA 2HOSA 2IP2A 4J19A 2Y31A 2ZFUA 3D9BA 2DR9A 2D41A 4YFNF 3T5LA 2ZNYA 3R61A 2CPJA 4A3DJ 4U7CA 2POKA 1EARA 3GLLA 2JA6J 1F60B 2QLBB 4BDYA 4D3GA 3VODA 2FXAA 2ZBPA 3H5SA 2ZBQA 2FUG9 4EM0B 2UU9F 4KHPJ 1RABB 2IRUA 5HOOA 2HW3A 1S1VB 2D3UA 4YELA 3BH7B 5KT6A 3ETOA 2ZMEB 1IKYA 3CJNA 2HWIA 1FE0A 3IH4A 4MIBA 2DH8A 1ULYA 2JRTA 3K57A 2XMWA 1SV5B 2CJBA 4EYHB 1X4BA 1S72I 3NQOA 2OEJA 4KISA 1C1CA 2K3FA 4IRCA 2W82A 3NGKA 4TQRA 4ILRA 2KFNA 2OAZA 1QHHD 1M5PC 2DNGA 3KUEA 4WYWA 4J9UE 2MC4A 3KLNA 3BDPA 4P1WA 2LCWA 4RNNA 2C6YA 1QY7A 3M32A 4JP0A 4KR0B 2V5HG 3FK4A 1RTHB 3CT9A 2PMZA 5B0BA 2IPOB 4I2PA 3LSMA 2VT2A 2IRXA 4O3NA 4DL2A 4OHYA 2K1RB 3V6JA 1MROB 4WF9Q 3HM9A 4II3A 3QGIA 4DZDA 2Q79A 3HSZA 2QG9B 5B5EC 3HOZJ 4EGYA 3HOVJ 4ZCMA 5KK1A 4ETXA 1Y0NA 1NJWA 2AV5A 4HEA2 4EQQA 1RBLA 1QM9A 1UKUA 4DR2F 4Q4ZF 3G2XA 1SQGA 3DXSX 2E7XA 1FP1D 5B66C 1IJFB 4F7VA 2QSGX 2UV8G 4KITB 4RNMA 2MKYA 5M2PA 1HSJA 1UB9A 3JSOA 1IKYB 1AFJA 2R7DA 2L48A 1W1WE 4HSTA 1T3NA 1WHXA 1Z91A 1D8KA 3EUAA 4AYBD 2M1BA 3M30A 1Q8LA 2XB2D 5EEHA 3MMAA 1U7LA 3PIOQ 5AXNA 1XR5A 1E2XA 1N78A 1Z7UA 3ZMSA 2XGPA 4F4AA 4WK3A 2BYVE 1RT3B 4A6EA 2KT2A 4DXLA 3OHAA 3LWLA 2YWFA 1X4OA 5F8IA 4XLFA 3OXFA 1F1ZA 1S6QB 1UJ4A 4B3TJ 4URSA 1TWHJ 3PM1A 2C2KB 1FEHA 2YBVA 4E7ZA 5IT9K 4OZLA 1AW0A 5H20A 3S1RJ 3OVAA 3KZYA 1Z9CA 1JLQB 5KFCA 1VBZA 4X4TA 5CYMA 2DHXA 4BC9A 3ETMA 2QN6B 3MCOA 5HNFA 2XS7A 4RW9A 1MN9A 1R6YA 3NWRA 3AAFA 1R0CB 5L3BA 4HH1A 1SIWB 1U09A 1YJ7A 3HMJG 2OPSA 3QT8A 2LP0A 2N4CA 2BJEA 4M5MA 4CM2A 3CCVI 1S9EB 1HW9A 1MG7A 3H90A 1RU2A 4ZVHA 4O44B 4O3RA 4F7ZA 1O8BA 9ATCB 1VC6A 1I3QJ 1JUMA 1MZBA 4RU9A 3IWXA 3MM8B 1BR2A 2X9DA 1ETYA 2CVEA 4BXXJ 2E71A 4N7TA 5A8WA 4UY8T 3BYPA 1JXVA 1X9WA 3GP9A 1TAQA 1YOVB 2FJ1A 3L9FA 4B3SJ 3H92A 1W25A 2HKEA 2YKOA 2YNFA 4L9JA 2PI5A 5IV3A 3SI8A 4YDDB 2FY1A 3TWZA 2DCUB 5LD2C 4D7MA 1RR7A 3N01A 2Q8KA 1FEEA 1FC3A 2C2EA 1QZYA 4MHGA 2QLWA 4XL9A 4G1PA 4UW2A 4Q43A 4ZCIA 4ZHRA 4G6QA 4B3RF 1TQMA 5FO5A 1U9OA 3IUOA 4FDFA 3LAMA 4YN3B 4LSLB 2XIGA 3QFWA 1RNLA 1IF1A 1EAYC 4IDKB 3NRBA 1Y1VJ 1TP4A 4LQ3A 5CVJA 5HO4A 3LA0A 3QRRA 4NRUA 3O6BB 2YNHA 1T2KA 2EK1A 3CZ6A 1XPXA 4RW9B 2VF3A 4ID5A 1RQ0A 4OI2A 2M5WA 2YWWA 4RW8A 2FBHA 3MPYA 3KEYA 2HKOA 2VASA 4HL9A 5LSRA 4FF3A 1UPPA 1D0ZA 3DRXA 3KCCA 1OWXA 1WRJA 5AXMA 4ED6A 2QLJB 3Q5FA 1X31C 2P9EA 3AL0B 4JP8A 4ZPVR 1ZGJA 2CZVC 2RRAA 4A3BJ 3IRRA 3DDNA 5ETRA 2ZKTA 1S49A 4C8YA 4HHHA 3R0JA 4RNFA 2ZH6A 1NH7A 2F4IA 2ASLA 3ZQGA 2V34A 1U0HA 3SXLA 1J09A 4HAMA 2BA9A 4FXWA 4B3TF 4XBFA 3DGVA 3BZ6A 5K20B 4R5PA 3IBWA 2HNHA 4BL0B 4CLUA 4AVPA 1OPCA 3ABUA 4HACB 4NMXA 4BCAA 3LQVA 4G12A 2AXLA 5FJ4A 4ZVFA 1RTJB 5D8LB 5F8NA 2RVJA 4I1TA 5ETOA 1JQGA 1KOHA 3FM5A 5ED4A 2Q3PA 5AT1B 3WTXC 3DRYA 4DR4F 2Z2ZA 2CNNB 1ZM4A 3EE3A 3DLLQ 3M9AA 1RHMB 4HI2A 2GMHA 5DM6F 5KFBA 2X6YA 3C8YA 4MEYF 1N5TA 3LA3A 2WSCC 4UOFA 5GP9A 4E7SA 1S6LA 5ETVA 1Q5YA 2QSFA 1R6VA 2BEFA 2XWYA 4F4KA 1L3TA 2ZFWA 2FHOB 1T8IA 4CCMA 2XUBA 5HQLA 4CO5A 4U0WA 2WY7Q 1WI6A 4C3JJ 2XAFA 2VQFF 4ECZA 3E8OA 4IH5A 4ZJQA 5JHFA 2EWHA 3IRWP 1RYSA 4ZVPB 3QP6A 5FKLA 1T03A 2DFEA 2DKOB 4BLGA 2XC9A 2HKXA 1M0SA 5LGUA 1NK9A 2XHKA 3HK2A 4M5DA 1I51B 3AXMA 4A47A 4CYUB 4IOCF 3HJVA 3GF2A 4XICA 3C15B 1FSHA 2UZKA 3ZTQA 5CZVA 1TK5A 1GX6A 2XROA 1ZAWA 3G1OA 4X66F 1S6OA 1N25A 2AXTC 1GTHA 2KG0A 2GHPA 2D74B 1QAXA 3NWGA 3HOTA 3ZPLA 4AD9A 2YWKA 3M6XA 4NQWA 1S4EA 4XLAA 1YJ9S 3F8FA 2BRKA 1HNVB 3HUGA 2VQLA 1OCCH 3FZ2A 3QIDA 3LPEA 4UT4A 3VQSA 5H9EJ 3W63A 4BY1J 1VRTB 3PTWA 3EGWB 4EGLA 2A2CA 3AG2H 1GMWA 4ID8A 2N7YA 4FXDA 5BYSA 2V8GA 2KU7A 2HFSA 1XB4A 4MFBA 5F9NA 4KT5C 3RAXA 1JXSA 2JUCA 2N8GA 3M8YA 3OTCA 3BR3A 1NJZA 1HBUA 2OQRA 1NSKL 2VKVA 3MEDA 3GZ5A 4ON0A 4X62J 3IR7B 2M5YA 1QPMA 1OCZH 4B1RA 1HHSA 3K59A 3A8IA 3MTJA 3REOA 2MYSA 3MHYA 4PJLA 1UAAA 1EX8A 3QT5A 3NY0A 3JQMA 3A1YA 3NOGA 1PUFB 4XTTA 3D67A 4JI1J 1TAUA 1FKPA 2X1EA 1KYZA 2D1CA 5MLCV 2GIZA 3RZAA 4USHA 3DPTA 1HQUA 3OSNA 3EJMA 1NB2A 4CYUA 2WAQA 4LFUA 3SIPB 1O3SA 4ZTFA 3VCDA 3EUHC 5TJJA 4A3MJ 4UY8I 2QTWA 3P6YC 5F1JA 4K50A 2I1RA 1RT1A 3FCHA 1RETA 4RJVA 2AQEA 5ILSA 5IPAA 4PG7A 3MR3A 2HHVA 1TL7A 3G1MA 3K0LA 2NVTJ 2VJ5A 2ADBA 2HBYB 2W4SA 1A36A 1YG0A 1BW6A 3S1MJ 1X19A 5K5QA 2Y0SA 4RAYA 4DL0C 1Z2LA 2MLGA 1K6YA 4G9YA 3LW5C 2HFOA 3DNCA 5HQMA 2Q43A 2DFHA 1ZPWX 4RPFA 3DOMA 1NH8A 2GA2A 1RDRA 1T9VA 4Q0BA 2HI3A 1OYWA 4LMYA 4FN5A 4PFOA 3Q8SB 4U95A 3B6BA 1Z77A 1WJAA 4V19X 2NAZA 3BO3A 3T5KA 2CQXA 1S1TB 3KJQB 2ZUGA 1HBNA 3VWBA 3JW4A 4MKYA 4OI3A 3MR6A 4YIIA 3M07A 1HQEA 3I5UA 3BREA 5KFAA 3DRPA 2V26A 1FMVA 4XPEA 1Z1DA 2FMLA 3M8JA 4RWXA 4P5OA 4ZCLA 3TUZC 5DTDA 2GLOA 1AWCA 4DZJA 4DHVA 1URRA 2YX7A 4LFBF 2R7QA 3A4CA 5LFAA 3F8CA 2FHJD 2XMAA 1SEUA 3GYGA 3OL7A 4DV4J 2ZC4A 4E2FB 1RI7A 2KT0A 4RU2A 3M6UA 2ZH1A 2JHEA 4F26A 2KHMA 4PCQA 1HWUA 4A8SA 5J2NB 1B9MA 2CQ1A 2CWEA 3EXCX 2MKKA 2B4PA 2DGSA 4CO2A 1KYWA 4YIRX 4RR5A 3W66A 3ENAA 4DR2J 2EJRA 2QO3A 5KCMA 2CDQA 2KFZA 1TTHB 1CJUA 1Q1KA 2VJIA 2QA1A 3CC4I 1GTEA 3UDEA 2CFOA 3UWTA 1HYSA 4IHWA 2M8EA 4Q8FA 2V8PA 2DXDA 1XJWB 4XLHA 5J3LA 5KG7A 1HI8A 1AA1B 4KMUX 2OSQA 4WFNQ 1NDLA 4IFYB 4OIXA 1SD4A 2W57A 4DR5F 2ROGA 2FOWA 3TX8A 1HA1A 1XSDA 1TC3C 2W25A 3SV3A 3A12A 4E7HA 2LQJA 3DDIA 3P96A 3ZQQA 4CDIA 1RB0A 3L00A 4HQEA 2IM3A 1K78B 4DJAA 1T33A 1VQ4I 5T41A 2WAEA 1G8XA 3KJVB 3GW2A 2L9DA 1NEEA 1S99A 4N8NA 4XMYA 2FHMA 3OVBA 1TL3A 3BG3A 5M5YJ 1RLCL 4TYAA 5D5WB 5JFRA 2HTSA 2LNBA 4U7BA 1RYRA 2MD0A 2EH3A 4OHVA 4HT7A 1TL5A 3T0YA 2OGUA 1S1XB 2N3OA 2WOMA 5LHGA 1CJVA 2C3PA 4QU7A 3L7WA 3CCWA 5J4VA 4K2XA 3BB5A 1W5TA 2VG5A 4EV0A 3PJWA 3ENVA 3GTLJ 5ETLA 2CQDA 2P9CA 4PUOB 2CJYB 3TL4X 1YTYA 3PW0A 3MECB 1SL1A 2ZH4A 3TJAA 2IGMA 3H2VE 1FXRA 3NCRA 3QLHB 1TKXA 3R1LA 4YEJA 2JZYA 4ZH4F 2LD5A 3O8WA 2N7CA 2RB7A 4OYOA 2HZCA 2BJ7A 3PYEA 1F5TA 3S2WA 3H36A 3H4DA 2YQ1A 1B9NA 1FERA 1MU2B 3FXLA 1EH7A 2JPCA 4NLQA 1FX7A 4WU3A 2YH1A 3AODA 4DL7A 3FIWA 4GKJJ 1HR0J 2GOMA 2JSPA 3W2VA 4HHUA 2LXFA 1I5OB 5KG4A 2V4JA 3CJRA 4ESBA 1MBHA 1BQNB 4NDLA 3C6TB 2CUJA 3HPOA 4DX7A 1OSCA 1U3EM 3F0CA 2RF2A 4KIFA 1QVFR 2O3DA 3BG9A 5KG3A 4RO0A 4XDCA 5F3ZA 2CQHA 2E9ZA 2HDCA 1UFMA 2E1PA 4QPXA 2R7SA 4OZ0A 2HAIA 5C25B 3K7AJ 1YLFA 3TA1A 5FJ8J 4JV1A 1RAJA 1HSTA 3FGVA 4HTJA 3MUTP 4G65A 1J5EF 4BBSJ 3CDHA 1MNDA 3SQNA 4I0BA 2ZB9A 4ILLA 1HXDA 3CWJA 5J6XA 2CW8A 4ZKAA 1VQYA 3QLHA 5KFMA 1VS3A 5B7WA 2DA2A 3BG6A 2M45A 3MF5A 3GO5A 1Q4RA 4XR6A 3VYTB 3S1TA 4HTIA 1A5JA 2DXIA 1X4CA 1MU2A 4ELTA 3CD6I 2Y1JA 4KT6A 3DFEA 2CUZA 1TV6A 2STTA 4ZPTR 1CJTA 1R43A 4KICA 3K7RA 4LF5F 1Z7LA 2PT0A 4DI6A 5B0CA 2IVFB 3CJQB 5K14B 1RJJA 5IOYA 2XMKA 4WX9A 5FDLA 2LU1A 2DW4A 2RNJA 1S5ZA 4C3HJ 2LQBA 5E33A 2B4VA 4CCLA 3SCKE 3AB4B 1WTBA 1UCRA 4LBIA 3AQPA 2GA7A 3BY6A 2A5WA 1JUSA 3D3CJ 5KFHA 1LV5A 1DDNA 4O3SA 2HZTA 3MCZA 4ZDOA 2BE9B 3E6MA 4XSZF 3CD0A 2ZMEC 4TV7A 2MEWA 2D9OA 2X3GA 5KOWA 2HS3A 2JEFA 4E8UA 3LSGA 3LQQA 2C2MB 1BI1A 3K4JA 3SEQA 2YKNA 3CDAA 4NZ0A 3OYMA 2QF7A 1YZ6A 3W6JB 2EZLA 4QSHA 2ECCA 1A35A 3RYRA 4KGXB 2K7KA 5B0DA 3GTJJ 2VPWB 1FEXA 2JA8J 1S6PB 2MD5A 3KP7A 3PYGA 2DHGA 4YRVA 3GU0A 5J2PA 1HQCA 2RILA 3MD1A 4NLYA 4LF6J 4ASNA 2J5OA 1DQ8A 3GG0A 4HNUA 4L9TA 1U1RA 1ZRDA 4E98A 4BBRJ 1NK8A 3TGNA 3MEEB 3ZN0A 1R1UA 2EG2A 1VQ9I 2HGNA 2NCKL 1VJWA 2DCEA 2OPTA 1A04A 1TL4A 2HZDA 2EFNA 3DXBA 5DEQA 1M1GA 2VFUA 3QU6A 3QQCD 3ISNC 5CJ9A 3MDFA 1WHYA 3UD4P 1SVLA 5F8MA 5KFXA 1U1KA 1X2NA 5AJ3J 1SIZA 1W36C 2VJJA 4DV7J 2RVCA 1IBCB 5HL7Q 1WGXA 1EH8A 2OTLI 1MBFA 1S0NA 1WKLA 1U4BA 4LF7J 3ZN1A 4Y15A 4IX7A 3IR6B 3M2UB 4M9ZA 1WSUA 4X1EA 4ZVTB 1D0YA 3RIRA 2CXEA 3W5YA 2VI6A 4ES3A 4FPIA 1RT5B 2YKAA 3H5RA 3V2UC 2DR8A 2V69A 2DTRA 3J7AO 2E9RX 1JKHA 1FSEA 2CSOA 3WE3A 1V6HA 1OYEA 2XY6A 2YVSA 2ID6A 2W9CB 2BMBA 1MGTA 2FJAB 1BC6A 5CCMA 3GLJA 1NUEA 1N32F 2Z8QA 4I4BA 4ED1A 1RA6A 3J80K 5B0GA 1XCVA 1IZ1A 3HB9A 2EZIA 3DTEA 4I56A 3CCZA 3QPTA 2GJIA 2IM2A 4MQVA 3WDOA 3GPAA 2MQMA 2B5JA 3HCXA 1P7IA 5HVGA 3KNGA 3DI6B 3BDDA 1SC4B 1YK9A 4M3GA 2DO4A 5H6QA 3BGUA 2MH9A 3CP2A 2ZDOA 4OYZA 3PX4A 2IIHA 3K17A 5A8KB 4ALZA 4LMZA 2UZAA 2BHZA 3OIQA 2ZOFA 2F5CA 2VOOA 1ZKGA 2GXGA 3UN5A 3KK2B 3G6EI 1VFJA 5EG0B 1TBXA 1X5TA 5GMEA 1P1TA 2WONA 1VQLI 4NLRA 3LSHA 5F3TA 3M2UA 2VJ4A 4AL7A 4G7HF 1Z4UA 3EGNA 2M2BA 2GHVC 5A8WB 2LU2A 3J81U 4ZIWA 2IBKA 4LSNB 5E3MA 2J7UA 1S1VA 2P5LC 3HHLD 5HP1A 3HKZN 4XLNF 1K47A 1IUYA 1KHVA 2GQCA 4PEOA 4WXWA 2R8HA 4C30A 3LSPA 1UG2A 2QYCA 2ZZNA 5J1UA 2OJ3A 5CVUA 1Y1WJ 3M2VA 4RUCA 1R22A 2M7BA 1RKIA 2H27A 3ZQLA 1E3PA 5LM7E 4PQUB 8ATCB 3E1SA 3VQTA 3GCMA 2PE8A 4UVCA 5DM6Q 3HVTB 4P71A 3EZ5A 2QLXA 1WC4A 4WKRA 3PNYA 1FKOB 3WG7H 3QRQA 1LB2A 4W92B 1K1SA 2V8DA 1APLC 1UA0A 3CMEI 3BP8A 2M87A 1H8AC 4U0VA 4GVBB 3LA2A 3AY0A 1B8IA 3OR2B 3BGRB 1X4GA 3ZMUA 1MMNA 1WOOA 1NHUA 1KA8A 1OCOH 2GAUA 1OJ4A 1YI2I 5FD1A 2F8HA 2YU3A 2QC3A 3KLGB 4RAFA 4C48A 1BIAA 2DPJA 5C44J 3UDCA 5A8KA 1QAIA 2NXEA 3D1OA 3EUNA 2CG4A 4IF4A 3F8MA 2PLYA 4TY9A 3MQ0A 4DX6A 2R2RA 4P2SA 2WONB 3PQKA 4CO4A 3RJPA 1C1BB 1Z0XA 3CVKA 4CH1A 3KUHA 1WH7A 1GT0C 2K9LA 1HOMA 3DN9A 2EZHA 5KFOA 3KMQA 4DUTA 2XASA 1SL2A 2JLFA 2MMYA 1FKAF 2OMLA 1HL6A 2B6AA 4TLRA 3TX0A 3GIRA 1EA3A 4UZBA 2P7VB 5BPIA 4JBCA 4OX7A 4ZDLA 1P6TA 3DM2A 3M2VB 4I68A 2D3ZA 2XYPB 2LRDA 1N34J 3I53A 1SAXA 1RTJA 1L3UA 1KU2A 1FO1A 3WODF 4DR6J 4KHPF 2CA9A 1RWOB 4XOPA 4LLLA 3HVTA 2ACYA 2M2EA 1B3TA 1XR7A 2A3JA 1S9GA 3KHLA 4V2FA 2LBFB 2NSCA 1V9OA 3T3FA 2DA3A 2FY8A 2Z33A 1FMWA 1JLQA 3RSNA 4QU6A 2FQ3A 3BCBA 3OL3A 3JXOA 3CCYA 1R7IA 5ICGA 1BJZA 4USUA 1ETWA 1B72B 1YG2A 3O44A 1MJBA 2BJDA 2JWNA 5TGTA 3TW6A 1N33F 1UZHA 1FY7A 3ZO7A 2GM4A 2V7FA 4ANJA 2K8GA 5KFRA 2KFDA 2M8HA 3T5JA 3KE2A 1IDZA 4DYRA 3ZQ7A 3W2WB 1UW9A 2IJRA 1YQAA 3LSJA 5D15A 2HS4A 2FOKA 4BACA 2BXZA 4N77A 4WE1B 3CJKB 2KXNB 4JV5J 2BRLA 3BN7A 1QSYA 1R27B 2DT7B 3PIPF 1VQ9S 5B1BH 3KLFB 4XSXF 2AYMA 3UKGA 3D68A 4OL8A 4KPCA 1YITS 4DL4A 4CICA 1WC3A 2HQRA 3UNGC 2F5GA 2OEKA 3F8BA 4RX6A 2A6OA 4Q8EA 5HJYA 2LC2A 4NEZA 4P9FA 3FEZA 4NC8A 3FEXB 1ZTTA 1O57A 1PKUA 4JI2J 3CMMA 5G0RB 1YRNA 3J81K 4QPTA 3Q0VA 4JBAA 3FCVA 4ETSA 4CQ1A 3RYLA 2XSFA 3M4XA 4GRIA 5CHCB 4S05A 4LF9F 1VBKA 4N41A 2IPQX 4DQIA 2MQPA 1JUPA 3H25A 4OYBA 2CIMA 1G6NA 1BQXA 1IN8A 1RLDA 3SSRA 4B9LA 5K9FA 2DLLA 4ZK7M 4OFZA 1Q82T 3AA9A 1W5SA 3JTPA 4DV5J 4V2GA 3W61A 1RT4B 1QE1A 1XMXA 1WORA 3NGSA 5E1WA 3FXUA 2Y0SN 3TA2A 3NBPA 3DEWA 2UVUA 4QQBA 2UVVA 2AJ4A 1UJ8A 3K4LA 4FZVA 4OI1A 1YJRA 1TR0A 1ODDA 5H1SV 1U0HB 1T95A 4I98B 1HC8A 4P6QA 2GJ2A 3DFGA 3JRIA 3WQPA 3S14J 2VOPA 3T1YJ 3QT7A 5DQIA 3EPGA 4PR6A 1R8PA 4DX8H 5GPCA 3WTSC 2GVDA 4KN4X 5F08A 1R36A 1VFCA 1FCAA 3PRBA 1OJLA 2HTJA 2FVQA 1N56A 1V5GA 2CV0A 4U7UK 5L38A 3C16B 1HKAA 2PIIA 2XRLA 3FHZA 2EB7A 1QSLA 2LY1A 2R7RA 3MMBB 3U9GA 4DFKA 1BY9A 1DFDA 3GMEA 3MXHP 5KFIA 1IXKA 4FF4A 4LG0B 3GMGA 1OKRA 4X4SA 1C0TB 4ZLNA 4IH7A 2QWWA 1Q86T 4G1QA 1RRJA 5IQQA 3NCQA 4DPWA 2KRFA 1MDMA 5F0CA 5J1EB 2DDBA 4I09A 4OHZA 1N5YA 3FSIA 2L3MA 2V67A 1YSJA 1SJ1A 3O5TB 1HW2A 2HQ3A 1N32J 4D5CA 2AEFA 5BOXA 1S3JA 1WCMJ 5BS6A 4WYLA 1TTYA 3SSQA 1YX2A 4A8MP 3MTKA 5J8FA 3UCZP 5KAFC 2BW2A 3QIPA 2W4CA 1GUUA 3S3OA 4MKAA 1IN6A 3J81j 2VBWA 1X60A 2EW9A 5M2UA 4DR7J 1E17A 3OYBA 2V9WA 3ICLA 3LNQA 3R7NB 1T9WA 2ICWG 1JLFB 1MBJA 1LWCB 3JQKA 3R27A 2L7ZA 4PWWA 2RMLA 2H8RA 1VQNS 2FJEB 1ZARA 2J0QD 2LVSA 1OQ6A 3H4BA 1PDNC 1U6ZA 1A6LA 3NNCA 3AG3H 5I42B 2MGZA 1URNA 5DETA 2VG7A 3FSYA 3JSMA 5DUKA 3HUGB 4A3GJ 2B9WA 1WWXA 3TYTA 4P10A 4IFVA 1HW1A 3R5DA 4DCPB 3BGFA 5HVQC 3MM9A 4A3CJ 2KTQA 3S8PA 2LDUA 2BW3A 4USTA 1IVZA 2ASDA 2RKIB 5ETQA 4KSEB 2QFIA 4XIUA 1HBUB 2M4GA 3I56S 2MLXA 3S93A 4UVAA 1EETB 3B54A 3EXYA 4XKBA 2LP4A 4QTRA 4DQPA 3MKYB 1ETXA 4A93J 2KYZA 2VDIA 2E5LF 4C11A 4ATNA 2L4MA 4LSZB 2XZWA 4A8FA 4CLFA 2A69F 2A6MA 4U8YA 3DWLE 2DXEA 2Z30B 4JI3F 5AIPA 1RUOA 2CPFA 3MM6A 3TQEA 2DJIA 4MH8A 3MM5A 2FB0A 2JZ5A 3KOAA 3BR0A 4YB1P 1PYSB 4IO9F 2IS2A 3UPFA 2MZQA 2HGCA 1JE8A 1W7PB 1FPQA 1MD0A 2VBXA 1X4DA 3VAFA 4XKVA 1LVKA 2DMNA 4LIRA 3ZMTA 2JRMA 2PMZN 1WJBA 4DV1J 2GCFA 3EYYA 1AHDP 3IGNA 1NJXA 3PW2A 3TOAA 2VG5B 5DCFA 2VBZA 1FYKA 2BE2B 4J9NA 4PUOA 1GXTA 2OF7A 4AIKA 2LQ8A 2EVZA 4IFVB 2QL7B 1G3SA 3S1NJ 3V8LA 1SFXA 2O3FA 3E3VA 1NKEA 4G1IA 1S29A 4ICLA 3HZGA 2DU9A 2ECBA 3D6TB 2QQAA 4QWQA 4KYZA 2F8EX 4XLCA 4JOUA 3QODA 2BE5F 1XGMA 1FD2A 5LSLA 1GT8A 2EK6A 3JAMY 1ZYQA 1KSPA 3RRHA 4B3SF 4K4VA 1U9NA 5L3GA 3VAHA 4J9MA 4KMFA 4CYCB 5LMUJ 2AGOA 1RKWA 4A3FJ 2AO9A 1T38A 2HOAA 3W64A 2D3O1 2GVZA 3VALA 5FB2A 3CJTA 3EYIA 3BR9A 4IG3A 4FS2A 1Y3KA 3DGPB 3K4BA 3BZKA 4XORA 1QA6A 5L8RC 2KHDA 3N6LA 1WF1A 3NLCA 4X64F 2CH0A 3FMQA 4ES2A 3M8RA 2ZZMA 1UZDA 1YIJI 4GCVA 1S6UA 4UY85 5D0GA 3SFGA 2KH9A 2EFVA 5CVIA 1EP4B 3LQRA 1L5UA 2MSYA 3KLHB 2XGDA 2OO4A 4B02A 2HYFA 2C28A 1NJYA 1RAAB 4P72A 1U1NA 1C4AA 2BOAA 3H35A 5HNHA 1RE1B 4F4WA 1HW5A 2MZJA 2FSWA 3TVYA 4ENKA 2HVIA 5GAHJ 2A05A 1DHMA 2DOAA 1FK9A 2P6TA 1PBUA 4LJZF 1S12A 3FBEA 3KJNB 4NRTA 3P4UB 2IC3A 4NLVA 3QQAA 3OUYA 3CCLI 4DDFA 4ELUA 4A48A 2D2WA 3B02A 3R9LA 4G94A 1HNWF 1L3LA 1REVA 2WCXA 3AG4H 4P2MA 1Z6RA 1HDDC 2H3EB 2IAJB 3LP1B 2XEXA 3RW6A 4HVZA 4A4JA 3OTEA 5A6PA 2C3OA 3RKWA 1IBKF 3HSEA 4RNHA 5EJCA 3S1QJ 1TWGJ 3DV8A 1W4MA 4RMNA 5DUIA 4DQQA 4KFCA 4ANCA 5A8RB 4NC6A 3TMOA 4HV6A 3N0VA 3I0SA 1BQMA 4JB8B 4PAAA 2V2ZA 1MROA 1WDDA 1Q8KA 2JLGA 4JX5A 1I1SA 2EKYA 4LBHA 2FVPA 5GPAA 1MNEA 2X7IA 1QDUB 2CV1A 2WSEC 4DCJB 2W1BA 4TU8A 3MEGA 3TUIC 2XI3A 4JI1F 1H89C 4D1QA 1DUXC 2IS6A 1CC8A 4Q48A 3DCFA 2KXFA 3TAQA 3VF0B 2UUZA 5E7OB 2YKMB 3EZUA 4L72B 5C42B 3D4JA 2G2ZA 4E70A 4C9YA 2ESHA 1GX5A 5ITHA 1QD1A 2RN7A 1VQPI 1W7WA 2RH3A 3PNIA 3JAMU 2XTJP 4OZ5A 4AD6A 2XF5A 2J6UA 1FD8A 3BM7A 2E36A 5EYRA 2B9SA 3I4PA 1HWKA 2VPZB 2R7OA 1XEZA 2L54A 2QA4I 1SMYF 3H5YA 4NHJA 2ZH5A 2AIRB 2ROPA 2J7WA 4M5GA 4J37A 2RDIA 1SKRA 4ZPAA 4IQXA 5ICFA 3FF5A 3WHCA 3AB2B 3CD6S 1A7GE 3RB4A 3S6EA 2VFRA 3OYEA 5L9XA 2CJKA 3X3UA 3ZQIA 5CYMB 4LK1F 4F04B 2NSBA 2KZMA 2DJWA 2KISA 3ILOA 4KGKA 5DS7A 1VQMS 4DGWB 3A02A 2D7SA 2UVWA 2EZKA 1XN7A 5J4YA 2CJAA 1PJRA 2X1GA 2CPIA 4GC7A 3UDVA 2CPXA 3C6TA 4O44A 4Y2CA 3WX4A 2DDAA 2QRRA 4Z7YA 1M5OC 4B3OA 3MEGB 3QWLA 4KQZA 3QBCA 3LSTA 4ZJZA 1ELOA 5LXYA 4LRBA 3POTB 1JT0A 3H0PA 5FLXU 4K4ZA 1IBLJ 3CF5F 3V5RA 3BH6B 4IRGA 5ICEA 1M1KT 1JNRB 4L5JA 1KD1T 3CLQA 4FISA 4DV5F 1RPWA 1JNZB 4USMA 4AL5A 2DPUA 2O67A 2DGVA 3SFZA 2FTRA 3HHLB 4JYAJ 4C97A 2DIVA 2C2NA 3PYDA 4QCLA 4NX9A 4LF2A 5KFWA 1IN0A 2PGCA 2ETHA 2VDHA 2KB2A 2MHEA 3PIOF 1IKWB 5BXIA 3IFEA 1IBMF 4K8RA 3PFYA 1TUWA 1UVMA 1LW2B 1D5VA 4OYPA 4JI6J 2XGQA 4XO0A 2NOJB 3E6CC 3A3PB 1IKXA 3S17J 2DR6A 2DMPA 3MR2A 1VQPS 2CNOB 1YLXA 2EI5A 2HXOA 3KKFA 1EIYB 3J7YI 4DSLA 3IS9B 3LO3A 4WXOA 3GR0A 4XRSA 3HRUA 3JB9k 3KLOA 3IRXA 4R25A 2MZTA 3M2RB 5IYCJ 2XPUA 2ZC2A 1RAOA 4LJMA 3UDLA 3ZP5A 3JQJA 4A8YA 5IS2A 2XS5A 3GZ7A 2QBYB 3US5A 4ECUA 2D1HA 5C7PA 4CM0A 5L1LA 1FOWA 2D1VA 2WTEA 4A5NA 1KVIA 2L41A 3K2ZA 1IJWC 4A8KA 4ENMA 1WJFA 3KK2A 3POTA 3MMCA 4CNYA 1RWXB 2IBOA 3ZTSA 1X7VA 5AE1A 3OFGA 1W2BR 1YRXA 1YO5C 1D9FA 1WNEA 2U1AA 1GXQA 2EFOA 2J9DE 5DJBA 3D66A 2COBA 1TQLA 3KLEB 5ETNA 3NNHA 1Q16B 4G7OF 2DMTA 3RPUD 4CA0A 1OCRH 1WVRA 2HK3A 2KRBA 2VFVA 1BR4A 4W97A 4N9IA 1IRXA 5DCMB 1N77A 2NVQJ 3FMSA 2WV0A 4BEHA 1IKWA 3JRDA 2ZJQF 3HVRA 4NLGA 3QGGA 1ACIA 3M8FA 2CW7A 4Y13A 4I67A 4DS4A 1C4CA 2CUFA 1P9YA 4L0ZB 1KQ0A 3V4MA 1YDLA 1XSVA 2XAJA 4DIQA 2P5VA 3HHKA 3N05A 2M8GX 1VZ0A 3RKQA 3V6KA 1RTIB 1Z05A 1SCJB 1NM2A 3EICA 4PQAA 5HLHA 1FFSB 1Z1ZA 4DSKA 4TVAB 3NARA 3V6DA 5AONA 2XO6A 4HLBA 3MMCB 4WP8A 3OYIA 4FE7A 2PSZA 5DDPC 3L95X 5JI6A 4X84A 2NXNB 1JKRC 1D0XA 2QQ9A 4Y7NJ 1YRUA 3VZHA 1H0MA 3C3WA 3NGRA 4E4HA 4M74A 2K3IA 4R0EA 2EINH 5GAGU 4OX6A 3TAMB 5D0RA 4FPRA 2AS5F 4L18B 3DM2B 4BC7A 3PR5B 2MB0B 1SV5A 1RGVA 3GTQJ 5IP7J 3S15J 1OPIA 4TXSA 3IKTA 2AT1B 4CCNA 2PC6A 4DPXA 1MSWD 1GV5A 3SZTA 5IT3A 3PNTA 2JA5J 3TW7A 2ZD1A 1JLCB 2HNZB 3HHNB 4UOHA 4DQSA 3IG1B 3TBIA 3WU1B 1XMAA 1T11A 2K06A 2FZKB 4ZYGA 3FZBA 1N5VA 2UV1A 1RHRB 1QUVA 1JJ6C 4NCBA 2O9LA 3FFIB 3OXLA 2FX0A 4BQQA 5E3PA 2ZXHA 3FXJA 3H7HB 1VQKS 2CWXA 3BV8A 4G7ZF 3G71I 3G87A 3IMQJ 5IY5H 1B72A 3UCGA 1D8JA 2GGPA 4V19J 3K4NA 2K1RA 1KQ9A 2QLZA 4RB1A 3D28A 2M4KA 1SB6A 4YEAA 4EM2A 4WZQA 1FVQA 3SDGA 5D4SA 4RGSA 4GXOA 2O8XA 4BXUA 4KIAA 1ZGAA 3QSIA 3CUQA 1LE8B 1OQYA 4MFDA 2DNQA 3FEYB 3SYTA 5GADJ 1X4EA 3IHUA 1Y10A 1WEZA 4O3PA 3FX3A 4YHHJ 3UO0A 3M7VA 1T0FA 2DTJA 2IA1A 4CDGA 4L74A 3MWMA 4ENJA 1UJ6A 3DLBA 3VFZA 2N82B 5DZ6A 2Y3YA 2M4MA 3N9UC 1WC5A 1R1TA 3QYEA 3ZFVA 2NYIA 4M3BA 1I6JA 3CF5Q 2KN4A 1QVTA 5A2QU 1X8DA 1KU9A 3C2PA 4EEYA 4UV9A 1RT2A 1HR0F 4UUSA 3M7GA 2VA3A 1RT3A 2QA2A 1P7JA 2ZD1B 4LK0F 2HNZA 1RWMB 5IFMA 1MWYA 1CGPA 3WTWC 1S7IA 4K4XA 4AQYJ 5EF6A 5G0RA 4ECTA 2FZGB 3DOMB 2VT3A 3PL8A 2EA4A 3QGPA 4ZP7A 2E1NA 2BHYA 4DV4F 3BGRA 1DTTA 1A6QA 4ZMMA 1U6GA 2HMIA 1D1AA 2JC1A 1LOUA 2AX1A 5AXKA 2H54B 2BJ3A 2IVMA 1IV6A 2DA1A 2UUCF 3KLIA 4DV0F 1XMOF 1R8CA 3HKZA 1E6YB 4DPUA 2LXIA 1AZSA 2YQ0A 3HSJA 4OX8A 4RKUC 3E3XA 3H2UB 4HPQA 1GV2A 5H2FC 3F3XA 4D7NA 1RHKB 2R5YB 2VBYA 3HO1A 3CCJI 3U1NA 2R7FA 1O3QA 1N36F 1GVDA 5HVHA 4RM3A 2Y1IA 4HX4A 2ZJPF 3A01A 4WP9A 5IC4B 3DRSA 4YR0A 5D5VB 4MO7A 1HBOA 3CW2C 2F40A 4YMEA 7AT1B 5KAKA 4WK8F 2CPYA 1MH4A 5HMWA 2JWTA 2R5ZB 2J76E 3VEPA 1MN7A 5EZHA 1R4MB 2FC9A 3EX7B 2AZ1A 5J2QB 3ZQCA 1NTCA 2V63A 5JR3A 3I54A 4IG0A 1ZM3A 2XB5A 4B3AA 3FSXA 5HQ8A 1M5KC 4C9DA 4ZLPA 4F4XA 4M5LA 4ZPDA 4N8OA 3H0GJ 2ZJQQ 4BHQA 3HXMA 1V4RA 2CPDA 3GJQB 2WC2A 4ID5B 2DT6A 1JWWA 4OX9J 3RDIA 3FVYA 2KZZA 1XTAA 2R8GA 4F3QA 2BY3A 5JVTA 1SVDA 2RQQA 2B63J 1YHQI 1FRMA 4IYQA 2J8AA 5LRRA 5IT9U 2CKWA 2GAHC 1I50J 5B0FA 4A8XA 2BJ1A 3RBEA 1KONA 4OJGA 3AJ2A 3OYKA 3H9GA 4IO9Q 2R5YA 5CQEA 1WHUA 4TYBA 3QFHA 1K73T 4L5IA 4BE1A 8AT1B 1TZLA 3ZXWA 1Q7YT 3ZOBA 4RNOA 5K5MA 4JI0F 2F8MA 2P6SA 2JX2A 4DR1J 1J0RA 2WOMB 3CSKA 4R5PB 3EGZA 5BNGA 3SDBA 3ESWB 2JFDA 1HBOB 4C8KA 4LLNA 2VPYB 5IP6A 4AT1B 4R79A 3IL2A 1R71A 2JVGA 1VMBA 1RUNA 2Z2LA 1RACB 1RWKB 1MSFC 1N5QA 3BTCA 4ZVGA 4PXBA 1WQ2A 3OYJA 1FOKA 3TP2A 2H5EA 2W7AA 4LG3A 1VQ6S 3PUFA 4PWUA 2AMCB 3CC4S 2ZOMA 1WI9A 3K6GA 4NCGB 1MMSA 1YRNB 2IYGA 4EO8A 3RB6A 4H4OB 2GIRA 3MM9B 5E79C 2VKHA 4OOIA 4UUVA 1D8YA 2PFFB 3TP3A 1T94A 1IQZA 4HEA9 3W9IA 3OIOA 2SXLA 4F0KA 3DKWA 3M4OJ 2NS1B 2M9HA 1QE1B 3W8PA 2EK5A 2CQQA 3J7ZT 4K4TA 4DYQA 1Y4ZB 3S2HJ 2EG1A 3RZDJ 3ZTPA 4RAGA 1J2VA 2R7WA 1YBAA 2G1HA 3G6ES 5KAIC 1IDYA 2K2PA 2YWHA 3RBZA 2B0LA 5E3AA 1QU3A 1NDKA 4N76A 3PVXA 2ELKA 4U96A 2HQ5A 2E1MC 2HWVA 4XDDA 4CLYA 1IKVA 3D0GE 4IHVA 2BABA 4RW8B 2MTLA 1BC7C 4EBDA 3CNQP 1APSA 3C15A 3G86A 1HF0A 3BKUA 2V2KA 3GFXA 3GZNB 2IDLA 1LXNA 3QYFA 3N6NA 5EN1A 2ATLA 3WIUA 1VI7A 3CIZA 4F2RA 2HHTA 1HQ2A 2ZFHA 1NZ8A 3K10A 2MSTA 3GSIA 4HX7A 1HDPA 1HPZB 1HI1A 3G1LA 3DPUA 3OD2A 3E5QA 5LOQA 2BYCA 1U8SA 3E01B 4FYYB 1IUFA 4RW7B 1WF2A 4LRDA 4F0HA 1W7PD 1FBSA 4YHHF 3HTSB 3MAAA 4D0PA 4Q7AA 3K1MA 3PO2J 4B9VA 4ITVA 5HS8A 1U24A 5IYDJ 3D2WA 5CLSA 4DOZA 3TQNA 1FNMA 1MDMB 5J1EA 1IJEB 1PYVA 4Y3OA 3W60A 3C7JA 2E2IJ 4EWTA 3FBCA 3BPXA 1P9QC 4L76A 3KPHA 2WVBA 3K1NA 3A3NB 4ETZA 2L01A 3KP2A 1HWIA 5F04A 4OHXA 1JKOC 4OQJA 5HMXA 2RQCA 2V9KA 3N28A 3F6OA 2V6CA 3SCLE 1PUFA 5DGBA 3OIPA 1SI9A 4Y2IA 1WUUA 4P7VA 1BR1A 3H5AA 3FJ2A 1YJNI 3D1NI 4DLEA 3KDOA 2BQ3A 1ZTRA 2FJWA 1SD7A 2LKXA 4NXNF 3TDUC 1V5IB 2L02A 2OBPA 1T9TA 3I55S 5K7FA 3HSGA 1JGSA 2HK2A 2PJPA 1LWFA 4E7KA 1U78A 2QYGA 2PO4A 1HHTP 1EJ9A 5M5XJ 2LECA 2UUAJ 1POGA 3ZZTA 1N4LA 3FHNA 2MGZB 4ZPBA 1FTRA 2WAQD 1Q81T 1U5TA 3GTGJ 3TDZC 2OMOA 1USSA 4DV2F 3IXQA 1TQPA 3HHGA 2QL5B 2EBGA 2P8TA 5ILUA 3E01A 3EMTA 3OXGA 5FLVA 2ZH8A 4MKBA 3J7YU 4ZPCA 2OFHX 4ZS6A 5DG9A 1PG5B 2A18A 4A6DA 1FX4A 2HOTA 2NXUA 2HDDA 4HYKA 3DLEB 3FKIJ 2V1XA 2KT3A 4GO5X 2HQAA 2PX9A 4P75A 2IAJA 2M52A 3DXJF 5EEAA 1CG2A 3OHBA 4IPAA 3V7SA 3HHDA 3ET6B 2HVSA 1DBDA 1GMUA 2MXYA 3KHGA 2LA4A 4DL5A 3QPIA 2FLLA 4WPAA 2LEBA 1UEVA 2IRYA 1I3AA 3I82A 3M9MB 1DTQB 4HX8A 4UUWA 1KRPA 2FJBB 3DOLA 4ZLJA 4OAYA 1HNVA 3AFGA 1TWCJ 3A4TA 1U5TC 1F9NA 3S3MA 2ZJRQ 2P7CB 2M3AA 2DCLA 1XG1A 4IHYA 4HQMA 2L4AA 4M5KA 4FT8A 2ELHA 1S0OA 3DKXA 2G1DA 1WSVA 1HW8A 2PMWA 4U88A 2FQ4A 4PDKA 1ONVA 4CH7A 2VZ9A 1T39A 1GEHA 4FVCA 3ZZZA 2Y0BB 2XYGB 4QIVA 3HP6A 1VQ6I 4ZA1A 4BYYA 3BR5A 1GK8A 3DF8A 5J2NA 1XNRJ 1VQSA 4O0IA 3OR1C 2AQ4A 1HNXF 2XAUA 1FYLA 3ZNUA 2DISA 4FP9A 2GIVA 4UUXA 3CEDA 1FYMA 2MZRA 4KGVB 3FXKA 3WU0A 3K69A 3M8ZA 1SC7A 2GA1A 2LFVA 5CCLA 3FC9A 4AUXA 1XGNA 2COMA 5L1JA 4ZLLA 5J2MB 4A8WA 1SFEA 2FYXA 2VFSA 2EIJH 2WK4A 4NBQA 3QMQA 1F3FA 4ELVA 1HFEL 2OIHA 1Q78A 5LEJA 4A3IJ 4MJKA 3K2AA 3U21A 4EM1A 3G4SI 3ISPA 3COAC 4BUPA 5JXSA 1R0AA 3PXGa 1FWPA 5D4OA 1RT1B 5JLWA 3R97A 2JMWA 2Z16A 5KFQA 4BHPA 4M63A 4NXNJ 1H2VZ 4CYCA 5BYRA 4Z6YA 2NLWA 1U25A 1SL0A 1FBQA 4I2PB 4CRJA 3DOLB 2K5CA 4O3MA 2VN2A 4ED0A 1OFCX 3PX0A 3FWEA 1VQ8I 2V8VA 2O0YA 4ED5A 3R8YA 2FLOA 1VQ5S 1WC1A 1U2FA 2PG4A 3D0IE 4K4UA 1BW5A 4XONA 4U8VA 3IV5A 2VKEA 3RUBL 2MZ1A 1K6OA 1EP4A 4QWAA 2GWRA 4N4OB 1X5SA 1F6TA 4Q45A 2LLZA 3IM9A 3Q8UA 1JT6A 2Z57B 4JI7J 2UUCJ 5IM0B 2VJVA 1U48A 2XLIA 2IT0A 3OBIA 5K5OA 1U8BA 4M8LA 3OTDA 4C3LA 2MLYA 2KHCA 3CMAS 3ASNH 2AD9A 5IT4A 2F48A 4ZVQB 1N48A 2ALZA 2BM0A 4F2SA 2H94A 4R8HA 2EILH 1ZRCA 3PCOB 2ZEJA 1VI0A 1RT7A 2HVQA 3ONQA 2B7CB 3ZTOA 1UEUA 3SDEB 1B8IB 4EJOA 1H72C 3OR2A 1KQGB 2XF6A 2H6BA 3NAUA 3D5SC 4U6PA 3I71A 1RIOH 2G0IA 1BQMB 1G3OA 3O1LA 3OOPA 2HFNA 3RRKA 1CF7B 1Y5LB 2OLWA 2V2QA 4LF5J 2ZJ2A 2OTJS 2Y9YA 4XRFA 4DUZF 2HSEB 3FNNA 2MQ8A 2Q1ZB 3NNAA 3PFOA 4I6ZA 2BVLA 1UPMB 4NZ6A 2LLKA 2E5ZA 2NVUB 3L7PA 2E1MB 2MW8A 3EUKL 5D6GA 5D4NA 2DNPA 2J7KA 1VF9A 2ADCA 3I0RB 3RR7A 4EGZA 3R5AA 2W48A 4LD5A 4IQ4A 4DS5A 4XAKA 3I56I 5HDGA 2DNMA 4QR2A 4J01A 3QPHA 3BPSP 3K0JA 3UQSA 2RSQA 1JK9B 2VPRA 3F8NA 3UI3A 1ZR4A 1U6FA 3HJEA 3EZOA 2B51A 3EM1A 2HU9A 1B7YB 1TL3B 3CC2I 4RGRA 1HWJA 1MSEC 1BM9A 3NGUA 3OS0A 1NKCA 1ZM2A 3CJ5A 4EK2A 5J1YA 1IR1A 4PSXA 3L9ZA 1Y9OA 1KTVA 1RT6A 2M0MA 4ZTJA 3H0DA 2K02A 5A2QZ 2P2CB 4CHUA 3QPSA 2FU4A 4RUHA 3C2GA 1XIQA 3TEDA 5D5UB 4F3MA 1M5HA 4NYOA 1TNSA 1CF7A 2CFXA 4MQ9F 5KFGA 5L39A 3I87A 1XERA 1BHNA 3M8PB 3MR7A 2Z0GA 1B59A 2DK8A 1OMSA 3HSRA 1O5JA 3QJPA 2Y48A 4AFFA 2I38A 7FD1A 4HI1A 2HXIA 1ULRA 1GMVA 1UAWA 3GZ6A 4LRFA 2B4OA 4DSEA 1AUDA 2ZJRF 4M5IA 1PC4A 1T0TV 3IWZA 1TWFJ 1DAXA 1X1DA 2IA2A 2BVZA 5IV4A 1D09B 4GFBA 4IJAA 2HPIA 1VC5A 1J5YA 2F9DA 1XQIA 5DRKA 4ECVA 1WELA 3SFUA 5DS9A 5BMZA 3HL2A 1TKDA 4BDPA 1TVRA 4G6DA 2HYIB 1KLMB 3Q8PB 3NAIA 3PRDA 3SFIA 2KFYA 4KV8B 1Z3XA 4JI4F 3C6UA 5FD5A 1XC5A 2V2VA 4IOBA 3KETA 2M7SA 1U8RA 1WKJA 2RF2B 2VH7A 3TVZA 2ADUA 1FOXA 1S6PA 1F5CA 4P74A 2VQHA 1DURA 3NWSA 9ANTA 4YY3J 1E6VA 2V6EA 3IG1A 4L9NA 3VR1A 3HI9A 5JVGQ 2E1OA 2VE9A 1WKMA 3Q86A 3MEEA 1RTDB 4JI7F 3DHWC 5KFZA 2WBMA 3CO6C 3M2RA 1SJ3P 3G73A 2VB6A 5DDQC 2XSJA 1X9SA 4NLOA 3RR8A 3M1EA 5KT4A 3FXRA 3P9IA 3AA8A 3BZCA 3FK6A 4W4MA 4FYVB 3MZ8A 4B3RJ 2DT9A 4B47A 4I0AA 1BLUA 3I4MJ 4MTEA 4DFJA 4GGGA 1NK0A 1Y8QB 2AYEA 1ETQA 3TEGA 4NLPA 4PYAA 2N3LA 2BW7A 4HV5A 3ZCOA 3I59B 3H98A 2VPXB 1YBTA 4ANEA 4CO3A 4IRKA 3HLUA 2BR0A 2IW5A 1E3HA 2F4OB 2K3PA 3CO0P 4UQGA 2YNIA 4Y00A 1KHWA 1HHQA 1BIBA 1K1QA 4IR1A 5K14A 4EJTA 4QBUA 3NRVA 1J75A 1PP8F 1ENHA 3RPQA 2O6GE 2G7HA 4GYGA 5GVQA 3C16A 5SUHA 4DBQA 2Z9OA 1Y7PA 3H5XA 2B7BB 2IMOA 2FMYA 1NNDA 3QAEA 2J5AA 4R8UA 5EX0A 2W2QP 2EPIA 3F72A 3A0BC 3DOKA 4I02A 1VRTA 4ZJOA 4NPOA 2NZCA 1JLAB 1HIYA 1LDDA 5LXRA 3L2RA 1V3RA 2BACA 4CO0A 5K8MA 1GHCA 5HBMB 2MQLA 1GNKA 5HSPA 2XYHB 4GKKF 2QIFA 3F56A 1R31A 2AX0A 3DBRB 1X5OA 2MZSA 5FLXZ 4IKAA 2G2YA 2HG4A 2R7TA 3DRRB 4BJ5C 2XSJB 4MIMA 4DW6A 1ZA2B 5H9FK 1RHQB 2QZ8A 3UCUP 1J5OA 4B8XA 4OIPF 3OOUA 3D5LA 5F41A 3DDKA 2E1AA 5J2PB 3GCWP 1SC1B 3WIVA 3KHRA 2XSDC 4S04A 2BY0A 1U47A 2UXCJ 2K9QA 1Z21A 3OSGA 1JLGB 3OL8A 5CYQA 2ZITA 2WW8A 4XKCA 1UWBB 2X1BA 2BJ8A 4HHJA 3BR1A 3FDSA 3W6VA 1H0HB 3VHQA 5IT9Y 4RUAA 3K70C 3TAMA 3SZ2A 3F9KA 1LKZA 3GWZA 3U2RA 4QIWD 1OO0B 2LYCA 3OVSA 4USIA 2JTVA 3OYFA 4CLTA 2R7VA 2XMTA 1UEKA 1TL7B 4GYIA 4OZNA 5K8NA 1CQNA 3F21A 3OFFA 2Z2SB 1TKZB 4CLKA 3OLBA 3JCUC 4IG0B 4LF4F 1Z67A 3DEUA 2BW3B 4HF2A 2OA4A 4ECYA 1RT5A 3O8GA 2HLTA 4M3DA 4OMZA 4MIWA 2PMZD 5EWEA 3FDYA 5LT5A 3FZVA 5E20A 1WACA 4NC7A 2R3VA 2GO9A 3G6YA 4Y34A 4DR4J 1EETA 3LF0A 2OHDA 2E60A 3TQ1A 1VOMA 1S1TA 4DR3F 4DV1F 2LMDA 2IHR1 2L08A 2B8PA 4MKVA 1HMVB 2DXFA 2QEXS 1RSCA 2E5HA 3FMWA 3DLHA 5KFLA 1CEZA 3IWLA 1ZS6A 1NK2P 2PEXA 1GVJA 4Y4RA 1DQAA 2G7UA 1GAOA 2BZ2A 2CO5A 5L3DA 2B5JB 1FRHA 3DI6A 3HSDA 3JSRA 2F5VA 5C4JJ 1XMKA 1R1VA 5A2QK 2HGMA 3QO9B 2TRTA 3JAMK 1T9UA 3M6VA 3C1DA 2ACJA 3UE2A 2QX0A 2NS0A 2KG1A 1YJNS 4DR7F 3U27A 2H65B 1ZPVA 2CNKB 1IGNA 3CCVS 2I2YA 3ZZ0A 3U1DA 2YU9J 4DZPA 2B0GA 2GQ2A 3M1CA 2RHSB 4WWSA 1L3SA 4KDPA 3CDUA 5GMDA 2QQBA 2X3DA 4BAYA 1X1AA 1HYSB 1ZLJA 1Y00A 1PGZA 3J7Z5 5GTHC 4ICLB 2KIQA 3BQ2A 4CCOA 3GTKJ 1HNIB 5E8IA 3BO2A 1MLAA 3BPVA 3HC7A 4DN9A 1DU6A 1DP3A 5KNLA 3ISZA 5E2QA 3OL6A 2IGOA 3DLKA 2HRTA 2L2OA 2DJNA 1IRFA 3TRGA 3BN4A 5KFSA 4WF2A 1JHFA 2CQGA 2EFGA 1YI2S 4MK7A 2KRRA 4E0DA 1FDAA 1R3NA 1XWLA 4YFUA 1S72S 1S9FA 5HI7A 4GRSA 5C24A 1K78A 3LOCA 3JRFA 3CB4A 1UVJA 4PQUA 4H4MA 3LGHA 2AKWB 4OWRB 4L3NA 1DARA 2CQ7A 3M9OB 4O4GA 2Q66A 3C14A 2KRHA 2EFQA 2GIQA 1XC9A 2HPUA 5A2QY 4CT9A 2EFPA 1XX5A 4WE1A 3CJKA 3S32A 2A2DA 1IWAA 1FTCA 4DR6F 2ZDPA 5HS7A 4WZMA 2MY7A 4JI2F 3W6KB 4GDFA 3V8KA 2M7AA 2JUGA 2GS8A 2Y8YA 4I7FB 1F3VA 5HMYA 4MGRA 3CDWA 1S1XA 6FD1A 5AIQA 5CH7B 1FT8A 5EGOA 4DWIA 2VL8A 4ESFA 3A03A 1IN4A 1WJDA 2ELJA 3BQYA 1N54B 2CVIA 2YUSA 5IOZA 3GUDA 3PSIA 1S9EA 3AD7C 1VYAA 4QOTA 3HZJA 3WU2C 2ZHBA 3MGJA 2DTZA 2BBEA 1T9YA 4C2UA 2OJED 2YH0A 1B70B 4IH6A 2FNPA 2OEMA 2X6OA 3DU5A 1HPZA 2K86A 3HOUJ 1ON1A 5D5XB 3NAHA 4IRDA 1FNNA 1IR0A 1F5AA 5FRNA 2J9DA 1HKTA 2NYHA 2B6AB 3LSRA 2PJRA 1LWEB 3MAAB 1NHAA 4U9RA 3DLKB 2AGQA 3BSAA 3HOXJ 1K4SA 2RDDA 1UCNA 3OMYA 5D6EA 4FYWB 1FIPA 1BXNA 2RU9A 4NNJA 2OKQA 1ZR2A 5KT2A 5F8JA 4Y0FA 3DQVC 5T7LB 1NAQA 5CAAA 2GQQA 3CCUI 1ZHFA 4DL6A 4PUSA 1IRZA 1IV8A 4O4GB 2OC6A 1XK8A 3K5MA 1FIAA 2IS4A 3CC7S 1BA5A 2HNYB 5MAOA 1XCBA 2EBEA 4GMKA 2K7JA 4ED7A 3A2KA 4F3OA 1ZYRF 3K5NA 3TW0A 1RAEB 2W2PP 4LOCA 1YJVA 2W8KA 4GKKJ 3CO7C 3BQ1A 5DYMA 3VB2A 3SV4A 4MFEA 4ERDA 1IXSB 1HWLA 4YIFA 2MH2A 1WG5A 4RGXA 3OL4A 3LMMA 1OYDA 3HZEA 1RADB 1X1PA 3L1PA 1ZTWA 3HHHA 5CQGA 2IA0A 3S2DJ 1YS7A 2H5JB 1XTZA 3H59A 4M71A 3H42A 1DQ9A 4J00A 2LQ9A 2NXJA 2VQEF 1PSDA 3TNVA 4H4OA 1IN7A 4LG0A 1NXIA 3Q89A 1IXCA 1DPRA 4OIOF 3P8BB 1WD6A 2VICA 1W36D 2I5UA 4Y6IA 3CCQS 1K61A 3MKLA 4FBTA 4PK4A 4W1UA 4A0ZA 3SSSA 2KPMA 5KG0A 4IKFA 3WE2A 1ZGWA 2E35A 4U7DA 5K7HA 3VGVA 5FD6A 2VJUA 1R8AA 1FA0A 2L3DA 3JS9A 1H9TA 4R1HA 3QIPB 3LTOA 4X2BA 2H5IB 3I9V2 2XULA 5AE2A 2CJ9A 5G4DA 4NI2A 4CZCA 4KT0C 3QZ8A 1ZM9A 4B3MJ 2HFVA 1ITYA 1BUXA 2V50A 3V4IA 5BYQA 5HLFB 3VSKA 1UELB 3PW4A 1XSXA 5CA5A 2YTCA 3OR1B 5GAGI 2WBRA 5LHIA 2IFXA 1JMTA 1X3ZB 3SHFA 1ETOA 3HHEA 5HAOA 4H0EA 3OTOF 1T02A 4H54A 3W62A 3K5OA 2ZNZA 2RV8A 1GDTA 3JSMB 3I32A 1D1UA 2DRAA 2ILZA 1TT0A 1AT1B 4K4WA 3A8JA 1GXPA 4RZRA 2DY1A 3BSOA 4UB8C 5EWGA 5GMKa 2KRCA 1P92A 1AKHA 3KTQA 2LK2A 3R6SA 3LP0A 2J8SA 1L0OC 2LVWA 5GADU 4E7IA 2BXJA 1IKXB 2JT1A 2QUFA 3GYNA 1X5PA 3I64A 4I6AA 3PO3J 3B82A 4KN7X 4USWA 1NO8A 4BS2A 3JRGA 1JLEA 3Q8VA 3UVJB 4P7TA 3IRXB 3I55I 4KTQA 2OELA 2IYIA 2HPMA 3CE8A 1G2HA 1H38A 2JL9A 2A07F 2MC3A 4ZVRB 2QBYA 2VPLA 3BGOP 1PP7U 1J7KA 4W98A 1NB7A 2FC8A 4RBOA 4Q2MA 3BJAA 2CZ9A 1F2GA 3IM8A 4FVMA 5HMZA 4PPZA 1R89A 4KB7A 4NLUA 5D0HA 1LFUP 2V94A 3PO5A 5FKKA 2RC4A 3KEQA 3KZZA 5C2GA 3UR0A 4Q44A 1LVAA 3GSDA 3SCJE 1XMBA 1QJHA 1IM6A 3OR1A 2NS7A 2FA5A 2BV6A 4IHSA 3Q2TC 2RQKA 2OZ6A 4W90B 2MJNA 1LEOA 1YYVA 4LFBJ 2ZMEA 1MMDA 3O2PE 5IM0A 3OQ2A 3QWUA 1FLIA 1B0VA 3DC2A 1NU4A 3RG6A 2XY7A 1WSRA 5DCMA 3P5JA 2Y0SD 4ZN1A 4RS8A 3FQKA 4WTOB 3KHHA 5DD8A 1FKPB 3E97A 4P52A 2O01C 1B7FA 4L0YB 3CIMA 2D3OR 3LSIA 4LREA 4HW0A 2VA2A 3HIFA 2A6HF 3NG8A 2AF6A 3DLEA 3HFZB 3ROUA 4TNOA 1NDPA 1YKWA 4HBLA 1DY3A 4XRSG 1I1GA 1SKSA 1JLEB 2DB1A 3FM3A 1MBGA 2HQNA 2AP6A 2NVYJ 2KKOA 4BE0A 1ZREA 1RTIA 5CABA 2DVIA 1S4FA 3U1KA 5L3FA 5BPDA 2E66A 3GJRB 2E5NA 1JKQC 3DGPA 2VQEJ 2LEPA 3MZIA 1H3DA 1X1CA 3ZGKA 1OCPA 4N5SA 4CSWA 2V79A 4LT6A 2VIHA 1FRXA 5DLFA 4OYWA 3DBHB 2UUBF 1XDSA 2H4YB 1LQ1A 3MCNA 4M3EA 2KZVA 1JTYA 1I5ZA 4MT1A 3A13A 2AHOB 4ZN3A 3S8SA 4OHWA 2KJBA 4RW6B 4EVIA 4LRAA 3S01A 5EWFA 2B43A 3CLOA 1I27A 1D8ZA 1VC0A 2L7MP 4DYCA 3GCXP 2R2UA 3LALA 4XNFA 1P27B 1K44A 4NLSA 4OYAA 4K0KJ 2HGLA 1HBMB 3KP6A 3J81Z 2PQ8A 4HKQA 4J90A 3GWCA 4JYKA 2CQCA 3MM6B 4LF6F 4OAZA 2OTJI 2AJQA 1A9NB 2YQ3A 1NHVA 3F22A 2C3UA 1EKRA 3D1HA 5KG2A 3OUYB 2MQNA 4Q5VA 2QVOA 3ASOH 2Y1LB 5KFEA 1D3YA 1QNTA 2X1DA 4ZCKA 3QYYA 3BR8A 5BR8J 1MWQA 4C6AA 5CD4A 4BS9A 3JSBA 4UTGA 2PEHA 1VQ4S 2LR8A 3CTRA 5M3FJ 4CI0B 1KBRA 1VDHA 4HDVA 1FRLA 3PKMA 1P6RA 4PJJA 1CJUB 3IC1A 4Y33A 5M2RA 4EYIB 3K4MA 2MQOA 3G2BA 2VU5A 1MNMC 1EKSA 5FLXK 1C0UA 2HQIA 3G8QA 4KHMA 2E5IA 2AZ3A 1T7PA 4EBEA 4KFBA 3PG9A 2XY5A 1S1UB 3H9QA 2ZZTA 1KTQA 2G0EA 1K79A 1Y11A 4DR3J 1SJQA 3OL9A 4IFYA 2BOLA 3QGHA 3BDEA 3MPUB 4RW6A 3RPUA 3RJMB 2AYBA 2JFKA 3Q8YA 5J47A 2XMJA 2IJLA 2AJFE 9RUBA 1NPRA 1D1CA 4BDZA 4PFPA 4X4QA 4IUFA 3I58A 2OI2A 2EA2A 1ZQ3P 1LK7A 3KJFB 4C2MJ 1DPUA 1RT2B 3H5UA 4QJVA 1LQ9A 4KRWA 4CLWA 1KGSA 5D77A 1TK0A 1NPKA 4QYZJ 4C3KA 1TK8A 4DV2J 1R8BA 1DGRM 1ITPA 2R8IA 3HEFA 4YB6A 4OJHA 4WBFA 1ORKA 4LF7F 5HVFA 3VSLA 4N4NB 2F6CA 2B9YA 4OYMA 3LP2A 1CJVB 1MJAA 4OJ3A 2F4FA 2XGEA 1LUJB 2IJFA 3R5CA 3M3YJ 2OSRA 1S77D 3RGIA 1G4DA 4CGZA 1RTDA 3F23A 4EI2A 5JVHQ 1YW9A 1U2WA 1SD5A 5D0EA 3PQJA 3GIIA 4M9XA 1KS2A 1YS6A 1LPQA 1E6YA 3O8HA 1J59A 5A76A 3O6QA 4DUYJ 3DLAA 2E2JJ 5FKNA 1S1UA 3T9NA 4Y3CA 4PJ0C 3CULA 2IGNA 1B6AA 4CCKA 1CULB 5I3PA 4A3KJ 4XLEA 2QSWA 2DODA 5LSOA 5E17F 3MAQA 3TP0A 1N88A 3B4MA 5A8RA 5B1AH 3VGTA 2UXDJ 5D4RA 2X1CA 1SFOJ 1VRQC 4A46A 1ZLKA 2JEGA 4GO1A 3MD3A 1DLOA 4HACA 1SXLA 1N75A 2KT5A 4OINF 2L9SA 1W0TA 4V19K 2P8IA 4YFXF 4QW9A 5J2QA 4FF2A 2CU7A 3MWBA 4R8UB 5D6FA 1U2CA 4F91B 2KP6A 4PXEA 4F0MA 3TARA 3THPA 4Z2XA 3LP2B 3EGVA 2Y9HA 2V9PA 4G6VB 4WJBA 5FLMJ 5IP9J 3CCRI 2J5PA 1QSSA 5HBMA 1V5FA 2M30A 3MKZA 4LF1A 3GX4X 1UWAA 4DQRA 4IO1A 3G6XA 1YHQS 3ZNJ1 1S7AA 2JPBA 1KVKA 3G3ZA 4A0XA 1AFIA 3OS1A 5I3UA 4QYZK 1BD6A 2G13A 2XLKA 4WFBQ 2HNDB 4HR2A 3SXYA 1ZRFA 2X6WA 2RU3A 5IYBJ 1OISA 1L3VA 2H09A 1WI8A 1V3ZA 3NBPB 3OJUA 1GXUA 4YB5A 4FETA 3EVMA 2FF4A 2R3SA 5E3OA 2JN6A 5ERIA 3T9ZA 2DT5A 2M9KA 1BN5A 5KG1A 1IWGA 4DU7A 2W85A 2MSSA 1QPIA 3WGIA 4WFZA 2XG8A 1JGGA 1JLGA 4JUZA 2DGWA 3SJMA 2DNYA 1K0TA 2ASYA 4LQ9A 5HROB 4FYDA 2QMUB 1LW0B 3T1HF 5EZGA 4CXFA 3LAKA 1CS4B 2DNHA 2V4JC 4B3OB 1DQUA 4FBUA 1FTTA 1T8EA 4L9VA 1Y56A 5GAEU 4F50A 4AVZA 2F5DA 2IAIA 3IO1A 4OYXA 2W2OP 3NS6A 3PX6A 1U1MA 1I3OB 5B3SH 3PJXA 1E6VB 1IAWA 3TZYA 1RAFB 2F3JA 3NL0A 3R2CJ 1FZPB 2VIXA 4BWMA 4X4NA 2ZHOA 4H4KC 4RUBA 4IXAA 3FMRA 4G1QB 1G59A 1H7XA 1FXLA 1LDJA 2X85A 3HKZD 5H9EK 2W7PA 4B9SA 3J7YJ 3K4KA 1H98A 4ED3A 1N5YB 4IL6C 2BGCA 4GVLA 2QMWA 3GIJA 5J40A 3OYAA 1JJ2R 3AOCA 4A5MA 3AFHA 3VV2B 2R42A 1R5HA 1AU7A 4JV0A 3HULA 2VKZG 2N4DA 2CRLA 3B8HA 5TRDA 2KJVA 3C66A 3EDRB 3KX2A 3OYHA 2J6TA 2OUGA 1ZG5A 3QRPA 1R6RA 2EPFA 2O5RA 3OSFA 3AOBA 3L4BC 1IKVB 3SMZA 3PW7A 1HLWA 1GMWD 1KR4A 1D9DA 1JI8A 2M34A 3CJSA 2UXBJ 4I2QA 3GEZA 2JQ7A 3BS9A 3MFIA 1GFWB 5B0AA 2HQCA 2F4VJ 1U49A 1FDDA 5EDWA 4YP3A 3UN3A 2IM1A 2ZKUA 2HVDA 4KC5A 4PXDA 4CLSA 3F0NA 4B3MF 3NP5A 5D3GB 2UXXA 2F63A 3EWGA 2VC1A 1T9XA 4WU2A 4EO6A 2W01A 3CCES 4LF9J 1JLCA 3WC2A 4DEZA 1K8AT 5J8CA 2GOXB 1T56A 4TU9A 1I6XA 3KYCB 4AXJA 4Z37A 4DBRA 2WVCA 4EMDA 2C2RA 1TFYA 3LPYA 2DQLA 3CJ8A 4NASA 4UOCA 4NB5A 4U0YA 1FWKA 2CQNA 3BZQA 2C2DA 4MTDA 4JK1X 3AJ1A 3IP0A 4OU0A 4WTYA 3MM7A 1Y6IA 5IQ6A 4KJIA 3CJ2A 4EJVA 3ULHA 4ENNA 3DYAA 3G71S 2DN0A 2JSCA 3QOPA 1PUEE 1ZOTA 4CLZA 3EETA 4LR7A 4EUVA 1S97A 3ILLA 2H1LA 2DGTA 5DM7Q 5TISC 3EVOA 2IVYA 4TU7A 2BQUA 5E18F 4ZVUB 1LJ9A 2DGUA 5THWA 1RKTA 1UWBA 1VLOA 3ZQHA 3CCEI 1YW8A 3MZHA 2BY2A 5FKOA 3I6PA 1LWFB 3NGTA 2DQRA 2FUG2 1Z3YA 3DTKA 4J9OA 5EGOB 3O3LA 1PVEA 2X1FA 2YWGA 3P5BP 3WC0A 1TW3A 3V6DB 1VQNI 3WHIA 1CQTA 3VYUB 1FWLA 4M3FA 2FJXA 3FMBA 3P9KA 3BC8A 3CCTA 3MCSA 2EV0A 4F52A 3CUQC 1IG7A 1TL1A 4F92B 1WJEA 3CMES 2XWXA 5DDOC 5HDNA 4LIUA 2DR5A 4MNUA 1EZZB 2GMJA 2JA7J 2RNGA 3IBCB 3NEKA 1KDNA 3WGGA 4XK4A 5EDNA 1WC0A 3ET6A 1SH3A 4M72A 5BJRA 3GV7B 4NA2A 4K0KF 1HD1A 4RGUA 1B0PA 1VRUB 5EEGA 2DRBA 3M30B 2GX8A 2FDNA 2UXBF 3MMAB 1PCAA 6FDRA 1O0PA 5HN0A 3CJTB 5BQTA 1ZA1B 2XPWA 4NUBA 1AZSB 3OT9A 3W3SA 1STZA 1SFUA 2KYXA 2HVHA 4WFXA 3TKYA 5F1RA 1S6QA 2F7VA 2IJNA 4YS2A 1YX5A 1AYEA 2QSFX 4DQ2A 2KVIA 3JSYA 3MMJA 3K70D 1T05A 1RAGB 3GLXA 4GVBA 2LKPA 4XK8C 4K5SA 1N0UA 2PN6A 3N97A 1Y5NB 3J81Y 1QVUA 1BL0A 1OYIA 3G8TA 2C22A 2CW0F 2GO8A 2Y0MA 3OYCA 2OPSB 2BEOA 3ABMH 4TN2A 5F0HA 1O51A 2UVRA 4I7HA 1NSQA 3DKDA 4KGMA 1RUSA 4TY8B 1D5YA 2YPRA 1KP6A 1LFBA 3PACA 1QZZA 1VQ7S 3P49B 3WBZA 2Y8WA 2KMUA 2KJWA 4O3OA 3JREA 4LVOP 4MAKA 1RHUB 4FASD 4IHXA 3JSPA 3TR5A 1KN6A 3BR2A 2F4MB 3BWGA 4BHBA 5KFVA 2DHSA 2LEAA 3M8SA 3PKYA 2EV5A 1R0AB 1X4AA 4USVA 5F64A 4R0JA 1EJ7L 4CP5A 2FHKA 3Q9SA 2PD1A 1YIOA 1VRUA 5K8OA 1YBUA 3CDBA 5IXUA 3GE9A 4QPQA 3CJ0A 4UUSB 1F9HA 4OMFG 3LGMA 4H4MB 4HH0A 4LB5A 4HOBA 2EKNA 3KK1A 1FJLA 5LGNA 1F2HA 3LOUA 3X1LB 1Z2ZA 3PJ9A 3VGUA 2A6TA 3KNAA 2TCTA 2Q6BA 3CCSI 2YNHB 4NI2B 2HHSA 3K5PA 1DTTB 2XO7A 3BF4A 1W0UA 1VQ7I 2DFIA 4FTHA 2Y75A 5RUBA 4ANDA 3V4IB 4O4RA 1CJKA 4AIDA 3KLIB 3MFHA 5GTIC 3NMAA 2DRDA 1FESA 3DP7A 3FKJA 3ECOA 1CBKA 2W84A 5KFDA 5E3CA 4OX9F 1UVNA 2ZXIA 3R1HA 3THVA 1HNXJ 1RP5A 3KIOA 4LIVA 4NXMF 4YG2F 4NCGA 2AEMA 2L5QA 2X48A 4V1Ak 4PG6A 4PZJA 2OPRB 4M5JA 4ZZLA 4UZCA 5B0EA 3OSPA 2DYAA 1V5EA 1LWEA 2DYRH 2X1AA 4X0GA 3EDPA 4D9JA 3IAM2 4PWDA 3RKYA 4NLTA 2ZWPA 1G7CB 1ICEB 2HBZB 2GW8A 1EQMA 3H3VK 3OLAA 2MGQA 4DR5J 3UD3P 3G9CA 2ISZA 4JX6A 2CQ0A 3PDNA 3C2BA 1FNOA 4AYBN 3TUJC 2NR0A 1UL3A 3Q0AA 1NDCA 3QOEA 4UF4A 1XD7A 5L3CA 2DAOA 5KFYA 3U02A 1M5VC 4LIWA 1WJ9A 5DGAA 5CVRA 5GAGJ 1SJ4P 2GJFA 1CQMA 2A61A 4HRIA 2CPZA 3I0RA 2LY2A 1FJGF 2RUGA 5E0OA 2XVCA 2PFBA 1IBKJ 2KM8B 4FX4A 1WJCA 1JLBA 5LL6d 3GIMA 3ZXSA 4KH0B 3FBBA 1J2XA 1RT4A 2DD8S 4X64J 5E1ZB 2C2OB 1BBYA 1LNQA 3HVAA 3HYIA 4CCJA 4EZ9A 4M6XA 1YQHA 4C0HA 3K8VA 1RA7A 3ZR8X 3CO9A 4KYWA 1U02A 2JVHA 3ENWA 1X58A 1G3YA 3CCJS 2CAJA 3B78A 4RW7A 1LW2A 1Y8RB 5CYVA 2LFBA 2VXDA 3P5TL 2RHQB 1JX4A 1X2MA 2DA7A 3GR1A 2XKPA 1F9FA 4I0WA 4RLEA 1UHMA 4J7CA 4L5EA 3W2AA 2J0WA 3I9ZA 3FBIB 3N4MA 2VUGA 2VG6A 4F8RA 3ULQB 1M90T 4JV2A 2RDJA 1FI4A 1RBOB 3R7SB 4C8LA 1VTNC 3H40A 3MD2A 2QENA 4Y2MA 5CXTA 2HHHF 1NK4A 3ITHA 3R0AA 1C0TA 3AG1H 2CJXB 3EPZA 1FFGB 4MFBB 4DV7F 1FWZA 2LREA 3F41A 4F93B 2W8LA 1I39A 2MPUA 3T1HJ 2XSJC 3S16J 1T98A 2HZVA 1TW2A 2GBYA 4UQTA 3TO6A 3TO9A 4QZVB 5GAHU 1TKTA 1U5TB 2AU0A 2QA4G 1XN9A 3SZGA 2MQQA 5DD4A 4DNCA 1KQFB 2HQDA 1WFXA 4DN0A 3C3LA 2OPPB 3JYTB 1AKHB 2IRFG 1E3OC 4ECRA 4E7JA 3GJSB 1KU7A 1LWCA 4MIAA 4I6YA 1R49A 2I9SA 5LJ5Y 4Y2KA 3J80Y 2GZWA 1YVFA 4Z2YA 2XC7A 1MWZA 2AWZA 3KYLA 1LFWA 2W2NP 4IHTA 5I42A 1IC8A 2VQGA 7FDRA 4E6KG 4IR9A 2FIUA 2J9EA 2KIUA 5IT0A 2D5VA 3QAHA 3KG0A 2OTLS 1VK3A 3M9NB 2HBQB 2GXAA 5E5NA 1QZEA 4F02A 1SVOA 3BR6A 2G9OA 4Y17A 3L2WA 1HA8A 1KWMA 4LB6B 3I59A 5KFFA 2KO1A 4Q0BB 2VQFJ 1U1LA 1RBAA 1EKEA 4RB2C 4PABA 3QJJA 1WWHA 1QUPA 3C46A 2CV2A 1G1XA 1FJEB 4BU2A 2UUBJ 2P5KA 2XCPA 3ZZOA 2EV6A 1YFHA 1K7AA 4DSFA 3VYSB 3W3CA 3G4SS 2OP5A 1K83J 2KLOA 2XDVA 5J2MA 1JIHA 3D0SA 4MK8A 2OAUA 3K58A 2BV3A 1YIJS 3NCPA 3NOCA 3UW1A 2GXBA 2HIYA 2YPZA 2ALYB 1FRIA 5E3QA 1N34F 3VVTA 3G6VA 3Q24A 1S10A 1NJIT 1VQ8S 3ECHA 1U1QA 1B1BA 3MAJA 2IA6A 4Z7CA 5HLTA 5AE3A 1UZCA 4O6JA 5KT3A 2BE2A 3WTVC 2K4BA 4CLPA 1Q53A 2ZE2B 3TJ9A 5L1IA 3CCQI