1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN HP0162
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
1WJEA 3HPHA 1WJDA 3F9KA 1K6YA 1E0EA 4F3QA 1WJFA 1LFPA 3HPGA 1KONA 1MW7A 1WJBA 1WJAA 1WJCA
chains in the Genus database with same CATH superfamily
4M5MA 2I10A 4J9OA 5L46A 3JSMB 1FYLA 3WE2A 4OFZA 1I50J 3FXUA 2M8DB 3CCVS 5E3NA 2QMXA 3WC0A 2JEJA 4WXDA 5LHIA 3WTYC 2LSOA 1O5JA 4ITVA 2YPYA 3W9IA 1Z2LA 4WPAA 2RNEA 4RNNA 4E2FB 2L7ZA 1LB2A 4ZCLA 2YR2A 3BG6A 4LIWA 4R5PA 1FXLA 1SD4A 3HOUJ 3LGNA 1W5SA 2A3SA 2ZFUA 5IT4A 3PVXA 3TEDA 3U02A 2YQ0A 2J7UA 2PX9A 5BQTA 4TLQA 2DO7A 3BROA 2OD5A 2VQGA 3CD5A 4BJTA 3OUYB 4OAZA 4EUVA 1FOXA 4YDDB 4LSLA 4HX7A 1W2BR 4WK1A 3C2BA 3QO9B 4OYMA 3HD2A 3MFKA 1FD2A 1BLUA 2J9DE 4DX6A 1HYSB 2BANA 4JOUA 4WXOA 2QA4G 4G1PA 1KYZA 2BJ9A 3D9BA 3OTCA 1MW7A 4M3EA 2BVLA 4NEZA 3LP0B 1DRZA 3MEDA 2QQ9A 4ZVHA 3IWNC 5KFQA 1CGPA 2KHDA 4C2MJ 1PUFA 2GHPA 3K0LA 4FX4A 1N0UA 3C6TA 4M1KA 4A8SA 2X1BA 4ANCA 4IXAA 3T5JA 3OBIA 2XF6A 4RW4A 3GJSB 1NK7A 4HF1A 1P7IA 4B3MJ 5JLXA 1POGA 5I3PA 2OC6A 1S5ZA 2BOPA 2OEMA 3CC4S 2M8HA 3SCIE 4BAYA 1IKVB 3FXJA 4IVNA 2OSRA 3UFCX 1ODDA 4C8KA 4PJLA 3DLGA 1UFMA 1U5TC 5C5JA 4Y2AA 1B0PA 3UDLA 3K5LA 4A8XA 4YIFA 3LSHA 4NC6A 2F5GA 2IM2A 2ZH5A 4NRTA 2WAQA 2XAHA 1MMNA 2MQLA 1UFKA 4IL6C 2EC2A 2YUSA 3KUEA 5KNLA 3QGIA 2PQ8A 5LEKA 2NXEA 3BY6A 1TKTB 4GRSA 4N9HA 1MWQA 5AE2A 1UW9A 2FU4A 2DD8S 5HQ8A 1ZAXA 4CNZA 2A6MA 1DTQB 2KG1A 3OFFA 5L1IA 2JT1A 3BQ2A 1Y6IA 2OZ6A 2BYVE 4AIHA 3WU1B 2QSFX 2QQAA 3CVKA 2OPTA 1GQEA 4F67A 3F23A 2G2YA 2P2CB 3CMES 3G96A 1SH0A 1JMTA 2VBYA 2EZLA 2H6CA 3ZQLA 1S57A 3JSMA 1X4OA 4XICA 1H6KX 1HW8A 4BY7J 2UU9J 1TV6A 3JAMZ 1WKLA 5C25B 3LP2B 4ZVOB 1SVDA 3UCZP 3LSJA 5IYBJ 4R1HA 5CA5A 3FXQA 2RHQB 5DDPC 2HFVA 5F3TA 4PUSA 3H90A 1KP6A 3X1LB 5CVIA 4B47A 1G2EA 1JKRC 4FNIA 2HKXA 1LWCA 4CUGA 5J4YA 4KIFA 4A8KA 4NCAA 2K7LA 3D7SB 1RHMB 2KG0A 2WY8Q 4Q0BB 1RWNB 2AJQA 3OYMA 3FISA 2CJBA 1TU0B 1EH7A 4EVIA 2W9BB 5F8NA 5EJCA 4IRIA 3U21A 1NJIT 3OVSA 3H2VE 2CXEA 2ZXJA 5CYMA 4WK3A 1URNA 4ZVUB 3R0AA 4RGSA 3VQTA 1SKWA 4C6AA 4ZYGA 5ETRA 2GZOA 5LOQA 4C11A 4EYHB 3EICA 4M5JA 3UWTA 1CULA 5J1PA 3B4DA 1FX2A 3GCMA 5U47A 4XAKA 4UOFA 4E7HA 5HLTA 4WCEQ 2W9CA 1ZH5A 5KFEA 3BO4A 2D3O1 2D74B 2IEKA 1V9OA 5BS6A 4JI8J 5CQEA 2V9PA 2QM3A 3VWBA 1PUFB 3OFHA 4CZCA 3GONA 2EV6A 2F7VA 2A6OA 1KNZA 4TVAB 1JXEA 1NHVA 5D0GA 5HQMA 4IG0B 2DHGA 1GMVA 5FKKA 4L5JA 3R27A 1ZOTA 3UKGA 3AKZA 3HHGA 3KX2A 3QP6A 5CYQB 4BL0B 1R6VA 1T56A 3MZYA 2V79A 1IN8A 1OCTC 3NWSA 2FZKB 4ED4A 2ZM6F 3GCXP 1Q8IA 4RB0A 2ELHA 5HO4A 3EE3A 1HQ2A 5BYSA 4EJWA 2KRCA 2JFDA 1FZPB 1TBXA 2QYCA 2HURA 2I6WA 5F8LA 1TK0A 2HHXA 8AT1B 4S05A 4I7FA 1XSXA 3KLGB 2LF8A 5D8KB 2XGQA 2E1OA 2XO6A 2MHEA 2JMWA 5ERIA 5C24A 2XGPA 4L74A 4MFDA 5LBQA 4B09A 2J9DA 3H3VK 4YIRX 4BCAA 2R3SA 3BG5A 4ZHRA 2DNNA 4XDCA 3LOCA 1KU2A 2KL4A 3RRKA 5I3UA 1UEKA 4LBPA 2W4DA 1OSCA 1R9TJ 1XC9A 2YNFA 1K1SA 2E66A 3QATA 2EV5A 1E6YB 5HMWA 4PKDB 3RPUD 4RB3C 5D0RA 4PUOA 3DOKB 5FD1A 3DRRB 4A8FA 2ILZA 3AJ1A 4KT0C 4NRUA 4EZ6A 4UY8I 2MLXA 4ECQA 3OTEA 1RAFB 1I27A 6FDRA 1K6YA 1NKCA 1CULB 3MZ8A 5FDLB 3G6XA 4NLVA 1XD7A 4F2RA 4CLKA 3TARA 4ZVPB 2LP4A 3BBFA 2KISA 3TQNA 2OO4A 4HNVA 2R5ZA 2Y0SA 1U6GA 2BZ2A 4OYBA 2EZIA 1HW2A 1Q81T 3MM6B 2N82B 3S16J 2CPYA 3QMQA 1JKPC 2FY1A 3OYFA 1YJRA 1X4CA 3VEPA 5HDNA 2RU3A 1TL1B 1KSPA 3LA2A 1IBKF 2KB2A 1HXDA 1K44A 2GNKA 4DN9A 4P7VA 3GZNB 3IGNA 3TYTA 4HEA9 3AG1H 1XWLA 2CGPA 2XZWA 4FN5A 3E2EA 2IFXA 3LL7A 2L4MA 4X84A 4A0YA 4UVBA 1S9FA 4DU7A 4XLCA 2LXFA 2RKIA 3IRXA 2H1LA 3I56S 3L4BC 4F4KA 3KHRA 1JIHA 2DXIA 4NZ6A 2QVOA 3MMBB 3QRPA 2LA4A 2VASA 2B9EA 3UCUP 3H3UA 4UUSB 1RTJA 2GIRA 4U8YA 2QF7A 2Z2YB 3CO6C 1TL7B 3FRZA 4TYAA 3S1QJ 1RHRB 1U8BA 5D4RA 4DUTA 2EQRA 1S97A 1C4AA 3H5UA 2VE8A 4DDFA 3TJ9A 4KPCA 4KGVB 4I0BA 4ZP6A 1RTJB 4FETA 3E6BA 4DFJA 3RUBL 3LSRA 3SYTA 1W36D 5FD5A 3HMJG 5JR3A 1Y5NB 5FRNA 4IOCQ 2FBHA 1DURA 1IR0A 1NKEA 2QYGA 2JA6J 3V8LA 3R7SB 3BCAA 1RSCA 2KZGA 1UEVA 2H54B 4OL8A 2MLYA 3FMWA 4WZMA 4NC7A 4B43A 2L9RA 4GO1A 1G3TA 2UUWA 3ERMA 4R8HA 4KGMA 1U5TA 1TMMA 3I87A 2EB7A 3OSFA 1T95A 2N4CA 1GTHA 2IT0A 2EEYA 3HLUA 3PL8A 4OLOA 2R7SA 4CLZA 4P9UA 3TVZA 4A0ZA 2OF7A 1UMJA 4B3MF 2ELJA 3NEKA 3FCVA 2LDUA 3KLIB 3RB0A 3DGVA 5B08A 2A5YB 2G2OA 3WTUC 1FVSA 4LK0F 2P5VA 2K3KA 5IWAJ 4C8OA 3VYSB 2W9BA 3QAHA 1TUGB 2DNKA 2DTJA 4TV7A 3E6CC 3R5GA 1FRKA 1NAQA 3MGJA 4O4GA 3GYHX 1JLFB 2LK2A 2JLFA 1NK9A 3H5NA 3C19A 5DLGA 2HQ5A 2IA2A 4E4HA 4QW8A 1C0UA 4QYRA 2K7KA 4KIBA 1DBDA 3OXGA 1ZM9A 3NKYA 5HVHA 4HHHA 4A12A 1DY3A 2F4FA 2LVSA 2K85A 1OYYA 2Y0BB 1O51A 2W1BA 3MFHA 2IP2A 4Y65A 2H8WA 4JI4F 4LR9A 5J1YA 3IXQA 1RT7B 2ACJA 3GTLJ 4FF1A 1U47A 3UE2A 5MAOA 4PR6A 3F8CA 4RNFA 1VRTB 2JEGA 1LQ9A 2XGCA 2B8PA 4ZPDA 4NOHA 4XO0A 4RW6A 5IV4A 4OHYA 3WZ0A 1S1XB 3EDRB 4WF9Q 3UW1A 4OHWA 5FLXZ 2AKWB 4PZVA 5ETPA 2AHQA 1VQKS 2VJ5A 1BOAA 1AKHB 4G3IA 4ZPCA 2AJ0A 4ENMA 3D1OA 2X51A 3OR1A 4LF1A 5TRDA 2KXNB 3P5TL 4CCMA 5C4JJ 3I64A 2CDQA 1VQOS 1U2CA 5K7ZA 4JI1F 1OPCA 4QIFA 2G4BA 3KETA 3WIUA 3DXJF 2VODA 4GVBA 1MH4A 2W25A 4XIUA 3V81A 3DGPB 3D0HE 4F0MA 4IRDA 3E5XA 2DHHA 3DFEA 3VAGA 3GX4X 1RP5A 1O3QA 4U7BA 2QL5B 3JSRA 5KFJA 3QWLA 1VJWA 2VKDA 3HRTA 2W7OA 4F25A 4HNUA 2OKQA 1FFSB 3D68A 4BXXJ 1EB0A 4JI0J 1GH8A 2OV7A 3VV2B 4HH0A 4IR1A 1XNRJ 4X64J 3CF2A 3CCQI 1YRTA 4HRIA 2DA5A 2QBYB 5I42B 2VUGA 2C2RA 1MH3A 3F3XA 4RDUA 2OIHA 3A3NB 5KFKA 3MWBA 2Z2ZA 3IC1A 1WHWA 3C14A 2F40A 3ENQA 4RW9B 5AXKA 4P72A 1GXLA 3DOLB 1ZLJA 4ILMA 1P6RA 2FXAA 2P5LC 2VQFJ 4HAMA 3BN7A 3DRXA 3ERED 4DS5A 4XLPF 2BACA 1XTZA 3PX6A 1J5EJ 3S1NJ 1B9NA 3TZYA 3HGGA 3V8JA 2RAQA 4Q44A 4G7HF 3MXHP 4ED8A 1QD1A 1LWCB 2DHXA 5CZVA 2UZAA 3KJQB 3SZ2A 1MSFC 4EBCA 4U0VA 1K0VA 2W48A 4NLUA 2M70A 5BYRA 1MLAA 4G94A 1QAYA 2XPUA 1C0UB 3C18A 4A3KJ 2IJNA 3BBBA 4P74A 3DPLC 1S4FA 2RQPA 4A8OA 3D67A 3I4PA 2BQRA 3BGRB 1Y8RB 1RTDB 1R8HA 4FYVB 2R8GA 3ZZZA 1WDDA 3R2CJ 4A47A 4UZBA 3PQJA 5LXYA 4ZKAA 2ME6A 2F6CA 3RB3A 3I4NJ 2LCWA 3OLBA 4TYBA 1IKYA 3R1LA 1UHWA 2DA7A 1SBRA 3QIDA 3PQKA 3NLCA 2J76E 5FJ4A 1X5PA 2E1MC 3KP5A 1B72A 1EH8A 4DSLA 1E17A 2HQ3A 4A3MJ 3TW6A 4ABZA 1F2HA 1ZYRF 5M5YJ 3IUOA 3BJYA 2KJBA 2XAUA 3CJ5A 4J5OA 5IOYA 1KQFB 3JSOA 2DITA 4YELA 2MY8A 1RE1B 2WAQN 3TO9A 2DA3A 3GBGA 4A5MA 3FC9A 4ZVGA 2ALZA 3I5BA 4H4OB 1N8RT 4J7CA 3U1DA 3KYCB 2L5QA 2XI3A 2VQEJ 1CJKB 4B8XA 3BTIA 2VBWA 1K7AA 4KMUX 4X62F 3THPA 1XK8A 2BY0A 3TW7A 2IS1A 2ZBQA 4OIOF 1XB4A 3OYEA 1FJCA 4IH6A 1CQNA 3NGRA 1OISA 1JJ6C 1K83J 5DM7F 1Y1WJ 2MMYA 1BR1A 4RUAA 2HZDA 4YFNF 4Q5VA 2FC9A 5H9EK 2R7WA 4KO0A 4FYDA 3I58A 2VPRA 3LP2A 3NGUA 2VICA 1JX4A 4EWTA 3NY0A 4YB5A 2WTFA 5KFBA 4M5DB 5E3RA 3P6YC 1RCXB 2DRDA 2V4JA 3AAWB 1OS5A 2OCCH 2LFVA 3VTIA 4FXWA 1SQFA 2Q0OA 1JLAB 1UTAA 2R2TA 2HEOA 3K4MA 5E0OA 3BO2A 3BG3A 3CPWR 3IRQA 3ET6A 2DXDA 1X0PA 2B9WA 2V8HA 3RB4A 3KMSA 3J80K 2VUMJ 3I96A 3F8NA 2HQAA 1D0YA 5J2NB 4C8LA 2AV5A 2CS3A 4A3EJ 2RDDA 2N7CA 2RKHA 4BWMA 3BZQA 4IOAQ 1VISA 2VZ9A 2QL9B 2J0XA 2D3UA 4ZJOA 1P4AA 4K59A 3AAFA 3OYIA 4LSNB 1RT3A 3ETOA 3BR2A 4MTDA 5IP7J 4HL9A 3KLEA 4P2SA 4A3LJ 1K78B 4WP9A 3V6JA 1TT0A 2Z2MA 1X0FA 2FX0A 3WTSC 2HBZB 2XVCA 2VF3A 3EVWA 2DYAA 1NLKL 1RQ0A 3MKWB 4A5NA 2H6BA 2LRDA 2BBEA 4DR3F 3GWZA 3HJEA 4QPQA 5L39A 2I2YA 1B4AA 4BE1A 4CICA 3DKDA 1QNTA 2LMIA 2CRLA 4LF5F 1APSA 2R8JA 1LK5A 2L9VA 1XGSA 1WEXA 1LWEA 2XGEA 1H72C 1MN7A 2W4CA 2QEXS 1R8AA 2CPZA 4KITB 4IG3A 1V3ZA 4J9RA 4OJHA 2GA2A 2IS6A 4P75A 4K7QA 1HC8A 3PJWA 2CNKB 2KVQE 3Q5FA 3A02A 2XHCA 2Y1RI 1GTEA 3SDEA 1R43A 3MMAB 1YFHA 2O67A 4B3TJ 4JV5J 3GO5A 4WX9A 3V6KA 4XKWA 2JJ7A 1RKIA 5ETSA 4CI0B 1WC5A 1N25A 2ZWPA 3EMTA 5KG2A 1Q8LA 2H51B 4BDZA 4IYQA 2CUEA 3OL7A 2M4KA 4WCGA 3SFZA 6FD1A 4M5KA 2MZRA 3CC2I 4AIJA 4ED7A 4ZA1A 5JXSA 2JPBA 1FJEB 1XSVA 2XB5A 2I9SA 4HDGA 3M8YA 3FNNA 1O3TA 4C3IJ 2YQ3A 3VAHA 5IM0A 5F64A 4NZ7A 4O6JA 3VOEA 2HAIA 1KKHA 2C6YA 3LAPA 1Z9CA 1YRNA 5D8LB 2GOXB 2RU9A 4DV4F 1R4NB 5B0DA 2QGUA 5J1EA 5JVGQ 4OJ3A 3OL6A 4A8QA 2J9EA 3JRCA 3MTKA 1XG1A 3MR3A 4XLNF 1IKWA 4QR2A 2DHSA 1BI0A 3GMGA 1AU7A 3U2RA 3EWGA 2O61A 4PRFA 3I5AA 3W9JA 2VG6A 2O01C 2NZ4A 3CCLI 2V2ZA 3VQSA 3QAUA 2WC2A 4O5VA 3T1HJ 2HDDA 1HYSA 2XC9A 3CDLA 4I2OA 1UP1A 2ZKTA 1RWMB 3MR2A 2ADBA 3M8PB 2ZC3A 3K4NA 5LSLA 2IGKA 4ENKA 3HPGA 5AE1A 1H0HB 3T1YJ 3HJVA 1Z3XA 2JN6A 3DRSA 1OR7A 1JLQB 2G0JA 3D28A 3DYAA 3O2PE 1ZQ3P 5BPDA 1NJZA 5GVQA 3PW7A 3T1AA 1L5UA 3LSKA 4P6QA 4TY8B 1D0XA 4R8UA 5HK4A 5ILVA 4KN4X 4OAYA 2CO5A 3WTTC 4ZDNA 3CJQA 4DV5J 2R4FA 2DGTA 2MDAA 4NXMJ 2AEFA 2YKMA 3IRXB 1RK8A 2Y8YA 3KLHA 5D0EA 1HSJA 3OVBA 3BPXA 1XMOF 1XCVA 2GS8A 3PXGa 1RT1B 3NG8A 4DR4F 4CTAA 2FMLA 2DCLA 1IGNA 5FIIA 4MEXF 1BR4A 1M5HA 1OYWA 4IDKB 2YSRA 2PFBA 2MJUA 1KQGB 3PYGA 1LEOA 2AJFE 3NRBA 3SV3A 2XASA 4JX5A 3SQOP 2DH8A 2V7FA 3HULA 4EGZA 4S04A 2Z8QA 4J9QA 2IRFG 4GGGA 2HMIB 4RGXA 3KHLA 1TC3C 1J5YA 1GXUA 4DV6J 2KPMA 1KGSA 1VI7A 2K06A 4I2PA 1S49A 2UXCF 2G13A 4CO2A 2K7JA 5K9FA 2ZWOA 3QRRA 1OKRA 2CQBA 3PG9A 3JS9A 2DJWA 3DMJA 4XRMA 1VQ4S 3HSDA 2BXYA 2GMJA 4OIXA 2TCTA 5I42A 4UVCA 2MABA 5L3CA 2QBYA 3ZNJ1 2MB0B 5LT5A 2GCFA 1TFWA 6PAXA 1AW0A 4OZLA 1SQEA 5F1RA 2DCUB 3MKZA 1IF1A 3QPHA 2W00A 1Y00A 2UXDF 2JA8J 1VK8A 4KHPJ 1CJVB 4I4BA 3A8IA 3MZIA 4Z7YA 2Z99A 4ID5A 4YOEA 3QFWA 6AT1B 4CYCA 2CG8A 3TX8A 3V8KA 3M4OJ 2MQMA 3HCXA 1RBOB 1RYSA 2C3UA 2H48B 5IPAA 4L5IA 1M5VC 1X7VA 4ELUA 2NPIA 4EV0A 2GM4A 3KMQA 2X6XA 2DRAA 3H0PA 2ICWG 4Y00A 1S76D 2HEKA 4KTQA 4KMFA 3US5A 2AQEA 3ABMH 4PYDA 1T9UA 2IMWP 3UVJA 1SL2A 4CM2A 2O66A 2WONA 1LOUA 3ZN1A 2OPRB 1S0OA 5L1LA 4BS2A 3FZVA 1Z7UA 2OMOA 1KBRA 2LQ8A 4M5NA 3BQYA 3IBFB 1R36A 1Y56A 1N32J 2Q6CA 4L72B 4KFCA 1NB2A 5HSPA 3FEZA 2JVRA 2BJEA 3K2YA 3C7JA 3K2ZA 1P27B 2M8GX 3NQOA 1S6LA 5J6XA 2LC2A 1N78A 3KK2A 1R8CA 4I7HA 3ILJA 2IAIA 3SSQA 2HQFA 3SBMA 1Q7LB 4ZP8A 1X4EA 3JAMU 4ZCIA 2OU2A 4LFUA 2VC1A 1FK9B 4ETXA 1HPZB 5F8GA 2LVWA 3I71A 2JC0A 1IBMF 4QIEA 4OYOA 3LA0A 4ANEA 3PNTA 3S1RJ 1HBXG 3RKYA 1KVJA 3O6BB 2HVDA 2V4RA 3ELKA 4K5SA 2XUBA 1LQ1A 3ITHB 4KPYA 3B82A 2ZNYA 2ADCA 2ZH8A 3BKTA 4PXDA 2IC3A 4I68A 1O6XA 2RRAA 1T9TA 2PMWA 4B9SA 2LKXA 1NK5A 3ZR8X 2P5KA 3GWCA 3A3OB 3LWMA 1XDSA 1BW6A 4OI6A 2HZTA 3R7BB 2RNJA 1YGYA 3VODA 4GVLA 3FXLA 4KGZB 1QJHA 4E7KA 3K70C 5KT3A 4B9NA 3K5OA 1CG2A 2YBVA 2EINH 3LF0A 4MIWA 2CQDA 3TBIA 4PZJA 1AROP 1H2VZ 2E9TA 2MSSA 8ATCB 1ZG5A 3ENWA 2V8VA 3J7Z5 1X3ZB 3F0NA 3WQPA 5J2MB 1IZ1A 4M5LA 1MMGA 1UJ5A 5ETOA 3TAPA 2F9JA 2LR8A 2QUFA 3HTUA 4DI6A 2XHKA 4U6PA 2HDWA 4AD9A 4JI2J 1WFXA 3BLYA 1QE1B 1YQAA 2KT3A 3GIMA 2JA5J 5GAHJ 3H35A 3HKZA 4AE5A 1RLCL 4RJVA 1M1HA 4NLWA 1E6VA 2ZH6A 1Q8BA 3NARA 1RKJA 3D5SC 3LUYA 1ZLKA 1IBLF 2DO4A 3S2DJ 3MPYA 4CRJA 1XEZA 3EPGA 2QX0A 5EN1A 5DDRC 2MQPA 2Z16A 2PBIA 1NZAA 5DDGA 3FXOA 2FC8A 4UQGA 3VYUB 2ME0A 4C9YA 3M3YJ 2XAFA 4CH0S 2AMCB 1RHUB 4DXLA 3UN5A 2HNYB 3S14J 2ID6A 4ZP7A 1MSWD 3MM6A 3Q3SA 5H9FK 1YG2A 1PJ7A 3B4MA 5HVGA 4IO1A 4DCPB 2PJRA 3O44A 2RH3A 4PWUA 2CPEA 5EUHA 3X2QH 4QIWN 3J7AO 2VFVA 1U6BA 1U2RA 1BBYA 1U02A 4K2JA 4LQ9A 5CZXA 4EO6A 4JI7J 3GG1A 2XMMA 3Q8QB 2FJEB 4ED6A 5CYQA 7FD1A 2C1EB 3TO7A 4ZZDA 1ZRFA 2XEXA 2RDPA 4RAZA 4MTPA 1VBKA 1U24A 4KYZA 1GT8A 4AYBN 3UDCA 3KK1A 3CCLS 3WTVC 4WFNQ 3GW2A 4AVZA 3HL2A 1UW4A 1JKOC 5GADJ 4NXNF 2DTRA 1VRTA 3IP4B 4CIOA 1HWJA 3BF4A 2F5DA 3GYXB 3LGMA 1EETA 4CH7A 5HANA 2C2ZB 3CCRS 2HYIB 3ZNUA 2AWZA 3TR5A 4AQYF 4LG0B 4URGA 4ZHRB 1H7WA 2V8GA 1BIAA 1VC5A 4J01A 5C7PA 3E3XA 5A2QZ 3CCJS 2VA3A 4CGZA 2A61A 2AXLA 3T6BA 4XKCA 4LREA 2CPIA 4LFCF 1H38A 4BQOA 4EATA 3UCGA 1W4MA 3GZ5A 4ZPTR 2APOA 1X1DA 1H89C 4N8OA 1V3FA 5K5MA 3R0JA 4F3MA 1RZ4A 4NLXA 4AU7A 1SPBP 3BCBA 1PJRA 4BH9A 3IG1B 4ZOSA 1NDLA 2HHTA 2BBYA 5KOXA 2GQ2A 2LYVA 4LFCJ 3MCOA 3RRHA 1U0SA 2Z5UA 2Q66A 4XQFA 1RYRA 2BX6A 5DGBA 1GHCA 2C2MB 2EG1A 4ZCMA 1O3RA 4F4XA 2PN6A 2AYGA 3E3VA 1X5SA 3O1LA 4D9JA 2WOMA 4ESBA 2HHWA 2VJIA 1T08B 4NL5A 1VIXA 2QA1A 5THWA 4M9SA 2IS2A 1S4EA 3HVAA 2FQQB 3S1MJ 3LMMA 4RGUA 2HFSA 3M1CA 1K6OA 5F0WA 3R6SA 4W98A 2NCKL 2MGZA 1VQOI 5JJBA 1WC6A 3PHTA 2KTQA 3A0HC 1Y5IB 4RW6B 1VIOA 1EP4A 1NEEA 2HVHA 3M2UB 4XNFA 2W8KA 3REOA 1SFEA 3CJRA 3ZO7A 4EM2A 2JUCA 1X1CA 2BE2B 4O3OA 2CUJA 3GTMJ 1EARA 4OI4A 1RT3B 2WSEC 2DOFA 3S3OA 2XNRA 3VR1A 4CLLA 3KJVB 2DH7A 2KDOA 1T0TV 2QLWA 3HC7A 2KZVA 1AWCA 1SI9A 1JTXA 4DV3J 2KL8A 4QBUA 4EMDA 3KJFB 3H1CA 1ZZFA 2H4WB 5D5VB 2QSHX 4R0JA 3MAJA 5KFGA 1ZHFA 5IOLA 1YI2S 2WY7Q 1HBNB 1YG0A 5F8JA 1WNEA 1FWLA 1BIBA 3H42A 3BPSP 3OL4A 2CVIA 4WFZA 2UUZA 3I3LA 1HQUB 2Y75A 2ROPA 4A2UA 2B0GA 5KG3A 4W92B 1FWKA 1FP1D 2D9PA 2EK1A 2MZJA 3L2WA 2HHPA 3TZZA 4ANJA 1B0VA 1WJFA 3CDWA 2NVXJ 4W1UA 5KFZA 1IR1A 3J7ZT 4LF4F 4PJJA 3V7RA 2GHWA 1J5EF 2UVRA 3GCWP 4JI8F 4MNUA 2KT2A 2ZNZA 2HXOA 3LAJA 1MBHA 1T8IA 1X4HA 1XBWA 3FK4A 3PFYA 4L0ZB 3PTWA 4IFYB 1Q16B 2AGQA 3GLXA 5A0YA 5DQIA 4LF9J 2XAQA 2CWXA 2WCXA 4E7IA 3DRPB 4CT9A 4KFBB 2KU7A 2BXJA 4C3LA 1R8BA 2BJDA 5AIQA 2CPDA 2I5UA 1CJUB 2GO9A 1WJAA 4P96A 4ENOA 1QRYA 4HI2A 1JLFA 3GU0A 2DU9A 5MLCV 4WZQA 1S1TA 4ERDA 1YIOA 4EEYA 5IQ6A 2IM1A 2CPXA 3MEGB 4G1IA 2PIIA 2W7NA 1YO5C 4JI1J 5DCMA 1OYDA 1G6BA 3SEOA 4CH1A 2PT0A 1X9WA 2ZHAA 4OZJA 4DPUA 3A4CA 3LQRA 1W26A 1Y3JA 3SQNA 2BHYA 2QA2A 4L9TA 1RT2A 3FSIA 2XSJB 4X65F 5A8KA 1TAUA 2BKPA 3JAMY 1KVIA 5E5NA 1Q78A 4FZVA 1I5OB 2GA1A 5CYMB 2X3GA 2WB1D 5B0EA 3ISND 1KQ0A 5GP9A 2FJXA 4X4NA 2X85A 2UU9F 2M88A 2L08A 5JVHQ 3CJQB 1A7GE 3CJ4A 4X4QA 1IBMJ 2UXBJ 4DQSA 4CLFA 1GK8A 2V2QA 1WF2A 4NLTA 2ZUAA 1HFEL 1BGXT 1AHDP 1TKDA 2K9NA 1NXIA 4LQ3A 4PGGA 2ESHA 2LNBA 2E34A 1SJ4P 1X4GA 2DR8A 1RUNA 4OZ0A 2FJBB 1UHSA 4I76A 3MR7A 1VQ6I 4DJAA 1TFYA 5HS8A 1WJ9A 2Y8WA 3ZTPA 3I56I 4C0HA 2XV4S 3BPVA 3MMBA 4LF9F 3VHQA 2AQ4A 2EKYA 3KHGA 3ABKH 3I0RA 3E01A 4LD5A 4DPYA 2BM0A 3K70D 2MXYA 1R7JA 4DSIA 4HLBA 2P7VB 2CZ4A 1HNWF 4ES2A 4DV1J 1HNVB 4ELTA 1AT1B 2IBOA 2RRNA 3BKFA 2V1NA 4IEJA 1PP7U 2EIKH 4U87A 1VQ7I 4UB6C 1QGPA 3AXKA 2KM8C 2W2OP 1LW0B 2ZOGA 3W63A 2MD5A 1W25A 1VFCA 3A12A 1FPQA 2CJ9A 5TGTA 5IT3A 1A0OB 3U1KA 2NSBA 4ZVSB 4PUOB 4DJBA 2JEIA 4F4ZA 1HIYA 4U9RA 1PBUA 3PUFA 3GMEA 3MURP 4AL7A 1HNZF 2K02A 4C48A 4LF5J 4AYBA 1DLOA 3BG9A 3KLOA 5CKTA 1XMBA 3SYZA 1P1LA 3W7BA 1PYSB 3IS9A 2ZH7A 4HOBA 2YWEA 2N3LA 2DGXA 1VI0A 1U1RA 1TTHB 3FDSA 1DQ8A 3NGSA 4JBCA 2HRYA 2PI5A 3A03A 3BEGB 1ETXA 3WGIA 1BY9A 1UFLA 2EIJH 3Q0VA 2AX1A 3THVA 1SC4B 2K86A 2EA2A 3HSFA 2SXLA 3D6FB 3IR6B 5KCMA 1RRJA 4UUTA 4NA1A 2OSQA 1MNDA 3SQGA 1IVZA 2M8EA 1YI2I 1IKWB 5D77A 4DV6F 2FF4A 4DW6A 5CH7B 3HHLA 1RNLA 1W5CC 4WKYA 2OPQA 2FOKA 1FXDA 4RLFA 4LG3A 2A3JA 4RU9A 5KT2A 2IPQX 3ZFVA 1BQXA 4R25A 4W90B 2XDVA 3ZXSA 4CDGA 3UDVA 3MUVP 2F5EA 4WXWA 4J37A 5L3BA 1TMJA 3PRDA 1ZR4A 2FQ3A 4EJVA 4RLEA 1YW9A 3AD8C 5H6QA 1CC7A 3BKUA 1RC9A 1N34J 1Q53A 2IYGA 3RU0A 3C16A 1I94F 3QU3A 3MM7A 2LH9A 2J5OA 2OPRA 4YMEA 2EFNA 3F73A 2M7SA 1C1BB 4YFUA 4G6TB 1VYAA 2HIQA 4JI5F 3PW5A 1NPKA 2BMBA 4P2MA 1AZSA 4HQEA 1ZAOA 5H6RA 2K9LA 2KH9A 1XMQF 1EAYC 1SV5B 2FNPA 1IXKA 5GAEI 2RVCA 4BHQA 3AJ2A 3HOXJ 3FMBA 4IRCA 2XSFA 5D78A 4YB6A 3FM5A 4RM2A 2P0WA 1BXNA 5FLVA 3KG1A 3LSMA 1RDRA 3L2VA 2YPRA 2FOWA 1QPIA 3PV8A 4FASD 2QWWA 2MZSA 3M2RA 1A04A 4QIVA 4OU0A 3GLJA 2L7KA 4RW7B 3OYBA 1ZN2A 3WG7H 1S7IA 3IKVA 2J6SA 1BOBA 4HA8A 2A05A 1MKMA 4ID8A 4MYTA 1V5EA 3SI8A 2JRTA 2B9SA 2LKSA 3K4LA 4KKOB 1H74A 2L9WA 2HRTA 4ZYAA 3MM9B 5DDOC 2JRMA 2J5AA 5IM0B 3GG0A 3FSYA 3SDGA 2YWFA 2XKPA 3HHLB 2HFUA 2RREA 2XLKA 5LRSA 3KWMA 3TVYA 2FJVA 2UVWA 1R22A 3NAUA 4AUXA 5K8MA 2HWTA 2R7QA 3CMEI 2RD5C 5D4NA 4DF8A 3ISPA 1BA5A 3I9V9 4E6KG 2CKWA 2Y0MA 2VQLA 1CF7A 3T5KA 4NHJA 2IPOB 2IBKA 4LF7F 4AUKA 5HVQC 1QVUA 2HXIA 1UELB 4QR1A 5LSOA 3WDOA 3JRAA 1FLIA 5HBMB 2V9WA 2H65B 4M71A 2MH2A 3FX3A 1N0VC 4OHXA 2AP6A 4WF2A 3DTKA 2HFZA 4YY3J 4ZLJA 2CQ1A 1UZCA 3CXCR 3DCFA 2HVSA 1H9TA 4CYCB 1T9VA 1U7LA 4MJKA 2DGSA 3BJ6A 2O3DA 2CV0A 2HOAA 1OLTA 2O7OA 3OIQA 3H2UB 1A35A 1ZR2A 1Z77A 1S9GA 1QTMA 3TAQA 1TP7A 5KFIA 2GFFA 4A6EA 4CO5A 4AD6A 1MDMA 3Q0WA 3TP3A 2PFDA 2K27A 1G4DA 3DRSB 1F4KA 1HBNA 5E41A 4EFAC 1D8YA 2MA3A 3I0SB 2JSPA 5F04A 2O9LA 1XNRF 3L2QA 1HMVB 3PR5B 2I0XA 1NG7A 2F5FA 3MI7X 3CCYA 1SH3A 2Q43A 3OV8A 1NMEB 5CQGA 2WADA 1BQNA 1DARA 4DPOA 4B9LA 5DM6F 2FVPA 2HFHA 3R3TA 5A2QU 1P2FA 4DFMA 3EDPA 3VZHA 2GW8A 1HOMA 4C8NA 4UW2A 4IH7A 5FKLA 3D5MA 2DT7B 3WIVA 2JQ7A 4CDIA 4OYPA 5EWGA 2KZMA 3RBZA 4D1QA 2NR0A 3BTJA 4DSEA 1WORA 1MMSA 3CCUS 3R5AA 3BV8A 2OUGA 3ZMZA 2GO8A 1LFWA 1LK7A 4UQTA 2QFIA 1YZ6A 1QSYA 5IT0A 1X4DA 1HKQA 3L7OA 4MEYF 2EZHA 3GJRB 5J1NA 3J81j 2KJCA 1KD1T 4U88A 2HVQA 2DMNA 2XLIA 3TZXA 3JSBA 1VR6A 2PA8D 4DR4J 1HD1A 2LREA 3MEEB 5KT4A 4D5FA 2FUG9 5HNHA 1CPZA 1ITPA 5EDNA 1FTZA 2ZM6J 1N77A 1H0MA 1LXNA 1QTNB 3B6AA 3CF5Q 2W2PP 4MFBA 1HHTP 3BR3A 4DPTA 4KDPA 4J90A 5I3QA 1R0AB 2V34A 1HI8A 1YLXA 4H54A 3K7AJ 3Q89A 3KYLA 2VKZG 4A8YA 1YKWA 4MYUA 5L8RC 2K40A 4NLGA 1S0NA 2NUUG 5AJ3F 2Z9OA 3CDBA 3D6MB 5DZ6A 4TLRA 1WCMJ 1FFGB 3EPIA 2GQCA 1H98A 2VDIA 1TKZA 2G0EA 3HI9A 3D1HA 1UZHA 2L41A 2X0LA 2L48A 4RBOA 2J0QD 5E8IA 4DBRA 4WJBA 1VGYA 3K4KA 3K4CA 4NQWB 4I6YA 4M94A 3MCZA 5DZ7A 4QYZK 5D15A 1QVTA 2MZQA 2JSXA 3IKTA 4BQQA 1HNIB 4IFVA 2ASLA 1SC7A 4FDFA 4Y28C 1Y9OA 5F0HA 4PXBA 3V4MA 2TRTA 2P6SA 1R0BG 2M5YA 2W84A 3Q2SC 4MIAA 4X1EA 3Q24A 2JH3A 4PG5A 2P81A 4KRWA 2OCEA 4M3GA 3QT8A 4XONA 2NQPA 3QQCD 1C1BA 2NS0A 3FEYB 5EYRA 2YU3A 1KDNA 2XMJA 1H88C 5HMXA 3K7RA 5C42B 2BM1A 5K1YA 2V9VA 3C16B 1SVLA 2BJ3A 3UR3C 4FE7A 4KV8B 1F2GA 2G9WA 3EYZA 2IVFB 2D9OA 3QZ7A 4FYWB 4MT1A 1UMQA 1A31A 3ET6B 2EFQA 3U27A 1RAJA 1JLGA 4LG0A 4DL7A 2NAZA 1X19A 3VSLA 2HU9A 1Q0NA 3CDEA 4PFOA 1FTCA 2MKKA 4NXMF 2IAJB 2ECCA 3ABTA 3PZPA 4Y2CA 5K14B 4JYKA 1B70B 4AC0A 9ANTA 1Z6TA 4DPWA 5D5XB 4C2MA 3AFGA 4OHVA 2Q79A 2J0SD 3VAMA 4J9SA 1J5OB 1KHWA 1N5TA 3R2DJ 1YOVB 2VKEA 3IO1A 1ITYA 4H4KC 1NRKA 2DGOA 2RN7A 3D0GE 2F4VF 1T02A 1FC3A 3IS9B 4NLQA 4LK1F 2M7AA 2C3MA 3CJKA 3RGIA 1AFJA 2QMWA 2C2OB 2HLTA 1VK3A 4U8VA 5F0FA 2ROGA 4A4JA 4E7ZA 4WE1A 5L9XA 3TJAA 2ZXHA 2KM8B 1IWAA 2ABYA 5F9LA 1FO1A 5KAIC 1DJ0A 2V8PA 3FQLA 1ZGAA 1M90T 4P9FA 2XB2D 3CCMI 5EEHA 3TO6A 3NAIA 4XL9A 3C15B 1QAXA 1ZM3A 2ZJ2A 5LGUA 1FCAA 1VQ4I 1TL7A 3WX8A 3ISNC 1RBAA 2YNHB 5GAHU 3M8SA 3BOQA 3EUAA 4JV5F 4M5GA 3FDYA 1UG0A 3NWRA 1KA8A 1WOPA 5HVFA 2FBKA 3P45B 4IO9Q 1WSUA 2YH1A 2RKIB 1RAHB 2LQ5A 2XO7A 1OMIA 2RQQA 3AOBA 2KIUA 2F8MA 5E3QA 3AH6A 3ECOA 1FKAF 1BJZA 5FRMA 1Q95G 1FK9A 2MYSA 4CO1A 2XIGA 2YWGA 1I39A 1HNXF 3F8MA 2MC3A 2LY1A 3DLEA 4PWDA 1AB8A 4ZYEA 1Q1KA 1D5VA 2RC4A 1BI1A 2XZTB 2XG8A 1OCPA 5HNFA 3R60A 4DR7J 3ZZ0A 3Q0UA 1WI8A 4C30A 1WG5A 3FBIB 1IC8A 5SUHA 2IRYA 3FFIB 5KFCA 4TU7A 1H9GA 2BW7A 4PXEA 2VD3A 3HYIA 2LQJA 4ZK7M 3K2AA 4QWAA 4IOCF 2EBGA 1U45A 5ICEA 1NBEB 1N33F 4Y2IA 5E3MA 1YRXA 1X4PA 4F91B 3PYEA 1KRPA 5DM7Q 1OIAA 2X4HA 2XB0X 3EQLF 1EKEA 3M32A 2EZKA 4JV1A 2UV8A 2HHQA 4MKYA 1EX8A 4MKAA 1MBKA 2B7BB 2DLLA 2WVDA 5F3ZA 1J0RA 1UAWA 1RT5A 2DCEA 2D45A 2E1RA 2VOPA 3LANA 5D3GB 2X6YA 4MKBA 3QT7A 4OIRF 2ASDA 2XNQA 4CLTA 4V19K 1TR0A 1XMQJ 1EJ7L 4WU2A 4GO5X 2QT7A 3HM9A 3RB6A 1HDDC 5CVJA 3ZGKA 1T33A 1R5ID 2RF2A 3ZXWA 3M8WA 1PDNC 2LOOA 2WHOA 4URQU 2OHDA 5A0YB 5LRRA 2GWRA 2PJRB 1UJ6A 3DRPA 4YEAA 3IMQJ 3G4SS 2WSFC 2F5CA 4LGWA 4WE1B 3A8EA 1C1CB 2CQ3A 4CO8A 4E70A 2CIMA 2QEXI 1WKKA 3JQJA 4N56A 3QZ8A 3I6PA 3THTA 2LQBA 1TK8A 3N79A 1YLFA 2E5GA 2YKNA 1NSQA 2JC1A 1TNSA 1XPXA 4G6DA 3W61A 1F5BA 4JB8B 2LEPA 3VGUA 1NK6A 2X6WA 1K79A 1JGSA 4BKXA 4C4WA 2Y30A 2BV3A 4USIA 4GRIA 2LXUA 1VQ9S 3ML6A 1MBEA 1FP2A 4PG6A 3BR6A 5KFHA 2OPQB 3VVTA 2WTEA 3BR8A 4E7LA 1XMKA 4UVAA 1H3DA 2LA6A 2DEJA 1LWXA 3L2RA 2IA1A 2Y1JA 1VRUA 5H9FJ 4FT8A 2LBFA 1SL1A 1JLEB 2LU2A 3KLNA 1B99A 2BOLA 3ZQIA 2O03A 2GOMA 4A6DA 2KIFA 3M4XA 2KVIA 3FKIJ 1O8BA 2DGWA 2YKMB 2MHNA 2R8KA 1FERA 4GCVA 3PW4A 5IT9U 3H2LA 3CJSA 4IKFA 1K61A 3O6QA 5HLFB 3PNIA 2V1DA 1VQ5S 1MROB 3HHLD 4UUVA 4Y0FA 3I4HX 1X5OA 4GVBB 2AEMA 5FLXU 3G6VA 3OHAA 4Q8EA 1AUDA 1TWAJ 4WK8F 1JKHB 1JKHA 2P6TA 2VG7A 4RW8B 4RA2A 2YH0A 3Q86A 2CQIA 2W4PA 1RKTA 5D4LA 3J81U 4N5SA 4BJ6C 3K1MA 2Y1LB 2WV0A 3GSDA 1EH6A 2W4SA 3OIPA 2OZUA 1M5SA 2UVUA 1NG6A 3BG7A 4X66F 3P5BP 3U9GA 4FNHA 1YJ9S 4M3FA 3OXFA 3OL8A 2O1PA 3GF2A 2DNPA 5GAEJ 1HNXJ 3W8PA 4EZ9A 2CQ2A 2FTRA 4Q5SF 3AB4B 1IJFB 4C11B 4J9PA 3KLFA 1YBAA 2MLGA 4ED3A 2G0IA 1HCRA 3QQAA 5FD6A 3MPWA 4ECSA 3DOMB 2HTSA 4G65A 4CXFA 3G1LA 2VV5A 3AOCA 4G6QA 1U8RA 3OV7A 2XLJA 3ZQ7A 2RVJA 2V63A 1R0AA 1S3JA 2PEHA 3BJAA 1ETWA 3P8BB 2JLGA 1A36A 2YY3A 3JSYA 5KFWA 4NYZA 4V19J 5CD4H 2M34A 3HVTB 3LOUA 5T14A 5KG0A 1Q8KA 1XR7A 3AOAA 2PA3A 4P7TA 4UOHA 1NO8A 4RNHA 1N52B 3K5NA 1JE8A 2C3OA 3DEUA 4IZZA 3MAAA 2CADA 4CLUA 1TELA 2VXDA 1WJ5A 3PIPQ 1C1CA 2C2KB 3S17J 2HS4A 3GV5B 1UCRA 2ZO4A 5KOWA 1Y7PA 4N7TA 2CV2A 1UETA 1ZK8A 4B4CA 2MY7A 2XM3A 3GTPJ 3HKWA 2V2KA 1VC6A 3DU5A 3CJTA 5BMZA 4XBFA 3OL3A 2FHJA 4IFVB 5FB2A 4QWEA 2V5HG 1Y0UA 3PYFA 2KXHA 1NK0A 3NGTA 3DKYA 2QV6A 2P9EA 1SKRA 2QSFA 2DK5A 1VQYA 2PO4A 3KDOA 2EILH 1PJ6A 4K4WA 4NBQA 4J91A 1SJQA 3ZQHA 4C0BA 3FEXB 3G3ZA 1TNTA 2ZE2B 2EC0A 3AQPA 3DMJB 3I0SA 3MEKA 3SV4A 2CH0A 4ILRA 3GFXA 2VHGA 1VQ6S 2EFWA 1U9OA 3L95X 2IDEA 5HN0A 4JI3F 3MM7B 4DFKA 3RJPA 1WTFA 3U1LA 3GR1A 2LD5A 1ELOA 3AQOA 3MR6A 4WIIA 2HGNA 1WEZA 1DTTB 3M6UA 4DL6A 1RLDA 4WU3A 3G6YA 1NDPA 1HNWJ 3QOPA 4XLEA 1SUQB 4N0BA 3WGGA 4QLCU 2PGCA 1J5OA 4O44B 1X60A 5B0BA 2ZCWA 3OJUA 1RXOB 4QU7A 5KG1A 2VONA 4DL5A 1UA0A 4HG2A 1DDNA 1UL3A 5J2QB 1OQ6A 4ZITA 5D0HA 5IC6B 3H5RA 1FRHA 4J9KA 3EZUA 3LAKA 3R9LA 2HZAA 3W3SA 4CSWA 2HVEA 1X4FA 3W64A 3HFZB 1S1VA 3QBCA 5HLGA 5KG7A 5DDQC 4LB6B 1K4TA 3GV8B 2KHMA 3POTA 3GYGA 2Z2SB 4R8UB 3LWLA 4GC7A 4KT5C 4EI2A 4OHZA 2P8IA 1XS9A 4M9XA 1P4WA 1QE1A 1YITI 2LMDA 2DN0A 2DOEA 3I53A 2GIVA 5EHHA 3CCQS 4HSRA 1OO0B 4MQ9F 5L1JA 1OR7C 3IHUA 5LD2C 1I3OB 1FTRA 2DW4A 2E35A 3EYIA 4MIBA 2WVFA 3ECHA 4RM3A 4PQAA 4IG3B 3G2XA 3BR0A 3VSKA 5GADU 4B3XA 1T03A 3OYGA 2CJQA 1D3WA 3CUQB 4MTEA 3TUJC 2DI3A 3GV7B 3W2VB 4CWBA 2QSWA 2XMVA 3R4KA 3ZQGA 3SJMA 1K9MT 5F0CA 2STTA 1QUPA 2BGCA 2PEXA 2PEBA 4QWBA 3RZAA 5J4VA 1VRUB 3BREA 2DXEA 2V69A 3M7VA 2DY1A 2HZVA 3FMQA 4KIAA 1VQKI 1VS3A 2E5LJ 1YIJI 3OS0A 2XMKA 5LMUJ 1MROA 3PR4A 2M3AA 2RDIA 2Y0SN 1TL5A 2BRKA 5C24B 3OR1C 3C8YA 2AF6A 1LWFA 2BKNA 4CZZA 2LP0A 5ILUA 4A3BJ 3PEHA 3MTJA 2X9DA 4DLGA 3W60A 1E0EA 1GLNA 2OQGA 3V7SA 1S72I 5T7LA 1FRMA 3GFZA 3KXDA 4HQMA 2YWHA 3H7HB 3C6UB 1RTHA 1VQPS 4FE4A 3RQIA 2HBYB 4Z2YA 4A3JJ 3FK6A 5LJ3Y 5FROA 2YX4A 2ZFWA 1RWKB 3VYRB 4UF4A 2XF7A 2QO3A 4LVOP 2V68A 1IG7A 5CXTA 4X2BA 1U1KA 1HR0J 3AHPA 1ZELA 3CP8A 4O4GB 3SZGA 2R7ZJ 5B66C 3CEDA 1D1UA 5D8HB 2IVMA 2E5LF 3BGLA 2J9CA 3GR0A 5D4PA 3M8QA 4BYYA 1FFWB 2ZH9A 3CJNA 4YEJA 3Q8RB 2W9CB 3AG2H 4E7JA 2IW5A 4PG4A 3JYTB 1MN9A 2VH7A 3B78A 1VLYA 3MOZA 3DM2B 4RUHA 1WPKA 2V6EA 2E44A 2HHSA 5A8WA 1BI2A 4IQJA 3E8OA 2RAEA 4CM0A 3MEGA 1WJEA 2NLWA 4BDPA 3TQ1A 2XYGB 4XTTA 3RPQA 2YU9J 1WJDA 3VB2A 2C3YA 3DLGB 3M05A 3SFIA 5HROB 1XSDA 1TK5A 4NXNJ 3VALA 3PHEA 3KUHA 1LW2B 2P9CA 2VQHA 2QLJB 2A0FB 2D2WA 3CESA 3KE2A 2HS3A 3KPHA 2OEKA 4DV2F 5B1AH 1GDTA 3PJRA 3OHBA 1U25A 5LJ5Y 4N9IA 3I55I 1YW8A 2CJJA 4J9VA 2QLBB 5CLSA 3ETMA 1FYKA 3DEWA 3FK7A 4DUZF 4ECWA 3C2PA 4C3KA 4BJ5C 2RGVA 3TRGA 2IA6A 4NMLA 2POKA 2B6AB 2WZ1A 5B5EC 1TLHB 3BB5A 3CJ0A 5ETQA 3TUPA 4CO3A 3GVAA 2FD2A 1S12A 4GXOA 1VBZA 4M3BA 3E5QA 1G4CA 4ZLNA 3KLHB 2HYGD 3CD0A 3WTXC 1XR6A 3EETA 4N77A 4HTIA 3E7LA 4HKQA 4RWXA 4H0EA 1F3VA 4KV8A 3K9TA 2Y9HA 3HSZA 3M2RB 3CO7C 4LFBF 5EGOB 1FMVA 3S1TA 3MPUB 5E18F 1VMBA 2YS9A 2EBIA 3KK1B 5RUBA 1S9EA 3Q9VA 1FDBA 2Q8KA 4LF2A 4YDXA 2A07F 3JW4A 3GTYX 2DFIA 5L3GA 3GFLA 1T3NA 5E2QA 3CCZA 4JX4A 5KFDA 1KU7A 2H27A 2IY5B 2HFOA 1E3PA 5KFUA 2PMUA 4L75A 2OUMA 4XSXF 3MCSA 4OX7A 3KEYA 2R5ZB 2HGLA 5J2PB 4DX8H 2MW8A 1RT2B 3E0JB 4OI3A 3QGPA 5HJXA 1ZG3A 5ICGA 2R7XA 3L2CA 1HQCA 3RYPA 2MKIA 4IFYA 4DWIA 1X4AA 1F5AA 3V4IA 1A5JA 4DQRA 2F4IA 2XKOA 3HBLA 3Q9SA 2B3TB 3ASNH 2XCPA 3C6TB 2PE8A 4DCOB 4PABA 1GXTA 3H5SA 1N4LA 5A8RB 3JTHA 3NMAA 1FOKA 3FVYA 3IH3A 3CIZA 4HLYA 4HH1A 4IQMA 3ZTSA 2GAUA 4LRDA 3TNVA 4PYAA 1IJEB 4XN3A 3HKZD 2QMUB 1R5HA 2AS5F 2J8AA 4USUA 3SXYA 1GXQA 4LITA 3MCNA 1BJAA 3K1NA 4ZPVR 2GVDA 1PC4A 2CPFA 1T38A 2MSTA 1CF7B 3QYYA 3OYHA 2B4UA 3T41A 1NH3A 4F04B 1L3UA 2DNLA 4EM1A 1F6TA 3K58A 2DT5A 4B9VA 3EVOA 3QNWB 5I4MA 2Z3YA 3CSKA 5KT5A 4L6V3 3SZPA 3BZKA 4CCNA 3BQ0A 4ECYA 2OBPA 5BOXA 2QGFB 3MCMA 3BDPA 1P8GA 4Y3CA 4NYPA 1JNZB 2WB4A 4IUFA 4DS4A 2CQ7A 3ZMSA 3NCPA 4KE5A 3LP1A 3AD7C 4LT6A 3N97A 2R8HA 4L76A 1MMAA 1U1PA 2DTZA 5B0FA 3GFIA 4XDDA 1YJUA 2JVHA 2QZ8A 4X65J 1IAWA 3G2BA 3DI6A 3V4GA 4H4KA 2B4VA 3J7A1 3RW6A 3K89A 2X1GA 1VQMI 1SB6A 4RL1A 5B09A 3Q8VA 2BQUA 4XRSG 1SJFA 1WG4A 2KO1A 4TXSA 1XMXA 2MC4A 5HP1A 3MD3A 3PIOF 3HRUA 2COMA 1IXSB 1SH2A 2MZ1A 1FD8A 4K4ZA 1FWZA 2CQXA 3IAM9 2FYXA 2VL8A 1TW2A 2FGCA 2ZD1B 2XC7A 3W2WB 4P55A 1UKUA 1HWKA 3CCWA 5J2NA 2YPZA 3GIKA 1TQLA 1I5ZA 2KIMA 4XRSA 1TKXA 1X9MA 3I82A 2K3IA 2BJ8A 4IRHA 1S9HA 4QU6A 3MR5A 3FWEA 4EEFG 3H20A 1KC8T 1A6IA 5H20A 3DPTA 1Y1VJ 2R2SA 2BEFA 4MK9A 1D1CA 4XPCA 3RTVA 1Q79A 5AONA 2J5PA 1X9SA 1B3TA 2E5NA 4EYIB 1KQ9A 2Z33A 1KQ8A 4PXCA 3PO2J 4XKBA 3PSFA 1QQIA 3HVRA 3E6DA 2NVYJ 1K73T 5E1XA 1E3HA 4BE2A 4OINF 3GTOJ 1F3FA 3T1BA 3CF5F 3HVTA 4AXJA 3G1OA 1SD5A 4X66J 4MKVA 2DPJA 3HX9A 3CC4I 4IKAA 3QFHA 2E5JA 4ELVA 3WHBA 3PACA 2G0CA 1KTQA 2IMOA 1G3WA 2IJFA 1JJCB 3SEZA 2Z0GA 3CP2A 3BZCA 3A0BC 1QBJA 4ZPBA 3TVKA 1O7LA 2YNGA 3KK3A 3M6XA 3HD1A 3ZP5A 2BE2A 1I6XA 5J40A 2GGPA 2V26A 1KU9A 1Q4RA 4ZPWR 1PIEA 5E3CA 3T1YF 3D2WA 3QPSA 1S7HA 4DL0C 1TZLA 4ICLA 2ZEJA 4C9DA 2Y69H 1E6YA 4YIIA 4Z6YA 2UWMA 3GP9A 4YR3A 1R0CB 5B0GA 2R2UA 1U0HA 1IDYA 3EZ5A 3HTSB 1UWBB 3OW2R 2NOGA 4PJMA 2HNDB 1N5YA 1U5TB 3GILA 3D3CJ 4XK8C 1MMDA 3F8FA 3H0DA 1UEUA 2BVMA 1HQUA 4WTOB 4DNCA 1UCNA 3PSIA 5KK1A 3HSJA 1JTYA 3UQSA 1S10A 4KY3A 1HNVA 2ZOFA 2FUG2 3CJKB 5IOZA 1NU4A 3IL2A 2W82A 1ZTTA 3CD7A 3D3BJ 3PIPF 4KB7A 3UD3P 1XTAA 4LVNP 5HDGA 5G4DA 4XLAA 3R5CA 2QENA 2W2QP 5KG6A 1J7KA 3QO9A 4DG1A 3GTKJ 2MBFA 4OX6A 3RZDJ 2FB0A 3A8KA 2FHJD 2LTPA 3OYKA 4LIVA 4BHBA 3MM9A 4B3OB 5L38A 2WW4A 3S7RA 4KICA 2DA2A 3PFOA 2KT5A 5K8PA 3ZMTA 4XLHA 1IV6A 1HF0A 1FTTA 1JLCB 2OP5A 5GAGJ 5HROA 2GLOA 3ZQQA 4K2XA 2VQCA 2K9QA 1D9FA 3ZQCA 4YN3B 2DR6A 1U1OA 1F5CA 2CQCA 3OOUA 4AQYJ 3FQKA 5FKNA 3CW2C 3EGNA 2MEWA 2X1FA 1PYOB 1XMAA 2CQ0A 3QLHA 4G1QA 3VPRA 4L3NA 4G1QB 4GO7X 2ZH4A 3I9V2 3JTPA 1MSEC 1S1WA 3EDQB 2L0KA 1FNMA 4DYRA 5LGNA 2VPYB 1KONA 2CAJA 4C8YA 5IWAF 1I6HJ 1DPRA 2GIZA 3N28A 4Y52J 3CC2S 2XYHB 2G2ZA 1JLQA 1X2NA 2FVSA 3CJRB 1TKTA 3OXLA 1RJJA 3SCLE 1FMWA 1TTYA 1N36J 2JVGA 4L5EA 2LG4A 3G1MA 1AXQA 3QGHA 3LGHA 2OTLI 3MWMA 3ISZA 3J80Z 1SFKA 1WH5A 2JL9A 2L02A 1TWFJ 3ULHA 1YK9A 1U6FA 4NWBA 2O6GE 3QYBA 2YQ1A 4RO0A 4A0XA 2J6TA 1R58A 3PRBA 2WBRA 2EVZA 5IS2A 1FJ7A 1KLNA 4GKKF 4NASA 1G8XA 2CZVC 3KUGA 3DDIA 2X1AA 4DV1F 4I64A 2JUGA 2VPLA 1DU6A 2LLKA 5GTIC 3J80U 3J7AN 2ROEA 1Y39A 4M74A 3R61A 4WP3A 4PQUB 2VE9A 2FZGB 2V0NA 3LA7A 4DG1B 3HXMA 2UP1A 3W3CA 3NGDA 4KO0B 3RKQA 1ACMB 1DTTA 5J3LA 1D8JA 5L9NA 3K4JA 4HNTA 4BY1J 4C7QA 2CRGA 4ZJLA 5EDWA 1JJ2R 3CUNA 5C42A 3N6NA 4KHMA 3TL4X 3M8PA 5LSRA 7FDRA 5E17F 4O44A 4A46A 2PI4A 3FF5A 2O5RA 4ZJQA 3CCEI 1BD6A 1TL4A 4DEZA 1PJ5A 3H5XA 1IO2A 3JRGA 3J7YU 4JI0F 5M3MJ 3KJNB 3GJTB 3HOYJ 1FX4A 3LSGA 3O8HA 2DNRA 2IIHA 2YKAA 3DC2A 2M2EA 4IR9A 2E60A 3TKYA 3I31A 1N6QB 4YHHF 2H8RA 5IP9J 2P4WA 1J59A 2CQHA 1W7PA 1RKWA 2OLWA 4OI2A 5DRKA 3D4JA 3HB9A 1EV7A 3M2UA 3OFEA 3QJLA 4DR6F 5E3PA 2DQLA 4II3A 3V6DA 2XCAA 3VAIA 1MDMB 4B08A 3JYTA 3GFYA 2XF5A 3KYDB 2R7TA 1FWPA 2DK2A 4DSJA 2YKOA 3DXSX 4IHTA 1WSRA 2VDHA 3RRGA 1KS2A 4HBLA 4G9YA 2WK4A 1XCBA 1HNZJ 1BQNB 1UJ4A 4LF6F 2KMUA 4DR5J 3OR2A 3LFUA 4EK2A 5C44J 1XN7A 3SHFA 2ACMA 4PCQA 3HT3A 4ED5A 1YBTA 3L9ZA 1W7PD 1IUYA 3CCSS 1IM4A 4G6VB 4QWDA 4O3QA 4MO7A 1CQTA 4H4MB 1S29A 2OPSB 3L3CA 4TNOA 2VQFF 1ETVA 1RR7A 3KP6A 1FIAA 3IAM2 1BMQB 5FLXY 1HW1A 1MMLA 2XY6A 1X58A 1LEAA 3Q0AA 1ZM4A 4IF4A 4C2TA 2KN4A 2KXFA 2H5IB 3OL9A 4M5IA 3DLEB 4PWDB 5B7WA 2A1BA 4PQUA 4HX4A 2R92J 5LMNJ 1MBFA 1TUVA 3ZQFA 4O3PA 4USJC 4A3FJ 1PUEE 1ZTRA 3IR5B 2IC3B 4KHPF 1S79A 1SC1B 1S77D 2NS8A 3PY8A 1OQ3A 4GDFA 4XSZF 1DTQA 1EETB 1JUSA 2VG5B 3LSIA 1GUUA 1W0TA 1RHKB 2I5JA 3VF0B 3DHWC 3H9GA 1JUPA 2GJ2A 4DN0A 4Y7NJ 2ZVIA 4FVCA 3SDBA 1F5TA 1SANA 1KU3A 1TAQA 2R7FA 1FJGJ 4YFKF 4FF2A 1S59A 4F55A 1ZPWX 2LLZA 2CPJA 4Q0BA 1KVKA 5F6FA 1QO0D 3H59A 4M3DA 1UVNA 4ITSA 1SQGA 4Y3OA 2QTWA 3BT9A 2HQIA 4OJGA 1NK2P 4F4YA 3H92A 3U1NA 1R27B 2GXBA 1FHTA 3QWUA 2NPFA 1U48A 2FMYA 5M5XJ 1YVFA 2UXCJ 2Q1LA 4A3DJ 4NQWA 4GYGA 3RI4A 4DLEA 3P9CA 4PG7A 2DEIA 1ZAWA 1ZRDA 1S1XA 1E2XA 4L9NA 1JLCA 1JUMA 1PC5A 3POTB 3DLLQ 2VB6A 2E7VA 3ZTRA 2VU5A 2NNNA 4ZLPA 4I0AA 3AT1B 1SKSA 2LU1A 1T0FC 2ZJRQ 5CJ9A 3KP2A 1B4SA 5IFMA 3GZ6A 5K7HA 4IRKA 4DPXA 2KP6A 5A6WA 1F1BB 4DQ2A 2ZUGA 1SVMA 2E1NA 1R00A 1W5TA 1WI9A 1WJBA 3E6MA 2Q3PA 3VAFA 3R7NB 4QQBA 3MFIA 4QTRA 4I7FB 1M1GA 1D0ZA 4H4MA 4LRAA 4W4MA 4QWCA 4Q8FA 2L7FP 3W6VA 1UA1A 1USSA 2LF7A 4D7MA 3ENVA 1M5PC 1C0TA 4JBAA 3RG6A 1MJ9A 4USKA 4LMYA 2HNZA 3SDEB 2ZE2A 4F8RA 2VT3A 2YKPA 4RAGA 1LWFB 3CD6I 2A5WA 1Y5LB 2M9HA 5J2MA 3RYLA 1U1LA 2OJED 3HHDA 5F8HA 2CW8A 1IW7F 2UUTA 2KI2A 1U0HB 2R5YB 5DG8A 1CJTA 3OLAA 1ZKGA 2STWA 4OIQF 3HG9A 1UWBA 3CDAA 4DSKA 1IR2A 2W2MP 4RW9A 5LLQA 1S9EB 4WFBQ 1PCAA 1HA1A 3N4WA 2OH2A 2RV8A 1TL3A 2H5JB 4USWA 4NNJA 5E79C 1LJ9A 4DQQA 2NREA 4GKJF 3TP0A 3OR2C 2DYRH 4JI6J 1Z6RA 5LHGA 2DR7A 2DH9A 5IYDJ 5M3FJ 5M5WJ 4DBQA 4X6AJ 3RTRA 2AYBA 4LF8J 2KRRA 4F26A 1TL3B 3RAMA 3F41A 1KFSA 2J7WA 2EWHA 1P9QC 2XMAA 2P7CB 1TKZB 4U67Q 3G8SA 2B7EA 1B9MA 4YUDA 1U2FA 1URRA 2RDJA 1WG1A 2QQBA 4F4AA 3FJ2A 1FNOA 5K7FA 3WX4A 1IRFA 4B3OA 3ZMUA 2BYCA 5KHDA 4LLNA 1MG7A 1OCZH 3MMCB 1UVJA 3RCOA 1CSJA 4KA4A 4F2SA 3HO1A 4ED1A 1S5LC 1NSKL 5D6GA 1FBUA 4B3TF 2ZJRF 1ZYQA 5KAFC 1HBMB 1JJ8C 5SZTA 1SJ1A 3GIJA 4M6YA 4KN7X 3NWGA 4N4NB 1F0XA 1WF0A 5JI6A 5C2GA 4MAKA 1WKJA 1BHNA 1FOYA 4ZZLA 3G71I 3CLQA 2HS0A 2FJWA 1MJAA 3HOVJ 1V3RA 4ZDOA 3MM8A 5M2RA 2GJIA 3SCJE 1ORKA 1HQEB 3DYAB 2ZJQF 4KUMA 2CJXB 4UTGA 3PDNA 3J80Y 1D3YA 1U0JA 3TOAA 4U95A 5FO5A 3W62A 3H4BA 2FD5A 4WFAQ 1LXJA 4UT4A 2MLKA 1Z1DA 3ESWB 3IN5A 5CCLA 5HMYA 1JHHA 4V2FA 1R1UA 2DGQA 3UN3A 3M6VA 4YG2F 5C4XJ 1NHUA 2H1YA 3SMZA 5LM7E 1ROFA 4PJ0C 4N76A 4KSEB 4RB2C 4M6XA 4B02A 2EJRA 8RUCA 4F3OA 4CCLA 1QSLA 3CLOA 2NYHA 3QU6A 1YJTA 1G59A 3HOZJ 3ILOA 1RB0A 4U0WA 3BSOA 2D7SA 2VI6A 4KFBA 2JK3A 4M9ZA 1MWYA 3M1EA 4E98A 1N5QA 3BBCA 1C2PA 2W85A 5K5RA 3TZWA 4WYLA 2QCOA 3A4TA 4UV9A 1C0WA 2MFZA 5D4SA 1FT8A 1Q1VA 3F56A 2EG2A 1WEYA 3JXOA 3EXYA 1WC0A 4NB5A 3QOEA 1JLGB 1N34F 2RRBA 2VG5A 1DQUA 1EA3A 3G6ES 3IM8A 5DO2A 2PG4A 1RWWB 4NLOA 2JFKA 5DQHA 1J09A 1R4MB 3UD4P 3DBHB 2I1RA 4M5DA 4G7OF 4DIQA 3FZBA 4ENNA 4QR0A 2ASJA 4IJAA 4P2XA 3Q8UA 1BM9A 4W97A 1PBAA 2WAEA 1RT4B 3DLKB 5HAOA 1XGOA 3ZCOA 2HNYA 4X4SA 1LKZA 5ETVA 5DD4A 3TMOA 3FM3A 3M1VB 4LSLB 1VBXA 5JMNA 1TL8A 5EX3A 2BDPA 2ZFHA 3BJOA 3MAQA 4MFEA 2XMWA 2H94A 2DQRA 3ZN0A 3K1PA 1BE4A 3NEUA 4CA0A 3T0YA 2OTJI 1YDLA 1KQSR 2HWIA 4XOTA 1VQLS 2QQ8A 3RQ4A 4HI1A 4Y33A 3GPAA 5GMEA 1U4BA 1MNMC 3ROUA 3FXKA 5JHFA 1IN0A 2R0QC 1KZHA 3SFGA 3UNGC 2OPPB 1FNXH 3MKLA 2BA9A 1GVJA 3Q8PB 1MBJA 2V2VA 2DA4A 1T2KA 4L9JA 3DKWA 3EYYA 2X7IA 2XI2A 4DZ6A 4KGXB 4A3GJ 3OD2A 3F6OA 3GZ7A 3A1YG 1UAAA 3MPVA 2DY9A 3KK3B 3S01A 4UNOA 1VCTA 2HOEA 3WU0A 4ASNA 1BWVA 2KJVA 1S6PB 4AIDA 1VBYA 2FE3A 1T0FA 3JCUC 2UZKA 3KK2B 4OI0A 2DR5A 1ENHA 1OWXA 3DNCA 4P1WA 1V6HA 2HWHA 2IVYA 2ALYB 1GAOA 1OPIA 1BC6A 3Q2TC 4RMNA 1SD7A 1PAEX 1HKTA 3E5UA 5ETTA 4O0IA 4DF4A 4OYIA 1YTYA 3J81Y 2HHUA 3BGUA 1AFIA 1I51B 2JHEA 4CCKA 3CMYA 1C0TB 1JXSA 4Q4ZF 4HHJA 3JR9A 2Z4PA 3JQKA 3HGYA 3OSNA 3RPUA 4LMZA 2JSCA 5K8NA 1QAIA 4ESFA 2JTVA 3H25A 2GZWA 4NUBA 2CQ4A 2YNFB 2I8DA 3E1SA 2VFTA 2V8DA 2H3EB 2ACYA 2V4JB 2BUNA 3K17A 2UUCJ 4AYBD 3H3ZA 5BJRA 2JDJA 3F0CA 4JI3J 1UB9A 3ZMVA 1EHWA 3OTOJ 5HI7A 5TJJA 3C14B 4B9UA 3RW7A 4XK4A 3KCCA 3N6MA 1W2IA 4ED2A 2HR3A 1QVFR 3AB2B 4E0DA 2HS5A 1SUQA 3GUDA 1MJBA 5DYMA 3W2WA 2RUSA 1CS4A 4GFBA 2JNJA 3HEFA 3L09A 4IOAF 3VDXA 4OMFG 1HKSA 4X62J 4TQSA 1M5KC 1O3SA 1SFXA 4HV5A 1JLBB 2WW8A 2NS7A 4D5CA 1BUXA 2PLYA 1RUOA 5LHHA 1WWXA 4OZ2A 2JVOA 5E8GA 2CUFA 1FBSA 1Q1HA 2FLLA 2XGXA 1REVB 2CJKA 1FXRA 3TAMA 2VFSA 4YR2A 4GKJJ 3CNQP 4X4PA 3QIPA 1YJNS 2CQKA 3DN9A 3CCTA 4N4OB 2YVSA 3QGGA 3I59B 2DXFA 3WGHA 4NEYA 3ZZPA 1TWHJ 1XN9A 4HVZA 2D1HA 3H4DA 2MTLA 2CZ9A 3TX0A 1IKVA 2X1EA 4RW4B 2VIXA 3MM8B 2C3PA 3KG0A 1W7WA 4NCBA 2DJIA 1WACA 3DM2A 4RB1A 4ZMMA 1RA7A 4I6ZA 1HQEA 5AXNA 3RR7A 3DLJA 3M30B 3HUGA 1VQNS 1FJGF 4KYWA 3HM5A 2IHR1 3HSGA 2KKHA 2Z2LA 4HYKA 1NK4A 3P96A 1YSJA 3H0GJ 4ICLB 3QLHB 4RGRA 4PSWA 4KH1B 1U1QA 1R7IA 2C22A 1M0SA 3HRSA 2XTJP 2EK6A 5E1ZB 2MKSA 3KLGA 4OYXA 3PFIA 3D5LA 3KNAA 2OMLA 3IR7B 3HHNB 4O3RA 1HHQA 1UPMB 2KFDA 5DGAA 3J7ZI 1Y10A 4Q7AA 4I2QB 3BDEA 2OFGX 4I1TA 5CVVA 2BHZA 1YHQI 1F60B 2NXNB 3GYNA 2OPSA 1L0OC 4UV8A 1R3NA 4FVMA 1CJKA 3DOMA 1NK8A 4ZDPA 3Q8YA 1HI0P 3PKYA 1XGNA 5IXUA 3SEQA 3JB9k 3OS1A 3W2AA 5IQQA 4EGYA 4OZNA 2PMHA 3N0VA 4RPFA 4IO9F 2CUYA 3M8EA 3VAJA 1ZA1B 2B0LA 4G12A 1U1MA 1IN4A 2IXSA 3RBEA 2ASYA 4N8NA 4WKRA 4MQVA 3E97A 5J1RA 3HDSA 3EJMA 4BEHA 4NLPA 1DUXC 2QJ3A 5KTQA 2BZTA 1WHYA 3A13A 4YQWA 2A69F 2IM0A 1I1SA 2DMTA 4EGLA 1STZA 3BPDA 4QZVB 2MPUA 1T05B 5E1WA 4X4OA 1FDNA 1HKAA 3TAMB 3LA3A 1VFJA 1N5SA 4TN2A 2R2RA 3T9NA 4F0HA 5ICFA 2WAFA 2ZC2A 1RTZA 1E3OC 3EXCX 2XRNA 4ZTJA 4WWSA 2WAQD 2BXZA 2E19A 2Y48A 5LFAA 3ICLA 3RDIA 3OWTA 1REVA 1JXLA 5KG4A 2KRBA 3CJ8A 4OJ1A 3QJPA 5KFOA 2GQQA 4FPIA 2HOSA 1RCOB 4PG8A 3W6KB 2RB7A 4NDLA 3M6WA 4JYAJ 2XQCA 3IH2A 4DV0J 4HHUA 4BGDA 2OD4A 1VQ8S 4JK1X 4BS9A 1A6LA 2Z56B 2HQDA 3CCVI 2BY3A 2X1CA 1SJRA 5DQGA 3M8JA 1YW7A 3GTJJ 2ETHA 4FCYA 4A69C 5LL6d 2K8GA 2MQQA 2PFFB 5JVTA 4LFBJ 2MQNA 3LWFA 1L3SA 4TU9A 2ZZNA 5ILSA 1LFPA 4LBIA 2L01A 2Q2EA 4QW9A 2VBXA 2NOJB 1VLOA 4LRCA 1LV5A 3AG3H 2M2BA 2EPIA 2NVUB 4C3HJ 3TUIC 1ZZNA 2UXNA 5KFFA 4RBUA 1OYEA 5E33A 4EQQA 1WWHA 2LY9A 1QSSA 1B59A 3ASOH 1IBKJ 3MOJB 1JJ4A 3HPHA 1AA1B 1SIWB 2AYMA 4EMSA 2XMUA 4JI6F 3RKWA 1R89A 4PGHA 2A18A 1V4RA 3KTQA 4Y34A 3T3FA 1RWXB 4BC9A 3B54A 2HW3A 2U1AA 4I02A 2C2NA 2RF2B 1BL0A 4OV6A 5M2UA 4FBTA 1H73A 4OX9J 2OQRA 1IV8A 2FGOA 5F8MA 3HPOA 1I3QJ 1ETKA 1L3TA 2EFGA 2FJAB 3LFKA 1OJ4A 4DR6J 1VQ8I 3HDDA 5ITHA 2VPZB 5CCMA 4F93B 4OIPF 4BEHB 2MG4A 3L1PA 3JRHA 3IWXA 3AA9A 3C66A 3VAKA 2GHVC 2F65A 2UUAF 3TOQA 2I5JB 4ZTFA 1RT6B 1Z05A 3QP5A 4NA3A 2M30A 1IUFA 4J9NA 2XBPA 5JHUA 1P7JA 3LTOA 1B8IA 1CVJA 3F6VA 1YHQS 1K4SA 3A01A 2DJNA 1FVQA 3CUQC 4NLYA 3S6EA 4RU2A 1HW9A 2BW2A 1D5YA 2E7WA 1B7YB 4DR7F 4NA2A 2XWYA 2XHWA 4K2EA 1HBMA 5EZGA 3MUMP 4RNMA 3ZZOA 1QM9A 4XKVA 3NL0A 1IKXA 2FVRA 1LPQA 4B17A 2KJWA 4DR2J 4OZ5A 3C15A 3BR9A 1S7EA 2CA9A 1ZREA 2VXZA 4RLQA 2IA0A 4LLGF 4J9UE 3JRIA 1YWXA 1KWMA 4JI2F 4MLOA 2N3OA 4NLDA 1T94A 2VJUA 3N5BA 4DUYF 4O3NA 2B9XA 1OCCH 5DJBA 1ETOA 2E5HA 1G2HA 1T9YA 2DT6A 5EX0A 2DO0A 4XORA 5IT9K 2FEZA 4X64F 4HPQA 1Z2ZA 4H4OA 4A3CJ 4HDHA 5IY5H 4LJZF 4KQZA 3N5FA 1IXCA 1YJWI 2YX1A 2DYSH 4BQAA 1R6YA 2DNHA 1NZ8A 3CDIA 1T9WA 1ZARA 3S8PA 3AL0B 2WVCA 3MDFA 3D0IE 1HBUA 1GMUA 4NCGA 2J6UA 4TY9A 2E5IA 4HF2A 2F4OB 5GPCA 2DDBA 3IM9A 2K9MA 1IBCB 2HPUA 5KFAA 1MU2A 2R42A 4RUCA 2PMZN 3ZZYA 1RISA 5HATA 2ZZMA 4IOBA 3KNGA 2KDZA 3HHHA 4RAFA 3BGFA 5CD4A 2M0MA 2K5CA 4K8RA 5M2PA 1LNWA 3V7CA 2A6HF 4I2PB 1Y8QB 5T41A 4KHRA 2E1CA 3NBPA 4QPOA 4OWRB 1NJYA 2HMIA 5G0RB 2V4JC 2GC8A 3KFWX 2NXJA 1H7XA 3CO9A 2OD6A 3CC7I 2GMHA 1S8NA 1JT0A 5FLXK 3CULA 1ZTWA 1CS4B 1V5FA 4HDVA 1P1TA 2J0WA 1JNRB 4USMA 4DL3A 4J19A 1OFCX 2CUZA 4B1RA 1SC3B 3CMAS 4A93J 2FLNA 5KT6A 2N4DA 3DOLA 3MM5B 3IAS9 3FBEA 4HX8A 4BWJA 3CDUA 1WI3A 2E9ZA 4LUBA 2M1BA 4HV6A 2HYFA 1QZYA 2FRHA 4OOIA 4QPXA 1WVRA 3JTGA 1RU2A 4IHVA 4JX6A 3ADAC 2EK5A 1KQKA 2YXLA 2BANB 5B3SH 3KDNA 2XSJA 2L2OA 1K47A 4BLGA 4ZVEA 3FMRA 5DUIA 2EFPA 3KJVA 1R23A 3FMSA 1KLMB 3CTAA 4Y17A 3OTBA 4WTYA 2L9SA 3AG4H 1QHHD 1AYEA 4KH0B 4ZS6A 3NNCA 2DDAA 3JTNA 1ETQA 1FDDA 1BWEA 2LQ9A 4JP8A 3ZRGA 3HIFA 3MF5A 4CP5A 5E3OA 3G8TA 3ELHA 3VVUA 5HLFA 3FKJA 2IDLA 2HK3A 2KT0A 5L3EA 4DR1F 4MK8A 1EP4B 2HGMA 2ZXWH 3BC8A 1HWIA 2OTJS 3ITHA 3QSIA 3H9JA 4I6WA 2QRRA 1Q82T 2DIVA 3UDEA 3OTOF 1AKHA 5L1KA 1PAUB 3HZEA 3L7WA 2HZCA 4IQ4A 3DI6B 5AJ3J 2HIYA 3K5MA 2HK2A 3EGWB 3DBRB 2LFBA 4OZ3A 5FFZA 2HHVA 1ZA2B 4RW7A 2CVEA 4LRBA 2QLFB 1JKQC 2B6AA 4KAIA 1O57A 1HARA 1S7AA 5A2QK 3KOAA 4IHSA 3UI3A 3ABLH 5I3UB 2HNZB 2Z57B 1Z3YA 5CVUA 1NH7A 3PFEA 3RBDA 2YKQA 2EXUA 3KZZA 1HHSA 1CJTB 4WIQA 3H98A 1JXVA 4DCJB 2G7UA 4QIGA 3QPTA 1WHUA 1RI7A 4JUZA 5FGMA 4MFBB 1M1EB 3JRFA 4ECVA 1KR4A 2LKPA 1XMOJ 1T8EA 4ZYDA 2X48A 4OYAA 1YE9A 3GFJA 4E7SA 3EUHC 3KZYA 2LDYA 5A8KB 4V1Ak 1FE4A 1ON1A 3IWLA 3PW0A 3KEQA 4F02A 1WOSA 3BSCA 3G87A 3GTQJ 2AEJA 1N36F 3BO3A 3W9HA 2ZBPA 3NOGA 4ID5B 3MZHA 1U8WA 1QLNA 1T9XA 5DCMB 2MH9A 3CB4A 1PYTA 2VIHA 2HG4A 3I59A 2I8EA 1S1TB 2F3JA 2KRHA 1VQNI 3BTLA 1FIPA 2GA7A 5H2FC 3G6EI 2D5VA 3NS5A 3CUQA 2WOMB 5KFXA 1AUSL 2XS7A 1GV2A 5GAGI 1DZ5A 2M45A 5H9EJ 3AD9C 2ZSIB 3MD2A 3KLEB 3LPYA 3BP8A 3EUNA 2YNGB 3I55S 3RYRA 3HJFA 2UUAJ 1NSPA 3DCAA 4Y6IA 3DTEA 4CYUA 3M8RA 4ZIWA 3NNAA 2MQ8A 1REGX 4B3AA 3T19A 3HXLA 1G7CB 4K4UA 2VJVA 2DPDA 3I32A 2L3DA 2R7VA 4U0YA 3MAAB 2NNYA 2BABA 4BC7A 4BU2A 2R3VA 4HR2A 3VGTA 3FCHA 4UZCA 3PNVA 1ZPVA 2FIUA 2AT1B 1T6SA 2VFUA 4XMYA 4PDKA 3TUZC 1RZMA 2MLZA 4FXVA 2MZTA 4FKXA 1QY7A 2Y3YA 2UUBF 2Y9YA 3B73A 5GMKa 4DQPA 2LXIA 4B3SJ 2DODA 3VGSA 2RQKA 1UG2A 1WUUA 2XMTA 3DP7A 2ZOMA 2M4MA 2ZJPQ 2PJPA 3SFUA 3ZOBA 2CQPA 4P9SA 2LY2A 4Y13A 5KFNA 3K59A 1TKXB 3KKFA 3K0JA 3GQCA 1LE8A 4HT5A 3K6GA 1BQMA 2KIQA 2NXNA 3UN2A 2F8HA 1V55H 1ZGJA 2JJ4D 2VKHA 2QA4S 3SSSA 3PYDA 3IA0A 2CWKA 3CTRA 4JP0A 1ZAVA 4AXIA 2E29A 3M9MB 4DFPA 1CJUA 1RHQB 2B56A 4DR3J 1YX5A 4QIWD 2NYXA 1NNDA 4N41A 1DP3A 2AZ1A 3SIPB 2ATCB 3CE8A 1WH7A 2ZC4A 4PSXA 1IRXA 2CNLB 2LYCA 5KVRA 1ERDA 1GMWD 2CNOB 3T8TA 3VYTB 1WSVA 3SZTA 4P2FA 3P7NA 3FSXA 1B8IB 4JV0A 2AQFA 2CQGA 1M1KT 4WBFA 2TDXA 4B48A 2PD1A 1D09B 1G3OA 2K4JA 2L3MA 4J9MA 2DNYA 3ZC4A 2BE9B 5GMDA 1D9DA 1RT7A 3F9KA 2XY5A 2P9GA 5FKMA 1L3VA 4B3SF 2B8QA 4C0OC 4ESJA 4D7NA 4ZJZA 2CW7A 1FRJA 4NZ0A 1Y11A 2DMUA 1U3EM 3X3UA 5JLWA 1H2UX 2OAUA 5EWFA 1SJ3P 1SAUA 2HBRB 1EZZB 3HKZN 3R5DA 3KIOA 3QAEA 3R6LB 4FKYA 3LAMA 1OY6A 5ICCA 2WBMA 2O5DA 5KAKA 1CEZA 2FLPA 2M52A 4KT6A 4LJMA 3OR1B 2CFOA 5AE3A 4FS2A 3P9KA 3O8WA 4X4RA 4C2UA 2CWEA 1NH8A 1N5VA 4ZN1A 3QRQA 2NSCA 3TJ8A 4UUWA 1JJHA 3CJ3A 4Q2MA 1VRQC 4DV7F 4FBUA 4QSHA 2UV8G 3IWZA 4X4UA 3CD6S 2K3FA 4HEA2 4MHGA 4K4TA 2EFVA 1NDKA 1FYMA 1J9IA 1Y0HA 2DBBA 3F8BA 4ON0A 1FOWA 3FBCA 5BR8J 2O0YA 2O3FA 3UD5A 4P71A 3PEJA 3M07A 2B5JA 1B6AA 2FDNA 3A1YA 1PSDA 1LWEB 3M7GA 4ENJA 3TO8A 4ZCKA 4TU8A 1A9NB 3ONQA 1YRUA 1TZ0A 1JK9B 2GAHC 2BQ3A 3ZMDA 4C8MA 2QA4I 4AIKA 4YS2A 3GIIA 2BV6A 1JWWA 4F3QA 3LNQA 2FHMA 3M32B 3OTDA 4BNCA 2M3DA 3D54A 2Z58B 4HACA 2A2DA 3IBWA 4KIGA 1RESA 2MKJA 2XPWA 4DX5A 2GBYA 2ISYA 3J7YJ 3RJMB 2WA0A 4B3RJ 1X3WB 5DUKA 3FXRA 5AIPA 3DKXA 5J1UA 1JLBA 3M2VB 3W5XA 4ZH4F 4CCHA 3N4MA 2U2FA 1S1WB 3GJQB 2ZHBA 1UZDA 5F27A 2PSZA 2C42A 2E71A 4I67A 2WVEA 4Y2KA 4AFFA 5C25A 2HHHJ 1Q86T 4B44A 3I4MJ 5DG9A 4HSTA 2UUCF 1EQ0A 2D1CA 2N7YA 1IKYB 1RIOH 1KEKA 5TISC 1TVRB 2V4QA 3M9OB 1FRIA 1VOMA 1IRGA 2L9NA 3PX4A 1YX2A 4ATNA 3OVAA 4L9VA 5EEAA 2ZMEB 9RUBA 3CMAI 3W66A 2QFJA 1FF2A 4NLRA 3S15J 4Y15A 4DGWB 3FUYA 3M30A 3AY0A 4P73A 3GSIA 2DNZA 2QLXA 1WHVA 4RAYA 5BPIA 3CC7S 3K10A 3JAMK 1ON2A 2HPIA 5EWEA 2MKCA 4CO4A 1GNKA 3MMCA 4BHPA 2DNQA 1LW2A 1AA7A 2ECBA 2DMPA 3PJXA 2BY1A 1RAGB 2VPXB 3LPEA 4DU8A 1D8ZA 2ZITA 2Q6BA 3N6LA 3PM9A 4BDYA 3CT9A 4LFAF 1ONVA 4DV0F 1UJ8A 1IQTA 1FA0A 2HNDA 1N5YB 1QA6A 2F48A 5BYQA 3K4BA 1LDDA 4ZVQB 2GXGA 2ADUA 2LEAA 1N48A 3DXBA 4U7UK 4O3MA 3D0SA 3PNYA 1HMVA 4FYXB 4BXUA 3TA0A 4DMZA 1Z7LA 1HPZA 2OAZA 5KFPA 1RAOA 4M95A 1YYVA 1VJQA 4V19X 1MU2B 1YJWS 2CQQA 4D0PA 5EZHA 2GVZA 2UVVA 4EM0B 5HOOA 2BE5F 3BR1A 1YRNB 3QWPA 1R49A 2OI2A 3WU2C 2L7MP 1RWPB 5D5WB 1OYIA 1TW3A 3O3LA 1FESA 3F21A 4M72A 4YP3A 4UHTA 1WGXA 5F41A 1YJ9I 1UPPA 5L3FA 3OIOA 1DGRM 4DR1J 1JI8A 4EBEA 3W5YA 3W5ZA 3LQVA 4GYIA 3AFHA 1KN6A 3IFEA 2DA6A 3KEOA 2XULA 4OV1A 3AJDA 3K5PA 5F1JA 4ZC3A 5B1BH 2FHKA 4Z37A 2KKOA 2JA2A 2VL1A 1SVOA 1HI1A 4HT7A 3BWGA 1FEEA 5CYVA 4P10A 4MH8A 4AVPA 1GEHA 3RBXA 3EM1A 5DS7A 4I09A 2V1XA 2JLEA 5EG0B 1X8DA 4G8XA 5D5UB 5IV3A 4IG0A 2MYFA 2XYPB 4CLYA 2CNNB 1D1BA 1FJLA 2HBQB 2JRSA 4FS1A 1QHGA 1MGTA 3OYNA 3MM5A 5LMNF 4BQNA 2AW0A 4I56A 1MD0A 3BQZA 3L9FA 4DV3F 2ZH1A 2MGZB 3CZ6A 2ZH3A 4CO0A 2RJZA 5DG7A 3J7YI 1ACIA 1HNIA 3C3WA 1RABB 3L7UA 3CIMA 3ZTQA 2O8KA 4WP8A 2HHHF 1QZEA 2GIFA 4BE0A 2OELA 2YKNB 1U1NA 4Y4RA 3Q23A 2HQNA 2XY7A 3HFVA 1FKPA 2CFXA 3H9QA 2BRLA 2V9KA 2BJ1A 5KFYA 1X2MA 1OQYA 4ZYHA 1K78A 4BUPA 2W9AA 5F9NA 1NHKL 1QPMA 2DNGA 1SMTA