1MW7A

X-ray structure of y162_helpy northeast structural genomics consortium target pr6
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDYNSFKLLNEGFESLKLPILKASLQRIATTPIELNDEQMELTEKLLDRIEDDDDVVALYTNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-RAY STRUCTURE OF Y162_HELPY NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET PR6
rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords HYPOTHETICAL PROTEIN HP0162
total genus 65
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1mw7A01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A02
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1mw7A03
1WJFA 1E0EA 3F9KA 1K6YA 3HPHA 1WJEA 4F3QA 1LFPA 1WJAA 1MW7A 1WJCA 1WJDA 3HPGA 1KONA 1WJBA
chains in the Genus database with same CATH superfamily
4NLVA 2KMUA 1FKOB 2UUAF 2PA8D 2WV0A 2W9BA 4L73A 1JLFA 3MECB 5L1JA 1E3HA 5J2QA 3S15J 1HNWJ 2HNZB 1FRLA 5D4PA 5AJ3J 1TWHJ 2QA1A 4LVNP 2K06A 5KG5A 3QT5A 3DOLA 1ZPWX 1ELOA 2IA2A 1PJRA 1IRXA 4KY3A 2FHKA 1JLFB 3DEWA 4DXLA 2HHVA 1X31C 2KRRA 3CCMI 5A8KA 1R8BA 2MABA 5F27A 1M0SA 3W1YC 2OJ3A 3GZ5A 1YJ7A 4S05A 4IHTA 4FS1A 2MLYA 1U48A 1TV6B 4HF0A 5CZVA 1FEEA 1K7AA 3SEZA 1WFXA 2ZH5A 2OJED 2O8XA 4UUSB 4USHA 4RW7A 2LQ9A 1O3TA 3CDWA 3T5KA 2VG5A 1IN8A 2PQ8A 1Y11A 4DR6F 3HVAA 2Y9YA 4NXMJ 4OZ1A 5L39A 5B3SH 2ZH6A 3NWRA 1MZBA 1ZR2A 1JKHB 1F2HA 2UXXA 4NASA 1FRHA 4ES2A 1S9EA 3D67A 3WGGA 4ZJQA 5IC4B 1RLDA 4EGLA 1QE1A 4OX6A 2DNMA 1SL2A 4S04A 4XK8C 3KIOA 1KTQA 3O2IA 1XQIA 2Y0BB 4A3FJ 1RTZA 1FJ7A 2ZSHB 4X2BA 3WTXC 3RBZA 3FMWA 4G94A 1KSPA 2R2TA 4RA2A 1J2XA 4YIRX 4OMYA 2CV0A 2HPMA 2EJRA 1YJ9I 1Y00A 3C6TA 1XDSA 3EGZA 4DL0C 2O67A 1C2PA 2MZRA 5ADZA 2E1MC 4DFMA 4YMEA 4CO3A 3TJ9A 3FBFA 3CTRA 1KRPA 2F4OB 3IBFB 1RE1B 4A0XA 2R8JA 3TBIA 2VD3A 1PJ6A 4UQTA 1F43A 3LA7A 2BQUA 2G2YA 4IOBA 3GONA 1R1TA 4PUOB 3GFLA 4A0YA 1TP7A 2ADUA 2BVLA 1YE9A 3EE3A 4URGA 5HLHA 2WAQN 3K1MA 1UG2A 2R7QA 1OY8A 2X9DA 1WVRA 1PO6A 2VL1A 2CDQA 4OIOF 3CUNA 3E8OA 2Q6BA 4NLOA 4FYYB 3ABUA 2DFHA 1I3OB 2WSCC 2GO8A 4ZYGA 1I27A 3PW5A 3OMYA 1SVDA 3IBCB 3UI3A 1X5TA 4WX9A 4DQSA 5KFZA 2M3AA 5J1NA 1Y10A 4EK2A 3LW5C 1MSWD 2ZNYA 3D5LA 4PAAA 4XN3A 2EV0A 1U5TA 2TRTA 3NLCA 4EU0A 1WOSA 2E1NA 1K6OA 3QFHA 2HNYB 3TOBA 3KJVA 4P2XA 1W7PB 2DW4A 2LQBA 1C0WA 5EWGA 5KVRA 4AYBN 2BE5F 3LANA 1JKQC 2BZ2A 4H4MB 4ZPAA 3TI0A 1OPCA 2DFIA 1L3KA 1J5OA 3CJRA 1TK8A 2V6AA 4WU2A 2IGKA 1HBMA 4UY8T 4M5DB 2F4FA 3TJAA 5LJ5Y 4X66F 4JOMA 3ZZOA 4ASNA 2QSWA 1SXLA 4ZPTR 3CC4I 1MG7A 4OU0A 1TKZB 3RYPA 1DURA 2E5JA 4UZBA 1ETKA 1VQ6I 1JLBA 3HPHA 4HHHA 4ZK7M 1JE8A 3CJRB 4L75A 2FA5A 3DTKA 3VALA 4K4XA 1H38A 1WELA 1SKWA 5HMWA 2L9DA 4PUSA 4CO0A 2PO4A 1OYDA 2UXDF 2FX0A 2M2BA 4WKYA 1XDUA 4F0MA 3EZUA 4KMUX 2LVSA 3WTVC 4DQQA 1TTHB 2VKZG 1ERDA 3HRUA 2ZOFA 3FEYB 2Z99A 2HQCA 2XMTA 1DGWY 5H9FK 1R71A 4C98A 4P2MA 2PD1A 5A0YB 2DITA 1FTZA 3H9JA 1UG0A 1FIAA 2W2MP 4M5JA 3CJ0A 3TQNA 2CPDA 1REVB 1K61A 4NBQA 2R93J 1LW2A 2XSJC 3KP7A 1RHJB 2V4JA 2P8IA 5KFYA 3H8YA 2D3UA 2VQLA 3ZTSA 2QZ8A 3CLOA 2FF4A 1X5SA 1U2CA 1Q5YA 1PCAA 2M8HA 1FTCA 3MR5A 5HVGA 3WU0A 3SI8A 2O3DA 3K4LA 3I0RA 2VOOA 3BJAA 4DL7A 5A2QY 3OIQA 2X6XA 1IO2A 2LY9A 2DLLA 3X2QH 4FN5A 1R9TJ 2ERRA 2MLZA 1V3SA 1SD5A 5IXUA 1ONVA 4OMFG 3GX4X 4FYXB 1GX5A 3VOEA 3E6DA 3SSSA 5LSOA 5I3UB 4LR8A 3L3CA 4TLQA 2FMLA 3UD3P 4LLGF 4CP5A 2W85A 2NS0A 4IUFA 3HUGA 3I0SB 3MZIA 3VFZA 1QSYA 2X3GA 5FKMA 4CNZA 4MQVA 5JI6A 4QR0A 1GMWA 1TQPA 1X3ZB 2CVEA 1D3WA 1FJEB 3NAHA 2KH9A 4ED7A 4Y2IA 4HQMA 4FCYA 2UVWA 4QYZK 3EVWA 2ALYB 1UZHA 4YFUA 1BXNA 4JV2A 1AXQA 2HHXA 3L2CA 1U25A 3L9ZA 1KLNA 2OPQA 2MZ1A 2VXZA 4A3BJ 5A2QZ 1S6QB 2RQKA 5CYJA 4DN0A 2A68F 1UWBA 2HZVA 4XSXF 2MKKA 1NJYA 2LU2A 4QIVA 1HNXF 5K7ZA 4D1QA 4IHSA 4ICLB 1TWCJ 5B1BH 1S7IA 4GO5X 5B0EA 4DPOA 1GVJA 4FP9A 3CDAA 3VODA 2QLBB 3EXYA 3T5LA 5THWA 2PMZD 1X0FA 1I94J 2YWEA 2IXSA 3FKIJ 2QGFB 2DNGA 5DUIA 1W1WE 2J5AA 5F3ZA 2WAQA 3ZMVA 1HNVB 1D8KA 3AODA 2XY5A 1EF4A 3MEDA 4NZ7A 3WE3A 3OY9A 3PO3J 4MYUA 3KLFA 3FUYA 3UPFA 2KIUA 3K70C 2BJ7A 3JREA 3B6CA 4UY85 2VQGA 1NPKA 3O8GA 2ESHA 4R1HA 4PSWA 1CULB 1P9YA 3MMAA 1O4XA 4ZYAA 2FZCB 2G2ZA 1IKVA 2ZC2A 1TVRB 1WC0A 3E3XA 3T8TA 1IQZA 2M7BA 4B4CA 3MM6B 1WD6A 1VRTB 1XTAA 2BXJA 1OR7C 1YIJS 3ZR8X 4QWEA 4FF1A 1X4OA 5ILVA 5T7LA 4DV5F 5GP9A 3SDEA 3G8TA 3QLHA 1BWVA 1KKHA 5C24B 2DY9A 2YKMA 3GBGA 1X5OA 2KXFA 2FOKA 3P96A 5IC6B 1U5TC 2WB1N 3EGNA 2KT0A 3ZNJ1 2UU9J 2E66A 1Q8IA 4KKOB 3AT1B 2JRSA 2RQQA 2O01C 3A0HC 1FOYA 3NEKA 4QPQA 3M1VB 1HPZB 4XIDA 4UY8I 1WJAA 1LQ9A 1A36A 3IKTA 5J8CA 4LK1F 5C4XJ 2G7UA 3HOTA 3RYRA 1G4CA 3M3YJ 3KOAA 3A4CA 3I82A 2LF8A 4PEOA 2DRDA 4HBLA 2EC0A 1XBWA 2Q2EA 5JHUA 1LOUA 2IM3A 3P3DA 4HW0A 3W8PA 3M30B 3PEJA 1UZDA 2HVSA 3U27A 2EZLA 3WZ0A 2NYHA 3A8KA 1I51B 5K8OA 3JSOA 1U3EM 3I87A 1RNLA 4DR3J 1VQ7I 3HMJG 3ZZTA 2XS7A 4XSZF 4EGZA 1T9WA 4O44A 2C3UA 1IBMF 4DFJA 4RU9A 5KFSA 3TAPA 4QTRA 5IOZA 1QU3A 4RW9B 4A8SA 3GILA 2R4GA 2LQJA 3POTA 5BYQA 1USTA 2H4WB 4GC7A 1UPMB 4KAIA 3ITHB 3SZPA 3OJUA 3ILLA 1Z7UA 1NHKL 3SXLA 5LHGA 2H8WA 1XGOA 2OD4A 4NLUA 1PBAA 2OUMA 4BJ5C 3HK2A 1RISA 5EG0B 3GCMA 4EO8A 1U9NA 2IJNA 4JUZA 1EKEA 1LUJB 1MH3A 2VIXA 4WP8A 3LAMA 4KGZB 1NM2A 5K14A 3BPXA 4ITSA 1ZGAA 2FUG9 4K8RA 5GADI 2ZJQF 3K5PA 2BM1A 2QA4S 4OAYA 2QSGX 2K5CA 2FEZA 4PABA 1U1MA 5LEJA 3OXLA 2GIZA 1DDNA 4DU8A 4N9IA 2IVFB 5E3PA 5ICEA 2DNPA 3FVYA 1I5OB 3MMCB 3JRHA 2M45A 5ETQA 1GXLA 4E6KG 3US5A 1ZKGA 4J90A 4JI3F 1FK9A 2JEGA 2XAJA 1BQNB 1KQ8A 4M72A 5KFFA 1V3FA 2RMLA 1FYLA 2YKQA 5FFZA 2JVOA 1B72B 2DHGA 2CQPA 2I5JA 1JQGA 2KXNB 3DLBA 3IA0A 3OL8A 2JZ5A 1QVUA 2W9BB 4ZLJA 1ETYA 3Q9VA 2LY2A 3HVRA 4C48A 2YKMB 2DODA 4PJMA 3N4MA 1JJCB 2IMWP 4DWIA 4RLQA 1U6ZA 5D6FA 4ILLA 3OS1A 2JLEA 4NLQA 4O23A 3X3UA 5LHHA 1OMIA 4A12A 1S1VB 3UDEA 2E5LJ 4IFVB 1HLVA 1DTTB 3SQNA 4GKJJ 1IKYB 4FF3A 1G3YA 2OU2A 3BBCA 2VI6A 4YS2A 5DRKA 2RDDA 1KU2A 2M34A 2KPMA 3HGGA 1S5LC 2EIKH 5IYCJ 4ED6A 4JI7F 3RYLA 2E1PA 2BVMA 3PYGA 2ADBA 4WP9A 1LE8B 2WVBA 1T02A 1GV2A 4CLWA 2M1BA 1VMBA 4K2XA 5J1RA 1HW8A 5HODA 2PI5A 1PSDA 4IKFA 1R0CB 5EG0A 2FSWA 2HS0A 4FPIA 4MGRA 4ZOSA 1J09A 2Z4PA 4HDUA 3IC7A 3D6TB 2DTRA 2WBMA 3R6GB 4WK3A 1XX5A 1IJFB 4Q8FA 3HM5A 4WU3A 2XHKA 4RDUA 2CNKB 4PG6A 5A2QK 3N6NA 5BMZA 4M94A 5EUHA 2WTEA 1SPBP 2M7AA 3T1YF 3GJQB 2MQMA 3HB9A 4UTGA 2LK2A 1DAXA 2OEKA 1YYVA 2R7TA 3SMZA 4YR0A 5BPIA 3KE2A 2WC2A 1IW7F 3FK7A 2ZXHA 3MMCA 4WE1A 2ZBQA 1S77D 3GZ7A 2EFOA 2V0NA 5CCLA 1QSLA 4LFUA 2BKPA 2R2UA 1F5AA 4GGGA 2IS1A 1N6QA 1YGYA 3NBPB 3H5YA 2MG4A 2HS3A 5IT3A 2QTWA 2E2HJ 2CPXA 4KE5A 4O4GA 1MSFC 1KQKA 1XERA 2ZMEC 2EKNA 4ZVTB 2ZBCA 3K89A 4IPAA 3GLXA 1EH7A 4M8LA 3DF8A 3HHEA 3H9GA 3ECOA 2QA4G 3Q0WA 3VVUA 4K2EA 7AT1B 4WIQA 3WU2C 2AHQA 1IXCA 1BQNA 3ILIA 4XLNF 4LF4J 2VPZB 5KFVA 2W48A 1MGTA 2FJDB 2KZGA 1RWOB 3QLHB 2UUZA 3ILJA 4QU7A 1RKWA 3AL0C 1SFXA 2WVEA 4UB6C 3OBIA 4NYOA 2JA5J 4YR2A 1D09B 3JRIA 4L5EA 2VE9A 4Q0BB 2FB0A 4KFBB 4HZFA 4KIAA 2MBFA 3ZZYA 4I7HA 5FKNA 3EUNA 1ON2A 4RUAA 2XRNA 2Y0SN 2DRBA 1W7PA 1STZA 1K4SA 5I42B 2CKWA 4CTAA 3Q2TC 3M30A 4ZP7A 3TO8A 3LAJA 2F5VA 2M9HA 2HGLA 3MEGA 3Q24A 2Q3PA 3W2AA 1MN9A 4FF4A 2OH2A 1VQOS 4NNJA 3GFJA 5K5RA 4FT8A 2OTJI 2M7SA 1IV6A 4EJWA 4UUWA 5HI7A 1IJWC 3CF2A 2J7WA 5JVGF 3W3SA 1TT0A 3V6KA 3ZQ7A 2MZJA 2VG5B 3GIKA 3DN9A 4M5MA 1SEUA 2KRBA 5ETRA 1XG1A 3CCTA 3JSMA 3I58A 3H2VE 1RR7A 4I56A 4DF4A 2HAIA 3JXOA 2V9KA 3TARA 1RT3A 2XUBA 4O44B 2E34A 4ECRA 2ZZNA 4K50A 2FJXA 1E6VB 2YH1A 3IRXA 3REOA 3HBLA 3CDLA 1X1DA 2OTLI 3OLAA 2VG6B 1VF9A 5J1UA 1REPC 3R9LA 4WTOB 3CJSA 1QGPA 4DU7A 1ZA1B 1OY9A 2L48A 2XSJA 2RDPA 3JB9k 4OHXA 2LA4A 5CXTA 1S12A 2JVRA 4KNYA 4BQQA 2PEXA 2Y69H 1K78B 1ITYA 5E3NA 1HI8A 4BACA 3U1MA 4PPZA 3OPKA 4RW8A 2HXIA 3F8FA 2XHWA 3QQCD 3TDUC 4QZVB 2YNFB 3PVXA 2ZE2A 2ECBA 4ZP6A 3MAHA 4BGDA 4ANJA 3OYKA 4A8XA 5LMNF 1NK4A 4PUOA 4G7OF 2MZTA 3CMMA 3IMQJ 3WTWC 1WH5A 3Q0VA 2Z2YB 4MKAA 4QIWN 3WHBA 1SJFA 1YW7A 3R0AA 1P92A 4PJJA 3BR3A 5HS7A 3CD0A 1JK9B 2AZ1A 3I5BA 4HI2A 1LKZA 5EWFA 6AT1B 2F5GA 1JTYA 2AX0A 4BYYA 2H9ZA 2GMLA 2DIUA 4HAMA 2MLXA 1P7JA 2UP1A 1ZG1A 1N78A 4G12A 3FXJA 3J7YJ 3M7VA 1NHAA 3M2UA 4E8UA 3C46A 2HNYA 4Q0BA 1D0ZA 3HKZD 1WG1A 4XDDA 4YB1P 5DV5A 3PO2J 4CT8A 3BR0A 4EO6A 3MAQA 2A07F 2JSXA 4AYBD 3MCSA 3I9V2 2F65A 4Z37A 4TV7A 5DQGA 4U7DA 2NVQJ 1VQ8S 4I1TA 4IHWA 1ZAVA 2XGQA 3ENQA 1T95A 3HHLD 4NCAA 1FFGB 2G9WA 1EH8A 4N56A 4DSKA 4MFBA 4KH0B 1UWBB 1VQKS 2WAQD 5DYMA 5SUHA 4M73A 3GTMJ 3QIPB 2BBYA 1RZ4A 5K5QA 1XIQA 5A76A 3D9BA 3MM9B 2GWRA 3R1LA 1SV5B 3K6GA 5HLFA 2C1EB 1S76D 4DPXA 5L3CA 1SL1A 2DEJA 1YITS 1E2XA 3A01A 1LWXA 3VAIA 3M32B 3HT3A 3OYBA 4HNVA 2MKYA 4DV1F 5CYMB 3LQQA 2KVIA 2DPIA 2F8MA 1Q4RA 1UKUA 1NEEA 2R4FA 1SD4A 1A9NB 1S72S 3BYPA 3RPUD 1K78A 1WQ2A 3KLFB 3NGTA 4ZJZA 2OSRA 3TOQA 3H59A 4ZN3A 1UJ5A 2P5LC 4J9MA 4AVPA 3D68A 2KYXA 2HOEA 5LRRA 4BDYA 3TP2A 2Y3YA 4AQYJ 3CIMA 1KYZA 2XGDA 2L3DA 3SXYA 1RGVA 2WVDA 3CC7S 5M2UA 1XMKA 3A8IA 3GEZA 1ZETA 2KU7A 1AWCA 5EDWA 3MR6A 2VXDA 2R42A 4LF5J 3MMYB 2GMJA 2IDLA 3EWGA 4TYBA 2LVWA 2QL9B 1FRKA 2EK1A 1KONA 2M70A 5LMUF 2XY7A 3WX4A 5IYDJ 2VFSA 3DKXA 5CYQB 2HHPA 1V5FA 4LFCJ 5B5EC 2V2KA 3PUFA 3TW7A 4CO5A 2KT5A 5D15A 3LWFA 4DV1J 2D9OA 4NLTA 2PMZN 5DLGA 3KUHA 3DP7A 3S2DJ 4LG0B 4B08A 2D45A 4J9NA 3CJQB 1G3OA 2JWTA 5HMZA 4ZVHA 3WU1B 1BMQB 1FERA 2F5DA 1QZZA 4CUGA 4NLDA 1CS4B 2UUWA 1XR5A 5LGUA 2YKAA 1YHQI 1WRJA 1FJCA 4PFOA 2AJ2A 2Y9ZA 1E6YA 2J0XA 4C4WA 2HFVA 1RHUB 5KFJA 3D2WA 3GO5A 3SV3A 3IHUA 1YBAA 5A8WA 2O5RA 4E70A 4KN4X 1S1UA 2AYEA 3A3PB 2YPYA 2K3IA 3WBZA 2R7VA 3J7YI 4NUBA 4HYEA 4EJUA 4F55A 1HYSB 3LUYA 1QAYA 3UCUP 1W26A 3HHGA 4LF2A 4JI1F 2D7SA 1TKDA 1UHSA 1O5JA 2YPZA 4UUSA 3T9NA 1RCOB 2VDHA 3N6MA 5FB2A 3RZOJ 4BJTA 5E79C 4G6VB 1PYOB 2HYJA 3E2EA 2IRXA 3HKZA 4DQPA 1EX8A 2HEOA 3D4JA 2DHSA 1SANA 4HTJA 1FRMA 1HWKA 4Q2MA 1Q0NA 2CJKA 3M6VA 4AC0A 2VJVA 4Q5SF 4C9DA 5HDNA 4HHJA 4OLOA 2AGPA 1PJ5A 2FUG2 3VGVA 1SH2A 4QR1A 2XO7A 3BR2A 5M2RA 2JVHA 3PNYA 2GZWA 4I0AA 1N33F 9ANTA 1UEVA 5GAHU 3K2AA 1R4MB 4OIXA 1U45A 2M30A 1O6XA 5LGNA 3JAMY 4O3RA 3BR8A 4AXIA 1LB2A 1Q79A 2KKHA 3R5BA 1FE0A 1VZ0A 2GQ2A 1E6VA 1M90T 2JJ7A 4M3FA 1FXDA 2ACJA 2K3KA 2QYOA 1DLOA 5F8JA 2LKZA 2QE5A 2L4AA 2Y75A 3HRMA 2BJDA 4ATNA 4CLFA 3PDNA 3L7PA 2V8HA 3N0VA 3BTJA 2IM2A 3HHHA 4NC6A 1F1BB 1TMJA 4FF2A 1F3FA 4PWDB 2WOMA 1P27B 3ZQIA 3DRPB 3GVAA 3C2HA 1Y39A 4ON0A 3CUQB 3K0LA 4XRSG 3KEYA 3GFIA 5C3EJ 2B0LA 4AYBA 2J7KA 4G9YA 4F4XA 4J19A 5E3MA 2R7UA 5E1XA 1S7AA 3UVJA 5L3DA 4E7JA 2JEIA 5ILSA 4AIJA 4Y52J 3F8CA 3QP6A 1HQEA 1S9GA 1C0TB 2VG7A 1DUXC 3PY8A 3ZOBA 2JZYA 3SSQA 3Q8YA 4LT6A 2PT0A 4WXDA 1FOXA 2DFFA 4C8NA 2VT3A 3CD6I 2ME0A 4XRSA 4Y17A 2NPFA 4BWJA 2J5OA 1RUNA 1IBKJ 1YITI 4XLEA 1W36C 2IMOA 3GU0A 2KN4A 4PG5A 1RT1B 4ZVEA 3RAMA 2M0MA 1RHRB 5DM7F 4KB7A 1GAOA 4KGMA 3I0RB 1LK5A 1O8BA 2HVRA 3BF4A 1ZN2A 1MNEA 4DS5A 4XDCA 2HQ3A 3LWMA 2DNYA 2HURA 4Y65A 3W7BA 1XMXA 1R6VA 5KT2A 4GMKA 3G8SA 2E1MB 1X3WB 3DRSB 4KIGA 1TELA 3OR1C 1X19A 1D1AA 3MF5A 4M95A 4MIWA 1N88A 3BG5A 2C6YA 4BXXJ 2NZ4A 4WTYA 3P6YC 4OYIA 4R0JA 1AHDP 2AEJA 2HOTA 2PMZA 3M4OJ 2VA3A 1X3UA 1HNVA 3G87A 3I4HX 2UV8A 2Z56B 2H1YA 4IOAQ 4FASD 4DR4J 1HD1A 5B09A 3E0JB 4EM1A 2RV8A 2R0QC 3N01A 2AD9A 1OQYA 3BZKA 4XQFA 3RBXA 4RBOA 1RKJA 1NRKA 2B8QA 2QLJB 1AROP 4AQYF 3CJ8A 5D4RA 3AAFA 5A0YA 4M6XA 3CO6C 4BBYA 4LITA 2DO4A 4EGYA 2OCEA 2CIMA 1FMWA 1R22A 2P7VB 5CQGA 2AV5A 1OYIA 4C11A 1ZLKA 2Z3YA 1FKOA 1I6JA 1RTJB 3DBLB 3T1AA 2XAGA 2HS4A 2MSTA 2K9SA 4UV9A 1PUEE 5C5JA 1ETOA 4RBTA 3OOPA 3S1TA 4EVIA 2PSZA 2XMVA 1YRTA 1RCXB 3L7WA 2ACMA 4RUBA 4I2PB 1H9GA 1YJ9S 3C16B 1QVGR 5KFKA 5GMKa 2DYSH 4KN7X 3ZMSA 2F8EX 3C18A 1AZSB 1BBYA 4UZCA 2V1XA 4UOHA 2U1AA 1OCTC 4XM3A 1PJ7A 3TA0A 4DL2A 4N4OB 3SFGA 3TO9A 2EFWA 2VICA 4C3IJ 1E6YB 2DA6A 2RS8A 1UW9A 1KS2A 1BW5A 4CM2A 1KU9A 3GFXA 5CKTA 1NCLA 3S3OA 2PJRA 4ER8A 1Y3KA 3IH4A 1ZRFA 3F0CA 2BY1A 4AUKA 1ZRDA 3SHFA 1LQ1A 3WODF 1U5TB 3H36A 4RZRA 3LAKA 1MBKA 1T3OA 5BYRA 5BPDA 3OL6A 1RTIB 1VQPI 4CNYA 4HH0A 2CZVC 2VT2A 2KZVA 1WKLA 3S8SA 2JSPA 1MU2A 4ANEA 1Q7YT 3D5MA 5D4OA 2ADCA 1HNZJ 4DS4A 3M1CA 1HBMB 4NRUA 2NVYJ 3OYEA 1WJEA 1IRFA 2BQ3A 5D4LA 1IDYA 3KHLA 3HL2A 2BEFA 3GR0A 2CXEA 3MMBA 1VI0A 3DLHA 4PJ0C 2B5JB 4UF4A 3Q8UA 4RLFA 3KJFB 1ETQA 2RF2B 2GBYA 2FGCA 1YQHA 3ZPLA 4IDKA 2EBGA 4H4OB 3TGNA 1Y7PA 3GIRA 4QPTA 4BEHB 4U0YA 3BYRA 5F0WA 1K79A 2JK3A 3TX8A 3QODA 4GYIA 1BQMB 4NI2A 3VAGA 2AYBA 1WCMJ 4OX8A 2FLNA 3Q8RB 2DGSA 4FYWB 3V7CA 3FGVA 3ZMTA 3T1YJ 1VHIA 3NNAA 1TQLA 2G2OA 3D1NI 1J75A 3O3LA 1RWVB 3RRGA 1Y8QB 4WFBQ 3BH7B 2XS5A 4M3GA 1Q95G 5AIQA 3CTAA 1N48A 3ONQA 4WXOA 5E5NA 4LSZB 2ASDA 3FXLA 1ULYA 3CT9A 5B0DA 3LSGA 4R79A 4X64J 2AT1B 3M8ZA 3OXFA 4M9SA 2V8GA 3E97A 1S1TA 2FJVA 4ZHRB 2IBDA 2K27A 1TKTB 2B7EA 1JT6A 1XNQF 3R2CJ 3FWEA 3J7ZT 3DFEA 5CVRA 1NH8A 3K4NA 2OFGX 4B3OB 3G8QA 4JI8F 1N33J 2EZHA 1Y0UA 1PILA 3M9NB 4O0NA 2V2VA 2WAFA 1VRUA 2AJ0A 3KK2A 3HKWA 4A8QA 2WBRA 2BACA 1U09A 4M5DA 4E98A 5ETPA 3K17A 4HEA9 3QU3A 2COMA 1X4EA 2RIJA 5JVTA 2EFVA 1QSSA 1MMNA 5A8RA 1N4LA 1T9XA 2KIFA 5J40A 2QSFX 1KYWA 2YX7A 2H48B 3E51A 1XMAA 4MT1A 4KYWA 2RQPA 4U8VA 1RT1A 3R97A 6FDRA 3R7SB 4JQFA 8ATCB 3Q9SA 2E7VA 4KYZA 2CVIA 3G71I 3DXBA 1R0AA 2PBIA 4NOHA 2VPLA 4IRGA 4KICA 1S99A 5KOXA 1U4BA 1JT0A 3V6HA 4P7TA 3GYGA 3MMBB 3HHNB 4MH8A 1YIOA 2NRAC 1LFPA 3QPSA 1X1PA 4EM2A 3UCZP 2NREA 2HWHA 3DRSA 5KG3A 4L3KA 1RT5B 5GTHC 2LREA 1KN6A 2IY5B 2BW7A 4HTIA 4ZJLA 5CZXA 5ICGA 4TY9A 2ZBPA 1HDPA 2I8DA 4B3SF 1QVFR 3O5TB 2OQRA 2N3OA 3FMBA 1XGNA 3BS9A 3C14B 1QM9A 2JLGA 4XR6A 2ZJ2A 1RIOH 1IM4A 3DOKB 2DTJA 4Z2XA 2OAZA 2P81A 4Q8EA 4ZA1A 2R7SA 2DMPA 4P9SA 1TZ0A 2LCWA 3HULA 2DT6A 2R5ZB 4WBFA 2R7OA 1HWIA 4RWXA 2ZZTA 3MPUB 2JFKA 2ISYA 1NK7A 4RNNA 1B59A 5J3LA 5JVGQ 3QGHA 2XQCA 5HLGA 1WHWA 4HT5A 4K4SA 1FWZA 4IG3B 1XPXA 2KJVA 3BPVA 1MBEA 2RDIA 5FDLA 1S6PA 1T3NA 2NXNB 4HV6A 1Y6IA 1NLKL 2V50A 2LU1A 1F3VA 4NEZA 3BO3A 4F2SA 3TO6A 4XONA 3HOWJ 2NS7A 2P4WA 1CBKA 1RWMB 4ZVSB 3IUOA 3RUBL 4GRSA 5CYQA 4QOTA 2NNNA 4IH6A 4C11B 1JUPA 4U87A 1YRUA 2CPIA 2ZSIB 1FX2A 1Z3XA 5CVIA 3HHKA 3CJTB 3V8JA 3N79A 4YEJA 4PYAA 2BM0A 4LF7J 3U9GA 4ZVFA 4WF9Q 1T8IA 5AXKA 3DDKA 4XIUA 1V5EA 2X4HA 4X84A 3PNIA 1OY6A 2RREA 3I59A 1UA1A 1Q7LB 1RACB 3TP3A 4ZPDA 1HWUA 1VNDA 5E20A 1MD0A 4U95A 3A02A 1JJ2R 4NA3A 4HDHA 2X1DA 4RUCA 4YP3A 3Q89A 2WA0A 1NK3P 3GP9A 2QM3A 4DL3A 3VGUA 1DBDA 2M5YA 3SQGB 2NVTJ 1HNWF 3OLBA 2NCKL 1GXUA 4TQSA 2E36A 3PFOA 2AKWB 1HPZA 2Y48A 1MWYA 2VJJA 4KHPJ 4HNUA 3W5ZA 4J37A 2RRAA 2MLKA 1HARA 2FTRA 3JTPA 2MMYA 1Y1WJ 1SFOJ 2K3FA 2JC1A 4OIPF 1DJ0A 3G73A 2IAIA 4L74A 4BHBA 4NPOA 3ZZ0A 2E5LF 3MAJA 1N0VC 2O0YA 4ILRA 4CO8A 1PIEA 2MKHA 4WXWA 4LLLA 2VPXB 2B8PA 4Q44A 1PUFA 1EQMA 1KQGB 2HQ5A 3F8MA 4GYGA 2IFXA 5ETNA 4KJIA 2LTPA 1NB7A 4N5SA 1ZTTA 3TQ1A 3MR7A 2G9OA 1RHKB 4NCBA 3BG7A 3IAS2 3S1MJ 4IOCQ 2CWKA 3SDBA 3KG4A 4DZJA 1A0OB 2LYVA 2R2RA 4LRFA 3P9IA 5JVHQ 3OYGA 3GV7B 3FZVA 1G2HA 3V81A 1ZGJA 4IL6C 3G4SS 1SBRA 4DR3F 4DG1A 2QN6B 4ECXA 3GJTB 3Q86A 4KO0A 1JLQA 4NA1A 4G7HF 2Z2SB 4XICA 3Q0UA 2CPZA 2VLAA 2JC0A 3TZYA 2DNZA 4HLXA 3VYUB 4U7BA 1BR4A 3TA1A 1M1EB 3T19A 2Y8WA 2QCOA 3DMJB 3A03A 2X0LA 1YSJA 3RGIA 1NSQA 4B9TA 4ES1A 2FNAA 3QGGA 1W5SA 2YY3A 3R7NB 3GUDA 2GJ2A 2KRFA 2XLIA 2K02A 2KB2A 2JJ4D 4B9UA 3HSRA 2FLPA 4YR3A 4FX4A 4G6QA 1FHTA 3HXLA 2E5HA 3C8YA 3UN3A 3E01A 1RAJA 5ETVA 2CUJA 3V42A 2W9CB 3QO9B 3VAMA 3WGIA 5IZHA 2MLGA 4YEAA 4DFPA 2HVQA 3BGFA 4QU6A 4MK7A 4GC6A 3F23A 5J1YA 4MEXF 1U8WA 5CVVA 2KT2A 3FSYA 5M3FJ 3RZAA 5H9EK 2JUGA 4N7TA 1X60A 4IFVA 1G6BA 2LEBA 3GCWP 3PRBA 3GMEA 5K8MA 2DAOA 3MN2A 3GSDA 1OLTA 3ITHA 2H4YB 2GIVA 4II3A 1ZZFA 2MPUA 3BT9A 3E5UA 2WADA 2JMWA 1X4FA 2EA4A 4RB0A 3UNYA 3S1QJ 4IX7A 1MIJA 1YKWA 2BEOA 3BG6A 1D8ZA 3G9CA 2F5EA 5D5WB 1YBUA 2ID6A 1OO0B 2F63A 1FZPB 1DTQB 4UXNA 3BTCA 3PJWA 3HZGA 3V6DA 2GNKA 2JFDA 1T0TV 2LP4A 5G0RA 2BOLA 3TQEA 2E1OA 4OYAA 2BXYA 1APLC 2NAZA 4YQWA 2IAJB 2CPYA 3ULHA 1IN7A 2CQXA 3BREA 3KETA 3PX4A 3M1EA 1AUSL 3EQLF 4CQ1A 1VFCA 2BV6A 4LB5A 1XC5A 2XS2A 2EPFA 3S01A 2MKJA 1RDRA 2Z2MA 3RAXA 4LLNA 2MJUA 3RU0A 4DYQA 2DBBA 3COAC 4DSLA 4BCAA 3DMJA 2WONA 4NCGB 2VJ5A 1ODDA 1WOPA 2LEAA 1GXPA 5HK4A 1FJLA 4BU2A 2LQ8A 1SFKA 3C6UB 1AB8A 3DBHB 5F0FA 2A6TA 5AXLA 1NZ8A 1TW3A 3PW2A 4OZNA 2ROPA 4LB6B 4LG0A 3RSNA 1RWXB 4CT9A 4CLYA 1ENHA 3OS0A 5F9LA 3HHLC 2EVZA 1H88C 3FXMA 1IF1A 4A3GJ 4DL5A 1AYEA 5HO4A 3OFEA 1MMSA 1YW8A 2JPCA 1XN7A 3CB4A 3IN5A 4OYZA 2B9WA 4EUVA 1VQ5S 2W25A 5KFHA 1KDNA 1LE8A 3VZHA 4XORA 3WHCA 4O3QA 4ZIVA 1F9HA 3RB4A 1FRJA 1VQMS 4F4AA 2NS1B 2AEFA 3PRDA 1X4CA 3QU6A 2HMIB 2VKHA 1R4NB 1X4HA 2DYAA 1K4TA 2GHVC 4A5NA 1MMDA 2QMXA 3VV2B 3PO4A 1Z67A 3CESA 4C8KA 3HLUA 2KQRA 3UDCA 3BN4A 4QYZJ 3D5RC 5T41A 3OHAA 4I6WA 3W63A 4E7LA 3H35A 2V69A 3BB5A 1B8IA 2HDDA 3FBIB 2I1RA 4KHRA 2VJIA 5D8LB 2Q2EB 3L2VA 2R7WA 2Q1LA 3GWCA 3JRBA 3KP3A 1VQNI 5KT3A 3PW0A 3QYBA 1B9MA 1Q81T 2L41A 5U47A 1T94A 5H20A 3BDPA 2WB1A 4A8MP 1SV5A 5HLFB 4YHHJ 3PV8A 2HDCA 3S16J 3ZQFA 4MK8A 5B08A 4DZ6A 5LXYA 2RHQB 3PJ9A 4CYUB 3ZTRA 3WC0A 1S1UB 2ZO4A 3GWZA 4WCGA 3CGIA 3DI6B 4CRJA 2QQAA 2Y1LB 3BY6A 4LD5A 5M3MJ 1XNRF 4I64A 4D3HA 3HIFA 1Z3YA 4M5GA 1TW2A 3FXOA 2V4JC 1U9OA 5IWAJ 4NCGA 4NDLA 3RJMB 4QWQA 2HBQB 2LDYA 1IBLJ 3KJNB 4PGGA 2N4DA 2XMMA 1Q86T 3R7BB 1QE1B 2CW8A 2JH3A 2ZH4A 1YJRA 3DCFA 4FE4A 1S4FA 5J6XA 3S2WA 3KLIA 3NS7B 2HVIA 2GIFA 4NYPA 4D9JA 3VAJA 3CMAI 4LSNB 2RHSB 3KK1B 3WTTC 2C3OA 1H2VZ 1IUYA 1IN6A 3FCWA 4ZP8A 2B6AA 2MTLA 5LJ3Y 3PKYA 2YXLA 3S93A 2HFUA 4JV5J 1UEUA 3M8PA 1VOMA 4R8UB 4DCPB 2FVRA 6PAXA 3G86A 4UW2A 4ABZA 3E7LA 3FFIA 1X1AA 4JP8A 4LUBA 3TVZA 1TL1A 1M1KT 5CA5A 1P6RA 5KFCA 3J7AN 1ZYQA 2C22A 1HF0A 3E3VA 4DX8H 2VHGA 3MUMP 2Q8KA 1SB6A 1Y9OA 4Y2AA 5CPRB 3MTJA 5ILUA 5KHDA 3F73A 5LLQA 3F72A 3N05A 4IHXA 5LFAA 4QQBA 3LMMA 3BKTA 2J9CA 2HQAA 2EZIA 5L1LA 4G8XA 4DQIA 3M9AA 2OAUA 2HRYA 5EGOB 2UXCJ 2FHJA 3W61A 1B3TA 2Y0MA 2FJAB 3QMQA 3NP5A 2A6OA 2CV2A 1F9FA 1QHHD 2M8DB 1FSEA 4MAKA 2MGZB 4TU7A 2DXEA 1J7KA 3DKWA 4PDKA 2EWNA 4ETZA 4DCJB 1XMOF 3V4GA 3F22A 1VQ4I 4ZVUB 1RTDA 4I99C 5IPAA 4IQMA 1HQ2A 3M9OB 3WDOA 1CJTA 3LP1B 1JLBB 1GMWD 2Y1RI 1M5PC 2DU9A 1MU2B 4QLCU 3HP6A 3E6BA 1M5HA 3LF0A 2JT1A 1RUSA 2B4UA 3VGTA 1SI9A 3Q83A 2YSRA 1HWJA 3M7GA 3Q23A 4B9VA 5J47A 2O3FA 4OHYA 1XSXA 4EWTA 2CGPA 1I3AA 3KKFA 1MJBA 4IDKB 3GFZA 1U0JA 1TR0A 3OFGA 2MKSA 2CJYB 2OELA 2BR0A 4OZ2A 3GTGJ 4WK8F 2CNOB 1Q8KA 3B02A 3MURP 1LWEA 3BQ0A 3KNAA 2F6CA 4DX7A 4I7FA 1TUVA 2V8DA 4UVAA 2P5KA 3L00A 2L0KA 1RLCL 3OWTA 1HW9A 2KFZA 1L3LA 5J2MB 1Y5NB 1WJFA 4ZDPA 3AOBA 4NX9A 4RX6A 1P6TA 3UVJB 4LRBA 3FK6A 3FZBA 3LO3A 1T03B 2HKEA 3HC7A 2VQEF 3DRPA 4MHGA 5M2PA 3CEDA 4BQOA 1JGSA 2XM3A 5B7WA 5CLSA 3WG9A 2LEPA 4NC8A 1G4DA 2RD5C 5D78A 2DJNA 2X1BA 4Z6YA 4JI6F 2FD5A 2OI2A 2OPSA 1GXQA 3GTPJ 5AE3A 2VQHA 4RO0A 3IR5B 3RW6A 4FZVA 4Z2YA 1ZS6A 2NYIA 2VIHA 1CVJA 3EGVA 2PN6A 4CXFA 3MEDB 4A8FA 2HQGA 2DGWA 3S1NJ 2WTFA 1TL1B 4CIOA 1M1GA 3DXJF 3A1YA 3FDSA 2HNDB 4CO2A 1H72C 3I59B 4K59A 5DCMB 2CJXB 2MD0A 1OWXA 3MZ8A 3R5JB 5FKKA 1QRYA 3QPHA 2J8SA 2D2WA 1XSVA 2HFHA 2GC8A 2E9ZA 1QLNA 1RTDB 4ZYHA 3BV8A 1HD0A 3J80Y 1KVIA 1HBOB 1T9TA 5IP6A 2L5QA 2XYGB 1ZH5A 5KFUA 3WGHA 3NMRA 4GVLA 2HNDA 2XASA 4BKXA 3DLLQ 2BE2B 1MDMB 3IM9A 1HHQA 2GXGA 2CRGA 3IAM2 3OVAA 1N5QA 2BHYA 2VDIA 2XAQA 5CD4A 2I5UA 1YHQS 3KCCA 3QFWA 2XDVA 3CJ4A 2XMJA 3BCBA 5DS7A 3WTYC 3W2VB 4IO9F 4B8XA 1PGZA 2PI0A 4RAZA 4F93B 2W4DA 4LF4F 3ET6B 2ATLA 4IFYA 3NY0A 3F6OA 2KDZA 2Q66A 1BI1A 4LVOP 1Y0NA 4Q48A 1UVKA 3VAKA 2M4GA 2BYCA 2LA6A 3IM8A 3EUHC 1Y0HA 4CYDA 1G8XA 4O3OA 1WNEA 2M87A 1TLHB 3CC2I 5GADJ 3EETA 2X6YA 1H89C 1HLWA 2EQRA 1H98A 1TL7A 4EBCA 1PC4A 1H73A 1V5IB 1RR8C 3N6LA 2CUEA 3L1PA 1Q78A 5D5XB 3OTOF 4CYCB 1JJHA 2Y0SD 3PNTA 1SAXA 2M9KA 5B0AA 2XYPB 1MBFA 1H3DA 3C19A 4C8LA 1YG2A 1HNZF 3VB2A 4KRWA 1UL3A 2XKPA 4MFEA 2ID3A 4ZS6A 2XLJA 1F4KA 1TFYA 2QLXA 2CADA 3HSGA 3QZ7A 4KMFA 2HIYA 4O6JA 3CC2S 1CJKB 1ZAOA 1WJ5A 1U47A 3Q3SA 2RQ4A 5E0OA 4DSJA 5D5VB 5IOYA 1WWXA 3U2RA 2IRYA 4KSEB 5C2GA 2E9RX 7FDRA 1RC9A 2IGMA 2LLZA 3M6XA 1YJTA 1U8RA 5LL6d 3H5AA 1C1BB 1D0YA 2V1NA 3V8KA 2L7ZA 3K7AJ 3UN5A 3KEOA 2B43A 4UUXA 2X6OA 1J5EF 2OZ6A 3ZN0A 1A7GE 3ENVA 3FHNA 1A04A 1ZA2B 1RWPB 4CA0A 3BP8A 1AUDA 3S32A 2EKYA 1WKMA 5A8RB 1YJNS 1VC6A 3IWXA 1JXVA 1HA8A 4OZ0A 5HLTA 2V67A 1FLIA 1P4AA 4BJ6C 3K9TA 4LR9A 5HQLA 2Q6CA 2FBHA 3DOMB 5H6RA 3A1YG 2ZKZA 1K0TA 4XAKA 3ABTA 1IWGA 1UETA 3VYSB 2VPWB 2IA0A 1WDDA 4EMSA 4USKA 1S0VA 2DRAA 1WHUA 2I10A 2BY0A 4TNOA 1U1QA 1VJWA 1RI7A 4DPTA 2XNRA 4NB5A 3DHXA 5D6GA 5DM6F 2OFHX 5IQ6A 2GJFA 4DJBA 2QLWA 5FLXY 3K2ZA 2R8IA 2XCPA 3ERMA 4RW9A 3V6DB 3PCOB 4F67A 2AZ3A 1V5GA 3VWSA 5HP1B 1S57A 1FOWA 4ZC3A 1DARA 1S0NA 4D3GA 3G71S 2DGUA 2BW3B 4BH9A 5DD8A 4BEHA 4KGKA 4B9SA 3ZN1A 2VPYB 4XKBA 2CQHA 2CZ9A 3CCLS 3JRCA 4H4KC 1RBAA 2MFZA 1HI1A 4PQUA 2MQNA 5EDNA 2HLTA 2QENA 1TFWA 5IP9J 1EETB 3T6JA 3DGPA 4BHCA 1R6YA 4ZCMA 2E5NA 2BDPA 5ICFA 1SD6A 2ZDOA 4KGVB 3LOCA 1P1TA 4I2OA 3THVA 3RIRA 2B51A 1TTYA 3GIIA 3DEEA 2AP6A 1CGPA 2Y0SA 2UU9F 3KDOA 4DR1F 3PL8A 2F2EA 3V7RA 2DHHA 4F50A 1B72A 3HGYA 1PBUA 4IH5A 2VODA 4J9KA 2KRHA 4DV6F 2B7CB 4JI2F 1B0VA 3DLKB 4OMZA 2ZB9A 1DU0A 4C2UA 4IYQA 5AONA 2K7LA 4DQRA 3T1BA 1T56A 4IG0A 1WGXA 3ZMZA 3L2RA 3PSFA 5HJXA 4YY3F 2QYCA 4ZPWR 4JYAJ 1CULA 4Y15A 1G2EA 1EKRA 3H25A 3H4DA 1S8NA 4WCEQ 4RB2C 3BQ2A 2JA6J 2A05A 3THTA 3KLVA 5L9XA 1APSA 3CMES 2R7DA 2CG4A 5CABA 4JI6J 4H54A 3TANA 2DOFA 1BN5A 2MSSA 3KK2B 3W62A 2HWVA 3TWZA 1N5TA 4K5RA 3CCRS 3SJMA 1GTEA 1W2IA 4FE7A 5BYSA 5LMNJ 3PFYA 3MMAB 5IFMA 3VDXA 4LIRA 2DXIA 2DQRA 1IR2A 2HMIA 2RVCA 5FKLA 2W1BA 4O4GB 2WY7Q 1SKUB 5HAOA 1DP7P 4AD9A 3FXUA 1QA6A 1HBOA 3U1KA 2UVRA 2XF6A 4TQRA 2ASJA 2DISA 2G1DA 1HBUA 2HQFA 3CLQA 3IWZA 1IJEB 4I67A 4M5IA 3O2PE 3FXKA 1VBKA 4WXCA 2LMDA 1P7IA 2J6SA 4ETXA 3RKYA 2RKIB 3LP2A 4AT1B 1UJ4A 1JJ4A 2XF7A 2ROEA 4BS2A 3LAPA 4PRFA 3SFZA 1F36A 1TK0A 1CJUA 2AWZA 3JQKA 3V5RA 2DVIA 1Q16B 4FNHA 1TL4A 4RJVA 2J76E 5L3FA 2CUFA 3J7YU 2EA2A 3W2VA 4K0KF 5KFAA 3JQMA 2M52A 4I6YA 1N25A 1OSDA 3RTVA 3UO0A 3EJMA 4C7QA 2K7KA 4EYHB 4IR1A 4PCQA 3JAMU 4P2FA 3PACA 2QEXS 2R3VA 4M5HA 1ZHFA 3MCNA 2LKPA 4XOTA 3L7UA 1PKUA 1ZM2A 2ZHOA 2BW3A 3MD1A 4P72A 1DZ5A 5DQIA 2CFOA 5H2FC 1DPUA 4ELVA 1NJXA 1ZPVA 4NLXA 3M9MB 4LSLA 3BSCA 1YIJI 3DLJA 3HX9A 5HVHA 3W66A 2DDAA 4YUDA 1S10A 3H40A 1JHFA 2VBYA 3VPRA 4GFBA 2EV5A 4V19X 1YQAA 4E7HA 4ZLNA 4ZDNA 3IS9A 2C3PA 4OV6A 4O4RA 2A1BA 3JS9A 1W7PD 3DWLE 2JQ7A 2VKDA 1WACA 1KTVA 2GCFA 2H1KA 2A6MA 3KLGB 2WSEC 1OMSA 1WJBA 4GCVA 4DIQA 2PJRB 4ED5A 1QHGA 3GYXB 2YUSA 3PRVA 4ZVPB 1RJJA 2ZWOA 1FK9B 4P71A 2VUMJ 4U7UD 1VC5A 1S3JA 1GK8A 1FJGJ 4YFKF 1LEAA 2Z2ZA 4B3RJ 1FNNA 1D9DA 4Y6IA 2Z30B 4DV7J 4G1PA 5K7HA 4HACB 5KFPA 3CP2A 1TT5B 2QFJA 1I6HJ 2CU7A 1C0TA 3ZQGA 5I3PA 3GJSB 4OYPA 4HKQA 2CRLA 2YVSA 1WH7A 1RB0A 1L3UA 3K8WA 2ELHA 3HTUA 2GM4A 3CCSI 1T33A 1IBKF 2FXAA 3PHTA 2XI3A 3G6ES 3S7RA 2AMCB 2M88A 3MPYA 3NAUA 4F4YA 1S6UA 4ZCIA 4X1EA 2YQ3A 1CJTB 5B0CA 3D3CJ 3W9HA 2F9JA 2XI2A 4B43A 1NBEB 2BVZA 2FMYA 1OS5A 4NMLA 5JJBA 1WHXA 4JX5A 1SKRA 5IV4A 1HCRA 1TWAJ 4KQZA 4HSTA 4YG2F 3OVBA 1H0HB 3OIPA 1UP1A 2L9SA 1BGXT 1VQ9I 3IH3A 3KYLA 4URQU 4TLRA 4XKVA 4DOZA 5E2QA 1T0FC 1QAJA 4MKBA 3H5NA 2MB0B 2OPPB 1HSJA 3AXMA 4QWAA 4ECZA 5CVJA 1IRZA 2AGQA 5FO5A 4O3NA 4K5SA 3DPTA 3HOXJ 1F60B 2WZ1A 4B3RF 2L9VA 3AG4H 1SMTA 2BJ9A 3C14A 4P7VA 2ZZMA 2BZTA 3E5QA 1GT0C 3BTIA 4OI0A 1EB0A 1FI4A 3CMEI 3GQCA 2PIIA 3SZGA 4QWDA 4LF8F 1HQUB 2MC4A 3J80Z 2ECCA 4X4PA 2G13A 1R5GA 3CCRI 2BUNA 2K3PA 3UDLA 3J81U 2RNJA 4K4VA 2QL7B 3JR9A 2IM1A 1KFDA 3MR2A 3OYNA 1UFKA 3FSXA 2PFFB 2FQQB 3C66A 3FBBA 4X4UA 4CCNA 4Y2CA 2FDNA 2XTJP 3ZP5A 4G65A 1H0MA 2DN0A 1XNRJ 2KFDA 4LF6F 5KOWA 3EYIA 4QJVA 4DR5J 3CCVI 5KG0A 2IM0A 4OHWA 2LDIA 3DXSX 3VYRB 3KZYA 4EJTA 1HDDC 1U1PA 2FU4A 1F5BA 2KZMA 1PAEX 1BOAA 1E3PA 4U88A 4X6AJ 1S9GB 5KFOA 3PR5B 1FBSA 2DR7A 1IUJA 2V7FA 3OSGA 4RKUC 5BNGA 4USJC 4DV7F 4FPRA 5HL7Q 4F7ZA 2MGQA 3AAWB 3RB6A 2QQBA 2C2RA 3ZZZA 4X62J 3H90A 1TKXB 3MUTP 1UMJA 1BM9A 5D4SA 2GIRA 1ZARA 4ZKAA 5HS8A 2BMBA 3NMAA 1ZTRA 4A0ZA 5F41A 5KG2A 4HRIA 3QPTA 3MMJA 4Y34A 3H42A 1FBQA 1I39A 4YIIA 3IWLA 4ED8A 3OIOA 3PM1A 5E3LA 2GGPB 2ZITA 5FLMJ 4JV1A 1UAWA 3DHWC 3IKVA 4RW6A 3TUJC 2BANA 3TAMB 1OQ3A 3A0BC 1FVQA 2WONB 2D3OR 4CTAB 2KVQE 1VR6A 2QF7A 2HQIA 2ZBRA 1MBJA 1CSJA 4X0GA 5EGYA 2UUAJ 2OZUA 1NK8A 3DPUA 3R61A 2QL5B 3O6QA 2KTQA 3J7A1 2BJ8A 2Z57B 2RF2A 2ZXIA 1B64A 1S9HA 2L4MA 1ROFA 2W2PP 2LLKA 4XPCA 1AKHB 1U78A 4F91B 2Y1IA 2P6TA 3F3XA 1RBLA 1LDKB 1CJKA 2BBEA 3KLHB 4YB6A 2VUGA 2XG8A 1PG5B 4BBSJ 1RPWA 2K1RB 3EICA 3IFEA 4X66J 1DU6A 1FT9A 4GVBB 4U7CA 2DH8A 1T9YA 3AG1H 2FLLA 1RHQB 3MDFA 2CPHA 5F08A 2FC8A 2BE9B 3KZZA 3UNGC 1BUXA 2WVFA 3OTDA 5L1IA 3MGJA 1MJ9A 4OYMA 2X1AA 5KAFC 3RBEA 1RUOA 3IWFA 3CMAS 3ZMDA 2H51B 4DLEA 3ZQHA 3CCSS 4AUXA 1AT1B 1N6QB 2GXBA 1QUPA 1OCZH 4PXDA 2XVCA 2KI2A 2KJWA 5AJ3F 4AIHA 2XB0X 2V4QA 4RLEA 4P73A 1Q1KA 4DUTA 1BHNA 1WF2A 2HHWA 3MI7X 3JTHA 5DO2A 3O44A 2EB7A 4RAFA 3AG3H 1KZHA 4DYRA 4USUA 3LA2A 1N36F 4ITVA 3W8GA 3MKZA 8AT1B 2J9EA 1UAAA 3R5DA 4GXOA 1NG7A 1YBTA 1GUUA 3IXQA 2QGUA 4V19J 5HN0A 4L9NA 3HT0A 4K2JA 5AT1B 3DU6A 5DDPC 1B1BA 3TZWA 2E2IJ 4WKRA 3H92A 3PIPQ 1CC8A 4ZYDA 2VQFF 4H4MA 4R8HA 2EH3A 3F9KA 1ICEB 1X4PA 1S29A 1F6TA 2KM8B 3OTCA 1TUGB 1TV6A 3NGKA 5DG8A 2AS5F 1Y3JA 3AOCA 2MD5A 3OYLA 2BKNA 2AXLA 1B4AA 1G3WA 2ZC4A 2CUYA 5HQ8A 1XCBA 1S4EA 1UFLA 1YRNB 1X8DA 3H0GJ 4CWBA 3BJ6A 4DV0F 2OF7A 1SJ1A 1IKWA 1XCVA 1FTTA 3L2QA 1M1HA 1TU0B 1H2UX 3BR6A 1Q1HA 1FA0A 3R2DJ 1U7LA 3I56S 1XJWB 4KBIA 4KITB 4R5PB 1NHUA 1RAAB 1SC3B 1VIOA 4PQUB 1KLMB 1OJLA 2MHNA 5E3RA 4RW6B 5EZGA 1O0PA 1Y56A 4D7MA 3DOKA 2XMWA 3M8FA 3CO9A 4LF8J 4KFCA 1IM6A 2LYCA 2LDUA 1YLFA 4XMYA 2HI3A 2LY1A 4O5VA 4F3QA 2CZ4A 4BLGA 3K59A 4MIMA 2CDRB 2O8KA 1VBXA 4AXJA 2HVHA 4LK0F 5A6PA 5AXNA 3HOSA 2PMUA 1PP8F 4LFAF 1S7EA 4NXNJ 1FDAA 4U7UK 1HR0J 3GMGA 4BE2A 3DLKA 3GE9A 2EFQA 2R8KA 4DUYJ 3VAFA 2IA1A 4KDPA 3M8JA 3AH6A 4DV3F 2NXUA 3AXKA 1GMVA 4BE1A 1Z7LA 4IG0B 4QWCA 4Q5VA 1V3ZA 3P7NA 3FSIA 2C2KB 3HDSA 1MN7A 5DDOC 1VK8A 4J9PA 4G1QA 1HW5A 4QIWD 2XY6A 3D66A 2ZH8A 1W5CC 1I94F 4WPAA 2GA2A 1MSEC 2MGZA 4DGWB 2K9QA 4ETSA 5KT6A 1KVJA 3BBBA 4DPYA 2M5WA 5I3QA 4HG2A 3CXCR 2BY2A 2H6BA 4MIAA 4M9ZA 1K6YA 4ID8A 3QPIA 3LGHA 1JWWA 4OAZA 3F56A 4K4TA 2VG7B 1U6GA 2OD5A 2IYGA 2CJAA 5L9NA 2FVQA 3CPWR 2L7KA 1D1BA 2YBVA 2B9XA 4A4JA 2F40A 2AXTC 4EI2A 4PPDA 4B44A 3MTKA 2DI3A 3CJQA 5F8LA 2ZVSA 2LFVA 4LF1A 4UOCA 3HD2A 3HJEA 3DV8A 1HXDA 3HYIA 2HBZB 4DYCA 3R5GA 1XGMA 4ZDOA 3RPQA 4XBFA 4UUVA 3LP2B 3DTEA 5FKOA 2RSQA 1C0UB 9RUBA 3V4IA 4RW4B 1MMGA 1S6OA 1NMEB 3Q8SB 4Q43A 2VJ4A 4DZPA 1BJZA 2J0QD 3EDQB 2FHOB 3GFYA 4A69C 1JGGA 1TKXA 3D0SA 3J81j 3A3OB 3BTLA 1OJ4A 2LSOA 5HP1A 1OKRA 4A6EA 2UV1A 1W7WA 1IBLF 1UJ8A 4WFZA 4ANDA 2IS2A 2AJ1A 2JEFA 3TUZC 1B70B 3TEGA 3I71A 4N9HA 1JB0C 2N82B 4DUZJ 2X1FA 4IKAA 5B0GA 1NO8A 4IH7A 2HU9A 1HA1A 3JYTB 2B9YA 3S6EA 1IZ1A 5H6QA 1EARA 4YELA 2QBYA 1NSKL 2Y8YA 1HYSA 3DLAA 2FY8A 2ZJQQ 2YWGA 3M2RB 2Q79A 4FQGA 3M2VB 1GFWB 3RKQA 3GG1A 2RB7A 1DGRM 2V6EA 4YN3B 2K4BA 1EQ0A 5ERIA 3DDNA 4TU8A 2J7UA 3SDGA 1NK0A 3KG1A 1KQ9A 2J9DA 3KUEA 5GAEU 2DNQA 2HWTA 3DKYA 1XSDA 2KHCA 5D0GA 3ML6A 3M8SA 1PVEA 2BYVE 3HSDA 2VE8A 2DK2A 3SCLE 3PIPF 2V4JB 2A69F 2B4PA 3V2UC 2C2ZB 5DG7A 1Q8BA 2K1RA 3MM6A 2KHMA 2XHCA 5AE2A 4L18B 4DR1J 2YKOA 2GX8A 3QAUA 4N41A 2B6AB 4F3OA 2V34A 1E0EA 3BROA 4Y3OA 2K7JA 5F04A 2ELKA 1PYTA 2QX0A 2LR8A 1BW6A 4ECWA 5A8WB 3HOVJ 3IP4B 3BR1A 5JLWA 1EZZB 1PDNC 4DDFA 5BQTA 2DR5A 3TKYA 3DOLB 2IVMA 2J6TA 3KX2A 3T6BA 1W5TA 3MCMA 5E3AA 1NB2A 2GW8A 2KFYA 2HQRA 4EBDA 3G6VA 5ETMA 4B02A 2JA8J 4XNFA 4X4VA 1N34J 1HWLA 2D41A 1HQEB 1YWXA 1Z91A 4L5IA 1YJUA 1B7YB 1D0XA 4FHTA 1J5OB 2VKRA 3CO0P 3UR0A 2B7BB 3NG8A 2QLZA 3WC2A 2VC0A 2KRCA 1AFIA 1WG4A 3M6WA 3CVKA 2BOPA 2W7OA 4E7IA 2YNGA 2DGVA 3KHRA 4PG8A 1S6LA 3KP5A 4QW8A 1B99A 2ZDPA 2WWYA 1NK5A 4A8OA 2RH3A 2FZKB 2W01A 1OISA 5A8KB 3KJVB 1NNDA 2EFPA 3G82B 4DL6A 2DGTA 3DM2B 3I96A 4I09A 5J2NA 2Y2ZA 2M2EA 1XK8A 3K2YA 1JHHA 5F1RA 1RT3B 2BW2A 3FZ2A 2MKCA 1DRZA 4USTA 1Y1VJ 3IRXB 3PFEA 2OBPA 2VFTA 4UUTA 3QJJA 3HVTA 5E3QA 1WOOA 1TL3A 1S7OA 3WTUC 2EG2A 1TAUA 1KBRA 2IC3A 3HTSB 2E1AA 3A12A 3CCLI 1LW2B 1NDPA 3RKWA 4ESBA 4FX0A 3OYJA 1FWPA 2V79A 1U24A 2MQOA 3FC9A 4K4YA 4TVAB 4P52A 2PMHA 2RDJA 4XTTA 2CQGA 2JA7J 5EHHA 1MLAA 1FF2A 4X4RA 1UVLA 3VVTA 2PX9A 1MWQA 5GVQA 2UUBF 2YKNA 1KQFB 2DR9A 3DC2A 4RM2A 3LSRA 1WJCA 3IRQA 4NLPA 3PNVA 4BY7J 5GPAA 4Q47A 1AA7A 5HJYA 1TVRA 3I5CA 3ELHA 5KFXA 5ICCA 2XWXA 3SCKE 1RA7A 3AQOA 3NOGA 3GJRB 4ZLPA 5L8RC 4G1QB 5DDRC 3OYCA 4ZIWA 3LSIA 5FLXZ 2XGXA 5DUKA 4UQGA 1LWCB 3QO9A 1AA1B 2V2ZA 2EK5A 4JYAF 2DPJA 3ZQQA 3BBFA 2HQDA 2XROA 3HPGA 1U2WA 1FX4A 2GA7A 2NR0A 2UZKA 2DMQA 1I1SA 1NPRA 5MAOA 4U8YA 3JRAA 2NS8A 5E17F 2C42A 1TL5A 3MFHA 4IO9Q 2CJBA 3C16A 3CCWA 1M5SA 1UCRA 2L7MP 3VR1A 3RI4A 3MM7A 3BGLA 4RU2A 1FIPA 2I8EA 4FBUA 4D7NA 5KG1A 5IP7J 3ENWA 1N56A 2M3DA 1EKSA 1JLEB 3LTOA 2IRFG 1ZYRF 2DQLA 1JKPC 3DNCA 2EI5A 3LSKA 2EW9A 1WC3A 2XSDC 1EP4A 4MMOA 1LVKA 4IOAF 1NXIA 4ZN1A 4NQWA 4AIKA 3I6PA 4J91A 1D9FA 1FP2A 4OJHA 5KNLA 4Y0FA 3MVPA 4RBUA 1OCOH 3JRDA 5CH7B 2VFVA 5EWEA 1KD1T 5BJRA 2QBYB 3CCYA 3S17J 2ZEJA 2ZM6J 2CNNB 1KU7A 4LF6J 1EP4B 3K7RA 3AG2H 2WY8Q 4P96A 3VYTB 4EV0A 3K57A 3G82A 1URNA 3N5BA 3POTB 3RCOA 3BGRA 2UUTA 1WEZA 2GLOA 1NU4A 2E44A 1S59A 1FRIA 4CH1A 2DA7A 1IAWA 2JWNA 2QEXI 4J5OA 4PK4A 3U1NA 2DNOA 4XRMA 3A8JA 2ZMEA 4ZLLA 1S0OA 3PYEA 2BQRA 2M4MA 1L5UA 1OIAA 2O66A 3HG9A 2CJ9A 3DTIA 4KGXB 3H5SA 4RMNA 5F8GA 2B3TB 3KP4A 1IRGA 4OL8A 1R8PA 2E71A 2EG1A 1UVIA 2W7PA 5GAHI 2Y31A 4YIFA 3I64A 4O3PA 1YJWI 1SC4B 2UXBF 3P9CA 1GDTA 3GYNA 1JXLA 3CJ2A 2W2OP 2JNJA 3TA2A 4DBRA 4OLPA 5BOXA 5FRNA 2HRTA 3ECHA 2IBKA 1UW4A 1WTFA 2D69A 1H9TA 3C2PA 5GAEI 1UHWA 1BC8C 2K8GA 1N52B 1FD2A 4C3KA 1OYYA 4DSIA 3KDNA 3HI9A 2VZ9A 2GZOA 2VL8A 1HKSA 3CJ5A 2KHDA 3SQGA 4ZMMA 4JOUA 1IGNA 1WF0A 3BDDA 4TKTA 3G1LA 2FY1A 3K4BA 1WUUA 2H94A 1V9OA 2XPUA 2HYIB 2BE7D 3RR8A 4RS8A 1RETA 2H27A 1XR6A 4B3OA 1EH6A 2FNPA 1UB9A 2AX1A 1R1UA 2L01A 3U1LA 3D0GE 4LQ9A 2W8KA 3VCDA 4F2RA 2YU9J 2XAUA 5CHCB 2TCTA 3MZYA 4C8ZA 1NG6A 2FZGB 1WI3A 5FD5A 4LQ3A 3NS6A 5IM0A 4RGSA 2M0GB 3VHQA 2FJ1A 4ALZA 2YWKA 4BXUA 1FYMA 2RRBA 3QAHA 1JLGB 2NOGA 4DLGA 3R6LB 2A0FB 3W2WB 2YX4A 2BOAA 3C7JA 1BA5A 5J2PA 2OHDA 3NS5A 3MOJB 4NC7A 1JLEA 3IV5A 3ABLH 3QIDA 1R3NA 3CJNA 3RPUA 3AB2B 2V2QA 3B4MA 3V6JA 4EM0B 1L3SA 5AXMA 2EPIA 4Q4ZF 3EPGA 3JCUC 5KFBA 5D4NA 1ACMB 3PX6A 3QWPA 3DM2A 3F8NA 3G96A 2QIFA 1RKTA 2LMIA 3P4UB 3OD2A 5DM6Q 4CLPA 3CD7A 1IXRC 3I53A 2OCCH 3ZO7A 1CF7B 3W6VA 3NQOA 4G1IA 3K70D 2SXLA 5ITHA 3D6HB 3MWMA 4HI1A 4RUHA 3SDEB 1Z77A 4DW6A 1SQFA 2F5CA 3OUYA 2KISA 2NXJA 1T03A 2Z16A 3B6BA 3L2UA 1D9AA 2JVGA 2R5YB 2L02A 4PXBA 1R8HA 5JHFA 2I0XA 2KIQA 2HIQA 3G2BA 4BAYA 3BDEA 2H65B 1JIHA 2E5ZA 4HVZA 2FHMA 4ECVA 1TMMA 1K8AT 1RYSA 3PIOF 3FBCA 3I31A 2WCXA 1G1XA 2LP0A 4BS9A 1YK9A 4HACA 4OX9F 3SZTA 1RTHB 5T14A 3T8RA 5FDLB 1GNKA 1P1LA 1H8AC 6FD1A 3D28A 3LPEA 5J8FA 3M2UB 2A2CA 3DBRB 5E3CA 4YB5A 1K1SA 3G6YA 3FKBA 1KQSR 1F9NA 3O1LA 2NYXA 1TWFJ 2IJRA 2BGCA 2DB1A 1PP7U 2QFIA 1X5PA 4ZITA 2NVUB 5HROB 4B3TJ 4BHPA 4JI5J 3BSOA 4AWXB 3TX0A 4LMYA 5C7PA 5C44J 1S1XB 2D9PA 1QAXA 1VS3A 1NH3A 5FIIA 4DMZA 1JLAA 5D3GB 5BS6A 2WW4A 3K5OA 3CCES 4AD6A 2HGMA 3U1DA 4LJZF 4BQAA 2L54A 4LREA 1YX5A 4XN0A 2ZUGA 3MFIA 4IVNA 4Y2KA 3AJDA 1IVZA 3KYDB 4EQQA 1R6RA 3CW2C 1QQIA 1XS9A 2IBOA 2W84A 3LALA 5MLCV 4TN2A 4LOCA 3L95X 3CDEA 1RT7B 3H3UA 4ECUA 5L38A 3T41A 1IUFA 2AQEA 2KIMA 2RRNA 3VWBA 3K5NA 2BJEA 2WRMA 2E7WA 4UNOA 4C2MJ 2P6SA 1S9EB 2CNLB 3V7SA 4J7CA 1IN5A 1HHTP 5J2PB 3RBDA 2EZKA 1GHCA 1IXSB 1VQ8I 2VF3A 2ZFWA 3QATA 3R1HA 3SBMA 3FXQA 4A3MJ 4AVZA 3TDZC 1HW1A 4ICLA 5KG6A 5RUBA 4B9LA 1WJDA 5CQEA 3H1CA 4TYAA 4J9QA 3IP0A 3K1NA 2YWFA 2MH9A 2ATCB 4DV0J 2CQNA 4TU9A 4QPOA 4NI2B 3BQYA 1J2VA 2I9SA 4WK1A 4LBPA 4X4QA 5JXSA 2ZKTA 2QO3A 3HRTA 1ETWA 4E7KA 1SIWB 1CF7A 3KUGA 2OA4A 2MC3A 4G7ZF 2D1CA 2IDEA 3W5YA 1C4AA 4DV6J 1GV5A 2PI4A 4DG1B 1C1BA 4CHUA 2QJ3A 2XCAA 1HBUB 1RABB 1LFBA 1R7JA 4OINF 4OWRB 2XPVA 1FXLA 4ZDLA 4LFBF 5E41A 4IEJA 1WG5A 2ZD1A 5KT5A 1VBZA 3KK1A 2X6WA 2FBKA 2V68A 3FNNA 2EC2A 1I3QJ 5F1JA 1G7CB 1WC5A 1ZTWA 1WC1A 2FRHA 1IKYA 1JLQB 2JSCA 2XGEA 2YKPA 1G3SA 3I5AA 1SJRA 5LSLA 1FXRA 3ETOA 4QIEA 1RAOA 2OTJS 2AIRB 3RQ4A 2L3MA 3I5UA 2ZUAA 1PC5A 1GQEA 2HHHJ 2V9VA 3OSNA 1NKEA 4KR0B 2DH9A 4OYXA 2O6GE 1Z2ZA 3NCQA 1VK3A 2HSEB 1I1GA 4I6AA 1EA3A 1WHVA 4ED0A 2XULA 2QRRA 1T9VA 2H54B 3RAQA 5IM0B 2H6CA 1DQAA 1S5ZA 4OV1A 4HQEA 4DV4J 1ZBTA 3IR6B 1QD1A 1RZMA 3QIPA 2H5JB 5LMUJ 4OZLA 4PR6A 3IH2A 3VQSA 2CQDA 3JTGA 2CO5A 3CDUA 2PFDA 2ZFHA 4OQJA 4QW9A 4P9UA 3BSNA 1O51A 1KLMA 1W0UA 1JLCA 3JYTA 4HH1A 1ZQ3P 2WV1A 1ETXA 3RTRA 1WTBA 1U1KA 4DR7F 4O0IA 3EZ5A 3A13A 3GR1A 4IRHA 4F04B 2XSJB 1LW0A 4L0YB 1NSAA 2BA9A 2GAHC 4CCHA 3J81Y 3QQAA 1SAUA 2AJFE 5JFRA 1NKBA 2OD6A 1YRNA 4LRAA 1NH7A 2X1GA 2WVCA 5A6WA 3ZGKA 3T0YA 1RWNB 2B5JA 1JX4A 5KG7A 5HS9A 1P9QC 4W98A 2HOAA 4DNCA 3SCIE 3MOZA 3A01B 3UWTA 3NNCA 3FCHA 3PKMA 1T0FA 1U1OA 1Y4ZB 4NXNF 3J80K 1WWHA 3LOUA 1SVLA 3H2LA 5C42A 5F6FA 2G0CA 4F36A 1ZAWA 3MEEA 1HBNB 1B0PA 2H3EB 5KFWA 3E1SA 2DGOA 2BKOA 1S6PB 2DHXA 1U02A 3MEXA 3NGSA 5FROA 2IRUA 1NK9A 3DYAA 3PTWA 1D5VA 2MKIA 2HYGD 2V4RA 4CCMA 2YQ0A 2WOMB 5IYBJ 4BXFA 4QCLA 4DR7J 3CQZJ 2F7VA 2FGOA 1J5YA 3EVOA 4OYBA 4LF9J 4PWUA 1XD7A 3OS2A 2I6WA 1KVKA 1REGX 1ZK8A 4I02A 3KMSA 3GTLJ 4ELUA 3SFUA 4KA4A 4Y7NJ 4M63A 4J9LA 1V3RA 3UR3C 1JUSA 2V5HG 5LSRA 2ZXWH 4HF1A 5FJ8J 4OX9J 1QPMA 3EDPA 5GAGJ 5DZ6A 4HDGA 3BR9A 2ZWPA 1S1VA 2A61A 3HKZN 4DX6A 2I5JB 3NOCA 3WHIA 4AU7A 4URSA 3NKYA 1BJAA 1RU1A 4B3MF 3W9IA 3DQVC 4X4OA 2O7OA 4M3DA 3DLLF 4QIFA 2O03A 3D1QA 1LVAA 3PYFA 1N0UA 2VA2A 4U6PA 1D8YA 1VIXA 2XPWA 4EJVA 1EJ9A 4I0WA 2DMUA 4YFXF 2RKIA 3SQOP 5M5YJ 1S72I 4OIQF 3OQ2A 2QKLB 4HEA2 3A4TA 3QT8A 3H98A 3PO5A 3K4KA 1FSHA 2F4VF 4OZ5A 4CDGA 2W4SA 3I3LA 1HQUA 4C97A 4DV2F 3TL4X 2J8AA 2ZBKA 1FNOA 2PDAA 4ZCKA 1SUQA 2DDBA 3ISPA 4MTDA 3CUQC 1R36A 4LIVA 3RB3A 2MEWA 4M6VA 2VG6A 2W4PA 1P2FA 3TVKA 3OFFA 4OFZA 1BE4A 1FT8A 5ETSA 2BANB 2DIVA 3TAMA 1MROB 2DT7B 2OQGA 2GMHA 3E6CC 3JW4A 4X65J 4ILMA 4B1RA 4ZH4F 2Q0OA 5HATA 4W90B 2QVOA 1FO1A 3MEEB 3BO4A 1TL3B 4B17A 4EEYA 1DLOB 2M0CA 2JX2A 1ZG5A 3AB4B 1VQKI 1UPPA 1IN4A 2BY3A 3O3KA 3HCXA 3NEUA 1CLFA 4A5MA 4ENMA 2OPSB 1U0HA 1FDNA 4LRCA 4XLPF 5FLXK 2W57A 1S7HA 3KLIB 5CAAA 1U1RA 1TP4A 5GPCA 3WTZA 1RT4B 1GXTA 3EDRB 3K4MA 1LWFB 3M6UA 2TDXA 5IT9Y 4ZTJA 4XRFA 3H2UB 1H7WA 1R43A 4G6TB 3HZEA 4HNTA 4N47A 1U2FA 3W5XA 5HANA 1VYAA 2AHOB 4LSNA 4HDVA 3PG9A 4W97A 4L9VA 3TAQA 4HLYA 2JEJA 3GPAA 1FJGF 2H09A 2VQFJ 2EFGA 2HGNA 3H3VK 4OI4A 3BJOA 2HLUA 1I6XA 3UFCX 3T1HF 4IXAA 5DDQC 3T5XA 3VSKA 1SL0A 1NDKA 3QPLA 1ZZNA 3SV4A 5D5UB 2KZZA 2XKOA 2HZDA 3B73A 5K7FA 4I69A 2DR6A 5B0BA 4X4SA 3EYZA 2GOMA 2HTJA 2IHR1 4C9YA 4F26A 3JRGA 4LBHA 4J9VA 2K40A 3K1PA 4JX6A 2HZCA 1IN0A 3FEZA 1MNMC 3MPWA 1MMLA 1JI8A 3HSJA 3UQSA 2M4KA 2CG8A 2Q43A 2DXFA 5BR8J 4MKVA 2WB4A 4OI3A 3S3MA 1B8IB 3LGNA 4B9NA 1R27B 5D8HB 5F8MA 5GAHJ 4V1Ak 3BC8A 1FMVA 1HKAA 5LBQA 3QRPA 4RW7B 4Y28C 5ETOA 4NXMF 3A2KA 3CJKA 1KHWA 5F0UA 3OL4A 5FFXA 1OPIA 1D1CA 1UVNA 4LRDA 4FBTA 4HYKA 3QP5A 2AJQA 2FE3A 2LKSA 2KM8C 1FC3A 1LFUP 3PQJA 4CYCA 4BDPA 2MXYA 5G0RB 5EN1A 1U0HB 4HT7A 2ABYA 3TP0A 4BC7A 2CFXA 1WSRA 1I50J 3RQIA 2CYYA 1E17A 1MWZA 3DLGB 3L2WA 2CH0A 1VQ6S 1WI6A 5EYRA 1TKZA 1XN9A 2MSYA 4L6V3 3BZQA 3D7SB 1IXKA 1T7PA 1PAUB 3F8BA 3IC1A 2PJPA 5D8KB 3I4PA 2V26A 4L3NA 1MBHA 1D8JA 5BR8F 1GX6A 3ZTQA 3F21A 1N5VA 1X9WA 4KT6A 3D54A 3PJXA 3ZRGA 3HF5A 3H5UA 2ZE2B 1TL8A 2R7FA 5M5XJ 1A6QA 4B47A 3FCVA 1M5VC 2XYHB 5LGTA 1LEBA 4CLUA 5BXIA 1YS6A 3B78A 1FKPB 3DDIA 1EHWA 4LF7F 1LXNA 4BHQA 2P0WA 2ZVIA 3HSFA 3C15A 4USIA 2QYGA 4J00A 3MR3A 4MKYA 1HBXG 1S9FA 1TZLA 4H0EA 2CJJA 3WE2A 2JDJA 2GA1A 2FJWA 1IKWB 3U02A 4ESFA 4F8RA 3HUGB 3QNWB 1U2RA 1H74A 2IP2A 3Q8PB 1SC7A 3C2BA 3LSJA 1F5TA 2GQCA 1AW0A 2NSBA 2N7CA 4WJBA 1IKXB 3LSPA 1WEXA 2PG4A 2L08A 3IG1A 2W7AA 5IT9Z 2R8GA 1UVMA 1RP5A 1RWUA 3FK4A 5E8GA 2B4OA 2J9DE 2DCUB 3DFGA 3QYYA 2RAQA 4HV5A 3JQJA 4X4NA 2IEKA 1R89A 1SJ4P 2EEYA 3GLJA 1F1ZA 4I2QA 1B0TA 1SCJB 2UVVA 1WORA 2EWHA 2I38A 2OEJA 4PSXA 1N32F 1ORKA 5TGTA 3GZ6A 3T5HA 2FIUA 4E0DA 3CCMS 2VKVA 3GIJA 1G59A 1P4WA 3CDHA 2NVXJ 1VLYA 5E7OB 1YFHA 1RXOB 2LECA 4EYIB 2A6EF 2F9DA 1BIAA 1IR1A 3BKFA 5KFEA 3UDVA 5IOLA 3GTQJ 3IL2A 5KG4A 1SH0A 1CG2A 1TUWA 1D3YA 2ZMEB 1R5ID 3QRQA 4DHVA 3B8HA 3CCQS 2RNEA 2KKOA 1CJVB 1S97A 1JXSA 2GOXB 3NBPA 1XMQF 5HNFA 3TR5A 3LSMA 4ENKA 4KV8A 2DCLA 1HFEL 2QSFA 2CW7A 2RNGA 4NYZA 2NXNA 3M2RA 1UHMA 3OW2R 2UXCF 1IC8A 1LWCA 5C24A 2XC9A 1WPKA 2DXDA 1HQCA 3PM9A 1BLUA 1LFWA 1CJVA 4X4TA 5L3BA 3CULA 3OYHA 1RT6B 4OJGA 2UVUA 2MH2A 3FM3A 4A6DA 4PG4A 2YNIA 4RNFA 3P9KA 4A3CJ 5L3EA 4CCOA 4DPUA 5ETKA 1BI3A 2N4CA 1FP1D 1Q8LA 2DT5A 4MFDA 4PYDA 3I0SA 4P2SA 5DS9A 1ZREA 2P9EA 3UD5A 4NL5A 2DK5A 1MMAA 1YJWS 2FYXA 4NLYA 4IRIA 5HVQC 3R3TA 3JAMZ 4ED4A 1LXJA 1K83J 3NWSA 2HRUA 3RRHA 2HQNA 4WWSA 3ZZRA 1UEKA 2NNYA 2G0JA 3T1HJ 3MXHP 4EBEA 1ETVA 3F44A 3KLOA 2CQ2A 3NAIA 1RTIA 4CDIA 1CPZA 1S1XA 2IVYA 5L1KA 2MJNA 4OX7A 4J9OA 2PMWA 1M5OC 3JSPA 4Q45A 4KKOA 1N77A 2F5FA 5HLIA 4B3XA 2Y1JA 3H20A 3CZ6A 1PYVA 5L3GA 1SD7A 2B9EA 3HZJA 2LXIA 1ZG3A 2CS3A 3PXGa 3QSIA 5H1SV 3OL3A 1KR4A 2KXHA 3OL9A 1R8AA 2QT7A 4RL1A 3AD9C 4QR2A 3HJVA 1RWKB 5HMXA 2MHEA 1OCPA 2DGQA 3DU5A 3F0NA 2A10A 3AFGA 2RN7A 3T9ZA 3FJ2A 3OR2A 3NGUA 2GAUA 3HFZB 2XF5A 2DD8S 5EEAA 3IGVA 4F25A 2CQ3A 4C3JJ 3OSFA 4P6QA 4E2FB 3NNHA 5DEQA 5B1AH 1VQ7S 3KLEA 2B9SA 5LRSA 1Z1ZA 4M1KA 1NZAA 1YZ7A 2ZKUA 1RT5A 4KUMA 1BQXA 5J1PA 1K1QA 3B82A 1QVTA 2DH7A 3CE8A 4M5NA 4KH1B 3KPHA 2P7CB 3TW6A 4K4ZA 2L9NA 2DTZA 1QTNB 2DPUA 3AHPA 3R60A 2P9GA 4LIWA 1S0MA 2HAFA 1RAHB 4I01A 3AL0B 3OYDA 3OJSA 1EV7A 4DL4A 3I4MJ 3WX8A 2QWWA 4NWBA 5E1ZB 1VCTA 1YS7A 4C3MA 2XZTB 4JI0F 3BQZA 3BO2A 3HVTB 2OKQA 1BI2A 2DA4A 5K14B 3QGPA 4HPQA 5FGMA 1YJNI 3QWLA 3MCOA 4M5KA 2X1EA 1HIYA 3OR2C 4IRCA 2HYFA 2R3SA 2EILH 4B9MA 2D1HA 3FMQA 2WW8A 4OZJA 2D3O1 1KQ0A 4R25A 3R0JA 4JBAA 2DMTA 5KT7A 4C0HA 3GYHX 5E1WA 5HROA 3ZNUA 1V54H 2VOPA 3M8YA 4CSWA 3IBWA 4A47A 2BJ1A 4HLBA 3AKZA 2R8HA 5AIPA 4KT0C 5FJ4A 1SH3A 3GW2A 1SC1B 4AE5A 2FVPA 3BQ1A 2CV1A 3K8VA 4C8OA 1YW9A 5KFLA 1FBUA 3RKXA 4Y3CA 2KDOA 1RADB 1JXEA 4I98B 4N8NA 1QNTA 4WP3A 4A3EJ 5K8PA 2OV7A 2KG1A 3UW1A 1RKIA 4M71A 2MQQA 3KWMA 2DO7A 4GKKF 2VQEJ 3SYTA 5DD4A 2CWEA 5LT5A 2FQ3A 1J9IA 3RZDJ 2XV4S 3GF2A 1TAQA 4I2QB 4XKWA 3P5TL 4JI2J 2CAJA 2DCEA 3QSYB 2GIQA 1RAEB 1X4GA 5E8IA 2HBRB 1FDBA 3DGPB 4XPEA 2V8PA 2IAJA 4V2FA 2QMUB 5L46A 1UFMA 4JX4A 3ZZPA 3HOZJ 1NUEA 2OPPA 2NZCA 2W8LA 3BPSP 2RE1A 2HK2A 2ISZA 2RUSA 4Q7AA 3A3NB 2CQ7A 1YI2I 4DR2F 2EBEA 2HPUA 3K10A 4MIBA 2AO9A 3H9QA 3M8WA 1ITPA 1LDJA 2IW5A 2PEHA 2VC1A 2ZCWA 2QLFB 3FKJA 2AU0A 4F52A 3R6SA 1U1NA 1TC3C 4Y13A 2CWXA 1NKCA 4J01A 4P75A 3GTOJ 1LWFA 2HTSA 3TVYA 1RK8A 2Z58B 2EV6A 3TEHB 1N8RT 2KYZA 4DBQA 4DV5J 3G1MA 3W6KB 3NXZA 1L3VA 4CLTA 5B66C 2POKA 1SVOA 2D1VA 2YPRA 2BRKA 3BGUA 2XC7A 2R9LA 2P2CB 4J9UE 5IY5H 1N5YB 3QOPA 1NTCA 4Z7YA 3HOUJ 3QYEA 2CPFA 4QWBA 4WE1B 4CGZA 2JHEA 2HEKA 3FXRA 3L09A 4FS2A 2KFNA 1KP6A 1TNTA 1M5KC 4PXEA 2HDWA 3KZIC 4WYWA 1W2BR 2LBFA 4KFBA 2H5EA 2A5WA 4K0KJ 4ENJA 5KFQA 2K9LA 2HFOA 3J7AY 5CJ9A 2W00A 3CCJI 5I4MA 3ZFVA 3EMTA 3D0HE 3TNVA 3ETMA 3Q2SC 2HFNA 5J2QB 3M8RA 4OI1A 3MQ0A 2ESNA 3CNQP 5KAIC 2RT3A 4A2UA 4D0PA 5EJCA 3HDDA 1VJQA 2J0SD 3TW0A 5CCMA 1F5CA 1RQ0A 3SCJE 2HG4A 3M4XA 2YNHB 2Z0GA 2M8EA 4HX7A 4PZJA 2V6CA 2X7IA 5KFTA 5HDGA 2VBZA 5M5WJ 1WKKA 2QUFA 1POGA 3M1VA 3LP0B 1Q82T 2P8TA 4ZTFA 5HBMB 5HSPA 1XGSA 1VQMI 3KP6A 3KXDA 1UMQA 5F64A 2XMKA 3UD4P 3R8YA 3H0DA 3KNGA 2VH7A 5DM7Q 3PJRA 3GIMA 1WI9A 2ASLA 2FBIA 3HHLB 4XLAA 2XSFA 4DZDA 4ECTA 3CDBA 2HKOA 5DJBA 4WXHA 1VQOI 2ZH9A 2UV8G 2CW0F 2F4IA 2E1RA 2LRDA 4NEYA 2QC3A 4U9RA 2Y9HA 1FDDA 2N3LA 5GAGU 4FETA 4JI1J 3MM8B 2MW8A 1QBJA 1Z05A 1FNXH 4C3HJ 3PX0A 2CQKA 4MO7A 4PWWA 1LNWA 2K9MA 1TBXA 1A6IA 4BNCA 2L9RA 3TZXA 4ECQA 4F92B 4RNOA 1IQTA 3OV8A 4BWMA 3P5BP 4N0BA 3ROUA 1HMVA 1GVDA 4ECYA 4YRVA 2IC3B 2EFNA 1YOVB 3J7AO 3BOQA 2DNNA 2DT9A 1FFSB 2ZM6F 2B4VA 1MW7A 1SVMA 1U49A 1X4BA 4PWDA 3O6BB 4GO1A 2OTLS 2ASYA 2UWMA 5HQMA 2UUBJ 2ZD1B 2ZH2A 3ICLA 1FWLA 3RR7A 2C2OB 2LH9A 3V81B 1REVA 2VBWA 4ESJA 2OPRA 3EPZA 2HZTA 1EJ7L 1YDLA 3SYZA 5TISC 1Z21A 3EUAA 4ED1A 2Z1DA 4PFPA 4LMZA 3W6JB 4K7QA 2XWYA 2JOQA 2ZNZA 2FJBB 1N5YA 2G0IA 4TY8A 4A46A 2F4MB 3FDYA 5C25B 1OR7A 2HXOA 3RJPA 3RRKA 3BM7A 7FD1A 1ON1A 2C3YA 3QJLA 1QZYA 2V94A 2GFFA 3B6AA 3O8HA 4TXSA 2OMLA 1JLGA 2N8GA 5HNHA 2FJEB 3UN2A 4OYWA 2HGCA 1L0OC 3ADAC 4L9JA 3IG1B 2J0WA 3FX3A 3KHHA 2MDAA 1KOOA 5IQQA 1JLCB 3H5XA 4OYOA 3MEGB 2WSFC 2RQMA 2VKEA 2E2JJ 1LPQA 1H7XA 1XTZA 1VQ9S 5DG9A 3UCGA 5KFIA 2PLYA 1LW0B 2NOJB 2DPDA 4KHMA 3I4NJ 1FY7A 4LG3A 2QG9B 1R0AB 4NZ0A 3DRYA 2VV5A 2HOSA 3TJ8A 2ZJRQ 4ZJOA 2X51A 2RS2A 1Q5VA 2HR3A 3I56I 1FD8A 3LH2S 2RU3A 3HEFA 3JTOA 2F1FA 2CQQA 2UZAA 1B6AA 3FBEA 4DV3J 3LP0A 2HNZA 2OEMA 3CCEI 5HBMA 2W7NA 1SFUA 2M8GX 4U0WA 3IRWP 1YJVA 2NXEA 4HA8A 1AU7A 4WFXA 2QV6A 1Y5LB 5E3OA 2KL8A 3ABKH 3F41A 3ZC4A 4BDZA 1ULRA 2F4VJ 1GTHA 3G3ZA 2DA5A 1WJ9A 2W1OA 4Y2MA 5EEHA 2OSQA 1S79A 2OGUA 2YNFA 1GEHA 3I55S 3BGRB 2IIHA 2NUHA 3HPOA 5F8IA 3TMOA 3H3ZA 2FQ4A 2C2NA 4ED2A 2ZC3A 5HDKA 2BX6A