1H89C

Crystal structure of ternary protein-dna complex2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
QCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h89C01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1h89C02
4A3IJ 5HODA 1JKQC 5M3MJ 5IP6A 2X6OA 4A3GJ 2AHQA 3TP0A 2CQQA 1OJLA 2FD5A 2ME0A 5GPCA 2VUMJ 2E1OA 3LSGA 5M3FJ 2L7ZA 2EBIA 1EF4A 2JMWA 4J19A 1IJWC 2NVTJ 2KT0A 2DA4A 1TWHJ 3LSRA 2R5ZB 1RESA 1ETVA 2WV1A 1GUUA 3IH3A 3G1OA 3FKIJ 5FKKA 4XICA 4JX4A 5IP9J 2M0CA 2JK3A 4X1EA 1IUFA 3BTJA 3IH4A 3HOYJ 1IDZA 3OSGA 3NARA 2JWTA 2Y9ZA 1WI3A 3GTPJ 4DYCA 2LP0A 5C4XJ 2R93J 3QPSA 3H0GJ 3HB9A 2JJ7A 2MGQA 1XG1A 3UKGA 3ZQLA 4IHWA 4FE4A 2VI6A 4AC0A 4A3CJ 3CDLA 1WGXA 1QPIA 1JUSA 3ZOBA 1AKHB 4I6ZA 1TWAJ 2NS7A 3JRDA 3GTQJ 4M3GA 5JLXA 1PUFB 2XSDC 4IHYA 5F27A 3TW6A 1JUMA 5J3LA 2R5ZA 4M3BA 1W0UA 1ORKA 4JYKA 2R0QC 4A93J 5FJ8J 1QRYA 5F08A 2NVYJ 1UG2A 1P7IA 4XK4A 3O8HA 2M8GX 1TWFJ 2YUSA 4A3DJ 5BNGA 3CQZJ 2Y9YA 2YS9A 3TW7A 4AYBN 2H8RA 4UUTA 5EG0B 5E3NA 3BTCA 1Z77A 4LOCA 1U9OA 5FKOA 1GDTA 2ELKA 4AUXA 2M34A 2XGEA 2MW8A 4BKXA 2OPTA 1GT0C 5K7HA 3LNQA 4Y52J 2FJ1A 3ZQGA 4MIMA 5FKMA 3GTJJ 2HOTA 1MBFA 2DA5A 4DYRA 2K9NA 1X58A 1BA5A 3I4NJ 2R5YA 3HOZJ 4BBSJ 1PUFA 5C3EJ 2HQ5A 4A3KJ 4A3MJ 1ZR4A 4X6AJ 2XPUA 2LFBA 3B6CA 4CYCB 1BW6A 2FQ4A 3BR5A 2WB1N 2LLKA 5DTDA 1U8BA 2CRGA 2AO9A 3OIOA 3HOUJ 4EEFG 3JRGA 5EYRA 1MNMC 3BQYA 3QQAA 2IAIA 2M2EA 4A3JJ 3HGYA 2O9LA 5J1RA 2R7ZJ 5K7ZA 1NK2P 5EG0A 3S1RJ 1VI0A 5F0FA 2N8GA 5IOYA 2E2HJ 2K9SA 3GTKJ 3S2HJ 2DA6A 2EZHA 2QCOA 5F0HA 3HOXJ 1JT0A 3S1QJ 3OSFA 2FX0A 3RKQA 1IGNA 2LTPA 2DJNA 3IH2A 2K9QA 1ETKA 2EQRA 4UUSB 1AU7A 3JRFA 3O8GA 2ECCA 2CQXA 2HI3A 1MH4A 1WH7A 1GV2A 4B3AA 1W0TA 1RETA 3FK7A 4MO7A 4QSHA 1U78A 2E2IJ 4W1UA 1B72A 1HLVA 3S2DJ 3S16J 2ID3A 4M3FA 1DU0A 5EDNA 2NVXJ 5EZGA 1TC3C 1TWGJ 4M3DA 2E19A 3MVPA 2WAQN 3BQZA 3MKLA 1RR7A 3BR0A 1AHDP 2E2JJ 3PM1A 3S1NJ 1XC5A 4DZJA 3Q0VA 2EZLA 5FKLA 4C3HJ 2Y31A 3GTLJ 1A5JA 1MSEC 2HOAA 1BW5A 2VPRA 4UUSA 2G0EA 1BJZA 3NAUA 3BG3A 1OCPA 1MBHA 2HYJA 3K7AJ 2HOSA 1I50J 1FIAA 4FTHA 4G12A 1E3OC 4D7NA 1ZKGA 1YRNB 3K2AA 4ABZA 3LSPA 1SANA 1ZR2A 1MSFC 2EZKA 2DA1A 2DMQA 2MG4A 1WH5A 3BTIA 1I3QJ 5EZHA 4A3FJ 4XIDA 4FE7A 1JJ6C 1APLC 5FKNA 3WHBA 4QTRA 3I4MJ 1JT6A 3ZQIA 2DA2A 2EZIA 2HXOA 4DZPA 4C3IJ 2LK2A 4D7MA 2JA7J 2O8KA 5EF6A 4XRMA 3HM5A 4S0HB 1VFCA 1AKHA 3ZQHA 2JA8J 3HEFA 2ZB9A 5E3OA 1MH3A 1X2NA 4Y7NJ 1YRNA 1D5YA 1UMQA 3SDGA 1Z0XA 2HDDA 1POGA 5J1UA 5J1YA 3MN2A 2QF7A 1OFCX 3G1LA 2GLOA 5GP9A 3BT9A 1H88C 3Q0UA 2L0KA 1IG7A 2P81A 1B8IB 1JKOC 2LR8A 4RBOA 3BR6A 1IDYA 1FTTA 1RPWA 1VNDA 2LVSA 3B6AA 3L1PA 2XGDA 3CMYA 5F1JA 3CCYA 2ME6A 1SFOJ 3M4OJ 3BTLA 2XGCA 2Y30A 3BR3A 3F0CA 1OCTC 1ETYA 4JP0A 2CU7A 5M5XJ 5IYBJ 1LE8B 3S17J 5E3LA 1GV5A 3GTOJ 3JRCA 3A03A 2DN0A 1GVDA 4C2MJ 1QVUA 2JN6A 2OF7A 2PMZN 5IP7J 1RKTA 3Q0WA 3GBGA 1ITYA 3VPRA 2XPVA 3DEWA 2NOGA 3SJMA 1ZK8A 5DS9A 4RDUA 5K7FA 3A01B 3G1MA 5GPAA 5IOZA 4C3JJ 1FJLA 1JGGA 3BR1A 1Y1WJ 1NK3P 3M3YJ 3W6VA 3HKZN 4A3LJ 1MBJA 4MFEA 4CYCA 2LY9A 3BR2A 1XS9A 1K83J 2DMPA 1P7JA 3GTMJ 4MFDA 5JLWA 1ENHA 1HCRA 2Y0SN 1B8IA 5EGOB 1F43A 1K61A 1I6HJ 1A6IA 4GFBA 1O4XA 3LOCA 3JRHA 2JA5J 2DMUA 3JRBA 3JRAA 1LFUP 1QVTA 2EH3A 3ZQCA 4BY1J 2IBDA 3A02A 2CUEA 1LE8A 2M9HA 5C44J 3BG5A 3OOUA 1HF0A 4NDLA 2DTZA 1S7EA 1Y1VJ 1ETXA 3GTGJ 1TWCJ 2KDZA 3WHCA 4BBRJ 2GBYA 2DA7A 3RQIA 3Q3SA 1ETOA 3RZOJ 3A01A 2TCTA 2L9RA 3PO3J 2YU9J 5C4JJ 1G2HA 2CUFA 4FISA 1FIPA 4BXXJ 5IYDJ 3E7LA 3JR9A 1HDPA 4DW6A 3HDDA 4IHVA 1VF9A 3TP3A 1MBEA 1HDDC 2DMTA 3BG9A 3HGGA 2I10A 3C2BA 4BY7J 1CQTA 2L7MP 1JKRC 5EGOA 5IPAA 2VKVA 3JRIA 3ZQFA 1ETWA 2XB5A 1FEXA 1IV6A 2H1KA 3H3VK 3SFIA 2MSYA 2JA6J 1JKPC 1MBGA 4DYQA 1ETQA 2XPWA 1NTCA 5FLMJ 2R5YB 1IC8A 1HOMA 3DCFA 4IHXA 2XRLA 4MLOA 4XRSA 3JREA 9ANTA 2GM4A 2HXIA 1JJ8C 1Q1VA 3S1MJ 3RZDJ 4B4CA 2NVQJ 2TRTA 5EEAA 2LKXA 4HNVA 1JUPA 1H89C 5IYCJ 2DA3A 1RKWA 4M6VA 4A69C 3S14J 3IV5A 4XRSG 2LD5A 4IEJA 4A3BJ 1MBKA 5M5WJ 1T56A 4B1RA 2XB0X 2NS8A 5E3MA 4FCYA 1ZGWA 3LSJA 1LFBA 2X9DA 4QIWN 2ID6A 2IEKA 1R9TJ 3TEDA 2B63J 2O7OA 4V2FA 3HBLA 3S15J 2X48A 2CJJA 2K40A 2DMNA 1U9NA 4D5FA 3HOVJ 2L7FP 4L5EA 2COBA 3FIWA 1B72B 2W48A 3FISA 4I76A 1JTXA 1H8AC 4JX5A 4A3EJ 1WCMJ 1ZQ3P 3HOWJ 2VKEA 3QPLA 5F04A 3D1NI 3FK6A 4M3EA 2ECBA 1BL0A 1IRZA 1DU6A 5FLVA 4W97A 4JX6A 2Y2ZA 1WPKA 5F0CA 1JTYA 1ZTRA 5M5YJ 4V2GA 2RAEA 2D5VA 4D5CA 1F36A 1UHSA 1X2MA 2R92J 1FTZA 3PO2J 1T33A
chains in the Genus database with same CATH superfamily
4IQ4A 3BG6A 1D3YA 4LJZF 4JK1X 2ZJ2A 1Z1DA 4E7JA 1B59A 1FBSA 4LITA 3E5UA 3TP0A 5ED4A 2BY2A 2IPQX 1DPUA 5BOXA 1F9NA 2NVTJ 3COAC 1MD0A 4NB5A 1TWHJ 3LSRA 1I27A 2L9SA 1ETVA 4S05A 1OISA 4R8HA 5HS9A 5DCMB 4ZYEA 5TRDA 1EJ9A 4NQWB 3C7JA 1IUFA 2D1HA 3BTJA 5FRMA 2Y48A 4G6TB 5JVTA 2P5KA 4KUMA 5LHIA 1FSEA 5ILUA 3GTPJ 3BP8A 4KT5C 1X1PA 1LUJB 1DUXC 3MFKA 3QPSA 1JHHA 2M5WA 3HB9A 2MGQA 2QVOA 3PNYA 3H9JA 4AWXB 1XG1A 3LQQA 5ICEA 1Z67A 1LNWA 1IAWA 2DXIA 4CO8A 3TOAA 1Y8RB 3TL4X 4FE4A 2DPDA 1IXCA 4AC0A 3CDLA 1WGXA 1MGTA 1QPIA 4ZC3A 1PVEA 1FBUA 5H6RA 1X3WB 1AKHB 4G9YA 2QZ8A 1BR1A 3BPXA 1USSA 4L0YB 2M4KA 1IN7A 2JUCA 1HSJA 1JUMA 1LEAA 4JQFA 1W0UA 1ORKA 4GGGA 5L3BA 3UNGC 4A93J 5FJ8J 4Y13A 1D8KA 5DCMA 3N97A 1P7IA 4NQWA 2KZVA 2WAQA 1FYLA 2DFFA 1EV7A 3QYBA 3MZYA 3D5SC 5EJCA 2YS9A 2EIKH 5E1XA 2IGOA 4UUTA 2XAHA 4P96A 5E3NA 1I6XA 1Z77A 3P9KA 3FKJA 4A0YA 1U9OA 2OQGA 3OS0A 2Z99A 1GDTA 2Y75A 3DU5A 3AL0C 3I55I 3CJNA 1P9QC 1K6OA 5FO5A 2FJ1A 2LSOA 4MIMA 3ZQGA 2X6XA 5CVVA 5LGTA 2H1LA 2K9NA 1NHAA 2MD5A 4IPAA 3I56I 2EJRA 4RAFA 5KK1A 1XTAA 1IF1A 5AONA 2HOEA 3BCBA 2HQ5A 4KIBA 4OIPF 3FDYA 3OS2A 3JW4A 4BXUA 4P9UA 1ZR4A 1B9NA 4KJZA 3SFZA 2FOWA 3D5RC 4MGRA 1TQMA 3A0HC 3HHGA 1Z05A 2LLKA 1U8BA 3OIOA 1OCOH 3HOUJ 2F4MB 3JRGA 4IL6C 2O03A 2IAIA 2Q8KA 4A3JJ 1G4DA 2EILH 2HTSA 1R5ID 4AYBA 1NK2P 4N4OB 1EH8A 3CO6C 2EK5A 3BCAA 3DV8A 3ABKH 3ULQB 2N8GA 2QQBA 3AG4H 3RQ4A 3MWMA 2E34A 4PJJA 2DA6A 2QCOA 1BC8C 3W6JB 2XSJC 1TQPA 2GOMA 1KU9A 3HOXJ 3S1QJ 3RPUA 3OSFA 1SC7A 3SZTA 2ICWG 2RDPA 2VN2A 2W7NA 3HRSA 1AU7A 3MCZA 2WADA 3ZMVA 2ECCA 3PUFA 1SD6A 1WH7A 1VQOI 2ZXIA 4K2EA 1GV2A 3CJRB 1RETA 5LEKA 4C2UA 4HX4A 1OCCH 4IX7A 4WX9A 1U78A 4V19K 2DU9A 3F72A 4IKFA 4JBAA 3J81K 4RGXA 2R7VA 3S16J 4BXFA 5IT3A 5H20A 4ENMA 1UJ8A 4PDKA 3R0JA 1J09A 4CCJA 2V1XA 3FXUA 1R6RA 2E19A 3BWGA 3MVPA 2WAQN 3KLOA 2WY7Q 3MKLA 1J75A 2LH9A 2PFBA 2FRHA 1XC5A 2ZC2A 3OYFA 3FHNA 4XKVA 2DOFA 1TT5B 5J4VA 4ENNA 1YS7A 2GQQA 3KP4A 2NRAC 1DGWY 4DZJA 3Q0VA 2F2EA 3I64A 3GYHX 4RAGA 2HDWA 1BW5A 2VPRA 3OYBA 2ADUA 2P5VA 2ESNA 2Y0MA 1OCPA 2BYVE 3CC4I 3K7AJ 1ON1A 2BEOA 4XKCA 2V1UA 2HOSA 1TTYA 1FIAA 3LAPA 2ZNZA 1BI0A 5CKTA 2HTJA 2XVCA 4G12A 4Y33A 3RDIA 3CCLI 2HWVA 1E3OC 1ZKGA 4JOMA 2F5EA 4HZFA 1YRNB 5JR3A 4LLGF 5DV5A 3CCMI 3K9TA 1TLHB 2HKOA 4XOTA 3BJOA 1QZEA 1R1UA 3WE2A 2M3AA 1ZRFA 2DA1A 3LA2A 3K1NA 1QBJA 5BS6A 3WTZA 1D0XA 5AIQA 4KDPA 3RKXA 2HEOA 1U3EM 4QTRA 4KMUX 1JT6A 2DA2A 2DT5A 2LKPA 3V7CA 4C3IJ 3LA3A 2LBFA 2LK2A 1O7FA 4D7MA 3DPTA 1O3TA 5LHHA 3MZHA 2I8DA 4BDZA 4U87A 3B02A 3IKVA 1LVAA 4XONA 4XRMA 2VE9A 3K4BA 2ELJA 3CDIA 1VFCA 1D5VA 5J6XA 4LLNA 2X0LA 3ZQHA 2KRCA 4KT6A 1YG2A 2JA2A 1SFEA 1U5TB 1BI2A 4DBRA 2K3FA 2XKPA 1YRNA 1D5YA 1U6GA 1SAUA 1E0EA 1POGA 5H2FC 5KHDA 3H9QA 3GFLA 2YSRA 3U21A 5J47A 2GLOA 2QQ8A 2EFWA 4A0XA 3FXKA 2A07F 1H88C 1IN8A 3PNTA 2P81A 3SEZA 1B8IB 4LB6B 2LR8A 5FRNA 2VONA 1FTTA 1VNDA 1A31A 3ERMA 3VOEA 1SFOJ 3BR3A 4ZTFA 3T8RA 3V8KA 4RB3C 4JP0A 2CU7A 4CCMA 5L3FA 2I5UA 4M9ZA 1BN5A 3ECHA 4F91B 3BZKA 2E71A 4HPQA 4M9SA 2PMZN 4L9VA 3T5XA 5FFZA 3KP7A 1ITYA 3DKYA 1I1GA 5CLSA 1LFPA 1PYVA 3L2WA 1DGRM 5K7FA 1U5TA 4DJAA 4M6YA 3A01B 5GPAA 4HSTA 1FJLA 4C3JJ 2WC2A 5D8LB 5KNLA 1JGGA 3M3YJ 3DF8A 5FB2A 2HPMA 4MFEA 2JQ7A 4A3LJ 2LY9A 3E5XA 3FXQA 2EV0A 3VYUB 4CYDA 4ZDLA 2DMPA 1P7JA 2GXGA 3J81Z 1ENHA 1B8IA 4CCOA 3PIPF 4RB0A 2PI0A 3OYHA 3JAMZ 4N0BA 1R5HA 3DBLB 3TO9A 2VKDA 4A0ZA 4IHSA 1QVTA 3WGGA 4AIKA 3ZQCA 2AQFA 3REOA 2K4JA 2BHZA 2VL8A 5C44J 3AKZA 5GAHJ 3OOUA 3GFMA 5DDGA 1Z3XA 2IS1A 4NDLA 4OU0A 4LG0B 1Y1VJ 1P4WA 2P5LC 4HNTA 2V6EA 1KU7A 2H6BA 4KN4X 2F5CA 5A2QK 2BVMA 4HRIA 1ETOA 3RZOJ 3C2HA 1T98A 3A01A 2PQ8A 4P9FA 3WU2C 2L9RA 2EA4A 4L9NA 2DTRA 1WVRA 3V42A 3CMEI 2CUFA 5IYDJ 2EV6A 1HA8A 4IHVA 3PUBA 2K5CA 2LYCA 1MBEA 4BEHB 3E6BA 2DMTA 2ZXJA 4GYIA 1CQTA 2L7MP 3KE2A 2X1CA 1QHGA 3RKYA 3KZZA 2VKVA 4FQGA 4XSZF 1IV6A 3K1PA 3DEUA 3BG7A 3G71I 2JA6J 3IAS2 4DYQA 1ETQA 3I59B 2XPWA 1IC8A 1WJAA 2CS3A 3DCFA 3LMMA 4LG0A 1R49A 3PQKA 4MLOA 3WTWC 3JREA 2E5NA 1QHHD 3OYCA 3OL4A 2GM4A 3M8FA 1BIBA 1RI7A 3S3MA 1Q1VA 1SEUA 4FX4A 3I71A 4U7DA 3GWZA 1UZCA 1B6AA 4BU2A 3CUQC 3HXLA 4FX0A 4IJAA 2E60A 2XF6A 1UB9A 2KIUA 4YIFA 2JRMA 1JE8A 1FOWA 4A69C 3IV5A 4XRSG 1UHMA 1EKEA 3M9AA 4A3BJ 1T56A 2YPRA 4FCYA 4BEHA 2RNGA 2X51A 4XLAA 4Q4ZF 2HR3A 2MH2A 4UB6C 3TOBA 1LFBA 4UNOA 1R9TJ 2GOXB 1FC3A 3TEDA 3KEOA 1LDJA 4V2FA 3VYTB 1U8RA 5KCMA 1D8JA 1STZA 1KU3A 4CSWA 3PNVA 5D5VB 1R22A 3I59A 1ZARA 2JPBA 4B47A 4D5FA 2HFHA 3FF5A 3GLLA 3HOVJ 1KQ0A 3K2ZA 3FX3A 4YG2F 5CQEA 2ACJA 2V4JC 3FIWA 4WWCA 1B72B 3L2UA 3ZGKA 2KKOA 1H8AC 2HQAA 4JX5A 3EUAA 5ILSA 4A3EJ 2W25A 3WGIA 3VYRB 2ZNYA 4MTEA 4E4HA 1FNNA 3MKWB 1PP8F 5F04A 1C0WA 1IRZA 1DU6A 2EV5A 4WXHA 3RSNA 5FLVA 1OLTA 1WPKA 2L2OA 1T0FC 3BROA 1JTYA 5F0CA 2L7KA 3S93A 3V8JA 3X2QH 4BQNA 1H0MA 1YQAA 2W4SA 2RAEA 4J00A 2D5VA 4YIIA 1WJEA 2FE3A 1F36A 2UXXA 1HW5A 2HVRA 4Q48A 1UHSA 1XGOA 2R92J 2VB6A 1FTZA 4M3BA 4BQQA 2KZGA 1YHQI 4CHUA 2EFNA 3H92A 4M6XA 2ZSHB 4C9YA 2DCEA 5E8GA 1I39A 2M7AA 5FFXA 5HDNA 2V9PA 5FGMA 2EBIA 3HRTA 4PFPA 3QAHA 1IZ1A 1MNEA 3L09A 2CW0F 4XN0A 3FXJA 4HX8A 1IXSB 2R5ZB 1VQNI 3G73A 1YW8A 1MDMB 1GUUA 3LSTA 3IH3A 4B44A 5A2QZ 4HQEA 4G7HF 2M0CA 4X1EA 4C30A 2GAUA 3GFIA 4CZZA 1IDZA 4HW0A 3DP7A 2JWTA 2LP0A 5C4XJ 3OMYA 2QUFA 3OYAA 2JJ7A 1HSTA 3TO7A 3UKGA 3FWEA 2AQEA 2CUJA 1RUNA 1HC8A 5DD4A 3WGHA 1YLFA 3NWTA 1S9HA 4I6ZA 2IP2A 2NS7A 4XLCA 5LFAA 4LIUA 4M3GA 3RIRA 1TBXA 2CW8A 5JLXA 3N4MA 3L2CA 1V5GA 4IHYA 3TW6A 4II3A 1W5CC 2DQLA 5J3LA 2R5ZA 3R4KA 4YFNF 3GW2A 1L0OC 1R36A 1NH3A 2P8TA 1FYKA 2ZMEC 4HV5A 3P7NA 4Z6YA 1OYYA 1PUEE 3G2BA 4KYWA 4A3DJ 6PAXA 2Y9YA 1MMGA 2XF7A 3HPHA 1ONVA 2CV0A 2H8RA 5E17F 2R3SA 2CV1A 3FMSA 1I5ZA 1IRGA 2M34A 2MW8A 1XX5A 3OY9A 2XKOA 4CCNA 2WY8Q 1Z3YA 2BY0A 2E5ZA 2CH0A 2IS4A 2QGUA 3P9CA 5LD2C 3GTJJ 1R4MB 2XAQA 1MBFA 2DA5A 2PG4A 5JHUA 2QSFX 1X58A 5ILVA 1S5LC 2R7SA 1E3HA 1U2WA 3K0LA 3EYYA 4EGZA 1N77A 3I4NJ 2VQHA 2KIMA 3OIPA 4LLLA 4A3KJ 2XC7A 4X6AJ 3CMAI 2XPUA 2VJIA 3G3ZA 4OMZA 3B6CA 5TGTA 1FPQA 5DM6F 3P5JA 4CYCB 1BW6A 5CVJA 5DTDA 3EUKL 1WQ2A 4HYEA 4PK4A 2LREA 4EEFG 2ESHA 5D4RA 2CQKA 5EYRA 1IN6A 1GVJA 3ZRGA 2ZJQF 3ZQ7A 2DO7A 3W3CA 2LY2A 2P7CB 5F0FA 2M1BA 4FETA 3PSIA 3VSKA 3L2QA 1O3RA 4X0GA 2JUGA 4RAYA 1Y6IA 2DYRH 5DEQA 4IOAF 2KHMA 2LF8A 2DLLA 4U0WA 2DJNA 2K9QA 2XASA 4Y17A 3L2RA 3J7YJ 2IW5A 2ELHA 2QEXI 4IO9F 4A6DA 1WWXA 1TNTA 2OC6A 1TNSA 1IRFA 1QQIA 2QSGX 3J7ZI 1KA8A 2VT3A 2VXZA 2CFXA 4KNYA 3IC7A 2HGCA 2VBXA 3F21A 2E2IJ 2D1VA 5LGUA 3FXMA 5LEJA 1BI1A 1J5YA 3DQVC 4I0AA 5E79C 2MFZA 2H27A 2JZYA 1V5FA 1W7PD 2ID3A 2IT0A 4M3FA 1DU0A 3GLXA 1D1AA 4PGGA 1FYMA 2NVXJ 4IOCF 3U9GA 2ZKZA 2BV6A 1MKMA 3ZQQA 4BJTA 3K10A 1RR7A 2J5OA 1WRJA 1AHDP 3I54A 2E2JJ 3PM1A 4FASD 2Z2SB 4CH7A 1FWZA 1J59A 3BC8A 5E20A 3ROUA 2V9KA 1MMDA 4MEYF 1SFXA 2HQNA 3H1CA 1MIJA 2QM3A 3OYEA 2BW3B 5FKLA 1WJCA 2Y31A 2VOPA 1MSEC 3Q9SA 4HDVA 1BJZA 2ETHA 3KIOA 3BG3A 3OV8A 1ZG1A 2IGKA 3E3VA 4ZTJA 3HUGB 1WZ2A 1I50J 2R7XA 3EQLF 4OWRB 1OYIA 1KU2A 2LF7A 2MA3A 5HS8A 5D5XB 2EA2A 3FBNB 2FNPA 3QYFA 4ABZA 2L02A 1ZELA 3LSPA 2ZXHA 1SANA 3D5LA 5FLXK 2B0LA 2FXAA 4IXAA 1JHFA 3CMMA 4A3FJ 2M87A 4XIDA 3H0DA 3I4MJ 1ON2A 1W1WE 2EZIA 3HJEA 4CZCA 4MNUA 3H3ZA 3E0JB 5CJ9A 5FROA 3PJRA 2E1NA 3K4NA 4HAMA 3JTHA 2A5WA 2IXSA 3M1CA 1FSHA 1FZPB 2BW3A 4A6EA 2BXYA 1FOKA 1LDKB 2R7QA 5EF6A 1BM9A 2ZFWA 5CPRB 4S0HB 5L3EA 1AKHA 3CF5F 2JA8J 3EUHC 3RI4A 1Z9CA 4UV8A 3I3LA 3GVAA 3KP2A 4Y7NJ 4FHTA 3HTSB 4EJWA 1XMAA 2VT2A 4RA2A 2GA2A 2DAOA 3KZYA 4MQ9F 3MN2A 1OFCX 1ZGJA 1IRXA 3MKZA 2OCEA 1PP7U 4B3XA 1IG7A 1D0ZA 4IQJA 3IWFA 3NWSA 1RNLA 1JKOC 2DOAA 4CUGA 3AL0B 4RBOA 3I9V2 5HDKA 1OCZH 2FUG2 1PDNC 1RPWA 2A6EF 1XD7A 3B6AA 2W57A 3F6OA 2GWRA 3F8FA 3HL2A 3M4OJ 3HHHA 2XGCA 2Y30A 3F0CA 4ZYDA 3WTSC 4M9XA 2MYSA 3WTTC 5AIPA 3RCOA 4RAZA 3F8NA 3S17J 3WODF 5E3LA 1GV5A 1HQCA 1I1SA 2FBIA 1GVDA 2GA1A 2LMDA 4C2MJ 4E7IA 1TT0A 1RKTA 4XSXF 3Q0WA 3GBGA 3ZXSA 2XPVA 4GYGA 4E6KG 1Q1HA 3ESWB 4ZDOA 3JSPA 2COMA 3SJMA 3CCVI 1S8NA 5ICCA 1JI8A 1P92A 1G3TA 4WXCA 2BZTA 1NK3P 2KPMA 4XBFA 1MBJA 4YIRX 2JPCA 3BR2A 3DXJF 4II2A 1XS9A 5F64A 2MLKA 4UVCA 4BH9A 2BHYA 2RREA 5JLWA 3K4KA 2DJIA 4HG2A 2Y0SN 3F23A 1I6HJ 3HYIA 1HW1A 4NUBA 3JRHA 3BJ6A 3ISPA 1EH6A 3H5AA 3QOPA 3F6VA 3PFIA 3LSIA 5DCFA 3E6DA 2EH3A 3CESA 1O3QA 2CUEA 1UELB 2M9HA 2ISYA 4Y3OA 3R6SA 2EB7A 2F48A 3B73A 3J7AO 2ZFUA 2Z33A 3EYIA 1TWCJ 2PMZA 2NAZA 3H9GA 3R0AA 2GBYA 2DDAA 3Q3SA 1KYZA 1CF7B 2YU9J 5C4JJ 1G2HA 1MZBA 3QYEA 3JR9A 3OS1A 3HDDA 3OL3A 1BOAA 2KFDA 3SHFA 3ASOH 3BG9A 2I10A 3JSOA 1B1BA 1JKRC 1OMIA 3F22A 5IPAA 2DW4A 1U0JA 3LSMA 2XB5A 2VKHA 1KQ9A 1FP2A 5FLXZ 3SFIA 1YITI 3CC2I 3ZP5A 1XDUA 1DPRA 5J4YA 1NTCA 2R5YB 1MMSA 1FP1D 2A5YB 2O8XA 2XRLA 4XRSA 4Y4RA 9ANTA 1ZAOA 2K85A 2K27A 1D1CA 3OYMA 1ZHFA 4ZYGA 5E18F 1JJ8C 3S1MJ 3RZDJ 4P1WA 2TRTA 5L3CA 2A6TA 1K78B 1T6SA 2IGMA 1JUPA 2ZBKA 1H89C 1CF7A 5IYCJ 1N75A 1UHWA 3S2WA 1ZH5A 2Z1DA 3S14J 4N9IA 2E1CA 3E97A 2TDXA 3MKYB 4QIWN 4XR6A 2HVQA 4HF2A 5D4SA 5EEGA 3S8PA 2LKSA 5J40A 4IRHA 2PJRB 1OCRH 2CJJA 2K40A 4EJTA 1X3UA 1PJRA 1X1BA 4DNCA 4RGRA 2XAJA 2OCCH 2AS5F 3HOSA 4QPQA 4L5EA 1TP4A 1JTXA 1X4OA 1V5EA 4AIHA 2F6CA 1K78A 3H35A 3HPGA 2BE5F 4BYYA 2X1DA 1TL8A 3MZ8A 1WKMA 2O0YA 4QWQA 1G3WA 4W97A 3E6CC 4JX6A 4O6JA 3BY6A 1ZTRA 5M5YJ 1V55H 4V2GA 3RPQA 5ERIA 3TMOA 1D1BA 1BI3A 2BOLA 3I53A 1TZLA 2PN6A 4D5CA 3IRRA 1R71A 2W1OA 1X2MA 2QSHX 2IA0A 1P2FA 3PO2J 4BE2A 5HODA 4FT8A 5M3MJ 1JKQC 3CJQB 3CCRI 3J7AY 4U88A 3ML6A 4U7BA 1YW7A 2K9LA 2M30A 3ZR8X 2AHQA 3K4LA 2AXLA 4PCQA 4O5VA 3A0BC 3GX4X 1OJLA 4NC8A 2HQRA 2ME0A 4EATA 2OU2A 5GPCA 4AVPA 2E1OA 4ZYAA 3LSGA 5M3FJ 3CC7I 2DK5A 4U0YA 4D0PA 1EF4A 3IUOA 3SYTA 4QLCU 2JMWA 1WJDA 2X4HA 2PJPA 4O3MA 1SFKA 1TW2A 1HW2A 3EPZA 1RESA 1SFUA 4OOIA 4EM0B 1KQ8A 4NBQA 5FKKA 4XICA 2EIJH 4JX4A 5IP9J 2KMUA 2JK3A 4XRFA 3IH4A 1VQ6I 5DM7F 2A05A 2KJBA 2X6YA 1VQPI 3HOYJ 4E7KA 3TDZC 4PUSA 2Y9ZA 1T95A 2ZCWA 1FOYA 4DYCA 3DBRB 2X6WA 1VQKI 2ZO4A 2R93J 1GXQA 2V7FA 2NYXA 4XLHA 1ZGAA 3KP3A 4F7ZA 2IRFG 1S72I 4HLXA 2XAFA 2R7WA 5TISC 2P0WA 1OR7A 4IHWA 2VI6A 3CP2A 4A3CJ 2P7VB 1JUSA 1HBXG 1ERDA 3WE3A 1TWAJ 3H5NA 3GTQJ 4LD5A 4AIDA 1SVMA 3KYLA 4I0BA 5D6FA 1QNTA 4LK0F 4PJ0C 1BJAA 4JYKA 2R0QC 1Z91A 1T38A 4BHPA 4B43A 2V6CA 4LIVA 1QRYA 5F08A 1SMTA 3M07A 4XN3A 1LJ9A 1UG2A 2M45A 4XK4A 3O8HA 1WI9A 3CDHA 4GXOA 1YJNI 4HF1A 2M8GX 1TWFJ 4G6QA 2YUSA 2CGPA 4NC7A 1QU3A 5BNGA 3CQZJ 4HBLA 4B09A 1XMKA 3SZGA 5EG0B 2CWEA 1KYWA 5D8KB 1DDNA 4YFXF 2FA5A 1R23A 4AUXA 4I98B 3J80K 1SD5A 4CCLA 2JVHA 1YTYA 3LNQA 2A6HF 2HOTA 3O3KA 5TJJA 1N25A 5GAGJ 5JFRA 2DQRA 4KFCA 2IA2A 3LFKA 4BBSJ 2CQNA 2IA1A 3RKWA 3VB2A 1S7OA 2QLZA 2H09A 2NVUB 1FY7A 3CUQB 5B1BH 2RQPA 1YI2I 2P6TA 2FSWA 2MD0A 3ZMZA 4G8XA 1IN5A 1KONA 2FMLA 3TO6A 2JT1A 2V1NA 5B1AH 3ZN0A 5GADJ 3WTVC 1MNMC 3QQAA 2O9LA 2A3SA 3HGYA 4BJ5C 2R7ZJ 4BACA 3KYCB 3OYDA 3M7GA 5EG0A 2M4GA 1VI0A 5CYVA 5IOYA 2E1MC 1TW3A 1E3PA 2M7BA 3HTUA 2E2HJ 3GTKJ 2A61A 1D0YA 1XPXA 1V54H 4F52A 2H94A 3GXOA 1QGPA 3ONQA 3UR3C 2LTPA 1K79A 4GO1A 3T0YA 4E7SA 1W7PB 4UB8C 3IH2A 4HA8A 4IVNA 2KLOA 3I4PA 2OJED 3TDUC 4UUSB 1G3YA 3EDPA 3JRFA 4Z2YA 2BVLA 2HI3A 1J2XA 2R7TA 5HOOA 3C3WA 2WWYA 2LC2A 1SVLA 2FMYA 4B3AA 4IRIA 1W0TA 2LOOA 3FK7A 2Q1ZB 2EIMH 1XCBA 2DFHA 4RGUA 4HOBA 4DIQA 4W1UA 1B72A 4DBQA 4KISA 1HLVA 4UHTA 5CVIA 4UV9A 5EDNA 4G6DA 5EZGA 1TWGJ 1YFHA 4ITVA 3VODA 1RR8C 4M3DA 2F4IA 2L4AA 4ZZDA 2O3FA 2KQRA 4ESBA 2A68F 4ENKA 3DKXA 1VQ8I 4HF0A 3R61A 2YR2A 5GAEJ 4EJOA 1ZREA 2EZLA 4P55A 1W7PA 2LNBA 3VFZA 4D1QA 3GTLJ 1H9GA 1QPMA 3U1KA 4UUSA 3LSKA 2G0EA 3NAUA 2QKMB 5ICFA 4BS9A 1DP3A 4RS8A 3DWLE 2QWWA 2HYJA 4HX7A 3T1BA 3MD2A 2X1EA 3A2KA 4I2OA 3S3NA 3GFJA 4D7NA 3LSHA 4BJ6C 5HDGA 2HNHA 1EA3A 3A1YA 3K2AA 1YX3A 3AG2H 1N78A 4I7HA 3VEPA 1Z6TA 1MDMA 2STTA 3SXYA 1YIOA 1ZR2A 3SEQA 3BPVA 2KDOA 1J0RA 1WH5A 3BTIA 2KP6A 1I3QJ 5EZHA 2DFIA 2O5RA 1S29A 2EFPA 3WHBA 3ZQIA 3DTKA 2HXOA 3CF2A 4DZPA 3GZ5A 5KAIC 1X19A 3NQOA 2WAEA 4AM3A 3F8CA 1F4KA 2LY1A 4DQ2A 3BLYA 3K1MA 2O8KA 2DBBA 3LL7A 3J80Z 1A35A 2Q0OA 1LPQA 4OMYA 2M8EA 2R7OA 1J9IA 4CA0A 1P4AA 2NXNB 4EM2A 2KRHA 2K9MA 4EJUA 5CVUA 2DFEA 1UCRA 2QBYB 1IW7F 3HEFA 1HKTA 5E3OA 5B66C 1MH3A 2ZMEB 2CV2A 3ABLH 3VYSB 4AIJA 4LB5A 2MABA 4UVAA 3GUDA 5J1YA 2L01A 2L5QA 2OAZA 2MC4A 2XDVA 2QF7A 4Q5SF 3G1LA 1R58A 5GP9A 3Q9VA 3BT9A 2VQLA 5LGNA 4CGZA 3Q0UA 2DT7B 2L0KA 1USTA 1B4AA 3HIFA 4A5MA 1VQMI 2CG4A 3K4JA 3KETA 2ZXWH 3ABUA 4ENJA 3BR6A 2IJLA 1IDYA 2RV8A 1KZHA 1ZLKA 4CCKA 2VE8A 2XGDA 1LVKA 5F1JA 3CMYA 4ZDPA 3W2VA 4BE1A 5H6QA 1SMYF 2FEZA 2L54A 3BTLA 4YEJA 2M0MA 3TGNA 1OCTC 1X1CA 2FF4A 3JRCA 3A03A 2DN0A 2WAFA 3QP6A 1B9MA 2JN6A 5IP7J 3ERED 5JHFA 2QYOA 4M72A 4G7ZF 3I0TA 1R7JA 4OAZA 3DU6A 2QBYA 3DEWA 3F8BA 2OZ6A 1ZK8A 5DS9A 1ODDA 5L3DA 3W2WA 3KCCA 1G59A 2ZMEA 3DTEA 3G1MA 4G94A 3HRUA 2WTEA 2ZSIB 2BGCA 2VBZA 3C2GA 1Y1WJ 1X3ZB 4HNUA 3HZJA 2XROA 2YX4A 4EJVA 4CYCA 4XLFA 3E1SA 1R4NB 1K83J 2CFOA 2XHKA 2B9SA 4PJLA 3GTMJ 2OTLI 2UXNA 1HCRA 5HVQC 3BZCA 2VC0A 4KN7X 3CJTB 4A2UA 1K61A 4UUVA 5E8IA 4GFBA 1O4XA 4YRVA 2DYSH 3JRBA 3ZMUA 1XSXA 1RUOA 1LFUP 3K70C 4BY1J 2IBDA 3A02A 4I02A 1ZRDA 3GCMA 5DD8A 1BC7C 3KLNA 4PZJA 1S7AA 1HF0A 2DTZA 1S7EA 3ELKA 3IAM2 1ETXA 1Z6RA 5K5RA 4J01A 4KIFA 2H6CA 3GTGJ 2KDZA 3JCUC 3WHCA 4BBRJ 5CVRA 3W2AA 4QPOA 3Q5FA 2R7FA 4E7ZA 3IRQA 1ZG3A 2WV0A 1FMVA 2XRNA 3OIQA 2TCTA 1ZRCA 2KRFA 4LK1F 4F3QA 2K3PA 4BXXJ 5HNHA 4MHGA 1YIJI 1HDPA 4DW6A 1QA6A 3FHZA 2W24A 1VF9A 1DP7P 4YELA 3TKYA 1IO2A 4RLFA 3GMEA 3MAJA 1DQUA 1HDDC 4NC6A 3JTGA 3HGGA 3C2BA 2Y0SA 3PL8A 1LEBA 4MQVA 2CW7A 2F5DA 3I5UA 2H1KA 3H3VK 1NG7A 2MSYA 3MMYB 4PFOA 5L3GA 1JKPC 1MBGA 1VQ4I 1T08B 1G6NA 5FLMJ 2DOEA 2HS5A 2Y69H 2P4WA 3OYNA 4IHXA 1BOBA 1Y8QB 4BQOA 3PFYA 1UAAA 2BY1A 1WHUA 4HDUA 2NVQJ 1QZZA 2VOOA 1BBYA 4HQMA 5EEAA 2LKXA 4HNVA 3HUGA 2Z9OA 2WBMA 5LRSA 4PSXA 1Y39A 3OYLA 2DA3A 2DPUA 1RKWA 3CO7C 4ZJZA 2NNNA 2VPLA 1LDDA 1ULYA 3O6BB 2LD5A 4I99C 1MBKA 3CLOA 5E3MA 2XB0X 2NS8A 3VWBA 4L0ZB 4L5JA 3RYPA 1MJ9A 2QENA 2R4GA 2X9DA 1F1ZA 2ID6A 2IEKA 1BR4A 2JSPA 1SAXA 2W85A 4L18B 5DYMA 1ZN2A 1W36C 5BPDA 2FNAA 1O3SA 4OIOF 4XNFA 1FMWA 3QU6A 4MTDA 4DGWB 4GRIA 5K5OA 3VSLA 2DMNA 2JTVA 2OD5A 3ECOA 2MH9A 3N05A 2NOJB 2UUZA 3E6MA 1FLIA 1RZ4A 4L5IA 2COBA 3FISA 1P6RA 2HU9A 4F93B 4PGHA 2XAGA 5D5UB 1HXDA 3TBIA 2CYYA 4PSWA 1R5GA 1WSUA 4F92B 1WCMJ 3QPLA 3D1NI 4N4NB 2ECBA 1O7LA 4EMSA 4BAYA 4OAYA 2OTJI 3QPTA 3OR2C 3M8JA 2CUZA 2EFQA 1RRJA 3C1DA 1XCVA 1JGSA 1MMAA 2LG4A 2GIVA 4HEA2 5J8CA 3F8MA 2EPFA 2IGNA 4A3IJ 1NG6A 2OBPA 5IP6A 1QO0D 2X6OA 4Y15A 3L00A 4A3GJ 1VQ5I 2JSCA 2OA4A 2V26A 5DUIA 2CQQA 2FD5A 2D45A 3ABTA 3AAFA 2VUMJ 3DLLF 3M8EA 5IY5H 2K4BA 2L7ZA 1XDSA 1IJWC 2G9WA 3AG1H 2VLAA 3EUHA 4J19A 2J5PA 1IN4A 1FX7A 2FU4A 3FXLA 2KT0A 2DA4A 2WB1A 2HYGD 2HZDA 2V1DA 1T39A 2WA0A 3F9KA 2WV1A 1MNDA 5B3SH 3G1OA 3A4CA 3FKIJ 1F5TA 3WTXC 2PLYA 1W4MA 4M74A 3WTUC 3JAMK 4OIQF 3SZPA 1LKXA 4EM1A 4PJNA 2JRTA 3L9FA 4XLNF 3OSGA 3NARA 1WI3A 5JI6A 2HZTA 3FXRA 3P9IA 2NS0A 4XKBA 1MMNA 1T2KA 1WJFA 4RLQA 3H0GJ 3O2PE 2LBFB 2RN7A 3DBHB 3CD6I 3ZQLA 1FOXA 3PIOF 1MJBA 3K69A 4EGYA 2JVGA 2GZWA 3KFWX 3DTIA 5HS7A 2K86A 1R1VA 1X1DA 2P6SA 3ZOBA 4AD9A 3KYDB 3CCJI 2RNJA 5FD6A 3JRDA 3ZPLA 3V7RA 4WK8F 1KGSA 3CZ6A 5LHGA 3KZIC 4BDYA 5CQGA 1IV8A 2DODA 3DPLC 2XGXA 2XSDC 2ZJRF 1PUFB 3FBIB 2DT6A 5F27A 2R7UA 3HSRA 4HV6A 2QA4I 1XSDA 2GIZA 3BOQA 4BE0A 4BNCA 4LFUA 3K70D 4IF4A 3V4GA 2W84A 2X85A 5HLTA 5HLHA 2RVCA 3CTAA 1U5TC 1A04A 2NVYJ 3ASNH 4E7LA 4CDGA 3KP6A 3DKWA 4IRGA 3KPHA 3OWTA 3TW7A 1XMXA 4AYBN 2VQGA 5ICGA 3BTCA 4LOCA 5FKOA 5J8FA 5LRRA 4D9JA 1W5TA 2ELKA 2HDCA 2XGEA 4BKXA 1GT0C 2OPTA 4XKWA 3BJAA 2F4OB 5K7HA 3BZ6A 4Y52J 1AWCA 3DPUA 3MQ0A 3LAJA 5FKMA 5K5QA 2LRDA 3ZMSA 4LMYA 1Y0NA 4DYRA 3PQJA 2BXZA 3SQNA 2V9VA 2K02A 4EV0A 1BA5A 3S32A 3V8LA 2R5YA 3HOZJ 2L9NA 3HSEA 3IP4B 1PUFA 1FBQA 2VC1A 5C3EJ 3QP5A 2FOKA 4A3MJ 2EWNA 4ZZLA 3CCQI 1O57A 2LFBA 1G3SA 1XSVA 2HKXA 4L9JA 4BHCA 4EQQA 2OQRA 2FQ4A 3BR5A 2WB1N 2XF5A 1T8IA 3RPUD 4WXDA 2CRGA 1LB2A 2AXTC 2AO9A 2PMHA 3BQYA 2M2EA 2KIFA 4NHJA 3V7SA 5J1RA 5K7ZA 3FMRA 4BHBA 3S1RJ 2HVSA 3K4MA 4U0VA 3OYGA 4OINF 3WTYC 1OR7C 3S2HJ 2K9SA 4E70A 4M71A 2V79A 2Z16A 3SDBA 1SVOA 2EZHA 3ZCOA 5F0HA 2EFOA 5JVGF 3G6EI 1JT0A 2E7WA 2FBHA 3IHUA 2FX0A 3RKQA 1IGNA 5LBQA 2GXAA 2E35A 4HLYA 2ISZA 2QKLB 3CP8A 2CSOA 1ETKA 1XN7A 2PJRA 4WF2A 2EQRA 4E7HA 2MC3A 3O8GA 1A6QA 2CQXA 2QQAA 1MH4A 1W36D 2YX7A 3CLQA 4MO7A 4QSHA 1MJAA 4L9TA 1YJ9I 3LWFA 1K7AA 3LQRA 4KIGA 3S2DJ 5IT9K 2W82A 2H8WA 2XV4S 3OR1C 4BQAA 3E5QA 4CXFA 4KMFA 3NEUA 1TC3C 3ABMH 1XB4A 2OV7A 4P5OA 1ACIA 3LA7A 2GXBA 1E17A 5HLIA 3WG7H 1WFXA 2FQ3A 3EETA 2F5VA 3BQZA 4M73A 3BR0A 3NRVA 2D2WA 3LFUA 3S1NJ 2XUBA 1L3LA 4TV7A 2CMPA 4CICA 3WU0A 4C3HJ 4RMNA 4XLPF 3AG3H 1A5JA 3FXOA 4XLEA 3L7WA 2KL4A 2HOAA 1MBHA 2UWMA 2EINH 3ZMDA 2Z5UA 4GCVA 4FTHA 3DEEA 3OYIA 1REPC 4KITB 3VDXA 4C2TA 5DUKA 3HKZA 2R7RA 2VJ4A 1ZLJA 4I01A 1CGPA 2KISA 4LGWA 4GDFA 2B7EA 2ZJPF 1XGNA 1MSFC 2EZKA 4ZYHA 2DMQA 2DK8A 1YJWI 2R7DA 2MG4A 4I09A 1ZG5A 3RJPA 4AVZA 3T8TA 1HKQA 4FE7A 1R00A 1RC9A 3K6GA 1JJ6C 5FKNA 1APLC 2DDBA 2STWA 1UG0A 2RC4A 5HNFA 4AU7A 1HKSA 1YOVB 2VIXA 2Q2EB 5LLQA 1AA7A 3FM5A 1H9TA 2JA7J 4ON0A 2MLGA 2OZUA 3K4CA 1A36A 3U1DA 2QQ9A 3HM5A 1BIAA 4B8XA 3QU3A 3KX2A 4RM3A 1X1AA 3ZN1A 2W00A 2ZB9A 1X2NA 3IWZA 1GHCA 3AFHA 3DFGA 2HYFA 1UMQA 5E1WA 1Z0XA 3SDGA 1VTNC 2HDDA 4IHTA 2PMUA 1YO5C 5D6EA 5J1UA 2IS6A 3PSFA 5F6FA 1MW7A 4WCGA 2L3DA 5EEHA 1J7KA 3HC7A 2BBYA 3U2RA 4PJMA 3CCSI 3FM3A 4UVBA 3DLAA 2L4MA 2VJJA 2LVSA 3L1PA 3OOPA 3CCYA 2ME6A 2Q2EA 2C6YA 3QOEA 2E7XA 1ETYA 1K4SA 4XOPA 3IL2A 5M5XJ 1LE8B 5IYBJ 4UY8I 4IZZA 1V3FA 3GTOJ 4RB2C 2O6GE 3HSFA 1G8XA 2OUMA 2F5FA 1QVUA 2OF7A 1IXRC 2O61A 4UXNA 1P4XA 3FZVA 4RB1A 3VPRA 2NOGA 2NNYA 4KA4A 4RDUA 1UFMA 3GZNB 5IOZA 1GLNA 3CUQA 1K6YA 1Z21A 4ANJA 3BR1A 2K7LA 3GO5A 4B48A 3W6VA 3HOTA 3HKZN 3GF2A 4XL9A 4RM2A 3CCUI 1YS6A 1IUYA 5F1RA 4XORA 4A12A 4MFDA 2E1MB 1Z7UA 2IVMA 5IT9Z 1F43A 5EGOB 5E1ZB 1A6IA 3I58A 3LOCA 2JA5J 2DMUA 2CQ7A 3JRAA 1M1EB 2PX9A 1FT9A 3QPHA 4H4KC 3RTRA 1LE8A 2XAUA 1W5SA 4XM3A 1VQLI 3BG5A 5HLGA 3IKTA 2BY3A 2G7UA 3R60A 1Z7LA 3TQNA 4XMYA 2VJ5A 2DA7A 2VBWA 3RQIA 2VASA 1VQ7I 4N9HA 3G4SI 1YYVA 3MEXA 4KICA 3PO3J 4OIRF 4FISA 1FIPA 5BMZA 2HPIA 3E7LA 4EVIA 1EH7A 4MEXF 3GEZA 3OYKA 3TP3A 5FD5A 4ASNA 1T0FA 3CUOA 3L2VA 2VBYA 3HG9A 1VZ0A 4BY7J 5EGOA 1E2XA 3JRIA 3ZQFA 1ETWA 3M1EA 3S3OA 4YFKF 2MBFA 4G7OF 1FEXA 3CCEI 4XQFA 1YW9A 2Z3YA 3H3UA 3QWLA 2VQCA 1YE9A 5BQTA 5GTIC 1HOMA 4HSRA 1SD4A 5BPIA 1BR2A 1Y56A 1ZYRF 1V4RA 4ESJA 1Y0UA 2UV1A 4A5NA 1XGMA 2HXIA 4B4CA 2VODA 1AOYA 2DI3A 3KEQA 4Q47A 3KP5A 4RGSA 1X4PA 1R1TA 1OPCA 3FMQA 4M6VA 4NNJA 4R79A 4IEJA 1YX5A 5M5WJ 4B1RA 4BL0B 1ZGWA 5K1YA 2IS2A 1WJBA 3WU1B 2PEXA 4R1HA 3LSJA 4F55A 3GZ6A 5KVRA 1JXSA 1S6LA 1LQ1A 2A69F 2CO5A 1S3JA 2B63J 2O7OA 3H5RA 4ETSA 1QZYA 3HBLA 3QODA 3HRMA 3S15J 2X48A 1OKRA 2LDUA 2E36A 3W6KB 4ZH4F 1RIOH 2RGVA 2VXDA 1GXPA 1I3AA 1WJ5A 1U9NA 3BDDA 4ESFA 4S04A 4BUPA 2L7FP 2XIGA 3KEYA 3RYRA 2W48A 4H0EA 2RKHA 4I76A 2G7HA 2KIQA 4DOZA 3ZMTA 3QRFF 4BGDA 2L9VA 2KJCA 1SD7A 1ZQ3P 3HOWJ 5GTHC 2RQQA 2VKEA 3F3XA 3FK6A 4M3EA 3D0SA 3WG9A 1BL0A 3H36A 3C18A 3OYJA 4LG3A 1TQIA 2Y2ZA 1VQ9I 5KAFC 2UZKA 1K4TA 5B5EC 5D5WB 2FBKA 1XGSA 1OQYA 1OYWA 2YU3A 1T33A 2PBIA
chains in the Genus database with same CATH topology
4A3IJ 5HODA 1JKQC 5M3MJ 5IP6A 2X6OA 4A3GJ 2AHQA 3TP0A 2CQQA 1OJLA 2FD5A 2ME0A 5GPCA 2VUMJ 2E1OA 3LSGA 5M3FJ 2L7ZA 2EBIA 1EF4A 2JMWA 4J19A 1IJWC 2NVTJ 2KT0A 2DA4A 1TWHJ 3LSRA 2R5ZB 1RESA 1ETVA 2WV1A 1GUUA 3IH3A 3G1OA 3FKIJ 5FKKA 4XICA 4JX4A 5IP9J 2M0CA 2JK3A 4X1EA 1IUFA 3BTJA 3IH4A 3HOYJ 1IDZA 3OSGA 3NARA 2JWTA 2Y9ZA 1WI3A 3GTPJ 4DYCA 2LP0A 5C4XJ 2R93J 3QPSA 3H0GJ 3HB9A 2JJ7A 2MGQA 1XG1A 3UKGA 3ZQLA 4IHWA 4FE4A 2VI6A 4AC0A 4A3CJ 3CDLA 1WGXA 1QPIA 1JUSA 3ZOBA 1AKHB 4I6ZA 1TWAJ 2NS7A 3JRDA 3GTQJ 4M3GA 5JLXA 1PUFB 2XSDC 4IHYA 5F27A 3TW6A 1JUMA 5J3LA 2R5ZA 4M3BA 1W0UA 1ORKA 4JYKA 2R0QC 4A93J 5FJ8J 1QRYA 5F08A 2NVYJ 1UG2A 1P7IA 4XK4A 3O8HA 2M8GX 1TWFJ 2YUSA 4A3DJ 5BNGA 3CQZJ 2Y9YA 2YS9A 3TW7A 4AYBN 2H8RA 4UUTA 5EG0B 5E3NA 3BTCA 1Z77A 4LOCA 1U9OA 5FKOA 1GDTA 2ELKA 4AUXA 2M34A 2XGEA 2MW8A 4BKXA 2OPTA 1GT0C 5K7HA 3LNQA 4Y52J 2FJ1A 3ZQGA 4MIMA 5FKMA 3GTJJ 2HOTA 1MBFA 2DA5A 4DYRA 2K9NA 1X58A 1BA5A 3I4NJ 2R5YA 3HOZJ 4BBSJ 1PUFA 5C3EJ 2HQ5A 4A3KJ 4A3MJ 1ZR4A 4X6AJ 2XPUA 2LFBA 3B6CA 4CYCB 1BW6A 2FQ4A 3BR5A 2WB1N 2LLKA 5DTDA 1U8BA 2CRGA 2AO9A 3OIOA 3HOUJ 4EEFG 3JRGA 5EYRA 1MNMC 3BQYA 3QQAA 2IAIA 2M2EA 4A3JJ 3HGYA 2O9LA 5J1RA 2R7ZJ 5K7ZA 1NK2P 5EG0A 3S1RJ 1VI0A 5F0FA 2N8GA 5IOYA 2E2HJ 2K9SA 3GTKJ 3S2HJ 2DA6A 2EZHA 2QCOA 5F0HA 3HOXJ 1JT0A 3S1QJ 3OSFA 2FX0A 3RKQA 1IGNA 2LTPA 2DJNA 3IH2A 2K9QA 1ETKA 2EQRA 4UUSB 1AU7A 3JRFA 3O8GA 2ECCA 2CQXA 2HI3A 1MH4A 1WH7A 1GV2A 4B3AA 1W0TA 1RETA 3FK7A 4MO7A 4QSHA 1U78A 2E2IJ 4W1UA 1B72A 1HLVA 3S2DJ 3S16J 2ID3A 4M3FA 1DU0A 5EDNA 2NVXJ 5EZGA 1TC3C 1TWGJ 4M3DA 2E19A 3MVPA 2WAQN 3BQZA 3MKLA 1RR7A 3BR0A 1AHDP 2E2JJ 3PM1A 3S1NJ 1XC5A 4DZJA 3Q0VA 2EZLA 5FKLA 4C3HJ 2Y31A 3GTLJ 1A5JA 1MSEC 2HOAA 1BW5A 2VPRA 4UUSA 2G0EA 1BJZA 3NAUA 3BG3A 1OCPA 1MBHA 2HYJA 3K7AJ 2HOSA 1I50J 1FIAA 4FTHA 4G12A 1E3OC 4D7NA 1ZKGA 1YRNB 3K2AA 4ABZA 3LSPA 1SANA 1ZR2A 1MSFC 2EZKA 2DA1A 2DMQA 2MG4A 1WH5A 3BTIA 1I3QJ 5EZHA 4A3FJ 4XIDA 4FE7A 1JJ6C 1APLC 5FKNA 3WHBA 4QTRA 3I4MJ 1JT6A 3ZQIA 2DA2A 2EZIA 2HXOA 4DZPA 4C3IJ 2LK2A 4D7MA 2JA7J 2O8KA 5EF6A 4XRMA 3HM5A 4S0HB 1VFCA 1AKHA 3ZQHA 2JA8J 3HEFA 2ZB9A 5E3OA 1MH3A 1X2NA 4Y7NJ 1YRNA 1D5YA 1UMQA 3SDGA 1Z0XA 2HDDA 1POGA 5J1UA 5J1YA 3MN2A 2QF7A 1OFCX 3G1LA 2GLOA 5GP9A 3BT9A 1H88C 3Q0UA 2L0KA 1IG7A 2P81A 1B8IB 1JKOC 2LR8A 4RBOA 3BR6A 1IDYA 1FTTA 1RPWA 1VNDA 2LVSA 3B6AA 3L1PA 2XGDA 3CMYA 5F1JA 3CCYA 2ME6A 1SFOJ 3M4OJ 3BTLA 2XGCA 2Y30A 3BR3A 3F0CA 1OCTC 1ETYA 4JP0A 2CU7A 5M5XJ 5IYBJ 1LE8B 3S17J 5E3LA 1GV5A 3GTOJ 3JRCA 3A03A 2DN0A 1GVDA 4C2MJ 1QVUA 2JN6A 2OF7A 2PMZN 5IP7J 1RKTA 3Q0WA 3GBGA 1ITYA 3VPRA 2XPVA 3DEWA 2NOGA 3SJMA 1ZK8A 5DS9A 4RDUA 5K7FA 3A01B 3G1MA 5GPAA 5IOZA 4C3JJ 1FJLA 1JGGA 3BR1A 1Y1WJ 1NK3P 3M3YJ 3W6VA 3HKZN 4A3LJ 1MBJA 4MFEA 4CYCA 2LY9A 3BR2A 1XS9A 1K83J 2DMPA 1P7JA 3GTMJ 4MFDA 5JLWA 1ENHA 1HCRA 2Y0SN 1B8IA 5EGOB 1F43A 1K61A 1I6HJ 1A6IA 4GFBA 1O4XA 3LOCA 3JRHA 2JA5J 2DMUA 3JRBA 3JRAA 1LFUP 1QVTA 2EH3A 3ZQCA 4BY1J 2IBDA 3A02A 2CUEA 1LE8A 2M9HA 5C44J 3BG5A 3OOUA 1HF0A 4NDLA 2DTZA 1S7EA 1Y1VJ 1ETXA 3GTGJ 1TWCJ 2KDZA 3WHCA 4BBRJ 2GBYA 2DA7A 3RQIA 3Q3SA 1ETOA 3RZOJ 3A01A 2TCTA 2L9RA 3PO3J 2YU9J 5C4JJ 1G2HA 2CUFA 4FISA 1FIPA 4BXXJ 5IYDJ 3E7LA 3JR9A 1HDPA 4DW6A 3HDDA 4IHVA 1VF9A 3TP3A 1MBEA 1HDDC 2DMTA 3BG9A 3HGGA 2I10A 3C2BA 4BY7J 1CQTA 2L7MP 1JKRC 5EGOA 5IPAA 2VKVA 3JRIA 3ZQFA 1ETWA 2XB5A 1FEXA 1IV6A 2H1KA 3H3VK 3SFIA 2MSYA 2JA6J 1JKPC 1MBGA 4DYQA 1ETQA 2XPWA 1NTCA 5FLMJ 2R5YB 1IC8A 1HOMA 3DCFA 4IHXA 2XRLA 4MLOA 4XRSA 3JREA 9ANTA 2GM4A 2HXIA 1JJ8C 1Q1VA 3S1MJ 3RZDJ 4B4CA 2NVQJ 2TRTA 5EEAA 2LKXA 4HNVA 1JUPA 1H89C 5IYCJ 2DA3A 1RKWA 4M6VA 4A69C 3S14J 3IV5A 4XRSG 2LD5A 4IEJA 4A3BJ 1MBKA 5M5WJ 1T56A 4B1RA 2XB0X 2NS8A 5E3MA 4FCYA 1ZGWA 3LSJA 1LFBA 2X9DA 4QIWN 2ID6A 2IEKA 1R9TJ 3TEDA 2B63J 2O7OA 4V2FA 3HBLA 3S15J 2X48A 2CJJA 2K40A 2DMNA 1U9NA 4D5FA 3HOVJ 2L7FP 4L5EA 2COBA 3FIWA 1B72B 2W48A 3FISA 4I76A 1JTXA 1H8AC 4JX5A 4A3EJ 1WCMJ 1ZQ3P 3HOWJ 2VKEA 3QPLA 5F04A 3D1NI 3FK6A 4M3EA 2ECBA 1BL0A 1IRZA 1DU6A 5FLVA 4W97A 4JX6A 2Y2ZA 1WPKA 5F0CA 1JTYA 1ZTRA 5M5YJ 4V2GA 2RAEA 2D5VA 4D5CA 1F36A 1UHSA 1X2MA 2R92J 1FTZA 3PO2J 1T33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I J;  5HOD A;  1JKQ C;  5M3M J;  5IP6 A;  2X6O A;  4A3G J;  2AHQ A;  3TP0 A;  2CQQ A;  1OJL A;  2FD5 A;  2ME0 A;  5GPC A;  2VUM J;  2E1O A;  3LSG A;  5M3F J;  2L7Z A;  2EBI A;  1EF4 A;  2JMW A;  4J19 A;  1IJW C;  2NVT J;  2KT0 A;  2DA4 A;  1TWH J;  3LSR A;  2R5Z B;  1RES A;  1ETV A;  2WV1 A;  1GUU A;  3IH3 A;  3G1O A;  3FKI J;  5FKK A;  4XIC A;  4JX4 A;  5IP9 J;  2M0C A;  2JK3 A;  4X1E A;  1IUF A;  3BTJ A;  3IH4 A;  3HOY J;  1IDZ A;  3OSG A;  3NAR A;  2JWT A;  2Y9Z A;  1WI3 A;  3GTP J;  4DYC A;  2LP0 A;  5C4X J;  2R93 J;  3QPS A;  3H0G J;  3HB9 A;  2JJ7 A;  2MGQ A;  1XG1 A;  3UKG A;  3ZQL A;  4IHW A;  4FE4 A;  2VI6 A;  4AC0 A;  4A3C J;  3CDL A;  1WGX A;  1QPI A;  1JUS A;  3ZOB A;  1AKH B;  4I6Z A;  1TWA J;  2NS7 A;  3JRD A;  3GTQ J;  4M3G A;  5JLX A;  1PUF B;  2XSD C;  4IHY A;  5F27 A;  3TW6 A;  1JUM A;  5J3L A;  2R5Z A;  4M3B A;  1W0U A;  1ORK A;  4JYK A;  2R0Q C;  4A93 J;  5FJ8 J;  1QRY A;  5F08 A;  2NVY J;  1UG2 A;  1P7I A;  4XK4 A;  3O8H A;  2M8G X;  1TWF J;  2YUS A;  4A3D J;  5BNG A;  3CQZ J;  2Y9Y A;  2YS9 A;  3TW7 A;  4AYB N;  2H8R A;  4UUT A;  5EG0 B;  5E3N A;  3BTC A;  1Z77 A;  4LOC A;  1U9O A;  5FKO A;  1GDT A;  2ELK A;  4AUX A;  2M34 A;  2XGE A;  2MW8 A;  4BKX A;  2OPT A;  1GT0 C;  5K7H A;  3LNQ A;  4Y52 J;  2FJ1 A;  3ZQG A;  4MIM A;  5FKM A;  3GTJ J;  2HOT A;  1MBF A;  2DA5 A;  4DYR A;  2K9N A;  1X58 A;  1BA5 A;  3I4N J;  2R5Y A;  3HOZ J;  4BBS J;  1PUF A;  5C3E J;  2HQ5 A;  4A3K J;  4A3M J;  1ZR4 A;  4X6A J;  2XPU A;  2LFB A;  3B6C A;  4CYC B;  1BW6 A;  2FQ4 A;  3BR5 A;  2WB1 N;  2LLK A;  5DTD A;  1U8B A;  2CRG A;  2AO9 A;  3OIO A;  3HOU J;  4EEF G;  3JRG A;  5EYR A;  1MNM C;  3BQY A;  3QQA A;  2IAI A;  2M2E A;  4A3J J;  3HGY A;  2O9L A;  5J1R A;  2R7Z J;  5K7Z A;  1NK2 P;  5EG0 A;  3S1R J;  1VI0 A;  5F0F A;  2N8G A;  5IOY A;  2E2H J;  2K9S A;  3GTK J;  3S2H J;  2DA6 A;  2EZH A;  2QCO A;  5F0H A;  3HOX J;  1JT0 A;  3S1Q J;  3OSF A;  2FX0 A;  3RKQ A;  1IGN A;  2LTP A;  2DJN A;  3IH2 A;  2K9Q A;  1ETK A;  2EQR A;  4UUS B;  1AU7 A;  3JRF A;  3O8G A;  2ECC A;  2CQX A;  2HI3 A;  1MH4 A;  1WH7 A;  1GV2 A;  4B3A A;  1W0T A;  1RET A;  3FK7 A;  4MO7 A;  4QSH A;  1U78 A;  2E2I J;  4W1U A;  1B72 A;  1HLV A;  3S2D J;  3S16 J;  2ID3 A;  4M3F A;  1DU0 A;  5EDN A;  2NVX J;  5EZG A;  1TC3 C;  1TWG J;  4M3D A;  2E19 A;  3MVP A;  2WAQ N;  3BQZ A;  3MKL A;  1RR7 A;  3BR0 A;  1AHD P;  2E2J J;  3PM1 A;  3S1N J;  1XC5 A;  4DZJ A;  3Q0V A;  2EZL A;  5FKL A;  4C3H J;  2Y31 A;  3GTL J;  1A5J A;  1MSE C;  2HOA A;  1BW5 A;  2VPR A;  4UUS A;  2G0E A;  1BJZ A;  3NAU A;  3BG3 A;  1OCP A;  1MBH A;  2HYJ A;  3K7A J;  2HOS A;  1I50 J;  1FIA A;  4FTH A;  4G12 A;  1E3O C;  4D7N A;  1ZKG A;  1YRN B;  3K2A A;  4ABZ A;  3LSP A;  1SAN A;  1ZR2 A;  1MSF C;  2EZK A;  2DA1 A;  2DMQ A;  2MG4 A;  1WH5 A;  3BTI A;  1I3Q J;  5EZH A;  4A3F J;  4XID A;  4FE7 A;  1JJ6 C;  1APL C;  5FKN A;  3WHB A;  4QTR A;  3I4M J;  1JT6 A;  3ZQI A;  2DA2 A;  2EZI A;  2HXO A;  4DZP A;  4C3I J;  2LK2 A;  4D7M A;  2JA7 J;  2O8K A;  5EF6 A;  4XRM A;  3HM5 A;  4S0H B;  1VFC A;  1AKH A;  3ZQH A;  2JA8 J;  3HEF A;  2ZB9 A;  5E3O A;  1MH3 A;  1X2N A;  4Y7N J;  1YRN A;  1D5Y A;  1UMQ A;  3SDG A;  1Z0X A;  2HDD A;  1POG A;  5J1U A;  5J1Y A;  3MN2 A;  2QF7 A;  1OFC X;  3G1L A;  2GLO A;  5GP9 A;  3BT9 A;  1H88 C;  3Q0U A;  2L0K A;  1IG7 A;  2P81 A;  1B8I B;  1JKO C;  2LR8 A;  4RBO A;  3BR6 A;  1IDY A;  1FTT A;  1RPW A;  1VND A;  2LVS A;  3B6A A;  3L1P A;  2XGD A;  3CMY A;  5F1J A;  3CCY A;  2ME6 A;  1SFO J;  3M4O J;  3BTL A;  2XGC A;  2Y30 A;  3BR3 A;  3F0C A;  1OCT C;  1ETY A;  4JP0 A;  2CU7 A;  5M5X J;  5IYB J;  1LE8 B;  3S17 J;  5E3L A;  1GV5 A;  3GTO J;  3JRC A;  3A03 A;  2DN0 A;  1GVD A;  4C2M J;  1QVU A;  2JN6 A;  2OF7 A;  2PMZ N;  5IP7 J;  1RKT A;  3Q0W A;  3GBG A;  1ITY A;  3VPR A;  2XPV A;  3DEW A;  2NOG A;  3SJM A;  1ZK8 A;  5DS9 A;  4RDU A;  5K7F A;  3A01 B;  3G1M A;  5GPA A;  5IOZ A;  4C3J J;  1FJL A;  1JGG A;  3BR1 A;  1Y1W J;  1NK3 P;  3M3Y J;  3W6V A;  3HKZ N;  4A3L J;  1MBJ A;  4MFE A;  4CYC A;  2LY9 A;  3BR2 A;  1XS9 A;  1K83 J;  2DMP A;  1P7J A;  3GTM J;  4MFD A;  5JLW A;  1ENH A;  1HCR A;  2Y0S N;  1B8I A;  5EGO B;  1F43 A;  1K61 A;  1I6H J;  1A6I A;  4GFB A;  1O4X A;  3LOC A;  3JRH A;  2JA5 J;  2DMU A;  3JRB A;  3JRA A;  1LFU P;  1QVT A;  2EH3 A;  3ZQC A;  4BY1 J;  2IBD A;  3A02 A;  2CUE A;  1LE8 A;  2M9H A;  5C44 J;  3BG5 A;  3OOU A;  1HF0 A;  4NDL A;  2DTZ A;  1S7E A;  1Y1V J;  1ETX A;  3GTG J;  1TWC J;  2KDZ A;  3WHC A;  4BBR J;  2GBY A;  2DA7 A;  3RQI A;  3Q3S A;  1ETO A;  3RZO J;  3A01 A;  2TCT A;  2L9R A;  3PO3 J;  2YU9 J;  5C4J J;  1G2H A;  2CUF A;  4FIS A;  1FIP A;  4BXX J;  5IYD J;  3E7L A;  3JR9 A;  1HDP A;  4DW6 A;  3HDD A;  4IHV A;  1VF9 A;  3TP3 A;  1MBE A;  1HDD C;  2DMT A;  3BG9 A;  3HGG A;  2I10 A;  3C2B A;  4BY7 J;  1CQT A;  2L7M P;  1JKR C;  5EGO A;  5IPA A;  2VKV A;  3JRI A;  3ZQF A;  1ETW A;  2XB5 A;  1FEX A;  1IV6 A;  2H1K A;  3H3V K;  3SFI A;  2MSY A;  2JA6 J;  1JKP C;  1MBG A;  4DYQ A;  1ETQ A;  2XPW A;  1NTC A;  5FLM J;  2R5Y B;  1IC8 A;  1HOM A;  3DCF A;  4IHX A;  2XRL A;  4MLO A;  4XRS A;  3JRE A;  9ANT A;  2GM4 A;  2HXI A;  1JJ8 C;  1Q1V A;  3S1M J;  3RZD J;  4B4C A;  2NVQ J;  2TRT A;  5EEA A;  2LKX A;  4HNV A;  1JUP A;  1H89 C;  5IYC J;  2DA3 A;  1RKW A;  4M6V A;  4A69 C;  3S14 J;  3IV5 A;  4XRS G;  2LD5 A;  4IEJ A;  4A3B J;  1MBK A;  5M5W J;  1T56 A;  4B1R A;  2XB0 X;  2NS8 A;  5E3M A;  4FCY A;  1ZGW A;  3LSJ A;  1LFB A;  2X9D A;  4QIW N;  2ID6 A;  2IEK A;  1R9T J;  3TED A;  2B63 J;  2O7O A;  4V2F A;  3HBL A;  3S15 J;  2X48 A;  2CJJ A;  2K40 A;  2DMN A;  1U9N A;  4D5F A;  3HOV J;  2L7F P;  4L5E A;  2COB A;  3FIW A;  1B72 B;  2W48 A;  3FIS A;  4I76 A;  1JTX A;  1H8A C;  4JX5 A;  4A3E J;  1WCM J;  1ZQ3 P;  3HOW J;  2VKE A;  3QPL A;  5F04 A;  3D1N I;  3FK6 A;  4M3E A;  2ECB A;  1BL0 A;  1IRZ A;  1DU6 A;  5FLV A;  4W97 A;  4JX6 A;  2Y2Z A;  1WPK A;  5F0C A;  1JTY A;  1ZTR A;  5M5Y J;  4V2G A;  2RAE A;  2D5V A;  4D5C A;  1F36 A;  1UHS A;  1X2M A;  2R92 J;  1FTZ A;  3PO2 J;  1T33 A; 
#chains in the Genus database with same CATH topology
 4IQ4 A;  3BG6 A;  1D3Y A;  4LJZ F;  4JK1 X;  2ZJ2 A;  1Z1D A;  4E7J A;  1B59 A;  1FBS A;  4LIT A;  3E5U A;  3TP0 A;  5ED4 A;  2BY2 A;  2IPQ X;  1DPU A;  5BOX A;  1F9N A;  2NVT J;  3COA C;  1MD0 A;  4NB5 A;  1TWH J;  3LSR A;  1I27 A;  2L9S A;  1ETV A;  4S05 A;  1OIS A;  4R8H A;  5HS9 A;  5DCM B;  4ZYE A;  5TRD A;  1EJ9 A;  4NQW B;  3C7J A;  1IUF A;  2D1H A;  3BTJ A;  5FRM A;  2Y48 A;  4G6T B;  5JVT A;  2P5K A;  4KUM A;  5LHI A;  1FSE A;  5ILU A;  3GTP J;  3BP8 A;  4KT5 C;  1X1P A;  1LUJ B;  1DUX C;  3MFK A;  3QPS A;  1JHH A;  2M5W A;  3HB9 A;  2MGQ A;  2QVO A;  3PNY A;  3H9J A;  4AWX B;  1XG1 A;  3LQQ A;  5ICE A;  1Z67 A;  1LNW A;  1IAW A;  2DXI A;  4CO8 A;  3TOA A;  1Y8R B;  3TL4 X;  4FE4 A;  2DPD A;  1IXC A;  4AC0 A;  3CDL A;  1WGX A;  1MGT A;  1QPI A;  4ZC3 A;  1PVE A;  1FBU A;  5H6R A;  1X3W B;  1AKH B;  4G9Y A;  2QZ8 A;  1BR1 A;  3BPX A;  1USS A;  4L0Y B;  2M4K A;  1IN7 A;  2JUC A;  1HSJ A;  1JUM A;  1LEA A;  4JQF A;  1W0U A;  1ORK A;  4GGG A;  5L3B A;  3UNG C;  4A93 J;  5FJ8 J;  4Y13 A;  1D8K A;  5DCM A;  3N97 A;  1P7I A;  4NQW A;  2KZV A;  2WAQ A;  1FYL A;  2DFF A;  1EV7 A;  3QYB A;  3MZY A;  3D5S C;  5EJC A;  2YS9 A;  2EIK H;  5E1X A;  2IGO A;  4UUT A;  2XAH A;  4P96 A;  5E3N A;  1I6X A;  1Z77 A;  3P9K A;  3FKJ A;  4A0Y A;  1U9O A;  2OQG A;  3OS0 A;  2Z99 A;  1GDT A;  2Y75 A;  3DU5 A;  3AL0 C;  3I55 I;  3CJN A;  1P9Q C;  1K6O A;  5FO5 A;  2FJ1 A;  2LSO A;  4MIM A;  3ZQG A;  2X6X A;  5CVV A;  5LGT A;  2H1L A;  2K9N A;  1NHA A;  2MD5 A;  4IPA A;  3I56 I;  2EJR A;  4RAF A;  5KK1 A;  1XTA A;  1IF1 A;  5AON A;  2HOE A;  3BCB A;  2HQ5 A;  4KIB A;  4OIP F;  3FDY A;  3OS2 A;  3JW4 A;  4BXU A;  4P9U A;  1ZR4 A;  1B9N A;  4KJZ A;  3SFZ A;  2FOW A;  3D5R C;  4MGR A;  1TQM A;  3A0H C;  3HHG A;  1Z05 A;  2LLK A;  1U8B A;  3OIO A;  1OCO H;  3HOU J;  2F4M B;  3JRG A;  4IL6 C;  2O03 A;  2IAI A;  2Q8K A;  4A3J J;  1G4D A;  2EIL H;  2HTS A;  1R5I D;  4AYB A;  1NK2 P;  4N4O B;  1EH8 A;  3CO6 C;  2EK5 A;  3BCA A;  3DV8 A;  3ABK H;  3ULQ B;  2N8G A;  2QQB A;  3AG4 H;  3RQ4 A;  3MWM A;  2E34 A;  4PJJ A;  2DA6 A;  2QCO A;  1BC8 C;  3W6J B;  2XSJ C;  1TQP A;  2GOM A;  1KU9 A;  3HOX J;  3S1Q J;  3RPU A;  3OSF A;  1SC7 A;  3SZT A;  2ICW G;  2RDP A;  2VN2 A;  2W7N A;  3HRS A;  1AU7 A;  3MCZ A;  2WAD A;  3ZMV A;  2ECC A;  3PUF A;  1SD6 A;  1WH7 A;  1VQO I;  2ZXI A;  4K2E A;  1GV2 A;  3CJR B;  1RET A;  5LEK A;  4C2U A;  4HX4 A;  1OCC H;  4IX7 A;  4WX9 A;  1U78 A;  4V19 K;  2DU9 A;  3F72 A;  4IKF A;  4JBA A;  3J81 K;  4RGX A;  2R7V A;  3S16 J;  4BXF A;  5IT3 A;  5H20 A;  4ENM A;  1UJ8 A;  4PDK A;  3R0J A;  1J09 A;  4CCJ A;  2V1X A;  3FXU A;  1R6R A;  2E19 A;  3BWG A;  3MVP A;  2WAQ N;  3KLO A;  2WY7 Q;  3MKL A;  1J75 A;  2LH9 A;  2PFB A;  2FRH A;  1XC5 A;  2ZC2 A;  3OYF A;  3FHN A;  4XKV A;  2DOF A;  1TT5 B;  5J4V A;  4ENN A;  1YS7 A;  2GQQ A;  3KP4 A;  2NRA C;  1DGW Y;  4DZJ A;  3Q0V A;  2F2E A;  3I64 A;  3GYH X;  4RAG A;  2HDW A;  1BW5 A;  2VPR A;  3OYB A;  2ADU A;  2P5V A;  2ESN A;  2Y0M A;  1OCP A;  2BYV E;  3CC4 I;  3K7A J;  1ON1 A;  2BEO A;  4XKC A;  2V1U A;  2HOS A;  1TTY A;  1FIA A;  3LAP A;  2ZNZ A;  1BI0 A;  5CKT A;  2HTJ A;  2XVC A;  4G12 A;  4Y33 A;  3RDI A;  3CCL I;  2HWV A;  1E3O C;  1ZKG A;  4JOM A;  2F5E A;  4HZF A;  1YRN B;  5JR3 A;  4LLG F;  5DV5 A;  3CCM I;  3K9T A;  1TLH B;  2HKO A;  4XOT A;  3BJO A;  1QZE A;  1R1U A;  3WE2 A;  2M3A A;  1ZRF A;  2DA1 A;  3LA2 A;  3K1N A;  1QBJ A;  5BS6 A;  3WTZ A;  1D0X A;  5AIQ A;  4KDP A;  3RKX A;  2HEO A;  1U3E M;  4QTR A;  4KMU X;  1JT6 A;  2DA2 A;  2DT5 A;  2LKP A;  3V7C A;  4C3I J;  3LA3 A;  2LBF A;  2LK2 A;  1O7F A;  4D7M A;  3DPT A;  1O3T A;  5LHH A;  3MZH A;  2I8D A;  4BDZ A;  4U87 A;  3B02 A;  3IKV A;  1LVA A;  4XON A;  4XRM A;  2VE9 A;  3K4B A;  2ELJ A;  3CDI A;  1VFC A;  1D5V A;  5J6X A;  4LLN A;  2X0L A;  3ZQH A;  2KRC A;  4KT6 A;  1YG2 A;  2JA2 A;  1SFE A;  1U5T B;  1BI2 A;  4DBR A;  2K3F A;  2XKP A;  1YRN A;  1D5Y A;  1U6G A;  1SAU A;  1E0E A;  1POG A;  5H2F C;  5KHD A;  3H9Q A;  3GFL A;  2YSR A;  3U21 A;  5J47 A;  2GLO A;  2QQ8 A;  2EFW A;  4A0X A;  3FXK A;  2A07 F;  1H88 C;  1IN8 A;  3PNT A;  2P81 A;  3SEZ A;  1B8I B;  4LB6 B;  2LR8 A;  5FRN A;  2VON A;  1FTT A;  1VND A;  1A31 A;  3ERM A;  3VOE A;  1SFO J;  3BR3 A;  4ZTF A;  3T8R A;  3V8K A;  4RB3 C;  4JP0 A;  2CU7 A;  4CCM A;  5L3F A;  2I5U A;  4M9Z A;  1BN5 A;  3ECH A;  4F91 B;  3BZK A;  2E71 A;  4HPQ A;  4M9S A;  2PMZ N;  4L9V A;  3T5X A;  5FFZ A;  3KP7 A;  1ITY A;  3DKY A;  1I1G A;  5CLS A;  1LFP A;  1PYV A;  3L2W A;  1DGR M;  5K7F A;  1U5T A;  4DJA A;  4M6Y A;  3A01 B;  5GPA A;  4HST A;  1FJL A;  4C3J J;  2WC2 A;  5D8L B;  5KNL A;  1JGG A;  3M3Y J;  3DF8 A;  5FB2 A;  2HPM A;  4MFE A;  2JQ7 A;  4A3L J;  2LY9 A;  3E5X A;  3FXQ A;  2EV0 A;  3VYU B;  4CYD A;  4ZDL A;  2DMP A;  1P7J A;  2GXG A;  3J81 Z;  1ENH A;  1B8I A;  4CCO A;  3PIP F;  4RB0 A;  2PI0 A;  3OYH A;  3JAM Z;  4N0B A;  1R5H A;  3DBL B;  3TO9 A;  2VKD A;  4A0Z A;  4IHS A;  1QVT A;  3WGG A;  4AIK A;  3ZQC A;  2AQF A;  3REO A;  2K4J A;  2BHZ A;  2VL8 A;  5C44 J;  3AKZ A;  5GAH J;  3OOU A;  3GFM A;  5DDG A;  1Z3X A;  2IS1 A;  4NDL A;  4OU0 A;  4LG0 B;  1Y1V J;  1P4W A;  2P5L C;  4HNT A;  2V6E A;  1KU7 A;  2H6B A;  4KN4 X;  2F5C A;  5A2Q K;  2BVM A;  4HRI A;  1ETO A;  3RZO J;  3C2H A;  1T98 A;  3A01 A;  2PQ8 A;  4P9F A;  3WU2 C;  2L9R A;  2EA4 A;  4L9N A;  2DTR A;  1WVR A;  3V42 A;  3CME I;  2CUF A;  5IYD J;  2EV6 A;  1HA8 A;  4IHV A;  3PUB A;  2K5C A;  2LYC A;  1MBE A;  4BEH B;  3E6B A;  2DMT A;  2ZXJ A;  4GYI A;  1CQT A;  2L7M P;  3KE2 A;  2X1C A;  1QHG A;  3RKY A;  3KZZ A;  2VKV A;  4FQG A;  4XSZ F;  1IV6 A;  3K1P A;  3DEU A;  3BG7 A;  3G71 I;  2JA6 J;  3IAS 2;  4DYQ A;  1ETQ A;  3I59 B;  2XPW A;  1IC8 A;  1WJA A;  2CS3 A;  3DCF A;  3LMM A;  4LG0 A;  1R49 A;  3PQK A;  4MLO A;  3WTW C;  3JRE A;  2E5N A;  1QHH D;  3OYC A;  3OL4 A;  2GM4 A;  3M8F A;  1BIB A;  1RI7 A;  3S3M A;  1Q1V A;  1SEU A;  4FX4 A;  3I71 A;  4U7D A;  3GWZ A;  1UZC A;  1B6A A;  4BU2 A;  3CUQ C;  3HXL A;  4FX0 A;  4IJA A;  2E60 A;  2XF6 A;  1UB9 A;  2KIU A;  4YIF A;  2JRM A;  1JE8 A;  1FOW A;  4A69 C;  3IV5 A;  4XRS G;  1UHM A;  1EKE A;  3M9A A;  4A3B J;  1T56 A;  2YPR A;  4FCY A;  4BEH A;  2RNG A;  2X51 A;  4XLA A;  4Q4Z F;  2HR3 A;  2MH2 A;  4UB6 C;  3TOB A;  1LFB A;  4UNO A;  1R9T J;  2GOX B;  1FC3 A;  3TED A;  3KEO A;  1LDJ A;  4V2F A;  3VYT B;  1U8R A;  5KCM A;  1D8J A;  1STZ A;  1KU3 A;  4CSW A;  3PNV A;  5D5V B;  1R22 A;  3I59 A;  1ZAR A;  2JPB A;  4B47 A;  4D5F A;  2HFH A;  3FF5 A;  3GLL A;  3HOV J;  1KQ0 A;  3K2Z A;  3FX3 A;  4YG2 F;  5CQE A;  2ACJ A;  2V4J C;  3FIW A;  4WWC A;  1B72 B;  3L2U A;  3ZGK A;  2KKO A;  1H8A C;  2HQA A;  4JX5 A;  3EUA A;  5ILS A;  4A3E J;  2W25 A;  3WGI A;  3VYR B;  2ZNY A;  4MTE A;  4E4H A;  1FNN A;  3MKW B;  1PP8 F;  5F04 A;  1C0W A;  1IRZ A;  1DU6 A;  2EV5 A;  4WXH A;  3RSN A;  5FLV A;  1OLT A;  1WPK A;  2L2O A;  1T0F C;  3BRO A;  1JTY A;  5F0C A;  2L7K A;  3S93 A;  3V8J A;  3X2Q H;  4BQN A;  1H0M A;  1YQA A;  2W4S A;  2RAE A;  4J00 A;  2D5V A;  4YII A;  1WJE A;  2FE3 A;  1F36 A;  2UXX A;  1HW5 A;  2HVR A;  4Q48 A;  1UHS A;  1XGO A;  2R92 J;  2VB6 A;  1FTZ A;  4M3B A;  4BQQ A;  2KZG A;  1YHQ I;  4CHU A;  2EFN A;  3H92 A;  4M6X A;  2ZSH B;  4C9Y A;  2DCE A;  5E8G A;  1I39 A;  2M7A A;  5FFX A;  5HDN A;  2V9P A;  5FGM A;  2EBI A;  3HRT A;  4PFP A;  3QAH A;  1IZ1 A;  1MNE A;  3L09 A;  2CW0 F;  4XN0 A;  3FXJ A;  4HX8 A;  1IXS B;  2R5Z B;  1VQN I;  3G73 A;  1YW8 A;  1MDM B;  1GUU A;  3LST A;  3IH3 A;  4B44 A;  5A2Q Z;  4HQE A;  4G7H F;  2M0C A;  4X1E A;  4C30 A;  2GAU A;  3GFI A;  4CZZ A;  1IDZ A;  4HW0 A;  3DP7 A;  2JWT A;  2LP0 A;  5C4X J;  3OMY A;  2QUF A;  3OYA A;  2JJ7 A;  1HST A;  3TO7 A;  3UKG A;  3FWE A;  2AQE A;  2CUJ A;  1RUN A;  1HC8 A;  5DD4 A;  3WGH A;  1YLF A;  3NWT A;  1S9H A;  4I6Z A;  2IP2 A;  2NS7 A;  4XLC A;  5LFA A;  4LIU A;  4M3G A;  3RIR A;  1TBX A;  2CW8 A;  5JLX A;  3N4M A;  3L2C A;  1V5G A;  4IHY A;  3TW6 A;  4II3 A;  1W5C C;  2DQL A;  5J3L A;  2R5Z A;  3R4K A;  4YFN F;  3GW2 A;  1L0O C;  1R36 A;  1NH3 A;  2P8T A;  1FYK A;  2ZME C;  4HV5 A;  3P7N A;  4Z6Y A;  1OYY A;  1PUE E;  3G2B A;  4KYW A;  4A3D J;  6PAX A;  2Y9Y A;  1MMG A;  2XF7 A;  3HPH A;  1ONV A;  2CV0 A;  2H8R A;  5E17 F;  2R3S A;  2CV1 A;  3FMS A;  1I5Z A;  1IRG A;  2M34 A;  2MW8 A;  1XX5 A;  3OY9 A;  2XKO A;  4CCN A;  2WY8 Q;  1Z3Y A;  2BY0 A;  2E5Z A;  2CH0 A;  2IS4 A;  2QGU A;  3P9C A;  5LD2 C;  3GTJ J;  1R4M B;  2XAQ A;  1MBF A;  2DA5 A;  2PG4 A;  5JHU A;  2QSF X;  1X58 A;  5ILV A;  1S5L C;  2R7S A;  1E3H A;  1U2W A;  3K0L A;  3EYY A;  4EGZ A;  1N77 A;  3I4N J;  2VQH A;  2KIM A;  3OIP A;  4LLL A;  4A3K J;  2XC7 A;  4X6A J;  3CMA I;  2XPU A;  2VJI A;  3G3Z A;  4OMZ A;  3B6C A;  5TGT A;  1FPQ A;  5DM6 F;  3P5J A;  4CYC B;  1BW6 A;  5CVJ A;  5DTD A;  3EUK L;  1WQ2 A;  4HYE A;  4PK4 A;  2LRE A;  4EEF G;  2ESH A;  5D4R A;  2CQK A;  5EYR A;  1IN6 A;  1GVJ A;  3ZRG A;  2ZJQ F;  3ZQ7 A;  2DO7 A;  3W3C A;  2LY2 A;  2P7C B;  5F0F A;  2M1B A;  4FET A;  3PSI A;  3VSK A;  3L2Q A;  1O3R A;  4X0G A;  2JUG A;  4RAY A;  1Y6I A;  2DYR H;  5DEQ A;  4IOA F;  2KHM A;  2LF8 A;  2DLL A;  4U0W A;  2DJN A;  2K9Q A;  2XAS A;  4Y17 A;  3L2R A;  3J7Y J;  2IW5 A;  2ELH A;  2QEX I;  4IO9 F;  4A6D A;  1WWX A;  1TNT A;  2OC6 A;  1TNS A;  1IRF A;  1QQI A;  2QSG X;  3J7Z I;  1KA8 A;  2VT3 A;  2VXZ A;  2CFX A;  4KNY A;  3IC7 A;  2HGC A;  2VBX A;  3F21 A;  2E2I J;  2D1V A;  5LGU A;  3FXM A;  5LEJ A;  1BI1 A;  1J5Y A;  3DQV C;  4I0A A;  5E79 C;  2MFZ A;  2H27 A;  2JZY A;  1V5F A;  1W7P D;  2ID3 A;  2IT0 A;  4M3F A;  1DU0 A;  3GLX A;  1D1A A;  4PGG A;  1FYM A;  2NVX J;  4IOC F;  3U9G A;  2ZKZ A;  2BV6 A;  1MKM A;  3ZQQ A;  4BJT A;  3K10 A;  1RR7 A;  2J5O A;  1WRJ A;  1AHD P;  3I54 A;  2E2J J;  3PM1 A;  4FAS D;  2Z2S B;  4CH7 A;  1FWZ A;  1J59 A;  3BC8 A;  5E20 A;  3ROU A;  2V9K A;  1MMD A;  4MEY F;  1SFX A;  2HQN A;  3H1C A;  1MIJ A;  2QM3 A;  3OYE A;  2BW3 B;  5FKL A;  1WJC A;  2Y31 A;  2VOP A;  1MSE C;  3Q9S A;  4HDV A;  1BJZ A;  2ETH A;  3KIO A;  3BG3 A;  3OV8 A;  1ZG1 A;  2IGK A;  3E3V A;  4ZTJ A;  3HUG B;  1WZ2 A;  1I50 J;  2R7X A;  3EQL F;  4OWR B;  1OYI A;  1KU2 A;  2LF7 A;  2MA3 A;  5HS8 A;  5D5X B;  2EA2 A;  3FBN B;  2FNP A;  3QYF A;  4ABZ A;  2L02 A;  1ZEL A;  3LSP A;  2ZXH A;  1SAN A;  3D5L A;  5FLX K;  2B0L A;  2FXA A;  4IXA A;  1JHF A;  3CMM A;  4A3F J;  2M87 A;  4XID A;  3H0D A;  3I4M J;  1ON2 A;  1W1W E;  2EZI A;  3HJE A;  4CZC A;  4MNU A;  3H3Z A;  3E0J B;  5CJ9 A;  5FRO A;  3PJR A;  2E1N A;  3K4N A;  4HAM A;  3JTH A;  2A5W A;  2IXS A;  3M1C A;  1FSH A;  1FZP B;  2BW3 A;  4A6E A;  2BXY A;  1FOK A;  1LDK B;  2R7Q A;  5EF6 A;  1BM9 A;  2ZFW A;  5CPR B;  4S0H B;  5L3E A;  1AKH A;  3CF5 F;  2JA8 J;  3EUH C;  3RI4 A;  1Z9C A;  4UV8 A;  3I3L A;  3GVA A;  3KP2 A;  4Y7N J;  4FHT A;  3HTS B;  4EJW A;  1XMA A;  2VT2 A;  4RA2 A;  2GA2 A;  2DAO A;  3KZY A;  4MQ9 F;  3MN2 A;  1OFC X;  1ZGJ A;  1IRX A;  3MKZ A;  2OCE A;  1PP7 U;  4B3X A;  1IG7 A;  1D0Z A;  4IQJ A;  3IWF A;  3NWS A;  1RNL A;  1JKO C;  2DOA A;  4CUG A;  3AL0 B;  4RBO A;  3I9V 2;  5HDK A;  1OCZ H;  2FUG 2;  1PDN C;  1RPW A;  2A6E F;  1XD7 A;  3B6A A;  2W57 A;  3F6O A;  2GWR A;  3F8F A;  3HL2 A;  3M4O J;  3HHH A;  2XGC A;  2Y30 A;  3F0C A;  4ZYD A;  3WTS C;  4M9X A;  2MYS A;  3WTT C;  5AIP A;  3RCO A;  4RAZ A;  3F8N A;  3S17 J;  3WOD F;  5E3L A;  1GV5 A;  1HQC A;  1I1S A;  2FBI A;  1GVD A;  2GA1 A;  2LMD A;  4C2M J;  4E7I A;  1TT0 A;  1RKT A;  4XSX F;  3Q0W A;  3GBG A;  3ZXS A;  2XPV A;  4GYG A;  4E6K G;  1Q1H A;  3ESW B;  4ZDO A;  3JSP A;  2COM A;  3SJM A;  3CCV I;  1S8N A;  5ICC A;  1JI8 A;  1P92 A;  1G3T A;  4WXC A;  2BZT A;  1NK3 P;  2KPM A;  4XBF A;  1MBJ A;  4YIR X;  2JPC A;  3BR2 A;  3DXJ F;  4II2 A;  1XS9 A;  5F64 A;  2MLK A;  4UVC A;  4BH9 A;  2BHY A;  2RRE A;  5JLW A;  3K4K A;  2DJI A;  4HG2 A;  2Y0S N;  3F23 A;  1I6H J;  3HYI A;  1HW1 A;  4NUB A;  3JRH A;  3BJ6 A;  3ISP A;  1EH6 A;  3H5A A;  3QOP A;  3F6V A;  3PFI A;  3LSI A;  5DCF A;  3E6D A;  2EH3 A;  3CES A;  1O3Q A;  2CUE A;  1UEL B;  2M9H A;  2ISY A;  4Y3O A;  3R6S A;  2EB7 A;  2F48 A;  3B73 A;  3J7A O;  2ZFU A;  2Z33 A;  3EYI A;  1TWC J;  2PMZ A;  2NAZ A;  3H9G A;  3R0A A;  2GBY A;  2DDA A;  3Q3S A;  1KYZ A;  1CF7 B;  2YU9 J;  5C4J J;  1G2H A;  1MZB A;  3QYE A;  3JR9 A;  3OS1 A;  3HDD A;  3OL3 A;  1BOA A;  2KFD A;  3SHF A;  3ASO H;  3BG9 A;  2I10 A;  3JSO A;  1B1B A;  1JKR C;  1OMI A;  3F22 A;  5IPA A;  2DW4 A;  1U0J A;  3LSM A;  2XB5 A;  2VKH A;  1KQ9 A;  1FP2 A;  5FLX Z;  3SFI A;  1YIT I;  3CC2 I;  3ZP5 A;  1XDU A;  1DPR A;  5J4Y A;  1NTC A;  2R5Y B;  1MMS A;  1FP1 D;  2A5Y B;  2O8X A;  2XRL A;  4XRS A;  4Y4R A;  9ANT A;  1ZAO A;  2K85 A;  2K27 A;  1D1C A;  3OYM A;  1ZHF A;  4ZYG A;  5E18 F;  1JJ8 C;  3S1M J;  3RZD J;  4P1W A;  2TRT A;  5L3C A;  2A6T A;  1K78 B;  1T6S A;  2IGM A;  1JUP A;  2ZBK A;  1H89 C;  1CF7 A;  5IYC J;  1N75 A;  1UHW A;  3S2W A;  1ZH5 A;  2Z1D A;  3S14 J;  4N9I A;  2E1C A;  3E97 A;  2TDX A;  3MKY B;  4QIW N;  4XR6 A;  2HVQ A;  4HF2 A;  5D4S A;  5EEG A;  3S8P A;  2LKS A;  5J40 A;  4IRH A;  2PJR B;  1OCR H;  2CJJ A;  2K40 A;  4EJT A;  1X3U A;  1PJR A;  1X1B A;  4DNC A;  4RGR A;  2XAJ A;  2OCC H;  2AS5 F;  3HOS A;  4QPQ A;  4L5E A;  1TP4 A;  1JTX A;  1X4O A;  1V5E A;  4AIH A;  2F6C A;  1K78 A;  3H35 A;  3HPG A;  2BE5 F;  4BYY A;  2X1D A;  1TL8 A;  3MZ8 A;  1WKM A;  2O0Y A;  4QWQ A;  1G3W A;  4W97 A;  3E6C C;  4JX6 A;  4O6J A;  3BY6 A;  1ZTR A;  5M5Y J;  1V55 H;  4V2G A;  3RPQ A;  5ERI A;  3TMO A;  1D1B A;  1BI3 A;  2BOL A;  3I53 A;  1TZL A;  2PN6 A;  4D5C A;  3IRR A;  1R71 A;  2W1O A;  1X2M A;  2QSH X;  2IA0 A;  1P2F A;  3PO2 J;  4BE2 A;  5HOD A;  4FT8 A;  5M3M J;  1JKQ C;  3CJQ B;  3CCR I;  3J7A Y;  4U88 A;  3ML6 A;  4U7B A;  1YW7 A;  2K9L A;  2M30 A;  3ZR8 X;  2AHQ A;  3K4L A;  2AXL A;  4PCQ A;  4O5V A;  3A0B C;  3GX4 X;  1OJL A;  4NC8 A;  2HQR A;  2ME0 A;  4EAT A;  2OU2 A;  5GPC A;  4AVP A;  2E1O A;  4ZYA A;  3LSG A;  5M3F J;  3CC7 I;  2DK5 A;  4U0Y A;  4D0P A;  1EF4 A;  3IUO A;  3SYT A;  4QLC U;  2JMW A;  1WJD A;  2X4H A;  2PJP A;  4O3M A;  1SFK A;  1TW2 A;  1HW2 A;  3EPZ A;  1RES A;  1SFU A;  4OOI A;  4EM0 B;  1KQ8 A;  4NBQ A;  5FKK A;  4XIC A;  2EIJ H;  4JX4 A;  5IP9 J;  2KMU A;  2JK3 A;  4XRF A;  3IH4 A;  1VQ6 I;  5DM7 F;  2A05 A;  2KJB A;  2X6Y A;  1VQP I;  3HOY J;  4E7K A;  3TDZ C;  4PUS A;  2Y9Z A;  1T95 A;  2ZCW A;  1FOY A;  4DYC A;  3DBR B;  2X6W A;  1VQK I;  2ZO4 A;  2R93 J;  1GXQ A;  2V7F A;  2NYX A;  4XLH A;  1ZGA A;  3KP3 A;  4F7Z A;  2IRF G;  1S72 I;  4HLX A;  2XAF A;  2R7W A;  5TIS C;  2P0W A;  1OR7 A;  4IHW A;  2VI6 A;  3CP2 A;  4A3C J;  2P7V B;  1JUS A;  1HBX G;  1ERD A;  3WE3 A;  1TWA J;  3H5N A;  3GTQ J;  4LD5 A;  4AID A;  1SVM A;  3KYL A;  4I0B A;  5D6F A;  1QNT A;  4LK0 F;  4PJ0 C;  1BJA A;  4JYK A;  2R0Q C;  1Z91 A;  1T38 A;  4BHP A;  4B43 A;  2V6C A;  4LIV A;  1QRY A;  5F08 A;  1SMT A;  3M07 A;  4XN3 A;  1LJ9 A;  1UG2 A;  2M45 A;  4XK4 A;  3O8H A;  1WI9 A;  3CDH A;  4GXO A;  1YJN I;  4HF1 A;  2M8G X;  1TWF J;  4G6Q A;  2YUS A;  2CGP A;  4NC7 A;  1QU3 A;  5BNG A;  3CQZ J;  4HBL A;  4B09 A;  1XMK A;  3SZG A;  5EG0 B;  2CWE A;  1KYW A;  5D8K B;  1DDN A;  4YFX F;  2FA5 A;  1R23 A;  4AUX A;  4I98 B;  3J80 K;  1SD5 A;  4CCL A;  2JVH A;  1YTY A;  3LNQ A;  2A6H F;  2HOT A;  3O3K A;  5TJJ A;  1N25 A;  5GAG J;  5JFR A;  2DQR A;  4KFC A;  2IA2 A;  3LFK A;  4BBS J;  2CQN A;  2IA1 A;  3RKW A;  3VB2 A;  1S7O A;  2QLZ A;  2H09 A;  2NVU B;  1FY7 A;  3CUQ B;  5B1B H;  2RQP A;  1YI2 I;  2P6T A;  2FSW A;  2MD0 A;  3ZMZ A;  4G8X A;  1IN5 A;  1KON A;  2FML A;  3TO6 A;  2JT1 A;  2V1N A;  5B1A H;  3ZN0 A;  5GAD J;  3WTV C;  1MNM C;  3QQA A;  2O9L A;  2A3S A;  3HGY A;  4BJ5 C;  2R7Z J;  4BAC A;  3KYC B;  3OYD A;  3M7G A;  5EG0 A;  2M4G A;  1VI0 A;  5CYV A;  5IOY A;  2E1M C;  1TW3 A;  1E3P A;  2M7B A;  3HTU A;  2E2H J;  3GTK J;  2A61 A;  1D0Y A;  1XPX A;  1V54 H;  4F52 A;  2H94 A;  3GXO A;  1QGP A;  3ONQ A;  3UR3 C;  2LTP A;  1K79 A;  4GO1 A;  3T0Y A;  4E7S A;  1W7P B;  4UB8 C;  3IH2 A;  4HA8 A;  4IVN A;  2KLO A;  3I4P A;  2OJE D;  3TDU C;  4UUS B;  1G3Y A;  3EDP A;  3JRF A;  4Z2Y A;  2BVL A;  2HI3 A;  1J2X A;  2R7T A;  5HOO A;  3C3W A;  2WWY A;  2LC2 A;  1SVL A;  2FMY A;  4B3A A;  4IRI A;  1W0T A;  2LOO A;  3FK7 A;  2Q1Z B;  2EIM H;  1XCB A;  2DFH A;  4RGU A;  4HOB A;  4DIQ A;  4W1U A;  1B72 A;  4DBQ A;  4KIS A;  1HLV A;  4UHT A;  5CVI A;  4UV9 A;  5EDN A;  4G6D A;  5EZG A;  1TWG J;  1YFH A;  4ITV A;  3VOD A;  1RR8 C;  4M3D A;  2F4I A;  2L4A A;  4ZZD A;  2O3F A;  2KQR A;  4ESB A;  2A68 F;  4ENK A;  3DKX A;  1VQ8 I;  4HF0 A;  3R61 A;  2YR2 A;  5GAE J;  4EJO A;  1ZRE A;  2EZL A;  4P55 A;  1W7P A;  2LNB A;  3VFZ A;  4D1Q A;  3GTL J;  1H9G A;  1QPM A;  3U1K A;  4UUS A;  3LSK A;  2G0E A;  3NAU A;  2QKM B;  5ICF A;  4BS9 A;  1DP3 A;  4RS8 A;  3DWL E;  2QWW A;  2HYJ A;  4HX7 A;  3T1B A;  3MD2 A;  2X1E A;  3A2K A;  4I2O A;  3S3N A;  3GFJ A;  4D7N A;  3LSH A;  4BJ6 C;  5HDG A;  2HNH A;  1EA3 A;  3A1Y A;  3K2A A;  1YX3 A;  3AG2 H;  1N78 A;  4I7H A;  3VEP A;  1Z6T A;  1MDM A;  2STT A;  3SXY A;  1YIO A;  1ZR2 A;  3SEQ A;  3BPV A;  2KDO A;  1J0R A;  1WH5 A;  3BTI A;  2KP6 A;  1I3Q J;  5EZH A;  2DFI A;  2O5R A;  1S29 A;  2EFP A;  3WHB A;  3ZQI A;  3DTK A;  2HXO A;  3CF2 A;  4DZP A;  3GZ5 A;  5KAI C;  1X19 A;  3NQO A;  2WAE A;  4AM3 A;  3F8C A;  1F4K A;  2LY1 A;  4DQ2 A;  3BLY A;  3K1M A;  2O8K A;  2DBB A;  3LL7 A;  3J80 Z;  1A35 A;  2Q0O A;  1LPQ A;  4OMY A;  2M8E A;  2R7O A;  1J9I A;  4CA0 A;  1P4A A;  2NXN B;  4EM2 A;  2KRH A;  2K9M A;  4EJU A;  5CVU A;  2DFE A;  1UCR A;  2QBY B;  1IW7 F;  3HEF A;  1HKT A;  5E3O A;  5B66 C;  1MH3 A;  2ZME B;  2CV2 A;  3ABL H;  3VYS B;  4AIJ A;  4LB5 A;  2MAB A;  4UVA A;  3GUD A;  5J1Y A;  2L01 A;  2L5Q A;  2OAZ A;  2MC4 A;  2XDV A;  2QF7 A;  4Q5S F;  3G1L A;  1R58 A;  5GP9 A;  3Q9V A;  3BT9 A;  2VQL A;  5LGN A;  4CGZ A;  3Q0U A;  2DT7 B;  2L0K A;  1UST A;  1B4A A;  3HIF A;  4A5M A;  1VQM I;  2CG4 A;  3K4J A;  3KET A;  2ZXW H;  3ABU A;  4ENJ A;  3BR6 A;  2IJL A;  1IDY A;  2RV8 A;  1KZH A;  1ZLK A;  4CCK A;  2VE8 A;  2XGD A;  1LVK A;  5F1J A;  3CMY A;  4ZDP A;  3W2V A;  4BE1 A;  5H6Q A;  1SMY F;  2FEZ A;  2L54 A;  3BTL A;  4YEJ A;  2M0M A;  3TGN A;  1OCT C;  1X1C A;  2FF4 A;  3JRC A;  3A03 A;  2DN0 A;  2WAF A;  3QP6 A;  1B9M A;  2JN6 A;  5IP7 J;  3ERE D;  5JHF A;  2QYO A;  4M72 A;  4G7Z F;  3I0T A;  1R7J A;  4OAZ A;  3DU6 A;  2QBY A;  3DEW A;  3F8B A;  2OZ6 A;  1ZK8 A;  5DS9 A;  1ODD A;  5L3D A;  3W2W A;  3KCC A;  1G59 A;  2ZME A;  3DTE A;  3G1M A;  4G94 A;  3HRU A;  2WTE A;  2ZSI B;  2BGC A;  2VBZ A;  3C2G A;  1Y1W J;  1X3Z B;  4HNU A;  3HZJ A;  2XRO A;  2YX4 A;  4EJV A;  4CYC A;  4XLF A;  3E1S A;  1R4N B;  1K83 J;  2CFO A;  2XHK A;  2B9S A;  4PJL A;  3GTM J;  2OTL I;  2UXN A;  1HCR A;  5HVQ C;  3BZC A;  2VC0 A;  4KN7 X;  3CJT B;  4A2U A;  1K61 A;  4UUV A;  5E8I A;  4GFB A;  1O4X A;  4YRV A;  2DYS H;  3JRB A;  3ZMU A;  1XSX A;  1RUO A;  1LFU P;  3K70 C;  4BY1 J;  2IBD A;  3A02 A;  4I02 A;  1ZRD A;  3GCM A;  5DD8 A;  1BC7 C;  3KLN A;  4PZJ A;  1S7A A;  1HF0 A;  2DTZ A;  1S7E A;  3ELK A;  3IAM 2;  1ETX A;  1Z6R A;  5K5R A;  4J01 A;  4KIF A;  2H6C A;  3GTG J;  2KDZ A;  3JCU C;  3WHC A;  4BBR J;  5CVR A;  3W2A A;  4QPO A;  3Q5F A;  2R7F A;  4E7Z A;  3IRQ A;  1ZG3 A;  2WV0 A;  1FMV A;  2XRN A;  3OIQ A;  2TCT A;  1ZRC A;  2KRF A;  4LK1 F;  4F3Q A;  2K3P A;  4BXX J;  5HNH A;  4MHG A;  1YIJ I;  1HDP A;  4DW6 A;  1QA6 A;  3FHZ A;  2W24 A;  1VF9 A;  1DP7 P;  4YEL A;  3TKY A;  1IO2 A;  4RLF A;  3GME A;  3MAJ A;  1DQU A;  1HDD C;  4NC6 A;  3JTG A;  3HGG A;  3C2B A;  2Y0S A;  3PL8 A;  1LEB A;  4MQV A;  2CW7 A;  2F5D A;  3I5U A;  2H1K A;  3H3V K;  1NG7 A;  2MSY A;  3MMY B;  4PFO A;  5L3G A;  1JKP C;  1MBG A;  1VQ4 I;  1T08 B;  1G6N A;  5FLM J;  2DOE A;  2HS5 A;  2Y69 H;  2P4W A;  3OYN A;  4IHX A;  1BOB A;  1Y8Q B;  4BQO A;  3PFY A;  1UAA A;  2BY1 A;  1WHU A;  4HDU A;  2NVQ J;  1QZZ A;  2VOO A;  1BBY A;  4HQM A;  5EEA A;  2LKX A;  4HNV A;  3HUG A;  2Z9O A;  2WBM A;  5LRS A;  4PSX A;  1Y39 A;  3OYL A;  2DA3 A;  2DPU A;  1RKW A;  3CO7 C;  4ZJZ A;  2NNN A;  2VPL A;  1LDD A;  1ULY A;  3O6B B;  2LD5 A;  4I99 C;  1MBK A;  3CLO A;  5E3M A;  2XB0 X;  2NS8 A;  3VWB A;  4L0Z B;  4L5J A;  3RYP A;  1MJ9 A;  2QEN A;  2R4G A;  2X9D A;  1F1Z A;  2ID6 A;  2IEK A;  1BR4 A;  2JSP A;  1SAX A;  2W85 A;  4L18 B;  5DYM A;  1ZN2 A;  1W36 C;  5BPD A;  2FNA A;  1O3S A;  4OIO F;  4XNF A;  1FMW A;  3QU6 A;  4MTD A;  4DGW B;  4GRI A;  5K5O A;  3VSL A;  2DMN A;  2JTV A;  2OD5 A;  3ECO A;  2MH9 A;  3N05 A;  2NOJ B;  2UUZ A;  3E6M A;  1FLI A;  1RZ4 A;  4L5I A;  2COB A;  3FIS A;  1P6R A;  2HU9 A;  4F93 B;  4PGH A;  2XAG A;  5D5U B;  1HXD A;  3TBI A;  2CYY A;  4PSW A;  1R5G A;  1WSU A;  4F92 B;  1WCM J;  3QPL A;  3D1N I;  4N4N B;  2ECB A;  1O7L A;  4EMS A;  4BAY A;  4OAY A;  2OTJ I;  3QPT A;  3OR2 C;  3M8J A;  2CUZ A;  2EFQ A;  1RRJ A;  3C1D A;  1XCV A;  1JGS A;  1MMA A;  2LG4 A;  2GIV A;  4HEA 2;  5J8C A;  3F8M A;  2EPF A;  2IGN A;  4A3I J;  1NG6 A;  2OBP A;  5IP6 A;  1QO0 D;  2X6O A;  4Y15 A;  3L00 A;  4A3G J;  1VQ5 I;  2JSC A;  2OA4 A;  2V26 A;  5DUI A;  2CQQ A;  2FD5 A;  2D45 A;  3ABT A;  3AAF A;  2VUM J;  3DLL F;  3M8E A;  5IY5 H;  2K4B A;  2L7Z A;  1XDS A;  1IJW C;  2G9W A;  3AG1 H;  2VLA A;  3EUH A;  4J19 A;  2J5P A;  1IN4 A;  1FX7 A;  2FU4 A;  3FXL A;  2KT0 A;  2DA4 A;  2WB1 A;  2HYG D;  2HZD A;  2V1D A;  1T39 A;  2WA0 A;  3F9K A;  2WV1 A;  1MND A;  5B3S H;  3G1O A;  3A4C A;  3FKI J;  1F5T A;  3WTX C;  2PLY A;  1W4M A;  4M74 A;  3WTU C;  3JAM K;  4OIQ F;  3SZP A;  1LKX A;  4EM1 A;  4PJN A;  2JRT A;  3L9F A;  4XLN F;  3OSG A;  3NAR A;  1WI3 A;  5JI6 A;  2HZT A;  3FXR A;  3P9I A;  2NS0 A;  4XKB A;  1MMN A;  1T2K A;  1WJF A;  4RLQ A;  3H0G J;  3O2P E;  2LBF B;  2RN7 A;  3DBH B;  3CD6 I;  3ZQL A;  1FOX A;  3PIO F;  1MJB A;  3K69 A;  4EGY A;  2JVG A;  2GZW A;  3KFW X;  3DTI A;  5HS7 A;  2K86 A;  1R1V A;  1X1D A;  2P6S A;  3ZOB A;  4AD9 A;  3KYD B;  3CCJ I;  2RNJ A;  5FD6 A;  3JRD A;  3ZPL A;  3V7R A;  4WK8 F;  1KGS A;  3CZ6 A;  5LHG A;  3KZI C;  4BDY A;  5CQG A;  1IV8 A;  2DOD A;  3DPL C;  2XGX A;  2XSD C;  2ZJR F;  1PUF B;  3FBI B;  2DT6 A;  5F27 A;  2R7U A;  3HSR A;  4HV6 A;  2QA4 I;  1XSD A;  2GIZ A;  3BOQ A;  4BE0 A;  4BNC A;  4LFU A;  3K70 D;  4IF4 A;  3V4G A;  2W84 A;  2X85 A;  5HLT A;  5HLH A;  2RVC A;  3CTA A;  1U5T C;  1A04 A;  2NVY J;  3ASN H;  4E7L A;  4CDG A;  3KP6 A;  3DKW A;  4IRG A;  3KPH A;  3OWT A;  3TW7 A;  1XMX A;  4AYB N;  2VQG A;  5ICG A;  3BTC A;  4LOC A;  5FKO A;  5J8F A;  5LRR A;  4D9J A;  1W5T A;  2ELK A;  2HDC A;  2XGE A;  4BKX A;  1GT0 C;  2OPT A;  4XKW A;  3BJA A;  2F4O B;  5K7H A;  3BZ6 A;  4Y52 J;  1AWC A;  3DPU A;  3MQ0 A;  3LAJ A;  5FKM A;  5K5Q A;  2LRD A;  3ZMS A;  4LMY A;  1Y0N A;  4DYR A;  3PQJ A;  2BXZ A;  3SQN A;  2V9V A;  2K02 A;  4EV0 A;  1BA5 A;  3S32 A;  3V8L A;  2R5Y A;  3HOZ J;  2L9N A;  3HSE A;  3IP4 B;  1PUF A;  1FBQ A;  2VC1 A;  5C3E J;  3QP5 A;  2FOK A;  4A3M J;  2EWN A;  4ZZL A;  3CCQ I;  1O57 A;  2LFB A;  1G3S A;  1XSV A;  2HKX A;  4L9J A;  4BHC A;  4EQQ A;  2OQR A;  2FQ4 A;  3BR5 A;  2WB1 N;  2XF5 A;  1T8I A;  3RPU D;  4WXD A;  2CRG A;  1LB2 A;  2AXT C;  2AO9 A;  2PMH A;  3BQY A;  2M2E A;  2KIF A;  4NHJ A;  3V7S A;  5J1R A;  5K7Z A;  3FMR A;  4BHB A;  3S1R J;  2HVS A;  3K4M A;  4U0V A;  3OYG A;  4OIN F;  3WTY C;  1OR7 C;  3S2H J;  2K9S A;  4E70 A;  4M71 A;  2V79 A;  2Z16 A;  3SDB A;  1SVO A;  2EZH A;  3ZCO A;  5F0H A;  2EFO A;  5JVG F;  3G6E I;  1JT0 A;  2E7W A;  2FBH A;  3IHU A;  2FX0 A;  3RKQ A;  1IGN A;  5LBQ A;  2GXA A;  2E35 A;  4HLY A;  2ISZ A;  2QKL B;  3CP8 A;  2CSO A;  1ETK A;  1XN7 A;  2PJR A;  4WF2 A;  2EQR A;  4E7H A;  2MC3 A;  3O8G A;  1A6Q A;  2CQX A;  2QQA A;  1MH4 A;  1W36 D;  2YX7 A;  3CLQ A;  4MO7 A;  4QSH A;  1MJA A;  4L9T A;  1YJ9 I;  3LWF A;  1K7A A;  3LQR A;  4KIG A;  3S2D J;  5IT9 K;  2W82 A;  2H8W A;  2XV4 S;  3OR1 C;  4BQA A;  3E5Q A;  4CXF A;  4KMF A;  3NEU A;  1TC3 C;  3ABM H;  1XB4 A;  2OV7 A;  4P5O A;  1ACI A;  3LA7 A;  2GXB A;  1E17 A;  5HLI A;  3WG7 H;  1WFX A;  2FQ3 A;  3EET A;  2F5V A;  3BQZ A;  4M73 A;  3BR0 A;  3NRV A;  2D2W A;  3LFU A;  3S1N J;  2XUB A;  1L3L A;  4TV7 A;  2CMP A;  4CIC A;  3WU0 A;  4C3H J;  4RMN A;  4XLP F;  3AG3 H;  1A5J A;  3FXO A;  4XLE A;  3L7W A;  2KL4 A;  2HOA A;  1MBH A;  2UWM A;  2EIN H;  3ZMD A;  2Z5U A;  4GCV A;  4FTH A;  3DEE A;  3OYI A;  1REP C;  4KIT B;  3VDX A;  4C2T A;  5DUK A;  3HKZ A;  2R7R A;  2VJ4 A;  1ZLJ A;  4I01 A;  1CGP A;  2KIS A;  4LGW A;  4GDF A;  2B7E A;  2ZJP F;  1XGN A;  1MSF C;  2EZK A;  4ZYH A;  2DMQ A;  2DK8 A;  1YJW I;  2R7D A;  2MG4 A;  4I09 A;  1ZG5 A;  3RJP A;  4AVZ A;  3T8T A;  1HKQ A;  4FE7 A;  1R00 A;  1RC9 A;  3K6G A;  1JJ6 C;  5FKN A;  1APL C;  2DDB A;  2STW A;  1UG0 A;  2RC4 A;  5HNF A;  4AU7 A;  1HKS A;  1YOV B;  2VIX A;  2Q2E B;  5LLQ A;  1AA7 A;  3FM5 A;  1H9T A;  2JA7 J;  4ON0 A;  2MLG A;  2OZU A;  3K4C A;  1A36 A;  3U1D A;  2QQ9 A;  3HM5 A;  1BIA A;  4B8X A;  3QU3 A;  3KX2 A;  4RM3 A;  1X1A A;  3ZN1 A;  2W00 A;  2ZB9 A;  1X2N A;  3IWZ A;  1GHC A;  3AFH A;  3DFG A;  2HYF A;  1UMQ A;  5E1W A;  1Z0X A;  3SDG A;  1VTN C;  2HDD A;  4IHT A;  2PMU A;  1YO5 C;  5D6E A;  5J1U A;  2IS6 A;  3PSF A;  5F6F A;  1MW7 A;  4WCG A;  2L3D A;  5EEH A;  1J7K A;  3HC7 A;  2BBY A;  3U2R A;  4PJM A;  3CCS I;  3FM3 A;  4UVB A;  3DLA A;  2L4M A;  2VJJ A;  2LVS A;  3L1P A;  3OOP A;  3CCY A;  2ME6 A;  2Q2E A;  2C6Y A;  3QOE A;  2E7X A;  1ETY A;  1K4S A;  4XOP A;  3IL2 A;  5M5X J;  1LE8 B;  5IYB J;  4UY8 I;  4IZZ A;  1V3F A;  3GTO J;  4RB2 C;  2O6G E;  3HSF A;  1G8X A;  2OUM A;  2F5F A;  1QVU A;  2OF7 A;  1IXR C;  2O61 A;  4UXN A;  1P4X A;  3FZV A;  4RB1 A;  3VPR A;  2NOG A;  2NNY A;  4KA4 A;  4RDU A;  1UFM A;  3GZN B;  5IOZ A;  1GLN A;  3CUQ A;  1K6Y A;  1Z21 A;  4ANJ A;  3BR1 A;  2K7L A;  3GO5 A;  4B48 A;  3W6V A;  3HOT A;  3HKZ N;  3GF2 A;  4XL9 A;  4RM2 A;  3CCU I;  1YS6 A;  1IUY A;  5F1R A;  4XOR A;  4A12 A;  4MFD A;  2E1M B;  1Z7U A;  2IVM A;  5IT9 Z;  1F43 A;  5EGO B;  5E1Z B;  1A6I A;  3I58 A;  3LOC A;  2JA5 J;  2DMU A;  2CQ7 A;  3JRA A;  1M1E B;  2PX9 A;  1FT9 A;  3QPH A;  4H4K C;  3RTR A;  1LE8 A;  2XAU A;  1W5S A;  4XM3 A;  1VQL I;  3BG5 A;  5HLG A;  3IKT A;  2BY3 A;  2G7U A;  3R60 A;  1Z7L A;  3TQN A;  4XMY A;  2VJ5 A;  2DA7 A;  2VBW A;  3RQI A;  2VAS A;  1VQ7 I;  4N9H A;  3G4S I;  1YYV A;  3MEX A;  4KIC A;  3PO3 J;  4OIR F;  4FIS A;  1FIP A;  5BMZ A;  2HPI A;  3E7L A;  4EVI A;  1EH7 A;  4MEX F;  3GEZ A;  3OYK A;  3TP3 A;  5FD5 A;  4ASN A;  1T0F A;  3CUO A;  3L2V A;  2VBY A;  3HG9 A;  1VZ0 A;  4BY7 J;  5EGO A;  1E2X A;  3JRI A;  3ZQF A;  1ETW A;  3M1E A;  3S3O A;  4YFK F;  2MBF A;  4G7O F;  1FEX A;  3CCE I;  4XQF A;  1YW9 A;  2Z3Y A;  3H3U A;  3QWL A;  2VQC A;  1YE9 A;  5BQT A;  5GTI C;  1HOM A;  4HSR A;  1SD4 A;  5BPI A;  1BR2 A;  1Y56 A;  1ZYR F;  1V4R A;  4ESJ A;  1Y0U A;  2UV1 A;  4A5N A;  1XGM A;  2HXI A;  4B4C A;  2VOD A;  1AOY A;  2DI3 A;  3KEQ A;  4Q47 A;  3KP5 A;  4RGS A;  1X4P A;  1R1T A;  1OPC A;  3FMQ A;  4M6V A;  4NNJ A;  4R79 A;  4IEJ A;  1YX5 A;  5M5W J;  4B1R A;  4BL0 B;  1ZGW A;  5K1Y A;  2IS2 A;  1WJB A;  3WU1 B;  2PEX A;  4R1H A;  3LSJ A;  4F55 A;  3GZ6 A;  5KVR A;  1JXS A;  1S6L A;  1LQ1 A;  2A69 F;  2CO5 A;  1S3J A;  2B63 J;  2O7O A;  3H5R A;  4ETS A;  1QZY A;  3HBL A;  3QOD A;  3HRM A;  3S15 J;  2X48 A;  1OKR A;  2LDU A;  2E36 A;  3W6K B;  4ZH4 F;  1RIO H;  2RGV A;  2VXD A;  1GXP A;  1I3A A;  1WJ5 A;  1U9N A;  3BDD A;  4ESF A;  4S04 A;  4BUP A;  2L7F P;  2XIG A;  3KEY A;  3RYR A;  2W48 A;  4H0E A;  2RKH A;  4I76 A;  2G7H A;  2KIQ A;  4DOZ A;  3ZMT A;  3QRF F;  4BGD A;  2L9V A;  2KJC A;  1SD7 A;  1ZQ3 P;  3HOW J;  5GTH C;  2RQQ A;  2VKE A;  3F3X A;  3FK6 A;  4M3E A;  3D0S A;  3WG9 A;  1BL0 A;  3H36 A;  3C18 A;  3OYJ A;  4LG3 A;  1TQI A;  2Y2Z A;  1VQ9 I;  5KAF C;  2UZK A;  1K4T A;  5B5E C;  5D5W B;  2FBK A;  1XGS A;  1OQY A;  1OYW A;  2YU3 A;  1T33 A;  2PBI A; 
#chains in the Genus database with same CATH homology
 4A3I J;  5HOD A;  1JKQ C;  5M3M J;  5IP6 A;  2X6O A;  4A3G J;  2AHQ A;  3TP0 A;  2CQQ A;  1OJL A;  2FD5 A;  2ME0 A;  5GPC A;  2VUM J;  2E1O A;  3LSG A;  5M3F J;  2L7Z A;  2EBI A;  1EF4 A;  2JMW A;  4J19 A;  1IJW C;  2NVT J;  2KT0 A;  2DA4 A;  1TWH J;  3LSR A;  2R5Z B;  1RES A;  1ETV A;  2WV1 A;  1GUU A;  3IH3 A;  3G1O A;  3FKI J;  5FKK A;  4XIC A;  4JX4 A;  5IP9 J;  2M0C A;  2JK3 A;  4X1E A;  1IUF A;  3BTJ A;  3IH4 A;  3HOY J;  1IDZ A;  3OSG A;  3NAR A;  2JWT A;  2Y9Z A;  1WI3 A;  3GTP J;  4DYC A;  2LP0 A;  5C4X J;  2R93 J;  3QPS A;  3H0G J;  3HB9 A;  2JJ7 A;  2MGQ A;  1XG1 A;  3UKG A;  3ZQL A;  4IHW A;  4FE4 A;  2VI6 A;  4AC0 A;  4A3C J;  3CDL A;  1WGX A;  1QPI A;  1JUS A;  3ZOB A;  1AKH B;  4I6Z A;  1TWA J;  2NS7 A;  3JRD A;  3GTQ J;  4M3G A;  5JLX A;  1PUF B;  2XSD C;  4IHY A;  5F27 A;  3TW6 A;  1JUM A;  5J3L A;  2R5Z A;  4M3B A;  1W0U A;  1ORK A;  4JYK A;  2R0Q C;  4A93 J;  5FJ8 J;  1QRY A;  5F08 A;  2NVY J;  1UG2 A;  1P7I A;  4XK4 A;  3O8H A;  2M8G X;  1TWF J;  2YUS A;  4A3D J;  5BNG A;  3CQZ J;  2Y9Y A;  2YS9 A;  3TW7 A;  4AYB N;  2H8R A;  4UUT A;  5EG0 B;  5E3N A;  3BTC A;  1Z77 A;  4LOC A;  1U9O A;  5FKO A;  1GDT A;  2ELK A;  4AUX A;  2M34 A;  2XGE A;  2MW8 A;  4BKX A;  2OPT A;  1GT0 C;  5K7H A;  3LNQ A;  4Y52 J;  2FJ1 A;  3ZQG A;  4MIM A;  5FKM A;  3GTJ J;  2HOT A;  1MBF A;  2DA5 A;  4DYR A;  2K9N A;  1X58 A;  1BA5 A;  3I4N J;  2R5Y A;  3HOZ J;  4BBS J;  1PUF A;  5C3E J;  2HQ5 A;  4A3K J;  4A3M J;  1ZR4 A;  4X6A J;  2XPU A;  2LFB A;  3B6C A;  4CYC B;  1BW6 A;  2FQ4 A;  3BR5 A;  2WB1 N;  2LLK A;  5DTD A;  1U8B A;  2CRG A;  2AO9 A;  3OIO A;  3HOU J;  4EEF G;  3JRG A;  5EYR A;  1MNM C;  3BQY A;  3QQA A;  2IAI A;  2M2E A;  4A3J J;  3HGY A;  2O9L A;  5J1R A;  2R7Z J;  5K7Z A;  1NK2 P;  5EG0 A;  3S1R J;  1VI0 A;  5F0F A;  2N8G A;  5IOY A;  2E2H J;  2K9S A;  3GTK J;  3S2H J;  2DA6 A;  2EZH A;  2QCO A;  5F0H A;  3HOX J;  1JT0 A;  3S1Q J;  3OSF A;  2FX0 A;  3RKQ A;  1IGN A;  2LTP A;  2DJN A;  3IH2 A;  2K9Q A;  1ETK A;  2EQR A;  4UUS B;  1AU7 A;  3JRF A;  3O8G A;  2ECC A;  2CQX A;  2HI3 A;  1MH4 A;  1WH7 A;  1GV2 A;  4B3A A;  1W0T A;  1RET A;  3FK7 A;  4MO7 A;  4QSH A;  1U78 A;  2E2I J;  4W1U A;  1B72 A;  1HLV A;  3S2D J;  3S16 J;  2ID3 A;  4M3F A;  1DU0 A;  5EDN A;  2NVX J;  5EZG A;  1TC3 C;  1TWG J;  4M3D A;  2E19 A;  3MVP A;  2WAQ N;  3BQZ A;  3MKL A;  1RR7 A;  3BR0 A;  1AHD P;  2E2J J;  3PM1 A;  3S1N J;  1XC5 A;  4DZJ A;  3Q0V A;  2EZL A;  5FKL A;  4C3H J;  2Y31 A;  3GTL J;  1A5J A;  1MSE C;  2HOA A;  1BW5 A;  2VPR A;  4UUS A;  2G0E A;  1BJZ A;  3NAU A;  3BG3 A;  1OCP A;  1MBH A;  2HYJ A;  3K7A J;  2HOS A;  1I50 J;  1FIA A;  4FTH A;  4G12 A;  1E3O C;  4D7N A;  1ZKG A;  1YRN B;  3K2A A;  4ABZ A;  3LSP A;  1SAN A;  1ZR2 A;  1MSF C;  2EZK A;  2DA1 A;  2DMQ A;  2MG4 A;  1WH5 A;  3BTI A;  1I3Q J;  5EZH A;  4A3F J;  4XID A;  4FE7 A;  1JJ6 C;  1APL C;  5FKN A;  3WHB A;  4QTR A;  3I4M J;  1JT6 A;  3ZQI A;  2DA2 A;  2EZI A;  2HXO A;  4DZP A;  4C3I J;  2LK2 A;  4D7M A;  2JA7 J;  2O8K A;  5EF6 A;  4XRM A;  3HM5 A;  4S0H B;  1VFC A;  1AKH A;  3ZQH A;  2JA8 J;  3HEF A;  2ZB9 A;  5E3O A;  1MH3 A;  1X2N A;  4Y7N J;  1YRN A;  1D5Y A;  1UMQ A;  3SDG A;  1Z0X A;  2HDD A;  1POG A;  5J1U A;  5J1Y A;  3MN2 A;  2QF7 A;  1OFC X;  3G1L A;  2GLO A;  5GP9 A;  3BT9 A;  1H88 C;  3Q0U A;  2L0K A;  1IG7 A;  2P81 A;  1B8I B;  1JKO C;  2LR8 A;  4RBO A;  3BR6 A;  1IDY A;  1FTT A;  1RPW A;  1VND A;  2LVS A;  3B6A A;  3L1P A;  2XGD A;  3CMY A;  5F1J A;  3CCY A;  2ME6 A;  1SFO J;  3M4O J;  3BTL A;  2XGC A;  2Y30 A;  3BR3 A;  3F0C A;  1OCT C;  1ETY A;  4JP0 A;  2CU7 A;  5M5X J;  5IYB J;  1LE8 B;  3S17 J;  5E3L A;  1GV5 A;  3GTO J;  3JRC A;  3A03 A;  2DN0 A;  1GVD A;  4C2M J;  1QVU A;  2JN6 A;  2OF7 A;  2PMZ N;  5IP7 J;  1RKT A;  3Q0W A;  3GBG A;  1ITY A;  3VPR A;  2XPV A;  3DEW A;  2NOG A;  3SJM A;  1ZK8 A;  5DS9 A;  4RDU A;  5K7F A;  3A01 B;  3G1M A;  5GPA A;  5IOZ A;  4C3J J;  1FJL A;  1JGG A;  3BR1 A;  1Y1W J;  1NK3 P;  3M3Y J;  3W6V A;  3HKZ N;  4A3L J;  1MBJ A;  4MFE A;  4CYC A;  2LY9 A;  3BR2 A;  1XS9 A;  1K83 J;  2DMP A;  1P7J A;  3GTM J;  4MFD A;  5JLW A;  1ENH A;  1HCR A;  2Y0S N;  1B8I A;  5EGO B;  1F43 A;  1K61 A;  1I6H J;  1A6I A;  4GFB A;  1O4X A;  3LOC A;  3JRH A;  2JA5 J;  2DMU A;  3JRB A;  3JRA A;  1LFU P;  1QVT A;  2EH3 A;  3ZQC A;  4BY1 J;  2IBD A;  3A02 A;  2CUE A;  1LE8 A;  2M9H A;  5C44 J;  3BG5 A;  3OOU A;  1HF0 A;  4NDL A;  2DTZ A;  1S7E A;  1Y1V J;  1ETX A;  3GTG J;  1TWC J;  2KDZ A;  3WHC A;  4BBR J;  2GBY A;  2DA7 A;  3RQI A;  3Q3S A;  1ETO A;  3RZO J;  3A01 A;  2TCT A;  2L9R A;  3PO3 J;  2YU9 J;  5C4J J;  1G2H A;  2CUF A;  4FIS A;  1FIP A;  4BXX J;  5IYD J;  3E7L A;  3JR9 A;  1HDP A;  4DW6 A;  3HDD A;  4IHV A;  1VF9 A;  3TP3 A;  1MBE A;  1HDD C;  2DMT A;  3BG9 A;  3HGG A;  2I10 A;  3C2B A;  4BY7 J;  1CQT A;  2L7M P;  1JKR C;  5EGO A;  5IPA A;  2VKV A;  3JRI A;  3ZQF A;  1ETW A;  2XB5 A;  1FEX A;  1IV6 A;  2H1K A;  3H3V K;  3SFI A;  2MSY A;  2JA6 J;  1JKP C;  1MBG A;  4DYQ A;  1ETQ A;  2XPW A;  1NTC A;  5FLM J;  2R5Y B;  1IC8 A;  1HOM A;  3DCF A;  4IHX A;  2XRL A;  4MLO A;  4XRS A;  3JRE A;  9ANT A;  2GM4 A;  2HXI A;  1JJ8 C;  1Q1V A;  3S1M J;  3RZD J;  4B4C A;  2NVQ J;  2TRT A;  5EEA A;  2LKX A;  4HNV A;  1JUP A;  1H89 C;  5IYC J;  2DA3 A;  1RKW A;  4M6V A;  4A69 C;  3S14 J;  3IV5 A;  4XRS G;  2LD5 A;  4IEJ A;  4A3B J;  1MBK A;  5M5W J;  1T56 A;  4B1R A;  2XB0 X;  2NS8 A;  5E3M A;  4FCY A;  1ZGW A;  3LSJ A;  1LFB A;  2X9D A;  4QIW N;  2ID6 A;  2IEK A;  1R9T J;  3TED A;  2B63 J;  2O7O A;  4V2F A;  3HBL A;  3S15 J;  2X48 A;  2CJJ A;  2K40 A;  2DMN A;  1U9N A;  4D5F A;  3HOV J;  2L7F P;  4L5E A;  2COB A;  3FIW A;  1B72 B;  2W48 A;  3FIS A;  4I76 A;  1JTX A;  1H8A C;  4JX5 A;  4A3E J;  1WCM J;  1ZQ3 P;  3HOW J;  2VKE A;  3QPL A;  5F04 A;  3D1N I;  3FK6 A;  4M3E A;  2ECB A;  1BL0 A;  1IRZ A;  1DU6 A;  5FLV A;  4W97 A;  4JX6 A;  2Y2Z A;  1WPK A;  5F0C A;  1JTY A;  1ZTR A;  5M5Y J;  4V2G A;  2RAE A;  2D5V A;  4D5C A;  1F36 A;  1UHS A;  1X2M A;  2R92 J;  1FTZ A;  3PO2 J;  1T33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...