1V4RA

Solution structure of streptmycal repressor trar
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional Repressor
publication title Solution structure of Streptmycal repressor TraR
rcsb
source organism Streptomyces
molecule tags Gene regulation
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v4rA01
4F7ZA 4CXFA 4KMUX 5ICEA 1L0OC 1ZRFA 2FA5A 4JQFA 2HWVA 4Q4ZF 3KP4A 3V7CA 4WCGA 4YFNF 1QZYA 4PDKA 4H0EA 3RKXA 3ELKA 4I7HA 4A6EA 3F8CA 2XKOA 2CWEA 5TJJA 3GVAA 4LFUA 4HDUA 4UXNA 4RB2C 3RYRA 1PP7U 1QGPA 1U5TA 2UWMA 4XSXF 1KU2A 3FXUA 4S04A 1QNTA 1U5TC 1G3SA 4ZYDA 4U0WA 1K6OA 1IUYA 4MQ9F 3BZ6A 3L00A 2H27A 3GZ5A 5FD6A 3E97A 4OIPF 4Z2YA 3R0AA 3HHGA 2KIMA 1P4XA 2VT3A 4OMYA 2WV0A 2OBPA 2A07F 1ZYRF 3TQNA 2D2WA 1ONVA 2PEXA 3BDDA 2XASA 2UXXA 4AIHA 3F21A 1R5HA 5HS8A 1ULYA 1KGSA 3HRUA 4IF4A 1OMIA 2VT2A 4HX4A 5JHUA 2QUFA 1RUNA 1BIAA 1MJBA 1U3EM 3JAMK 1FBUA 4R79A 1IN4A 3WU1B 5BQTA 3J81Z 1O3TA 2Y0MA 5KVRA 1ZRDA 1QO0D 2HGCA 4L9TA 1P2FA 2K86A 3FXQA 2PMHA 4M6XA 1YS7A 3HHHA 2M1BA 3P9IA 2B0LA 2DQRA 5K1YA 4IPAA 1B6AA 3HOTA 5LGUA 5A2QK 2EFPA 4O3MA 4XLPF 2P6TA 1T0FA 4IJAA 5HS7A 4P9FA 2IW5A 1Z7UA 1K7AA 4ZYEA 1SAXA 1YYVA 3HUGA 2HOEA 5TRDA 1IXCA 2DW4A 3MEXA 3GWZA 3IRRA 3ZMTA 3WGGA 4M71A 2LSOA 5LRSA 3GFLA 1B59A 4PZJA 1R22A 2V1DA 4LB6B 1DPRA 2XAJA 4RGRA 1EH6A 2E7WA 3KP2A 4HF1A 2L01A 5D5WB 2FE3A 3T0YA 5HDKA 2NYXA 3TDZC 2P7CB 1JXSA 4GYIA 3I58A 4RAYA 2STTA 1IN6A 1W7PD 3V8JA 5E8GA 1HBXG 4IRGA 2ISZA 3L09A 3SQNA 2YU3A 2HEOA 5AIQA 5E20A 1GHCA 2J5PA 1I1SA 1IF1A 1U5TB 5LGNA 2DBBA 1YIOA 1F1ZA 2ZKZA 4WWCA 4A2UA 4ASNA 4IRIA 4L0YB 4RGSA 2GAUA 1FBSA 3HSRA 1GXPA 2FBIA 3K1NA 4I2OA 3QU6A 4EGZA 5K5OA 2O6GE 3MQ0A 2IRFG 4LGWA 4AIJA 3I4PA 3BPXA 2CGPA 4RB1A 1TBXA 3DXJF 2VBWA 3V7SA 1TW3A 4DNCA 3ZPLA 3ZN1A 2F5EA 3T5XA 2EA2A 5LEJA 2AXLA 2V1UA 1IRGA 1S7OA 3KLNA 2DTRA 4I02A 5DD8A 1HXDA 2HDCA 2A69F 3I54A 3EDPA 5H6RA 4HW0A 5J6XA 1FYMA 4YIIA 1FYKA 5HDGA 4I98B 2CW0F 1XCVA 1O3RA 4ZYHA 5DD4A 1YW9A 3PFIA 4FT8A 1ZRCA 5H6QA 2DFIA 1DPUA 3EYYA 4O5VA 2HKOA 1IN7A 2DK5A 1CGPA 1ZGJA 1R1UA 3Q9VA 1DUXC 1HKQA 2OZUA 4CGZA 5EEGA 1B1BA 5JFRA 2L02A 3HRSA 3RDIA 1AOYA 4KN7X 1X3UA 4AIKA 2PBIA 3VODA 2NS0A 1BI1A 1U78A 1SMTA 2ZMEA 3F8FA 3CDHA 3DF8A 4HQEA 2ISYA 2A61A 3T1BA 3TOBA 2QWWA 3F23A 1S8NA 2QZ8A 1U2WA 4UVBA 4CDGA 1YLFA 2MH2A 4BYYA 3VOEA 2P4WA 1O3SA 2CFXA 5FGMA 5IT9K 3EETA 4B8XA 3J80Z 3F3XA 1Z9CA 4ENMA 4U0VA 4A6DA 2VBZA 2A6EF 4HAMA 1IN8A 1SFUA 1XN7A 1Z91A 2QBYA 1LB2A 2PJPA 3VB2A 2PI0A 2BGCA 3O2PE 3WODF 5FLXZ 2HFHA 3TKYA 1O7FA 1JHFA 2A5YB 5AIPA 1UFMA 3BPVA 5ERIA 2DI3A 1DP7P 4BHPA 5IT3A 4LLLA 2F2EA 1T6SA 1LDDA 3W6KB 1SMYF 1Q1HA 2XAFA 4Y13A 2IT0A 2F5CA 3M8FA 1OKRA 3EUHA 3HTSB 1ZGAA 2P8TA 4L5IA 1FC3A 2MH9A 3FMQA 2V79A 1USTA 5E8IA 2VC1A 2IA1A 2TDXA 2JRTA 4KNYA 2DPDA 1KU9A 2ZJ2A 3ECOA 2M5WA 3IKTA 3EQLF 4UVCA 5LEKA 2M45A 4UVAA 1R58A 1F4KA 3H92A 3W6JB 4EQQA 2OQRA 4M9SA 5K5QA 2UXNA 3KE2A 3E6DA 4XRFA 3OV8A 1JE8A 3LA3A 3NRVA 3E5UA 5HLGA 1NHAA 4RGXA 2M30A 1KU3A 1R5GA 5E1XA 2H94A 1SFEA 5D6EA 5JVTA 2RN7A 3E6MA 3QPHA 2A68F 4BXUA 1C0WA 1BM9A 1W4MA 3NEUA 5LGTA 4L5JA 4HZFA 4QLCU 5CVRA 2HQNA 1Z6TA 2QQAA 4R1HA 4EM2A 1XB4A 1FYLA 4TV7A 5L3CA 3WGIA 2EV5A 2RKHA 1KQ9A 3DV8A 2DO7A 1WWXA 3HSFA 1SFXA 1SD4A 1IRFA 4RAZA 2PQ8A 2V9VA 2K4JA 1TQIA 1UHWA 3RPUA 1S6LA 5L3BA 3LAPA 4M72A 4LK0F 3HTUA 2L3DA 3QOPA 4G9YA 5BMZA 1A04A 1MDMB 1FT9A 3LFKA 5F1RA 1XGOA 5HOOA 1R23A 5D5VB 2HTSA 2O03A 2FMYA 4OMZA 1S29A 2O3FA 3Q9SA 2QBYB 1ON1A 5FFZA 2RV8A 3K2ZA 2L4MA 4K2EA 4IRHA 4QWQA 3WE3A 1HSJA 1YW8A 3BY6A 3CUQC 4M9ZA 4LJZF 4PCQA 1LVAA 3FHZA 4KICA 1Z05A 4G94A 1E2XA 1ZHFA 4ESJA 3JW4A 1MZBA 2EFQA 2XAHA 1YO5C 4NQWA 1MJAA 1QQIA 5JI6A 1XGNA 3KETA 1Z6RA 1VTNC 3K0LA 2G9WA 5E18F 3BOQA 4EV0A 1I27A 3E3VA 2PN6A 4B09A 3F22A 4EM1A 4N9IA 2VBYA 2DLLA 4OIOF 4RB0A 1TQMA 2Z99A 2STWA 2HYFA 2JTVA 5D4RA 1RIOH 3FM3A 4AD9A 1XGSA 2IVMA 2XROA 2O61A 3M1EA 1ZH5A 2BBYA 1J5YA 1KYZA 5CLSA 2VC0A 1T38A 2OAZA 2NAZA 3PQJA 2XAGA 2M87A 1B4AA 3MWMA 2QENA 1W5TA 1J7KA 4MTDA 3CJNA 3KP5A 3J7AO 2ESHA 3O3KA 2FQ3A 1TLHB 4EJTA 1D5VA 2MLKA 2X4HA 1DDNA 1V3FA 4HYEA 3QAHA 5FD5A 1XGMA 3JSOA 5LHGA 2GA1A 3V8LA 1Y0UA 2F5DA 4S05A 1O7LA 1OYIA 1BIBA 5HLIA 3ULQB 2GZWA 2HKXA 2WTEA 4HX8A 2KJCA 3P7NA 1AWCA 3KLOA 1FPQA 2CG4A 3GLXA 3ROUA 3JTGA 2IA2A 3CO6C 2DK8A 4BHBA 5LHHA 4Q48A 5ED4A 1J59A 3CUQB 3ABTA 5D8KB 1G3TA 1EH8A 3WGHA 3GW2A 1QPMA 4HV6A 1IW7F 4PGGA 4G7ZF 2OQGA 2XIGA 1KQ8A 3DEUA 2NRAC 3CLOA 5E1WA 1I5ZA 3MFKA 4CICA 3E5QA 3HYIA 2HZTA 4OOIA 4HF2A 3H3ZA 3ZN0A 2KRFA 2IJLA 4L0ZB 2QQ9A 2ZCWA 1FWZA 1FOKA 2EJRA 3TO9A 1O3QA 3DP7A 2K4BA 2LKPA 2VE9A 4KYWA 2FEZA 2BYVE 4L9NA 3E5XA 2YX4A 3DQVC 1I1GA 4P5OA 2DAOA 3GO5A 1P4AA 1RI7A 1XSXA 3FX3A 1S3JA 1GXQA 4OU0A 1YTYA 1OYWA 3JAMZ 3V7RA 2JT1A 4IHTA 4M73A 2PFBA 3IHUA 1ZN2A 5ILUA 3GUDA 3ZMUA 2COMA 3WTUC 2GXBA 3T8RA 5A2QZ 2RQPA 2KIUA 3KEQA 2H09A 3KFWX 3ZMSA 2QVOA 3C18A 3PQKA 2K02A 4RGUA 1HSTA 1STZA 2XKPA 2MC3A 4N0BA 3JSPA 2P5LC 3RPQA 3I53A 1G3WA 2GQQA 3FMSA 3I64A 3U9GA 1QBJA 4BQAA 2VOOA 1O57A 3F8NA 5DUIA 3SZTA 3VEPA 2QLZA 2KJBA 3WE2A 5K5RA 4GCVA 3C3WA 1LDKB 3R6SA 1FP2A 4OIRF 4L18B 2W24A 3EYIA 1ZG5A 3G73A 2KIFA 5DCFA 1PP8F 3ERED 2VONA 4EJWA 4OINF 2HTJA 1RZ4A 4GXOA 2FU4A 3TO7A 5J8CA 2FOKA 1R00A 2FBHA 5CJ9A 2JPCA 1P6RA 3REOA 1JHHA 5CVUA 1L3LA 2FXAA 5CVIA 4EVIA 2IPQX 3R4KA 5E1ZB 1PDNC 2JSCA 2W57A 1LQ1A 5DDGA 2CO5A 5CVVA 3N97A 1MDMA 2XRNA 3HSEA 4YG2F 3V8KA 1W7PB 2DT5A 2ELHA 2XVCA 4JBAA 3CUOA 4E70A 1BBYA 4L9VA 1R36A 5D4SA 2PG4A 1B9NA 1WKMA 5DV5A 5AONA 1EH7A 3K9TA 2EFOA 3DPLC 2UZKA 4CZZA 1FLIA 3FZVA 1J75A 1BC7C 2BEOA 1HW5A 5HDNA 2XV4S 3D5LA 3TO6A 1FBQA 1OR7A 1ZAOA 1G4DA 5HS9A 4HOBA 1R1VA 1D3YA 5HLHA 4L9JA 4G7OF 2X0LA 1I6XA 1IN5A 2D45A 3SHFA 3QPTA 1SD6A 2MD5A 5KK1A 3ZMVA 5DEQA 2Q2EA 2R3SA 2Z3YA 1CF7B 1BI2A 1Z1DA 2QM3A 3L9FA 4UUVA 3ECHA 2NNYA 4WF2A 2J5OA 1KU7A 1ZLKA 1XMKA 5D8LB 3WTYC 5FFXA 3DFGA 4HQMA 4Y15A 4EMSA 4ZZLA 2CSOA 1XMAA 1ZG3A 3QRFF 4FX4A 2Q0OA 1KYWA 4ENJA 4IHSA 2VXZA 3MZHA 4FX0A 2GXGA 3GFJA 2EFNA 3FF5A 3GF2A 4LMYA 3IC7A 1S7AA 1K78B 1D8KA 3V4GA 4MHGA 2PMUA 1TNTA 1KA8A 4EJOA 2R7DA 3FMRA 1FZPB 2XGXA 3GYHX 3I0TA 3N4MA 5IT9Z 1SD7A 2G7HA 2DPUA 3OOPA 1TQPA 3KZZA 1R1TA 1UHMA 5DCMB 4CO8A 3T8TA 3ML6A 4I0BA 4MEXF 1XDSA 1D8JA 2EB7A 2RGVA 5JR3A 3KCCA 1E17A 3CTAA 1UCRA 2BE5F 4ZYGA 3CUQA 1QZZA 2YX7A 1LEBA 1BC8C 1LNWA 3AAFA 1XSDA 3WG9A 5L3FA 3L7WA 3L2CA 4D0PA 2A6HF 4UNOA 1G3YA 2ZNZA 4M74A 1FSEA 3R61A 2GA2A 5ICFA 1UB9A 3RIRA 3FM5A 2RC4A 4ESFA 3IWFA 4HBLA 1R7JA 2LF8A 2Z5UA 1MD0A 3BJ6A 1T39A 4XBFA 2ETHA 3M9AA 4EGYA 3B02A 3QU3A 4BNCA 2DU9A 2M8EA 4I01A 3LA2A 1W5SA 4WXDA 1USSA 1ZLJA 3HRMA 1REPC 4A0YA 3K1MA 3R0JA 4RB3C 2FNPA 4A0XA 3RYPA 3K69A 3RI4A 4ZZDA 2BV6A 3QP5A 4EM0B 1ODDA 4MNUA 3K1PA 3D0SA 3VFZA 2K27A 3ZQ7A 4LB5A 4HDVA 2LDUA 5D6FA 2YSRA 3U1DA 4KIBA 4U7BA 4BAYA 4N9HA 2P7VB 4WK8F 2RVCA 2C6YA 1G6NA 1GVJA 4AVPA 4HV5A 1ZARA 2D1HA 1BI0A 3WTSC 4G6DA 2EV0A 3S2WA 2OU2A 4U88A 4KN4X 3I71A 2JZYA 2XAQA 1WQ2A 1LJ9A 2ESNA 4I09A 3HOSA 2IP2A 2OZ6A 2Q8KA 4NB5A 1LDJA 5DUKA 2CQKA 1MJ9A 1T98A 2GWRA 3DKWA 1XDUA 2O0YA 1IZ1A 1U8RA 1WSUA 3I59A 1YG2A 3MAJA 1V4RA 3ZMZA 3KP7A 4HLXA 4HF0A 2P5VA 4KMFA 1FX7A 1FP1D 4IXAA 3ZMDA 3TOAA 5LHIA 4UV9A 2H6BA 5J8FA 2GIVA 2ZNYA 4KT5C 2HQRA 4LG0B 1MKMA 1J9IA 3IRQA 3F8BA 2F5FA 4P96A 2JPBA 3SFZA 5E17F 4WX9A 3LQQA 1HW2A 4HA8A 1MGTA 4NHJA 4YFXF 3C1DA 2ADUA 1BJAA 4M9XA 1OYYA 3RTRA 3G3ZA 1TTYA 3P9KA 4LLNA 2HS5A 5BOXA 3KP6A 5ICCA 2WWYA 1W7PA 4GO1A 1KQ0A 3F8MA 5CVJA 1J2XA 2ZFWA 4WXCA 5FB2A 2MA3A 4LLGF 1H9GA 4A5NA 4JK1X 5F64A 2XHKA 3BP8A 4XLNF 3FXRA 1HKSA 2MBFA 1IXRC 2ZO4A 4UV8A 4Q5SF 3BROA 3I5UA 4LK1F 5ILSA 3GEZA 4HLYA 3BJAA 1F9NA 2H6CA 5ILVA 4MTEA 3WTZA 2V1XA 1P92A 3J80K 4WXHA 2W25A 1F5TA 4ETSA 4M6YA 5F6FA 3SXYA 1BN5A 3RKWA 4G7HF 2ZXJA 5D5XB 2FNAA 4CYDA 3WTVC 4DQ2A 2VBXA 3ISPA 2EFWA 4KA4A 1OPCA 3H3UA 2EV6A 4ENKA 5HVQC 2FRHA 2ZBKA 1CF7A 5FLXK 3R60A 2A3SA 2D1VA 1YQAA 5BPIA 4KDPA 1PUEE 4AWXB 2L4AA 4A5MA 1FSHA 3U2RA 3JTHA 3COAC 2YR2A 2PLYA 4I0AA 2KKOA 1IXSB 2EWNA 2E1NA 3KP3A 4O6JA 4PGHA 5L3EA 1XSVA 3Q5FA 4P9UA 3I59B 2Y75A 2VODA 4UHTA 2AS5F 4MQVA 2DQLA 4G8XA 4RS8A 1K78A 2OA4A 4BH9A 2E1CA 5LBQA 5EEHA 3M8EA 5D5UB 5FO5A 4KUMA 4HX7A 4U0YA 4G6QA 3ZP5A 3FWEA 2RDPA 5DCMA 4BHCA 1TW2A 1ZG1A 2OD5A 3F6OA 3HIFA 3TGNA 3GFIA 3RKYA 3F6VA 1WI9A 2IA0A 2FMLA 1HW1A 1LEAA 3RJPA 1YS6A 3QP6A 2P6SA 2NNNA 2E7XA 1YFHA 4KIGA 2R7FA 3LA7A 2YPRA 1EV7A 3HRTA 1WRJA 1P4WA 2VOPA 1RNLA 1ON2A 4Y17A 1B9MA 3BWGA 4MEYF 2EK5A 4KIFA 4R8HA 3WTXC 1YW7A 3E6CC 3C7JA 1ZREA 3ABUA 3LWFA 4IVNA 2K7LA 3LAJA 2HR3A 2XUBA 2FF4A 1BOAA 1BI3A 1U6GA 1IAWA 5L3DA 3MCZA 2QQBA 4GYGA 4EJUA 2P5KA 5BS6A 3WU0A 3GXOA 3KZYA 3SZPA 2ACJA 1HQCA 4YFKF 4ON0A 2Z9OA 1XD7A 6PAXA 4LD5A 5H20A 4ESBA 4Q47A 2Z33A 2RNJA 1J0RA 4A12A 2W84A 3DPTA 3LQRA 4XSZF 3KEOA 3O6BB 2V6CA 3WTWC 5LRRA 3CO7C 4A0ZA 2EA4A 4MGRA 2HYGD 3NQOA 3B73A 5ICGA 2FBKA 3IL2A 3IWZA 1SD5A 2W85A 3WTTC 1XCBA 3M7GA 5BPDA 2L54A 3F72A 4KFCA 4ZH4F 2CYYA 5LLQA 3GZ6A 1TNSA 1K79A 1H0MA 1JGSA 1T2KA 3J81K 2MLGA 4EJVA 5L3GA 2LNBA 1RUOA 1FNNA 2VE8A 1H9TA 3P9CA 5CYVA 2O8XA 4FHTA 4U7DA 2Y48A 4GGGA 4OIQF 3IKVA 2LF7A 2QYOA 3GX4X 2ZMEB 1HKTA 4CHUA 2G7UA 1FY7A 2VN2A 3LSTA 2FSWA 4ENNA 3BJOA 4P55A 3TDUC 4LG0A 5DYMA 2WC2A 3GFMA 3MZYA 3E6BA 4YIFA
chains in the Genus database with same CATH superfamily
2DN0A 4F7ZA 1ITYA 4CXFA 4KMUX 5ICEA 1L0OC 1ZRFA 2FA5A 4JQFA 2DTZA 2HWVA 1MMSA 4Q4ZF 3KP4A 4Y3OA 3V7CA 4WCGA 1UMQA 2W4SA 3H0GJ 1XC5A 1HDDC 3HB9A 4YFNF 1UZCA 1IDZA 2QSFX 1QZYA 4PDKA 3DCFA 1ZKGA 3RKXA 3ELKA 4I7HA 4A6EA 4E7SA 2QA4I 3JRCA 1Y8QB 3Q0WA 2GM4A 2JA2A 3F8CA 1WZ2A 2XKOA 2CWEA 5TJJA 3GVAA 4LFUA 4HDUA 4BACA 4UXNA 2FJ1A 2OPTA 3ZXSA 4CSWA 4A3JJ 4RB2C 2ID6A 4BE1A 3RYRA 4ZTJA 1PP7U 1QGPA 1U5TA 4V2GA 2AQFA 2UWMA 2ECCA 4XSXF 2OCCH 1KU2A 5KCMA 3TL4X 3FXUA 4S04A 3JRAA 1QNTA 1U5TC 4A3KJ 1G3SA 5EEAA 5EJCA 4ZYDA 4U0WA 2JK3A 1KZHA 1K6OA 1IUYA 4MQ9F 3BZ6A 3L00A 3RQ4A 4AYBN 2H27A 2MC4A 3GZ5A 2RNGA 2CRGA 3E97A 5FD6A 4OIPF 3MN2A 2K3PA 4Z2YA 3R0AA 3HHGA 2KIMA 1ERDA 1P4XA 2LBFA 2VT3A 4RA2A 4OMYA 2DA6A 1A35A 2WV0A 3L2WA 2OBPA 2A07F 1HCRA 1ZYRF 3H5AA 3TQNA 2D2WA 3G4SI 1ONVA 2AXTC 2PEXA 1WFXA 3BDDA 2XASA 2L7MP 2UXXA 3OYJA 5LFAA 4P1WA 4AIHA 3F21A 1R5HA 3OYGA 4H0EA 5HS8A 1ULYA 1KGSA 1RETA 3HRUA 4IF4A 1OMIA 2VT2A 1IG7A 4HX4A 1HOMA 1BR2A 2NVQJ 5JHUA 2R7ZJ 2QUFA 4XKCA 3FXMA 1RUNA 3M8JA 4A3LJ 1BIAA 1MJBA 3CMEI 1U3EM 3JAMK 2ZSIB 1FBUA 3OYIA 4R79A 4BQQA 1IN4A 3WU1B 2DDAA 4Y33A 4UUTA 2A6TA 5BQTA 3J81Z 2Y0MA 1O3TA 1SVLA 2IGKA 3SEQA 2BY3A 5KVRA 2R4GA 1ZRDA 1QO0D 1TWGJ 4DJAA 2KLOA 2V1NA 4W97A 4A3IJ 2HGCA 3S2DJ 3DBHB 4L9TA 1P2FA 5GPAA 1UG0A 2K86A 3FXQA 2XSJC 2PMHA 4M6XA 1YS7A 3HHHA 2M1BA 3P9IA 1RR7A 2HVSA 2B0LA 2DQRA 3BG6A 5K1YA 5FROA 4IPAA 1B6AA 3K6GA 3HOTA 3OIPA 5LGUA 5A2QK 2CV1A 2EFPA 1VI0A 2R5ZB 4MFDA 3L2UA 4O3MA 4XLPF 1TZLA 4BY1J 2P6TA 1T0FA 3PNYA 4IJAA 4P9FA 2IW5A 5HS7A 3S1QJ 1ETVA 3A4CA 1Z7UA 3ESWB 2DFFA 1K7AA 4ZYEA 3H5NA 1YRNA 1SAXA 1YYVA 3HUGA 3PM1A 5EDNA 2CU7A 2HOEA 3LSPA 5TRDA 1IXCA 3LSMA 3VYUB 2OTLI 2DW4A 4XICA 3MEXA 2JUGA 2VI6A 3NWTA 3GWZA 3IRRA 3ZMTA 3HJEA 4M71A 2LSOA 3WGGA 5LRSA 3GTPJ 2KFDA 2KIQA 1BR1A 1B59A 3GFLA 5KNLA 1SEUA 4PZJA 1R22A 2LR8A 1XG1A 4YEJA 2CV0A 2V1DA 5FKMA 2BXYA 4LB6B 4J00A 1DPRA 1I3QJ 2XAJA 2VL8A 1EH6A 3GBGA 4RGRA 2E7WA 4PJNA 3KP2A 2DMPA 4HF1A 2L01A 5D5WB 2FE3A 2VKDA 2VJ5A 3Q3SA 3T0YA 3TW6A 2NYXA 4QIWN 5HDKA 3TDZC 2P7CB 1JXSA 4GYIA 3S15J 2XC7A 2CUJA 4XORA 3I58A 4RAYA 4FE7A 1IN6A 2STTA 1ZGWA 1X58A 2GBYA 2GIZA 3B6AA 1W7PD 4LG3A 4N4OB 3V8JA 5E8GA 1TL8A 1HBXG 4IRGA 2ISZA 1WJEA 5E3LA 2DCEA 1ETQA 3L09A 3SQNA 2YU3A 3G1LA 3OS1A 2HEOA 5AIQA 3K4BA 2XF6A 5E20A 1GHCA 4KT6A 2J5PA 1I1SA 1IF1A 1U5TB 5LGNA 2DXIA 1YIOA 1MMNA 2DBBA 1F1ZA 3S14J 4M3EA 1GVDA 2ZKZA 4QPOA 1I6HJ 1WHUA 4WWCA 1X1AA 3CP2A 4A2UA 4ASNA 4BJTA 4IRIA 4L0YB 4RGSA 2QGUA 2V9KA 2GAUA 1FBSA 2K5CA 3K10A 3HSRA 2I8DA 1GXPA 2W00A 4NQWB 2XRLA 2FBIA 3K1NA 4I2OA 4IEJA 1YHQI 3QU6A 3DKYA 3OYHA 4EGZA 4BBSJ 2X1EA 2Y0SA 2DOFA 5CQGA 5KAFC 1FIAA 5K5OA 3QOEA 1ETWA 2HVQA 2O6GE 4LITA 3BR6A 5J40A 3N05A 3EUKL 1B72B 1JJ6C 5BNGA 3WHCA 3MQ0A 3RSNA 2IRFG 1T56A 2W48A 4LGWA 4CYCA 4AIJA 3QQAA 3I4PA 4XLCA 3BPXA 3M1CA 1T95A 4A3EJ 4I99C 2CGPA 4RB1A 1PYVA 1TBXA 2K85A 1JKRC 2WB1A 2LFBA 3DXJF 2VBWA 3V7SA 1TW3A 1I3AA 3S32A 4DNCA 2L5QA 3ZPLA 3ZN1A 1U9NA 2F5EA 4B3AA 2CFOA 3T5XA 1ZQ3P 3RZOJ 2EA2A 5LEJA 2AXLA 2BVMA 2V1UA 1SC7A 1IRGA 1S7OA 3KLNA 2DTRA 4I02A 5DD8A 1HXDA 3GTQJ 4PJMA 1ENHA 2HDCA 4IQ4A 2A69F 3I54A 2VJIA 3ZQFA 3EDPA 1SANA 1J09A 3KYLA 1A5JA 4M3FA 5H6RA 1JGGA 4HW0A 5J6XA 1FYMA 2OCEA 4YIIA 1FYKA 4E7HA 5HDGA 4I98B 2CW0F 5IOZA 4QPQA 1XCVA 2Y9YA 3J7ZI 1Q1VA 4FETA 4C3IJ 2M7BA 4E7IA 1TWHJ 2YUSA 1O3RA 1N25A 4ZYHA 5DD4A 1YW9A 4BDYA 1VQ8I 3PFIA 2X6YA 3SDBA 1WVRA 3K4JA 4XRSG 1UG2A 4FT8A 3JRFA 1BR4A 3I9V2 3FIWA 3GTOJ 3GLLA 1ZRCA 1ZR4A 5H6QA 2DFIA 2ZC2A 1DPUA 3EYYA 3O8HA 2LKSA 4O5VA 2HKOA 1IN7A 3AFHA 2DK5A 2R7SA 1CGPA 1ZGJA 1NK3P 1R1UA 1Y1WJ 1GLNA 3A01B 2CS3A 4HSTA 3FBNB 3Q9VA 1QZEA 1P7IA 4NNJA 1DUXC 1HKQA 2OZUA 5EGOA 4CGZA 5EEGA 5M5XJ 1B1BA 4CCOA 1Y56A 3HC7A 1TT0A 5JFRA 2L02A 4E7ZA 3HRSA 3X2QH 3RDIA 3BTIA 1AOYA 4KN7X 2ZJRF 1P9QC 1X3UA 3HOVJ 1QPIA 2Y9ZA 4AIKA 3EUAA 2PBIA 2CUEA 5E3MA 3L2VA 1FIPA 2L7FP 3VODA 5B66C 1X1BA 1D1CA 2NS0A 1BI1A 1QA6A 2Q1ZB 2PMZN 1RKTA 1U78A 1EF4A 4II3A 1R4MB 4BQNA 1SMTA 1MNMC 3AG3H 2ZMEA 3F8FA 3CDHA 2ID3A 2R5YB 3DF8A 4HQEA 2ISYA 3CCMI 2A61A 2CW8A 3T1BA 3TOBA 1D5YA 1TT5B 2DT6A 2QWWA 3F23A 1S8NA 2QZ8A 1T08B 2L7KA 4BDZA 1U2WA 3GCMA 4UVBA 1JUSA 4CDGA 5FRMA 3BG7A 1YLFA 2MH2A 4BYYA 3AL0C 3VOEA 3W6VA 2P4WA 4E7LA 1O3SA 5M3FJ 3SFIA 2CFXA 5FGMA 5IT9K 3A0HC 3EETA 1SVOA 4B8XA 3J80Z 3BCAA 3F3XA 2DMNA 3VPRA 3NWSA 4ENMA 4U0VA 1Z9CA 4A6DA 1K61A 2VBZA 1PVEA 3MKLA 1DU6A 2A6EF 1I39A 4HAMA 1VQ6I 1UAAA 3GMEA 1IN8A 2V26A 1SFUA 1OCOH 1XN7A 2K9LA 3PNVA 1MMDA 3FKIJ 1Z91A 2F6CA 2JN6A 4F93B 2QBYA 1LB2A 2PJPA 3K4LA 3PJRA 1AHDP 3OYEA 2VXDA 3VB2A 2BGCA 2PI0A 5EZGA 3VWBA 3O2PE 3D1NI 3WODF 3H0DA 5FLXZ 2HFHA 3TKYA 1O7FA 1Z21A 2K40A 2KDOA 1YX3A 1JHFA 2LD5A 2A5YB 2E1MC 5AIPA 1UFMA 3BPVA 1JUMA 5ERIA 2CJJA 1VQ5I 3VYRB 2DI3A 1TC3C 1K83J 5GAEJ 1DP7P 4BHPA 5IT3A 3FXJA 4F91B 4LLLA 2F2EA 1T6SA 1LDDA 4D7MA 3B6CA 3W6KB 1SMYF 5IOYA 3JR9A 3SYTA 1Q1HA 2M4KA 2XAFA 1WCMJ 4HPQA 4Y13A 5FJ8J 2F5CA 2IT0A 3M8FA 1OKRA 3LSIA 3EUHA 3HTSB 1AA7A 1ZGAA 2P8TA 4L5IA 1FC3A 3BG3A 1FMWA 2MH9A 3FMQA 2V79A 1USTA 3EUHC 5E8IA 2VC1A 4E7JA 4A3CJ 2E2HJ 4FASD 1X2MA 2IA1A 2TDXA 2JRTA 4KNYA 2DPDA 3S17J 3C2GA 1KU9A 2NOJB 2ZJ2A 3ECOA 2M5WA 2JSPA 3IKTA 3CCUI 3EQLF 4B47A 2XPUA 3S3OA 4XQFA 2NVUB 4UVCA 1X3ZB 5LEKA 2M45A 4UVAA 1A6QA 2ELKA 1R58A 3RCOA 1F4KA 1MSFC 3H92A 2HVRA 2M0CA 3W6JB 1X19A 4EQQA 4QTRA 3IUOA 2OQRA 4M9SA 3IP4B 5K5QA 1UHSA 2UXNA 3BG5A 3H9QA 3KE2A 2EZLA 1MSEC 3E6DA 4XRFA 3OV8A 1JE8A 4DZPA 3LA3A 3HOWJ 3NRVA 3E5UA 5HLGA 2HI3A 1POGA 3SEZA 1NHAA 4RGXA 3BC8A 2M30A 1SAUA 1ETYA 1KU3A 3CCVI 1R5GA 3OL3A 5E1XA 3ZQGA 1MBJA 2H94A 1SFEA 5D6EA 4UB6C 2V7FA 5EGOB 5JVTA 4BJ5C 2RN7A 3E6MA 3QPHA 2A68F 4BXUA 1C0WA 1BM9A 4ANJA 1SFOJ 3JCUC 1W4MA 3DTIA 3NEUA 2JVGA 2MABA 1WJCA 4RAGA 2WAQN 4F55A 5LGTA 4IO9F 4L5JA 4HZFA 4QLCU 5CPRB 5CVRA 2HQNA 2UUZA 2R7UA 5K7HA 3CC7I 1K4SA 5J4VA 3JREA 3CC4I 4A3BJ 1Z6TA 2QQAA 4R1HA 1VNDA 4EM2A 1XB4A 1Y39A 4ZDOA 1FYLA 4D7NA 4TV7A 3CCYA 5L3CA 3WGIA 2EV5A 1VQPI 2RKHA 2ZJQF 3H5RA 3HL2A 1KQ9A 5H2FC 2DFHA 1V5FA 4RDUA 4BGDA 3TP3A 3QPLA 3DV8A 3OYCA 2DO7A 1WWXA 2KMUA 4BE0A 5JLXA 3HSFA 1V5GA 4BQOA 1SFXA 1FEXA 3VYSB 3CCSI 1SD4A 1IRFA 1Z3YA 1CQTA 3AL0B 4RAZA 2PQ8A 2V9VA 2Y2ZA 2K4JA 1TQIA 1UHWA 3RPUA 1S6LA 5L3BA 3LAPA 4M72A 2WY8Q 4LK0F 3TMOA 3HTUA 2L3DA 3QOPA 4G9YA 3ZQCA 5BMZA 1A04A 1MDMB 1FT9A 3LFKA 2M9HA 5F1RA 1XGOA 5HOOA 1R23A 5D5VB 2HTSA 2O03A 2X9DA 3CC2I 2FMYA 5GAGJ 4OMZA 4XOTA 1S29A 2CV2A 1MIJA 2O3FA 2XF5A 3Q9SA 3MKZA 4ZC3A 1ETXA 4XLFA 2QBYB 1ON1A 3TW7A 5FFZA 2RV8A 3K2ZA 2X6XA 2L4MA 4K2EA 4BXFA 4IRHA 4QWQA 3WE3A 1HSJA 1YW8A 3CUQC 3BY6A 4M9ZA 1OCTC 1TWCJ 4LJZF 3KEYA 2QSGX 4PCQA 2E1MB 1LVAA 3FHZA 4KICA 5FRNA 3FK7A 1Z05A 4G94A 1E2XA 1ZHFA 2Y69H 3WG7H 4LOCA 4ESJA 4RAFA 3HOYJ 3JW4A 1MZBA 5IP6A 2JA8J 2E5NA 2EFQA 3ASOH 2IGNA 4F92B 2XAHA 1YO5C 1YJNI 5CKTA 4NQWA 1MJAA 1QQIA 1SVMA 2VQGA 5JI6A 4HEA2 3L2RA 1XGNA 3KETA 1Z6RA 5IY5H 3S1NJ 3CP8A 1VTNC 3K0LA 4ZDLA 2G9WA 1DP3A 2FX0A 5E18F 3KZIC 3BOQA 4EV0A 2JUCA 1I27A 4UB8C 3E3VA 2PN6A 4B09A 1LKXA 3F22A 2NXNB 4N9IA 4EM1A 2VBYA 1RPWA 2DLLA 1B72A 4OIOF 5C44J 4BJ6C 2Q2EB 2MG4A 4RB0A 1TQMA 2Z99A 2STWA 2HYFA 1VQLI 2JTVA 3OSGA 5D4RA 1VQ7I 1RIOH 2ZB9A 5M5WJ 2I5UA 2LLKA 3FM3A 4PUSA 3BCBA 3WU2C 3JRDA 4AD9A 1XGSA 2IVMA 2XROA 2O61A 3M1EA 2M3AA 1ZH5A 2BBYA 1J5YA 1KYZA 5CLSA 4IHXA 4PK4A 2VC0A 1T38A 2OAZA 5E3NA 1JKOC 1OFCX 2NAZA 1PJRA 5KHDA 3PQJA 2XAGA 5B5EC 1YIJI 1WGXA 3SJMA 2ZJPF 2WV1A 2M87A 1B4AA 3GTMJ 3ZRGA 3MD2A 3MWMA 2QENA 1W5TA 1J7KA 4MTDA 3CJNA 3KP5A 3K70D 3OYDA 1APLC 3J7AO 1RR8C 4ITVA 3MKYB 4XLHA 2ESHA 3O3KA 3FKJA 2CH0A 3KYCB 3OYBA 3HZJA 2FQ3A 4MFEA 1TLHB 4EJTA 2AQEA 4EATA 1HC8A 1D5VA 2JA7J 1F36A 2KRCA 2MLKA 2X4HA 3BG9A 1DDNA 2R92J 1V3FA 3RQIA 4HYEA 3CCRI 3C2HA 3QAHA 1EA3A 3OYNA 2XDVA 2HDDA 5FD5A 1XGMA 3S93A 3KX2A 1FJLA 2IXSA 3JSOA 3HXLA 5LHGA 2GA1A 3V8LA 2Y31A 1Y0UA 2F5DA 2JVHA 4Z6YA 3A01A 4M3DA 3CDIA 3VSKA 1O7LA 4S05A 1OYIA 1BIBA 5HLIA 4M3GA 3ULQB 1IRXA 2GZWA 2HKXA 2KL4A 3CCQI 2WTEA 2EZKA 4HX8A 2KJCA 3P7NA 1AWCA 3KLOA 1FPQA 1N75A 2CG4A 3GLXA 2X85A 4IOAF 3J7YJ 1K6YA 3ROUA 1G8XA 2ICWG 1MH4A 1BW5A 3BLYA 2BY2A 3JTGA 2IA2A 3U1KA 3BQZA 2L2OA 1H8AC 3CO6C 2DK8A 5IYCJ 4X0GA 3ZQHA 4DW6A 4BHBA 4C2MJ 5LHHA 2ME6A 3CCEI 1MNEA 3FHNA 3CMYA 2IS2A 4Q48A 2HXOA 2NS8A 2QQ8A 2R5YA 2H1LA 5ED4A 2V4JC 1J59A 3SZGA 3JRBA 3CUQB 3ABTA 5D8KB 1G3TA 1EH8A 3WGHA 2R7RA 2M8GX 3GW2A 1E3OC 1QPMA 4AVZA 4HV6A 1IW7F 4PGGA 4G7ZF 1RESA 2OQGA 2XIGA 1KQ8A 2DA4A 2HOSA 1X4PA 3DEUA 3CLOA 2NRAC 3UR3C 5E1WA 4H4KC 2LY9A 4OAYA 1I5ZA 3MFKA 2V9PA 4CICA 3CMMA 2DMQA 2HZTA 3E5QA 3HYIA 4OOIA 4HF2A 3H3ZA 1FMVA 3ZN0A 2KRFA 2IJLA 3AG2H 3WHBA 4L0ZB 3ASNH 2QQ9A 2ZCWA 1FWZA 3BTCA 1FOKA 4BL0B 2HOTA 2EJRA 3TO9A 1O3QA 3M4OJ 3QYFA 3DP7A 4LIVA 2K4BA 3AG1H 3HKZN 2LKPA 2VE9A 3OY9A 4KYWA 2FEZA 2BYVE 1IV8A 4L9NA 3E5XA 2YX4A 3DQVC 3DLLF 3CF5F 1I1GA 2UV1A 4P5OA 3PO2J 2DAOA 3I56I 1W1WE 1W36D 3DBRB 2K9SA 3M3YJ 3FISA 1QU3A 3GO5A 1PUFB 1P4AA 1RI7A 5IYDJ 1LUJB 1XSXA 3FX3A 1S3JA 1GXQA 5HLTA 4OU0A 1YTYA 4KJZA 3U21A 1XMXA 3ZOBA 1OYWA 3JAMZ 1U0JA 3V7RA 1NK2P 3OIQA 2VQCA 2JT1A 1OCPA 3QPSA 2LP0A 4IHTA 2YU9J 1VZ0A 4M73A 2PFBA 2ZXWH 1UJ8A 3IHUA 3K4KA 3GTJJ 1ZN2A 1YE9A 3E7LA 5ILUA 2HOAA 3J7AY 3GUDA 3ZMUA 5B1BH 1RC9A 1AKHA 4CZCA 2COMA 4RLQA 1F43A 2JWTA 3WTUC 2KDZA 3Q0UA 2GXBA 3T8RA 5A2QZ 2TCTA 5EYRA 2RQPA 2KIUA 5TISC 3KEQA 2H09A 3KFWX 4CCNA 4IL6C 3ZMSA 2QVOA 3C18A 3PQKA 3OYAA 2K02A 5K7ZA 4RGUA 1HSTA 1STZA 2M4GA 2XKPA 2MYSA 2OJED 4BXXJ 2KP6A 2R7TA 2MC3A 2OV7A 4N0BA 3JSPA 2GLOA 2P5LC 1OCRH 2F4MB 4E4HA 4X6AJ 3RPQA 2FD5A 3I53A 3HOXJ 3I4MJ 2AHQA 3BR5A 4BU2A 1GDTA 3OL4A 2DOEA 1G3WA 2GQQA 5HODA 3FMSA 2DYRH 3PUBA 4L5EA 1HLVA 2HYJA 3I64A 1NG6A 3U9GA 2EILH 3BR3A 1WJAA 2JA5J 4G6TB 1QBJA 2DYSH 5J1YA 5DS9A 2HDWA 2DODA 1W0UA 1YJ9I 4BQAA 4AUXA 2VOOA 1O57A 1T8IA 3CD6I 4QSHA 5TGTA 3F8NA 3S3MA 3CZ6A 3DEWA 1LFPA 4NC8A 5DUIA 1R5ID 3H1CA 3F9KA 3K4NA 4AIDA 3SZTA 2HPIA 2QLZA 4RLFA 3VEPA 1IGNA 2XAUA 2KJBA 3WE2A 5K5RA 4II2A 2E71A 4GCVA 3C3WA 1LDKB 3OOUA 3R6SA 4FE4A 1FP2A 4OIRF 4L18B 2W24A 3EYIA 1ZG5A 3G73A 2KIFA 3LFUA 5DCFA 3V42A 4EEFG 4CCJA 1PP8F 2QKLB 4B44A 3HBLA 1VQKI 4C30A 1LFUP 2ECBA 1D1AA 1Y6IA 3VDXA 1V5EA 3ERED 2VONA 4EJWA 1VQOI 2E34A 3Q0VA 4OINF 1BL0A 2HTJA 1RZ4A 4GXOA 2FU4A 1OISA 3TO7A 5J8CA 1IRZA 2FOKA 1R00A 2FBHA 3BT9A 5CJ9A 2JPCA 1P6RA 2BW3B 3REOA 1JHHA 5CVUA 5F0FA 1L3LA 2FXAA 5CVIA 2COBA 2B9SA 4C3HJ 4EVIA 1V54H 2IPQX 2LOOA 2NVYJ 2PMZA 3R4KA 4X1EA 5E1ZB 3E0JB 1VQMI 5GAHJ 1PDNC 2JSCA 2W57A 1LQ1A 5DDGA 1S7EA 2A5WA 2CO5A 5CVVA 3S8PA 3N97A 1MDMA 2XRNA 3HSEA 2CQXA 4YG2F 5DM7F 5EZHA 3V8KA 2WA0A 1S72I 2VKEA 1W7PB 2EBIA 3OR1C 2DT5A 2ELHA 2XVCA 2W82A 4JBAA 5IP9J 3CUOA 3K2AA 4E70A 1BBYA 4L9VA 4NC6A 1R36A 3NAUA 2DMTA 3CDLA 1W5CC 2LG4A 5D4SA 2PG4A 1B9NA 2XGDA 5K7FA 2BY1A 1WKMA 1N77A 5DV5A 5AONA 1EH7A 1ETOA 2BZTA 3K9TA 3H9JA 2EFOA 3DPLC 1W0TA 2UZKA 4CZZA 4B3XA 2RQQA 1FLIA 3FZVA 1X1DA 1J75A 3G2BA 1BC7C 2QEXI 1DU0A 4NC7A 5JHFA 3A02A 1TWAJ 1EJ9A 2BEOA 3PSFA 1HW5A 1IDYA 5HDNA 1MBEA 1Z0XA 2XV4S 2RREA 2L7ZA 3D5LA 3UNGC 2HNHA 2PJRA 2QSHX 3TO6A 1FBQA 2KISA 1OR7A 3IH3A 3JRHA 5FKKA 3S16J 1ZAOA 1G4DA 3UKGA 5HS9A 3DLAA 2NOGA 1OR7C 4HOBA 1R1VA 4C9YA 1D3YA 1OCZH 1WJDA 5HLHA 3LSKA 4L9JA 4G7OF 2X0LA 3VYTB 1I6XA 1IN5A 1MBKA 2D45A 3SHFA 1YJWI 1ZELA 3QPTA 1SD6A 4Y52J 2MD5A 2VASA 1X3WB 1AKHB 1MMAA 5KK1A 1QVTA 2O5RA 2XPWA 4G12A 5DEQA 3ZMVA 2Q2EA 3DEEA 2R3SA 2Z3YA 3LOCA 1CF7B 1UELB 2MFZA 3OSFA 1MH3A 4W1UA 1BJZA 3DTKA 1TP4A 1BI2A 1Z1DA 2QM3A 3L9FA 4UUVA 4V19K 3ECHA 4UY8I 4PSWA 4XR6A 2IGMA 2NNYA 4GRIA 4WF2A 4FISA 2J5OA 1KU7A 3DKXA 2XSDC 1XMKA 1ZLKA 5D8LB 3WTYC 5FFXA 4XL9A 1Y8RB 4S0HB 2IS6A 2P81A 3ONQA 2X51A 4JX5A 1LPQA 2BVLA 3IAM2 4E6KG 3W2AA 3DFGA 4HQMA 4Y15A 3H3VK 4EMSA 3OYKA 4ZZLA 4A3MJ 1IJWC 2CSOA 2QKMB 2HZDA 2Z16A 1S9HA 5M3MJ 1LVKA 4BE2A 1XMAA 4NBQA 3I4NJ 1ZG3A 2XPVA 3QRFF 4FX4A 2Q0OA 4DOZA 1KYWA 2D5VA 2WAEA 4ENJA 4XM3A 4IHSA 4B1RA 2VXZA 5CQEA 3MZHA 4FX0A 2GXGA 2H1KA 2MSYA 4N4NB 3GFJA 4PJ0C 1BOBA 2EFNA 3FF5A 3GF2A 3HEFA 4LMYA 3IC7A 4RBOA 1S7AA 1K78B 1D8KA 4MIMA 3V4GA 4MHGA 2PMUA 4IOCF 1TNTA 2E19A 2ZXIA 3GZNB 2KRHA 1KA8A 4C2TA 2B7EA 2R7DA 3FMRA 4EJOA 1FZPB 2XGXA 3GYHX 3I0TA 3HG9A 3N4MA 4J19A 1JI8A 2CUFA 2WAQA 3QWLA 4C3JJ 2FOWA 5IT9Z 1SD7A 3HOUJ 5C4XJ 3AKZA 2G7HA 2DPUA 3MMYB 3ZR8X 4Y7NJ 3ZQLA 3OOPA 1TQPA 3KZZA 4M6VA 5F0CA 1R1TA 1UHMA 5DCMB 4ABZA 4CO8A 5EG0B 1R9TJ 4F3QA 1HDPA 3RPUD 2R0QC 2K9NA 1R4NB 4MO7A 4JP0A 3TP0A 4JYKA 4AU7A 2EH3A 4MLOA 3T8TA 3CJTB 3ML6A 4A69C 2LRDA 2DA2A 3FBIB 2DDBA 4I0BA 4MEXF 1XDSA 2EQRA 2VKHA 1D8JA 1O4XA 2EB7A 2RGVA 4OAZA 5JR3A 3OYFA 3M07A 1A36A 3KCCA 1E17A 4HG2A 3BR0A 3CTAA 3OYMA 1AU7A 4JX4A 1I50J 1UCRA 1B8IB 2BE5F 4ZYGA 1Z77A 3PUFA 3CUQA 4KITB 1GV2A 1QZZA 2YX7A 3HOZJ 1LEBA 3RZDJ 1BC8C 1LNWA 2Y30A 3AAFA 1XSDA 4A3GJ 3WG9A 5L3FA 5F1JA 3L7WA 1NH3A 1H88C 2L9SA 1A6IA 3L2CA 4D0PA 5IPAA 5JLWA 3TBIA 3G1MA 2A6HF 4UNOA 1G3YA 4AC0A 1MBGA 2ZNZA 4M74A 1FSEA 3CMAI 4J01A 3R61A 2GA2A 4ZJZA 5ICFA 1UB9A 2JJ7A 3RIRA 3FM5A 4PSXA 2PJRB 2RC4A 4CH7A 4ESFA 3IWFA 3BQYA 3ZCOA 4HBLA 2IGOA 1R7JA 2LF8A 3BTLA 2Z5UA 4AM3A 1MD0A 3BJ6A 4DBRA 1T39A 4XBFA 2JMWA 3I3LA 2ETHA 3M9AA 4EGYA 3B02A 3QU3A 1Z3XA 5GTHC 4BNCA 2DU9A 2M8EA 2BHZA 1E3HA 3K7AJ 1QHGA 4BEHB 1PUFA 4I01A 3KPHA 4AYBA 3LA2A 4XK4A 4A3FJ 2E60A 1W5SA 4WXDA 1USSA 1ZLJA 3HRMA 1REPC 2FQ4A 4A0YA 2NVTJ 3K1MA 3R0JA 5GPCA 4RB3C 1XX5A 1D1BA 2EIKH 1MBFA 2FNPA 2MW8A 4A0XA 4CCMA 3RYPA 1OJLA 3K69A 1NG7A 4KISA 2KT0A 3RI4A 4YIRX 3ERMA 3HGYA 4ZZDA 2BV6A 3QP5A 4EM0B 2O8KA 1MBHA 4YRVA 1WPKA 5FLVA 1ODDA 4MNUA 2VIXA 3K1PA 4XRSA 3D0SA 2VPRA 3VFZA 2OC6A 4DYQA 3CQZJ 1T33A 2K27A 3ZQ7A 4D5CA 2LREA 4IHVA 4LB5A 1GUUA 2VPLA 4HDVA 2LDUA 5D6FA 2LVSA 3D5RC 4DYCA 2CQNA 5LD2C 1U9OA 3CJQB 5E79C 4BKXA 2YSRA 3U1DA 2OUMA 4KIBA 3G71I 1MW7A 2W7NA 3OR2C 4BAYA 2VB6A 4N9HA 2P7VB 4U7BA 2KHMA 4WK8F 3LSGA 2RVCA 2C6YA 1G6NA 3LNQA 1GVJA 4AVPA 4HV5A 1ZARA 2D1HA 1BI0A 3WTSC 4V2FA 4G6DA 2XB5A 2EV0A 3S2WA 1H89C 2X6OA 2OU2A 1R49A 4U88A 1R71A 2YS9A 4KN4X 5FLMJ 1D0YA 3I71A 2OF7A 3ABLH 2JZYA 2XAQA 4IHWA 1WQ2A 1QRYA 1NTCA 5B1AH 3LSJA 5B3SH 3OIOA 5DM6F 1LJ9A 3LL7A 2ESNA 2VUMJ 2JRMA 2M2EA 4I09A 3HOSA 1P7JA 2ZXHA 3QYBA 2IP2A 2E36A 2OZ6A 1JTYA 2Q8KA 4NB5A 1LDJA 5DUKA 3DPUA 1TWFJ 3K70C 2EZIA 2CQKA 2EPFA 1DGWY 3OWTA 1MJ9A 1T98A 2GWRA 3DKWA 1XDUA 2O0YA 1IZ1A 3QYEA 5J47A 2TRTA 1U8RA 1WSUA 3FDYA 3FK6A 3I59A 1YG2A 2PX9A 3MAJA 1V4RA 3ZMZA 3KP7A 3S3NA 1WJBA 2CUZA 2MGQA 4HLXA 1U8BA 5F04A 4BBRJ 2BY0A 4HF0A 1ACIA 3BZKA 2P5VA 1T0FC 4KMFA 1FX7A 1FP1D 3DU5A 2G0EA 5E3OA 2X6WA 4IXAA 3ZMDA 2H8RA 2CQQA 3TOAA 4DGWB 2R7WA 3ABMH 3HGGA 1E3PA 3S1RJ 5LHIA 2E1OA 2IAIA 4UV9A 1YI2I 3ABKH 2H6BA 5C3EJ 5J8FA 2GIVA 2ZNYA 4KT5C 4BUPA 1G59A 2XB0X 2HQRA 3CCLI 3H9GA 4LG0B 3GTKJ 1MKMA 2LY1A 1J9IA 3IRQA 3L2QA 1ZR2A 3C2BA 3D5SC 3F8BA 3DU6A 2LC2A 2F5FA 3RKQA 4P96A 2JPBA 2H8WA 3SFZA 5E17F 2BW3A 4WX9A 3LQQA 4HNTA 1HW2A 4HA8A 1MGTA 3PIPF 4NHJA 4YFXF 2DA1A 3C1DA 2ADUA 1BJAA 1KONA 4M9XA 4PFPA 1OYYA 3RTRA 4XLEA 2L9VA 3G3ZA 1TTYA 3P9KA 4YELA 4LLNA 5GADJ 2HS5A 4PJJA 5BOXA 5HNHA 4ZDPA 3KP6A 5ICCA 2WWYA 1W7PA 4GO1A 1KQ0A 3F8MA 2Z1DA 5CVJA 1J2XA 2DT7B 2ZFWA 4WXCA 5FB2A 1JJ8C 1VFCA 2MA3A 4LLGF 2R7QA 1H9GA 2XGCA 4A5NA 4JK1X 1VF9A 2XHKA 3BP8A 5F64A 4XLNF 4XKWA 2XGEA 4BY7J 1QHHD 4FQGA 3FXRA 1HKSA 2MBFA 1IXRC 3KIOA 1EKEA 2ZO4A 4UV8A 2Y0SN 4Y4RA 3PL8A 4Q5SF 2JA6J 3BROA 3I5UA 4XN0A 2KPMA 1Z67A 2HQ5A 2DA7A 1MMGA 2HPMA 4LK1F 5ILSA 3GEZA 4HLYA 2F4OB 2N8GA 2I10A 1IC8A 3BJAA 1F9NA 1WJ5A 2H6CA 2GOXB 4A93J 5ILVA 4HNVA 1WI3A 4MTEA 4DYRA 3HKZA 4I76A 3WTZA 2BXZA 2V1XA 3PFYA 1P92A 3J80K 3DBLB 4WXHA 2LBFB 2XF7A 2W25A 4LIUA 1F5TA 4ETSA 4M6YA 4GFBA 5F6FA 1JTXA 3H36A 3SXYA 2LMDA 2RAEA 2O7OA 2WB1N 3HPGA 3CCJI 1BN5A 3RKWA 4G7HF 2ZXJA 3I55I 3L1PA 2ZSHB 3GTLJ 5J3LA 5D5XB 4B48A 1OLTA 2FNAA 1LE8A 4CYDA 3WTVC 2ZFUA 3PNTA 2DOAA 4DQ2A 2VBXA 5FKOA 4HNUA 3PO3J 3ISPA 2LYCA 3PSIA 2GOMA 1W36C 2EFWA 4KA4A 1OPCA 1S5LC 3H3UA 2EV6A 2VLAA 4ENKA 4UUSA 3ZQQA 5HVQC 2FRHA 2ZBKA 1CF7A 5FLXK 3R60A 1ETKA 2A3SA 2GXAA 2D1VA 1YQAA 1N78A 3G6EI 1IV6A 5BPIA 4IX7A 4DBQA 4KDPA 2E2JJ 3W3CA 3O8GA 2K3FA 1GV5A 4AWXB 1PUEE 1JKPC 2L4AA 3W2WA 4A5MA 1FSHA 1JT6A 3U2RA 3JTHA 2HQAA 1MNDA 3F0CA 3COAC 4GDFA 3IH2A 4CUGA 2YR2A 2M0MA 2K9MA 2R7OA 2PLYA 3DWLE 1ZTRA 2NVXJ 4I0AA 2KKOA 3CF2A 4CA0A 1IXSB 3HDDA 3NARA 3K4MA 4RM3A 4XKVA 2EWNA 4XMYA 4NDLA 1X1PA 2DFEA 1Y1VJ 2E1NA 3E1SA 3TEDA 3KP3A 4JOMA 1X1CA 3CJRB 1Z7LA 4O6JA 4PGHA 5L3EA 1XSVA 2VJJA 4IHYA 2OTJI 3Q5FA 4P9UA 3HPHA 1DGRM 3I59B 2Y75A 2VODA 4UHTA 2L0KA 3A03A 3MZ8A 2AS5F 4MQVA 2DQLA 4G8XA 4RS8A 2DA5A 2WADA 5GP9A 3EPZA 1K78A 4C2UA 2OA4A 1YRNB 4BH9A 2E1CA 3HUGB 4D9JA 5F0HA 1FOWA 5EEHA 5LBQA 3M8EA 1E0EA 4PJLA 3IV5A 3LMMA 5D5UB 5FO5A 4KUMA 4HX7A 3CESA 2ME0A 3PIOF 3SDGA 4U0YA 1HF0A 4G6QA 2BHYA 3ZP5A 4B43A 1XTAA 3IH4A 3FWEA 2RDPA 3IAS2 1ORKA 1R6RA 4FCYA 5DCMA 2M34A 5EG0A 4BHCA 1TW2A 1ZG1A 2Z2SB 2OD5A 3F6OA 4XIDA 3OS0A 3HIFA 3TGNA 3GFIA 2LTPA 4IQJA 3RKYA 3F6VA 1IUFA 4PFOA 4ZYAA 2WAFA 9ANTA 4DIQA 3ZGKA 1WI9A 2IA0A 1FOXA 1WJFA 2FMLA 5GTIC 1HW1A 1LEAA 3BR1A 3RJPA 2ZMEC 3LSHA 1HA8A 2F48A 1D0ZA 2VJ4A 1YS6A 3QP6A 2P6SA 1OCCH 5F08A 2NNNA 2E7XA 4IKFA 1YFHA 4KIGA 5IYBJ 2R7FA 3LA7A 2YPRA 1EV7A 2X1CA 1B8IA 5HNFA 3HRTA 1WRJA 1P4WA 1BA5A 1LFBA 1K4TA 2M7AA 4CCKA 2W1OA 1RKWA 2AO9A 4XNFA 2VOPA 1RNLA 1ON2A 1DQUA 4Y17A 1B9MA 4XN3A 1SFKA 3BWGA 3VSLA 4MEYF 2EK5A 3OMYA 3QODA 4KIFA 4R8HA 2QCOA 3A0BC 3WTXC 1M1EB 2DMUA 1YITI 2L9NA 3A1YA 1YW7A 2R93J 3E6CC 1JUPA 3C7JA 1ZREA 2LKXA 3ABUA 3LWFA 4IVNA 2K7LA 2WBMA 5J1UA 3LAJA 1YX5A 2HR3A 2XUBA 2F4IA 1RRJA 2FF4A 1BOAA 4FTHA 1QVUA 1BI3A 1U6GA 5F27A 4XRMA 1IAWA 4XLAA 5L3DA 2JQ7A 4CYCB 4HSRA 1Y0NA 3MCZA 1LE8B 2QQBA 4GYGA 4EJUA 2X48A 2R7XA 1VQ4I 2P5KA 3OS2A 5BS6A 3WU0A 2P0WA 3GXOA 2E5ZA 4RM2A 3JRIA 2O9LA 3KZYA 4BEHA 3SZPA 2ACJA 4UUSB 2IS1A 1HQCA 4YFKF 3S2HJ 4DZJA 3FXLA 4ON0A 2Z9OA 1D0XA 1XD7A 6PAXA 2EINH 4LD5A 5H20A 4B4CA 3P5JA 1GT0C 4ESBA 4Q47A 2Z33A 3ZQIA 2K9QA 2F5VA 1A31A 2RNJA 4M3BA 1X4OA 1J0RA 4A12A 4HRIA 3H35A 1FTZA 2W84A 3DPTA 3LQRA 4XSZF 2MD0A 5J1RA 2DA3A 1VQNI 3KEOA 1BW6A 2IEKA 5M5YJ 2B63J 3O6BB 2LH9A 2V6CA 1WH7A 3WTWC 4NUBA 5LRRA 3BTJA 2IBDA 1XS9A 3BR2A 3CO7C 3FXOA 4A0ZA 5JVGF 4IZZA 3MVPA 2EA4A 4E7KA 4MGRA 4I6ZA 4JX6A 2E2IJ 2R7VA 2HYGD 2CMPA 2VKVA 1JT0A 3NQOA 2QF7A 5FKLA 3B73A 4A3DJ 4D5FA 5ICGA 5FKNA 2FBKA 3IL2A 3S1MJ 2ELJA 1JKQC 3IWZA 2A05A 2HXIA 1SD5A 2CQ7A 2W85A 5C4JJ 3HM5A 3WTTC 1XCBA 3M7GA 5BPDA 5KAIC 3DTEA 1ZK8A 1OQYA 2L54A 2DJIA 3F72A 4F52A 1FOYA 5EF6A 4KFCA 4ZH4F 2DJNA 2FUG2 2CYYA 5LLQA 3GZ6A 3CLQA 1TNSA 3K4CA 2HU9A 1K79A 2VQHA 2L9RA 3OYLA 1H0MA 1JGSA 1T2KA 4BS9A 2X1DA 2MLGA 4XONA 4EJVA 5L3GA 3J81K 1WH5A 3G1OA 2LNBA 1RUOA 1FNNA 4ZTFA 2VE8A 2R5ZA 1H9TA 2EZHA 3P9CA 3JRGA 1VQ9I 2KZVA 2LK2A 5CYVA 2O8XA 4XOPA 2IS4A 5DTDA 2LY2A 5J4YA 4FHTA 2E35A 5IP7J 4U7DA 3LSRA 1XPXA 2WY7Q 2V6EA 3W2VA 2Y48A 3AG4H 4D1QA 4GGGA 1YOVB 4OIQF 3IKVA 2LF7A 2QYOA 3GX4X 2CW7A 2BOLA 2ZMEB 1HKTA 4CCLA 4CHUA 3GTGJ 4OWRB 2VQLA 2G7UA 4XKBA 2KZGA 1FY7A 2VN2A 1V55H 2FSWA 3LSTA 3BJOA 3BZCA 4ENNA 3FXKA 4P55A 4U87A 1FTTA 3TDUC 4LG0A 1IO2A 1X2NA 4RMNA 5DYMA 2WC2A 2NS7A 3KYDB 3GFMA 3MZYA 3E6BA 3MKWB 3A2KA 2EIMH 1G2HA 2EIJH 4YIFA 2KQRA
chains in the Genus database with same CATH topology
4F7ZA 4CXFA 4KMUX 5ICEA 1L0OC 1ZRFA 2FA5A 4JQFA 2HWVA 4Q4ZF 3KP4A 3V7CA 4WCGA 4YFNF 1QZYA 4PDKA 4H0EA 3RKXA 3ELKA 4I7HA 4A6EA 3F8CA 2XKOA 2CWEA 5TJJA 3GVAA 4LFUA 4HDUA 4UXNA 4RB2C 3RYRA 1PP7U 1QGPA 1U5TA 2UWMA 4XSXF 1KU2A 3FXUA 4S04A 1QNTA 1U5TC 1G3SA 4ZYDA 4U0WA 1K6OA 1IUYA 4MQ9F 3BZ6A 3L00A 2H27A 3GZ5A 5FD6A 3E97A 4OIPF 4Z2YA 3R0AA 3HHGA 2KIMA 1P4XA 2VT3A 4OMYA 2WV0A 2OBPA 2A07F 1ZYRF 3TQNA 2D2WA 1ONVA 2PEXA 3BDDA 2XASA 2UXXA 4AIHA 3F21A 1R5HA 5HS8A 1ULYA 1KGSA 3HRUA 4IF4A 1OMIA 2VT2A 4HX4A 5JHUA 2QUFA 1RUNA 1BIAA 1MJBA 1U3EM 3JAMK 1FBUA 4R79A 1IN4A 3WU1B 5BQTA 3J81Z 1O3TA 2Y0MA 5KVRA 1ZRDA 1QO0D 2HGCA 4L9TA 1P2FA 2K86A 3FXQA 2PMHA 4M6XA 1YS7A 3HHHA 2M1BA 3P9IA 2B0LA 2DQRA 5K1YA 4IPAA 1B6AA 3HOTA 5LGUA 5A2QK 2EFPA 4O3MA 4XLPF 2P6TA 1T0FA 4IJAA 5HS7A 4P9FA 2IW5A 1Z7UA 1K7AA 4ZYEA 1SAXA 1YYVA 3HUGA 2HOEA 5TRDA 1IXCA 2DW4A 3MEXA 3GWZA 3IRRA 3ZMTA 3WGGA 4M71A 2LSOA 5LRSA 3GFLA 1B59A 4PZJA 1R22A 2V1DA 4LB6B 1DPRA 2XAJA 4RGRA 1EH6A 2E7WA 3KP2A 4HF1A 2L01A 5D5WB 2FE3A 3T0YA 5HDKA 2NYXA 3TDZC 2P7CB 1JXSA 4GYIA 3I58A 4RAYA 2STTA 1IN6A 1W7PD 3V8JA 5E8GA 1HBXG 4IRGA 2ISZA 3L09A 3SQNA 2YU3A 2HEOA 5AIQA 5E20A 1GHCA 2J5PA 1I1SA 1IF1A 1U5TB 5LGNA 2DBBA 1YIOA 1F1ZA 2ZKZA 4WWCA 4A2UA 4ASNA 4IRIA 4L0YB 4RGSA 2GAUA 1FBSA 3HSRA 1GXPA 2FBIA 3K1NA 4I2OA 3QU6A 4EGZA 5K5OA 2O6GE 3MQ0A 2IRFG 4LGWA 4AIJA 3I4PA 3BPXA 2CGPA 4RB1A 1TBXA 3DXJF 2VBWA 3V7SA 1TW3A 4DNCA 3ZPLA 3ZN1A 2F5EA 3T5XA 2EA2A 5LEJA 2AXLA 2V1UA 1IRGA 1S7OA 3KLNA 2DTRA 4I02A 5DD8A 1HXDA 2HDCA 2A69F 3I54A 3EDPA 5H6RA 4HW0A 5J6XA 1FYMA 4YIIA 1FYKA 5HDGA 4I98B 2CW0F 1XCVA 1O3RA 4ZYHA 5DD4A 1YW9A 3PFIA 4FT8A 1ZRCA 5H6QA 2DFIA 1DPUA 3EYYA 4O5VA 2HKOA 1IN7A 2DK5A 1CGPA 1ZGJA 1R1UA 3Q9VA 1DUXC 1HKQA 2OZUA 4CGZA 5EEGA 1B1BA 5JFRA 2L02A 3HRSA 3RDIA 1AOYA 4KN7X 1X3UA 4AIKA 2PBIA 3VODA 2NS0A 1BI1A 1U78A 1SMTA 2ZMEA 3F8FA 3CDHA 3DF8A 4HQEA 2ISYA 2A61A 3T1BA 3TOBA 2QWWA 3F23A 1S8NA 2QZ8A 1U2WA 4UVBA 4CDGA 1YLFA 2MH2A 4BYYA 3VOEA 2P4WA 1O3SA 2CFXA 5FGMA 5IT9K 3EETA 4B8XA 3J80Z 3F3XA 1Z9CA 4ENMA 4U0VA 4A6DA 2VBZA 2A6EF 4HAMA 1IN8A 1SFUA 1XN7A 1Z91A 2QBYA 1LB2A 2PJPA 3VB2A 2PI0A 2BGCA 3O2PE 3WODF 5FLXZ 2HFHA 3TKYA 1O7FA 1JHFA 2A5YB 5AIPA 1UFMA 3BPVA 5ERIA 2DI3A 1DP7P 4BHPA 5IT3A 4LLLA 2F2EA 1T6SA 1LDDA 3W6KB 1SMYF 1Q1HA 2XAFA 4Y13A 2IT0A 2F5CA 3M8FA 1OKRA 3EUHA 3HTSB 1ZGAA 2P8TA 4L5IA 1FC3A 2MH9A 3FMQA 2V79A 1USTA 5E8IA 2VC1A 2IA1A 2TDXA 2JRTA 4KNYA 2DPDA 1KU9A 2ZJ2A 3ECOA 2M5WA 3IKTA 3EQLF 4UVCA 5LEKA 2M45A 4UVAA 1R58A 1F4KA 3H92A 3W6JB 4EQQA 2OQRA 4M9SA 5K5QA 2UXNA 3KE2A 3E6DA 4XRFA 3OV8A 1JE8A 3LA3A 3NRVA 3E5UA 5HLGA 1NHAA 4RGXA 2M30A 1KU3A 1R5GA 5E1XA 2H94A 1SFEA 5D6EA 5JVTA 2RN7A 3E6MA 3QPHA 2A68F 4BXUA 1C0WA 1BM9A 1W4MA 3NEUA 5LGTA 4L5JA 4HZFA 4QLCU 5CVRA 2HQNA 1Z6TA 2QQAA 4R1HA 4EM2A 1XB4A 1FYLA 4TV7A 5L3CA 3WGIA 2EV5A 2RKHA 1KQ9A 3DV8A 2DO7A 1WWXA 3HSFA 1SFXA 1SD4A 1IRFA 4RAZA 2PQ8A 2V9VA 2K4JA 1TQIA 1UHWA 3RPUA 1S6LA 5L3BA 3LAPA 4M72A 4LK0F 3HTUA 2L3DA 3QOPA 4G9YA 5BMZA 1A04A 1MDMB 1FT9A 3LFKA 5F1RA 1XGOA 5HOOA 1R23A 5D5VB 2HTSA 2O03A 2FMYA 4OMZA 1S29A 2O3FA 3Q9SA 2QBYB 1ON1A 5FFZA 2RV8A 3K2ZA 2L4MA 4K2EA 4IRHA 4QWQA 3WE3A 1HSJA 1YW8A 3BY6A 3CUQC 4M9ZA 4LJZF 4PCQA 1LVAA 3FHZA 4KICA 1Z05A 4G94A 1E2XA 1ZHFA 4ESJA 3JW4A 1MZBA 2EFQA 2XAHA 1YO5C 4NQWA 1MJAA 1QQIA 5JI6A 1XGNA 3KETA 1Z6RA 1VTNC 3K0LA 2G9WA 5E18F 3BOQA 4EV0A 1I27A 3E3VA 2PN6A 4B09A 3F22A 4EM1A 4N9IA 2VBYA 2DLLA 4OIOF 4RB0A 1TQMA 2Z99A 2STWA 2HYFA 2JTVA 5D4RA 1RIOH 3FM3A 4AD9A 1XGSA 2IVMA 2XROA 2O61A 3M1EA 1ZH5A 2BBYA 1J5YA 1KYZA 5CLSA 2VC0A 1T38A 2OAZA 2NAZA 3PQJA 2XAGA 2M87A 1B4AA 3MWMA 2QENA 1W5TA 1J7KA 4MTDA 3CJNA 3KP5A 3J7AO 2ESHA 3O3KA 2FQ3A 1TLHB 4EJTA 1D5VA 2MLKA 2X4HA 1DDNA 1V3FA 4HYEA 3QAHA 5FD5A 1XGMA 3JSOA 5LHGA 2GA1A 3V8LA 1Y0UA 2F5DA 4S05A 1O7LA 1OYIA 1BIBA 5HLIA 3ULQB 2GZWA 2HKXA 2WTEA 4HX8A 2KJCA 3P7NA 1AWCA 3KLOA 1FPQA 2CG4A 3GLXA 3ROUA 3JTGA 2IA2A 3CO6C 2DK8A 4BHBA 5LHHA 4Q48A 5ED4A 1J59A 3CUQB 3ABTA 5D8KB 1G3TA 1EH8A 3WGHA 3GW2A 1QPMA 4HV6A 1IW7F 4PGGA 4G7ZF 2OQGA 2XIGA 1KQ8A 3DEUA 2NRAC 3CLOA 5E1WA 1I5ZA 3MFKA 4CICA 3E5QA 3HYIA 2HZTA 4OOIA 4HF2A 3H3ZA 3ZN0A 2KRFA 2IJLA 4L0ZB 2QQ9A 2ZCWA 1FWZA 1FOKA 2EJRA 3TO9A 1O3QA 3DP7A 2K4BA 2LKPA 2VE9A 4KYWA 2FEZA 2BYVE 4L9NA 3E5XA 2YX4A 3DQVC 1I1GA 4P5OA 2DAOA 3GO5A 1P4AA 1RI7A 1XSXA 3FX3A 1S3JA 1GXQA 4OU0A 1YTYA 1OYWA 3JAMZ 3V7RA 2JT1A 4IHTA 4M73A 2PFBA 3IHUA 1ZN2A 5ILUA 3GUDA 3ZMUA 2COMA 3WTUC 2GXBA 3T8RA 5A2QZ 2RQPA 2KIUA 3KEQA 2H09A 3KFWX 3ZMSA 2QVOA 3C18A 3PQKA 2K02A 4RGUA 1HSTA 1STZA 2XKPA 2MC3A 4N0BA 3JSPA 2P5LC 3RPQA 3I53A 1G3WA 2GQQA 3FMSA 3I64A 3U9GA 1QBJA 4BQAA 2VOOA 1O57A 3F8NA 5DUIA 3SZTA 3VEPA 2QLZA 2KJBA 3WE2A 5K5RA 4GCVA 3C3WA 1LDKB 3R6SA 1FP2A 4OIRF 4L18B 2W24A 3EYIA 1ZG5A 3G73A 2KIFA 5DCFA 1PP8F 3ERED 2VONA 4EJWA 4OINF 2HTJA 1RZ4A 4GXOA 2FU4A 3TO7A 5J8CA 2FOKA 1R00A 2FBHA 5CJ9A 2JPCA 1P6RA 3REOA 1JHHA 5CVUA 1L3LA 2FXAA 5CVIA 4EVIA 2IPQX 3R4KA 5E1ZB 1PDNC 2JSCA 2W57A 1LQ1A 5DDGA 2CO5A 5CVVA 3N97A 1MDMA 2XRNA 3HSEA 4YG2F 3V8KA 1W7PB 2DT5A 2ELHA 2XVCA 4JBAA 3CUOA 4E70A 1BBYA 4L9VA 1R36A 5D4SA 2PG4A 1B9NA 1WKMA 5DV5A 5AONA 1EH7A 3K9TA 2EFOA 3DPLC 2UZKA 4CZZA 1FLIA 3FZVA 1J75A 1BC7C 2BEOA 1HW5A 5HDNA 2XV4S 3D5LA 3TO6A 1FBQA 1OR7A 1ZAOA 1G4DA 5HS9A 4HOBA 1R1VA 1D3YA 5HLHA 4L9JA 4G7OF 2X0LA 1I6XA 1IN5A 2D45A 3SHFA 3QPTA 1SD6A 2MD5A 5KK1A 3ZMVA 5DEQA 2Q2EA 2R3SA 2Z3YA 1CF7B 1BI2A 1Z1DA 2QM3A 3L9FA 4UUVA 3ECHA 2NNYA 4WF2A 2J5OA 1KU7A 1ZLKA 1XMKA 5D8LB 3WTYC 5FFXA 3DFGA 4HQMA 4Y15A 4EMSA 4ZZLA 2CSOA 1XMAA 1ZG3A 3QRFF 4FX4A 2Q0OA 1KYWA 4ENJA 4IHSA 2VXZA 3MZHA 4FX0A 2GXGA 3GFJA 2EFNA 3FF5A 3GF2A 4LMYA 3IC7A 1S7AA 1K78B 1D8KA 3V4GA 4MHGA 2PMUA 1TNTA 1KA8A 4EJOA 2R7DA 3FMRA 1FZPB 2XGXA 3GYHX 3I0TA 3N4MA 5IT9Z 1SD7A 2G7HA 2DPUA 3OOPA 1TQPA 3KZZA 1R1TA 1UHMA 5DCMB 4CO8A 3T8TA 3ML6A 4I0BA 4MEXF 1XDSA 1D8JA 2EB7A 2RGVA 5JR3A 3KCCA 1E17A 3CTAA 1UCRA 2BE5F 4ZYGA 3CUQA 1QZZA 2YX7A 1LEBA 1BC8C 1LNWA 3AAFA 1XSDA 3WG9A 5L3FA 3L7WA 3L2CA 4D0PA 2A6HF 4UNOA 1G3YA 2ZNZA 4M74A 1FSEA 3R61A 2GA2A 5ICFA 1UB9A 3RIRA 3FM5A 2RC4A 4ESFA 3IWFA 4HBLA 1R7JA 2LF8A 2Z5UA 1MD0A 3BJ6A 1T39A 4XBFA 2ETHA 3M9AA 4EGYA 3B02A 3QU3A 4BNCA 2DU9A 2M8EA 4I01A 3LA2A 1W5SA 4WXDA 1USSA 1ZLJA 3HRMA 1REPC 4A0YA 3K1MA 3R0JA 4RB3C 2FNPA 4A0XA 3RYPA 3K69A 3RI4A 4ZZDA 2BV6A 3QP5A 4EM0B 1ODDA 4MNUA 3K1PA 3D0SA 3VFZA 2K27A 3ZQ7A 4LB5A 4HDVA 2LDUA 5D6FA 2YSRA 3U1DA 4KIBA 4U7BA 4BAYA 4N9HA 2P7VB 4WK8F 2RVCA 2C6YA 1G6NA 1GVJA 4AVPA 4HV5A 1ZARA 2D1HA 1BI0A 3WTSC 4G6DA 2EV0A 3S2WA 2OU2A 4U88A 4KN4X 3I71A 2JZYA 2XAQA 1WQ2A 1LJ9A 2ESNA 4I09A 3HOSA 2IP2A 2OZ6A 2Q8KA 4NB5A 1LDJA 5DUKA 2CQKA 1MJ9A 1T98A 2GWRA 3DKWA 1XDUA 2O0YA 1IZ1A 1U8RA 1WSUA 3I59A 1YG2A 3MAJA 1V4RA 3ZMZA 3KP7A 4HLXA 4HF0A 2P5VA 4KMFA 1FX7A 1FP1D 4IXAA 3ZMDA 3TOAA 5LHIA 4UV9A 2H6BA 5J8FA 2GIVA 2ZNYA 4KT5C 2HQRA 4LG0B 1MKMA 1J9IA 3IRQA 3F8BA 2F5FA 4P96A 2JPBA 3SFZA 5E17F 4WX9A 3LQQA 1HW2A 4HA8A 1MGTA 4NHJA 4YFXF 3C1DA 2ADUA 1BJAA 4M9XA 1OYYA 3RTRA 3G3ZA 1TTYA 3P9KA 4LLNA 2HS5A 5BOXA 3KP6A 5ICCA 2WWYA 1W7PA 4GO1A 1KQ0A 3F8MA 5CVJA 1J2XA 2ZFWA 4WXCA 5FB2A 2MA3A 4LLGF 1H9GA 4A5NA 4JK1X 5F64A 2XHKA 3BP8A 4XLNF 3FXRA 1HKSA 2MBFA 1IXRC 2ZO4A 4UV8A 4Q5SF 3BROA 3I5UA 4LK1F 5ILSA 3GEZA 4HLYA 3BJAA 1F9NA 2H6CA 5ILVA 4MTEA 3WTZA 2V1XA 1P92A 3J80K 4WXHA 2W25A 1F5TA 4ETSA 4M6YA 5F6FA 3SXYA 1BN5A 3RKWA 4G7HF 2ZXJA 5D5XB 2FNAA 4CYDA 3WTVC 4DQ2A 2VBXA 3ISPA 2EFWA 4KA4A 1OPCA 3H3UA 2EV6A 4ENKA 5HVQC 2FRHA 2ZBKA 1CF7A 5FLXK 3R60A 2A3SA 2D1VA 1YQAA 5BPIA 4KDPA 1PUEE 4AWXB 2L4AA 4A5MA 1FSHA 3U2RA 3JTHA 3COAC 2YR2A 2PLYA 4I0AA 2KKOA 1IXSB 2EWNA 2E1NA 3KP3A 4O6JA 4PGHA 5L3EA 1XSVA 3Q5FA 4P9UA 3I59B 2Y75A 2VODA 4UHTA 2AS5F 4MQVA 2DQLA 4G8XA 4RS8A 1K78A 2OA4A 4BH9A 2E1CA 5LBQA 5EEHA 3M8EA 5D5UB 5FO5A 4KUMA 4HX7A 4U0YA 4G6QA 3ZP5A 3FWEA 2RDPA 5DCMA 4BHCA 1TW2A 1ZG1A 2OD5A 3F6OA 3HIFA 3TGNA 3GFIA 3RKYA 3F6VA 1WI9A 2IA0A 2FMLA 1HW1A 1LEAA 3RJPA 1YS6A 3QP6A 2P6SA 2NNNA 2E7XA 1YFHA 4KIGA 2R7FA 3LA7A 2YPRA 1EV7A 3HRTA 1WRJA 1P4WA 2VOPA 1RNLA 1ON2A 4Y17A 1B9MA 3BWGA 4MEYF 2EK5A 4KIFA 4R8HA 3WTXC 1YW7A 3E6CC 3C7JA 1ZREA 3ABUA 3LWFA 4IVNA 2K7LA 3LAJA 2HR3A 2XUBA 2FF4A 1BOAA 1BI3A 1U6GA 1IAWA 5L3DA 3MCZA 2QQBA 4GYGA 4EJUA 2P5KA 5BS6A 3WU0A 3GXOA 3KZYA 3SZPA 2ACJA 1HQCA 4YFKF 4ON0A 2Z9OA 1XD7A 6PAXA 4LD5A 5H20A 4ESBA 4Q47A 2Z33A 2RNJA 1J0RA 4A12A 2W84A 3DPTA 3LQRA 4XSZF 3KEOA 3O6BB 2V6CA 3WTWC 5LRRA 3CO7C 4A0ZA 2EA4A 4MGRA 2HYGD 3NQOA 3B73A 5ICGA 2FBKA 3IL2A 3IWZA 1SD5A 2W85A 3WTTC 1XCBA 3M7GA 5BPDA 2L54A 3F72A 4KFCA 4ZH4F 2CYYA 5LLQA 3GZ6A 1TNSA 1K79A 1H0MA 1JGSA 1T2KA 3J81K 2MLGA 4EJVA 5L3GA 2LNBA 1RUOA 1FNNA 2VE8A 1H9TA 3P9CA 5CYVA 2O8XA 4FHTA 4U7DA 2Y48A 4GGGA 4OIQF 3IKVA 2LF7A 2QYOA 3GX4X 2ZMEB 1HKTA 4CHUA 2G7UA 1FY7A 2VN2A 3LSTA 2FSWA 4ENNA 3BJOA 4P55A 3TDUC 4LG0A 5DYMA 2WC2A 3GFMA 3MZYA 3E6BA 4YIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  4CXF A;  4KMU X;  5ICE A;  1L0O C;  1ZRF A;  2FA5 A;  4JQF A;  2HWV A;  4Q4Z F;  3KP4 A;  3V7C A;  4WCG A;  4YFN F;  1QZY A;  4PDK A;  4H0E A;  3RKX A;  3ELK A;  4I7H A;  4A6E A;  3F8C A;  2XKO A;  2CWE A;  5TJJ A;  3GVA A;  4LFU A;  4HDU A;  4UXN A;  4RB2 C;  3RYR A;  1PP7 U;  1QGP A;  1U5T A;  2UWM A;  4XSX F;  1KU2 A;  3FXU A;  4S04 A;  1QNT A;  1U5T C;  1G3S A;  4ZYD A;  4U0W A;  1K6O A;  1IUY A;  4MQ9 F;  3BZ6 A;  3L00 A;  2H27 A;  3GZ5 A;  5FD6 A;  3E97 A;  4OIP F;  4Z2Y A;  3R0A A;  3HHG A;  2KIM A;  1P4X A;  2VT3 A;  4OMY A;  2WV0 A;  2OBP A;  2A07 F;  1ZYR F;  3TQN A;  2D2W A;  1ONV A;  2PEX A;  3BDD A;  2XAS A;  2UXX A;  4AIH A;  3F21 A;  1R5H A;  5HS8 A;  1ULY A;  1KGS A;  3HRU A;  4IF4 A;  1OMI A;  2VT2 A;  4HX4 A;  5JHU A;  2QUF A;  1RUN A;  1BIA A;  1MJB A;  1U3E M;  3JAM K;  1FBU A;  4R79 A;  1IN4 A;  3WU1 B;  5BQT A;  3J81 Z;  1O3T A;  2Y0M A;  5KVR A;  1ZRD A;  1QO0 D;  2HGC A;  4L9T A;  1P2F A;  2K86 A;  3FXQ A;  2PMH A;  4M6X A;  1YS7 A;  3HHH A;  2M1B A;  3P9I A;  2B0L A;  2DQR A;  5K1Y A;  4IPA A;  1B6A A;  3HOT A;  5LGU A;  5A2Q K;  2EFP A;  4O3M A;  4XLP F;  2P6T A;  1T0F A;  4IJA A;  5HS7 A;  4P9F A;  2IW5 A;  1Z7U A;  1K7A A;  4ZYE A;  1SAX A;  1YYV A;  3HUG A;  2HOE A;  5TRD A;  1IXC A;  2DW4 A;  3MEX A;  3GWZ A;  3IRR A;  3ZMT A;  3WGG A;  4M71 A;  2LSO A;  5LRS A;  3GFL A;  1B59 A;  4PZJ A;  1R22 A;  2V1D A;  4LB6 B;  1DPR A;  2XAJ A;  4RGR A;  1EH6 A;  2E7W A;  3KP2 A;  4HF1 A;  2L01 A;  5D5W B;  2FE3 A;  3T0Y A;  5HDK A;  2NYX A;  3TDZ C;  2P7C B;  1JXS A;  4GYI A;  3I58 A;  4RAY A;  2STT A;  1IN6 A;  1W7P D;  3V8J A;  5E8G A;  1HBX G;  4IRG A;  2ISZ A;  3L09 A;  3SQN A;  2YU3 A;  2HEO A;  5AIQ A;  5E20 A;  1GHC A;  2J5P A;  1I1S A;  1IF1 A;  1U5T B;  5LGN A;  2DBB A;  1YIO A;  1F1Z A;  2ZKZ A;  4WWC A;  4A2U A;  4ASN A;  4IRI A;  4L0Y B;  4RGS A;  2GAU A;  1FBS A;  3HSR A;  1GXP A;  2FBI A;  3K1N A;  4I2O A;  3QU6 A;  4EGZ A;  5K5O A;  2O6G E;  3MQ0 A;  2IRF G;  4LGW A;  4AIJ A;  3I4P A;  3BPX A;  2CGP A;  4RB1 A;  1TBX A;  3DXJ F;  2VBW A;  3V7S A;  1TW3 A;  4DNC A;  3ZPL A;  3ZN1 A;  2F5E A;  3T5X A;  2EA2 A;  5LEJ A;  2AXL A;  2V1U A;  1IRG A;  1S7O A;  3KLN A;  2DTR A;  4I02 A;  5DD8 A;  1HXD A;  2HDC A;  2A69 F;  3I54 A;  3EDP A;  5H6R A;  4HW0 A;  5J6X A;  1FYM A;  4YII A;  1FYK A;  5HDG A;  4I98 B;  2CW0 F;  1XCV A;  1O3R A;  4ZYH A;  5DD4 A;  1YW9 A;  3PFI A;  4FT8 A;  1ZRC A;  5H6Q A;  2DFI A;  1DPU A;  3EYY A;  4O5V A;  2HKO A;  1IN7 A;  2DK5 A;  1CGP A;  1ZGJ A;  1R1U A;  3Q9V A;  1DUX C;  1HKQ A;  2OZU A;  4CGZ A;  5EEG A;  1B1B A;  5JFR A;  2L02 A;  3HRS A;  3RDI A;  1AOY A;  4KN7 X;  1X3U A;  4AIK A;  2PBI A;  3VOD A;  2NS0 A;  1BI1 A;  1U78 A;  1SMT A;  2ZME A;  3F8F A;  3CDH A;  3DF8 A;  4HQE A;  2ISY A;  2A61 A;  3T1B A;  3TOB A;  2QWW A;  3F23 A;  1S8N A;  2QZ8 A;  1U2W A;  4UVB A;  4CDG A;  1YLF A;  2MH2 A;  4BYY A;  3VOE A;  2P4W A;  1O3S A;  2CFX A;  5FGM A;  5IT9 K;  3EET A;  4B8X A;  3J80 Z;  3F3X A;  1Z9C A;  4ENM A;  4U0V A;  4A6D A;  2VBZ A;  2A6E F;  4HAM A;  1IN8 A;  1SFU A;  1XN7 A;  1Z91 A;  2QBY A;  1LB2 A;  2PJP A;  3VB2 A;  2PI0 A;  2BGC A;  3O2P E;  3WOD F;  5FLX Z;  2HFH A;  3TKY A;  1O7F A;  1JHF A;  2A5Y B;  5AIP A;  1UFM A;  3BPV A;  5ERI A;  2DI3 A;  1DP7 P;  4BHP A;  5IT3 A;  4LLL A;  2F2E A;  1T6S A;  1LDD A;  3W6K B;  1SMY F;  1Q1H A;  2XAF A;  4Y13 A;  2IT0 A;  2F5C A;  3M8F A;  1OKR A;  3EUH A;  3HTS B;  1ZGA A;  2P8T A;  4L5I A;  1FC3 A;  2MH9 A;  3FMQ A;  2V79 A;  1UST A;  5E8I A;  2VC1 A;  2IA1 A;  2TDX A;  2JRT A;  4KNY A;  2DPD A;  1KU9 A;  2ZJ2 A;  3ECO A;  2M5W A;  3IKT A;  3EQL F;  4UVC A;  5LEK A;  2M45 A;  4UVA A;  1R58 A;  1F4K A;  3H92 A;  3W6J B;  4EQQ A;  2OQR A;  4M9S A;  5K5Q A;  2UXN A;  3KE2 A;  3E6D A;  4XRF A;  3OV8 A;  1JE8 A;  3LA3 A;  3NRV A;  3E5U A;  5HLG A;  1NHA A;  4RGX A;  2M30 A;  1KU3 A;  1R5G A;  5E1X A;  2H94 A;  1SFE A;  5D6E A;  5JVT A;  2RN7 A;  3E6M A;  3QPH A;  2A68 F;  4BXU A;  1C0W A;  1BM9 A;  1W4M A;  3NEU A;  5LGT A;  4L5J A;  4HZF A;  4QLC U;  5CVR A;  2HQN A;  1Z6T A;  2QQA A;  4R1H A;  4EM2 A;  1XB4 A;  1FYL A;  4TV7 A;  5L3C A;  3WGI A;  2EV5 A;  2RKH A;  1KQ9 A;  3DV8 A;  2DO7 A;  1WWX A;  3HSF A;  1SFX A;  1SD4 A;  1IRF A;  4RAZ A;  2PQ8 A;  2V9V A;  2K4J A;  1TQI A;  1UHW A;  3RPU A;  1S6L A;  5L3B A;  3LAP A;  4M72 A;  4LK0 F;  3HTU A;  2L3D A;  3QOP A;  4G9Y A;  5BMZ A;  1A04 A;  1MDM B;  1FT9 A;  3LFK A;  5F1R A;  1XGO A;  5HOO A;  1R23 A;  5D5V B;  2HTS A;  2O03 A;  2FMY A;  4OMZ A;  1S29 A;  2O3F A;  3Q9S A;  2QBY B;  1ON1 A;  5FFZ A;  2RV8 A;  3K2Z A;  2L4M A;  4K2E A;  4IRH A;  4QWQ A;  3WE3 A;  1HSJ A;  1YW8 A;  3BY6 A;  3CUQ C;  4M9Z A;  4LJZ F;  4PCQ A;  1LVA A;  3FHZ A;  4KIC A;  1Z05 A;  4G94 A;  1E2X A;  1ZHF A;  4ESJ A;  3JW4 A;  1MZB A;  2EFQ A;  2XAH A;  1YO5 C;  4NQW A;  1MJA A;  1QQI A;  5JI6 A;  1XGN A;  3KET A;  1Z6R A;  1VTN C;  3K0L A;  2G9W A;  5E18 F;  3BOQ A;  4EV0 A;  1I27 A;  3E3V A;  2PN6 A;  4B09 A;  3F22 A;  4EM1 A;  4N9I A;  2VBY A;  2DLL A;  4OIO F;  4RB0 A;  1TQM A;  2Z99 A;  2STW A;  2HYF A;  2JTV A;  5D4R A;  1RIO H;  3FM3 A;  4AD9 A;  1XGS A;  2IVM A;  2XRO A;  2O61 A;  3M1E A;  1ZH5 A;  2BBY A;  1J5Y A;  1KYZ A;  5CLS A;  2VC0 A;  1T38 A;  2OAZ A;  2NAZ A;  3PQJ A;  2XAG A;  2M87 A;  1B4A A;  3MWM A;  2QEN A;  1W5T A;  1J7K A;  4MTD A;  3CJN A;  3KP5 A;  3J7A O;  2ESH A;  3O3K A;  2FQ3 A;  1TLH B;  4EJT A;  1D5V A;  2MLK A;  2X4H A;  1DDN A;  1V3F A;  4HYE A;  3QAH A;  5FD5 A;  1XGM A;  3JSO A;  5LHG A;  2GA1 A;  3V8L A;  1Y0U A;  2F5D A;  4S05 A;  1O7L A;  1OYI A;  1BIB A;  5HLI A;  3ULQ B;  2GZW A;  2HKX A;  2WTE A;  4HX8 A;  2KJC A;  3P7N A;  1AWC A;  3KLO A;  1FPQ A;  2CG4 A;  3GLX A;  3ROU A;  3JTG A;  2IA2 A;  3CO6 C;  2DK8 A;  4BHB A;  5LHH A;  4Q48 A;  5ED4 A;  1J59 A;  3CUQ B;  3ABT A;  5D8K B;  1G3T A;  1EH8 A;  3WGH A;  3GW2 A;  1QPM A;  4HV6 A;  1IW7 F;  4PGG A;  4G7Z F;  2OQG A;  2XIG A;  1KQ8 A;  3DEU A;  2NRA C;  3CLO A;  5E1W A;  1I5Z A;  3MFK A;  4CIC A;  3E5Q A;  3HYI A;  2HZT A;  4OOI A;  4HF2 A;  3H3Z A;  3ZN0 A;  2KRF A;  2IJL A;  4L0Z B;  2QQ9 A;  2ZCW A;  1FWZ A;  1FOK A;  2EJR A;  3TO9 A;  1O3Q A;  3DP7 A;  2K4B A;  2LKP A;  2VE9 A;  4KYW A;  2FEZ A;  2BYV E;  4L9N A;  3E5X A;  2YX4 A;  3DQV C;  1I1G A;  4P5O A;  2DAO A;  3GO5 A;  1P4A A;  1RI7 A;  1XSX A;  3FX3 A;  1S3J A;  1GXQ A;  4OU0 A;  1YTY A;  1OYW A;  3JAM Z;  3V7R A;  2JT1 A;  4IHT A;  4M73 A;  2PFB A;  3IHU A;  1ZN2 A;  5ILU A;  3GUD A;  3ZMU A;  2COM A;  3WTU C;  2GXB A;  3T8R A;  5A2Q Z;  2RQP A;  2KIU A;  3KEQ A;  2H09 A;  3KFW X;  3ZMS A;  2QVO A;  3C18 A;  3PQK A;  2K02 A;  4RGU A;  1HST A;  1STZ A;  2XKP A;  2MC3 A;  4N0B A;  3JSP A;  2P5L C;  3RPQ A;  3I53 A;  1G3W A;  2GQQ A;  3FMS A;  3I64 A;  3U9G A;  1QBJ A;  4BQA A;  2VOO A;  1O57 A;  3F8N A;  5DUI A;  3SZT A;  3VEP A;  2QLZ A;  2KJB A;  3WE2 A;  5K5R A;  4GCV A;  3C3W A;  1LDK B;  3R6S A;  1FP2 A;  4OIR F;  4L18 B;  2W24 A;  3EYI A;  1ZG5 A;  3G73 A;  2KIF A;  5DCF A;  1PP8 F;  3ERE D;  2VON A;  4EJW A;  4OIN F;  2HTJ A;  1RZ4 A;  4GXO A;  2FU4 A;  3TO7 A;  5J8C A;  2FOK A;  1R00 A;  2FBH A;  5CJ9 A;  2JPC A;  1P6R A;  3REO A;  1JHH A;  5CVU A;  1L3L A;  2FXA A;  5CVI A;  4EVI A;  2IPQ X;  3R4K A;  5E1Z B;  1PDN C;  2JSC A;  2W57 A;  1LQ1 A;  5DDG A;  2CO5 A;  5CVV A;  3N97 A;  1MDM A;  2XRN A;  3HSE A;  4YG2 F;  3V8K A;  1W7P B;  2DT5 A;  2ELH A;  2XVC A;  4JBA A;  3CUO A;  4E70 A;  1BBY A;  4L9V A;  1R36 A;  5D4S A;  2PG4 A;  1B9N A;  1WKM A;  5DV5 A;  5AON A;  1EH7 A;  3K9T A;  2EFO A;  3DPL C;  2UZK A;  4CZZ A;  1FLI A;  3FZV A;  1J75 A;  1BC7 C;  2BEO A;  1HW5 A;  5HDN A;  2XV4 S;  3D5L A;  3TO6 A;  1FBQ A;  1OR7 A;  1ZAO A;  1G4D A;  5HS9 A;  4HOB A;  1R1V A;  1D3Y A;  5HLH A;  4L9J A;  4G7O F;  2X0L A;  1I6X A;  1IN5 A;  2D45 A;  3SHF A;  3QPT A;  1SD6 A;  2MD5 A;  5KK1 A;  3ZMV A;  5DEQ A;  2Q2E A;  2R3S A;  2Z3Y A;  1CF7 B;  1BI2 A;  1Z1D A;  2QM3 A;  3L9F A;  4UUV A;  3ECH A;  2NNY A;  4WF2 A;  2J5O A;  1KU7 A;  1ZLK A;  1XMK A;  5D8L B;  3WTY C;  5FFX A;  3DFG A;  4HQM A;  4Y15 A;  4EMS A;  4ZZL A;  2CSO A;  1XMA A;  1ZG3 A;  3QRF F;  4FX4 A;  2Q0O A;  1KYW A;  4ENJ A;  4IHS A;  2VXZ A;  3MZH A;  4FX0 A;  2GXG A;  3GFJ A;  2EFN A;  3FF5 A;  3GF2 A;  4LMY A;  3IC7 A;  1S7A A;  1K78 B;  1D8K A;  3V4G A;  4MHG A;  2PMU A;  1TNT A;  1KA8 A;  4EJO A;  2R7D A;  3FMR A;  1FZP B;  2XGX A;  3GYH X;  3I0T A;  3N4M A;  5IT9 Z;  1SD7 A;  2G7H A;  2DPU A;  3OOP A;  1TQP A;  3KZZ A;  1R1T A;  1UHM A;  5DCM B;  4CO8 A;  3T8T A;  3ML6 A;  4I0B A;  4MEX F;  1XDS A;  1D8J A;  2EB7 A;  2RGV A;  5JR3 A;  3KCC A;  1E17 A;  3CTA A;  1UCR A;  2BE5 F;  4ZYG A;  3CUQ A;  1QZZ A;  2YX7 A;  1LEB A;  1BC8 C;  1LNW A;  3AAF A;  1XSD A;  3WG9 A;  5L3F A;  3L7W A;  3L2C A;  4D0P A;  2A6H F;  4UNO A;  1G3Y A;  2ZNZ A;  4M74 A;  1FSE A;  3R61 A;  2GA2 A;  5ICF A;  1UB9 A;  3RIR A;  3FM5 A;  2RC4 A;  4ESF A;  3IWF A;  4HBL A;  1R7J A;  2LF8 A;  2Z5U A;  1MD0 A;  3BJ6 A;  1T39 A;  4XBF A;  2ETH A;  3M9A A;  4EGY A;  3B02 A;  3QU3 A;  4BNC A;  2DU9 A;  2M8E A;  4I01 A;  3LA2 A;  1W5S A;  4WXD A;  1USS A;  1ZLJ A;  3HRM A;  1REP C;  4A0Y A;  3K1M A;  3R0J A;  4RB3 C;  2FNP A;  4A0X A;  3RYP A;  3K69 A;  3RI4 A;  4ZZD A;  2BV6 A;  3QP5 A;  4EM0 B;  1ODD A;  4MNU A;  3K1P A;  3D0S A;  3VFZ A;  2K27 A;  3ZQ7 A;  4LB5 A;  4HDV A;  2LDU A;  5D6F A;  2YSR A;  3U1D A;  4KIB A;  4U7B A;  4BAY A;  4N9H A;  2P7V B;  4WK8 F;  2RVC A;  2C6Y A;  1G6N A;  1GVJ A;  4AVP A;  4HV5 A;  1ZAR A;  2D1H A;  1BI0 A;  3WTS C;  4G6D A;  2EV0 A;  3S2W A;  2OU2 A;  4U88 A;  4KN4 X;  3I71 A;  2JZY A;  2XAQ A;  1WQ2 A;  1LJ9 A;  2ESN A;  4I09 A;  3HOS A;  2IP2 A;  2OZ6 A;  2Q8K A;  4NB5 A;  1LDJ A;  5DUK A;  2CQK A;  1MJ9 A;  1T98 A;  2GWR A;  3DKW A;  1XDU A;  2O0Y A;  1IZ1 A;  1U8R A;  1WSU A;  3I59 A;  1YG2 A;  3MAJ A;  1V4R A;  3ZMZ A;  3KP7 A;  4HLX A;  4HF0 A;  2P5V A;  4KMF A;  1FX7 A;  1FP1 D;  4IXA A;  3ZMD A;  3TOA A;  5LHI A;  4UV9 A;  2H6B A;  5J8F A;  2GIV A;  2ZNY A;  4KT5 C;  2HQR A;  4LG0 B;  1MKM A;  1J9I A;  3IRQ A;  3F8B A;  2F5F A;  4P96 A;  2JPB A;  3SFZ A;  5E17 F;  4WX9 A;  3LQQ A;  1HW2 A;  4HA8 A;  1MGT A;  4NHJ A;  4YFX F;  3C1D A;  2ADU A;  1BJA A;  4M9X A;  1OYY A;  3RTR A;  3G3Z A;  1TTY A;  3P9K A;  4LLN A;  2HS5 A;  5BOX A;  3KP6 A;  5ICC A;  2WWY A;  1W7P A;  4GO1 A;  1KQ0 A;  3F8M A;  5CVJ A;  1J2X A;  2ZFW A;  4WXC A;  5FB2 A;  2MA3 A;  4LLG F;  1H9G A;  4A5N A;  4JK1 X;  5F64 A;  2XHK A;  3BP8 A;  4XLN F;  3FXR A;  1HKS A;  2MBF A;  1IXR C;  2ZO4 A;  4UV8 A;  4Q5S F;  3BRO A;  3I5U A;  4LK1 F;  5ILS A;  3GEZ A;  4HLY A;  3BJA A;  1F9N A;  2H6C A;  5ILV A;  4MTE A;  3WTZ A;  2V1X A;  1P92 A;  3J80 K;  4WXH A;  2W25 A;  1F5T A;  4ETS A;  4M6Y A;  5F6F A;  3SXY A;  1BN5 A;  3RKW A;  4G7H F;  2ZXJ A;  5D5X B;  2FNA A;  4CYD A;  3WTV C;  4DQ2 A;  2VBX A;  3ISP A;  2EFW A;  4KA4 A;  1OPC A;  3H3U A;  2EV6 A;  4ENK A;  5HVQ C;  2FRH A;  2ZBK A;  1CF7 A;  5FLX K;  3R60 A;  2A3S A;  2D1V A;  1YQA A;  5BPI A;  4KDP A;  1PUE E;  4AWX B;  2L4A A;  4A5M A;  1FSH A;  3U2R A;  3JTH A;  3COA C;  2YR2 A;  2PLY A;  4I0A A;  2KKO A;  1IXS B;  2EWN A;  2E1N A;  3KP3 A;  4O6J A;  4PGH A;  5L3E A;  1XSV A;  3Q5F A;  4P9U A;  3I59 B;  2Y75 A;  2VOD A;  4UHT A;  2AS5 F;  4MQV A;  2DQL A;  4G8X A;  4RS8 A;  1K78 A;  2OA4 A;  4BH9 A;  2E1C A;  5LBQ A;  5EEH A;  3M8E A;  5D5U B;  5FO5 A;  4KUM A;  4HX7 A;  4U0Y A;  4G6Q A;  3ZP5 A;  3FWE A;  2RDP A;  5DCM A;  4BHC A;  1TW2 A;  1ZG1 A;  2OD5 A;  3F6O A;  3HIF A;  3TGN A;  3GFI A;  3RKY A;  3F6V A;  1WI9 A;  2IA0 A;  2FML A;  1HW1 A;  1LEA A;  3RJP A;  1YS6 A;  3QP6 A;  2P6S A;  2NNN A;  2E7X A;  1YFH A;  4KIG A;  2R7F A;  3LA7 A;  2YPR A;  1EV7 A;  3HRT A;  1WRJ A;  1P4W A;  2VOP A;  1RNL A;  1ON2 A;  4Y17 A;  1B9M A;  3BWG A;  4MEY F;  2EK5 A;  4KIF A;  4R8H A;  3WTX C;  1YW7 A;  3E6C C;  3C7J A;  1ZRE A;  3ABU A;  3LWF A;  4IVN A;  2K7L A;  3LAJ A;  2HR3 A;  2XUB A;  2FF4 A;  1BOA A;  1BI3 A;  1U6G A;  1IAW A;  5L3D A;  3MCZ A;  2QQB A;  4GYG A;  4EJU A;  2P5K A;  5BS6 A;  3WU0 A;  3GXO A;  3KZY A;  3SZP A;  2ACJ A;  1HQC A;  4YFK F;  4ON0 A;  2Z9O A;  1XD7 A;  6PAX A;  4LD5 A;  5H20 A;  4ESB A;  4Q47 A;  2Z33 A;  2RNJ A;  1J0R A;  4A12 A;  2W84 A;  3DPT A;  3LQR A;  4XSZ F;  3KEO A;  3O6B B;  2V6C A;  3WTW C;  5LRR A;  3CO7 C;  4A0Z A;  2EA4 A;  4MGR A;  2HYG D;  3NQO A;  3B73 A;  5ICG A;  2FBK A;  3IL2 A;  3IWZ A;  1SD5 A;  2W85 A;  3WTT C;  1XCB A;  3M7G A;  5BPD A;  2L54 A;  3F72 A;  4KFC A;  4ZH4 F;  2CYY A;  5LLQ A;  3GZ6 A;  1TNS A;  1K79 A;  1H0M A;  1JGS A;  1T2K A;  3J81 K;  2MLG A;  4EJV A;  5L3G A;  2LNB A;  1RUO A;  1FNN A;  2VE8 A;  1H9T A;  3P9C A;  5CYV A;  2O8X A;  4FHT A;  4U7D A;  2Y48 A;  4GGG A;  4OIQ F;  3IKV A;  2LF7 A;  2QYO A;  3GX4 X;  2ZME B;  1HKT A;  4CHU A;  2G7U A;  1FY7 A;  2VN2 A;  3LST A;  2FSW A;  4ENN A;  3BJO A;  4P55 A;  3TDU C;  4LG0 A;  5DYM A;  2WC2 A;  3GFM A;  3MZY A;  3E6B A;  4YIF A; 
#chains in the Genus database with same CATH topology
 2DN0 A;  4F7Z A;  1ITY A;  4CXF A;  4KMU X;  5ICE A;  1L0O C;  1ZRF A;  2FA5 A;  4JQF A;  2DTZ A;  2HWV A;  1MMS A;  4Q4Z F;  3KP4 A;  4Y3O A;  3V7C A;  4WCG A;  1UMQ A;  2W4S A;  3H0G J;  1XC5 A;  1HDD C;  3HB9 A;  4YFN F;  1UZC A;  1IDZ A;  2QSF X;  1QZY A;  4PDK A;  3DCF A;  1ZKG A;  3RKX A;  3ELK A;  4I7H A;  4A6E A;  4E7S A;  2QA4 I;  3JRC A;  1Y8Q B;  3Q0W A;  2GM4 A;  2JA2 A;  3F8C A;  1WZ2 A;  2XKO A;  2CWE A;  5TJJ A;  3GVA A;  4LFU A;  4HDU A;  4BAC A;  4UXN A;  2FJ1 A;  2OPT A;  3ZXS A;  4CSW A;  4A3J J;  4RB2 C;  2ID6 A;  4BE1 A;  3RYR A;  4ZTJ A;  1PP7 U;  1QGP A;  1U5T A;  4V2G A;  2AQF A;  2UWM A;  2ECC A;  4XSX F;  2OCC H;  1KU2 A;  5KCM A;  3TL4 X;  3FXU A;  4S04 A;  3JRA A;  1QNT A;  1U5T C;  4A3K J;  1G3S A;  5EEA A;  5EJC A;  4ZYD A;  4U0W A;  2JK3 A;  1KZH A;  1K6O A;  1IUY A;  4MQ9 F;  3BZ6 A;  3L00 A;  3RQ4 A;  4AYB N;  2H27 A;  2MC4 A;  3GZ5 A;  2RNG A;  2CRG A;  3E97 A;  5FD6 A;  4OIP F;  3MN2 A;  2K3P A;  4Z2Y A;  3R0A A;  3HHG A;  2KIM A;  1ERD A;  1P4X A;  2LBF A;  2VT3 A;  4RA2 A;  4OMY A;  2DA6 A;  1A35 A;  2WV0 A;  3L2W A;  2OBP A;  2A07 F;  1HCR A;  1ZYR F;  3H5A A;  3TQN A;  2D2W A;  3G4S I;  1ONV A;  2AXT C;  2PEX A;  1WFX A;  3BDD A;  2XAS A;  2L7M P;  2UXX A;  3OYJ A;  5LFA A;  4P1W A;  4AIH A;  3F21 A;  1R5H A;  3OYG A;  4H0E A;  5HS8 A;  1ULY A;  1KGS A;  1RET A;  3HRU A;  4IF4 A;  1OMI A;  2VT2 A;  1IG7 A;  4HX4 A;  1HOM A;  1BR2 A;  2NVQ J;  5JHU A;  2R7Z J;  2QUF A;  4XKC A;  3FXM A;  1RUN A;  3M8J A;  4A3L J;  1BIA A;  1MJB A;  3CME I;  1U3E M;  3JAM K;  2ZSI B;  1FBU A;  3OYI A;  4R79 A;  4BQQ A;  1IN4 A;  3WU1 B;  2DDA A;  4Y33 A;  4UUT A;  2A6T A;  5BQT A;  3J81 Z;  2Y0M A;  1O3T A;  1SVL A;  2IGK A;  3SEQ A;  2BY3 A;  5KVR A;  2R4G A;  1ZRD A;  1QO0 D;  1TWG J;  4DJA A;  2KLO A;  2V1N A;  4W97 A;  4A3I J;  2HGC A;  3S2D J;  3DBH B;  4L9T A;  1P2F A;  5GPA A;  1UG0 A;  2K86 A;  3FXQ A;  2XSJ C;  2PMH A;  4M6X A;  1YS7 A;  3HHH A;  2M1B A;  3P9I A;  1RR7 A;  2HVS A;  2B0L A;  2DQR A;  3BG6 A;  5K1Y A;  5FRO A;  4IPA A;  1B6A A;  3K6G A;  3HOT A;  3OIP A;  5LGU A;  5A2Q K;  2CV1 A;  2EFP A;  1VI0 A;  2R5Z B;  4MFD A;  3L2U A;  4O3M A;  4XLP F;  1TZL A;  4BY1 J;  2P6T A;  1T0F A;  3PNY A;  4IJA A;  4P9F A;  2IW5 A;  5HS7 A;  3S1Q J;  1ETV A;  3A4C A;  1Z7U A;  3ESW B;  2DFF A;  1K7A A;  4ZYE A;  3H5N A;  1YRN A;  1SAX A;  1YYV A;  3HUG A;  3PM1 A;  5EDN A;  2CU7 A;  2HOE A;  3LSP A;  5TRD A;  1IXC A;  3LSM A;  3VYU B;  2OTL I;  2DW4 A;  4XIC A;  3MEX A;  2JUG A;  2VI6 A;  3NWT A;  3GWZ A;  3IRR A;  3ZMT A;  3HJE A;  4M71 A;  2LSO A;  3WGG A;  5LRS A;  3GTP J;  2KFD A;  2KIQ A;  1BR1 A;  1B59 A;  3GFL A;  5KNL A;  1SEU A;  4PZJ A;  1R22 A;  2LR8 A;  1XG1 A;  4YEJ A;  2CV0 A;  2V1D A;  5FKM A;  2BXY A;  4LB6 B;  4J00 A;  1DPR A;  1I3Q J;  2XAJ A;  2VL8 A;  1EH6 A;  3GBG A;  4RGR A;  2E7W A;  4PJN A;  3KP2 A;  2DMP A;  4HF1 A;  2L01 A;  5D5W B;  2FE3 A;  2VKD A;  2VJ5 A;  3Q3S A;  3T0Y A;  3TW6 A;  2NYX A;  4QIW N;  5HDK A;  3TDZ C;  2P7C B;  1JXS A;  4GYI A;  3S15 J;  2XC7 A;  2CUJ A;  4XOR A;  3I58 A;  4RAY A;  4FE7 A;  1IN6 A;  2STT A;  1ZGW A;  1X58 A;  2GBY A;  2GIZ A;  3B6A A;  1W7P D;  4LG3 A;  4N4O B;  3V8J A;  5E8G A;  1TL8 A;  1HBX G;  4IRG A;  2ISZ A;  1WJE A;  5E3L A;  2DCE A;  1ETQ A;  3L09 A;  3SQN A;  2YU3 A;  3G1L A;  3OS1 A;  2HEO A;  5AIQ A;  3K4B A;  2XF6 A;  5E20 A;  1GHC A;  4KT6 A;  2J5P A;  1I1S A;  1IF1 A;  1U5T B;  5LGN A;  2DXI A;  1YIO A;  1MMN A;  2DBB A;  1F1Z A;  3S14 J;  4M3E A;  1GVD A;  2ZKZ A;  4QPO A;  1I6H J;  1WHU A;  4WWC A;  1X1A A;  3CP2 A;  4A2U A;  4ASN A;  4BJT A;  4IRI A;  4L0Y B;  4RGS A;  2QGU A;  2V9K A;  2GAU A;  1FBS A;  2K5C A;  3K10 A;  3HSR A;  2I8D A;  1GXP A;  2W00 A;  4NQW B;  2XRL A;  2FBI A;  3K1N A;  4I2O A;  4IEJ A;  1YHQ I;  3QU6 A;  3DKY A;  3OYH A;  4EGZ A;  4BBS J;  2X1E A;  2Y0S A;  2DOF A;  5CQG A;  5KAF C;  1FIA A;  5K5O A;  3QOE A;  1ETW A;  2HVQ A;  2O6G E;  4LIT A;  3BR6 A;  5J40 A;  3N05 A;  3EUK L;  1B72 B;  1JJ6 C;  5BNG A;  3WHC A;  3MQ0 A;  3RSN A;  2IRF G;  1T56 A;  2W48 A;  4LGW A;  4CYC A;  4AIJ A;  3QQA A;  3I4P A;  4XLC A;  3BPX A;  3M1C A;  1T95 A;  4A3E J;  4I99 C;  2CGP A;  4RB1 A;  1PYV A;  1TBX A;  2K85 A;  1JKR C;  2WB1 A;  2LFB A;  3DXJ F;  2VBW A;  3V7S A;  1TW3 A;  1I3A A;  3S32 A;  4DNC A;  2L5Q A;  3ZPL A;  3ZN1 A;  1U9N A;  2F5E A;  4B3A A;  2CFO A;  3T5X A;  1ZQ3 P;  3RZO J;  2EA2 A;  5LEJ A;  2AXL A;  2BVM A;  2V1U A;  1SC7 A;  1IRG A;  1S7O A;  3KLN A;  2DTR A;  4I02 A;  5DD8 A;  1HXD A;  3GTQ J;  4PJM A;  1ENH A;  2HDC A;  4IQ4 A;  2A69 F;  3I54 A;  2VJI A;  3ZQF A;  3EDP A;  1SAN A;  1J09 A;  3KYL A;  1A5J A;  4M3F A;  5H6R A;  1JGG A;  4HW0 A;  5J6X A;  1FYM A;  2OCE A;  4YII A;  1FYK A;  4E7H A;  5HDG A;  4I98 B;  2CW0 F;  5IOZ A;  4QPQ A;  1XCV A;  2Y9Y A;  3J7Z I;  1Q1V A;  4FET A;  4C3I J;  2M7B A;  4E7I A;  1TWH J;  2YUS A;  1O3R A;  1N25 A;  4ZYH A;  5DD4 A;  1YW9 A;  4BDY A;  1VQ8 I;  3PFI A;  2X6Y A;  3SDB A;  1WVR A;  3K4J A;  4XRS G;  1UG2 A;  4FT8 A;  3JRF A;  1BR4 A;  3I9V 2;  3FIW A;  3GTO J;  3GLL A;  1ZRC A;  1ZR4 A;  5H6Q A;  2DFI A;  2ZC2 A;  1DPU A;  3EYY A;  3O8H A;  2LKS A;  4O5V A;  2HKO A;  1IN7 A;  3AFH A;  2DK5 A;  2R7S A;  1CGP A;  1ZGJ A;  1NK3 P;  1R1U A;  1Y1W J;  1GLN A;  3A01 B;  2CS3 A;  4HST A;  3FBN B;  3Q9V A;  1QZE A;  1P7I A;  4NNJ A;  1DUX C;  1HKQ A;  2OZU A;  5EGO A;  4CGZ A;  5EEG A;  5M5X J;  1B1B A;  4CCO A;  1Y56 A;  3HC7 A;  1TT0 A;  5JFR A;  2L02 A;  4E7Z A;  3HRS A;  3X2Q H;  3RDI A;  3BTI A;  1AOY A;  4KN7 X;  2ZJR F;  1P9Q C;  1X3U A;  3HOV J;  1QPI A;  2Y9Z A;  4AIK A;  3EUA A;  2PBI A;  2CUE A;  5E3M A;  3L2V A;  1FIP A;  2L7F P;  3VOD A;  5B66 C;  1X1B A;  1D1C A;  2NS0 A;  1BI1 A;  1QA6 A;  2Q1Z B;  2PMZ N;  1RKT A;  1U78 A;  1EF4 A;  4II3 A;  1R4M B;  4BQN A;  1SMT A;  1MNM C;  3AG3 H;  2ZME A;  3F8F A;  3CDH A;  2ID3 A;  2R5Y B;  3DF8 A;  4HQE A;  2ISY A;  3CCM I;  2A61 A;  2CW8 A;  3T1B A;  3TOB A;  1D5Y A;  1TT5 B;  2DT6 A;  2QWW A;  3F23 A;  1S8N A;  2QZ8 A;  1T08 B;  2L7K A;  4BDZ A;  1U2W A;  3GCM A;  4UVB A;  1JUS A;  4CDG A;  5FRM A;  3BG7 A;  1YLF A;  2MH2 A;  4BYY A;  3AL0 C;  3VOE A;  3W6V A;  2P4W A;  4E7L A;  1O3S A;  5M3F J;  3SFI A;  2CFX A;  5FGM A;  5IT9 K;  3A0H C;  3EET A;  1SVO A;  4B8X A;  3J80 Z;  3BCA A;  3F3X A;  2DMN A;  3VPR A;  3NWS A;  4ENM A;  4U0V A;  1Z9C A;  4A6D A;  1K61 A;  2VBZ A;  1PVE A;  3MKL A;  1DU6 A;  2A6E F;  1I39 A;  4HAM A;  1VQ6 I;  1UAA A;  3GME A;  1IN8 A;  2V26 A;  1SFU A;  1OCO H;  1XN7 A;  2K9L A;  3PNV A;  1MMD A;  3FKI J;  1Z91 A;  2F6C A;  2JN6 A;  4F93 B;  2QBY A;  1LB2 A;  2PJP A;  3K4L A;  3PJR A;  1AHD P;  3OYE A;  2VXD A;  3VB2 A;  2BGC A;  2PI0 A;  5EZG A;  3VWB A;  3O2P E;  3D1N I;  3WOD F;  3H0D A;  5FLX Z;  2HFH A;  3TKY A;  1O7F A;  1Z21 A;  2K40 A;  2KDO A;  1YX3 A;  1JHF A;  2LD5 A;  2A5Y B;  2E1M C;  5AIP A;  1UFM A;  3BPV A;  1JUM A;  5ERI A;  2CJJ A;  1VQ5 I;  3VYR B;  2DI3 A;  1TC3 C;  1K83 J;  5GAE J;  1DP7 P;  4BHP A;  5IT3 A;  3FXJ A;  4F91 B;  4LLL A;  2F2E A;  1T6S A;  1LDD A;  4D7M A;  3B6C A;  3W6K B;  1SMY F;  5IOY A;  3JR9 A;  3SYT A;  1Q1H A;  2M4K A;  2XAF A;  1WCM J;  4HPQ A;  4Y13 A;  5FJ8 J;  2F5C A;  2IT0 A;  3M8F A;  1OKR A;  3LSI A;  3EUH A;  3HTS B;  1AA7 A;  1ZGA A;  2P8T A;  4L5I A;  1FC3 A;  3BG3 A;  1FMW A;  2MH9 A;  3FMQ A;  2V79 A;  1UST A;  3EUH C;  5E8I A;  2VC1 A;  4E7J A;  4A3C J;  2E2H J;  4FAS D;  1X2M A;  2IA1 A;  2TDX A;  2JRT A;  4KNY A;  2DPD A;  3S17 J;  3C2G A;  1KU9 A;  2NOJ B;  2ZJ2 A;  3ECO A;  2M5W A;  2JSP A;  3IKT A;  3CCU I;  3EQL F;  4B47 A;  2XPU A;  3S3O A;  4XQF A;  2NVU B;  4UVC A;  1X3Z B;  5LEK A;  2M45 A;  4UVA A;  1A6Q A;  2ELK A;  1R58 A;  3RCO A;  1F4K A;  1MSF C;  3H92 A;  2HVR A;  2M0C A;  3W6J B;  1X19 A;  4EQQ A;  4QTR A;  3IUO A;  2OQR A;  4M9S A;  3IP4 B;  5K5Q A;  1UHS A;  2UXN A;  3BG5 A;  3H9Q A;  3KE2 A;  2EZL A;  1MSE C;  3E6D A;  4XRF A;  3OV8 A;  1JE8 A;  4DZP A;  3LA3 A;  3HOW J;  3NRV A;  3E5U A;  5HLG A;  2HI3 A;  1POG A;  3SEZ A;  1NHA A;  4RGX A;  3BC8 A;  2M30 A;  1SAU A;  1ETY A;  1KU3 A;  3CCV I;  1R5G A;  3OL3 A;  5E1X A;  3ZQG A;  1MBJ A;  2H94 A;  1SFE A;  5D6E A;  4UB6 C;  2V7F A;  5EGO B;  5JVT A;  4BJ5 C;  2RN7 A;  3E6M A;  3QPH A;  2A68 F;  4BXU A;  1C0W A;  1BM9 A;  4ANJ A;  1SFO J;  3JCU C;  1W4M A;  3DTI A;  3NEU A;  2JVG A;  2MAB A;  1WJC A;  4RAG A;  2WAQ N;  4F55 A;  5LGT A;  4IO9 F;  4L5J A;  4HZF A;  4QLC U;  5CPR B;  5CVR A;  2HQN A;  2UUZ A;  2R7U A;  5K7H A;  3CC7 I;  1K4S A;  5J4V A;  3JRE A;  3CC4 I;  4A3B J;  1Z6T A;  2QQA A;  4R1H A;  1VND A;  4EM2 A;  1XB4 A;  1Y39 A;  4ZDO A;  1FYL A;  4D7N A;  4TV7 A;  3CCY A;  5L3C A;  3WGI A;  2EV5 A;  1VQP I;  2RKH A;  2ZJQ F;  3H5R A;  3HL2 A;  1KQ9 A;  5H2F C;  2DFH A;  1V5F A;  4RDU A;  4BGD A;  3TP3 A;  3QPL A;  3DV8 A;  3OYC A;  2DO7 A;  1WWX A;  2KMU A;  4BE0 A;  5JLX A;  3HSF A;  1V5G A;  4BQO A;  1SFX A;  1FEX A;  3VYS B;  3CCS I;  1SD4 A;  1IRF A;  1Z3Y A;  1CQT A;  3AL0 B;  4RAZ A;  2PQ8 A;  2V9V A;  2Y2Z A;  2K4J A;  1TQI A;  1UHW A;  3RPU A;  1S6L A;  5L3B A;  3LAP A;  4M72 A;  2WY8 Q;  4LK0 F;  3TMO A;  3HTU A;  2L3D A;  3QOP A;  4G9Y A;  3ZQC A;  5BMZ A;  1A04 A;  1MDM B;  1FT9 A;  3LFK A;  2M9H A;  5F1R A;  1XGO A;  5HOO A;  1R23 A;  5D5V B;  2HTS A;  2O03 A;  2X9D A;  3CC2 I;  2FMY A;  5GAG J;  4OMZ A;  4XOT A;  1S29 A;  2CV2 A;  1MIJ A;  2O3F A;  2XF5 A;  3Q9S A;  3MKZ A;  4ZC3 A;  1ETX A;  4XLF A;  2QBY B;  1ON1 A;  3TW7 A;  5FFZ A;  2RV8 A;  3K2Z A;  2X6X A;  2L4M A;  4K2E A;  4BXF A;  4IRH A;  4QWQ A;  3WE3 A;  1HSJ A;  1YW8 A;  3CUQ C;  3BY6 A;  4M9Z A;  1OCT C;  1TWC J;  4LJZ F;  3KEY A;  2QSG X;  4PCQ A;  2E1M B;  1LVA A;  3FHZ A;  4KIC A;  5FRN A;  3FK7 A;  1Z05 A;  4G94 A;  1E2X A;  1ZHF A;  2Y69 H;  3WG7 H;  4LOC A;  4ESJ A;  4RAF A;  3HOY J;  3JW4 A;  1MZB A;  5IP6 A;  2JA8 J;  2E5N A;  2EFQ A;  3ASO H;  2IGN A;  4F92 B;  2XAH A;  1YO5 C;  1YJN I;  5CKT A;  4NQW A;  1MJA A;  1QQI A;  1SVM A;  2VQG A;  5JI6 A;  4HEA 2;  3L2R A;  1XGN A;  3KET A;  1Z6R A;  5IY5 H;  3S1N J;  3CP8 A;  1VTN C;  3K0L A;  4ZDL A;  2G9W A;  1DP3 A;  2FX0 A;  5E18 F;  3KZI C;  3BOQ A;  4EV0 A;  2JUC A;  1I27 A;  4UB8 C;  3E3V A;  2PN6 A;  4B09 A;  1LKX A;  3F22 A;  2NXN B;  4N9I A;  4EM1 A;  2VBY A;  1RPW A;  2DLL A;  1B72 A;  4OIO F;  5C44 J;  4BJ6 C;  2Q2E B;  2MG4 A;  4RB0 A;  1TQM A;  2Z99 A;  2STW A;  2HYF A;  1VQL I;  2JTV A;  3OSG A;  5D4R A;  1VQ7 I;  1RIO H;  2ZB9 A;  5M5W J;  2I5U A;  2LLK A;  3FM3 A;  4PUS A;  3BCB A;  3WU2 C;  3JRD A;  4AD9 A;  1XGS A;  2IVM A;  2XRO A;  2O61 A;  3M1E A;  2M3A A;  1ZH5 A;  2BBY A;  1J5Y A;  1KYZ A;  5CLS A;  4IHX A;  4PK4 A;  2VC0 A;  1T38 A;  2OAZ A;  5E3N A;  1JKO C;  1OFC X;  2NAZ A;  1PJR A;  5KHD A;  3PQJ A;  2XAG A;  5B5E C;  1YIJ I;  1WGX A;  3SJM A;  2ZJP F;  2WV1 A;  2M87 A;  1B4A A;  3GTM J;  3ZRG A;  3MD2 A;  3MWM A;  2QEN A;  1W5T A;  1J7K A;  4MTD A;  3CJN A;  3KP5 A;  3K70 D;  3OYD A;  1APL C;  3J7A O;  1RR8 C;  4ITV A;  3MKY B;  4XLH A;  2ESH A;  3O3K A;  3FKJ A;  2CH0 A;  3KYC B;  3OYB A;  3HZJ A;  2FQ3 A;  4MFE A;  1TLH B;  4EJT A;  2AQE A;  4EAT A;  1HC8 A;  1D5V A;  2JA7 J;  1F36 A;  2KRC A;  2MLK A;  2X4H A;  3BG9 A;  1DDN A;  2R92 J;  1V3F A;  3RQI A;  4HYE A;  3CCR I;  3C2H A;  3QAH A;  1EA3 A;  3OYN A;  2XDV A;  2HDD A;  5FD5 A;  1XGM A;  3S93 A;  3KX2 A;  1FJL A;  2IXS A;  3JSO A;  3HXL A;  5LHG A;  2GA1 A;  3V8L A;  2Y31 A;  1Y0U A;  2F5D A;  2JVH A;  4Z6Y A;  3A01 A;  4M3D A;  3CDI A;  3VSK A;  1O7L A;  4S05 A;  1OYI A;  1BIB A;  5HLI A;  4M3G A;  3ULQ B;  1IRX A;  2GZW A;  2HKX A;  2KL4 A;  3CCQ I;  2WTE A;  2EZK A;  4HX8 A;  2KJC A;  3P7N A;  1AWC A;  3KLO A;  1FPQ A;  1N75 A;  2CG4 A;  3GLX A;  2X85 A;  4IOA F;  3J7Y J;  1K6Y A;  3ROU A;  1G8X A;  2ICW G;  1MH4 A;  1BW5 A;  3BLY A;  2BY2 A;  3JTG A;  2IA2 A;  3U1K A;  3BQZ A;  2L2O A;  1H8A C;  3CO6 C;  2DK8 A;  5IYC J;  4X0G A;  3ZQH A;  4DW6 A;  4BHB A;  4C2M J;  5LHH A;  2ME6 A;  3CCE I;  1MNE A;  3FHN A;  3CMY A;  2IS2 A;  4Q48 A;  2HXO A;  2NS8 A;  2QQ8 A;  2R5Y A;  2H1L A;  5ED4 A;  2V4J C;  1J59 A;  3SZG A;  3JRB A;  3CUQ B;  3ABT A;  5D8K B;  1G3T A;  1EH8 A;  3WGH A;  2R7R A;  2M8G X;  3GW2 A;  1E3O C;  1QPM A;  4AVZ A;  4HV6 A;  1IW7 F;  4PGG A;  4G7Z F;  1RES A;  2OQG A;  2XIG A;  1KQ8 A;  2DA4 A;  2HOS A;  1X4P A;  3DEU A;  3CLO A;  2NRA C;  3UR3 C;  5E1W A;  4H4K C;  2LY9 A;  4OAY A;  1I5Z A;  3MFK A;  2V9P A;  4CIC A;  3CMM A;  2DMQ A;  2HZT A;  3E5Q A;  3HYI A;  4OOI A;  4HF2 A;  3H3Z A;  1FMV A;  3ZN0 A;  2KRF A;  2IJL A;  3AG2 H;  3WHB A;  4L0Z B;  3ASN H;  2QQ9 A;  2ZCW A;  1FWZ A;  3BTC A;  1FOK A;  4BL0 B;  2HOT A;  2EJR A;  3TO9 A;  1O3Q A;  3M4O J;  3QYF A;  3DP7 A;  4LIV A;  2K4B A;  3AG1 H;  3HKZ N;  2LKP A;  2VE9 A;  3OY9 A;  4KYW A;  2FEZ A;  2BYV E;  1IV8 A;  4L9N A;  3E5X A;  2YX4 A;  3DQV C;  3DLL F;  3CF5 F;  1I1G A;  2UV1 A;  4P5O A;  3PO2 J;  2DAO A;  3I56 I;  1W1W E;  1W36 D;  3DBR B;  2K9S A;  3M3Y J;  3FIS A;  1QU3 A;  3GO5 A;  1PUF B;  1P4A A;  1RI7 A;  5IYD J;  1LUJ B;  1XSX A;  3FX3 A;  1S3J A;  1GXQ A;  5HLT A;  4OU0 A;  1YTY A;  4KJZ A;  3U21 A;  1XMX A;  3ZOB A;  1OYW A;  3JAM Z;  1U0J A;  3V7R A;  1NK2 P;  3OIQ A;  2VQC A;  2JT1 A;  1OCP A;  3QPS A;  2LP0 A;  4IHT A;  2YU9 J;  1VZ0 A;  4M73 A;  2PFB A;  2ZXW H;  1UJ8 A;  3IHU A;  3K4K A;  3GTJ J;  1ZN2 A;  1YE9 A;  3E7L A;  5ILU A;  2HOA A;  3J7A Y;  3GUD A;  3ZMU A;  5B1B H;  1RC9 A;  1AKH A;  4CZC A;  2COM A;  4RLQ A;  1F43 A;  2JWT A;  3WTU C;  2KDZ A;  3Q0U A;  2GXB A;  3T8R A;  5A2Q Z;  2TCT A;  5EYR A;  2RQP A;  2KIU A;  5TIS C;  3KEQ A;  2H09 A;  3KFW X;  4CCN A;  4IL6 C;  3ZMS A;  2QVO A;  3C18 A;  3PQK A;  3OYA A;  2K02 A;  5K7Z A;  4RGU A;  1HST A;  1STZ A;  2M4G A;  2XKP A;  2MYS A;  2OJE D;  4BXX J;  2KP6 A;  2R7T A;  2MC3 A;  2OV7 A;  4N0B A;  3JSP A;  2GLO A;  2P5L C;  1OCR H;  2F4M B;  4E4H A;  4X6A J;  3RPQ A;  2FD5 A;  3I53 A;  3HOX J;  3I4M J;  2AHQ A;  3BR5 A;  4BU2 A;  1GDT A;  3OL4 A;  2DOE A;  1G3W A;  2GQQ A;  5HOD A;  3FMS A;  2DYR H;  3PUB A;  4L5E A;  1HLV A;  2HYJ A;  3I64 A;  1NG6 A;  3U9G A;  2EIL H;  3BR3 A;  1WJA A;  2JA5 J;  4G6T B;  1QBJ A;  2DYS H;  5J1Y A;  5DS9 A;  2HDW A;  2DOD A;  1W0U A;  1YJ9 I;  4BQA A;  4AUX A;  2VOO A;  1O57 A;  1T8I A;  3CD6 I;  4QSH A;  5TGT A;  3F8N A;  3S3M A;  3CZ6 A;  3DEW A;  1LFP A;  4NC8 A;  5DUI A;  1R5I D;  3H1C A;  3F9K A;  3K4N A;  4AID A;  3SZT A;  2HPI A;  2QLZ A;  4RLF A;  3VEP A;  1IGN A;  2XAU A;  2KJB A;  3WE2 A;  5K5R A;  4II2 A;  2E71 A;  4GCV A;  3C3W A;  1LDK B;  3OOU A;  3R6S A;  4FE4 A;  1FP2 A;  4OIR F;  4L18 B;  2W24 A;  3EYI A;  1ZG5 A;  3G73 A;  2KIF A;  3LFU A;  5DCF A;  3V42 A;  4EEF G;  4CCJ A;  1PP8 F;  2QKL B;  4B44 A;  3HBL A;  1VQK I;  4C30 A;  1LFU P;  2ECB A;  1D1A A;  1Y6I A;  3VDX A;  1V5E A;  3ERE D;  2VON A;  4EJW A;  1VQO I;  2E34 A;  3Q0V A;  4OIN F;  1BL0 A;  2HTJ A;  1RZ4 A;  4GXO A;  2FU4 A;  1OIS A;  3TO7 A;  5J8C A;  1IRZ A;  2FOK A;  1R00 A;  2FBH A;  3BT9 A;  5CJ9 A;  2JPC A;  1P6R A;  2BW3 B;  3REO A;  1JHH A;  5CVU A;  5F0F A;  1L3L A;  2FXA A;  5CVI A;  2COB A;  2B9S A;  4C3H J;  4EVI A;  1V54 H;  2IPQ X;  2LOO A;  2NVY J;  2PMZ A;  3R4K A;  4X1E A;  5E1Z B;  3E0J B;  1VQM I;  5GAH J;  1PDN C;  2JSC A;  2W57 A;  1LQ1 A;  5DDG A;  1S7E A;  2A5W A;  2CO5 A;  5CVV A;  3S8P A;  3N97 A;  1MDM A;  2XRN A;  3HSE A;  2CQX A;  4YG2 F;  5DM7 F;  5EZH A;  3V8K A;  2WA0 A;  1S72 I;  2VKE A;  1W7P B;  2EBI A;  3OR1 C;  2DT5 A;  2ELH A;  2XVC A;  2W82 A;  4JBA A;  5IP9 J;  3CUO A;  3K2A A;  4E70 A;  1BBY A;  4L9V A;  4NC6 A;  1R36 A;  3NAU A;  2DMT A;  3CDL A;  1W5C C;  2LG4 A;  5D4S A;  2PG4 A;  1B9N A;  2XGD A;  5K7F A;  2BY1 A;  1WKM A;  1N77 A;  5DV5 A;  5AON A;  1EH7 A;  1ETO A;  2BZT A;  3K9T A;  3H9J A;  2EFO A;  3DPL C;  1W0T A;  2UZK A;  4CZZ A;  4B3X A;  2RQQ A;  1FLI A;  3FZV A;  1X1D A;  1J75 A;  3G2B A;  1BC7 C;  2QEX I;  1DU0 A;  4NC7 A;  5JHF A;  3A02 A;  1TWA J;  1EJ9 A;  2BEO A;  3PSF A;  1HW5 A;  1IDY A;  5HDN A;  1MBE A;  1Z0X A;  2XV4 S;  2RRE A;  2L7Z A;  3D5L A;  3UNG C;  2HNH A;  2PJR A;  2QSH X;  3TO6 A;  1FBQ A;  2KIS A;  1OR7 A;  3IH3 A;  3JRH A;  5FKK A;  3S16 J;  1ZAO A;  1G4D A;  3UKG A;  5HS9 A;  3DLA A;  2NOG A;  1OR7 C;  4HOB A;  1R1V A;  4C9Y A;  1D3Y A;  1OCZ H;  1WJD A;  5HLH A;  3LSK A;  4L9J A;  4G7O F;  2X0L A;  3VYT B;  1I6X A;  1IN5 A;  1MBK A;  2D45 A;  3SHF A;  1YJW I;  1ZEL A;  3QPT A;  1SD6 A;  4Y52 J;  2MD5 A;  2VAS A;  1X3W B;  1AKH B;  1MMA A;  5KK1 A;  1QVT A;  2O5R A;  2XPW A;  4G12 A;  5DEQ A;  3ZMV A;  2Q2E A;  3DEE A;  2R3S A;  2Z3Y A;  3LOC A;  1CF7 B;  1UEL B;  2MFZ A;  3OSF A;  1MH3 A;  4W1U A;  1BJZ A;  3DTK A;  1TP4 A;  1BI2 A;  1Z1D A;  2QM3 A;  3L9F A;  4UUV A;  4V19 K;  3ECH A;  4UY8 I;  4PSW A;  4XR6 A;  2IGM A;  2NNY A;  4GRI A;  4WF2 A;  4FIS A;  2J5O A;  1KU7 A;  3DKX A;  2XSD C;  1XMK A;  1ZLK A;  5D8L B;  3WTY C;  5FFX A;  4XL9 A;  1Y8R B;  4S0H B;  2IS6 A;  2P81 A;  3ONQ A;  2X51 A;  4JX5 A;  1LPQ A;  2BVL A;  3IAM 2;  4E6K G;  3W2A A;  3DFG A;  4HQM A;  4Y15 A;  3H3V K;  4EMS A;  3OYK A;  4ZZL A;  4A3M J;  1IJW C;  2CSO A;  2QKM B;  2HZD A;  2Z16 A;  1S9H A;  5M3M J;  1LVK A;  4BE2 A;  1XMA A;  4NBQ A;  3I4N J;  1ZG3 A;  2XPV A;  3QRF F;  4FX4 A;  2Q0O A;  4DOZ A;  1KYW A;  2D5V A;  2WAE A;  4ENJ A;  4XM3 A;  4IHS A;  4B1R A;  2VXZ A;  5CQE A;  3MZH A;  4FX0 A;  2GXG A;  2H1K A;  2MSY A;  4N4N B;  3GFJ A;  4PJ0 C;  1BOB A;  2EFN A;  3FF5 A;  3GF2 A;  3HEF A;  4LMY A;  3IC7 A;  4RBO A;  1S7A A;  1K78 B;  1D8K A;  4MIM A;  3V4G A;  4MHG A;  2PMU A;  4IOC F;  1TNT A;  2E19 A;  2ZXI A;  3GZN B;  2KRH A;  1KA8 A;  4C2T A;  2B7E A;  2R7D A;  3FMR A;  4EJO A;  1FZP B;  2XGX A;  3GYH X;  3I0T A;  3HG9 A;  3N4M A;  4J19 A;  1JI8 A;  2CUF A;  2WAQ A;  3QWL A;  4C3J J;  2FOW A;  5IT9 Z;  1SD7 A;  3HOU J;  5C4X J;  3AKZ A;  2G7H A;  2DPU A;  3MMY B;  3ZR8 X;  4Y7N J;  3ZQL A;  3OOP A;  1TQP A;  3KZZ A;  4M6V A;  5F0C A;  1R1T A;  1UHM A;  5DCM B;  4ABZ A;  4CO8 A;  5EG0 B;  1R9T J;  4F3Q A;  1HDP A;  3RPU D;  2R0Q C;  2K9N A;  1R4N B;  4MO7 A;  4JP0 A;  3TP0 A;  4JYK A;  4AU7 A;  2EH3 A;  4MLO A;  3T8T A;  3CJT B;  3ML6 A;  4A69 C;  2LRD A;  2DA2 A;  3FBI B;  2DDB A;  4I0B A;  4MEX F;  1XDS A;  2EQR A;  2VKH A;  1D8J A;  1O4X A;  2EB7 A;  2RGV A;  4OAZ A;  5JR3 A;  3OYF A;  3M07 A;  1A36 A;  3KCC A;  1E17 A;  4HG2 A;  3BR0 A;  3CTA A;  3OYM A;  1AU7 A;  4JX4 A;  1I50 J;  1UCR A;  1B8I B;  2BE5 F;  4ZYG A;  1Z77 A;  3PUF A;  3CUQ A;  4KIT B;  1GV2 A;  1QZZ A;  2YX7 A;  3HOZ J;  1LEB A;  3RZD J;  1BC8 C;  1LNW A;  2Y30 A;  3AAF A;  1XSD A;  4A3G J;  3WG9 A;  5L3F A;  5F1J A;  3L7W A;  1NH3 A;  1H88 C;  2L9S A;  1A6I A;  3L2C A;  4D0P A;  5IPA A;  5JLW A;  3TBI A;  3G1M A;  2A6H F;  4UNO A;  1G3Y A;  4AC0 A;  1MBG A;  2ZNZ A;  4M74 A;  1FSE A;  3CMA I;  4J01 A;  3R61 A;  2GA2 A;  4ZJZ A;  5ICF A;  1UB9 A;  2JJ7 A;  3RIR A;  3FM5 A;  4PSX A;  2PJR B;  2RC4 A;  4CH7 A;  4ESF A;  3IWF A;  3BQY A;  3ZCO A;  4HBL A;  2IGO A;  1R7J A;  2LF8 A;  3BTL A;  2Z5U A;  4AM3 A;  1MD0 A;  3BJ6 A;  4DBR A;  1T39 A;  4XBF A;  2JMW A;  3I3L A;  2ETH A;  3M9A A;  4EGY A;  3B02 A;  3QU3 A;  1Z3X A;  5GTH C;  4BNC A;  2DU9 A;  2M8E A;  2BHZ A;  1E3H A;  3K7A J;  1QHG A;  4BEH B;  1PUF A;  4I01 A;  3KPH A;  4AYB A;  3LA2 A;  4XK4 A;  4A3F J;  2E60 A;  1W5S A;  4WXD A;  1USS A;  1ZLJ A;  3HRM A;  1REP C;  2FQ4 A;  4A0Y A;  2NVT J;  3K1M A;  3R0J A;  5GPC A;  4RB3 C;  1XX5 A;  1D1B A;  2EIK H;  1MBF A;  2FNP A;  2MW8 A;  4A0X A;  4CCM A;  3RYP A;  1OJL A;  3K69 A;  1NG7 A;  4KIS A;  2KT0 A;  3RI4 A;  4YIR X;  3ERM A;  3HGY A;  4ZZD A;  2BV6 A;  3QP5 A;  4EM0 B;  2O8K A;  1MBH A;  4YRV A;  1WPK A;  5FLV A;  1ODD A;  4MNU A;  2VIX A;  3K1P A;  4XRS A;  3D0S A;  2VPR A;  3VFZ A;  2OC6 A;  4DYQ A;  3CQZ J;  1T33 A;  2K27 A;  3ZQ7 A;  4D5C A;  2LRE A;  4IHV A;  4LB5 A;  1GUU A;  2VPL A;  4HDV A;  2LDU A;  5D6F A;  2LVS A;  3D5R C;  4DYC A;  2CQN A;  5LD2 C;  1U9O A;  3CJQ B;  5E79 C;  4BKX A;  2YSR A;  3U1D A;  2OUM A;  4KIB A;  3G71 I;  1MW7 A;  2W7N A;  3OR2 C;  4BAY A;  2VB6 A;  4N9H A;  2P7V B;  4U7B A;  2KHM A;  4WK8 F;  3LSG A;  2RVC A;  2C6Y A;  1G6N A;  3LNQ A;  1GVJ A;  4AVP A;  4HV5 A;  1ZAR A;  2D1H A;  1BI0 A;  3WTS C;  4V2F A;  4G6D A;  2XB5 A;  2EV0 A;  3S2W A;  1H89 C;  2X6O A;  2OU2 A;  1R49 A;  4U88 A;  1R71 A;  2YS9 A;  4KN4 X;  5FLM J;  1D0Y A;  3I71 A;  2OF7 A;  3ABL H;  2JZY A;  2XAQ A;  4IHW A;  1WQ2 A;  1QRY A;  1NTC A;  5B1A H;  3LSJ A;  5B3S H;  3OIO A;  5DM6 F;  1LJ9 A;  3LL7 A;  2ESN A;  2VUM J;  2JRM A;  2M2E A;  4I09 A;  3HOS A;  1P7J A;  2ZXH A;  3QYB A;  2IP2 A;  2E36 A;  2OZ6 A;  1JTY A;  2Q8K A;  4NB5 A;  1LDJ A;  5DUK A;  3DPU A;  1TWF J;  3K70 C;  2EZI A;  2CQK A;  2EPF A;  1DGW Y;  3OWT A;  1MJ9 A;  1T98 A;  2GWR A;  3DKW A;  1XDU A;  2O0Y A;  1IZ1 A;  3QYE A;  5J47 A;  2TRT A;  1U8R A;  1WSU A;  3FDY A;  3FK6 A;  3I59 A;  1YG2 A;  2PX9 A;  3MAJ A;  1V4R A;  3ZMZ A;  3KP7 A;  3S3N A;  1WJB A;  2CUZ A;  2MGQ A;  4HLX A;  1U8B A;  5F04 A;  4BBR J;  2BY0 A;  4HF0 A;  1ACI A;  3BZK A;  2P5V A;  1T0F C;  4KMF A;  1FX7 A;  1FP1 D;  3DU5 A;  2G0E A;  5E3O A;  2X6W A;  4IXA A;  3ZMD A;  2H8R A;  2CQQ A;  3TOA A;  4DGW B;  2R7W A;  3ABM H;  3HGG A;  1E3P A;  3S1R J;  5LHI A;  2E1O A;  2IAI A;  4UV9 A;  1YI2 I;  3ABK H;  2H6B A;  5C3E J;  5J8F A;  2GIV A;  2ZNY A;  4KT5 C;  4BUP A;  1G59 A;  2XB0 X;  2HQR A;  3CCL I;  3H9G A;  4LG0 B;  3GTK J;  1MKM A;  2LY1 A;  1J9I A;  3IRQ A;  3L2Q A;  1ZR2 A;  3C2B A;  3D5S C;  3F8B A;  3DU6 A;  2LC2 A;  2F5F A;  3RKQ A;  4P96 A;  2JPB A;  2H8W A;  3SFZ A;  5E17 F;  2BW3 A;  4WX9 A;  3LQQ A;  4HNT A;  1HW2 A;  4HA8 A;  1MGT A;  3PIP F;  4NHJ A;  4YFX F;  2DA1 A;  3C1D A;  2ADU A;  1BJA A;  1KON A;  4M9X A;  4PFP A;  1OYY A;  3RTR A;  4XLE A;  2L9V A;  3G3Z A;  1TTY A;  3P9K A;  4YEL A;  4LLN A;  5GAD J;  2HS5 A;  4PJJ A;  5BOX A;  5HNH A;  4ZDP A;  3KP6 A;  5ICC A;  2WWY A;  1W7P A;  4GO1 A;  1KQ0 A;  3F8M A;  2Z1D A;  5CVJ A;  1J2X A;  2DT7 B;  2ZFW A;  4WXC A;  5FB2 A;  1JJ8 C;  1VFC A;  2MA3 A;  4LLG F;  2R7Q A;  1H9G A;  2XGC A;  4A5N A;  4JK1 X;  1VF9 A;  2XHK A;  3BP8 A;  5F64 A;  4XLN F;  4XKW A;  2XGE A;  4BY7 J;  1QHH D;  4FQG A;  3FXR A;  1HKS A;  2MBF A;  1IXR C;  3KIO A;  1EKE A;  2ZO4 A;  4UV8 A;  2Y0S N;  4Y4R A;  3PL8 A;  4Q5S F;  2JA6 J;  3BRO A;  3I5U A;  4XN0 A;  2KPM A;  1Z67 A;  2HQ5 A;  2DA7 A;  1MMG A;  2HPM A;  4LK1 F;  5ILS A;  3GEZ A;  4HLY A;  2F4O B;  2N8G A;  2I10 A;  1IC8 A;  3BJA A;  1F9N A;  1WJ5 A;  2H6C A;  2GOX B;  4A93 J;  5ILV A;  4HNV A;  1WI3 A;  4MTE A;  4DYR A;  3HKZ A;  4I76 A;  3WTZ A;  2BXZ A;  2V1X A;  3PFY A;  1P92 A;  3J80 K;  3DBL B;  4WXH A;  2LBF B;  2XF7 A;  2W25 A;  4LIU A;  1F5T A;  4ETS A;  4M6Y A;  4GFB A;  5F6F A;  1JTX A;  3H36 A;  3SXY A;  2LMD A;  2RAE A;  2O7O A;  2WB1 N;  3HPG A;  3CCJ I;  1BN5 A;  3RKW A;  4G7H F;  2ZXJ A;  3I55 I;  3L1P A;  2ZSH B;  3GTL J;  5J3L A;  5D5X B;  4B48 A;  1OLT A;  2FNA A;  1LE8 A;  4CYD A;  3WTV C;  2ZFU A;  3PNT A;  2DOA A;  4DQ2 A;  2VBX A;  5FKO A;  4HNU A;  3PO3 J;  3ISP A;  2LYC A;  3PSI A;  2GOM A;  1W36 C;  2EFW A;  4KA4 A;  1OPC A;  1S5L C;  3H3U A;  2EV6 A;  2VLA A;  4ENK A;  4UUS A;  3ZQQ A;  5HVQ C;  2FRH A;  2ZBK A;  1CF7 A;  5FLX K;  3R60 A;  1ETK A;  2A3S A;  2GXA A;  2D1V A;  1YQA A;  1N78 A;  3G6E I;  1IV6 A;  5BPI A;  4IX7 A;  4DBQ A;  4KDP A;  2E2J J;  3W3C A;  3O8G A;  2K3F A;  1GV5 A;  4AWX B;  1PUE E;  1JKP C;  2L4A A;  3W2W A;  4A5M A;  1FSH A;  1JT6 A;  3U2R A;  3JTH A;  2HQA A;  1MND A;  3F0C A;  3COA C;  4GDF A;  3IH2 A;  4CUG A;  2YR2 A;  2M0M A;  2K9M A;  2R7O A;  2PLY A;  3DWL E;  1ZTR A;  2NVX J;  4I0A A;  2KKO A;  3CF2 A;  4CA0 A;  1IXS B;  3HDD A;  3NAR A;  3K4M A;  4RM3 A;  4XKV A;  2EWN A;  4XMY A;  4NDL A;  1X1P A;  2DFE A;  1Y1V J;  2E1N A;  3E1S A;  3TED A;  3KP3 A;  4JOM A;  1X1C A;  3CJR B;  1Z7L A;  4O6J A;  4PGH A;  5L3E A;  1XSV A;  2VJJ A;  4IHY A;  2OTJ I;  3Q5F A;  4P9U A;  3HPH A;  1DGR M;  3I59 B;  2Y75 A;  2VOD A;  4UHT A;  2L0K A;  3A03 A;  3MZ8 A;  2AS5 F;  4MQV A;  2DQL A;  4G8X A;  4RS8 A;  2DA5 A;  2WAD A;  5GP9 A;  3EPZ A;  1K78 A;  4C2U A;  2OA4 A;  1YRN B;  4BH9 A;  2E1C A;  3HUG B;  4D9J A;  5F0H A;  1FOW A;  5EEH A;  5LBQ A;  3M8E A;  1E0E A;  4PJL A;  3IV5 A;  3LMM A;  5D5U B;  5FO5 A;  4KUM A;  4HX7 A;  3CES A;  2ME0 A;  3PIO F;  3SDG A;  4U0Y A;  1HF0 A;  4G6Q A;  2BHY A;  3ZP5 A;  4B43 A;  1XTA A;  3IH4 A;  3FWE A;  2RDP A;  3IAS 2;  1ORK A;  1R6R A;  4FCY A;  5DCM A;  2M34 A;  5EG0 A;  4BHC A;  1TW2 A;  1ZG1 A;  2Z2S B;  2OD5 A;  3F6O A;  4XID A;  3OS0 A;  3HIF A;  3TGN A;  3GFI A;  2LTP A;  4IQJ A;  3RKY A;  3F6V A;  1IUF A;  4PFO A;  4ZYA A;  2WAF A;  9ANT A;  4DIQ A;  3ZGK A;  1WI9 A;  2IA0 A;  1FOX A;  1WJF A;  2FML A;  5GTI C;  1HW1 A;  1LEA A;  3BR1 A;  3RJP A;  2ZME C;  3LSH A;  1HA8 A;  2F48 A;  1D0Z A;  2VJ4 A;  1YS6 A;  3QP6 A;  2P6S A;  1OCC H;  5F08 A;  2NNN A;  2E7X A;  4IKF A;  1YFH A;  4KIG A;  5IYB J;  2R7F A;  3LA7 A;  2YPR A;  1EV7 A;  2X1C A;  1B8I A;  5HNF A;  3HRT A;  1WRJ A;  1P4W A;  1BA5 A;  1LFB A;  1K4T A;  2M7A A;  4CCK A;  2W1O A;  1RKW A;  2AO9 A;  4XNF A;  2VOP A;  1RNL A;  1ON2 A;  1DQU A;  4Y17 A;  1B9M A;  4XN3 A;  1SFK A;  3BWG A;  3VSL A;  4MEY F;  2EK5 A;  3OMY A;  3QOD A;  4KIF A;  4R8H A;  2QCO A;  3A0B C;  3WTX C;  1M1E B;  2DMU A;  1YIT I;  2L9N A;  3A1Y A;  1YW7 A;  2R93 J;  3E6C C;  1JUP A;  3C7J A;  1ZRE A;  2LKX A;  3ABU A;  3LWF A;  4IVN A;  2K7L A;  2WBM A;  5J1U A;  3LAJ A;  1YX5 A;  2HR3 A;  2XUB A;  2F4I A;  1RRJ A;  2FF4 A;  1BOA A;  4FTH A;  1QVU A;  1BI3 A;  1U6G A;  5F27 A;  4XRM A;  1IAW A;  4XLA A;  5L3D A;  2JQ7 A;  4CYC B;  4HSR A;  1Y0N A;  3MCZ A;  1LE8 B;  2QQB A;  4GYG A;  4EJU A;  2X48 A;  2R7X A;  1VQ4 I;  2P5K A;  3OS2 A;  5BS6 A;  3WU0 A;  2P0W A;  3GXO A;  2E5Z A;  4RM2 A;  3JRI A;  2O9L A;  3KZY A;  4BEH A;  3SZP A;  2ACJ A;  4UUS B;  2IS1 A;  1HQC A;  4YFK F;  3S2H J;  4DZJ A;  3FXL A;  4ON0 A;  2Z9O A;  1D0X A;  1XD7 A;  6PAX A;  2EIN H;  4LD5 A;  5H20 A;  4B4C A;  3P5J A;  1GT0 C;  4ESB A;  4Q47 A;  2Z33 A;  3ZQI A;  2K9Q A;  2F5V A;  1A31 A;  2RNJ A;  4M3B A;  1X4O A;  1J0R A;  4A12 A;  4HRI A;  3H35 A;  1FTZ A;  2W84 A;  3DPT A;  3LQR A;  4XSZ F;  2MD0 A;  5J1R A;  2DA3 A;  1VQN I;  3KEO A;  1BW6 A;  2IEK A;  5M5Y J;  2B63 J;  3O6B B;  2LH9 A;  2V6C A;  1WH7 A;  3WTW C;  4NUB A;  5LRR A;  3BTJ A;  2IBD A;  1XS9 A;  3BR2 A;  3CO7 C;  3FXO A;  4A0Z A;  5JVG F;  4IZZ A;  3MVP A;  2EA4 A;  4E7K A;  4MGR A;  4I6Z A;  4JX6 A;  2E2I J;  2R7V A;  2HYG D;  2CMP A;  2VKV A;  1JT0 A;  3NQO A;  2QF7 A;  5FKL A;  3B73 A;  4A3D J;  4D5F A;  5ICG A;  5FKN A;  2FBK A;  3IL2 A;  3S1M J;  2ELJ A;  1JKQ C;  3IWZ A;  2A05 A;  2HXI A;  1SD5 A;  2CQ7 A;  2W85 A;  5C4J J;  3HM5 A;  3WTT C;  1XCB A;  3M7G A;  5BPD A;  5KAI C;  3DTE A;  1ZK8 A;  1OQY A;  2L54 A;  2DJI A;  3F72 A;  4F52 A;  1FOY A;  5EF6 A;  4KFC A;  4ZH4 F;  2DJN A;  2FUG 2;  2CYY A;  5LLQ A;  3GZ6 A;  3CLQ A;  1TNS A;  3K4C A;  2HU9 A;  1K79 A;  2VQH A;  2L9R A;  3OYL A;  1H0M A;  1JGS A;  1T2K A;  4BS9 A;  2X1D A;  2MLG A;  4XON A;  4EJV A;  5L3G A;  3J81 K;  1WH5 A;  3G1O A;  2LNB A;  1RUO A;  1FNN A;  4ZTF A;  2VE8 A;  2R5Z A;  1H9T A;  2EZH A;  3P9C A;  3JRG A;  1VQ9 I;  2KZV A;  2LK2 A;  5CYV A;  2O8X A;  4XOP A;  2IS4 A;  5DTD A;  2LY2 A;  5J4Y A;  4FHT A;  2E35 A;  5IP7 J;  4U7D A;  3LSR A;  1XPX A;  2WY7 Q;  2V6E A;  3W2V A;  2Y48 A;  3AG4 H;  4D1Q A;  4GGG A;  1YOV B;  4OIQ F;  3IKV A;  2LF7 A;  2QYO A;  3GX4 X;  2CW7 A;  2BOL A;  2ZME B;  1HKT A;  4CCL A;  4CHU A;  3GTG J;  4OWR B;  2VQL A;  2G7U A;  4XKB A;  2KZG A;  1FY7 A;  2VN2 A;  1V55 H;  2FSW A;  3LST A;  3BJO A;  3BZC A;  4ENN A;  3FXK A;  4P55 A;  4U87 A;  1FTT A;  3TDU C;  4LG0 A;  1IO2 A;  1X2N A;  4RMN A;  5DYM A;  2WC2 A;  2NS7 A;  3KYD B;  3GFM A;  3MZY A;  3E6B A;  3MKW B;  3A2K A;  2EIM H;  1G2H A;  2EIJ H;  4YIF A;  2KQR A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  4CXF A;  4KMU X;  5ICE A;  1L0O C;  1ZRF A;  2FA5 A;  4JQF A;  2HWV A;  4Q4Z F;  3KP4 A;  3V7C A;  4WCG A;  4YFN F;  1QZY A;  4PDK A;  4H0E A;  3RKX A;  3ELK A;  4I7H A;  4A6E A;  3F8C A;  2XKO A;  2CWE A;  5TJJ A;  3GVA A;  4LFU A;  4HDU A;  4UXN A;  4RB2 C;  3RYR A;  1PP7 U;  1QGP A;  1U5T A;  2UWM A;  4XSX F;  1KU2 A;  3FXU A;  4S04 A;  1QNT A;  1U5T C;  1G3S A;  4ZYD A;  4U0W A;  1K6O A;  1IUY A;  4MQ9 F;  3BZ6 A;  3L00 A;  2H27 A;  3GZ5 A;  5FD6 A;  3E97 A;  4OIP F;  4Z2Y A;  3R0A A;  3HHG A;  2KIM A;  1P4X A;  2VT3 A;  4OMY A;  2WV0 A;  2OBP A;  2A07 F;  1ZYR F;  3TQN A;  2D2W A;  1ONV A;  2PEX A;  3BDD A;  2XAS A;  2UXX A;  4AIH A;  3F21 A;  1R5H A;  5HS8 A;  1ULY A;  1KGS A;  3HRU A;  4IF4 A;  1OMI A;  2VT2 A;  4HX4 A;  5JHU A;  2QUF A;  1RUN A;  1BIA A;  1MJB A;  1U3E M;  3JAM K;  1FBU A;  4R79 A;  1IN4 A;  3WU1 B;  5BQT A;  3J81 Z;  1O3T A;  2Y0M A;  5KVR A;  1ZRD A;  1QO0 D;  2HGC A;  4L9T A;  1P2F A;  2K86 A;  3FXQ A;  2PMH A;  4M6X A;  1YS7 A;  3HHH A;  2M1B A;  3P9I A;  2B0L A;  2DQR A;  5K1Y A;  4IPA A;  1B6A A;  3HOT A;  5LGU A;  5A2Q K;  2EFP A;  4O3M A;  4XLP F;  2P6T A;  1T0F A;  4IJA A;  5HS7 A;  4P9F A;  2IW5 A;  1Z7U A;  1K7A A;  4ZYE A;  1SAX A;  1YYV A;  3HUG A;  2HOE A;  5TRD A;  1IXC A;  2DW4 A;  3MEX A;  3GWZ A;  3IRR A;  3ZMT A;  3WGG A;  4M71 A;  2LSO A;  5LRS A;  3GFL A;  1B59 A;  4PZJ A;  1R22 A;  2V1D A;  4LB6 B;  1DPR A;  2XAJ A;  4RGR A;  1EH6 A;  2E7W A;  3KP2 A;  4HF1 A;  2L01 A;  5D5W B;  2FE3 A;  3T0Y A;  5HDK A;  2NYX A;  3TDZ C;  2P7C B;  1JXS A;  4GYI A;  3I58 A;  4RAY A;  2STT A;  1IN6 A;  1W7P D;  3V8J A;  5E8G A;  1HBX G;  4IRG A;  2ISZ A;  3L09 A;  3SQN A;  2YU3 A;  2HEO A;  5AIQ A;  5E20 A;  1GHC A;  2J5P A;  1I1S A;  1IF1 A;  1U5T B;  5LGN A;  2DBB A;  1YIO A;  1F1Z A;  2ZKZ A;  4WWC A;  4A2U A;  4ASN A;  4IRI A;  4L0Y B;  4RGS A;  2GAU A;  1FBS A;  3HSR A;  1GXP A;  2FBI A;  3K1N A;  4I2O A;  3QU6 A;  4EGZ A;  5K5O A;  2O6G E;  3MQ0 A;  2IRF G;  4LGW A;  4AIJ A;  3I4P A;  3BPX A;  2CGP A;  4RB1 A;  1TBX A;  3DXJ F;  2VBW A;  3V7S A;  1TW3 A;  4DNC A;  3ZPL A;  3ZN1 A;  2F5E A;  3T5X A;  2EA2 A;  5LEJ A;  2AXL A;  2V1U A;  1IRG A;  1S7O A;  3KLN A;  2DTR A;  4I02 A;  5DD8 A;  1HXD A;  2HDC A;  2A69 F;  3I54 A;  3EDP A;  5H6R A;  4HW0 A;  5J6X A;  1FYM A;  4YII A;  1FYK A;  5HDG A;  4I98 B;  2CW0 F;  1XCV A;  1O3R A;  4ZYH A;  5DD4 A;  1YW9 A;  3PFI A;  4FT8 A;  1ZRC A;  5H6Q A;  2DFI A;  1DPU A;  3EYY A;  4O5V A;  2HKO A;  1IN7 A;  2DK5 A;  1CGP A;  1ZGJ A;  1R1U A;  3Q9V A;  1DUX C;  1HKQ A;  2OZU A;  4CGZ A;  5EEG A;  1B1B A;  5JFR A;  2L02 A;  3HRS A;  3RDI A;  1AOY A;  4KN7 X;  1X3U A;  4AIK A;  2PBI A;  3VOD A;  2NS0 A;  1BI1 A;  1U78 A;  1SMT A;  2ZME A;  3F8F A;  3CDH A;  3DF8 A;  4HQE A;  2ISY A;  2A61 A;  3T1B A;  3TOB A;  2QWW A;  3F23 A;  1S8N A;  2QZ8 A;  1U2W A;  4UVB A;  4CDG A;  1YLF A;  2MH2 A;  4BYY A;  3VOE A;  2P4W A;  1O3S A;  2CFX A;  5FGM A;  5IT9 K;  3EET A;  4B8X A;  3J80 Z;  3F3X A;  1Z9C A;  4ENM A;  4U0V A;  4A6D A;  2VBZ A;  2A6E F;  4HAM A;  1IN8 A;  1SFU A;  1XN7 A;  1Z91 A;  2QBY A;  1LB2 A;  2PJP A;  3VB2 A;  2PI0 A;  2BGC A;  3O2P E;  3WOD F;  5FLX Z;  2HFH A;  3TKY A;  1O7F A;  1JHF A;  2A5Y B;  5AIP A;  1UFM A;  3BPV A;  5ERI A;  2DI3 A;  1DP7 P;  4BHP A;  5IT3 A;  4LLL A;  2F2E A;  1T6S A;  1LDD A;  3W6K B;  1SMY F;  1Q1H A;  2XAF A;  4Y13 A;  2IT0 A;  2F5C A;  3M8F A;  1OKR A;  3EUH A;  3HTS B;  1ZGA A;  2P8T A;  4L5I A;  1FC3 A;  2MH9 A;  3FMQ A;  2V79 A;  1UST A;  5E8I A;  2VC1 A;  2IA1 A;  2TDX A;  2JRT A;  4KNY A;  2DPD A;  1KU9 A;  2ZJ2 A;  3ECO A;  2M5W A;  3IKT A;  3EQL F;  4UVC A;  5LEK A;  2M45 A;  4UVA A;  1R58 A;  1F4K A;  3H92 A;  3W6J B;  4EQQ A;  2OQR A;  4M9S A;  5K5Q A;  2UXN A;  3KE2 A;  3E6D A;  4XRF A;  3OV8 A;  1JE8 A;  3LA3 A;  3NRV A;  3E5U A;  5HLG A;  1NHA A;  4RGX A;  2M30 A;  1KU3 A;  1R5G A;  5E1X A;  2H94 A;  1SFE A;  5D6E A;  5JVT A;  2RN7 A;  3E6M A;  3QPH A;  2A68 F;  4BXU A;  1C0W A;  1BM9 A;  1W4M A;  3NEU A;  5LGT A;  4L5J A;  4HZF A;  4QLC U;  5CVR A;  2HQN A;  1Z6T A;  2QQA A;  4R1H A;  4EM2 A;  1XB4 A;  1FYL A;  4TV7 A;  5L3C A;  3WGI A;  2EV5 A;  2RKH A;  1KQ9 A;  3DV8 A;  2DO7 A;  1WWX A;  3HSF A;  1SFX A;  1SD4 A;  1IRF A;  4RAZ A;  2PQ8 A;  2V9V A;  2K4J A;  1TQI A;  1UHW A;  3RPU A;  1S6L A;  5L3B A;  3LAP A;  4M72 A;  4LK0 F;  3HTU A;  2L3D A;  3QOP A;  4G9Y A;  5BMZ A;  1A04 A;  1MDM B;  1FT9 A;  3LFK A;  5F1R A;  1XGO A;  5HOO A;  1R23 A;  5D5V B;  2HTS A;  2O03 A;  2FMY A;  4OMZ A;  1S29 A;  2O3F A;  3Q9S A;  2QBY B;  1ON1 A;  5FFZ A;  2RV8 A;  3K2Z A;  2L4M A;  4K2E A;  4IRH A;  4QWQ A;  3WE3 A;  1HSJ A;  1YW8 A;  3BY6 A;  3CUQ C;  4M9Z A;  4LJZ F;  4PCQ A;  1LVA A;  3FHZ A;  4KIC A;  1Z05 A;  4G94 A;  1E2X A;  1ZHF A;  4ESJ A;  3JW4 A;  1MZB A;  2EFQ A;  2XAH A;  1YO5 C;  4NQW A;  1MJA A;  1QQI A;  5JI6 A;  1XGN A;  3KET A;  1Z6R A;  1VTN C;  3K0L A;  2G9W A;  5E18 F;  3BOQ A;  4EV0 A;  1I27 A;  3E3V A;  2PN6 A;  4B09 A;  3F22 A;  4EM1 A;  4N9I A;  2VBY A;  2DLL A;  4OIO F;  4RB0 A;  1TQM A;  2Z99 A;  2STW A;  2HYF A;  2JTV A;  5D4R A;  1RIO H;  3FM3 A;  4AD9 A;  1XGS A;  2IVM A;  2XRO A;  2O61 A;  3M1E A;  1ZH5 A;  2BBY A;  1J5Y A;  1KYZ A;  5CLS A;  2VC0 A;  1T38 A;  2OAZ A;  2NAZ A;  3PQJ A;  2XAG A;  2M87 A;  1B4A A;  3MWM A;  2QEN A;  1W5T A;  1J7K A;  4MTD A;  3CJN A;  3KP5 A;  3J7A O;  2ESH A;  3O3K A;  2FQ3 A;  1TLH B;  4EJT A;  1D5V A;  2MLK A;  2X4H A;  1DDN A;  1V3F A;  4HYE A;  3QAH A;  5FD5 A;  1XGM A;  3JSO A;  5LHG A;  2GA1 A;  3V8L A;  1Y0U A;  2F5D A;  4S05 A;  1O7L A;  1OYI A;  1BIB A;  5HLI A;  3ULQ B;  2GZW A;  2HKX A;  2WTE A;  4HX8 A;  2KJC A;  3P7N A;  1AWC A;  3KLO A;  1FPQ A;  2CG4 A;  3GLX A;  3ROU A;  3JTG A;  2IA2 A;  3CO6 C;  2DK8 A;  4BHB A;  5LHH A;  4Q48 A;  5ED4 A;  1J59 A;  3CUQ B;  3ABT A;  5D8K B;  1G3T A;  1EH8 A;  3WGH A;  3GW2 A;  1QPM A;  4HV6 A;  1IW7 F;  4PGG A;  4G7Z F;  2OQG A;  2XIG A;  1KQ8 A;  3DEU A;  2NRA C;  3CLO A;  5E1W A;  1I5Z A;  3MFK A;  4CIC A;  3E5Q A;  3HYI A;  2HZT A;  4OOI A;  4HF2 A;  3H3Z A;  3ZN0 A;  2KRF A;  2IJL A;  4L0Z B;  2QQ9 A;  2ZCW A;  1FWZ A;  1FOK A;  2EJR A;  3TO9 A;  1O3Q A;  3DP7 A;  2K4B A;  2LKP A;  2VE9 A;  4KYW A;  2FEZ A;  2BYV E;  4L9N A;  3E5X A;  2YX4 A;  3DQV C;  1I1G A;  4P5O A;  2DAO A;  3GO5 A;  1P4A A;  1RI7 A;  1XSX A;  3FX3 A;  1S3J A;  1GXQ A;  4OU0 A;  1YTY A;  1OYW A;  3JAM Z;  3V7R A;  2JT1 A;  4IHT A;  4M73 A;  2PFB A;  3IHU A;  1ZN2 A;  5ILU A;  3GUD A;  3ZMU A;  2COM A;  3WTU C;  2GXB A;  3T8R A;  5A2Q Z;  2RQP A;  2KIU A;  3KEQ A;  2H09 A;  3KFW X;  3ZMS A;  2QVO A;  3C18 A;  3PQK A;  2K02 A;  4RGU A;  1HST A;  1STZ A;  2XKP A;  2MC3 A;  4N0B A;  3JSP A;  2P5L C;  3RPQ A;  3I53 A;  1G3W A;  2GQQ A;  3FMS A;  3I64 A;  3U9G A;  1QBJ A;  4BQA A;  2VOO A;  1O57 A;  3F8N A;  5DUI A;  3SZT A;  3VEP A;  2QLZ A;  2KJB A;  3WE2 A;  5K5R A;  4GCV A;  3C3W A;  1LDK B;  3R6S A;  1FP2 A;  4OIR F;  4L18 B;  2W24 A;  3EYI A;  1ZG5 A;  3G73 A;  2KIF A;  5DCF A;  1PP8 F;  3ERE D;  2VON A;  4EJW A;  4OIN F;  2HTJ A;  1RZ4 A;  4GXO A;  2FU4 A;  3TO7 A;  5J8C A;  2FOK A;  1R00 A;  2FBH A;  5CJ9 A;  2JPC A;  1P6R A;  3REO A;  1JHH A;  5CVU A;  1L3L A;  2FXA A;  5CVI A;  4EVI A;  2IPQ X;  3R4K A;  5E1Z B;  1PDN C;  2JSC A;  2W57 A;  1LQ1 A;  5DDG A;  2CO5 A;  5CVV A;  3N97 A;  1MDM A;  2XRN A;  3HSE A;  4YG2 F;  3V8K A;  1W7P B;  2DT5 A;  2ELH A;  2XVC A;  4JBA A;  3CUO A;  4E70 A;  1BBY A;  4L9V A;  1R36 A;  5D4S A;  2PG4 A;  1B9N A;  1WKM A;  5DV5 A;  5AON A;  1EH7 A;  3K9T A;  2EFO A;  3DPL C;  2UZK A;  4CZZ A;  1FLI A;  3FZV A;  1J75 A;  1BC7 C;  2BEO A;  1HW5 A;  5HDN A;  2XV4 S;  3D5L A;  3TO6 A;  1FBQ A;  1OR7 A;  1ZAO A;  1G4D A;  5HS9 A;  4HOB A;  1R1V A;  1D3Y A;  5HLH A;  4L9J A;  4G7O F;  2X0L A;  1I6X A;  1IN5 A;  2D45 A;  3SHF A;  3QPT A;  1SD6 A;  2MD5 A;  5KK1 A;  3ZMV A;  5DEQ A;  2Q2E A;  2R3S A;  2Z3Y A;  1CF7 B;  1BI2 A;  1Z1D A;  2QM3 A;  3L9F A;  4UUV A;  3ECH A;  2NNY A;  4WF2 A;  2J5O A;  1KU7 A;  1ZLK A;  1XMK A;  5D8L B;  3WTY C;  5FFX A;  3DFG A;  4HQM A;  4Y15 A;  4EMS A;  4ZZL A;  2CSO A;  1XMA A;  1ZG3 A;  3QRF F;  4FX4 A;  2Q0O A;  1KYW A;  4ENJ A;  4IHS A;  2VXZ A;  3MZH A;  4FX0 A;  2GXG A;  3GFJ A;  2EFN A;  3FF5 A;  3GF2 A;  4LMY A;  3IC7 A;  1S7A A;  1K78 B;  1D8K A;  3V4G A;  4MHG A;  2PMU A;  1TNT A;  1KA8 A;  4EJO A;  2R7D A;  3FMR A;  1FZP B;  2XGX A;  3GYH X;  3I0T A;  3N4M A;  5IT9 Z;  1SD7 A;  2G7H A;  2DPU A;  3OOP A;  1TQP A;  3KZZ A;  1R1T A;  1UHM A;  5DCM B;  4CO8 A;  3T8T A;  3ML6 A;  4I0B A;  4MEX F;  1XDS A;  1D8J A;  2EB7 A;  2RGV A;  5JR3 A;  3KCC A;  1E17 A;  3CTA A;  1UCR A;  2BE5 F;  4ZYG A;  3CUQ A;  1QZZ A;  2YX7 A;  1LEB A;  1BC8 C;  1LNW A;  3AAF A;  1XSD A;  3WG9 A;  5L3F A;  3L7W A;  3L2C A;  4D0P A;  2A6H F;  4UNO A;  1G3Y A;  2ZNZ A;  4M74 A;  1FSE A;  3R61 A;  2GA2 A;  5ICF A;  1UB9 A;  3RIR A;  3FM5 A;  2RC4 A;  4ESF A;  3IWF A;  4HBL A;  1R7J A;  2LF8 A;  2Z5U A;  1MD0 A;  3BJ6 A;  1T39 A;  4XBF A;  2ETH A;  3M9A A;  4EGY A;  3B02 A;  3QU3 A;  4BNC A;  2DU9 A;  2M8E A;  4I01 A;  3LA2 A;  1W5S A;  4WXD A;  1USS A;  1ZLJ A;  3HRM A;  1REP C;  4A0Y A;  3K1M A;  3R0J A;  4RB3 C;  2FNP A;  4A0X A;  3RYP A;  3K69 A;  3RI4 A;  4ZZD A;  2BV6 A;  3QP5 A;  4EM0 B;  1ODD A;  4MNU A;  3K1P A;  3D0S A;  3VFZ A;  2K27 A;  3ZQ7 A;  4LB5 A;  4HDV A;  2LDU A;  5D6F A;  2YSR A;  3U1D A;  4KIB A;  4U7B A;  4BAY A;  4N9H A;  2P7V B;  4WK8 F;  2RVC A;  2C6Y A;  1G6N A;  1GVJ A;  4AVP A;  4HV5 A;  1ZAR A;  2D1H A;  1BI0 A;  3WTS C;  4G6D A;  2EV0 A;  3S2W A;  2OU2 A;  4U88 A;  4KN4 X;  3I71 A;  2JZY A;  2XAQ A;  1WQ2 A;  1LJ9 A;  2ESN A;  4I09 A;  3HOS A;  2IP2 A;  2OZ6 A;  2Q8K A;  4NB5 A;  1LDJ A;  5DUK A;  2CQK A;  1MJ9 A;  1T98 A;  2GWR A;  3DKW A;  1XDU A;  2O0Y A;  1IZ1 A;  1U8R A;  1WSU A;  3I59 A;  1YG2 A;  3MAJ A;  1V4R A;  3ZMZ A;  3KP7 A;  4HLX A;  4HF0 A;  2P5V A;  4KMF A;  1FX7 A;  1FP1 D;  4IXA A;  3ZMD A;  3TOA A;  5LHI A;  4UV9 A;  2H6B A;  5J8F A;  2GIV A;  2ZNY A;  4KT5 C;  2HQR A;  4LG0 B;  1MKM A;  1J9I A;  3IRQ A;  3F8B A;  2F5F A;  4P96 A;  2JPB A;  3SFZ A;  5E17 F;  4WX9 A;  3LQQ A;  1HW2 A;  4HA8 A;  1MGT A;  4NHJ A;  4YFX F;  3C1D A;  2ADU A;  1BJA A;  4M9X A;  1OYY A;  3RTR A;  3G3Z A;  1TTY A;  3P9K A;  4LLN A;  2HS5 A;  5BOX A;  3KP6 A;  5ICC A;  2WWY A;  1W7P A;  4GO1 A;  1KQ0 A;  3F8M A;  5CVJ A;  1J2X A;  2ZFW A;  4WXC A;  5FB2 A;  2MA3 A;  4LLG F;  1H9G A;  4A5N A;  4JK1 X;  5F64 A;  2XHK A;  3BP8 A;  4XLN F;  3FXR A;  1HKS A;  2MBF A;  1IXR C;  2ZO4 A;  4UV8 A;  4Q5S F;  3BRO A;  3I5U A;  4LK1 F;  5ILS A;  3GEZ A;  4HLY A;  3BJA A;  1F9N A;  2H6C A;  5ILV A;  4MTE A;  3WTZ A;  2V1X A;  1P92 A;  3J80 K;  4WXH A;  2W25 A;  1F5T A;  4ETS A;  4M6Y A;  5F6F A;  3SXY A;  1BN5 A;  3RKW A;  4G7H F;  2ZXJ A;  5D5X B;  2FNA A;  4CYD A;  3WTV C;  4DQ2 A;  2VBX A;  3ISP A;  2EFW A;  4KA4 A;  1OPC A;  3H3U A;  2EV6 A;  4ENK A;  5HVQ C;  2FRH A;  2ZBK A;  1CF7 A;  5FLX K;  3R60 A;  2A3S A;  2D1V A;  1YQA A;  5BPI A;  4KDP A;  1PUE E;  4AWX B;  2L4A A;  4A5M A;  1FSH A;  3U2R A;  3JTH A;  3COA C;  2YR2 A;  2PLY A;  4I0A A;  2KKO A;  1IXS B;  2EWN A;  2E1N A;  3KP3 A;  4O6J A;  4PGH A;  5L3E A;  1XSV A;  3Q5F A;  4P9U A;  3I59 B;  2Y75 A;  2VOD A;  4UHT A;  2AS5 F;  4MQV A;  2DQL A;  4G8X A;  4RS8 A;  1K78 A;  2OA4 A;  4BH9 A;  2E1C A;  5LBQ A;  5EEH A;  3M8E A;  5D5U B;  5FO5 A;  4KUM A;  4HX7 A;  4U0Y A;  4G6Q A;  3ZP5 A;  3FWE A;  2RDP A;  5DCM A;  4BHC A;  1TW2 A;  1ZG1 A;  2OD5 A;  3F6O A;  3HIF A;  3TGN A;  3GFI A;  3RKY A;  3F6V A;  1WI9 A;  2IA0 A;  2FML A;  1HW1 A;  1LEA A;  3RJP A;  1YS6 A;  3QP6 A;  2P6S A;  2NNN A;  2E7X A;  1YFH A;  4KIG A;  2R7F A;  3LA7 A;  2YPR A;  1EV7 A;  3HRT A;  1WRJ A;  1P4W A;  2VOP A;  1RNL A;  1ON2 A;  4Y17 A;  1B9M A;  3BWG A;  4MEY F;  2EK5 A;  4KIF A;  4R8H A;  3WTX C;  1YW7 A;  3E6C C;  3C7J A;  1ZRE A;  3ABU A;  3LWF A;  4IVN A;  2K7L A;  3LAJ A;  2HR3 A;  2XUB A;  2FF4 A;  1BOA A;  1BI3 A;  1U6G A;  1IAW A;  5L3D A;  3MCZ A;  2QQB A;  4GYG A;  4EJU A;  2P5K A;  5BS6 A;  3WU0 A;  3GXO A;  3KZY A;  3SZP A;  2ACJ A;  1HQC A;  4YFK F;  4ON0 A;  2Z9O A;  1XD7 A;  6PAX A;  4LD5 A;  5H20 A;  4ESB A;  4Q47 A;  2Z33 A;  2RNJ A;  1J0R A;  4A12 A;  2W84 A;  3DPT A;  3LQR A;  4XSZ F;  3KEO A;  3O6B B;  2V6C A;  3WTW C;  5LRR A;  3CO7 C;  4A0Z A;  2EA4 A;  4MGR A;  2HYG D;  3NQO A;  3B73 A;  5ICG A;  2FBK A;  3IL2 A;  3IWZ A;  1SD5 A;  2W85 A;  3WTT C;  1XCB A;  3M7G A;  5BPD A;  2L54 A;  3F72 A;  4KFC A;  4ZH4 F;  2CYY A;  5LLQ A;  3GZ6 A;  1TNS A;  1K79 A;  1H0M A;  1JGS A;  1T2K A;  3J81 K;  2MLG A;  4EJV A;  5L3G A;  2LNB A;  1RUO A;  1FNN A;  2VE8 A;  1H9T A;  3P9C A;  5CYV A;  2O8X A;  4FHT A;  4U7D A;  2Y48 A;  4GGG A;  4OIQ F;  3IKV A;  2LF7 A;  2QYO A;  3GX4 X;  2ZME B;  1HKT A;  4CHU A;  2G7U A;  1FY7 A;  2VN2 A;  3LST A;  2FSW A;  4ENN A;  3BJO A;  4P55 A;  3TDU C;  4LG0 A;  5DYM A;  2WC2 A;  3GFM A;  3MZY A;  3E6B A;  4YIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...