1V4RA

Solution structure of streptmycal repressor trar
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Transcriptional Repressor
publication title Solution structure of Streptmycal repressor TraR
rcsb
source organism Streptomyces
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v4rA01
4CICA 4ZYEA 1PUEE 2W24A 4M9SA 4G9YA 4HF2A 2NNNA 5LGTA 4IVNA 1ZRDA 5BQTA 1FP1D 4BXUA 2O03A 4HOBA 5FFZA 1ZLJA 3HTSB 4KYWA 3QP6A 1NHAA 4WCGA 4Y15A 3WTWC 3I54A 5DCMB 2DW4A 5IT9K 1ZHFA 4ZZLA 2HTJA 3F3XA 3QU3A 2DU9A 3BDDA 2PMHA 2XUBA 4IJAA 5CVVA 2XHKA 2FNPA 4M74A 3WU0A 2FBHA 4HF0A 2EFOA 3WG9A 4H0EA 1RZ4A 2D1HA 1W5TA 1IXSB 1E2XA 4WXCA 2ADUA 2XASA 2L01A 4OIPF 1IN8A 2GWRA 5LBQA 3CUQA 2ETHA 2P7CB 3TO7A 3Q9SA 3WTTC 2FEZA 2ESNA 2GA1A 2JZYA 3KP5A 2KRFA 3F6OA 3R0AA 5IT9Z 2DPUA 2L4MA 2M1BA 3CO6C 1AOYA 3RYRA 1FYKA 4LLLA 3TQNA 3MEXA 4HLXA 4YFXF 2A6HF 2ZNZA 4HAMA 1HW2A 1EH8A 3S2WA 4L9NA 3CDHA 3M8EA 3BJAA 2D1VA 1XB4A 3GFMA 5K1YA 3RIRA 1BN5A 2OBPA 4OU0A 3HOSA 4A0YA 1Q1HA 2HGCA 2EK5A 2ZFWA 3GW2A 5F64A 3U2RA 4AD9A 1U5TA 4JBAA 2P5LC 1CF7A 3T8TA 3QP5A 2Q2EA 4WF2A 4EGYA 1IW7F 5H6RA 4I09A 2LNBA 3HOTA 1S8NA 1TQMA 3L7WA 1QZZA 2OA4A 3I59B 3WODF 4LK0F 2MC3A 4LB6B 3R6SA 1BC7C 2NYXA 5A2QK 1YQAA 1T2KA 2FRHA 3TDUC 2OU2A 2DQLA 2V1XA 1Z91A 3K2ZA 1PP7U 2G7HA 4EV0A 1ODDA 1ZG3A 1QO0D 1B59A 2XROA 2P7VB 2P8TA 1T6SA 1K7AA 2K02A 3HSFA 2VOOA 4A12A 2GXGA 3P9KA 1YIOA 1O3RA 2IA0A 2M87A 3MCZA 3R4KA 2BYVE 3C1DA 2EV5A 4UVCA 4RAYA 2CO5A 1UFMA 2MBFA 3SXYA 1W7PA 5J6XA 2ESHA 1OPCA 2ZKZA 1EH6A 4Z2YA 5A2QZ 1USSA 1SFUA 3ZQ7A 3ZN1A 1F5TA 5HDNA 2OZUA 3G3ZA 4CZZA 4KMFA 3IC7A 1LNWA 1W7PD 2A68F 5HLGA 3VOEA 1IRGA 1IXCA 4HBLA 4IRIA 2L02A 1KU2A 1JHFA 2UWMA 6PAXA 3R0JA 5LHIA 1RUOA 2VBZA 5ILSA 2XV4S 2X4HA 2W85A 2E1CA 1FSHA 1HKQA 4KICA 3QRFF 4MEYF 5D6EA 2VE9A 1F9NA 1HKSA 5HOOA 1KQ0A 1A04A 1QBJA 1QNTA 4AIJA 4G7HF 1FP2A 1P2FA 3T8RA 3DV8A 3COAC 5FGMA 3I64A 1XSVA 4UNOA 3DQVC 3BJOA 1YS6A 2L4AA 4OIOF 4A2UA 4EM2A 3REOA 1YW8A 4HW0A 1Z6TA 1XGMA 1O3QA 4M9ZA 4P9FA 1J5YA 3JW4A 2QENA 5E1ZB 1IN5A 3FMSA 1FWZA 3FXQA 2RN7A 2V6CA 4KFCA 2WC2A 2JSCA 4WXHA 5JR3A 4L9VA 3TOAA 1WKMA 5HDKA 3NRVA 4L0ZB 1S3JA 2QZ8A 3DKWA 2PLYA 4IPAA 4R1HA 1WRJA 2X0LA 5JVTA 3ZMZA 4BQAA 4U0WA 1SMTA 2RDPA 3HRTA 3IWFA 3KZZA 3J80K 2E7XA 1WQ2A 1BBYA 2IRFG 2DK8A 1MJ9A 2P5KA 2RGVA 2ZCWA 1TQPA 3V7SA 2EWNA 2OZ6A 3P9CA 1D8JA 5CVIA 3IKVA 2HKXA 4EM0B 3KP6A 1BJAA 4KN4X 2HFHA 2PEXA 5FLXK 4LLNA 2W84A 2FE3A 2BV6A 5H20A 3E5QA 5AONA 3E6BA 3GYHX 1G3YA 2VT3A 2QLZA 2EFNA 3CUOA 1H9TA 5L3GA 1I6XA 2UXXA 1MKMA 4KMUX 4MHGA 1IN7A 3SHFA 5FFXA 3J80Z 2Z33A 4GXOA 2M8EA 3GX4X 2MLKA 1B9NA 2NS0A 1DPRA 2P6SA 2H09A 4HDVA 1ZG5A 2LDUA 3GUDA 1PP8F 4XRFA 2IA2A 4LK1F 4ON0A 2W25A 1YYVA 4M6XA 2JT1A 5FLXZ 3K0LA 3TGNA 4L5JA 4GO1A 3K69A 3C7JA 1KGSA 5D4SA 3I4PA 2XGXA 1O57A 3O6BB 3I5UA 4LB5A 5ICCA 4K2EA 4RAZA 2P4WA 5HVQC 1UHMA 3ML6A 1TTYA 2A07F 1ON2A 1GXQA 3CJNA 3PFIA 3GFIA 5LHHA 5ICGA 1FBUA 5D8LB 4HX4A 2VC1A 5ICEA 3ISPA 3AAFA 1D8KA 4B09A 3F8CA 3SZPA 2WV0A 4RB2C 3BZ6A 2RKHA 3T5XA 4MQ9F 4PCQA 4A6EA 4OIQF 3MFKA 3G73A 1V4RA 3WTZA 3WE3A 1TNTA 5CYVA 3F22A 5J8CA 1U78A 2PQ8A 2OD5A 3LAJA 5F6FA 1K79A 5D8KB 3TOBA 5L3CA 3DPTA 5CVRA 3IKTA 3WE2A 3NEUA 1HKTA 4N9HA 4G8XA 2JRTA 3WGIA 2DPDA 2BE5F 3IL2A 1FX7A 1S7AA 1HSTA 2JTVA 5DCFA 3DP7A 2ZO4A 3DEUA 2F5DA 4U7DA 2RC4A 4LMYA 2HWVA 3I71A 2YPRA 2PI0A 3KCCA 4YG2F 4A5NA 2O8XA 4U0YA 3ELKA 4IHSA 1R00A 1BI3A 4RB1A 2Z3YA 1IN4A 3HRUA 4U0VA 3DF8A 1UB9A 2ZMEB 3V7RA 2DT5A 1Z1DA 2QQ9A 3WGHA 5BMZA 2FXAA 4IXAA 4UHTA 4MEXF 5D6FA 2DQRA 1LQ1A 4G7ZF 2DLLA 4OINF 3ZP5A 2PG4A 1H0MA 2F5FA 2O3FA 2CWEA 4JK1X 5HS9A 4Y13A 5KK1A 4BH9A 4P96A 3FXUA 2IT0A 4IRHA 2LKPA 4UV9A 4EVIA 5CVJA 2YX4A 3MWMA 2K4JA 4UXNA 4HZFA 1U6GA 2L54A 1F4KA 1T38A 4ZYGA 4XBFA 3ZMUA 3IRQA 2KKOA 4O3MA 4EQQA 5FD6A 3M8FA 3F72A 3U9GA 4HX8A 1KU9A 2G7UA 1FT9A 3KP7A 3QOPA 2VE8A 1LVAA 4HQMA 3QPTA 1GXPA 1Z9CA 3FF5A 3EYIA 4M9XA 3MAJA 2HDCA 3E5UA 5DUIA 3KP4A 1FYLA 4M72A 3K1MA 1VTNC 1R58A 1ZGJA 3GZ5A 3TO9A 3V8JA 4NHJA 5LEJA 3HUGA 2HKOA 5BS6A 3HIFA 5LEKA 1ZARA 2PBIA 2DBBA 2QVOA 1S7OA 1ZRCA 1LJ9A 4F7ZA 2L3DA 1LB2A 2EJRA 4FHTA 1ZN2A 2VBYA 3GXOA 4YFKF 2FBIA 2WWYA 2LF7A 4LG0B 4I0AA 4TV7A 2QUFA 1USTA 3OV8A 4AIHA 2HTSA 4GYIA 5LRRA 5BPIA 3WTUC 4IRGA 5D5WB 2ZNYA 1UCRA 2GQQA 4G6DA 3B02A 4LJZF 1YFHA 3N97A 4R79A 3RPQA 2FU4A 2XKOA 3CTAA 3EQLF 4KIFA 1SFEA 1XGOA 4PGHA 3O2PE 2V1UA 3ERED 2GA2A 3RJPA 1ZGAA 3FM3A 5E17F 1F1ZA 2HQRA 2IP2A 1BI0A 4ENKA 2Z5UA 5E8GA 3BPXA 1BC8C 1T98A 3RYPA 2E7WA 4FX4A 5AIQA 4EJVA 5FD5A 2FSWA 1P4AA 1IUYA 3IRRA 2COMA 2Y0MA 1U2WA 4BYYA 5JHUA 2EV0A 4IHTA 4LGWA 2IPQX 5D5VB 3Q5FA 3WU1B 2O6GE 3V7CA 2MD5A 4AVPA 2FOKA 3ZMVA 4GCVA 2H27A 3ABTA 1KA8A 1I5ZA 4HQEA 1R36A 2CFXA 4RB0A 1FC3A 5AIPA 4DQ2A 3VEPA 1AWCA 1D3YA 1KU7A 1J9IA 3U1DA 1STZA 4P9UA 3MZHA 2K86A 4HDUA 1CGPA 2CGPA 4KN7X 4MGRA 1FLIA 5BPDA 4XSXF 3BPVA 3BWGA 2GIVA 2O61A 4GGGA 4I98B 4QLCU 2J5PA 5DCMA 1JXSA 4P55A 2F5EA 4CO8A 1R1VA 3BROA 1S6LA 3F8FA 3GFLA 2PMUA 3HSRA 1KQ8A 3HHGA 4G94A 2M45A 2F5CA 2AS5F 1KU3A 1LDKB 2ISZA 4EJTA 1FSEA 4D0PA 1XGSA 2VC0A 4AWXB 1OYWA 4B8XA 2IVMA 1C0WA 1G4DA 4M71A 2GZWA 2OQRA 1J75A 1SMYF 1RI7A 1EH7A 3D5LA 3WTSC 1XN7A 2FF4A 3JTGA 3VFZA 1B6AA 2J5OA 3M7GA 1MJAA 1YS7A 1R23A 1U8RA 3J7AO 5F1RA 2EB7A 1B9MA 1KYWA 4S04A 3LA2A 5CJ9A 1BI2A 1BM9A 3KP3A 4RGXA 5DDGA 1R22A 2RNJA 3HRSA 2Z99A 3IHUA 2Z9OA 3KETA 5K5OA 4NB5A 1IAWA 4CYDA 1ZLKA 4Y17A 1YO5C 4P5OA 3EDPA 2YU3A 3I58A 5DYMA 1HXDA 2VONA 1JHHA 3WGGA 1U5TB 1CF7B 3I59A 4PDKA 4FT8A 4QWQA 1TBXA 5EEHA 2MA3A 2V9VA 1TW3A 2V1DA 1SD4A 3LA7A 2HZTA 4L5IA 3ZPLA 2H6BA 2D45A 2EFQA 1QQIA 2ZXJA 2VODA 4RB3C 2P6TA 2DAOA 2YSRA 1K6OA 5JI6A 4OMZA 3H3ZA 1FPQA 1U3EM 3GEZA 4ZH4F 1IF1A 2BBYA 2O0YA 2KIUA 1PDNC 4XSZF 3H92A 1R5HA 1B4AA 4RGUA 3RTRA 2QQAA 3Q9VA 3VB2A 2FBKA 3KP2A 3L00A 5HLHA 2HYGD 1JGSA 1E17A 1FYMA 3ZMDA 3L09A 2W57A 2FA5A 5LLQA 5TRDA 5IT3A 4BAYA 1W7PB 3BP8A 3K1PA 1G3WA 1HBXG 2Y75A 2LF8A 2FNAA 3OOPA 3I0TA 5FB2A 5ERIA 3L2CA 1I27A 1KYZA 4A5MA 3KLOA 1MD0A 1XD7A 1IXRC 3ABUA 1TLHB 3ROUA 3JAMK 3MZYA 3P9IA 3K9TA 4OMYA 4I0BA 4FX0A 3E6MA 2F2EA 3F6VA 5HS7A 3WTXC 1D5VA 1O3TA 2CQKA 4RGRA 2FQ3A 3LQQA 2QBYB 3QPHA 3BOQA 4MTEA 1ZG1A 3E5XA 4BHBA 3NQOA 3F8BA 4RS8A 4E70A 2EV6A 1YG2A 3JAMZ 3HHHA 2PFBA 3EYYA 5L3FA 3GF2A 1W4MA 2EFPA 3FHZA 1W5SA 4NQWA 3GZ6A 2XIGA 5DEQA 3GFJA 4ZYDA 1XCVA 1U5TC 5ILVA 1MDMB 1J59A 3E6DA 2G9WA 3SQNA 2NAZA 4LD5A 5L3BA 2BGCA 1KQ9A 2P5VA 2JPCA 4WK8F 1R1TA 3V4GA 3F23A 3ECOA 4UUVA 1R1UA 3ECHA 2HR3A 1FNNA 3WTVC 2CYYA 4R8HA 3K1NA 2IJLA 1FZPB 5E8IA 5E18F 1I1GA 4L18B 1YW7A 3JSPA 3RI4A 4EMSA 3EUHA 1FOKA 4HX7A 1TQIA 4Q47A 1XDSA 1G3SA 2XAHA 3BJ6A 1JE8A 4KIGA 4CGZA 5CVUA 1LEAA 4MNUA 2VBWA 1HW1A 1LDJA 1QPMA 1I1SA 5K5RA 1P4WA 2FMLA 5BOXA 2EA2A 1SFXA 1SD7A 4HLYA 2M5WA 1G6NA 2H94A 5ILUA 4I01A 3SZTA 4L9JA 1ULYA 4ESBA 3ZN0A 4HV6A 5DV5A 2R7FA 2UZKA 4CDGA 4HYEA 2IW5A 3M1EA 3CO7C 3KE2A 1S29A 2V79A 4YFNF 2GXBA 2KJBA 3PQJA 3T0YA 3QAHA 1L0OC 1BIAA 1ONVA 1XDUA 2EA4A 5KVRA 1IZ1A 2FMYA 2OAZA 5E1XA 5D5XB 5D5UB 4YIFA 1HW5A 4OIRF 1YLFA 2STTA 2UXNA 3HRMA 3KEOA 1DP7P 4MTDA 2VBXA 2MH9A 1SD5A 3JTHA 3GVAA 1B1BA 1Y0UA 2A61A 4CXFA 1IRFA 2CW0F 5HS8A 2KJCA 3FX3A 2XVCA 3F8NA 3HYIA 4O5VA 2PN6A 3H3UA 4WWCA 3N4MA 3W6KB 4O6JA 1OYIA 1IN6A 3V8LA 1OYYA 5TJJA 2RVCA 3F8MA 2XAGA 3KZYA 3TDZC 1ZYRF 4KA4A 1XGNA 5ED4A 2PJPA 1ZAOA 4KDPA 4Q4ZF 4LFUA 4EJUA 2M30A 5HDGA 2HOEA 1TNSA 3BY6A 2RQPA 1Z6RA 4I7HA 1ZRFA 1DUXC 4XLNF 1ON1A 2YX7A 4KNYA 2VXZA 4XLPF 1XSXA 4IF4A 3FWEA 1J0RA 2VN2A 3LWFA 3DXJF 2VOPA 2JPBA 1EV7A 2R3SA 3R61A 4YIIA 1K78B 2XAJA 3DFGA 4MQVA 1FBSA 4RGSA 2NNYA 2LSOA 5L3DA 2DK5A 3LQRA 4KT5C 1YTYA 2ISYA 4OOIA 2QBYA 1LDDA 4A6DA 3ZMSA 3RKXA 1BI1A 2BEOA 3W6JB 3WTYC 2CG4A 4S05A 2NRAC 1P6RA 1G3TA 1P92A 2A3SA 2ZMEA 3R60A 4I2OA 1R7JA 4BHPA 3KEQA 3FXRA 1P4XA 1Z05A 1ZREA 3FMRA 2ZJ2A 3IWZA 2KIFA 5E20A 1MDMA 4EJOA 4KIBA 4ENMA 2QWWA 1TW2A 1YW9A 3I53A 3E3VA 1BIBA 1MZBA 3O3KA 1LEBA 1O7FA 1FY7A 5L3EA 5DD4A 3M9AA 1GVJA 3CLOA 3CUQB 1L3LA 2DO7A 2QYOA 3F21A 5LGNA 1UHWA 4ZZDA 2XRNA 1WSUA 3RPUA 4EM1A 2A5YB 4ESFA 4I02A 3RKWA 4KUMA 3L9FA 2EFWA 4Q48A 2AXLA 2HS5A 2Q8KA 3B73A 5LHGA 4G7OF 2GAUA 1XSDA 4UV8A 4N0BA 2Y48A 1OMIA 1SAXA 3FMQA 4UVAA 5LRSA 4HF1A 1GHCA 4HV5A 1OR7A 4CHUA 4WXDA 1X3UA 3TKYA 3E97A 3FM5A 3LA3A 5LGUA 1RNLA 2MLGA 2STWA 2VT2A 1R5GA 3HSEA 3MQ0A 1J7KA 5K5QA 4ESJA 1DPUA 3LFKA 3D0SA 5D4RA 1J2XA 4AIKA 2Q0OA 5FO5A 4L0YB 2HQNA 2DFIA 4WX9A 3C3WA 2K27A 1OKRA 3RKYA 3VODA 2K7LA 2RV8A 1XCBA 4ZYHA 1RUNA 5CLSA 5ICFA 2MH2A 4M6YA 4ETSA 1RIOH 2YR2A 5J8FA 4LG0A 4UVBA 3GLXA 4DNCA 3SFZA 1QGPA 1MJBA 4L9TA 1O3SA 2C6YA 1XMKA 1ZH5A 3EETA 4HA8A 4PZJA 5HLIA 1T39A 1QZYA 4JQFA 3J81K 3V8KA 2ACJA 2A69F 3LSTA 4LLGF 2E1NA 2DI3A 1HQCA 3KLNA 1BOAA 3LAPA 2ELHA 1V3FA 4G6QA 4EJWA 2ZBKA 4PGGA 3DPLC 1FBQA 2WTEA 4N9IA 3ZMTA 3E6CC 2HEOA 4EGZA 4Q5SF 1DDNA 4A0XA 1WWXA 4ENNA 4GYGA 2XAQA 2TDXA 2HYFA 3ULQB 3T1BA 1HSJA 5DD8A 2IA1A 5EEGA 3TO6A 5E1WA 4ENJA 3J81Z 5H6QA 3PQKA 4U88A 4A0ZA 1T0FA 1Z7UA 2R7DA 3KFWX 2DTRA 3GO5A 2QQBA 3QU6A 2KIMA 1WI9A 2OQGA 2B0LA 3CUQC 4ASNA 2QM3A 3P7NA 1SD6A 3JSOA 2CSOA 3C18A 4BNCA 2XAFA 4M73A 3FZVA 2XKPA 4BHCA 3RDIA 4U7BA 1REPC 1K78A 1H9GA 1MGTA 1O7LA 2A6EF 5JFRA 3GWZA 1XMAA 2D2WA 3HTUA 2K4BA 5DUKA 2H6CA
chains in the Genus database with same CATH superfamily
2W48A 3FK6A 2HPMA 2DXIA 3S3OA 1U9NA 2BW3B 4CICA 4ZYEA 1PUEE 4ZDOA 2CQXA 3UNGC 2W24A 4M9SA 2WY8Q 3BG5A 2VB6A 4G9YA 1CQTA 4HF2A 1ZQ3P 1VQ9I 1GLNA 2HVQA 2K85A 2NNNA 4E7ZA 5LGTA 4IVNA 1ZRDA 5BQTA 2ID3A 2WAEA 3LSKA 2E2JJ 1FP1D 4BXUA 2O03A 2E1OA 4BKXA 4HOBA 5FFZA 1ZLJA 3HM5A 1RR8C 3HTSB 5EZHA 3TW7A 4A3JJ 4KYWA 3BC8A 4XLCA 3QP6A 1NHAA 2QSFX 2ME6A 4CUGA 4WCGA 4ITVA 3FISA 4Y15A 5IOYA 2KHMA 1MMGA 5FKOA 2EIMH 2LY2A 3WTWC 3I54A 5DCMB 3HC7A 2DFFA 2DW4A 5IT9K 4BBSJ 1ZHFA 2PMZN 3I3LA 4GRIA 3BR6A 1I50J 4ZZLA 1ZKGA 2HTJA 3D5RC 3F3XA 3QU3A 2DU9A 3BDDA 2PMHA 2XUBA 4PFOA 1WJAA 2TRTA 1FMWA 4IJAA 5CVVA 2XHKA 3ZQCA 1R6RA 2FNPA 3Q0UA 3HOUJ 2HPIA 4M74A 3WU0A 2FBHA 1XC5A 3HZJA 2OF7A 2X6YA 4HF0A 2EFOA 3WG9A 4H0EA 3CP8A 1RZ4A 2KLOA 3J7YJ 2D1HA 4XM3A 4XN0A 1W5TA 3DTKA 1IXSB 1E2XA 4WXCA 2ADUA 2XASA 2L01A 3S2HJ 1VQMI 4RM2A 1IN8A 4OIPF 2GWRA 3DKXA 5LBQA 3CUQA 2ETHA 3C2GA 1MNEA 2P7CB 3VWBA 2OCEA 3TO7A 2R7TA 2IAIA 1YITI 3BG7A 3W2VA 3Q9SA 2DA6A 3WTTC 2FEZA 2ESNA 4RAFA 3S93A 3CMAI 4Y52J 2GA1A 2N8GA 4OAZA 2JZYA 3KP5A 2KRFA 5F0FA 1LFBA 3F6OA 2IXSA 2CUZA 3R0AA 4KT6A 3OWTA 1ZGWA 3W3CA 1MIJA 5IT9Z 3H9GA 2DPUA 2L4MA 2K9SA 2M1BA 2BY2A 3CO6C 3W6VA 2LP0A 1AOYA 3RYRA 1JJ8C 1FYKA 4LLLA 4E7SA 2Y0SN 3TQNA 3MEXA 2LREA 4HLXA 4IHYA 2Y31A 1Y8RB 2YUSA 3H5RA 3OL3A 4YFXF 2A6HF 2ZNZA 4HAMA 3CCUI 1HW2A 1BW5A 1EH8A 3S2WA 4LITA 4L9NA 4B4CA 3CDHA 3M8EA 2KPMA 2X9DA 3BJAA 1WJFA 2D1VA 1XB4A 3GFMA 5K1YA 1M1EB 1Z7LA 3OMYA 3S3NA 2QSHX 4AUXA 3RIRA 1BN5A 2OBPA 1T08B 4OU0A 2O9LA 3HOSA 4A0YA 3G1LA 1Q1HA 2NVYJ 2HGCA 2EK5A 2ZFWA 3GW2A 1V55H 1JT6A 2IBDA 1RR7A 5F64A 3U2RA 4AD9A 1U5TA 2F4IA 4JBAA 3J7ZI 2P5LC 3CQZJ 2LBFB 1CF7A 2V6EA 1KZHA 3T8TA 1HA8A 2OTJI 4B48A 2JA8J 5KHDA 3QP5A 3K70C 5HNFA 2Q2EA 4HNUA 3OYJA 2WBMA 4WF2A 4EGYA 1MNMC 1ACIA 1IW7F 5H6RA 1MBHA 4XKWA 2CQNA 4I09A 3JRGA 2LNBA 3HOTA 1S8NA 1TQMA 2E60A 3L7WA 2NOJB 1QZZA 2OA4A 2HOAA 3I59B 5BNGA 3WODF 4V2FA 4LK0F 1SVOA 2HDDA 2MC3A 2M34A 1D0ZA 1NTCA 4LB6B 3JRHA 3R6SA 1BC7C 3P5JA 2E2HJ 2NYXA 5A2QK 1YQAA 1T2KA 2FRHA 3TDUC 2X6WA 4BS9A 2OU2A 4BJTA 4DIQA 4X0GA 2DQLA 2V1XA 1Z91A 4C2MJ 3K2ZA 2VXDA 1PP7U 4D5CA 2F5VA 2G7HA 2KQRA 4EV0A 2WY7Q 1ODDA 2JN6A 1ZG3A 1QO0D 3CCEI 4PSWA 1B59A 4U87A 3EUKL 2XB5A 3M3YJ 2XROA 2LY9A 2P7VB 2P8TA 1T6SA 1K7AA 9ANTA 3VSLA 4A93J 2K02A 2GBYA 2K3PA 4II3A 5E3LA 3HSFA 2VOOA 1N78A 3ERMA 4A12A 4QSHA 2OJED 2GXGA 3P9KA 1YIOA 5B66C 2F6CA 1O3RA 3HGYA 2IA0A 1ETYA 2M87A 3CJTB 3FDYA 3RQIA 3MCZA 3R4KA 1WJEA 3LSPA 2BYVE 3PUBA 1VZ0A 3C1DA 2EV5A 2M3AA 4UVCA 4RAYA 4IHVA 3HPGA 2PMZA 2CO5A 1UFMA 2KRHA 4S0HB 2MBFA 3SXYA 1W7PA 5J6XA 4NDLA 1I3QJ 5FKLA 2ESHA 5F0CA 1OPCA 2ZKZA 1EH6A 4Z2YA 3KPHA 5A2QZ 1USSA 3WU2C 1SFUA 3ZQ7A 4PUSA 4ABZA 2L0KA 5DS9A 2DTZA 3ZN1A 1N77A 4E6KG 1H88C 2L7FP 4NBQA 3OYFA 2ID6A 5F27A 1F5TA 1ETKA 5HDNA 2OZUA 3G3ZA 3QOEA 3ESWB 3H5AA 2VKHA 2H8WA 2M7BA 4CZZA 2L9NA 3GZNB 4KMFA 1GT0C 4NC6A 3KYDB 3IC7A 1LNWA 1W7PD 2A68F 4AU7A 5HLGA 1FOXA 3VOEA 4FTHA 2E35A 1VQPI 1IRGA 1IXCA 4HBLA 1MBFA 4IRIA 1MW7A 1BR4A 2L02A 1KU2A 5EGOA 1JHFA 2UWMA 6PAXA 1TT5B 3R0JA 5E3MA 1QVUA 3NWTA 1X2MA 4HPQA 5LHIA 2Y9ZA 2VBZA 1RUOA 5ILSA 2NVTJ 5FLMJ 3CLQA 5LFAA 2XV4S 2X4HA 2W85A 3K70D 5B1BH 2E1CA 1DP3A 2K3FA 1FSHA 2AQEA 1HKQA 1JUMA 1ENHA 3PFYA 4KICA 2RREA 3QRFF 4NC8A 4MEYF 2BHYA 2Y0SA 3LSMA 5D6EA 1F9NA 2VE9A 1HKSA 2G0EA 3HJEA 5HOOA 1KQ0A 1A04A 2DOAA 4IQ4A 1QBJA 1AKHB 5M5XJ 1QNTA 4AIJA 3OYEA 4G7HF 1GVDA 1FP2A 1UELB 3HBLA 3ZR8X 1P2FA 4ZYAA 4B1RA 1OCCH 3T8RA 2MABA 3DV8A 2X51A 3COAC 1UG0A 1FJLA 5FGMA 2MD0A 3I64A 1A31A 2L5QA 2LH9A 1XSVA 3E7LA 3A0HC 4IZZA 2H1LA 4UNOA 3CESA 1WHUA 1X58A 3DQVC 3BJOA 1YS6A 4BE0A 3BR5A 2L4AA 1RETA 4UUSB 2BVMA 4OIOF 4A2UA 2JWTA 2ZSIB 3SZGA 4EM2A 3REOA 1YW8A 4D5FA 3HKZN 4A3KJ 4UB8C 1I3AA 4HW0A 1Z6TA 1XGMA 1JI8A 1O3QA 2ECCA 4M9ZA 4P9FA 4UUTA 1IRXA 3BZCA 1J5YA 2DA2A 3JW4A 4NQWB 2B63J 3DLAA 4DYCA 2QENA 2V9PA 3HB9A 4F92B 2EINH 3CDLA 5E1ZB 1IN5A 3FMSA 2I10A 3I56I 1FWZA 3FXQA 4BDYA 1V54H 2RN7A 2V6CA 4KFCA 2WC2A 5IOZA 2JSCA 4WXHA 5JLXA 5JR3A 4L9VA 3TOAA 1WKMA 5HDKA 3NRVA 4L0ZB 1S3JA 5EEAA 5J1YA 2V26A 2F4OB 2QZ8A 3DKWA 2PLYA 4IPAA 4R1HA 3MKYB 1WRJA 1Z67A 3BR3A 3ZQFA 2X0LA 5JVTA 3ZMZA 4BQAA 4XICA 5KAFC 4I99C 4U0WA 1P7JA 3A01A 1SMTA 4DOZA 2RDPA 3HRTA 3IWFA 3KZZA 3J80K 2HOTA 3S15J 1F36A 2E7XA 1WQ2A 2CW8A 1BBYA 4HNVA 1ZR4A 2IRFG 2DK8A 2LOOA 1MJ9A 2P5KA 2RGVA 4RAGA 2ZCWA 1TQPA 3IUOA 1X1BA 2VKDA 3V7SA 2EWNA 2OZ6A 3P9CA 1D8JA 3OSFA 5CVIA 3BTIA 2R0QC 3I4NJ 4HEA2 1APLC 3IKVA 2HKXA 4EM0B 5DM6F 3KP6A 1BJAA 3AG2H 4DZPA 4KN4X 2HFHA 2PEXA 5FLXK 1H8AC 4LG3A 4M3BA 2VKVA 4LLNA 4IL6C 2W84A 2FE3A 2BV6A 1A5JA 2QQ8A 5H20A 3A03A 3E5QA 4CSWA 5AONA 3E6BA 4RLFA 1G3YA 3GYHX 2VT3A 2QLZA 2JQ7A 2EFNA 3CUOA 3PUFA 1H9TA 5L3GA 4XQFA 5EZGA 1I6XA 5JHFA 2UXXA 1MKMA 1YOVB 5J3LA 3NARA 3HUGB 1RPWA 4KMUX 4MHGA 1RRJA 1IN7A 2WA0A 2XB0X 1ORKA 5FFXA 3FXLA 3SHFA 3J80Z 2Z33A 4GXOA 2M8EA 3GX4X 1MMNA 2VPRA 2MLKA 1B9NA 2NS0A 1DPRA 2P6SA 2H09A 3E0JB 4HDVA 1ZG5A 2LDUA 2VJIA 1MH4A 2EZKA 2X6OA 2WADA 2R4GA 3GUDA 1PP8F 4XRFA 2LFBA 2IA2A 4LK1F 5EDNA 4IOAF 4ON0A 3HG9A 3QPLA 2W25A 1YYVA 2R7OA 2ELJA 4M6XA 2EBIA 2JT1A 3BG6A 5FLXZ 3K0LA 3TGNA 3LMMA 2O5RA 4L5JA 4GO1A 1ETXA 3K69A 4JX4A 4IX7A 4KITB 2V7FA 3BR1A 4EEFG 3OYLA 3C7JA 1WJDA 4F91B 1KGSA 4FISA 5D4SA 3I4PA 3KX2A 3EUAA 2XGXA 1O57A 3O6BB 3ASOH 3I5UA 4LB5A 2I5UA 5ICCA 4K2EA 4RAZA 2P4WA 5HVQC 1UHMA 2VQCA 3ML6A 3RSNA 1TTYA 2A07F 2E71A 2DCEA 2KDZA 2K9NA 2L7MP 1ON2A 2L7KA 3G71I 2KL4A 1XG1A 1GXQA 4QIWN 3CJNA 3TP0A 3MD2A 2ZXHA 3PFIA 3GFIA 4FETA 1WCMJ 4XKVA 5LHHA 1FMVA 2K40A 5J1RA 5ICGA 1MSEC 1FBUA 3H36A 4B43A 4Y3OA 2QF7A 5D8LB 2MC4A 4UB6C 2EZHA 4D1QA 3OIQA 4HX4A 2E34A 2VC1A 3C2HA 5ICEA 3ISPA 3AAFA 4Z6YA 2FOWA 4A3FJ 3ZXSA 3HKZA 3BG3A 1D8KA 2LLKA 4B09A 3F8CA 3SZPA 1BOBA 1K4TA 4DGWB 2WV0A 3VYSB 1O4XA 3OOUA 2E1MB 3FXJA 1B72A 3MKZA 4RB2C 4CA0A 2L9SA 3DU6A 2XPWA 2HOSA 2MFZA 3TL4X 3BZ6A 3RCOA 2RKHA 4FE4A 1ETOA 1SC7A 4B47A 3T5XA 3HOXJ 2DMTA 4MQ9F 4PCQA 4A6EA 3OY9A 1Y39A 4OIQF 3MFKA 3G73A 1V4RA 3WTZA 3WE3A 1TNTA 5CYVA 3F22A 5J8CA 1U78A 2RQQA 2PQ8A 3GBGA 2OD5A 3LAJA 5F6FA 4IQJA 3CF5F 1K79A 5D8KB 2KFDA 3PO2J 1FIAA 3TOBA 2BXYA 2CQQA 2OV7A 5KAIC 5HODA 1G2HA 5L3CA 3DPTA 4PJ0C 5CVRA 2M8GX 3IKTA 3ABLH 1U0JA 3WE2A 3CC4I 3NEUA 1HKTA 2FX0A 1OFCX 1LFPA 2KMUA 4N9HA 4G8XA 3K4CA 5GPAA 4MFDA 2LRDA 3LFUA 2JRTA 3EUHC 3WGIA 5IYDJ 3OR2C 5EG0B 2DPDA 4C3JJ 2BE5F 3IL2A 1K6YA 2Z1DA 5KNLA 1FX7A 1N75A 3CCMI 1S7AA 2ZJRF 1YE9A 1HSTA 2JTVA 4IKFA 5DCFA 3DP7A 3LL7A 3CCSI 2ZO4A 3KZIC 1WJCA 1D5YA 3DEUA 3PO3J 2F5DA 4CYCB 4U7DA 2RC4A 2CUEA 2HDWA 3I4MJ 4LMYA 2HWVA 3I71A 1JKOC 2A05A 2YPRA 3KCCA 4YG2F 2PI0A 4A5NA 2O8XA 1RC9A 1EJ9A 2JRMA 4U0YA 3ELKA 4IHSA 1R00A 2R7VA 1BI3A 3S1QJ 2M9HA 3ZGKA 4RB1A 2Z3YA 2QGUA 1IN4A 3HRUA 3N05A 4U0VA 4UUSA 3DF8A 1UB9A 2CS3A 2VKEA 3IH4A 2DOFA 2NOGA 2ZMEB 3V7RA 3JCUC 4JP0A 1HLVA 2DT5A 1Z1DA 3H35A 2QQ9A 4C9YA 3WGHA 2R7RA 1YRNA 5BMZA 2FXAA 4IXAA 2EZLA 3QYFA 4UHTA 5K7ZA 2KISA 4MEXF 5D6FA 2JVHA 1E3HA 2DQRA 3K4BA 5C4XJ 3IV5A 2CH0A 3S1MJ 3EPZA 1LQ1A 4G7ZF 2DLLA 4OINF 3ZP5A 2XRLA 3I9V2 2PG4A 1WI3A 2AXTC 2F5FA 2O3FA 3OIOA 2CWEA 1H0MA 4JK1X 5HS9A 1FTZA 3A02A 4Y13A 5KK1A 4A3EJ 1BL0A 2DDBA 4BH9A 1K83J 1PUFA 1TWFJ 3IP4B 4P96A 3FXUA 3GTLJ 2IT0A 1HC8A 4IRHA 2LKPA 4UV9A 3Q3SA 4EVIA 5CVJA 2W82A 2YX4A 3DCFA 3BT9A 3LSRA 3KYLA 1U9OA 4B3XA 2DA4A 1D1AA 2EIJH 2OC6A 4BBRJ 4A3MJ 3MWMA 2HNHA 2K4JA 4UXNA 4HZFA 1U6GA 2JMWA 2L54A 3ZQQA 4H4KC 1YI2I 1T38A 2L9RA 4Y7NJ 1F4KA 4ZYGA 4XBFA 3ZMUA 2BY0A 2DJNA 2O8KA 1S7EA 5M3FJ 3IRQA 1FIPA 2KKOA 4O3MA 2JUCA 4EQQA 1VI0A 4BEHB 4C2UA 5CQGA 1VQKI 5FD6A 4M3EA 3M8FA 3F72A 3U9GA 3X2QH 4HX8A 1KU9A 2G7UA 4XORA 1FT9A 3KP7A 2Y2ZA 2VE8A 3QOPA 1LVAA 2DT7B 4HQMA 3QPTA 2BHZA 1Z9CA 1GXPA 3FF5A 2DMUA 3EYIA 2K9LA 4M9XA 3RKQA 3MAJA 1QHGA 1QPIA 4BQQA 2HDCA 1NH3A 2E1MC 4BACA 1MBJA 1HDPA 2ZFUA 3E5UA 2X85A 5DUIA 3WG7H 3KP4A 1FYLA 3DPUA 2ZJPF 2HXIA 2WB1N 3BCAA 2P81A 3BQYA 4M72A 3K1MA 2MSYA 1VTNC 1R58A 1ITYA 1ZGJA 2CFOA 2KZVA 3GZ5A 3TO9A 3V8JA 4NHJA 2M7AA 5LEJA 2Y69H 3HUGA 2HKOA 5BS6A 2LVSA 3HIFA 2EQRA 2DA5A 3TMOA 1IV8A 1ZARA 2PBIA 5LEKA 5E3OA 5J1UA 2ELKA 2DBBA 2QVOA 2MGQA 2R5YB 1S7OA 4M3DA 3S1RJ 1TWHJ 4HSRA 1ZRCA 2R93J 3GTGJ 1LJ9A 3DKYA 4F7ZA 2L3DA 3VPRA 3OS2A 1LB2A 2E5ZA 1BR2A 2EJRA 5GADJ 3L2UA 3L2WA 1NG6A 2FQ4A 4AVZA 4FHTA 1ZN2A 2VBYA 3GXOA 4BU2A 4YFKF 3GTJJ 1V5EA 3HPHA 2FBIA 2WWYA 2LF7A 4XR6A 2JSPA 1OCTC 4LG0B 4I0AA 4TV7A 3HOVJ 4I76A 1IV6A 3CF2A 5C3EJ 1A6QA 2AQFA 2QUFA 4C30A 1USTA 2VQLA 3OV8A 5B3SH 4AIHA 2HTSA 2GOXB 3VYRB 4GYIA 3S2DJ 1OCRH 5LRRA 4RDUA 3DTIA 3IAM2 4P1WA 5BPIA 2K5CA 3WTUC 4IRGA 3ZRGA 5D5WB 3DBHB 2X1CA 2ZNYA 1UCRA 2GQQA 2XDVA 4G6DA 3B02A 4ANJA 4LJZF 3DBLB 1YFHA 3N97A 4R79A 4A3GJ 2FU4A 3RPQA 2XKOA 3CTAA 3EQLF 2R5ZA 2OPTA 4KIFA 1SFEA 1LPQA 1LE8B 1XGOA 4PGHA 3O2PE 2V1UA 3ERED 2GA2A 3RJPA 2DJIA 5IYBJ 1ZGAA 2K9QA 1W36C 3FM3A 2LD5A 5E17F 1F1ZA 2HQRA 2IP2A 2ZMEC 1BI0A 4ENKA 2Z5UA 5E8GA 2CU7A 3BPXA 2V4JC 1E3OC 1BC8C 1D0YA 1EA3A 1T98A 5M5YJ 3RYPA 3HEFA 2MW8A 3GTPJ 2DA3A 2E7WA 4N4OB 4II2A 4FX4A 5AIQA 3OYAA 3OIPA 5CQEA 5DTDA 4EJVA 3O8GA 5FD5A 1VQ6I 2FSWA 1P4AA 1IUYA 3BZKA 4ZDLA 1FTTA 2LKSA 2GIZA 3IRRA 2COMA 3M4OJ 2Y0MA 2EH3A 1U2WA 3BTLA 4BYYA 2L9VA 4CCKA 5JHUA 2EV0A 1ETQA 4IHTA 4LGWA 2IPQX 1TP4A 5D5VB 3Q5FA 3WU1B 3PIOF 3HGGA 1IRZA 2O6GE 3V7CA 3MKWB 2MD5A 4AVPA 1R9TJ 3ZQLA 4RMNA 3DWLE 5FROA 3B6CA 4BGDA 2FOKA 3ZMVA 4GCVA 4RM3A 5TGTA 2H27A 3ABTA 1KA8A 3KEYA 1I5ZA 4HQEA 1R36A 2CFXA 2OUMA 1H89C 2M4KA 1JJ6C 2DN0A 1TWCJ 2W4SA 4DW6A 2JUGA 5DM7F 3DBRB 4HG2A 4E7KA 4RB0A 1FC3A 1WJBA 2DOEA 5AIPA 5FKKA 5EG0A 2BW3A 4LOCA 4DQ2A 3VEPA 3G6EI 2DMPA 5GTIC 3RZOJ 1AWCA 1D3YA 2NXNB 1KU7A 1J9IA 2XF7A 1GUUA 3PSFA 4NUBA 3U1DA 4NC7A 3PM1A 3UKGA 1DGWY 4E7JA 1STZA 4CYCA 4P9UA 3MZHA 2HU9A 2K86A 3HXLA 3TBIA 4HDUA 1ETWA 3M07A 5IPAA 5TISC 1CGPA 2CGPA 4KN7X 1OR7C 4MGRA 2VI6A 1FLIA 5BPDA 1A6IA 3BR2A 3IAS2 4XSXF 2Q1ZB 2LKXA 3BPVA 3BWGA 1S72I 3CCJI 2GIVA 2O61A 4GGGA 2WB1A 2IGMA 4CCOA 4I98B 4QLCU 2J5PA 5DCMA 1JXSA 1V5FA 4V2GA 2WAQN 1IJWC 4P55A 2F5EA 4M3FA 4CO8A 3IH2A 1R1VA 3SEZA 3BROA 3DU5A 1S6LA 3F8FA 3GFLA 5K7HA 3ZQIA 2PMUA 2GXAA 3HSRA 1KQ8A 3HHGA 2ZXWH 4G94A 3JRFA 2M45A 4BL0B 3CMEI 1X4PA 3DEWA 3AG4H 3G1OA 4AYBN 2LMDA 5IYCJ 3QWLA 2F5CA 1VQ7I 2AS5F 1KU3A 1LDKB 2ISZA 4EJTA 1NK3P 1R5ID 1FSEA 4D0PA 1XGSA 5M5WJ 1W36D 1WJ5A 1XMXA 1JUPA 3KYCB 2VC0A 4AWXB 4XMYA 4YEJA 4J19A 2R7QA 5GP9A 4RBOA 3BCBA 5EF6A 4DBQA 5C44J 2ECBA 4A3CJ 1OYWA 4B8XA 1K4SA 2IVMA 4CCNA 1C0WA 1G4DA 3WHCA 4M71A 1OCPA 4GFBA 2CUFA 3BLYA 4FE7A 2GZWA 3O8HA 2IS2A 2WAFA 2OQRA 2DA1A 3GTOJ 3D5SC 1ZTRA 3DTEA 3OYBA 1SMYF 1RI7A 1J75A 1EH7A 3D5LA 1BJZA 3WTSC 5IP7J 3CCRI 1I39A 1XN7A 2WV1A 3S3MA 2FF4A 2JA5J 3ZQHA 1MMAA 3JTGA 3MKLA 3VFZA 1Y1WJ 1B6AA 2J5OA 3M7GA 1MJAA 3OL4A 1YS7A 1R23A 3H5NA 4BEHA 2CMPA 2KZGA 2ZSHB 1U8RA 1BA5A 3J7AO 5F1RA 2UUZA 1QVTA 3TW6A 2EB7A 1B9MA 1KYWA 4S04A 3LA2A 5CJ9A 1AA7A 4X1EA 1XTAA 1BI2A 1BM9A 3KP3A 3GCMA 3PNVA 2COBA 4RGXA 2E19A 2K9MA 1G8XA 2DODA 5DDGA 4XRSG 2KRCA 4I6ZA 2FUG2 1R22A 3JREA 2RNJA 4BUPA 3HRSA 4F93B 2Z99A 3IHUA 2Z9OA 4XLAA 3SFIA 5K5OA 3KETA 1IGNA 4BE1A 1D1BA 2ZB9A 5JLWA 2R7ZJ 1JKPC 2EZIA 4NB5A 1IAWA 3K10A 4CYDA 2OCCH 3JRAA 1ZLKA 2FJ1A 2JVGA 1W1WE 2LBFA 4Y17A 1N25A 1YO5C 2IS6A 2V1NA 5FRMA 4ZJZA 4P5OA 3CJQB 3EDPA 3PNTA 1MBGA 2YU3A 3I58A 5DYMA 1HXDA 2VONA 1G59A 1JHHA 3WGGA 5IP9J 1U5TB 5GPCA 1CF7B 2OTLI 4KJZA 3I59A 4PDKA 4FT8A 4QWQA 2XPVA 2Q2EB 1TBXA 1Z3YA 5C4JJ 2R7UA 5EEHA 4JX6A 3H9QA 4OAYA 1MSFC 2MA3A 2CUJA 1JKRC 2V9VA 1TW3A 2V1DA 4CZCA 4UY8I 1Z77A 3UR3C 3HOWJ 4DZJA 1SD4A 3AL0B 3LA7A 2HZTA 4L5IA 3ZPLA 2H6BA 2D45A 2EFQA 5IY5H 1QQIA 2BXZA 2ZXJA 4C2TA 2VODA 3K2AA 2R92J 4RB3C 2P6TA 2W7NA 2DAOA 5GAHJ 2LY1A 3DEEA 3CCQI 1SEUA 2H8RA 2YSRA 1K6OA 5JI6A 4E7IA 4OMZA 3C2BA 3H3ZA 3VDXA 2GLOA 1FPQA 4J00A 1U3EM 2DMNA 3GEZA 4ZH4F 1IF1A 3S17J 4IHXA 2BBYA 3M1CA 4IO9F 1QZEA 2XGDA 2O0YA 2KIUA 2QKLB 1LE8A 1PDNC 4XSZF 3H92A 4B3AA 1FEXA 1R5HA 3LOCA 1B4AA 3GLLA 2CJJA 4RGUA 2WAQA 5F08A 3RTRA 2QQAA 3Q9VA 3VB2A 2FBKA 2NVUB 3OYNA 3KP2A 3U21A 3L00A 2NS8A 4XRSA 5HLHA 2HYGD 4XOTA 2VJJA 1JGSA 4IHWA 4BXFA 1E17A 1FYMA 4M6VA 2HQAA 3Q0VA 1VQ5I 3ZMDA 1WGXA 3L09A 2W57A 2FA5A 3A1YA 4AYBA 5LLQA 5TRDA 5IT3A 4X6AJ 4BAYA 1W7PB 3BP8A 3K1PA 1G3WA 4C3IJ 3MN2A 1PVEA 1HBXG 1T95A 2Y75A 2X6XA 4ZC3A 2LF8A 2FNAA 3OOPA 3PNYA 3I0TA 5FB2A 3CDIA 5ERIA 3L2CA 1I27A 1KYZA 4A5MA 1DQUA 4F52A 3MMYB 1WPKA 3KLOA 4EATA 3W2AA 1MD0A 5E3NA 2VLAA 1XD7A 4DJAA 2KP6A 3G4SI 1EF4A 1IXRC 3ABUA 1T8IA 2D5VA 1TLHB 1Y1VJ 3ROUA 3LSHA 3JAMK 3JR9A 3MZYA 2E5NA 1VNDA 1GV2A 3P9IA 5B1AH 2VJ5A 2JK3A 3K9TA 3VSKA 1QHHD 5EGOB 2AHQA 4I0BA 4OMYA 4F55A 4FX0A 3E6MA 2F2EA 3F6VA 1MNDA 1ZELA 3H3VK 5HS7A 2PJRB 3FBIB 1OQYA 3CJRB 3WTXC 4A3DJ 3H0GJ 3CMYA 1AKHA 1D5VA 1MMDA 3QYBA 1UZCA 3W2WA 1HCRA 2HZDA 2BVLA 3CC7I 1O3TA 2CQKA 3WHBA 1OCOH 4RGRA 2FQ3A 3LQQA 2QBYB 3HOYJ 3QPHA 1DGRM 3BOQA 1HF0A 1T56A 1WFXA 3OS1A 4MTEA 1ZG1A 3J7AY 5HLTA 2DDAA 2DT6A 1I6HJ 3E5XA 3ZQGA 4PSXA 1B8IB 2KIQA 4BHBA 3B6AA 3NQOA 4YRVA 1VQLI 3F8BA 4RS8A 4A3IJ 3H1CA 5FRNA 4E70A 1RKWA 2EV6A 2X1DA 1YG2A 3JAMZ 3HHHA 4XLEA 2ME0A 2Y9YA 2PFBA 2XC7A 3OYGA 3EYYA 5L3FA 3OSGA 3GF2A 1V5GA 3SJMA 4XIDA 1W4MA 1OJLA 4JOMA 1F43A 2EFPA 3FHZA 2CV2A 1W5SA 5GAGJ 4ZTFA 4NQWA 5CPRB 3U1KA 3GZ6A 2XIGA 2Y30A 3GFJA 5DEQA 2ZC2A 4ZYDA 2M0CA 1XCVA 1U5TC 2VJ4A 5ILVA 4YIRX 1MDMB 4N4NB 1J59A 3TP3A 3E6DA 2DYSH 3LSJA 3D1NI 2G9WA 4MIMA 3SQNA 2R7XA 2NAZA 1SAUA 4KISA 4LD5A 5L3BA 2BGCA 1TWAJ 2BY1A 2QKMB 2HVSA 1KQ9A 2P5VA 2JPCA 3FIWA 4QTRA 3OYKA 3MVPA 4MO7A 1Y56A 1YJWI 4WK8F 1R1TA 5J4VA 3V42A 1SVMA 1X2NA 3V4GA 3AL0C 3F23A 3ECOA 4UUVA 1R1UA 3ECHA 2HR3A 1FNNA 3WTVC 2I8DA 2CYYA 4R8HA 3K1NA 3PL8A 2YU9J 2IJLA 1FZPB 5E8IA 5E18F 1I1GA 2B7EA 1YW7A 4L18B 3CCLI 3JSPA 3RI4A 4FASD 4EMSA 3EUHA 4PJLA 4XKBA 1FOKA 4HX7A 4HNTA 2VUMJ 1FOWA 1EKEA 1TQIA 4Q47A 3A01B 1XDSA 1AU7A 3KIOA 1G3SA 2XAHA 3OYDA 2X1EA 3BJ6A 1JE8A 4KIGA 4CGZA 3K7AJ 5CVUA 1LEAA 4MLOA 1SFOJ 1MMSA 4MNUA 1HOMA 1HDDC 2VBWA 1S9HA 1IDYA 2LK2A 4Y4RA 1HW1A 1DU0A 2YS9A 1LDJA 5B5EC 1QPMA 1I1SA 5K5RA 2JA7J 1P4WA 2IS4A 2FMLA 1UMQA 3AKZA 3TEDA 1X1PA 3JRDA 3H0DA 3QPSA 5BOXA 2EA2A 1SFXA 1SD7A 4HLYA 2M5WA 3L2VA 2AO9A 3FXKA 1BW6A 1VF9A 4XRMA 1G6NA 2H94A 4PJNA 5ILUA 3IH3A 4RA2A 4I01A 3BTCA 3SZTA 4L9JA 4BQNA 2LG4A 1IO2A 1ULYA 4XNFA 4ESBA 3ZN0A 4HV6A 5H2FC 5DV5A 2R7FA 2UZKA 4J01A 4L5EA 4CDGA 4HYEA 2IW5A 3CZ6A 3M1EA 1DU6A 1TZLA 3CO7C 2NS7A 1SVLA 3JRCA 4HRIA 3KE2A 1S29A 2V79A 5F04A 4YFNF 2GXBA 2KJBA 3PQJA 1W0TA 3T0YA 1JT0A 3QAHA 1E0EA 1L0OC 3HOZJ 1YJ9I 1BIAA 1ONVA 1XDUA 2W00A 2EA4A 2VPLA 5KVRA 3GMEA 4BY7J 2BY3A 1NK2P 1E3PA 1IZ1A 2FMYA 3JRIA 4BJ6C 1LKXA 2OAZA 5E1XA 5D5XB 5D5UB 4YIFA 1HW5A 2DMQA 1LVKA 4OIRF 2JA2A 2LYCA 1AHDP 2B9SA 1YLFA 2STTA 1YHQI 2UXNA 3HRMA 3OYCA 3KEOA 4YELA 1DP7P 4MTDA 2VBXA 2MH9A 1X3ZB 1SD5A 3JTHA 3GVAA 1B1BA 5FKNA 1Y0UA 2A61A 3L1PA 4CXFA 4FQGA 1IRFA 2CW0F 1D1CA 4F3QA 5HS8A 2KJCA 3FX3A 1ZR2A 2XVCA 3F8NA 3HYIA 1VQOI 4O5VA 2PN6A 3H3UA 4WWCA 3N4MA 2VASA 1JTXA 3W6KB 1XPXA 4O6JA 1OYIA 1IN6A 3ZCOA 3PSIA 4MFEA 3V8LA 1JKQC 1LFUP 2ZJQF 1OYYA 5TJJA 1JUSA 2RVCA 3F8MA 2X48A 5F1JA 2XAGA 3KZYA 3TDZC 3LSGA 3CCVI 1X19A 3A2KA 1ZYRF 4KA4A 1XGNA 5ED4A 2PJPA 2DYRH 1JTYA 2PX9A 1ZAOA 4KDPA 1P7IA 4Q4ZF 2QCOA 4LFUA 4EJUA 4DYQA 2M30A 5HDGA 4D7NA 2HOEA 1WH7A 4XLHA 2Z16A 1TNSA 3BY6A 5M3MJ 2HYJA 2RQPA 1Z6RA 4AIDA 4I7HA 2LC2A 4IOCF 1W5CC 1Z21A 4HSTA 1ZRFA 4ZDPA 1DUXC 1A35A 4A3BJ 1Y0NA 3DLLF 1B72B 4XLNF 1ON1A 2YX7A 4KNYA 1UHSA 3K4NA 5FJ8J 1FOYA 3CC2I 2XGCA 4PJJA 1QU3A 4A3LJ 2IEKA 1IUFA 2VXZA 3S14J 4XLPF 2VQHA 1XSXA 3BG9A 4M3GA 1RESA 1NG7A 2GOMA 2XGEA 4IF4A 3FWEA 4B44A 1OCZH 1J0RA 2HI3A 2XF6A 2VN2A 4BE2A 3LWFA 3DXJF 2VOPA 2JPBA 3LSIA 2QSGX 1EV7A 2HQ5A 2A5WA 2R3SA 3R61A 4LIUA 4YIIA 4QPOA 2JJ7A 3QQAA 1K78B 3PIPF 2XAJA 3SDBA 2W1OA 3FXMA 3DFGA 4MQVA 4G6TB 2PJRA 1FBSA 4V19K 1POGA 4RGSA 4OWRB 2NNYA 4BQOA 2ICWG 2LSOA 5CKTA 5L3DA 1MH3A 2DK5A 3LQRA 4KT5C 1YTYA 5J4YA 2ISYA 1QRYA 3GTMJ 3AG3H 3FBNB 4OOIA 1D0XA 2QBYA 4LIVA 3S1NJ 1LDDA 5HNHA 4CCJA 4A6DA 3ZMSA 4E7HA 1R49A 1YX3A 3RKXA 1BI1A 3F9KA 4BJ5C 2BEOA 3W6JB 1B8IA 3WTYC 3L2RA 2CG4A 5EJCA 4S05A 2NRAC 3K4KA 1P6RA 4PFPA 1J09A 1GV5A 1G3TA 1WVRA 1P92A 2ZMEA 2A3SA 3R60A 1R4MB 1QA6A 1TT0A 1R7JA 4I2OA 1Y8QB 2IGOA 4BHPA 1BR1A 2HVRA 5IP6A 3OYMA 2XPUA 3KEQA 3FXRA 1P4XA 4W97A 1Z05A 2O7OA 2ZXIA 1ZREA 3FMRA 4BY1J 2ZJ2A 3IWZA 2F4MB 3GTQJ 2XSJC 2KIFA 2E36A 5E20A 1MDMA 3QYEA 1WH5A 2V9KA 4KIBA 4EJOA 2QEXI 4ENMA 3G1MA 1YRNB 2L7ZA 2E2IJ 2QWWA 2KDOA 2VL8A 2JA6J 4XONA 1TW2A 1YW9A 3I53A 3E3VA 1BIBA 2DFHA 1MZBA 3O3KA 4XL9A 3L2QA 3AFHA 4C3HJ 2CRGA 1OISA 2IS1A 1X1CA 1Z0XA 1LEBA 1O7FA 1FY7A 5L3EA 3OYHA 4A69C 5DD4A 3M9AA 2M0MA 1GVJA 3CLOA 3CUQB 3FKJA 2CQ7A 2IGKA 1PUFB 1L3LA 1IDZA 3G2BA 4JX5A 2DO7A 2QYOA 2DA7A 3F21A 3K4MA 5LGNA 1UHWA 4ZZDA 2XRNA 1WSUA 3RPUA 2FD5A 4EM1A 2MG4A 1ETVA 2A5YB 3LNQA 3HDDA 4ESFA 4I02A 3RKWA 1X4OA 4KUMA 3L9FA 2EFWA 4Q48A 1PYVA 1IC8A 2Z2SB 2AXLA 2HS5A 1KONA 2Q8KA 4W1UA 3CD6I 1LUJB 3B73A 3ASNH 4XLFA 5LHGA 1IG7A 4G7OF 2GAUA 1XSDA 4UV8A 5GAEJ 4N0BA 2Y48A 3VYTB 1OMIA 4AC0A 4CCMA 3SYTA 2R7WA 1SAXA 4AM3A 3FMQA 3E1SA 5J40A 4QPQA 4UVAA 3RPUD 1X1DA 5LRSA 4HF1A 1GHCA 3PJRA 4HV5A 1OR7A 4CHUA 4G12A 4WXDA 1X3UA 3TKYA 3E97A 3FM5A 2DFEA 3LA3A 4NNJA 5LGUA 2M4GA 1OLTA 1RNLA 2MLGA 2CV1A 4BDZA 4DBRA 1Y6IA 2VT2A 2STWA 3FXOA 1X3WB 4DYRA 1R5GA 3HSEA 2MYSA 1TWGJ 3MQ0A 1UJ8A 4RLQA 1J7KA 4CCLA 5K5QA 4ESJA 3RQ4A 3S8PA 1DPUA 1RKTA 3M8JA 3ZOBA 3LFKA 3D0SA 5D4RA 2R5YA 1J2XA 2L2OA 1R4NB 4XK4A 4AIKA 2LR8A 2Q0OA 4E4HA 1T0FC 5FO5A 2F48A 4L0YB 2EIKH 2HQNA 1TL8A 1W0UA 2DFIA 4WX9A 3C3WA 2K27A 5F0HA 1OKRA 3RKYA 2NVXJ 3VODA 2K7LA 4D9JA 3SEQA 2RV8A 2BOLA 1Z3XA 1XCBA 2BZTA 2RAEA 4ZYHA 5K7FA 1RUNA 5CLSA 5ICFA 2NVQJ 2MH2A 3VYUB 1UAAA 4M6YA 5FKMA 4ETSA 3RZDJ 1RIOH 2YR2A 1PJRA 5J8FA 4LG0A 2H1KA 3BTJA 4UVBA 3ABMH 2VIXA 4ZTJA 3GLXA 4DNCA 3QODA 2IGNA 3SFZA 1QGPA 1MBEA 1MJBA 1U8BA 3K4LA 4L9TA 2R7SA 3K6GA 1O3SA 3HL2A 1XMKA 2C6YA 1ZH5A 3EETA 5JVGF 1ZK8A 4HA8A 4PZJA 5HLIA 1T39A 1QZYA 4JQFA 1S5LC 4XKCA 4PJMA 3Q0WA 3J81K 4FCYA 3V8KA 1XS9A 4PK4A 2UV1A 2ACJA 2A69F 3LSTA 1YIJI 2M2EA 4LLGF 3GTKJ 1A36A 2E1NA 3BR0A 2DI3A 2XF5A 1YJNI 1MBKA 1HQCA 1WZ2A 3F0CA 3A0BC 3KLNA 1SANA 1BOAA 3LAPA 2ELHA 1V3FA 4G6QA 2QA4I 1P9QC 4EJWA 1SFKA 2ZBKA 4PGGA 1YX5A 4Y33A 3DPLC 3I55I 3A4CA 1FBQA 2WTEA 1R71A 3MZ8A 4N9IA 3ZMTA 3E6CC 2R5ZB 3SDGA 2HEOA 4EGZA 3S16J 4Q5SF 4BXXJ 1DDNA 1VQ8I 4A0XA 1WWXA 4ENNA 4GYGA 2XAQA 1ERDA 2TDXA 3K4JA 2HYFA 3ULQB 3BQZA 3T1BA 2RNGA 1XX5A 2GM4A 1Q1VA 4D7MA 5FLVA 1HSJA 3NWSA 5DD8A 2IA1A 5EEGA 3TO6A 3NAUA 3FK7A 5E79C 5E1WA 1GDTA 5KCMA 5EYRA 3OS0A 1JGGA 3JRBA 4ENJA 1K61A 2P0WA 1VQ4I 3J81Z 5H6QA 3PQKA 5LD2C 4U88A 4A0ZA 1T0FA 3ONQA 1Z7UA 2A6TA 2R7DA 3H9JA 3KFWX 2LTPA 2KT0A 2DTRA 2EPFA 2QQBA 3AG1H 2KIMA 3CMMA 3GO5A 3QU6A 1WI9A 2OQGA 2CW7A 3FKIJ 2B0LA 3CUQC 4ASNA 2QM3A 3P7NA 1SD6A 2CV0A 4GDFA 2XSDC 3JSOA 2CSOA 3C18A 4BNCA 5J47A 4E7LA 2XAFA 1TC3C 1T33A 2TCTA 4M73A 3FZVA 1X1AA 4JYKA 1UG2A 2XKPA 4BHCA 3RDIA 4U7BA 1REPC 1K78A 1H9GA 1MGTA 1O7LA 2A6EF 4XOPA 5JFRA 3ABKH 3GWZA 1VFCA 1XMAA 3FHNA 2D2WA 3OR1C 2VQGA 3HTUA 2EILH 3CP2A 3S32A 4CH7A 2K4BA 3OYIA 1VQNI 5DUKA 3CCYA 4IEJA 2XAUA 2H6CA 4XN3A 5GTHC 2HXOA
chains in the Genus database with same CATH topology
4CICA 4ZYEA 1PUEE 2W24A 4M9SA 4G9YA 4HF2A 2NNNA 5LGTA 4IVNA 1ZRDA 5BQTA 1FP1D 4BXUA 2O03A 4HOBA 5FFZA 1ZLJA 3HTSB 4KYWA 3QP6A 1NHAA 4WCGA 4Y15A 3WTWC 3I54A 5DCMB 2DW4A 5IT9K 1ZHFA 4ZZLA 2HTJA 3F3XA 3QU3A 2DU9A 3BDDA 2PMHA 2XUBA 4IJAA 5CVVA 2XHKA 2FNPA 4M74A 3WU0A 2FBHA 4HF0A 2EFOA 3WG9A 4H0EA 1RZ4A 2D1HA 1W5TA 1IXSB 1E2XA 4WXCA 2ADUA 2XASA 2L01A 4OIPF 1IN8A 2GWRA 5LBQA 3CUQA 2ETHA 2P7CB 3TO7A 3Q9SA 3WTTC 2FEZA 2ESNA 2GA1A 2JZYA 3KP5A 2KRFA 3F6OA 3R0AA 5IT9Z 2DPUA 2L4MA 2M1BA 3CO6C 1AOYA 3RYRA 1FYKA 4LLLA 3TQNA 3MEXA 4HLXA 4YFXF 2A6HF 2ZNZA 4HAMA 1HW2A 1EH8A 3S2WA 4L9NA 3CDHA 3M8EA 3BJAA 2D1VA 1XB4A 3GFMA 5K1YA 3RIRA 1BN5A 2OBPA 4OU0A 3HOSA 4A0YA 1Q1HA 2HGCA 2EK5A 2ZFWA 3GW2A 5F64A 3U2RA 4AD9A 1U5TA 4JBAA 2P5LC 1CF7A 3T8TA 3QP5A 2Q2EA 4WF2A 4EGYA 1IW7F 5H6RA 4I09A 2LNBA 3HOTA 1S8NA 1TQMA 3L7WA 1QZZA 2OA4A 3I59B 3WODF 4LK0F 2MC3A 4LB6B 3R6SA 1BC7C 2NYXA 5A2QK 1YQAA 1T2KA 2FRHA 3TDUC 2OU2A 2DQLA 2V1XA 1Z91A 3K2ZA 1PP7U 2G7HA 4EV0A 1ODDA 1ZG3A 1QO0D 1B59A 2XROA 2P7VB 2P8TA 1T6SA 1K7AA 2K02A 3HSFA 2VOOA 4A12A 2GXGA 3P9KA 1YIOA 1O3RA 2IA0A 2M87A 3MCZA 3R4KA 2BYVE 3C1DA 2EV5A 4UVCA 4RAYA 2CO5A 1UFMA 2MBFA 3SXYA 1W7PA 5J6XA 2ESHA 1OPCA 2ZKZA 1EH6A 4Z2YA 5A2QZ 1USSA 1SFUA 3ZQ7A 3ZN1A 1F5TA 5HDNA 2OZUA 3G3ZA 4CZZA 4KMFA 3IC7A 1LNWA 1W7PD 2A68F 5HLGA 3VOEA 1IRGA 1IXCA 4HBLA 4IRIA 2L02A 1KU2A 1JHFA 2UWMA 6PAXA 3R0JA 5LHIA 1RUOA 2VBZA 5ILSA 2XV4S 2X4HA 2W85A 2E1CA 1FSHA 1HKQA 4KICA 3QRFF 4MEYF 5D6EA 2VE9A 1F9NA 1HKSA 5HOOA 1KQ0A 1A04A 1QBJA 1QNTA 4AIJA 4G7HF 1FP2A 1P2FA 3T8RA 3DV8A 3COAC 5FGMA 3I64A 1XSVA 4UNOA 3DQVC 3BJOA 1YS6A 2L4AA 4OIOF 4A2UA 4EM2A 3REOA 1YW8A 4HW0A 1Z6TA 1XGMA 1O3QA 4M9ZA 4P9FA 1J5YA 3JW4A 2QENA 5E1ZB 1IN5A 3FMSA 1FWZA 3FXQA 2RN7A 2V6CA 4KFCA 2WC2A 2JSCA 4WXHA 5JR3A 4L9VA 3TOAA 1WKMA 5HDKA 3NRVA 4L0ZB 1S3JA 2QZ8A 3DKWA 2PLYA 4IPAA 4R1HA 1WRJA 2X0LA 5JVTA 3ZMZA 4BQAA 4U0WA 1SMTA 2RDPA 3HRTA 3IWFA 3KZZA 3J80K 2E7XA 1WQ2A 1BBYA 2IRFG 2DK8A 1MJ9A 2P5KA 2RGVA 2ZCWA 1TQPA 3V7SA 2EWNA 2OZ6A 3P9CA 1D8JA 5CVIA 3IKVA 2HKXA 4EM0B 3KP6A 1BJAA 4KN4X 2HFHA 2PEXA 5FLXK 4LLNA 2W84A 2FE3A 2BV6A 5H20A 3E5QA 5AONA 3E6BA 3GYHX 1G3YA 2VT3A 2QLZA 2EFNA 3CUOA 1H9TA 5L3GA 1I6XA 2UXXA 1MKMA 4KMUX 4MHGA 1IN7A 3SHFA 5FFXA 3J80Z 2Z33A 4GXOA 2M8EA 3GX4X 2MLKA 1B9NA 2NS0A 1DPRA 2P6SA 2H09A 4HDVA 1ZG5A 2LDUA 3GUDA 1PP8F 4XRFA 2IA2A 4LK1F 4ON0A 2W25A 1YYVA 4M6XA 2JT1A 5FLXZ 3K0LA 3TGNA 4L5JA 4GO1A 3K69A 3C7JA 1KGSA 5D4SA 3I4PA 2XGXA 1O57A 3O6BB 3I5UA 4LB5A 5ICCA 4K2EA 4RAZA 2P4WA 5HVQC 1UHMA 3ML6A 1TTYA 2A07F 1ON2A 1GXQA 3CJNA 3PFIA 3GFIA 5LHHA 5ICGA 1FBUA 5D8LB 4HX4A 2VC1A 5ICEA 3ISPA 3AAFA 1D8KA 4B09A 3F8CA 3SZPA 2WV0A 4RB2C 3BZ6A 2RKHA 3T5XA 4MQ9F 4PCQA 4A6EA 4OIQF 3MFKA 3G73A 1V4RA 3WTZA 3WE3A 1TNTA 5CYVA 3F22A 5J8CA 1U78A 2PQ8A 2OD5A 3LAJA 5F6FA 1K79A 5D8KB 3TOBA 5L3CA 3DPTA 5CVRA 3IKTA 3WE2A 3NEUA 1HKTA 4N9HA 4G8XA 2JRTA 3WGIA 2DPDA 2BE5F 3IL2A 1FX7A 1S7AA 1HSTA 2JTVA 5DCFA 3DP7A 2ZO4A 3DEUA 2F5DA 4U7DA 2RC4A 4LMYA 2HWVA 3I71A 2YPRA 2PI0A 3KCCA 4YG2F 4A5NA 2O8XA 4U0YA 3ELKA 4IHSA 1R00A 1BI3A 4RB1A 2Z3YA 1IN4A 3HRUA 4U0VA 3DF8A 1UB9A 2ZMEB 3V7RA 2DT5A 1Z1DA 2QQ9A 3WGHA 5BMZA 2FXAA 4IXAA 4UHTA 4MEXF 5D6FA 2DQRA 1LQ1A 4G7ZF 2DLLA 4OINF 3ZP5A 2PG4A 1H0MA 2F5FA 2O3FA 2CWEA 4JK1X 5HS9A 4Y13A 5KK1A 4BH9A 4P96A 3FXUA 2IT0A 4IRHA 2LKPA 4UV9A 4EVIA 5CVJA 2YX4A 3MWMA 2K4JA 4UXNA 4HZFA 1U6GA 2L54A 1F4KA 1T38A 4ZYGA 4XBFA 3ZMUA 3IRQA 2KKOA 4O3MA 4EQQA 5FD6A 3M8FA 3F72A 3U9GA 4HX8A 1KU9A 2G7UA 1FT9A 3KP7A 3QOPA 2VE8A 1LVAA 4HQMA 3QPTA 1GXPA 1Z9CA 3FF5A 3EYIA 4M9XA 3MAJA 2HDCA 3E5UA 5DUIA 3KP4A 1FYLA 4M72A 3K1MA 1VTNC 1R58A 1ZGJA 3GZ5A 3TO9A 3V8JA 4NHJA 5LEJA 3HUGA 2HKOA 5BS6A 3HIFA 5LEKA 1ZARA 2PBIA 2DBBA 2QVOA 1S7OA 1ZRCA 1LJ9A 4F7ZA 2L3DA 1LB2A 2EJRA 4FHTA 1ZN2A 2VBYA 3GXOA 4YFKF 2FBIA 2WWYA 2LF7A 4LG0B 4I0AA 4TV7A 2QUFA 1USTA 3OV8A 4AIHA 2HTSA 4GYIA 5LRRA 5BPIA 3WTUC 4IRGA 5D5WB 2ZNYA 1UCRA 2GQQA 4G6DA 3B02A 4LJZF 1YFHA 3N97A 4R79A 3RPQA 2FU4A 2XKOA 3CTAA 3EQLF 4KIFA 1SFEA 1XGOA 4PGHA 3O2PE 2V1UA 3ERED 2GA2A 3RJPA 1ZGAA 3FM3A 5E17F 1F1ZA 2HQRA 2IP2A 1BI0A 4ENKA 2Z5UA 5E8GA 3BPXA 1BC8C 1T98A 3RYPA 2E7WA 4FX4A 5AIQA 4EJVA 5FD5A 2FSWA 1P4AA 1IUYA 3IRRA 2COMA 2Y0MA 1U2WA 4BYYA 5JHUA 2EV0A 4IHTA 4LGWA 2IPQX 5D5VB 3Q5FA 3WU1B 2O6GE 3V7CA 2MD5A 4AVPA 2FOKA 3ZMVA 4GCVA 2H27A 3ABTA 1KA8A 1I5ZA 4HQEA 1R36A 2CFXA 4RB0A 1FC3A 5AIPA 4DQ2A 3VEPA 1AWCA 1D3YA 1KU7A 1J9IA 3U1DA 1STZA 4P9UA 3MZHA 2K86A 4HDUA 1CGPA 2CGPA 4KN7X 4MGRA 1FLIA 5BPDA 4XSXF 3BPVA 3BWGA 2GIVA 2O61A 4GGGA 4I98B 4QLCU 2J5PA 5DCMA 1JXSA 4P55A 2F5EA 4CO8A 1R1VA 3BROA 1S6LA 3F8FA 3GFLA 2PMUA 3HSRA 1KQ8A 3HHGA 4G94A 2M45A 2F5CA 2AS5F 1KU3A 1LDKB 2ISZA 4EJTA 1FSEA 4D0PA 1XGSA 2VC0A 4AWXB 1OYWA 4B8XA 2IVMA 1C0WA 1G4DA 4M71A 2GZWA 2OQRA 1J75A 1SMYF 1RI7A 1EH7A 3D5LA 3WTSC 1XN7A 2FF4A 3JTGA 3VFZA 1B6AA 2J5OA 3M7GA 1MJAA 1YS7A 1R23A 1U8RA 3J7AO 5F1RA 2EB7A 1B9MA 1KYWA 4S04A 3LA2A 5CJ9A 1BI2A 1BM9A 3KP3A 4RGXA 5DDGA 1R22A 2RNJA 3HRSA 2Z99A 3IHUA 2Z9OA 3KETA 5K5OA 4NB5A 1IAWA 4CYDA 1ZLKA 4Y17A 1YO5C 4P5OA 3EDPA 2YU3A 3I58A 5DYMA 1HXDA 2VONA 1JHHA 3WGGA 1U5TB 1CF7B 3I59A 4PDKA 4FT8A 4QWQA 1TBXA 5EEHA 2MA3A 2V9VA 1TW3A 2V1DA 1SD4A 3LA7A 2HZTA 4L5IA 3ZPLA 2H6BA 2D45A 2EFQA 1QQIA 2ZXJA 2VODA 4RB3C 2P6TA 2DAOA 2YSRA 1K6OA 5JI6A 4OMZA 3H3ZA 1FPQA 1U3EM 3GEZA 4ZH4F 1IF1A 2BBYA 2O0YA 2KIUA 1PDNC 4XSZF 3H92A 1R5HA 1B4AA 4RGUA 3RTRA 2QQAA 3Q9VA 3VB2A 2FBKA 3KP2A 3L00A 5HLHA 2HYGD 1JGSA 1E17A 1FYMA 3ZMDA 3L09A 2W57A 2FA5A 5LLQA 5TRDA 5IT3A 4BAYA 1W7PB 3BP8A 3K1PA 1G3WA 1HBXG 2Y75A 2LF8A 2FNAA 3OOPA 3I0TA 5FB2A 5ERIA 3L2CA 1I27A 1KYZA 4A5MA 3KLOA 1MD0A 1XD7A 1IXRC 3ABUA 1TLHB 3ROUA 3JAMK 3MZYA 3P9IA 3K9TA 4OMYA 4I0BA 4FX0A 3E6MA 2F2EA 3F6VA 5HS7A 3WTXC 1D5VA 1O3TA 2CQKA 4RGRA 2FQ3A 3LQQA 2QBYB 3QPHA 3BOQA 4MTEA 1ZG1A 3E5XA 4BHBA 3NQOA 3F8BA 4RS8A 4E70A 2EV6A 1YG2A 3JAMZ 3HHHA 2PFBA 3EYYA 5L3FA 3GF2A 1W4MA 2EFPA 3FHZA 1W5SA 4NQWA 3GZ6A 2XIGA 5DEQA 3GFJA 4ZYDA 1XCVA 1U5TC 5ILVA 1MDMB 1J59A 3E6DA 2G9WA 3SQNA 2NAZA 4LD5A 5L3BA 2BGCA 1KQ9A 2P5VA 2JPCA 4WK8F 1R1TA 3V4GA 3F23A 3ECOA 4UUVA 1R1UA 3ECHA 2HR3A 1FNNA 3WTVC 2CYYA 4R8HA 3K1NA 2IJLA 1FZPB 5E8IA 5E18F 1I1GA 4L18B 1YW7A 3JSPA 3RI4A 4EMSA 3EUHA 1FOKA 4HX7A 1TQIA 4Q47A 1XDSA 1G3SA 2XAHA 3BJ6A 1JE8A 4KIGA 4CGZA 5CVUA 1LEAA 4MNUA 2VBWA 1HW1A 1LDJA 1QPMA 1I1SA 5K5RA 1P4WA 2FMLA 5BOXA 2EA2A 1SFXA 1SD7A 4HLYA 2M5WA 1G6NA 2H94A 5ILUA 4I01A 3SZTA 4L9JA 1ULYA 4ESBA 3ZN0A 4HV6A 5DV5A 2R7FA 2UZKA 4CDGA 4HYEA 2IW5A 3M1EA 3CO7C 3KE2A 1S29A 2V79A 4YFNF 2GXBA 2KJBA 3PQJA 3T0YA 3QAHA 1L0OC 1BIAA 1ONVA 1XDUA 2EA4A 5KVRA 1IZ1A 2FMYA 2OAZA 5E1XA 5D5XB 5D5UB 4YIFA 1HW5A 4OIRF 1YLFA 2STTA 2UXNA 3HRMA 3KEOA 1DP7P 4MTDA 2VBXA 2MH9A 1SD5A 3JTHA 3GVAA 1B1BA 1Y0UA 2A61A 4CXFA 1IRFA 2CW0F 5HS8A 2KJCA 3FX3A 2XVCA 3F8NA 3HYIA 4O5VA 2PN6A 3H3UA 4WWCA 3N4MA 3W6KB 4O6JA 1OYIA 1IN6A 3V8LA 1OYYA 5TJJA 2RVCA 3F8MA 2XAGA 3KZYA 3TDZC 1ZYRF 4KA4A 1XGNA 5ED4A 2PJPA 1ZAOA 4KDPA 4Q4ZF 4LFUA 4EJUA 2M30A 5HDGA 2HOEA 1TNSA 3BY6A 2RQPA 1Z6RA 4I7HA 1ZRFA 1DUXC 4XLNF 1ON1A 2YX7A 4KNYA 2VXZA 4XLPF 1XSXA 4IF4A 3FWEA 1J0RA 2VN2A 3LWFA 3DXJF 2VOPA 2JPBA 1EV7A 2R3SA 3R61A 4YIIA 1K78B 2XAJA 3DFGA 4MQVA 1FBSA 4RGSA 2NNYA 2LSOA 5L3DA 2DK5A 3LQRA 4KT5C 1YTYA 2ISYA 4OOIA 2QBYA 1LDDA 4A6DA 3ZMSA 3RKXA 1BI1A 2BEOA 3W6JB 3WTYC 2CG4A 4S05A 2NRAC 1P6RA 1G3TA 1P92A 2A3SA 2ZMEA 3R60A 4I2OA 1R7JA 4BHPA 3KEQA 3FXRA 1P4XA 1Z05A 1ZREA 3FMRA 2ZJ2A 3IWZA 2KIFA 5E20A 1MDMA 4EJOA 4KIBA 4ENMA 2QWWA 1TW2A 1YW9A 3I53A 3E3VA 1BIBA 1MZBA 3O3KA 1LEBA 1O7FA 1FY7A 5L3EA 5DD4A 3M9AA 1GVJA 3CLOA 3CUQB 1L3LA 2DO7A 2QYOA 3F21A 5LGNA 1UHWA 4ZZDA 2XRNA 1WSUA 3RPUA 4EM1A 2A5YB 4ESFA 4I02A 3RKWA 4KUMA 3L9FA 2EFWA 4Q48A 2AXLA 2HS5A 2Q8KA 3B73A 5LHGA 4G7OF 2GAUA 1XSDA 4UV8A 4N0BA 2Y48A 1OMIA 1SAXA 3FMQA 4UVAA 5LRSA 4HF1A 1GHCA 4HV5A 1OR7A 4CHUA 4WXDA 1X3UA 3TKYA 3E97A 3FM5A 3LA3A 5LGUA 1RNLA 2MLGA 2STWA 2VT2A 1R5GA 3HSEA 3MQ0A 1J7KA 5K5QA 4ESJA 1DPUA 3LFKA 3D0SA 5D4RA 1J2XA 4AIKA 2Q0OA 5FO5A 4L0YB 2HQNA 2DFIA 4WX9A 3C3WA 2K27A 1OKRA 3RKYA 3VODA 2K7LA 2RV8A 1XCBA 4ZYHA 1RUNA 5CLSA 5ICFA 2MH2A 4M6YA 4ETSA 1RIOH 2YR2A 5J8FA 4LG0A 4UVBA 3GLXA 4DNCA 3SFZA 1QGPA 1MJBA 4L9TA 1O3SA 2C6YA 1XMKA 1ZH5A 3EETA 4HA8A 4PZJA 5HLIA 1T39A 1QZYA 4JQFA 3J81K 3V8KA 2ACJA 2A69F 3LSTA 4LLGF 2E1NA 2DI3A 1HQCA 3KLNA 1BOAA 3LAPA 2ELHA 1V3FA 4G6QA 4EJWA 2ZBKA 4PGGA 3DPLC 1FBQA 2WTEA 4N9IA 3ZMTA 3E6CC 2HEOA 4EGZA 4Q5SF 1DDNA 4A0XA 1WWXA 4ENNA 4GYGA 2XAQA 2TDXA 2HYFA 3ULQB 3T1BA 1HSJA 5DD8A 2IA1A 5EEGA 3TO6A 5E1WA 4ENJA 3J81Z 5H6QA 3PQKA 4U88A 4A0ZA 1T0FA 1Z7UA 2R7DA 3KFWX 2DTRA 3GO5A 2QQBA 3QU6A 2KIMA 1WI9A 2OQGA 2B0LA 3CUQC 4ASNA 2QM3A 3P7NA 1SD6A 3JSOA 2CSOA 3C18A 4BNCA 2XAFA 4M73A 3FZVA 2XKPA 4BHCA 3RDIA 4U7BA 1REPC 1K78A 1H9GA 1MGTA 1O7LA 2A6EF 5JFRA 3GWZA 1XMAA 2D2WA 3HTUA 2K4BA 5DUKA 2H6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIC A;  4ZYE A;  1PUE E;  2W24 A;  4M9S A;  4G9Y A;  4HF2 A;  2NNN A;  5LGT A;  4IVN A;  1ZRD A;  5BQT A;  1FP1 D;  4BXU A;  2O03 A;  4HOB A;  5FFZ A;  1ZLJ A;  3HTS B;  4KYW A;  3QP6 A;  1NHA A;  4WCG A;  4Y15 A;  3WTW C;  3I54 A;  5DCM B;  2DW4 A;  5IT9 K;  1ZHF A;  4ZZL A;  2HTJ A;  3F3X A;  3QU3 A;  2DU9 A;  3BDD A;  2PMH A;  2XUB A;  4IJA A;  5CVV A;  2XHK A;  2FNP A;  4M74 A;  3WU0 A;  2FBH A;  4HF0 A;  2EFO A;  3WG9 A;  4H0E A;  1RZ4 A;  2D1H A;  1W5T A;  1IXS B;  1E2X A;  4WXC A;  2ADU A;  2XAS A;  2L01 A;  4OIP F;  1IN8 A;  2GWR A;  5LBQ A;  3CUQ A;  2ETH A;  2P7C B;  3TO7 A;  3Q9S A;  3WTT C;  2FEZ A;  2ESN A;  2GA1 A;  2JZY A;  3KP5 A;  2KRF A;  3F6O A;  3R0A A;  5IT9 Z;  2DPU A;  2L4M A;  2M1B A;  3CO6 C;  1AOY A;  3RYR A;  1FYK A;  4LLL A;  3TQN A;  3MEX A;  4HLX A;  4YFX F;  2A6H F;  2ZNZ A;  4HAM A;  1HW2 A;  1EH8 A;  3S2W A;  4L9N A;  3CDH A;  3M8E A;  3BJA A;  2D1V A;  1XB4 A;  3GFM A;  5K1Y A;  3RIR A;  1BN5 A;  2OBP A;  4OU0 A;  3HOS A;  4A0Y A;  1Q1H A;  2HGC A;  2EK5 A;  2ZFW A;  3GW2 A;  5F64 A;  3U2R A;  4AD9 A;  1U5T A;  4JBA A;  2P5L C;  1CF7 A;  3T8T A;  3QP5 A;  2Q2E A;  4WF2 A;  4EGY A;  1IW7 F;  5H6R A;  4I09 A;  2LNB A;  3HOT A;  1S8N A;  1TQM A;  3L7W A;  1QZZ A;  2OA4 A;  3I59 B;  3WOD F;  4LK0 F;  2MC3 A;  4LB6 B;  3R6S A;  1BC7 C;  2NYX A;  5A2Q K;  1YQA A;  1T2K A;  2FRH A;  3TDU C;  2OU2 A;  2DQL A;  2V1X A;  1Z91 A;  3K2Z A;  1PP7 U;  2G7H A;  4EV0 A;  1ODD A;  1ZG3 A;  1QO0 D;  1B59 A;  2XRO A;  2P7V B;  2P8T A;  1T6S A;  1K7A A;  2K02 A;  3HSF A;  2VOO A;  4A12 A;  2GXG A;  3P9K A;  1YIO A;  1O3R A;  2IA0 A;  2M87 A;  3MCZ A;  3R4K A;  2BYV E;  3C1D A;  2EV5 A;  4UVC A;  4RAY A;  2CO5 A;  1UFM A;  2MBF A;  3SXY A;  1W7P A;  5J6X A;  2ESH A;  1OPC A;  2ZKZ A;  1EH6 A;  4Z2Y A;  5A2Q Z;  1USS A;  1SFU A;  3ZQ7 A;  3ZN1 A;  1F5T A;  5HDN A;  2OZU A;  3G3Z A;  4CZZ A;  4KMF A;  3IC7 A;  1LNW A;  1W7P D;  2A68 F;  5HLG A;  3VOE A;  1IRG A;  1IXC A;  4HBL A;  4IRI A;  2L02 A;  1KU2 A;  1JHF A;  2UWM A;  6PAX A;  3R0J A;  5LHI A;  1RUO A;  2VBZ A;  5ILS A;  2XV4 S;  2X4H A;  2W85 A;  2E1C A;  1FSH A;  1HKQ A;  4KIC A;  3QRF F;  4MEY F;  5D6E A;  2VE9 A;  1F9N A;  1HKS A;  5HOO A;  1KQ0 A;  1A04 A;  1QBJ A;  1QNT A;  4AIJ A;  4G7H F;  1FP2 A;  1P2F A;  3T8R A;  3DV8 A;  3COA C;  5FGM A;  3I64 A;  1XSV A;  4UNO A;  3DQV C;  3BJO A;  1YS6 A;  2L4A A;  4OIO F;  4A2U A;  4EM2 A;  3REO A;  1YW8 A;  4HW0 A;  1Z6T A;  1XGM A;  1O3Q A;  4M9Z A;  4P9F A;  1J5Y A;  3JW4 A;  2QEN A;  5E1Z B;  1IN5 A;  3FMS A;  1FWZ A;  3FXQ A;  2RN7 A;  2V6C A;  4KFC A;  2WC2 A;  2JSC A;  4WXH A;  5JR3 A;  4L9V A;  3TOA A;  1WKM A;  5HDK A;  3NRV A;  4L0Z B;  1S3J A;  2QZ8 A;  3DKW A;  2PLY A;  4IPA A;  4R1H A;  1WRJ A;  2X0L A;  5JVT A;  3ZMZ A;  4BQA A;  4U0W A;  1SMT A;  2RDP A;  3HRT A;  3IWF A;  3KZZ A;  3J80 K;  2E7X A;  1WQ2 A;  1BBY A;  2IRF G;  2DK8 A;  1MJ9 A;  2P5K A;  2RGV A;  2ZCW A;  1TQP A;  3V7S A;  2EWN A;  2OZ6 A;  3P9C A;  1D8J A;  5CVI A;  3IKV A;  2HKX A;  4EM0 B;  3KP6 A;  1BJA A;  4KN4 X;  2HFH A;  2PEX A;  5FLX K;  4LLN A;  2W84 A;  2FE3 A;  2BV6 A;  5H20 A;  3E5Q A;  5AON A;  3E6B A;  3GYH X;  1G3Y A;  2VT3 A;  2QLZ A;  2EFN A;  3CUO A;  1H9T A;  5L3G A;  1I6X A;  2UXX A;  1MKM A;  4KMU X;  4MHG A;  1IN7 A;  3SHF A;  5FFX A;  3J80 Z;  2Z33 A;  4GXO A;  2M8E A;  3GX4 X;  2MLK A;  1B9N A;  2NS0 A;  1DPR A;  2P6S A;  2H09 A;  4HDV A;  1ZG5 A;  2LDU A;  3GUD A;  1PP8 F;  4XRF A;  2IA2 A;  4LK1 F;  4ON0 A;  2W25 A;  1YYV A;  4M6X A;  2JT1 A;  5FLX Z;  3K0L A;  3TGN A;  4L5J A;  4GO1 A;  3K69 A;  3C7J A;  1KGS A;  5D4S A;  3I4P A;  2XGX A;  1O57 A;  3O6B B;  3I5U A;  4LB5 A;  5ICC A;  4K2E A;  4RAZ A;  2P4W A;  5HVQ C;  1UHM A;  3ML6 A;  1TTY A;  2A07 F;  1ON2 A;  1GXQ A;  3CJN A;  3PFI A;  3GFI A;  5LHH A;  5ICG A;  1FBU A;  5D8L B;  4HX4 A;  2VC1 A;  5ICE A;  3ISP A;  3AAF A;  1D8K A;  4B09 A;  3F8C A;  3SZP A;  2WV0 A;  4RB2 C;  3BZ6 A;  2RKH A;  3T5X A;  4MQ9 F;  4PCQ A;  4A6E A;  4OIQ F;  3MFK A;  3G73 A;  1V4R A;  3WTZ A;  3WE3 A;  1TNT A;  5CYV A;  3F22 A;  5J8C A;  1U78 A;  2PQ8 A;  2OD5 A;  3LAJ A;  5F6F A;  1K79 A;  5D8K B;  3TOB A;  5L3C A;  3DPT A;  5CVR A;  3IKT A;  3WE2 A;  3NEU A;  1HKT A;  4N9H A;  4G8X A;  2JRT A;  3WGI A;  2DPD A;  2BE5 F;  3IL2 A;  1FX7 A;  1S7A A;  1HST A;  2JTV A;  5DCF A;  3DP7 A;  2ZO4 A;  3DEU A;  2F5D A;  4U7D A;  2RC4 A;  4LMY A;  2HWV A;  3I71 A;  2YPR A;  2PI0 A;  3KCC A;  4YG2 F;  4A5N A;  2O8X A;  4U0Y A;  3ELK A;  4IHS A;  1R00 A;  1BI3 A;  4RB1 A;  2Z3Y A;  1IN4 A;  3HRU A;  4U0V A;  3DF8 A;  1UB9 A;  2ZME B;  3V7R A;  2DT5 A;  1Z1D A;  2QQ9 A;  3WGH A;  5BMZ A;  2FXA A;  4IXA A;  4UHT A;  4MEX F;  5D6F A;  2DQR A;  1LQ1 A;  4G7Z F;  2DLL A;  4OIN F;  3ZP5 A;  2PG4 A;  1H0M A;  2F5F A;  2O3F A;  2CWE A;  4JK1 X;  5HS9 A;  4Y13 A;  5KK1 A;  4BH9 A;  4P96 A;  3FXU A;  2IT0 A;  4IRH A;  2LKP A;  4UV9 A;  4EVI A;  5CVJ A;  2YX4 A;  3MWM A;  2K4J A;  4UXN A;  4HZF A;  1U6G A;  2L54 A;  1F4K A;  1T38 A;  4ZYG A;  4XBF A;  3ZMU A;  3IRQ A;  2KKO A;  4O3M A;  4EQQ A;  5FD6 A;  3M8F A;  3F72 A;  3U9G A;  4HX8 A;  1KU9 A;  2G7U A;  1FT9 A;  3KP7 A;  3QOP A;  2VE8 A;  1LVA A;  4HQM A;  3QPT A;  1GXP A;  1Z9C A;  3FF5 A;  3EYI A;  4M9X A;  3MAJ A;  2HDC A;  3E5U A;  5DUI A;  3KP4 A;  1FYL A;  4M72 A;  3K1M A;  1VTN C;  1R58 A;  1ZGJ A;  3GZ5 A;  3TO9 A;  3V8J A;  4NHJ A;  5LEJ A;  3HUG A;  2HKO A;  5BS6 A;  3HIF A;  5LEK A;  1ZAR A;  2PBI A;  2DBB A;  2QVO A;  1S7O A;  1ZRC A;  1LJ9 A;  4F7Z A;  2L3D A;  1LB2 A;  2EJR A;  4FHT A;  1ZN2 A;  2VBY A;  3GXO A;  4YFK F;  2FBI A;  2WWY A;  2LF7 A;  4LG0 B;  4I0A A;  4TV7 A;  2QUF A;  1UST A;  3OV8 A;  4AIH A;  2HTS A;  4GYI A;  5LRR A;  5BPI A;  3WTU C;  4IRG A;  5D5W B;  2ZNY A;  1UCR A;  2GQQ A;  4G6D A;  3B02 A;  4LJZ F;  1YFH A;  3N97 A;  4R79 A;  3RPQ A;  2FU4 A;  2XKO A;  3CTA A;  3EQL F;  4KIF A;  1SFE A;  1XGO A;  4PGH A;  3O2P E;  2V1U A;  3ERE D;  2GA2 A;  3RJP A;  1ZGA A;  3FM3 A;  5E17 F;  1F1Z A;  2HQR A;  2IP2 A;  1BI0 A;  4ENK A;  2Z5U A;  5E8G A;  3BPX A;  1BC8 C;  1T98 A;  3RYP A;  2E7W A;  4FX4 A;  5AIQ A;  4EJV A;  5FD5 A;  2FSW A;  1P4A A;  1IUY A;  3IRR A;  2COM A;  2Y0M A;  1U2W A;  4BYY A;  5JHU A;  2EV0 A;  4IHT A;  4LGW A;  2IPQ X;  5D5V B;  3Q5F A;  3WU1 B;  2O6G E;  3V7C A;  2MD5 A;  4AVP A;  2FOK A;  3ZMV A;  4GCV A;  2H27 A;  3ABT A;  1KA8 A;  1I5Z A;  4HQE A;  1R36 A;  2CFX A;  4RB0 A;  1FC3 A;  5AIP A;  4DQ2 A;  3VEP A;  1AWC A;  1D3Y A;  1KU7 A;  1J9I A;  3U1D A;  1STZ A;  4P9U A;  3MZH A;  2K86 A;  4HDU A;  1CGP A;  2CGP A;  4KN7 X;  4MGR A;  1FLI A;  5BPD A;  4XSX F;  3BPV A;  3BWG A;  2GIV A;  2O61 A;  4GGG A;  4I98 B;  4QLC U;  2J5P A;  5DCM A;  1JXS A;  4P55 A;  2F5E A;  4CO8 A;  1R1V A;  3BRO A;  1S6L A;  3F8F A;  3GFL A;  2PMU A;  3HSR A;  1KQ8 A;  3HHG A;  4G94 A;  2M45 A;  2F5C A;  2AS5 F;  1KU3 A;  1LDK B;  2ISZ A;  4EJT A;  1FSE A;  4D0P A;  1XGS A;  2VC0 A;  4AWX B;  1OYW A;  4B8X A;  2IVM A;  1C0W A;  1G4D A;  4M71 A;  2GZW A;  2OQR A;  1J75 A;  1SMY F;  1RI7 A;  1EH7 A;  3D5L A;  3WTS C;  1XN7 A;  2FF4 A;  3JTG A;  3VFZ A;  1B6A A;  2J5O A;  3M7G A;  1MJA A;  1YS7 A;  1R23 A;  1U8R A;  3J7A O;  5F1R A;  2EB7 A;  1B9M A;  1KYW A;  4S04 A;  3LA2 A;  5CJ9 A;  1BI2 A;  1BM9 A;  3KP3 A;  4RGX A;  5DDG A;  1R22 A;  2RNJ A;  3HRS A;  2Z99 A;  3IHU A;  2Z9O A;  3KET A;  5K5O A;  4NB5 A;  1IAW A;  4CYD A;  1ZLK A;  4Y17 A;  1YO5 C;  4P5O A;  3EDP A;  2YU3 A;  3I58 A;  5DYM A;  1HXD A;  2VON A;  1JHH A;  3WGG A;  1U5T B;  1CF7 B;  3I59 A;  4PDK A;  4FT8 A;  4QWQ A;  1TBX A;  5EEH A;  2MA3 A;  2V9V A;  1TW3 A;  2V1D A;  1SD4 A;  3LA7 A;  2HZT A;  4L5I A;  3ZPL A;  2H6B A;  2D45 A;  2EFQ A;  1QQI A;  2ZXJ A;  2VOD A;  4RB3 C;  2P6T A;  2DAO A;  2YSR A;  1K6O A;  5JI6 A;  4OMZ A;  3H3Z A;  1FPQ A;  1U3E M;  3GEZ A;  4ZH4 F;  1IF1 A;  2BBY A;  2O0Y A;  2KIU A;  1PDN C;  4XSZ F;  3H92 A;  1R5H A;  1B4A A;  4RGU A;  3RTR A;  2QQA A;  3Q9V A;  3VB2 A;  2FBK A;  3KP2 A;  3L00 A;  5HLH A;  2HYG D;  1JGS A;  1E17 A;  1FYM A;  3ZMD A;  3L09 A;  2W57 A;  2FA5 A;  5LLQ A;  5TRD A;  5IT3 A;  4BAY A;  1W7P B;  3BP8 A;  3K1P A;  1G3W A;  1HBX G;  2Y75 A;  2LF8 A;  2FNA A;  3OOP A;  3I0T A;  5FB2 A;  5ERI A;  3L2C A;  1I27 A;  1KYZ A;  4A5M A;  3KLO A;  1MD0 A;  1XD7 A;  1IXR C;  3ABU A;  1TLH B;  3ROU A;  3JAM K;  3MZY A;  3P9I A;  3K9T A;  4OMY A;  4I0B A;  4FX0 A;  3E6M A;  2F2E A;  3F6V A;  5HS7 A;  3WTX C;  1D5V A;  1O3T A;  2CQK A;  4RGR A;  2FQ3 A;  3LQQ A;  2QBY B;  3QPH A;  3BOQ A;  4MTE A;  1ZG1 A;  3E5X A;  4BHB A;  3NQO A;  3F8B A;  4RS8 A;  4E70 A;  2EV6 A;  1YG2 A;  3JAM Z;  3HHH A;  2PFB A;  3EYY A;  5L3F A;  3GF2 A;  1W4M A;  2EFP A;  3FHZ A;  1W5S A;  4NQW A;  3GZ6 A;  2XIG A;  5DEQ A;  3GFJ A;  4ZYD A;  1XCV A;  1U5T C;  5ILV A;  1MDM B;  1J59 A;  3E6D A;  2G9W A;  3SQN A;  2NAZ A;  4LD5 A;  5L3B A;  2BGC A;  1KQ9 A;  2P5V A;  2JPC A;  4WK8 F;  1R1T A;  3V4G A;  3F23 A;  3ECO A;  4UUV A;  1R1U A;  3ECH A;  2HR3 A;  1FNN A;  3WTV C;  2CYY A;  4R8H A;  3K1N A;  2IJL A;  1FZP B;  5E8I A;  5E18 F;  1I1G A;  4L18 B;  1YW7 A;  3JSP A;  3RI4 A;  4EMS A;  3EUH A;  1FOK A;  4HX7 A;  1TQI A;  4Q47 A;  1XDS A;  1G3S A;  2XAH A;  3BJ6 A;  1JE8 A;  4KIG A;  4CGZ A;  5CVU A;  1LEA A;  4MNU A;  2VBW A;  1HW1 A;  1LDJ A;  1QPM A;  1I1S A;  5K5R A;  1P4W A;  2FML A;  5BOX A;  2EA2 A;  1SFX A;  1SD7 A;  4HLY A;  2M5W A;  1G6N A;  2H94 A;  5ILU A;  4I01 A;  3SZT A;  4L9J A;  1ULY A;  4ESB A;  3ZN0 A;  4HV6 A;  5DV5 A;  2R7F A;  2UZK A;  4CDG A;  4HYE A;  2IW5 A;  3M1E A;  3CO7 C;  3KE2 A;  1S29 A;  2V79 A;  4YFN F;  2GXB A;  2KJB A;  3PQJ A;  3T0Y A;  3QAH A;  1L0O C;  1BIA A;  1ONV A;  1XDU A;  2EA4 A;  5KVR A;  1IZ1 A;  2FMY A;  2OAZ A;  5E1X A;  5D5X B;  5D5U B;  4YIF A;  1HW5 A;  4OIR F;  1YLF A;  2STT A;  2UXN A;  3HRM A;  3KEO A;  1DP7 P;  4MTD A;  2VBX A;  2MH9 A;  1SD5 A;  3JTH A;  3GVA A;  1B1B A;  1Y0U A;  2A61 A;  4CXF A;  1IRF A;  2CW0 F;  5HS8 A;  2KJC A;  3FX3 A;  2XVC A;  3F8N A;  3HYI A;  4O5V A;  2PN6 A;  3H3U A;  4WWC A;  3N4M A;  3W6K B;  4O6J A;  1OYI A;  1IN6 A;  3V8L A;  1OYY A;  5TJJ A;  2RVC A;  3F8M A;  2XAG A;  3KZY A;  3TDZ C;  1ZYR F;  4KA4 A;  1XGN A;  5ED4 A;  2PJP A;  1ZAO A;  4KDP A;  4Q4Z F;  4LFU A;  4EJU A;  2M30 A;  5HDG A;  2HOE A;  1TNS A;  3BY6 A;  2RQP A;  1Z6R A;  4I7H A;  1ZRF A;  1DUX C;  4XLN F;  1ON1 A;  2YX7 A;  4KNY A;  2VXZ A;  4XLP F;  1XSX A;  4IF4 A;  3FWE A;  1J0R A;  2VN2 A;  3LWF A;  3DXJ F;  2VOP A;  2JPB A;  1EV7 A;  2R3S A;  3R61 A;  4YII A;  1K78 B;  2XAJ A;  3DFG A;  4MQV A;  1FBS A;  4RGS A;  2NNY A;  2LSO A;  5L3D A;  2DK5 A;  3LQR A;  4KT5 C;  1YTY A;  2ISY A;  4OOI A;  2QBY A;  1LDD A;  4A6D A;  3ZMS A;  3RKX A;  1BI1 A;  2BEO A;  3W6J B;  3WTY C;  2CG4 A;  4S05 A;  2NRA C;  1P6R A;  1G3T A;  1P92 A;  2A3S A;  2ZME A;  3R60 A;  4I2O A;  1R7J A;  4BHP A;  3KEQ A;  3FXR A;  1P4X A;  1Z05 A;  1ZRE A;  3FMR A;  2ZJ2 A;  3IWZ A;  2KIF A;  5E20 A;  1MDM A;  4EJO A;  4KIB A;  4ENM A;  2QWW A;  1TW2 A;  1YW9 A;  3I53 A;  3E3V A;  1BIB A;  1MZB A;  3O3K A;  1LEB A;  1O7F A;  1FY7 A;  5L3E A;  5DD4 A;  3M9A A;  1GVJ A;  3CLO A;  3CUQ B;  1L3L A;  2DO7 A;  2QYO A;  3F21 A;  5LGN A;  1UHW A;  4ZZD A;  2XRN A;  1WSU A;  3RPU A;  4EM1 A;  2A5Y B;  4ESF A;  4I02 A;  3RKW A;  4KUM A;  3L9F A;  2EFW A;  4Q48 A;  2AXL A;  2HS5 A;  2Q8K A;  3B73 A;  5LHG A;  4G7O F;  2GAU A;  1XSD A;  4UV8 A;  4N0B A;  2Y48 A;  1OMI A;  1SAX A;  3FMQ A;  4UVA A;  5LRS A;  4HF1 A;  1GHC A;  4HV5 A;  1OR7 A;  4CHU A;  4WXD A;  1X3U A;  3TKY A;  3E97 A;  3FM5 A;  3LA3 A;  5LGU A;  1RNL A;  2MLG A;  2STW A;  2VT2 A;  1R5G A;  3HSE A;  3MQ0 A;  1J7K A;  5K5Q A;  4ESJ A;  1DPU A;  3LFK A;  3D0S A;  5D4R A;  1J2X A;  4AIK A;  2Q0O A;  5FO5 A;  4L0Y B;  2HQN A;  2DFI A;  4WX9 A;  3C3W A;  2K27 A;  1OKR A;  3RKY A;  3VOD A;  2K7L A;  2RV8 A;  1XCB A;  4ZYH A;  1RUN A;  5CLS A;  5ICF A;  2MH2 A;  4M6Y A;  4ETS A;  1RIO H;  2YR2 A;  5J8F A;  4LG0 A;  4UVB A;  3GLX A;  4DNC A;  3SFZ A;  1QGP A;  1MJB A;  4L9T A;  1O3S A;  2C6Y A;  1XMK A;  1ZH5 A;  3EET A;  4HA8 A;  4PZJ A;  5HLI A;  1T39 A;  1QZY A;  4JQF A;  3J81 K;  3V8K A;  2ACJ A;  2A69 F;  3LST A;  4LLG F;  2E1N A;  2DI3 A;  1HQC A;  3KLN A;  1BOA A;  3LAP A;  2ELH A;  1V3F A;  4G6Q A;  4EJW A;  2ZBK A;  4PGG A;  3DPL C;  1FBQ A;  2WTE A;  4N9I A;  3ZMT A;  3E6C C;  2HEO A;  4EGZ A;  4Q5S F;  1DDN A;  4A0X A;  1WWX A;  4ENN A;  4GYG A;  2XAQ A;  2TDX A;  2HYF A;  3ULQ B;  3T1B A;  1HSJ A;  5DD8 A;  2IA1 A;  5EEG A;  3TO6 A;  5E1W A;  4ENJ A;  3J81 Z;  5H6Q A;  3PQK A;  4U88 A;  4A0Z A;  1T0F A;  1Z7U A;  2R7D A;  3KFW X;  2DTR A;  3GO5 A;  2QQB A;  3QU6 A;  2KIM A;  1WI9 A;  2OQG A;  2B0L A;  3CUQ C;  4ASN A;  2QM3 A;  3P7N A;  1SD6 A;  3JSO A;  2CSO A;  3C18 A;  4BNC A;  2XAF A;  4M73 A;  3FZV A;  2XKP A;  4BHC A;  3RDI A;  4U7B A;  1REP C;  1K78 A;  1H9G A;  1MGT A;  1O7L A;  2A6E F;  5JFR A;  3GWZ A;  1XMA A;  2D2W A;  3HTU A;  2K4B A;  5DUK A;  2H6C A; 
#chains in the Genus database with same CATH topology
 2W48 A;  3FK6 A;  2HPM A;  2DXI A;  3S3O A;  1U9N A;  2BW3 B;  4CIC A;  4ZYE A;  1PUE E;  4ZDO A;  2CQX A;  3UNG C;  2W24 A;  4M9S A;  2WY8 Q;  3BG5 A;  2VB6 A;  4G9Y A;  1CQT A;  4HF2 A;  1ZQ3 P;  1VQ9 I;  1GLN A;  2HVQ A;  2K85 A;  2NNN A;  4E7Z A;  5LGT A;  4IVN A;  1ZRD A;  5BQT A;  2ID3 A;  2WAE A;  3LSK A;  2E2J J;  1FP1 D;  4BXU A;  2O03 A;  2E1O A;  4BKX A;  4HOB A;  5FFZ A;  1ZLJ A;  3HM5 A;  1RR8 C;  3HTS B;  5EZH A;  3TW7 A;  4A3J J;  4KYW A;  3BC8 A;  4XLC A;  3QP6 A;  1NHA A;  2QSF X;  2ME6 A;  4CUG A;  4WCG A;  4ITV A;  3FIS A;  4Y15 A;  5IOY A;  2KHM A;  1MMG A;  5FKO A;  2EIM H;  2LY2 A;  3WTW C;  3I54 A;  5DCM B;  3HC7 A;  2DFF A;  2DW4 A;  5IT9 K;  4BBS J;  1ZHF A;  2PMZ N;  3I3L A;  4GRI A;  3BR6 A;  1I50 J;  4ZZL A;  1ZKG A;  2HTJ A;  3D5R C;  3F3X A;  3QU3 A;  2DU9 A;  3BDD A;  2PMH A;  2XUB A;  4PFO A;  1WJA A;  2TRT A;  1FMW A;  4IJA A;  5CVV A;  2XHK A;  3ZQC A;  1R6R A;  2FNP A;  3Q0U A;  3HOU J;  2HPI A;  4M74 A;  3WU0 A;  2FBH A;  1XC5 A;  3HZJ A;  2OF7 A;  2X6Y A;  4HF0 A;  2EFO A;  3WG9 A;  4H0E A;  3CP8 A;  1RZ4 A;  2KLO A;  3J7Y J;  2D1H A;  4XM3 A;  4XN0 A;  1W5T A;  3DTK A;  1IXS B;  1E2X A;  4WXC A;  2ADU A;  2XAS A;  2L01 A;  3S2H J;  1VQM I;  4RM2 A;  1IN8 A;  4OIP F;  2GWR A;  3DKX A;  5LBQ A;  3CUQ A;  2ETH A;  3C2G A;  1MNE A;  2P7C B;  3VWB A;  2OCE A;  3TO7 A;  2R7T A;  2IAI A;  1YIT I;  3BG7 A;  3W2V A;  3Q9S A;  2DA6 A;  3WTT C;  2FEZ A;  2ESN A;  4RAF A;  3S93 A;  3CMA I;  4Y52 J;  2GA1 A;  2N8G A;  4OAZ A;  2JZY A;  3KP5 A;  2KRF A;  5F0F A;  1LFB A;  3F6O A;  2IXS A;  2CUZ A;  3R0A A;  4KT6 A;  3OWT A;  1ZGW A;  3W3C A;  1MIJ A;  5IT9 Z;  3H9G A;  2DPU A;  2L4M A;  2K9S A;  2M1B A;  2BY2 A;  3CO6 C;  3W6V A;  2LP0 A;  1AOY A;  3RYR A;  1JJ8 C;  1FYK A;  4LLL A;  4E7S A;  2Y0S N;  3TQN A;  3MEX A;  2LRE A;  4HLX A;  4IHY A;  2Y31 A;  1Y8R B;  2YUS A;  3H5R A;  3OL3 A;  4YFX F;  2A6H F;  2ZNZ A;  4HAM A;  3CCU I;  1HW2 A;  1BW5 A;  1EH8 A;  3S2W A;  4LIT A;  4L9N A;  4B4C A;  3CDH A;  3M8E A;  2KPM A;  2X9D A;  3BJA A;  1WJF A;  2D1V A;  1XB4 A;  3GFM A;  5K1Y A;  1M1E B;  1Z7L A;  3OMY A;  3S3N A;  2QSH X;  4AUX A;  3RIR A;  1BN5 A;  2OBP A;  1T08 B;  4OU0 A;  2O9L A;  3HOS A;  4A0Y A;  3G1L A;  1Q1H A;  2NVY J;  2HGC A;  2EK5 A;  2ZFW A;  3GW2 A;  1V55 H;  1JT6 A;  2IBD A;  1RR7 A;  5F64 A;  3U2R A;  4AD9 A;  1U5T A;  2F4I A;  4JBA A;  3J7Z I;  2P5L C;  3CQZ J;  2LBF B;  1CF7 A;  2V6E A;  1KZH A;  3T8T A;  1HA8 A;  2OTJ I;  4B48 A;  2JA8 J;  5KHD A;  3QP5 A;  3K70 C;  5HNF A;  2Q2E A;  4HNU A;  3OYJ A;  2WBM A;  4WF2 A;  4EGY A;  1MNM C;  1ACI A;  1IW7 F;  5H6R A;  1MBH A;  4XKW A;  2CQN A;  4I09 A;  3JRG A;  2LNB A;  3HOT A;  1S8N A;  1TQM A;  2E60 A;  3L7W A;  2NOJ B;  1QZZ A;  2OA4 A;  2HOA A;  3I59 B;  5BNG A;  3WOD F;  4V2F A;  4LK0 F;  1SVO A;  2HDD A;  2MC3 A;  2M34 A;  1D0Z A;  1NTC A;  4LB6 B;  3JRH A;  3R6S A;  1BC7 C;  3P5J A;  2E2H J;  2NYX A;  5A2Q K;  1YQA A;  1T2K A;  2FRH A;  3TDU C;  2X6W A;  4BS9 A;  2OU2 A;  4BJT A;  4DIQ A;  4X0G A;  2DQL A;  2V1X A;  1Z91 A;  4C2M J;  3K2Z A;  2VXD A;  1PP7 U;  4D5C A;  2F5V A;  2G7H A;  2KQR A;  4EV0 A;  2WY7 Q;  1ODD A;  2JN6 A;  1ZG3 A;  1QO0 D;  3CCE I;  4PSW A;  1B59 A;  4U87 A;  3EUK L;  2XB5 A;  3M3Y J;  2XRO A;  2LY9 A;  2P7V B;  2P8T A;  1T6S A;  1K7A A;  9ANT A;  3VSL A;  4A93 J;  2K02 A;  2GBY A;  2K3P A;  4II3 A;  5E3L A;  3HSF A;  2VOO A;  1N78 A;  3ERM A;  4A12 A;  4QSH A;  2OJE D;  2GXG A;  3P9K A;  1YIO A;  5B66 C;  2F6C A;  1O3R A;  3HGY A;  2IA0 A;  1ETY A;  2M87 A;  3CJT B;  3FDY A;  3RQI A;  3MCZ A;  3R4K A;  1WJE A;  3LSP A;  2BYV E;  3PUB A;  1VZ0 A;  3C1D A;  2EV5 A;  2M3A A;  4UVC A;  4RAY A;  4IHV A;  3HPG A;  2PMZ A;  2CO5 A;  1UFM A;  2KRH A;  4S0H B;  2MBF A;  3SXY A;  1W7P A;  5J6X A;  4NDL A;  1I3Q J;  5FKL A;  2ESH A;  5F0C A;  1OPC A;  2ZKZ A;  1EH6 A;  4Z2Y A;  3KPH A;  5A2Q Z;  1USS A;  3WU2 C;  1SFU A;  3ZQ7 A;  4PUS A;  4ABZ A;  2L0K A;  5DS9 A;  2DTZ A;  3ZN1 A;  1N77 A;  4E6K G;  1H88 C;  2L7F P;  4NBQ A;  3OYF A;  2ID6 A;  5F27 A;  1F5T A;  1ETK A;  5HDN A;  2OZU A;  3G3Z A;  3QOE A;  3ESW B;  3H5A A;  2VKH A;  2H8W A;  2M7B A;  4CZZ A;  2L9N A;  3GZN B;  4KMF A;  1GT0 C;  4NC6 A;  3KYD B;  3IC7 A;  1LNW A;  1W7P D;  2A68 F;  4AU7 A;  5HLG A;  1FOX A;  3VOE A;  4FTH A;  2E35 A;  1VQP I;  1IRG A;  1IXC A;  4HBL A;  1MBF A;  4IRI A;  1MW7 A;  1BR4 A;  2L02 A;  1KU2 A;  5EGO A;  1JHF A;  2UWM A;  6PAX A;  1TT5 B;  3R0J A;  5E3M A;  1QVU A;  3NWT A;  1X2M A;  4HPQ A;  5LHI A;  2Y9Z A;  2VBZ A;  1RUO A;  5ILS A;  2NVT J;  5FLM J;  3CLQ A;  5LFA A;  2XV4 S;  2X4H A;  2W85 A;  3K70 D;  5B1B H;  2E1C A;  1DP3 A;  2K3F A;  1FSH A;  2AQE A;  1HKQ A;  1JUM A;  1ENH A;  3PFY A;  4KIC A;  2RRE A;  3QRF F;  4NC8 A;  4MEY F;  2BHY A;  2Y0S A;  3LSM A;  5D6E A;  1F9N A;  2VE9 A;  1HKS A;  2G0E A;  3HJE A;  5HOO A;  1KQ0 A;  1A04 A;  2DOA A;  4IQ4 A;  1QBJ A;  1AKH B;  5M5X J;  1QNT A;  4AIJ A;  3OYE A;  4G7H F;  1GVD A;  1FP2 A;  1UEL B;  3HBL A;  3ZR8 X;  1P2F A;  4ZYA A;  4B1R A;  1OCC H;  3T8R A;  2MAB A;  3DV8 A;  2X51 A;  3COA C;  1UG0 A;  1FJL A;  5FGM A;  2MD0 A;  3I64 A;  1A31 A;  2L5Q A;  2LH9 A;  1XSV A;  3E7L A;  3A0H C;  4IZZ A;  2H1L A;  4UNO A;  3CES A;  1WHU A;  1X58 A;  3DQV C;  3BJO A;  1YS6 A;  4BE0 A;  3BR5 A;  2L4A A;  1RET A;  4UUS B;  2BVM A;  4OIO F;  4A2U A;  2JWT A;  2ZSI B;  3SZG A;  4EM2 A;  3REO A;  1YW8 A;  4D5F A;  3HKZ N;  4A3K J;  4UB8 C;  1I3A A;  4HW0 A;  1Z6T A;  1XGM A;  1JI8 A;  1O3Q A;  2ECC A;  4M9Z A;  4P9F A;  4UUT A;  1IRX A;  3BZC A;  1J5Y A;  2DA2 A;  3JW4 A;  4NQW B;  2B63 J;  3DLA A;  4DYC A;  2QEN A;  2V9P A;  3HB9 A;  4F92 B;  2EIN H;  3CDL A;  5E1Z B;  1IN5 A;  3FMS A;  2I10 A;  3I56 I;  1FWZ A;  3FXQ A;  4BDY A;  1V54 H;  2RN7 A;  2V6C A;  4KFC A;  2WC2 A;  5IOZ A;  2JSC A;  4WXH A;  5JLX A;  5JR3 A;  4L9V A;  3TOA A;  1WKM A;  5HDK A;  3NRV A;  4L0Z B;  1S3J A;  5EEA A;  5J1Y A;  2V26 A;  2F4O B;  2QZ8 A;  3DKW A;  2PLY A;  4IPA A;  4R1H A;  3MKY B;  1WRJ A;  1Z67 A;  3BR3 A;  3ZQF A;  2X0L A;  5JVT A;  3ZMZ A;  4BQA A;  4XIC A;  5KAF C;  4I99 C;  4U0W A;  1P7J A;  3A01 A;  1SMT A;  4DOZ A;  2RDP A;  3HRT A;  3IWF A;  3KZZ A;  3J80 K;  2HOT A;  3S15 J;  1F36 A;  2E7X A;  1WQ2 A;  2CW8 A;  1BBY A;  4HNV A;  1ZR4 A;  2IRF G;  2DK8 A;  2LOO A;  1MJ9 A;  2P5K A;  2RGV A;  4RAG A;  2ZCW A;  1TQP A;  3IUO A;  1X1B A;  2VKD A;  3V7S A;  2EWN A;  2OZ6 A;  3P9C A;  1D8J A;  3OSF A;  5CVI A;  3BTI A;  2R0Q C;  3I4N J;  4HEA 2;  1APL C;  3IKV A;  2HKX A;  4EM0 B;  5DM6 F;  3KP6 A;  1BJA A;  3AG2 H;  4DZP A;  4KN4 X;  2HFH A;  2PEX A;  5FLX K;  1H8A C;  4LG3 A;  4M3B A;  2VKV A;  4LLN A;  4IL6 C;  2W84 A;  2FE3 A;  2BV6 A;  1A5J A;  2QQ8 A;  5H20 A;  3A03 A;  3E5Q A;  4CSW A;  5AON A;  3E6B A;  4RLF A;  1G3Y A;  3GYH X;  2VT3 A;  2QLZ A;  2JQ7 A;  2EFN A;  3CUO A;  3PUF A;  1H9T A;  5L3G A;  4XQF A;  5EZG A;  1I6X A;  5JHF A;  2UXX A;  1MKM A;  1YOV B;  5J3L A;  3NAR A;  3HUG B;  1RPW A;  4KMU X;  4MHG A;  1RRJ A;  1IN7 A;  2WA0 A;  2XB0 X;  1ORK A;  5FFX A;  3FXL A;  3SHF A;  3J80 Z;  2Z33 A;  4GXO A;  2M8E A;  3GX4 X;  1MMN A;  2VPR A;  2MLK A;  1B9N A;  2NS0 A;  1DPR A;  2P6S A;  2H09 A;  3E0J B;  4HDV A;  1ZG5 A;  2LDU A;  2VJI A;  1MH4 A;  2EZK A;  2X6O A;  2WAD A;  2R4G A;  3GUD A;  1PP8 F;  4XRF A;  2LFB A;  2IA2 A;  4LK1 F;  5EDN A;  4IOA F;  4ON0 A;  3HG9 A;  3QPL A;  2W25 A;  1YYV A;  2R7O A;  2ELJ A;  4M6X A;  2EBI A;  2JT1 A;  3BG6 A;  5FLX Z;  3K0L A;  3TGN A;  3LMM A;  2O5R A;  4L5J A;  4GO1 A;  1ETX A;  3K69 A;  4JX4 A;  4IX7 A;  4KIT B;  2V7F A;  3BR1 A;  4EEF G;  3OYL A;  3C7J A;  1WJD A;  4F91 B;  1KGS A;  4FIS A;  5D4S A;  3I4P A;  3KX2 A;  3EUA A;  2XGX A;  1O57 A;  3O6B B;  3ASO H;  3I5U A;  4LB5 A;  2I5U A;  5ICC A;  4K2E A;  4RAZ A;  2P4W A;  5HVQ C;  1UHM A;  2VQC A;  3ML6 A;  3RSN A;  1TTY A;  2A07 F;  2E71 A;  2DCE A;  2KDZ A;  2K9N A;  2L7M P;  1ON2 A;  2L7K A;  3G71 I;  2KL4 A;  1XG1 A;  1GXQ A;  4QIW N;  3CJN A;  3TP0 A;  3MD2 A;  2ZXH A;  3PFI A;  3GFI A;  4FET A;  1WCM J;  4XKV A;  5LHH A;  1FMV A;  2K40 A;  5J1R A;  5ICG A;  1MSE C;  1FBU A;  3H36 A;  4B43 A;  4Y3O A;  2QF7 A;  5D8L B;  2MC4 A;  4UB6 C;  2EZH A;  4D1Q A;  3OIQ A;  4HX4 A;  2E34 A;  2VC1 A;  3C2H A;  5ICE A;  3ISP A;  3AAF A;  4Z6Y A;  2FOW A;  4A3F J;  3ZXS A;  3HKZ A;  3BG3 A;  1D8K A;  2LLK A;  4B09 A;  3F8C A;  3SZP A;  1BOB A;  1K4T A;  4DGW B;  2WV0 A;  3VYS B;  1O4X A;  3OOU A;  2E1M B;  3FXJ A;  1B72 A;  3MKZ A;  4RB2 C;  4CA0 A;  2L9S A;  3DU6 A;  2XPW A;  2HOS A;  2MFZ A;  3TL4 X;  3BZ6 A;  3RCO A;  2RKH A;  4FE4 A;  1ETO A;  1SC7 A;  4B47 A;  3T5X A;  3HOX J;  2DMT A;  4MQ9 F;  4PCQ A;  4A6E A;  3OY9 A;  1Y39 A;  4OIQ F;  3MFK A;  3G73 A;  1V4R A;  3WTZ A;  3WE3 A;  1TNT A;  5CYV A;  3F22 A;  5J8C A;  1U78 A;  2RQQ A;  2PQ8 A;  3GBG A;  2OD5 A;  3LAJ A;  5F6F A;  4IQJ A;  3CF5 F;  1K79 A;  5D8K B;  2KFD A;  3PO2 J;  1FIA A;  3TOB A;  2BXY A;  2CQQ A;  2OV7 A;  5KAI C;  5HOD A;  1G2H A;  5L3C A;  3DPT A;  4PJ0 C;  5CVR A;  2M8G X;  3IKT A;  3ABL H;  1U0J A;  3WE2 A;  3CC4 I;  3NEU A;  1HKT A;  2FX0 A;  1OFC X;  1LFP A;  2KMU A;  4N9H A;  4G8X A;  3K4C A;  5GPA A;  4MFD A;  2LRD A;  3LFU A;  2JRT A;  3EUH C;  3WGI A;  5IYD J;  3OR2 C;  5EG0 B;  2DPD A;  4C3J J;  2BE5 F;  3IL2 A;  1K6Y A;  2Z1D A;  5KNL A;  1FX7 A;  1N75 A;  3CCM I;  1S7A A;  2ZJR F;  1YE9 A;  1HST A;  2JTV A;  4IKF A;  5DCF A;  3DP7 A;  3LL7 A;  3CCS I;  2ZO4 A;  3KZI C;  1WJC A;  1D5Y A;  3DEU A;  3PO3 J;  2F5D A;  4CYC B;  4U7D A;  2RC4 A;  2CUE A;  2HDW A;  3I4M J;  4LMY A;  2HWV A;  3I71 A;  1JKO C;  2A05 A;  2YPR A;  3KCC A;  4YG2 F;  2PI0 A;  4A5N A;  2O8X A;  1RC9 A;  1EJ9 A;  2JRM A;  4U0Y A;  3ELK A;  4IHS A;  1R00 A;  2R7V A;  1BI3 A;  3S1Q J;  2M9H A;  3ZGK A;  4RB1 A;  2Z3Y A;  2QGU A;  1IN4 A;  3HRU A;  3N05 A;  4U0V A;  4UUS A;  3DF8 A;  1UB9 A;  2CS3 A;  2VKE A;  3IH4 A;  2DOF A;  2NOG A;  2ZME B;  3V7R A;  3JCU C;  4JP0 A;  1HLV A;  2DT5 A;  1Z1D A;  3H35 A;  2QQ9 A;  4C9Y A;  3WGH A;  2R7R A;  1YRN A;  5BMZ A;  2FXA A;  4IXA A;  2EZL A;  3QYF A;  4UHT A;  5K7Z A;  2KIS A;  4MEX F;  5D6F A;  2JVH A;  1E3H A;  2DQR A;  3K4B A;  5C4X J;  3IV5 A;  2CH0 A;  3S1M J;  3EPZ A;  1LQ1 A;  4G7Z F;  2DLL A;  4OIN F;  3ZP5 A;  2XRL A;  3I9V 2;  2PG4 A;  1WI3 A;  2AXT C;  2F5F A;  2O3F A;  3OIO A;  2CWE A;  1H0M A;  4JK1 X;  5HS9 A;  1FTZ A;  3A02 A;  4Y13 A;  5KK1 A;  4A3E J;  1BL0 A;  2DDB A;  4BH9 A;  1K83 J;  1PUF A;  1TWF J;  3IP4 B;  4P96 A;  3FXU A;  3GTL J;  2IT0 A;  1HC8 A;  4IRH A;  2LKP A;  4UV9 A;  3Q3S A;  4EVI A;  5CVJ A;  2W82 A;  2YX4 A;  3DCF A;  3BT9 A;  3LSR A;  3KYL A;  1U9O A;  4B3X A;  2DA4 A;  1D1A A;  2EIJ H;  2OC6 A;  4BBR J;  4A3M J;  3MWM A;  2HNH A;  2K4J A;  4UXN A;  4HZF A;  1U6G A;  2JMW A;  2L54 A;  3ZQQ A;  4H4K C;  1YI2 I;  1T38 A;  2L9R A;  4Y7N J;  1F4K A;  4ZYG A;  4XBF A;  3ZMU A;  2BY0 A;  2DJN A;  2O8K A;  1S7E A;  5M3F J;  3IRQ A;  1FIP A;  2KKO A;  4O3M A;  2JUC A;  4EQQ A;  1VI0 A;  4BEH B;  4C2U A;  5CQG A;  1VQK I;  5FD6 A;  4M3E A;  3M8F A;  3F72 A;  3U9G A;  3X2Q H;  4HX8 A;  1KU9 A;  2G7U A;  4XOR A;  1FT9 A;  3KP7 A;  2Y2Z A;  2VE8 A;  3QOP A;  1LVA A;  2DT7 B;  4HQM A;  3QPT A;  2BHZ A;  1Z9C A;  1GXP A;  3FF5 A;  2DMU A;  3EYI A;  2K9L A;  4M9X A;  3RKQ A;  3MAJ A;  1QHG A;  1QPI A;  4BQQ A;  2HDC A;  1NH3 A;  2E1M C;  4BAC A;  1MBJ A;  1HDP A;  2ZFU A;  3E5U A;  2X85 A;  5DUI A;  3WG7 H;  3KP4 A;  1FYL A;  3DPU A;  2ZJP F;  2HXI A;  2WB1 N;  3BCA A;  2P81 A;  3BQY A;  4M72 A;  3K1M A;  2MSY A;  1VTN C;  1R58 A;  1ITY A;  1ZGJ A;  2CFO A;  2KZV A;  3GZ5 A;  3TO9 A;  3V8J A;  4NHJ A;  2M7A A;  5LEJ A;  2Y69 H;  3HUG A;  2HKO A;  5BS6 A;  2LVS A;  3HIF A;  2EQR A;  2DA5 A;  3TMO A;  1IV8 A;  1ZAR A;  2PBI A;  5LEK A;  5E3O A;  5J1U A;  2ELK A;  2DBB A;  2QVO A;  2MGQ A;  2R5Y B;  1S7O A;  4M3D A;  3S1R J;  1TWH J;  4HSR A;  1ZRC A;  2R93 J;  3GTG J;  1LJ9 A;  3DKY A;  4F7Z A;  2L3D A;  3VPR A;  3OS2 A;  1LB2 A;  2E5Z A;  1BR2 A;  2EJR A;  5GAD J;  3L2U A;  3L2W A;  1NG6 A;  2FQ4 A;  4AVZ A;  4FHT A;  1ZN2 A;  2VBY A;  3GXO A;  4BU2 A;  4YFK F;  3GTJ J;  1V5E A;  3HPH A;  2FBI A;  2WWY A;  2LF7 A;  4XR6 A;  2JSP A;  1OCT C;  4LG0 B;  4I0A A;  4TV7 A;  3HOV J;  4I76 A;  1IV6 A;  3CF2 A;  5C3E J;  1A6Q A;  2AQF A;  2QUF A;  4C30 A;  1UST A;  2VQL A;  3OV8 A;  5B3S H;  4AIH A;  2HTS A;  2GOX B;  3VYR B;  4GYI A;  3S2D J;  1OCR H;  5LRR A;  4RDU A;  3DTI A;  3IAM 2;  4P1W A;  5BPI A;  2K5C A;  3WTU C;  4IRG A;  3ZRG A;  5D5W B;  3DBH B;  2X1C A;  2ZNY A;  1UCR A;  2GQQ A;  2XDV A;  4G6D A;  3B02 A;  4ANJ A;  4LJZ F;  3DBL B;  1YFH A;  3N97 A;  4R79 A;  4A3G J;  2FU4 A;  3RPQ A;  2XKO A;  3CTA A;  3EQL F;  2R5Z A;  2OPT A;  4KIF A;  1SFE A;  1LPQ A;  1LE8 B;  1XGO A;  4PGH A;  3O2P E;  2V1U A;  3ERE D;  2GA2 A;  3RJP A;  2DJI A;  5IYB J;  1ZGA A;  2K9Q A;  1W36 C;  3FM3 A;  2LD5 A;  5E17 F;  1F1Z A;  2HQR A;  2IP2 A;  2ZME C;  1BI0 A;  4ENK A;  2Z5U A;  5E8G A;  2CU7 A;  3BPX A;  2V4J C;  1E3O C;  1BC8 C;  1D0Y A;  1EA3 A;  1T98 A;  5M5Y J;  3RYP A;  3HEF A;  2MW8 A;  3GTP J;  2DA3 A;  2E7W A;  4N4O B;  4II2 A;  4FX4 A;  5AIQ A;  3OYA A;  3OIP A;  5CQE A;  5DTD A;  4EJV A;  3O8G A;  5FD5 A;  1VQ6 I;  2FSW A;  1P4A A;  1IUY A;  3BZK A;  4ZDL A;  1FTT A;  2LKS A;  2GIZ A;  3IRR A;  2COM A;  3M4O J;  2Y0M A;  2EH3 A;  1U2W A;  3BTL A;  4BYY A;  2L9V A;  4CCK A;  5JHU A;  2EV0 A;  1ETQ A;  4IHT A;  4LGW A;  2IPQ X;  1TP4 A;  5D5V B;  3Q5F A;  3WU1 B;  3PIO F;  3HGG A;  1IRZ A;  2O6G E;  3V7C A;  3MKW B;  2MD5 A;  4AVP A;  1R9T J;  3ZQL A;  4RMN A;  3DWL E;  5FRO A;  3B6C A;  4BGD A;  2FOK A;  3ZMV A;  4GCV A;  4RM3 A;  5TGT A;  2H27 A;  3ABT A;  1KA8 A;  3KEY A;  1I5Z A;  4HQE A;  1R36 A;  2CFX A;  2OUM A;  1H89 C;  2M4K A;  1JJ6 C;  2DN0 A;  1TWC J;  2W4S A;  4DW6 A;  2JUG A;  5DM7 F;  3DBR B;  4HG2 A;  4E7K A;  4RB0 A;  1FC3 A;  1WJB A;  2DOE A;  5AIP A;  5FKK A;  5EG0 A;  2BW3 A;  4LOC A;  4DQ2 A;  3VEP A;  3G6E I;  2DMP A;  5GTI C;  3RZO J;  1AWC A;  1D3Y A;  2NXN B;  1KU7 A;  1J9I A;  2XF7 A;  1GUU A;  3PSF A;  4NUB A;  3U1D A;  4NC7 A;  3PM1 A;  3UKG A;  1DGW Y;  4E7J A;  1STZ A;  4CYC A;  4P9U A;  3MZH A;  2HU9 A;  2K86 A;  3HXL A;  3TBI A;  4HDU A;  1ETW A;  3M07 A;  5IPA A;  5TIS C;  1CGP A;  2CGP A;  4KN7 X;  1OR7 C;  4MGR A;  2VI6 A;  1FLI A;  5BPD A;  1A6I A;  3BR2 A;  3IAS 2;  4XSX F;  2Q1Z B;  2LKX A;  3BPV A;  3BWG A;  1S72 I;  3CCJ I;  2GIV A;  2O61 A;  4GGG A;  2WB1 A;  2IGM A;  4CCO A;  4I98 B;  4QLC U;  2J5P A;  5DCM A;  1JXS A;  1V5F A;  4V2G A;  2WAQ N;  1IJW C;  4P55 A;  2F5E A;  4M3F A;  4CO8 A;  3IH2 A;  1R1V A;  3SEZ A;  3BRO A;  3DU5 A;  1S6L A;  3F8F A;  3GFL A;  5K7H A;  3ZQI A;  2PMU A;  2GXA A;  3HSR A;  1KQ8 A;  3HHG A;  2ZXW H;  4G94 A;  3JRF A;  2M45 A;  4BL0 B;  3CME I;  1X4P A;  3DEW A;  3AG4 H;  3G1O A;  4AYB N;  2LMD A;  5IYC J;  3QWL A;  2F5C A;  1VQ7 I;  2AS5 F;  1KU3 A;  1LDK B;  2ISZ A;  4EJT A;  1NK3 P;  1R5I D;  1FSE A;  4D0P A;  1XGS A;  5M5W J;  1W36 D;  1WJ5 A;  1XMX A;  1JUP A;  3KYC B;  2VC0 A;  4AWX B;  4XMY A;  4YEJ A;  4J19 A;  2R7Q A;  5GP9 A;  4RBO A;  3BCB A;  5EF6 A;  4DBQ A;  5C44 J;  2ECB A;  4A3C J;  1OYW A;  4B8X A;  1K4S A;  2IVM A;  4CCN A;  1C0W A;  1G4D A;  3WHC A;  4M71 A;  1OCP A;  4GFB A;  2CUF A;  3BLY A;  4FE7 A;  2GZW A;  3O8H A;  2IS2 A;  2WAF A;  2OQR A;  2DA1 A;  3GTO J;  3D5S C;  1ZTR A;  3DTE A;  3OYB A;  1SMY F;  1RI7 A;  1J75 A;  1EH7 A;  3D5L A;  1BJZ A;  3WTS C;  5IP7 J;  3CCR I;  1I39 A;  1XN7 A;  2WV1 A;  3S3M A;  2FF4 A;  2JA5 J;  3ZQH A;  1MMA A;  3JTG A;  3MKL A;  3VFZ A;  1Y1W J;  1B6A A;  2J5O A;  3M7G A;  1MJA A;  3OL4 A;  1YS7 A;  1R23 A;  3H5N A;  4BEH A;  2CMP A;  2KZG A;  2ZSH B;  1U8R A;  1BA5 A;  3J7A O;  5F1R A;  2UUZ A;  1QVT A;  3TW6 A;  2EB7 A;  1B9M A;  1KYW A;  4S04 A;  3LA2 A;  5CJ9 A;  1AA7 A;  4X1E A;  1XTA A;  1BI2 A;  1BM9 A;  3KP3 A;  3GCM A;  3PNV A;  2COB A;  4RGX A;  2E19 A;  2K9M A;  1G8X A;  2DOD A;  5DDG A;  4XRS G;  2KRC A;  4I6Z A;  2FUG 2;  1R22 A;  3JRE A;  2RNJ A;  4BUP A;  3HRS A;  4F93 B;  2Z99 A;  3IHU A;  2Z9O A;  4XLA A;  3SFI A;  5K5O A;  3KET A;  1IGN A;  4BE1 A;  1D1B A;  2ZB9 A;  5JLW A;  2R7Z J;  1JKP C;  2EZI A;  4NB5 A;  1IAW A;  3K10 A;  4CYD A;  2OCC H;  3JRA A;  1ZLK A;  2FJ1 A;  2JVG A;  1W1W E;  2LBF A;  4Y17 A;  1N25 A;  1YO5 C;  2IS6 A;  2V1N A;  5FRM A;  4ZJZ A;  4P5O A;  3CJQ B;  3EDP A;  3PNT A;  1MBG A;  2YU3 A;  3I58 A;  5DYM A;  1HXD A;  2VON A;  1G59 A;  1JHH A;  3WGG A;  5IP9 J;  1U5T B;  5GPC A;  1CF7 B;  2OTL I;  4KJZ A;  3I59 A;  4PDK A;  4FT8 A;  4QWQ A;  2XPV A;  2Q2E B;  1TBX A;  1Z3Y A;  5C4J J;  2R7U A;  5EEH A;  4JX6 A;  3H9Q A;  4OAY A;  1MSF C;  2MA3 A;  2CUJ A;  1JKR C;  2V9V A;  1TW3 A;  2V1D A;  4CZC A;  4UY8 I;  1Z77 A;  3UR3 C;  3HOW J;  4DZJ A;  1SD4 A;  3AL0 B;  3LA7 A;  2HZT A;  4L5I A;  3ZPL A;  2H6B A;  2D45 A;  2EFQ A;  5IY5 H;  1QQI A;  2BXZ A;  2ZXJ A;  4C2T A;  2VOD A;  3K2A A;  2R92 J;  4RB3 C;  2P6T A;  2W7N A;  2DAO A;  5GAH J;  2LY1 A;  3DEE A;  3CCQ I;  1SEU A;  2H8R A;  2YSR A;  1K6O A;  5JI6 A;  4E7I A;  4OMZ A;  3C2B A;  3H3Z A;  3VDX A;  2GLO A;  1FPQ A;  4J00 A;  1U3E M;  2DMN A;  3GEZ A;  4ZH4 F;  1IF1 A;  3S17 J;  4IHX A;  2BBY A;  3M1C A;  4IO9 F;  1QZE A;  2XGD A;  2O0Y A;  2KIU A;  2QKL B;  1LE8 A;  1PDN C;  4XSZ F;  3H92 A;  4B3A A;  1FEX A;  1R5H A;  3LOC A;  1B4A A;  3GLL A;  2CJJ A;  4RGU A;  2WAQ A;  5F08 A;  3RTR A;  2QQA A;  3Q9V A;  3VB2 A;  2FBK A;  2NVU B;  3OYN A;  3KP2 A;  3U21 A;  3L00 A;  2NS8 A;  4XRS A;  5HLH A;  2HYG D;  4XOT A;  2VJJ A;  1JGS A;  4IHW A;  4BXF A;  1E17 A;  1FYM A;  4M6V A;  2HQA A;  3Q0V A;  1VQ5 I;  3ZMD A;  1WGX A;  3L09 A;  2W57 A;  2FA5 A;  3A1Y A;  4AYB A;  5LLQ A;  5TRD A;  5IT3 A;  4X6A J;  4BAY A;  1W7P B;  3BP8 A;  3K1P A;  1G3W A;  4C3I J;  3MN2 A;  1PVE A;  1HBX G;  1T95 A;  2Y75 A;  2X6X A;  4ZC3 A;  2LF8 A;  2FNA A;  3OOP A;  3PNY A;  3I0T A;  5FB2 A;  3CDI A;  5ERI A;  3L2C A;  1I27 A;  1KYZ A;  4A5M A;  1DQU A;  4F52 A;  3MMY B;  1WPK A;  3KLO A;  4EAT A;  3W2A A;  1MD0 A;  5E3N A;  2VLA A;  1XD7 A;  4DJA A;  2KP6 A;  3G4S I;  1EF4 A;  1IXR C;  3ABU A;  1T8I A;  2D5V A;  1TLH B;  1Y1V J;  3ROU A;  3LSH A;  3JAM K;  3JR9 A;  3MZY A;  2E5N A;  1VND A;  1GV2 A;  3P9I A;  5B1A H;  2VJ5 A;  2JK3 A;  3K9T A;  3VSK A;  1QHH D;  5EGO B;  2AHQ A;  4I0B A;  4OMY A;  4F55 A;  4FX0 A;  3E6M A;  2F2E A;  3F6V A;  1MND A;  1ZEL A;  3H3V K;  5HS7 A;  2PJR B;  3FBI B;  1OQY A;  3CJR B;  3WTX C;  4A3D J;  3H0G J;  3CMY A;  1AKH A;  1D5V A;  1MMD A;  3QYB A;  1UZC A;  3W2W A;  1HCR A;  2HZD A;  2BVL A;  3CC7 I;  1O3T A;  2CQK A;  3WHB A;  1OCO H;  4RGR A;  2FQ3 A;  3LQQ A;  2QBY B;  3HOY J;  3QPH A;  1DGR M;  3BOQ A;  1HF0 A;  1T56 A;  1WFX A;  3OS1 A;  4MTE A;  1ZG1 A;  3J7A Y;  5HLT A;  2DDA A;  2DT6 A;  1I6H J;  3E5X A;  3ZQG A;  4PSX A;  1B8I B;  2KIQ A;  4BHB A;  3B6A A;  3NQO A;  4YRV A;  1VQL I;  3F8B A;  4RS8 A;  4A3I J;  3H1C A;  5FRN A;  4E70 A;  1RKW A;  2EV6 A;  2X1D A;  1YG2 A;  3JAM Z;  3HHH A;  4XLE A;  2ME0 A;  2Y9Y A;  2PFB A;  2XC7 A;  3OYG A;  3EYY A;  5L3F A;  3OSG A;  3GF2 A;  1V5G A;  3SJM A;  4XID A;  1W4M A;  1OJL A;  4JOM A;  1F43 A;  2EFP A;  3FHZ A;  2CV2 A;  1W5S A;  5GAG J;  4ZTF A;  4NQW A;  5CPR B;  3U1K A;  3GZ6 A;  2XIG A;  2Y30 A;  3GFJ A;  5DEQ A;  2ZC2 A;  4ZYD A;  2M0C A;  1XCV A;  1U5T C;  2VJ4 A;  5ILV A;  4YIR X;  1MDM B;  4N4N B;  1J59 A;  3TP3 A;  3E6D A;  2DYS H;  3LSJ A;  3D1N I;  2G9W A;  4MIM A;  3SQN A;  2R7X A;  2NAZ A;  1SAU A;  4KIS A;  4LD5 A;  5L3B A;  2BGC A;  1TWA J;  2BY1 A;  2QKM B;  2HVS A;  1KQ9 A;  2P5V A;  2JPC A;  3FIW A;  4QTR A;  3OYK A;  3MVP A;  4MO7 A;  1Y56 A;  1YJW I;  4WK8 F;  1R1T A;  5J4V A;  3V42 A;  1SVM A;  1X2N A;  3V4G A;  3AL0 C;  3F23 A;  3ECO A;  4UUV A;  1R1U A;  3ECH A;  2HR3 A;  1FNN A;  3WTV C;  2I8D A;  2CYY A;  4R8H A;  3K1N A;  3PL8 A;  2YU9 J;  2IJL A;  1FZP B;  5E8I A;  5E18 F;  1I1G A;  2B7E A;  1YW7 A;  4L18 B;  3CCL I;  3JSP A;  3RI4 A;  4FAS D;  4EMS A;  3EUH A;  4PJL A;  4XKB A;  1FOK A;  4HX7 A;  4HNT A;  2VUM J;  1FOW A;  1EKE A;  1TQI A;  4Q47 A;  3A01 B;  1XDS A;  1AU7 A;  3KIO A;  1G3S A;  2XAH A;  3OYD A;  2X1E A;  3BJ6 A;  1JE8 A;  4KIG A;  4CGZ A;  3K7A J;  5CVU A;  1LEA A;  4MLO A;  1SFO J;  1MMS A;  4MNU A;  1HOM A;  1HDD C;  2VBW A;  1S9H A;  1IDY A;  2LK2 A;  4Y4R A;  1HW1 A;  1DU0 A;  2YS9 A;  1LDJ A;  5B5E C;  1QPM A;  1I1S A;  5K5R A;  2JA7 J;  1P4W A;  2IS4 A;  2FML A;  1UMQ A;  3AKZ A;  3TED A;  1X1P A;  3JRD A;  3H0D A;  3QPS A;  5BOX A;  2EA2 A;  1SFX A;  1SD7 A;  4HLY A;  2M5W A;  3L2V A;  2AO9 A;  3FXK A;  1BW6 A;  1VF9 A;  4XRM A;  1G6N A;  2H94 A;  4PJN A;  5ILU A;  3IH3 A;  4RA2 A;  4I01 A;  3BTC A;  3SZT A;  4L9J A;  4BQN A;  2LG4 A;  1IO2 A;  1ULY A;  4XNF A;  4ESB A;  3ZN0 A;  4HV6 A;  5H2F C;  5DV5 A;  2R7F A;  2UZK A;  4J01 A;  4L5E A;  4CDG A;  4HYE A;  2IW5 A;  3CZ6 A;  3M1E A;  1DU6 A;  1TZL A;  3CO7 C;  2NS7 A;  1SVL A;  3JRC A;  4HRI A;  3KE2 A;  1S29 A;  2V79 A;  5F04 A;  4YFN F;  2GXB A;  2KJB A;  3PQJ A;  1W0T A;  3T0Y A;  1JT0 A;  3QAH A;  1E0E A;  1L0O C;  3HOZ J;  1YJ9 I;  1BIA A;  1ONV A;  1XDU A;  2W00 A;  2EA4 A;  2VPL A;  5KVR A;  3GME A;  4BY7 J;  2BY3 A;  1NK2 P;  1E3P A;  1IZ1 A;  2FMY A;  3JRI A;  4BJ6 C;  1LKX A;  2OAZ A;  5E1X A;  5D5X B;  5D5U B;  4YIF A;  1HW5 A;  2DMQ A;  1LVK A;  4OIR F;  2JA2 A;  2LYC A;  1AHD P;  2B9S A;  1YLF A;  2STT A;  1YHQ I;  2UXN A;  3HRM A;  3OYC A;  3KEO A;  4YEL A;  1DP7 P;  4MTD A;  2VBX A;  2MH9 A;  1X3Z B;  1SD5 A;  3JTH A;  3GVA A;  1B1B A;  5FKN A;  1Y0U A;  2A61 A;  3L1P A;  4CXF A;  4FQG A;  1IRF A;  2CW0 F;  1D1C A;  4F3Q A;  5HS8 A;  2KJC A;  3FX3 A;  1ZR2 A;  2XVC A;  3F8N A;  3HYI A;  1VQO I;  4O5V A;  2PN6 A;  3H3U A;  4WWC A;  3N4M A;  2VAS A;  1JTX A;  3W6K B;  1XPX A;  4O6J A;  1OYI A;  1IN6 A;  3ZCO A;  3PSI A;  4MFE A;  3V8L A;  1JKQ C;  1LFU P;  2ZJQ F;  1OYY A;  5TJJ A;  1JUS A;  2RVC A;  3F8M A;  2X48 A;  5F1J A;  2XAG A;  3KZY A;  3TDZ C;  3LSG A;  3CCV I;  1X19 A;  3A2K A;  1ZYR F;  4KA4 A;  1XGN A;  5ED4 A;  2PJP A;  2DYR H;  1JTY A;  2PX9 A;  1ZAO A;  4KDP A;  1P7I A;  4Q4Z F;  2QCO A;  4LFU A;  4EJU A;  4DYQ A;  2M30 A;  5HDG A;  4D7N A;  2HOE A;  1WH7 A;  4XLH A;  2Z16 A;  1TNS A;  3BY6 A;  5M3M J;  2HYJ A;  2RQP A;  1Z6R A;  4AID A;  4I7H A;  2LC2 A;  4IOC F;  1W5C C;  1Z21 A;  4HST A;  1ZRF A;  4ZDP A;  1DUX C;  1A35 A;  4A3B J;  1Y0N A;  3DLL F;  1B72 B;  4XLN F;  1ON1 A;  2YX7 A;  4KNY A;  1UHS A;  3K4N A;  5FJ8 J;  1FOY A;  3CC2 I;  2XGC A;  4PJJ A;  1QU3 A;  4A3L J;  2IEK A;  1IUF A;  2VXZ A;  3S14 J;  4XLP F;  2VQH A;  1XSX A;  3BG9 A;  4M3G A;  1RES A;  1NG7 A;  2GOM A;  2XGE A;  4IF4 A;  3FWE A;  4B44 A;  1OCZ H;  1J0R A;  2HI3 A;  2XF6 A;  2VN2 A;  4BE2 A;  3LWF A;  3DXJ F;  2VOP A;  2JPB A;  3LSI A;  2QSG X;  1EV7 A;  2HQ5 A;  2A5W A;  2R3S A;  3R61 A;  4LIU A;  4YII A;  4QPO A;  2JJ7 A;  3QQA A;  1K78 B;  3PIP F;  2XAJ A;  3SDB A;  2W1O A;  3FXM A;  3DFG A;  4MQV A;  4G6T B;  2PJR A;  1FBS A;  4V19 K;  1POG A;  4RGS A;  4OWR B;  2NNY A;  4BQO A;  2ICW G;  2LSO A;  5CKT A;  5L3D A;  1MH3 A;  2DK5 A;  3LQR A;  4KT5 C;  1YTY A;  5J4Y A;  2ISY A;  1QRY A;  3GTM J;  3AG3 H;  3FBN B;  4OOI A;  1D0X A;  2QBY A;  4LIV A;  3S1N J;  1LDD A;  5HNH A;  4CCJ A;  4A6D A;  3ZMS A;  4E7H A;  1R49 A;  1YX3 A;  3RKX A;  1BI1 A;  3F9K A;  4BJ5 C;  2BEO A;  3W6J B;  1B8I A;  3WTY C;  3L2R A;  2CG4 A;  5EJC A;  4S05 A;  2NRA C;  3K4K A;  1P6R A;  4PFP A;  1J09 A;  1GV5 A;  1G3T A;  1WVR A;  1P92 A;  2ZME A;  2A3S A;  3R60 A;  1R4M B;  1QA6 A;  1TT0 A;  1R7J A;  4I2O A;  1Y8Q B;  2IGO A;  4BHP A;  1BR1 A;  2HVR A;  5IP6 A;  3OYM A;  2XPU A;  3KEQ A;  3FXR A;  1P4X A;  4W97 A;  1Z05 A;  2O7O A;  2ZXI A;  1ZRE A;  3FMR A;  4BY1 J;  2ZJ2 A;  3IWZ A;  2F4M B;  3GTQ J;  2XSJ C;  2KIF A;  2E36 A;  5E20 A;  1MDM A;  3QYE A;  1WH5 A;  2V9K A;  4KIB A;  4EJO A;  2QEX I;  4ENM A;  3G1M A;  1YRN B;  2L7Z A;  2E2I J;  2QWW A;  2KDO A;  2VL8 A;  2JA6 J;  4XON A;  1TW2 A;  1YW9 A;  3I53 A;  3E3V A;  1BIB A;  2DFH A;  1MZB A;  3O3K A;  4XL9 A;  3L2Q A;  3AFH A;  4C3H J;  2CRG A;  1OIS A;  2IS1 A;  1X1C A;  1Z0X A;  1LEB A;  1O7F A;  1FY7 A;  5L3E A;  3OYH A;  4A69 C;  5DD4 A;  3M9A A;  2M0M A;  1GVJ A;  3CLO A;  3CUQ B;  3FKJ A;  2CQ7 A;  2IGK A;  1PUF B;  1L3L A;  1IDZ A;  3G2B A;  4JX5 A;  2DO7 A;  2QYO A;  2DA7 A;  3F21 A;  3K4M A;  5LGN A;  1UHW A;  4ZZD A;  2XRN A;  1WSU A;  3RPU A;  2FD5 A;  4EM1 A;  2MG4 A;  1ETV A;  2A5Y B;  3LNQ A;  3HDD A;  4ESF A;  4I02 A;  3RKW A;  1X4O A;  4KUM A;  3L9F A;  2EFW A;  4Q48 A;  1PYV A;  1IC8 A;  2Z2S B;  2AXL A;  2HS5 A;  1KON A;  2Q8K A;  4W1U A;  3CD6 I;  1LUJ B;  3B73 A;  3ASN H;  4XLF A;  5LHG A;  1IG7 A;  4G7O F;  2GAU A;  1XSD A;  4UV8 A;  5GAE J;  4N0B A;  2Y48 A;  3VYT B;  1OMI A;  4AC0 A;  4CCM A;  3SYT A;  2R7W A;  1SAX A;  4AM3 A;  3FMQ A;  3E1S A;  5J40 A;  4QPQ A;  4UVA A;  3RPU D;  1X1D A;  5LRS A;  4HF1 A;  1GHC A;  3PJR A;  4HV5 A;  1OR7 A;  4CHU A;  4G12 A;  4WXD A;  1X3U A;  3TKY A;  3E97 A;  3FM5 A;  2DFE A;  3LA3 A;  4NNJ A;  5LGU A;  2M4G A;  1OLT A;  1RNL A;  2MLG A;  2CV1 A;  4BDZ A;  4DBR A;  1Y6I A;  2VT2 A;  2STW A;  3FXO A;  1X3W B;  4DYR A;  1R5G A;  3HSE A;  2MYS A;  1TWG J;  3MQ0 A;  1UJ8 A;  4RLQ A;  1J7K A;  4CCL A;  5K5Q A;  4ESJ A;  3RQ4 A;  3S8P A;  1DPU A;  1RKT A;  3M8J A;  3ZOB A;  3LFK A;  3D0S A;  5D4R A;  2R5Y A;  1J2X A;  2L2O A;  1R4N B;  4XK4 A;  4AIK A;  2LR8 A;  2Q0O A;  4E4H A;  1T0F C;  5FO5 A;  2F48 A;  4L0Y B;  2EIK H;  2HQN A;  1TL8 A;  1W0U A;  2DFI A;  4WX9 A;  3C3W A;  2K27 A;  5F0H A;  1OKR A;  3RKY A;  2NVX J;  3VOD A;  2K7L A;  4D9J A;  3SEQ A;  2RV8 A;  2BOL A;  1Z3X A;  1XCB A;  2BZT A;  2RAE A;  4ZYH A;  5K7F A;  1RUN A;  5CLS A;  5ICF A;  2NVQ J;  2MH2 A;  3VYU B;  1UAA A;  4M6Y A;  5FKM A;  4ETS A;  3RZD J;  1RIO H;  2YR2 A;  1PJR A;  5J8F A;  4LG0 A;  2H1K A;  3BTJ A;  4UVB A;  3ABM H;  2VIX A;  4ZTJ A;  3GLX A;  4DNC A;  3QOD A;  2IGN A;  3SFZ A;  1QGP A;  1MBE A;  1MJB A;  1U8B A;  3K4L A;  4L9T A;  2R7S A;  3K6G A;  1O3S A;  3HL2 A;  1XMK A;  2C6Y A;  1ZH5 A;  3EET A;  5JVG F;  1ZK8 A;  4HA8 A;  4PZJ A;  5HLI A;  1T39 A;  1QZY A;  4JQF A;  1S5L C;  4XKC A;  4PJM A;  3Q0W A;  3J81 K;  4FCY A;  3V8K A;  1XS9 A;  4PK4 A;  2UV1 A;  2ACJ A;  2A69 F;  3LST A;  1YIJ I;  2M2E A;  4LLG F;  3GTK J;  1A36 A;  2E1N A;  3BR0 A;  2DI3 A;  2XF5 A;  1YJN I;  1MBK A;  1HQC A;  1WZ2 A;  3F0C A;  3A0B C;  3KLN A;  1SAN A;  1BOA A;  3LAP A;  2ELH A;  1V3F A;  4G6Q A;  2QA4 I;  1P9Q C;  4EJW A;  1SFK A;  2ZBK A;  4PGG A;  1YX5 A;  4Y33 A;  3DPL C;  3I55 I;  3A4C A;  1FBQ A;  2WTE A;  1R71 A;  3MZ8 A;  4N9I A;  3ZMT A;  3E6C C;  2R5Z B;  3SDG A;  2HEO A;  4EGZ A;  3S16 J;  4Q5S F;  4BXX J;  1DDN A;  1VQ8 I;  4A0X A;  1WWX A;  4ENN A;  4GYG A;  2XAQ A;  1ERD A;  2TDX A;  3K4J A;  2HYF A;  3ULQ B;  3BQZ A;  3T1B A;  2RNG A;  1XX5 A;  2GM4 A;  1Q1V A;  4D7M A;  5FLV A;  1HSJ A;  3NWS A;  5DD8 A;  2IA1 A;  5EEG A;  3TO6 A;  3NAU A;  3FK7 A;  5E79 C;  5E1W A;  1GDT A;  5KCM A;  5EYR A;  3OS0 A;  1JGG A;  3JRB A;  4ENJ A;  1K61 A;  2P0W A;  1VQ4 I;  3J81 Z;  5H6Q A;  3PQK A;  5LD2 C;  4U88 A;  4A0Z A;  1T0F A;  3ONQ A;  1Z7U A;  2A6T A;  2R7D A;  3H9J A;  3KFW X;  2LTP A;  2KT0 A;  2DTR A;  2EPF A;  2QQB A;  3AG1 H;  2KIM A;  3CMM A;  3GO5 A;  3QU6 A;  1WI9 A;  2OQG A;  2CW7 A;  3FKI J;  2B0L A;  3CUQ C;  4ASN A;  2QM3 A;  3P7N A;  1SD6 A;  2CV0 A;  4GDF A;  2XSD C;  3JSO A;  2CSO A;  3C18 A;  4BNC A;  5J47 A;  4E7L A;  2XAF A;  1TC3 C;  1T33 A;  2TCT A;  4M73 A;  3FZV A;  1X1A A;  4JYK A;  1UG2 A;  2XKP A;  4BHC A;  3RDI A;  4U7B A;  1REP C;  1K78 A;  1H9G A;  1MGT A;  1O7L A;  2A6E F;  4XOP A;  5JFR A;  3ABK H;  3GWZ A;  1VFC A;  1XMA A;  3FHN A;  2D2W A;  3OR1 C;  2VQG A;  3HTU A;  2EIL H;  3CP2 A;  3S32 A;  4CH7 A;  2K4B A;  3OYI A;  1VQN I;  5DUK A;  3CCY A;  4IEJ A;  2XAU A;  2H6C A;  4XN3 A;  5GTH C;  2HXO A; 
#chains in the Genus database with same CATH homology
 4CIC A;  4ZYE A;  1PUE E;  2W24 A;  4M9S A;  4G9Y A;  4HF2 A;  2NNN A;  5LGT A;  4IVN A;  1ZRD A;  5BQT A;  1FP1 D;  4BXU A;  2O03 A;  4HOB A;  5FFZ A;  1ZLJ A;  3HTS B;  4KYW A;  3QP6 A;  1NHA A;  4WCG A;  4Y15 A;  3WTW C;  3I54 A;  5DCM B;  2DW4 A;  5IT9 K;  1ZHF A;  4ZZL A;  2HTJ A;  3F3X A;  3QU3 A;  2DU9 A;  3BDD A;  2PMH A;  2XUB A;  4IJA A;  5CVV A;  2XHK A;  2FNP A;  4M74 A;  3WU0 A;  2FBH A;  4HF0 A;  2EFO A;  3WG9 A;  4H0E A;  1RZ4 A;  2D1H A;  1W5T A;  1IXS B;  1E2X A;  4WXC A;  2ADU A;  2XAS A;  2L01 A;  4OIP F;  1IN8 A;  2GWR A;  5LBQ A;  3CUQ A;  2ETH A;  2P7C B;  3TO7 A;  3Q9S A;  3WTT C;  2FEZ A;  2ESN A;  2GA1 A;  2JZY A;  3KP5 A;  2KRF A;  3F6O A;  3R0A A;  5IT9 Z;  2DPU A;  2L4M A;  2M1B A;  3CO6 C;  1AOY A;  3RYR A;  1FYK A;  4LLL A;  3TQN A;  3MEX A;  4HLX A;  4YFX F;  2A6H F;  2ZNZ A;  4HAM A;  1HW2 A;  1EH8 A;  3S2W A;  4L9N A;  3CDH A;  3M8E A;  3BJA A;  2D1V A;  1XB4 A;  3GFM A;  5K1Y A;  3RIR A;  1BN5 A;  2OBP A;  4OU0 A;  3HOS A;  4A0Y A;  1Q1H A;  2HGC A;  2EK5 A;  2ZFW A;  3GW2 A;  5F64 A;  3U2R A;  4AD9 A;  1U5T A;  4JBA A;  2P5L C;  1CF7 A;  3T8T A;  3QP5 A;  2Q2E A;  4WF2 A;  4EGY A;  1IW7 F;  5H6R A;  4I09 A;  2LNB A;  3HOT A;  1S8N A;  1TQM A;  3L7W A;  1QZZ A;  2OA4 A;  3I59 B;  3WOD F;  4LK0 F;  2MC3 A;  4LB6 B;  3R6S A;  1BC7 C;  2NYX A;  5A2Q K;  1YQA A;  1T2K A;  2FRH A;  3TDU C;  2OU2 A;  2DQL A;  2V1X A;  1Z91 A;  3K2Z A;  1PP7 U;  2G7H A;  4EV0 A;  1ODD A;  1ZG3 A;  1QO0 D;  1B59 A;  2XRO A;  2P7V B;  2P8T A;  1T6S A;  1K7A A;  2K02 A;  3HSF A;  2VOO A;  4A12 A;  2GXG A;  3P9K A;  1YIO A;  1O3R A;  2IA0 A;  2M87 A;  3MCZ A;  3R4K A;  2BYV E;  3C1D A;  2EV5 A;  4UVC A;  4RAY A;  2CO5 A;  1UFM A;  2MBF A;  3SXY A;  1W7P A;  5J6X A;  2ESH A;  1OPC A;  2ZKZ A;  1EH6 A;  4Z2Y A;  5A2Q Z;  1USS A;  1SFU A;  3ZQ7 A;  3ZN1 A;  1F5T A;  5HDN A;  2OZU A;  3G3Z A;  4CZZ A;  4KMF A;  3IC7 A;  1LNW A;  1W7P D;  2A68 F;  5HLG A;  3VOE A;  1IRG A;  1IXC A;  4HBL A;  4IRI A;  2L02 A;  1KU2 A;  1JHF A;  2UWM A;  6PAX A;  3R0J A;  5LHI A;  1RUO A;  2VBZ A;  5ILS A;  2XV4 S;  2X4H A;  2W85 A;  2E1C A;  1FSH A;  1HKQ A;  4KIC A;  3QRF F;  4MEY F;  5D6E A;  2VE9 A;  1F9N A;  1HKS A;  5HOO A;  1KQ0 A;  1A04 A;  1QBJ A;  1QNT A;  4AIJ A;  4G7H F;  1FP2 A;  1P2F A;  3T8R A;  3DV8 A;  3COA C;  5FGM A;  3I64 A;  1XSV A;  4UNO A;  3DQV C;  3BJO A;  1YS6 A;  2L4A A;  4OIO F;  4A2U A;  4EM2 A;  3REO A;  1YW8 A;  4HW0 A;  1Z6T A;  1XGM A;  1O3Q A;  4M9Z A;  4P9F A;  1J5Y A;  3JW4 A;  2QEN A;  5E1Z B;  1IN5 A;  3FMS A;  1FWZ A;  3FXQ A;  2RN7 A;  2V6C A;  4KFC A;  2WC2 A;  2JSC A;  4WXH A;  5JR3 A;  4L9V A;  3TOA A;  1WKM A;  5HDK A;  3NRV A;  4L0Z B;  1S3J A;  2QZ8 A;  3DKW A;  2PLY A;  4IPA A;  4R1H A;  1WRJ A;  2X0L A;  5JVT A;  3ZMZ A;  4BQA A;  4U0W A;  1SMT A;  2RDP A;  3HRT A;  3IWF A;  3KZZ A;  3J80 K;  2E7X A;  1WQ2 A;  1BBY A;  2IRF G;  2DK8 A;  1MJ9 A;  2P5K A;  2RGV A;  2ZCW A;  1TQP A;  3V7S A;  2EWN A;  2OZ6 A;  3P9C A;  1D8J A;  5CVI A;  3IKV A;  2HKX A;  4EM0 B;  3KP6 A;  1BJA A;  4KN4 X;  2HFH A;  2PEX A;  5FLX K;  4LLN A;  2W84 A;  2FE3 A;  2BV6 A;  5H20 A;  3E5Q A;  5AON A;  3E6B A;  3GYH X;  1G3Y A;  2VT3 A;  2QLZ A;  2EFN A;  3CUO A;  1H9T A;  5L3G A;  1I6X A;  2UXX A;  1MKM A;  4KMU X;  4MHG A;  1IN7 A;  3SHF A;  5FFX A;  3J80 Z;  2Z33 A;  4GXO A;  2M8E A;  3GX4 X;  2MLK A;  1B9N A;  2NS0 A;  1DPR A;  2P6S A;  2H09 A;  4HDV A;  1ZG5 A;  2LDU A;  3GUD A;  1PP8 F;  4XRF A;  2IA2 A;  4LK1 F;  4ON0 A;  2W25 A;  1YYV A;  4M6X A;  2JT1 A;  5FLX Z;  3K0L A;  3TGN A;  4L5J A;  4GO1 A;  3K69 A;  3C7J A;  1KGS A;  5D4S A;  3I4P A;  2XGX A;  1O57 A;  3O6B B;  3I5U A;  4LB5 A;  5ICC A;  4K2E A;  4RAZ A;  2P4W A;  5HVQ C;  1UHM A;  3ML6 A;  1TTY A;  2A07 F;  1ON2 A;  1GXQ A;  3CJN A;  3PFI A;  3GFI A;  5LHH A;  5ICG A;  1FBU A;  5D8L B;  4HX4 A;  2VC1 A;  5ICE A;  3ISP A;  3AAF A;  1D8K A;  4B09 A;  3F8C A;  3SZP A;  2WV0 A;  4RB2 C;  3BZ6 A;  2RKH A;  3T5X A;  4MQ9 F;  4PCQ A;  4A6E A;  4OIQ F;  3MFK A;  3G73 A;  1V4R A;  3WTZ A;  3WE3 A;  1TNT A;  5CYV A;  3F22 A;  5J8C A;  1U78 A;  2PQ8 A;  2OD5 A;  3LAJ A;  5F6F A;  1K79 A;  5D8K B;  3TOB A;  5L3C A;  3DPT A;  5CVR A;  3IKT A;  3WE2 A;  3NEU A;  1HKT A;  4N9H A;  4G8X A;  2JRT A;  3WGI A;  2DPD A;  2BE5 F;  3IL2 A;  1FX7 A;  1S7A A;  1HST A;  2JTV A;  5DCF A;  3DP7 A;  2ZO4 A;  3DEU A;  2F5D A;  4U7D A;  2RC4 A;  4LMY A;  2HWV A;  3I71 A;  2YPR A;  2PI0 A;  3KCC A;  4YG2 F;  4A5N A;  2O8X A;  4U0Y A;  3ELK A;  4IHS A;  1R00 A;  1BI3 A;  4RB1 A;  2Z3Y A;  1IN4 A;  3HRU A;  4U0V A;  3DF8 A;  1UB9 A;  2ZME B;  3V7R A;  2DT5 A;  1Z1D A;  2QQ9 A;  3WGH A;  5BMZ A;  2FXA A;  4IXA A;  4UHT A;  4MEX F;  5D6F A;  2DQR A;  1LQ1 A;  4G7Z F;  2DLL A;  4OIN F;  3ZP5 A;  2PG4 A;  1H0M A;  2F5F A;  2O3F A;  2CWE A;  4JK1 X;  5HS9 A;  4Y13 A;  5KK1 A;  4BH9 A;  4P96 A;  3FXU A;  2IT0 A;  4IRH A;  2LKP A;  4UV9 A;  4EVI A;  5CVJ A;  2YX4 A;  3MWM A;  2K4J A;  4UXN A;  4HZF A;  1U6G A;  2L54 A;  1F4K A;  1T38 A;  4ZYG A;  4XBF A;  3ZMU A;  3IRQ A;  2KKO A;  4O3M A;  4EQQ A;  5FD6 A;  3M8F A;  3F72 A;  3U9G A;  4HX8 A;  1KU9 A;  2G7U A;  1FT9 A;  3KP7 A;  3QOP A;  2VE8 A;  1LVA A;  4HQM A;  3QPT A;  1GXP A;  1Z9C A;  3FF5 A;  3EYI A;  4M9X A;  3MAJ A;  2HDC A;  3E5U A;  5DUI A;  3KP4 A;  1FYL A;  4M72 A;  3K1M A;  1VTN C;  1R58 A;  1ZGJ A;  3GZ5 A;  3TO9 A;  3V8J A;  4NHJ A;  5LEJ A;  3HUG A;  2HKO A;  5BS6 A;  3HIF A;  5LEK A;  1ZAR A;  2PBI A;  2DBB A;  2QVO A;  1S7O A;  1ZRC A;  1LJ9 A;  4F7Z A;  2L3D A;  1LB2 A;  2EJR A;  4FHT A;  1ZN2 A;  2VBY A;  3GXO A;  4YFK F;  2FBI A;  2WWY A;  2LF7 A;  4LG0 B;  4I0A A;  4TV7 A;  2QUF A;  1UST A;  3OV8 A;  4AIH A;  2HTS A;  4GYI A;  5LRR A;  5BPI A;  3WTU C;  4IRG A;  5D5W B;  2ZNY A;  1UCR A;  2GQQ A;  4G6D A;  3B02 A;  4LJZ F;  1YFH A;  3N97 A;  4R79 A;  3RPQ A;  2FU4 A;  2XKO A;  3CTA A;  3EQL F;  4KIF A;  1SFE A;  1XGO A;  4PGH A;  3O2P E;  2V1U A;  3ERE D;  2GA2 A;  3RJP A;  1ZGA A;  3FM3 A;  5E17 F;  1F1Z A;  2HQR A;  2IP2 A;  1BI0 A;  4ENK A;  2Z5U A;  5E8G A;  3BPX A;  1BC8 C;  1T98 A;  3RYP A;  2E7W A;  4FX4 A;  5AIQ A;  4EJV A;  5FD5 A;  2FSW A;  1P4A A;  1IUY A;  3IRR A;  2COM A;  2Y0M A;  1U2W A;  4BYY A;  5JHU A;  2EV0 A;  4IHT A;  4LGW A;  2IPQ X;  5D5V B;  3Q5F A;  3WU1 B;  2O6G E;  3V7C A;  2MD5 A;  4AVP A;  2FOK A;  3ZMV A;  4GCV A;  2H27 A;  3ABT A;  1KA8 A;  1I5Z A;  4HQE A;  1R36 A;  2CFX A;  4RB0 A;  1FC3 A;  5AIP A;  4DQ2 A;  3VEP A;  1AWC A;  1D3Y A;  1KU7 A;  1J9I A;  3U1D A;  1STZ A;  4P9U A;  3MZH A;  2K86 A;  4HDU A;  1CGP A;  2CGP A;  4KN7 X;  4MGR A;  1FLI A;  5BPD A;  4XSX F;  3BPV A;  3BWG A;  2GIV A;  2O61 A;  4GGG A;  4I98 B;  4QLC U;  2J5P A;  5DCM A;  1JXS A;  4P55 A;  2F5E A;  4CO8 A;  1R1V A;  3BRO A;  1S6L A;  3F8F A;  3GFL A;  2PMU A;  3HSR A;  1KQ8 A;  3HHG A;  4G94 A;  2M45 A;  2F5C A;  2AS5 F;  1KU3 A;  1LDK B;  2ISZ A;  4EJT A;  1FSE A;  4D0P A;  1XGS A;  2VC0 A;  4AWX B;  1OYW A;  4B8X A;  2IVM A;  1C0W A;  1G4D A;  4M71 A;  2GZW A;  2OQR A;  1J75 A;  1SMY F;  1RI7 A;  1EH7 A;  3D5L A;  3WTS C;  1XN7 A;  2FF4 A;  3JTG A;  3VFZ A;  1B6A A;  2J5O A;  3M7G A;  1MJA A;  1YS7 A;  1R23 A;  1U8R A;  3J7A O;  5F1R A;  2EB7 A;  1B9M A;  1KYW A;  4S04 A;  3LA2 A;  5CJ9 A;  1BI2 A;  1BM9 A;  3KP3 A;  4RGX A;  5DDG A;  1R22 A;  2RNJ A;  3HRS A;  2Z99 A;  3IHU A;  2Z9O A;  3KET A;  5K5O A;  4NB5 A;  1IAW A;  4CYD A;  1ZLK A;  4Y17 A;  1YO5 C;  4P5O A;  3EDP A;  2YU3 A;  3I58 A;  5DYM A;  1HXD A;  2VON A;  1JHH A;  3WGG A;  1U5T B;  1CF7 B;  3I59 A;  4PDK A;  4FT8 A;  4QWQ A;  1TBX A;  5EEH A;  2MA3 A;  2V9V A;  1TW3 A;  2V1D A;  1SD4 A;  3LA7 A;  2HZT A;  4L5I A;  3ZPL A;  2H6B A;  2D45 A;  2EFQ A;  1QQI A;  2ZXJ A;  2VOD A;  4RB3 C;  2P6T A;  2DAO A;  2YSR A;  1K6O A;  5JI6 A;  4OMZ A;  3H3Z A;  1FPQ A;  1U3E M;  3GEZ A;  4ZH4 F;  1IF1 A;  2BBY A;  2O0Y A;  2KIU A;  1PDN C;  4XSZ F;  3H92 A;  1R5H A;  1B4A A;  4RGU A;  3RTR A;  2QQA A;  3Q9V A;  3VB2 A;  2FBK A;  3KP2 A;  3L00 A;  5HLH A;  2HYG D;  1JGS A;  1E17 A;  1FYM A;  3ZMD A;  3L09 A;  2W57 A;  2FA5 A;  5LLQ A;  5TRD A;  5IT3 A;  4BAY A;  1W7P B;  3BP8 A;  3K1P A;  1G3W A;  1HBX G;  2Y75 A;  2LF8 A;  2FNA A;  3OOP A;  3I0T A;  5FB2 A;  5ERI A;  3L2C A;  1I27 A;  1KYZ A;  4A5M A;  3KLO A;  1MD0 A;  1XD7 A;  1IXR C;  3ABU A;  1TLH B;  3ROU A;  3JAM K;  3MZY A;  3P9I A;  3K9T A;  4OMY A;  4I0B A;  4FX0 A;  3E6M A;  2F2E A;  3F6V A;  5HS7 A;  3WTX C;  1D5V A;  1O3T A;  2CQK A;  4RGR A;  2FQ3 A;  3LQQ A;  2QBY B;  3QPH A;  3BOQ A;  4MTE A;  1ZG1 A;  3E5X A;  4BHB A;  3NQO A;  3F8B A;  4RS8 A;  4E70 A;  2EV6 A;  1YG2 A;  3JAM Z;  3HHH A;  2PFB A;  3EYY A;  5L3F A;  3GF2 A;  1W4M A;  2EFP A;  3FHZ A;  1W5S A;  4NQW A;  3GZ6 A;  2XIG A;  5DEQ A;  3GFJ A;  4ZYD A;  1XCV A;  1U5T C;  5ILV A;  1MDM B;  1J59 A;  3E6D A;  2G9W A;  3SQN A;  2NAZ A;  4LD5 A;  5L3B A;  2BGC A;  1KQ9 A;  2P5V A;  2JPC A;  4WK8 F;  1R1T A;  3V4G A;  3F23 A;  3ECO A;  4UUV A;  1R1U A;  3ECH A;  2HR3 A;  1FNN A;  3WTV C;  2CYY A;  4R8H A;  3K1N A;  2IJL A;  1FZP B;  5E8I A;  5E18 F;  1I1G A;  4L18 B;  1YW7 A;  3JSP A;  3RI4 A;  4EMS A;  3EUH A;  1FOK A;  4HX7 A;  1TQI A;  4Q47 A;  1XDS A;  1G3S A;  2XAH A;  3BJ6 A;  1JE8 A;  4KIG A;  4CGZ A;  5CVU A;  1LEA A;  4MNU A;  2VBW A;  1HW1 A;  1LDJ A;  1QPM A;  1I1S A;  5K5R A;  1P4W A;  2FML A;  5BOX A;  2EA2 A;  1SFX A;  1SD7 A;  4HLY A;  2M5W A;  1G6N A;  2H94 A;  5ILU A;  4I01 A;  3SZT A;  4L9J A;  1ULY A;  4ESB A;  3ZN0 A;  4HV6 A;  5DV5 A;  2R7F A;  2UZK A;  4CDG A;  4HYE A;  2IW5 A;  3M1E A;  3CO7 C;  3KE2 A;  1S29 A;  2V79 A;  4YFN F;  2GXB A;  2KJB A;  3PQJ A;  3T0Y A;  3QAH A;  1L0O C;  1BIA A;  1ONV A;  1XDU A;  2EA4 A;  5KVR A;  1IZ1 A;  2FMY A;  2OAZ A;  5E1X A;  5D5X B;  5D5U B;  4YIF A;  1HW5 A;  4OIR F;  1YLF A;  2STT A;  2UXN A;  3HRM A;  3KEO A;  1DP7 P;  4MTD A;  2VBX A;  2MH9 A;  1SD5 A;  3JTH A;  3GVA A;  1B1B A;  1Y0U A;  2A61 A;  4CXF A;  1IRF A;  2CW0 F;  5HS8 A;  2KJC A;  3FX3 A;  2XVC A;  3F8N A;  3HYI A;  4O5V A;  2PN6 A;  3H3U A;  4WWC A;  3N4M A;  3W6K B;  4O6J A;  1OYI A;  1IN6 A;  3V8L A;  1OYY A;  5TJJ A;  2RVC A;  3F8M A;  2XAG A;  3KZY A;  3TDZ C;  1ZYR F;  4KA4 A;  1XGN A;  5ED4 A;  2PJP A;  1ZAO A;  4KDP A;  4Q4Z F;  4LFU A;  4EJU A;  2M30 A;  5HDG A;  2HOE A;  1TNS A;  3BY6 A;  2RQP A;  1Z6R A;  4I7H A;  1ZRF A;  1DUX C;  4XLN F;  1ON1 A;  2YX7 A;  4KNY A;  2VXZ A;  4XLP F;  1XSX A;  4IF4 A;  3FWE A;  1J0R A;  2VN2 A;  3LWF A;  3DXJ F;  2VOP A;  2JPB A;  1EV7 A;  2R3S A;  3R61 A;  4YII A;  1K78 B;  2XAJ A;  3DFG A;  4MQV A;  1FBS A;  4RGS A;  2NNY A;  2LSO A;  5L3D A;  2DK5 A;  3LQR A;  4KT5 C;  1YTY A;  2ISY A;  4OOI A;  2QBY A;  1LDD A;  4A6D A;  3ZMS A;  3RKX A;  1BI1 A;  2BEO A;  3W6J B;  3WTY C;  2CG4 A;  4S05 A;  2NRA C;  1P6R A;  1G3T A;  1P92 A;  2A3S A;  2ZME A;  3R60 A;  4I2O A;  1R7J A;  4BHP A;  3KEQ A;  3FXR A;  1P4X A;  1Z05 A;  1ZRE A;  3FMR A;  2ZJ2 A;  3IWZ A;  2KIF A;  5E20 A;  1MDM A;  4EJO A;  4KIB A;  4ENM A;  2QWW A;  1TW2 A;  1YW9 A;  3I53 A;  3E3V A;  1BIB A;  1MZB A;  3O3K A;  1LEB A;  1O7F A;  1FY7 A;  5L3E A;  5DD4 A;  3M9A A;  1GVJ A;  3CLO A;  3CUQ B;  1L3L A;  2DO7 A;  2QYO A;  3F21 A;  5LGN A;  1UHW A;  4ZZD A;  2XRN A;  1WSU A;  3RPU A;  4EM1 A;  2A5Y B;  4ESF A;  4I02 A;  3RKW A;  4KUM A;  3L9F A;  2EFW A;  4Q48 A;  2AXL A;  2HS5 A;  2Q8K A;  3B73 A;  5LHG A;  4G7O F;  2GAU A;  1XSD A;  4UV8 A;  4N0B A;  2Y48 A;  1OMI A;  1SAX A;  3FMQ A;  4UVA A;  5LRS A;  4HF1 A;  1GHC A;  4HV5 A;  1OR7 A;  4CHU A;  4WXD A;  1X3U A;  3TKY A;  3E97 A;  3FM5 A;  3LA3 A;  5LGU A;  1RNL A;  2MLG A;  2STW A;  2VT2 A;  1R5G A;  3HSE A;  3MQ0 A;  1J7K A;  5K5Q A;  4ESJ A;  1DPU A;  3LFK A;  3D0S A;  5D4R A;  1J2X A;  4AIK A;  2Q0O A;  5FO5 A;  4L0Y B;  2HQN A;  2DFI A;  4WX9 A;  3C3W A;  2K27 A;  1OKR A;  3RKY A;  3VOD A;  2K7L A;  2RV8 A;  1XCB A;  4ZYH A;  1RUN A;  5CLS A;  5ICF A;  2MH2 A;  4M6Y A;  4ETS A;  1RIO H;  2YR2 A;  5J8F A;  4LG0 A;  4UVB A;  3GLX A;  4DNC A;  3SFZ A;  1QGP A;  1MJB A;  4L9T A;  1O3S A;  2C6Y A;  1XMK A;  1ZH5 A;  3EET A;  4HA8 A;  4PZJ A;  5HLI A;  1T39 A;  1QZY A;  4JQF A;  3J81 K;  3V8K A;  2ACJ A;  2A69 F;  3LST A;  4LLG F;  2E1N A;  2DI3 A;  1HQC A;  3KLN A;  1BOA A;  3LAP A;  2ELH A;  1V3F A;  4G6Q A;  4EJW A;  2ZBK A;  4PGG A;  3DPL C;  1FBQ A;  2WTE A;  4N9I A;  3ZMT A;  3E6C C;  2HEO A;  4EGZ A;  4Q5S F;  1DDN A;  4A0X A;  1WWX A;  4ENN A;  4GYG A;  2XAQ A;  2TDX A;  2HYF A;  3ULQ B;  3T1B A;  1HSJ A;  5DD8 A;  2IA1 A;  5EEG A;  3TO6 A;  5E1W A;  4ENJ A;  3J81 Z;  5H6Q A;  3PQK A;  4U88 A;  4A0Z A;  1T0F A;  1Z7U A;  2R7D A;  3KFW X;  2DTR A;  3GO5 A;  2QQB A;  3QU6 A;  2KIM A;  1WI9 A;  2OQG A;  2B0L A;  3CUQ C;  4ASN A;  2QM3 A;  3P7N A;  1SD6 A;  3JSO A;  2CSO A;  3C18 A;  4BNC A;  2XAF A;  4M73 A;  3FZV A;  2XKP A;  4BHC A;  3RDI A;  4U7B A;  1REP C;  1K78 A;  1H9G A;  1MGT A;  1O7L A;  2A6E F;  5JFR A;  3GWZ A;  1XMA A;  2D2W A;  3HTU A;  2K4B A;  5DUK A;  2H6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...