1V4RA

Solution structure of streptmycal repressor trar
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional Repressor
publication title Solution structure of Streptmycal repressor TraR
rcsb
source organism Streptomyces
molecule tags Gene regulation
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v4rA01
2UXNA 1O3QA 1KGSA 2YU3A 2QM3A 2D1VA 3RDIA 2Z9OA 1HKTA 1ONVA 2XKPA 4MTDA 3P9CA 4FHTA 5CVUA 2K27A 4FX4A 3T8TA 1B9MA 2VT3A 4UXNA 3LA3A 4A6EA 3QPTA 2JPCA 5DEQA 1CF7B 1MGTA 1P6RA 1O3RA 2G9WA 2G7HA 1XN7A 3P9IA 3SZPA 2M5WA 5KK1A 3ZQ7A 5DDGA 5E18F 2ZBKA 1WQ2A 2EWNA 3KP2A 4KN4X 3RYPA 3DFGA 3DEUA 2NYXA 2Z5UA 5HVQC 2RV8A 1LB2A 1J5YA 2PFBA 3K2ZA 1IAWA 3EYIA 4CO8A 3ZMDA 1BI2A 2VONA 5E8IA 1KQ8A 2GXGA 3GUDA 4GO1A 5CLSA 3JSOA 3SHFA 1OYYA 3EYYA 3WODF 1HW5A 3K69A 1XD7A 4KN7X 3GYHX 5LGNA 4LLLA 1ZLJA 5CVRA 2HZTA 2HGCA 1GHCA 1UCRA 1FNNA 4ZYGA 1RI7A 4UV9A 4HA8A 3RTRA 3R0JA 3HHGA 2BYVE 2O0YA 1WI9A 2DPUA 5EEGA 4HF2A 1ZREA 3HOSA 4E70A 5FD6A 4UNOA 2QWWA 2HWVA 4GYGA 3EETA 3TOAA 1XCBA 2BBYA 4BXUA 3DXJF 4LGWA 1PDNC 3CUQB 5KVRA 3GXOA 1SAXA 2A6HF 3TDZC 1RIOH 4WK8F 5L3DA 2OA4A 4CXFA 3BPVA 2Z3YA 3E6BA 3M9AA 2FRHA 2X0LA 1ZGJA 2DPDA 3DQVC 4M9SA 3KFWX 4Q5SF 2ETHA 4G6QA 4HQMA 1T2KA 1D8KA 2L01A 2Z33A 2F5CA 1P92A 3J80K 2BE5F 4EM2A 2VC0A 3F21A 4LB6B 1MDMA 1K6OA 3L7WA 5FGMA 1XMAA 2ISZA 1U3EM 1KYWA 4KDPA 4LLNA 3LQRA 3GW2A 2RGVA 3F6OA 5H6QA 1QBJA 3W6KB 2CWEA 2FQ3A 5A2QK 2K4BA 2DAOA 3D5LA 5LEKA 3DPLC 3MZYA 4HAMA 4A0ZA 1HKSA 2VOOA 3WGIA 3ZMTA 1KU7A 3KP5A 4BNCA 4I0BA 4ZYHA 2PLYA 1HBXG 4UVAA 1XDUA 3I53A 1XGMA 1YYVA 2V1DA 2EV6A 2P7CB 4U7BA 4UVCA 3FM3A 3GFLA 3S2WA 4S04A 2YX4A 2A6EF 1YLFA 3NEUA 4MQVA 4BQAA 3V8LA 4I01A 3M8EA 2MC3A 1BI1A 2FF4A 2Z99A 3RYRA 4PDKA 2O3FA 4H0EA 4KIFA 4L5IA 5HDGA 2NNYA 3GF2A 2F2EA 2QENA 1I27A 1KU9A 3ZMZA 4ESJA 5E1WA 4P96A 2GWRA 1R36A 2L4AA 3K0LA 4MEYF 4OIRF 3DF8A 5FB2A 3M7GA 1MJ9A 1U2WA 2K86A 4BH9A 4LG0B 2C6YA 1SD6A 3EUHA 1B1BA 2J5OA 4HF1A 3VODA 2A5YB 4PCQA 6PAXA 1YW8A 2O03A 4RS8A 3L2CA 2GZWA 4PGGA 5D6FA 1ZN2A 3WTUC 1JHFA 4GXOA 1YO5C 3R61A 1XGNA 3CUQA 2ESNA 4EJUA 2FMLA 5BQTA 1HSTA 3T0YA 1YTYA 4LFUA 1R22A 3IWZA 1ZAOA 5L3BA 3KETA 2BV6A 2J5PA 1U5TA 2UZKA 2VN2A 1MZBA 3I5UA 1XB4A 2OZ6A 3O3KA 1HQCA 3T1BA 1F4KA 2O8XA 1USTA 2M87A 3I64A 1SFXA 3Q9SA 4HF0A 2FNPA 3VOEA 2W57A 4HDUA 4A12A 3QOPA 1O7FA 5DD8A 3WTTC 1EH8A 4OIPF 3M1EA 2PN6A 4LMYA 4JK1X 3O2PE 1G3WA 3F8FA 3FZVA 2ISYA 4ESBA 2A07F 2PG4A 2WV0A 5LGTA 1BM9A 4S05A 2HS5A 2VOPA 3IL2A 2Q2EA 5HDNA 1YIOA 3Q9VA 3N4MA 1T6SA 1TQMA 1AWCA 3ABTA 1ZYRF 2W84A 4A5MA 3FF5A 2GXBA 1T38A 2MLKA 1L0OC 1JGSA 2IPQX 4I0AA 2E1CA 1KQ0A 2XV4S 3RJPA 1GVJA 2YR2A 1I1GA 4ENJA 2XGXA 1TTYA 2L3DA 3FM5A 4EGZA 4YFXF 2P4WA 5HS7A 4RAYA 2HFHA 3P7NA 2DI3A 2W24A 2EB7A 2PMUA 2ZKZA 2ZMEA 3DP7A 2H27A 4AWXB 3BJOA 4M9XA 5D4RA 1O3SA 3WTVC 4G7HF 1XDSA 2EK5A 3E6DA 3FXRA 1D8JA 4G6DA 1IUYA 4L9NA 3PQJA 5FO5A 3J80Z 4WXCA 4U7DA 2P5KA 3KP3A 1JXSA 1L3LA 2JZYA 1OYWA 2R3SA 3BPXA 4WXDA 1G3TA 3F8MA 3CLOA 1T0FA 5LBQA 1QZYA 2NAZA 4EM0B 1J59A 1ON1A 3HRUA 3LFKA 4BAYA 1IZ1A 5A2QZ 4A0YA 3QRFF 2FU4A 1S8NA 3LSTA 4KICA 2V1UA 3W6JB 1EV7A 4EGYA 3U1DA 2GQQA 1MKMA 5K1YA 2R7FA 1IN5A 4MGRA 4BYYA 2LNBA 3LA2A 4RGXA 2LKPA 1R5HA 2RDPA 1CGPA 2V1XA 3D0SA 5E20A 3NRVA 4RGUA 2GA2A 3V7SA 1K78A 5ILUA 4B8XA 1STZA 1QGPA 4L9TA 3MWMA 1FYLA 3HRTA 4IHTA 4ESFA 5TRDA 4EJVA 4ZYDA 3OV8A 1B9NA 3VEPA 5J6XA 5LEJA 4HX7A 1LEBA 2A68F 4O5VA 3MQ0A 2RKHA 1FX7A 3K1MA 3SXYA 3MCZA 4M9ZA 3EQLF 1Z9CA 5IT9Z 3F72A 2CYYA 4IRHA 5BPDA 4K2EA 3HTSB 5E1XA 3ECOA 4A2UA 1LDKB 5H20A 2QLZA 1FBUA 1EH6A 2A61A 3I4PA 2WC2A 2WWYA 1ZG3A 1B6AA 1SD4A 3QAHA 4HQEA 5IT3A 4IXAA 4G94A 1NHAA 1AOYA 1S3JA 2XASA 3B73A 1IXSB 4ENMA 5ICEA 3VB2A 1SFUA 1J2XA 4OU0A 5DUKA 4MNUA 1BJAA 1U8RA 4AVPA 3HIFA 2IRFG 4LD5A 3OOPA 2YSRA 2LDUA 1ZARA 3WE2A 3JAMK 1ZRCA 4HV6A 3CUQC 2DBBA 4HV5A 3TKYA 3V4GA 4HX8A 1P4WA 2YX7A 1Z6TA 4OOIA 3H3ZA 2VC1A 3R60A 2CQKA 4XRFA 2OBPA 1UFMA 1U5TC 3C7JA 1IXRC 3IRQA 4ENNA 3V7RA 3BDDA 2M30A 3K1PA 5JHUA 4M71A 1ZG5A 1U5TB 5FD5A 3ZMSA 2QQ9A 3MAJA 1LNWA 4EQQA 1S29A 4HZFA 3MEXA 5AIQA 4I2OA 1PP7U 4FT8A 2CG4A 5E17F 3AAFA 3BROA 2HEOA 4HX4A 5E8GA 1PUEE 1HXDA 5ILSA 1BI3A 2MBFA 2M1BA 3KP4A 5DYMA 4ETSA 1B4AA 1TW3A 3HHHA 1H9GA 1XSDA 4IJAA 4QWQA 3J81K 1BN5A 3E3VA 1W5TA 5ICGA 1V4RA 3ULQB 2ZO4A 2W25A 4YIFA 4N0BA 3HYIA 2TDXA 3WU1B 3DV8A 2CFXA 2NNNA 2FBIA 5H6RA 2P5LC 3FX3A 2JSCA 2P6TA 4L0YB 1LDDA 3F8BA 2B0LA 4EJOA 5FLXK 4NHJA 3J7AO 3E5QA 3QPHA 4DNCA 4CGZA 1BIBA 1DUXC 5E1ZB 4BHCA 3WTSC 1KU2A 3REOA 1I6XA 3RKYA 3ISPA 1ULYA 2RQPA 3H3UA 3GZ6A 3ZPLA 1JHHA 2NRAC 4A0XA 2EFNA 3PFIA 3BZ6A 2ZMEB 4KFCA 4MQ9F 1WKMA 5FFZA 3GWZA 3GFMA 1R1UA 5AIPA 4D0PA 2EFWA 3C3WA 3N97A 1XGSA 1SFEA 1HW2A 4AD9A 5L3EA 4CYDA 3R4KA 2IP2A 1R23A 4N9HA 2HQRA 2UWMA 2EV0A 1H9TA 3IWFA 1MJAA 2YPRA 2VODA 1O3TA 4N9IA 1YW7A 2HYFA 2LF7A 2RVCA 2IJLA 5D6EA 2Q8KA 1DP7P 4ZYEA 1XSVA 5D5XB 3ZMUA 1ZHFA 4OIQF 4L18B 2X4HA 5IT9K 2QVOA 1IN6A 4CZZA 1DDNA 1IW7F 3ML6A 2CO5A 2DO7A 1O57A 1J0RA 1FYMA 2KIUA 2JTVA 4GGGA 4KMUX 3KZYA 2A69F 1FP2A 3E5XA 4XLNF 3WTZA 1TQPA 1BOAA 1A04A 3BWGA 2L02A 2EFOA 3HUGA 3IKTA 3LAPA 1UHMA 1J75A 5K5RA 1RUOA 5ERIA 3DPTA 1D5VA 1R1TA 2P5VA 4MTEA 1FBSA 2GAUA 1QNTA 2PBIA 2V6CA 3HRSA 3KP6A 1MD0A 3CDHA 3HSEA 3G3ZA 1IN7A 4G8XA 1K78B 3IHUA 4EMSA 1Q1HA 1ODDA 1FPQA 5L3CA 5LLQA 3LAJA 2VT2A 2EV5A 3KEOA 3IKVA 3ABUA 2KKOA 1R00A 3FMSA 1OYIA 3L09A 1WSUA 4CHUA 1R7JA 5CYVA 3V8KA 3TQNA 1IXCA 2FBKA 2MH2A 2F5FA 4LB5A 1DPUA 5CVJA 4ON0A 2P7VB 4EJTA 2M8EA 1ON2A 3SQNA 5HLIA 3QU6A 1ZGAA 3RIRA 4KUMA 2XHKA 1RNLA 3B02A 4KYWA 3JAMZ 4I02A 1TW2A 1I1SA 4M72A 4WXHA 1Z05A 3K9TA 5FFXA 3BJAA 4GCVA 4RB1A 4KA4A 2AS5F 2OAZA 1UB9A 1V3FA 2FBHA 5F1RA 5ICCA 4U0WA 1P4XA 4RB0A 3WGHA 2VBXA 3F23A 1YS6A 3HSFA 2FXAA 2D45A 4HYEA 3DKWA 5HLHA 3U9GA 2ACJA 1F1ZA 1HKQA 2HQNA 2LSOA 3M8FA 3KZZA 5JFRA 3GLXA 3JTHA 4XBFA 1IN8A 4M73A 1LEAA 4FX0A 3U2RA 4ENKA 3GFIA 3EDPA 3TO9A 1IRGA 3J81Z 2E1NA 2GA1A 2IT0A 5BMZA 1C0WA 5J8CA 1PP8F 1OMIA 4ZZDA 3I54A 3FHZA 3WG9A 5DCMB 5AONA 1FWZA 2JRTA 1FSEA 4Q4ZF 3R6SA 2VBYA 1FYKA 2BEOA 4LK0F 3F6VA 3CO6C 5LRSA 4RB2C 3TDUC 1SMTA 5FLXZ 2QZ8A 2L54A 2G7UA 1K79A 3HOTA 4LLGF 3FMRA 2HTJA 2H09A 1Z1DA 4L9VA 4UHTA 1J7KA 1YG2A 2EFPA 4AIKA 3C1DA 4A5NA 1IF1A 1XMKA 4EJWA 1EH7A 2JPBA 4Y13A 2H94A 1HW1A 4U88A 3RI4A 4KT5C 4JQFA 2QQBA 2DQRA 5BS6A 2IA2A 2XAHA 2KIMA 5JR3A 5D8KB 3NQOA 5D5UB 1SD7A 2IVMA 1TQIA 3ECHA 3HRMA 1D3YA 5LHIA 4KIGA 5DV5A 4M6XA 1LJ9A 1KQ9A 1T98A 1BBYA 1SD5A 1E17A 5HDKA 3KP7A 5ILVA 3E6MA 1TNTA 2VE8A 3KLNA 2QUFA 1FC3A 3CO7C 3GVAA 2UXXA 3IRRA 3E5UA 2HDCA 5F64A 4HLXA 1YFHA 4P9UA 2PI0A 3CJNA 1WWXA 2RN7A 1ZRDA 1Z91A 2EA4A 2GIVA 3CTAA 2MLGA 2CSOA 5ICFA 5CJ9A 3WTWC 1W7PD 3KLOA 2ZNYA 4M74A 2D2WA 3ZMVA 4UUVA 2R7DA 4EM1A 4AIJA 2XROA 4TV7A 2QBYA 3O6BB 1Z7UA 2EA2A 4XSXF 1KA8A 2Y48A 3H92A 5JVTA 3GO5A 3K1NA 4OINF 1QPMA 2H6CA 1FBQA 1RZ4A 3I59B 2EFQA 1W7PB 2W85A 5DCMA 2STTA 1KYZA 3FXQA 2DK8A 2PEXA 1G4DA 2HKOA 2E7WA 4G7OF 3ERED 3WU0A 5CVIA 4U0VA 2IW5A 5F6FA 2XAQA 5EEHA 2VE9A 4R79A 1BI0A 4G9YA 2E7XA 2FEZA 4CDGA 5HS9A 3F3XA 5LHGA 2ZNZA 1VTNC 2P8TA 2ELHA 4RAZA 1G3SA 5LGUA 3BP8A 1X3UA 1QZZA 4R1HA 1F5TA 2KJCA 4ASNA 2VBWA 1TLHB 3IC7A 2ADUA 2K4JA 2IA1A 3PQKA 3KE2A 2M45A 2DQLA 2HTSA 4MEXF 3QP6A 2V79A 4Q48A 4BHPA 1OKRA 4RGRA 5D8LB 2HOEA 3BJ6A 4UV8A 2DFIA 4EV0A 3F22A 2XAGA 1JE8A 1ZLKA 4M6YA 4WX9A 3ZP5A 1REPC 2OQRA 2XAJA 2OZUA 3I58A 2VXZA 4GYIA 3SFZA 3RPUA 1S7OA 4BHBA 1LQ1A 3ROUA 1FY7A 2HYGD 4YFKF 4IRGA 4L9JA 4MHGA 2BGCA 1HSJA 5LRRA 1P4AA 2WTEA 4R8HA 4Y17A 1CF7A 3WE3A 1FZPB 1I5ZA 2DTRA 4Z2YA 3I0TA 3FMQA 2NS0A 1DPRA 1U78A 4JBAA 5JI6A 4I7HA 1U6GA 4Y15A 4CICA 2PQ8A 3KCCA 2KRFA 2ZXJA 3WGGA 2OQGA 2O61A 4LK1F 4HBLA 1Y0UA 1UHWA 4NB5A 4P5OA 1YS7A 1XSXA 4XSZF 3QP5A 4P9FA 4WWCA 1FOKA 2QQAA 3F8NA 4KMFA 2DU9A 2A3SA 1ZRFA 2ESHA 3LQQA 1GXQA 5TJJA 4ZZLA 5LHHA 2AXLA 2KJBA 3BOQA 1R58A 1XGOA 1MJBA 2DLLA 1QO0D 3P9KA 1J9IA 4WCGA 5K5OA 3I59A 3FWEA 3ZN1A 5DD4A 3C18A 1W7PA 4WF2A 2MH9A 3WTXC 4G7ZF 4RB3C 4KIBA 3VFZA 3QU3A 4YG2F 2CW0F 1ZH5A 2STWA 5BOXA 3HTUA 1W5SA 2K02A 2CGPA 4O6JA 3GX4X 2XKOA 4OIOF 4O3MA 4I98B 3TO6A 4L5JA 1SMYF 2HKXA 1USSA 2FA5A 4PGHA 3RKWA 4UVBA 5K5QA 1WRJA 1K7AA 3R0AA 3G73A 3GFJA 3GEZA 2QYOA 3ELKA 1S7AA 1LDJA 5DCFA 3TGNA 4A6DA 4IVNA 2Q0OA 2K7LA 3T8RA 1FLIA 4HLYA 2P6SA 5D4SA 1H0MA 3TOBA 1R5GA 4U0YA 3JSPA 1IN4A 1QQIA 2EJRA 4HW0A 3F8CA 4IHSA 4XLPF 2O6GE 4EVIA 1FSHA 3CUOA 2F5DA 3TO7A 2V9VA 4HOBA 3E6CC 3BY6A 1TNSA 5BPIA 4YIIA 4OMZA 1GXPA 5D5VB 1IRFA 2VBZA 3V7CA 3Q5FA 3SZTA 4P55A 1P2FA 3I71A 4AIHA 4NQWA 4DQ2A 5HOOA 1BC7C 1ZG1A 5L3GA 4RGSA 2ZJ2A 1T39A 2FOKA 2MD5A 4Q47A 2FMYA 4ZH4F 2DT5A 2KIFA 3V8JA 5D5WB 3JTGA 1LVAA 1S6LA 3RKXA 2FE3A 3COAC 2OU2A 1YQAA 2HR3A 2QBYB 1R1VA 1E2XA 2PMHA 4QLCU 2IA0A 4OMYA 3JW4A 4YFNF 1OR7A 2OD5A 1RUNA 2Y75A 1FT9A 5J8FA 2Y0MA 5CVVA 3KEQA 5L3FA 2RC4A 3E97A 3HSRA 2RNJA 4IRIA 1FP1D 4HDVA 3L9FA 5HLGA 4F7ZA 2COMA 4IF4A 3FXUA 3GZ5A 2ZCWA 1XCVA 1G6NA 5DUIA 2MA3A 4I09A 4LG0A 4L0ZB 4LJZF 3MFKA 1BC8C 2DW4A 2XRNA 1KU3A 2LF8A 2FSWA 2XVCA 2L4MA 2PJPA 2H6BA 1Z6RA 2XUBA 3T5XA 4B09A 3ZN0A 1YW9A 1W4MA 3MZHA 1B59A 2FNAA 2XIGA 3L00A 2DK5A 5ED4A 3LWFA 1TBXA 2JT1A 1G3YA 3LA7A 1F9NA 2D1HA 5HS8A 4KNYA 1OPCA 2ZFWA 3WTYC 1BIAA 2F5EA 1MDMB 4IPAA 1O7LA 3RPQA 2XAFA 4PZJA
chains in the Genus database with same CATH superfamily
1VF9A 1A36A 2UXNA 4B47A 1O3QA 2I8DA 1KGSA 2YU3A 4DBRA 2LH9A 2QM3A 3TP3A 3TBIA 2D1VA 1VQPI 2ME0A 3RDIA 2LREA 2Z9OA 3X2QH 3L2WA 1YJNI 1ZTRA 2DA7A 2P81A 4B43A 1HKTA 1ONVA 2XKPA 3FIWA 2NVYJ 4MTDA 3HZJA 3P9CA 4FHTA 3S1MJ 4E4HA 3E1SA 5CVUA 5E3MA 4J19A 2CW8A 2K27A 4FX4A 3T8TA 1B9MA 2VT3A 4UXNA 3LA3A 3BG6A 4A6EA 3QPTA 2JPCA 2R7QA 5DEQA 4HNTA 1MGTA 4BJ5C 1CF7B 1P6RA 1K4TA 1O3RA 1K6YA 2G9WA 5J47A 2G7HA 2NVUB 5IYBJ 3OYFA 2X1CA 2EZHA 3D1NI 2IEKA 1V5FA 1XN7A 2IBDA 2JWTA 3P9IA 3SZPA 4C2MJ 3ABMH 3FXKA 2JUCA 2M5WA 5KK1A 3ZQ7A 5DDGA 5E18F 1MH3A 2EIMH 1WQ2A 2ZBKA 4IO9F 1ACIA 1A6QA 2EWNA 3KP2A 1VI0A 4KN4X 3RYPA 3DFGA 1T56A 3DEUA 3I55I 2NYXA 4I6ZA 2H1LA 2Z5UA 1PVEA 2VJJA 3AG1H 5HVQC 2RV8A 5B5EC 1LB2A 4NC8A 2CFOA 3I4NJ 3OSFA 1J5YA 2P0WA 2PFBA 2MG4A 3K2ZA 2NVTJ 1IAWA 3EYIA 2LFBA 4CO8A 1P9QC 3ZMDA 1BI2A 2VONA 5E8IA 1KQ8A 2ZJQF 3MN2A 2GXGA 3CZ6A 3GUDA 4GO1A 5CLSA 3JSOA 3SHFA 2E1MC 1OYYA 2K5CA 1OCRH 2GIZA 2QKMB 2XPVA 4X0GA 3HM5A 5F1JA 3EYYA 3DBHB 1Y1WJ 3WODF 2LR8A 3NAUA 2MC4A 3LNQA 3A01A 1QHHD 2VJ5A 1HW5A 2DMUA 2AHQA 2CMPA 3K69A 5IYDJ 3L2RA 4UB8C 4CCLA 1XD7A 3MKLA 2VPLA 4KN7X 3GYHX 2JA2A 5LGNA 3CCMI 4LLLA 2K9SA 1ZLJA 5CVRA 3IH4A 1ERDA 2HZTA 2R7WA 1ETQA 2HGCA 1GHCA 1UHSA 1UCRA 1FNNA 4ZYGA 1MBJA 2R7OA 1MBFA 2BY2A 1RI7A 4UV9A 1A31A 1WH7A 1I50J 4HA8A 2E2JJ 4BQQA 3VSKA 1N77A 3RTRA 3R0JA 3ZQLA 5DM6F 3HHGA 2R7UA 2BYVE 2O0YA 2L7FP 3ZXSA 1WI9A 2DPUA 3LOCA 5EEGA 4QIWN 5TISC 4HF2A 2CUZA 1ZREA 4RBOA 3HOSA 4E70A 5FD6A 4CZCA 4UNOA 2QWWA 3GCMA 1W0UA 2HWVA 4GYGA 2R92J 3EETA 3TOAA 3BG9A 1XCBA 2BBYA 4QSHA 3SYTA 1Z67A 4BXUA 3DXJF 4LGWA 1D0ZA 4F52A 1PDNC 3CUQB 5KVRA 2B9SA 3GXOA 4Y3OA 5JHFA 1SAXA 3QPSA 2FJ1A 2A6HF 3TDZC 1RIOH 4WK8F 1MNMC 5L3DA 5GAEJ 1KONA 2OA4A 4CXFA 3BPVA 2Z3YA 3E6BA 3IV5A 3M9AA 2FRHA 4QTRA 2X6XA 2W82A 2XRLA 2H8RA 2ZJRF 5E3OA 4PJ0C 2X0LA 5E79C 5FKNA 3OSGA 1ZGJA 4XR6A 4J01A 5HLTA 3S1QJ 1Z3YA 2DPDA 3DQVC 4M9SA 3KFWX 4Q5SF 3WHCA 1QVTA 2ETHA 3MD2A 1X1BA 5J1RA 4G6QA 3A2KA 3A0HC 4IQ4A 4HQMA 2JA5J 1T2KA 1D8KA 2L9VA 1MSEC 2DMPA 2L01A 2Z33A 4PK4A 1X4PA 1WJCA 2F5CA 5EGOB 2K3FA 1A6IA 1P92A 2WADA 3J80K 2QEXI 3GTMJ 2BE5F 4EM2A 2VC0A 3O8HA 4F3QA 3F21A 5IP6A 4LB6B 1MDMA 1K6OA 3L7WA 5FGMA 3TEDA 4H4KC 2X51A 2Q2EB 1XMAA 1D0YA 2EILH 2L9RA 3HKZN 2ISZA 1U3EM 3CCEI 1KYWA 4KDPA 4LLNA 1TZLA 2DDBA 2WV1A 3LQRA 4RMNA 3GW2A 2GOMA 2RGVA 1Y8QB 3F6OA 5H6QA 2QF7A 4NC7A 1QBJA 2XGEA 5IOYA 3FXLA 2F5VA 3W6KB 4CSWA 2ICWG 3VYRB 2XB0X 2CWEA 2FQ3A 5A2QK 2K4BA 2DAOA 3D5LA 3F9KA 5LEKA 3DPLC 3MZYA 4HAMA 4A0ZA 4AC0A 1HKSA 3DEEA 1VQNI 2BVMA 4YEJA 2VOOA 5B1BH 3WGIA 3ZMTA 4IOCF 1KU7A 3KP5A 4E7KA 2M34A 4BNCA 4I0BA 1JKOC 2HQ5A 4ZYHA 5FKMA 2PLYA 2VLAA 1HBXG 1FIAA 1UZCA 2X85A 4NQWB 4UVAA 4XQFA 4DJAA 2PJRA 1XDUA 4UUTA 4A3MJ 3OR2C 3GTGJ 2Z1DA 3I53A 1XGMA 1YYVA 3UKGA 1UELB 2V1DA 1FJLA 2EV6A 2P7CB 4CYCB 4U7BA 2GBYA 4UVCA 3FM3A 4ABZA 3JREA 3GFLA 3JCUC 2X1DA 3S2WA 2NOGA 4W1UA 2DYSH 4S04A 2LG4A 2R7RA 3S1NJ 4JX6A 2YX4A 1POGA 1IO2A 1ETKA 2A6EF 1YLFA 3NEUA 3KYDB 5DM7F 3S14J 2KQRA 4LOCA 1ETXA 3FKIJ 2RREA 4MQVA 4BQAA 3V8LA 1VQ5I 5K7ZA 2DT7B 3PNVA 4E6KG 5E3NA 1OR7C 2EINH 3CESA 1VQ6I 3I4MJ 2LVSA 4I01A 2G0EA 5EEAA 3M8EA 2OF7A 2MC3A 1HOMA 4B4CA 1BI1A 2FF4A 2Z99A 3RYRA 4PDKA 4XOTA 2VQCA 2O3FA 4H0EA 1A35A 4KIFA 2DN0A 2CW7A 4L5IA 4XN0A 3PIOF 5HDGA 2NNYA 2B7EA 3GF2A 2F2EA 2QENA 1I27A 1KU9A 3ZMZA 2HOTA 4ESJA 5E1WA 4P96A 4CCJA 2GWRA 4DZJA 1R36A 2L4AA 3K0LA 4ZYAA 4KISA 4MEYF 5CQEA 3KYLA 4OIRF 2WAQN 1BOBA 3DF8A 5FB2A 3M7GA 3RKQA 3ONQA 1MJ9A 1U2WA 2K86A 1TWGJ 2EQRA 2NS8A 2JK3A 4BH9A 4LG0B 2C6YA 2PMZN 3HL2A 1SD6A 2Y9ZA 3EUHA 1B1BA 1JGGA 2J5OA 2BHYA 4HF1A 3VODA 3JRDA 3ASNH 2A5YB 4PCQA 4CUGA 6PAXA 1YW8A 2O03A 2VPRA 4RS8A 3L2CA 3AG3H 2GZWA 4PGGA 5D6FA 1ZN2A 3CJQB 1JHFA 3WTUC 4XIDA 2EIKH 3K70C 3OL4A 4GXOA 2IS2A 1YO5C 3R61A 1XGNA 4V2GA 3VDXA 3CUQA 2ESNA 4NNJA 4A3DJ 4EJUA 2JVHA 2R5ZB 3K4LA 1Y0NA 2FMLA 3ZQGA 5BQTA 1V5GA 1HSTA 1XC5A 5FLVA 2HPIA 1MMGA 1BJZA 3T0YA 2XDVA 1YTYA 4S0HB 4LFUA 4C3JJ 1R22A 3IWZA 5LD2C 1ZAOA 5L3BA 4HNUA 3KETA 2BV6A 2J5PA 1U5TA 3AG2H 3GMEA 2UZKA 2VN2A 1MZBA 3E0JB 3I5UA 1XB4A 2OZ6A 3O3KA 4A3CJ 1HQCA 3T1BA 3LSGA 1F4KA 2O8XA 1GUUA 3CCSI 1QU3A 1USTA 1WJDA 3OIOA 2M87A 3I64A 1SFXA 2X48A 2F4IA 3Q9SA 5FRNA 4HF0A 2FNPA 2WY8Q 3VOEA 2R7XA 2W57A 3U1KA 4HDUA 4A12A 2Y0SN 2QKLB 4G6TB 2RNGA 1X3ZB 4AYBA 3QOPA 1JUPA 1O7FA 1EJ9A 5DD8A 2HDDA 1YRNB 3WTTC 2IS4A 2GXAA 1EH8A 3G1OA 3OWTA 2JN6A 2CU7A 2V9KA 3M1EA 3MKWB 3CCVI 4OIPF 1GV5A 2FOWA 2PN6A 4LMYA 2JSPA 4JK1X 1OCCH 3O2PE 1G3WA 3F8FA 3FZVA 1IRXA 2ISYA 4PJLA 4ESBA 1E3OC 2A07F 2XGCA 2PG4A 2WV0A 5LGTA 3CC4I 3FXJA 5FROA 1BM9A 4S05A 2HS5A 2VOPA 3IL2A 2Q2EA 4XKCA 1YIOA 5HDNA 3Q9VA 3N4MA 2WB1A 1T6SA 1TQMA 1AWCA 1OJLA 2VQLA 3ABTA 5M3MJ 1ZYRF 2W84A 4A5MA 3FF5A 2GXBA 2HI3A 1T38A 1FMWA 1X1PA 2MLKA 1L0OC 1JGSA 3OYIA 5F04A 2IPQX 4I0AA 1ZR2A 2E1CA 3GTJJ 1LFUP 1KQ0A 4P1WA 2XV4S 4MFDA 3RJPA 1GVJA 2YR2A 2WY7Q 1I1GA 4ENJA 2XGXA 1TTYA 2L3DA 3FM5A 5FLMJ 4DBQA 4EGZA 2IAIA 4EATA 4YFXF 1AKHB 1W36D 2P4WA 2CQ7A 5HS7A 4RAYA 4BE0A 1RR8C 2HU9A 2HFHA 3P7NA 2DI3A 2W24A 4Z6YA 2EB7A 2PMUA 2ZKZA 3B6AA 5FKOA 2ZMEA 3DP7A 2LMDA 1U9NA 4BBRJ 3MZ8A 4JX5A 1TWCJ 2ELKA 2H27A 4AWXB 3BJOA 5B1AH 2O8KA 4M9XA 4XKBA 5D4RA 4C3IJ 3KYCB 1O3SA 3WTVC 3BR3A 2HZDA 4G7HF 4Y52J 5K7FA 1JKRC 3CCRI 2OTJI 1XDSA 1N78A 3HC7A 1W36C 1VQ9I 2EK5A 2QSFX 3E6DA 4HEA2 1NTCA 2DCEA 3FXRA 1X4OA 1D8JA 4G6DA 3OOUA 1X1CA 3IAS2 2VI6A 1MMAA 2EPFA 2IS1A 3GZNB 4L9NA 1IUYA 3D5SC 3PIPF 3PQJA 3PSFA 2CUEA 3M1CA 5FO5A 4N4NB 2VKVA 3J80Z 3SDBA 4WXCA 5HNHA 3HOXJ 2E2HJ 1EA3A 1OISA 1YOVB 4X1EA 4U7DA 3CMMA 1FOWA 2P5KA 5EG0A 3KP3A 3QODA 3M8JA 2KZVA 5J3LA 5GP9A 1BL0A 1JXSA 1L3LA 2JZYA 3TP0A 1OYWA 2E34A 2R3SA 3H5NA 2E36A 3OYKA 1NK2P 4MLOA 3BPXA 3D5RC 1NG7A 2ZSIB 5FKLA 4WXDA 1G3TA 3F8MA 3CLOA 2OCCH 1T0FA 5LBQA 4DYCA 1QZYA 2LP0A 2NAZA 1VQKI 4EM0B 1J59A 3BTJA 1ON1A 3HRUA 3OYLA 3LFKA 2R4GA 4BAYA 3JR9A 1IZ1A 5A2QZ 4A0YA 3QRFF 2FU4A 1S8NA 1SVMA 3LSTA 4D7NA 3MKYB 3ZRGA 2BXYA 4KICA 4II2A 2V1UA 1X2MA 2R5ZA 3LSKA 1EV7A 3W6JB 1R71A 2AQEA 4AU7A 4EGYA 3ESWB 3U1DA 2GQQA 1JTYA 1PYVA 1MKMA 1Y6IA 5K1YA 2R7FA 1IN5A 4MGRA 3VYUB 4BYYA 3BR5A 1WHUA 5DS9A 1SAUA 2LNBA 3LA2A 2RAEA 3CP2A 4RGXA 2K9MA 2LKPA 1R5HA 3OYGA 2RDPA 1CGPA 2V1XA 3N05A 2XPWA 3D0SA 3IAM2 1U0JA 3IP4B 5E20A 3NRVA 1WJBA 1R5ID 1PJRA 4RGUA 3LSHA 2GA2A 3V7SA 1K78A 5ILUA 1YRNA 4B8XA 1STZA 1Z3XA 4XKWA 1QGPA 2NVXJ 2LTPA 3HJEA 3MWMA 4L9TA 2N8GA 3H5AA 3AFHA 1FYLA 3HRTA 4IHTA 3W2VA 4ESFA 5TRDA 3CDLA 4EJVA 4XM3A 2I5UA 2EH3A 4ZYDA 3OV8A 1JUMA 4ZTFA 2F4OB 4A93J 1B9NA 3VEPA 5J6XA 5M3FJ 5LEJA 2DFFA 4HX7A 2XSDC 3Q3SA 2LKSA 1LEBA 2A68F 4O5VA 2LYCA 3S3MA 1VFCA 1I3QJ 1IG7A 4QPOA 1VQ8I 4X6AJ 3MQ0A 2PJRB 2RKHA 1FMVA 1FX7A 3K1MA 1IC8A 2JUGA 5CKTA 2BZTA 2XGDA 3MCZA 3SXYA 3TW7A 4BY1J 2L0KA 4HSRA 2A5WA 4M9ZA 1MIJA 3EQLF 3ZOBA 2DT6A 1Z9CA 3B6CA 2EZIA 3MVPA 5IT9Z 3F72A 3DLAA 2CYYA 3C2BA 4A3IJ 1R4NB 1XG1A 1DU0A 4IRHA 3KX2A 2WBMA 3H36A 3TL4X 5BPDA 1RRJA 3TMOA 4K2EA 3HTSB 5E1XA 4D9JA 5J1YA 3K2AA 3ECOA 4XK4A 3BQYA 4A2UA 1AKHA 2DMTA 2K9LA 1LDKB 5EZHA 5H20A 3A4CA 1SVLA 4BJ6C 3HEFA 2QLZA 3DU6A 1FBUA 1EH6A 1ORKA 1X1AA 2A61A 3I9V2 3I4PA 2WC2A 2WWYA 1MBHA 1IDYA 1B6AA 1ZG3A 3A03A 5EF6A 1SD4A 3G6EI 1JT0A 1FTZA 3QAHA 4HQEA 3HB9A 4IXAA 4RAGA 5IT3A 5KHDA 1JKQC 4G94A 2E19A 4YIRX 1NHAA 4RAFA 1AOYA 3B73A 1S3JA 2XASA 3UNGC 1IXSB 2COBA 4ENMA 3EUHC 5ICEA 1Z21A 3LSPA 1Y39A 4DIQA 1IRZA 1HF0A 3VB2A 1SFUA 4FASD 1J2XA 4NBQA 3PUFA 4OU0A 5DUKA 3S3NA 4MNUA 1BJAA 2ECBA 3S8PA 2HVQA 1FTTA 1U8RA 1ZELA 4AVPA 2E60A 3BG3A 2JVGA 3W2AA 3HIFA 4E7ZA 2IRFG 3HOZJ 4PJMA 2ZJPF 4LD5A 5GADJ 5HNFA 3OOPA 4XLEA 2YSRA 2LDUA 1ZARA 3WE2A 3JAMK 1ZRCA 2VKHA 4G12A 4FE7A 4HV6A 4C9YA 3CUQC 2DBBA 4HV5A 3CP8A 3TKYA 5LFAA 3V4GA 4HX8A 4A3LJ 1P4WA 2BW3B 2YX7A 4UB6C 2IGNA 3OYMA 4IKFA 2MSYA 4RDUA 1Z6TA 4OOIA 3H3ZA 1DQUA 2VC1A 3R60A 2CQKA 4XRFA 2OBPA 4ZC3A 1UFMA 3CC2I 1U5TC 3S93A 4MFEA 3C7JA 1IXRC 3IRQA 4ENNA 3IH2A 2DYRH 1QHGA 3V7RA 3BDDA 2M30A 3BZCA 3K1PA 5JHUA 1WJFA 4M71A 2JRMA 1ZG5A 1U5TB 3G1LA 5FD5A 3ZMSA 3ZQCA 2QQ9A 3MAJA 1LNWA 3E7LA 1XX5A 3G2BA 4FETA 2GM4A 3G4SI 2IGKA 4EQQA 2LKXA 1S29A 2DA2A 2YUSA 3MEXA 4HZFA 4I76A 5AIQA 4I2OA 1PP7U 5C4JJ 4FT8A 2CG4A 1SANA 3AAFA 5E17F 3BROA 2HEOA 4HX4A 5E8GA 2ME6A 2VJIA 2FUG2 1HXDA 2VIXA 5ILSA 1WJ5A 1PUEE 1BI3A 2MBFA 2M1BA 3KP4A 4GFBA 5DYMA 4ANJA 4XLFA 1OLTA 4ETSA 4UUSA 1JJ6C 1BR2A 1B4AA 1TW3A 3FHNA 3CMEI 2IGOA 3HHHA 3SFIA 1H9GA 2LY2A 1XSDA 4IJAA 1HA8A 2DFEA 4QWQA 3J81K 4ZJZA 4KITB 1BN5A 3E3VA 2XB5A 1W5TA 5ICGA 1V4RA 3ULQB 2ZO4A 2W25A 3BG5A 3RZDJ 4YIFA 1I6HJ 4N0BA 5C44J 2R7TA 3HYIA 2AXTC 2TDXA 3FXOA 4A69C 3WU1B 3DV8A 2W48A 2CFXA 2GOXB 5GAGJ 2NNNA 4LIUA 2FBIA 5H6RA 5GPCA 4BU2A 1WFXA 4F55A 3HPHA 2P5LC 3FX3A 3ZQQA 3K4KA 3UR3C 2JSCA 2Y31A 2P6TA 4L0YB 1LDDA 2RQQA 3F8BA 2B0LA 4Y4RA 4EJOA 5FLXK 4NHJA 3J7AO 3E5QA 2DMNA 3QPHA 4DNCA 4CGZA 1BIBA 4PSWA 5M5YJ 3KEYA 5C3EJ 1DUXC 5E1ZB 2X1EA 4BHCA 4CCKA 3WTSC 1VQ7I 1SFOJ 2M7BA 1KU2A 2E35A 3REOA 1I6XA 2QCOA 3RKYA 3FK7A 3ISPA 1ULYA 2AO9A 2RQPA 2VASA 2ZMEC 3H3UA 2K3PA 3GZ6A 3ZPLA 3OIPA 1JHHA 2Q1ZB 1Z7LA 2M4GA 2NRAC 2L7KA 2M2EA 4A0XA 1FOYA 2XPUA 4B3XA 2EFNA 3AG4H 3PFIA 3BZ6A 2ZMEB 4E7JA 4KFCA 2ID3A 2HXIA 2HNHA 4MQ9F 3V42A 2DMQA 1WKMA 5FFZA 4PFOA 4BBSJ 3GWZA 4XLAA 2MW8A 3GFMA 4BL0B 3ZQFA 1R1UA 4OWRB 5AIPA 4D0PA 2D5VA 3WHBA 2EFWA 3C3WA 2DXIA 3N97A 3OYNA 3GTQJ 1SFKA 3PL8A 1XGSA 1SFEA 1HW2A 1CQTA 4CCMA 4F92B 4AD9A 1APLC 5L3EA 4CYDA 3R4KA 2IP2A 1B72A 1Z0XA 3CF2A 1KZHA 3S2HJ 4BXFA 1PUFB 1R23A 4N9HA 2HQRA 4L5EA 2UWMA 2KL4A 2EV0A 4ZDLA 1H9TA 3IWFA 1WH5A 1MJAA 2YPRA 1H8AC 2VODA 3HOVJ 1O3TA 4N9IA 2KFDA 2V7FA 1YW7A 5C4XJ 4D5FA 2HYFA 4A3KJ 2LF7A 2XAUA 3BZKA 4ZTJA 5EG0B 2RVCA 2IJLA 1S72I 5D6EA 2Q8KA 3AL0C 1XTAA 2X6WA 3Q0VA 1DP7P 4ZYEA 1XSVA 2CH0A 2LY1A 1T0FC 5D5XB 3ZMUA 4DGWB 4BXXJ 2VL8A 1ZHFA 5GTHC 4OIQF 4L18B 3FDYA 2X4HA 1WVRA 3AL0B 4XOPA 2JA7J 5F08A 1LKXA 5IT9K 2QVOA 4LIVA 3LSIA 1IN6A 4CZZA 1DDNA 2QQ8A 1IW7F 3ML6A 2CO5A 2DO7A 5TGTA 3S2DJ 1O57A 1J0RA 2BW3A 1FYMA 2KIUA 5E3LA 2JTVA 3BCAA 1IGNA 4GGGA 4KMUX 3KZYA 2A69F 2DJIA 1FP2A 1LPQA 5K7HA 3E5XA 5B3SH 4XLNF 2LD5A 3WTZA 1YIJI 3GTKJ 2M4KA 1TQPA 1BOAA 1A04A 3BWGA 2L02A 3U21A 1O4XA 2EFOA 3HUGA 2I10A 5EYRA 3IKTA 3LAPA 1UHMA 1J75A 5K5RA 1RUOA 2KMUA 2OTLI 5ERIA 3DPTA 1D5VA 1R1TA 2W1OA 2L9NA 1ETYA 2P5VA 4MTEA 1FBSA 3H3VK 1E3HA 1TWHJ 1QNTA 2DODA 2GAUA 2PBIA 3VYTB 4B44A 2V6CA 3C2GA 3HRSA 1V54H 3ASOH 4II3A 3KP6A 1MD0A 3CDHA 3HSEA 2K85A 3G3ZA 1IN7A 3Q0UA 3SJMA 4G8XA 3LSRA 3DU5A 1K78B 5KAFC 4E7IA 3IHUA 4EMSA 1Q1HA 1ODDA 1FPQA 5L3CA 1YI2I 2BY3A 5LLQA 3LAJA 2VT2A 2EV5A 3GTLJ 3NARA 4B1RA 4E7SA 4BY7J 4IHYA 3KEOA 3IKVA 3ABUA 1N75A 1Q1VA 1ENHA 4NUBA 2KKOA 5J4VA 1W1WE 1S7EA 1F43A 1R00A 4MO7A 3FMSA 1OYIA 3L09A 2R5YB 1WSUA 2JMWA 3OS0A 1EKEA 4CHUA 1MMSA 1R7JA 5CYVA 3V8KA 3TQNA 1IXCA 2X6YA 4J00A 5IP9J 2FBKA 2MH2A 2F5FA 3WU2C 4LB5A 1DPUA 4PUSA 5CVJA 4ON0A 3H0DA 4XNFA 3SDGA 2P7VB 4EJTA 1D1BA 2M8EA 1ON2A 3SQNA 5GTIC 1QPIA 3FKJA 5HLIA 2MD0A 4JP0A 3QU6A 2BOLA 1ZGAA 1W5CC 2ZFUA 3RIRA 4KUMA 2XHKA 1RNLA 1RKWA 2DA5A 2Z2SB 4C2TA 2NXNB 3B02A 3FISA 4C2UA 4KYWA 3JAMZ 2QGUA 3AKZA 1X1DA 4I02A 4DYRA 2NOJB 5H2FC 1W0TA 1NH3A 4GDFA 4B48A 3RQ4A 1TW2A 1I1SA 1P7IA 4M72A 4WXHA 1Z05A 3K9TA 5FFXA 3BJAA 4GCVA 4RM2A 4RB1A 2DOEA 1UG2A 4KA4A 3PO2J 1RR7A 2AS5F 2OAZA 5GAHJ 4PJNA 1DU6A 1UB9A 4HSTA 1V3FA 2FBHA 2HDWA 3VWBA 1ZK8A 4JOMA 2BVLA 5F1RA 1EF4A 3BR2A 5ICCA 2R93J 5IY5H 1G2HA 1AHDP 4U0WA 1P4XA 4I99C 4A3JJ 2V1NA 2CRGA 3H5RA 4RB0A 1I3AA 3FXMA 2OCEA 4BDYA 4NC6A 3WGHA 2VBXA 2K40A 2LOOA 3F23A 3PUBA 1H89C 1YS6A 4XONA 1AA7A 3HSFA 2FXAA 2D45A 1R6RA 4HYEA 1MW7A 4RM3A 3DKWA 1JT6A 2ECCA 5HLHA 3BTIA 3K6GA 1GV2A 1F1ZA 1HKQA 3U9GA 1QVUA 2ACJA 1RC9A 2CUFA 2M0MA 2HQNA 3JRIA 2LSOA 3M8FA 1PUFA 3KZZA 5JFRA 2DOFA 2W4SA 3GLXA 3JTHA 4XBFA 1IN8A 4M73A 1LEAA 4FX0A 3U2RA 4ENKA 2IS6A 3S15J 2WAEA 4IEJA 5FRMA 3GFIA 3EDPA 1BA5A 3HXLA 2VJ4A 2BXZA 3TO9A 4AVZA 4A3GJ 1IRGA 2VKEA 3J81Z 2E1NA 2GA1A 2IT0A 5BMZA 1C0WA 5DTDA 1X19A 5J8CA 1PP8F 1TT5B 1OMIA 2CV0A 4ZZDA 1MBGA 3I54A 5J4YA 1MNDA 1T95A 4DOZA 4FTHA 3FHZA 3WG9A 1HC8A 5DCMB 5AONA 3DTKA 3KZIC 1TP4A 3MMYB 1FWZA 2JRTA 1FSEA 4Q4ZF 3R6SA 4ZDOA 2VBYA 1FYKA 2BEOA 4MIMA 4LK0F 3F6VA 3TW6A 2HXOA 1ZKGA 3IUOA 3CO6C 5LRSA 4RB2C 1I39A 3TDUC 1SMTA 5FLXZ 2QZ8A 1MNEA 4PFPA 2L54A 5BNGA 2G7UA 1K79A 2CV2A 3HOTA 2O5RA 1IV8A 4LLGF 4HPQA 3FMRA 1HLVA 1SC7A 1IV6A 3CJTB 3JRCA 1MH4A 2HTJA 2BY1A 3GTPJ 3S17J 4UY8I 3ZGKA 4BGDA 1T33A 4UUSB 2H09A 1Z1DA 4XRSG 4RA2A 3IH3A 1Z77A 4L9VA 3L1PA 4UHTA 1J7KA 3A0BC 1YG2A 2EFPA 2YU9J 3H1CA 4AIKA 3C1DA 1R4MB 3K4BA 4A5NA 1IF1A 1XMKA 3DTIA 4EJWA 1EH7A 1UG0A 2JPBA 4Y13A 2FX0A 2H94A 1HW1A 3PJRA 2ZXHA 1ETVA 4U88A 3W3CA 3I56I 3ABKH 3BC8A 1LVKA 3RI4A 3HKZA 4KT5C 3DEWA 4PSXA 4JQFA 2QQBA 1V5EA 3DBRB 5IYCJ 2DQRA 2WA0A 5BS6A 4BUPA 2IA2A 4XRSA 1N25A 1QA6A 2O7OA 4EEFG 1VQOI 2XAHA 1QRYA 1ETOA 2KIMA 2Y69H 4AYBN 5JR3A 5D8KB 1GVDA 3CQZJ 3NQOA 4OAZA 2R5YA 2M3AA 5D5UB 1SD7A 2IVMA 1XMXA 4XLHA 2V4JC 3QQAA 1HDDC 4LITA 2KISA 1D1AA 1TQIA 2Z16A 3PNYA 3ECHA 3HRMA 1D3YA 1WJAA 4KJZA 5J40A 2CV1A 5LHIA 3PM1A 4KIGA 2OC6A 5DV5A 4M6XA 1LJ9A 1KQ9A 1T98A 3H0GJ 3CCQI 2WB1N 2LBFB 3EUKL 1ZQ3P 2X6OA 1TT0A 2E71A 2HOSA 1BBYA 4F91B 3K10A 3OYHA 1SD5A 4D7MA 4GRIA 3LL7A 1QZEA 1E17A 2CQXA 4CCNA 3HGYA 3CLQA 5HDKA 3KP7A 2LRDA 5ILVA 3HBLA 2R7SA 5FJ8J 3CCJI 3E6MA 2EIJH 4D1QA 1TNTA 2VE8A 4DZPA 5EDNA 2KRCA 2ZXIA 1B72B 2QUFA 3KLNA 1FC3A 1FOXA 3CO7C 3GVAA 4IZZA 3BG7A 4M3EA 3OYDA 3OYJA 3H35A 1ZR4A 2UXXA 3IRRA 3E5UA 3C2HA 2HDCA 2V26A 5F64A 3OYAA 4HLXA 2DTZA 1YFHA 1YE9A 1SVOA 4P9UA 2PI0A 3CJNA 1WWXA 1MMNA 3DTEA 2RN7A 1VNDA 1ZRDA 1Z91A 2YS9A 2EA4A 2GIVA 2WAQA 2CQNA 3CTAA 2MLGA 2CSOA 4M6VA 5ICFA 3FBIB 5CJ9A 3WTWC 2Y30A 1W7PD 3KLOA 2ZNYA 4M74A 3OS1A 2D2WA 2KZGA 3ZMVA 4UUVA 2E1MB 3WG7H 3KIOA 1WJEA 2PMZA 2R7DA 4HG2A 4EM1A 3RZOJ 4N4OB 4AIJA 2XROA 4TV7A 3CMYA 2QBYA 4XMYA 3O6BB 2L9SA 3BQZA 1Z7UA 3M4OJ 3JRFA 2EA2A 4XSXF 1KA8A 3DBLB 1X58A 2Y48A 1K83J 3H92A 5JVTA 4JX4A 3GO5A 3K1NA 5IPAA 1WZ2A 3NWSA 4OINF 1B8IA 1QPMA 4XICA 4BE2A 1JTXA 2VQHA 5CPRB 2QSGX 2H6CA 3A02A 1FBQA 3LSMA 1RZ4A 4A3EJ 3I59B 1XPXA 2EFQA 2F4MB 4XL9A 4C3HJ 1W7PB 2W85A 3F0CA 5DCMA 2STTA 4XORA 4U87A 3JRBA 1TL8A 1KYZA 2OUMA 3FXQA 3PSIA 3HUGB 4BKXA 2DK8A 2PEXA 1G4DA 3OYBA 1DGWY 2HKOA 2E7WA 3RSNA 2L5QA 2Y2ZA 4G7OF 3WU0A 2IGMA 5CVIA 3ERED 4DYQA 3QYBA 3OY9A 4U0VA 4FCYA 2IW5A 1H88C 1TWAJ 5F6FA 2CUJA 2NVQJ 4BQNA 4IHXA 2XAQA 4LG3A 5EEHA 2VE9A 4R79A 1BI0A 4G9YA 4E7LA 2E7XA 2KDOA 2FEZA 4CDGA 5HS9A 4M3GA 1TC3C 2F48A 2E5ZA 3F3XA 3QYEA 3CMAI 5LHGA 2ZNZA 1VTNC 2P8TA 2ELHA 2VUMJ 4RAZA 1LE8A 1G3SA 2Y0SA 4JYKA 3H9QA 3VPRA 5LGUA 2WAFA 4B3AA 3BP8A 1X3UA 4Y7NJ 2HQAA 1QZZA 4R1HA 3GLLA 1F5TA 2TRTA 2KJCA 2UUZA 1Y8RB 3HGGA 5F0HA 4BE1A 2QA4I 4ASNA 3ZQIA 2OJED 3K4JA 9ANTA 2VBWA 5B66C 1TLHB 2L2OA 4M3FA 3IC7A 3S1RJ 2ADUA 2K4JA 2PX9A 2IA1A 3ERMA 3PQKA 3KE2A 2M45A 4FE4A 2DQLA 2HTSA 4MEXF 3QP6A 3KPHA 1V55H 2V79A 1AU7A 1RETA 4Q48A 2AQFA 5F0CA 1T08B 4IHWA 4M3BA 4BHPA 1OKRA 4RGRA 4AIDA 5D8LB 1BR1A 5M5XJ 3VSLA 2HOEA 3OL3A 3BJ6A 4UV8A 4V19K 3OR1C 3PNTA 3GBGA 3BT9A 2DFIA 2LY9A 4EV0A 4XRMA 2XAGA 3F22A 1JE8A 1ZLKA 4IL6C 4M6YA 1WI3A 3ABLH 4WX9A 3M3YJ 3ZP5A 1REPC 3QPLA 2OQRA 2VXDA 2XAJA 2OZUA 3I58A 1OCPA 2ZC2A 4W97A 2VXZA 4GYIA 1TWFJ 2LC2A 3SFZA 3RPUA 1S7OA 4BHBA 3CCUI 3I3LA 1LQ1A 5M5WJ 2ID6A 1FY7A 3ROUA 5F0FA 2HYGD 4YFKF 3OMYA 1LFPA 4IRGA 2KRHA 3OIQA 2KPMA 4L9JA 4MHGA 2EZLA 2R7ZJ 2BGCA 1NG6A 1YHQI 3K4MA 1HSJA 5LRRA 2HYJA 1HDPA 1P4AA 2LBFA 2EZKA 4F93B 2WTEA 4R8HA 4Y17A 1CF7A 2XF7A 3WE3A 5EZGA 2OPTA 1UJ8A 2E5NA 4BACA 1FZPB 2DJNA 3G1MA 1I5ZA 2VKDA 2DTRA 1MBKA 2IXSA 2KHMA 3L2QA 4Z2YA 4BS9A 2A05A 2M0CA 2MYSA 3I0TA 5IP7J 3FMQA 3JRAA 2NS0A 1DPRA 3L2UA 2BHZA 2K9QA 1U78A 4JBAA 1K4SA 3DLLF 5JI6A 4I7HA 4BJTA 2EBIA 2VB6A 3MKZA 1U6GA 4Y15A 4CICA 3CCYA 2PQ8A 2L7ZA 3KCCA 2KRFA 1G59A 1JUSA 3BTCA 3CJRB 2ZXJA 2E1OA 3H9JA 1D1CA 3QOEA 2LK2A 5EJCA 3WGGA 2OQGA 2O61A 4LK1F 3BR6A 1U8BA 4HBLA 1Y0UA 1UHWA 1M1EB 4NB5A 2X9DA 3W6VA 4P5OA 1YS7A 1XSXA 2NS7A 5F27A 4XSZF 4IX7A 2F6CA 2FD5A 1RESA 3QP5A 3W2WA 1YJ9I 1UAAA 4P9FA 4WWCA 1FOKA 2QQAA 3F8NA 4BEHB 4KMFA 2DU9A 2A3SA 3FK6A 1VQ4I 1ZRFA 2M7AA 2ESHA 3LQQA 1GXQA 5TJJA 4ZZLA 3LMMA 5LHHA 1VQLI 3RCOA 2E2IJ 1X3WB 2AXLA 2KJBA 3BOQA 2XF6A 1R58A 1XGOA 1MJBA 2DLLA 1QO0D 3Q0WA 3K70D 1S5LC 3P9KA 1J9IA 4WCGA 4HRIA 2KP6A 2DA1A 2KT0A 1LUJB 3VYSB 5K5OA 1YJWI 2JQ7A 4AM3A 3I59A 5JVGF 3FWEA 3ZN1A 2DDAA 3K7AJ 5DD4A 3C18A 3EUAA 1Y1VJ 1IJWC 1W7PA 4WF2A 2MH9A 2JA8J 3WTXC 4G7ZF 4RB3C 4KIBA 1GLNA 4V2FA 4C30A 3VFZA 3QU3A 1Y56A 1R49A 1JJ8C 4YG2F 2CW0F 1ZH5A 2STWA 2V9PA 4IOAF 5BOXA 3HTUA 1W5SA 2K02A 2CGPA 1YITI 4O6JA 4RLQA 2UV1A 3GX4X 1FIPA 3CF5F 1ZGWA 2HVSA 1E0EA 2XKOA 4OIOF 1OFCX 3CC7I 3EPZA 4O3MA 4I98B 2B63J 3TO6A 4L5JA 5IOZA 2QSHX 1SMYF 2HKXA 1USSA 3OYCA 2FA5A 5FKKA 2HVRA 1ETWA 4PGHA 3RKWA 4IQJA 4UVBA 5K5QA 3A1YA 1WRJA 4PJJA 1K7AA 3R0AA 3G73A 3GFJA 4E7HA 3GEZA 2QYOA 3DCFA 3ELKA 1VZ0A 2KIQA 2DA4A 5KNLA 3J7ZI 1S9HA 1LFBA 1S7AA 1LDJA 5DCFA 3TGNA 1IUFA 1D0XA 4A6DA 4IVNA 1DGRM 1GDTA 1OCOH 2Q0OA 3PO3J 2K7LA 3T8RA 1FLIA 4HLYA 2P6SA 5D4SA 1P7JA 5EGOA 1H0MA 3DKXA 3QWLA 1SEUA 3TOBA 1U9OA 1OQYA 1R5GA 1BW6A 4M3DA 4U0YA 1IN4A 1QQIA 2EJRA 4HW0A 3O8GA 3JSPA 1UMQA 2ZSHB 3HOYJ 3F8CA 4IHSA 4XLPF 3CCLI 5JLXA 2O6GE 2KLOA 3ZCOA 3S32A 3P5JA 1G8XA 4HNVA 1D5YA 2GLOA 3SZGA 4KT6A 3K4NA 4EVIA 1FSHA 1WGXA 3CUOA 2JA6J 2V6EA 1K61A 3JRHA 2A6TA 2F5DA 3TO7A 2V9VA 4HOBA 3HPGA 3E6CC 3K4CA 2CQQA 3BY6A 4BQOA 1TNSA 2BY0A 5BPIA 4YIIA 1BW5A 4OMZA 3BCBA 1GXPA 5D5VB 3GTOJ 3DPUA 4A3BJ 3OYEA 1IRFA 2VBZA 1FEXA 3BTLA 3QYFA 1X2NA 2KDZA 4CA0A 3V7CA 3Q5FA 2DOAA 3SZTA 4P55A 2ZXWH 1VQMI 4QPQA 1P2FA 3LFUA 3I71A 4FQGA 2W00A 4ITVA 4AIHA 1R9TJ 5KAIC 1ITYA 4NQWA 4DQ2A 5HOOA 4XLCA 1OCTC 2R0QC 1BC7C 1ZG1A 5L3GA 4RGSA 2ZJ2A 4BDZA 1T39A 2FOKA 2MD5A 4Q47A 2FMYA 5HODA 4CYCA 3OS2A 2Y9YA 4ZH4F 2DT5A 2KIFA 2TCTA 3V8JA 5D5WB 4IHVA 3JTGA 1LVAA 1S6LA 5J1UA 3SEQA 3A01B 3RKXA 2FE3A 4OAYA 3COAC 2H8WA 2OU2A 1YQAA 3FBNB 3J7AY 2HR3A 2QBYB 3JRGA 3CD6I 2FQ4A 1R1VA 3PFYA 1E2XA 3LSJA 2PMHA 1MSFC 2L7MP 5CQGA 2MABA 3BR0A 4QLCU 2IA0A 1OCZH 3S3OA 1E3PA 1XS9A 4OMYA 3JW4A 4YFNF 2H1KA 4Y33A 1OR7A 1B8IB 1YX3A 5KCMA 1MBEA 2DFHA 2OD5A 1MMDA 4AUXA 1RUNA 4XKVA 2Y75A 1FT9A 5J8FA 2Y0MA 1YX5A 5CVVA 2ZB9A 1J09A 3KEQA 5L3FA 4BEHA 2RC4A 3E97A 3HSRA 1JI8A 2HPMA 1RPWA 2RNJA 3M07A 4IRIA 1FP1D 4HDVA 3L9FA 5HLGA 4FISA 4F7ZA 2CS3A 2COMA 2JJ7A 3H9GA 4IF4A 3FXUA 3GZ5A 4A3FJ 2ZCWA 1XCVA 1G6NA 1T8IA 5DUIA 2MA3A 4I09A 4LG0A 3ZR8X 2M9HA 4L0ZB 4LJZF 2LLKA 3MFKA 3DWLE 1BC8C 2ELJA 1NK3P 4D5CA 3HG9A 2DW4A 3ZQHA 4YELA 1F36A 2XRNA 1KU3A 1GT0C 4CH7A 1LE8B 2LF8A 4NDLA 2K9NA 2FSWA 2MFZA 1BR4A 2XVCA 3DKYA 4ZDPA 3HOWJ 2L4MA 1WPKA 1RKTA 2W7NA 3SEZA 2PJPA 1WCMJ 2XF5A 2H6BA 1Z6RA 2XUBA 3T5XA 4B09A 1IDZA 3RQIA 3J7YJ 3ZN0A 1DP3A 1YW9A 2MGQA 1W4MA 3MZHA 1B59A 2FNAA 3HOUJ 1A5JA 2XIGA 2VQGA 3RPUD 3L00A 3NWTA 1JKPC 2DK5A 2OV7A 2HOAA 3BLYA 2XC7A 5ED4A 3LWFA 1TBXA 2JT1A 2CJJA 2DA6A 3BR1A 5GPAA 5JLWA 2XSJC 3L2VA 1G3YA 4RLFA 3LA7A 3CDIA 4DW6A 1F9NA 2D1HA 2O9LA 5HS8A 4KNYA 1OPCA 4XN3A 4CCOA 2ZFWA 3WTYC 3G71I 1BIAA 3S16J 2R7VA 2F5EA 1MDMB 4IPAA 3HDDA 2DA3A 1HCRA 1O7LA 2M8GX 3RPQA 2XAFA 4YRVA 4PZJA
chains in the Genus database with same CATH topology
2UXNA 1O3QA 1KGSA 2YU3A 2QM3A 2D1VA 3RDIA 2Z9OA 1HKTA 1ONVA 2XKPA 4MTDA 3P9CA 4FHTA 5CVUA 2K27A 4FX4A 3T8TA 1B9MA 2VT3A 4UXNA 3LA3A 4A6EA 3QPTA 2JPCA 5DEQA 1CF7B 1MGTA 1P6RA 1O3RA 2G9WA 2G7HA 1XN7A 3P9IA 3SZPA 2M5WA 5KK1A 3ZQ7A 5DDGA 5E18F 2ZBKA 1WQ2A 2EWNA 3KP2A 4KN4X 3RYPA 3DFGA 3DEUA 2NYXA 2Z5UA 5HVQC 2RV8A 1LB2A 1J5YA 2PFBA 3K2ZA 1IAWA 3EYIA 4CO8A 3ZMDA 1BI2A 2VONA 5E8IA 1KQ8A 2GXGA 3GUDA 4GO1A 5CLSA 3JSOA 3SHFA 1OYYA 3EYYA 3WODF 1HW5A 3K69A 1XD7A 4KN7X 3GYHX 5LGNA 4LLLA 1ZLJA 5CVRA 2HZTA 2HGCA 1GHCA 1UCRA 1FNNA 4ZYGA 1RI7A 4UV9A 4HA8A 3RTRA 3R0JA 3HHGA 2BYVE 2O0YA 1WI9A 2DPUA 5EEGA 4HF2A 1ZREA 3HOSA 4E70A 5FD6A 4UNOA 2QWWA 2HWVA 4GYGA 3EETA 3TOAA 1XCBA 2BBYA 4BXUA 3DXJF 4LGWA 1PDNC 3CUQB 5KVRA 3GXOA 1SAXA 2A6HF 3TDZC 1RIOH 4WK8F 5L3DA 2OA4A 4CXFA 3BPVA 2Z3YA 3E6BA 3M9AA 2FRHA 2X0LA 1ZGJA 2DPDA 3DQVC 4M9SA 3KFWX 4Q5SF 2ETHA 4G6QA 4HQMA 1T2KA 1D8KA 2L01A 2Z33A 2F5CA 1P92A 3J80K 2BE5F 4EM2A 2VC0A 3F21A 4LB6B 1MDMA 1K6OA 3L7WA 5FGMA 1XMAA 2ISZA 1U3EM 1KYWA 4KDPA 4LLNA 3LQRA 3GW2A 2RGVA 3F6OA 5H6QA 1QBJA 3W6KB 2CWEA 2FQ3A 5A2QK 2K4BA 2DAOA 3D5LA 5LEKA 3DPLC 3MZYA 4HAMA 4A0ZA 1HKSA 2VOOA 3WGIA 3ZMTA 1KU7A 3KP5A 4BNCA 4I0BA 4ZYHA 2PLYA 1HBXG 4UVAA 1XDUA 3I53A 1XGMA 1YYVA 2V1DA 2EV6A 2P7CB 4U7BA 4UVCA 3FM3A 3GFLA 3S2WA 4S04A 2YX4A 2A6EF 1YLFA 3NEUA 4MQVA 4BQAA 3V8LA 4I01A 3M8EA 2MC3A 1BI1A 2FF4A 2Z99A 3RYRA 4PDKA 2O3FA 4H0EA 4KIFA 4L5IA 5HDGA 2NNYA 3GF2A 2F2EA 2QENA 1I27A 1KU9A 3ZMZA 4ESJA 5E1WA 4P96A 2GWRA 1R36A 2L4AA 3K0LA 4MEYF 4OIRF 3DF8A 5FB2A 3M7GA 1MJ9A 1U2WA 2K86A 4BH9A 4LG0B 2C6YA 1SD6A 3EUHA 1B1BA 2J5OA 4HF1A 3VODA 2A5YB 4PCQA 6PAXA 1YW8A 2O03A 4RS8A 3L2CA 2GZWA 4PGGA 5D6FA 1ZN2A 3WTUC 1JHFA 4GXOA 1YO5C 3R61A 1XGNA 3CUQA 2ESNA 4EJUA 2FMLA 5BQTA 1HSTA 3T0YA 1YTYA 4LFUA 1R22A 3IWZA 1ZAOA 5L3BA 3KETA 2BV6A 2J5PA 1U5TA 2UZKA 2VN2A 1MZBA 3I5UA 1XB4A 2OZ6A 3O3KA 1HQCA 3T1BA 1F4KA 2O8XA 1USTA 2M87A 3I64A 1SFXA 3Q9SA 4HF0A 2FNPA 3VOEA 2W57A 4HDUA 4A12A 3QOPA 1O7FA 5DD8A 3WTTC 1EH8A 4OIPF 3M1EA 2PN6A 4LMYA 4JK1X 3O2PE 1G3WA 3F8FA 3FZVA 2ISYA 4ESBA 2A07F 2PG4A 2WV0A 5LGTA 1BM9A 4S05A 2HS5A 2VOPA 3IL2A 2Q2EA 5HDNA 1YIOA 3Q9VA 3N4MA 1T6SA 1TQMA 1AWCA 3ABTA 1ZYRF 2W84A 4A5MA 3FF5A 2GXBA 1T38A 2MLKA 1L0OC 1JGSA 2IPQX 4I0AA 2E1CA 1KQ0A 2XV4S 3RJPA 1GVJA 2YR2A 1I1GA 4ENJA 2XGXA 1TTYA 2L3DA 3FM5A 4EGZA 4YFXF 2P4WA 5HS7A 4RAYA 2HFHA 3P7NA 2DI3A 2W24A 2EB7A 2PMUA 2ZKZA 2ZMEA 3DP7A 2H27A 4AWXB 3BJOA 4M9XA 5D4RA 1O3SA 3WTVC 4G7HF 1XDSA 2EK5A 3E6DA 3FXRA 1D8JA 4G6DA 1IUYA 4L9NA 3PQJA 5FO5A 3J80Z 4WXCA 4U7DA 2P5KA 3KP3A 1JXSA 1L3LA 2JZYA 1OYWA 2R3SA 3BPXA 4WXDA 1G3TA 3F8MA 3CLOA 1T0FA 5LBQA 1QZYA 2NAZA 4EM0B 1J59A 1ON1A 3HRUA 3LFKA 4BAYA 1IZ1A 5A2QZ 4A0YA 3QRFF 2FU4A 1S8NA 3LSTA 4KICA 2V1UA 3W6JB 1EV7A 4EGYA 3U1DA 2GQQA 1MKMA 5K1YA 2R7FA 1IN5A 4MGRA 4BYYA 2LNBA 3LA2A 4RGXA 2LKPA 1R5HA 2RDPA 1CGPA 2V1XA 3D0SA 5E20A 3NRVA 4RGUA 2GA2A 3V7SA 1K78A 5ILUA 4B8XA 1STZA 1QGPA 4L9TA 3MWMA 1FYLA 3HRTA 4IHTA 4ESFA 5TRDA 4EJVA 4ZYDA 3OV8A 1B9NA 3VEPA 5J6XA 5LEJA 4HX7A 1LEBA 2A68F 4O5VA 3MQ0A 2RKHA 1FX7A 3K1MA 3SXYA 3MCZA 4M9ZA 3EQLF 1Z9CA 5IT9Z 3F72A 2CYYA 4IRHA 5BPDA 4K2EA 3HTSB 5E1XA 3ECOA 4A2UA 1LDKB 5H20A 2QLZA 1FBUA 1EH6A 2A61A 3I4PA 2WC2A 2WWYA 1ZG3A 1B6AA 1SD4A 3QAHA 4HQEA 5IT3A 4IXAA 4G94A 1NHAA 1AOYA 1S3JA 2XASA 3B73A 1IXSB 4ENMA 5ICEA 3VB2A 1SFUA 1J2XA 4OU0A 5DUKA 4MNUA 1BJAA 1U8RA 4AVPA 3HIFA 2IRFG 4LD5A 3OOPA 2YSRA 2LDUA 1ZARA 3WE2A 3JAMK 1ZRCA 4HV6A 3CUQC 2DBBA 4HV5A 3TKYA 3V4GA 4HX8A 1P4WA 2YX7A 1Z6TA 4OOIA 3H3ZA 2VC1A 3R60A 2CQKA 4XRFA 2OBPA 1UFMA 1U5TC 3C7JA 1IXRC 3IRQA 4ENNA 3V7RA 3BDDA 2M30A 3K1PA 5JHUA 4M71A 1ZG5A 1U5TB 5FD5A 3ZMSA 2QQ9A 3MAJA 1LNWA 4EQQA 1S29A 4HZFA 3MEXA 5AIQA 4I2OA 1PP7U 4FT8A 2CG4A 5E17F 3AAFA 3BROA 2HEOA 4HX4A 5E8GA 1PUEE 1HXDA 5ILSA 1BI3A 2MBFA 2M1BA 3KP4A 5DYMA 4ETSA 1B4AA 1TW3A 3HHHA 1H9GA 1XSDA 4IJAA 4QWQA 3J81K 1BN5A 3E3VA 1W5TA 5ICGA 1V4RA 3ULQB 2ZO4A 2W25A 4YIFA 4N0BA 3HYIA 2TDXA 3WU1B 3DV8A 2CFXA 2NNNA 2FBIA 5H6RA 2P5LC 3FX3A 2JSCA 2P6TA 4L0YB 1LDDA 3F8BA 2B0LA 4EJOA 5FLXK 4NHJA 3J7AO 3E5QA 3QPHA 4DNCA 4CGZA 1BIBA 1DUXC 5E1ZB 4BHCA 3WTSC 1KU2A 3REOA 1I6XA 3RKYA 3ISPA 1ULYA 2RQPA 3H3UA 3GZ6A 3ZPLA 1JHHA 2NRAC 4A0XA 2EFNA 3PFIA 3BZ6A 2ZMEB 4KFCA 4MQ9F 1WKMA 5FFZA 3GWZA 3GFMA 1R1UA 5AIPA 4D0PA 2EFWA 3C3WA 3N97A 1XGSA 1SFEA 1HW2A 4AD9A 5L3EA 4CYDA 3R4KA 2IP2A 1R23A 4N9HA 2HQRA 2UWMA 2EV0A 1H9TA 3IWFA 1MJAA 2YPRA 2VODA 1O3TA 4N9IA 1YW7A 2HYFA 2LF7A 2RVCA 2IJLA 5D6EA 2Q8KA 1DP7P 4ZYEA 1XSVA 5D5XB 3ZMUA 1ZHFA 4OIQF 4L18B 2X4HA 5IT9K 2QVOA 1IN6A 4CZZA 1DDNA 1IW7F 3ML6A 2CO5A 2DO7A 1O57A 1J0RA 1FYMA 2KIUA 2JTVA 4GGGA 4KMUX 3KZYA 2A69F 1FP2A 3E5XA 4XLNF 3WTZA 1TQPA 1BOAA 1A04A 3BWGA 2L02A 2EFOA 3HUGA 3IKTA 3LAPA 1UHMA 1J75A 5K5RA 1RUOA 5ERIA 3DPTA 1D5VA 1R1TA 2P5VA 4MTEA 1FBSA 2GAUA 1QNTA 2PBIA 2V6CA 3HRSA 3KP6A 1MD0A 3CDHA 3HSEA 3G3ZA 1IN7A 4G8XA 1K78B 3IHUA 4EMSA 1Q1HA 1ODDA 1FPQA 5L3CA 5LLQA 3LAJA 2VT2A 2EV5A 3KEOA 3IKVA 3ABUA 2KKOA 1R00A 3FMSA 1OYIA 3L09A 1WSUA 4CHUA 1R7JA 5CYVA 3V8KA 3TQNA 1IXCA 2FBKA 2MH2A 2F5FA 4LB5A 1DPUA 5CVJA 4ON0A 2P7VB 4EJTA 2M8EA 1ON2A 3SQNA 5HLIA 3QU6A 1ZGAA 3RIRA 4KUMA 2XHKA 1RNLA 3B02A 4KYWA 3JAMZ 4I02A 1TW2A 1I1SA 4M72A 4WXHA 1Z05A 3K9TA 5FFXA 3BJAA 4GCVA 4RB1A 4KA4A 2AS5F 2OAZA 1UB9A 1V3FA 2FBHA 5F1RA 5ICCA 4U0WA 1P4XA 4RB0A 3WGHA 2VBXA 3F23A 1YS6A 3HSFA 2FXAA 2D45A 4HYEA 3DKWA 5HLHA 3U9GA 2ACJA 1F1ZA 1HKQA 2HQNA 2LSOA 3M8FA 3KZZA 5JFRA 3GLXA 3JTHA 4XBFA 1IN8A 4M73A 1LEAA 4FX0A 3U2RA 4ENKA 3GFIA 3EDPA 3TO9A 1IRGA 3J81Z 2E1NA 2GA1A 2IT0A 5BMZA 1C0WA 5J8CA 1PP8F 1OMIA 4ZZDA 3I54A 3FHZA 3WG9A 5DCMB 5AONA 1FWZA 2JRTA 1FSEA 4Q4ZF 3R6SA 2VBYA 1FYKA 2BEOA 4LK0F 3F6VA 3CO6C 5LRSA 4RB2C 3TDUC 1SMTA 5FLXZ 2QZ8A 2L54A 2G7UA 1K79A 3HOTA 4LLGF 3FMRA 2HTJA 2H09A 1Z1DA 4L9VA 4UHTA 1J7KA 1YG2A 2EFPA 4AIKA 3C1DA 4A5NA 1IF1A 1XMKA 4EJWA 1EH7A 2JPBA 4Y13A 2H94A 1HW1A 4U88A 3RI4A 4KT5C 4JQFA 2QQBA 2DQRA 5BS6A 2IA2A 2XAHA 2KIMA 5JR3A 5D8KB 3NQOA 5D5UB 1SD7A 2IVMA 1TQIA 3ECHA 3HRMA 1D3YA 5LHIA 4KIGA 5DV5A 4M6XA 1LJ9A 1KQ9A 1T98A 1BBYA 1SD5A 1E17A 5HDKA 3KP7A 5ILVA 3E6MA 1TNTA 2VE8A 3KLNA 2QUFA 1FC3A 3CO7C 3GVAA 2UXXA 3IRRA 3E5UA 2HDCA 5F64A 4HLXA 1YFHA 4P9UA 2PI0A 3CJNA 1WWXA 2RN7A 1ZRDA 1Z91A 2EA4A 2GIVA 3CTAA 2MLGA 2CSOA 5ICFA 5CJ9A 3WTWC 1W7PD 3KLOA 2ZNYA 4M74A 2D2WA 3ZMVA 4UUVA 2R7DA 4EM1A 4AIJA 2XROA 4TV7A 2QBYA 3O6BB 1Z7UA 2EA2A 4XSXF 1KA8A 2Y48A 3H92A 5JVTA 3GO5A 3K1NA 4OINF 1QPMA 2H6CA 1FBQA 1RZ4A 3I59B 2EFQA 1W7PB 2W85A 5DCMA 2STTA 1KYZA 3FXQA 2DK8A 2PEXA 1G4DA 2HKOA 2E7WA 4G7OF 3ERED 3WU0A 5CVIA 4U0VA 2IW5A 5F6FA 2XAQA 5EEHA 2VE9A 4R79A 1BI0A 4G9YA 2E7XA 2FEZA 4CDGA 5HS9A 3F3XA 5LHGA 2ZNZA 1VTNC 2P8TA 2ELHA 4RAZA 1G3SA 5LGUA 3BP8A 1X3UA 1QZZA 4R1HA 1F5TA 2KJCA 4ASNA 2VBWA 1TLHB 3IC7A 2ADUA 2K4JA 2IA1A 3PQKA 3KE2A 2M45A 2DQLA 2HTSA 4MEXF 3QP6A 2V79A 4Q48A 4BHPA 1OKRA 4RGRA 5D8LB 2HOEA 3BJ6A 4UV8A 2DFIA 4EV0A 3F22A 2XAGA 1JE8A 1ZLKA 4M6YA 4WX9A 3ZP5A 1REPC 2OQRA 2XAJA 2OZUA 3I58A 2VXZA 4GYIA 3SFZA 3RPUA 1S7OA 4BHBA 1LQ1A 3ROUA 1FY7A 2HYGD 4YFKF 4IRGA 4L9JA 4MHGA 2BGCA 1HSJA 5LRRA 1P4AA 2WTEA 4R8HA 4Y17A 1CF7A 3WE3A 1FZPB 1I5ZA 2DTRA 4Z2YA 3I0TA 3FMQA 2NS0A 1DPRA 1U78A 4JBAA 5JI6A 4I7HA 1U6GA 4Y15A 4CICA 2PQ8A 3KCCA 2KRFA 2ZXJA 3WGGA 2OQGA 2O61A 4LK1F 4HBLA 1Y0UA 1UHWA 4NB5A 4P5OA 1YS7A 1XSXA 4XSZF 3QP5A 4P9FA 4WWCA 1FOKA 2QQAA 3F8NA 4KMFA 2DU9A 2A3SA 1ZRFA 2ESHA 3LQQA 1GXQA 5TJJA 4ZZLA 5LHHA 2AXLA 2KJBA 3BOQA 1R58A 1XGOA 1MJBA 2DLLA 1QO0D 3P9KA 1J9IA 4WCGA 5K5OA 3I59A 3FWEA 3ZN1A 5DD4A 3C18A 1W7PA 4WF2A 2MH9A 3WTXC 4G7ZF 4RB3C 4KIBA 3VFZA 3QU3A 4YG2F 2CW0F 1ZH5A 2STWA 5BOXA 3HTUA 1W5SA 2K02A 2CGPA 4O6JA 3GX4X 2XKOA 4OIOF 4O3MA 4I98B 3TO6A 4L5JA 1SMYF 2HKXA 1USSA 2FA5A 4PGHA 3RKWA 4UVBA 5K5QA 1WRJA 1K7AA 3R0AA 3G73A 3GFJA 3GEZA 2QYOA 3ELKA 1S7AA 1LDJA 5DCFA 3TGNA 4A6DA 4IVNA 2Q0OA 2K7LA 3T8RA 1FLIA 4HLYA 2P6SA 5D4SA 1H0MA 3TOBA 1R5GA 4U0YA 3JSPA 1IN4A 1QQIA 2EJRA 4HW0A 3F8CA 4IHSA 4XLPF 2O6GE 4EVIA 1FSHA 3CUOA 2F5DA 3TO7A 2V9VA 4HOBA 3E6CC 3BY6A 1TNSA 5BPIA 4YIIA 4OMZA 1GXPA 5D5VB 1IRFA 2VBZA 3V7CA 3Q5FA 3SZTA 4P55A 1P2FA 3I71A 4AIHA 4NQWA 4DQ2A 5HOOA 1BC7C 1ZG1A 5L3GA 4RGSA 2ZJ2A 1T39A 2FOKA 2MD5A 4Q47A 2FMYA 4ZH4F 2DT5A 2KIFA 3V8JA 5D5WB 3JTGA 1LVAA 1S6LA 3RKXA 2FE3A 3COAC 2OU2A 1YQAA 2HR3A 2QBYB 1R1VA 1E2XA 2PMHA 4QLCU 2IA0A 4OMYA 3JW4A 4YFNF 1OR7A 2OD5A 1RUNA 2Y75A 1FT9A 5J8FA 2Y0MA 5CVVA 3KEQA 5L3FA 2RC4A 3E97A 3HSRA 2RNJA 4IRIA 1FP1D 4HDVA 3L9FA 5HLGA 4F7ZA 2COMA 4IF4A 3FXUA 3GZ5A 2ZCWA 1XCVA 1G6NA 5DUIA 2MA3A 4I09A 4LG0A 4L0ZB 4LJZF 3MFKA 1BC8C 2DW4A 2XRNA 1KU3A 2LF8A 2FSWA 2XVCA 2L4MA 2PJPA 2H6BA 1Z6RA 2XUBA 3T5XA 4B09A 3ZN0A 1YW9A 1W4MA 3MZHA 1B59A 2FNAA 2XIGA 3L00A 2DK5A 5ED4A 3LWFA 1TBXA 2JT1A 1G3YA 3LA7A 1F9NA 2D1HA 5HS8A 4KNYA 1OPCA 2ZFWA 3WTYC 1BIAA 2F5EA 1MDMB 4IPAA 1O7LA 3RPQA 2XAFA 4PZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXN A;  1O3Q A;  1KGS A;  2YU3 A;  2QM3 A;  2D1V A;  3RDI A;  2Z9O A;  1HKT A;  1ONV A;  2XKP A;  4MTD A;  3P9C A;  4FHT A;  5CVU A;  2K27 A;  4FX4 A;  3T8T A;  1B9M A;  2VT3 A;  4UXN A;  3LA3 A;  4A6E A;  3QPT A;  2JPC A;  5DEQ A;  1CF7 B;  1MGT A;  1P6R A;  1O3R A;  2G9W A;  2G7H A;  1XN7 A;  3P9I A;  3SZP A;  2M5W A;  5KK1 A;  3ZQ7 A;  5DDG A;  5E18 F;  2ZBK A;  1WQ2 A;  2EWN A;  3KP2 A;  4KN4 X;  3RYP A;  3DFG A;  3DEU A;  2NYX A;  2Z5U A;  5HVQ C;  2RV8 A;  1LB2 A;  1J5Y A;  2PFB A;  3K2Z A;  1IAW A;  3EYI A;  4CO8 A;  3ZMD A;  1BI2 A;  2VON A;  5E8I A;  1KQ8 A;  2GXG A;  3GUD A;  4GO1 A;  5CLS A;  3JSO A;  3SHF A;  1OYY A;  3EYY A;  3WOD F;  1HW5 A;  3K69 A;  1XD7 A;  4KN7 X;  3GYH X;  5LGN A;  4LLL A;  1ZLJ A;  5CVR A;  2HZT A;  2HGC A;  1GHC A;  1UCR A;  1FNN A;  4ZYG A;  1RI7 A;  4UV9 A;  4HA8 A;  3RTR A;  3R0J A;  3HHG A;  2BYV E;  2O0Y A;  1WI9 A;  2DPU A;  5EEG A;  4HF2 A;  1ZRE A;  3HOS A;  4E70 A;  5FD6 A;  4UNO A;  2QWW A;  2HWV A;  4GYG A;  3EET A;  3TOA A;  1XCB A;  2BBY A;  4BXU A;  3DXJ F;  4LGW A;  1PDN C;  3CUQ B;  5KVR A;  3GXO A;  1SAX A;  2A6H F;  3TDZ C;  1RIO H;  4WK8 F;  5L3D A;  2OA4 A;  4CXF A;  3BPV A;  2Z3Y A;  3E6B A;  3M9A A;  2FRH A;  2X0L A;  1ZGJ A;  2DPD A;  3DQV C;  4M9S A;  3KFW X;  4Q5S F;  2ETH A;  4G6Q A;  4HQM A;  1T2K A;  1D8K A;  2L01 A;  2Z33 A;  2F5C A;  1P92 A;  3J80 K;  2BE5 F;  4EM2 A;  2VC0 A;  3F21 A;  4LB6 B;  1MDM A;  1K6O A;  3L7W A;  5FGM A;  1XMA A;  2ISZ A;  1U3E M;  1KYW A;  4KDP A;  4LLN A;  3LQR A;  3GW2 A;  2RGV A;  3F6O A;  5H6Q A;  1QBJ A;  3W6K B;  2CWE A;  2FQ3 A;  5A2Q K;  2K4B A;  2DAO A;  3D5L A;  5LEK A;  3DPL C;  3MZY A;  4HAM A;  4A0Z A;  1HKS A;  2VOO A;  3WGI A;  3ZMT A;  1KU7 A;  3KP5 A;  4BNC A;  4I0B A;  4ZYH A;  2PLY A;  1HBX G;  4UVA A;  1XDU A;  3I53 A;  1XGM A;  1YYV A;  2V1D A;  2EV6 A;  2P7C B;  4U7B A;  4UVC A;  3FM3 A;  3GFL A;  3S2W A;  4S04 A;  2YX4 A;  2A6E F;  1YLF A;  3NEU A;  4MQV A;  4BQA A;  3V8L A;  4I01 A;  3M8E A;  2MC3 A;  1BI1 A;  2FF4 A;  2Z99 A;  3RYR A;  4PDK A;  2O3F A;  4H0E A;  4KIF A;  4L5I A;  5HDG A;  2NNY A;  3GF2 A;  2F2E A;  2QEN A;  1I27 A;  1KU9 A;  3ZMZ A;  4ESJ A;  5E1W A;  4P96 A;  2GWR A;  1R36 A;  2L4A A;  3K0L A;  4MEY F;  4OIR F;  3DF8 A;  5FB2 A;  3M7G A;  1MJ9 A;  1U2W A;  2K86 A;  4BH9 A;  4LG0 B;  2C6Y A;  1SD6 A;  3EUH A;  1B1B A;  2J5O A;  4HF1 A;  3VOD A;  2A5Y B;  4PCQ A;  6PAX A;  1YW8 A;  2O03 A;  4RS8 A;  3L2C A;  2GZW A;  4PGG A;  5D6F A;  1ZN2 A;  3WTU C;  1JHF A;  4GXO A;  1YO5 C;  3R61 A;  1XGN A;  3CUQ A;  2ESN A;  4EJU A;  2FML A;  5BQT A;  1HST A;  3T0Y A;  1YTY A;  4LFU A;  1R22 A;  3IWZ A;  1ZAO A;  5L3B A;  3KET A;  2BV6 A;  2J5P A;  1U5T A;  2UZK A;  2VN2 A;  1MZB A;  3I5U A;  1XB4 A;  2OZ6 A;  3O3K A;  1HQC A;  3T1B A;  1F4K A;  2O8X A;  1UST A;  2M87 A;  3I64 A;  1SFX A;  3Q9S A;  4HF0 A;  2FNP A;  3VOE A;  2W57 A;  4HDU A;  4A12 A;  3QOP A;  1O7F A;  5DD8 A;  3WTT C;  1EH8 A;  4OIP F;  3M1E A;  2PN6 A;  4LMY A;  4JK1 X;  3O2P E;  1G3W A;  3F8F A;  3FZV A;  2ISY A;  4ESB A;  2A07 F;  2PG4 A;  2WV0 A;  5LGT A;  1BM9 A;  4S05 A;  2HS5 A;  2VOP A;  3IL2 A;  2Q2E A;  5HDN A;  1YIO A;  3Q9V A;  3N4M A;  1T6S A;  1TQM A;  1AWC A;  3ABT A;  1ZYR F;  2W84 A;  4A5M A;  3FF5 A;  2GXB A;  1T38 A;  2MLK A;  1L0O C;  1JGS A;  2IPQ X;  4I0A A;  2E1C A;  1KQ0 A;  2XV4 S;  3RJP A;  1GVJ A;  2YR2 A;  1I1G A;  4ENJ A;  2XGX A;  1TTY A;  2L3D A;  3FM5 A;  4EGZ A;  4YFX F;  2P4W A;  5HS7 A;  4RAY A;  2HFH A;  3P7N A;  2DI3 A;  2W24 A;  2EB7 A;  2PMU A;  2ZKZ A;  2ZME A;  3DP7 A;  2H27 A;  4AWX B;  3BJO A;  4M9X A;  5D4R A;  1O3S A;  3WTV C;  4G7H F;  1XDS A;  2EK5 A;  3E6D A;  3FXR A;  1D8J A;  4G6D A;  1IUY A;  4L9N A;  3PQJ A;  5FO5 A;  3J80 Z;  4WXC A;  4U7D A;  2P5K A;  3KP3 A;  1JXS A;  1L3L A;  2JZY A;  1OYW A;  2R3S A;  3BPX A;  4WXD A;  1G3T A;  3F8M A;  3CLO A;  1T0F A;  5LBQ A;  1QZY A;  2NAZ A;  4EM0 B;  1J59 A;  1ON1 A;  3HRU A;  3LFK A;  4BAY A;  1IZ1 A;  5A2Q Z;  4A0Y A;  3QRF F;  2FU4 A;  1S8N A;  3LST A;  4KIC A;  2V1U A;  3W6J B;  1EV7 A;  4EGY A;  3U1D A;  2GQQ A;  1MKM A;  5K1Y A;  2R7F A;  1IN5 A;  4MGR A;  4BYY A;  2LNB A;  3LA2 A;  4RGX A;  2LKP A;  1R5H A;  2RDP A;  1CGP A;  2V1X A;  3D0S A;  5E20 A;  3NRV A;  4RGU A;  2GA2 A;  3V7S A;  1K78 A;  5ILU A;  4B8X A;  1STZ A;  1QGP A;  4L9T A;  3MWM A;  1FYL A;  3HRT A;  4IHT A;  4ESF A;  5TRD A;  4EJV A;  4ZYD A;  3OV8 A;  1B9N A;  3VEP A;  5J6X A;  5LEJ A;  4HX7 A;  1LEB A;  2A68 F;  4O5V A;  3MQ0 A;  2RKH A;  1FX7 A;  3K1M A;  3SXY A;  3MCZ A;  4M9Z A;  3EQL F;  1Z9C A;  5IT9 Z;  3F72 A;  2CYY A;  4IRH A;  5BPD A;  4K2E A;  3HTS B;  5E1X A;  3ECO A;  4A2U A;  1LDK B;  5H20 A;  2QLZ A;  1FBU A;  1EH6 A;  2A61 A;  3I4P A;  2WC2 A;  2WWY A;  1ZG3 A;  1B6A A;  1SD4 A;  3QAH A;  4HQE A;  5IT3 A;  4IXA A;  4G94 A;  1NHA A;  1AOY A;  1S3J A;  2XAS A;  3B73 A;  1IXS B;  4ENM A;  5ICE A;  3VB2 A;  1SFU A;  1J2X A;  4OU0 A;  5DUK A;  4MNU A;  1BJA A;  1U8R A;  4AVP A;  3HIF A;  2IRF G;  4LD5 A;  3OOP A;  2YSR A;  2LDU A;  1ZAR A;  3WE2 A;  3JAM K;  1ZRC A;  4HV6 A;  3CUQ C;  2DBB A;  4HV5 A;  3TKY A;  3V4G A;  4HX8 A;  1P4W A;  2YX7 A;  1Z6T A;  4OOI A;  3H3Z A;  2VC1 A;  3R60 A;  2CQK A;  4XRF A;  2OBP A;  1UFM A;  1U5T C;  3C7J A;  1IXR C;  3IRQ A;  4ENN A;  3V7R A;  3BDD A;  2M30 A;  3K1P A;  5JHU A;  4M71 A;  1ZG5 A;  1U5T B;  5FD5 A;  3ZMS A;  2QQ9 A;  3MAJ A;  1LNW A;  4EQQ A;  1S29 A;  4HZF A;  3MEX A;  5AIQ A;  4I2O A;  1PP7 U;  4FT8 A;  2CG4 A;  5E17 F;  3AAF A;  3BRO A;  2HEO A;  4HX4 A;  5E8G A;  1PUE E;  1HXD A;  5ILS A;  1BI3 A;  2MBF A;  2M1B A;  3KP4 A;  5DYM A;  4ETS A;  1B4A A;  1TW3 A;  3HHH A;  1H9G A;  1XSD A;  4IJA A;  4QWQ A;  3J81 K;  1BN5 A;  3E3V A;  1W5T A;  5ICG A;  1V4R A;  3ULQ B;  2ZO4 A;  2W25 A;  4YIF A;  4N0B A;  3HYI A;  2TDX A;  3WU1 B;  3DV8 A;  2CFX A;  2NNN A;  2FBI A;  5H6R A;  2P5L C;  3FX3 A;  2JSC A;  2P6T A;  4L0Y B;  1LDD A;  3F8B A;  2B0L A;  4EJO A;  5FLX K;  4NHJ A;  3J7A O;  3E5Q A;  3QPH A;  4DNC A;  4CGZ A;  1BIB A;  1DUX C;  5E1Z B;  4BHC A;  3WTS C;  1KU2 A;  3REO A;  1I6X A;  3RKY A;  3ISP A;  1ULY A;  2RQP A;  3H3U A;  3GZ6 A;  3ZPL A;  1JHH A;  2NRA C;  4A0X A;  2EFN A;  3PFI A;  3BZ6 A;  2ZME B;  4KFC A;  4MQ9 F;  1WKM A;  5FFZ A;  3GWZ A;  3GFM A;  1R1U A;  5AIP A;  4D0P A;  2EFW A;  3C3W A;  3N97 A;  1XGS A;  1SFE A;  1HW2 A;  4AD9 A;  5L3E A;  4CYD A;  3R4K A;  2IP2 A;  1R23 A;  4N9H A;  2HQR A;  2UWM A;  2EV0 A;  1H9T A;  3IWF A;  1MJA A;  2YPR A;  2VOD A;  1O3T A;  4N9I A;  1YW7 A;  2HYF A;  2LF7 A;  2RVC A;  2IJL A;  5D6E A;  2Q8K A;  1DP7 P;  4ZYE A;  1XSV A;  5D5X B;  3ZMU A;  1ZHF A;  4OIQ F;  4L18 B;  2X4H A;  5IT9 K;  2QVO A;  1IN6 A;  4CZZ A;  1DDN A;  1IW7 F;  3ML6 A;  2CO5 A;  2DO7 A;  1O57 A;  1J0R A;  1FYM A;  2KIU A;  2JTV A;  4GGG A;  4KMU X;  3KZY A;  2A69 F;  1FP2 A;  3E5X A;  4XLN F;  3WTZ A;  1TQP A;  1BOA A;  1A04 A;  3BWG A;  2L02 A;  2EFO A;  3HUG A;  3IKT A;  3LAP A;  1UHM A;  1J75 A;  5K5R A;  1RUO A;  5ERI A;  3DPT A;  1D5V A;  1R1T A;  2P5V A;  4MTE A;  1FBS A;  2GAU A;  1QNT A;  2PBI A;  2V6C A;  3HRS A;  3KP6 A;  1MD0 A;  3CDH A;  3HSE A;  3G3Z A;  1IN7 A;  4G8X A;  1K78 B;  3IHU A;  4EMS A;  1Q1H A;  1ODD A;  1FPQ A;  5L3C A;  5LLQ A;  3LAJ A;  2VT2 A;  2EV5 A;  3KEO A;  3IKV A;  3ABU A;  2KKO A;  1R00 A;  3FMS A;  1OYI A;  3L09 A;  1WSU A;  4CHU A;  1R7J A;  5CYV A;  3V8K A;  3TQN A;  1IXC A;  2FBK A;  2MH2 A;  2F5F A;  4LB5 A;  1DPU A;  5CVJ A;  4ON0 A;  2P7V B;  4EJT A;  2M8E A;  1ON2 A;  3SQN A;  5HLI A;  3QU6 A;  1ZGA A;  3RIR A;  4KUM A;  2XHK A;  1RNL A;  3B02 A;  4KYW A;  3JAM Z;  4I02 A;  1TW2 A;  1I1S A;  4M72 A;  4WXH A;  1Z05 A;  3K9T A;  5FFX A;  3BJA A;  4GCV A;  4RB1 A;  4KA4 A;  2AS5 F;  2OAZ A;  1UB9 A;  1V3F A;  2FBH A;  5F1R A;  5ICC A;  4U0W A;  1P4X A;  4RB0 A;  3WGH A;  2VBX A;  3F23 A;  1YS6 A;  3HSF A;  2FXA A;  2D45 A;  4HYE A;  3DKW A;  5HLH A;  3U9G A;  2ACJ A;  1F1Z A;  1HKQ A;  2HQN A;  2LSO A;  3M8F A;  3KZZ A;  5JFR A;  3GLX A;  3JTH A;  4XBF A;  1IN8 A;  4M73 A;  1LEA A;  4FX0 A;  3U2R A;  4ENK A;  3GFI A;  3EDP A;  3TO9 A;  1IRG A;  3J81 Z;  2E1N A;  2GA1 A;  2IT0 A;  5BMZ A;  1C0W A;  5J8C A;  1PP8 F;  1OMI A;  4ZZD A;  3I54 A;  3FHZ A;  3WG9 A;  5DCM B;  5AON A;  1FWZ A;  2JRT A;  1FSE A;  4Q4Z F;  3R6S A;  2VBY A;  1FYK A;  2BEO A;  4LK0 F;  3F6V A;  3CO6 C;  5LRS A;  4RB2 C;  3TDU C;  1SMT A;  5FLX Z;  2QZ8 A;  2L54 A;  2G7U A;  1K79 A;  3HOT A;  4LLG F;  3FMR A;  2HTJ A;  2H09 A;  1Z1D A;  4L9V A;  4UHT A;  1J7K A;  1YG2 A;  2EFP A;  4AIK A;  3C1D A;  4A5N A;  1IF1 A;  1XMK A;  4EJW A;  1EH7 A;  2JPB A;  4Y13 A;  2H94 A;  1HW1 A;  4U88 A;  3RI4 A;  4KT5 C;  4JQF A;  2QQB A;  2DQR A;  5BS6 A;  2IA2 A;  2XAH A;  2KIM A;  5JR3 A;  5D8K B;  3NQO A;  5D5U B;  1SD7 A;  2IVM A;  1TQI A;  3ECH A;  3HRM A;  1D3Y A;  5LHI A;  4KIG A;  5DV5 A;  4M6X A;  1LJ9 A;  1KQ9 A;  1T98 A;  1BBY A;  1SD5 A;  1E17 A;  5HDK A;  3KP7 A;  5ILV A;  3E6M A;  1TNT A;  2VE8 A;  3KLN A;  2QUF A;  1FC3 A;  3CO7 C;  3GVA A;  2UXX A;  3IRR A;  3E5U A;  2HDC A;  5F64 A;  4HLX A;  1YFH A;  4P9U A;  2PI0 A;  3CJN A;  1WWX A;  2RN7 A;  1ZRD A;  1Z91 A;  2EA4 A;  2GIV A;  3CTA A;  2MLG A;  2CSO A;  5ICF A;  5CJ9 A;  3WTW C;  1W7P D;  3KLO A;  2ZNY A;  4M74 A;  2D2W A;  3ZMV A;  4UUV A;  2R7D A;  4EM1 A;  4AIJ A;  2XRO A;  4TV7 A;  2QBY A;  3O6B B;  1Z7U A;  2EA2 A;  4XSX F;  1KA8 A;  2Y48 A;  3H92 A;  5JVT A;  3GO5 A;  3K1N A;  4OIN F;  1QPM A;  2H6C A;  1FBQ A;  1RZ4 A;  3I59 B;  2EFQ A;  1W7P B;  2W85 A;  5DCM A;  2STT A;  1KYZ A;  3FXQ A;  2DK8 A;  2PEX A;  1G4D A;  2HKO A;  2E7W A;  4G7O F;  3ERE D;  3WU0 A;  5CVI A;  4U0V A;  2IW5 A;  5F6F A;  2XAQ A;  5EEH A;  2VE9 A;  4R79 A;  1BI0 A;  4G9Y A;  2E7X A;  2FEZ A;  4CDG A;  5HS9 A;  3F3X A;  5LHG A;  2ZNZ A;  1VTN C;  2P8T A;  2ELH A;  4RAZ A;  1G3S A;  5LGU A;  3BP8 A;  1X3U A;  1QZZ A;  4R1H A;  1F5T A;  2KJC A;  4ASN A;  2VBW A;  1TLH B;  3IC7 A;  2ADU A;  2K4J A;  2IA1 A;  3PQK A;  3KE2 A;  2M45 A;  2DQL A;  2HTS A;  4MEX F;  3QP6 A;  2V79 A;  4Q48 A;  4BHP A;  1OKR A;  4RGR A;  5D8L B;  2HOE A;  3BJ6 A;  4UV8 A;  2DFI A;  4EV0 A;  3F22 A;  2XAG A;  1JE8 A;  1ZLK A;  4M6Y A;  4WX9 A;  3ZP5 A;  1REP C;  2OQR A;  2XAJ A;  2OZU A;  3I58 A;  2VXZ A;  4GYI A;  3SFZ A;  3RPU A;  1S7O A;  4BHB A;  1LQ1 A;  3ROU A;  1FY7 A;  2HYG D;  4YFK F;  4IRG A;  4L9J A;  4MHG A;  2BGC A;  1HSJ A;  5LRR A;  1P4A A;  2WTE A;  4R8H A;  4Y17 A;  1CF7 A;  3WE3 A;  1FZP B;  1I5Z A;  2DTR A;  4Z2Y A;  3I0T A;  3FMQ A;  2NS0 A;  1DPR A;  1U78 A;  4JBA A;  5JI6 A;  4I7H A;  1U6G A;  4Y15 A;  4CIC A;  2PQ8 A;  3KCC A;  2KRF A;  2ZXJ A;  3WGG A;  2OQG A;  2O61 A;  4LK1 F;  4HBL A;  1Y0U A;  1UHW A;  4NB5 A;  4P5O A;  1YS7 A;  1XSX A;  4XSZ F;  3QP5 A;  4P9F A;  4WWC A;  1FOK A;  2QQA A;  3F8N A;  4KMF A;  2DU9 A;  2A3S A;  1ZRF A;  2ESH A;  3LQQ A;  1GXQ A;  5TJJ A;  4ZZL A;  5LHH A;  2AXL A;  2KJB A;  3BOQ A;  1R58 A;  1XGO A;  1MJB A;  2DLL A;  1QO0 D;  3P9K A;  1J9I A;  4WCG A;  5K5O A;  3I59 A;  3FWE A;  3ZN1 A;  5DD4 A;  3C18 A;  1W7P A;  4WF2 A;  2MH9 A;  3WTX C;  4G7Z F;  4RB3 C;  4KIB A;  3VFZ A;  3QU3 A;  4YG2 F;  2CW0 F;  1ZH5 A;  2STW A;  5BOX A;  3HTU A;  1W5S A;  2K02 A;  2CGP A;  4O6J A;  3GX4 X;  2XKO A;  4OIO F;  4O3M A;  4I98 B;  3TO6 A;  4L5J A;  1SMY F;  2HKX A;  1USS A;  2FA5 A;  4PGH A;  3RKW A;  4UVB A;  5K5Q A;  1WRJ A;  1K7A A;  3R0A A;  3G73 A;  3GFJ A;  3GEZ A;  2QYO A;  3ELK A;  1S7A A;  1LDJ A;  5DCF A;  3TGN A;  4A6D A;  4IVN A;  2Q0O A;  2K7L A;  3T8R A;  1FLI A;  4HLY A;  2P6S A;  5D4S A;  1H0M A;  3TOB A;  1R5G A;  4U0Y A;  3JSP A;  1IN4 A;  1QQI A;  2EJR A;  4HW0 A;  3F8C A;  4IHS A;  4XLP F;  2O6G E;  4EVI A;  1FSH A;  3CUO A;  2F5D A;  3TO7 A;  2V9V A;  4HOB A;  3E6C C;  3BY6 A;  1TNS A;  5BPI A;  4YII A;  4OMZ A;  1GXP A;  5D5V B;  1IRF A;  2VBZ A;  3V7C A;  3Q5F A;  3SZT A;  4P55 A;  1P2F A;  3I71 A;  4AIH A;  4NQW A;  4DQ2 A;  5HOO A;  1BC7 C;  1ZG1 A;  5L3G A;  4RGS A;  2ZJ2 A;  1T39 A;  2FOK A;  2MD5 A;  4Q47 A;  2FMY A;  4ZH4 F;  2DT5 A;  2KIF A;  3V8J A;  5D5W B;  3JTG A;  1LVA A;  1S6L A;  3RKX A;  2FE3 A;  3COA C;  2OU2 A;  1YQA A;  2HR3 A;  2QBY B;  1R1V A;  1E2X A;  2PMH A;  4QLC U;  2IA0 A;  4OMY A;  3JW4 A;  4YFN F;  1OR7 A;  2OD5 A;  1RUN A;  2Y75 A;  1FT9 A;  5J8F A;  2Y0M A;  5CVV A;  3KEQ A;  5L3F A;  2RC4 A;  3E97 A;  3HSR A;  2RNJ A;  4IRI A;  1FP1 D;  4HDV A;  3L9F A;  5HLG A;  4F7Z A;  2COM A;  4IF4 A;  3FXU A;  3GZ5 A;  2ZCW A;  1XCV A;  1G6N A;  5DUI A;  2MA3 A;  4I09 A;  4LG0 A;  4L0Z B;  4LJZ F;  3MFK A;  1BC8 C;  2DW4 A;  2XRN A;  1KU3 A;  2LF8 A;  2FSW A;  2XVC A;  2L4M A;  2PJP A;  2H6B A;  1Z6R A;  2XUB A;  3T5X A;  4B09 A;  3ZN0 A;  1YW9 A;  1W4M A;  3MZH A;  1B59 A;  2FNA A;  2XIG A;  3L00 A;  2DK5 A;  5ED4 A;  3LWF A;  1TBX A;  2JT1 A;  1G3Y A;  3LA7 A;  1F9N A;  2D1H A;  5HS8 A;  4KNY A;  1OPC A;  2ZFW A;  3WTY C;  1BIA A;  2F5E A;  1MDM B;  4IPA A;  1O7L A;  3RPQ A;  2XAF A;  4PZJ A; 
#chains in the Genus database with same CATH topology
 1VF9 A;  1A36 A;  2UXN A;  4B47 A;  1O3Q A;  2I8D A;  1KGS A;  2YU3 A;  4DBR A;  2LH9 A;  2QM3 A;  3TP3 A;  3TBI A;  2D1V A;  1VQP I;  2ME0 A;  3RDI A;  2LRE A;  2Z9O A;  3X2Q H;  3L2W A;  1YJN I;  1ZTR A;  2DA7 A;  2P81 A;  4B43 A;  1HKT A;  1ONV A;  2XKP A;  3FIW A;  2NVY J;  4MTD A;  3HZJ A;  3P9C A;  4FHT A;  3S1M J;  4E4H A;  3E1S A;  5CVU A;  5E3M A;  4J19 A;  2CW8 A;  2K27 A;  4FX4 A;  3T8T A;  1B9M A;  2VT3 A;  4UXN A;  3LA3 A;  3BG6 A;  4A6E A;  3QPT A;  2JPC A;  2R7Q A;  5DEQ A;  4HNT A;  1MGT A;  4BJ5 C;  1CF7 B;  1P6R A;  1K4T A;  1O3R A;  1K6Y A;  2G9W A;  5J47 A;  2G7H A;  2NVU B;  5IYB J;  3OYF A;  2X1C A;  2EZH A;  3D1N I;  2IEK A;  1V5F A;  1XN7 A;  2IBD A;  2JWT A;  3P9I A;  3SZP A;  4C2M J;  3ABM H;  3FXK A;  2JUC A;  2M5W A;  5KK1 A;  3ZQ7 A;  5DDG A;  5E18 F;  1MH3 A;  2EIM H;  1WQ2 A;  2ZBK A;  4IO9 F;  1ACI A;  1A6Q A;  2EWN A;  3KP2 A;  1VI0 A;  4KN4 X;  3RYP A;  3DFG A;  1T56 A;  3DEU A;  3I55 I;  2NYX A;  4I6Z A;  2H1L A;  2Z5U A;  1PVE A;  2VJJ A;  3AG1 H;  5HVQ C;  2RV8 A;  5B5E C;  1LB2 A;  4NC8 A;  2CFO A;  3I4N J;  3OSF A;  1J5Y A;  2P0W A;  2PFB A;  2MG4 A;  3K2Z A;  2NVT J;  1IAW A;  3EYI A;  2LFB A;  4CO8 A;  1P9Q C;  3ZMD A;  1BI2 A;  2VON A;  5E8I A;  1KQ8 A;  2ZJQ F;  3MN2 A;  2GXG A;  3CZ6 A;  3GUD A;  4GO1 A;  5CLS A;  3JSO A;  3SHF A;  2E1M C;  1OYY A;  2K5C A;  1OCR H;  2GIZ A;  2QKM B;  2XPV A;  4X0G A;  3HM5 A;  5F1J A;  3EYY A;  3DBH B;  1Y1W J;  3WOD F;  2LR8 A;  3NAU A;  2MC4 A;  3LNQ A;  3A01 A;  1QHH D;  2VJ5 A;  1HW5 A;  2DMU A;  2AHQ A;  2CMP A;  3K69 A;  5IYD J;  3L2R A;  4UB8 C;  4CCL A;  1XD7 A;  3MKL A;  2VPL A;  4KN7 X;  3GYH X;  2JA2 A;  5LGN A;  3CCM I;  4LLL A;  2K9S A;  1ZLJ A;  5CVR A;  3IH4 A;  1ERD A;  2HZT A;  2R7W A;  1ETQ A;  2HGC A;  1GHC A;  1UHS A;  1UCR A;  1FNN A;  4ZYG A;  1MBJ A;  2R7O A;  1MBF A;  2BY2 A;  1RI7 A;  4UV9 A;  1A31 A;  1WH7 A;  1I50 J;  4HA8 A;  2E2J J;  4BQQ A;  3VSK A;  1N77 A;  3RTR A;  3R0J A;  3ZQL A;  5DM6 F;  3HHG A;  2R7U A;  2BYV E;  2O0Y A;  2L7F P;  3ZXS A;  1WI9 A;  2DPU A;  3LOC A;  5EEG A;  4QIW N;  5TIS C;  4HF2 A;  2CUZ A;  1ZRE A;  4RBO A;  3HOS A;  4E70 A;  5FD6 A;  4CZC A;  4UNO A;  2QWW A;  3GCM A;  1W0U A;  2HWV A;  4GYG A;  2R92 J;  3EET A;  3TOA A;  3BG9 A;  1XCB A;  2BBY A;  4QSH A;  3SYT A;  1Z67 A;  4BXU A;  3DXJ F;  4LGW A;  1D0Z A;  4F52 A;  1PDN C;  3CUQ B;  5KVR A;  2B9S A;  3GXO A;  4Y3O A;  5JHF A;  1SAX A;  3QPS A;  2FJ1 A;  2A6H F;  3TDZ C;  1RIO H;  4WK8 F;  1MNM C;  5L3D A;  5GAE J;  1KON A;  2OA4 A;  4CXF A;  3BPV A;  2Z3Y A;  3E6B A;  3IV5 A;  3M9A A;  2FRH A;  4QTR A;  2X6X A;  2W82 A;  2XRL A;  2H8R A;  2ZJR F;  5E3O A;  4PJ0 C;  2X0L A;  5E79 C;  5FKN A;  3OSG A;  1ZGJ A;  4XR6 A;  4J01 A;  5HLT A;  3S1Q J;  1Z3Y A;  2DPD A;  3DQV C;  4M9S A;  3KFW X;  4Q5S F;  3WHC A;  1QVT A;  2ETH A;  3MD2 A;  1X1B A;  5J1R A;  4G6Q A;  3A2K A;  3A0H C;  4IQ4 A;  4HQM A;  2JA5 J;  1T2K A;  1D8K A;  2L9V A;  1MSE C;  2DMP A;  2L01 A;  2Z33 A;  4PK4 A;  1X4P A;  1WJC A;  2F5C A;  5EGO B;  2K3F A;  1A6I A;  1P92 A;  2WAD A;  3J80 K;  2QEX I;  3GTM J;  2BE5 F;  4EM2 A;  2VC0 A;  3O8H A;  4F3Q A;  3F21 A;  5IP6 A;  4LB6 B;  1MDM A;  1K6O A;  3L7W A;  5FGM A;  3TED A;  4H4K C;  2X51 A;  2Q2E B;  1XMA A;  1D0Y A;  2EIL H;  2L9R A;  3HKZ N;  2ISZ A;  1U3E M;  3CCE I;  1KYW A;  4KDP A;  4LLN A;  1TZL A;  2DDB A;  2WV1 A;  3LQR A;  4RMN A;  3GW2 A;  2GOM A;  2RGV A;  1Y8Q B;  3F6O A;  5H6Q A;  2QF7 A;  4NC7 A;  1QBJ A;  2XGE A;  5IOY A;  3FXL A;  2F5V A;  3W6K B;  4CSW A;  2ICW G;  3VYR B;  2XB0 X;  2CWE A;  2FQ3 A;  5A2Q K;  2K4B A;  2DAO A;  3D5L A;  3F9K A;  5LEK A;  3DPL C;  3MZY A;  4HAM A;  4A0Z A;  4AC0 A;  1HKS A;  3DEE A;  1VQN I;  2BVM A;  4YEJ A;  2VOO A;  5B1B H;  3WGI A;  3ZMT A;  4IOC F;  1KU7 A;  3KP5 A;  4E7K A;  2M34 A;  4BNC A;  4I0B A;  1JKO C;  2HQ5 A;  4ZYH A;  5FKM A;  2PLY A;  2VLA A;  1HBX G;  1FIA A;  1UZC A;  2X85 A;  4NQW B;  4UVA A;  4XQF A;  4DJA A;  2PJR A;  1XDU A;  4UUT A;  4A3M J;  3OR2 C;  3GTG J;  2Z1D A;  3I53 A;  1XGM A;  1YYV A;  3UKG A;  1UEL B;  2V1D A;  1FJL A;  2EV6 A;  2P7C B;  4CYC B;  4U7B A;  2GBY A;  4UVC A;  3FM3 A;  4ABZ A;  3JRE A;  3GFL A;  3JCU C;  2X1D A;  3S2W A;  2NOG A;  4W1U A;  2DYS H;  4S04 A;  2LG4 A;  2R7R A;  3S1N J;  4JX6 A;  2YX4 A;  1POG A;  1IO2 A;  1ETK A;  2A6E F;  1YLF A;  3NEU A;  3KYD B;  5DM7 F;  3S14 J;  2KQR A;  4LOC A;  1ETX A;  3FKI J;  2RRE A;  4MQV A;  4BQA A;  3V8L A;  1VQ5 I;  5K7Z A;  2DT7 B;  3PNV A;  4E6K G;  5E3N A;  1OR7 C;  2EIN H;  3CES A;  1VQ6 I;  3I4M J;  2LVS A;  4I01 A;  2G0E A;  5EEA A;  3M8E A;  2OF7 A;  2MC3 A;  1HOM A;  4B4C A;  1BI1 A;  2FF4 A;  2Z99 A;  3RYR A;  4PDK A;  4XOT A;  2VQC A;  2O3F A;  4H0E A;  1A35 A;  4KIF A;  2DN0 A;  2CW7 A;  4L5I A;  4XN0 A;  3PIO F;  5HDG A;  2NNY A;  2B7E A;  3GF2 A;  2F2E A;  2QEN A;  1I27 A;  1KU9 A;  3ZMZ A;  2HOT A;  4ESJ A;  5E1W A;  4P96 A;  4CCJ A;  2GWR A;  4DZJ A;  1R36 A;  2L4A A;  3K0L A;  4ZYA A;  4KIS A;  4MEY F;  5CQE A;  3KYL A;  4OIR F;  2WAQ N;  1BOB A;  3DF8 A;  5FB2 A;  3M7G A;  3RKQ A;  3ONQ A;  1MJ9 A;  1U2W A;  2K86 A;  1TWG J;  2EQR A;  2NS8 A;  2JK3 A;  4BH9 A;  4LG0 B;  2C6Y A;  2PMZ N;  3HL2 A;  1SD6 A;  2Y9Z A;  3EUH A;  1B1B A;  1JGG A;  2J5O A;  2BHY A;  4HF1 A;  3VOD A;  3JRD A;  3ASN H;  2A5Y B;  4PCQ A;  4CUG A;  6PAX A;  1YW8 A;  2O03 A;  2VPR A;  4RS8 A;  3L2C A;  3AG3 H;  2GZW A;  4PGG A;  5D6F A;  1ZN2 A;  3CJQ B;  1JHF A;  3WTU C;  4XID A;  2EIK H;  3K70 C;  3OL4 A;  4GXO A;  2IS2 A;  1YO5 C;  3R61 A;  1XGN A;  4V2G A;  3VDX A;  3CUQ A;  2ESN A;  4NNJ A;  4A3D J;  4EJU A;  2JVH A;  2R5Z B;  3K4L A;  1Y0N A;  2FML A;  3ZQG A;  5BQT A;  1V5G A;  1HST A;  1XC5 A;  5FLV A;  2HPI A;  1MMG A;  1BJZ A;  3T0Y A;  2XDV A;  1YTY A;  4S0H B;  4LFU A;  4C3J J;  1R22 A;  3IWZ A;  5LD2 C;  1ZAO A;  5L3B A;  4HNU A;  3KET A;  2BV6 A;  2J5P A;  1U5T A;  3AG2 H;  3GME A;  2UZK A;  2VN2 A;  1MZB A;  3E0J B;  3I5U A;  1XB4 A;  2OZ6 A;  3O3K A;  4A3C J;  1HQC A;  3T1B A;  3LSG A;  1F4K A;  2O8X A;  1GUU A;  3CCS I;  1QU3 A;  1UST A;  1WJD A;  3OIO A;  2M87 A;  3I64 A;  1SFX A;  2X48 A;  2F4I A;  3Q9S A;  5FRN A;  4HF0 A;  2FNP A;  2WY8 Q;  3VOE A;  2R7X A;  2W57 A;  3U1K A;  4HDU A;  4A12 A;  2Y0S N;  2QKL B;  4G6T B;  2RNG A;  1X3Z B;  4AYB A;  3QOP A;  1JUP A;  1O7F A;  1EJ9 A;  5DD8 A;  2HDD A;  1YRN B;  3WTT C;  2IS4 A;  2GXA A;  1EH8 A;  3G1O A;  3OWT A;  2JN6 A;  2CU7 A;  2V9K A;  3M1E A;  3MKW B;  3CCV I;  4OIP F;  1GV5 A;  2FOW A;  2PN6 A;  4LMY A;  2JSP A;  4JK1 X;  1OCC H;  3O2P E;  1G3W A;  3F8F A;  3FZV A;  1IRX A;  2ISY A;  4PJL A;  4ESB A;  1E3O C;  2A07 F;  2XGC A;  2PG4 A;  2WV0 A;  5LGT A;  3CC4 I;  3FXJ A;  5FRO A;  1BM9 A;  4S05 A;  2HS5 A;  2VOP A;  3IL2 A;  2Q2E A;  4XKC A;  1YIO A;  5HDN A;  3Q9V A;  3N4M A;  2WB1 A;  1T6S A;  1TQM A;  1AWC A;  1OJL A;  2VQL A;  3ABT A;  5M3M J;  1ZYR F;  2W84 A;  4A5M A;  3FF5 A;  2GXB A;  2HI3 A;  1T38 A;  1FMW A;  1X1P A;  2MLK A;  1L0O C;  1JGS A;  3OYI A;  5F04 A;  2IPQ X;  4I0A A;  1ZR2 A;  2E1C A;  3GTJ J;  1LFU P;  1KQ0 A;  4P1W A;  2XV4 S;  4MFD A;  3RJP A;  1GVJ A;  2YR2 A;  2WY7 Q;  1I1G A;  4ENJ A;  2XGX A;  1TTY A;  2L3D A;  3FM5 A;  5FLM J;  4DBQ A;  4EGZ A;  2IAI A;  4EAT A;  4YFX F;  1AKH B;  1W36 D;  2P4W A;  2CQ7 A;  5HS7 A;  4RAY A;  4BE0 A;  1RR8 C;  2HU9 A;  2HFH A;  3P7N A;  2DI3 A;  2W24 A;  4Z6Y A;  2EB7 A;  2PMU A;  2ZKZ A;  3B6A A;  5FKO A;  2ZME A;  3DP7 A;  2LMD A;  1U9N A;  4BBR J;  3MZ8 A;  4JX5 A;  1TWC J;  2ELK A;  2H27 A;  4AWX B;  3BJO A;  5B1A H;  2O8K A;  4M9X A;  4XKB A;  5D4R A;  4C3I J;  3KYC B;  1O3S A;  3WTV C;  3BR3 A;  2HZD A;  4G7H F;  4Y52 J;  5K7F A;  1JKR C;  3CCR I;  2OTJ I;  1XDS A;  1N78 A;  3HC7 A;  1W36 C;  1VQ9 I;  2EK5 A;  2QSF X;  3E6D A;  4HEA 2;  1NTC A;  2DCE A;  3FXR A;  1X4O A;  1D8J A;  4G6D A;  3OOU A;  1X1C A;  3IAS 2;  2VI6 A;  1MMA A;  2EPF A;  2IS1 A;  3GZN B;  4L9N A;  1IUY A;  3D5S C;  3PIP F;  3PQJ A;  3PSF A;  2CUE A;  3M1C A;  5FO5 A;  4N4N B;  2VKV A;  3J80 Z;  3SDB A;  4WXC A;  5HNH A;  3HOX J;  2E2H J;  1EA3 A;  1OIS A;  1YOV B;  4X1E A;  4U7D A;  3CMM A;  1FOW A;  2P5K A;  5EG0 A;  3KP3 A;  3QOD A;  3M8J A;  2KZV A;  5J3L A;  5GP9 A;  1BL0 A;  1JXS A;  1L3L A;  2JZY A;  3TP0 A;  1OYW A;  2E34 A;  2R3S A;  3H5N A;  2E36 A;  3OYK A;  1NK2 P;  4MLO A;  3BPX A;  3D5R C;  1NG7 A;  2ZSI B;  5FKL A;  4WXD A;  1G3T A;  3F8M A;  3CLO A;  2OCC H;  1T0F A;  5LBQ A;  4DYC A;  1QZY A;  2LP0 A;  2NAZ A;  1VQK I;  4EM0 B;  1J59 A;  3BTJ A;  1ON1 A;  3HRU A;  3OYL A;  3LFK A;  2R4G A;  4BAY A;  3JR9 A;  1IZ1 A;  5A2Q Z;  4A0Y A;  3QRF F;  2FU4 A;  1S8N A;  1SVM A;  3LST A;  4D7N A;  3MKY B;  3ZRG A;  2BXY A;  4KIC A;  4II2 A;  2V1U A;  1X2M A;  2R5Z A;  3LSK A;  1EV7 A;  3W6J B;  1R71 A;  2AQE A;  4AU7 A;  4EGY A;  3ESW B;  3U1D A;  2GQQ A;  1JTY A;  1PYV A;  1MKM A;  1Y6I A;  5K1Y A;  2R7F A;  1IN5 A;  4MGR A;  3VYU B;  4BYY A;  3BR5 A;  1WHU A;  5DS9 A;  1SAU A;  2LNB A;  3LA2 A;  2RAE A;  3CP2 A;  4RGX A;  2K9M A;  2LKP A;  1R5H A;  3OYG A;  2RDP A;  1CGP A;  2V1X A;  3N05 A;  2XPW A;  3D0S A;  3IAM 2;  1U0J A;  3IP4 B;  5E20 A;  3NRV A;  1WJB A;  1R5I D;  1PJR A;  4RGU A;  3LSH A;  2GA2 A;  3V7S A;  1K78 A;  5ILU A;  1YRN A;  4B8X A;  1STZ A;  1Z3X A;  4XKW A;  1QGP A;  2NVX J;  2LTP A;  3HJE A;  3MWM A;  4L9T A;  2N8G A;  3H5A A;  3AFH A;  1FYL A;  3HRT A;  4IHT A;  3W2V A;  4ESF A;  5TRD A;  3CDL A;  4EJV A;  4XM3 A;  2I5U A;  2EH3 A;  4ZYD A;  3OV8 A;  1JUM A;  4ZTF A;  2F4O B;  4A93 J;  1B9N A;  3VEP A;  5J6X A;  5M3F J;  5LEJ A;  2DFF A;  4HX7 A;  2XSD C;  3Q3S A;  2LKS A;  1LEB A;  2A68 F;  4O5V A;  2LYC A;  3S3M A;  1VFC A;  1I3Q J;  1IG7 A;  4QPO A;  1VQ8 I;  4X6A J;  3MQ0 A;  2PJR B;  2RKH A;  1FMV A;  1FX7 A;  3K1M A;  1IC8 A;  2JUG A;  5CKT A;  2BZT A;  2XGD A;  3MCZ A;  3SXY A;  3TW7 A;  4BY1 J;  2L0K A;  4HSR A;  2A5W A;  4M9Z A;  1MIJ A;  3EQL F;  3ZOB A;  2DT6 A;  1Z9C A;  3B6C A;  2EZI A;  3MVP A;  5IT9 Z;  3F72 A;  3DLA A;  2CYY A;  3C2B A;  4A3I J;  1R4N B;  1XG1 A;  1DU0 A;  4IRH A;  3KX2 A;  2WBM A;  3H36 A;  3TL4 X;  5BPD A;  1RRJ A;  3TMO A;  4K2E A;  3HTS B;  5E1X A;  4D9J A;  5J1Y A;  3K2A A;  3ECO A;  4XK4 A;  3BQY A;  4A2U A;  1AKH A;  2DMT A;  2K9L A;  1LDK B;  5EZH A;  5H20 A;  3A4C A;  1SVL A;  4BJ6 C;  3HEF A;  2QLZ A;  3DU6 A;  1FBU A;  1EH6 A;  1ORK A;  1X1A A;  2A61 A;  3I9V 2;  3I4P A;  2WC2 A;  2WWY A;  1MBH A;  1IDY A;  1B6A A;  1ZG3 A;  3A03 A;  5EF6 A;  1SD4 A;  3G6E I;  1JT0 A;  1FTZ A;  3QAH A;  4HQE A;  3HB9 A;  4IXA A;  4RAG A;  5IT3 A;  5KHD A;  1JKQ C;  4G94 A;  2E19 A;  4YIR X;  1NHA A;  4RAF A;  1AOY A;  3B73 A;  1S3J A;  2XAS A;  3UNG C;  1IXS B;  2COB A;  4ENM A;  3EUH C;  5ICE A;  1Z21 A;  3LSP A;  1Y39 A;  4DIQ A;  1IRZ A;  1HF0 A;  3VB2 A;  1SFU A;  4FAS D;  1J2X A;  4NBQ A;  3PUF A;  4OU0 A;  5DUK A;  3S3N A;  4MNU A;  1BJA A;  2ECB A;  3S8P A;  2HVQ A;  1FTT A;  1U8R A;  1ZEL A;  4AVP A;  2E60 A;  3BG3 A;  2JVG A;  3W2A A;  3HIF A;  4E7Z A;  2IRF G;  3HOZ J;  4PJM A;  2ZJP F;  4LD5 A;  5GAD J;  5HNF A;  3OOP A;  4XLE A;  2YSR A;  2LDU A;  1ZAR A;  3WE2 A;  3JAM K;  1ZRC A;  2VKH A;  4G12 A;  4FE7 A;  4HV6 A;  4C9Y A;  3CUQ C;  2DBB A;  4HV5 A;  3CP8 A;  3TKY A;  5LFA A;  3V4G A;  4HX8 A;  4A3L J;  1P4W A;  2BW3 B;  2YX7 A;  4UB6 C;  2IGN A;  3OYM A;  4IKF A;  2MSY A;  4RDU A;  1Z6T A;  4OOI A;  3H3Z A;  1DQU A;  2VC1 A;  3R60 A;  2CQK A;  4XRF A;  2OBP A;  4ZC3 A;  1UFM A;  3CC2 I;  1U5T C;  3S93 A;  4MFE A;  3C7J A;  1IXR C;  3IRQ A;  4ENN A;  3IH2 A;  2DYR H;  1QHG A;  3V7R A;  3BDD A;  2M30 A;  3BZC A;  3K1P A;  5JHU A;  1WJF A;  4M71 A;  2JRM A;  1ZG5 A;  1U5T B;  3G1L A;  5FD5 A;  3ZMS A;  3ZQC A;  2QQ9 A;  3MAJ A;  1LNW A;  3E7L A;  1XX5 A;  3G2B A;  4FET A;  2GM4 A;  3G4S I;  2IGK A;  4EQQ A;  2LKX A;  1S29 A;  2DA2 A;  2YUS A;  3MEX A;  4HZF A;  4I76 A;  5AIQ A;  4I2O A;  1PP7 U;  5C4J J;  4FT8 A;  2CG4 A;  1SAN A;  3AAF A;  5E17 F;  3BRO A;  2HEO A;  4HX4 A;  5E8G A;  2ME6 A;  2VJI A;  2FUG 2;  1HXD A;  2VIX A;  5ILS A;  1WJ5 A;  1PUE E;  1BI3 A;  2MBF A;  2M1B A;  3KP4 A;  4GFB A;  5DYM A;  4ANJ A;  4XLF A;  1OLT A;  4ETS A;  4UUS A;  1JJ6 C;  1BR2 A;  1B4A A;  1TW3 A;  3FHN A;  3CME I;  2IGO A;  3HHH A;  3SFI A;  1H9G A;  2LY2 A;  1XSD A;  4IJA A;  1HA8 A;  2DFE A;  4QWQ A;  3J81 K;  4ZJZ A;  4KIT B;  1BN5 A;  3E3V A;  2XB5 A;  1W5T A;  5ICG A;  1V4R A;  3ULQ B;  2ZO4 A;  2W25 A;  3BG5 A;  3RZD J;  4YIF A;  1I6H J;  4N0B A;  5C44 J;  2R7T A;  3HYI A;  2AXT C;  2TDX A;  3FXO A;  4A69 C;  3WU1 B;  3DV8 A;  2W48 A;  2CFX A;  2GOX B;  5GAG J;  2NNN A;  4LIU A;  2FBI A;  5H6R A;  5GPC A;  4BU2 A;  1WFX A;  4F55 A;  3HPH A;  2P5L C;  3FX3 A;  3ZQQ A;  3K4K A;  3UR3 C;  2JSC A;  2Y31 A;  2P6T A;  4L0Y B;  1LDD A;  2RQQ A;  3F8B A;  2B0L A;  4Y4R A;  4EJO A;  5FLX K;  4NHJ A;  3J7A O;  3E5Q A;  2DMN A;  3QPH A;  4DNC A;  4CGZ A;  1BIB A;  4PSW A;  5M5Y J;  3KEY A;  5C3E J;  1DUX C;  5E1Z B;  2X1E A;  4BHC A;  4CCK A;  3WTS C;  1VQ7 I;  1SFO J;  2M7B A;  1KU2 A;  2E35 A;  3REO A;  1I6X A;  2QCO A;  3RKY A;  3FK7 A;  3ISP A;  1ULY A;  2AO9 A;  2RQP A;  2VAS A;  2ZME C;  3H3U A;  2K3P A;  3GZ6 A;  3ZPL A;  3OIP A;  1JHH A;  2Q1Z B;  1Z7L A;  2M4G A;  2NRA C;  2L7K A;  2M2E A;  4A0X A;  1FOY A;  2XPU A;  4B3X A;  2EFN A;  3AG4 H;  3PFI A;  3BZ6 A;  2ZME B;  4E7J A;  4KFC A;  2ID3 A;  2HXI A;  2HNH A;  4MQ9 F;  3V42 A;  2DMQ A;  1WKM A;  5FFZ A;  4PFO A;  4BBS J;  3GWZ A;  4XLA A;  2MW8 A;  3GFM A;  4BL0 B;  3ZQF A;  1R1U A;  4OWR B;  5AIP A;  4D0P A;  2D5V A;  3WHB A;  2EFW A;  3C3W A;  2DXI A;  3N97 A;  3OYN A;  3GTQ J;  1SFK A;  3PL8 A;  1XGS A;  1SFE A;  1HW2 A;  1CQT A;  4CCM A;  4F92 B;  4AD9 A;  1APL C;  5L3E A;  4CYD A;  3R4K A;  2IP2 A;  1B72 A;  1Z0X A;  3CF2 A;  1KZH A;  3S2H J;  4BXF A;  1PUF B;  1R23 A;  4N9H A;  2HQR A;  4L5E A;  2UWM A;  2KL4 A;  2EV0 A;  4ZDL A;  1H9T A;  3IWF A;  1WH5 A;  1MJA A;  2YPR A;  1H8A C;  2VOD A;  3HOV J;  1O3T A;  4N9I A;  2KFD A;  2V7F A;  1YW7 A;  5C4X J;  4D5F A;  2HYF A;  4A3K J;  2LF7 A;  2XAU A;  3BZK A;  4ZTJ A;  5EG0 B;  2RVC A;  2IJL A;  1S72 I;  5D6E A;  2Q8K A;  3AL0 C;  1XTA A;  2X6W A;  3Q0V A;  1DP7 P;  4ZYE A;  1XSV A;  2CH0 A;  2LY1 A;  1T0F C;  5D5X B;  3ZMU A;  4DGW B;  4BXX J;  2VL8 A;  1ZHF A;  5GTH C;  4OIQ F;  4L18 B;  3FDY A;  2X4H A;  1WVR A;  3AL0 B;  4XOP A;  2JA7 J;  5F08 A;  1LKX A;  5IT9 K;  2QVO A;  4LIV A;  3LSI A;  1IN6 A;  4CZZ A;  1DDN A;  2QQ8 A;  1IW7 F;  3ML6 A;  2CO5 A;  2DO7 A;  5TGT A;  3S2D J;  1O57 A;  1J0R A;  2BW3 A;  1FYM A;  2KIU A;  5E3L A;  2JTV A;  3BCA A;  1IGN A;  4GGG A;  4KMU X;  3KZY A;  2A69 F;  2DJI A;  1FP2 A;  1LPQ A;  5K7H A;  3E5X A;  5B3S H;  4XLN F;  2LD5 A;  3WTZ A;  1YIJ I;  3GTK J;  2M4K A;  1TQP A;  1BOA A;  1A04 A;  3BWG A;  2L02 A;  3U21 A;  1O4X A;  2EFO A;  3HUG A;  2I10 A;  5EYR A;  3IKT A;  3LAP A;  1UHM A;  1J75 A;  5K5R A;  1RUO A;  2KMU A;  2OTL I;  5ERI A;  3DPT A;  1D5V A;  1R1T A;  2W1O A;  2L9N A;  1ETY A;  2P5V A;  4MTE A;  1FBS A;  3H3V K;  1E3H A;  1TWH J;  1QNT A;  2DOD A;  2GAU A;  2PBI A;  3VYT B;  4B44 A;  2V6C A;  3C2G A;  3HRS A;  1V54 H;  3ASO H;  4II3 A;  3KP6 A;  1MD0 A;  3CDH A;  3HSE A;  2K85 A;  3G3Z A;  1IN7 A;  3Q0U A;  3SJM A;  4G8X A;  3LSR A;  3DU5 A;  1K78 B;  5KAF C;  4E7I A;  3IHU A;  4EMS A;  1Q1H A;  1ODD A;  1FPQ A;  5L3C A;  1YI2 I;  2BY3 A;  5LLQ A;  3LAJ A;  2VT2 A;  2EV5 A;  3GTL J;  3NAR A;  4B1R A;  4E7S A;  4BY7 J;  4IHY A;  3KEO A;  3IKV A;  3ABU A;  1N75 A;  1Q1V A;  1ENH A;  4NUB A;  2KKO A;  5J4V A;  1W1W E;  1S7E A;  1F43 A;  1R00 A;  4MO7 A;  3FMS A;  1OYI A;  3L09 A;  2R5Y B;  1WSU A;  2JMW A;  3OS0 A;  1EKE A;  4CHU A;  1MMS A;  1R7J A;  5CYV A;  3V8K A;  3TQN A;  1IXC A;  2X6Y A;  4J00 A;  5IP9 J;  2FBK A;  2MH2 A;  2F5F A;  3WU2 C;  4LB5 A;  1DPU A;  4PUS A;  5CVJ A;  4ON0 A;  3H0D A;  4XNF A;  3SDG A;  2P7V B;  4EJT A;  1D1B A;  2M8E A;  1ON2 A;  3SQN A;  5GTI C;  1QPI A;  3FKJ A;  5HLI A;  2MD0 A;  4JP0 A;  3QU6 A;  2BOL A;  1ZGA A;  1W5C C;  2ZFU A;  3RIR A;  4KUM A;  2XHK A;  1RNL A;  1RKW A;  2DA5 A;  2Z2S B;  4C2T A;  2NXN B;  3B02 A;  3FIS A;  4C2U A;  4KYW A;  3JAM Z;  2QGU A;  3AKZ A;  1X1D A;  4I02 A;  4DYR A;  2NOJ B;  5H2F C;  1W0T A;  1NH3 A;  4GDF A;  4B48 A;  3RQ4 A;  1TW2 A;  1I1S A;  1P7I A;  4M72 A;  4WXH A;  1Z05 A;  3K9T A;  5FFX A;  3BJA A;  4GCV A;  4RM2 A;  4RB1 A;  2DOE A;  1UG2 A;  4KA4 A;  3PO2 J;  1RR7 A;  2AS5 F;  2OAZ A;  5GAH J;  4PJN A;  1DU6 A;  1UB9 A;  4HST A;  1V3F A;  2FBH A;  2HDW A;  3VWB A;  1ZK8 A;  4JOM A;  2BVL A;  5F1R A;  1EF4 A;  3BR2 A;  5ICC A;  2R93 J;  5IY5 H;  1G2H A;  1AHD P;  4U0W A;  1P4X A;  4I99 C;  4A3J J;  2V1N A;  2CRG A;  3H5R A;  4RB0 A;  1I3A A;  3FXM A;  2OCE A;  4BDY A;  4NC6 A;  3WGH A;  2VBX A;  2K40 A;  2LOO A;  3F23 A;  3PUB A;  1H89 C;  1YS6 A;  4XON A;  1AA7 A;  3HSF A;  2FXA A;  2D45 A;  1R6R A;  4HYE A;  1MW7 A;  4RM3 A;  3DKW A;  1JT6 A;  2ECC A;  5HLH A;  3BTI A;  3K6G A;  1GV2 A;  1F1Z A;  1HKQ A;  3U9G A;  1QVU A;  2ACJ A;  1RC9 A;  2CUF A;  2M0M A;  2HQN A;  3JRI A;  2LSO A;  3M8F A;  1PUF A;  3KZZ A;  5JFR A;  2DOF A;  2W4S A;  3GLX A;  3JTH A;  4XBF A;  1IN8 A;  4M73 A;  1LEA A;  4FX0 A;  3U2R A;  4ENK A;  2IS6 A;  3S15 J;  2WAE A;  4IEJ A;  5FRM A;  3GFI A;  3EDP A;  1BA5 A;  3HXL A;  2VJ4 A;  2BXZ A;  3TO9 A;  4AVZ A;  4A3G J;  1IRG A;  2VKE A;  3J81 Z;  2E1N A;  2GA1 A;  2IT0 A;  5BMZ A;  1C0W A;  5DTD A;  1X19 A;  5J8C A;  1PP8 F;  1TT5 B;  1OMI A;  2CV0 A;  4ZZD A;  1MBG A;  3I54 A;  5J4Y A;  1MND A;  1T95 A;  4DOZ A;  4FTH A;  3FHZ A;  3WG9 A;  1HC8 A;  5DCM B;  5AON A;  3DTK A;  3KZI C;  1TP4 A;  3MMY B;  1FWZ A;  2JRT A;  1FSE A;  4Q4Z F;  3R6S A;  4ZDO A;  2VBY A;  1FYK A;  2BEO A;  4MIM A;  4LK0 F;  3F6V A;  3TW6 A;  2HXO A;  1ZKG A;  3IUO A;  3CO6 C;  5LRS A;  4RB2 C;  1I39 A;  3TDU C;  1SMT A;  5FLX Z;  2QZ8 A;  1MNE A;  4PFP A;  2L54 A;  5BNG A;  2G7U A;  1K79 A;  2CV2 A;  3HOT A;  2O5R A;  1IV8 A;  4LLG F;  4HPQ A;  3FMR A;  1HLV A;  1SC7 A;  1IV6 A;  3CJT B;  3JRC A;  1MH4 A;  2HTJ A;  2BY1 A;  3GTP J;  3S17 J;  4UY8 I;  3ZGK A;  4BGD A;  1T33 A;  4UUS B;  2H09 A;  1Z1D A;  4XRS G;  4RA2 A;  3IH3 A;  1Z77 A;  4L9V A;  3L1P A;  4UHT A;  1J7K A;  3A0B C;  1YG2 A;  2EFP A;  2YU9 J;  3H1C A;  4AIK A;  3C1D A;  1R4M B;  3K4B A;  4A5N A;  1IF1 A;  1XMK A;  3DTI A;  4EJW A;  1EH7 A;  1UG0 A;  2JPB A;  4Y13 A;  2FX0 A;  2H94 A;  1HW1 A;  3PJR A;  2ZXH A;  1ETV A;  4U88 A;  3W3C A;  3I56 I;  3ABK H;  3BC8 A;  1LVK A;  3RI4 A;  3HKZ A;  4KT5 C;  3DEW A;  4PSX A;  4JQF A;  2QQB A;  1V5E A;  3DBR B;  5IYC J;  2DQR A;  2WA0 A;  5BS6 A;  4BUP A;  2IA2 A;  4XRS A;  1N25 A;  1QA6 A;  2O7O A;  4EEF G;  1VQO I;  2XAH A;  1QRY A;  1ETO A;  2KIM A;  2Y69 H;  4AYB N;  5JR3 A;  5D8K B;  1GVD A;  3CQZ J;  3NQO A;  4OAZ A;  2R5Y A;  2M3A A;  5D5U B;  1SD7 A;  2IVM A;  1XMX A;  4XLH A;  2V4J C;  3QQA A;  1HDD C;  4LIT A;  2KIS A;  1D1A A;  1TQI A;  2Z16 A;  3PNY A;  3ECH A;  3HRM A;  1D3Y A;  1WJA A;  4KJZ A;  5J40 A;  2CV1 A;  5LHI A;  3PM1 A;  4KIG A;  2OC6 A;  5DV5 A;  4M6X A;  1LJ9 A;  1KQ9 A;  1T98 A;  3H0G J;  3CCQ I;  2WB1 N;  2LBF B;  3EUK L;  1ZQ3 P;  2X6O A;  1TT0 A;  2E71 A;  2HOS A;  1BBY A;  4F91 B;  3K10 A;  3OYH A;  1SD5 A;  4D7M A;  4GRI A;  3LL7 A;  1QZE A;  1E17 A;  2CQX A;  4CCN A;  3HGY A;  3CLQ A;  5HDK A;  3KP7 A;  2LRD A;  5ILV A;  3HBL A;  2R7S A;  5FJ8 J;  3CCJ I;  3E6M A;  2EIJ H;  4D1Q A;  1TNT A;  2VE8 A;  4DZP A;  5EDN A;  2KRC A;  2ZXI A;  1B72 B;  2QUF A;  3KLN A;  1FC3 A;  1FOX A;  3CO7 C;  3GVA A;  4IZZ A;  3BG7 A;  4M3E A;  3OYD A;  3OYJ A;  3H35 A;  1ZR4 A;  2UXX A;  3IRR A;  3E5U A;  3C2H A;  2HDC A;  2V26 A;  5F64 A;  3OYA A;  4HLX A;  2DTZ A;  1YFH A;  1YE9 A;  1SVO A;  4P9U A;  2PI0 A;  3CJN A;  1WWX A;  1MMN A;  3DTE A;  2RN7 A;  1VND A;  1ZRD A;  1Z91 A;  2YS9 A;  2EA4 A;  2GIV A;  2WAQ A;  2CQN A;  3CTA A;  2MLG A;  2CSO A;  4M6V A;  5ICF A;  3FBI B;  5CJ9 A;  3WTW C;  2Y30 A;  1W7P D;  3KLO A;  2ZNY A;  4M74 A;  3OS1 A;  2D2W A;  2KZG A;  3ZMV A;  4UUV A;  2E1M B;  3WG7 H;  3KIO A;  1WJE A;  2PMZ A;  2R7D A;  4HG2 A;  4EM1 A;  3RZO J;  4N4O B;  4AIJ A;  2XRO A;  4TV7 A;  3CMY A;  2QBY A;  4XMY A;  3O6B B;  2L9S A;  3BQZ A;  1Z7U A;  3M4O J;  3JRF A;  2EA2 A;  4XSX F;  1KA8 A;  3DBL B;  1X58 A;  2Y48 A;  1K83 J;  3H92 A;  5JVT A;  4JX4 A;  3GO5 A;  3K1N A;  5IPA A;  1WZ2 A;  3NWS A;  4OIN F;  1B8I A;  1QPM A;  4XIC A;  4BE2 A;  1JTX A;  2VQH A;  5CPR B;  2QSG X;  2H6C A;  3A02 A;  1FBQ A;  3LSM A;  1RZ4 A;  4A3E J;  3I59 B;  1XPX A;  2EFQ A;  2F4M B;  4XL9 A;  4C3H J;  1W7P B;  2W85 A;  3F0C A;  5DCM A;  2STT A;  4XOR A;  4U87 A;  3JRB A;  1TL8 A;  1KYZ A;  2OUM A;  3FXQ A;  3PSI A;  3HUG B;  4BKX A;  2DK8 A;  2PEX A;  1G4D A;  3OYB A;  1DGW Y;  2HKO A;  2E7W A;  3RSN A;  2L5Q A;  2Y2Z A;  4G7O F;  3WU0 A;  2IGM A;  5CVI A;  3ERE D;  4DYQ A;  3QYB A;  3OY9 A;  4U0V A;  4FCY A;  2IW5 A;  1H88 C;  1TWA J;  5F6F A;  2CUJ A;  2NVQ J;  4BQN A;  4IHX A;  2XAQ A;  4LG3 A;  5EEH A;  2VE9 A;  4R79 A;  1BI0 A;  4G9Y A;  4E7L A;  2E7X A;  2KDO A;  2FEZ A;  4CDG A;  5HS9 A;  4M3G A;  1TC3 C;  2F48 A;  2E5Z A;  3F3X A;  3QYE A;  3CMA I;  5LHG A;  2ZNZ A;  1VTN C;  2P8T A;  2ELH A;  2VUM J;  4RAZ A;  1LE8 A;  1G3S A;  2Y0S A;  4JYK A;  3H9Q A;  3VPR A;  5LGU A;  2WAF A;  4B3A A;  3BP8 A;  1X3U A;  4Y7N J;  2HQA A;  1QZZ A;  4R1H A;  3GLL A;  1F5T A;  2TRT A;  2KJC A;  2UUZ A;  1Y8R B;  3HGG A;  5F0H A;  4BE1 A;  2QA4 I;  4ASN A;  3ZQI A;  2OJE D;  3K4J A;  9ANT A;  2VBW A;  5B66 C;  1TLH B;  2L2O A;  4M3F A;  3IC7 A;  3S1R J;  2ADU A;  2K4J A;  2PX9 A;  2IA1 A;  3ERM A;  3PQK A;  3KE2 A;  2M45 A;  4FE4 A;  2DQL A;  2HTS A;  4MEX F;  3QP6 A;  3KPH A;  1V55 H;  2V79 A;  1AU7 A;  1RET A;  4Q48 A;  2AQF A;  5F0C A;  1T08 B;  4IHW A;  4M3B A;  4BHP A;  1OKR A;  4RGR A;  4AID A;  5D8L B;  1BR1 A;  5M5X J;  3VSL A;  2HOE A;  3OL3 A;  3BJ6 A;  4UV8 A;  4V19 K;  3OR1 C;  3PNT A;  3GBG A;  3BT9 A;  2DFI A;  2LY9 A;  4EV0 A;  4XRM A;  2XAG A;  3F22 A;  1JE8 A;  1ZLK A;  4IL6 C;  4M6Y A;  1WI3 A;  3ABL H;  4WX9 A;  3M3Y J;  3ZP5 A;  1REP C;  3QPL A;  2OQR A;  2VXD A;  2XAJ A;  2OZU A;  3I58 A;  1OCP A;  2ZC2 A;  4W97 A;  2VXZ A;  4GYI A;  1TWF J;  2LC2 A;  3SFZ A;  3RPU A;  1S7O A;  4BHB A;  3CCU I;  3I3L A;  1LQ1 A;  5M5W J;  2ID6 A;  1FY7 A;  3ROU A;  5F0F A;  2HYG D;  4YFK F;  3OMY A;  1LFP A;  4IRG A;  2KRH A;  3OIQ A;  2KPM A;  4L9J A;  4MHG A;  2EZL A;  2R7Z J;  2BGC A;  1NG6 A;  1YHQ I;  3K4M A;  1HSJ A;  5LRR A;  2HYJ A;  1HDP A;  1P4A A;  2LBF A;  2EZK A;  4F93 B;  2WTE A;  4R8H A;  4Y17 A;  1CF7 A;  2XF7 A;  3WE3 A;  5EZG A;  2OPT A;  1UJ8 A;  2E5N A;  4BAC A;  1FZP B;  2DJN A;  3G1M A;  1I5Z A;  2VKD A;  2DTR A;  1MBK A;  2IXS A;  2KHM A;  3L2Q A;  4Z2Y A;  4BS9 A;  2A05 A;  2M0C A;  2MYS A;  3I0T A;  5IP7 J;  3FMQ A;  3JRA A;  2NS0 A;  1DPR A;  3L2U A;  2BHZ A;  2K9Q A;  1U78 A;  4JBA A;  1K4S A;  3DLL F;  5JI6 A;  4I7H A;  4BJT A;  2EBI A;  2VB6 A;  3MKZ A;  1U6G A;  4Y15 A;  4CIC A;  3CCY A;  2PQ8 A;  2L7Z A;  3KCC A;  2KRF A;  1G59 A;  1JUS A;  3BTC A;  3CJR B;  2ZXJ A;  2E1O A;  3H9J A;  1D1C A;  3QOE A;  2LK2 A;  5EJC A;  3WGG A;  2OQG A;  2O61 A;  4LK1 F;  3BR6 A;  1U8B A;  4HBL A;  1Y0U A;  1UHW A;  1M1E B;  4NB5 A;  2X9D A;  3W6V A;  4P5O A;  1YS7 A;  1XSX A;  2NS7 A;  5F27 A;  4XSZ F;  4IX7 A;  2F6C A;  2FD5 A;  1RES A;  3QP5 A;  3W2W A;  1YJ9 I;  1UAA A;  4P9F A;  4WWC A;  1FOK A;  2QQA A;  3F8N A;  4BEH B;  4KMF A;  2DU9 A;  2A3S A;  3FK6 A;  1VQ4 I;  1ZRF A;  2M7A A;  2ESH A;  3LQQ A;  1GXQ A;  5TJJ A;  4ZZL A;  3LMM A;  5LHH A;  1VQL I;  3RCO A;  2E2I J;  1X3W B;  2AXL A;  2KJB A;  3BOQ A;  2XF6 A;  1R58 A;  1XGO A;  1MJB A;  2DLL A;  1QO0 D;  3Q0W A;  3K70 D;  1S5L C;  3P9K A;  1J9I A;  4WCG A;  4HRI A;  2KP6 A;  2DA1 A;  2KT0 A;  1LUJ B;  3VYS B;  5K5O A;  1YJW I;  2JQ7 A;  4AM3 A;  3I59 A;  5JVG F;  3FWE A;  3ZN1 A;  2DDA A;  3K7A J;  5DD4 A;  3C18 A;  3EUA A;  1Y1V J;  1IJW C;  1W7P A;  4WF2 A;  2MH9 A;  2JA8 J;  3WTX C;  4G7Z F;  4RB3 C;  4KIB A;  1GLN A;  4V2F A;  4C30 A;  3VFZ A;  3QU3 A;  1Y56 A;  1R49 A;  1JJ8 C;  4YG2 F;  2CW0 F;  1ZH5 A;  2STW A;  2V9P A;  4IOA F;  5BOX A;  3HTU A;  1W5S A;  2K02 A;  2CGP A;  1YIT I;  4O6J A;  4RLQ A;  2UV1 A;  3GX4 X;  1FIP A;  3CF5 F;  1ZGW A;  2HVS A;  1E0E A;  2XKO A;  4OIO F;  1OFC X;  3CC7 I;  3EPZ A;  4O3M A;  4I98 B;  2B63 J;  3TO6 A;  4L5J A;  5IOZ A;  2QSH X;  1SMY F;  2HKX A;  1USS A;  3OYC A;  2FA5 A;  5FKK A;  2HVR A;  1ETW A;  4PGH A;  3RKW A;  4IQJ A;  4UVB A;  5K5Q A;  3A1Y A;  1WRJ A;  4PJJ A;  1K7A A;  3R0A A;  3G73 A;  3GFJ A;  4E7H A;  3GEZ A;  2QYO A;  3DCF A;  3ELK A;  1VZ0 A;  2KIQ A;  2DA4 A;  5KNL A;  3J7Z I;  1S9H A;  1LFB A;  1S7A A;  1LDJ A;  5DCF A;  3TGN A;  1IUF A;  1D0X A;  4A6D A;  4IVN A;  1DGR M;  1GDT A;  1OCO H;  2Q0O A;  3PO3 J;  2K7L A;  3T8R A;  1FLI A;  4HLY A;  2P6S A;  5D4S A;  1P7J A;  5EGO A;  1H0M A;  3DKX A;  3QWL A;  1SEU A;  3TOB A;  1U9O A;  1OQY A;  1R5G A;  1BW6 A;  4M3D A;  4U0Y A;  1IN4 A;  1QQI A;  2EJR A;  4HW0 A;  3O8G A;  3JSP A;  1UMQ A;  2ZSH B;  3HOY J;  3F8C A;  4IHS A;  4XLP F;  3CCL I;  5JLX A;  2O6G E;  2KLO A;  3ZCO A;  3S32 A;  3P5J A;  1G8X A;  4HNV A;  1D5Y A;  2GLO A;  3SZG A;  4KT6 A;  3K4N A;  4EVI A;  1FSH A;  1WGX A;  3CUO A;  2JA6 J;  2V6E A;  1K61 A;  3JRH A;  2A6T A;  2F5D A;  3TO7 A;  2V9V A;  4HOB A;  3HPG A;  3E6C C;  3K4C A;  2CQQ A;  3BY6 A;  4BQO A;  1TNS A;  2BY0 A;  5BPI A;  4YII A;  1BW5 A;  4OMZ A;  3BCB A;  1GXP A;  5D5V B;  3GTO J;  3DPU A;  4A3B J;  3OYE A;  1IRF A;  2VBZ A;  1FEX A;  3BTL A;  3QYF A;  1X2N A;  2KDZ A;  4CA0 A;  3V7C A;  3Q5F A;  2DOA A;  3SZT A;  4P55 A;  2ZXW H;  1VQM I;  4QPQ A;  1P2F A;  3LFU A;  3I71 A;  4FQG A;  2W00 A;  4ITV A;  4AIH A;  1R9T J;  5KAI C;  1ITY A;  4NQW A;  4DQ2 A;  5HOO A;  4XLC A;  1OCT C;  2R0Q C;  1BC7 C;  1ZG1 A;  5L3G A;  4RGS A;  2ZJ2 A;  4BDZ A;  1T39 A;  2FOK A;  2MD5 A;  4Q47 A;  2FMY A;  5HOD A;  4CYC A;  3OS2 A;  2Y9Y A;  4ZH4 F;  2DT5 A;  2KIF A;  2TCT A;  3V8J A;  5D5W B;  4IHV A;  3JTG A;  1LVA A;  1S6L A;  5J1U A;  3SEQ A;  3A01 B;  3RKX A;  2FE3 A;  4OAY A;  3COA C;  2H8W A;  2OU2 A;  1YQA A;  3FBN B;  3J7A Y;  2HR3 A;  2QBY B;  3JRG A;  3CD6 I;  2FQ4 A;  1R1V A;  3PFY A;  1E2X A;  3LSJ A;  2PMH A;  1MSF C;  2L7M P;  5CQG A;  2MAB A;  3BR0 A;  4QLC U;  2IA0 A;  1OCZ H;  3S3O A;  1E3P A;  1XS9 A;  4OMY A;  3JW4 A;  4YFN F;  2H1K A;  4Y33 A;  1OR7 A;  1B8I B;  1YX3 A;  5KCM A;  1MBE A;  2DFH A;  2OD5 A;  1MMD A;  4AUX A;  1RUN A;  4XKV A;  2Y75 A;  1FT9 A;  5J8F A;  2Y0M A;  1YX5 A;  5CVV A;  2ZB9 A;  1J09 A;  3KEQ A;  5L3F A;  4BEH A;  2RC4 A;  3E97 A;  3HSR A;  1JI8 A;  2HPM A;  1RPW A;  2RNJ A;  3M07 A;  4IRI A;  1FP1 D;  4HDV A;  3L9F A;  5HLG A;  4FIS A;  4F7Z A;  2CS3 A;  2COM A;  2JJ7 A;  3H9G A;  4IF4 A;  3FXU A;  3GZ5 A;  4A3F J;  2ZCW A;  1XCV A;  1G6N A;  1T8I A;  5DUI A;  2MA3 A;  4I09 A;  4LG0 A;  3ZR8 X;  2M9H A;  4L0Z B;  4LJZ F;  2LLK A;  3MFK A;  3DWL E;  1BC8 C;  2ELJ A;  1NK3 P;  4D5C A;  3HG9 A;  2DW4 A;  3ZQH A;  4YEL A;  1F36 A;  2XRN A;  1KU3 A;  1GT0 C;  4CH7 A;  1LE8 B;  2LF8 A;  4NDL A;  2K9N A;  2FSW A;  2MFZ A;  1BR4 A;  2XVC A;  3DKY A;  4ZDP A;  3HOW J;  2L4M A;  1WPK A;  1RKT A;  2W7N A;  3SEZ A;  2PJP A;  1WCM J;  2XF5 A;  2H6B A;  1Z6R A;  2XUB A;  3T5X A;  4B09 A;  1IDZ A;  3RQI A;  3J7Y J;  3ZN0 A;  1DP3 A;  1YW9 A;  2MGQ A;  1W4M A;  3MZH A;  1B59 A;  2FNA A;  3HOU J;  1A5J A;  2XIG A;  2VQG A;  3RPU D;  3L00 A;  3NWT A;  1JKP C;  2DK5 A;  2OV7 A;  2HOA A;  3BLY A;  2XC7 A;  5ED4 A;  3LWF A;  1TBX A;  2JT1 A;  2CJJ A;  2DA6 A;  3BR1 A;  5GPA A;  5JLW A;  2XSJ C;  3L2V A;  1G3Y A;  4RLF A;  3LA7 A;  3CDI A;  4DW6 A;  1F9N A;  2D1H A;  2O9L A;  5HS8 A;  4KNY A;  1OPC A;  4XN3 A;  4CCO A;  2ZFW A;  3WTY C;  3G71 I;  1BIA A;  3S16 J;  2R7V A;  2F5E A;  1MDM B;  4IPA A;  3HDD A;  2DA3 A;  1HCR A;  1O7L A;  2M8G X;  3RPQ A;  2XAF A;  4YRV A;  4PZJ A; 
#chains in the Genus database with same CATH homology
 2UXN A;  1O3Q A;  1KGS A;  2YU3 A;  2QM3 A;  2D1V A;  3RDI A;  2Z9O A;  1HKT A;  1ONV A;  2XKP A;  4MTD A;  3P9C A;  4FHT A;  5CVU A;  2K27 A;  4FX4 A;  3T8T A;  1B9M A;  2VT3 A;  4UXN A;  3LA3 A;  4A6E A;  3QPT A;  2JPC A;  5DEQ A;  1CF7 B;  1MGT A;  1P6R A;  1O3R A;  2G9W A;  2G7H A;  1XN7 A;  3P9I A;  3SZP A;  2M5W A;  5KK1 A;  3ZQ7 A;  5DDG A;  5E18 F;  2ZBK A;  1WQ2 A;  2EWN A;  3KP2 A;  4KN4 X;  3RYP A;  3DFG A;  3DEU A;  2NYX A;  2Z5U A;  5HVQ C;  2RV8 A;  1LB2 A;  1J5Y A;  2PFB A;  3K2Z A;  1IAW A;  3EYI A;  4CO8 A;  3ZMD A;  1BI2 A;  2VON A;  5E8I A;  1KQ8 A;  2GXG A;  3GUD A;  4GO1 A;  5CLS A;  3JSO A;  3SHF A;  1OYY A;  3EYY A;  3WOD F;  1HW5 A;  3K69 A;  1XD7 A;  4KN7 X;  3GYH X;  5LGN A;  4LLL A;  1ZLJ A;  5CVR A;  2HZT A;  2HGC A;  1GHC A;  1UCR A;  1FNN A;  4ZYG A;  1RI7 A;  4UV9 A;  4HA8 A;  3RTR A;  3R0J A;  3HHG A;  2BYV E;  2O0Y A;  1WI9 A;  2DPU A;  5EEG A;  4HF2 A;  1ZRE A;  3HOS A;  4E70 A;  5FD6 A;  4UNO A;  2QWW A;  2HWV A;  4GYG A;  3EET A;  3TOA A;  1XCB A;  2BBY A;  4BXU A;  3DXJ F;  4LGW A;  1PDN C;  3CUQ B;  5KVR A;  3GXO A;  1SAX A;  2A6H F;  3TDZ C;  1RIO H;  4WK8 F;  5L3D A;  2OA4 A;  4CXF A;  3BPV A;  2Z3Y A;  3E6B A;  3M9A A;  2FRH A;  2X0L A;  1ZGJ A;  2DPD A;  3DQV C;  4M9S A;  3KFW X;  4Q5S F;  2ETH A;  4G6Q A;  4HQM A;  1T2K A;  1D8K A;  2L01 A;  2Z33 A;  2F5C A;  1P92 A;  3J80 K;  2BE5 F;  4EM2 A;  2VC0 A;  3F21 A;  4LB6 B;  1MDM A;  1K6O A;  3L7W A;  5FGM A;  1XMA A;  2ISZ A;  1U3E M;  1KYW A;  4KDP A;  4LLN A;  3LQR A;  3GW2 A;  2RGV A;  3F6O A;  5H6Q A;  1QBJ A;  3W6K B;  2CWE A;  2FQ3 A;  5A2Q K;  2K4B A;  2DAO A;  3D5L A;  5LEK A;  3DPL C;  3MZY A;  4HAM A;  4A0Z A;  1HKS A;  2VOO A;  3WGI A;  3ZMT A;  1KU7 A;  3KP5 A;  4BNC A;  4I0B A;  4ZYH A;  2PLY A;  1HBX G;  4UVA A;  1XDU A;  3I53 A;  1XGM A;  1YYV A;  2V1D A;  2EV6 A;  2P7C B;  4U7B A;  4UVC A;  3FM3 A;  3GFL A;  3S2W A;  4S04 A;  2YX4 A;  2A6E F;  1YLF A;  3NEU A;  4MQV A;  4BQA A;  3V8L A;  4I01 A;  3M8E A;  2MC3 A;  1BI1 A;  2FF4 A;  2Z99 A;  3RYR A;  4PDK A;  2O3F A;  4H0E A;  4KIF A;  4L5I A;  5HDG A;  2NNY A;  3GF2 A;  2F2E A;  2QEN A;  1I27 A;  1KU9 A;  3ZMZ A;  4ESJ A;  5E1W A;  4P96 A;  2GWR A;  1R36 A;  2L4A A;  3K0L A;  4MEY F;  4OIR F;  3DF8 A;  5FB2 A;  3M7G A;  1MJ9 A;  1U2W A;  2K86 A;  4BH9 A;  4LG0 B;  2C6Y A;  1SD6 A;  3EUH A;  1B1B A;  2J5O A;  4HF1 A;  3VOD A;  2A5Y B;  4PCQ A;  6PAX A;  1YW8 A;  2O03 A;  4RS8 A;  3L2C A;  2GZW A;  4PGG A;  5D6F A;  1ZN2 A;  3WTU C;  1JHF A;  4GXO A;  1YO5 C;  3R61 A;  1XGN A;  3CUQ A;  2ESN A;  4EJU A;  2FML A;  5BQT A;  1HST A;  3T0Y A;  1YTY A;  4LFU A;  1R22 A;  3IWZ A;  1ZAO A;  5L3B A;  3KET A;  2BV6 A;  2J5P A;  1U5T A;  2UZK A;  2VN2 A;  1MZB A;  3I5U A;  1XB4 A;  2OZ6 A;  3O3K A;  1HQC A;  3T1B A;  1F4K A;  2O8X A;  1UST A;  2M87 A;  3I64 A;  1SFX A;  3Q9S A;  4HF0 A;  2FNP A;  3VOE A;  2W57 A;  4HDU A;  4A12 A;  3QOP A;  1O7F A;  5DD8 A;  3WTT C;  1EH8 A;  4OIP F;  3M1E A;  2PN6 A;  4LMY A;  4JK1 X;  3O2P E;  1G3W A;  3F8F A;  3FZV A;  2ISY A;  4ESB A;  2A07 F;  2PG4 A;  2WV0 A;  5LGT A;  1BM9 A;  4S05 A;  2HS5 A;  2VOP A;  3IL2 A;  2Q2E A;  5HDN A;  1YIO A;  3Q9V A;  3N4M A;  1T6S A;  1TQM A;  1AWC A;  3ABT A;  1ZYR F;  2W84 A;  4A5M A;  3FF5 A;  2GXB A;  1T38 A;  2MLK A;  1L0O C;  1JGS A;  2IPQ X;  4I0A A;  2E1C A;  1KQ0 A;  2XV4 S;  3RJP A;  1GVJ A;  2YR2 A;  1I1G A;  4ENJ A;  2XGX A;  1TTY A;  2L3D A;  3FM5 A;  4EGZ A;  4YFX F;  2P4W A;  5HS7 A;  4RAY A;  2HFH A;  3P7N A;  2DI3 A;  2W24 A;  2EB7 A;  2PMU A;  2ZKZ A;  2ZME A;  3DP7 A;  2H27 A;  4AWX B;  3BJO A;  4M9X A;  5D4R A;  1O3S A;  3WTV C;  4G7H F;  1XDS A;  2EK5 A;  3E6D A;  3FXR A;  1D8J A;  4G6D A;  1IUY A;  4L9N A;  3PQJ A;  5FO5 A;  3J80 Z;  4WXC A;  4U7D A;  2P5K A;  3KP3 A;  1JXS A;  1L3L A;  2JZY A;  1OYW A;  2R3S A;  3BPX A;  4WXD A;  1G3T A;  3F8M A;  3CLO A;  1T0F A;  5LBQ A;  1QZY A;  2NAZ A;  4EM0 B;  1J59 A;  1ON1 A;  3HRU A;  3LFK A;  4BAY A;  1IZ1 A;  5A2Q Z;  4A0Y A;  3QRF F;  2FU4 A;  1S8N A;  3LST A;  4KIC A;  2V1U A;  3W6J B;  1EV7 A;  4EGY A;  3U1D A;  2GQQ A;  1MKM A;  5K1Y A;  2R7F A;  1IN5 A;  4MGR A;  4BYY A;  2LNB A;  3LA2 A;  4RGX A;  2LKP A;  1R5H A;  2RDP A;  1CGP A;  2V1X A;  3D0S A;  5E20 A;  3NRV A;  4RGU A;  2GA2 A;  3V7S A;  1K78 A;  5ILU A;  4B8X A;  1STZ A;  1QGP A;  4L9T A;  3MWM A;  1FYL A;  3HRT A;  4IHT A;  4ESF A;  5TRD A;  4EJV A;  4ZYD A;  3OV8 A;  1B9N A;  3VEP A;  5J6X A;  5LEJ A;  4HX7 A;  1LEB A;  2A68 F;  4O5V A;  3MQ0 A;  2RKH A;  1FX7 A;  3K1M A;  3SXY A;  3MCZ A;  4M9Z A;  3EQL F;  1Z9C A;  5IT9 Z;  3F72 A;  2CYY A;  4IRH A;  5BPD A;  4K2E A;  3HTS B;  5E1X A;  3ECO A;  4A2U A;  1LDK B;  5H20 A;  2QLZ A;  1FBU A;  1EH6 A;  2A61 A;  3I4P A;  2WC2 A;  2WWY A;  1ZG3 A;  1B6A A;  1SD4 A;  3QAH A;  4HQE A;  5IT3 A;  4IXA A;  4G94 A;  1NHA A;  1AOY A;  1S3J A;  2XAS A;  3B73 A;  1IXS B;  4ENM A;  5ICE A;  3VB2 A;  1SFU A;  1J2X A;  4OU0 A;  5DUK A;  4MNU A;  1BJA A;  1U8R A;  4AVP A;  3HIF A;  2IRF G;  4LD5 A;  3OOP A;  2YSR A;  2LDU A;  1ZAR A;  3WE2 A;  3JAM K;  1ZRC A;  4HV6 A;  3CUQ C;  2DBB A;  4HV5 A;  3TKY A;  3V4G A;  4HX8 A;  1P4W A;  2YX7 A;  1Z6T A;  4OOI A;  3H3Z A;  2VC1 A;  3R60 A;  2CQK A;  4XRF A;  2OBP A;  1UFM A;  1U5T C;  3C7J A;  1IXR C;  3IRQ A;  4ENN A;  3V7R A;  3BDD A;  2M30 A;  3K1P A;  5JHU A;  4M71 A;  1ZG5 A;  1U5T B;  5FD5 A;  3ZMS A;  2QQ9 A;  3MAJ A;  1LNW A;  4EQQ A;  1S29 A;  4HZF A;  3MEX A;  5AIQ A;  4I2O A;  1PP7 U;  4FT8 A;  2CG4 A;  5E17 F;  3AAF A;  3BRO A;  2HEO A;  4HX4 A;  5E8G A;  1PUE E;  1HXD A;  5ILS A;  1BI3 A;  2MBF A;  2M1B A;  3KP4 A;  5DYM A;  4ETS A;  1B4A A;  1TW3 A;  3HHH A;  1H9G A;  1XSD A;  4IJA A;  4QWQ A;  3J81 K;  1BN5 A;  3E3V A;  1W5T A;  5ICG A;  1V4R A;  3ULQ B;  2ZO4 A;  2W25 A;  4YIF A;  4N0B A;  3HYI A;  2TDX A;  3WU1 B;  3DV8 A;  2CFX A;  2NNN A;  2FBI A;  5H6R A;  2P5L C;  3FX3 A;  2JSC A;  2P6T A;  4L0Y B;  1LDD A;  3F8B A;  2B0L A;  4EJO A;  5FLX K;  4NHJ A;  3J7A O;  3E5Q A;  3QPH A;  4DNC A;  4CGZ A;  1BIB A;  1DUX C;  5E1Z B;  4BHC A;  3WTS C;  1KU2 A;  3REO A;  1I6X A;  3RKY A;  3ISP A;  1ULY A;  2RQP A;  3H3U A;  3GZ6 A;  3ZPL A;  1JHH A;  2NRA C;  4A0X A;  2EFN A;  3PFI A;  3BZ6 A;  2ZME B;  4KFC A;  4MQ9 F;  1WKM A;  5FFZ A;  3GWZ A;  3GFM A;  1R1U A;  5AIP A;  4D0P A;  2EFW A;  3C3W A;  3N97 A;  1XGS A;  1SFE A;  1HW2 A;  4AD9 A;  5L3E A;  4CYD A;  3R4K A;  2IP2 A;  1R23 A;  4N9H A;  2HQR A;  2UWM A;  2EV0 A;  1H9T A;  3IWF A;  1MJA A;  2YPR A;  2VOD A;  1O3T A;  4N9I A;  1YW7 A;  2HYF A;  2LF7 A;  2RVC A;  2IJL A;  5D6E A;  2Q8K A;  1DP7 P;  4ZYE A;  1XSV A;  5D5X B;  3ZMU A;  1ZHF A;  4OIQ F;  4L18 B;  2X4H A;  5IT9 K;  2QVO A;  1IN6 A;  4CZZ A;  1DDN A;  1IW7 F;  3ML6 A;  2CO5 A;  2DO7 A;  1O57 A;  1J0R A;  1FYM A;  2KIU A;  2JTV A;  4GGG A;  4KMU X;  3KZY A;  2A69 F;  1FP2 A;  3E5X A;  4XLN F;  3WTZ A;  1TQP A;  1BOA A;  1A04 A;  3BWG A;  2L02 A;  2EFO A;  3HUG A;  3IKT A;  3LAP A;  1UHM A;  1J75 A;  5K5R A;  1RUO A;  5ERI A;  3DPT A;  1D5V A;  1R1T A;  2P5V A;  4MTE A;  1FBS A;  2GAU A;  1QNT A;  2PBI A;  2V6C A;  3HRS A;  3KP6 A;  1MD0 A;  3CDH A;  3HSE A;  3G3Z A;  1IN7 A;  4G8X A;  1K78 B;  3IHU A;  4EMS A;  1Q1H A;  1ODD A;  1FPQ A;  5L3C A;  5LLQ A;  3LAJ A;  2VT2 A;  2EV5 A;  3KEO A;  3IKV A;  3ABU A;  2KKO A;  1R00 A;  3FMS A;  1OYI A;  3L09 A;  1WSU A;  4CHU A;  1R7J A;  5CYV A;  3V8K A;  3TQN A;  1IXC A;  2FBK A;  2MH2 A;  2F5F A;  4LB5 A;  1DPU A;  5CVJ A;  4ON0 A;  2P7V B;  4EJT A;  2M8E A;  1ON2 A;  3SQN A;  5HLI A;  3QU6 A;  1ZGA A;  3RIR A;  4KUM A;  2XHK A;  1RNL A;  3B02 A;  4KYW A;  3JAM Z;  4I02 A;  1TW2 A;  1I1S A;  4M72 A;  4WXH A;  1Z05 A;  3K9T A;  5FFX A;  3BJA A;  4GCV A;  4RB1 A;  4KA4 A;  2AS5 F;  2OAZ A;  1UB9 A;  1V3F A;  2FBH A;  5F1R A;  5ICC A;  4U0W A;  1P4X A;  4RB0 A;  3WGH A;  2VBX A;  3F23 A;  1YS6 A;  3HSF A;  2FXA A;  2D45 A;  4HYE A;  3DKW A;  5HLH A;  3U9G A;  2ACJ A;  1F1Z A;  1HKQ A;  2HQN A;  2LSO A;  3M8F A;  3KZZ A;  5JFR A;  3GLX A;  3JTH A;  4XBF A;  1IN8 A;  4M73 A;  1LEA A;  4FX0 A;  3U2R A;  4ENK A;  3GFI A;  3EDP A;  3TO9 A;  1IRG A;  3J81 Z;  2E1N A;  2GA1 A;  2IT0 A;  5BMZ A;  1C0W A;  5J8C A;  1PP8 F;  1OMI A;  4ZZD A;  3I54 A;  3FHZ A;  3WG9 A;  5DCM B;  5AON A;  1FWZ A;  2JRT A;  1FSE A;  4Q4Z F;  3R6S A;  2VBY A;  1FYK A;  2BEO A;  4LK0 F;  3F6V A;  3CO6 C;  5LRS A;  4RB2 C;  3TDU C;  1SMT A;  5FLX Z;  2QZ8 A;  2L54 A;  2G7U A;  1K79 A;  3HOT A;  4LLG F;  3FMR A;  2HTJ A;  2H09 A;  1Z1D A;  4L9V A;  4UHT A;  1J7K A;  1YG2 A;  2EFP A;  4AIK A;  3C1D A;  4A5N A;  1IF1 A;  1XMK A;  4EJW A;  1EH7 A;  2JPB A;  4Y13 A;  2H94 A;  1HW1 A;  4U88 A;  3RI4 A;  4KT5 C;  4JQF A;  2QQB A;  2DQR A;  5BS6 A;  2IA2 A;  2XAH A;  2KIM A;  5JR3 A;  5D8K B;  3NQO A;  5D5U B;  1SD7 A;  2IVM A;  1TQI A;  3ECH A;  3HRM A;  1D3Y A;  5LHI A;  4KIG A;  5DV5 A;  4M6X A;  1LJ9 A;  1KQ9 A;  1T98 A;  1BBY A;  1SD5 A;  1E17 A;  5HDK A;  3KP7 A;  5ILV A;  3E6M A;  1TNT A;  2VE8 A;  3KLN A;  2QUF A;  1FC3 A;  3CO7 C;  3GVA A;  2UXX A;  3IRR A;  3E5U A;  2HDC A;  5F64 A;  4HLX A;  1YFH A;  4P9U A;  2PI0 A;  3CJN A;  1WWX A;  2RN7 A;  1ZRD A;  1Z91 A;  2EA4 A;  2GIV A;  3CTA A;  2MLG A;  2CSO A;  5ICF A;  5CJ9 A;  3WTW C;  1W7P D;  3KLO A;  2ZNY A;  4M74 A;  2D2W A;  3ZMV A;  4UUV A;  2R7D A;  4EM1 A;  4AIJ A;  2XRO A;  4TV7 A;  2QBY A;  3O6B B;  1Z7U A;  2EA2 A;  4XSX F;  1KA8 A;  2Y48 A;  3H92 A;  5JVT A;  3GO5 A;  3K1N A;  4OIN F;  1QPM A;  2H6C A;  1FBQ A;  1RZ4 A;  3I59 B;  2EFQ A;  1W7P B;  2W85 A;  5DCM A;  2STT A;  1KYZ A;  3FXQ A;  2DK8 A;  2PEX A;  1G4D A;  2HKO A;  2E7W A;  4G7O F;  3ERE D;  3WU0 A;  5CVI A;  4U0V A;  2IW5 A;  5F6F A;  2XAQ A;  5EEH A;  2VE9 A;  4R79 A;  1BI0 A;  4G9Y A;  2E7X A;  2FEZ A;  4CDG A;  5HS9 A;  3F3X A;  5LHG A;  2ZNZ A;  1VTN C;  2P8T A;  2ELH A;  4RAZ A;  1G3S A;  5LGU A;  3BP8 A;  1X3U A;  1QZZ A;  4R1H A;  1F5T A;  2KJC A;  4ASN A;  2VBW A;  1TLH B;  3IC7 A;  2ADU A;  2K4J A;  2IA1 A;  3PQK A;  3KE2 A;  2M45 A;  2DQL A;  2HTS A;  4MEX F;  3QP6 A;  2V79 A;  4Q48 A;  4BHP A;  1OKR A;  4RGR A;  5D8L B;  2HOE A;  3BJ6 A;  4UV8 A;  2DFI A;  4EV0 A;  3F22 A;  2XAG A;  1JE8 A;  1ZLK A;  4M6Y A;  4WX9 A;  3ZP5 A;  1REP C;  2OQR A;  2XAJ A;  2OZU A;  3I58 A;  2VXZ A;  4GYI A;  3SFZ A;  3RPU A;  1S7O A;  4BHB A;  1LQ1 A;  3ROU A;  1FY7 A;  2HYG D;  4YFK F;  4IRG A;  4L9J A;  4MHG A;  2BGC A;  1HSJ A;  5LRR A;  1P4A A;  2WTE A;  4R8H A;  4Y17 A;  1CF7 A;  3WE3 A;  1FZP B;  1I5Z A;  2DTR A;  4Z2Y A;  3I0T A;  3FMQ A;  2NS0 A;  1DPR A;  1U78 A;  4JBA A;  5JI6 A;  4I7H A;  1U6G A;  4Y15 A;  4CIC A;  2PQ8 A;  3KCC A;  2KRF A;  2ZXJ A;  3WGG A;  2OQG A;  2O61 A;  4LK1 F;  4HBL A;  1Y0U A;  1UHW A;  4NB5 A;  4P5O A;  1YS7 A;  1XSX A;  4XSZ F;  3QP5 A;  4P9F A;  4WWC A;  1FOK A;  2QQA A;  3F8N A;  4KMF A;  2DU9 A;  2A3S A;  1ZRF A;  2ESH A;  3LQQ A;  1GXQ A;  5TJJ A;  4ZZL A;  5LHH A;  2AXL A;  2KJB A;  3BOQ A;  1R58 A;  1XGO A;  1MJB A;  2DLL A;  1QO0 D;  3P9K A;  1J9I A;  4WCG A;  5K5O A;  3I59 A;  3FWE A;  3ZN1 A;  5DD4 A;  3C18 A;  1W7P A;  4WF2 A;  2MH9 A;  3WTX C;  4G7Z F;  4RB3 C;  4KIB A;  3VFZ A;  3QU3 A;  4YG2 F;  2CW0 F;  1ZH5 A;  2STW A;  5BOX A;  3HTU A;  1W5S A;  2K02 A;  2CGP A;  4O6J A;  3GX4 X;  2XKO A;  4OIO F;  4O3M A;  4I98 B;  3TO6 A;  4L5J A;  1SMY F;  2HKX A;  1USS A;  2FA5 A;  4PGH A;  3RKW A;  4UVB A;  5K5Q A;  1WRJ A;  1K7A A;  3R0A A;  3G73 A;  3GFJ A;  3GEZ A;  2QYO A;  3ELK A;  1S7A A;  1LDJ A;  5DCF A;  3TGN A;  4A6D A;  4IVN A;  2Q0O A;  2K7L A;  3T8R A;  1FLI A;  4HLY A;  2P6S A;  5D4S A;  1H0M A;  3TOB A;  1R5G A;  4U0Y A;  3JSP A;  1IN4 A;  1QQI A;  2EJR A;  4HW0 A;  3F8C A;  4IHS A;  4XLP F;  2O6G E;  4EVI A;  1FSH A;  3CUO A;  2F5D A;  3TO7 A;  2V9V A;  4HOB A;  3E6C C;  3BY6 A;  1TNS A;  5BPI A;  4YII A;  4OMZ A;  1GXP A;  5D5V B;  1IRF A;  2VBZ A;  3V7C A;  3Q5F A;  3SZT A;  4P55 A;  1P2F A;  3I71 A;  4AIH A;  4NQW A;  4DQ2 A;  5HOO A;  1BC7 C;  1ZG1 A;  5L3G A;  4RGS A;  2ZJ2 A;  1T39 A;  2FOK A;  2MD5 A;  4Q47 A;  2FMY A;  4ZH4 F;  2DT5 A;  2KIF A;  3V8J A;  5D5W B;  3JTG A;  1LVA A;  1S6L A;  3RKX A;  2FE3 A;  3COA C;  2OU2 A;  1YQA A;  2HR3 A;  2QBY B;  1R1V A;  1E2X A;  2PMH A;  4QLC U;  2IA0 A;  4OMY A;  3JW4 A;  4YFN F;  1OR7 A;  2OD5 A;  1RUN A;  2Y75 A;  1FT9 A;  5J8F A;  2Y0M A;  5CVV A;  3KEQ A;  5L3F A;  2RC4 A;  3E97 A;  3HSR A;  2RNJ A;  4IRI A;  1FP1 D;  4HDV A;  3L9F A;  5HLG A;  4F7Z A;  2COM A;  4IF4 A;  3FXU A;  3GZ5 A;  2ZCW A;  1XCV A;  1G6N A;  5DUI A;  2MA3 A;  4I09 A;  4LG0 A;  4L0Z B;  4LJZ F;  3MFK A;  1BC8 C;  2DW4 A;  2XRN A;  1KU3 A;  2LF8 A;  2FSW A;  2XVC A;  2L4M A;  2PJP A;  2H6B A;  1Z6R A;  2XUB A;  3T5X A;  4B09 A;  3ZN0 A;  1YW9 A;  1W4M A;  3MZH A;  1B59 A;  2FNA A;  2XIG A;  3L00 A;  2DK5 A;  5ED4 A;  3LWF A;  1TBX A;  2JT1 A;  1G3Y A;  3LA7 A;  1F9N A;  2D1H A;  5HS8 A;  4KNY A;  1OPC A;  2ZFW A;  3WTY C;  1BIA A;  2F5E A;  1MDM B;  4IPA A;  1O7L A;  3RPQ A;  2XAF A;  4PZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...