1V4RA

Solution structure of streptmycal repressor trar
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Streptmycal repressor TraR
rcsb
source organism Streptomyces
molecule tags Gene regulation
molecule keywords Transcriptional Repressor
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1v4rA01
2L4MA 1XMAA 1JHHA 1ZYRF 3TDZC 1L0OC 3ML6A 4HX7A 4A6DA 1O3RA 4KIGA 1GXQA 3JAMZ 4M9SA 3QPHA 4WXHA 2Z3YA 2QM3A 4KICA 3PFIA 4CICA 1USSA 5ICGA 4LB6B 3FHZA 1YTYA 1B1BA 2P7CB 4RGRA 1OYYA 5FLXZ 4L9JA 1O3SA 1QNTA 1J2XA 3M8EA 1O3QA 3Q5FA 3T8TA 5D8LB 4RGUA 1TW2A 3CUQB 4IVNA 2OQGA 1FSEA 1IAWA 1KQ0A 1IRFA 3VEPA 2LF7A 3C7JA 1ZAOA 1KU3A 5CVVA 2HYFA 1LVAA 2JSCA 3F8NA 1KGSA 2A5YB 2RC4A 4PCQA 4ESFA 2M87A 2XROA 3ISPA 4GYGA 1QZYA 4KT5C 3KP2A 3FXRA 2A6HF 3HHGA 2A68F 2WV0A 4EJWA 1Y0UA 4DQ2A 3GZ6A 2LKPA 1G3YA 1V3FA 1BJAA 1WWXA 3I71A 3I0TA 4L0ZB 4A5NA 1MGTA 1UFMA 2MH2A 4KN7X 4FX4A 5D6FA 4ZYEA 1ZLKA 1SD5A 1I6XA 5DCMA 5FO5A 1U2WA 4ENJA 2CYYA 2FRHA 2MC3A 1IN8A 5E8IA 3T0YA 2Z33A 4GYIA 3J81K 3DXJF 5CVRA 3PQJA 4NHJA 3P7NA 3FXQA 3WTYC 5JI6A 4U88A 2KIFA 5D5UB 2QQAA 2ZMEA 1RUOA 3M8FA 4ZYDA 2DK8A 3BDDA 2XAJA 5E1ZB 5ICCA 3M1EA 4R8HA 2P5LC 3S2WA 4K2EA 1FBUA 3E6MA 4PZJA 1BIBA 2JTVA 3KFWX 2ISYA 1IF1A 2HEOA 1ODDA 1Z05A 4ENKA 1YG2A 4I09A 4HLXA 4G7OF 5H20A 3BROA 2VBXA 1FX7A 2ZO4A 3FM3A 3BP8A 2RNJA 2C6YA 5BPDA 3KE2A 2QENA 2IA1A 2CGPA 5E1WA 2IVMA 5KK1A 4N9HA 2V1XA 2QWWA 3V8JA 4I01A 2L3DA 5FFZA 1GXPA 4EV0A 1D8JA 2PN6A 3HUGA 3M7GA 2R7DA 4H0EA 2M5WA 3G3ZA 3R4KA 1JE8A 5DYMA 4GGGA 4JQFA 3RKYA 1XSDA 2MLKA 4MHGA 2CW0F 3IRRA 4L18B 2LDUA 1SFXA 3LAJA 1Z6RA 1OYIA 1A04A 3F8CA 1XSVA 1KA8A 3IRQA 1YW8A 3WTSC 2X0LA 4OMYA 4M74A 2ZBKA 4EMSA 4ASNA 4CDGA 1MKMA 1SFUA 5IT9K 4HW0A 2FMYA 1YYVA 2K7LA 3DV8A 3HRSA 1P4AA 1HSJA 5FGMA 2V79A 1BM9A 2EA4A 2M30A 3TDUC 3AAFA 4EQQA 2QUFA 3RDIA 2Y0MA 2ESHA 2ZKZA 2EFNA 3EETA 4O3MA 2WC2A 4P55A 5BMZA 2ZNZA 3RYPA 1YS7A 2JZYA 1Z91A 3KETA 3KP3A 1B9MA 5A2QZ 5LGTA 2MLGA 3WE2A 4GXOA 1RI7A 5LEJA 1BOAA 2EWNA 4AVPA 3F23A 2IPQX 4LG0A 1G6NA 4OINF 1BI3A 3DQVC 2DLLA 1R00A 4RS8A 2ZCWA 1I1SA 1JHFA 1D5VA 2W85A 2M1BA 4B8XA 3MZHA 4BAYA 3RTRA 2Q2EA 4IRGA 2UZKA 4KUMA 2VONA 2JPBA 2NRAC 2PI0A 5JR3A 1OKRA 3DKWA 1DP7P 4LK1F 4D0PA 5DCFA 3MFKA 1P4WA 4WWCA 1SD7A 2K86A 2OAZA 5HS7A 1J59A 4BH9A 4HDVA 3FX3A 4P96A 5D5VB 3BJOA 4KYWA 2FXAA 1TNSA 2LNBA 1IXCA 3J81Z 4Y13A 3ABTA 1ZREA 4RB3C 1IN5A 1QO0D 5K5OA 2XRNA 1P6RA 1YO5C 1FNNA 1I1GA 5J8CA 2CO5A 1XGNA 4OOIA 2HQRA 1TBXA 5E20A 3REOA 1ZRDA 2HQNA 1KU7A 2QYOA 3K2ZA 3VFZA 3KP4A 3IWFA 4PGGA 1Z1DA 3RPQA 2O03A 1YLFA 2MD5A 1KU2A 1NHAA 3DPLC 3F72A 5H6QA 1KU9A 3FMRA 1BIAA 3F6VA 1RIOH 4HQMA 1W5SA 4M73A 3F8MA 1MJBA 1TLHB 5L3DA 1IN7A 2NYXA 5AONA 2PBIA 4P9FA 3HRTA 3R60A 2DW4A 1GVJA 2XAHA 3TGNA 3V7CA 2BV6A 1RUNA 4UUVA 2DO7A 3L00A 3WODF 5FD6A 4UHTA 3CO7C 2EA2A 4OIOF 4KA4A 2RDPA 3HSFA 4CYDA 5L3GA 5DUIA 3K0LA 1LEAA 2P6TA 3ZMDA 3MZYA 3JTHA 2F5FA 1TNTA 2O0YA 2B0LA 3FZVA 1YW9A 5HS8A 1XDUA 3FXUA 2HKOA 4XSXF 1FT9A 5TJJA 1R23A 3CO6C 1HQCA 3EDPA 2A6EF 2D2WA 5F1RA 4UVAA 1LJ9A 3JAMK 2A61A 1U3EM 2FBKA 2QQ9A 2AS5F 4ESBA 3BOQA 4BNCA 3ECHA 4RB1A 3BJAA 2WWYA 2DK5A 4G94A 4EM0B 4LLLA 4LLGF 3BY6A 5L3EA 3O6BB 4HZFA 2F2EA 5BS6A 4M71A 2FEZA 3I59B 1YQAA 5E8GA 1U8RA 2XAFA 1ZARA 1WI9A 1REPC 1SD4A 3WTXC 3E5UA 1RNLA 5HDKA 3CJNA 2Q8KA 4RB2C 2JT1A 1X3UA 3MEXA 2YSRA 3W6JB 2WTEA 2UXNA 2YR2A 4BYYA 5FB2A 3WTVC 2J5OA 1UHWA 2ELHA 3ZN0A 2DI3A 5K1YA 2XGXA 1S7AA 3WTWC 3QU6A 5HOOA 4MEXF 4JK1X 1FBQA 4UNOA 3NEUA 5LGNA 4ETSA 1T39A 2QQBA 4HAMA 1EH7A 4G6QA 4L9NA 4Q4ZF 3ZQ7A 4LK0F 2H27A 3U9GA 4BHPA 1KYZA 4I0BA 3COAC 1J7KA 1K79A 1USTA 4O6JA 3GFLA 5H6RA 2ISZA 3IC7A 3ULQB 4ESJA 4P9UA 5D4SA 3V8LA 3RI4A 4KN4X 1T98A 1S8NA 1WKMA 2QVOA 5DD8A 2K4BA 1ZRFA 3I53A 4BXUA 3CUQA 2Y75A 4OMZA 1YS6A 3OOPA 5BQTA 2O8XA 2RGVA 4MTDA 4Q47A 1HKTA 1FSHA 4IPAA 1K7AA 3IL2A 3NQOA 1T6SA 1BC8C 2ZJ2A 5AIPA 4FX0A 1ZN2A 1ZG1A 3MAJA 1H9TA 5LGUA 3C3WA 1XSXA 2EV6A 3MWMA 1ON2A 1MDMB 5ILVA 4U0VA 3RJPA 4BHCA 2HYGD 3HOTA 3HRUA 2Q0OA 2RVCA 4S05A 2RQPA 3LSTA 4U7BA 1IN6A 4ENNA 4KDPA 4EM2A 3WGIA 1BI1A 2DBBA 2XASA 3TO9A 4UVCA 3CUOA 2M45A 2W25A 1VTNC 1K78A 4N0BA 1QPMA 1F4KA 4P5OA 2HWVA 4U0WA 4KMFA 1UHMA 1XCVA 2IA2A 3LFKA 4RB0A 3CLOA 1TTYA 1O3TA 2H6CA 2BE5F 2EFQA 2F5DA 2FA5A 5TRDA 3BPXA 3F22A 4KFCA 1J5YA 1P4XA 4O5VA 2P7VB 3BJ6A 3GVAA 4LJZF 2OBPA 2E7XA 2OQRA 4N9IA 2HDCA 2ACJA 1FZPB 3K9TA 1W7PB 1XD7A 5FLXK 1FYMA 3ZMTA 4LGWA 1PUEE 3K1PA 3R61A 4CZZA 2CSOA 5CVUA 2XIGA 4LG0B 1W4MA 2V6CA 1T2KA 5D6EA 1Z6TA 4G7HF 1EH8A 2KIMA 1S3JA 3DFGA 4R1HA 2HFHA 3IHUA 2VBYA 4RGSA 1LB2A 4LB5A 2FF4A 2OA4A 1QZZA 2FNPA 5D8KB 5LBQA 3I4PA 5ILSA 2VE9A 3KEOA 1PP8F 2O61A 1IRGA 3ROUA 3ZN1A 2ADUA 1HKQA 2KJBA 2VOOA 3ZP5A 1ZRCA 2CQKA 2YPRA 2P5KA 3KP5A 1I5ZA 3QU3A 3QAHA 1ZGAA 1K78B 1DDNA 1OYWA 5EEGA 4G6DA 2R7FA 1IZ1A 3VODA 1SAXA 3EYYA 3JSOA 2D1VA 3IWZA 4A5MA 3U2RA 2PMUA 2EJRA 4YFKF 2D1HA 2NS0A 2QBYA 3VB2A 1H0MA 2E1NA 3GUDA 4YFNF 3ERED 3HHHA 3SXYA 5HLHA 2CFXA 4A2UA 4WX9A 5J6XA 3C18A 1FY7A 1JGSA 3HTUA 5HDGA 2DAOA 2EK5A 4M72A 3SHFA 1J9IA 5JFRA 1LNWA 5A2QK 4HDUA 2PMHA 5ED4A 1P2FA 3R0AA 3ZMSA 4OIPF 4CO8A 3OV8A 2GIVA 3BWGA 3WU0A 3J80K 4RAYA 1FP1D 2ETHA 3E3VA 4IF4A 4HX8A 5ICEA 3TO7A 3GFJA 6PAXA 1XCBA 1YIOA 4RAZA 3GFMA 2HKXA 1KQ8A 2COMA 3H3UA 3TKYA 3GYHX 3HSEA 1MD0A 4HQEA 3N97A 3MQ0A 1S7OA 1WQ2A 2K4JA 4Z2YA 4I98B 4XLPF 1H9GA 1EH6A 2XV4S 2IP2A 2VXZA 2STWA 3JSPA 4L9VA 1ZG5A 3L7WA 1SMTA 3TOBA 1HSTA 4R79A 1HBXG 3ELKA 4CGZA 2VOPA 4MQVA 2KKOA 3I54A 1WSUA 2PG4A 2QLZA 2EV5A 2XAGA 4WF2A 3GEZA 2IT0A 4ZZLA 5JHUA 1YW7A 4BHBA 3I5UA 4M6XA 3WTUC 1BN5A 2HGCA 4AIHA 1ONVA 1EV7A 2M8EA 2CWEA 2L01A 4M9ZA 2JPCA 4OIQF 1PDNC 1UCRA 1XN7A 4LD5A 2MH9A 2GAUA 4AWXB 4NB5A 1HXDA 4EJOA 3D0SA 3GW2A 3L2CA 3SZPA 3V8KA 2DU9A 5HLIA 3WE3A 4I02A 3QPTA 2Z5UA 4UV8A 4M6YA 1OMIA 1UB9A 2XVCA 3O2PE 2GA2A 4HV6A 2RN7A 5CYVA 1SMYF 2VBZA 4Y17A 3CTAA 1O7FA 3RPUA 2VT2A 1KYWA 2XAQA 5CLSA 3H92A 3HRMA 3RIRA 1IN4A 4ZH4F 5DCMB 1ON1A 4Q48A 1ZH5A 5DDGA 2KJCA 3E6DA 3SZTA 2H6BA 1ZGJA 5DD4A 1L3LA 3N4MA 2JRTA 2XUBA 1J75A 3LWFA 1G3SA 2BEOA 5LEKA 1Q1HA 3KLOA 4MGRA 4OU0A 3BPVA 3W6KB 4IHSA 2H94A 1SD6A 2DTRA 5HS9A 2PLYA 1LDDA 1LDKB 4QLCU 4IXAA 4HF2A 2DPDA 3KZYA 2W57A 2O6GE 2MBFA 2BYVE 1OPCA 3MCZA 4HF0A 4TV7A 1C0WA 4G9YA 3F3XA 5IT3A 4ON0A 2VC0A 5F64A 1U5TB 4B09A 5IT9Z 1AOYA 1BC7C 2V1UA 3GO5A 1F5TA 3R6SA 2E1CA 1TQPA 3WGGA 4A0YA 4AD9A 5J8FA 3H3ZA 2RV8A 2HZTA 3T1BA 1FLIA 5HLGA 3I59A 1W7PA 3WGHA 2EB7A 5LHGA 1CF7B 2X4HA 1DUXC 2P8TA 5D5XB 1K6OA 3SFZA 2AXLA 5FD5A 3CUQC 5DUKA 3LAPA 3LA7A 1IW7F 2VT3A 4HLYA 4YIIA 2IA0A 2FOKA 2NNNA 3V7RA 1BI2A 5E18F 4WXCA 1XDSA 5KVRA 1FP2A 1MJ9A 5LHHA 1HW1A 1R5HA 2IRFG 2DFIA 2GXGA 1KQ9A 1U6GA 2H09A 1B59A 4KMUX 4AIJA 2P4WA 4JBAA 4YFXF 3E97A 1V4RA 1B6AA 1XMKA 3FWEA 3TQNA 2VE8A 5D4RA 1U5TC 5BOXA 2P6SA 2PFBA 1R1UA 1LQ1A 4CXFA 3DEUA 2A69F 2V9VA 4LLNA 1R22A 3FF5A 5D5WB 2XKPA 3JTGA 1Z7UA 5LHIA 3FM5A 5ERIA 4EJVA 1Z9CA 1B4AA 3P9KA 2YU3A 1R58A 4EM1A 2A3SA 2FSWA 4IRHA 3J7AO 2W24A 1D8KA 3E6BA 2VN2A 4MEYF 2DPUA 4GO1A 3FMSA 4HA8A 1CF7A 1FC3A 3K69A 1MZBA 4IJAA 3F6OA 2BGCA 1R1VA 2F5EA 2NNYA 3B73A 1D3YA 2G7HA 2OZ6A 5DV5A 2R3SA 4HBLA 4HOBA 4LMYA 3LA2A 3GX4X 1MJAA 4L0YB 1U78A 1R1TA 3M9AA 3T8RA 2EFOA 2L02A 2KIUA 1T0FA 3DP7A 1O7LA 4G7ZF 1GHCA 1R5GA 3P9IA 3LQQA 2IJLA 1XGMA 5E17F 2K02A 4HYEA 5LRRA 5K5RA 3F8FA 2O3FA 2ZFWA 4DNCA 4I2OA 4A12A 2FU4A 4YIFA 2Y48A 5HVQC 1O57A 4XBFA 4WK8F 2OU2A 2VODA 3WTZA 5L3BA 1PP7U 3LA3A 3E5QA 1SFEA 4ZYHA 1TQIA 3IKVA 3Q9VA 3K1NA 1E17A 2FBIA 4U0YA 3WG9A 4AIKA 1QGPA 2LF8A 5HDNA 1S6LA 3RYRA 4BQAA 1P92A 3GWZA 1FOKA 4L5JA 3J80Z 5JVTA 1BI0A 1E2XA 2CG4A 4EJTA 1FWZA 3RKWA 3VOEA 2EFPA 4G8XA 1TW3A 2P5VA 3E6CC 4L5IA 4EJUA 3ECOA 1T38A 4XLNF 2HTJA 5BPIA 1YFHA 2OZUA 4EVIA 3B02A 5L3FA 2UWMA 2XHKA 2VC1A 3KCCA 3ZMVA 2IW5A 1J0RA 3CDHA 2LSOA 1XGOA 4L9TA 4IRIA 4MTEA 4HF1A 2ZXJA 5AIQA 3D5LA 4U7DA 3SQNA 3C1DA 1G3TA 3HSRA 1WRJA 1TQMA 3EQLF 3L9FA 2TDXA 3GLXA 3T5XA 3TO6A 5FFXA 1XB4A 1LEBA 2DQLA 4XRFA 3HIFA 1BBYA 4OIRF 3QRFF 4EGYA 2V1DA 3RKXA 3F21A 2STTA 3LQRA 2ZMEB 1ZLJA 3BZ6A 1G4DA 4KNYA 4I7HA 4A0ZA 2Z99A 5LLQA 4M9XA 5DEQA 2HS5A 2GQQA 1IXSB 3G73A 1G3WA 4PGHA 2ESNA 2W84A 2PEXA 3I64A 2EFWA 2HTSA 3KLNA 5LRSA 5F6FA 1DPRA 2NAZA 2Z9OA 4KIFA 3ABUA 1DPUA 4Y15A 2FBHA 3IKTA 3ZMUA 1IUYA 1LDJA 2PQ8A 4MNUA 1JXSA 3R0JA 3HTSB 2QBYB 3GZ5A 4I0AA 1R7JA 3JW4A 4FT8A 3E5XA 3KEQA 2GZWA 4HX4A 2A07F 2MA3A 4MQ9F 3GXOA 3F8BA 2J5PA 4XSZF 3DPTA 3ZPLA 3FMQA 2D45A 2FE3A 3KP6A 3NRVA 2G7UA 4RGXA 4ZZDA 1ULYA 1IXRC 1FPQA 4GCVA 1STZA 2E7WA 3EYIA 1S29A 3QP5A 3KZZA 4CHUA 3Q9SA 3V4GA 1F1ZA 2XKOA 1HKSA 4QWQA 2DQRA 3QOPA 4LFUA 1CGPA 4E70A 3EUHA 2YX4A 4UXNA 1RZ4A 3U1DA 3GF2A 3O3KA 4HV5A 2OD5A 1U5TA 5K5QA 4IHTA 3P9CA 2KRFA 2GA1A 4EGZA 2DT5A 1HW5A 2QZ8A 1XGSA 2VBWA 1W5TA 2GWRA 4A0XA 2UXXA 2F5CA 2FMLA 2L4AA 3HYIA 5L3CA 5CJ9A 4YG2F 4Q5SF 2FNAA 1FBSA 4PDKA 3WU1B 2EV0A 4WCGA 4UV9A 5ICFA 1R36A 3TOAA 3PQKA 5CVJA 1FYLA 5CVIA 3L09A 2HOEA 1MDMA 4F7ZA 1W7PD 3I58A 4UVBA 4FHTA 4S04A 2FQ3A 1QQIA 3DF8A 3HOSA 4ZYGA 1ZHFA 2BBYA 5E1XA 2RKHA 1F9NA 3ZMZA 4WXDA 2L54A 3GFIA 4A6EA 2GXBA 1FYKA 1AWCA 1ZG3A 1QBJA 2ZNYA 4KIBA 3WTTC 2YX7A 2PJPA 2K27A 3QP6A 4ENMA 5EEHA 1B9NA 1OR7A 3V7SA 4NQWA 2G9WA 1I27A 2HR3A 3KP7A 5ILUA 3K1MA 1HW2A
chains in the Genus database with same CATH superfamily
2K9NA 2L4MA 2LY9A 1XMAA 1JHHA 1JI8A 1ZYRF 2ZMEC 3TDZC 3N05A 2R0QC 1L0OC 4FQGA 2KRCA 2EPFA 2NVQJ 1T0FC 3W2AA 3ML6A 4HX7A 4A6DA 1O3RA 3BG5A 3NWSA 2Z16A 1R5ID 4KIGA 1GXQA 3S2DJ 3VSKA 3JAMZ 4M9SA 3QPHA 4WXHA 2VL8A 3F0CA 2Z3YA 1K4TA 2DXIA 2HI3A 3L2RA 2DDBA 4A3FJ 2QM3A 4CSWA 4KICA 3PFIA 4CICA 1USSA 5ICGA 4LB6B 4CCOA 2HDDA 4C3HJ 3FHZA 1DGRM 1RR7A 1NK3P 5CQGA 2YU9J 1YTYA 1B1BA 2P7CB 4RGRA 1OYYA 2E34A 5FLXZ 4L9JA 2KLOA 3ONQA 2WAQN 1O3SA 3G71I 1QNTA 1J2XA 3M8EA 5EG0B 1O3QA 3Q5FA 1AKHA 2LRDA 4M3FA 3T8TA 3LNQA 5D8LB 4RGUA 4ANJA 1TW2A 1MH4A 3CUQB 4NBQA 2XB0X 1X4OA 4CCJA 3BT9A 3MKWB 4IVNA 2OQGA 4S0HB 1FSEA 1IAWA 2GIZA 1KQ0A 2YS9A 1IRFA 3KYDB 2DMPA 3VEPA 2LF7A 3C7JA 1ZAOA 1KU3A 2P0WA 1K83J 1LVKA 2CMPA 3BLYA 5CVVA 2HYFA 1LVAA 2K3FA 5EF6A 2JSCA 2Y0SA 5K7HA 3S93A 3F8NA 1KGSA 2F4MB 2A5YB 2RC4A 3CJRB 4PCQA 2CW8A 2COBA 4ESFA 2M87A 4AC0A 2XROA 3ISPA 4GYGA 1OCOH 1W0UA 1QZYA 3S1NJ 1Z3XA 4KT5C 1Y1WJ 3KP2A 3CC2I 1Z21A 3DBRB 1X1DA 3FXRA 3HB9A 2A6HF 5KNLA 1QZEA 2A68F 2WV0A 3HHGA 2NOJB 2VIXA 3GTQJ 4EJWA 1SVLA 1I39A 1Y0UA 2E1MC 2V9KA 3B6AA 5DS9A 2W82A 4DQ2A 2XGEA 3GZ6A 1QPIA 2LKPA 5M5YJ 1X2MA 1G3YA 1V3FA 3RPUD 1BJAA 1UG0A 2HOSA 3CCJI 4E7ZA 5FROA 1FTZA 1WWXA 1ETKA 3I71A 3HPHA 3I0TA 5DM7F 4L0ZB 2DMQA 4A5NA 1MGTA 1UFMA 1FOWA 3OYDA 5IYBJ 2MH2A 1NTCA 4KN7X 4FX4A 5D6FA 2HVRA 1LUJB 2K85A 2BHYA 4ZYEA 1ZLKA 4PFOA 3CDLA 1SD5A 1I6XA 2BY1A 4V2FA 3HBLA 1MMNA 5DCMA 3ZOBA 2IEKA 5FO5A 1U2WA 3LL7A 3CCRI 4OWRB 4ENJA 1TC3C 2CYYA 2MC3A 2FRHA 1EA3A 1IN8A 2KHMA 3PNTA 4RAFA 5E8IA 2W00A 1WPKA 4LG3A 3T0YA 3DTEA 4BJ5C 4BY1J 2Z33A 3HDDA 2Q2EB 4GYIA 3J81K 3DXJF 5CVRA 2XGDA 3PQJA 4NHJA 3P7NA 3FXQA 1N78A 3WTYC 3CD6I 5JI6A 2R92J 4U88A 3A01B 3LSMA 2LR8A 2M4GA 2KIFA 5D5UB 2QQAA 2ZMEA 1RUOA 3M8FA 4ZYDA 2BZTA 2DK8A 1J09A 3MZ8A 4JYKA 3BDDA 2XAJA 2MD0A 5E1ZB 1DU6A 5ICCA 1T33A 3M1EA 4R8HA 1EF4A 2P5LC 4DW6A 3S2WA 3VYRB 3CCQI 4K2EA 1FBUA 2R7SA 3KYLA 3E6MA 4PZJA 2H8RA 3M8JA 1BIBA 2JTVA 3L2QA 1OFCX 1MIJA 2QKLB 3KFWX 2ISYA 3BR1A 3LSHA 1IF1A 1X1BA 2HEOA 2WBMA 1ODDA 1Z05A 3NARA 1WVRA 1YG2A 4ENKA 2AXTC 4I09A 4HLXA 3DU6A 4G7OF 5H20A 3QQAA 3BROA 2HXIA 5FKNA 2VBXA 3IV5A 1FX7A 1CQTA 2ZO4A 4B44A 3FM3A 3BP8A 1S72I 4GDFA 5F1JA 3TP3A 2RNJA 2C6YA 2K9MA 5BPDA 3KE2A 2EIKH 2QENA 2IA1A 4A3JJ 3DKYA 5DTDA 2CGPA 1ACIA 3K7AJ 5E1WA 4ZDLA 2IVMA 2JN6A 5KK1A 3OYGA 5FJ8J 4N9HA 3AG1H 4XNFA 2BY3A 3H3VK 4ABZA 5JLWA 2QQ8A 5IY5H 2L7MP 3UKGA 3S3OA 3LSRA 2D5VA 1Z77A 2F6CA 2V1XA 3OR1C 4C2TA 1YITI 4B47A 1SFOJ 2BOLA 2QWWA 5J40A 4I01A 2L3DA 2VKDA 1MMGA 3V8JA 5FFZA 2Y9ZA 4EV0A 1GXPA 1D8JA 3PJRA 2LY1A 2L7KA 2PN6A 2R5YA 3FISA 3HUGA 2R7DA 3M7GA 4H0EA 3A2KA 2M5WA 3G3ZA 3R4KA 4AIDA 1JE8A 4Y52J 5DYMA 4GGGA 4JQFA 1BR4A 2RNGA 3RKYA 1XSDA 2MLKA 4BS9A 2E36A 1Y8QB 4MHGA 3JRBA 2CW0F 3IRRA 1BOBA 2KL4A 4L18B 2E2IJ 2LDUA 3FBIB 1SFXA 1NH3A 2R7RA 1TWAJ 3LAJA 1ZKGA 3K4BA 5FKKA 4ZTJA 3ZR8X 1VQ5I 1Z6RA 3DLLF 1OYIA 4BBRJ 1A04A 5K7FA 3F8CA 1XSVA 4BDYA 2Y31A 1XS9A 1KA8A 3CC4I 5B1BH 1YW8A 3WTSC 3IRQA 1GVDA 1Q1VA 2X0LA 3FK7A 1N77A 4OMYA 4M74A 2ZBKA 9ANTA 4EMSA 4M6VA 4ASNA 4CDGA 1VQOI 1MKMA 2VPRA 1SFUA 2CUJA 2WAFA 5IT9K 4HW0A 2F4IA 4GRIA 3FKJA 2IAIA 2FMYA 3MVPA 1YYVA 4BY7J 2MABA 2K7LA 5E79C 2OJED 1LFUP 4I76A 2A05A 3DV8A 3HRSA 1P4AA 2BXYA 2GOXB 2CH0A 1R6RA 3KX2A 2F4OB 2GXAA 1HSJA 2IS2A 3U21A 1HC8A 1MMDA 5FGMA 2Y2ZA 1HLVA 2V79A 1X3WB 4XRSA 1BM9A 1NG7A 2EA4A 2M30A 3TDUC 3AAFA 4EQQA 2JA2A 2NS7A 1ETOA 2QUFA 3SYTA 1JGGA 3PSIA 4H4KC 1U9NA 2Y0MA 3RDIA 2ESHA 2ZKZA 2EFNA 2ZJRF 3EETA 4O3MA 2WC2A 4P55A 5BMZA 2ZNZA 3RYPA 4XLEA 1YS7A 2Z2SB 4L5EA 4XKCA 4E6KG 1QA6A 2JZYA 4I99C 2XSDC 4JX4A 5KHDA 1Z91A 2RREA 3KETA 1POGA 3KP3A 1B9MA 2WADA 5A2QZ 5LGTA 2MLGA 4NC8A 3WE2A 4GXOA 1RI7A 5LEJA 1BOAA 2EWNA 4AVPA 3F23A 1SVOA 2IPQX 2ECBA 1G6NA 4LG0A 4OINF 3DQVC 1BI3A 2DLLA 1R00A 4RS8A 2ZCWA 1I1SA 1JHFA 3RQ4A 1D5VA 3I4MJ 2VQLA 4A3KJ 5J1RA 2W85A 3FXKA 4RM3A 2VXDA 2M1BA 4B8XA 3MZHA 2LFBA 4EATA 3EUKL 1VQ4I 4BAYA 3RTRA 2Q2EA 4IRGA 2FQ4A 5GTHC 2B9SA 2UZKA 4XOPA 4KUMA 4CCMA 2VONA 2JPBA 2MW8A 4F52A 2NRAC 2PI0A 5JR3A 1OKRA 3DEWA 3DKWA 1DP7P 1VZ0A 3TW6A 2EILH 4LK1F 4RA2A 1OCPA 2VI6A 4D0PA 5DCFA 3MFKA 2WB1A 2IS1A 3PIOF 4BEHB 1P4WA 2EBIA 4WWCA 4BDZA 4AYBA 1SD7A 2QSGX 2K86A 2OAZA 5HS7A 1J59A 4KISA 2XPUA 2XAUA 4BH9A 4HDVA 3FX3A 4P96A 3L2VA 5D5VB 2QSFX 2R7ZJ 2HPMA 3BQZA 4M3DA 3BJOA 4KYWA 2FXAA 1TNSA 2LNBA 4GFBA 5M5WJ 1IXCA 2ZXIA 1AKHB 2LKSA 3NWTA 4A3BJ 3J81Z 4Y13A 2XPVA 1ORKA 3ABTA 3PIPF 1WI3A 1UZCA 1ZREA 4RB3C 1IN5A 1E3OC 3QYBA 1QO0D 5K5OA 2XRNA 1IV8A 1P6RA 1YO5C 1FNNA 1X2NA 1I1GA 3LOCA 1E3PA 5J8CA 1Y39A 1BA5A 4IHYA 3F9KA 3OSGA 2WV1A 2ZXHA 1XGNA 2CO5A 1O4XA 3K70C 4HRIA 3DU5A 3ABMH 4OOIA 1ETXA 1TBXA 2HQRA 5E20A 5F04A 3REOA 4CCLA 1ZRDA 1KONA 2HQNA 1KU7A 2QYOA 3K4MA 3K2ZA 3VFZA 1VQMI 3KP4A 4C2UA 5J1UA 4XMYA 3IWFA 3L1PA 1VQ7I 4PGGA 3PNYA 3OYLA 1Z1DA 3RPQA 1QVTA 4N4OB 3ZCOA 2O03A 4BQQA 5LFAA 2R5YB 2JA8J 1YLFA 2MD5A 1KU2A 1NHAA 3DPLC 3QPSA 2H8WA 4FTHA 1GV5A 1BW5A 2DCEA 2JVGA 3E7LA 2DJIA 3F72A 5H6QA 2BW3A 1KU9A 3FMRA 5B66C 1BIAA 2DT6A 3F6VA 1RIOH 3A4CA 4HQMA 3ASOH 1R4NB 2V1NA 1MBGA 2AQFA 3GTGJ 1W5SA 4M73A 3F8MA 1MJBA 1TLHB 5L3DA 4D9JA 4QPOA 1IN7A 2NYXA 2DOAA 5AONA 1D5YA 2K9QA 2PBIA 1JJ6C 4P9FA 3HRTA 4UUSB 3R60A 2DW4A 4NQWB 4MFDA 1GVJA 3H0GJ 2ZSHB 3K4NA 2XAHA 3JRIA 2MFZA 5EZGA 3RZOJ 3AG3H 3TGNA 3V7CA 2BV6A 3CMAI 1RUNA 3HOWJ 4UUVA 1RC9A 3ERMA 2DO7A 1ETVA 3BTCA 3L00A 3WODF 2BY0A 4W1UA 5EGOA 2MG4A 5B1AH 5FD6A 3JRHA 4UHTA 3CO7C 3C2HA 2EA2A 4OIOF 4KA4A 1IO2A 2RDPA 1T08B 2ICWG 5F0HA 2ZSIB 3HKZN 3HSFA 5M5XJ 1JUPA 2R7TA 4CYDA 5L3GA 5DUIA 3ABKH 1YI2I 1XTAA 2CJJA 2DYSH 3K0LA 1LEAA 1MH3A 1WJAA 1MW7A 2P6TA 3ZMDA 5IOZA 3MZYA 3JTHA 2F5FA 1TNTA 2O0YA 2DA1A 2B0LA 3DTIA 3FZVA 4YEJA 2L0KA 5FLMJ 1YW9A 1A6IA 5HS8A 3OS0A 2E1OA 2X6OA 2FUG2 4XN0A 1SANA 1XDUA 3FXUA 2HKOA 2BXZA 4XSXF 1FT9A 4ZDOA 4RDUA 5TJJA 1R23A 4HEA2 3CO6C 1HQCA 3EDPA 2A6EF 2D2WA 3DEEA 5F1RA 2CS3A 3M3YJ 3G1OA 4UVAA 1UAAA 1LJ9A 1BL0A 3JAMK 1ZQ3P 4ZC3A 1W1WE 2A61A 4I6ZA 1U3EM 1MMSA 1OISA 2FBKA 2QQ9A 2AS5F 1G8XA 4ESBA 3BOQA 5HODA 3D1NI 4HPQA 4BNCA 4X6AJ 3ECHA 2M7AA 2OC6A 4RB1A 4BJ6C 5J3LA 2V26A 4XK4A 2EZKA 5EZHA 4E7IA 5GPCA 4A3CJ 2ME6A 3BJAA 3BR5A 2B7EA 2LMDA 2WWYA 2DK5A 2YUSA 4G94A 4EM0B 1MMAA 4LLLA 1B72B 4LLGF 3BY6A 3DBLB 4BXXJ 1A6QA 2R7QA 3DLAA 4JX5A 1XG1A 1JJ8C 3PUFA 5L3EA 3O6BB 4HZFA 4KT6A 2FOWA 4AM3A 1GDTA 2F2EA 2CV1A 1ETYA 5BS6A 4M71A 5E3OA 5EYRA 2FEZA 3I59B 1YQAA 1HF0A 2AHQA 4UB6C 5KCMA 2OPTA 5E8GA 1U8RA 3GTMJ 3V42A 2XAFA 1ZARA 1OR7C 4C30A 1QHHD 1TWHJ 4XN3A 1WI9A 2L9SA 4PUSA 1REPC 2DTZA 2P81A 2Y0SN 5JLXA 4AU7A 1SD4A 3WTXC 3E5UA 1Z67A 2X85A 1RNLA 5HDKA 3CJNA 3FDYA 3OR2C 2Q8KA 1S5LC 3IH4A 4RB2C 2JT1A 4F3QA 1X3UA 3JRFA 1VI0A 3MEXA 5FRNA 2YSRA 3W6JB 2WTEA 3PUBA 2UXNA 2WA0A 5J1YA 2YR2A 4BYYA 5FB2A 3WTVC 4BQNA 3NAUA 3FXLA 2J5OA 3IH2A 1UHWA 2ELHA 3ZN0A 1TZLA 2DI3A 3C2GA 5K1YA 2VQHA 2XGXA 1DP3A 2E5NA 1S7AA 3WTWC 3QU6A 5HOOA 4MEXF 4JK1X 1FBQA 3K2AA 3NEUA 4XICA 5LGNA 4UNOA 3D5SC 4ETSA 3LSIA 1T8IA 1T39A 3LMMA 2QQBA 3DBHB 4HAMA 3RQIA 1W36C 4B3XA 1Y1VJ 1EH7A 2L9NA 3G2BA 4G6QA 3HKZA 4L9NA 3ZQ7A 4Q4ZF 3GTPJ 2V9PA 4LK0F 2H27A 3U9GA 1WH7A 4BHPA 3QYEA 2V4JC 1KYZA 3BC8A 4I0BA 3COAC 3I9V2 1J7KA 4XIDA 1K79A 5GTIC 1USTA 4O6JA 3AL0C 3GFLA 4C9YA 5H6RA 2ISZA 3IC7A 3CLQA 3HC7A 3ULQB 1MSEC 3W2WA 4ESJA 3S2HJ 4P9UA 5D4SA 4B4CA 3V8LA 1A36A 5IYDJ 3RI4A 2BVLA 2EZLA 2K5CA 4KN4X 1T98A 2O8KA 1S8NA 1AA7A 1WKMA 2QVOA 2XGCA 5DD8A 3H36A 2K4BA 4MO7A 3I53A 1ZRFA 3AG4H 2X1CA 4BXUA 4C3IJ 3CUQA 1G59A 2Y75A 4KJZA 2JA6J 2W48A 3LSGA 4OMZA 1AHDP 1YS6A 3OOPA 5BQTA 2O8XA 3Q3SA 4XR6A 1NK2P 4BQOA 3CDIA 2RGVA 4G6TB 4MTDA 3RCOA 2W1OA 4Q47A 1HKTA 1FSHA 4HG2A 1QRYA 4IPAA 1K7AA 4Y3OA 3LFUA 3O8HA 3IL2A 3NQOA 1T6SA 3WHCA 1BC8C 5E3NA 1KZHA 2ZJ2A 5AIPA 2LVSA 4FX0A 1ZN2A 2JSPA 5J4YA 4HSRA 3CCYA 1ZG1A 3PFYA 4IHVA 3MAJA 1H9TA 2ELJA 2ID6A 5LGUA 3ESWB 3BZKA 3C3WA 1XSXA 2CV2A 3G6EI 1IGNA 2EV6A 3MWMA 4FISA 1ON2A 1MDMB 5ILVA 4U0VA 2KISA 3OYFA 2XF7A 2ID3A 1X1PA 3RJPA 1JT0A 4BHCA 2DFHA 2HYGD 3HOTA 1D1BA 3HRUA 1K4SA 2Q0OA 4XLFA 3G4SI 4LOCA 2CQXA 3BTIA 1WH5A 2NXNB 2RVCA 5M3FJ 4M3GA 1D1AA 1I50J 4A3DJ 4S05A 2Y69H 3HOZJ 4OAYA 2RQPA 4XLAA 1D1CA 3LSTA 1IC8A 1F36A 4NC7A 2QA4I 3FK6A 4U7BA 4C3JJ 2QF7A 1IN6A 4ENNA 4KDPA 4EM2A 1TWGJ 3WGIA 1BI1A 2LOOA 3GTOJ 1ETWA 2DBBA 2DMTA 2X6YA 2XASA 3H9JA 3TO9A 1VQ9I 4UVCA 3BCAA 5E3MA 2O7OA 3CUOA 2M45A 2W25A 1ZTRA 1VTNC 4BUPA 2CRGA 1K78A 1RETA 4N0BA 1QPMA 1TT5B 1Z7LA 1F4KA 4P5OA 2HWVA 1UG2A 4U0WA 4KMFA 1UHMA 1XCVA 2IA2A 2K9SA 5F0FA 3LFKA 2IS6A 4RB0A 4XKVA 3CLOA 1TTYA 4XRMA 1O3TA 3FBNB 2H6CA 2BE5F 2EFQA 4D5CA 2R7UA 2HYJA 2F5DA 2FA5A 2I8DA 2M0CA 3SZGA 2K3PA 5GPAA 3I55I 3CCEI 5TRDA 3BPXA 5IP6A 3F22A 2M8GX 1WJBA 3MD2A 3LSPA 3S1RJ 1J5YA 4KFCA 2CUZA 2ZXWH 1E3HA 1P4XA 4O5VA 3CCVI 2P7VB 3BJ6A 1Y0NA 2JK3A 3S3NA 3GVAA 4LJZF 1OQYA 2OBPA 2E7XA 2OQRA 3CQZJ 4N9IA 2HDCA 2ACJA 4EEFG 1PUFB 1FZPB 2Y30A 3K9TA 1W7PB 1XD7A 4RLFA 5F27A 5FLXK 2O5RA 3J7YJ 4F91B 1FYMA 1JKQC 3ZMTA 4LGWA 2CU7A 4FE7A 1Z0XA 2VLAA 2F48A 1PUEE 1WJDA 1IG7A 3DKXA 3K1PA 3R61A 5FKMA 1U0JA 2DFEA 3I56I 2WB1N 3ZQIA 5F0CA 5BNGA 4CZZA 2CSOA 2VKEA 1TP4A 2X6WA 5CVUA 3KPHA 4BL0B 2XIGA 2VUMJ 2VJ4A 4LG0B 1W4MA 2V6CA 1T2KA 3QODA 4LIVA 5D6EA 1FOYA 1Z6TA 4G7HF 1EH8A 2KIMA 1S3JA 3DFGA 3M07A 2W7NA 2DA7A 4BGDA 4R1HA 2HFHA 3IHUA 2Q1ZB 1RKTA 2VBYA 4RGSA 4PFPA 4E7LA 1LB2A 2FF4A 2OA4A 1QZZA 2KRHA 2FNPA 3OIOA 5EJCA 5D8KB 4LB5A 3EPZA 3TL4X 2WY7Q 2CQQA 5LBQA 3I4PA 3OYCA 3OL3A 3TEDA 4UUTA 2GM4A 1OCCH 3UR3C 3OYJA 5ILSA 4IHWA 3MKZA 2VE9A 1XX5A 3KEOA 1PP8F 2O61A 1IRGA 3ROUA 2JUCA 3BG3A 3ZN1A 2ADUA 4DOZA 1HKQA 1Z3YA 2KJBA 2VOOA 3ZP5A 3HXLA 1ZRCA 2CQKA 2YPRA 4BXFA 2P5KA 5C44J 1V5FA 3KP5A 1I6HJ 1OCRH 5TGTA 1I5ZA 3QU3A 1GT0C 1H88C 3QAHA 4F92B 1ZGAA 3OIQA 4DIQA 1K78B 2UV1A 4XL9A 1DDNA 1LE8A 2RAEA 4IHXA 3TW7A 1OYWA 5EEGA 3S14J 2MYSA 4G6DA 3JRAA 1FMWA 2KMUA 4JP0A 2R7FA 1IZ1A 3VODA 1SAXA 2UUZA 3EYYA 5K7ZA 3JREA 3OL4A 3JSOA 1SFKA 2I10A 4DBQA 2D1VA 3HM5A 3IWZA 2EINH 1BR1A 3HL2A 2DODA 4A5MA 3U2RA 4PJNA 4HNTA 2PMUA 2K9LA 2EJRA 4YFKF 1I3QJ 2V7FA 4B3AA 2D1HA 2NS0A 2QBYA 3VYSB 3VB2A 1WJCA 2GLOA 1SEUA 2LY2A 1EJ9A 2MC4A 1WZ2A 1H0MA 2E1NA 3GUDA 3OOUA 1X1CA 2L7ZA 4YFNF 3ERED 2FD5A 3OWTA 4D7MA 3HHHA 3SXYA 5HLHA 2DN0A 3VSLA 3EUHC 4C2MJ 2CFXA 2XB5A 4M3BA 4A2UA 1WHUA 3OYMA 3L2UA 4WX9A 3BZCA 2DJNA 3GLLA 1V55H 5J6XA 3C18A 3PM1A 2DMNA 2EIJH 4J19A 3M4OJ 4F55A 1FY7A 1JGSA 3HTUA 3IAM2 5HDGA 2B63J 2M34A 2DAOA 2EK5A 2LBFB 4M72A 3Q0UA 3SHFA 1UMQA 1J9IA 4FASD 2WAQA 5JFRA 1DGWY 1LNWA 5A2QK 3H0DA 3L2WA 1ENHA 3PNVA 2PMHA 4HDUA 1FIAA 3FIWA 2XC7A 2MGQA 5ED4A 2QEXI 4A3GJ 1P2FA 2R4GA 3R0AA 5J4VA 3ZMSA 4UB8C 4OIPF 2LC2A 4CO8A 3OV8A 4CCKA 1HOMA 2GIVA 3BWGA 1WCMJ 3WU0A 3J80K 4RAYA 1YRNB 2CUFA 3H35A 1FP1D 2ETHA 4XKWA 1PYVA 2XSJC 3E3VA 4IF4A 4J00A 3TMOA 4J01A 4HX8A 1XMXA 4CZCA 5ICEA 3TO7A 3S32A 3GFJA 6PAXA 2JRMA 1XCBA 5EGOB 1YIOA 2R7VA 4RAZA 4ZJZA 1JUSA 2HNHA 3GFMA 1R4MB 5GADJ 2HKXA 4NC6A 4E7KA 5FKOA 4BU2A 1YRNA 4BEHA 3X2QH 4NNJA 1BR2A 5HNHA 2A6TA 2HOTA 1KQ8A 2COMA 1X4PA 3H3UA 2KT0A 3H5NA 3HSEA 3TKYA 1MD0A 3GYHX 4HQEA 3N97A 3BR3A 4IOAF 1VQPI 3MQ0A 1S7OA 1IV6A 2OCEA 1VQ6I 3IAS2 3CMMA 2PJRA 4P1WA 3S3MA 1PUFA 1WQ2A 1FOXA 1PJRA 2K4JA 1I3AA 4Z2YA 4I98B 4RM2A 4XLPF 1H9GA 1EH6A 4IQ4A 1IRXA 2XV4S 2IP2A 2L7FP 2VXZA 2STWA 1H89C 3GTJJ 3JSPA 4L9VA 3PO2J 1RKWA 3BR2A 1ZG5A 3L7WA 1FJLA 1D0XA 3H5AA 2BVMA 1SMTA 3TOBA 1HSTA 4R79A 1YJWI 3LSKA 1HBXG 1MNMC 2EZHA 3ELKA 4CGZA 4MQVA 2VOPA 2EZIA 2KKOA 5HLTA 1GLNA 3I54A 3SDGA 4RAGA 1WSUA 2PG4A 2QLZA 1IJWC 2EV5A 2XAGA 4WF2A 3GEZA 2IT0A 2JJ7A 1V5GA 4ZZLA 5JHUA 1YW7A 4BHBA 4BBSJ 3I5UA 2PX9A 4M6XA 2H1LA 3WTUC 5FRMA 1BN5A 2KQRA 2HGCA 5J47A 4AIHA 3HG9A 1K6YA 1N75A 3PL8A 1ONVA 1EV7A 2M8EA 2CWEA 3RZDJ 1VNDA 2L01A 4M9ZA 2JPCA 4OIQF 1JKOC 3G1MA 1PDNC 1WGXA 1UCRA 1XN7A 4RBOA 2L9RA 2M9HA 3VPRA 4LD5A 3EUAA 2MH9A 4E4HA 3JR9A 4M3EA 4A93J 2CW7A 2HVSA 1X3ZB 3HPGA 3IUOA 2GAUA 4AWXB 1SAUA 4NB5A 1HXDA 1TT0A 3BG9A 3KEYA 3S8PA 4EJOA 3D0SA 3GW2A 2QCOA 3L2CA 3SZPA 2I5UA 4XRSG 2KDOA 2ZJQF 3FHNA 3V8KA 4Y33A 4XQFA 3AKZA 2DU9A 2KZGA 5HLIA 3WE3A 4I02A 3QPTA 3SFIA 2Z5UA 3JCUC 4UV8A 4M6YA 5B5EC 1OMIA 3MN2A 2LYCA 3G1LA 3HOYJ 1UB9A 1QVUA 2XVCA 4QIWN 4HSTA 2V6EA 2QKMB 3VDXA 3O2PE 1AU7A 3TP0A 1VQNI 3KIOA 2GA2A 5GAHJ 4HV6A 1JKPC 3K6GA 2RN7A 5CYVA 1SMYF 2VBZA 4Y17A 3CTAA 2PMZN 1O7FA 3RPUA 2VT2A 1KYWA 2XAQA 5CLSA 4CYCA 1W36D 1APLC 4JX6A 3H92A 3HRMA 3RIRA 1IN4A 4ZH4F 1YHQI 5DCMB 3RKQA 1ON1A 4U87A 2LLKA 4Q48A 1ZH5A 5DDGA 2KJCA 3K4JA 2E19A 3E6DA 3SZTA 2H6BA 3J7ZI 4CYCB 1ZGJA 2DA4A 2VJIA 5C4XJ 5CKTA 5DD4A 1T56A 2EIMH 1H8AC 2HPIA 1L3LA 3N4MA 2PMZA 3OYHA 1R49A 2JRTA 2XUBA 1J75A 2E60A 2KIQA 3LWFA 2X9DA 4DGWB 1G3SA 2QGUA 2BEOA 1U8BA 5LEKA 1Q1HA 3KLOA 4MGRA 4OU0A 4IQJA 3BPVA 3W6KB 3AFHA 2H94A 4IHSA 1SD6A 2DTRA 4HNUA 2IGNA 5HS9A 2PLYA 1LDDA 2DYRH 1LDKB 3CCMI 3KZIC 1X19A 1ZK8A 4QLCU 2JA7J 1MBHA 4IXAA 4D5FA 4HF2A 2DPDA 2R7XA 1D0YA 3KZYA 2W57A 5CQEA 2O6GE 2MBFA 2KPMA 3CMYA 3OYKA 3OYEA 2BYVE 1OCTC 1YX3A 2O9LA 1OPCA 3MCZA 4HF0A 4TV7A 4QPQA 1C0WA 4G9YA 3F3XA 1D0ZA 2XRLA 5IT3A 1FTTA 1OJLA 4ON0A 3TBIA 4DYCA 2E35A 2VC0A 1MBKA 1YE9A 5F64A 1U5TB 3BR6A 4IL6C 4B09A 5IT9Z 3ZQLA 3FKIJ 2CQ7A 4QTRA 2JA5J 1AOYA 1BC7C 2DA3A 2LTPA 2V1UA 1IDYA 4XM3A 2L5QA 2X51A 2VJJA 1QHGA 3GO5A 5F08A 3B6CA 1VFCA 1HDDC 1F5TA 4PK4A 3R6SA 3OIPA 2E1CA 1TQPA 3WGGA 3IP4B 4A0YA 4DZJA 2XF5A 3CF2A 4AD9A 2WAEA 5J8FA 1XC5A 3H3ZA 1B72A 2RV8A 3ABLH 2HZTA 5JHFA 3T1BA 1FLIA 5HLGA 3GBGA 3HZJA 2IS4A 3I59A 1W7PA 5DM6F 3CC7I 4A3LJ 3WGHA 2KZVA 4YIRX 3A0BC 2EB7A 5LHGA 5GAGJ 1RR8C 3SDBA 1GUUA 1CF7B 4II2A 2X4HA 1DUXC 2P8TA 1TWFJ 5D5XB 3Q0VA 3OYAA 2IGOA 1K6OA 2ELKA 3SFZA 1VQLI 2AXLA 5FD5A 4IZZA 3CUQC 3OSFA 1VF9A 2W4SA 1MBJA 1P9QC 5DUKA 3HOVJ 3LAPA 3LA7A 4UUSA 1IW7F 3FXJA 4DYRA 2VT3A 2HQ5A 2BHZA 4HLYA 4YIIA 4YRVA 2IA0A 2FOKA 2LK2A 2NNNA 3CZ6A 3GZNB 4Y7NJ 3V7RA 1YOVB 1BI2A 2HXOA 2HDWA 4MLOA 3P5JA 4WXCA 1UELB 5E18F 2E2HJ 5B3SH 1XDSA 5KVRA 1FP2A 1MJ9A 4XONA 5LHHA 1HW1A 3A0HC 1R5HA 2IRFG 2AO9A 3FXMA 2DFIA 3CMEI 2GXGA 4DBRA 2LP0A 1KQ9A 1U6GA 3HUGB 4QSHA 4LITA 1S7EA 2H09A 1B59A 3H9QA 2BY2A 5C3EJ 4KMUX 4AIJA 2P4WA 4JBAA 4RLQA 4YFXF 3E97A 1WJEA 1IDZA 2N8GA 1V4RA 1B6AA 2L2OA 1XMKA 3FWEA 4DJAA 1FMVA 3TQNA 2GOMA 2VE8A 5D4RA 3OMYA 2XDVA 1U5TC 5BOXA 4HNVA 2P6SA 2PFBA 1R1UA 1LQ1A 4AYBN 1MSFC 2VQGA 4CXFA 3DEUA 2A69F 1JT6A 2V9VA 4B1RA 4PJMA 1R22A 1BW6A 4LLNA 3HOUJ 2IBDA 3FF5A 2ZFUA 2NVUB 5D5WB 4LIUA 2XKPA 4F93B 1Z7UA 3JTGA 5LHIA 3FM5A 3DPUA 3Q0WA 5ERIA 4EJVA 2E71A 2DOEA 4KITB 1Z9CA 1B4AA 3SEQA 3P9KA 3E0JB 1X58A 2YU3A 1R58A 1NG6A 4EM1A 2A3SA 1DU0A 2FSWA 1BJZA 4IRHA 3ZGKA 2DOFA 3OYBA 3J7AO 3U1KA 2IXSA 5IPAA 3ZQCA 3GTLJ 4PSXA 2W24A 3ZQHA 4IO9F 1JTXA 1WFXA 3GTKJ 4FETA 1D8KA 2OTJI 2XF6A 3HGYA 2LREA 3E6BA 2VN2A 4MEYF 1YJ9I 1LE8B 1R71A 3K10A 2DPUA 4GO1A 3CF5F 3ZRGA 3FMSA 4HA8A 2ZJPF 2MSYA 2OF7A 1W0TA 1CF7A 1FC3A 3HJEA 3K69A 1MBFA 1MZBA 3S17J 4IJAA 4PJLA 4PJ0C 1MBEA 3A1YA 4PJJA 3F6OA 2BGCA 5H2FC 1R1VA 2F5EA 2NOGA 2NNYA 3GCMA 3B73A 1D3YA 2G7HA 3J7AY 4RMNA 3H1CA 2OZ6A 1RRJA 5DV5A 2CUEA 2R3SA 2F5VA 4HBLA 5M3MJ 4HOBA 4LMYA 3LA2A 3GX4X 1MJAA 4L0YB 3IH3A 1U78A 1R1TA 2DT7B 3LSJA 2EFOA 3M9AA 3T8RA 4DYQA 4X0GA 2CQNA 2L02A 2KIUA 1T0FA 3DP7A 1O7LA 3OY9A 4G7ZF 1ZR2A 2X48A 1GHCA 2CFOA 4YELA 2IGMA 2VB6A 1G2HA 1R5GA 3P9IA 3LQQA 2A5WA 2IJLA 3E1SA 3O8GA 1XGMA 5E17F 2K02A 4HYEA 3MKYB 4DZPA 3A01A 5LRRA 5K5RA 4BKXA 3F8FA 3VWBA 4IX7A 2VQCA 2O3FA 4CA0A 1LFPA 4D7NA 2JMWA 4A3IJ 1LKXA 2ZFWA 4DNCA 4I2OA 4A12A 2FU4A 2LBFA 2Y48A 4YIFA 3RSNA 5HVQC 4XLHA 5EDNA 1O57A 3QWLA 3A02A 4XBFA 4WK8F 3S1MJ 2OU2A 1TWCJ 3JRCA 4BE2A 1OLTA 2NS8A 2VODA 3WTZA 2TRTA 3DCFA 5L3BA 2RQQA 2E5ZA 1PP7U 5FKLA 2VASA 3BG7A 3LA3A 4B48A 2Z1DA 3WHBA 3E5QA 3BG6A 2OV7A 4G12A 2M3AA 1SFEA 3H5RA 4ZYHA 1WJFA 3JRDA 1TQIA 2LG4A 3IKVA 4A3MJ 3Q9VA 3K1NA 1E17A 3CP8A 1N25A 2FBIA 4U0YA 3WG9A 4AIKA 1QGPA 1GV2A 3ASNH 2LF8A 5HDNA 1S6LA 4X1EA 3RYRA 4BQAA 1P92A 3GWZA 1FOKA 3FXOA 4D1QA 1T95A 2IGKA 4L5JA 3J80Z 4ZDPA 4AVZA 5JVTA 1BI0A 1E2XA 1U9OA 2CG4A 2ECCA 4EJTA 1FWZA 4BJTA 3RKWA 3VOEA 2EFPA 4JOMA 4G8XA 3DWLE 1SC7A 1TW3A 2WY8Q 1A35A 2P5VA 4FCYA 3E6CC 2K40A 3CCUI 4L5IA 4EJUA 3ECOA 3SEZA 2EQRA 4B43A 3HEFA 1T38A 3UNGC 4XKBA 4XLNF 5LD2C 2M0MA 1P7IA 1XPXA 2HTJA 4IEJA 2LD5A 2X6XA 3C2BA 5BPIA 2OTLI 1YFHA 2OZUA 1YJNI 5KAIC 4EVIA 1JUMA 3B02A 4IOCF 3CCLI 5L3FA 2UWMA 2R5ZB 4V19K 2XHKA 2VC1A 2R7OA 3KCCA 4NDLA 3ZMVA 2NVXJ 3BCBA 2IW5A 2PJRB 5EG0A 1J0RA 1JTYA 3CDHA 2LSOA 1XGOA 1MNEA 1Y6IA 4L9TA 1B8IA 4IRIA 3S15J 3GMEA 4MTEA 4HF1A 2HVQA 2ZXJA 5HNFA 1PVEA 3K70D 3W2VA 5AIQA 3D5LA 5C4JJ 4MIMA 4U7DA 3ZXSA 3SQNA 3C1DA 1G3TA 3HSRA 2ZC2A 4ITVA 5IP7J 1A31A 1WRJA 1TQMA 5FLVA 3EQLF 3L9FA 2TDXA 3GLXA 5E3LA 4NUBA 3T5XA 1ZELA 1B8IB 3TO6A 3OYIA 2TCTA 3K4KA 1XB4A 5FFXA 1EKEA 1LEBA 1F43A 2LH9A 3OYNA 3QOEA 2DQLA 4XRFA 3HIFA 1BBYA 4OIRF 3QRFF 2VKVA 3S16J 1WJ5A 4EGYA 2V1DA 2DDAA 4V2GA 3RKXA 1QU3A 3F21A 2M7BA 2STTA 4XLCA 4ZTFA 3AG2H 3LQRA 2ZMEB 1ZLJA 3BZ6A 3MKLA 1G4DA 2EH3A 4KNYA 3QPLA 4I7HA 4XOTA 4A0ZA 1LFBA 3CCSI 2Z99A 3I4NJ 2VKHA 5LLQA 4M9XA 5DEQA 2HS5A 2ZB9A 1HDPA 1K61A 3VYUB 2GQQA 4BE0A 1IXSB 3G73A 1G3WA 2DA6A 4PGHA 2ESNA 1Y56A 2W84A 4N4NB 4A3EJ 2PEXA 3BTJA 3I64A 2EFWA 2HTSA 3W6VA 5CPRB 3K4LA 1LPQA 5TISC 3KLNA 3HOXJ 2NVYJ 5LRSA 4W97A 5IYCJ 5F6FA 1DPRA 2NAZA 2Z9OA 5EEAA 4IKFA 4KIFA 3ABUA 1MNDA 3QYFA 1DPUA 4Y15A 2FBHA 3IKTA 3ZMUA 1FIPA 1IUYA 1W5CC 1LDJA 2PQ8A 2X1DA 4MNUA 1JXSA 3R0JA 3HTSB 1JKRC 2E1MB 3GZ5A 4I0AA 2QBYB 1R7JA 3JW4A 3CJQB 4FT8A 3CESA 3E5XA 3KEQA 2GZWA 4HX4A 3SJMA 3BTLA 2A07F 1A5JA 5IP9J 2MA3A 4MQ9F 3GXOA 3F8BA 2J5PA 4XSZF 2R7WA 3DPTA 3ZPLA 2M2EA 3FMQA 3PSFA 2D45A 2AQEA 2FE3A 3PO3J 2KDZA 1X1AA 3KP6A 5GP9A 3NRVA 2G7UA 2ME0A 2X1EA 4RGXA 3K4CA 4ZZDA 1ULYA 1IXRC 1FPQA 4GCVA 1STZA 4II3A 4Y4RA 3ZQGA 4E7SA 2DA2A 1IUFA 2E7WA 2M4KA 4E7HA 3EYIA 4FE4A 1S29A 3M1CA 3QP5A 3KZZA 3ZQQA 5JVGF 4CHUA 3Q9SA 3ZQFA 3V4GA 1F1ZA 2KP6A 2XKOA 3JRGA 3H9GA 1HKSA 1RESA 4AUXA 1V54H 2JUGA 2HU9A 4QWQA 2DQRA 3QOPA 4LFUA 1CGPA 4UY8I 4E70A 3EUHA 2YX4A 2XPWA 4UXNA 1UHSA 3CJTB 1RZ4A 3I3LA 4BACA 3U1DA 1R9TJ 2NVTJ 3GF2A 3O3KA 4HV5A 1S9HA 2OD5A 1TL8A 2VJ5A 2KFDA 2FJ1A 1U5TA 5K5QA 2E2JJ 3MMYB 4ZYAA 4IHTA 1ZGWA 3BQYA 1HCRA 1ITYA 3P9CA 2KRFA 2GA1A 4EGZA 2DT5A 1HW5A 2QZ8A 2HZDA 1XGSA 2R93J 1IRZA 2VBWA 2OUMA 1W5TA 2JQ7A 3OS1A 2GWRA 2LKXA 4A0XA 2UXXA 2F5CA 2FMLA 2L4AA 3AL0B 4E7JA 3OS2A 2CV0A 3HYIA 4CUGA 5L3CA 4CCNA 2DA5A 5CJ9A 2DFFA 4YG2F 4Q5SF 3DTKA 3KYCB 2FNAA 1YIJI 5KAFC 1FBSA 1UJ8A 4PDKA 2VPLA 3WU1B 2EV0A 4WCGA 4UV9A 5ICFA 1R36A 1YX5A 3TOAA 3PQKA 4A69C 5IOYA 5CVJA 1FYLA 5CVIA 3WU2C 3L09A 2HOEA 1MDMA 4F7ZA 2DMUA 1W7PD 2JVHA 3I58A 1VQ8I 1FEXA 4UVBA 4MFEA 4FHTA 4S04A 2FQ3A 1E0EA 1QQIA 4Z6YA 2HOAA 4OAZA 3W3CA 3DF8A 3WG7H 1DQUA 3HOSA 1ERDA 2H1KA 2FX0A 2OCCH 1HA8A 4PSWA 4ZYGA 1ZHFA 1ETQA 3HGGA 2G0EA 2L9VA 2BBYA 1RPWA 5E1XA 1SVMA 2RKHA 1F9NA 2R5ZA 1ZR4A 3ZMZA 1Y8RB 4WXDA 2L54A 3GFIA 4A6EA 2GXBA 2QSHX 2HQAA 1FYKA 1AWCA 1ZG3A 2BW3B 1P7JA 1QBJA 2ZNYA 4CH7A 4KIBA 3WTTC 2YX7A 2PJPA 2K27A 3QP6A 1VQKI 4ENMA 5EEHA 3D5RC 3BR0A 3A03A 2Y9YA 1B9NA 1OR7A 3V7SA 4NQWA 2G9WA 1I27A 1OCZH 2HR3A 3CP2A 2JWTA 5GAEJ 1V5EA 4XORA 3VYTB 4BE1A 3S1QJ 2GBYA 1M1EB 3KP7A 5ILUA 3K1MA 1HW2A
chains in the Genus database with same CATH topology
2L4MA 1XMAA 1JHHA 1ZYRF 3TDZC 1L0OC 3ML6A 4HX7A 4A6DA 1O3RA 4KIGA 1GXQA 3JAMZ 4M9SA 3QPHA 4WXHA 2Z3YA 2QM3A 4KICA 3PFIA 4CICA 1USSA 5ICGA 4LB6B 3FHZA 1YTYA 1B1BA 2P7CB 4RGRA 1OYYA 5FLXZ 4L9JA 1O3SA 1QNTA 1J2XA 3M8EA 1O3QA 3Q5FA 3T8TA 5D8LB 4RGUA 1TW2A 3CUQB 4IVNA 2OQGA 1FSEA 1IAWA 1KQ0A 1IRFA 3VEPA 2LF7A 3C7JA 1ZAOA 1KU3A 5CVVA 2HYFA 1LVAA 2JSCA 3F8NA 1KGSA 2A5YB 2RC4A 4PCQA 4ESFA 2M87A 2XROA 3ISPA 4GYGA 1QZYA 4KT5C 3KP2A 3FXRA 2A6HF 3HHGA 2A68F 2WV0A 4EJWA 1Y0UA 4DQ2A 3GZ6A 2LKPA 1G3YA 1V3FA 1BJAA 1WWXA 3I71A 3I0TA 4L0ZB 4A5NA 1MGTA 1UFMA 2MH2A 4KN7X 4FX4A 5D6FA 4ZYEA 1ZLKA 1SD5A 1I6XA 5DCMA 5FO5A 1U2WA 4ENJA 2CYYA 2FRHA 2MC3A 1IN8A 5E8IA 3T0YA 2Z33A 4GYIA 3J81K 3DXJF 5CVRA 3PQJA 4NHJA 3P7NA 3FXQA 3WTYC 5JI6A 4U88A 2KIFA 5D5UB 2QQAA 2ZMEA 1RUOA 3M8FA 4ZYDA 2DK8A 3BDDA 2XAJA 5E1ZB 5ICCA 3M1EA 4R8HA 2P5LC 3S2WA 4K2EA 1FBUA 3E6MA 4PZJA 1BIBA 2JTVA 3KFWX 2ISYA 1IF1A 2HEOA 1ODDA 1Z05A 4ENKA 1YG2A 4I09A 4HLXA 4G7OF 5H20A 3BROA 2VBXA 1FX7A 2ZO4A 3FM3A 3BP8A 2RNJA 2C6YA 5BPDA 3KE2A 2QENA 2IA1A 2CGPA 5E1WA 2IVMA 5KK1A 4N9HA 2V1XA 2QWWA 3V8JA 4I01A 2L3DA 5FFZA 1GXPA 4EV0A 1D8JA 2PN6A 3HUGA 3M7GA 2R7DA 4H0EA 2M5WA 3G3ZA 3R4KA 1JE8A 5DYMA 4GGGA 4JQFA 3RKYA 1XSDA 2MLKA 4MHGA 2CW0F 3IRRA 4L18B 2LDUA 1SFXA 3LAJA 1Z6RA 1OYIA 1A04A 3F8CA 1XSVA 1KA8A 3IRQA 1YW8A 3WTSC 2X0LA 4OMYA 4M74A 2ZBKA 4EMSA 4ASNA 4CDGA 1MKMA 1SFUA 5IT9K 4HW0A 2FMYA 1YYVA 2K7LA 3DV8A 3HRSA 1P4AA 1HSJA 5FGMA 2V79A 1BM9A 2EA4A 2M30A 3TDUC 3AAFA 4EQQA 2QUFA 3RDIA 2Y0MA 2ESHA 2ZKZA 2EFNA 3EETA 4O3MA 2WC2A 4P55A 5BMZA 2ZNZA 3RYPA 1YS7A 2JZYA 1Z91A 3KETA 3KP3A 1B9MA 5A2QZ 5LGTA 2MLGA 3WE2A 4GXOA 1RI7A 5LEJA 1BOAA 2EWNA 4AVPA 3F23A 2IPQX 4LG0A 1G6NA 4OINF 1BI3A 3DQVC 2DLLA 1R00A 4RS8A 2ZCWA 1I1SA 1JHFA 1D5VA 2W85A 2M1BA 4B8XA 3MZHA 4BAYA 3RTRA 2Q2EA 4IRGA 2UZKA 4KUMA 2VONA 2JPBA 2NRAC 2PI0A 5JR3A 1OKRA 3DKWA 1DP7P 4LK1F 4D0PA 5DCFA 3MFKA 1P4WA 4WWCA 1SD7A 2K86A 2OAZA 5HS7A 1J59A 4BH9A 4HDVA 3FX3A 4P96A 5D5VB 3BJOA 4KYWA 2FXAA 1TNSA 2LNBA 1IXCA 3J81Z 4Y13A 3ABTA 1ZREA 4RB3C 1IN5A 1QO0D 5K5OA 2XRNA 1P6RA 1YO5C 1FNNA 1I1GA 5J8CA 2CO5A 1XGNA 4OOIA 2HQRA 1TBXA 5E20A 3REOA 1ZRDA 2HQNA 1KU7A 2QYOA 3K2ZA 3VFZA 3KP4A 3IWFA 4PGGA 1Z1DA 3RPQA 2O03A 1YLFA 2MD5A 1KU2A 1NHAA 3DPLC 3F72A 5H6QA 1KU9A 3FMRA 1BIAA 3F6VA 1RIOH 4HQMA 1W5SA 4M73A 3F8MA 1MJBA 1TLHB 5L3DA 1IN7A 2NYXA 5AONA 2PBIA 4P9FA 3HRTA 3R60A 2DW4A 1GVJA 2XAHA 3TGNA 3V7CA 2BV6A 1RUNA 4UUVA 2DO7A 3L00A 3WODF 5FD6A 4UHTA 3CO7C 2EA2A 4OIOF 4KA4A 2RDPA 3HSFA 4CYDA 5L3GA 5DUIA 3K0LA 1LEAA 2P6TA 3ZMDA 3MZYA 3JTHA 2F5FA 1TNTA 2O0YA 2B0LA 3FZVA 1YW9A 5HS8A 1XDUA 3FXUA 2HKOA 4XSXF 1FT9A 5TJJA 1R23A 3CO6C 1HQCA 3EDPA 2A6EF 2D2WA 5F1RA 4UVAA 1LJ9A 3JAMK 2A61A 1U3EM 2FBKA 2QQ9A 2AS5F 4ESBA 3BOQA 4BNCA 3ECHA 4RB1A 3BJAA 2WWYA 2DK5A 4G94A 4EM0B 4LLLA 4LLGF 3BY6A 5L3EA 3O6BB 4HZFA 2F2EA 5BS6A 4M71A 2FEZA 3I59B 1YQAA 5E8GA 1U8RA 2XAFA 1ZARA 1WI9A 1REPC 1SD4A 3WTXC 3E5UA 1RNLA 5HDKA 3CJNA 2Q8KA 4RB2C 2JT1A 1X3UA 3MEXA 2YSRA 3W6JB 2WTEA 2UXNA 2YR2A 4BYYA 5FB2A 3WTVC 2J5OA 1UHWA 2ELHA 3ZN0A 2DI3A 5K1YA 2XGXA 1S7AA 3WTWC 3QU6A 5HOOA 4MEXF 4JK1X 1FBQA 4UNOA 3NEUA 5LGNA 4ETSA 1T39A 2QQBA 4HAMA 1EH7A 4G6QA 4L9NA 4Q4ZF 3ZQ7A 4LK0F 2H27A 3U9GA 4BHPA 1KYZA 4I0BA 3COAC 1J7KA 1K79A 1USTA 4O6JA 3GFLA 5H6RA 2ISZA 3IC7A 3ULQB 4ESJA 4P9UA 5D4SA 3V8LA 3RI4A 4KN4X 1T98A 1S8NA 1WKMA 2QVOA 5DD8A 2K4BA 1ZRFA 3I53A 4BXUA 3CUQA 2Y75A 4OMZA 1YS6A 3OOPA 5BQTA 2O8XA 2RGVA 4MTDA 4Q47A 1HKTA 1FSHA 4IPAA 1K7AA 3IL2A 3NQOA 1T6SA 1BC8C 2ZJ2A 5AIPA 4FX0A 1ZN2A 1ZG1A 3MAJA 1H9TA 5LGUA 3C3WA 1XSXA 2EV6A 3MWMA 1ON2A 1MDMB 5ILVA 4U0VA 3RJPA 4BHCA 2HYGD 3HOTA 3HRUA 2Q0OA 2RVCA 4S05A 2RQPA 3LSTA 4U7BA 1IN6A 4ENNA 4KDPA 4EM2A 3WGIA 1BI1A 2DBBA 2XASA 3TO9A 4UVCA 3CUOA 2M45A 2W25A 1VTNC 1K78A 4N0BA 1QPMA 1F4KA 4P5OA 2HWVA 4U0WA 4KMFA 1UHMA 1XCVA 2IA2A 3LFKA 4RB0A 3CLOA 1TTYA 1O3TA 2H6CA 2BE5F 2EFQA 2F5DA 2FA5A 5TRDA 3BPXA 3F22A 4KFCA 1J5YA 1P4XA 4O5VA 2P7VB 3BJ6A 3GVAA 4LJZF 2OBPA 2E7XA 2OQRA 4N9IA 2HDCA 2ACJA 1FZPB 3K9TA 1W7PB 1XD7A 5FLXK 1FYMA 3ZMTA 4LGWA 1PUEE 3K1PA 3R61A 4CZZA 2CSOA 5CVUA 2XIGA 4LG0B 1W4MA 2V6CA 1T2KA 5D6EA 1Z6TA 4G7HF 1EH8A 2KIMA 1S3JA 3DFGA 4R1HA 2HFHA 3IHUA 2VBYA 4RGSA 1LB2A 4LB5A 2FF4A 2OA4A 1QZZA 2FNPA 5D8KB 5LBQA 3I4PA 5ILSA 2VE9A 3KEOA 1PP8F 2O61A 1IRGA 3ROUA 3ZN1A 2ADUA 1HKQA 2KJBA 2VOOA 3ZP5A 1ZRCA 2CQKA 2YPRA 2P5KA 3KP5A 1I5ZA 3QU3A 3QAHA 1ZGAA 1K78B 1DDNA 1OYWA 5EEGA 4G6DA 2R7FA 1IZ1A 3VODA 1SAXA 3EYYA 3JSOA 2D1VA 3IWZA 4A5MA 3U2RA 2PMUA 2EJRA 4YFKF 2D1HA 2NS0A 2QBYA 3VB2A 1H0MA 2E1NA 3GUDA 4YFNF 3ERED 3HHHA 3SXYA 5HLHA 2CFXA 4A2UA 4WX9A 5J6XA 3C18A 1FY7A 1JGSA 3HTUA 5HDGA 2DAOA 2EK5A 4M72A 3SHFA 1J9IA 5JFRA 1LNWA 5A2QK 4HDUA 2PMHA 5ED4A 1P2FA 3R0AA 3ZMSA 4OIPF 4CO8A 3OV8A 2GIVA 3BWGA 3WU0A 3J80K 4RAYA 1FP1D 2ETHA 3E3VA 4IF4A 4HX8A 5ICEA 3TO7A 3GFJA 6PAXA 1XCBA 1YIOA 4RAZA 3GFMA 2HKXA 1KQ8A 2COMA 3H3UA 3TKYA 3GYHX 3HSEA 1MD0A 4HQEA 3N97A 3MQ0A 1S7OA 1WQ2A 2K4JA 4Z2YA 4I98B 4XLPF 1H9GA 1EH6A 2XV4S 2IP2A 2VXZA 2STWA 3JSPA 4L9VA 1ZG5A 3L7WA 1SMTA 3TOBA 1HSTA 4R79A 1HBXG 3ELKA 4CGZA 2VOPA 4MQVA 2KKOA 3I54A 1WSUA 2PG4A 2QLZA 2EV5A 2XAGA 4WF2A 3GEZA 2IT0A 4ZZLA 5JHUA 1YW7A 4BHBA 3I5UA 4M6XA 3WTUC 1BN5A 2HGCA 4AIHA 1ONVA 1EV7A 2M8EA 2CWEA 2L01A 4M9ZA 2JPCA 4OIQF 1PDNC 1UCRA 1XN7A 4LD5A 2MH9A 2GAUA 4AWXB 4NB5A 1HXDA 4EJOA 3D0SA 3GW2A 3L2CA 3SZPA 3V8KA 2DU9A 5HLIA 3WE3A 4I02A 3QPTA 2Z5UA 4UV8A 4M6YA 1OMIA 1UB9A 2XVCA 3O2PE 2GA2A 4HV6A 2RN7A 5CYVA 1SMYF 2VBZA 4Y17A 3CTAA 1O7FA 3RPUA 2VT2A 1KYWA 2XAQA 5CLSA 3H92A 3HRMA 3RIRA 1IN4A 4ZH4F 5DCMB 1ON1A 4Q48A 1ZH5A 5DDGA 2KJCA 3E6DA 3SZTA 2H6BA 1ZGJA 5DD4A 1L3LA 3N4MA 2JRTA 2XUBA 1J75A 3LWFA 1G3SA 2BEOA 5LEKA 1Q1HA 3KLOA 4MGRA 4OU0A 3BPVA 3W6KB 4IHSA 2H94A 1SD6A 2DTRA 5HS9A 2PLYA 1LDDA 1LDKB 4QLCU 4IXAA 4HF2A 2DPDA 3KZYA 2W57A 2O6GE 2MBFA 2BYVE 1OPCA 3MCZA 4HF0A 4TV7A 1C0WA 4G9YA 3F3XA 5IT3A 4ON0A 2VC0A 5F64A 1U5TB 4B09A 5IT9Z 1AOYA 1BC7C 2V1UA 3GO5A 1F5TA 3R6SA 2E1CA 1TQPA 3WGGA 4A0YA 4AD9A 5J8FA 3H3ZA 2RV8A 2HZTA 3T1BA 1FLIA 5HLGA 3I59A 1W7PA 3WGHA 2EB7A 5LHGA 1CF7B 2X4HA 1DUXC 2P8TA 5D5XB 1K6OA 3SFZA 2AXLA 5FD5A 3CUQC 5DUKA 3LAPA 3LA7A 1IW7F 2VT3A 4HLYA 4YIIA 2IA0A 2FOKA 2NNNA 3V7RA 1BI2A 5E18F 4WXCA 1XDSA 5KVRA 1FP2A 1MJ9A 5LHHA 1HW1A 1R5HA 2IRFG 2DFIA 2GXGA 1KQ9A 1U6GA 2H09A 1B59A 4KMUX 4AIJA 2P4WA 4JBAA 4YFXF 3E97A 1V4RA 1B6AA 1XMKA 3FWEA 3TQNA 2VE8A 5D4RA 1U5TC 5BOXA 2P6SA 2PFBA 1R1UA 1LQ1A 4CXFA 3DEUA 2A69F 2V9VA 4LLNA 1R22A 3FF5A 5D5WB 2XKPA 3JTGA 1Z7UA 5LHIA 3FM5A 5ERIA 4EJVA 1Z9CA 1B4AA 3P9KA 2YU3A 1R58A 4EM1A 2A3SA 2FSWA 4IRHA 3J7AO 2W24A 1D8KA 3E6BA 2VN2A 4MEYF 2DPUA 4GO1A 3FMSA 4HA8A 1CF7A 1FC3A 3K69A 1MZBA 4IJAA 3F6OA 2BGCA 1R1VA 2F5EA 2NNYA 3B73A 1D3YA 2G7HA 2OZ6A 5DV5A 2R3SA 4HBLA 4HOBA 4LMYA 3LA2A 3GX4X 1MJAA 4L0YB 1U78A 1R1TA 3M9AA 3T8RA 2EFOA 2L02A 2KIUA 1T0FA 3DP7A 1O7LA 4G7ZF 1GHCA 1R5GA 3P9IA 3LQQA 2IJLA 1XGMA 5E17F 2K02A 4HYEA 5LRRA 5K5RA 3F8FA 2O3FA 2ZFWA 4DNCA 4I2OA 4A12A 2FU4A 4YIFA 2Y48A 5HVQC 1O57A 4XBFA 4WK8F 2OU2A 2VODA 3WTZA 5L3BA 1PP7U 3LA3A 3E5QA 1SFEA 4ZYHA 1TQIA 3IKVA 3Q9VA 3K1NA 1E17A 2FBIA 4U0YA 3WG9A 4AIKA 1QGPA 2LF8A 5HDNA 1S6LA 3RYRA 4BQAA 1P92A 3GWZA 1FOKA 4L5JA 3J80Z 5JVTA 1BI0A 1E2XA 2CG4A 4EJTA 1FWZA 3RKWA 3VOEA 2EFPA 4G8XA 1TW3A 2P5VA 3E6CC 4L5IA 4EJUA 3ECOA 1T38A 4XLNF 2HTJA 5BPIA 1YFHA 2OZUA 4EVIA 3B02A 5L3FA 2UWMA 2XHKA 2VC1A 3KCCA 3ZMVA 2IW5A 1J0RA 3CDHA 2LSOA 1XGOA 4L9TA 4IRIA 4MTEA 4HF1A 2ZXJA 5AIQA 3D5LA 4U7DA 3SQNA 3C1DA 1G3TA 3HSRA 1WRJA 1TQMA 3EQLF 3L9FA 2TDXA 3GLXA 3T5XA 3TO6A 5FFXA 1XB4A 1LEBA 2DQLA 4XRFA 3HIFA 1BBYA 4OIRF 3QRFF 4EGYA 2V1DA 3RKXA 3F21A 2STTA 3LQRA 2ZMEB 1ZLJA 3BZ6A 1G4DA 4KNYA 4I7HA 4A0ZA 2Z99A 5LLQA 4M9XA 5DEQA 2HS5A 2GQQA 1IXSB 3G73A 1G3WA 4PGHA 2ESNA 2W84A 2PEXA 3I64A 2EFWA 2HTSA 3KLNA 5LRSA 5F6FA 1DPRA 2NAZA 2Z9OA 4KIFA 3ABUA 1DPUA 4Y15A 2FBHA 3IKTA 3ZMUA 1IUYA 1LDJA 2PQ8A 4MNUA 1JXSA 3R0JA 3HTSB 2QBYB 3GZ5A 4I0AA 1R7JA 3JW4A 4FT8A 3E5XA 3KEQA 2GZWA 4HX4A 2A07F 2MA3A 4MQ9F 3GXOA 3F8BA 2J5PA 4XSZF 3DPTA 3ZPLA 3FMQA 2D45A 2FE3A 3KP6A 3NRVA 2G7UA 4RGXA 4ZZDA 1ULYA 1IXRC 1FPQA 4GCVA 1STZA 2E7WA 3EYIA 1S29A 3QP5A 3KZZA 4CHUA 3Q9SA 3V4GA 1F1ZA 2XKOA 1HKSA 4QWQA 2DQRA 3QOPA 4LFUA 1CGPA 4E70A 3EUHA 2YX4A 4UXNA 1RZ4A 3U1DA 3GF2A 3O3KA 4HV5A 2OD5A 1U5TA 5K5QA 4IHTA 3P9CA 2KRFA 2GA1A 4EGZA 2DT5A 1HW5A 2QZ8A 1XGSA 2VBWA 1W5TA 2GWRA 4A0XA 2UXXA 2F5CA 2FMLA 2L4AA 3HYIA 5L3CA 5CJ9A 4YG2F 4Q5SF 2FNAA 1FBSA 4PDKA 3WU1B 2EV0A 4WCGA 4UV9A 5ICFA 1R36A 3TOAA 3PQKA 5CVJA 1FYLA 5CVIA 3L09A 2HOEA 1MDMA 4F7ZA 1W7PD 3I58A 4UVBA 4FHTA 4S04A 2FQ3A 1QQIA 3DF8A 3HOSA 4ZYGA 1ZHFA 2BBYA 5E1XA 2RKHA 1F9NA 3ZMZA 4WXDA 2L54A 3GFIA 4A6EA 2GXBA 1FYKA 1AWCA 1ZG3A 1QBJA 2ZNYA 4KIBA 3WTTC 2YX7A 2PJPA 2K27A 3QP6A 4ENMA 5EEHA 1B9NA 1OR7A 3V7SA 4NQWA 2G9WA 1I27A 2HR3A 3KP7A 5ILUA 3K1MA 1HW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4M A;  1XMA A;  1JHH A;  1ZYR F;  3TDZ C;  1L0O C;  3ML6 A;  4HX7 A;  4A6D A;  1O3R A;  4KIG A;  1GXQ A;  3JAM Z;  4M9S A;  3QPH A;  4WXH A;  2Z3Y A;  2QM3 A;  4KIC A;  3PFI A;  4CIC A;  1USS A;  5ICG A;  4LB6 B;  3FHZ A;  1YTY A;  1B1B A;  2P7C B;  4RGR A;  1OYY A;  5FLX Z;  4L9J A;  1O3S A;  1QNT A;  1J2X A;  3M8E A;  1O3Q A;  3Q5F A;  3T8T A;  5D8L B;  4RGU A;  1TW2 A;  3CUQ B;  4IVN A;  2OQG A;  1FSE A;  1IAW A;  1KQ0 A;  1IRF A;  3VEP A;  2LF7 A;  3C7J A;  1ZAO A;  1KU3 A;  5CVV A;  2HYF A;  1LVA A;  2JSC A;  3F8N A;  1KGS A;  2A5Y B;  2RC4 A;  4PCQ A;  4ESF A;  2M87 A;  2XRO A;  3ISP A;  4GYG A;  1QZY A;  4KT5 C;  3KP2 A;  3FXR A;  2A6H F;  3HHG A;  2A68 F;  2WV0 A;  4EJW A;  1Y0U A;  4DQ2 A;  3GZ6 A;  2LKP A;  1G3Y A;  1V3F A;  1BJA A;  1WWX A;  3I71 A;  3I0T A;  4L0Z B;  4A5N A;  1MGT A;  1UFM A;  2MH2 A;  4KN7 X;  4FX4 A;  5D6F A;  4ZYE A;  1ZLK A;  1SD5 A;  1I6X A;  5DCM A;  5FO5 A;  1U2W A;  4ENJ A;  2CYY A;  2FRH A;  2MC3 A;  1IN8 A;  5E8I A;  3T0Y A;  2Z33 A;  4GYI A;  3J81 K;  3DXJ F;  5CVR A;  3PQJ A;  4NHJ A;  3P7N A;  3FXQ A;  3WTY C;  5JI6 A;  4U88 A;  2KIF A;  5D5U B;  2QQA A;  2ZME A;  1RUO A;  3M8F A;  4ZYD A;  2DK8 A;  3BDD A;  2XAJ A;  5E1Z B;  5ICC A;  3M1E A;  4R8H A;  2P5L C;  3S2W A;  4K2E A;  1FBU A;  3E6M A;  4PZJ A;  1BIB A;  2JTV A;  3KFW X;  2ISY A;  1IF1 A;  2HEO A;  1ODD A;  1Z05 A;  4ENK A;  1YG2 A;  4I09 A;  4HLX A;  4G7O F;  5H20 A;  3BRO A;  2VBX A;  1FX7 A;  2ZO4 A;  3FM3 A;  3BP8 A;  2RNJ A;  2C6Y A;  5BPD A;  3KE2 A;  2QEN A;  2IA1 A;  2CGP A;  5E1W A;  2IVM A;  5KK1 A;  4N9H A;  2V1X A;  2QWW A;  3V8J A;  4I01 A;  2L3D A;  5FFZ A;  1GXP A;  4EV0 A;  1D8J A;  2PN6 A;  3HUG A;  3M7G A;  2R7D A;  4H0E A;  2M5W A;  3G3Z A;  3R4K A;  1JE8 A;  5DYM A;  4GGG A;  4JQF A;  3RKY A;  1XSD A;  2MLK A;  4MHG A;  2CW0 F;  3IRR A;  4L18 B;  2LDU A;  1SFX A;  3LAJ A;  1Z6R A;  1OYI A;  1A04 A;  3F8C A;  1XSV A;  1KA8 A;  3IRQ A;  1YW8 A;  3WTS C;  2X0L A;  4OMY A;  4M74 A;  2ZBK A;  4EMS A;  4ASN A;  4CDG A;  1MKM A;  1SFU A;  5IT9 K;  4HW0 A;  2FMY A;  1YYV A;  2K7L A;  3DV8 A;  3HRS A;  1P4A A;  1HSJ A;  5FGM A;  2V79 A;  1BM9 A;  2EA4 A;  2M30 A;  3TDU C;  3AAF A;  4EQQ A;  2QUF A;  3RDI A;  2Y0M A;  2ESH A;  2ZKZ A;  2EFN A;  3EET A;  4O3M A;  2WC2 A;  4P55 A;  5BMZ A;  2ZNZ A;  3RYP A;  1YS7 A;  2JZY A;  1Z91 A;  3KET A;  3KP3 A;  1B9M A;  5A2Q Z;  5LGT A;  2MLG A;  3WE2 A;  4GXO A;  1RI7 A;  5LEJ A;  1BOA A;  2EWN A;  4AVP A;  3F23 A;  2IPQ X;  4LG0 A;  1G6N A;  4OIN F;  1BI3 A;  3DQV C;  2DLL A;  1R00 A;  4RS8 A;  2ZCW A;  1I1S A;  1JHF A;  1D5V A;  2W85 A;  2M1B A;  4B8X A;  3MZH A;  4BAY A;  3RTR A;  2Q2E A;  4IRG A;  2UZK A;  4KUM A;  2VON A;  2JPB A;  2NRA C;  2PI0 A;  5JR3 A;  1OKR A;  3DKW A;  1DP7 P;  4LK1 F;  4D0P A;  5DCF A;  3MFK A;  1P4W A;  4WWC A;  1SD7 A;  2K86 A;  2OAZ A;  5HS7 A;  1J59 A;  4BH9 A;  4HDV A;  3FX3 A;  4P96 A;  5D5V B;  3BJO A;  4KYW A;  2FXA A;  1TNS A;  2LNB A;  1IXC A;  3J81 Z;  4Y13 A;  3ABT A;  1ZRE A;  4RB3 C;  1IN5 A;  1QO0 D;  5K5O A;  2XRN A;  1P6R A;  1YO5 C;  1FNN A;  1I1G A;  5J8C A;  2CO5 A;  1XGN A;  4OOI A;  2HQR A;  1TBX A;  5E20 A;  3REO A;  1ZRD A;  2HQN A;  1KU7 A;  2QYO A;  3K2Z A;  3VFZ A;  3KP4 A;  3IWF A;  4PGG A;  1Z1D A;  3RPQ A;  2O03 A;  1YLF A;  2MD5 A;  1KU2 A;  1NHA A;  3DPL C;  3F72 A;  5H6Q A;  1KU9 A;  3FMR A;  1BIA A;  3F6V A;  1RIO H;  4HQM A;  1W5S A;  4M73 A;  3F8M A;  1MJB A;  1TLH B;  5L3D A;  1IN7 A;  2NYX A;  5AON A;  2PBI A;  4P9F A;  3HRT A;  3R60 A;  2DW4 A;  1GVJ A;  2XAH A;  3TGN A;  3V7C A;  2BV6 A;  1RUN A;  4UUV A;  2DO7 A;  3L00 A;  3WOD F;  5FD6 A;  4UHT A;  3CO7 C;  2EA2 A;  4OIO F;  4KA4 A;  2RDP A;  3HSF A;  4CYD A;  5L3G A;  5DUI A;  3K0L A;  1LEA A;  2P6T A;  3ZMD A;  3MZY A;  3JTH A;  2F5F A;  1TNT A;  2O0Y A;  2B0L A;  3FZV A;  1YW9 A;  5HS8 A;  1XDU A;  3FXU A;  2HKO A;  4XSX F;  1FT9 A;  5TJJ A;  1R23 A;  3CO6 C;  1HQC A;  3EDP A;  2A6E F;  2D2W A;  5F1R A;  4UVA A;  1LJ9 A;  3JAM K;  2A61 A;  1U3E M;  2FBK A;  2QQ9 A;  2AS5 F;  4ESB A;  3BOQ A;  4BNC A;  3ECH A;  4RB1 A;  3BJA A;  2WWY A;  2DK5 A;  4G94 A;  4EM0 B;  4LLL A;  4LLG F;  3BY6 A;  5L3E A;  3O6B B;  4HZF A;  2F2E A;  5BS6 A;  4M71 A;  2FEZ A;  3I59 B;  1YQA A;  5E8G A;  1U8R A;  2XAF A;  1ZAR A;  1WI9 A;  1REP C;  1SD4 A;  3WTX C;  3E5U A;  1RNL A;  5HDK A;  3CJN A;  2Q8K A;  4RB2 C;  2JT1 A;  1X3U A;  3MEX A;  2YSR A;  3W6J B;  2WTE A;  2UXN A;  2YR2 A;  4BYY A;  5FB2 A;  3WTV C;  2J5O A;  1UHW A;  2ELH A;  3ZN0 A;  2DI3 A;  5K1Y A;  2XGX A;  1S7A A;  3WTW C;  3QU6 A;  5HOO A;  4MEX F;  4JK1 X;  1FBQ A;  4UNO A;  3NEU A;  5LGN A;  4ETS A;  1T39 A;  2QQB A;  4HAM A;  1EH7 A;  4G6Q A;  4L9N A;  4Q4Z F;  3ZQ7 A;  4LK0 F;  2H27 A;  3U9G A;  4BHP A;  1KYZ A;  4I0B A;  3COA C;  1J7K A;  1K79 A;  1UST A;  4O6J A;  3GFL A;  5H6R A;  2ISZ A;  3IC7 A;  3ULQ B;  4ESJ A;  4P9U A;  5D4S A;  3V8L A;  3RI4 A;  4KN4 X;  1T98 A;  1S8N A;  1WKM A;  2QVO A;  5DD8 A;  2K4B A;  1ZRF A;  3I53 A;  4BXU A;  3CUQ A;  2Y75 A;  4OMZ A;  1YS6 A;  3OOP A;  5BQT A;  2O8X A;  2RGV A;  4MTD A;  4Q47 A;  1HKT A;  1FSH A;  4IPA A;  1K7A A;  3IL2 A;  3NQO A;  1T6S A;  1BC8 C;  2ZJ2 A;  5AIP A;  4FX0 A;  1ZN2 A;  1ZG1 A;  3MAJ A;  1H9T A;  5LGU A;  3C3W A;  1XSX A;  2EV6 A;  3MWM A;  1ON2 A;  1MDM B;  5ILV A;  4U0V A;  3RJP A;  4BHC A;  2HYG D;  3HOT A;  3HRU A;  2Q0O A;  2RVC A;  4S05 A;  2RQP A;  3LST A;  4U7B A;  1IN6 A;  4ENN A;  4KDP A;  4EM2 A;  3WGI A;  1BI1 A;  2DBB A;  2XAS A;  3TO9 A;  4UVC A;  3CUO A;  2M45 A;  2W25 A;  1VTN C;  1K78 A;  4N0B A;  1QPM A;  1F4K A;  4P5O A;  2HWV A;  4U0W A;  4KMF A;  1UHM A;  1XCV A;  2IA2 A;  3LFK A;  4RB0 A;  3CLO A;  1TTY A;  1O3T A;  2H6C A;  2BE5 F;  2EFQ A;  2F5D A;  2FA5 A;  5TRD A;  3BPX A;  3F22 A;  4KFC A;  1J5Y A;  1P4X A;  4O5V A;  2P7V B;  3BJ6 A;  3GVA A;  4LJZ F;  2OBP A;  2E7X A;  2OQR A;  4N9I A;  2HDC A;  2ACJ A;  1FZP B;  3K9T A;  1W7P B;  1XD7 A;  5FLX K;  1FYM A;  3ZMT A;  4LGW A;  1PUE E;  3K1P A;  3R61 A;  4CZZ A;  2CSO A;  5CVU A;  2XIG A;  4LG0 B;  1W4M A;  2V6C A;  1T2K A;  5D6E A;  1Z6T A;  4G7H F;  1EH8 A;  2KIM A;  1S3J A;  3DFG A;  4R1H A;  2HFH A;  3IHU A;  2VBY A;  4RGS A;  1LB2 A;  4LB5 A;  2FF4 A;  2OA4 A;  1QZZ A;  2FNP A;  5D8K B;  5LBQ A;  3I4P A;  5ILS A;  2VE9 A;  3KEO A;  1PP8 F;  2O61 A;  1IRG A;  3ROU A;  3ZN1 A;  2ADU A;  1HKQ A;  2KJB A;  2VOO A;  3ZP5 A;  1ZRC A;  2CQK A;  2YPR A;  2P5K A;  3KP5 A;  1I5Z A;  3QU3 A;  3QAH A;  1ZGA A;  1K78 B;  1DDN A;  1OYW A;  5EEG A;  4G6D A;  2R7F A;  1IZ1 A;  3VOD A;  1SAX A;  3EYY A;  3JSO A;  2D1V A;  3IWZ A;  4A5M A;  3U2R A;  2PMU A;  2EJR A;  4YFK F;  2D1H A;  2NS0 A;  2QBY A;  3VB2 A;  1H0M A;  2E1N A;  3GUD A;  4YFN F;  3ERE D;  3HHH A;  3SXY A;  5HLH A;  2CFX A;  4A2U A;  4WX9 A;  5J6X A;  3C18 A;  1FY7 A;  1JGS A;  3HTU A;  5HDG A;  2DAO A;  2EK5 A;  4M72 A;  3SHF A;  1J9I A;  5JFR A;  1LNW A;  5A2Q K;  4HDU A;  2PMH A;  5ED4 A;  1P2F A;  3R0A A;  3ZMS A;  4OIP F;  4CO8 A;  3OV8 A;  2GIV A;  3BWG A;  3WU0 A;  3J80 K;  4RAY A;  1FP1 D;  2ETH A;  3E3V A;  4IF4 A;  4HX8 A;  5ICE A;  3TO7 A;  3GFJ A;  6PAX A;  1XCB A;  1YIO A;  4RAZ A;  3GFM A;  2HKX A;  1KQ8 A;  2COM A;  3H3U A;  3TKY A;  3GYH X;  3HSE A;  1MD0 A;  4HQE A;  3N97 A;  3MQ0 A;  1S7O A;  1WQ2 A;  2K4J A;  4Z2Y A;  4I98 B;  4XLP F;  1H9G A;  1EH6 A;  2XV4 S;  2IP2 A;  2VXZ A;  2STW A;  3JSP A;  4L9V A;  1ZG5 A;  3L7W A;  1SMT A;  3TOB A;  1HST A;  4R79 A;  1HBX G;  3ELK A;  4CGZ A;  2VOP A;  4MQV A;  2KKO A;  3I54 A;  1WSU A;  2PG4 A;  2QLZ A;  2EV5 A;  2XAG A;  4WF2 A;  3GEZ A;  2IT0 A;  4ZZL A;  5JHU A;  1YW7 A;  4BHB A;  3I5U A;  4M6X A;  3WTU C;  1BN5 A;  2HGC A;  4AIH A;  1ONV A;  1EV7 A;  2M8E A;  2CWE A;  2L01 A;  4M9Z A;  2JPC A;  4OIQ F;  1PDN C;  1UCR A;  1XN7 A;  4LD5 A;  2MH9 A;  2GAU A;  4AWX B;  4NB5 A;  1HXD A;  4EJO A;  3D0S A;  3GW2 A;  3L2C A;  3SZP A;  3V8K A;  2DU9 A;  5HLI A;  3WE3 A;  4I02 A;  3QPT A;  2Z5U A;  4UV8 A;  4M6Y A;  1OMI A;  1UB9 A;  2XVC A;  3O2P E;  2GA2 A;  4HV6 A;  2RN7 A;  5CYV A;  1SMY F;  2VBZ A;  4Y17 A;  3CTA A;  1O7F A;  3RPU A;  2VT2 A;  1KYW A;  2XAQ A;  5CLS A;  3H92 A;  3HRM A;  3RIR A;  1IN4 A;  4ZH4 F;  5DCM B;  1ON1 A;  4Q48 A;  1ZH5 A;  5DDG A;  2KJC A;  3E6D A;  3SZT A;  2H6B A;  1ZGJ A;  5DD4 A;  1L3L A;  3N4M A;  2JRT A;  2XUB A;  1J75 A;  3LWF A;  1G3S A;  2BEO A;  5LEK A;  1Q1H A;  3KLO A;  4MGR A;  4OU0 A;  3BPV A;  3W6K B;  4IHS A;  2H94 A;  1SD6 A;  2DTR A;  5HS9 A;  2PLY A;  1LDD A;  1LDK B;  4QLC U;  4IXA A;  4HF2 A;  2DPD A;  3KZY A;  2W57 A;  2O6G E;  2MBF A;  2BYV E;  1OPC A;  3MCZ A;  4HF0 A;  4TV7 A;  1C0W A;  4G9Y A;  3F3X A;  5IT3 A;  4ON0 A;  2VC0 A;  5F64 A;  1U5T B;  4B09 A;  5IT9 Z;  1AOY A;  1BC7 C;  2V1U A;  3GO5 A;  1F5T A;  3R6S A;  2E1C A;  1TQP A;  3WGG A;  4A0Y A;  4AD9 A;  5J8F A;  3H3Z A;  2RV8 A;  2HZT A;  3T1B A;  1FLI A;  5HLG A;  3I59 A;  1W7P A;  3WGH A;  2EB7 A;  5LHG A;  1CF7 B;  2X4H A;  1DUX C;  2P8T A;  5D5X B;  1K6O A;  3SFZ A;  2AXL A;  5FD5 A;  3CUQ C;  5DUK A;  3LAP A;  3LA7 A;  1IW7 F;  2VT3 A;  4HLY A;  4YII A;  2IA0 A;  2FOK A;  2NNN A;  3V7R A;  1BI2 A;  5E18 F;  4WXC A;  1XDS A;  5KVR A;  1FP2 A;  1MJ9 A;  5LHH A;  1HW1 A;  1R5H A;  2IRF G;  2DFI A;  2GXG A;  1KQ9 A;  1U6G A;  2H09 A;  1B59 A;  4KMU X;  4AIJ A;  2P4W A;  4JBA A;  4YFX F;  3E97 A;  1V4R A;  1B6A A;  1XMK A;  3FWE A;  3TQN A;  2VE8 A;  5D4R A;  1U5T C;  5BOX A;  2P6S A;  2PFB A;  1R1U A;  1LQ1 A;  4CXF A;  3DEU A;  2A69 F;  2V9V A;  4LLN A;  1R22 A;  3FF5 A;  5D5W B;  2XKP A;  3JTG A;  1Z7U A;  5LHI A;  3FM5 A;  5ERI A;  4EJV A;  1Z9C A;  1B4A A;  3P9K A;  2YU3 A;  1R58 A;  4EM1 A;  2A3S A;  2FSW A;  4IRH A;  3J7A O;  2W24 A;  1D8K A;  3E6B A;  2VN2 A;  4MEY F;  2DPU A;  4GO1 A;  3FMS A;  4HA8 A;  1CF7 A;  1FC3 A;  3K69 A;  1MZB A;  4IJA A;  3F6O A;  2BGC A;  1R1V A;  2F5E A;  2NNY A;  3B73 A;  1D3Y A;  2G7H A;  2OZ6 A;  5DV5 A;  2R3S A;  4HBL A;  4HOB A;  4LMY A;  3LA2 A;  3GX4 X;  1MJA A;  4L0Y B;  1U78 A;  1R1T A;  3M9A A;  3T8R A;  2EFO A;  2L02 A;  2KIU A;  1T0F A;  3DP7 A;  1O7L A;  4G7Z F;  1GHC A;  1R5G A;  3P9I A;  3LQQ A;  2IJL A;  1XGM A;  5E17 F;  2K02 A;  4HYE A;  5LRR A;  5K5R A;  3F8F A;  2O3F A;  2ZFW A;  4DNC A;  4I2O A;  4A12 A;  2FU4 A;  4YIF A;  2Y48 A;  5HVQ C;  1O57 A;  4XBF A;  4WK8 F;  2OU2 A;  2VOD A;  3WTZ A;  5L3B A;  1PP7 U;  3LA3 A;  3E5Q A;  1SFE A;  4ZYH A;  1TQI A;  3IKV A;  3Q9V A;  3K1N A;  1E17 A;  2FBI A;  4U0Y A;  3WG9 A;  4AIK A;  1QGP A;  2LF8 A;  5HDN A;  1S6L A;  3RYR A;  4BQA A;  1P92 A;  3GWZ A;  1FOK A;  4L5J A;  3J80 Z;  5JVT A;  1BI0 A;  1E2X A;  2CG4 A;  4EJT A;  1FWZ A;  3RKW A;  3VOE A;  2EFP A;  4G8X A;  1TW3 A;  2P5V A;  3E6C C;  4L5I A;  4EJU A;  3ECO A;  1T38 A;  4XLN F;  2HTJ A;  5BPI A;  1YFH A;  2OZU A;  4EVI A;  3B02 A;  5L3F A;  2UWM A;  2XHK A;  2VC1 A;  3KCC A;  3ZMV A;  2IW5 A;  1J0R A;  3CDH A;  2LSO A;  1XGO A;  4L9T A;  4IRI A;  4MTE A;  4HF1 A;  2ZXJ A;  5AIQ A;  3D5L A;  4U7D A;  3SQN A;  3C1D A;  1G3T A;  3HSR A;  1WRJ A;  1TQM A;  3EQL F;  3L9F A;  2TDX A;  3GLX A;  3T5X A;  3TO6 A;  5FFX A;  1XB4 A;  1LEB A;  2DQL A;  4XRF A;  3HIF A;  1BBY A;  4OIR F;  3QRF F;  4EGY A;  2V1D A;  3RKX A;  3F21 A;  2STT A;  3LQR A;  2ZME B;  1ZLJ A;  3BZ6 A;  1G4D A;  4KNY A;  4I7H A;  4A0Z A;  2Z99 A;  5LLQ A;  4M9X A;  5DEQ A;  2HS5 A;  2GQQ A;  1IXS B;  3G73 A;  1G3W A;  4PGH A;  2ESN A;  2W84 A;  2PEX A;  3I64 A;  2EFW A;  2HTS A;  3KLN A;  5LRS A;  5F6F A;  1DPR A;  2NAZ A;  2Z9O A;  4KIF A;  3ABU A;  1DPU A;  4Y15 A;  2FBH A;  3IKT A;  3ZMU A;  1IUY A;  1LDJ A;  2PQ8 A;  4MNU A;  1JXS A;  3R0J A;  3HTS B;  2QBY B;  3GZ5 A;  4I0A A;  1R7J A;  3JW4 A;  4FT8 A;  3E5X A;  3KEQ A;  2GZW A;  4HX4 A;  2A07 F;  2MA3 A;  4MQ9 F;  3GXO A;  3F8B A;  2J5P A;  4XSZ F;  3DPT A;  3ZPL A;  3FMQ A;  2D45 A;  2FE3 A;  3KP6 A;  3NRV A;  2G7U A;  4RGX A;  4ZZD A;  1ULY A;  1IXR C;  1FPQ A;  4GCV A;  1STZ A;  2E7W A;  3EYI A;  1S29 A;  3QP5 A;  3KZZ A;  4CHU A;  3Q9S A;  3V4G A;  1F1Z A;  2XKO A;  1HKS A;  4QWQ A;  2DQR A;  3QOP A;  4LFU A;  1CGP A;  4E70 A;  3EUH A;  2YX4 A;  4UXN A;  1RZ4 A;  3U1D A;  3GF2 A;  3O3K A;  4HV5 A;  2OD5 A;  1U5T A;  5K5Q A;  4IHT A;  3P9C A;  2KRF A;  2GA1 A;  4EGZ A;  2DT5 A;  1HW5 A;  2QZ8 A;  1XGS A;  2VBW A;  1W5T A;  2GWR A;  4A0X A;  2UXX A;  2F5C A;  2FML A;  2L4A A;  3HYI A;  5L3C A;  5CJ9 A;  4YG2 F;  4Q5S F;  2FNA A;  1FBS A;  4PDK A;  3WU1 B;  2EV0 A;  4WCG A;  4UV9 A;  5ICF A;  1R36 A;  3TOA A;  3PQK A;  5CVJ A;  1FYL A;  5CVI A;  3L09 A;  2HOE A;  1MDM A;  4F7Z A;  1W7P D;  3I58 A;  4UVB A;  4FHT A;  4S04 A;  2FQ3 A;  1QQI A;  3DF8 A;  3HOS A;  4ZYG A;  1ZHF A;  2BBY A;  5E1X A;  2RKH A;  1F9N A;  3ZMZ A;  4WXD A;  2L54 A;  3GFI A;  4A6E A;  2GXB A;  1FYK A;  1AWC A;  1ZG3 A;  1QBJ A;  2ZNY A;  4KIB A;  3WTT C;  2YX7 A;  2PJP A;  2K27 A;  3QP6 A;  4ENM A;  5EEH A;  1B9N A;  1OR7 A;  3V7S A;  4NQW A;  2G9W A;  1I27 A;  2HR3 A;  3KP7 A;  5ILU A;  3K1M A;  1HW2 A; 
#chains in the Genus database with same CATH topology
 2K9N A;  2L4M A;  2LY9 A;  1XMA A;  1JHH A;  1JI8 A;  1ZYR F;  2ZME C;  3TDZ C;  3N05 A;  2R0Q C;  1L0O C;  4FQG A;  2KRC A;  2EPF A;  2NVQ J;  1T0F C;  3W2A A;  3ML6 A;  4HX7 A;  4A6D A;  1O3R A;  3BG5 A;  3NWS A;  2Z16 A;  1R5I D;  4KIG A;  1GXQ A;  3S2D J;  3VSK A;  3JAM Z;  4M9S A;  3QPH A;  4WXH A;  2VL8 A;  3F0C A;  2Z3Y A;  1K4T A;  2DXI A;  2HI3 A;  3L2R A;  2DDB A;  4A3F J;  2QM3 A;  4CSW A;  4KIC A;  3PFI A;  4CIC A;  1USS A;  5ICG A;  4LB6 B;  4CCO A;  2HDD A;  4C3H J;  3FHZ A;  1DGR M;  1RR7 A;  1NK3 P;  5CQG A;  2YU9 J;  1YTY A;  1B1B A;  2P7C B;  4RGR A;  1OYY A;  2E34 A;  5FLX Z;  4L9J A;  2KLO A;  3ONQ A;  2WAQ N;  1O3S A;  3G71 I;  1QNT A;  1J2X A;  3M8E A;  5EG0 B;  1O3Q A;  3Q5F A;  1AKH A;  2LRD A;  4M3F A;  3T8T A;  3LNQ A;  5D8L B;  4RGU A;  4ANJ A;  1TW2 A;  1MH4 A;  3CUQ B;  4NBQ A;  2XB0 X;  1X4O A;  4CCJ A;  3BT9 A;  3MKW B;  4IVN A;  2OQG A;  4S0H B;  1FSE A;  1IAW A;  2GIZ A;  1KQ0 A;  2YS9 A;  1IRF A;  3KYD B;  2DMP A;  3VEP A;  2LF7 A;  3C7J A;  1ZAO A;  1KU3 A;  2P0W A;  1K83 J;  1LVK A;  2CMP A;  3BLY A;  5CVV A;  2HYF A;  1LVA A;  2K3F A;  5EF6 A;  2JSC A;  2Y0S A;  5K7H A;  3S93 A;  3F8N A;  1KGS A;  2F4M B;  2A5Y B;  2RC4 A;  3CJR B;  4PCQ A;  2CW8 A;  2COB A;  4ESF A;  2M87 A;  4AC0 A;  2XRO A;  3ISP A;  4GYG A;  1OCO H;  1W0U A;  1QZY A;  3S1N J;  1Z3X A;  4KT5 C;  1Y1W J;  3KP2 A;  3CC2 I;  1Z21 A;  3DBR B;  1X1D A;  3FXR A;  3HB9 A;  2A6H F;  5KNL A;  1QZE A;  2A68 F;  2WV0 A;  3HHG A;  2NOJ B;  2VIX A;  3GTQ J;  4EJW A;  1SVL A;  1I39 A;  1Y0U A;  2E1M C;  2V9K A;  3B6A A;  5DS9 A;  2W82 A;  4DQ2 A;  2XGE A;  3GZ6 A;  1QPI A;  2LKP A;  5M5Y J;  1X2M A;  1G3Y A;  1V3F A;  3RPU D;  1BJA A;  1UG0 A;  2HOS A;  3CCJ I;  4E7Z A;  5FRO A;  1FTZ A;  1WWX A;  1ETK A;  3I71 A;  3HPH A;  3I0T A;  5DM7 F;  4L0Z B;  2DMQ A;  4A5N A;  1MGT A;  1UFM A;  1FOW A;  3OYD A;  5IYB J;  2MH2 A;  1NTC A;  4KN7 X;  4FX4 A;  5D6F A;  2HVR A;  1LUJ B;  2K85 A;  2BHY A;  4ZYE A;  1ZLK A;  4PFO A;  3CDL A;  1SD5 A;  1I6X A;  2BY1 A;  4V2F A;  3HBL A;  1MMN A;  5DCM A;  3ZOB A;  2IEK A;  5FO5 A;  1U2W A;  3LL7 A;  3CCR I;  4OWR B;  4ENJ A;  1TC3 C;  2CYY A;  2MC3 A;  2FRH A;  1EA3 A;  1IN8 A;  2KHM A;  3PNT A;  4RAF A;  5E8I A;  2W00 A;  1WPK A;  4LG3 A;  3T0Y A;  3DTE A;  4BJ5 C;  4BY1 J;  2Z33 A;  3HDD A;  2Q2E B;  4GYI A;  3J81 K;  3DXJ F;  5CVR A;  2XGD A;  3PQJ A;  4NHJ A;  3P7N A;  3FXQ A;  1N78 A;  3WTY C;  3CD6 I;  5JI6 A;  2R92 J;  4U88 A;  3A01 B;  3LSM A;  2LR8 A;  2M4G A;  2KIF A;  5D5U B;  2QQA A;  2ZME A;  1RUO A;  3M8F A;  4ZYD A;  2BZT A;  2DK8 A;  1J09 A;  3MZ8 A;  4JYK A;  3BDD A;  2XAJ A;  2MD0 A;  5E1Z B;  1DU6 A;  5ICC A;  1T33 A;  3M1E A;  4R8H A;  1EF4 A;  2P5L C;  4DW6 A;  3S2W A;  3VYR B;  3CCQ I;  4K2E A;  1FBU A;  2R7S A;  3KYL A;  3E6M A;  4PZJ A;  2H8R A;  3M8J A;  1BIB A;  2JTV A;  3L2Q A;  1OFC X;  1MIJ A;  2QKL B;  3KFW X;  2ISY A;  3BR1 A;  3LSH A;  1IF1 A;  1X1B A;  2HEO A;  2WBM A;  1ODD A;  1Z05 A;  3NAR A;  1WVR A;  1YG2 A;  4ENK A;  2AXT C;  4I09 A;  4HLX A;  3DU6 A;  4G7O F;  5H20 A;  3QQA A;  3BRO A;  2HXI A;  5FKN A;  2VBX A;  3IV5 A;  1FX7 A;  1CQT A;  2ZO4 A;  4B44 A;  3FM3 A;  3BP8 A;  1S72 I;  4GDF A;  5F1J A;  3TP3 A;  2RNJ A;  2C6Y A;  2K9M A;  5BPD A;  3KE2 A;  2EIK H;  2QEN A;  2IA1 A;  4A3J J;  3DKY A;  5DTD A;  2CGP A;  1ACI A;  3K7A J;  5E1W A;  4ZDL A;  2IVM A;  2JN6 A;  5KK1 A;  3OYG A;  5FJ8 J;  4N9H A;  3AG1 H;  4XNF A;  2BY3 A;  3H3V K;  4ABZ A;  5JLW A;  2QQ8 A;  5IY5 H;  2L7M P;  3UKG A;  3S3O A;  3LSR A;  2D5V A;  1Z77 A;  2F6C A;  2V1X A;  3OR1 C;  4C2T A;  1YIT I;  4B47 A;  1SFO J;  2BOL A;  2QWW A;  5J40 A;  4I01 A;  2L3D A;  2VKD A;  1MMG A;  3V8J A;  5FFZ A;  2Y9Z A;  4EV0 A;  1GXP A;  1D8J A;  3PJR A;  2LY1 A;  2L7K A;  2PN6 A;  2R5Y A;  3FIS A;  3HUG A;  2R7D A;  3M7G A;  4H0E A;  3A2K A;  2M5W A;  3G3Z A;  3R4K A;  4AID A;  1JE8 A;  4Y52 J;  5DYM A;  4GGG A;  4JQF A;  1BR4 A;  2RNG A;  3RKY A;  1XSD A;  2MLK A;  4BS9 A;  2E36 A;  1Y8Q B;  4MHG A;  3JRB A;  2CW0 F;  3IRR A;  1BOB A;  2KL4 A;  4L18 B;  2E2I J;  2LDU A;  3FBI B;  1SFX A;  1NH3 A;  2R7R A;  1TWA J;  3LAJ A;  1ZKG A;  3K4B A;  5FKK A;  4ZTJ A;  3ZR8 X;  1VQ5 I;  1Z6R A;  3DLL F;  1OYI A;  4BBR J;  1A04 A;  5K7F A;  3F8C A;  1XSV A;  4BDY A;  2Y31 A;  1XS9 A;  1KA8 A;  3CC4 I;  5B1B H;  1YW8 A;  3WTS C;  3IRQ A;  1GVD A;  1Q1V A;  2X0L A;  3FK7 A;  1N77 A;  4OMY A;  4M74 A;  2ZBK A;  9ANT A;  4EMS A;  4M6V A;  4ASN A;  4CDG A;  1VQO I;  1MKM A;  2VPR A;  1SFU A;  2CUJ A;  2WAF A;  5IT9 K;  4HW0 A;  2F4I A;  4GRI A;  3FKJ A;  2IAI A;  2FMY A;  3MVP A;  1YYV A;  4BY7 J;  2MAB A;  2K7L A;  5E79 C;  2OJE D;  1LFU P;  4I76 A;  2A05 A;  3DV8 A;  3HRS A;  1P4A A;  2BXY A;  2GOX B;  2CH0 A;  1R6R A;  3KX2 A;  2F4O B;  2GXA A;  1HSJ A;  2IS2 A;  3U21 A;  1HC8 A;  1MMD A;  5FGM A;  2Y2Z A;  1HLV A;  2V79 A;  1X3W B;  4XRS A;  1BM9 A;  1NG7 A;  2EA4 A;  2M30 A;  3TDU C;  3AAF A;  4EQQ A;  2JA2 A;  2NS7 A;  1ETO A;  2QUF A;  3SYT A;  1JGG A;  3PSI A;  4H4K C;  1U9N A;  2Y0M A;  3RDI A;  2ESH A;  2ZKZ A;  2EFN A;  2ZJR F;  3EET A;  4O3M A;  2WC2 A;  4P55 A;  5BMZ A;  2ZNZ A;  3RYP A;  4XLE A;  1YS7 A;  2Z2S B;  4L5E A;  4XKC A;  4E6K G;  1QA6 A;  2JZY A;  4I99 C;  2XSD C;  4JX4 A;  5KHD A;  1Z91 A;  2RRE A;  3KET A;  1POG A;  3KP3 A;  1B9M A;  2WAD A;  5A2Q Z;  5LGT A;  2MLG A;  4NC8 A;  3WE2 A;  4GXO A;  1RI7 A;  5LEJ A;  1BOA A;  2EWN A;  4AVP A;  3F23 A;  1SVO A;  2IPQ X;  2ECB A;  1G6N A;  4LG0 A;  4OIN F;  3DQV C;  1BI3 A;  2DLL A;  1R00 A;  4RS8 A;  2ZCW A;  1I1S A;  1JHF A;  3RQ4 A;  1D5V A;  3I4M J;  2VQL A;  4A3K J;  5J1R A;  2W85 A;  3FXK A;  4RM3 A;  2VXD A;  2M1B A;  4B8X A;  3MZH A;  2LFB A;  4EAT A;  3EUK L;  1VQ4 I;  4BAY A;  3RTR A;  2Q2E A;  4IRG A;  2FQ4 A;  5GTH C;  2B9S A;  2UZK A;  4XOP A;  4KUM A;  4CCM A;  2VON A;  2JPB A;  2MW8 A;  4F52 A;  2NRA C;  2PI0 A;  5JR3 A;  1OKR A;  3DEW A;  3DKW A;  1DP7 P;  1VZ0 A;  3TW6 A;  2EIL H;  4LK1 F;  4RA2 A;  1OCP A;  2VI6 A;  4D0P A;  5DCF A;  3MFK A;  2WB1 A;  2IS1 A;  3PIO F;  4BEH B;  1P4W A;  2EBI A;  4WWC A;  4BDZ A;  4AYB A;  1SD7 A;  2QSG X;  2K86 A;  2OAZ A;  5HS7 A;  1J59 A;  4KIS A;  2XPU A;  2XAU A;  4BH9 A;  4HDV A;  3FX3 A;  4P96 A;  3L2V A;  5D5V B;  2QSF X;  2R7Z J;  2HPM A;  3BQZ A;  4M3D A;  3BJO A;  4KYW A;  2FXA A;  1TNS A;  2LNB A;  4GFB A;  5M5W J;  1IXC A;  2ZXI A;  1AKH B;  2LKS A;  3NWT A;  4A3B J;  3J81 Z;  4Y13 A;  2XPV A;  1ORK A;  3ABT A;  3PIP F;  1WI3 A;  1UZC A;  1ZRE A;  4RB3 C;  1IN5 A;  1E3O C;  3QYB A;  1QO0 D;  5K5O A;  2XRN A;  1IV8 A;  1P6R A;  1YO5 C;  1FNN A;  1X2N A;  1I1G A;  3LOC A;  1E3P A;  5J8C A;  1Y39 A;  1BA5 A;  4IHY A;  3F9K A;  3OSG A;  2WV1 A;  2ZXH A;  1XGN A;  2CO5 A;  1O4X A;  3K70 C;  4HRI A;  3DU5 A;  3ABM H;  4OOI A;  1ETX A;  1TBX A;  2HQR A;  5E20 A;  5F04 A;  3REO A;  4CCL A;  1ZRD A;  1KON A;  2HQN A;  1KU7 A;  2QYO A;  3K4M A;  3K2Z A;  3VFZ A;  1VQM I;  3KP4 A;  4C2U A;  5J1U A;  4XMY A;  3IWF A;  3L1P A;  1VQ7 I;  4PGG A;  3PNY A;  3OYL A;  1Z1D A;  3RPQ A;  1QVT A;  4N4O B;  3ZCO A;  2O03 A;  4BQQ A;  5LFA A;  2R5Y B;  2JA8 J;  1YLF A;  2MD5 A;  1KU2 A;  1NHA A;  3DPL C;  3QPS A;  2H8W A;  4FTH A;  1GV5 A;  1BW5 A;  2DCE A;  2JVG A;  3E7L A;  2DJI A;  3F72 A;  5H6Q A;  2BW3 A;  1KU9 A;  3FMR A;  5B66 C;  1BIA A;  2DT6 A;  3F6V A;  1RIO H;  3A4C A;  4HQM A;  3ASO H;  1R4N B;  2V1N A;  1MBG A;  2AQF A;  3GTG J;  1W5S A;  4M73 A;  3F8M A;  1MJB A;  1TLH B;  5L3D A;  4D9J A;  4QPO A;  1IN7 A;  2NYX A;  2DOA A;  5AON A;  1D5Y A;  2K9Q A;  2PBI A;  1JJ6 C;  4P9F A;  3HRT A;  4UUS B;  3R60 A;  2DW4 A;  4NQW B;  4MFD A;  1GVJ A;  3H0G J;  2ZSH B;  3K4N A;  2XAH A;  3JRI A;  2MFZ A;  5EZG A;  3RZO J;  3AG3 H;  3TGN A;  3V7C A;  2BV6 A;  3CMA I;  1RUN A;  3HOW J;  4UUV A;  1RC9 A;  3ERM A;  2DO7 A;  1ETV A;  3BTC A;  3L00 A;  3WOD F;  2BY0 A;  4W1U A;  5EGO A;  2MG4 A;  5B1A H;  5FD6 A;  3JRH A;  4UHT A;  3CO7 C;  3C2H A;  2EA2 A;  4OIO F;  4KA4 A;  1IO2 A;  2RDP A;  1T08 B;  2ICW G;  5F0H A;  2ZSI B;  3HKZ N;  3HSF A;  5M5X J;  1JUP A;  2R7T A;  4CYD A;  5L3G A;  5DUI A;  3ABK H;  1YI2 I;  1XTA A;  2CJJ A;  2DYS H;  3K0L A;  1LEA A;  1MH3 A;  1WJA A;  1MW7 A;  2P6T A;  3ZMD A;  5IOZ A;  3MZY A;  3JTH A;  2F5F A;  1TNT A;  2O0Y A;  2DA1 A;  2B0L A;  3DTI A;  3FZV A;  4YEJ A;  2L0K A;  5FLM J;  1YW9 A;  1A6I A;  5HS8 A;  3OS0 A;  2E1O A;  2X6O A;  2FUG 2;  4XN0 A;  1SAN A;  1XDU A;  3FXU A;  2HKO A;  2BXZ A;  4XSX F;  1FT9 A;  4ZDO A;  4RDU A;  5TJJ A;  1R23 A;  4HEA 2;  3CO6 C;  1HQC A;  3EDP A;  2A6E F;  2D2W A;  3DEE A;  5F1R A;  2CS3 A;  3M3Y J;  3G1O A;  4UVA A;  1UAA A;  1LJ9 A;  1BL0 A;  3JAM K;  1ZQ3 P;  4ZC3 A;  1W1W E;  2A61 A;  4I6Z A;  1U3E M;  1MMS A;  1OIS A;  2FBK A;  2QQ9 A;  2AS5 F;  1G8X A;  4ESB A;  3BOQ A;  5HOD A;  3D1N I;  4HPQ A;  4BNC A;  4X6A J;  3ECH A;  2M7A A;  2OC6 A;  4RB1 A;  4BJ6 C;  5J3L A;  2V26 A;  4XK4 A;  2EZK A;  5EZH A;  4E7I A;  5GPC A;  4A3C J;  2ME6 A;  3BJA A;  3BR5 A;  2B7E A;  2LMD A;  2WWY A;  2DK5 A;  2YUS A;  4G94 A;  4EM0 B;  1MMA A;  4LLL A;  1B72 B;  4LLG F;  3BY6 A;  3DBL B;  4BXX J;  1A6Q A;  2R7Q A;  3DLA A;  4JX5 A;  1XG1 A;  1JJ8 C;  3PUF A;  5L3E A;  3O6B B;  4HZF A;  4KT6 A;  2FOW A;  4AM3 A;  1GDT A;  2F2E A;  2CV1 A;  1ETY A;  5BS6 A;  4M71 A;  5E3O A;  5EYR A;  2FEZ A;  3I59 B;  1YQA A;  1HF0 A;  2AHQ A;  4UB6 C;  5KCM A;  2OPT A;  5E8G A;  1U8R A;  3GTM J;  3V42 A;  2XAF A;  1ZAR A;  1OR7 C;  4C30 A;  1QHH D;  1TWH J;  4XN3 A;  1WI9 A;  2L9S A;  4PUS A;  1REP C;  2DTZ A;  2P81 A;  2Y0S N;  5JLX A;  4AU7 A;  1SD4 A;  3WTX C;  3E5U A;  1Z67 A;  2X85 A;  1RNL A;  5HDK A;  3CJN A;  3FDY A;  3OR2 C;  2Q8K A;  1S5L C;  3IH4 A;  4RB2 C;  2JT1 A;  4F3Q A;  1X3U A;  3JRF A;  1VI0 A;  3MEX A;  5FRN A;  2YSR A;  3W6J B;  2WTE A;  3PUB A;  2UXN A;  2WA0 A;  5J1Y A;  2YR2 A;  4BYY A;  5FB2 A;  3WTV C;  4BQN A;  3NAU A;  3FXL A;  2J5O A;  3IH2 A;  1UHW A;  2ELH A;  3ZN0 A;  1TZL A;  2DI3 A;  3C2G A;  5K1Y A;  2VQH A;  2XGX A;  1DP3 A;  2E5N A;  1S7A A;  3WTW C;  3QU6 A;  5HOO A;  4MEX F;  4JK1 X;  1FBQ A;  3K2A A;  3NEU A;  4XIC A;  5LGN A;  4UNO A;  3D5S C;  4ETS A;  3LSI A;  1T8I A;  1T39 A;  3LMM A;  2QQB A;  3DBH B;  4HAM A;  3RQI A;  1W36 C;  4B3X A;  1Y1V J;  1EH7 A;  2L9N A;  3G2B A;  4G6Q A;  3HKZ A;  4L9N A;  3ZQ7 A;  4Q4Z F;  3GTP J;  2V9P A;  4LK0 F;  2H27 A;  3U9G A;  1WH7 A;  4BHP A;  3QYE A;  2V4J C;  1KYZ A;  3BC8 A;  4I0B A;  3COA C;  3I9V 2;  1J7K A;  4XID A;  1K79 A;  5GTI C;  1UST A;  4O6J A;  3AL0 C;  3GFL A;  4C9Y A;  5H6R A;  2ISZ A;  3IC7 A;  3CLQ A;  3HC7 A;  3ULQ B;  1MSE C;  3W2W A;  4ESJ A;  3S2H J;  4P9U A;  5D4S A;  4B4C A;  3V8L A;  1A36 A;  5IYD J;  3RI4 A;  2BVL A;  2EZL A;  2K5C A;  4KN4 X;  1T98 A;  2O8K A;  1S8N A;  1AA7 A;  1WKM A;  2QVO A;  2XGC A;  5DD8 A;  3H36 A;  2K4B A;  4MO7 A;  3I53 A;  1ZRF A;  3AG4 H;  2X1C A;  4BXU A;  4C3I J;  3CUQ A;  1G59 A;  2Y75 A;  4KJZ A;  2JA6 J;  2W48 A;  3LSG A;  4OMZ A;  1AHD P;  1YS6 A;  3OOP A;  5BQT A;  2O8X A;  3Q3S A;  4XR6 A;  1NK2 P;  4BQO A;  3CDI A;  2RGV A;  4G6T B;  4MTD A;  3RCO A;  2W1O A;  4Q47 A;  1HKT A;  1FSH A;  4HG2 A;  1QRY A;  4IPA A;  1K7A A;  4Y3O A;  3LFU A;  3O8H A;  3IL2 A;  3NQO A;  1T6S A;  3WHC A;  1BC8 C;  5E3N A;  1KZH A;  2ZJ2 A;  5AIP A;  2LVS A;  4FX0 A;  1ZN2 A;  2JSP A;  5J4Y A;  4HSR A;  3CCY A;  1ZG1 A;  3PFY A;  4IHV A;  3MAJ A;  1H9T A;  2ELJ A;  2ID6 A;  5LGU A;  3ESW B;  3BZK A;  3C3W A;  1XSX A;  2CV2 A;  3G6E I;  1IGN A;  2EV6 A;  3MWM A;  4FIS A;  1ON2 A;  1MDM B;  5ILV A;  4U0V A;  2KIS A;  3OYF A;  2XF7 A;  2ID3 A;  1X1P A;  3RJP A;  1JT0 A;  4BHC A;  2DFH A;  2HYG D;  3HOT A;  1D1B A;  3HRU A;  1K4S A;  2Q0O A;  4XLF A;  3G4S I;  4LOC A;  2CQX A;  3BTI A;  1WH5 A;  2NXN B;  2RVC A;  5M3F J;  4M3G A;  1D1A A;  1I50 J;  4A3D J;  4S05 A;  2Y69 H;  3HOZ J;  4OAY A;  2RQP A;  4XLA A;  1D1C A;  3LST A;  1IC8 A;  1F36 A;  4NC7 A;  2QA4 I;  3FK6 A;  4U7B A;  4C3J J;  2QF7 A;  1IN6 A;  4ENN A;  4KDP A;  4EM2 A;  1TWG J;  3WGI A;  1BI1 A;  2LOO A;  3GTO J;  1ETW A;  2DBB A;  2DMT A;  2X6Y A;  2XAS A;  3H9J A;  3TO9 A;  1VQ9 I;  4UVC A;  3BCA A;  5E3M A;  2O7O A;  3CUO A;  2M45 A;  2W25 A;  1ZTR A;  1VTN C;  4BUP A;  2CRG A;  1K78 A;  1RET A;  4N0B A;  1QPM A;  1TT5 B;  1Z7L A;  1F4K A;  4P5O A;  2HWV A;  1UG2 A;  4U0W A;  4KMF A;  1UHM A;  1XCV A;  2IA2 A;  2K9S A;  5F0F A;  3LFK A;  2IS6 A;  4RB0 A;  4XKV A;  3CLO A;  1TTY A;  4XRM A;  1O3T A;  3FBN B;  2H6C A;  2BE5 F;  2EFQ A;  4D5C A;  2R7U A;  2HYJ A;  2F5D A;  2FA5 A;  2I8D A;  2M0C A;  3SZG A;  2K3P A;  5GPA A;  3I55 I;  3CCE I;  5TRD A;  3BPX A;  5IP6 A;  3F22 A;  2M8G X;  1WJB A;  3MD2 A;  3LSP A;  3S1R J;  1J5Y A;  4KFC A;  2CUZ A;  2ZXW H;  1E3H A;  1P4X A;  4O5V A;  3CCV I;  2P7V B;  3BJ6 A;  1Y0N A;  2JK3 A;  3S3N A;  3GVA A;  4LJZ F;  1OQY A;  2OBP A;  2E7X A;  2OQR A;  3CQZ J;  4N9I A;  2HDC A;  2ACJ A;  4EEF G;  1PUF B;  1FZP B;  2Y30 A;  3K9T A;  1W7P B;  1XD7 A;  4RLF A;  5F27 A;  5FLX K;  2O5R A;  3J7Y J;  4F91 B;  1FYM A;  1JKQ C;  3ZMT A;  4LGW A;  2CU7 A;  4FE7 A;  1Z0X A;  2VLA A;  2F48 A;  1PUE E;  1WJD A;  1IG7 A;  3DKX A;  3K1P A;  3R61 A;  5FKM A;  1U0J A;  2DFE A;  3I56 I;  2WB1 N;  3ZQI A;  5F0C A;  5BNG A;  4CZZ A;  2CSO A;  2VKE A;  1TP4 A;  2X6W A;  5CVU A;  3KPH A;  4BL0 B;  2XIG A;  2VUM J;  2VJ4 A;  4LG0 B;  1W4M A;  2V6C A;  1T2K A;  3QOD A;  4LIV A;  5D6E A;  1FOY A;  1Z6T A;  4G7H F;  1EH8 A;  2KIM A;  1S3J A;  3DFG A;  3M07 A;  2W7N A;  2DA7 A;  4BGD A;  4R1H A;  2HFH A;  3IHU A;  2Q1Z B;  1RKT A;  2VBY A;  4RGS A;  4PFP A;  4E7L A;  1LB2 A;  2FF4 A;  2OA4 A;  1QZZ A;  2KRH A;  2FNP A;  3OIO A;  5EJC A;  5D8K B;  4LB5 A;  3EPZ A;  3TL4 X;  2WY7 Q;  2CQQ A;  5LBQ A;  3I4P A;  3OYC A;  3OL3 A;  3TED A;  4UUT A;  2GM4 A;  1OCC H;  3UR3 C;  3OYJ A;  5ILS A;  4IHW A;  3MKZ A;  2VE9 A;  1XX5 A;  3KEO A;  1PP8 F;  2O61 A;  1IRG A;  3ROU A;  2JUC A;  3BG3 A;  3ZN1 A;  2ADU A;  4DOZ A;  1HKQ A;  1Z3Y A;  2KJB A;  2VOO A;  3ZP5 A;  3HXL A;  1ZRC A;  2CQK A;  2YPR A;  4BXF A;  2P5K A;  5C44 J;  1V5F A;  3KP5 A;  1I6H J;  1OCR H;  5TGT A;  1I5Z A;  3QU3 A;  1GT0 C;  1H88 C;  3QAH A;  4F92 B;  1ZGA A;  3OIQ A;  4DIQ A;  1K78 B;  2UV1 A;  4XL9 A;  1DDN A;  1LE8 A;  2RAE A;  4IHX A;  3TW7 A;  1OYW A;  5EEG A;  3S14 J;  2MYS A;  4G6D A;  3JRA A;  1FMW A;  2KMU A;  4JP0 A;  2R7F A;  1IZ1 A;  3VOD A;  1SAX A;  2UUZ A;  3EYY A;  5K7Z A;  3JRE A;  3OL4 A;  3JSO A;  1SFK A;  2I10 A;  4DBQ A;  2D1V A;  3HM5 A;  3IWZ A;  2EIN H;  1BR1 A;  3HL2 A;  2DOD A;  4A5M A;  3U2R A;  4PJN A;  4HNT A;  2PMU A;  2K9L A;  2EJR A;  4YFK F;  1I3Q J;  2V7F A;  4B3A A;  2D1H A;  2NS0 A;  2QBY A;  3VYS B;  3VB2 A;  1WJC A;  2GLO A;  1SEU A;  2LY2 A;  1EJ9 A;  2MC4 A;  1WZ2 A;  1H0M A;  2E1N A;  3GUD A;  3OOU A;  1X1C A;  2L7Z A;  4YFN F;  3ERE D;  2FD5 A;  3OWT A;  4D7M A;  3HHH A;  3SXY A;  5HLH A;  2DN0 A;  3VSL A;  3EUH C;  4C2M J;  2CFX A;  2XB5 A;  4M3B A;  4A2U A;  1WHU A;  3OYM A;  3L2U A;  4WX9 A;  3BZC A;  2DJN A;  3GLL A;  1V55 H;  5J6X A;  3C18 A;  3PM1 A;  2DMN A;  2EIJ H;  4J19 A;  3M4O J;  4F55 A;  1FY7 A;  1JGS A;  3HTU A;  3IAM 2;  5HDG A;  2B63 J;  2M34 A;  2DAO A;  2EK5 A;  2LBF B;  4M72 A;  3Q0U A;  3SHF A;  1UMQ A;  1J9I A;  4FAS D;  2WAQ A;  5JFR A;  1DGW Y;  1LNW A;  5A2Q K;  3H0D A;  3L2W A;  1ENH A;  3PNV A;  2PMH A;  4HDU A;  1FIA A;  3FIW A;  2XC7 A;  2MGQ A;  5ED4 A;  2QEX I;  4A3G J;  1P2F A;  2R4G A;  3R0A A;  5J4V A;  3ZMS A;  4UB8 C;  4OIP F;  2LC2 A;  4CO8 A;  3OV8 A;  4CCK A;  1HOM A;  2GIV A;  3BWG A;  1WCM J;  3WU0 A;  3J80 K;  4RAY A;  1YRN B;  2CUF A;  3H35 A;  1FP1 D;  2ETH A;  4XKW A;  1PYV A;  2XSJ C;  3E3V A;  4IF4 A;  4J00 A;  3TMO A;  4J01 A;  4HX8 A;  1XMX A;  4CZC A;  5ICE A;  3TO7 A;  3S32 A;  3GFJ A;  6PAX A;  2JRM A;  1XCB A;  5EGO B;  1YIO A;  2R7V A;  4RAZ A;  4ZJZ A;  1JUS A;  2HNH A;  3GFM A;  1R4M B;  5GAD J;  2HKX A;  4NC6 A;  4E7K A;  5FKO A;  4BU2 A;  1YRN A;  4BEH A;  3X2Q H;  4NNJ A;  1BR2 A;  5HNH A;  2A6T A;  2HOT A;  1KQ8 A;  2COM A;  1X4P A;  3H3U A;  2KT0 A;  3H5N A;  3HSE A;  3TKY A;  1MD0 A;  3GYH X;  4HQE A;  3N97 A;  3BR3 A;  4IOA F;  1VQP I;  3MQ0 A;  1S7O A;  1IV6 A;  2OCE A;  1VQ6 I;  3IAS 2;  3CMM A;  2PJR A;  4P1W A;  3S3M A;  1PUF A;  1WQ2 A;  1FOX A;  1PJR A;  2K4J A;  1I3A A;  4Z2Y A;  4I98 B;  4RM2 A;  4XLP F;  1H9G A;  1EH6 A;  4IQ4 A;  1IRX A;  2XV4 S;  2IP2 A;  2L7F P;  2VXZ A;  2STW A;  1H89 C;  3GTJ J;  3JSP A;  4L9V A;  3PO2 J;  1RKW A;  3BR2 A;  1ZG5 A;  3L7W A;  1FJL A;  1D0X A;  3H5A A;  2BVM A;  1SMT A;  3TOB A;  1HST A;  4R79 A;  1YJW I;  3LSK A;  1HBX G;  1MNM C;  2EZH A;  3ELK A;  4CGZ A;  4MQV A;  2VOP A;  2EZI A;  2KKO A;  5HLT A;  1GLN A;  3I54 A;  3SDG A;  4RAG A;  1WSU A;  2PG4 A;  2QLZ A;  1IJW C;  2EV5 A;  2XAG A;  4WF2 A;  3GEZ A;  2IT0 A;  2JJ7 A;  1V5G A;  4ZZL A;  5JHU A;  1YW7 A;  4BHB A;  4BBS J;  3I5U A;  2PX9 A;  4M6X A;  2H1L A;  3WTU C;  5FRM A;  1BN5 A;  2KQR A;  2HGC A;  5J47 A;  4AIH A;  3HG9 A;  1K6Y A;  1N75 A;  3PL8 A;  1ONV A;  1EV7 A;  2M8E A;  2CWE A;  3RZD J;  1VND A;  2L01 A;  4M9Z A;  2JPC A;  4OIQ F;  1JKO C;  3G1M A;  1PDN C;  1WGX A;  1UCR A;  1XN7 A;  4RBO A;  2L9R A;  2M9H A;  3VPR A;  4LD5 A;  3EUA A;  2MH9 A;  4E4H A;  3JR9 A;  4M3E A;  4A93 J;  2CW7 A;  2HVS A;  1X3Z B;  3HPG A;  3IUO A;  2GAU A;  4AWX B;  1SAU A;  4NB5 A;  1HXD A;  1TT0 A;  3BG9 A;  3KEY A;  3S8P A;  4EJO A;  3D0S A;  3GW2 A;  2QCO A;  3L2C A;  3SZP A;  2I5U A;  4XRS G;  2KDO A;  2ZJQ F;  3FHN A;  3V8K A;  4Y33 A;  4XQF A;  3AKZ A;  2DU9 A;  2KZG A;  5HLI A;  3WE3 A;  4I02 A;  3QPT A;  3SFI A;  2Z5U A;  3JCU C;  4UV8 A;  4M6Y A;  5B5E C;  1OMI A;  3MN2 A;  2LYC A;  3G1L A;  3HOY J;  1UB9 A;  1QVU A;  2XVC A;  4QIW N;  4HST A;  2V6E A;  2QKM B;  3VDX A;  3O2P E;  1AU7 A;  3TP0 A;  1VQN I;  3KIO A;  2GA2 A;  5GAH J;  4HV6 A;  1JKP C;  3K6G A;  2RN7 A;  5CYV A;  1SMY F;  2VBZ A;  4Y17 A;  3CTA A;  2PMZ N;  1O7F A;  3RPU A;  2VT2 A;  1KYW A;  2XAQ A;  5CLS A;  4CYC A;  1W36 D;  1APL C;  4JX6 A;  3H92 A;  3HRM A;  3RIR A;  1IN4 A;  4ZH4 F;  1YHQ I;  5DCM B;  3RKQ A;  1ON1 A;  4U87 A;  2LLK A;  4Q48 A;  1ZH5 A;  5DDG A;  2KJC A;  3K4J A;  2E19 A;  3E6D A;  3SZT A;  2H6B A;  3J7Z I;  4CYC B;  1ZGJ A;  2DA4 A;  2VJI A;  5C4X J;  5CKT A;  5DD4 A;  1T56 A;  2EIM H;  1H8A C;  2HPI A;  1L3L A;  3N4M A;  2PMZ A;  3OYH A;  1R49 A;  2JRT A;  2XUB A;  1J75 A;  2E60 A;  2KIQ A;  3LWF A;  2X9D A;  4DGW B;  1G3S A;  2QGU A;  2BEO A;  1U8B A;  5LEK A;  1Q1H A;  3KLO A;  4MGR A;  4OU0 A;  4IQJ A;  3BPV A;  3W6K B;  3AFH A;  2H94 A;  4IHS A;  1SD6 A;  2DTR A;  4HNU A;  2IGN A;  5HS9 A;  2PLY A;  1LDD A;  2DYR H;  1LDK B;  3CCM I;  3KZI C;  1X19 A;  1ZK8 A;  4QLC U;  2JA7 J;  1MBH A;  4IXA A;  4D5F A;  4HF2 A;  2DPD A;  2R7X A;  1D0Y A;  3KZY A;  2W57 A;  5CQE A;  2O6G E;  2MBF A;  2KPM A;  3CMY A;  3OYK A;  3OYE A;  2BYV E;  1OCT C;  1YX3 A;  2O9L A;  1OPC A;  3MCZ A;  4HF0 A;  4TV7 A;  4QPQ A;  1C0W A;  4G9Y A;  3F3X A;  1D0Z A;  2XRL A;  5IT3 A;  1FTT A;  1OJL A;  4ON0 A;  3TBI A;  4DYC A;  2E35 A;  2VC0 A;  1MBK A;  1YE9 A;  5F64 A;  1U5T B;  3BR6 A;  4IL6 C;  4B09 A;  5IT9 Z;  3ZQL A;  3FKI J;  2CQ7 A;  4QTR A;  2JA5 J;  1AOY A;  1BC7 C;  2DA3 A;  2LTP A;  2V1U A;  1IDY A;  4XM3 A;  2L5Q A;  2X51 A;  2VJJ A;  1QHG A;  3GO5 A;  5F08 A;  3B6C A;  1VFC A;  1HDD C;  1F5T A;  4PK4 A;  3R6S A;  3OIP A;  2E1C A;  1TQP A;  3WGG A;  3IP4 B;  4A0Y A;  4DZJ A;  2XF5 A;  3CF2 A;  4AD9 A;  2WAE A;  5J8F A;  1XC5 A;  3H3Z A;  1B72 A;  2RV8 A;  3ABL H;  2HZT A;  5JHF A;  3T1B A;  1FLI A;  5HLG A;  3GBG A;  3HZJ A;  2IS4 A;  3I59 A;  1W7P A;  5DM6 F;  3CC7 I;  4A3L J;  3WGH A;  2KZV A;  4YIR X;  3A0B C;  2EB7 A;  5LHG A;  5GAG J;  1RR8 C;  3SDB A;  1GUU A;  1CF7 B;  4II2 A;  2X4H A;  1DUX C;  2P8T A;  1TWF J;  5D5X B;  3Q0V A;  3OYA A;  2IGO A;  1K6O A;  2ELK A;  3SFZ A;  1VQL I;  2AXL A;  5FD5 A;  4IZZ A;  3CUQ C;  3OSF A;  1VF9 A;  2W4S A;  1MBJ A;  1P9Q C;  5DUK A;  3HOV J;  3LAP A;  3LA7 A;  4UUS A;  1IW7 F;  3FXJ A;  4DYR A;  2VT3 A;  2HQ5 A;  2BHZ A;  4HLY A;  4YII A;  4YRV A;  2IA0 A;  2FOK A;  2LK2 A;  2NNN A;  3CZ6 A;  3GZN B;  4Y7N J;  3V7R A;  1YOV B;  1BI2 A;  2HXO A;  2HDW A;  4MLO A;  3P5J A;  4WXC A;  1UEL B;  5E18 F;  2E2H J;  5B3S H;  1XDS A;  5KVR A;  1FP2 A;  1MJ9 A;  4XON A;  5LHH A;  1HW1 A;  3A0H C;  1R5H A;  2IRF G;  2AO9 A;  3FXM A;  2DFI A;  3CME I;  2GXG A;  4DBR A;  2LP0 A;  1KQ9 A;  1U6G A;  3HUG B;  4QSH A;  4LIT A;  1S7E A;  2H09 A;  1B59 A;  3H9Q A;  2BY2 A;  5C3E J;  4KMU X;  4AIJ A;  2P4W A;  4JBA A;  4RLQ A;  4YFX F;  3E97 A;  1WJE A;  1IDZ A;  2N8G A;  1V4R A;  1B6A A;  2L2O A;  1XMK A;  3FWE A;  4DJA A;  1FMV A;  3TQN A;  2GOM A;  2VE8 A;  5D4R A;  3OMY A;  2XDV A;  1U5T C;  5BOX A;  4HNV A;  2P6S A;  2PFB A;  1R1U A;  1LQ1 A;  4AYB N;  1MSF C;  2VQG A;  4CXF A;  3DEU A;  2A69 F;  1JT6 A;  2V9V A;  4B1R A;  4PJM A;  1R22 A;  1BW6 A;  4LLN A;  3HOU J;  2IBD A;  3FF5 A;  2ZFU A;  2NVU B;  5D5W B;  4LIU A;  2XKP A;  4F93 B;  1Z7U A;  3JTG A;  5LHI A;  3FM5 A;  3DPU A;  3Q0W A;  5ERI A;  4EJV A;  2E71 A;  2DOE A;  4KIT B;  1Z9C A;  1B4A A;  3SEQ A;  3P9K A;  3E0J B;  1X58 A;  2YU3 A;  1R58 A;  1NG6 A;  4EM1 A;  2A3S A;  1DU0 A;  2FSW A;  1BJZ A;  4IRH A;  3ZGK A;  2DOF A;  3OYB A;  3J7A O;  3U1K A;  2IXS A;  5IPA A;  3ZQC A;  3GTL J;  4PSX A;  2W24 A;  3ZQH A;  4IO9 F;  1JTX A;  1WFX A;  3GTK J;  4FET A;  1D8K A;  2OTJ I;  2XF6 A;  3HGY A;  2LRE A;  3E6B A;  2VN2 A;  4MEY F;  1YJ9 I;  1LE8 B;  1R71 A;  3K10 A;  2DPU A;  4GO1 A;  3CF5 F;  3ZRG A;  3FMS A;  4HA8 A;  2ZJP F;  2MSY A;  2OF7 A;  1W0T A;  1CF7 A;  1FC3 A;  3HJE A;  3K69 A;  1MBF A;  1MZB A;  3S17 J;  4IJA A;  4PJL A;  4PJ0 C;  1MBE A;  3A1Y A;  4PJJ A;  3F6O A;  2BGC A;  5H2F C;  1R1V A;  2F5E A;  2NOG A;  2NNY A;  3GCM A;  3B73 A;  1D3Y A;  2G7H A;  3J7A Y;  4RMN A;  3H1C A;  2OZ6 A;  1RRJ A;  5DV5 A;  2CUE A;  2R3S A;  2F5V A;  4HBL A;  5M3M J;  4HOB A;  4LMY A;  3LA2 A;  3GX4 X;  1MJA A;  4L0Y B;  3IH3 A;  1U78 A;  1R1T A;  2DT7 B;  3LSJ A;  2EFO A;  3M9A A;  3T8R A;  4DYQ A;  4X0G A;  2CQN A;  2L02 A;  2KIU A;  1T0F A;  3DP7 A;  1O7L A;  3OY9 A;  4G7Z F;  1ZR2 A;  2X48 A;  1GHC A;  2CFO A;  4YEL A;  2IGM A;  2VB6 A;  1G2H A;  1R5G A;  3P9I A;  3LQQ A;  2A5W A;  2IJL A;  3E1S A;  3O8G A;  1XGM A;  5E17 F;  2K02 A;  4HYE A;  3MKY B;  4DZP A;  3A01 A;  5LRR A;  5K5R A;  4BKX A;  3F8F A;  3VWB A;  4IX7 A;  2VQC A;  2O3F A;  4CA0 A;  1LFP A;  4D7N A;  2JMW A;  4A3I J;  1LKX A;  2ZFW A;  4DNC A;  4I2O A;  4A12 A;  2FU4 A;  2LBF A;  2Y48 A;  4YIF A;  3RSN A;  5HVQ C;  4XLH A;  5EDN A;  1O57 A;  3QWL A;  3A02 A;  4XBF A;  4WK8 F;  3S1M J;  2OU2 A;  1TWC J;  3JRC A;  4BE2 A;  1OLT A;  2NS8 A;  2VOD A;  3WTZ A;  2TRT A;  3DCF A;  5L3B A;  2RQQ A;  2E5Z A;  1PP7 U;  5FKL A;  2VAS A;  3BG7 A;  3LA3 A;  4B48 A;  2Z1D A;  3WHB A;  3E5Q A;  3BG6 A;  2OV7 A;  4G12 A;  2M3A A;  1SFE A;  3H5R A;  4ZYH A;  1WJF A;  3JRD A;  1TQI A;  2LG4 A;  3IKV A;  4A3M J;  3Q9V A;  3K1N A;  1E17 A;  3CP8 A;  1N25 A;  2FBI A;  4U0Y A;  3WG9 A;  4AIK A;  1QGP A;  1GV2 A;  3ASN H;  2LF8 A;  5HDN A;  1S6L A;  4X1E A;  3RYR A;  4BQA A;  1P92 A;  3GWZ A;  1FOK A;  3FXO A;  4D1Q A;  1T95 A;  2IGK A;  4L5J A;  3J80 Z;  4ZDP A;  4AVZ A;  5JVT A;  1BI0 A;  1E2X A;  1U9O A;  2CG4 A;  2ECC A;  4EJT A;  1FWZ A;  4BJT A;  3RKW A;  3VOE A;  2EFP A;  4JOM A;  4G8X A;  3DWL E;  1SC7 A;  1TW3 A;  2WY8 Q;  1A35 A;  2P5V A;  4FCY A;  3E6C C;  2K40 A;  3CCU I;  4L5I A;  4EJU A;  3ECO A;  3SEZ A;  2EQR A;  4B43 A;  3HEF A;  1T38 A;  3UNG C;  4XKB A;  4XLN F;  5LD2 C;  2M0M A;  1P7I A;  1XPX A;  2HTJ A;  4IEJ A;  2LD5 A;  2X6X A;  3C2B A;  5BPI A;  2OTL I;  1YFH A;  2OZU A;  1YJN I;  5KAI C;  4EVI A;  1JUM A;  3B02 A;  4IOC F;  3CCL I;  5L3F A;  2UWM A;  2R5Z B;  4V19 K;  2XHK A;  2VC1 A;  2R7O A;  3KCC A;  4NDL A;  3ZMV A;  2NVX J;  3BCB A;  2IW5 A;  2PJR B;  5EG0 A;  1J0R A;  1JTY A;  3CDH A;  2LSO A;  1XGO A;  1MNE A;  1Y6I A;  4L9T A;  1B8I A;  4IRI A;  3S15 J;  3GME A;  4MTE A;  4HF1 A;  2HVQ A;  2ZXJ A;  5HNF A;  1PVE A;  3K70 D;  3W2V A;  5AIQ A;  3D5L A;  5C4J J;  4MIM A;  4U7D A;  3ZXS A;  3SQN A;  3C1D A;  1G3T A;  3HSR A;  2ZC2 A;  4ITV A;  5IP7 J;  1A31 A;  1WRJ A;  1TQM A;  5FLV A;  3EQL F;  3L9F A;  2TDX A;  3GLX A;  5E3L A;  4NUB A;  3T5X A;  1ZEL A;  1B8I B;  3TO6 A;  3OYI A;  2TCT A;  3K4K A;  1XB4 A;  5FFX A;  1EKE A;  1LEB A;  1F43 A;  2LH9 A;  3OYN A;  3QOE A;  2DQL A;  4XRF A;  3HIF A;  1BBY A;  4OIR F;  3QRF F;  2VKV A;  3S16 J;  1WJ5 A;  4EGY A;  2V1D A;  2DDA A;  4V2G A;  3RKX A;  1QU3 A;  3F21 A;  2M7B A;  2STT A;  4XLC A;  4ZTF A;  3AG2 H;  3LQR A;  2ZME B;  1ZLJ A;  3BZ6 A;  3MKL A;  1G4D A;  2EH3 A;  4KNY A;  3QPL A;  4I7H A;  4XOT A;  4A0Z A;  1LFB A;  3CCS I;  2Z99 A;  3I4N J;  2VKH A;  5LLQ A;  4M9X A;  5DEQ A;  2HS5 A;  2ZB9 A;  1HDP A;  1K61 A;  3VYU B;  2GQQ A;  4BE0 A;  1IXS B;  3G73 A;  1G3W A;  2DA6 A;  4PGH A;  2ESN A;  1Y56 A;  2W84 A;  4N4N B;  4A3E J;  2PEX A;  3BTJ A;  3I64 A;  2EFW A;  2HTS A;  3W6V A;  5CPR B;  3K4L A;  1LPQ A;  5TIS C;  3KLN A;  3HOX J;  2NVY J;  5LRS A;  4W97 A;  5IYC J;  5F6F A;  1DPR A;  2NAZ A;  2Z9O A;  5EEA A;  4IKF A;  4KIF A;  3ABU A;  1MND A;  3QYF A;  1DPU A;  4Y15 A;  2FBH A;  3IKT A;  3ZMU A;  1FIP A;  1IUY A;  1W5C C;  1LDJ A;  2PQ8 A;  2X1D A;  4MNU A;  1JXS A;  3R0J A;  3HTS B;  1JKR C;  2E1M B;  3GZ5 A;  4I0A A;  2QBY B;  1R7J A;  3JW4 A;  3CJQ B;  4FT8 A;  3CES A;  3E5X A;  3KEQ A;  2GZW A;  4HX4 A;  3SJM A;  3BTL A;  2A07 F;  1A5J A;  5IP9 J;  2MA3 A;  4MQ9 F;  3GXO A;  3F8B A;  2J5P A;  4XSZ F;  2R7W A;  3DPT A;  3ZPL A;  2M2E A;  3FMQ A;  3PSF A;  2D45 A;  2AQE A;  2FE3 A;  3PO3 J;  2KDZ A;  1X1A A;  3KP6 A;  5GP9 A;  3NRV A;  2G7U A;  2ME0 A;  2X1E A;  4RGX A;  3K4C A;  4ZZD A;  1ULY A;  1IXR C;  1FPQ A;  4GCV A;  1STZ A;  4II3 A;  4Y4R A;  3ZQG A;  4E7S A;  2DA2 A;  1IUF A;  2E7W A;  2M4K A;  4E7H A;  3EYI A;  4FE4 A;  1S29 A;  3M1C A;  3QP5 A;  3KZZ A;  3ZQQ A;  5JVG F;  4CHU A;  3Q9S A;  3ZQF A;  3V4G A;  1F1Z A;  2KP6 A;  2XKO A;  3JRG A;  3H9G A;  1HKS A;  1RES A;  4AUX A;  1V54 H;  2JUG A;  2HU9 A;  4QWQ A;  2DQR A;  3QOP A;  4LFU A;  1CGP A;  4UY8 I;  4E70 A;  3EUH A;  2YX4 A;  2XPW A;  4UXN A;  1UHS A;  3CJT B;  1RZ4 A;  3I3L A;  4BAC A;  3U1D A;  1R9T J;  2NVT J;  3GF2 A;  3O3K A;  4HV5 A;  1S9H A;  2OD5 A;  1TL8 A;  2VJ5 A;  2KFD A;  2FJ1 A;  1U5T A;  5K5Q A;  2E2J J;  3MMY B;  4ZYA A;  4IHT A;  1ZGW A;  3BQY A;  1HCR A;  1ITY A;  3P9C A;  2KRF A;  2GA1 A;  4EGZ A;  2DT5 A;  1HW5 A;  2QZ8 A;  2HZD A;  1XGS A;  2R93 J;  1IRZ A;  2VBW A;  2OUM A;  1W5T A;  2JQ7 A;  3OS1 A;  2GWR A;  2LKX A;  4A0X A;  2UXX A;  2F5C A;  2FML A;  2L4A A;  3AL0 B;  4E7J A;  3OS2 A;  2CV0 A;  3HYI A;  4CUG A;  5L3C A;  4CCN A;  2DA5 A;  5CJ9 A;  2DFF A;  4YG2 F;  4Q5S F;  3DTK A;  3KYC B;  2FNA A;  1YIJ I;  5KAF C;  1FBS A;  1UJ8 A;  4PDK A;  2VPL A;  3WU1 B;  2EV0 A;  4WCG A;  4UV9 A;  5ICF A;  1R36 A;  1YX5 A;  3TOA A;  3PQK A;  4A69 C;  5IOY A;  5CVJ A;  1FYL A;  5CVI A;  3WU2 C;  3L09 A;  2HOE A;  1MDM A;  4F7Z A;  2DMU A;  1W7P D;  2JVH A;  3I58 A;  1VQ8 I;  1FEX A;  4UVB A;  4MFE A;  4FHT A;  4S04 A;  2FQ3 A;  1E0E A;  1QQI A;  4Z6Y A;  2HOA A;  4OAZ A;  3W3C A;  3DF8 A;  3WG7 H;  1DQU A;  3HOS A;  1ERD A;  2H1K A;  2FX0 A;  2OCC H;  1HA8 A;  4PSW A;  4ZYG A;  1ZHF A;  1ETQ A;  3HGG A;  2G0E A;  2L9V A;  2BBY A;  1RPW A;  5E1X A;  1SVM A;  2RKH A;  1F9N A;  2R5Z A;  1ZR4 A;  3ZMZ A;  1Y8R B;  4WXD A;  2L54 A;  3GFI A;  4A6E A;  2GXB A;  2QSH X;  2HQA A;  1FYK A;  1AWC A;  1ZG3 A;  2BW3 B;  1P7J A;  1QBJ A;  2ZNY A;  4CH7 A;  4KIB A;  3WTT C;  2YX7 A;  2PJP A;  2K27 A;  3QP6 A;  1VQK I;  4ENM A;  5EEH A;  3D5R C;  3BR0 A;  3A03 A;  2Y9Y A;  1B9N A;  1OR7 A;  3V7S A;  4NQW A;  2G9W A;  1I27 A;  1OCZ H;  2HR3 A;  3CP2 A;  2JWT A;  5GAE J;  1V5E A;  4XOR A;  3VYT B;  4BE1 A;  3S1Q J;  2GBY A;  1M1E B;  3KP7 A;  5ILU A;  3K1M A;  1HW2 A; 
#chains in the Genus database with same CATH homology
 2L4M A;  1XMA A;  1JHH A;  1ZYR F;  3TDZ C;  1L0O C;  3ML6 A;  4HX7 A;  4A6D A;  1O3R A;  4KIG A;  1GXQ A;  3JAM Z;  4M9S A;  3QPH A;  4WXH A;  2Z3Y A;  2QM3 A;  4KIC A;  3PFI A;  4CIC A;  1USS A;  5ICG A;  4LB6 B;  3FHZ A;  1YTY A;  1B1B A;  2P7C B;  4RGR A;  1OYY A;  5FLX Z;  4L9J A;  1O3S A;  1QNT A;  1J2X A;  3M8E A;  1O3Q A;  3Q5F A;  3T8T A;  5D8L B;  4RGU A;  1TW2 A;  3CUQ B;  4IVN A;  2OQG A;  1FSE A;  1IAW A;  1KQ0 A;  1IRF A;  3VEP A;  2LF7 A;  3C7J A;  1ZAO A;  1KU3 A;  5CVV A;  2HYF A;  1LVA A;  2JSC A;  3F8N A;  1KGS A;  2A5Y B;  2RC4 A;  4PCQ A;  4ESF A;  2M87 A;  2XRO A;  3ISP A;  4GYG A;  1QZY A;  4KT5 C;  3KP2 A;  3FXR A;  2A6H F;  3HHG A;  2A68 F;  2WV0 A;  4EJW A;  1Y0U A;  4DQ2 A;  3GZ6 A;  2LKP A;  1G3Y A;  1V3F A;  1BJA A;  1WWX A;  3I71 A;  3I0T A;  4L0Z B;  4A5N A;  1MGT A;  1UFM A;  2MH2 A;  4KN7 X;  4FX4 A;  5D6F A;  4ZYE A;  1ZLK A;  1SD5 A;  1I6X A;  5DCM A;  5FO5 A;  1U2W A;  4ENJ A;  2CYY A;  2FRH A;  2MC3 A;  1IN8 A;  5E8I A;  3T0Y A;  2Z33 A;  4GYI A;  3J81 K;  3DXJ F;  5CVR A;  3PQJ A;  4NHJ A;  3P7N A;  3FXQ A;  3WTY C;  5JI6 A;  4U88 A;  2KIF A;  5D5U B;  2QQA A;  2ZME A;  1RUO A;  3M8F A;  4ZYD A;  2DK8 A;  3BDD A;  2XAJ A;  5E1Z B;  5ICC A;  3M1E A;  4R8H A;  2P5L C;  3S2W A;  4K2E A;  1FBU A;  3E6M A;  4PZJ A;  1BIB A;  2JTV A;  3KFW X;  2ISY A;  1IF1 A;  2HEO A;  1ODD A;  1Z05 A;  4ENK A;  1YG2 A;  4I09 A;  4HLX A;  4G7O F;  5H20 A;  3BRO A;  2VBX A;  1FX7 A;  2ZO4 A;  3FM3 A;  3BP8 A;  2RNJ A;  2C6Y A;  5BPD A;  3KE2 A;  2QEN A;  2IA1 A;  2CGP A;  5E1W A;  2IVM A;  5KK1 A;  4N9H A;  2V1X A;  2QWW A;  3V8J A;  4I01 A;  2L3D A;  5FFZ A;  1GXP A;  4EV0 A;  1D8J A;  2PN6 A;  3HUG A;  3M7G A;  2R7D A;  4H0E A;  2M5W A;  3G3Z A;  3R4K A;  1JE8 A;  5DYM A;  4GGG A;  4JQF A;  3RKY A;  1XSD A;  2MLK A;  4MHG A;  2CW0 F;  3IRR A;  4L18 B;  2LDU A;  1SFX A;  3LAJ A;  1Z6R A;  1OYI A;  1A04 A;  3F8C A;  1XSV A;  1KA8 A;  3IRQ A;  1YW8 A;  3WTS C;  2X0L A;  4OMY A;  4M74 A;  2ZBK A;  4EMS A;  4ASN A;  4CDG A;  1MKM A;  1SFU A;  5IT9 K;  4HW0 A;  2FMY A;  1YYV A;  2K7L A;  3DV8 A;  3HRS A;  1P4A A;  1HSJ A;  5FGM A;  2V79 A;  1BM9 A;  2EA4 A;  2M30 A;  3TDU C;  3AAF A;  4EQQ A;  2QUF A;  3RDI A;  2Y0M A;  2ESH A;  2ZKZ A;  2EFN A;  3EET A;  4O3M A;  2WC2 A;  4P55 A;  5BMZ A;  2ZNZ A;  3RYP A;  1YS7 A;  2JZY A;  1Z91 A;  3KET A;  3KP3 A;  1B9M A;  5A2Q Z;  5LGT A;  2MLG A;  3WE2 A;  4GXO A;  1RI7 A;  5LEJ A;  1BOA A;  2EWN A;  4AVP A;  3F23 A;  2IPQ X;  4LG0 A;  1G6N A;  4OIN F;  1BI3 A;  3DQV C;  2DLL A;  1R00 A;  4RS8 A;  2ZCW A;  1I1S A;  1JHF A;  1D5V A;  2W85 A;  2M1B A;  4B8X A;  3MZH A;  4BAY A;  3RTR A;  2Q2E A;  4IRG A;  2UZK A;  4KUM A;  2VON A;  2JPB A;  2NRA C;  2PI0 A;  5JR3 A;  1OKR A;  3DKW A;  1DP7 P;  4LK1 F;  4D0P A;  5DCF A;  3MFK A;  1P4W A;  4WWC A;  1SD7 A;  2K86 A;  2OAZ A;  5HS7 A;  1J59 A;  4BH9 A;  4HDV A;  3FX3 A;  4P96 A;  5D5V B;  3BJO A;  4KYW A;  2FXA A;  1TNS A;  2LNB A;  1IXC A;  3J81 Z;  4Y13 A;  3ABT A;  1ZRE A;  4RB3 C;  1IN5 A;  1QO0 D;  5K5O A;  2XRN A;  1P6R A;  1YO5 C;  1FNN A;  1I1G A;  5J8C A;  2CO5 A;  1XGN A;  4OOI A;  2HQR A;  1TBX A;  5E20 A;  3REO A;  1ZRD A;  2HQN A;  1KU7 A;  2QYO A;  3K2Z A;  3VFZ A;  3KP4 A;  3IWF A;  4PGG A;  1Z1D A;  3RPQ A;  2O03 A;  1YLF A;  2MD5 A;  1KU2 A;  1NHA A;  3DPL C;  3F72 A;  5H6Q A;  1KU9 A;  3FMR A;  1BIA A;  3F6V A;  1RIO H;  4HQM A;  1W5S A;  4M73 A;  3F8M A;  1MJB A;  1TLH B;  5L3D A;  1IN7 A;  2NYX A;  5AON A;  2PBI A;  4P9F A;  3HRT A;  3R60 A;  2DW4 A;  1GVJ A;  2XAH A;  3TGN A;  3V7C A;  2BV6 A;  1RUN A;  4UUV A;  2DO7 A;  3L00 A;  3WOD F;  5FD6 A;  4UHT A;  3CO7 C;  2EA2 A;  4OIO F;  4KA4 A;  2RDP A;  3HSF A;  4CYD A;  5L3G A;  5DUI A;  3K0L A;  1LEA A;  2P6T A;  3ZMD A;  3MZY A;  3JTH A;  2F5F A;  1TNT A;  2O0Y A;  2B0L A;  3FZV A;  1YW9 A;  5HS8 A;  1XDU A;  3FXU A;  2HKO A;  4XSX F;  1FT9 A;  5TJJ A;  1R23 A;  3CO6 C;  1HQC A;  3EDP A;  2A6E F;  2D2W A;  5F1R A;  4UVA A;  1LJ9 A;  3JAM K;  2A61 A;  1U3E M;  2FBK A;  2QQ9 A;  2AS5 F;  4ESB A;  3BOQ A;  4BNC A;  3ECH A;  4RB1 A;  3BJA A;  2WWY A;  2DK5 A;  4G94 A;  4EM0 B;  4LLL A;  4LLG F;  3BY6 A;  5L3E A;  3O6B B;  4HZF A;  2F2E A;  5BS6 A;  4M71 A;  2FEZ A;  3I59 B;  1YQA A;  5E8G A;  1U8R A;  2XAF A;  1ZAR A;  1WI9 A;  1REP C;  1SD4 A;  3WTX C;  3E5U A;  1RNL A;  5HDK A;  3CJN A;  2Q8K A;  4RB2 C;  2JT1 A;  1X3U A;  3MEX A;  2YSR A;  3W6J B;  2WTE A;  2UXN A;  2YR2 A;  4BYY A;  5FB2 A;  3WTV C;  2J5O A;  1UHW A;  2ELH A;  3ZN0 A;  2DI3 A;  5K1Y A;  2XGX A;  1S7A A;  3WTW C;  3QU6 A;  5HOO A;  4MEX F;  4JK1 X;  1FBQ A;  4UNO A;  3NEU A;  5LGN A;  4ETS A;  1T39 A;  2QQB A;  4HAM A;  1EH7 A;  4G6Q A;  4L9N A;  4Q4Z F;  3ZQ7 A;  4LK0 F;  2H27 A;  3U9G A;  4BHP A;  1KYZ A;  4I0B A;  3COA C;  1J7K A;  1K79 A;  1UST A;  4O6J A;  3GFL A;  5H6R A;  2ISZ A;  3IC7 A;  3ULQ B;  4ESJ A;  4P9U A;  5D4S A;  3V8L A;  3RI4 A;  4KN4 X;  1T98 A;  1S8N A;  1WKM A;  2QVO A;  5DD8 A;  2K4B A;  1ZRF A;  3I53 A;  4BXU A;  3CUQ A;  2Y75 A;  4OMZ A;  1YS6 A;  3OOP A;  5BQT A;  2O8X A;  2RGV A;  4MTD A;  4Q47 A;  1HKT A;  1FSH A;  4IPA A;  1K7A A;  3IL2 A;  3NQO A;  1T6S A;  1BC8 C;  2ZJ2 A;  5AIP A;  4FX0 A;  1ZN2 A;  1ZG1 A;  3MAJ A;  1H9T A;  5LGU A;  3C3W A;  1XSX A;  2EV6 A;  3MWM A;  1ON2 A;  1MDM B;  5ILV A;  4U0V A;  3RJP A;  4BHC A;  2HYG D;  3HOT A;  3HRU A;  2Q0O A;  2RVC A;  4S05 A;  2RQP A;  3LST A;  4U7B A;  1IN6 A;  4ENN A;  4KDP A;  4EM2 A;  3WGI A;  1BI1 A;  2DBB A;  2XAS A;  3TO9 A;  4UVC A;  3CUO A;  2M45 A;  2W25 A;  1VTN C;  1K78 A;  4N0B A;  1QPM A;  1F4K A;  4P5O A;  2HWV A;  4U0W A;  4KMF A;  1UHM A;  1XCV A;  2IA2 A;  3LFK A;  4RB0 A;  3CLO A;  1TTY A;  1O3T A;  2H6C A;  2BE5 F;  2EFQ A;  2F5D A;  2FA5 A;  5TRD A;  3BPX A;  3F22 A;  4KFC A;  1J5Y A;  1P4X A;  4O5V A;  2P7V B;  3BJ6 A;  3GVA A;  4LJZ F;  2OBP A;  2E7X A;  2OQR A;  4N9I A;  2HDC A;  2ACJ A;  1FZP B;  3K9T A;  1W7P B;  1XD7 A;  5FLX K;  1FYM A;  3ZMT A;  4LGW A;  1PUE E;  3K1P A;  3R61 A;  4CZZ A;  2CSO A;  5CVU A;  2XIG A;  4LG0 B;  1W4M A;  2V6C A;  1T2K A;  5D6E A;  1Z6T A;  4G7H F;  1EH8 A;  2KIM A;  1S3J A;  3DFG A;  4R1H A;  2HFH A;  3IHU A;  2VBY A;  4RGS A;  1LB2 A;  4LB5 A;  2FF4 A;  2OA4 A;  1QZZ A;  2FNP A;  5D8K B;  5LBQ A;  3I4P A;  5ILS A;  2VE9 A;  3KEO A;  1PP8 F;  2O61 A;  1IRG A;  3ROU A;  3ZN1 A;  2ADU A;  1HKQ A;  2KJB A;  2VOO A;  3ZP5 A;  1ZRC A;  2CQK A;  2YPR A;  2P5K A;  3KP5 A;  1I5Z A;  3QU3 A;  3QAH A;  1ZGA A;  1K78 B;  1DDN A;  1OYW A;  5EEG A;  4G6D A;  2R7F A;  1IZ1 A;  3VOD A;  1SAX A;  3EYY A;  3JSO A;  2D1V A;  3IWZ A;  4A5M A;  3U2R A;  2PMU A;  2EJR A;  4YFK F;  2D1H A;  2NS0 A;  2QBY A;  3VB2 A;  1H0M A;  2E1N A;  3GUD A;  4YFN F;  3ERE D;  3HHH A;  3SXY A;  5HLH A;  2CFX A;  4A2U A;  4WX9 A;  5J6X A;  3C18 A;  1FY7 A;  1JGS A;  3HTU A;  5HDG A;  2DAO A;  2EK5 A;  4M72 A;  3SHF A;  1J9I A;  5JFR A;  1LNW A;  5A2Q K;  4HDU A;  2PMH A;  5ED4 A;  1P2F A;  3R0A A;  3ZMS A;  4OIP F;  4CO8 A;  3OV8 A;  2GIV A;  3BWG A;  3WU0 A;  3J80 K;  4RAY A;  1FP1 D;  2ETH A;  3E3V A;  4IF4 A;  4HX8 A;  5ICE A;  3TO7 A;  3GFJ A;  6PAX A;  1XCB A;  1YIO A;  4RAZ A;  3GFM A;  2HKX A;  1KQ8 A;  2COM A;  3H3U A;  3TKY A;  3GYH X;  3HSE A;  1MD0 A;  4HQE A;  3N97 A;  3MQ0 A;  1S7O A;  1WQ2 A;  2K4J A;  4Z2Y A;  4I98 B;  4XLP F;  1H9G A;  1EH6 A;  2XV4 S;  2IP2 A;  2VXZ A;  2STW A;  3JSP A;  4L9V A;  1ZG5 A;  3L7W A;  1SMT A;  3TOB A;  1HST A;  4R79 A;  1HBX G;  3ELK A;  4CGZ A;  2VOP A;  4MQV A;  2KKO A;  3I54 A;  1WSU A;  2PG4 A;  2QLZ A;  2EV5 A;  2XAG A;  4WF2 A;  3GEZ A;  2IT0 A;  4ZZL A;  5JHU A;  1YW7 A;  4BHB A;  3I5U A;  4M6X A;  3WTU C;  1BN5 A;  2HGC A;  4AIH A;  1ONV A;  1EV7 A;  2M8E A;  2CWE A;  2L01 A;  4M9Z A;  2JPC A;  4OIQ F;  1PDN C;  1UCR A;  1XN7 A;  4LD5 A;  2MH9 A;  2GAU A;  4AWX B;  4NB5 A;  1HXD A;  4EJO A;  3D0S A;  3GW2 A;  3L2C A;  3SZP A;  3V8K A;  2DU9 A;  5HLI A;  3WE3 A;  4I02 A;  3QPT A;  2Z5U A;  4UV8 A;  4M6Y A;  1OMI A;  1UB9 A;  2XVC A;  3O2P E;  2GA2 A;  4HV6 A;  2RN7 A;  5CYV A;  1SMY F;  2VBZ A;  4Y17 A;  3CTA A;  1O7F A;  3RPU A;  2VT2 A;  1KYW A;  2XAQ A;  5CLS A;  3H92 A;  3HRM A;  3RIR A;  1IN4 A;  4ZH4 F;  5DCM B;  1ON1 A;  4Q48 A;  1ZH5 A;  5DDG A;  2KJC A;  3E6D A;  3SZT A;  2H6B A;  1ZGJ A;  5DD4 A;  1L3L A;  3N4M A;  2JRT A;  2XUB A;  1J75 A;  3LWF A;  1G3S A;  2BEO A;  5LEK A;  1Q1H A;  3KLO A;  4MGR A;  4OU0 A;  3BPV A;  3W6K B;  4IHS A;  2H94 A;  1SD6 A;  2DTR A;  5HS9 A;  2PLY A;  1LDD A;  1LDK B;  4QLC U;  4IXA A;  4HF2 A;  2DPD A;  3KZY A;  2W57 A;  2O6G E;  2MBF A;  2BYV E;  1OPC A;  3MCZ A;  4HF0 A;  4TV7 A;  1C0W A;  4G9Y A;  3F3X A;  5IT3 A;  4ON0 A;  2VC0 A;  5F64 A;  1U5T B;  4B09 A;  5IT9 Z;  1AOY A;  1BC7 C;  2V1U A;  3GO5 A;  1F5T A;  3R6S A;  2E1C A;  1TQP A;  3WGG A;  4A0Y A;  4AD9 A;  5J8F A;  3H3Z A;  2RV8 A;  2HZT A;  3T1B A;  1FLI A;  5HLG A;  3I59 A;  1W7P A;  3WGH A;  2EB7 A;  5LHG A;  1CF7 B;  2X4H A;  1DUX C;  2P8T A;  5D5X B;  1K6O A;  3SFZ A;  2AXL A;  5FD5 A;  3CUQ C;  5DUK A;  3LAP A;  3LA7 A;  1IW7 F;  2VT3 A;  4HLY A;  4YII A;  2IA0 A;  2FOK A;  2NNN A;  3V7R A;  1BI2 A;  5E18 F;  4WXC A;  1XDS A;  5KVR A;  1FP2 A;  1MJ9 A;  5LHH A;  1HW1 A;  1R5H A;  2IRF G;  2DFI A;  2GXG A;  1KQ9 A;  1U6G A;  2H09 A;  1B59 A;  4KMU X;  4AIJ A;  2P4W A;  4JBA A;  4YFX F;  3E97 A;  1V4R A;  1B6A A;  1XMK A;  3FWE A;  3TQN A;  2VE8 A;  5D4R A;  1U5T C;  5BOX A;  2P6S A;  2PFB A;  1R1U A;  1LQ1 A;  4CXF A;  3DEU A;  2A69 F;  2V9V A;  4LLN A;  1R22 A;  3FF5 A;  5D5W B;  2XKP A;  3JTG A;  1Z7U A;  5LHI A;  3FM5 A;  5ERI A;  4EJV A;  1Z9C A;  1B4A A;  3P9K A;  2YU3 A;  1R58 A;  4EM1 A;  2A3S A;  2FSW A;  4IRH A;  3J7A O;  2W24 A;  1D8K A;  3E6B A;  2VN2 A;  4MEY F;  2DPU A;  4GO1 A;  3FMS A;  4HA8 A;  1CF7 A;  1FC3 A;  3K69 A;  1MZB A;  4IJA A;  3F6O A;  2BGC A;  1R1V A;  2F5E A;  2NNY A;  3B73 A;  1D3Y A;  2G7H A;  2OZ6 A;  5DV5 A;  2R3S A;  4HBL A;  4HOB A;  4LMY A;  3LA2 A;  3GX4 X;  1MJA A;  4L0Y B;  1U78 A;  1R1T A;  3M9A A;  3T8R A;  2EFO A;  2L02 A;  2KIU A;  1T0F A;  3DP7 A;  1O7L A;  4G7Z F;  1GHC A;  1R5G A;  3P9I A;  3LQQ A;  2IJL A;  1XGM A;  5E17 F;  2K02 A;  4HYE A;  5LRR A;  5K5R A;  3F8F A;  2O3F A;  2ZFW A;  4DNC A;  4I2O A;  4A12 A;  2FU4 A;  4YIF A;  2Y48 A;  5HVQ C;  1O57 A;  4XBF A;  4WK8 F;  2OU2 A;  2VOD A;  3WTZ A;  5L3B A;  1PP7 U;  3LA3 A;  3E5Q A;  1SFE A;  4ZYH A;  1TQI A;  3IKV A;  3Q9V A;  3K1N A;  1E17 A;  2FBI A;  4U0Y A;  3WG9 A;  4AIK A;  1QGP A;  2LF8 A;  5HDN A;  1S6L A;  3RYR A;  4BQA A;  1P92 A;  3GWZ A;  1FOK A;  4L5J A;  3J80 Z;  5JVT A;  1BI0 A;  1E2X A;  2CG4 A;  4EJT A;  1FWZ A;  3RKW A;  3VOE A;  2EFP A;  4G8X A;  1TW3 A;  2P5V A;  3E6C C;  4L5I A;  4EJU A;  3ECO A;  1T38 A;  4XLN F;  2HTJ A;  5BPI A;  1YFH A;  2OZU A;  4EVI A;  3B02 A;  5L3F A;  2UWM A;  2XHK A;  2VC1 A;  3KCC A;  3ZMV A;  2IW5 A;  1J0R A;  3CDH A;  2LSO A;  1XGO A;  4L9T A;  4IRI A;  4MTE A;  4HF1 A;  2ZXJ A;  5AIQ A;  3D5L A;  4U7D A;  3SQN A;  3C1D A;  1G3T A;  3HSR A;  1WRJ A;  1TQM A;  3EQL F;  3L9F A;  2TDX A;  3GLX A;  3T5X A;  3TO6 A;  5FFX A;  1XB4 A;  1LEB A;  2DQL A;  4XRF A;  3HIF A;  1BBY A;  4OIR F;  3QRF F;  4EGY A;  2V1D A;  3RKX A;  3F21 A;  2STT A;  3LQR A;  2ZME B;  1ZLJ A;  3BZ6 A;  1G4D A;  4KNY A;  4I7H A;  4A0Z A;  2Z99 A;  5LLQ A;  4M9X A;  5DEQ A;  2HS5 A;  2GQQ A;  1IXS B;  3G73 A;  1G3W A;  4PGH A;  2ESN A;  2W84 A;  2PEX A;  3I64 A;  2EFW A;  2HTS A;  3KLN A;  5LRS A;  5F6F A;  1DPR A;  2NAZ A;  2Z9O A;  4KIF A;  3ABU A;  1DPU A;  4Y15 A;  2FBH A;  3IKT A;  3ZMU A;  1IUY A;  1LDJ A;  2PQ8 A;  4MNU A;  1JXS A;  3R0J A;  3HTS B;  2QBY B;  3GZ5 A;  4I0A A;  1R7J A;  3JW4 A;  4FT8 A;  3E5X A;  3KEQ A;  2GZW A;  4HX4 A;  2A07 F;  2MA3 A;  4MQ9 F;  3GXO A;  3F8B A;  2J5P A;  4XSZ F;  3DPT A;  3ZPL A;  3FMQ A;  2D45 A;  2FE3 A;  3KP6 A;  3NRV A;  2G7U A;  4RGX A;  4ZZD A;  1ULY A;  1IXR C;  1FPQ A;  4GCV A;  1STZ A;  2E7W A;  3EYI A;  1S29 A;  3QP5 A;  3KZZ A;  4CHU A;  3Q9S A;  3V4G A;  1F1Z A;  2XKO A;  1HKS A;  4QWQ A;  2DQR A;  3QOP A;  4LFU A;  1CGP A;  4E70 A;  3EUH A;  2YX4 A;  4UXN A;  1RZ4 A;  3U1D A;  3GF2 A;  3O3K A;  4HV5 A;  2OD5 A;  1U5T A;  5K5Q A;  4IHT A;  3P9C A;  2KRF A;  2GA1 A;  4EGZ A;  2DT5 A;  1HW5 A;  2QZ8 A;  1XGS A;  2VBW A;  1W5T A;  2GWR A;  4A0X A;  2UXX A;  2F5C A;  2FML A;  2L4A A;  3HYI A;  5L3C A;  5CJ9 A;  4YG2 F;  4Q5S F;  2FNA A;  1FBS A;  4PDK A;  3WU1 B;  2EV0 A;  4WCG A;  4UV9 A;  5ICF A;  1R36 A;  3TOA A;  3PQK A;  5CVJ A;  1FYL A;  5CVI A;  3L09 A;  2HOE A;  1MDM A;  4F7Z A;  1W7P D;  3I58 A;  4UVB A;  4FHT A;  4S04 A;  2FQ3 A;  1QQI A;  3DF8 A;  3HOS A;  4ZYG A;  1ZHF A;  2BBY A;  5E1X A;  2RKH A;  1F9N A;  3ZMZ A;  4WXD A;  2L54 A;  3GFI A;  4A6E A;  2GXB A;  1FYK A;  1AWC A;  1ZG3 A;  1QBJ A;  2ZNY A;  4KIB A;  3WTT C;  2YX7 A;  2PJP A;  2K27 A;  3QP6 A;  4ENM A;  5EEH A;  1B9N A;  1OR7 A;  3V7S A;  4NQW A;  2G9W A;  1I27 A;  2HR3 A;  3KP7 A;  5ILU A;  3K1M A;  1HW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...