5DM7F

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
144
structure length
144
Chain Sequence
MRRVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
total genus 13
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5dm7F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5dm7F01
2ZJRF 4V19K 2E34A 5GADJ 3CF5F 3CJQB 1VQLI 3CC2I 2E36A 1FOYA 1YHQI 1YITI 1Y39A 5GAGJ 3CD6I 2K3FA 4IOAF 2ZJPF 1VQPI 1YJ9I 3CCUI 3PIOF 3CMEI 3G4SI 4IOCF 1VQMI 2FOWA 3G6EI 3CCJI 1YJWI 3I56I 1QA6A 1VQ7I 1VQNI 2ZJQF 1VQ6I 1VQ4I 1YIJI 1VQ9I 2JQ7A 3EGVB 2QEXI 1VQKI 3CCRI 3J7ZI 3CC7I 5GAHJ 5GAEJ 1VQ5I 3PIPF 3I55I 1HC8A 1FOWA 1VQ8I 2NXNB 3CC4I 1VQOI 1MMSA 3CJTB 4UY8I 1ACIA 1YJNI 3CCLI 2H8WA 3G71I 2E35A 3CCSI 3J7YJ 1YI2I 3DLLF 3CJRB 5DM7F 3CCVI 5DM6F 1FOXA 3CMAI 3CCMI 2OTJI 3CCQI 2QA4I 1S72I 3CJSB 5JVGF 3CCEI 4IO9F 1WIBA 2OTLI
chains in the Genus database with same CATH superfamily
2GOXB 2M1BA 1OCPA 4UVCA 2KJCA 2OU2A 3BG6A 4P5OA 2QBYA 5F0FA 2R5ZB 1P92A 2VB6A 4N4OB 2FE3A 1LE8A 3SEZA 3MKZA 3KLOA 4LLNA 5GAGJ 2AO9A 2DI3A 1XCBA 2DT6A 1ZGJA 4MNUA 2MW8A 2GQQA 3WE2A 1U8RA 1ZRDA 3M8EA 2ZXHA 3JREA 3I53A 3KIOA 3OYGA 4EJVA 1VNDA 3K4CA 4Y33A 4WCGA 3CP8A 2K27A 3VFZA 4A3BJ 1D8JA 2RQPA 2XAUA 1KONA 2TDXA 4NC8A 2PJRA 4L9NA 2ZNYA 3PQKA 2X9DA 3S8PA 4HA8A 3BG9A 2K40A 2E1MC 1A6QA 5ICEA 3SFIA 1D3YA 3FXJA 4NHJA 1YS7A 2JUCA 3D5LA 1IUYA 3KCCA 1AKHA 3NRVA 1X4PA 4EATA 1HDDC 3I56I 4Y3OA 3ERED 5B1BH 2X4HA 1EH8A 3L2VA 4HYEA 3HB9A 2XAFA 5FGMA 2QEXI 2CV1A 2LBFA 3HRMA 2IPQX 2UXXA 3KX2A 3AAFA 2VE9A 4BDYA 2GWRA 5GTHC 1IW7F 3BT9A 3K69A 5GP9A 3ZPLA 3Q0VA 1ZKGA 2DMQA 4KIFA 4F3QA 2WAFA 3DBLB 3K4MA 1W36C 2KP6A 4B3AA 4BHCA 4B3XA 3JAMZ 5E3MA 2NXNB 3NARA 2ID3A 4A3CJ 2MH9A 4EJOA 3CDHA 4OMYA 5JVTA 1E3PA 2CUZA 3SZGA 2AQFA 3T8TA 3V7CA 3GTGJ 2XPUA 5J8FA 1TBXA 4AIKA 4FQGA 2QBYB 2XHKA 4CCJA 2FJ1A 1MMGA 2MG4A 2VKHA 4CZCA 2K3PA 3I9V2 4IHXA 5DM7F 5H6QA 1D0YA 4BE0A 5EG0A 4DYCA 4K2EA 1XG1A 4E70A 2BZTA 3GLXA 2R0QC 3E6CC 2Z1DA 1MNMC 2XPVA 2JSCA 3OL3A 5IP6A 1IG7A 1ITYA 3ZQGA 2MH2A 2BY1A 1OISA 3BR0A 3NWSA 3OYAA 1ZLKA 1XDSA 2VONA 1JXSA 2R7QA 4P1WA 2PJRB 1FYMA 5LEJA 2XC7A 4AYBN 2HI3A 2M7BA 2EH3A 2VKDA 4HG2A 3V8JA 1MMDA 1GHCA 1RR7A 1P9QC 3V7SA 1KU2A 4UHTA 3JAMK 2W84A 4XSXF 4RB1A 4F93B 4UUSB 1FJLA 4D5CA 3A2KA 3LAJA 2XPWA 1AKHB 1LPQA 2E71A 4DQ2A 3HOSA 2A6EF 2FMLA 3HKZA 3CF5F 3E6BA 1GVDA 5C4JJ 4RAGA 1J59A 4WXDA 1FOYA 2CJJA 4F7ZA 1FTZA 3QP5A 2X6WA 4FTHA 1X19A 2F5VA 2LBFB 3FIWA 4BBRJ 4ITVA 3RPQA 1W0TA 4II2A 1UCRA 4IZZA 2BVMA 3OYHA 3C2GA 5L3DA 2HQ5A 2VC1A 2COMA 2HXOA 2JA6J 4U7DA 4CCNA 2VT3A 3S3NA 1H88C 2PJPA 1L0OC 2K5CA 2LP0A 4FE4A 1J75A 3HGGA 2G0EA 2VQHA 4JYKA 1VI0A 2YX4A 4A3EJ 2F4OB 1FYKA 2BY3A 3EETA 3FMSA 2HFHA 2O3FA 1XSDA 3E7LA 3F6VA 1IZ1A 4BDZA 3DPLC 5EG0B 5KK1A 3OYDA 4CYCA 2LG4A 2EJRA 3H92A 4JOMA 1BR2A 2LLKA 5M3MJ 5D6EA 3ONQA 1R00A 3HSEA 2IJLA 3MZHA 2DMNA 3L00A 5FD6A 1SVLA 3J80Z 4BKXA 3LNQA 3IAM2 1HLVA 4IKFA 4IXAA 1KGSA 4EVIA 4MO7A 4R1HA 3I58A 4PJLA 1X3UA 2HDCA 3OR1C 3KEQA 3KPHA 4RB0A 2GOMA 3OYCA 5HLHA 2EB7A 3GZ6A 2ZXJA 2D5VA 2KISA 3WGHA 3R0AA 5K5QA 3I4PA 1HCRA 5FO5A 1Z6TA 3N05A 3W2WA 4ESFA 3H3UA 4L9VA 2HKXA 5FKLA 4HZFA 1BIBA 1R23A 3ABUA 3WU2C 2HOTA 3E97A 4RGXA 2MA3A 3U1DA 2R7RA 3TW7A 2DU9A 2JUGA 3HPGA 2IGMA 1IXCA 5LFAA 2CYYA 4HLYA 2PLYA 2L4AA 4PFOA 5L3CA 2V26A 4HNTA 1T2KA 2GIZA 1CGPA 4V19K 1SMTA 1Q1VA 3F6OA 4JQFA 1J0RA 2QLZA 4CYCB 5FLXZ 4EJTA 2EIKH 5E79C 4PJJA 1GXQA 2JVGA 3DBHB 2KQRA 3QYBA 4EV0A 4L5JA 3DP7A 1YRNB 3M07A 4G6TB 3V8KA 2KFDA 3R4KA 3H9GA 3E3VA 1U8BA 3E6MA 1VQPI 2OAZA 4O3MA 5K5OA 1DUXC 2Y9YA 3PIOF 1NG6A 4XR6A 3VSLA 5D5WB 4H0EA 4QPOA 4UV8A 4A6EA 2XRLA 4CXFA 1ZLJA 4XN3A 1MMAA 4EM2A 2GXGA 2NVUB 2RNJA 2ZFUA 1MBEA 3TKYA 1TLHB 4PCQA 4RLQA 2QQ8A 2X85A 3MAJA 3HHHA 3O2PE 1MNDA 2OD5A 4MFDA 4DBQA 3RTRA 3ML6A 2IA0A 1U5TC 1Y56A 4RBOA 3S15J 1VZ0A 3CDLA 4F52A 4S0HB 1OCRH 3TQNA 3DBRB 2Y0SA 4A0YA 4ENNA 2NVTJ 5E8GA 5B3SH 3OYKA 2PI0A 4MLOA 1ENHA 3FXLA 1BA5A 5AONA 2LH9A 1I39A 2QQBA 4G12A 2LYCA 3GTMJ 1SMYF 1O4XA 3M8JA 1BR1A 2I5UA 2DQLA 3ZQHA 1B72A 2BHZA 2HDDA 2DTRA 4LGWA 3K1PA 3CUQA 2HEOA 5J4VA 3SDBA 2NRAC 1HC8A 2HZTA 1VQOI 2NNNA 1Z77A 5IYDJ 1MMSA 2UUZA 2DFFA 1QZYA 3K4BA 4FX4A 2QWWA 3RPUA 3HGYA 4P9UA 2L02A 3AKZA 2H8WA 3HXLA 1Z05A 2E35A 4I98B 1ERDA 3J7YJ 4M3DA 4ESBA 1HQCA 1DDNA 5FKKA 4L5IA 4Q47A 5AIQA 1J7KA 3B73A 4L9JA 2QZ8A 1PUFA 1YG2A 2DMTA 3A02A 1GDTA 4V2FA 2V6EA 1X1CA 3LA2A 3DF8A 4A6DA 2WAEA 3F72A 4O6JA 3ZGKA 4F55A 5E3OA 1JUMA 4BHBA 1XS9A 3IP4B 1RR8C 4LLLA 4HV6A 1PP8F 1TL8A 2P0WA 2DODA 3RPUD 3JRIA 2ELJA 2OQRA 1NTCA 2DOEA 2XGEA 1KQ8A 3BQZA 4ZYAA 1MDMB 5FFZA 1ZREA 5DD8A 3HYIA 3U9GA 3I59A 2NNYA 5CVJA 2D2WA 2L7FP 4XM3A 5D5XB 1ETYA 3OR2C 5HNHA 1O3QA 5HLTA 3ZMUA 2MLKA 1MBGA 1R58A 1Y1VJ 5DCFA 4PK4A 1VTNC 3ZP5A 2XROA 2R7TA 4X6AJ 1ZRCA 2FD5A 2M4GA 2L9RA 2DFHA 4YFKF 1WJEA 4BEHA 1OCTC 1GUUA 2W48A 1B72B 1HW5A 3ZXSA 3QU3A 1IV8A 5A2QZ 4ZTFA 3CUQB 4LIUA 1HF0A 3G3ZA 2M34A 1D1CA 2K4BA 1MZBA 4I02A 2ZB9A 1VQMI 1QVUA 4AC0A 4E7SA 3JRDA 3A1YA 4CGZA 2E60A 3W2VA 4C2UA 2B7EA 3HG9A 4M9SA 4RDUA 3PJRA 3DEUA 1HW1A 1USTA 1Z7UA 1R6RA 3GYHX 3VWBA 2WV1A 4NC6A 3H36A 2MABA 3D5SC 2K4JA 4LB6B 4DNCA 4ENKA 4KT6A 1LFBA 1YOVB 1LB2A 1I50J 5TGTA 2DFIA 2PEXA 1RKWA 1LUJB 1QGPA 5IY5H 2OA4A 3GCMA 4ABZA 2IGKA 1PUFB 3JSPA 5BMZA 2WTEA 4IRHA 3HTUA 3WTZA 1I27A 2CW7A 1XGMA 3K2AA 4KMUX 3WTYC 3HDDA 3C7JA 4AIHA 4HF1A 4IVNA 2Y69H 2EQRA 2ME0A 1O3TA 3BP8A 5HS8A 1B9NA 2VUMJ 3AFHA 2RAEA 2X48A 4L9TA 1D0XA 1YS6A 1QZZA 3LSMA 3CJTB 5DYMA 5LHHA 1ZGWA 3I59B 1X1BA 3BQYA 2GA2A 3M8FA 5CKTA 4BXFA 2W4SA 3WODF 5LHIA 2DA6A 3E5XA 4AIDA 5C44J 3ABMH 5D8LB 1WHUA 1N75A 2L01A 4BQQA 1HKQA 3P9IA 2OC6A 4J00A 3G2BA 4AYBA 4XICA 3M1CA 4BEHB 3O8HA 4XRMA 3PUBA 1Y8QB 5H6RA 3ESWB 1ONVA 2RVCA 2Z5UA 3Q0UA 3DKWA 3O3KA 1BI3A 5IP7J 1MW7A 3KYDB 4IL6C 1U3EM 4LG0A 3S1RJ 3ZMVA 4KYWA 1SANA 4OWRB 4C9YA 2K3FA 4HNVA 2FBIA 4CCLA 2VIXA 2Z9OA 1Y0UA 3K70D 2J5PA 2E1MB 3GF2A 2WY7Q 4UV9A 1E17A 2DPDA 3CJQB 1YYVA 1Z1DA 1V5EA 2ACJA 4BY7J 4BXXJ 2E19A 2DT5A 5EZHA 5DV5A 4OIPF 1W1WE 5ILUA 1G3SA 2MD5A 3ABKH 3QPTA 1XMKA 2VBXA 3BR6A 3PO2J 1WH5A 2UXNA 4BXUA 3SZPA 1OYYA 1T95A 2ESHA 3OYBA 1S3JA 3S3MA 2F4MB 2HTSA 2O03A 3IH4A 2MD0A 1FBQA 1B6AA 2O61A 1FMVA 4XLAA 1XSXA 4LLGF 2PX9A 2KKOA 2XF7A 2R7ZJ 3FKJA 3F8MA 2QENA 5HS9A 3ZMDA 2UWMA 3ERMA 1QA6A 3HL2A 1DP7P 3JW4A 2HGCA 4L0YB 2RREA 2OV7A 1T39A 3P7NA 3GMEA 3QU6A 3QPLA 3K4KA 1S8NA 1EKEA 2KZVA 1PJRA 3VYUB 3J7ZI 4BE1A 2XASA 1G3TA 1HBXG 2LR8A 1JJ6C 4A5MA 2QM3A 2VBWA 2LDUA 5LGUA 1MJAA 2MGQA 1HW2A 2PN6A 2C6YA 2MSYA 2QYOA 4LG0B 1WH7A 3HPHA 3RKXA 3W2AA 3CP2A 4ETSA 3SDGA 4N9IA 2VKEA 5LBQA 1DU6A 2N8GA 1EH7A 3K4JA 2Z16A 4I01A 2LKXA 2KRCA 2EA2A 3DTIA 1FIPA 2H09A 3U2RA 3RIRA 3H0DA 3OYIA 4A3KJ 3S2HJ 4WX9A 4G7OF 4KIBA 1W5SA 1DPRA 1X4OA 5DM6F 4G9YA 4XOTA 2EWNA 3T1BA 1C0WA 1I3QJ 2BXZA 2VJ4A 2LF8A 2O8XA 1IN8A 1ZG1A 2RNGA 3DKXA 4E7HA 3TMOA 2FQ3A 3GTJJ 3HC7A 3RJPA 3MVPA 2PFBA 1JE8A 4NQWB 1ZN2A 3I0TA 1EA3A 2BGCA 4EM0B 2GIVA 2R7UA 1S6LA 2P7VB 1RPWA 3SFZA 2ZSHB 3VOEA 1BOBA 5DUIA 2QQ9A 3T0YA 4M72A 4HLXA 2CU7A 2E34A 4JBAA 2XRNA 2EV5A 1PUEE 3K4LA 5BQTA 3J81Z 4QPQA 2KIMA 1GXPA 1QU3A 3RDIA 4AUXA 5IOZA 4W97A 1U9OA 1JT0A 2STWA 4D7MA 3FDYA 3ZMSA 2YUSA 3K2ZA 3DPTA 1OJLA 1P6RA 1G4DA 5L3BA 1ZRFA 4OAYA 3WTTC 1N25A 1FOKA 3IWZA 1BOAA 4YFNF 4HDUA 3CTAA 3CMMA 3HOWJ 2G7HA 2Y48A 3S1NJ 2PQ8A 1IRFA 2CG4A 1XX5A 2BYVE 1H89C 1SVMA 1TT5B 4KN4X 2COBA 3ZQLA 1YE9A 1VQNI 1F4KA 1XMXA 3LQRA 1BL0A 2EBIA 4CA0A 1YIJI 2VBZA 2OZ6A 3FXOA 2XIGA 1MNEA 2JN6A 3LFUA 1UG2A 3GFLA 1NH3A 2LREA 4RB3C 1T8IA 2M45A 3M9AA 5HLIA 1U5TA 4I09A 2VXZA 2XB0X 1HKSA 2FXAA 2JJ7A 4DOZA 3PUFA 3J81K 1WPKA 3CMYA 3OSFA 1VQ5I 4A3GJ 3WTSC 4E4HA 1BC8C 1I1SA 1MBHA 2L3DA 3BR1A 4UUSA 6PAXA 3K10A 4P9FA 1F5TA 2DA5A 1IGNA 1HA8A 2O5RA 1Y0NA 2R7SA 2Z33A 1JUPA 2ZNZA 1YJNI 4DW6A 4KISA 3BZKA 2V7FA 4HF2A 3DTEA 3FHNA 5ED4A 1WFXA 1JJ8C 2O9LA 1YI2I 1WJFA 1ZAOA 2ZJ2A 3FM5A 1XGSA 2W85A 3GZ5A 4B8XA 2LF7A 4C2MJ 4D7NA 5E17F 3OV8A 4C3HJ 3BDDA 5E1ZB 5FJ8J 1AOYA 4BJ5C 1S7EA 4XKWA 1IN4A 4BJTA 5FKOA 3S17J 4DBRA 3F23A 2FQ4A 4WXCA 4ZYGA 3IC7A 2K86A 4Y4RA 3BTIA 3K70C 2X0LA 3CJSB 2VN2A 2AHQA 2NVXJ 2VT2A 4B43A 3L2RA 3L2UA 5FLVA 4B4CA 1SFEA 2NS8A 1TQIA 4CHUA 2V6CA 1O3SA 1TWCJ 2OQGA 4HAMA 3E0JB 2KHMA 1MH3A 2VQLA 3DEWA 4I7HA 5C3EJ 3ABTA 3ZMTA 1QBJA 1E0EA 4F91B 3MKLA 1ZELA 1JHFA 1Y8RB 5CYVA 2IS4A 5H2FC 3FMRA 4YIIA 2R93J 4XLCA 3BG7A 3BJAA 2GZWA 3TO7A 3EUAA 4HDVA 2M4KA 1U5TB 3I3LA 1QHGA 4A3JJ 4XRSG 4RS8A 4XONA 3RCOA 1FTTA 1EJ9A 4EMSA 4E7JA 1QPMA 2WA0A 3K7AJ 2Z2SB 2HQNA 5LEKA 3QPSA 5KNLA 1K4SA 2A61A 1SD7A 2NVYJ 3F8CA 4MIMA 4U0YA 2JA2A 5M5WJ 1X2MA 3HUGA 2CUEA 3HOXJ 3I5UA 1T98A 2WAQN 1W7PA 2FSWA 4IQJA 1Z3YA 2RDPA 3TO9A 2FU4A 1GV5A 1DP3A 2I8DA 5EEGA 1IDZA 1BI2A 2L9VA 3BPXA 2XSJC 5D8KB 4ZZDA 3LA7A 2LOOA 2HYJA 1T0FC 3U21A 3J7AO 1QZEA 5FKNA 3FX3A 2FRHA 1LNWA 4N9HA 4BAYA 3PIPF 1P4AA 1B9MA 3LWFA 5HLGA 4ZYHA 4XLEA 4FE7A 2X1DA 5EEHA 5IP9J 3JR9A 2EZLA 4RM2A 1W7PD 3CCLI 5HOOA 3G71I 4GYGA 1LQ1A 4UVBA 1P4WA 2UV1A 4IJAA 3VDXA 5KAIC 3HRTA 2EA4A 1BC7C 5DTDA 3A0BC 1YRNA 3PL8A 2ZMEC 1V5GA 3GBGA 3B6AA 1HDPA 1JT6A 2MYSA 3PNVA 2ZFWA 1QO0D 5J47A 1X1PA 4ENMA 1Z0XA 3HRUA 1EF4A 2DO7A 1IF1A 2XAGA 3H5AA 4PSXA 1FX7A 2W00A 4JK1X 3QAHA 4Z2YA 4UB8C 1WJAA 3BTJA 2LMDA 3EUKL 2EFPA 4XNFA 1MSEC 3K1NA 1WIBA 2KT0A 4RA2A 4S05A 3IV5A 2JA8J 1KA8A 1K79A 3HUGB 2NS0A 2E7XA 1OLTA 5IT3A 2VXDA 1W7PB 1J2XA 1ZGAA 4ZYDA 3MQ0A 4GCVA 1XSVA 2VODA 3ZOBA 3Q5FA 5BS6A 2CV2A 1N78A 1MSFC 3TW6A 3OY9A 3BR5A 3S93A 3CCYA 3K0LA 1Y6IA 3B6CA 3OYJA 1VFCA 2DCEA 2CGPA 3W6VA 1U78A 2HPIA 1XMAA 1YJ9I 5J1UA 3J80K 1ZARA 2X6OA 2R5YA 1PP7U 4BY1J 2HOAA 3HJEA 5ERIA 5FRNA 3S1MJ 3F3XA 4G6QA 3WU1B 3ZN1A 2Q0OA 2EINH 3FXMA 1VF9A 3G6EI 2BVLA 1WJ5A 4OMZA 3AG3H 2WWYA 3L7WA 4D5FA 1MKMA 2HU9A 3ULQB 1VQ7I 2I10A 4KDPA 4EJUA 2LNBA 3HIFA 3VB2A 1ZK8A 1R36A 2ECCA 2F6CA 1WQ2A 4I6ZA 1IXRC 5F1RA 5E18F 3H5NA 2WB1N 4CSWA 1IV6A 1ETWA 5E3NA 1AU7A 5D4RA 2M5WA 3OIQA 2MLGA 2HYFA 4XKVA 2IS6A 1R22A 1FPQA 3MWMA 2K9SA 5EYRA 2ICWG 2L2OA 4HQEA 2DT7B 1R5HA 3E6DA 1O3RA 2LVSA 4XSZF 1WGXA 4J01A 4CZZA 1I6XA 4U0WA 3WHCA 1MDMA 5ICCA 3FK6A 4C2TA 1A36A 2YSRA 5M5XJ 2IT0A 1ZR4A 2EILH 5E20A 4UNOA 3JCUC 2CSOA 1SD4A 2H1LA 4IX7A 1IN7A 3WHBA 1TNTA 2V1UA 1MJ9A 2JT1A 3FXQA 2VJJA 2XF5A 4WF2A 3DXJF 3ZQFA 3FBIB 5FLXK 2V1NA 3IKTA 1X1AA 3G1LA 2OPTA 2KIFA 2BXYA 3CMAI 2TRTA 4GGGA 4GXOA 1TP4A 2BV6A 1KU7A 1PYVA 2LY1A 4PUSA 3RKQA 2BEOA 2R5YB 4Y17A 2L7MP 3E5UA 5B5EC 4LJZF 2JPBA 3E5QA 1UHSA 4RAFA 3PSIA 4KNYA 1K6YA 1OKRA 2M7AA 4YFXF 4YRVA 5JVGF 2A5WA 1BI1A 1K78A 5CQEA 1RKTA 1ON2A 1V55H 2QGUA 2BHYA 1RC9A 4UUTA 1ZG5A 4ZZLA 2VC0A 1AWCA 2ZJRF 5IT9Z 1R7JA 4E7KA 5EEAA 4ESJA 3ISPA 3RYPA 3QOPA 2ADUA 2H27A 3EYYA 4IRIA 2WBMA 2PMHA 2P8TA 3HZJA 1G3WA 5DEQA 9ANTA 1AA7A 2AS5F 1R1TA 3DKYA 4ZJZA 3KFWX 3JRFA 4CICA 2EFQA 3BJ6A 3CESA 4HV5A 1I5ZA 4G94A 3CMEI 1SFUA 1SAXA 1UHMA 1F9NA 4LOCA 2B9SA 2LD5A 3H3VK 3GTPJ 3W6JB 5JFRA 1TC3C 4IF4A 4M74A 1PVEA 2VASA 2EK5A 3H1CA 4HSRA 1MD0A 1F43A 3M1EA 2GA1A 4XKCA 3T8RA 4BACA 3ASOH 4GYIA 4GRIA 1ON1A 5D5UB 3BR2A 2BE5F 1VQKI 4OIQF 5IT9K 2CW0F 4MTDA 3EQLF 1POGA 4XLNF 3WGIA 1MGTA 2H94A 4RGRA 2GBYA 1UAAA 3A4CA 3JRHA 4EJWA 2QKMB 4KMFA 1P7IA 2X6XA 3ASNH 2JK3A 2FNAA 2HWVA 2Y31A 3SEQA 5L3GA 4L18B 1X58A 3BZ6A 4IHWA 3COAC 2DW4A 2X1CA 3S1QJ 2IRFG 1K78B 3HTSB 5HVQC 1V5FA 2Z3YA 4FISA 4FCYA 3PFIA 5D4SA 2PBIA 2XAHA 2HPMA 2G7UA 3OWTA 4RB2C 2LK2A 1QVTA 3SQNA 1TW3A 4RM3A 1OQYA 3TEDA 1QNTA 1X1DA 2YPRA 1ZR2A 3L9FA 1NHAA 5J3LA 1FBSA 1R9TJ 3S14J 2V9KA 5BPDA 2AXTC 4UVAA 5FROA 4A3FJ 1DPUA 3F8BA 2OTJI 4WWCA 1MBKA 5A2QK 2D1HA 2VOOA 4LK1F 4X0GA 3VYTB 1E2XA 5TRDA 5F0CA 2KPMA 1RUOA 2QCOA 1QQIA 5K5RA 1ETQA 4A3LJ 3NWTA 1NK2P 2Q2EA 4M3EA 3K6GA 4A3DJ 4YIFA 1G59A 3H35A 1OCCH 1IAWA 1LKXA 2Y30A 2DA2A 2HR3A 2WV0A 2X51A 1WJDA 4Q48A 2M9HA 3JSOA 1UJ8A 3LSPA 1YW8A 4E7IA 2RQQA 1VQLI 3ELKA 3AG4H 3K4NA 1YHQI 1DU0A 1TWHJ 1JTYA 3CLOA 3G1OA 5EF6A 2OZUA 3RZDJ 2O6GE 1HSTA 5F1JA 4AM3A 4C3IJ 5EGOA 1APLC 2OCCH 2Y0MA 3DLAA 4PZJA 4FT8A 3H5RA 4WK8F 4AWXB 4IHTA 4EGYA 2L5QA 1BIAA 1Z9CA 1X3ZB 2Z99A 4BE2A 4IOCF 1JI8A 2XKOA 4XRFA 2P6SA 2WAQA 2KRFA 4B47A 3GFMA 4XL9A 3OMYA 3MZ8A 2R92J 3BJOA 4EGZA 1SC7A 4CCKA 4ASNA 1LEAA 2W1OA 3RI4A 1LFPA 1ZQ3P 1G2HA 3CQZJ 2B0LA 3LMMA 4OAZA 3IH2A 2HVQA 2LRDA 4XLFA 2P5VA 1LJ9A 3EGVB 1RRJA 3BG3A 5CJ9A 4U87A 1B8IA 5GPCA 3OSGA 3ZQIA 3IRRA 2XVCA 1AHDP 4XIDA 2CQNA 2HKOA 5LRSA 5LHGA 2DMUA 4LFUA 2M2EA 3LOCA 2LY9A 4ZYEA 1V4RA 1R71A 4OIRF 2E7WA 4NQWA 2MFZA 4CCMA 5KVRA 4B44A 3OYEA 4LIVA 4KN7X 3CC4I 4AVPA 3BCAA 2XF6A 4LG3A 1T0FA 4KITB 2CWEA 2Q2EB 2IVMA 3QYFA 2KDOA 1FC3A 3OYMA 2JMWA 2QKLB 2L54A 4R8HA 2GLOA 2FBHA 4QTRA 1OCOH 3GFIA 1LEBA 3DLLF 1FEXA 3HSFA 2VBYA 2JSPA 4IQ4A 2JVHA 3VEPA 2NYXA 4RLFA 1JHHA 3LSRA 3EUHA 3A0HC 3BR3A 1MIJA 4PJ0C 1N77A 3FBNB 3GTKJ 5CVVA 5EGOB 5F64A 3GO5A 1XB4A 2ZCWA 3FXRA 1A6IA 2LKPA 3L2QA 3M3YJ 2F5FA 2ZMEA 5BOXA 1FY7A 2F5CA 3BROA 2E1NA 4A0XA 1FP2A 3OIPA 4M3GA 2EFOA 2A3SA 2CO5A 2CQKA 2WY8Q 2X1EA 3WG7H 4X1EA 1FSHA 3WTVC 4JX4A 3KEYA 1UG0A 5K7ZA 3VYRB 3H9QA 2W7NA 2IW5A 2KMUA 3N97A 1O57A 4I99C 1OFCX 4OINF 1OCZH 4EQQA 2R7VA 4EM1A 1B8IB 1BN5A 2RGVA 4Z6YA 1NG7A 1OR7C 5KHDA 2BY0A 3FHZA 4NUBA 1JGSA 2XV4S 3R61A 4DJAA 1W5TA 2ESNA 5LGTA 1DGRM 3QP6A 3ZQ7A 1MMNA 1KU9A 2B63J 1HSJA 5EJCA 4BQAA 3GXOA 3DPUA 3FZVA 4DZJA 5D5VB 3W6KB 2CV0A 3CLQA 1FP1D 4RGSA 4M6VA 1FYLA 4XK4A 2IS2A 5M3FJ 1B59A 4BBSJ 4I0BA 4PDKA 2CUFA 4QWQA 2A68F 1YJWI 1GLNA 2DYSH 3F0CA 4HBLA 3ZCOA 2WB1A 2Y75A 2EZHA 2CRGA 1T6SA 3ZQCA 2CQQA 4BH9A 2HZDA 1H0MA 1A04A 2V9PA 3SXYA 1SVOA 4M6YA 3F9KA 1YO5C 2XGXA 2P81A 4R79A 3DFGA 5F04A 4BNCA 4HOBA 5GAHJ 2NOJB 2L7KA 2LC2A 3JTHA 4MHGA 5GAEJ 3VPRA 1TQMA 2ZMEB 1W0UA 2ELKA 2MC3A 2XUBA 2YU3A 3PQJA 5KCMA 4AD9A 3DEEA 3N4MA 1BM9A 1O7FA 1REPC 1S7AA 1FT9A 1P4XA 5JLWA 1K4TA 3MD2A 1W5CC 2QSFX 5TISC 4XMYA 4DGWB 4M71A 3OYFA 1Q1HA 2W82A 2CH0A 4U0VA 3IH3A 3HOVJ 4A69C 1FBUA 1UHWA 4M9XA 4XKBA 1MBJA 4G7HF 3GW2A 2DMPA 3PFYA 4PSWA 3LSGA 3CCMI 4IPAA 4XORA 3DU5A 3RYRA 4LMYA 2DFEA 1H9TA 5FB2A 2IBDA 2DTZA 3ZRGA 3L1PA 2F4IA 3OS0A 4GFBA 4HEA2 3D0SA 5HDGA 3CJNA 4CH7A 2VOPA 2DYRH 3FXUA 1XGOA 4HX7A 4RGUA 2FOKA 1K61A 3ABLH 4BL0B 3WU0A 2E5ZA 3GTLJ 2PMUA 1EH6A 2DOAA 4L0ZB 1TWAJ 4O5VA 2ISYA 4XN0A 1WVRA 3KP2A 1LVKA 3QWLA 3TP3A 2DA4A 3U1KA 3AG2H 5L3FA 2KDZA 4IOAF 4S04A 2KIQA 4WXHA 3WGGA 2ZC2A 1G8XA 3QQAA 4HX4A 2XB5A 1JUSA 4RAZA 1O7LA 4BQOA 2ZJPF 3HOZJ 3KP4A 5FD5A 2O7OA 3KLNA 2ISZA 4H4KC 5KAFC 1D1AA 3WG9A 5B66C 1H9GA 1X3WB 4NC7A 1WJBA 4BQNA 1JKOC 3GUDA 3HHGA 3M4OJ 1K7AA 1G6NA 5CPRB 3BTCA 4D9JA 4Y7NJ 2A6TA 2A6HF 1KYWA 3TDUC 3EDPA 3OS1A 5E1XA 2IAIA 3MFKA 4NBQA 2E1CA 2JRMA 4HNUA 3EYIA 1R4MB 3DV8A 1Z6RA 3P5JA 2P4WA 4KA4A 1SFOJ 4Q4ZF 4U7BA 2K9LA 3IWFA 2R7FA 5D6FA 3JRGA 3JRAA 2JQ7A 3FKIJ 1R49A 4PJNA 1U6GA 2DDAA 3LSKA 1LE8B 1JKRC 2M0CA 2VQCA 4IRGA 2Y2ZA 3KZZA 1T33A 1YX5A 1F1ZA 3HM5A 2IA1A 3WTXC 1KZHA 3J7AY 3C2BA 1VQ8I 2DA1A 4A93J 5IYCJ 5LD2C 4EEFG 3MEXA 3L2WA 2CUJA 1SAUA 1GV2A 5J6XA 1IRXA 3AL0B 3BTLA 2DA3A 1TQPA 3CCSI 4E6KG 1IJWC 4MEXF 2DBBA 1GVJA 4XLHA 3CJRB 3KZYA 2A5YB 2HNHA 3S2WA 2KJBA 3CCVI 3ZR8X 5F0HA 2CFXA 2QF7A 5JHFA 3S2DJ 4CUGA 2DLLA 2RV8A 2GXAA 2R7DA 5J1RA 5F27A 2ZXWH 5F6FA 4ZC3A 1BJAA 2IGNA 3DU6A 2V1DA 2KL4A 1YX3A 5IYBJ 3EUHC 5H20A 1MJBA 3TOAA 5AIPA 2MBFA 1K6OA 3CF2A 4QLCU 4F92B 2XGDA 3FK7A 2W57A 2DK5A 5EZGA 3HOYJ 2STTA 1YW9A 4LITA 3RSNA 3ZMZA 4OIOF 3KYCB 5CQGA 3X2QH 2VPRA 3R0JA 1S9HA 2YX7A 5GADJ 1P7JA 2DJNA 3NEUA 4JX6A 2E2HJ 3RQIA 4YELA 4Y52J 3C2HA 1YITI 1Y39A 2H1KA 1ETOA 4Q5SF 3FF5A 1UZCA 1S29A 2CS3A 2JA7J 4II3A 4MEYF 2EFWA 2CW8A 3L2CA 3CCUI 1R1UA 3BC8A 2L4MA 1XDUA 3F22A 3GFJA 1HOMA 3Q3SA 1BW5A 2FMYA 2BY2A 2VJ5A 1B4AA 2V1XA 2IS1A 2P7CB 2BW3A 3K9TA 4HW0A 2XSDC 3BZCA 4N0BA 1UB9A 2VJIA 4HPQA 1RESA 4YIRX 4DYRA 2NAZA 4BUPA 1WI9A 3WTUC 1TNSA 4DIQA 3DCFA 1MBFA 2HVRA 1VQ6I 1XN7A 1FIAA 3DWLE 2O8KA 4IHVA 2Q1ZB 1ORKA 3GWZA 3CZ6A 1WKMA 3CCRI 3BCBA 2EV6A 4HX8A 4NDLA 3JTGA 1I6HJ 2GM4A 1FNNA 1EV7A 1RNLA 2TCTA 3TP0A 3TO6A 1HKTA 1E3HA 3MN2A 3CDIA 4B09A 1XGNA 3NAUA 4G8XA 2ECBA 2DPUA 1SD6A 1RETA 5BNGA 3GTOJ 3Q9VA 3KZIC 1OYIA 5GPAA 3PNYA 1YTYA 2IGOA 2VKVA 3MCZA 5DD4A 4A2UA 2FUG2 2E2IJ 1J5YA 2K02A 5IPAA 4MGRA 1ULYA 4TV7A 1D5VA 2EIMH 1ETVA 4I76A 5J40A 2H8RA 5K7FA 5E1WA 3I54A 1S5LC 1Z91A 4KFCA 1Z7LA 2OF7A 2VI6A 4YEJA 2FNPA 5B1AH 1HXDA 2JA5J 5IOYA 4M6XA 4C30A 2DA7A 1U0JA 2D1VA 2K9QA 2KIUA 5F08A 3R60A 2V9VA 4AU7A 2PMZN 4M3FA 4MQVA 3P9KA 4KUMA 3IKVA 3LSTA 3RQ4A 2FF4A 4BGDA 2M3AA 2VPLA 1RZ4A 4RMNA 1IXSB 4A3MJ 3L09A 1A31A 5HNFA 1XCVA 3OS2A 3CCEI 4IO9F 3GLLA 2BW3B 1BR4A 1ZYRF 3SYTA 2NOGA 1E3OC 2F2EA 5K7HA 2LFBA 3MKWB 3UNGC 2F5DA 1OMIA 2AQEA 3ECHA 4FX0A 2O0YA 4UB6C 1YLFA 1YW7A 3DQVC 1TTYA 3BOQA 3FWEA 4YG2F 1A35A 1IN6A 3LL7A 3OYLA 2HXIA 2F5EA 1ZHFA 4Y13A 3BY6A 2CQ7A 3MMYB 3BPVA 2OUMA 5CVIA 3AL0C 2E1OA 4ZH4F 1CF7A 2JRTA 2ZBKA 4L5EA 1QRYA 1PDNC 3H0GJ 4JX5A 4M9ZA 1OR7A 3ECOA 2LSOA 3TGNA 4GO1A 1ODDA 1ZTRA 4PFPA 1WZ2A 3FXKA 3OL4A 4J19A 1S7OA 2HVSA 2VLAA 4LB5A 2P6TA 5GTIC 1XTAA 3UR3C 3HSRA 4QIWN 2IXSA 2R3SA 2J5OA 3E1SA 2OBPA 2RKHA 4UXNA 4XLPF 3V42A 1VQ4I 1VQ9I 5BPIA 1RIOH 1KYZA 1ETXA 1SEUA 3KP6A 4HSTA 1I3AA 1CQTA 1DQUA 5LLQA 3W3CA 3EPZA 3CC7I 2W24A 5DUKA 1J09A 1G3YA 5E3LA 2LKSA 4KICA 2F48A 3KE2A 1IO2A 3REOA 3QPHA 1FOWA 4ENJA 3LSIA 3HRSA 1WSUA 2HDWA 3P9CA 2YS9A 1I1GA 2ZSIB 4M3BA 4KT5C 1QHHD 1ACIA 3IRQA 4I2OA 2CMPA 4P55A 3PO3J 5ICFA 3LA3A 3V8LA 4D1QA 3VYSB 2UZKA 2XGCA 3GTQJ 1T08B 3JRCA 2KRHA 1T56A 2ID6A 4BS9A 3R6SA 5HDKA 2HS5A 3LSJA 5JLXA 3QODA 1JKPC 3MKYB 1CF7B 4KJZA 2MC4A 2L7ZA 2ETHA 4BJ6C 2IP2A 3OOPA 2ME6A 2L0KA 4XOPA 2Y9ZA 3H3ZA 2P5KA 3S32A 1W4MA 4FHTA 2GAUA 3G1MA 4JP0A 4OU0A 2OCEA 4E7ZA 2KZGA 4D0PA 4ZDOA 4CDGA 1U9NA 1DGWY 4ANJA 3BG5A 2DQRA 4B1RA 3GZNB 5EDNA 2BOLA 3S3OA 3ROUA 3T5XA 4IEJA 3CD6I 2R7OA 1XC5A 2E5NA 2R7WA 2EZIA 2M8GX 3B02A 3FM3A 3HKZN 2XAJA 3V7RA 4DYQA 1LDJA 1XD7A 3O6BB 2IEKA 1LFUP 3IUOA 5ILVA 2V4JC 2NVQJ 4BHPA 5ICGA 2RC4A 5LGNA 3O8GA 2A69F 1GT0C 2DK8A 5M5YJ 4HRIA 2EPFA 1SD5A 1TWGJ 5DCMA 2DJIA 1JGGA 1D1BA 5TJJA 1YQAA 3Q9SA 1Z3XA 3FISA 3GVAA 4LD5A 1FZPB 1R4NB 1B1BA 5LRRA 5ILSA 5J4YA 3Q0WA 2ZJQF 4QSHA 2M30A 1H8AC 3HEFA 4PJMA 5DS9A 2EIJH 2H6BA 2ELHA 5JR3A 4A12A 1ZG3A 4Y15A 3WE3A 3HOTA 4C3JJ 1XPXA 3GX4X 3M7GA 1BBYA 3I4MJ 2RN7A 3WTWC 2FX0A 3I55I 4IHSA 1KQ0A 3D5RC 5CVUA 2R4GA 2QUFA 1WJCA 1FMWA 2JPCA 3S16J 3VODA 4UUVA 5FFXA 2V79A 4MTEA 1W36D 2GXBA 3LFKA 4XRSA 4RAYA 4ZDLA 2YR2A 3QYEA 2WC2A 2K9MA 4E7LA 3HBLA 3AG1H 1TT0A 3QOEA 4FETA 2VL8A 1Z21A 2VE8A 5DDGA 4CCOA 2H6CA 1D0ZA 1V54H 1SFKA 1OYWA 3A03A 3FMQA 4A0ZA 2HOEA 5FLMJ 3RKYA 2HTJA 5J8CA 2FA5A 3MZYA 3PNTA 2QA4I 2Q8KA 1ZH5A 5L3EA 1WI3A 1SFXA 5HS7A 1FWZA 1WRJA 5DCMB 3DTKA 2FEZA 3SZTA 4MFEA 4GDFA 2W25A 5JI6A 1QPIA 2WADA 3QRFF 1T38A 4PGGA 1KU3A 1BJZA 2OTLI 2XAQA 1IC8A 2K7LA 2M8EA 1F36A 3A01A 1WCMJ 1LDKB 1IRGA 3C1DA 2M87A 2JWTA 4IHYA 2DXIA 1UELB 3KEOA 3PM1A 4N4NB 5HDNA 1RI7A 3CC2I 2E36A 3IHUA 2IA2A 3SHFA 1IRZA 5FRMA 1JKQC 2CQXA 2JZYA 2A07F 2HOSA 2XKPA 3RKWA 3KP7A 4MQ9F 5K1YA 4M73A 1LDDA 1Y1WJ 3I71A 4V2GA 2EV0A 1JTXA 2HYGD 4P96A 3TOBA 3ZN0A 2QQAA 2AXLA 5FKMA 1A5JA 2NS7A 3G4SI 3JRBA 2X6YA 5J1YA 1FSEA 1BI0A 3OYNA 1R5GA 1NK3P 4U88A 3KP3A 2FOWA 1KQ9A 2FBKA 1D8KA 5JHUA 2A05A 3BWGA 3CCJI 2VQGA 4DZPA 3NQOA 2KLOA 2L9NA 3LSHA 4BYYA 5CLSA 4AIJA 1M1EB 3SJMA 2R5ZA 3ZQQA 1D5YA 4NNJA 2M0MA 1USSA 4NB5A 1RUNA 2LY2A 3BLYA 3F8FA 3LAPA 3D1NI 3PSFA 3HOUJ 2LTPA 3F21A 3C18A 1YIOA 3GEZA 2DDBA 3CUQC 3OOUA 2DN0A 2E2JJ 4CYDA 4G7ZF 4PGHA 1R1VA 4ZDPA 3CO6C 1UMQA 3C3WA 3V4GA 4I0AA 4A3IJ 4G6DA 5CVRA 4FASD 2ZXIA 1STZA 2Y0SN 4HQMA 4ON0A 4AVZA 2K9NA 1R5ID 1P2FA 2QSHX 3F8NA 1LVAA 1U2WA 2CFOA 1WWXA 1YFHA 3TDZC 2DAOA 4A5NA 1IN5A 3UKGA 2EZKA 4UY8I 1K83J 2K85A 3H9JA 1X2NA 3VSKA 3I64A 2QSGX 2HQAA 3A01B 1IDYA 4B48A 2ZKZA 3LQQA 3KETA 2ZO4A 1TWFJ 3RZOJ 3TBIA 3IAS2 1ETKA 2HQRA 3CUOA 2L9SA 2YU9J 2DOFA 4XQFA 3G73A 3TL4X 4W1UA 2R7XA 2PG4A 2PMZA 4KIGA 3CO7C 1FOXA 2G9WA 2BBYA 5C4XJ 2D45A 1V3FA 3KYLA 1FLIA 4LK0F 2JTVA 4XBFA 3KP5A 4OOIA 2EFNA 5E8IA 3CCQI 4BU2A 5HODA 3I4NJ 1J9IA 2XDVA 1OPCA 1IUFA 2P5LC 3IL2A 2QVOA 4ZTJA 1Z67A 3OIOA 1BW6A 1S72I 1UFMA 1TZLA 4HF0A 1L3LA 1MH4A 2OJED 4CO8A 1TW2A 3K1MA
chains in the Genus database with same CATH topology
2ZJRF 4V19K 2E34A 5GADJ 3CF5F 3CJQB 1VQLI 3CC2I 2E36A 1FOYA 1YHQI 1YITI 1Y39A 5GAGJ 3CD6I 2K3FA 4IOAF 2ZJPF 1VQPI 1YJ9I 3CCUI 3PIOF 3CMEI 3G4SI 4IOCF 1VQMI 2FOWA 3G6EI 3CCJI 1YJWI 3I56I 1QA6A 1VQ7I 1VQNI 2ZJQF 1VQ6I 1VQ4I 1YIJI 1VQ9I 2JQ7A 3EGVB 2QEXI 1VQKI 3CCRI 3J7ZI 3CC7I 5GAHJ 5GAEJ 1VQ5I 3PIPF 3I55I 1HC8A 1FOWA 1VQ8I 2NXNB 3CC4I 1VQOI 1MMSA 3CJTB 4UY8I 1ACIA 1YJNI 3CCLI 2H8WA 3G71I 2E35A 3CCSI 3J7YJ 1YI2I 3DLLF 3CJRB 5DM7F 3CCVI 5DM6F 1FOXA 3CMAI 3CCMI 2OTJI 3CCQI 2QA4I 1S72I 3CJSB 5JVGF 3CCEI 4IO9F 1WIBA 2OTLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR F;  4V19 K;  2E34 A;  5GAD J;  3CF5 F;  3CJQ B;  1VQL I;  3CC2 I;  2E36 A;  1FOY A;  1YHQ I;  1YIT I;  1Y39 A;  5GAG J;  3CD6 I;  2K3F A;  4IOA F;  2ZJP F;  1VQP I;  1YJ9 I;  3CCU I;  3PIO F;  3CME I;  3G4S I;  4IOC F;  1VQM I;  2FOW A;  3G6E I;  3CCJ I;  1YJW I;  3I56 I;  1QA6 A;  1VQ7 I;  1VQN I;  2ZJQ F;  1VQ6 I;  1VQ4 I;  1YIJ I;  1VQ9 I;  2JQ7 A;  3EGV B;  2QEX I;  1VQK I;  3CCR I;  3J7Z I;  3CC7 I;  5GAH J;  5GAE J;  1VQ5 I;  3PIP F;  3I55 I;  1HC8 A;  1FOW A;  1VQ8 I;  2NXN B;  3CC4 I;  1VQO I;  1MMS A;  3CJT B;  4UY8 I;  1ACI A;  1YJN I;  3CCL I;  2H8W A;  3G71 I;  2E35 A;  3CCS I;  3J7Y J;  1YI2 I;  3DLL F;  3CJR B;  5DM7 F;  3CCV I;  5DM6 F;  1FOX A;  3CMA I;  3CCM I;  2OTJ I;  3CCQ I;  2QA4 I;  1S72 I;  3CJS B;  5JVG F;  3CCE I;  4IO9 F;  1WIB A;  2OTL I; 
#chains in the Genus database with same CATH topology
 2GOX B;  2M1B A;  1OCP A;  4UVC A;  2KJC A;  2OU2 A;  3BG6 A;  4P5O A;  2QBY A;  5F0F A;  2R5Z B;  1P92 A;  2VB6 A;  4N4O B;  2FE3 A;  1LE8 A;  3SEZ A;  3MKZ A;  3KLO A;  4LLN A;  5GAG J;  2AO9 A;  2DI3 A;  1XCB A;  2DT6 A;  1ZGJ A;  4MNU A;  2MW8 A;  2GQQ A;  3WE2 A;  1U8R A;  1ZRD A;  3M8E A;  2ZXH A;  3JRE A;  3I53 A;  3KIO A;  3OYG A;  4EJV A;  1VND A;  3K4C A;  4Y33 A;  4WCG A;  3CP8 A;  2K27 A;  3VFZ A;  4A3B J;  1D8J A;  2RQP A;  2XAU A;  1KON A;  2TDX A;  4NC8 A;  2PJR A;  4L9N A;  2ZNY A;  3PQK A;  2X9D A;  3S8P A;  4HA8 A;  3BG9 A;  2K40 A;  2E1M C;  1A6Q A;  5ICE A;  3SFI A;  1D3Y A;  3FXJ A;  4NHJ A;  1YS7 A;  2JUC A;  3D5L A;  1IUY A;  3KCC A;  1AKH A;  3NRV A;  1X4P A;  4EAT A;  1HDD C;  3I56 I;  4Y3O A;  3ERE D;  5B1B H;  2X4H A;  1EH8 A;  3L2V A;  4HYE A;  3HB9 A;  2XAF A;  5FGM A;  2QEX I;  2CV1 A;  2LBF A;  3HRM A;  2IPQ X;  2UXX A;  3KX2 A;  3AAF A;  2VE9 A;  4BDY A;  2GWR A;  5GTH C;  1IW7 F;  3BT9 A;  3K69 A;  5GP9 A;  3ZPL A;  3Q0V A;  1ZKG A;  2DMQ A;  4KIF A;  4F3Q A;  2WAF A;  3DBL B;  3K4M A;  1W36 C;  2KP6 A;  4B3A A;  4BHC A;  4B3X A;  3JAM Z;  5E3M A;  2NXN B;  3NAR A;  2ID3 A;  4A3C J;  2MH9 A;  4EJO A;  3CDH A;  4OMY A;  5JVT A;  1E3P A;  2CUZ A;  3SZG A;  2AQF A;  3T8T A;  3V7C A;  3GTG J;  2XPU A;  5J8F A;  1TBX A;  4AIK A;  4FQG A;  2QBY B;  2XHK A;  4CCJ A;  2FJ1 A;  1MMG A;  2MG4 A;  2VKH A;  4CZC A;  2K3P A;  3I9V 2;  4IHX A;  5DM7 F;  5H6Q A;  1D0Y A;  4BE0 A;  5EG0 A;  4DYC A;  4K2E A;  1XG1 A;  4E70 A;  2BZT A;  3GLX A;  2R0Q C;  3E6C C;  2Z1D A;  1MNM C;  2XPV A;  2JSC A;  3OL3 A;  5IP6 A;  1IG7 A;  1ITY A;  3ZQG A;  2MH2 A;  2BY1 A;  1OIS A;  3BR0 A;  3NWS A;  3OYA A;  1ZLK A;  1XDS A;  2VON A;  1JXS A;  2R7Q A;  4P1W A;  2PJR B;  1FYM A;  5LEJ A;  2XC7 A;  4AYB N;  2HI3 A;  2M7B A;  2EH3 A;  2VKD A;  4HG2 A;  3V8J A;  1MMD A;  1GHC A;  1RR7 A;  1P9Q C;  3V7S A;  1KU2 A;  4UHT A;  3JAM K;  2W84 A;  4XSX F;  4RB1 A;  4F93 B;  4UUS B;  1FJL A;  4D5C A;  3A2K A;  3LAJ A;  2XPW A;  1AKH B;  1LPQ A;  2E71 A;  4DQ2 A;  3HOS A;  2A6E F;  2FML A;  3HKZ A;  3CF5 F;  3E6B A;  1GVD A;  5C4J J;  4RAG A;  1J59 A;  4WXD A;  1FOY A;  2CJJ A;  4F7Z A;  1FTZ A;  3QP5 A;  2X6W A;  4FTH A;  1X19 A;  2F5V A;  2LBF B;  3FIW A;  4BBR J;  4ITV A;  3RPQ A;  1W0T A;  4II2 A;  1UCR A;  4IZZ A;  2BVM A;  3OYH A;  3C2G A;  5L3D A;  2HQ5 A;  2VC1 A;  2COM A;  2HXO A;  2JA6 J;  4U7D A;  4CCN A;  2VT3 A;  3S3N A;  1H88 C;  2PJP A;  1L0O C;  2K5C A;  2LP0 A;  4FE4 A;  1J75 A;  3HGG A;  2G0E A;  2VQH A;  4JYK A;  1VI0 A;  2YX4 A;  4A3E J;  2F4O B;  1FYK A;  2BY3 A;  3EET A;  3FMS A;  2HFH A;  2O3F A;  1XSD A;  3E7L A;  3F6V A;  1IZ1 A;  4BDZ A;  3DPL C;  5EG0 B;  5KK1 A;  3OYD A;  4CYC A;  2LG4 A;  2EJR A;  3H92 A;  4JOM A;  1BR2 A;  2LLK A;  5M3M J;  5D6E A;  3ONQ A;  1R00 A;  3HSE A;  2IJL A;  3MZH A;  2DMN A;  3L00 A;  5FD6 A;  1SVL A;  3J80 Z;  4BKX A;  3LNQ A;  3IAM 2;  1HLV A;  4IKF A;  4IXA A;  1KGS A;  4EVI A;  4MO7 A;  4R1H A;  3I58 A;  4PJL A;  1X3U A;  2HDC A;  3OR1 C;  3KEQ A;  3KPH A;  4RB0 A;  2GOM A;  3OYC A;  5HLH A;  2EB7 A;  3GZ6 A;  2ZXJ A;  2D5V A;  2KIS A;  3WGH A;  3R0A A;  5K5Q A;  3I4P A;  1HCR A;  5FO5 A;  1Z6T A;  3N05 A;  3W2W A;  4ESF A;  3H3U A;  4L9V A;  2HKX A;  5FKL A;  4HZF A;  1BIB A;  1R23 A;  3ABU A;  3WU2 C;  2HOT A;  3E97 A;  4RGX A;  2MA3 A;  3U1D A;  2R7R A;  3TW7 A;  2DU9 A;  2JUG A;  3HPG A;  2IGM A;  1IXC A;  5LFA A;  2CYY A;  4HLY A;  2PLY A;  2L4A A;  4PFO A;  5L3C A;  2V26 A;  4HNT A;  1T2K A;  2GIZ A;  1CGP A;  4V19 K;  1SMT A;  1Q1V A;  3F6O A;  4JQF A;  1J0R A;  2QLZ A;  4CYC B;  5FLX Z;  4EJT A;  2EIK H;  5E79 C;  4PJJ A;  1GXQ A;  2JVG A;  3DBH B;  2KQR A;  3QYB A;  4EV0 A;  4L5J A;  3DP7 A;  1YRN B;  3M07 A;  4G6T B;  3V8K A;  2KFD A;  3R4K A;  3H9G A;  3E3V A;  1U8B A;  3E6M A;  1VQP I;  2OAZ A;  4O3M A;  5K5O A;  1DUX C;  2Y9Y A;  3PIO F;  1NG6 A;  4XR6 A;  3VSL A;  5D5W B;  4H0E A;  4QPO A;  4UV8 A;  4A6E A;  2XRL A;  4CXF A;  1ZLJ A;  4XN3 A;  1MMA A;  4EM2 A;  2GXG A;  2NVU B;  2RNJ A;  2ZFU A;  1MBE A;  3TKY A;  1TLH B;  4PCQ A;  4RLQ A;  2QQ8 A;  2X85 A;  3MAJ A;  3HHH A;  3O2P E;  1MND A;  2OD5 A;  4MFD A;  4DBQ A;  3RTR A;  3ML6 A;  2IA0 A;  1U5T C;  1Y56 A;  4RBO A;  3S15 J;  1VZ0 A;  3CDL A;  4F52 A;  4S0H B;  1OCR H;  3TQN A;  3DBR B;  2Y0S A;  4A0Y A;  4ENN A;  2NVT J;  5E8G A;  5B3S H;  3OYK A;  2PI0 A;  4MLO A;  1ENH A;  3FXL A;  1BA5 A;  5AON A;  2LH9 A;  1I39 A;  2QQB A;  4G12 A;  2LYC A;  3GTM J;  1SMY F;  1O4X A;  3M8J A;  1BR1 A;  2I5U A;  2DQL A;  3ZQH A;  1B72 A;  2BHZ A;  2HDD A;  2DTR A;  4LGW A;  3K1P A;  3CUQ A;  2HEO A;  5J4V A;  3SDB A;  2NRA C;  1HC8 A;  2HZT A;  1VQO I;  2NNN A;  1Z77 A;  5IYD J;  1MMS A;  2UUZ A;  2DFF A;  1QZY A;  3K4B A;  4FX4 A;  2QWW A;  3RPU A;  3HGY A;  4P9U A;  2L02 A;  3AKZ A;  2H8W A;  3HXL A;  1Z05 A;  2E35 A;  4I98 B;  1ERD A;  3J7Y J;  4M3D A;  4ESB A;  1HQC A;  1DDN A;  5FKK A;  4L5I A;  4Q47 A;  5AIQ A;  1J7K A;  3B73 A;  4L9J A;  2QZ8 A;  1PUF A;  1YG2 A;  2DMT A;  3A02 A;  1GDT A;  4V2F A;  2V6E A;  1X1C A;  3LA2 A;  3DF8 A;  4A6D A;  2WAE A;  3F72 A;  4O6J A;  3ZGK A;  4F55 A;  5E3O A;  1JUM A;  4BHB A;  1XS9 A;  3IP4 B;  1RR8 C;  4LLL A;  4HV6 A;  1PP8 F;  1TL8 A;  2P0W A;  2DOD A;  3RPU D;  3JRI A;  2ELJ A;  2OQR A;  1NTC A;  2DOE A;  2XGE A;  1KQ8 A;  3BQZ A;  4ZYA A;  1MDM B;  5FFZ A;  1ZRE A;  5DD8 A;  3HYI A;  3U9G A;  3I59 A;  2NNY A;  5CVJ A;  2D2W A;  2L7F P;  4XM3 A;  5D5X B;  1ETY A;  3OR2 C;  5HNH A;  1O3Q A;  5HLT A;  3ZMU A;  2MLK A;  1MBG A;  1R58 A;  1Y1V J;  5DCF A;  4PK4 A;  1VTN C;  3ZP5 A;  2XRO A;  2R7T A;  4X6A J;  1ZRC A;  2FD5 A;  2M4G A;  2L9R A;  2DFH A;  4YFK F;  1WJE A;  4BEH A;  1OCT C;  1GUU A;  2W48 A;  1B72 B;  1HW5 A;  3ZXS A;  3QU3 A;  1IV8 A;  5A2Q Z;  4ZTF A;  3CUQ B;  4LIU A;  1HF0 A;  3G3Z A;  2M34 A;  1D1C A;  2K4B A;  1MZB A;  4I02 A;  2ZB9 A;  1VQM I;  1QVU A;  4AC0 A;  4E7S A;  3JRD A;  3A1Y A;  4CGZ A;  2E60 A;  3W2V A;  4C2U A;  2B7E A;  3HG9 A;  4M9S A;  4RDU A;  3PJR A;  3DEU A;  1HW1 A;  1UST A;  1Z7U A;  1R6R A;  3GYH X;  3VWB A;  2WV1 A;  4NC6 A;  3H36 A;  2MAB A;  3D5S C;  2K4J A;  4LB6 B;  4DNC A;  4ENK A;  4KT6 A;  1LFB A;  1YOV B;  1LB2 A;  1I50 J;  5TGT A;  2DFI A;  2PEX A;  1RKW A;  1LUJ B;  1QGP A;  5IY5 H;  2OA4 A;  3GCM A;  4ABZ A;  2IGK A;  1PUF B;  3JSP A;  5BMZ A;  2WTE A;  4IRH A;  3HTU A;  3WTZ A;  1I27 A;  2CW7 A;  1XGM A;  3K2A A;  4KMU X;  3WTY C;  3HDD A;  3C7J A;  4AIH A;  4HF1 A;  4IVN A;  2Y69 H;  2EQR A;  2ME0 A;  1O3T A;  3BP8 A;  5HS8 A;  1B9N A;  2VUM J;  3AFH A;  2RAE A;  2X48 A;  4L9T A;  1D0X A;  1YS6 A;  1QZZ A;  3LSM A;  3CJT B;  5DYM A;  5LHH A;  1ZGW A;  3I59 B;  1X1B A;  3BQY A;  2GA2 A;  3M8F A;  5CKT A;  4BXF A;  2W4S A;  3WOD F;  5LHI A;  2DA6 A;  3E5X A;  4AID A;  5C44 J;  3ABM H;  5D8L B;  1WHU A;  1N75 A;  2L01 A;  4BQQ A;  1HKQ A;  3P9I A;  2OC6 A;  4J00 A;  3G2B A;  4AYB A;  4XIC A;  3M1C A;  4BEH B;  3O8H A;  4XRM A;  3PUB A;  1Y8Q B;  5H6R A;  3ESW B;  1ONV A;  2RVC A;  2Z5U A;  3Q0U A;  3DKW A;  3O3K A;  1BI3 A;  5IP7 J;  1MW7 A;  3KYD B;  4IL6 C;  1U3E M;  4LG0 A;  3S1R J;  3ZMV A;  4KYW A;  1SAN A;  4OWR B;  4C9Y A;  2K3F A;  4HNV A;  2FBI A;  4CCL A;  2VIX A;  2Z9O A;  1Y0U A;  3K70 D;  2J5P A;  2E1M B;  3GF2 A;  2WY7 Q;  4UV9 A;  1E17 A;  2DPD A;  3CJQ B;  1YYV A;  1Z1D A;  1V5E A;  2ACJ A;  4BY7 J;  4BXX J;  2E19 A;  2DT5 A;  5EZH A;  5DV5 A;  4OIP F;  1W1W E;  5ILU A;  1G3S A;  2MD5 A;  3ABK H;  3QPT A;  1XMK A;  2VBX A;  3BR6 A;  3PO2 J;  1WH5 A;  2UXN A;  4BXU A;  3SZP A;  1OYY A;  1T95 A;  2ESH A;  3OYB A;  1S3J A;  3S3M A;  2F4M B;  2HTS A;  2O03 A;  3IH4 A;  2MD0 A;  1FBQ A;  1B6A A;  2O61 A;  1FMV A;  4XLA A;  1XSX A;  4LLG F;  2PX9 A;  2KKO A;  2XF7 A;  2R7Z J;  3FKJ A;  3F8M A;  2QEN A;  5HS9 A;  3ZMD A;  2UWM A;  3ERM A;  1QA6 A;  3HL2 A;  1DP7 P;  3JW4 A;  2HGC A;  4L0Y B;  2RRE A;  2OV7 A;  1T39 A;  3P7N A;  3GME A;  3QU6 A;  3QPL A;  3K4K A;  1S8N A;  1EKE A;  2KZV A;  1PJR A;  3VYU B;  3J7Z I;  4BE1 A;  2XAS A;  1G3T A;  1HBX G;  2LR8 A;  1JJ6 C;  4A5M A;  2QM3 A;  2VBW A;  2LDU A;  5LGU A;  1MJA A;  2MGQ A;  1HW2 A;  2PN6 A;  2C6Y A;  2MSY A;  2QYO A;  4LG0 B;  1WH7 A;  3HPH A;  3RKX A;  3W2A A;  3CP2 A;  4ETS A;  3SDG A;  4N9I A;  2VKE A;  5LBQ A;  1DU6 A;  2N8G A;  1EH7 A;  3K4J A;  2Z16 A;  4I01 A;  2LKX A;  2KRC A;  2EA2 A;  3DTI A;  1FIP A;  2H09 A;  3U2R A;  3RIR A;  3H0D A;  3OYI A;  4A3K J;  3S2H J;  4WX9 A;  4G7O F;  4KIB A;  1W5S A;  1DPR A;  1X4O A;  5DM6 F;  4G9Y A;  4XOT A;  2EWN A;  3T1B A;  1C0W A;  1I3Q J;  2BXZ A;  2VJ4 A;  2LF8 A;  2O8X A;  1IN8 A;  1ZG1 A;  2RNG A;  3DKX A;  4E7H A;  3TMO A;  2FQ3 A;  3GTJ J;  3HC7 A;  3RJP A;  3MVP A;  2PFB A;  1JE8 A;  4NQW B;  1ZN2 A;  3I0T A;  1EA3 A;  2BGC A;  4EM0 B;  2GIV A;  2R7U A;  1S6L A;  2P7V B;  1RPW A;  3SFZ A;  2ZSH B;  3VOE A;  1BOB A;  5DUI A;  2QQ9 A;  3T0Y A;  4M72 A;  4HLX A;  2CU7 A;  2E34 A;  4JBA A;  2XRN A;  2EV5 A;  1PUE E;  3K4L A;  5BQT A;  3J81 Z;  4QPQ A;  2KIM A;  1GXP A;  1QU3 A;  3RDI A;  4AUX A;  5IOZ A;  4W97 A;  1U9O A;  1JT0 A;  2STW A;  4D7M A;  3FDY A;  3ZMS A;  2YUS A;  3K2Z A;  3DPT A;  1OJL A;  1P6R A;  1G4D A;  5L3B A;  1ZRF A;  4OAY A;  3WTT C;  1N25 A;  1FOK A;  3IWZ A;  1BOA A;  4YFN F;  4HDU A;  3CTA A;  3CMM A;  3HOW J;  2G7H A;  2Y48 A;  3S1N J;  2PQ8 A;  1IRF A;  2CG4 A;  1XX5 A;  2BYV E;  1H89 C;  1SVM A;  1TT5 B;  4KN4 X;  2COB A;  3ZQL A;  1YE9 A;  1VQN I;  1F4K A;  1XMX A;  3LQR A;  1BL0 A;  2EBI A;  4CA0 A;  1YIJ I;  2VBZ A;  2OZ6 A;  3FXO A;  2XIG A;  1MNE A;  2JN6 A;  3LFU A;  1UG2 A;  3GFL A;  1NH3 A;  2LRE A;  4RB3 C;  1T8I A;  2M45 A;  3M9A A;  5HLI A;  1U5T A;  4I09 A;  2VXZ A;  2XB0 X;  1HKS A;  2FXA A;  2JJ7 A;  4DOZ A;  3PUF A;  3J81 K;  1WPK A;  3CMY A;  3OSF A;  1VQ5 I;  4A3G J;  3WTS C;  4E4H A;  1BC8 C;  1I1S A;  1MBH A;  2L3D A;  3BR1 A;  4UUS A;  6PAX A;  3K10 A;  4P9F A;  1F5T A;  2DA5 A;  1IGN A;  1HA8 A;  2O5R A;  1Y0N A;  2R7S A;  2Z33 A;  1JUP A;  2ZNZ A;  1YJN I;  4DW6 A;  4KIS A;  3BZK A;  2V7F A;  4HF2 A;  3DTE A;  3FHN A;  5ED4 A;  1WFX A;  1JJ8 C;  2O9L A;  1YI2 I;  1WJF A;  1ZAO A;  2ZJ2 A;  3FM5 A;  1XGS A;  2W85 A;  3GZ5 A;  4B8X A;  2LF7 A;  4C2M J;  4D7N A;  5E17 F;  3OV8 A;  4C3H J;  3BDD A;  5E1Z B;  5FJ8 J;  1AOY A;  4BJ5 C;  1S7E A;  4XKW A;  1IN4 A;  4BJT A;  5FKO A;  3S17 J;  4DBR A;  3F23 A;  2FQ4 A;  4WXC A;  4ZYG A;  3IC7 A;  2K86 A;  4Y4R A;  3BTI A;  3K70 C;  2X0L A;  3CJS B;  2VN2 A;  2AHQ A;  2NVX J;  2VT2 A;  4B43 A;  3L2R A;  3L2U A;  5FLV A;  4B4C A;  1SFE A;  2NS8 A;  1TQI A;  4CHU A;  2V6C A;  1O3S A;  1TWC J;  2OQG A;  4HAM A;  3E0J B;  2KHM A;  1MH3 A;  2VQL A;  3DEW A;  4I7H A;  5C3E J;  3ABT A;  3ZMT A;  1QBJ A;  1E0E A;  4F91 B;  3MKL A;  1ZEL A;  1JHF A;  1Y8R B;  5CYV A;  2IS4 A;  5H2F C;  3FMR A;  4YII A;  2R93 J;  4XLC A;  3BG7 A;  3BJA A;  2GZW A;  3TO7 A;  3EUA A;  4HDV A;  2M4K A;  1U5T B;  3I3L A;  1QHG A;  4A3J J;  4XRS G;  4RS8 A;  4XON A;  3RCO A;  1FTT A;  1EJ9 A;  4EMS A;  4E7J A;  1QPM A;  2WA0 A;  3K7A J;  2Z2S B;  2HQN A;  5LEK A;  3QPS A;  5KNL A;  1K4S A;  2A61 A;  1SD7 A;  2NVY J;  3F8C A;  4MIM A;  4U0Y A;  2JA2 A;  5M5W J;  1X2M A;  3HUG A;  2CUE A;  3HOX J;  3I5U A;  1T98 A;  2WAQ N;  1W7P A;  2FSW A;  4IQJ A;  1Z3Y A;  2RDP A;  3TO9 A;  2FU4 A;  1GV5 A;  1DP3 A;  2I8D A;  5EEG A;  1IDZ A;  1BI2 A;  2L9V A;  3BPX A;  2XSJ C;  5D8K B;  4ZZD A;  3LA7 A;  2LOO A;  2HYJ A;  1T0F C;  3U21 A;  3J7A O;  1QZE A;  5FKN A;  3FX3 A;  2FRH A;  1LNW A;  4N9H A;  4BAY A;  3PIP F;  1P4A A;  1B9M A;  3LWF A;  5HLG A;  4ZYH A;  4XLE A;  4FE7 A;  2X1D A;  5EEH A;  5IP9 J;  3JR9 A;  2EZL A;  4RM2 A;  1W7P D;  3CCL I;  5HOO A;  3G71 I;  4GYG A;  1LQ1 A;  4UVB A;  1P4W A;  2UV1 A;  4IJA A;  3VDX A;  5KAI C;  3HRT A;  2EA4 A;  1BC7 C;  5DTD A;  3A0B C;  1YRN A;  3PL8 A;  2ZME C;  1V5G A;  3GBG A;  3B6A A;  1HDP A;  1JT6 A;  2MYS A;  3PNV A;  2ZFW A;  1QO0 D;  5J47 A;  1X1P A;  4ENM A;  1Z0X A;  3HRU A;  1EF4 A;  2DO7 A;  1IF1 A;  2XAG A;  3H5A A;  4PSX A;  1FX7 A;  2W00 A;  4JK1 X;  3QAH A;  4Z2Y A;  4UB8 C;  1WJA A;  3BTJ A;  2LMD A;  3EUK L;  2EFP A;  4XNF A;  1MSE C;  3K1N A;  1WIB A;  2KT0 A;  4RA2 A;  4S05 A;  3IV5 A;  2JA8 J;  1KA8 A;  1K79 A;  3HUG B;  2NS0 A;  2E7X A;  1OLT A;  5IT3 A;  2VXD A;  1W7P B;  1J2X A;  1ZGA A;  4ZYD A;  3MQ0 A;  4GCV A;  1XSV A;  2VOD A;  3ZOB A;  3Q5F A;  5BS6 A;  2CV2 A;  1N78 A;  1MSF C;  3TW6 A;  3OY9 A;  3BR5 A;  3S93 A;  3CCY A;  3K0L A;  1Y6I A;  3B6C A;  3OYJ A;  1VFC A;  2DCE A;  2CGP A;  3W6V A;  1U78 A;  2HPI A;  1XMA A;  1YJ9 I;  5J1U A;  3J80 K;  1ZAR A;  2X6O A;  2R5Y A;  1PP7 U;  4BY1 J;  2HOA A;  3HJE A;  5ERI A;  5FRN A;  3S1M J;  3F3X A;  4G6Q A;  3WU1 B;  3ZN1 A;  2Q0O A;  2EIN H;  3FXM A;  1VF9 A;  3G6E I;  2BVL A;  1WJ5 A;  4OMZ A;  3AG3 H;  2WWY A;  3L7W A;  4D5F A;  1MKM A;  2HU9 A;  3ULQ B;  1VQ7 I;  2I10 A;  4KDP A;  4EJU A;  2LNB A;  3HIF A;  3VB2 A;  1ZK8 A;  1R36 A;  2ECC A;  2F6C A;  1WQ2 A;  4I6Z A;  1IXR C;  5F1R A;  5E18 F;  3H5N A;  2WB1 N;  4CSW A;  1IV6 A;  1ETW A;  5E3N A;  1AU7 A;  5D4R A;  2M5W A;  3OIQ A;  2MLG A;  2HYF A;  4XKV A;  2IS6 A;  1R22 A;  1FPQ A;  3MWM A;  2K9S A;  5EYR A;  2ICW G;  2L2O A;  4HQE A;  2DT7 B;  1R5H A;  3E6D A;  1O3R A;  2LVS A;  4XSZ F;  1WGX A;  4J01 A;  4CZZ A;  1I6X A;  4U0W A;  3WHC A;  1MDM A;  5ICC A;  3FK6 A;  4C2T A;  1A36 A;  2YSR A;  5M5X J;  2IT0 A;  1ZR4 A;  2EIL H;  5E20 A;  4UNO A;  3JCU C;  2CSO A;  1SD4 A;  2H1L A;  4IX7 A;  1IN7 A;  3WHB A;  1TNT A;  2V1U A;  1MJ9 A;  2JT1 A;  3FXQ A;  2VJJ A;  2XF5 A;  4WF2 A;  3DXJ F;  3ZQF A;  3FBI B;  5FLX K;  2V1N A;  3IKT A;  1X1A A;  3G1L A;  2OPT A;  2KIF A;  2BXY A;  3CMA I;  2TRT A;  4GGG A;  4GXO A;  1TP4 A;  2BV6 A;  1KU7 A;  1PYV A;  2LY1 A;  4PUS A;  3RKQ A;  2BEO A;  2R5Y B;  4Y17 A;  2L7M P;  3E5U A;  5B5E C;  4LJZ F;  2JPB A;  3E5Q A;  1UHS A;  4RAF A;  3PSI A;  4KNY A;  1K6Y A;  1OKR A;  2M7A A;  4YFX F;  4YRV A;  5JVG F;  2A5W A;  1BI1 A;  1K78 A;  5CQE A;  1RKT A;  1ON2 A;  1V55 H;  2QGU A;  2BHY A;  1RC9 A;  4UUT A;  1ZG5 A;  4ZZL A;  2VC0 A;  1AWC A;  2ZJR F;  5IT9 Z;  1R7J A;  4E7K A;  5EEA A;  4ESJ A;  3ISP A;  3RYP A;  3QOP A;  2ADU A;  2H27 A;  3EYY A;  4IRI A;  2WBM A;  2PMH A;  2P8T A;  3HZJ A;  1G3W A;  5DEQ A;  9ANT A;  1AA7 A;  2AS5 F;  1R1T A;  3DKY A;  4ZJZ A;  3KFW X;  3JRF A;  4CIC A;  2EFQ A;  3BJ6 A;  3CES A;  4HV5 A;  1I5Z A;  4G94 A;  3CME I;  1SFU A;  1SAX A;  1UHM A;  1F9N A;  4LOC A;  2B9S A;  2LD5 A;  3H3V K;  3GTP J;  3W6J B;  5JFR A;  1TC3 C;  4IF4 A;  4M74 A;  1PVE A;  2VAS A;  2EK5 A;  3H1C A;  4HSR A;  1MD0 A;  1F43 A;  3M1E A;  2GA1 A;  4XKC A;  3T8R A;  4BAC A;  3ASO H;  4GYI A;  4GRI A;  1ON1 A;  5D5U B;  3BR2 A;  2BE5 F;  1VQK I;  4OIQ F;  5IT9 K;  2CW0 F;  4MTD A;  3EQL F;  1POG A;  4XLN F;  3WGI A;  1MGT A;  2H94 A;  4RGR A;  2GBY A;  1UAA A;  3A4C A;  3JRH A;  4EJW A;  2QKM B;  4KMF A;  1P7I A;  2X6X A;  3ASN H;  2JK3 A;  2FNA A;  2HWV A;  2Y31 A;  3SEQ A;  5L3G A;  4L18 B;  1X58 A;  3BZ6 A;  4IHW A;  3COA C;  2DW4 A;  2X1C A;  3S1Q J;  2IRF G;  1K78 B;  3HTS B;  5HVQ C;  1V5F A;  2Z3Y A;  4FIS A;  4FCY A;  3PFI A;  5D4S A;  2PBI A;  2XAH A;  2HPM A;  2G7U A;  3OWT A;  4RB2 C;  2LK2 A;  1QVT A;  3SQN A;  1TW3 A;  4RM3 A;  1OQY A;  3TED A;  1QNT A;  1X1D A;  2YPR A;  1ZR2 A;  3L9F A;  1NHA A;  5J3L A;  1FBS A;  1R9T J;  3S14 J;  2V9K A;  5BPD A;  2AXT C;  4UVA A;  5FRO A;  4A3F J;  1DPU A;  3F8B A;  2OTJ I;  4WWC A;  1MBK A;  5A2Q K;  2D1H A;  2VOO A;  4LK1 F;  4X0G A;  3VYT B;  1E2X A;  5TRD A;  5F0C A;  2KPM A;  1RUO A;  2QCO A;  1QQI A;  5K5R A;  1ETQ A;  4A3L J;  3NWT A;  1NK2 P;  2Q2E A;  4M3E A;  3K6G A;  4A3D J;  4YIF A;  1G59 A;  3H35 A;  1OCC H;  1IAW A;  1LKX A;  2Y30 A;  2DA2 A;  2HR3 A;  2WV0 A;  2X51 A;  1WJD A;  4Q48 A;  2M9H A;  3JSO A;  1UJ8 A;  3LSP A;  1YW8 A;  4E7I A;  2RQQ A;  1VQL I;  3ELK A;  3AG4 H;  3K4N A;  1YHQ I;  1DU0 A;  1TWH J;  1JTY A;  3CLO A;  3G1O A;  5EF6 A;  2OZU A;  3RZD J;  2O6G E;  1HST A;  5F1J A;  4AM3 A;  4C3I J;  5EGO A;  1APL C;  2OCC H;  2Y0M A;  3DLA A;  4PZJ A;  4FT8 A;  3H5R A;  4WK8 F;  4AWX B;  4IHT A;  4EGY A;  2L5Q A;  1BIA A;  1Z9C A;  1X3Z B;  2Z99 A;  4BE2 A;  4IOC F;  1JI8 A;  2XKO A;  4XRF A;  2P6S A;  2WAQ A;  2KRF A;  4B47 A;  3GFM A;  4XL9 A;  3OMY A;  3MZ8 A;  2R92 J;  3BJO A;  4EGZ A;  1SC7 A;  4CCK A;  4ASN A;  1LEA A;  2W1O A;  3RI4 A;  1LFP A;  1ZQ3 P;  1G2H A;  3CQZ J;  2B0L A;  3LMM A;  4OAZ A;  3IH2 A;  2HVQ A;  2LRD A;  4XLF A;  2P5V A;  1LJ9 A;  3EGV B;  1RRJ A;  3BG3 A;  5CJ9 A;  4U87 A;  1B8I A;  5GPC A;  3OSG A;  3ZQI A;  3IRR A;  2XVC A;  1AHD P;  4XID A;  2CQN A;  2HKO A;  5LRS A;  5LHG A;  2DMU A;  4LFU A;  2M2E A;  3LOC A;  2LY9 A;  4ZYE A;  1V4R A;  1R71 A;  4OIR F;  2E7W A;  4NQW A;  2MFZ A;  4CCM A;  5KVR A;  4B44 A;  3OYE A;  4LIV A;  4KN7 X;  3CC4 I;  4AVP A;  3BCA A;  2XF6 A;  4LG3 A;  1T0F A;  4KIT B;  2CWE A;  2Q2E B;  2IVM A;  3QYF A;  2KDO A;  1FC3 A;  3OYM A;  2JMW A;  2QKL B;  2L54 A;  4R8H A;  2GLO A;  2FBH A;  4QTR A;  1OCO H;  3GFI A;  1LEB A;  3DLL F;  1FEX A;  3HSF A;  2VBY A;  2JSP A;  4IQ4 A;  2JVH A;  3VEP A;  2NYX A;  4RLF A;  1JHH A;  3LSR A;  3EUH A;  3A0H C;  3BR3 A;  1MIJ A;  4PJ0 C;  1N77 A;  3FBN B;  3GTK J;  5CVV A;  5EGO B;  5F64 A;  3GO5 A;  1XB4 A;  2ZCW A;  3FXR A;  1A6I A;  2LKP A;  3L2Q A;  3M3Y J;  2F5F A;  2ZME A;  5BOX A;  1FY7 A;  2F5C A;  3BRO A;  2E1N A;  4A0X A;  1FP2 A;  3OIP A;  4M3G A;  2EFO A;  2A3S A;  2CO5 A;  2CQK A;  2WY8 Q;  2X1E A;  3WG7 H;  4X1E A;  1FSH A;  3WTV C;  4JX4 A;  3KEY A;  1UG0 A;  5K7Z A;  3VYR B;  3H9Q A;  2W7N A;  2IW5 A;  2KMU A;  3N97 A;  1O57 A;  4I99 C;  1OFC X;  4OIN F;  1OCZ H;  4EQQ A;  2R7V A;  4EM1 A;  1B8I B;  1BN5 A;  2RGV A;  4Z6Y A;  1NG7 A;  1OR7 C;  5KHD A;  2BY0 A;  3FHZ A;  4NUB A;  1JGS A;  2XV4 S;  3R61 A;  4DJA A;  1W5T A;  2ESN A;  5LGT A;  1DGR M;  3QP6 A;  3ZQ7 A;  1MMN A;  1KU9 A;  2B63 J;  1HSJ A;  5EJC A;  4BQA A;  3GXO A;  3DPU A;  3FZV A;  4DZJ A;  5D5V B;  3W6K B;  2CV0 A;  3CLQ A;  1FP1 D;  4RGS A;  4M6V A;  1FYL A;  4XK4 A;  2IS2 A;  5M3F J;  1B59 A;  4BBS J;  4I0B A;  4PDK A;  2CUF A;  4QWQ A;  2A68 F;  1YJW I;  1GLN A;  2DYS H;  3F0C A;  4HBL A;  3ZCO A;  2WB1 A;  2Y75 A;  2EZH A;  2CRG A;  1T6S A;  3ZQC A;  2CQQ A;  4BH9 A;  2HZD A;  1H0M A;  1A04 A;  2V9P A;  3SXY A;  1SVO A;  4M6Y A;  3F9K A;  1YO5 C;  2XGX A;  2P81 A;  4R79 A;  3DFG A;  5F04 A;  4BNC A;  4HOB A;  5GAH J;  2NOJ B;  2L7K A;  2LC2 A;  3JTH A;  4MHG A;  5GAE J;  3VPR A;  1TQM A;  2ZME B;  1W0U A;  2ELK A;  2MC3 A;  2XUB A;  2YU3 A;  3PQJ A;  5KCM A;  4AD9 A;  3DEE A;  3N4M A;  1BM9 A;  1O7F A;  1REP C;  1S7A A;  1FT9 A;  1P4X A;  5JLW A;  1K4T A;  3MD2 A;  1W5C C;  2QSF X;  5TIS C;  4XMY A;  4DGW B;  4M71 A;  3OYF A;  1Q1H A;  2W82 A;  2CH0 A;  4U0V A;  3IH3 A;  3HOV J;  4A69 C;  1FBU A;  1UHW A;  4M9X A;  4XKB A;  1MBJ A;  4G7H F;  3GW2 A;  2DMP A;  3PFY A;  4PSW A;  3LSG A;  3CCM I;  4IPA A;  4XOR A;  3DU5 A;  3RYR A;  4LMY A;  2DFE A;  1H9T A;  5FB2 A;  2IBD A;  2DTZ A;  3ZRG A;  3L1P A;  2F4I A;  3OS0 A;  4GFB A;  4HEA 2;  3D0S A;  5HDG A;  3CJN A;  4CH7 A;  2VOP A;  2DYR H;  3FXU A;  1XGO A;  4HX7 A;  4RGU A;  2FOK A;  1K61 A;  3ABL H;  4BL0 B;  3WU0 A;  2E5Z A;  3GTL J;  2PMU A;  1EH6 A;  2DOA A;  4L0Z B;  1TWA J;  4O5V A;  2ISY A;  4XN0 A;  1WVR A;  3KP2 A;  1LVK A;  3QWL A;  3TP3 A;  2DA4 A;  3U1K A;  3AG2 H;  5L3F A;  2KDZ A;  4IOA F;  4S04 A;  2KIQ A;  4WXH A;  3WGG A;  2ZC2 A;  1G8X A;  3QQA A;  4HX4 A;  2XB5 A;  1JUS A;  4RAZ A;  1O7L A;  4BQO A;  2ZJP F;  3HOZ J;  3KP4 A;  5FD5 A;  2O7O A;  3KLN A;  2ISZ A;  4H4K C;  5KAF C;  1D1A A;  3WG9 A;  5B66 C;  1H9G A;  1X3W B;  4NC7 A;  1WJB A;  4BQN A;  1JKO C;  3GUD A;  3HHG A;  3M4O J;  1K7A A;  1G6N A;  5CPR B;  3BTC A;  4D9J A;  4Y7N J;  2A6T A;  2A6H F;  1KYW A;  3TDU C;  3EDP A;  3OS1 A;  5E1X A;  2IAI A;  3MFK A;  4NBQ A;  2E1C A;  2JRM A;  4HNU A;  3EYI A;  1R4M B;  3DV8 A;  1Z6R A;  3P5J A;  2P4W A;  4KA4 A;  1SFO J;  4Q4Z F;  4U7B A;  2K9L A;  3IWF A;  2R7F A;  5D6F A;  3JRG A;  3JRA A;  2JQ7 A;  3FKI J;  1R49 A;  4PJN A;  1U6G A;  2DDA A;  3LSK A;  1LE8 B;  1JKR C;  2M0C A;  2VQC A;  4IRG A;  2Y2Z A;  3KZZ A;  1T33 A;  1YX5 A;  1F1Z A;  3HM5 A;  2IA1 A;  3WTX C;  1KZH A;  3J7A Y;  3C2B A;  1VQ8 I;  2DA1 A;  4A93 J;  5IYC J;  5LD2 C;  4EEF G;  3MEX A;  3L2W A;  2CUJ A;  1SAU A;  1GV2 A;  5J6X A;  1IRX A;  3AL0 B;  3BTL A;  2DA3 A;  1TQP A;  3CCS I;  4E6K G;  1IJW C;  4MEX F;  2DBB A;  1GVJ A;  4XLH A;  3CJR B;  3KZY A;  2A5Y B;  2HNH A;  3S2W A;  2KJB A;  3CCV I;  3ZR8 X;  5F0H A;  2CFX A;  2QF7 A;  5JHF A;  3S2D J;  4CUG A;  2DLL A;  2RV8 A;  2GXA A;  2R7D A;  5J1R A;  5F27 A;  2ZXW H;  5F6F A;  4ZC3 A;  1BJA A;  2IGN A;  3DU6 A;  2V1D A;  2KL4 A;  1YX3 A;  5IYB J;  3EUH C;  5H20 A;  1MJB A;  3TOA A;  5AIP A;  2MBF A;  1K6O A;  3CF2 A;  4QLC U;  4F92 B;  2XGD A;  3FK7 A;  2W57 A;  2DK5 A;  5EZG A;  3HOY J;  2STT A;  1YW9 A;  4LIT A;  3RSN A;  3ZMZ A;  4OIO F;  3KYC B;  5CQG A;  3X2Q H;  2VPR A;  3R0J A;  1S9H A;  2YX7 A;  5GAD J;  1P7J A;  2DJN A;  3NEU A;  4JX6 A;  2E2H J;  3RQI A;  4YEL A;  4Y52 J;  3C2H A;  1YIT I;  1Y39 A;  2H1K A;  1ETO A;  4Q5S F;  3FF5 A;  1UZC A;  1S29 A;  2CS3 A;  2JA7 J;  4II3 A;  4MEY F;  2EFW A;  2CW8 A;  3L2C A;  3CCU I;  1R1U A;  3BC8 A;  2L4M A;  1XDU A;  3F22 A;  3GFJ A;  1HOM A;  3Q3S A;  1BW5 A;  2FMY A;  2BY2 A;  2VJ5 A;  1B4A A;  2V1X A;  2IS1 A;  2P7C B;  2BW3 A;  3K9T A;  4HW0 A;  2XSD C;  3BZC A;  4N0B A;  1UB9 A;  2VJI A;  4HPQ A;  1RES A;  4YIR X;  4DYR A;  2NAZ A;  4BUP A;  1WI9 A;  3WTU C;  1TNS A;  4DIQ A;  3DCF A;  1MBF A;  2HVR A;  1VQ6 I;  1XN7 A;  1FIA A;  3DWL E;  2O8K A;  4IHV A;  2Q1Z B;  1ORK A;  3GWZ A;  3CZ6 A;  1WKM A;  3CCR I;  3BCB A;  2EV6 A;  4HX8 A;  4NDL A;  3JTG A;  1I6H J;  2GM4 A;  1FNN A;  1EV7 A;  1RNL A;  2TCT A;  3TP0 A;  3TO6 A;  1HKT A;  1E3H A;  3MN2 A;  3CDI A;  4B09 A;  1XGN A;  3NAU A;  4G8X A;  2ECB A;  2DPU A;  1SD6 A;  1RET A;  5BNG A;  3GTO J;  3Q9V A;  3KZI C;  1OYI A;  5GPA A;  3PNY A;  1YTY A;  2IGO A;  2VKV A;  3MCZ A;  5DD4 A;  4A2U A;  2FUG 2;  2E2I J;  1J5Y A;  2K02 A;  5IPA A;  4MGR A;  1ULY A;  4TV7 A;  1D5V A;  2EIM H;  1ETV A;  4I76 A;  5J40 A;  2H8R A;  5K7F A;  5E1W A;  3I54 A;  1S5L C;  1Z91 A;  4KFC A;  1Z7L A;  2OF7 A;  2VI6 A;  4YEJ A;  2FNP A;  5B1A H;  1HXD A;  2JA5 J;  5IOY A;  4M6X A;  4C30 A;  2DA7 A;  1U0J A;  2D1V A;  2K9Q A;  2KIU A;  5F08 A;  3R60 A;  2V9V A;  4AU7 A;  2PMZ N;  4M3F A;  4MQV A;  3P9K A;  4KUM A;  3IKV A;  3LST A;  3RQ4 A;  2FF4 A;  4BGD A;  2M3A A;  2VPL A;  1RZ4 A;  4RMN A;  1IXS B;  4A3M J;  3L09 A;  1A31 A;  5HNF A;  1XCV A;  3OS2 A;  3CCE I;  4IO9 F;  3GLL A;  2BW3 B;  1BR4 A;  1ZYR F;  3SYT A;  2NOG A;  1E3O C;  2F2E A;  5K7H A;  2LFB A;  3MKW B;  3UNG C;  2F5D A;  1OMI A;  2AQE A;  3ECH A;  4FX0 A;  2O0Y A;  4UB6 C;  1YLF A;  1YW7 A;  3DQV C;  1TTY A;  3BOQ A;  3FWE A;  4YG2 F;  1A35 A;  1IN6 A;  3LL7 A;  3OYL A;  2HXI A;  2F5E A;  1ZHF A;  4Y13 A;  3BY6 A;  2CQ7 A;  3MMY B;  3BPV A;  2OUM A;  5CVI A;  3AL0 C;  2E1O A;  4ZH4 F;  1CF7 A;  2JRT A;  2ZBK A;  4L5E A;  1QRY A;  1PDN C;  3H0G J;  4JX5 A;  4M9Z A;  1OR7 A;  3ECO A;  2LSO A;  3TGN A;  4GO1 A;  1ODD A;  1ZTR A;  4PFP A;  1WZ2 A;  3FXK A;  3OL4 A;  4J19 A;  1S7O A;  2HVS A;  2VLA A;  4LB5 A;  2P6T A;  5GTI C;  1XTA A;  3UR3 C;  3HSR A;  4QIW N;  2IXS A;  2R3S A;  2J5O A;  3E1S A;  2OBP A;  2RKH A;  4UXN A;  4XLP F;  3V42 A;  1VQ4 I;  1VQ9 I;  5BPI A;  1RIO H;  1KYZ A;  1ETX A;  1SEU A;  3KP6 A;  4HST A;  1I3A A;  1CQT A;  1DQU A;  5LLQ A;  3W3C A;  3EPZ A;  3CC7 I;  2W24 A;  5DUK A;  1J09 A;  1G3Y A;  5E3L A;  2LKS A;  4KIC A;  2F48 A;  3KE2 A;  1IO2 A;  3REO A;  3QPH A;  1FOW A;  4ENJ A;  3LSI A;  3HRS A;  1WSU A;  2HDW A;  3P9C A;  2YS9 A;  1I1G A;  2ZSI B;  4M3B A;  4KT5 C;  1QHH D;  1ACI A;  3IRQ A;  4I2O A;  2CMP A;  4P55 A;  3PO3 J;  5ICF A;  3LA3 A;  3V8L A;  4D1Q A;  3VYS B;  2UZK A;  2XGC A;  3GTQ J;  1T08 B;  3JRC A;  2KRH A;  1T56 A;  2ID6 A;  4BS9 A;  3R6S A;  5HDK A;  2HS5 A;  3LSJ A;  5JLX A;  3QOD A;  1JKP C;  3MKY B;  1CF7 B;  4KJZ A;  2MC4 A;  2L7Z A;  2ETH A;  4BJ6 C;  2IP2 A;  3OOP A;  2ME6 A;  2L0K A;  4XOP A;  2Y9Z A;  3H3Z A;  2P5K A;  3S32 A;  1W4M A;  4FHT A;  2GAU A;  3G1M A;  4JP0 A;  4OU0 A;  2OCE A;  4E7Z A;  2KZG A;  4D0P A;  4ZDO A;  4CDG A;  1U9N A;  1DGW Y;  4ANJ A;  3BG5 A;  2DQR A;  4B1R A;  3GZN B;  5EDN A;  2BOL A;  3S3O A;  3ROU A;  3T5X A;  4IEJ A;  3CD6 I;  2R7O A;  1XC5 A;  2E5N A;  2R7W A;  2EZI A;  2M8G X;  3B02 A;  3FM3 A;  3HKZ N;  2XAJ A;  3V7R A;  4DYQ A;  1LDJ A;  1XD7 A;  3O6B B;  2IEK A;  1LFU P;  3IUO A;  5ILV A;  2V4J C;  2NVQ J;  4BHP A;  5ICG A;  2RC4 A;  5LGN A;  3O8G A;  2A69 F;  1GT0 C;  2DK8 A;  5M5Y J;  4HRI A;  2EPF A;  1SD5 A;  1TWG J;  5DCM A;  2DJI A;  1JGG A;  1D1B A;  5TJJ A;  1YQA A;  3Q9S A;  1Z3X A;  3FIS A;  3GVA A;  4LD5 A;  1FZP B;  1R4N B;  1B1B A;  5LRR A;  5ILS A;  5J4Y A;  3Q0W A;  2ZJQ F;  4QSH A;  2M30 A;  1H8A C;  3HEF A;  4PJM A;  5DS9 A;  2EIJ H;  2H6B A;  2ELH A;  5JR3 A;  4A12 A;  1ZG3 A;  4Y15 A;  3WE3 A;  3HOT A;  4C3J J;  1XPX A;  3GX4 X;  3M7G A;  1BBY A;  3I4M J;  2RN7 A;  3WTW C;  2FX0 A;  3I55 I;  4IHS A;  1KQ0 A;  3D5R C;  5CVU A;  2R4G A;  2QUF A;  1WJC A;  1FMW A;  2JPC A;  3S16 J;  3VOD A;  4UUV A;  5FFX A;  2V79 A;  4MTE A;  1W36 D;  2GXB A;  3LFK A;  4XRS A;  4RAY A;  4ZDL A;  2YR2 A;  3QYE A;  2WC2 A;  2K9M A;  4E7L A;  3HBL A;  3AG1 H;  1TT0 A;  3QOE A;  4FET A;  2VL8 A;  1Z21 A;  2VE8 A;  5DDG A;  4CCO A;  2H6C A;  1D0Z A;  1V54 H;  1SFK A;  1OYW A;  3A03 A;  3FMQ A;  4A0Z A;  2HOE A;  5FLM J;  3RKY A;  2HTJ A;  5J8C A;  2FA5 A;  3MZY A;  3PNT A;  2QA4 I;  2Q8K A;  1ZH5 A;  5L3E A;  1WI3 A;  1SFX A;  5HS7 A;  1FWZ A;  1WRJ A;  5DCM B;  3DTK A;  2FEZ A;  3SZT A;  4MFE A;  4GDF A;  2W25 A;  5JI6 A;  1QPI A;  2WAD A;  3QRF F;  1T38 A;  4PGG A;  1KU3 A;  1BJZ A;  2OTL I;  2XAQ A;  1IC8 A;  2K7L A;  2M8E A;  1F36 A;  3A01 A;  1WCM J;  1LDK B;  1IRG A;  3C1D A;  2M87 A;  2JWT A;  4IHY A;  2DXI A;  1UEL B;  3KEO A;  3PM1 A;  4N4N B;  5HDN A;  1RI7 A;  3CC2 I;  2E36 A;  3IHU A;  2IA2 A;  3SHF A;  1IRZ A;  5FRM A;  1JKQ C;  2CQX A;  2JZY A;  2A07 F;  2HOS A;  2XKP A;  3RKW A;  3KP7 A;  4MQ9 F;  5K1Y A;  4M73 A;  1LDD A;  1Y1W J;  3I71 A;  4V2G A;  2EV0 A;  1JTX A;  2HYG D;  4P96 A;  3TOB A;  3ZN0 A;  2QQA A;  2AXL A;  5FKM A;  1A5J A;  2NS7 A;  3G4S I;  3JRB A;  2X6Y A;  5J1Y A;  1FSE A;  1BI0 A;  3OYN A;  1R5G A;  1NK3 P;  4U88 A;  3KP3 A;  2FOW A;  1KQ9 A;  2FBK A;  1D8K A;  5JHU A;  2A05 A;  3BWG A;  3CCJ I;  2VQG A;  4DZP A;  3NQO A;  2KLO A;  2L9N A;  3LSH A;  4BYY A;  5CLS A;  4AIJ A;  1M1E B;  3SJM A;  2R5Z A;  3ZQQ A;  1D5Y A;  4NNJ A;  2M0M A;  1USS A;  4NB5 A;  1RUN A;  2LY2 A;  3BLY A;  3F8F A;  3LAP A;  3D1N I;  3PSF A;  3HOU J;  2LTP A;  3F21 A;  3C18 A;  1YIO A;  3GEZ A;  2DDB A;  3CUQ C;  3OOU A;  2DN0 A;  2E2J J;  4CYD A;  4G7Z F;  4PGH A;  1R1V A;  4ZDP A;  3CO6 C;  1UMQ A;  3C3W A;  3V4G A;  4I0A A;  4A3I J;  4G6D A;  5CVR A;  4FAS D;  2ZXI A;  1STZ A;  2Y0S N;  4HQM A;  4ON0 A;  4AVZ A;  2K9N A;  1R5I D;  1P2F A;  2QSH X;  3F8N A;  1LVA A;  1U2W A;  2CFO A;  1WWX A;  1YFH A;  3TDZ C;  2DAO A;  4A5N A;  1IN5 A;  3UKG A;  2EZK A;  4UY8 I;  1K83 J;  2K85 A;  3H9J A;  1X2N A;  3VSK A;  3I64 A;  2QSG X;  2HQA A;  3A01 B;  1IDY A;  4B48 A;  2ZKZ A;  3LQQ A;  3KET A;  2ZO4 A;  1TWF J;  3RZO J;  3TBI A;  3IAS 2;  1ETK A;  2HQR A;  3CUO A;  2L9S A;  2YU9 J;  2DOF A;  4XQF A;  3G73 A;  3TL4 X;  4W1U A;  2R7X A;  2PG4 A;  2PMZ A;  4KIG A;  3CO7 C;  1FOX A;  2G9W A;  2BBY A;  5C4X J;  2D45 A;  1V3F A;  3KYL A;  1FLI A;  4LK0 F;  2JTV A;  4XBF A;  3KP5 A;  4OOI A;  2EFN A;  5E8I A;  3CCQ I;  4BU2 A;  5HOD A;  3I4N J;  1J9I A;  2XDV A;  1OPC A;  1IUF A;  2P5L C;  3IL2 A;  2QVO A;  4ZTJ A;  1Z67 A;  3OIO A;  1BW6 A;  1S72 I;  1UFM A;  1TZL A;  4HF0 A;  1L3L A;  1MH4 A;  2OJE D;  4CO8 A;  1TW2 A;  3K1M A; 
#chains in the Genus database with same CATH homology
 2ZJR F;  4V19 K;  2E34 A;  5GAD J;  3CF5 F;  3CJQ B;  1VQL I;  3CC2 I;  2E36 A;  1FOY A;  1YHQ I;  1YIT I;  1Y39 A;  5GAG J;  3CD6 I;  2K3F A;  4IOA F;  2ZJP F;  1VQP I;  1YJ9 I;  3CCU I;  3PIO F;  3CME I;  3G4S I;  4IOC F;  1VQM I;  2FOW A;  3G6E I;  3CCJ I;  1YJW I;  3I56 I;  1QA6 A;  1VQ7 I;  1VQN I;  2ZJQ F;  1VQ6 I;  1VQ4 I;  1YIJ I;  1VQ9 I;  2JQ7 A;  3EGV B;  2QEX I;  1VQK I;  3CCR I;  3J7Z I;  3CC7 I;  5GAH J;  5GAE J;  1VQ5 I;  3PIP F;  3I55 I;  1HC8 A;  1FOW A;  1VQ8 I;  2NXN B;  3CC4 I;  1VQO I;  1MMS A;  3CJT B;  4UY8 I;  1ACI A;  1YJN I;  3CCL I;  2H8W A;  3G71 I;  2E35 A;  3CCS I;  3J7Y J;  1YI2 I;  3DLL F;  3CJR B;  5DM7 F;  3CCV I;  5DM6 F;  1FOX A;  3CMA I;  3CCM I;  2OTJ I;  3CCQ I;  2QA4 I;  1S72 I;  3CJS B;  5JVG F;  3CCE I;  4IO9 F;  1WIB A;  2OTL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...