5DM7F

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
144
structure length
144
Chain Sequence
MRRVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 13
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5dm7F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5dm7F01
4IOCF 3J7YJ 2OTJI 1ACIA 2ZJRF 3PIPF 1VQKI 1FOYA 3CMEI 4UY8I 1FOXA 3CJTB 1S72I 1VQMI 3PIOF 5GAEJ 4IOAF 2E35A 5GAHJ 1VQ4I 1VQ8I 3CMAI 3CCUI 1VQNI 3CJQB 3CCVI 1VQOI 1VQ6I 1Y39A 3G71I 2QA4I 1QA6A 2H8WA 2E34A 1VQLI 5GADJ 1MMSA 1YHQI 3EGVB 3I55I 1YI2I 3CCEI 2QEXI 3CCMI 1VQ5I 1YJ9I 3G4SI 3CCLI 1YJWI 5DM6F 3CC7I 2FOWA 3DLLF 2E36A 2ZJPF 1WIBA 5DM7F 3CJSB 3CCQI 1YJNI 1YITI 3J7ZI 1VQ9I 3CD6I 2JQ7A 1HC8A 5GAGJ 1YIJI 1FOWA 3CCRI 3CC4I 2NXNB 3CCSI 3CCJI 4IO9F 3CC2I 3G6EI 3I56I 1VQ7I 3CF5F 5JVGF 1VQPI 2K3FA 2OTLI 4V19K 3CJRB 2ZJQF
chains in the Genus database with same CATH superfamily
3M7GA 4RGRA 3AG1H 5LHGA 2E1MC 2DMPA 5HS8A 4F91B 1J75A 3SEZA 4BQOA 1WQ2A 3CMEI 1D8KA 2FRHA 1S7OA 3M3YJ 2CWEA 2ETHA 4NBQA 2DT6A 2LKPA 3QOPA 3S93A 4AVZA 4ENJA 2A05A 2LKXA 3L00A 4LD5A 4G8XA 3JCUC 1BW5A 2OQGA 3QYFA 1HOMA 1X1CA 1MBJA 1Y1WJ 3L2UA 4PJ0C 3M8JA 3GF2A 3JAMK 2V9VA 3BWGA 3CMAI 2N8GA 1XG1A 3KEYA 2ZBKA 3U1DA 3KX2A 1S8NA 2R7VA 3TP0A 1TT5B 3ASNH 3U21A 3TP3A 3H9GA 1YFHA 5CVVA 3N97A 2A3SA 2VODA 3HOYJ 5A2QK 2HPMA 1CF7A 3JTGA 2OPTA 1ZKGA 3OYGA 3HB9A 2E2IJ 2DK8A 1T95A 1U78A 3IHUA 2BV6A 4IRIA 1P9QC 5B3SH 1JKPC 2EINH 1ZG3A 4LITA 4A3LJ 3FXUA 5J1UA 2O3FA 2HYJA 3BROA 2MW8A 2VKHA 3FKIJ 3F3XA 1TWCJ 2TDXA 3BCBA 3IL2A 4Y15A 4KIFA 1OFCX 1ZARA 5KAIC 1FSEA 2DA5A 3Q0UA 4DJAA 4L5EA 2E1CA 2NYXA 2IP2A 1T56A 4ENKA 3G1LA 1HW2A 1DPRA 1XS9A 4FE4A 2IEKA 4N9IA 2WA0A 2VQCA 4KNYA 1WIBA 2RN7A 3WG7H 3CJSB 1UG0A 4BNCA 4LIUA 4A3JJ 2JMWA 4AU7A 1QPIA 1TQMA 3E6CC 2GIZA 1FP2A 3IP4B 3K4MA 2XDVA 2TRTA 2LDUA 3EUHA 3L09A 4GCVA 4HX7A 5F6FA 3QYEA 5J4VA 3OYEA 4RB3C 1HA8A 2IA0A 3OIOA 1V5EA 3BR2A 1EF4A 4EM1A 3IRQA 1I50J 2V9KA 5B1BH 1ONVA 3BR0A 4PFPA 1R1UA 1A5JA 3S2HJ 2IVMA 1RI7A 3P5JA 4GXOA 4M6YA 3KEQA 2VKEA 3ESWB 3K4LA 3V42A 3H1CA 2XPWA 4Z2YA 3ROUA 4AWXB 4ZTJA 2ESNA 4CO8A 2CV2A 4UXNA 1TW3A 1T98A 5E3MA 2LC2A 5B1AH 5JHUA 2CQKA 3Q0VA 2QQBA 4M74A 1FBUA 3GCMA 4I02A 2R5YB 4KYWA 2WAFA 5TJJA 2WAEA 5L3DA 2D5VA 4MHGA 1FWZA 2DXIA 2HXOA 4OAYA 2DLLA 4QPQA 2P0WA 3BTJA 2B7EA 2X1EA 1IW7F 1X1DA 4C3IJ 3R60A 4OIQF 2K5CA 1VQNI 3MAJA 4DQ2A 3S2DJ 4AC0A 1P4WA 1IN6A 5IPAA 4CSWA 2VJJA 3REOA 2GZWA 1I1GA 3RSNA 4AM3A 1QA6A 3FHNA 1BJZA 1SMTA 1G3WA 6PAXA 1O3TA 4XN3A 3H3ZA 5J40A 5LRSA 1N25A 2XSJC 1HW1A 4HX4A 1OCOH 5D6FA 1R4NB 4E7IA 2W1OA 3G1OA 3BTLA 4A3BJ 1UFMA 2L9RA 3HM5A 2NAZA 3I54A 4YRVA 4CYCB 1T2KA 2V6EA 1RR8C 2I8DA 4II3A 1ETQA 2KPMA 5LEJA 4P9UA 2ESHA 3P9IA 3GTMJ 3TW6A 4AIHA 4LFUA 3E97A 2QWWA 4PSXA 3OYCA 3LOCA 2M1BA 3FDYA 5BNGA 2DODA 2ID6A 4UUTA 4AVPA 3JAMZ 3HOZJ 3G4SI 2F4MB 4A5MA 2V1NA 4A3IJ 1TBXA 2A6EF 2VUMJ 2DJNA 1F9NA 1WKMA 2E36A 4WF2A 2L4MA 3LSTA 3G73A 1P92A 3C1DA 3N05A 5CVUA 3TBIA 3KZYA 1MDMA 1MJBA 1D5YA 1R1VA 1R7JA 2KKOA 4II2A 4ZDPA 2XPVA 1KU9A 1TTYA 3EQLF 2GM4A 2EFNA 4J01A 3PO2J 4CCMA 2MGQA 3LSJA 1W5CC 1GT0C 3BZKA 5DEQA 4EJOA 2A61A 2VE8A 4PSWA 1WVRA 5EF6A 4XRSA 1BR1A 3H5AA 1FTTA 1K4TA 5DYMA 5FKKA 3A01B 3O8GA 3TOAA 3DF8A 1B4AA 1OPCA 3AFHA 1E3OC 3DEWA 3E6MA 2YPRA 3DEEA 1BIAA 3G6EI 3LSGA 1WJ5A 1H88C 4ZYDA 3R61A 4HQMA 1D0ZA 3SJMA 3E5QA 1TW2A 3ABLH 5KVRA 1ZREA 2RGVA 2IBDA 4HX8A 3LSMA 1RUNA 2JA8J 1B9NA 4IOCF 4BE1A 5C4XJ 3K7AJ 1Z67A 2Z99A 3BPXA 4PDKA 4ON0A 4RMNA 4U7BA 1NG7A 1MW7A 4XKBA 5J3LA 4CDGA 1OKRA 3I71A 4IVNA 2V6CA 4MFDA 1N77A 3EUHC 1R1TA 1BBYA 5K7FA 4F55A 1FYKA 1V54H 2C6YA 3WODF 4Y33A 2DFFA 3C2HA 2P4WA 5CPRB 4I76A 2XROA 4BDZA 2K9QA 5IP6A 1WH5A 2L7KA 2QQ8A 3A2KA 1FT9A 4J19A 3QAHA 2VBYA 1U6GA 2XB5A 1R9TJ 2Y0MA 2BZTA 1P7JA 2JTVA 1SMYF 1OQYA 2QUFA 2YS9A 5FGMA 1SD5A 1MH3A 3MKWB 1KONA 5HLHA 2LSOA 3I55I 1RKWA 1UHMA 3F22A 3W3CA 4DYRA 1IDZA 2KP6A 1NK3P 1FC3A 1BOBA 3HOWJ 5DD4A 1H9GA 2NNNA 4NB5A 5FLMJ 2H8RA 1SAXA 3L1PA 4KJZA 3BDDA 4MTEA 1XCBA 2QKMB 4WXHA 4YIFA 3H36A 3OSFA 4UV9A 2X1DA 1BI0A 1KU2A 4RAZA 2A6HF 3DKYA 2VKDA 3PSIA 4IL6C 4FT8A 3S2WA 1GXQA 1ON1A 3R0JA 5LFAA 3LAJA 4CUGA 2R5ZA 1U9OA 4ESBA 4BQAA 9ANTA 3BR1A 4ESFA 2OJED 1R4MB 3C2BA 2M8GX 1JT6A 1XB4A 1ERDA 1KYWA 2CGPA 2MABA 2EV6A 2L4AA 3NRVA 1JTYA 1FP1D 3LQRA 2M4GA 3R0AA 4XBFA 2P5LC 2M2EA 2KRHA 3FXLA 4R8HA 3M1EA 2L2OA 3CUOA 3FXRA 4ASNA 4CCNA 5BMZA 2NOGA 2PLYA 2GIVA 2CJJA 1NG6A 1PJRA 2GOMA 1LQ1A 3FXOA 1XC5A 4I99C 3E6DA 2IW5A 4FHTA 3ZMTA 1FNNA 5LEKA 5HLTA 4RS8A 1J0RA 3W2VA 4C3HJ 2UZKA 2ZO4A 2GA2A 2EQRA 4A5NA 2KIQA 1TLHB 2X0LA 4LJZF 1FMVA 1R6RA 2HU9A 4KIGA 4ZC3A 1FOKA 3QP6A 3JTHA 2A69F 2QLZA 5DDGA 3TDZC 2R7ZJ 1SANA 5CQEA 2K7LA 4PZJA 3RKXA 4CYDA 5BPDA 4QPOA 4LB6B 4M3EA 3L2CA 3IH2A 4EJWA 4DZPA 5CKTA 1G4DA 3V8LA 1RPWA 5TGTA 2W00A 1FZPB 1JKRC 2IJLA 3AG2H 4B8XA 5B66C 1RKTA 4BYYA 3MFKA 2FD5A 3BOQA 3K0LA 3FBIB 3S32A 3QQAA 4FQGA 1EKEA 2CYYA 3HRSA 1MBHA 4CZZA 3H3UA 4CYCA 1TQIA 1X2NA 3I4PA 3BPVA 3E5XA 4P55A 4MTDA 3GTJJ 1U5TB 1QBJA 1G2HA 4CGZA 2Q0OA 1ZQ3P 2EFPA 3E1SA 5EGOA 1R23A 4IHXA 3BC8A 2OQRA 3EGVB 1WRJA 4OIPF 2QENA 4HEA2 1KU3A 5E20A 1I27A 3P9KA 1D8JA 5F64A 1B9MA 4M72A 3PL8A 5D5UB 4PGGA 2BVLA 3BG5A 3BR5A 3FK6A 4IXAA 3OYFA 1ETVA 2EZKA 3GZ5A 3VYSB 3TO7A 2QCOA 3DWLE 2X1CA 3FMQA 2O9LA 2EIMH 2FOWA 3HL2A 3RKYA 1OYYA 1LUJB 4BACA 2ZFWA 3O3KA 1Y8RB 2XPUA 2W25A 3VYUB 1K61A 5IOZA 2Y0SN 1OR7A 1YQAA 2LRDA 4AD9A 2KISA 1A04A 2PMUA 3M9AA 1UELB 2R7OA 5F0FA 3WE3A 3BCAA 2NVUB 3PFIA 3O8HA 5JR3A 3IWZA 2JQ7A 5K7HA 4E7ZA 3CMYA 1I3QJ 2ELHA 4GYIA 2EZIA 2DOAA 3OYBA 2FJ1A 2IPQX 1TC3C 1HCRA 2CQ7A 3WTYC 2EBIA 2E5ZA 2JN6A 2HPIA 2VJIA 4ITVA 1ZRDA 4KA4A 2CMPA 2MC4A 1SVLA 2LREA 3ABUA 3VPRA 4B3AA 3OYDA 3ZQLA 3A4CA 2DA3A 3CCJI 2OCCH 3A02A 2DFHA 3BQZA 5E79C 3FXQA 3KYCB 2EZLA 1U0JA 2EA2A 4PFOA 3EUAA 5E3NA 4BXXJ 3HTSB 1Y0UA 3PNVA 3AKZA 3ZXSA 2WADA 1F4KA 3GTGJ 3FHZA 1IG7A 1ZRFA 1ENHA 2LNBA 3GW2A 4P1WA 3KP2A 3CTAA 1K6YA 3KLNA 5JI6A 5L3EA 3NQOA 3OYLA 4C2TA 3GO5A 1X19A 3LNQA 2WY7Q 4UV8A 4E6KG 3JR9A 1JE8A 4EJVA 1JUMA 3F21A 2E1NA 1BI2A 4EJTA 2ID3A 1MMDA 3DTKA 1FMWA 4BS9A 3ZQFA 5DUIA 2GBYA 1VQOI 1YRNB 1C0WA 4IZZA 4EMSA 2ZXJA 3F8MA 2WWYA 3HJEA 3OOUA 2P6SA 2XF6A 3HOVJ 3D5RC 1XGNA 3HUGA 2ZJ2A 1D1AA 1JKQC 2DA7A 5HOOA 5DCFA 4IPAA 4E70A 2FBHA 2PX9A 5EZGA 4JX5A 2CQQA 4I2OA 5JHFA 5IYBJ 2ZXHA 4LLGF 3NEUA 4BBRJ 2X4HA 1R36A 5K5RA 5M5XJ 3CLOA 2CV1A 1I3AA 2P7VB 3D1NI 1MMGA 4LLNA 1MGTA 4Y7NJ 1UHWA 4IX7A 4ZZDA 5H2FC 2DMQA 3JRBA 3KP7A 5DM6F 2AHQA 2IGKA 4GDFA 3ZP5A 2L7MP 5ILUA 2L5QA 2DN0A 3KETA 2EIJH 5M5WJ 1JHHA 1B72A 3IWFA 1GV2A 3MKYB 3ECOA 3ZGKA 4YEJA 2O8XA 1AU7A 2CW7A 1R5GA 4D1QA 2FA5A 5CVJA 4HNVA 2KJBA 1IV8A 4HW0A 3V8KA 3OY9A 1T0FA 2F5CA 1V3FA 3K9TA 4BEHA 2J5PA 4DNCA 1EA3A 1BI3A 1ZHFA 5HDGA 4A3FJ 2YUSA 3CP2A 4QIWN 3BTIA 4HDUA 2YSRA 2VBWA 3U1KA 2VN2A 2DCEA 3KP4A 4EM2A 2DOEA 4B1RA 2LYCA 4X0GA 5K7ZA 1TWHJ 5FLXK 4OWRB 3QU6A 2FNAA 3NAUA 2VI6A 3K70C 3CJRB 4BGDA 2EV0A 2NRAC 5IT9Z 3K1MA 5IT3A 4A3KJ 2BY3A 4A0YA 1A6IA 1GLNA 2FXAA 4QTRA 1Y6IA 2R7XA 2O6GE 4BHCA 3MZ8A 1ZG5A 4LMYA 3MD2A 2RNJA 3H3VK 3IAS2 4A3EJ 1OCRH 2CH0A 3AG4H 3S15J 2W24A 3CJTB 4DOZA 4U0YA 4HPQA 2LK2A 3E3VA 2F4OB 2BHZA 4HF1A 2VLAA 5GAEJ 3OR1C 4FETA 1YW9A 2H09A 4LG0A 2DA1A 2ISZA 3RTRA 3FM3A 5LBQA 2MD0A 3E7LA 4DBRA 4LB5A 4BU2A 4D7MA 1W1WE 3ZOBA 1AKHB 3GXOA 2UV1A 3FISA 4C2UA 2HZDA 1S7AA 3Q9SA 4XM3A 2Z16A 1X58A 4AIKA 3JRIA 3I4NJ 3RIRA 5A2QZ 3P7NA 1S29A 4Q48A 3DU5A 2IS2A 3GTLJ 4RLQA 1SFKA 4IRHA 2V26A 4CXFA 3HGGA 4OINF 4P96A 2UUZA 2JSCA 3FIWA 4IQ4A 4FASD 1B8IB 4O5VA 4LIVA 4YIRX 1UCRA 3EDPA 1PDNC 2FSWA 1IZ1A 2BY0A 2ZNZA 1JHFA 3S17J 3TGNA 2LP0A 1YE9A 3LWFA 5CVIA 2QKLB 2EFWA 1RIOH 5HS7A 1GHCA 5DTDA 1HKQA 1UAAA 4QWQA 5FKLA 1IXCA 4O3MA 4XSZF 3IAM2 1TP4A 2P5VA 3I59A 1YJNI 1Z77A 5GPCA 2DDBA 1IC8A 4ABZA 4BE0A 4RDUA 1K6OA 2KQRA 1DGRM 3KFWX 1O7FA 3FX3A 4UVBA 4A0ZA 1WJAA 3I4MJ 2R3SA 3E0JB 5ICFA 4CCLA 2NS0A 3V7RA 2X6OA 4XLAA 5H6RA 1X2MA 4IO9F 5L3CA 2K85A 3HRUA 4M71A 3TMOA 3I56I 1YO5C 1F43A 1VQ7I 2G0EA 4M3FA 3R6SA 5GTIC 5JVGF 1Y56A 4H4KC 4B44A 5FLVA 4BL0B 2H6BA 1HDPA 2DFEA 2OUMA 2ZKZA 3HIFA 3LA7A 5D8KB 3IV5A 3CLQA 2VJ5A 2BEOA 2X48A 4E7JA 2FQ3A 1MD0A 2HYFA 4BHPA 3LSRA 2JA2A 3ERMA 2XUBA 4EJUA 3PQKA 1NH3A 2QGUA 2VBZA 1Z7UA 3FXMA 3KYDB 1WH7A 3EPZA 3L9FA 4ESJA 3N4MA 1ORKA 2NS8A 3F8BA 3JRHA 2W85A 4UNOA 2ZFUA 1X4PA 3CQZJ 2A5YB 3KIOA 3PQJA 1V5FA 1X4OA 2OZ6A 1O7LA 1S9HA 5F0CA 3G71I 4LOCA 2E1OA 3ELKA 3FMRA 3L2RA 2OCEA 3VOEA 1BJAA 4M73A 1V4RA 1BR2A 1XTAA 5TRDA 1WWXA 4RB2C 3B6CA 1XDUA 2CUEA 2KMUA 4RGUA 4XRMA 3GZNB 3E6BA 4MEXF 4BEHB 2EZHA 1FPQA 4HBLA 2IGOA 2QVOA 3E5UA 3H9QA 3J80Z 1Z3YA 4RM3A 3VEPA 3CCYA 3KP6A 1KA8A 1KQ9A 1MH4A 2XKOA 4BUPA 4C30A 3BG3A 1HLVA 3DU6A 3LSPA 2QBYB 2LY2A 2IA1A 2ZC2A 3K4KA 3J80K 2L54A 1K79A 3VSKA 3JRGA 2VXDA 3NARA 5FKNA 3F72A 3MWMA 2IS6A 1SFEA 1IO2A 5HDKA 5EGOB 5KNLA 2HQ5A 1UG2A 3RQ4A 2HDCA 3CO7C 1YITI 3CD6I 2EK5A 4XMYA 2V4JC 2RKHA 3ZMZA 1PP7U 4KT5C 3RPUA 1F1ZA 2L02A 1QPMA 4M9ZA 4RBOA 4DZJA 3L2WA 1UHSA 4HOBA 2UXXA 3HOSA 1WFXA 3QOEA 3GX4X 1MMNA 2R7UA 1J2XA 2Z1DA 1SAUA 1I6HJ 1YW7A 1R58A 1H8AC 2K9MA 1FBQA 3TL4X 2XGXA 2W7NA 1GXPA 4V19K 1BW6A 4YFKF 2LG4A 3W2WA 3I59B 2K4JA 5GPAA 3UNGC 3ZQHA 1HSJA 3ZMDA 3BG9A 2V1XA 5CYVA 2ZMEC 2FE3A 2IS4A 2JUCA 3SFIA 2DYSH 3OIQA 1DGWY 3PNTA 1TWAJ 1SVOA 2PMZA 2X85A 5K5QA 4WK8F 2GXGA 4YFNF 3HSFA 1MZBA 1J7KA 3MEXA 4RAGA 2K9NA 5J8FA 2E35A 2HQNA 3QPSA 4L18B 4PJJA 2L9NA 2XF5A 3GTKJ 3CJQB 1USSA 2WBMA 1QVTA 3GMEA 4B4CA 1S5LC 4FE7A 2F5DA 2ZXWH 3ECHA 4G7HF 2PFBA 2QM3A 3FXJA 1O3RA 2FEZA 2E34A 5FKOA 5JFRA 1I5ZA 4IKFA 1B1BA 4NDLA 1G3YA 2GXBA 5J1YA 1IXSB 5BOXA 2R4GA 4IJAA 1RUOA 1ZR4A 4H0EA 3VWBA 2BVMA 3W6VA 2PN6A 1GUUA 4V2FA 1FEXA 2D1HA 1I1SA 3F6VA 4UVCA 2K4BA 1OLTA 1TNSA 1D0XA 1U2WA 2OAZA 3FM5A 1ULYA 2K9LA 4G9YA 4IHTA 3SZPA 2LH9A 2NS7A 5E3LA 2IXSA 2V1UA 3CCLI 2MC3A 3KPHA 5FD6A 2IA2A 1IJWC 3HKZA 2F4IA 3I3LA 1D1BA 3B02A 1YX3A 1YJWI 1YYVA 2W82A 4M3BA 3ZRGA 3KZIC 3DLLF 3AL0B 2ZXIA 2BYVE 2XAFA 1YOVB 1IN4A 2IGMA 1QHHD 2V1DA 1MBGA 5CJ9A 4A6DA 2H1LA 4B48A 2D45A 5FRMA 2JA6J 2ME6A 2B63J 1VQ9I 1WGXA 2RC4A 3FF5A 2M34A 2R5YA 2PEXA 5D5VB 2HOTA 2HR3A 3KEOA 3H0DA 2FMLA 1G6NA 2P81A 2DMUA 4JOMA 3B73A 1A31A 1HKSA 5FRNA 1OCZH 1POGA 3I58A 2FQ4A 2FF4A 4N0BA 1XGOA 2QSFX 2ZSIB 2Y2ZA 3CUQA 2OTLI 2HTSA 1FIAA 1OR7C 2LR8A 1S6LA 4EQQA 1MBFA 1J5YA 3TDUC 1T8IA 4PCQA 2P8TA 2AO9A 4E7LA 2NVQJ 2HZTA 1O57A 4L9NA 2HVSA 3OWTA 2MFZA 5L3BA 3FXKA 4A69C 2GAUA 5DD8A 2DJIA 4CCKA 3GFMA 1B59A 5M5YJ 3U9GA 4OMZA 4RAYA 1Q1HA 3QPTA 3IKVA 3CCUI 3OYIA 4QSHA 1ETWA 3HRTA 2IS1A 2ZNYA 1ITYA 3LAPA 2ECCA 4JQFA 3F8FA 4IHWA 2YR2A 2COMA 4RAFA 2BBYA 3A1YA 3WG9A 3M8EA 1BC7C 4HSTA 3FK7A 1LE8B 1VQLI 1P6RA 5FB2A 2HQAA 1LVKA 2Q8KA 2EIKH 4RLFA 2FUG2 4PUSA 3HUGB 5TISC 2E19A 5CQGA 3FWEA 5KCMA 3GFIA 1ZELA 3DBHB 3GWZA 1L3LA 1K83J 5EYRA 3R4KA 3RJPA 2JK3A 3GUDA 2JPCA 4QLCU 2JRMA 1WCMJ 4U88A 4R79A 4ANJA 3H0GJ 2EPFA 3S14J 3RZOJ 4DYCA 1HF0A 2E2JJ 2DMNA 1HDDC 5HNFA 2A68F 2X9DA 2XHKA 2VIXA 4K2EA 2M30A 3H5RA 2XC7A 2ZMEB 3NWTA 1W36D 5E8GA 2M3AA 3K69A 1MBKA 5IP9J 2Y9ZA 2DAOA 1SD4A 5F1JA 4A3CJ 1LEAA 4UUSB 2M87A 3OSGA 3LSKA 2AXLA 2Y30A 3HC7A 4LG0B 1CQTA 2NVXJ 4L5IA 5HDNA 5BS6A 4Y3OA 4LGWA 2HXIA 1YIJI 2AXTC 2DFIA 4ETSA 5JLXA 4G6DA 4BQNA 4BY1J 4PGHA 2R92J 4OMYA 5FFZA 1KU7A 1XGSA 4A3MJ 1SD7A 1Z9CA 4XK4A 1BOAA 3TO6A 2CRGA 3WGHA 3BZCA 2ADUA 3HSRA 2VT2A 2JVHA 1LFPA 3CF5F 3HRMA 3PJRA 4UHTA 1MMAA 1OCCH 2EB7A 1ZLKA 4F52A 3HOTA 2PG4A 4GO1A 1WJDA 3CDLA 3D5SC 3I9V2 4I0AA 4I09A 1LE8A 2OTJI 1LB2A 4EV0A 1W5TA 2IGNA 3IKTA 2BY2A 1FOYA 4F92B 2H1KA 5LGUA 2BHYA 3WTUC 1OYWA 1WHUA 3UR3C 1YTYA 3ZQCA 1HKTA 2D2WA 1FIPA 1FOXA 4XR6A 3ONQA 3ZN0A 1ETOA 2M8EA 1VQMI 4CH7A 4I01A 3OL3A 5DCMA 3DBRB 1Q1VA 5K1YA 4ENMA 4ZYGA 4MIMA 3EUKL 3OYAA 2LKSA 3BZ6A 4XL9A 1R5HA 3I5UA 3V4GA 2L7FP 2MH9A 4I7HA 1P2FA 2FX0A 2HYGD 4L5JA 4XN0A 4AUXA 4KN7X 4BXUA 2A07F 4L0YB 3F8NA 3I64A 1QO0D 2Q1ZB 2DU9A 3J81K 2HEOA 3BP8A 4WXDA 4ZYHA 2WY8Q 5JVTA 3CCEI 2KJCA 3AG3H 2CUZA 3I53A 1H89C 3J7AY 1JTXA 2VC1A 5LRRA 3RCOA 1NTCA 2VQHA 2M5WA 2OBPA 3CCMI 2KZGA 1ZRCA 3RPQA 1EV7A 3K1NA 4BBSJ 5LD2C 4ENNA 5DS9A 4KMFA 1YW8A 4M9SA 1ZLJA 4IRGA 1XD7A 4D7NA 1E2XA 2UWMA 1FTZA 4EATA 3CDIA 3G1MA 3ZR8X 2ZJPF 4EVIA 4PJMA 4N9HA 4GRIA 2AQFA 1KQ8A 3RKWA 1LPQA 4XORA 1BIBA 4EM0B 3S1NJ 2EILH 3U2RA 1FBSA 2OD5A 3DKWA 3P9CA 2ZB9A 4FISA 3ML6A 4G7ZF 3JSOA 2RQPA 2VONA 3RKQA 1QZYA 2F6CA 4XOTA 4D9JA 2JA7J 1S3JA 2HKOA 4KN4X 4MLOA 4W1UA 3S3OA 2J5OA 1IGNA 1KYZA 1BA5A 4A6EA 4ZDOA 4BHBA 5HLIA 2CFXA 1Z1DA 5EEHA 4XLPF 1X1AA 1LDKB 4AYBA 4KDPA 2BXZA 1I6XA 5KAFC 4MEYF 3CC2I 1JXSA 4DW6A 1VZ0A 5ILVA 3RI4A 3GLLA 3OMYA 3MN2A 4HSRA 2V79A 4Y52J 2MSYA 4WXCA 3QU3A 4HV6A 3SYTA 1VQPI 4BKXA 2E60A 3HPGA 3TO9A 5IOYA 2HDDA 1X1PA 3QP5A 1ZYRF 2WTEA 3EYYA 1LEBA 2P6TA 2O0YA 2BW3B 4D5CA 3WTXC 1W0UA 1K78A 4XQFA 4AIJA 1P4AA 4Q47A 2Z9OA 2BGCA 2ICWG 1VF9A 1R5ID 2AQEA 4FX4A 2Z3YA 3TW7A 1J9IA 1XX5A 1HXDA 1P7IA 4ZDLA 3TKYA 5CLSA 4CICA 2R0QC 1D1CA 3HZJA 5DV5A 5B5EC 4L9TA 3T0YA 5FFXA 3OYHA 3GYHX 3CCVI 4A12A 2H6CA 2VPLA 1T08B 3WU2C 5EEGA 3O6BB 2OA4A 3C2GA 1MDMB 1ZTRA 2XASA 3S1QJ 2JPBA 1U8BA 1D0YA 2TCTA 2F5VA 1DUXC 5E17F 4RGXA 4NC7A 4CA0A 1PYVA 1QU3A 2NOJB 3MVPA 4KMUX 1T6SA 1WPKA 2F5EA 1LDDA 5K5OA 3DQVC 2WAQA 2QEXI 3CUQC 2KZVA 2L9VA 3MMYB 4A0XA 2QSHX 3ZPLA 4F7ZA 4PK4A 3BJOA 1WZ2A 2XKPA 2MA3A 2XRLA 1ZGWA 2LVSA 1VQ5I 1D5VA 4B3XA 1I39A 4UUSA 3MKZA 4KT6A 5IP7J 3L2QA 3ZMUA 4BDYA 1B6AA 1EJ9A 1BR4A 4W97A 1G3SA 2GOXB 1U8RA 1XPXA 2O8KA 2DDAA 2HOAA 5LGNA 1Z7LA 2LBFB 5F08A 3IC7A 5LHHA 1W7PB 4MNUA 4JBAA 4M3GA 3LSIA 3K4JA 4KITB 3S3NA 3GTQJ 5GP9A 1YS6A 3KE2A 4FCYA 2LLKA 3MZYA 1G59A 4C2MJ 2WV0A 1AKHA 4FX0A 2DQRA 3T8TA 1LDJA 4Y17A 2ACJA 1FOWA 3ZMVA 4MQ9F 3IH4A 1XMXA 2M9HA 1IV6A 2JSPA 3A0HC 1MNEA 2JZYA 4HRIA 3CZ6A 3ZQIA 4MO7A 3V7CA 5F1RA 3HDDA 4HLXA 4HQEA 3T1BA 4CCOA 2L01A 2FNPA 3QODA 4OOIA 5F27A 2XGDA 4RGSA 5E1XA 3JREA 2H27A 2YX4A 4CHUA 2XAGA 1EH6A 2XAJA 3C18A 3BJ6A 3K4CA 4NQWA 1N75A 3PIPF 2RNGA 3BG6A 1STZA 3DTEA 5H20A 2YU9J 3GTPJ 2KL4A 4M9XA 4HA8A 2IT0A 1WI3A 1JUPA 1MJ9A 2M7AA 3PUFA 4M6XA 2A5WA 5D6EA 3WHCA 3QRFF 1TWGJ 2IRFG 4UY8I 3ZN1A 1IN7A 5EG0B 2HI3A 3HYIA 1U3EM 1K78B 1YS7A 1ODDA 3ABKH 5FJ8J 2PMZN 5HVQC 1SFUA 3GTOJ 3PIOF 1S7EA 4F3QA 3SHFA 5J1RA 4Q5SF 1VQ8I 2GWRA 3HSEA 1W7PA 2YU3A 2G9WA 3BT9A 1MJAA 4XONA 2CSOA 3BTCA 1V5GA 3S3MA 1Y0NA 2LD5A 2VOOA 2XGCA 3GFLA 1H0MA 1JUSA 3HTUA 2EA4A 3LMMA 1ETKA 3CJNA 2VQGA 3C3WA 5M3FJ 1APLC 2DPUA 4X6AJ 1J09A 2PMHA 1VFCA 4I0BA 4JK1X 4AIDA 4Z6YA 1ZG1A 1FX7A 2VJ4A 2I10A 1B8IA 1CF7B 1FYLA 4DIQA 4XOPA 1X3WB 4S04A 2PBIA 3C7JA 1WJFA 2K86A 1KZHA 3BG7A 4Y13A 2W4SA 3VYRB 1DPUA 3IRRA 4O6JA 2RV8A 1OYIA 4EEFG 2VQLA 2DOFA 3BR6A 3FZVA 3H92A 3OR2C 1BC8C 4UVAA 3L2VA 3ABTA 5M3MJ 3S8PA 2HFHA 2LF8A 3CP8A 4YFXF 4YIIA 1X3UA 2EFQA 1W36C 1N78A 1ZGAA 1J59A 3OS1A 3F0CA 2R93J 3K70D 4MGRA 1JJ8C 4KIBA 3DEUA 3M4OJ 5AONA 1PUEE 1MBEA 4F93B 2HWVA 3EYIA 2CW8A 3PSFA 3HBLA 2YX7A 1M1EB 4OIOF 2DMTA 2FBIA 2MH2A 1R00A 1IAWA 2FU4A 2MLGA 4N4OB 1XCVA 2FBKA 4B09A 3DFGA 2KRCA 3LA2A 1JGGA 2VASA 2HKXA 3SDGA 1KGSA 4WX9A 1LNWA 3TOBA 2HS5A 4XKWA 4P5OA 4ZYEA 5D4RA 1LFBA 2BXYA 2CW0F 2DO7A 3ERED 5FKMA 4S05A 3Q3SA 2K3FA 3A03A 1B72B 2VPRA 1BN5A 4I98B 2XSDC 3KCCA 3CUQB 2M4KA 1UMQA 1CGPA 2F2EA 1ACIA 4XLEA 1WJBA 1YX5A 2STWA 3S1RJ 1DDNA 3X2QH 5EJCA 3F23A 3G3ZA 2ZSHB 1ZK8A 4OIRF 3Q9VA 4HAMA 2QSGX 2WC2A 2DYRH 2K27A 1AOYA 2E7XA 1T38A 3OYKA 2LMDA 2O5RA 4NC8A 2DPDA 1R22A 4IOAF 1XGMA 4U7DA 2RREA 3PFYA 2JVGA 4E7SA 1XSXA 4BE2A 1HSTA 5EG0A 2ME0A 4B43A 1FSHA 3RPUD 3PNYA 3BJAA 1T33A 2QA4I 2H8WA 3A0BC 1UZCA 1E0EA 5LLQA 1RZ4A 2B0LA 1W4MA 2JWTA 1YRNA 3GZ6A 3WGGA 5IYCJ 2Z33A 3S16J 2I5UA 2HOEA 3H5NA 4L0ZB 4FTHA 1V55H 3ASOH 4DBQA 1G8XA 2M45A 4XIDA 1OCPA 2OC6A 5LGTA 2H94A 4I6ZA 5HS9A 4YG2F 3GEZA 2KIUA 3LFUA 4UB8C 1VI0A 2XB0X 4C3JJ 3CMMA 2ISYA 5FD5A 1PVEA 3W6JB 3SDBA 5D8LB 2DA2A 2GLOA 1AWCA 1O4XA 2ZCWA 1XMKA 4XNFA 2Y0SA 1XSVA 2MBFA 3H9JA 2E7WA 3HEFA 1MNMC 5DM7F 1UB9A 4BJ6C 3H35A 2EJRA 3LQQA 3CCQI 2DA4A 2Y69H 2JA5J 4A3GJ 5KHDA 5L3GA 4X1EA 1D3YA 3PM1A 3WU0A 1O3QA 2WB1N 1RNLA 4PJLA 4U0WA 2R5ZB 2R7TA 1ETYA 3V8JA 3SQNA 4D0PA 2BY1A 4KUMA 1DP7P 3GBGA 4G6TB 3QYBA 2VC0A 2DA6A 3ULQB 2HGCA 3QPHA 1TWFJ 4P9FA 3HGYA 3CCRI 3CC4I 2FMYA 2VL8A 3RYRA 1QZZA 1AHDP 1JGSA 3MKLA 1RETA 4OU0A 1U5TC 2EWNA 2OF7A 2Y75A 3CCSI 1MSEC 1XMAA 1NHAA 1PUFA 4AYBN 2VOPA 3EETA 3J7AO 3K2AA 3K10A 1GVJA 4LK1F 1SFOJ 4IHSA 1SC7A 1QGPA 4LG3A 3OIPA 1OCTC 3SZGA 2CS3A 4JX4A 1GV5A 1GVDA 3I0TA 4G94A 5ERIA 5FLXZ 3SFZA 1Z6TA 3VFZA 4HNUA 2XRNA 3JRDA 1IN8A 2Z2SB 5D5WB 1MKMA 1PP8F 5E1WA 3TEDA 5IT9K 2JJ7A 4GYGA 1FY7A 1JT0A 2DTRA 1S72I 1VNDA 2A6TA 2KLOA 3T8RA 2GA1A 1A6QA 2B9SA 2K40A 3MZHA 2CUFA 4A3DJ 2X51A 1X1BA 1XN7A 2EFOA 5C44J 1ZH5A 1DU6A 2Y31A 5ED4A 5HNHA 4ZYAA 3JSPA 3KP3A 2XAHA 3KYLA 3RQIA 2OU2A 3OV8A 5J4YA 1WI9A 2BW3A 1QRYA 1TT0A 2ZMEA 1RRJA 2XAQA 3F9KA 4B47A 1FJLA 5GADJ 1GDTA 5IYDJ 3LFKA 2HOSA 3RDIA 2NNYA 2V7FA 1IUFA 4IEJA 5E3OA 1E17A 5EZHA 1TL8A 2O03A 1YI2I 2R7FA 5D5XB 4IQJA 3MQ0A 4E4HA 3S1MJ 4M3DA 4XSXF 4MFEA 2OV7A 4NC6A 4WCGA 4HF2A 1BI1A 1QHGA 4WWCA 2COBA 2ECBA 3JW4A 4G7OF 3D0SA 4HYEA 1QNTA 1IN5A 2K02A 4CCJA 1R71A 1BM9A 1DU0A 1XDSA 3Q5FA 3FBNB 1LJ9A 2KIMA 4CZCA 1E3HA 3KLOA 4XRFA 2BOLA 4YELA 3CC7I 2HDWA 4KFCA 5L3FA 3OYMA 4RB1A 2E5NA 1EH7A 2FOKA 1R49A 1WJEA 2CG4A 2E71A 2ELKA 3CDHA 3RYPA 3V7SA 5FO5A 3LA3A 2Y9YA 3OS0A 2XGEA 4XKVA 4GFBA 2CU7A 3KP5A 2MLKA 2Q2EA 2K3PA 5E1ZB 4XRSG 1O3SA 2STTA 2XVCA 2DW4A 1A36A 4UUVA 4A2UA 3RZDJ 3M07A 1TNTA 3F8CA 4DGWB 2M0CA 3ABMH 2W84A 3DKXA 4HZFA 4C9YA 3AAFA 1DP3A 4HDVA 2L0KA 2QQ9A 2F5FA 3JRFA 3G2BA 1DQUA 4BJTA 4GGGA 1IXRC 3DXJF 1T39A 4PJNA 3DV8A 3WGIA 4BXFA 3HOUJ 2PJRB 3CESA 3BQYA 2VT3A 1H9TA 3DTIA 1Y1VJ 2LF7A 1JKOC 1Y8QB 3JRCA 5JLWA 2CV0A 3OYJA 3AL0C 3UKGA 4NHJA 5ICCA 4JYKA 2CUJA 1Z91A 2R7QA 5E18F 1U9NA 1OISA 4XLFA 3FMSA 2EH3A 2L3DA 1T0FC 2RQQA 2Z5UA 2CO5A 2XIGA 3SXYA 4EGYA 2L9SA 2KHMA 4OAZA 5J8CA 1VQ4I 1QZEA 4HF0A 3O2PE 5KK1A 1P4XA 1TZLA 3WTVC 1W7PD 1E3PA 2VXZA 1U5TA 3WTSC 1YIOA 4DYQA 5J6XA 2LOOA 2MD5A 2KDOA 4U87A 2M0MA 4MQVA 2K9SA 4E7HA 3DPUA 5HODA 4EGZA 4IHYA 3OOPA 1YLFA 4XICA 1YG2A 4G12A 2PI0A 2W57A 3JRAA 1YHQI 1SD6A 3WTTC 1WJCA 3ZCOA 1LFUP 2R7WA 2IAIA 4R1HA 3MCZA 2VE9A 4U0VA 2QQAA 1IRZA 3DPTA 2E1MB 2WAQN 2WV1A 3SEQA 1USTA 4A93J 5E8IA 4KICA 5C3EJ 3K2ZA 2UXNA 2CFOA 1ZAOA 1SFXA 4M6VA 3K6GA 2R7SA 3DP7A 1KQ0A 3IH3A 4BQQA 2PJPA 1HBXG 3BY6A 2CQNA 2ELJA 2QYOA 2DT5A 2V9PA 5D4SA 1VTNC 1W0TA 1MSFC 4LLLA 1K7AA 2DI3A 1ZGJA 2O7OA 1Z21A 3M1CA 4XLNF 1LKXA 1IRXA 1NK2P 2KDZA 5CVRA 2L7ZA 1G3TA 4RM2A 3HG9A 3FKJA 1RESA 3DBLB 3DCFA 1IRGA 3J7ZI 2DBBA 4XLHA 3SZTA 3CO6C 1PUFB 3ZMSA 3PUBA 2G7UA 4JX6A 5GTHC 3IUOA 4L9JA 2E2HJ 2KIFA 2X6WA 4TV7A 2DQLA 4Y4RA 1ON2A 2G7HA 1BL0A 2NXNB 3ZQGA 5DCMB 3D5LA 2XV4S 1A35A 1LVAA 3VODA 2KT0A 2JRTA 1Z05A 3GFJA 2LBFA 2LY9A 3WU1B 3Q0WA 1JJ6C 3W2AA 2KRFA 1F36A 3GLXA 5ICGA 2LTPA 2VB6A 3M8FA 4L9VA 3DPLC 2D1VA 2PQ8A 2ZJQF 3WE2A 2VBXA 5C4JJ 4ZTFA 3J7YJ 5HLGA 2HQRA 2ZJRF 4IHVA 1VQKI 2O61A 3WHBA 5EEAA 2XF7A 1K4SA 2HNHA 4NQWB 4ZH4F 5J47A 5AIQA 3TQNA 1IDYA 4RB0A 1ETXA 2JT1A 4D5FA 2AS5F 4XKCA 3DLAA 1FYMA 5ICEA 1W5SA 1OJLA 4V2GA 4HNTA 1UJ8A 3WTWC 5GAHJ 3VYTB 4JP0A 4HV5A 2PJRA 3T5XA 3HKZN 1SVMA 2P5KA 1VQ6I 2BE5F 1Y39A 3K4NA 1RC9A 5IY5H 5F0HA 2RAEA 3HPHA 1MIJA 2QZ8A 4IF4A 3LL7A 3GVAA 2W48A 4HLYA 1TQPA 2QBYA 3COAC 4ZZLA 1MMSA 2HVRA 1X3ZB 4XLCA 4HG2A 2XAUA 4S0HB 5BQTA 1IF1A 4BY7J 3HHHA 2CQXA 2Q2EB 2RVCA 4NNJA 3CF2A 1EH8A 1HQCA 3VDXA 1ZR2A 2DT7B 3NWSA 3K1PA 4RA2A 5EDNA 2X6YA 5ILSA 2NVYJ 1SEUA 5DUKA 4BJ5C 2MYSA 3A01A 4E7KA 1WSUA 5H6QA 1YJ9I 2R7DA 1IUYA 3ZQQA 3OYNA 2JUGA 3KZZA 2OZUA 2RDPA 3PO3J 3BR3A 3W6KB 3HHGA 4ZJZA 1F5TA 1L0OC 5AIPA 3HXLA 3QPLA 3LSHA 1Z3XA 2HTJA 2F48A 2VKVA 4BH9A 1JI8A 3WTZA 2R7RA 5BPIA 2DTZA 3L7WA 4KISA 2M7BA 2EV5A 4Q4ZF 5F04A 2P7CB 3OL4A 4G6QA 1FLIA 3J81Z 2NVTJ 4J00A 2WB1A 2QF7A 1HC8A 4BAYA 5GAGJ 4NUBA 5LHIA 2LY1A 2HVQA 2GXAA 3BLYA 1RR7A 3B6AA 1XSDA 3VSLA 1QQIA 4N4NB 3VB2A 1MNDA 2DK5A 1Z6RA 1Z0XA 3F6OA 3HOXJ 3ISPA 2KFDA 4LK0F 1OMIA 5FROA 1IRFA 2X6XA 3QWLA 3ZQ7A 3OS2A 1AA7A 1ZN2A 2GQQA 1REPC 2Y48A 1QVUA 2LFBA 3K4BA 2MG4A 1HW5A 4UB6C
chains in the Genus database with same CATH topology
4IOCF 3J7YJ 2OTJI 1ACIA 2ZJRF 3PIPF 1VQKI 1FOYA 3CMEI 4UY8I 1FOXA 3CJTB 1S72I 1VQMI 3PIOF 5GAEJ 4IOAF 2E35A 5GAHJ 1VQ4I 1VQ8I 3CMAI 3CCUI 1VQNI 3CJQB 3CCVI 1VQOI 1VQ6I 1Y39A 3G71I 2QA4I 1QA6A 2H8WA 2E34A 1VQLI 5GADJ 1MMSA 1YHQI 3EGVB 3I55I 1YI2I 3CCEI 2QEXI 3CCMI 1VQ5I 1YJ9I 3G4SI 3CCLI 1YJWI 5DM6F 3CC7I 2FOWA 3DLLF 2E36A 2ZJPF 1WIBA 5DM7F 3CJSB 3CCQI 1YJNI 1YITI 3J7ZI 1VQ9I 3CD6I 2JQ7A 1HC8A 5GAGJ 1YIJI 1FOWA 3CCRI 3CC4I 2NXNB 3CCSI 3CCJI 4IO9F 3CC2I 3G6EI 3I56I 1VQ7I 3CF5F 5JVGF 1VQPI 2K3FA 2OTLI 4V19K 3CJRB 2ZJQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC F;  3J7Y J;  2OTJ I;  1ACI A;  2ZJR F;  3PIP F;  1VQK I;  1FOY A;  3CME I;  4UY8 I;  1FOX A;  3CJT B;  1S72 I;  1VQM I;  3PIO F;  5GAE J;  4IOA F;  2E35 A;  5GAH J;  1VQ4 I;  1VQ8 I;  3CMA I;  3CCU I;  1VQN I;  3CJQ B;  3CCV I;  1VQO I;  1VQ6 I;  1Y39 A;  3G71 I;  2QA4 I;  1QA6 A;  2H8W A;  2E34 A;  1VQL I;  5GAD J;  1MMS A;  1YHQ I;  3EGV B;  3I55 I;  1YI2 I;  3CCE I;  2QEX I;  3CCM I;  1VQ5 I;  1YJ9 I;  3G4S I;  3CCL I;  1YJW I;  5DM6 F;  3CC7 I;  2FOW A;  3DLL F;  2E36 A;  2ZJP F;  1WIB A;  5DM7 F;  3CJS B;  3CCQ I;  1YJN I;  1YIT I;  3J7Z I;  1VQ9 I;  3CD6 I;  2JQ7 A;  1HC8 A;  5GAG J;  1YIJ I;  1FOW A;  3CCR I;  3CC4 I;  2NXN B;  3CCS I;  3CCJ I;  4IO9 F;  3CC2 I;  3G6E I;  3I56 I;  1VQ7 I;  3CF5 F;  5JVG F;  1VQP I;  2K3F A;  2OTL I;  4V19 K;  3CJR B;  2ZJQ F; 
#chains in the Genus database with same CATH topology
 3M7G A;  4RGR A;  3AG1 H;  5LHG A;  2E1M C;  2DMP A;  5HS8 A;  4F91 B;  1J75 A;  3SEZ A;  4BQO A;  1WQ2 A;  3CME I;  1D8K A;  2FRH A;  1S7O A;  3M3Y J;  2CWE A;  2ETH A;  4NBQ A;  2DT6 A;  2LKP A;  3QOP A;  3S93 A;  4AVZ A;  4ENJ A;  2A05 A;  2LKX A;  3L00 A;  4LD5 A;  4G8X A;  3JCU C;  1BW5 A;  2OQG A;  3QYF A;  1HOM A;  1X1C A;  1MBJ A;  1Y1W J;  3L2U A;  4PJ0 C;  3M8J A;  3GF2 A;  3JAM K;  2V9V A;  3BWG A;  3CMA I;  2N8G A;  1XG1 A;  3KEY A;  2ZBK A;  3U1D A;  3KX2 A;  1S8N A;  2R7V A;  3TP0 A;  1TT5 B;  3ASN H;  3U21 A;  3TP3 A;  3H9G A;  1YFH A;  5CVV A;  3N97 A;  2A3S A;  2VOD A;  3HOY J;  5A2Q K;  2HPM A;  1CF7 A;  3JTG A;  2OPT A;  1ZKG A;  3OYG A;  3HB9 A;  2E2I J;  2DK8 A;  1T95 A;  1U78 A;  3IHU A;  2BV6 A;  4IRI A;  1P9Q C;  5B3S H;  1JKP C;  2EIN H;  1ZG3 A;  4LIT A;  4A3L J;  3FXU A;  5J1U A;  2O3F A;  2HYJ A;  3BRO A;  2MW8 A;  2VKH A;  3FKI J;  3F3X A;  1TWC J;  2TDX A;  3BCB A;  3IL2 A;  4Y15 A;  4KIF A;  1OFC X;  1ZAR A;  5KAI C;  1FSE A;  2DA5 A;  3Q0U A;  4DJA A;  4L5E A;  2E1C A;  2NYX A;  2IP2 A;  1T56 A;  4ENK A;  3G1L A;  1HW2 A;  1DPR A;  1XS9 A;  4FE4 A;  2IEK A;  4N9I A;  2WA0 A;  2VQC A;  4KNY A;  1WIB A;  2RN7 A;  3WG7 H;  3CJS B;  1UG0 A;  4BNC A;  4LIU A;  4A3J J;  2JMW A;  4AU7 A;  1QPI A;  1TQM A;  3E6C C;  2GIZ A;  1FP2 A;  3IP4 B;  3K4M A;  2XDV A;  2TRT A;  2LDU A;  3EUH A;  3L09 A;  4GCV A;  4HX7 A;  5F6F A;  3QYE A;  5J4V A;  3OYE A;  4RB3 C;  1HA8 A;  2IA0 A;  3OIO A;  1V5E A;  3BR2 A;  1EF4 A;  4EM1 A;  3IRQ A;  1I50 J;  2V9K A;  5B1B H;  1ONV A;  3BR0 A;  4PFP A;  1R1U A;  1A5J A;  3S2H J;  2IVM A;  1RI7 A;  3P5J A;  4GXO A;  4M6Y A;  3KEQ A;  2VKE A;  3ESW B;  3K4L A;  3V42 A;  3H1C A;  2XPW A;  4Z2Y A;  3ROU A;  4AWX B;  4ZTJ A;  2ESN A;  4CO8 A;  2CV2 A;  4UXN A;  1TW3 A;  1T98 A;  5E3M A;  2LC2 A;  5B1A H;  5JHU A;  2CQK A;  3Q0V A;  2QQB A;  4M74 A;  1FBU A;  3GCM A;  4I02 A;  2R5Y B;  4KYW A;  2WAF A;  5TJJ A;  2WAE A;  5L3D A;  2D5V A;  4MHG A;  1FWZ A;  2DXI A;  2HXO A;  4OAY A;  2DLL A;  4QPQ A;  2P0W A;  3BTJ A;  2B7E A;  2X1E A;  1IW7 F;  1X1D A;  4C3I J;  3R60 A;  4OIQ F;  2K5C A;  1VQN I;  3MAJ A;  4DQ2 A;  3S2D J;  4AC0 A;  1P4W A;  1IN6 A;  5IPA A;  4CSW A;  2VJJ A;  3REO A;  2GZW A;  1I1G A;  3RSN A;  4AM3 A;  1QA6 A;  3FHN A;  1BJZ A;  1SMT A;  1G3W A;  6PAX A;  1O3T A;  4XN3 A;  3H3Z A;  5J40 A;  5LRS A;  1N25 A;  2XSJ C;  1HW1 A;  4HX4 A;  1OCO H;  5D6F A;  1R4N B;  4E7I A;  2W1O A;  3G1O A;  3BTL A;  4A3B J;  1UFM A;  2L9R A;  3HM5 A;  2NAZ A;  3I54 A;  4YRV A;  4CYC B;  1T2K A;  2V6E A;  1RR8 C;  2I8D A;  4II3 A;  1ETQ A;  2KPM A;  5LEJ A;  4P9U A;  2ESH A;  3P9I A;  3GTM J;  3TW6 A;  4AIH A;  4LFU A;  3E97 A;  2QWW A;  4PSX A;  3OYC A;  3LOC A;  2M1B A;  3FDY A;  5BNG A;  2DOD A;  2ID6 A;  4UUT A;  4AVP A;  3JAM Z;  3HOZ J;  3G4S I;  2F4M B;  4A5M A;  2V1N A;  4A3I J;  1TBX A;  2A6E F;  2VUM J;  2DJN A;  1F9N A;  1WKM A;  2E36 A;  4WF2 A;  2L4M A;  3LST A;  3G73 A;  1P92 A;  3C1D A;  3N05 A;  5CVU A;  3TBI A;  3KZY A;  1MDM A;  1MJB A;  1D5Y A;  1R1V A;  1R7J A;  2KKO A;  4II2 A;  4ZDP A;  2XPV A;  1KU9 A;  1TTY A;  3EQL F;  2GM4 A;  2EFN A;  4J01 A;  3PO2 J;  4CCM A;  2MGQ A;  3LSJ A;  1W5C C;  1GT0 C;  3BZK A;  5DEQ A;  4EJO A;  2A61 A;  2VE8 A;  4PSW A;  1WVR A;  5EF6 A;  4XRS A;  1BR1 A;  3H5A A;  1FTT A;  1K4T A;  5DYM A;  5FKK A;  3A01 B;  3O8G A;  3TOA A;  3DF8 A;  1B4A A;  1OPC A;  3AFH A;  1E3O C;  3DEW A;  3E6M A;  2YPR A;  3DEE A;  1BIA A;  3G6E I;  3LSG A;  1WJ5 A;  1H88 C;  4ZYD A;  3R61 A;  4HQM A;  1D0Z A;  3SJM A;  3E5Q A;  1TW2 A;  3ABL H;  5KVR A;  1ZRE A;  2RGV A;  2IBD A;  4HX8 A;  3LSM A;  1RUN A;  2JA8 J;  1B9N A;  4IOC F;  4BE1 A;  5C4X J;  3K7A J;  1Z67 A;  2Z99 A;  3BPX A;  4PDK A;  4ON0 A;  4RMN A;  4U7B A;  1NG7 A;  1MW7 A;  4XKB A;  5J3L A;  4CDG A;  1OKR A;  3I71 A;  4IVN A;  2V6C A;  4MFD A;  1N77 A;  3EUH C;  1R1T A;  1BBY A;  5K7F A;  4F55 A;  1FYK A;  1V54 H;  2C6Y A;  3WOD F;  4Y33 A;  2DFF A;  3C2H A;  2P4W A;  5CPR B;  4I76 A;  2XRO A;  4BDZ A;  2K9Q A;  5IP6 A;  1WH5 A;  2L7K A;  2QQ8 A;  3A2K A;  1FT9 A;  4J19 A;  3QAH A;  2VBY A;  1U6G A;  2XB5 A;  1R9T J;  2Y0M A;  2BZT A;  1P7J A;  2JTV A;  1SMY F;  1OQY A;  2QUF A;  2YS9 A;  5FGM A;  1SD5 A;  1MH3 A;  3MKW B;  1KON A;  5HLH A;  2LSO A;  3I55 I;  1RKW A;  1UHM A;  3F22 A;  3W3C A;  4DYR A;  1IDZ A;  2KP6 A;  1NK3 P;  1FC3 A;  1BOB A;  3HOW J;  5DD4 A;  1H9G A;  2NNN A;  4NB5 A;  5FLM J;  2H8R A;  1SAX A;  3L1P A;  4KJZ A;  3BDD A;  4MTE A;  1XCB A;  2QKM B;  4WXH A;  4YIF A;  3H36 A;  3OSF A;  4UV9 A;  2X1D A;  1BI0 A;  1KU2 A;  4RAZ A;  2A6H F;  3DKY A;  2VKD A;  3PSI A;  4IL6 C;  4FT8 A;  3S2W A;  1GXQ A;  1ON1 A;  3R0J A;  5LFA A;  3LAJ A;  4CUG A;  2R5Z A;  1U9O A;  4ESB A;  4BQA A;  9ANT A;  3BR1 A;  4ESF A;  2OJE D;  1R4M B;  3C2B A;  2M8G X;  1JT6 A;  1XB4 A;  1ERD A;  1KYW A;  2CGP A;  2MAB A;  2EV6 A;  2L4A A;  3NRV A;  1JTY A;  1FP1 D;  3LQR A;  2M4G A;  3R0A A;  4XBF A;  2P5L C;  2M2E A;  2KRH A;  3FXL A;  4R8H A;  3M1E A;  2L2O A;  3CUO A;  3FXR A;  4ASN A;  4CCN A;  5BMZ A;  2NOG A;  2PLY A;  2GIV A;  2CJJ A;  1NG6 A;  1PJR A;  2GOM A;  1LQ1 A;  3FXO A;  1XC5 A;  4I99 C;  3E6D A;  2IW5 A;  4FHT A;  3ZMT A;  1FNN A;  5LEK A;  5HLT A;  4RS8 A;  1J0R A;  3W2V A;  4C3H J;  2UZK A;  2ZO4 A;  2GA2 A;  2EQR A;  4A5N A;  2KIQ A;  1TLH B;  2X0L A;  4LJZ F;  1FMV A;  1R6R A;  2HU9 A;  4KIG A;  4ZC3 A;  1FOK A;  3QP6 A;  3JTH A;  2A69 F;  2QLZ A;  5DDG A;  3TDZ C;  2R7Z J;  1SAN A;  5CQE A;  2K7L A;  4PZJ A;  3RKX A;  4CYD A;  5BPD A;  4QPO A;  4LB6 B;  4M3E A;  3L2C A;  3IH2 A;  4EJW A;  4DZP A;  5CKT A;  1G4D A;  3V8L A;  1RPW A;  5TGT A;  2W00 A;  1FZP B;  1JKR C;  2IJL A;  3AG2 H;  4B8X A;  5B66 C;  1RKT A;  4BYY A;  3MFK A;  2FD5 A;  3BOQ A;  3K0L A;  3FBI B;  3S32 A;  3QQA A;  4FQG A;  1EKE A;  2CYY A;  3HRS A;  1MBH A;  4CZZ A;  3H3U A;  4CYC A;  1TQI A;  1X2N A;  3I4P A;  3BPV A;  3E5X A;  4P55 A;  4MTD A;  3GTJ J;  1U5T B;  1QBJ A;  1G2H A;  4CGZ A;  2Q0O A;  1ZQ3 P;  2EFP A;  3E1S A;  5EGO A;  1R23 A;  4IHX A;  3BC8 A;  2OQR A;  3EGV B;  1WRJ A;  4OIP F;  2QEN A;  4HEA 2;  1KU3 A;  5E20 A;  1I27 A;  3P9K A;  1D8J A;  5F64 A;  1B9M A;  4M72 A;  3PL8 A;  5D5U B;  4PGG A;  2BVL A;  3BG5 A;  3BR5 A;  3FK6 A;  4IXA A;  3OYF A;  1ETV A;  2EZK A;  3GZ5 A;  3VYS B;  3TO7 A;  2QCO A;  3DWL E;  2X1C A;  3FMQ A;  2O9L A;  2EIM H;  2FOW A;  3HL2 A;  3RKY A;  1OYY A;  1LUJ B;  4BAC A;  2ZFW A;  3O3K A;  1Y8R B;  2XPU A;  2W25 A;  3VYU B;  1K61 A;  5IOZ A;  2Y0S N;  1OR7 A;  1YQA A;  2LRD A;  4AD9 A;  2KIS A;  1A04 A;  2PMU A;  3M9A A;  1UEL B;  2R7O A;  5F0F A;  3WE3 A;  3BCA A;  2NVU B;  3PFI A;  3O8H A;  5JR3 A;  3IWZ A;  2JQ7 A;  5K7H A;  4E7Z A;  3CMY A;  1I3Q J;  2ELH A;  4GYI A;  2EZI A;  2DOA A;  3OYB A;  2FJ1 A;  2IPQ X;  1TC3 C;  1HCR A;  2CQ7 A;  3WTY C;  2EBI A;  2E5Z A;  2JN6 A;  2HPI A;  2VJI A;  4ITV A;  1ZRD A;  4KA4 A;  2CMP A;  2MC4 A;  1SVL A;  2LRE A;  3ABU A;  3VPR A;  4B3A A;  3OYD A;  3ZQL A;  3A4C A;  2DA3 A;  3CCJ I;  2OCC H;  3A02 A;  2DFH A;  3BQZ A;  5E79 C;  3FXQ A;  3KYC B;  2EZL A;  1U0J A;  2EA2 A;  4PFO A;  3EUA A;  5E3N A;  4BXX J;  3HTS B;  1Y0U A;  3PNV A;  3AKZ A;  3ZXS A;  2WAD A;  1F4K A;  3GTG J;  3FHZ A;  1IG7 A;  1ZRF A;  1ENH A;  2LNB A;  3GW2 A;  4P1W A;  3KP2 A;  3CTA A;  1K6Y A;  3KLN A;  5JI6 A;  5L3E A;  3NQO A;  3OYL A;  4C2T A;  3GO5 A;  1X19 A;  3LNQ A;  2WY7 Q;  4UV8 A;  4E6K G;  3JR9 A;  1JE8 A;  4EJV A;  1JUM A;  3F21 A;  2E1N A;  1BI2 A;  4EJT A;  2ID3 A;  1MMD A;  3DTK A;  1FMW A;  4BS9 A;  3ZQF A;  5DUI A;  2GBY A;  1VQO I;  1YRN B;  1C0W A;  4IZZ A;  4EMS A;  2ZXJ A;  3F8M A;  2WWY A;  3HJE A;  3OOU A;  2P6S A;  2XF6 A;  3HOV J;  3D5R C;  1XGN A;  3HUG A;  2ZJ2 A;  1D1A A;  1JKQ C;  2DA7 A;  5HOO A;  5DCF A;  4IPA A;  4E70 A;  2FBH A;  2PX9 A;  5EZG A;  4JX5 A;  2CQQ A;  4I2O A;  5JHF A;  5IYB J;  2ZXH A;  4LLG F;  3NEU A;  4BBR J;  2X4H A;  1R36 A;  5K5R A;  5M5X J;  3CLO A;  2CV1 A;  1I3A A;  2P7V B;  3D1N I;  1MMG A;  4LLN A;  1MGT A;  4Y7N J;  1UHW A;  4IX7 A;  4ZZD A;  5H2F C;  2DMQ A;  3JRB A;  3KP7 A;  5DM6 F;  2AHQ A;  2IGK A;  4GDF A;  3ZP5 A;  2L7M P;  5ILU A;  2L5Q A;  2DN0 A;  3KET A;  2EIJ H;  5M5W J;  1JHH A;  1B72 A;  3IWF A;  1GV2 A;  3MKY B;  3ECO A;  3ZGK A;  4YEJ A;  2O8X A;  1AU7 A;  2CW7 A;  1R5G A;  4D1Q A;  2FA5 A;  5CVJ A;  4HNV A;  2KJB A;  1IV8 A;  4HW0 A;  3V8K A;  3OY9 A;  1T0F A;  2F5C A;  1V3F A;  3K9T A;  4BEH A;  2J5P A;  4DNC A;  1EA3 A;  1BI3 A;  1ZHF A;  5HDG A;  4A3F J;  2YUS A;  3CP2 A;  4QIW N;  3BTI A;  4HDU A;  2YSR A;  2VBW A;  3U1K A;  2VN2 A;  2DCE A;  3KP4 A;  4EM2 A;  2DOE A;  4B1R A;  2LYC A;  4X0G A;  5K7Z A;  1TWH J;  5FLX K;  4OWR B;  3QU6 A;  2FNA A;  3NAU A;  2VI6 A;  3K70 C;  3CJR B;  4BGD A;  2EV0 A;  2NRA C;  5IT9 Z;  3K1M A;  5IT3 A;  4A3K J;  2BY3 A;  4A0Y A;  1A6I A;  1GLN A;  2FXA A;  4QTR A;  1Y6I A;  2R7X A;  2O6G E;  4BHC A;  3MZ8 A;  1ZG5 A;  4LMY A;  3MD2 A;  2RNJ A;  3H3V K;  3IAS 2;  4A3E J;  1OCR H;  2CH0 A;  3AG4 H;  3S15 J;  2W24 A;  3CJT B;  4DOZ A;  4U0Y A;  4HPQ A;  2LK2 A;  3E3V A;  2F4O B;  2BHZ A;  4HF1 A;  2VLA A;  5GAE J;  3OR1 C;  4FET A;  1YW9 A;  2H09 A;  4LG0 A;  2DA1 A;  2ISZ A;  3RTR A;  3FM3 A;  5LBQ A;  2MD0 A;  3E7L A;  4DBR A;  4LB5 A;  4BU2 A;  4D7M A;  1W1W E;  3ZOB A;  1AKH B;  3GXO A;  2UV1 A;  3FIS A;  4C2U A;  2HZD A;  1S7A A;  3Q9S A;  4XM3 A;  2Z16 A;  1X58 A;  4AIK A;  3JRI A;  3I4N J;  3RIR A;  5A2Q Z;  3P7N A;  1S29 A;  4Q48 A;  3DU5 A;  2IS2 A;  3GTL J;  4RLQ A;  1SFK A;  4IRH A;  2V26 A;  4CXF A;  3HGG A;  4OIN F;  4P96 A;  2UUZ A;  2JSC A;  3FIW A;  4IQ4 A;  4FAS D;  1B8I B;  4O5V A;  4LIV A;  4YIR X;  1UCR A;  3EDP A;  1PDN C;  2FSW A;  1IZ1 A;  2BY0 A;  2ZNZ A;  1JHF A;  3S17 J;  3TGN A;  2LP0 A;  1YE9 A;  3LWF A;  5CVI A;  2QKL B;  2EFW A;  1RIO H;  5HS7 A;  1GHC A;  5DTD A;  1HKQ A;  1UAA A;  4QWQ A;  5FKL A;  1IXC A;  4O3M A;  4XSZ F;  3IAM 2;  1TP4 A;  2P5V A;  3I59 A;  1YJN I;  1Z77 A;  5GPC A;  2DDB A;  1IC8 A;  4ABZ A;  4BE0 A;  4RDU A;  1K6O A;  2KQR A;  1DGR M;  3KFW X;  1O7F A;  3FX3 A;  4UVB A;  4A0Z A;  1WJA A;  3I4M J;  2R3S A;  3E0J B;  5ICF A;  4CCL A;  2NS0 A;  3V7R A;  2X6O A;  4XLA A;  5H6R A;  1X2M A;  4IO9 F;  5L3C A;  2K85 A;  3HRU A;  4M71 A;  3TMO A;  3I56 I;  1YO5 C;  1F43 A;  1VQ7 I;  2G0E A;  4M3F A;  3R6S A;  5GTI C;  5JVG F;  1Y56 A;  4H4K C;  4B44 A;  5FLV A;  4BL0 B;  2H6B A;  1HDP A;  2DFE A;  2OUM A;  2ZKZ A;  3HIF A;  3LA7 A;  5D8K B;  3IV5 A;  3CLQ A;  2VJ5 A;  2BEO A;  2X48 A;  4E7J A;  2FQ3 A;  1MD0 A;  2HYF A;  4BHP A;  3LSR A;  2JA2 A;  3ERM A;  2XUB A;  4EJU A;  3PQK A;  1NH3 A;  2QGU A;  2VBZ A;  1Z7U A;  3FXM A;  3KYD B;  1WH7 A;  3EPZ A;  3L9F A;  4ESJ A;  3N4M A;  1ORK A;  2NS8 A;  3F8B A;  3JRH A;  2W85 A;  4UNO A;  2ZFU A;  1X4P A;  3CQZ J;  2A5Y B;  3KIO A;  3PQJ A;  1V5F A;  1X4O A;  2OZ6 A;  1O7L A;  1S9H A;  5F0C A;  3G71 I;  4LOC A;  2E1O A;  3ELK A;  3FMR A;  3L2R A;  2OCE A;  3VOE A;  1BJA A;  4M73 A;  1V4R A;  1BR2 A;  1XTA A;  5TRD A;  1WWX A;  4RB2 C;  3B6C A;  1XDU A;  2CUE A;  2KMU A;  4RGU A;  4XRM A;  3GZN B;  3E6B A;  4MEX F;  4BEH B;  2EZH A;  1FPQ A;  4HBL A;  2IGO A;  2QVO A;  3E5U A;  3H9Q A;  3J80 Z;  1Z3Y A;  4RM3 A;  3VEP A;  3CCY A;  3KP6 A;  1KA8 A;  1KQ9 A;  1MH4 A;  2XKO A;  4BUP A;  4C30 A;  3BG3 A;  1HLV A;  3DU6 A;  3LSP A;  2QBY B;  2LY2 A;  2IA1 A;  2ZC2 A;  3K4K A;  3J80 K;  2L54 A;  1K79 A;  3VSK A;  3JRG A;  2VXD A;  3NAR A;  5FKN A;  3F72 A;  3MWM A;  2IS6 A;  1SFE A;  1IO2 A;  5HDK A;  5EGO B;  5KNL A;  2HQ5 A;  1UG2 A;  3RQ4 A;  2HDC A;  3CO7 C;  1YIT I;  3CD6 I;  2EK5 A;  4XMY A;  2V4J C;  2RKH A;  3ZMZ A;  1PP7 U;  4KT5 C;  3RPU A;  1F1Z A;  2L02 A;  1QPM A;  4M9Z A;  4RBO A;  4DZJ A;  3L2W A;  1UHS A;  4HOB A;  2UXX A;  3HOS A;  1WFX A;  3QOE A;  3GX4 X;  1MMN A;  2R7U A;  1J2X A;  2Z1D A;  1SAU A;  1I6H J;  1YW7 A;  1R58 A;  1H8A C;  2K9M A;  1FBQ A;  3TL4 X;  2XGX A;  2W7N A;  1GXP A;  4V19 K;  1BW6 A;  4YFK F;  2LG4 A;  3W2W A;  3I59 B;  2K4J A;  5GPA A;  3UNG C;  3ZQH A;  1HSJ A;  3ZMD A;  3BG9 A;  2V1X A;  5CYV A;  2ZME C;  2FE3 A;  2IS4 A;  2JUC A;  3SFI A;  2DYS H;  3OIQ A;  1DGW Y;  3PNT A;  1TWA J;  1SVO A;  2PMZ A;  2X85 A;  5K5Q A;  4WK8 F;  2GXG A;  4YFN F;  3HSF A;  1MZB A;  1J7K A;  3MEX A;  4RAG A;  2K9N A;  5J8F A;  2E35 A;  2HQN A;  3QPS A;  4L18 B;  4PJJ A;  2L9N A;  2XF5 A;  3GTK J;  3CJQ B;  1USS A;  2WBM A;  1QVT A;  3GME A;  4B4C A;  1S5L C;  4FE7 A;  2F5D A;  2ZXW H;  3ECH A;  4G7H F;  2PFB A;  2QM3 A;  3FXJ A;  1O3R A;  2FEZ A;  2E34 A;  5FKO A;  5JFR A;  1I5Z A;  4IKF A;  1B1B A;  4NDL A;  1G3Y A;  2GXB A;  5J1Y A;  1IXS B;  5BOX A;  2R4G A;  4IJA A;  1RUO A;  1ZR4 A;  4H0E A;  3VWB A;  2BVM A;  3W6V A;  2PN6 A;  1GUU A;  4V2F A;  1FEX A;  2D1H A;  1I1S A;  3F6V A;  4UVC A;  2K4B A;  1OLT A;  1TNS A;  1D0X A;  1U2W A;  2OAZ A;  3FM5 A;  1ULY A;  2K9L A;  4G9Y A;  4IHT A;  3SZP A;  2LH9 A;  2NS7 A;  5E3L A;  2IXS A;  2V1U A;  3CCL I;  2MC3 A;  3KPH A;  5FD6 A;  2IA2 A;  1IJW C;  3HKZ A;  2F4I A;  3I3L A;  1D1B A;  3B02 A;  1YX3 A;  1YJW I;  1YYV A;  2W82 A;  4M3B A;  3ZRG A;  3KZI C;  3DLL F;  3AL0 B;  2ZXI A;  2BYV E;  2XAF A;  1YOV B;  1IN4 A;  2IGM A;  1QHH D;  2V1D A;  1MBG A;  5CJ9 A;  4A6D A;  2H1L A;  4B48 A;  2D45 A;  5FRM A;  2JA6 J;  2ME6 A;  2B63 J;  1VQ9 I;  1WGX A;  2RC4 A;  3FF5 A;  2M34 A;  2R5Y A;  2PEX A;  5D5V B;  2HOT A;  2HR3 A;  3KEO A;  3H0D A;  2FML A;  1G6N A;  2P81 A;  2DMU A;  4JOM A;  3B73 A;  1A31 A;  1HKS A;  5FRN A;  1OCZ H;  1POG A;  3I58 A;  2FQ4 A;  2FF4 A;  4N0B A;  1XGO A;  2QSF X;  2ZSI B;  2Y2Z A;  3CUQ A;  2OTL I;  2HTS A;  1FIA A;  1OR7 C;  2LR8 A;  1S6L A;  4EQQ A;  1MBF A;  1J5Y A;  3TDU C;  1T8I A;  4PCQ A;  2P8T A;  2AO9 A;  4E7L A;  2NVQ J;  2HZT A;  1O57 A;  4L9N A;  2HVS A;  3OWT A;  2MFZ A;  5L3B A;  3FXK A;  4A69 C;  2GAU A;  5DD8 A;  2DJI A;  4CCK A;  3GFM A;  1B59 A;  5M5Y J;  3U9G A;  4OMZ A;  4RAY A;  1Q1H A;  3QPT A;  3IKV A;  3CCU I;  3OYI A;  4QSH A;  1ETW A;  3HRT A;  2IS1 A;  2ZNY A;  1ITY A;  3LAP A;  2ECC A;  4JQF A;  3F8F A;  4IHW A;  2YR2 A;  2COM A;  4RAF A;  2BBY A;  3A1Y A;  3WG9 A;  3M8E A;  1BC7 C;  4HST A;  3FK7 A;  1LE8 B;  1VQL I;  1P6R A;  5FB2 A;  2HQA A;  1LVK A;  2Q8K A;  2EIK H;  4RLF A;  2FUG 2;  4PUS A;  3HUG B;  5TIS C;  2E19 A;  5CQG A;  3FWE A;  5KCM A;  3GFI A;  1ZEL A;  3DBH B;  3GWZ A;  1L3L A;  1K83 J;  5EYR A;  3R4K A;  3RJP A;  2JK3 A;  3GUD A;  2JPC A;  4QLC U;  2JRM A;  1WCM J;  4U88 A;  4R79 A;  4ANJ A;  3H0G J;  2EPF A;  3S14 J;  3RZO J;  4DYC A;  1HF0 A;  2E2J J;  2DMN A;  1HDD C;  5HNF A;  2A68 F;  2X9D A;  2XHK A;  2VIX A;  4K2E A;  2M30 A;  3H5R A;  2XC7 A;  2ZME B;  3NWT A;  1W36 D;  5E8G A;  2M3A A;  3K69 A;  1MBK A;  5IP9 J;  2Y9Z A;  2DAO A;  1SD4 A;  5F1J A;  4A3C J;  1LEA A;  4UUS B;  2M87 A;  3OSG A;  3LSK A;  2AXL A;  2Y30 A;  3HC7 A;  4LG0 B;  1CQT A;  2NVX J;  4L5I A;  5HDN A;  5BS6 A;  4Y3O A;  4LGW A;  2HXI A;  1YIJ I;  2AXT C;  2DFI A;  4ETS A;  5JLX A;  4G6D A;  4BQN A;  4BY1 J;  4PGH A;  2R92 J;  4OMY A;  5FFZ A;  1KU7 A;  1XGS A;  4A3M J;  1SD7 A;  1Z9C A;  4XK4 A;  1BOA A;  3TO6 A;  2CRG A;  3WGH A;  3BZC A;  2ADU A;  3HSR A;  2VT2 A;  2JVH A;  1LFP A;  3CF5 F;  3HRM A;  3PJR A;  4UHT A;  1MMA A;  1OCC H;  2EB7 A;  1ZLK A;  4F52 A;  3HOT A;  2PG4 A;  4GO1 A;  1WJD A;  3CDL A;  3D5S C;  3I9V 2;  4I0A A;  4I09 A;  1LE8 A;  2OTJ I;  1LB2 A;  4EV0 A;  1W5T A;  2IGN A;  3IKT A;  2BY2 A;  1FOY A;  4F92 B;  2H1K A;  5LGU A;  2BHY A;  3WTU C;  1OYW A;  1WHU A;  3UR3 C;  1YTY A;  3ZQC A;  1HKT A;  2D2W A;  1FIP A;  1FOX A;  4XR6 A;  3ONQ A;  3ZN0 A;  1ETO A;  2M8E A;  1VQM I;  4CH7 A;  4I01 A;  3OL3 A;  5DCM A;  3DBR B;  1Q1V A;  5K1Y A;  4ENM A;  4ZYG A;  4MIM A;  3EUK L;  3OYA A;  2LKS A;  3BZ6 A;  4XL9 A;  1R5H A;  3I5U A;  3V4G A;  2L7F P;  2MH9 A;  4I7H A;  1P2F A;  2FX0 A;  2HYG D;  4L5J A;  4XN0 A;  4AUX A;  4KN7 X;  4BXU A;  2A07 F;  4L0Y B;  3F8N A;  3I64 A;  1QO0 D;  2Q1Z B;  2DU9 A;  3J81 K;  2HEO A;  3BP8 A;  4WXD A;  4ZYH A;  2WY8 Q;  5JVT A;  3CCE I;  2KJC A;  3AG3 H;  2CUZ A;  3I53 A;  1H89 C;  3J7A Y;  1JTX A;  2VC1 A;  5LRR A;  3RCO A;  1NTC A;  2VQH A;  2M5W A;  2OBP A;  3CCM I;  2KZG A;  1ZRC A;  3RPQ A;  1EV7 A;  3K1N A;  4BBS J;  5LD2 C;  4ENN A;  5DS9 A;  4KMF A;  1YW8 A;  4M9S A;  1ZLJ A;  4IRG A;  1XD7 A;  4D7N A;  1E2X A;  2UWM A;  1FTZ A;  4EAT A;  3CDI A;  3G1M A;  3ZR8 X;  2ZJP F;  4EVI A;  4PJM A;  4N9H A;  4GRI A;  2AQF A;  1KQ8 A;  3RKW A;  1LPQ A;  4XOR A;  1BIB A;  4EM0 B;  3S1N J;  2EIL H;  3U2R A;  1FBS A;  2OD5 A;  3DKW A;  3P9C A;  2ZB9 A;  4FIS A;  3ML6 A;  4G7Z F;  3JSO A;  2RQP A;  2VON A;  3RKQ A;  1QZY A;  2F6C A;  4XOT A;  4D9J A;  2JA7 J;  1S3J A;  2HKO A;  4KN4 X;  4MLO A;  4W1U A;  3S3O A;  2J5O A;  1IGN A;  1KYZ A;  1BA5 A;  4A6E A;  4ZDO A;  4BHB A;  5HLI A;  2CFX A;  1Z1D A;  5EEH A;  4XLP F;  1X1A A;  1LDK B;  4AYB A;  4KDP A;  2BXZ A;  1I6X A;  5KAF C;  4MEY F;  3CC2 I;  1JXS A;  4DW6 A;  1VZ0 A;  5ILV A;  3RI4 A;  3GLL A;  3OMY A;  3MN2 A;  4HSR A;  2V79 A;  4Y52 J;  2MSY A;  4WXC A;  3QU3 A;  4HV6 A;  3SYT A;  1VQP I;  4BKX A;  2E60 A;  3HPG A;  3TO9 A;  5IOY A;  2HDD A;  1X1P A;  3QP5 A;  1ZYR F;  2WTE A;  3EYY A;  1LEB A;  2P6T A;  2O0Y A;  2BW3 B;  4D5C A;  3WTX C;  1W0U A;  1K78 A;  4XQF A;  4AIJ A;  1P4A A;  4Q47 A;  2Z9O A;  2BGC A;  2ICW G;  1VF9 A;  1R5I D;  2AQE A;  4FX4 A;  2Z3Y A;  3TW7 A;  1J9I A;  1XX5 A;  1HXD A;  1P7I A;  4ZDL A;  3TKY A;  5CLS A;  4CIC A;  2R0Q C;  1D1C A;  3HZJ A;  5DV5 A;  5B5E C;  4L9T A;  3T0Y A;  5FFX A;  3OYH A;  3GYH X;  3CCV I;  4A12 A;  2H6C A;  2VPL A;  1T08 B;  3WU2 C;  5EEG A;  3O6B B;  2OA4 A;  3C2G A;  1MDM B;  1ZTR A;  2XAS A;  3S1Q J;  2JPB A;  1U8B A;  1D0Y A;  2TCT A;  2F5V A;  1DUX C;  5E17 F;  4RGX A;  4NC7 A;  4CA0 A;  1PYV A;  1QU3 A;  2NOJ B;  3MVP A;  4KMU X;  1T6S A;  1WPK A;  2F5E A;  1LDD A;  5K5O A;  3DQV C;  2WAQ A;  2QEX I;  3CUQ C;  2KZV A;  2L9V A;  3MMY B;  4A0X A;  2QSH X;  3ZPL A;  4F7Z A;  4PK4 A;  3BJO A;  1WZ2 A;  2XKP A;  2MA3 A;  2XRL A;  1ZGW A;  2LVS A;  1VQ5 I;  1D5V A;  4B3X A;  1I39 A;  4UUS A;  3MKZ A;  4KT6 A;  5IP7 J;  3L2Q A;  3ZMU A;  4BDY A;  1B6A A;  1EJ9 A;  1BR4 A;  4W97 A;  1G3S A;  2GOX B;  1U8R A;  1XPX A;  2O8K A;  2DDA A;  2HOA A;  5LGN A;  1Z7L A;  2LBF B;  5F08 A;  3IC7 A;  5LHH A;  1W7P B;  4MNU A;  4JBA A;  4M3G A;  3LSI A;  3K4J A;  4KIT B;  3S3N A;  3GTQ J;  5GP9 A;  1YS6 A;  3KE2 A;  4FCY A;  2LLK A;  3MZY A;  1G59 A;  4C2M J;  2WV0 A;  1AKH A;  4FX0 A;  2DQR A;  3T8T A;  1LDJ A;  4Y17 A;  2ACJ A;  1FOW A;  3ZMV A;  4MQ9 F;  3IH4 A;  1XMX A;  2M9H A;  1IV6 A;  2JSP A;  3A0H C;  1MNE A;  2JZY A;  4HRI A;  3CZ6 A;  3ZQI A;  4MO7 A;  3V7C A;  5F1R A;  3HDD A;  4HLX A;  4HQE A;  3T1B A;  4CCO A;  2L01 A;  2FNP A;  3QOD A;  4OOI A;  5F27 A;  2XGD A;  4RGS A;  5E1X A;  3JRE A;  2H27 A;  2YX4 A;  4CHU A;  2XAG A;  1EH6 A;  2XAJ A;  3C18 A;  3BJ6 A;  3K4C A;  4NQW A;  1N75 A;  3PIP F;  2RNG A;  3BG6 A;  1STZ A;  3DTE A;  5H20 A;  2YU9 J;  3GTP J;  2KL4 A;  4M9X A;  4HA8 A;  2IT0 A;  1WI3 A;  1JUP A;  1MJ9 A;  2M7A A;  3PUF A;  4M6X A;  2A5W A;  5D6E A;  3WHC A;  3QRF F;  1TWG J;  2IRF G;  4UY8 I;  3ZN1 A;  1IN7 A;  5EG0 B;  2HI3 A;  3HYI A;  1U3E M;  1K78 B;  1YS7 A;  1ODD A;  3ABK H;  5FJ8 J;  2PMZ N;  5HVQ C;  1SFU A;  3GTO J;  3PIO F;  1S7E A;  4F3Q A;  3SHF A;  5J1R A;  4Q5S F;  1VQ8 I;  2GWR A;  3HSE A;  1W7P A;  2YU3 A;  2G9W A;  3BT9 A;  1MJA A;  4XON A;  2CSO A;  3BTC A;  1V5G A;  3S3M A;  1Y0N A;  2LD5 A;  2VOO A;  2XGC A;  3GFL A;  1H0M A;  1JUS A;  3HTU A;  2EA4 A;  3LMM A;  1ETK A;  3CJN A;  2VQG A;  3C3W A;  5M3F J;  1APL C;  2DPU A;  4X6A J;  1J09 A;  2PMH A;  1VFC A;  4I0B A;  4JK1 X;  4AID A;  4Z6Y A;  1ZG1 A;  1FX7 A;  2VJ4 A;  2I10 A;  1B8I A;  1CF7 B;  1FYL A;  4DIQ A;  4XOP A;  1X3W B;  4S04 A;  2PBI A;  3C7J A;  1WJF A;  2K86 A;  1KZH A;  3BG7 A;  4Y13 A;  2W4S A;  3VYR B;  1DPU A;  3IRR A;  4O6J A;  2RV8 A;  1OYI A;  4EEF G;  2VQL A;  2DOF A;  3BR6 A;  3FZV A;  3H92 A;  3OR2 C;  1BC8 C;  4UVA A;  3L2V A;  3ABT A;  5M3M J;  3S8P A;  2HFH A;  2LF8 A;  3CP8 A;  4YFX F;  4YII A;  1X3U A;  2EFQ A;  1W36 C;  1N78 A;  1ZGA A;  1J59 A;  3OS1 A;  3F0C A;  2R93 J;  3K70 D;  4MGR A;  1JJ8 C;  4KIB A;  3DEU A;  3M4O J;  5AON A;  1PUE E;  1MBE A;  4F93 B;  2HWV A;  3EYI A;  2CW8 A;  3PSF A;  3HBL A;  2YX7 A;  1M1E B;  4OIO F;  2DMT A;  2FBI A;  2MH2 A;  1R00 A;  1IAW A;  2FU4 A;  2MLG A;  4N4O B;  1XCV A;  2FBK A;  4B09 A;  3DFG A;  2KRC A;  3LA2 A;  1JGG A;  2VAS A;  2HKX A;  3SDG A;  1KGS A;  4WX9 A;  1LNW A;  3TOB A;  2HS5 A;  4XKW A;  4P5O A;  4ZYE A;  5D4R A;  1LFB A;  2BXY A;  2CW0 F;  2DO7 A;  3ERE D;  5FKM A;  4S05 A;  3Q3S A;  2K3F A;  3A03 A;  1B72 B;  2VPR A;  1BN5 A;  4I98 B;  2XSD C;  3KCC A;  3CUQ B;  2M4K A;  1UMQ A;  1CGP A;  2F2E A;  1ACI A;  4XLE A;  1WJB A;  1YX5 A;  2STW A;  3S1R J;  1DDN A;  3X2Q H;  5EJC A;  3F23 A;  3G3Z A;  2ZSH B;  1ZK8 A;  4OIR F;  3Q9V A;  4HAM A;  2QSG X;  2WC2 A;  2DYR H;  2K27 A;  1AOY A;  2E7X A;  1T38 A;  3OYK A;  2LMD A;  2O5R A;  4NC8 A;  2DPD A;  1R22 A;  4IOA F;  1XGM A;  4U7D A;  2RRE A;  3PFY A;  2JVG A;  4E7S A;  1XSX A;  4BE2 A;  1HST A;  5EG0 A;  2ME0 A;  4B43 A;  1FSH A;  3RPU D;  3PNY A;  3BJA A;  1T33 A;  2QA4 I;  2H8W A;  3A0B C;  1UZC A;  1E0E A;  5LLQ A;  1RZ4 A;  2B0L A;  1W4M A;  2JWT A;  1YRN A;  3GZ6 A;  3WGG A;  5IYC J;  2Z33 A;  3S16 J;  2I5U A;  2HOE A;  3H5N A;  4L0Z B;  4FTH A;  1V55 H;  3ASO H;  4DBQ A;  1G8X A;  2M45 A;  4XID A;  1OCP A;  2OC6 A;  5LGT A;  2H94 A;  4I6Z A;  5HS9 A;  4YG2 F;  3GEZ A;  2KIU A;  3LFU A;  4UB8 C;  1VI0 A;  2XB0 X;  4C3J J;  3CMM A;  2ISY A;  5FD5 A;  1PVE A;  3W6J B;  3SDB A;  5D8L B;  2DA2 A;  2GLO A;  1AWC A;  1O4X A;  2ZCW A;  1XMK A;  4XNF A;  2Y0S A;  1XSV A;  2MBF A;  3H9J A;  2E7W A;  3HEF A;  1MNM C;  5DM7 F;  1UB9 A;  4BJ6 C;  3H35 A;  2EJR A;  3LQQ A;  3CCQ I;  2DA4 A;  2Y69 H;  2JA5 J;  4A3G J;  5KHD A;  5L3G A;  4X1E A;  1D3Y A;  3PM1 A;  3WU0 A;  1O3Q A;  2WB1 N;  1RNL A;  4PJL A;  4U0W A;  2R5Z B;  2R7T A;  1ETY A;  3V8J A;  3SQN A;  4D0P A;  2BY1 A;  4KUM A;  1DP7 P;  3GBG A;  4G6T B;  3QYB A;  2VC0 A;  2DA6 A;  3ULQ B;  2HGC A;  3QPH A;  1TWF J;  4P9F A;  3HGY A;  3CCR I;  3CC4 I;  2FMY A;  2VL8 A;  3RYR A;  1QZZ A;  1AHD P;  1JGS A;  3MKL A;  1RET A;  4OU0 A;  1U5T C;  2EWN A;  2OF7 A;  2Y75 A;  3CCS I;  1MSE C;  1XMA A;  1NHA A;  1PUF A;  4AYB N;  2VOP A;  3EET A;  3J7A O;  3K2A A;  3K10 A;  1GVJ A;  4LK1 F;  1SFO J;  4IHS A;  1SC7 A;  1QGP A;  4LG3 A;  3OIP A;  1OCT C;  3SZG A;  2CS3 A;  4JX4 A;  1GV5 A;  1GVD A;  3I0T A;  4G94 A;  5ERI A;  5FLX Z;  3SFZ A;  1Z6T A;  3VFZ A;  4HNU A;  2XRN A;  3JRD A;  1IN8 A;  2Z2S B;  5D5W B;  1MKM A;  1PP8 F;  5E1W A;  3TED A;  5IT9 K;  2JJ7 A;  4GYG A;  1FY7 A;  1JT0 A;  2DTR A;  1S72 I;  1VND A;  2A6T A;  2KLO A;  3T8R A;  2GA1 A;  1A6Q A;  2B9S A;  2K40 A;  3MZH A;  2CUF A;  4A3D J;  2X51 A;  1X1B A;  1XN7 A;  2EFO A;  5C44 J;  1ZH5 A;  1DU6 A;  2Y31 A;  5ED4 A;  5HNH A;  4ZYA A;  3JSP A;  3KP3 A;  2XAH A;  3KYL A;  3RQI A;  2OU2 A;  3OV8 A;  5J4Y A;  1WI9 A;  2BW3 A;  1QRY A;  1TT0 A;  2ZME A;  1RRJ A;  2XAQ A;  3F9K A;  4B47 A;  1FJL A;  5GAD J;  1GDT A;  5IYD J;  3LFK A;  2HOS A;  3RDI A;  2NNY A;  2V7F A;  1IUF A;  4IEJ A;  5E3O A;  1E17 A;  5EZH A;  1TL8 A;  2O03 A;  1YI2 I;  2R7F A;  5D5X B;  4IQJ A;  3MQ0 A;  4E4H A;  3S1M J;  4M3D A;  4XSX F;  4MFE A;  2OV7 A;  4NC6 A;  4WCG A;  4HF2 A;  1BI1 A;  1QHG A;  4WWC A;  2COB A;  2ECB A;  3JW4 A;  4G7O F;  3D0S A;  4HYE A;  1QNT A;  1IN5 A;  2K02 A;  4CCJ A;  1R71 A;  1BM9 A;  1DU0 A;  1XDS A;  3Q5F A;  3FBN B;  1LJ9 A;  2KIM A;  4CZC A;  1E3H A;  3KLO A;  4XRF A;  2BOL A;  4YEL A;  3CC7 I;  2HDW A;  4KFC A;  5L3F A;  3OYM A;  4RB1 A;  2E5N A;  1EH7 A;  2FOK A;  1R49 A;  1WJE A;  2CG4 A;  2E71 A;  2ELK A;  3CDH A;  3RYP A;  3V7S A;  5FO5 A;  3LA3 A;  2Y9Y A;  3OS0 A;  2XGE A;  4XKV A;  4GFB A;  2CU7 A;  3KP5 A;  2MLK A;  2Q2E A;  2K3P A;  5E1Z B;  4XRS G;  1O3S A;  2STT A;  2XVC A;  2DW4 A;  1A36 A;  4UUV A;  4A2U A;  3RZD J;  3M07 A;  1TNT A;  3F8C A;  4DGW B;  2M0C A;  3ABM H;  2W84 A;  3DKX A;  4HZF A;  4C9Y A;  3AAF A;  1DP3 A;  4HDV A;  2L0K A;  2QQ9 A;  2F5F A;  3JRF A;  3G2B A;  1DQU A;  4BJT A;  4GGG A;  1IXR C;  3DXJ F;  1T39 A;  4PJN A;  3DV8 A;  3WGI A;  4BXF A;  3HOU J;  2PJR B;  3CES A;  3BQY A;  2VT3 A;  1H9T A;  3DTI A;  1Y1V J;  2LF7 A;  1JKO C;  1Y8Q B;  3JRC A;  5JLW A;  2CV0 A;  3OYJ A;  3AL0 C;  3UKG A;  4NHJ A;  5ICC A;  4JYK A;  2CUJ A;  1Z91 A;  2R7Q A;  5E18 F;  1U9N A;  1OIS A;  4XLF A;  3FMS A;  2EH3 A;  2L3D A;  1T0F C;  2RQQ A;  2Z5U A;  2CO5 A;  2XIG A;  3SXY A;  4EGY A;  2L9S A;  2KHM A;  4OAZ A;  5J8C A;  1VQ4 I;  1QZE A;  4HF0 A;  3O2P E;  5KK1 A;  1P4X A;  1TZL A;  3WTV C;  1W7P D;  1E3P A;  2VXZ A;  1U5T A;  3WTS C;  1YIO A;  4DYQ A;  5J6X A;  2LOO A;  2MD5 A;  2KDO A;  4U87 A;  2M0M A;  4MQV A;  2K9S A;  4E7H A;  3DPU A;  5HOD A;  4EGZ A;  4IHY A;  3OOP A;  1YLF A;  4XIC A;  1YG2 A;  4G12 A;  2PI0 A;  2W57 A;  3JRA A;  1YHQ I;  1SD6 A;  3WTT C;  1WJC A;  3ZCO A;  1LFU P;  2R7W A;  2IAI A;  4R1H A;  3MCZ A;  2VE9 A;  4U0V A;  2QQA A;  1IRZ A;  3DPT A;  2E1M B;  2WAQ N;  2WV1 A;  3SEQ A;  1UST A;  4A93 J;  5E8I A;  4KIC A;  5C3E J;  3K2Z A;  2UXN A;  2CFO A;  1ZAO A;  1SFX A;  4M6V A;  3K6G A;  2R7S A;  3DP7 A;  1KQ0 A;  3IH3 A;  4BQQ A;  2PJP A;  1HBX G;  3BY6 A;  2CQN A;  2ELJ A;  2QYO A;  2DT5 A;  2V9P A;  5D4S A;  1VTN C;  1W0T A;  1MSF C;  4LLL A;  1K7A A;  2DI3 A;  1ZGJ A;  2O7O A;  1Z21 A;  3M1C A;  4XLN F;  1LKX A;  1IRX A;  1NK2 P;  2KDZ A;  5CVR A;  2L7Z A;  1G3T A;  4RM2 A;  3HG9 A;  3FKJ A;  1RES A;  3DBL B;  3DCF A;  1IRG A;  3J7Z I;  2DBB A;  4XLH A;  3SZT A;  3CO6 C;  1PUF B;  3ZMS A;  3PUB A;  2G7U A;  4JX6 A;  5GTH C;  3IUO A;  4L9J A;  2E2H J;  2KIF A;  2X6W A;  4TV7 A;  2DQL A;  4Y4R A;  1ON2 A;  2G7H A;  1BL0 A;  2NXN B;  3ZQG A;  5DCM B;  3D5L A;  2XV4 S;  1A35 A;  1LVA A;  3VOD A;  2KT0 A;  2JRT A;  1Z05 A;  3GFJ A;  2LBF A;  2LY9 A;  3WU1 B;  3Q0W A;  1JJ6 C;  3W2A A;  2KRF A;  1F36 A;  3GLX A;  5ICG A;  2LTP A;  2VB6 A;  3M8F A;  4L9V A;  3DPL C;  2D1V A;  2PQ8 A;  2ZJQ F;  3WE2 A;  2VBX A;  5C4J J;  4ZTF A;  3J7Y J;  5HLG A;  2HQR A;  2ZJR F;  4IHV A;  1VQK I;  2O61 A;  3WHB A;  5EEA A;  2XF7 A;  1K4S A;  2HNH A;  4NQW B;  4ZH4 F;  5J47 A;  5AIQ A;  3TQN A;  1IDY A;  4RB0 A;  1ETX A;  2JT1 A;  4D5F A;  2AS5 F;  4XKC A;  3DLA A;  1FYM A;  5ICE A;  1W5S A;  1OJL A;  4V2G A;  4HNT A;  1UJ8 A;  3WTW C;  5GAH J;  3VYT B;  4JP0 A;  4HV5 A;  2PJR A;  3T5X A;  3HKZ N;  1SVM A;  2P5K A;  1VQ6 I;  2BE5 F;  1Y39 A;  3K4N A;  1RC9 A;  5IY5 H;  5F0H A;  2RAE A;  3HPH A;  1MIJ A;  2QZ8 A;  4IF4 A;  3LL7 A;  3GVA A;  2W48 A;  4HLY A;  1TQP A;  2QBY A;  3COA C;  4ZZL A;  1MMS A;  2HVR A;  1X3Z B;  4XLC A;  4HG2 A;  2XAU A;  4S0H B;  5BQT A;  1IF1 A;  4BY7 J;  3HHH A;  2CQX A;  2Q2E B;  2RVC A;  4NNJ A;  3CF2 A;  1EH8 A;  1HQC A;  3VDX A;  1ZR2 A;  2DT7 B;  3NWS A;  3K1P A;  4RA2 A;  5EDN A;  2X6Y A;  5ILS A;  2NVY J;  1SEU A;  5DUK A;  4BJ5 C;  2MYS A;  3A01 A;  4E7K A;  1WSU A;  5H6Q A;  1YJ9 I;  2R7D A;  1IUY A;  3ZQQ A;  3OYN A;  2JUG A;  3KZZ A;  2OZU A;  2RDP A;  3PO3 J;  3BR3 A;  3W6K B;  3HHG A;  4ZJZ A;  1F5T A;  1L0O C;  5AIP A;  3HXL A;  3QPL A;  3LSH A;  1Z3X A;  2HTJ A;  2F48 A;  2VKV A;  4BH9 A;  1JI8 A;  3WTZ A;  2R7R A;  5BPI A;  2DTZ A;  3L7W A;  4KIS A;  2M7B A;  2EV5 A;  4Q4Z F;  5F04 A;  2P7C B;  3OL4 A;  4G6Q A;  1FLI A;  3J81 Z;  2NVT J;  4J00 A;  2WB1 A;  2QF7 A;  1HC8 A;  4BAY A;  5GAG J;  4NUB A;  5LHI A;  2LY1 A;  2HVQ A;  2GXA A;  3BLY A;  1RR7 A;  3B6A A;  1XSD A;  3VSL A;  1QQI A;  4N4N B;  3VB2 A;  1MND A;  2DK5 A;  1Z6R A;  1Z0X A;  3F6O A;  3HOX J;  3ISP A;  2KFD A;  4LK0 F;  1OMI A;  5FRO A;  1IRF A;  2X6X A;  3QWL A;  3ZQ7 A;  3OS2 A;  1AA7 A;  1ZN2 A;  2GQQ A;  1REP C;  2Y48 A;  1QVU A;  2LFB A;  3K4B A;  2MG4 A;  1HW5 A;  4UB6 C; 
#chains in the Genus database with same CATH homology
 4IOC F;  3J7Y J;  2OTJ I;  1ACI A;  2ZJR F;  3PIP F;  1VQK I;  1FOY A;  3CME I;  4UY8 I;  1FOX A;  3CJT B;  1S72 I;  1VQM I;  3PIO F;  5GAE J;  4IOA F;  2E35 A;  5GAH J;  1VQ4 I;  1VQ8 I;  3CMA I;  3CCU I;  1VQN I;  3CJQ B;  3CCV I;  1VQO I;  1VQ6 I;  1Y39 A;  3G71 I;  2QA4 I;  1QA6 A;  2H8W A;  2E34 A;  1VQL I;  5GAD J;  1MMS A;  1YHQ I;  3EGV B;  3I55 I;  1YI2 I;  3CCE I;  2QEX I;  3CCM I;  1VQ5 I;  1YJ9 I;  3G4S I;  3CCL I;  1YJW I;  5DM6 F;  3CC7 I;  2FOW A;  3DLL F;  2E36 A;  2ZJP F;  1WIB A;  5DM7 F;  3CJS B;  3CCQ I;  1YJN I;  1YIT I;  3J7Z I;  1VQ9 I;  3CD6 I;  2JQ7 A;  1HC8 A;  5GAG J;  1YIJ I;  1FOW A;  3CCR I;  3CC4 I;  2NXN B;  3CCS I;  3CCJ I;  4IO9 F;  3CC2 I;  3G6E I;  3I56 I;  1VQ7 I;  3CF5 F;  5JVG F;  1VQP I;  2K3F A;  2OTL I;  4V19 K;  3CJR B;  2ZJQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...