5DM7F

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
144
structure length
144
Chain Sequence
MRRVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIYADRSFTFITKTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 13
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 5dm7F02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 5dm7F01
1MMSA 5GAEJ 3G4SI 5GAHJ 2E34A 3EGVB 1Y39A 2ZJRF 1FOWA 1VQLI 1S72I 3CMEI 3CC4I 2FOWA 3CCJI 3CCSI 1QA6A 2NXNB 1YJ9I 2E36A 3CJTB 3CCLI 3PIOF 1YIJI 1FOYA 1YHQI 5DM6F 1VQKI 1VQMI 3CMAI 5JVGF 3CF5F 1YI2I 3G6EI 3CC2I 3CCRI 1VQNI 2K3FA 4IOCF 1ACIA 1VQ5I 2JQ7A 1VQ8I 3CCQI 3CJSB 3I56I 5GAGJ 3CJRB 2ZJQF 3CJQB 4V19K 2H8WA 1VQ6I 3CCUI 3CCVI 3CD6I 1VQ4I 4IOAF 3I55I 1YJWI 2OTJI 2QA4I 3DLLF 1VQ9I 4UY8I 3J7YJ 1HC8A 2E35A 1YJNI 3CC7I 5DM7F 1VQPI 1FOXA 3PIPF 1YITI 3J7ZI 3G71I 1VQOI 3CCEI 2ZJPF 2QEXI 4IO9F 1VQ7I 5GADJ 1WIBA 2OTLI 3CCMI
chains in the Genus database with same CATH superfamily
1B4AA 1YRNB 2CQKA 2L5QA 2DLLA 2X1EA 2E1CA 3F3XA 3EGVB 4CYDA 3TBIA 2M0CA 4ZC3A 3MKYB 3IH3A 4BXXJ 4KMUX 2CUEA 5D5XB 2ZXIA 1WI3A 1Y56A 3F8CA 2LR8A 5B1BH 3GTLJ 4RGXA 1EH6A 2BHYA 2DN0A 3S15J 5EGOA 4ITVA 1QGPA 1F36A 4E7LA 2Y0MA 2R7FA 1YO5C 1GDTA 2LDUA 3IRQA 2EK5A 4RM2A 3MZYA 2Z3YA 3ECOA 5GPCA 1A6IA 2LF7A 4D1QA 1AU7A 5D5WB 4FE4A 1FSEA 5LD2C 3RQ4A 5D6FA 1QQIA 4HW0A 3U1KA 5FLXZ 2GOXB 2CJJA 3FIWA 4L9VA 4QWQA 3OYCA 5ILSA 4KT5C 4O6JA 2DJIA 2BE5F 5DUIA 4JX4A 3M8JA 3W2AA 2K9SA 3SQNA 1JUSA 2CG4A 1RNLA 1R9TJ 4RGSA 2A69F 1NG7A 2VKDA 4XMYA 4Y15A 1YTYA 1X4OA 1MBEA 2XPVA 3K9TA 1VQ6I 3CD6I 9ANTA 4IRIA 2X85A 4HLYA 4I02A 5A2QK 3OYDA 4M74A 3JRDA 2BY0A 1ZQ3P 2K86A 4A3FJ 4XOPA 5DTDA 4I7HA 4FX0A 1ZTRA 1IG7A 3A03A 4OOIA 1J0RA 3SXYA 2HTSA 4XORA 4MTDA 3DLLF 1EV7A 1UB9A 3QODA 3O3KA 1UCRA 1BW6A 4C3HJ 1FMWA 2P81A 2IA0A 4PFOA 2E1NA 2M2EA 4DZJA 2Q8KA 4U87A 3WHBA 5E79C 1MJBA 5DM7F 1SEUA 3BT9A 3RKYA 2UZKA 3VSLA 1XSDA 3LSIA 1NH3A 1MBJA 4EM2A 2K02A 3Q3SA 4XKBA 3D1NI 1R5ID 1YITI 4ANJA 5EEHA 1MSEC 3G1OA 4YFNF 1QU3A 1OYWA 2ZSIB 1ULYA 4G12A 3BCAA 5GPAA 3VYRB 4CZZA 2OA4A 3HRTA 3OYGA 5FB2A 3RYPA 3S1MJ 1FTTA 2VJ4A 3IWZA 2QEXI 1QNTA 3QU3A 4IHTA 4RGUA 3CZ6A 1KU3A 2Y9ZA 1A04A 1K4SA 4IQJA 3ZMUA 4ETSA 2XGCA 2DOFA 3HSFA 2DU9A 3IHUA 2Z99A 3K69A 4BJTA 1MMSA 2GLOA 1LDJA 2ISYA 2HDDA 1MZBA 2LREA 3ZQCA 5FKNA 2GWRA 3SHFA 1MMAA 2V9VA 3A2KA 1ZYRF 1O7FA 2NVTJ 2C6YA 2VQCA 4NC8A 3HBLA 4BE1A 1RIOH 1HBXG 1K78B 2W25A 4WXDA 3TW7A 2NXNB 4BQQA 2AQFA 2HOTA 1ZG5A 2O6GE 2HDWA 3FXMA 3CCLI 3TGNA 1IXCA 2XASA 3N05A 4PSXA 1XGOA 3TO7A 3AG2H 1O7LA 2M87A 1UHMA 2RGVA 2RC4A 5CVIA 4BDZA 2R93J 1XCVA 3ULQB 2IS6A 4XBFA 5AIPA 4M73A 2W1OA 3C2BA 3TOAA 5HLTA 1FT9A 2DXIA 2RV8A 3CMYA 2VXDA 1AHDP 3QOPA 2DBBA 3IAM2 4FQGA 3IH4A 2CSOA 2CV2A 3CCRI 4L5IA 4OIPF 5E17F 4GFBA 2E5NA 2K3FA 4Y13A 4B48A 4U7DA 2L7MP 3S17J 3L1PA 4V19K 3I71A 2DJNA 2L4MA 2ZXWH 1J7KA 5DDGA 2PLYA 2RVCA 4TV7A 2LKXA 5F64A 3JSOA 3M8EA 5AIQA 1UZCA 3M7GA 5FFZA 1LPQA 2P6SA 4J00A 4DW6A 2MC4A 2HVRA 2IXSA 1HKQA 3DFGA 5L3EA 1P92A 2EV5A 3CQZJ 3LL7A 1O4XA 1WGXA 2WY7Q 1XGSA 4L9NA 2PQ8A 3K7AJ 3NWTA 4M71A 1XX5A 2EFWA 3K0LA 4A6EA 1LJ9A 2LBFA 5J1YA 2MC3A 3E5QA 2QZ8A 4PJLA 3TL4X 4HNVA 2IW5A 2NVQJ 3EUHA 4RMNA 1MMGA 3F8FA 1KYWA 2F48A 2ZC2A 3KEOA 3ZMVA 1Q1HA 4DYCA 5LRSA 3E97A 2EZHA 1FZPB 1HSJA 3L2QA 1MH3A 2HGCA 3LOCA 5FFXA 3H3UA 2IS2A 1B8IB 3ZGKA 3KP2A 4E7JA 2LTPA 1IN6A 1IUFA 4AM3A 2IEKA 1RKWA 5AONA 3G4SI 2JN6A 2HVSA 5LRRA 4GYIA 3SFIA 5FO5A 1WJCA 1BR2A 3CDLA 1SANA 1SVOA 3DTKA 3RPQA 2EBIA 1Z9CA 4A3CJ 2DT6A 1Q1VA 1KGSA 2AXTC 3FXRA 1QVUA 3ISPA 2VBZA 1D0XA 5L3CA 3QP6A 4LD5A 2AO9A 2A07F 4UVCA 2VKVA 3WTSC 1I50J 3QPTA 3FXLA 1XPXA 2JA6J 1ZG3A 2QGUA 1W7PA 4XLFA 5JHFA 3ZQFA 2YX7A 4XN0A 3ABUA 5HDGA 3ZQHA 5BS6A 3V7RA 1W7PD 1TT5B 3LQQA 4M9ZA 3FK6A 1DUXC 2KIFA 1A5JA 2IVMA 4OIOF 1PVEA 3OYAA 2M4GA 1FOYA 2YX4A 3HXLA 3B02A 2G7UA 4BY7J 3WGHA 2OC6A 2I8DA 1OMIA 5JVGF 1I1GA 3BQZA 3EQLF 2M7BA 4IPAA 2Z2SB 1UMQA 2Z5UA 4A0XA 4ZZLA 4KYWA 1N78A 3F9KA 3CJQB 4KA4A 3JRHA 5K7FA 4GCVA 3PM1A 1Y0UA 3BOQA 3ZN1A 3AG1H 6PAXA 1T98A 4DJAA 1V55H 2DOEA 1IXRC 2Y75A 4FX4A 2XHKA 3OWTA 3GTQJ 1ETYA 2FMLA 4UV9A 4DIQA 3Q5FA 1Y8RB 3SDBA 3LSMA 1V3FA 4D0PA 4BBSJ 5L3GA 5LGTA 4JX5A 3JREA 4WXCA 2DMUA 1PUFB 1PUEE 1XGMA 4MQVA 1AKHB 5EF6A 5IOYA 2V9PA 3ZQIA 2JPBA 2H94A 4A3BJ 2JSPA 1BC8C 1P4XA 4UB8C 1SMTA 3MWMA 3GXOA 1U3EM 2HZTA 2L01A 2K9LA 3P5JA 1XMXA 4R1HA 4F3QA 3BTCA 1R58A 3SEZA 2EH3A 1FX7A 2EINH 4LK1F 5DCMB 4E7ZA 2V6EA 3RZDJ 3IRRA 1R36A 2JA7J 2HZDA 4IJAA 1XGNA 4CGZA 4KIBA 4N4OB 4AVPA 2FUG2 1E3OC 4EATA 2BY2A 1FNNA 3N4MA 5D5UB 1RR7A 2L7FP 2VQGA 4KN7X 4AU7A 4LLLA 3ZP5A 2STWA 2DODA 3TDUC 3FM5A 1FBQA 2NAZA 1YG2A 3HPHA 3CCSI 4HX7A 1Y1VJ 4XRSA 3BY6A 2DCEA 3WTUC 4S04A 3CCYA 1FY7A 2E36A 2DO7A 4ESFA 2R4GA 3GZNB 1AOYA 1JT6A 3JAMZ 4P1WA 5CKTA 2R7XA 4ESBA 1YQAA 3FF5A 4I99C 3WTWC 2W4SA 2Z9OA 2JZYA 3OL4A 5GTIC 2H1KA 4BL0B 1SFOJ 3BCBA 1IN5A 4HNTA 1BR4A 2HYJA 3OYJA 3RJPA 3KX2A 2WADA 3CO6C 4YFKF 4C9YA 1O3SA 4PUSA 4NC7A 2GQQA 1XN7A 3U1DA 3VSKA 1K6YA 3K4LA 1ETQA 3I58A 4YELA 3CCUI 5HDNA 3CCVI 2KISA 2CW8A 3JW4A 4BUPA 5L3BA 3BZ6A 4NC6A 1FYLA 2OBPA 5CLSA 2B7EA 4PGGA 4N4NB 2JVHA 2KZGA 1D8JA 1MBHA 1PYVA 1Z91A 2W82A 1OPCA 2DMPA 2OZUA 5E20A 1I1SA 3VWBA 4RB0A 2QM3A 2ELHA 5B5EC 3FBIB 3HC7A 5TJJA 3RIRA 2OPTA 3H9QA 2B0LA 1W5CC 3PL8A 1ZRFA 2KKOA 2P5LC 3FXKA 3RCOA 5IPAA 2UXXA 3IAS2 1HXDA 1H0MA 2F5CA 3ERMA 3UR3C 2WA0A 2R7DA 4N0BA 5L3FA 1ZLJA 4PSWA 4RB3C 3LSRA 4X0GA 2A3SA 1XS9A 3BR6A 1V54H 3RQIA 1BI0A 2M3AA 1KZHA 4MGRA 3LA2A 4ZJZA 1DP3A 4UVBA 3RI4A 2WC2A 3I54A 3BTJA 1U9NA 2ME0A 5HVQC 5LBQA 1G59A 3IWFA 3H5AA 1UJ8A 5CVJA 4DYQA 3S1NJ 4RDUA 1BL0A 4RAZA 3TW6A 1S72I 2PMHA 2P5VA 3FX3A 1PDNC 4FCYA 2A5YB 2HYFA 2F5FA 1NTCA 4OIRF 2EZKA 4ZYAA 2NNYA 4CUGA 1WJDA 3T1BA 2HTJA 1TQPA 2MSYA 4CH7A 2V4JC 3GTPJ 2R7UA 3H3ZA 2MBFA 3S2WA 3AG4H 1G3WA 3BR5A 1JE8A 3OYMA 4PGHA 1R1TA 1YS6A 1X3ZB 4A2UA 2RQQA 3GF2A 4RAYA 3IKVA 2Q0OA 3BG7A 3C1DA 4CICA 1JKRC 3OOUA 1VQKI 3GLLA 5E1XA 1Y6IA 2EB7A 4RLFA 1B1BA 2D1HA 4OIQF 2VODA 1P7IA 5EZGA 2KL4A 5ED4A 3CC2I 4HOBA 2ZNZA 4JBAA 1JUPA 3DCFA 4ENKA 1G3TA 4ZYEA 2DA3A 2Y2ZA 3HRMA 4MFEA 4M3FA 4EMSA 2EIJH 2VPRA 3CJSB 2DMQA 4I98B 3JAMK 5K5QA 3CCQI 2BBYA 2STTA 2QBYA 1WCMJ 3H5NA 4AIJA 4A3DJ 1VQ4I 3DLAA 3HRUA 4ZYDA 3LFUA 3H9JA 3ERED 5KK1A 4XR6A 3R0AA 4E6KG 3EETA 2KP6A 2OUMA 3OR1C 3DBRB 4Y52J 3ZMTA 3RYRA 2W84A 3K1PA 4MIMA 1HSTA 1Y1WJ 4ZYGA 2K7LA 2DFHA 1CF7B 4EJUA 3COAC 2LLKA 1MJAA 1KQ9A 1UHWA 3KFWX 1D3YA 4PFPA 5E1ZB 4RLQA 3QAHA 4BBRJ 2JVGA 3P9KA 1IDZA 2WTEA 5C4JJ 1ETXA 2Y69H 5E1WA 3OIQA 2BXZA 5JI6A 1Z0XA 2XKOA 2X6WA 5K7HA 5IYDJ 1DU6A 3JRIA 2HQ5A 4CSWA 2XF7A 2IS1A 1X3WB 2DFIA 1OYYA 5J6XA 1GT0C 1E3PA 3FHNA 2LKPA 2JA2A 4M6YA 2KRHA 4IQ4A 1QZYA 2JK3A 2QQ8A 1MMNA 4XKWA 1MMDA 3GZ5A 3L2UA 1FOKA 3RKWA 4P5OA 3J80Z 3MMYB 2VQHA 4WXHA 4BEHA 2L9RA 3HGGA 2KRCA 2LNBA 4IHSA 2OQRA 2Y9YA 1Y39A 5H6QA 1U0JA 3KEQA 1FLIA 2VT3A 3RZOJ 4D7NA 1GV2A 5IYCJ 4GO1A 1FOWA 1YYVA 1P6RA 1Y8QB 3CC4I 4UNOA 2X48A 1IAWA 3OIOA 1ON2A 1GVJA 2N8GA 2O9LA 3HKZN 3WHCA 3J7AO 4M72A 3H0DA 2VJ5A 3CJTB 2XPUA 3E6MA 3WTXC 1R4NB 2H8RA 4E7KA 1G4DA 2PMZN 2E1MB 2CQ7A 2RAEA 3BJAA 3WGIA 4IHVA 2KJBA 2P8TA 2HS5A 2VUMJ 2LFBA 2P0WA 2KMUA 1IJWC 2HR3A 4QPQA 2BY3A 2BEOA 3E7LA 1V5EA 2F5DA 4ZYHA 3S1QJ 1C0WA 3CMMA 3WODF 3V8JA 4ASNA 1ODDA 1U5TB 4I09A 4HV6A 1TWFJ 4KICA 3OYNA 2X9DA 5M3FJ 2ECCA 1R5HA 2IT0A 1UG0A 4XRMA 3WTTC 3FXQA 3LSTA 3L2RA 1LE8B 4E7HA 2PX9A 2DOAA 3GTOJ 3GFJA 2CH0A 3I4PA 3B73A 2IJLA 1EF4A 4BGDA 1W7PB 5HS8A 1LQ1A 3HZJA 4FTHA 2HQAA 2GZWA 3U21A 3FXOA 2FMYA 3PJRA 4G7OF 4NNJA 3JSPA 1V5FA 2EV6A 2P7VB 4DYRA 2R7OA 2OQGA 3E6DA 1RKTA 1LDKB 1APLC 2O8KA 4AD9A 2ZMEB 1ZN2A 1BI2A 4LB6B 3BQYA 3HSRA 3GW2A 4OINF 4C3IJ 2XAHA 4L5JA 2CS3A 2CV1A 2WB1N 1LVKA 2ACJA 2FJ1A 3BG5A 1Z6RA 4NDLA 4HF2A 2E1MC 3WE3A 2K9NA 1UFMA 3DF8A 4WK8F 1OR7C 3F6OA 5ICEA 4G6TB 4Y3OA 1SAXA 4IHYA 3T5XA 1DGWY 3MKWB 2BYVE 3BG3A 1MBGA 3FMSA 2F6CA 5ICFA 1Z21A 3AL0B 1EKEA 1PJRA 4LFUA 2OAZA 2K9QA 4AVZA 4F93B 4EJOA 5HNHA 1RESA 1WHUA 4B43A 2FBIA 3K70C 2KHMA 4A3GJ 1WSUA 3ZXSA 2XC7A 1TWAJ 1WH5A 2E19A 1HW5A 2MW8A 4DGWB 3G73A 4IHWA 1FTZA 3K1MA 4B3AA 3DU6A 2KIUA 1E3HA 4XQFA 4AIKA 1VQLI 4KITB 2EV0A 2VBXA 1N75A 1GXQA 4CCJA 1TWHJ 2WY8Q 5C3EJ 1WH7A 2F2EA 4Y4RA 4OMZA 3SZGA 1YJ9I 2R92J 2A05A 4UUVA 3WTZA 3Q9VA 1I3QJ 5ILVA 2CQXA 1X58A 4MQ9F 3PIOF 5LGUA 4BS9A 1DGRM 5CPRB 4RA2A 2XGXA 2PMUA 1L3LA 3LA7A 1G6NA 4UUSA 3HJEA 2DK8A 2G0EA 2QKLB 4YFXF 1WJEA 1FIAA 3MD2A 4LIVA 3SYTA 4XICA 4FISA 2H6BA 4I6ZA 2LOOA 1DDNA 1SD5A 3BDDA 1O3RA 1QRYA 3GBGA 1R1VA 1VQ5I 1ACIA 4B3XA 2MFZA 1JHFA 4QSHA 3CJRB 2R5YA 1LB2A 2W7NA 5M5WJ 4MFDA 4D5FA 3ASNH 1WJAA 2FEZA 4E7SA 2Z33A 4M3DA 1KQ8A 3IV5A 2ZXJA 2V1NA 3MZ8A 1JKOC 4UB6C 4XM3A 3BZCA 2OTJI 5EEGA 2MH9A 2D45A 1ZR4A 1K78A 3M8FA 2XGEA 2LP0A 2XVCA 3WE2A 1LVAA 1S6LA 1XTAA 3H92A 4LITA 4NQWB 3U9GA 1REPC 3NAUA 4LIUA 3L2CA 2E2JJ 4BJ5C 2M0MA 2R7QA 3HOWJ 1XD7A 1JTXA 1J2XA 1HC8A 4AIDA 4ZH4F 1HOMA 4LMYA 1K79A 4UXNA 5IYBJ 3LSGA 4QLCU 3GO5A 4OWRB 5BNGA 2DFEA 1TLHB 1KA8A 1FIPA 2E71A 2FE3A 3PQKA 2LY2A 3J7ZI 3S14J 1K7AA 3R6SA 1Z7UA 4KIGA 3HTSB 5FROA 2J5OA 2HXIA 3QYFA 3S8PA 1MIJA 1M1EB 1O3TA 5CVUA 2ZBKA 3F72A 3HGYA 4XLNF 3KZYA 5BQTA 3CO7C 3MKLA 4XLPF 4IZZA 1W0TA 1R6RA 3K4KA 2KRFA 1L0OC 2BVLA 1JTYA 2K4BA 2MGQA 1U5TC 2FD5A 4M9XA 2HPIA 1RUNA 4B09A 3EUAA 4G7HF 2R7TA 3MAJA 2GXGA 3BJOA 3CLQA 1CF7A 3BPXA 2H27A 3D5RC 1BOBA 2LY1A 2GXBA 5KAIC 1WZ2A 2IS4A 4U88A 2QWWA 4W1UA 4IF4A 3WU1B 2X6YA 5HS7A 3A01A 1OCOH 4U7BA 3T8RA 4LG0B 2VC0A 3LMMA 3HIFA 1OISA 2MLKA 5KVRA 1WRJA 4PK4A 4Y33A 1XDUA 2Q2EA 1BC7C 5DEQA 4FETA 1E0EA 2VI6A 2BZTA 2XAFA 2V1XA 4G8XA 2PEXA 1B59A 2FOKA 5FKOA 5FJ8J 1ZRCA 1A36A 4HZFA 3GCMA 3OL3A 1ETKA 2MD0A 5ICGA 1XSXA 5KAFC 1W36D 1U2WA 2QQAA 2JT1A 2RN7A 4IOCF 3J7AY 4P96A 4BACA 3E5UA 4BU2A 1G3YA 3KLNA 3HSEA 2XAGA 1ZK8A 5JLWA 2MH2A 3TP0A 4NQWA 2YUSA 4O3MA 4N9IA 3VPRA 1P4WA 1WQ2A 2G9WA 3P9CA 4H4KC 1IDYA 3O8HA 4JK1X 4A3EJ 2VONA 3O2PE 2NOJB 1F5TA 1T0FA 3DWLE 1KQ0A 3O8GA 2DQLA 2X6OA 2Z16A 3H0GJ 5L3DA 3HOVJ 4HV5A 3S2DJ 5HLHA 2NS7A 3DQVC 2M4KA 4D5CA 1BI1A 2DA5A 2QCOA 1SD6A 3K4BA 4OAYA 2EFNA 3JTGA 4BE2A 4ZTFA 1WWXA 2M1BA 4C3JJ 1TNTA 2CV0A 2JA5J 3Q0WA 1GHCA 3F8NA 4PJ0C 2PN6A 4HNUA 3OYBA 2CUJA 1H8AC 1IRGA 3NQOA 3CCEI 4FE7A 1VF9A 2GA2A 1X2NA 2WV1A 2QLZA 4HF1A 1W5TA 1D5YA 2M9HA 3BR3A 1IC8A 1MBKA 3M4OJ 2X1DA 4LLGF 2QF7A 1VZ0A 2L4AA 3IP4B 1S7EA 1XSVA 4EV0A 2NVYJ 3ZQQA 3AKZA 2KPMA 2ZNYA 1IN8A 2LH9A 2DTZA 2F4MB 3HOSA 2ICWG 1T0FC 4CYCB 3HOXJ 2LYCA 1LFBA 4LB5A 2ECBA 3M3YJ 2OJED 5M3MJ 1A6QA 4B8XA 4HYEA 5B66C 3MFKA 1D5VA 5FRNA 1ENHA 5EEAA 3VB2A 2VJJA 4CCOA 3CCJI 2FBHA 2M34A 1BA5A 2JUGA 4EGYA 1MDMA 1TTYA 4E7IA 1Z1DA 1S7OA 2CO5A 4MO7A 5FKMA 2QSGX 1ZELA 3E1SA 3FKJA 2A6EF 3I53A 4NBQA 2ZMEA 3DPTA 4M3EA 2DFFA 2EIKH 2VE9A 1YIJI 2XDVA 5JFRA 1PP7U 3OYFA 2QYOA 3KCCA 4OAZA 4BEHB 1FP2A 4M9SA 5JHUA 4DBRA 1B72B 3PO2J 1TNSA 3BROA 3PFYA 4FT8A 4HSRA 4GXOA 1JXSA 2L7KA 2XAQA 3BPVA 1FYMA 2PJRA 2JPCA 3HOYJ 5D6EA 1YX5A 5DS9A 2FQ3A 2VLAA 2A68F 3DEEA 5KCMA 4KT6A 3E6BA 3BR1A 2EIMH 2NOGA 1D0YA 3S16J 3F0CA 4U0VA 2XGDA 3F8MA 3JRCA 2DK5A 1S9HA 4X1EA 3I56I 1VTNC 1GUUA 4ZTJA 3PUBA 2O61A 2O7OA 2R7VA 5IT9Z 2WAQA 2VKEA 2NS0A 5HLIA 1SFUA 1MH4A 3BP8A 2E2HJ 1SC7A 1LKXA 5DCMA 3I9V2 1KU2A 1OLTA 3MZHA 3I4NJ 2OV7A 1JKPC 3KP7A 4UY8I 3I59B 2L7ZA 3OS1A 3OSFA 1P7JA 2CUFA 1ZREA 3SZTA 1SFEA 1YJNI 4V2GA 1TL8A 1ZAOA 1TT0A 1FYKA 4B47A 4C2TA 1FOXA 2LRDA 2LF8A 2O3FA 5J40A 5K7ZA 3IUOA 4BXFA 2DQRA 1F1ZA 3IL2A 2CW7A 1VQOI 3HHGA 4IEJA 2DPUA 4WCGA 5B3SH 3C2GA 2VT2A 2VB6A 1B6AA 5EYRA 3V8LA 1LDDA 4BNCA 1YX3A 3G3ZA 4F92B 1ETVA 3OY9A 1OR7A 3S3MA 1Z3XA 2AQEA 3TOBA 5GADJ 5FKLA 5E3LA 1W4MA 3LA3A 2XF5A 2Y30A 4XK4A 3OS2A 2IGNA 2R7RA 4L9JA 2PJPA 4ENMA 3IKTA 1D1BA 3FISA 1TWCJ 2LVSA 3M1CA 2HPMA 1OFCX 1ERDA 1FC3A 1W36C 3H1CA 1TQMA 2IGKA 1MNDA 4CDGA 1D1CA 2FOWA 1K6OA 1X2MA 1R1UA 3I5UA 2EQRA 3D5LA 4GDFA 1XG1A 2W00A 1R49A 2DW4A 2P5KA 3BR2A 1HW1A 3AL0C 3C2HA 5TISC 2I10A 4LG3A 3GLXA 4A3KJ 1E2XA 2QSHX 1ON1A 3K1NA 4ABZA 4EJTA 5FGMA 2BHZA 2GIZA 1D1AA 3CUOA 5J8FA 1T38A 3PNTA 5HODA 3B6CA 3ABTA 3QP5A 1IW7F 3GFLA 2CFXA 2K85A 1QBJA 1H89C 1LEAA 3BLYA 5KNLA 4AWXB 1U78A 3QRFF 2BOLA 2CW0F 3A1YA 3K70D 2Y48A 1FP1D 1U9OA 1UAAA 3H36A 3LAJA 2QENA 5M5YJ 5D4RA 1V5GA 5ILUA 2KJCA 1BBYA 1OYIA 2WB1A 4GGGA 2H8WA 2L9VA 1LE8A 1NK2P 5HS9A 4R8HA 3RSNA 2XSDC 2R7ZJ 2X1CA 5B1AH 1T39A 1JUMA 2HVQA 2DYRH 2V6CA 4Q5SF 3HEFA 2R0QC 2QA4I 5K1YA 5EG0B 2K4JA 2BGCA 1BR1A 4A93J 3FDYA 3UKGA 1OQYA 2MG4A 3L2VA 1U8BA 4KMFA 3KP4A 3GUDA 2DA2A 2GA1A 1DP7P 2K5CA 5J8CA 5M5XJ 4ZZDA 5IT9K 2DA1A 2VJIA 4HF0A 3WTYC 1VQPI 1JI8A 1B9NA 5KHDA 2JWTA 2MABA 2L9NA 3BWGA 1BI3A 2CWEA 4YEJA 5BPIA 1ZR2A 4RAGA 3KE2A 3HPGA 2CRGA 2O5RA 3JRAA 4RB2C 2JRTA 2ZJPF 1EH8A 2KDOA 2LC2A 2OU2A 2ETHA 1EJ9A 4L18B 1R71A 3M07A 2EZIA 2VQLA 2E60A 2RKHA 1QO0D 3QPSA 2B9SA 5FLVA 1OCZH 1Z77A 5FD5A 4RBOA 2FQ4A 2B63J 2XV4S 2VL8A 2IA1A 4H0EA 4RAFA 3CP2A 1SD4A 4Z6YA 4LLNA 5EDNA 2VC1A 4W97A 1MNEA 5DUKA 2PMZA 4LGWA 4IL6C 1YW8A 1XMAA 1QVTA 1ETOA 1XMKA 4A5MA 5IP9J 2BW3A 3JR9A 2XROA 3VEPA 5DD8A 4HA8A 1V4RA 3ASOH 2H09A 4X6AJ 1T6SA 1SAUA 2M8GX 1U5TA 4XLCA 4M3GA 4XONA 3T0YA 3I4MJ 4RGRA 4MTEA 4EQQA 5TGTA 2M8EA 3ELKA 1Z05A 1X1PA 2DT7B 3ML6A 2LY9A 3PUFA 4CCKA 2DAOA 4G7ZF 4XN3A 3VYUB 4CCLA 2ZB9A 1SFXA 2DMTA 2L54A 5E8IA 2R3SA 4ENJA 4N9HA 1W0UA 3BG9A 2KZVA 3OIPA 1H88C 3CDHA 2EPFA 3HM5A 1X1BA 4PJMA 1POGA 2YR2A 3LSJA 2HXOA 4R79A 3CLOA 1X19A 3KYLA 3K6GA 5J4YA 3GMEA 2KQRA 2L3DA 4I0AA 2UXNA 2AHQA 2VOPA 1TW3A 3D5SC 3F22A 1X1DA 2K9MA 2FU4A 2ADUA 4ON0A 3CUQC 4LOCA 4G9YA 3SZPA 4JP0A 1IRXA 4E70A 5LEJA 2ZJQF 3W2VA 2IRFG 2H6CA 2W85A 4G94A 2XB0X 1WVRA 5D8KB 5DV5A 2GOMA 2X0LA 3TO6A 4PJJA 1J5YA 3AAFA 1TBXA 4EVIA 2HFHA 3BJ6A 4UVAA 2PG4A 2XAJA 3BTLA 1PUFA 4HPQA 3VOEA 1JJ8C 2VBYA 3CJNA 4NHJA 4AUXA 3FMRA 2RNGA 3ABLH 4L0YB 1D0ZA 2ZCWA 3J81Z 3GYHX 2EILH 2TDXA 1S3JA 1B9MA 2J5PA 1WFXA 5H6RA 3CUQB 2EFOA 3DKWA 1B8IA 2PI0A 2P7CB 3K10A 3MCZA 4BDYA 4G6DA 3S3NA 1IN4A 1P4AA 4KIFA 1DPRA 3K4CA 1PP8F 3GTGJ 3GFIA 1T2KA 5C4XJ 3HB9A 3WU2C 2IGMA 1OCTC 4I01A 1HA8A 3F23A 2JMWA 2BV6A 2NRAC 2HQRA 1SD7A 5E3MA 2OCEA 2WV0A 3HRSA 2ZFWA 2LSOA 5EZHA 4F7ZA 4A5NA 1UHSA 1H9GA 4PDKA 3T8TA 2FBKA 3FHZA 1IUYA 2EA4A 4IXAA 2A6TA 2COBA 5GAHJ 5FLXK 4JOMA 3VYSB 3CTAA 3K4MA 5E3NA 4UUSB 1LFUP 1U6GA 5DYMA 3FKIJ 3WGGA 3FXJA 4XRFA 2ZJRF 3K2AA 1A31A 1I5ZA 3G1MA 3FWEA 3QYBA 4D7MA 1I27A 3CF2A 4P55A 4C30A 1RUOA 5LFAA 1Z67A 2IGOA 2DYSH 3BG6A 2GAUA 3RPUD 3UNGC 3GTMJ 4AYBA 2CQNA 2R7SA 3QPLA 3QU6A 1KYZA 1MW7A 3X2QH 2IA2A 2PFBA 2A61A 3GVAA 1XB4A 2FSWA 5LHIA 1HW2A 4J19A 4OU0A 2KIQA 4IKFA 1BM9A 5K5RA 2R5YB 3V42A 3GZ6A 2COMA 3L9FA 2W57A 3HOZJ 5J1RA 1VQMI 3CMAI 3FBNB 2MA3A 1S8NA 3DTIA 2TCTA 3SFZA 2MD5A 2Z1DA 1I6HJ 5LHHA 4A6DA 3HTUA 3ZRGA 1UG2A 1AWCA 3PSIA 3I64A 3B6AA 2VBWA 2BXYA 1RETA 2FNPA 3KEYA 4A3IJ 1IF1A 3ZPLA 1XDSA 4PJNA 2DTRA 3SDGA 1S5LC 3V7SA 3F21A 3WU0A 2F5VA 4IVNA 3DBLB 3H35A 3LSHA 4Y17A 1EA3A 3I3LA 2EZLA 4AIHA 3NWSA 3WG9A 3LSKA 2OD5A 4Q48A 3BR0A 4CCMA 3J7YJ 3MQ0A 5F0FA 2E35A 5J1UA 3GWZA 3HOUJ 3OSGA 4PZJA 3MVPA 3QQAA 1DU0A 1VFCA 1J9IA 1F9NA 4YIIA 3S3OA 4WF2A 1OCRH 4S05A 2L9SA 2ZXHA 3RKQA 4CZCA 3G71I 2ZO4A 4YRVA 3JRFA 2BVMA 2L02A 3QWLA 1TW2A 4MEYF 4NUBA 1A35A 3LWFA 3ZQGA 4Y7NJ 5CQGA 2NVXJ 3EYYA 4B1RA 2D1VA 3ROUA 5HLGA 1T08B 4LK0F 2O8XA 1BW5A 4A0YA 4O5VA 1FMVA 4ENNA 4EJWA 1YRNA 3W3CA 1I39A 3DBHB 1HCRA 2OTLI 5FRMA 1ZGWA 4DBQA 2H1LA 1R23A 4CXFA 1T95A 4Q47A 2M45A 1X1AA 3PSFA 1I6XA 3W6KB 4P9UA 1FWZA 3ZQ7A 4A3JJ 1T56A 2CGPA 1MGTA 5FLMJ 3EPZA 3HYIA 4EJVA 1T33A 2XSJC 3RPUA 3VDXA 1LUJB 1BN5A 2HOAA 3H3VK 5F0HA 2XRNA 3R4KA 1YW7A 2L0KA 2W48A 2HKXA 3CP8A 2EFPA 4BAYA 1P9QC 4S0HB 1R00A 1X4PA 3BZKA 4XOTA 4C2UA 4XIDA 2DA4A 1U8RA 1TWGJ 1QZEA 2XKPA 3L2WA 2ELJA 2LK2A 2P6TA 4M3BA 3DXJF 4JQFA 1XCBA 2FNAA 2EJRA 5BMZA 4IX7A 2ESHA 1H9TA 2XRLA 5CVRA 5H2FC 2ELKA 3W2WA 1JGSA 3CUQA 1IXSB 2E5ZA 3ZCOA 4OMYA 2E7XA 3GTKJ 3PNVA 5D8LB 2CU7A 4V2FA 3HL2A 4HG2A 4AYBN 2PBIA 3DP7A 2HNHA 1K4TA 1VQ8I 2FF4A 4HDUA 2V26A 4PCQA 3KP5A 2M30A 5F04A 3PNYA 4WX9A 3GFMA 1QPIA 3H5RA 1IRZA 3V8KA 4BHPA 3ZQLA 2VOOA 4F91B 1JJ6C 1YJWI 2WWYA 3ONQA 3KETA 3OYIA 3KPHA 5DD4A 1IO2A 4BXUA 1G2HA 2CQQA 4E4HA 1YOVB 2O0YA 3IH2A 3DV8A 2R5ZA 4MHGA 4L9TA 1RPWA 1Z7LA 2QQ9A 4KISA 2OCCH 1VI0A 1DQUA 2VPLA 3SEQA 2GXAA 4UUTA 3ESWB 2DA6A 2IAIA 4GRIA 2HI3A 5E8GA 1NK3P 3A0HC 3TQNA 5JLXA 4DOZA 1YE9A 3A01B 4RM3A 5F1JA 3ABMH 4KDPA 3WG7H 1QPMA 4NB5A 2X6XA 4XKCA 1R5GA 2I5UA 1QHGA 1W5SA 2F4OB 4IRHA 2HYGD 4I76A 3E5XA 3P9IA 1ZGJA 5GTHC 3JRGA 2Q2EB 3HKZA 2YU9J 2D5VA 3V4GA 1WIBA 4BH9A 2Y0SA 5LLQA 2HEOA 4RB1A 2DDBA 3L09A 3M1EA 3L00A 1ZRDA 2E34A 5D5VB 3MEXA 3ZN0A 2BY1A 3KYCB 2LBFB 4ZDOA 2XF6A 2KIMA 1FJLA 2DI3A 2AXLA 1FBUA 1F43A 1AA7A 1GV5A 3CMEI 4HX8A 1YS7A 2NNNA 3F6VA 5F1RA 5DCFA 1HDDC 3NEUA 2G7HA 5F27A 1DPUA 2JRMA 3FM3A 5E3OA 3OR2C 5TRDA 2GM4A 5LEKA 2VN2A 1S7AA 3OYKA 3PFIA 2KT0A 3BC8A 4AC0A 1NG6A 2GIVA 3EUKL 3QOEA 4XRSG 4BQNA 3KLOA 2ME6A 3J80K 1R22A 1BJAA 1CGPA 3M9AA 4QPOA 4I2OA 4A3LJ 4KN4X 4M6XA 2R7WA 2BW3B 4IRGA 1STZA 2OF7A 1Z3YA 2X51A 4XKVA 3OMYA 3A0BC 1YLFA 3KP6A 3DEUA 3CF5F 1JGGA 1YI2I 3G6EI 4CHUA 3H9GA 5K5OA 2XUBA 3EUHC 1VQNI 1E17A 4B44A 3HUGB 4CCNA 2JJ7A 2HOSA 2JQ7A 2A5WA 4BJ6C 1J09A 5GAGJ 4L0ZB 1MNMC 1N25A 2R5ZB 1HF0A 1HKTA 3HUGA 4G6QA 3JCUC 5F08A 2VKHA 2O03A 2EA2A 5J47A 1G3SA 5EG0A 4LG0A 3I55I 2ID3A 4XL9A 5BOXA 4I0BA 1WKMA 1YW9A 3G1LA 3LQRA 3LFKA 4JYKA 4XLEA 3S32A 1OJLA 1USSA 2DDAA 3G2BA 3OYHA 4A3MJ 3S2HJ 4QIWN 2V79A 5GP9A 2DPDA 4F52A 5F6FA 3FMQA 3LNQA 3RKXA 3ZMDA 2UUZA 3VFZA 1TP4A 3ZMZA 3OV8A 1RC9A 2ID6A 1R4MB 3R0JA 3TMOA 1SVLA 2VE8A 3HHHA 5EJCA 3I0TA 2K3PA 4KUMA 2WAQN 4FASD 2PJRB 1ZLKA 4BY1J 1RI7A 3TDZC 2QSFX 1ZHFA 1UELB 3D0SA 4II3A 5HOOA 2RQPA 1JKQC 2CYYA 1Z6TA 1SMYF 3C7JA 1MD0A 2NS8A 3TP3A 3J81K 3K4NA 5H20A 3VYTB 3S93A 2V1UA 1WPKA 1P2FA 3KZZA 3FXUA 1BJZA 4A0ZA 5D4SA 2E7WA 3AG3H 3U2RA 1OCPA 4MEXF 2GBYA 2RDPA 2UWMA 1TQIA 2KLOA 3E6CC 1ONVA 1WJFA 4EM0B 2F4IA 4P9FA 4K2EA 2ZFUA 3F8BA 4HSTA 2UV1A 2QBYB 2D2WA 4BQAA 5IP7J 3CESA 3DTEA 5ICCA 1WJBA 2DT5A 1RR8C 2RNJA 3CDIA 2IP2A 4ZDPA 3K4JA 4HX4A 4DQ2A 4KFCA 2HKOA 2W24A 2ZKZA 4YIRX 3R61A 2E2IJ 1QA6A 2RREA 3KZIC 3HG9A 1O3QA 4D9JA 4F55A 2Q1ZB 2Y0SN 4MNUA 1ETWA 3QPHA 1J59A 2L2OA 2XIGA 1IN7A 4A12A 4XNFA 3DPUA 1BIBA 2FRHA 3BTIA 4UV8A 3LAPA 3Q0UA 4KNYA 2AS5F 2K40A 5DM6F 2YS9A 3KIOA 2HQNA 2NVUB 3TO9A 1IGNA 2HWVA 3DKXA 2X4HA 2KDZA 4QTRA 5F0CA 3DKYA 1YFHA 4B4CA 3ZMSA 1OKRA 1GVDA 4Z2YA 5IY5H 3GTJJ 5HNFA 4A69C 1RRJA 3FK7A 3MN2A 2F5EA 2ZSHB 1BOAA 1USTA 1T8IA 4HDVA 2WBMA 2FA5A 4EGZA 1ZARA 4J01A 1LNWA 1MJ9A 1IRFA 1S29A 1KU7A 4IOAF 1VNDA 4XLAA 1MDMB 2E1OA 2QQBA 2LMDA 4XSZF 4U0YA 1HKSA 4KJZA 4II2A 3RTRA 1TC3C 4WWCA 3QYEA 5FKKA 1IV6A 1MSFC 1ZH5A 3DU5A 3ZR8X 3OYLA 1IZ1A 3KYDB 2M7AA 5CYVA 2V1DA 3GEZA 4BYYA 3NRVA 3VODA 2TRTA 4HQEA 3CC7I 2V7FA 3MKZA 2IBDA 4HQMA 2Y31A 2EFQA 2YPRA 4CA0A 2QKMB 3PIPF 2DA7A 1FSHA 3LSPA 1MBFA 5FD6A 2HU9A 5JR3A 1K61A 1BIAA 4ZDLA 5IOZA 2MYSA 5LGNA 4MLOA 1LFPA 2JTVA 1D8KA 4BHCA 2ISZA 1MKMA 3TKYA 3EYIA 1WI9A 3C18A 5CJ9A 4LJZF 1ITYA 2LD5A 3ZOBA 3KP3A 3E3VA 1JHHA 1X3UA 3P7NA 3AFHA 3HDDA 3CCMI 4HRIA 3JTHA 1ORKA 1W1WE 5GAEJ 3E0JB 3FZVA 3A02A 4Q4ZF 2VASA 1O57A 4M6VA 3Q0VA 3N97A 2M5WA 2FXAA 2IPQX 4JX6A 1IV8A 4DNCA 3I59A 3PO3J 3RDIA 3TEDA 3A4CA 4C2MJ 3SJMA 3R60A 4BKXA 2WAEA 4GYGA 1GXPA 2ZMEC 2A6HF 1FEXA 4XSXF 3HOTA 4BHBA 3S1RJ 4BE0A 1X1CA 2DMNA 4HEA2 3OOPA 4EM1A 2MLGA 4HAMA 1QZZA 1Y0NA 4UHTA 5BPDA 2OZ6A 1CQTA 1FPQA 4EEFG 1R7JA 1XC5A 1ZGAA 4CO8A 5EGOB 5CQEA 1YHQI 1FBSA 1KU9A 1SFKA 5LHGA 1SVMA 3W6VA 4L5EA 1YIOA 2K27A 2XAUA 4ESJA 2LG4A 3EDPA 1HLVA 2V9KA 2QVOA 2VXZA 3REOA 1AKHA 2HDCA 1HDPA 2KFDA 3WTVC 1OCCH 2JSCA 2CUZA 1I3AA 1N77A 3IC7A 1B72A 1ZG1A 4YIFA 2VIXA 3V7CA 1ZKGA 1TZLA 2HOEA 5E18F 5C44J 5A2QZ 1F4KA 3PQJA 2JUCA 4HBLA 3DPLC 2ZJ2A 4FHTA 3W6JB 5ERIA 2CMPA 1VQ9I 2FX0A 2P4WA 2XB5A 5J4VA 4DZPA 1KONA 1LEBA 4YG2F 2WAFA 1RZ4A 3O6BB 5IT3A 1J75A 4RS8A 2YU3A 5JVTA 2CFOA 3GX4X 1JT0A 3ABKH 1NHAA 2EWNA 2NYXA 1QHHD 5J3LA 2QUFA 2YSRA 1EH7A 2ESNA 3JRBA 1G8XA 4XLHA 5IP6A 5CVVA 4HLXA 3OYEA 1WJ5A 2JA8J 5HDKA 1GLNA 2XPWA 3C3WA 3K2ZA 4BQOA 4IO9F 3Q9SA 3OS0A 4U0WA 4CYCA 3NARA 1VQ7I 1K83J 4IHXA 3DEWA 2LKSA 3L7WA 1HQCA 3ECHA
chains in the Genus database with same CATH topology
1MMSA 5GAEJ 3G4SI 5GAHJ 2E34A 3EGVB 1Y39A 2ZJRF 1FOWA 1VQLI 1S72I 3CMEI 3CC4I 2FOWA 3CCJI 3CCSI 1QA6A 2NXNB 1YJ9I 2E36A 3CJTB 3CCLI 3PIOF 1YIJI 1FOYA 1YHQI 5DM6F 1VQKI 1VQMI 3CMAI 5JVGF 3CF5F 1YI2I 3G6EI 3CC2I 3CCRI 1VQNI 2K3FA 4IOCF 1ACIA 1VQ5I 2JQ7A 1VQ8I 3CCQI 3CJSB 3I56I 5GAGJ 3CJRB 2ZJQF 3CJQB 4V19K 2H8WA 1VQ6I 3CCUI 3CCVI 3CD6I 1VQ4I 4IOAF 3I55I 1YJWI 2OTJI 2QA4I 3DLLF 1VQ9I 4UY8I 3J7YJ 1HC8A 2E35A 1YJNI 3CC7I 5DM7F 1VQPI 1FOXA 3PIPF 1YITI 3J7ZI 3G71I 1VQOI 3CCEI 2ZJPF 2QEXI 4IO9F 1VQ7I 5GADJ 1WIBA 2OTLI 3CCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMS A;  5GAE J;  3G4S I;  5GAH J;  2E34 A;  3EGV B;  1Y39 A;  2ZJR F;  1FOW A;  1VQL I;  1S72 I;  3CME I;  3CC4 I;  2FOW A;  3CCJ I;  3CCS I;  1QA6 A;  2NXN B;  1YJ9 I;  2E36 A;  3CJT B;  3CCL I;  3PIO F;  1YIJ I;  1FOY A;  1YHQ I;  5DM6 F;  1VQK I;  1VQM I;  3CMA I;  5JVG F;  3CF5 F;  1YI2 I;  3G6E I;  3CC2 I;  3CCR I;  1VQN I;  2K3F A;  4IOC F;  1ACI A;  1VQ5 I;  2JQ7 A;  1VQ8 I;  3CCQ I;  3CJS B;  3I56 I;  5GAG J;  3CJR B;  2ZJQ F;  3CJQ B;  4V19 K;  2H8W A;  1VQ6 I;  3CCU I;  3CCV I;  3CD6 I;  1VQ4 I;  4IOA F;  3I55 I;  1YJW I;  2OTJ I;  2QA4 I;  3DLL F;  1VQ9 I;  4UY8 I;  3J7Y J;  1HC8 A;  2E35 A;  1YJN I;  3CC7 I;  5DM7 F;  1VQP I;  1FOX A;  3PIP F;  1YIT I;  3J7Z I;  3G71 I;  1VQO I;  3CCE I;  2ZJP F;  2QEX I;  4IO9 F;  1VQ7 I;  5GAD J;  1WIB A;  2OTL I;  3CCM I; 
#chains in the Genus database with same CATH topology
 1B4A A;  1YRN B;  2CQK A;  2L5Q A;  2DLL A;  2X1E A;  2E1C A;  3F3X A;  3EGV B;  4CYD A;  3TBI A;  2M0C A;  4ZC3 A;  3MKY B;  3IH3 A;  4BXX J;  4KMU X;  2CUE A;  5D5X B;  2ZXI A;  1WI3 A;  1Y56 A;  3F8C A;  2LR8 A;  5B1B H;  3GTL J;  4RGX A;  1EH6 A;  2BHY A;  2DN0 A;  3S15 J;  5EGO A;  4ITV A;  1QGP A;  1F36 A;  4E7L A;  2Y0M A;  2R7F A;  1YO5 C;  1GDT A;  2LDU A;  3IRQ A;  2EK5 A;  4RM2 A;  3MZY A;  2Z3Y A;  3ECO A;  5GPC A;  1A6I A;  2LF7 A;  4D1Q A;  1AU7 A;  5D5W B;  4FE4 A;  1FSE A;  5LD2 C;  3RQ4 A;  5D6F A;  1QQI A;  4HW0 A;  3U1K A;  5FLX Z;  2GOX B;  2CJJ A;  3FIW A;  4L9V A;  4QWQ A;  3OYC A;  5ILS A;  4KT5 C;  4O6J A;  2DJI A;  2BE5 F;  5DUI A;  4JX4 A;  3M8J A;  3W2A A;  2K9S A;  3SQN A;  1JUS A;  2CG4 A;  1RNL A;  1R9T J;  4RGS A;  2A69 F;  1NG7 A;  2VKD A;  4XMY A;  4Y15 A;  1YTY A;  1X4O A;  1MBE A;  2XPV A;  3K9T A;  1VQ6 I;  3CD6 I;  9ANT A;  4IRI A;  2X85 A;  4HLY A;  4I02 A;  5A2Q K;  3OYD A;  4M74 A;  3JRD A;  2BY0 A;  1ZQ3 P;  2K86 A;  4A3F J;  4XOP A;  5DTD A;  4I7H A;  4FX0 A;  1ZTR A;  1IG7 A;  3A03 A;  4OOI A;  1J0R A;  3SXY A;  2HTS A;  4XOR A;  4MTD A;  3DLL F;  1EV7 A;  1UB9 A;  3QOD A;  3O3K A;  1UCR A;  1BW6 A;  4C3H J;  1FMW A;  2P81 A;  2IA0 A;  4PFO A;  2E1N A;  2M2E A;  4DZJ A;  2Q8K A;  4U87 A;  3WHB A;  5E79 C;  1MJB A;  5DM7 F;  1SEU A;  3BT9 A;  3RKY A;  2UZK A;  3VSL A;  1XSD A;  3LSI A;  1NH3 A;  1MBJ A;  4EM2 A;  2K02 A;  3Q3S A;  4XKB A;  3D1N I;  1R5I D;  1YIT I;  4ANJ A;  5EEH A;  1MSE C;  3G1O A;  4YFN F;  1QU3 A;  1OYW A;  2ZSI B;  1ULY A;  4G12 A;  3BCA A;  5GPA A;  3VYR B;  4CZZ A;  2OA4 A;  3HRT A;  3OYG A;  5FB2 A;  3RYP A;  3S1M J;  1FTT A;  2VJ4 A;  3IWZ A;  2QEX I;  1QNT A;  3QU3 A;  4IHT A;  4RGU A;  3CZ6 A;  1KU3 A;  2Y9Z A;  1A04 A;  1K4S A;  4IQJ A;  3ZMU A;  4ETS A;  2XGC A;  2DOF A;  3HSF A;  2DU9 A;  3IHU A;  2Z99 A;  3K69 A;  4BJT A;  1MMS A;  2GLO A;  1LDJ A;  2ISY A;  2HDD A;  1MZB A;  2LRE A;  3ZQC A;  5FKN A;  2GWR A;  3SHF A;  1MMA A;  2V9V A;  3A2K A;  1ZYR F;  1O7F A;  2NVT J;  2C6Y A;  2VQC A;  4NC8 A;  3HBL A;  4BE1 A;  1RIO H;  1HBX G;  1K78 B;  2W25 A;  4WXD A;  3TW7 A;  2NXN B;  4BQQ A;  2AQF A;  2HOT A;  1ZG5 A;  2O6G E;  2HDW A;  3FXM A;  3CCL I;  3TGN A;  1IXC A;  2XAS A;  3N05 A;  4PSX A;  1XGO A;  3TO7 A;  3AG2 H;  1O7L A;  2M87 A;  1UHM A;  2RGV A;  2RC4 A;  5CVI A;  4BDZ A;  2R93 J;  1XCV A;  3ULQ B;  2IS6 A;  4XBF A;  5AIP A;  4M73 A;  2W1O A;  3C2B A;  3TOA A;  5HLT A;  1FT9 A;  2DXI A;  2RV8 A;  3CMY A;  2VXD A;  1AHD P;  3QOP A;  2DBB A;  3IAM 2;  4FQG A;  3IH4 A;  2CSO A;  2CV2 A;  3CCR I;  4L5I A;  4OIP F;  5E17 F;  4GFB A;  2E5N A;  2K3F A;  4Y13 A;  4B48 A;  4U7D A;  2L7M P;  3S17 J;  3L1P A;  4V19 K;  3I71 A;  2DJN A;  2L4M A;  2ZXW H;  1J7K A;  5DDG A;  2PLY A;  2RVC A;  4TV7 A;  2LKX A;  5F64 A;  3JSO A;  3M8E A;  5AIQ A;  1UZC A;  3M7G A;  5FFZ A;  1LPQ A;  2P6S A;  4J00 A;  4DW6 A;  2MC4 A;  2HVR A;  2IXS A;  1HKQ A;  3DFG A;  5L3E A;  1P92 A;  2EV5 A;  3CQZ J;  3LL7 A;  1O4X A;  1WGX A;  2WY7 Q;  1XGS A;  4L9N A;  2PQ8 A;  3K7A J;  3NWT A;  4M71 A;  1XX5 A;  2EFW A;  3K0L A;  4A6E A;  1LJ9 A;  2LBF A;  5J1Y A;  2MC3 A;  3E5Q A;  2QZ8 A;  4PJL A;  3TL4 X;  4HNV A;  2IW5 A;  2NVQ J;  3EUH A;  4RMN A;  1MMG A;  3F8F A;  1KYW A;  2F48 A;  2ZC2 A;  3KEO A;  3ZMV A;  1Q1H A;  4DYC A;  5LRS A;  3E97 A;  2EZH A;  1FZP B;  1HSJ A;  3L2Q A;  1MH3 A;  2HGC A;  3LOC A;  5FFX A;  3H3U A;  2IS2 A;  1B8I B;  3ZGK A;  3KP2 A;  4E7J A;  2LTP A;  1IN6 A;  1IUF A;  4AM3 A;  2IEK A;  1RKW A;  5AON A;  3G4S I;  2JN6 A;  2HVS A;  5LRR A;  4GYI A;  3SFI A;  5FO5 A;  1WJC A;  1BR2 A;  3CDL A;  1SAN A;  1SVO A;  3DTK A;  3RPQ A;  2EBI A;  1Z9C A;  4A3C J;  2DT6 A;  1Q1V A;  1KGS A;  2AXT C;  3FXR A;  1QVU A;  3ISP A;  2VBZ A;  1D0X A;  5L3C A;  3QP6 A;  4LD5 A;  2AO9 A;  2A07 F;  4UVC A;  2VKV A;  3WTS C;  1I50 J;  3QPT A;  3FXL A;  1XPX A;  2JA6 J;  1ZG3 A;  2QGU A;  1W7P A;  4XLF A;  5JHF A;  3ZQF A;  2YX7 A;  4XN0 A;  3ABU A;  5HDG A;  3ZQH A;  5BS6 A;  3V7R A;  1W7P D;  1TT5 B;  3LQQ A;  4M9Z A;  3FK6 A;  1DUX C;  2KIF A;  1A5J A;  2IVM A;  4OIO F;  1PVE A;  3OYA A;  2M4G A;  1FOY A;  2YX4 A;  3HXL A;  3B02 A;  2G7U A;  4BY7 J;  3WGH A;  2OC6 A;  2I8D A;  1OMI A;  5JVG F;  1I1G A;  3BQZ A;  3EQL F;  2M7B A;  4IPA A;  2Z2S B;  1UMQ A;  2Z5U A;  4A0X A;  4ZZL A;  4KYW A;  1N78 A;  3F9K A;  3CJQ B;  4KA4 A;  3JRH A;  5K7F A;  4GCV A;  3PM1 A;  1Y0U A;  3BOQ A;  3ZN1 A;  3AG1 H;  6PAX A;  1T98 A;  4DJA A;  1V55 H;  2DOE A;  1IXR C;  2Y75 A;  4FX4 A;  2XHK A;  3OWT A;  3GTQ J;  1ETY A;  2FML A;  4UV9 A;  4DIQ A;  3Q5F A;  1Y8R B;  3SDB A;  3LSM A;  1V3F A;  4D0P A;  4BBS J;  5L3G A;  5LGT A;  4JX5 A;  3JRE A;  4WXC A;  2DMU A;  1PUF B;  1PUE E;  1XGM A;  4MQV A;  1AKH B;  5EF6 A;  5IOY A;  2V9P A;  3ZQI A;  2JPB A;  2H94 A;  4A3B J;  2JSP A;  1BC8 C;  1P4X A;  4UB8 C;  1SMT A;  3MWM A;  3GXO A;  1U3E M;  2HZT A;  2L01 A;  2K9L A;  3P5J A;  1XMX A;  4R1H A;  4F3Q A;  3BTC A;  1R58 A;  3SEZ A;  2EH3 A;  1FX7 A;  2EIN H;  4LK1 F;  5DCM B;  4E7Z A;  2V6E A;  3RZD J;  3IRR A;  1R36 A;  2JA7 J;  2HZD A;  4IJA A;  1XGN A;  4CGZ A;  4KIB A;  4N4O B;  4AVP A;  2FUG 2;  1E3O C;  4EAT A;  2BY2 A;  1FNN A;  3N4M A;  5D5U B;  1RR7 A;  2L7F P;  2VQG A;  4KN7 X;  4AU7 A;  4LLL A;  3ZP5 A;  2STW A;  2DOD A;  3TDU C;  3FM5 A;  1FBQ A;  2NAZ A;  1YG2 A;  3HPH A;  3CCS I;  4HX7 A;  1Y1V J;  4XRS A;  3BY6 A;  2DCE A;  3WTU C;  4S04 A;  3CCY A;  1FY7 A;  2E36 A;  2DO7 A;  4ESF A;  2R4G A;  3GZN B;  1AOY A;  1JT6 A;  3JAM Z;  4P1W A;  5CKT A;  2R7X A;  4ESB A;  1YQA A;  3FF5 A;  4I99 C;  3WTW C;  2W4S A;  2Z9O A;  2JZY A;  3OL4 A;  5GTI C;  2H1K A;  4BL0 B;  1SFO J;  3BCB A;  1IN5 A;  4HNT A;  1BR4 A;  2HYJ A;  3OYJ A;  3RJP A;  3KX2 A;  2WAD A;  3CO6 C;  4YFK F;  4C9Y A;  1O3S A;  4PUS A;  4NC7 A;  2GQQ A;  1XN7 A;  3U1D A;  3VSK A;  1K6Y A;  3K4L A;  1ETQ A;  3I58 A;  4YEL A;  3CCU I;  5HDN A;  3CCV I;  2KIS A;  2CW8 A;  3JW4 A;  4BUP A;  5L3B A;  3BZ6 A;  4NC6 A;  1FYL A;  2OBP A;  5CLS A;  2B7E A;  4PGG A;  4N4N B;  2JVH A;  2KZG A;  1D8J A;  1MBH A;  1PYV A;  1Z91 A;  2W82 A;  1OPC A;  2DMP A;  2OZU A;  5E20 A;  1I1S A;  3VWB A;  4RB0 A;  2QM3 A;  2ELH A;  5B5E C;  3FBI B;  3HC7 A;  5TJJ A;  3RIR A;  2OPT A;  3H9Q A;  2B0L A;  1W5C C;  3PL8 A;  1ZRF A;  2KKO A;  2P5L C;  3FXK A;  3RCO A;  5IPA A;  2UXX A;  3IAS 2;  1HXD A;  1H0M A;  2F5C A;  3ERM A;  3UR3 C;  2WA0 A;  2R7D A;  4N0B A;  5L3F A;  1ZLJ A;  4PSW A;  4RB3 C;  3LSR A;  4X0G A;  2A3S A;  1XS9 A;  3BR6 A;  1V54 H;  3RQI A;  1BI0 A;  2M3A A;  1KZH A;  4MGR A;  3LA2 A;  4ZJZ A;  1DP3 A;  4UVB A;  3RI4 A;  2WC2 A;  3I54 A;  3BTJ A;  1U9N A;  2ME0 A;  5HVQ C;  5LBQ A;  1G59 A;  3IWF A;  3H5A A;  1UJ8 A;  5CVJ A;  4DYQ A;  3S1N J;  4RDU A;  1BL0 A;  4RAZ A;  3TW6 A;  1S72 I;  2PMH A;  2P5V A;  3FX3 A;  1PDN C;  4FCY A;  2A5Y B;  2HYF A;  2F5F A;  1NTC A;  4OIR F;  2EZK A;  4ZYA A;  2NNY A;  4CUG A;  1WJD A;  3T1B A;  2HTJ A;  1TQP A;  2MSY A;  4CH7 A;  2V4J C;  3GTP J;  2R7U A;  3H3Z A;  2MBF A;  3S2W A;  3AG4 H;  1G3W A;  3BR5 A;  1JE8 A;  3OYM A;  4PGH A;  1R1T A;  1YS6 A;  1X3Z B;  4A2U A;  2RQQ A;  3GF2 A;  4RAY A;  3IKV A;  2Q0O A;  3BG7 A;  3C1D A;  4CIC A;  1JKR C;  3OOU A;  1VQK I;  3GLL A;  5E1X A;  1Y6I A;  2EB7 A;  4RLF A;  1B1B A;  2D1H A;  4OIQ F;  2VOD A;  1P7I A;  5EZG A;  2KL4 A;  5ED4 A;  3CC2 I;  4HOB A;  2ZNZ A;  4JBA A;  1JUP A;  3DCF A;  4ENK A;  1G3T A;  4ZYE A;  2DA3 A;  2Y2Z A;  3HRM A;  4MFE A;  4M3F A;  4EMS A;  2EIJ H;  2VPR A;  3CJS B;  2DMQ A;  4I98 B;  3JAM K;  5K5Q A;  3CCQ I;  2BBY A;  2STT A;  2QBY A;  1WCM J;  3H5N A;  4AIJ A;  4A3D J;  1VQ4 I;  3DLA A;  3HRU A;  4ZYD A;  3LFU A;  3H9J A;  3ERE D;  5KK1 A;  4XR6 A;  3R0A A;  4E6K G;  3EET A;  2KP6 A;  2OUM A;  3OR1 C;  3DBR B;  4Y52 J;  3ZMT A;  3RYR A;  2W84 A;  3K1P A;  4MIM A;  1HST A;  1Y1W J;  4ZYG A;  2K7L A;  2DFH A;  1CF7 B;  4EJU A;  3COA C;  2LLK A;  1MJA A;  1KQ9 A;  1UHW A;  3KFW X;  1D3Y A;  4PFP A;  5E1Z B;  4RLQ A;  3QAH A;  4BBR J;  2JVG A;  3P9K A;  1IDZ A;  2WTE A;  5C4J J;  1ETX A;  2Y69 H;  5E1W A;  3OIQ A;  2BXZ A;  5JI6 A;  1Z0X A;  2XKO A;  2X6W A;  5K7H A;  5IYD J;  1DU6 A;  3JRI A;  2HQ5 A;  4CSW A;  2XF7 A;  2IS1 A;  1X3W B;  2DFI A;  1OYY A;  5J6X A;  1GT0 C;  1E3P A;  3FHN A;  2LKP A;  2JA2 A;  4M6Y A;  2KRH A;  4IQ4 A;  1QZY A;  2JK3 A;  2QQ8 A;  1MMN A;  4XKW A;  1MMD A;  3GZ5 A;  3L2U A;  1FOK A;  3RKW A;  4P5O A;  3J80 Z;  3MMY B;  2VQH A;  4WXH A;  4BEH A;  2L9R A;  3HGG A;  2KRC A;  2LNB A;  4IHS A;  2OQR A;  2Y9Y A;  1Y39 A;  5H6Q A;  1U0J A;  3KEQ A;  1FLI A;  2VT3 A;  3RZO J;  4D7N A;  1GV2 A;  5IYC J;  4GO1 A;  1FOW A;  1YYV A;  1P6R A;  1Y8Q B;  3CC4 I;  4UNO A;  2X48 A;  1IAW A;  3OIO A;  1ON2 A;  1GVJ A;  2N8G A;  2O9L A;  3HKZ N;  3WHC A;  3J7A O;  4M72 A;  3H0D A;  2VJ5 A;  3CJT B;  2XPU A;  3E6M A;  3WTX C;  1R4N B;  2H8R A;  4E7K A;  1G4D A;  2PMZ N;  2E1M B;  2CQ7 A;  2RAE A;  3BJA A;  3WGI A;  4IHV A;  2KJB A;  2P8T A;  2HS5 A;  2VUM J;  2LFB A;  2P0W A;  2KMU A;  1IJW C;  2HR3 A;  4QPQ A;  2BY3 A;  2BEO A;  3E7L A;  1V5E A;  2F5D A;  4ZYH A;  3S1Q J;  1C0W A;  3CMM A;  3WOD F;  3V8J A;  4ASN A;  1ODD A;  1U5T B;  4I09 A;  4HV6 A;  1TWF J;  4KIC A;  3OYN A;  2X9D A;  5M3F J;  2ECC A;  1R5H A;  2IT0 A;  1UG0 A;  4XRM A;  3WTT C;  3FXQ A;  3LST A;  3L2R A;  1LE8 B;  4E7H A;  2PX9 A;  2DOA A;  3GTO J;  3GFJ A;  2CH0 A;  3I4P A;  3B73 A;  2IJL A;  1EF4 A;  4BGD A;  1W7P B;  5HS8 A;  1LQ1 A;  3HZJ A;  4FTH A;  2HQA A;  2GZW A;  3U21 A;  3FXO A;  2FMY A;  3PJR A;  4G7O F;  4NNJ A;  3JSP A;  1V5F A;  2EV6 A;  2P7V B;  4DYR A;  2R7O A;  2OQG A;  3E6D A;  1RKT A;  1LDK B;  1APL C;  2O8K A;  4AD9 A;  2ZME B;  1ZN2 A;  1BI2 A;  4LB6 B;  3BQY A;  3HSR A;  3GW2 A;  4OIN F;  4C3I J;  2XAH A;  4L5J A;  2CS3 A;  2CV1 A;  2WB1 N;  1LVK A;  2ACJ A;  2FJ1 A;  3BG5 A;  1Z6R A;  4NDL A;  4HF2 A;  2E1M C;  3WE3 A;  2K9N A;  1UFM A;  3DF8 A;  4WK8 F;  1OR7 C;  3F6O A;  5ICE A;  4G6T B;  4Y3O A;  1SAX A;  4IHY A;  3T5X A;  1DGW Y;  3MKW B;  2BYV E;  3BG3 A;  1MBG A;  3FMS A;  2F6C A;  5ICF A;  1Z21 A;  3AL0 B;  1EKE A;  1PJR A;  4LFU A;  2OAZ A;  2K9Q A;  4AVZ A;  4F93 B;  4EJO A;  5HNH A;  1RES A;  1WHU A;  4B43 A;  2FBI A;  3K70 C;  2KHM A;  4A3G J;  1WSU A;  3ZXS A;  2XC7 A;  1TWA J;  1WH5 A;  2E19 A;  1HW5 A;  2MW8 A;  4DGW B;  3G73 A;  4IHW A;  1FTZ A;  3K1M A;  4B3A A;  3DU6 A;  2KIU A;  1E3H A;  4XQF A;  4AIK A;  1VQL I;  4KIT B;  2EV0 A;  2VBX A;  1N75 A;  1GXQ A;  4CCJ A;  1TWH J;  2WY8 Q;  5C3E J;  1WH7 A;  2F2E A;  4Y4R A;  4OMZ A;  3SZG A;  1YJ9 I;  2R92 J;  2A05 A;  4UUV A;  3WTZ A;  3Q9V A;  1I3Q J;  5ILV A;  2CQX A;  1X58 A;  4MQ9 F;  3PIO F;  5LGU A;  4BS9 A;  1DGR M;  5CPR B;  4RA2 A;  2XGX A;  2PMU A;  1L3L A;  3LA7 A;  1G6N A;  4UUS A;  3HJE A;  2DK8 A;  2G0E A;  2QKL B;  4YFX F;  1WJE A;  1FIA A;  3MD2 A;  4LIV A;  3SYT A;  4XIC A;  4FIS A;  2H6B A;  4I6Z A;  2LOO A;  1DDN A;  1SD5 A;  3BDD A;  1O3R A;  1QRY A;  3GBG A;  1R1V A;  1VQ5 I;  1ACI A;  4B3X A;  2MFZ A;  1JHF A;  4QSH A;  3CJR B;  2R5Y A;  1LB2 A;  2W7N A;  5M5W J;  4MFD A;  4D5F A;  3ASN H;  1WJA A;  2FEZ A;  4E7S A;  2Z33 A;  4M3D A;  1KQ8 A;  3IV5 A;  2ZXJ A;  2V1N A;  3MZ8 A;  1JKO C;  4UB6 C;  4XM3 A;  3BZC A;  2OTJ I;  5EEG A;  2MH9 A;  2D45 A;  1ZR4 A;  1K78 A;  3M8F A;  2XGE A;  2LP0 A;  2XVC A;  3WE2 A;  1LVA A;  1S6L A;  1XTA A;  3H92 A;  4LIT A;  4NQW B;  3U9G A;  1REP C;  3NAU A;  4LIU A;  3L2C A;  2E2J J;  4BJ5 C;  2M0M A;  2R7Q A;  3HOW J;  1XD7 A;  1JTX A;  1J2X A;  1HC8 A;  4AID A;  4ZH4 F;  1HOM A;  4LMY A;  1K79 A;  4UXN A;  5IYB J;  3LSG A;  4QLC U;  3GO5 A;  4OWR B;  5BNG A;  2DFE A;  1TLH B;  1KA8 A;  1FIP A;  2E71 A;  2FE3 A;  3PQK A;  2LY2 A;  3J7Z I;  3S14 J;  1K7A A;  3R6S A;  1Z7U A;  4KIG A;  3HTS B;  5FRO A;  2J5O A;  2HXI A;  3QYF A;  3S8P A;  1MIJ A;  1M1E B;  1O3T A;  5CVU A;  2ZBK A;  3F72 A;  3HGY A;  4XLN F;  3KZY A;  5BQT A;  3CO7 C;  3MKL A;  4XLP F;  4IZZ A;  1W0T A;  1R6R A;  3K4K A;  2KRF A;  1L0O C;  2BVL A;  1JTY A;  2K4B A;  2MGQ A;  1U5T C;  2FD5 A;  4M9X A;  2HPI A;  1RUN A;  4B09 A;  3EUA A;  4G7H F;  2R7T A;  3MAJ A;  2GXG A;  3BJO A;  3CLQ A;  1CF7 A;  3BPX A;  2H27 A;  3D5R C;  1BOB A;  2LY1 A;  2GXB A;  5KAI C;  1WZ2 A;  2IS4 A;  4U88 A;  2QWW A;  4W1U A;  4IF4 A;  3WU1 B;  2X6Y A;  5HS7 A;  3A01 A;  1OCO H;  4U7B A;  3T8R A;  4LG0 B;  2VC0 A;  3LMM A;  3HIF A;  1OIS A;  2MLK A;  5KVR A;  1WRJ A;  4PK4 A;  4Y33 A;  1XDU A;  2Q2E A;  1BC7 C;  5DEQ A;  4FET A;  1E0E A;  2VI6 A;  2BZT A;  2XAF A;  2V1X A;  4G8X A;  2PEX A;  1B59 A;  2FOK A;  5FKO A;  5FJ8 J;  1ZRC A;  1A36 A;  4HZF A;  3GCM A;  3OL3 A;  1ETK A;  2MD0 A;  5ICG A;  1XSX A;  5KAF C;  1W36 D;  1U2W A;  2QQA A;  2JT1 A;  2RN7 A;  4IOC F;  3J7A Y;  4P96 A;  4BAC A;  3E5U A;  4BU2 A;  1G3Y A;  3KLN A;  3HSE A;  2XAG A;  1ZK8 A;  5JLW A;  2MH2 A;  3TP0 A;  4NQW A;  2YUS A;  4O3M A;  4N9I A;  3VPR A;  1P4W A;  1WQ2 A;  2G9W A;  3P9C A;  4H4K C;  1IDY A;  3O8H A;  4JK1 X;  4A3E J;  2VON A;  3O2P E;  2NOJ B;  1F5T A;  1T0F A;  3DWL E;  1KQ0 A;  3O8G A;  2DQL A;  2X6O A;  2Z16 A;  3H0G J;  5L3D A;  3HOV J;  4HV5 A;  3S2D J;  5HLH A;  2NS7 A;  3DQV C;  2M4K A;  4D5C A;  1BI1 A;  2DA5 A;  2QCO A;  1SD6 A;  3K4B A;  4OAY A;  2EFN A;  3JTG A;  4BE2 A;  4ZTF A;  1WWX A;  2M1B A;  4C3J J;  1TNT A;  2CV0 A;  2JA5 J;  3Q0W A;  1GHC A;  3F8N A;  4PJ0 C;  2PN6 A;  4HNU A;  3OYB A;  2CUJ A;  1H8A C;  1IRG A;  3NQO A;  3CCE I;  4FE7 A;  1VF9 A;  2GA2 A;  1X2N A;  2WV1 A;  2QLZ A;  4HF1 A;  1W5T A;  1D5Y A;  2M9H A;  3BR3 A;  1IC8 A;  1MBK A;  3M4O J;  2X1D A;  4LLG F;  2QF7 A;  1VZ0 A;  2L4A A;  3IP4 B;  1S7E A;  1XSV A;  4EV0 A;  2NVY J;  3ZQQ A;  3AKZ A;  2KPM A;  2ZNY A;  1IN8 A;  2LH9 A;  2DTZ A;  2F4M B;  3HOS A;  2ICW G;  1T0F C;  4CYC B;  3HOX J;  2LYC A;  1LFB A;  4LB5 A;  2ECB A;  3M3Y J;  2OJE D;  5M3M J;  1A6Q A;  4B8X A;  4HYE A;  5B66 C;  3MFK A;  1D5V A;  5FRN A;  1ENH A;  5EEA A;  3VB2 A;  2VJJ A;  4CCO A;  3CCJ I;  2FBH A;  2M34 A;  1BA5 A;  2JUG A;  4EGY A;  1MDM A;  1TTY A;  4E7I A;  1Z1D A;  1S7O A;  2CO5 A;  4MO7 A;  5FKM A;  2QSG X;  1ZEL A;  3E1S A;  3FKJ A;  2A6E F;  3I53 A;  4NBQ A;  2ZME A;  3DPT A;  4M3E A;  2DFF A;  2EIK H;  2VE9 A;  1YIJ I;  2XDV A;  5JFR A;  1PP7 U;  3OYF A;  2QYO A;  3KCC A;  4OAZ A;  4BEH B;  1FP2 A;  4M9S A;  5JHU A;  4DBR A;  1B72 B;  3PO2 J;  1TNS A;  3BRO A;  3PFY A;  4FT8 A;  4HSR A;  4GXO A;  1JXS A;  2L7K A;  2XAQ A;  3BPV A;  1FYM A;  2PJR A;  2JPC A;  3HOY J;  5D6E A;  1YX5 A;  5DS9 A;  2FQ3 A;  2VLA A;  2A68 F;  3DEE A;  5KCM A;  4KT6 A;  3E6B A;  3BR1 A;  2EIM H;  2NOG A;  1D0Y A;  3S16 J;  3F0C A;  4U0V A;  2XGD A;  3F8M A;  3JRC A;  2DK5 A;  1S9H A;  4X1E A;  3I56 I;  1VTN C;  1GUU A;  4ZTJ A;  3PUB A;  2O61 A;  2O7O A;  2R7V A;  5IT9 Z;  2WAQ A;  2VKE A;  2NS0 A;  5HLI A;  1SFU A;  1MH4 A;  3BP8 A;  2E2H J;  1SC7 A;  1LKX A;  5DCM A;  3I9V 2;  1KU2 A;  1OLT A;  3MZH A;  3I4N J;  2OV7 A;  1JKP C;  3KP7 A;  4UY8 I;  3I59 B;  2L7Z A;  3OS1 A;  3OSF A;  1P7J A;  2CUF A;  1ZRE A;  3SZT A;  1SFE A;  1YJN I;  4V2G A;  1TL8 A;  1ZAO A;  1TT0 A;  1FYK A;  4B47 A;  4C2T A;  1FOX A;  2LRD A;  2LF8 A;  2O3F A;  5J40 A;  5K7Z A;  3IUO A;  4BXF A;  2DQR A;  1F1Z A;  3IL2 A;  2CW7 A;  1VQO I;  3HHG A;  4IEJ A;  2DPU A;  4WCG A;  5B3S H;  3C2G A;  2VT2 A;  2VB6 A;  1B6A A;  5EYR A;  3V8L A;  1LDD A;  4BNC A;  1YX3 A;  3G3Z A;  4F92 B;  1ETV A;  3OY9 A;  1OR7 A;  3S3M A;  1Z3X A;  2AQE A;  3TOB A;  5GAD J;  5FKL A;  5E3L A;  1W4M A;  3LA3 A;  2XF5 A;  2Y30 A;  4XK4 A;  3OS2 A;  2IGN A;  2R7R A;  4L9J A;  2PJP A;  4ENM A;  3IKT A;  1D1B A;  3FIS A;  1TWC J;  2LVS A;  3M1C A;  2HPM A;  1OFC X;  1ERD A;  1FC3 A;  1W36 C;  3H1C A;  1TQM A;  2IGK A;  1MND A;  4CDG A;  1D1C A;  2FOW A;  1K6O A;  1X2M A;  1R1U A;  3I5U A;  2EQR A;  3D5L A;  4GDF A;  1XG1 A;  2W00 A;  1R49 A;  2DW4 A;  2P5K A;  3BR2 A;  1HW1 A;  3AL0 C;  3C2H A;  5TIS C;  2I10 A;  4LG3 A;  3GLX A;  4A3K J;  1E2X A;  2QSH X;  1ON1 A;  3K1N A;  4ABZ A;  4EJT A;  5FGM A;  2BHZ A;  2GIZ A;  1D1A A;  3CUO A;  5J8F A;  1T38 A;  3PNT A;  5HOD A;  3B6C A;  3ABT A;  3QP5 A;  1IW7 F;  3GFL A;  2CFX A;  2K85 A;  1QBJ A;  1H89 C;  1LEA A;  3BLY A;  5KNL A;  4AWX B;  1U78 A;  3QRF F;  2BOL A;  2CW0 F;  3A1Y A;  3K70 D;  2Y48 A;  1FP1 D;  1U9O A;  1UAA A;  3H36 A;  3LAJ A;  2QEN A;  5M5Y J;  5D4R A;  1V5G A;  5ILU A;  2KJC A;  1BBY A;  1OYI A;  2WB1 A;  4GGG A;  2H8W A;  2L9V A;  1LE8 A;  1NK2 P;  5HS9 A;  4R8H A;  3RSN A;  2XSD C;  2R7Z J;  2X1C A;  5B1A H;  1T39 A;  1JUM A;  2HVQ A;  2DYR H;  2V6C A;  4Q5S F;  3HEF A;  2R0Q C;  2QA4 I;  5K1Y A;  5EG0 B;  2K4J A;  2BGC A;  1BR1 A;  4A93 J;  3FDY A;  3UKG A;  1OQY A;  2MG4 A;  3L2V A;  1U8B A;  4KMF A;  3KP4 A;  3GUD A;  2DA2 A;  2GA1 A;  1DP7 P;  2K5C A;  5J8C A;  5M5X J;  4ZZD A;  5IT9 K;  2DA1 A;  2VJI A;  4HF0 A;  3WTY C;  1VQP I;  1JI8 A;  1B9N A;  5KHD A;  2JWT A;  2MAB A;  2L9N A;  3BWG A;  1BI3 A;  2CWE A;  4YEJ A;  5BPI A;  1ZR2 A;  4RAG A;  3KE2 A;  3HPG A;  2CRG A;  2O5R A;  3JRA A;  4RB2 C;  2JRT A;  2ZJP F;  1EH8 A;  2KDO A;  2LC2 A;  2OU2 A;  2ETH A;  1EJ9 A;  4L18 B;  1R71 A;  3M07 A;  2EZI A;  2VQL A;  2E60 A;  2RKH A;  1QO0 D;  3QPS A;  2B9S A;  5FLV A;  1OCZ H;  1Z77 A;  5FD5 A;  4RBO A;  2FQ4 A;  2B63 J;  2XV4 S;  2VL8 A;  2IA1 A;  4H0E A;  4RAF A;  3CP2 A;  1SD4 A;  4Z6Y A;  4LLN A;  5EDN A;  2VC1 A;  4W97 A;  1MNE A;  5DUK A;  2PMZ A;  4LGW A;  4IL6 C;  1YW8 A;  1XMA A;  1QVT A;  1ETO A;  1XMK A;  4A5M A;  5IP9 J;  2BW3 A;  3JR9 A;  2XRO A;  3VEP A;  5DD8 A;  4HA8 A;  1V4R A;  3ASO H;  2H09 A;  4X6A J;  1T6S A;  1SAU A;  2M8G X;  1U5T A;  4XLC A;  4M3G A;  4XON A;  3T0Y A;  3I4M J;  4RGR A;  4MTE A;  4EQQ A;  5TGT A;  2M8E A;  3ELK A;  1Z05 A;  1X1P A;  2DT7 B;  3ML6 A;  2LY9 A;  3PUF A;  4CCK A;  2DAO A;  4G7Z F;  4XN3 A;  3VYU B;  4CCL A;  2ZB9 A;  1SFX A;  2DMT A;  2L54 A;  5E8I A;  2R3S A;  4ENJ A;  4N9H A;  1W0U A;  3BG9 A;  2KZV A;  3OIP A;  1H88 C;  3CDH A;  2EPF A;  3HM5 A;  1X1B A;  4PJM A;  1POG A;  2YR2 A;  3LSJ A;  2HXO A;  4R79 A;  3CLO A;  1X19 A;  3KYL A;  3K6G A;  5J4Y A;  3GME A;  2KQR A;  2L3D A;  4I0A A;  2UXN A;  2AHQ A;  2VOP A;  1TW3 A;  3D5S C;  3F22 A;  1X1D A;  2K9M A;  2FU4 A;  2ADU A;  4ON0 A;  3CUQ C;  4LOC A;  4G9Y A;  3SZP A;  4JP0 A;  1IRX A;  4E70 A;  5LEJ A;  2ZJQ F;  3W2V A;  2IRF G;  2H6C A;  2W85 A;  4G94 A;  2XB0 X;  1WVR A;  5D8K B;  5DV5 A;  2GOM A;  2X0L A;  3TO6 A;  4PJJ A;  1J5Y A;  3AAF A;  1TBX A;  4EVI A;  2HFH A;  3BJ6 A;  4UVA A;  2PG4 A;  2XAJ A;  3BTL A;  1PUF A;  4HPQ A;  3VOE A;  1JJ8 C;  2VBY A;  3CJN A;  4NHJ A;  4AUX A;  3FMR A;  2RNG A;  3ABL H;  4L0Y B;  1D0Z A;  2ZCW A;  3J81 Z;  3GYH X;  2EIL H;  2TDX A;  1S3J A;  1B9M A;  2J5P A;  1WFX A;  5H6R A;  3CUQ B;  2EFO A;  3DKW A;  1B8I A;  2PI0 A;  2P7C B;  3K10 A;  3MCZ A;  4BDY A;  4G6D A;  3S3N A;  1IN4 A;  1P4A A;  4KIF A;  1DPR A;  3K4C A;  1PP8 F;  3GTG J;  3GFI A;  1T2K A;  5C4X J;  3HB9 A;  3WU2 C;  2IGM A;  1OCT C;  4I01 A;  1HA8 A;  3F23 A;  2JMW A;  2BV6 A;  2NRA C;  2HQR A;  1SD7 A;  5E3M A;  2OCE A;  2WV0 A;  3HRS A;  2ZFW A;  2LSO A;  5EZH A;  4F7Z A;  4A5N A;  1UHS A;  1H9G A;  4PDK A;  3T8T A;  2FBK A;  3FHZ A;  1IUY A;  2EA4 A;  4IXA A;  2A6T A;  2COB A;  5GAH J;  5FLX K;  4JOM A;  3VYS B;  3CTA A;  3K4M A;  5E3N A;  4UUS B;  1LFU P;  1U6G A;  5DYM A;  3FKI J;  3WGG A;  3FXJ A;  4XRF A;  2ZJR F;  3K2A A;  1A31 A;  1I5Z A;  3G1M A;  3FWE A;  3QYB A;  4D7M A;  1I27 A;  3CF2 A;  4P55 A;  4C30 A;  1RUO A;  5LFA A;  1Z67 A;  2IGO A;  2DYS H;  3BG6 A;  2GAU A;  3RPU D;  3UNG C;  3GTM J;  4AYB A;  2CQN A;  2R7S A;  3QPL A;  3QU6 A;  1KYZ A;  1MW7 A;  3X2Q H;  2IA2 A;  2PFB A;  2A61 A;  3GVA A;  1XB4 A;  2FSW A;  5LHI A;  1HW2 A;  4J19 A;  4OU0 A;  2KIQ A;  4IKF A;  1BM9 A;  5K5R A;  2R5Y B;  3V42 A;  3GZ6 A;  2COM A;  3L9F A;  2W57 A;  3HOZ J;  5J1R A;  1VQM I;  3CMA I;  3FBN B;  2MA3 A;  1S8N A;  3DTI A;  2TCT A;  3SFZ A;  2MD5 A;  2Z1D A;  1I6H J;  5LHH A;  4A6D A;  3HTU A;  3ZRG A;  1UG2 A;  1AWC A;  3PSI A;  3I64 A;  3B6A A;  2VBW A;  2BXY A;  1RET A;  2FNP A;  3KEY A;  4A3I J;  1IF1 A;  3ZPL A;  1XDS A;  4PJN A;  2DTR A;  3SDG A;  1S5L C;  3V7S A;  3F21 A;  3WU0 A;  2F5V A;  4IVN A;  3DBL B;  3H35 A;  3LSH A;  4Y17 A;  1EA3 A;  3I3L A;  2EZL A;  4AIH A;  3NWS A;  3WG9 A;  3LSK A;  2OD5 A;  4Q48 A;  3BR0 A;  4CCM A;  3J7Y J;  3MQ0 A;  5F0F A;  2E35 A;  5J1U A;  3GWZ A;  3HOU J;  3OSG A;  4PZJ A;  3MVP A;  3QQA A;  1DU0 A;  1VFC A;  1J9I A;  1F9N A;  4YII A;  3S3O A;  4WF2 A;  1OCR H;  4S05 A;  2L9S A;  2ZXH A;  3RKQ A;  4CZC A;  3G71 I;  2ZO4 A;  4YRV A;  3JRF A;  2BVM A;  2L02 A;  3QWL A;  1TW2 A;  4MEY F;  4NUB A;  1A35 A;  3LWF A;  3ZQG A;  4Y7N J;  5CQG A;  2NVX J;  3EYY A;  4B1R A;  2D1V A;  3ROU A;  5HLG A;  1T08 B;  4LK0 F;  2O8X A;  1BW5 A;  4A0Y A;  4O5V A;  1FMV A;  4ENN A;  4EJW A;  1YRN A;  3W3C A;  1I39 A;  3DBH B;  1HCR A;  2OTL I;  5FRM A;  1ZGW A;  4DBQ A;  2H1L A;  1R23 A;  4CXF A;  1T95 A;  4Q47 A;  2M45 A;  1X1A A;  3PSF A;  1I6X A;  3W6K B;  4P9U A;  1FWZ A;  3ZQ7 A;  4A3J J;  1T56 A;  2CGP A;  1MGT A;  5FLM J;  3EPZ A;  3HYI A;  4EJV A;  1T33 A;  2XSJ C;  3RPU A;  3VDX A;  1LUJ B;  1BN5 A;  2HOA A;  3H3V K;  5F0H A;  2XRN A;  3R4K A;  1YW7 A;  2L0K A;  2W48 A;  2HKX A;  3CP8 A;  2EFP A;  4BAY A;  1P9Q C;  4S0H B;  1R00 A;  1X4P A;  3BZK A;  4XOT A;  4C2U A;  4XID A;  2DA4 A;  1U8R A;  1TWG J;  1QZE A;  2XKP A;  3L2W A;  2ELJ A;  2LK2 A;  2P6T A;  4M3B A;  3DXJ F;  4JQF A;  1XCB A;  2FNA A;  2EJR A;  5BMZ A;  4IX7 A;  2ESH A;  1H9T A;  2XRL A;  5CVR A;  5H2F C;  2ELK A;  3W2W A;  1JGS A;  3CUQ A;  1IXS B;  2E5Z A;  3ZCO A;  4OMY A;  2E7X A;  3GTK J;  3PNV A;  5D8L B;  2CU7 A;  4V2F A;  3HL2 A;  4HG2 A;  4AYB N;  2PBI A;  3DP7 A;  2HNH A;  1K4T A;  1VQ8 I;  2FF4 A;  4HDU A;  2V26 A;  4PCQ A;  3KP5 A;  2M30 A;  5F04 A;  3PNY A;  4WX9 A;  3GFM A;  1QPI A;  3H5R A;  1IRZ A;  3V8K A;  4BHP A;  3ZQL A;  2VOO A;  4F91 B;  1JJ6 C;  1YJW I;  2WWY A;  3ONQ A;  3KET A;  3OYI A;  3KPH A;  5DD4 A;  1IO2 A;  4BXU A;  1G2H A;  2CQQ A;  4E4H A;  1YOV B;  2O0Y A;  3IH2 A;  3DV8 A;  2R5Z A;  4MHG A;  4L9T A;  1RPW A;  1Z7L A;  2QQ9 A;  4KIS A;  2OCC H;  1VI0 A;  1DQU A;  2VPL A;  3SEQ A;  2GXA A;  4UUT A;  3ESW B;  2DA6 A;  2IAI A;  4GRI A;  2HI3 A;  5E8G A;  1NK3 P;  3A0H C;  3TQN A;  5JLX A;  4DOZ A;  1YE9 A;  3A01 B;  4RM3 A;  5F1J A;  3ABM H;  4KDP A;  3WG7 H;  1QPM A;  4NB5 A;  2X6X A;  4XKC A;  1R5G A;  2I5U A;  1QHG A;  1W5S A;  2F4O B;  4IRH A;  2HYG D;  4I76 A;  3E5X A;  3P9I A;  1ZGJ A;  5GTH C;  3JRG A;  2Q2E B;  3HKZ A;  2YU9 J;  2D5V A;  3V4G A;  1WIB A;  4BH9 A;  2Y0S A;  5LLQ A;  2HEO A;  4RB1 A;  2DDB A;  3L09 A;  3M1E A;  3L00 A;  1ZRD A;  2E34 A;  5D5V B;  3MEX A;  3ZN0 A;  2BY1 A;  3KYC B;  2LBF B;  4ZDO A;  2XF6 A;  2KIM A;  1FJL A;  2DI3 A;  2AXL A;  1FBU A;  1F43 A;  1AA7 A;  1GV5 A;  3CME I;  4HX8 A;  1YS7 A;  2NNN A;  3F6V A;  5F1R A;  5DCF A;  1HDD C;  3NEU A;  2G7H A;  5F27 A;  1DPU A;  2JRM A;  3FM3 A;  5E3O A;  3OR2 C;  5TRD A;  2GM4 A;  5LEK A;  2VN2 A;  1S7A A;  3OYK A;  3PFI A;  2KT0 A;  3BC8 A;  4AC0 A;  1NG6 A;  2GIV A;  3EUK L;  3QOE A;  4XRS G;  4BQN A;  3KLO A;  2ME6 A;  3J80 K;  1R22 A;  1BJA A;  1CGP A;  3M9A A;  4QPO A;  4I2O A;  4A3L J;  4KN4 X;  4M6X A;  2R7W A;  2BW3 B;  4IRG A;  1STZ A;  2OF7 A;  1Z3Y A;  2X51 A;  4XKV A;  3OMY A;  3A0B C;  1YLF A;  3KP6 A;  3DEU A;  3CF5 F;  1JGG A;  1YI2 I;  3G6E I;  4CHU A;  3H9G A;  5K5O A;  2XUB A;  3EUH C;  1VQN I;  1E17 A;  4B44 A;  3HUG B;  4CCN A;  2JJ7 A;  2HOS A;  2JQ7 A;  2A5W A;  4BJ6 C;  1J09 A;  5GAG J;  4L0Z B;  1MNM C;  1N25 A;  2R5Z B;  1HF0 A;  1HKT A;  3HUG A;  4G6Q A;  3JCU C;  5F08 A;  2VKH A;  2O03 A;  2EA2 A;  5J47 A;  1G3S A;  5EG0 A;  4LG0 A;  3I55 I;  2ID3 A;  4XL9 A;  5BOX A;  4I0B A;  1WKM A;  1YW9 A;  3G1L A;  3LQR A;  3LFK A;  4JYK A;  4XLE A;  3S32 A;  1OJL A;  1USS A;  2DDA A;  3G2B A;  3OYH A;  4A3M J;  3S2H J;  4QIW N;  2V79 A;  5GP9 A;  2DPD A;  4F52 A;  5F6F A;  3FMQ A;  3LNQ A;  3RKX A;  3ZMD A;  2UUZ A;  3VFZ A;  1TP4 A;  3ZMZ A;  3OV8 A;  1RC9 A;  2ID6 A;  1R4M B;  3R0J A;  3TMO A;  1SVL A;  2VE8 A;  3HHH A;  5EJC A;  3I0T A;  2K3P A;  4KUM A;  2WAQ N;  4FAS D;  2PJR B;  1ZLK A;  4BY1 J;  1RI7 A;  3TDZ C;  2QSF X;  1ZHF A;  1UEL B;  3D0S A;  4II3 A;  5HOO A;  2RQP A;  1JKQ C;  2CYY A;  1Z6T A;  1SMY F;  3C7J A;  1MD0 A;  2NS8 A;  3TP3 A;  3J81 K;  3K4N A;  5H20 A;  3VYT B;  3S93 A;  2V1U A;  1WPK A;  1P2F A;  3KZZ A;  3FXU A;  1BJZ A;  4A0Z A;  5D4S A;  2E7W A;  3AG3 H;  3U2R A;  1OCP A;  4MEX F;  2GBY A;  2RDP A;  2UWM A;  1TQI A;  2KLO A;  3E6C C;  1ONV A;  1WJF A;  4EM0 B;  2F4I A;  4P9F A;  4K2E A;  2ZFU A;  3F8B A;  4HST A;  2UV1 A;  2QBY B;  2D2W A;  4BQA A;  5IP7 J;  3CES A;  3DTE A;  5ICC A;  1WJB A;  2DT5 A;  1RR8 C;  2RNJ A;  3CDI A;  2IP2 A;  4ZDP A;  3K4J A;  4HX4 A;  4DQ2 A;  4KFC A;  2HKO A;  2W24 A;  2ZKZ A;  4YIR X;  3R61 A;  2E2I J;  1QA6 A;  2RRE A;  3KZI C;  3HG9 A;  1O3Q A;  4D9J A;  4F55 A;  2Q1Z B;  2Y0S N;  4MNU A;  1ETW A;  3QPH A;  1J59 A;  2L2O A;  2XIG A;  1IN7 A;  4A12 A;  4XNF A;  3DPU A;  1BIB A;  2FRH A;  3BTI A;  4UV8 A;  3LAP A;  3Q0U A;  4KNY A;  2AS5 F;  2K40 A;  5DM6 F;  2YS9 A;  3KIO A;  2HQN A;  2NVU B;  3TO9 A;  1IGN A;  2HWV A;  3DKX A;  2X4H A;  2KDZ A;  4QTR A;  5F0C A;  3DKY A;  1YFH A;  4B4C A;  3ZMS A;  1OKR A;  1GVD A;  4Z2Y A;  5IY5 H;  3GTJ J;  5HNF A;  4A69 C;  1RRJ A;  3FK7 A;  3MN2 A;  2F5E A;  2ZSH B;  1BOA A;  1UST A;  1T8I A;  4HDV A;  2WBM A;  2FA5 A;  4EGZ A;  1ZAR A;  4J01 A;  1LNW A;  1MJ9 A;  1IRF A;  1S29 A;  1KU7 A;  4IOA F;  1VND A;  4XLA A;  1MDM B;  2E1O A;  2QQB A;  2LMD A;  4XSZ F;  4U0Y A;  1HKS A;  4KJZ A;  4II2 A;  3RTR A;  1TC3 C;  4WWC A;  3QYE A;  5FKK A;  1IV6 A;  1MSF C;  1ZH5 A;  3DU5 A;  3ZR8 X;  3OYL A;  1IZ1 A;  3KYD B;  2M7A A;  5CYV A;  2V1D A;  3GEZ A;  4BYY A;  3NRV A;  3VOD A;  2TRT A;  4HQE A;  3CC7 I;  2V7F A;  3MKZ A;  2IBD A;  4HQM A;  2Y31 A;  2EFQ A;  2YPR A;  4CA0 A;  2QKM B;  3PIP F;  2DA7 A;  1FSH A;  3LSP A;  1MBF A;  5FD6 A;  2HU9 A;  5JR3 A;  1K61 A;  1BIA A;  4ZDL A;  5IOZ A;  2MYS A;  5LGN A;  4MLO A;  1LFP A;  2JTV A;  1D8K A;  4BHC A;  2ISZ A;  1MKM A;  3TKY A;  3EYI A;  1WI9 A;  3C18 A;  5CJ9 A;  4LJZ F;  1ITY A;  2LD5 A;  3ZOB A;  3KP3 A;  3E3V A;  1JHH A;  1X3U A;  3P7N A;  3AFH A;  3HDD A;  3CCM I;  4HRI A;  3JTH A;  1ORK A;  1W1W E;  5GAE J;  3E0J B;  3FZV A;  3A02 A;  4Q4Z F;  2VAS A;  1O57 A;  4M6V A;  3Q0V A;  3N97 A;  2M5W A;  2FXA A;  2IPQ X;  4JX6 A;  1IV8 A;  4DNC A;  3I59 A;  3PO3 J;  3RDI A;  3TED A;  3A4C A;  4C2M J;  3SJM A;  3R60 A;  4BKX A;  2WAE A;  4GYG A;  1GXP A;  2ZME C;  2A6H F;  1FEX A;  4XSX F;  3HOT A;  4BHB A;  3S1R J;  4BE0 A;  1X1C A;  2DMN A;  4HEA 2;  3OOP A;  4EM1 A;  2MLG A;  4HAM A;  1QZZ A;  1Y0N A;  4UHT A;  5BPD A;  2OZ6 A;  1CQT A;  1FPQ A;  4EEF G;  1R7J A;  1XC5 A;  1ZGA A;  4CO8 A;  5EGO B;  5CQE A;  1YHQ I;  1FBS A;  1KU9 A;  1SFK A;  5LHG A;  1SVM A;  3W6V A;  4L5E A;  1YIO A;  2K27 A;  2XAU A;  4ESJ A;  2LG4 A;  3EDP A;  1HLV A;  2V9K A;  2QVO A;  2VXZ A;  3REO A;  1AKH A;  2HDC A;  1HDP A;  2KFD A;  3WTV C;  1OCC H;  2JSC A;  2CUZ A;  1I3A A;  1N77 A;  3IC7 A;  1B72 A;  1ZG1 A;  4YIF A;  2VIX A;  3V7C A;  1ZKG A;  1TZL A;  2HOE A;  5E18 F;  5C44 J;  5A2Q Z;  1F4K A;  3PQJ A;  2JUC A;  4HBL A;  3DPL C;  2ZJ2 A;  4FHT A;  3W6J B;  5ERI A;  2CMP A;  1VQ9 I;  2FX0 A;  2P4W A;  2XB5 A;  5J4V A;  4DZP A;  1KON A;  1LEB A;  4YG2 F;  2WAF A;  1RZ4 A;  3O6B B;  5IT3 A;  1J75 A;  4RS8 A;  2YU3 A;  5JVT A;  2CFO A;  3GX4 X;  1JT0 A;  3ABK H;  1NHA A;  2EWN A;  2NYX A;  1QHH D;  5J3L A;  2QUF A;  2YSR A;  1EH7 A;  2ESN A;  3JRB A;  1G8X A;  4XLH A;  5IP6 A;  5CVV A;  4HLX A;  3OYE A;  1WJ5 A;  2JA8 J;  5HDK A;  1GLN A;  2XPW A;  3C3W A;  3K2Z A;  4BQO A;  4IO9 F;  3Q9S A;  3OS0 A;  4U0W A;  4CYC A;  3NAR A;  1VQ7 I;  1K83 J;  4IHX A;  3DEW A;  2LKS A;  3L7W A;  1HQC A;  3ECH A; 
#chains in the Genus database with same CATH homology
 1MMS A;  5GAE J;  3G4S I;  5GAH J;  2E34 A;  3EGV B;  1Y39 A;  2ZJR F;  1FOW A;  1VQL I;  1S72 I;  3CME I;  3CC4 I;  2FOW A;  3CCJ I;  3CCS I;  1QA6 A;  2NXN B;  1YJ9 I;  2E36 A;  3CJT B;  3CCL I;  3PIO F;  1YIJ I;  1FOY A;  1YHQ I;  5DM6 F;  1VQK I;  1VQM I;  3CMA I;  5JVG F;  3CF5 F;  1YI2 I;  3G6E I;  3CC2 I;  3CCR I;  1VQN I;  2K3F A;  4IOC F;  1ACI A;  1VQ5 I;  2JQ7 A;  1VQ8 I;  3CCQ I;  3CJS B;  3I56 I;  5GAG J;  3CJR B;  2ZJQ F;  3CJQ B;  4V19 K;  2H8W A;  1VQ6 I;  3CCU I;  3CCV I;  3CD6 I;  1VQ4 I;  4IOA F;  3I55 I;  1YJW I;  2OTJ I;  2QA4 I;  3DLL F;  1VQ9 I;  4UY8 I;  3J7Y J;  1HC8 A;  2E35 A;  1YJN I;  3CC7 I;  5DM7 F;  1VQP I;  1FOX A;  3PIP F;  1YIT I;  3J7Z I;  3G71 I;  1VQO I;  3CCE I;  2ZJP F;  2QEX I;  4IO9 F;  1VQ7 I;  5GAD J;  1WIB A;  2OTL I;  3CCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...