1PUFB

Crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
b'ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*
publication title STRUCTURE OF HOXA9 AND PBX1 BOUND TO DNA: HOX HEXAPEPTIDE AND DNA RECOGNITION ANTERIOR TO POSTERIOR
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pufB00
1GV2A 3JRDA 1ETQA 3K7AJ 2AHQA 3BR6A 2NVXJ 5C3EJ 2DA2A 1Y1VJ 1W0UA 1QVTA 2DA7A 2LLKA 3JRHA 2YU9J 2OF7A 1ZK8A 2FJ1A 3RQIA 4M6VA 2VPRA 3S1MJ 4D7MA 5IOZA 1JTYA 1LFUP 3S1QJ 1DU0A 3GTGJ 4MLOA 2ID6A 3BG5A 4BXXJ 2EH3A 4X1EA 1K83J 2HOAA 1X2MA 1Q1VA 1Y1WJ 3BTCA 4JX4A 2CQQA 5K7FA 3HOYJ 3CMYA 1PUFB 1SFOJ 1JT0A 4JP0A 2G0EA 1XG1A 3A03A 4FISA 2EZLA 3HBLA 4DYCA 1MSFC 2DA6A 2M9HA 3IH4A 2KT0A 4MFEA 3UKGA 4JX5A 1ETXA 3S2HJ 4XK4A 3VPRA 4M3FA 2X48A 5FJ8J 4X6AJ 2JA6J 1E3OC 1BJZA 1FIAA 5F0CA 2R0QC 1LFBA 4C3HJ 3F0CA 4CYCA 3ZQLA 1CQTA 3I4NJ 1JJ8C 5DS9A 1TWCJ 4AUXA 2ME6A 3WHBA 2FD5A 3IH2A 4XICA 1VFCA 2HDDA 1K61A 2E2IJ 3BTLA 1JUSA 2VI6A 1B72A 1POGA 1MBEA 1IG7A 3BR2A 1I3QJ 1UG2A 1JKRC 5IYDJ 4A69C 2CJJA 3L1PA 1RESA 3TW7A 5IP7J 3S2DJ 2Y31A 2MSYA 1FIPA 2OPTA 1GDTA 3BG3A 3FIWA 2R5ZA 1RPWA 1TWHJ 5M3MJ 2GM4A 5EZGA 2VKEA 3BR3A 1MBFA 4C3IJ 2DA5A 1ETKA 2HOTA 3CQZJ 1RR7A 1WI3A 3ZQHA 5EDNA 3E7LA 3QPSA 3Q0UA 3GTMJ 1F43A 1RKTA 1T33A 3OIOA 2HI3A 2MW8A 3C2BA 1HF0A 3HKZN 4LOCA 3RKQA 4XRSA 3Q3SA 2Y0SN 4V2FA 1F36A 3MN2A 4BBSJ 2XGCA 1B8IA 4A3MJ 3GTJJ 5J1RA 4MFDA 1Z77A 3ZQFA 1ETVA 4A3JJ 1O4XA 2M0CA 2B63J 5EYRA 5EGOA 5C4JJ 4IHXA 5C44J 5FKNA 1YRNA 3SFIA 3A01A 2XPWA 2R93J 1WH5A 1ZTRA 2D5VA 3W6VA 2VUMJ 1AU7A 3FK6A 4DZJA 3JRAA 1U9OA 4BY7J 2IEKA 5E3LA 2E19A 2XB5A 2E2JJ 4ABZA 1JKOC 5F1JA 2XSDC 2N8GA 2Y9ZA 3BR0A 3ZOBA 4QTRA 1ZR4A 3QQAA 2L7FP 5EG0B 4C3JJ 1ZQ3P 2ECBA 2EZKA 1X2NA 3JRBA 3JRGA 3PM1A 3HOUJ 4DYQA 3IV5A 5EEAA 4UUSB 2K9QA 2HYJA 3BR5A 4RDUA 1TWGJ 5IP6A 1A6IA 5F0HA 2K9SA 2E1OA 2O7OA 2XB0X 1IUFA 1P7IA 4M3GA 4IHVA 4EEFG 5BNGA 3RZDJ 3CCYA 2K9NA 2LK2A 3NARA 2DMQA 1MH3A 2JK3A 5IYCJ 5FKOA 4A3IJ 4XRSG 1ETOA 2Y2ZA 4HNVA 3GTQJ 4BKXA 1ZKGA 3GTOJ 4M3EA 2VKVA 3BR1A 1ETYA 4A3FJ 1QRYA 2WB1N 1I6HJ 1FTTA 4M3BA 2ELKA 2IBDA 2L7ZA 3S14J 1JT6A 2DN0A 4IEJA 2DA4A 3HGYA 2Y30A 3G1OA 1U8BA 1BA5A 1WCMJ 1U78A 3S16J 2HOSA 2ID3A 4MIMA 4QSHA 1D5YA 3S1RJ 1MBKA 1I50J 3BQYA 3I4MJ 4BBRJ 5IOYA 2NOGA 4UUTA 1IDYA 3HDDA 1UMQA 3QPLA 1OJLA 3DEWA 5J3LA 1ZGWA 3JRIA 1U9NA 2DA1A 3NAUA 4G12A 4A3GJ 3BTIA 3GTPJ 1AKHB 3OOUA 2HXIA 3K2AA 3PO3J 3Q0VA 1FEXA 3S17J 2CU7A 1EF4A 1DU6A 3ZQCA 3H3VK 3MVPA 4W97A 5DTDA 2X6OA 3BT9A 2KDZA 2XGEA 1PUFA 3TP0A 4XIDA 1JKPC 1ENHA 1ETWA 2XGDA 3JR9A 3OSGA 2JA7J 3BTJA 4M3DA 2ECCA 2LY9A 1IDZA 5IYBJ 2K40A 2LR8A 2M2EA 4AYBN 3LNQA 2Y9YA 2CQXA 1BW6A 3HOWJ 4AC0A 5FKKA 2MGQA 2LKXA 5F08A 1GUUA 1H88C 3ZQIA 1P7JA 5E3MA 3CDLA 1AHDP 2R7ZJ 1JUMA 3GBGA 3SDGA 1MNMC 2JJ7A 4A3CJ 2CUEA 3SJMA 1TWAJ 1IV6A 3JRFA 2LVSA 4B1RA 1ITYA 4A3LJ 2LP0A 4A3KJ 1ZR2A 2X9DA 5E3OA 1VNDA 5FKMA 5HODA 2WAQN 2M34A 5JLWA 2LFBA 1LE8B 4A3EJ 5F04A 1G2HA 1WH7A 2CUFA 4D5FA 2QF7A 4Y7NJ 3S1NJ 1X58A 2LTPA 2L7MP 3LOCA 3HOXJ 2P81A 5IP9J 3GTLJ 2NS7A 5M3FJ 2ME0A 2ZB9A 1IJWC 1QVUA 2NVYJ 4S0HB 2EZHA 4I76A 3TW6A 2W48A 1A5JA 1XC5A 3HGGA 3M3YJ 1IRZA 3FK7A 3S15J 3ZQGA 1T56A 2R5YB 2I10A 2DMTA 4FCYA 2PMZN 2FX0A 1VI0A 2TCTA 1JKQC 1QPIA 4L5EA 2YS9A 3BQZA 3G1LA 4C2MJ 1WPKA 3Q0WA 4D7NA 1ORKA 4V2GA 2COBA 2QCOA 2JMWA 1B72B 1OCTC 1H89C 4A3BJ 5EZHA 1OCPA 5K7ZA 5GP9A 5M5XJ 1JGGA 3LSRA 2H8RA 2DA3A 1RETA 1OFCX 2LD5A 1W0TA 2EBIA 1IC8A 2IAIA 1JJ6C 4XRMA 2R92J 2MG4A 2R5ZB 4IHWA 4DW6A 4GFBA 1FTZA 4J19A 1LE8A 2DMNA 3MKLA 3TEDA 2FQ4A 1NTCA 3GTKJ 5FLMJ 1SANA 3LSPA 3HM5A 3OSFA 5EG0A 5M5WJ 4DYRA 4B3AA 4FE4A 2JA8J 2NS8A 5K7HA 1JTXA 2TRTA 4B4CA 4QIWN 3LSGA 3TP3A 2R5YA 1B8IB 1APLC 3H0GJ 3HB9A 2JA5J 2HQ5A 2XPUA 3PO2J 4UUSA 2L9RA 3JREA 5F0FA 4IHYA 5EGOB 2WV1A 3HOVJ 3FISA 1TWFJ 1YRNB 1BW5A 3A01B 3B6AA 2XRLA 4RBOA 5M5YJ 3O8GA 5GPAA 2CRGA 1TC3C 2JN6A 3B6CA 1NK2P 1GVDA 3M4OJ 2HXOA 2DMUA 1Z0XA 4I6ZA 2JWTA 3LSJA 1H8AC 2EQRA 1GV5A 2GBYA 3WHCA 2GLOA 3RZOJ 3FKIJ 1BL0A 3IH3A 5EF6A 1WGXA 1MH4A 2RAEA 2NVQJ 2NVTJ 1R9TJ 2DTZA 3HOZJ 4W1UA 4Y52J 1FJLA 2E2HJ 3JRCA 3G1MA 2DJNA 1RKWA 1NK3P 4DZPA 1MSEC 9ANTA 4NDLA 1MBJA 4FTHA 5F27A 4JX6A 5J1YA 1HDPA 4MO7A 3DCFA 3BG9A 1MBGA 3O8HA 1S7EA 1XS9A 2M8GX 1GT0C 1HLVA 1HOMA 2DMPA 1AKHA 5JLXA 3HEFA 4FE7A 1JUPA 2AO9A 5FLVA 4JYKA 5IPAA 2O8KA 1UHSA 2YUSA 5E3NA 4BY1J 4A93J 4A3DJ 3A02A 5C4XJ 3D1NI 1VF9A 5FKLA 4D5CA 5J1UA 1HCRA 4CYCB 2L0KA 2XPVA 2EZIA 2H1KA 1MBHA 1HDDC 5GPCA 1IGNA 2O9LA
chains in the Genus database with same CATH superfamily
1GV2A 2EFQA 3BROA 4HV6A 3JRDA 1IN7A 1ZG5A 1ETQA 1YS7A 3OYLA 2DK5A 3BR6A 1BOBA 1Y1VJ 3RKWA 2LLKA 1ZK8A 3S2WA 4IRHA 2FJ1A 1IZ1A 2VPRA 3S1MJ 3ERED 4O3MA 4PFPA 4P55A 1U5TB 3K1NA 4IPAA 3VOEA 4I01A 3WTYC 4F55A 2LF7A 1JTYA 1LFUP 2CQ7A 3BPVA 1XCBA 4RLFA 4BQOA 3GTGJ 1KQ9A 2FBKA 4BXXJ 2VLAA 2EH3A 4X1EA 2HOAA 3H3ZA 5FD6A 3DLAA 1Q1VA 1Y1WJ 2VODA 1BC8C 4JX4A 1T8IA 2FA5A 2P7CB 1B9MA 2FQ3A 3ULQB 2ZJ2A 4GYIA 4BAYA 4RGRA 2QKMB 3OYCA 3HBLA 1RRJA 3WU2C 1ZLJA 4G6DA 4RB0A 2VB6A 3I59A 2UWMA 2M9HA 2ZSHB 1ON2A 5FB2A 4WWCA 2L7KA 4M3FA 1E3OC 1BJZA 1LFBA 2EINH 2VC0A 4CYCA 2F5EA 3ZQLA 3P7NA 2ME6A 4KN7X 4XLHA 3V42A 1VFCA 3S3MA 4UB6C 1D5VA 1ZG3A 3HZJA 2Q1ZB 2IS4A 2P7VB 4TV7A 1IG7A 2KP6A 3U2RA 2ZXIA 1UG2A 1I6XA 2AQEA 2OQRA 3I3LA 4A69C 1ZGAA 2CJJA 2RNGA 2K9LA 1RI7A 3L1PA 2L02A 2D2WA 1PVEA 4CGZA 4PCQA 3I0TA 4GCVA 3SEZA 1TNSA 2Y75A 1FIPA 2E34A 4BUPA 3L2RA 1PP8F 1BJAA 3I4PA 4IVNA 4S04A 1RPWA 5M3MJ 2GM4A 2M0MA 3DPLC 3OL4A 3BR3A 5EZGA 2DA5A 2DFIA 1ETKA 5GADJ 2QBYA 2DFHA 5LEKA 2DO7A 4E70A 3GVAA 3ZCOA 2IS1A 3GW2A 1X1AA 2BVMA 1IXCA 4LK0F 1WJEA 1T33A 3ISPA 3U9GA 3WTTC 1XN7A 2MW8A 1HF0A 3HKZN 3ZN1A 1HXDA 4XRSA 1LDDA 3AAFA 2BEOA 1QBJA 2Y0SN 2A69F 2HDCA 4BBSJ 1FWZA 4NUBA 2ICWG 2VQHA 1Z67A 3CMMA 1STZA 4CSWA 4WCGA 4A3JJ 2DQLA 4GGGA 2M0CA 2P6SA 5HS7A 2M30A 5C44J 2DTRA 5FKNA 4ESFA 2HDWA 1YRNA 2R4GA 3SFIA 4P5OA 3GWZA 2XPWA 1Y6IA 2R93J 2VT3A 4XLPF 1UFMA 2IEKA 3TO9A 1B59A 2ZXWH 2ELHA 1FBUA 2XB5A 2MLKA 4EJTA 1W7PD 1I3AA 5CVIA 1JKOC 5F1JA 4B48A 3CC2I 4U0WA 2DOAA 2N8GA 2H8WA 3BR0A 2Y9ZA 2EILH 4QTRA 5ICEA 3E3VA 3E5XA 5TRDA 3GMEA 3OR2C 3GUDA 3ASOH 4GXOA 2WV0A 5JFRA 1BR4A 2OCCH 2COMA 4C30A 2P4WA 3KZIC 2Y0MA 3O2PE 1QPMA 3DPTA 1OMIA 3L00A 3WTXC 3FXUA 5EEAA 2K9QA 2HYJA 4EJOA 2GOMA 3EQLF 4HPQA 2KLOA 1V5EA 2DQRA 5F0HA 4M73A 1P7IA 1LFPA 2X0LA 4EEFG 5BNGA 2L5QA 2K9NA 3FBNB 3GZ5A 3FHNA 4KT6A 3M1CA 5B5EC 2JK3A 3F9KA 4ZDOA 2M87A 4N9IA 3GTQJ 3EUHA 3DV8A 4UV8A 2FU4A 1R36A 1ON1A 2JQ7A 5GTHC 2R7DA 5DD8A 3HPGA 2BOLA 4BS9A 1OLTA 3K69A 4IEJA 2HYGD 3HGYA 1R1VA 4XKCA 1U78A 1YG2A 2JTVA 3U1KA 3Q5FA 3E97A 3VYRB 3DBLB 1HC8A 3BQYA 4LB6B 2KIQA 5E18F 1IF1A 5L3GA 2X4HA 4I02A 1IDYA 2XV4S 2HQRA 2GXBA 3C3WA 4YEJA 3NAUA 2VN2A 5ILSA 5BOXA 1AKHB 3E6BA 3G73A 1U6GA 1SAUA 1EKEA 3S17J 3VYSB 2CU7A 2X1CA 2VKDA 3K4LA 4DBQA 1MZBA 1P4XA 2YSRA 1IUYA 1MJ9A 1O3RA 2X6OA 3U1DA 4ZC3A 3MMYB 1C0WA 1PUFA 4XIDA 3G6EI 1JKPC 4L9TA 1R23A 2XGDA 2R7WA 3L2WA 3GF2A 2FOKA 1J75A 2Y9YA 1A35A 3K0LA 1R00A 5FKKA 4LITA 4E7IA 2LY2A 3BG6A 4RM3A 2W25A 3IAS2 4OIRF 1P7JA 1S7OA 5A2QK 3CDLA 1AHDP 2VOOA 3N05A 3GBGA 1N77A 2F48A 3OYIA 2M3AA 4LIVA 4A6DA 3SJMA 1TWAJ 3G2BA 3S93A 3JRFA 5KCMA 2VQLA 2OUMA 3H5NA 4KYWA 2HS5A 2X9DA 1ZR2A 1LEBA 2F2EA 1VNDA 5FKMA 4JBAA 2WAQN 1S8NA 5JLWA 4BJ6C 3OYMA 1G2HA 3LA3A 1WH7A 4Y7NJ 5LGTA 5CJ9A 3CUQC 4HQEA 2LTPA 2DCEA 1UHWA 2NS7A 4RGXA 4WXDA 1R58A 4I76A 2M5WA 2VJ5A 1YO5C 2RC4A 1I1SA 2O0YA 3FK7A 1S72I 5GAHJ 3S15J 2EV5A 2VC1A 3LSTA 2BHZA 4K2EA 1U0JA 3HJEA 3D0SA 2FX0A 1VI0A 2TCTA 2UXXA 1D8JA 2HTJA 3I64A 2PI0A 1WPKA 3F8NA 3Q0WA 1ORKA 1XSDA 1QZYA 4A5MA 1OCTC 5TJJA 1NHAA 1V54H 1E3PA 3LMMA 1SFXA 3NRVA 1XCVA 2H8RA 2V4JC 2VT2A 1VQ9I 2XF6A 1Y8RB 2R7OA 3D5RC 1UB9A 3PQJA 3L2CA 1KYZA 1WJBA 4IF4A 2JRMA 1OQYA 3HUGA 1MMGA 1IC8A 1JJ6C 1MMAA 4CCMA 4IHWA 3O3KA 1IN4A 1V4RA 2KIFA 3KYCB 3LSMA 3CCEI 1LE8A 4D9JA 4HF2A 3MKLA 2DT7B 1GXQA 2YPRA 2O3FA 1UELB 1ULYA 1WJAA 2ZJQF 4EJUA 4AIJA 1JI8A 2YR2A 3FF5A 1N78A 4ZJZA 3HRTA 3FM3A 2XVCA 1VQ4I 1HW2A 4RLQA 2DFEA 2JA8J 3DU6A 3H9JA 2BW3B 1JTXA 4EJVA 2DXIA 1G3WA 2K86A 4A5NA 4QIWN 4BQNA 4I0BA 3TP3A 5J8CA 1APLC 5LRSA 2D1HA 5D5WB 2JA5J 3ZMUA 5B1BH 2EFWA 1P9QC 2KKOA 4U87A 4CO8A 2A3SA 3S32A 3ZQ7A 3JREA 1VQLI 3F8FA 1G3SA 2WV1A 5EGOB 1A6QA 1BW5A 5E8GA 3A01B 3B6AA 3FHZA 2F5FA 3QU3A 3CCMI 1IRGA 4XQFA 4RBOA 2W57A 4MQ9F 2OQGA 1OYWA 2DPUA 4P9UA 3M4OJ 1X4PA 2DMUA 2KIUA 2QKLB 2RREA 3CZ6A 4E7JA 2PFBA 3KYLA 2JA2A 4F7ZA 5E8IA 4Q5SF 2XAFA 1IN5A 1SVOA 3WHCA 1UG0A 5LGUA 1BL0A 3AL0B 4LLGF 3ZGKA 4R1HA 2RAEA 1SD4A 4C2UA 4IJAA 3AG1H 4A6EA 4ENKA 2VASA 1R9TJ 2O8XA 2MBFA 2RN7A 2HVSA 5E1ZB 1X1CA 1W5SA 2X1DA 1PUEE 2ETHA 2EWNA 3OMYA 1FJLA 3JRCA 1YJNI 3LWFA 1YYVA 2X6WA 2E1CA 1NK3P 4DZPA 1S7AA 2BBYA 2ZSIB 3PNYA 1MBJA 2UV1A 4JX6A 5H2FC 3K2ZA 3DCFA 5ILUA 2NVUB 4BHBA 3WTVC 1IW7F 3BJOA 2HWVA 4AWXB 5JLXA 3WGIA 4II2A 2I5UA 5IPAA 3C2HA 2O8KA 5E3NA 1D1CA 4BNCA 2HZDA 2DU9A 2QLZA 1VQOI 3ABTA 4A3DJ 5C4XJ 1VF9A 3ERMA 4ZH4F 4PFOA 4D5CA 2GQQA 2HYFA 5J1UA 4IRIA 2RKHA 2GWRA 1SD6A 3A4CA 3T8TA 1S5LC 2L0KA 3IL2A 2CSOA 1MIJA 2GZWA 1EA3A 4NB5A 5D4RA 4BL0B 1VQKI 3HOZJ 1F5TA 5DCMB 4XORA 3RTRA 1S29A 4EM2A 1W36C 5C3EJ 4LJZF 2A6HF 2EB7A 2Z5UA 2M4GA 5D8LB 2OBPA 4OMYA 1W0UA 2DA7A 2EFOA 2ZFUA 3DEUA 4B43A 1YS6A 3JRHA 2YU9J 2OF7A 1FMWA 5IT9K 2RVCA 1TQIA 1HKSA 2NYXA 4G7ZF 2WTEA 3M1EA 2OZUA 1QHGA 3DBHB 1YFHA 2QWWA 3PL8A 2VKHA 2EV0A 1R7JA 5FGMA 1K83J 3L7WA 4FT8A 4P9FA 1X2MA 1B6AA 3BTCA 2CQQA 1SD7A 2OV7A 5L3EA 3A03A 2EZLA 2NXNB 3JW4A 1WSUA 1TBXA 1IN6A 3ZMSA 2L9NA 4HEA2 5E1XA 4KMFA 3K1MA 3K4BA 3MZYA 1MSFC 2P6TA 2A61A 3IH4A 4MFEA 4DJAA 3UKGA 1KQ8A 1R4NB 3BZKA 1BOAA 1OPCA 4XK4A 5FJ8J 3CJRB 2XKPA 4ASNA 3QYFA 3KCCA 5F0CA 2R0QC 4C3HJ 3FXJA 3K4JA 4I7HA 1P4AA 3TKYA 1CQTA 2KRHA 2L01A 4I99C 1TWCJ 2CS3A 4BU2A 4AUXA 1T38A 2FD5A 2FOWA 2AXLA 2MYSA 1VZ0A 2K5CA 3G4SI 4Y33A 1WZ2A 2E2IJ 3BTLA 3EUKL 3QP6A 1XPXA 1I3QJ 4ZYAA 5KHDA 1BI2A 1JKRC 2QQ9A 2P8TA 2LY1A 2RQPA 3KEOA 2JUCA 1ODDA 5B3SH 1KU9A 2NNYA 5IP7J 2B7EA 2OPTA 1A04A 1LKXA 2CO5A 3T5XA 2JT1A 3FIWA 5AONA 4PSWA 3MKZA 1TWHJ 3I5UA 3JTGA 3MQ0A 3CQZJ 4LG0B 3HRUA 1Z6TA 1WI3A 2M1BA 3GFIA 2Q2EB 2WAFA 3FKJA 3K6GA 1J7KA 3S3OA 3Q0UA 2P5VA 4IRGA 1QHHD 3C2BA 4FETA 3J81K 1X3WB 2HOEA 1QGPA 5DCFA 2LDUA 2K4BA 1SEUA 2C6YA 4V2FA 1D3YA 2D45A 1YX3A 4P1WA 3LSKA 2BVLA 3KX2A 1B8IA 4J00A 1V5FA 1D1AA 1ZG1A 2DDAA 2WAQA 4HF0A 4AIDA 2OZ6A 4A0ZA 1ZLKA 1YW7A 2B63J 3IHUA 4NC8A 3JSOA 1T08B 3BWGA 4IHXA 3E6MA 2XASA 2W82A 3AKZA 2H6BA 5JHFA 3SYTA 1W5CC 4L9VA 1ZTRA 3W6VA 4HG2A 3FK6A 3KP2A 1U9OA 3AL0C 2JVHA 3ZMZA 3W2AA 3J80K 2QQBA 4N4NB 1H9GA 4XN0A 4IOAF 2V1XA 2W1OA 5DYMA 1WQ2A 3D5LA 2E2JJ 2UXNA 4ABZA 3V7RA 2XSDC 3CD6I 1TLHB 5F6FA 4N0BA 3OIQA 3QPHA 2L7FP 5EG0B 2BY2A 3CUQA 3CUOA 5HNHA 3DKXA 3LA7A 2ECBA 2EZKA 1X2NA 2OAZA 2ZXHA 3ZXSA 2VQCA 2BY1A 2Q0OA 4M9SA 1P2FA 4BEHB 4BDYA 3PM1A 3JAMZ 2JVGA 2QVOA 4DYQA 3HOUJ 2E71A 2VE8A 2LSOA 4UUSB 3TQNA 1XGOA 4RDUA 3PJRA 2R7RA 2E1NA 5LBQA 4IHSA 2QQAA 1A6IA 2XUBA 1IXRC 3FXOA 1MJBA 4IHVA 1YITI 1XDUA 2A5WA 3MZ8A 1UCRA 1W7PA 5HDNA 3CCYA 4XLCA 3SEQA 2LK2A 4BXUA 2CW8A 1MH3A 3DEEA 1K4SA 4IXAA 1ETOA 3QPTA 4OU0A 3B73A 3G3ZA 3OYAA 2M8EA 5EEHA 4M3EA 1J2XA 3Q9VA 3BOQA 4P96A 1HKQA 3I71A 1OCCH 1RIOH 1FTTA 4ESJA 2IBDA 4M72A 4XL9A 2EPFA 4ON0A 1RUNA 2Y30A 4EQQA 3G1OA 1YI2I 2KISA 1UHMA 1GXPA 4HF1A 3OS1A 4I98B 3O6BB 2J5OA 4A0XA 3S1RJ 2CYYA 1D5YA 4OWRB 1I50J 1MD0A 4RGSA 2E35A 3I4MJ 2XAQA 5DUIA 2VIXA 4B44A 3ML6A 2XAUA 3SXYA 1OJLA 3DEWA 3E1SA 4UHTA 1BR2A 1I27A 2NS0A 3L9FA 2DA1A 4EM0B 2IS2A 2MLGA 3BTIA 2OTJI 4HW0A 5LEJA 3K2AA 2CQKA 4ZDLA 2X1EA 3WG9A 3PO3J 2G7HA 1E3HA 3PQKA 4BHPA 2LH9A 4OIPF 3VODA 1WI9A 1X4OA 3I54A 3H3VK 4WXCA 3IKTA 4W97A 2GA2A 1XGNA 3R0AA 2JUGA 3BT9A 2F5DA 2XGEA 3TP0A 1TNTA 3AFHA 1A31A 3JR9A 3OSGA 3BTJA 1HSJA 2LY9A 2HEOA 4XLEA 1IDZA 2FUG2 4IHTA 4AYBN 2KQRA 3LNQA 2DAOA 3BJAA 2JPBA 1BN5A 4MGRA 2KJBA 1YW9A 2CQXA 2Z2SB 3KP5A 2MGQA 3CO6C 4BQAA 1V3FA 3E6CC 3ZQIA 2R3SA 3VDXA 2ACJA 1IAWA 1XB4A 3NWTA 5DM6F 2DYRH 3SDGA 5CVVA 3QOPA 1XSXA 4DGWB 1OR7C 4B1RA 1ITYA 3ONQA 1Z91A 1HW1A 4A3KJ 1G6NA 2KPMA 1FMVA 2L2OA 1CF7A 3MAJA 1IO2A 5CLSA 1J59A 1FP1D 4HNUA 2M34A 2FE3A 2LFBA 1ZYRF 4A3EJ 3QWLA 3OS0A 5F04A 1X3ZB 2XROA 1WFXA 1TL8A 4O6JA 1SVMA 2CG4A 2OD5A 3PUBA 3FXLA 1M1EB 2L7MP 2IA2A 3HOXJ 4L9NA 5IP9J 2NRAC 3X2QH 1TT0A 1QA6A 3GTLJ 2ME0A 3I59B 3GEZA 1IJWC 1MGTA 3WGHA 2PMZA 4S0HB 2W48A 4CDGA 1A5JA 3M3YJ 4G7OF 1LPQA 2JPCA 3ZQGA 3K70D 1WJCA 3BCBA 1VQMI 3ZQQA 3IKVA 2R5YB 2IJLA 3FDYA 2DMTA 5LHHA 3LSIA 3SZPA 1GHCA 1SFUA 2YS9A 1YLFA 3G1LA 4CCNA 1ZRDA 2O61A 4V2GA 2COBA 4CCOA 1H89C 1X1PA 2E7XA 2HPMA 5EZHA 3A2KA 4KUMA 5GP9A 5M5XJ 3GLLA 1JGGA 4ZTJA 4M6YA 5BPIA 4MQVA 3KEQA 2LD5A 1QNTA 5CPRB 1K6OA 1D0YA 2W85A 2MABA 4BE2A 2R92J 2MG4A 3QP5A 4ANJA 4J01A 2EK5A 4ZDPA 2X6YA 2L54A 4GFBA 2QBYB 2DMNA 3HPHA 3TEDA 1KYWA 5FLXZ 3VWBA 4GYGA 1LB2A 4MEXF 1EH6A 5L3FA 5AIPA 2A05A 3HYIA 1U5TC 2LREA 3CDHA 3ZP5A 1SANA 4UUVA 4XKWA 1BIBA 2E1MB 1SMYF 3LSPA 1VQPI 4IKFA 3OSFA 1VQNI 4ENMA 4RB1A 2PJRA 4HYEA 3S3NA 1VQ6I 3R6SA 4B3AA 4IZZA 2TDXA 4O5VA 4Y3OA 4AD9A 1FYMA 4RA2A 4G6TB 1G8XA 2BHYA 3LQQA 5BQTA 2W00A 1J0RA 1XX5A 3FM5A 4CZCA 1RR8C 1G3TA 1DUXC 4CYDA 2IT0A 2ZFWA 1TQMA 3ESWB 3JTHA 3OS2A 3HOVJ 1QO0D 5E1WA 2YU3A 2DBBA 4Q48A 5JI6A 1YRNB 4M9ZA 4XM3A 4XR6A 4XKVA 4LGWA 4AVZA 1K78A 1K7AA 2GXGA 4DIQA 3E5UA 2Y69H 3RKXA 5GTIC 1VQ8I 1Z0XA 3H5AA 1H8AC 2GIZA 1P6RA 1XTAA 3GFJA 2EQRA 3BDDA 2ELJA 2GLOA 3RZOJ 1DGRM 3G71I 4RGUA 1EH8A 4KIFA 5KAIC 5KAFC 5EF6A 3F22A 1WGXA 3IWFA 5H6QA 2V6CA 2ZNYA 3A0HC 3DP7A 2B9SA 2DI3A 5ICFA 1NH3A 1LUJB 3R0JA 2DTZA 4LMYA 3OYJA 4UVCA 3OL3A 2KJCA 4Y52J 5GAEJ 2E2HJ 3A1YA 1LDJA 2H1LA 4YIFA 2EIJH 2DJNA 3W2VA 2XAJA 3HIFA 3S8PA 5FD5A 3KP7A 1MSEC 9ANTA 1IV8A 4FTHA 1VQ7I 5J1YA 3V8KA 2E5ZA 3BG9A 2BW3A 2QQ8A 1ERDA 4HA8A 3FX3A 4R8HA 2ISZA 4FQGA 4FHTA 3ASNH 2M8GX 4G8XA 1HLVA 1F9NA 2DMPA 4HSTA 4FE7A 1JUPA 2AO9A 2IXSA 2K9MA 4JYKA 2Z33A 4ESBA 2H09A 1JXSA 1XGSA 2L4MA 4BY1J 2HKOA 1W36D 3P5JA 2D1VA 3CP2A 3D1NI 1ZH5A 2MH2A 4B09A 4CCJA 4ZZDA 2O6GE 2F5VA 3GLXA 1N75A 1TT5B 3QYEA 4PDKA 1NG6A 2QM3A 3OOPA 5IT3A 3RPUD 1MNEA 3M8FA 1FOWA 5KNLA 1N25A 4EVIA 4HZFA 2XDVA 1HDDC 3H3UA 1Y0UA 3H0DA 1IXSB 5L3DA 3K7AJ 5LLQA 4UVAA 2NVXJ 2DA2A 1QVTA 1WRJA 1B4AA 4G9YA 2L9VA 1FBQA 3RQIA 3K70C 1MMSA 4ZYHA 2K7LA 3OWTA 1TZLA 3IRQA 2F4OB 3BP8A 2HU9A 2CW0F 5IOZA 3RCOA 1W1WE 4HOBA 2P0WA 3S1QJ 2IVMA 3VB2A 2IA0A 5JVGF 1DU0A 2Z16A 3IC7A 1OKRA 4H0EA 2EFPA 1S3JA 1XMXA 3CP8A 3M07A 4I0AA 2ID6A 3CTAA 2CQNA 4Y4RA 2WAEA 3RKYA 3WODF 1BM9A 2VE9A 2F6CA 2OJED 4ENJA 1PUFB 4JP0A 3H5RA 2G0EA 2RV8A 4XSXF 2FMYA 1X3UA 2IP2A 2NAZA 2XF5A 3KP6A 4DYCA 1U3EM 1XMAA 2HVQA 2KT0A 4PJ0C 4JX5A 3DWLE 2R7VA 1OYIA 3CCLI 2G9WA 3CJNA 4MTEA 1FIAA 4GO1A 4EATA 5E79C 4IL6C 2DODA 3ABMH 3HXLA 1CGPA 2FBHA 3IH2A 4OIQF 2OCEA 3BPXA 5EEGA 1K61A 5DCMA 2HDDA 4JQFA 5E17F 2OU2A 1D8KA 1JUSA 2HFHA 2VI6A 3H9GA 1POGA 1B72A 3VEPA 1MJAA 3HOSA 5LRRA 5LFAA 4F52A 3R61A 4PZJA 4KICA 2HGCA 5IYDJ 1FBSA 3W6KB 2WY7Q 1Y0NA 2MH9A 2X85A 3K9TA 3OIPA 3WGGA 1OCRH 1YX5A 4HDVA 4KIBA 3MKWB 2Y31A 1YIOA 3N4MA 1GDTA 4NBQA 3BG3A 2R5ZA 1KU7A 3OYDA 4BE1A 4FX0A 1MBFA 4Y17A 4C3IJ 3FMSA 1RR7A 2QUFA 3HKZA 3ZQHA 4HQMA 2LBFB 2EV6A 5EDNA 4KDPA 3KYDB 2Y0SA 1XGMA 1XD7A 3GTMJ 4U88A 1SMTA 3OIOA 5HDGA 2HI3A 2PLYA 3CCQI 3MCZA 4LOCA 3RKQA 3R4KA 3Q3SA 2VQGA 4UY8I 1F1ZA 1F36A 3CC7I 1J09A 4YFNF 2ESNA 3HSFA 4KNYA 2H6CA 3OR1C 2DT5A 2PJPA 2DDBA 3NEUA 4MFDA 4I2OA 1KU3A 1Z77A 2VJIA 1ETVA 3ZQFA 5D5XB 3LA2A 3F23A 1FY7A 4E7KA 3CLOA 3SQNA 1D0ZA 3L2QA 3HUGB 4RAGA 5EYRA 5C4JJ 2KRCA 3BC8A 5HOOA 2PQ8A 1R22A 1XSVA 1AU7A 3RYPA 4DZJA 3JRAA 1HKTA 1HW5A 4BY7J 1OR7A 2K02A 5FRNA 2E19A 2RNJA 3CESA 1I5ZA 3M8EA 1USTA 4KITB 3ZOBA 1W5TA 1ZR4A 2F4IA 3EYIA 2DLLA 2RDPA 2AXTC 2HQAA 4LG0A 2GOXB 1T98A 2R7UA 2K3PA 2NOJB 3P9CA 4AIHA 2ESHA 4WK8F 1ZQ3P 2H27A 2Q2EA 4KJZA 4NQWA 4V19K 1LDKB 3JRBA 5FO5A 1F4KA 1AOYA 3HRSA 4FASD 1Y56A 3IV5A 1JHFA 1H9TA 2FRHA 1WWXA 4KT5C 5K5RA 3H35A 4N9HA 1TWGJ 3RI4A 5IP6A 1YJWI 3GFMA 4ITVA 4CHUA 3HTSB 2XB0X 1IUFA 1U8RA 2V1UA 3K4NA 3RZDJ 2VBZA 3FXKA 2DMQA 4IOCF 3WG7H 5IYCJ 1QU3A 4RAFA 4OMZA 4DBRA 2LG4A 3CCJI 4BKXA 1FOXA 3KLOA 1D0XA 2BXZA 3FXRA 4JOMA 1ETYA 3K4CA 4XONA 2IGOA 2WB1N 3TO6A 1I6HJ 2DFFA 1KU2A 3CCVI 4M3BA 1DGWY 3MD2A 3H92A 2DA4A 3GX4X 3KE2A 3F72A 1WCMJ 2HOSA 2STTA 3DBRB 2HPIA 3DKYA 2F5CA 1ZN2A 4F91B 1MBKA 2LNBA 2I8DA 1I1GA 3ZR8X 1FC3A 4UUTA 1IRXA 2FXAA 1UMQA 3BCAA 4AIKA 2JZYA 3KZYA 4CA0A 2HR3A 5K5QA 5FRMA 1U9NA 1U5TA 3VYTB 3DTIA 3PIOF 3HL2A 4A3GJ 2HXIA 2KIMA 4CCKA 1A36A 3ZMTA 3Q0VA 2EA4A 1EF4A 1DU6A 2Z99A 3JCUC 4M71A 5LD2C 3ZQCA 4LD5A 2FNAA 1ZGJA 2AQFA 4AU7A 3COAC 1USSA 2VXZA 2ZXJA 1EJ9A 2KDZA 4NNJA 2O03A 1JGSA 1FP2A 4H4KC 3L2VA 1R6RA 4G7HF 1ETWA 2JA7J 2K85A 2ZNZA 5IYBJ 2LR8A 2M2EA 2RGVA 2ZC2A 2KMUA 4MNUA 4BYYA 5GAGJ 3HOWJ 4AC0A 1MDMB 2LKXA 4HDUA 1GUUA 4BDZA 1H88C 4XBFA 2FSWA 3F8MA 2EJRA 4D1QA 2WY8Q 3ABUA 3IAM2 2R7ZJ 1VTNC 2HZTA 1R1TA 3PSIA 1YTYA 2W4SA 2JJ7A 5F1RA 1K4TA 3I9V2 2CFXA 4BJTA 4HLYA 1OCZH 1V5GA 2JSCA 2L9SA 3HSRA 4KMUX 3GZ6A 1FX7A 2PBIA 3SFZA 1KA8A 3QRFF 1T6SA 5E3OA 2MA3A 1J5YA 2G7UA 1WJ5A 5HODA 1Z9CA 3QAHA 2BY3A 4LLLA 3TDZC 3E0JB 2Q8KA 4D5FA 1G4DA 2LOOA 2QF7A 1PYVA 4U7DA 3S1NJ 2ZMEB 3KP3A 3I56I 2Z9OA 2QYOA 4QPOA 3LOCA 2P81A 1MKMA 3FWEA 2DK8A 1QZZA 1B1BA 3RQ4A 4E6KG 5J4YA 2NVYJ 3MFKA 4D0PA 4YIRX 2EZHA 2R7SA 2DOEA 3ABLH 2GA1A 3OYNA 3HGGA 3BG7A 4CUGA 4Q4ZF 1Z21A 4Y15A 4L5IA 4BHCA 1S9HA 1T56A 2I10A 5AIQA 3H1CA 3CCUI 1JKQC 3QU6A 1QPIA 3NQOA 3KIOA 1UZCA 1KGSA 3BQZA 1YQAA 4R79A 4D7NA 1BC7C 2QENA 2QCOA 3FXQA 2HQNA 5H6RA 2VL8A 3BZ6A 2QSGX 5J4VA 3F6VA 2LRDA 3DQVC 4RMNA 2DA3A 2XAHA 1OFCX 1MMDA 4XLNF 1W0TA 2MD5A 3PFIA 2A6EF 2EBIA 3WTWC 2QGUA 3KP4A 5DDGA 3DLLF 2IAIA 2YX4A 3FMRA 2DOFA 4L18B 1HQCA 2PEXA 5CVJA 2CV0A 2HKXA 4DW6A 1K79A 3DTKA 4XRFA 5E20A 1ZHFA 3V4GA 4BH9A 2ZO4A 3CMAI 4XNFA 1SC7A 3PIPF 3ECOA 2O5RA 2FQ4A 1R71A 2FEZA 1NTCA 3E5QA 5HVQC 4BACA 3GTKJ 1KQ0A 3EYYA 3HM5A 1IN8A 4XLFA 5M5WJ 2KL4A 4DYRA 4YELA 2R7FA 4HNTA 1BI1A 4FE4A 4IO9F 3C18A 5K7HA 2TRTA 3CO7C 2V79A 3TDUC 1B8IB 2R5YA 3F8CA 3H0GJ 2EIMH 2IGNA 4A2UA 1O7FA 3HB9A 4NC6A 2KHMA 3OYEA 2KZGA 2HQ5A 3PO2J 3F8BA 3MZHA 5J40A 4CZZA 2WBMA 4ETSA 2FF4A 3FISA 1LVAA 4AVPA 4G6QA 1E0EA 3F6OA 3HG9A 3ROUA 2L3DA 5M5YJ 4UV9A 2VJ4A 3O8GA 5GPAA 2CRGA 1KONA 1TC3C 2JN6A 4ZYGA 5HLHA 3SDBA 1BIAA 1NK2P 1GVDA 1O7LA 2LKPA 4E7SA 3D5SC 4G94A 4I6ZA 3CDIA 3LSJA 4WF2A 1SAXA 4M74A 5HLIA 1GV5A 2K4JA 3WTSC 1WVRA 5F64A 2Z3YA 3KEYA 4I09A 3PSFA 1TTYA 1FOYA 2GXAA 3CUQB 3HC7A 3J7YJ 2VXDA 1WJDA 3JAMK 4PJMA 1P92A 5FROA 1G3YA 3IWZA 3J7AY 3G1MA 2R7XA 1R5GA 3ZRGA 1J9IA 3B02A 3HRMA 3EUAA 2A68F 1G59A 1Z7UA 2UZKA 3H9QA 4ZZLA 4MO7A 4BXFA 3U21A 1AA7A 3ELKA 2FMLA 1OYYA 1S7EA 1W7PB 4NHJA 1R49A 1AKHA 3PNVA 3Q9SA 2HVRA 1UHSA 2YUSA 3BJ6A 4PK4A 1H0MA 4A93J 2DJIA 4QPQA 2E36A 3VSKA 3A02A 3W6JB 3ZMVA 4LK1F 3TOBA 2V9KA 4PJLA 3RIRA 4U7BA 1LNWA 2LF8A 1MW7A 5FKLA 4CXFA 2WC2A 3CJQB 2M45A 2V7FA 5B1AH 4CYCB 3CLQA 4EJWA 2BYVE 4UNOA 2XPVA 2BZTA 3VYUB 1MBHA 5L3BA 3QOEA 5GPCA 5B66C 3MKYB 1IGNA 4C9YA 2MC4A 4II3A 3HHHA 4KIGA 4XN3A 2IGKA 2AHQA 1T39A 3DXJF 5J8FA 2EFNA 2MFZA 4PJJA 4M6VA 3WE2A 1ZAOA 2CW7A 2PMHA 4B47A 4D7MA 5A2QZ 3CMEI 1JHHA 2V1DA 5K1YA 1FZPB 5J47A 2CWEA 3KZZA 2DPDA 2HTSA 2ZMEC 4X0GA 3LAPA 3MWMA 4MLOA 3BG5A 1YHQI 1XMKA 4IX7A 2XSJC 3RPUA 2MD0A 4Y13A 5K7FA 3HOYJ 3CMYA 1JT0A 1SFOJ 3T1BA 2CFOA 1XG1A 4FISA 1ZRCA 2IW5A 2K3FA 2WB1A 4LG3A 1AWCA 3GYHX 1RNLA 2DA6A 5ERIA 5D4SA 1GVJA 1BI0A 2OC6A 2ZBKA 1ETXA 2PMUA 3OY9A 3S2HJ 5CVUA 3VPRA 2X48A 1DQUA 4X6AJ 2JA6J 3KETA 1DPUA 2W7NA 1S6LA 5HNFA 1E17A 3TOAA 4DNCA 3F0CA 3DKWA 1JJ8C 3I4NJ 5TGTA 1Z6RA 5DS9A 2ZKZA 3PNTA 3BZCA 4MEYF 3WHBA 4XICA 1Z1DA 4BQQA 5HS8A 1IRFA 4LIUA 1MBEA 3BR2A 1CF7B 2BXYA 5ICGA 1YOVB 2JRTA 5CVRA 2IPQX 4YIIA 4Z2YA 4NC7A 4KISA 1RESA 3TW7A 3FXMA 3CC4I 3M8JA 3S2DJ 1VQ5I 1LJ9A 2MSYA 5JVTA 3FMQA 1UJ8A 4BE0A 2VKEA 2HOTA 1T2KA 3LFKA 2NNNA 1XDSA 3NWSA 1T0FC 4Q47A 3ZMDA 5HDKA 1UAAA 1LEAA 3E7LA 3QPSA 1ACIA 2DT6A 3IRRA 4ZYDA 1W4MA 3I53A 2V1NA 1RKTA 1F43A 2CV2A 4RAYA 2KRFA 3J7AO 5LHGA 5DD4A 2HNHA 5EJCA 4PUSA 1MNDA 1YJ9I 3MN2A 1TW3A 2XGCA 2VBYA 4MHGA 4A3MJ 3GTJJ 2WA0A 5J1RA 4OINF 2VPLA 3V8LA 1O4XA 2CMPA 1REPC 3AG2H 5TISC 5EGOA 2QA4I 2IA1A 4XOTA 4A12A 2IRFG 5FLXK 3RDIA 1R5ID 3A01A 4YG2F 4F93B 1WH5A 2D5VA 4PGHA 2VUMJ 2LC2A 5FFZA 2BE5F 3UNGC 5E3LA 2ZCWA 1O3SA 2XAGA 4XKBA 2X6XA 4PSXA 3T0YA 2KZVA 4YFXF 3OYKA 3QQAA 2BGCA 4M9XA 2PJRB 1HSTA 2CGPA 3KFWX 1K6YA 4C3JJ 2LBFA 2KFDA 1Y8QB 3M7GA 3UR3C 3CCRI 3TMOA 1O3TA 2E60A 2XIGA 3R60A 1Z7LA 3JRGA 1Y39A 3WU0A 4JK1X 2E5NA 2IGMA 3KLNA 5ILVA 4ENNA 2CV1A 2F4MB 3E6DA 4QWQA 2VJJA 3BR5A 2E7WA 4FX4A 2AS5F 2DW4A 2H94A 5D5UB 4U0YA 1Z3XA 3JSPA 2K9SA 2E1OA 2O7OA 2KDOA 1HBXG 4M3GA 3CF2A 2CUJA 1TP4A 1NG7A 3BY6A 1X1DA 3NARA 1K78B 5H20A 1FLIA 2UUZA 5FKOA 4A3IJ 1ONVA 4XRSG 4RB2C 1YIJI 2Y2ZA 4HNVA 4EGYA 3GTOJ 1ZKGA 4KFCA 1X1BA 3C2GA 2VKVA 3BR1A 4HBLA 4L5JA 3A0BC 4A3FJ 2X51A 1QRYA 1ZELA 2EA2A 5KK1A 1YE9A 3W3CA 1GLNA 3DPUA 3OYHA 1T95A 2ELKA 2L7ZA 3S14J 1JT6A 2PG4A 2DN0A 3K1PA 1MMNA 1DP3A 1BA5A 1SFKA 2ISYA 3OYBA 1U8BA 4ZTFA 3S16J 1WHUA 2ID3A 3HTUA 4MIMA 4QSHA 2XC7A 2A07F 2FBIA 2A6TA 1L0OC 2V26A 4LB5A 1D1BA 4UB8C 4BBRJ 4IQ4A 5IOYA 2W24A 2NOGA 2YX7A 2QEXI 3HDDA 3WU1B 1BBYA 3K4MA 3QPLA 5J3LA 3V8JA 3OYGA 2M7AA 2VONA 1ZGWA 3JRIA 4BJ5C 1R4MB 4G12A 4LLNA 1FYLA 5IT9Z 3TGNA 4DQ2A 1JE8A 3GTPJ 3OOUA 5LHIA 1RUOA 1FEXA 1FSHA 1QZEA 3HHGA 3F3XA 4AYBA 3MVPA 5CQEA 4OAZA 5DTDA 4A0YA 2E1MC 4RM2A 1DDNA 4IQJA 5BS6A 5FFXA 4UVBA 4GDFA 1ENHA 4HV5A 3IP4B 4M3DA 2ECCA 4Z6YA 4PJNA 2K40A 1ZARA 3PFYA 1Z3YA 4B3XA 3CJTB 1FSEA 4XSZF 2B0LA 5HS9A 2VBWA 3H36A 5DM7F 1BW6A 1LQ1A 1BI3A 5F08A 5K5OA 3N97A 3P9KA 3FBIB 3QODA 5E3MA 1PP7U 2MC3A 3EETA 4EV0A 4HX4A 5BPDA 1I39A 1JUMA 4PGGA 1MNMC 4A3CJ 2CUEA 4EMSA 1U2WA 4LFUA 1IV6A 4YFKF 4HRIA 1OISA 2LVSA 2QSHX 4S05A 2VOPA 2XHKA 4EM1A 4A3LJ 4L0YB 2LP0A 1DP7P 2R7QA 3HSEA 2RQQA 1OCOH 5JR3A 1WJFA 2DYSH 1RZ4A 1B9NA 1LE8B 4CH7A 4ZYEA 2CUFA 4C2TA 3FZVA 3F21A 3REOA 1X58A 2BY0A 3M9AA 3KPHA 4RB3C 1SVLA 5M3FJ 2ZB9A 1TQPA 1QVUA 2EIKH 1FNNA 3DU5A 4N4OB 3TW6A 1ZREA 1XC5A 3PUFA 4GRIA 4WX9A 1IRZA 3MEXA 2OA4A 2WWYA 3WE3A 3SZTA 4DOZA 1RC9A 4RS8A 5JHUA 2Z1DA 4FCYA 2PMZN 1V55H 3ZN0A 2ZJRF 3TBIA 5DEQA 4L5EA 2Y48A 4C2MJ 5BMZA 4F3QA 1MDMA 2JMWA 1B72B 2WADA 1R1UA 4A3BJ 3J81Z 1SFEA 3EUHC 1OCPA 2PN6A 5K7ZA 3OV8A 5LGNA 4KA4A 1LVKA 4HSRA 3LSRA 1Q1HA 1RETA 3GXOA 2V9PA 3LQRA 1EV7A 3TL4X 3C1DA 3RYRA 2PX9A 3L2UA 4HX7A 1FOKA 1HA8A 1WKMA 2XRNA 3BLYA 4XRMA 4OOIA 2LYCA 3WTUC 2R5ZB 1L3LA 5HLGA 4XOPA 1KZHA 1FYKA 1O57A 2K27A 3V7CA 1FTZA 4J19A 3DFGA 4EGZA 1QQIA 3VSLA 4B8XA 1Z05A 2V6EA 2P5LC 2ZMEA 2QZ8A 3LL7A 3EDPA 1FT9A 2XKOA 3QYBA 3J80Z 5FLMJ 4AM3A 5CYVA 5D8KB 2A5YB 4BGDA 4UXNA 5EG0A 4KN4X 3J7ZI 2NS8A 5ED4A 4B4CA 3T8RA 3LSGA 4RAZA 3W2WA 4YRVA 3ECHA 4BEHA 5J6XA 3OYFA 4M6XA 1E2XA 2XF7A 3IUOA 2XPUA 4U0VA 3CF5F 2FNPA 4HAMA 5DUKA 4UUSA 2L9RA 5L3CA 3AG4H 2P5KA 5F0FA 5KVRA 4IHYA 1R5HA 3K10A 1TWFJ 4XMYA 4OAYA 4CICA 5IY5H 4E7ZA 3EPZA 3WTZA 2XRLA 1SD5A 4L9JA 4QLCU 5ICCA 3CCSI 3P9IA 4MTDA 2CH0A 3V7SA 1X19A 3B6CA 3SZGA 2BV6A 2HXOA 5DV5A 1PDNC 4CCLA 4F92B 2JWTA 3I58A 3LSHA 3RJPA 2GBYA 3RSNA 2IS6A 3DF8A 3FKIJ 3IH3A 3VFZA 1MH4A 1FPQA 2J5PA 2VBXA 5D6EA 1DPRA 3LFUA 2NVQJ 4NQWB 2NVTJ 2V9VA 5D6FA 3L09A 1TW2A 5HLTA 3RPQA 5CKTA 2ADUA 4W1UA 2L4AA 3K4KA 3ZPLA 1BR1A 2LKSA 4L0ZB 1RKWA 2W84A 4XLAA 3HOTA 2STWA 5CQGA 2QSFX 4NDLA 2M7BA 1T0FA 5F27A 3SHFA 4E7HA 1HDPA 3GFLA 1MBGA 3O8HA 2GAUA 1P4WA 3GZNB 4HLXA 1XS9A 1GT0C 1HOMA 1PJRA 6PAXA 3HEFA 5FLVA 3LAJA 1EH7A 5D5VB 2OTLI 2CUZA 1ZRFA 4E7LA 4HX8A 2ZJPF 3TO7A 3C7JA 4E4HA 2R7TA 3GO5A 2XGXA 1YW8A 2M4KA 2JSPA 1O3QA 3AG3H 1HCRA 4OIOF 4WXHA 3I55I 3DTEA 2EZIA 3GCMA 2LMDA 2H1KA 2GIVA 3ABKH 2O9LA
chains in the Genus database with same CATH topology
1GV2A 3JRDA 1ETQA 3K7AJ 2AHQA 3BR6A 2NVXJ 5C3EJ 2DA2A 1Y1VJ 1W0UA 1QVTA 2DA7A 2LLKA 3JRHA 2YU9J 2OF7A 1ZK8A 2FJ1A 3RQIA 4M6VA 2VPRA 3S1MJ 4D7MA 5IOZA 1JTYA 1LFUP 3S1QJ 1DU0A 3GTGJ 4MLOA 2ID6A 3BG5A 4BXXJ 2EH3A 4X1EA 1K83J 2HOAA 1X2MA 1Q1VA 1Y1WJ 3BTCA 4JX4A 2CQQA 5K7FA 3HOYJ 3CMYA 1PUFB 1SFOJ 1JT0A 4JP0A 2G0EA 1XG1A 3A03A 4FISA 2EZLA 3HBLA 4DYCA 1MSFC 2DA6A 2M9HA 3IH4A 2KT0A 4MFEA 3UKGA 4JX5A 1ETXA 3S2HJ 4XK4A 3VPRA 4M3FA 2X48A 5FJ8J 4X6AJ 2JA6J 1E3OC 1BJZA 1FIAA 5F0CA 2R0QC 1LFBA 4C3HJ 3F0CA 4CYCA 3ZQLA 1CQTA 3I4NJ 1JJ8C 5DS9A 1TWCJ 4AUXA 2ME6A 3WHBA 2FD5A 3IH2A 4XICA 1VFCA 2HDDA 1K61A 2E2IJ 3BTLA 1JUSA 2VI6A 1B72A 1POGA 1MBEA 1IG7A 3BR2A 1I3QJ 1UG2A 1JKRC 5IYDJ 4A69C 2CJJA 3L1PA 1RESA 3TW7A 5IP7J 3S2DJ 2Y31A 2MSYA 1FIPA 2OPTA 1GDTA 3BG3A 3FIWA 2R5ZA 1RPWA 1TWHJ 5M3MJ 2GM4A 5EZGA 2VKEA 3BR3A 1MBFA 4C3IJ 2DA5A 1ETKA 2HOTA 3CQZJ 1RR7A 1WI3A 3ZQHA 5EDNA 3E7LA 3QPSA 3Q0UA 3GTMJ 1F43A 1RKTA 1T33A 3OIOA 2HI3A 2MW8A 3C2BA 1HF0A 3HKZN 4LOCA 3RKQA 4XRSA 3Q3SA 2Y0SN 4V2FA 1F36A 3MN2A 4BBSJ 2XGCA 1B8IA 4A3MJ 3GTJJ 5J1RA 4MFDA 1Z77A 3ZQFA 1ETVA 4A3JJ 1O4XA 2M0CA 2B63J 5EYRA 5EGOA 5C4JJ 4IHXA 5C44J 5FKNA 1YRNA 3SFIA 3A01A 2XPWA 2R93J 1WH5A 1ZTRA 2D5VA 3W6VA 2VUMJ 1AU7A 3FK6A 4DZJA 3JRAA 1U9OA 4BY7J 2IEKA 5E3LA 2E19A 2XB5A 2E2JJ 4ABZA 1JKOC 5F1JA 2XSDC 2N8GA 2Y9ZA 3BR0A 3ZOBA 4QTRA 1ZR4A 3QQAA 2L7FP 5EG0B 4C3JJ 1ZQ3P 2ECBA 2EZKA 1X2NA 3JRBA 3JRGA 3PM1A 3HOUJ 4DYQA 3IV5A 5EEAA 4UUSB 2K9QA 2HYJA 3BR5A 4RDUA 1TWGJ 5IP6A 1A6IA 5F0HA 2K9SA 2E1OA 2O7OA 2XB0X 1IUFA 1P7IA 4M3GA 4IHVA 4EEFG 5BNGA 3RZDJ 3CCYA 2K9NA 2LK2A 3NARA 2DMQA 1MH3A 2JK3A 5IYCJ 5FKOA 4A3IJ 4XRSG 1ETOA 2Y2ZA 4HNVA 3GTQJ 4BKXA 1ZKGA 3GTOJ 4M3EA 2VKVA 3BR1A 1ETYA 4A3FJ 1QRYA 2WB1N 1I6HJ 1FTTA 4M3BA 2ELKA 2IBDA 2L7ZA 3S14J 1JT6A 2DN0A 4IEJA 2DA4A 3HGYA 2Y30A 3G1OA 1U8BA 1BA5A 1WCMJ 1U78A 3S16J 2HOSA 2ID3A 4MIMA 4QSHA 1D5YA 3S1RJ 1MBKA 1I50J 3BQYA 3I4MJ 4BBRJ 5IOYA 2NOGA 4UUTA 1IDYA 3HDDA 1UMQA 3QPLA 1OJLA 3DEWA 5J3LA 1ZGWA 3JRIA 1U9NA 2DA1A 3NAUA 4G12A 4A3GJ 3BTIA 3GTPJ 1AKHB 3OOUA 2HXIA 3K2AA 3PO3J 3Q0VA 1FEXA 3S17J 2CU7A 1EF4A 1DU6A 3ZQCA 3H3VK 3MVPA 4W97A 5DTDA 2X6OA 3BT9A 2KDZA 2XGEA 1PUFA 3TP0A 4XIDA 1JKPC 1ENHA 1ETWA 2XGDA 3JR9A 3OSGA 2JA7J 3BTJA 4M3DA 2ECCA 2LY9A 1IDZA 5IYBJ 2K40A 2LR8A 2M2EA 4AYBN 3LNQA 2Y9YA 2CQXA 1BW6A 3HOWJ 4AC0A 5FKKA 2MGQA 2LKXA 5F08A 1GUUA 1H88C 3ZQIA 1P7JA 5E3MA 3CDLA 1AHDP 2R7ZJ 1JUMA 3GBGA 3SDGA 1MNMC 2JJ7A 4A3CJ 2CUEA 3SJMA 1TWAJ 1IV6A 3JRFA 2LVSA 4B1RA 1ITYA 4A3LJ 2LP0A 4A3KJ 1ZR2A 2X9DA 5E3OA 1VNDA 5FKMA 5HODA 2WAQN 2M34A 5JLWA 2LFBA 1LE8B 4A3EJ 5F04A 1G2HA 1WH7A 2CUFA 4D5FA 2QF7A 4Y7NJ 3S1NJ 1X58A 2LTPA 2L7MP 3LOCA 3HOXJ 2P81A 5IP9J 3GTLJ 2NS7A 5M3FJ 2ME0A 2ZB9A 1IJWC 1QVUA 2NVYJ 4S0HB 2EZHA 4I76A 3TW6A 2W48A 1A5JA 1XC5A 3HGGA 3M3YJ 1IRZA 3FK7A 3S15J 3ZQGA 1T56A 2R5YB 2I10A 2DMTA 4FCYA 2PMZN 2FX0A 1VI0A 2TCTA 1JKQC 1QPIA 4L5EA 2YS9A 3BQZA 3G1LA 4C2MJ 1WPKA 3Q0WA 4D7NA 1ORKA 4V2GA 2COBA 2QCOA 2JMWA 1B72B 1OCTC 1H89C 4A3BJ 5EZHA 1OCPA 5K7ZA 5GP9A 5M5XJ 1JGGA 3LSRA 2H8RA 2DA3A 1RETA 1OFCX 2LD5A 1W0TA 2EBIA 1IC8A 2IAIA 1JJ6C 4XRMA 2R92J 2MG4A 2R5ZB 4IHWA 4DW6A 4GFBA 1FTZA 4J19A 1LE8A 2DMNA 3MKLA 3TEDA 2FQ4A 1NTCA 3GTKJ 5FLMJ 1SANA 3LSPA 3HM5A 3OSFA 5EG0A 5M5WJ 4DYRA 4B3AA 4FE4A 2JA8J 2NS8A 5K7HA 1JTXA 2TRTA 4B4CA 4QIWN 3LSGA 3TP3A 2R5YA 1B8IB 1APLC 3H0GJ 3HB9A 2JA5J 2HQ5A 2XPUA 3PO2J 4UUSA 2L9RA 3JREA 5F0FA 4IHYA 5EGOB 2WV1A 3HOVJ 3FISA 1TWFJ 1YRNB 1BW5A 3A01B 3B6AA 2XRLA 4RBOA 5M5YJ 3O8GA 5GPAA 2CRGA 1TC3C 2JN6A 3B6CA 1NK2P 1GVDA 3M4OJ 2HXOA 2DMUA 1Z0XA 4I6ZA 2JWTA 3LSJA 1H8AC 2EQRA 1GV5A 2GBYA 3WHCA 2GLOA 3RZOJ 3FKIJ 1BL0A 3IH3A 5EF6A 1WGXA 1MH4A 2RAEA 2NVQJ 2NVTJ 1R9TJ 2DTZA 3HOZJ 4W1UA 4Y52J 1FJLA 2E2HJ 3JRCA 3G1MA 2DJNA 1RKWA 1NK3P 4DZPA 1MSEC 9ANTA 4NDLA 1MBJA 4FTHA 5F27A 4JX6A 5J1YA 1HDPA 4MO7A 3DCFA 3BG9A 1MBGA 3O8HA 1S7EA 1XS9A 2M8GX 1GT0C 1HLVA 1HOMA 2DMPA 1AKHA 5JLXA 3HEFA 4FE7A 1JUPA 2AO9A 5FLVA 4JYKA 5IPAA 2O8KA 1UHSA 2YUSA 5E3NA 4BY1J 4A93J 4A3DJ 3A02A 5C4XJ 3D1NI 1VF9A 5FKLA 4D5CA 5J1UA 1HCRA 4CYCB 2L0KA 2XPVA 2EZIA 2H1KA 1MBHA 1HDDC 5GPCA 1IGNA 2O9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  3JRD A;  1ETQ A;  3K7A J;  2AHQ A;  3BR6 A;  2NVX J;  5C3E J;  2DA2 A;  1Y1V J;  1W0U A;  1QVT A;  2DA7 A;  2LLK A;  3JRH A;  2YU9 J;  2OF7 A;  1ZK8 A;  2FJ1 A;  3RQI A;  4M6V A;  2VPR A;  3S1M J;  4D7M A;  5IOZ A;  1JTY A;  1LFU P;  3S1Q J;  1DU0 A;  3GTG J;  4MLO A;  2ID6 A;  3BG5 A;  4BXX J;  2EH3 A;  4X1E A;  1K83 J;  2HOA A;  1X2M A;  1Q1V A;  1Y1W J;  3BTC A;  4JX4 A;  2CQQ A;  5K7F A;  3HOY J;  3CMY A;  1PUF B;  1SFO J;  1JT0 A;  4JP0 A;  2G0E A;  1XG1 A;  3A03 A;  4FIS A;  2EZL A;  3HBL A;  4DYC A;  1MSF C;  2DA6 A;  2M9H A;  3IH4 A;  2KT0 A;  4MFE A;  3UKG A;  4JX5 A;  1ETX A;  3S2H J;  4XK4 A;  3VPR A;  4M3F A;  2X48 A;  5FJ8 J;  4X6A J;  2JA6 J;  1E3O C;  1BJZ A;  1FIA A;  5F0C A;  2R0Q C;  1LFB A;  4C3H J;  3F0C A;  4CYC A;  3ZQL A;  1CQT A;  3I4N J;  1JJ8 C;  5DS9 A;  1TWC J;  4AUX A;  2ME6 A;  3WHB A;  2FD5 A;  3IH2 A;  4XIC A;  1VFC A;  2HDD A;  1K61 A;  2E2I J;  3BTL A;  1JUS A;  2VI6 A;  1B72 A;  1POG A;  1MBE A;  1IG7 A;  3BR2 A;  1I3Q J;  1UG2 A;  1JKR C;  5IYD J;  4A69 C;  2CJJ A;  3L1P A;  1RES A;  3TW7 A;  5IP7 J;  3S2D J;  2Y31 A;  2MSY A;  1FIP A;  2OPT A;  1GDT A;  3BG3 A;  3FIW A;  2R5Z A;  1RPW A;  1TWH J;  5M3M J;  2GM4 A;  5EZG A;  2VKE A;  3BR3 A;  1MBF A;  4C3I J;  2DA5 A;  1ETK A;  2HOT A;  3CQZ J;  1RR7 A;  1WI3 A;  3ZQH A;  5EDN A;  3E7L A;  3QPS A;  3Q0U A;  3GTM J;  1F43 A;  1RKT A;  1T33 A;  3OIO A;  2HI3 A;  2MW8 A;  3C2B A;  1HF0 A;  3HKZ N;  4LOC A;  3RKQ A;  4XRS A;  3Q3S A;  2Y0S N;  4V2F A;  1F36 A;  3MN2 A;  4BBS J;  2XGC A;  1B8I A;  4A3M J;  3GTJ J;  5J1R A;  4MFD A;  1Z77 A;  3ZQF A;  1ETV A;  4A3J J;  1O4X A;  2M0C A;  2B63 J;  5EYR A;  5EGO A;  5C4J J;  4IHX A;  5C44 J;  5FKN A;  1YRN A;  3SFI A;  3A01 A;  2XPW A;  2R93 J;  1WH5 A;  1ZTR A;  2D5V A;  3W6V A;  2VUM J;  1AU7 A;  3FK6 A;  4DZJ A;  3JRA A;  1U9O A;  4BY7 J;  2IEK A;  5E3L A;  2E19 A;  2XB5 A;  2E2J J;  4ABZ A;  1JKO C;  5F1J A;  2XSD C;  2N8G A;  2Y9Z A;  3BR0 A;  3ZOB A;  4QTR A;  1ZR4 A;  3QQA A;  2L7F P;  5EG0 B;  4C3J J;  1ZQ3 P;  2ECB A;  2EZK A;  1X2N A;  3JRB A;  3JRG A;  3PM1 A;  3HOU J;  4DYQ A;  3IV5 A;  5EEA A;  4UUS B;  2K9Q A;  2HYJ A;  3BR5 A;  4RDU A;  1TWG J;  5IP6 A;  1A6I A;  5F0H A;  2K9S A;  2E1O A;  2O7O A;  2XB0 X;  1IUF A;  1P7I A;  4M3G A;  4IHV A;  4EEF G;  5BNG A;  3RZD J;  3CCY A;  2K9N A;  2LK2 A;  3NAR A;  2DMQ A;  1MH3 A;  2JK3 A;  5IYC J;  5FKO A;  4A3I J;  4XRS G;  1ETO A;  2Y2Z A;  4HNV A;  3GTQ J;  4BKX A;  1ZKG A;  3GTO J;  4M3E A;  2VKV A;  3BR1 A;  1ETY A;  4A3F J;  1QRY A;  2WB1 N;  1I6H J;  1FTT A;  4M3B A;  2ELK A;  2IBD A;  2L7Z A;  3S14 J;  1JT6 A;  2DN0 A;  4IEJ A;  2DA4 A;  3HGY A;  2Y30 A;  3G1O A;  1U8B A;  1BA5 A;  1WCM J;  1U78 A;  3S16 J;  2HOS A;  2ID3 A;  4MIM A;  4QSH A;  1D5Y A;  3S1R J;  1MBK A;  1I50 J;  3BQY A;  3I4M J;  4BBR J;  5IOY A;  2NOG A;  4UUT A;  1IDY A;  3HDD A;  1UMQ A;  3QPL A;  1OJL A;  3DEW A;  5J3L A;  1ZGW A;  3JRI A;  1U9N A;  2DA1 A;  3NAU A;  4G12 A;  4A3G J;  3BTI A;  3GTP J;  1AKH B;  3OOU A;  2HXI A;  3K2A A;  3PO3 J;  3Q0V A;  1FEX A;  3S17 J;  2CU7 A;  1EF4 A;  1DU6 A;  3ZQC A;  3H3V K;  3MVP A;  4W97 A;  5DTD A;  2X6O A;  3BT9 A;  2KDZ A;  2XGE A;  1PUF A;  3TP0 A;  4XID A;  1JKP C;  1ENH A;  1ETW A;  2XGD A;  3JR9 A;  3OSG A;  2JA7 J;  3BTJ A;  4M3D A;  2ECC A;  2LY9 A;  1IDZ A;  5IYB J;  2K40 A;  2LR8 A;  2M2E A;  4AYB N;  3LNQ A;  2Y9Y A;  2CQX A;  1BW6 A;  3HOW J;  4AC0 A;  5FKK A;  2MGQ A;  2LKX A;  5F08 A;  1GUU A;  1H88 C;  3ZQI A;  1P7J A;  5E3M A;  3CDL A;  1AHD P;  2R7Z J;  1JUM A;  3GBG A;  3SDG A;  1MNM C;  2JJ7 A;  4A3C J;  2CUE A;  3SJM A;  1TWA J;  1IV6 A;  3JRF A;  2LVS A;  4B1R A;  1ITY A;  4A3L J;  2LP0 A;  4A3K J;  1ZR2 A;  2X9D A;  5E3O A;  1VND A;  5FKM A;  5HOD A;  2WAQ N;  2M34 A;  5JLW A;  2LFB A;  1LE8 B;  4A3E J;  5F04 A;  1G2H A;  1WH7 A;  2CUF A;  4D5F A;  2QF7 A;  4Y7N J;  3S1N J;  1X58 A;  2LTP A;  2L7M P;  3LOC A;  3HOX J;  2P81 A;  5IP9 J;  3GTL J;  2NS7 A;  5M3F J;  2ME0 A;  2ZB9 A;  1IJW C;  1QVU A;  2NVY J;  4S0H B;  2EZH A;  4I76 A;  3TW6 A;  2W48 A;  1A5J A;  1XC5 A;  3HGG A;  3M3Y J;  1IRZ A;  3FK7 A;  3S15 J;  3ZQG A;  1T56 A;  2R5Y B;  2I10 A;  2DMT A;  4FCY A;  2PMZ N;  2FX0 A;  1VI0 A;  2TCT A;  1JKQ C;  1QPI A;  4L5E A;  2YS9 A;  3BQZ A;  3G1L A;  4C2M J;  1WPK A;  3Q0W A;  4D7N A;  1ORK A;  4V2G A;  2COB A;  2QCO A;  2JMW A;  1B72 B;  1OCT C;  1H89 C;  4A3B J;  5EZH A;  1OCP A;  5K7Z A;  5GP9 A;  5M5X J;  1JGG A;  3LSR A;  2H8R A;  2DA3 A;  1RET A;  1OFC X;  2LD5 A;  1W0T A;  2EBI A;  1IC8 A;  2IAI A;  1JJ6 C;  4XRM A;  2R92 J;  2MG4 A;  2R5Z B;  4IHW A;  4DW6 A;  4GFB A;  1FTZ A;  4J19 A;  1LE8 A;  2DMN A;  3MKL A;  3TED A;  2FQ4 A;  1NTC A;  3GTK J;  5FLM J;  1SAN A;  3LSP A;  3HM5 A;  3OSF A;  5EG0 A;  5M5W J;  4DYR A;  4B3A A;  4FE4 A;  2JA8 J;  2NS8 A;  5K7H A;  1JTX A;  2TRT A;  4B4C A;  4QIW N;  3LSG A;  3TP3 A;  2R5Y A;  1B8I B;  1APL C;  3H0G J;  3HB9 A;  2JA5 J;  2HQ5 A;  2XPU A;  3PO2 J;  4UUS A;  2L9R A;  3JRE A;  5F0F A;  4IHY A;  5EGO B;  2WV1 A;  3HOV J;  3FIS A;  1TWF J;  1YRN B;  1BW5 A;  3A01 B;  3B6A A;  2XRL A;  4RBO A;  5M5Y J;  3O8G A;  5GPA A;  2CRG A;  1TC3 C;  2JN6 A;  3B6C A;  1NK2 P;  1GVD A;  3M4O J;  2HXO A;  2DMU A;  1Z0X A;  4I6Z A;  2JWT A;  3LSJ A;  1H8A C;  2EQR A;  1GV5 A;  2GBY A;  3WHC A;  2GLO A;  3RZO J;  3FKI J;  1BL0 A;  3IH3 A;  5EF6 A;  1WGX A;  1MH4 A;  2RAE A;  2NVQ J;  2NVT J;  1R9T J;  2DTZ A;  3HOZ J;  4W1U A;  4Y52 J;  1FJL A;  2E2H J;  3JRC A;  3G1M A;  2DJN A;  1RKW A;  1NK3 P;  4DZP A;  1MSE C;  9ANT A;  4NDL A;  1MBJ A;  4FTH A;  5F27 A;  4JX6 A;  5J1Y A;  1HDP A;  4MO7 A;  3DCF A;  3BG9 A;  1MBG A;  3O8H A;  1S7E A;  1XS9 A;  2M8G X;  1GT0 C;  1HLV A;  1HOM A;  2DMP A;  1AKH A;  5JLX A;  3HEF A;  4FE7 A;  1JUP A;  2AO9 A;  5FLV A;  4JYK A;  5IPA A;  2O8K A;  1UHS A;  2YUS A;  5E3N A;  4BY1 J;  4A93 J;  4A3D J;  3A02 A;  5C4X J;  3D1N I;  1VF9 A;  5FKL A;  4D5C A;  5J1U A;  1HCR A;  4CYC B;  2L0K A;  2XPV A;  2EZI A;  2H1K A;  1MBH A;  1HDD C;  5GPC A;  1IGN A;  2O9L A; 
#chains in the Genus database with same CATH topology
 1GV2 A;  2EFQ A;  3BRO A;  4HV6 A;  3JRD A;  1IN7 A;  1ZG5 A;  1ETQ A;  1YS7 A;  3OYL A;  2DK5 A;  3BR6 A;  1BOB A;  1Y1V J;  3RKW A;  2LLK A;  1ZK8 A;  3S2W A;  4IRH A;  2FJ1 A;  1IZ1 A;  2VPR A;  3S1M J;  3ERE D;  4O3M A;  4PFP A;  4P55 A;  1U5T B;  3K1N A;  4IPA A;  3VOE A;  4I01 A;  3WTY C;  4F55 A;  2LF7 A;  1JTY A;  1LFU P;  2CQ7 A;  3BPV A;  1XCB A;  4RLF A;  4BQO A;  3GTG J;  1KQ9 A;  2FBK A;  4BXX J;  2VLA A;  2EH3 A;  4X1E A;  2HOA A;  3H3Z A;  5FD6 A;  3DLA A;  1Q1V A;  1Y1W J;  2VOD A;  1BC8 C;  4JX4 A;  1T8I A;  2FA5 A;  2P7C B;  1B9M A;  2FQ3 A;  3ULQ B;  2ZJ2 A;  4GYI A;  4BAY A;  4RGR A;  2QKM B;  3OYC A;  3HBL A;  1RRJ A;  3WU2 C;  1ZLJ A;  4G6D A;  4RB0 A;  2VB6 A;  3I59 A;  2UWM A;  2M9H A;  2ZSH B;  1ON2 A;  5FB2 A;  4WWC A;  2L7K A;  4M3F A;  1E3O C;  1BJZ A;  1LFB A;  2EIN H;  2VC0 A;  4CYC A;  2F5E A;  3ZQL A;  3P7N A;  2ME6 A;  4KN7 X;  4XLH A;  3V42 A;  1VFC A;  3S3M A;  4UB6 C;  1D5V A;  1ZG3 A;  3HZJ A;  2Q1Z B;  2IS4 A;  2P7V B;  4TV7 A;  1IG7 A;  2KP6 A;  3U2R A;  2ZXI A;  1UG2 A;  1I6X A;  2AQE A;  2OQR A;  3I3L A;  4A69 C;  1ZGA A;  2CJJ A;  2RNG A;  2K9L A;  1RI7 A;  3L1P A;  2L02 A;  2D2W A;  1PVE A;  4CGZ A;  4PCQ A;  3I0T A;  4GCV A;  3SEZ A;  1TNS A;  2Y75 A;  1FIP A;  2E34 A;  4BUP A;  3L2R A;  1PP8 F;  1BJA A;  3I4P A;  4IVN A;  4S04 A;  1RPW A;  5M3M J;  2GM4 A;  2M0M A;  3DPL C;  3OL4 A;  3BR3 A;  5EZG A;  2DA5 A;  2DFI A;  1ETK A;  5GAD J;  2QBY A;  2DFH A;  5LEK A;  2DO7 A;  4E70 A;  3GVA A;  3ZCO A;  2IS1 A;  3GW2 A;  1X1A A;  2BVM A;  1IXC A;  4LK0 F;  1WJE A;  1T33 A;  3ISP A;  3U9G A;  3WTT C;  1XN7 A;  2MW8 A;  1HF0 A;  3HKZ N;  3ZN1 A;  1HXD A;  4XRS A;  1LDD A;  3AAF A;  2BEO A;  1QBJ A;  2Y0S N;  2A69 F;  2HDC A;  4BBS J;  1FWZ A;  4NUB A;  2ICW G;  2VQH A;  1Z67 A;  3CMM A;  1STZ A;  4CSW A;  4WCG A;  4A3J J;  2DQL A;  4GGG A;  2M0C A;  2P6S A;  5HS7 A;  2M30 A;  5C44 J;  2DTR A;  5FKN A;  4ESF A;  2HDW A;  1YRN A;  2R4G A;  3SFI A;  4P5O A;  3GWZ A;  2XPW A;  1Y6I A;  2R93 J;  2VT3 A;  4XLP F;  1UFM A;  2IEK A;  3TO9 A;  1B59 A;  2ZXW H;  2ELH A;  1FBU A;  2XB5 A;  2MLK A;  4EJT A;  1W7P D;  1I3A A;  5CVI A;  1JKO C;  5F1J A;  4B48 A;  3CC2 I;  4U0W A;  2DOA A;  2N8G A;  2H8W A;  3BR0 A;  2Y9Z A;  2EIL H;  4QTR A;  5ICE A;  3E3V A;  3E5X A;  5TRD A;  3GME A;  3OR2 C;  3GUD A;  3ASO H;  4GXO A;  2WV0 A;  5JFR A;  1BR4 A;  2OCC H;  2COM A;  4C30 A;  2P4W A;  3KZI C;  2Y0M A;  3O2P E;  1QPM A;  3DPT A;  1OMI A;  3L00 A;  3WTX C;  3FXU A;  5EEA A;  2K9Q A;  2HYJ A;  4EJO A;  2GOM A;  3EQL F;  4HPQ A;  2KLO A;  1V5E A;  2DQR A;  5F0H A;  4M73 A;  1P7I A;  1LFP A;  2X0L A;  4EEF G;  5BNG A;  2L5Q A;  2K9N A;  3FBN B;  3GZ5 A;  3FHN A;  4KT6 A;  3M1C A;  5B5E C;  2JK3 A;  3F9K A;  4ZDO A;  2M87 A;  4N9I A;  3GTQ J;  3EUH A;  3DV8 A;  4UV8 A;  2FU4 A;  1R36 A;  1ON1 A;  2JQ7 A;  5GTH C;  2R7D A;  5DD8 A;  3HPG A;  2BOL A;  4BS9 A;  1OLT A;  3K69 A;  4IEJ A;  2HYG D;  3HGY A;  1R1V A;  4XKC A;  1U78 A;  1YG2 A;  2JTV A;  3U1K A;  3Q5F A;  3E97 A;  3VYR B;  3DBL B;  1HC8 A;  3BQY A;  4LB6 B;  2KIQ A;  5E18 F;  1IF1 A;  5L3G A;  2X4H A;  4I02 A;  1IDY A;  2XV4 S;  2HQR A;  2GXB A;  3C3W A;  4YEJ A;  3NAU A;  2VN2 A;  5ILS A;  5BOX A;  1AKH B;  3E6B A;  3G73 A;  1U6G A;  1SAU A;  1EKE A;  3S17 J;  3VYS B;  2CU7 A;  2X1C A;  2VKD A;  3K4L A;  4DBQ A;  1MZB A;  1P4X A;  2YSR A;  1IUY A;  1MJ9 A;  1O3R A;  2X6O A;  3U1D A;  4ZC3 A;  3MMY B;  1C0W A;  1PUF A;  4XID A;  3G6E I;  1JKP C;  4L9T A;  1R23 A;  2XGD A;  2R7W A;  3L2W A;  3GF2 A;  2FOK A;  1J75 A;  2Y9Y A;  1A35 A;  3K0L A;  1R00 A;  5FKK A;  4LIT A;  4E7I A;  2LY2 A;  3BG6 A;  4RM3 A;  2W25 A;  3IAS 2;  4OIR F;  1P7J A;  1S7O A;  5A2Q K;  3CDL A;  1AHD P;  2VOO A;  3N05 A;  3GBG A;  1N77 A;  2F48 A;  3OYI A;  2M3A A;  4LIV A;  4A6D A;  3SJM A;  1TWA J;  3G2B A;  3S93 A;  3JRF A;  5KCM A;  2VQL A;  2OUM A;  3H5N A;  4KYW A;  2HS5 A;  2X9D A;  1ZR2 A;  1LEB A;  2F2E A;  1VND A;  5FKM A;  4JBA A;  2WAQ N;  1S8N A;  5JLW A;  4BJ6 C;  3OYM A;  1G2H A;  3LA3 A;  1WH7 A;  4Y7N J;  5LGT A;  5CJ9 A;  3CUQ C;  4HQE A;  2LTP A;  2DCE A;  1UHW A;  2NS7 A;  4RGX A;  4WXD A;  1R58 A;  4I76 A;  2M5W A;  2VJ5 A;  1YO5 C;  2RC4 A;  1I1S A;  2O0Y A;  3FK7 A;  1S72 I;  5GAH J;  3S15 J;  2EV5 A;  2VC1 A;  3LST A;  2BHZ A;  4K2E A;  1U0J A;  3HJE A;  3D0S A;  2FX0 A;  1VI0 A;  2TCT A;  2UXX A;  1D8J A;  2HTJ A;  3I64 A;  2PI0 A;  1WPK A;  3F8N A;  3Q0W A;  1ORK A;  1XSD A;  1QZY A;  4A5M A;  1OCT C;  5TJJ A;  1NHA A;  1V54 H;  1E3P A;  3LMM A;  1SFX A;  3NRV A;  1XCV A;  2H8R A;  2V4J C;  2VT2 A;  1VQ9 I;  2XF6 A;  1Y8R B;  2R7O A;  3D5R C;  1UB9 A;  3PQJ A;  3L2C A;  1KYZ A;  1WJB A;  4IF4 A;  2JRM A;  1OQY A;  3HUG A;  1MMG A;  1IC8 A;  1JJ6 C;  1MMA A;  4CCM A;  4IHW A;  3O3K A;  1IN4 A;  1V4R A;  2KIF A;  3KYC B;  3LSM A;  3CCE I;  1LE8 A;  4D9J A;  4HF2 A;  3MKL A;  2DT7 B;  1GXQ A;  2YPR A;  2O3F A;  1UEL B;  1ULY A;  1WJA A;  2ZJQ F;  4EJU A;  4AIJ A;  1JI8 A;  2YR2 A;  3FF5 A;  1N78 A;  4ZJZ A;  3HRT A;  3FM3 A;  2XVC A;  1VQ4 I;  1HW2 A;  4RLQ A;  2DFE A;  2JA8 J;  3DU6 A;  3H9J A;  2BW3 B;  1JTX A;  4EJV A;  2DXI A;  1G3W A;  2K86 A;  4A5N A;  4QIW N;  4BQN A;  4I0B A;  3TP3 A;  5J8C A;  1APL C;  5LRS A;  2D1H A;  5D5W B;  2JA5 J;  3ZMU A;  5B1B H;  2EFW A;  1P9Q C;  2KKO A;  4U87 A;  4CO8 A;  2A3S A;  3S32 A;  3ZQ7 A;  3JRE A;  1VQL I;  3F8F A;  1G3S A;  2WV1 A;  5EGO B;  1A6Q A;  1BW5 A;  5E8G A;  3A01 B;  3B6A A;  3FHZ A;  2F5F A;  3QU3 A;  3CCM I;  1IRG A;  4XQF A;  4RBO A;  2W57 A;  4MQ9 F;  2OQG A;  1OYW A;  2DPU A;  4P9U A;  3M4O J;  1X4P A;  2DMU A;  2KIU A;  2QKL B;  2RRE A;  3CZ6 A;  4E7J A;  2PFB A;  3KYL A;  2JA2 A;  4F7Z A;  5E8I A;  4Q5S F;  2XAF A;  1IN5 A;  1SVO A;  3WHC A;  1UG0 A;  5LGU A;  1BL0 A;  3AL0 B;  4LLG F;  3ZGK A;  4R1H A;  2RAE A;  1SD4 A;  4C2U A;  4IJA A;  3AG1 H;  4A6E A;  4ENK A;  2VAS A;  1R9T J;  2O8X A;  2MBF A;  2RN7 A;  2HVS A;  5E1Z B;  1X1C A;  1W5S A;  2X1D A;  1PUE E;  2ETH A;  2EWN A;  3OMY A;  1FJL A;  3JRC A;  1YJN I;  3LWF A;  1YYV A;  2X6W A;  2E1C A;  1NK3 P;  4DZP A;  1S7A A;  2BBY A;  2ZSI B;  3PNY A;  1MBJ A;  2UV1 A;  4JX6 A;  5H2F C;  3K2Z A;  3DCF A;  5ILU A;  2NVU B;  4BHB A;  3WTV C;  1IW7 F;  3BJO A;  2HWV A;  4AWX B;  5JLX A;  3WGI A;  4II2 A;  2I5U A;  5IPA A;  3C2H A;  2O8K A;  5E3N A;  1D1C A;  4BNC A;  2HZD A;  2DU9 A;  2QLZ A;  1VQO I;  3ABT A;  4A3D J;  5C4X J;  1VF9 A;  3ERM A;  4ZH4 F;  4PFO A;  4D5C A;  2GQQ A;  2HYF A;  5J1U A;  4IRI A;  2RKH A;  2GWR A;  1SD6 A;  3A4C A;  3T8T A;  1S5L C;  2L0K A;  3IL2 A;  2CSO A;  1MIJ A;  2GZW A;  1EA3 A;  4NB5 A;  5D4R A;  4BL0 B;  1VQK I;  3HOZ J;  1F5T A;  5DCM B;  4XOR A;  3RTR A;  1S29 A;  4EM2 A;  1W36 C;  5C3E J;  4LJZ F;  2A6H F;  2EB7 A;  2Z5U A;  2M4G A;  5D8L B;  2OBP A;  4OMY A;  1W0U A;  2DA7 A;  2EFO A;  2ZFU A;  3DEU A;  4B43 A;  1YS6 A;  3JRH A;  2YU9 J;  2OF7 A;  1FMW A;  5IT9 K;  2RVC A;  1TQI A;  1HKS A;  2NYX A;  4G7Z F;  2WTE A;  3M1E A;  2OZU A;  1QHG A;  3DBH B;  1YFH A;  2QWW A;  3PL8 A;  2VKH A;  2EV0 A;  1R7J A;  5FGM A;  1K83 J;  3L7W A;  4FT8 A;  4P9F A;  1X2M A;  1B6A A;  3BTC A;  2CQQ A;  1SD7 A;  2OV7 A;  5L3E A;  3A03 A;  2EZL A;  2NXN B;  3JW4 A;  1WSU A;  1TBX A;  1IN6 A;  3ZMS A;  2L9N A;  4HEA 2;  5E1X A;  4KMF A;  3K1M A;  3K4B A;  3MZY A;  1MSF C;  2P6T A;  2A61 A;  3IH4 A;  4MFE A;  4DJA A;  3UKG A;  1KQ8 A;  1R4N B;  3BZK A;  1BOA A;  1OPC A;  4XK4 A;  5FJ8 J;  3CJR B;  2XKP A;  4ASN A;  3QYF A;  3KCC A;  5F0C A;  2R0Q C;  4C3H J;  3FXJ A;  3K4J A;  4I7H A;  1P4A A;  3TKY A;  1CQT A;  2KRH A;  2L01 A;  4I99 C;  1TWC J;  2CS3 A;  4BU2 A;  4AUX A;  1T38 A;  2FD5 A;  2FOW A;  2AXL A;  2MYS A;  1VZ0 A;  2K5C A;  3G4S I;  4Y33 A;  1WZ2 A;  2E2I J;  3BTL A;  3EUK L;  3QP6 A;  1XPX A;  1I3Q J;  4ZYA A;  5KHD A;  1BI2 A;  1JKR C;  2QQ9 A;  2P8T A;  2LY1 A;  2RQP A;  3KEO A;  2JUC A;  1ODD A;  5B3S H;  1KU9 A;  2NNY A;  5IP7 J;  2B7E A;  2OPT A;  1A04 A;  1LKX A;  2CO5 A;  3T5X A;  2JT1 A;  3FIW A;  5AON A;  4PSW A;  3MKZ A;  1TWH J;  3I5U A;  3JTG A;  3MQ0 A;  3CQZ J;  4LG0 B;  3HRU A;  1Z6T A;  1WI3 A;  2M1B A;  3GFI A;  2Q2E B;  2WAF A;  3FKJ A;  3K6G A;  1J7K A;  3S3O A;  3Q0U A;  2P5V A;  4IRG A;  1QHH D;  3C2B A;  4FET A;  3J81 K;  1X3W B;  2HOE A;  1QGP A;  5DCF A;  2LDU A;  2K4B A;  1SEU A;  2C6Y A;  4V2F A;  1D3Y A;  2D45 A;  1YX3 A;  4P1W A;  3LSK A;  2BVL A;  3KX2 A;  1B8I A;  4J00 A;  1V5F A;  1D1A A;  1ZG1 A;  2DDA A;  2WAQ A;  4HF0 A;  4AID A;  2OZ6 A;  4A0Z A;  1ZLK A;  1YW7 A;  2B63 J;  3IHU A;  4NC8 A;  3JSO A;  1T08 B;  3BWG A;  4IHX A;  3E6M A;  2XAS A;  2W82 A;  3AKZ A;  2H6B A;  5JHF A;  3SYT A;  1W5C C;  4L9V A;  1ZTR A;  3W6V A;  4HG2 A;  3FK6 A;  3KP2 A;  1U9O A;  3AL0 C;  2JVH A;  3ZMZ A;  3W2A A;  3J80 K;  2QQB A;  4N4N B;  1H9G A;  4XN0 A;  4IOA F;  2V1X A;  2W1O A;  5DYM A;  1WQ2 A;  3D5L A;  2E2J J;  2UXN A;  4ABZ A;  3V7R A;  2XSD C;  3CD6 I;  1TLH B;  5F6F A;  4N0B A;  3OIQ A;  3QPH A;  2L7F P;  5EG0 B;  2BY2 A;  3CUQ A;  3CUO A;  5HNH A;  3DKX A;  3LA7 A;  2ECB A;  2EZK A;  1X2N A;  2OAZ A;  2ZXH A;  3ZXS A;  2VQC A;  2BY1 A;  2Q0O A;  4M9S A;  1P2F A;  4BEH B;  4BDY A;  3PM1 A;  3JAM Z;  2JVG A;  2QVO A;  4DYQ A;  3HOU J;  2E71 A;  2VE8 A;  2LSO A;  4UUS B;  3TQN A;  1XGO A;  4RDU A;  3PJR A;  2R7R A;  2E1N A;  5LBQ A;  4IHS A;  2QQA A;  1A6I A;  2XUB A;  1IXR C;  3FXO A;  1MJB A;  4IHV A;  1YIT I;  1XDU A;  2A5W A;  3MZ8 A;  1UCR A;  1W7P A;  5HDN A;  3CCY A;  4XLC A;  3SEQ A;  2LK2 A;  4BXU A;  2CW8 A;  1MH3 A;  3DEE A;  1K4S A;  4IXA A;  1ETO A;  3QPT A;  4OU0 A;  3B73 A;  3G3Z A;  3OYA A;  2M8E A;  5EEH A;  4M3E A;  1J2X A;  3Q9V A;  3BOQ A;  4P96 A;  1HKQ A;  3I71 A;  1OCC H;  1RIO H;  1FTT A;  4ESJ A;  2IBD A;  4M72 A;  4XL9 A;  2EPF A;  4ON0 A;  1RUN A;  2Y30 A;  4EQQ A;  3G1O A;  1YI2 I;  2KIS A;  1UHM A;  1GXP A;  4HF1 A;  3OS1 A;  4I98 B;  3O6B B;  2J5O A;  4A0X A;  3S1R J;  2CYY A;  1D5Y A;  4OWR B;  1I50 J;  1MD0 A;  4RGS A;  2E35 A;  3I4M J;  2XAQ A;  5DUI A;  2VIX A;  4B44 A;  3ML6 A;  2XAU A;  3SXY A;  1OJL A;  3DEW A;  3E1S A;  4UHT A;  1BR2 A;  1I27 A;  2NS0 A;  3L9F A;  2DA1 A;  4EM0 B;  2IS2 A;  2MLG A;  3BTI A;  2OTJ I;  4HW0 A;  5LEJ A;  3K2A A;  2CQK A;  4ZDL A;  2X1E A;  3WG9 A;  3PO3 J;  2G7H A;  1E3H A;  3PQK A;  4BHP A;  2LH9 A;  4OIP F;  3VOD A;  1WI9 A;  1X4O A;  3I54 A;  3H3V K;  4WXC A;  3IKT A;  4W97 A;  2GA2 A;  1XGN A;  3R0A A;  2JUG A;  3BT9 A;  2F5D A;  2XGE A;  3TP0 A;  1TNT A;  3AFH A;  1A31 A;  3JR9 A;  3OSG A;  3BTJ A;  1HSJ A;  2LY9 A;  2HEO A;  4XLE A;  1IDZ A;  2FUG 2;  4IHT A;  4AYB N;  2KQR A;  3LNQ A;  2DAO A;  3BJA A;  2JPB A;  1BN5 A;  4MGR A;  2KJB A;  1YW9 A;  2CQX A;  2Z2S B;  3KP5 A;  2MGQ A;  3CO6 C;  4BQA A;  1V3F A;  3E6C C;  3ZQI A;  2R3S A;  3VDX A;  2ACJ A;  1IAW A;  1XB4 A;  3NWT A;  5DM6 F;  2DYR H;  3SDG A;  5CVV A;  3QOP A;  1XSX A;  4DGW B;  1OR7 C;  4B1R A;  1ITY A;  3ONQ A;  1Z91 A;  1HW1 A;  4A3K J;  1G6N A;  2KPM A;  1FMV A;  2L2O A;  1CF7 A;  3MAJ A;  1IO2 A;  5CLS A;  1J59 A;  1FP1 D;  4HNU A;  2M34 A;  2FE3 A;  2LFB A;  1ZYR F;  4A3E J;  3QWL A;  3OS0 A;  5F04 A;  1X3Z B;  2XRO A;  1WFX A;  1TL8 A;  4O6J A;  1SVM A;  2CG4 A;  2OD5 A;  3PUB A;  3FXL A;  1M1E B;  2L7M P;  2IA2 A;  3HOX J;  4L9N A;  5IP9 J;  2NRA C;  3X2Q H;  1TT0 A;  1QA6 A;  3GTL J;  2ME0 A;  3I59 B;  3GEZ A;  1IJW C;  1MGT A;  3WGH A;  2PMZ A;  4S0H B;  2W48 A;  4CDG A;  1A5J A;  3M3Y J;  4G7O F;  1LPQ A;  2JPC A;  3ZQG A;  3K70 D;  1WJC A;  3BCB A;  1VQM I;  3ZQQ A;  3IKV A;  2R5Y B;  2IJL A;  3FDY A;  2DMT A;  5LHH A;  3LSI A;  3SZP A;  1GHC A;  1SFU A;  2YS9 A;  1YLF A;  3G1L A;  4CCN A;  1ZRD A;  2O61 A;  4V2G A;  2COB A;  4CCO A;  1H89 C;  1X1P A;  2E7X A;  2HPM A;  5EZH A;  3A2K A;  4KUM A;  5GP9 A;  5M5X J;  3GLL A;  1JGG A;  4ZTJ A;  4M6Y A;  5BPI A;  4MQV A;  3KEQ A;  2LD5 A;  1QNT A;  5CPR B;  1K6O A;  1D0Y A;  2W85 A;  2MAB A;  4BE2 A;  2R92 J;  2MG4 A;  3QP5 A;  4ANJ A;  4J01 A;  2EK5 A;  4ZDP A;  2X6Y A;  2L54 A;  4GFB A;  2QBY B;  2DMN A;  3HPH A;  3TED A;  1KYW A;  5FLX Z;  3VWB A;  4GYG A;  1LB2 A;  4MEX F;  1EH6 A;  5L3F A;  5AIP A;  2A05 A;  3HYI A;  1U5T C;  2LRE A;  3CDH A;  3ZP5 A;  1SAN A;  4UUV A;  4XKW A;  1BIB A;  2E1M B;  1SMY F;  3LSP A;  1VQP I;  4IKF A;  3OSF A;  1VQN I;  4ENM A;  4RB1 A;  2PJR A;  4HYE A;  3S3N A;  1VQ6 I;  3R6S A;  4B3A A;  4IZZ A;  2TDX A;  4O5V A;  4Y3O A;  4AD9 A;  1FYM A;  4RA2 A;  4G6T B;  1G8X A;  2BHY A;  3LQQ A;  5BQT A;  2W00 A;  1J0R A;  1XX5 A;  3FM5 A;  4CZC A;  1RR8 C;  1G3T A;  1DUX C;  4CYD A;  2IT0 A;  2ZFW A;  1TQM A;  3ESW B;  3JTH A;  3OS2 A;  3HOV J;  1QO0 D;  5E1W A;  2YU3 A;  2DBB A;  4Q48 A;  5JI6 A;  1YRN B;  4M9Z A;  4XM3 A;  4XR6 A;  4XKV A;  4LGW A;  4AVZ A;  1K78 A;  1K7A A;  2GXG A;  4DIQ A;  3E5U A;  2Y69 H;  3RKX A;  5GTI C;  1VQ8 I;  1Z0X A;  3H5A A;  1H8A C;  2GIZ A;  1P6R A;  1XTA A;  3GFJ A;  2EQR A;  3BDD A;  2ELJ A;  2GLO A;  3RZO J;  1DGR M;  3G71 I;  4RGU A;  1EH8 A;  4KIF A;  5KAI C;  5KAF C;  5EF6 A;  3F22 A;  1WGX A;  3IWF A;  5H6Q A;  2V6C A;  2ZNY A;  3A0H C;  3DP7 A;  2B9S A;  2DI3 A;  5ICF A;  1NH3 A;  1LUJ B;  3R0J A;  2DTZ A;  4LMY A;  3OYJ A;  4UVC A;  3OL3 A;  2KJC A;  4Y52 J;  5GAE J;  2E2H J;  3A1Y A;  1LDJ A;  2H1L A;  4YIF A;  2EIJ H;  2DJN A;  3W2V A;  2XAJ A;  3HIF A;  3S8P A;  5FD5 A;  3KP7 A;  1MSE C;  9ANT A;  1IV8 A;  4FTH A;  1VQ7 I;  5J1Y A;  3V8K A;  2E5Z A;  3BG9 A;  2BW3 A;  2QQ8 A;  1ERD A;  4HA8 A;  3FX3 A;  4R8H A;  2ISZ A;  4FQG A;  4FHT A;  3ASN H;  2M8G X;  4G8X A;  1HLV A;  1F9N A;  2DMP A;  4HST A;  4FE7 A;  1JUP A;  2AO9 A;  2IXS A;  2K9M A;  4JYK A;  2Z33 A;  4ESB A;  2H09 A;  1JXS A;  1XGS A;  2L4M A;  4BY1 J;  2HKO A;  1W36 D;  3P5J A;  2D1V A;  3CP2 A;  3D1N I;  1ZH5 A;  2MH2 A;  4B09 A;  4CCJ A;  4ZZD A;  2O6G E;  2F5V A;  3GLX A;  1N75 A;  1TT5 B;  3QYE A;  4PDK A;  1NG6 A;  2QM3 A;  3OOP A;  5IT3 A;  3RPU D;  1MNE A;  3M8F A;  1FOW A;  5KNL A;  1N25 A;  4EVI A;  4HZF A;  2XDV A;  1HDD C;  3H3U A;  1Y0U A;  3H0D A;  1IXS B;  5L3D A;  3K7A J;  5LLQ A;  4UVA A;  2NVX J;  2DA2 A;  1QVT A;  1WRJ A;  1B4A A;  4G9Y A;  2L9V A;  1FBQ A;  3RQI A;  3K70 C;  1MMS A;  4ZYH A;  2K7L A;  3OWT A;  1TZL A;  3IRQ A;  2F4O B;  3BP8 A;  2HU9 A;  2CW0 F;  5IOZ A;  3RCO A;  1W1W E;  4HOB A;  2P0W A;  3S1Q J;  2IVM A;  3VB2 A;  2IA0 A;  5JVG F;  1DU0 A;  2Z16 A;  3IC7 A;  1OKR A;  4H0E A;  2EFP A;  1S3J A;  1XMX A;  3CP8 A;  3M07 A;  4I0A A;  2ID6 A;  3CTA A;  2CQN A;  4Y4R A;  2WAE A;  3RKY A;  3WOD F;  1BM9 A;  2VE9 A;  2F6C A;  2OJE D;  4ENJ A;  1PUF B;  4JP0 A;  3H5R A;  2G0E A;  2RV8 A;  4XSX F;  2FMY A;  1X3U A;  2IP2 A;  2NAZ A;  2XF5 A;  3KP6 A;  4DYC A;  1U3E M;  1XMA A;  2HVQ A;  2KT0 A;  4PJ0 C;  4JX5 A;  3DWL E;  2R7V A;  1OYI A;  3CCL I;  2G9W A;  3CJN A;  4MTE A;  1FIA A;  4GO1 A;  4EAT A;  5E79 C;  4IL6 C;  2DOD A;  3ABM H;  3HXL A;  1CGP A;  2FBH A;  3IH2 A;  4OIQ F;  2OCE A;  3BPX A;  5EEG A;  1K61 A;  5DCM A;  2HDD A;  4JQF A;  5E17 F;  2OU2 A;  1D8K A;  1JUS A;  2HFH A;  2VI6 A;  3H9G A;  1POG A;  1B72 A;  3VEP A;  1MJA A;  3HOS A;  5LRR A;  5LFA A;  4F52 A;  3R61 A;  4PZJ A;  4KIC A;  2HGC A;  5IYD J;  1FBS A;  3W6K B;  2WY7 Q;  1Y0N A;  2MH9 A;  2X85 A;  3K9T A;  3OIP A;  3WGG A;  1OCR H;  1YX5 A;  4HDV A;  4KIB A;  3MKW B;  2Y31 A;  1YIO A;  3N4M A;  1GDT A;  4NBQ A;  3BG3 A;  2R5Z A;  1KU7 A;  3OYD A;  4BE1 A;  4FX0 A;  1MBF A;  4Y17 A;  4C3I J;  3FMS A;  1RR7 A;  2QUF A;  3HKZ A;  3ZQH A;  4HQM A;  2LBF B;  2EV6 A;  5EDN A;  4KDP A;  3KYD B;  2Y0S A;  1XGM A;  1XD7 A;  3GTM J;  4U88 A;  1SMT A;  3OIO A;  5HDG A;  2HI3 A;  2PLY A;  3CCQ I;  3MCZ A;  4LOC A;  3RKQ A;  3R4K A;  3Q3S A;  2VQG A;  4UY8 I;  1F1Z A;  1F36 A;  3CC7 I;  1J09 A;  4YFN F;  2ESN A;  3HSF A;  4KNY A;  2H6C A;  3OR1 C;  2DT5 A;  2PJP A;  2DDB A;  3NEU A;  4MFD A;  4I2O A;  1KU3 A;  1Z77 A;  2VJI A;  1ETV A;  3ZQF A;  5D5X B;  3LA2 A;  3F23 A;  1FY7 A;  4E7K A;  3CLO A;  3SQN A;  1D0Z A;  3L2Q A;  3HUG B;  4RAG A;  5EYR A;  5C4J J;  2KRC A;  3BC8 A;  5HOO A;  2PQ8 A;  1R22 A;  1XSV A;  1AU7 A;  3RYP A;  4DZJ A;  3JRA A;  1HKT A;  1HW5 A;  4BY7 J;  1OR7 A;  2K02 A;  5FRN A;  2E19 A;  2RNJ A;  3CES A;  1I5Z A;  3M8E A;  1UST A;  4KIT B;  3ZOB A;  1W5T A;  1ZR4 A;  2F4I A;  3EYI A;  2DLL A;  2RDP A;  2AXT C;  2HQA A;  4LG0 A;  2GOX B;  1T98 A;  2R7U A;  2K3P A;  2NOJ B;  3P9C A;  4AIH A;  2ESH A;  4WK8 F;  1ZQ3 P;  2H27 A;  2Q2E A;  4KJZ A;  4NQW A;  4V19 K;  1LDK B;  3JRB A;  5FO5 A;  1F4K A;  1AOY A;  3HRS A;  4FAS D;  1Y56 A;  3IV5 A;  1JHF A;  1H9T A;  2FRH A;  1WWX A;  4KT5 C;  5K5R A;  3H35 A;  4N9H A;  1TWG J;  3RI4 A;  5IP6 A;  1YJW I;  3GFM A;  4ITV A;  4CHU A;  3HTS B;  2XB0 X;  1IUF A;  1U8R A;  2V1U A;  3K4N A;  3RZD J;  2VBZ A;  3FXK A;  2DMQ A;  4IOC F;  3WG7 H;  5IYC J;  1QU3 A;  4RAF A;  4OMZ A;  4DBR A;  2LG4 A;  3CCJ I;  4BKX A;  1FOX A;  3KLO A;  1D0X A;  2BXZ A;  3FXR A;  4JOM A;  1ETY A;  3K4C A;  4XON A;  2IGO A;  2WB1 N;  3TO6 A;  1I6H J;  2DFF A;  1KU2 A;  3CCV I;  4M3B A;  1DGW Y;  3MD2 A;  3H92 A;  2DA4 A;  3GX4 X;  3KE2 A;  3F72 A;  1WCM J;  2HOS A;  2STT A;  3DBR B;  2HPI A;  3DKY A;  2F5C A;  1ZN2 A;  4F91 B;  1MBK A;  2LNB A;  2I8D A;  1I1G A;  3ZR8 X;  1FC3 A;  4UUT A;  1IRX A;  2FXA A;  1UMQ A;  3BCA A;  4AIK A;  2JZY A;  3KZY A;  4CA0 A;  2HR3 A;  5K5Q A;  5FRM A;  1U9N A;  1U5T A;  3VYT B;  3DTI A;  3PIO F;  3HL2 A;  4A3G J;  2HXI A;  2KIM A;  4CCK A;  1A36 A;  3ZMT A;  3Q0V A;  2EA4 A;  1EF4 A;  1DU6 A;  2Z99 A;  3JCU C;  4M71 A;  5LD2 C;  3ZQC A;  4LD5 A;  2FNA A;  1ZGJ A;  2AQF A;  4AU7 A;  3COA C;  1USS A;  2VXZ A;  2ZXJ A;  1EJ9 A;  2KDZ A;  4NNJ A;  2O03 A;  1JGS A;  1FP2 A;  4H4K C;  3L2V A;  1R6R A;  4G7H F;  1ETW A;  2JA7 J;  2K85 A;  2ZNZ A;  5IYB J;  2LR8 A;  2M2E A;  2RGV A;  2ZC2 A;  2KMU A;  4MNU A;  4BYY A;  5GAG J;  3HOW J;  4AC0 A;  1MDM B;  2LKX A;  4HDU A;  1GUU A;  4BDZ A;  1H88 C;  4XBF A;  2FSW A;  3F8M A;  2EJR A;  4D1Q A;  2WY8 Q;  3ABU A;  3IAM 2;  2R7Z J;  1VTN C;  2HZT A;  1R1T A;  3PSI A;  1YTY A;  2W4S A;  2JJ7 A;  5F1R A;  1K4T A;  3I9V 2;  2CFX A;  4BJT A;  4HLY A;  1OCZ H;  1V5G A;  2JSC A;  2L9S A;  3HSR A;  4KMU X;  3GZ6 A;  1FX7 A;  2PBI A;  3SFZ A;  1KA8 A;  3QRF F;  1T6S A;  5E3O A;  2MA3 A;  1J5Y A;  2G7U A;  1WJ5 A;  5HOD A;  1Z9C A;  3QAH A;  2BY3 A;  4LLL A;  3TDZ C;  3E0J B;  2Q8K A;  4D5F A;  1G4D A;  2LOO A;  2QF7 A;  1PYV A;  4U7D A;  3S1N J;  2ZME B;  3KP3 A;  3I56 I;  2Z9O A;  2QYO A;  4QPO A;  3LOC A;  2P81 A;  1MKM A;  3FWE A;  2DK8 A;  1QZZ A;  1B1B A;  3RQ4 A;  4E6K G;  5J4Y A;  2NVY J;  3MFK A;  4D0P A;  4YIR X;  2EZH A;  2R7S A;  2DOE A;  3ABL H;  2GA1 A;  3OYN A;  3HGG A;  3BG7 A;  4CUG A;  4Q4Z F;  1Z21 A;  4Y15 A;  4L5I A;  4BHC A;  1S9H A;  1T56 A;  2I10 A;  5AIQ A;  3H1C A;  3CCU I;  1JKQ C;  3QU6 A;  1QPI A;  3NQO A;  3KIO A;  1UZC A;  1KGS A;  3BQZ A;  1YQA A;  4R79 A;  4D7N A;  1BC7 C;  2QEN A;  2QCO A;  3FXQ A;  2HQN A;  5H6R A;  2VL8 A;  3BZ6 A;  2QSG X;  5J4V A;  3F6V A;  2LRD A;  3DQV C;  4RMN A;  2DA3 A;  2XAH A;  1OFC X;  1MMD A;  4XLN F;  1W0T A;  2MD5 A;  3PFI A;  2A6E F;  2EBI A;  3WTW C;  2QGU A;  3KP4 A;  5DDG A;  3DLL F;  2IAI A;  2YX4 A;  3FMR A;  2DOF A;  4L18 B;  1HQC A;  2PEX A;  5CVJ A;  2CV0 A;  2HKX A;  4DW6 A;  1K79 A;  3DTK A;  4XRF A;  5E20 A;  1ZHF A;  3V4G A;  4BH9 A;  2ZO4 A;  3CMA I;  4XNF A;  1SC7 A;  3PIP F;  3ECO A;  2O5R A;  2FQ4 A;  1R71 A;  2FEZ A;  1NTC A;  3E5Q A;  5HVQ C;  4BAC A;  3GTK J;  1KQ0 A;  3EYY A;  3HM5 A;  1IN8 A;  4XLF A;  5M5W J;  2KL4 A;  4DYR A;  4YEL A;  2R7F A;  4HNT A;  1BI1 A;  4FE4 A;  4IO9 F;  3C18 A;  5K7H A;  2TRT A;  3CO7 C;  2V79 A;  3TDU C;  1B8I B;  2R5Y A;  3F8C A;  3H0G J;  2EIM H;  2IGN A;  4A2U A;  1O7F A;  3HB9 A;  4NC6 A;  2KHM A;  3OYE A;  2KZG A;  2HQ5 A;  3PO2 J;  3F8B A;  3MZH A;  5J40 A;  4CZZ A;  2WBM A;  4ETS A;  2FF4 A;  3FIS A;  1LVA A;  4AVP A;  4G6Q A;  1E0E A;  3F6O A;  3HG9 A;  3ROU A;  2L3D A;  5M5Y J;  4UV9 A;  2VJ4 A;  3O8G A;  5GPA A;  2CRG A;  1KON A;  1TC3 C;  2JN6 A;  4ZYG A;  5HLH A;  3SDB A;  1BIA A;  1NK2 P;  1GVD A;  1O7L A;  2LKP A;  4E7S A;  3D5S C;  4G94 A;  4I6Z A;  3CDI A;  3LSJ A;  4WF2 A;  1SAX A;  4M74 A;  5HLI A;  1GV5 A;  2K4J A;  3WTS C;  1WVR A;  5F64 A;  2Z3Y A;  3KEY A;  4I09 A;  3PSF A;  1TTY A;  1FOY A;  2GXA A;  3CUQ B;  3HC7 A;  3J7Y J;  2VXD A;  1WJD A;  3JAM K;  4PJM A;  1P92 A;  5FRO A;  1G3Y A;  3IWZ A;  3J7A Y;  3G1M A;  2R7X A;  1R5G A;  3ZRG A;  1J9I A;  3B02 A;  3HRM A;  3EUA A;  2A68 F;  1G59 A;  1Z7U A;  2UZK A;  3H9Q A;  4ZZL A;  4MO7 A;  4BXF A;  3U21 A;  1AA7 A;  3ELK A;  2FML A;  1OYY A;  1S7E A;  1W7P B;  4NHJ A;  1R49 A;  1AKH A;  3PNV A;  3Q9S A;  2HVR A;  1UHS A;  2YUS A;  3BJ6 A;  4PK4 A;  1H0M A;  4A93 J;  2DJI A;  4QPQ A;  2E36 A;  3VSK A;  3A02 A;  3W6J B;  3ZMV A;  4LK1 F;  3TOB A;  2V9K A;  4PJL A;  3RIR A;  4U7B A;  1LNW A;  2LF8 A;  1MW7 A;  5FKL A;  4CXF A;  2WC2 A;  3CJQ B;  2M45 A;  2V7F A;  5B1A H;  4CYC B;  3CLQ A;  4EJW A;  2BYV E;  4UNO A;  2XPV A;  2BZT A;  3VYU B;  1MBH A;  5L3B A;  3QOE A;  5GPC A;  5B66 C;  3MKY B;  1IGN A;  4C9Y A;  2MC4 A;  4II3 A;  3HHH A;  4KIG A;  4XN3 A;  2IGK A;  2AHQ A;  1T39 A;  3DXJ F;  5J8F A;  2EFN A;  2MFZ A;  4PJJ A;  4M6V A;  3WE2 A;  1ZAO A;  2CW7 A;  2PMH A;  4B47 A;  4D7M A;  5A2Q Z;  3CME I;  1JHH A;  2V1D A;  5K1Y A;  1FZP B;  5J47 A;  2CWE A;  3KZZ A;  2DPD A;  2HTS A;  2ZME C;  4X0G A;  3LAP A;  3MWM A;  4MLO A;  3BG5 A;  1YHQ I;  1XMK A;  4IX7 A;  2XSJ C;  3RPU A;  2MD0 A;  4Y13 A;  5K7F A;  3HOY J;  3CMY A;  1JT0 A;  1SFO J;  3T1B A;  2CFO A;  1XG1 A;  4FIS A;  1ZRC A;  2IW5 A;  2K3F A;  2WB1 A;  4LG3 A;  1AWC A;  3GYH X;  1RNL A;  2DA6 A;  5ERI A;  5D4S A;  1GVJ A;  1BI0 A;  2OC6 A;  2ZBK A;  1ETX A;  2PMU A;  3OY9 A;  3S2H J;  5CVU A;  3VPR A;  2X48 A;  1DQU A;  4X6A J;  2JA6 J;  3KET A;  1DPU A;  2W7N A;  1S6L A;  5HNF A;  1E17 A;  3TOA A;  4DNC A;  3F0C A;  3DKW A;  1JJ8 C;  3I4N J;  5TGT A;  1Z6R A;  5DS9 A;  2ZKZ A;  3PNT A;  3BZC A;  4MEY F;  3WHB A;  4XIC A;  1Z1D A;  4BQQ A;  5HS8 A;  1IRF A;  4LIU A;  1MBE A;  3BR2 A;  1CF7 B;  2BXY A;  5ICG A;  1YOV B;  2JRT A;  5CVR A;  2IPQ X;  4YII A;  4Z2Y A;  4NC7 A;  4KIS A;  1RES A;  3TW7 A;  3FXM A;  3CC4 I;  3M8J A;  3S2D J;  1VQ5 I;  1LJ9 A;  2MSY A;  5JVT A;  3FMQ A;  1UJ8 A;  4BE0 A;  2VKE A;  2HOT A;  1T2K A;  3LFK A;  2NNN A;  1XDS A;  3NWS A;  1T0F C;  4Q47 A;  3ZMD A;  5HDK A;  1UAA A;  1LEA A;  3E7L A;  3QPS A;  1ACI A;  2DT6 A;  3IRR A;  4ZYD A;  1W4M A;  3I53 A;  2V1N A;  1RKT A;  1F43 A;  2CV2 A;  4RAY A;  2KRF A;  3J7A O;  5LHG A;  5DD4 A;  2HNH A;  5EJC A;  4PUS A;  1MND A;  1YJ9 I;  3MN2 A;  1TW3 A;  2XGC A;  2VBY A;  4MHG A;  4A3M J;  3GTJ J;  2WA0 A;  5J1R A;  4OIN F;  2VPL A;  3V8L A;  1O4X A;  2CMP A;  1REP C;  3AG2 H;  5TIS C;  5EGO A;  2QA4 I;  2IA1 A;  4XOT A;  4A12 A;  2IRF G;  5FLX K;  3RDI A;  1R5I D;  3A01 A;  4YG2 F;  4F93 B;  1WH5 A;  2D5V A;  4PGH A;  2VUM J;  2LC2 A;  5FFZ A;  2BE5 F;  3UNG C;  5E3L A;  2ZCW A;  1O3S A;  2XAG A;  4XKB A;  2X6X A;  4PSX A;  3T0Y A;  2KZV A;  4YFX F;  3OYK A;  3QQA A;  2BGC A;  4M9X A;  2PJR B;  1HST A;  2CGP A;  3KFW X;  1K6Y A;  4C3J J;  2LBF A;  2KFD A;  1Y8Q B;  3M7G A;  3UR3 C;  3CCR I;  3TMO A;  1O3T A;  2E60 A;  2XIG A;  3R60 A;  1Z7L A;  3JRG A;  1Y39 A;  3WU0 A;  4JK1 X;  2E5N A;  2IGM A;  3KLN A;  5ILV A;  4ENN A;  2CV1 A;  2F4M B;  3E6D A;  4QWQ A;  2VJJ A;  3BR5 A;  2E7W A;  4FX4 A;  2AS5 F;  2DW4 A;  2H94 A;  5D5U B;  4U0Y A;  1Z3X A;  3JSP A;  2K9S A;  2E1O A;  2O7O A;  2KDO A;  1HBX G;  4M3G A;  3CF2 A;  2CUJ A;  1TP4 A;  1NG7 A;  3BY6 A;  1X1D A;  3NAR A;  1K78 B;  5H20 A;  1FLI A;  2UUZ A;  5FKO A;  4A3I J;  1ONV A;  4XRS G;  4RB2 C;  1YIJ I;  2Y2Z A;  4HNV A;  4EGY A;  3GTO J;  1ZKG A;  4KFC A;  1X1B A;  3C2G A;  2VKV A;  3BR1 A;  4HBL A;  4L5J A;  3A0B C;  4A3F J;  2X51 A;  1QRY A;  1ZEL A;  2EA2 A;  5KK1 A;  1YE9 A;  3W3C A;  1GLN A;  3DPU A;  3OYH A;  1T95 A;  2ELK A;  2L7Z A;  3S14 J;  1JT6 A;  2PG4 A;  2DN0 A;  3K1P A;  1MMN A;  1DP3 A;  1BA5 A;  1SFK A;  2ISY A;  3OYB A;  1U8B A;  4ZTF A;  3S16 J;  1WHU A;  2ID3 A;  3HTU A;  4MIM A;  4QSH A;  2XC7 A;  2A07 F;  2FBI A;  2A6T A;  1L0O C;  2V26 A;  4LB5 A;  1D1B A;  4UB8 C;  4BBR J;  4IQ4 A;  5IOY A;  2W24 A;  2NOG A;  2YX7 A;  2QEX I;  3HDD A;  3WU1 B;  1BBY A;  3K4M A;  3QPL A;  5J3L A;  3V8J A;  3OYG A;  2M7A A;  2VON A;  1ZGW A;  3JRI A;  4BJ5 C;  1R4M B;  4G12 A;  4LLN A;  1FYL A;  5IT9 Z;  3TGN A;  4DQ2 A;  1JE8 A;  3GTP J;  3OOU A;  5LHI A;  1RUO A;  1FEX A;  1FSH A;  1QZE A;  3HHG A;  3F3X A;  4AYB A;  3MVP A;  5CQE A;  4OAZ A;  5DTD A;  4A0Y A;  2E1M C;  4RM2 A;  1DDN A;  4IQJ A;  5BS6 A;  5FFX A;  4UVB A;  4GDF A;  1ENH A;  4HV5 A;  3IP4 B;  4M3D A;  2ECC A;  4Z6Y A;  4PJN A;  2K40 A;  1ZAR A;  3PFY A;  1Z3Y A;  4B3X A;  3CJT B;  1FSE A;  4XSZ F;  2B0L A;  5HS9 A;  2VBW A;  3H36 A;  5DM7 F;  1BW6 A;  1LQ1 A;  1BI3 A;  5F08 A;  5K5O A;  3N97 A;  3P9K A;  3FBI B;  3QOD A;  5E3M A;  1PP7 U;  2MC3 A;  3EET A;  4EV0 A;  4HX4 A;  5BPD A;  1I39 A;  1JUM A;  4PGG A;  1MNM C;  4A3C J;  2CUE A;  4EMS A;  1U2W A;  4LFU A;  1IV6 A;  4YFK F;  4HRI A;  1OIS A;  2LVS A;  2QSH X;  4S05 A;  2VOP A;  2XHK A;  4EM1 A;  4A3L J;  4L0Y B;  2LP0 A;  1DP7 P;  2R7Q A;  3HSE A;  2RQQ A;  1OCO H;  5JR3 A;  1WJF A;  2DYS H;  1RZ4 A;  1B9N A;  1LE8 B;  4CH7 A;  4ZYE A;  2CUF A;  4C2T A;  3FZV A;  3F21 A;  3REO A;  1X58 A;  2BY0 A;  3M9A A;  3KPH A;  4RB3 C;  1SVL A;  5M3F J;  2ZB9 A;  1TQP A;  1QVU A;  2EIK H;  1FNN A;  3DU5 A;  4N4O B;  3TW6 A;  1ZRE A;  1XC5 A;  3PUF A;  4GRI A;  4WX9 A;  1IRZ A;  3MEX A;  2OA4 A;  2WWY A;  3WE3 A;  3SZT A;  4DOZ A;  1RC9 A;  4RS8 A;  5JHU A;  2Z1D A;  4FCY A;  2PMZ N;  1V55 H;  3ZN0 A;  2ZJR F;  3TBI A;  5DEQ A;  4L5E A;  2Y48 A;  4C2M J;  5BMZ A;  4F3Q A;  1MDM A;  2JMW A;  1B72 B;  2WAD A;  1R1U A;  4A3B J;  3J81 Z;  1SFE A;  3EUH C;  1OCP A;  2PN6 A;  5K7Z A;  3OV8 A;  5LGN A;  4KA4 A;  1LVK A;  4HSR A;  3LSR A;  1Q1H A;  1RET A;  3GXO A;  2V9P A;  3LQR A;  1EV7 A;  3TL4 X;  3C1D A;  3RYR A;  2PX9 A;  3L2U A;  4HX7 A;  1FOK A;  1HA8 A;  1WKM A;  2XRN A;  3BLY A;  4XRM A;  4OOI A;  2LYC A;  3WTU C;  2R5Z B;  1L3L A;  5HLG A;  4XOP A;  1KZH A;  1FYK A;  1O57 A;  2K27 A;  3V7C A;  1FTZ A;  4J19 A;  3DFG A;  4EGZ A;  1QQI A;  3VSL A;  4B8X A;  1Z05 A;  2V6E A;  2P5L C;  2ZME A;  2QZ8 A;  3LL7 A;  3EDP A;  1FT9 A;  2XKO A;  3QYB A;  3J80 Z;  5FLM J;  4AM3 A;  5CYV A;  5D8K B;  2A5Y B;  4BGD A;  4UXN A;  5EG0 A;  4KN4 X;  3J7Z I;  2NS8 A;  5ED4 A;  4B4C A;  3T8R A;  3LSG A;  4RAZ A;  3W2W A;  4YRV A;  3ECH A;  4BEH A;  5J6X A;  3OYF A;  4M6X A;  1E2X A;  2XF7 A;  3IUO A;  2XPU A;  4U0V A;  3CF5 F;  2FNP A;  4HAM A;  5DUK A;  4UUS A;  2L9R A;  5L3C A;  3AG4 H;  2P5K A;  5F0F A;  5KVR A;  4IHY A;  1R5H A;  3K10 A;  1TWF J;  4XMY A;  4OAY A;  4CIC A;  5IY5 H;  4E7Z A;  3EPZ A;  3WTZ A;  2XRL A;  1SD5 A;  4L9J A;  4QLC U;  5ICC A;  3CCS I;  3P9I A;  4MTD A;  2CH0 A;  3V7S A;  1X19 A;  3B6C A;  3SZG A;  2BV6 A;  2HXO A;  5DV5 A;  1PDN C;  4CCL A;  4F92 B;  2JWT A;  3I58 A;  3LSH A;  3RJP A;  2GBY A;  3RSN A;  2IS6 A;  3DF8 A;  3FKI J;  3IH3 A;  3VFZ A;  1MH4 A;  1FPQ A;  2J5P A;  2VBX A;  5D6E A;  1DPR A;  3LFU A;  2NVQ J;  4NQW B;  2NVT J;  2V9V A;  5D6F A;  3L09 A;  1TW2 A;  5HLT A;  3RPQ A;  5CKT A;  2ADU A;  4W1U A;  2L4A A;  3K4K A;  3ZPL A;  1BR1 A;  2LKS A;  4L0Z B;  1RKW A;  2W84 A;  4XLA A;  3HOT A;  2STW A;  5CQG A;  2QSF X;  4NDL A;  2M7B A;  1T0F A;  5F27 A;  3SHF A;  4E7H A;  1HDP A;  3GFL A;  1MBG A;  3O8H A;  2GAU A;  1P4W A;  3GZN B;  4HLX A;  1XS9 A;  1GT0 C;  1HOM A;  1PJR A;  6PAX A;  3HEF A;  5FLV A;  3LAJ A;  1EH7 A;  5D5V B;  2OTL I;  2CUZ A;  1ZRF A;  4E7L A;  4HX8 A;  2ZJP F;  3TO7 A;  3C7J A;  4E4H A;  2R7T A;  3GO5 A;  2XGX A;  1YW8 A;  2M4K A;  2JSP A;  1O3Q A;  3AG3 H;  1HCR A;  4OIO F;  4WXH A;  3I55 I;  3DTE A;  2EZI A;  3GCM A;  2LMD A;  2H1K A;  2GIV A;  3ABK H;  2O9L A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  3JRD A;  1ETQ A;  3K7A J;  2AHQ A;  3BR6 A;  2NVX J;  5C3E J;  2DA2 A;  1Y1V J;  1W0U A;  1QVT A;  2DA7 A;  2LLK A;  3JRH A;  2YU9 J;  2OF7 A;  1ZK8 A;  2FJ1 A;  3RQI A;  4M6V A;  2VPR A;  3S1M J;  4D7M A;  5IOZ A;  1JTY A;  1LFU P;  3S1Q J;  1DU0 A;  3GTG J;  4MLO A;  2ID6 A;  3BG5 A;  4BXX J;  2EH3 A;  4X1E A;  1K83 J;  2HOA A;  1X2M A;  1Q1V A;  1Y1W J;  3BTC A;  4JX4 A;  2CQQ A;  5K7F A;  3HOY J;  3CMY A;  1PUF B;  1SFO J;  1JT0 A;  4JP0 A;  2G0E A;  1XG1 A;  3A03 A;  4FIS A;  2EZL A;  3HBL A;  4DYC A;  1MSF C;  2DA6 A;  2M9H A;  3IH4 A;  2KT0 A;  4MFE A;  3UKG A;  4JX5 A;  1ETX A;  3S2H J;  4XK4 A;  3VPR A;  4M3F A;  2X48 A;  5FJ8 J;  4X6A J;  2JA6 J;  1E3O C;  1BJZ A;  1FIA A;  5F0C A;  2R0Q C;  1LFB A;  4C3H J;  3F0C A;  4CYC A;  3ZQL A;  1CQT A;  3I4N J;  1JJ8 C;  5DS9 A;  1TWC J;  4AUX A;  2ME6 A;  3WHB A;  2FD5 A;  3IH2 A;  4XIC A;  1VFC A;  2HDD A;  1K61 A;  2E2I J;  3BTL A;  1JUS A;  2VI6 A;  1B72 A;  1POG A;  1MBE A;  1IG7 A;  3BR2 A;  1I3Q J;  1UG2 A;  1JKR C;  5IYD J;  4A69 C;  2CJJ A;  3L1P A;  1RES A;  3TW7 A;  5IP7 J;  3S2D J;  2Y31 A;  2MSY A;  1FIP A;  2OPT A;  1GDT A;  3BG3 A;  3FIW A;  2R5Z A;  1RPW A;  1TWH J;  5M3M J;  2GM4 A;  5EZG A;  2VKE A;  3BR3 A;  1MBF A;  4C3I J;  2DA5 A;  1ETK A;  2HOT A;  3CQZ J;  1RR7 A;  1WI3 A;  3ZQH A;  5EDN A;  3E7L A;  3QPS A;  3Q0U A;  3GTM J;  1F43 A;  1RKT A;  1T33 A;  3OIO A;  2HI3 A;  2MW8 A;  3C2B A;  1HF0 A;  3HKZ N;  4LOC A;  3RKQ A;  4XRS A;  3Q3S A;  2Y0S N;  4V2F A;  1F36 A;  3MN2 A;  4BBS J;  2XGC A;  1B8I A;  4A3M J;  3GTJ J;  5J1R A;  4MFD A;  1Z77 A;  3ZQF A;  1ETV A;  4A3J J;  1O4X A;  2M0C A;  2B63 J;  5EYR A;  5EGO A;  5C4J J;  4IHX A;  5C44 J;  5FKN A;  1YRN A;  3SFI A;  3A01 A;  2XPW A;  2R93 J;  1WH5 A;  1ZTR A;  2D5V A;  3W6V A;  2VUM J;  1AU7 A;  3FK6 A;  4DZJ A;  3JRA A;  1U9O A;  4BY7 J;  2IEK A;  5E3L A;  2E19 A;  2XB5 A;  2E2J J;  4ABZ A;  1JKO C;  5F1J A;  2XSD C;  2N8G A;  2Y9Z A;  3BR0 A;  3ZOB A;  4QTR A;  1ZR4 A;  3QQA A;  2L7F P;  5EG0 B;  4C3J J;  1ZQ3 P;  2ECB A;  2EZK A;  1X2N A;  3JRB A;  3JRG A;  3PM1 A;  3HOU J;  4DYQ A;  3IV5 A;  5EEA A;  4UUS B;  2K9Q A;  2HYJ A;  3BR5 A;  4RDU A;  1TWG J;  5IP6 A;  1A6I A;  5F0H A;  2K9S A;  2E1O A;  2O7O A;  2XB0 X;  1IUF A;  1P7I A;  4M3G A;  4IHV A;  4EEF G;  5BNG A;  3RZD J;  3CCY A;  2K9N A;  2LK2 A;  3NAR A;  2DMQ A;  1MH3 A;  2JK3 A;  5IYC J;  5FKO A;  4A3I J;  4XRS G;  1ETO A;  2Y2Z A;  4HNV A;  3GTQ J;  4BKX A;  1ZKG A;  3GTO J;  4M3E A;  2VKV A;  3BR1 A;  1ETY A;  4A3F J;  1QRY A;  2WB1 N;  1I6H J;  1FTT A;  4M3B A;  2ELK A;  2IBD A;  2L7Z A;  3S14 J;  1JT6 A;  2DN0 A;  4IEJ A;  2DA4 A;  3HGY A;  2Y30 A;  3G1O A;  1U8B A;  1BA5 A;  1WCM J;  1U78 A;  3S16 J;  2HOS A;  2ID3 A;  4MIM A;  4QSH A;  1D5Y A;  3S1R J;  1MBK A;  1I50 J;  3BQY A;  3I4M J;  4BBR J;  5IOY A;  2NOG A;  4UUT A;  1IDY A;  3HDD A;  1UMQ A;  3QPL A;  1OJL A;  3DEW A;  5J3L A;  1ZGW A;  3JRI A;  1U9N A;  2DA1 A;  3NAU A;  4G12 A;  4A3G J;  3BTI A;  3GTP J;  1AKH B;  3OOU A;  2HXI A;  3K2A A;  3PO3 J;  3Q0V A;  1FEX A;  3S17 J;  2CU7 A;  1EF4 A;  1DU6 A;  3ZQC A;  3H3V K;  3MVP A;  4W97 A;  5DTD A;  2X6O A;  3BT9 A;  2KDZ A;  2XGE A;  1PUF A;  3TP0 A;  4XID A;  1JKP C;  1ENH A;  1ETW A;  2XGD A;  3JR9 A;  3OSG A;  2JA7 J;  3BTJ A;  4M3D A;  2ECC A;  2LY9 A;  1IDZ A;  5IYB J;  2K40 A;  2LR8 A;  2M2E A;  4AYB N;  3LNQ A;  2Y9Y A;  2CQX A;  1BW6 A;  3HOW J;  4AC0 A;  5FKK A;  2MGQ A;  2LKX A;  5F08 A;  1GUU A;  1H88 C;  3ZQI A;  1P7J A;  5E3M A;  3CDL A;  1AHD P;  2R7Z J;  1JUM A;  3GBG A;  3SDG A;  1MNM C;  2JJ7 A;  4A3C J;  2CUE A;  3SJM A;  1TWA J;  1IV6 A;  3JRF A;  2LVS A;  4B1R A;  1ITY A;  4A3L J;  2LP0 A;  4A3K J;  1ZR2 A;  2X9D A;  5E3O A;  1VND A;  5FKM A;  5HOD A;  2WAQ N;  2M34 A;  5JLW A;  2LFB A;  1LE8 B;  4A3E J;  5F04 A;  1G2H A;  1WH7 A;  2CUF A;  4D5F A;  2QF7 A;  4Y7N J;  3S1N J;  1X58 A;  2LTP A;  2L7M P;  3LOC A;  3HOX J;  2P81 A;  5IP9 J;  3GTL J;  2NS7 A;  5M3F J;  2ME0 A;  2ZB9 A;  1IJW C;  1QVU A;  2NVY J;  4S0H B;  2EZH A;  4I76 A;  3TW6 A;  2W48 A;  1A5J A;  1XC5 A;  3HGG A;  3M3Y J;  1IRZ A;  3FK7 A;  3S15 J;  3ZQG A;  1T56 A;  2R5Y B;  2I10 A;  2DMT A;  4FCY A;  2PMZ N;  2FX0 A;  1VI0 A;  2TCT A;  1JKQ C;  1QPI A;  4L5E A;  2YS9 A;  3BQZ A;  3G1L A;  4C2M J;  1WPK A;  3Q0W A;  4D7N A;  1ORK A;  4V2G A;  2COB A;  2QCO A;  2JMW A;  1B72 B;  1OCT C;  1H89 C;  4A3B J;  5EZH A;  1OCP A;  5K7Z A;  5GP9 A;  5M5X J;  1JGG A;  3LSR A;  2H8R A;  2DA3 A;  1RET A;  1OFC X;  2LD5 A;  1W0T A;  2EBI A;  1IC8 A;  2IAI A;  1JJ6 C;  4XRM A;  2R92 J;  2MG4 A;  2R5Z B;  4IHW A;  4DW6 A;  4GFB A;  1FTZ A;  4J19 A;  1LE8 A;  2DMN A;  3MKL A;  3TED A;  2FQ4 A;  1NTC A;  3GTK J;  5FLM J;  1SAN A;  3LSP A;  3HM5 A;  3OSF A;  5EG0 A;  5M5W J;  4DYR A;  4B3A A;  4FE4 A;  2JA8 J;  2NS8 A;  5K7H A;  1JTX A;  2TRT A;  4B4C A;  4QIW N;  3LSG A;  3TP3 A;  2R5Y A;  1B8I B;  1APL C;  3H0G J;  3HB9 A;  2JA5 J;  2HQ5 A;  2XPU A;  3PO2 J;  4UUS A;  2L9R A;  3JRE A;  5F0F A;  4IHY A;  5EGO B;  2WV1 A;  3HOV J;  3FIS A;  1TWF J;  1YRN B;  1BW5 A;  3A01 B;  3B6A A;  2XRL A;  4RBO A;  5M5Y J;  3O8G A;  5GPA A;  2CRG A;  1TC3 C;  2JN6 A;  3B6C A;  1NK2 P;  1GVD A;  3M4O J;  2HXO A;  2DMU A;  1Z0X A;  4I6Z A;  2JWT A;  3LSJ A;  1H8A C;  2EQR A;  1GV5 A;  2GBY A;  3WHC A;  2GLO A;  3RZO J;  3FKI J;  1BL0 A;  3IH3 A;  5EF6 A;  1WGX A;  1MH4 A;  2RAE A;  2NVQ J;  2NVT J;  1R9T J;  2DTZ A;  3HOZ J;  4W1U A;  4Y52 J;  1FJL A;  2E2H J;  3JRC A;  3G1M A;  2DJN A;  1RKW A;  1NK3 P;  4DZP A;  1MSE C;  9ANT A;  4NDL A;  1MBJ A;  4FTH A;  5F27 A;  4JX6 A;  5J1Y A;  1HDP A;  4MO7 A;  3DCF A;  3BG9 A;  1MBG A;  3O8H A;  1S7E A;  1XS9 A;  2M8G X;  1GT0 C;  1HLV A;  1HOM A;  2DMP A;  1AKH A;  5JLX A;  3HEF A;  4FE7 A;  1JUP A;  2AO9 A;  5FLV A;  4JYK A;  5IPA A;  2O8K A;  1UHS A;  2YUS A;  5E3N A;  4BY1 J;  4A93 J;  4A3D J;  3A02 A;  5C4X J;  3D1N I;  1VF9 A;  5FKL A;  4D5C A;  5J1U A;  1HCR A;  4CYC B;  2L0K A;  2XPV A;  2EZI A;  2H1K A;  1MBH A;  1HDD C;  5GPC A;  1IGN A;  2O9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...