1PUFB

Crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*
publication title STRUCTURE OF HOXA9 AND PBX1 BOUND TO DNA: HOX HEXAPEPTIDE AND DNA RECOGNITION ANTERIOR TO POSTERIOR
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pufB00
2HOAA 2X9DA 2O8KA 2B63J 2CUEA 5GPCA 2CRGA 1SANA 1WI3A 4XRMA 4FE7A 2OF7A 1MBFA 1F43A 3ZQLA 1W0UA 3S1RJ 5IOYA 2DA5A 2DTZA 3LSJA 2QF7A 1IRZA 4C3IJ 2IBDA 2ID3A 2E1OA 1MSFC 3HDDA 2XPVA 3O8GA 2WAQN 5F08A 2XB0X 5J1RA 1ZK8A 3HOUJ 2XRLA 2N8GA 3IH3A 1LE8B 4JX5A 4XRSG 3BR6A 1UMQA 4M3FA 4G12A 1BA5A 3O8HA 2EZKA 2LP0A 5M5YJ 5IP7J 1ENHA 1H88C 2VUMJ 4B1RA 2ME6A 1ETWA 3FISA 2XPUA 4A3EJ 2R0QC 3GTJJ 4Y52J 1OCPA 1MBGA 3ZQHA 1PUFB 1WH7A 1X58A 2NS8A 3TP0A 4IHWA 1BW5A 5C44J 2JA8J 4JP0A 5C4XJ 4A3JJ 3IV5A 4NDLA 2ID6A 2DA1A 2LY9A 1ZGWA 1SFOJ 4RBOA 1BW6A 4BXXJ 3LNQA 2K9QA 3E7LA 2NVXJ 1IG7A 2NOGA 1I50J 2XGEA 3CCYA 3BTCA 2IAIA 3BR2A 1D5YA 2MG4A 3JRGA 4W97A 1UG2A 1IJWC 2EZHA 3H0GJ 2M8GX 5GPAA 2GLOA 2FJ1A 2WB1N 4I6ZA 4DZPA 3LOCA 4B3AA 5K7HA 2XGDA 3HGYA 5EF6A 2DA7A 1U78A 2XSDC 2L0KA 1ETYA 1RESA 1U9OA 5EG0B 3B6AA 1IGNA 2JN6A 1PUFA 4ABZA 2O9LA 1JKPC 1GV2A 3S15J 1YRNA 2R92J 2OPTA 2M9HA 3BQYA 1U9NA 5E3NA 3C2BA 3BTJA 4B4CA 1ZR4A 4A3BJ 2QCOA 1W0TA 1NK3P 4FE4A 5C4JJ 2Y9ZA 4MFEA 4GFBA 4M3GA 1B8IA 2JA5J 2Y31A 4CYCB 1MH3A 1RKWA 1ETOA 1JJ6C 5FKLA 4QIWN 3F0CA 3JRCA 1FJLA 3BR5A 3JRBA 2R7ZJ 2CQQA 3BR0A 4D5CA 4AC0A 2LKXA 5K7ZA 3G1LA 2VPRA 1LFUP 3GTPJ 2FQ4A 3A02A 2L9RA 2JA7J 1ETKA 2X48A 5M5XJ 5JLWA 4J19A 1TWGJ 4A3FJ 5EG0A 1FIAA 3FK7A 1I6HJ 5E3LA 4QTRA 5J1UA 3HEFA 1MBEA 3QPLA 3TP3A 4A3IJ 1AU7A 2GBYA 2R93J 1X2NA 2IEKA 1JUPA 2X6OA 4V2GA 3OIOA 4BBRJ 2LVSA 5DS9A 1ETVA 5IYCJ 1NTCA 2K9SA 1OJLA 4CYCA 4UUSA 3RZDJ 5M3FJ 3I4MJ 4MO7A 1OFCX 2ECBA 4D7MA 2L7MP 3S1NJ 1QVUA 1MH4A 2Y30A 3OSFA 9ANTA 1U8BA 1XG1A 1OCTC 1VI0A 3S1MJ 1G2HA 4FISA 4C3HJ 1IC8A 3PO2J 5F0FA 5IP9J 3WHCA 1IDYA 1GT0C 4W1UA 4C2MJ 5E3MA 3TEDA 2XGCA 1H89C 5IYDJ 3JRAA 3L1PA 2E2HJ 1B72A 2R5YA 3HOVJ 1X2MA 3GTQJ 3ZQIA 4BY1J 1NK2P 3S2HJ 3D1NI 2NVYJ 3H3VK 2W48A 3HOYJ 1Y1VJ 3K2AA 5IOZA 2DA4A 2DMQA 1RETA 2KDZA 3HB9A 1P7JA 1T56A 2O7OA 3OOUA 1MBJA 2EZIA 5EDNA 4D7NA 2ECCA 2RAEA 2HOTA 1LE8A 2R5ZB 5F0CA 4DYQA 4M3DA 2HXIA 1HDDC 4QSHA 2DMPA 1MSEC 1FTTA 3RZOJ 2DMTA 3ZQCA 3GTOJ 4LOCA 4D5FA 2PMZN 1MBKA 3G1OA 4IHXA 2D5VA 3OSGA 3RQIA 3I4NJ 2EBIA 4DYRA 4IHVA 4AYBN 1Z77A 1P7IA 2CJJA 5F04A 3DEWA 2NS7A 2Y0SN 5F27A 3TW7A 3ZQFA 1JKOC 2TCTA 2LFBA 1POGA 1A6IA 3DCFA 5FJ8J 2JJ7A 1XC5A 5FKMA 5F0HA 1TC3C 5M5WJ 4BY7J 4A69C 2YUSA 3IH2A 3ZOBA 3Q3SA 1AHDP 1XS9A 2M2EA 5IYBJ 2R5ZA 4JX6A 2COBA 2DMNA 2E2JJ 1RPWA 4M3EA 5F1JA 3GTGJ 2VKEA 1GUUA 4V2FA 2LLKA 1Y1WJ 2WV1A 2ME0A 3BTIA 4EEFG 4UUTA 1WGXA 1RKTA 2M0CA 1JT6A 3FK6A 3FIWA 3HGGA 2LTPA 3VPRA 4RDUA 2KT0A 5DTDA 2YS9A 3CQZJ 2LK2A 2LR8A 2HOSA 4IEJA 5FKKA 3HM5A 2NVTJ 2TRTA 3PM1A 4DW6A 1BJZA 1HCRA 2EZLA 1ORKA 1HF0A 3MVPA 1JT0A 4M3BA 1IDZA 4DZJA 2E2IJ 5M3MJ 3UKGA 4X6AJ 3CMYA 5FKOA 4C3JJ 4MFDA 1FEXA 1VNDA 2ELKA 3HKZN 2MSYA 2CU7A 4XRSA 2YU9J 4A3DJ 3BG9A 3FKIJ 3BG5A 2NVQJ 3HOWJ 1RR7A 3HOZJ 2M34A 2DA3A 5E3OA 2E19A 1JUMA 1IUFA 3IH4A 2P81A 1GVDA 3Q0WA 2HI3A 2DJNA 5FKNA 4JX4A 4XK4A 1ETQA 3SDGA 1QRYA 4I76A 2HDDA 1DU6A 1FIPA 1O4XA 1EF4A 4A3LJ 3A03A 1HLVA 3GBGA 2HXOA 3QQAA 3JREA 1QVTA 2JK3A 2CQXA 3BT9A 5EZHA 5EGOB 1S7EA 1TWFJ 4BBSJ 1UHSA 2I10A 4Y7NJ 5IPAA 5GP9A 1IV6A 1JJ8C 4DYCA 4A3CJ 3LSGA 5J1YA 3S17J 3JRHA 2DMUA 2L7ZA 1I3QJ 1MBHA 1F36A 4A3KJ 1WH5A 3HBLA 4S0HB 1YRNB 3BTLA 1JKRC 3PO3J 3CDLA 1TWCJ 2LD5A 3MKLA 5EYRA 3JRIA 3JRFA 1BL0A 2DN0A 3BR3A 3MN2A 3QPSA 2MW8A 5K7FA 2FX0A 2Y2ZA 3NAUA 1AKHB 1DU0A 3BR1A 2AO9A 1B8IB 5EZGA 2H8RA 3S16J 5EEAA 1HDPA 3W6VA 4MIMA 5FLVA 3SJMA 1CQTA 2K40A 1WCMJ 5EGOA 1ZQ3P 5FLMJ 2AHQA 3NARA 2DA6A 2H1KA 1HOMA 2HQ5A 3Q0VA 3A01B 2VKVA 1ZTRA 5BNGA 2L7FP 5IP6A 3G1MA 1ZKGA 4MLOA 4FTHA 1APLC 2JA6J 3JR9A 2GM4A 2VI6A 1K83J 1JGGA 1T33A 2EH3A 4BKXA 1GDTA 3S1QJ 2CUFA 4JYKA 1ZR2A 3WHBA 3BG3A 4A3MJ 2G0EA 4HNVA 4X1EA 3LSPA 3GTMJ 1Q1VA 1QPIA 2JWTA 3SFIA 4XICA 3TW6A 1AKHA 1MNMC 1K61A 5HODA 3JRDA 3GTLJ 4FCYA 4UUSB 2XB5A 3M4OJ 2FD5A 3BQZA 3S2DJ 5J3LA 3HOXJ 2XPWA 4A93J 4L5EA 3GTKJ 1JKQC 3Q0UA 3B6CA 4M6VA 1JTYA 3K7AJ 2MGQA 2K9NA 1ITYA 3A01A 2DA2A 3S14J 1TWHJ 2Y9YA 2HYJA 1R9TJ 1LFBA 1FTZA 1TWAJ 5JLXA 1JUSA 3ZQGA 4AUXA 1WPKA 4XIDA 5C3EJ 3LSRA 1VFCA 1JTXA 1A5JA 4IHYA 3M3YJ 2EQRA 2ZB9A 1H8AC 2JMWA 3RKQA 1ETXA 1B72B 2R5YB 1GV5A 1E3OC 1VF9A 4A3GJ 1Z0XA
chains in the Genus database with same CATH superfamily
2O8KA 2XDVA 2BVLA 2LREA 1FSEA 2OF7A 4V19K 1X4OA 5HLIA 4U7BA 1Z67A 2EPFA 2Q1ZB 2PBIA 2WY7Q 1TQPA 4YFKF 1R5HA 2QLZA 3FKJA 4C3IJ 4IQ4A 3K70C 1YLFA 2W1OA 5DUKA 3HDDA 3CUOA 2Z2SB 4UB8C 3O8GA 2WAQN 3WTXC 5F08A 3OYHA 3PUFA 4P1WA 2N8GA 3IH3A 4XRSG 1UMQA 4CGZA 4M3FA 1BA5A 3F8BA 3I54A 2HNHA 3FMQA 1FBQA 2BW3A 3CJQB 4ON0A 2I8DA 4OAYA 1VQ8I 2VUMJ 3DU6A 3DF8A 2V9PA 3JCUC 2F5DA 1ETWA 4A3EJ 1UJ8A 2R0QC 4A5MA 3HHGA 1U6GA 2K3PA 1WH7A 3DXJF 5J4YA 3CMMA 1D1BA 1W5CC 4OINF 3QWLA 3LQRA 4O3MA 5C44J 1WJ5A 2PQ8A 5CYVA 1SAXA 1VQ6I 3CCSI 2WAFA 4IL6C 4EJOA 1V5GA 2ID6A 2DA1A 2VONA 1J75A 1SFOJ 5LHGA 3TQNA 1BOBA 1MNEA 4WF2A 4OIOF 3LNQA 3E7LA 2NVXJ 1D0ZA 5DEQA 5ICFA 2JTVA 2RQQA 3CCYA 4WXDA 4G7ZF 1D5YA 2MG4A 2VBWA 1IJWC 1XCVA 1XDUA 2EZHA 3H0GJ 2JPBA 2M8GX 2WB1N 4I6ZA 2E1CA 1UAAA 3WE3A 4BEHA 3HOTA 4B3AA 2XGDA 4NB5A 3LL7A 4XN3A 2VE8A 4UHTA 3DBLB 2L2OA 4AVPA 3FXLA 5EG0B 1Z1DA 3FF5A 1OCRH 1T38A 2E35A 3QOPA 2R7WA 4XNFA 1KONA 1YRNA 4PDKA 2JUGA 5HDGA 1U9NA 4B4CA 5ICEA 4A3BJ 3N05A 2QCOA 2NAZA 4BHCA 4E7KA 1NK3P 4L0ZB 3W2AA 4RAYA 3CCJI 1Z6TA 1MMDA 4MFEA 3HPHA 2X1CA 4ESFA 2R7DA 3HHHA 2OA4A 3S3NA 2JA5J 4BDYA 2ISZA 2Y31A 4CYCB 1VQ7I 2VOPA 3C2HA 2QGUA 4QIWN 4Z6YA 2ZMEA 3F0CA 3HTUA 2JSCA 2QBYA 3MZHA 4PJMA 2CQQA 3BR0A 1QQIA 3V8LA 1VQ4I 3RKYA 4F92B 5K7ZA 2Z9OA 1MNDA 1B1BA 3R0AA 4LK1F 2L9RA 2JA7J 1R7JA 2QQAA 1ETKA 5JLWA 1B9MA 1TWGJ 4MNUA 2MH9A 5LGNA 2F6CA 3FK7A 1IN5A 2RGVA 2BE5F 5E3LA 3VSKA 2F4MB 3J81Z 1MBEA 3QPLA 2P8TA 3EDPA 1P2FA 1R4NB 3ZP5A 2YPRA 1ZELA 2LVSA 2AXLA 2VXDA 1ETVA 5DS9A 1NTCA 1FYKA 2EV5A 2EJRA 3I53A 5M3FJ 3HXLA 2ECBA 2Y30A 3OSFA 5EJCA 4OMYA 1L0OC 2OJED 1U8BA 5LHHA 1VI0A 3S1MJ 1G2HA 2OAZA 2FF4A 1Y8RB 2EFWA 4HF2A 2FXAA 4IOAF 4UV8A 2ZXJA 5IP9J 4RAGA 2EIJH 4IZZA 2RDPA 1X3WB 4MQVA 4W1UA 1OCZH 3GFMA 3K9TA 4C2MJ 1K79A 2OCEA 4HDVA 2KJCA 3JRAA 3KEQA 1S6LA 1W7PD 1B9NA 3RQ4A 1B72A 3HOVJ 2B7EA 1X2MA 4RLFA 3OYLA 3CUQA 3CP2A 3DQVC 4E70A 2K7LA 3M9AA 1G8XA 1MMNA 3FM5A 3P7NA 4RS8A 4LG3A 4H4KC 3OR1C 3I55I 5ICGA 3H3UA 2X1EA 2W48A 2GAUA 4UNOA 1FT9A 4DJAA 2V1NA 2DA4A 2QSHX 1Y0NA 1ON1A 3FHNA 4RA2A 3M1EA 2L4MA 5DCMA 2E60A 5D5WB 2O7OA 1DDNA 3OOUA 5EDNA 1HW1A 2ECCA 2RAEA 2RNJA 3G71I 3LA3A 3D5LA 1LE8A 2HYGD 4DYQA 4M3DA 3SZGA 1AOYA 2DOAA 1SD6A 3EETA 3TO6A 1FTTA 5J4VA 2ZJ2A 1YW8A 2DU9A 3F3XA 4HNTA 2HTSA 3ZR8X 3ZQCA 3HL2A 5FB2A 3KLOA 2PMZN 3BJ6A 3P5JA 1MBKA 3C2GA 2E1NA 2AQFA 4HX8A 4AVZA 3JAMK 2D5VA 3OSGA 3MZ8A 3LQQA 1OPCA 1Z77A 4YIFA 2QENA 2OC6A 5F04A 1WJDA 3L2VA 2NS7A 3IC7A 2Y0SN 4I0BA 4IOCF 3ERMA 1BM9A 5HLHA 3OY9A 1OISA 1HW2A 3O2PE 1POGA 4I99C 3CMAI 1W4MA 5FKMA 4XLFA 3TDZC 5M5WJ 1YFHA 3IH2A 3ONQA 1FSHA 2M2EA 2R5ZA 1LPQA 4UB6C 2COBA 2DMNA 2E2JJ 4M3EA 4L18B 2DFHA 3GO5A 3KCCA 1RRJA 2UV1A 4V2FA 3GZNB 1MDMB 3OYMA 1D8JA 2WV1A 1FWZA 3BTIA 4LFUA 1Z21A 1BOAA 4EEFG 2BHZA 3KYCB 2O3FA 5K5OA 3HGGA 1JGSA 2QSFX 3VPRA 2KIMA 2HDCA 4XLEA 1BI1A 1V54H 2F2EA 5DTDA 5CPRB 3DLAA 2AXTC 3UR3C 3FXOA 2BBYA 3AFHA 1WZ2A 2XAHA 1BJZA 2LMDA 3L00A 2FEZA 1IW7F 1HF0A 1D8KA 4CICA 4RLQA 4F91B 1MGTA 2DCEA 3K4NA 4I01A 3FXUA 2A6EF 1HKQA 3T8TA 2NXNB 2R3SA 1S7OA 1IN8A 4HV6A 2BW3B 3MZYA 1J5YA 2MSYA 4BAYA 5FGMA 4ZTJA 3CC7I 2LY1A 2KKOA 2NVQJ 4EMSA 1FP2A 1MKMA 4DGWB 2HR3A 3U2RA 3SFZA 1E0EA 1SVMA 2DA3A 4YELA 4CH7A 5E3OA 2E19A 4DOZA 4IKFA 4G94A 4LIUA 1N75A 3IH4A 2DYRH 3QP6A 2P81A 1MJBA 3F9KA 1GVDA 5E1WA 3OYFA 4CUGA 2DJNA 2BGCA 2HZDA 1E3PA 4JX4A 1XSDA 3L9FA 2GOMA 2PN6A 3CLQA 4XK4A 1HQCA 4LB5A 2CQ7A 4I76A 4A0XA 3HG9A 5GTHC 3FXKA 2QA4I 2DQRA 3HKZA 5AONA 1N25A 2K86A 5CJ9A 3BG7A 2O8XA 4KT5C 4LG0A 2HEOA 1ON2A 1SMYF 3H35A 4A3LJ 3DPUA 2JK3A 3NQOA 5EZHA 1V5FA 5HS9A 1LDDA 4BEHB 3FXJA 1BR1A 1JJ8C 5AIQA 3EQLF 3M07A 1L3LA 3WE2A 4XSZF 1VQOI 2VJIA 3VB2A 1F36A 2W7NA 2VPLA 1A04A 1G3SA 1TQIA 2IA2A 3WGHA 2XVCA 2P0WA 1YRNB 4BE0A 3PO3J 3CDLA 5JHUA 1IXRC 1JE8A 2EFPA 3ML6A 4XMYA 4KJZA 2IPQX 3CO6C 2DT5A 1FMWA 1ULYA 1M1EB 1DU0A 3U21A 5EZGA 3S16J 1HDPA 2ZKZA 4JQFA 1RUOA 3MWMA 4I09A 2FUG2 3SJMA 2QBYB 1CGPA 3SXYA 5EGOA 3V8JA 5CQGA 3VDXA 5E8IA 2KISA 2K9MA 2CG4A 4P9FA 1XMAA 1YJWI 1HOMA 1DGWY 3I3LA 2IXSA 1SFEA 2OBPA 1HXDA 2VKVA 1KYWA 3KZIC 3PNTA 3E6DA 4CCOA 1J09A 5BNGA 4PSWA 3LSKA 1USSA 2P4WA 5CKTA 3JR9A 3CCMI 4RGSA 1WJAA 4BGDA 5J40A 1W36D 1JGGA 1TNTA 2COMA 4GDFA 1DPRA 2EH3A 3CCUI 2CYYA 2Y0MA 3KEOA 5E20A 4BKXA 5H2FC 1GDTA 5IT9K 5E17F 2L9VA 3BCBA 4UV9A 2NRAC 1TTYA 3G73A 2G0EA 4X1EA 4E7SA 2JWTA 1LDJA 1TT0A 3ZMTA 3WTTC 1ZGJA 4U88A 1G3WA 3ABMH 4XICA 5HODA 3JRDA 1R58A 1X19A 3GTLJ 2KDOA 2XB5A 3M4OJ 2M4KA 3VYUB 2FD5A 2IGOA 2RN7A 1SVOA 2L9SA 2VQHA 3GTKJ 1JXSA 2HFHA 2MC4A 3SYTA 5HLGA 3CZ6A 3K7AJ 2MGQA 1TWHJ 1I6XA 1R9TJ 2PI0A 2IS2A 2L02A 3BWGA 1TWAJ 1MMAA 2WBMA 3L2CA 1USTA 4FX0A 1JUSA 4ZC3A 1S29A 1OKRA 2KMUA 2WV0A 2ZSIB 1GVJA 2LC2A 2QSGX 2R7FA 5D5XB 3ZQQA 1XMXA 1B72B 1NG7A 2DDBA 3CCEI 4UUVA 2EFOA 3HRTA 2ETHA 1LJ9A 1YIJI 1OR7A 1ZAOA 3SEZA 1VQPI 2GWRA 1U3EM 2M5WA 3ZMDA 4L5JA 1SANA 3J7YJ 4OAZA 4FE7A 1F43A 3DP7A 2KRFA 3WG9A 5LBQA 1W0UA 4PCQA 1HBXG 3TBIA 5L3DA 2QF7A 4Y33A 4G7OF 2CWEA 3BPXA 4KISA 3DKWA 2L9NA 5DCMB 1I1GA 4KT6A 3KP7A 4B47A 1IUYA 2D1VA 3KEYA 2XPVA 2W25A 1IN7A 3N4MA 5J1RA 1ZK8A 1LE8B 2ZFWA 4B44A 1QZZA 2XF5A 3BZ6A 3BR6A 3HZJA 1WJCA 4DQ2A 4PJNA 3HUGA 4N4NB 3BP8A 1R4MB 2LBFA 1KQ0A 1FNNA 1U5TA 5DYMA 5M5YJ 1ENHA 3MFKA 4LMYA 2ME6A 4ESJA 3S3OA 1SFUA 1I5ZA 2PG4A 3FISA 2XPUA 2R7SA 5JI6A 4Y52J 4D0PA 1OCPA 3ABLH 1YJ9I 1PP8F 1PUFB 3BCAA 5FD5A 1JHFA 2NS8A 4GYGA 1CF7A 2M1BA 5J8CA 2NYXA 1W5TA 2FBKA 3M8EA 1BW5A 4HA8A 3TO7A 1ZN2A 3RPQA 5L3GA 2O6GE 5C4XJ 4ESBA 3OYEA 1B6AA 2IS1A 4BS9A 1YE9A 3J7AO 2M7BA 2IGNA 2L54A 4IHTA 3MKYB 1ZGWA 1O57A 4R1HA 1XGOA 2D2WA 3NWSA 2K4JA 4XOTA 5HS7A 5LGTA 1HC8A 2NOGA 1I50J 4OIQF 3BTCA 4EM0B 1ZGAA 1VQ9I 3R0JA 1UG2A 5F1RA 5ICCA 1HSTA 2PEXA 5L3CA 1R5ID 4BJ6C 2GLOA 1FBSA 4DZPA 2CV0A 4XORA 1D1AA 1KYZA 2XSDC 1VQLI 2MFZA 1T6SA 3B6AA 4ABZA 2O9LA 2KQRA 1BC8C 2OQGA 3OYBA 2DDAA 2NOJB 4L9NA 3S2WA 3LFUA 2MD0A 3KP4A 5BOXA 4KDPA 2OPTA 2KJBA 1RIOH 3BTJA 2OCCH 3PFYA 1W0TA 2XAGA 3K2ZA 4PJLA 3H9QA 4XN0A 1S3JA 3W2WA 2JVGA 2Y75A 5JFRA 4MTEA 2WY8Q 1O7LA 4OU0A 4II2A 1Z9CA 3MAJA 1MH3A 2R7QA 1JJ6C 3TGNA 4AD9A 3H5RA 3JRCA 3BR5A 2A5WA 5K5RA 2E36A 2NNYA 3AG1H 3OYGA 4Q47A 1LFUP 3GTPJ 2FQ4A 5KHDA 2WADA 2VODA 2X48A 5M5XJ 4J19A 1J9IA 3K4CA 2MLGA 2ZJRF 4B09A 5FLXK 4BXUA 2HS5A 5J1UA 2R7OA 4A3IJ 1AU7A 2OV7A 4BL0B 2M30A 3N97A 4PSXA 2FRHA 5TISC 3F6OA 2GXGA 4BBRJ 2LNBA 2Z5UA 5E8GA 4H0EA 4E7JA 2HOEA 5KAIC 4LG0B 5IYCJ 4C9YA 4BE2A 5L3FA 2K9SA 2IGKA 1OJLA 2DODA 4P55A 5D6EA 2QZ8A 3BC8A 4ENJA 1ZG3A 4D7MA 4EATA 3I0TA 1MH4A 4A0ZA 4LIVA 2V7FA 2A69F 5DM7F 1OCCH 2KL4A 3E6CC 3VOEA 1UELB 4FISA 4C3HJ 1IC8A 2OU2A 1F5TA 3IAS2 1IDYA 3AAFA 2XRNA 4IPAA 5E3MA 2BV6A 2RV8A 5ILUA 1T2KA 4D9JA 3R4KA 3EPZA 4U0YA 1O3TA 3GYHX 5J6XA 4XM3A 3M1CA 2R5YA 3ZMZA 2CO5A 2IP2A 2HYFA 4CO8A 2B9SA 1R00A 3RYRA 4CDGA 3Q5FA 3PQJA 5CVVA 3HRUA 1EV7A 3OL4A 3S2HJ 3BJOA 3J7AY 4XLAA 2YU3A 4NC7A 3D1NI 3HIFA 4IHSA 2MA3A 3H3VK 5LFAA 3ZRGA 3RTRA 4EM2A 3HOYJ 1Y1VJ 3K2AA 1OYYA 4A6DA 5LD2C 1T98A 3JW4A 5CVIA 4Y13A 3IKTA 3K10A 4KA4A 2DMQA 3SZTA 4HSTA 2UWMA 1S5LC 3OYNA 4HEA2 1K4TA 5B1AH 4KUMA 1T56A 1WFXA 2V1DA 3ZMSA 1HKTA 3IWFA 1MBJA 2W4SA 3EYIA 1XGNA 1EA3A 2G9WA 3Q9VA 2D1HA 4J01A 2VBXA 5F0CA 1WJFA 2DYSH 3LAJA 3H9GA 2QM3A 2DMPA 4MGRA 2KRCA 1GLNA 3F23A 2MC3A 3RZOJ 3WTUC 2MYSA 4CA0A 1H9GA 1Y56A 4HPQA 3GTOJ 3I59B 3EUHC 4C2TA 2XKOA 4JOMA 4IHXA 3WU2C 2LH9A 3RQIA 3I4NJ 1U5TC 3DU5A 4Q48A 5DD8A 4DYRA 2BOLA 1T8IA 1OLTA 1SAUA 1YOVB 2CJJA 3DEWA 2PFBA 5F27A 3GWZA 3IUOA 4MHGA 1A6IA 1W7PB 2JJ7A 1KU9A 5D4SA 3F72A 1WI9A 5TGTA 5F0HA 4L9TA 4A69C 2YUSA 5B1BH 1IN4A 3ZOBA 2P5LC 4PGHA 1XS9A 2RNGA 5IYBJ 3LSMA 4ENKA 3TOAA 4I7HA 3K4LA 4WXCA 2M45A 2VC1A 3FDYA 1YHQI 4WWCA 2P7CB 4NC8A 1S8NA 5J8FA 3WU1B 2DQLA 4P9UA 2LLKA 2HTJA 3H1CA 1Y1WJ 3DEEA 4UUTA 2V26A 1SFXA 5JVGF 1RKTA 4FX4A 2FMYA 3FIWA 2R7XA 2LTPA 3ZN0A 4RDUA 5GAGJ 2H6CA 3FMRA 1X3UA 4ZDPA 4AWXB 2E1MC 1YW7A 2H6BA 3HM5A 3F8MA 3ECOA 2KZVA 1I1SA 5LHIA 4HF1A 1BI3A 2QUFA 1TNSA 2EZLA 3JTGA 1IRGA 4ZZDA 2GZWA 4WXHA 3MVPA 1S9HA 4A5NA 3JSOA 1IDZA 2EFNA 3VFZA 2OQRA 3B73A 4KFCA 2FBHA 4C3JJ 4MFDA 1FEXA 5DV5A 3HUGB 5LRSA 3RCOA 2KZGA 4RAFA 3HKZN 1LB2A 4B48A 1U5TB 2FBIA 1IN6A 1YO5C 2DOEA 5FD6A 2LF8A 4BE1A 4ZDOA 5D5UB 3HRSA 2LY2A 3HOZJ 1I39A 2QKMB 4I0AA 4Y4RA 3J7ZI 1CF7B 1XN7A 1WJBA 5ILSA 4HOBA 2OZUA 4PFOA 2HI3A 1EJ9A 5FKNA 3J80K 1WKMA 4N4OB 1WSUA 4DBQA 2Y69H 1LQ1A 4XLCA 4RM2A 3CDIA 1O4XA 5DCFA 2KP6A 3HJEA 4RGXA 1D5VA 4Z2YA 1R6RA 1V3FA 5HDKA 1FLIA 1P4AA 4HW0A 3RYPA 2XKPA 1HLVA 3JREA 4KICA 2RKHA 5LRRA 2CQXA 4UVBA 4BHPA 1S7EA 2A6HF 1UHSA 2CFOA 4LLGF 5IPAA 4C2UA 5F64A 3GZ6A 4QLCU 4A3CJ 1WHUA 3VYSB 3S17J 3DEUA 2DMUA 1I3QJ 1MBHA 2E1MB 4XOPA 1WQ2A 5HVQC 4NQWA 4S0HB 1XCBA 3REOA 2OUMA 1TWCJ 2LD5A 4M73A 3I71A 5D8KB 2NNNA 4KN7X 2DOFA 4UY8I 5ILVA 2IVMA 4AIDA 3AL0C 2DN0A 3BR3A 1X1AA 3MN2A 2OD5A 3QPSA 5K7FA 3NAUA 1G6NA 4QPOA 1SFKA 3BR1A 1WWXA 3BDDA 2H8RA 2VC0A 3U1KA 3CLOA 1ZARA 1P4XA 1XSXA 3L09A 4N9IA 1CQTA 2E7XA 4XLHA 1WCMJ 1XDSA 4PJJA 3LFKA 2Z33A 3NARA 4B43A 5K5QA 3Q0VA 1K7AA 3OIQA 3A01B 1NG6A 1W36C 2PMHA 3SQNA 4HQEA 1APLC 3HRMA 5E79C 3W2VA 1K4SA 2CUJA 1K83J 1QGPA 2UXXA 1SVLA 2FQ3A 2BHYA 1E3HA 3CJNA 4R8HA 2CUFA 4JYKA 4O6JA 1K78B 4C30A 2H8WA 3I4PA 3BG3A 1T0FA 3LA7A 3OL3A 2Q2EA 2ZFUA 2UUZA 4PFPA 3LSPA 1W1WE 4ZYDA 4QPQA 3S3MA 3BZKA 1GHCA 3SFIA 4A12A 2V4JC 1AKHA 1MNMC 1ONVA 2VJJA 3CD6I 3FXMA 1TW2A 4PZJA 2M87A 3K1NA 1QZYA 4CCJA 2IS6A 2GIZA 5J3LA 1QHGA 2QQBA 2VE9A 4L5EA 1R71A 2VL8A 3Q0UA 3BOQA 3BZCA 1TP4A 2HYJA 2KHMA 4EJUA 4Y15A 5DDGA 4HV5A 1RZ4A 1YW9A 1N78A 3DTEA 1VFCA 1WPKA 5C3EJ 1WJEA 3GMEA 3HOSA 3F8CA 3PSFA 1RNLA 1TLHB 3QP5A 4RM3A 4IHYA 3AL0B 2EQRA 2ZB9A 1H8AC 2B0LA 2FE3A 2VXZA 4FHTA 4ANJA 1LFPA 3FWEA 2DBBA 2MH2A 2ZMEC 2R5YB 5FRMA 2BXYA 2EV6A 3QOEA 4HG2A 3V8KA 3QU3A 3FX3A 2X9DA 4BHBA 2B63J 2CUEA 3F8FA 4HSRA 5GPCA 2CRGA 4S05A 2XGXA 3OMYA 1F4KA 1IXSB 1WI3A 5FO5A 1T39A 1B59A 5D8LB 2LRDA 3S1RJ 5HDNA 3A0HC 2EV0A 3AG4H 2DA5A 4WX9A 4F55A 1MZBA 1IRZA 2ID3A 2E1OA 4XR6A 1MSFC 1A36A 2XASA 4BQAA 4M9SA 2XB0X 3C1DA 3HOUJ 3MMYB 2J5OA 2XRLA 5GAHJ 2LSOA 4YG2F 5EEHA 4KIFA 3K69A 3PQKA 1BN5A 4G12A 3QYBA 4FETA 3GFLA 1REPC 3EUAA 2H94A 2EZKA 3O8HA 2CMPA 1F9NA 2EIMH 3HSRA 3IKVA 4B1RA 4F93B 2XF6A 3GTJJ 2X6YA 2HKXA 3GFIA 1MBGA 2A68F 3ZQHA 1X1CA 3QPTA 1BIAA 4ZH4F 2PJRA 3VWBA 1NH3A 4IVNA 3R60A 2MLKA 2A3SA 2IT0A 1WRJA 3JAMZ 2R4GA 1XB4A 4EQQA 4IO9F 1YYVA 4NDLA 2A05A 2P7VB 3CO7C 2CW7A 2HKOA 3QODA 2P5KA 3HPGA 4KNYA 4RBOA 5BMZA 3COAC 3VYRB 2K9QA 3H5NA 3JTHA 1IG7A 2VN2A 1G59A 3CUQC 2BEOA 2ZMEB 2IAIA 3BR2A 2E34A 1HA8A 3JRGA 4W97A 3M8JA 5EEGA 2E71A 1XD7A 3ASNH 2V9VA 4L9JA 2FJ1A 3KZYA 3L2UA 2QKLB 3LOCA 3LA2A 3HGYA 2L3DA 5EF6A 3PIOF 2DA7A 1U78A 4N9HA 2L0KA 1RESA 1U9OA 3E3VA 2K02A 2TDXA 4WK8F 1IGNA 3HSEA 3BPVA 1JKPC 4BUPA 3S15J 3NWTA 5CVUA 2R92J 4XKCA 2M9HA 5B3SH 1LVKA 3RDIA 4E7LA 3C2BA 3DTIA 4EJTA 4DIQA 1R22A 2GA2A 3SDBA 2L01A 2BZTA 2G7UA 4RGUA 1UCRA 4FE4A 1ERDA 5C4JJ 4GGGA 2Y9ZA 2DPUA 3I9V2 3E6BA 4GFBA 3BROA 2E5NA 4M3GA 1B8IA 4BDZA 1RKWA 3M8FA 3E97A 1MDMA 2MBFA 4LLNA 5FKLA 4OOIA 2IA1A 1FJLA 2E5ZA 4ZYEA 2R7ZJ 1U2WA 2FOKA 4D5CA 4G6QA 3CC2I 4KITB 3O6BB 3FZVA 1DP3A 1X1BA 3G1LA 1EH7A 4CCKA 2VPRA 3E1SA 3A02A 4OWRB 3T1BA 1QU3A 3KE2A 4A3FJ 5EG0A 3H5AA 1G4DA 2XAFA 1R23A 5IY5H 5BS6A 2XUBA 2CQNA 3GUDA 3GW2A 3HEFA 3QPHA 3WTVC 2GBYA 5DM6F 3NEUA 2F4IA 2R93J 3GZ5A 1V55H 1X2NA 1IRFA 3CUQB 2X6OA 4V2GA 1T0FC 1FP1D 3WTYC 3WODF 2KIUA 3OIOA 3CMEI 4ZTFA 1Y8QB 4BQNA 1TL8A 3DFGA 2K85A 4CYCA 4R79A 1XGSA 3I4MJ 3GEZA 1OFCX 5A2QK 4YFNF 3S1NJ 1QVUA 2X6WA 2LOOA 2VOOA 3F22A 4FASD 2VQLA 1AWCA 4RB1A 3W6JB 1HW5A 2VKHA 3PNVA 4DBRA 5F0FA 4PGGA 2Z99A 5ED4A 3WHCA 2EINH 1EH6A 1GT0C 4EGYA 2O0YA 3E5XA 3TEDA 4IX7A 4I98B 1X4PA 2KPMA 4A0YA 5IYDJ 3ELKA 3DWLE 4M72A 5AIPA 3RKXA 4ZYGA 2KRHA 4A6EA 2LYCA 3GTQJ 3ZQIA 2W00A 3PFIA 4G9YA 3IP4B 3W6KB 1LNWA 4L5IA 2LKPA 5TJJA 1TBXA 3DBRB 2YSRA 2Z3YA 4M9ZA 3KYDB 3HB9A 1P7JA 2CQKA 2HQAA 3CESA 4AU7A 2WWYA 2HWVA 2CUZA 4B3XA 4E6KG 1LUJB 3P9KA 2EZIA 3H3ZA 4BU2A 2EIKH 2VB6A 3RKWA 2R5ZB 4GRIA 2HDWA 1PYVA 4ENNA 2HXIA 4QSHA 2H09A 1YX5A 1X1DA 2Q2EB 4XKVA 4AIHA 2ADUA 4LOCA 4D5FA 3F6VA 5K1YA 2VT3A 4GYIA 2GXAA 2ZXIA 5FROA 4BACA 1N77A 2BY2A 4E7ZA 2EBIA 3KLNA 3QRFF 4IHVA 5IT9Z 4HYEA 2H27A 1FOXA 4G6TB 1P7IA 1D0YA 1I27A 1ZG5A 4XRFA 1Z7UA 2M8EA 2ZC2A 3MQ0A 3K0LA 3TW7A 3CDHA 3FXQA 1KGSA 2TCTA 3H36A 1LEAA 4EV0A 2LFBA 2W84A 2XSJC 3DCFA 1SEUA 5FJ8J 4LJZF 1J0RA 2YR2A 2O03A 4YIIA 1TC3C 3RI4A 3L2WA 2H1LA 1AHDP 3HYIA 3Q3SA 4EVIA 3E0JB 3ZMVA 4PK4A 1YITI 4F7ZA 4XLPF 5JVTA 4BJ5C 2VKEA 2FU4A 1QZEA 4S04A 1GUUA 2DAOA 2Z16A 1YJNI 4MEXF 2VBYA 5D4RA 2EA2A 1ZRDA 3KP3A 2RQPA 2ME0A 3QU6A 2OTLI 4KN4X 3H9JA 2MD5A 3WGGA 1WGXA 4M74A 3CCLI 2M0CA 1JT6A 3JSPA 2EWNA 1B4AA 5CLSA 2DTRA 2YS9A 5TRDA 3CQZJ 1R49A 4ZJZA 2LR8A 2HOSA 5FRNA 3GFJA 4IJAA 5FKKA 3B02A 4LGWA 2RREA 4HQMA 3PM1A 3WTSC 4DW6A 5CQEA 1HCRA 2ICWG 2DO7A 2DI3A 2VQGA 1FZPB 2M0MA 1QA6A 2F48A 4M3BA 3A1YA 4DZJA 2E2IJ 2M4GA 5A2QZ 3UKGA 2BVMA 3ZN1A 3LMMA 3NRVA 5FKOA 1BIBA 1DP7P 2F5EA 5JHFA 3V7RA 3BY6A 2D45A 2CU7A 4XRSA 1MD0A 4J00A 2ZBKA 2CW0F 2YU9J 3G3ZA 4BXFA 4IRGA 3ISPA 2XROA 2JQ7A 1OYIA 1YIOA 3HOWJ 3S8PA 3J81K 1XPXA 2M34A 3GLXA 2GXBA 2PJRB 2HPMA 4TV7A 2NVUB 2VIXA 2E7WA 1JUMA 1BR2A 4U0WA 1IAWA 1IUFA 3QYEA 4LD5A 3Q0WA 4AIKA 2UZKA 5KAFC 2IS4A 1ETQA 1QRYA 2BXZA 2STWA 1KU3A 2HDDA 1D0XA 2VASA 1FIPA 2NS0A 1NHAA 3IHUA 3OS1A 1O7FA 3G4SI 3V7CA 2FMLA 4KYWA 1DPUA 3P9IA 3A03A 2HXOA 1OR7C 1FBUA 2LDUA 4HX4A 5EGOB 1ZHFA 1MJAA 1TWFJ 1D1CA 4EJVA 1H9TA 2I10A 4Y7NJ 4XSXF 4YIRX 2CV1A 1R1UA 1J59A 4NBQA 3U1DA 4G7HF 3MCZA 3IWZA 1LDKB 5GP9A 3M7GA 1I3AA 1OCOH 1IV6A 1MMGA 3LSGA 1VQNI 5J1YA 3E6MA 3JRHA 2L7ZA 5ERIA 3L2QA 2XC7A 4A3KJ 2HZTA 3GLLA 3BJAA 3BTLA 3K4MA 2RVCA 3WG7H 1U8RA 1JKRC 2ESNA 5HNHA 2KIFA 3MKLA 4HLXA 4PJ0C 3DV8A 3A0BC 4HAMA 3JRIA 3JRFA 2F5VA 2K3FA 1BR4A 1Z05A 2Y2ZA 3ULQB 1Y6IA 4Q4ZF 2AO9A 1B8IB 1WVRA 1X1PA 5EEAA 4E7IA 3PNYA 3W6VA 1KQ8A 4I2OA 3DBHB 3ZGKA 4MIMA 1T08B 2CGPA 4IRHA 2K40A 1ZQ3P 5FLMJ 2DA6A 2G7HA 4ZYHA 3SEQA 2CV2A 1ACIA 1JHHA 2Y48A 1Q1HA 3QAHA 2ESHA 2L7FP 4CXFA 1K6YA 2V1UA 4RGRA 3G1MA 4ENMA 4MLOA 3HSFA 2BY1A 2JA6J 2VLAA 3ABUA 3ESWB 2VI6A 2W85A 2ZNZA 2DJIA 3RIRA 1VZ0A 2DFEA 4L0YB 3ZMUA 1SD5A 1ZR2A 2EK5A 4ZYAA 3HC7A 4IQJA 2ACJA 4HNVA 3O3KA 1QPIA 1BC7C 1FPQA 1Z7LA 1E17A 1KU7A 5FLXZ 1XGMA 2FOWA 4XONA 3WTZA 5IT3A 3GVAA 4FCYA 1FYLA 2JRMA 3MKWB 3OS0A 2Z1DA 2O5RA 1TT5B 3BQZA 2A6TA 1C0WA 5LEKA 3S2DJ 3HOXJ 4U0VA 1JKQC 1DQUA 1R36A 1JTYA 3OIPA 2Y9YA 1QHHD 4BYYA 2VT2A 1LFBA 3TOBA 1FTZA 1BBYA 3GXOA 4XIDA 3LSRA 3HTSB 1P6RA 4HZFA 1H0MA 2GOXB 2UXNA 2VJ5A 2LBFB 2X51A 2JMWA 4DNCA 1ETXA 3RKQA 3UNGC 2IRFG 4BQQA 1ZH5A 1IXCA 1E3OC 1VF9A 4B8XA 1BJAA 2VKDA 1Z0XA 3T0YA 1IZ1A 2HOAA 4ZDLA 3OS2A 2DT7B 3ECHA 4F3QA 5LLQA 4OIPF 1QO0D 2XF7A 2DFIA 3RPUD 3FBNB 4XRMA 2V6CA 3IAM2 4MTDA 1MBFA 2JZYA 3ZQLA 1J7KA 2FA5A 5LEJA 5IOYA 5KNLA 2DTZA 3LSJA 3P9CA 4MEYF 3BG6A 1LEBA 3ZXSA 3IRQA 4M71A 1IO2A 2IBDA 3EUKL 3VEPA 3VYTB 4ETSA 4YEJA 2DFFA 1VQKI 3EYYA 1YS7A 3RSNA 3LSHA 4CHUA 4MQ9F 2ZCWA 4JX5A 3K70D 1STZA 1VTNC 1MMSA 3ABTA 2HPIA 4FQGA 2LP0A 5IP7J 1H88C 3PIPF 1G3YA 4CSWA 5HLTA 5BPIA 2L4AA 4HNUA 4JBAA 1GXQA 4BQOA 3V4GA 3TDUC 1X58A 3K1MA 4CCNA 5HS8A 4Q5SF 2OZ6A 3TP0A 2DPDA 2ISYA 3OYKA 4NHJA 5CVJA 4IHWA 2JA8J 4JP0A 3K4JA 3I56I 3A2KA 1HKSA 3K6GA 4A3JJ 2WAQA 3IV5A 2YX7A 1IV8A 2LY9A 3K4BA 2OTJI 2EILH 5H6RA 1FYMA 1BW6A 4BXXJ 2A5YB 1T95A 1S7AA 2FNAA 2DK8A 4NNJA 2XGEA 1P9QC 3ABKH 2HGCA 4PUSA 2VBZA 3C18A 5GPAA 5B66C 1XMKA 3DPTA 4CYDA 4UVAA 4EJWA 5K7HA 3OOPA 3D5SC 4A2UA 5J47A 5H6QA 2A61A 3AG2H 5LGUA 1ETYA 2ZXHA 1J2XA 2BY0A 2JN6A 1PUFA 5GADJ 1ZRFA 3WGIA 4LB6B 1ZRCA 1GV2A 4XL9A 3KP2A 1Z3YA 3AKZA 5GAEJ 2EFQA 1R5GA 3BQYA 3VODA 5E3NA 1RR8C 3GCMA 4RMNA 1ZR4A 3MD2A 1FX7A 2ZJQF 1YX3A 2JUCA 3E5UA 1O3QA 1RUNA 3KETA 4ASNA 2WB1A 1EH8A 2IA0A 1ETOA 3DTKA 1KZHA 3JRBA 4RAZA 5GTIC 4AC0A 2LKXA 2CW8A 3PSIA 2JT1A 3VSLA 4YFXF 5E1XA 2CS3A 2DK5A 1FIAA 1TW3A 4EGZA 2QWWA 2QYOA 2M3AA 1I6HJ 4QTRA 2XIGA 3FM3A 3QYFA 3TP3A 1FOWA 1MIJA 4EM1A 4XLNF 3S32A 1PP7U 1FOKA 1TZLA 1P92A 2V1XA 2IEKA 1JUPA 3FXRA 1SD4A 3WU0A 2ZO4A 5BPDA 1W5SA 2JSPA 1G3TA 2QVOA 3D0SA 5D6FA 3J80Z 4UUSA 3RZDJ 4MO7A 5BQTA 2F5FA 2PJPA 2L7MP 9ANTA 4II3A 3IRRA 2ZXWH 3KFWX 2GA1A 3D5RC 4LITA 1Y39A 1XG1A 1OCTC 3GX4X 1YQAA 2Q0OA 3W3CA 3PO2J 2ELJA 3KIOA 1V5EA 4U7DA 2IGMA 2X85A 3E5QA 4NC6A 1X3ZB 1XSVA 2WC2A 2XGCA 4LK0F 2Q8KA 3L2RA 1H89C 3R61A 3CF5F 2MABA 3L1PA 2X1DA 4RB3C 2E2HJ 5FFXA 3K4KA 1BI2A 4HF0A 2DXIA 1YS6A 4BY1J 1NK2P 5FFZA 1QBJA 4KMFA 2NVYJ 3I5UA 4CCLA 3SZPA 1HSJA 5IOZA 2KFDA 2BY3A 2AS5F 3CCRI 1RETA 1V4RA 4GO1A 3LSTA 2KDZA 3CCVI 1RC9A 5H20A 4JK1X 3MKZA 5KK1A 4Y17A 4BH9A 4D7NA 1YTYA 4HDUA 2HOTA 4L9VA 2QQ8A 3C3WA 2P6SA 2XAJA 1HDDC 3ZPLA 4M9XA 2W82A 1FMVA 1YI2I 1MSEC 4CZZA 2P6TA 1UHMA 2V6EA 4AM3A 2W24A 5CVRA 2DMTA 1UG0A 2VJ4A 3G1OA 2XAQA 2XV4S 1YG2A 2VQCA 4U87A 1F1ZA 2KIQA 3CTAA 5HNFA 2PLYA 4AYBN 4KMUX 4CZCA 3DPLC 3OWTA 1ZLJA 2PMUA 4AIJA 4G8XA 1FC3A 2LG4A 3ZQFA 1JKOC 4M6XA 4UXNA 4IRIA 6PAXA 4K2EA 4BJTA 2O61A 5D5VB 1XC5A 4IF4A 1OQYA 4BY7J 1R1VA 2FNPA 5B5EC 2LKSA 4P5OA 4D1QA 2PMZA 4JX6A 2X0LA 3I64A 1PUEE 1RPWA 5F1JA 3RPUA 3GTGJ 2K4BA 1LVAA 2I5UA 5KCMA 2F4OB 2L5QA 3G2BA 3I59A 3TKYA 2KLOA 2Y0SA 4E7HA 4XBFA 3ASOH 4IXAA 2JRTA 1AA7A 2DLLA 3FK6A 2STTA 2KT0A 4N0BA 2ZSHB 2JPCA 2R7RA 2LK2A 5E1ZB 1Z6RA 4IEJA 1VQMI 2NVTJ 3DLLF 2TRTA 5DD4A 4OIRF 3BLYA 4FT8A 4XKBA 1ORKA 1W7PA 1KQ9A 1JT0A 4WCGA 5M3MJ 2QQ9A 4X6AJ 3CMYA 4G6DA 1PVEA 2HU9A 1KA8A 4BNCA 3A4CA 4ITVA 2R7TA 1VNDA 2ELKA 3DKXA 2K9LA 3CF2A 4CCMA 4HX7A 2X6XA 2BYVE 2ZJPF 4A3DJ 1FOYA 3BG9A 3FKIJ 2DT6A 3BG5A 3R6SA 1MW7A 2L7KA 1RR7A 1PJRA 4RB0A 1ZREA 1ODDA 4NQWB 4Y3OA 5F6FA 3I58A 1OYWA 4O5VA 1P4WA 2K27A 1OMIA 4XKWA 3TMOA 1DUXC 4F52A 4M6YA 3FHZA 2F5CA 1XTAA 1LKXA 1RI7A 3H92A 3FBIB 2JA2A 3AG3H 2V9KA 2WA0A 3OYCA 2W57A 1VQ5I 4RB2C 3SDGA 3ZQ7A 2CSOA 3PUBA 1SMTA 3RJPA 1UB9A 1DU6A 2R7UA 1EF4A 3KX2A 1QPMA 3U9GA 3GBGA 3QQAA 3CP8A 4KIBA 1QVTA 1EKEA 3G6EI 3BT9A 3ROUA 3OYAA 3C7JA 1XX5A 2P5VA 1QNTA 3EUHA 3IL2A 4BBSJ 3GF2A 3Q9SA 4DYCA 2C6YA 1O3RA 3KYLA 1TQMA 3S93A 2A07F 1WH5A 3HBLA 4GCVA 3LSIA 1A35A 4QWQA 3DKYA 4LLLA 5JR3A 2K5CA 4KIGA 1O3SA 3OR2C 2QEXI 2HQNA 5EYRA 3TO9A 4HBLA 3PL8A 2AQEA 3LWFA 3CC4I 1BL0A 3OV8A 1GXPA 2MW8A 2ZNYA 2FX0A 3OYIA 2JVHA 3TL4X 2RC4A 1KU2A 4NUBA 1UZCA 1AKHB 2ELHA 2GQQA 3F21A 1ZLKA 2IJLA 2V79A 2GIVA 3OYDA 5FLVA 4P96A 5E18F 3T8RA 1ZG1A 4HRIA 3KPHA 3PJRA 2AHQA 2EA4A 2H1KA 2HQRA 2IW5A 2HQ5A 4YRVA 1ZTRA 4ZZLA 1K6OA 5IP6A 1ZKGA 4FTHA 1E2XA 2XHKA 3H0DA 3CJTB 3K1PA 3KP6A 1MJ9A 2GM4A 1T33A 4E4HA 1IRXA 2XAUA 3S1QJ 1BI0A 3WHBA 3OYJA 4AYBA 1Z91A 4I02A 3SHFA 3F8NA 3KZZA 4XQFA 3KP5A 4A3MJ 3GTMJ 1ZYRF 3CCQI 2PX9A 1Q1VA 1U0JA 2HVRA 2CH0A 2CFXA 1Z3XA 2LF7A 1D3YA 2J5PA 4X0GA 3TW6A 4GXOA 1K61A 3ERED 2WTEA 3FMSA 3T5XA 2WAEA 1FY7A 4UUSB 2R7VA 4UVCA 1IF1A 1R1TA 3L7WA 5L3BA 2XPWA 1Y0UA 3ZCOA 4A93J 1DGRM 3V42A 4HLYA 4OMZA 5HOOA 3LAPA 3B6CA 4M6VA 5KVRA 1JI8A 1ITYA 2K9NA 5DUIA 3A01A 2DA2A 3S14J 1PDNC 2HVQA 2EB7A 1SD7A 1A6QA 5JLXA 3CJRB 5L3EA 2HVSA 3ZQGA 2YX4A 4AUXA 2DW4A 2M7AA 2X4HA 1JTXA 2FSWA 1A31A 1SC7A 1A5JA 3M3YJ 3X2QH 1K78A 3WTWC 3MEXA 1UHWA 1S72I 1GV5A 4A3GJ 3V7SA 1UFMA
chains in the Genus database with same CATH topology
2HOAA 2X9DA 2O8KA 2B63J 2CUEA 5GPCA 2CRGA 1SANA 1WI3A 4XRMA 4FE7A 2OF7A 1MBFA 1F43A 3ZQLA 1W0UA 3S1RJ 5IOYA 2DA5A 2DTZA 3LSJA 2QF7A 1IRZA 4C3IJ 2IBDA 2ID3A 2E1OA 1MSFC 3HDDA 2XPVA 3O8GA 2WAQN 5F08A 2XB0X 5J1RA 1ZK8A 3HOUJ 2XRLA 2N8GA 3IH3A 1LE8B 4JX5A 4XRSG 3BR6A 1UMQA 4M3FA 4G12A 1BA5A 3O8HA 2EZKA 2LP0A 5M5YJ 5IP7J 1ENHA 1H88C 2VUMJ 4B1RA 2ME6A 1ETWA 3FISA 2XPUA 4A3EJ 2R0QC 3GTJJ 4Y52J 1OCPA 1MBGA 3ZQHA 1PUFB 1WH7A 1X58A 2NS8A 3TP0A 4IHWA 1BW5A 5C44J 2JA8J 4JP0A 5C4XJ 4A3JJ 3IV5A 4NDLA 2ID6A 2DA1A 2LY9A 1ZGWA 1SFOJ 4RBOA 1BW6A 4BXXJ 3LNQA 2K9QA 3E7LA 2NVXJ 1IG7A 2NOGA 1I50J 2XGEA 3CCYA 3BTCA 2IAIA 3BR2A 1D5YA 2MG4A 3JRGA 4W97A 1UG2A 1IJWC 2EZHA 3H0GJ 2M8GX 5GPAA 2GLOA 2FJ1A 2WB1N 4I6ZA 4DZPA 3LOCA 4B3AA 5K7HA 2XGDA 3HGYA 5EF6A 2DA7A 1U78A 2XSDC 2L0KA 1ETYA 1RESA 1U9OA 5EG0B 3B6AA 1IGNA 2JN6A 1PUFA 4ABZA 2O9LA 1JKPC 1GV2A 3S15J 1YRNA 2R92J 2OPTA 2M9HA 3BQYA 1U9NA 5E3NA 3C2BA 3BTJA 4B4CA 1ZR4A 4A3BJ 2QCOA 1W0TA 1NK3P 4FE4A 5C4JJ 2Y9ZA 4MFEA 4GFBA 4M3GA 1B8IA 2JA5J 2Y31A 4CYCB 1MH3A 1RKWA 1ETOA 1JJ6C 5FKLA 4QIWN 3F0CA 3JRCA 1FJLA 3BR5A 3JRBA 2R7ZJ 2CQQA 3BR0A 4D5CA 4AC0A 2LKXA 5K7ZA 3G1LA 2VPRA 1LFUP 3GTPJ 2FQ4A 3A02A 2L9RA 2JA7J 1ETKA 2X48A 5M5XJ 5JLWA 4J19A 1TWGJ 4A3FJ 5EG0A 1FIAA 3FK7A 1I6HJ 5E3LA 4QTRA 5J1UA 3HEFA 1MBEA 3QPLA 3TP3A 4A3IJ 1AU7A 2GBYA 2R93J 1X2NA 2IEKA 1JUPA 2X6OA 4V2GA 3OIOA 4BBRJ 2LVSA 5DS9A 1ETVA 5IYCJ 1NTCA 2K9SA 1OJLA 4CYCA 4UUSA 3RZDJ 5M3FJ 3I4MJ 4MO7A 1OFCX 2ECBA 4D7MA 2L7MP 3S1NJ 1QVUA 1MH4A 2Y30A 3OSFA 9ANTA 1U8BA 1XG1A 1OCTC 1VI0A 3S1MJ 1G2HA 4FISA 4C3HJ 1IC8A 3PO2J 5F0FA 5IP9J 3WHCA 1IDYA 1GT0C 4W1UA 4C2MJ 5E3MA 3TEDA 2XGCA 1H89C 5IYDJ 3JRAA 3L1PA 2E2HJ 1B72A 2R5YA 3HOVJ 1X2MA 3GTQJ 3ZQIA 4BY1J 1NK2P 3S2HJ 3D1NI 2NVYJ 3H3VK 2W48A 3HOYJ 1Y1VJ 3K2AA 5IOZA 2DA4A 2DMQA 1RETA 2KDZA 3HB9A 1P7JA 1T56A 2O7OA 3OOUA 1MBJA 2EZIA 5EDNA 4D7NA 2ECCA 2RAEA 2HOTA 1LE8A 2R5ZB 5F0CA 4DYQA 4M3DA 2HXIA 1HDDC 4QSHA 2DMPA 1MSEC 1FTTA 3RZOJ 2DMTA 3ZQCA 3GTOJ 4LOCA 4D5FA 2PMZN 1MBKA 3G1OA 4IHXA 2D5VA 3OSGA 3RQIA 3I4NJ 2EBIA 4DYRA 4IHVA 4AYBN 1Z77A 1P7IA 2CJJA 5F04A 3DEWA 2NS7A 2Y0SN 5F27A 3TW7A 3ZQFA 1JKOC 2TCTA 2LFBA 1POGA 1A6IA 3DCFA 5FJ8J 2JJ7A 1XC5A 5FKMA 5F0HA 1TC3C 5M5WJ 4BY7J 4A69C 2YUSA 3IH2A 3ZOBA 3Q3SA 1AHDP 1XS9A 2M2EA 5IYBJ 2R5ZA 4JX6A 2COBA 2DMNA 2E2JJ 1RPWA 4M3EA 5F1JA 3GTGJ 2VKEA 1GUUA 4V2FA 2LLKA 1Y1WJ 2WV1A 2ME0A 3BTIA 4EEFG 4UUTA 1WGXA 1RKTA 2M0CA 1JT6A 3FK6A 3FIWA 3HGGA 2LTPA 3VPRA 4RDUA 2KT0A 5DTDA 2YS9A 3CQZJ 2LK2A 2LR8A 2HOSA 4IEJA 5FKKA 3HM5A 2NVTJ 2TRTA 3PM1A 4DW6A 1BJZA 1HCRA 2EZLA 1ORKA 1HF0A 3MVPA 1JT0A 4M3BA 1IDZA 4DZJA 2E2IJ 5M3MJ 3UKGA 4X6AJ 3CMYA 5FKOA 4C3JJ 4MFDA 1FEXA 1VNDA 2ELKA 3HKZN 2MSYA 2CU7A 4XRSA 2YU9J 4A3DJ 3BG9A 3FKIJ 3BG5A 2NVQJ 3HOWJ 1RR7A 3HOZJ 2M34A 2DA3A 5E3OA 2E19A 1JUMA 1IUFA 3IH4A 2P81A 1GVDA 3Q0WA 2HI3A 2DJNA 5FKNA 4JX4A 4XK4A 1ETQA 3SDGA 1QRYA 4I76A 2HDDA 1DU6A 1FIPA 1O4XA 1EF4A 4A3LJ 3A03A 1HLVA 3GBGA 2HXOA 3QQAA 3JREA 1QVTA 2JK3A 2CQXA 3BT9A 5EZHA 5EGOB 1S7EA 1TWFJ 4BBSJ 1UHSA 2I10A 4Y7NJ 5IPAA 5GP9A 1IV6A 1JJ8C 4DYCA 4A3CJ 3LSGA 5J1YA 3S17J 3JRHA 2DMUA 2L7ZA 1I3QJ 1MBHA 1F36A 4A3KJ 1WH5A 3HBLA 4S0HB 1YRNB 3BTLA 1JKRC 3PO3J 3CDLA 1TWCJ 2LD5A 3MKLA 5EYRA 3JRIA 3JRFA 1BL0A 2DN0A 3BR3A 3MN2A 3QPSA 2MW8A 5K7FA 2FX0A 2Y2ZA 3NAUA 1AKHB 1DU0A 3BR1A 2AO9A 1B8IB 5EZGA 2H8RA 3S16J 5EEAA 1HDPA 3W6VA 4MIMA 5FLVA 3SJMA 1CQTA 2K40A 1WCMJ 5EGOA 1ZQ3P 5FLMJ 2AHQA 3NARA 2DA6A 2H1KA 1HOMA 2HQ5A 3Q0VA 3A01B 2VKVA 1ZTRA 5BNGA 2L7FP 5IP6A 3G1MA 1ZKGA 4MLOA 4FTHA 1APLC 2JA6J 3JR9A 2GM4A 2VI6A 1K83J 1JGGA 1T33A 2EH3A 4BKXA 1GDTA 3S1QJ 2CUFA 4JYKA 1ZR2A 3WHBA 3BG3A 4A3MJ 2G0EA 4HNVA 4X1EA 3LSPA 3GTMJ 1Q1VA 1QPIA 2JWTA 3SFIA 4XICA 3TW6A 1AKHA 1MNMC 1K61A 5HODA 3JRDA 3GTLJ 4FCYA 4UUSB 2XB5A 3M4OJ 2FD5A 3BQZA 3S2DJ 5J3LA 3HOXJ 2XPWA 4A93J 4L5EA 3GTKJ 1JKQC 3Q0UA 3B6CA 4M6VA 1JTYA 3K7AJ 2MGQA 2K9NA 1ITYA 3A01A 2DA2A 3S14J 1TWHJ 2Y9YA 2HYJA 1R9TJ 1LFBA 1FTZA 1TWAJ 5JLXA 1JUSA 3ZQGA 4AUXA 1WPKA 4XIDA 5C3EJ 3LSRA 1VFCA 1JTXA 1A5JA 4IHYA 3M3YJ 2EQRA 2ZB9A 1H8AC 2JMWA 3RKQA 1ETXA 1B72B 2R5YB 1GV5A 1E3OC 1VF9A 4A3GJ 1Z0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOA A;  2X9D A;  2O8K A;  2B63 J;  2CUE A;  5GPC A;  2CRG A;  1SAN A;  1WI3 A;  4XRM A;  4FE7 A;  2OF7 A;  1MBF A;  1F43 A;  3ZQL A;  1W0U A;  3S1R J;  5IOY A;  2DA5 A;  2DTZ A;  3LSJ A;  2QF7 A;  1IRZ A;  4C3I J;  2IBD A;  2ID3 A;  2E1O A;  1MSF C;  3HDD A;  2XPV A;  3O8G A;  2WAQ N;  5F08 A;  2XB0 X;  5J1R A;  1ZK8 A;  3HOU J;  2XRL A;  2N8G A;  3IH3 A;  1LE8 B;  4JX5 A;  4XRS G;  3BR6 A;  1UMQ A;  4M3F A;  4G12 A;  1BA5 A;  3O8H A;  2EZK A;  2LP0 A;  5M5Y J;  5IP7 J;  1ENH A;  1H88 C;  2VUM J;  4B1R A;  2ME6 A;  1ETW A;  3FIS A;  2XPU A;  4A3E J;  2R0Q C;  3GTJ J;  4Y52 J;  1OCP A;  1MBG A;  3ZQH A;  1PUF B;  1WH7 A;  1X58 A;  2NS8 A;  3TP0 A;  4IHW A;  1BW5 A;  5C44 J;  2JA8 J;  4JP0 A;  5C4X J;  4A3J J;  3IV5 A;  4NDL A;  2ID6 A;  2DA1 A;  2LY9 A;  1ZGW A;  1SFO J;  4RBO A;  1BW6 A;  4BXX J;  3LNQ A;  2K9Q A;  3E7L A;  2NVX J;  1IG7 A;  2NOG A;  1I50 J;  2XGE A;  3CCY A;  3BTC A;  2IAI A;  3BR2 A;  1D5Y A;  2MG4 A;  3JRG A;  4W97 A;  1UG2 A;  1IJW C;  2EZH A;  3H0G J;  2M8G X;  5GPA A;  2GLO A;  2FJ1 A;  2WB1 N;  4I6Z A;  4DZP A;  3LOC A;  4B3A A;  5K7H A;  2XGD A;  3HGY A;  5EF6 A;  2DA7 A;  1U78 A;  2XSD C;  2L0K A;  1ETY A;  1RES A;  1U9O A;  5EG0 B;  3B6A A;  1IGN A;  2JN6 A;  1PUF A;  4ABZ A;  2O9L A;  1JKP C;  1GV2 A;  3S15 J;  1YRN A;  2R92 J;  2OPT A;  2M9H A;  3BQY A;  1U9N A;  5E3N A;  3C2B A;  3BTJ A;  4B4C A;  1ZR4 A;  4A3B J;  2QCO A;  1W0T A;  1NK3 P;  4FE4 A;  5C4J J;  2Y9Z A;  4MFE A;  4GFB A;  4M3G A;  1B8I A;  2JA5 J;  2Y31 A;  4CYC B;  1MH3 A;  1RKW A;  1ETO A;  1JJ6 C;  5FKL A;  4QIW N;  3F0C A;  3JRC A;  1FJL A;  3BR5 A;  3JRB A;  2R7Z J;  2CQQ A;  3BR0 A;  4D5C A;  4AC0 A;  2LKX A;  5K7Z A;  3G1L A;  2VPR A;  1LFU P;  3GTP J;  2FQ4 A;  3A02 A;  2L9R A;  2JA7 J;  1ETK A;  2X48 A;  5M5X J;  5JLW A;  4J19 A;  1TWG J;  4A3F J;  5EG0 A;  1FIA A;  3FK7 A;  1I6H J;  5E3L A;  4QTR A;  5J1U A;  3HEF A;  1MBE A;  3QPL A;  3TP3 A;  4A3I J;  1AU7 A;  2GBY A;  2R93 J;  1X2N A;  2IEK A;  1JUP A;  2X6O A;  4V2G A;  3OIO A;  4BBR J;  2LVS A;  5DS9 A;  1ETV A;  5IYC J;  1NTC A;  2K9S A;  1OJL A;  4CYC A;  4UUS A;  3RZD J;  5M3F J;  3I4M J;  4MO7 A;  1OFC X;  2ECB A;  4D7M A;  2L7M P;  3S1N J;  1QVU A;  1MH4 A;  2Y30 A;  3OSF A;  9ANT A;  1U8B A;  1XG1 A;  1OCT C;  1VI0 A;  3S1M J;  1G2H A;  4FIS A;  4C3H J;  1IC8 A;  3PO2 J;  5F0F A;  5IP9 J;  3WHC A;  1IDY A;  1GT0 C;  4W1U A;  4C2M J;  5E3M A;  3TED A;  2XGC A;  1H89 C;  5IYD J;  3JRA A;  3L1P A;  2E2H J;  1B72 A;  2R5Y A;  3HOV J;  1X2M A;  3GTQ J;  3ZQI A;  4BY1 J;  1NK2 P;  3S2H J;  3D1N I;  2NVY J;  3H3V K;  2W48 A;  3HOY J;  1Y1V J;  3K2A A;  5IOZ A;  2DA4 A;  2DMQ A;  1RET A;  2KDZ A;  3HB9 A;  1P7J A;  1T56 A;  2O7O A;  3OOU A;  1MBJ A;  2EZI A;  5EDN A;  4D7N A;  2ECC A;  2RAE A;  2HOT A;  1LE8 A;  2R5Z B;  5F0C A;  4DYQ A;  4M3D A;  2HXI A;  1HDD C;  4QSH A;  2DMP A;  1MSE C;  1FTT A;  3RZO J;  2DMT A;  3ZQC A;  3GTO J;  4LOC A;  4D5F A;  2PMZ N;  1MBK A;  3G1O A;  4IHX A;  2D5V A;  3OSG A;  3RQI A;  3I4N J;  2EBI A;  4DYR A;  4IHV A;  4AYB N;  1Z77 A;  1P7I A;  2CJJ A;  5F04 A;  3DEW A;  2NS7 A;  2Y0S N;  5F27 A;  3TW7 A;  3ZQF A;  1JKO C;  2TCT A;  2LFB A;  1POG A;  1A6I A;  3DCF A;  5FJ8 J;  2JJ7 A;  1XC5 A;  5FKM A;  5F0H A;  1TC3 C;  5M5W J;  4BY7 J;  4A69 C;  2YUS A;  3IH2 A;  3ZOB A;  3Q3S A;  1AHD P;  1XS9 A;  2M2E A;  5IYB J;  2R5Z A;  4JX6 A;  2COB A;  2DMN A;  2E2J J;  1RPW A;  4M3E A;  5F1J A;  3GTG J;  2VKE A;  1GUU A;  4V2F A;  2LLK A;  1Y1W J;  2WV1 A;  2ME0 A;  3BTI A;  4EEF G;  4UUT A;  1WGX A;  1RKT A;  2M0C A;  1JT6 A;  3FK6 A;  3FIW A;  3HGG A;  2LTP A;  3VPR A;  4RDU A;  2KT0 A;  5DTD A;  2YS9 A;  3CQZ J;  2LK2 A;  2LR8 A;  2HOS A;  4IEJ A;  5FKK A;  3HM5 A;  2NVT J;  2TRT A;  3PM1 A;  4DW6 A;  1BJZ A;  1HCR A;  2EZL A;  1ORK A;  1HF0 A;  3MVP A;  1JT0 A;  4M3B A;  1IDZ A;  4DZJ A;  2E2I J;  5M3M J;  3UKG A;  4X6A J;  3CMY A;  5FKO A;  4C3J J;  4MFD A;  1FEX A;  1VND A;  2ELK A;  3HKZ N;  2MSY A;  2CU7 A;  4XRS A;  2YU9 J;  4A3D J;  3BG9 A;  3FKI J;  3BG5 A;  2NVQ J;  3HOW J;  1RR7 A;  3HOZ J;  2M34 A;  2DA3 A;  5E3O A;  2E19 A;  1JUM A;  1IUF A;  3IH4 A;  2P81 A;  1GVD A;  3Q0W A;  2HI3 A;  2DJN A;  5FKN A;  4JX4 A;  4XK4 A;  1ETQ A;  3SDG A;  1QRY A;  4I76 A;  2HDD A;  1DU6 A;  1FIP A;  1O4X A;  1EF4 A;  4A3L J;  3A03 A;  1HLV A;  3GBG A;  2HXO A;  3QQA A;  3JRE A;  1QVT A;  2JK3 A;  2CQX A;  3BT9 A;  5EZH A;  5EGO B;  1S7E A;  1TWF J;  4BBS J;  1UHS A;  2I10 A;  4Y7N J;  5IPA A;  5GP9 A;  1IV6 A;  1JJ8 C;  4DYC A;  4A3C J;  3LSG A;  5J1Y A;  3S17 J;  3JRH A;  2DMU A;  2L7Z A;  1I3Q J;  1MBH A;  1F36 A;  4A3K J;  1WH5 A;  3HBL A;  4S0H B;  1YRN B;  3BTL A;  1JKR C;  3PO3 J;  3CDL A;  1TWC J;  2LD5 A;  3MKL A;  5EYR A;  3JRI A;  3JRF A;  1BL0 A;  2DN0 A;  3BR3 A;  3MN2 A;  3QPS A;  2MW8 A;  5K7F A;  2FX0 A;  2Y2Z A;  3NAU A;  1AKH B;  1DU0 A;  3BR1 A;  2AO9 A;  1B8I B;  5EZG A;  2H8R A;  3S16 J;  5EEA A;  1HDP A;  3W6V A;  4MIM A;  5FLV A;  3SJM A;  1CQT A;  2K40 A;  1WCM J;  5EGO A;  1ZQ3 P;  5FLM J;  2AHQ A;  3NAR A;  2DA6 A;  2H1K A;  1HOM A;  2HQ5 A;  3Q0V A;  3A01 B;  2VKV A;  1ZTR A;  5BNG A;  2L7F P;  5IP6 A;  3G1M A;  1ZKG A;  4MLO A;  4FTH A;  1APL C;  2JA6 J;  3JR9 A;  2GM4 A;  2VI6 A;  1K83 J;  1JGG A;  1T33 A;  2EH3 A;  4BKX A;  1GDT A;  3S1Q J;  2CUF A;  4JYK A;  1ZR2 A;  3WHB A;  3BG3 A;  4A3M J;  2G0E A;  4HNV A;  4X1E A;  3LSP A;  3GTM J;  1Q1V A;  1QPI A;  2JWT A;  3SFI A;  4XIC A;  3TW6 A;  1AKH A;  1MNM C;  1K61 A;  5HOD A;  3JRD A;  3GTL J;  4FCY A;  4UUS B;  2XB5 A;  3M4O J;  2FD5 A;  3BQZ A;  3S2D J;  5J3L A;  3HOX J;  2XPW A;  4A93 J;  4L5E A;  3GTK J;  1JKQ C;  3Q0U A;  3B6C A;  4M6V A;  1JTY A;  3K7A J;  2MGQ A;  2K9N A;  1ITY A;  3A01 A;  2DA2 A;  3S14 J;  1TWH J;  2Y9Y A;  2HYJ A;  1R9T J;  1LFB A;  1FTZ A;  1TWA J;  5JLX A;  1JUS A;  3ZQG A;  4AUX A;  1WPK A;  4XID A;  5C3E J;  3LSR A;  1VFC A;  1JTX A;  1A5J A;  4IHY A;  3M3Y J;  2EQR A;  2ZB9 A;  1H8A C;  2JMW A;  3RKQ A;  1ETX A;  1B72 B;  2R5Y B;  1GV5 A;  1E3O C;  1VF9 A;  4A3G J;  1Z0X A; 
#chains in the Genus database with same CATH topology
 2O8K A;  2XDV A;  2BVL A;  2LRE A;  1FSE A;  2OF7 A;  4V19 K;  1X4O A;  5HLI A;  4U7B A;  1Z67 A;  2EPF A;  2Q1Z B;  2PBI A;  2WY7 Q;  1TQP A;  4YFK F;  1R5H A;  2QLZ A;  3FKJ A;  4C3I J;  4IQ4 A;  3K70 C;  1YLF A;  2W1O A;  5DUK A;  3HDD A;  3CUO A;  2Z2S B;  4UB8 C;  3O8G A;  2WAQ N;  3WTX C;  5F08 A;  3OYH A;  3PUF A;  4P1W A;  2N8G A;  3IH3 A;  4XRS G;  1UMQ A;  4CGZ A;  4M3F A;  1BA5 A;  3F8B A;  3I54 A;  2HNH A;  3FMQ A;  1FBQ A;  2BW3 A;  3CJQ B;  4ON0 A;  2I8D A;  4OAY A;  1VQ8 I;  2VUM J;  3DU6 A;  3DF8 A;  2V9P A;  3JCU C;  2F5D A;  1ETW A;  4A3E J;  1UJ8 A;  2R0Q C;  4A5M A;  3HHG A;  1U6G A;  2K3P A;  1WH7 A;  3DXJ F;  5J4Y A;  3CMM A;  1D1B A;  1W5C C;  4OIN F;  3QWL A;  3LQR A;  4O3M A;  5C44 J;  1WJ5 A;  2PQ8 A;  5CYV A;  1SAX A;  1VQ6 I;  3CCS I;  2WAF A;  4IL6 C;  4EJO A;  1V5G A;  2ID6 A;  2DA1 A;  2VON A;  1J75 A;  1SFO J;  5LHG A;  3TQN A;  1BOB A;  1MNE A;  4WF2 A;  4OIO F;  3LNQ A;  3E7L A;  2NVX J;  1D0Z A;  5DEQ A;  5ICF A;  2JTV A;  2RQQ A;  3CCY A;  4WXD A;  4G7Z F;  1D5Y A;  2MG4 A;  2VBW A;  1IJW C;  1XCV A;  1XDU A;  2EZH A;  3H0G J;  2JPB A;  2M8G X;  2WB1 N;  4I6Z A;  2E1C A;  1UAA A;  3WE3 A;  4BEH A;  3HOT A;  4B3A A;  2XGD A;  4NB5 A;  3LL7 A;  4XN3 A;  2VE8 A;  4UHT A;  3DBL B;  2L2O A;  4AVP A;  3FXL A;  5EG0 B;  1Z1D A;  3FF5 A;  1OCR H;  1T38 A;  2E35 A;  3QOP A;  2R7W A;  4XNF A;  1KON A;  1YRN A;  4PDK A;  2JUG A;  5HDG A;  1U9N A;  4B4C A;  5ICE A;  4A3B J;  3N05 A;  2QCO A;  2NAZ A;  4BHC A;  4E7K A;  1NK3 P;  4L0Z B;  3W2A A;  4RAY A;  3CCJ I;  1Z6T A;  1MMD A;  4MFE A;  3HPH A;  2X1C A;  4ESF A;  2R7D A;  3HHH A;  2OA4 A;  3S3N A;  2JA5 J;  4BDY A;  2ISZ A;  2Y31 A;  4CYC B;  1VQ7 I;  2VOP A;  3C2H A;  2QGU A;  4QIW N;  4Z6Y A;  2ZME A;  3F0C A;  3HTU A;  2JSC A;  2QBY A;  3MZH A;  4PJM A;  2CQQ A;  3BR0 A;  1QQI A;  3V8L A;  1VQ4 I;  3RKY A;  4F92 B;  5K7Z A;  2Z9O A;  1MND A;  1B1B A;  3R0A A;  4LK1 F;  2L9R A;  2JA7 J;  1R7J A;  2QQA A;  1ETK A;  5JLW A;  1B9M A;  1TWG J;  4MNU A;  2MH9 A;  5LGN A;  2F6C A;  3FK7 A;  1IN5 A;  2RGV A;  2BE5 F;  5E3L A;  3VSK A;  2F4M B;  3J81 Z;  1MBE A;  3QPL A;  2P8T A;  3EDP A;  1P2F A;  1R4N B;  3ZP5 A;  2YPR A;  1ZEL A;  2LVS A;  2AXL A;  2VXD A;  1ETV A;  5DS9 A;  1NTC A;  1FYK A;  2EV5 A;  2EJR A;  3I53 A;  5M3F J;  3HXL A;  2ECB A;  2Y30 A;  3OSF A;  5EJC A;  4OMY A;  1L0O C;  2OJE D;  1U8B A;  5LHH A;  1VI0 A;  3S1M J;  1G2H A;  2OAZ A;  2FF4 A;  1Y8R B;  2EFW A;  4HF2 A;  2FXA A;  4IOA F;  4UV8 A;  2ZXJ A;  5IP9 J;  4RAG A;  2EIJ H;  4IZZ A;  2RDP A;  1X3W B;  4MQV A;  4W1U A;  1OCZ H;  3GFM A;  3K9T A;  4C2M J;  1K79 A;  2OCE A;  4HDV A;  2KJC A;  3JRA A;  3KEQ A;  1S6L A;  1W7P D;  1B9N A;  3RQ4 A;  1B72 A;  3HOV J;  2B7E A;  1X2M A;  4RLF A;  3OYL A;  3CUQ A;  3CP2 A;  3DQV C;  4E70 A;  2K7L A;  3M9A A;  1G8X A;  1MMN A;  3FM5 A;  3P7N A;  4RS8 A;  4LG3 A;  4H4K C;  3OR1 C;  3I55 I;  5ICG A;  3H3U A;  2X1E A;  2W48 A;  2GAU A;  4UNO A;  1FT9 A;  4DJA A;  2V1N A;  2DA4 A;  2QSH X;  1Y0N A;  1ON1 A;  3FHN A;  4RA2 A;  3M1E A;  2L4M A;  5DCM A;  2E60 A;  5D5W B;  2O7O A;  1DDN A;  3OOU A;  5EDN A;  1HW1 A;  2ECC A;  2RAE A;  2RNJ A;  3G71 I;  3LA3 A;  3D5L A;  1LE8 A;  2HYG D;  4DYQ A;  4M3D A;  3SZG A;  1AOY A;  2DOA A;  1SD6 A;  3EET A;  3TO6 A;  1FTT A;  5J4V A;  2ZJ2 A;  1YW8 A;  2DU9 A;  3F3X A;  4HNT A;  2HTS A;  3ZR8 X;  3ZQC A;  3HL2 A;  5FB2 A;  3KLO A;  2PMZ N;  3BJ6 A;  3P5J A;  1MBK A;  3C2G A;  2E1N A;  2AQF A;  4HX8 A;  4AVZ A;  3JAM K;  2D5V A;  3OSG A;  3MZ8 A;  3LQQ A;  1OPC A;  1Z77 A;  4YIF A;  2QEN A;  2OC6 A;  5F04 A;  1WJD A;  3L2V A;  2NS7 A;  3IC7 A;  2Y0S N;  4I0B A;  4IOC F;  3ERM A;  1BM9 A;  5HLH A;  3OY9 A;  1OIS A;  1HW2 A;  3O2P E;  1POG A;  4I99 C;  3CMA I;  1W4M A;  5FKM A;  4XLF A;  3TDZ C;  5M5W J;  1YFH A;  3IH2 A;  3ONQ A;  1FSH A;  2M2E A;  2R5Z A;  1LPQ A;  4UB6 C;  2COB A;  2DMN A;  2E2J J;  4M3E A;  4L18 B;  2DFH A;  3GO5 A;  3KCC A;  1RRJ A;  2UV1 A;  4V2F A;  3GZN B;  1MDM B;  3OYM A;  1D8J A;  2WV1 A;  1FWZ A;  3BTI A;  4LFU A;  1Z21 A;  1BOA A;  4EEF G;  2BHZ A;  3KYC B;  2O3F A;  5K5O A;  3HGG A;  1JGS A;  2QSF X;  3VPR A;  2KIM A;  2HDC A;  4XLE A;  1BI1 A;  1V54 H;  2F2E A;  5DTD A;  5CPR B;  3DLA A;  2AXT C;  3UR3 C;  3FXO A;  2BBY A;  3AFH A;  1WZ2 A;  2XAH A;  1BJZ A;  2LMD A;  3L00 A;  2FEZ A;  1IW7 F;  1HF0 A;  1D8K A;  4CIC A;  4RLQ A;  4F91 B;  1MGT A;  2DCE A;  3K4N A;  4I01 A;  3FXU A;  2A6E F;  1HKQ A;  3T8T A;  2NXN B;  2R3S A;  1S7O A;  1IN8 A;  4HV6 A;  2BW3 B;  3MZY A;  1J5Y A;  2MSY A;  4BAY A;  5FGM A;  4ZTJ A;  3CC7 I;  2LY1 A;  2KKO A;  2NVQ J;  4EMS A;  1FP2 A;  1MKM A;  4DGW B;  2HR3 A;  3U2R A;  3SFZ A;  1E0E A;  1SVM A;  2DA3 A;  4YEL A;  4CH7 A;  5E3O A;  2E19 A;  4DOZ A;  4IKF A;  4G94 A;  4LIU A;  1N75 A;  3IH4 A;  2DYR H;  3QP6 A;  2P81 A;  1MJB A;  3F9K A;  1GVD A;  5E1W A;  3OYF A;  4CUG A;  2DJN A;  2BGC A;  2HZD A;  1E3P A;  4JX4 A;  1XSD A;  3L9F A;  2GOM A;  2PN6 A;  3CLQ A;  4XK4 A;  1HQC A;  4LB5 A;  2CQ7 A;  4I76 A;  4A0X A;  3HG9 A;  5GTH C;  3FXK A;  2QA4 I;  2DQR A;  3HKZ A;  5AON A;  1N25 A;  2K86 A;  5CJ9 A;  3BG7 A;  2O8X A;  4KT5 C;  4LG0 A;  2HEO A;  1ON2 A;  1SMY F;  3H35 A;  4A3L J;  3DPU A;  2JK3 A;  3NQO A;  5EZH A;  1V5F A;  5HS9 A;  1LDD A;  4BEH B;  3FXJ A;  1BR1 A;  1JJ8 C;  5AIQ A;  3EQL F;  3M07 A;  1L3L A;  3WE2 A;  4XSZ F;  1VQO I;  2VJI A;  3VB2 A;  1F36 A;  2W7N A;  2VPL A;  1A04 A;  1G3S A;  1TQI A;  2IA2 A;  3WGH A;  2XVC A;  2P0W A;  1YRN B;  4BE0 A;  3PO3 J;  3CDL A;  5JHU A;  1IXR C;  1JE8 A;  2EFP A;  3ML6 A;  4XMY A;  4KJZ A;  2IPQ X;  3CO6 C;  2DT5 A;  1FMW A;  1ULY A;  1M1E B;  1DU0 A;  3U21 A;  5EZG A;  3S16 J;  1HDP A;  2ZKZ A;  4JQF A;  1RUO A;  3MWM A;  4I09 A;  2FUG 2;  3SJM A;  2QBY B;  1CGP A;  3SXY A;  5EGO A;  3V8J A;  5CQG A;  3VDX A;  5E8I A;  2KIS A;  2K9M A;  2CG4 A;  4P9F A;  1XMA A;  1YJW I;  1HOM A;  1DGW Y;  3I3L A;  2IXS A;  1SFE A;  2OBP A;  1HXD A;  2VKV A;  1KYW A;  3KZI C;  3PNT A;  3E6D A;  4CCO A;  1J09 A;  5BNG A;  4PSW A;  3LSK A;  1USS A;  2P4W A;  5CKT A;  3JR9 A;  3CCM I;  4RGS A;  1WJA A;  4BGD A;  5J40 A;  1W36 D;  1JGG A;  1TNT A;  2COM A;  4GDF A;  1DPR A;  2EH3 A;  3CCU I;  2CYY A;  2Y0M A;  3KEO A;  5E20 A;  4BKX A;  5H2F C;  1GDT A;  5IT9 K;  5E17 F;  2L9V A;  3BCB A;  4UV9 A;  2NRA C;  1TTY A;  3G73 A;  2G0E A;  4X1E A;  4E7S A;  2JWT A;  1LDJ A;  1TT0 A;  3ZMT A;  3WTT C;  1ZGJ A;  4U88 A;  1G3W A;  3ABM H;  4XIC A;  5HOD A;  3JRD A;  1R58 A;  1X19 A;  3GTL J;  2KDO A;  2XB5 A;  3M4O J;  2M4K A;  3VYU B;  2FD5 A;  2IGO A;  2RN7 A;  1SVO A;  2L9S A;  2VQH A;  3GTK J;  1JXS A;  2HFH A;  2MC4 A;  3SYT A;  5HLG A;  3CZ6 A;  3K7A J;  2MGQ A;  1TWH J;  1I6X A;  1R9T J;  2PI0 A;  2IS2 A;  2L02 A;  3BWG A;  1TWA J;  1MMA A;  2WBM A;  3L2C A;  1UST A;  4FX0 A;  1JUS A;  4ZC3 A;  1S29 A;  1OKR A;  2KMU A;  2WV0 A;  2ZSI B;  1GVJ A;  2LC2 A;  2QSG X;  2R7F A;  5D5X B;  3ZQQ A;  1XMX A;  1B72 B;  1NG7 A;  2DDB A;  3CCE I;  4UUV A;  2EFO A;  3HRT A;  2ETH A;  1LJ9 A;  1YIJ I;  1OR7 A;  1ZAO A;  3SEZ A;  1VQP I;  2GWR A;  1U3E M;  2M5W A;  3ZMD A;  4L5J A;  1SAN A;  3J7Y J;  4OAZ A;  4FE7 A;  1F43 A;  3DP7 A;  2KRF A;  3WG9 A;  5LBQ A;  1W0U A;  4PCQ A;  1HBX G;  3TBI A;  5L3D A;  2QF7 A;  4Y33 A;  4G7O F;  2CWE A;  3BPX A;  4KIS A;  3DKW A;  2L9N A;  5DCM B;  1I1G A;  4KT6 A;  3KP7 A;  4B47 A;  1IUY A;  2D1V A;  3KEY A;  2XPV A;  2W25 A;  1IN7 A;  3N4M A;  5J1R A;  1ZK8 A;  1LE8 B;  2ZFW A;  4B44 A;  1QZZ A;  2XF5 A;  3BZ6 A;  3BR6 A;  3HZJ A;  1WJC A;  4DQ2 A;  4PJN A;  3HUG A;  4N4N B;  3BP8 A;  1R4M B;  2LBF A;  1KQ0 A;  1FNN A;  1U5T A;  5DYM A;  5M5Y J;  1ENH A;  3MFK A;  4LMY A;  2ME6 A;  4ESJ A;  3S3O A;  1SFU A;  1I5Z A;  2PG4 A;  3FIS A;  2XPU A;  2R7S A;  5JI6 A;  4Y52 J;  4D0P A;  1OCP A;  3ABL H;  1YJ9 I;  1PP8 F;  1PUF B;  3BCA A;  5FD5 A;  1JHF A;  2NS8 A;  4GYG A;  1CF7 A;  2M1B A;  5J8C A;  2NYX A;  1W5T A;  2FBK A;  3M8E A;  1BW5 A;  4HA8 A;  3TO7 A;  1ZN2 A;  3RPQ A;  5L3G A;  2O6G E;  5C4X J;  4ESB A;  3OYE A;  1B6A A;  2IS1 A;  4BS9 A;  1YE9 A;  3J7A O;  2M7B A;  2IGN A;  2L54 A;  4IHT A;  3MKY B;  1ZGW A;  1O57 A;  4R1H A;  1XGO A;  2D2W A;  3NWS A;  2K4J A;  4XOT A;  5HS7 A;  5LGT A;  1HC8 A;  2NOG A;  1I50 J;  4OIQ F;  3BTC A;  4EM0 B;  1ZGA A;  1VQ9 I;  3R0J A;  1UG2 A;  5F1R A;  5ICC A;  1HST A;  2PEX A;  5L3C A;  1R5I D;  4BJ6 C;  2GLO A;  1FBS A;  4DZP A;  2CV0 A;  4XOR A;  1D1A A;  1KYZ A;  2XSD C;  1VQL I;  2MFZ A;  1T6S A;  3B6A A;  4ABZ A;  2O9L A;  2KQR A;  1BC8 C;  2OQG A;  3OYB A;  2DDA A;  2NOJ B;  4L9N A;  3S2W A;  3LFU A;  2MD0 A;  3KP4 A;  5BOX A;  4KDP A;  2OPT A;  2KJB A;  1RIO H;  3BTJ A;  2OCC H;  3PFY A;  1W0T A;  2XAG A;  3K2Z A;  4PJL A;  3H9Q A;  4XN0 A;  1S3J A;  3W2W A;  2JVG A;  2Y75 A;  5JFR A;  4MTE A;  2WY8 Q;  1O7L A;  4OU0 A;  4II2 A;  1Z9C A;  3MAJ A;  1MH3 A;  2R7Q A;  1JJ6 C;  3TGN A;  4AD9 A;  3H5R A;  3JRC A;  3BR5 A;  2A5W A;  5K5R A;  2E36 A;  2NNY A;  3AG1 H;  3OYG A;  4Q47 A;  1LFU P;  3GTP J;  2FQ4 A;  5KHD A;  2WAD A;  2VOD A;  2X48 A;  5M5X J;  4J19 A;  1J9I A;  3K4C A;  2MLG A;  2ZJR F;  4B09 A;  5FLX K;  4BXU A;  2HS5 A;  5J1U A;  2R7O A;  4A3I J;  1AU7 A;  2OV7 A;  4BL0 B;  2M30 A;  3N97 A;  4PSX A;  2FRH A;  5TIS C;  3F6O A;  2GXG A;  4BBR J;  2LNB A;  2Z5U A;  5E8G A;  4H0E A;  4E7J A;  2HOE A;  5KAI C;  4LG0 B;  5IYC J;  4C9Y A;  4BE2 A;  5L3F A;  2K9S A;  2IGK A;  1OJL A;  2DOD A;  4P55 A;  5D6E A;  2QZ8 A;  3BC8 A;  4ENJ A;  1ZG3 A;  4D7M A;  4EAT A;  3I0T A;  1MH4 A;  4A0Z A;  4LIV A;  2V7F A;  2A69 F;  5DM7 F;  1OCC H;  2KL4 A;  3E6C C;  3VOE A;  1UEL B;  4FIS A;  4C3H J;  1IC8 A;  2OU2 A;  1F5T A;  3IAS 2;  1IDY A;  3AAF A;  2XRN A;  4IPA A;  5E3M A;  2BV6 A;  2RV8 A;  5ILU A;  1T2K A;  4D9J A;  3R4K A;  3EPZ A;  4U0Y A;  1O3T A;  3GYH X;  5J6X A;  4XM3 A;  3M1C A;  2R5Y A;  3ZMZ A;  2CO5 A;  2IP2 A;  2HYF A;  4CO8 A;  2B9S A;  1R00 A;  3RYR A;  4CDG A;  3Q5F A;  3PQJ A;  5CVV A;  3HRU A;  1EV7 A;  3OL4 A;  3S2H J;  3BJO A;  3J7A Y;  4XLA A;  2YU3 A;  4NC7 A;  3D1N I;  3HIF A;  4IHS A;  2MA3 A;  3H3V K;  5LFA A;  3ZRG A;  3RTR A;  4EM2 A;  3HOY J;  1Y1V J;  3K2A A;  1OYY A;  4A6D A;  5LD2 C;  1T98 A;  3JW4 A;  5CVI A;  4Y13 A;  3IKT A;  3K10 A;  4KA4 A;  2DMQ A;  3SZT A;  4HST A;  2UWM A;  1S5L C;  3OYN A;  4HEA 2;  1K4T A;  5B1A H;  4KUM A;  1T56 A;  1WFX A;  2V1D A;  3ZMS A;  1HKT A;  3IWF A;  1MBJ A;  2W4S A;  3EYI A;  1XGN A;  1EA3 A;  2G9W A;  3Q9V A;  2D1H A;  4J01 A;  2VBX A;  5F0C A;  1WJF A;  2DYS H;  3LAJ A;  3H9G A;  2QM3 A;  2DMP A;  4MGR A;  2KRC A;  1GLN A;  3F23 A;  2MC3 A;  3RZO J;  3WTU C;  2MYS A;  4CA0 A;  1H9G A;  1Y56 A;  4HPQ A;  3GTO J;  3I59 B;  3EUH C;  4C2T A;  2XKO A;  4JOM A;  4IHX A;  3WU2 C;  2LH9 A;  3RQI A;  3I4N J;  1U5T C;  3DU5 A;  4Q48 A;  5DD8 A;  4DYR A;  2BOL A;  1T8I A;  1OLT A;  1SAU A;  1YOV B;  2CJJ A;  3DEW A;  2PFB A;  5F27 A;  3GWZ A;  3IUO A;  4MHG A;  1A6I A;  1W7P B;  2JJ7 A;  1KU9 A;  5D4S A;  3F72 A;  1WI9 A;  5TGT A;  5F0H A;  4L9T A;  4A69 C;  2YUS A;  5B1B H;  1IN4 A;  3ZOB A;  2P5L C;  4PGH A;  1XS9 A;  2RNG A;  5IYB J;  3LSM A;  4ENK A;  3TOA A;  4I7H A;  3K4L A;  4WXC A;  2M45 A;  2VC1 A;  3FDY A;  1YHQ I;  4WWC A;  2P7C B;  4NC8 A;  1S8N A;  5J8F A;  3WU1 B;  2DQL A;  4P9U A;  2LLK A;  2HTJ A;  3H1C A;  1Y1W J;  3DEE A;  4UUT A;  2V26 A;  1SFX A;  5JVG F;  1RKT A;  4FX4 A;  2FMY A;  3FIW A;  2R7X A;  2LTP A;  3ZN0 A;  4RDU A;  5GAG J;  2H6C A;  3FMR A;  1X3U A;  4ZDP A;  4AWX B;  2E1M C;  1YW7 A;  2H6B A;  3HM5 A;  3F8M A;  3ECO A;  2KZV A;  1I1S A;  5LHI A;  4HF1 A;  1BI3 A;  2QUF A;  1TNS A;  2EZL A;  3JTG A;  1IRG A;  4ZZD A;  2GZW A;  4WXH A;  3MVP A;  1S9H A;  4A5N A;  3JSO A;  1IDZ A;  2EFN A;  3VFZ A;  2OQR A;  3B73 A;  4KFC A;  2FBH A;  4C3J J;  4MFD A;  1FEX A;  5DV5 A;  3HUG B;  5LRS A;  3RCO A;  2KZG A;  4RAF A;  3HKZ N;  1LB2 A;  4B48 A;  1U5T B;  2FBI A;  1IN6 A;  1YO5 C;  2DOE A;  5FD6 A;  2LF8 A;  4BE1 A;  4ZDO A;  5D5U B;  3HRS A;  2LY2 A;  3HOZ J;  1I39 A;  2QKM B;  4I0A A;  4Y4R A;  3J7Z I;  1CF7 B;  1XN7 A;  1WJB A;  5ILS A;  4HOB A;  2OZU A;  4PFO A;  2HI3 A;  1EJ9 A;  5FKN A;  3J80 K;  1WKM A;  4N4O B;  1WSU A;  4DBQ A;  2Y69 H;  1LQ1 A;  4XLC A;  4RM2 A;  3CDI A;  1O4X A;  5DCF A;  2KP6 A;  3HJE A;  4RGX A;  1D5V A;  4Z2Y A;  1R6R A;  1V3F A;  5HDK A;  1FLI A;  1P4A A;  4HW0 A;  3RYP A;  2XKP A;  1HLV A;  3JRE A;  4KIC A;  2RKH A;  5LRR A;  2CQX A;  4UVB A;  4BHP A;  1S7E A;  2A6H F;  1UHS A;  2CFO A;  4LLG F;  5IPA A;  4C2U A;  5F64 A;  3GZ6 A;  4QLC U;  4A3C J;  1WHU A;  3VYS B;  3S17 J;  3DEU A;  2DMU A;  1I3Q J;  1MBH A;  2E1M B;  4XOP A;  1WQ2 A;  5HVQ C;  4NQW A;  4S0H B;  1XCB A;  3REO A;  2OUM A;  1TWC J;  2LD5 A;  4M73 A;  3I71 A;  5D8K B;  2NNN A;  4KN7 X;  2DOF A;  4UY8 I;  5ILV A;  2IVM A;  4AID A;  3AL0 C;  2DN0 A;  3BR3 A;  1X1A A;  3MN2 A;  2OD5 A;  3QPS A;  5K7F A;  3NAU A;  1G6N A;  4QPO A;  1SFK A;  3BR1 A;  1WWX A;  3BDD A;  2H8R A;  2VC0 A;  3U1K A;  3CLO A;  1ZAR A;  1P4X A;  1XSX A;  3L09 A;  4N9I A;  1CQT A;  2E7X A;  4XLH A;  1WCM J;  1XDS A;  4PJJ A;  3LFK A;  2Z33 A;  3NAR A;  4B43 A;  5K5Q A;  3Q0V A;  1K7A A;  3OIQ A;  3A01 B;  1NG6 A;  1W36 C;  2PMH A;  3SQN A;  4HQE A;  1APL C;  3HRM A;  5E79 C;  3W2V A;  1K4S A;  2CUJ A;  1K83 J;  1QGP A;  2UXX A;  1SVL A;  2FQ3 A;  2BHY A;  1E3H A;  3CJN A;  4R8H A;  2CUF A;  4JYK A;  4O6J A;  1K78 B;  4C30 A;  2H8W A;  3I4P A;  3BG3 A;  1T0F A;  3LA7 A;  3OL3 A;  2Q2E A;  2ZFU A;  2UUZ A;  4PFP A;  3LSP A;  1W1W E;  4ZYD A;  4QPQ A;  3S3M A;  3BZK A;  1GHC A;  3SFI A;  4A12 A;  2V4J C;  1AKH A;  1MNM C;  1ONV A;  2VJJ A;  3CD6 I;  3FXM A;  1TW2 A;  4PZJ A;  2M87 A;  3K1N A;  1QZY A;  4CCJ A;  2IS6 A;  2GIZ A;  5J3L A;  1QHG A;  2QQB A;  2VE9 A;  4L5E A;  1R71 A;  2VL8 A;  3Q0U A;  3BOQ A;  3BZC A;  1TP4 A;  2HYJ A;  2KHM A;  4EJU A;  4Y15 A;  5DDG A;  4HV5 A;  1RZ4 A;  1YW9 A;  1N78 A;  3DTE A;  1VFC A;  1WPK A;  5C3E J;  1WJE A;  3GME A;  3HOS A;  3F8C A;  3PSF A;  1RNL A;  1TLH B;  3QP5 A;  4RM3 A;  4IHY A;  3AL0 B;  2EQR A;  2ZB9 A;  1H8A C;  2B0L A;  2FE3 A;  2VXZ A;  4FHT A;  4ANJ A;  1LFP A;  3FWE A;  2DBB A;  2MH2 A;  2ZME C;  2R5Y B;  5FRM A;  2BXY A;  2EV6 A;  3QOE A;  4HG2 A;  3V8K A;  3QU3 A;  3FX3 A;  2X9D A;  4BHB A;  2B63 J;  2CUE A;  3F8F A;  4HSR A;  5GPC A;  2CRG A;  4S05 A;  2XGX A;  3OMY A;  1F4K A;  1IXS B;  1WI3 A;  5FO5 A;  1T39 A;  1B59 A;  5D8L B;  2LRD A;  3S1R J;  5HDN A;  3A0H C;  2EV0 A;  3AG4 H;  2DA5 A;  4WX9 A;  4F55 A;  1MZB A;  1IRZ A;  2ID3 A;  2E1O A;  4XR6 A;  1MSF C;  1A36 A;  2XAS A;  4BQA A;  4M9S A;  2XB0 X;  3C1D A;  3HOU J;  3MMY B;  2J5O A;  2XRL A;  5GAH J;  2LSO A;  4YG2 F;  5EEH A;  4KIF A;  3K69 A;  3PQK A;  1BN5 A;  4G12 A;  3QYB A;  4FET A;  3GFL A;  1REP C;  3EUA A;  2H94 A;  2EZK A;  3O8H A;  2CMP A;  1F9N A;  2EIM H;  3HSR A;  3IKV A;  4B1R A;  4F93 B;  2XF6 A;  3GTJ J;  2X6Y A;  2HKX A;  3GFI A;  1MBG A;  2A68 F;  3ZQH A;  1X1C A;  3QPT A;  1BIA A;  4ZH4 F;  2PJR A;  3VWB A;  1NH3 A;  4IVN A;  3R60 A;  2MLK A;  2A3S A;  2IT0 A;  1WRJ A;  3JAM Z;  2R4G A;  1XB4 A;  4EQQ A;  4IO9 F;  1YYV A;  4NDL A;  2A05 A;  2P7V B;  3CO7 C;  2CW7 A;  2HKO A;  3QOD A;  2P5K A;  3HPG A;  4KNY A;  4RBO A;  5BMZ A;  3COA C;  3VYR B;  2K9Q A;  3H5N A;  3JTH A;  1IG7 A;  2VN2 A;  1G59 A;  3CUQ C;  2BEO A;  2ZME B;  2IAI A;  3BR2 A;  2E34 A;  1HA8 A;  3JRG A;  4W97 A;  3M8J A;  5EEG A;  2E71 A;  1XD7 A;  3ASN H;  2V9V A;  4L9J A;  2FJ1 A;  3KZY A;  3L2U A;  2QKL B;  3LOC A;  3LA2 A;  3HGY A;  2L3D A;  5EF6 A;  3PIO F;  2DA7 A;  1U78 A;  4N9H A;  2L0K A;  1RES A;  1U9O A;  3E3V A;  2K02 A;  2TDX A;  4WK8 F;  1IGN A;  3HSE A;  3BPV A;  1JKP C;  4BUP A;  3S15 J;  3NWT A;  5CVU A;  2R92 J;  4XKC A;  2M9H A;  5B3S H;  1LVK A;  3RDI A;  4E7L A;  3C2B A;  3DTI A;  4EJT A;  4DIQ A;  1R22 A;  2GA2 A;  3SDB A;  2L01 A;  2BZT A;  2G7U A;  4RGU A;  1UCR A;  4FE4 A;  1ERD A;  5C4J J;  4GGG A;  2Y9Z A;  2DPU A;  3I9V 2;  3E6B A;  4GFB A;  3BRO A;  2E5N A;  4M3G A;  1B8I A;  4BDZ A;  1RKW A;  3M8F A;  3E97 A;  1MDM A;  2MBF A;  4LLN A;  5FKL A;  4OOI A;  2IA1 A;  1FJL A;  2E5Z A;  4ZYE A;  2R7Z J;  1U2W A;  2FOK A;  4D5C A;  4G6Q A;  3CC2 I;  4KIT B;  3O6B B;  3FZV A;  1DP3 A;  1X1B A;  3G1L A;  1EH7 A;  4CCK A;  2VPR A;  3E1S A;  3A02 A;  4OWR B;  3T1B A;  1QU3 A;  3KE2 A;  4A3F J;  5EG0 A;  3H5A A;  1G4D A;  2XAF A;  1R23 A;  5IY5 H;  5BS6 A;  2XUB A;  2CQN A;  3GUD A;  3GW2 A;  3HEF A;  3QPH A;  3WTV C;  2GBY A;  5DM6 F;  3NEU A;  2F4I A;  2R93 J;  3GZ5 A;  1V55 H;  1X2N A;  1IRF A;  3CUQ B;  2X6O A;  4V2G A;  1T0F C;  1FP1 D;  3WTY C;  3WOD F;  2KIU A;  3OIO A;  3CME I;  4ZTF A;  1Y8Q B;  4BQN A;  1TL8 A;  3DFG A;  2K85 A;  4CYC A;  4R79 A;  1XGS A;  3I4M J;  3GEZ A;  1OFC X;  5A2Q K;  4YFN F;  3S1N J;  1QVU A;  2X6W A;  2LOO A;  2VOO A;  3F22 A;  4FAS D;  2VQL A;  1AWC A;  4RB1 A;  3W6J B;  1HW5 A;  2VKH A;  3PNV A;  4DBR A;  5F0F A;  4PGG A;  2Z99 A;  5ED4 A;  3WHC A;  2EIN H;  1EH6 A;  1GT0 C;  4EGY A;  2O0Y A;  3E5X A;  3TED A;  4IX7 A;  4I98 B;  1X4P A;  2KPM A;  4A0Y A;  5IYD J;  3ELK A;  3DWL E;  4M72 A;  5AIP A;  3RKX A;  4ZYG A;  2KRH A;  4A6E A;  2LYC A;  3GTQ J;  3ZQI A;  2W00 A;  3PFI A;  4G9Y A;  3IP4 B;  3W6K B;  1LNW A;  4L5I A;  2LKP A;  5TJJ A;  1TBX A;  3DBR B;  2YSR A;  2Z3Y A;  4M9Z A;  3KYD B;  3HB9 A;  1P7J A;  2CQK A;  2HQA A;  3CES A;  4AU7 A;  2WWY A;  2HWV A;  2CUZ A;  4B3X A;  4E6K G;  1LUJ B;  3P9K A;  2EZI A;  3H3Z A;  4BU2 A;  2EIK H;  2VB6 A;  3RKW A;  2R5Z B;  4GRI A;  2HDW A;  1PYV A;  4ENN A;  2HXI A;  4QSH A;  2H09 A;  1YX5 A;  1X1D A;  2Q2E B;  4XKV A;  4AIH A;  2ADU A;  4LOC A;  4D5F A;  3F6V A;  5K1Y A;  2VT3 A;  4GYI A;  2GXA A;  2ZXI A;  5FRO A;  4BAC A;  1N77 A;  2BY2 A;  4E7Z A;  2EBI A;  3KLN A;  3QRF F;  4IHV A;  5IT9 Z;  4HYE A;  2H27 A;  1FOX A;  4G6T B;  1P7I A;  1D0Y A;  1I27 A;  1ZG5 A;  4XRF A;  1Z7U A;  2M8E A;  2ZC2 A;  3MQ0 A;  3K0L A;  3TW7 A;  3CDH A;  3FXQ A;  1KGS A;  2TCT A;  3H36 A;  1LEA A;  4EV0 A;  2LFB A;  2W84 A;  2XSJ C;  3DCF A;  1SEU A;  5FJ8 J;  4LJZ F;  1J0R A;  2YR2 A;  2O03 A;  4YII A;  1TC3 C;  3RI4 A;  3L2W A;  2H1L A;  1AHD P;  3HYI A;  3Q3S A;  4EVI A;  3E0J B;  3ZMV A;  4PK4 A;  1YIT I;  4F7Z A;  4XLP F;  5JVT A;  4BJ5 C;  2VKE A;  2FU4 A;  1QZE A;  4S04 A;  1GUU A;  2DAO A;  2Z16 A;  1YJN I;  4MEX F;  2VBY A;  5D4R A;  2EA2 A;  1ZRD A;  3KP3 A;  2RQP A;  2ME0 A;  3QU6 A;  2OTL I;  4KN4 X;  3H9J A;  2MD5 A;  3WGG A;  1WGX A;  4M74 A;  3CCL I;  2M0C A;  1JT6 A;  3JSP A;  2EWN A;  1B4A A;  5CLS A;  2DTR A;  2YS9 A;  5TRD A;  3CQZ J;  1R49 A;  4ZJZ A;  2LR8 A;  2HOS A;  5FRN A;  3GFJ A;  4IJA A;  5FKK A;  3B02 A;  4LGW A;  2RRE A;  4HQM A;  3PM1 A;  3WTS C;  4DW6 A;  5CQE A;  1HCR A;  2ICW G;  2DO7 A;  2DI3 A;  2VQG A;  1FZP B;  2M0M A;  1QA6 A;  2F48 A;  4M3B A;  3A1Y A;  4DZJ A;  2E2I J;  2M4G A;  5A2Q Z;  3UKG A;  2BVM A;  3ZN1 A;  3LMM A;  3NRV A;  5FKO A;  1BIB A;  1DP7 P;  2F5E A;  5JHF A;  3V7R A;  3BY6 A;  2D45 A;  2CU7 A;  4XRS A;  1MD0 A;  4J00 A;  2ZBK A;  2CW0 F;  2YU9 J;  3G3Z A;  4BXF A;  4IRG A;  3ISP A;  2XRO A;  2JQ7 A;  1OYI A;  1YIO A;  3HOW J;  3S8P A;  3J81 K;  1XPX A;  2M34 A;  3GLX A;  2GXB A;  2PJR B;  2HPM A;  4TV7 A;  2NVU B;  2VIX A;  2E7W A;  1JUM A;  1BR2 A;  4U0W A;  1IAW A;  1IUF A;  3QYE A;  4LD5 A;  3Q0W A;  4AIK A;  2UZK A;  5KAF C;  2IS4 A;  1ETQ A;  1QRY A;  2BXZ A;  2STW A;  1KU3 A;  2HDD A;  1D0X A;  2VAS A;  1FIP A;  2NS0 A;  1NHA A;  3IHU A;  3OS1 A;  1O7F A;  3G4S I;  3V7C A;  2FML A;  4KYW A;  1DPU A;  3P9I A;  3A03 A;  2HXO A;  1OR7 C;  1FBU A;  2LDU A;  4HX4 A;  5EGO B;  1ZHF A;  1MJA A;  1TWF J;  1D1C A;  4EJV A;  1H9T A;  2I10 A;  4Y7N J;  4XSX F;  4YIR X;  2CV1 A;  1R1U A;  1J59 A;  4NBQ A;  3U1D A;  4G7H F;  3MCZ A;  3IWZ A;  1LDK B;  5GP9 A;  3M7G A;  1I3A A;  1OCO H;  1IV6 A;  1MMG A;  3LSG A;  1VQN I;  5J1Y A;  3E6M A;  3JRH A;  2L7Z A;  5ERI A;  3L2Q A;  2XC7 A;  4A3K J;  2HZT A;  3GLL A;  3BJA A;  3BTL A;  3K4M A;  2RVC A;  3WG7 H;  1U8R A;  1JKR C;  2ESN A;  5HNH A;  2KIF A;  3MKL A;  4HLX A;  4PJ0 C;  3DV8 A;  3A0B C;  4HAM A;  3JRI A;  3JRF A;  2F5V A;  2K3F A;  1BR4 A;  1Z05 A;  2Y2Z A;  3ULQ B;  1Y6I A;  4Q4Z F;  2AO9 A;  1B8I B;  1WVR A;  1X1P A;  5EEA A;  4E7I A;  3PNY A;  3W6V A;  1KQ8 A;  4I2O A;  3DBH B;  3ZGK A;  4MIM A;  1T08 B;  2CGP A;  4IRH A;  2K40 A;  1ZQ3 P;  5FLM J;  2DA6 A;  2G7H A;  4ZYH A;  3SEQ A;  2CV2 A;  1ACI A;  1JHH A;  2Y48 A;  1Q1H A;  3QAH A;  2ESH A;  2L7F P;  4CXF A;  1K6Y A;  2V1U A;  4RGR A;  3G1M A;  4ENM A;  4MLO A;  3HSF A;  2BY1 A;  2JA6 J;  2VLA A;  3ABU A;  3ESW B;  2VI6 A;  2W85 A;  2ZNZ A;  2DJI A;  3RIR A;  1VZ0 A;  2DFE A;  4L0Y B;  3ZMU A;  1SD5 A;  1ZR2 A;  2EK5 A;  4ZYA A;  3HC7 A;  4IQJ A;  2ACJ A;  4HNV A;  3O3K A;  1QPI A;  1BC7 C;  1FPQ A;  1Z7L A;  1E17 A;  1KU7 A;  5FLX Z;  1XGM A;  2FOW A;  4XON A;  3WTZ A;  5IT3 A;  3GVA A;  4FCY A;  1FYL A;  2JRM A;  3MKW B;  3OS0 A;  2Z1D A;  2O5R A;  1TT5 B;  3BQZ A;  2A6T A;  1C0W A;  5LEK A;  3S2D J;  3HOX J;  4U0V A;  1JKQ C;  1DQU A;  1R36 A;  1JTY A;  3OIP A;  2Y9Y A;  1QHH D;  4BYY A;  2VT2 A;  1LFB A;  3TOB A;  1FTZ A;  1BBY A;  3GXO A;  4XID A;  3LSR A;  3HTS B;  1P6R A;  4HZF A;  1H0M A;  2GOX B;  2UXN A;  2VJ5 A;  2LBF B;  2X51 A;  2JMW A;  4DNC A;  1ETX A;  3RKQ A;  3UNG C;  2IRF G;  4BQQ A;  1ZH5 A;  1IXC A;  1E3O C;  1VF9 A;  4B8X A;  1BJA A;  2VKD A;  1Z0X A;  3T0Y A;  1IZ1 A;  2HOA A;  4ZDL A;  3OS2 A;  2DT7 B;  3ECH A;  4F3Q A;  5LLQ A;  4OIP F;  1QO0 D;  2XF7 A;  2DFI A;  3RPU D;  3FBN B;  4XRM A;  2V6C A;  3IAM 2;  4MTD A;  1MBF A;  2JZY A;  3ZQL A;  1J7K A;  2FA5 A;  5LEJ A;  5IOY A;  5KNL A;  2DTZ A;  3LSJ A;  3P9C A;  4MEY F;  3BG6 A;  1LEB A;  3ZXS A;  3IRQ A;  4M71 A;  1IO2 A;  2IBD A;  3EUK L;  3VEP A;  3VYT B;  4ETS A;  4YEJ A;  2DFF A;  1VQK I;  3EYY A;  1YS7 A;  3RSN A;  3LSH A;  4CHU A;  4MQ9 F;  2ZCW A;  4JX5 A;  3K70 D;  1STZ A;  1VTN C;  1MMS A;  3ABT A;  2HPI A;  4FQG A;  2LP0 A;  5IP7 J;  1H88 C;  3PIP F;  1G3Y A;  4CSW A;  5HLT A;  5BPI A;  2L4A A;  4HNU A;  4JBA A;  1GXQ A;  4BQO A;  3V4G A;  3TDU C;  1X58 A;  3K1M A;  4CCN A;  5HS8 A;  4Q5S F;  2OZ6 A;  3TP0 A;  2DPD A;  2ISY A;  3OYK A;  4NHJ A;  5CVJ A;  4IHW A;  2JA8 J;  4JP0 A;  3K4J A;  3I56 I;  3A2K A;  1HKS A;  3K6G A;  4A3J J;  2WAQ A;  3IV5 A;  2YX7 A;  1IV8 A;  2LY9 A;  3K4B A;  2OTJ I;  2EIL H;  5H6R A;  1FYM A;  1BW6 A;  4BXX J;  2A5Y B;  1T95 A;  1S7A A;  2FNA A;  2DK8 A;  4NNJ A;  2XGE A;  1P9Q C;  3ABK H;  2HGC A;  4PUS A;  2VBZ A;  3C18 A;  5GPA A;  5B66 C;  1XMK A;  3DPT A;  4CYD A;  4UVA A;  4EJW A;  5K7H A;  3OOP A;  3D5S C;  4A2U A;  5J47 A;  5H6Q A;  2A61 A;  3AG2 H;  5LGU A;  1ETY A;  2ZXH A;  1J2X A;  2BY0 A;  2JN6 A;  1PUF A;  5GAD J;  1ZRF A;  3WGI A;  4LB6 B;  1ZRC A;  1GV2 A;  4XL9 A;  3KP2 A;  1Z3Y A;  3AKZ A;  5GAE J;  2EFQ A;  1R5G A;  3BQY A;  3VOD A;  5E3N A;  1RR8 C;  3GCM A;  4RMN A;  1ZR4 A;  3MD2 A;  1FX7 A;  2ZJQ F;  1YX3 A;  2JUC A;  3E5U A;  1O3Q A;  1RUN A;  3KET A;  4ASN A;  2WB1 A;  1EH8 A;  2IA0 A;  1ETO A;  3DTK A;  1KZH A;  3JRB A;  4RAZ A;  5GTI C;  4AC0 A;  2LKX A;  2CW8 A;  3PSI A;  2JT1 A;  3VSL A;  4YFX F;  5E1X A;  2CS3 A;  2DK5 A;  1FIA A;  1TW3 A;  4EGZ A;  2QWW A;  2QYO A;  2M3A A;  1I6H J;  4QTR A;  2XIG A;  3FM3 A;  3QYF A;  3TP3 A;  1FOW A;  1MIJ A;  4EM1 A;  4XLN F;  3S32 A;  1PP7 U;  1FOK A;  1TZL A;  1P92 A;  2V1X A;  2IEK A;  1JUP A;  3FXR A;  1SD4 A;  3WU0 A;  2ZO4 A;  5BPD A;  1W5S A;  2JSP A;  1G3T A;  2QVO A;  3D0S A;  5D6F A;  3J80 Z;  4UUS A;  3RZD J;  4MO7 A;  5BQT A;  2F5F A;  2PJP A;  2L7M P;  9ANT A;  4II3 A;  3IRR A;  2ZXW H;  3KFW X;  2GA1 A;  3D5R C;  4LIT A;  1Y39 A;  1XG1 A;  1OCT C;  3GX4 X;  1YQA A;  2Q0O A;  3W3C A;  3PO2 J;  2ELJ A;  3KIO A;  1V5E A;  4U7D A;  2IGM A;  2X85 A;  3E5Q A;  4NC6 A;  1X3Z B;  1XSV A;  2WC2 A;  2XGC A;  4LK0 F;  2Q8K A;  3L2R A;  1H89 C;  3R61 A;  3CF5 F;  2MAB A;  3L1P A;  2X1D A;  4RB3 C;  2E2H J;  5FFX A;  3K4K A;  1BI2 A;  4HF0 A;  2DXI A;  1YS6 A;  4BY1 J;  1NK2 P;  5FFZ A;  1QBJ A;  4KMF A;  2NVY J;  3I5U A;  4CCL A;  3SZP A;  1HSJ A;  5IOZ A;  2KFD A;  2BY3 A;  2AS5 F;  3CCR I;  1RET A;  1V4R A;  4GO1 A;  3LST A;  2KDZ A;  3CCV I;  1RC9 A;  5H20 A;  4JK1 X;  3MKZ A;  5KK1 A;  4Y17 A;  4BH9 A;  4D7N A;  1YTY A;  4HDU A;  2HOT A;  4L9V A;  2QQ8 A;  3C3W A;  2P6S A;  2XAJ A;  1HDD C;  3ZPL A;  4M9X A;  2W82 A;  1FMV A;  1YI2 I;  1MSE C;  4CZZ A;  2P6T A;  1UHM A;  2V6E A;  4AM3 A;  2W24 A;  5CVR A;  2DMT A;  1UG0 A;  2VJ4 A;  3G1O A;  2XAQ A;  2XV4 S;  1YG2 A;  2VQC A;  4U87 A;  1F1Z A;  2KIQ A;  3CTA A;  5HNF A;  2PLY A;  4AYB N;  4KMU X;  4CZC A;  3DPL C;  3OWT A;  1ZLJ A;  2PMU A;  4AIJ A;  4G8X A;  1FC3 A;  2LG4 A;  3ZQF A;  1JKO C;  4M6X A;  4UXN A;  4IRI A;  6PAX A;  4K2E A;  4BJT A;  2O61 A;  5D5V B;  1XC5 A;  4IF4 A;  1OQY A;  4BY7 J;  1R1V A;  2FNP A;  5B5E C;  2LKS A;  4P5O A;  4D1Q A;  2PMZ A;  4JX6 A;  2X0L A;  3I64 A;  1PUE E;  1RPW A;  5F1J A;  3RPU A;  3GTG J;  2K4B A;  1LVA A;  2I5U A;  5KCM A;  2F4O B;  2L5Q A;  3G2B A;  3I59 A;  3TKY A;  2KLO A;  2Y0S A;  4E7H A;  4XBF A;  3ASO H;  4IXA A;  2JRT A;  1AA7 A;  2DLL A;  3FK6 A;  2STT A;  2KT0 A;  4N0B A;  2ZSH B;  2JPC A;  2R7R A;  2LK2 A;  5E1Z B;  1Z6R A;  4IEJ A;  1VQM I;  2NVT J;  3DLL F;  2TRT A;  5DD4 A;  4OIR F;  3BLY A;  4FT8 A;  4XKB A;  1ORK A;  1W7P A;  1KQ9 A;  1JT0 A;  4WCG A;  5M3M J;  2QQ9 A;  4X6A J;  3CMY A;  4G6D A;  1PVE A;  2HU9 A;  1KA8 A;  4BNC A;  3A4C A;  4ITV A;  2R7T A;  1VND A;  2ELK A;  3DKX A;  2K9L A;  3CF2 A;  4CCM A;  4HX7 A;  2X6X A;  2BYV E;  2ZJP F;  4A3D J;  1FOY A;  3BG9 A;  3FKI J;  2DT6 A;  3BG5 A;  3R6S A;  1MW7 A;  2L7K A;  1RR7 A;  1PJR A;  4RB0 A;  1ZRE A;  1ODD A;  4NQW B;  4Y3O A;  5F6F A;  3I58 A;  1OYW A;  4O5V A;  1P4W A;  2K27 A;  1OMI A;  4XKW A;  3TMO A;  1DUX C;  4F52 A;  4M6Y A;  3FHZ A;  2F5C A;  1XTA A;  1LKX A;  1RI7 A;  3H92 A;  3FBI B;  2JA2 A;  3AG3 H;  2V9K A;  2WA0 A;  3OYC A;  2W57 A;  1VQ5 I;  4RB2 C;  3SDG A;  3ZQ7 A;  2CSO A;  3PUB A;  1SMT A;  3RJP A;  1UB9 A;  1DU6 A;  2R7U A;  1EF4 A;  3KX2 A;  1QPM A;  3U9G A;  3GBG A;  3QQA A;  3CP8 A;  4KIB A;  1QVT A;  1EKE A;  3G6E I;  3BT9 A;  3ROU A;  3OYA A;  3C7J A;  1XX5 A;  2P5V A;  1QNT A;  3EUH A;  3IL2 A;  4BBS J;  3GF2 A;  3Q9S A;  4DYC A;  2C6Y A;  1O3R A;  3KYL A;  1TQM A;  3S93 A;  2A07 F;  1WH5 A;  3HBL A;  4GCV A;  3LSI A;  1A35 A;  4QWQ A;  3DKY A;  4LLL A;  5JR3 A;  2K5C A;  4KIG A;  1O3S A;  3OR2 C;  2QEX I;  2HQN A;  5EYR A;  3TO9 A;  4HBL A;  3PL8 A;  2AQE A;  3LWF A;  3CC4 I;  1BL0 A;  3OV8 A;  1GXP A;  2MW8 A;  2ZNY A;  2FX0 A;  3OYI A;  2JVH A;  3TL4 X;  2RC4 A;  1KU2 A;  4NUB A;  1UZC A;  1AKH B;  2ELH A;  2GQQ A;  3F21 A;  1ZLK A;  2IJL A;  2V79 A;  2GIV A;  3OYD A;  5FLV A;  4P96 A;  5E18 F;  3T8R A;  1ZG1 A;  4HRI A;  3KPH A;  3PJR A;  2AHQ A;  2EA4 A;  2H1K A;  2HQR A;  2IW5 A;  2HQ5 A;  4YRV A;  1ZTR A;  4ZZL A;  1K6O A;  5IP6 A;  1ZKG A;  4FTH A;  1E2X A;  2XHK A;  3H0D A;  3CJT B;  3K1P A;  3KP6 A;  1MJ9 A;  2GM4 A;  1T33 A;  4E4H A;  1IRX A;  2XAU A;  3S1Q J;  1BI0 A;  3WHB A;  3OYJ A;  4AYB A;  1Z91 A;  4I02 A;  3SHF A;  3F8N A;  3KZZ A;  4XQF A;  3KP5 A;  4A3M J;  3GTM J;  1ZYR F;  3CCQ I;  2PX9 A;  1Q1V A;  1U0J A;  2HVR A;  2CH0 A;  2CFX A;  1Z3X A;  2LF7 A;  1D3Y A;  2J5P A;  4X0G A;  3TW6 A;  4GXO A;  1K61 A;  3ERE D;  2WTE A;  3FMS A;  3T5X A;  2WAE A;  1FY7 A;  4UUS B;  2R7V A;  4UVC A;  1IF1 A;  1R1T A;  3L7W A;  5L3B A;  2XPW A;  1Y0U A;  3ZCO A;  4A93 J;  1DGR M;  3V42 A;  4HLY A;  4OMZ A;  5HOO A;  3LAP A;  3B6C A;  4M6V A;  5KVR A;  1JI8 A;  1ITY A;  2K9N A;  5DUI A;  3A01 A;  2DA2 A;  3S14 J;  1PDN C;  2HVQ A;  2EB7 A;  1SD7 A;  1A6Q A;  5JLX A;  3CJR B;  5L3E A;  2HVS A;  3ZQG A;  2YX4 A;  4AUX A;  2DW4 A;  2M7A A;  2X4H A;  1JTX A;  2FSW A;  1A31 A;  1SC7 A;  1A5J A;  3M3Y J;  3X2Q H;  1K78 A;  3WTW C;  3MEX A;  1UHW A;  1S72 I;  1GV5 A;  4A3G J;  3V7S A;  1UFM A; 
#chains in the Genus database with same CATH homology
 2HOA A;  2X9D A;  2O8K A;  2B63 J;  2CUE A;  5GPC A;  2CRG A;  1SAN A;  1WI3 A;  4XRM A;  4FE7 A;  2OF7 A;  1MBF A;  1F43 A;  3ZQL A;  1W0U A;  3S1R J;  5IOY A;  2DA5 A;  2DTZ A;  3LSJ A;  2QF7 A;  1IRZ A;  4C3I J;  2IBD A;  2ID3 A;  2E1O A;  1MSF C;  3HDD A;  2XPV A;  3O8G A;  2WAQ N;  5F08 A;  2XB0 X;  5J1R A;  1ZK8 A;  3HOU J;  2XRL A;  2N8G A;  3IH3 A;  1LE8 B;  4JX5 A;  4XRS G;  3BR6 A;  1UMQ A;  4M3F A;  4G12 A;  1BA5 A;  3O8H A;  2EZK A;  2LP0 A;  5M5Y J;  5IP7 J;  1ENH A;  1H88 C;  2VUM J;  4B1R A;  2ME6 A;  1ETW A;  3FIS A;  2XPU A;  4A3E J;  2R0Q C;  3GTJ J;  4Y52 J;  1OCP A;  1MBG A;  3ZQH A;  1PUF B;  1WH7 A;  1X58 A;  2NS8 A;  3TP0 A;  4IHW A;  1BW5 A;  5C44 J;  2JA8 J;  4JP0 A;  5C4X J;  4A3J J;  3IV5 A;  4NDL A;  2ID6 A;  2DA1 A;  2LY9 A;  1ZGW A;  1SFO J;  4RBO A;  1BW6 A;  4BXX J;  3LNQ A;  2K9Q A;  3E7L A;  2NVX J;  1IG7 A;  2NOG A;  1I50 J;  2XGE A;  3CCY A;  3BTC A;  2IAI A;  3BR2 A;  1D5Y A;  2MG4 A;  3JRG A;  4W97 A;  1UG2 A;  1IJW C;  2EZH A;  3H0G J;  2M8G X;  5GPA A;  2GLO A;  2FJ1 A;  2WB1 N;  4I6Z A;  4DZP A;  3LOC A;  4B3A A;  5K7H A;  2XGD A;  3HGY A;  5EF6 A;  2DA7 A;  1U78 A;  2XSD C;  2L0K A;  1ETY A;  1RES A;  1U9O A;  5EG0 B;  3B6A A;  1IGN A;  2JN6 A;  1PUF A;  4ABZ A;  2O9L A;  1JKP C;  1GV2 A;  3S15 J;  1YRN A;  2R92 J;  2OPT A;  2M9H A;  3BQY A;  1U9N A;  5E3N A;  3C2B A;  3BTJ A;  4B4C A;  1ZR4 A;  4A3B J;  2QCO A;  1W0T A;  1NK3 P;  4FE4 A;  5C4J J;  2Y9Z A;  4MFE A;  4GFB A;  4M3G A;  1B8I A;  2JA5 J;  2Y31 A;  4CYC B;  1MH3 A;  1RKW A;  1ETO A;  1JJ6 C;  5FKL A;  4QIW N;  3F0C A;  3JRC A;  1FJL A;  3BR5 A;  3JRB A;  2R7Z J;  2CQQ A;  3BR0 A;  4D5C A;  4AC0 A;  2LKX A;  5K7Z A;  3G1L A;  2VPR A;  1LFU P;  3GTP J;  2FQ4 A;  3A02 A;  2L9R A;  2JA7 J;  1ETK A;  2X48 A;  5M5X J;  5JLW A;  4J19 A;  1TWG J;  4A3F J;  5EG0 A;  1FIA A;  3FK7 A;  1I6H J;  5E3L A;  4QTR A;  5J1U A;  3HEF A;  1MBE A;  3QPL A;  3TP3 A;  4A3I J;  1AU7 A;  2GBY A;  2R93 J;  1X2N A;  2IEK A;  1JUP A;  2X6O A;  4V2G A;  3OIO A;  4BBR J;  2LVS A;  5DS9 A;  1ETV A;  5IYC J;  1NTC A;  2K9S A;  1OJL A;  4CYC A;  4UUS A;  3RZD J;  5M3F J;  3I4M J;  4MO7 A;  1OFC X;  2ECB A;  4D7M A;  2L7M P;  3S1N J;  1QVU A;  1MH4 A;  2Y30 A;  3OSF A;  9ANT A;  1U8B A;  1XG1 A;  1OCT C;  1VI0 A;  3S1M J;  1G2H A;  4FIS A;  4C3H J;  1IC8 A;  3PO2 J;  5F0F A;  5IP9 J;  3WHC A;  1IDY A;  1GT0 C;  4W1U A;  4C2M J;  5E3M A;  3TED A;  2XGC A;  1H89 C;  5IYD J;  3JRA A;  3L1P A;  2E2H J;  1B72 A;  2R5Y A;  3HOV J;  1X2M A;  3GTQ J;  3ZQI A;  4BY1 J;  1NK2 P;  3S2H J;  3D1N I;  2NVY J;  3H3V K;  2W48 A;  3HOY J;  1Y1V J;  3K2A A;  5IOZ A;  2DA4 A;  2DMQ A;  1RET A;  2KDZ A;  3HB9 A;  1P7J A;  1T56 A;  2O7O A;  3OOU A;  1MBJ A;  2EZI A;  5EDN A;  4D7N A;  2ECC A;  2RAE A;  2HOT A;  1LE8 A;  2R5Z B;  5F0C A;  4DYQ A;  4M3D A;  2HXI A;  1HDD C;  4QSH A;  2DMP A;  1MSE C;  1FTT A;  3RZO J;  2DMT A;  3ZQC A;  3GTO J;  4LOC A;  4D5F A;  2PMZ N;  1MBK A;  3G1O A;  4IHX A;  2D5V A;  3OSG A;  3RQI A;  3I4N J;  2EBI A;  4DYR A;  4IHV A;  4AYB N;  1Z77 A;  1P7I A;  2CJJ A;  5F04 A;  3DEW A;  2NS7 A;  2Y0S N;  5F27 A;  3TW7 A;  3ZQF A;  1JKO C;  2TCT A;  2LFB A;  1POG A;  1A6I A;  3DCF A;  5FJ8 J;  2JJ7 A;  1XC5 A;  5FKM A;  5F0H A;  1TC3 C;  5M5W J;  4BY7 J;  4A69 C;  2YUS A;  3IH2 A;  3ZOB A;  3Q3S A;  1AHD P;  1XS9 A;  2M2E A;  5IYB J;  2R5Z A;  4JX6 A;  2COB A;  2DMN A;  2E2J J;  1RPW A;  4M3E A;  5F1J A;  3GTG J;  2VKE A;  1GUU A;  4V2F A;  2LLK A;  1Y1W J;  2WV1 A;  2ME0 A;  3BTI A;  4EEF G;  4UUT A;  1WGX A;  1RKT A;  2M0C A;  1JT6 A;  3FK6 A;  3FIW A;  3HGG A;  2LTP A;  3VPR A;  4RDU A;  2KT0 A;  5DTD A;  2YS9 A;  3CQZ J;  2LK2 A;  2LR8 A;  2HOS A;  4IEJ A;  5FKK A;  3HM5 A;  2NVT J;  2TRT A;  3PM1 A;  4DW6 A;  1BJZ A;  1HCR A;  2EZL A;  1ORK A;  1HF0 A;  3MVP A;  1JT0 A;  4M3B A;  1IDZ A;  4DZJ A;  2E2I J;  5M3M J;  3UKG A;  4X6A J;  3CMY A;  5FKO A;  4C3J J;  4MFD A;  1FEX A;  1VND A;  2ELK A;  3HKZ N;  2MSY A;  2CU7 A;  4XRS A;  2YU9 J;  4A3D J;  3BG9 A;  3FKI J;  3BG5 A;  2NVQ J;  3HOW J;  1RR7 A;  3HOZ J;  2M34 A;  2DA3 A;  5E3O A;  2E19 A;  1JUM A;  1IUF A;  3IH4 A;  2P81 A;  1GVD A;  3Q0W A;  2HI3 A;  2DJN A;  5FKN A;  4JX4 A;  4XK4 A;  1ETQ A;  3SDG A;  1QRY A;  4I76 A;  2HDD A;  1DU6 A;  1FIP A;  1O4X A;  1EF4 A;  4A3L J;  3A03 A;  1HLV A;  3GBG A;  2HXO A;  3QQA A;  3JRE A;  1QVT A;  2JK3 A;  2CQX A;  3BT9 A;  5EZH A;  5EGO B;  1S7E A;  1TWF J;  4BBS J;  1UHS A;  2I10 A;  4Y7N J;  5IPA A;  5GP9 A;  1IV6 A;  1JJ8 C;  4DYC A;  4A3C J;  3LSG A;  5J1Y A;  3S17 J;  3JRH A;  2DMU A;  2L7Z A;  1I3Q J;  1MBH A;  1F36 A;  4A3K J;  1WH5 A;  3HBL A;  4S0H B;  1YRN B;  3BTL A;  1JKR C;  3PO3 J;  3CDL A;  1TWC J;  2LD5 A;  3MKL A;  5EYR A;  3JRI A;  3JRF A;  1BL0 A;  2DN0 A;  3BR3 A;  3MN2 A;  3QPS A;  2MW8 A;  5K7F A;  2FX0 A;  2Y2Z A;  3NAU A;  1AKH B;  1DU0 A;  3BR1 A;  2AO9 A;  1B8I B;  5EZG A;  2H8R A;  3S16 J;  5EEA A;  1HDP A;  3W6V A;  4MIM A;  5FLV A;  3SJM A;  1CQT A;  2K40 A;  1WCM J;  5EGO A;  1ZQ3 P;  5FLM J;  2AHQ A;  3NAR A;  2DA6 A;  2H1K A;  1HOM A;  2HQ5 A;  3Q0V A;  3A01 B;  2VKV A;  1ZTR A;  5BNG A;  2L7F P;  5IP6 A;  3G1M A;  1ZKG A;  4MLO A;  4FTH A;  1APL C;  2JA6 J;  3JR9 A;  2GM4 A;  2VI6 A;  1K83 J;  1JGG A;  1T33 A;  2EH3 A;  4BKX A;  1GDT A;  3S1Q J;  2CUF A;  4JYK A;  1ZR2 A;  3WHB A;  3BG3 A;  4A3M J;  2G0E A;  4HNV A;  4X1E A;  3LSP A;  3GTM J;  1Q1V A;  1QPI A;  2JWT A;  3SFI A;  4XIC A;  3TW6 A;  1AKH A;  1MNM C;  1K61 A;  5HOD A;  3JRD A;  3GTL J;  4FCY A;  4UUS B;  2XB5 A;  3M4O J;  2FD5 A;  3BQZ A;  3S2D J;  5J3L A;  3HOX J;  2XPW A;  4A93 J;  4L5E A;  3GTK J;  1JKQ C;  3Q0U A;  3B6C A;  4M6V A;  1JTY A;  3K7A J;  2MGQ A;  2K9N A;  1ITY A;  3A01 A;  2DA2 A;  3S14 J;  1TWH J;  2Y9Y A;  2HYJ A;  1R9T J;  1LFB A;  1FTZ A;  1TWA J;  5JLX A;  1JUS A;  3ZQG A;  4AUX A;  1WPK A;  4XID A;  5C3E J;  3LSR A;  1VFC A;  1JTX A;  1A5J A;  4IHY A;  3M3Y J;  2EQR A;  2ZB9 A;  1H8A C;  2JMW A;  3RKQ A;  1ETX A;  1B72 B;  2R5Y B;  1GV5 A;  1E3O C;  1VF9 A;  4A3G J;  1Z0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...