1PUFB

Crystal structure of hoxa9 and pbx1 homeodomains bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
ARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*AP*CP*GP*
publication title STRUCTURE OF HOXA9 AND PBX1 BOUND TO DNA: HOX HEXAPEPTIDE AND DNA RECOGNITION ANTERIOR TO POSTERIOR
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1pufB00
2K9SA 1ETKA 1TWFJ 5E3NA 1VI0A 1IUFA 1D5YA 4HNVA 2IEKA 5JLWA 1B72A 2GLOA 1AKHA 1IG7A 2DMUA 3GBGA 4Y7NJ 2LR8A 1BJZA 2DA1A 2NVYJ 2X9DA 2KDZA 3S1NJ 1ITYA 5F0CA 4C3HJ 1K61A 1RPWA 1JKPC 4XRSA 1JJ8C 3BR0A 2R0QC 5EDNA 1W0UA 1I3QJ 2L0KA 4MLOA 4DYCA 1HCRA 5F08A 3ZQIA 1JUMA 1QVUA 3VPRA 4M6VA 4A3KJ 4MFDA 4A3FJ 3K7AJ 5E3LA 4D5FA 3S14J 5F27A 2EQRA 2M8GX 3IH2A 3JRBA 4QSHA 5EGOA 2E1OA 3FISA 1VFCA 1ETXA 1U9NA 2FD5A 1FIAA 1A6IA 2DA3A 2IAIA 3HGGA 3K2AA 3PO2J 3CQZJ 5EG0B 3JRFA 3JRAA 2QF7A 4JYKA 1B8IA 3Q0VA 4DYQA 5C4XJ 2L7ZA 3HB9A 1MH4A 1MH3A 2VUMJ 2O7OA 5DS9A 3HKZN 2LK2A 2JMWA 1IDZA 1DU0A 1X2MA 1BL0A 1MSFC 4A3GJ 2YS9A 1BW6A 3QPSA 2AO9A 2XB0X 2CUEA 1HLVA 2NS7A 1LFUP 2M0CA 3OOUA 5E3OA 4J19A 2OF7A 3MN2A 2JA8J 2KT0A 1MBJA 2YUSA 4EEFG 3BR5A 2XSDC 2O9LA 2CQQA 3M3YJ 2VI6A 1SFOJ 5HODA 1AU7A 4LOCA 2WB1N 1UMQA 5EZGA 1P7JA 1R9TJ 5GP9A 1I50J 3TW7A 1I6HJ 2EH3A 2MW8A 4I6ZA 2DA5A 4NDLA 1ZR2A 4XK4A 1JT0A 1IRZA 2B63J 3I4MJ 5J1YA 4AUXA 1JUPA 1Z77A 2MGQA 3CCYA 1HDDC 3B6AA 3JRDA 2K9NA 5K7HA 5FJ8J 4D5CA 4A3JJ 3S1MJ 2VKVA 3S2HJ 1ETWA 3FK7A 3HEFA 4DW6A 1Q1VA 2X48A 3GTQJ 1GUUA 3GTLJ 1NK2P 2LLKA 1JTYA 4FCYA 3O8HA 2Y2ZA 1H88C 4BBRJ 3A02A 1OFCX 2JA7J 3MKLA 4D7NA 2XGEA 2W48A 1NTCA 1P7IA 1MNMC 2E2HJ 4M3DA 3BTIA 3BQZA 2DN0A 4MFEA 1ETYA 2M34A 4W1UA 2H8RA 4D7MA 3W6VA 1QVTA 1W0TA 4AYBN 4B1RA 3NARA 4JX6A 1TWGJ 1Y1VJ 2XGDA 3TP0A 5IP6A 1CQTA 1GDTA 2DTZA 2DA7A 2Y31A 5C44J 4L5EA 2ELKA 2DA2A 2JN6A 4UUTA 3D1NI 2HXOA 3BR2A 1Z0XA 3H3VK 1MBEA 3ZOBA 3GTKJ 3SJMA 1SANA 1ETVA 4A3EJ 2XPVA 3HOZJ 3OSFA 2G0EA 1MSEC 1XC5A 3MVPA 1RKWA 3BG5A 1FEXA 2Y9ZA 1HOMA 3DCFA 3GTPJ 5C4JJ 3FKIJ 2IBDA 1MBGA 2WV1A 3TEDA 5IPAA 3JRIA 2PMZN 2NVQJ 3GTGJ 4G12A 5EG0A 1RESA 2E2JJ 4XICA 2LD5A 3FIWA 3FK6A 3PM1A 4IHYA 2FX0A 4C3JJ 5GPCA 1YRNA 5IYCJ 4DZJA 5EEAA 2JWTA 1JTXA 3BR3A 3A01A 1IDYA 1LE8B 2Y0SN 2Y9YA 2MG4A 2WAQN 1IC8A 2R5ZA 3HOUJ 1AHDP 1A5JA 1TC3C 2GBYA 2CUFA 2X6OA 3RZOJ 1YRNB 2DJNA 4C2MJ 4BY1J 3OIOA 1QRYA 5IYBJ 5M3FJ 2Y30A 3A01B 3A03A 5FKKA 1U9OA 2R5ZB 2HOSA 3ZQLA 2DMQA 1WPKA 4DZPA 5IOYA 1OCPA 2EZIA 3BR6A 5K7FA 2P81A 4BBSJ 4IEJA 1UHSA 4X1EA 2HOTA 1GVDA 2EZKA 5J3LA 3LSPA 3RKQA 3WHBA 1ZTRA 3M4OJ 1POGA 2QCOA 5J1RA 1ZQ3P 5IP9J 2CJJA 4A3DJ 4IHWA 1RR7A 1PUFB 1O4XA 1BA5A 1S7EA 2DA6A 3G1LA 4JP0A 2HYJA 1APLC 1FTTA 1WI3A 5J1UA 4M3EA 1WCMJ 1GV5A 1XS9A 2LKXA 4QIWN 2AHQA 2E19A 3CDLA 3QQAA 2JA6J 3RQIA 5F04A 5EZHA 4A3BJ 3WHCA 2R5YA 3S1QJ 2XRLA 2LVSA 3L1PA 1LFBA 3HOVJ 3JRHA 2ECBA 2VPRA 1IV6A 2R5YB 2NOGA 2ECCA 4BY7J 5FKLA 3B6CA 5BNGA 2EZHA 4FE7A 3GTJJ 2EBIA 5E3MA 9ANTA 4RBOA 4IHXA 2RAEA 1F43A 5M5YJ 2M2EA 4W97A 3OSGA 3RZDJ 3HM5A 3HOWJ 2N8GA 2VKEA 3S17J 5FKOA 4A93J 2JJ7A 2MSYA 5FKMA 3LOCA 3I4NJ 2YU9J 3NAUA 3TW6A 4C3IJ 5FLMJ 2LP0A 2FQ4A 4UUSB 5M5WJ 5IYDJ 3LSGA 1JKOC 1G2HA 1TWHJ 5F0HA 4MIMA 2NVTJ 2JK3A 1MBFA 4A69C 5C3EJ 5IOZA 2K9QA 4FE4A 2R93J 1Y1WJ 1TWCJ 1B72B 1H89C 1AKHB 4CYCA 1ORKA 1VNDA 3F0CA 2K40A 5EYRA 2HOAA 3HOXJ 3ZQCA 2O8KA 5GPAA 4A3LJ 4CYCB 5EF6A 1RETA 4XIDA 2DA4A 1WH5A 1MBHA 3GTMJ 4M3FA 3JRCA 1ETQA 1LE8A 1F36A 1ZK8A 5FLVA 2R92J 1DU6A 3HOYJ 1U8BA 1ZKGA 4JX5A 2HI3A 3BR1A 2COBA 4GFBA 5F0FA 3JREA 1E3OC 2OPTA 2JA5J 4RDUA 2ID6A 3ZQFA 3UKGA 2CU7A 3GTOJ 2I10A 2DMNA 2TCTA 2CQXA 3TP3A 2HDDA 2LTPA 3ZQHA 3HDDA 4X6AJ 4Y52J 4M3GA 1H8AC 1FJLA 2L7MP 2H1KA 1X2NA 3DEWA 1ZR4A 1IJWC 5EGOB 1HF0A 2LY9A 2L7FP 5FKNA 3ZQGA 2ME6A 4XRSG 2EZLA 2XGCA 2XPWA 1TWAJ 1UG2A 3BTJA 3QPLA 1EF4A 4A3CJ 4B4CA 2E2IJ 1T56A 1OJLA 1X58A 4BKXA 1PUFA 1GV2A 3BG3A 2DMPA 4S0HB 5F1JA 4DYRA 1B8IB 1BW5A 2CRGA 3SDGA 1NK3P 1JUSA 3S16J 3HGYA 2FJ1A 5M5XJ 5IP7J 3LSRA 1U78A 2M9HA 1ENHA 4BXXJ 1JKQC 3IH4A 2ZB9A 3LSJA 4I76A 3Q3SA 4V2GA 1QPIA 4V2FA 3CMYA 4FTHA 2NVXJ 3SFIA 2GM4A 1HDPA 1ZGWA 1FTZA 3S1RJ 3C2BA 4FISA 4M3BA 2ME0A 3S15J 4IHVA 1VF9A 3IV5A 2TRTA 3G1OA 3HBLA 5DTDA 3JR9A 3S2DJ 3H0GJ 2ID3A 2HXIA 5M3MJ 1XG1A 1JJ6C 4A3IJ 3BQYA 1JT6A 3Q0UA 3O8GA 1JKRC 1K83J 1IGNA 3BG9A 2HQ5A 3BT9A 1ETOA 5JLXA 1WGXA 1GT0C 2XPUA 3LNQA 2D5VA 1T33A 2NS8A 4QTRA 4XRMA 3BTLA 4ABZA 2L9RA 2DMTA 4MO7A 2XB5A 4A3MJ 3G1MA 3JRGA 4JX4A 1RKTA 3E7LA 3PO3J 4UUSA 3BTCA 5K7ZA 1OCTC 1JGGA 2R7ZJ 1WH7A 4B3AA 1MBKA 2LFBA 3IH3A 3Q0WA 4AC0A 1FIPA
chains in the Genus database with same CATH superfamily
1ETKA 1OYIA 5E3NA 1MNDA 1VI0A 1IUFA 1D5YA 4ENMA 2HZTA 5LLQA 1FYLA 3L2CA 2IA1A 3KE2A 5J4VA 2DMUA 4IPAA 4XLPF 4ZDOA 3CO6C 2O3FA 3SZGA 1YW8A 3KP3A 3V8JA 2EILH 4ZZLA 5DM6F 1EJ9A 4BL0B 1G3SA 1ITYA 1W7PA 1K61A 1ZRDA 3SYTA 5BPIA 3DBRB 4G94A 3ZN1A 4OIQF 5KVRA 2I5UA 3BR0A 4MQ9F 5EDNA 2CFOA 1W0UA 2ETHA 2HTJA 5FD5A 1HQCA 4OIRF 2JPCA 3AL0B 1FOKA 1I3QJ 2JT1A 2L0KA 1OISA 4MLOA 4IQ4A 4P5OA 5H6QA 1YYVA 3L2WA 3DKWA 3ZQQA 2MD5A 3ZQIA 3C1DA 3R6SA 3N4MA 1LEBA 1FYMA 1EKEA 3E5UA 3SQNA 3MKYB 4MFDA 1SMTA 1AWCA 1XD7A 4E6KG 2QQ8A 4P9FA 3FDYA 1K4TA 1O3QA 2LBFA 3S14J 5F27A 1QZYA 2JRTA 2HVRA 2EQRA 4XRFA 2M8GX 3IH2A 3JRBA 4QSHA 4HRIA 2W82A 1VFCA 3KYCB 4BEHA 1SD6A 1U9NA 2KISA 1Y56A 3LSIA 2E7WA 2OQRA 3DPLC 1A04A 4CGZA 1P4WA 2BY0A 4MGRA 4XLHA 3MZHA 2YX4A 2EV6A 5C4XJ 2L7ZA 5ILVA 4UUVA 4IRGA 1UB9A 2PG4A 4LGWA 1Z7LA 4XSZF 3JTGA 2JMWA 2HQAA 5B66C 1UCRA 4XLFA 2YS9A 4HLXA 4XN3A 2CWEA 4LG0A 2NS7A 2V6CA 3K1NA 3P9CA 3D5LA 2XAHA 5E3OA 2L7KA 1P2FA 2CFXA 2YUSA 1LEAA 2VXDA 5HLGA 1BI1A 3JSPA 3DF8A 1V3FA 3HL2A 2QENA 1F1ZA 5CVJA 2XVCA 2WB1N 2VC1A 3QYFA 5EZGA 3WTUC 4UVAA 2HOEA 4V19K 3TW7A 4DJAA 4WWCA 1O3SA 4ZYAA 1X4OA 3KEYA 1O3RA 2EH3A 2HEOA 5HNHA 4NDLA 3IWZA 1UHMA 3HXLA 1Z77A 1F9NA 2PJRB 1LB2A 3NWSA 3RKYA 2P0WA 5K7HA 3GFJA 1Y0UA 5CVUA 3P5JA 4D5CA 5TISC 2QLZA 4YFXF 3S2HJ 2H6BA 2FSWA 4GGGA 1BR2A 4NBQA 1Q1VA 2X48A 4LB5A 4ZZDA 2DJIA 3CMMA 3VYTB 5KK1A 2BYVE 1KU9A 2Y2ZA 4HYEA 1TT0A 1TLHB 2WBMA 3RPUA 5LHGA 1Z05A 2FU4A 4D7NA 3L2VA 1OKRA 1IN7A 2E5NA 5D8LB 3CP2A 4LLGF 2CUJA 1YJWI 5F1RA 4BJ6C 2ZJ2A 1SFXA 3WG7H 4EJOA 4CSWA 4EV0A 4A12A 4D7MA 5D6FA 4ESJA 3WE3A 1QVTA 1W0TA 2XAJA 5ICCA 1HKSA 1I39A 2KQRA 1JE8A 5CYVA 1TWGJ 1Y1VJ 3TP0A 1S7OA 2DTZA 1P9QC 2EPFA 3ISPA 3F3XA 3D1NI 2ADUA 1QO0D 5KNLA 3I71A 3GTKJ 5L3CA 1WJCA 2CGPA 1XDSA 1V5FA 2HWVA 4P1WA 1Q1HA 3K4CA 3AG1H 1RR8C 2OU2A 3MVPA 3F6OA 2F2EA 3BG5A 2DBBA 4CZCA 2M4KA 3DCFA 2DDAA 4BACA 3SHFA 1MBGA 1U5TB 2RN7A 3CF2A 2KHMA 1WZ2A 2UZKA 2FBHA 1RESA 4PJNA 4KITB 2DT5A 3FIWA 4A0ZA 5D6EA 3UR3C 3FK6A 4MTEA 3FHZA 2K4JA 2RKHA 2QEXI 3GZNB 2FX0A 1MNEA 4C3JJ 2VOOA 4RLQA 2VOPA 4ESBA 4IRIA 1YRNA 1IV8A 2IA2A 4XONA 1JTXA 4BS9A 3A01A 1IDYA 2UV1A 3HOUJ 3K4BA 2DJNA 4C2MJ 4BY1J 5DM7F 3LSHA 4HW0A 2FQ3A 5CQGA 4RM2A 5DCMA 1JXSA 1H9TA 4BHPA 2H1LA 2E5ZA 5CVRA 4EATA 5FRNA 5J8FA 3VEPA 3AKZA 3MFKA 1FNNA 1R5HA 1OCPA 1MJ9A 1WWXA 1O3TA 3W3CA 3TDZC 3S3MA 2EZIA 3TGNA 2PI0A 2CYYA 2KIUA 1ODDA 2BVMA 2EIKH 3CESA 3L7WA 4IO9F 3AG4H 4BBSJ 4H4KC 5LGTA 4L0ZB 4X1EA 4IX7A 2DK5A 1VQ4I 4DBRA 2EZKA 5J3LA 2MLGA 3A1YA 2ZO4A 1PP7U 1X1BA 3M4OJ 3DXJF 2QCOA 2PJRA 4M72A 1LPQA 4BHCA 3O6BB 1QGPA 4ANJA 4BE2A 5H6RA 1KONA 4A3DJ 1O4XA 1FMVA 5KAFC 2DA6A 3GLLA 2GOMA 3LMMA 3OS1A 2EJRA 3PQJA 4C2TA 1E0EA 2DXIA 4BXFA 2E19A 2Q1ZB 2FF4A 4LD5A 4X0GA 1HKTA 3QQAA 1T0FA 3BC8A 3HTSB 2G9WA 4A3BJ 2VT3A 3TO7A 2R5YA 2OA4A 3S1QJ 1QU3A 1D0YA 2LVSA 1XGSA 3DU6A 3ABMH 2Q2EA 3JRHA 3DKYA 3RJPA 2ECBA 2VPRA 1ACIA 4WF2A 2ZSHB 4BDYA 3LWFA 4BY7J 2ZJPF 2GA1A 5BNGA 4G9YA 3GTJJ 2DDBA 1R1TA 4LLNA 2VBXA 1KYZA 5DV5A 2L54A 2P5LC 4WXHA 3L00A 1YO5C 4HNTA 1XPXA 2ELJA 3OSGA 3HOWJ 3LA7A 3HM5A 4IOCF 1TQPA 5D5XB 2N8GA 1VQ6I 1YTYA 1EH8A 3F72A 2W25A 3IL2A 3HSEA 4NNJA 3CJRB 2X1DA 5FKMA 1IXCA 1R6RA 3LA3A 5LFAA 1K78A 1IXRC 3K1MA 4I98B 2BEOA 4A0YA 4YRVA 2FQ4A 1R36A 5F0HA 3L2RA 2JUCA 4Q48A 3RTRA 3KYDB 4FE4A 4GYIA 3U2RA 2OUMA 1K7AA 2Y0MA 1B72B 2VN2A 1TNTA 1XN7A 3P7NA 2F5EA 1ORKA 5FD6A 3F9KA 2AQEA 2PBIA 4NUBA 4U0VA 4PGHA 3HOXJ 2NVUB 4HBLA 3EPZA 3GLXA 4A3LJ 3OOPA 1D8JA 4CYCB 4KDPA 3F21A 2XAUA 2M7BA 1WH5A 3O2PE 3E5QA 1K6YA 1S3JA 4M3FA 3JRCA 3ABTA 1QQIA 1ZK8A 4K2EA 3HOYJ 4UXNA 5AONA 1ZKGA 2I8DA 3QU6A 2Z5UA 3E6DA 3R60A 1XCBA 2COBA 5F0FA 3JREA 4LK1F 2JA5J 1P6RA 4RDUA 3K4JA 2LNBA 1KQ0A 3O3KA 2DMNA 2MH9A 2CQXA 2K3PA 2BHYA 2TCTA 1S5LC 3M8EA 4X6AJ 2STWA 2E1NA 3V7RA 2V6EA 3C3WA 1BOBA 1HSJA 3AFHA 2Q8KA 3DEWA 1BR4A 3AG3H 1I5ZA 1F4KA 2L9VA 2LY9A 1FOWA 1ZAOA 1W36C 2XPWA 3F8NA 3QPLA 4II3A 2OC6A 4M6YA 1EF4A 4B4CA 2EIMH 3VWBA 2VE9A 3PNYA 4YFKF 5F1JA 4KISA 4DYRA 3RIRA 3CO7C 3S16J 2FJ1A 4OWRB 2HQRA 4PK4A 1GHCA 1X3WB 3VDXA 1QPIA 3BLYA 1LQ1A 1HSTA 4BJ5C 1LJ9A 2GM4A 4EM2A 3F8BA 3AL0C 4TV7A 1FTZA 2V7FA 2ME0A 3PIPF 1B4AA 3TQNA 2DFFA 4OOIA 1QNTA 2F5VA 5H2FC 2QBYB 3S2DJ 1ZLKA 4KIGA 5GADJ 2ID3A 3SDBA 1XG1A 3BQYA 1JT6A 1S9HA 2IGNA 2LG4A 2XPUA 2LF7A 2X6YA 2FXAA 2E71A 2CW7A 3C2GA 3E0JB 3ZR8X 2R7SA 4RMNA 2ESNA 2FBIA 4MO7A 3GO5A 4MEXF 3LA2A 4R1HA 3A0BC 2P7CB 4EJTA 3H9GA 3IC7A 2MA3A 1RKTA 4P96A 2LKSA 5ICFA 4B3AA 2M3AA 3IH3A 3KFWX 3Q0WA 3KZZA 2VJ4A 1TWFJ 3L2UA 4WXDA 2BXZA 3KLOA 3QP5A 1B72A 2GLOA 4HF0A 1MJAA 3RKWA 1BI2A 1MMGA 1OYWA 2LR8A 4KYWA 3QAHA 5DCFA 3GZ6A 4AVPA 3SFZA 3OYJA 2BY1A 2NVYJ 3IUOA 1IN5A 4B3XA 2L5QA 1TP4A 2R3SA 3VYRB 3E6CC 4L9NA 2Y75A 1I1GA 1B59A 5E1ZB 3F22A 3CF5F 2IS1A 4PGGA 5LBQA 1W7PB 1YG2A 5D8KB 4XORA 4QPOA 3C2HA 3I54A 1O7LA 4XLAA 3CJTB 3OYCA 3V42A 2IGKA 1J2XA 2P4WA 4WCGA 3CCRI 4A3FJ 4CICA 2F48A 4D5FA 5BPDA 3IKVA 3J7ZI 1GXQA 4EJWA 1SEUA 3G71I 1OCCH 4GXOA 3WU0A 2K27A 3HYIA 2E1OA 2WTEA 3FISA 4B8XA 1RC9A 2HQNA 2M30A 2LBFB 4A2UA 3M1CA 4KMFA 1S8NA 1Z3YA 4KN7X 2YR2A 4QPQA 1A6IA 1T0FC 3PO2J 3CCSI 4XN0A 2KJBA 2QQ9A 3JRFA 3EDPA 1NHAA 4A5MA 2QF7A 2W24A 1MMAA 1KU3A 3S2WA 2LH9A 4BEHB 4DYQA 3HB9A 4LB6B 1MH3A 2VUMJ 3K4MA 2W00A 4HV6A 1BN5A 3EETA 1TBXA 3EYIA 1IDZA 4I2OA 3I64A 1MSFC 2NYXA 1BL0A 3KZIC 5J4YA 3I55I 2Z99A 5HVQC 3K70D 3QYBA 2AO9A 5LRRA 1B9MA 3G4SI 2Z16A 3EYYA 5A2QK 1LFUP 3OOUA 3H3ZA 2F5CA 3BROA 1IN8A 2A5WA 2OF7A 4RB3C 2F5DA 4CHUA 3OMYA 2R7QA 2QBYA 4EEFG 1FBQA 2K85A 3I53A 3K4NA 3M3YJ 2K3FA 2MLKA 3IAM2 5HODA 4S05A 4PFOA 3CCEI 1I50J 4AIKA 2JPBA 3J80K 1U5TC 1I6HJ 3BCAA 2DA5A 2OTLI 1HC8A 1EV7A 4A0XA 2R7OA 3LQQA 1JUPA 3OYAA 1EH6A 1HDDC 2Z9OA 1OMIA 5FJ8J 2OZ6A 2WWYA 2FMLA 1ETWA 1DP3A 1ZGAA 3ONQA 4DW6A 3M7GA 2HTSA 4U0WA 3O8HA 2WB1A 1H88C 1OFCX 1ZGJA 4WX9A 3MKLA 3MWMA 3CD6I 3W2VA 4KIBA 3VFZA 4NHJA 5TRDA 1FWZA 2IT0A 1NTCA 1MNMC 2HZDA 4M3DA 4ZH4F 1GLNA 1MMNA 3V8KA 2DN0A 4MFEA 4ON0A 2M34A 1VQ5I 2DOFA 3OYKA 3LFUA 3OWTA 5CLSA 4B1RA 4JX6A 4M9ZA 5IP6A 2XGDA 1RUNA 4IHSA 2B0LA 4JK1X 4U7DA 2EA2A 2HS5A 5C44J 1X3ZB 2WV0A 1YS7A 2ELKA 3VSKA 4L18B 2JN6A 2MFZA 2HXOA 4MQVA 4J01A 2OQGA 3H3VK 2UWMA 3OV8A 3SJMA 1VQ9I 1SANA 1X19A 2JSCA 1ETVA 4HG2A 3TL4X 2RREA 1UELB 5CKTA 3OSFA 1MSEC 3GW2A 1RKWA 5D4SA 3JAMZ 1C0WA 4ZC3A 1FEXA 1YS6A 4XLCA 2AS5F 4KN4X 3GTPJ 1Z6TA 1IUYA 5B5EC 4ASNA 1E17A 1D0ZA 4FQGA 1BR1A 2DLLA 1OCRH 4XOPA 4OU0A 1QBJA 5KHDA 4PJLA 4ZYDA 2JA2A 2PMZN 3ZXSA 4XICA 1LVKA 4BDZA 2Y48A 4CCJA 1S29A 3HSRA 1YLFA 2KRCA 4IHYA 2E36A 2P7VB 5HS8A 1I1SA 1VTNC 1XX5A 1XMXA 3FMSA 5IYCJ 2UXXA 5D5VB 4XQFA 5D5UB 4DZJA 5EEAA 3WU2C 3F23A 1IN6A 2JWTA 3BR3A 4MNUA 4B09A 1A36A 3E6MA 2Y9YA 1KYWA 2WAQN 1IC8A 1V5GA 2R5ZA 3CCJI 2CUFA 1YRNB 5L3EA 4E7LA 5M3FJ 4OIPF 3A01B 1VQNI 3A03A 1OR7C 1U9OA 1FOYA 3HPHA 2HOSA 1VQOI 2QKLB 3OL3A 3RSNA 1ERDA 3ABLH 4DZPA 5DCMB 1BIAA 1J09A 1RI7A 2HYFA 1QA6A 1XCVA 5LRSA 3J81K 4A6EA 4DNCA 4IEJA 2HOTA 2V1XA 1GVDA 5ICEA 2GXAA 3HOTA 4Y13A 2DYSH 1POGA 5J1RA 1BI3A 3D5RC 4U0YA 3KYLA 1RR7A 1PUFB 2BBYA 4XLNF 4L5JA 3HZJA 2WY7Q 4EGZA 2M4GA 3GFLA 4M3EA 1WCMJ 1K79A 5LGUA 2QM3A 1PDNC 1O7FA 2FNAA 2LKXA 4BU2A 1FBUA 1U0JA 3GXOA 5F04A 2L4AA 3HRUA 1T08B 2EFOA 2Z3YA 2QGUA 5FFZA 4HLYA 3IRRA 2BOLA 2XRLA 4ZJZA 1I3AA 4QLCU 1SVMA 3ASNH 1MMSA 3EQLF 4AIHA 2G7UA 5AIPA 3HOVJ 3RQ4A 2L3DA 1VQ7I 1IV6A 3CMEI 3L2QA 1SVLA 2L9NA 2R5YB 2R7XA 3KETA 2NOGA 2ECCA 5JFRA 3SEQA 3BJOA 1UHWA 4I0BA 2BY3A 3B6CA 4CYDA 2Q2EB 4FE7A 2PN6A 1F5TA 2EBIA 2HR3A 4BGDA 2E1CA 4RBOA 2BV6A 2RAEA 3NEUA 2A05A 4JBAA 3A2KA 5H20A 3CDHA 4FETA 5FKOA 4L9TA 3BZKA 5KAIC 2EV5A 2LKPA 1FMWA 1XDUA 2Q0OA 2JJ7A 1ULYA 2MSYA 2VJIA 3VOEA 2VQGA 3LOCA 3A4CA 2X6XA 1XSDA 4HSRA 3P9IA 5E1XA 4C3IJ 5M5WJ 4UUSB 2LP0A 3BJAA 2KIFA 3KP2A 4UV9A 5AIQA 2FBKA 4UHTA 2JK3A 3ZCOA 4HDUA 3F8FA 1K78B 1XMKA 5EJCA 2R93J 4NB5A 1X1AA 1FY7A 2X6WA 3HSFA 1H89C 4BAYA 1P92A 3RCOA 1DDNA 2PQ8A 1X1PA 5EYRA 3CC2I 2K02A 3IHUA 4I99C 3WODF 1T39A 1WJDA 2UXNA 3BG6A 5GPAA 3GX4X 3CMAI 1RETA 3CUOA 1LDKB 2DA4A 3E3VA 2D1HA 3HRTA 5FLVA 1EH7A 3E5XA 1U8BA 2R7TA 4JX5A 2LC2A 4FASD 2OCCH 2P8TA 1USSA 3OYFA 3H5NA 4E7SA 2ACJA 1E3OC 1T6SA 3ZQFA 2X51A 2CU7A 3MKWB 4C9YA 2W4SA 3TP3A 2PLYA 4HEA2 2LTPA 2BXYA 4YIIA 5IY5H 2BGCA 4UVCA 2H1KA 2KL4A 1ZR4A 4XKCA 1JHHA 2EB7A 1HF0A 1SD4A 3ESWB 1PUEE 5FKNA 1PVEA 2E60A 3DEUA 1VQ8I 2ME6A 2OCEA 4XRSG 3IAS2 5LEJA 5CPRB 2XGCA 4BQQA 1IN4A 3MD2A 1TQIA 2M87A 1T56A 4CCOA 2ZKZA 1X58A 1BC7C 3OYBA 1PUFA 1GV2A 1BW5A 3LQRA 1JUSA 2DFHA 3N05A 3DEEA 2M8EA 1YFHA 1U78A 3FXUA 3MQ0A 1MD0A 1W5TA 1TW2A 4I02A 2V79A 2E34A 2EK5A 1WRJA 3Q3SA 3NRVA 4V2GA 4V2FA 4FTHA 1VQLI 2R7UA 3GF2A 4MHGA 2E1MB 4UB6C 3C2BA 2ZJQF 1K6OA 2IS6A 1VF9A 1R58A 2ZNZA 1R5GA 1UJ8A 3WE2A 2L02A 3HBLA 2DQLA 4ZDLA 2VBYA 3JR9A 3Q5FA 1W5CC 3GEZA 3ZMDA 4U7BA 2HXIA 4FHTA 2EFWA 3Q0UA 1UZCA 4PUSA 3SZPA 3BT9A 2HVSA 1GT0C 1WGXA 1HBXG 4EJUA 3VYUB 3I3LA 1T33A 2IW5A 1HXDA 3QOEA 4ENJA 4RGSA 4E7JA 3KEQA 1R4NB 4Z6YA 2K9LA 2F4MB 2DYRH 2DFEA 3HUGA 4XRMA 1R00A 4F92B 5LGNA 3BTLA 3ABKH 4ABZA 4GDFA 2RNJA 2L9RA 4IXAA 2ZXWH 2OBPA 1R7JA 2XRNA 5E8IA 5DUKA 2RGVA 2RDPA 3PNVA 2P5VA 1KQ9A 4B47A 3G1MA 4BQAA 2LRDA 4NC8A 4RB0A 4XKVA 3E7LA 3IWFA 4UUSA 3BTCA 4XM3A 1OYYA 2KPMA 2QYOA 1JGGA 3KPHA 2AXTC 2KZVA 1SD5A 4AC0A 1FIPA 2K9SA 5E17F 1G4DA 2KKOA 3FMRA 2IEKA 4HNVA 3U21A 5JR3A 2DW4A 1IG7A 4Q4ZF 4AIJA 2XDVA 3KX2A 5EEGA 1ZHFA 2LREA 4Y7NJ 4Y4RA 1J59A 1G6NA 2DA1A 2HPMA 5HLIA 3GYHX 3I4PA 3FXQA 2NS0A 4BNCA 2D2WA 2O61A 1H0MA 3S1NJ 2X1EA 1FP2A 1U3EM 1OLTA 2CQ7A 3I59B 3CLOA 1YX3A 5TJJA 2KDOA 2Y69H 4XRSA 5BS6A 2R0QC 2M1BA 4HX7A 2X4HA 2QWWA 4BE1A 3JTHA 4IVNA 2A07F 1FP1D 1ZG1A 4RAGA 3T8TA 1ON2A 2M7AA 1RRJA 5F08A 1HCRA 4IOAF 1YW9A 3CJQB 3ZMZA 3T0YA 1QVUA 2FA5A 3VPRA 3HOSA 1RUOA 2CMPA 4M6VA 3JSOA 5JVTA 1D1BA 1H9GA 3MZYA 2XUBA 5E3LA 3GFIA 2J5OA 5BQTA 2O03A 1E2XA 2KRHA 2CW0F 3LFKA 4NQWA 1XGOA 2FEZA 5GAHJ 2FD5A 2K7LA 2OAZA 1FIAA 2IAIA 3K2AA 3OR1C 2P5KA 3CQZJ 3DTEA 2XV4S 3JRAA 2IP2A 4JYKA 3J7YJ 4LG3A 3Q0VA 4HX4A 1V54H 4BQOA 4AU7A 1MH4A 2XC7A 2QQBA 3DQVC 3HKZN 2R4GA 3ASOH 3J7AO 2X0LA 3L9FA 2A5YB 4IJAA 3QPSA 5J47A 2CUEA 1HLVA 4Y33A 1SFUA 2JA8J 2KT0A 3BG7A 4LIVA 3WTZA 1MBJA 1Y39A 2GA2A 4OINF 3BR5A 4E4HA 2XSDC 1FX7A 2O9LA 2EFNA 3FF5A 5FFXA 2VI6A 3FZVA 1SFOJ 2BVLA 5EEHA 3FX3A 4GCVA 3DTKA 2ZFWA 1UMQA 4FX0A 5DD8A 1P7JA 3ECOA 4HQMA 2KIQA 1R9TJ 1IRFA 3SXYA 1Z67A 4Q47A 2R7WA 2VQCA 2AXLA 1DQUA 2B7EA 3CP8A 1Z21A 3S93A 2F6CA 4I6ZA 1IAWA 1ZR2A 4XK4A 1LUJB 4EM0B 1JT0A 3PFIA 2B63J 2PMHA 1IRZA 3BWGA 4AUXA 1WJ5A 2VONA 2D1VA 2WAFA 3B6AA 3FXRA 4NC7A 2PX9A 3LL7A 1L0OC 3IP4B 3MMYB 2VE8A 5DD4A 2IVMA 2XASA 3S1MJ 3FK7A 3HEFA 4RA2A 5ILSA 1IO2A 4L5IA 5GTIC 3GTQJ 1ZG3A 1GUUA 3GTLJ 2LLKA 1JTYA 5FLXK 2OJED 3BPXA 3FBIB 4BBRJ 2JA7J 2ZXIA 3F6VA 3B73A 1MGTA 2L4MA 1LNWA 2W48A 3FM3A 3GFMA 2E2HJ 4G6QA 2DT7B 2R7VA 1RZ4A 3BTIA 1ETYA 4W1UA 1Z7UA 2PJPA 3I59A 1MMDA 4IHTA 2MYSA 4AYBN 5E1WA 3NARA 1CQTA 1MW7A 4RGUA 2DA7A 2Y31A 4RB1A 5HS9A 4L5EA 1PP8F 2DA2A 1HA8A 1Z0XA 1R22A 1MBEA 1WJFA 2HYGD 2R7FA 3ZOBA 3OYMA 4FX4A 3OS0A 2XPVA 4G7HF 3HOZJ 1G3WA 2GZWA 4LMYA 3CC4I 1XC5A 4LK0F 1TTYA 3LSTA 2Y9ZA 2PFBA 3OL4A 3D5SC 3C7JA 2F4OB 1QZEA 1R5ID 3FKIJ 5IT9K 3LAPA 2LF8A 1SC7A 1WSUA 3CCQI 1P4AA 5A2QZ 4II2A 2CG4A 1B9NA 3KZYA 4A5NA 1VQKI 2C6YA 2RVCA 2QSGX 1FSHA 3ERMA 4OMYA 1USTA 2XAFA 3PM1A 3S32A 2QVOA 2QZ8A 3LAJA 5BOXA 4WK8F 2KMUA 4LLLA 4C30A 3FXLA 3K1PA 2KLOA 1ZARA 1D1CA 1LE8B 1O57A 2Y0SN 2H27A 3J80Z 2CUZA 2A6HF 1XGNA 2MG4A 1SMYF 3LSMA 3BDDA 3DFGA 1BM9A 2GBYA 3RPUD 1RIOH 3RZOJ 1HW1A 1W36D 1PJRA 5B1AH 4ETSA 1QRYA 3H9JA 4KFCA 4I0AA 4R79A 2ZCWA 2A3SA 2PMZA 3GMEA 4CH7A 2R5ZB 2H94A 2RQPA 4N9IA 4P9UA 2MC4A 3ZQLA 1WPKA 3WG9A 5IOYA 3G2BA 1SAXA 3DWLE 2CV0A 4F91B 3BR6A 4F55A 1ONVA 2JUGA 1N75A 2P81A 5K7FA 4WXCA 1IW7F 1UHSA 3CCVI 5FRMA 4GYGA 1YQAA 1YW7A 2XKOA 3RKXA 3LSPA 4YIRX 3T1BA 3ZMSA 3RKQA 1ZTRA 3I9V2 2CV1A 2ZC2A 3QPHA 3U1DA 2DK8A 2JZYA 4IZZA 3H35A 2CO5A 2WAQA 1ZQ3P 5IP9J 3WTYC 4AVZA 4DGWB 2CQNA 3M9AA 2DPUA 2OZUA 1BA5A 1MKMA 3TOBA 3G1LA 4D9JA 3RPQA 2HYJA 4M6XA 1FTTA 1NH3A 1WI3A 4ZYEA 1REPC 4BXUA 3R61A 3GWZA 2HDWA 1IXSB 3WGGA 2AHQA 1X1DA 4QIWN 4EJVA 4HDVA 3ZMTA 2RNGA 5K1YA 5BMZA 2A6TA 2JA6J 5EZHA 1P4XA 2X1CA 5JHUA 3QOPA 4OMZA 3L1PA 1T2KA 1R23A 2IRFG 1LFBA 4IRHA 4I01A 2KIMA 3DPUA 2R7DA 3CCLI 5GAEJ 4HPQA 4G6DA 4ESFA 2J5PA 4LITA 4PJMA 5GAGJ 3CCMI 3KEOA 2EZHA 1OCZH 1SD7A 3DTIA 2O6GE 2K9MA 5E3MA 9ANTA 1R49A 1KZHA 2VODA 1XSVA 1LDDA 3FHNA 5ERIA 1ZRCA 2L2OA 4KT5C 1BI0A 1F43A 4W97A 1FZPB 4LJZF 4DIQA 2LMDA 3CCUI 2HKXA 2VKEA 2W84A 4RGXA 4A93J 4CCKA 2YU9J 2GWRA 3NAUA 4XLEA 5FLMJ 1TNSA 3LSGA 5HS7A 4A6DA 2NOJB 1TWHJ 5K5QA 2BW3B 4MIMA 2LDUA 4M9XA 4A69C 4CCLA 4UV8A 3TDUC 1T98A 4BH9A 1LFPA 1Y1WJ 1TWCJ 2KP6A 2TDXA 2E1MC 5E79C 4E70A 3JW4A 1AKHB 2A61A 3QRFF 1WJAA 3F0CA 3RYPA 2K40A 1QHHD 4Y3OA 1YJNI 1T95A 2JQ7A 2O5RA 4XKBA 3SEZA 3ZQCA 1BOAA 5HOOA 2ZJRF 3KIOA 4IKFA 4RS8A 2VKHA 4XIDA 2CS3A 2F5FA 1MJBA 3J81Z 2CV2A 1MBHA 2HGCA 1OQYA 3GTMJ 1T38A 2RV8A 3FXMA 1LE8A 1VQMI 3FMQA 2R92J 4KIFA 1RNLA 5F64A 3WTXC 4S04A 5F6FA 3ZP5A 1DU6A 3H9QA 3RYRA 4F3QA 2NRAC 1OCOH 2HI3A 3VB2A 2H09A 3QWLA 3BR1A 4GFBA 2MBFA 2HPIA 4E7KA 1WQ2A 2ID6A 3UKGA 2I10A 2HDDA 3ZQHA 4Y52J 4M3GA 1OPCA 1H8AC 1IZ1A 2DO7A 4ZTJA 1L3LA 2W1OA 1X2NA 3DP7A 1EA3A 5EGOB 4LIUA 2IS2A 4MEYF 2L7FP 4OAYA 3ZQGA 3QPTA 3R0JA 2EZLA 3JAMK 4MTDA 3BTJA 2ZBKA 4EQQA 2CH0A 3V7SA 2E2IJ 1DGWY 3MAJA 3I0TA 3CUQB 1ZH5A 4BKXA 3HHGA 3BG3A 4S0HB 1B8IB 5IT3A 2CRGA 1NK3P 3N97A 2VBZA 1S6LA 1GVJA 2M9HA 1TT5B 3IH4A 5J6XA 2ZB9A 3BZ6A 3LSJA 4I76A 4PFPA 1AA7A 2DTRA 3FXJA 2XF7A 1HDPA 4RAYA 4XMYA 4FISA 3VYSB 5CVIA 3IV5A 2ZMEB 2EFPA 1UFMA 2VASA 2TRTA 5DTDA 1YJ9I 2DPDA 1Y8RB 3I5UA 5JHFA 2HNHA 5ILUA 1JJ6C 2CW8A 1JKRC 1IGNA 3BG9A 1ETOA 5LD2C 4HOBA 1DPUA 1SFEA 3H36A 5L3GA 4YEJA 3LNQA 2D5VA 2ESHA 2NS8A 1FOXA 3OY9A 1Z1DA 3ZMVA 4UY8I 2WA0A 2M45A 1QPMA 3DU5A 3H5AA 4DOZA 4QTRA 3WTWC 1A35A 1D5VA 3ELKA 1DP7P 4XL9A 4B43A 4HF1A 2IS4A 2KFDA 1WHUA 2A68F 4RM3A 2DMTA 1CF7B 3I58A 1DGRM 2XB5A 5L3FA 3OYDA 1M1EB 2LYCA 3HUGB 3OIPA 3JRGA 5FO5A 2E35A 4HX8A 1WJEA 2FE3A 3PO3J 3GCMA 4L0YB 1JI8A 2DFIA 3AAFA 2W7NA 1OCTC 2R7ZJ 2BW3A 1SFKA 1MBKA 2LFBA 2LSOA 5GTHC 3T8RA 1GV5A 4RLFA 1BC8C 1YE9A 1LDJA 3R0AA 1KGSA 4ITVA 2Z33A 2LOOA 5HDNA 5JLWA 4E7IA 2VQHA 1AKHA 4HF2A 4IQJA 2L01A 3GBGA 1G3YA 2WADA 2V9VA 5LEKA 1YHQI 1YI2I 1J9IA 1BJZA 4H0EA 2X85A 3OYGA 2X9DA 1MIJA 1V5EA 2KDZA 4ZYGA 2ELHA 2GIVA 2VIXA 3Q9VA 2V9KA 2XKPA 5F0CA 4C3HJ 1ZLJA 4CXFA 1RPWA 3CTAA 1JKPC 2K86A 1JJ8C 1BJAA 1U6GA 1X3UA 2LY2A 2CQKA 2WAEA 3WGHA 4KT6A 2E7XA 4DYCA 3E6BA 2F4IA 2EA4A 5CVVA 1JUMA 1A31A 1D0XA 2DAOA 4A3KJ 3K7AJ 2STTA 4EVIA 3OIQA 1HW5A 3UNGC 4CCNA 3QYEA 4RAFA 3OYNA 1XB4A 4I7HA 4IL6C 1G8XA 3AG2H 4F7ZA 1HKQA 1D3YA 2VKDA 5EGOA 4I09A 1I6XA 2RC4A 3G73A 1YX5A 1JHFA 1ETXA 2IGOA 2P6SA 2EIJH 3GVAA 2DA3A 3HGGA 1D8KA 4M73A 4EMSA 2QUFA 4CCMA 5EG0B 1MDMB 1IRGA 4EM1A 2B9SA 3CUQA 3J7AY 1GXPA 4NQWB 3M8JA 1B8IA 2O0YA 2HVQA 3PNTA 5D4RA 2EFQA 3TKYA 2JVGA 2O7OA 5FROA 1G3TA 5DS9A 3FBNB 2LK2A 3V8LA 1DU0A 1B1BA 1X2MA 4A3GJ 3EUHA 1BW6A 4YG2F 4XR6A 1N77A 4HA8A 3QODA 4RGRA 2XB0X 4PJJA 4F93B 2M0CA 3IRQA 1Z6RA 4J19A 2NNNA 2ZMEA 3MN2A 1ZRFA 3RDIA 2YSRA 3K69A 2KJCA 2BY2A 2CQQA 4KUMA 1VZ0A 2ZNYA 4RAZA 1AU7A 1FT9A 4LOCA 3PIOF 3WTTC 2VJ5A 5E20A 5DYMA 5GP9A 4LFUA 2UUZA 3H1CA 4P55A 4BJTA 4B44A 5DDGA 2BHZA 2VXZA 2MW8A 1G59A 3HKZA 2VPLA 4U87A 4KMUX 1U2WA 2HFHA 3DKXA 3I4MJ 5J1YA 3KP7A 2MGQA 3EUAA 3M1EA 1QZZA 2VBWA 3CCYA 3LSKA 3M07A 3JRDA 2A69F 2K9NA 1CF7A 4N9HA 1K4SA 4XKWA 4D0PA 3ABUA 4M9SA 1WFXA 3WU1B 4PZJA 4A3JJ 4OIOF 2VKVA 2R7RA 4IF4A 3H3UA 1IF1A 4EGYA 1NK2P 1UG0A 2V26A 4FCYA 4CO8A 2PEXA 3A02A 3TOAA 1MZBA 1W4MA 3HHHA 2V1UA 2XGEA 4UB8C 2H6CA 1P7IA 5HLHA 3PL8A 2YPRA 3U9GA 3BQZA 3H92A 3BZCA 1NG7A 4YIFA 2DCEA 4F52A 1IRXA 4XNFA 3BJ6A 2H8RA 1WJBA 3W6VA 2EWNA 4HSTA 4BYYA 1GDTA 4L9VA 2OV7A 2XIGA 2JRMA 4UUTA 3BR2A 3D0SA 1B6AA 3OYEA 3DBLB 1DUXC 1FPQA 3MKZA 3PFYA 2XROA 1ZELA 4A3EJ 1TZLA 4YFNF 2G0EA 1TW3A 2KRFA 5DEQA 2L9SA 2K4BA 1U5TA 3F8CA 3L09A 3NWTA 3ERED 1HOMA 4Y15A 1X1CA 4KJZA 1S72I 3PSFA 3ULQB 3HTUA 5C4JJ 2IBDA 2OD5A 2GQQA 2NAZA 4GO1A 2G7HA 2WV1A 4HQEA 2DU9A 2W57A 5TGTA 3QU3A 4CDGA 1XTAA 4AYBA 1Z91A 3CZ6A 5IPAA 3JRIA 3TEDA 1DPRA 2KZGA 3KP5A 3CDIA 3M8FA 3OYHA 2NVQJ 3OS2A 3GTGJ 4G12A 2VT2A 5EG0A 1MDMA 1R4MB 2E2JJ 2LD5A 2XF5A 2OTJI 4HNUA 3WGIA 2YU3A 3R4KA 5CJ9A 4JOMA 1E3PA 3TO9A 3HPGA 3H0DA 2VLAA 5GPCA 2HU9A 2O8XA 2D45A 2ZXJA 3W2AA 4QWQA 5J8CA 1AHDP 1A5JA 4N0BA 1TC3C 2X6OA 3BCBA 3K10A 3OIOA 5IYBJ 4ENKA 2MH2A 4CA0A 3ZGKA 3W6KB 2Y30A 3PSIA 5FKKA 3DPTA 1J7KA 2QKMB 3WTSC 4GRIA 3ZN0A 4ZYHA 2DMQA 4E7ZA 1N78A 3VODA 4HAMA 3T5XA 4XSXF 2HKOA 2IA0A 3IKTA 3Q9SA 2ZSIB 5FLXZ 2QSHX 2DOAA 1S7AA 2H8WA 3BPVA 3HRMA 1STZA 3K70C 1W7PD 3K4LA 3ZRGA 2NXNB 3WHBA 4BHBA 3V4GA 2Y0SA 3DLLF 2JVHA 2CJJA 3TMOA 5HLTA 4IHWA 4DBQA 2FMYA 2XF6A 3KCCA 2GXBA 1S7EA 3HG9A 2WC2A 4B48A 2DQRA 4JP0A 1APLC 2W85A 4CZZA 3G3ZA 1XSXA 5J1UA 5JI6A 2ICWG 1KA8A 2YX7A 4BUPA 1XS9A 2QSFX 3TBIA 3E1SA 3CDLA 4BQNA 1YITI 2COMA 3H5RA 2VQLA 3RQIA 4CUGA 3WHCA 1R1VA 1BIBA 1KU7A 3S3OA 4ZDPA 2GAUA 2QQAA 3X2QH 4KA4A 3PJRA 1W1WE 1J5YA 1SAUA 3K4KA 4PDKA 1I27A 1J0RA 2FOKA 5ICGA 2CSOA 4N4NB 1ZYRF 3VSLA 2V1DA 1Y8QB 2MABA 3WTVC 2NNYA 1FBSA 3FM5A 4E7HA 3CJNA 1LVAA 5FKLA 5IT9Z 3PUBA 4NC6A 1JGSA 1LKXA 4C2UA 1OR7A 2FNPA 4IHXA 3W6JB 4Y17A 3A0HC 2ISZA 1KU2A 5M5YJ 2AQFA 2M2EA 3RZDJ 4G6TB 1J75A 2A6EF 4OAZA 2IPQX 1FYKA 3S17J 2EINH 1CGPA 3CUQC 3K0LA 1UAAA 1E3HA 3HRSA 3REOA 3I4NJ 2XGXA 4HV5A 2MC3A 5LHHA 2DI3A 1YIOA 3TW6A 5IYDJ 1KQ8A 2VC0A 5D5WB 1JKOC 3OR2C 1G2HA 4YELA 1XGMA 2NVTJ 3C18A 1HW2A 2GXGA 4M71A 1MBFA 5C3EJ 2JTVA 3P9KA 4O3MA 3FWEA 2K9QA 3TO6A 3ZQ7A 3SZTA 3EUHC 5IOZA 3G6EI 4J00A 4UVBA 4CYCA 2ISYA 1VNDA 4PSWA 4HZFA 1QHGA 4G8XA 2VL8A 1SVOA 2ZMEC 2V9PA 2HOAA 3BP8A 4JQFA 5JVGF 4ZTFA 2RQQA 2IXSA 2M0MA 2ZXHA 3JCUC 5HDKA 2O8KA 2LY1A 1NG6A 3BOQA 5EF6A 3FXOA 3HIFA 2GOXB 3HJEA 5ED4A 3CC7I 4RB2C 3COAC 2BE5F 4XBFA 1ETQA 4PCQA 1U8RA 2EV0A 2XAGA 1F36A 3ML6A 1WKMA 1R71A 1YOVB 4AIDA 3OYIA 3DV8A 5CQEA 3KLNA 2XSJC 3HC7A 6PAXA 1BBYA 2VJJA 2DODA 2FUG2 4R8HA 1Y0NA 5L3DA 4U88A 2OPTA 4D1QA 1T8IA 1FLIA 3GZ5A 4PSXA 3ECHA 2FRHA 3GTOJ 1V4RA 1W5SA 4Z2YA 1ZG5A 3HDDA 1FJLA 2PMUA 3PUFA 2L7MP 4L9JA 3S3NA 5K5OA 5FB2A 3RI4A 1A6QA 3K6GA 3DLAA 1IJWC 2Z2SB 5FGMA 3NQOA 3FKJA 1X4PA 2V4JC 3KP4A 1PYVA 3I56I 3CLQA 4FT8A 4O5VA 1ZREA 2BZTA 2M5WA 4N4OB 1TWAJ 1UG2A 1D1AA 2QA4I 4A3CJ 3QP6A 4KNYA 4PJ0C 3W2WA 1OJLA 4DQ2A 3MZ8A 2VB6A 1WVRA 5HDGA 3ZPLA 2DMPA 3DBHB 5B1BH 3SDGA 1Z9CA 3HGYA 2DT6A 1VQPI 4XOTA 5M5XJ 3LSRA 1ENHA 3FXKA 1JKQC 4BXXJ 1XMAA 2DOEA 3K9TA 4G7ZF 2HDCA 3CMYA 2NVXJ 3U1KA 4AM3A 3SFIA 4AD9A 3KP6A 1ZGWA 4LG0B 1AOYA 3S1RJ 3PQKA 4M3BA 2WY8Q 3S15J 4IHVA 2JSPA 1TL8A 5E8GA 1WI9A 3MCZA 1FC3A 5HNFA 2V1NA 3G1OA 2Z1DA 4UNOA 3H0GJ 3MEXA 5M3MJ 4A3IJ 1FSEA 3K2ZA 3V7CA 3BY6A 1V55H 3ZMUA 3O8GA 4KICA 1K83J 5K5RA 3S8PA 2HQ5A 3GUDA 2IGMA 5JLXA 3E97A 1N25A 2MD0A 1TQMA 3F8MA 1Z3XA 1R1UA 2P6TA 4BE0A 5L3BA 3OYLA 2ZFUA 5KCMA 3B02A 4G7OF 2FOWA 2IJLA 2GIZA 5E18F 2XAQA 3ROUA 1YIJI 2K5CA 5LHIA 2XHKA 4A3MJ 1ON1A 4JX4A 4O6JA 3EUKL 4ENNA 5K7ZA 5DUIA 1ZN2A 5B3SH 1WH7A 4Q5SF 5J40A 4AWXB 4M74A 1Y6IA 5IP7J
chains in the Genus database with same CATH topology
2K9SA 1ETKA 1TWFJ 5E3NA 1VI0A 1IUFA 1D5YA 4HNVA 2IEKA 5JLWA 1B72A 2GLOA 1AKHA 1IG7A 2DMUA 3GBGA 4Y7NJ 2LR8A 1BJZA 2DA1A 2NVYJ 2X9DA 2KDZA 3S1NJ 1ITYA 5F0CA 4C3HJ 1K61A 1RPWA 1JKPC 4XRSA 1JJ8C 3BR0A 2R0QC 5EDNA 1W0UA 1I3QJ 2L0KA 4MLOA 4DYCA 1HCRA 5F08A 3ZQIA 1JUMA 1QVUA 3VPRA 4M6VA 4A3KJ 4MFDA 4A3FJ 3K7AJ 5E3LA 4D5FA 3S14J 5F27A 2EQRA 2M8GX 3IH2A 3JRBA 4QSHA 5EGOA 2E1OA 3FISA 1VFCA 1ETXA 1U9NA 2FD5A 1FIAA 1A6IA 2DA3A 2IAIA 3HGGA 3K2AA 3PO2J 3CQZJ 5EG0B 3JRFA 3JRAA 2QF7A 4JYKA 1B8IA 3Q0VA 4DYQA 5C4XJ 2L7ZA 3HB9A 1MH4A 1MH3A 2VUMJ 2O7OA 5DS9A 3HKZN 2LK2A 2JMWA 1IDZA 1DU0A 1X2MA 1BL0A 1MSFC 4A3GJ 2YS9A 1BW6A 3QPSA 2AO9A 2XB0X 2CUEA 1HLVA 2NS7A 1LFUP 2M0CA 3OOUA 5E3OA 4J19A 2OF7A 3MN2A 2JA8J 2KT0A 1MBJA 2YUSA 4EEFG 3BR5A 2XSDC 2O9LA 2CQQA 3M3YJ 2VI6A 1SFOJ 5HODA 1AU7A 4LOCA 2WB1N 1UMQA 5EZGA 1P7JA 1R9TJ 5GP9A 1I50J 3TW7A 1I6HJ 2EH3A 2MW8A 4I6ZA 2DA5A 4NDLA 1ZR2A 4XK4A 1JT0A 1IRZA 2B63J 3I4MJ 5J1YA 4AUXA 1JUPA 1Z77A 2MGQA 3CCYA 1HDDC 3B6AA 3JRDA 2K9NA 5K7HA 5FJ8J 4D5CA 4A3JJ 3S1MJ 2VKVA 3S2HJ 1ETWA 3FK7A 3HEFA 4DW6A 1Q1VA 2X48A 3GTQJ 1GUUA 3GTLJ 1NK2P 2LLKA 1JTYA 4FCYA 3O8HA 2Y2ZA 1H88C 4BBRJ 3A02A 1OFCX 2JA7J 3MKLA 4D7NA 2XGEA 2W48A 1NTCA 1P7IA 1MNMC 2E2HJ 4M3DA 3BTIA 3BQZA 2DN0A 4MFEA 1ETYA 2M34A 4W1UA 2H8RA 4D7MA 3W6VA 1QVTA 1W0TA 4AYBN 4B1RA 3NARA 4JX6A 1TWGJ 1Y1VJ 2XGDA 3TP0A 5IP6A 1CQTA 1GDTA 2DTZA 2DA7A 2Y31A 5C44J 4L5EA 2ELKA 2DA2A 2JN6A 4UUTA 3D1NI 2HXOA 3BR2A 1Z0XA 3H3VK 1MBEA 3ZOBA 3GTKJ 3SJMA 1SANA 1ETVA 4A3EJ 2XPVA 3HOZJ 3OSFA 2G0EA 1MSEC 1XC5A 3MVPA 1RKWA 3BG5A 1FEXA 2Y9ZA 1HOMA 3DCFA 3GTPJ 5C4JJ 3FKIJ 2IBDA 1MBGA 2WV1A 3TEDA 5IPAA 3JRIA 2PMZN 2NVQJ 3GTGJ 4G12A 5EG0A 1RESA 2E2JJ 4XICA 2LD5A 3FIWA 3FK6A 3PM1A 4IHYA 2FX0A 4C3JJ 5GPCA 1YRNA 5IYCJ 4DZJA 5EEAA 2JWTA 1JTXA 3BR3A 3A01A 1IDYA 1LE8B 2Y0SN 2Y9YA 2MG4A 2WAQN 1IC8A 2R5ZA 3HOUJ 1AHDP 1A5JA 1TC3C 2GBYA 2CUFA 2X6OA 3RZOJ 1YRNB 2DJNA 4C2MJ 4BY1J 3OIOA 1QRYA 5IYBJ 5M3FJ 2Y30A 3A01B 3A03A 5FKKA 1U9OA 2R5ZB 2HOSA 3ZQLA 2DMQA 1WPKA 4DZPA 5IOYA 1OCPA 2EZIA 3BR6A 5K7FA 2P81A 4BBSJ 4IEJA 1UHSA 4X1EA 2HOTA 1GVDA 2EZKA 5J3LA 3LSPA 3RKQA 3WHBA 1ZTRA 3M4OJ 1POGA 2QCOA 5J1RA 1ZQ3P 5IP9J 2CJJA 4A3DJ 4IHWA 1RR7A 1PUFB 1O4XA 1BA5A 1S7EA 2DA6A 3G1LA 4JP0A 2HYJA 1APLC 1FTTA 1WI3A 5J1UA 4M3EA 1WCMJ 1GV5A 1XS9A 2LKXA 4QIWN 2AHQA 2E19A 3CDLA 3QQAA 2JA6J 3RQIA 5F04A 5EZHA 4A3BJ 3WHCA 2R5YA 3S1QJ 2XRLA 2LVSA 3L1PA 1LFBA 3HOVJ 3JRHA 2ECBA 2VPRA 1IV6A 2R5YB 2NOGA 2ECCA 4BY7J 5FKLA 3B6CA 5BNGA 2EZHA 4FE7A 3GTJJ 2EBIA 5E3MA 9ANTA 4RBOA 4IHXA 2RAEA 1F43A 5M5YJ 2M2EA 4W97A 3OSGA 3RZDJ 3HM5A 3HOWJ 2N8GA 2VKEA 3S17J 5FKOA 4A93J 2JJ7A 2MSYA 5FKMA 3LOCA 3I4NJ 2YU9J 3NAUA 3TW6A 4C3IJ 5FLMJ 2LP0A 2FQ4A 4UUSB 5M5WJ 5IYDJ 3LSGA 1JKOC 1G2HA 1TWHJ 5F0HA 4MIMA 2NVTJ 2JK3A 1MBFA 4A69C 5C3EJ 5IOZA 2K9QA 4FE4A 2R93J 1Y1WJ 1TWCJ 1B72B 1H89C 1AKHB 4CYCA 1ORKA 1VNDA 3F0CA 2K40A 5EYRA 2HOAA 3HOXJ 3ZQCA 2O8KA 5GPAA 4A3LJ 4CYCB 5EF6A 1RETA 4XIDA 2DA4A 1WH5A 1MBHA 3GTMJ 4M3FA 3JRCA 1ETQA 1LE8A 1F36A 1ZK8A 5FLVA 2R92J 1DU6A 3HOYJ 1U8BA 1ZKGA 4JX5A 2HI3A 3BR1A 2COBA 4GFBA 5F0FA 3JREA 1E3OC 2OPTA 2JA5J 4RDUA 2ID6A 3ZQFA 3UKGA 2CU7A 3GTOJ 2I10A 2DMNA 2TCTA 2CQXA 3TP3A 2HDDA 2LTPA 3ZQHA 3HDDA 4X6AJ 4Y52J 4M3GA 1H8AC 1FJLA 2L7MP 2H1KA 1X2NA 3DEWA 1ZR4A 1IJWC 5EGOB 1HF0A 2LY9A 2L7FP 5FKNA 3ZQGA 2ME6A 4XRSG 2EZLA 2XGCA 2XPWA 1TWAJ 1UG2A 3BTJA 3QPLA 1EF4A 4A3CJ 4B4CA 2E2IJ 1T56A 1OJLA 1X58A 4BKXA 1PUFA 1GV2A 3BG3A 2DMPA 4S0HB 5F1JA 4DYRA 1B8IB 1BW5A 2CRGA 3SDGA 1NK3P 1JUSA 3S16J 3HGYA 2FJ1A 5M5XJ 5IP7J 3LSRA 1U78A 2M9HA 1ENHA 4BXXJ 1JKQC 3IH4A 2ZB9A 3LSJA 4I76A 3Q3SA 4V2GA 1QPIA 4V2FA 3CMYA 4FTHA 2NVXJ 3SFIA 2GM4A 1HDPA 1ZGWA 1FTZA 3S1RJ 3C2BA 4FISA 4M3BA 2ME0A 3S15J 4IHVA 1VF9A 3IV5A 2TRTA 3G1OA 3HBLA 5DTDA 3JR9A 3S2DJ 3H0GJ 2ID3A 2HXIA 5M3MJ 1XG1A 1JJ6C 4A3IJ 3BQYA 1JT6A 3Q0UA 3O8GA 1JKRC 1K83J 1IGNA 3BG9A 2HQ5A 3BT9A 1ETOA 5JLXA 1WGXA 1GT0C 2XPUA 3LNQA 2D5VA 1T33A 2NS8A 4QTRA 4XRMA 3BTLA 4ABZA 2L9RA 2DMTA 4MO7A 2XB5A 4A3MJ 3G1MA 3JRGA 4JX4A 1RKTA 3E7LA 3PO3J 4UUSA 3BTCA 5K7ZA 1OCTC 1JGGA 2R7ZJ 1WH7A 4B3AA 1MBKA 2LFBA 3IH3A 3Q0WA 4AC0A 1FIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9S A;  1ETK A;  1TWF J;  5E3N A;  1VI0 A;  1IUF A;  1D5Y A;  4HNV A;  2IEK A;  5JLW A;  1B72 A;  2GLO A;  1AKH A;  1IG7 A;  2DMU A;  3GBG A;  4Y7N J;  2LR8 A;  1BJZ A;  2DA1 A;  2NVY J;  2X9D A;  2KDZ A;  3S1N J;  1ITY A;  5F0C A;  4C3H J;  1K61 A;  1RPW A;  1JKP C;  4XRS A;  1JJ8 C;  3BR0 A;  2R0Q C;  5EDN A;  1W0U A;  1I3Q J;  2L0K A;  4MLO A;  4DYC A;  1HCR A;  5F08 A;  3ZQI A;  1JUM A;  1QVU A;  3VPR A;  4M6V A;  4A3K J;  4MFD A;  4A3F J;  3K7A J;  5E3L A;  4D5F A;  3S14 J;  5F27 A;  2EQR A;  2M8G X;  3IH2 A;  3JRB A;  4QSH A;  5EGO A;  2E1O A;  3FIS A;  1VFC A;  1ETX A;  1U9N A;  2FD5 A;  1FIA A;  1A6I A;  2DA3 A;  2IAI A;  3HGG A;  3K2A A;  3PO2 J;  3CQZ J;  5EG0 B;  3JRF A;  3JRA A;  2QF7 A;  4JYK A;  1B8I A;  3Q0V A;  4DYQ A;  5C4X J;  2L7Z A;  3HB9 A;  1MH4 A;  1MH3 A;  2VUM J;  2O7O A;  5DS9 A;  3HKZ N;  2LK2 A;  2JMW A;  1IDZ A;  1DU0 A;  1X2M A;  1BL0 A;  1MSF C;  4A3G J;  2YS9 A;  1BW6 A;  3QPS A;  2AO9 A;  2XB0 X;  2CUE A;  1HLV A;  2NS7 A;  1LFU P;  2M0C A;  3OOU A;  5E3O A;  4J19 A;  2OF7 A;  3MN2 A;  2JA8 J;  2KT0 A;  1MBJ A;  2YUS A;  4EEF G;  3BR5 A;  2XSD C;  2O9L A;  2CQQ A;  3M3Y J;  2VI6 A;  1SFO J;  5HOD A;  1AU7 A;  4LOC A;  2WB1 N;  1UMQ A;  5EZG A;  1P7J A;  1R9T J;  5GP9 A;  1I50 J;  3TW7 A;  1I6H J;  2EH3 A;  2MW8 A;  4I6Z A;  2DA5 A;  4NDL A;  1ZR2 A;  4XK4 A;  1JT0 A;  1IRZ A;  2B63 J;  3I4M J;  5J1Y A;  4AUX A;  1JUP A;  1Z77 A;  2MGQ A;  3CCY A;  1HDD C;  3B6A A;  3JRD A;  2K9N A;  5K7H A;  5FJ8 J;  4D5C A;  4A3J J;  3S1M J;  2VKV A;  3S2H J;  1ETW A;  3FK7 A;  3HEF A;  4DW6 A;  1Q1V A;  2X48 A;  3GTQ J;  1GUU A;  3GTL J;  1NK2 P;  2LLK A;  1JTY A;  4FCY A;  3O8H A;  2Y2Z A;  1H88 C;  4BBR J;  3A02 A;  1OFC X;  2JA7 J;  3MKL A;  4D7N A;  2XGE A;  2W48 A;  1NTC A;  1P7I A;  1MNM C;  2E2H J;  4M3D A;  3BTI A;  3BQZ A;  2DN0 A;  4MFE A;  1ETY A;  2M34 A;  4W1U A;  2H8R A;  4D7M A;  3W6V A;  1QVT A;  1W0T A;  4AYB N;  4B1R A;  3NAR A;  4JX6 A;  1TWG J;  1Y1V J;  2XGD A;  3TP0 A;  5IP6 A;  1CQT A;  1GDT A;  2DTZ A;  2DA7 A;  2Y31 A;  5C44 J;  4L5E A;  2ELK A;  2DA2 A;  2JN6 A;  4UUT A;  3D1N I;  2HXO A;  3BR2 A;  1Z0X A;  3H3V K;  1MBE A;  3ZOB A;  3GTK J;  3SJM A;  1SAN A;  1ETV A;  4A3E J;  2XPV A;  3HOZ J;  3OSF A;  2G0E A;  1MSE C;  1XC5 A;  3MVP A;  1RKW A;  3BG5 A;  1FEX A;  2Y9Z A;  1HOM A;  3DCF A;  3GTP J;  5C4J J;  3FKI J;  2IBD A;  1MBG A;  2WV1 A;  3TED A;  5IPA A;  3JRI A;  2PMZ N;  2NVQ J;  3GTG J;  4G12 A;  5EG0 A;  1RES A;  2E2J J;  4XIC A;  2LD5 A;  3FIW A;  3FK6 A;  3PM1 A;  4IHY A;  2FX0 A;  4C3J J;  5GPC A;  1YRN A;  5IYC J;  4DZJ A;  5EEA A;  2JWT A;  1JTX A;  3BR3 A;  3A01 A;  1IDY A;  1LE8 B;  2Y0S N;  2Y9Y A;  2MG4 A;  2WAQ N;  1IC8 A;  2R5Z A;  3HOU J;  1AHD P;  1A5J A;  1TC3 C;  2GBY A;  2CUF A;  2X6O A;  3RZO J;  1YRN B;  2DJN A;  4C2M J;  4BY1 J;  3OIO A;  1QRY A;  5IYB J;  5M3F J;  2Y30 A;  3A01 B;  3A03 A;  5FKK A;  1U9O A;  2R5Z B;  2HOS A;  3ZQL A;  2DMQ A;  1WPK A;  4DZP A;  5IOY A;  1OCP A;  2EZI A;  3BR6 A;  5K7F A;  2P81 A;  4BBS J;  4IEJ A;  1UHS A;  4X1E A;  2HOT A;  1GVD A;  2EZK A;  5J3L A;  3LSP A;  3RKQ A;  3WHB A;  1ZTR A;  3M4O J;  1POG A;  2QCO A;  5J1R A;  1ZQ3 P;  5IP9 J;  2CJJ A;  4A3D J;  4IHW A;  1RR7 A;  1PUF B;  1O4X A;  1BA5 A;  1S7E A;  2DA6 A;  3G1L A;  4JP0 A;  2HYJ A;  1APL C;  1FTT A;  1WI3 A;  5J1U A;  4M3E A;  1WCM J;  1GV5 A;  1XS9 A;  2LKX A;  4QIW N;  2AHQ A;  2E19 A;  3CDL A;  3QQA A;  2JA6 J;  3RQI A;  5F04 A;  5EZH A;  4A3B J;  3WHC A;  2R5Y A;  3S1Q J;  2XRL A;  2LVS A;  3L1P A;  1LFB A;  3HOV J;  3JRH A;  2ECB A;  2VPR A;  1IV6 A;  2R5Y B;  2NOG A;  2ECC A;  4BY7 J;  5FKL A;  3B6C A;  5BNG A;  2EZH A;  4FE7 A;  3GTJ J;  2EBI A;  5E3M A;  9ANT A;  4RBO A;  4IHX A;  2RAE A;  1F43 A;  5M5Y J;  2M2E A;  4W97 A;  3OSG A;  3RZD J;  3HM5 A;  3HOW J;  2N8G A;  2VKE A;  3S17 J;  5FKO A;  4A93 J;  2JJ7 A;  2MSY A;  5FKM A;  3LOC A;  3I4N J;  2YU9 J;  3NAU A;  3TW6 A;  4C3I J;  5FLM J;  2LP0 A;  2FQ4 A;  4UUS B;  5M5W J;  5IYD J;  3LSG A;  1JKO C;  1G2H A;  1TWH J;  5F0H A;  4MIM A;  2NVT J;  2JK3 A;  1MBF A;  4A69 C;  5C3E J;  5IOZ A;  2K9Q A;  4FE4 A;  2R93 J;  1Y1W J;  1TWC J;  1B72 B;  1H89 C;  1AKH B;  4CYC A;  1ORK A;  1VND A;  3F0C A;  2K40 A;  5EYR A;  2HOA A;  3HOX J;  3ZQC A;  2O8K A;  5GPA A;  4A3L J;  4CYC B;  5EF6 A;  1RET A;  4XID A;  2DA4 A;  1WH5 A;  1MBH A;  3GTM J;  4M3F A;  3JRC A;  1ETQ A;  1LE8 A;  1F36 A;  1ZK8 A;  5FLV A;  2R92 J;  1DU6 A;  3HOY J;  1U8B A;  1ZKG A;  4JX5 A;  2HI3 A;  3BR1 A;  2COB A;  4GFB A;  5F0F A;  3JRE A;  1E3O C;  2OPT A;  2JA5 J;  4RDU A;  2ID6 A;  3ZQF A;  3UKG A;  2CU7 A;  3GTO J;  2I10 A;  2DMN A;  2TCT A;  2CQX A;  3TP3 A;  2HDD A;  2LTP A;  3ZQH A;  3HDD A;  4X6A J;  4Y52 J;  4M3G A;  1H8A C;  1FJL A;  2L7M P;  2H1K A;  1X2N A;  3DEW A;  1ZR4 A;  1IJW C;  5EGO B;  1HF0 A;  2LY9 A;  2L7F P;  5FKN A;  3ZQG A;  2ME6 A;  4XRS G;  2EZL A;  2XGC A;  2XPW A;  1TWA J;  1UG2 A;  3BTJ A;  3QPL A;  1EF4 A;  4A3C J;  4B4C A;  2E2I J;  1T56 A;  1OJL A;  1X58 A;  4BKX A;  1PUF A;  1GV2 A;  3BG3 A;  2DMP A;  4S0H B;  5F1J A;  4DYR A;  1B8I B;  1BW5 A;  2CRG A;  3SDG A;  1NK3 P;  1JUS A;  3S16 J;  3HGY A;  2FJ1 A;  5M5X J;  5IP7 J;  3LSR A;  1U78 A;  2M9H A;  1ENH A;  4BXX J;  1JKQ C;  3IH4 A;  2ZB9 A;  3LSJ A;  4I76 A;  3Q3S A;  4V2G A;  1QPI A;  4V2F A;  3CMY A;  4FTH A;  2NVX J;  3SFI A;  2GM4 A;  1HDP A;  1ZGW A;  1FTZ A;  3S1R J;  3C2B A;  4FIS A;  4M3B A;  2ME0 A;  3S15 J;  4IHV A;  1VF9 A;  3IV5 A;  2TRT A;  3G1O A;  3HBL A;  5DTD A;  3JR9 A;  3S2D J;  3H0G J;  2ID3 A;  2HXI A;  5M3M J;  1XG1 A;  1JJ6 C;  4A3I J;  3BQY A;  1JT6 A;  3Q0U A;  3O8G A;  1JKR C;  1K83 J;  1IGN A;  3BG9 A;  2HQ5 A;  3BT9 A;  1ETO A;  5JLX A;  1WGX A;  1GT0 C;  2XPU A;  3LNQ A;  2D5V A;  1T33 A;  2NS8 A;  4QTR A;  4XRM A;  3BTL A;  4ABZ A;  2L9R A;  2DMT A;  4MO7 A;  2XB5 A;  4A3M J;  3G1M A;  3JRG A;  4JX4 A;  1RKT A;  3E7L A;  3PO3 J;  4UUS A;  3BTC A;  5K7Z A;  1OCT C;  1JGG A;  2R7Z J;  1WH7 A;  4B3A A;  1MBK A;  2LFB A;  3IH3 A;  3Q0W A;  4AC0 A;  1FIP A; 
#chains in the Genus database with same CATH topology
 1ETK A;  1OYI A;  5E3N A;  1MND A;  1VI0 A;  1IUF A;  1D5Y A;  4ENM A;  2HZT A;  5LLQ A;  1FYL A;  3L2C A;  2IA1 A;  3KE2 A;  5J4V A;  2DMU A;  4IPA A;  4XLP F;  4ZDO A;  3CO6 C;  2O3F A;  3SZG A;  1YW8 A;  3KP3 A;  3V8J A;  2EIL H;  4ZZL A;  5DM6 F;  1EJ9 A;  4BL0 B;  1G3S A;  1ITY A;  1W7P A;  1K61 A;  1ZRD A;  3SYT A;  5BPI A;  3DBR B;  4G94 A;  3ZN1 A;  4OIQ F;  5KVR A;  2I5U A;  3BR0 A;  4MQ9 F;  5EDN A;  2CFO A;  1W0U A;  2ETH A;  2HTJ A;  5FD5 A;  1HQC A;  4OIR F;  2JPC A;  3AL0 B;  1FOK A;  1I3Q J;  2JT1 A;  2L0K A;  1OIS A;  4MLO A;  4IQ4 A;  4P5O A;  5H6Q A;  1YYV A;  3L2W A;  3DKW A;  3ZQQ A;  2MD5 A;  3ZQI A;  3C1D A;  3R6S A;  3N4M A;  1LEB A;  1FYM A;  1EKE A;  3E5U A;  3SQN A;  3MKY B;  4MFD A;  1SMT A;  1AWC A;  1XD7 A;  4E6K G;  2QQ8 A;  4P9F A;  3FDY A;  1K4T A;  1O3Q A;  2LBF A;  3S14 J;  5F27 A;  1QZY A;  2JRT A;  2HVR A;  2EQR A;  4XRF A;  2M8G X;  3IH2 A;  3JRB A;  4QSH A;  4HRI A;  2W82 A;  1VFC A;  3KYC B;  4BEH A;  1SD6 A;  1U9N A;  2KIS A;  1Y56 A;  3LSI A;  2E7W A;  2OQR A;  3DPL C;  1A04 A;  4CGZ A;  1P4W A;  2BY0 A;  4MGR A;  4XLH A;  3MZH A;  2YX4 A;  2EV6 A;  5C4X J;  2L7Z A;  5ILV A;  4UUV A;  4IRG A;  1UB9 A;  2PG4 A;  4LGW A;  1Z7L A;  4XSZ F;  3JTG A;  2JMW A;  2HQA A;  5B66 C;  1UCR A;  4XLF A;  2YS9 A;  4HLX A;  4XN3 A;  2CWE A;  4LG0 A;  2NS7 A;  2V6C A;  3K1N A;  3P9C A;  3D5L A;  2XAH A;  5E3O A;  2L7K A;  1P2F A;  2CFX A;  2YUS A;  1LEA A;  2VXD A;  5HLG A;  1BI1 A;  3JSP A;  3DF8 A;  1V3F A;  3HL2 A;  2QEN A;  1F1Z A;  5CVJ A;  2XVC A;  2WB1 N;  2VC1 A;  3QYF A;  5EZG A;  3WTU C;  4UVA A;  2HOE A;  4V19 K;  3TW7 A;  4DJA A;  4WWC A;  1O3S A;  4ZYA A;  1X4O A;  3KEY A;  1O3R A;  2EH3 A;  2HEO A;  5HNH A;  4NDL A;  3IWZ A;  1UHM A;  3HXL A;  1Z77 A;  1F9N A;  2PJR B;  1LB2 A;  3NWS A;  3RKY A;  2P0W A;  5K7H A;  3GFJ A;  1Y0U A;  5CVU A;  3P5J A;  4D5C A;  5TIS C;  2QLZ A;  4YFX F;  3S2H J;  2H6B A;  2FSW A;  4GGG A;  1BR2 A;  4NBQ A;  1Q1V A;  2X48 A;  4LB5 A;  4ZZD A;  2DJI A;  3CMM A;  3VYT B;  5KK1 A;  2BYV E;  1KU9 A;  2Y2Z A;  4HYE A;  1TT0 A;  1TLH B;  2WBM A;  3RPU A;  5LHG A;  1Z05 A;  2FU4 A;  4D7N A;  3L2V A;  1OKR A;  1IN7 A;  2E5N A;  5D8L B;  3CP2 A;  4LLG F;  2CUJ A;  1YJW I;  5F1R A;  4BJ6 C;  2ZJ2 A;  1SFX A;  3WG7 H;  4EJO A;  4CSW A;  4EV0 A;  4A12 A;  4D7M A;  5D6F A;  4ESJ A;  3WE3 A;  1QVT A;  1W0T A;  2XAJ A;  5ICC A;  1HKS A;  1I39 A;  2KQR A;  1JE8 A;  5CYV A;  1TWG J;  1Y1V J;  3TP0 A;  1S7O A;  2DTZ A;  1P9Q C;  2EPF A;  3ISP A;  3F3X A;  3D1N I;  2ADU A;  1QO0 D;  5KNL A;  3I71 A;  3GTK J;  5L3C A;  1WJC A;  2CGP A;  1XDS A;  1V5F A;  2HWV A;  4P1W A;  1Q1H A;  3K4C A;  3AG1 H;  1RR8 C;  2OU2 A;  3MVP A;  3F6O A;  2F2E A;  3BG5 A;  2DBB A;  4CZC A;  2M4K A;  3DCF A;  2DDA A;  4BAC A;  3SHF A;  1MBG A;  1U5T B;  2RN7 A;  3CF2 A;  2KHM A;  1WZ2 A;  2UZK A;  2FBH A;  1RES A;  4PJN A;  4KIT B;  2DT5 A;  3FIW A;  4A0Z A;  5D6E A;  3UR3 C;  3FK6 A;  4MTE A;  3FHZ A;  2K4J A;  2RKH A;  2QEX I;  3GZN B;  2FX0 A;  1MNE A;  4C3J J;  2VOO A;  4RLQ A;  2VOP A;  4ESB A;  4IRI A;  1YRN A;  1IV8 A;  2IA2 A;  4XON A;  1JTX A;  4BS9 A;  3A01 A;  1IDY A;  2UV1 A;  3HOU J;  3K4B A;  2DJN A;  4C2M J;  4BY1 J;  5DM7 F;  3LSH A;  4HW0 A;  2FQ3 A;  5CQG A;  4RM2 A;  5DCM A;  1JXS A;  1H9T A;  4BHP A;  2H1L A;  2E5Z A;  5CVR A;  4EAT A;  5FRN A;  5J8F A;  3VEP A;  3AKZ A;  3MFK A;  1FNN A;  1R5H A;  1OCP A;  1MJ9 A;  1WWX A;  1O3T A;  3W3C A;  3TDZ C;  3S3M A;  2EZI A;  3TGN A;  2PI0 A;  2CYY A;  2KIU A;  1ODD A;  2BVM A;  2EIK H;  3CES A;  3L7W A;  4IO9 F;  3AG4 H;  4BBS J;  4H4K C;  5LGT A;  4L0Z B;  4X1E A;  4IX7 A;  2DK5 A;  1VQ4 I;  4DBR A;  2EZK A;  5J3L A;  2MLG A;  3A1Y A;  2ZO4 A;  1PP7 U;  1X1B A;  3M4O J;  3DXJ F;  2QCO A;  2PJR A;  4M72 A;  1LPQ A;  4BHC A;  3O6B B;  1QGP A;  4ANJ A;  4BE2 A;  5H6R A;  1KON A;  4A3D J;  1O4X A;  1FMV A;  5KAF C;  2DA6 A;  3GLL A;  2GOM A;  3LMM A;  3OS1 A;  2EJR A;  3PQJ A;  4C2T A;  1E0E A;  2DXI A;  4BXF A;  2E19 A;  2Q1Z B;  2FF4 A;  4LD5 A;  4X0G A;  1HKT A;  3QQA A;  1T0F A;  3BC8 A;  3HTS B;  2G9W A;  4A3B J;  2VT3 A;  3TO7 A;  2R5Y A;  2OA4 A;  3S1Q J;  1QU3 A;  1D0Y A;  2LVS A;  1XGS A;  3DU6 A;  3ABM H;  2Q2E A;  3JRH A;  3DKY A;  3RJP A;  2ECB A;  2VPR A;  1ACI A;  4WF2 A;  2ZSH B;  4BDY A;  3LWF A;  4BY7 J;  2ZJP F;  2GA1 A;  5BNG A;  4G9Y A;  3GTJ J;  2DDB A;  1R1T A;  4LLN A;  2VBX A;  1KYZ A;  5DV5 A;  2L54 A;  2P5L C;  4WXH A;  3L00 A;  1YO5 C;  4HNT A;  1XPX A;  2ELJ A;  3OSG A;  3HOW J;  3LA7 A;  3HM5 A;  4IOC F;  1TQP A;  5D5X B;  2N8G A;  1VQ6 I;  1YTY A;  1EH8 A;  3F72 A;  2W25 A;  3IL2 A;  3HSE A;  4NNJ A;  3CJR B;  2X1D A;  5FKM A;  1IXC A;  1R6R A;  3LA3 A;  5LFA A;  1K78 A;  1IXR C;  3K1M A;  4I98 B;  2BEO A;  4A0Y A;  4YRV A;  2FQ4 A;  1R36 A;  5F0H A;  3L2R A;  2JUC A;  4Q48 A;  3RTR A;  3KYD B;  4FE4 A;  4GYI A;  3U2R A;  2OUM A;  1K7A A;  2Y0M A;  1B72 B;  2VN2 A;  1TNT A;  1XN7 A;  3P7N A;  2F5E A;  1ORK A;  5FD6 A;  3F9K A;  2AQE A;  2PBI A;  4NUB A;  4U0V A;  4PGH A;  3HOX J;  2NVU B;  4HBL A;  3EPZ A;  3GLX A;  4A3L J;  3OOP A;  1D8J A;  4CYC B;  4KDP A;  3F21 A;  2XAU A;  2M7B A;  1WH5 A;  3O2P E;  3E5Q A;  1K6Y A;  1S3J A;  4M3F A;  3JRC A;  3ABT A;  1QQI A;  1ZK8 A;  4K2E A;  3HOY J;  4UXN A;  5AON A;  1ZKG A;  2I8D A;  3QU6 A;  2Z5U A;  3E6D A;  3R60 A;  1XCB A;  2COB A;  5F0F A;  3JRE A;  4LK1 F;  2JA5 J;  1P6R A;  4RDU A;  3K4J A;  2LNB A;  1KQ0 A;  3O3K A;  2DMN A;  2MH9 A;  2CQX A;  2K3P A;  2BHY A;  2TCT A;  1S5L C;  3M8E A;  4X6A J;  2STW A;  2E1N A;  3V7R A;  2V6E A;  3C3W A;  1BOB A;  1HSJ A;  3AFH A;  2Q8K A;  3DEW A;  1BR4 A;  3AG3 H;  1I5Z A;  1F4K A;  2L9V A;  2LY9 A;  1FOW A;  1ZAO A;  1W36 C;  2XPW A;  3F8N A;  3QPL A;  4II3 A;  2OC6 A;  4M6Y A;  1EF4 A;  4B4C A;  2EIM H;  3VWB A;  2VE9 A;  3PNY A;  4YFK F;  5F1J A;  4KIS A;  4DYR A;  3RIR A;  3CO7 C;  3S16 J;  2FJ1 A;  4OWR B;  2HQR A;  4PK4 A;  1GHC A;  1X3W B;  3VDX A;  1QPI A;  3BLY A;  1LQ1 A;  1HST A;  4BJ5 C;  1LJ9 A;  2GM4 A;  4EM2 A;  3F8B A;  3AL0 C;  4TV7 A;  1FTZ A;  2V7F A;  2ME0 A;  3PIP F;  1B4A A;  3TQN A;  2DFF A;  4OOI A;  1QNT A;  2F5V A;  5H2F C;  2QBY B;  3S2D J;  1ZLK A;  4KIG A;  5GAD J;  2ID3 A;  3SDB A;  1XG1 A;  3BQY A;  1JT6 A;  1S9H A;  2IGN A;  2LG4 A;  2XPU A;  2LF7 A;  2X6Y A;  2FXA A;  2E71 A;  2CW7 A;  3C2G A;  3E0J B;  3ZR8 X;  2R7S A;  4RMN A;  2ESN A;  2FBI A;  4MO7 A;  3GO5 A;  4MEX F;  3LA2 A;  4R1H A;  3A0B C;  2P7C B;  4EJT A;  3H9G A;  3IC7 A;  2MA3 A;  1RKT A;  4P96 A;  2LKS A;  5ICF A;  4B3A A;  2M3A A;  3IH3 A;  3KFW X;  3Q0W A;  3KZZ A;  2VJ4 A;  1TWF J;  3L2U A;  4WXD A;  2BXZ A;  3KLO A;  3QP5 A;  1B72 A;  2GLO A;  4HF0 A;  1MJA A;  3RKW A;  1BI2 A;  1MMG A;  1OYW A;  2LR8 A;  4KYW A;  3QAH A;  5DCF A;  3GZ6 A;  4AVP A;  3SFZ A;  3OYJ A;  2BY1 A;  2NVY J;  3IUO A;  1IN5 A;  4B3X A;  2L5Q A;  1TP4 A;  2R3S A;  3VYR B;  3E6C C;  4L9N A;  2Y75 A;  1I1G A;  1B59 A;  5E1Z B;  3F22 A;  3CF5 F;  2IS1 A;  4PGG A;  5LBQ A;  1W7P B;  1YG2 A;  5D8K B;  4XOR A;  4QPO A;  3C2H A;  3I54 A;  1O7L A;  4XLA A;  3CJT B;  3OYC A;  3V42 A;  2IGK A;  1J2X A;  2P4W A;  4WCG A;  3CCR I;  4A3F J;  4CIC A;  2F48 A;  4D5F A;  5BPD A;  3IKV A;  3J7Z I;  1GXQ A;  4EJW A;  1SEU A;  3G71 I;  1OCC H;  4GXO A;  3WU0 A;  2K27 A;  3HYI A;  2E1O A;  2WTE A;  3FIS A;  4B8X A;  1RC9 A;  2HQN A;  2M30 A;  2LBF B;  4A2U A;  3M1C A;  4KMF A;  1S8N A;  1Z3Y A;  4KN7 X;  2YR2 A;  4QPQ A;  1A6I A;  1T0F C;  3PO2 J;  3CCS I;  4XN0 A;  2KJB A;  2QQ9 A;  3JRF A;  3EDP A;  1NHA A;  4A5M A;  2QF7 A;  2W24 A;  1MMA A;  1KU3 A;  3S2W A;  2LH9 A;  4BEH B;  4DYQ A;  3HB9 A;  4LB6 B;  1MH3 A;  2VUM J;  3K4M A;  2W00 A;  4HV6 A;  1BN5 A;  3EET A;  1TBX A;  3EYI A;  1IDZ A;  4I2O A;  3I64 A;  1MSF C;  2NYX A;  1BL0 A;  3KZI C;  5J4Y A;  3I55 I;  2Z99 A;  5HVQ C;  3K70 D;  3QYB A;  2AO9 A;  5LRR A;  1B9M A;  3G4S I;  2Z16 A;  3EYY A;  5A2Q K;  1LFU P;  3OOU A;  3H3Z A;  2F5C A;  3BRO A;  1IN8 A;  2A5W A;  2OF7 A;  4RB3 C;  2F5D A;  4CHU A;  3OMY A;  2R7Q A;  2QBY A;  4EEF G;  1FBQ A;  2K85 A;  3I53 A;  3K4N A;  3M3Y J;  2K3F A;  2MLK A;  3IAM 2;  5HOD A;  4S05 A;  4PFO A;  3CCE I;  1I50 J;  4AIK A;  2JPB A;  3J80 K;  1U5T C;  1I6H J;  3BCA A;  2DA5 A;  2OTL I;  1HC8 A;  1EV7 A;  4A0X A;  2R7O A;  3LQQ A;  1JUP A;  3OYA A;  1EH6 A;  1HDD C;  2Z9O A;  1OMI A;  5FJ8 J;  2OZ6 A;  2WWY A;  2FML A;  1ETW A;  1DP3 A;  1ZGA A;  3ONQ A;  4DW6 A;  3M7G A;  2HTS A;  4U0W A;  3O8H A;  2WB1 A;  1H88 C;  1OFC X;  1ZGJ A;  4WX9 A;  3MKL A;  3MWM A;  3CD6 I;  3W2V A;  4KIB A;  3VFZ A;  4NHJ A;  5TRD A;  1FWZ A;  2IT0 A;  1NTC A;  1MNM C;  2HZD A;  4M3D A;  4ZH4 F;  1GLN A;  1MMN A;  3V8K A;  2DN0 A;  4MFE A;  4ON0 A;  2M34 A;  1VQ5 I;  2DOF A;  3OYK A;  3LFU A;  3OWT A;  5CLS A;  4B1R A;  4JX6 A;  4M9Z A;  5IP6 A;  2XGD A;  1RUN A;  4IHS A;  2B0L A;  4JK1 X;  4U7D A;  2EA2 A;  2HS5 A;  5C44 J;  1X3Z B;  2WV0 A;  1YS7 A;  2ELK A;  3VSK A;  4L18 B;  2JN6 A;  2MFZ A;  2HXO A;  4MQV A;  4J01 A;  2OQG A;  3H3V K;  2UWM A;  3OV8 A;  3SJM A;  1VQ9 I;  1SAN A;  1X19 A;  2JSC A;  1ETV A;  4HG2 A;  3TL4 X;  2RRE A;  1UEL B;  5CKT A;  3OSF A;  1MSE C;  3GW2 A;  1RKW A;  5D4S A;  3JAM Z;  1C0W A;  4ZC3 A;  1FEX A;  1YS6 A;  4XLC A;  2AS5 F;  4KN4 X;  3GTP J;  1Z6T A;  1IUY A;  5B5E C;  4ASN A;  1E17 A;  1D0Z A;  4FQG A;  1BR1 A;  2DLL A;  1OCR H;  4XOP A;  4OU0 A;  1QBJ A;  5KHD A;  4PJL A;  4ZYD A;  2JA2 A;  2PMZ N;  3ZXS A;  4XIC A;  1LVK A;  4BDZ A;  2Y48 A;  4CCJ A;  1S29 A;  3HSR A;  1YLF A;  2KRC A;  4IHY A;  2E36 A;  2P7V B;  5HS8 A;  1I1S A;  1VTN C;  1XX5 A;  1XMX A;  3FMS A;  5IYC J;  2UXX A;  5D5V B;  4XQF A;  5D5U B;  4DZJ A;  5EEA A;  3WU2 C;  3F23 A;  1IN6 A;  2JWT A;  3BR3 A;  4MNU A;  4B09 A;  1A36 A;  3E6M A;  2Y9Y A;  1KYW A;  2WAQ N;  1IC8 A;  1V5G A;  2R5Z A;  3CCJ I;  2CUF A;  1YRN B;  5L3E A;  4E7L A;  5M3F J;  4OIP F;  3A01 B;  1VQN I;  3A03 A;  1OR7 C;  1U9O A;  1FOY A;  3HPH A;  2HOS A;  1VQO I;  2QKL B;  3OL3 A;  3RSN A;  1ERD A;  3ABL H;  4DZP A;  5DCM B;  1BIA A;  1J09 A;  1RI7 A;  2HYF A;  1QA6 A;  1XCV A;  5LRS A;  3J81 K;  4A6E A;  4DNC A;  4IEJ A;  2HOT A;  2V1X A;  1GVD A;  5ICE A;  2GXA A;  3HOT A;  4Y13 A;  2DYS H;  1POG A;  5J1R A;  1BI3 A;  3D5R C;  4U0Y A;  3KYL A;  1RR7 A;  1PUF B;  2BBY A;  4XLN F;  4L5J A;  3HZJ A;  2WY7 Q;  4EGZ A;  2M4G A;  3GFL A;  4M3E A;  1WCM J;  1K79 A;  5LGU A;  2QM3 A;  1PDN C;  1O7F A;  2FNA A;  2LKX A;  4BU2 A;  1FBU A;  1U0J A;  3GXO A;  5F04 A;  2L4A A;  3HRU A;  1T08 B;  2EFO A;  2Z3Y A;  2QGU A;  5FFZ A;  4HLY A;  3IRR A;  2BOL A;  2XRL A;  4ZJZ A;  1I3A A;  4QLC U;  1SVM A;  3ASN H;  1MMS A;  3EQL F;  4AIH A;  2G7U A;  5AIP A;  3HOV J;  3RQ4 A;  2L3D A;  1VQ7 I;  1IV6 A;  3CME I;  3L2Q A;  1SVL A;  2L9N A;  2R5Y B;  2R7X A;  3KET A;  2NOG A;  2ECC A;  5JFR A;  3SEQ A;  3BJO A;  1UHW A;  4I0B A;  2BY3 A;  3B6C A;  4CYD A;  2Q2E B;  4FE7 A;  2PN6 A;  1F5T A;  2EBI A;  2HR3 A;  4BGD A;  2E1C A;  4RBO A;  2BV6 A;  2RAE A;  3NEU A;  2A05 A;  4JBA A;  3A2K A;  5H20 A;  3CDH A;  4FET A;  5FKO A;  4L9T A;  3BZK A;  5KAI C;  2EV5 A;  2LKP A;  1FMW A;  1XDU A;  2Q0O A;  2JJ7 A;  1ULY A;  2MSY A;  2VJI A;  3VOE A;  2VQG A;  3LOC A;  3A4C A;  2X6X A;  1XSD A;  4HSR A;  3P9I A;  5E1X A;  4C3I J;  5M5W J;  4UUS B;  2LP0 A;  3BJA A;  2KIF A;  3KP2 A;  4UV9 A;  5AIQ A;  2FBK A;  4UHT A;  2JK3 A;  3ZCO A;  4HDU A;  3F8F A;  1K78 B;  1XMK A;  5EJC A;  2R93 J;  4NB5 A;  1X1A A;  1FY7 A;  2X6W A;  3HSF A;  1H89 C;  4BAY A;  1P92 A;  3RCO A;  1DDN A;  2PQ8 A;  1X1P A;  5EYR A;  3CC2 I;  2K02 A;  3IHU A;  4I99 C;  3WOD F;  1T39 A;  1WJD A;  2UXN A;  3BG6 A;  5GPA A;  3GX4 X;  3CMA I;  1RET A;  3CUO A;  1LDK B;  2DA4 A;  3E3V A;  2D1H A;  3HRT A;  5FLV A;  1EH7 A;  3E5X A;  1U8B A;  2R7T A;  4JX5 A;  2LC2 A;  4FAS D;  2OCC H;  2P8T A;  1USS A;  3OYF A;  3H5N A;  4E7S A;  2ACJ A;  1E3O C;  1T6S A;  3ZQF A;  2X51 A;  2CU7 A;  3MKW B;  4C9Y A;  2W4S A;  3TP3 A;  2PLY A;  4HEA 2;  2LTP A;  2BXY A;  4YII A;  5IY5 H;  2BGC A;  4UVC A;  2H1K A;  2KL4 A;  1ZR4 A;  4XKC A;  1JHH A;  2EB7 A;  1HF0 A;  1SD4 A;  3ESW B;  1PUE E;  5FKN A;  1PVE A;  2E60 A;  3DEU A;  1VQ8 I;  2ME6 A;  2OCE A;  4XRS G;  3IAS 2;  5LEJ A;  5CPR B;  2XGC A;  4BQQ A;  1IN4 A;  3MD2 A;  1TQI A;  2M87 A;  1T56 A;  4CCO A;  2ZKZ A;  1X58 A;  1BC7 C;  3OYB A;  1PUF A;  1GV2 A;  1BW5 A;  3LQR A;  1JUS A;  2DFH A;  3N05 A;  3DEE A;  2M8E A;  1YFH A;  1U78 A;  3FXU A;  3MQ0 A;  1MD0 A;  1W5T A;  1TW2 A;  4I02 A;  2V79 A;  2E34 A;  2EK5 A;  1WRJ A;  3Q3S A;  3NRV A;  4V2G A;  4V2F A;  4FTH A;  1VQL I;  2R7U A;  3GF2 A;  4MHG A;  2E1M B;  4UB6 C;  3C2B A;  2ZJQ F;  1K6O A;  2IS6 A;  1VF9 A;  1R58 A;  2ZNZ A;  1R5G A;  1UJ8 A;  3WE2 A;  2L02 A;  3HBL A;  2DQL A;  4ZDL A;  2VBY A;  3JR9 A;  3Q5F A;  1W5C C;  3GEZ A;  3ZMD A;  4U7B A;  2HXI A;  4FHT A;  2EFW A;  3Q0U A;  1UZC A;  4PUS A;  3SZP A;  3BT9 A;  2HVS A;  1GT0 C;  1WGX A;  1HBX G;  4EJU A;  3VYU B;  3I3L A;  1T33 A;  2IW5 A;  1HXD A;  3QOE A;  4ENJ A;  4RGS A;  4E7J A;  3KEQ A;  1R4N B;  4Z6Y A;  2K9L A;  2F4M B;  2DYR H;  2DFE A;  3HUG A;  4XRM A;  1R00 A;  4F92 B;  5LGN A;  3BTL A;  3ABK H;  4ABZ A;  4GDF A;  2RNJ A;  2L9R A;  4IXA A;  2ZXW H;  2OBP A;  1R7J A;  2XRN A;  5E8I A;  5DUK A;  2RGV A;  2RDP A;  3PNV A;  2P5V A;  1KQ9 A;  4B47 A;  3G1M A;  4BQA A;  2LRD A;  4NC8 A;  4RB0 A;  4XKV A;  3E7L A;  3IWF A;  4UUS A;  3BTC A;  4XM3 A;  1OYY A;  2KPM A;  2QYO A;  1JGG A;  3KPH A;  2AXT C;  2KZV A;  1SD5 A;  4AC0 A;  1FIP A;  2K9S A;  5E17 F;  1G4D A;  2KKO A;  3FMR A;  2IEK A;  4HNV A;  3U21 A;  5JR3 A;  2DW4 A;  1IG7 A;  4Q4Z F;  4AIJ A;  2XDV A;  3KX2 A;  5EEG A;  1ZHF A;  2LRE A;  4Y7N J;  4Y4R A;  1J59 A;  1G6N A;  2DA1 A;  2HPM A;  5HLI A;  3GYH X;  3I4P A;  3FXQ A;  2NS0 A;  4BNC A;  2D2W A;  2O61 A;  1H0M A;  3S1N J;  2X1E A;  1FP2 A;  1U3E M;  1OLT A;  2CQ7 A;  3I59 B;  3CLO A;  1YX3 A;  5TJJ A;  2KDO A;  2Y69 H;  4XRS A;  5BS6 A;  2R0Q C;  2M1B A;  4HX7 A;  2X4H A;  2QWW A;  4BE1 A;  3JTH A;  4IVN A;  2A07 F;  1FP1 D;  1ZG1 A;  4RAG A;  3T8T A;  1ON2 A;  2M7A A;  1RRJ A;  5F08 A;  1HCR A;  4IOA F;  1YW9 A;  3CJQ B;  3ZMZ A;  3T0Y A;  1QVU A;  2FA5 A;  3VPR A;  3HOS A;  1RUO A;  2CMP A;  4M6V A;  3JSO A;  5JVT A;  1D1B A;  1H9G A;  3MZY A;  2XUB A;  5E3L A;  3GFI A;  2J5O A;  5BQT A;  2O03 A;  1E2X A;  2KRH A;  2CW0 F;  3LFK A;  4NQW A;  1XGO A;  2FEZ A;  5GAH J;  2FD5 A;  2K7L A;  2OAZ A;  1FIA A;  2IAI A;  3K2A A;  3OR1 C;  2P5K A;  3CQZ J;  3DTE A;  2XV4 S;  3JRA A;  2IP2 A;  4JYK A;  3J7Y J;  4LG3 A;  3Q0V A;  4HX4 A;  1V54 H;  4BQO A;  4AU7 A;  1MH4 A;  2XC7 A;  2QQB A;  3DQV C;  3HKZ N;  2R4G A;  3ASO H;  3J7A O;  2X0L A;  3L9F A;  2A5Y B;  4IJA A;  3QPS A;  5J47 A;  2CUE A;  1HLV A;  4Y33 A;  1SFU A;  2JA8 J;  2KT0 A;  3BG7 A;  4LIV A;  3WTZ A;  1MBJ A;  1Y39 A;  2GA2 A;  4OIN F;  3BR5 A;  4E4H A;  2XSD C;  1FX7 A;  2O9L A;  2EFN A;  3FF5 A;  5FFX A;  2VI6 A;  3FZV A;  1SFO J;  2BVL A;  5EEH A;  3FX3 A;  4GCV A;  3DTK A;  2ZFW A;  1UMQ A;  4FX0 A;  5DD8 A;  1P7J A;  3ECO A;  4HQM A;  2KIQ A;  1R9T J;  1IRF A;  3SXY A;  1Z67 A;  4Q47 A;  2R7W A;  2VQC A;  2AXL A;  1DQU A;  2B7E A;  3CP8 A;  1Z21 A;  3S93 A;  2F6C A;  4I6Z A;  1IAW A;  1ZR2 A;  4XK4 A;  1LUJ B;  4EM0 B;  1JT0 A;  3PFI A;  2B63 J;  2PMH A;  1IRZ A;  3BWG A;  4AUX A;  1WJ5 A;  2VON A;  2D1V A;  2WAF A;  3B6A A;  3FXR A;  4NC7 A;  2PX9 A;  3LL7 A;  1L0O C;  3IP4 B;  3MMY B;  2VE8 A;  5DD4 A;  2IVM A;  2XAS A;  3S1M J;  3FK7 A;  3HEF A;  4RA2 A;  5ILS A;  1IO2 A;  4L5I A;  5GTI C;  3GTQ J;  1ZG3 A;  1GUU A;  3GTL J;  2LLK A;  1JTY A;  5FLX K;  2OJE D;  3BPX A;  3FBI B;  4BBR J;  2JA7 J;  2ZXI A;  3F6V A;  3B73 A;  1MGT A;  2L4M A;  1LNW A;  2W48 A;  3FM3 A;  3GFM A;  2E2H J;  4G6Q A;  2DT7 B;  2R7V A;  1RZ4 A;  3BTI A;  1ETY A;  4W1U A;  1Z7U A;  2PJP A;  3I59 A;  1MMD A;  4IHT A;  2MYS A;  4AYB N;  5E1W A;  3NAR A;  1CQT A;  1MW7 A;  4RGU A;  2DA7 A;  2Y31 A;  4RB1 A;  5HS9 A;  4L5E A;  1PP8 F;  2DA2 A;  1HA8 A;  1Z0X A;  1R22 A;  1MBE A;  1WJF A;  2HYG D;  2R7F A;  3ZOB A;  3OYM A;  4FX4 A;  3OS0 A;  2XPV A;  4G7H F;  3HOZ J;  1G3W A;  2GZW A;  4LMY A;  3CC4 I;  1XC5 A;  4LK0 F;  1TTY A;  3LST A;  2Y9Z A;  2PFB A;  3OL4 A;  3D5S C;  3C7J A;  2F4O B;  1QZE A;  1R5I D;  3FKI J;  5IT9 K;  3LAP A;  2LF8 A;  1SC7 A;  1WSU A;  3CCQ I;  1P4A A;  5A2Q Z;  4II2 A;  2CG4 A;  1B9N A;  3KZY A;  4A5N A;  1VQK I;  2C6Y A;  2RVC A;  2QSG X;  1FSH A;  3ERM A;  4OMY A;  1UST A;  2XAF A;  3PM1 A;  3S32 A;  2QVO A;  2QZ8 A;  3LAJ A;  5BOX A;  4WK8 F;  2KMU A;  4LLL A;  4C30 A;  3FXL A;  3K1P A;  2KLO A;  1ZAR A;  1D1C A;  1LE8 B;  1O57 A;  2Y0S N;  2H27 A;  3J80 Z;  2CUZ A;  2A6H F;  1XGN A;  2MG4 A;  1SMY F;  3LSM A;  3BDD A;  3DFG A;  1BM9 A;  2GBY A;  3RPU D;  1RIO H;  3RZO J;  1HW1 A;  1W36 D;  1PJR A;  5B1A H;  4ETS A;  1QRY A;  3H9J A;  4KFC A;  4I0A A;  4R79 A;  2ZCW A;  2A3S A;  2PMZ A;  3GME A;  4CH7 A;  2R5Z B;  2H94 A;  2RQP A;  4N9I A;  4P9U A;  2MC4 A;  3ZQL A;  1WPK A;  3WG9 A;  5IOY A;  3G2B A;  1SAX A;  3DWL E;  2CV0 A;  4F91 B;  3BR6 A;  4F55 A;  1ONV A;  2JUG A;  1N75 A;  2P81 A;  5K7F A;  4WXC A;  1IW7 F;  1UHS A;  3CCV I;  5FRM A;  4GYG A;  1YQA A;  1YW7 A;  2XKO A;  3RKX A;  3LSP A;  4YIR X;  3T1B A;  3ZMS A;  3RKQ A;  1ZTR A;  3I9V 2;  2CV1 A;  2ZC2 A;  3QPH A;  3U1D A;  2DK8 A;  2JZY A;  4IZZ A;  3H35 A;  2CO5 A;  2WAQ A;  1ZQ3 P;  5IP9 J;  3WTY C;  4AVZ A;  4DGW B;  2CQN A;  3M9A A;  2DPU A;  2OZU A;  1BA5 A;  1MKM A;  3TOB A;  3G1L A;  4D9J A;  3RPQ A;  2HYJ A;  4M6X A;  1FTT A;  1NH3 A;  1WI3 A;  4ZYE A;  1REP C;  4BXU A;  3R61 A;  3GWZ A;  2HDW A;  1IXS B;  3WGG A;  2AHQ A;  1X1D A;  4QIW N;  4EJV A;  4HDV A;  3ZMT A;  2RNG A;  5K1Y A;  5BMZ A;  2A6T A;  2JA6 J;  5EZH A;  1P4X A;  2X1C A;  5JHU A;  3QOP A;  4OMZ A;  3L1P A;  1T2K A;  1R23 A;  2IRF G;  1LFB A;  4IRH A;  4I01 A;  2KIM A;  3DPU A;  2R7D A;  3CCL I;  5GAE J;  4HPQ A;  4G6D A;  4ESF A;  2J5P A;  4LIT A;  4PJM A;  5GAG J;  3CCM I;  3KEO A;  2EZH A;  1OCZ H;  1SD7 A;  3DTI A;  2O6G E;  2K9M A;  5E3M A;  9ANT A;  1R49 A;  1KZH A;  2VOD A;  1XSV A;  1LDD A;  3FHN A;  5ERI A;  1ZRC A;  2L2O A;  4KT5 C;  1BI0 A;  1F43 A;  4W97 A;  1FZP B;  4LJZ F;  4DIQ A;  2LMD A;  3CCU I;  2HKX A;  2VKE A;  2W84 A;  4RGX A;  4A93 J;  4CCK A;  2YU9 J;  2GWR A;  3NAU A;  4XLE A;  5FLM J;  1TNS A;  3LSG A;  5HS7 A;  4A6D A;  2NOJ B;  1TWH J;  5K5Q A;  2BW3 B;  4MIM A;  2LDU A;  4M9X A;  4A69 C;  4CCL A;  4UV8 A;  3TDU C;  1T98 A;  4BH9 A;  1LFP A;  1Y1W J;  1TWC J;  2KP6 A;  2TDX A;  2E1M C;  5E79 C;  4E70 A;  3JW4 A;  1AKH B;  2A61 A;  3QRF F;  1WJA A;  3F0C A;  3RYP A;  2K40 A;  1QHH D;  4Y3O A;  1YJN I;  1T95 A;  2JQ7 A;  2O5R A;  4XKB A;  3SEZ A;  3ZQC A;  1BOA A;  5HOO A;  2ZJR F;  3KIO A;  4IKF A;  4RS8 A;  2VKH A;  4XID A;  2CS3 A;  2F5F A;  1MJB A;  3J81 Z;  2CV2 A;  1MBH A;  2HGC A;  1OQY A;  3GTM J;  1T38 A;  2RV8 A;  3FXM A;  1LE8 A;  1VQM I;  3FMQ A;  2R92 J;  4KIF A;  1RNL A;  5F64 A;  3WTX C;  4S04 A;  5F6F A;  3ZP5 A;  1DU6 A;  3H9Q A;  3RYR A;  4F3Q A;  2NRA C;  1OCO H;  2HI3 A;  3VB2 A;  2H09 A;  3QWL A;  3BR1 A;  4GFB A;  2MBF A;  2HPI A;  4E7K A;  1WQ2 A;  2ID6 A;  3UKG A;  2I10 A;  2HDD A;  3ZQH A;  4Y52 J;  4M3G A;  1OPC A;  1H8A C;  1IZ1 A;  2DO7 A;  4ZTJ A;  1L3L A;  2W1O A;  1X2N A;  3DP7 A;  1EA3 A;  5EGO B;  4LIU A;  2IS2 A;  4MEY F;  2L7F P;  4OAY A;  3ZQG A;  3QPT A;  3R0J A;  2EZL A;  3JAM K;  4MTD A;  3BTJ A;  2ZBK A;  4EQQ A;  2CH0 A;  3V7S A;  2E2I J;  1DGW Y;  3MAJ A;  3I0T A;  3CUQ B;  1ZH5 A;  4BKX A;  3HHG A;  3BG3 A;  4S0H B;  1B8I B;  5IT3 A;  2CRG A;  1NK3 P;  3N97 A;  2VBZ A;  1S6L A;  1GVJ A;  2M9H A;  1TT5 B;  3IH4 A;  5J6X A;  2ZB9 A;  3BZ6 A;  3LSJ A;  4I76 A;  4PFP A;  1AA7 A;  2DTR A;  3FXJ A;  2XF7 A;  1HDP A;  4RAY A;  4XMY A;  4FIS A;  3VYS B;  5CVI A;  3IV5 A;  2ZME B;  2EFP A;  1UFM A;  2VAS A;  2TRT A;  5DTD A;  1YJ9 I;  2DPD A;  1Y8R B;  3I5U A;  5JHF A;  2HNH A;  5ILU A;  1JJ6 C;  2CW8 A;  1JKR C;  1IGN A;  3BG9 A;  1ETO A;  5LD2 C;  4HOB A;  1DPU A;  1SFE A;  3H36 A;  5L3G A;  4YEJ A;  3LNQ A;  2D5V A;  2ESH A;  2NS8 A;  1FOX A;  3OY9 A;  1Z1D A;  3ZMV A;  4UY8 I;  2WA0 A;  2M45 A;  1QPM A;  3DU5 A;  3H5A A;  4DOZ A;  4QTR A;  3WTW C;  1A35 A;  1D5V A;  3ELK A;  1DP7 P;  4XL9 A;  4B43 A;  4HF1 A;  2IS4 A;  2KFD A;  1WHU A;  2A68 F;  4RM3 A;  2DMT A;  1CF7 B;  3I58 A;  1DGR M;  2XB5 A;  5L3F A;  3OYD A;  1M1E B;  2LYC A;  3HUG B;  3OIP A;  3JRG A;  5FO5 A;  2E35 A;  4HX8 A;  1WJE A;  2FE3 A;  3PO3 J;  3GCM A;  4L0Y B;  1JI8 A;  2DFI A;  3AAF A;  2W7N A;  1OCT C;  2R7Z J;  2BW3 A;  1SFK A;  1MBK A;  2LFB A;  2LSO A;  5GTH C;  3T8R A;  1GV5 A;  4RLF A;  1BC8 C;  1YE9 A;  1LDJ A;  3R0A A;  1KGS A;  4ITV A;  2Z33 A;  2LOO A;  5HDN A;  5JLW A;  4E7I A;  2VQH A;  1AKH A;  4HF2 A;  4IQJ A;  2L01 A;  3GBG A;  1G3Y A;  2WAD A;  2V9V A;  5LEK A;  1YHQ I;  1YI2 I;  1J9I A;  1BJZ A;  4H0E A;  2X85 A;  3OYG A;  2X9D A;  1MIJ A;  1V5E A;  2KDZ A;  4ZYG A;  2ELH A;  2GIV A;  2VIX A;  3Q9V A;  2V9K A;  2XKP A;  5F0C A;  4C3H J;  1ZLJ A;  4CXF A;  1RPW A;  3CTA A;  1JKP C;  2K86 A;  1JJ8 C;  1BJA A;  1U6G A;  1X3U A;  2LY2 A;  2CQK A;  2WAE A;  3WGH A;  4KT6 A;  2E7X A;  4DYC A;  3E6B A;  2F4I A;  2EA4 A;  5CVV A;  1JUM A;  1A31 A;  1D0X A;  2DAO A;  4A3K J;  3K7A J;  2STT A;  4EVI A;  3OIQ A;  1HW5 A;  3UNG C;  4CCN A;  3QYE A;  4RAF A;  3OYN A;  1XB4 A;  4I7H A;  4IL6 C;  1G8X A;  3AG2 H;  4F7Z A;  1HKQ A;  1D3Y A;  2VKD A;  5EGO A;  4I09 A;  1I6X A;  2RC4 A;  3G73 A;  1YX5 A;  1JHF A;  1ETX A;  2IGO A;  2P6S A;  2EIJ H;  3GVA A;  2DA3 A;  3HGG A;  1D8K A;  4M73 A;  4EMS A;  2QUF A;  4CCM A;  5EG0 B;  1MDM B;  1IRG A;  4EM1 A;  2B9S A;  3CUQ A;  3J7A Y;  1GXP A;  4NQW B;  3M8J A;  1B8I A;  2O0Y A;  2HVQ A;  3PNT A;  5D4R A;  2EFQ A;  3TKY A;  2JVG A;  2O7O A;  5FRO A;  1G3T A;  5DS9 A;  3FBN B;  2LK2 A;  3V8L A;  1DU0 A;  1B1B A;  1X2M A;  4A3G J;  3EUH A;  1BW6 A;  4YG2 F;  4XR6 A;  1N77 A;  4HA8 A;  3QOD A;  4RGR A;  2XB0 X;  4PJJ A;  4F93 B;  2M0C A;  3IRQ A;  1Z6R A;  4J19 A;  2NNN A;  2ZME A;  3MN2 A;  1ZRF A;  3RDI A;  2YSR A;  3K69 A;  2KJC A;  2BY2 A;  2CQQ A;  4KUM A;  1VZ0 A;  2ZNY A;  4RAZ A;  1AU7 A;  1FT9 A;  4LOC A;  3PIO F;  3WTT C;  2VJ5 A;  5E20 A;  5DYM A;  5GP9 A;  4LFU A;  2UUZ A;  3H1C A;  4P55 A;  4BJT A;  4B44 A;  5DDG A;  2BHZ A;  2VXZ A;  2MW8 A;  1G59 A;  3HKZ A;  2VPL A;  4U87 A;  4KMU X;  1U2W A;  2HFH A;  3DKX A;  3I4M J;  5J1Y A;  3KP7 A;  2MGQ A;  3EUA A;  3M1E A;  1QZZ A;  2VBW A;  3CCY A;  3LSK A;  3M07 A;  3JRD A;  2A69 F;  2K9N A;  1CF7 A;  4N9H A;  1K4S A;  4XKW A;  4D0P A;  3ABU A;  4M9S A;  1WFX A;  3WU1 B;  4PZJ A;  4A3J J;  4OIO F;  2VKV A;  2R7R A;  4IF4 A;  3H3U A;  1IF1 A;  4EGY A;  1NK2 P;  1UG0 A;  2V26 A;  4FCY A;  4CO8 A;  2PEX A;  3A02 A;  3TOA A;  1MZB A;  1W4M A;  3HHH A;  2V1U A;  2XGE A;  4UB8 C;  2H6C A;  1P7I A;  5HLH A;  3PL8 A;  2YPR A;  3U9G A;  3BQZ A;  3H92 A;  3BZC A;  1NG7 A;  4YIF A;  2DCE A;  4F52 A;  1IRX A;  4XNF A;  3BJ6 A;  2H8R A;  1WJB A;  3W6V A;  2EWN A;  4HST A;  4BYY A;  1GDT A;  4L9V A;  2OV7 A;  2XIG A;  2JRM A;  4UUT A;  3BR2 A;  3D0S A;  1B6A A;  3OYE A;  3DBL B;  1DUX C;  1FPQ A;  3MKZ A;  3PFY A;  2XRO A;  1ZEL A;  4A3E J;  1TZL A;  4YFN F;  2G0E A;  1TW3 A;  2KRF A;  5DEQ A;  2L9S A;  2K4B A;  1U5T A;  3F8C A;  3L09 A;  3NWT A;  3ERE D;  1HOM A;  4Y15 A;  1X1C A;  4KJZ A;  1S72 I;  3PSF A;  3ULQ B;  3HTU A;  5C4J J;  2IBD A;  2OD5 A;  2GQQ A;  2NAZ A;  4GO1 A;  2G7H A;  2WV1 A;  4HQE A;  2DU9 A;  2W57 A;  5TGT A;  3QU3 A;  4CDG A;  1XTA A;  4AYB A;  1Z91 A;  3CZ6 A;  5IPA A;  3JRI A;  3TED A;  1DPR A;  2KZG A;  3KP5 A;  3CDI A;  3M8F A;  3OYH A;  2NVQ J;  3OS2 A;  3GTG J;  4G12 A;  2VT2 A;  5EG0 A;  1MDM A;  1R4M B;  2E2J J;  2LD5 A;  2XF5 A;  2OTJ I;  4HNU A;  3WGI A;  2YU3 A;  3R4K A;  5CJ9 A;  4JOM A;  1E3P A;  3TO9 A;  3HPG A;  3H0D A;  2VLA A;  5GPC A;  2HU9 A;  2O8X A;  2D45 A;  2ZXJ A;  3W2A A;  4QWQ A;  5J8C A;  1AHD P;  1A5J A;  4N0B A;  1TC3 C;  2X6O A;  3BCB A;  3K10 A;  3OIO A;  5IYB J;  4ENK A;  2MH2 A;  4CA0 A;  3ZGK A;  3W6K B;  2Y30 A;  3PSI A;  5FKK A;  3DPT A;  1J7K A;  2QKM B;  3WTS C;  4GRI A;  3ZN0 A;  4ZYH A;  2DMQ A;  4E7Z A;  1N78 A;  3VOD A;  4HAM A;  3T5X A;  4XSX F;  2HKO A;  2IA0 A;  3IKT A;  3Q9S A;  2ZSI B;  5FLX Z;  2QSH X;  2DOA A;  1S7A A;  2H8W A;  3BPV A;  3HRM A;  1STZ A;  3K70 C;  1W7P D;  3K4L A;  3ZRG A;  2NXN B;  3WHB A;  4BHB A;  3V4G A;  2Y0S A;  3DLL F;  2JVH A;  2CJJ A;  3TMO A;  5HLT A;  4IHW A;  4DBQ A;  2FMY A;  2XF6 A;  3KCC A;  2GXB A;  1S7E A;  3HG9 A;  2WC2 A;  4B48 A;  2DQR A;  4JP0 A;  1APL C;  2W85 A;  4CZZ A;  3G3Z A;  1XSX A;  5J1U A;  5JI6 A;  2ICW G;  1KA8 A;  2YX7 A;  4BUP A;  1XS9 A;  2QSF X;  3TBI A;  3E1S A;  3CDL A;  4BQN A;  1YIT I;  2COM A;  3H5R A;  2VQL A;  3RQI A;  4CUG A;  3WHC A;  1R1V A;  1BIB A;  1KU7 A;  3S3O A;  4ZDP A;  2GAU A;  2QQA A;  3X2Q H;  4KA4 A;  3PJR A;  1W1W E;  1J5Y A;  1SAU A;  3K4K A;  4PDK A;  1I27 A;  1J0R A;  2FOK A;  5ICG A;  2CSO A;  4N4N B;  1ZYR F;  3VSL A;  2V1D A;  1Y8Q B;  2MAB A;  3WTV C;  2NNY A;  1FBS A;  3FM5 A;  4E7H A;  3CJN A;  1LVA A;  5FKL A;  5IT9 Z;  3PUB A;  4NC6 A;  1JGS A;  1LKX A;  4C2U A;  1OR7 A;  2FNP A;  4IHX A;  3W6J B;  4Y17 A;  3A0H C;  2ISZ A;  1KU2 A;  5M5Y J;  2AQF A;  2M2E A;  3RZD J;  4G6T B;  1J75 A;  2A6E F;  4OAZ A;  2IPQ X;  1FYK A;  3S17 J;  2EIN H;  1CGP A;  3CUQ C;  3K0L A;  1UAA A;  1E3H A;  3HRS A;  3REO A;  3I4N J;  2XGX A;  4HV5 A;  2MC3 A;  5LHH A;  2DI3 A;  1YIO A;  3TW6 A;  5IYD J;  1KQ8 A;  2VC0 A;  5D5W B;  1JKO C;  3OR2 C;  1G2H A;  4YEL A;  1XGM A;  2NVT J;  3C18 A;  1HW2 A;  2GXG A;  4M71 A;  1MBF A;  5C3E J;  2JTV A;  3P9K A;  4O3M A;  3FWE A;  2K9Q A;  3TO6 A;  3ZQ7 A;  3SZT A;  3EUH C;  5IOZ A;  3G6E I;  4J00 A;  4UVB A;  4CYC A;  2ISY A;  1VND A;  4PSW A;  4HZF A;  1QHG A;  4G8X A;  2VL8 A;  1SVO A;  2ZME C;  2V9P A;  2HOA A;  3BP8 A;  4JQF A;  5JVG F;  4ZTF A;  2RQQ A;  2IXS A;  2M0M A;  2ZXH A;  3JCU C;  5HDK A;  2O8K A;  2LY1 A;  1NG6 A;  3BOQ A;  5EF6 A;  3FXO A;  3HIF A;  2GOX B;  3HJE A;  5ED4 A;  3CC7 I;  4RB2 C;  3COA C;  2BE5 F;  4XBF A;  1ETQ A;  4PCQ A;  1U8R A;  2EV0 A;  2XAG A;  1F36 A;  3ML6 A;  1WKM A;  1R71 A;  1YOV B;  4AID A;  3OYI A;  3DV8 A;  5CQE A;  3KLN A;  2XSJ C;  3HC7 A;  6PAX A;  1BBY A;  2VJJ A;  2DOD A;  2FUG 2;  4R8H A;  1Y0N A;  5L3D A;  4U88 A;  2OPT A;  4D1Q A;  1T8I A;  1FLI A;  3GZ5 A;  4PSX A;  3ECH A;  2FRH A;  3GTO J;  1V4R A;  1W5S A;  4Z2Y A;  1ZG5 A;  3HDD A;  1FJL A;  2PMU A;  3PUF A;  2L7M P;  4L9J A;  3S3N A;  5K5O A;  5FB2 A;  3RI4 A;  1A6Q A;  3K6G A;  3DLA A;  1IJW C;  2Z2S B;  5FGM A;  3NQO A;  3FKJ A;  1X4P A;  2V4J C;  3KP4 A;  1PYV A;  3I56 I;  3CLQ A;  4FT8 A;  4O5V A;  1ZRE A;  2BZT A;  2M5W A;  4N4O B;  1TWA J;  1UG2 A;  1D1A A;  2QA4 I;  4A3C J;  3QP6 A;  4KNY A;  4PJ0 C;  3W2W A;  1OJL A;  4DQ2 A;  3MZ8 A;  2VB6 A;  1WVR A;  5HDG A;  3ZPL A;  2DMP A;  3DBH B;  5B1B H;  3SDG A;  1Z9C A;  3HGY A;  2DT6 A;  1VQP I;  4XOT A;  5M5X J;  3LSR A;  1ENH A;  3FXK A;  1JKQ C;  4BXX J;  1XMA A;  2DOE A;  3K9T A;  4G7Z F;  2HDC A;  3CMY A;  2NVX J;  3U1K A;  4AM3 A;  3SFI A;  4AD9 A;  3KP6 A;  1ZGW A;  4LG0 B;  1AOY A;  3S1R J;  3PQK A;  4M3B A;  2WY8 Q;  3S15 J;  4IHV A;  2JSP A;  1TL8 A;  5E8G A;  1WI9 A;  3MCZ A;  1FC3 A;  5HNF A;  2V1N A;  3G1O A;  2Z1D A;  4UNO A;  3H0G J;  3MEX A;  5M3M J;  4A3I J;  1FSE A;  3K2Z A;  3V7C A;  3BY6 A;  1V55 H;  3ZMU A;  3O8G A;  4KIC A;  1K83 J;  5K5R A;  3S8P A;  2HQ5 A;  3GUD A;  2IGM A;  5JLX A;  3E97 A;  1N25 A;  2MD0 A;  1TQM A;  3F8M A;  1Z3X A;  1R1U A;  2P6T A;  4BE0 A;  5L3B A;  3OYL A;  2ZFU A;  5KCM A;  3B02 A;  4G7O F;  2FOW A;  2IJL A;  2GIZ A;  5E18 F;  2XAQ A;  3ROU A;  1YIJ I;  2K5C A;  5LHI A;  2XHK A;  4A3M J;  1ON1 A;  4JX4 A;  4O6J A;  3EUK L;  4ENN A;  5K7Z A;  5DUI A;  1ZN2 A;  5B3S H;  1WH7 A;  4Q5S F;  5J40 A;  4AWX B;  4M74 A;  1Y6I A;  5IP7 J; 
#chains in the Genus database with same CATH homology
 2K9S A;  1ETK A;  1TWF J;  5E3N A;  1VI0 A;  1IUF A;  1D5Y A;  4HNV A;  2IEK A;  5JLW A;  1B72 A;  2GLO A;  1AKH A;  1IG7 A;  2DMU A;  3GBG A;  4Y7N J;  2LR8 A;  1BJZ A;  2DA1 A;  2NVY J;  2X9D A;  2KDZ A;  3S1N J;  1ITY A;  5F0C A;  4C3H J;  1K61 A;  1RPW A;  1JKP C;  4XRS A;  1JJ8 C;  3BR0 A;  2R0Q C;  5EDN A;  1W0U A;  1I3Q J;  2L0K A;  4MLO A;  4DYC A;  1HCR A;  5F08 A;  3ZQI A;  1JUM A;  1QVU A;  3VPR A;  4M6V A;  4A3K J;  4MFD A;  4A3F J;  3K7A J;  5E3L A;  4D5F A;  3S14 J;  5F27 A;  2EQR A;  2M8G X;  3IH2 A;  3JRB A;  4QSH A;  5EGO A;  2E1O A;  3FIS A;  1VFC A;  1ETX A;  1U9N A;  2FD5 A;  1FIA A;  1A6I A;  2DA3 A;  2IAI A;  3HGG A;  3K2A A;  3PO2 J;  3CQZ J;  5EG0 B;  3JRF A;  3JRA A;  2QF7 A;  4JYK A;  1B8I A;  3Q0V A;  4DYQ A;  5C4X J;  2L7Z A;  3HB9 A;  1MH4 A;  1MH3 A;  2VUM J;  2O7O A;  5DS9 A;  3HKZ N;  2LK2 A;  2JMW A;  1IDZ A;  1DU0 A;  1X2M A;  1BL0 A;  1MSF C;  4A3G J;  2YS9 A;  1BW6 A;  3QPS A;  2AO9 A;  2XB0 X;  2CUE A;  1HLV A;  2NS7 A;  1LFU P;  2M0C A;  3OOU A;  5E3O A;  4J19 A;  2OF7 A;  3MN2 A;  2JA8 J;  2KT0 A;  1MBJ A;  2YUS A;  4EEF G;  3BR5 A;  2XSD C;  2O9L A;  2CQQ A;  3M3Y J;  2VI6 A;  1SFO J;  5HOD A;  1AU7 A;  4LOC A;  2WB1 N;  1UMQ A;  5EZG A;  1P7J A;  1R9T J;  5GP9 A;  1I50 J;  3TW7 A;  1I6H J;  2EH3 A;  2MW8 A;  4I6Z A;  2DA5 A;  4NDL A;  1ZR2 A;  4XK4 A;  1JT0 A;  1IRZ A;  2B63 J;  3I4M J;  5J1Y A;  4AUX A;  1JUP A;  1Z77 A;  2MGQ A;  3CCY A;  1HDD C;  3B6A A;  3JRD A;  2K9N A;  5K7H A;  5FJ8 J;  4D5C A;  4A3J J;  3S1M J;  2VKV A;  3S2H J;  1ETW A;  3FK7 A;  3HEF A;  4DW6 A;  1Q1V A;  2X48 A;  3GTQ J;  1GUU A;  3GTL J;  1NK2 P;  2LLK A;  1JTY A;  4FCY A;  3O8H A;  2Y2Z A;  1H88 C;  4BBR J;  3A02 A;  1OFC X;  2JA7 J;  3MKL A;  4D7N A;  2XGE A;  2W48 A;  1NTC A;  1P7I A;  1MNM C;  2E2H J;  4M3D A;  3BTI A;  3BQZ A;  2DN0 A;  4MFE A;  1ETY A;  2M34 A;  4W1U A;  2H8R A;  4D7M A;  3W6V A;  1QVT A;  1W0T A;  4AYB N;  4B1R A;  3NAR A;  4JX6 A;  1TWG J;  1Y1V J;  2XGD A;  3TP0 A;  5IP6 A;  1CQT A;  1GDT A;  2DTZ A;  2DA7 A;  2Y31 A;  5C44 J;  4L5E A;  2ELK A;  2DA2 A;  2JN6 A;  4UUT A;  3D1N I;  2HXO A;  3BR2 A;  1Z0X A;  3H3V K;  1MBE A;  3ZOB A;  3GTK J;  3SJM A;  1SAN A;  1ETV A;  4A3E J;  2XPV A;  3HOZ J;  3OSF A;  2G0E A;  1MSE C;  1XC5 A;  3MVP A;  1RKW A;  3BG5 A;  1FEX A;  2Y9Z A;  1HOM A;  3DCF A;  3GTP J;  5C4J J;  3FKI J;  2IBD A;  1MBG A;  2WV1 A;  3TED A;  5IPA A;  3JRI A;  2PMZ N;  2NVQ J;  3GTG J;  4G12 A;  5EG0 A;  1RES A;  2E2J J;  4XIC A;  2LD5 A;  3FIW A;  3FK6 A;  3PM1 A;  4IHY A;  2FX0 A;  4C3J J;  5GPC A;  1YRN A;  5IYC J;  4DZJ A;  5EEA A;  2JWT A;  1JTX A;  3BR3 A;  3A01 A;  1IDY A;  1LE8 B;  2Y0S N;  2Y9Y A;  2MG4 A;  2WAQ N;  1IC8 A;  2R5Z A;  3HOU J;  1AHD P;  1A5J A;  1TC3 C;  2GBY A;  2CUF A;  2X6O A;  3RZO J;  1YRN B;  2DJN A;  4C2M J;  4BY1 J;  3OIO A;  1QRY A;  5IYB J;  5M3F J;  2Y30 A;  3A01 B;  3A03 A;  5FKK A;  1U9O A;  2R5Z B;  2HOS A;  3ZQL A;  2DMQ A;  1WPK A;  4DZP A;  5IOY A;  1OCP A;  2EZI A;  3BR6 A;  5K7F A;  2P81 A;  4BBS J;  4IEJ A;  1UHS A;  4X1E A;  2HOT A;  1GVD A;  2EZK A;  5J3L A;  3LSP A;  3RKQ A;  3WHB A;  1ZTR A;  3M4O J;  1POG A;  2QCO A;  5J1R A;  1ZQ3 P;  5IP9 J;  2CJJ A;  4A3D J;  4IHW A;  1RR7 A;  1PUF B;  1O4X A;  1BA5 A;  1S7E A;  2DA6 A;  3G1L A;  4JP0 A;  2HYJ A;  1APL C;  1FTT A;  1WI3 A;  5J1U A;  4M3E A;  1WCM J;  1GV5 A;  1XS9 A;  2LKX A;  4QIW N;  2AHQ A;  2E19 A;  3CDL A;  3QQA A;  2JA6 J;  3RQI A;  5F04 A;  5EZH A;  4A3B J;  3WHC A;  2R5Y A;  3S1Q J;  2XRL A;  2LVS A;  3L1P A;  1LFB A;  3HOV J;  3JRH A;  2ECB A;  2VPR A;  1IV6 A;  2R5Y B;  2NOG A;  2ECC A;  4BY7 J;  5FKL A;  3B6C A;  5BNG A;  2EZH A;  4FE7 A;  3GTJ J;  2EBI A;  5E3M A;  9ANT A;  4RBO A;  4IHX A;  2RAE A;  1F43 A;  5M5Y J;  2M2E A;  4W97 A;  3OSG A;  3RZD J;  3HM5 A;  3HOW J;  2N8G A;  2VKE A;  3S17 J;  5FKO A;  4A93 J;  2JJ7 A;  2MSY A;  5FKM A;  3LOC A;  3I4N J;  2YU9 J;  3NAU A;  3TW6 A;  4C3I J;  5FLM J;  2LP0 A;  2FQ4 A;  4UUS B;  5M5W J;  5IYD J;  3LSG A;  1JKO C;  1G2H A;  1TWH J;  5F0H A;  4MIM A;  2NVT J;  2JK3 A;  1MBF A;  4A69 C;  5C3E J;  5IOZ A;  2K9Q A;  4FE4 A;  2R93 J;  1Y1W J;  1TWC J;  1B72 B;  1H89 C;  1AKH B;  4CYC A;  1ORK A;  1VND A;  3F0C A;  2K40 A;  5EYR A;  2HOA A;  3HOX J;  3ZQC A;  2O8K A;  5GPA A;  4A3L J;  4CYC B;  5EF6 A;  1RET A;  4XID A;  2DA4 A;  1WH5 A;  1MBH A;  3GTM J;  4M3F A;  3JRC A;  1ETQ A;  1LE8 A;  1F36 A;  1ZK8 A;  5FLV A;  2R92 J;  1DU6 A;  3HOY J;  1U8B A;  1ZKG A;  4JX5 A;  2HI3 A;  3BR1 A;  2COB A;  4GFB A;  5F0F A;  3JRE A;  1E3O C;  2OPT A;  2JA5 J;  4RDU A;  2ID6 A;  3ZQF A;  3UKG A;  2CU7 A;  3GTO J;  2I10 A;  2DMN A;  2TCT A;  2CQX A;  3TP3 A;  2HDD A;  2LTP A;  3ZQH A;  3HDD A;  4X6A J;  4Y52 J;  4M3G A;  1H8A C;  1FJL A;  2L7M P;  2H1K A;  1X2N A;  3DEW A;  1ZR4 A;  1IJW C;  5EGO B;  1HF0 A;  2LY9 A;  2L7F P;  5FKN A;  3ZQG A;  2ME6 A;  4XRS G;  2EZL A;  2XGC A;  2XPW A;  1TWA J;  1UG2 A;  3BTJ A;  3QPL A;  1EF4 A;  4A3C J;  4B4C A;  2E2I J;  1T56 A;  1OJL A;  1X58 A;  4BKX A;  1PUF A;  1GV2 A;  3BG3 A;  2DMP A;  4S0H B;  5F1J A;  4DYR A;  1B8I B;  1BW5 A;  2CRG A;  3SDG A;  1NK3 P;  1JUS A;  3S16 J;  3HGY A;  2FJ1 A;  5M5X J;  5IP7 J;  3LSR A;  1U78 A;  2M9H A;  1ENH A;  4BXX J;  1JKQ C;  3IH4 A;  2ZB9 A;  3LSJ A;  4I76 A;  3Q3S A;  4V2G A;  1QPI A;  4V2F A;  3CMY A;  4FTH A;  2NVX J;  3SFI A;  2GM4 A;  1HDP A;  1ZGW A;  1FTZ A;  3S1R J;  3C2B A;  4FIS A;  4M3B A;  2ME0 A;  3S15 J;  4IHV A;  1VF9 A;  3IV5 A;  2TRT A;  3G1O A;  3HBL A;  5DTD A;  3JR9 A;  3S2D J;  3H0G J;  2ID3 A;  2HXI A;  5M3M J;  1XG1 A;  1JJ6 C;  4A3I J;  3BQY A;  1JT6 A;  3Q0U A;  3O8G A;  1JKR C;  1K83 J;  1IGN A;  3BG9 A;  2HQ5 A;  3BT9 A;  1ETO A;  5JLX A;  1WGX A;  1GT0 C;  2XPU A;  3LNQ A;  2D5V A;  1T33 A;  2NS8 A;  4QTR A;  4XRM A;  3BTL A;  4ABZ A;  2L9R A;  2DMT A;  4MO7 A;  2XB5 A;  4A3M J;  3G1M A;  3JRG A;  4JX4 A;  1RKT A;  3E7L A;  3PO3 J;  4UUS A;  3BTC A;  5K7Z A;  1OCT C;  1JGG A;  2R7Z J;  1WH7 A;  4B3A A;  1MBK A;  2LFB A;  3IH3 A;  3Q0W A;  4AC0 A;  1FIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...