3OR2C

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKVTGFKLKQIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or2C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or2C01
1JI8A 1YX3A 2V4JC 1SAUA 3OR1C 2XSJC 3OR2C 2A5WA
chains in the Genus database with same CATH superfamily
1BIBA 2VBYA 2XHKA 4LFUA 3PUFA 1BR4A 3O8GA 5FO5A 2NS8A 4ZTFA 2FA5A 4XOTA 2YR2A 3IAS2 3DTKA 5IT9K 1TWFJ 2HYJA 1I6HJ 3H5AA 1H9TA 3WTZA 1KQ8A 1H9GA 3E3VA 3HB9A 4EGYA 1RC9A 3PM1A 3AG3H 3T0YA 3GTKJ 5IYBJ 2H27A 2GAUA 5GPAA 1WJEA 2B0LA 2QBYB 1N25A 3KPHA 2EFWA 3JW4A 2VQHA 4F91B 2DTZA 1LDJA 3ZN0A 2HYFA 2R7DA 1Y0NA 3F6OA 1BM9A 4LOCA 4IQ4A 3BT9A 2E1CA 5D5UB 4KN4X 3IL2A 3CC4I 4IKFA 2JSPA 1IAWA 1F9NA 1U0JA 3E97A 4JX5A 3DEEA 4RGUA 4XRSG 4R79A 2MD5A 2EZHA 3LNQA 3E6CC 2H6BA 1K79A 5J6XA 3TEDA 5D5WB 1JTYA 2BV6A 1TNSA 1MSFC 5TGTA 1FJLA 4UVCA 3HRMA 2FX0A 2EFNA 1HW2A 2LMDA 3PFIA 3REOA 2KMUA 4I98B 1BOAA 3E7LA 5J4YA 3NRVA 3S3NA 3WHCA 3ZP5A 2CG4A 1W1WE 3T8TA 1P6RA 3U21A 1JJ8C 2C6YA 1ZLJA 1SMYF 1ETYA 2KJCA 3KZZA 4U0VA 1ETWA 1TT5B 2CW7A 3WE2A 2HQRA 2DOAA 4E4HA 2HZTA 2CQKA 3TO7A 5FLXZ 2QVOA 3G4SI 2L9VA 1Y1VJ 3LQQA 1Z7UA 3NEUA 5LLQA 4HDVA 2MH2A 4MEXF 2OTJI 1GT0C 1VQ7I 4I76A 2VPRA 3MN2A 4HZFA 2HQ5A 4V2FA 2CV2A 4Y4RA 3L2QA 2DT5A 5DCMB 1XPXA 5LD2C 1AOYA 1Y8RB 3K4NA 4A5MA 2G9WA 4E6KG 4F92B 5FD6A 3S17J 2G0EA 2ZXJA 4HNUA 2VT3A 3OR1C 3K7AJ 4NC6A 2VKEA 4LJZF 3FK7A 3G6EI 2HQNA 3JAMZ 2L2OA 5EDNA 1PYVA 2V79A 1KGSA 1B9MA 2FUG2 2X6WA 4RB0A 3S1NJ 4XRMA 2FF4A 2DJIA 4OIQF 2JPCA 2XF6A 3G1LA 2LLKA 2MYSA 2JA2A 2R7ZJ 1J59A 4U7BA 2IW5A 3VPRA 1XSDA 3CCRI 2Z3YA 3EPZA 2NRAC 3I59B 2JUCA 1FLIA 2JTVA 5CVJA 4MTDA 1QRYA 1OKRA 2HGCA 3HKZA 1G3SA 5E8GA 2HWVA 2NVYJ 3DEUA 4NQWA 2OZ6A 1W5SA 5B66C 2K02A 3F0CA 4DZPA 2ME0A 1Z7LA 1E2XA 1O3SA 1OQYA 1MDMB 5JLXA 3CCEI 2EJRA 2A68F 2KIFA 5HLIA 5KVRA 4IHSA 3HTUA 3WG7H 5LEKA 1U8RA 1J9IA 1G8XA 4L5EA 4NC7A 1RESA 5FRNA 1VQ6I 1DP3A 2L7ZA 3AFHA 3ESWB 2E1MB 3ERED 4L9VA 5LGTA 2LH9A 4PSXA 4RM3A 1S8NA 4P1WA 5J40A 3A0BC 3MQ0A 5D4SA 5M3FJ 2GQQA 2L7FP 1XCBA 3MZYA 4L9JA 2IT0A 3K70D 2L7MP 1UFMA 3OYLA 2IA2A 5GAEJ 3KIOA 1AHDP 1XX5A 2H1KA 2GXGA 1TP4A 3UR3C 3D5SC 2HDDA 1BI1A 1ACIA 3GXOA 3EUHC 2F5FA 1T33A 2IA1A 4ZYAA 4KUMA 4CUGA 4FX4A 3GTQJ 4M9XA 2CQQA 5E8IA 1Z91A 4IX7A 4CYDA 4HEA2 4Q48A 5AIQA 4HG2A 4HNVA 4C2TA 3K4BA 4A0XA 4EVIA 2HOEA 2A6TA 2LNBA 3FMSA 1MDMA 4MGRA 4PSWA 3K9TA 5LRSA 5GPCA 4XONA 2DMPA 4LG3A 4HV6A 2EFQA 4L5JA 4WXDA 3OS2A 4HW0A 1JUSA 4JX4A 1I1SA 1ON2A 1T98A 3BJ6A 3E5XA 3OYAA 4RM2A 5J1YA 4BGDA 2DLLA 1QHHD 2MC4A 2HU9A 3K2ZA 1IN7A 1B1BA 3OYIA 3S3MA 1SVLA 5K5QA 4ZJZA 3TOAA 2QCOA 3M8JA 1FC3A 4LD5A 5LEJA 1G2HA 1LDDA 4I0AA 2HVRA 1HOMA 2DYSH 2HVQA 2ISYA 3FHNA 2B63J 3Q9VA 4A12A 2OUMA 4UV9A 1YO5C 2DN0A 2K9QA 2EV0A 1IGNA 1ZG5A 5DM7F 4BEHA 3JCUC 2CYYA 3U1KA 1I3QJ 2DT6A 2UXNA 1ZGJA 4HSTA 3JRCA 2GXBA 1V5GA 2CW8A 4M6XA 3J7AY 3T8RA 4BBSJ 3S32A 1X1DA 2RQPA 2VC1A 2WTEA 2KRFA 3H3ZA 2QSHX 4CYCB 1ZKGA 3WTUC 4M3FA 3HHHA 2XGXA 2R7WA 5K7HA 3V8LA 2L4AA 2DOFA 4FT8A 3E5QA 1X2MA 4J01A 1IN8A 3TGNA 2E2IJ 1P7IA 1SD7A 2MBFA 1S72I 2GOMA 5EZGA 1R58A 2COBA 1T2KA 2Y31A 3F3XA 4Y15A 4ENJA 2FNAA 4KIBA 4N4OB 4P9UA 2FRHA 4E7LA 3BG9A 2EQRA 2XB5A 2A3SA 3IH2A 4XLEA 5FB2A 2BY3A 2DDAA 4BBRJ 5CVIA 3GEZA 2O61A 4RMNA 1B6AA 1E0EA 5L3FA 1ZR4A 2LG4A 3EUHA 1S9HA 3PNYA 3Q0UA 4XK4A 3ZQIA 3JR9A 1K78B 1X4PA 4PFOA 4B1RA 2IGKA 4UXNA 4ZYDA 2CV0A 3PSFA 1OR7C 3CCYA 1BW6A 4BXXJ 3WTSC 2H1LA 1H8AC 5DV5A 5F27A 4ENMA 1FSEA 2NOJB 4NHJA 3SEZA 4EM0B 5E3NA 2IA0A 3OL4A 4AIHA 2Y2ZA 3DFGA 5F08A 4HX8A 1MBGA 3BR0A 3OS0A 1PUEE 1SFKA 1WI9A 1V5FA 3H9QA 3M4OJ 3HRSA 3ZR8X 4IZZA 3S2WA 3TBIA 5DUIA 3DV8A 3BOQA 1T38A 2E1NA 4PUSA 2MABA 1MMGA 1Z9CA 2DPDA 2H6CA 2IP2A 5FFXA 3EQLF 4YG2F 1R9TJ 2A5WA 2Y9ZA 1ZN2A 2FXAA 4IRGA 1FYMA 5DS9A 1R00A 3RQIA 3TO9A 5F1JA 3W2WA 2YS9A 1KA8A 5L3DA 4E7SA 2VJ4A 2VE9A 2EV6A 2FQ4A 1ZRFA 2DAOA 2QGUA 2WY8Q 3FXLA 4S0HB 5F0FA 2VODA 3W6JB 2NS7A 1P92A 4YIFA 1A35A 3HPHA 3JRFA 2ZXHA 2BW3B 3CUQB 1EV7A 3N05A 4RAZA 4LIUA 1XGMA 1S6LA 2I8DA 3SYTA 4HA8A 4OOIA 3RZOJ 2QUFA 2QM3A 2E60A 1AKHA 1PDNC 2VQGA 3SFIA 1SEUA 4ESJA 2F4OB 2CO5A 2XPVA 1MJ9A 1FMVA 3JREA 4OIPF 4AWXB 3A0HC 3DKWA 1XSXA 1RKWA 4OU0A 3CCSI 4WK8F 5D8KB 2O6GE 1O7FA 1LDKB 1TQPA 1WRJA 4YFNF 5L3GA 2R5YA 2W57A 1Z3YA 2ID6A 4GFBA 1YS7A 4EV0A 1Z0XA 2GIVA 2ZSHB 2ECBA 3VFZA 4ZDLA 5J4VA 4M6YA 2Y69H 1B8IA 3VYTB 2FMLA 2BZTA 4C30A 3WTXC 1IZ1A 2Q0OA 2GA2A 2R7SA 2L5QA 3AL0C 2M3AA 5HDGA 3LOCA 1ZLKA 2ZMEB 1SFEA 3LSMA 2VBZA 2WB1N 1KQ0A 3S3OA 1UJ8A 2FJ1A 4UY8I 1RZ4A 2VJ5A 3VSLA 2K5CA 4DYCA 4A93J 5KNLA 2ZMEC 2Z5UA 1P9QC 2X0LA 2A69F 2BY0A 1H0MA 1TL8A 2PJRB 1K61A 3G3ZA 3FF5A 2ZC2A 2R0QC 3HXLA 1SD4A 3M3YJ 4Y17A 3LA7A 1B4AA 3OYBA 1XS9A 3A03A 1MBFA 2K86A 1IXSB 4MLOA 5LHGA 5LHHA 2DMTA 3GTMJ 3BJAA 3CDLA 4MTEA 4FE4A 4ZYEA 2FE3A 4EMSA 1XC5A 1Z21A 2VB6A 3ZOBA 1O4XA 1O3TA 2EIKH 1VQ5I 5JLWA 3MKWB 1Y0UA 3H5RA 3LSKA 3JTHA 3LA3A 4MNUA 1LVAA 2K9MA 3JTGA 2GA1A 3I4MJ 1V4RA 3RYPA 2HOTA 1BC8C 1J5YA 3MKYB 1J0RA 3DF8A 4C2MJ 3EYYA 3FM5A 1U2WA 3KYDB 1U5TC 2E5NA 1LEBA 4PJ0C 3ZQCA 2DOEA 2JZYA 3K4JA 1ZGWA 3I54A 5C4XJ 4PDKA 3AG4H 3QPLA 4JX6A 1X3WB 1R7JA 1R6RA 3NARA 3C2HA 3FIWA 5BPDA 4LLGF 1RI7A 2DT7B 2HZDA 2IXSA 3OL3A 5IP6A 1VQ8I 4L9TA 3L09A 3KP7A 3CUOA 1QBJA 4AU7A 4XLFA 2B7EA 5CVRA 5CVUA 2D1HA 3G2BA 2D45A 5H6QA 2V26A 4LITA 4LIVA 2DQLA 2ELKA 3BG5A 3TQNA 1FOWA 3A01B 3I71A 3L2UA 1WJDA 2K27A 1GVJA 1YX3A 1I5ZA 2X9DA 4IPAA 3QOPA 3QU3A 3E0JB 4BDYA 2VUMJ 3A4CA 1QVTA 4PGGA 1HSTA 1QPIA 2ELJA 3PQKA 4QWQA 4BJ6C 3KP3A 4M3GA 1FYLA 2WA0A 5AIPA 5F0HA 3G1MA 1IDYA 4LLLA 2EFOA 1ZG1A 1TLHB 3QP5A 5E18F 1EH6A 5FKNA 2TDXA 3BPXA 5ILVA 2Z33A 1V5EA 2ZBKA 3QYBA 2DDBA 3OYKA 1O3RA 3SXYA 3ZGKA 3ASOH 2DO7A 1OYYA 3EETA 4GXOA 4O6JA 1X3UA 4KISA 3KCCA 4IHXA 4GRIA 4BE0A 1RR7A 2A6EF 2JSCA 5HS7A 2AQEA 3R0JA 2MW8A 3CCVI 1A6QA 1UHMA 3BCAA 4W97A 4MQ9F 1WWXA 1A36A 1T6SA 1U6GA 2HOAA 3LSIA 5E1XA 3SZTA 4LB6B 3FMRA 3DTIA 2L54A 3HM5A 1YJ9I 2E71A 2YSRA 1T08B 4UB8C 2ACJA 5GTHC 2HKOA 4CCLA 1LE8B 2JUGA 4B09A 3KX2A 5J1RA 1XD7A 3JRBA 4X6AJ 3CP2A 5J8FA 4I6ZA 3ZMZA 2W00A 3GVAA 4JBAA 2ZKZA 2QQAA 1I50J 3UKGA 3I56I 1FP1D 3MD2A 1T95A 3IKVA 3M9AA 5M3MJ 2OD5A 2NYXA 1X4OA 2BVLA 3F72A 1PP8F 4BY7J 5ILSA 3I4PA 1QHGA 2FD5A 2P7VB 3AKZA 4R1HA 1QZZA 4MIMA 3HRUA 5K1YA 1GVDA 2XF5A 2CU7A 1P4WA 4CICA 2CFOA 2MLKA 2P6TA 1IRXA 4G6QA 2A61A 2W84A 2K9LA 4H0EA 4BNCA 4HSRA 2W82A 2P7CB 1JUMA 2W48A 4C3IJ 2X6XA 3ULQB 1MBHA 2OPTA 2ZNZA 2VE8A 4W1UA 3CF5F 4EATA 2F5EA 3RQ4A 3ABUA 4FCYA 2QYOA 2IS6A 3WGGA 2XGEA 4X0GA 3K2AA 3H3UA 1SC7A 4A3FJ 1GXPA 4JYKA 4NQWB 5FKLA 1W0TA 1I1GA 1Z6RA 3N4MA 2FQ3A 3BQYA 1UG0A 3IV5A 1YRNA 1MIJA 1X1PA 4WXHA 5FKMA 1TQMA 1SFOJ 3LMMA 4A3KJ 3ERMA 2GXAA 3MMYB 2WAQA 4V19K 2KQRA 3GBGA 2OZUA 1S7OA 2HEOA 2E1OA 4ENKA 1ZREA 2MD0A 4P96A 2KHMA 4GCVA 3KEYA 2DA2A 2XRNA 3CJNA 2OQRA 2R7OA 2M87A 4A5NA 4CZZA 5ICGA 3TL4X 2QWWA 3TDZC 4ABZA 2IBDA 4PJLA 3BY6A 2BOLA 2D2WA 4PFPA 4D0PA 5EGOA 2YX7A 4QIWN 4Q47A 3VYUB 3K69A 3E6DA 5HS8A 3OS1A 3JSOA 2IGNA 2NS0A 4HF2A 3SZGA 1UZCA 5E20A 4DQ2A 1EKEA 1TWHJ 3KP4A 3FBIB 1HSJA 4RB2C 4GYGA 2HTJA 5DDGA 1V54H 3DBRB 4IVNA 3ISPA 4LGWA 1G6NA 3C1DA 4HRIA 3NAUA 1LUJB 2R93J 2M1BA 5J8CA 4RBOA 2OJED 3QWLA 1OFCX 2IGOA 1R1UA 4M3EA 1X1CA 4HOBA 1GXQA 3L9FA 4DBQA 1JGGA 3J81K 3RYRA 3JRDA 3WGHA 3WE3A 5DM6F 2EA4A 2KT0A 2MH9A 4UUSB 3IRRA 2NOGA 1KU2A 2QF7A 3HUGA 4G6TB 4M72A 3OYCA 3S1MJ 3DKYA 3L1PA 4FX0A 2V1DA 1W7PB 2HS5A 2ID3A 2XIGA 1YOVB 3J7YJ 3TOBA 5ED4A 4EEFG 3F23A 2RQQA 4ZZDA 1SAXA 4NC8A 4XICA 2JT1A 2COMA 2Q8KA 4CYCA 4IO9F 1DGWY 1APLC 3GLXA 1KYZA 1UMQA 4Y3OA 1LVKA 2XASA 3CCJI 1B72B 2LD5A 1E3OC 4GGGA 4D1QA 2VT2A 2QSFX 3HOXJ 4QPQA 3FXOA 1MH4A 4FASD 2WB1A 1R71A 4Y7NJ 4Q5SF 1W7PA 3IUOA 5DD4A 3MKZA 4KFCA 2IGMA 5DCMA 5M5YJ 3RJPA 3HOZJ 1HW1A 3H9JA 1RUNA 2HPMA 4M73A 1X1BA 2L7KA 4KA4A 1G59A 2P5VA 3HKZN 1KQ9A 2BHZA 3OYEA 1FOXA 4AUXA 4LLNA 2PG4A 2VKDA 1B9NA 1MZBA 2HKXA 5B1BH 3VOEA 2V9PA 4G6DA 3JRHA 3KFWX 3H36A 4D5FA 1Z3XA 4U7DA 2EIMH 4M9SA 5EF6A 2PQ8A 2BYVE 2OV7A 3LSRA 2LBFB 2ZXWH 2JWTA 2MC3A 3LFKA 3V8KA 1OYIA 9ANTA 2F5DA 3CTAA 5CKTA 3HG9A 4FTHA 2VXZA 2HDCA 4UNOA 1TWAJ 1HKQA 4GYIA 2F5VA 4MO7A 4HV5A 5F6FA 2JA8J 4UVAA 3MAJA 3B6CA 5IPAA 4DJAA 3ZMTA 1HKTA 3WHBA 4KYWA 3DU6A 1YJWI 1QGPA 2ADUA 3H3VK 3PFYA 1GV2A 2L02A 2RDPA 3GWZA 2YX4A 3L2VA 4Y52J 1OJLA 2OC6A 3C7JA 4WF2A 1U9OA 1FIPA 2DK8A 3ML6A 5KAIC 3TMOA 4CA0A 1OR7A 3HSRA 1X1AA 2DW4A 1D0XA 2FU4A 4BL0B 3SEQA 1G3TA 2CUJA 1XGSA 1MNDA 5LRRA 2DK5A 3DXJF 2Y0MA 1R4MB 3NQOA 5GTIC 4A0ZA 1D8KA 2LFBA 4OWRB 4U0WA 3UNGC 3QPTA 1LNWA 4AD9A 3QYFA 4S04A 1RUOA 3MZHA 1T0FA 1IG7A 1A5JA 4ESBA 1BBYA 2ZMEA 1SD5A 2DTRA 3F8MA 2B9SA 1K83J 3H5NA 4RAYA 3SFZA 2GM4A 3OSFA 3RPQA 3KEQA 5CVVA 1WJAA 2X4HA 4PK4A 2EINH 2GWRA 1MNEA 3R6SA 4HYEA 5A2QZ 3CMAI 1IN6A 3K70C 2HR3A 2EFPA 3KLOA 1CF7A 1FT9A 2FNPA 4KIFA 2NVUB 4LB5A 2GZWA 2P5LC 5C4JJ 2KP6A 1MH3A 3R60A 4HPQA 3F22A 3FXKA 1J7KA 2XAGA 2WBMA 4XRSA 3QOEA 3BQZA 4BEHB 2EB7A 2VPLA 4EJVA 3DPUA 3BDDA 3OYNA 2LSOA 4ANJA 4XN0A 3ZCOA 2J5OA 5FD5A 2KRHA 3GX4X 1PJRA 2M8EA 3PL8A 1NH3A 1UAAA 2LY1A 2TCTA 1HBXG 1IJWC 5A2QK 2EZKA 1G3YA 3U9GA 2V1UA 1BA5A 2VLAA 1ETOA 1U5TA 4OAZA 1EA3A 1UCRA 4YIRX 5HOOA 3F6VA 3A02A 3MEXA 1YLFA 5K5RA 4IRHA 5CLSA 1TW3A 4F3QA 4KMUX 4CCKA 3IH3A 4Y33A 3BCBA 3H35A 3KZYA 2IVMA 3QYEA 1JT0A 1HLVA 1IV6A 2ISZA 1D5VA 5JHUA 4RLQA 4C9YA 1HC8A 3CJRB 3CO6C 3IWFA 3FWEA 4BE1A 3HPGA 1VNDA 3GFLA 1FNNA 2F4IA 3FKIJ 3HOTA 1HDPA 4G12A 4XLNF 1QZYA 4XORA 1LFBA 2R92J 4AVPA 1W0UA 3W6KB 1WHUA 5K7FA 3FXRA 4XMYA 2E1MC 1YW9A 3F9KA 1AKHB 1FWZA 3BZCA 4PJNA 2DFFA 3AG1H 1SMTA 1Z05A 2X6YA 2V9VA 4AIKA 2RC4A 3ZPLA 2XAQA 5L3CA 2XAJA 4U0YA 1LB2A 3GTPJ 2KDZA 1OMIA 2DA4A 1XMKA 2R7XA 1V55H 3LSPA 4UHTA 3FMQA 2KDOA 1VQNI 1HKSA 3U2RA 3P9CA 4QTRA 3CC2I 5E17F 5EEGA 4M71A 2LY2A 2R5ZA 1S5LC 1OCPA 1P4AA 1WJFA 1ZH5A 3QP6A 3ASNH 4O5VA 2EILH 1JKRC 1K78A 2KISA 1CGPA 3DWLE 4OIRF 3QPHA 3BG6A 2CH0A 1NG6A 1D1CA 2JVGA 3NWTA 1E17A 3SDGA 5IOZA 3L2WA 4YIIA 1MBJA 2MSYA 2R7RA 1MW7A 4DIQA 2DPUA 2EZIA 3ABLH 2X1DA 1U78A 2PJPA 2JRTA 3DBHB 1ETQA 3GZ6A 2E7WA 4N9IA 3A01A 3ELKA 4HBLA 4BH9A 5HLGA 5HNHA 1VZ0A 1MJBA 2XV4S 1POGA 5KK1A 1RRJA 4CCJA 2Z9OA 3VWBA 5CQGA 1WI3A 3MWMA 4HX7A 2CGPA 2LREA 4UB6C 3CQZJ 1FSHA 1K4TA 3Q0VA 2DA1A 3DPTA 2QSGX 3EDPA 3OMYA 1WCMJ 1ZAOA 2MA3A 2AS5F 1MMDA 1MMSA 1S7EA 3K1MA 2R7VA 2XB0X 4EQQA 5IOYA 4XIDA 2W85A 4XOPA 2PMHA 4HLYA 2F48A 4Y13A 3CC7I 1A04A 1F5TA 2AXTC 1RPWA 1YHQI 1X58A 1UELB 2AO9A 2LDUA 4ZYGA 2DFHA 5CJ9A 2EK5A 2OQGA 2F2EA 4WCGA 4IEJA 3J81Z 1F1ZA 3OOPA 4IHVA 4ON0A 3V42A 2M2EA 3K10A 2RREA 5EGOB 4FETA 3DTEA 2HXIA 2ZO4A 2P0WA 1S29A 1TWCJ 3DEWA 1F4KA 2LF7A 3LWFA 3JRIA 2MG4A 4YFXF 5BOXA 2J5PA 5LBQA 3FM3A 4JOMA 1IC8A 1ETKA 2LP0A 2OA4A 1FOKA 3OWTA 2AXLA 2M8GX 2Y0SN 1F36A 3VYSB 4CH7A 1SD6A 3WTYC 4BU2A 5TISC 4XM3A 2WAEA 2AQFA 4E7JA 1JHHA 5JI6A 3GTLJ 2IAIA 3FXMA 2ZJ2A 4XBFA 2QA4I 2V6EA 1L0OC 4HDUA 1ZELA 1HCRA 2KFDA 2L0KA 2WY7Q 4HQEA 4N9HA 4Q4ZF 3WGIA 1QZEA 4D7MA 5TJJA 5M5XJ 4D5CA 2CRGA 1PUFB 1RETA 2STWA 1KYWA 3KP2A 4E7ZA 2L9NA 3CCLI 3HOSA 2Y75A 1DPRA 5KCMA 5AONA 1FBQA 3F21A 4BUPA 3I55I 2PJRA 1BN5A 5DUKA 2E7XA 2K3PA 4KNYA 4CZCA 2X6OA 5EEHA 1JTXA 4M9ZA 2YU9J 2MLGA 3P7NA 2PBIA 2JK3A 1O57A 2FSWA 1FTZA 3L2RA 2VOOA 3SDBA 1K6YA 3ONQA 4XQFA 4I01A 1FIAA 2H09A 1XN7A 1VQKI 2ZSIB 1XSVA 2N8GA 4O3MA 3FZVA 2P6SA 3ABMH 4CSWA 3S93A 2RKHA 1EF4A 1FOYA 1IO2A 4XLCA 1A31A 2K9NA 3RZDJ 4RGXA 2VIXA 4D7NA 3WTTC 1MBKA 4XKVA 2EWNA 3E5UA 4IOAF 3EUAA 2WV0A 5J47A 1BJZA 3D5LA 3LSGA 3WU0A 4A0YA 3HSEA 1OLTA 3RI4A 5HDKA 4BS9A 5LGNA 1JI8A 2VL8A 5GP9A 1FYKA 3HTSB 4IHTA 3FXQA 1LKXA 2TRTA 2KIUA 3CLOA 5HVQC 2Z2SB 2DA5A 1BR2A 2ELHA 1ZHFA 1Z6TA 1MGTA 2I5UA 2K9SA 1GV5A 2DFEA 2CUEA 2JRMA 3CMYA 3O6BB 1YW7A 3RIRA 3KEOA 1D8JA 4DYRA 1NHAA 1FBSA 2X51A 4C2UA 2JA6J 4PCQA 1TW2A 2ESNA 2HDWA 4XKWA 3X2QH 1AA7A 2JJ7A 4PZJA 5F64A 4LK1F 2XDVA 3LFUA 2G7HA 1LJ9A 2XGDA 3NWSA 1OCOH 1B72A 4XSXF 3GFIA 2I10A 3S2HJ 2IEKA 1FP2A 4IHYA 2JN6A 2LKPA 2UZKA 2WV1A 5EEAA 3Q3SA 5HLHA 5DEQA 2XRLA 1R22A 3HZJA 3L00A 3TDUC 4XKBA 1K4SA 4EGZA 3DU5A 5M5WJ 2XGCA 2YUSA 2K4JA 3S1QJ 2VXDA 2PLYA 4WXCA 3S15J 3B6AA 1WKMA 4RB1A 3OY9A 1ODDA 1YQAA 3TP0A 2L01A 3OIQA 4NDLA 1STZA 2UV1A 2YPRA 4TV7A 3D0SA 1HA8A 4KT6A 5EJCA 2GIZA 3DCFA 4XSZF 5JVTA 1QVUA 1ZYRF 5LGUA 2R4GA 4F55A 1WGXA 2HVSA 1RNLA 1WJCA 4IL6C 2JA5J 4LMYA 3SQNA 2EPFA 1OCTC 3LQRA 2K40A 1UHSA 3JSPA 3CCMI 3CCQI 1KU3A 1Q1VA 4EJTA 3IP4B 3OR2C 3QQAA 3ZRGA 4B4CA 1KZHA 1SFUA 2LF8A 2O3FA 3PIOF 2BY2A 5D5XB 2IS2A 4I09A 2CJJA 4UV8A 3GW2A 4XN3A 1JKQC 1K6OA 5IYDJ 4QLCU 1LFPA 4LG0A 3H92A 3WTWC 2CQ7A 2GBYA 4XLPF 2AHQA 4LK0F 5FKKA 1XMAA 4BY1J 2WC2A 2LYCA 2XPUA 1G4DA 2OF7A 3L2CA 1MKMA 1UB9A 1GDTA 3OYDA 2BHYA 1IF1A 3A2KA 4QSHA 3S8PA 4BXUA 2NVXJ 1QU3A 3TP3A 4NUBA 3BR1A 1JXSA 2LVSA 3KYCB 2CSOA 3E6MA 4GO1A 1YRNB 2O03A 4KICA 3HOYJ 3HBLA 1A6IA 3ZMVA 4FISA 2DMUA 2QBYA 5BPIA 1AWCA 4AYBA 1J09A 3M8FA 1IRZA 3ECOA 1OCZH 1WJ5A 2M0MA 2PMUA 3GLLA 3W2VA 3K6GA 2JPBA 2XAHA 5TRDA 5LFAA 3BROA 1JKOC 3HOWJ 1DU0A 2A5YB 2L4MA 3CD6I 5HODA 2GLOA 3OYFA 2HYGD 2DXIA 4XNFA 2STTA 2Y30A 2OBPA 4A3BJ 4P9FA 3K4KA 5F04A 4B48A 2CUZA 3DP7A 3LA2A 3V7RA 2V1NA 1AU7A 2GOXB 1BOBA 5BNGA 1T8IA 2ESHA 3BG7A 4G7HF 3GF2A 1JGSA 3RTRA 2K85A 1H88C 3V7SA 4BACA 3AAFA 1VQ4I 3BZKA 3VYRB 1YX5A 1R1TA 2CV1A 2ZB9A 3FKJA 5E3LA 1LFUP 4A3LJ 4CDGA 2W7NA 2O5RA 2OAZA 5BS6A 5ICEA 4YRVA 2QQ9A 1S7AA 3GTGJ 2LOOA 4DYQA 3PO3J 2HFHA 2BXYA 5GAHJ 2VQLA 2LY9A 2QQBA 3R4KA 2NVTJ 4BE2A 3SJMA 2KRCA 4L18B 2ZJQF 2VONA 3C3WA 1Y39A 1XDSA 1ZRCA 1R4NB 4R8HA 4L0ZB 4B3XA 2HQAA 1ERDA 2H8WA 4HLXA 1R1VA 2DI3A 4XLAA 4B3AA 4A3EJ 2DA7A 3LSJA 2QEXI 1H89C 1LE8A 4BXFA 1W5CC 5EG0A 3VSKA 2M7BA 3QODA 1JE8A 4D9JA 1TC3C 3I9V2 1ZQ3P 5H6RA 4BJ5C 1CF7B 2O8KA 5HDNA 2R7UA 4ZDOA 2DYRH 1P7JA 4DGWB 3RKWA 3ZQFA 3I5UA 1DDNA 4J19A 4ZDPA 3HGYA 5K5OA 2M7AA 2NXNB 2VASA 4BJTA 3CDHA 4V2GA 1DGRM 4DW6A 5CPRB 2VKHA 3PUBA 2R5ZB 2FBKA 5D8LB 1R36A 1Z67A 1OISA 2WAQN 4BHPA 3KP6A 4N0BA 3EYIA 3CUQC 1MNMC 2CMPA 3IHUA 4H4KC 4AC0A 3I3LA 3F8CA 3K1PA 1QQIA 4AYBN 2ZCWA 4RGRA 2VKVA 4BAYA 1TTYA 2DA3A 2XVCA 2IPQX 4A3GJ 5IY5H 4A3IJ 3N97A 4U87A 2PMZA 3W3CA 2V9KA 3GFJA 4RGSA 4E7IA 1B8IB 2JQ7A 2KPMA 1YG2A 3ZQLA 4IXAA 1NTCA 3RDIA 5KHDA 3GCMA 5DTDA 2H94A 2DODA 4MHGA 3O3KA 5FLMJ 3E1SA 3ZQQA 2RAEA 2ECCA 2P81A 3V4GA 5JHFA 3MVPA 4CCOA 5D5VB 4E70A 4Z6YA 4ZH4F 5HS9A 1N77A 1W4MA 5D4RA 4EJUA 1DP7P 1WVRA 1Y8QB 3IH4A 2K7LA 4L5IA 1DU6A 2UXXA 3D5RC 1D0YA 5E1ZB 2QKMB 1T39A 2Q2EA 1DPUA 4DZJA 1U8BA 2FOKA 1XG1A 3HDDA 4OMYA 1U5TB 1K7AA 2LK2A 5DCFA 3HSFA 2YU3A 3BR3A 4XKCA 4DBRA 2E2HJ 4EM1A 2RNGA 3BTCA 4HQMA 3I58A 4RS8A 1OCRH 2M45A 1UHWA 1P2FA 2G7UA 3Q0WA 1XCVA 3PSIA 3Q9SA 3MCZA 4FHTA 3DKXA 3PJRA 5B1AH 3CJTB 3HC7A 2KZVA 5K7ZA 1USTA 1C0WA 2VJIA 2RGVA 3S2DJ 1BR1A 2R5YB 1ONVA 4CO8A 5FGMA 3ZMSA 2E2JJ 2DBBA 4BKXA 2CQNA 4ZYHA 1MSEC 1NK3P 3F8FA 3I0TA 1YS6A 4AIDA 2RVCA 2X1EA 1ZG3A 2W24A 2WADA 4ENNA 3FDYA 3KE2A 1L3LA 3GO5A 2Z99A 1XGOA 4OINF 1LPQA 4CGZA 1VQOI 3RPUD 3DPLC 1VTNC 1U3EM 2X48A 2CS3A 2JVHA 3W2AA 2LKXA 1S3JA 2Z16A 2WAFA 1GHCA 4M6VA 4BHCA 4A2UA 4A3CJ 3ZQ7A 3JRAA 1B59A 5D6EA 4A6DA 2KIQA 2W1OA 4HF1A 1F43A 3H1CA 1ZGAA 5JFRA 1HF0A 2WWYA 5KAFC 3LL7A 2LRDA 5CYVA 4G7ZF 2HI3A 1WSUA 3F8BA 1X19A 1XGNA 4RDUA 4G8XA 3FHZA 1WH5A 3GFMA 5FKOA 4B43A 2ZJPF 2R7QA 5BMZA 1R5ID 2CW0F 2HPIA 3M8EA 4DOZA 4HAMA 4P55A 3GTJJ 1X2NA 4G9YA 4MQVA 2F4MB 4C3HJ 1W5TA 3BTJA 2P4WA 4P5OA 3J7AO 5DD8A 3CMEI 3DBLB 4ZZLA 2BE5F 1XMXA 4G94A 3QPSA 4CHUA 2OCCH 2HOSA 1P4XA 3C2GA 4S05A 2D1VA 3HGGA 1SVMA 3VEPA 5H2FC 2KJBA 2CUFA 4UUTA 4XR6A 2EBIA 3CJQB 3I59A 3V8JA 4MFEA 3OYJA 1M1EB 2Y48A 3VODA 1J75A 2PI0A 3IRQA 2XAFA 2DU9A 2BW3A 3ZMUA 2EZLA 3KP5A 2NAZA 3RKYA 5HNFA 2ICWG 3T1BA 1E3PA 3I53A 2A6HF 4YFKF 3EUKL 3M1EA 5J1UA 2ME6A 4BHBA 1KU9A 3AL0B 1EH7A 4CXFA 5B3SH 2XAUA 1RIOH 2E36A 1SANA 4PJJA 3K1NA 5B5EC 3HOUJ 4CCMA 2UWMA 3DLLF 2R7FA 4LG0B 2HXOA 3ZQGA 3BJOA 2MGQA 4NBQA 3FK6A 4IRIA 2XROA 2VBWA 3QU6A 1HDDC 1DQUA 1LQ1A 2IS1A 1YW8A 4UVBA 4A69C 4GDFA 1T56A 3QRFF 2PX9A 1SVOA 5GADJ 4BQOA 4FE7A 3R61A 2LBFA 1TT0A 2KKOA 4M3BA 4HNTA 4I2OA 2O8XA 1J2XA 5GAGJ 3DLAA 3G73A 3ZN1A 1MMAA 2XPWA 1R5GA 1T0FC 5FLVA 1I6XA 3H0DA 3I64A 1FBUA 5F0CA 1FZPB 3S1RJ 4YEJA 1OCCH 1TZLA 4RAFA 1NK2P 2M5WA 1I39A 2VI6A 3QAHA 4I0BA 3CF2A 2NNYA 2X85A 2VQCA 2JA7J 2OCEA 5FFZA 1G3WA 4WX9A 2JMWA 5FRMA 4EJWA 1ZRDA 2NNNA 4IF4A 4ETSA 2XSDC 3B73A 3D1NI 3MZ8A 1IUYA 1NG7A 2M34A 5ERIA 1R5HA 4IOCF 1TNTA 1EH8A 2BEOA 3LSTA 2IRFG 2NVQJ 2LKSA 2M9HA 1HQCA 2XKOA 1XDUA 1QO0D 2PMZN 4I7HA 1YIOA 2L9SA 1BIAA 3GUDA 1IRFA 1YE9A 1O7LA 4M3DA 1SAUA 2OTLI 2BGCA 3FX3A 2F6CA 3M07A 3PNVA 2QKLB 2CFXA 3K4CA 2CQXA 2ZFWA 5IP7J 1ZR2A 4QPOA 1HXDA 2KLOA 5FLXK 1FEXA 3CMMA 1HW5A 5E3OA 1BW5A 1IN4A 2M4GA 1MD0A 2VBXA 1WJBA 1UG2A 1BI3A 3IWZA 3CLQA 4FQGA 5EYRA 1BJAA 2HNHA 3M7GA 4PJMA 3BLYA 1N78A 2O7OA 4A3JJ 3GTOJ 1VI0A 2FBIA 3CDIA 2H8RA 1RKTA 3ZXSA 1ORKA 2EIJH 2E35A 3LAPA 1D5YA 2LR8A 4F93B 4XLHA 2IS4A 3WU2C 1VQPI 3HHGA 1FTTA 4K2EA 3O8HA 1GUUA 2QENA 3K4LA 2Z1DA 3WODF 3P9IA 5E3MA 3OIOA 1IDZA 2EA2A 2M30A 3CUQA 3AG2H 2EH3A 2P8TA 4JK1X 2V4JC 2K4BA 4KDPA 1W7PD 2RN7A 3OOUA 4BDZA 1IUFA 2Q2EB 1U9NA 4ZTJA 4B8XA 4RB3C 3GMEA 1JUPA 2R3SA 4EJOA 1XB4A 1VQMI 2R7TA 3BTIA 1YYVA 2KL4A 5C44J 3BPVA 3E6BA 3U1DA 5H20A 3CESA 1YITI 3ROUA 1MBEA 3SZPA 2RNJA 2X1CA 3O2PE 4A6EA 3FISA 4PGHA 2E34A 4KMFA 4N4NB 3W6VA 5JVGF 2BY1A 3BG3A 4OMZA 5J3LA 3OYGA 3OYHA 1W36D 2M0CA 3DQVC 1DUXC 3LSHA 4CCNA 3CO7C 4E7KA 5IT9Z 4L0YB 4C3JJ 2PN6A 3WU1B 1D1AA 3FBNB 2BBYA 3ABKH 1D0ZA 4F7ZA 6PAXA 3RPUA 2DQRA 1JJ6C 1E3HA 5E79C 4X1EA 2E5ZA 3SHFA 2DA6A 2XC7A 3GYHX 2HTSA 3V7CA 1BI2A 1YIJI 4BYYA 1Y1WJ 4ESFA 1I27A 2O0YA 3J7ZI 1VF9A 2XUBA 1N75A 2CWEA 1FX7A 3BR5A 4HX4A 2ZJRF 2UUZA 3CZ6A 4E7HA 3FXJA 4OAYA 1PP7U 4BQAA 5ICFA 2VC0A 3TW7A 2FMYA 3C18A 1PUFA 3HOVJ 3OV8A 2Y9YA 5F1RA 4UUVA 2FOWA 2F5CA 5FROA 1PVEA 1ULYA 2M4KA 3KLNA 1ZK8A 2FBHA 2QQ8A 5EG0B 4WWCA 3C2BA 3G71I 2VJJA 5FJ8J 2VOPA 4KITB 1SFXA 3S16J 3BR2A 3WG9A 4UUSA 1YI2I 4F52A 1R49A 1ITYA 3HYIA 2KZGA 1ETVA 5C3EJ 5JR3A 3FXUA 2ETHA 2E19A 3P5JA 3HJEA 3KYLA 3VB2A 1KU7A 3ECHA 3BWGA 2A07F 3PNTA 1USSA 3RSNA 2W25A 1YTYA 1ZTRA 2KIMA 2L3DA 3GZ5A 4IHWA 1R23A 3JAMK 4RLFA 3OYMA 1REPC 4G7OF 3G1OA 1TQIA 1Z77A 4RAGA 1OYWA 1BC7C 1JHFA 2MFZA 1VQ9I 1IXRC 1D1BA 4JP0A 3L7WA 2V1XA 1YFHA 3S14J 4ASNA 3BP8A 2QZ8A 2RV8A 3ZQHA 1X3ZB 3PQJA 2DFIA 1V3FA 3P9KA 4KN7X 3BZ6A 4XL9A 3OSGA 2Q1ZB 1VFCA 4HF0A 3CCUI 2V6CA 1GLNA 1TBXA 2A05A 1LEAA 1FY7A 1IRGA 2XKPA 4U88A 3COAC 2QLZA 3HEFA 4XRFA 1XTAA 4OIOF 3J80Z 3H9GA 3J80K 3Q5FA 1QA6A 4IQJA 4BQNA 5BQTA 2XF7A 3KETA 2K3FA 1WPKA 1IN5A 5IP9J 2LTPA 2DMQA 5HLTA 2DCEA 2D5VA 2PEXA 3F8NA 2LC2A 1Z1DA 5D6FA 1O3QA 3H0GJ 4II3A 4MEYF 1WZ2A 5DYMA 2OU2A 3IAM2 3JRGA 3MKLA 3ZMDA 5EZHA 1WH7A 2O9LA 2Y0SA 1W36C 3TKYA 4IJAA 4JQFA 3A1YA 2ZXIA 1Q1HA 2VN2A 2P5KA 3CP8A 4B44A 1JKPC 1BI0A 1D3YA 1CQTA 3VDXA 2L9RA 3OIPA 4DNCA 3T5XA 1OPCA 2ZNYA 4NNJA 1VQLI 4A3DJ 1Y6IA 3TO6A 3RKXA 4J00A 3WTVC 5L3EA 3M1CA 3R0AA 3PIPF 3HL2A 2W4SA 4BQQA 1IW7F 3BR6A 1FMWA 1KONA 4Z2YA 3IKTA 1QPMA 5ILUA 1ZARA 4NB5A 2DMNA 4L9NA 2ZFUA 5IYCJ 3LAJA 1RR8C 3PO2J 3TW6A 1FPQA 4A3MJ 1ON1A 4YELA 5ICCA 3IC7A 5IT3A 3RKQA 1YJNI 3KZIC 1BL0A 3BC8A 3GZNB 3MFKA 4KJZA 3ABTA 1Y56A 4AM3A 4KT5C 1QNTA 2BXZA 3HRTA 4KIGA 1IV8A 3K0LA 5L3BA 4ITVA 1MJAA 3BTLA 4B47A 2PFBA 4M74A 5CQEA 4AIJA 2XSJC 3RCOA 4I99C 2IJLA 1I3AA 1TWGJ 2BVMA 3I4NJ 1ENHA 2DJNA 3B02A 3K4MA 5E1WA 1JT6A 4EM2A 3HUGB 1MMNA 1ETXA 1IXCA 4AVZA 5LHIA 1WFXA 2V7FA 3HIFA 4MFDA 4ZC3A 4II2A 2EV5A 1EJ9A 1WQ2A 2FEZA 4RA2A 4I02A
chains in the Genus database with same CATH topology
3C2HA 2X1DA 1BR4A 2DT7B 2HZDA 2IXSA 3OL3A 4ZTFA 4XOTA 3IAS2 3DTKA 5HNHA 4AU7A 1VZ0A 3VWBA 4XLFA 3H5AA 4CCJA 2X1EA 2WADA 5CQGA 3FDYA 2LREA 3G2BA 3RPUD 3DPLC 2V26A 2CS3A 4LITA 2JVHA 4LIVA 3W2AA 3DPTA 2Z16A 1WJEA 2WAFA 3OMYA 2VQHA 4F91B 3L2UA 1WJDA 1MMDA 2R7VA 2W1OA 1YX3A 4XOPA 4IQ4A 3E0JB 3LL7A 4BDYA 3A4CA 2LRDA 4IKFA 2JSPA 1U0JA 2ELJA 1UELB 4BJ6C 1X19A 3DEEA 4B43A 4R79A 2R7QA 2HPIA 2WA0A 4DOZA 5TGTA 3V42A 3K10A 2RREA 4FETA 3DTEA 2P0WA 1V5EA 2KMUA 4P5OA 3QYBA 3OYKA 3ZGKA 3S3NA 4JOMA 4KISA 3U21A 3OWTA 4GRIA 4BE0A 3C2GA 3VYSB 4CH7A 2CW7A 2DOAA 4BU2A 4E4HA 2AQEA 4XM3A 3BCAA 4XR6A 3CJQB 2WAEA 3OYJA 2AQFA 4E7JA 3LSIA 2BW3A 3DTIA 5HNFA 2V6EA 1ZELA 2WY7Q 3EUKL 4CCLA 2CV2A 4Y4RA 3AL0B 2JUGA 2XAUA 3KX2A 3L2QA 5LD2C 4PJJA 3K4NA 3CP2A 2W00A 4E6KG 4F92B 4CCMA 2UWMA 4E7ZA 2L9NA 3HOSA 3MD2A 1T95A 4HNUA 5KCMA 3OR1C 4BUPA 1X4OA 2PJRA 2BVLA 2L2OA 1PYVA 1DQUA 2K3PA 4CZCA 2IS1A 2FUG2 2X6WA 1QHGA 3AKZA 2DJIA 2XF6A 4BQOA 2MYSA 2JA2A 2XF5A 2LBFA 1TT0A 4U7BA 4HNTA 3L2RA 3SDBA 1K6YA 2CFOA 3ONQA 3EPZA 4XQFA 1IRXA 3DLAA 1MMAA 2ZSIB 3HKZA 2K9LA 3S93A 1T0FC 4CSWA 3H0DA 4HSRA 2W82A 2X6XA 4YEJA 1Z7LA 4XLCA 1TZLA 4EATA 3RQ4A 3CF2A 2VIXA 2X85A 2VQCA 1G8XA 2IS6A 4NC7A 4XKVA 5FRMA 5FRNA 4X0GA 3EUAA 1DP3A 4NQWB 3AFHA 2E1MB 1NG7A 3D5LA 3LSGA 1OLTA 2LH9A 4PSXA 4RM3A 4BS9A 1UG0A 4P1WA 2VL8A 1JI8A 3LMMA 1LKXA 3MMYB 2WAQA 5HVQC 2Z2SB 2KQRA 3GBGA 1BR2A 2MD0A 2KHMA 3K70D 3OYLA 3KEYA 2R7OA 2L9SA 3TL4X 3UR3C 4PJLA 3D5SC 1YE9A 2BOLA 1SAUA 2X51A 4PFPA 4C2UA 3EUHC 2HDWA 3VYUB 4XKWA 4ZYAA 1AA7A 3OS1A 4CUGA 2F6CA 2XDVA 3LFUA 2IGNA 3PNVA 4IX7A 2QKLB 3K4CA 4HEA2 4C2TA 4HG2A 3SZGA 3NWSA 4QPOA 3K4BA 2KLOA 2A6TA 3CMMA 3FBIB 4PSWA 2M4GA 1WJBA 4XONA 4LG3A 2HNHA 3OS2A 4XKBA 4HRIA 3DU5A 4PJMA 3BLYA 1N78A 2VXDA 3OYAA 4RM2A 3OY9A 4BGDA 2IGOA 3ZXSA 1QHHD 2MC4A 1X1CA 2HU9A 3OIQA 3S3MA 3OYIA 4DBQA 4F93B 4XLHA 2UV1A 2IS4A 4ZJZA 3K4LA 2Z1DA 3M8JA 1HA8A 4KT6A 4G6TB 3OYCA 3DKYA 2V4JC 2R4GA 4F55A 2HVRA 2HVQA 3OOUA 4BDZA 3FHNA 2HVSA 2Q2EB 4ZTJA 2RQQA 1WJCA 4NC8A 2OUMA 1DGWY 4Y3OA 1LVKA 2R7TA 4BEHA 2KL4A 3IP4B 2DT6A 3CESA 4D1QA 4HSTA 3OR2C 3ZRGA 1V5GA 2CW8A 4QPQA 3J7AY 2X1CA 4FASD 2WB1A 3IUOA 3S32A 1X1DA 2IS2A 3MKZA 4N4NB 2IGMA 3OYGA 3OYHA 1W36D 3DQVC 4XN3A 3LSHA 3H9JA 2HPMA 4CCNA 1LFPA 4E7KA 1X1BA 2R7WA 2L7KA 1G59A 1D1AA 3FBNB 3OYEA 4J01A 1D0ZA 2VKDA 2LYCA 2E5ZA 2GOMA 2XC7A 4N4OB 1Z3XA 3OYDA 4E7LA 3A2KA 3S8PA 1QU3A 4NUBA 1N75A 4XLEA 2OV7A 2LBFB 4RMNA 2UUZA 3CZ6A 4E7HA 1E0EA 4OAYA 2LG4A 3PNYA 1S9HA 5CKTA 3HG9A 1X4PA 2VXZA 4PFOA 2IGKA 4AYBA 2CV0A 2F5VA 3PSFA 1J09A 1OR7C 5FROA 2M4KA 4DJAA 1WJ5A 2M0MA 3W2VA 2NOJB 3K6GA 3SEZA 5LFAA 3DU6A 2VJJA 3OL4A 3PFYA 4KITB 3OYFA 2DXIA 3OS0A 3L2VA 1SFKA 3H9QA 1V5FA 4XNFA 3ZR8X 4IZZA 4F52A 3TBIA 2OC6A 3K4KA 4CA0A 3TMOA 4PUSA 2MABA 4B48A 2CUZA 1MMGA 1X1AA 2V1NA 1D0XA 2GOXB 1BOBA 4BL0B 3SEQA 3BG7A 2CUJA 3KYLA 2A5WA 3PNTA 1MNDA 3RTRA 3RSNA 4BACA 3W2WA 4E7SA 4RLFA 3VYRB 1YX5A 3OYMA 2VJ4A 3FKJA 2CV1A 4OWRB 3UNGC 3QYFA 2W7NA 2WY8Q 2O5RA 2MFZA 4YRVA 1D1BA 2LOOA 3H5NA 3HPHA 2VQLA 4BE2A 1WJAA 2KRCA 4PK4A 2ZXHA 1MNEA 2BW3B 3N05A 3K70C 4XL9A 2HQAA 2Q1ZB 4B3XA 1ERDA 4LIUA 4XLAA 1GLNA 2I8DA 2KP6A 3SYTA 4BXFA 4HPQA 1R6RA 2E60A 2VQGA 3VSKA 2M7BA 2WBMA 3H9GA 3QODA 3QOEA 4IQJA 4BEHB 4D9JA 2VPLA 4BQNA 1FMVA 3DPUA 3I9V2 3OYNA 4BJ5C 2R7UA 4ANJA 4XN0A 4ZDOA 2XF7A 3ZCOA 4DGWB 2KRHA 1LDKB 1PJRA 3PL8A 1UAAA 4ZDPA 2LY1A 1Z3YA 2M7AA 5HLTA 2DCEA 2VASA 4BJTA 1DGRM 5CPRB 2VKHA 3PUBA 2VLAA 4OAZA 1EA3A 2LC2A 2ZSHB 5HOOA 4ZDLA 4II3A 2CMPA 3VYTB 4C30A 4H4KC 3I3LA 3IAM2 4F3QA 2R7SA 2L5QA 3AL0C 2M3AA 4CCKA 4Y33A 3BCBA 3LSMA 3H35A 2Y0SA 1W36C 3QYEA 4JQFA 4B44A 3A1YA 2ZXIA 3CP8A 4RLQA 4C9YA 3CJRB 3S3OA 4BE1A 3VDXA 3HPGA 2VJ5A 4U87A 3OIPA 2PMZA 3W3CA 3VSLA 2V9KA 4NNJA 4E7IA 2K5CA 1Y6IA 2F4IA 2KPMA 5KNLA 3HOTA 4J00A 1P9QC 5KHDA 3M1CA 4XORA 3HL2A 2PJRB 2W4SA 4BQQA 3HXLA 1FMWA 1KONA 3E1SA 4XMYA 2E1MC 3ZQQA 3OYBA 3F9KA 5JHFA 4CCOA 4PJNA 4MLOA 1N77A 2ZFUA 2X6YA 4YELA 3D5RC 1D0YA 2VB6A 1Z21A 2QKMB 2R7XA 3BC8A 4KJZA 1Y56A 2KDOA 3MKWB 3H5RA 3LSKA 2LY2A 4ITVA 2K9MA 4B47A 1WJFA 5CQEA 4XKCA 4DBRA 2XSJC 3RCOA 2RNGA 3MKYB 2BVMA 3DWLE 2CH0A 3BG6A 3K4MA 2E5NA 3PSIA 1NG6A 3HUGB 1D1CA 1MMNA 2JVGA 3DKXA 3NWTA 3PJRA 3K4JA 4AVZA 1WFXA 2V7FA 3HC7A 4ZC3A 2KZVA 3L2WA 2R7RA 4II2A 2VJIA 1MW7A 4DIQA 1BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI8 A;  1YX3 A;  2V4J C;  1SAU A;  3OR1 C;  2XSJ C;  3OR2 C;  2A5W A; 
#chains in the Genus database with same CATH topology
 1BIB A;  2VBY A;  2XHK A;  4LFU A;  3PUF A;  1BR4 A;  3O8G A;  5FO5 A;  2NS8 A;  4ZTF A;  2FA5 A;  4XOT A;  2YR2 A;  3IAS 2;  3DTK A;  5IT9 K;  1TWF J;  2HYJ A;  1I6H J;  3H5A A;  1H9T A;  3WTZ A;  1KQ8 A;  1H9G A;  3E3V A;  3HB9 A;  4EGY A;  1RC9 A;  3PM1 A;  3AG3 H;  3T0Y A;  3GTK J;  5IYB J;  2H27 A;  2GAU A;  5GPA A;  1WJE A;  2B0L A;  2QBY B;  1N25 A;  3KPH A;  2EFW A;  3JW4 A;  2VQH A;  4F91 B;  2DTZ A;  1LDJ A;  3ZN0 A;  2HYF A;  2R7D A;  1Y0N A;  3F6O A;  1BM9 A;  4LOC A;  4IQ4 A;  3BT9 A;  2E1C A;  5D5U B;  4KN4 X;  3IL2 A;  3CC4 I;  4IKF A;  2JSP A;  1IAW A;  1F9N A;  1U0J A;  3E97 A;  4JX5 A;  3DEE A;  4RGU A;  4XRS G;  4R79 A;  2MD5 A;  2EZH A;  3LNQ A;  3E6C C;  2H6B A;  1K79 A;  5J6X A;  3TED A;  5D5W B;  1JTY A;  2BV6 A;  1TNS A;  1MSF C;  5TGT A;  1FJL A;  4UVC A;  3HRM A;  2FX0 A;  2EFN A;  1HW2 A;  2LMD A;  3PFI A;  3REO A;  2KMU A;  4I98 B;  1BOA A;  3E7L A;  5J4Y A;  3NRV A;  3S3N A;  3WHC A;  3ZP5 A;  2CG4 A;  1W1W E;  3T8T A;  1P6R A;  3U21 A;  1JJ8 C;  2C6Y A;  1ZLJ A;  1SMY F;  1ETY A;  2KJC A;  3KZZ A;  4U0V A;  1ETW A;  1TT5 B;  2CW7 A;  3WE2 A;  2HQR A;  2DOA A;  4E4H A;  2HZT A;  2CQK A;  3TO7 A;  5FLX Z;  2QVO A;  3G4S I;  2L9V A;  1Y1V J;  3LQQ A;  1Z7U A;  3NEU A;  5LLQ A;  4HDV A;  2MH2 A;  4MEX F;  2OTJ I;  1GT0 C;  1VQ7 I;  4I76 A;  2VPR A;  3MN2 A;  4HZF A;  2HQ5 A;  4V2F A;  2CV2 A;  4Y4R A;  3L2Q A;  2DT5 A;  5DCM B;  1XPX A;  5LD2 C;  1AOY A;  1Y8R B;  3K4N A;  4A5M A;  2G9W A;  4E6K G;  4F92 B;  5FD6 A;  3S17 J;  2G0E A;  2ZXJ A;  4HNU A;  2VT3 A;  3OR1 C;  3K7A J;  4NC6 A;  2VKE A;  4LJZ F;  3FK7 A;  3G6E I;  2HQN A;  3JAM Z;  2L2O A;  5EDN A;  1PYV A;  2V79 A;  1KGS A;  1B9M A;  2FUG 2;  2X6W A;  4RB0 A;  3S1N J;  4XRM A;  2FF4 A;  2DJI A;  4OIQ F;  2JPC A;  2XF6 A;  3G1L A;  2LLK A;  2MYS A;  2JA2 A;  2R7Z J;  1J59 A;  4U7B A;  2IW5 A;  3VPR A;  1XSD A;  3CCR I;  2Z3Y A;  3EPZ A;  2NRA C;  3I59 B;  2JUC A;  1FLI A;  2JTV A;  5CVJ A;  4MTD A;  1QRY A;  1OKR A;  2HGC A;  3HKZ A;  1G3S A;  5E8G A;  2HWV A;  2NVY J;  3DEU A;  4NQW A;  2OZ6 A;  1W5S A;  5B66 C;  2K02 A;  3F0C A;  4DZP A;  2ME0 A;  1Z7L A;  1E2X A;  1O3S A;  1OQY A;  1MDM B;  5JLX A;  3CCE I;  2EJR A;  2A68 F;  2KIF A;  5HLI A;  5KVR A;  4IHS A;  3HTU A;  3WG7 H;  5LEK A;  1U8R A;  1J9I A;  1G8X A;  4L5E A;  4NC7 A;  1RES A;  5FRN A;  1VQ6 I;  1DP3 A;  2L7Z A;  3AFH A;  3ESW B;  2E1M B;  3ERE D;  4L9V A;  5LGT A;  2LH9 A;  4PSX A;  4RM3 A;  1S8N A;  4P1W A;  5J40 A;  3A0B C;  3MQ0 A;  5D4S A;  5M3F J;  2GQQ A;  2L7F P;  1XCB A;  3MZY A;  4L9J A;  2IT0 A;  3K70 D;  2L7M P;  1UFM A;  3OYL A;  2IA2 A;  5GAE J;  3KIO A;  1AHD P;  1XX5 A;  2H1K A;  2GXG A;  1TP4 A;  3UR3 C;  3D5S C;  2HDD A;  1BI1 A;  1ACI A;  3GXO A;  3EUH C;  2F5F A;  1T33 A;  2IA1 A;  4ZYA A;  4KUM A;  4CUG A;  4FX4 A;  3GTQ J;  4M9X A;  2CQQ A;  5E8I A;  1Z91 A;  4IX7 A;  4CYD A;  4HEA 2;  4Q48 A;  5AIQ A;  4HG2 A;  4HNV A;  4C2T A;  3K4B A;  4A0X A;  4EVI A;  2HOE A;  2A6T A;  2LNB A;  3FMS A;  1MDM A;  4MGR A;  4PSW A;  3K9T A;  5LRS A;  5GPC A;  4XON A;  2DMP A;  4LG3 A;  4HV6 A;  2EFQ A;  4L5J A;  4WXD A;  3OS2 A;  4HW0 A;  1JUS A;  4JX4 A;  1I1S A;  1ON2 A;  1T98 A;  3BJ6 A;  3E5X A;  3OYA A;  4RM2 A;  5J1Y A;  4BGD A;  2DLL A;  1QHH D;  2MC4 A;  2HU9 A;  3K2Z A;  1IN7 A;  1B1B A;  3OYI A;  3S3M A;  1SVL A;  5K5Q A;  4ZJZ A;  3TOA A;  2QCO A;  3M8J A;  1FC3 A;  4LD5 A;  5LEJ A;  1G2H A;  1LDD A;  4I0A A;  2HVR A;  1HOM A;  2DYS H;  2HVQ A;  2ISY A;  3FHN A;  2B63 J;  3Q9V A;  4A12 A;  2OUM A;  4UV9 A;  1YO5 C;  2DN0 A;  2K9Q A;  2EV0 A;  1IGN A;  1ZG5 A;  5DM7 F;  4BEH A;  3JCU C;  2CYY A;  3U1K A;  1I3Q J;  2DT6 A;  2UXN A;  1ZGJ A;  4HST A;  3JRC A;  2GXB A;  1V5G A;  2CW8 A;  4M6X A;  3J7A Y;  3T8R A;  4BBS J;  3S32 A;  1X1D A;  2RQP A;  2VC1 A;  2WTE A;  2KRF A;  3H3Z A;  2QSH X;  4CYC B;  1ZKG A;  3WTU C;  4M3F A;  3HHH A;  2XGX A;  2R7W A;  5K7H A;  3V8L A;  2L4A A;  2DOF A;  4FT8 A;  3E5Q A;  1X2M A;  4J01 A;  1IN8 A;  3TGN A;  2E2I J;  1P7I A;  1SD7 A;  2MBF A;  1S72 I;  2GOM A;  5EZG A;  1R58 A;  2COB A;  1T2K A;  2Y31 A;  3F3X A;  4Y15 A;  4ENJ A;  2FNA A;  4KIB A;  4N4O B;  4P9U A;  2FRH A;  4E7L A;  3BG9 A;  2EQR A;  2XB5 A;  2A3S A;  3IH2 A;  4XLE A;  5FB2 A;  2BY3 A;  2DDA A;  4BBR J;  5CVI A;  3GEZ A;  2O61 A;  4RMN A;  1B6A A;  1E0E A;  5L3F A;  1ZR4 A;  2LG4 A;  3EUH A;  1S9H A;  3PNY A;  3Q0U A;  4XK4 A;  3ZQI A;  3JR9 A;  1K78 B;  1X4P A;  4PFO A;  4B1R A;  2IGK A;  4UXN A;  4ZYD A;  2CV0 A;  3PSF A;  1OR7 C;  3CCY A;  1BW6 A;  4BXX J;  3WTS C;  2H1L A;  1H8A C;  5DV5 A;  5F27 A;  4ENM A;  1FSE A;  2NOJ B;  4NHJ A;  3SEZ A;  4EM0 B;  5E3N A;  2IA0 A;  3OL4 A;  4AIH A;  2Y2Z A;  3DFG A;  5F08 A;  4HX8 A;  1MBG A;  3BR0 A;  3OS0 A;  1PUE E;  1SFK A;  1WI9 A;  1V5F A;  3H9Q A;  3M4O J;  3HRS A;  3ZR8 X;  4IZZ A;  3S2W A;  3TBI A;  5DUI A;  3DV8 A;  3BOQ A;  1T38 A;  2E1N A;  4PUS A;  2MAB A;  1MMG A;  1Z9C A;  2DPD A;  2H6C A;  2IP2 A;  5FFX A;  3EQL F;  4YG2 F;  1R9T J;  2A5W A;  2Y9Z A;  1ZN2 A;  2FXA A;  4IRG A;  1FYM A;  5DS9 A;  1R00 A;  3RQI A;  3TO9 A;  5F1J A;  3W2W A;  2YS9 A;  1KA8 A;  5L3D A;  4E7S A;  2VJ4 A;  2VE9 A;  2EV6 A;  2FQ4 A;  1ZRF A;  2DAO A;  2QGU A;  2WY8 Q;  3FXL A;  4S0H B;  5F0F A;  2VOD A;  3W6J B;  2NS7 A;  1P92 A;  4YIF A;  1A35 A;  3HPH A;  3JRF A;  2ZXH A;  2BW3 B;  3CUQ B;  1EV7 A;  3N05 A;  4RAZ A;  4LIU A;  1XGM A;  1S6L A;  2I8D A;  3SYT A;  4HA8 A;  4OOI A;  3RZO J;  2QUF A;  2QM3 A;  2E60 A;  1AKH A;  1PDN C;  2VQG A;  3SFI A;  1SEU A;  4ESJ A;  2F4O B;  2CO5 A;  2XPV A;  1MJ9 A;  1FMV A;  3JRE A;  4OIP F;  4AWX B;  3A0H C;  3DKW A;  1XSX A;  1RKW A;  4OU0 A;  3CCS I;  4WK8 F;  5D8K B;  2O6G E;  1O7F A;  1LDK B;  1TQP A;  1WRJ A;  4YFN F;  5L3G A;  2R5Y A;  2W57 A;  1Z3Y A;  2ID6 A;  4GFB A;  1YS7 A;  4EV0 A;  1Z0X A;  2GIV A;  2ZSH B;  2ECB A;  3VFZ A;  4ZDL A;  5J4V A;  4M6Y A;  2Y69 H;  1B8I A;  3VYT B;  2FML A;  2BZT A;  4C30 A;  3WTX C;  1IZ1 A;  2Q0O A;  2GA2 A;  2R7S A;  2L5Q A;  3AL0 C;  2M3A A;  5HDG A;  3LOC A;  1ZLK A;  2ZME B;  1SFE A;  3LSM A;  2VBZ A;  2WB1 N;  1KQ0 A;  3S3O A;  1UJ8 A;  2FJ1 A;  4UY8 I;  1RZ4 A;  2VJ5 A;  3VSL A;  2K5C A;  4DYC A;  4A93 J;  5KNL A;  2ZME C;  2Z5U A;  1P9Q C;  2X0L A;  2A69 F;  2BY0 A;  1H0M A;  1TL8 A;  2PJR B;  1K61 A;  3G3Z A;  3FF5 A;  2ZC2 A;  2R0Q C;  3HXL A;  1SD4 A;  3M3Y J;  4Y17 A;  3LA7 A;  1B4A A;  3OYB A;  1XS9 A;  3A03 A;  1MBF A;  2K86 A;  1IXS B;  4MLO A;  5LHG A;  5LHH A;  2DMT A;  3GTM J;  3BJA A;  3CDL A;  4MTE A;  4FE4 A;  4ZYE A;  2FE3 A;  4EMS A;  1XC5 A;  1Z21 A;  2VB6 A;  3ZOB A;  1O4X A;  1O3T A;  2EIK H;  1VQ5 I;  5JLW A;  3MKW B;  1Y0U A;  3H5R A;  3LSK A;  3JTH A;  3LA3 A;  4MNU A;  1LVA A;  2K9M A;  3JTG A;  2GA1 A;  3I4M J;  1V4R A;  3RYP A;  2HOT A;  1BC8 C;  1J5Y A;  3MKY B;  1J0R A;  3DF8 A;  4C2M J;  3EYY A;  3FM5 A;  1U2W A;  3KYD B;  1U5T C;  2E5N A;  1LEB A;  4PJ0 C;  3ZQC A;  2DOE A;  2JZY A;  3K4J A;  1ZGW A;  3I54 A;  5C4X J;  4PDK A;  3AG4 H;  3QPL A;  4JX6 A;  1X3W B;  1R7J A;  1R6R A;  3NAR A;  3C2H A;  3FIW A;  5BPD A;  4LLG F;  1RI7 A;  2DT7 B;  2HZD A;  2IXS A;  3OL3 A;  5IP6 A;  1VQ8 I;  4L9T A;  3L09 A;  3KP7 A;  3CUO A;  1QBJ A;  4AU7 A;  4XLF A;  2B7E A;  5CVR A;  5CVU A;  2D1H A;  3G2B A;  2D45 A;  5H6Q A;  2V26 A;  4LIT A;  4LIV A;  2DQL A;  2ELK A;  3BG5 A;  3TQN A;  1FOW A;  3A01 B;  3I71 A;  3L2U A;  1WJD A;  2K27 A;  1GVJ A;  1YX3 A;  1I5Z A;  2X9D A;  4IPA A;  3QOP A;  3QU3 A;  3E0J B;  4BDY A;  2VUM J;  3A4C A;  1QVT A;  4PGG A;  1HST A;  1QPI A;  2ELJ A;  3PQK A;  4QWQ A;  4BJ6 C;  3KP3 A;  4M3G A;  1FYL A;  2WA0 A;  5AIP A;  5F0H A;  3G1M A;  1IDY A;  4LLL A;  2EFO A;  1ZG1 A;  1TLH B;  3QP5 A;  5E18 F;  1EH6 A;  5FKN A;  2TDX A;  3BPX A;  5ILV A;  2Z33 A;  1V5E A;  2ZBK A;  3QYB A;  2DDB A;  3OYK A;  1O3R A;  3SXY A;  3ZGK A;  3ASO H;  2DO7 A;  1OYY A;  3EET A;  4GXO A;  4O6J A;  1X3U A;  4KIS A;  3KCC A;  4IHX A;  4GRI A;  4BE0 A;  1RR7 A;  2A6E F;  2JSC A;  5HS7 A;  2AQE A;  3R0J A;  2MW8 A;  3CCV I;  1A6Q A;  1UHM A;  3BCA A;  4W97 A;  4MQ9 F;  1WWX A;  1A36 A;  1T6S A;  1U6G A;  2HOA A;  3LSI A;  5E1X A;  3SZT A;  4LB6 B;  3FMR A;  3DTI A;  2L54 A;  3HM5 A;  1YJ9 I;  2E71 A;  2YSR A;  1T08 B;  4UB8 C;  2ACJ A;  5GTH C;  2HKO A;  4CCL A;  1LE8 B;  2JUG A;  4B09 A;  3KX2 A;  5J1R A;  1XD7 A;  3JRB A;  4X6A J;  3CP2 A;  5J8F A;  4I6Z A;  3ZMZ A;  2W00 A;  3GVA A;  4JBA A;  2ZKZ A;  2QQA A;  1I50 J;  3UKG A;  3I56 I;  1FP1 D;  3MD2 A;  1T95 A;  3IKV A;  3M9A A;  5M3M J;  2OD5 A;  2NYX A;  1X4O A;  2BVL A;  3F72 A;  1PP8 F;  4BY7 J;  5ILS A;  3I4P A;  1QHG A;  2FD5 A;  2P7V B;  3AKZ A;  4R1H A;  1QZZ A;  4MIM A;  3HRU A;  5K1Y A;  1GVD A;  2XF5 A;  2CU7 A;  1P4W A;  4CIC A;  2CFO A;  2MLK A;  2P6T A;  1IRX A;  4G6Q A;  2A61 A;  2W84 A;  2K9L A;  4H0E A;  4BNC A;  4HSR A;  2W82 A;  2P7C B;  1JUM A;  2W48 A;  4C3I J;  2X6X A;  3ULQ B;  1MBH A;  2OPT A;  2ZNZ A;  2VE8 A;  4W1U A;  3CF5 F;  4EAT A;  2F5E A;  3RQ4 A;  3ABU A;  4FCY A;  2QYO A;  2IS6 A;  3WGG A;  2XGE A;  4X0G A;  3K2A A;  3H3U A;  1SC7 A;  4A3F J;  1GXP A;  4JYK A;  4NQW B;  5FKL A;  1W0T A;  1I1G A;  1Z6R A;  3N4M A;  2FQ3 A;  3BQY A;  1UG0 A;  3IV5 A;  1YRN A;  1MIJ A;  1X1P A;  4WXH A;  5FKM A;  1TQM A;  1SFO J;  3LMM A;  4A3K J;  3ERM A;  2GXA A;  3MMY B;  2WAQ A;  4V19 K;  2KQR A;  3GBG A;  2OZU A;  1S7O A;  2HEO A;  2E1O A;  4ENK A;  1ZRE A;  2MD0 A;  4P96 A;  2KHM A;  4GCV A;  3KEY A;  2DA2 A;  2XRN A;  3CJN A;  2OQR A;  2R7O A;  2M87 A;  4A5N A;  4CZZ A;  5ICG A;  3TL4 X;  2QWW A;  3TDZ C;  4ABZ A;  2IBD A;  4PJL A;  3BY6 A;  2BOL A;  2D2W A;  4PFP A;  4D0P A;  5EGO A;  2YX7 A;  4QIW N;  4Q47 A;  3VYU B;  3K69 A;  3E6D A;  5HS8 A;  3OS1 A;  3JSO A;  2IGN A;  2NS0 A;  4HF2 A;  3SZG A;  1UZC A;  5E20 A;  4DQ2 A;  1EKE A;  1TWH J;  3KP4 A;  3FBI B;  1HSJ A;  4RB2 C;  4GYG A;  2HTJ A;  5DDG A;  1V54 H;  3DBR B;  4IVN A;  3ISP A;  4LGW A;  1G6N A;  3C1D A;  4HRI A;  3NAU A;  1LUJ B;  2R93 J;  2M1B A;  5J8C A;  4RBO A;  2OJE D;  3QWL A;  1OFC X;  2IGO A;  1R1U A;  4M3E A;  1X1C A;  4HOB A;  1GXQ A;  3L9F A;  4DBQ A;  1JGG A;  3J81 K;  3RYR A;  3JRD A;  3WGH A;  3WE3 A;  5DM6 F;  2EA4 A;  2KT0 A;  2MH9 A;  4UUS B;  3IRR A;  2NOG A;  1KU2 A;  2QF7 A;  3HUG A;  4G6T B;  4M72 A;  3OYC A;  3S1M J;  3DKY A;  3L1P A;  4FX0 A;  2V1D A;  1W7P B;  2HS5 A;  2ID3 A;  2XIG A;  1YOV B;  3J7Y J;  3TOB A;  5ED4 A;  4EEF G;  3F23 A;  2RQQ A;  4ZZD A;  1SAX A;  4NC8 A;  4XIC A;  2JT1 A;  2COM A;  2Q8K A;  4CYC A;  4IO9 F;  1DGW Y;  1APL C;  3GLX A;  1KYZ A;  1UMQ A;  4Y3O A;  1LVK A;  2XAS A;  3CCJ I;  1B72 B;  2LD5 A;  1E3O C;  4GGG A;  4D1Q A;  2VT2 A;  2QSF X;  3HOX J;  4QPQ A;  3FXO A;  1MH4 A;  4FAS D;  2WB1 A;  1R71 A;  4Y7N J;  4Q5S F;  1W7P A;  3IUO A;  5DD4 A;  3MKZ A;  4KFC A;  2IGM A;  5DCM A;  5M5Y J;  3RJP A;  3HOZ J;  1HW1 A;  3H9J A;  1RUN A;  2HPM A;  4M73 A;  1X1B A;  2L7K A;  4KA4 A;  1G59 A;  2P5V A;  3HKZ N;  1KQ9 A;  2BHZ A;  3OYE A;  1FOX A;  4AUX A;  4LLN A;  2PG4 A;  2VKD A;  1B9N A;  1MZB A;  2HKX A;  5B1B H;  3VOE A;  2V9P A;  4G6D A;  3JRH A;  3KFW X;  3H36 A;  4D5F A;  1Z3X A;  4U7D A;  2EIM H;  4M9S A;  5EF6 A;  2PQ8 A;  2BYV E;  2OV7 A;  3LSR A;  2LBF B;  2ZXW H;  2JWT A;  2MC3 A;  3LFK A;  3V8K A;  1OYI A;  9ANT A;  2F5D A;  3CTA A;  5CKT A;  3HG9 A;  4FTH A;  2VXZ A;  2HDC A;  4UNO A;  1TWA J;  1HKQ A;  4GYI A;  2F5V A;  4MO7 A;  4HV5 A;  5F6F A;  2JA8 J;  4UVA A;  3MAJ A;  3B6C A;  5IPA A;  4DJA A;  3ZMT A;  1HKT A;  3WHB A;  4KYW A;  3DU6 A;  1YJW I;  1QGP A;  2ADU A;  3H3V K;  3PFY A;  1GV2 A;  2L02 A;  2RDP A;  3GWZ A;  2YX4 A;  3L2V A;  4Y52 J;  1OJL A;  2OC6 A;  3C7J A;  4WF2 A;  1U9O A;  1FIP A;  2DK8 A;  3ML6 A;  5KAI C;  3TMO A;  4CA0 A;  1OR7 A;  3HSR A;  1X1A A;  2DW4 A;  1D0X A;  2FU4 A;  4BL0 B;  3SEQ A;  1G3T A;  2CUJ A;  1XGS A;  1MND A;  5LRR A;  2DK5 A;  3DXJ F;  2Y0M A;  1R4M B;  3NQO A;  5GTI C;  4A0Z A;  1D8K A;  2LFB A;  4OWR B;  4U0W A;  3UNG C;  3QPT A;  1LNW A;  4AD9 A;  3QYF A;  4S04 A;  1RUO A;  3MZH A;  1T0F A;  1IG7 A;  1A5J A;  4ESB A;  1BBY A;  2ZME A;  1SD5 A;  2DTR A;  3F8M A;  2B9S A;  1K83 J;  3H5N A;  4RAY A;  3SFZ A;  2GM4 A;  3OSF A;  3RPQ A;  3KEQ A;  5CVV A;  1WJA A;  2X4H A;  4PK4 A;  2EIN H;  2GWR A;  1MNE A;  3R6S A;  4HYE A;  5A2Q Z;  3CMA I;  1IN6 A;  3K70 C;  2HR3 A;  2EFP A;  3KLO A;  1CF7 A;  1FT9 A;  2FNP A;  4KIF A;  2NVU B;  4LB5 A;  2GZW A;  2P5L C;  5C4J J;  2KP6 A;  1MH3 A;  3R60 A;  4HPQ A;  3F22 A;  3FXK A;  1J7K A;  2XAG A;  2WBM A;  4XRS A;  3QOE A;  3BQZ A;  4BEH B;  2EB7 A;  2VPL A;  4EJV A;  3DPU A;  3BDD A;  3OYN A;  2LSO A;  4ANJ A;  4XN0 A;  3ZCO A;  2J5O A;  5FD5 A;  2KRH A;  3GX4 X;  1PJR A;  2M8E A;  3PL8 A;  1NH3 A;  1UAA A;  2LY1 A;  2TCT A;  1HBX G;  1IJW C;  5A2Q K;  2EZK A;  1G3Y A;  3U9G A;  2V1U A;  1BA5 A;  2VLA A;  1ETO A;  1U5T A;  4OAZ A;  1EA3 A;  1UCR A;  4YIR X;  5HOO A;  3F6V A;  3A02 A;  3MEX A;  1YLF A;  5K5R A;  4IRH A;  5CLS A;  1TW3 A;  4F3Q A;  4KMU X;  4CCK A;  3IH3 A;  4Y33 A;  3BCB A;  3H35 A;  3KZY A;  2IVM A;  3QYE A;  1JT0 A;  1HLV A;  1IV6 A;  2ISZ A;  1D5V A;  5JHU A;  4RLQ A;  4C9Y A;  1HC8 A;  3CJR B;  3CO6 C;  3IWF A;  3FWE A;  4BE1 A;  3HPG A;  1VND A;  3GFL A;  1FNN A;  2F4I A;  3FKI J;  3HOT A;  1HDP A;  4G12 A;  4XLN F;  1QZY A;  4XOR A;  1LFB A;  2R92 J;  4AVP A;  1W0U A;  3W6K B;  1WHU A;  5K7F A;  3FXR A;  4XMY A;  2E1M C;  1YW9 A;  3F9K A;  1AKH B;  1FWZ A;  3BZC A;  4PJN A;  2DFF A;  3AG1 H;  1SMT A;  1Z05 A;  2X6Y A;  2V9V A;  4AIK A;  2RC4 A;  3ZPL A;  2XAQ A;  5L3C A;  2XAJ A;  4U0Y A;  1LB2 A;  3GTP J;  2KDZ A;  1OMI A;  2DA4 A;  1XMK A;  2R7X A;  1V55 H;  3LSP A;  4UHT A;  3FMQ A;  2KDO A;  1VQN I;  1HKS A;  3U2R A;  3P9C A;  4QTR A;  3CC2 I;  5E17 F;  5EEG A;  4M71 A;  2LY2 A;  2R5Z A;  1S5L C;  1OCP A;  1P4A A;  1WJF A;  1ZH5 A;  3QP6 A;  3ASN H;  4O5V A;  2EIL H;  1JKR C;  1K78 A;  2KIS A;  1CGP A;  3DWL E;  4OIR F;  3QPH A;  3BG6 A;  2CH0 A;  1NG6 A;  1D1C A;  2JVG A;  3NWT A;  1E17 A;  3SDG A;  5IOZ A;  3L2W A;  4YII A;  1MBJ A;  2MSY A;  2R7R A;  1MW7 A;  4DIQ A;  2DPU A;  2EZI A;  3ABL H;  2X1D A;  1U78 A;  2PJP A;  2JRT A;  3DBH B;  1ETQ A;  3GZ6 A;  2E7W A;  4N9I A;  3A01 A;  3ELK A;  4HBL A;  4BH9 A;  5HLG A;  5HNH A;  1VZ0 A;  1MJB A;  2XV4 S;  1POG A;  5KK1 A;  1RRJ A;  4CCJ A;  2Z9O A;  3VWB A;  5CQG A;  1WI3 A;  3MWM A;  4HX7 A;  2CGP A;  2LRE A;  4UB6 C;  3CQZ J;  1FSH A;  1K4T A;  3Q0V A;  2DA1 A;  3DPT A;  2QSG X;  3EDP A;  3OMY A;  1WCM J;  1ZAO A;  2MA3 A;  2AS5 F;  1MMD A;  1MMS A;  1S7E A;  3K1M A;  2R7V A;  2XB0 X;  4EQQ A;  5IOY A;  4XID A;  2W85 A;  4XOP A;  2PMH A;  4HLY A;  2F48 A;  4Y13 A;  3CC7 I;  1A04 A;  1F5T A;  2AXT C;  1RPW A;  1YHQ I;  1X58 A;  1UEL B;  2AO9 A;  2LDU A;  4ZYG A;  2DFH A;  5CJ9 A;  2EK5 A;  2OQG A;  2F2E A;  4WCG A;  4IEJ A;  3J81 Z;  1F1Z A;  3OOP A;  4IHV A;  4ON0 A;  3V42 A;  2M2E A;  3K10 A;  2RRE A;  5EGO B;  4FET A;  3DTE A;  2HXI A;  2ZO4 A;  2P0W A;  1S29 A;  1TWC J;  3DEW A;  1F4K A;  2LF7 A;  3LWF A;  3JRI A;  2MG4 A;  4YFX F;  5BOX A;  2J5P A;  5LBQ A;  3FM3 A;  4JOM A;  1IC8 A;  1ETK A;  2LP0 A;  2OA4 A;  1FOK A;  3OWT A;  2AXL A;  2M8G X;  2Y0S N;  1F36 A;  3VYS B;  4CH7 A;  1SD6 A;  3WTY C;  4BU2 A;  5TIS C;  4XM3 A;  2WAE A;  2AQF A;  4E7J A;  1JHH A;  5JI6 A;  3GTL J;  2IAI A;  3FXM A;  2ZJ2 A;  4XBF A;  2QA4 I;  2V6E A;  1L0O C;  4HDU A;  1ZEL A;  1HCR A;  2KFD A;  2L0K A;  2WY7 Q;  4HQE A;  4N9H A;  4Q4Z F;  3WGI A;  1QZE A;  4D7M A;  5TJJ A;  5M5X J;  4D5C A;  2CRG A;  1PUF B;  1RET A;  2STW A;  1KYW A;  3KP2 A;  4E7Z A;  2L9N A;  3CCL I;  3HOS A;  2Y75 A;  1DPR A;  5KCM A;  5AON A;  1FBQ A;  3F21 A;  4BUP A;  3I55 I;  2PJR A;  1BN5 A;  5DUK A;  2E7X A;  2K3P A;  4KNY A;  4CZC A;  2X6O A;  5EEH A;  1JTX A;  4M9Z A;  2YU9 J;  2MLG A;  3P7N A;  2PBI A;  2JK3 A;  1O57 A;  2FSW A;  1FTZ A;  3L2R A;  2VOO A;  3SDB A;  1K6Y A;  3ONQ A;  4XQF A;  4I01 A;  1FIA A;  2H09 A;  1XN7 A;  1VQK I;  2ZSI B;  1XSV A;  2N8G A;  4O3M A;  3FZV A;  2P6S A;  3ABM H;  4CSW A;  3S93 A;  2RKH A;  1EF4 A;  1FOY A;  1IO2 A;  4XLC A;  1A31 A;  2K9N A;  3RZD J;  4RGX A;  2VIX A;  4D7N A;  3WTT C;  1MBK A;  4XKV A;  2EWN A;  3E5U A;  4IOA F;  3EUA A;  2WV0 A;  5J47 A;  1BJZ A;  3D5L A;  3LSG A;  3WU0 A;  4A0Y A;  3HSE A;  1OLT A;  3RI4 A;  5HDK A;  4BS9 A;  5LGN A;  1JI8 A;  2VL8 A;  5GP9 A;  1FYK A;  3HTS B;  4IHT A;  3FXQ A;  1LKX A;  2TRT A;  2KIU A;  3CLO A;  5HVQ C;  2Z2S B;  2DA5 A;  1BR2 A;  2ELH A;  1ZHF A;  1Z6T A;  1MGT A;  2I5U A;  2K9S A;  1GV5 A;  2DFE A;  2CUE A;  2JRM A;  3CMY A;  3O6B B;  1YW7 A;  3RIR A;  3KEO A;  1D8J A;  4DYR A;  1NHA A;  1FBS A;  2X51 A;  4C2U A;  2JA6 J;  4PCQ A;  1TW2 A;  2ESN A;  2HDW A;  4XKW A;  3X2Q H;  1AA7 A;  2JJ7 A;  4PZJ A;  5F64 A;  4LK1 F;  2XDV A;  3LFU A;  2G7H A;  1LJ9 A;  2XGD A;  3NWS A;  1OCO H;  1B72 A;  4XSX F;  3GFI A;  2I10 A;  3S2H J;  2IEK A;  1FP2 A;  4IHY A;  2JN6 A;  2LKP A;  2UZK A;  2WV1 A;  5EEA A;  3Q3S A;  5HLH A;  5DEQ A;  2XRL A;  1R22 A;  3HZJ A;  3L00 A;  3TDU C;  4XKB A;  1K4S A;  4EGZ A;  3DU5 A;  5M5W J;  2XGC A;  2YUS A;  2K4J A;  3S1Q J;  2VXD A;  2PLY A;  4WXC A;  3S15 J;  3B6A A;  1WKM A;  4RB1 A;  3OY9 A;  1ODD A;  1YQA A;  3TP0 A;  2L01 A;  3OIQ A;  4NDL A;  1STZ A;  2UV1 A;  2YPR A;  4TV7 A;  3D0S A;  1HA8 A;  4KT6 A;  5EJC A;  2GIZ A;  3DCF A;  4XSZ F;  5JVT A;  1QVU A;  1ZYR F;  5LGU A;  2R4G A;  4F55 A;  1WGX A;  2HVS A;  1RNL A;  1WJC A;  4IL6 C;  2JA5 J;  4LMY A;  3SQN A;  2EPF A;  1OCT C;  3LQR A;  2K40 A;  1UHS A;  3JSP A;  3CCM I;  3CCQ I;  1KU3 A;  1Q1V A;  4EJT A;  3IP4 B;  3OR2 C;  3QQA A;  3ZRG A;  4B4C A;  1KZH A;  1SFU A;  2LF8 A;  2O3F A;  3PIO F;  2BY2 A;  5D5X B;  2IS2 A;  4I09 A;  2CJJ A;  4UV8 A;  3GW2 A;  4XN3 A;  1JKQ C;  1K6O A;  5IYD J;  4QLC U;  1LFP A;  4LG0 A;  3H92 A;  3WTW C;  2CQ7 A;  2GBY A;  4XLP F;  2AHQ A;  4LK0 F;  5FKK A;  1XMA A;  4BY1 J;  2WC2 A;  2LYC A;  2XPU A;  1G4D A;  2OF7 A;  3L2C A;  1MKM A;  1UB9 A;  1GDT A;  3OYD A;  2BHY A;  1IF1 A;  3A2K A;  4QSH A;  3S8P A;  4BXU A;  2NVX J;  1QU3 A;  3TP3 A;  4NUB A;  3BR1 A;  1JXS A;  2LVS A;  3KYC B;  2CSO A;  3E6M A;  4GO1 A;  1YRN B;  2O03 A;  4KIC A;  3HOY J;  3HBL A;  1A6I A;  3ZMV A;  4FIS A;  2DMU A;  2QBY A;  5BPI A;  1AWC A;  4AYB A;  1J09 A;  3M8F A;  1IRZ A;  3ECO A;  1OCZ H;  1WJ5 A;  2M0M A;  2PMU A;  3GLL A;  3W2V A;  3K6G A;  2JPB A;  2XAH A;  5TRD A;  5LFA A;  3BRO A;  1JKO C;  3HOW J;  1DU0 A;  2A5Y B;  2L4M A;  3CD6 I;  5HOD A;  2GLO A;  3OYF A;  2HYG D;  2DXI A;  4XNF A;  2STT A;  2Y30 A;  2OBP A;  4A3B J;  4P9F A;  3K4K A;  5F04 A;  4B48 A;  2CUZ A;  3DP7 A;  3LA2 A;  3V7R A;  2V1N A;  1AU7 A;  2GOX B;  1BOB A;  5BNG A;  1T8I A;  2ESH A;  3BG7 A;  4G7H F;  3GF2 A;  1JGS A;  3RTR A;  2K85 A;  1H88 C;  3V7S A;  4BAC A;  3AAF A;  1VQ4 I;  3BZK A;  3VYR B;  1YX5 A;  1R1T A;  2CV1 A;  2ZB9 A;  3FKJ A;  5E3L A;  1LFU P;  4A3L J;  4CDG A;  2W7N A;  2O5R A;  2OAZ A;  5BS6 A;  5ICE A;  4YRV A;  2QQ9 A;  1S7A A;  3GTG J;  2LOO A;  4DYQ A;  3PO3 J;  2HFH A;  2BXY A;  5GAH J;  2VQL A;  2LY9 A;  2QQB A;  3R4K A;  2NVT J;  4BE2 A;  3SJM A;  2KRC A;  4L18 B;  2ZJQ F;  2VON A;  3C3W A;  1Y39 A;  1XDS A;  1ZRC A;  1R4N B;  4R8H A;  4L0Z B;  4B3X A;  2HQA A;  1ERD A;  2H8W A;  4HLX A;  1R1V A;  2DI3 A;  4XLA A;  4B3A A;  4A3E J;  2DA7 A;  3LSJ A;  2QEX I;  1H89 C;  1LE8 A;  4BXF A;  1W5C C;  5EG0 A;  3VSK A;  2M7B A;  3QOD A;  1JE8 A;  4D9J A;  1TC3 C;  3I9V 2;  1ZQ3 P;  5H6R A;  4BJ5 C;  1CF7 B;  2O8K A;  5HDN A;  2R7U A;  4ZDO A;  2DYR H;  1P7J A;  4DGW B;  3RKW A;  3ZQF A;  3I5U A;  1DDN A;  4J19 A;  4ZDP A;  3HGY A;  5K5O A;  2M7A A;  2NXN B;  2VAS A;  4BJT A;  3CDH A;  4V2G A;  1DGR M;  4DW6 A;  5CPR B;  2VKH A;  3PUB A;  2R5Z B;  2FBK A;  5D8L B;  1R36 A;  1Z67 A;  1OIS A;  2WAQ N;  4BHP A;  3KP6 A;  4N0B A;  3EYI A;  3CUQ C;  1MNM C;  2CMP A;  3IHU A;  4H4K C;  4AC0 A;  3I3L A;  3F8C A;  3K1P A;  1QQI A;  4AYB N;  2ZCW A;  4RGR A;  2VKV A;  4BAY A;  1TTY A;  2DA3 A;  2XVC A;  2IPQ X;  4A3G J;  5IY5 H;  4A3I J;  3N97 A;  4U87 A;  2PMZ A;  3W3C A;  2V9K A;  3GFJ A;  4RGS A;  4E7I A;  1B8I B;  2JQ7 A;  2KPM A;  1YG2 A;  3ZQL A;  4IXA A;  1NTC A;  3RDI A;  5KHD A;  3GCM A;  5DTD A;  2H94 A;  2DOD A;  4MHG A;  3O3K A;  5FLM J;  3E1S A;  3ZQQ A;  2RAE A;  2ECC A;  2P81 A;  3V4G A;  5JHF A;  3MVP A;  4CCO A;  5D5V B;  4E70 A;  4Z6Y A;  4ZH4 F;  5HS9 A;  1N77 A;  1W4M A;  5D4R A;  4EJU A;  1DP7 P;  1WVR A;  1Y8Q B;  3IH4 A;  2K7L A;  4L5I A;  1DU6 A;  2UXX A;  3D5R C;  1D0Y A;  5E1Z B;  2QKM B;  1T39 A;  2Q2E A;  1DPU A;  4DZJ A;  1U8B A;  2FOK A;  1XG1 A;  3HDD A;  4OMY A;  1U5T B;  1K7A A;  2LK2 A;  5DCF A;  3HSF A;  2YU3 A;  3BR3 A;  4XKC A;  4DBR A;  2E2H J;  4EM1 A;  2RNG A;  3BTC A;  4HQM A;  3I58 A;  4RS8 A;  1OCR H;  2M45 A;  1UHW A;  1P2F A;  2G7U A;  3Q0W A;  1XCV A;  3PSI A;  3Q9S A;  3MCZ A;  4FHT A;  3DKX A;  3PJR A;  5B1A H;  3CJT B;  3HC7 A;  2KZV A;  5K7Z A;  1UST A;  1C0W A;  2VJI A;  2RGV A;  3S2D J;  1BR1 A;  2R5Y B;  1ONV A;  4CO8 A;  5FGM A;  3ZMS A;  2E2J J;  2DBB A;  4BKX A;  2CQN A;  4ZYH A;  1MSE C;  1NK3 P;  3F8F A;  3I0T A;  1YS6 A;  4AID A;  2RVC A;  2X1E A;  1ZG3 A;  2W24 A;  2WAD A;  4ENN A;  3FDY A;  3KE2 A;  1L3L A;  3GO5 A;  2Z99 A;  1XGO A;  4OIN F;  1LPQ A;  4CGZ A;  1VQO I;  3RPU D;  3DPL C;  1VTN C;  1U3E M;  2X48 A;  2CS3 A;  2JVH A;  3W2A A;  2LKX A;  1S3J A;  2Z16 A;  2WAF A;  1GHC A;  4M6V A;  4BHC A;  4A2U A;  4A3C J;  3ZQ7 A;  3JRA A;  1B59 A;  5D6E A;  4A6D A;  2KIQ A;  2W1O A;  4HF1 A;  1F43 A;  3H1C A;  1ZGA A;  5JFR A;  1HF0 A;  2WWY A;  5KAF C;  3LL7 A;  2LRD A;  5CYV A;  4G7Z F;  2HI3 A;  1WSU A;  3F8B A;  1X19 A;  1XGN A;  4RDU A;  4G8X A;  3FHZ A;  1WH5 A;  3GFM A;  5FKO A;  4B43 A;  2ZJP F;  2R7Q A;  5BMZ A;  1R5I D;  2CW0 F;  2HPI A;  3M8E A;  4DOZ A;  4HAM A;  4P55 A;  3GTJ J;  1X2N A;  4G9Y A;  4MQV A;  2F4M B;  4C3H J;  1W5T A;  3BTJ A;  2P4W A;  4P5O A;  3J7A O;  5DD8 A;  3CME I;  3DBL B;  4ZZL A;  2BE5 F;  1XMX A;  4G94 A;  3QPS A;  4CHU A;  2OCC H;  2HOS A;  1P4X A;  3C2G A;  4S05 A;  2D1V A;  3HGG A;  1SVM A;  3VEP A;  5H2F C;  2KJB A;  2CUF A;  4UUT A;  4XR6 A;  2EBI A;  3CJQ B;  3I59 A;  3V8J A;  4MFE A;  3OYJ A;  1M1E B;  2Y48 A;  3VOD A;  1J75 A;  2PI0 A;  3IRQ A;  2XAF A;  2DU9 A;  2BW3 A;  3ZMU A;  2EZL A;  3KP5 A;  2NAZ A;  3RKY A;  5HNF A;  2ICW G;  3T1B A;  1E3P A;  3I53 A;  2A6H F;  4YFK F;  3EUK L;  3M1E A;  5J1U A;  2ME6 A;  4BHB A;  1KU9 A;  3AL0 B;  1EH7 A;  4CXF A;  5B3S H;  2XAU A;  1RIO H;  2E36 A;  1SAN A;  4PJJ A;  3K1N A;  5B5E C;  3HOU J;  4CCM A;  2UWM A;  3DLL F;  2R7F A;  4LG0 B;  2HXO A;  3ZQG A;  3BJO A;  2MGQ A;  4NBQ A;  3FK6 A;  4IRI A;  2XRO A;  2VBW A;  3QU6 A;  1HDD C;  1DQU A;  1LQ1 A;  2IS1 A;  1YW8 A;  4UVB A;  4A69 C;  4GDF A;  1T56 A;  3QRF F;  2PX9 A;  1SVO A;  5GAD J;  4BQO A;  4FE7 A;  3R61 A;  2LBF A;  1TT0 A;  2KKO A;  4M3B A;  4HNT A;  4I2O A;  2O8X A;  1J2X A;  5GAG J;  3DLA A;  3G73 A;  3ZN1 A;  1MMA A;  2XPW A;  1R5G A;  1T0F C;  5FLV A;  1I6X A;  3H0D A;  3I64 A;  1FBU A;  5F0C A;  1FZP B;  3S1R J;  4YEJ A;  1OCC H;  1TZL A;  4RAF A;  1NK2 P;  2M5W A;  1I39 A;  2VI6 A;  3QAH A;  4I0B A;  3CF2 A;  2NNY A;  2X85 A;  2VQC A;  2JA7 J;  2OCE A;  5FFZ A;  1G3W A;  4WX9 A;  2JMW A;  5FRM A;  4EJW A;  1ZRD A;  2NNN A;  4IF4 A;  4ETS A;  2XSD C;  3B73 A;  3D1N I;  3MZ8 A;  1IUY A;  1NG7 A;  2M34 A;  5ERI A;  1R5H A;  4IOC F;  1TNT A;  1EH8 A;  2BEO A;  3LST A;  2IRF G;  2NVQ J;  2LKS A;  2M9H A;  1HQC A;  2XKO A;  1XDU A;  1QO0 D;  2PMZ N;  4I7H A;  1YIO A;  2L9S A;  1BIA A;  3GUD A;  1IRF A;  1YE9 A;  1O7L A;  4M3D A;  1SAU A;  2OTL I;  2BGC A;  3FX3 A;  2F6C A;  3M07 A;  3PNV A;  2QKL B;  2CFX A;  3K4C A;  2CQX A;  2ZFW A;  5IP7 J;  1ZR2 A;  4QPO A;  1HXD A;  2KLO A;  5FLX K;  1FEX A;  3CMM A;  1HW5 A;  5E3O A;  1BW5 A;  1IN4 A;  2M4G A;  1MD0 A;  2VBX A;  1WJB A;  1UG2 A;  1BI3 A;  3IWZ A;  3CLQ A;  4FQG A;  5EYR A;  1BJA A;  2HNH A;  3M7G A;  4PJM A;  3BLY A;  1N78 A;  2O7O A;  4A3J J;  3GTO J;  1VI0 A;  2FBI A;  3CDI A;  2H8R A;  1RKT A;  3ZXS A;  1ORK A;  2EIJ H;  2E35 A;  3LAP A;  1D5Y A;  2LR8 A;  4F93 B;  4XLH A;  2IS4 A;  3WU2 C;  1VQP I;  3HHG A;  1FTT A;  4K2E A;  3O8H A;  1GUU A;  2QEN A;  3K4L A;  2Z1D A;  3WOD F;  3P9I A;  5E3M A;  3OIO A;  1IDZ A;  2EA2 A;  2M30 A;  3CUQ A;  3AG2 H;  2EH3 A;  2P8T A;  4JK1 X;  2V4J C;  2K4B A;  4KDP A;  1W7P D;  2RN7 A;  3OOU A;  4BDZ A;  1IUF A;  2Q2E B;  1U9N A;  4ZTJ A;  4B8X A;  4RB3 C;  3GME A;  1JUP A;  2R3S A;  4EJO A;  1XB4 A;  1VQM I;  2R7T A;  3BTI A;  1YYV A;  2KL4 A;  5C44 J;  3BPV A;  3E6B A;  3U1D A;  5H20 A;  3CES A;  1YIT I;  3ROU A;  1MBE A;  3SZP A;  2RNJ A;  2X1C A;  3O2P E;  4A6E A;  3FIS A;  4PGH A;  2E34 A;  4KMF A;  4N4N B;  3W6V A;  5JVG F;  2BY1 A;  3BG3 A;  4OMZ A;  5J3L A;  3OYG A;  3OYH A;  1W36 D;  2M0C A;  3DQV C;  1DUX C;  3LSH A;  4CCN A;  3CO7 C;  4E7K A;  5IT9 Z;  4L0Y B;  4C3J J;  2PN6 A;  3WU1 B;  1D1A A;  3FBN B;  2BBY A;  3ABK H;  1D0Z A;  4F7Z A;  6PAX A;  3RPU A;  2DQR A;  1JJ6 C;  1E3H A;  5E79 C;  4X1E A;  2E5Z A;  3SHF A;  2DA6 A;  2XC7 A;  3GYH X;  2HTS A;  3V7C A;  1BI2 A;  1YIJ I;  4BYY A;  1Y1W J;  4ESF A;  1I27 A;  2O0Y A;  3J7Z I;  1VF9 A;  2XUB A;  1N75 A;  2CWE A;  1FX7 A;  3BR5 A;  4HX4 A;  2ZJR F;  2UUZ A;  3CZ6 A;  4E7H A;  3FXJ A;  4OAY A;  1PP7 U;  4BQA A;  5ICF A;  2VC0 A;  3TW7 A;  2FMY A;  3C18 A;  1PUF A;  3HOV J;  3OV8 A;  2Y9Y A;  5F1R A;  4UUV A;  2FOW A;  2F5C A;  5FRO A;  1PVE A;  1ULY A;  2M4K A;  3KLN A;  1ZK8 A;  2FBH A;  2QQ8 A;  5EG0 B;  4WWC A;  3C2B A;  3G71 I;  2VJJ A;  5FJ8 J;  2VOP A;  4KIT B;  1SFX A;  3S16 J;  3BR2 A;  3WG9 A;  4UUS A;  1YI2 I;  4F52 A;  1R49 A;  1ITY A;  3HYI A;  2KZG A;  1ETV A;  5C3E J;  5JR3 A;  3FXU A;  2ETH A;  2E19 A;  3P5J A;  3HJE A;  3KYL A;  3VB2 A;  1KU7 A;  3ECH A;  3BWG A;  2A07 F;  3PNT A;  1USS A;  3RSN A;  2W25 A;  1YTY A;  1ZTR A;  2KIM A;  2L3D A;  3GZ5 A;  4IHW A;  1R23 A;  3JAM K;  4RLF A;  3OYM A;  1REP C;  4G7O F;  3G1O A;  1TQI A;  1Z77 A;  4RAG A;  1OYW A;  1BC7 C;  1JHF A;  2MFZ A;  1VQ9 I;  1IXR C;  1D1B A;  4JP0 A;  3L7W A;  2V1X A;  1YFH A;  3S14 J;  4ASN A;  3BP8 A;  2QZ8 A;  2RV8 A;  3ZQH A;  1X3Z B;  3PQJ A;  2DFI A;  1V3F A;  3P9K A;  4KN7 X;  3BZ6 A;  4XL9 A;  3OSG A;  2Q1Z B;  1VFC A;  4HF0 A;  3CCU I;  2V6C A;  1GLN A;  1TBX A;  2A05 A;  1LEA A;  1FY7 A;  1IRG A;  2XKP A;  4U88 A;  3COA C;  2QLZ A;  3HEF A;  4XRF A;  1XTA A;  4OIO F;  3J80 Z;  3H9G A;  3J80 K;  3Q5F A;  1QA6 A;  4IQJ A;  4BQN A;  5BQT A;  2XF7 A;  3KET A;  2K3F A;  1WPK A;  1IN5 A;  5IP9 J;  2LTP A;  2DMQ A;  5HLT A;  2DCE A;  2D5V A;  2PEX A;  3F8N A;  2LC2 A;  1Z1D A;  5D6F A;  1O3Q A;  3H0G J;  4II3 A;  4MEY F;  1WZ2 A;  5DYM A;  2OU2 A;  3IAM 2;  3JRG A;  3MKL A;  3ZMD A;  5EZH A;  1WH7 A;  2O9L A;  2Y0S A;  1W36 C;  3TKY A;  4IJA A;  4JQF A;  3A1Y A;  2ZXI A;  1Q1H A;  2VN2 A;  2P5K A;  3CP8 A;  4B44 A;  1JKP C;  1BI0 A;  1D3Y A;  1CQT A;  3VDX A;  2L9R A;  3OIP A;  4DNC A;  3T5X A;  1OPC A;  2ZNY A;  4NNJ A;  1VQL I;  4A3D J;  1Y6I A;  3TO6 A;  3RKX A;  4J00 A;  3WTV C;  5L3E A;  3M1C A;  3R0A A;  3PIP F;  3HL2 A;  2W4S A;  4BQQ A;  1IW7 F;  3BR6 A;  1FMW A;  1KON A;  4Z2Y A;  3IKT A;  1QPM A;  5ILU A;  1ZAR A;  4NB5 A;  2DMN A;  4L9N A;  2ZFU A;  5IYC J;  3LAJ A;  1RR8 C;  3PO2 J;  3TW6 A;  1FPQ A;  4A3M J;  1ON1 A;  4YEL A;  5ICC A;  3IC7 A;  5IT3 A;  3RKQ A;  1YJN I;  3KZI C;  1BL0 A;  3BC8 A;  3GZN B;  3MFK A;  4KJZ A;  3ABT A;  1Y56 A;  4AM3 A;  4KT5 C;  1QNT A;  2BXZ A;  3HRT A;  4KIG A;  1IV8 A;  3K0L A;  5L3B A;  4ITV A;  1MJA A;  3BTL A;  4B47 A;  2PFB A;  4M74 A;  5CQE A;  4AIJ A;  2XSJ C;  3RCO A;  4I99 C;  2IJL A;  1I3A A;  1TWG J;  2BVM A;  3I4N J;  1ENH A;  2DJN A;  3B02 A;  3K4M A;  5E1W A;  1JT6 A;  4EM2 A;  3HUG B;  1MMN A;  1ETX A;  1IXC A;  4AVZ A;  5LHI A;  1WFX A;  2V7F A;  3HIF A;  4MFD A;  4ZC3 A;  4II2 A;  2EV5 A;  1EJ9 A;  1WQ2 A;  2FEZ A;  4RA2 A;  4I02 A; 
#chains in the Genus database with same CATH homology
 3C2H A;  2X1D A;  1BR4 A;  2DT7 B;  2HZD A;  2IXS A;  3OL3 A;  4ZTF A;  4XOT A;  3IAS 2;  3DTK A;  5HNH A;  4AU7 A;  1VZ0 A;  3VWB A;  4XLF A;  3H5A A;  4CCJ A;  2X1E A;  2WAD A;  5CQG A;  3FDY A;  2LRE A;  3G2B A;  3RPU D;  3DPL C;  2V26 A;  2CS3 A;  4LIT A;  2JVH A;  4LIV A;  3W2A A;  3DPT A;  2Z16 A;  1WJE A;  2WAF A;  3OMY A;  2VQH A;  4F91 B;  3L2U A;  1WJD A;  1MMD A;  2R7V A;  2W1O A;  1YX3 A;  4XOP A;  4IQ4 A;  3E0J B;  3LL7 A;  4BDY A;  3A4C A;  2LRD A;  4IKF A;  2JSP A;  1U0J A;  2ELJ A;  1UEL B;  4BJ6 C;  1X19 A;  3DEE A;  4B43 A;  4R79 A;  2R7Q A;  2HPI A;  2WA0 A;  4DOZ A;  5TGT A;  3V42 A;  3K10 A;  2RRE A;  4FET A;  3DTE A;  2P0W A;  1V5E A;  2KMU A;  4P5O A;  3QYB A;  3OYK A;  3ZGK A;  3S3N A;  4JOM A;  4KIS A;  3U21 A;  3OWT A;  4GRI A;  4BE0 A;  3C2G A;  3VYS B;  4CH7 A;  2CW7 A;  2DOA A;  4BU2 A;  4E4H A;  2AQE A;  4XM3 A;  3BCA A;  4XR6 A;  3CJQ B;  2WAE A;  3OYJ A;  2AQF A;  4E7J A;  3LSI A;  2BW3 A;  3DTI A;  5HNF A;  2V6E A;  1ZEL A;  2WY7 Q;  3EUK L;  4CCL A;  2CV2 A;  4Y4R A;  3AL0 B;  2JUG A;  2XAU A;  3KX2 A;  3L2Q A;  5LD2 C;  4PJJ A;  3K4N A;  3CP2 A;  2W00 A;  4E6K G;  4F92 B;  4CCM A;  2UWM A;  4E7Z A;  2L9N A;  3HOS A;  3MD2 A;  1T95 A;  4HNU A;  5KCM A;  3OR1 C;  4BUP A;  1X4O A;  2PJR A;  2BVL A;  2L2O A;  1PYV A;  1DQU A;  2K3P A;  4CZC A;  2IS1 A;  2FUG 2;  2X6W A;  1QHG A;  3AKZ A;  2DJI A;  2XF6 A;  4BQO A;  2MYS A;  2JA2 A;  2XF5 A;  2LBF A;  1TT0 A;  4U7B A;  4HNT A;  3L2R A;  3SDB A;  1K6Y A;  2CFO A;  3ONQ A;  3EPZ A;  4XQF A;  1IRX A;  3DLA A;  1MMA A;  2ZSI B;  3HKZ A;  2K9L A;  3S93 A;  1T0F C;  4CSW A;  3H0D A;  4HSR A;  2W82 A;  2X6X A;  4YEJ A;  1Z7L A;  4XLC A;  1TZL A;  4EAT A;  3RQ4 A;  3CF2 A;  2VIX A;  2X85 A;  2VQC A;  1G8X A;  2IS6 A;  4NC7 A;  4XKV A;  5FRM A;  5FRN A;  4X0G A;  3EUA A;  1DP3 A;  4NQW B;  3AFH A;  2E1M B;  1NG7 A;  3D5L A;  3LSG A;  1OLT A;  2LH9 A;  4PSX A;  4RM3 A;  4BS9 A;  1UG0 A;  4P1W A;  2VL8 A;  1JI8 A;  3LMM A;  1LKX A;  3MMY B;  2WAQ A;  5HVQ C;  2Z2S B;  2KQR A;  3GBG A;  1BR2 A;  2MD0 A;  2KHM A;  3K70 D;  3OYL A;  3KEY A;  2R7O A;  2L9S A;  3TL4 X;  3UR3 C;  4PJL A;  3D5S C;  1YE9 A;  2BOL A;  1SAU A;  2X51 A;  4PFP A;  4C2U A;  3EUH C;  2HDW A;  3VYU B;  4XKW A;  4ZYA A;  1AA7 A;  3OS1 A;  4CUG A;  2F6C A;  2XDV A;  3LFU A;  2IGN A;  3PNV A;  4IX7 A;  2QKL B;  3K4C A;  4HEA 2;  4C2T A;  4HG2 A;  3SZG A;  3NWS A;  4QPO A;  3K4B A;  2KLO A;  2A6T A;  3CMM A;  3FBI B;  4PSW A;  2M4G A;  1WJB A;  4XON A;  4LG3 A;  2HNH A;  3OS2 A;  4XKB A;  4HRI A;  3DU5 A;  4PJM A;  3BLY A;  1N78 A;  2VXD A;  3OYA A;  4RM2 A;  3OY9 A;  4BGD A;  2IGO A;  3ZXS A;  1QHH D;  2MC4 A;  1X1C A;  2HU9 A;  3OIQ A;  3S3M A;  3OYI A;  4DBQ A;  4F93 B;  4XLH A;  2UV1 A;  2IS4 A;  4ZJZ A;  3K4L A;  2Z1D A;  3M8J A;  1HA8 A;  4KT6 A;  4G6T B;  3OYC A;  3DKY A;  2V4J C;  2R4G A;  4F55 A;  2HVR A;  2HVQ A;  3OOU A;  4BDZ A;  3FHN A;  2HVS A;  2Q2E B;  4ZTJ A;  2RQQ A;  1WJC A;  4NC8 A;  2OUM A;  1DGW Y;  4Y3O A;  1LVK A;  2R7T A;  4BEH A;  2KL4 A;  3IP4 B;  2DT6 A;  3CES A;  4D1Q A;  4HST A;  3OR2 C;  3ZRG A;  1V5G A;  2CW8 A;  4QPQ A;  3J7A Y;  2X1C A;  4FAS D;  2WB1 A;  3IUO A;  3S32 A;  1X1D A;  2IS2 A;  3MKZ A;  4N4N B;  2IGM A;  3OYG A;  3OYH A;  1W36 D;  3DQV C;  4XN3 A;  3LSH A;  3H9J A;  2HPM A;  4CCN A;  1LFP A;  4E7K A;  1X1B A;  2R7W A;  2L7K A;  1G59 A;  1D1A A;  3FBN B;  3OYE A;  4J01 A;  1D0Z A;  2VKD A;  2LYC A;  2E5Z A;  2GOM A;  2XC7 A;  4N4O B;  1Z3X A;  3OYD A;  4E7L A;  3A2K A;  3S8P A;  1QU3 A;  4NUB A;  1N75 A;  4XLE A;  2OV7 A;  2LBF B;  4RMN A;  2UUZ A;  3CZ6 A;  4E7H A;  1E0E A;  4OAY A;  2LG4 A;  3PNY A;  1S9H A;  5CKT A;  3HG9 A;  1X4P A;  2VXZ A;  4PFO A;  2IGK A;  4AYB A;  2CV0 A;  2F5V A;  3PSF A;  1J09 A;  1OR7 C;  5FRO A;  2M4K A;  4DJA A;  1WJ5 A;  2M0M A;  3W2V A;  2NOJ B;  3K6G A;  3SEZ A;  5LFA A;  3DU6 A;  2VJJ A;  3OL4 A;  3PFY A;  4KIT B;  3OYF A;  2DXI A;  3OS0 A;  3L2V A;  1SFK A;  3H9Q A;  1V5F A;  4XNF A;  3ZR8 X;  4IZZ A;  4F52 A;  3TBI A;  2OC6 A;  3K4K A;  4CA0 A;  3TMO A;  4PUS A;  2MAB A;  4B48 A;  2CUZ A;  1MMG A;  1X1A A;  2V1N A;  1D0X A;  2GOX B;  1BOB A;  4BL0 B;  3SEQ A;  3BG7 A;  2CUJ A;  3KYL A;  2A5W A;  3PNT A;  1MND A;  3RTR A;  3RSN A;  4BAC A;  3W2W A;  4E7S A;  4RLF A;  3VYR B;  1YX5 A;  3OYM A;  2VJ4 A;  3FKJ A;  2CV1 A;  4OWR B;  3UNG C;  3QYF A;  2W7N A;  2WY8 Q;  2O5R A;  2MFZ A;  4YRV A;  1D1B A;  2LOO A;  3H5N A;  3HPH A;  2VQL A;  4BE2 A;  1WJA A;  2KRC A;  4PK4 A;  2ZXH A;  1MNE A;  2BW3 B;  3N05 A;  3K70 C;  4XL9 A;  2HQA A;  2Q1Z B;  4B3X A;  1ERD A;  4LIU A;  4XLA A;  1GLN A;  2I8D A;  2KP6 A;  3SYT A;  4BXF A;  4HPQ A;  1R6R A;  2E60 A;  2VQG A;  3VSK A;  2M7B A;  2WBM A;  3H9G A;  3QOD A;  3QOE A;  4IQJ A;  4BEH B;  4D9J A;  2VPL A;  4BQN A;  1FMV A;  3DPU A;  3I9V 2;  3OYN A;  4BJ5 C;  2R7U A;  4ANJ A;  4XN0 A;  4ZDO A;  2XF7 A;  3ZCO A;  4DGW B;  2KRH A;  1LDK B;  1PJR A;  3PL8 A;  1UAA A;  4ZDP A;  2LY1 A;  1Z3Y A;  2M7A A;  5HLT A;  2DCE A;  2VAS A;  4BJT A;  1DGR M;  5CPR B;  2VKH A;  3PUB A;  2VLA A;  4OAZ A;  1EA3 A;  2LC2 A;  2ZSH B;  5HOO A;  4ZDL A;  4II3 A;  2CMP A;  3VYT B;  4C30 A;  4H4K C;  3I3L A;  3IAM 2;  4F3Q A;  2R7S A;  2L5Q A;  3AL0 C;  2M3A A;  4CCK A;  4Y33 A;  3BCB A;  3LSM A;  3H35 A;  2Y0S A;  1W36 C;  3QYE A;  4JQF A;  4B44 A;  3A1Y A;  2ZXI A;  3CP8 A;  4RLQ A;  4C9Y A;  3CJR B;  3S3O A;  4BE1 A;  3VDX A;  3HPG A;  2VJ5 A;  4U87 A;  3OIP A;  2PMZ A;  3W3C A;  3VSL A;  2V9K A;  4NNJ A;  4E7I A;  2K5C A;  1Y6I A;  2F4I A;  2KPM A;  5KNL A;  3HOT A;  4J00 A;  1P9Q C;  5KHD A;  3M1C A;  4XOR A;  3HL2 A;  2PJR B;  2W4S A;  4BQQ A;  3HXL A;  1FMW A;  1KON A;  3E1S A;  4XMY A;  2E1M C;  3ZQQ A;  3OYB A;  3F9K A;  5JHF A;  4CCO A;  4PJN A;  4MLO A;  1N77 A;  2ZFU A;  2X6Y A;  4YEL A;  3D5R C;  1D0Y A;  2VB6 A;  1Z21 A;  2QKM B;  2R7X A;  3BC8 A;  4KJZ A;  1Y56 A;  2KDO A;  3MKW B;  3H5R A;  3LSK A;  2LY2 A;  4ITV A;  2K9M A;  4B47 A;  1WJF A;  5CQE A;  4XKC A;  4DBR A;  2XSJ C;  3RCO A;  2RNG A;  3MKY B;  2BVM A;  3DWL E;  2CH0 A;  3BG6 A;  3K4M A;  2E5N A;  3PSI A;  1NG6 A;  3HUG B;  1D1C A;  1MMN A;  2JVG A;  3DKX A;  3NWT A;  3PJR A;  3K4J A;  4AVZ A;  1WFX A;  2V7F A;  3HC7 A;  4ZC3 A;  2KZV A;  3L2W A;  2R7R A;  4II2 A;  2VJI A;  1MW7 A;  4DIQ A;  1BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...