3OR2C

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKVTGFKLKQIYELFPSGPGKGACKMAGLPKPTGCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite redcutase subunit alpha
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or2C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or2C01
1JI8A 2V4JC 1SAUA 2A5WA 2XSJC 3OR1C 3OR2C 1YX3A
chains in the Genus database with same CATH superfamily
4BYYA 5B1AH 1BW6A 1SFKA 2NNNA 2HVRA 2W1OA 5JLWA 2GXBA 2H1KA 2IVMA 1X1DA 5E3MA 4FE4A 3WG9A 5TGTA 3I5UA 3OIOA 4CCKA 4PSXA 5IT9Z 3SDGA 4D0PA 1MNEA 3LQRA 2Y30A 5FD5A 4XRSA 2L2OA 3KYLA 4XLFA 5DUIA 2CUJA 4MLOA 4YEJA 2OV7A 2VKVA 5KAFC 1QHHD 5DS9A 3I59B 1QPIA 3MAJA 4B3XA 1QO0D 1RPWA 3QP6A 4PJ0C 4XRFA 3J7YJ 2GXGA 1ON2A 2CG4A 3HJEA 3OYBA 4D5CA 5IYDJ 3ZQ7A 5H2FC 3R0JA 4Y13A 3HB9A 4HQEA 3KZIC 4PDKA 5E3NA 1QVTA 1T08B 3KIOA 2O8XA 1U78A 5D4RA 2RGVA 4AVZA 1KQ0A 3M1CA 1IRFA 1KYZA 1KU7A 3V8LA 3W6VA 2DA1A 2GOMA 4X0GA 5E3LA 4HDUA 2ECCA 1ETWA 3K10A 3KP7A 5FD6A 1OYIA 2GXAA 4L18B 3F8BA 4XM3A 1IXRC 1ZG5A 3BJ6A 3LSMA 4EVIA 1MMDA 1B6AA 4KUMA 3SZPA 3DPUA 4BXFA 2JVHA 5BPIA 4OMZA 1P7IA 2O7OA 4HBLA 2W25A 3IRRA 3IHUA 3CMYA 3AG2H 1DPRA 2QCOA 3ERED 1H8AC 3VSKA 4X6AJ 3CLOA 1H0MA 2YR2A 5LHGA 1GDTA 1A35A 1HSJA 2E34A 2L7ZA 2DK5A 1J09A 4IHVA 2WA0A 2DT6A 1MMGA 2EV6A 4OAZA 3H5RA 3EYIA 3TQNA 2X6WA 4JX4A 1MMSA 3FF5A 4BS9A 1BA5A 4A0XA 1SD6A 3HG9A 4BQAA 3DTKA 2DTRA 2QSFX 3W6JB 4IQJA 5E1XA 2E1NA 4HF0A 2FF4A 2NS7A 2C6YA 3HOYJ 3PM1A 4DZPA 3CJQB 1OPCA 4FASD 4I99C 4HQMA 2Y0SN 2YU3A 1T38A 3LAPA 5FKKA 3I4MJ 2KLOA 3WTYC 2A69F 3LSIA 3LNQA 1RUNA 1VQKI 2QZ8A 2Z2SB 3WTXC 2XAGA 4V2FA 2CQKA 2DK8A 3AG3H 3Q3SA 3RDIA 4A3IJ 1SC7A 1USSA 2HYFA 1YYVA 2P7VB 4U88A 2XSDC 3K0LA 2O61A 1QA6A 2DFFA 1T39A 2E71A 2W48A 5C3EJ 3FKJA 2JK3A 3GFJA 1WSUA 1JT6A 3VOEA 3EUKL 2HR3A 3HIFA 1VQ5I 4OIQF 1BI2A 2FOKA 2K27A 4YELA 4HG2A 3H9QA 2DMQA 2IXSA 2HEOA 2ID3A 2ZMEB 1JTXA 2L02A 3BR0A 3OYAA 4UVCA 2K4JA 5LEJA 3KLOA 5M3MJ 2R7DA 1U3EM 1YW8A 3E6BA 2VKDA 2JA7J 1MD0A 2XV4S 5JR3A 2IA0A 2P81A 2XVCA 3Q0VA 4LG3A 1FYMA 1FOXA 1S5LC 1Z0XA 4LLNA 5H20A 2CQXA 1T98A 2IJLA 4G7HF 3TP3A 3BG5A 2QA4I 1EH6A 1N75A 1R36A 2EFOA 1MSFC 1F36A 2X6YA 3K1MA 1QBJA 1FSEA 3E5UA 2QSHX 4YFNF 3CP8A 3CCEI 1R1TA 3PSFA 3OIQA 4KN4X 2GA1A 2WV0A 2QF7A 3OL4A 4I2OA 1T6SA 5L3BA 1TQPA 3LSPA 1W1WE 1YO5C 4ZC3A 3KP4A 1WI9A 2IA2A 5DCMB 3JRGA 4UUVA 3GYHX 1E3PA 2NS0A 3W2WA 2FXAA 3QWLA 4MEYF 2EA2A 2FNAA 3OYGA 1STZA 4RDUA 2E2JJ 1JTYA 2H94A 4XRSG 4M3EA 4W1UA 3CC4I 3MZYA 1MJAA 3SFIA 2P5LC 1ZLJA 1UJ8A 2HZDA 3VODA 1T2KA 2A61A 1A5JA 3DLLF 4CO8A 1ETYA 2JJ7A 1OCTC 2HDWA 2HTSA 3PO2J 4BACA 1TWFJ 3HC7A 4G8XA 3PQJA 5L3GA 2E35A 4LFUA 4XNFA 5HLGA 4AIDA 4KA4A 1DGWY 1DDNA 2FRHA 4F55A 3CC2I 3K4MA 3L2RA 4V2GA 2L9SA 3A01B 4IHXA 4IRGA 1A6IA 1YLFA 2M45A 4KIGA 5IYCJ 1Y0UA 4S05A 2NVTJ 2LBFA 4G7ZF 2HDDA 3N05A 4RGXA 3TEDA 4CSWA 3W2VA 1R71A 4PJJA 1T33A 4OOIA 3HOUJ 4GYGA 4E7SA 2B0LA 3ZP5A 2FNPA 3KX2A 5F0FA 1E17A 5ICGA 2F4MB 3GBGA 1UELB 3BR3A 3O2PE 2HDCA 3TO9A 2JA8J 3HRMA 2DCEA 2FMYA 2R93J 2OF7A 1YS6A 4DGWB 4BNCA 3JR9A 3DEEA 5CQGA 4BEHA 3RPUA 4C2UA 4AM3A 3FZVA 2Z3YA 4I0AA 1OCRH 2DMTA 2QENA 1O3RA 4IF4A 4RGUA 5ILVA 1HXDA 2J5PA 3LSHA 3MEXA 4WXHA 1BR2A 3X2QH 4LGWA 4M9SA 2EA4A 5F04A 4HLXA 3LQQA 2Y75A 3A02A 2R3SA 2VKHA 2PG4A 2F5DA 4F92B 2L4AA 5C44J 2IPQX 5D5WB 4M6YA 1FIAA 3BLYA 1JI8A 2R5ZB 4L9VA 4XOTA 3F8CA 1KZHA 3F8FA 1OYWA 4CA0A 4N4OB 5BNGA 3FM3A 4CCJA 2FQ4A 2LREA 3M8EA 1XSVA 2OBPA 4L5JA 4ZDOA 4XLNF 2QBYB 1GVJA 3CZ6A 2OQRA 3K69A 1RKTA 4A0ZA 4BHPA 3K4CA 4JP0A 1ULYA 2VE9A 2LH9A 1V5FA 3RI4A 1OQYA 2DA7A 1LEBA 3ABTA 4AVPA 3P9IA 4F91B 4B3AA 2CGPA 4GFBA 3FMSA 1BBYA 3EUHC 1JUPA 2ZSHB 2V4JC 3FKIJ 2VXDA 4M9ZA 3M7GA 4AIHA 3PUBA 4RB3C 5F64A 3V7RA 3ZQCA 1TP4A 3VYUB 4P5OA 3BC8A 4BDZA 2IGNA 3ZN0A 2PI0A 1VF9A 1Z05A 1TZLA 5LHIA 3OYDA 1Z77A 3TGNA 1B72A 2YX7A 2OZUA 2LOOA 4LB6B 1IC8A 1TNSA 4Y7NJ 1AHDP 5HODA 2NXNB 2F48A 1LE8A 1TW3A 5CVUA 1YIJI 3S3MA 1Y0NA 3J81K 2XKPA 2GZWA 1XCBA 3F0CA 3DPLC 3LWFA 5KHDA 1Q1VA 5TISC 1QPMA 5GADJ 3T1BA 4LLLA 3BPVA 2XB0X 2M2EA 3ZN1A 1SFOJ 1UG2A 2DAOA 2QKMB 1S29A 2DQRA 3PNTA 2X51A 4JOMA 3MKWB 3LSJA 2ZXHA 2R5YB 5FFXA 2AHQA 3IAM2 2CS3A 5BPDA 1QU3A 4A5NA 4XLPF 4RGRA 1WI3A 4R8HA 2EQRA 4M6XA 4EGZA 2JA6J 1XGOA 4O5VA 2XDVA 3I71A 2MLGA 3RZDJ 1YX3A 3GEZA 3LSRA 3D0SA 3CCYA 2KRFA 3FBIB 3J7AO 1G3YA 4BE1A 4XLCA 2DFHA 4XBFA 1YRNB 5M5WJ 4PK4A 1LB2A 2K86A 1MBHA 3R6SA 2M3AA 3H0GJ 3HOTA 2AO9A 3RYRA 5ILUA 2A6HF 2WY7Q 4L9JA 1KU9A 2AQEA 2HOEA 2JRMA 2X9DA 3HSRA 2P5KA 3OL3A 2ZJRF 3OYKA 2DN0A 4DW6A 1HA8A 3RJPA 2Z5UA 4ENMA 2M87A 4Z2YA 1LFBA 2JWTA 3WGIA 2M5WA 1HKSA 5D8KB 4L5EA 2K9LA 1QZYA 3DKXA 4AWXB 1X4OA 4E70A 4CDGA 2V7FA 4XMYA 2XC7A 1OCPA 1MJ9A 4QPOA 1W4MA 3BPXA 3HGGA 4XLEA 3GF2A 5HOOA 2V1UA 1SD5A 1BM9A 3H35A 2H27A 2L5QA 2QQ9A 1HOMA 1E0EA 4NQWA 3GTGJ 1OLTA 2RNGA 4M3FA 2P5VA 5E8IA 2L54A 1KU2A 3AKZA 5KNLA 1XTAA 1TQIA 1SFXA 1IF1A 1AKHB 1AOYA 1Y6IA 2DA2A 4I09A 1KQ9A 1X2MA 3E97A 3FWEA 3ZMVA 3SYTA 5ICEA 2ME0A 2PBIA 2NVYJ 4Q4ZF 1PP8F 1I3AA 2DTZA 3KEYA 2WAQN 2RDPA 3A4CA 1MBFA 2QVOA 2IP2A 3ZMTA 2H1LA 2OD5A 3HPGA 2M8EA 2X1DA 3DTIA 3P9KA 2BVMA 4ITVA 4E4HA 3H5NA 2HZTA 5ILSA 2PMZN 5JVGF 2KPMA 2B7EA 2NS8A 1ON1A 4XICA 3CCRI 4AYBA 1OFCX 1WJEA 4FX4A 3CDLA 5FLXK 1TC3C 3I54A 1IJWC 5J47A 4BXUA 1N78A 2VN2A 4RB2C 2V9KA 3UNGC 1Z9CA 2YSRA 4AIJA 1K78B 2F2EA 1VQLI 4RAYA 2HKXA 3I59A 1XMXA 2BY2A 4L5IA 1MH4A 4EM1A 3IKVA 3T0YA 3HOXJ 3BOQA 3F72A 3JRHA 1LNWA 4QPQA 1IN7A 5H6QA 1POGA 1WGXA 1TT5B 3ZGKA 1VQ9I 1N25A 1Y1VJ 1ZK8A 4XKWA 4PJMA 1PDNC 2DOAA 3KZYA 4HV6A 3CMEI 3KCCA 1I6XA 5EEGA 1RESA 1V55H 5F0HA 1PUFB 4XONA 1O3TA 3JTHA 4LJZF 3UKGA 4CCLA 2O5RA 3T8RA 4M3BA 2F6CA 4KMFA 1X3WB 3IH2A 3GCMA 2MFZA 3U2RA 2E7WA 4CCNA 4I6ZA 4ENKA 3BTCA 3BR6A 1V4RA 5TRDA 1XS9A 2R7QA 1AWCA 3SZGA 4BJ6C 3GTLJ 5CPRB 3NWSA 1NK3P 3CCLI 4OIPF 4Y33A 4B1RA 3GZ6A 4L9NA 1XSXA 1U8RA 3ZQGA 4BQOA 1R22A 3VFZA 1WPKA 3LMMA 1YJ9I 4CUGA 2HTJA 2EH3A 3LA3A 4BY7J 4BJ5C 4KJZA 2G7HA 5J3LA 4P96A 4N9HA 2VT2A 1V5EA 2XROA 1ZHFA 2DT5A 3K6GA 1W0TA 2E5ZA 1XDUA 4MQVA 1TQMA 2DT7B 3HRTA 1LPQA 4G6QA 4PUSA 5E8GA 2ID6A 4U87A 5HVQC 1GV5A 1T56A 5FRMA 2DJIA 4H0EA 2COMA 3MN2A 3BZKA 1ZTRA 1MW7A 1D1BA 1AU7A 1K6YA 2JN6A 5DD4A 2GLOA 2NRAC 4A3MJ 5GP9A 4BJTA 2LK2A 3HUGB 3LFKA 1GHCA 4GRIA 2DYSH 5ERIA 2M9HA 4RA2A 1KQ8A 4UV8A 1TT0A 3TW7A 5IPAA 2A6EF 3IH4A 2LY9A 1MDMB 3RQIA 1KYWA 1OISA 1JUSA 2DJNA 2VBXA 3WE3A 4BUPA 2DDAA 2ZMEA 4G6TB 1B1BA 2G7UA 3GUDA 2PX9A 3GXOA 3DU5A 2P6SA 3L7WA 3BG9A 2LFBA 2TCTA 2DMNA 4LMYA 5FKLA 3L2VA 4ZZDA 2Q2EB 2JA2A 1ETXA 3G1LA 4JX6A 2AXTC 1IZ1A 3E5QA 4G6DA 1VQ4I 4AUXA 1W0UA 5FB2A 2ZKZA 4PZJA 2YX4A 4XKVA 3BY6A 3RKYA 2O6GE 2M7BA 2QQAA 1IN5A 3KP2A 5HS7A 4EJUA 3K4JA 5HDKA 5GPCA 5LRRA 1P6RA 3O6BB 4CH7A 1HLVA 2ZSIB 2CUEA 4PGGA 2VJJA 2JT1A 2PJPA 3H3ZA 2ZCWA 2OTLI 1APLC 4ESJA 2FBKA 2L3DA 2VQHA 4CXFA 1D0XA 1K4TA 2WV1A 2HQRA 5JVTA 3DEUA 3JTGA 2VUMJ 5DDGA 2X85A 5E3OA 2FE3A 3JREA 4B47A 4I0BA 1J75A 4XRMA 4BQQA 1EA3A 4E7ZA 1K79A 3AL0C 1VQ6I 2XGEA 1MMNA 2XKOA 2DXIA 4J19A 2V6CA 4OMYA 1NG6A 1VZ0A 3MVPA 3WE2A 1QVUA 1EH8A 1R5HA 3K2AA 4XIDA 1IRGA 2VL8A 2OQGA 1HDPA 2PMHA 1Y39A 4UVBA 4K2EA 2MC4A 1QGPA 3SQNA 5LGNA 1D3YA 2R7SA 2BYVE 3HBLA 2HKOA 3BWGA 2ICWG 2ZNYA 3WG7H 1NG7A 2QQ8A 3DQVC 3ZQHA 3AL0B 2KRCA 2N8GA 4A3LJ 2CH0A 4A93J 1JGGA 2E19A 2A5WA 3V4GA 2HXIA 1R49A 5K7FA 1F4KA 2ADUA 4AC0A 3E6MA 2IS4A 4E7HA 2OZ6A 3HKZA 5EJCA 1P4XA 5FO5A 4ZYEA 5J4YA 2KJBA 5CVRA 5F27A 5HS8A 2AQFA 2ZC2A 3ZQIA 3HOSA 1JJ8C 1Y56A 2KP6A 5DYMA 3V42A 2RN7A 1LVAA 1P7JA 1SVLA 5JFRA 3G4SI 2K4BA 1J9IA 2R7XA 4XORA 1Y8RB 2VBWA 4UUSB 5LBQA 1GVDA 1Z7LA 2EZLA 4MFEA 1YS7A 2W24A 2BHYA 5IOYA 4A0YA 3AFHA 1JE8A 1E3OC 2BOLA 2OAZA 3J81Z 4M74A 3GO5A 2EZHA 2LG4A 1S6LA 3G73A 1SANA 3ZOBA 1FJLA 1H9GA 3S2HJ 1OKRA 4EEFG 1MZBA 3PL8A 1GUUA 2QGUA 2XGDA 4B48A 3L2QA 5KCMA 3FK7A 2R92J 1I6HJ 4P1WA 1TLHB 5D6FA 3I56I 3JRDA 4Y3OA 5M5XJ 1G4DA 2E1MC 3CP2A 3IRQA 4Y52J 1MNMC 2PJRB 3JAMZ 2ACJA 3ML6A 1J5YA 2R5ZA 3OR1C 3K2ZA 3FXQA 3PFYA 4IOCF 2ZJ2A 4G12A 1TTYA 2GM4A 4Y17A 2WB1N 3QPHA 2IGOA 1HW1A 3HHHA 4LIUA 3CO7C 2KL4A 1VQPI 3CMAI 2UXNA 3MZHA 2BY3A 4HF2A 2LKSA 2E1MB 3R60A 2OU2A 3QP5A 3WU0A 1F1ZA 4R1HA 5K1YA 2X1CA 4C2TA 4S04A 2LVSA 2QYOA 2ESNA 5A2QK 4EM2A 2K02A 3CDIA 1SVMA 1U8BA 2LD5A 4XOPA 4CCMA 1DPUA 1BIAA 5CVVA 1BR4A 3SEZA 3GTPJ 2WWYA 2NNYA 4LD5A 3ZMZA 2LKPA 3NEUA 3OSGA 2HS5A 3MMYB 2EFWA 3Q9SA 3DF8A 3BTLA 3VYSB 2EPFA 4ZZLA 2ZB9A 4GCVA 3GX4X 1ZGAA 5B5EC 1LQ1A 2YU9J 3Q0WA 3I9V2 4YFKF 2MBFA 2EBIA 2W00A 4PJLA 5H6RA 4OIRF 4V19K 1FP2A 1F43A 5L3DA 2DOEA 1ZELA 4WX9A 3KFWX 2GOXB 3AG4H 5M3FJ 2IBDA 1EV7A 2BW3B 4U7BA 1MMAA 1GT0C 3B73A 3E1SA 3RKWA 1DQUA 2FQ3A 4MIMA 2HQNA 2LR8A 1B9NA 2KISA 2MGQA 4FISA 2NYXA 3RQ4A 1ZGWA 1S7EA 1W5TA 1J0RA 1VQNI 3C1DA 1M1EB 1ZRDA 3BR5A 3ERMA 2R7OA 1O3SA 4D5FA 5EGOA 2H6BA 2CW8A 3MZ8A 5IOZA 2KDOA 1WWXA 4MFDA 2R5YA 2NVXJ 4YFXF 3HYIA 2M8GX 1OR7C 4M71A 1X4PA 3F8MA 3BR1A 1R58A 4BHBA 3LSKA 5IP9J 5HDNA 2F4OB 2K3PA 2QKLB 3OSFA 2DA3A 1GXQA 3S8PA 1REPC 4HF1A 3T5XA 3F6OA 4JK1X 4ZDPA 2CFXA 3HZJA 3I58A 1A36A 2DO7A 2D1VA 3DFGA 5FLXZ 3LA7A 2G9WA 5IP7J 2NAZA 2JZYA 3CCUI 1DUXC 3FXOA 2RQPA 3M07A 4GO1A 1XC5A 2KZVA 1WJBA 3ISPA 3O8HA 5C4XJ 5FJ8J 3Q5FA 3QPLA 1MGTA 4XK4A 3COAC 2Y9ZA 2WBMA 2XF5A 1U5TC 4R79A 1FOWA 3KLNA 2PFBA 2XAUA 4BQNA 3GFLA 1FYKA 4II2A 1IO2A 2AS5F 2JPBA 3GFIA 5J40A 1RRJA 4CICA 3PSIA 1OCZH 3CJNA 5FLVA 1JUMA 2ELHA 3QQAA 3R61A 3TBIA 2B63J 3M1EA 3WU2C 3DBHB 3I64A 4NC7A 3TP0A 2XB5A 2HOTA 1U5TB 5J1RA 5F1JA 3BCAA 2STWA 2QUFA 4UY8I 1ENHA 3GTMJ 3HEFA 2KIMA 4II3A 2BGCA 4AD9A 1JKPC 3WTSC 3CESA 1R9TJ 1GV2A 3OIPA 2CMPA 1O57A 3ABMH 1IDZA 3E7LA 3K7AJ 3L09A 1AKHA 4EJTA 3E3VA 3V7CA 2GBYA 2WTEA 1FLIA 3ONQA 1D0YA 2HQAA 4PGHA 1FTTA 1G2HA 3JRCA 3F6VA 1HW2A 3DBLB 2R7TA 2BXYA 3ELKA 1VTNC 1P4AA 3P9CA 2P7CB 2LF8A 4M72A 3DTEA 3CCVI 2EZKA 2NOJB 2JMWA 5K5RA 2VJIA 2BEOA 4I76A 4DBQA 3FIWA 5DCFA 1W36D 4Q48A 4FETA 4EJOA 3JSPA 1MNDA 4U0WA 4ZYDA 3O3KA 1Z91A 1G8XA 3MD2A 3QOPA 1XGSA 2VQCA 2CYYA 1TBXA 2MD5A 1VQOI 3VYTB 3GTOJ 1ZREA 5LEKA 4C2MJ 5CQEA 1IXSB 2JUGA 3DBRB 3WODF 4O3MA 2VODA 1K78A 1OCOH 1RKWA 2CWEA 2ISZA 5FGMA 3ZMSA 2WAFA 5L3EA 4FCYA 1N77A 2OUMA 1TWHJ 3WU1B 1OYYA 3BDDA 3L9FA 4YG2F 3OYCA 1RI7A 3NWTA 1LDKB 3O8GA 1MBEA 5J8FA 1JKRC 2Z1DA 4XR6A 1I1GA 4HOBA 3ABKH 2XIGA 1DGRM 4M6VA 2A3SA 3N4MA 2HPMA 1WH7A 4IXAA 5FRNA 2JA5J 2E1OA 1FX7A 2RREA 1IDYA 2RV8A 4LK0F 1EF4A 3SEQA 4HRIA 1ACIA 1FZPB 1UZCA 3GWZA 3ESWB 3QYEA 1I1SA 4HV5A 1D5VA 3OV8A 4MNUA 1W7PD 3IL2A 1JT0A 1ZG3A 2M34A 3OY9A 2CV2A 2HNHA 4F7ZA 2CQQA 1GLNA 2A05A 4HZFA 3CUOA 5CVIA 4HNVA 1X58A 2BVLA 1O7FA 2MA3A 3K4LA 4RLQA 3GTQJ 2DI3A 2W84A 4X1EA 2Y2ZA 2EV0A 3OS2A 1D8KA 1WJ5A 4ZJZA 4DIQA 4BDYA 4LK1F 4HLYA 5HNHA 3SFZA 1RIOH 3JAMK 2Y48A 4HX4A 3GLXA 2Y0SA 3BT9A 1BR1A 3FXLA 2LDUA 2XGCA 3D5RC 2NVQJ 1R4MB 1UHSA 3OS1A 4KYWA 1J2XA 4U0VA 1T8IA 2BBYA 3K9TA 4I98B 1HKTA 4UVAA 1CQTA 4E7JA 2EFPA 2VQLA 5GPAA 3L2CA 3JW4A 4QIWN 1WH5A 2FEZA 3QPTA 2DLLA 1U6GA 1JKQC 4BGDA 5DEQA 3KYCB 3E6CC 1X1BA 1X2NA 1S3JA 4NNJA 5EZHA 5EF6A 2Z9OA 1LUJB 2GWRA 4CZCA 2ZFWA 5B1BH 3HUGA 4A69C 4WCGA 3BG6A 5D4SA 4HX8A 3S1MJ 1XSDA 3MKLA 4KITB 4YIRX 2ZFUA 5E1WA 2W7NA 3DLAA 3IAS2 4KN7X 2EB7A 5E20A 1MDMA 2LSOA 1YX5A 2VIXA 3RCOA 3QU6A 3ZCOA 5EG0A 3ZMUA 4A6EA 3JSOA 2K5CA 4CYDA 1ZRCA 2CRGA 1ETOA 3LFUA 1D1CA 4AIKA 4ESBA 2V1NA 1IXCA 2TRTA 1ZARA 2Q2EA 3G1OA 2DFIA 3G71I 5ICFA 4EATA 2JQ7A 5JHFA 2R7RA 4UV9A 3C2HA 5EZGA 5AIPA 4N0BA 3FXRA 1TW2A 5D8LB 3IWFA 1C0WA 3OYEA 3PJRA 1S7AA 1JKOC 2DA4A 5DM7F 4EGYA 1VNDA 1VFCA 1LEAA 1V3FA 3M3YJ 3HSEA 3D5SC 3J80Z 4MHGA 2CW0F 1YW9A 2L7FP 4MGRA 3GMEA 2P0WA 2F5EA 3H3VK 5K7HA 3KE2A 3HTUA 1CF7B 4FT8A 3KETA 3TOBA 1PJRA 4FTHA 3IKTA 3U9GA 4ZH4F 1U9NA 2FBIA 2FUG2 3HRSA 1FNNA 1UFMA 2YUSA 3EDPA 4A6DA 3DP7A 4UB6C 4WXCA 4N4NB 3K70C 2XAQA 2X6OA 1HC8A 4P9FA 3JRIA 2K3FA 1XGMA 1NTCA 1WJCA 3H9GA 2RQQA 4XKBA 5C4JJ 1XX5A 2L9NA 5BOXA 1NH3A 1YE9A 4AU7A 3GTJJ 4XLAA 2CQ7A 4ZTJA 3J7ZI 3L00A 4HW0A 4RM2A 3ABLH 4EV0A 2HWVA 5A2QZ 3PIOF 1TWGJ 1JHFA 1IG7A 1FBSA 3R4KA 3S17J 1G3WA 4PFPA 3OOUA 3ROUA 2HVQA 4M3GA 1HW5A 3SHFA 2HGCA 3U1KA 2LY1A 4KFCA 4YIFA 1Z6TA 4RB0A 2XSJC 2VQGA 3CF5F 4WWCA 4IX7A 1RR8C 3CCJI 2JUCA 3F23A 3BP8A 2LC2A 4BU2A 1V54H 1YFHA 2PLYA 2GIVA 2DODA 1QHGA 3I0TA 3TDUC 4DYCA 1R23A 3JRFA 3S14J 4RMNA 1MSEC 1X1AA 4B09A 2V6EA 2K85A 3DU6A 5D5UB 3EYYA 1IV8A 1P92A 4JX5A 2AXLA 3HXLA 3WTWC 4LG0B 4ANJA 1X3ZB 2E2IJ 1LFPA 2ZXIA 1IN4A 2R7FA 2XHKA 2K9NA 2Z99A 4DZJA 2XRNA 3NQOA 4UXNA 2D45A 2CW7A 3RSNA 1YITI 1X1PA 2XPUA 1HDDC 5CJ9A 1IN8A 3VB2A 1E2XA 2OA4A 2P8TA 2PJRA 3A1YA 4LIVA 4C3JJ 4A3DJ 2E2HJ 3RKXA 1RETA 1FMWA 1WCMJ 1USTA 3DKWA 4B44A 4L0YB 5L3CA 2RNJA 2STTA 1SAXA 4MO7A 4E7LA 5HLIA 1B9MA 3EETA 3FX3A 4IEJA 4A3CJ 2X0LA 2FJ1A 2PQ8A 5BQTA 3QYBA 3CCQI 3MQ0A 4FE7A 5FLMJ 1Z21A 3T8TA 3S2DJ 3HOZJ 3HGYA 5AONA 5KVRA 4A3JJ 1OJLA 1EH7A 1ZN2A 2EILH 3HRUA 2HFHA 4RAGA 2R4GA 1R4NB 1BI1A 4F3QA 4XQFA 5K5OA 3S3OA 1YHQI 3HOVJ 5F08A 3F3XA 2V9PA 3OOPA 4TV7A 5J1YA 3JCUC 4PCQA 2IS1A 5ED4A 4D9JA 2VC1A 2HYJA 1FWZA 2IS6A 2O03A 2HXOA 4P9UA 3ZQLA 4EJWA 3AG1H 5EYRA 2FMLA 4DYQA 1WJFA 3R0AA 3BJAA 3PNYA 2XAFA 5HS9A 3G6EI 4M9XA 1SD4A 2X1EA 4MTDA 4C3IJ 1L0OC 5DD8A 3PO3J 3SJMA 1FC3A 5J4VA 1FYLA 3ZQQA 2CUFA 2K9QA 5DCMA 3Q0UA 4IZZA 4ETSA 5GTHC 4BBSJ 5F0CA 2MABA 2KIFA 2OCCH 5F1RA 1BOAA 1KGSA 2KJCA 2DPUA 4LITA 5E17F 2F4IA 2VOOA 1I3QJ 4RM3A 1HKQA 4IHYA 5TJJA 3FXKA 3H9JA 3CO6C 5J6XA 2XRLA 2XUBA 4OIOF 2VPRA 2M30A 3VYRB 1K4SA 2VC0A 4UB8C 4A2UA 1T0FC 4E7IA 1EKEA 1MKMA 3RZOJ 3PNVA 3L1PA 5K5QA 2NOGA 3RPUD 4M3DA 1OR7A 2VB6A 3E5XA 1MBJA 4BY1J 4FHTA 1FOYA 1W36C 4Z6YA 1IUYA 3CDHA 1DU0A 1U9OA 3BCBA 3A01A 5FROA 1CGPA 4XSZF 5L3FA 4IRHA 3I3LA 2OPTA 2OJED 3SXYA 2Z16A 1H89C 2OTJI 3BR2A 2Y31A 1QRYA 4MEXF 4B4CA 3IV5A 4D7NA 3SDBA 4BBRJ 4G94A 2JSPA 1P2FA 1JXSA 3OWTA 3GFMA 1HSTA 4C30A 2LRDA 3OYFA 2D2WA 1SEUA 3GVAA 3TW6A 2GIZA 2DW4A 2ZO4A 3BJOA 3EQLF 1LDDA 1FOKA 2IEKA 1XPXA 4ESFA 1BJAA 3MCZA 2DQLA 4GYIA 1NK2P 3RIRA 5IP6A 4RB1A 5D5VB 1QZEA 1U5TA 4KIBA 3QAHA 4ZDLA 2JRTA 2RVCA 2X48A 3WTTC 1XGNA 5CKTA 1UCRA 2EZIA 3J80K 2MH2A 3VPRA 1W5CC 1HBXG 2DOFA 3U1DA 2FOWA 2WAQA 1IRZA 1ODDA 3E0JB 1Y1WJ 2Z33A 3TMOA 2BE5F 1LKXA 3K70D 2I10A 3QOEA 5BMZA 2PMZA 2ZJPF 1Z3YA 2IA1A 1JJ6C 3ZR8X 2QSGX 1S72I 1FBUA 1LVKA 4KISA 2H8RA 4IVNA 4DBRA 1IN6A 1BIBA 1WFXA 4NDLA 1YTYA 3B02A 4KNYA 5E79C 4IKFA 3H3UA 2VASA 2V1XA 3H1CA 1BI0A 4XKCA 4C3HJ 1X1CA 3H0DA 2E5NA 2B9SA 2VJ4A 3C7JA 5CLSA 1QQIA 6PAXA 2X6XA 1XD7A 1K61A 1W7PB 2QBYA 4J00A 2DDBA 1B4AA 4NHJA 4XN0A 2OC6A 3KP6A 3NAUA 1PVEA 2UXXA 4OINF 1YW7A 3ULQB 2CSOA 4GGGA 2KT0A 3KYDB 4MQ9F 4UHTA 1R6RA 2L01A 2ZMEC 4L9TA 2ZXWH 3DV8A 2E60A 2WC2A 1Z3XA 3QPSA 1S9HA 3GZ5A 2QEXI 3D5LA 2QM3A 4QTRA 3N97A 3M4OJ 2VPLA 3DPTA 3S2WA 4E7KA 1ZLKA 3SZTA 5FKNA 1BL0A 1P4WA 2BY0A 2M1BA 1F5TA 1KONA 2EFNA 2HI3A 1BI3A 3OYIA 3HM5A 1TNTA 2I5UA 3Q9VA 4NC8A 4DYRA 4ZYGA 1X19A 1OMIA 1XMAA 4DOZA 1DP3A 1B8IB 2KQRA 3FHZA 3EUHA 2EFQA 3HDDA 4XLHA 2V1DA 4CYCB 2A5YB 3CUQC 2VBYA 3DEWA 4HNUA 2MG4A 2W4SA 1HF0A 2VONA 1BC7C 1PUEE 2BHZA 3K4KA 3KZZA 2RKHA 3BQYA 4EMSA 3FDYA 4IHSA 4HX7A 4QWQA 4CZZA 2XPWA 5EEAA 3CJTB 4HAMA 2NVUB 2ESHA 3VSLA 5F6FA 5FFZA 2VKEA 4A5MA 3CUQB 2Q1ZB 1H9TA 1S7OA 2O0YA 4I7HA 3CF2A 1QZZA 3V8JA 2FU4A 3TDZC 3W6KB 1O7LA 2QLZA 3FISA 3K1PA 2MW8A 3HOWJ 3BTIA 1WQ2A 2ELKA 2K9MA 2LY2A 1B59A 5JLXA 3OYHA 4IHTA 4JYKA 1WRJA 4EJVA 2M4KA 3CC7I 3M8JA 3IUOA 1Z7UA 1YRNA 1ZH5A 2UUZA 2FA5A 1DP7P 2EIJH 2R0QC 1KU3A 2ECBA 1A04A 3H36A 4AYBN 4BXXJ 1ZQ3P 1ZG1A 1YJWI 3FXJA 1WZ2A 2PMUA 4BL0B 4A3BJ 4D7MA 3W2AA 5IYBJ 1Q1HA 1Y8QB 4XSXF 4S0HB 5LLQA 4GDFA 2R7WA 4MTEA 1XB4A 2ZNZA 1J7KA 4KT6A 2WY8Q 4NBQA 3WGHA 3QU3A 2O9LA 3CQZJ 1G6NA 3QODA 3S1NJ 4ENJA 1ERDA 4U0YA 2KDZA 4QSHA 4IHWA 2EK5A 2HOAA 4A12A 1O3QA 3FHNA 2IGMA 5LFAA 3A0HC 4OU0A 5EDNA 2JTVA 1IW7F 4H4KC 4KICA 3AAFA 1GXPA 2BXZA 2XPVA 3IWZA 5BS6A 3FBNB 3ECOA 2UWMA 2YS9A 3BG7A 4ZYAA 2W85A 4N9IA 1ZYRF 3S93A 1XMKA 5IY5H 1WJAA 2L9RA 5HLHA 2VXZA 3P5JA 4HA8A 3A2KA 3ASOH 4JQFA 3F21A 2L7MP 1FIPA 4LB5A 4BE2A 4RS8A 2QWWA 3FXMA 3KEQA 4KIFA 2ME6A 5LRSA 3HPHA 3CJRB 5JHUA 4RLFA 1K6OA 2I8DA 2XF6A 2HU9A 3PUFA 4Q47A 2V79A 5IT9K 5HLTA 4HYEA 3I4PA 1D0ZA 2RAEA 1CF7A 3ECHA 1UB9A 3CTAA 2HQ5A 2DMUA 2M0CA 1K7AA 1E3HA 3S1RJ 3ZPLA 3HL2A 1UHMA 4HEA2 1U2WA 2KRHA 1MBKA 2FX0A 3L2WA 3LSGA 1XCVA 4DQ2A 3DXJF 1XG1A 1ZKGA 2VE8A 3MKZA 4ENNA 4LLGF 3CD6I 3C3WA 3G3ZA 2PEXA 2VI6A 1EJ9A 1A6QA 4ON0A 9ANTA 2BV6A 1MIJA 4BH9A 3OYNA 1FMVA 2HYGD 2M0MA 4JBAA 4XL9A 1PUFA 5EEHA 3S3NA 2ELJA 2A07F 2HVSA 1BC8C 3J7AY 2DBBA 1WVRA 3H92A 3RYPA 5GAEJ 1VQ8I 2IGKA 2K40A 2EIMH 1LDJA 1RZ4A 2HPIA 3S32A 1F9NA 1IUFA 1IV6A 2D1HA 2ISYA 3F9KA 4IL6C 1BJZA 2KZGA 2MC3A 3I53A 5FKMA 4A3KJ 1ORKA 4NC6A 1FTZA 4F52A 2PN6A 3TO7A 4OAYA 1IRXA 2IW5A 1VI0A 2CU7A 2CV1A 4LG0A 2UZKA 3FK6A 1FT9A 2FBHA 5K7ZA 1YOVB 3A0BC 5EGOB 5LGTA 2Q0OA 4RBOA 5JI6A 2VLAA 1R7JA 2BY1A 3REOA 5ICCA 2MSYA 4IQ4A 2COBA 1RUOA 2WB1A 3H5AA 1YQAA 4ASNA 2HOSA 2EIKH 1VQMI 3DWLE 3I55I 2M7AA 1U0JA 5AIQA 3G1MA 2L0KA 3OYLA 5J1UA 4Y15A 1Z1DA 2O3FA 2P4WA 2CV0A 5GAHJ 4BE0A 3D1NI 4HPQA 3BG3A 3P7NA 3S15J 1G59A 2F5VA 2L4MA 4F93B 1XN7A 4GXOA 2BZTA 2W57A 2XGXA 3NARA 4WF2A 1XDSA 5E1ZB 3B6CA 4LOCA 5B3SH 1I50J 3EUAA 4HSTA 3U21A 1UG0A 4U7DA 4P55A 4HDVA 2ZJQF 3LAJA 2LBFB 2DPDA 3CCSI 3PFIA 1FBQA 4XN3A 2VOPA 4RAZA 2KHMA 4DJAA 1RNLA 4FQGA 3IH3A 3GLLA 3V7SA 2VT3A 4C9YA 3GTKJ 2MH9A 2RC4A 2H6CA 3BTJA 4Y4RA 1VQ7I 4HSRA 4CHUA 5DTDA 3HKZN 1A31A 1JGSA 3EPZA 2Y69H 2J5OA 4J01A 2R7UA 2L9VA 2H09A 1FSHA 4G9YA 1R00A 3FM5A 2KKOA 3MFKA 1J59A 3ZRGA 3K1NA 3CCMI 2KMUA 2EWNA 3IC7A 1NHAA 3ZMDA 4BEHB 2EJRA 4EQQA 4UNOA 2EV5A 2ZXJA 1TL8A 3W3CA 2D5VA 1H88C 1UHWA 5DV5A 1Z6RA 3PIPF 3ZQFA 2KIQA 3OMYA 2Q8KA 4DNCA 3PQKA 2UV1A 1ZR4A 4A3FJ 3F8NA 1SAUA 2XASA 1YIOA 2MD0A 1RR7A 1PYVA 5GAGJ 5E18F 1YJNI 2R7ZJ 2L7KA 1HCRA 1TWCJ 1WHUA 4IOAF 3KPHA 1DU6A 3GZNB 3S1QJ 1YG2A 3RPQA 3JRAA 2ZBKA 5LD2C 2EINH 4I01A 4YIIA 3WHBA 3CMMA 2OCEA 2VBZA 3OYMA 4A3GJ 2GQQA 4PJNA 3ASNH 4PFOA 1L3LA 1R1UA 2K7LA 5KK1A 3ZXSA 1G3TA 4FX0A 1P9QC 2DFEA 1LJ9A 2XAHA 3K4BA 5KAIC 1R1VA 2E36A 2W82A 2Y9YA 2LKXA 3WHCA 2GAUA 5CVJA 1G3SA 1HQCA 2E1CA 4BHCA 3L2UA 2LTPA 2XF7A 3VWBA 1BN5A 2DA6A 5DUKA 3UR3C 3HHGA 5J8CA 4D1QA 4A3EJ 4IPAA 3LOCA 3KP5A 4KT5C 3WGGA 1FY7A 4WK8F 1QNTA 3KEOA 3QYFA 1T0FA 2DA5A 5IT3A 2IS2A 2X4HA 3FMRA 2V26A 2H8WA 3MWMA 3S16J 1ZR2A 4PSWA 3WTVC 1UMQA 4UUSA 1B72B 3C18A 1ITYA 5HNFA 4NB5A 2Y0MA 4OWRB 1W5SA 1Z67A 4KDPA 1SFEA 1BOBA 1SMTA 3M8FA 1FPQA 1MH3A 3TOAA 1SVOA 2ETHA 3QRFF 1LE8B 3I4NJ 5LGUA 2DMPA 2IT0A 1I5ZA 3TKYA 2MYSA 2V9VA 4ZYHA 2JSCA 3TO6A 3OR2C 3HSFA 3TL4X 1SMYF 4G7OF 3KP3A 2CO5A 3G2BA 3C2BA 1IAWA 2G0EA 2CFOA 1RC9A 1R5GA 4ZTFA 5HDGA 5GTIC 4L0ZB 1T95A 3VEPA 2WAEA 5DM6F 2LNBA 1YI2I 3BQZA 3BROA 2O8KA 3JRBA 1MJBA 1ETVA 4W97A 2TDXA 4IRIA 1K83J 4B8XA 3LA2A 2WADA 2KIUA 2LF7A 1KA8A 4EM0B 3BZCA 1WJDA 2LLKA 2CJJA 1S8NA 1WKMA 4YRVA 1JHHA 1PP7U 2XAJA 2JPCA 2FSWA 2CUZA 1ETKA 1ZRFA 4O6JA 1D8JA 2YPRA 4RGSA 1O4XA 1W7PA 3NRVA 1ETQA 2CQNA 2DU9A 2F5CA 4QLCU 3K4NA 3DKYA 5D6EA 5M5YJ 3HTSB 1I39A 4UUTA 1ONVA 4BKXA 2VJ5A 3IP4B 2F5FA 4E6KG 1SD7A 4IJAA 4IO9F 3RTRA 3M9AA 3BZ6A 3OS0A 2IRFG 3MKYB 2IAIA 1D1AA 1X3UA 4I02A 2R7VA 3RKQA 4Q5SF 2FD5A 4NUBA 5CYVA 5B66C 2E7XA 3DCFA 1MBGA 4CCOA 3FXUA 2LYCA 2P6TA 3F22A 3LL7A 1AA7A 2DYRH 1OCCH 1FP1D 2JVGA 1V5GA 3OYJA 2GA2A 2KFDA 5EG0B 5FKOA 1R5ID 3C2GA 4HNTA 3B6AA 1D5YA 3ABUA 1B8IA 4NQWB 3VDXA 5D5XB 1LFUP 2BW3A 4M73A 4CGZA 3WTUC 1IGNA 4CYCA 3FMQA 4BAYA 3LSTA 3CLQA 1SFUA 1BW5A 3V8KA 4WXDA 4RAFA 2K9SA 2LP0A 3E6DA 2MLKA 3A03A 2A68F 4ABZA 4B43A 1UAAA 1TWAJ 1FEXA 2M4GA 5LHHA 1ZGJA 2A6TA 4KMUX 2QQBA 1I27A 3CUQA 1ZAOA 3WTZA 3GW2A 2LMDA
chains in the Genus database with same CATH topology
2RREA 3K4KA 1SFKA 2HVRA 2W1OA 1X1DA 3SEQA 4HRIA 3FDYA 5TGTA 4CCKA 4PSXA 3VSLA 1MNEA 3QYEA 2L2OA 4QPQA 3KYLA 4XLFA 2Q1ZB 3ZGKA 2CUJA 4MLOA 4YEJA 2OV7A 3CF2A 3OY9A 4XKWA 2CV2A 2HNHA 4PJMA 1QHHD 2DOAA 1GLNA 4B3XA 2BVLA 3K4LA 4RLQA 2K9MA 2LY2A 3OYBA 3OYHA 3OS2A 4XONA 1WJ5A 2M4KA 3M8JA 4CCLA 3IUOA 4DIQA 4ZJZA 4BDYA 2O5RA 5HNHA 2UUZA 2F6CA 4AVZA 2Y0SA 2MFZA 1BR1A 3M1CA 4CCNA 3D5RC 3OS1A 2GOMA 4X0GA 2R7QA 3SZGA 4BJ6C 3K10A 4BL0B 5CPRB 3NWSA 4E7JA 4Y33A 3W2AA 2VQLA 4XM3A 2R7WA 4BQOA 3LMMA 3LSMA 4KT6A 4CUGA 2WY8Q 1MMDA 4BXFA 3DPUA 4BJ5C 2JVHA 4BGDA 4KJZA 3QODA 1X1BA 1ERDA 1V5EA 4NNJA 3VSKA 3K6GA 4CZCA 2E5ZA 3BG6A 3FHNA 2DT7B 1J09A 2IGMA 2WA0A 4PUSA 2DT6A 5LFAA 1MMGA 4OAZA 4U87A 3H5RA 4KITB 5HVQC 2ZFUA 5FRMA 2DJIA 2X6WA 2W7NA 4BS9A 3DLAA 4H4KC 3HG9A 3IAS2 1MW7A 3DTKA 1D1BA 1K6YA 1YX5A 4IQJA 3FBNB 2VIXA 3RCOA 3ZCOA 2UWMA 4BJTA 3BG7A 4ZYAA 3CJQB 3HUGB 4FASD 2K5CA 4GRIA 3LFUA 3S93A 1D1CA 2V1NA 1WJAA 2VXZA 2KLOA 1TT0A 3LSIA 3A2KA 4EATA 4JQFA 2Z2SB 4BE2A 5JHFA 2R7RA 3HPHA 3C2HA 3CJRB 4RLFA 2I8DA 2XF6A 4BUPA 2HU9A 4G6TB 3DU5A 3OYEA 3L2VA 5HLTA 3PJRA 3FKJA 1D0ZA 2Q2EB 2JA2A 3EUKL 3D5SC 4YELA 4HG2A 3H9QA 3HL2A 2IXSA 4HEA2 3OYAA 4XKVA 2KRHA 2P0WA 2M7BA 3L2WA 3LSGA 3K4JA 2VKDA 4CH7A 2ZSIB 2VJJA 4LG3A 3MKZA 1PJRA 2VQHA 1D0XA 2FUG2 3OYNA 4N4NB 1FMVA 3K70C 2X85A 1N75A 2M0MA 2X6YA 4XL9A 4B47A 3CP8A 3S3NA 2ELJA 3PSFA 3OIQA 1WJCA 3H9GA 2RQQA 4XKBA 1EA3A 4BQQA 2L9NA 3OL4A 4E7ZA 1YE9A 4AU7A 3J7AY 4XLAA 3AL0C 4ZTJA 1MMNA 4RM2A 4ZC3A 2DXIA 1NG6A 2IGKA 1VZ0A 2HPIA 3S32A 4PFPA 2VL8A 3OOUA 2HVQA 3F9KA 3W2WA 2MC4A 3OYGA 2LY1A 4F52A 2R7SA 2XSJC 2VQGA 4OAYA 1IRXA 3AL0B 1NG7A 3DQVC 4IX7A 2KRCA 2CH0A 2HZDA 2CV1A 2A5WA 2LC2A 4BU2A 1QHGA 2HDWA 2IS4A 4E7HA 3HKZA 2VLAA 4BACA 3HC7A 4IQ4A 4RMNA 1X1AA 2WB1A 3H5AA 4XNFA 2V6EA 3DU6A 2AQFA 3HOSA 1Y56A 2KP6A 3DWLE 3V42A 1DGWY 1U0JA 2M7AA 3HXLA 4F55A 3OYLA 4ANJA 2R7XA 4XORA 1LFPA 3K4MA 3L2RA 2ZXIA 2CV0A 4BE0A 2L9SA 1Z7LA 4HPQA 2CW7A 3RSNA 2LBFA 1G59A 2F5VA 3N05A 4F93B 3AFHA 2BOLA 4CSWA 2PJRA 3W2VA 3A1YA 4LIVA 4PJJA 2LG4A 4E7SA 3KX2A 3PL8A 3GBGA 3EUAA 4HSTA 1FMWA 1UG0A 3U21A 4B48A 3L2QA 4B44A 1UELB 2LBFB 5KCMA 2DCEA 4P1WA 4DGWB 4E7LA 4XN3A 4Y3OA 2KHMA 3DEEA 5CQGA 2E1MC 3CP2A 4BEHA 4DJAA 4C9YA 2PJRB 4C2UA 3QYBA 4Y4RA 3OR1C 3PFYA 1Z21A 4HSRA 3LSHA 3EPZA 4J01A 2R7UA 2IGOA 1BR2A 2R4GA 4F3QA 4LIUA 4XQFA 3S3OA 3ZRGA 2KL4A 2KMUA 4BEHB 2VKHA 4F92B 2IS1A 2E1MB 3W3CA 4D9JA 3BLYA 1JI8A 2IS6A 2X1CA 4XOTA 4C2TA 3OMYA 2UV1A 4CA0A 1WJFA 4N4OB 1SAUA 3PNYA 2MD0A 1PYVA 4XOPA 4CCMA 4CCJA 2LREA 1BR4A 2L7KA 3SEZA 2X1EA 4ZDOA 3CZ6A 3MMYB 5LD2C 3K4CA 3VYSB 3ZQQA 2LH9A 1V5FA 3CMMA 3I9V2 2W00A 3OYMA 4PJLA 4PJNA 4F91B 4PFOA 4IZZA 1ZELA 3EUHC 2MABA 2ZSHB 3ZXSA 2V4JC 1P9QC 2VXDA 2GOXB 2BW3B 3K4BA 4U7BA 1MMAA 2W82A 3E1SA 3PUBA 1DQUA 4LITA 2F4IA 4RM3A 4P5OA 3VYUB 3BC8A 3L2UA 4BDZA 2XF7A 2IGNA 3RQ4A 3VWBA 3H9JA 1TZLA 3OYDA 3UR3C 4D1QA 2R7OA 2CW8A 2LOOA 3VYRB 2KDOA 1T0FC 4E7IA 3QYFA 1OR7C 3PNVA 1X4PA 3RPUD 3S3MA 2IS2A 3LSKA 2VB6A 2HVSA 2V26A 3DPLC 2K3PA 2QKLB 5KHDA 1W36C 4PSWA 3S8PA 4ZDPA 3BCBA 5HNFA 5FROA 3I3LA 4OWRB 2QKMB 2Z16A 1BOBA 3PNTA 2X51A 4JOMA 3MKWB 2ZXHA 3IAM2 2CS3A 1QU3A 3SDBA 2JSPA 3OWTA 4C30A 2LRDA 2MYSA 3OYFA 2KZVA 2XDVA 3OR2C 3TL4X 1WJBA 1YX3A 3G2BA 2CFOA 3FBIB 4ZTFA 2WBMA 2XF5A 4R79A 1T95A 4BE1A 2WAEA 4XLCA 2XAUA 4PK4A 4BQNA 4ZDLA 2M3AA 4II2A 3HOTA 5CKTA 3PSIA 2WY7Q 2WADA 2WAQA 1WJDA 2AQEA 3TBIA 3OL3A 3E0JB 4YRVA 3OYKA 3TMOA 4NC7A 1HA8A 1LKXA 3K70D 3QOEA 2CUZA 2PMZA 1Z3YA 3BCAA 3ZR8X 2K9LA 1LVKA 3DKXA 4II3A 4KISA 1X4OA 3K4NA 3DKYA 3CESA 4DBRA 2V7FA 1WFXA 4XMYA 2XC7A 3OIPA 2CMPA 4QPOA 4IKFA 4XLEA 2VASA 2VJ5A 3IP4B 4E6KG 4XKCA 5HOOA 3RTRA 1X1CA 3H0DA 3ONQA 2E5NA 3OS0A 1D0YA 2HQAA 2VJ4A 3MKYB 3H35A 1D1AA 2L5QA 2R7VA 2X6XA 1E0EA 4NUBA 4J00A 1OLTA 2RNGA 2R7TA 4XN0A 2OC6A 4CCOA 2LYCA 3LL7A 1AA7A 3AKZA 5KNLA 2JVGA 1V5GA 3DTEA 2NOJB 3OYJA 2VJIA 4DBQA 1W36D 1R6RA 1Y6IA 4FETA 2E60A 3C2GA 1Z3XA 4HNTA 1MNDA 1S9HA 3SYTA 3D5LA 1G8XA 3MD2A 4NQWB 3VDXA 2VQCA 2VPLA 3DPTA 2BW3A 3KEYA 4E7KA 3VYTB 3A4CA 5CQEA 2JUGA 3HPGA 1KONA 2X1DA 3DTIA 2BVMA 4ITVA 4E4HA 3H5NA 3OYIA 2KPMA 4NC8A 1X19A 2WAFA 1N77A 2OUMA 4DOZA 4AYBA 1DP3A 3OYCA 4B43A 1WJEA 1UAAA 2KQRA 3NWTA 1LDKB 2M4GA 2Z1DA 4XLHA 4XR6A 1N78A 2A6TA 1DGRM 2HPMA 2V9KA 3UNGC 4HNUA 2W4SA 5FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI8 A;  2V4J C;  1SAU A;  2A5W A;  2XSJ C;  3OR1 C;  3OR2 C;  1YX3 A; 
#chains in the Genus database with same CATH topology
 4BYY A;  5B1A H;  1BW6 A;  1SFK A;  2NNN A;  2HVR A;  2W1O A;  5JLW A;  2GXB A;  2H1K A;  2IVM A;  1X1D A;  5E3M A;  4FE4 A;  3WG9 A;  5TGT A;  3I5U A;  3OIO A;  4CCK A;  4PSX A;  5IT9 Z;  3SDG A;  4D0P A;  1MNE A;  3LQR A;  2Y30 A;  5FD5 A;  4XRS A;  2L2O A;  3KYL A;  4XLF A;  5DUI A;  2CUJ A;  4MLO A;  4YEJ A;  2OV7 A;  2VKV A;  5KAF C;  1QHH D;  5DS9 A;  3I59 B;  1QPI A;  3MAJ A;  4B3X A;  1QO0 D;  1RPW A;  3QP6 A;  4PJ0 C;  4XRF A;  3J7Y J;  2GXG A;  1ON2 A;  2CG4 A;  3HJE A;  3OYB A;  4D5C A;  5IYD J;  3ZQ7 A;  5H2F C;  3R0J A;  4Y13 A;  3HB9 A;  4HQE A;  3KZI C;  4PDK A;  5E3N A;  1QVT A;  1T08 B;  3KIO A;  2O8X A;  1U78 A;  5D4R A;  2RGV A;  4AVZ A;  1KQ0 A;  3M1C A;  1IRF A;  1KYZ A;  1KU7 A;  3V8L A;  3W6V A;  2DA1 A;  2GOM A;  4X0G A;  5E3L A;  4HDU A;  2ECC A;  1ETW A;  3K10 A;  3KP7 A;  5FD6 A;  1OYI A;  2GXA A;  4L18 B;  3F8B A;  4XM3 A;  1IXR C;  1ZG5 A;  3BJ6 A;  3LSM A;  4EVI A;  1MMD A;  1B6A A;  4KUM A;  3SZP A;  3DPU A;  4BXF A;  2JVH A;  5BPI A;  4OMZ A;  1P7I A;  2O7O A;  4HBL A;  2W25 A;  3IRR A;  3IHU A;  3CMY A;  3AG2 H;  1DPR A;  2QCO A;  3ERE D;  1H8A C;  3VSK A;  4X6A J;  3CLO A;  1H0M A;  2YR2 A;  5LHG A;  1GDT A;  1A35 A;  1HSJ A;  2E34 A;  2L7Z A;  2DK5 A;  1J09 A;  4IHV A;  2WA0 A;  2DT6 A;  1MMG A;  2EV6 A;  4OAZ A;  3H5R A;  3EYI A;  3TQN A;  2X6W A;  4JX4 A;  1MMS A;  3FF5 A;  4BS9 A;  1BA5 A;  4A0X A;  1SD6 A;  3HG9 A;  4BQA A;  3DTK A;  2DTR A;  2QSF X;  3W6J B;  4IQJ A;  5E1X A;  2E1N A;  4HF0 A;  2FF4 A;  2NS7 A;  2C6Y A;  3HOY J;  3PM1 A;  4DZP A;  3CJQ B;  1OPC A;  4FAS D;  4I99 C;  4HQM A;  2Y0S N;  2YU3 A;  1T38 A;  3LAP A;  5FKK A;  3I4M J;  2KLO A;  3WTY C;  2A69 F;  3LSI A;  3LNQ A;  1RUN A;  1VQK I;  2QZ8 A;  2Z2S B;  3WTX C;  2XAG A;  4V2F A;  2CQK A;  2DK8 A;  3AG3 H;  3Q3S A;  3RDI A;  4A3I J;  1SC7 A;  1USS A;  2HYF A;  1YYV A;  2P7V B;  4U88 A;  2XSD C;  3K0L A;  2O61 A;  1QA6 A;  2DFF A;  1T39 A;  2E71 A;  2W48 A;  5C3E J;  3FKJ A;  2JK3 A;  3GFJ A;  1WSU A;  1JT6 A;  3VOE A;  3EUK L;  2HR3 A;  3HIF A;  1VQ5 I;  4OIQ F;  1BI2 A;  2FOK A;  2K27 A;  4YEL A;  4HG2 A;  3H9Q A;  2DMQ A;  2IXS A;  2HEO A;  2ID3 A;  2ZME B;  1JTX A;  2L02 A;  3BR0 A;  3OYA A;  4UVC A;  2K4J A;  5LEJ A;  3KLO A;  5M3M J;  2R7D A;  1U3E M;  1YW8 A;  3E6B A;  2VKD A;  2JA7 J;  1MD0 A;  2XV4 S;  5JR3 A;  2IA0 A;  2P81 A;  2XVC A;  3Q0V A;  4LG3 A;  1FYM A;  1FOX A;  1S5L C;  1Z0X A;  4LLN A;  5H20 A;  2CQX A;  1T98 A;  2IJL A;  4G7H F;  3TP3 A;  3BG5 A;  2QA4 I;  1EH6 A;  1N75 A;  1R36 A;  2EFO A;  1MSF C;  1F36 A;  2X6Y A;  3K1M A;  1QBJ A;  1FSE A;  3E5U A;  2QSH X;  4YFN F;  3CP8 A;  3CCE I;  1R1T A;  3PSF A;  3OIQ A;  4KN4 X;  2GA1 A;  2WV0 A;  2QF7 A;  3OL4 A;  4I2O A;  1T6S A;  5L3B A;  1TQP A;  3LSP A;  1W1W E;  1YO5 C;  4ZC3 A;  3KP4 A;  1WI9 A;  2IA2 A;  5DCM B;  3JRG A;  4UUV A;  3GYH X;  1E3P A;  2NS0 A;  3W2W A;  2FXA A;  3QWL A;  4MEY F;  2EA2 A;  2FNA A;  3OYG A;  1STZ A;  4RDU A;  2E2J J;  1JTY A;  2H94 A;  4XRS G;  4M3E A;  4W1U A;  3CC4 I;  3MZY A;  1MJA A;  3SFI A;  2P5L C;  1ZLJ A;  1UJ8 A;  2HZD A;  3VOD A;  1T2K A;  2A61 A;  1A5J A;  3DLL F;  4CO8 A;  1ETY A;  2JJ7 A;  1OCT C;  2HDW A;  2HTS A;  3PO2 J;  4BAC A;  1TWF J;  3HC7 A;  4G8X A;  3PQJ A;  5L3G A;  2E35 A;  4LFU A;  4XNF A;  5HLG A;  4AID A;  4KA4 A;  1DGW Y;  1DDN A;  2FRH A;  4F55 A;  3CC2 I;  3K4M A;  3L2R A;  4V2G A;  2L9S A;  3A01 B;  4IHX A;  4IRG A;  1A6I A;  1YLF A;  2M45 A;  4KIG A;  5IYC J;  1Y0U A;  4S05 A;  2NVT J;  2LBF A;  4G7Z F;  2HDD A;  3N05 A;  4RGX A;  3TED A;  4CSW A;  3W2V A;  1R71 A;  4PJJ A;  1T33 A;  4OOI A;  3HOU J;  4GYG A;  4E7S A;  2B0L A;  3ZP5 A;  2FNP A;  3KX2 A;  5F0F A;  1E17 A;  5ICG A;  2F4M B;  3GBG A;  1UEL B;  3BR3 A;  3O2P E;  2HDC A;  3TO9 A;  2JA8 J;  3HRM A;  2DCE A;  2FMY A;  2R93 J;  2OF7 A;  1YS6 A;  4DGW B;  4BNC A;  3JR9 A;  3DEE A;  5CQG A;  4BEH A;  3RPU A;  4C2U A;  4AM3 A;  3FZV A;  2Z3Y A;  4I0A A;  1OCR H;  2DMT A;  2QEN A;  1O3R A;  4IF4 A;  4RGU A;  5ILV A;  1HXD A;  2J5P A;  3LSH A;  3MEX A;  4WXH A;  1BR2 A;  3X2Q H;  4LGW A;  4M9S A;  2EA4 A;  5F04 A;  4HLX A;  3LQQ A;  2Y75 A;  3A02 A;  2R3S A;  2VKH A;  2PG4 A;  2F5D A;  4F92 B;  2L4A A;  5C44 J;  2IPQ X;  5D5W B;  4M6Y A;  1FIA A;  3BLY A;  1JI8 A;  2R5Z B;  4L9V A;  4XOT A;  3F8C A;  1KZH A;  3F8F A;  1OYW A;  4CA0 A;  4N4O B;  5BNG A;  3FM3 A;  4CCJ A;  2FQ4 A;  2LRE A;  3M8E A;  1XSV A;  2OBP A;  4L5J A;  4ZDO A;  4XLN F;  2QBY B;  1GVJ A;  3CZ6 A;  2OQR A;  3K69 A;  1RKT A;  4A0Z A;  4BHP A;  3K4C A;  4JP0 A;  1ULY A;  2VE9 A;  2LH9 A;  1V5F A;  3RI4 A;  1OQY A;  2DA7 A;  1LEB A;  3ABT A;  4AVP A;  3P9I A;  4F91 B;  4B3A A;  2CGP A;  4GFB A;  3FMS A;  1BBY A;  3EUH C;  1JUP A;  2ZSH B;  2V4J C;  3FKI J;  2VXD A;  4M9Z A;  3M7G A;  4AIH A;  3PUB A;  4RB3 C;  5F64 A;  3V7R A;  3ZQC A;  1TP4 A;  3VYU B;  4P5O A;  3BC8 A;  4BDZ A;  2IGN A;  3ZN0 A;  2PI0 A;  1VF9 A;  1Z05 A;  1TZL A;  5LHI A;  3OYD A;  1Z77 A;  3TGN A;  1B72 A;  2YX7 A;  2OZU A;  2LOO A;  4LB6 B;  1IC8 A;  1TNS A;  4Y7N J;  1AHD P;  5HOD A;  2NXN B;  2F48 A;  1LE8 A;  1TW3 A;  5CVU A;  1YIJ I;  3S3M A;  1Y0N A;  3J81 K;  2XKP A;  2GZW A;  1XCB A;  3F0C A;  3DPL C;  3LWF A;  5KHD A;  1Q1V A;  5TIS C;  1QPM A;  5GAD J;  3T1B A;  4LLL A;  3BPV A;  2XB0 X;  2M2E A;  3ZN1 A;  1SFO J;  1UG2 A;  2DAO A;  2QKM B;  1S29 A;  2DQR A;  3PNT A;  2X51 A;  4JOM A;  3MKW B;  3LSJ A;  2ZXH A;  2R5Y B;  5FFX A;  2AHQ A;  3IAM 2;  2CS3 A;  5BPD A;  1QU3 A;  4A5N A;  4XLP F;  4RGR A;  1WI3 A;  4R8H A;  2EQR A;  4M6X A;  4EGZ A;  2JA6 J;  1XGO A;  4O5V A;  2XDV A;  3I71 A;  2MLG A;  3RZD J;  1YX3 A;  3GEZ A;  3LSR A;  3D0S A;  3CCY A;  2KRF A;  3FBI B;  3J7A O;  1G3Y A;  4BE1 A;  4XLC A;  2DFH A;  4XBF A;  1YRN B;  5M5W J;  4PK4 A;  1LB2 A;  2K86 A;  1MBH A;  3R6S A;  2M3A A;  3H0G J;  3HOT A;  2AO9 A;  3RYR A;  5ILU A;  2A6H F;  2WY7 Q;  4L9J A;  1KU9 A;  2AQE A;  2HOE A;  2JRM A;  2X9D A;  3HSR A;  2P5K A;  3OL3 A;  2ZJR F;  3OYK A;  2DN0 A;  4DW6 A;  1HA8 A;  3RJP A;  2Z5U A;  4ENM A;  2M87 A;  4Z2Y A;  1LFB A;  2JWT A;  3WGI A;  2M5W A;  1HKS A;  5D8K B;  4L5E A;  2K9L A;  1QZY A;  3DKX A;  4AWX B;  1X4O A;  4E70 A;  4CDG A;  2V7F A;  4XMY A;  2XC7 A;  1OCP A;  1MJ9 A;  4QPO A;  1W4M A;  3BPX A;  3HGG A;  4XLE A;  3GF2 A;  5HOO A;  2V1U A;  1SD5 A;  1BM9 A;  3H35 A;  2H27 A;  2L5Q A;  2QQ9 A;  1HOM A;  1E0E A;  4NQW A;  3GTG J;  1OLT A;  2RNG A;  4M3F A;  2P5V A;  5E8I A;  2L54 A;  1KU2 A;  3AKZ A;  5KNL A;  1XTA A;  1TQI A;  1SFX A;  1IF1 A;  1AKH B;  1AOY A;  1Y6I A;  2DA2 A;  4I09 A;  1KQ9 A;  1X2M A;  3E97 A;  3FWE A;  3ZMV A;  3SYT A;  5ICE A;  2ME0 A;  2PBI A;  2NVY J;  4Q4Z F;  1PP8 F;  1I3A A;  2DTZ A;  3KEY A;  2WAQ N;  2RDP A;  3A4C A;  1MBF A;  2QVO A;  2IP2 A;  3ZMT A;  2H1L A;  2OD5 A;  3HPG A;  2M8E A;  2X1D A;  3DTI A;  3P9K A;  2BVM A;  4ITV A;  4E4H A;  3H5N A;  2HZT A;  5ILS A;  2PMZ N;  5JVG F;  2KPM A;  2B7E A;  2NS8 A;  1ON1 A;  4XIC A;  3CCR I;  4AYB A;  1OFC X;  1WJE A;  4FX4 A;  3CDL A;  5FLX K;  1TC3 C;  3I54 A;  1IJW C;  5J47 A;  4BXU A;  1N78 A;  2VN2 A;  4RB2 C;  2V9K A;  3UNG C;  1Z9C A;  2YSR A;  4AIJ A;  1K78 B;  2F2E A;  1VQL I;  4RAY A;  2HKX A;  3I59 A;  1XMX A;  2BY2 A;  4L5I A;  1MH4 A;  4EM1 A;  3IKV A;  3T0Y A;  3HOX J;  3BOQ A;  3F72 A;  3JRH A;  1LNW A;  4QPQ A;  1IN7 A;  5H6Q A;  1POG A;  1WGX A;  1TT5 B;  3ZGK A;  1VQ9 I;  1N25 A;  1Y1V J;  1ZK8 A;  4XKW A;  4PJM A;  1PDN C;  2DOA A;  3KZY A;  4HV6 A;  3CME I;  3KCC A;  1I6X A;  5EEG A;  1RES A;  1V55 H;  5F0H A;  1PUF B;  4XON A;  1O3T A;  3JTH A;  4LJZ F;  3UKG A;  4CCL A;  2O5R A;  3T8R A;  4M3B A;  2F6C A;  4KMF A;  1X3W B;  3IH2 A;  3GCM A;  2MFZ A;  3U2R A;  2E7W A;  4CCN A;  4I6Z A;  4ENK A;  3BTC A;  3BR6 A;  1V4R A;  5TRD A;  1XS9 A;  2R7Q A;  1AWC A;  3SZG A;  4BJ6 C;  3GTL J;  5CPR B;  3NWS A;  1NK3 P;  3CCL I;  4OIP F;  4Y33 A;  4B1R A;  3GZ6 A;  4L9N A;  1XSX A;  1U8R A;  3ZQG A;  4BQO A;  1R22 A;  3VFZ A;  1WPK A;  3LMM A;  1YJ9 I;  4CUG A;  2HTJ A;  2EH3 A;  3LA3 A;  4BY7 J;  4BJ5 C;  4KJZ A;  2G7H A;  5J3L A;  4P96 A;  4N9H A;  2VT2 A;  1V5E A;  2XRO A;  1ZHF A;  2DT5 A;  3K6G A;  1W0T A;  2E5Z A;  1XDU A;  4MQV A;  1TQM A;  2DT7 B;  3HRT A;  1LPQ A;  4G6Q A;  4PUS A;  5E8G A;  2ID6 A;  4U87 A;  5HVQ C;  1GV5 A;  1T56 A;  5FRM A;  2DJI A;  4H0E A;  2COM A;  3MN2 A;  3BZK A;  1ZTR A;  1MW7 A;  1D1B A;  1AU7 A;  1K6Y A;  2JN6 A;  5DD4 A;  2GLO A;  2NRA C;  4A3M J;  5GP9 A;  4BJT A;  2LK2 A;  3HUG B;  3LFK A;  1GHC A;  4GRI A;  2DYS H;  5ERI A;  2M9H A;  4RA2 A;  1KQ8 A;  4UV8 A;  1TT0 A;  3TW7 A;  5IPA A;  2A6E F;  3IH4 A;  2LY9 A;  1MDM B;  3RQI A;  1KYW A;  1OIS A;  1JUS A;  2DJN A;  2VBX A;  3WE3 A;  4BUP A;  2DDA A;  2ZME A;  4G6T B;  1B1B A;  2G7U A;  3GUD A;  2PX9 A;  3GXO A;  3DU5 A;  2P6S A;  3L7W A;  3BG9 A;  2LFB A;  2TCT A;  2DMN A;  4LMY A;  5FKL A;  3L2V A;  4ZZD A;  2Q2E B;  2JA2 A;  1ETX A;  3G1L A;  4JX6 A;  2AXT C;  1IZ1 A;  3E5Q A;  4G6D A;  1VQ4 I;  4AUX A;  1W0U A;  5FB2 A;  2ZKZ A;  4PZJ A;  2YX4 A;  4XKV A;  3BY6 A;  3RKY A;  2O6G E;  2M7B A;  2QQA A;  1IN5 A;  3KP2 A;  5HS7 A;  4EJU A;  3K4J A;  5HDK A;  5GPC A;  5LRR A;  1P6R A;  3O6B B;  4CH7 A;  1HLV A;  2ZSI B;  2CUE A;  4PGG A;  2VJJ A;  2JT1 A;  2PJP A;  3H3Z A;  2ZCW A;  2OTL I;  1APL C;  4ESJ A;  2FBK A;  2L3D A;  2VQH A;  4CXF A;  1D0X A;  1K4T A;  2WV1 A;  2HQR A;  5JVT A;  3DEU A;  3JTG A;  2VUM J;  5DDG A;  2X85 A;  5E3O A;  2FE3 A;  3JRE A;  4B47 A;  4I0B A;  1J75 A;  4XRM A;  4BQQ A;  1EA3 A;  4E7Z A;  1K79 A;  3AL0 C;  1VQ6 I;  2XGE A;  1MMN A;  2XKO A;  2DXI A;  4J19 A;  2V6C A;  4OMY A;  1NG6 A;  1VZ0 A;  3MVP A;  3WE2 A;  1QVU A;  1EH8 A;  1R5H A;  3K2A A;  4XID A;  1IRG A;  2VL8 A;  2OQG A;  1HDP A;  2PMH A;  1Y39 A;  4UVB A;  4K2E A;  2MC4 A;  1QGP A;  3SQN A;  5LGN A;  1D3Y A;  2R7S A;  2BYV E;  3HBL A;  2HKO A;  3BWG A;  2ICW G;  2ZNY A;  3WG7 H;  1NG7 A;  2QQ8 A;  3DQV C;  3ZQH A;  3AL0 B;  2KRC A;  2N8G A;  4A3L J;  2CH0 A;  4A93 J;  1JGG A;  2E19 A;  2A5W A;  3V4G A;  2HXI A;  1R49 A;  5K7F A;  1F4K A;  2ADU A;  4AC0 A;  3E6M A;  2IS4 A;  4E7H A;  2OZ6 A;  3HKZ A;  5EJC A;  1P4X A;  5FO5 A;  4ZYE A;  5J4Y A;  2KJB A;  5CVR A;  5F27 A;  5HS8 A;  2AQF A;  2ZC2 A;  3ZQI A;  3HOS A;  1JJ8 C;  1Y56 A;  2KP6 A;  5DYM A;  3V42 A;  2RN7 A;  1LVA A;  1P7J A;  1SVL A;  5JFR A;  3G4S I;  2K4B A;  1J9I A;  2R7X A;  4XOR A;  1Y8R B;  2VBW A;  4UUS B;  5LBQ A;  1GVD A;  1Z7L A;  2EZL A;  4MFE A;  1YS7 A;  2W24 A;  2BHY A;  5IOY A;  4A0Y A;  3AFH A;  1JE8 A;  1E3O C;  2BOL A;  2OAZ A;  3J81 Z;  4M74 A;  3GO5 A;  2EZH A;  2LG4 A;  1S6L A;  3G73 A;  1SAN A;  3ZOB A;  1FJL A;  1H9G A;  3S2H J;  1OKR A;  4EEF G;  1MZB A;  3PL8 A;  1GUU A;  2QGU A;  2XGD A;  4B48 A;  3L2Q A;  5KCM A;  3FK7 A;  2R92 J;  1I6H J;  4P1W A;  1TLH B;  5D6F A;  3I56 I;  3JRD A;  4Y3O A;  5M5X J;  1G4D A;  2E1M C;  3CP2 A;  3IRQ A;  4Y52 J;  1MNM C;  2PJR B;  3JAM Z;  2ACJ A;  3ML6 A;  1J5Y A;  2R5Z A;  3OR1 C;  3K2Z A;  3FXQ A;  3PFY A;  4IOC F;  2ZJ2 A;  4G12 A;  1TTY A;  2GM4 A;  4Y17 A;  2WB1 N;  3QPH A;  2IGO A;  1HW1 A;  3HHH A;  4LIU A;  3CO7 C;  2KL4 A;  1VQP I;  3CMA I;  2UXN A;  3MZH A;  2BY3 A;  4HF2 A;  2LKS A;  2E1M B;  3R60 A;  2OU2 A;  3QP5 A;  3WU0 A;  1F1Z A;  4R1H A;  5K1Y A;  2X1C A;  4C2T A;  4S04 A;  2LVS A;  2QYO A;  2ESN A;  5A2Q K;  4EM2 A;  2K02 A;  3CDI A;  1SVM A;  1U8B A;  2LD5 A;  4XOP A;  4CCM A;  1DPU A;  1BIA A;  5CVV A;  1BR4 A;  3SEZ A;  3GTP J;  2WWY A;  2NNY A;  4LD5 A;  3ZMZ A;  2LKP A;  3NEU A;  3OSG A;  2HS5 A;  3MMY B;  2EFW A;  3Q9S A;  3DF8 A;  3BTL A;  3VYS B;  2EPF A;  4ZZL A;  2ZB9 A;  4GCV A;  3GX4 X;  1ZGA A;  5B5E C;  1LQ1 A;  2YU9 J;  3Q0W A;  3I9V 2;  4YFK F;  2MBF A;  2EBI A;  2W00 A;  4PJL A;  5H6R A;  4OIR F;  4V19 K;  1FP2 A;  1F43 A;  5L3D A;  2DOE A;  1ZEL A;  4WX9 A;  3KFW X;  2GOX B;  3AG4 H;  5M3F J;  2IBD A;  1EV7 A;  2BW3 B;  4U7B A;  1MMA A;  1GT0 C;  3B73 A;  3E1S A;  3RKW A;  1DQU A;  2FQ3 A;  4MIM A;  2HQN A;  2LR8 A;  1B9N A;  2KIS A;  2MGQ A;  4FIS A;  2NYX A;  3RQ4 A;  1ZGW A;  1S7E A;  1W5T A;  1J0R A;  1VQN I;  3C1D A;  1M1E B;  1ZRD A;  3BR5 A;  3ERM A;  2R7O A;  1O3S A;  4D5F A;  5EGO A;  2H6B A;  2CW8 A;  3MZ8 A;  5IOZ A;  2KDO A;  1WWX A;  4MFD A;  2R5Y A;  2NVX J;  4YFX F;  3HYI A;  2M8G X;  1OR7 C;  4M71 A;  1X4P A;  3F8M A;  3BR1 A;  1R58 A;  4BHB A;  3LSK A;  5IP9 J;  5HDN A;  2F4O B;  2K3P A;  2QKL B;  3OSF A;  2DA3 A;  1GXQ A;  3S8P A;  1REP C;  4HF1 A;  3T5X A;  3F6O A;  4JK1 X;  4ZDP A;  2CFX A;  3HZJ A;  3I58 A;  1A36 A;  2DO7 A;  2D1V A;  3DFG A;  5FLX Z;  3LA7 A;  2G9W A;  5IP7 J;  2NAZ A;  2JZY A;  3CCU I;  1DUX C;  3FXO A;  2RQP A;  3M07 A;  4GO1 A;  1XC5 A;  2KZV A;  1WJB A;  3ISP A;  3O8H A;  5C4X J;  5FJ8 J;  3Q5F A;  3QPL A;  1MGT A;  4XK4 A;  3COA C;  2Y9Z A;  2WBM A;  2XF5 A;  1U5T C;  4R79 A;  1FOW A;  3KLN A;  2PFB A;  2XAU A;  4BQN A;  3GFL A;  1FYK A;  4II2 A;  1IO2 A;  2AS5 F;  2JPB A;  3GFI A;  5J40 A;  1RRJ A;  4CIC A;  3PSI A;  1OCZ H;  3CJN A;  5FLV A;  1JUM A;  2ELH A;  3QQA A;  3R61 A;  3TBI A;  2B63 J;  3M1E A;  3WU2 C;  3DBH B;  3I64 A;  4NC7 A;  3TP0 A;  2XB5 A;  2HOT A;  1U5T B;  5J1R A;  5F1J A;  3BCA A;  2STW A;  2QUF A;  4UY8 I;  1ENH A;  3GTM J;  3HEF A;  2KIM A;  4II3 A;  2BGC A;  4AD9 A;  1JKP C;  3WTS C;  3CES A;  1R9T J;  1GV2 A;  3OIP A;  2CMP A;  1O57 A;  3ABM H;  1IDZ A;  3E7L A;  3K7A J;  3L09 A;  1AKH A;  4EJT A;  3E3V A;  3V7C A;  2GBY A;  2WTE A;  1FLI A;  3ONQ A;  1D0Y A;  2HQA A;  4PGH A;  1FTT A;  1G2H A;  3JRC A;  3F6V A;  1HW2 A;  3DBL B;  2R7T A;  2BXY A;  3ELK A;  1VTN C;  1P4A A;  3P9C A;  2P7C B;  2LF8 A;  4M72 A;  3DTE A;  3CCV I;  2EZK A;  2NOJ B;  2JMW A;  5K5R A;  2VJI A;  2BEO A;  4I76 A;  4DBQ A;  3FIW A;  5DCF A;  1W36 D;  4Q48 A;  4FET A;  4EJO A;  3JSP A;  1MND A;  4U0W A;  4ZYD A;  3O3K A;  1Z91 A;  1G8X A;  3MD2 A;  3QOP A;  1XGS A;  2VQC A;  2CYY A;  1TBX A;  2MD5 A;  1VQO I;  3VYT B;  3GTO J;  1ZRE A;  5LEK A;  4C2M J;  5CQE A;  1IXS B;  2JUG A;  3DBR B;  3WOD F;  4O3M A;  2VOD A;  1K78 A;  1OCO H;  1RKW A;  2CWE A;  2ISZ A;  5FGM A;  3ZMS A;  2WAF A;  5L3E A;  4FCY A;  1N77 A;  2OUM A;  1TWH J;  3WU1 B;  1OYY A;  3BDD A;  3L9F A;  4YG2 F;  3OYC A;  1RI7 A;  3NWT A;  1LDK B;  3O8G A;  1MBE A;  5J8F A;  1JKR C;  2Z1D A;  4XR6 A;  1I1G A;  4HOB A;  3ABK H;  2XIG A;  1DGR M;  4M6V A;  2A3S A;  3N4M A;  2HPM A;  1WH7 A;  4IXA A;  5FRN A;  2JA5 J;  2E1O A;  1FX7 A;  2RRE A;  1IDY A;  2RV8 A;  4LK0 F;  1EF4 A;  3SEQ A;  4HRI A;  1ACI A;  1FZP B;  1UZC A;  3GWZ A;  3ESW B;  3QYE A;  1I1S A;  4HV5 A;  1D5V A;  3OV8 A;  4MNU A;  1W7P D;  3IL2 A;  1JT0 A;  1ZG3 A;  2M34 A;  3OY9 A;  2CV2 A;  2HNH A;  4F7Z A;  2CQQ A;  1GLN A;  2A05 A;  4HZF A;  3CUO A;  5CVI A;  4HNV A;  1X58 A;  2BVL A;  1O7F A;  2MA3 A;  3K4L A;  4RLQ A;  3GTQ J;  2DI3 A;  2W84 A;  4X1E A;  2Y2Z A;  2EV0 A;  3OS2 A;  1D8K A;  1WJ5 A;  4ZJZ A;  4DIQ A;  4BDY A;  4LK1 F;  4HLY A;  5HNH A;  3SFZ A;  1RIO H;  3JAM K;  2Y48 A;  4HX4 A;  3GLX A;  2Y0S A;  3BT9 A;  1BR1 A;  3FXL A;  2LDU A;  2XGC A;  3D5R C;  2NVQ J;  1R4M B;  1UHS A;  3OS1 A;  4KYW A;  1J2X A;  4U0V A;  1T8I A;  2BBY A;  3K9T A;  4I98 B;  1HKT A;  4UVA A;  1CQT A;  4E7J A;  2EFP A;  2VQL A;  5GPA A;  3L2C A;  3JW4 A;  4QIW N;  1WH5 A;  2FEZ A;  3QPT A;  2DLL A;  1U6G A;  1JKQ C;  4BGD A;  5DEQ A;  3KYC B;  3E6C C;  1X1B A;  1X2N A;  1S3J A;  4NNJ A;  5EZH A;  5EF6 A;  2Z9O A;  1LUJ B;  2GWR A;  4CZC A;  2ZFW A;  5B1B H;  3HUG A;  4A69 C;  4WCG A;  3BG6 A;  5D4S A;  4HX8 A;  3S1M J;  1XSD A;  3MKL A;  4KIT B;  4YIR X;  2ZFU A;  5E1W A;  2W7N A;  3DLA A;  3IAS 2;  4KN7 X;  2EB7 A;  5E20 A;  1MDM A;  2LSO A;  1YX5 A;  2VIX A;  3RCO A;  3QU6 A;  3ZCO A;  5EG0 A;  3ZMU A;  4A6E A;  3JSO A;  2K5C A;  4CYD A;  1ZRC A;  2CRG A;  1ETO A;  3LFU A;  1D1C A;  4AIK A;  4ESB A;  2V1N A;  1IXC A;  2TRT A;  1ZAR A;  2Q2E A;  3G1O A;  2DFI A;  3G71 I;  5ICF A;  4EAT A;  2JQ7 A;  5JHF A;  2R7R A;  4UV9 A;  3C2H A;  5EZG A;  5AIP A;  4N0B A;  3FXR A;  1TW2 A;  5D8L B;  3IWF A;  1C0W A;  3OYE A;  3PJR A;  1S7A A;  1JKO C;  2DA4 A;  5DM7 F;  4EGY A;  1VND A;  1VFC A;  1LEA A;  1V3F A;  3M3Y J;  3HSE A;  3D5S C;  3J80 Z;  4MHG A;  2CW0 F;  1YW9 A;  2L7F P;  4MGR A;  3GME A;  2P0W A;  2F5E A;  3H3V K;  5K7H A;  3KE2 A;  3HTU A;  1CF7 B;  4FT8 A;  3KET A;  3TOB A;  1PJR A;  4FTH A;  3IKT A;  3U9G A;  4ZH4 F;  1U9N A;  2FBI A;  2FUG 2;  3HRS A;  1FNN A;  1UFM A;  2YUS A;  3EDP A;  4A6D A;  3DP7 A;  4UB6 C;  4WXC A;  4N4N B;  3K70 C;  2XAQ A;  2X6O A;  1HC8 A;  4P9F A;  3JRI A;  2K3F A;  1XGM A;  1NTC A;  1WJC A;  3H9G A;  2RQQ A;  4XKB A;  5C4J J;  1XX5 A;  2L9N A;  5BOX A;  1NH3 A;  1YE9 A;  4AU7 A;  3GTJ J;  4XLA A;  2CQ7 A;  4ZTJ A;  3J7Z I;  3L00 A;  4HW0 A;  4RM2 A;  3ABL H;  4EV0 A;  2HWV A;  5A2Q Z;  3PIO F;  1TWG J;  1JHF A;  1IG7 A;  1FBS A;  3R4K A;  3S17 J;  1G3W A;  4PFP A;  3OOU A;  3ROU A;  2HVQ A;  4M3G A;  1HW5 A;  3SHF A;  2HGC A;  3U1K A;  2LY1 A;  4KFC A;  4YIF A;  1Z6T A;  4RB0 A;  2XSJ C;  2VQG A;  3CF5 F;  4WWC A;  4IX7 A;  1RR8 C;  3CCJ I;  2JUC A;  3F23 A;  3BP8 A;  2LC2 A;  4BU2 A;  1V54 H;  1YFH A;  2PLY A;  2GIV A;  2DOD A;  1QHG A;  3I0T A;  3TDU C;  4DYC A;  1R23 A;  3JRF A;  3S14 J;  4RMN A;  1MSE C;  1X1A A;  4B09 A;  2V6E A;  2K85 A;  3DU6 A;  5D5U B;  3EYY A;  1IV8 A;  1P92 A;  4JX5 A;  2AXL A;  3HXL A;  3WTW C;  4LG0 B;  4ANJ A;  1X3Z B;  2E2I J;  1LFP A;  2ZXI A;  1IN4 A;  2R7F A;  2XHK A;  2K9N A;  2Z99 A;  4DZJ A;  2XRN A;  3NQO A;  4UXN A;  2D45 A;  2CW7 A;  3RSN A;  1YIT I;  1X1P A;  2XPU A;  1HDD C;  5CJ9 A;  1IN8 A;  3VB2 A;  1E2X A;  2OA4 A;  2P8T A;  2PJR A;  3A1Y A;  4LIV A;  4C3J J;  4A3D J;  2E2H J;  3RKX A;  1RET A;  1FMW A;  1WCM J;  1UST A;  3DKW A;  4B44 A;  4L0Y B;  5L3C A;  2RNJ A;  2STT A;  1SAX A;  4MO7 A;  4E7L A;  5HLI A;  1B9M A;  3EET A;  3FX3 A;  4IEJ A;  4A3C J;  2X0L A;  2FJ1 A;  2PQ8 A;  5BQT A;  3QYB A;  3CCQ I;  3MQ0 A;  4FE7 A;  5FLM J;  1Z21 A;  3T8T A;  3S2D J;  3HOZ J;  3HGY A;  5AON A;  5KVR A;  4A3J J;  1OJL A;  1EH7 A;  1ZN2 A;  2EIL H;  3HRU A;  2HFH A;  4RAG A;  2R4G A;  1R4N B;  1BI1 A;  4F3Q A;  4XQF A;  5K5O A;  3S3O A;  1YHQ I;  3HOV J;  5F08 A;  3F3X A;  2V9P A;  3OOP A;  4TV7 A;  5J1Y A;  3JCU C;  4PCQ A;  2IS1 A;  5ED4 A;  4D9J A;  2VC1 A;  2HYJ A;  1FWZ A;  2IS6 A;  2O03 A;  2HXO A;  4P9U A;  3ZQL A;  4EJW A;  3AG1 H;  5EYR A;  2FML A;  4DYQ A;  1WJF A;  3R0A A;  3BJA A;  3PNY A;  2XAF A;  5HS9 A;  3G6E I;  4M9X A;  1SD4 A;  2X1E A;  4MTD A;  4C3I J;  1L0O C;  5DD8 A;  3PO3 J;  3SJM A;  1FC3 A;  5J4V A;  1FYL A;  3ZQQ A;  2CUF A;  2K9Q A;  5DCM A;  3Q0U A;  4IZZ A;  4ETS A;  5GTH C;  4BBS J;  5F0C A;  2MAB A;  2KIF A;  2OCC H;  5F1R A;  1BOA A;  1KGS A;  2KJC A;  2DPU A;  4LIT A;  5E17 F;  2F4I A;  2VOO A;  1I3Q J;  4RM3 A;  1HKQ A;  4IHY A;  5TJJ A;  3FXK A;  3H9J A;  3CO6 C;  5J6X A;  2XRL A;  2XUB A;  4OIO F;  2VPR A;  2M30 A;  3VYR B;  1K4S A;  2VC0 A;  4UB8 C;  4A2U A;  1T0F C;  4E7I A;  1EKE A;  1MKM A;  3RZO J;  3PNV A;  3L1P A;  5K5Q A;  2NOG A;  3RPU D;  4M3D A;  1OR7 A;  2VB6 A;  3E5X A;  1MBJ A;  4BY1 J;  4FHT A;  1FOY A;  1W36 C;  4Z6Y A;  1IUY A;  3CDH A;  1DU0 A;  1U9O A;  3BCB A;  3A01 A;  5FRO A;  1CGP A;  4XSZ F;  5L3F A;  4IRH A;  3I3L A;  2OPT A;  2OJE D;  3SXY A;  2Z16 A;  1H89 C;  2OTJ I;  3BR2 A;  2Y31 A;  1QRY A;  4MEX F;  4B4C A;  3IV5 A;  4D7N A;  3SDB A;  4BBR J;  4G94 A;  2JSP A;  1P2F A;  1JXS A;  3OWT A;  3GFM A;  1HST A;  4C30 A;  2LRD A;  3OYF A;  2D2W A;  1SEU A;  3GVA A;  3TW6 A;  2GIZ A;  2DW4 A;  2ZO4 A;  3BJO A;  3EQL F;  1LDD A;  1FOK A;  2IEK A;  1XPX A;  4ESF A;  1BJA A;  3MCZ A;  2DQL A;  4GYI A;  1NK2 P;  3RIR A;  5IP6 A;  4RB1 A;  5D5V B;  1QZE A;  1U5T A;  4KIB A;  3QAH A;  4ZDL A;  2JRT A;  2RVC A;  2X48 A;  3WTT C;  1XGN A;  5CKT A;  1UCR A;  2EZI A;  3J80 K;  2MH2 A;  3VPR A;  1W5C C;  1HBX G;  2DOF A;  3U1D A;  2FOW A;  2WAQ A;  1IRZ A;  1ODD A;  3E0J B;  1Y1W J;  2Z33 A;  3TMO A;  2BE5 F;  1LKX A;  3K70 D;  2I10 A;  3QOE A;  5BMZ A;  2PMZ A;  2ZJP F;  1Z3Y A;  2IA1 A;  1JJ6 C;  3ZR8 X;  2QSG X;  1S72 I;  1FBU A;  1LVK A;  4KIS A;  2H8R A;  4IVN A;  4DBR A;  1IN6 A;  1BIB A;  1WFX A;  4NDL A;  1YTY A;  3B02 A;  4KNY A;  5E79 C;  4IKF A;  3H3U A;  2VAS A;  2V1X A;  3H1C A;  1BI0 A;  4XKC A;  4C3H J;  1X1C A;  3H0D A;  2E5N A;  2B9S A;  2VJ4 A;  3C7J A;  5CLS A;  1QQI A;  6PAX A;  2X6X A;  1XD7 A;  1K61 A;  1W7P B;  2QBY A;  4J00 A;  2DDB A;  1B4A A;  4NHJ A;  4XN0 A;  2OC6 A;  3KP6 A;  3NAU A;  1PVE A;  2UXX A;  4OIN F;  1YW7 A;  3ULQ B;  2CSO A;  4GGG A;  2KT0 A;  3KYD B;  4MQ9 F;  4UHT A;  1R6R A;  2L01 A;  2ZME C;  4L9T A;  2ZXW H;  3DV8 A;  2E60 A;  2WC2 A;  1Z3X A;  3QPS A;  1S9H A;  3GZ5 A;  2QEX I;  3D5L A;  2QM3 A;  4QTR A;  3N97 A;  3M4O J;  2VPL A;  3DPT A;  3S2W A;  4E7K A;  1ZLK A;  3SZT A;  5FKN A;  1BL0 A;  1P4W A;  2BY0 A;  2M1B A;  1F5T A;  1KON A;  2EFN A;  2HI3 A;  1BI3 A;  3OYI A;  3HM5 A;  1TNT A;  2I5U A;  3Q9V A;  4NC8 A;  4DYR A;  4ZYG A;  1X19 A;  1OMI A;  1XMA A;  4DOZ A;  1DP3 A;  1B8I B;  2KQR A;  3FHZ A;  3EUH A;  2EFQ A;  3HDD A;  4XLH A;  2V1D A;  4CYC B;  2A5Y B;  3CUQ C;  2VBY A;  3DEW A;  4HNU A;  2MG4 A;  2W4S A;  1HF0 A;  2VON A;  1BC7 C;  1PUE E;  2BHZ A;  3K4K A;  3KZZ A;  2RKH A;  3BQY A;  4EMS A;  3FDY A;  4IHS A;  4HX7 A;  4QWQ A;  4CZZ A;  2XPW A;  5EEA A;  3CJT B;  4HAM A;  2NVU B;  2ESH A;  3VSL A;  5F6F A;  5FFZ A;  2VKE A;  4A5M A;  3CUQ B;  2Q1Z B;  1H9T A;  1S7O A;  2O0Y A;  4I7H A;  3CF2 A;  1QZZ A;  3V8J A;  2FU4 A;  3TDZ C;  3W6K B;  1O7L A;  2QLZ A;  3FIS A;  3K1P A;  2MW8 A;  3HOW J;  3BTI A;  1WQ2 A;  2ELK A;  2K9M A;  2LY2 A;  1B59 A;  5JLX A;  3OYH A;  4IHT A;  4JYK A;  1WRJ A;  4EJV A;  2M4K A;  3CC7 I;  3M8J A;  3IUO A;  1Z7U A;  1YRN A;  1ZH5 A;  2UUZ A;  2FA5 A;  1DP7 P;  2EIJ H;  2R0Q C;  1KU3 A;  2ECB A;  1A04 A;  3H36 A;  4AYB N;  4BXX J;  1ZQ3 P;  1ZG1 A;  1YJW I;  3FXJ A;  1WZ2 A;  2PMU A;  4BL0 B;  4A3B J;  4D7M A;  3W2A A;  5IYB J;  1Q1H A;  1Y8Q B;  4XSX F;  4S0H B;  5LLQ A;  4GDF A;  2R7W A;  4MTE A;  1XB4 A;  2ZNZ A;  1J7K A;  4KT6 A;  2WY8 Q;  4NBQ A;  3WGH A;  3QU3 A;  2O9L A;  3CQZ J;  1G6N A;  3QOD A;  3S1N J;  4ENJ A;  1ERD A;  4U0Y A;  2KDZ A;  4QSH A;  4IHW A;  2EK5 A;  2HOA A;  4A12 A;  1O3Q A;  3FHN A;  2IGM A;  5LFA A;  3A0H C;  4OU0 A;  5EDN A;  2JTV A;  1IW7 F;  4H4K C;  4KIC A;  3AAF A;  1GXP A;  2BXZ A;  2XPV A;  3IWZ A;  5BS6 A;  3FBN B;  3ECO A;  2UWM A;  2YS9 A;  3BG7 A;  4ZYA A;  2W85 A;  4N9I A;  1ZYR F;  3S93 A;  1XMK A;  5IY5 H;  1WJA A;  2L9R A;  5HLH A;  2VXZ A;  3P5J A;  4HA8 A;  3A2K A;  3ASO H;  4JQF A;  3F21 A;  2L7M P;  1FIP A;  4LB5 A;  4BE2 A;  4RS8 A;  2QWW A;  3FXM A;  3KEQ A;  4KIF A;  2ME6 A;  5LRS A;  3HPH A;  3CJR B;  5JHU A;  4RLF A;  1K6O A;  2I8D A;  2XF6 A;  2HU9 A;  3PUF A;  4Q47 A;  2V79 A;  5IT9 K;  5HLT A;  4HYE A;  3I4P A;  1D0Z A;  2RAE A;  1CF7 A;  3ECH A;  1UB9 A;  3CTA A;  2HQ5 A;  2DMU A;  2M0C A;  1K7A A;  1E3H A;  3S1R J;  3ZPL A;  3HL2 A;  1UHM A;  4HEA 2;  1U2W A;  2KRH A;  1MBK A;  2FX0 A;  3L2W A;  3LSG A;  1XCV A;  4DQ2 A;  3DXJ F;  1XG1 A;  1ZKG A;  2VE8 A;  3MKZ A;  4ENN A;  4LLG F;  3CD6 I;  3C3W A;  3G3Z A;  2PEX A;  2VI6 A;  1EJ9 A;  1A6Q A;  4ON0 A;  9ANT A;  2BV6 A;  1MIJ A;  4BH9 A;  3OYN A;  1FMV A;  2HYG D;  2M0M A;  4JBA A;  4XL9 A;  1PUF A;  5EEH A;  3S3N A;  2ELJ A;  2A07 F;  2HVS A;  1BC8 C;  3J7A Y;  2DBB A;  1WVR A;  3H92 A;  3RYP A;  5GAE J;  1VQ8 I;  2IGK A;  2K40 A;  2EIM H;  1LDJ A;  1RZ4 A;  2HPI A;  3S32 A;  1F9N A;  1IUF A;  1IV6 A;  2D1H A;  2ISY A;  3F9K A;  4IL6 C;  1BJZ A;  2KZG A;  2MC3 A;  3I53 A;  5FKM A;  4A3K J;  1ORK A;  4NC6 A;  1FTZ A;  4F52 A;  2PN6 A;  3TO7 A;  4OAY A;  1IRX A;  2IW5 A;  1VI0 A;  2CU7 A;  2CV1 A;  4LG0 A;  2UZK A;  3FK6 A;  1FT9 A;  2FBH A;  5K7Z A;  1YOV B;  3A0B C;  5EGO B;  5LGT A;  2Q0O A;  4RBO A;  5JI6 A;  2VLA A;  1R7J A;  2BY1 A;  3REO A;  5ICC A;  2MSY A;  4IQ4 A;  2COB A;  1RUO A;  2WB1 A;  3H5A A;  1YQA A;  4ASN A;  2HOS A;  2EIK H;  1VQM I;  3DWL E;  3I55 I;  2M7A A;  1U0J A;  5AIQ A;  3G1M A;  2L0K A;  3OYL A;  5J1U A;  4Y15 A;  1Z1D A;  2O3F A;  2P4W A;  2CV0 A;  5GAH J;  4BE0 A;  3D1N I;  4HPQ A;  3BG3 A;  3P7N A;  3S15 J;  1G59 A;  2F5V A;  2L4M A;  4F93 B;  1XN7 A;  4GXO A;  2BZT A;  2W57 A;  2XGX A;  3NAR A;  4WF2 A;  1XDS A;  5E1Z B;  3B6C A;  4LOC A;  5B3S H;  1I50 J;  3EUA A;  4HST A;  3U21 A;  1UG0 A;  4U7D A;  4P55 A;  4HDV A;  2ZJQ F;  3LAJ A;  2LBF B;  2DPD A;  3CCS I;  3PFI A;  1FBQ A;  4XN3 A;  2VOP A;  4RAZ A;  2KHM A;  4DJA A;  1RNL A;  4FQG A;  3IH3 A;  3GLL A;  3V7S A;  2VT3 A;  4C9Y A;  3GTK J;  2MH9 A;  2RC4 A;  2H6C A;  3BTJ A;  4Y4R A;  1VQ7 I;  4HSR A;  4CHU A;  5DTD A;  3HKZ N;  1A31 A;  1JGS A;  3EPZ A;  2Y69 H;  2J5O A;  4J01 A;  2R7U A;  2L9V A;  2H09 A;  1FSH A;  4G9Y A;  1R00 A;  3FM5 A;  2KKO A;  3MFK A;  1J59 A;  3ZRG A;  3K1N A;  3CCM I;  2KMU A;  2EWN A;  3IC7 A;  1NHA A;  3ZMD A;  4BEH B;  2EJR A;  4EQQ A;  4UNO A;  2EV5 A;  2ZXJ A;  1TL8 A;  3W3C A;  2D5V A;  1H88 C;  1UHW A;  5DV5 A;  1Z6R A;  3PIP F;  3ZQF A;  2KIQ A;  3OMY A;  2Q8K A;  4DNC A;  3PQK A;  2UV1 A;  1ZR4 A;  4A3F J;  3F8N A;  1SAU A;  2XAS A;  1YIO A;  2MD0 A;  1RR7 A;  1PYV A;  5GAG J;  5E18 F;  1YJN I;  2R7Z J;  2L7K A;  1HCR A;  1TWC J;  1WHU A;  4IOA F;  3KPH A;  1DU6 A;  3GZN B;  3S1Q J;  1YG2 A;  3RPQ A;  3JRA A;  2ZBK A;  5LD2 C;  2EIN H;  4I01 A;  4YII A;  3WHB A;  3CMM A;  2OCE A;  2VBZ A;  3OYM A;  4A3G J;  2GQQ A;  4PJN A;  3ASN H;  4PFO A;  1L3L A;  1R1U A;  2K7L A;  5KK1 A;  3ZXS A;  1G3T A;  4FX0 A;  1P9Q C;  2DFE A;  1LJ9 A;  2XAH A;  3K4B A;  5KAI C;  1R1V A;  2E36 A;  2W82 A;  2Y9Y A;  2LKX A;  3WHC A;  2GAU A;  5CVJ A;  1G3S A;  1HQC A;  2E1C A;  4BHC A;  3L2U A;  2LTP A;  2XF7 A;  3VWB A;  1BN5 A;  2DA6 A;  5DUK A;  3UR3 C;  3HHG A;  5J8C A;  4D1Q A;  4A3E J;  4IPA A;  3LOC A;  3KP5 A;  4KT5 C;  3WGG A;  1FY7 A;  4WK8 F;  1QNT A;  3KEO A;  3QYF A;  1T0F A;  2DA5 A;  5IT3 A;  2IS2 A;  2X4H A;  3FMR A;  2V26 A;  2H8W A;  3MWM A;  3S16 J;  1ZR2 A;  4PSW A;  3WTV C;  1UMQ A;  4UUS A;  1B72 B;  3C18 A;  1ITY A;  5HNF A;  4NB5 A;  2Y0M A;  4OWR B;  1W5S A;  1Z67 A;  4KDP A;  1SFE A;  1BOB A;  1SMT A;  3M8F A;  1FPQ A;  1MH3 A;  3TOA A;  1SVO A;  2ETH A;  3QRF F;  1LE8 B;  3I4N J;  5LGU A;  2DMP A;  2IT0 A;  1I5Z A;  3TKY A;  2MYS A;  2V9V A;  4ZYH A;  2JSC A;  3TO6 A;  3OR2 C;  3HSF A;  3TL4 X;  1SMY F;  4G7O F;  3KP3 A;  2CO5 A;  3G2B A;  3C2B A;  1IAW A;  2G0E A;  2CFO A;  1RC9 A;  1R5G A;  4ZTF A;  5HDG A;  5GTI C;  4L0Z B;  1T95 A;  3VEP A;  2WAE A;  5DM6 F;  2LNB A;  1YI2 I;  3BQZ A;  3BRO A;  2O8K A;  3JRB A;  1MJB A;  1ETV A;  4W97 A;  2TDX A;  4IRI A;  1K83 J;  4B8X A;  3LA2 A;  2WAD A;  2KIU A;  2LF7 A;  1KA8 A;  4EM0 B;  3BZC A;  1WJD A;  2LLK A;  2CJJ A;  1S8N A;  1WKM A;  4YRV A;  1JHH A;  1PP7 U;  2XAJ A;  2JPC A;  2FSW A;  2CUZ A;  1ETK A;  1ZRF A;  4O6J A;  1D8J A;  2YPR A;  4RGS A;  1O4X A;  1W7P A;  3NRV A;  1ETQ A;  2CQN A;  2DU9 A;  2F5C A;  4QLC U;  3K4N A;  3DKY A;  5D6E A;  5M5Y J;  3HTS B;  1I39 A;  4UUT A;  1ONV A;  4BKX A;  2VJ5 A;  3IP4 B;  2F5F A;  4E6K G;  1SD7 A;  4IJA A;  4IO9 F;  3RTR A;  3M9A A;  3BZ6 A;  3OS0 A;  2IRF G;  3MKY B;  2IAI A;  1D1A A;  1X3U A;  4I02 A;  2R7V A;  3RKQ A;  4Q5S F;  2FD5 A;  4NUB A;  5CYV A;  5B66 C;  2E7X A;  3DCF A;  1MBG A;  4CCO A;  3FXU A;  2LYC A;  2P6T A;  3F22 A;  3LL7 A;  1AA7 A;  2DYR H;  1OCC H;  1FP1 D;  2JVG A;  1V5G A;  3OYJ A;  2GA2 A;  2KFD A;  5EG0 B;  5FKO A;  1R5I D;  3C2G A;  4HNT A;  3B6A A;  1D5Y A;  3ABU A;  1B8I A;  4NQW B;  3VDX A;  5D5X B;  1LFU P;  2BW3 A;  4M73 A;  4CGZ A;  3WTU C;  1IGN A;  4CYC A;  3FMQ A;  4BAY A;  3LST A;  3CLQ A;  1SFU A;  1BW5 A;  3V8K A;  4WXD A;  4RAF A;  2K9S A;  2LP0 A;  3E6D A;  2MLK A;  3A03 A;  2A68 F;  4ABZ A;  4B43 A;  1UAA A;  1TWA J;  1FEX A;  2M4G A;  5LHH A;  1ZGJ A;  2A6T A;  4KMU X;  2QQB A;  1I27 A;  3CUQ A;  1ZAO A;  3WTZ A;  3GW2 A;  2LMD A; 
#chains in the Genus database with same CATH homology
 2RRE A;  3K4K A;  1SFK A;  2HVR A;  2W1O A;  1X1D A;  3SEQ A;  4HRI A;  3FDY A;  5TGT A;  4CCK A;  4PSX A;  3VSL A;  1MNE A;  3QYE A;  2L2O A;  4QPQ A;  3KYL A;  4XLF A;  2Q1Z B;  3ZGK A;  2CUJ A;  4MLO A;  4YEJ A;  2OV7 A;  3CF2 A;  3OY9 A;  4XKW A;  2CV2 A;  2HNH A;  4PJM A;  1QHH D;  2DOA A;  1GLN A;  4B3X A;  2BVL A;  3K4L A;  4RLQ A;  2K9M A;  2LY2 A;  3OYB A;  3OYH A;  3OS2 A;  4XON A;  1WJ5 A;  2M4K A;  3M8J A;  4CCL A;  3IUO A;  4DIQ A;  4ZJZ A;  4BDY A;  2O5R A;  5HNH A;  2UUZ A;  2F6C A;  4AVZ A;  2Y0S A;  2MFZ A;  1BR1 A;  3M1C A;  4CCN A;  3D5R C;  3OS1 A;  2GOM A;  4X0G A;  2R7Q A;  3SZG A;  4BJ6 C;  3K10 A;  4BL0 B;  5CPR B;  3NWS A;  4E7J A;  4Y33 A;  3W2A A;  2VQL A;  4XM3 A;  2R7W A;  4BQO A;  3LMM A;  3LSM A;  4KT6 A;  4CUG A;  2WY8 Q;  1MMD A;  4BXF A;  3DPU A;  4BJ5 C;  2JVH A;  4BGD A;  4KJZ A;  3QOD A;  1X1B A;  1ERD A;  1V5E A;  4NNJ A;  3VSK A;  3K6G A;  4CZC A;  2E5Z A;  3BG6 A;  3FHN A;  2DT7 B;  1J09 A;  2IGM A;  2WA0 A;  4PUS A;  2DT6 A;  5LFA A;  1MMG A;  4OAZ A;  4U87 A;  3H5R A;  4KIT B;  5HVQ C;  2ZFU A;  5FRM A;  2DJI A;  2X6W A;  2W7N A;  4BS9 A;  3DLA A;  4H4K C;  3HG9 A;  3IAS 2;  1MW7 A;  3DTK A;  1D1B A;  1K6Y A;  1YX5 A;  4IQJ A;  3FBN B;  2VIX A;  3RCO A;  3ZCO A;  2UWM A;  4BJT A;  3BG7 A;  4ZYA A;  3CJQ B;  3HUG B;  4FAS D;  2K5C A;  4GRI A;  3LFU A;  3S93 A;  1D1C A;  2V1N A;  1WJA A;  2VXZ A;  2KLO A;  1TT0 A;  3LSI A;  3A2K A;  4EAT A;  4JQF A;  2Z2S B;  4BE2 A;  5JHF A;  2R7R A;  3HPH A;  3C2H A;  3CJR B;  4RLF A;  2I8D A;  2XF6 A;  4BUP A;  2HU9 A;  4G6T B;  3DU5 A;  3OYE A;  3L2V A;  5HLT A;  3PJR A;  3FKJ A;  1D0Z A;  2Q2E B;  2JA2 A;  3EUK L;  3D5S C;  4YEL A;  4HG2 A;  3H9Q A;  3HL2 A;  2IXS A;  4HEA 2;  3OYA A;  4XKV A;  2KRH A;  2P0W A;  2M7B A;  3L2W A;  3LSG A;  3K4J A;  2VKD A;  4CH7 A;  2ZSI B;  2VJJ A;  4LG3 A;  3MKZ A;  1PJR A;  2VQH A;  1D0X A;  2FUG 2;  3OYN A;  4N4N B;  1FMV A;  3K70 C;  2X85 A;  1N75 A;  2M0M A;  2X6Y A;  4XL9 A;  4B47 A;  3CP8 A;  3S3N A;  2ELJ A;  3PSF A;  3OIQ A;  1WJC A;  3H9G A;  2RQQ A;  4XKB A;  1EA3 A;  4BQQ A;  2L9N A;  3OL4 A;  4E7Z A;  1YE9 A;  4AU7 A;  3J7A Y;  4XLA A;  3AL0 C;  4ZTJ A;  1MMN A;  4RM2 A;  4ZC3 A;  2DXI A;  1NG6 A;  2IGK A;  1VZ0 A;  2HPI A;  3S32 A;  4PFP A;  2VL8 A;  3OOU A;  2HVQ A;  3F9K A;  3W2W A;  2MC4 A;  3OYG A;  2LY1 A;  4F52 A;  2R7S A;  2XSJ C;  2VQG A;  4OAY A;  1IRX A;  3AL0 B;  1NG7 A;  3DQV C;  4IX7 A;  2KRC A;  2CH0 A;  2HZD A;  2CV1 A;  2A5W A;  2LC2 A;  4BU2 A;  1QHG A;  2HDW A;  2IS4 A;  4E7H A;  3HKZ A;  2VLA A;  4BAC A;  3HC7 A;  4IQ4 A;  4RMN A;  1X1A A;  2WB1 A;  3H5A A;  4XNF A;  2V6E A;  3DU6 A;  2AQF A;  3HOS A;  1Y56 A;  2KP6 A;  3DWL E;  3V42 A;  1DGW Y;  1U0J A;  2M7A A;  3HXL A;  4F55 A;  3OYL A;  4ANJ A;  2R7X A;  4XOR A;  1LFP A;  3K4M A;  3L2R A;  2ZXI A;  2CV0 A;  4BE0 A;  2L9S A;  1Z7L A;  4HPQ A;  2CW7 A;  3RSN A;  2LBF A;  1G59 A;  2F5V A;  3N05 A;  4F93 B;  3AFH A;  2BOL A;  4CSW A;  2PJR A;  3W2V A;  3A1Y A;  4LIV A;  4PJJ A;  2LG4 A;  4E7S A;  3KX2 A;  3PL8 A;  3GBG A;  3EUA A;  4HST A;  1FMW A;  1UG0 A;  3U21 A;  4B48 A;  3L2Q A;  4B44 A;  1UEL B;  2LBF B;  5KCM A;  2DCE A;  4P1W A;  4DGW B;  4E7L A;  4XN3 A;  4Y3O A;  2KHM A;  3DEE A;  5CQG A;  2E1M C;  3CP2 A;  4BEH A;  4DJA A;  4C9Y A;  2PJR B;  4C2U A;  3QYB A;  4Y4R A;  3OR1 C;  3PFY A;  1Z21 A;  4HSR A;  3LSH A;  3EPZ A;  4J01 A;  2R7U A;  2IGO A;  1BR2 A;  2R4G A;  4F3Q A;  4LIU A;  4XQF A;  3S3O A;  3ZRG A;  2KL4 A;  2KMU A;  4BEH B;  2VKH A;  4F92 B;  2IS1 A;  2E1M B;  3W3C A;  4D9J A;  3BLY A;  1JI8 A;  2IS6 A;  2X1C A;  4XOT A;  4C2T A;  3OMY A;  2UV1 A;  4CA0 A;  1WJF A;  4N4O B;  1SAU A;  3PNY A;  2MD0 A;  1PYV A;  4XOP A;  4CCM A;  4CCJ A;  2LRE A;  1BR4 A;  2L7K A;  3SEZ A;  2X1E A;  4ZDO A;  3CZ6 A;  3MMY B;  5LD2 C;  3K4C A;  3VYS B;  3ZQQ A;  2LH9 A;  1V5F A;  3CMM A;  3I9V 2;  2W00 A;  3OYM A;  4PJL A;  4PJN A;  4F91 B;  4PFO A;  4IZZ A;  1ZEL A;  3EUH C;  2MAB A;  2ZSH B;  3ZXS A;  2V4J C;  1P9Q C;  2VXD A;  2GOX B;  2BW3 B;  3K4B A;  4U7B A;  1MMA A;  2W82 A;  3E1S A;  3PUB A;  1DQU A;  4LIT A;  2F4I A;  4RM3 A;  4P5O A;  3VYU B;  3BC8 A;  3L2U A;  4BDZ A;  2XF7 A;  2IGN A;  3RQ4 A;  3VWB A;  3H9J A;  1TZL A;  3OYD A;  3UR3 C;  4D1Q A;  2R7O A;  2CW8 A;  2LOO A;  3VYR B;  2KDO A;  1T0F C;  4E7I A;  3QYF A;  1OR7 C;  3PNV A;  1X4P A;  3RPU D;  3S3M A;  2IS2 A;  3LSK A;  2VB6 A;  2HVS A;  2V26 A;  3DPL C;  2K3P A;  2QKL B;  5KHD A;  1W36 C;  4PSW A;  3S8P A;  4ZDP A;  3BCB A;  5HNF A;  5FRO A;  3I3L A;  4OWR B;  2QKM B;  2Z16 A;  1BOB A;  3PNT A;  2X51 A;  4JOM A;  3MKW B;  2ZXH A;  3IAM 2;  2CS3 A;  1QU3 A;  3SDB A;  2JSP A;  3OWT A;  4C30 A;  2LRD A;  2MYS A;  3OYF A;  2KZV A;  2XDV A;  3OR2 C;  3TL4 X;  1WJB A;  1YX3 A;  3G2B A;  2CFO A;  3FBI B;  4ZTF A;  2WBM A;  2XF5 A;  4R79 A;  1T95 A;  4BE1 A;  2WAE A;  4XLC A;  2XAU A;  4PK4 A;  4BQN A;  4ZDL A;  2M3A A;  4II2 A;  3HOT A;  5CKT A;  3PSI A;  2WY7 Q;  2WAD A;  2WAQ A;  1WJD A;  2AQE A;  3TBI A;  3OL3 A;  3E0J B;  4YRV A;  3OYK A;  3TMO A;  4NC7 A;  1HA8 A;  1LKX A;  3K70 D;  3QOE A;  2CUZ A;  2PMZ A;  1Z3Y A;  3BCA A;  3ZR8 X;  2K9L A;  1LVK A;  3DKX A;  4II3 A;  4KIS A;  1X4O A;  3K4N A;  3DKY A;  3CES A;  4DBR A;  2V7F A;  1WFX A;  4XMY A;  2XC7 A;  3OIP A;  2CMP A;  4QPO A;  4IKF A;  4XLE A;  2VAS A;  2VJ5 A;  3IP4 B;  4E6K G;  4XKC A;  5HOO A;  3RTR A;  1X1C A;  3H0D A;  3ONQ A;  2E5N A;  3OS0 A;  1D0Y A;  2HQA A;  2VJ4 A;  3MKY B;  3H35 A;  1D1A A;  2L5Q A;  2R7V A;  2X6X A;  1E0E A;  4NUB A;  4J00 A;  1OLT A;  2RNG A;  2R7T A;  4XN0 A;  2OC6 A;  4CCO A;  2LYC A;  3LL7 A;  1AA7 A;  3AKZ A;  5KNL A;  2JVG A;  1V5G A;  3DTE A;  2NOJ B;  3OYJ A;  2VJI A;  4DBQ A;  1W36 D;  1R6R A;  1Y6I A;  4FET A;  2E60 A;  3C2G A;  1Z3X A;  4HNT A;  1MND A;  1S9H A;  3SYT A;  3D5L A;  1G8X A;  3MD2 A;  4NQW B;  3VDX A;  2VQC A;  2VPL A;  3DPT A;  2BW3 A;  3KEY A;  4E7K A;  3VYT B;  3A4C A;  5CQE A;  2JUG A;  3HPG A;  1KON A;  2X1D A;  3DTI A;  2BVM A;  4ITV A;  4E4H A;  3H5N A;  3OYI A;  2KPM A;  4NC8 A;  1X19 A;  2WAF A;  1N77 A;  2OUM A;  4DOZ A;  4AYB A;  1DP3 A;  3OYC A;  4B43 A;  1WJE A;  1UAA A;  2KQR A;  3NWT A;  1LDK B;  2M4G A;  2Z1D A;  4XLH A;  4XR6 A;  1N78 A;  2A6T A;  1DGR M;  2HPM A;  2V9K A;  3UNG C;  4HNU A;  2W4S A;  5FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...