3OR2C

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKVTGFKLKQIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or2C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or2C01
2A5WA 2V4JC 1YX3A 3OR1C 1SAUA 3OR2C 2XSJC 1JI8A
chains in the Genus database with same CATH superfamily
3HSFA 1B6AA 1F5TA 1T08B 3GVAA 3TL4X 1OYWA 4I6ZA 3BQZA 3KLOA 2Z5UA 4HYEA 5GP9A 1ZRCA 4JX6A 4HF1A 2WBMA 1QHHD 3A02A 4WXDA 2CQKA 1OCCH 4XKCA 1WI9A 2DBBA 2Y9ZA 1DPUA 3IC7A 2MW8A 4GGGA 3CCQI 4GFBA 5EGOB 2E34A 4LG3A 4A69C 1YO5C 1EH7A 3HZJA 1FMWA 1DGWY 2OQRA 2WB1N 3WGHA 1IN6A 1RR7A 2V4JC 5E1XA 1MNEA 3HGGA 2FNPA 3QPHA 1USTA 5FO5A 2H27A 1T8IA 3GFMA 2NYXA 2L9NA 2LVSA 2P6TA 2A69F 1OCRH 2XAFA 3OIOA 3JAMK 1OCPA 2LSOA 5D6FA 4DBQA 2HNHA 3V7RA 2E1MB 5EDNA 1PYVA 5FKKA 3M3YJ 3WTUC 3WG9A 4D1QA 3L00A 3VFZA 1EH6A 1K83J 1IUYA 3G2BA 3FKIJ 1Z7LA 2VLAA 4O5VA 4S04A 4DZPA 2FEZA 3I5UA 3RZOJ 1XCVA 3CMAI 2L4AA 2ZXWH 3TDUC 5KNLA 2K27A 3FISA 1SFUA 4Q4ZF 2QGUA 4A3GJ 3VSKA 1WVRA 5TRDA 2LTPA 3KETA 1IN8A 1ZGAA 4M3GA 1ZREA 2M7AA 2FBIA 2H8RA 2ZCWA 1DP7P 3G4SI 3H9QA 1W5TA 4IRHA 4EATA 4XLEA 3HBLA 4PCQA 5E8IA 3CC2I 3F8CA 2FRHA 4HG2A 4AIKA 2HXOA 3OYCA 4I7HA 3DPLC 4CO8A 3CCYA 1ITYA 3HRSA 4IX7A 4M3BA 1BJAA 3GFLA 1K61A 3BG5A 1RR8C 1MMDA 2A5WA 5EYRA 1MMSA 2XVCA 5IPAA 3BZ6A 2KIMA 4KYWA 1TNSA 3G73A 3RPQA 2H94A 4A3MJ 3JAMZ 5BPDA 1RESA 2PN6A 1S7OA 4LMYA 1X4PA 4C3IJ 2DOEA 4A0XA 2HQNA 2RN7A 5FKOA 2BHZA 5K7FA 3RDIA 2P5LC 2DU9A 2HQAA 3F21A 3CJNA 2HEOA 4CCLA 3PIOF 1BC7C 1V5FA 1G8XA 4ESJA 2WADA 4KITB 1TWHJ 3SEZA 3OIPA 4HV6A 5E3NA 3M9AA 3S17J 3WHBA 1B9NA 4RB2C 2Z16A 2X1CA 1OR7A 5E79C 1WWXA 3GFIA 4ETSA 2QF7A 4CUGA 3EUAA 2A68F 3KP5A 1MJBA 3TOBA 3IKVA 2OCEA 2WAEA 1SVLA 4S0HB 2XPVA 1FTZA 3V8JA 3P9KA 1IXSB 2GZWA 3DWLE 1LFBA 1XDSA 1N77A 1QQIA 5FROA 3SZGA 3AKZA 2ZBKA 4C2MJ 1F9NA 3PIPF 3DKXA 2X51A 2BVLA 4XRSA 1B59A 2XAHA 2CFXA 1X4OA 3CDHA 2R3SA 2D45A 2FXAA 3GFJA 2L9RA 3DLAA 4EEFG 2P7CB 3FHZA 2FUG2 3GO5A 2L7FP 3JTHA 3PNVA 5A2QK 4Q47A 2A07F 3BCBA 2FMYA 1IF1A 1X1PA 4ZC3A 2XHKA 3TKYA 2GBYA 2IP2A 2ME0A 4XLAA 3CF2A 3KX2A 2DJNA 2L4MA 1ETQA 2ZNYA 3RYPA 1P7IA 4NC8A 5IOYA 4G7HF 3C7JA 4HW0A 3S93A 1WJAA 2E60A 2K86A 1PVEA 3VYRB 3HKZN 3IAS2 1R71A 5F0FA 4II2A 2VKHA 3EUHC 2KFDA 3MKLA 2EFPA 4CICA 2CUEA 2DOAA 3MCZA 1EKEA 5K5QA 4BJ5C 1IN7A 2DA3A 3ZOBA 1ZN2A 3BOQA 5C3EJ 4XM3A 1YI2I 2YS9A 3L9FA 5KK1A 1PUFB 4AC0A 2K9QA 2LR8A 5IP7J 2VKDA 5C44J 2YSRA 5BS6A 2VQLA 3HB9A 2C6YA 1MGTA 5J1YA 1XSXA 4KIFA 2BVMA 1NG6A 2LKXA 2EZLA 1WH5A 3LWFA 4C30A 1HKQA 3K69A 5A2QZ 3LSRA 4E7SA 1FWZA 1RPWA 3LSJA 3LFKA 2H8WA 3I4NJ 3MWMA 2JSPA 3S2WA 4XOPA 5HNHA 2KPMA 1TQMA 1ETVA 2P6SA 4UVCA 3FXRA 4M72A 4XLNF 4KIGA 2LNBA 2ID3A 2PMHA 3OR1C 2LD5A 3UR3C 3KPHA 4B09A 5E8GA 4LB6B 3KCCA 3LSTA 4I76A 5EF6A 3S1MJ 3CF5F 1TWGJ 5E1ZB 2XSDC 2Z1DA 4BQNA 2HDCA 5L3EA 4ZYDA 2HOSA 2N8GA 5AIPA 3HC7A 9ANTA 2KRCA 2MA3A 5L3DA 1IRGA 4KMFA 2F4IA 1IDZA 4BL0B 4P9FA 2MD0A 2ELHA 4E7IA 1YG2A 3JR9A 1MDMB 3OS1A 4KISA 1LKXA 1ZK8A 4NHJA 5IYDJ 3ZQLA 3MAJA 1F43A 3ZN0A 4M71A 3WTTC 1ZG1A 3L1PA 1T0FC 4OU0A 1X2NA 3OY9A 4XKBA 2FMLA 1CQTA 2ZFWA 1UG2A 4BAYA 1WJDA 3HTSB 2IA1A 1F36A 4HA8A 3HOVJ 3DU6A 1IRXA 3IH3A 4OMZA 2A05A 3OV8A 1JHFA 3V7SA 1QO0D 1R1UA 4A6EA 2ZC2A 3L2UA 3SYTA 5LRSA 4A5NA 3ULQB 4RBOA 2HKXA 2R7OA 4G6TB 2FF4A 5HODA 3ABUA 4IQJA 4Z2YA 2A5YB 2LLKA 2Y69H 2KJCA 4H4KC 5CJ9A 1Y39A 1P2FA 3ROUA 2VBZA 2HQ5A 4KT5C 3AL0C 2Q1ZB 2EA4A 3H3UA 5GAGJ 1O3TA 1LQ1A 3R4KA 1NTCA 3H92A 2YU9J 1SAUA 1W7PB 1D8JA 3A0HC 1FLIA 1SC7A 2M45A 4F93B 2E1CA 1IXCA 1VQ4I 2JT1A 2QKLB 4N9HA 2P81A 3NARA 3JRGA 2VJ5A 2KRHA 3DF8A 4LLNA 5IYCJ 4GXOA 6PAXA 1QNTA 1OKRA 3BT9A 4YG2F 3CD6I 4HPQA 2QUFA 3W2WA 3VDXA 1LEBA 4A6DA 2W4SA 4BXFA 4M3EA 2E2HJ 1UG0A 3N4MA 2EK5A 3WU1B 3CO6C 3ABTA 4IO9F 3OSGA 1D3YA 2DDAA 3DEWA 1D0XA 4FE7A 2R7RA 2VOPA 5GADJ 1D8KA 2QSFX 3CUQC 5E18F 4BE0A 3OOPA 1R1VA 1H0MA 1G6NA 1ZH5A 1S8NA 3MMYB 4JOMA 2Y31A 3CLOA 5GAEJ 2ISZA 3MKYB 1WQ2A 4NC6A 2M2EA 3BJ6A 4EJVA 3QPLA 3HOZJ 2QENA 1P4XA 3HTUA 5AIQA 2ICWG 1FBSA 3SDGA 4A5MA 2VJ4A 4BEHA 1AWCA 4Y3OA 5LGTA 4GRIA 3DEUA 2OV7A 3BWGA 1VQ8I 1W36D 4A3BJ 2X9DA 3A01B 2ECCA 4EGYA 2QQAA 3V8LA 3E6BA 2UXXA 1XCBA 1QGPA 2LOOA 3ZQGA 3BTIA 2LG4A 3LMMA 2NNNA 4AYBA 4M9SA 3SXYA 4DYQA 2TDXA 3SJMA 2D5VA 1VQ6I 2V9KA 5FB2A 2JWTA 4V2GA 2YX7A 1LVKA 3HHGA 4RDUA 2OCCH 1N25A 4IRIA 1ON2A 2FOWA 5FJ8J 1U78A 2DPDA 2M8GX 4UVBA 1NHAA 4IXAA 2EIJH 2KIQA 4MQ9F 2ZFUA 3GTQJ 3HXLA 2BY3A 1OFCX 1USSA 5KAFC 1KGSA 4HDVA 4PJNA 2VPLA 2O0YA 2WV0A 4I99C 2EA2A 3SZTA 3TMOA 4MIMA 1J59A 2CUJA 3OYGA 2RREA 3F72A 2R7QA 2JA6J 1VQ5I 1R5HA 2EV5A 3DLLF 2HYFA 1IXRC 4A3KJ 3FWEA 1MDMA 1F4KA 3ASNH 2DAOA 4A3EJ 4AD9A 4BQQA 2RGVA 1E3HA 3PNTA 2DQLA 3C18A 3M4OJ 4DIQA 1Z77A 1A35A 2ZXIA 3W2AA 3I4PA 1UZCA 1BR1A 3E0JB 1Y1WJ 3HDDA 3ZCOA 3QYEA 1YW9A 4D5FA 4BJ6C 1MSEC 4IQ4A 3GF2A 2R7DA 2PFBA 4MO7A 4QLCU 1GDTA 1R4NB 1X1DA 5B5EC 3HL2A 1R9TJ 1UHSA 2F5VA 5TJJA 4RGSA 2M9HA 2OBPA 2JK3A 3E6MA 3LA7A 3HOTA 3V42A 2Z33A 2ZMEB 3S2HJ 3LA3A 1ON1A 2OU2A 2DDBA 2EFOA 1RUNA 2EZIA 2L9SA 1TBXA 1JKRC 5HDKA 3AAFA 2R7TA 2R7SA 1TW2A 1BN5A 2K9NA 4MLOA 4ZYEA 4KDPA 2JQ7A 1FP2A 4BHCA 4LFUA 4HNUA 4RB1A 5CQEA 3I71A 2NVTJ 2RNGA 2CH0A 3M8EA 1FYLA 1W7PA 2CW7A 5LHHA 3MD2A 1SANA 4EGZA 4RAGA 1R23A 3C2GA 4RLFA 2AQFA 4D0PA 5LHGA 3G71I 1E3PA 3FF5A 2EQRA 4RS8A 2IRFG 3CJTB 2IS1A 1BA5A 4XICA 2HDWA 5F04A 1HSTA 5E17F 4A0YA 3JREA 3F8NA 5KCMA 1LUJB 4F3QA 2E2IJ 2NVQJ 3ZQQA 1HOMA 3DU5A 1AHDP 2O5RA 4A3CJ 4B43A 4BKXA 2WTEA 2LMDA 2MFZA 4M6VA 3RKXA 4WXHA 3GTJJ 3OSFA 5CVRA 3RIRA 4BE1A 4ESBA 4AM3A 2DPUA 1FOWA 1GLNA 4PJJA 1R49A 2QBYB 3F6OA 4BBRJ 2LY2A 3JW4A 3FK7A 5M5XJ 1ZLJA 2M87A 4A3JJ 1TNTA 1W36C 2Y30A 2IJLA 4BS9A 3Q9VA 1TTYA 5F0HA 2XPWA 2ACJA 2V7FA 1OQYA 4PUSA 3CO7C 2M4GA 1C0WA 2XUBA 4NQWA 1JGSA 3GTLJ 4WF2A 2R7ZJ 4PDKA 3GZ5A 2GA2A 2Z2SB 1OR7C 5DYMA 5DDGA 3GUDA 2R4GA 4AWXB 5HOOA 2V6EA 3LQRA 3CC7I 3I55I 3CMMA 3EUKL 2DMQA 1WJCA 4BHBA 1BM9A 3WODF 1ETOA 1FMVA 3A01A 2XAQA 2DMTA 2M7BA 2VB6A 2V6CA 3G1OA 4N9IA 4QWQA 3JRHA 1T95A 2W25A 1I5ZA 1XGSA 3HRUA 1VQ7I 2IXSA 3KP3A 1FIAA 2OZ6A 5DUKA 1YW8A 4UUSB 3ZQIA 2R7XA 1BR4A 2OZUA 4KN7X 1Z21A 2HTSA 4NBQA 1X1AA 3F23A 1U8BA 3GMEA 3BTCA 2EBIA 1H9GA 1LDDA 1JTYA 3COAC 3K7AJ 1I3QJ 2L7ZA 4OIRF 3J81K 2WY7Q 2E35A 4P1WA 1XD7A 1B72B 2CFOA 5DD4A 4ENJA 3K70C 4EJWA 4HAMA 2PMUA 3BR3A 1XSDA 1K6YA 1S6LA 3H5RA 4DYCA 2JA8J 1YRNB 4XIDA 2EPFA 2XGEA 1RI7A 1PP7U 3F8MA 1WRJA 3QU3A 4ABZA 4R8HA 3ECOA 1LPQA 5ILSA 5HNFA 5AONA 2VOOA 4U0WA 2F2EA 4UY8I 2VXZA 3ASOH 2ZJRF 2MC3A 3H5NA 4HX4A 2V79A 4LB5A 5ICGA 2E1MC 3NWTA 4ESFA 2CQXA 3WTZA 5L3CA 1GXQA 1U8RA 2RDPA 3EETA 4IHYA 3R0AA 2QQ8A 3CJRB 4G7ZF 1MIJA 4IHXA 3PQKA 1JTXA 1HLVA 3S1RJ 1BBYA 2Y2ZA 2J5OA 3PFYA 4CCKA 2ZMEA 2LDUA 4EJUA 3HSRA 2BBYA 3OS2A 5GAHJ 2XDVA 5D5VB 3TW6A 2VE9A 4RGXA 3SQNA 3TEDA 4B48A 4XLPF 3LAJA 4YEJA 3OMYA 1LFUP 3J81Z 4HEA2 2K9MA 1O4XA 5GTIC 3P9CA 3OIQA 2M1BA 2E2JJ 1B1BA 2WB1A 1AOYA 1STZA 2MABA 3DFGA 1XMKA 2JMWA 3BPXA 2BE5F 3N05A 1BR2A 3QQAA 3IHUA 1ETXA 2KISA 3DTKA 2FE3A 1NG7A 3I59A 3BPVA 2A6HF 4JK1X 4HNTA 2K85A 1A04A 3CCMI 3BY6A 1FBQA 5F27A 3FXMA 1JJ8C 3HUGB 5HDGA 1IAWA 4MEYF 4BACA 1Z0XA 4HV5A 2AS5F 4JBAA 2DTZA 1FYMA 1DGRM 1Y0UA 4BQAA 3OYJA 2HGCA 4D7NA 1VQKI 3LSHA 1J2XA 1SMTA 1OCTC 3K0LA 5LBQA 3FX3A 3OYIA 1K7AA 2ZSHB 4XLHA 3FIWA 3SFZA 5L3BA 4RLQA 1UELB 4UB8C 2X6WA 5HDNA 1HDPA 2ESHA 4I02A 2R92J 2QBYA 2DMNA 2DO7A 3ZMSA 4V2FA 3IV5A 5IT9K 5IY5H 1VQMI 2IS4A 1LEAA 2GXGA 3M07A 4CCOA 3J80K 3CMYA 4CXFA 2ECBA 3BC8A 1IJWC 1X3UA 2VQGA 4FX0A 4G8XA 2BY1A 4HDUA 3A4CA 4YIFA 1H9TA 1KYZA 3IWFA 5JFRA 2OA4A 4Y4RA 1G3WA 2BV6A 2WAFA 2YX4A 3T8RA 1ZRFA 4ZTFA 3E3VA 3F8FA 5F64A 1SEUA 2BY0A 2F6CA 1E17A 2KT0A 1H89C 1FOKA 3OYNA 2O7OA 2DA4A 3JRCA 1ZKGA 3BLYA 1U9NA 4DOZA 2E7XA 4GDFA 3I3LA 3ZGKA 2ETHA 2HS5A 1QPMA 3EDPA 2EILH 1D0ZA 1WJBA 2DA1A 3K2AA 1Z3YA 3RPUA 4UUSA 1JJ6C 1K78A 2MBFA 3RCOA 1FSEA 1HW5A 5M5WJ 1GXPA 1YE9A 2CW0F 3JRFA 1D5YA 2FJ1A 4AU7A 1ZR4A 4J19A 3WTWC 4M74A 1FYKA 2W1OA 3HPHA 2HTJA 5DV5A 2FNAA 1VQLI 3TO6A 1T98A 3JRAA 3T5XA 2PBIA 2W85A 1KQ0A 1B72A 2B9SA 2X1EA 1QVTA 5CKTA 4BY7J 3U9GA 3H0DA 2B7EA 2L9VA 3K1NA 3I54A 2JPBA 4P5OA 1V55H 4YELA 1YRNA 5H2FC 1W7PD 2MYSA 2BEOA 5DS9A 4XRMA 2IGOA 2BZTA 3ZQCA 3CTAA 3ZMDA 5BNGA 4BJTA 3J80Z 2IS6A 1V54H 5IP9J 2WAQN 1S3JA 1OMIA 1OYIA 4N4NB 2YR2A 1LE8A 4IVNA 3OYFA 3ZR8X 3E7LA 5KHDA 2OPTA 4CCMA 3DTEA 2XSJC 4C9YA 4A93J 4RA2A 3V4GA 2O03A 2J5PA 3WU2C 5FRNA 4Q5SF 4HF0A 2VONA 3PM1A 3O8GA 1YJNI 2RQQA 3JRIA 1UB9A 2M8EA 3UNGC 1ZG5A 2F48A 1TT5B 4XLCA 3JSPA 1FZPB 3HOSA 1XMXA 3C2BA 2XGCA 1OCOH 2HVQA 3PUBA 2HQRA 2H6CA 2VBWA 3GX4X 5K1YA 3D1NI 1UHWA 1W0TA 1MBFA 4IRGA 2JA5J 4M73A 3I0TA 3FBNB 1G3TA 2Y48A 4OWRB 5CVIA 2LF8A 2XPUA 1VFCA 1OJLA 2DA5A 4OIOF 2PEXA 1DUXC 1IV8A 1X3WB 2HOEA 4ZDLA 2GLOA 3BZKA 1R1TA 3FMRA 2XASA 3P9IA 4DGWB 1OPCA 4E7JA 4C2UA 4RAYA 2HVRA 1MH3A 2VQHA 1FNNA 3FMQA 5E3LA 1IUFA 1ZLKA 2E5NA 3KEOA 1FC3A 3M1CA 3HUGA 1TW3A 2VC1A 5JHFA 1ZAOA 4L9VA 1IN5A 2JUCA 4BEHB 2LRDA 3H36A 3RQIA 1T56A 2H1LA 5ILUA 1QPIA 1FY7A 4OIQF 2XB5A 2F5CA 5H20A 2VKEA 1LFPA 3GTKJ 1BC8C 1DPRA 1JT0A 2Y0SN 3TGNA 4A3LJ 2X6OA 1DQUA 3TP3A 4OAZA 3FK6A 1JKOC 1TWFJ 5C4JJ 2O61A 1JUMA 1LVAA 3KEYA 4M3FA 4IL6C 2CRGA 2CV2A 2VASA 5FD5A 1S72I 3MKWB 3VPRA 4PSWA 5DCFA 3PQJA 4L5EA 5FD6A 3CC4I 4ZDOA 1GVDA 3D0SA 2IEKA 5ED4A 4LG0B 4Y15A 2F4MB 5JLWA 1JI8A 1QVUA 1BW6A 1ETKA 3HYIA 2KP6A 1P4WA 3FXJA 3Q0UA 2I10A 1F1ZA 4RAZA 5CPRB 1IO2A 1EH8A 4EQQA 2ZJQF 5ICCA 2ZJ2A 2XC7A 1B8IA 2X85A 4KA4A 2KZVA 4AIHA 3FXKA 2DXIA 2L2OA 4L18B 4EM1A 4MTEA 2X0LA 2BXZA 2W24A 2IGNA 5F08A 4FX4A 4ASNA 4MNUA 1KU2A 2CUFA 3G1MA 4DZJA 4YFNF 4C3JJ 1P6RA 2FU4A 2QKMB 1WGXA 4IHTA 4AIJA 4L9TA 4BH9A 5EG0B 2EFQA 2DN0A 2MH9A 1E0EA 1KU7A 3OYDA 1SD6A 3TBIA 2QZ8A 2DK5A 4E4HA 3HOWJ 2O3FA 3T0YA 1R5ID 1XGOA 1BIAA 3KIOA 3GTOJ 1BW5A 3CCRI 4YFKF 4MEXF 4I01A 2JUGA 2HPMA 3GW2A 3KZYA 5HS8A 4A12A 3H0GJ 1X19A 2ISYA 1R22A 2IVMA 2H1KA 2OUMA 4CHUA 2V1XA 1WKMA 2K5CA 1BI0A 2ZKZA 1J7KA 2ID6A 5LRRA 1Y6IA 4ITVA 1H8AC 2DK8A 4Y17A 2XAGA 5CVVA 1S9HA 4G6DA 3ESWB 4BDYA 1FPQA 4GCVA 5H6QA 1V3FA 3L2RA 2UXNA 4EV0A 1WCMJ 2R7UA 1KZHA 2Q8KA 3TQNA 4UVAA 2V1NA 3A1YA 2X6XA 3DCFA 2FBHA 4FCYA 1G3YA 3OYLA 2W00A 1X1CA 3HOUJ 3L2WA 2CV0A 1J9IA 5HVQC 3BR2A 3ZP5A 2EINH 4U0VA 1NK3P 3PUFA 2YPRA 2CS3A 1MJAA 3SEQA 3FXQA 4PFOA 2UWMA 4FTHA 1R00A 4D7MA 4O6JA 2STWA 2GAUA 3NEUA 4F92B 3R61A 2W7NA 4HLYA 2FSWA 1UMQA 3HOYJ 3ERMA 2M34A 1Y8QB 5GPAA 3U2RA 2X48A 1ZG3A 1A6QA 2GOXB 3H3ZA 2W57A 1WJEA 3HJEA 4MFDA 3I53A 1XSVA 3QOPA 4NQWB 1FEXA 2LC2A 3C3WA 1E2XA 3K4KA 3L2VA 5KAIC 3RPUD 3T8TA 4E7KA 3S1QJ 2FD5A 1I50J 3IL2A 3FM5A 1XN7A 4KJZA 3I64A 1QRYA 2PMZN 2Q2EB 3R60A 1KQ9A 3WGIA 1HKTA 2G9WA 2KLOA 2VODA 3WU0A 1WI3A 4YRVA 2V1UA 4JX5A 5IT3A 2XROA 1LNWA 1ZGJA 1SFXA 3CUOA 1DDNA 4ZYGA 3FXOA 4U88A 2BGCA 5J6XA 4CZZA 2YU3A 1I3AA 4PGGA 1FIPA 1V5GA 5M3MJ 3CP2A 2K7LA 1YX5A 1BI2A 2LF7A 4LG0A 2W48A 5K5RA 1J5YA 3E5UA 2ELKA 2MLKA 2PG4A 4HSRA 5FLVA 2ZMEC 2KL4A 2L5QA 2VUMJ 2CJJA 3K4JA 2A3SA 4HBLA 5EEHA 3D5LA 1FX7A 2CU7A 2NVXJ 2DA6A 3H9GA 2KRFA 1VQPI 2HOAA 4LGWA 4M9XA 4WWCA 2F5FA 4NUBA 1YYVA 3QAHA 3LFUA 2I8DA 3R6SA 1R5GA 1HW1A 5J8FA 2BY2A 1EV7A 2ZSIB 4B3XA 2CGPA 5JHUA 1D1BA 2ESNA 5BOXA 2M4KA 3I9V2 2Q0OA 1R4MB 4U0YA 3DXJF 1GV5A 1XX5A 2DODA 3I58A 1WH7A 3F9KA 5EG0A 2VPRA 1XPXA 2LFBA 3S8PA 2W82A 1A6IA 4CZCA 1VQNI 2RAEA 2HKOA 3EQLF 5D8LB 5JVTA 1IDYA 3Q9SA 4B47A 3OL4A 2GOMA 4MTDA 2EFWA 4XN0A 3DBHB 3CCSI 1ONVA 2KZGA 3DEEA 2UV1A 3GTPJ 3QWLA 1ZR2A 4QPOA 4I2OA 3GXOA 2A6EF 1BL0A 3SHFA 2RKHA 2ZXHA 3OR2C 3DBLB 1HW2A 3GTMJ 2BHYA 3LSPA 3PO2J 1MW7A 3WTSC 3IUOA 1FSHA 2L02A 3P7NA 3DQVC 5EZHA 2JTVA 3WG7H 2L0KA 3LA2A 1WZ2A 1JHHA 5HLIA 1MH4A 1YW7A 2E1NA 1XGNA 2DQRA 3AG1H 4JX4A 1K4SA 1AU7A 2R5ZB 3I59B 2ELJA 4XONA 4EM0B 4FASD 5E1WA 3WHCA 2WV1A 1LDJA 2FA5A 3BQYA 4Y13A 1MBGA 3GZ6A 5LD2C 3F6VA 4G7OF 1KQ8A 4XL9A 4B3AA 2IPQX 4K2EA 3QPTA 2KKOA 2RVCA 1NK2P 3O8HA 4KFCA 2LY1A 2NAZA 5JR3A 3ZQHA 2QVOA 4B4CA 3GWZA 4XR6A 1D1AA 3OS0A 4ZZLA 1QHGA 1X2MA 4N0BA 5ICFA 5JLXA 2EWNA 2OF7A 1Z9CA 3KYCB 1UFMA 3GCMA 3FHNA 3PNYA 4FETA 3MQ0A 1IW7F 1HF0A 3QP5A 3E97A 4CCNA 2DOFA 1U0JA 2DA2A 4LITA 5BMZA 1HCRA 1SVOA 5D5WB 3ELKA 4WK8F 5CVUA 5FKLA 3S2DJ 2R7VA 2L54A 4XNFA 2O6GE 3MZYA 3NRVA 1W5CC 2NXNB 3C1DA 4MGRA 3RJPA 2DTRA 1VF9A 3BR6A 4PJLA 2VBXA 2CQQA 5FFXA 5L3GA 3I56I 1QZZA 3ZPLA 2CUZA 2Q2EA 3EYYA 2K9LA 4ZYAA 4XORA 1BOAA 3L09A 3W3CA 1SVMA 4UV8A 4Y52J 1IRZA 4IF4A 3ZQFA 1HC8A 3JCUC 3M8JA 2FQ3A 3BP8A 3GLLA 4IJAA 2CQNA 4OOIA 4A3FJ 1BJZA 1K78B 5J8CA 3FXUA 2IT0A 1WJ5A 2OJED 1FP1D 3J7YJ 3KP4A 1E3OC 4HF2A 2DFIA 1KONA 5D4RA 3S3OA 1U6GA 1REPC 1W4MA 1Y1VJ 2JVGA 4FE4A 3K4MA 1T2KA 4B1RA 3CCVI 4UNOA 3ZMTA 2BXYA 2KQRA 3D5RC 3ONQA 2XGXA 1QZYA 2XKPA 4IEJA 2CSOA 3LSIA 2OD5A 4XKWA 1I6XA 4R1HA 1R7JA 1Z05A 4EJOA 4RB3C 3CUQA 1LJ9A 1RRJA 2HR3A 4EM2A 4E6KG 1OCZH 3R0JA 5LLQA 1LE8B 4QIWN 5CLSA 2E71A 2QWWA 1SFOJ 4BU2A 2PJRB 3DP7A 1ODDA 1T38A 1U5TB 3VYTB 5B3SH 1TQIA 5D5XB 2O8XA 1EA3A 4BNCA 1HQCA 5K7ZA 4WX9A 1XS9A 4P9UA 1YIJI 1TQPA 1YFHA 2LP0A 2M3AA 5K7HA 1K4TA 4UUTA 1WPKA 3K1MA 2P5KA 2VQCA 4E7ZA 2KIFA 3QYBA 2KHMA 1J75A 4HX8A 1RUOA 2GWRA 4LK1F 5D8KB 2K02A 3BDDA 2IW5A 1SAXA 1XC5A 3TO9A 1VQ9I 2A6TA 3IP4B 1MD0A 2HYGD 4P55A 2Y0MA 3QRFF 2HU9A 1QU3A 2GM4A 3F3XA 4L0ZB 2NS0A 1XG1A 1X3ZB 3FKJA 5ERIA 2LBFA 5E20A 2R5ZA 4YFXF 3L2CA 3HHHA 3LNQA 5EEGA 3U1DA 3FZVA 3OWTA 4AUXA 4ON0A 4B8XA 4J00A 1H88C 1QBJA 3W6KB 1SFKA 1U9OA 1RIOH 3RKYA 4GYIA 3AFHA 4UV9A 3E1SA 3IRQA 2DFHA 3LQQA 2CG4A 1POGA 3ABLH 2GA1A 3H35A 4CH7A 4Y7NJ 4LIVA 2NOJB 2X4HA 3U1KA 1ZGWA 1S7AA 4KNYA 3HSEA 1N78A 2JRTA 3BJOA 2ZXJA 3RZDJ 3A03A 2O9LA 2JJ7A 1MMGA 1VI0A 5LGUA 4V19K 1P4AA 2M0MA 2PX9A 2O8KA 3JTGA 1L3LA 1AA7A 2QM3A 3ECHA 1O7FA 4BDZA 1I1SA 2GIVA 2BYVE 2NVYJ 4G12A 2QQ9A 1G4DA 5D4SA 2XRNA 4CDGA 4RMNA 4EVIA 3B6CA 1N75A 1QZEA 2EIMH 2VXDA 3W2VA 1JXSA 2Y9YA 3RSNA 3GTGJ 3S16J 3VSLA 2XGDA 3VB2A 1GHCA 4NNJA 3FM3A 1JE8A 4PFPA 2OQGA 3KP7A 5B1BH 2MSYA 3BG7A 3JRBA 1B8IB 5B66C 1RKWA 3RQ4A 4JQFA 3BJAA 2V1DA 3WTYC 3VOEA 4J01A 1I1GA 3CZ6A 5LEKA 3VWBA 4L5JA 3EPZA 1AKHB 1FOXA 1KYWA 2G0EA 1RKTA 2FOKA 2QLZA 2RC4A 3HM5A 3G6EI 4UUVA 2WY8Q 1JKPC 1IZ1A 2IGKA 2NNYA 3HGYA 3ML6A 2L7MP 3O3KA 5ILVA 1YS7A 4RGUA 4CYDA 2R7FA 1A31A 5C4XJ 2DT6A 1R58A 4CCJA 2LY9A 5E3OA 2DMUA 2VI6A 4CYCB 1G59A 3V8KA 3RKQA 3CDIA 5TGTA 1Z67A 2VIXA 4OAYA 2MGQA 2H6BA 3S14J 1XTAA 3Q3SA 1MZBA 3DBRB 4PK4A 2K3PA 4U87A 3ABMH 2QA4I 5IT9Z 3ABKH 2HOTA 3FBIB 3ZXSA 2GQQA 3RYRA 1X58A 3KE2A 4MHGA 5FRMA 1Z6TA 3G3ZA 1BIBA 1OLTA 1CF7B 2FBKA 2COMA 4GYGA 1MBEA 2XV4S 2M5WA 2PJRA 3T1BA 5IP6A 3F0CA 4HQMA 2CWEA 2LH9A 2WAQA 1GVJA 2WA0A 1U5TA 3H1CA 1IV6A 4YIIA 1TWAJ 2AXTC 1A5JA 2EV6A 2DYSH 2IA2A 2KIUA 1PP8F 1S5LC 4O3MA 3KLNA 5CYVA 4AVZA 3DPTA 2GIZA 1YX3A 3B73A 3Q0VA 2L01A 4BGDA 3B6AA 2NVUB 4R79A 5FGMA 1HKSA 4YIRX 1ZRDA 2ZJPF 1ZTRA 1SD7A 2K4JA 2AO9A 2LREA 1D0YA 1MNDA 4ANJA 3FDYA 1KA8A 3PSFA 3BZCA 4IOAF 3LSGA 2W84A 2EIKH 3QPSA 3REOA 4BXXJ 2NOGA 1IRFA 3KEQA 2IA0A 2EZHA 3PFIA 3DKWA 2GXAA 2XF6A 4QTRA 2OC6A 3P5JA 2XIGA 3LSMA 5BPIA 2NS7A 1APLC 2TCTA 2K3FA 3CDLA 2P8TA 3HKZA 2M30A 3HRTA 3S32A 5EGOA 3WGGA 4MFEA 4Q48A 4KIBA 4XLFA 3HPGA 1D1CA 5FLMJ 3TP0A 4A3IJ 4OIPF 1RETA 1YQAA 5L3FA 3BR5A 4IPAA 3J7AO 3K1PA 4BYYA 1SD5A 5J4YA 3FMSA 4HSTA 3E6CC 3VYSB 1S29A 4WXCA 5DEQA 4W97A 2L7KA 2AHQA 2PLYA 5J40A 2H09A 3RKWA 2QQBA 3C2HA 2TRTA 1YHQI 3GEZA 2OAZA 3UKGA 1HSJA 2L3DA 3ISPA 2JPCA 3QYFA 4L5IA 2VT3A 4NDLA 4E7LA 1B4AA 3MFKA 3KZZA 3AG4H 3F22A 3CCJI 2E7WA 2JVHA 1P9QC 3BTJA 2Y0SA 1CGPA 2CYYA 4XMYA 1I6HJ 2P5VA 1M1EB 1Z3XA 1WJFA 4E7HA 1ZARA 4ZTJA 1TP4A 3QOEA 4BUPA 4CA0A 5E3MA 4KMUX 3SDBA 4B44A 2DLLA 1SD4A 5LFAA 4C3HJ 3IKTA 3HEFA 3NQOA 4H0EA 5DM6F 2ZB9A 1JUPA 4XBFA 1W1WE 3TOAA 4FHTA 2XF5A 2V9VA 3RI4A 3CQZJ 3BG3A 2B63J 2VN2A 1BI1A 2ME6A 1AKHA 2JRMA 4ZJZA 4NC7A 4X0GA 1ORKA 4KT6A 1K79A 1ZHFA 1PJRA 3IAM2 1UHMA 2KDZA 2EJRA 4XKVA 5HLHA 2JSCA 5KVRA 4DJAA 4LK0F 5M3FJ 2IBDA 4L9NA 5HLTA 5FKMA 4PGHA 5F6FA 4CSWA 4HX7A 1WFXA 2XAJA 5F0CA 1IN4A 1BOBA 5DM7F 3CCUI 2EFNA 4G94A 4Z6YA 1Q1VA 4CYCA 4LD5A 4I09A 3AG3H 3ZRGA 1PUEE 4A0ZA 2B0LA 3GYHX 1XB4A 5FLXK 3K9TA 2DW4A 2DT7B 3BCAA 4Y33A 2VE8A 3ZMUA 4XK4A 3F8BA 2RQPA 3X2QH 1O7LA 1MBHA 3JSOA 2E1OA 3E6DA 2HVSA 2D1HA 4HNVA 2PI0A 2V26A 3KP6A 4D5CA 3TO7A 1G2HA 2COBA 2XAUA 2QYOA 2FQ4A 4JP0A 2VL8A 4PSXA 5DD8A 1UCRA 1CF7A 5ICEA 1ETWA 4AIDA 3SFIA 3DPUA 4LLLA 4WCGA 4DQ2A 1GUUA 3BTLA 4BBSJ 1WHUA 4IHWA 2MD5A 2CMPA 5DTDA 5F1JA 4FISA 4F7ZA 1IG7A 2HZDA 3KP2A 3MEXA 3Q0WA 5BQTA 3GBGA 2IAIA 1J09A 1TLHB 4IHSA 4BXUA 4LIUA 2DJIA 1ULYA 4KUMA 2X1DA 1MSFC 5J4VA 4ZDPA 3FXLA 4G9YA 1SMYF 2XF7A 3PL8A 3E5XA 2VBYA 5GTHC 2BW3B 2X6YA 2JA2A 1YOVB 1IGNA 1Z1DA 3ZQ7A 1MJ9A 1Z7UA 4XRFA 1O3QA 4F52A 4ENNA 1RNLA 2PQ8A 4OINF 1VNDA 3S1NJ 5FLXZ 2QCOA 1FJLA 2CV1A 4JYKA 1KU9A 4IKFA 4HRIA 4DW6A 4F91B 2WC2A 3OYMA 3PJRA 3O6BB 3CCEI 4G6QA 1TT0A 2LYCA 4FT8A 4L9JA 3B02A 3HRMA 2VJIA 2Z3YA 1V4RA 4EMSA 3J7ZI 3SZPA 3S3NA 1XMAA 4XOTA 1HA8A 1I27A 1DU0A 1T33A 3QODA 3HOXJ 4IZZA 2DFEA 3HIFA 5HLGA 1YJ9I 3GLXA 1TZLA 2P4WA 4E70A 3H3VK 2NRAC 4II3A 4EJTA 3K2ZA 4DBRA 1HXDA 2DT5A 2IGMA 3AL0B 3BR1A 2HWVA 5GPCA 4KICA 4QSHA 5CVJA 5TISC 1PUFA 3Q5FA 2PMZA 1O3SA 1FBUA 4BY1J 4XQFA 3RTRA 4P96A 1JGGA 1ENHA 2R5YB 3IH4A 4I0AA 1MBKA 3KFWX 1SFEA 1TC3C 2D1VA 3LL7A 1T6SA 1VZ0A 4NB5A 1P92A 4PJMA 5JVGF 3VODA 1VTNC 4I0BA 1R6RA 1VQOI 4AYBN 4XSXF 1W0UA 3IRRA 5D6EA 1Z91A 2DA7A 3EUHA 5HS7A 2A61A 3MVPA 1ZQ3P 1B9MA 3DV8A 1WSUA 1P7JA 3DKYA 3KYDB 3CUQB 1MMNA 3S15J 1HBXG 5F1RA 2JN6A 2DFFA 3H5AA 3OYBA 4IOCF 2IS2A 1UAAA 2VT2A 4ENKA 3TDZC 3A0BC 4FQGA 5DCMB 5H6RA 3TW7A 3LAPA 1MBJA 3NAUA 1W5SA 1BI3A 4HLXA 3BG9A 2OTJI 1YTYA 1Y0NA 3VYUB 1FTTA 4DYRA 2DYRH 5LHIA 3BROA 4UXNA 1DU6A 2Z99A 5FKNA 3CJQB 1MMAA 4HZFA 3OYHA 3U21A 4RAFA 1U2WA 2VKVA 3JRDA 1ZELA 3OYKA 3K70D 3K10A 2DCEA 2JZYA 2EH3A 1T39A 5HS9A 4I98B 3QP6A 3W6VA 5DUIA 4L0YB 2MC4A 3MN2A 1RC9A 1XDUA 3IWZA 5B1AH 2KMUA 3NWSA 5IYBJ 1FT9A 1K6OA 1LB2A 1O3RA 1LDKB 3V7CA 2EZKA 2R7WA 2HYJA 3LOCA 1V5EA 3CLQA 3E5QA 3WE2A 5M5YJ 2LBFB 5IOZA 3K4NA 2HZTA 5J1UA 4RGRA 2AXLA 3PSIA 1GV2A 1D5VA 2VC0A 1S7EA 1PDNC 1MKMA 1G3SA 2KDOA 4M3DA 4ZYHA 3ERED 2LK2A 1QA6A 4LJZF 1YJWI 2M0CA 3ZN1A 4PZJA 4U7BA 2G7UA 2AQEA 3W6JB 2BW3A 1ZYRF 2K9SA 2Z9OA 2ADUA 1EF4A 5LGNA 2XKOA 3MZ8A 4QPQA 2RNJA 2DI3A 3PO3J 1O57A 1T0FA 2MG4A 2XRLA 4KN4X 2CW8A 3K4CA 2P0WA 1R36A 3HG9A 4LLGF 3BG6A 3H9JA 2K40A 1NH3A 1Z6RA 3K4BA 1Y8RB 2K4BA 3CMEI 3QU6A 4BHPA 5D5UB 2NS8A 3S3MA 3MZHA 1ETYA 1YIOA 3VEPA 1XGMA 3CP8A 3ZMZA 3A2KA 2G7HA 2OTLI 2VJJA 3CCLI 4BQOA 3GZNB 1HDDC 4UHTA 3J7AY 2HXIA 4F55A 1JT6A 2ZNZA 4A3DJ 1KU3A 2UZKA 2Y75A 3OOUA 4ZH4F 1L0OC 2QSHX 1Y56A 2GXBA 5EEAA 2CO5A 1TL8A 4RB0A 1OISA 3N97A 2DMPA 2YUSA 3DTIA 4UB6C 3WE3A 4ZZDA 5LEJA 4XN3A 1EJ9A 4M6YA 4D9JA 1JKQC 2V9PA 1ACIA 3L7WA 4GO1A 2BOLA 3D5SC 1U5TC 3M8FA 1DP3A 3MKZA 3L2QA 2D2WA 1UJ8A 2R5YA 1TWCJ 3OYEA 1J0RA 1JUSA 2QSGX 1Q1HA 2E19A 4X6AJ 2CQ7A 4RM3A 2E36A 5K5OA 5J1RA 4PJ0C 3OL3A 5J47A 5JI6A 3BR0A 2HFHA 2P7VB 2ZO4A 4DNCA 2R0QC 2HDDA 2HPIA 3EYIA 2KJBA 4HOBA 5CQGA 3OYAA 3M1EA 2STTA 2EV0A 4XRSG 3G1LA 4RM2A 1GT0C 1RZ4A 1MNMC 4N4OB 1IC8A 5EZGA 3KYLA 1A36A 1U3EM 4X1EA 3K6GA 3LSKA 2F5EA 2FX0A 4MQVA 3WTXC 1YS6A 3WTVC 5J3LA 4OMYA 4C2TA 1OYYA 4M6XA 4XSZF 2I5UA 2EB7A 2F4OB 5FFZA 4U7DA 2QEXI 3ZMVA 2UUZA 2LKPA 4M9ZA 2PJPA 4S05A 5DCMA 3I4MJ 2E5ZA 2R93J 3M7GA 2WWYA 4BE2A 1ERDA 2MH2A 2JA7J 4TV7A 3O2PE 2XB0X 3IH2A 3KZIC 5EJCA 4W1UA 2F5DA 1YITI 4LOCA 4IHVA 2HI3A 3CESA 4A2UA 4CGZA 1YLFA 4HQEA 1I39A 3AG2H 2LKSA 2MLGA 4ENMA 4AVPA 3K4LA 2RV8A 1FOYA 1X1BA
chains in the Genus database with same CATH topology
4AVZA 3DPTA 1YX3A 2F5VA 2OUMA 3HOTA 3TL4X 3V42A 4BGDA 2K5CA 4R79A 2WBMA 1QHHD 1Y6IA 4ITVA 4XKCA 2L9SA 2R7TA 2LREA 2R7SA 4MLOA 1D0YA 1MNDA 1S9HA 4ANJA 3FDYA 3PSFA 4HNUA 3LSGA 4BDYA 4LG3A 5CQEA 2RNGA 1FMWA 2CH0A 3L2RA 2R7UA 2XF6A 1DGWY 2OC6A 3LSMA 2V1NA 3A1YA 2X6XA 2CW7A 3OYLA 2W00A 1X1CA 3MD2A 2V4JC 3C2GA 3L2WA 2CV0A 4RLFA 5HVQC 1MNEA 3HKZA 3S32A 2AQFA 2CS3A 3SEQA 2IS1A 2L9NA 4PFOA 4XLFA 2UWMA 3HPGA 1D1CA 2HDWA 5KCMA 4F3QA 4DBQA 3ZQQA 2HNHA 4F92B 2E1MB 3DU5A 2O5RA 1PYVA 2W7NA 4B43A 2MFZA 4D1QA 4HSTA 3G2BA 3VYSB 2GOXB 1Z7LA 4NQWB 2VLAA 1WJEA 4BE1A 2L7KA 2LC2A 1GLNA 4PJJA 3K4KA 3L2VA 3C2HA 2LY2A 5KNLA 3RPUD 4E7KA 1W36C 4BS9A 3VSKA 4KJZA 2V7FA 2Q2EB 4PUSA 2M4GA 3QYFA 4E7LA 2M7AA 2KLOA 2JVHA 1P9QC 2Y0SA 3H9QA 4YRVA 2Z2SB 1OR7C 4EATA 4XMYA 2R4GA 4XLEA 5HOOA 2V6EA 1Z3XA 1WJFA 4E7HA 3CMMA 3EUKL 4ZTJA 4HG2A 1WJCA 3OYCA 3QOEA 4BUPA 4CA0A 3DPLC 3SDBA 1FMVA 4B44A 5LFAA 2M7BA 2VB6A 4IX7A 1V5GA 3CP2A 1YX5A 1T95A 2XF5A 1MMDA 2A5WA 2IXSA 2R7XA 1BR4A 4HSRA 4ZJZA 4NC7A 1Z21A 4X0GA 2KL4A 1X1AA 4KT6A 2L5QA 3IAM2 1PJRA 3K4JA 4XKVA 4DJAA 3D5LA 1X4PA 2WY7Q 5HLTA 3H9GA 4P1WA 2CFOA 4CSWA 1WFXA 1BOBA 4NUBA 3K70C 2HQAA 3LFUA 2I8DA 1K6YA 3ZRGA 3H5RA 2ZSIB 4CCLA 4B3XA 1V5FA 1G8XA 1D1BA 4Y33A 2DT7B 3BCAA 2M4KA 3I9V2 2WADA 4KITB 3F9KA 3SEZA 3OIPA 2W82A 3S8PA 4CZCA 2HVSA 5HNFA 2V26A 4B47A 3OL4A 2Z16A 2X1CA 2GOMA 2XAUA 2VXZA 4XN0A 2VL8A 4PSXA 3H5NA 4CUGA 3DEEA 2UV1A 3EUAA 4QPOA 3DPUA 2E1MC 3NWTA 2WAEA 2CMPA 3DWLE 1N77A 2ZXHA 5FROA 3OR2C 3SZGA 3AKZA 3DKXA 2HZDA 2X51A 3CJRB 2BVLA 1MW7A 3IUOA 1X4OA 3GBGA 3DQVC 3PFYA 1J09A 3DLAA 4CCKA 2FUG2 4LIUA 2DJIA 3PNVA 3OS2A 2X1DA 2XDVA 3BCBA 4ZDPA 4B48A 2XF7A 3PL8A 2BW3B 2ELJA 2X6YA 3OMYA 4HEA2 2K9MA 4XONA 4YEJA 4ZC3A 4FASD 2JA2A 3OIQA 4XLAA 3CF2A 2WB1A 3KX2A 5LD2C 2MABA 4F52A 3N05A 4XL9A 4NC8A 1BR2A 3S93A 1WJAA 2E60A 3VYRB 3DTKA 3IAS2 1NG7A 4HNTA 2LY1A 2CV1A 4II2A 4IKFA 4HRIA 2VKHA 3EUHC 4F91B 4XR6A 3OYMA 1D1AA 3OS0A 3PJRA 1QHGA 2DOAA 1TT0A 2LYCA 4BJ5C 3HUGB 4BACA 3FHNA 2VJIA 3PNYA 4FETA 1DGRM 4XM3A 3OYJA 4CCNA 1U0JA 3S3NA 3LSHA 4XOTA 1HA8A 4LITA 2VKDA 3QODA 3OYIA 4IZZA 2ZSHB 2R7VA 4XLHA 1TZLA 4RLQA 1UELB 2VQLA 4XNFA 2X6WA 4II3A 4DBRA 2IGMA 3AL0B 4PJLA 2PMZA 2BVMA 1NG6A 2IS4A 4CCOA 4XQFA 2CUZA 3RTRA 3BC8A 4C30A 2K9LA 4ZYAA 2VQGA 4XORA 4E7SA 3W3CA 3A4CA 3LL7A 1VZ0A 4Y4RA 2JSPA 4PJMA 4XOPA 2WAFA 5HNHA 2KPMA 1R6RA 3M8JA 4ZTFA 2F6CA 3OR1C 3OYNA 3UR3C 1WJ5A 3BLYA 4DOZA 1KONA 3I3LA 3ZGKA 3S3OA 2Z1DA 4BQNA 1D0ZA 3DKYA 1WJBA 1MMNA 1Z3YA 2JVGA 3K4MA 3RCOA 3HC7A 2KRCA 1YE9A 2KQRA 3D5RC 3ONQA 4AU7A 3H5AA 3OYBA 2W1OA 2IS2A 2F4IA 1UAAA 3LSIA 3HPHA 4BL0B 4XKWA 2MD0A 4E7IA 3OS1A 4KISA 1LKXA 2X1EA 3VYUB 4E6KG 5CKTA 3H0DA 1T0FC 4YELA 4P5OA 3OY9A 4XKBA 2PJRB 4BU2A 2MYSA 1WJDA 2IGOA 3CJQB 1MMAA 3OYHA 3U21A 3DU6A 1IRXA 3VYTB 4BJTA 2IS6A 1EA3A 1ZELA 3OYKA 3K70D 3K10A 2DCEA 4N4NB 3OYFA 3SYTA 3L2UA 3ZR8X 5KHDA 4CCMA 2MC4A 2M3AA 3DTEA 2XSJC 2R7OA 4G6TB 4C9YA 2KMUA 3NWSA 5FRNA 2VQCA 4IQJA 4E7ZA 3QYBA 1LDKB 2KHMA 2RQQA 3UNGC 2R7WA 1V5EA 2LBFB 4H4KC 4XLCA 3K4NA 3HOSA 2A6TA 3AL0C 3IP4B 2Q1ZB 2HVQA 1SAUA 3PSIA 3PUBA 2HU9A 4F93B 1QU3A 2KDOA 2QKLB 2VJ5A 4U7BA 3FKJA 2KRHA 2LBFA 3FBNB 2AQEA 2BW3A 4OWRB 4HPQA 4QPQA 3OWTA 3W2WA 4J00A 4ZDLA 3VDXA 2CW8A 3K4CA 2W4SA 2P0WA 3HG9A 4BXFA 1SFKA 4DGWB 1UG0A 3AFHA 3BG6A 4E7JA 3E1SA 3H9JA 4C2UA 2HVRA 1D0XA 2R7RA 2VQHA 3K4BA 3H35A 4CH7A 4LIVA 2NOJB 3S3MA 2E5NA 4BE0A 3M1CA 3MMYB 4JOMA 3A2KA 3CP8A 5JHFA 1N78A 2VJJA 4BQOA 1MMGA 4BEHB 2LRDA 3MKYB 2M0MA 3J7AY 4F55A 1AA7A 4BDZA 3OOUA 1LFPA 4RMNA 1Y56A 1N75A 2VJ4A 2VXDA 3W2VA 1DQUA 4BEHA 3RSNA 4OAZA 4Y3OA 3DTIA 4GRIA 3VSLA 2OV7A 4XN3A 3KEYA 4NNJA 4D9JA 1W36D 2CV2A 2BOLA 2VASA 4PFPA 3D5SC 3MKWB 1DP3A 3BG7A 3MKZA 3L2QA 4PSWA 3OYEA 3RQ4A 4JQFA 4ZDOA 2LOOA 4J01A 1JI8A 3CZ6A 2LG4A 3VWBA 4RM3A 3LMMA 3EPZA 4AYBA 2KP6A 3OL3A 5CPRB 2V9KA 2WY8Q 1LVKA 2IGKA 2HPIA 2XC7A 2X85A 3OYAA 5CQGA 2KZVA 2DXIA 4RM2A 2L2OA 2DT6A 4N4OB 2ZFUA 4CCJA 3HXLA 2IGNA 3KYLA 1G59A 3K6GA 3LSKA 5TGTA 4PJNA 2VIXA 2VPLA 4OAYA 3TMOA 2QKMB 4C2TA 2CUJA 3OYGA 2RREA 2R7QA 2K3PA 4PK4A 4U87A 2UUZA 2E5ZA 3FBIB 3ZXSA 4BE2A 1ERDA 1E0EA 4BQQA 5FRMA 3PNTA 3OYDA 3TBIA 4E4HA 1OLTA 4DIQA 2ZXIA 3CESA 3W2AA 1BR1A 3E0JB 2PJRA 3ZCOA 3QYEA 2LH9A 2JUGA 2WAQA 2WA0A 3K4LA 4IQ4A 4BJ6C 2HPMA 1X1DA 1X19A 3HL2A 1X1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  2V4J C;  1YX3 A;  3OR1 C;  1SAU A;  3OR2 C;  2XSJ C;  1JI8 A; 
#chains in the Genus database with same CATH topology
 3HSF A;  1B6A A;  1F5T A;  1T08 B;  3GVA A;  3TL4 X;  1OYW A;  4I6Z A;  3BQZ A;  3KLO A;  2Z5U A;  4HYE A;  5GP9 A;  1ZRC A;  4JX6 A;  4HF1 A;  2WBM A;  1QHH D;  3A02 A;  4WXD A;  2CQK A;  1OCC H;  4XKC A;  1WI9 A;  2DBB A;  2Y9Z A;  1DPU A;  3IC7 A;  2MW8 A;  4GGG A;  3CCQ I;  4GFB A;  5EGO B;  2E34 A;  4LG3 A;  4A69 C;  1YO5 C;  1EH7 A;  3HZJ A;  1FMW A;  1DGW Y;  2OQR A;  2WB1 N;  3WGH A;  1IN6 A;  1RR7 A;  2V4J C;  5E1X A;  1MNE A;  3HGG A;  2FNP A;  3QPH A;  1UST A;  5FO5 A;  2H27 A;  1T8I A;  3GFM A;  2NYX A;  2L9N A;  2LVS A;  2P6T A;  2A69 F;  1OCR H;  2XAF A;  3OIO A;  3JAM K;  1OCP A;  2LSO A;  5D6F A;  4DBQ A;  2HNH A;  3V7R A;  2E1M B;  5EDN A;  1PYV A;  5FKK A;  3M3Y J;  3WTU C;  3WG9 A;  4D1Q A;  3L00 A;  3VFZ A;  1EH6 A;  1K83 J;  1IUY A;  3G2B A;  3FKI J;  1Z7L A;  2VLA A;  4O5V A;  4S04 A;  4DZP A;  2FEZ A;  3I5U A;  3RZO J;  1XCV A;  3CMA I;  2L4A A;  2ZXW H;  3TDU C;  5KNL A;  2K27 A;  3FIS A;  1SFU A;  4Q4Z F;  2QGU A;  4A3G J;  3VSK A;  1WVR A;  5TRD A;  2LTP A;  3KET A;  1IN8 A;  1ZGA A;  4M3G A;  1ZRE A;  2M7A A;  2FBI A;  2H8R A;  2ZCW A;  1DP7 P;  3G4S I;  3H9Q A;  1W5T A;  4IRH A;  4EAT A;  4XLE A;  3HBL A;  4PCQ A;  5E8I A;  3CC2 I;  3F8C A;  2FRH A;  4HG2 A;  4AIK A;  2HXO A;  3OYC A;  4I7H A;  3DPL C;  4CO8 A;  3CCY A;  1ITY A;  3HRS A;  4IX7 A;  4M3B A;  1BJA A;  3GFL A;  1K61 A;  3BG5 A;  1RR8 C;  1MMD A;  2A5W A;  5EYR A;  1MMS A;  2XVC A;  5IPA A;  3BZ6 A;  2KIM A;  4KYW A;  1TNS A;  3G73 A;  3RPQ A;  2H94 A;  4A3M J;  3JAM Z;  5BPD A;  1RES A;  2PN6 A;  1S7O A;  4LMY A;  1X4P A;  4C3I J;  2DOE A;  4A0X A;  2HQN A;  2RN7 A;  5FKO A;  2BHZ A;  5K7F A;  3RDI A;  2P5L C;  2DU9 A;  2HQA A;  3F21 A;  3CJN A;  2HEO A;  4CCL A;  3PIO F;  1BC7 C;  1V5F A;  1G8X A;  4ESJ A;  2WAD A;  4KIT B;  1TWH J;  3SEZ A;  3OIP A;  4HV6 A;  5E3N A;  3M9A A;  3S17 J;  3WHB A;  1B9N A;  4RB2 C;  2Z16 A;  2X1C A;  1OR7 A;  5E79 C;  1WWX A;  3GFI A;  4ETS A;  2QF7 A;  4CUG A;  3EUA A;  2A68 F;  3KP5 A;  1MJB A;  3TOB A;  3IKV A;  2OCE A;  2WAE A;  1SVL A;  4S0H B;  2XPV A;  1FTZ A;  3V8J A;  3P9K A;  1IXS B;  2GZW A;  3DWL E;  1LFB A;  1XDS A;  1N77 A;  1QQI A;  5FRO A;  3SZG A;  3AKZ A;  2ZBK A;  4C2M J;  1F9N A;  3PIP F;  3DKX A;  2X51 A;  2BVL A;  4XRS A;  1B59 A;  2XAH A;  2CFX A;  1X4O A;  3CDH A;  2R3S A;  2D45 A;  2FXA A;  3GFJ A;  2L9R A;  3DLA A;  4EEF G;  2P7C B;  3FHZ A;  2FUG 2;  3GO5 A;  2L7F P;  3JTH A;  3PNV A;  5A2Q K;  4Q47 A;  2A07 F;  3BCB A;  2FMY A;  1IF1 A;  1X1P A;  4ZC3 A;  2XHK A;  3TKY A;  2GBY A;  2IP2 A;  2ME0 A;  4XLA A;  3CF2 A;  3KX2 A;  2DJN A;  2L4M A;  1ETQ A;  2ZNY A;  3RYP A;  1P7I A;  4NC8 A;  5IOY A;  4G7H F;  3C7J A;  4HW0 A;  3S93 A;  1WJA A;  2E60 A;  2K86 A;  1PVE A;  3VYR B;  3HKZ N;  3IAS 2;  1R71 A;  5F0F A;  4II2 A;  2VKH A;  3EUH C;  2KFD A;  3MKL A;  2EFP A;  4CIC A;  2CUE A;  2DOA A;  3MCZ A;  1EKE A;  5K5Q A;  4BJ5 C;  1IN7 A;  2DA3 A;  3ZOB A;  1ZN2 A;  3BOQ A;  5C3E J;  4XM3 A;  1YI2 I;  2YS9 A;  3L9F A;  5KK1 A;  1PUF B;  4AC0 A;  2K9Q A;  2LR8 A;  5IP7 J;  2VKD A;  5C44 J;  2YSR A;  5BS6 A;  2VQL A;  3HB9 A;  2C6Y A;  1MGT A;  5J1Y A;  1XSX A;  4KIF A;  2BVM A;  1NG6 A;  2LKX A;  2EZL A;  1WH5 A;  3LWF A;  4C30 A;  1HKQ A;  3K69 A;  5A2Q Z;  3LSR A;  4E7S A;  1FWZ A;  1RPW A;  3LSJ A;  3LFK A;  2H8W A;  3I4N J;  3MWM A;  2JSP A;  3S2W A;  4XOP A;  5HNH A;  2KPM A;  1TQM A;  1ETV A;  2P6S A;  4UVC A;  3FXR A;  4M72 A;  4XLN F;  4KIG A;  2LNB A;  2ID3 A;  2PMH A;  3OR1 C;  2LD5 A;  3UR3 C;  3KPH A;  4B09 A;  5E8G A;  4LB6 B;  3KCC A;  3LST A;  4I76 A;  5EF6 A;  3S1M J;  3CF5 F;  1TWG J;  5E1Z B;  2XSD C;  2Z1D A;  4BQN A;  2HDC A;  5L3E A;  4ZYD A;  2HOS A;  2N8G A;  5AIP A;  3HC7 A;  9ANT A;  2KRC A;  2MA3 A;  5L3D A;  1IRG A;  4KMF A;  2F4I A;  1IDZ A;  4BL0 B;  4P9F A;  2MD0 A;  2ELH A;  4E7I A;  1YG2 A;  3JR9 A;  1MDM B;  3OS1 A;  4KIS A;  1LKX A;  1ZK8 A;  4NHJ A;  5IYD J;  3ZQL A;  3MAJ A;  1F43 A;  3ZN0 A;  4M71 A;  3WTT C;  1ZG1 A;  3L1P A;  1T0F C;  4OU0 A;  1X2N A;  3OY9 A;  4XKB A;  2FML A;  1CQT A;  2ZFW A;  1UG2 A;  4BAY A;  1WJD A;  3HTS B;  2IA1 A;  1F36 A;  4HA8 A;  3HOV J;  3DU6 A;  1IRX A;  3IH3 A;  4OMZ A;  2A05 A;  3OV8 A;  1JHF A;  3V7S A;  1QO0 D;  1R1U A;  4A6E A;  2ZC2 A;  3L2U A;  3SYT A;  5LRS A;  4A5N A;  3ULQ B;  4RBO A;  2HKX A;  2R7O A;  4G6T B;  2FF4 A;  5HOD A;  3ABU A;  4IQJ A;  4Z2Y A;  2A5Y B;  2LLK A;  2Y69 H;  2KJC A;  4H4K C;  5CJ9 A;  1Y39 A;  1P2F A;  3ROU A;  2VBZ A;  2HQ5 A;  4KT5 C;  3AL0 C;  2Q1Z B;  2EA4 A;  3H3U A;  5GAG J;  1O3T A;  1LQ1 A;  3R4K A;  1NTC A;  3H92 A;  2YU9 J;  1SAU A;  1W7P B;  1D8J A;  3A0H C;  1FLI A;  1SC7 A;  2M45 A;  4F93 B;  2E1C A;  1IXC A;  1VQ4 I;  2JT1 A;  2QKL B;  4N9H A;  2P81 A;  3NAR A;  3JRG A;  2VJ5 A;  2KRH A;  3DF8 A;  4LLN A;  5IYC J;  4GXO A;  6PAX A;  1QNT A;  1OKR A;  3BT9 A;  4YG2 F;  3CD6 I;  4HPQ A;  2QUF A;  3W2W A;  3VDX A;  1LEB A;  4A6D A;  2W4S A;  4BXF A;  4M3E A;  2E2H J;  1UG0 A;  3N4M A;  2EK5 A;  3WU1 B;  3CO6 C;  3ABT A;  4IO9 F;  3OSG A;  1D3Y A;  2DDA A;  3DEW A;  1D0X A;  4FE7 A;  2R7R A;  2VOP A;  5GAD J;  1D8K A;  2QSF X;  3CUQ C;  5E18 F;  4BE0 A;  3OOP A;  1R1V A;  1H0M A;  1G6N A;  1ZH5 A;  1S8N A;  3MMY B;  4JOM A;  2Y31 A;  3CLO A;  5GAE J;  2ISZ A;  3MKY B;  1WQ2 A;  4NC6 A;  2M2E A;  3BJ6 A;  4EJV A;  3QPL A;  3HOZ J;  2QEN A;  1P4X A;  3HTU A;  5AIQ A;  2ICW G;  1FBS A;  3SDG A;  4A5M A;  2VJ4 A;  4BEH A;  1AWC A;  4Y3O A;  5LGT A;  4GRI A;  3DEU A;  2OV7 A;  3BWG A;  1VQ8 I;  1W36 D;  4A3B J;  2X9D A;  3A01 B;  2ECC A;  4EGY A;  2QQA A;  3V8L A;  3E6B A;  2UXX A;  1XCB A;  1QGP A;  2LOO A;  3ZQG A;  3BTI A;  2LG4 A;  3LMM A;  2NNN A;  4AYB A;  4M9S A;  3SXY A;  4DYQ A;  2TDX A;  3SJM A;  2D5V A;  1VQ6 I;  2V9K A;  5FB2 A;  2JWT A;  4V2G A;  2YX7 A;  1LVK A;  3HHG A;  4RDU A;  2OCC H;  1N25 A;  4IRI A;  1ON2 A;  2FOW A;  5FJ8 J;  1U78 A;  2DPD A;  2M8G X;  4UVB A;  1NHA A;  4IXA A;  2EIJ H;  2KIQ A;  4MQ9 F;  2ZFU A;  3GTQ J;  3HXL A;  2BY3 A;  1OFC X;  1USS A;  5KAF C;  1KGS A;  4HDV A;  4PJN A;  2VPL A;  2O0Y A;  2WV0 A;  4I99 C;  2EA2 A;  3SZT A;  3TMO A;  4MIM A;  1J59 A;  2CUJ A;  3OYG A;  2RRE A;  3F72 A;  2R7Q A;  2JA6 J;  1VQ5 I;  1R5H A;  2EV5 A;  3DLL F;  2HYF A;  1IXR C;  4A3K J;  3FWE A;  1MDM A;  1F4K A;  3ASN H;  2DAO A;  4A3E J;  4AD9 A;  4BQQ A;  2RGV A;  1E3H A;  3PNT A;  2DQL A;  3C18 A;  3M4O J;  4DIQ A;  1Z77 A;  1A35 A;  2ZXI A;  3W2A A;  3I4P A;  1UZC A;  1BR1 A;  3E0J B;  1Y1W J;  3HDD A;  3ZCO A;  3QYE A;  1YW9 A;  4D5F A;  4BJ6 C;  1MSE C;  4IQ4 A;  3GF2 A;  2R7D A;  2PFB A;  4MO7 A;  4QLC U;  1GDT A;  1R4N B;  1X1D A;  5B5E C;  3HL2 A;  1R9T J;  1UHS A;  2F5V A;  5TJJ A;  4RGS A;  2M9H A;  2OBP A;  2JK3 A;  3E6M A;  3LA7 A;  3HOT A;  3V42 A;  2Z33 A;  2ZME B;  3S2H J;  3LA3 A;  1ON1 A;  2OU2 A;  2DDB A;  2EFO A;  1RUN A;  2EZI A;  2L9S A;  1TBX A;  1JKR C;  5HDK A;  3AAF A;  2R7T A;  2R7S A;  1TW2 A;  1BN5 A;  2K9N A;  4MLO A;  4ZYE A;  4KDP A;  2JQ7 A;  1FP2 A;  4BHC A;  4LFU A;  4HNU A;  4RB1 A;  5CQE A;  3I71 A;  2NVT J;  2RNG A;  2CH0 A;  3M8E A;  1FYL A;  1W7P A;  2CW7 A;  5LHH A;  3MD2 A;  1SAN A;  4EGZ A;  4RAG A;  1R23 A;  3C2G A;  4RLF A;  2AQF A;  4D0P A;  5LHG A;  3G71 I;  1E3P A;  3FF5 A;  2EQR A;  4RS8 A;  2IRF G;  3CJT B;  2IS1 A;  1BA5 A;  4XIC A;  2HDW A;  5F04 A;  1HST A;  5E17 F;  4A0Y A;  3JRE A;  3F8N A;  5KCM A;  1LUJ B;  4F3Q A;  2E2I J;  2NVQ J;  3ZQQ A;  1HOM A;  3DU5 A;  1AHD P;  2O5R A;  4A3C J;  4B43 A;  4BKX A;  2WTE A;  2LMD A;  2MFZ A;  4M6V A;  3RKX A;  4WXH A;  3GTJ J;  3OSF A;  5CVR A;  3RIR A;  4BE1 A;  4ESB A;  4AM3 A;  2DPU A;  1FOW A;  1GLN A;  4PJJ A;  1R49 A;  2QBY B;  3F6O A;  4BBR J;  2LY2 A;  3JW4 A;  3FK7 A;  5M5X J;  1ZLJ A;  2M87 A;  4A3J J;  1TNT A;  1W36 C;  2Y30 A;  2IJL A;  4BS9 A;  3Q9V A;  1TTY A;  5F0H A;  2XPW A;  2ACJ A;  2V7F A;  1OQY A;  4PUS A;  3CO7 C;  2M4G A;  1C0W A;  2XUB A;  4NQW A;  1JGS A;  3GTL J;  4WF2 A;  2R7Z J;  4PDK A;  3GZ5 A;  2GA2 A;  2Z2S B;  1OR7 C;  5DYM A;  5DDG A;  3GUD A;  2R4G A;  4AWX B;  5HOO A;  2V6E A;  3LQR A;  3CC7 I;  3I55 I;  3CMM A;  3EUK L;  2DMQ A;  1WJC A;  4BHB A;  1BM9 A;  3WOD F;  1ETO A;  1FMV A;  3A01 A;  2XAQ A;  2DMT A;  2M7B A;  2VB6 A;  2V6C A;  3G1O A;  4N9I A;  4QWQ A;  3JRH A;  1T95 A;  2W25 A;  1I5Z A;  1XGS A;  3HRU A;  1VQ7 I;  2IXS A;  3KP3 A;  1FIA A;  2OZ6 A;  5DUK A;  1YW8 A;  4UUS B;  3ZQI A;  2R7X A;  1BR4 A;  2OZU A;  4KN7 X;  1Z21 A;  2HTS A;  4NBQ A;  1X1A A;  3F23 A;  1U8B A;  3GME A;  3BTC A;  2EBI A;  1H9G A;  1LDD A;  1JTY A;  3COA C;  3K7A J;  1I3Q J;  2L7Z A;  4OIR F;  3J81 K;  2WY7 Q;  2E35 A;  4P1W A;  1XD7 A;  1B72 B;  2CFO A;  5DD4 A;  4ENJ A;  3K70 C;  4EJW A;  4HAM A;  2PMU A;  3BR3 A;  1XSD A;  1K6Y A;  1S6L A;  3H5R A;  4DYC A;  2JA8 J;  1YRN B;  4XID A;  2EPF A;  2XGE A;  1RI7 A;  1PP7 U;  3F8M A;  1WRJ A;  3QU3 A;  4ABZ A;  4R8H A;  3ECO A;  1LPQ A;  5ILS A;  5HNF A;  5AON A;  2VOO A;  4U0W A;  2F2E A;  4UY8 I;  2VXZ A;  3ASO H;  2ZJR F;  2MC3 A;  3H5N A;  4HX4 A;  2V79 A;  4LB5 A;  5ICG A;  2E1M C;  3NWT A;  4ESF A;  2CQX A;  3WTZ A;  5L3C A;  1GXQ A;  1U8R A;  2RDP A;  3EET A;  4IHY A;  3R0A A;  2QQ8 A;  3CJR B;  4G7Z F;  1MIJ A;  4IHX A;  3PQK A;  1JTX A;  1HLV A;  3S1R J;  1BBY A;  2Y2Z A;  2J5O A;  3PFY A;  4CCK A;  2ZME A;  2LDU A;  4EJU A;  3HSR A;  2BBY A;  3OS2 A;  5GAH J;  2XDV A;  5D5V B;  3TW6 A;  2VE9 A;  4RGX A;  3SQN A;  3TED A;  4B48 A;  4XLP F;  3LAJ A;  4YEJ A;  3OMY A;  1LFU P;  3J81 Z;  4HEA 2;  2K9M A;  1O4X A;  5GTI C;  3P9C A;  3OIQ A;  2M1B A;  2E2J J;  1B1B A;  2WB1 A;  1AOY A;  1STZ A;  2MAB A;  3DFG A;  1XMK A;  2JMW A;  3BPX A;  2BE5 F;  3N05 A;  1BR2 A;  3QQA A;  3IHU A;  1ETX A;  2KIS A;  3DTK A;  2FE3 A;  1NG7 A;  3I59 A;  3BPV A;  2A6H F;  4JK1 X;  4HNT A;  2K85 A;  1A04 A;  3CCM I;  3BY6 A;  1FBQ A;  5F27 A;  3FXM A;  1JJ8 C;  3HUG B;  5HDG A;  1IAW A;  4MEY F;  4BAC A;  1Z0X A;  4HV5 A;  2AS5 F;  4JBA A;  2DTZ A;  1FYM A;  1DGR M;  1Y0U A;  4BQA A;  3OYJ A;  2HGC A;  4D7N A;  1VQK I;  3LSH A;  1J2X A;  1SMT A;  1OCT C;  3K0L A;  5LBQ A;  3FX3 A;  3OYI A;  1K7A A;  2ZSH B;  4XLH A;  3FIW A;  3SFZ A;  5L3B A;  4RLQ A;  1UEL B;  4UB8 C;  2X6W A;  5HDN A;  1HDP A;  2ESH A;  4I02 A;  2R92 J;  2QBY A;  2DMN A;  2DO7 A;  3ZMS A;  4V2F A;  3IV5 A;  5IT9 K;  5IY5 H;  1VQM I;  2IS4 A;  1LEA A;  2GXG A;  3M07 A;  4CCO A;  3J80 K;  3CMY A;  4CXF A;  2ECB A;  3BC8 A;  1IJW C;  1X3U A;  2VQG A;  4FX0 A;  4G8X A;  2BY1 A;  4HDU A;  3A4C A;  4YIF A;  1H9T A;  1KYZ A;  3IWF A;  5JFR A;  2OA4 A;  4Y4R A;  1G3W A;  2BV6 A;  2WAF A;  2YX4 A;  3T8R A;  1ZRF A;  4ZTF A;  3E3V A;  3F8F A;  5F64 A;  1SEU A;  2BY0 A;  2F6C A;  1E17 A;  2KT0 A;  1H89 C;  1FOK A;  3OYN A;  2O7O A;  2DA4 A;  3JRC A;  1ZKG A;  3BLY A;  1U9N A;  4DOZ A;  2E7X A;  4GDF A;  3I3L A;  3ZGK A;  2ETH A;  2HS5 A;  1QPM A;  3EDP A;  2EIL H;  1D0Z A;  1WJB A;  2DA1 A;  3K2A A;  1Z3Y A;  3RPU A;  4UUS A;  1JJ6 C;  1K78 A;  2MBF A;  3RCO A;  1FSE A;  1HW5 A;  5M5W J;  1GXP A;  1YE9 A;  2CW0 F;  3JRF A;  1D5Y A;  2FJ1 A;  4AU7 A;  1ZR4 A;  4J19 A;  3WTW C;  4M74 A;  1FYK A;  2W1O A;  3HPH A;  2HTJ A;  5DV5 A;  2FNA A;  1VQL I;  3TO6 A;  1T98 A;  3JRA A;  3T5X A;  2PBI A;  2W85 A;  1KQ0 A;  1B72 A;  2B9S A;  2X1E A;  1QVT A;  5CKT A;  4BY7 J;  3U9G A;  3H0D A;  2B7E A;  2L9V A;  3K1N A;  3I54 A;  2JPB A;  4P5O A;  1V55 H;  4YEL A;  1YRN A;  5H2F C;  1W7P D;  2MYS A;  2BEO A;  5DS9 A;  4XRM A;  2IGO A;  2BZT A;  3ZQC A;  3CTA A;  3ZMD A;  5BNG A;  4BJT A;  3J80 Z;  2IS6 A;  1V54 H;  5IP9 J;  2WAQ N;  1S3J A;  1OMI A;  1OYI A;  4N4N B;  2YR2 A;  1LE8 A;  4IVN A;  3OYF A;  3ZR8 X;  3E7L A;  5KHD A;  2OPT A;  4CCM A;  3DTE A;  2XSJ C;  4C9Y A;  4A93 J;  4RA2 A;  3V4G A;  2O03 A;  2J5P A;  3WU2 C;  5FRN A;  4Q5S F;  4HF0 A;  2VON A;  3PM1 A;  3O8G A;  1YJN I;  2RQQ A;  3JRI A;  1UB9 A;  2M8E A;  3UNG C;  1ZG5 A;  2F48 A;  1TT5 B;  4XLC A;  3JSP A;  1FZP B;  3HOS A;  1XMX A;  3C2B A;  2XGC A;  1OCO H;  2HVQ A;  3PUB A;  2HQR A;  2H6C A;  2VBW A;  3GX4 X;  5K1Y A;  3D1N I;  1UHW A;  1W0T A;  1MBF A;  4IRG A;  2JA5 J;  4M73 A;  3I0T A;  3FBN B;  1G3T A;  2Y48 A;  4OWR B;  5CVI A;  2LF8 A;  2XPU A;  1VFC A;  1OJL A;  2DA5 A;  4OIO F;  2PEX A;  1DUX C;  1IV8 A;  1X3W B;  2HOE A;  4ZDL A;  2GLO A;  3BZK A;  1R1T A;  3FMR A;  2XAS A;  3P9I A;  4DGW B;  1OPC A;  4E7J A;  4C2U A;  4RAY A;  2HVR A;  1MH3 A;  2VQH A;  1FNN A;  3FMQ A;  5E3L A;  1IUF A;  1ZLK A;  2E5N A;  3KEO A;  1FC3 A;  3M1C A;  3HUG A;  1TW3 A;  2VC1 A;  5JHF A;  1ZAO A;  4L9V A;  1IN5 A;  2JUC A;  4BEH B;  2LRD A;  3H36 A;  3RQI A;  1T56 A;  2H1L A;  5ILU A;  1QPI A;  1FY7 A;  4OIQ F;  2XB5 A;  2F5C A;  5H20 A;  2VKE A;  1LFP A;  3GTK J;  1BC8 C;  1DPR A;  1JT0 A;  2Y0S N;  3TGN A;  4A3L J;  2X6O A;  1DQU A;  3TP3 A;  4OAZ A;  3FK6 A;  1JKO C;  1TWF J;  5C4J J;  2O61 A;  1JUM A;  1LVA A;  3KEY A;  4M3F A;  4IL6 C;  2CRG A;  2CV2 A;  2VAS A;  5FD5 A;  1S72 I;  3MKW B;  3VPR A;  4PSW A;  5DCF A;  3PQJ A;  4L5E A;  5FD6 A;  3CC4 I;  4ZDO A;  1GVD A;  3D0S A;  2IEK A;  5ED4 A;  4LG0 B;  4Y15 A;  2F4M B;  5JLW A;  1JI8 A;  1QVU A;  1BW6 A;  1ETK A;  3HYI A;  2KP6 A;  1P4W A;  3FXJ A;  3Q0U A;  2I10 A;  1F1Z A;  4RAZ A;  5CPR B;  1IO2 A;  1EH8 A;  4EQQ A;  2ZJQ F;  5ICC A;  2ZJ2 A;  2XC7 A;  1B8I A;  2X85 A;  4KA4 A;  2KZV A;  4AIH A;  3FXK A;  2DXI A;  2L2O A;  4L18 B;  4EM1 A;  4MTE A;  2X0L A;  2BXZ A;  2W24 A;  2IGN A;  5F08 A;  4FX4 A;  4ASN A;  4MNU A;  1KU2 A;  2CUF A;  3G1M A;  4DZJ A;  4YFN F;  4C3J J;  1P6R A;  2FU4 A;  2QKM B;  1WGX A;  4IHT A;  4AIJ A;  4L9T A;  4BH9 A;  5EG0 B;  2EFQ A;  2DN0 A;  2MH9 A;  1E0E A;  1KU7 A;  3OYD A;  1SD6 A;  3TBI A;  2QZ8 A;  2DK5 A;  4E4H A;  3HOW J;  2O3F A;  3T0Y A;  1R5I D;  1XGO A;  1BIA A;  3KIO A;  3GTO J;  1BW5 A;  3CCR I;  4YFK F;  4MEX F;  4I01 A;  2JUG A;  2HPM A;  3GW2 A;  3KZY A;  5HS8 A;  4A12 A;  3H0G J;  1X19 A;  2ISY A;  1R22 A;  2IVM A;  2H1K A;  2OUM A;  4CHU A;  2V1X A;  1WKM A;  2K5C A;  1BI0 A;  2ZKZ A;  1J7K A;  2ID6 A;  5LRR A;  1Y6I A;  4ITV A;  1H8A C;  2DK8 A;  4Y17 A;  2XAG A;  5CVV A;  1S9H A;  4G6D A;  3ESW B;  4BDY A;  1FPQ A;  4GCV A;  5H6Q A;  1V3F A;  3L2R A;  2UXN A;  4EV0 A;  1WCM J;  2R7U A;  1KZH A;  2Q8K A;  3TQN A;  4UVA A;  2V1N A;  3A1Y A;  2X6X A;  3DCF A;  2FBH A;  4FCY A;  1G3Y A;  3OYL A;  2W00 A;  1X1C A;  3HOU J;  3L2W A;  2CV0 A;  1J9I A;  5HVQ C;  3BR2 A;  3ZP5 A;  2EIN H;  4U0V A;  1NK3 P;  3PUF A;  2YPR A;  2CS3 A;  1MJA A;  3SEQ A;  3FXQ A;  4PFO A;  2UWM A;  4FTH A;  1R00 A;  4D7M A;  4O6J A;  2STW A;  2GAU A;  3NEU A;  4F92 B;  3R61 A;  2W7N A;  4HLY A;  2FSW A;  1UMQ A;  3HOY J;  3ERM A;  2M34 A;  1Y8Q B;  5GPA A;  3U2R A;  2X48 A;  1ZG3 A;  1A6Q A;  2GOX B;  3H3Z A;  2W57 A;  1WJE A;  3HJE A;  4MFD A;  3I53 A;  1XSV A;  3QOP A;  4NQW B;  1FEX A;  2LC2 A;  3C3W A;  1E2X A;  3K4K A;  3L2V A;  5KAI C;  3RPU D;  3T8T A;  4E7K A;  3S1Q J;  2FD5 A;  1I50 J;  3IL2 A;  3FM5 A;  1XN7 A;  4KJZ A;  3I64 A;  1QRY A;  2PMZ N;  2Q2E B;  3R60 A;  1KQ9 A;  3WGI A;  1HKT A;  2G9W A;  2KLO A;  2VOD A;  3WU0 A;  1WI3 A;  4YRV A;  2V1U A;  4JX5 A;  5IT3 A;  2XRO A;  1LNW A;  1ZGJ A;  1SFX A;  3CUO A;  1DDN A;  4ZYG A;  3FXO A;  4U88 A;  2BGC A;  5J6X A;  4CZZ A;  2YU3 A;  1I3A A;  4PGG A;  1FIP A;  1V5G A;  5M3M J;  3CP2 A;  2K7L A;  1YX5 A;  1BI2 A;  2LF7 A;  4LG0 A;  2W48 A;  5K5R A;  1J5Y A;  3E5U A;  2ELK A;  2MLK A;  2PG4 A;  4HSR A;  5FLV A;  2ZME C;  2KL4 A;  2L5Q A;  2VUM J;  2CJJ A;  3K4J A;  2A3S A;  4HBL A;  5EEH A;  3D5L A;  1FX7 A;  2CU7 A;  2NVX J;  2DA6 A;  3H9G A;  2KRF A;  1VQP I;  2HOA A;  4LGW A;  4M9X A;  4WWC A;  2F5F A;  4NUB A;  1YYV A;  3QAH A;  3LFU A;  2I8D A;  3R6S A;  1R5G A;  1HW1 A;  5J8F A;  2BY2 A;  1EV7 A;  2ZSI B;  4B3X A;  2CGP A;  5JHU A;  1D1B A;  2ESN A;  5BOX A;  2M4K A;  3I9V 2;  2Q0O A;  1R4M B;  4U0Y A;  3DXJ F;  1GV5 A;  1XX5 A;  2DOD A;  3I58 A;  1WH7 A;  3F9K A;  5EG0 A;  2VPR A;  1XPX A;  2LFB A;  3S8P A;  2W82 A;  1A6I A;  4CZC A;  1VQN I;  2RAE A;  2HKO A;  3EQL F;  5D8L B;  5JVT A;  1IDY A;  3Q9S A;  4B47 A;  3OL4 A;  2GOM A;  4MTD A;  2EFW A;  4XN0 A;  3DBH B;  3CCS I;  1ONV A;  2KZG A;  3DEE A;  2UV1 A;  3GTP J;  3QWL A;  1ZR2 A;  4QPO A;  4I2O A;  3GXO A;  2A6E F;  1BL0 A;  3SHF A;  2RKH A;  2ZXH A;  3OR2 C;  3DBL B;  1HW2 A;  3GTM J;  2BHY A;  3LSP A;  3PO2 J;  1MW7 A;  3WTS C;  3IUO A;  1FSH A;  2L02 A;  3P7N A;  3DQV C;  5EZH A;  2JTV A;  3WG7 H;  2L0K A;  3LA2 A;  1WZ2 A;  1JHH A;  5HLI A;  1MH4 A;  1YW7 A;  2E1N A;  1XGN A;  2DQR A;  3AG1 H;  4JX4 A;  1K4S A;  1AU7 A;  2R5Z B;  3I59 B;  2ELJ A;  4XON A;  4EM0 B;  4FAS D;  5E1W A;  3WHC A;  2WV1 A;  1LDJ A;  2FA5 A;  3BQY A;  4Y13 A;  1MBG A;  3GZ6 A;  5LD2 C;  3F6V A;  4G7O F;  1KQ8 A;  4XL9 A;  4B3A A;  2IPQ X;  4K2E A;  3QPT A;  2KKO A;  2RVC A;  1NK2 P;  3O8H A;  4KFC A;  2LY1 A;  2NAZ A;  5JR3 A;  3ZQH A;  2QVO A;  4B4C A;  3GWZ A;  4XR6 A;  1D1A A;  3OS0 A;  4ZZL A;  1QHG A;  1X2M A;  4N0B A;  5ICF A;  5JLX A;  2EWN A;  2OF7 A;  1Z9C A;  3KYC B;  1UFM A;  3GCM A;  3FHN A;  3PNY A;  4FET A;  3MQ0 A;  1IW7 F;  1HF0 A;  3QP5 A;  3E97 A;  4CCN A;  2DOF A;  1U0J A;  2DA2 A;  4LIT A;  5BMZ A;  1HCR A;  1SVO A;  5D5W B;  3ELK A;  4WK8 F;  5CVU A;  5FKL A;  3S2D J;  2R7V A;  2L54 A;  4XNF A;  2O6G E;  3MZY A;  3NRV A;  1W5C C;  2NXN B;  3C1D A;  4MGR A;  3RJP A;  2DTR A;  1VF9 A;  3BR6 A;  4PJL A;  2VBX A;  2CQQ A;  5FFX A;  5L3G A;  3I56 I;  1QZZ A;  3ZPL A;  2CUZ A;  2Q2E A;  3EYY A;  2K9L A;  4ZYA A;  4XOR A;  1BOA A;  3L09 A;  3W3C A;  1SVM A;  4UV8 A;  4Y52 J;  1IRZ A;  4IF4 A;  3ZQF A;  1HC8 A;  3JCU C;  3M8J A;  2FQ3 A;  3BP8 A;  3GLL A;  4IJA A;  2CQN A;  4OOI A;  4A3F J;  1BJZ A;  1K78 B;  5J8C A;  3FXU A;  2IT0 A;  1WJ5 A;  2OJE D;  1FP1 D;  3J7Y J;  3KP4 A;  1E3O C;  4HF2 A;  2DFI A;  1KON A;  5D4R A;  3S3O A;  1U6G A;  1REP C;  1W4M A;  1Y1V J;  2JVG A;  4FE4 A;  3K4M A;  1T2K A;  4B1R A;  3CCV I;  4UNO A;  3ZMT A;  2BXY A;  2KQR A;  3D5R C;  3ONQ A;  2XGX A;  1QZY A;  2XKP A;  4IEJ A;  2CSO A;  3LSI A;  2OD5 A;  4XKW A;  1I6X A;  4R1H A;  1R7J A;  1Z05 A;  4EJO A;  4RB3 C;  3CUQ A;  1LJ9 A;  1RRJ A;  2HR3 A;  4EM2 A;  4E6K G;  1OCZ H;  3R0J A;  5LLQ A;  1LE8 B;  4QIW N;  5CLS A;  2E71 A;  2QWW A;  1SFO J;  4BU2 A;  2PJR B;  3DP7 A;  1ODD A;  1T38 A;  1U5T B;  3VYT B;  5B3S H;  1TQI A;  5D5X B;  2O8X A;  1EA3 A;  4BNC A;  1HQC A;  5K7Z A;  4WX9 A;  1XS9 A;  4P9U A;  1YIJ I;  1TQP A;  1YFH A;  2LP0 A;  2M3A A;  5K7H A;  1K4T A;  4UUT A;  1WPK A;  3K1M A;  2P5K A;  2VQC A;  4E7Z A;  2KIF A;  3QYB A;  2KHM A;  1J75 A;  4HX8 A;  1RUO A;  2GWR A;  4LK1 F;  5D8K B;  2K02 A;  3BDD A;  2IW5 A;  1SAX A;  1XC5 A;  3TO9 A;  1VQ9 I;  2A6T A;  3IP4 B;  1MD0 A;  2HYG D;  4P55 A;  2Y0M A;  3QRF F;  2HU9 A;  1QU3 A;  2GM4 A;  3F3X A;  4L0Z B;  2NS0 A;  1XG1 A;  1X3Z B;  3FKJ A;  5ERI A;  2LBF A;  5E20 A;  2R5Z A;  4YFX F;  3L2C A;  3HHH A;  3LNQ A;  5EEG A;  3U1D A;  3FZV A;  3OWT A;  4AUX A;  4ON0 A;  4B8X A;  4J00 A;  1H88 C;  1QBJ A;  3W6K B;  1SFK A;  1U9O A;  1RIO H;  3RKY A;  4GYI A;  3AFH A;  4UV9 A;  3E1S A;  3IRQ A;  2DFH A;  3LQQ A;  2CG4 A;  1POG A;  3ABL H;  2GA1 A;  3H35 A;  4CH7 A;  4Y7N J;  4LIV A;  2NOJ B;  2X4H A;  3U1K A;  1ZGW A;  1S7A A;  4KNY A;  3HSE A;  1N78 A;  2JRT A;  3BJO A;  2ZXJ A;  3RZD J;  3A03 A;  2O9L A;  2JJ7 A;  1MMG A;  1VI0 A;  5LGU A;  4V19 K;  1P4A A;  2M0M A;  2PX9 A;  2O8K A;  3JTG A;  1L3L A;  1AA7 A;  2QM3 A;  3ECH A;  1O7F A;  4BDZ A;  1I1S A;  2GIV A;  2BYV E;  2NVY J;  4G12 A;  2QQ9 A;  1G4D A;  5D4S A;  2XRN A;  4CDG A;  4RMN A;  4EVI A;  3B6C A;  1N75 A;  1QZE A;  2EIM H;  2VXD A;  3W2V A;  1JXS A;  2Y9Y A;  3RSN A;  3GTG J;  3S16 J;  3VSL A;  2XGD A;  3VB2 A;  1GHC A;  4NNJ A;  3FM3 A;  1JE8 A;  4PFP A;  2OQG A;  3KP7 A;  5B1B H;  2MSY A;  3BG7 A;  3JRB A;  1B8I B;  5B66 C;  1RKW A;  3RQ4 A;  4JQF A;  3BJA A;  2V1D A;  3WTY C;  3VOE A;  4J01 A;  1I1G A;  3CZ6 A;  5LEK A;  3VWB A;  4L5J A;  3EPZ A;  1AKH B;  1FOX A;  1KYW A;  2G0E A;  1RKT A;  2FOK A;  2QLZ A;  2RC4 A;  3HM5 A;  3G6E I;  4UUV A;  2WY8 Q;  1JKP C;  1IZ1 A;  2IGK A;  2NNY A;  3HGY A;  3ML6 A;  2L7M P;  3O3K A;  5ILV A;  1YS7 A;  4RGU A;  4CYD A;  2R7F A;  1A31 A;  5C4X J;  2DT6 A;  1R58 A;  4CCJ A;  2LY9 A;  5E3O A;  2DMU A;  2VI6 A;  4CYC B;  1G59 A;  3V8K A;  3RKQ A;  3CDI A;  5TGT A;  1Z67 A;  2VIX A;  4OAY A;  2MGQ A;  2H6B A;  3S14 J;  1XTA A;  3Q3S A;  1MZB A;  3DBR B;  4PK4 A;  2K3P A;  4U87 A;  3ABM H;  2QA4 I;  5IT9 Z;  3ABK H;  2HOT A;  3FBI B;  3ZXS A;  2GQQ A;  3RYR A;  1X58 A;  3KE2 A;  4MHG A;  5FRM A;  1Z6T A;  3G3Z A;  1BIB A;  1OLT A;  1CF7 B;  2FBK A;  2COM A;  4GYG A;  1MBE A;  2XV4 S;  2M5W A;  2PJR A;  3T1B A;  5IP6 A;  3F0C A;  4HQM A;  2CWE A;  2LH9 A;  2WAQ A;  1GVJ A;  2WA0 A;  1U5T A;  3H1C A;  1IV6 A;  4YII A;  1TWA J;  2AXT C;  1A5J A;  2EV6 A;  2DYS H;  2IA2 A;  2KIU A;  1PP8 F;  1S5L C;  4O3M A;  3KLN A;  5CYV A;  4AVZ A;  3DPT A;  2GIZ A;  1YX3 A;  3B73 A;  3Q0V A;  2L01 A;  4BGD A;  3B6A A;  2NVU B;  4R79 A;  5FGM A;  1HKS A;  4YIR X;  1ZRD A;  2ZJP F;  1ZTR A;  1SD7 A;  2K4J A;  2AO9 A;  2LRE A;  1D0Y A;  1MND A;  4ANJ A;  3FDY A;  1KA8 A;  3PSF A;  3BZC A;  4IOA F;  3LSG A;  2W84 A;  2EIK H;  3QPS A;  3REO A;  4BXX J;  2NOG A;  1IRF A;  3KEQ A;  2IA0 A;  2EZH A;  3PFI A;  3DKW A;  2GXA A;  2XF6 A;  4QTR A;  2OC6 A;  3P5J A;  2XIG A;  3LSM A;  5BPI A;  2NS7 A;  1APL C;  2TCT A;  2K3F A;  3CDL A;  2P8T A;  3HKZ A;  2M30 A;  3HRT A;  3S32 A;  5EGO A;  3WGG A;  4MFE A;  4Q48 A;  4KIB A;  4XLF A;  3HPG A;  1D1C A;  5FLM J;  3TP0 A;  4A3I J;  4OIP F;  1RET A;  1YQA A;  5L3F A;  3BR5 A;  4IPA A;  3J7A O;  3K1P A;  4BYY A;  1SD5 A;  5J4Y A;  3FMS A;  4HST A;  3E6C C;  3VYS B;  1S29 A;  4WXC A;  5DEQ A;  4W97 A;  2L7K A;  2AHQ A;  2PLY A;  5J40 A;  2H09 A;  3RKW A;  2QQB A;  3C2H A;  2TRT A;  1YHQ I;  3GEZ A;  2OAZ A;  3UKG A;  1HSJ A;  2L3D A;  3ISP A;  2JPC A;  3QYF A;  4L5I A;  2VT3 A;  4NDL A;  4E7L A;  1B4A A;  3MFK A;  3KZZ A;  3AG4 H;  3F22 A;  3CCJ I;  2E7W A;  2JVH A;  1P9Q C;  3BTJ A;  2Y0S A;  1CGP A;  2CYY A;  4XMY A;  1I6H J;  2P5V A;  1M1E B;  1Z3X A;  1WJF A;  4E7H A;  1ZAR A;  4ZTJ A;  1TP4 A;  3QOE A;  4BUP A;  4CA0 A;  5E3M A;  4KMU X;  3SDB A;  4B44 A;  2DLL A;  1SD4 A;  5LFA A;  4C3H J;  3IKT A;  3HEF A;  3NQO A;  4H0E A;  5DM6 F;  2ZB9 A;  1JUP A;  4XBF A;  1W1W E;  3TOA A;  4FHT A;  2XF5 A;  2V9V A;  3RI4 A;  3CQZ J;  3BG3 A;  2B63 J;  2VN2 A;  1BI1 A;  2ME6 A;  1AKH A;  2JRM A;  4ZJZ A;  4NC7 A;  4X0G A;  1ORK A;  4KT6 A;  1K79 A;  1ZHF A;  1PJR A;  3IAM 2;  1UHM A;  2KDZ A;  2EJR A;  4XKV A;  5HLH A;  2JSC A;  5KVR A;  4DJA A;  4LK0 F;  5M3F J;  2IBD A;  4L9N A;  5HLT A;  5FKM A;  4PGH A;  5F6F A;  4CSW A;  4HX7 A;  1WFX A;  2XAJ A;  5F0C A;  1IN4 A;  1BOB A;  5DM7 F;  3CCU I;  2EFN A;  4G94 A;  4Z6Y A;  1Q1V A;  4CYC A;  4LD5 A;  4I09 A;  3AG3 H;  3ZRG A;  1PUE E;  4A0Z A;  2B0L A;  3GYH X;  1XB4 A;  5FLX K;  3K9T A;  2DW4 A;  2DT7 B;  3BCA A;  4Y33 A;  2VE8 A;  3ZMU A;  4XK4 A;  3F8B A;  2RQP A;  3X2Q H;  1O7L A;  1MBH A;  3JSO A;  2E1O A;  3E6D A;  2HVS A;  2D1H A;  4HNV A;  2PI0 A;  2V26 A;  3KP6 A;  4D5C A;  3TO7 A;  1G2H A;  2COB A;  2XAU A;  2QYO A;  2FQ4 A;  4JP0 A;  2VL8 A;  4PSX A;  5DD8 A;  1UCR A;  1CF7 A;  5ICE A;  1ETW A;  4AID A;  3SFI A;  3DPU A;  4LLL A;  4WCG A;  4DQ2 A;  1GUU A;  3BTL A;  4BBS J;  1WHU A;  4IHW A;  2MD5 A;  2CMP A;  5DTD A;  5F1J A;  4FIS A;  4F7Z A;  1IG7 A;  2HZD A;  3KP2 A;  3MEX A;  3Q0W A;  5BQT A;  3GBG A;  2IAI A;  1J09 A;  1TLH B;  4IHS A;  4BXU A;  4LIU A;  2DJI A;  1ULY A;  4KUM A;  2X1D A;  1MSF C;  5J4V A;  4ZDP A;  3FXL A;  4G9Y A;  1SMY F;  2XF7 A;  3PL8 A;  3E5X A;  2VBY A;  5GTH C;  2BW3 B;  2X6Y A;  2JA2 A;  1YOV B;  1IGN A;  1Z1D A;  3ZQ7 A;  1MJ9 A;  1Z7U A;  4XRF A;  1O3Q A;  4F52 A;  4ENN A;  1RNL A;  2PQ8 A;  4OIN F;  1VND A;  3S1N J;  5FLX Z;  2QCO A;  1FJL A;  2CV1 A;  4JYK A;  1KU9 A;  4IKF A;  4HRI A;  4DW6 A;  4F91 B;  2WC2 A;  3OYM A;  3PJR A;  3O6B B;  3CCE I;  4G6Q A;  1TT0 A;  2LYC A;  4FT8 A;  4L9J A;  3B02 A;  3HRM A;  2VJI A;  2Z3Y A;  1V4R A;  4EMS A;  3J7Z I;  3SZP A;  3S3N A;  1XMA A;  4XOT A;  1HA8 A;  1I27 A;  1DU0 A;  1T33 A;  3QOD A;  3HOX J;  4IZZ A;  2DFE A;  3HIF A;  5HLG A;  1YJ9 I;  3GLX A;  1TZL A;  2P4W A;  4E70 A;  3H3V K;  2NRA C;  4II3 A;  4EJT A;  3K2Z A;  4DBR A;  1HXD A;  2DT5 A;  2IGM A;  3AL0 B;  3BR1 A;  2HWV A;  5GPC A;  4KIC A;  4QSH A;  5CVJ A;  5TIS C;  1PUF A;  3Q5F A;  2PMZ A;  1O3S A;  1FBU A;  4BY1 J;  4XQF A;  3RTR A;  4P96 A;  1JGG A;  1ENH A;  2R5Y B;  3IH4 A;  4I0A A;  1MBK A;  3KFW X;  1SFE A;  1TC3 C;  2D1V A;  3LL7 A;  1T6S A;  1VZ0 A;  4NB5 A;  1P92 A;  4PJM A;  5JVG F;  3VOD A;  1VTN C;  4I0B A;  1R6R A;  1VQO I;  4AYB N;  4XSX F;  1W0U A;  3IRR A;  5D6E A;  1Z91 A;  2DA7 A;  3EUH A;  5HS7 A;  2A61 A;  3MVP A;  1ZQ3 P;  1B9M A;  3DV8 A;  1WSU A;  1P7J A;  3DKY A;  3KYD B;  3CUQ B;  1MMN A;  3S15 J;  1HBX G;  5F1R A;  2JN6 A;  2DFF A;  3H5A A;  3OYB A;  4IOC F;  2IS2 A;  1UAA A;  2VT2 A;  4ENK A;  3TDZ C;  3A0B C;  4FQG A;  5DCM B;  5H6R A;  3TW7 A;  3LAP A;  1MBJ A;  3NAU A;  1W5S A;  1BI3 A;  4HLX A;  3BG9 A;  2OTJ I;  1YTY A;  1Y0N A;  3VYU B;  1FTT A;  4DYR A;  2DYR H;  5LHI A;  3BRO A;  4UXN A;  1DU6 A;  2Z99 A;  5FKN A;  3CJQ B;  1MMA A;  4HZF A;  3OYH A;  3U21 A;  4RAF A;  1U2W A;  2VKV A;  3JRD A;  1ZEL A;  3OYK A;  3K70 D;  3K10 A;  2DCE A;  2JZY A;  2EH3 A;  1T39 A;  5HS9 A;  4I98 B;  3QP6 A;  3W6V A;  5DUI A;  4L0Y B;  2MC4 A;  3MN2 A;  1RC9 A;  1XDU A;  3IWZ A;  5B1A H;  2KMU A;  3NWS A;  5IYB J;  1FT9 A;  1K6O A;  1LB2 A;  1O3R A;  1LDK B;  3V7C A;  2EZK A;  2R7W A;  2HYJ A;  3LOC A;  1V5E A;  3CLQ A;  3E5Q A;  3WE2 A;  5M5Y J;  2LBF B;  5IOZ A;  3K4N A;  2HZT A;  5J1U A;  4RGR A;  2AXL A;  3PSI A;  1GV2 A;  1D5V A;  2VC0 A;  1S7E A;  1PDN C;  1MKM A;  1G3S A;  2KDO A;  4M3D A;  4ZYH A;  3ERE D;  2LK2 A;  1QA6 A;  4LJZ F;  1YJW I;  2M0C A;  3ZN1 A;  4PZJ A;  4U7B A;  2G7U A;  2AQE A;  3W6J B;  2BW3 A;  1ZYR F;  2K9S A;  2Z9O A;  2ADU A;  1EF4 A;  5LGN A;  2XKO A;  3MZ8 A;  4QPQ A;  2RNJ A;  2DI3 A;  3PO3 J;  1O57 A;  1T0F A;  2MG4 A;  2XRL A;  4KN4 X;  2CW8 A;  3K4C A;  2P0W A;  1R36 A;  3HG9 A;  4LLG F;  3BG6 A;  3H9J A;  2K40 A;  1NH3 A;  1Z6R A;  3K4B A;  1Y8R B;  2K4B A;  3CME I;  3QU6 A;  4BHP A;  5D5U B;  2NS8 A;  3S3M A;  3MZH A;  1ETY A;  1YIO A;  3VEP A;  1XGM A;  3CP8 A;  3ZMZ A;  3A2K A;  2G7H A;  2OTL I;  2VJJ A;  3CCL I;  4BQO A;  3GZN B;  1HDD C;  4UHT A;  3J7A Y;  2HXI A;  4F55 A;  1JT6 A;  2ZNZ A;  4A3D J;  1KU3 A;  2UZK A;  2Y75 A;  3OOU A;  4ZH4 F;  1L0O C;  2QSH X;  1Y56 A;  2GXB A;  5EEA A;  2CO5 A;  1TL8 A;  4RB0 A;  1OIS A;  3N97 A;  2DMP A;  2YUS A;  3DTI A;  4UB6 C;  3WE3 A;  4ZZD A;  5LEJ A;  4XN3 A;  1EJ9 A;  4M6Y A;  4D9J A;  1JKQ C;  2V9P A;  1ACI A;  3L7W A;  4GO1 A;  2BOL A;  3D5S C;  1U5T C;  3M8F A;  1DP3 A;  3MKZ A;  3L2Q A;  2D2W A;  1UJ8 A;  2R5Y A;  1TWC J;  3OYE A;  1J0R A;  1JUS A;  2QSG X;  1Q1H A;  2E19 A;  4X6A J;  2CQ7 A;  4RM3 A;  2E36 A;  5K5O A;  5J1R A;  4PJ0 C;  3OL3 A;  5J47 A;  5JI6 A;  3BR0 A;  2HFH A;  2P7V B;  2ZO4 A;  4DNC A;  2R0Q C;  2HDD A;  2HPI A;  3EYI A;  2KJB A;  4HOB A;  5CQG A;  3OYA A;  3M1E A;  2STT A;  2EV0 A;  4XRS G;  3G1L A;  4RM2 A;  1GT0 C;  1RZ4 A;  1MNM C;  4N4O B;  1IC8 A;  5EZG A;  3KYL A;  1A36 A;  1U3E M;  4X1E A;  3K6G A;  3LSK A;  2F5E A;  2FX0 A;  4MQV A;  3WTX C;  1YS6 A;  3WTV C;  5J3L A;  4OMY A;  4C2T A;  1OYY A;  4M6X A;  4XSZ F;  2I5U A;  2EB7 A;  2F4O B;  5FFZ A;  4U7D A;  2QEX I;  3ZMV A;  2UUZ A;  2LKP A;  4M9Z A;  2PJP A;  4S05 A;  5DCM A;  3I4M J;  2E5Z A;  2R93 J;  3M7G A;  2WWY A;  4BE2 A;  1ERD A;  2MH2 A;  2JA7 J;  4TV7 A;  3O2P E;  2XB0 X;  3IH2 A;  3KZI C;  5EJC A;  4W1U A;  2F5D A;  1YIT I;  4LOC A;  4IHV A;  2HI3 A;  3CES A;  4A2U A;  4CGZ A;  1YLF A;  4HQE A;  1I39 A;  3AG2 H;  2LKS A;  2MLG A;  4ENM A;  4AVP A;  3K4L A;  2RV8 A;  1FOY A;  1X1B A; 
#chains in the Genus database with same CATH homology
 4AVZ A;  3DPT A;  1YX3 A;  2F5V A;  2OUM A;  3HOT A;  3TL4 X;  3V42 A;  4BGD A;  2K5C A;  4R79 A;  2WBM A;  1QHH D;  1Y6I A;  4ITV A;  4XKC A;  2L9S A;  2R7T A;  2LRE A;  2R7S A;  4MLO A;  1D0Y A;  1MND A;  1S9H A;  4ANJ A;  3FDY A;  3PSF A;  4HNU A;  3LSG A;  4BDY A;  4LG3 A;  5CQE A;  2RNG A;  1FMW A;  2CH0 A;  3L2R A;  2R7U A;  2XF6 A;  1DGW Y;  2OC6 A;  3LSM A;  2V1N A;  3A1Y A;  2X6X A;  2CW7 A;  3OYL A;  2W00 A;  1X1C A;  3MD2 A;  2V4J C;  3C2G A;  3L2W A;  2CV0 A;  4RLF A;  5HVQ C;  1MNE A;  3HKZ A;  3S32 A;  2AQF A;  2CS3 A;  3SEQ A;  2IS1 A;  2L9N A;  4PFO A;  4XLF A;  2UWM A;  3HPG A;  1D1C A;  2HDW A;  5KCM A;  4F3Q A;  4DBQ A;  3ZQQ A;  2HNH A;  4F92 B;  2E1M B;  3DU5 A;  2O5R A;  1PYV A;  2W7N A;  4B43 A;  2MFZ A;  4D1Q A;  4HST A;  3G2B A;  3VYS B;  2GOX B;  1Z7L A;  4NQW B;  2VLA A;  1WJE A;  4BE1 A;  2L7K A;  2LC2 A;  1GLN A;  4PJJ A;  3K4K A;  3L2V A;  3C2H A;  2LY2 A;  5KNL A;  3RPU D;  4E7K A;  1W36 C;  4BS9 A;  3VSK A;  4KJZ A;  2V7F A;  2Q2E B;  4PUS A;  2M4G A;  3QYF A;  4E7L A;  2M7A A;  2KLO A;  2JVH A;  1P9Q C;  2Y0S A;  3H9Q A;  4YRV A;  2Z2S B;  1OR7 C;  4EAT A;  4XMY A;  2R4G A;  4XLE A;  5HOO A;  2V6E A;  1Z3X A;  1WJF A;  4E7H A;  3CMM A;  3EUK L;  4ZTJ A;  4HG2 A;  1WJC A;  3OYC A;  3QOE A;  4BUP A;  4CA0 A;  3DPL C;  3SDB A;  1FMV A;  4B44 A;  5LFA A;  2M7B A;  2VB6 A;  4IX7 A;  1V5G A;  3CP2 A;  1YX5 A;  1T95 A;  2XF5 A;  1MMD A;  2A5W A;  2IXS A;  2R7X A;  1BR4 A;  4HSR A;  4ZJZ A;  4NC7 A;  1Z21 A;  4X0G A;  2KL4 A;  1X1A A;  4KT6 A;  2L5Q A;  3IAM 2;  1PJR A;  3K4J A;  4XKV A;  4DJA A;  3D5L A;  1X4P A;  2WY7 Q;  5HLT A;  3H9G A;  4P1W A;  2CFO A;  4CSW A;  1WFX A;  1BOB A;  4NUB A;  3K70 C;  2HQA A;  3LFU A;  2I8D A;  1K6Y A;  3ZRG A;  3H5R A;  2ZSI B;  4CCL A;  4B3X A;  1V5F A;  1G8X A;  1D1B A;  4Y33 A;  2DT7 B;  3BCA A;  2M4K A;  3I9V 2;  2WAD A;  4KIT B;  3F9K A;  3SEZ A;  3OIP A;  2W82 A;  3S8P A;  4CZC A;  2HVS A;  5HNF A;  2V26 A;  4B47 A;  3OL4 A;  2Z16 A;  2X1C A;  2GOM A;  2XAU A;  2VXZ A;  4XN0 A;  2VL8 A;  4PSX A;  3H5N A;  4CUG A;  3DEE A;  2UV1 A;  3EUA A;  4QPO A;  3DPU A;  2E1M C;  3NWT A;  2WAE A;  2CMP A;  3DWL E;  1N77 A;  2ZXH A;  5FRO A;  3OR2 C;  3SZG A;  3AKZ A;  3DKX A;  2HZD A;  2X51 A;  3CJR B;  2BVL A;  1MW7 A;  3IUO A;  1X4O A;  3GBG A;  3DQV C;  3PFY A;  1J09 A;  3DLA A;  4CCK A;  2FUG 2;  4LIU A;  2DJI A;  3PNV A;  3OS2 A;  2X1D A;  2XDV A;  3BCB A;  4ZDP A;  4B48 A;  2XF7 A;  3PL8 A;  2BW3 B;  2ELJ A;  2X6Y A;  3OMY A;  4HEA 2;  2K9M A;  4XON A;  4YEJ A;  4ZC3 A;  4FAS D;  2JA2 A;  3OIQ A;  4XLA A;  3CF2 A;  2WB1 A;  3KX2 A;  5LD2 C;  2MAB A;  4F52 A;  3N05 A;  4XL9 A;  4NC8 A;  1BR2 A;  3S93 A;  1WJA A;  2E60 A;  3VYR B;  3DTK A;  3IAS 2;  1NG7 A;  4HNT A;  2LY1 A;  2CV1 A;  4II2 A;  4IKF A;  4HRI A;  2VKH A;  3EUH C;  4F91 B;  4XR6 A;  3OYM A;  1D1A A;  3OS0 A;  3PJR A;  1QHG A;  2DOA A;  1TT0 A;  2LYC A;  4BJ5 C;  3HUG B;  4BAC A;  3FHN A;  2VJI A;  3PNY A;  4FET A;  1DGR M;  4XM3 A;  3OYJ A;  4CCN A;  1U0J A;  3S3N A;  3LSH A;  4XOT A;  1HA8 A;  4LIT A;  2VKD A;  3QOD A;  3OYI A;  4IZZ A;  2ZSH B;  2R7V A;  4XLH A;  1TZL A;  4RLQ A;  1UEL B;  2VQL A;  4XNF A;  2X6W A;  4II3 A;  4DBR A;  2IGM A;  3AL0 B;  4PJL A;  2PMZ A;  2BVM A;  1NG6 A;  2IS4 A;  4CCO A;  4XQF A;  2CUZ A;  3RTR A;  3BC8 A;  4C30 A;  2K9L A;  4ZYA A;  2VQG A;  4XOR A;  4E7S A;  3W3C A;  3A4C A;  3LL7 A;  1VZ0 A;  4Y4R A;  2JSP A;  4PJM A;  4XOP A;  2WAF A;  5HNH A;  2KPM A;  1R6R A;  3M8J A;  4ZTF A;  2F6C A;  3OR1 C;  3OYN A;  3UR3 C;  1WJ5 A;  3BLY A;  4DOZ A;  1KON A;  3I3L A;  3ZGK A;  3S3O A;  2Z1D A;  4BQN A;  1D0Z A;  3DKY A;  1WJB A;  1MMN A;  1Z3Y A;  2JVG A;  3K4M A;  3RCO A;  3HC7 A;  2KRC A;  1YE9 A;  2KQR A;  3D5R C;  3ONQ A;  4AU7 A;  3H5A A;  3OYB A;  2W1O A;  2IS2 A;  2F4I A;  1UAA A;  3LSI A;  3HPH A;  4BL0 B;  4XKW A;  2MD0 A;  4E7I A;  3OS1 A;  4KIS A;  1LKX A;  2X1E A;  3VYU B;  4E6K G;  5CKT A;  3H0D A;  1T0F C;  4YEL A;  4P5O A;  3OY9 A;  4XKB A;  2PJR B;  4BU2 A;  2MYS A;  1WJD A;  2IGO A;  3CJQ B;  1MMA A;  3OYH A;  3U21 A;  3DU6 A;  1IRX A;  3VYT B;  4BJT A;  2IS6 A;  1EA3 A;  1ZEL A;  3OYK A;  3K70 D;  3K10 A;  2DCE A;  4N4N B;  3OYF A;  3SYT A;  3L2U A;  3ZR8 X;  5KHD A;  4CCM A;  2MC4 A;  2M3A A;  3DTE A;  2XSJ C;  2R7O A;  4G6T B;  4C9Y A;  2KMU A;  3NWS A;  5FRN A;  2VQC A;  4IQJ A;  4E7Z A;  3QYB A;  1LDK B;  2KHM A;  2RQQ A;  3UNG C;  2R7W A;  1V5E A;  2LBF B;  4H4K C;  4XLC A;  3K4N A;  3HOS A;  2A6T A;  3AL0 C;  3IP4 B;  2Q1Z B;  2HVQ A;  1SAU A;  3PSI A;  3PUB A;  2HU9 A;  4F93 B;  1QU3 A;  2KDO A;  2QKL B;  2VJ5 A;  4U7B A;  3FKJ A;  2KRH A;  2LBF A;  3FBN B;  2AQE A;  2BW3 A;  4OWR B;  4HPQ A;  4QPQ A;  3OWT A;  3W2W A;  4J00 A;  4ZDL A;  3VDX A;  2CW8 A;  3K4C A;  2W4S A;  2P0W A;  3HG9 A;  4BXF A;  1SFK A;  4DGW B;  1UG0 A;  3AFH A;  3BG6 A;  4E7J A;  3E1S A;  3H9J A;  4C2U A;  2HVR A;  1D0X A;  2R7R A;  2VQH A;  3K4B A;  3H35 A;  4CH7 A;  4LIV A;  2NOJ B;  3S3M A;  2E5N A;  4BE0 A;  3M1C A;  3MMY B;  4JOM A;  3A2K A;  3CP8 A;  5JHF A;  1N78 A;  2VJJ A;  4BQO A;  1MMG A;  4BEH B;  2LRD A;  3MKY B;  2M0M A;  3J7A Y;  4F55 A;  1AA7 A;  4BDZ A;  3OOU A;  1LFP A;  4RMN A;  1Y56 A;  1N75 A;  2VJ4 A;  2VXD A;  3W2V A;  1DQU A;  4BEH A;  3RSN A;  4OAZ A;  4Y3O A;  3DTI A;  4GRI A;  3VSL A;  2OV7 A;  4XN3 A;  3KEY A;  4NNJ A;  4D9J A;  1W36 D;  2CV2 A;  2BOL A;  2VAS A;  4PFP A;  3D5S C;  3MKW B;  1DP3 A;  3BG7 A;  3MKZ A;  3L2Q A;  4PSW A;  3OYE A;  3RQ4 A;  4JQF A;  4ZDO A;  2LOO A;  4J01 A;  1JI8 A;  3CZ6 A;  2LG4 A;  3VWB A;  4RM3 A;  3LMM A;  3EPZ A;  4AYB A;  2KP6 A;  3OL3 A;  5CPR B;  2V9K A;  2WY8 Q;  1LVK A;  2IGK A;  2HPI A;  2XC7 A;  2X85 A;  3OYA A;  5CQG A;  2KZV A;  2DXI A;  4RM2 A;  2L2O A;  2DT6 A;  4N4O B;  2ZFU A;  4CCJ A;  3HXL A;  2IGN A;  3KYL A;  1G59 A;  3K6G A;  3LSK A;  5TGT A;  4PJN A;  2VIX A;  2VPL A;  4OAY A;  3TMO A;  2QKM B;  4C2T A;  2CUJ A;  3OYG A;  2RRE A;  2R7Q A;  2K3P A;  4PK4 A;  4U87 A;  2UUZ A;  2E5Z A;  3FBI B;  3ZXS A;  4BE2 A;  1ERD A;  1E0E A;  4BQQ A;  5FRM A;  3PNT A;  3OYD A;  3TBI A;  4E4H A;  1OLT A;  4DIQ A;  2ZXI A;  3CES A;  3W2A A;  1BR1 A;  3E0J B;  2PJR A;  3ZCO A;  3QYE A;  2LH9 A;  2JUG A;  2WAQ A;  2WA0 A;  3K4L A;  4IQ4 A;  4BJ6 C;  2HPM A;  1X1D A;  1X19 A;  3HL2 A;  1X1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...