3OR2C

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKVTGFKLKQIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite redcutase subunit alpha
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or2C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or2C01
2A5WA 1YX3A 3OR1C 2V4JC 1JI8A 1SAUA 3OR2C 2XSJC
chains in the Genus database with same CATH superfamily
2ADUA 2GM4A 1QRYA 4RAGA 3SDGA 5IYDJ 2Y2ZA 3LSGA 3IC7A 2PI0A 3HGGA 2H09A 4HQMA 1YG2A 3OYFA 1BW5A 3DBLB 4BQQA 3PJRA 2PMZA 1AWCA 2L7MP 3V4GA 4FQGA 1N25A 4PJLA 5EZHA 2RNJA 1ZR4A 2GXBA 2DAOA 2IVMA 4QPOA 3ZQFA 4RB1A 2CW7A 2DA1A 2XROA 2V4JC 4ZYHA 2UZKA 3FMSA 2G0EA 4IRGA 2IA2A 5E1XA 3J7AY 3E5XA 3IL2A 2DYRH 3GX4X 4G8XA 2HYFA 1E0EA 1DPUA 4BEHA 3BR5A 4OMZA 2DA7A 1R00A 4XSZF 3BQZA 5DCFA 3G3ZA 2F5VA 1WWXA 2D45A 1J7KA 1VQNI 1KU7A 2DQRA 4MNUA 2OCEA 5GP9A 2Z16A 4JX5A 2XGDA 4IJAA 4KT6A 3HOSA 3QU3A 3VYSB 2BVMA 1W7PA 2BYVE 4CDGA 5E18F 1BJZA 1OCPA 4C3IJ 2RQQA 5DCMB 1X1CA 4DZPA 5EG0B 1ZAOA 5EGOB 5BOXA 1SFUA 2R7ZJ 1MKMA 5F04A 2W57A 2FMLA 2VBZA 3E5UA 1W0UA 3KZIC 4ENNA 5GAEJ 4HEA2 2HFHA 2HXOA 3GTPJ 3BJ6A 2A61A 1MNEA 2L9RA 1LDDA 4MGRA 4RS8A 2KDOA 4KIGA 4B47A 3QPHA 4M9ZA 4CYCA 1IXCA 5L3FA 2P6SA 2XKPA 2AQFA 4Q47A 1TT0A 3U1DA 3FHZA 4AIDA 5K5QA 2QM3A 2KRCA 5EDNA 2LH9A 1ZG1A 1IRXA 2AHQA 1IGNA 1ZLKA 2FU4A 2IS2A 2IS1A 3CC7I 2MYSA 3S3OA 4WF2A 3PFIA 1ODDA 3B6AA 3J81K 3DQVC 1Z6RA 3OMYA 4BYYA 4N0BA 3MQ0A 4KN7X 5E20A 2QBYB 3LNQA 2UXNA 4I01A 4E7ZA 1H88C 3LA7A 4XNFA 1PUFA 2UWMA 2P81A 3HEFA 1TC3C 2W24A 1OCRH 3HOWJ 3L09A 1X19A 2X1CA 1SMTA 2GQQA 1G3TA 1R6RA 3Q3SA 4M3GA 4XRFA 2VOPA 2IEKA 2L9VA 4NDLA 3CD6I 1D3YA 2DFEA 3BCAA 3IP4B 4OAYA 4UVBA 1VFCA 1U2WA 3MAJA 2STTA 4I99C 4A5NA 3DTIA 5E3OA 2Q1ZB 5HDGA 3E3VA 3S14J 5BQTA 3T1BA 1AA7A 2RV8A 1Z3XA 3TBIA 4XMYA 2XPVA 1XMXA 1Q1VA 4NBQA 4RGXA 1MSFC 2QSHX 1Y1VJ 2BXZA 2E60A 1FBUA 5KVRA 5J1YA 4WXHA 4F91B 4CZCA 4LFUA 4EJTA 2EA2A 1S8NA 1H9GA 2COMA 3EYIA 4OIOF 1B1BA 1R5ID 2ID3A 4DIQA 3ECOA 1RI7A 3MKLA 1FP1D 2COBA 2LTPA 2VKEA 3S3NA 3AG2H 2H6BA 3BZKA 1AU7A 2H6CA 4D7MA 5CVIA 2KHMA 1X3ZB 2DCEA 1HW2A 5KHDA 2OF7A 1D8JA 1FSHA 4FISA 1W5SA 1J09A 1USSA 5HLGA 1S7AA 2M4GA 3GCMA 3FXQA 1FOWA 1JKPC 2TRTA 2D5VA 4D5CA 1LFBA 4ABZA 2BY3A 2MH9A 1PUEE 3R0JA 4J19A 1E3HA 4ETSA 4A3BJ 1T2KA 2IXSA 4DJAA 1ZQ3P 2EIJH 1VQLI 2X85A 3KEQA 4KUMA 2X1EA 3LMMA 4GDFA 1TBXA 2K27A 3K10A 1ETOA 2RKHA 2DLLA 1JUSA 3JRHA 2P6TA 1X2MA 4M3BA 4BXUA 4U7BA 1TL8A 5HNHA 1SFKA 2AO9A 3LSRA 3ISPA 3RPUD 3KCCA 3A01B 2XVCA 4IRHA 1MSEC 1LB2A 2O8XA 2UXXA 1AKHB 3TO6A 3DXJF 5IYBJ 5J4YA 3HSFA 4XSXF 4L0YB 1VNDA 1R23A 5FFZA 2QQBA 2JQ7A 1A5JA 3ZQHA 3PSIA 2XRNA 2MA3A 2JPBA 2HNHA 4G7ZF 1Z9CA 2LOOA 2B9SA 4LLLA 2HTJA 2F48A 4R8HA 3VWBA 1FBSA 1UHSA 2XF6A 2QYOA 1ZGJA 4YIIA 3DEUA 5H2FC 3PIPF 2YR2A 1ZH5A 5C4JJ 2XAQA 5FLVA 3DU5A 2NNYA 3CCYA 3KP6A 4F3QA 2ZJQF 3G73A 3SZPA 2R92J 2R7FA 3VPRA 4CH7A 5JVGF 2JA7J 4XL9A 4C2TA 2ZXJA 4GRIA 4DBRA 5FLMJ 4OIRF 3QOEA 2P0WA 3REOA 4HV6A 1IAWA 3HJEA 5GPCA 3HOYJ 4GXOA 3W6VA 2DT6A 3E5QA 3ZN0A 5FLXZ 2IS6A 4M3FA 1D1AA 1ENHA 3TW7A 4LMYA 2R7XA 2ZC2A 2WAQA 4UXNA 3JCUC 5DEQA 1YFHA 3MD2A 4HF2A 4KA4A 5CVUA 2KIUA 4LK1F 4I6ZA 4L0ZB 2KIFA 1YX5A 4DQ2A 5D4SA 5JLWA 2NXNB 1UFMA 1LFUP 1ETYA 2EZHA 2JRTA 1IRGA 1JUPA 3G2BA 1R5HA 3FMQA 4W97A 1T8IA 3U21A 2EBIA 3A4CA 5M3FJ 1OMIA 3OIOA 4XIDA 3KE2A 2DA3A 2K9MA 1LEAA 2R4GA 1MDMA 4G6TB 4A3KJ 4OOIA 3LAJA 3E0JB 2NAZA 2ELJA 1NTCA 3WU2C 1W5TA 2ZBKA 2MG4A 2IA1A 1MMAA 3QQAA 1FOXA 2G7UA 1TW3A 4FCYA 4LLGF 2CUEA 1TZLA 2VBYA 3M7GA 2A5YB 2VIXA 1RC9A 1FP2A 3F8MA 2K9SA 3SYTA 4KITB 5DV5A 2R3SA 1RNLA 3COAC 3TEDA 2K40A 5EEGA 1L0OC 3NRVA 2FMYA 3OOUA 4E7JA 1FYKA 5TJJA 1H8AC 5KAFC 4A3DJ 4IKFA 2HR3A 2RREA 3A0BC 4RA2A 4XLCA 2LF7A 1FC3A 1JGGA 4L9NA 3VSLA 3RJPA 1ETWA 3GXOA 4RGUA 4BEHB 5J3LA 1R1UA 4HBLA 1BC7C 4II2A 2QEXI 2VJIA 2KDZA 2A3SA 4DYQA 4XN3A 5KK1A 1RUNA 4A3FJ 4PDKA 2DMQA 1LDKB 1SD4A 2L3DA 1XG1A 2QLZA 1ACIA 3GF2A 1JHHA 3OIQA 3OL3A 2OV7A 1R36A 5LHIA 4BKXA 2Y0SN 5FLXK 2ECBA 3MZHA 4NQWA 4A3GJ 2VQHA 3T8TA 3TP3A 1W7PB 1V5FA 3WTVC 2L7ZA 5F64A 3A03A 1W4MA 1IJWC 1FT9A 3GEZA 2FF4A 4CCLA 3EUAA 4A2UA 3K4KA 2NOJB 1QHHD 1YHQI 2K86A 2LSOA 1SAXA 4HNTA 1G3YA 3PO3J 3H5RA 5L3GA 1QZZA 5HS8A 4HX4A 4L18B 2M87A 3J7AO 1D5VA 4YRVA 3ABUA 2E2HJ 3J7YJ 1XCVA 2KJCA 2KISA 4N4NB 4V2FA 4EQQA 3RZOJ 4WX9A 3HRSA 2PMHA 2BW3A 3K4MA 1O3QA 2V79A 3HL2A 1WI3A 1SD6A 2ME6A 2XB0X 2YX4A 3WHCA 2HS5A 3S16J 1O7LA 1ONVA 4HLXA 3LOCA 3P9CA 2W25A 1JTYA 2ZB9A 3BTCA 3BCBA 3FXOA 5LLQA 5EYRA 1I3QJ 3DU6A 3I56I 5ERIA 4OAZA 3TDZC 3FM5A 4XRMA 1SVLA 3K70C 1WSUA 3RKYA 1KQ9A 1X3WB 3NARA 4CO8A 3V7CA 2E2JJ 3G1LA 3BOQA 4DW6A 1LPQA 3AKZA 4CCMA 1SC7A 2LKSA 3FXKA 1PUFB 4U0VA 2XKOA 1ZGWA 3DBHB 1SFXA 2CV1A 2L02A 1TWGJ 1V55H 1IDZA 3H36A 3QWLA 5J6XA 1B8IA 2HU9A 4EEFG 3QPSA 1WKMA 5HVQC 1DPRA 4HSTA 4R1HA 5B1AH 2WAQN 2W85A 2VPRA 4HRIA 2NVUB 2B63J 5GADJ 1LDJA 3AG1H 3RDIA 1YITI 1KA8A 1X1BA 1IN4A 1VQ4I 4C30A 1MBKA 3KZZA 3L2RA 4ENMA 4RGSA 3O3KA 3F6VA 2KZVA 5ICGA 2E1CA 3WTYC 3ULQB 1HC8A 1FIAA 4ZYGA 1MMSA 1T39A 1WCMJ 2WAEA 1OYIA 2F5DA 2OA4A 3E97A 3Q0WA 4I0BA 1I1GA 1FTZA 4MIMA 3BR6A 5ICEA 3IH3A 1Z1DA 3BPVA 2IT0A 2JA6J 5HODA 1BR4A 1XC5A 5HLTA 1U3EM 4NB5A 2FX0A 3M4OJ 4U88A 3JTHA 3FXUA 1WJCA 4I2OA 3C1DA 4BQOA 1YIJI 1VQ5I 3U9GA 3DKYA 2Y0MA 4HNVA 2DMTA 1S29A 3GZ5A 3LQQA 2GOMA 2XV4S 3SEQA 3S1MJ 5ILUA 3H5AA 2V9VA 3I9V2 2Q8KA 1SEUA 2H8WA 1XDSA 2PFBA 2MD0A 2WC2A 2VE9A 5CJ9A 3H0DA 2DBBA 3H5NA 4DYCA 5A2QK 2KLOA 1MBGA 2J5OA 2EZIA 4Y17A 4LIUA 3T0YA 3ZMVA 2CMPA 1JHFA 2BEOA 1IUFA 3I0TA 4YFKF 1ZREA 2F4IA 3H3UA 4KFCA 4GYIA 1IV6A 3K69A 3SJMA 4ZDPA 2F5FA 2EFOA 3SHFA 4MO7A 5D8KB 3ELKA 1X58A 1FMWA 1WJBA 2WB1A 1BI3A 3ZQIA 2VQCA 4S05A 1FMVA 2X6WA 2K9QA 1MBJA 2QSFX 2X4HA 4M6VA 3F23A 3D5LA 1ORKA 3G6EI 1TQMA 1SFOJ 4P9UA 3RPQA 5AIQA 1FLIA 2LFBA 4BDYA 5BS6A 2R7VA 3T5XA 1IUYA 2LY2A 1WH7A 2VBXA 3KZYA 1PDNC 3F8NA 4LG3A 2LVSA 4HX8A 5H20A 4BJ5C 3MZYA 3HOZJ 1IRZA 3LFKA 4S04A 4BAYA 2K4BA 3QYFA 4O3MA 4KJZA 3IV5A 2JTVA 4I0AA 1QZEA 4BACA 3GUDA 4XLNF 4CYDA 3A2KA 2VC1A 1J9IA 3DBRB 2CFOA 3OYGA 4V19K 4HAMA 2OTLI 1JI8A 4D5FA 1N77A 1HSTA 3HUGA 3JRFA 6PAXA 3PUFA 1FEXA 1T6SA 2CQQA 3OYKA 2ISZA 3BTLA 4BUPA 1SD7A 1GDTA 1LNWA 1XGNA 4PCQA 1ZLJA 2HYGD 2OQRA 4ANJA 3U1KA 2D1VA 2KJBA 5LRSA 2IGOA 3HB9A 1K78A 1OCOH 3DTEA 4G9YA 5IY5H 4C2UA 5F0HA 3W2VA 1QO0D 2EZLA 3WTSC 5GTIC 5IPAA 4XN0A 2O6GE 3L2CA 2BHYA 3J80K 1YI2I 4IHXA 3T8RA 1VZ0A 3I53A 3PM1A 2FQ4A 5LEJA 1DP7P 4UNOA 1MDMB 3HC7A 3L2VA 3HOVJ 2NVXJ 1U5TC 2R7TA 2F2EA 1WQ2A 3BP8A 4HX7A 2ZJRF 4HG2A 2L4MA 1F4KA 5TISC 1F43A 3CTAA 3WTZA 2XDVA 2LKPA 3LSJA 2MBFA 1IO2A 3I4MJ 1G59A 1FY7A 1NH3A 2WADA 2O3FA 2LREA 3FXJA 2GZWA 2D2WA 2Y31A 3BJAA 1PP8F 3CLQA 2XSDC 4RB3C 3S15J 3J81Z 2Z5UA 1W5CC 1A36A 3ZN1A 3IH4A 1V54H 5KCMA 1SD5A 1ZRCA 5ICCA 3FISA 1XPXA 2VN2A 2L5QA 2V6EA 5L3BA 1IW7F 2JA2A 3BROA 3EQLF 3CC2I 4IHYA 1I3AA 5C44J 3E6MA 2LC2A 3QU6A 2W84A 3MN2A 2J5PA 4DZJA 3OY9A 2E34A 1ZRDA 3I59B 2LY9A 4EJOA 4YFXF 2ZJPF 3TW6A 4NQWB 2F6CA 4NC6A 4W1UA 3PQJA 5LBQA 4BU2A 3ZMTA 4KICA 4JX4A 1DQUA 4L9TA 2ELHA 3S8PA 1KYWA 1XCBA 2XSJC 1KQ0A 4WCGA 2ZO4A 2X0LA 1T33A 3Q9SA 2IS4A 4XKVA 2W00A 5FRMA 3JSPA 2XC7A 1ETXA 3CJQB 2NVQJ 5F27A 3WG7H 5AIPA 2B7EA 2LG4A 2EQRA 1LUJB 3CF5F 1U0JA 3FZVA 4B4CA 2M5WA 5J8CA 4NNJA 2LY1A 1YS6A 1OFCX 2BW3B 2I8DA 2PG4A 2DU9A 2VJJA 1OKRA 1R5GA 3FHNA 5FKOA 4EM2A 1HF0A 5HLIA 3CLOA 1XSVA 2CWEA 4KISA 2V9KA 2Z2SB 3ROUA 4DBQA 4PFOA 2QENA 2YPRA 4A3CJ 3HOUJ 1U9OA 2AXTC 2DOFA 2C6YA 3OYDA 5F0FA 3GFLA 2CQ7A 5FD5A 3K1NA 5FKMA 4XKWA 2YU3A 1O3SA 1F1ZA 1VI0A 2LDUA 2R7OA 4F93B 2JA5J 1BJAA 1YRNA 3ML6A 2DT7B 2EINH 3VYTB 2ESHA 1QVUA 4HDUA 5FB2A 3V8KA 3H92A 2VT3A 3AL0C 5HLHA 4AYBN 4MTDA 4KNYA 2DMUA 2PJRA 1S7OA 3G71I 1B8IB 2JZYA 3B6CA 4BQAA 5L3DA 3HBLA 5IT9K 1XSXA 4CHUA 1RPWA 3KP2A 4BY7J 1RR8C 1HOMA 3O2PE 3PSFA 3I5UA 4EGZA 1JKOC 2R5YA 4UUSB 1SANA 1W36C 1MMDA 1S7EA 3JAMK 1P6RA 5D4RA 3TO9A 3SDBA 3BG7A 4IF4A 1HW1A 1TT5B 3AAFA 4E4HA 3QRFF 1W1WE 4JOMA 4Y52J 2FA5A 1DDNA 1IC8A 3CMMA 4ZDLA 1U5TB 5J40A 3LSPA 4XLHA 5F1RA 4EVIA 3FBIB 4XKCA 1V5GA 1NHAA 3ZMZA 2GXGA 2QKMB 2A68F 1F36A 4JQFA 3JRGA 4D0PA 1A35A 2XASA 2JT1A 1Z91A 5LGUA 3KYLA 1MBHA 4X6AJ 2ELKA 1Z3YA 1BR1A 4BY1J 2UV1A 2VOOA 2CYYA 2OZUA 3CCVI 3S2HJ 1FOKA 2RNGA 3D5RC 2R7RA 3OV8A 2XAFA 2BGCA 4NHJA 2RQPA 2MH2A 2XPWA 1SAUA 5IOYA 1R7JA 4FTHA 2A6TA 3CQZJ 1X3UA 3MWMA 1I5ZA 2ZXWH 1WJ5A 3CO7C 3DFGA 4AU7A 4Q4ZF 1VQ6I 4ITVA 4A3LJ 1H0MA 1WPKA 1GVJA 2XHKA 2LMDA 4C9YA 2HPMA 1Z0XA 1GT0C 3HSEA 2LRDA 3HKZA 1H9TA 2PMZN 2LR8A 3OS2A 1Y0UA 4HSRA 4I7HA 2H1LA 1LE8A 2FOKA 4RLFA 5DTDA 4IX7A 3CUQA 4IVNA 2KZGA 2XUBA 1HA8A 3O6BB 3F22A 1JKRC 2Y69H 1MMNA 2E36A 1X2NA 3K4NA 4JYKA 2HDCA 3OYHA 2OBPA 3QYBA 4Z2YA 4XQFA 4EM0B 4IEJA 4G6QA 3HOXJ 1S72I 4XBFA 2DN0A 4Q48A 3L9FA 1R1VA 2GBYA 3AG3H 2O9LA 4A69C 3S93A 3ZMUA 1RKWA 5KAIC 1UHMA 3GO5A 2VE8A 2MSYA 2VKHA 2HOTA 5HNFA 3OSGA 1W7PD 4M3DA 3PL8A 2LBFB 3SXYA 3ABLH 3KP3A 3CCUI 3S17J 2KRFA 2PQ8A 3CDIA 3RCOA 2KQRA 3IRQA 2O7OA 5HS7A 4IHVA 5GAHJ 3L00A 2E35A 3C2HA 2EFPA 1T0FA 3S1QJ 5DD4A 1NK3P 3F8FA 4ZH4F 2EJRA 2RN7A 3HUGB 2GLOA 1U8RA 1ZK8A 4J00A 5DYMA 1QVTA 5E3LA 4QWQA 1O3TA 1NG7A 3GTLJ 3D5SC 2ZKZA 2E2IJ 1OCZH 1Z21A 4KIFA 2FXAA 1DGRM 2Q2EA 1G3WA 1JT6A 2MC4A 1Z67A 1XMAA 2KPMA 4OMYA 3AL0B 2CUJA 1K78B 3HDDA 2O8KA 1ZELA 1BBYA 2JSCA 2DK8A 2R0QC 3OL4A 2K3FA 2VT2A 3LSMA 4M6YA 3JRIA 3DPUA 1PP7U 4OU0A 3A02A 2EIMH 2P5KA 2QQ9A 2E1MB 3L2QA 1TWAJ 1RIOH 4LIVA 4ZDOA 1B72A 1MJ9A 2KFDA 2AXLA 2GAUA 4U0YA 1I6XA 4ESBA 1YE9A 2KKOA 4XM3A 1IRFA 4N4OB 4E70A 1R49A 5IT3A 3LA3A 3BTJA 2CRGA 1BOBA 2BOLA 4BHCA 2DYSH 3EUHA 1VQ8I 4K2EA 1DU6A 1EA3A 2IW5A 1SVOA 3K2AA 1MJAA 2ZJ2A 3KP7A 4F92B 4AIJA 1ZYRF 1G3SA 3HIFA 2K7LA 1D0ZA 5CQGA 1MZBA 3HOTA 1Z7UA 3CJTB 3EPZA 2L54A 1A04A 2M1BA 1YIOA 2HQAA 4HDVA 3LL7A 3GFIA 1XGMA 3GTOJ 4CCJA 4EJVA 2GOXB 2BVLA 4UVAA 2NRAC 4HNUA 4AC0A 2I5UA 4HLYA 2BY2A 2JSPA 3QYEA 1MNMC 5CPRB 4NC8A 1A6QA 3HHHA 5ICFA 5K7FA 2ZCWA 4JK1X 5EZGA 3ONQA 1UG0A 2DW4A 2PX9A 5H6RA 2PMUA 3FF5A 3K4BA 2P5LC 1EJ9A 4BXXJ 2ZFWA 4YIRX 2CV2A 3ECHA 4B43A 2PJPA 2ZSHB 3KX2A 2FRHA 3CCJI 1QPMA 2MABA 4MFDA 1ERDA 3I3LA 2EFNA 3HPGA 5KNLA 2X48A 3W6JB 2HKXA 2R7DA 3KYDB 3HPHA 4HA8A 3W6KB 1P92A 2GWRA 3WG9A 3HTSB 3FWEA 1MMGA 4P96A 2M34A 2X9DA 4IXAA 5LHGA 3OS1A 5F08A 5LEKA 2Y75A 4LG0A 2E7WA 3IUOA 3BPXA 3N4MA 3HRTA 3ZR8X 1K4SA 2OPTA 1BR2A 4A0YA 2O5RA 1E2XA 3ASOH 1HDDC 2QF7A 3KPHA 1K6OA 5FKLA 1OQYA 2B0LA 1PJRA 3TOBA 3DCFA 1YJ9I 4YIFA 2JJ7A 4M6XA 1T0FC 5E1ZB 1J5YA 4OWRB 3DKWA 3Q0UA 2VC0A 5D8LB 5CVJA 4CYCB 2IGNA 3ZCOA 4ON0A 3X2QH 5DM7F 3FIWA 2YSRA 2XGCA 3RKXA 3HSRA 3VOEA 4G7HF 5ED4A 1YRNB 2QQAA 3OWTA 3W2AA 2I10A 1RUOA 2W82A 5A2QZ 2LD5A 3JREA 3VODA 3OR1C 1J59A 4ZTJA 4FE7A 4RBOA 2V1NA 2JWTA 3IHUA 1YW7A 2PJRB 5EGOA 4IOCF 2IGMA 3HXLA 5DUIA 1EF4A 3PFYA 1DU0A 3IKVA 1BL0A 2E71A 1ZRFA 2A05A 2LYCA 3QP6A 3VYUB 3HRMA 2DK5A 3WODF 1ZHFA 3ZP5A 3GW2A 5ILVA 1HSJA 2CS3A 3L1PA 4R79A 2FSWA 3OYNA 1ZARA 3K70D 2P5VA 3M8FA 1JUMA 1MIJA 1MBEA 2XF5A 2IRFG 4A3EJ 2DDBA 2VLAA 4GO1A 4S0HB 2BXYA 4JX6A 4GYGA 1MJBA 1WJEA 3ZQ7A 5F6FA 3EUHC 1YLFA 5E8IA 4J01A 5JFRA 3R0AA 1IV8A 2K5CA 3H0GJ 3IWZA 4B09A 1X4OA 2EZKA 5AONA 5LGTA 1APLC 3V7RA 2JPCA 3I64A 3E1SA 3FX3A 5GAGJ 3L2UA 2XAGA 4DNCA 3GTQJ 3HGYA 2QBYA 3VFZA 4AIHA 5IP7J 2F4MB 4A0XA 2AQEA 5L3EA 4ZYEA 2KIQA 1QNTA 1FYLA 2ME0A 3WGHA 5B66C 1TWHJ 1IXSB 2IPQX 4PGHA 3L2WA 1H89C 1GV5A 2H1KA 2O03A 4NUBA 2L01A 5IP6A 5CYVA 3CCLI 2NYXA 2M4KA 3R6SA 3WGIA 2M7AA 2L9SA 3CESA 3FDYA 4M72A 5J8FA 4ZTFA 3RQIA 5JVTA 2EH3A 5CVRA 2QWWA 3BWGA 3WU0A 3V8JA 1YJWI 2WBMA 4BNCA 2O61A 1XB4A 3IAS2 1KU9A 2HPIA 1F5TA 1Y0NA 4MQVA 1D1CA 3I4NJ 1HKQA 2UUZA 2QGUA 2LNBA 5FJ8J 3B73A 1POGA 1LE8B 1HW5A 3CUQB 1I50J 3J80Z 3VYRB 2A5WA 2W1OA 5DM6F 2LP0A 4O5VA 4HF0A 1UAAA 2K3PA 3ZXSA 3HZJA 3GZ6A 4ESJA 2H8RA 2YU9J 3BZCA 1Z05A 1QPIA 2EV0A 4RB0A 5E17F 1ZGAA 3BR3A 1KU3A 3ABMH 3CMEI 3OR2C 4G7OF 2CV0A 5EEHA 3ZMSA 1IN8A 3M1CA 2OQGA 1LVAA 2HI3A 3SZTA 1VQ7I 1E17A 2KP6A 4L9JA 3SQNA 4U7DA 2QA4I 3OSFA 4GFBA 1LQ1A 2EV5A 2W4SA 4XOTA 4CGZA 1HKSA 1LKXA 1YOVB 1UHWA 4PJ0C 1TNTA 2ETHA 4C3HJ 2M3AA 2ZNZA 2KMUA 2KRHA 3DP7A 3DLAA 3ZRGA 2VKDA 1WGXA 3BC8A 3CZ6A 1FOYA 1YS7A 4N9IA 1FNNA 5E79C 3RSNA 4P1WA 3WTWC 1P2FA 1BA5A 1YO5C 2HXIA 3M07A 2V9PA 2V1DA 1ETVA 3F72A 3KEOA 1R71A 4QLCU 1Y8QB 2FEZA 5HDNA 3IRRA 5K5OA 3Q0VA 1OPCA 3FM3A 2D1HA 5ILSA 2Q2EB 3A1YA 4HW0A 4CZZA 5CKTA 1IG7A 4DGWB 1MNDA 4FX0A 3BG3A 4WXCA 3E6BA 5BNGA 1ZG5A 1WJFA 1AKHA 3HHGA 3GWZA 2FD5A 4GGGA 1QU3A 3BLYA 1TP4A 3WGGA 2WV1A 2K02A 2L0KA 4EMSA 5B5EC 2QQ8A 2EFQA 2Z33A 1ZN2A 5JLXA 1B72B 2HVSA 3D1NI 2BZTA 3DV8A 3KP5A 3PNVA 1WFXA 1B59A 4BE0A 1JGSA 2X6OA 1F9NA 4EJUA 2JVHA 4UY8I 1OYWA 1UELB 2DO7A 1FPQA 1T56A 2LF8A 4CSWA 4WK8F 2MFZA 3W3CA 1GVDA 1G6NA 2JK3A 3MMYB 4BL0B 4ZZDA 5F1JA 2EIKH 5IYCJ 4EGYA 1HQCA 3C2BA 4GCVA 2DPUA 3GMEA 4E7LA 3OYJA 4B8XA 5CLSA 2DPDA 4LB5A 4L9VA 4JP0A 3LAPA 3WHBA 1MD0A 3GFMA 1A31A 4LLNA 1HXDA 2XF7A 5DS9A 1XX5A 3DLLF 2L7FP 2CFXA 4PFPA 4CA0A 2WWYA 3RYPA 5HDKA 4JBAA 2L7KA 2ID6A 2XB5A 3ZQQA 3G1MA 5C3EJ 3PNTA 5BPDA 4AM3A 3TQNA 1QGPA 2DXIA 3MCZA 1BI2A 5L3CA 3IAM2 2E5ZA 2GA2A 2QZ8A 3VDXA 1ITYA 4XLFA 4HZFA 4ZZLA 2VXZA 4YELA 3K6GA 3NEUA 1OCTC 2V1UA 4M71A 1BI1A 4RGRA 3KEYA 2EK5A 3GLXA 4QSHA 1WJDA 1KGSA 1P9QC 3VSKA 5IT9Z 2P7CB 2LLKA 4RAYA 5FFXA 2HGCA 3NQOA 2CSOA 3RZDJ 4LD5A 2WY8Q 1K83J 1RETA 3PO2J 5TGTA 1YX3A 3JAMZ 3SZGA 1WHUA 2JUCA 4UUVA 3F8CA 2A6HF 4MFEA 5FO5A 2R93J 2BBYA 1RR7A 2HZTA 3OYIA 4LG0B 4IZZA 3BDDA 3GVAA 3C7JA 3OIPA 2JRMA 1R4NB 3V8LA 2CUZA 1BOAA 4PGGA 1USTA 2O0YA 1UJ8A 2AS5F 1P4WA 1HKTA 3ABKH 2FUG2 2CW8A 3LSKA 1R1TA 2IA0A 4M9SA 4O6JA 4B48A 5F0CA 4E6KG 4IOAF 3HG9A 1D0XA 4BGDA 1X1PA 2K4JA 5K5RA 4IRIA 2WB1N 3H3ZA 5M5WJ 2TCTA 3BJOA 4ZYAA 4MEYF 2JN6A 2HQRA 3QAHA 3GZNB 4A5MA 4BDZA 1FYMA 4IQ4A 3RPUA 1P7JA 2MGQA 3FXMA 4NC7A 3MZ8A 2X6XA 1VF9A 2R7QA 4DYRA 5J1RA 1DP3A 1WJAA 3K1PA 4LJZF 4B3AA 2EA4A 1O3RA 1Y1WJ 5GPAA 3CF2A 1BW6A 4B44A 4A3IJ 2FBKA 3K9TA 2NS7A 2G7HA 2R7UA 1G2HA 1KU2A 3M8JA 1LVKA 3CDHA 3DKXA 3I58A 3PQKA 4M74A 2DOAA 1JE8A 4MEXF 3P7NA 2N8GA 2F4OB 3DEEA 3IKTA 3J7ZI 3TGNA 1SFEA 4BQNA 4B1RA 1U9NA 4EM1A 2NOGA 4G94A 3CUOA 3O8GA 4XLAA 1EH7A 2HZDA 4BHBA 2V6CA 3DF8A 4A3MJ 2ZMEA 1MH3A 3ZGKA 2E1MC 3OOPA 1ULYA 4P5OA 5DDGA 1S5LC 4HQEA 3KETA 2IP2A 3C18A 2HVRA 4IHWA 3LSHA 1Z77A 4AUXA 5LFAA 5LRRA 2VXDA 4CCOA 2XIGA 4WXDA 4E7KA 1FSEA 3RQ4A 3P9KA 4F55A 2JA8J 3EYYA 2CQNA 2VONA 4C2MJ 2KL4A 2HOAA 1WVRA 5H6QA 3GTJJ 3JTGA 2M0CA 4KDPA 3GFJA 3I71A 3JR9A 3FBNB 1W36D 1U8BA 2VQLA 1R58A 2FQ3A 1R9TJ 5K1YA 5JHUA 1BIAA 3WTTC 4B3XA 2PEXA 1GXPA 3DTKA 1V3FA 5E1WA 2P7VB 4BBRJ 2JMWA 1GV2A 3KYCB 4YFNF 2XAHA 2DDAA 2DA6A 1TNSA 4I98B 2EILH 4KIBA 2HWVA 4A0ZA 3F8BA 3FK7A 1Z6TA 5D5WB 2ZSIB 4E7SA 3LQRA 2DTZA 5EF6A 2VBWA 4FASD 4Z6YA 3JRDA 2YX7A 2IGKA 3K0LA 5DD8A 3ASNH 1JJ6C 1MGTA 3S32A 4X0GA 3OYEA 1B6AA 2M0MA 4BS9A 2HOEA 1O4XA 2PBIA 2IBDA 4EV0A 5FRNA 3FK6A 3CCRI 5EJCA 1Y6IA 3DPTA 1EH6A 2MLKA 3U2RA 4Y33A 2VL8A 1IZ1A 1QQIA 4BE2A 1QZYA 1XN7A 2VJ4A 1Y8RB 3CCEI 2NVTJ 1GHCA 4ZJZA 2DFFA 1E3PA 2FBIA 4FHTA 2NS0A 2Y0SA 2XPUA 3CJNA 2HQ5A 4G12A 5HOOA 3S2WA 1CF7A 4RAZA 3R60A 3K4LA 1IN6A 3MKZA 4YG2F 1IN5A 1ZTRA 3K4JA 3OYMA 2DMPA 1Q1HA 1QBJA 2OTJI 3IH2A 4PJNA 2FNPA 2CJJA 1MBFA 1K6YA 1FIPA 4XONA 4A12A 1IXRC 4EJWA 2IJLA 2HOSA 3GTMJ 1FX7A 3KLNA 1S3JA 1YTYA 1UB9A 4PK4A 3RI4A 4CCNA 5JI6A 3OYCA 2GXAA 1I27A 4XLPF 2Z1DA 1B9MA 3V7SA 4V2GA 5J4VA 1V5EA 1TLHB 5CVVA 4HV5A 2HVQA 3QOPA 2ZXIA 1LEBA 3N97A 2STWA 5JR3A 1TW2A 3S1RJ 3CCSI 5K7ZA 3FKIJ 2QVOA 2ZMEC 1TTYA 2WA0A 2M7BA 3OS0A 3EUKL 3PUBA 1GXQA 1HDPA 2Y48A 3FMRA 1R22A 2PN6A 3H9JA 2M45A 2OZ6A 2BHZA 3GBGA 3CP2A 2R5ZA 1I6HJ 4BBSJ 3P5JA 4M9XA 3UNGC 2X1DA 5B3SH 5B1BH 2OAZA 1FTTA 3CDLA 2XAJA 1OYYA 1XGOA 2ZFUA 5E8GA 1FBQA 1AOYA 1UG2A 2EFWA 3BTIA 1OISA 1G4DA 2VUMJ 4BE1A 4BJTA 3ZOBA 4ENKA 2Y30A 1C0WA 2EB7A 4PUSA 2FJ1A 1YW8A 2BE5F 2WV0A 3M9AA 4MLOA 4AWXB 3TOAA 2F5CA 5E3MA 1ON1A 2KT0A 4L5EA 2ESNA 3CC4I 3M1EA 4CCKA 1FWZA 3M8EA 4ZC3A 1EV7A 3OYAA 2NS8A 5LHHA 4BXFA 1DUXC 2HKOA 2PLYA 3Q9VA 3TO7A 4ESFA 3BZ6A 1CGPA 4IPAA 4TV7A 2HDWA 4ENJA 4II3A 4PSXA 4F52A 2FNAA 2A69F 4A3JJ 2CW0F 1K61A 4RDUA 3HTUA 2ZNYA 2DT5A 2MLGA 3LSIA 4BHPA 3LFUA 4QIWN 1HBXG 3QP5A 4IL6C 3MEXA 3GYHX 2ZXHA 3I54A 2IAIA 4BJ6C 3WE2A 2OU2A 3F6OA 4CXFA 1X4PA 2DQLA 4XR6A 2V7FA 2H94A 3BT9A 4A6EA 1WI9A 1BC8C 5C4XJ 2VQGA 4KMUX 3G4SI 2BY0A 9ANTA 1O57A 2ISYA 4OIQF 4U0WA 4RM2A 1RZ4A 2ACJA 1SMYF 2M2EA 4PZJA 3TL4X 3SEZA 4XK4A 1ON2A 1U78A 3I4PA 3K7AJ 2LK2A 3CUQC 2CG4A 4RAFA 2P8TA 2HQNA 5FD6A 1RRJA 2K85A 4X1EA 2M9HA 1SVMA 3PNYA 2CH0A 2RGVA 2CO5A 3HYIA 4KT5C 1LFPA 4FETA 3AFHA 5K7HA 3WU1B 4PSWA 1U6GA 1REPC 3HKZN 2M8EA 2L4AA 5D6FA 2QKLB 2E7XA 4HPQA 1QA6A 1P7IA 3WTUC 1HCRA 3EDPA 2Z9OA 3WTXC 4KN4X 2WTEA 3LSTA 2CQXA 2DJIA 1ZG3A 2E5NA 4FE4A 4XKBA 4LK0F 5D6EA 3CMYA 2RC4A 2DTRA 3I59A 3AG4H 3ZQGA 4F7ZA 4DOZA 4UUTA 3ZQCA 1YW9A 2FE3A 3ZPLA 3KLOA 3OYLA 5IOZA 3H3VK 4WWCA 5D5UB 3BR0A 3BY6A 3BG6A 4OINF 1XSDA 4H4KC 1XDUA 2W48A 2Y9YA 1D1BA 2R7WA 3H1CA 2BV6A 1ZKGA 2DOEA 1A6IA 1EH8A 4MTEA 4Y4RA 1LJ9A 2A6EF 3IWFA 1N78A 1YQAA 1T38A 2DA4A 2V1XA 2QUFA 1VTNC 3ESWB 2G9WA 5DCMA 5EG0A 3H9GA 3H35A 1OJLA 1FZPB 3W2WA 2KIMA 4D1QA 1BM9A 1VQMI 2X51A 3JSOA 2ZMEB 1VQOI 1OR7A 3QPLA 1KZHA 4AVZA 3K4CA 3E6CC 2DA2A 3BG5A 3BR1A 2R5YB 2ICWG 1UMQA 3ZQLA 3P9IA 2YUSA 4CICA 3F0CA 1NK2P 4YEJA 1K4TA 2MC3A 2RAEA 1EKEA 1M1EB 1R4MB 3O8HA 1TWCJ 3GTGJ 3MKYB 1XS9A 1WRJA 4H0EA 3L7WA 4ZYDA 1Z7LA 1TQIA 1ZR2A 1WH5A 2BY1A 4A93J 2VB6A 3TDUC 2A07F 3KIOA 4Y3OA 4D9JA 1J2XA 2DFIA 3SFZA 3JRBA 3F3XA 3B02A 5JHFA 2P4WA 5LD2C 3FKJA 3BG9A 3R61A 2JUGA 1E3OC 2WAFA 4I09A 4M73A 4CUGA 4E7HA 2K9LA 4MQ9F 1N75A 4IHSA 1JXSA 1XGSA 3QPTA 1DGWY 1T08B 5BPIA 3CCMI 4RM3A 1KQ8A 2CUFA 4EATA 1J75A 3H9QA 1I1SA 1OCCH 2EPFA 3QODA 4UUSA 1BN5A 3MVPA 1T95A 4XOPA 3KFWX 4LOCA 3VEPA 4Q5SF 2CQKA 2XAUA 1L3LA 1XD7A 2DI3A 1STZA 1UCRA 2QSGX 1RKTA 1HLVA 3RKWA 2FOWA 1U5TA 1QHGA 2QCOA 3CP8A 4AVPA 2OC6A 2WY7Q 4UB6C 3GLLA 4IQJA 2DMNA 1UZCA 2Z3YA 1CQTA 3ERED 1KONA 3C2GA 5FGMA 3I55I 1GLNA 2HEOA 1KYZA 1Y56A 3A0HC 4RB2C 2JVGA 4Y7NJ 3V42A 2W7NA 1B4AA 2FBHA 4I02A 3Q5FA 1OLTA 1S6LA 4ASNA 4LITA 3RTRA 1VQKI 2CGPA 1AHDP 3GTKJ 2EWNA 1JKQC 1JT0A 3JRAA 5J47A 4HOBA 2NNNA 4OIPF 1B9NA 1VQPI 1CF7B 4XRSG 1RESA 3TMOA 1ETKA 2DA5A 4XICA 3BQYA 3TKYA 4P55A 5D5VB 3RIRA 2E1NA 3LWFA 4KMFA 2VASA 4UVCA 4FX4A 1X1DA 4RMNA 2RVCA 3LA2A 2H27A 1T98A 3N05A 5EEAA 5GTHC 5M5XJ 3S2DJ 2M30A 1P4AA 1V4RA 3HM5A 4MHGA 1O7FA 4AD9A 2OUMA 1YJNI 4Y13A 2Z99A 4XRSA 1TWFJ 2RDPA 3RYRA 1WZ2A 1YYVA 2NVYJ 3JRCA 3NWSA 5BMZA 2OCCH 3BR2A 4QTRA 4UV8A 5DUKA 1PVEA 5E3NA 1D5YA 2DFHA 3DWLE 3F21A 1W0TA 2XGXA 1S9HA 2HTSA 2VKVA 3JW4A 4LGWA 3R4KA 2E19A 3A01A 2TDXA 2L9NA 4A6DA 1OR7C 2K9NA 2HDDA 2R7SA 3SFIA 4D7NA 5D5XB 2X6YA 3G1OA 3MKWB 3C3WA 4G6DA 1Y39A 2LBFA 4N9HA 2R5ZB 2VODA 3VB2A 2DJNA 2Y9ZA 3HRUA 3M3YJ 3UKGA 2VJ5A 3DPLC 2Q0OA 4KYWA 4XLEA 1GUUA 3NAUA 1J0RA 3CMAI 4AYBA 1D0YA 4M3EA 4C3JJ 3K2ZA 1ETQA 1K7AA 2M8GX 2EV6A 1XMKA 2MW8A 4L5JA 5FROA 5IP9J 3FXRA 4LB6B 1JTXA 5M5YJ 4PJMA 2LKXA 1BI0A 4HF1A 4HYEA 1K79A 5J1UA 4QPQA 2OD5A 2OJED 3OYBA 3ZMDA 1IF1A 3WE3A 1NG6A 3DEWA 2VI6A 3S1NJ 4AIKA 4UV9A 1I39A 4IHTA 3K1MA 4FT8A 3TP0A 3CCQI 1X1AA 1MH4A 4E7IA 3FXLA 1D8KA 1MW7A 3NWTA 2F5EA 4UHTA 1VQ9I 2HYJA 2VPLA 3S3MA 4I76A 3KP4A 3UR3C 2CU7A 4Y15A 1TQPA 2MD5A 2E1OA 3CO6C 2GA1A 1IDYA 3E7LA 5M3MJ 4U87A 4BH9A 5FKNA 4P9FA 3ERMA 3D0SA 3EETA 5HS9A 1P4XA 1PYVA 2L2OA 2YS9A 3ABTA 1FJLA 5FKKA 3RKQA 2V26A 4RLQA 4UB8C 4PJJA 3PIOF 1IN7A 2GIVA 3F9KA 2GIZA 1BIBA 2ECCA 5CQEA 3MFKA 5TRDA 4XORA 1JJ8C 4L5IA 2XRLA 1G8XA 2XGEA 2DODA 1XTAA 3CJRB 4IO9F 3E6DA 5LGNA
chains in the Genus database with same CATH topology
2GOMA 3SEQA 3S32A 3ONQA 4X0GA 1UG0A 3OYEA 3H5AA 3I9V2 3LSGA 2M0MA 4BS9A 3K4BA 5FRNA 2MD0A 3OYFA 3H0DA 3H5NA 4BQQA 3PJRA 2CV2A 1Y6IA 2PMZA 3DPTA 4Y33A 2VL8A 2ZSHB 3KX2A 4B43A 4BE2A 2KLOA 4LIUA 2MABA 4PJLA 2VJ4A 2CMPA 3I3LA 1ERDA 3HPGA 4QPOA 5KNLA 2CW7A 2V4JC 2F4IA 3HPHA 4ZJZA 3J7AY 4ZDPA 1E0EA 1MMGA 2Y0SA 4BEHA 3OS1A 5HOOA 3K4LA 1FMWA 3IUOA 3MKZA 1WJBA 2F5VA 3ZR8X 3K4JA 1BR2A 3OYMA 2O5RA 2WB1A 2Z16A 4PJNA 2VQCA 4KT6A 1FMVA 1K6YA 2X6WA 4XONA 1PJRA 3D5LA 3HOSA 3VYSB 1T0FC 2BVMA 4BDYA 4OWRB 2R7VA 2LY2A 2RQQA 1X1CA 4PK4A 2IGNA 3ZCOA 4CCNA 4LG3A 3OYCA 4BJ5C 2Z1DA 1V5EA 4HEA2 3W2AA 3OWTA 3QYFA 4KJZA 2HVQA 2ZXIA 4BACA 2W82A 1MNEA 3A2KA 3OR1C 2KDOA 2CFOA 4ZTJA 3OYGA 2V1NA 4B47A 2PJRB 2WA0A 2IGMA 2M7BA 3OS0A 3EUKL 3HXLA 1JI8A 2AQFA 1TT0A 3PUBA 1N77A 3PFYA 2KRCA 3H9JA 2LH9A 1IRXA 3GBGA 2LYCA 3CP2A 2IS2A 2IS1A 3VYUB 3OYKA 2MYSA 3S3OA 3UNGC 2X1DA 4BUPA 2CS3A 4R79A 3OYNA 2ZFUA 3K70D 3DQVC 3OMYA 2XF5A 4ANJA 4BE1A 4BJTA 2VLAA 4PUSA 2IGOA 3DTEA 1WJEA 4C2UA 4MLOA 3W2VA 4E7ZA 3EUHC 4XN0A 4XNFA 4CCKA 2UWMA 4J01A 4ZC3A 2K5CA 3OYAA 1X4OA 2X1CA 1X19A 4BXFA 1VZ0A 1R6RA 3E1SA 3HC7A 3L2UA 3L2VA 2HDWA 4II3A 4PSXA 4F52A 2R7TA 3BCAA 3IP4B 4OAYA 3LSIA 2AQEA 3LFUA 3DTIA 2ZXHA 4HG2A 2Q1ZB 4BJ6C 3L2WA 1AA7A 2XDVA 1Z3XA 4NUBA 1X4PA 4XR6A 3TBIA 2V7FA 1G59A 4XMYA 2M4KA 2M7AA 2L9SA 2VQGA 2WADA 3CESA 2LREA 3FDYA 4ZTFA 4RM2A 2E60A 3TL4X 3SEZA 4F91B 4CZCA 2WBMA 5KCMA 3IAS2 2HPIA 2L5QA 2V6EA 1D1CA 4DIQA 2JA2A 2UUZA 3PNYA 2CH0A 3S3NA 2LC2A 3VYRB 2KHMA 2A5WA 2DCEA 2W1OA 1LFPA 4FETA 3OY9A 3AFHA 5KHDA 1UAAA 2K3PA 4PSWA 3ZXSA 1J09A 2M4GA 4NQWB 2F6CA 2QKLB 4HPQA 4BU2A 1DQUA 3OR2C 2CV0A 3S8PA 2IXSA 2DJIA 2XSJC 2E5NA 4DJAA 4XKBA 3M1CA 2X85A 2IS4A 4XKVA 2W00A 2X1EA 5FRMA 3LMMA 2XC7A 2KP6A 3CJQB 3K10A 4DOZA 2W4SA 2LG4A 4XOTA 4U7BA 1LKXA 3OYLA 5HNHA 1SFKA 1U0JA 2M3AA 4NNJA 2KMUA 2KRHA 3DLAA 3ZRGA 2LY1A 2BW3B 2VKDA 3CZ6A 3BC8A 3BG6A 2I8DA 4H4KC 2VJJA 3FHNA 3RPUD 3RSNA 1D1BA 4P1WA 2R7WA 4KISA 2V9KA 2Z2SB 4Y4RA 4DBQA 4PFOA 1N78A 3PSIA 3OYDA 2HNHA 2LOOA 2Q2EB 3A1YA 3H9GA 3H35A 5CKTA 3VWBA 4DGWB 1MNDA 2XF6A 3W2WA 4D1QA 4XKWA 1WJFA 4F93B 2X51A 2R7OA 3DU5A 4AVZA 3K4CA 4F3QA 2DT7B 1QU3A 4CH7A 3VYTB 3BLYA 4XL9A 4C2TA 4GRIA 4DBRA 3AL0C 3QOEA 4YEJA 2PJRA 2P0WA 3MKYB 2HVSA 3PNVA 1Z7LA 2DT6A 1WFXA 2IS6A 4BE0A 1D1AA 2JVHA 2VB6A 1UELB 2R7XA 3PSFA 4Y3OA 2WAQA 4CSWA 4D9JA 2MFZA 3W3CA 5JHFA 5LD2C 3MD2A 3MMYB 3FKJA 4BL0B 1W36C 1MMDA 2JUGA 2WAFA 3SDBA 4CUGA 3BG7A 4E7HA 2K9LA 1N75A 4E7LA 3OYJA 1YX5A 4E4HA 1DGWY 4JOMA 2XF7A 4RM3A 3CMMA 4ZDLA 4PFPA 3G2BA 4EATA 4XLHA 4CA0A 3U21A 3H9QA 3FBIB 3A4CA 4XKCA 1V5GA 3QODA 2L7KA 1T95A 2K9MA 2QKMB 2R4GA 3ZQQA 4XOPA 3PNTA 4G6TB 2XAUA 4JQFA 3E0JB 2ELJA 2DXIA 3KYLA 3IAM2 2E5ZA 3VDXA 1MMAA 1BR1A 1Z3YA 2UV1A 4XLFA 2VXZA 4YELA 3K6GA 1QHGA 2RNGA 1TZLA 3D5RC 3CP8A 2OC6A 2WY7Q 2R7RA 2VIXA 3KEYA 4IQJA 3SYTA 1WJDA 1SAUA 1P9QC 3VSKA 1KONA 4KITB 3C2GA 1GLNA 2A6TA 1Y56A 1WJ5A 2JVGA 3V42A 4AU7A 2W7NA 4ITVA 4E7JA 3OOUA 1OLTA 2WY8Q 4LITA 5TGTA 1YX3A 3RTRA 4XLCA 2RREA 4IKFA 3SZGA 3VSLA 4C9YA 2HPMA 2LRDA 3HKZA 4BEHB 3OS2A 4HSRA 4II2A 2VJIA 3OYIA 3TMOA 4RLFA 4IX7A 4IZZA 4XN3A 3OIPA 1HA8A 1LDKB 2VASA 1MMNA 2CUZA 3K4NA 1X1DA 4RMNA 3OYHA 3OIQA 3OL3A 2OV7A 3QYBA 4XQFA 3N05A 2FUG2 2VQHA 2CW8A 3LSKA 4B48A 4E6KG 1V5FA 3HG9A 1D0XA 4BGDA 2OUMA 4CCLA 3EUAA 3S93A 3K4KA 2NOJB 1QHHD 4ZYAA 4HNTA 2VKHA 3NWSA 3H5RA 5HNFA 3PL8A 2LBFB 4BDZA 4IQ4A 4YRVA 4NC7A 2X6XA 2JSPA 2R7QA 3RCOA 2KQRA 1DP3A 1WJAA 4N4NB 3DWLE 3CF2A 4B44A 1S9HA 2BW3A 3K4MA 3C2HA 3HL2A 2L9NA 2R7UA 1OR7C 2R7SA 2X6YA 3MKWB 3HUGB 3M8JA 1LVKA 2LBFA 3DKXA 4J00A 2DOAA 3BCBA 1NG7A 3DEEA 2VJ5A 3D5SC 3DPLC 3DU6A 1Z21A 4BQNA 4OAZA 1DGRM 4XLEA 3K70C 2MC4A 4AYBA 4XLAA 1D0YA 2KPMA 3AL0B 2CUJA 2HZDA 5FROA 1ZELA 3AKZA 4CCMA 3ZGKA 2E1MC 3OL4A 3LSMA 4P5OA 3DPUA 4PJMA 2CV1A 2HVRA 4QPQA 2E1MB 3LSHA 3L2QA 3OYBA 5LFAA 4LIVA 2VXDA 1NG6A 4CCOA 4ZDOA 4E7KA 2HU9A 3RQ4A 4F55A 1YE9A 4XM3A 1X1AA 5HVQC 2KL4A 4N4OB 4HSTA 4E7IA 1MW7A 3NWTA 3QYEA 4HRIA 1BOBA 2BOLA 2VPLA 3S3MA 3FBNB 1W36D 1X1BA 3UR3C 1EA3A 2VQLA 4C30A 3L2RA 4F92B 4U87A 4B3XA 2KZVA 1D0ZA 5CQGA 3HOTA 1PYVA 2L2OA 3DTKA 3EPZA 2WAEA 2V26A 4RLQA 4PJJA 3F9KA 2HQAA 5CQEA 4XORA 3LL7A 1BR4A 5HLTA 1G8XA 4CCJA 2GOXB 2BVLA 2ZSIB 3CJRB 4HNUA 4E7SA 1WJCA 4BQOA 4FASD 3DKYA 2IGKA 5CPRB 4NC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  1YX3 A;  3OR1 C;  2V4J C;  1JI8 A;  1SAU A;  3OR2 C;  2XSJ C; 
#chains in the Genus database with same CATH topology
 2ADU A;  2GM4 A;  1QRY A;  4RAG A;  3SDG A;  5IYD J;  2Y2Z A;  3LSG A;  3IC7 A;  2PI0 A;  3HGG A;  2H09 A;  4HQM A;  1YG2 A;  3OYF A;  1BW5 A;  3DBL B;  4BQQ A;  3PJR A;  2PMZ A;  1AWC A;  2L7M P;  3V4G A;  4FQG A;  1N25 A;  4PJL A;  5EZH A;  2RNJ A;  1ZR4 A;  2GXB A;  2DAO A;  2IVM A;  4QPO A;  3ZQF A;  4RB1 A;  2CW7 A;  2DA1 A;  2XRO A;  2V4J C;  4ZYH A;  2UZK A;  3FMS A;  2G0E A;  4IRG A;  2IA2 A;  5E1X A;  3J7A Y;  3E5X A;  3IL2 A;  2DYR H;  3GX4 X;  4G8X A;  2HYF A;  1E0E A;  1DPU A;  4BEH A;  3BR5 A;  4OMZ A;  2DA7 A;  1R00 A;  4XSZ F;  3BQZ A;  5DCF A;  3G3Z A;  2F5V A;  1WWX A;  2D45 A;  1J7K A;  1VQN I;  1KU7 A;  2DQR A;  4MNU A;  2OCE A;  5GP9 A;  2Z16 A;  4JX5 A;  2XGD A;  4IJA A;  4KT6 A;  3HOS A;  3QU3 A;  3VYS B;  2BVM A;  1W7P A;  2BYV E;  4CDG A;  5E18 F;  1BJZ A;  1OCP A;  4C3I J;  2RQQ A;  5DCM B;  1X1C A;  4DZP A;  5EG0 B;  1ZAO A;  5EGO B;  5BOX A;  1SFU A;  2R7Z J;  1MKM A;  5F04 A;  2W57 A;  2FML A;  2VBZ A;  3E5U A;  1W0U A;  3KZI C;  4ENN A;  5GAE J;  4HEA 2;  2HFH A;  2HXO A;  3GTP J;  3BJ6 A;  2A61 A;  1MNE A;  2L9R A;  1LDD A;  4MGR A;  4RS8 A;  2KDO A;  4KIG A;  4B47 A;  3QPH A;  4M9Z A;  4CYC A;  1IXC A;  5L3F A;  2P6S A;  2XKP A;  2AQF A;  4Q47 A;  1TT0 A;  3U1D A;  3FHZ A;  4AID A;  5K5Q A;  2QM3 A;  2KRC A;  5EDN A;  2LH9 A;  1ZG1 A;  1IRX A;  2AHQ A;  1IGN A;  1ZLK A;  2FU4 A;  2IS2 A;  2IS1 A;  3CC7 I;  2MYS A;  3S3O A;  4WF2 A;  3PFI A;  1ODD A;  3B6A A;  3J81 K;  3DQV C;  1Z6R A;  3OMY A;  4BYY A;  4N0B A;  3MQ0 A;  4KN7 X;  5E20 A;  2QBY B;  3LNQ A;  2UXN A;  4I01 A;  4E7Z A;  1H88 C;  3LA7 A;  4XNF A;  1PUF A;  2UWM A;  2P81 A;  3HEF A;  1TC3 C;  2W24 A;  1OCR H;  3HOW J;  3L09 A;  1X19 A;  2X1C A;  1SMT A;  2GQQ A;  1G3T A;  1R6R A;  3Q3S A;  4M3G A;  4XRF A;  2VOP A;  2IEK A;  2L9V A;  4NDL A;  3CD6 I;  1D3Y A;  2DFE A;  3BCA A;  3IP4 B;  4OAY A;  4UVB A;  1VFC A;  1U2W A;  3MAJ A;  2STT A;  4I99 C;  4A5N A;  3DTI A;  5E3O A;  2Q1Z B;  5HDG A;  3E3V A;  3S14 J;  5BQT A;  3T1B A;  1AA7 A;  2RV8 A;  1Z3X A;  3TBI A;  4XMY A;  2XPV A;  1XMX A;  1Q1V A;  4NBQ A;  4RGX A;  1MSF C;  2QSH X;  1Y1V J;  2BXZ A;  2E60 A;  1FBU A;  5KVR A;  5J1Y A;  4WXH A;  4F91 B;  4CZC A;  4LFU A;  4EJT A;  2EA2 A;  1S8N A;  1H9G A;  2COM A;  3EYI A;  4OIO F;  1B1B A;  1R5I D;  2ID3 A;  4DIQ A;  3ECO A;  1RI7 A;  3MKL A;  1FP1 D;  2COB A;  2LTP A;  2VKE A;  3S3N A;  3AG2 H;  2H6B A;  3BZK A;  1AU7 A;  2H6C A;  4D7M A;  5CVI A;  2KHM A;  1X3Z B;  2DCE A;  1HW2 A;  5KHD A;  2OF7 A;  1D8J A;  1FSH A;  4FIS A;  1W5S A;  1J09 A;  1USS A;  5HLG A;  1S7A A;  2M4G A;  3GCM A;  3FXQ A;  1FOW A;  1JKP C;  2TRT A;  2D5V A;  4D5C A;  1LFB A;  4ABZ A;  2BY3 A;  2MH9 A;  1PUE E;  3R0J A;  4J19 A;  1E3H A;  4ETS A;  4A3B J;  1T2K A;  2IXS A;  4DJA A;  1ZQ3 P;  2EIJ H;  1VQL I;  2X85 A;  3KEQ A;  4KUM A;  2X1E A;  3LMM A;  4GDF A;  1TBX A;  2K27 A;  3K10 A;  1ETO A;  2RKH A;  2DLL A;  1JUS A;  3JRH A;  2P6T A;  1X2M A;  4M3B A;  4BXU A;  4U7B A;  1TL8 A;  5HNH A;  1SFK A;  2AO9 A;  3LSR A;  3ISP A;  3RPU D;  3KCC A;  3A01 B;  2XVC A;  4IRH A;  1MSE C;  1LB2 A;  2O8X A;  2UXX A;  1AKH B;  3TO6 A;  3DXJ F;  5IYB J;  5J4Y A;  3HSF A;  4XSX F;  4L0Y B;  1VND A;  1R23 A;  5FFZ A;  2QQB A;  2JQ7 A;  1A5J A;  3ZQH A;  3PSI A;  2XRN A;  2MA3 A;  2JPB A;  2HNH A;  4G7Z F;  1Z9C A;  2LOO A;  2B9S A;  4LLL A;  2HTJ A;  2F48 A;  4R8H A;  3VWB A;  1FBS A;  1UHS A;  2XF6 A;  2QYO A;  1ZGJ A;  4YII A;  3DEU A;  5H2F C;  3PIP F;  2YR2 A;  1ZH5 A;  5C4J J;  2XAQ A;  5FLV A;  3DU5 A;  2NNY A;  3CCY A;  3KP6 A;  4F3Q A;  2ZJQ F;  3G73 A;  3SZP A;  2R92 J;  2R7F A;  3VPR A;  4CH7 A;  5JVG F;  2JA7 J;  4XL9 A;  4C2T A;  2ZXJ A;  4GRI A;  4DBR A;  5FLM J;  4OIR F;  3QOE A;  2P0W A;  3REO A;  4HV6 A;  1IAW A;  3HJE A;  5GPC A;  3HOY J;  4GXO A;  3W6V A;  2DT6 A;  3E5Q A;  3ZN0 A;  5FLX Z;  2IS6 A;  4M3F A;  1D1A A;  1ENH A;  3TW7 A;  4LMY A;  2R7X A;  2ZC2 A;  2WAQ A;  4UXN A;  3JCU C;  5DEQ A;  1YFH A;  3MD2 A;  4HF2 A;  4KA4 A;  5CVU A;  2KIU A;  4LK1 F;  4I6Z A;  4L0Z B;  2KIF A;  1YX5 A;  4DQ2 A;  5D4S A;  5JLW A;  2NXN B;  1UFM A;  1LFU P;  1ETY A;  2EZH A;  2JRT A;  1IRG A;  1JUP A;  3G2B A;  1R5H A;  3FMQ A;  4W97 A;  1T8I A;  3U21 A;  2EBI A;  3A4C A;  5M3F J;  1OMI A;  3OIO A;  4XID A;  3KE2 A;  2DA3 A;  2K9M A;  1LEA A;  2R4G A;  1MDM A;  4G6T B;  4A3K J;  4OOI A;  3LAJ A;  3E0J B;  2NAZ A;  2ELJ A;  1NTC A;  3WU2 C;  1W5T A;  2ZBK A;  2MG4 A;  2IA1 A;  1MMA A;  3QQA A;  1FOX A;  2G7U A;  1TW3 A;  4FCY A;  4LLG F;  2CUE A;  1TZL A;  2VBY A;  3M7G A;  2A5Y B;  2VIX A;  1RC9 A;  1FP2 A;  3F8M A;  2K9S A;  3SYT A;  4KIT B;  5DV5 A;  2R3S A;  1RNL A;  3COA C;  3TED A;  2K40 A;  5EEG A;  1L0O C;  3NRV A;  2FMY A;  3OOU A;  4E7J A;  1FYK A;  5TJJ A;  1H8A C;  5KAF C;  4A3D J;  4IKF A;  2HR3 A;  2RRE A;  3A0B C;  4RA2 A;  4XLC A;  2LF7 A;  1FC3 A;  1JGG A;  4L9N A;  3VSL A;  3RJP A;  1ETW A;  3GXO A;  4RGU A;  4BEH B;  5J3L A;  1R1U A;  4HBL A;  1BC7 C;  4II2 A;  2QEX I;  2VJI A;  2KDZ A;  2A3S A;  4DYQ A;  4XN3 A;  5KK1 A;  1RUN A;  4A3F J;  4PDK A;  2DMQ A;  1LDK B;  1SD4 A;  2L3D A;  1XG1 A;  2QLZ A;  1ACI A;  3GF2 A;  1JHH A;  3OIQ A;  3OL3 A;  2OV7 A;  1R36 A;  5LHI A;  4BKX A;  2Y0S N;  5FLX K;  2ECB A;  3MZH A;  4NQW A;  4A3G J;  2VQH A;  3T8T A;  3TP3 A;  1W7P B;  1V5F A;  3WTV C;  2L7Z A;  5F64 A;  3A03 A;  1W4M A;  1IJW C;  1FT9 A;  3GEZ A;  2FF4 A;  4CCL A;  3EUA A;  4A2U A;  3K4K A;  2NOJ B;  1QHH D;  1YHQ I;  2K86 A;  2LSO A;  1SAX A;  4HNT A;  1G3Y A;  3PO3 J;  3H5R A;  5L3G A;  1QZZ A;  5HS8 A;  4HX4 A;  4L18 B;  2M87 A;  3J7A O;  1D5V A;  4YRV A;  3ABU A;  2E2H J;  3J7Y J;  1XCV A;  2KJC A;  2KIS A;  4N4N B;  4V2F A;  4EQQ A;  3RZO J;  4WX9 A;  3HRS A;  2PMH A;  2BW3 A;  3K4M A;  1O3Q A;  2V79 A;  3HL2 A;  1WI3 A;  1SD6 A;  2ME6 A;  2XB0 X;  2YX4 A;  3WHC A;  2HS5 A;  3S16 J;  1O7L A;  1ONV A;  4HLX A;  3LOC A;  3P9C A;  2W25 A;  1JTY A;  2ZB9 A;  3BTC A;  3BCB A;  3FXO A;  5LLQ A;  5EYR A;  1I3Q J;  3DU6 A;  3I56 I;  5ERI A;  4OAZ A;  3TDZ C;  3FM5 A;  4XRM A;  1SVL A;  3K70 C;  1WSU A;  3RKY A;  1KQ9 A;  1X3W B;  3NAR A;  4CO8 A;  3V7C A;  2E2J J;  3G1L A;  3BOQ A;  4DW6 A;  1LPQ A;  3AKZ A;  4CCM A;  1SC7 A;  2LKS A;  3FXK A;  1PUF B;  4U0V A;  2XKO A;  1ZGW A;  3DBH B;  1SFX A;  2CV1 A;  2L02 A;  1TWG J;  1V55 H;  1IDZ A;  3H36 A;  3QWL A;  5J6X A;  1B8I A;  2HU9 A;  4EEF G;  3QPS A;  1WKM A;  5HVQ C;  1DPR A;  4HST A;  4R1H A;  5B1A H;  2WAQ N;  2W85 A;  2VPR A;  4HRI A;  2NVU B;  2B63 J;  5GAD J;  1LDJ A;  3AG1 H;  3RDI A;  1YIT I;  1KA8 A;  1X1B A;  1IN4 A;  1VQ4 I;  4C30 A;  1MBK A;  3KZZ A;  3L2R A;  4ENM A;  4RGS A;  3O3K A;  3F6V A;  2KZV A;  5ICG A;  2E1C A;  3WTY C;  3ULQ B;  1HC8 A;  1FIA A;  4ZYG A;  1MMS A;  1T39 A;  1WCM J;  2WAE A;  1OYI A;  2F5D A;  2OA4 A;  3E97 A;  3Q0W A;  4I0B A;  1I1G A;  1FTZ A;  4MIM A;  3BR6 A;  5ICE A;  3IH3 A;  1Z1D A;  3BPV A;  2IT0 A;  2JA6 J;  5HOD A;  1BR4 A;  1XC5 A;  5HLT A;  1U3E M;  4NB5 A;  2FX0 A;  3M4O J;  4U88 A;  3JTH A;  3FXU A;  1WJC A;  4I2O A;  3C1D A;  4BQO A;  1YIJ I;  1VQ5 I;  3U9G A;  3DKY A;  2Y0M A;  4HNV A;  2DMT A;  1S29 A;  3GZ5 A;  3LQQ A;  2GOM A;  2XV4 S;  3SEQ A;  3S1M J;  5ILU A;  3H5A A;  2V9V A;  3I9V 2;  2Q8K A;  1SEU A;  2H8W A;  1XDS A;  2PFB A;  2MD0 A;  2WC2 A;  2VE9 A;  5CJ9 A;  3H0D A;  2DBB A;  3H5N A;  4DYC A;  5A2Q K;  2KLO A;  1MBG A;  2J5O A;  2EZI A;  4Y17 A;  4LIU A;  3T0Y A;  3ZMV A;  2CMP A;  1JHF A;  2BEO A;  1IUF A;  3I0T A;  4YFK F;  1ZRE A;  2F4I A;  3H3U A;  4KFC A;  4GYI A;  1IV6 A;  3K69 A;  3SJM A;  4ZDP A;  2F5F A;  2EFO A;  3SHF A;  4MO7 A;  5D8K B;  3ELK A;  1X58 A;  1FMW A;  1WJB A;  2WB1 A;  1BI3 A;  3ZQI A;  2VQC A;  4S05 A;  1FMV A;  2X6W A;  2K9Q A;  1MBJ A;  2QSF X;  2X4H A;  4M6V A;  3F23 A;  3D5L A;  1ORK A;  3G6E I;  1TQM A;  1SFO J;  4P9U A;  3RPQ A;  5AIQ A;  1FLI A;  2LFB A;  4BDY A;  5BS6 A;  2R7V A;  3T5X A;  1IUY A;  2LY2 A;  1WH7 A;  2VBX A;  3KZY A;  1PDN C;  3F8N A;  4LG3 A;  2LVS A;  4HX8 A;  5H20 A;  4BJ5 C;  3MZY A;  3HOZ J;  1IRZ A;  3LFK A;  4S04 A;  4BAY A;  2K4B A;  3QYF A;  4O3M A;  4KJZ A;  3IV5 A;  2JTV A;  4I0A A;  1QZE A;  4BAC A;  3GUD A;  4XLN F;  4CYD A;  3A2K A;  2VC1 A;  1J9I A;  3DBR B;  2CFO A;  3OYG A;  4V19 K;  4HAM A;  2OTL I;  1JI8 A;  4D5F A;  1N77 A;  1HST A;  3HUG A;  3JRF A;  6PAX A;  3PUF A;  1FEX A;  1T6S A;  2CQQ A;  3OYK A;  2ISZ A;  3BTL A;  4BUP A;  1SD7 A;  1GDT A;  1LNW A;  1XGN A;  4PCQ A;  1ZLJ A;  2HYG D;  2OQR A;  4ANJ A;  3U1K A;  2D1V A;  2KJB A;  5LRS A;  2IGO A;  3HB9 A;  1K78 A;  1OCO H;  3DTE A;  4G9Y A;  5IY5 H;  4C2U A;  5F0H A;  3W2V A;  1QO0 D;  2EZL A;  3WTS C;  5GTI C;  5IPA A;  4XN0 A;  2O6G E;  3L2C A;  2BHY A;  3J80 K;  1YI2 I;  4IHX A;  3T8R A;  1VZ0 A;  3I53 A;  3PM1 A;  2FQ4 A;  5LEJ A;  1DP7 P;  4UNO A;  1MDM B;  3HC7 A;  3L2V A;  3HOV J;  2NVX J;  1U5T C;  2R7T A;  2F2E A;  1WQ2 A;  3BP8 A;  4HX7 A;  2ZJR F;  4HG2 A;  2L4M A;  1F4K A;  5TIS C;  1F43 A;  3CTA A;  3WTZ A;  2XDV A;  2LKP A;  3LSJ A;  2MBF A;  1IO2 A;  3I4M J;  1G59 A;  1FY7 A;  1NH3 A;  2WAD A;  2O3F A;  2LRE A;  3FXJ A;  2GZW A;  2D2W A;  2Y31 A;  3BJA A;  1PP8 F;  3CLQ A;  2XSD C;  4RB3 C;  3S15 J;  3J81 Z;  2Z5U A;  1W5C C;  1A36 A;  3ZN1 A;  3IH4 A;  1V54 H;  5KCM A;  1SD5 A;  1ZRC A;  5ICC A;  3FIS A;  1XPX A;  2VN2 A;  2L5Q A;  2V6E A;  5L3B A;  1IW7 F;  2JA2 A;  3BRO A;  3EQL F;  3CC2 I;  4IHY A;  1I3A A;  5C44 J;  3E6M A;  2LC2 A;  3QU6 A;  2W84 A;  3MN2 A;  2J5P A;  4DZJ A;  3OY9 A;  2E34 A;  1ZRD A;  3I59 B;  2LY9 A;  4EJO A;  4YFX F;  2ZJP F;  3TW6 A;  4NQW B;  2F6C A;  4NC6 A;  4W1U A;  3PQJ A;  5LBQ A;  4BU2 A;  3ZMT A;  4KIC A;  4JX4 A;  1DQU A;  4L9T A;  2ELH A;  3S8P A;  1KYW A;  1XCB A;  2XSJ C;  1KQ0 A;  4WCG A;  2ZO4 A;  2X0L A;  1T33 A;  3Q9S A;  2IS4 A;  4XKV A;  2W00 A;  5FRM A;  3JSP A;  2XC7 A;  1ETX A;  3CJQ B;  2NVQ J;  5F27 A;  3WG7 H;  5AIP A;  2B7E A;  2LG4 A;  2EQR A;  1LUJ B;  3CF5 F;  1U0J A;  3FZV A;  4B4C A;  2M5W A;  5J8C A;  4NNJ A;  2LY1 A;  1YS6 A;  1OFC X;  2BW3 B;  2I8D A;  2PG4 A;  2DU9 A;  2VJJ A;  1OKR A;  1R5G A;  3FHN A;  5FKO A;  4EM2 A;  1HF0 A;  5HLI A;  3CLO A;  1XSV A;  2CWE A;  4KIS A;  2V9K A;  2Z2S B;  3ROU A;  4DBQ A;  4PFO A;  2QEN A;  2YPR A;  4A3C J;  3HOU J;  1U9O A;  2AXT C;  2DOF A;  2C6Y A;  3OYD A;  5F0F A;  3GFL A;  2CQ7 A;  5FD5 A;  3K1N A;  5FKM A;  4XKW A;  2YU3 A;  1O3S A;  1F1Z A;  1VI0 A;  2LDU A;  2R7O A;  4F93 B;  2JA5 J;  1BJA A;  1YRN A;  3ML6 A;  2DT7 B;  2EIN H;  3VYT B;  2ESH A;  1QVU A;  4HDU A;  5FB2 A;  3V8K A;  3H92 A;  2VT3 A;  3AL0 C;  5HLH A;  4AYB N;  4MTD A;  4KNY A;  2DMU A;  2PJR A;  1S7O A;  3G71 I;  1B8I B;  2JZY A;  3B6C A;  4BQA A;  5L3D A;  3HBL A;  5IT9 K;  1XSX A;  4CHU A;  1RPW A;  3KP2 A;  4BY7 J;  1RR8 C;  1HOM A;  3O2P E;  3PSF A;  3I5U A;  4EGZ A;  1JKO C;  2R5Y A;  4UUS B;  1SAN A;  1W36 C;  1MMD A;  1S7E A;  3JAM K;  1P6R A;  5D4R A;  3TO9 A;  3SDB A;  3BG7 A;  4IF4 A;  1HW1 A;  1TT5 B;  3AAF A;  4E4H A;  3QRF F;  1W1W E;  4JOM A;  4Y52 J;  2FA5 A;  1DDN A;  1IC8 A;  3CMM A;  4ZDL A;  1U5T B;  5J40 A;  3LSP A;  4XLH A;  5F1R A;  4EVI A;  3FBI B;  4XKC A;  1V5G A;  1NHA A;  3ZMZ A;  2GXG A;  2QKM B;  2A68 F;  1F36 A;  4JQF A;  3JRG A;  4D0P A;  1A35 A;  2XAS A;  2JT1 A;  1Z91 A;  5LGU A;  3KYL A;  1MBH A;  4X6A J;  2ELK A;  1Z3Y A;  1BR1 A;  4BY1 J;  2UV1 A;  2VOO A;  2CYY A;  2OZU A;  3CCV I;  3S2H J;  1FOK A;  2RNG A;  3D5R C;  2R7R A;  3OV8 A;  2XAF A;  2BGC A;  4NHJ A;  2RQP A;  2MH2 A;  2XPW A;  1SAU A;  5IOY A;  1R7J A;  4FTH A;  2A6T A;  3CQZ J;  1X3U A;  3MWM A;  1I5Z A;  2ZXW H;  1WJ5 A;  3CO7 C;  3DFG A;  4AU7 A;  4Q4Z F;  1VQ6 I;  4ITV A;  4A3L J;  1H0M A;  1WPK A;  1GVJ A;  2XHK A;  2LMD A;  4C9Y A;  2HPM A;  1Z0X A;  1GT0 C;  3HSE A;  2LRD A;  3HKZ A;  1H9T A;  2PMZ N;  2LR8 A;  3OS2 A;  1Y0U A;  4HSR A;  4I7H A;  2H1L A;  1LE8 A;  2FOK A;  4RLF A;  5DTD A;  4IX7 A;  3CUQ A;  4IVN A;  2KZG A;  2XUB A;  1HA8 A;  3O6B B;  3F22 A;  1JKR C;  2Y69 H;  1MMN A;  2E36 A;  1X2N A;  3K4N A;  4JYK A;  2HDC A;  3OYH A;  2OBP A;  3QYB A;  4Z2Y A;  4XQF A;  4EM0 B;  4IEJ A;  4G6Q A;  3HOX J;  1S72 I;  4XBF A;  2DN0 A;  4Q48 A;  3L9F A;  1R1V A;  2GBY A;  3AG3 H;  2O9L A;  4A69 C;  3S93 A;  3ZMU A;  1RKW A;  5KAI C;  1UHM A;  3GO5 A;  2VE8 A;  2MSY A;  2VKH A;  2HOT A;  5HNF A;  3OSG A;  1W7P D;  4M3D A;  3PL8 A;  2LBF B;  3SXY A;  3ABL H;  3KP3 A;  3CCU I;  3S17 J;  2KRF A;  2PQ8 A;  3CDI A;  3RCO A;  2KQR A;  3IRQ A;  2O7O A;  5HS7 A;  4IHV A;  5GAH J;  3L00 A;  2E35 A;  3C2H A;  2EFP A;  1T0F A;  3S1Q J;  5DD4 A;  1NK3 P;  3F8F A;  4ZH4 F;  2EJR A;  2RN7 A;  3HUG B;  2GLO A;  1U8R A;  1ZK8 A;  4J00 A;  5DYM A;  1QVT A;  5E3L A;  4QWQ A;  1O3T A;  1NG7 A;  3GTL J;  3D5S C;  2ZKZ A;  2E2I J;  1OCZ H;  1Z21 A;  4KIF A;  2FXA A;  1DGR M;  2Q2E A;  1G3W A;  1JT6 A;  2MC4 A;  1Z67 A;  1XMA A;  2KPM A;  4OMY A;  3AL0 B;  2CUJ A;  1K78 B;  3HDD A;  2O8K A;  1ZEL A;  1BBY A;  2JSC A;  2DK8 A;  2R0Q C;  3OL4 A;  2K3F A;  2VT2 A;  3LSM A;  4M6Y A;  3JRI A;  3DPU A;  1PP7 U;  4OU0 A;  3A02 A;  2EIM H;  2P5K A;  2QQ9 A;  2E1M B;  3L2Q A;  1TWA J;  1RIO H;  4LIV A;  4ZDO A;  1B72 A;  1MJ9 A;  2KFD A;  2AXL A;  2GAU A;  4U0Y A;  1I6X A;  4ESB A;  1YE9 A;  2KKO A;  4XM3 A;  1IRF A;  4N4O B;  4E70 A;  1R49 A;  5IT3 A;  3LA3 A;  3BTJ A;  2CRG A;  1BOB A;  2BOL A;  4BHC A;  2DYS H;  3EUH A;  1VQ8 I;  4K2E A;  1DU6 A;  1EA3 A;  2IW5 A;  1SVO A;  3K2A A;  1MJA A;  2ZJ2 A;  3KP7 A;  4F92 B;  4AIJ A;  1ZYR F;  1G3S A;  3HIF A;  2K7L A;  1D0Z A;  5CQG A;  1MZB A;  3HOT A;  1Z7U A;  3CJT B;  3EPZ A;  2L54 A;  1A04 A;  2M1B A;  1YIO A;  2HQA A;  4HDV A;  3LL7 A;  3GFI A;  1XGM A;  3GTO J;  4CCJ A;  4EJV A;  2GOX B;  2BVL A;  4UVA A;  2NRA C;  4HNU A;  4AC0 A;  2I5U A;  4HLY A;  2BY2 A;  2JSP A;  3QYE A;  1MNM C;  5CPR B;  4NC8 A;  1A6Q A;  3HHH A;  5ICF A;  5K7F A;  2ZCW A;  4JK1 X;  5EZG A;  3ONQ A;  1UG0 A;  2DW4 A;  2PX9 A;  5H6R A;  2PMU A;  3FF5 A;  3K4B A;  2P5L C;  1EJ9 A;  4BXX J;  2ZFW A;  4YIR X;  2CV2 A;  3ECH A;  4B43 A;  2PJP A;  2ZSH B;  3KX2 A;  2FRH A;  3CCJ I;  1QPM A;  2MAB A;  4MFD A;  1ERD A;  3I3L A;  2EFN A;  3HPG A;  5KNL A;  2X48 A;  3W6J B;  2HKX A;  2R7D A;  3KYD B;  3HPH A;  4HA8 A;  3W6K B;  1P92 A;  2GWR A;  3WG9 A;  3HTS B;  3FWE A;  1MMG A;  4P96 A;  2M34 A;  2X9D A;  4IXA A;  5LHG A;  3OS1 A;  5F08 A;  5LEK A;  2Y75 A;  4LG0 A;  2E7W A;  3IUO A;  3BPX A;  3N4M A;  3HRT A;  3ZR8 X;  1K4S A;  2OPT A;  1BR2 A;  4A0Y A;  2O5R A;  1E2X A;  3ASO H;  1HDD C;  2QF7 A;  3KPH A;  1K6O A;  5FKL A;  1OQY A;  2B0L A;  1PJR A;  3TOB A;  3DCF A;  1YJ9 I;  4YIF A;  2JJ7 A;  4M6X A;  1T0F C;  5E1Z B;  1J5Y A;  4OWR B;  3DKW A;  3Q0U A;  2VC0 A;  5D8L B;  5CVJ A;  4CYC B;  2IGN A;  3ZCO A;  4ON0 A;  3X2Q H;  5DM7 F;  3FIW A;  2YSR A;  2XGC A;  3RKX A;  3HSR A;  3VOE A;  4G7H F;  5ED4 A;  1YRN B;  2QQA A;  3OWT A;  3W2A A;  2I10 A;  1RUO A;  2W82 A;  5A2Q Z;  2LD5 A;  3JRE A;  3VOD A;  3OR1 C;  1J59 A;  4ZTJ A;  4FE7 A;  4RBO A;  2V1N A;  2JWT A;  3IHU A;  1YW7 A;  2PJR B;  5EGO A;  4IOC F;  2IGM A;  3HXL A;  5DUI A;  1EF4 A;  3PFY A;  1DU0 A;  3IKV A;  1BL0 A;  2E71 A;  1ZRF A;  2A05 A;  2LYC A;  3QP6 A;  3VYU B;  3HRM A;  2DK5 A;  3WOD F;  1ZHF A;  3ZP5 A;  3GW2 A;  5ILV A;  1HSJ A;  2CS3 A;  3L1P A;  4R79 A;  2FSW A;  3OYN A;  1ZAR A;  3K70 D;  2P5V A;  3M8F A;  1JUM A;  1MIJ A;  1MBE A;  2XF5 A;  2IRF G;  4A3E J;  2DDB A;  2VLA A;  4GO1 A;  4S0H B;  2BXY A;  4JX6 A;  4GYG A;  1MJB A;  1WJE A;  3ZQ7 A;  5F6F A;  3EUH C;  1YLF A;  5E8I A;  4J01 A;  5JFR A;  3R0A A;  1IV8 A;  2K5C A;  3H0G J;  3IWZ A;  4B09 A;  1X4O A;  2EZK A;  5AON A;  5LGT A;  1APL C;  3V7R A;  2JPC A;  3I64 A;  3E1S A;  3FX3 A;  5GAG J;  3L2U A;  2XAG A;  4DNC A;  3GTQ J;  3HGY A;  2QBY A;  3VFZ A;  4AIH A;  5IP7 J;  2F4M B;  4A0X A;  2AQE A;  5L3E A;  4ZYE A;  2KIQ A;  1QNT A;  1FYL A;  2ME0 A;  3WGH A;  5B66 C;  1TWH J;  1IXS B;  2IPQ X;  4PGH A;  3L2W A;  1H89 C;  1GV5 A;  2H1K A;  2O03 A;  4NUB A;  2L01 A;  5IP6 A;  5CYV A;  3CCL I;  2NYX A;  2M4K A;  3R6S A;  3WGI A;  2M7A A;  2L9S A;  3CES A;  3FDY A;  4M72 A;  5J8F A;  4ZTF A;  3RQI A;  5JVT A;  2EH3 A;  5CVR A;  2QWW A;  3BWG A;  3WU0 A;  3V8J A;  1YJW I;  2WBM A;  4BNC A;  2O61 A;  1XB4 A;  3IAS 2;  1KU9 A;  2HPI A;  1F5T A;  1Y0N A;  4MQV A;  1D1C A;  3I4N J;  1HKQ A;  2UUZ A;  2QGU A;  2LNB A;  5FJ8 J;  3B73 A;  1POG A;  1LE8 B;  1HW5 A;  3CUQ B;  1I50 J;  3J80 Z;  3VYR B;  2A5W A;  2W1O A;  5DM6 F;  2LP0 A;  4O5V A;  4HF0 A;  1UAA A;  2K3P A;  3ZXS A;  3HZJ A;  3GZ6 A;  4ESJ A;  2H8R A;  2YU9 J;  3BZC A;  1Z05 A;  1QPI A;  2EV0 A;  4RB0 A;  5E17 F;  1ZGA A;  3BR3 A;  1KU3 A;  3ABM H;  3CME I;  3OR2 C;  4G7O F;  2CV0 A;  5EEH A;  3ZMS A;  1IN8 A;  3M1C A;  2OQG A;  1LVA A;  2HI3 A;  3SZT A;  1VQ7 I;  1E17 A;  2KP6 A;  4L9J A;  3SQN A;  4U7D A;  2QA4 I;  3OSF A;  4GFB A;  1LQ1 A;  2EV5 A;  2W4S A;  4XOT A;  4CGZ A;  1HKS A;  1LKX A;  1YOV B;  1UHW A;  4PJ0 C;  1TNT A;  2ETH A;  4C3H J;  2M3A A;  2ZNZ A;  2KMU A;  2KRH A;  3DP7 A;  3DLA A;  3ZRG A;  2VKD A;  1WGX A;  3BC8 A;  3CZ6 A;  1FOY A;  1YS7 A;  4N9I A;  1FNN A;  5E79 C;  3RSN A;  4P1W A;  3WTW C;  1P2F A;  1BA5 A;  1YO5 C;  2HXI A;  3M07 A;  2V9P A;  2V1D A;  1ETV A;  3F72 A;  3KEO A;  1R71 A;  4QLC U;  1Y8Q B;  2FEZ A;  5HDN A;  3IRR A;  5K5O A;  3Q0V A;  1OPC A;  3FM3 A;  2D1H A;  5ILS A;  2Q2E B;  3A1Y A;  4HW0 A;  4CZZ A;  5CKT A;  1IG7 A;  4DGW B;  1MND A;  4FX0 A;  3BG3 A;  4WXC A;  3E6B A;  5BNG A;  1ZG5 A;  1WJF A;  1AKH A;  3HHG A;  3GWZ A;  2FD5 A;  4GGG A;  1QU3 A;  3BLY A;  1TP4 A;  3WGG A;  2WV1 A;  2K02 A;  2L0K A;  4EMS A;  5B5E C;  2QQ8 A;  2EFQ A;  2Z33 A;  1ZN2 A;  5JLX A;  1B72 B;  2HVS A;  3D1N I;  2BZT A;  3DV8 A;  3KP5 A;  3PNV A;  1WFX A;  1B59 A;  4BE0 A;  1JGS A;  2X6O A;  1F9N A;  4EJU A;  2JVH A;  4UY8 I;  1OYW A;  1UEL B;  2DO7 A;  1FPQ A;  1T56 A;  2LF8 A;  4CSW A;  4WK8 F;  2MFZ A;  3W3C A;  1GVD A;  1G6N A;  2JK3 A;  3MMY B;  4BL0 B;  4ZZD A;  5F1J A;  2EIK H;  5IYC J;  4EGY A;  1HQC A;  3C2B A;  4GCV A;  2DPU A;  3GME A;  4E7L A;  3OYJ A;  4B8X A;  5CLS A;  2DPD A;  4LB5 A;  4L9V A;  4JP0 A;  3LAP A;  3WHB A;  1MD0 A;  3GFM A;  1A31 A;  4LLN A;  1HXD A;  2XF7 A;  5DS9 A;  1XX5 A;  3DLL F;  2L7F P;  2CFX A;  4PFP A;  4CA0 A;  2WWY A;  3RYP A;  5HDK A;  4JBA A;  2L7K A;  2ID6 A;  2XB5 A;  3ZQQ A;  3G1M A;  5C3E J;  3PNT A;  5BPD A;  4AM3 A;  3TQN A;  1QGP A;  2DXI A;  3MCZ A;  1BI2 A;  5L3C A;  3IAM 2;  2E5Z A;  2GA2 A;  2QZ8 A;  3VDX A;  1ITY A;  4XLF A;  4HZF A;  4ZZL A;  2VXZ A;  4YEL A;  3K6G A;  3NEU A;  1OCT C;  2V1U A;  4M71 A;  1BI1 A;  4RGR A;  3KEY A;  2EK5 A;  3GLX A;  4QSH A;  1WJD A;  1KGS A;  1P9Q C;  3VSK A;  5IT9 Z;  2P7C B;  2LLK A;  4RAY A;  5FFX A;  2HGC A;  3NQO A;  2CSO A;  3RZD J;  4LD5 A;  2WY8 Q;  1K83 J;  1RET A;  3PO2 J;  5TGT A;  1YX3 A;  3JAM Z;  3SZG A;  1WHU A;  2JUC A;  4UUV A;  3F8C A;  2A6H F;  4MFE A;  5FO5 A;  2R93 J;  2BBY A;  1RR7 A;  2HZT A;  3OYI A;  4LG0 B;  4IZZ A;  3BDD A;  3GVA A;  3C7J A;  3OIP A;  2JRM A;  1R4N B;  3V8L A;  2CUZ A;  1BOA A;  4PGG A;  1UST A;  2O0Y A;  1UJ8 A;  2AS5 F;  1P4W A;  1HKT A;  3ABK H;  2FUG 2;  2CW8 A;  3LSK A;  1R1T A;  2IA0 A;  4M9S A;  4O6J A;  4B48 A;  5F0C A;  4E6K G;  4IOA F;  3HG9 A;  1D0X A;  4BGD A;  1X1P A;  2K4J A;  5K5R A;  4IRI A;  2WB1 N;  3H3Z A;  5M5W J;  2TCT A;  3BJO A;  4ZYA A;  4MEY F;  2JN6 A;  2HQR A;  3QAH A;  3GZN B;  4A5M A;  4BDZ A;  1FYM A;  4IQ4 A;  3RPU A;  1P7J A;  2MGQ A;  3FXM A;  4NC7 A;  3MZ8 A;  2X6X A;  1VF9 A;  2R7Q A;  4DYR A;  5J1R A;  1DP3 A;  1WJA A;  3K1P A;  4LJZ F;  4B3A A;  2EA4 A;  1O3R A;  1Y1W J;  5GPA A;  3CF2 A;  1BW6 A;  4B44 A;  4A3I J;  2FBK A;  3K9T A;  2NS7 A;  2G7H A;  2R7U A;  1G2H A;  1KU2 A;  3M8J A;  1LVK A;  3CDH A;  3DKX A;  3I58 A;  3PQK A;  4M74 A;  2DOA A;  1JE8 A;  4MEX F;  3P7N A;  2N8G A;  2F4O B;  3DEE A;  3IKT A;  3J7Z I;  3TGN A;  1SFE A;  4BQN A;  4B1R A;  1U9N A;  4EM1 A;  2NOG A;  4G94 A;  3CUO A;  3O8G A;  4XLA A;  1EH7 A;  2HZD A;  4BHB A;  2V6C A;  3DF8 A;  4A3M J;  2ZME A;  1MH3 A;  3ZGK A;  2E1M C;  3OOP A;  1ULY A;  4P5O A;  5DDG A;  1S5L C;  4HQE A;  3KET A;  2IP2 A;  3C18 A;  2HVR A;  4IHW A;  3LSH A;  1Z77 A;  4AUX A;  5LFA A;  5LRR A;  2VXD A;  4CCO A;  2XIG A;  4WXD A;  4E7K A;  1FSE A;  3RQ4 A;  3P9K A;  4F55 A;  2JA8 J;  3EYY A;  2CQN A;  2VON A;  4C2M J;  2KL4 A;  2HOA A;  1WVR A;  5H6Q A;  3GTJ J;  3JTG A;  2M0C A;  4KDP A;  3GFJ A;  3I71 A;  3JR9 A;  3FBN B;  1W36 D;  1U8B A;  2VQL A;  1R58 A;  2FQ3 A;  1R9T J;  5K1Y A;  5JHU A;  1BIA A;  3WTT C;  4B3X A;  2PEX A;  1GXP A;  3DTK A;  1V3F A;  5E1W A;  2P7V B;  4BBR J;  2JMW A;  1GV2 A;  3KYC B;  4YFN F;  2XAH A;  2DDA A;  2DA6 A;  1TNS A;  4I98 B;  2EIL H;  4KIB A;  2HWV A;  4A0Z A;  3F8B A;  3FK7 A;  1Z6T A;  5D5W B;  2ZSI B;  4E7S A;  3LQR A;  2DTZ A;  5EF6 A;  2VBW A;  4FAS D;  4Z6Y A;  3JRD A;  2YX7 A;  2IGK A;  3K0L A;  5DD8 A;  3ASN H;  1JJ6 C;  1MGT A;  3S32 A;  4X0G A;  3OYE A;  1B6A A;  2M0M A;  4BS9 A;  2HOE A;  1O4X A;  2PBI A;  2IBD A;  4EV0 A;  5FRN A;  3FK6 A;  3CCR I;  5EJC A;  1Y6I A;  3DPT A;  1EH6 A;  2MLK A;  3U2R A;  4Y33 A;  2VL8 A;  1IZ1 A;  1QQI A;  4BE2 A;  1QZY A;  1XN7 A;  2VJ4 A;  1Y8R B;  3CCE I;  2NVT J;  1GHC A;  4ZJZ A;  2DFF A;  1E3P A;  2FBI A;  4FHT A;  2NS0 A;  2Y0S A;  2XPU A;  3CJN A;  2HQ5 A;  4G12 A;  5HOO A;  3S2W A;  1CF7 A;  4RAZ A;  3R60 A;  3K4L A;  1IN6 A;  3MKZ A;  4YG2 F;  1IN5 A;  1ZTR A;  3K4J A;  3OYM A;  2DMP A;  1Q1H A;  1QBJ A;  2OTJ I;  3IH2 A;  4PJN A;  2FNP A;  2CJJ A;  1MBF A;  1K6Y A;  1FIP A;  4XON A;  4A12 A;  1IXR C;  4EJW A;  2IJL A;  2HOS A;  3GTM J;  1FX7 A;  3KLN A;  1S3J A;  1YTY A;  1UB9 A;  4PK4 A;  3RI4 A;  4CCN A;  5JI6 A;  3OYC A;  2GXA A;  1I27 A;  4XLP F;  2Z1D A;  1B9M A;  3V7S A;  4V2G A;  5J4V A;  1V5E A;  1TLH B;  5CVV A;  4HV5 A;  2HVQ A;  3QOP A;  2ZXI A;  1LEB A;  3N97 A;  2STW A;  5JR3 A;  1TW2 A;  3S1R J;  3CCS I;  5K7Z A;  3FKI J;  2QVO A;  2ZME C;  1TTY A;  2WA0 A;  2M7B A;  3OS0 A;  3EUK L;  3PUB A;  1GXQ A;  1HDP A;  2Y48 A;  3FMR A;  1R22 A;  2PN6 A;  3H9J A;  2M45 A;  2OZ6 A;  2BHZ A;  3GBG A;  3CP2 A;  2R5Z A;  1I6H J;  4BBS J;  3P5J A;  4M9X A;  3UNG C;  2X1D A;  5B3S H;  5B1B H;  2OAZ A;  1FTT A;  3CDL A;  2XAJ A;  1OYY A;  1XGO A;  2ZFU A;  5E8G A;  1FBQ A;  1AOY A;  1UG2 A;  2EFW A;  3BTI A;  1OIS A;  1G4D A;  2VUM J;  4BE1 A;  4BJT A;  3ZOB A;  4ENK A;  2Y30 A;  1C0W A;  2EB7 A;  4PUS A;  2FJ1 A;  1YW8 A;  2BE5 F;  2WV0 A;  3M9A A;  4MLO A;  4AWX B;  3TOA A;  2F5C A;  5E3M A;  1ON1 A;  2KT0 A;  4L5E A;  2ESN A;  3CC4 I;  3M1E A;  4CCK A;  1FWZ A;  3M8E A;  4ZC3 A;  1EV7 A;  3OYA A;  2NS8 A;  5LHH A;  4BXF A;  1DUX C;  2HKO A;  2PLY A;  3Q9V A;  3TO7 A;  4ESF A;  3BZ6 A;  1CGP A;  4IPA A;  4TV7 A;  2HDW A;  4ENJ A;  4II3 A;  4PSX A;  4F52 A;  2FNA A;  2A69 F;  4A3J J;  2CW0 F;  1K61 A;  4RDU A;  3HTU A;  2ZNY A;  2DT5 A;  2MLG A;  3LSI A;  4BHP A;  3LFU A;  4QIW N;  1HBX G;  3QP5 A;  4IL6 C;  3MEX A;  3GYH X;  2ZXH A;  3I54 A;  2IAI A;  4BJ6 C;  3WE2 A;  2OU2 A;  3F6O A;  4CXF A;  1X4P A;  2DQL A;  4XR6 A;  2V7F A;  2H94 A;  3BT9 A;  4A6E A;  1WI9 A;  1BC8 C;  5C4X J;  2VQG A;  4KMU X;  3G4S I;  2BY0 A;  9ANT A;  1O57 A;  2ISY A;  4OIQ F;  4U0W A;  4RM2 A;  1RZ4 A;  2ACJ A;  1SMY F;  2M2E A;  4PZJ A;  3TL4 X;  3SEZ A;  4XK4 A;  1ON2 A;  1U78 A;  3I4P A;  3K7A J;  2LK2 A;  3CUQ C;  2CG4 A;  4RAF A;  2P8T A;  2HQN A;  5FD6 A;  1RRJ A;  2K85 A;  4X1E A;  2M9H A;  1SVM A;  3PNY A;  2CH0 A;  2RGV A;  2CO5 A;  3HYI A;  4KT5 C;  1LFP A;  4FET A;  3AFH A;  5K7H A;  3WU1 B;  4PSW A;  1U6G A;  1REP C;  3HKZ N;  2M8E A;  2L4A A;  5D6F A;  2QKL B;  2E7X A;  4HPQ A;  1QA6 A;  1P7I A;  3WTU C;  1HCR A;  3EDP A;  2Z9O A;  3WTX C;  4KN4 X;  2WTE A;  3LST A;  2CQX A;  2DJI A;  1ZG3 A;  2E5N A;  4FE4 A;  4XKB A;  4LK0 F;  5D6E A;  3CMY A;  2RC4 A;  2DTR A;  3I59 A;  3AG4 H;  3ZQG A;  4F7Z A;  4DOZ A;  4UUT A;  3ZQC A;  1YW9 A;  2FE3 A;  3ZPL A;  3KLO A;  3OYL A;  5IOZ A;  3H3V K;  4WWC A;  5D5U B;  3BR0 A;  3BY6 A;  3BG6 A;  4OIN F;  1XSD A;  4H4K C;  1XDU A;  2W48 A;  2Y9Y A;  1D1B A;  2R7W A;  3H1C A;  2BV6 A;  1ZKG A;  2DOE A;  1A6I A;  1EH8 A;  4MTE A;  4Y4R A;  1LJ9 A;  2A6E F;  3IWF A;  1N78 A;  1YQA A;  1T38 A;  2DA4 A;  2V1X A;  2QUF A;  1VTN C;  3ESW B;  2G9W A;  5DCM A;  5EG0 A;  3H9G A;  3H35 A;  1OJL A;  1FZP B;  3W2W A;  2KIM A;  4D1Q A;  1BM9 A;  1VQM I;  2X51 A;  3JSO A;  2ZME B;  1VQO I;  1OR7 A;  3QPL A;  1KZH A;  4AVZ A;  3K4C A;  3E6C C;  2DA2 A;  3BG5 A;  3BR1 A;  2R5Y B;  2ICW G;  1UMQ A;  3ZQL A;  3P9I A;  2YUS A;  4CIC A;  3F0C A;  1NK2 P;  4YEJ A;  1K4T A;  2MC3 A;  2RAE A;  1EKE A;  1M1E B;  1R4M B;  3O8H A;  1TWC J;  3GTG J;  3MKY B;  1XS9 A;  1WRJ A;  4H0E A;  3L7W A;  4ZYD A;  1Z7L A;  1TQI A;  1ZR2 A;  1WH5 A;  2BY1 A;  4A93 J;  2VB6 A;  3TDU C;  2A07 F;  3KIO A;  4Y3O A;  4D9J A;  1J2X A;  2DFI A;  3SFZ A;  3JRB A;  3F3X A;  3B02 A;  5JHF A;  2P4W A;  5LD2 C;  3FKJ A;  3BG9 A;  3R61 A;  2JUG A;  1E3O C;  2WAF A;  4I09 A;  4M73 A;  4CUG A;  4E7H A;  2K9L A;  4MQ9 F;  1N75 A;  4IHS A;  1JXS A;  1XGS A;  3QPT A;  1DGW Y;  1T08 B;  5BPI A;  3CCM I;  4RM3 A;  1KQ8 A;  2CUF A;  4EAT A;  1J75 A;  3H9Q A;  1I1S A;  1OCC H;  2EPF A;  3QOD A;  4UUS A;  1BN5 A;  3MVP A;  1T95 A;  4XOP A;  3KFW X;  4LOC A;  3VEP A;  4Q5S F;  2CQK A;  2XAU A;  1L3L A;  1XD7 A;  2DI3 A;  1STZ A;  1UCR A;  2QSG X;  1RKT A;  1HLV A;  3RKW A;  2FOW A;  1U5T A;  1QHG A;  2QCO A;  3CP8 A;  4AVP A;  2OC6 A;  2WY7 Q;  4UB6 C;  3GLL A;  4IQJ A;  2DMN A;  1UZC A;  2Z3Y A;  1CQT A;  3ERE D;  1KON A;  3C2G A;  5FGM A;  3I55 I;  1GLN A;  2HEO A;  1KYZ A;  1Y56 A;  3A0H C;  4RB2 C;  2JVG A;  4Y7N J;  3V42 A;  2W7N A;  1B4A A;  2FBH A;  4I02 A;  3Q5F A;  1OLT A;  1S6L A;  4ASN A;  4LIT A;  3RTR A;  1VQK I;  2CGP A;  1AHD P;  3GTK J;  2EWN A;  1JKQ C;  1JT0 A;  3JRA A;  5J47 A;  4HOB A;  2NNN A;  4OIP F;  1B9N A;  1VQP I;  1CF7 B;  4XRS G;  1RES A;  3TMO A;  1ETK A;  2DA5 A;  4XIC A;  3BQY A;  3TKY A;  4P55 A;  5D5V B;  3RIR A;  2E1N A;  3LWF A;  4KMF A;  2VAS A;  4UVC A;  4FX4 A;  1X1D A;  4RMN A;  2RVC A;  3LA2 A;  2H27 A;  1T98 A;  3N05 A;  5EEA A;  5GTH C;  5M5X J;  3S2D J;  2M30 A;  1P4A A;  1V4R A;  3HM5 A;  4MHG A;  1O7F A;  4AD9 A;  2OUM A;  1YJN I;  4Y13 A;  2Z99 A;  4XRS A;  1TWF J;  2RDP A;  3RYR A;  1WZ2 A;  1YYV A;  2NVY J;  3JRC A;  3NWS A;  5BMZ A;  2OCC H;  3BR2 A;  4QTR A;  4UV8 A;  5DUK A;  1PVE A;  5E3N A;  1D5Y A;  2DFH A;  3DWL E;  3F21 A;  1W0T A;  2XGX A;  1S9H A;  2HTS A;  2VKV A;  3JW4 A;  4LGW A;  3R4K A;  2E19 A;  3A01 A;  2TDX A;  2L9N A;  4A6D A;  1OR7 C;  2K9N A;  2HDD A;  2R7S A;  3SFI A;  4D7N A;  5D5X B;  2X6Y A;  3G1O A;  3MKW B;  3C3W A;  4G6D A;  1Y39 A;  2LBF A;  4N9H A;  2R5Z B;  2VOD A;  3VB2 A;  2DJN A;  2Y9Z A;  3HRU A;  3M3Y J;  3UKG A;  2VJ5 A;  3DPL C;  2Q0O A;  4KYW A;  4XLE A;  1GUU A;  3NAU A;  1J0R A;  3CMA I;  4AYB A;  1D0Y A;  4M3E A;  4C3J J;  3K2Z A;  1ETQ A;  1K7A A;  2M8G X;  2EV6 A;  1XMK A;  2MW8 A;  4L5J A;  5FRO A;  5IP9 J;  3FXR A;  4LB6 B;  1JTX A;  5M5Y J;  4PJM A;  2LKX A;  1BI0 A;  4HF1 A;  4HYE A;  1K79 A;  5J1U A;  4QPQ A;  2OD5 A;  2OJE D;  3OYB A;  3ZMD A;  1IF1 A;  3WE3 A;  1NG6 A;  3DEW A;  2VI6 A;  3S1N J;  4AIK A;  4UV9 A;  1I39 A;  4IHT A;  3K1M A;  4FT8 A;  3TP0 A;  3CCQ I;  1X1A A;  1MH4 A;  4E7I A;  3FXL A;  1D8K A;  1MW7 A;  3NWT A;  2F5E A;  4UHT A;  1VQ9 I;  2HYJ A;  2VPL A;  3S3M A;  4I76 A;  3KP4 A;  3UR3 C;  2CU7 A;  4Y15 A;  1TQP A;  2MD5 A;  2E1O A;  3CO6 C;  2GA1 A;  1IDY A;  3E7L A;  5M3M J;  4U87 A;  4BH9 A;  5FKN A;  4P9F A;  3ERM A;  3D0S A;  3EET A;  5HS9 A;  1P4X A;  1PYV A;  2L2O A;  2YS9 A;  3ABT A;  1FJL A;  5FKK A;  3RKQ A;  2V26 A;  4RLQ A;  4UB8 C;  4PJJ A;  3PIO F;  1IN7 A;  2GIV A;  3F9K A;  2GIZ A;  1BIB A;  2ECC A;  5CQE A;  3MFK A;  5TRD A;  4XOR A;  1JJ8 C;  4L5I A;  2XRL A;  1G8X A;  2XGE A;  2DOD A;  1XTA A;  3CJR B;  4IO9 F;  3E6D A;  5LGN A; 
#chains in the Genus database with same CATH homology
 2GOM A;  3SEQ A;  3S32 A;  3ONQ A;  4X0G A;  1UG0 A;  3OYE A;  3H5A A;  3I9V 2;  3LSG A;  2M0M A;  4BS9 A;  3K4B A;  5FRN A;  2MD0 A;  3OYF A;  3H0D A;  3H5N A;  4BQQ A;  3PJR A;  2CV2 A;  1Y6I A;  2PMZ A;  3DPT A;  4Y33 A;  2VL8 A;  2ZSH B;  3KX2 A;  4B43 A;  4BE2 A;  2KLO A;  4LIU A;  2MAB A;  4PJL A;  2VJ4 A;  2CMP A;  3I3L A;  1ERD A;  3HPG A;  4QPO A;  5KNL A;  2CW7 A;  2V4J C;  2F4I A;  3HPH A;  4ZJZ A;  3J7A Y;  4ZDP A;  1E0E A;  1MMG A;  2Y0S A;  4BEH A;  3OS1 A;  5HOO A;  3K4L A;  1FMW A;  3IUO A;  3MKZ A;  1WJB A;  2F5V A;  3ZR8 X;  3K4J A;  1BR2 A;  3OYM A;  2O5R A;  2WB1 A;  2Z16 A;  4PJN A;  2VQC A;  4KT6 A;  1FMV A;  1K6Y A;  2X6W A;  4XON A;  1PJR A;  3D5L A;  3HOS A;  3VYS B;  1T0F C;  2BVM A;  4BDY A;  4OWR B;  2R7V A;  2LY2 A;  2RQQ A;  1X1C A;  4PK4 A;  2IGN A;  3ZCO A;  4CCN A;  4LG3 A;  3OYC A;  4BJ5 C;  2Z1D A;  1V5E A;  4HEA 2;  3W2A A;  3OWT A;  3QYF A;  4KJZ A;  2HVQ A;  2ZXI A;  4BAC A;  2W82 A;  1MNE A;  3A2K A;  3OR1 C;  2KDO A;  2CFO A;  4ZTJ A;  3OYG A;  2V1N A;  4B47 A;  2PJR B;  2WA0 A;  2IGM A;  2M7B A;  3OS0 A;  3EUK L;  3HXL A;  1JI8 A;  2AQF A;  1TT0 A;  3PUB A;  1N77 A;  3PFY A;  2KRC A;  3H9J A;  2LH9 A;  1IRX A;  3GBG A;  2LYC A;  3CP2 A;  2IS2 A;  2IS1 A;  3VYU B;  3OYK A;  2MYS A;  3S3O A;  3UNG C;  2X1D A;  4BUP A;  2CS3 A;  4R79 A;  3OYN A;  2ZFU A;  3K70 D;  3DQV C;  3OMY A;  2XF5 A;  4ANJ A;  4BE1 A;  4BJT A;  2VLA A;  4PUS A;  2IGO A;  3DTE A;  1WJE A;  4C2U A;  4MLO A;  3W2V A;  4E7Z A;  3EUH C;  4XN0 A;  4XNF A;  4CCK A;  2UWM A;  4J01 A;  4ZC3 A;  2K5C A;  3OYA A;  1X4O A;  2X1C A;  1X19 A;  4BXF A;  1VZ0 A;  1R6R A;  3E1S A;  3HC7 A;  3L2U A;  3L2V A;  2HDW A;  4II3 A;  4PSX A;  4F52 A;  2R7T A;  3BCA A;  3IP4 B;  4OAY A;  3LSI A;  2AQE A;  3LFU A;  3DTI A;  2ZXH A;  4HG2 A;  2Q1Z B;  4BJ6 C;  3L2W A;  1AA7 A;  2XDV A;  1Z3X A;  4NUB A;  1X4P A;  4XR6 A;  3TBI A;  2V7F A;  1G59 A;  4XMY A;  2M4K A;  2M7A A;  2L9S A;  2VQG A;  2WAD A;  3CES A;  2LRE A;  3FDY A;  4ZTF A;  4RM2 A;  2E60 A;  3TL4 X;  3SEZ A;  4F91 B;  4CZC A;  2WBM A;  5KCM A;  3IAS 2;  2HPI A;  2L5Q A;  2V6E A;  1D1C A;  4DIQ A;  2JA2 A;  2UUZ A;  3PNY A;  2CH0 A;  3S3N A;  2LC2 A;  3VYR B;  2KHM A;  2A5W A;  2DCE A;  2W1O A;  1LFP A;  4FET A;  3OY9 A;  3AFH A;  5KHD A;  1UAA A;  2K3P A;  4PSW A;  3ZXS A;  1J09 A;  2M4G A;  4NQW B;  2F6C A;  2QKL B;  4HPQ A;  4BU2 A;  1DQU A;  3OR2 C;  2CV0 A;  3S8P A;  2IXS A;  2DJI A;  2XSJ C;  2E5N A;  4DJA A;  4XKB A;  3M1C A;  2X85 A;  2IS4 A;  4XKV A;  2W00 A;  2X1E A;  5FRM A;  3LMM A;  2XC7 A;  2KP6 A;  3CJQ B;  3K10 A;  4DOZ A;  2W4S A;  2LG4 A;  4XOT A;  4U7B A;  1LKX A;  3OYL A;  5HNH A;  1SFK A;  1U0J A;  2M3A A;  4NNJ A;  2KMU A;  2KRH A;  3DLA A;  3ZRG A;  2LY1 A;  2BW3 B;  2VKD A;  3CZ6 A;  3BC8 A;  3BG6 A;  2I8D A;  4H4K C;  2VJJ A;  3FHN A;  3RPU D;  3RSN A;  1D1B A;  4P1W A;  2R7W A;  4KIS A;  2V9K A;  2Z2S B;  4Y4R A;  4DBQ A;  4PFO A;  1N78 A;  3PSI A;  3OYD A;  2HNH A;  2LOO A;  2Q2E B;  3A1Y A;  3H9G A;  3H35 A;  5CKT A;  3VWB A;  4DGW B;  1MND A;  2XF6 A;  3W2W A;  4D1Q A;  4XKW A;  1WJF A;  4F93 B;  2X51 A;  2R7O A;  3DU5 A;  4AVZ A;  3K4C A;  4F3Q A;  2DT7 B;  1QU3 A;  4CH7 A;  3VYT B;  3BLY A;  4XL9 A;  4C2T A;  4GRI A;  4DBR A;  3AL0 C;  3QOE A;  4YEJ A;  2PJR A;  2P0W A;  3MKY B;  2HVS A;  3PNV A;  1Z7L A;  2DT6 A;  1WFX A;  2IS6 A;  4BE0 A;  1D1A A;  2JVH A;  2VB6 A;  1UEL B;  2R7X A;  3PSF A;  4Y3O A;  2WAQ A;  4CSW A;  4D9J A;  2MFZ A;  3W3C A;  5JHF A;  5LD2 C;  3MD2 A;  3MMY B;  3FKJ A;  4BL0 B;  1W36 C;  1MMD A;  2JUG A;  2WAF A;  3SDB A;  4CUG A;  3BG7 A;  4E7H A;  2K9L A;  1N75 A;  4E7L A;  3OYJ A;  1YX5 A;  4E4H A;  1DGW Y;  4JOM A;  2XF7 A;  4RM3 A;  3CMM A;  4ZDL A;  4PFP A;  3G2B A;  4EAT A;  4XLH A;  4CA0 A;  3U21 A;  3H9Q A;  3FBI B;  3A4C A;  4XKC A;  1V5G A;  3QOD A;  2L7K A;  1T95 A;  2K9M A;  2QKM B;  2R4G A;  3ZQQ A;  4XOP A;  3PNT A;  4G6T B;  2XAU A;  4JQF A;  3E0J B;  2ELJ A;  2DXI A;  3KYL A;  3IAM 2;  2E5Z A;  3VDX A;  1MMA A;  1BR1 A;  1Z3Y A;  2UV1 A;  4XLF A;  2VXZ A;  4YEL A;  3K6G A;  1QHG A;  2RNG A;  1TZL A;  3D5R C;  3CP8 A;  2OC6 A;  2WY7 Q;  2R7R A;  2VIX A;  3KEY A;  4IQJ A;  3SYT A;  1WJD A;  1SAU A;  1P9Q C;  3VSK A;  1KON A;  4KIT B;  3C2G A;  1GLN A;  2A6T A;  1Y56 A;  1WJ5 A;  2JVG A;  3V42 A;  4AU7 A;  2W7N A;  4ITV A;  4E7J A;  3OOU A;  1OLT A;  2WY8 Q;  4LIT A;  5TGT A;  1YX3 A;  3RTR A;  4XLC A;  2RRE A;  4IKF A;  3SZG A;  3VSL A;  4C9Y A;  2HPM A;  2LRD A;  3HKZ A;  4BEH B;  3OS2 A;  4HSR A;  4II2 A;  2VJI A;  3OYI A;  3TMO A;  4RLF A;  4IX7 A;  4IZZ A;  4XN3 A;  3OIP A;  1HA8 A;  1LDK B;  2VAS A;  1MMN A;  2CUZ A;  3K4N A;  1X1D A;  4RMN A;  3OYH A;  3OIQ A;  3OL3 A;  2OV7 A;  3QYB A;  4XQF A;  3N05 A;  2FUG 2;  2VQH A;  2CW8 A;  3LSK A;  4B48 A;  4E6K G;  1V5F A;  3HG9 A;  1D0X A;  4BGD A;  2OUM A;  4CCL A;  3EUA A;  3S93 A;  3K4K A;  2NOJ B;  1QHH D;  4ZYA A;  4HNT A;  2VKH A;  3NWS A;  3H5R A;  5HNF A;  3PL8 A;  2LBF B;  4BDZ A;  4IQ4 A;  4YRV A;  4NC7 A;  2X6X A;  2JSP A;  2R7Q A;  3RCO A;  2KQR A;  1DP3 A;  1WJA A;  4N4N B;  3DWL E;  3CF2 A;  4B44 A;  1S9H A;  2BW3 A;  3K4M A;  3C2H A;  3HL2 A;  2L9N A;  2R7U A;  1OR7 C;  2R7S A;  2X6Y A;  3MKW B;  3HUG B;  3M8J A;  1LVK A;  2LBF A;  3DKX A;  4J00 A;  2DOA A;  3BCB A;  1NG7 A;  3DEE A;  2VJ5 A;  3D5S C;  3DPL C;  3DU6 A;  1Z21 A;  4BQN A;  4OAZ A;  1DGR M;  4XLE A;  3K70 C;  2MC4 A;  4AYB A;  4XLA A;  1D0Y A;  2KPM A;  3AL0 B;  2CUJ A;  2HZD A;  5FRO A;  1ZEL A;  3AKZ A;  4CCM A;  3ZGK A;  2E1M C;  3OL4 A;  3LSM A;  4P5O A;  3DPU A;  4PJM A;  2CV1 A;  2HVR A;  4QPQ A;  2E1M B;  3LSH A;  3L2Q A;  3OYB A;  5LFA A;  4LIV A;  2VXD A;  1NG6 A;  4CCO A;  4ZDO A;  4E7K A;  2HU9 A;  3RQ4 A;  4F55 A;  1YE9 A;  4XM3 A;  1X1A A;  5HVQ C;  2KL4 A;  4N4O B;  4HST A;  4E7I A;  1MW7 A;  3NWT A;  3QYE A;  4HRI A;  1BOB A;  2BOL A;  2VPL A;  3S3M A;  3FBN B;  1W36 D;  1X1B A;  3UR3 C;  1EA3 A;  2VQL A;  4C30 A;  3L2R A;  4F92 B;  4U87 A;  4B3X A;  2KZV A;  1D0Z A;  5CQG A;  3HOT A;  1PYV A;  2L2O A;  3DTK A;  3EPZ A;  2WAE A;  2V26 A;  4RLQ A;  4PJJ A;  3F9K A;  2HQA A;  5CQE A;  4XOR A;  3LL7 A;  1BR4 A;  5HLT A;  1G8X A;  4CCJ A;  2GOX B;  2BVL A;  2ZSI B;  3CJR B;  4HNU A;  4E7S A;  1WJC A;  4BQO A;  4FAS D;  3DKY A;  2IGK A;  5CPR B;  4NC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...