3OR2C

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKVTGFKLKQIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3or2C02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 3or2C01
2A5WA 3OR1C 3OR2C 2XSJC 1JI8A 1SAUA 2V4JC 1YX3A
chains in the Genus database with same CATH superfamily
2ZMEC 2MH9A 3UR3C 2R7XA 4ENKA 3GTMJ 4HZFA 4L9JA 3OMYA 2ID6A 2M4KA 2R5YA 1BI3A 4RBOA 2GXAA 2A6HF 2P5VA 4MLOA 4MGRA 1TL8A 1EF4A 2F5DA 2Q0OA 4MFDA 1FEXA 1QVUA 5JVTA 2Z33A 3TO9A 2QENA 3DKYA 1AKHA 1S29A 2ZO4A 1V5GA 3H5AA 1XMAA 2O7OA 1EH8A 2KIQA 3CCRI 1T38A 1EH6A 3V7CA 3OYNA 2QCOA 3BCAA 3W2VA 4HX8A 2XIGA 3FXQA 4Y52J 1JT0A 2VJJA 1BW6A 4NHJA 4JX4A 1OCCH 2VONA 2J5PA 2OF7A 3OOPA 5LHGA 1WH5A 1CF7A 3IH4A 2FXAA 2QYOA 2AHQA 4D7NA 3K70C 1VQMI 3F22A 4NQWB 1BIBA 1QGPA 1XSDA 2VUMJ 3HOTA 2XUBA 4G6TB 2DA4A 4GCVA 5EJCA 3HRSA 4M71A 1UELB 5HLGA 2IS2A 1TWCJ 1USSA 2HU9A 2EILH 1E3PA 1TNTA 2VE8A 5F0HA 2FQ3A 1MNEA 1MW7A 2PG4A 3M07A 4C2UA 4KMFA 1AHDP 2LY1A 4MQVA 3VFZA 4B8XA 4C9YA 2BY2A 2KP6A 2VJ4A 3TDZC 1RKWA 3K10A 4L5JA 4CCKA 1SVMA 4E7JA 4E7KA 4PDKA 4RGXA 5L3FA 1W1WE 3GTKJ 2M0MA 4DYCA 4JP0A 4B44A 2GM4A 3LA3A 3IP4B 5GTIC 1LDJA 3OYFA 3IC7A 3C2HA 3SZGA 4A12A 1RRJA 3GZNB 2KQRA 2XGEA 3ONQA 5DD8A 1ZG5A 1FBSA 4B47A 2R7VA 2VC0A 2R7DA 2JVHA 5J8CA 2JRMA 5B5EC 4BJTA 3OYKA 4HEA2 1YFHA 1EV7A 1Y8RB 4EJTA 4FISA 4P5OA 4C2TA 3K4CA 2WY8Q 1R1TA 1ZYRF 5ED4A 1PP7U 4IHWA 4XLCA 3ABTA 2VB6A 1W7PD 3BZCA 2DPDA 1IAWA 2L7MP 1S7OA 5FLXZ 2DA3A 3P9IA 4E7LA 2AQFA 2V7FA 4A3DJ 1C0WA 2JTVA 2K4JA 1T56A 1IV8A 5CJ9A 2M5WA 1Z21A 3VYTB 2KHMA 3RZOJ 2JWTA 5D8KB 2IRFG 1X3WB 3SDBA 4M9SA 3REOA 2JA2A 2EWNA 1ZLKA 2P0WA 2VPLA 3G1LA 4ASNA 3VOEA 5E18F 3AG1H 3FISA 3LFUA 5D6EA 1GXQA 3HTSB 4PZJA 2GOXB 4CGZA 4YFNF 2VJ5A 1TQIA 2QQ9A 1TBXA 3JREA 4G7OF 4L0YB 1N77A 3M3YJ 2QGUA 2AO9A 4A3JJ 3CO6C 5FRNA 3KYLA 1BI0A 4HF1A 3HOXJ 4WXHA 3H35A 1SFKA 3ABUA 1SMYF 3V7RA 1LJ9A 1MNDA 5M5YJ 3OYMA 2BGCA 3U1DA 5FD5A 2QQBA 2EFQA 2NRAC 3PJRA 4E4HA 4XNFA 2X6OA 2KJCA 3WTZA 4F91B 1YITI 3LWFA 5EYRA 3HOWJ 3JRCA 4XRMA 2IGOA 1WRJA 2BVMA 2Y9ZA 3AL0B 2W25A 2QKMB 2IGKA 2DOEA 1TNSA 4KA4A 4N4NB 5FFZA 2XROA 2NNYA 2P5KA 3C18A 1IC8A 3D5LA 1P4AA 1YX5A 3MAJA 4LG3A 2E36A 2NS7A 1ETKA 4LK1F 4X0GA 3FXJA 3ABLH 3KP6A 3KETA 3H9JA 3TO6A 2Y9YA 2RC4A 1HDPA 1P7IA 1XSVA 2VIXA 3LQRA 4YIFA 1W36D 2HDCA 4PCQA 2DYSH 2UXXA 2I8DA 4RS8A 4CUGA 1XC5A 2L7FP 1ONVA 1HW1A 2HQ5A 1ZRFA 1ETYA 2OCCH 3F8CA 4QSHA 2FJ1A 2DYRH 2ZMEB 2DA2A 3K6GA 3H0GJ 1DQUA 3I56I 2W00A 1XGNA 3GZ6A 3M8FA 3ML6A 3BZKA 4QPQA 3SEZA 1FOXA 4BNCA 2D1HA 1YOVB 2YS9A 4DZJA 4WWCA 2VJIA 1W7PA 2O03A 4ABZA 2L3DA 4BQNA 2LP0A 2LRDA 2PQ8A 2EV5A 3L9FA 3TW7A 2PMHA 3CUQC 1K4SA 3KZIC 4DOZA 4M6VA 4XONA 1STZA 3LAPA 3OWTA 5C3EJ 5DM6F 1HOMA 2WAFA 4GFBA 3FZVA 2FA5A 1UG2A 1I6XA 4DQ2A 2GBYA 3E6DA 2A6TA 2DT5A 2CW0F 5J1UA 3G4SI 2ISZA 1XPXA 2FE3A 3DLAA 2FBIA 1OCRH 3HHHA 2ZXWH 4V2FA 3DU6A 3CUOA 2COBA 2XDVA 2NOJB 5DCFA 2CWEA 1OR7A 2LFBA 4D9JA 5J1YA 1JT6A 3PNVA 2M30A 3RTRA 3ZR8X 4Y4RA 1D1AA 4LIUA 1PP8F 3LNQA 2K9NA 2Z1DA 3IKTA 5K5RA 2VQGA 3H9QA 5BPDA 1DU0A 3M4OJ 1MBGA 1VI0A 2X0LA 2JUGA 3JSPA 4RAFA 2MBFA 3X2QH 2WAQN 4D1QA 4AIKA 4I2OA 2M8EA 1A5JA 3BQZA 4WF2A 4RB1A 1YS6A 1LE8A 3IWZA 3M7GA 1HKSA 2STTA 4PJ0C 1MIJA 2IVMA 3KIOA 4AIDA 4RB2C 3KCCA 2E2IJ 3CJNA 5DEQA 3HUGB 1Y0UA 3H9GA 3SHFA 1OYIA 4UVCA 2VQHA 4CA0A 3PSFA 4MNUA 1U9NA 1W5TA 4XKWA 1JUPA 1Q1VA 4WXCA 1JTYA 3SZTA 3S8PA 4UUSB 1Y1WJ 1NK3P 1U5TB 4I98B 4KICA 4OAYA 4M6XA 3E6MA 3S1NJ 4CO8A 2FMLA 2FOWA 4EGYA 1LEAA 3S1RJ 2BV6A 4IHSA 2HDDA 4WX9A 2DT6A 1TQPA 2LBFB 1LFPA 1DPRA 2ZFUA 1I3QJ 1LFUP 4PUSA 1LNWA 2WWYA 3KEYA 1Z6TA 2OC6A 4Q48A 2DODA 1POGA 1QQIA 2W85A 3GLXA 2V9VA 5FD6A 5D5UB 2DMPA 2RGVA 1WPKA 2VKHA 2KLOA 3PSIA 2KPMA 1HDDC 4CH7A 3G6EI 4G6DA 2ZNYA 1SAXA 1XCVA 2VBZA 2BVLA 2X51A 2ESHA 5ERIA 4M73A 4PFOA 2XB5A 3ZQ7A 1R1VA 3ZMSA 3K4JA 1O3QA 3WG9A 3W6JB 3H92A 5CQEA 1Z6RA 4LG0A 3BG5A 3CMYA 3GTGJ 1X2NA 4PSXA 2BY3A 2HWVA 5DD4A 3AG3H 3RSNA 4BGDA 2R93J 4HW0A 3OV8A 4LGWA 4N4OB 2WC2A 3K7AJ 1RKTA 3K4KA 1R6RA 1FIPA 2YSRA 5M3FJ 3HKZA 5KK1A 2HXOA 3OL3A 1X19A 3FX3A 3J7ZI 1XGOA 4Q4ZF 2L2OA 1RI7A 2BHZA 2W84A 3CJTB 4BXUA 1T8IA 3KP3A 2GA1A 3L2QA 2NS8A 2A3SA 4C30A 1GT0C 2IGNA 1IW7F 3DTKA 4R79A 1RUOA 4BDYA 3CC2I 2DTZA 1FMVA 3BR0A 3EUHC 4CCMA 4CYCA 2BOLA 4BQAA 3WTSC 2PLYA 1XSXA 1X4OA 4HYEA 4BS9A 2XGCA 1LDKB 5HOOA 3HOSA 3S16J 3J81K 4AWXB 1PUFB 3G73A 1XGMA 5J40A 3ZOBA 3KEQA 5GTHC 1O3RA 2Y30A 4CYDA 1YO5C 1OCOH 3GMEA 3S2DJ 1P6RA 1DDNA 3LSRA 5E1WA 4XORA 1F1ZA 2KISA 2M8GX 1HC8A 2FD5A 3I4PA 4BQOA 4XMYA 1ENHA 2DQRA 3LSPA 4HA8A 3I5UA 1FIAA 5CVJA 4CZCA 1QPIA 2R92J 2M9HA 2A05A 2DMNA 1FP2A 2AQEA 2K4BA 1VQ9I 2X4HA 3CJRB 4D7MA 4A0YA 5JVGF 2N8GA 1UB9A 2VKDA 5J6XA 2DAOA 4BKXA 3JTHA 4KNYA 1ZRDA 1KQ0A 2HGCA 2IAIA 4CYCB 1HF0A 3FIWA 2DN0A 4MO7A 2P5LC 3DPUA 2FBHA 4IPAA 2DI3A 3SJMA 2LOOA 3BWGA 1HW2A 2R0QC 1DGWY 2Q1ZB 1K78B 2CQNA 5HS7A 4F92B 1Y39A 4D5FA 3FXRA 1U8BA 3I58A 3JRFA 1R5HA 1HBXG 4N0BA 3HRUA 5B1AH 3AKZA 5JLXA 2A5WA 4RLQA 5KCMA 1SFOJ 1G3SA 4IQ4A 2VASA 1OKRA 3IL2A 1BR1A 4E7HA 1UHWA 1KYWA 1ULYA 5BOXA 2W4SA 1SANA 2Y0MA 4BE1A 2QWWA 1XDSA 4Y33A 2QSFX 4XLFA 4XLNF 3OIOA 3CO7C 4RB3C 4IXAA 2CS3A 4RLFA 1UG0A 1BIAA 2ZCWA 3QQAA 4G94A 3TW6A 1SFUA 2ACJA 1MBHA 3KP5A 4LLGF 3CCSI 4AIJA 1UJ8A 4Q5SF 2F4OB 3PQKA 3CC4I 1VQ6I 2ZFWA 3IRQA 5KAFC 3COAC 2ISYA 3KZZA 4KT6A 5C4XJ 1Z91A 2OA4A 4L5IA 5FLMJ 2E1MB 5DDGA 4BY7J 2PJRB 3BQYA 3J7YJ 1IN4A 1D0YA 5A2QZ 1ERDA 3OYDA 3F9KA 1YE9A 3EETA 4NC7A 4RMNA 3DF8A 4M3FA 3S1MJ 1MD0A 3BR6A 5LRSA 2V6CA 5B66C 4B09A 2GXGA 3ESWB 1XD7A 3H1CA 1FTTA 2HZTA 1IN8A 1CGPA 1XDUA 1L3LA 1M1EB 2XAUA 3SDGA 5IPAA 1XMXA 4IRIA 3LA7A 1SD7A 2H27A 4U88A 4BHCA 1UCRA 1Z77A 2L7KA 1JKQC 5ICGA 3CCEI 3E5XA 4OINF 1ON2A 1Y8QB 2WADA 3IHUA 4C3HJ 1LVAA 4JX6A 2JQ7A 5J8FA 1U5TA 2GIVA 5DUIA 1LB2A 2HQNA 4ZTJA 5K7HA 4XOPA 2HPIA 2PJRA 2LH9A 2DFHA 3KE2A 1T2KA 3C7JA 2DMTA 3BPXA 1VQOI 3PNTA 2W24A 3PM1A 4QTRA 4XSXF 5KHDA 2ZNZA 3MVPA 2Z2SB 3BT9A 3CLQA 2F5EA 1YS7A 3DU5A 3GFLA 2XAJA 4DJAA 2NVQJ 2V1UA 3V7SA 3ZRGA 1N75A 5CYVA 1MSEC 4ZDPA 1X2MA 2EFOA 2KL4A 3RDIA 4ZZDA 4F93B 5J4YA 5EGOA 4XRSG 1LQ1A 2E2JJ 2ETHA 1ZHFA 3W2WA 1FC3A 2XGXA 4LB5A 4OWRB 3M1EA 2G7HA 3CCVI 2UUZA 2K02A 2ECBA 1R4MB 3BLYA 3CQZJ 2Z3YA 1XS9A 3SFZA 2V4JC 1W0UA 4IZZA 1A35A 2HOSA 4UUTA 1R9TJ 2E7WA 1TWHJ 3ASOH 4RAZA 4PJNA 4UVAA 4ZDLA 4IJAA 4CCNA 1QHGA 4Y13A 2P8TA 2LNBA 2L0KA 3B73A 5EZGA 1FT9A 1ZGJA 2JA7J 4U7DA 5C44J 4FTHA 3BTCA 3BR1A 1RNLA 1MBKA 5HLIA 1JGSA 2X1CA 1ZG3A 2VT3A 3FKIJ 3M1CA 2EFPA 3V8LA 1U2WA 2DMUA 4PJMA 5DCMA 2ZSHB 3GW2A 1WJ5A 2OU2A 2M7AA 2MD5A 3OYBA 5M3MJ 4RGSA 2WAEA 3EPZA 3FM5A 4HV5A 1XCBA 4HOBA 3CCUI 5TJJA 3GTPJ 1ZN2A 3HTUA 2A5YB 1I3AA 2ZBKA 3HOVJ 1MBFA 1JKOC 3JAMK 5GAGJ 1YTYA 3E5UA 1QPMA 4BUPA 1V54H 3SYTA 1IGNA 1X1CA 4AU7A 4DBRA 1FTZA 3N05A 2ZJQF 2DJIA 3ZPLA 1WZ2A 5LGTA 3ZCOA 3GO5A 3ZN1A 3GUDA 2HYJA 1XG1A 2Z9OA 4Y17A 2QM3A 5BS6A 4XRFA 2OZUA 4CCJA 2JK3A 2HXIA 3JTGA 1B9NA 2DW4A 5FKLA 2FOKA 1GDTA 2F5CA 1LDDA 2HOEA 4M9ZA 4GO1A 3CCLI 4MHGA 2Y2ZA 1O7LA 2OV7A 4UXNA 5F08A 4FQGA 3RIRA 4FASD 4HF2A 3WTVC 1S3JA 5JHFA 1KZHA 5LFAA 4S04A 5L3CA 4L9VA 3OYAA 2KZVA 2X1EA 2RREA 1ETOA 4LITA 1TP4A 3QOPA 2RKHA 4H4KC 2HTJA 1MMSA 1HW5A 1P7JA 2XAGA 4IKFA 2EIMH 1USTA 2HI3A 3DLLF 3I4NJ 2QLZA 2DA6A 1XX5A 3KYCB 4F55A 4XIDA 5BPIA 1QU3A 3F8MA 2KRFA 1RPWA 2VN2A 4XRSA 2K9QA 3CDHA 3CF5F 1WSUA 2BE5F 1UHSA 4A3MJ 4I7HA 1ACIA 4GYGA 2HOTA 4XQFA 1L0OC 3R60A 1LFBA 2EBIA 4F52A 1OMIA 2FQ4A 2CV0A 2P6SA 1FBUA 2YPRA 3K69A 3MWMA 5LHIA 4PJLA 3DKWA 4O6JA 1R00A 3TP3A 5JLWA 2OAZA 1G3WA 4FT8A 3I53A 1Y1VJ 4BACA 1V55H 3J81Z 1B8IA 4LLNA 3DBRB 2AXLA 2FF4A 4JYKA 1LUJB 4M3GA 3G1MA 1H0MA 3V8KA 1VNDA 2E7XA 5JHUA 3L2RA 3QP6A 3C2BA 3EQLF 1WI3A 3FM3A 4BH9A 4IHYA 2KIUA 5L3EA 1GVJA 2GLOA 4A3CJ 4CCLA 2JA8J 3I64A 1IJWC 5E3OA 4L9TA 1FMWA 3PQJA 4KMUX 3I59A 2TDXA 1VQLI 3WTYC 2QBYB 1U3EM 2DCEA 1RR8C 1MJ9A 5KNLA 4OAZA 2LBFA 2X6YA 2ELJA 3A02A 3R4KA 3HKZN 1APLC 3FMQA 4ENNA 1QZZA 4LIVA 4OIRF 3HSEA 4WXDA 3ULQB 1T39A 2R5YB 1TQMA 1KA8A 1G4DA 1Z7UA 5J47A 1IUFA 3RKWA 3VB2A 2LYCA 4ENMA 2P7VB 3K4BA 3ZQIA 2X9DA 2LD5A 3E6CC 1D5YA 3QYBA 4W97A 3T1BA 4YELA 1MJBA 4HX4A 1YRNB 4DYRA 2XGDA 3VYRB 3RQ4A 1V3FA 5FKNA 1I50J 2MA3A 1J9IA 3BR2A 2WTEA 2QKLB 5FFXA 1TWGJ 1UFMA 1R36A 1MKMA 1X1BA 1CQTA 4L18B 3KP4A 4BQQA 3D5RC 3HM5A 4X1EA 2HTSA 5GADJ 5GAEJ 3MKYB 3DBLB 2ECCA 4NDLA 3S3MA 3F21A 1YJNI 4ZYGA 2ICWG 3RPUA 5IOYA 2OBPA 3TQNA 2BW3B 1ZELA 3LSTA 3FMSA 2RAEA 4XR6A 4RM3A 2HFHA 3A4CA 2H94A 4XN3A 4M6YA 3S2WA 4A69C 2LKPA 2BHYA 1WJCA 4UV9A 2MLKA 3OIQA 2DXIA 1Z05A 5J3LA 3S3NA 4M3DA 4OIQF 5CLSA 3HDDA 1N25A 1QO0D 4AM3A 3HYIA 2JA6J 4LB6B 2XRNA 2CFXA 3QODA 4XKBA 5F6FA 1XB4A 1W7PB 2KDZA 2QQAA 2K40A 3ERMA 2DFIA 3TP0A 3E0JB 3DCFA 5E17F 1K78A 1BC7C 3OR2C 2EV0A 2R7TA 1Z0XA 4XLAA 2EZHA 3SEQA 1YW8A 2R7QA 2LTPA 3FBIB 4EQQA 2IXSA 2NVXJ 4XOTA 3WU1B 4A2UA 1D0XA 3IWFA 3ECHA 2D5VA 5E20A 1Z3XA 1MMAA 1PDNC 4ZJZA 4TV7A 1ETXA 1QVTA 4GYIA 4EJUA 1EH7A 4OU0A 2E1MC 4HRIA 3S15J 1I5ZA 1HLVA 1J5YA 3JAMZ 1IDZA 3BDDA 1ZTRA 1KU2A 5H6QA 2TCTA 2HS5A 4PGHA 1OYYA 5HS8A 3T5XA 1U8RA 3BJAA 3K4MA 4XKVA 1YG2A 4JOMA 4YFKF 2R5ZB 2LF7A 1BL0A 3G2BA 3O8HA 2W48A 3DEWA 3I59B 4P9FA 1ZRCA 5EEGA 3RKYA 2QBYA 3GLLA 4BBSJ 5FO5A 2E1OA 1T33A 4G9YA 1VQNI 2RN7A 2HYFA 1NTCA 3TBIA 3CCMI 4L0ZB 5D5WB 2M1BA 1R4NB 4RB0A 5DYMA 1S6LA 1W4MA 2DOFA 2L9RA 2F6CA 3FHZA 3L7WA 1MZBA 2OCEA 2D45A 2LREA 5D5XB 2IS6A 1OLTA 2R7SA 3L2VA 3PO3J 2FX0A 2JRTA 4LK0F 1OPCA 2H6CA 5D8LB 2WBMA 3EUHA 3MKZA 1TT5B 2XAHA 3GYHX 1J59A 1WCMJ 1DU6A 2H1LA 2O61A 4DBQA 4FE4A 4PFPA 3MZHA 2W82A 2RVCA 5HDGA 4AYBA 5IT3A 1G2HA 1EA3A 4HQMA 2M45A 3S3OA 2E60A 5LGNA 3A03A 2COMA 2E34A 4NC6A 1B4AA 4BAYA 3AAFA 4EJVA 1MBJA 3K1NA 3FXLA 4OMZA 4MQ9F 3I55I 2KRCA 2DK5A 1TTYA 5CVUA 1IRZA 3ASNH 2LKXA 5L3BA 2XC7A 5HLHA 4UUSA 2D1VA 2AXTC 1SFEA 2CG4A 1AA7A 5F04A 2GA2A 1ETVA 3HRTA 5IYBJ 1AOYA 1A31A 2YU9J 4XICA 2K9LA 1O57A 2R7RA 2H1KA 1JTXA 2Z5UA 2W1OA 2RV8A 3EUAA 1DP7P 4IHXA 4MEYF 5M5WJ 1WI9A 3DQVC 3E5QA 2XAQA 3QPSA 4YEJA 1OFCX 3H36A 3QOEA 5E3NA 4N9IA 3HGYA 3WE2A 2BXYA 2D2WA 3F8NA 3RPUD 3OSFA 4UNOA 2ID3A 4BXFA 5HNHA 1VQ5I 1OCTC 3OYIA 3GFMA 2XVCA 1H9GA 2LG4A 1K6OA 1GV2A 4XLPF 1RR7A 1RESA 2VI6A 3WE3A 2XSJC 5HODA 1BR2A 4QWQA 3CZ6A 3NRVA 1OISA 2MC3A 5EZHA 2HZDA 3WGGA 3O6BB 2OQRA 2KRHA 2DO7A 1HKTA 2P6TA 3F0CA 4A6EA 5EEHA 2R7FA 3ABKH 4RGUA 3MQ0A 3QYEA 4GDFA 2LKSA 1R5ID 2KFDA 3QYFA 2B9SA 2H09A 2IA2A 2XHKA 3GWZA 1QNTA 2Y69H 2JJ7A 2YU3A 4P55A 3ZMDA 3T8RA 2E5NA 3W6VA 1RUNA 2LC2A 3DEUA 3PFIA 2VOOA 1G3YA 5FKOA 2VKVA 5LRRA 1YJWI 4KUMA 1HKQA 4WK8F 2EB7A 1NG7A 3R0JA 3N97A 3V8JA 4BJ6C 5BMZA 2Y48A 1PUEE 1ZGAA 5FKMA 1TWAJ 4MEXF 1SVOA 2M87A 4B3AA 3GXOA 1OQYA 2K3PA 3VSLA 5ICEA 2CW8A 2L01A 5E1ZB 3F72A 4BDZA 2VBYA 3S2HJ 2CUFA 1OCZH 2UZKA 4J19A 1S9HA 2PMUA 3L1PA 1R23A 1BOBA 4IRHA 3QPLA 3SFIA 3RYRA 4ENJA 3CMMA 2ZXJA 5E8IA 3DXJF 3HB9A 3A01B 2CFOA 1SVLA 2OD5A 2PFBA 1KONA 3BJ6A 5F27A 3IH2A 3J7AY 2BY1A 4WCGA 3FWEA 3P7NA 2EA2A 4V2GA 2O8XA 1YHQI 1BN5A 2NS0A 1Z9CA 1OR7C 4ANJA 3DKXA 4II2A 1J0RA 1B72B 1W5SA 1IZ1A 2OPTA 2V26A 2WV0A 4D5CA 2A61A 3OS0A 3T8TA 1ZREA 2C6YA 4L9NA 3K1PA 1K61A 1A6QA 4KISA 1VQ4I 4ZYAA 3UNGC 5IT9Z 4HG2A 3K9TA 1MMDA 2F2EA 4S05A 1K7AA 3I71A 5F0CA 2ESNA 3JCUC 3KZYA 4II3A 3PO2J 4EJWA 5E79C 3DEEA 4D0PA 5LEJA 2DPUA 5GPCA 2MW8A 3CUQA 4UVBA 4GRIA 5ILUA 2WB1A 5DV5A 5F1JA 2V1XA 1J2XA 2DJNA 4ZC3A 1T95A 2X6XA 4U7BA 4IF4A 3JRDA 1IN6A 3U21A 5ILSA 1ZKGA 1IO2A 3F3XA 4BY1J 4C3IJ 1JKRC 1ZAOA 2ELKA 2CV2A 1ODDA 2MH2A 2XKPA 1WH7A 4KN4X 2K85A 2QSHX 1K79A 4A3EJ 3F23A 1E3OC 1NK2P 4I0BA 3CLOA 2JUCA 4HPQA 3PIPF 3LSMA 3O3KA 2R7ZJ 3QPTA 5HDKA 2JPBA 4E6KG 5M5XJ 2PJPA 3GVAA 4R1HA 2FU4A 1KYZA 4I01A 3HC7A 3OIPA 2CU7A 4HX7A 3MD2A 2K27A 2CQ7A 3FXOA 4P96A 2L5QA 3RKXA 5TISC 2VBXA 3JW4A 1D3YA 1MH3A 3KLNA 1BI2A 2VC1A 2PN6A 2OTJI 3E97A 4RA2A 4EM2A 4PSWA 1T6SA 5K1YA 4BU2A 3GFIA 2LDUA 4E70A 3MKLA 3QP5A 3RQIA 2LK2A 2P4WA 3PIOF 3NEUA 2DK8A 3BCBA 3WU2C 4RM2A 2XASA 3U9GA 4XSZF 2W7NA 2CQKA 4JK1X 3HOUJ 5IYDJ 4V19K 1YRNA 4GGGA 1A6IA 1JHHA 3BG7A 2HVSA 2FMYA 1QRYA 1Z67A 2NXNB 3TEDA 4C2MJ 1PUFA 4LD5A 2RNJA 3JRAA 4BYYA 1PJRA 3CC7I 2DFEA 2DMQA 2DU9A 1VFCA 3FHNA 5FGMA 2L4AA 4E7ZA 2HVRA 3W2AA 2R7UA 1JUMA 2EPFA 2HPMA 1SFXA 3HG9A 4QPOA 3FBNB 2KIFA 4KJZA 1W36C 3W6KB 4HNVA 2F4MB 2DTRA 2EJRA 2BW3A 5HNFA 3C1DA 2IEKA 1WFXA 4A3IJ 1YI2I 2STWA 1BJZA 2ZJRF 3G1OA 1MDMB 3ROUA 4RAYA 4P9UA 1HSTA 2CW7A 3BPVA 2EK5A 2DDBA 3K2ZA 1FLIA 2BYVE 1HSJA 2ZC2A 3MMYB 3TGNA 2LVSA 1FY7A 2ELHA 4HNUA 5E1XA 2UXNA 2LY9A 5EDNA 2EINH 4B43A 2R5ZA 3ABMH 2ZMEA 1DP3A 4JX5A 3BR5A 4A6DA 3VSKA 1VF9A 3JRGA 3EYIA 1F5TA 3U1KA 2L7ZA 1D0ZA 3E1SA 4U0VA 1R7JA 2V79A 1U5TC 2QUFA 1UMQA 4DZPA 1JHFA 2GAUA 2XB0X 4E7SA 3J7AO 2MYSA 4C3JJ 4ESBA 2HR3A 3L2WA 2JA5J 3WG7H 3CMAI 5AONA 1GHCA 1EKEA 3FMRA 2WA0A 2ME6A 3K0LA 3I4MJ 3GCMA 1QHHD 3S14J 3BC8A 3GEZA 3DPLC 4AUXA 3FF5A 3OL4A 5LHHA 3RCOA 2JSPA 2GZWA 3H5RA 1T0FA 3MZ8A 2XF7A 3OY9A 4B3XA 1K83J 3M9AA 4XL9A 3K2AA 5AIQA 4DYQA 3RZDJ 1Z3YA 1ZLJA 2G9WA 4IVNA 4A3FJ 4J01A 1IRFA 3QU3A 3T0YA 4A0XA 2IJLA 2VXZA 2HVQA 2X48A 4Y15A 2XPVA 5BQTA 4YIRX 3U2RA 2QEXI 1IXCA 3MCZA 1B8IB 2XF5A 1NG6A 2Y0SN 1WHUA 3GTJJ 1HXDA 3HSFA 2FUG2 3BG6A 3K1MA 4DNCA 3CMEI 1BW5A 1D1BA 4OOIA 1B9MA 4BEHB 4MTEA 4UHTA 2CH0A 3WU0A 3IAM2 4YFXF 3KPHA 4I09A 5GPAA 1BR4A 2KT0A 4ON0A 2QZ8A 4EM0B 1ORKA 4S0HB 4XLEA 3KFWX 3V4GA 2R3SA 5FROA 2DFFA 1P9QC 2V1NA 1EJ9A 1Y56A 2ZJ2A 1X1AA 2Q8KA 5D4SA 1JXSA 1VQKI 2O5RA 4Q47A 1S5LC 4I99C 2CV1A 1MMNA 9ANTA 1LEBA 1QZYA 2OUMA 3CUQB 4DW6A 4FE7A 4NUBA 5IYCJ 4ZTFA 3OYLA 3DBHB 4AVZA 3KYDB 3GX4X 3MZYA 3CJQB 4F3QA 1KQ9A 1NHAA 2VPRA 1NH3A 1WKMA 3ZQFA 4HNTA 4M74A 4Z6YA 3EYYA 4HSRA 4Z2YA 2GXBA 2ZSIB 1REPC 2Q2EB 5H2FC 2R7WA 1XTAA 1SEUA 4G8XA 4YIIA 3Q9SA 4IHVA 3LSHA 2NVUB 3WTUC 5KAIC 4ESJA 1Y6IA 1B1BA 1WJEA 3IV5A 3CCQI 1MGTA 1ZARA 2NYXA 5JFRA 3MN2A 1YJ9I 4OMYA 2IT0A 3L00A 4AVPA 3OS1A 3ZMVA 3L09A 3PNYA 1W0TA 1MMGA 4A5MA 2IA0A 4BHPA 2EFWA 1FWZA 1I6HJ 3PUFA 2VODA 3WHCA 3E6BA 2I5UA 1ZR2A 1IG7A 3OR1C 3L2UA 2Y0SA 1TW3A 4H0EA 1ZH5A 4NB5A 2YX4A 2GWRA 3BR3A 4P1WA 2NVYJ 5DUKA 2RDPA 1JGGA 1FX7A 1OYWA 1E0EA 3SZPA 4UB6C 3OSGA 4LG0B 1FOKA 1FYLA 2DT7B 2E1NA 5E3MA 2IS4A 2EFNA 1KU3A 1BM9A 4JQFA 1YIJI 1N78A 4MIMA 4UV8A 5CQGA 2L4MA 1GVDA 4O5VA 2KJBA 5TGTA 5DCMB 1SC7A 2HOAA 5CKTA 3HJEA 3FDYA 3GTOJ 1E2XA 1Z1DA 4AD9A 5HVQC 2L9NA 3R6SA 3HOYJ 2XKOA 1H88C 1BI1A 5H20A 4K2EA 1X1DA 4ZDOA 3GZ5A 2CO5A 3BG3A 3LSIA 2M7BA 5K7ZA 4HLYA 3D0SA 2L54A 3BG9A 2KZGA 1FJLA 1YYVA 1V5EA 2PBIA 3AG4H 1FSHA 2E5ZA 2M3AA 2GQQA 3ZN0A 3BTLA 5FLVA 4M3EA 3FK6A 5LLQA 2RQPA 3WODF 2VXDA 3G3ZA 4KIBA 1IDYA 4G7HF 4QLCU 4I02A 1ZQ3P 2V6EA 3HSRA 2WAQA 2BZTA 4FETA 5IT9K 1H9TA 4ESFA 2YX7A 1GUUA 3BOQA 4UB8C 1IF1A 4ZYHA 3QRFF 1R5GA 3Q9VA 3ZGKA 2JMWA 4W1UA 4HLXA 1G8XA 3I9V2 2UV1A 5LBQA 3LAJA 1UHMA 2YR2A 3N4MA 3HZJA 1A36A 5D6FA 2MC4A 2FNPA 1LE8B 4PJJA 1DPUA 2DA5A 4U0WA 5FJ8J 5IP9J 2NAZA 2MLGA 2CGPA 3CP8A 4Y3OA 3DPTA 3Q3SA 1J75A 5ICFA 3RPQA 2KMUA 1V4RA 5L3GA 2WV1A 4M9XA 3FXKA 2BXZA 3GF2A 1TW2A 2H8WA 3NARA 2IBDA 2DA1A 2Z99A 5CVIA 3S32A 1I1SA 3TKYA 4EM1A 2Y31A 1FP1D 2M2EA 3I54A 3QPHA 3TOBA 1P4WA 2CQQA 1D1CA 2HQAA 2HQRA 1F36A 3FXMA 3HIFA 2XSDC 2HYGD 2NOGA 2W57A 2IA1A 3H5NA 1WJDA 3TOAA 5LD2C 1WWXA 3O8GA 5EGOB 2CSOA 4KFCA 1IRGA 2M0CA 3GTQJ 3DTEA 3VWBA 4BEHA 2K9SA 4G7ZF 4HBLA 1X58A 1MH4A 2X1DA 1R71A 3NWTA 1K6YA 3AG2H 3F8BA 2EIKH 3R0AA 3A0HC 4EMSA 5LEKA 4LLLA 3RKQA 5F0FA 3B02A 3HEFA 3PFYA 2M4GA 4F7ZA 2Q2EA 3Q0UA 5E8GA 1GXPA 3CDLA 3KLOA 5IP7J 1H89C 1DUXC 2B0LA 3DV8A 3BZ6A 1E17A 3K4NA 4KIFA 3ZP5A 2JT1A 4BL0B 1FZPB 3S17J 4ITVA 1QZEA 2V9KA 5F64A 1Y0NA 2A68F 2H8RA 3OYHA 2CUZA 1H8AC 4XLHA 4AYBN 1BC8C 2XPUA 2QQ8A 2K5CA 1XGSA 3BTJA 3ZMTA 3IH3A 3WTTC 1O7FA 3IUOA 2E71A 4BXXJ 1XN7A 4KYWA 3NQOA 1T08B 4ZYEA 4BE2A 3ZQGA 3RJPA 2FSWA 4MTDA 3A2KA 4DGWB 3D5SC 5JI6A 4E7IA 2GIZA 2K3FA 2O3FA 3VDXA 1MSFC 3WGHA 3A1YA 2DBBA 3WHBA 1PYVA 1IXRC 3OYCA 4IOAF 4CZZA 1P4XA 4J00A 4NQWA 3RI4A 2LR8A 4M3BA 1P2FA 2HKOA 3PL8A 2LLKA 2TRTA 4Y7NJ 5BNGA 2PI0A 3S1QJ 1D8JA 4NBQA 1FPQA 4OIPF 2CMPA 2HKXA 3HL2A 2KDOA 2DOAA 2ZXHA 3ZMUA 2RNGA 3HRMA 2QVOA 1S7AA 2ZKZA 2DQLA 1Q1HA 1JJ8C 2O8KA 1BBYA 1J7KA 2HNHA 2JSCA 1BJAA 3V42A 1MDMA 2V1DA 5IY5H 4EEFG 5F1RA 1O4XA 4HAMA 5LGUA 2L9SA 2P7CB 2FBKA 2EV6A 3ECOA 5FLXK 2PX9A 3CD6I 5KVRA 2L9VA 4LOCA 3HUGA 3DFGA 4U87A 1IV6A 5DS9A 3WTXC 3H3ZA 3VYUB 2VQCA 4JBAA 2BY0A 5H6RA 3HPHA 1ZR4A 4EVIA 4G12A 1SD6A 3FK7A 4CDGA 2IPQX 2LMDA 1PVEA 3DTIA 3IKVA 3ZXSA 2ZJPF 3LSGA 2EIJH 2E35A 3VODA 1HQCA 4IX7A 1BOAA 3GBGA 4UUVA 4IQJA 2X85A 4A3BJ 1OCPA 1FSEA 2LSOA 5IOZA 3HXLA 3PUBA 4A5NA 4HF0A 2KKOA 4CXFA 3JRIA 4FX0A 4XN0A 2YUSA 5DTDA 1TZLA 2ZB9A 3MFKA 1J09A 3BJOA 4A0ZA 1HA8A 1SD5A 4B48A 1TWFJ 2CRGA 5K5OA 2OJED 2J5OA 2P81A 2V9PA 2IP2A 4M72A 4CCOA 4U0YA 4G6QA 1FBQA 1JKPC 1F9NA 3QU6A 1D8KA 4EGZA 5CVVA 3Q5FA 3LSJA 4FHTA 1LKXA 3MEXA 1XMKA 4KITB 4CICA 4N9HA 1WQ2A 5GAHJ 3CTAA 2VBWA 4I0AA 5J1RA 3BP8A 1WJAA 3BROA 1MJAA 3FXUA 1QBJA 1BA5A 5D5VB 3E7LA 4HV6A 3ZQQA 1R1UA 4DIQA 2E1CA 2MGQA 1KQ8A 1SAUA 5EEAA 2G0EA 1ETQA 2F5VA 4B1RA 3VEPA 4BJ5C 1FYMA 3KP7A 1U6GA 3JRHA 3R61A 2ZXIA 3IRRA 3HOZJ 1S7EA 4EV0A 3JR9A 4R8HA 4IOCF 4OIOF 3KP2A 1B72A 3VYSB 4XKCA 2ADUA 2NVTJ 2A6EF 1ZGWA 2A07F 3DWLE 1LPQA 4ZZLA 5B3SH 1FOWA 3FKJA 4YRVA 3OS2A 1I1GA 1KU9A 2A69F 1VQPI 2EH3A 1VQ8I 4HDUA 3G71I 1AU7A 1WVRA 4LFUA 4A3KJ 1S72I 5K5QA 3CESA 4YG2F 4PGGA 3LSKA 5FRMA 3M8EA 1Z7LA 1T98A 3LMMA 4LJZF 3A0BC 2HEOA 3OYJA 1VZ0A 3B6AA 1R49A 1WJFA 1JUSA 1ZK8A 1I27A 4EJOA 1FNNA 1TLHB 3QWLA 5EG0B 2FEZA 2VOPA 3F6VA 4KT5C 2UWMA 2HDWA 2CYYA 4A93J 5C4JJ 4HDVA 2FNAA 1JE8A 2NNNA 2RQQA 3VPRA 2M34A 2XAFA 3CDIA 3ERED 3F8FA 2K7LA 3WTWC 1CF7B 3NAUA 2AS5F 2MABA 2QF7A 3ZQCA 3CP2A 4IHTA 2PMZN 3JSOA 3LA2A 3H3VK 3Q0VA 1TT0A 4A3LJ 1IXSB 1X3UA 3OYGA 4FX4A 2EZIA 1B59A 2VKEA 3I3LA 5J4VA 3HGGA 4RAGA 2CUJA 1RIOH 5FB2A 3NWSA 1X1PA 4LMYA 2XPWA 1K4TA 1S8NA 1UAAA 2CUEA 3MKWB 5K7FA 1YW9A 2CQXA 2OQGA 2BBYA 2LY2A 4ETSA 1X4PA 2OZ6A 3GFJA 2MFZA 3SQNA 2ME0A 3P9CA 4B4CA 1O3SA 5IP6A 3LQQA 1RZ4A 3TO7A 4EATA 5HS9A 2F4IA 3ZMZA 2FRHA 1WGXA 4CSWA 5CVRA 1U0JA 1F4KA 4CHUA 3SXYA 3TMOA 3AL0C 4RDUA 1AKHB 2R7OA 4BBRJ 3TL4X 3CCYA 1AWCA 3ELKA 4KN7X 2IS1A 4HSTA 1D5VA 2B7EA 2DLLA 1UZCA 4NC8A 4BE0A 2GOMA 1P92A 1YLFA 1SD4A 2JN6A 2Y75A 1MNMC 2JPCA 3S93A 3J80Z 3KX2A 1JJ6C 3RYPA 4IO9F 2K86A 3H3UA 2LF8A 3EDPA 2MD0A 1DGRM 1R58A 2VL8A 1I39A 2CJJA 3LOCA 4I76A 4XK4A 3BTIA 1IN5A 2EZLA 4UY8I 5GP9A 5B1BH 5ICCA 2IW5A 2IGMA 3JRBA 1OJLA 3QAHA 3DP7A 5L3DA 1VQ7I 2VT2A 3BY6A 5DM7F 1ETWA 2B63J 1X3ZB 3ZQHA 5JR3A 4KIGA 1RC9A 1WJBA 2PMZA 3IAS2 1O3TA 1FYKA 3HHGA 1F43A 3UKGA 3EUKL 1U78A 4AC0A 1KU7A 3LFKA 4IEJA 1HCRA 2XRLA 4MFEA 3WGIA 3C2GA 2OTLI 3CF2A 2XF6A 5ILVA 2VQLA 3LL7A 4ZH4F 1YW7A 2VLAA 1TC3C 4XM3A 1B6AA 1IRXA 3F6OA 3ZQLA 4AIHA 2EZKA 1ON1A 1JI8A 3TDUC 2XV4S 3A01A 2Z16A 1G59A 1QA6A 1IUYA 2H6BA 4I6ZA 3W3CA 4RGRA 4HQEA 2F48A 5E3LA 1VTNC 2JVGA 1YIOA 1G6NA 1IN7A 3M8JA 3ISPA 2VE9A 1RETA 2F5FA 4ZYDA 4A3GJ 4X6AJ 1GV5A 1GLNA 3KEOA 2O6GE 3HPGA 4O3MA 2PEXA 5HDNA 1ITYA 2BEOA 4PK4A 3H0DA 1T0FC 2MG4A 2K9MA 2O0YA 2G7UA 5EG0A 2QSGX 3GTLJ 2EQRA 1G3TA 3HBLA 3CCJI 1ZG1A 2MSYA 3B6CA 3AFHA 2WB1N 3OOUA 4KDPA 5CPRB 2O9LA 1YX3A 1SMTA 2JZYA 4IL6C 1MBEA 1E3HA 2E19A 3D1NI 3L2CA 2R4GA 2QA4I 1R22A 2E2HJ 4XBFA 3K4LA 2L02A 2WY7Q 3I0TA 1V5FA 5AIPA 5D4RA 1YQAA 3K70D 4BHBA 3J80K 2DA7A 3C3WA 6PAXA 4QIWN 5EF6A 3P9KA 5FKKA 2I10A 1LVKA 1FOYA 1A04A 2KIMA 4L5EA 5HLTA 3P5JA 3E3VA 3O2PE 5TRDA 1U9OA 2DDAA 3Q0WA 4GXOA 2EA4A 5A2QK 4FCYA 1W5CC 4NNJA 3OYEA 1KGSA 2X6WA 4IRGA
chains in the Genus database with same CATH topology
2R7RA 1BR1A 4E7HA 3ZGKA 3UR3C 2R7XA 2W4SA 2W1OA 3EUAA 1G8XA 3I9V2 3OMYA 2UV1A 2M4KA 3DQVC 4BE1A 4Y33A 4XLFA 4YEJA 4MLOA 2CS3A 4RLFA 1UG0A 2MC4A 3QOEA 4PJJA 3RPUD 4BXFA 5HNHA 3CP8A 4Y3OA 3OYIA 3DPTA 3DKYA 2LG4A 2KMUA 1V5GA 3H5AA 2XSJC 4KT6A 1BR2A 3OYNA 3CZ6A 3BCAA 3W2VA 2E1MB 2HZDA 2PJRB 1ERDA 2KRHA 1D0YA 3OYDA 3F9KA 1YE9A 2VJJA 4NC7A 4RMNA 3S32A 3QYEA 3QYFA 3K70C 1D1CA 2HQAA 4NQWB 2XAUA 2E5NA 3HOTA 3H5NA 1WJDA 4G6TB 5LD2C 2LC2A 2L7KA 1UELB 2WADA 2IS2A 2HU9A 3DTEA 3VWBA 4BEHA 1MNEA 1MW7A 1NG7A 4ZTJA 4XOPA 4C2UA 2HPIA 2X1DA 2PJRA 2LY1A 2LH9A 4BJ6C 3NWTA 1K6YA 4C9YA 2KP6A 2VJ4A 3PNTA 5KHDA 3PFYA 2M4GA 2Z2SB 3K10A 4CCKA 4E7JA 3DU5A 4E7KA 2K3PA 3VSLA 4DJAA 2M0MA 2CW8A 4BDZA 4B44A 1S9HA 3IP4B 3ZRGA 1N75A 1BOBA 3OYFA 3K4NA 4ZDPA 3CMMA 4BL0B 2KL4A 3C2HA 3SZGA 4ITVA 4F93B 2CFOA 2V9KA 1KONA 3OYHA 3J7AY 2CUZA 3W2WA 4XLHA 2KQRA 3ONQA 4B47A 2R7VA 4OWRB 2UUZA 2JVHA 4BJTA 2K5CA 3OYKA 4HEA2 1OR7C 3BLYA 4ANJA 3DKXA 3IUOA 4II2A 2V4JC 4P5OA 2V26A 3K4CA 4IZZA 2WY8Q 4C2TA 4BE2A 3OS0A 3A2KA 4XLCA 3D5SC 4DGWB 2VB6A 4PJNA 4ZDLA 4E7IA 4KISA 3VDXA 4ZYAA 4CCNA 3UNGC 3A1YA 1QHGA 4HG2A 1PYVA 1MMDA 3OYCA 4E7LA 2AQFA 2V7FA 4II3A 4J00A 3DEEA 1Z21A 3VYTB 2KHMA 2X1CA 3PL8A 3M1CA 3SDBA 4GRIA 2JA2A 4PJMA 2ZSHB 2WB1A 1WJ5A 2M7AA 2CMPA 3HL2A 3OYBA 2KDOA 2DOAA 2P0WA 2ZXHA 4ZC3A 2WAEA 1T95A 2RNGA 3EPZA 2VPLA 2X6XA 4U7BA 3LFUA 3U21A 2GOXB 2CV2A 2VJ5A 4BUPA 3SYTA 2HNHA 1N77A 1X1CA 4AU7A 4DBRA 3N05A 2DJIA 3V42A 5FRNA 3ZCOA 3KYLA 3H35A 1SFKA 2L9SA 1MNDA 4HPQA 3OYMA 3LSMA 4CCJA 4U87A 3PJRA 4E4HA 4E6KG 4XNFA 4F91B 3VYUB 2VQCA 3HPHA 3HC7A 3OIPA 2IGOA 2OV7A 3MD2A 2BVMA 2L5QA 3AL0B 3DTIA 3ZXSA 2QKMB 3LSGA 2IGKA 4FASD 5JHFA 4IX7A 5LFAA 4N4NB 3GBGA 4PSWA 3OYAA 4IQJA 2X85A 2KZVA 2X1EA 2RREA 4BU2A 2VASA 3D5LA 4LITA 1YX5A 4LG3A 3HXLA 3PUBA 4H4KC 4X0GA 4XN0A 1TZLA 3BCBA 4RM2A 1J09A 2W7NA 4IKFA 1HA8A 4B48A 3H9JA 3BG7A 4F55A 2HVSA 1QU3A 2VIXA 4CCOA 1W36D 1PJRA 2I8DA 4CUGA 3FHNA 1LKXA 4E7ZA 2HVRA 3W2AA 2R7UA 4KITB 2HPMA 3HG9A 4QPOA 4XQFA 3FBNB 4F52A 3K6GA 2CV0A 1WJAA 4KJZA 1DQUA 4PJLA 1W36C 2W00A 3SEZA 4QPQA 3ZQQA 4BACA 4DIQA 2BW3A 5HNFA 2VJIA 1WFXA 1SAUA 4BQNA 2F5VA 2LRDA 4BJ5C 2CW7A 3L2RA 4DOZA 4XONA 3OWTA 4CCLA 2ZXIA 2WAFA 3MMYB 1FMWA 3VYSB 4XKCA 2A6TA 2DCEA 4HNUA 4B43A 3DWLE 5KNLA 4OAZA 1DP3A 2LBFA 2X6YA 3VSKA 3FKJA 3DLAA 2ELJA 4YRVA 3OS2A 4LIVA 1D0ZA 3E1SA 3DU6A 2XDVA 2NOJB 3CESA 2LYCA 3LSKA 4D9JA 5FRMA 3K4BA 3PNVA 4E7SA 2MYSA 1Z7LA 3LMMA 3RTRA 3QYBA 3ZR8X 3OYJA 4Y4RA 1D1AA 1VZ0A 4LIUA 1WJFA 3L2WA 4YELA 2Z1DA 2WA0A 3VYRB 2UWMA 3RQ4A 2HDWA 2VQGA 3H9QA 1QHHD 2QKLB 2RQQA 2JUGA 3BC8A 3DPLC 4D1QA 3OL4A 3RCOA 2JSPA 1X1BA 3H5RA 2XF7A 3OY9A 4B3XA 4XL9A 4BQQA 2MABA 3D5RC 1Z3YA 3MKYB 3CP2A 4J01A 3S3MA 1TT0A 2VXZA 2HVQA 3OYGA 3HUGB 3H9GA 3I3LA 2VQHA 4CA0A 2BW3B 1ZELA 2XF5A 3PSFA 1NG6A 2CUJA 4XKWA 4XR6A 3NWSA 4RM3A 3S8PA 2FUG2 3A4CA 3BG6A 1UAAA 3MKWB 1D1BA 4XN3A 2LY2A 1X4PA 4OAYA 4BEHB 2MFZA 1WJCA 2CH0A 3OIQA 3IAM2 2DXIA 1BR4A 3S3NA 4XLEA 4EATA 5FROA 1P9QC 2DT6A 2F4IA 2V1NA 4CSWA 3QODA 1Y56A 1U0JA 4XKBA 1LFPA 1X1AA 2LBFB 3TMOA 3AL0C 2ZFUA 2R7OA 2O5RA 3TL4X 2CV1A 4PUSA 1MMNA 3KEYA 2OUMA 3E0JB 2OC6A 4NUBA 2IS1A 4HSTA 3OR2C 4ZTFA 4BE0A 4NC8A 3OYLA 2R7TA 4AVZA 2VKHA 2GOMA 3CJQB 2KLOA 3PSIA 4XLAA 4F3QA 3SEQA 2KPMA 4CH7A 4HNTA 3S93A 3KX2A 2BVLA 2R7QA 2X51A 4HSRA 3FBIB 2ZSIB 2IXSA 4PFOA 4XOTA 2Q2EB 2R7WA 1D0XA 2MD0A 3K4JA 1DGRM 2VL8A 5CQEA 3LSHA 1Z3XA 1MMAA 4ZJZA 4PSXA 1Y6IA 1WJEA 2IGMA 3RSNA 4BGDA 2E1MC 4HRIA 4N4OB 3OS1A 3K4KA 1WJBA 3PNYA 1R6RA 1MMGA 2PMZA 3IAS2 3HKZA 3OL3A 3EUKL 1X19A 2L2OA 3K4MA 3OR1C 4XKVA 3L2UA 2Y0SA 4JOMA 4P1WA 1E0EA 3L2QA 3G2BA 3C2GA 4C30A 3CF2A 2XF6A 2IGNA 2VQLA 3LL7A 3DTKA 4R79A 2VLAA 4XM3A 1IRXA 4BDYA 2DT7B 2IS4A 1FMVA 1JI8A 3EUHC 4CCMA 2BOLA 2Z16A 3TBIA 1G59A 1X4OA 4JQFA 4BS9A 3HOSA 1LDKB 5HOOA 1N78A 3W3CA 5CQGA 2F6CA 5TGTA 2JVGA 3M8JA 2LREA 5CKTA 2IS6A 1OLTA 2R7SA 3FDYA 3L2VA 1GLNA 4XORA 3HPGA 5HVQC 2L9NA 4PK4A 3H0DA 1T0FC 4BQOA 2K9MA 4XMYA 2WBMA 3MKZA 4CZCA 1X1DA 4ZDOA 3LSIA 3AFHA 2AQEA 4DBQA 2M7BA 3CJRB 3OOUA 4PFPA 5CPRB 1YX3A 2W82A 2VKDA 2R4GA 4AYBA 3K4LA 1EA3A 1V5EA 2WY7Q 3S3OA 1V5FA 2E60A 3K70D 2E5ZA 3DPUA 2M3AA 2LOOA 1LVKA 1DGWY 2Q1ZB 2VXDA 5HLTA 2KRCA 4F92B 2XC7A 2V6EA 4FETA 2WAQA 1AA7A 3AKZA 2A5WA 4NNJA 4RLQA 5KCMA 3OYEA 4IQ4A 2K9LA 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5W A;  3OR1 C;  3OR2 C;  2XSJ C;  1JI8 A;  1SAU A;  2V4J C;  1YX3 A; 
#chains in the Genus database with same CATH topology
 2ZME C;  2MH9 A;  3UR3 C;  2R7X A;  4ENK A;  3GTM J;  4HZF A;  4L9J A;  3OMY A;  2ID6 A;  2M4K A;  2R5Y A;  1BI3 A;  4RBO A;  2GXA A;  2A6H F;  2P5V A;  4MLO A;  4MGR A;  1TL8 A;  1EF4 A;  2F5D A;  2Q0O A;  4MFD A;  1FEX A;  1QVU A;  5JVT A;  2Z33 A;  3TO9 A;  2QEN A;  3DKY A;  1AKH A;  1S29 A;  2ZO4 A;  1V5G A;  3H5A A;  1XMA A;  2O7O A;  1EH8 A;  2KIQ A;  3CCR I;  1T38 A;  1EH6 A;  3V7C A;  3OYN A;  2QCO A;  3BCA A;  3W2V A;  4HX8 A;  2XIG A;  3FXQ A;  4Y52 J;  1JT0 A;  2VJJ A;  1BW6 A;  4NHJ A;  4JX4 A;  1OCC H;  2VON A;  2J5P A;  2OF7 A;  3OOP A;  5LHG A;  1WH5 A;  1CF7 A;  3IH4 A;  2FXA A;  2QYO A;  2AHQ A;  4D7N A;  3K70 C;  1VQM I;  3F22 A;  4NQW B;  1BIB A;  1QGP A;  1XSD A;  2VUM J;  3HOT A;  2XUB A;  4G6T B;  2DA4 A;  4GCV A;  5EJC A;  3HRS A;  4M71 A;  1UEL B;  5HLG A;  2IS2 A;  1TWC J;  1USS A;  2HU9 A;  2EIL H;  1E3P A;  1TNT A;  2VE8 A;  5F0H A;  2FQ3 A;  1MNE A;  1MW7 A;  2PG4 A;  3M07 A;  4C2U A;  4KMF A;  1AHD P;  2LY1 A;  4MQV A;  3VFZ A;  4B8X A;  4C9Y A;  2BY2 A;  2KP6 A;  2VJ4 A;  3TDZ C;  1RKW A;  3K10 A;  4L5J A;  4CCK A;  1SVM A;  4E7J A;  4E7K A;  4PDK A;  4RGX A;  5L3F A;  1W1W E;  3GTK J;  2M0M A;  4DYC A;  4JP0 A;  4B44 A;  2GM4 A;  3LA3 A;  3IP4 B;  5GTI C;  1LDJ A;  3OYF A;  3IC7 A;  3C2H A;  3SZG A;  4A12 A;  1RRJ A;  3GZN B;  2KQR A;  2XGE A;  3ONQ A;  5DD8 A;  1ZG5 A;  1FBS A;  4B47 A;  2R7V A;  2VC0 A;  2R7D A;  2JVH A;  5J8C A;  2JRM A;  5B5E C;  4BJT A;  3OYK A;  4HEA 2;  1YFH A;  1EV7 A;  1Y8R B;  4EJT A;  4FIS A;  4P5O A;  4C2T A;  3K4C A;  2WY8 Q;  1R1T A;  1ZYR F;  5ED4 A;  1PP7 U;  4IHW A;  4XLC A;  3ABT A;  2VB6 A;  1W7P D;  3BZC A;  2DPD A;  1IAW A;  2L7M P;  1S7O A;  5FLX Z;  2DA3 A;  3P9I A;  4E7L A;  2AQF A;  2V7F A;  4A3D J;  1C0W A;  2JTV A;  2K4J A;  1T56 A;  1IV8 A;  5CJ9 A;  2M5W A;  1Z21 A;  3VYT B;  2KHM A;  3RZO J;  2JWT A;  5D8K B;  2IRF G;  1X3W B;  3SDB A;  4M9S A;  3REO A;  2JA2 A;  2EWN A;  1ZLK A;  2P0W A;  2VPL A;  3G1L A;  4ASN A;  3VOE A;  5E18 F;  3AG1 H;  3FIS A;  3LFU A;  5D6E A;  1GXQ A;  3HTS B;  4PZJ A;  2GOX B;  4CGZ A;  4YFN F;  2VJ5 A;  1TQI A;  2QQ9 A;  1TBX A;  3JRE A;  4G7O F;  4L0Y B;  1N77 A;  3M3Y J;  2QGU A;  2AO9 A;  4A3J J;  3CO6 C;  5FRN A;  3KYL A;  1BI0 A;  4HF1 A;  3HOX J;  4WXH A;  3H35 A;  1SFK A;  3ABU A;  1SMY F;  3V7R A;  1LJ9 A;  1MND A;  5M5Y J;  3OYM A;  2BGC A;  3U1D A;  5FD5 A;  2QQB A;  2EFQ A;  2NRA C;  3PJR A;  4E4H A;  4XNF A;  2X6O A;  2KJC A;  3WTZ A;  4F91 B;  1YIT I;  3LWF A;  5EYR A;  3HOW J;  3JRC A;  4XRM A;  2IGO A;  1WRJ A;  2BVM A;  2Y9Z A;  3AL0 B;  2W25 A;  2QKM B;  2IGK A;  2DOE A;  1TNS A;  4KA4 A;  4N4N B;  5FFZ A;  2XRO A;  2NNY A;  2P5K A;  3C18 A;  1IC8 A;  3D5L A;  1P4A A;  1YX5 A;  3MAJ A;  4LG3 A;  2E36 A;  2NS7 A;  1ETK A;  4LK1 F;  4X0G A;  3FXJ A;  3ABL H;  3KP6 A;  3KET A;  3H9J A;  3TO6 A;  2Y9Y A;  2RC4 A;  1HDP A;  1P7I A;  1XSV A;  2VIX A;  3LQR A;  4YIF A;  1W36 D;  2HDC A;  4PCQ A;  2DYS H;  2UXX A;  2I8D A;  4RS8 A;  4CUG A;  1XC5 A;  2L7F P;  1ONV A;  1HW1 A;  2HQ5 A;  1ZRF A;  1ETY A;  2OCC H;  3F8C A;  4QSH A;  2FJ1 A;  2DYR H;  2ZME B;  2DA2 A;  3K6G A;  3H0G J;  1DQU A;  3I56 I;  2W00 A;  1XGN A;  3GZ6 A;  3M8F A;  3ML6 A;  3BZK A;  4QPQ A;  3SEZ A;  1FOX A;  4BNC A;  2D1H A;  1YOV B;  2YS9 A;  4DZJ A;  4WWC A;  2VJI A;  1W7P A;  2O03 A;  4ABZ A;  2L3D A;  4BQN A;  2LP0 A;  2LRD A;  2PQ8 A;  2EV5 A;  3L9F A;  3TW7 A;  2PMH A;  3CUQ C;  1K4S A;  3KZI C;  4DOZ A;  4M6V A;  4XON A;  1STZ A;  3LAP A;  3OWT A;  5C3E J;  5DM6 F;  1HOM A;  2WAF A;  4GFB A;  3FZV A;  2FA5 A;  1UG2 A;  1I6X A;  4DQ2 A;  2GBY A;  3E6D A;  2A6T A;  2DT5 A;  2CW0 F;  5J1U A;  3G4S I;  2ISZ A;  1XPX A;  2FE3 A;  3DLA A;  2FBI A;  1OCR H;  3HHH A;  2ZXW H;  4V2F A;  3DU6 A;  3CUO A;  2COB A;  2XDV A;  2NOJ B;  5DCF A;  2CWE A;  1OR7 A;  2LFB A;  4D9J A;  5J1Y A;  1JT6 A;  3PNV A;  2M30 A;  3RTR A;  3ZR8 X;  4Y4R A;  1D1A A;  4LIU A;  1PP8 F;  3LNQ A;  2K9N A;  2Z1D A;  3IKT A;  5K5R A;  2VQG A;  3H9Q A;  5BPD A;  1DU0 A;  3M4O J;  1MBG A;  1VI0 A;  2X0L A;  2JUG A;  3JSP A;  4RAF A;  2MBF A;  3X2Q H;  2WAQ N;  4D1Q A;  4AIK A;  4I2O A;  2M8E A;  1A5J A;  3BQZ A;  4WF2 A;  4RB1 A;  1YS6 A;  1LE8 A;  3IWZ A;  3M7G A;  1HKS A;  2STT A;  4PJ0 C;  1MIJ A;  2IVM A;  3KIO A;  4AID A;  4RB2 C;  3KCC A;  2E2I J;  3CJN A;  5DEQ A;  3HUG B;  1Y0U A;  3H9G A;  3SHF A;  1OYI A;  4UVC A;  2VQH A;  4CA0 A;  3PSF A;  4MNU A;  1U9N A;  1W5T A;  4XKW A;  1JUP A;  1Q1V A;  4WXC A;  1JTY A;  3SZT A;  3S8P A;  4UUS B;  1Y1W J;  1NK3 P;  1U5T B;  4I98 B;  4KIC A;  4OAY A;  4M6X A;  3E6M A;  3S1N J;  4CO8 A;  2FML A;  2FOW A;  4EGY A;  1LEA A;  3S1R J;  2BV6 A;  4IHS A;  2HDD A;  4WX9 A;  2DT6 A;  1TQP A;  2LBF B;  1LFP A;  1DPR A;  2ZFU A;  1I3Q J;  1LFU P;  4PUS A;  1LNW A;  2WWY A;  3KEY A;  1Z6T A;  2OC6 A;  4Q48 A;  2DOD A;  1POG A;  1QQI A;  2W85 A;  3GLX A;  2V9V A;  5FD6 A;  5D5U B;  2DMP A;  2RGV A;  1WPK A;  2VKH A;  2KLO A;  3PSI A;  2KPM A;  1HDD C;  4CH7 A;  3G6E I;  4G6D A;  2ZNY A;  1SAX A;  1XCV A;  2VBZ A;  2BVL A;  2X51 A;  2ESH A;  5ERI A;  4M73 A;  4PFO A;  2XB5 A;  3ZQ7 A;  1R1V A;  3ZMS A;  3K4J A;  1O3Q A;  3WG9 A;  3W6J B;  3H92 A;  5CQE A;  1Z6R A;  4LG0 A;  3BG5 A;  3CMY A;  3GTG J;  1X2N A;  4PSX A;  2BY3 A;  2HWV A;  5DD4 A;  3AG3 H;  3RSN A;  4BGD A;  2R93 J;  4HW0 A;  3OV8 A;  4LGW A;  4N4O B;  2WC2 A;  3K7A J;  1RKT A;  3K4K A;  1R6R A;  1FIP A;  2YSR A;  5M3F J;  3HKZ A;  5KK1 A;  2HXO A;  3OL3 A;  1X19 A;  3FX3 A;  3J7Z I;  1XGO A;  4Q4Z F;  2L2O A;  1RI7 A;  2BHZ A;  2W84 A;  3CJT B;  4BXU A;  1T8I A;  3KP3 A;  2GA1 A;  3L2Q A;  2NS8 A;  2A3S A;  4C30 A;  1GT0 C;  2IGN A;  1IW7 F;  3DTK A;  4R79 A;  1RUO A;  4BDY A;  3CC2 I;  2DTZ A;  1FMV A;  3BR0 A;  3EUH C;  4CCM A;  4CYC A;  2BOL A;  4BQA A;  3WTS C;  2PLY A;  1XSX A;  1X4O A;  4HYE A;  4BS9 A;  2XGC A;  1LDK B;  5HOO A;  3HOS A;  3S16 J;  3J81 K;  4AWX B;  1PUF B;  3G73 A;  1XGM A;  5J40 A;  3ZOB A;  3KEQ A;  5GTH C;  1O3R A;  2Y30 A;  4CYD A;  1YO5 C;  1OCO H;  3GME A;  3S2D J;  1P6R A;  1DDN A;  3LSR A;  5E1W A;  4XOR A;  1F1Z A;  2KIS A;  2M8G X;  1HC8 A;  2FD5 A;  3I4P A;  4BQO A;  4XMY A;  1ENH A;  2DQR A;  3LSP A;  4HA8 A;  3I5U A;  1FIA A;  5CVJ A;  4CZC A;  1QPI A;  2R92 J;  2M9H A;  2A05 A;  2DMN A;  1FP2 A;  2AQE A;  2K4B A;  1VQ9 I;  2X4H A;  3CJR B;  4D7M A;  4A0Y A;  5JVG F;  2N8G A;  1UB9 A;  2VKD A;  5J6X A;  2DAO A;  4BKX A;  3JTH A;  4KNY A;  1ZRD A;  1KQ0 A;  2HGC A;  2IAI A;  4CYC B;  1HF0 A;  3FIW A;  2DN0 A;  4MO7 A;  2P5L C;  3DPU A;  2FBH A;  4IPA A;  2DI3 A;  3SJM A;  2LOO A;  3BWG A;  1HW2 A;  2R0Q C;  1DGW Y;  2Q1Z B;  1K78 B;  2CQN A;  5HS7 A;  4F92 B;  1Y39 A;  4D5F A;  3FXR A;  1U8B A;  3I58 A;  3JRF A;  1R5H A;  1HBX G;  4N0B A;  3HRU A;  5B1A H;  3AKZ A;  5JLX A;  2A5W A;  4RLQ A;  5KCM A;  1SFO J;  1G3S A;  4IQ4 A;  2VAS A;  1OKR A;  3IL2 A;  1BR1 A;  4E7H A;  1UHW A;  1KYW A;  1ULY A;  5BOX A;  2W4S A;  1SAN A;  2Y0M A;  4BE1 A;  2QWW A;  1XDS A;  4Y33 A;  2QSF X;  4XLF A;  4XLN F;  3OIO A;  3CO7 C;  4RB3 C;  4IXA A;  2CS3 A;  4RLF A;  1UG0 A;  1BIA A;  2ZCW A;  3QQA A;  4G94 A;  3TW6 A;  1SFU A;  2ACJ A;  1MBH A;  3KP5 A;  4LLG F;  3CCS I;  4AIJ A;  1UJ8 A;  4Q5S F;  2F4O B;  3PQK A;  3CC4 I;  1VQ6 I;  2ZFW A;  3IRQ A;  5KAF C;  3COA C;  2ISY A;  3KZZ A;  4KT6 A;  5C4X J;  1Z91 A;  2OA4 A;  4L5I A;  5FLM J;  2E1M B;  5DDG A;  4BY7 J;  2PJR B;  3BQY A;  3J7Y J;  1IN4 A;  1D0Y A;  5A2Q Z;  1ERD A;  3OYD A;  3F9K A;  1YE9 A;  3EET A;  4NC7 A;  4RMN A;  3DF8 A;  4M3F A;  3S1M J;  1MD0 A;  3BR6 A;  5LRS A;  2V6C A;  5B66 C;  4B09 A;  2GXG A;  3ESW B;  1XD7 A;  3H1C A;  1FTT A;  2HZT A;  1IN8 A;  1CGP A;  1XDU A;  1L3L A;  1M1E B;  2XAU A;  3SDG A;  5IPA A;  1XMX A;  4IRI A;  3LA7 A;  1SD7 A;  2H27 A;  4U88 A;  4BHC A;  1UCR A;  1Z77 A;  2L7K A;  1JKQ C;  5ICG A;  3CCE I;  3E5X A;  4OIN F;  1ON2 A;  1Y8Q B;  2WAD A;  3IHU A;  4C3H J;  1LVA A;  4JX6 A;  2JQ7 A;  5J8F A;  1U5T A;  2GIV A;  5DUI A;  1LB2 A;  2HQN A;  4ZTJ A;  5K7H A;  4XOP A;  2HPI A;  2PJR A;  2LH9 A;  2DFH A;  3KE2 A;  1T2K A;  3C7J A;  2DMT A;  3BPX A;  1VQO I;  3PNT A;  2W24 A;  3PM1 A;  4QTR A;  4XSX F;  5KHD A;  2ZNZ A;  3MVP A;  2Z2S B;  3BT9 A;  3CLQ A;  2F5E A;  1YS7 A;  3DU5 A;  3GFL A;  2XAJ A;  4DJA A;  2NVQ J;  2V1U A;  3V7S A;  3ZRG A;  1N75 A;  5CYV A;  1MSE C;  4ZDP A;  1X2M A;  2EFO A;  2KL4 A;  3RDI A;  4ZZD A;  4F93 B;  5J4Y A;  5EGO A;  4XRS G;  1LQ1 A;  2E2J J;  2ETH A;  1ZHF A;  3W2W A;  1FC3 A;  2XGX A;  4LB5 A;  4OWR B;  3M1E A;  2G7H A;  3CCV I;  2UUZ A;  2K02 A;  2ECB A;  1R4M B;  3BLY A;  3CQZ J;  2Z3Y A;  1XS9 A;  3SFZ A;  2V4J C;  1W0U A;  4IZZ A;  1A35 A;  2HOS A;  4UUT A;  1R9T J;  2E7W A;  1TWH J;  3ASO H;  4RAZ A;  4PJN A;  4UVA A;  4ZDL A;  4IJA A;  4CCN A;  1QHG A;  4Y13 A;  2P8T A;  2LNB A;  2L0K A;  3B73 A;  5EZG A;  1FT9 A;  1ZGJ A;  2JA7 J;  4U7D A;  5C44 J;  4FTH A;  3BTC A;  3BR1 A;  1RNL A;  1MBK A;  5HLI A;  1JGS A;  2X1C A;  1ZG3 A;  2VT3 A;  3FKI J;  3M1C A;  2EFP A;  3V8L A;  1U2W A;  2DMU A;  4PJM A;  5DCM A;  2ZSH B;  3GW2 A;  1WJ5 A;  2OU2 A;  2M7A A;  2MD5 A;  3OYB A;  5M3M J;  4RGS A;  2WAE A;  3EPZ A;  3FM5 A;  4HV5 A;  1XCB A;  4HOB A;  3CCU I;  5TJJ A;  3GTP J;  1ZN2 A;  3HTU A;  2A5Y B;  1I3A A;  2ZBK A;  3HOV J;  1MBF A;  1JKO C;  3JAM K;  5GAG J;  1YTY A;  3E5U A;  1QPM A;  4BUP A;  1V54 H;  3SYT A;  1IGN A;  1X1C A;  4AU7 A;  4DBR A;  1FTZ A;  3N05 A;  2ZJQ F;  2DJI A;  3ZPL A;  1WZ2 A;  5LGT A;  3ZCO A;  3GO5 A;  3ZN1 A;  3GUD A;  2HYJ A;  1XG1 A;  2Z9O A;  4Y17 A;  2QM3 A;  5BS6 A;  4XRF A;  2OZU A;  4CCJ A;  2JK3 A;  2HXI A;  3JTG A;  1B9N A;  2DW4 A;  5FKL A;  2FOK A;  1GDT A;  2F5C A;  1LDD A;  2HOE A;  4M9Z A;  4GO1 A;  3CCL I;  4MHG A;  2Y2Z A;  1O7L A;  2OV7 A;  4UXN A;  5F08 A;  4FQG A;  3RIR A;  4FAS D;  4HF2 A;  3WTV C;  1S3J A;  5JHF A;  1KZH A;  5LFA A;  4S04 A;  5L3C A;  4L9V A;  3OYA A;  2KZV A;  2X1E A;  2RRE A;  1ETO A;  4LIT A;  1TP4 A;  3QOP A;  2RKH A;  4H4K C;  2HTJ A;  1MMS A;  1HW5 A;  1P7J A;  2XAG A;  4IKF A;  2EIM H;  1UST A;  2HI3 A;  3DLL F;  3I4N J;  2QLZ A;  2DA6 A;  1XX5 A;  3KYC B;  4F55 A;  4XID A;  5BPI A;  1QU3 A;  3F8M A;  2KRF A;  1RPW A;  2VN2 A;  4XRS A;  2K9Q A;  3CDH A;  3CF5 F;  1WSU A;  2BE5 F;  1UHS A;  4A3M J;  4I7H A;  1ACI A;  4GYG A;  2HOT A;  4XQF A;  1L0O C;  3R60 A;  1LFB A;  2EBI A;  4F52 A;  1OMI A;  2FQ4 A;  2CV0 A;  2P6S A;  1FBU A;  2YPR A;  3K69 A;  3MWM A;  5LHI A;  4PJL A;  3DKW A;  4O6J A;  1R00 A;  3TP3 A;  5JLW A;  2OAZ A;  1G3W A;  4FT8 A;  3I53 A;  1Y1V J;  4BAC A;  1V55 H;  3J81 Z;  1B8I A;  4LLN A;  3DBR B;  2AXL A;  2FF4 A;  4JYK A;  1LUJ B;  4M3G A;  3G1M A;  1H0M A;  3V8K A;  1VND A;  2E7X A;  5JHU A;  3L2R A;  3QP6 A;  3C2B A;  3EQL F;  1WI3 A;  3FM3 A;  4BH9 A;  4IHY A;  2KIU A;  5L3E A;  1GVJ A;  2GLO A;  4A3C J;  4CCL A;  2JA8 J;  3I64 A;  1IJW C;  5E3O A;  4L9T A;  1FMW A;  3PQJ A;  4KMU X;  3I59 A;  2TDX A;  1VQL I;  3WTY C;  2QBY B;  1U3E M;  2DCE A;  1RR8 C;  1MJ9 A;  5KNL A;  4OAZ A;  2LBF A;  2X6Y A;  2ELJ A;  3A02 A;  3R4K A;  3HKZ N;  1APL C;  3FMQ A;  4ENN A;  1QZZ A;  4LIV A;  4OIR F;  3HSE A;  4WXD A;  3ULQ B;  1T39 A;  2R5Y B;  1TQM A;  1KA8 A;  1G4D A;  1Z7U A;  5J47 A;  1IUF A;  3RKW A;  3VB2 A;  2LYC A;  4ENM A;  2P7V B;  3K4B A;  3ZQI A;  2X9D A;  2LD5 A;  3E6C C;  1D5Y A;  3QYB A;  4W97 A;  3T1B A;  4YEL A;  1MJB A;  4HX4 A;  1YRN B;  4DYR A;  2XGD A;  3VYR B;  3RQ4 A;  1V3F A;  5FKN A;  1I50 J;  2MA3 A;  1J9I A;  3BR2 A;  2WTE A;  2QKL B;  5FFX A;  1TWG J;  1UFM A;  1R36 A;  1MKM A;  1X1B A;  1CQT A;  4L18 B;  3KP4 A;  4BQQ A;  3D5R C;  3HM5 A;  4X1E A;  2HTS A;  5GAD J;  5GAE J;  3MKY B;  3DBL B;  2ECC A;  4NDL A;  3S3M A;  3F21 A;  1YJN I;  4ZYG A;  2ICW G;  3RPU A;  5IOY A;  2OBP A;  3TQN A;  2BW3 B;  1ZEL A;  3LST A;  3FMS A;  2RAE A;  4XR6 A;  4RM3 A;  2HFH A;  3A4C A;  2H94 A;  4XN3 A;  4M6Y A;  3S2W A;  4A69 C;  2LKP A;  2BHY A;  1WJC A;  4UV9 A;  2MLK A;  3OIQ A;  2DXI A;  1Z05 A;  5J3L A;  3S3N A;  4M3D A;  4OIQ F;  5CLS A;  3HDD A;  1N25 A;  1QO0 D;  4AM3 A;  3HYI A;  2JA6 J;  4LB6 B;  2XRN A;  2CFX A;  3QOD A;  4XKB A;  5F6F A;  1XB4 A;  1W7P B;  2KDZ A;  2QQA A;  2K40 A;  3ERM A;  2DFI A;  3TP0 A;  3E0J B;  3DCF A;  5E17 F;  1K78 A;  1BC7 C;  3OR2 C;  2EV0 A;  2R7T A;  1Z0X A;  4XLA A;  2EZH A;  3SEQ A;  1YW8 A;  2R7Q A;  2LTP A;  3FBI B;  4EQQ A;  2IXS A;  2NVX J;  4XOT A;  3WU1 B;  4A2U A;  1D0X A;  3IWF A;  3ECH A;  2D5V A;  5E20 A;  1Z3X A;  1MMA A;  1PDN C;  4ZJZ A;  4TV7 A;  1ETX A;  1QVT A;  4GYI A;  4EJU A;  1EH7 A;  4OU0 A;  2E1M C;  4HRI A;  3S15 J;  1I5Z A;  1HLV A;  1J5Y A;  3JAM Z;  1IDZ A;  3BDD A;  1ZTR A;  1KU2 A;  5H6Q A;  2TCT A;  2HS5 A;  4PGH A;  1OYY A;  5HS8 A;  3T5X A;  1U8R A;  3BJA A;  3K4M A;  4XKV A;  1YG2 A;  4JOM A;  4YFK F;  2R5Z B;  2LF7 A;  1BL0 A;  3G2B A;  3O8H A;  2W48 A;  3DEW A;  3I59 B;  4P9F A;  1ZRC A;  5EEG A;  3RKY A;  2QBY A;  3GLL A;  4BBS J;  5FO5 A;  2E1O A;  1T33 A;  4G9Y A;  1VQN I;  2RN7 A;  2HYF A;  1NTC A;  3TBI A;  3CCM I;  4L0Z B;  5D5W B;  2M1B A;  1R4N B;  4RB0 A;  5DYM A;  1S6L A;  1W4M A;  2DOF A;  2L9R A;  2F6C A;  3FHZ A;  3L7W A;  1MZB A;  2OCE A;  2D45 A;  2LRE A;  5D5X B;  2IS6 A;  1OLT A;  2R7S A;  3L2V A;  3PO3 J;  2FX0 A;  2JRT A;  4LK0 F;  1OPC A;  2H6C A;  5D8L B;  2WBM A;  3EUH A;  3MKZ A;  1TT5 B;  2XAH A;  3GYH X;  1J59 A;  1WCM J;  1DU6 A;  2H1L A;  2O61 A;  4DBQ A;  4FE4 A;  4PFP A;  3MZH A;  2W82 A;  2RVC A;  5HDG A;  4AYB A;  5IT3 A;  1G2H A;  1EA3 A;  4HQM A;  2M45 A;  3S3O A;  2E60 A;  5LGN A;  3A03 A;  2COM A;  2E34 A;  4NC6 A;  1B4A A;  4BAY A;  3AAF A;  4EJV A;  1MBJ A;  3K1N A;  3FXL A;  4OMZ A;  4MQ9 F;  3I55 I;  2KRC A;  2DK5 A;  1TTY A;  5CVU A;  1IRZ A;  3ASN H;  2LKX A;  5L3B A;  2XC7 A;  5HLH A;  4UUS A;  2D1V A;  2AXT C;  1SFE A;  2CG4 A;  1AA7 A;  5F04 A;  2GA2 A;  1ETV A;  3HRT A;  5IYB J;  1AOY A;  1A31 A;  2YU9 J;  4XIC A;  2K9L A;  1O57 A;  2R7R A;  2H1K A;  1JTX A;  2Z5U A;  2W1O A;  2RV8 A;  3EUA A;  1DP7 P;  4IHX A;  4MEY F;  5M5W J;  1WI9 A;  3DQV C;  3E5Q A;  2XAQ A;  3QPS A;  4YEJ A;  1OFC X;  3H36 A;  3QOE A;  5E3N A;  4N9I A;  3HGY A;  3WE2 A;  2BXY A;  2D2W A;  3F8N A;  3RPU D;  3OSF A;  4UNO A;  2ID3 A;  4BXF A;  5HNH A;  1VQ5 I;  1OCT C;  3OYI A;  3GFM A;  2XVC A;  1H9G A;  2LG4 A;  1K6O A;  1GV2 A;  4XLP F;  1RR7 A;  1RES A;  2VI6 A;  3WE3 A;  2XSJ C;  5HOD A;  1BR2 A;  4QWQ A;  3CZ6 A;  3NRV A;  1OIS A;  2MC3 A;  5EZH A;  2HZD A;  3WGG A;  3O6B B;  2OQR A;  2KRH A;  2DO7 A;  1HKT A;  2P6T A;  3F0C A;  4A6E A;  5EEH A;  2R7F A;  3ABK H;  4RGU A;  3MQ0 A;  3QYE A;  4GDF A;  2LKS A;  1R5I D;  2KFD A;  3QYF A;  2B9S A;  2H09 A;  2IA2 A;  2XHK A;  3GWZ A;  1QNT A;  2Y69 H;  2JJ7 A;  2YU3 A;  4P55 A;  3ZMD A;  3T8R A;  2E5N A;  3W6V A;  1RUN A;  2LC2 A;  3DEU A;  3PFI A;  2VOO A;  1G3Y A;  5FKO A;  2VKV A;  5LRR A;  1YJW I;  4KUM A;  1HKQ A;  4WK8 F;  2EB7 A;  1NG7 A;  3R0J A;  3N97 A;  3V8J A;  4BJ6 C;  5BMZ A;  2Y48 A;  1PUE E;  1ZGA A;  5FKM A;  1TWA J;  4MEX F;  1SVO A;  2M87 A;  4B3A A;  3GXO A;  1OQY A;  2K3P A;  3VSL A;  5ICE A;  2CW8 A;  2L01 A;  5E1Z B;  3F72 A;  4BDZ A;  2VBY A;  3S2H J;  2CUF A;  1OCZ H;  2UZK A;  4J19 A;  1S9H A;  2PMU A;  3L1P A;  1R23 A;  1BOB A;  4IRH A;  3QPL A;  3SFI A;  3RYR A;  4ENJ A;  3CMM A;  2ZXJ A;  5E8I A;  3DXJ F;  3HB9 A;  3A01 B;  2CFO A;  1SVL A;  2OD5 A;  2PFB A;  1KON A;  3BJ6 A;  5F27 A;  3IH2 A;  3J7A Y;  2BY1 A;  4WCG A;  3FWE A;  3P7N A;  2EA2 A;  4V2G A;  2O8X A;  1YHQ I;  1BN5 A;  2NS0 A;  1Z9C A;  1OR7 C;  4ANJ A;  3DKX A;  4II2 A;  1J0R A;  1B72 B;  1W5S A;  1IZ1 A;  2OPT A;  2V26 A;  2WV0 A;  4D5C A;  2A61 A;  3OS0 A;  3T8T A;  1ZRE A;  2C6Y A;  4L9N A;  3K1P A;  1K61 A;  1A6Q A;  4KIS A;  1VQ4 I;  4ZYA A;  3UNG C;  5IT9 Z;  4HG2 A;  3K9T A;  1MMD A;  2F2E A;  4S05 A;  1K7A A;  3I71 A;  5F0C A;  2ESN A;  3JCU C;  3KZY A;  4II3 A;  3PO2 J;  4EJW A;  5E79 C;  3DEE A;  4D0P A;  5LEJ A;  2DPU A;  5GPC A;  2MW8 A;  3CUQ A;  4UVB A;  4GRI A;  5ILU A;  2WB1 A;  5DV5 A;  5F1J A;  2V1X A;  1J2X A;  2DJN A;  4ZC3 A;  1T95 A;  2X6X A;  4U7B A;  4IF4 A;  3JRD A;  1IN6 A;  3U21 A;  5ILS A;  1ZKG A;  1IO2 A;  3F3X A;  4BY1 J;  4C3I J;  1JKR C;  1ZAO A;  2ELK A;  2CV2 A;  1ODD A;  2MH2 A;  2XKP A;  1WH7 A;  4KN4 X;  2K85 A;  2QSH X;  1K79 A;  4A3E J;  3F23 A;  1E3O C;  1NK2 P;  4I0B A;  3CLO A;  2JUC A;  4HPQ A;  3PIP F;  3LSM A;  3O3K A;  2R7Z J;  3QPT A;  5HDK A;  2JPB A;  4E6K G;  5M5X J;  2PJP A;  3GVA A;  4R1H A;  2FU4 A;  1KYZ A;  4I01 A;  3HC7 A;  3OIP A;  2CU7 A;  4HX7 A;  3MD2 A;  2K27 A;  2CQ7 A;  3FXO A;  4P96 A;  2L5Q A;  3RKX A;  5TIS C;  2VBX A;  3JW4 A;  1D3Y A;  1MH3 A;  3KLN A;  1BI2 A;  2VC1 A;  2PN6 A;  2OTJ I;  3E97 A;  4RA2 A;  4EM2 A;  4PSW A;  1T6S A;  5K1Y A;  4BU2 A;  3GFI A;  2LDU A;  4E70 A;  3MKL A;  3QP5 A;  3RQI A;  2LK2 A;  2P4W A;  3PIO F;  3NEU A;  2DK8 A;  3BCB A;  3WU2 C;  4RM2 A;  2XAS A;  3U9G A;  4XSZ F;  2W7N A;  2CQK A;  4JK1 X;  3HOU J;  5IYD J;  4V19 K;  1YRN A;  4GGG A;  1A6I A;  1JHH A;  3BG7 A;  2HVS A;  2FMY A;  1QRY A;  1Z67 A;  2NXN B;  3TED A;  4C2M J;  1PUF A;  4LD5 A;  2RNJ A;  3JRA A;  4BYY A;  1PJR A;  3CC7 I;  2DFE A;  2DMQ A;  2DU9 A;  1VFC A;  3FHN A;  5FGM A;  2L4A A;  4E7Z A;  2HVR A;  3W2A A;  2R7U A;  1JUM A;  2EPF A;  2HPM A;  1SFX A;  3HG9 A;  4QPO A;  3FBN B;  2KIF A;  4KJZ A;  1W36 C;  3W6K B;  4HNV A;  2F4M B;  2DTR A;  2EJR A;  2BW3 A;  5HNF A;  3C1D A;  2IEK A;  1WFX A;  4A3I J;  1YI2 I;  2STW A;  1BJZ A;  2ZJR F;  3G1O A;  1MDM B;  3ROU A;  4RAY A;  4P9U A;  1HST A;  2CW7 A;  3BPV A;  2EK5 A;  2DDB A;  3K2Z A;  1FLI A;  2BYV E;  1HSJ A;  2ZC2 A;  3MMY B;  3TGN A;  2LVS A;  1FY7 A;  2ELH A;  4HNU A;  5E1X A;  2UXN A;  2LY9 A;  5EDN A;  2EIN H;  4B43 A;  2R5Z A;  3ABM H;  2ZME A;  1DP3 A;  4JX5 A;  3BR5 A;  4A6D A;  3VSK A;  1VF9 A;  3JRG A;  3EYI A;  1F5T A;  3U1K A;  2L7Z A;  1D0Z A;  3E1S A;  4U0V A;  1R7J A;  2V79 A;  1U5T C;  2QUF A;  1UMQ A;  4DZP A;  1JHF A;  2GAU A;  2XB0 X;  4E7S A;  3J7A O;  2MYS A;  4C3J J;  4ESB A;  2HR3 A;  3L2W A;  2JA5 J;  3WG7 H;  3CMA I;  5AON A;  1GHC A;  1EKE A;  3FMR A;  2WA0 A;  2ME6 A;  3K0L A;  3I4M J;  3GCM A;  1QHH D;  3S14 J;  3BC8 A;  3GEZ A;  3DPL C;  4AUX A;  3FF5 A;  3OL4 A;  5LHH A;  3RCO A;  2JSP A;  2GZW A;  3H5R A;  1T0F A;  3MZ8 A;  2XF7 A;  3OY9 A;  4B3X A;  1K83 J;  3M9A A;  4XL9 A;  3K2A A;  5AIQ A;  4DYQ A;  3RZD J;  1Z3Y A;  1ZLJ A;  2G9W A;  4IVN A;  4A3F J;  4J01 A;  1IRF A;  3QU3 A;  3T0Y A;  4A0X A;  2IJL A;  2VXZ A;  2HVQ A;  2X48 A;  4Y15 A;  2XPV A;  5BQT A;  4YIR X;  3U2R A;  2QEX I;  1IXC A;  3MCZ A;  1B8I B;  2XF5 A;  1NG6 A;  2Y0S N;  1WHU A;  3GTJ J;  1HXD A;  3HSF A;  2FUG 2;  3BG6 A;  3K1M A;  4DNC A;  3CME I;  1BW5 A;  1D1B A;  4OOI A;  1B9M A;  4BEH B;  4MTE A;  4UHT A;  2CH0 A;  3WU0 A;  3IAM 2;  4YFX F;  3KPH A;  4I09 A;  5GPA A;  1BR4 A;  2KT0 A;  4ON0 A;  2QZ8 A;  4EM0 B;  1ORK A;  4S0H B;  4XLE A;  3KFW X;  3V4G A;  2R3S A;  5FRO A;  2DFF A;  1P9Q C;  2V1N A;  1EJ9 A;  1Y56 A;  2ZJ2 A;  1X1A A;  2Q8K A;  5D4S A;  1JXS A;  1VQK I;  2O5R A;  4Q47 A;  1S5L C;  4I99 C;  2CV1 A;  1MMN A;  9ANT A;  1LEB A;  1QZY A;  2OUM A;  3CUQ B;  4DW6 A;  4FE7 A;  4NUB A;  5IYC J;  4ZTF A;  3OYL A;  3DBH B;  4AVZ A;  3KYD B;  3GX4 X;  3MZY A;  3CJQ B;  4F3Q A;  1KQ9 A;  1NHA A;  2VPR A;  1NH3 A;  1WKM A;  3ZQF A;  4HNT A;  4M74 A;  4Z6Y A;  3EYY A;  4HSR A;  4Z2Y A;  2GXB A;  2ZSI B;  1REP C;  2Q2E B;  5H2F C;  2R7W A;  1XTA A;  1SEU A;  4G8X A;  4YII A;  3Q9S A;  4IHV A;  3LSH A;  2NVU B;  3WTU C;  5KAI C;  4ESJ A;  1Y6I A;  1B1B A;  1WJE A;  3IV5 A;  3CCQ I;  1MGT A;  1ZAR A;  2NYX A;  5JFR A;  3MN2 A;  1YJ9 I;  4OMY A;  2IT0 A;  3L00 A;  4AVP A;  3OS1 A;  3ZMV A;  3L09 A;  3PNY A;  1W0T A;  1MMG A;  4A5M A;  2IA0 A;  4BHP A;  2EFW A;  1FWZ A;  1I6H J;  3PUF A;  2VOD A;  3WHC A;  3E6B A;  2I5U A;  1ZR2 A;  1IG7 A;  3OR1 C;  3L2U A;  2Y0S A;  1TW3 A;  4H0E A;  1ZH5 A;  4NB5 A;  2YX4 A;  2GWR A;  3BR3 A;  4P1W A;  2NVY J;  5DUK A;  2RDP A;  1JGG A;  1FX7 A;  1OYW A;  1E0E A;  3SZP A;  4UB6 C;  3OSG A;  4LG0 B;  1FOK A;  1FYL A;  2DT7 B;  2E1N A;  5E3M A;  2IS4 A;  2EFN A;  1KU3 A;  1BM9 A;  4JQF A;  1YIJ I;  1N78 A;  4MIM A;  4UV8 A;  5CQG A;  2L4M A;  1GVD A;  4O5V A;  2KJB A;  5TGT A;  5DCM B;  1SC7 A;  2HOA A;  5CKT A;  3HJE A;  3FDY A;  3GTO J;  1E2X A;  1Z1D A;  4AD9 A;  5HVQ C;  2L9N A;  3R6S A;  3HOY J;  2XKO A;  1H88 C;  1BI1 A;  5H20 A;  4K2E A;  1X1D A;  4ZDO A;  3GZ5 A;  2CO5 A;  3BG3 A;  3LSI A;  2M7B A;  5K7Z A;  4HLY A;  3D0S A;  2L54 A;  3BG9 A;  2KZG A;  1FJL A;  1YYV A;  1V5E A;  2PBI A;  3AG4 H;  1FSH A;  2E5Z A;  2M3A A;  2GQQ A;  3ZN0 A;  3BTL A;  5FLV A;  4M3E A;  3FK6 A;  5LLQ A;  2RQP A;  3WOD F;  2VXD A;  3G3Z A;  4KIB A;  1IDY A;  4G7H F;  4QLC U;  4I02 A;  1ZQ3 P;  2V6E A;  3HSR A;  2WAQ A;  2BZT A;  4FET A;  5IT9 K;  1H9T A;  4ESF A;  2YX7 A;  1GUU A;  3BOQ A;  4UB8 C;  1IF1 A;  4ZYH A;  3QRF F;  1R5G A;  3Q9V A;  3ZGK A;  2JMW A;  4W1U A;  4HLX A;  1G8X A;  3I9V 2;  2UV1 A;  5LBQ A;  3LAJ A;  1UHM A;  2YR2 A;  3N4M A;  3HZJ A;  1A36 A;  5D6F A;  2MC4 A;  2FNP A;  1LE8 B;  4PJJ A;  1DPU A;  2DA5 A;  4U0W A;  5FJ8 J;  5IP9 J;  2NAZ A;  2MLG A;  2CGP A;  3CP8 A;  4Y3O A;  3DPT A;  3Q3S A;  1J75 A;  5ICF A;  3RPQ A;  2KMU A;  1V4R A;  5L3G A;  2WV1 A;  4M9X A;  3FXK A;  2BXZ A;  3GF2 A;  1TW2 A;  2H8W A;  3NAR A;  2IBD A;  2DA1 A;  2Z99 A;  5CVI A;  3S32 A;  1I1S A;  3TKY A;  4EM1 A;  2Y31 A;  1FP1 D;  2M2E A;  3I54 A;  3QPH A;  3TOB A;  1P4W A;  2CQQ A;  1D1C A;  2HQA A;  2HQR A;  1F36 A;  3FXM A;  3HIF A;  2XSD C;  2HYG D;  2NOG A;  2W57 A;  2IA1 A;  3H5N A;  1WJD A;  3TOA A;  5LD2 C;  1WWX A;  3O8G A;  5EGO B;  2CSO A;  4KFC A;  1IRG A;  2M0C A;  3GTQ J;  3DTE A;  3VWB A;  4BEH A;  2K9S A;  4G7Z F;  4HBL A;  1X58 A;  1MH4 A;  2X1D A;  1R71 A;  3NWT A;  1K6Y A;  3AG2 H;  3F8B A;  2EIK H;  3R0A A;  3A0H C;  4EMS A;  5LEK A;  4LLL A;  3RKQ A;  5F0F A;  3B02 A;  3HEF A;  3PFY A;  2M4G A;  4F7Z A;  2Q2E A;  3Q0U A;  5E8G A;  1GXP A;  3CDL A;  3KLO A;  5IP7 J;  1H89 C;  1DUX C;  2B0L A;  3DV8 A;  3BZ6 A;  1E17 A;  3K4N A;  4KIF A;  3ZP5 A;  2JT1 A;  4BL0 B;  1FZP B;  3S17 J;  4ITV A;  1QZE A;  2V9K A;  5F64 A;  1Y0N A;  2A68 F;  2H8R A;  3OYH A;  2CUZ A;  1H8A C;  4XLH A;  4AYB N;  1BC8 C;  2XPU A;  2QQ8 A;  2K5C A;  1XGS A;  3BTJ A;  3ZMT A;  3IH3 A;  3WTT C;  1O7F A;  3IUO A;  2E71 A;  4BXX J;  1XN7 A;  4KYW A;  3NQO A;  1T08 B;  4ZYE A;  4BE2 A;  3ZQG A;  3RJP A;  2FSW A;  4MTD A;  3A2K A;  4DGW B;  3D5S C;  5JI6 A;  4E7I A;  2GIZ A;  2K3F A;  2O3F A;  3VDX A;  1MSF C;  3WGH A;  3A1Y A;  2DBB A;  3WHB A;  1PYV A;  1IXR C;  3OYC A;  4IOA F;  4CZZ A;  1P4X A;  4J00 A;  4NQW A;  3RI4 A;  2LR8 A;  4M3B A;  1P2F A;  2HKO A;  3PL8 A;  2LLK A;  2TRT A;  4Y7N J;  5BNG A;  2PI0 A;  3S1Q J;  1D8J A;  4NBQ A;  1FPQ A;  4OIP F;  2CMP A;  2HKX A;  3HL2 A;  2KDO A;  2DOA A;  2ZXH A;  3ZMU A;  2RNG A;  3HRM A;  2QVO A;  1S7A A;  2ZKZ A;  2DQL A;  1Q1H A;  1JJ8 C;  2O8K A;  1BBY A;  1J7K A;  2HNH A;  2JSC A;  1BJA A;  3V42 A;  1MDM A;  2V1D A;  5IY5 H;  4EEF G;  5F1R A;  1O4X A;  4HAM A;  5LGU A;  2L9S A;  2P7C B;  2FBK A;  2EV6 A;  3ECO A;  5FLX K;  2PX9 A;  3CD6 I;  5KVR A;  2L9V A;  4LOC A;  3HUG A;  3DFG A;  4U87 A;  1IV6 A;  5DS9 A;  3WTX C;  3H3Z A;  3VYU B;  2VQC A;  4JBA A;  2BY0 A;  5H6R A;  3HPH A;  1ZR4 A;  4EVI A;  4G12 A;  1SD6 A;  3FK7 A;  4CDG A;  2IPQ X;  2LMD A;  1PVE A;  3DTI A;  3IKV A;  3ZXS A;  2ZJP F;  3LSG A;  2EIJ H;  2E35 A;  3VOD A;  1HQC A;  4IX7 A;  1BOA A;  3GBG A;  4UUV A;  4IQJ A;  2X85 A;  4A3B J;  1OCP A;  1FSE A;  2LSO A;  5IOZ A;  3HXL A;  3PUB A;  4A5N A;  4HF0 A;  2KKO A;  4CXF A;  3JRI A;  4FX0 A;  4XN0 A;  2YUS A;  5DTD A;  1TZL A;  2ZB9 A;  3MFK A;  1J09 A;  3BJO A;  4A0Z A;  1HA8 A;  1SD5 A;  4B48 A;  1TWF J;  2CRG A;  5K5O A;  2OJE D;  2J5O A;  2P81 A;  2V9P A;  2IP2 A;  4M72 A;  4CCO A;  4U0Y A;  4G6Q A;  1FBQ A;  1JKP C;  1F9N A;  3QU6 A;  1D8K A;  4EGZ A;  5CVV A;  3Q5F A;  3LSJ A;  4FHT A;  1LKX A;  3MEX A;  1XMK A;  4KIT B;  4CIC A;  4N9H A;  1WQ2 A;  5GAH J;  3CTA A;  2VBW A;  4I0A A;  5J1R A;  3BP8 A;  1WJA A;  3BRO A;  1MJA A;  3FXU A;  1QBJ A;  1BA5 A;  5D5V B;  3E7L A;  4HV6 A;  3ZQQ A;  1R1U A;  4DIQ A;  2E1C A;  2MGQ A;  1KQ8 A;  1SAU A;  5EEA A;  2G0E A;  1ETQ A;  2F5V A;  4B1R A;  3VEP A;  4BJ5 C;  1FYM A;  3KP7 A;  1U6G A;  3JRH A;  3R61 A;  2ZXI A;  3IRR A;  3HOZ J;  1S7E A;  4EV0 A;  3JR9 A;  4R8H A;  4IOC F;  4OIO F;  3KP2 A;  1B72 A;  3VYS B;  4XKC A;  2ADU A;  2NVT J;  2A6E F;  1ZGW A;  2A07 F;  3DWL E;  1LPQ A;  4ZZL A;  5B3S H;  1FOW A;  3FKJ A;  4YRV A;  3OS2 A;  1I1G A;  1KU9 A;  2A69 F;  1VQP I;  2EH3 A;  1VQ8 I;  4HDU A;  3G71 I;  1AU7 A;  1WVR A;  4LFU A;  4A3K J;  1S72 I;  5K5Q A;  3CES A;  4YG2 F;  4PGG A;  3LSK A;  5FRM A;  3M8E A;  1Z7L A;  1T98 A;  3LMM A;  4LJZ F;  3A0B C;  2HEO A;  3OYJ A;  1VZ0 A;  3B6A A;  1R49 A;  1WJF A;  1JUS A;  1ZK8 A;  1I27 A;  4EJO A;  1FNN A;  1TLH B;  3QWL A;  5EG0 B;  2FEZ A;  2VOP A;  3F6V A;  4KT5 C;  2UWM A;  2HDW A;  2CYY A;  4A93 J;  5C4J J;  4HDV A;  2FNA A;  1JE8 A;  2NNN A;  2RQQ A;  3VPR A;  2M34 A;  2XAF A;  3CDI A;  3ERE D;  3F8F A;  2K7L A;  3WTW C;  1CF7 B;  3NAU A;  2AS5 F;  2MAB A;  2QF7 A;  3ZQC A;  3CP2 A;  4IHT A;  2PMZ N;  3JSO A;  3LA2 A;  3H3V K;  3Q0V A;  1TT0 A;  4A3L J;  1IXS B;  1X3U A;  3OYG A;  4FX4 A;  2EZI A;  1B59 A;  2VKE A;  3I3L A;  5J4V A;  3HGG A;  4RAG A;  2CUJ A;  1RIO H;  5FB2 A;  3NWS A;  1X1P A;  4LMY A;  2XPW A;  1K4T A;  1S8N A;  1UAA A;  2CUE A;  3MKW B;  5K7F A;  1YW9 A;  2CQX A;  2OQG A;  2BBY A;  2LY2 A;  4ETS A;  1X4P A;  2OZ6 A;  3GFJ A;  2MFZ A;  3SQN A;  2ME0 A;  3P9C A;  4B4C A;  1O3S A;  5IP6 A;  3LQQ A;  1RZ4 A;  3TO7 A;  4EAT A;  5HS9 A;  2F4I A;  3ZMZ A;  2FRH A;  1WGX A;  4CSW A;  5CVR A;  1U0J A;  1F4K A;  4CHU A;  3SXY A;  3TMO A;  3AL0 C;  4RDU A;  1AKH B;  2R7O A;  4BBR J;  3TL4 X;  3CCY A;  1AWC A;  3ELK A;  4KN7 X;  2IS1 A;  4HST A;  1D5V A;  2B7E A;  2DLL A;  1UZC A;  4NC8 A;  4BE0 A;  2GOM A;  1P92 A;  1YLF A;  1SD4 A;  2JN6 A;  2Y75 A;  1MNM C;  2JPC A;  3S93 A;  3J80 Z;  3KX2 A;  1JJ6 C;  3RYP A;  4IO9 F;  2K86 A;  3H3U A;  2LF8 A;  3EDP A;  2MD0 A;  1DGR M;  1R58 A;  2VL8 A;  1I39 A;  2CJJ A;  3LOC A;  4I76 A;  4XK4 A;  3BTI A;  1IN5 A;  2EZL A;  4UY8 I;  5GP9 A;  5B1B H;  5ICC A;  2IW5 A;  2IGM A;  3JRB A;  1OJL A;  3QAH A;  3DP7 A;  5L3D A;  1VQ7 I;  2VT2 A;  3BY6 A;  5DM7 F;  1ETW A;  2B63 J;  1X3Z B;  3ZQH A;  5JR3 A;  4KIG A;  1RC9 A;  1WJB A;  2PMZ A;  3IAS 2;  1O3T A;  1FYK A;  3HHG A;  1F43 A;  3UKG A;  3EUK L;  1U78 A;  4AC0 A;  1KU7 A;  3LFK A;  4IEJ A;  1HCR A;  2XRL A;  4MFE A;  3WGI A;  3C2G A;  2OTL I;  3CF2 A;  2XF6 A;  5ILV A;  2VQL A;  3LL7 A;  4ZH4 F;  1YW7 A;  2VLA A;  1TC3 C;  4XM3 A;  1B6A A;  1IRX A;  3F6O A;  3ZQL A;  4AIH A;  2EZK A;  1ON1 A;  1JI8 A;  3TDU C;  2XV4 S;  3A01 A;  2Z16 A;  1G59 A;  1QA6 A;  1IUY A;  2H6B A;  4I6Z A;  3W3C A;  4RGR A;  4HQE A;  2F48 A;  5E3L A;  1VTN C;  2JVG A;  1YIO A;  1G6N A;  1IN7 A;  3M8J A;  3ISP A;  2VE9 A;  1RET A;  2F5F A;  4ZYD A;  4A3G J;  4X6A J;  1GV5 A;  1GLN A;  3KEO A;  2O6G E;  3HPG A;  4O3M A;  2PEX A;  5HDN A;  1ITY A;  2BEO A;  4PK4 A;  3H0D A;  1T0F C;  2MG4 A;  2K9M A;  2O0Y A;  2G7U A;  5EG0 A;  2QSG X;  3GTL J;  2EQR A;  1G3T A;  3HBL A;  3CCJ I;  1ZG1 A;  2MSY A;  3B6C A;  3AFH A;  2WB1 N;  3OOU A;  4KDP A;  5CPR B;  2O9L A;  1YX3 A;  1SMT A;  2JZY A;  4IL6 C;  1MBE A;  1E3H A;  2E19 A;  3D1N I;  3L2C A;  2R4G A;  2QA4 I;  1R22 A;  2E2H J;  4XBF A;  3K4L A;  2L02 A;  2WY7 Q;  3I0T A;  1V5F A;  5AIP A;  5D4R A;  1YQA A;  3K70 D;  4BHB A;  3J80 K;  2DA7 A;  3C3W A;  6PAX A;  4QIW N;  5EF6 A;  3P9K A;  5FKK A;  2I10 A;  1LVK A;  1FOY A;  1A04 A;  2KIM A;  4L5E A;  5HLT A;  3P5J A;  3E3V A;  3O2P E;  5TRD A;  1U9O A;  2DDA A;  3Q0W A;  4GXO A;  2EA4 A;  5A2Q K;  4FCY A;  1W5C C;  4NNJ A;  3OYE A;  1KGS A;  2X6W A;  4IRG A; 
#chains in the Genus database with same CATH homology
 2R7R A;  1BR1 A;  4E7H A;  3ZGK A;  3UR3 C;  2R7X A;  2W4S A;  2W1O A;  3EUA A;  1G8X A;  3I9V 2;  3OMY A;  2UV1 A;  2M4K A;  3DQV C;  4BE1 A;  4Y33 A;  4XLF A;  4YEJ A;  4MLO A;  2CS3 A;  4RLF A;  1UG0 A;  2MC4 A;  3QOE A;  4PJJ A;  3RPU D;  4BXF A;  5HNH A;  3CP8 A;  4Y3O A;  3OYI A;  3DPT A;  3DKY A;  2LG4 A;  2KMU A;  1V5G A;  3H5A A;  2XSJ C;  4KT6 A;  1BR2 A;  3OYN A;  3CZ6 A;  3BCA A;  3W2V A;  2E1M B;  2HZD A;  2PJR B;  1ERD A;  2KRH A;  1D0Y A;  3OYD A;  3F9K A;  1YE9 A;  2VJJ A;  4NC7 A;  4RMN A;  3S32 A;  3QYE A;  3QYF A;  3K70 C;  1D1C A;  2HQA A;  4NQW B;  2XAU A;  2E5N A;  3HOT A;  3H5N A;  1WJD A;  4G6T B;  5LD2 C;  2LC2 A;  2L7K A;  1UEL B;  2WAD A;  2IS2 A;  2HU9 A;  3DTE A;  3VWB A;  4BEH A;  1MNE A;  1MW7 A;  1NG7 A;  4ZTJ A;  4XOP A;  4C2U A;  2HPI A;  2X1D A;  2PJR A;  2LY1 A;  2LH9 A;  4BJ6 C;  3NWT A;  1K6Y A;  4C9Y A;  2KP6 A;  2VJ4 A;  3PNT A;  5KHD A;  3PFY A;  2M4G A;  2Z2S B;  3K10 A;  4CCK A;  4E7J A;  3DU5 A;  4E7K A;  2K3P A;  3VSL A;  4DJA A;  2M0M A;  2CW8 A;  4BDZ A;  4B44 A;  1S9H A;  3IP4 B;  3ZRG A;  1N75 A;  1BOB A;  3OYF A;  3K4N A;  4ZDP A;  3CMM A;  4BL0 B;  2KL4 A;  3C2H A;  3SZG A;  4ITV A;  4F93 B;  2CFO A;  2V9K A;  1KON A;  3OYH A;  3J7A Y;  2CUZ A;  3W2W A;  4XLH A;  2KQR A;  3ONQ A;  4B47 A;  2R7V A;  4OWR B;  2UUZ A;  2JVH A;  4BJT A;  2K5C A;  3OYK A;  4HEA 2;  1OR7 C;  3BLY A;  4ANJ A;  3DKX A;  3IUO A;  4II2 A;  2V4J C;  4P5O A;  2V26 A;  3K4C A;  4IZZ A;  2WY8 Q;  4C2T A;  4BE2 A;  3OS0 A;  3A2K A;  4XLC A;  3D5S C;  4DGW B;  2VB6 A;  4PJN A;  4ZDL A;  4E7I A;  4KIS A;  3VDX A;  4ZYA A;  4CCN A;  3UNG C;  3A1Y A;  1QHG A;  4HG2 A;  1PYV A;  1MMD A;  3OYC A;  4E7L A;  2AQF A;  2V7F A;  4II3 A;  4J00 A;  3DEE A;  1Z21 A;  3VYT B;  2KHM A;  2X1C A;  3PL8 A;  3M1C A;  3SDB A;  4GRI A;  2JA2 A;  4PJM A;  2ZSH B;  2WB1 A;  1WJ5 A;  2M7A A;  2CMP A;  3HL2 A;  3OYB A;  2KDO A;  2DOA A;  2P0W A;  2ZXH A;  4ZC3 A;  2WAE A;  1T95 A;  2RNG A;  3EPZ A;  2VPL A;  2X6X A;  4U7B A;  3LFU A;  3U21 A;  2GOX B;  2CV2 A;  2VJ5 A;  4BUP A;  3SYT A;  2HNH A;  1N77 A;  1X1C A;  4AU7 A;  4DBR A;  3N05 A;  2DJI A;  3V42 A;  5FRN A;  3ZCO A;  3KYL A;  3H35 A;  1SFK A;  2L9S A;  1MND A;  4HPQ A;  3OYM A;  3LSM A;  4CCJ A;  4U87 A;  3PJR A;  4E4H A;  4E6K G;  4XNF A;  4F91 B;  3VYU B;  2VQC A;  3HPH A;  3HC7 A;  3OIP A;  2IGO A;  2OV7 A;  3MD2 A;  2BVM A;  2L5Q A;  3AL0 B;  3DTI A;  3ZXS A;  2QKM B;  3LSG A;  2IGK A;  4FAS D;  5JHF A;  4IX7 A;  5LFA A;  4N4N B;  3GBG A;  4PSW A;  3OYA A;  4IQJ A;  2X85 A;  2KZV A;  2X1E A;  2RRE A;  4BU2 A;  2VAS A;  3D5L A;  4LIT A;  1YX5 A;  4LG3 A;  3HXL A;  3PUB A;  4H4K C;  4X0G A;  4XN0 A;  1TZL A;  3BCB A;  4RM2 A;  1J09 A;  2W7N A;  4IKF A;  1HA8 A;  4B48 A;  3H9J A;  3BG7 A;  4F55 A;  2HVS A;  1QU3 A;  2VIX A;  4CCO A;  1W36 D;  1PJR A;  2I8D A;  4CUG A;  3FHN A;  1LKX A;  4E7Z A;  2HVR A;  3W2A A;  2R7U A;  4KIT B;  2HPM A;  3HG9 A;  4QPO A;  4XQF A;  3FBN B;  4F52 A;  3K6G A;  2CV0 A;  1WJA A;  4KJZ A;  1DQU A;  4PJL A;  1W36 C;  2W00 A;  3SEZ A;  4QPQ A;  3ZQQ A;  4BAC A;  4DIQ A;  2BW3 A;  5HNF A;  2VJI A;  1WFX A;  1SAU A;  4BQN A;  2F5V A;  2LRD A;  4BJ5 C;  2CW7 A;  3L2R A;  4DOZ A;  4XON A;  3OWT A;  4CCL A;  2ZXI A;  2WAF A;  3MMY B;  1FMW A;  3VYS B;  4XKC A;  2A6T A;  2DCE A;  4HNU A;  4B43 A;  3DWL E;  5KNL A;  4OAZ A;  1DP3 A;  2LBF A;  2X6Y A;  3VSK A;  3FKJ A;  3DLA A;  2ELJ A;  4YRV A;  3OS2 A;  4LIV A;  1D0Z A;  3E1S A;  3DU6 A;  2XDV A;  2NOJ B;  3CES A;  2LYC A;  3LSK A;  4D9J A;  5FRM A;  3K4B A;  3PNV A;  4E7S A;  2MYS A;  1Z7L A;  3LMM A;  3RTR A;  3QYB A;  3ZR8 X;  3OYJ A;  4Y4R A;  1D1A A;  1VZ0 A;  4LIU A;  1WJF A;  3L2W A;  4YEL A;  2Z1D A;  2WA0 A;  3VYR B;  2UWM A;  3RQ4 A;  2HDW A;  2VQG A;  3H9Q A;  1QHH D;  2QKL B;  2RQQ A;  2JUG A;  3BC8 A;  3DPL C;  4D1Q A;  3OL4 A;  3RCO A;  2JSP A;  1X1B A;  3H5R A;  2XF7 A;  3OY9 A;  4B3X A;  4XL9 A;  4BQQ A;  2MAB A;  3D5R C;  1Z3Y A;  3MKY B;  3CP2 A;  4J01 A;  3S3M A;  1TT0 A;  2VXZ A;  2HVQ A;  3OYG A;  3HUG B;  3H9G A;  3I3L A;  2VQH A;  4CA0 A;  2BW3 B;  1ZEL A;  2XF5 A;  3PSF A;  1NG6 A;  2CUJ A;  4XKW A;  4XR6 A;  3NWS A;  4RM3 A;  3S8P A;  2FUG 2;  3A4C A;  3BG6 A;  1UAA A;  3MKW B;  1D1B A;  4XN3 A;  2LY2 A;  1X4P A;  4OAY A;  4BEH B;  2MFZ A;  1WJC A;  2CH0 A;  3OIQ A;  3IAM 2;  2DXI A;  1BR4 A;  3S3N A;  4XLE A;  4EAT A;  5FRO A;  1P9Q C;  2DT6 A;  2F4I A;  2V1N A;  4CSW A;  3QOD A;  1Y56 A;  1U0J A;  4XKB A;  1LFP A;  1X1A A;  2LBF B;  3TMO A;  3AL0 C;  2ZFU A;  2R7O A;  2O5R A;  3TL4 X;  2CV1 A;  4PUS A;  1MMN A;  3KEY A;  2OUM A;  3E0J B;  2OC6 A;  4NUB A;  2IS1 A;  4HST A;  3OR2 C;  4ZTF A;  4BE0 A;  4NC8 A;  3OYL A;  2R7T A;  4AVZ A;  2VKH A;  2GOM A;  3CJQ B;  2KLO A;  3PSI A;  4XLA A;  4F3Q A;  3SEQ A;  2KPM A;  4CH7 A;  4HNT A;  3S93 A;  3KX2 A;  2BVL A;  2R7Q A;  2X51 A;  4HSR A;  3FBI B;  2ZSI B;  2IXS A;  4PFO A;  4XOT A;  2Q2E B;  2R7W A;  1D0X A;  2MD0 A;  3K4J A;  1DGR M;  2VL8 A;  5CQE A;  3LSH A;  1Z3X A;  1MMA A;  4ZJZ A;  4PSX A;  1Y6I A;  1WJE A;  2IGM A;  3RSN A;  4BGD A;  2E1M C;  4HRI A;  4N4O B;  3OS1 A;  3K4K A;  1WJB A;  3PNY A;  1R6R A;  1MMG A;  2PMZ A;  3IAS 2;  3HKZ A;  3OL3 A;  3EUK L;  1X19 A;  2L2O A;  3K4M A;  3OR1 C;  4XKV A;  3L2U A;  2Y0S A;  4JOM A;  4P1W A;  1E0E A;  3L2Q A;  3G2B A;  3C2G A;  4C30 A;  3CF2 A;  2XF6 A;  2IGN A;  2VQL A;  3LL7 A;  3DTK A;  4R79 A;  2VLA A;  4XM3 A;  1IRX A;  4BDY A;  2DT7 B;  2IS4 A;  1FMV A;  1JI8 A;  3EUH C;  4CCM A;  2BOL A;  2Z16 A;  3TBI A;  1G59 A;  1X4O A;  4JQF A;  4BS9 A;  3HOS A;  1LDK B;  5HOO A;  1N78 A;  3W3C A;  5CQG A;  2F6C A;  5TGT A;  2JVG A;  3M8J A;  2LRE A;  5CKT A;  2IS6 A;  1OLT A;  2R7S A;  3FDY A;  3L2V A;  1GLN A;  4XOR A;  3HPG A;  5HVQ C;  2L9N A;  4PK4 A;  3H0D A;  1T0F C;  4BQO A;  2K9M A;  4XMY A;  2WBM A;  3MKZ A;  4CZC A;  1X1D A;  4ZDO A;  3LSI A;  3AFH A;  2AQE A;  4DBQ A;  2M7B A;  3CJR B;  3OOU A;  4PFP A;  5CPR B;  1YX3 A;  2W82 A;  2VKD A;  2R4G A;  4AYB A;  3K4L A;  1EA3 A;  1V5E A;  2WY7 Q;  3S3O A;  1V5F A;  2E60 A;  3K70 D;  2E5Z A;  3DPU A;  2M3A A;  2LOO A;  1LVK A;  1DGW Y;  2Q1Z B;  2VXD A;  5HLT A;  2KRC A;  4F92 B;  2XC7 A;  2V6E A;  4FET A;  2WAQ A;  1AA7 A;  3AKZ A;  2A5W A;  4NNJ A;  4RLQ A;  5KCM A;  3OYE A;  4IQ4 A;  2K9L A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...