3K10A

Crystal structure of telomere capping protein stn1 from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
170
Chain Sequence
TSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDSGILLHLEYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein STN1
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 55
structure length 170
sequence length 179
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12659 Stn1_C Telomere capping C-terminal wHTH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A01
1.10.10.1090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A02
3KEYA 3K10A
chains in the Genus database with same CATH superfamily
1W7PA 4L5EA 2GQQA 2XSDC 1OR7A 1YX5A 2JK3A 2H8RA 1KA8A 4PK4A 3BTCA 2OF7A 1HQCA 2BVLA 1OJLA 5H2FC 3S3OA 2P6SA 3QP5A 1UG2A 2QGUA 3FXQA 4HA8A 4PZJA 4OAYA 2YU9J 1XSVA 2ID6A 3PQJA 4UV9A 4II3A 2W25A 9ANTA 2E1MC 2XHKA 5KAFC 3HSRA 1XCBA 1BI0A 3KYCB 2LVSA 3ESWB 3CZ6A 1L0OC 3KEYA 4NC6A 2JA7J 3RKQA 4HPQA 1LFPA 1K78B 2WAQN 1W5CC 3N97A 3C7JA 3OL4A 1WJDA 2G7HA 4G7HF 2CV2A 2ZXHA 3AKZA 3HTSB 3LNQA 2HDCA 3S1QJ 3OYDA 3PSFA 1LUJB 3RZDJ 4HLXA 1D5YA 2E1NA 4M9ZA 5DD4A 5BS6A 1AOYA 2A69F 1IRFA 2Y9ZA 2VONA 3RYRA 4NUBA 4MQ9F 2I5UA 2LFBA 3BOQA 4M6XA 2HTJA 2TDXA 2GBYA 4J01A 1O4XA 2XAQA 1MD0A 1V5GA 1LVAA 3FKJA 2H6BA 5FKMA 5D5WB 1P6RA 3F8NA 3GTGJ 3Q3SA 3RIRA 5D5VB 4Y52J 2F5EA 3M4OJ 3IWZA 2CMPA 4EATA 3DQVC 3F21A 3VYSB 1R36A 4BQNA 3C2HA 3L2WA 3LA3A 4ENNA 2W00A 3JREA 3F8MA 4BAYA 2E36A 3LSIA 2KPMA 1XPXA 4QPQA 2KRHA 3TW6A 1FEXA 3JRDA 1N78A 2FNAA 1JTYA 2EFPA 3E0JB 4RAYA 2DMQA 3CC7I 3MN2A 4MNUA 1IGNA 2JA8J 2CW8A 4FT8A 2ID3A 3G3ZA 1SVMA 1VQPI 3SJMA 3CDLA 1KONA 1OCPA 2OCCH 1FWZA 2VN2A 5JLXA 2FEZA 3PM1A 4Y4RA 1IZ1A 5FFZA 4E4HA 4LLGF 3SEQA 2ZMEC 1W1WE 2FOKA 4N4NB 4OIQF 2L3DA 1MMDA 2HWVA 2R7QA 2NVQJ 1W36D 2FSWA 1MZBA 2VJ4A 1Z3XA 2MBFA 3TBIA 5DDGA 4WWCA 2E1MB 2HNHA 1MJBA 2E2HJ 3BQYA 3JTHA 3BJAA 4C3JJ 3GXOA 1LEBA 4UXNA 4BDZA 1ZAOA 1PUFB 4V19K 1W0UA 1LFBA 3QAHA 1HLVA 3H3VK 2BY3A 3G1LA 5IP9J 5FKLA 4RLQA 4XOTA 1TC3C 1D0XA 3BR2A 4LGWA 2K3FA 3OYJA 2Y48A 1VTNC 2DOFA 1JKPC 3VDXA 1XDSA 2R7FA 1O7FA 1TQMA 4A5NA 3ELKA 2R7RA 1RETA 2W82A 2GXBA 4EM0B 2EWNA 2Q2EB 4OMZA 2BW3A 5EEGA 5CVIA 4XSZF 4Q4ZF 4BGDA 1USSA 1IRXA 2DOEA 3KLNA 1U5TC 2XB5A 4TV7A 3ERMA 1J0RA 3VSLA 3CDHA 5FB2A 3JRHA 1QBJA 4IQJA 1HW1A 1OYYA 5EYRA 5J3LA 5M5WJ 5BOXA 3BT9A 4BXUA 3BJ6A 5K5QA 3ZXSA 3ZOBA 3BTLA 3I55I 3VYTB 3UR3C 5HLIA 3HOZJ 1UB9A 4BNCA 4MLOA 2GA1A 1JUPA 1FIAA 4DYQA 1E3PA 2MG4A 1T0FA 3KEQA 1MMAA 2R4GA 3LFKA 4KJZA 2IJLA 2DA7A 5D6FA 2QEXI 1BA5A 2FD5A 3LWFA 2EIJH 2VPRA 5F0HA 1L3LA 2X48A 3FXRA 4D5CA 3OYGA 2RAEA 1NH3A 1IDYA 3VYUB 4BQAA 1RUOA 4OIRF 1WPKA 3EETA 4WXHA 2KL4A 4CDGA 3DU6A 2BBYA 4U7DA 4AIHA 2LR8A 3M1CA 2QQBA 1EV7A 1APLC 2XKPA 1KU7A 1MKMA 2XV4S 2HKOA 2W48A 3TP3A 3JAMK 2OTLI 1H9GA 2MYSA 1ZKGA 4KIFA 3ZMDA 1OCOH 1WI3A 1SAUA 2NRAC 3OYCA 2P5VA 2QSFX 5EEAA 1HW5A 4HF2A 4NC8A 4XKWA 3HBLA 4YELA 4KIGA 1GVDA 2WY7Q 5E8IA 1BR4A 5C4JJ 3S1RJ 2WB1A 2EV5A 5HS9A 2QCOA 4ZTJA 6PAXA 1GVJA 1M1EB 1QZYA 3J7YJ 1P7JA 3RKWA 5DM6F 2FU4A 2HPMA 3DLAA 5LD2C 3A01A 3FHNA 3IC7A 4RDUA 5E1WA 4BL0B 3WGIA 2MA3A 3Q0WA 1ODDA 3M8FA 3GEZA 4M3BA 1RESA 5K5RA 3IHUA 5JFRA 4Q48A 2GXGA 4P9FA 2E5ZA 2XPWA 2MABA 1MJAA 2A61A 3ZGKA 4ASNA 1D0YA 3M8EA 1D1BA 2F6CA 3U9GA 2W7NA 1CGPA 3CJQB 1PJRA 3SQNA 1MDMA 2DFEA 4MEYF 2FX0A 2RREA 3RSNA 4D0PA 3IKTA 1XMKA 2F48A 5D8LB 3K0LA 1HDPA 1S29A 4EJUA 3W6KB 4HNUA 1O3SA 4OOIA 4XNFA 1UHMA 2G0EA 2CG4A 2VOPA 3E97A 3FISA 2KP6A 3M07A 2HGCA 5GP9A 2BGCA 1R22A 3K2ZA 3DBHB 1YJ9I 1AKHB 2XF7A 1D1AA 3CCUI 1GDTA 1FMWA 5B1BH 5ICFA 3HOXJ 3PSIA 2E34A 4A3IJ 3PUFA 3VPRA 3HDDA 1WJCA 3QWLA 1R5GA 2P0WA 3SYTA 3LSPA 2CO5A 1JUMA 2X6WA 5J40A 5E3OA 1B9MA 3MAJA 4ZYEA 2CV1A 4IO9F 3LL7A 4ZC3A 3OOPA 3RTRA 2P8TA 2V9VA 5GPAA 4A3EJ 2Z3YA 1LJ9A 2O7OA 3I9V2 3B6CA 1LDJA 1T38A 1IJWC 1R58A 4B44A 5EGOB 1BN5A 3OSGA 2JWTA 4XRMA 1S72I 1EF4A 1W4MA 3LAJA 4A3MJ 3S2HJ 3GMEA 1TLHB 3KP7A 3HC7A 3WTTC 3DPTA 3I71A 2Q1ZB 2X1CA 4JX6A 2VBZA 2FBIA 4XLAA 1YG2A 1IN5A 1F1ZA 4M3FA 1B9NA 3ZR8X 2EV6A 2V9PA 2LY2A 2MSYA 3RQIA 1B1BA 2GM4A 1ZELA 2YSRA 1OQYA 2QVOA 5FROA 3PO3J 3K2AA 2WWYA 4KITB 4DZPA 2DJIA 2R7TA 4BE2A 2LK2A 1T6SA 2DA4A 1Z67A 5HLHA 2E7XA 2E19A 1HXDA 5K1YA 2XAJA 4PFOA 3CESA 1DDNA 1ZRDA 1JE8A 2UWMA 4I76A 3L9FA 1XG1A 5H6QA 1OCRH 4W97A 1RKTA 2AQFA 5A2QK 5IT3A 4LK0F 1UCRA 3V8KA 1QQIA 2AXTC 2LBFB 4C2TA 4C3IJ 4XLCA 2VXZA 3A0HC 3I59B 4KMFA 3JTGA 3CO6C 2L01A 1W0TA 4A69C 1R1TA 1XGMA 2GOXB 3P9KA 2YX4A 3FX3A 4LMYA 4LLLA 3M1EA 4UNOA 1LKXA 2HYFA 2CUZA 1QVUA 4ZH4F 4IHWA 3HZJA 4ITVA 3FM5A 2WA0A 5FFXA 3DTIA 1H88C 2HZDA 1Z3YA 1R49A 1E17A 3HHGA 3OR2C 1P4XA 1W5SA 3CMMA 3ERED 2O8KA 4IQ4A 3T1BA 4HOBA 4D7MA 3CP8A 3H1CA 3LFUA 3GUDA 3F8BA 3T8TA 4PJNA 1A6IA 4L9VA 5J8FA 4HQEA 3I64A 1K78A 2WB1N 2NNNA 3DBLB 4HF1A 3ZMUA 2IRFG 2PN6A 3BR1A 1BBYA 2O03A 2M8EA 4ESJA 4IEJA 2ZJ2A 2NXNB 2R7OA 2M7BA 1WH7A 3OS0A 1R1UA 2VJ5A 3U21A 5DV5A 4CZCA 3FMQA 4Y7NJ 5CVRA 3JRGA 5J1YA 2QWWA 2PJRB 1AHDP 3GBGA 3A2KA 2XIGA 1OCTC 2M87A 1PDNC 5BPIA 2NYXA 2TRTA 1BM9A 2RGVA 4BHBA 3QOEA 1VQ9I 3MZYA 3CCYA 4E7IA 2FF4A 3K70C 2F4IA 3ONQA 1TQIA 5LHGA 3ASOH 3JRFA 2ESHA 3BG5A 1B59A 2FJ1A 4Q5SF 1FP2A 3JAMZ 1S7OA 1DQUA 1JKOC 3BC8A 2A05A 1TBXA 2K9MA 4D1QA 3PIOF 2ZC2A 3F3XA 1P7IA 2G9WA 3I3LA 1QHGA 1Y0NA 1Y8RB 2XGCA 1YYVA 2KKOA 3GCMA 1X3ZB 1Y1VJ 4EM2A 1XD7A 2Q0OA 1T33A 1VQOI 2HU9A 2Z5UA 4BYYA 4F52A 1XSXA 3LSMA 3N4MA 1LB2A 3SZTA 2KQRA 3IL2A 1XGOA 3E5UA 4DBQA 5EZHA 5F0CA 3KZYA 2Z1DA 1Z77A 3LSTA 3OOUA 1CF7B 3Q0VA 1K4SA 3PO2J 1D0ZA 1MNEA 3QYFA 3L2CA 1ULYA 5DD8A 3WTUC 1B6AA 1TW3A 2X85A 1ZG1A 2VBWA 3G1MA 3GTJJ 5FGMA 2RC4A 4F91B 1PUFA 1I6HJ 1YW8A 1OCZH 2M8GX 2XF6A 3RKXA 1ACIA 5ICCA 1A04A 2GA2A 4I7HA 1JKQC 3W2WA 4KN4X 2ZB9A 3NARA 4Z6YA 5LRSA 4FX4A 3DXJF 1J5YA 3SEZA 4IHYA 3I5UA 2HVSA 4I6ZA 1YQAA 1SAXA 5J4VA 2DMNA 3D5SC 2E71A 2F5CA 1SD6A 1WJBA 1ZREA 2VKHA 4RS8A 4EM1A 4DYRA 4L0YB 2Q2EA 5KCMA 1YRNA 3D5LA 1QO0D 1SFOJ 4RA2A 3A0BC 3H5NA 2BOLA 3E5QA 2DPDA 4LJZF 4Q47A 5FKKA 3FXMA 1GUUA 4A0XA 2HQAA 1H89C 2OAZA 4HX8A 3ISPA 2EIMH 4CHUA 2IBDA 2ADUA 2K9NA 5DCMB 3I4NJ 2DODA 2J5PA 2Y2ZA 1R23A 1I6XA 3FM3A 4N4OB 1YJNI 3S93A 3WGGA 3DBRB 2CJJA 5DUIA 4HDVA 3R61A 5K5OA 2JVGA 1KYZA 3MKYB 1YW7A 1A6QA 4XICA 2VIXA 4RGSA 1MBEA 3K4KA 2ELHA 4DW6A 3ROUA 4IKFA 3DWLE 1R1VA 5FD5A 4G12A 1KZHA 1LPQA 2DBBA 3BDDA 4I0AA 4S0HB 1S3JA 2P5KA 1G3TA 2KRCA 2M7AA 1ITYA 4H4KC 5FKOA 4KT6A 2Z9OA 2R7UA 4A3FJ 3IH3A 3DKWA 4KFCA 3K1PA 4O3MA 2M5WA 4A6DA 3GFIA 1R5HA 5M5YJ 5FRMA 3K70D 2LNBA 2A68F 1W36C 1GT0C 3ZN1A 1F4KA 1HA8A 4A0YA 2STWA 3OS2A 2Y0MA 2YPRA 3HHHA 2FOWA 2EZLA 1EH6A 4EEFG 4YIFA 3F23A 4FTHA 2EFOA 3WTZA 2H1KA 1X4OA 4RM3A 1IG7A 3T5XA 3ZMSA 3GTOJ 1UJ8A 1HKSA 3DCFA 3CC4I 3G73A 4ABZA 4FE7A 3QQAA 1XSDA 4AUXA 2QA4I 2OZUA 3TO6A 2Z2SB 3GZNB 1HDDC 1EJ9A 2RQQA 4EVIA 1QNTA 3GFJA 2VQHA 3KP2A 1VNDA 2ZXWH 3FK7A 3OMYA 4GGGA 4IOAF 1MMSA 3EDPA 2WV1A 3S3MA 2IP2A 2LY9A 2CS3A 3MFKA 1O57A 4MFDA 4HSTA 3OYHA 5B5EC 2O61A 2HR3A 3LOCA 4EQQA 2WV0A 4HRIA 5LGTA 1CQTA 4QIWN 1YIJI 3HRMA 5A2QZ 1N25A 4C9YA 3R6SA 1FSHA 2AXLA 1PYVA 2VKVA 5DTDA 4BBSJ 2YS9A 3R0JA 2DLLA 3J81K 2WADA 3D0SA 2CV0A 4F55A 1TT0A 3S17J 3L2VA 3HPHA 2AHQA 2EINH 4DJAA 3RJPA 1KYWA 2L9VA 2QQAA 2BZTA 3ASNH 1WSUA 4KN7X 4LFUA 2ME0A 4A6EA 1S7EA 2GZWA 3LSRA 2OQRA 3WTYC 5FLVA 3KZIC 3L2RA 3KP3A 4IF4A 1O7LA 1JI8A 2ZSIB 2C6YA 2P5LC 2Y0SN 2IXSA 3HGYA 5J47A 4IOCF 2CFOA 1QGPA 3F22A 1PP7U 2KIUA 3A03A 1H0MA 2LG4A 5E20A 1ZR4A 5F08A 4F7ZA 1VI0A 1WI9A 3OIOA 4E70A 3CD6I 2O0YA 2J5OA 1U78A 2XAGA 2JRTA 1Z7UA 1TQPA 3I58A 1AKHA 1XDUA 4U87A 5L3GA 2NAZA 4L9JA 5IOYA 1WFXA 2NS8A 2Y31A 4E7KA 3HGGA 5AONA 2Z33A 1Z9CA 2BHZA 3GTMJ 3VEPA 5FJ8J 3ZPLA 4CCLA 4EJOA 4KISA 2ECCA 2RN7A 1YTYA 2Q8KA 2HOAA 2DT5A 4BUPA 1WZ2A 1E0EA 1C0WA 1F9NA 4IPAA 1G8XA 4FHTA 5EGOA 1T39A 2IS2A 1YITI 2VJIA 2JT1A 2M0MA 3H0DA 3FBNB 1FTZA 2CYYA 2E5NA 3CUOA 2EFQA 4X6AJ 3CUQC 1JTXA 5HNHA 2B9SA 2P81A 2R5YB 2KISA 4ZYHA 1QRYA 2DYSH 3NWTA 3RI4A 3WE2A 3HOVJ 2FUG2 1FY7A 2MGQA 4E7LA 1S8NA 3FZVA 4WF2A 3UNGC 1FZPB 2CQNA 4IHVA 4ZDOA 2DJNA 1G3YA 4XQFA 1YS7A 2DA2A 2IA2A 2PI0A 3H5AA 4JX5A 1I50J 4XL9A 3BLYA 1ZH5A 2HDWA 3VODA 4AYBN 5F6FA 1XGNA 3K10A 3QOPA 3V7CA 1QZZA 3VOEA 4U0YA 1H9TA 3D1NI 2XASA 1HC8A 3KP4A 5DCFA 2QKLB 4UY8I 2LYCA 2UUZA 2A07F 1K83J 1I1GA 1X4PA 3H0GJ 3PUBA 5J8CA 4C2UA 1SMTA 4PSWA 2CUFA 1RIOH 4AC0A 1MGTA 2LOOA 3CCVI 1BR1A 3JW4A 2OBPA 1OLTA 2E7WA 1Z05A 2L2OA 3BWGA 3W6JB 1DP7P 3P5JA 4HEA2 4YFNF 4A3JJ 4DGWB 1OR7C 2KHMA 2H1LA 4XK4A 1WJEA 2ZFWA 3WTSC 2QLZA 4L5JA 2QQ8A 2PMZA 2LBFA 3RPUD 3E6BA 4HYEA 4QSHA 2KIQA 1DU0A 1Y1WJ 2BY1A 3DEEA 3H3UA 1MMNA 4LIUA 2ACJA 2EFNA 3FXOA 2D45A 1VQ8I 2EK5A 1P4WA 4XLHA 3IWFA 2BV6A 2X6OA 3GZ6A 4DYCA 3MD2A 1Q1VA 1X3WB 1XB4A 3U2RA 2XKOA 1D1CA 4HX7A 2HQ5A 2R3SA 4U88A 4BXFA 1LE8B 3TDZC 3JR9A 3HSEA 2H09A 1JKRC 2RNGA 2OU2A 3I54A 3V8JA 2HEOA 3K4BA 2E1OA 1BJZA 2HYGD 3S1NJ 1FT9A 3IV5A 3ZN0A 2FXAA 1MIJA 3DTKA 1DPRA 4G6DA 3G4SI 1NK3P 4NHJA 2ZMEB 2H94A 5EG0B 2LKXA 2KJCA 3KP5A 4DQ2A 2CGPA 2ZCWA 2VKDA 2CW7A 2R5ZB 2NOGA 4BDYA 5LFAA 5E3MA 3RDIA 1MBGA 5IT9K 4JOMA 2DA5A 3H9QA 1ZLJA 1IUYA 4MHGA 2P7CB 1POGA 1J75A 2DI3A 2COMA 1YW9A 2F5FA 3AG1H 4IJAA 1FTTA 1X1BA 1PVEA 2IEKA 3S1MJ 1BIBA 2CRGA 2LDUA 1SVOA 2IGOA 3N05A 1I39A 1IDZA 1B72B 2KMUA 3BG6A 3BR0A 2R7SA 2WAFA 2X6XA 2BHYA 1UFMA 2DOAA 1YE9A 2TCTA 1Z0XA 3KPHA 1IW7F 1ETYA 1SANA 4M74A 4UHTA 4EJTA 1IC8A 5E8GA 4HNVA 4FQGA 1J09A 4XMYA 1Y39A 4FE4A 1SFUA 1U5TB 4FX0A 1FOWA 2L54A 3C2BA 3LSGA 4KNYA 2HKXA 1S5LC 4BE0A 4HDUA 2VOOA 4BXXJ 2F5VA 1FMVA 5FLXK 2M0CA 1XCVA 2EZIA 5ICGA 5JHUA 1WCMJ 3SDBA 1SD4A 3G6EI 4AIJA 3TL4X 1B4AA 1VQ6I 4N9IA 3DF8A 3L00A 4RAZA 5HOOA 2VODA 3UKGA 4F93B 1FOXA 1O3QA 3H35A 3IKVA 1CF7A 1W7PD 2VQGA 1K6OA 4KICA 4NNJA 1VZ0A 2K85A 4ESBA 5K7ZA 4AIDA 3SZPA 4JYKA 5LEKA 3BY6A 4PJMA 1R5ID 3CCMI 3TDUC 1Z21A 4ETSA 2R7WA 2EV0A 3R0AA 3J81Z 1EH8A 3VFZA 1RR7A 5J1UA 2IVMA 2HZTA 2BY0A 3BROA 3FBIB 5HNFA 5FKNA 2GLOA 1P2FA 1U2WA 1V54H 3K7AJ 3FXUA 2NOJB 1A36A 3K1MA 4GYIA 4PGGA 4R1HA 1JJ6C 3AFHA 2VBYA 2VT2A 4B3XA 5GTHC 3K4CA 4OWRB 1UAAA 1ZARA 2XB0X 2GIVA 1LVKA 2V6EA 3GFLA 2D1VA 4MQVA 1MBJA 3FDYA 4V2GA 1I1SA 3HRTA 3QP6A 1OMIA 4L9NA 1U8RA 1K7AA 4RB2C 1OYWA 2L5QA 4M73A 3PL8A 2BY2A 3HG9A 4H0EA 5M3FJ 4YRVA 5ILVA 1HCRA 1T0FC 2K9QA 2K3PA 2VBXA 4BEHB 1LEAA 3CCQI 1NK2P 2A3SA 4XN3A 5DCMA 2VB6A 2B7EA 4ZYAA 2STTA 5M3MJ 2JJ7A 3CCEI 2CQQA 1X19A 2Z99A 2ISYA 5AIQA 4HZFA 2XAFA 4O5VA 3BTJA 2M4GA 4RGRA 2OV7A 2L4MA 3GLLA 4HQMA 3KFWX 5GPCA 2ELJA 4WCGA 3KLOA 2O8XA 4RGUA 4E7SA 3IAM2 1VQ5I 3FXJA 1X2MA 2PMZN 3SFIA 5F0FA 2CU7A 1EA3A 2G7UA 2LKSA 4PJLA 1RZ4A 1ETVA 1FIPA 2O3FA 2HQRA 4FCYA 1SFEA 4JK1X 3COAC 1IV8A 3WG9A 4YG2F 2ZFUA 5C4XJ 4K2EA 4MFEA 5H20A 4AWXB 1P92A 3OV8A 1DUXC 4CUGA 1F5TA 2UXNA 2CSOA 5IYBJ 4G7ZF 2EFWA 2HXIA 3K1NA 2LH9A 4LD5A 3TKYA 1IXRC 2I8DA 4PUSA 4UB6C 2JZYA 4D5FA 4IX7A 4QTRA 1SEUA 3ECHA 2W24A 3FWEA 4C2MJ 1HKTA 1LNWA 3GYHX 2LP0A 3LSKA 4AVZA 5BMZA 1QZEA 2XROA 2M34A 1SD5A 2YR2A 1R00A 4G94A 2CWEA 2X51A 5LLQA 2JSPA 3T8RA 3BP8A 1V5EA 1TP4A 2DAOA 3MCZA 3Q9SA 1VQ7I 3FHZA 2VQLA 4IHTA 4LB6B 1VQKI 1ZLKA 3HYIA 4Y15A 2NS0A 2GOMA 2RQPA 2IAIA 2LMDA 5HDGA 1WRJA 4BY7J 3DEUA 3S32A 3WGHA 2QZ8A 1VQ4I 1X1AA 4CYDA 3LAPA 1HBXG 2BEOA 2R93J 4A3GJ 3OYIA 4OMYA 1IN6A 3OYMA 4PJ0C 4ZYDA 1JT0A 3OIPA 2EA4A 3HUGB 2HVQA 4IRHA 4ENJA 3BG9A 4DNCA 2HI3A 3HKZA 3EUHA 1AU7A 4LG0B 1IUFA 2XC7A 3ZMTA 3ZP5A 4HAMA 2AS5F 2FBHA 3HSFA 4IHXA 4XLEA 3LA2A 3OSFA 4NB5A 5F27A 2DFHA 4BJTA 1BC8C 2VE8A 3FIWA 1S7AA 2YX7A 1FP1D 2XDVA 5F04A 2JA5J 1KU9A 4KT5C 3REOA 3O2PE 1H8AC 3QPLA 3C18A 4A3BJ 1WGXA 1QU3A 1KQ9A 1TWHJ 3GO5A 4A3KJ 2FQ4A 2HQNA 4CH7A 4M3DA 3EYIA 1D8JA 5TGTA 5JVGF 1QA6A 2XPUA 2W85A 4B09A 5KVRA 3E7LA 4KUMA 3QPHA 3FMRA 2KIFA 3I4PA 1N77A 2PBIA 2EA2A 2W4SA 3X2QH 3MZ8A 5KHDA 5F64A 4A0ZA 1G59A 2XGEA 1FYKA 1I5ZA 5IT9Z 4HG2A 3E6CC 1SD7A 2CUJA 2M3AA 4PJJA 4IXAA 2WAQA 3PQKA 1JHFA 3ZQQA 4ZYGA 2DW4A 4YIRX 4HNTA 3MKWB 5EF6A 2AQEA 4CO8A 4E7HA 4GCVA 3ABUA 3O6BB 4B3AA 4B43A 1SMYF 3OL3A 3ABKH 3U1KA 2XGXA 3K6GA 1JXSA 3MQ0A 4KA4A 4AVPA 1X1CA 3SFZA 5CKTA 2RV8A 3H9JA 1UHSA 2MLKA 3NEUA 1K79A 1ONVA 5LHIA 2WAEA 3BTIA 1I3AA 1XC5A 4UUTA 3IH2A 1RC9A 5E1XA 4KIBA 2K7LA 1J59A 4EGYA 4LLNA 2F4MB 3ZMZA 4ANJA 1MDMB 2PQ8A 3HB9A 2H8WA 2BXYA 1WWXA 1Z1DA 1MNMC 4E7JA 3NRVA 2MW8A 5FLXZ 1MBKA 2K86A 4U7BA 1MJ9A 2OZ6A 4A12A 2DFIA 4UB8C 2OCEA 1MNDA 2QF7A 4UUVA 2BYVE 2OQGA 3GVAA 3JCUC 2E2IJ 3M7GA 2CH0A 3FXLA 1LFUP 3OYAA 3NAUA 2NNYA 5BNGA 2M30A 3PFIA 2QBYB 1F43A 1GXQA 2P7VB 5L3BA 1K61A 1OPCA 3WTWC 1GV2A 4PSXA 1ZG5A 1TL8A 5LGUA 1RRJA 2LREA 1T8IA 2DA3A 4PCQA 2ZJRF 2ZNZA 4HW0A 5CPRB 5GAEJ 2IGNA 1GHCA 1HOMA 3CJTB 5GAHJ 1R9TJ 2QSGX 2CQ7A 4EGZA 3CC2I 3JRIA 3BZCA 1ZTRA 2HYJA 5CYVA 1VFCA 1ENHA 3EPZA 3B6AA 1X58A 2K4JA 3TO7A 1JUSA 2KLOA 5EDNA 3ULQB 1ZG3A 4L5IA 4XN0A 1R71A 1BJAA 1MMGA 2V1XA 2KRFA 3FXKA 2K40A 4BHCA 5TISC 3V42A 2QENA 4HSRA 2CUEA 2DTRA 3A02A 2L7KA 1LE8A 5FD6A 4RMNA 1FNNA 4N0BA 1W5TA 1UHWA 2ZKZA 1D3YA 1YLFA 2BXZA 3IH4A 4XR6A 2OA4A 1ETKA 2JPBA 3PNYA 3QU3A 4Y3OA 5B3SH 2QUFA 4IZZA 3DEWA 2ZMEA 4M9XA 5EG0A 3OY9A 2ZO4A 4LG3A 4V2FA 2R5ZA 1OYIA 1UZCA 3FF5A 3J7AO 1RNLA 3BZ6A 4UVBA 1YIOA 2R7VA 2ZJPF 1WKMA 2HOEA 5CVUA 3HOSA 3RZOJ 4G7OF 2LRDA 2K02A 3E3VA 2NVTJ 4X0GA 2EJRA 5ED4A 1RR8C 4YFKF 3JSPA 4XRSA 3KETA 3MZHA 2A6HF 1ZQ3P 2HS5A 1TWAJ 1OCCH 3WTVC 2VT3A 2EIKH 5IY5H 1B72A 2A6EF 3G2BA 3K4LA 5JVTA 3H36A 2LF7A 4GXOA 4MO7A 3LSHA 3KEOA 1FBQA 2LSOA 1YJWI 4HF0A 3E6MA 3GZ5A 3SDGA 4D7NA 4BBRJ 2XRNA 4GRIA 1IO2A 4GO1A 2MD5A 5IP7J 4XLNF 1U5TA 5CLSA 1BOAA 4QPOA 2V26A 3V7RA 1NG6A 5D6EA 1KGSA 3P7NA 2JRMA 3GTKJ 2VE9A 4CCOA 4CYCB 3CF5F 3H9GA 3GTQJ 2IT0A 4BHPA 4I01A 3WODF 3ZQCA 4WXCA 4WK8F 3KX2A 3LSJA 4R8HA 3QU6A 4XLPF 2LD5A 3S15J 2KDOA 4M71A 2DO7A 4UUSB 5GAGJ 2R7ZJ 1KQ8A 3JRCA 2DT6A 1XMXA 2VI6A 4I2OA 4P96A 1QHHD 3E5XA 4S05A 4ENKA 5J6XA 3BQZA 4LIVA 2X0LA 3CJNA 1B8IB 1G4DA 1XTAA 2V4JC 3DFGA 5LGNA 3WE3A 5FRNA 2COBA 1G3SA 1YOVB 4LB5A 2M9HA 3TEDA 3JRAA 1JJ8C 1FSEA 2EZHA 3G71I 2DFFA 1KU2A 2LKPA 3S16J 4RGXA 1U0JA 3DTEA 4L0ZB 4YFXF 4A5MA 1I3QJ 3CDIA 1DGRM 2KDZA 2LC2A 2UZKA 3Q5FA 4ZDLA 2IA1A 3CF2A 5TRDA 1BI2A 2IA0A 2X1DA 1TW2A 2Y75A 1R6RA 3CMEI 2QM3A 4MGRA 4AM3A 3IAS2 3P9CA 1PP8F 3HOTA 1VF9A 2ZNYA 3DKYA 2AO9A 2VPLA 2PEXA 2Z16A 2VL8A 2EH3A 3RKYA 1J7KA 2L7MP 2VUMJ 2K4BA 2L9SA 1A5JA 1Y0UA 4M6VA 4BY1J 3W2AA 3WU0A 3F9KA 4J19A 3OYKA 4E7ZA 1FX7A 1LQ1A 3C1DA 2VXDA 3GW2A 4B47A 3FMSA 3U1DA 1Y8QB 2ZXJA 5JHFA 2RKHA 2ECBA 1YHQI 1WVRA 1FLIA 4I09A 2GIZA 3WG7H 4GYGA 5DM7F 2D1HA 5CJ9A 4B48A 4BEHA 4C3HJ 3HOWJ 3BG7A 3S3NA 3OS1A 2DTZA 4CGZA 3HJEA 3R60A 3F8CA 4BQQA 1X2NA 1J2XA 1NHAA 2RNJA 3L09A 1IF1A 2E1CA 3GTLJ 5LHHA 3MMYB 3M8JA 3V7SA 3W6VA 3BZKA 1DGWY 5CVJA 3PIPF 5HS7A 1ETQA 1BW6A 2DXIA 4IRIA 2EBIA 4LK1F 4BS9A 2W57A 5DUKA 3BG3A 4XOPA 1ZYRF 2K27A 1UMQA 2CW0F 5IYDJ 2BE5F 2I10A 1MSEC 4P1WA 5JR3A 1YS6A 3TOBA 1EKEA 5BQTA 2PFBA 3QPSA 1P4AA 4DOZA 3T0YA 1R7JA 4ZDPA 3VWBA 2VC0A 3JSOA 4WX9A 4WXDA 2FQ3A 2FRHA 5D4SA 4EMSA 1VQNI 3QODA 4XM3A 1U6GA 2R0QC 1WQ2A 4I0BA 5L3DA 2MH2A 4OINF 1O3RA 3ZMVA 4PDKA 2V1UA 1LDDA 2KT0A 4L18B 3I59A 1RUNA 5BPDA 1XGSA 4QLCU 5ILUA 4FETA 2E60A 3K9TA 3WHBA 2NVXJ 5L3EA 2DDAA 1ZK8A 4HV5A 4UVAA 3TP0A 1U9NA 3ABLH 3VB2A 3LMMA 1YRNB 2ISZA 2DN0A 3L7WA 4XKVA 1UELB 1T56A 1RI7A 4RBOA 1JGSA 3DU5A 3W2VA 2JPCA 1V4RA 5HVQC 4I98B 2ZXIA 1ZRCA 1U3EM 2YUSA 2GWRA 3CCRI 2MD0A 3ABTA 3OR1C 1O3TA 1TNTA 2GAUA 2XGDA 3OYLA 4A93J 4XIDA 1FBSA 5EEHA 3K69A 4NQWB 3KIOA 4QWQA 1OISA 4CA0A 3HPGA 4HBLA 2XPVA 3HUGA 3HRSA 2DDBA 4F3QA 2M45A 2L9RA 4RAGA 2V1DA 2DYRH 3BJOA 3EUAA 3CUQB 4CCNA 4MTDA 4LG0A 1E3OC 4XKCA 4BH9A 4BU2A 1IRZA 3HTUA 2HFHA 3K4NA 2E2JJ 1NTCA 2ZSHB 3ZQLA 1TZLA 3CP2A 3DV8A 4ON0A 1QPIA 1FPQA 1F36A 1BI3A 2JUCA 1OKRA 2YU3A 3BR3A 4XKBA 2KZGA 5EZGA 2DCEA 5TJJA 3TMOA 4A3DJ 3SZGA 1QPMA 4KYWA 4A3LJ 5LEJA 2PJRA 4U0WA 1BOBA 2K5CA 4EV0A 2B63J 3ZQGA 4X1EA 3AG2H 1HSJA 3CMAI 4YEJA 5L3CA 1XX5A 2ESNA 4B4CA 1QVTA 2HVRA 3J80K 4J00A 2Y9YA 4UV8A 1V55H 5D4RA 1Y56A 4P5OA 3RQ4A 4B8XA 3RYPA 4ENMA 1D8KA 1W7PB 3A4CA 2R7DA 3CO7C 3R4KA 4DIQA 3KCCA 4IVNA 2ICWG 1KU3A 2OD5A 1SFXA 1MH3A 1ON1A 3GTPJ 1N75A 1TWFJ 5CQGA 1X1PA 4DBRA 1BL0A 3J7ZI 1Z91A 1ZR2A 3HOYJ 3OYNA 3GLXA 5DYMA 1ON2A 3QYEA 4RM2A 5LRRA 4FASD 2DPUA 3BCAA 2PLYA 3L2QA 3AG3H 1ETOA 2RVCA 2XRLA 4BJ5C 3TO9A 1DP3A 2LY1A 2EZKA 1MH4A 3PNTA 4XRFA 4CSWA 2GXAA 3B02A 5ICEA 4KDPA 4M9SA 4A2UA 3GWZA 4DZJA 4Z2YA 3M9AA 4FISA 1HW2A 1DU6A 4CXFA 1ORKA 1S6LA 4M6YA 1Z6TA 5C44J 2FE3A 2IS1A 1JT6A 1V3FA 3KYDB 4O6JA 2UV1A 2UXXA 3AL0C 2IW5A 1YO5C 3VSKA 4W1UA 3SXYA 4C30A 5M5XJ 2VQCA 4UVCA 2ME6A 3I4MJ 1E3HA 4BKXA 3CLQA 2HDDA 2LF8A 4NC7A 4G8XA 2MH9A 5ILSA 5HDKA 3IUOA 4BE1A 4RAFA 2V6CA 4I99C 4ZTFA 1Z7LA 3CTAA 1UG0A 1XN7A 2R92J 2PMUA 3H3ZA 3VYRB 5E17F 4AD9A 2QBYA 3LA7A 4RB1A 3EYYA 4XRSG 4I02A 2DK8A 5J1RA 3S14J 4D9JA 2HXOA 3EUKL 5HDNA 2IS4A 4M3GA 2H6CA 4JBAA 4IL6C 4YIIA 1ZGWA 1GXPA 2KFDA 3PJRA 1X3UA 3EQLF 1MBFA 2OPTA 2X6YA 3DKXA 3OWTA 2V1NA 3GFMA 3OIQA 1IRGA 5D5XB 3BR5A 3MKLA 4HX4A 1IN8A 5FO5A 1IXCA 5HLGA 1IAWA 4Y17A 1AWCA 1GV5A 1ZGJA 2DMUA 2X4HA 3LQRA 4Y33A 1HF0A 2OTJI 5J4YA 1TT5B 3WHCA 3DP7A 4ZZLA 2QKMB 4ZJZA 3S2WA 1BR2A 2DA1A 2EB7A 5GTIC 4LOCA 2VASA 2EILH 3B73A 1G6NA 1HKQA 1I27A 2K9SA 2L7ZA 2M1BA 2FMLA 3OYBA 1Y6IA 2A5YB 2X1EA 4AU7A 2FBKA 2A6TA 3P9IA 2ELKA 2BVMA 1V5FA 5DS9A 2L0KA 3LQQA 5JI6A 3ABMH 4M3EA 3F8FA 1ETWA 4G6QA 3S8PA 2VLAA 5EJCA 4JP0A 3V4GA 2L4AA 2FNPA 3PNVA 2MC3A 1BW5A 3J7AY 4BQOA 4Y13A 2K9LA 2FA5A 3ML6A 4XORA 3HOUJ 1FYLA 1WJFA 2JTVA 2JN6A 4F92B 2DA6A 1TTYA 5AIPA 3I56I 2EPFA 2OUMA 3H92A 4GFBA 5L3FA 3AL0B 3NQOA 4HLYA 2JUGA 2BW3B 3JRBA 2XSJC 1YI2I 1PUEE 5KNLA 2PJPA 2P6TA 2JQ7A 1U8BA 3A1YA 2F5DA 4ZZDA 1FC3A 2MFZA 2XVCA 3MVPA 1BC7C 2MC4A 5LBQA 1Z6RA 2W84A 2F4OB 3CQZJ 1WJ5A 1Q1HA 2HPIA 3IP4B 1KQ0A 5HS8A 3WU2C 4CICA 2DQLA 4OU0A 3SHFA 1G3WA 2F2EA 4U0VA 1OFCX 4MIMA 4RLFA 3C2GA 5F1JA 3E6DA 3W3CA 1T08B 2JA2A 1IN4A 4PGHA 2R7XA 2PG4A 4CYCA 2RDPA 1R4MB 3F0CA 3KZZA 2JMWA 4LITA 3MEXA 4CCKA 3Q0UA 4PFPA 2XAUA 2WBMA 5IP6A 1FJLA 3S2DJ 4E6KG 5HODA 2NVYJ 4A3CJ 3ZQIA 4P9UA 1G2HA 3QRFF 2XF5A 2CQKA 4UUSA 1VQMI 4OAZA 4BACA 2WC2A 4RB0A 3CCJI 1ZGAA 5IYCJ 3WTXC 1B8IA 3AAFA 3H5RA 2W1OA 4OIPF 2L9NA 3Q9VA 4XONA 2NVUB 4GDFA 3M3YJ 1LDKB 4ESFA 3MWMA 5IPAA 3BCBA 1ETXA 2FMYA 2VJJA 3F72A 2QSHX 3ZQ7A 2ZJQF 5E79C 1ZRFA 2QYOA 3IRQA 2LTPA 4R79A 2E35A 2V79A 5D5UB 3GX4X 2HOSA 2CQXA 3DPLC 2D5VA 2HTSA 2OJED 5ERIA 2M4KA 3ZQHA 3F6VA 3HIFA 3PFYA 1WH5A 3A01B 4G6TB 4IRGA 1SC7A 3CCLI 2B0LA 1EH7A 1ZN2A 1REPC 3I0TA 3I53A 1XMAA 3DLLF 2IS6A 3J80Z 3C3WA 5JLWA 1MSFC 2Y0SA 3BR6A 4AIKA 3QPTA 2KJBA 2P4WA 3TQNA 3GF2A 2R5YA 2O9LA 3RPQA 5KK1A 1X1DA 3CJRB 5E18F 3F6OA 1XS9A 3FKIJ 4XSXF 1T2KA 2PX9A 2JSCA 3V8LA 1T95A 1ZHFA 1IV6A 3RPUA 3OYEA 1A35A 1AA7A 4MEXF 4KMUX 5GADJ 2WTEA 3TGNA 1JHHA 3O8GA 4B1RA 2DT7B 3KYLA 1IXSB 2EQRA 3RCOA 3ZRGA 3HL2A 4EJVA 2M2EA 1RKWA 4S04A 3CCSI 1T98A 2DU9A 4EJWA 1YFHA 3HXLA 4NBQA 1K4TA 3IRRA 2DMPA 4N9HA 2L7FP 1FYMA 1U9OA 4BJ6C 1IN7A 3O8HA 2ETHA 3OYFA 3FK6A 1J9IA 3E1SA 4IHSA 1S9HA 2VC1A 4XBFA 3G1OA 4RB3C 1USTA 5CQEA 5E3LA 5IOZA 4CCJA 3K4MA 1MW7A 2CFXA 2O5RA 3KE2A 1NG7A 1ERDA 4OIOF 2IPQX 4HV6A 1SFKA 5FLMJ 5DEQA 4AYBA 1WHUA 3EUHC 2HOTA 1MBHA 2L02A 2WY8Q 1P9QC 2KIMA 1HSTA 5K7HA 1TWGJ 3CLOA 5KAIC 2DK5A 3D5RC 2H27A 4NDLA 2XUBA 3MKZA 3AG4H 4NQWA 3KP6A 5B66C 2Y69H 3BPXA 2VKEA 2JVHA 5C3EJ 3O3KA 1BI1A 1FOYA 1YX3A 2V9KA 3HEFA 2XAHA 1WJAA 3ECOA 1TNSA 3QYBA 3HRUA 3CUQA 1RPWA 2DQRA 3ZQFA 3DPUA 2IGKA 2MLGA 3CMYA 2ZBKA 1JGGA 1VQLI 1E2XA 3HM5A 1SVLA 2JA6J 1D5VA 5K7FA 2OC6A 5H6RA 5E3NA 1R4NB 2KZVA 3BPVA 4JQFA 2DMTA 1DPUA 3WU1B 2A5WA 4P55A 4CCMA 1BIAA 4CZZA 3HKZN 1A31A 2V7FA 2D2WA 2Y30A 5D8KB 5HLTA 3ZCOA 3L1PA 2NS7A 2N8GA 2QQ9A 1K6YA 1STZA 2LLKA 4G9YA 4JX4A 4M72A 1FBUA 1GLNA 2IGMA 5B1AH 4II2A 1TWCJ 2X9DA 5E1ZB 2O6GE 2PMHA 5F1RA 3NWSA 3TW7A 3K4JA 4XLFA 5CVVA 3TOAA 1FOKA 3L2UA 4L9TA 4MTEA
chains in the Genus database with same CATH topology
3LMMA 4XKVA 1UELB 1YX5A 1DQUA 2L5QA 3DU5A 3W2VA 3BC8A 4PK4A 3PL8A 3HG9A 2K9MA 5HVQC 4D1QA 2ZXIA 4YRVA 2BVLA 1T0FC 2K3PA 3S3OA 4BEHB 3I3LA 2MD0A 3OR1C 4OAYA 1QHGA 4XN3A 3OYLA 2VB6A 4ZYAA 4NQWB 4II3A 2E1MC 1X19A 2HU9A 4CA0A 3HPGA 4F52A 3CZ6A 3LSMA 2M4GA 3KEYA 2OV7A 4F3QA 2KQRA 4HPQA 1LFPA 2ELJA 3EUAA 4DBQA 4CCNA 3OL4A 4XKCA 1WJDA 4BU2A 4E7SA 2CV2A 2ZXHA 3AKZA 2Z1DA 3IAM2 3OOUA 3OYDA 3K4NA 3PSFA 2ZSHB 1EA3A 1TZLA 1D0ZA 3CP2A 1MNEA 4PJLA 3QYFA 4NUBA 2ZFUA 2X85A 4XKBA 4J01A 2DCEA 3TMOA 3SZGA 4CUGA 4F91B 1V5GA 2PJRA 2XF6A 1BOBA 3FKJA 2K5CA 2LH9A 2I8DA 4PUSA 3W2WA 4IX7A 3SEZA 4YEJA 2CMPA 2HVSA 2HVRA 4J00A 4EATA 3DQVC 3LSKA 4AVZA 3D5SC 3VYSB 4BQNA 3C2HA 3L2WA 1WJBA 1Y56A 2VKHA 2X51A 4P5OA 2W00A 2JSPA 3RQ4A 3A4CA 1V5EA 5KCMA 3D5LA 4DIQA 3H5NA 2BOLA 2VQLA 2GOMA 2KPMA 3LSIA 2HQAA 4QPQA 1N75A 2KRHA 5CQGA 3S32A 1N78A 4DBRA 3E0JB 1X1AA 3OYNA 3OYIA 2CW8A 3QYEA 3OYMA 4N4OB 4RM2A 3S93A 4FASD 3OIPA 3BCAA 2HVQA 3HUGB 1KONA 3L2QA 2JVGA 4Y4RA 3MKYB 4BJ5C 4E4HA 1DP3A 3HKZA 2LY1A 3SEQA 4CSWA 3PNTA 4N4NB 2VIXA 2XC7A 3K4KA 4XLEA 4IKFA 3DWLE 1MMDA 2R7QA 4BJTA 1W36D 2VJ4A 3TBIA 1Z3XA 2IS1A 2XDVA 2E1MB 2HNHA 2KRCA 2M7AA 2UV1A 4H4KC 4KT6A 3AL0C 2R7UA 4BDZA 1QU3A 3VSKA 5FRMA 3K70D 4C30A 2VQCA 1W36C 1HA8A 4CH7A 3OS2A 4RLQA 5TGTA 4XOTA 1D0XA 4NC7A 3OYJA 4BE1A 3IUOA 4ZTFA 1Z7LA 3VDXA 1X4OA 1UG0A 4RM3A 1N77A 2R7RA 2W4SA 2W82A 3VYRB 2Q2EB 5KHDA 2BW3A 1G59A 4BGDA 2Z2SB 4HG2A 1IRXA 2CUJA 2RQQA 2M3AA 4D9JA 2VQHA 4PJJA 3EUKL 2WAQA 3OMYA 3ZQQA 2IS4A 3VSLA 4HNTA 3PJRA 3S3MA 3MKWB 2X6YA 3DKXA 2AQEA 2CS3A 4IQJA 3OWTA 4E7HA 3OYHA 4HSTA 2V1NA 3OIQA 4HRIA 4B43A 3ZXSA 3OL3A 3K6GA 4Y33A 3VYTB 3UR3C 4C9YA 1X1CA 4MLOA 5CKTA 2QKMB 1PYVA 4ZJZA 3H9JA 1BR2A 4KJZA 2VASA 1MMAA 2R4GA 2WAEA 2WADA 2CV0A 4F55A 1TT0A 3L2VA 3HPHA 4DJAA 3OYBA 3OYGA 1Y6IA 2X1EA 4AU7A 2A6TA 3VYUB 4ANJA 2BVMA 1V5FA 2KL4A 3DU6A 3L2RA 3S8PA 2VLAA 4E7JA 1JI8A 2ZSIB 3PNVA 3M1CA 2IXSA 4U7BA 3J7AY 2CFOA 4BQOA 2K9LA 4XORA 1MNDA 1WJFA 2LG4A 4F92B 2MYSA 2CH0A 2OUMA 1SAUA 3OYAA 3AL0B 3OYCA 2JUGA 2BW3B 2XSJC 4NC8A 4XKWA 4PSXA 4U87A 4YELA 5KNLA 1WFXA 2WY7Q 2LREA 4E7KA 1BR4A 3A1YA 2WB1A 5CPRB 4ZTJA 2MFZA 2IGNA 2MC4A 4CCLA 4KISA 2HPMA 3DLAA 1WJ5A 5LD2C 2HPIA 3FHNA 4BUPA 3IP4B 1E0EA 4BL0B 3ONQA 1G8XA 3EPZA 2IS2A 2KLOA 2VJIA 2M0MA 3H0DA 3FBNB 4XN0A 1MMGA 2E5NA 4RLFA 3V42A 4HSRA 3C2GA 2E5ZA 5HNHA 3W3CA 2MABA 2JA2A 3NWTA 3ZGKA 2L7KA 2FUG2 1D0YA 2R7XA 1D1BA 2F6CA 4RMNA 2W7NA 4E7LA 3UNGC 4ZDOA 3CJQB 1PJRA 4XR6A 4LITA 4CCKA 4XQFA 4PFPA 3PNYA 2XAUA 3H5AA 2WBMA 4Y3OA 4XL9A 4IZZA 2RREA 3BLYA 4E6KG 2HDWA 3RSNA 3OY9A 3K10A 4LG3A 2XF5A 4OAZA 4BACA 2QKLB 2LYCA 2UUZA 4HNUA 4XNFA 1X4PA 3PUBA 4C2UA 4PSWA 2R7VA 3H5RA 3HOSA 2W1OA 2KP6A 2LOOA 2LRDA 1BR1A 1OLTA 2L9NA 4XONA 1LDKB 4X0GA 2XF7A 1D1AA 2L2OA 3BCBA 2VJJA 1FMWA 4HEA2 3PSIA 4DGWB 1OR7C 2KHMA 1WJCA 1WJEA 4R79A 2P0WA 3SYTA 2X6WA 3DPLC 2CV1A 3LL7A 2PMZA 2LBFA 4ZC3A 3RPUD 3RTRA 2M4KA 3G2BA 3K4LA 3DEEA 1MMNA 4LIUA 3LSHA 3PFYA 3I9V2 4G6TB 4B44A 4GRIA 4XLHA 2IS6A 3MD2A 4QPOA 2Y0SA 2V26A 3HC7A 3DPTA 1NG6A 2Q1ZB 2X1CA 1D1CA 4BXFA 4XLAA 1X1DA 3CJRB 4CCOA 3H9GA 2RNGA 3K4BA 3ZR8X 2LY2A 3KX2A 3DTKA 1T95A 1ZELA 2KDOA 3OYEA 1AA7A 5FROA 2VKDA 2CW7A 4KITB 2DJIA 4BDYA 2DT6A 5LFAA 2R7TA 4BE2A 1QHHD 4LIVA 2DT7B 4JOMA 3KYLA 3RCOA 2V4JC 3ZRGA 3HL2A 5FRNA 3H9QA 4PFOA 3HXLA 3CESA 2UWMA 1U0JA 3DTEA 1X1BA 1DGRM 2LC2A 4BJ6C 4ZDLA 3OYFA 3CF2A 2AQFA 2IGOA 2X1DA 3N05A 3E1SA 1R6RA 1S9HA 2KMUA 3BG6A 3IAS2 2LBFB 3HOTA 4C2TA 4XLCA 2VXZA 2WAFA 3DKYA 2R7SA 2VPLA 2X6XA 2Z16A 2VL8A 2DOAA 1YE9A 5CQEA 2L9SA 4CCJA 2GOXB 1MW7A 3K4MA 2O5RA 3W2AA 3F9KA 1J09A 1NG7A 4XMYA 4E7ZA 3OYKA 1ERDA 1SFKA 1LKXA 2VXDA 4B47A 2CUZA 4AYBA 3EUHC 5JHFA 3LSGA 2WY8Q 4BE0A 4ITVA 1P9QC 2WA0A 2F5VA 3DTIA 1FMVA 2HZDA 1Z3YA 4B48A 4BEHA 3D5RC 3OR2C 3BG7A 3S3NA 3SDBA 3CMMA 3OS1A 3MKZA 4IQ4A 3TL4X 2JVHA 2V9KA 1YX3A 4BQQA 3CP8A 3LFUA 5HOOA 1WJAA 3QYBA 4PJNA 3MMYB 3M8JA 4F93B 1DGWY 3H35A 2VQGA 3DPUA 4NNJA 1VZ0A 2IGKA 2DXIA 4BS9A 4XOPA 2R7OA 2M7BA 3OS0A 2VJ5A 4PJMA 2OC6A 3U21A 1Z21A 2KZVA 2R7WA 4JQFA 4CZCA 4P1WA 2A5WA 4CCMA 2PJRB 4DOZA 2V7FA 3FBIB 3VWBA 4ZDPA 5HNFA 3GBGA 5HLTA 3ZCOA 2NOJB 3A2KA 1K6YA 3QODA 4XM3A 1GLNA 2IGMA 3AFHA 4II2A 4B3XA 3K4CA 4OWRB 3QOEA 1UAAA 3NWSA 1LVKA 4E7IA 2V6EA 3K4JA 4XLFA 4FETA 2E60A 3K70C 3L2UA 3FDYA 2F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEY A;  3K10 A; 
#chains in the Genus database with same CATH topology
 1W7P A;  4L5E A;  2GQQ A;  2XSD C;  1OR7 A;  1YX5 A;  2JK3 A;  2H8R A;  1KA8 A;  4PK4 A;  3BTC A;  2OF7 A;  1HQC A;  2BVL A;  1OJL A;  5H2F C;  3S3O A;  2P6S A;  3QP5 A;  1UG2 A;  2QGU A;  3FXQ A;  4HA8 A;  4PZJ A;  4OAY A;  2YU9 J;  1XSV A;  2ID6 A;  3PQJ A;  4UV9 A;  4II3 A;  2W25 A;  9ANT A;  2E1M C;  2XHK A;  5KAF C;  3HSR A;  1XCB A;  1BI0 A;  3KYC B;  2LVS A;  3ESW B;  3CZ6 A;  1L0O C;  3KEY A;  4NC6 A;  2JA7 J;  3RKQ A;  4HPQ A;  1LFP A;  1K78 B;  2WAQ N;  1W5C C;  3N97 A;  3C7J A;  3OL4 A;  1WJD A;  2G7H A;  4G7H F;  2CV2 A;  2ZXH A;  3AKZ A;  3HTS B;  3LNQ A;  2HDC A;  3S1Q J;  3OYD A;  3PSF A;  1LUJ B;  3RZD J;  4HLX A;  1D5Y A;  2E1N A;  4M9Z A;  5DD4 A;  5BS6 A;  1AOY A;  2A69 F;  1IRF A;  2Y9Z A;  2VON A;  3RYR A;  4NUB A;  4MQ9 F;  2I5U A;  2LFB A;  3BOQ A;  4M6X A;  2HTJ A;  2TDX A;  2GBY A;  4J01 A;  1O4X A;  2XAQ A;  1MD0 A;  1V5G A;  1LVA A;  3FKJ A;  2H6B A;  5FKM A;  5D5W B;  1P6R A;  3F8N A;  3GTG J;  3Q3S A;  3RIR A;  5D5V B;  4Y52 J;  2F5E A;  3M4O J;  3IWZ A;  2CMP A;  4EAT A;  3DQV C;  3F21 A;  3VYS B;  1R36 A;  4BQN A;  3C2H A;  3L2W A;  3LA3 A;  4ENN A;  2W00 A;  3JRE A;  3F8M A;  4BAY A;  2E36 A;  3LSI A;  2KPM A;  1XPX A;  4QPQ A;  2KRH A;  3TW6 A;  1FEX A;  3JRD A;  1N78 A;  2FNA A;  1JTY A;  2EFP A;  3E0J B;  4RAY A;  2DMQ A;  3CC7 I;  3MN2 A;  4MNU A;  1IGN A;  2JA8 J;  2CW8 A;  4FT8 A;  2ID3 A;  3G3Z A;  1SVM A;  1VQP I;  3SJM A;  3CDL A;  1KON A;  1OCP A;  2OCC H;  1FWZ A;  2VN2 A;  5JLX A;  2FEZ A;  3PM1 A;  4Y4R A;  1IZ1 A;  5FFZ A;  4E4H A;  4LLG F;  3SEQ A;  2ZME C;  1W1W E;  2FOK A;  4N4N B;  4OIQ F;  2L3D A;  1MMD A;  2HWV A;  2R7Q A;  2NVQ J;  1W36 D;  2FSW A;  1MZB A;  2VJ4 A;  1Z3X A;  2MBF A;  3TBI A;  5DDG A;  4WWC A;  2E1M B;  2HNH A;  1MJB A;  2E2H J;  3BQY A;  3JTH A;  3BJA A;  4C3J J;  3GXO A;  1LEB A;  4UXN A;  4BDZ A;  1ZAO A;  1PUF B;  4V19 K;  1W0U A;  1LFB A;  3QAH A;  1HLV A;  3H3V K;  2BY3 A;  3G1L A;  5IP9 J;  5FKL A;  4RLQ A;  4XOT A;  1TC3 C;  1D0X A;  3BR2 A;  4LGW A;  2K3F A;  3OYJ A;  2Y48 A;  1VTN C;  2DOF A;  1JKP C;  3VDX A;  1XDS A;  2R7F A;  1O7F A;  1TQM A;  4A5N A;  3ELK A;  2R7R A;  1RET A;  2W82 A;  2GXB A;  4EM0 B;  2EWN A;  2Q2E B;  4OMZ A;  2BW3 A;  5EEG A;  5CVI A;  4XSZ F;  4Q4Z F;  4BGD A;  1USS A;  1IRX A;  2DOE A;  3KLN A;  1U5T C;  2XB5 A;  4TV7 A;  3ERM A;  1J0R A;  3VSL A;  3CDH A;  5FB2 A;  3JRH A;  1QBJ A;  4IQJ A;  1HW1 A;  1OYY A;  5EYR A;  5J3L A;  5M5W J;  5BOX A;  3BT9 A;  4BXU A;  3BJ6 A;  5K5Q A;  3ZXS A;  3ZOB A;  3BTL A;  3I55 I;  3VYT B;  3UR3 C;  5HLI A;  3HOZ J;  1UB9 A;  4BNC A;  4MLO A;  2GA1 A;  1JUP A;  1FIA A;  4DYQ A;  1E3P A;  2MG4 A;  1T0F A;  3KEQ A;  1MMA A;  2R4G A;  3LFK A;  4KJZ A;  2IJL A;  2DA7 A;  5D6F A;  2QEX I;  1BA5 A;  2FD5 A;  3LWF A;  2EIJ H;  2VPR A;  5F0H A;  1L3L A;  2X48 A;  3FXR A;  4D5C A;  3OYG A;  2RAE A;  1NH3 A;  1IDY A;  3VYU B;  4BQA A;  1RUO A;  4OIR F;  1WPK A;  3EET A;  4WXH A;  2KL4 A;  4CDG A;  3DU6 A;  2BBY A;  4U7D A;  4AIH A;  2LR8 A;  3M1C A;  2QQB A;  1EV7 A;  1APL C;  2XKP A;  1KU7 A;  1MKM A;  2XV4 S;  2HKO A;  2W48 A;  3TP3 A;  3JAM K;  2OTL I;  1H9G A;  2MYS A;  1ZKG A;  4KIF A;  3ZMD A;  1OCO H;  1WI3 A;  1SAU A;  2NRA C;  3OYC A;  2P5V A;  2QSF X;  5EEA A;  1HW5 A;  4HF2 A;  4NC8 A;  4XKW A;  3HBL A;  4YEL A;  4KIG A;  1GVD A;  2WY7 Q;  5E8I A;  1BR4 A;  5C4J J;  3S1R J;  2WB1 A;  2EV5 A;  5HS9 A;  2QCO A;  4ZTJ A;  6PAX A;  1GVJ A;  1M1E B;  1QZY A;  3J7Y J;  1P7J A;  3RKW A;  5DM6 F;  2FU4 A;  2HPM A;  3DLA A;  5LD2 C;  3A01 A;  3FHN A;  3IC7 A;  4RDU A;  5E1W A;  4BL0 B;  3WGI A;  2MA3 A;  3Q0W A;  1ODD A;  3M8F A;  3GEZ A;  4M3B A;  1RES A;  5K5R A;  3IHU A;  5JFR A;  4Q48 A;  2GXG A;  4P9F A;  2E5Z A;  2XPW A;  2MAB A;  1MJA A;  2A61 A;  3ZGK A;  4ASN A;  1D0Y A;  3M8E A;  1D1B A;  2F6C A;  3U9G A;  2W7N A;  1CGP A;  3CJQ B;  1PJR A;  3SQN A;  1MDM A;  2DFE A;  4MEY F;  2FX0 A;  2RRE A;  3RSN A;  4D0P A;  3IKT A;  1XMK A;  2F48 A;  5D8L B;  3K0L A;  1HDP A;  1S29 A;  4EJU A;  3W6K B;  4HNU A;  1O3S A;  4OOI A;  4XNF A;  1UHM A;  2G0E A;  2CG4 A;  2VOP A;  3E97 A;  3FIS A;  2KP6 A;  3M07 A;  2HGC A;  5GP9 A;  2BGC A;  1R22 A;  3K2Z A;  3DBH B;  1YJ9 I;  1AKH B;  2XF7 A;  1D1A A;  3CCU I;  1GDT A;  1FMW A;  5B1B H;  5ICF A;  3HOX J;  3PSI A;  2E34 A;  4A3I J;  3PUF A;  3VPR A;  3HDD A;  1WJC A;  3QWL A;  1R5G A;  2P0W A;  3SYT A;  3LSP A;  2CO5 A;  1JUM A;  2X6W A;  5J40 A;  5E3O A;  1B9M A;  3MAJ A;  4ZYE A;  2CV1 A;  4IO9 F;  3LL7 A;  4ZC3 A;  3OOP A;  3RTR A;  2P8T A;  2V9V A;  5GPA A;  4A3E J;  2Z3Y A;  1LJ9 A;  2O7O A;  3I9V 2;  3B6C A;  1LDJ A;  1T38 A;  1IJW C;  1R58 A;  4B44 A;  5EGO B;  1BN5 A;  3OSG A;  2JWT A;  4XRM A;  1S72 I;  1EF4 A;  1W4M A;  3LAJ A;  4A3M J;  3S2H J;  3GME A;  1TLH B;  3KP7 A;  3HC7 A;  3WTT C;  3DPT A;  3I71 A;  2Q1Z B;  2X1C A;  4JX6 A;  2VBZ A;  2FBI A;  4XLA A;  1YG2 A;  1IN5 A;  1F1Z A;  4M3F A;  1B9N A;  3ZR8 X;  2EV6 A;  2V9P A;  2LY2 A;  2MSY A;  3RQI A;  1B1B A;  2GM4 A;  1ZEL A;  2YSR A;  1OQY A;  2QVO A;  5FRO A;  3PO3 J;  3K2A A;  2WWY A;  4KIT B;  4DZP A;  2DJI A;  2R7T A;  4BE2 A;  2LK2 A;  1T6S A;  2DA4 A;  1Z67 A;  5HLH A;  2E7X A;  2E19 A;  1HXD A;  5K1Y A;  2XAJ A;  4PFO A;  3CES A;  1DDN A;  1ZRD A;  1JE8 A;  2UWM A;  4I76 A;  3L9F A;  1XG1 A;  5H6Q A;  1OCR H;  4W97 A;  1RKT A;  2AQF A;  5A2Q K;  5IT3 A;  4LK0 F;  1UCR A;  3V8K A;  1QQI A;  2AXT C;  2LBF B;  4C2T A;  4C3I J;  4XLC A;  2VXZ A;  3A0H C;  3I59 B;  4KMF A;  3JTG A;  3CO6 C;  2L01 A;  1W0T A;  4A69 C;  1R1T A;  1XGM A;  2GOX B;  3P9K A;  2YX4 A;  3FX3 A;  4LMY A;  4LLL A;  3M1E A;  4UNO A;  1LKX A;  2HYF A;  2CUZ A;  1QVU A;  4ZH4 F;  4IHW A;  3HZJ A;  4ITV A;  3FM5 A;  2WA0 A;  5FFX A;  3DTI A;  1H88 C;  2HZD A;  1Z3Y A;  1R49 A;  1E17 A;  3HHG A;  3OR2 C;  1P4X A;  1W5S A;  3CMM A;  3ERE D;  2O8K A;  4IQ4 A;  3T1B A;  4HOB A;  4D7M A;  3CP8 A;  3H1C A;  3LFU A;  3GUD A;  3F8B A;  3T8T A;  4PJN A;  1A6I A;  4L9V A;  5J8F A;  4HQE A;  3I64 A;  1K78 A;  2WB1 N;  2NNN A;  3DBL B;  4HF1 A;  3ZMU A;  2IRF G;  2PN6 A;  3BR1 A;  1BBY A;  2O03 A;  2M8E A;  4ESJ A;  4IEJ A;  2ZJ2 A;  2NXN B;  2R7O A;  2M7B A;  1WH7 A;  3OS0 A;  1R1U A;  2VJ5 A;  3U21 A;  5DV5 A;  4CZC A;  3FMQ A;  4Y7N J;  5CVR A;  3JRG A;  5J1Y A;  2QWW A;  2PJR B;  1AHD P;  3GBG A;  3A2K A;  2XIG A;  1OCT C;  2M87 A;  1PDN C;  5BPI A;  2NYX A;  2TRT A;  1BM9 A;  2RGV A;  4BHB A;  3QOE A;  1VQ9 I;  3MZY A;  3CCY A;  4E7I A;  2FF4 A;  3K70 C;  2F4I A;  3ONQ A;  1TQI A;  5LHG A;  3ASO H;  3JRF A;  2ESH A;  3BG5 A;  1B59 A;  2FJ1 A;  4Q5S F;  1FP2 A;  3JAM Z;  1S7O A;  1DQU A;  1JKO C;  3BC8 A;  2A05 A;  1TBX A;  2K9M A;  4D1Q A;  3PIO F;  2ZC2 A;  3F3X A;  1P7I A;  2G9W A;  3I3L A;  1QHG A;  1Y0N A;  1Y8R B;  2XGC A;  1YYV A;  2KKO A;  3GCM A;  1X3Z B;  1Y1V J;  4EM2 A;  1XD7 A;  2Q0O A;  1T33 A;  1VQO I;  2HU9 A;  2Z5U A;  4BYY A;  4F52 A;  1XSX A;  3LSM A;  3N4M A;  1LB2 A;  3SZT A;  2KQR A;  3IL2 A;  1XGO A;  3E5U A;  4DBQ A;  5EZH A;  5F0C A;  3KZY A;  2Z1D A;  1Z77 A;  3LST A;  3OOU A;  1CF7 B;  3Q0V A;  1K4S A;  3PO2 J;  1D0Z A;  1MNE A;  3QYF A;  3L2C A;  1ULY A;  5DD8 A;  3WTU C;  1B6A A;  1TW3 A;  2X85 A;  1ZG1 A;  2VBW A;  3G1M A;  3GTJ J;  5FGM A;  2RC4 A;  4F91 B;  1PUF A;  1I6H J;  1YW8 A;  1OCZ H;  2M8G X;  2XF6 A;  3RKX A;  1ACI A;  5ICC A;  1A04 A;  2GA2 A;  4I7H A;  1JKQ C;  3W2W A;  4KN4 X;  2ZB9 A;  3NAR A;  4Z6Y A;  5LRS A;  4FX4 A;  3DXJ F;  1J5Y A;  3SEZ A;  4IHY A;  3I5U A;  2HVS A;  4I6Z A;  1YQA A;  1SAX A;  5J4V A;  2DMN A;  3D5S C;  2E71 A;  2F5C A;  1SD6 A;  1WJB A;  1ZRE A;  2VKH A;  4RS8 A;  4EM1 A;  4DYR A;  4L0Y B;  2Q2E A;  5KCM A;  1YRN A;  3D5L A;  1QO0 D;  1SFO J;  4RA2 A;  3A0B C;  3H5N A;  2BOL A;  3E5Q A;  2DPD A;  4LJZ F;  4Q47 A;  5FKK A;  3FXM A;  1GUU A;  4A0X A;  2HQA A;  1H89 C;  2OAZ A;  4HX8 A;  3ISP A;  2EIM H;  4CHU A;  2IBD A;  2ADU A;  2K9N A;  5DCM B;  3I4N J;  2DOD A;  2J5P A;  2Y2Z A;  1R23 A;  1I6X A;  3FM3 A;  4N4O B;  1YJN I;  3S93 A;  3WGG A;  3DBR B;  2CJJ A;  5DUI A;  4HDV A;  3R61 A;  5K5O A;  2JVG A;  1KYZ A;  3MKY B;  1YW7 A;  1A6Q A;  4XIC A;  2VIX A;  4RGS A;  1MBE A;  3K4K A;  2ELH A;  4DW6 A;  3ROU A;  4IKF A;  3DWL E;  1R1V A;  5FD5 A;  4G12 A;  1KZH A;  1LPQ A;  2DBB A;  3BDD A;  4I0A A;  4S0H B;  1S3J A;  2P5K A;  1G3T A;  2KRC A;  2M7A A;  1ITY A;  4H4K C;  5FKO A;  4KT6 A;  2Z9O A;  2R7U A;  4A3F J;  3IH3 A;  3DKW A;  4KFC A;  3K1P A;  4O3M A;  2M5W A;  4A6D A;  3GFI A;  1R5H A;  5M5Y J;  5FRM A;  3K70 D;  2LNB A;  2A68 F;  1W36 C;  1GT0 C;  3ZN1 A;  1F4K A;  1HA8 A;  4A0Y A;  2STW A;  3OS2 A;  2Y0M A;  2YPR A;  3HHH A;  2FOW A;  2EZL A;  1EH6 A;  4EEF G;  4YIF A;  3F23 A;  4FTH A;  2EFO A;  3WTZ A;  2H1K A;  1X4O A;  4RM3 A;  1IG7 A;  3T5X A;  3ZMS A;  3GTO J;  1UJ8 A;  1HKS A;  3DCF A;  3CC4 I;  3G73 A;  4ABZ A;  4FE7 A;  3QQA A;  1XSD A;  4AUX A;  2QA4 I;  2OZU A;  3TO6 A;  2Z2S B;  3GZN B;  1HDD C;  1EJ9 A;  2RQQ A;  4EVI A;  1QNT A;  3GFJ A;  2VQH A;  3KP2 A;  1VND A;  2ZXW H;  3FK7 A;  3OMY A;  4GGG A;  4IOA F;  1MMS A;  3EDP A;  2WV1 A;  3S3M A;  2IP2 A;  2LY9 A;  2CS3 A;  3MFK A;  1O57 A;  4MFD A;  4HST A;  3OYH A;  5B5E C;  2O61 A;  2HR3 A;  3LOC A;  4EQQ A;  2WV0 A;  4HRI A;  5LGT A;  1CQT A;  4QIW N;  1YIJ I;  3HRM A;  5A2Q Z;  1N25 A;  4C9Y A;  3R6S A;  1FSH A;  2AXL A;  1PYV A;  2VKV A;  5DTD A;  4BBS J;  2YS9 A;  3R0J A;  2DLL A;  3J81 K;  2WAD A;  3D0S A;  2CV0 A;  4F55 A;  1TT0 A;  3S17 J;  3L2V A;  3HPH A;  2AHQ A;  2EIN H;  4DJA A;  3RJP A;  1KYW A;  2L9V A;  2QQA A;  2BZT A;  3ASN H;  1WSU A;  4KN7 X;  4LFU A;  2ME0 A;  4A6E A;  1S7E A;  2GZW A;  3LSR A;  2OQR A;  3WTY C;  5FLV A;  3KZI C;  3L2R A;  3KP3 A;  4IF4 A;  1O7L A;  1JI8 A;  2ZSI B;  2C6Y A;  2P5L C;  2Y0S N;  2IXS A;  3HGY A;  5J47 A;  4IOC F;  2CFO A;  1QGP A;  3F22 A;  1PP7 U;  2KIU A;  3A03 A;  1H0M A;  2LG4 A;  5E20 A;  1ZR4 A;  5F08 A;  4F7Z A;  1VI0 A;  1WI9 A;  3OIO A;  4E70 A;  3CD6 I;  2O0Y A;  2J5O A;  1U78 A;  2XAG A;  2JRT A;  1Z7U A;  1TQP A;  3I58 A;  1AKH A;  1XDU A;  4U87 A;  5L3G A;  2NAZ A;  4L9J A;  5IOY A;  1WFX A;  2NS8 A;  2Y31 A;  4E7K A;  3HGG A;  5AON A;  2Z33 A;  1Z9C A;  2BHZ A;  3GTM J;  3VEP A;  5FJ8 J;  3ZPL A;  4CCL A;  4EJO A;  4KIS A;  2ECC A;  2RN7 A;  1YTY A;  2Q8K A;  2HOA A;  2DT5 A;  4BUP A;  1WZ2 A;  1E0E A;  1C0W A;  1F9N A;  4IPA A;  1G8X A;  4FHT A;  5EGO A;  1T39 A;  2IS2 A;  1YIT I;  2VJI A;  2JT1 A;  2M0M A;  3H0D A;  3FBN B;  1FTZ A;  2CYY A;  2E5N A;  3CUO A;  2EFQ A;  4X6A J;  3CUQ C;  1JTX A;  5HNH A;  2B9S A;  2P81 A;  2R5Y B;  2KIS A;  4ZYH A;  1QRY A;  2DYS H;  3NWT A;  3RI4 A;  3WE2 A;  3HOV J;  2FUG 2;  1FY7 A;  2MGQ A;  4E7L A;  1S8N A;  3FZV A;  4WF2 A;  3UNG C;  1FZP B;  2CQN A;  4IHV A;  4ZDO A;  2DJN A;  1G3Y A;  4XQF A;  1YS7 A;  2DA2 A;  2IA2 A;  2PI0 A;  3H5A A;  4JX5 A;  1I50 J;  4XL9 A;  3BLY A;  1ZH5 A;  2HDW A;  3VOD A;  4AYB N;  5F6F A;  1XGN A;  3K10 A;  3QOP A;  3V7C A;  1QZZ A;  3VOE A;  4U0Y A;  1H9T A;  3D1N I;  2XAS A;  1HC8 A;  3KP4 A;  5DCF A;  2QKL B;  4UY8 I;  2LYC A;  2UUZ A;  2A07 F;  1K83 J;  1I1G A;  1X4P A;  3H0G J;  3PUB A;  5J8C A;  4C2U A;  1SMT A;  4PSW A;  2CUF A;  1RIO H;  4AC0 A;  1MGT A;  2LOO A;  3CCV I;  1BR1 A;  3JW4 A;  2OBP A;  1OLT A;  2E7W A;  1Z05 A;  2L2O A;  3BWG A;  3W6J B;  1DP7 P;  3P5J A;  4HEA 2;  4YFN F;  4A3J J;  4DGW B;  1OR7 C;  2KHM A;  2H1L A;  4XK4 A;  1WJE A;  2ZFW A;  3WTS C;  2QLZ A;  4L5J A;  2QQ8 A;  2PMZ A;  2LBF A;  3RPU D;  3E6B A;  4HYE A;  4QSH A;  2KIQ A;  1DU0 A;  1Y1W J;  2BY1 A;  3DEE A;  3H3U A;  1MMN A;  4LIU A;  2ACJ A;  2EFN A;  3FXO A;  2D45 A;  1VQ8 I;  2EK5 A;  1P4W A;  4XLH A;  3IWF A;  2BV6 A;  2X6O A;  3GZ6 A;  4DYC A;  3MD2 A;  1Q1V A;  1X3W B;  1XB4 A;  3U2R A;  2XKO A;  1D1C A;  4HX7 A;  2HQ5 A;  2R3S A;  4U88 A;  4BXF A;  1LE8 B;  3TDZ C;  3JR9 A;  3HSE A;  2H09 A;  1JKR C;  2RNG A;  2OU2 A;  3I54 A;  3V8J A;  2HEO A;  3K4B A;  2E1O A;  1BJZ A;  2HYG D;  3S1N J;  1FT9 A;  3IV5 A;  3ZN0 A;  2FXA A;  1MIJ A;  3DTK A;  1DPR A;  4G6D A;  3G4S I;  1NK3 P;  4NHJ A;  2ZME B;  2H94 A;  5EG0 B;  2LKX A;  2KJC A;  3KP5 A;  4DQ2 A;  2CGP A;  2ZCW A;  2VKD A;  2CW7 A;  2R5Z B;  2NOG A;  4BDY A;  5LFA A;  5E3M A;  3RDI A;  1MBG A;  5IT9 K;  4JOM A;  2DA5 A;  3H9Q A;  1ZLJ A;  1IUY A;  4MHG A;  2P7C B;  1POG A;  1J75 A;  2DI3 A;  2COM A;  1YW9 A;  2F5F A;  3AG1 H;  4IJA A;  1FTT A;  1X1B A;  1PVE A;  2IEK A;  3S1M J;  1BIB A;  2CRG A;  2LDU A;  1SVO A;  2IGO A;  3N05 A;  1I39 A;  1IDZ A;  1B72 B;  2KMU A;  3BG6 A;  3BR0 A;  2R7S A;  2WAF A;  2X6X A;  2BHY A;  1UFM A;  2DOA A;  1YE9 A;  2TCT A;  1Z0X A;  3KPH A;  1IW7 F;  1ETY A;  1SAN A;  4M74 A;  4UHT A;  4EJT A;  1IC8 A;  5E8G A;  4HNV A;  4FQG A;  1J09 A;  4XMY A;  1Y39 A;  4FE4 A;  1SFU A;  1U5T B;  4FX0 A;  1FOW A;  2L54 A;  3C2B A;  3LSG A;  4KNY A;  2HKX A;  1S5L C;  4BE0 A;  4HDU A;  2VOO A;  4BXX J;  2F5V A;  1FMV A;  5FLX K;  2M0C A;  1XCV A;  2EZI A;  5ICG A;  5JHU A;  1WCM J;  3SDB A;  1SD4 A;  3G6E I;  4AIJ A;  3TL4 X;  1B4A A;  1VQ6 I;  4N9I A;  3DF8 A;  3L00 A;  4RAZ A;  5HOO A;  2VOD A;  3UKG A;  4F93 B;  1FOX A;  1O3Q A;  3H35 A;  3IKV A;  1CF7 A;  1W7P D;  2VQG A;  1K6O A;  4KIC A;  4NNJ A;  1VZ0 A;  2K85 A;  4ESB A;  5K7Z A;  4AID A;  3SZP A;  4JYK A;  5LEK A;  3BY6 A;  4PJM A;  1R5I D;  3CCM I;  3TDU C;  1Z21 A;  4ETS A;  2R7W A;  2EV0 A;  3R0A A;  3J81 Z;  1EH8 A;  3VFZ A;  1RR7 A;  5J1U A;  2IVM A;  2HZT A;  2BY0 A;  3BRO A;  3FBI B;  5HNF A;  5FKN A;  2GLO A;  1P2F A;  1U2W A;  1V54 H;  3K7A J;  3FXU A;  2NOJ B;  1A36 A;  3K1M A;  4GYI A;  4PGG A;  4R1H A;  1JJ6 C;  3AFH A;  2VBY A;  2VT2 A;  4B3X A;  5GTH C;  3K4C A;  4OWR B;  1UAA A;  1ZAR A;  2XB0 X;  2GIV A;  1LVK A;  2V6E A;  3GFL A;  2D1V A;  4MQV A;  1MBJ A;  3FDY A;  4V2G A;  1I1S A;  3HRT A;  3QP6 A;  1OMI A;  4L9N A;  1U8R A;  1K7A A;  4RB2 C;  1OYW A;  2L5Q A;  4M73 A;  3PL8 A;  2BY2 A;  3HG9 A;  4H0E A;  5M3F J;  4YRV A;  5ILV A;  1HCR A;  1T0F C;  2K9Q A;  2K3P A;  2VBX A;  4BEH B;  1LEA A;  3CCQ I;  1NK2 P;  2A3S A;  4XN3 A;  5DCM A;  2VB6 A;  2B7E A;  4ZYA A;  2STT A;  5M3M J;  2JJ7 A;  3CCE I;  2CQQ A;  1X19 A;  2Z99 A;  2ISY A;  5AIQ A;  4HZF A;  2XAF A;  4O5V A;  3BTJ A;  2M4G A;  4RGR A;  2OV7 A;  2L4M A;  3GLL A;  4HQM A;  3KFW X;  5GPC A;  2ELJ A;  4WCG A;  3KLO A;  2O8X A;  4RGU A;  4E7S A;  3IAM 2;  1VQ5 I;  3FXJ A;  1X2M A;  2PMZ N;  3SFI A;  5F0F A;  2CU7 A;  1EA3 A;  2G7U A;  2LKS A;  4PJL A;  1RZ4 A;  1ETV A;  1FIP A;  2O3F A;  2HQR A;  4FCY A;  1SFE A;  4JK1 X;  3COA C;  1IV8 A;  3WG9 A;  4YG2 F;  2ZFU A;  5C4X J;  4K2E A;  4MFE A;  5H20 A;  4AWX B;  1P92 A;  3OV8 A;  1DUX C;  4CUG A;  1F5T A;  2UXN A;  2CSO A;  5IYB J;  4G7Z F;  2EFW A;  2HXI A;  3K1N A;  2LH9 A;  4LD5 A;  3TKY A;  1IXR C;  2I8D A;  4PUS A;  4UB6 C;  2JZY A;  4D5F A;  4IX7 A;  4QTR A;  1SEU A;  3ECH A;  2W24 A;  3FWE A;  4C2M J;  1HKT A;  1LNW A;  3GYH X;  2LP0 A;  3LSK A;  4AVZ A;  5BMZ A;  1QZE A;  2XRO A;  2M34 A;  1SD5 A;  2YR2 A;  1R00 A;  4G94 A;  2CWE A;  2X51 A;  5LLQ A;  2JSP A;  3T8R A;  3BP8 A;  1V5E A;  1TP4 A;  2DAO A;  3MCZ A;  3Q9S A;  1VQ7 I;  3FHZ A;  2VQL A;  4IHT A;  4LB6 B;  1VQK I;  1ZLK A;  3HYI A;  4Y15 A;  2NS0 A;  2GOM A;  2RQP A;  2IAI A;  2LMD A;  5HDG A;  1WRJ A;  4BY7 J;  3DEU A;  3S32 A;  3WGH A;  2QZ8 A;  1VQ4 I;  1X1A A;  4CYD A;  3LAP A;  1HBX G;  2BEO A;  2R93 J;  4A3G J;  3OYI A;  4OMY A;  1IN6 A;  3OYM A;  4PJ0 C;  4ZYD A;  1JT0 A;  3OIP A;  2EA4 A;  3HUG B;  2HVQ A;  4IRH A;  4ENJ A;  3BG9 A;  4DNC A;  2HI3 A;  3HKZ A;  3EUH A;  1AU7 A;  4LG0 B;  1IUF A;  2XC7 A;  3ZMT A;  3ZP5 A;  4HAM A;  2AS5 F;  2FBH A;  3HSF A;  4IHX A;  4XLE A;  3LA2 A;  3OSF A;  4NB5 A;  5F27 A;  2DFH A;  4BJT A;  1BC8 C;  2VE8 A;  3FIW A;  1S7A A;  2YX7 A;  1FP1 D;  2XDV A;  5F04 A;  2JA5 J;  1KU9 A;  4KT5 C;  3REO A;  3O2P E;  1H8A C;  3QPL A;  3C18 A;  4A3B J;  1WGX A;  1QU3 A;  1KQ9 A;  1TWH J;  3GO5 A;  4A3K J;  2FQ4 A;  2HQN A;  4CH7 A;  4M3D A;  3EYI A;  1D8J A;  5TGT A;  5JVG F;  1QA6 A;  2XPU A;  2W85 A;  4B09 A;  5KVR A;  3E7L A;  4KUM A;  3QPH A;  3FMR A;  2KIF A;  3I4P A;  1N77 A;  2PBI A;  2EA2 A;  2W4S A;  3X2Q H;  3MZ8 A;  5KHD A;  5F64 A;  4A0Z A;  1G59 A;  2XGE A;  1FYK A;  1I5Z A;  5IT9 Z;  4HG2 A;  3E6C C;  1SD7 A;  2CUJ A;  2M3A A;  4PJJ A;  4IXA A;  2WAQ A;  3PQK A;  1JHF A;  3ZQQ A;  4ZYG A;  2DW4 A;  4YIR X;  4HNT A;  3MKW B;  5EF6 A;  2AQE A;  4CO8 A;  4E7H A;  4GCV A;  3ABU A;  3O6B B;  4B3A A;  4B43 A;  1SMY F;  3OL3 A;  3ABK H;  3U1K A;  2XGX A;  3K6G A;  1JXS A;  3MQ0 A;  4KA4 A;  4AVP A;  1X1C A;  3SFZ A;  5CKT A;  2RV8 A;  3H9J A;  1UHS A;  2MLK A;  3NEU A;  1K79 A;  1ONV A;  5LHI A;  2WAE A;  3BTI A;  1I3A A;  1XC5 A;  4UUT A;  3IH2 A;  1RC9 A;  5E1X A;  4KIB A;  2K7L A;  1J59 A;  4EGY A;  4LLN A;  2F4M B;  3ZMZ A;  4ANJ A;  1MDM B;  2PQ8 A;  3HB9 A;  2H8W A;  2BXY A;  1WWX A;  1Z1D A;  1MNM C;  4E7J A;  3NRV A;  2MW8 A;  5FLX Z;  1MBK A;  2K86 A;  4U7B A;  1MJ9 A;  2OZ6 A;  4A12 A;  2DFI A;  4UB8 C;  2OCE A;  1MND A;  2QF7 A;  4UUV A;  2BYV E;  2OQG A;  3GVA A;  3JCU C;  2E2I J;  3M7G A;  2CH0 A;  3FXL A;  1LFU P;  3OYA A;  3NAU A;  2NNY A;  5BNG A;  2M30 A;  3PFI A;  2QBY B;  1F43 A;  1GXQ A;  2P7V B;  5L3B A;  1K61 A;  1OPC A;  3WTW C;  1GV2 A;  4PSX A;  1ZG5 A;  1TL8 A;  5LGU A;  1RRJ A;  2LRE A;  1T8I A;  2DA3 A;  4PCQ A;  2ZJR F;  2ZNZ A;  4HW0 A;  5CPR B;  5GAE J;  2IGN A;  1GHC A;  1HOM A;  3CJT B;  5GAH J;  1R9T J;  2QSG X;  2CQ7 A;  4EGZ A;  3CC2 I;  3JRI A;  3BZC A;  1ZTR A;  2HYJ A;  5CYV A;  1VFC A;  1ENH A;  3EPZ A;  3B6A A;  1X58 A;  2K4J A;  3TO7 A;  1JUS A;  2KLO A;  5EDN A;  3ULQ B;  1ZG3 A;  4L5I A;  4XN0 A;  1R71 A;  1BJA A;  1MMG A;  2V1X A;  2KRF A;  3FXK A;  2K40 A;  4BHC A;  5TIS C;  3V42 A;  2QEN A;  4HSR A;  2CUE A;  2DTR A;  3A02 A;  2L7K A;  1LE8 A;  5FD6 A;  4RMN A;  1FNN A;  4N0B A;  1W5T A;  1UHW A;  2ZKZ A;  1D3Y A;  1YLF A;  2BXZ A;  3IH4 A;  4XR6 A;  2OA4 A;  1ETK A;  2JPB A;  3PNY A;  3QU3 A;  4Y3O A;  5B3S H;  2QUF A;  4IZZ A;  3DEW A;  2ZME A;  4M9X A;  5EG0 A;  3OY9 A;  2ZO4 A;  4LG3 A;  4V2F A;  2R5Z A;  1OYI A;  1UZC A;  3FF5 A;  3J7A O;  1RNL A;  3BZ6 A;  4UVB A;  1YIO A;  2R7V A;  2ZJP F;  1WKM A;  2HOE A;  5CVU A;  3HOS A;  3RZO J;  4G7O F;  2LRD A;  2K02 A;  3E3V A;  2NVT J;  4X0G A;  2EJR A;  5ED4 A;  1RR8 C;  4YFK F;  3JSP A;  4XRS A;  3KET A;  3MZH A;  2A6H F;  1ZQ3 P;  2HS5 A;  1TWA J;  1OCC H;  3WTV C;  2VT3 A;  2EIK H;  5IY5 H;  1B72 A;  2A6E F;  3G2B A;  3K4L A;  5JVT A;  3H36 A;  2LF7 A;  4GXO A;  4MO7 A;  3LSH A;  3KEO A;  1FBQ A;  2LSO A;  1YJW I;  4HF0 A;  3E6M A;  3GZ5 A;  3SDG A;  4D7N A;  4BBR J;  2XRN A;  4GRI A;  1IO2 A;  4GO1 A;  2MD5 A;  5IP7 J;  4XLN F;  1U5T A;  5CLS A;  1BOA A;  4QPO A;  2V26 A;  3V7R A;  1NG6 A;  5D6E A;  1KGS A;  3P7N A;  2JRM A;  3GTK J;  2VE9 A;  4CCO A;  4CYC B;  3CF5 F;  3H9G A;  3GTQ J;  2IT0 A;  4BHP A;  4I01 A;  3WOD F;  3ZQC A;  4WXC A;  4WK8 F;  3KX2 A;  3LSJ A;  4R8H A;  3QU6 A;  4XLP F;  2LD5 A;  3S15 J;  2KDO A;  4M71 A;  2DO7 A;  4UUS B;  5GAG J;  2R7Z J;  1KQ8 A;  3JRC A;  2DT6 A;  1XMX A;  2VI6 A;  4I2O A;  4P96 A;  1QHH D;  3E5X A;  4S05 A;  4ENK A;  5J6X A;  3BQZ A;  4LIV A;  2X0L A;  3CJN A;  1B8I B;  1G4D A;  1XTA A;  2V4J C;  3DFG A;  5LGN A;  3WE3 A;  5FRN A;  2COB A;  1G3S A;  1YOV B;  4LB5 A;  2M9H A;  3TED A;  3JRA A;  1JJ8 C;  1FSE A;  2EZH A;  3G71 I;  2DFF A;  1KU2 A;  2LKP A;  3S16 J;  4RGX A;  1U0J A;  3DTE A;  4L0Z B;  4YFX F;  4A5M A;  1I3Q J;  3CDI A;  1DGR M;  2KDZ A;  2LC2 A;  2UZK A;  3Q5F A;  4ZDL A;  2IA1 A;  3CF2 A;  5TRD A;  1BI2 A;  2IA0 A;  2X1D A;  1TW2 A;  2Y75 A;  1R6R A;  3CME I;  2QM3 A;  4MGR A;  4AM3 A;  3IAS 2;  3P9C A;  1PP8 F;  3HOT A;  1VF9 A;  2ZNY A;  3DKY A;  2AO9 A;  2VPL A;  2PEX A;  2Z16 A;  2VL8 A;  2EH3 A;  3RKY A;  1J7K A;  2L7M P;  2VUM J;  2K4B A;  2L9S A;  1A5J A;  1Y0U A;  4M6V A;  4BY1 J;  3W2A A;  3WU0 A;  3F9K A;  4J19 A;  3OYK A;  4E7Z A;  1FX7 A;  1LQ1 A;  3C1D A;  2VXD A;  3GW2 A;  4B47 A;  3FMS A;  3U1D A;  1Y8Q B;  2ZXJ A;  5JHF A;  2RKH A;  2ECB A;  1YHQ I;  1WVR A;  1FLI A;  4I09 A;  2GIZ A;  3WG7 H;  4GYG A;  5DM7 F;  2D1H A;  5CJ9 A;  4B48 A;  4BEH A;  4C3H J;  3HOW J;  3BG7 A;  3S3N A;  3OS1 A;  2DTZ A;  4CGZ A;  3HJE A;  3R60 A;  3F8C A;  4BQQ A;  1X2N A;  1J2X A;  1NHA A;  2RNJ A;  3L09 A;  1IF1 A;  2E1C A;  3GTL J;  5LHH A;  3MMY B;  3M8J A;  3V7S A;  3W6V A;  3BZK A;  1DGW Y;  5CVJ A;  3PIP F;  5HS7 A;  1ETQ A;  1BW6 A;  2DXI A;  4IRI A;  2EBI A;  4LK1 F;  4BS9 A;  2W57 A;  5DUK A;  3BG3 A;  4XOP A;  1ZYR F;  2K27 A;  1UMQ A;  2CW0 F;  5IYD J;  2BE5 F;  2I10 A;  1MSE C;  4P1W A;  5JR3 A;  1YS6 A;  3TOB A;  1EKE A;  5BQT A;  2PFB A;  3QPS A;  1P4A A;  4DOZ A;  3T0Y A;  1R7J A;  4ZDP A;  3VWB A;  2VC0 A;  3JSO A;  4WX9 A;  4WXD A;  2FQ3 A;  2FRH A;  5D4S A;  4EMS A;  1VQN I;  3QOD A;  4XM3 A;  1U6G A;  2R0Q C;  1WQ2 A;  4I0B A;  5L3D A;  2MH2 A;  4OIN F;  1O3R A;  3ZMV A;  4PDK A;  2V1U A;  1LDD A;  2KT0 A;  4L18 B;  3I59 A;  1RUN A;  5BPD A;  1XGS A;  4QLC U;  5ILU A;  4FET A;  2E60 A;  3K9T A;  3WHB A;  2NVX J;  5L3E A;  2DDA A;  1ZK8 A;  4HV5 A;  4UVA A;  3TP0 A;  1U9N A;  3ABL H;  3VB2 A;  3LMM A;  1YRN B;  2ISZ A;  2DN0 A;  3L7W A;  4XKV A;  1UEL B;  1T56 A;  1RI7 A;  4RBO A;  1JGS A;  3DU5 A;  3W2V A;  2JPC A;  1V4R A;  5HVQ C;  4I98 B;  2ZXI A;  1ZRC A;  1U3E M;  2YUS A;  2GWR A;  3CCR I;  2MD0 A;  3ABT A;  3OR1 C;  1O3T A;  1TNT A;  2GAU A;  2XGD A;  3OYL A;  4A93 J;  4XID A;  1FBS A;  5EEH A;  3K69 A;  4NQW B;  3KIO A;  4QWQ A;  1OIS A;  4CA0 A;  3HPG A;  4HBL A;  2XPV A;  3HUG A;  3HRS A;  2DDB A;  4F3Q A;  2M45 A;  2L9R A;  4RAG A;  2V1D A;  2DYR H;  3BJO A;  3EUA A;  3CUQ B;  4CCN A;  4MTD A;  4LG0 A;  1E3O C;  4XKC A;  4BH9 A;  4BU2 A;  1IRZ A;  3HTU A;  2HFH A;  3K4N A;  2E2J J;  1NTC A;  2ZSH B;  3ZQL A;  1TZL A;  3CP2 A;  3DV8 A;  4ON0 A;  1QPI A;  1FPQ A;  1F36 A;  1BI3 A;  2JUC A;  1OKR A;  2YU3 A;  3BR3 A;  4XKB A;  2KZG A;  5EZG A;  2DCE A;  5TJJ A;  3TMO A;  4A3D J;  3SZG A;  1QPM A;  4KYW A;  4A3L J;  5LEJ A;  2PJR A;  4U0W A;  1BOB A;  2K5C A;  4EV0 A;  2B63 J;  3ZQG A;  4X1E A;  3AG2 H;  1HSJ A;  3CMA I;  4YEJ A;  5L3C A;  1XX5 A;  2ESN A;  4B4C A;  1QVT A;  2HVR A;  3J80 K;  4J00 A;  2Y9Y A;  4UV8 A;  1V55 H;  5D4R A;  1Y56 A;  4P5O A;  3RQ4 A;  4B8X A;  3RYP A;  4ENM A;  1D8K A;  1W7P B;  3A4C A;  2R7D A;  3CO7 C;  3R4K A;  4DIQ A;  3KCC A;  4IVN A;  2ICW G;  1KU3 A;  2OD5 A;  1SFX A;  1MH3 A;  1ON1 A;  3GTP J;  1N75 A;  1TWF J;  5CQG A;  1X1P A;  4DBR A;  1BL0 A;  3J7Z I;  1Z91 A;  1ZR2 A;  3HOY J;  3OYN A;  3GLX A;  5DYM A;  1ON2 A;  3QYE A;  4RM2 A;  5LRR A;  4FAS D;  2DPU A;  3BCA A;  2PLY A;  3L2Q A;  3AG3 H;  1ETO A;  2RVC A;  2XRL A;  4BJ5 C;  3TO9 A;  1DP3 A;  2LY1 A;  2EZK A;  1MH4 A;  3PNT A;  4XRF A;  4CSW A;  2GXA A;  3B02 A;  5ICE A;  4KDP A;  4M9S A;  4A2U A;  3GWZ A;  4DZJ A;  4Z2Y A;  3M9A A;  4FIS A;  1HW2 A;  1DU6 A;  4CXF A;  1ORK A;  1S6L A;  4M6Y A;  1Z6T A;  5C44 J;  2FE3 A;  2IS1 A;  1JT6 A;  1V3F A;  3KYD B;  4O6J A;  2UV1 A;  2UXX A;  3AL0 C;  2IW5 A;  1YO5 C;  3VSK A;  4W1U A;  3SXY A;  4C30 A;  5M5X J;  2VQC A;  4UVC A;  2ME6 A;  3I4M J;  1E3H A;  4BKX A;  3CLQ A;  2HDD A;  2LF8 A;  4NC7 A;  4G8X A;  2MH9 A;  5ILS A;  5HDK A;  3IUO A;  4BE1 A;  4RAF A;  2V6C A;  4I99 C;  4ZTF A;  1Z7L A;  3CTA A;  1UG0 A;  1XN7 A;  2R92 J;  2PMU A;  3H3Z A;  3VYR B;  5E17 F;  4AD9 A;  2QBY A;  3LA7 A;  4RB1 A;  3EYY A;  4XRS G;  4I02 A;  2DK8 A;  5J1R A;  3S14 J;  4D9J A;  2HXO A;  3EUK L;  5HDN A;  2IS4 A;  4M3G A;  2H6C A;  4JBA A;  4IL6 C;  4YII A;  1ZGW A;  1GXP A;  2KFD A;  3PJR A;  1X3U A;  3EQL F;  1MBF A;  2OPT A;  2X6Y A;  3DKX A;  3OWT A;  2V1N A;  3GFM A;  3OIQ A;  1IRG A;  5D5X B;  3BR5 A;  3MKL A;  4HX4 A;  1IN8 A;  5FO5 A;  1IXC A;  5HLG A;  1IAW A;  4Y17 A;  1AWC A;  1GV5 A;  1ZGJ A;  2DMU A;  2X4H A;  3LQR A;  4Y33 A;  1HF0 A;  2OTJ I;  5J4Y A;  1TT5 B;  3WHC A;  3DP7 A;  4ZZL A;  2QKM B;  4ZJZ A;  3S2W A;  1BR2 A;  2DA1 A;  2EB7 A;  5GTI C;  4LOC A;  2VAS A;  2EIL H;  3B73 A;  1G6N A;  1HKQ A;  1I27 A;  2K9S A;  2L7Z A;  2M1B A;  2FML A;  3OYB A;  1Y6I A;  2A5Y B;  2X1E A;  4AU7 A;  2FBK A;  2A6T A;  3P9I A;  2ELK A;  2BVM A;  1V5F A;  5DS9 A;  2L0K A;  3LQQ A;  5JI6 A;  3ABM H;  4M3E A;  3F8F A;  1ETW A;  4G6Q A;  3S8P A;  2VLA A;  5EJC A;  4JP0 A;  3V4G A;  2L4A A;  2FNP A;  3PNV A;  2MC3 A;  1BW5 A;  3J7A Y;  4BQO A;  4Y13 A;  2K9L A;  2FA5 A;  3ML6 A;  4XOR A;  3HOU J;  1FYL A;  1WJF A;  2JTV A;  2JN6 A;  4F92 B;  2DA6 A;  1TTY A;  5AIP A;  3I56 I;  2EPF A;  2OUM A;  3H92 A;  4GFB A;  5L3F A;  3AL0 B;  3NQO A;  4HLY A;  2JUG A;  2BW3 B;  3JRB A;  2XSJ C;  1YI2 I;  1PUE E;  5KNL A;  2PJP A;  2P6T A;  2JQ7 A;  1U8B A;  3A1Y A;  2F5D A;  4ZZD A;  1FC3 A;  2MFZ A;  2XVC A;  3MVP A;  1BC7 C;  2MC4 A;  5LBQ A;  1Z6R A;  2W84 A;  2F4O B;  3CQZ J;  1WJ5 A;  1Q1H A;  2HPI A;  3IP4 B;  1KQ0 A;  5HS8 A;  3WU2 C;  4CIC A;  2DQL A;  4OU0 A;  3SHF A;  1G3W A;  2F2E A;  4U0V A;  1OFC X;  4MIM A;  4RLF A;  3C2G A;  5F1J A;  3E6D A;  3W3C A;  1T08 B;  2JA2 A;  1IN4 A;  4PGH A;  2R7X A;  2PG4 A;  4CYC A;  2RDP A;  1R4M B;  3F0C A;  3KZZ A;  2JMW A;  4LIT A;  3MEX A;  4CCK A;  3Q0U A;  4PFP A;  2XAU A;  2WBM A;  5IP6 A;  1FJL A;  3S2D J;  4E6K G;  5HOD A;  2NVY J;  4A3C J;  3ZQI A;  4P9U A;  1G2H A;  3QRF F;  2XF5 A;  2CQK A;  4UUS A;  1VQM I;  4OAZ A;  4BAC A;  2WC2 A;  4RB0 A;  3CCJ I;  1ZGA A;  5IYC J;  3WTX C;  1B8I A;  3AAF A;  3H5R A;  2W1O A;  4OIP F;  2L9N A;  3Q9V A;  4XON A;  2NVU B;  4GDF A;  3M3Y J;  1LDK B;  4ESF A;  3MWM A;  5IPA A;  3BCB A;  1ETX A;  2FMY A;  2VJJ A;  3F72 A;  2QSH X;  3ZQ7 A;  2ZJQ F;  5E79 C;  1ZRF A;  2QYO A;  3IRQ A;  2LTP A;  4R79 A;  2E35 A;  2V79 A;  5D5U B;  3GX4 X;  2HOS A;  2CQX A;  3DPL C;  2D5V A;  2HTS A;  2OJE D;  5ERI A;  2M4K A;  3ZQH A;  3F6V A;  3HIF A;  3PFY A;  1WH5 A;  3A01 B;  4G6T B;  4IRG A;  1SC7 A;  3CCL I;  2B0L A;  1EH7 A;  1ZN2 A;  1REP C;  3I0T A;  3I53 A;  1XMA A;  3DLL F;  2IS6 A;  3J80 Z;  3C3W A;  5JLW A;  1MSF C;  2Y0S A;  3BR6 A;  4AIK A;  3QPT A;  2KJB A;  2P4W A;  3TQN A;  3GF2 A;  2R5Y A;  2O9L A;  3RPQ A;  5KK1 A;  1X1D A;  3CJR B;  5E18 F;  3F6O A;  1XS9 A;  3FKI J;  4XSX F;  1T2K A;  2PX9 A;  2JSC A;  3V8L A;  1T95 A;  1ZHF A;  1IV6 A;  3RPU A;  3OYE A;  1A35 A;  1AA7 A;  4MEX F;  4KMU X;  5GAD J;  2WTE A;  3TGN A;  1JHH A;  3O8G A;  4B1R A;  2DT7 B;  3KYL A;  1IXS B;  2EQR A;  3RCO A;  3ZRG A;  3HL2 A;  4EJV A;  2M2E A;  1RKW A;  4S04 A;  3CCS I;  1T98 A;  2DU9 A;  4EJW A;  1YFH A;  3HXL A;  4NBQ A;  1K4T A;  3IRR A;  2DMP A;  4N9H A;  2L7F P;  1FYM A;  1U9O A;  4BJ6 C;  1IN7 A;  3O8H A;  2ETH A;  3OYF A;  3FK6 A;  1J9I A;  3E1S A;  4IHS A;  1S9H A;  2VC1 A;  4XBF A;  3G1O A;  4RB3 C;  1UST A;  5CQE A;  5E3L A;  5IOZ A;  4CCJ A;  3K4M A;  1MW7 A;  2CFX A;  2O5R A;  3KE2 A;  1NG7 A;  1ERD A;  4OIO F;  2IPQ X;  4HV6 A;  1SFK A;  5FLM J;  5DEQ A;  4AYB A;  1WHU A;  3EUH C;  2HOT A;  1MBH A;  2L02 A;  2WY8 Q;  1P9Q C;  2KIM A;  1HST A;  5K7H A;  1TWG J;  3CLO A;  5KAI C;  2DK5 A;  3D5R C;  2H27 A;  4NDL A;  2XUB A;  3MKZ A;  3AG4 H;  4NQW A;  3KP6 A;  5B66 C;  2Y69 H;  3BPX A;  2VKE A;  2JVH A;  5C3E J;  3O3K A;  1BI1 A;  1FOY A;  1YX3 A;  2V9K A;  3HEF A;  2XAH A;  1WJA A;  3ECO A;  1TNS A;  3QYB A;  3HRU A;  3CUQ A;  1RPW A;  2DQR A;  3ZQF A;  3DPU A;  2IGK A;  2MLG A;  3CMY A;  2ZBK A;  1JGG A;  1VQL I;  1E2X A;  3HM5 A;  1SVL A;  2JA6 J;  1D5V A;  5K7F A;  2OC6 A;  5H6R A;  5E3N A;  1R4N B;  2KZV A;  3BPV A;  4JQF A;  2DMT A;  1DPU A;  3WU1 B;  2A5W A;  4P55 A;  4CCM A;  1BIA A;  4CZZ A;  3HKZ N;  1A31 A;  2V7F A;  2D2W A;  2Y30 A;  5D8K B;  5HLT A;  3ZCO A;  3L1P A;  2NS7 A;  2N8G A;  2QQ9 A;  1K6Y A;  1STZ A;  2LLK A;  4G9Y A;  4JX4 A;  4M72 A;  1FBU A;  1GLN A;  2IGM A;  5B1A H;  4II2 A;  1TWC J;  2X9D A;  5E1Z B;  2O6G E;  2PMH A;  5F1R A;  3NWS A;  3TW7 A;  3K4J A;  4XLF A;  5CVV A;  3TOA A;  1FOK A;  3L2U A;  4L9T A;  4MTE A; 
#chains in the Genus database with same CATH homology
 3LMM A;  4XKV A;  1UEL B;  1YX5 A;  1DQU A;  2L5Q A;  3DU5 A;  3W2V A;  3BC8 A;  4PK4 A;  3PL8 A;  3HG9 A;  2K9M A;  5HVQ C;  4D1Q A;  2ZXI A;  4YRV A;  2BVL A;  1T0F C;  2K3P A;  3S3O A;  4BEH B;  3I3L A;  2MD0 A;  3OR1 C;  4OAY A;  1QHG A;  4XN3 A;  3OYL A;  2VB6 A;  4ZYA A;  4NQW B;  4II3 A;  2E1M C;  1X19 A;  2HU9 A;  4CA0 A;  3HPG A;  4F52 A;  3CZ6 A;  3LSM A;  2M4G A;  3KEY A;  2OV7 A;  4F3Q A;  2KQR A;  4HPQ A;  1LFP A;  2ELJ A;  3EUA A;  4DBQ A;  4CCN A;  3OL4 A;  4XKC A;  1WJD A;  4BU2 A;  4E7S A;  2CV2 A;  2ZXH A;  3AKZ A;  2Z1D A;  3IAM 2;  3OOU A;  3OYD A;  3K4N A;  3PSF A;  2ZSH B;  1EA3 A;  1TZL A;  1D0Z A;  3CP2 A;  1MNE A;  4PJL A;  3QYF A;  4NUB A;  2ZFU A;  2X85 A;  4XKB A;  4J01 A;  2DCE A;  3TMO A;  3SZG A;  4CUG A;  4F91 B;  1V5G A;  2PJR A;  2XF6 A;  1BOB A;  3FKJ A;  2K5C A;  2LH9 A;  2I8D A;  4PUS A;  3W2W A;  4IX7 A;  3SEZ A;  4YEJ A;  2CMP A;  2HVS A;  2HVR A;  4J00 A;  4EAT A;  3DQV C;  3LSK A;  4AVZ A;  3D5S C;  3VYS B;  4BQN A;  3C2H A;  3L2W A;  1WJB A;  1Y56 A;  2VKH A;  2X51 A;  4P5O A;  2W00 A;  2JSP A;  3RQ4 A;  3A4C A;  1V5E A;  5KCM A;  3D5L A;  4DIQ A;  3H5N A;  2BOL A;  2VQL A;  2GOM A;  2KPM A;  3LSI A;  2HQA A;  4QPQ A;  1N75 A;  2KRH A;  5CQG A;  3S32 A;  1N78 A;  4DBR A;  3E0J B;  1X1A A;  3OYN A;  3OYI A;  2CW8 A;  3QYE A;  3OYM A;  4N4O B;  4RM2 A;  3S93 A;  4FAS D;  3OIP A;  3BCA A;  2HVQ A;  3HUG B;  1KON A;  3L2Q A;  2JVG A;  4Y4R A;  3MKY B;  4BJ5 C;  4E4H A;  1DP3 A;  3HKZ A;  2LY1 A;  3SEQ A;  4CSW A;  3PNT A;  4N4N B;  2VIX A;  2XC7 A;  3K4K A;  4XLE A;  4IKF A;  3DWL E;  1MMD A;  2R7Q A;  4BJT A;  1W36 D;  2VJ4 A;  3TBI A;  1Z3X A;  2IS1 A;  2XDV A;  2E1M B;  2HNH A;  2KRC A;  2M7A A;  2UV1 A;  4H4K C;  4KT6 A;  3AL0 C;  2R7U A;  4BDZ A;  1QU3 A;  3VSK A;  5FRM A;  3K70 D;  4C30 A;  2VQC A;  1W36 C;  1HA8 A;  4CH7 A;  3OS2 A;  4RLQ A;  5TGT A;  4XOT A;  1D0X A;  4NC7 A;  3OYJ A;  4BE1 A;  3IUO A;  4ZTF A;  1Z7L A;  3VDX A;  1X4O A;  1UG0 A;  4RM3 A;  1N77 A;  2R7R A;  2W4S A;  2W82 A;  3VYR B;  2Q2E B;  5KHD A;  2BW3 A;  1G59 A;  4BGD A;  2Z2S B;  4HG2 A;  1IRX A;  2CUJ A;  2RQQ A;  2M3A A;  4D9J A;  2VQH A;  4PJJ A;  3EUK L;  2WAQ A;  3OMY A;  3ZQQ A;  2IS4 A;  3VSL A;  4HNT A;  3PJR A;  3S3M A;  3MKW B;  2X6Y A;  3DKX A;  2AQE A;  2CS3 A;  4IQJ A;  3OWT A;  4E7H A;  3OYH A;  4HST A;  2V1N A;  3OIQ A;  4HRI A;  4B43 A;  3ZXS A;  3OL3 A;  3K6G A;  4Y33 A;  3VYT B;  3UR3 C;  4C9Y A;  1X1C A;  4MLO A;  5CKT A;  2QKM B;  1PYV A;  4ZJZ A;  3H9J A;  1BR2 A;  4KJZ A;  2VAS A;  1MMA A;  2R4G A;  2WAE A;  2WAD A;  2CV0 A;  4F55 A;  1TT0 A;  3L2V A;  3HPH A;  4DJA A;  3OYB A;  3OYG A;  1Y6I A;  2X1E A;  4AU7 A;  2A6T A;  3VYU B;  4ANJ A;  2BVM A;  1V5F A;  2KL4 A;  3DU6 A;  3L2R A;  3S8P A;  2VLA A;  4E7J A;  1JI8 A;  2ZSI B;  3PNV A;  3M1C A;  2IXS A;  4U7B A;  3J7A Y;  2CFO A;  4BQO A;  2K9L A;  4XOR A;  1MND A;  1WJF A;  2LG4 A;  4F92 B;  2MYS A;  2CH0 A;  2OUM A;  1SAU A;  3OYA A;  3AL0 B;  3OYC A;  2JUG A;  2BW3 B;  2XSJ C;  4NC8 A;  4XKW A;  4PSX A;  4U87 A;  4YEL A;  5KNL A;  1WFX A;  2WY7 Q;  2LRE A;  4E7K A;  1BR4 A;  3A1Y A;  2WB1 A;  5CPR B;  4ZTJ A;  2MFZ A;  2IGN A;  2MC4 A;  4CCL A;  4KIS A;  2HPM A;  3DLA A;  1WJ5 A;  5LD2 C;  2HPI A;  3FHN A;  4BUP A;  3IP4 B;  1E0E A;  4BL0 B;  3ONQ A;  1G8X A;  3EPZ A;  2IS2 A;  2KLO A;  2VJI A;  2M0M A;  3H0D A;  3FBN B;  4XN0 A;  1MMG A;  2E5N A;  4RLF A;  3V42 A;  4HSR A;  3C2G A;  2E5Z A;  5HNH A;  3W3C A;  2MAB A;  2JA2 A;  3NWT A;  3ZGK A;  2L7K A;  2FUG 2;  1D0Y A;  2R7X A;  1D1B A;  2F6C A;  4RMN A;  2W7N A;  4E7L A;  3UNG C;  4ZDO A;  3CJQ B;  1PJR A;  4XR6 A;  4LIT A;  4CCK A;  4XQF A;  4PFP A;  3PNY A;  2XAU A;  3H5A A;  2WBM A;  4Y3O A;  4XL9 A;  4IZZ A;  2RRE A;  3BLY A;  4E6K G;  2HDW A;  3RSN A;  3OY9 A;  3K10 A;  4LG3 A;  2XF5 A;  4OAZ A;  4BAC A;  2QKL B;  2LYC A;  2UUZ A;  4HNU A;  4XNF A;  1X4P A;  3PUB A;  4C2U A;  4PSW A;  2R7V A;  3H5R A;  3HOS A;  2W1O A;  2KP6 A;  2LOO A;  2LRD A;  1BR1 A;  1OLT A;  2L9N A;  4XON A;  1LDK B;  4X0G A;  2XF7 A;  1D1A A;  2L2O A;  3BCB A;  2VJJ A;  1FMW A;  4HEA 2;  3PSI A;  4DGW B;  1OR7 C;  2KHM A;  1WJC A;  1WJE A;  4R79 A;  2P0W A;  3SYT A;  2X6W A;  3DPL C;  2CV1 A;  3LL7 A;  2PMZ A;  2LBF A;  4ZC3 A;  3RPU D;  3RTR A;  2M4K A;  3G2B A;  3K4L A;  3DEE A;  1MMN A;  4LIU A;  3LSH A;  3PFY A;  3I9V 2;  4G6T B;  4B44 A;  4GRI A;  4XLH A;  2IS6 A;  3MD2 A;  4QPO A;  2Y0S A;  2V26 A;  3HC7 A;  3DPT A;  1NG6 A;  2Q1Z B;  2X1C A;  1D1C A;  4BXF A;  4XLA A;  1X1D A;  3CJR B;  4CCO A;  3H9G A;  2RNG A;  3K4B A;  3ZR8 X;  2LY2 A;  3KX2 A;  3DTK A;  1T95 A;  1ZEL A;  2KDO A;  3OYE A;  1AA7 A;  5FRO A;  2VKD A;  2CW7 A;  4KIT B;  2DJI A;  4BDY A;  2DT6 A;  5LFA A;  2R7T A;  4BE2 A;  1QHH D;  4LIV A;  2DT7 B;  4JOM A;  3KYL A;  3RCO A;  2V4J C;  3ZRG A;  3HL2 A;  5FRN A;  3H9Q A;  4PFO A;  3HXL A;  3CES A;  2UWM A;  1U0J A;  3DTE A;  1X1B A;  1DGR M;  2LC2 A;  4BJ6 C;  4ZDL A;  3OYF A;  3CF2 A;  2AQF A;  2IGO A;  2X1D A;  3N05 A;  3E1S A;  1R6R A;  1S9H A;  2KMU A;  3BG6 A;  3IAS 2;  2LBF B;  3HOT A;  4C2T A;  4XLC A;  2VXZ A;  2WAF A;  3DKY A;  2R7S A;  2VPL A;  2X6X A;  2Z16 A;  2VL8 A;  2DOA A;  1YE9 A;  5CQE A;  2L9S A;  4CCJ A;  2GOX B;  1MW7 A;  3K4M A;  2O5R A;  3W2A A;  3F9K A;  1J09 A;  1NG7 A;  4XMY A;  4E7Z A;  3OYK A;  1ERD A;  1SFK A;  1LKX A;  2VXD A;  4B47 A;  2CUZ A;  4AYB A;  3EUH C;  5JHF A;  3LSG A;  2WY8 Q;  4BE0 A;  4ITV A;  1P9Q C;  2WA0 A;  2F5V A;  3DTI A;  1FMV A;  2HZD A;  1Z3Y A;  4B48 A;  4BEH A;  3D5R C;  3OR2 C;  3BG7 A;  3S3N A;  3SDB A;  3CMM A;  3OS1 A;  3MKZ A;  4IQ4 A;  3TL4 X;  2JVH A;  2V9K A;  1YX3 A;  4BQQ A;  3CP8 A;  3LFU A;  5HOO A;  1WJA A;  3QYB A;  4PJN A;  3MMY B;  3M8J A;  4F93 B;  1DGW Y;  3H35 A;  2VQG A;  3DPU A;  4NNJ A;  1VZ0 A;  2IGK A;  2DXI A;  4BS9 A;  4XOP A;  2R7O A;  2M7B A;  3OS0 A;  2VJ5 A;  4PJM A;  2OC6 A;  3U21 A;  1Z21 A;  2KZV A;  2R7W A;  4JQF A;  4CZC A;  4P1W A;  2A5W A;  4CCM A;  2PJR B;  4DOZ A;  2V7F A;  3FBI B;  3VWB A;  4ZDP A;  5HNF A;  3GBG A;  5HLT A;  3ZCO A;  2NOJ B;  3A2K A;  1K6Y A;  3QOD A;  4XM3 A;  1GLN A;  2IGM A;  3AFH A;  4II2 A;  4B3X A;  3K4C A;  4OWR B;  3QOE A;  1UAA A;  3NWS A;  1LVK A;  4E7I A;  2V6E A;  3K4J A;  4XLF A;  4FET A;  2E60 A;  3K70 C;  3L2U A;  3FDY A;  2F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...