3K10A

Crystal structure of telomere capping protein stn1 from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
170
Chain Sequence
TSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDSGILLHLEYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein STN1
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 55
structure length 170
sequence length 179
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12659 Stn1_C Telomere capping C-terminal wHTH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A01
1.10.10.1090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A02
3K10A 3KEYA
chains in the Genus database with same CATH superfamily
4ZZLA 4HV5A 3A0BC 1BC7C 1I39A 1S9HA 2QQ9A 5DUKA 4BHBA 2DOEA 3JW4A 2HWVA 1YYVA 2ZJ2A 5HDGA 5J3LA 2OTLI 3FK6A 1SFEA 5IP9J 5CVVA 5JI6A 2DMUA 4XLEA 1FBSA 3KEOA 2IXSA 1T6SA 3B6CA 1MMAA 3JRHA 3CUQB 4R79A 1FJLA 1FZPB 2E5NA 3MKWB 4XN3A 4L9NA 1VNDA 5ICCA 1T0FC 1GXQA 2Y69H 5FRMA 1D0XA 1HKQA 3W2VA 4HG2A 2X1EA 1XB4A 3S2DJ 4PUSA 2VPLA 1OISA 2E19A 2HQNA 3QPHA 4A3BJ 4W1UA 1LB2A 4KT5C 1QVTA 1D0YA 1FMWA 1OYYA 1KGSA 2LREA 3GTLJ 1N77A 2IJLA 1W5CC 2QVOA 2BOLA 2WADA 3BTIA 1GV2A 2JA2A 4Y17A 3PNVA 4XL9A 4L0YB 1SC7A 1MSFC 1LFBA 4LOCA 4YRVA 3ABTA 3CC4I 2VJ4A 3ZQCA 3KFWX 2QQ8A 1X4PA 4ZTFA 5EEGA 4MHGA 4NC7A 3CUOA 2JVHA 1G8XA 2XDVA 2K27A 3L09A 2VBXA 2ICWG 3V7CA 4OAZA 4CZCA 1DUXC 2W00A 2AQEA 1FIAA 4UUSB 3LA3A 3GTOJ 1FBUA 2EZHA 2KJBA 1J2XA 4YIFA 2PMHA 1BI3A 4CCJA 3ZOBA 1TZLA 4QPQA 2DPDA 3U1DA 2M87A 2X51A 4BBRJ 4P9UA 2XSJC 1J09A 4L5IA 2BGCA 2ACJA 3BZKA 1CQTA 5KCMA 5FD6A 2XB5A 4IHWA 2Y0MA 3TQNA 4Y33A 2WV0A 5ICGA 4AUXA 1PDNC 3Q0UA 3PFIA 4PZJA 4EVIA 2DA7A 4C3HJ 5E20A 4IEJA 3GWZA 1YLFA 4LFUA 2IGNA 2DFHA 4KISA 4EM0B 1RPWA 1HLVA 2ISZA 4HAMA 2IS6A 4KYWA 4XLCA 3FBIB 1TLHB 4HF0A 2L01A 3CUQA 3FIWA 4WXCA 2K9LA 2EFQA 1JKQC 4RB3C 3E6BA 2OPTA 3OYNA 1A36A 2NYXA 1VZ0A 3GTGJ 4U87A 2K4JA 3K4NA 1TQIA 2DO7A 2HOSA 4HEA2 2Z33A 3OR2C 2PBIA 2W48A 3HTSB 1Z3YA 5EG0B 2LKXA 3KE2A 1U0JA 3HUGB 2VQGA 4BXFA 1QZYA 4D5FA 2WAEA 5FRNA 2XKOA 1P2FA 1UHSA 2LY2A 4D7NA 1KYZA 2ECBA 4YEJA 3L2RA 1QPIA 4M73A 2ZNZA 4B4CA 2XRLA 5L3GA 4I0AA 2HZTA 2ETHA 1YW8A 3HM5A 4MEXF 4EJUA 1XSDA 3JR9A 2ELKA 4KMFA 4UUSA 5H20A 3TOAA 5ILSA 5D4RA 3S8PA 3GLXA 2BY0A 3K4BA 5CVJA 1DDNA 2IA1A 3DKWA 5GAHJ 2M1BA 2DDBA 1X3WB 4CXFA 2ECCA 2LYCA 4MO7A 4AU7A 1DQUA 2KISA 3DEUA 3EPZA 3RCOA 3JRIA 3JTGA 3VOEA 1S72I 3BR0A 1TL8A 1J59A 1KU7A 3DF8A 3WTTC 3BTCA 2QLZA 4Y7NJ 1VQ9I 1WVRA 1O7FA 5B3SH 1Z0XA 3I64A 1WJEA 2IGMA 2NVXJ 3BZ6A 3ZMUA 1ZK8A 1FIPA 3WHBA 3SJMA 3VB2A 1YRNB 3MVPA 2WV1A 3LSTA 5DCMB 3LA2A 1IXSB 1STZA 4OWRB 1ON1A 3DLAA 2DN0A 3K1NA 3RKXA 2KHMA 1V54H 3I59B 1ULYA 4I7HA 5EJCA 4NNJA 5CVIA 3OYEA 4HLXA 1RNLA 4HX4A 4BHPA 2KFDA 2XGDA 2W84A 3FXLA 1HBXG 1BW5A 3BR5A 5TJJA 1FT9A 4KN7X 1TT5B 3BG7A 3H5NA 3QPTA 3EUHC 3HUGA 4IHVA 2XRNA 4UVCA 1IN5A 4O5VA 4ENKA 2M9HA 3RZOJ 4IRHA 2Q1ZB 2VE8A 1YG2A 1FSEA 4ZH4F 2MC3A 4HYEA 4MTDA 3IC7A 5GADJ 2BW3A 2VBYA 5HS9A 4E7IA 1KQ8A 2GLOA 1J75A 2HNHA 5LBQA 4PSWA 3AL0C 4AWXB 3AFHA 1NK3P 4HW0A 2QA4I 3BTJA 2Z9OA 2K3PA 2TCTA 1ZGJA 2W4SA 4PDKA 2CGPA 2FNPA 3WTZA 4L5EA 2EA2A 3EYIA 2P8TA 4Z6YA 3VODA 1QBJA 1X1DA 3JRDA 1X19A 2M8EA 2XPUA 4BE0A 2GZWA 5IYCJ 1YIJI 2FE3A 1D0ZA 2K3FA 1LNWA 4I01A 2R7UA 3H5RA 5D8LB 3BJ6A 3LAJA 2O8XA 4HOBA 4GRIA 4M3EA 4DNCA 3F6OA 3I59A 4FTHA 2FQ4A 2KMUA 1ETYA 5E1XA 3J81K 1MMGA 3RKQA 1R4NB 3RJPA 3F8MA 2D2WA 3RZDJ 2KIFA 5BOXA 4LGWA 2HU9A 2IPQX 3ISPA 1J7KA 1P92A 1YOVB 3TP0A 2R5YB 3C2HA 2DK5A 1U8RA 3G4SI 2HDWA 3LNQA 2X85A 2ZJRF 4IRIA 3OR1C 4XKBA 3KP3A 1A35A 5F1RA 1UJ8A 3H9GA 1RC9A 1GV5A 2DA6A 4CCLA 3OYGA 1BI1A 1MBKA 2EV5A 4XLPF 2VT3A 2EZKA 3IKVA 3DV8A 1FNNA 2EH3A 3I58A 1UG0A 2DJIA 3ABUA 2XGEA 3R60A 1WJ5A 2E71A 1H8AC 5KVRA 1YJ9I 1NH3A 2R7VA 5FKMA 3M8FA 4OOIA 3HSEA 5FLMJ 3P9CA 1C0WA 3QPSA 1VF9A 1TNTA 1HW2A 9ANTA 3ZRGA 2WTEA 3N97A 1T38A 3GO5A 1LFUP 3FXJA 2UUZA 3NQOA 2EIMH 2JUCA 4BE1A 4A0YA 4A2UA 2CO5A 1TQPA 2K9QA 1MSEC 2NNNA 4ASNA 2LR8A 3FWEA 2YX7A 3CP2A 2XGXA 3J7YJ 4EJTA 2JSPA 3BQZA 3ASNH 3DEEA 3CCJI 3HGGA 5J1UA 2P4WA 3G3ZA 1P6RA 3IWFA 3RSNA 3G71I 3CF2A 3SDBA 3F21A 3CLQA 3TBIA 3WU0A 4N4NB 1OJLA 2KT0A 3U2RA 5DM7F 1V5GA 3OYDA 1I6XA 1HDDC 2A05A 2FJ1A 1TP4A 4DYCA 2VQCA 3RKWA 5TRDA 1ORKA 2PI0A 3ZMTA 3DPTA 1FX7A 3KYLA 1WWXA 1ZHFA 4B3XA 2QF7A 3KLNA 4MGRA 2VKDA 1S5LC 2R7OA 2HVSA 3GFIA 4MNUA 5M3MJ 2IVMA 5E8GA 3H36A 1I50J 3J81Z 2LSOA 3I3LA 5K7HA 2O61A 4WK8F 3FBNB 5LHGA 4RB1A 3JRCA 1WZ2A 4UXNA 2JMWA 4BJ6C 2HYFA 2K86A 2V7FA 2WWYA 2E2JJ 1VI0A 1S8NA 3E0JB 3CCLI 3WU2C 3KIOA 1LDJA 2XGCA 1MNEA 1Z6RA 2G7UA 5CYVA 5F0CA 4RB2C 3LSKA 4Z2YA 3WTVC 1WJDA 2H27A 4CO8A 3N05A 3CD6I 2DODA 5E3NA 3MCZA 1RR7A 3PJRA 2M34A 3JREA 2E1OA 1TWHJ 3H9JA 2HZDA 5J47A 3PO3J 2CV1A 1IUYA 4MQVA 3M1EA 1I1SA 4KFCA 3IWZA 4RB0A 4AVPA 1S6LA 2LD5A 4PJMA 1I5ZA 1ON2A 2H8RA 2EQRA 3FZVA 2OZ6A 3GXOA 1TC3C 3OS0A 2KQRA 2NAZA 1M1EB 3BJOA 4JX5A 2OBPA 5C4XJ 2K9SA 1ZARA 1N75A 3BPXA 4U0YA 5LD2C 3CJNA 2GXGA 4OMZA 1DU0A 2OC6A 2GM4A 4P55A 3BTLA 1JUPA 3DKXA 3QRFF 4AVZA 1J5YA 1IGNA 3E3VA 2ZXHA 3R0AA 2DAOA 2IGOA 4FE4A 3Q0VA 3LSGA 3GTPJ 2GIVA 1APLC 4RA2A 2DLLA 4KDPA 3IAS2 3GTQJ 2VXZA 1SANA 2LBFB 3VDXA 1V5FA 2WY7Q 1LDDA 3GBGA 2EILH 2Z16A 3SFZA 3CCSI 3QOEA 1JHHA 4N4OB 4RLFA 3VEPA 1MDMB 3FXOA 4XOTA 3GTJJ 1VQOI 2YR2A 1FLIA 2RQPA 2DCEA 2XV4S 1XD7A 4BXUA 5D8KB 1BW6A 1SAXA 2AS5F 4LK0F 3BOQA 2X6YA 2E36A 4IRGA 3F3XA 1T8IA 2DU9A 2I10A 4UVAA 2E1MC 3H1CA 1CGPA 3GMEA 3T8TA 5LGTA 2VQLA 2X6OA 2DT6A 3HOXJ 3R6SA 1UFMA 1S3JA 2GOMA 4PGHA 1WGXA 5K5RA 1YX5A 1J9IA 5AONA 1Y0UA 2F5CA 5JR3A 2CG4A 2QSGX 2MD5A 3LSPA 2XF5A 1V4RA 4G7ZF 1TWCJ 4G9YA 1WH5A 3KCCA 4MQ9F 5FJ8J 4Y3OA 3FK7A 2QBYA 2M7AA 2OCCH 4XMYA 2MYSA 2DTZA 4P96A 3GEZA 3SZTA 4DQ2A 2HQAA 4EJVA 1BA5A 3TGNA 1LUJB 1BM9A 1E17A 2IEKA 1YX3A 5HLIA 1FTTA 3M8JA 4RGSA 1X58A 1MBJA 3GYHX 1PP7U 1ZLKA 2LC2A 4I02A 3CC7I 1YJWI 3MQ0A 5AIQA 2A07F 1ZELA 3DTKA 1R1TA 1E3PA 2AO9A 4BY7J 2HOTA 3EDPA 2OAZA 3HKZN 2HGCA 5EEHA 1FEXA 1W7PA 3V4GA 4C3IJ 3PUBA 2ADUA 4M3DA 4GYGA 4HSRA 2AXTC 3MKLA 2XAQA 4GGGA 4C2UA 4XQFA 3VSKA 5E3OA 2ZXIA 2L02A 2J5PA 4N9IA 5HNFA 4GO1A 2TRTA 2I8DA 3NWTA 4I09A 3BT9A 4Q47A 2O5RA 1WSUA 4BHCA 4F91B 3W6JB 5LLQA 2K7LA 4J01A 4A6EA 5CVRA 3IRQA 2XAJA 1BOBA 5F0HA 1BJAA 4LB5A 4BGDA 1IO2A 1ZGAA 1JTYA 2QGUA 1IRGA 4IHTA 1SD7A 3CMYA 3S32A 2R7SA 1WPKA 4G94A 1REPC 4A3LJ 2WAFA 5EEAA 5J1YA 3TW7A 1JHFA 3FM3A 2VC0A 3WHCA 1JGGA 1IG7A 3BR6A 2ZMEA 3ASOH 1U5TA 1ZLJA 3ABMH 5HLHA 3EUKL 1WI9A 4XRMA 3N4MA 2PJRB 3H92A 2NVYJ 3HKZA 3OIOA 5A2QK 2F2EA 2VKHA 4LLLA 5D6FA 3H35A 2RN7A 3FXUA 3AG4H 5K7FA 1PJRA 1BC8C 3BY6A 1ZREA 4XLNF 4A3JJ 5HODA 4IJAA 3CCVI 3M8EA 3WTSC 1XGNA 3VYUB 5ERIA 1EA3A 2EZIA 4A5MA 1KONA 1JUMA 4DW6A 4ESFA 3QAHA 2OF7A 1MW7A 4EATA 5KHDA 4LG0A 3WE2A 2VJIA 1NG6A 2QWWA 4DBRA 3CO6C 1OCZH 2MD0A 3DBHB 4RDUA 3E97A 4NQWA 3OWTA 1BR2A 2CS3A 1O7LA 1I1GA 5HLTA 4E7LA 4IHXA 4S0HB 3HOTA 3HZJA 3MKYB 2F48A 1O3TA 4CCNA 3K4KA 3T8RA 2KIUA 1ZQ3P 1YO5C 3A02A 3PIPF 1OR7A 4IOCF 1VTNC 3H0GJ 3UKGA 3HTUA 1LE8B 2BE5F 3KP6A 4Y4RA 3DQVC 1H9GA 4CICA 2HEOA 3HDDA 3OOUA 5FB2A 3OS1A 2Q2EB 2R5ZB 5F04A 4L18B 1GT0C 1UHWA 2Z1DA 1AKHB 2N8GA 1R1UA 2XPWA 3BR3A 1ZR4A 3ZXSA 2QEXI 4A3FJ 3S1QJ 4YIRX 4BDZA 1WQ2A 4FCYA 2MGQA 4BAYA 3J7AO 3KYDB 4AC0A 4FETA 1W7PD 1MNDA 1S7AA 4A3GJ 4EEFG 3O8GA 4JX6A 5C44J 1U9NA 3OYIA 2R7QA 2XSDC 4BDYA 1RETA 3A1YA 3OL4A 4XKWA 2LVSA 2UXNA 3K1PA 5J8CA 1AOYA 2L7FP 2W25A 2W82A 4O6JA 4D5CA 3S14J 1XPXA 4PJJA 3RIRA 1JT0A 2WY8Q 2EFWA 4E7JA 3KP5A 2CW0F 2ZMEC 1U5TC 1LFPA 3HOVJ 2ZJQF 1YS6A 1HW5A 3KP2A 4XLHA 3PFYA 4V2FA 5ED4A 3HPHA 1UAAA 2JPCA 1DP3A 1XGMA 5A2QZ 2DMPA 1R58A 5HNHA 4ZZDA 1X2NA 2KKOA 5ICEA 3HPGA 2VBZA 3IKTA 2VC1A 3MZHA 1AHDP 3PL8A 3LAPA 1GLNA 2DTRA 3KZIC 2HYGD 4HV6A 4FASD 1KZHA 3Q5FA 4BJTA 2RNGA 1LE8A 1UZCA 3C18A 2FXAA 5L3EA 1QVUA 4HNTA 4ITVA 3AG2H 2L4MA 2W85A 3QWLA 2VPRA 2Q2EA 3ZMZA 3NRVA 1YFHA 1TT0A 3D5RC 1RRJA 1E2XA 4XKCA 5IP7J 1AKHA 1L0OC 5K5QA 2GBYA 1IXCA 2B63J 1ETWA 2Z5UA 4UB6C 1MNMC 3JRGA 1QRYA 4HX7A 5M3FJ 3S1RJ 4ZDLA 3SDGA 4PFOA 3LSJA 3K0LA 5BPIA 4LLNA 3F22A 4RGUA 4BEHB 4DJAA 1OR7C 2RQQA 5EYRA 3BQYA 1JKOC 4A12A 1W36C 4II3A 3K10A 5L3CA 4A3KJ 2P81A 4ENJA 3CF5F 4NHJA 3FXKA 2OJED 1B1BA 2EA4A 2NOGA 3ESWB 5FKOA 3TL4X 1JXSA 1YHQI 3ZGKA 1BOAA 1W36D 2M8GX 1P7IA 3IH4A 2CU7A 3OSFA 2CUZA 2EINH 1K6OA 3VYTB 1XCBA 1ETXA 5FKKA 3SXYA 6PAXA 3MD2A 1Z1DA 2IA0A 4A6DA 4RAZA 1YIOA 1E3HA 1T2KA 1S7EA 1TWFJ 4UY8I 1XSXA 1W5SA 2A68F 4IQ4A 2M4GA 2COMA 3FF5A 4B47A 3IRRA 3KEYA 3HOSA 1MMSA 2XPVA 4EJOA 2LDUA 4Y13A 2XVCA 1SMYF 3QOPA 1XG1A 1BI0A 3FKIJ 4LITA 4XN0A 3PIOF 1K4SA 2LG4A 3W6KB 2DW4A 4U7DA 3PO2J 2ESNA 1R1VA 2F5EA 1B59A 5JHFA 2P6SA 4AD9A 3ZCOA 2H1KA 3TKYA 2HDCA 3C2BA 2E2IJ 2NVTJ 5FROA 2VL8A 5DYMA 1R23A 1B9MA 2M45A 1BI2A 3HXLA 3CJQB 3R61A 4IF4A 2RNJA 3A4CA 5J4VA 5EG0A 4M6XA 5IOZA 3H0DA 2O6GE 4F55A 4L0ZB 3RYPA 3QP6A 4GXOA 5BMZA 5DTDA 3LSMA 2K02A 2P5KA 2XAFA 2LFBA 4IOAF 4ESJA 4BEHA 2RAEA 3FXMA 2CRGA 3ZQ7A 4N0BA 2JRTA 3CUQC 4ON0A 2DMQA 2A6HF 2XIGA 4UUVA 4I2OA 4KNYA 3AG3H 2MH2A 3LFKA 1TTYA 1D8JA 1D1BA 3K4JA 5GAEJ 1R71A 1LJ9A 3V7SA 4DZJA 4EV0A 1VQNI 2FOKA 2XHKA 3CCRI 3GTKJ 2MSYA 5DS9A 1BIBA 3PM1A 1OFCX 1ETKA 1X2MA 3E7LA 4RLQA 3TDUC 4E6KG 3ZMSA 1GUUA 3ULQB 3BLYA 4YG2F 2DQRA 3DTIA 1P7JA 4MLOA 2TDXA 1YRNA 2L9VA 5DV5A 1OKRA 1XTAA 5DCMA 2VBWA 2YU3A 4OINF 2AQFA 1A31A 2R7RA 2A5WA 3V7RA 1WFXA 2EV0A 3RDIA 5B5EC 2FSWA 2RVCA 3K7AJ 4RM2A 1O3RA 1WJAA 2FNAA 5H6RA 3CZ6A 1D1CA 2RGVA 3WE3A 2XROA 1I27A 4HDVA 2STWA 2E60A 1IRXA 1LVAA 1CF7B 2OQRA 2M5WA 1F5TA 1Z67A 1UHMA 1OCCH 3L2VA 2V1UA 3R4KA 3RQ4A 4JK1X 1T95A 2UXXA 3MZ8A 4PCQA 1HDPA 2B7EA 4CUGA 2OU2A 5IT3A 1SFKA 5M5XJ 4A3IJ 2O03A 3K2AA 3K1MA 1BJZA 2PMZN 2GWRA 3WG9A 2VASA 1ONVA 3QYBA 4E7HA 2LNBA 1KU3A 3JTHA 2CFXA 5CLSA 2J5OA 5D5XB 2DBBA 1DPRA 2FA5A 5DUIA 3BCAA 2NVUB 3ERMA 4LK1F 3M07A 3P5JA 3IH3A 5JVTA 2VE9A 4EM1A 5DEQA 2M30A 3WGIA 3IP4B 3BG3A 4LMYA 2A6EF 3M1CA 3S1MJ 3HRSA 4MTEA 2W1OA 2KDOA 1XMXA 5KNLA 2ZXWH 5KAFC 1IN6A 1LEAA 4CCKA 3F8CA 4B1RA 1IDZA 4JQFA 3ZQQA 3KETA 4CCOA 2PN6A 4IHYA 2EFNA 2MABA 3CP8A 4UNOA 4QWQA 4R8HA 2K85A 4XRSA 1IV8A 1NHAA 3A01B 3J7ZI 1R7JA 1B6AA 2HS5A 5DDGA 5EZHA 4AYBN 1ZYRF 3W6VA 4C30A 3KX2A 1VQ8I 3VWBA 2IP2A 1RIOH 4FT8A 5FLXK 3M9AA 4BQAA 4XK4A 2PMZA 2X48A 3E1SA 3ROUA 5E79C 4F93B 2X6WA 2HPIA 2VXDA 4LIVA 1RR8C 2DA5A 1WCMJ 4HF1A 5D5UB 1MH4A 2ISYA 3H3UA 4Q48A 4FX4A 4IO9F 5CJ9A 2R5YA 2ESHA 3FMQA 3KLOA 4D7MA 1VQ7I 4L5JA 1FYLA 2P7VB 1Q1VA 2L4AA 4HSTA 3OL3A 2MBFA 2FU4A 1R9TJ 3GUDA 1AWCA 3LSIA 1SD4A 3F8NA 3CO7C 1KA8A 1VQ5I 4PSXA 4Q4ZF 2OD5A 2EFPA 2ZNYA 1EKEA 2PX9A 2YS9A 3CDHA 4G6TB 5IPAA 5CPRB 4HDUA 1FYMA 2BV6A 2MG4A 4QLCU 4AYBA 2HVRA 3EUAA 2PJPA 3GZ6A 3A0HC 1IRFA 3SEZA 2EB7A 1D1AA 1WJCA 5LGNA 3F0CA 3FXQA 2VKEA 4XKVA 1ERDA 5M5YJ 3B02A 5BS6A 1KQ9A 1UELB 1TW3A 3K9TA 3CMAI 3DP7A 4B3AA 2ZXJA 2HFHA 2IT0A 4BS9A 1K83J 2VB6A 4RS8A 3IL2A 2M0CA 2H94A 2E5ZA 2W24A 3IUOA 2HTSA 3E6CC 3A01A 2CUJA 3X2QH 2VIXA 1V5EA 2W57A 4ZJZA 2YUSA 4UUTA 3KEQA 3I4MJ 3WTXC 1W1WE 4UHTA 4CYDA 1MBHA 1FTZA 2NS8A 3KP4A 1D8KA 4NUBA 3CESA 2E34A 2OA4A 4YFKF 3J7AY 4BBSJ 4CYCB 4RAGA 1IF1A 2GXBA 4JOMA 2V6CA 1U6GA 4XR6A 4AIKA 1VQKI 2P7CB 4Y52J 3QU3A 5KK1A 2GAUA 5E3MA 2R93J 2VOOA 4I6ZA 5ILVA 2F4MB 1USTA 3BDDA 1FP2A 3JRAA 2O7OA 3G6EI 1Y0NA 2V9KA 1R36A 5HS8A 2E7XA 4XBFA 1ZRDA 2QM3A 4C3JJ 5HLGA 4X6AJ 1K6YA 4RAFA 4C9YA 2DDAA 3BR2A 3TDZC 1SVOA 3A03A 4CZZA 1YTYA 5FLXZ 4ZTJA 1PP8F 4OIOF 3HIFA 2BY3A 3L9FA 2VODA 3WU1B 4B48A 2L9NA 3QP5A 1QZZA 4NC6A 2OZUA 3ZQIA 4C2TA 5F0FA 3S2WA 2BEOA 4MFEA 3CCEI 3CDLA 4AIDA 2GXAA 3OYHA 3MWMA 1OLTA 1ETQA 4ZC3A 4CSWA 2BVLA 3HC7A 3NARA 5D5WB 4XIDA 4NC8A 1U9OA 2JJ7A 3F72A 3AAFA 2HXOA 2I5UA 1N78A 3K4LA 1KU2A 1VQPI 1R5GA 1YI2I 1A6QA 1SD6A 5F27A 5J40A 4MIMA 2MH9A 1ETVA 1HXDA 2R7ZJ 1ZKGA 3LQQA 2R7WA 5CKTA 3CQZJ 1P4XA 4HA8A 1O3SA 4I98B 2E1NA 4CYCA 1K78B 5KAIC 3WGHA 1ITYA 2LH9A 3O6BB 4DYRA 1HKSA 2ZSHB 1LDKB 4HZFA 3PNTA 1DU6A 2EPFA 4FISA 5D5VB 3GF2A 2VJ5A 2BXZA 3GFJA 2CQKA 2JWTA 1VQMI 1R5HA 3UR3C 1MKMA 3FX3A 2ELHA 4S05A 2Y48A 3WTWC 1QHHD 4A0ZA 2KDZA 1VQ4I 1I6HJ 2K40A 1QGPA 1QQIA 2Y9YA 2CWEA 2VI6A 3KYCB 3OIQA 2BXYA 1UCRA 2FMYA 3AKZA 4CGZA 2CQ7A 5DD8A 3L2QA 1R49A 2VJJA 1RUNA 2GA2A 2LBFA 1ZR2A 1Y1WJ 2GA1A 4WWCA 1H88C 1Z21A 2BHYA 4DGWB 4XRSG 2LF7A 3CDIA 3ECHA 2BBYA 3BWGA 4E70A 1MDMA 1XCVA 4CHUA 3GZNB 1F1ZA 2JA6J 1E0EA 3F9KA 5JVGF 1SFOJ 1XMKA 2XB0X 2M3AA 2QQBA 5K7ZA 4RGRA 5FLVA 2D45A 3TMOA 4BKXA 4B43A 4WCGA 1ETOA 4F92B 2NOJB 3CCMI 1X1PA 3CJRB 5BPDA 4XONA 3W3CA 3L2UA 1D5VA 1RZ4A 2L2OA 3SZGA 5HDNA 2FF4A 1ENHA 3TEDA 1IAWA 2QSFX 1ZG5A 4WXDA 3D5LA 2CV2A 3TO7A 2K9NA 2IRFG 1JKPC 5ILUA 1BR4A 1IN7A 2JT1A 1OQYA 3M3YJ 1JT6A 1ZTRA 5L3FA 2VKVA 4MFDA 3BG9A 4J19A 1JGSA 2AXLA 2FMLA 3LOCA 2KLOA 2ZKZA 3IAM2 2PFBA 4M6YA 1TWAJ 1K79A 1VFCA 5F08A 5F1JA 5JFRA 2K9MA 4KITB 1POGA 5F64A 5J8FA 3BROA 5BQTA 3I9V2 3PSFA 3PUFA 5BNGA 2MFZA 2Y31A 4JX4A 1JE8A 2Y30A 4H4KC 4UVBA 1K61A 4ZYDA 2M0MA 1G3TA 2JVGA 2YPRA 3FKJA 3GVAA 4M3BA 4QSHA 1W0TA 2EZLA 2KIQA 5FFXA 5LHHA 2ZCWA 2UV1A 1G3YA 2F5VA 4LLGF 1Z3XA 4A69C 2Y2ZA 4XLFA 2A3SA 1VQLI 2CH0A 2VLAA 1PVEA 3QU6A 4XLAA 3DFGA 4G6DA 3COAC 2K4BA 1MBEA 1WKMA 2L9RA 3K4MA 2KRFA 2JPBA 3S3OA 3TW6A 3J80K 3MEXA 2CUFA 1IZ1A 3E5QA 3DPLC 3CLOA 4M9XA 3I55I 1ZN2A 2XF7A 1MJBA 2IAIA 2DMNA 1TWGJ 2CFOA 4XRFA 3KZYA 1XS9A 1X4OA 3I5UA 3K2ZA 1QHGA 3OIPA 2F5DA 1V55H 2RC4A 3RPUA 4DYQA 3H3VK 5DM6F 3FHNA 1RESA 3F8BA 2QKLB 1GVJA 3ZQFA 2L5QA 3JCUC 4KIBA 4ETSA 1EH8A 2QUFA 4MEYF 3U1KA 4A93J 1X3UA 1MMDA 4KUMA 5TGTA 3E5XA 1ZRFA 1QNTA 3JAMK 4ANJA 3GFLA 4G7OF 1EJ9A 2CQXA 5J1RA 3QPLA 4U0VA 2O9LA 4XOPA 2Z99A 1MMNA 2VOPA 2H09A 5B66C 2KIMA 4A0XA 4D9JA 1OCOH 2PJRA 2QCOA 3DWLE 2E35A 3P9IA 2W7NA 3JSOA 4KA4A 1HA8A 5CQEA 2CYYA 5DCFA 1BIAA 1FBQA 1XDSA 1GXPA 2A69F 1YE9A 2R3SA 5IP6A 1DPUA 3VPRA 3PQJA 2LKSA 3LL7A 4V2GA 4ZDPA 1P4WA 2K5CA 4G8XA 4F7ZA 4BACA 3AL0B 3OYCA 1IUFA 1OCTC 3G1OA 3SFIA 1W4MA 1SMTA 2YSRA 1R5ID 2ID6A 3FDYA 1Z7UA 1V3FA 2X4HA 3GX4X 1OCRH 4L9VA 1LKXA 3V8LA 1RKTA 1PUEE 1NTCA 3H9QA 3A2KA 4M74A 2Z2SB 1JUSA 2MA3A 3K4CA 1TBXA 3L2WA 1Y1VJ 2QYOA 2R92J 4GFBA 1SFXA 2CMPA 2DQLA 4XORA 3T5XA 3OSGA 3HYIA 3REOA 1YJNI 3DPUA 2PG4A 1X3ZB 2Y0SN 2ZB9A 4I0BA 3RTRA 2KZVA 2KRCA 3DCFA 2IS4A 3ZN0A 5K5OA 2IS1A 2JA5J 3V42A 3ZQHA 1QU3A 2RREA 1PYVA 3RQIA 3JRBA 3BCBA 1T08B 3GCMA 1IV6A 1U8BA 1NG7A 2Q0OA 3LA7A 5LHIA 1LPQA 2JA8J 1Y8QB 2DA3A 3HSFA 4M3GA 3J80Z 1IXRC 3SYTA 2NS7A 2NXNB 4U7BA 2R5ZA 2DPUA 5IT9K 3EUHA 2CV0A 1YS7A 3P9KA 4NB5A 4WXHA 3S93A 4L9TA 1A5JA 4Q5SF 2F4IA 3HOYJ 4HLYA 3K70C 3TO9A 1RKWA 2JK3A 3IV5A 1UMQA 5C4JJ 4B44A 4PJLA 1XMAA 2NVQJ 4B8XA 4RMNA 3C1DA 2P5VA 1HSJA 3DLLF 3RPUD 4LJZF 5B1BH 1HF0A 3K70D 4II2A 3ZMDA 2LMDA 2Y9ZA 2ZFWA 2RKHA 2O0YA 4G7HF 1FOKA 3WG7H 2FQ3A 1Q1HA 5J6XA 4UV8A 2HVQA 1Z7LA 1PUFB 2Y0SA 2X1CA 3QYEA 1X1AA 3DTEA 2QZ8A 3GLLA 3JAMZ 1G6NA 2D1HA 3ZR8X 2O3FA 2B9SA 3WGGA 4LIUA 1D3YA 1LEBA 3HHHA 2L7MP 2V26A 2LF8A 3JRFA 2L0KA 2ZO4A 1G4DA 2AHQA 4XSXF 3TOBA 2JUGA 1BL0A 5CVUA 4DZPA 1TQMA 2V9PA 1NK2P 1WJFA 3DXJF 4V19K 2HPMA 3HB9A 5F6FA 1Z05A 2FEZA 2H1LA 2BW3B 3Q0WA 2HDDA 2P0WA 3I4NJ 2DFIA 2PQ8A 1RUOA 4BUPA 5E8IA 1VQ6I 1QZEA 1X1BA 4EM2A 3L00A 4EGYA 3ELKA 4EMSA 1TNSA 2BVMA 4RGXA 3O8HA 2QKMB 4ZYHA 1G3WA 4HQEA 2OQGA 2LRDA 3TP3A 2HQ5A 1Z9CA 1SAUA 3MAJA 3E6DA 2PMUA 4ABZA 3C7JA 1EH7A 1F43A 4KIGA 3OYFA 2MLGA 1L3LA 1MIJA 2LK2A 1HOMA 4J00A 1OYWA 1U3EM 2YU9J 1JKRC 2KPMA 3AG1H 1B8IB 1ZG3A 3W2WA 4OIRF 4P9FA 1O57A 2DT5A 1N25A 2LOOA 4R1HA 2JTVA 1AU7A 1HKTA 3VFZA 2ME0A 2DMTA 1FOWA 4RAYA 1PUFA 5IYDJ 3F23A 5JLXA 3I4PA 2L9SA 3FHZA 4P1WA 3FISA 1BR1A 1G59A 5IT9Z 2BY2A 2WAQN 2ZBKA 1YW7A 4LD5A 4BE2A 3BP8A 4BL0B 3LSRA 3BZCA 4I99C 1IDYA 2V9VA 4DOZA 4E7ZA 4GDFA 3S1NJ 3D1NI 1U2WA 2LY9A 4BQOA 3K69A 2FX0A 5L3DA 3HHGA 4O3MA 1S29A 4EGZA 3EYYA 2HTJA 1FOXA 5HOOA 4CCMA 1QO0D 2G0EA 4ZYGA 2JN6A 1B9NA 3G73A 1R4MB 1R00A 1H0MA 5FD5A 4BNCA 3RKYA 2CQNA 2XAUA 5FKLA 3EETA 3DEWA 2DJNA 2A5YB 2MLKA 2Y75A 2DA2A 2FBKA 2X0LA 3OOPA 1XC5A 1J0RA 1ZRCA 3TO6A 2EV6A 3EQLF 1X1CA 2HOAA 3HGYA 3BR1A 3LFUA 4CA0A 2B0LA 2IS2A 3F8FA 3O3KA 4WX9A 2A61A 2R7FA 4S04A 3S3NA 4NBQA 1EH6A 4KICA 4BY1J 2WAQA 3R0JA 4BQQA 5K1YA 2HYJA 2F5FA 4L9JA 2BHZA 2EIJH 3Q9SA 4BXXJ 2M7BA 3LSHA 3I54A 2Q8KA 1B8IA 3ZQGA 4HNVA 3CCQI 5GPAA 5GPCA 2DOAA 3VYSB 4KIFA 1W0UA 1BBYA 3GZ5A 1BN5A 4IXAA 2QQAA 2IBDA 3ABLH 3ZQLA 4PFPA 3FMRA 2FBIA 5C3EJ 5EDNA 2STTA 2DYSH 2CQQA 2UWMA 2XAHA 1FOYA 3Q9VA 1OYIA 1XSVA 2EWNA 3K6GA 1R22A 2DYRH 2UZKA 1WRJA 3S16J 4HRIA 4HX8A 4QIWN 4A3CJ 2R7XA 2IA2A 4ESBA 2D1VA 2E1MB 1EF4A 1EV7A 4XNFA 3OYMA 4I76A 3BC8A 2FOWA 5FKNA 5J4YA 5EGOB 1ZAOA 5D4SA 3MMYB 1E3OC 1G3SA 3I0TA 3IHUA 3B6AA 1HC8A 2JRMA 2OV7A 1ZH5A 3S15J 5LFAA 3CTAA 4HBLA 1KU9A 3M4OJ 1Z6TA 4M3FA 1DP7P 4JYKA 3BPVA 1I3AA 5GP9A 2G7HA 1CF7A 2R7TA 3O2PE 2HR3A 3MZYA 3MN2A 3P7NA 3HOZJ 3HOUJ 2EBIA 5JHUA 3OYKA 1MH3A 3HJEA 2WBMA 1FWZA 4AIJA 5E17F 4ZDOA 4NDLA 3ABKH 2ME6A 4A3EJ 2CJJA 4C2MJ 5EF6A 2KP6A 3OS2A 3OYJA 3VSLA 5LRSA 2E2HJ 1HW1A 3LMMA 2ZJPF 4OMYA 1LVKA 3QODA 1T98A 1W5TA 1WI3A 3U9GA 4BH9A 2HXIA 2RV8A 4OU0A 3DBLB 3KPHA 5E18F 2QSHX 3ECOA 2HOEA 2DFEA 2FRHA 3HEFA 4RBOA 1MJ9A 2A6TA 5FGMA 4E7SA 1DGWY 4HNUA 1SD5A 4OIPF 5DD4A 4EJWA 3NEUA 1HQCA 4N9HA 3OYBA 4W97A 5FO5A 4X0GA 3IH2A 1GDTA 3FM5A 1LQ1A 2LP0A 2GIZA 4IX7A 2D5VA 5M5WJ 1S7OA 3CJTB 4FQGA 3C3WA 3HRMA 2BY1A 2HI3A 2XAGA 4TV7A 4IHSA 2P5LC 5EGOA 3G1LA 1F36A 4A3DJ 1AA7A 1Z91A 1DGRM 3SQNA 2RDPA 3OV8A 2X6XA 1H9TA 4X1EA 5GTIC 2FBHA 3L7WA 4G12A 1H89C 1YW9A 1USSA 1P9QC 3DKYA 4BQNA 2L3DA 2XASA 4WF2A 3MFKA 1O3QA 4D1QA 4CH7A 1JTXA 2ID3A 2FUG2 2V1XA 1ZGWA 4HQMA 3DBRB 1KYWA 4K2EA 3FXRA 1IC8A 1FYKA 1SVMA 5L3BA 2DXIA 4IPAA 3GFMA 1IRZA 1Y39A 1A6IA 2DA4A 4PJ0C 1F9NA 1B72B 2DA1A 3MKZA 5E3LA 3JSPA 2M4KA 1R6RA 2P6TA 3U21A 1K7AA 3HBLA 2WB1N 1SVLA 2V6EA 1K4TA 2EJRA 3Q3SA 1Y8RB 1I3QJ 2E7WA 1YITI 2E1CA 1U78A 1OPCA 1XGSA 4A3MJ 3PQKA 2C6YA 1MJAA 3LQRA 1T39A 1MGTA 2QBYB 4ZYEA 4HPQA 3BJAA 1IN8A 2CW7A 4ZYAA 3QYFA 2V4JC 3UNGC 1Y6IA 3NWSA 5EZGA 3V8KA 1FMVA 4KN4X 2EIKH 1JJ6C 2VQHA 2ZFUA 4UV9A 1IN4A 2VN2A 4M9ZA 4PK4A 2BYVE 3OMYA 2NNYA 5IY5H 2OTJI 4LB6B 4AIHA 4F3QA 2BZTA 2R4GA 2V1NA 2X1DA 4IZZA 3CCYA 4UB8C 4BU2A 2M2EA 2DOFA 2XC7A 3VYRB 2DI3A 1UB9A 3OYLA 1ZG1A 2L54A 1OCPA 2WB1A 5E1ZB 4U88A 5HS7A 1SFUA 1TW2A 2WA0A 1W7PB 4YFNF 2LY1A 3I56I 4DIQA 4YFXF 3D0SA 3RYRA 4D0PA 3CCUI 1RI7A 4OIQF 1QPMA 1ODDA 3E6MA 3B73A 3F6VA 4JP0A 4OAYA 2F4OB 3SEQA 3GW2A 2GOXB 2WC2A 2Z3YA 3V8JA 1B72A 4A5NA 4G6QA 3HL2A 3C2GA 1JI8A 3ZN1A 2H6BA 1HSTA 5H2FC 4HF2A 3BG6A 2ZSIB 2NRAC 4CDGA 3CMEI 2OCEA 2ZC2A 2L7ZA 3ERED 3HRUA 3NAUA 1KQ0A 3S17J 2ZMEB 1U5TB 2X9DA 5LRRA 1QA6A 4YELA 2IW5A 2R7DA 1MBFA 2JQ7A 3G2BA 4IL6C 4KMUX 3H3ZA 3T0YA 1IW7F 4Y15A 2QENA 2KZGA 2ELJA 1UG2A 4RM3A 2R0QC 4F52A 5AIPA 3RI4A 5FFZA 2HKXA 2JSCA 2MC4A 2OUMA 3WTYC 2JA7J 3S2HJ 2L7KA 2LLKA 5LEKA 5JLWA 3HRTA 5GTHC 4M72A 1WJBA 3LWFA 2YX4A 3ZP5A 2LTPA 1K78A 2GQQA 1FY7A 2DFFA 4GCVA 4M6VA 4LG0B 1T0FA 2COBA 3BG5A 4XICA 4H0EA 3G1MA 1D5YA 3KZZA 2EK5A 3I71A 3CC2I 2JZYA 5IOYA 2PEXA 2F6CA 4IVNA 1WHUA 2EFOA 4NQWB 3PSIA 4GYIA 4M71A 1B4AA 4IKFA 1FSHA 2O8KA 2V79A 3HG9A 3I53A 4PGGA 4FX0A 1XDUA 4YIIA 1GHCA 4QPOA 1A04A 4KT6A 4DBQA 5LEJA 5E1WA 5HVQC 5D6EA 4BJ5C 5ICFA 4KJZA 5CQGA 3CMMA 4E4HA 2CSOA 3DU5A 1FP1D 3OY9A 5TISC 1WH7A 5HDKA 1MZBA 1MD0A 3QQAA 3W2AA 4LG3A 1IJWC 1FC3A 3HOWJ 4XM3A 4BYYA 5LGUA 1OMIA 2XF6A 3D5SC 3WTUC 1FPQA 3OYAA 1Y56A 2G9WA 4JBAA 2PLYA 3L1PA 2CUEA 4ENMA 2HQRA 5H6QA 4ENNA 2DK8A 2VONA 1SEUA 3GTMJ 1T33A 5GAGJ 3S3MA 4U0WA 3ONQA 1F4KA 2MW8A 3M7GA 2VUMJ 4PJNA 5IYBJ 4EQQA 2VT2A 3RPQA 2DT7B 2CW8A 3KP7A 2HKOA 1T56A 2H6CA 4IQJA 1YQAA 2KRHA 1XX5A 3T1BA 1MBGA 4XSZF 4E7KA 2XUBA 4P5OA 1HCRA 2NS0A 3ML6A 4M9SA 1JJ8C 1XGOA 2KJCA 3ZPLA 4FE7A 2H8WA 3DU6A 2FD5A 3HSRA 1Z77A 1P4AA 3ZMVA 1G2HA 2KL4A 3FMSA 3SZPA 1GVDA 3L2CA 4QTRA 3H5AA 4B09A 4FHTA 3PNYA 5B1AH 2XKPA 4AM3A 2V1DA 1O4XA 3E5UA 2LKPA 3WODF 1ACIA 1XN7A 2IGKA 3SHFA
chains in the Genus database with same CATH topology
2HPIA 2QKMB 1S9HA 2VXDA 4LIVA 2LRDA 2GOMA 1SAUA 4XLEA 1YX5A 3OYFA 2IXSA 1MMAA 4R79A 2XF5A 2E5NA 3MKWB 4J00A 4XN3A 2KPMA 4HSTA 3OL3A 1T0FC 3W2WA 5FRMA 1D0XA 3W2VA 4HG2A 2X1EA 4Y3OA 2VPLA 4PUSA 2LOOA 3LSIA 2M7AA 4PSXA 4G6TB 5CPRB 1D0YA 1FMWA 2LREA 2L9SA 4XMYA 2MYSA 4P1WA 4AYBA 1N77A 3EUAA 2HVRA 2BOLA 2WADA 1BR1A 2HQAA 1G59A 3SEZA 1D1AA 2JA2A 4BE2A 3PNVA 4XL9A 4BL0B 4YRVA 1WJCA 1YX3A 2VJ4A 4XKVA 4E7ZA 4DOZA 1ERDA 3M8JA 4BQOA 1X4PA 4ZTFA 4NC7A 1UELB 2LC2A 2JVHA 1G8XA 2XDVA 4OAZA 4BS9A 4CZCA 2VB6A 2W00A 2AQEA 3IUOA 2E5ZA 5HOOA 1ZELA 3DTKA 4CCMA 2CUJA 2VIXA 4CCJA 1V5EA 2XAUA 4ZJZA 1TZLA 4QPQA 3PUBA 2X51A 4HSRA 2XSJC 1J09A 4C2UA 4XQFA 3VSKA 2ZXIA 4NUBA 5KCMA 3CESA 5HNFA 1X1CA 3J7AY 4Y33A 2I8DA 3NWTA 3LFUA 4JOMA 4CA0A 4XR6A 2IS2A 2O5RA 3S3NA 4F91B 2IGNA 4J01A 4KISA 1BOBA 2WAQA 4BQQA 2IS6A 4BGDA 4XLCA 3FBIB 2K9LA 2M7BA 3S32A 3LSHA 2R7SA 2V9KA 2WAFA 3OYNA 1VZ0A 4U87A 3K4NA 1K6YA 4C9YA 2DOAA 3EUKL 3VYSB 4HEA2 3OR2C 4ZTJA 2PJRB 1Z3YA 4PFPA 3HKZA 4B48A 2L9NA 1U0JA 3HUGB 2VKHA 2VQGA 4BXFA 2WAEA 3H35A 5FRNA 2UWMA 4C2TA 1PJRA 2LY2A 3L2RA 3K6GA 4YEJA 3OYHA 1OLTA 4ZC3A 4CSWA 2BVLA 3HC7A 4HRIA 3VYUB 4NC8A 1EA3A 2R7XA 1KONA 2E1MB 1N78A 3K4LA 4XNFA 3OYMA 1MW7A 4EATA 5KHDA 2VJIA 1NG6A 3S8PA 3BC8A 3K4BA 4DBRA 2MD0A 3MMYB 2LYCA 3OWTA 4AU7A 1DQUA 1BR2A 2CS3A 3EPZA 3RCOA 2R7WA 2OV7A 5CKTA 5HLTA 4E7LA 3HOTA 5LFAA 3MKYB 4CCNA 3K4KA 2LH9A 1WJEA 2IGMA 2R7TA 2ZSHB 1LDKB 3PNTA 2VJ5A 4OWRB 3DLAA 3OYKA 4Y4RA 2WBMA 2KHMA 3DQVC 3UR3C 4NNJA 4ZDOA 3OYEA 3OOUA 3OS1A 2Q2EB 1QHHD 2KP6A 2Z1DA 3OS2A 3VSLA 3OYJA 3OIQA 3ZXSA 3AKZA 3LMMA 4BDZA 1LVKA 3QODA 3BG7A 3H5NA 4FETA 1MNDA 3L2QA 3EUHC 2VJJA 2LBFA 3OYIA 2R7QA 2A6TA 4E7SA 1DGWY 1Z21A 2Q1ZB 4DGWB 4BDYA 3A1YA 3OL4A 4HNUA 4XKWA 2W82A 3OYBA 1E0EA 3F9KA 4X0GA 2BW3A 4PJJA 4E7IA 2HNHA 2WY8Q 4IX7A 4E7JA 2M3AA 4PSWA 3AL0C 3TMOA 4B43A 1LFPA 3AFHA 1AA7A 2K3PA 4F92B 2NOJB 4XLHA 1DGRM 2W4SA 3PFYA 3CJRB 4XONA 3HPHA 3W3CA 3L2UA 1UAAA 1DP3A 2L2OA 3SZGA 2X6XA 3D5LA 1X1DA 5HNHA 1X19A 4BE0A 2CV2A 1D0ZA 1P9QC 3HPGA 3DKYA 4BQNA 1BR4A 2R7UA 3H5RA 3PL8A 4D1QA 1GLNA 4CH7A 4FASD 2FUG2 4BJTA 4GRIA 2RNGA 2KLOA 3IAM2 2DXIA 2K9MA 4KITB 2KMUA 4HNTA 4ITVA 1MMGA 3MKZA 3I9V2 1TT0A 3PSFA 3D5RC 2M4KA 4XKCA 1R6RA 2MFZA 2HU9A 4H4KC 3U21A 2M0MA 2V6EA 2JVGA 3C2HA 2HDWA 3FKJA 2X85A 3OR1C 4XKBA 4ZDLA 4PFOA 2UV1A 2F5VA 3H9GA 4BEHB 4CCLA 1Z3XA 1OR7C 4DJAA 2RQQA 1W36C 4II3A 4XLFA 3K10A 3OYGA 2CH0A 4HPQA 2VLAA 2CW7A 4ZYAA 4XLAA 3QYFA 2V4JC 3UNGC 1Y6IA 3NWSA 1FMVA 3TL4X 3K4MA 3ZGKA 3S3OA 1UG0A 2VQHA 2DJIA 2ZFUA 3DPLC 1W36D 2XF7A 4PK4A 2CFOA 3OMYA 2CUZA 3VYTB 1X4OA 3OIPA 1QHGA 1WJ5A 4F3QA 3MD2A 2R7VA 2R4GA 2V1NA 3FHNA 2X1DA 4IZZA 2QKLB 4BU2A 2XC7A 2L5QA 3VYRB 3OYLA 4IQ4A 2M4GA 3HOSA 4B47A 3KEYA 1MMDA 2WB1A 3ZRGA 2WA0A 2LY1A 2UUZA 5TGTA 4DIQA 4BE1A 4LITA 4XN0A 2LG4A 4ANJA 5JHFA 4OAYA 3SEQA 3CP2A 2GOXB 3ZCOA 4XOPA 1MMNA 2JSPA 3DEEA 5FROA 2VL8A 4D9JA 3RSNA 3HL2A 3CF2A 3HXLA 3C2GA 2PJRA 2W7NA 3DWLE 3SDBA 1HA8A 3CJQB 1JI8A 3TBIA 5CQEA 3A4CA 3BG6A 3H0DA 2ZSIB 4F55A 1YE9A 4N4NB 3LL7A 1V5GA 4ZDPA 3OYDA 3LSMA 2K5CA 2VQCA 4BACA 3AL0B 4BEHA 3DPTA 3OYCA 3KYLA 4YELA 4B3XA 3G2BA 2VKDA 3FDYA 2R7OA 2HVSA 1LKXA 1D1BA 3K4JA 2ELJA 4RM3A 3I3LA 4F52A 3H9QA 3FBNB 3A2KA 2Z2SB 4BJ6C 3K4CA 2MC4A 2OUMA 2V7FA 2L7KA 3L2WA 3E0JB 1WJBA 2CMPA 4XORA 1MNEA 3LSKA 3DPUA 4RLQA 4E6KG 3BLYA 3RTRA 1WJDA 2KZVA 2KRCA 3DTIA 2IS4A 4MLOA 3N05A 2IS1A 3V42A 1QU3A 2RREA 1PYVA 3BCBA 2F6CA 2AQFA 4NQWB 3PJRA 3PSIA 2R7RA 4IKFA 2A5WA 1NG7A 1WFXA 3HG9A 3H9JA 2HZDA 4RM2A 4QPOA 1WJAA 3SYTA 4U7BA 2CV1A 4KT6A 3CZ6A 1D1CA 2CV0A 4DBQA 3S93A 2E60A 5HVQC 1IRXA 4BJ5C 4PJMA 2F4IA 4KJZA 5CQGA 3L2VA 3CMMA 4E4HA 3K70C 3DU5A 3RQ4A 3OS0A 2KQRA 4B44A 3OY9A 1T95A 4PJLA 3W2AA 4LG3A 4RMNA 4CUGA 4XM3A 1N75A 3RPUD 1SFKA 3K70D 4II2A 5LD2C 2XF6A 2VASA 3D5SC 3QYBA 3OYAA 2OC6A 4E7HA 1Y56A 2HVQA 1Z7LA 3DKXA 4AVZA 2Y0SA 2ZXHA 2X1CA 3BCAA 3QYEA 1X1AA 3DTEA 2IGOA 3LSGA 3S3MA 3ZR8X 3IP4B 3ONQA 3IAS2 4PJNA 4LIUA 2VXZA 3M1CA 2DT7B 2LBFB 2CW8A 3VDXA 2W1OA 1V5FA 2V26A 2WY7Q 3GBGA 2KDOA 4IQJA 2KRHA 2Z16A 5KNLA 2JUGA 3QOEA 4E7KA 4N4OB 4RLFA 4CCKA 4P5OA 4JQFA 3ZQQA 4CCOA 1WJFA 4XOTA 2HPMA 2MABA 3CP8A 2DCEA 3DU6A 2BW3B 2P0WA 4BUPA 2KL4A 2X6YA 4C30A 3H5AA 3KX2A 3VWBA 3PNYA 1X1BA 2E1MC 2PMZA 3E1SA 2VQLA 2BVMA 2IGKA 4F93B 2DT6A 2X6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K10 A;  3KEY A; 
#chains in the Genus database with same CATH topology
 4ZZL A;  4HV5 A;  3A0B C;  1BC7 C;  1I39 A;  1S9H A;  2QQ9 A;  5DUK A;  4BHB A;  2DOE A;  3JW4 A;  2HWV A;  1YYV A;  2ZJ2 A;  5HDG A;  5J3L A;  2OTL I;  3FK6 A;  1SFE A;  5IP9 J;  5CVV A;  5JI6 A;  2DMU A;  4XLE A;  1FBS A;  3KEO A;  2IXS A;  1T6S A;  3B6C A;  1MMA A;  3JRH A;  3CUQ B;  4R79 A;  1FJL A;  1FZP B;  2E5N A;  3MKW B;  4XN3 A;  4L9N A;  1VND A;  5ICC A;  1T0F C;  1GXQ A;  2Y69 H;  5FRM A;  1D0X A;  1HKQ A;  3W2V A;  4HG2 A;  2X1E A;  1XB4 A;  3S2D J;  4PUS A;  2VPL A;  1OIS A;  2E19 A;  2HQN A;  3QPH A;  4A3B J;  4W1U A;  1LB2 A;  4KT5 C;  1QVT A;  1D0Y A;  1FMW A;  1OYY A;  1KGS A;  2LRE A;  3GTL J;  1N77 A;  2IJL A;  1W5C C;  2QVO A;  2BOL A;  2WAD A;  3BTI A;  1GV2 A;  2JA2 A;  4Y17 A;  3PNV A;  4XL9 A;  4L0Y B;  1SC7 A;  1MSF C;  1LFB A;  4LOC A;  4YRV A;  3ABT A;  3CC4 I;  2VJ4 A;  3ZQC A;  3KFW X;  2QQ8 A;  1X4P A;  4ZTF A;  5EEG A;  4MHG A;  4NC7 A;  3CUO A;  2JVH A;  1G8X A;  2XDV A;  2K27 A;  3L09 A;  2VBX A;  2ICW G;  3V7C A;  4OAZ A;  4CZC A;  1DUX C;  2W00 A;  2AQE A;  1FIA A;  4UUS B;  3LA3 A;  3GTO J;  1FBU A;  2EZH A;  2KJB A;  1J2X A;  4YIF A;  2PMH A;  1BI3 A;  4CCJ A;  3ZOB A;  1TZL A;  4QPQ A;  2DPD A;  3U1D A;  2M87 A;  2X51 A;  4BBR J;  4P9U A;  2XSJ C;  1J09 A;  4L5I A;  2BGC A;  2ACJ A;  3BZK A;  1CQT A;  5KCM A;  5FD6 A;  2XB5 A;  4IHW A;  2Y0M A;  3TQN A;  4Y33 A;  2WV0 A;  5ICG A;  4AUX A;  1PDN C;  3Q0U A;  3PFI A;  4PZJ A;  4EVI A;  2DA7 A;  4C3H J;  5E20 A;  4IEJ A;  3GWZ A;  1YLF A;  4LFU A;  2IGN A;  2DFH A;  4KIS A;  4EM0 B;  1RPW A;  1HLV A;  2ISZ A;  4HAM A;  2IS6 A;  4KYW A;  4XLC A;  3FBI B;  1TLH B;  4HF0 A;  2L01 A;  3CUQ A;  3FIW A;  4WXC A;  2K9L A;  2EFQ A;  1JKQ C;  4RB3 C;  3E6B A;  2OPT A;  3OYN A;  1A36 A;  2NYX A;  1VZ0 A;  3GTG J;  4U87 A;  2K4J A;  3K4N A;  1TQI A;  2DO7 A;  2HOS A;  4HEA 2;  2Z33 A;  3OR2 C;  2PBI A;  2W48 A;  3HTS B;  1Z3Y A;  5EG0 B;  2LKX A;  3KE2 A;  1U0J A;  3HUG B;  2VQG A;  4BXF A;  1QZY A;  4D5F A;  2WAE A;  5FRN A;  2XKO A;  1P2F A;  1UHS A;  2LY2 A;  4D7N A;  1KYZ A;  2ECB A;  4YEJ A;  3L2R A;  1QPI A;  4M73 A;  2ZNZ A;  4B4C A;  2XRL A;  5L3G A;  4I0A A;  2HZT A;  2ETH A;  1YW8 A;  3HM5 A;  4MEX F;  4EJU A;  1XSD A;  3JR9 A;  2ELK A;  4KMF A;  4UUS A;  5H20 A;  3TOA A;  5ILS A;  5D4R A;  3S8P A;  3GLX A;  2BY0 A;  3K4B A;  5CVJ A;  1DDN A;  2IA1 A;  3DKW A;  5GAH J;  2M1B A;  2DDB A;  1X3W B;  4CXF A;  2ECC A;  2LYC A;  4MO7 A;  4AU7 A;  1DQU A;  2KIS A;  3DEU A;  3EPZ A;  3RCO A;  3JRI A;  3JTG A;  3VOE A;  1S72 I;  3BR0 A;  1TL8 A;  1J59 A;  1KU7 A;  3DF8 A;  3WTT C;  3BTC A;  2QLZ A;  4Y7N J;  1VQ9 I;  1WVR A;  1O7F A;  5B3S H;  1Z0X A;  3I64 A;  1WJE A;  2IGM A;  2NVX J;  3BZ6 A;  3ZMU A;  1ZK8 A;  1FIP A;  3WHB A;  3SJM A;  3VB2 A;  1YRN B;  3MVP A;  2WV1 A;  3LST A;  5DCM B;  3LA2 A;  1IXS B;  1STZ A;  4OWR B;  1ON1 A;  3DLA A;  2DN0 A;  3K1N A;  3RKX A;  2KHM A;  1V54 H;  3I59 B;  1ULY A;  4I7H A;  5EJC A;  4NNJ A;  5CVI A;  3OYE A;  4HLX A;  1RNL A;  4HX4 A;  4BHP A;  2KFD A;  2XGD A;  2W84 A;  3FXL A;  1HBX G;  1BW5 A;  3BR5 A;  5TJJ A;  1FT9 A;  4KN7 X;  1TT5 B;  3BG7 A;  3H5N A;  3QPT A;  3EUH C;  3HUG A;  4IHV A;  2XRN A;  4UVC A;  1IN5 A;  4O5V A;  4ENK A;  2M9H A;  3RZO J;  4IRH A;  2Q1Z B;  2VE8 A;  1YG2 A;  1FSE A;  4ZH4 F;  2MC3 A;  4HYE A;  4MTD A;  3IC7 A;  5GAD J;  2BW3 A;  2VBY A;  5HS9 A;  4E7I A;  1KQ8 A;  2GLO A;  1J75 A;  2HNH A;  5LBQ A;  4PSW A;  3AL0 C;  4AWX B;  3AFH A;  1NK3 P;  4HW0 A;  2QA4 I;  3BTJ A;  2Z9O A;  2K3P A;  2TCT A;  1ZGJ A;  2W4S A;  4PDK A;  2CGP A;  2FNP A;  3WTZ A;  4L5E A;  2EA2 A;  3EYI A;  2P8T A;  4Z6Y A;  3VOD A;  1QBJ A;  1X1D A;  3JRD A;  1X19 A;  2M8E A;  2XPU A;  4BE0 A;  2GZW A;  5IYC J;  1YIJ I;  2FE3 A;  1D0Z A;  2K3F A;  1LNW A;  4I01 A;  2R7U A;  3H5R A;  5D8L B;  3BJ6 A;  3LAJ A;  2O8X A;  4HOB A;  4GRI A;  4M3E A;  4DNC A;  3F6O A;  3I59 A;  4FTH A;  2FQ4 A;  2KMU A;  1ETY A;  5E1X A;  3J81 K;  1MMG A;  3RKQ A;  1R4N B;  3RJP A;  3F8M A;  2D2W A;  3RZD J;  2KIF A;  5BOX A;  4LGW A;  2HU9 A;  2IPQ X;  3ISP A;  1J7K A;  1P92 A;  1YOV B;  3TP0 A;  2R5Y B;  3C2H A;  2DK5 A;  1U8R A;  3G4S I;  2HDW A;  3LNQ A;  2X85 A;  2ZJR F;  4IRI A;  3OR1 C;  4XKB A;  3KP3 A;  1A35 A;  5F1R A;  1UJ8 A;  3H9G A;  1RC9 A;  1GV5 A;  2DA6 A;  4CCL A;  3OYG A;  1BI1 A;  1MBK A;  2EV5 A;  4XLP F;  2VT3 A;  2EZK A;  3IKV A;  3DV8 A;  1FNN A;  2EH3 A;  3I58 A;  1UG0 A;  2DJI A;  3ABU A;  2XGE A;  3R60 A;  1WJ5 A;  2E71 A;  1H8A C;  5KVR A;  1YJ9 I;  1NH3 A;  2R7V A;  5FKM A;  3M8F A;  4OOI A;  3HSE A;  5FLM J;  3P9C A;  1C0W A;  3QPS A;  1VF9 A;  1TNT A;  1HW2 A;  9ANT A;  3ZRG A;  2WTE A;  3N97 A;  1T38 A;  3GO5 A;  1LFU P;  3FXJ A;  2UUZ A;  3NQO A;  2EIM H;  2JUC A;  4BE1 A;  4A0Y A;  4A2U A;  2CO5 A;  1TQP A;  2K9Q A;  1MSE C;  2NNN A;  4ASN A;  2LR8 A;  3FWE A;  2YX7 A;  3CP2 A;  2XGX A;  3J7Y J;  4EJT A;  2JSP A;  3BQZ A;  3ASN H;  3DEE A;  3CCJ I;  3HGG A;  5J1U A;  2P4W A;  3G3Z A;  1P6R A;  3IWF A;  3RSN A;  3G71 I;  3CF2 A;  3SDB A;  3F21 A;  3CLQ A;  3TBI A;  3WU0 A;  4N4N B;  1OJL A;  2KT0 A;  3U2R A;  5DM7 F;  1V5G A;  3OYD A;  1I6X A;  1HDD C;  2A05 A;  2FJ1 A;  1TP4 A;  4DYC A;  2VQC A;  3RKW A;  5TRD A;  1ORK A;  2PI0 A;  3ZMT A;  3DPT A;  1FX7 A;  3KYL A;  1WWX A;  1ZHF A;  4B3X A;  2QF7 A;  3KLN A;  4MGR A;  2VKD A;  1S5L C;  2R7O A;  2HVS A;  3GFI A;  4MNU A;  5M3M J;  2IVM A;  5E8G A;  3H36 A;  1I50 J;  3J81 Z;  2LSO A;  3I3L A;  5K7H A;  2O61 A;  4WK8 F;  3FBN B;  5LHG A;  4RB1 A;  3JRC A;  1WZ2 A;  4UXN A;  2JMW A;  4BJ6 C;  2HYF A;  2K86 A;  2V7F A;  2WWY A;  2E2J J;  1VI0 A;  1S8N A;  3E0J B;  3CCL I;  3WU2 C;  3KIO A;  1LDJ A;  2XGC A;  1MNE A;  1Z6R A;  2G7U A;  5CYV A;  5F0C A;  4RB2 C;  3LSK A;  4Z2Y A;  3WTV C;  1WJD A;  2H27 A;  4CO8 A;  3N05 A;  3CD6 I;  2DOD A;  5E3N A;  3MCZ A;  1RR7 A;  3PJR A;  2M34 A;  3JRE A;  2E1O A;  1TWH J;  3H9J A;  2HZD A;  5J47 A;  3PO3 J;  2CV1 A;  1IUY A;  4MQV A;  3M1E A;  1I1S A;  4KFC A;  3IWZ A;  4RB0 A;  4AVP A;  1S6L A;  2LD5 A;  4PJM A;  1I5Z A;  1ON2 A;  2H8R A;  2EQR A;  3FZV A;  2OZ6 A;  3GXO A;  1TC3 C;  3OS0 A;  2KQR A;  2NAZ A;  1M1E B;  3BJO A;  4JX5 A;  2OBP A;  5C4X J;  2K9S A;  1ZAR A;  1N75 A;  3BPX A;  4U0Y A;  5LD2 C;  3CJN A;  2GXG A;  4OMZ A;  1DU0 A;  2OC6 A;  2GM4 A;  4P55 A;  3BTL A;  1JUP A;  3DKX A;  3QRF F;  4AVZ A;  1J5Y A;  1IGN A;  3E3V A;  2ZXH A;  3R0A A;  2DAO A;  2IGO A;  4FE4 A;  3Q0V A;  3LSG A;  3GTP J;  2GIV A;  1APL C;  4RA2 A;  2DLL A;  4KDP A;  3IAS 2;  3GTQ J;  2VXZ A;  1SAN A;  2LBF B;  3VDX A;  1V5F A;  2WY7 Q;  1LDD A;  3GBG A;  2EIL H;  2Z16 A;  3SFZ A;  3CCS I;  3QOE A;  1JHH A;  4N4O B;  4RLF A;  3VEP A;  1MDM B;  3FXO A;  4XOT A;  3GTJ J;  1VQO I;  2YR2 A;  1FLI A;  2RQP A;  2DCE A;  2XV4 S;  1XD7 A;  4BXU A;  5D8K B;  1BW6 A;  1SAX A;  2AS5 F;  4LK0 F;  3BOQ A;  2X6Y A;  2E36 A;  4IRG A;  3F3X A;  1T8I A;  2DU9 A;  2I10 A;  4UVA A;  2E1M C;  3H1C A;  1CGP A;  3GME A;  3T8T A;  5LGT A;  2VQL A;  2X6O A;  2DT6 A;  3HOX J;  3R6S A;  1UFM A;  1S3J A;  2GOM A;  4PGH A;  1WGX A;  5K5R A;  1YX5 A;  1J9I A;  5AON A;  1Y0U A;  2F5C A;  5JR3 A;  2CG4 A;  2QSG X;  2MD5 A;  3LSP A;  2XF5 A;  1V4R A;  4G7Z F;  1TWC J;  4G9Y A;  1WH5 A;  3KCC A;  4MQ9 F;  5FJ8 J;  4Y3O A;  3FK7 A;  2QBY A;  2M7A A;  2OCC H;  4XMY A;  2MYS A;  2DTZ A;  4P96 A;  3GEZ A;  3SZT A;  4DQ2 A;  2HQA A;  4EJV A;  1BA5 A;  3TGN A;  1LUJ B;  1BM9 A;  1E17 A;  2IEK A;  1YX3 A;  5HLI A;  1FTT A;  3M8J A;  4RGS A;  1X58 A;  1MBJ A;  3GYH X;  1PP7 U;  1ZLK A;  2LC2 A;  4I02 A;  3CC7 I;  1YJW I;  3MQ0 A;  5AIQ A;  2A07 F;  1ZEL A;  3DTK A;  1R1T A;  1E3P A;  2AO9 A;  4BY7 J;  2HOT A;  3EDP A;  2OAZ A;  3HKZ N;  2HGC A;  5EEH A;  1FEX A;  1W7P A;  3V4G A;  4C3I J;  3PUB A;  2ADU A;  4M3D A;  4GYG A;  4HSR A;  2AXT C;  3MKL A;  2XAQ A;  4GGG A;  4C2U A;  4XQF A;  3VSK A;  5E3O A;  2ZXI A;  2L02 A;  2J5P A;  4N9I A;  5HNF A;  4GO1 A;  2TRT A;  2I8D A;  3NWT A;  4I09 A;  3BT9 A;  4Q47 A;  2O5R A;  1WSU A;  4BHC A;  4F91 B;  3W6J B;  5LLQ A;  2K7L A;  4J01 A;  4A6E A;  5CVR A;  3IRQ A;  2XAJ A;  1BOB A;  5F0H A;  1BJA A;  4LB5 A;  4BGD A;  1IO2 A;  1ZGA A;  1JTY A;  2QGU A;  1IRG A;  4IHT A;  1SD7 A;  3CMY A;  3S32 A;  2R7S A;  1WPK A;  4G94 A;  1REP C;  4A3L J;  2WAF A;  5EEA A;  5J1Y A;  3TW7 A;  1JHF A;  3FM3 A;  2VC0 A;  3WHC A;  1JGG A;  1IG7 A;  3BR6 A;  2ZME A;  3ASO H;  1U5T A;  1ZLJ A;  3ABM H;  5HLH A;  3EUK L;  1WI9 A;  4XRM A;  3N4M A;  2PJR B;  3H92 A;  2NVY J;  3HKZ A;  3OIO A;  5A2Q K;  2F2E A;  2VKH A;  4LLL A;  5D6F A;  3H35 A;  2RN7 A;  3FXU A;  3AG4 H;  5K7F A;  1PJR A;  1BC8 C;  3BY6 A;  1ZRE A;  4XLN F;  4A3J J;  5HOD A;  4IJA A;  3CCV I;  3M8E A;  3WTS C;  1XGN A;  3VYU B;  5ERI A;  1EA3 A;  2EZI A;  4A5M A;  1KON A;  1JUM A;  4DW6 A;  4ESF A;  3QAH A;  2OF7 A;  1MW7 A;  4EAT A;  5KHD A;  4LG0 A;  3WE2 A;  2VJI A;  1NG6 A;  2QWW A;  4DBR A;  3CO6 C;  1OCZ H;  2MD0 A;  3DBH B;  4RDU A;  3E97 A;  4NQW A;  3OWT A;  1BR2 A;  2CS3 A;  1O7L A;  1I1G A;  5HLT A;  4E7L A;  4IHX A;  4S0H B;  3HOT A;  3HZJ A;  3MKY B;  2F48 A;  1O3T A;  4CCN A;  3K4K A;  3T8R A;  2KIU A;  1ZQ3 P;  1YO5 C;  3A02 A;  3PIP F;  1OR7 A;  4IOC F;  1VTN C;  3H0G J;  3UKG A;  3HTU A;  1LE8 B;  2BE5 F;  3KP6 A;  4Y4R A;  3DQV C;  1H9G A;  4CIC A;  2HEO A;  3HDD A;  3OOU A;  5FB2 A;  3OS1 A;  2Q2E B;  2R5Z B;  5F04 A;  4L18 B;  1GT0 C;  1UHW A;  2Z1D A;  1AKH B;  2N8G A;  1R1U A;  2XPW A;  3BR3 A;  1ZR4 A;  3ZXS A;  2QEX I;  4A3F J;  3S1Q J;  4YIR X;  4BDZ A;  1WQ2 A;  4FCY A;  2MGQ A;  4BAY A;  3J7A O;  3KYD B;  4AC0 A;  4FET A;  1W7P D;  1MND A;  1S7A A;  4A3G J;  4EEF G;  3O8G A;  4JX6 A;  5C44 J;  1U9N A;  3OYI A;  2R7Q A;  2XSD C;  4BDY A;  1RET A;  3A1Y A;  3OL4 A;  4XKW A;  2LVS A;  2UXN A;  3K1P A;  5J8C A;  1AOY A;  2L7F P;  2W25 A;  2W82 A;  4O6J A;  4D5C A;  3S14 J;  1XPX A;  4PJJ A;  3RIR A;  1JT0 A;  2WY8 Q;  2EFW A;  4E7J A;  3KP5 A;  2CW0 F;  2ZME C;  1U5T C;  1LFP A;  3HOV J;  2ZJQ F;  1YS6 A;  1HW5 A;  3KP2 A;  4XLH A;  3PFY A;  4V2F A;  5ED4 A;  3HPH A;  1UAA A;  2JPC A;  1DP3 A;  1XGM A;  5A2Q Z;  2DMP A;  1R58 A;  5HNH A;  4ZZD A;  1X2N A;  2KKO A;  5ICE A;  3HPG A;  2VBZ A;  3IKT A;  2VC1 A;  3MZH A;  1AHD P;  3PL8 A;  3LAP A;  1GLN A;  2DTR A;  3KZI C;  2HYG D;  4HV6 A;  4FAS D;  1KZH A;  3Q5F A;  4BJT A;  2RNG A;  1LE8 A;  1UZC A;  3C18 A;  2FXA A;  5L3E A;  1QVU A;  4HNT A;  4ITV A;  3AG2 H;  2L4M A;  2W85 A;  3QWL A;  2VPR A;  2Q2E A;  3ZMZ A;  3NRV A;  1YFH A;  1TT0 A;  3D5R C;  1RRJ A;  1E2X A;  4XKC A;  5IP7 J;  1AKH A;  1L0O C;  5K5Q A;  2GBY A;  1IXC A;  2B63 J;  1ETW A;  2Z5U A;  4UB6 C;  1MNM C;  3JRG A;  1QRY A;  4HX7 A;  5M3F J;  3S1R J;  4ZDL A;  3SDG A;  4PFO A;  3LSJ A;  3K0L A;  5BPI A;  4LLN A;  3F22 A;  4RGU A;  4BEH B;  4DJA A;  1OR7 C;  2RQQ A;  5EYR A;  3BQY A;  1JKO C;  4A12 A;  1W36 C;  4II3 A;  3K10 A;  5L3C A;  4A3K J;  2P81 A;  4ENJ A;  3CF5 F;  4NHJ A;  3FXK A;  2OJE D;  1B1B A;  2EA4 A;  2NOG A;  3ESW B;  5FKO A;  3TL4 X;  1JXS A;  1YHQ I;  3ZGK A;  1BOA A;  1W36 D;  2M8G X;  1P7I A;  3IH4 A;  2CU7 A;  3OSF A;  2CUZ A;  2EIN H;  1K6O A;  3VYT B;  1XCB A;  1ETX A;  5FKK A;  3SXY A;  6PAX A;  3MD2 A;  1Z1D A;  2IA0 A;  4A6D A;  4RAZ A;  1YIO A;  1E3H A;  1T2K A;  1S7E A;  1TWF J;  4UY8 I;  1XSX A;  1W5S A;  2A68 F;  4IQ4 A;  2M4G A;  2COM A;  3FF5 A;  4B47 A;  3IRR A;  3KEY A;  3HOS A;  1MMS A;  2XPV A;  4EJO A;  2LDU A;  4Y13 A;  2XVC A;  1SMY F;  3QOP A;  1XG1 A;  1BI0 A;  3FKI J;  4LIT A;  4XN0 A;  3PIO F;  1K4S A;  2LG4 A;  3W6K B;  2DW4 A;  4U7D A;  3PO2 J;  2ESN A;  1R1V A;  2F5E A;  1B59 A;  5JHF A;  2P6S A;  4AD9 A;  3ZCO A;  2H1K A;  3TKY A;  2HDC A;  3C2B A;  2E2I J;  2NVT J;  5FRO A;  2VL8 A;  5DYM A;  1R23 A;  1B9M A;  2M45 A;  1BI2 A;  3HXL A;  3CJQ B;  3R61 A;  4IF4 A;  2RNJ A;  3A4C A;  5J4V A;  5EG0 A;  4M6X A;  5IOZ A;  3H0D A;  2O6G E;  4F55 A;  4L0Z B;  3RYP A;  3QP6 A;  4GXO A;  5BMZ A;  5DTD A;  3LSM A;  2K02 A;  2P5K A;  2XAF A;  2LFB A;  4IOA F;  4ESJ A;  4BEH A;  2RAE A;  3FXM A;  2CRG A;  3ZQ7 A;  4N0B A;  2JRT A;  3CUQ C;  4ON0 A;  2DMQ A;  2A6H F;  2XIG A;  4UUV A;  4I2O A;  4KNY A;  3AG3 H;  2MH2 A;  3LFK A;  1TTY A;  1D8J A;  1D1B A;  3K4J A;  5GAE J;  1R71 A;  1LJ9 A;  3V7S A;  4DZJ A;  4EV0 A;  1VQN I;  2FOK A;  2XHK A;  3CCR I;  3GTK J;  2MSY A;  5DS9 A;  1BIB A;  3PM1 A;  1OFC X;  1ETK A;  1X2M A;  3E7L A;  4RLQ A;  3TDU C;  4E6K G;  3ZMS A;  1GUU A;  3ULQ B;  3BLY A;  4YG2 F;  2DQR A;  3DTI A;  1P7J A;  4MLO A;  2TDX A;  1YRN A;  2L9V A;  5DV5 A;  1OKR A;  1XTA A;  5DCM A;  2VBW A;  2YU3 A;  4OIN F;  2AQF A;  1A31 A;  2R7R A;  2A5W A;  3V7R A;  1WFX A;  2EV0 A;  3RDI A;  5B5E C;  2FSW A;  2RVC A;  3K7A J;  4RM2 A;  1O3R A;  1WJA A;  2FNA A;  5H6R A;  3CZ6 A;  1D1C A;  2RGV A;  3WE3 A;  2XRO A;  1I27 A;  4HDV A;  2STW A;  2E60 A;  1IRX A;  1LVA A;  1CF7 B;  2OQR A;  2M5W A;  1F5T A;  1Z67 A;  1UHM A;  1OCC H;  3L2V A;  2V1U A;  3R4K A;  3RQ4 A;  4JK1 X;  1T95 A;  2UXX A;  3MZ8 A;  4PCQ A;  1HDP A;  2B7E A;  4CUG A;  2OU2 A;  5IT3 A;  1SFK A;  5M5X J;  4A3I J;  2O03 A;  3K2A A;  3K1M A;  1BJZ A;  2PMZ N;  2GWR A;  3WG9 A;  2VAS A;  1ONV A;  3QYB A;  4E7H A;  2LNB A;  1KU3 A;  3JTH A;  2CFX A;  5CLS A;  2J5O A;  5D5X B;  2DBB A;  1DPR A;  2FA5 A;  5DUI A;  3BCA A;  2NVU B;  3ERM A;  4LK1 F;  3M07 A;  3P5J A;  3IH3 A;  5JVT A;  2VE9 A;  4EM1 A;  5DEQ A;  2M30 A;  3WGI A;  3IP4 B;  3BG3 A;  4LMY A;  2A6E F;  3M1C A;  3S1M J;  3HRS A;  4MTE A;  2W1O A;  2KDO A;  1XMX A;  5KNL A;  2ZXW H;  5KAF C;  1IN6 A;  1LEA A;  4CCK A;  3F8C A;  4B1R A;  1IDZ A;  4JQF A;  3ZQQ A;  3KET A;  4CCO A;  2PN6 A;  4IHY A;  2EFN A;  2MAB A;  3CP8 A;  4UNO A;  4QWQ A;  4R8H A;  2K85 A;  4XRS A;  1IV8 A;  1NHA A;  3A01 B;  3J7Z I;  1R7J A;  1B6A A;  2HS5 A;  5DDG A;  5EZH A;  4AYB N;  1ZYR F;  3W6V A;  4C30 A;  3KX2 A;  1VQ8 I;  3VWB A;  2IP2 A;  1RIO H;  4FT8 A;  5FLX K;  3M9A A;  4BQA A;  4XK4 A;  2PMZ A;  2X48 A;  3E1S A;  3ROU A;  5E79 C;  4F93 B;  2X6W A;  2HPI A;  2VXD A;  4LIV A;  1RR8 C;  2DA5 A;  1WCM J;  4HF1 A;  5D5U B;  1MH4 A;  2ISY A;  3H3U A;  4Q48 A;  4FX4 A;  4IO9 F;  5CJ9 A;  2R5Y A;  2ESH A;  3FMQ A;  3KLO A;  4D7M A;  1VQ7 I;  4L5J A;  1FYL A;  2P7V B;  1Q1V A;  2L4A A;  4HST A;  3OL3 A;  2MBF A;  2FU4 A;  1R9T J;  3GUD A;  1AWC A;  3LSI A;  1SD4 A;  3F8N A;  3CO7 C;  1KA8 A;  1VQ5 I;  4PSX A;  4Q4Z F;  2OD5 A;  2EFP A;  2ZNY A;  1EKE A;  2PX9 A;  2YS9 A;  3CDH A;  4G6T B;  5IPA A;  5CPR B;  4HDU A;  1FYM A;  2BV6 A;  2MG4 A;  4QLC U;  4AYB A;  2HVR A;  3EUA A;  2PJP A;  3GZ6 A;  3A0H C;  1IRF A;  3SEZ A;  2EB7 A;  1D1A A;  1WJC A;  5LGN A;  3F0C A;  3FXQ A;  2VKE A;  4XKV A;  1ERD A;  5M5Y J;  3B02 A;  5BS6 A;  1KQ9 A;  1UEL B;  1TW3 A;  3K9T A;  3CMA I;  3DP7 A;  4B3A A;  2ZXJ A;  2HFH A;  2IT0 A;  4BS9 A;  1K83 J;  2VB6 A;  4RS8 A;  3IL2 A;  2M0C A;  2H94 A;  2E5Z A;  2W24 A;  3IUO A;  2HTS A;  3E6C C;  3A01 A;  2CUJ A;  3X2Q H;  2VIX A;  1V5E A;  2W57 A;  4ZJZ A;  2YUS A;  4UUT A;  3KEQ A;  3I4M J;  3WTX C;  1W1W E;  4UHT A;  4CYD A;  1MBH A;  1FTZ A;  2NS8 A;  3KP4 A;  1D8K A;  4NUB A;  3CES A;  2E34 A;  2OA4 A;  4YFK F;  3J7A Y;  4BBS J;  4CYC B;  4RAG A;  1IF1 A;  2GXB A;  4JOM A;  2V6C A;  1U6G A;  4XR6 A;  4AIK A;  1VQK I;  2P7C B;  4Y52 J;  3QU3 A;  5KK1 A;  2GAU A;  5E3M A;  2R93 J;  2VOO A;  4I6Z A;  5ILV A;  2F4M B;  1UST A;  3BDD A;  1FP2 A;  3JRA A;  2O7O A;  3G6E I;  1Y0N A;  2V9K A;  1R36 A;  5HS8 A;  2E7X A;  4XBF A;  1ZRD A;  2QM3 A;  4C3J J;  5HLG A;  4X6A J;  1K6Y A;  4RAF A;  4C9Y A;  2DDA A;  3BR2 A;  3TDZ C;  1SVO A;  3A03 A;  4CZZ A;  1YTY A;  5FLX Z;  4ZTJ A;  1PP8 F;  4OIO F;  3HIF A;  2BY3 A;  3L9F A;  2VOD A;  3WU1 B;  4B48 A;  2L9N A;  3QP5 A;  1QZZ A;  4NC6 A;  2OZU A;  3ZQI A;  4C2T A;  5F0F A;  3S2W A;  2BEO A;  4MFE A;  3CCE I;  3CDL A;  4AID A;  2GXA A;  3OYH A;  3MWM A;  1OLT A;  1ETQ A;  4ZC3 A;  4CSW A;  2BVL A;  3HC7 A;  3NAR A;  5D5W B;  4XID A;  4NC8 A;  1U9O A;  2JJ7 A;  3F72 A;  3AAF A;  2HXO A;  2I5U A;  1N78 A;  3K4L A;  1KU2 A;  1VQP I;  1R5G A;  1YI2 I;  1A6Q A;  1SD6 A;  5F27 A;  5J40 A;  4MIM A;  2MH9 A;  1ETV A;  1HXD A;  2R7Z J;  1ZKG A;  3LQQ A;  2R7W A;  5CKT A;  3CQZ J;  1P4X A;  4HA8 A;  1O3S A;  4I98 B;  2E1N A;  4CYC A;  1K78 B;  5KAI C;  3WGH A;  1ITY A;  2LH9 A;  3O6B B;  4DYR A;  1HKS A;  2ZSH B;  1LDK B;  4HZF A;  3PNT A;  1DU6 A;  2EPF A;  4FIS A;  5D5V B;  3GF2 A;  2VJ5 A;  2BXZ A;  3GFJ A;  2CQK A;  2JWT A;  1VQM I;  1R5H A;  3UR3 C;  1MKM A;  3FX3 A;  2ELH A;  4S05 A;  2Y48 A;  3WTW C;  1QHH D;  4A0Z A;  2KDZ A;  1VQ4 I;  1I6H J;  2K40 A;  1QGP A;  1QQI A;  2Y9Y A;  2CWE A;  2VI6 A;  3KYC B;  3OIQ A;  2BXY A;  1UCR A;  2FMY A;  3AKZ A;  4CGZ A;  2CQ7 A;  5DD8 A;  3L2Q A;  1R49 A;  2VJJ A;  1RUN A;  2GA2 A;  2LBF A;  1ZR2 A;  1Y1W J;  2GA1 A;  4WWC A;  1H88 C;  1Z21 A;  2BHY A;  4DGW B;  4XRS G;  2LF7 A;  3CDI A;  3ECH A;  2BBY A;  3BWG A;  4E70 A;  1MDM A;  1XCV A;  4CHU A;  3GZN B;  1F1Z A;  2JA6 J;  1E0E A;  3F9K A;  5JVG F;  1SFO J;  1XMK A;  2XB0 X;  2M3A A;  2QQB A;  5K7Z A;  4RGR A;  5FLV A;  2D45 A;  3TMO A;  4BKX A;  4B43 A;  4WCG A;  1ETO A;  4F92 B;  2NOJ B;  3CCM I;  1X1P A;  3CJR B;  5BPD A;  4XON A;  3W3C A;  3L2U A;  1D5V A;  1RZ4 A;  2L2O A;  3SZG A;  5HDN A;  2FF4 A;  1ENH A;  3TED A;  1IAW A;  2QSF X;  1ZG5 A;  4WXD A;  3D5L A;  2CV2 A;  3TO7 A;  2K9N A;  2IRF G;  1JKP C;  5ILU A;  1BR4 A;  1IN7 A;  2JT1 A;  1OQY A;  3M3Y J;  1JT6 A;  1ZTR A;  5L3F A;  2VKV A;  4MFD A;  3BG9 A;  4J19 A;  1JGS A;  2AXL A;  2FML A;  3LOC A;  2KLO A;  2ZKZ A;  3IAM 2;  2PFB A;  4M6Y A;  1TWA J;  1K79 A;  1VFC A;  5F08 A;  5F1J A;  5JFR A;  2K9M A;  4KIT B;  1POG A;  5F64 A;  5J8F A;  3BRO A;  5BQT A;  3I9V 2;  3PSF A;  3PUF A;  5BNG A;  2MFZ A;  2Y31 A;  4JX4 A;  1JE8 A;  2Y30 A;  4H4K C;  4UVB A;  1K61 A;  4ZYD A;  2M0M A;  1G3T A;  2JVG A;  2YPR A;  3FKJ A;  3GVA A;  4M3B A;  4QSH A;  1W0T A;  2EZL A;  2KIQ A;  5FFX A;  5LHH A;  2ZCW A;  2UV1 A;  1G3Y A;  2F5V A;  4LLG F;  1Z3X A;  4A69 C;  2Y2Z A;  4XLF A;  2A3S A;  1VQL I;  2CH0 A;  2VLA A;  1PVE A;  3QU6 A;  4XLA A;  3DFG A;  4G6D A;  3COA C;  2K4B A;  1MBE A;  1WKM A;  2L9R A;  3K4M A;  2KRF A;  2JPB A;  3S3O A;  3TW6 A;  3J80 K;  3MEX A;  2CUF A;  1IZ1 A;  3E5Q A;  3DPL C;  3CLO A;  4M9X A;  3I55 I;  1ZN2 A;  2XF7 A;  1MJB A;  2IAI A;  2DMN A;  1TWG J;  2CFO A;  4XRF A;  3KZY A;  1XS9 A;  1X4O A;  3I5U A;  3K2Z A;  1QHG A;  3OIP A;  2F5D A;  1V55 H;  2RC4 A;  3RPU A;  4DYQ A;  3H3V K;  5DM6 F;  3FHN A;  1RES A;  3F8B A;  2QKL B;  1GVJ A;  3ZQF A;  2L5Q A;  3JCU C;  4KIB A;  4ETS A;  1EH8 A;  2QUF A;  4MEY F;  3U1K A;  4A93 J;  1X3U A;  1MMD A;  4KUM A;  5TGT A;  3E5X A;  1ZRF A;  1QNT A;  3JAM K;  4ANJ A;  3GFL A;  4G7O F;  1EJ9 A;  2CQX A;  5J1R A;  3QPL A;  4U0V A;  2O9L A;  4XOP A;  2Z99 A;  1MMN A;  2VOP A;  2H09 A;  5B66 C;  2KIM A;  4A0X A;  4D9J A;  1OCO H;  2PJR A;  2QCO A;  3DWL E;  2E35 A;  3P9I A;  2W7N A;  3JSO A;  4KA4 A;  1HA8 A;  5CQE A;  2CYY A;  5DCF A;  1BIA A;  1FBQ A;  1XDS A;  1GXP A;  2A69 F;  1YE9 A;  2R3S A;  5IP6 A;  1DPU A;  3VPR A;  3PQJ A;  2LKS A;  3LL7 A;  4V2G A;  4ZDP A;  1P4W A;  2K5C A;  4G8X A;  4F7Z A;  4BAC A;  3AL0 B;  3OYC A;  1IUF A;  1OCT C;  3G1O A;  3SFI A;  1W4M A;  1SMT A;  2YSR A;  1R5I D;  2ID6 A;  3FDY A;  1Z7U A;  1V3F A;  2X4H A;  3GX4 X;  1OCR H;  4L9V A;  1LKX A;  3V8L A;  1RKT A;  1PUE E;  1NTC A;  3H9Q A;  3A2K A;  4M74 A;  2Z2S B;  1JUS A;  2MA3 A;  3K4C A;  1TBX A;  3L2W A;  1Y1V J;  2QYO A;  2R92 J;  4GFB A;  1SFX A;  2CMP A;  2DQL A;  4XOR A;  3T5X A;  3OSG A;  3HYI A;  3REO A;  1YJN I;  3DPU A;  2PG4 A;  1X3Z B;  2Y0S N;  2ZB9 A;  4I0B A;  3RTR A;  2KZV A;  2KRC A;  3DCF A;  2IS4 A;  3ZN0 A;  5K5O A;  2IS1 A;  2JA5 J;  3V42 A;  3ZQH A;  1QU3 A;  2RRE A;  1PYV A;  3RQI A;  3JRB A;  3BCB A;  1T08 B;  3GCM A;  1IV6 A;  1U8B A;  1NG7 A;  2Q0O A;  3LA7 A;  5LHI A;  1LPQ A;  2JA8 J;  1Y8Q B;  2DA3 A;  3HSF A;  4M3G A;  3J80 Z;  1IXR C;  3SYT A;  2NS7 A;  2NXN B;  4U7B A;  2R5Z A;  2DPU A;  5IT9 K;  3EUH A;  2CV0 A;  1YS7 A;  3P9K A;  4NB5 A;  4WXH A;  3S93 A;  4L9T A;  1A5J A;  4Q5S F;  2F4I A;  3HOY J;  4HLY A;  3K70 C;  3TO9 A;  1RKW A;  2JK3 A;  3IV5 A;  1UMQ A;  5C4J J;  4B44 A;  4PJL A;  1XMA A;  2NVQ J;  4B8X A;  4RMN A;  3C1D A;  2P5V A;  1HSJ A;  3DLL F;  3RPU D;  4LJZ F;  5B1B H;  1HF0 A;  3K70 D;  4II2 A;  3ZMD A;  2LMD A;  2Y9Z A;  2ZFW A;  2RKH A;  2O0Y A;  4G7H F;  1FOK A;  3WG7 H;  2FQ3 A;  1Q1H A;  5J6X A;  4UV8 A;  2HVQ A;  1Z7L A;  1PUF B;  2Y0S A;  2X1C A;  3QYE A;  1X1A A;  3DTE A;  2QZ8 A;  3GLL A;  3JAM Z;  1G6N A;  2D1H A;  3ZR8 X;  2O3F A;  2B9S A;  3WGG A;  4LIU A;  1D3Y A;  1LEB A;  3HHH A;  2L7M P;  2V26 A;  2LF8 A;  3JRF A;  2L0K A;  2ZO4 A;  1G4D A;  2AHQ A;  4XSX F;  3TOB A;  2JUG A;  1BL0 A;  5CVU A;  4DZP A;  1TQM A;  2V9P A;  1NK2 P;  1WJF A;  3DXJ F;  4V19 K;  2HPM A;  3HB9 A;  5F6F A;  1Z05 A;  2FEZ A;  2H1L A;  2BW3 B;  3Q0W A;  2HDD A;  2P0W A;  3I4N J;  2DFI A;  2PQ8 A;  1RUO A;  4BUP A;  5E8I A;  1VQ6 I;  1QZE A;  1X1B A;  4EM2 A;  3L00 A;  4EGY A;  3ELK A;  4EMS A;  1TNS A;  2BVM A;  4RGX A;  3O8H A;  2QKM B;  4ZYH A;  1G3W A;  4HQE A;  2OQG A;  2LRD A;  3TP3 A;  2HQ5 A;  1Z9C A;  1SAU A;  3MAJ A;  3E6D A;  2PMU A;  4ABZ A;  3C7J A;  1EH7 A;  1F43 A;  4KIG A;  3OYF A;  2MLG A;  1L3L A;  1MIJ A;  2LK2 A;  1HOM A;  4J00 A;  1OYW A;  1U3E M;  2YU9 J;  1JKR C;  2KPM A;  3AG1 H;  1B8I B;  1ZG3 A;  3W2W A;  4OIR F;  4P9F A;  1O57 A;  2DT5 A;  1N25 A;  2LOO A;  4R1H A;  2JTV A;  1AU7 A;  1HKT A;  3VFZ A;  2ME0 A;  2DMT A;  1FOW A;  4RAY A;  1PUF A;  5IYD J;  3F23 A;  5JLX A;  3I4P A;  2L9S A;  3FHZ A;  4P1W A;  3FIS A;  1BR1 A;  1G59 A;  5IT9 Z;  2BY2 A;  2WAQ N;  2ZBK A;  1YW7 A;  4LD5 A;  4BE2 A;  3BP8 A;  4BL0 B;  3LSR A;  3BZC A;  4I99 C;  1IDY A;  2V9V A;  4DOZ A;  4E7Z A;  4GDF A;  3S1N J;  3D1N I;  1U2W A;  2LY9 A;  4BQO A;  3K69 A;  2FX0 A;  5L3D A;  3HHG A;  4O3M A;  1S29 A;  4EGZ A;  3EYY A;  2HTJ A;  1FOX A;  5HOO A;  4CCM A;  1QO0 D;  2G0E A;  4ZYG A;  2JN6 A;  1B9N A;  3G73 A;  1R4M B;  1R00 A;  1H0M A;  5FD5 A;  4BNC A;  3RKY A;  2CQN A;  2XAU A;  5FKL A;  3EET A;  3DEW A;  2DJN A;  2A5Y B;  2MLK A;  2Y75 A;  2DA2 A;  2FBK A;  2X0L A;  3OOP A;  1XC5 A;  1J0R A;  1ZRC A;  3TO6 A;  2EV6 A;  3EQL F;  1X1C A;  2HOA A;  3HGY A;  3BR1 A;  3LFU A;  4CA0 A;  2B0L A;  2IS2 A;  3F8F A;  3O3K A;  4WX9 A;  2A61 A;  2R7F A;  4S04 A;  3S3N A;  4NBQ A;  1EH6 A;  4KIC A;  4BY1 J;  2WAQ A;  3R0J A;  4BQQ A;  5K1Y A;  2HYJ A;  2F5F A;  4L9J A;  2BHZ A;  2EIJ H;  3Q9S A;  4BXX J;  2M7B A;  3LSH A;  3I54 A;  2Q8K A;  1B8I A;  3ZQG A;  4HNV A;  3CCQ I;  5GPA A;  5GPC A;  2DOA A;  3VYS B;  4KIF A;  1W0U A;  1BBY A;  3GZ5 A;  1BN5 A;  4IXA A;  2QQA A;  2IBD A;  3ABL H;  3ZQL A;  4PFP A;  3FMR A;  2FBI A;  5C3E J;  5EDN A;  2STT A;  2DYS H;  2CQQ A;  2UWM A;  2XAH A;  1FOY A;  3Q9V A;  1OYI A;  1XSV A;  2EWN A;  3K6G A;  1R22 A;  2DYR H;  2UZK A;  1WRJ A;  3S16 J;  4HRI A;  4HX8 A;  4QIW N;  4A3C J;  2R7X A;  2IA2 A;  4ESB A;  2D1V A;  2E1M B;  1EF4 A;  1EV7 A;  4XNF A;  3OYM A;  4I76 A;  3BC8 A;  2FOW A;  5FKN A;  5J4Y A;  5EGO B;  1ZAO A;  5D4S A;  3MMY B;  1E3O C;  1G3S A;  3I0T A;  3IHU A;  3B6A A;  1HC8 A;  2JRM A;  2OV7 A;  1ZH5 A;  3S15 J;  5LFA A;  3CTA A;  4HBL A;  1KU9 A;  3M4O J;  1Z6T A;  4M3F A;  1DP7 P;  4JYK A;  3BPV A;  1I3A A;  5GP9 A;  2G7H A;  1CF7 A;  2R7T A;  3O2P E;  2HR3 A;  3MZY A;  3MN2 A;  3P7N A;  3HOZ J;  3HOU J;  2EBI A;  5JHU A;  3OYK A;  1MH3 A;  3HJE A;  2WBM A;  1FWZ A;  4AIJ A;  5E17 F;  4ZDO A;  4NDL A;  3ABK H;  2ME6 A;  4A3E J;  2CJJ A;  4C2M J;  5EF6 A;  2KP6 A;  3OS2 A;  3OYJ A;  3VSL A;  5LRS A;  2E2H J;  1HW1 A;  3LMM A;  2ZJP F;  4OMY A;  1LVK A;  3QOD A;  1T98 A;  1W5T A;  1WI3 A;  3U9G A;  4BH9 A;  2HXI A;  2RV8 A;  4OU0 A;  3DBL B;  3KPH A;  5E18 F;  2QSH X;  3ECO A;  2HOE A;  2DFE A;  2FRH A;  3HEF A;  4RBO A;  1MJ9 A;  2A6T A;  5FGM A;  4E7S A;  1DGW Y;  4HNU A;  1SD5 A;  4OIP F;  5DD4 A;  4EJW A;  3NEU A;  1HQC A;  4N9H A;  3OYB A;  4W97 A;  5FO5 A;  4X0G A;  3IH2 A;  1GDT A;  3FM5 A;  1LQ1 A;  2LP0 A;  2GIZ A;  4IX7 A;  2D5V A;  5M5W J;  1S7O A;  3CJT B;  4FQG A;  3C3W A;  3HRM A;  2BY1 A;  2HI3 A;  2XAG A;  4TV7 A;  4IHS A;  2P5L C;  5EGO A;  3G1L A;  1F36 A;  4A3D J;  1AA7 A;  1Z91 A;  1DGR M;  3SQN A;  2RDP A;  3OV8 A;  2X6X A;  1H9T A;  4X1E A;  5GTI C;  2FBH A;  3L7W A;  4G12 A;  1H89 C;  1YW9 A;  1USS A;  1P9Q C;  3DKY A;  4BQN A;  2L3D A;  2XAS A;  4WF2 A;  3MFK A;  1O3Q A;  4D1Q A;  4CH7 A;  1JTX A;  2ID3 A;  2FUG 2;  2V1X A;  1ZGW A;  4HQM A;  3DBR B;  1KYW A;  4K2E A;  3FXR A;  1IC8 A;  1FYK A;  1SVM A;  5L3B A;  2DXI A;  4IPA A;  3GFM A;  1IRZ A;  1Y39 A;  1A6I A;  2DA4 A;  4PJ0 C;  1F9N A;  1B72 B;  2DA1 A;  3MKZ A;  5E3L A;  3JSP A;  2M4K A;  1R6R A;  2P6T A;  3U21 A;  1K7A A;  3HBL A;  2WB1 N;  1SVL A;  2V6E A;  1K4T A;  2EJR A;  3Q3S A;  1Y8R B;  1I3Q J;  2E7W A;  1YIT I;  2E1C A;  1U78 A;  1OPC A;  1XGS A;  4A3M J;  3PQK A;  2C6Y A;  1MJA A;  3LQR A;  1T39 A;  1MGT A;  2QBY B;  4ZYE A;  4HPQ A;  3BJA A;  1IN8 A;  2CW7 A;  4ZYA A;  3QYF A;  2V4J C;  3UNG C;  1Y6I A;  3NWS A;  5EZG A;  3V8K A;  1FMV A;  4KN4 X;  2EIK H;  1JJ6 C;  2VQH A;  2ZFU A;  4UV9 A;  1IN4 A;  2VN2 A;  4M9Z A;  4PK4 A;  2BYV E;  3OMY A;  2NNY A;  5IY5 H;  2OTJ I;  4LB6 B;  4AIH A;  4F3Q A;  2BZT A;  2R4G A;  2V1N A;  2X1D A;  4IZZ A;  3CCY A;  4UB8 C;  4BU2 A;  2M2E A;  2DOF A;  2XC7 A;  3VYR B;  2DI3 A;  1UB9 A;  3OYL A;  1ZG1 A;  2L54 A;  1OCP A;  2WB1 A;  5E1Z B;  4U88 A;  5HS7 A;  1SFU A;  1TW2 A;  2WA0 A;  1W7P B;  4YFN F;  2LY1 A;  3I56 I;  4DIQ A;  4YFX F;  3D0S A;  3RYR A;  4D0P A;  3CCU I;  1RI7 A;  4OIQ F;  1QPM A;  1ODD A;  3E6M A;  3B73 A;  3F6V A;  4JP0 A;  4OAY A;  2F4O B;  3SEQ A;  3GW2 A;  2GOX B;  2WC2 A;  2Z3Y A;  3V8J A;  1B72 A;  4A5N A;  4G6Q A;  3HL2 A;  3C2G A;  1JI8 A;  3ZN1 A;  2H6B A;  1HST A;  5H2F C;  4HF2 A;  3BG6 A;  2ZSI B;  2NRA C;  4CDG A;  3CME I;  2OCE A;  2ZC2 A;  2L7Z A;  3ERE D;  3HRU A;  3NAU A;  1KQ0 A;  3S17 J;  2ZME B;  1U5T B;  2X9D A;  5LRR A;  1QA6 A;  4YEL A;  2IW5 A;  2R7D A;  1MBF A;  2JQ7 A;  3G2B A;  4IL6 C;  4KMU X;  3H3Z A;  3T0Y A;  1IW7 F;  4Y15 A;  2QEN A;  2KZG A;  2ELJ A;  1UG2 A;  4RM3 A;  2R0Q C;  4F52 A;  5AIP A;  3RI4 A;  5FFZ A;  2HKX A;  2JSC A;  2MC4 A;  2OUM A;  3WTY C;  2JA7 J;  3S2H J;  2L7K A;  2LLK A;  5LEK A;  5JLW A;  3HRT A;  5GTH C;  4M72 A;  1WJB A;  3LWF A;  2YX4 A;  3ZP5 A;  2LTP A;  1K78 A;  2GQQ A;  1FY7 A;  2DFF A;  4GCV A;  4M6V A;  4LG0 B;  1T0F A;  2COB A;  3BG5 A;  4XIC A;  4H0E A;  3G1M A;  1D5Y A;  3KZZ A;  2EK5 A;  3I71 A;  3CC2 I;  2JZY A;  5IOY A;  2PEX A;  2F6C A;  4IVN A;  1WHU A;  2EFO A;  4NQW B;  3PSI A;  4GYI A;  4M71 A;  1B4A A;  4IKF A;  1FSH A;  2O8K A;  2V79 A;  3HG9 A;  3I53 A;  4PGG A;  4FX0 A;  1XDU A;  4YII A;  1GHC A;  4QPO A;  1A04 A;  4KT6 A;  4DBQ A;  5LEJ A;  5E1W A;  5HVQ C;  5D6E A;  4BJ5 C;  5ICF A;  4KJZ A;  5CQG A;  3CMM A;  4E4H A;  2CSO A;  3DU5 A;  1FP1 D;  3OY9 A;  5TIS C;  1WH7 A;  5HDK A;  1MZB A;  1MD0 A;  3QQA A;  3W2A A;  4LG3 A;  1IJW C;  1FC3 A;  3HOW J;  4XM3 A;  4BYY A;  5LGU A;  1OMI A;  2XF6 A;  3D5S C;  3WTU C;  1FPQ A;  3OYA A;  1Y56 A;  2G9W A;  4JBA A;  2PLY A;  3L1P A;  2CUE A;  4ENM A;  2HQR A;  5H6Q A;  4ENN A;  2DK8 A;  2VON A;  1SEU A;  3GTM J;  1T33 A;  5GAG J;  3S3M A;  4U0W A;  3ONQ A;  1F4K A;  2MW8 A;  3M7G A;  2VUM J;  4PJN A;  5IYB J;  4EQQ A;  2VT2 A;  3RPQ A;  2DT7 B;  2CW8 A;  3KP7 A;  2HKO A;  1T56 A;  2H6C A;  4IQJ A;  1YQA A;  2KRH A;  1XX5 A;  3T1B A;  1MBG A;  4XSZ F;  4E7K A;  2XUB A;  4P5O A;  1HCR A;  2NS0 A;  3ML6 A;  4M9S A;  1JJ8 C;  1XGO A;  2KJC A;  3ZPL A;  4FE7 A;  2H8W A;  3DU6 A;  2FD5 A;  3HSR A;  1Z77 A;  1P4A A;  3ZMV A;  1G2H A;  2KL4 A;  3FMS A;  3SZP A;  1GVD A;  3L2C A;  4QTR A;  3H5A A;  4B09 A;  4FHT A;  3PNY A;  5B1A H;  2XKP A;  4AM3 A;  2V1D A;  1O4X A;  3E5U A;  2LKP A;  3WOD F;  1ACI A;  1XN7 A;  2IGK A;  3SHF A; 
#chains in the Genus database with same CATH homology
 2HPI A;  2QKM B;  1S9H A;  2VXD A;  4LIV A;  2LRD A;  2GOM A;  1SAU A;  4XLE A;  1YX5 A;  3OYF A;  2IXS A;  1MMA A;  4R79 A;  2XF5 A;  2E5N A;  3MKW B;  4J00 A;  4XN3 A;  2KPM A;  4HST A;  3OL3 A;  1T0F C;  3W2W A;  5FRM A;  1D0X A;  3W2V A;  4HG2 A;  2X1E A;  4Y3O A;  2VPL A;  4PUS A;  2LOO A;  3LSI A;  2M7A A;  4PSX A;  4G6T B;  5CPR B;  1D0Y A;  1FMW A;  2LRE A;  2L9S A;  4XMY A;  2MYS A;  4P1W A;  4AYB A;  1N77 A;  3EUA A;  2HVR A;  2BOL A;  2WAD A;  1BR1 A;  2HQA A;  1G59 A;  3SEZ A;  1D1A A;  2JA2 A;  4BE2 A;  3PNV A;  4XL9 A;  4BL0 B;  4YRV A;  1WJC A;  1YX3 A;  2VJ4 A;  4XKV A;  4E7Z A;  4DOZ A;  1ERD A;  3M8J A;  4BQO A;  1X4P A;  4ZTF A;  4NC7 A;  1UEL B;  2LC2 A;  2JVH A;  1G8X A;  2XDV A;  4OAZ A;  4BS9 A;  4CZC A;  2VB6 A;  2W00 A;  2AQE A;  3IUO A;  2E5Z A;  5HOO A;  1ZEL A;  3DTK A;  4CCM A;  2CUJ A;  2VIX A;  4CCJ A;  1V5E A;  2XAU A;  4ZJZ A;  1TZL A;  4QPQ A;  3PUB A;  2X51 A;  4HSR A;  2XSJ C;  1J09 A;  4C2U A;  4XQF A;  3VSK A;  2ZXI A;  4NUB A;  5KCM A;  3CES A;  5HNF A;  1X1C A;  3J7A Y;  4Y33 A;  2I8D A;  3NWT A;  3LFU A;  4JOM A;  4CA0 A;  4XR6 A;  2IS2 A;  2O5R A;  3S3N A;  4F91 B;  2IGN A;  4J01 A;  4KIS A;  1BOB A;  2WAQ A;  4BQQ A;  2IS6 A;  4BGD A;  4XLC A;  3FBI B;  2K9L A;  2M7B A;  3S32 A;  3LSH A;  2R7S A;  2V9K A;  2WAF A;  3OYN A;  1VZ0 A;  4U87 A;  3K4N A;  1K6Y A;  4C9Y A;  2DOA A;  3EUK L;  3VYS B;  4HEA 2;  3OR2 C;  4ZTJ A;  2PJR B;  1Z3Y A;  4PFP A;  3HKZ A;  4B48 A;  2L9N A;  1U0J A;  3HUG B;  2VKH A;  2VQG A;  4BXF A;  2WAE A;  3H35 A;  5FRN A;  2UWM A;  4C2T A;  1PJR A;  2LY2 A;  3L2R A;  3K6G A;  4YEJ A;  3OYH A;  1OLT A;  4ZC3 A;  4CSW A;  2BVL A;  3HC7 A;  4HRI A;  3VYU B;  4NC8 A;  1EA3 A;  2R7X A;  1KON A;  2E1M B;  1N78 A;  3K4L A;  4XNF A;  3OYM A;  1MW7 A;  4EAT A;  5KHD A;  2VJI A;  1NG6 A;  3S8P A;  3BC8 A;  3K4B A;  4DBR A;  2MD0 A;  3MMY B;  2LYC A;  3OWT A;  4AU7 A;  1DQU A;  1BR2 A;  2CS3 A;  3EPZ A;  3RCO A;  2R7W A;  2OV7 A;  5CKT A;  5HLT A;  4E7L A;  3HOT A;  5LFA A;  3MKY B;  4CCN A;  3K4K A;  2LH9 A;  1WJE A;  2IGM A;  2R7T A;  2ZSH B;  1LDK B;  3PNT A;  2VJ5 A;  4OWR B;  3DLA A;  3OYK A;  4Y4R A;  2WBM A;  2KHM A;  3DQV C;  3UR3 C;  4NNJ A;  4ZDO A;  3OYE A;  3OOU A;  3OS1 A;  2Q2E B;  1QHH D;  2KP6 A;  2Z1D A;  3OS2 A;  3VSL A;  3OYJ A;  3OIQ A;  3ZXS A;  3AKZ A;  3LMM A;  4BDZ A;  1LVK A;  3QOD A;  3BG7 A;  3H5N A;  4FET A;  1MND A;  3L2Q A;  3EUH C;  2VJJ A;  2LBF A;  3OYI A;  2R7Q A;  2A6T A;  4E7S A;  1DGW Y;  1Z21 A;  2Q1Z B;  4DGW B;  4BDY A;  3A1Y A;  3OL4 A;  4HNU A;  4XKW A;  2W82 A;  3OYB A;  1E0E A;  3F9K A;  4X0G A;  2BW3 A;  4PJJ A;  4E7I A;  2HNH A;  2WY8 Q;  4IX7 A;  4E7J A;  2M3A A;  4PSW A;  3AL0 C;  3TMO A;  4B43 A;  1LFP A;  3AFH A;  1AA7 A;  2K3P A;  4F92 B;  2NOJ B;  4XLH A;  1DGR M;  2W4S A;  3PFY A;  3CJR B;  4XON A;  3HPH A;  3W3C A;  3L2U A;  1UAA A;  1DP3 A;  2L2O A;  3SZG A;  2X6X A;  3D5L A;  1X1D A;  5HNH A;  1X19 A;  4BE0 A;  2CV2 A;  1D0Z A;  1P9Q C;  3HPG A;  3DKY A;  4BQN A;  1BR4 A;  2R7U A;  3H5R A;  3PL8 A;  4D1Q A;  1GLN A;  4CH7 A;  4FAS D;  2FUG 2;  4BJT A;  4GRI A;  2RNG A;  2KLO A;  3IAM 2;  2DXI A;  2K9M A;  4KIT B;  2KMU A;  4HNT A;  4ITV A;  1MMG A;  3MKZ A;  3I9V 2;  1TT0 A;  3PSF A;  3D5R C;  2M4K A;  4XKC A;  1R6R A;  2MFZ A;  2HU9 A;  4H4K C;  3U21 A;  2M0M A;  2V6E A;  2JVG A;  3C2H A;  2HDW A;  3FKJ A;  2X85 A;  3OR1 C;  4XKB A;  4ZDL A;  4PFO A;  2UV1 A;  2F5V A;  3H9G A;  4BEH B;  4CCL A;  1Z3X A;  1OR7 C;  4DJA A;  2RQQ A;  1W36 C;  4II3 A;  4XLF A;  3K10 A;  3OYG A;  2CH0 A;  4HPQ A;  2VLA A;  2CW7 A;  4ZYA A;  4XLA A;  3QYF A;  2V4J C;  3UNG C;  1Y6I A;  3NWS A;  1FMV A;  3TL4 X;  3K4M A;  3ZGK A;  3S3O A;  1UG0 A;  2VQH A;  2DJI A;  2ZFU A;  3DPL C;  1W36 D;  2XF7 A;  4PK4 A;  2CFO A;  3OMY A;  2CUZ A;  3VYT B;  1X4O A;  3OIP A;  1QHG A;  1WJ5 A;  4F3Q A;  3MD2 A;  2R7V A;  2R4G A;  2V1N A;  3FHN A;  2X1D A;  4IZZ A;  2QKL B;  4BU2 A;  2XC7 A;  2L5Q A;  3VYR B;  3OYL A;  4IQ4 A;  2M4G A;  3HOS A;  4B47 A;  3KEY A;  1MMD A;  2WB1 A;  3ZRG A;  2WA0 A;  2LY1 A;  2UUZ A;  5TGT A;  4DIQ A;  4BE1 A;  4LIT A;  4XN0 A;  2LG4 A;  4ANJ A;  5JHF A;  4OAY A;  3SEQ A;  3CP2 A;  2GOX B;  3ZCO A;  4XOP A;  1MMN A;  2JSP A;  3DEE A;  5FRO A;  2VL8 A;  4D9J A;  3RSN A;  3HL2 A;  3CF2 A;  3HXL A;  3C2G A;  2PJR A;  2W7N A;  3DWL E;  3SDB A;  1HA8 A;  3CJQ B;  1JI8 A;  3TBI A;  5CQE A;  3A4C A;  3BG6 A;  3H0D A;  2ZSI B;  4F55 A;  1YE9 A;  4N4N B;  3LL7 A;  1V5G A;  4ZDP A;  3OYD A;  3LSM A;  2K5C A;  2VQC A;  4BAC A;  3AL0 B;  4BEH A;  3DPT A;  3OYC A;  3KYL A;  4YEL A;  4B3X A;  3G2B A;  2VKD A;  3FDY A;  2R7O A;  2HVS A;  1LKX A;  1D1B A;  3K4J A;  2ELJ A;  4RM3 A;  3I3L A;  4F52 A;  3H9Q A;  3FBN B;  3A2K A;  2Z2S B;  4BJ6 C;  3K4C A;  2MC4 A;  2OUM A;  2V7F A;  2L7K A;  3L2W A;  3E0J B;  1WJB A;  2CMP A;  4XOR A;  1MNE A;  3LSK A;  3DPU A;  4RLQ A;  4E6K G;  3BLY A;  3RTR A;  1WJD A;  2KZV A;  2KRC A;  3DTI A;  2IS4 A;  4MLO A;  3N05 A;  2IS1 A;  3V42 A;  1QU3 A;  2RRE A;  1PYV A;  3BCB A;  2F6C A;  2AQF A;  4NQW B;  3PJR A;  3PSI A;  2R7R A;  4IKF A;  2A5W A;  1NG7 A;  1WFX A;  3HG9 A;  3H9J A;  2HZD A;  4RM2 A;  4QPO A;  1WJA A;  3SYT A;  4U7B A;  2CV1 A;  4KT6 A;  3CZ6 A;  1D1C A;  2CV0 A;  4DBQ A;  3S93 A;  2E60 A;  5HVQ C;  1IRX A;  4BJ5 C;  4PJM A;  2F4I A;  4KJZ A;  5CQG A;  3L2V A;  3CMM A;  4E4H A;  3K70 C;  3DU5 A;  3RQ4 A;  3OS0 A;  2KQR A;  4B44 A;  3OY9 A;  1T95 A;  4PJL A;  3W2A A;  4LG3 A;  4RMN A;  4CUG A;  4XM3 A;  1N75 A;  3RPU D;  1SFK A;  3K70 D;  4II2 A;  5LD2 C;  2XF6 A;  2VAS A;  3D5S C;  3QYB A;  3OYA A;  2OC6 A;  4E7H A;  1Y56 A;  2HVQ A;  1Z7L A;  3DKX A;  4AVZ A;  2Y0S A;  2ZXH A;  2X1C A;  3BCA A;  3QYE A;  1X1A A;  3DTE A;  2IGO A;  3LSG A;  3S3M A;  3ZR8 X;  3IP4 B;  3ONQ A;  3IAS 2;  4PJN A;  4LIU A;  2VXZ A;  3M1C A;  2DT7 B;  2LBF B;  2CW8 A;  3VDX A;  2W1O A;  1V5F A;  2V26 A;  2WY7 Q;  3GBG A;  2KDO A;  4IQJ A;  2KRH A;  2Z16 A;  5KNL A;  2JUG A;  3QOE A;  4E7K A;  4N4O B;  4RLF A;  4CCK A;  4P5O A;  4JQF A;  3ZQQ A;  4CCO A;  1WJF A;  4XOT A;  2HPM A;  2MAB A;  3CP8 A;  2DCE A;  3DU6 A;  2BW3 B;  2P0W A;  4BUP A;  2KL4 A;  2X6Y A;  4C30 A;  3H5A A;  3KX2 A;  3VWB A;  3PNY A;  1X1B A;  2E1M C;  2PMZ A;  3E1S A;  2VQL A;  2BVM A;  2IGK A;  4F93 B;  2DT6 A;  2X6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...