3K10A

Crystal structure of telomere capping protein stn1 from saccharomyces cerevisiae
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
170
Chain Sequence
TSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDSGILLHLEYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Protein STN1
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 170
sequence length 179
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12659 Stn1_C Telomere capping C-terminal wHTH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1080 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A01
1.10.10.1090 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3k10A02
3KEYA 3K10A
chains in the Genus database with same CATH superfamily
3VWBA 2K7LA 1MKMA 2RV8A 2H1LA 2FBHA 3ERMA 1PDNC 1WRJA 3QPHA 3ERED 1YS7A 2YSRA 4IF4A 2QSGX 1V3FA 3SDGA 3HOSA 1OPCA 5BNGA 1J09A 3PM1A 3A1YA 1SMYF 2VT2A 3S16J 2COMA 1JT6A 4ASNA 1VI0A 5D5VB 4FETA 4M3DA 1JKRC 4PJJA 2IPQX 3RQIA 5EJCA 1T38A 2LMDA 3GTJJ 4IQ4A 3KLOA 2VJJA 1Y39A 4QWQA 1UB9A 1W7PA 3EYIA 1NHAA 2JJ7A 2QQ9A 1YJNI 1K83J 5HNHA 4IEJA 1UAAA 4KMFA 2OCCH 1IRFA 4ZJZA 1B8IB 1DQUA 3FHZA 3WG9A 1EV7A 4BYYA 5B1AH 3IKTA 2ZJ2A 2CRGA 4EEFG 1D5YA 1Y1WJ 2VONA 1RNLA 3OS0A 2EWNA 3OYHA 3RZOJ 2XRLA 3HBLA 3ZQFA 3I53A 2XROA 1GXQA 1Z05A 4AVPA 2NOJB 3K9TA 1ZH5A 3J7YJ 3CUQC 3IH4A 2Z2SB 1BW5A 5GPCA 1E3OC 1UHMA 2LBFA 2L9VA 3RQ4A 4EJWA 3PJRA 2JVHA 3CJTB 3F23A 4OWRB 2ZXHA 3S15J 1MH4A 4XN0A 2QYOA 1FBQA 2P5VA 2Q0OA 4IRIA 4I01A 1OJLA 3F72A 1P2FA 3ISPA 1BL0A 1ZELA 3P9KA 2P81A 4E7LA 3H3VK 3R61A 4BH9A 5JI6A 5DCMB 5F08A 3E3VA 3OIQA 3BR0A 2WAQN 4I98B 4UUSB 1B1BA 2HPMA 3TO6A 2VIXA 2QGUA 3H9QA 2OPTA 2B7EA 1LUJB 3F0CA 2ELHA 2CYYA 2KFDA 3COAC 2W00A 3T8RA 2R7FA 3HTSB 4X6AJ 4FISA 5DD4A 1IN5A 3BLYA 4HG2A 4G7ZF 1V54H 2M5WA 2FX0A 2M0CA 3G73A 5FRNA 5HDGA 1JGSA 3H9GA 5JLWA 1Z7LA 1TL8A 2EZHA 1MZBA 1A35A 1Z9CA 3TOBA 3EDPA 5KK1A 2DA7A 1X3WB 2UWMA 3BCAA 2XAHA 3WTSC 3KZYA 4O5VA 3I64A 4XLEA 4A3FJ 4XOTA 2QM3A 2VC0A 4LIVA 1R58A 3U2RA 3BWGA 2GXAA 4IHWA 2Z99A 2CQQA 2KPMA 4B3XA 1IO2A 4AVZA 2R7SA 5A2QK 3BG9A 2L7MP 5AIQA 1Z77A 5BOXA 1W7PB 2MA3A 1D8KA 1YRNA 3LSMA 3OYLA 1BI0A 2KIFA 4A3CJ 2NOGA 2DPDA 5DDGA 3K2ZA 2HOAA 2XAQA 2AXTC 2QQBA 4I09A 3A4CA 4N9IA 3DBLB 2H8RA 5A2QZ 1PUFA 2FJ1A 2H1KA 1T0FC 3H9JA 1XX5A 4QPQA 1X2MA 3L2WA 1W7PD 2WA0A 3OR2C 5IYDJ 2FNAA 1YE9A 1SAUA 4RLFA 3KLNA 2VKHA 1R5ID 2ZJPF 3KEOA 2X0LA 4S05A 5D8LB 2DJIA 2ECBA 2HVQA 4IHSA 4ABZA 1SFOJ 4PCQA 4GO1A 2VC1A 3GZNB 2UZKA 3K4NA 2HGCA 3PIPF 1USSA 2RKHA 1FNNA 2G7HA 2XSJC 2V26A 4CSWA 1T39A 1WJBA 1U3EM 2EIMH 2ACJA 5LLQA 1SD7A 3EPZA 2CW7A 2V6CA 1Y56A 1UMQA 3T0YA 4L0ZB 4C2UA 2DJNA 5LRRA 1N78A 4FQGA 4M73A 2HVSA 1IDYA 1VQ7I 3CUQA 3ZQLA 2M3AA 4ZDPA 3CCVI 5CYVA 1RUNA 3UKGA 1X4PA 3BR2A 2ZXWH 1K6YA 2DA5A 3LQQA 3AG1H 2JPBA 4ITVA 2JSPA 1ON2A 4EMSA 5IYBJ 3L2UA 2RREA 4D5FA 5M5XJ 2NAZA 4II2A 1LNWA 3BZCA 2M7BA 4W97A 1UHSA 2K9LA 1ZN2A 2LY2A 1B72A 3K69A 3VYSB 2WAEA 5K5OA 2DFHA 4XM3A 4N4NB 3HYIA 4S04A 3HOWJ 1ZTRA 3SJMA 1P4WA 2R7WA 2ZMEC 3I59A 3K7AJ 5K1YA 5M5YJ 4EJTA 4Q47A 4G7HF 1WSUA 2IRFG 1S7EA 3MKZA 1YRNB 2NXNB 1RIOH 5LBQA 5GTHC 2KL4A 3ZQ7A 3S1MJ 2VJ5A 1ZKGA 3AG3H 2V79A 3FMSA 4I6ZA 1OR7C 3HPHA 4HDVA 2BW3A 1XTAA 2D1VA 4Y3OA 1HSTA 3I4PA 3L2RA 2MSYA 4FE4A 2GLOA 3LOCA 3DV8A 3GZ6A 4BHBA 3Q0UA 3KEQA 1PUFB 1JUMA 3JRFA 2QSFX 1IN6A 1UFMA 4MFDA 4ESJA 2PFBA 2D45A 2Y0MA 4N4OB 2NS0A 1YW7A 2GWRA 3FM5A 2DPUA 3ABKH 4OMZA 1JHFA 4NC7A 2FA5A 3ROUA 4A3GJ 2CFOA 1GLNA 3BZ6A 5CVUA 3KP7A 1D0YA 2HYJA 2X9DA 4NQWA 2EB7A 3BP8A 5JLXA 3KP2A 3SEQA 2ZO4A 2L02A 4KITB 3KE2A 2TDXA 2DOFA 1XSXA 2E7XA 4Y13A 4EJOA 1T0FA 5L3EA 1EKEA 2YU9J 1C0WA 2X51A 2LC2A 2VPRA 2K85A 3TL4X 2LTPA 2ZB9A 2XAJA 3WGHA 1ETXA 2L7FP 1S72I 1FTZA 3HXLA 5DD8A 4Y7NJ 3PFIA 2JK3A 4JX4A 2DA6A 3GMEA 2TCTA 2DLLA 3CUQB 2DA1A 4BKXA 1K6OA 2Y0SN 3BQZA 4HSTA 4AIHA 4RGXA 1YOVB 3TDZC 2DT6A 2KRFA 4P96A 3P7NA 4IJAA 1ZR2A 1T6SA 2I5UA 2EZKA 2BXYA 4QTRA 3KYCB 4KIFA 3S2WA 4YELA 1U9NA 1XCBA 1SVLA 2G7UA 1G6NA 4IL6C 2FU4A 2LVSA 5H6RA 4ZZDA 4BGDA 3F21A 1B72B 1U8RA 4P9UA 3QOPA 1DPUA 1VNDA 3CQZJ 1SD4A 2EQRA 3EUHC 1DUXC 2QENA 4RAGA 5C44J 4EGZA 2Y48A 2HYGD 1OLTA 4NC8A 2VKDA 2E71A 3BG6A 1MJAA 2VQGA 1G3YA 2F6CA 2KIUA 2YU3A 3BZKA 1P7IA 4IXAA 3VYUB 2L9RA 1T98A 3GZ5A 5FJ8J 4AYBN 2BW3B 2B0LA 3H1CA 3LSTA 4KT5C 1FLIA 2YR2A 3LL7A 4B4CA 4ESFA 4KJZA 3CCMI 3IP4B 1TQMA 2ZMEA 1TNTA 1BJZA 1S5LC 3HHHA 3OR1C 1R49A 3OS1A 4CYCA 5E3OA 3WTVC 2GZWA 2X6WA 2AXLA 3CJNA 1XMKA 4BNCA 2WC2A 1EH7A 5C4JJ 4RGUA 4OMYA 1FIAA 1Z1DA 2QSHX 1BOAA 5D5WB 2ICWG 4XIDA 1UZCA 2Y2ZA 3EUAA 5F1JA 1I27A 2IGOA 4C2MJ 4F91B 1X1AA 2FRHA 2OZUA 4NQWB 3GTPJ 2Y9YA 3BCBA 3GX4X 4UB8C 1OCRH 4E7ZA 1TWGJ 2QQ8A 3RKQA 2HDDA 1XD7A 2LR8A 1ZLJA 3FXLA 1B9NA 1LFUP 3GYHX 4CXFA 4D1QA 2HYFA 1VQLI 1XGNA 1LPQA 4G12A 3Q9VA 5HS7A 4YIRX 5E8GA 5GAGJ 5KNLA 1FMVA 3MKWB 1ETWA 1JTYA 1TW2A 5CPRB 3KP3A 2O03A 2XB0X 3DPLC 3CCEI 1IXSB 4Q48A 4MHGA 1WKMA 4BQQA 5FFXA 2RNJA 2HWVA 1VF9A 2V4JC 2DFEA 2J5PA 2DA4A 3CZ6A 3FK7A 4IRHA 3BPVA 4U87A 3CMMA 2PJRA 2ID6A 4II3A 3LSHA 1WFXA 3PQJA 1E3HA 1IAWA 5F0FA 2HPIA 5LD2C 1YITI 1V4RA 5HLTA 2P5KA 1W4MA 2KDOA 2P7VB 4A12A 2LNBA 2E19A 3CCJI 5B66C 4FHTA 3K6GA 4OIOF 3K4JA 3OYCA 2DDBA 2FOKA 2MBFA 1SFXA 4CCJA 3ZMVA 1WH7A 2P4WA 2YX7A 3ESWB 3ZQCA 2WBMA 2E2HJ 4IHVA 2PI0A 1N75A 3I55I 5JFRA 4V2GA 5B5EC 4IVNA 1P92A 2IS6A 2DBBA 2GOMA 2OZ6A 1ULYA 3UNGC 3NARA 5J8FA 5FD5A 4C2TA 5CVIA 1XGOA 2VB6A 4UHTA 2CSOA 2MG4A 2PMZN 3HM5A 2Z33A 5E18F 4M74A 2RN7A 4MO7A 3I9V2 3AKZA 1OYWA 3TO9A 2IS2A 3ASOH 4Y17A 4L0YB 4XKVA 3EUHA 2ZMEB 4YFKF 4A3BJ 4RM2A 2L01A 4I99C 4CYCB 4BDZA 3CJQB 5E1XA 4CCMA 3ZMTA 5IT3A 4ZYDA 4V2FA 3HUGA 2K9MA 1BJAA 4YFXF 1TC3C 1R6RA 4X1EA 2DK8A 1T33A 3E6CC 2B9SA 1AKHA 4L9NA 1NK2P 2EH3A 5JHUA 1SD6A 3BR6A 5J1UA 1YLFA 3JTGA 3WTWC 1BIAA 4LK0F 5J1RA 4RB0A 1BA5A 2Y30A 1E17A 1TQIA 1R36A 3BJOA 1O7LA 2VKEA 4U0WA 3I56I 4UUTA 3RYPA 4A3IJ 4HQMA 4MEYF 4LLNA 2W84A 4WWCA 3ZP5A 3J7AO 3GTGJ 3GF2A 2FSWA 3HC7A 3CUOA 1NG7A 2V9PA 2Y75A 4EGYA 4BDYA 1J75A 2QBYA 3ABMH 2BBYA 4HSRA 3RKYA 2YX4A 4H0EA 2M8GX 1J9IA 3OYBA 1Y8RB 3KYDB 3JAMK 1H89C 2MLKA 4A3DJ 3DKXA 1ON1A 2VUMJ 1XGSA 3F6VA 2FQ4A 1SD5A 5FD6A 1VQOI 2PN6A 1XCVA 2ZSIB 3F3XA 1HKSA 1YFHA 3GLLA 3PIOF 2LYCA 1B59A 2EK5A 4G8XA 4MQVA 1X2NA 2V1UA 3QYEA 3ELKA 1YQAA 4H4KC 4AD9A 2GA1A 2BVMA 3SQNA 3JAMZ 3RKWA 2QA4I 2DMUA 1TP4A 2JA5J 2R93J 2ELKA 2BOLA 2BY3A 1OCOH 1STZA 2DT7B 2JA2A 4L9VA 2K3FA 5TGTA 3CMAI 3CD6I 4IHTA 4EVIA 4RBOA 5ILSA 1R5GA 1SVMA 4CDGA 1KQ8A 1YX3A 3JSPA 2QEXI 4LFUA 2O61A 4KYWA 1PJRA 4JK1X 2XRNA 5J3LA 3RCOA 1QZZA 2V1NA 2L7KA 3CDLA 3N4MA 3LSGA 2R5YA 1VQKI 3DTEA 4QPOA 3RYRA 4B44A 1RR7A 3V42A 1R23A 2WB1N 2O5RA 3MZ8A 1FJLA 2IJLA 3H0DA 5F6FA 2KKOA 2UXXA 1SEUA 5J47A 5H2FC 1O3RA 2KZVA 4XRSA 3WG7H 1EF4A 2RVCA 4N0BA 4XLFA 2HEOA 2HOSA 5E3NA 3WTTC 3QRFF 1TWHJ 3O8GA 2BYVE 3B02A 1ZG1A 1AKHB 1I3QJ 2M7AA 4N9HA 3CC7I 1ZLKA 1BOBA 2VPLA 1A6IA 2RC4A 3LSKA 3ZQIA 2XAUA 1Y8QB 2EIJH 5DS9A 1KYWA 2DN0A 1CF7B 5E17F 1OCPA 4HV6A 3JRBA 3TMOA 2ZXIA 2HOTA 1BIBA 3GFIA 2XHKA 2NS8A 3KZIC 2KISA 3JREA 4GYIA 3ASNH 1WPKA 1R5HA 3K2AA 2QBYB 3HSRA 3S3OA 2A6HF 1FOKA 1MH3A 4HV5A 1FWZA 3HOYJ 2QKMB 2V7FA 3PFYA 2FUG2 3HOTA 1D1AA 2L3DA 4HW0A 3JRIA 5LFAA 4LOCA 3I3LA 3SFIA 3V8LA 2CUEA 1HW1A 2KJCA 1DU6A 2WY7Q 4A6DA 2HDWA 4ANJA 3CCUI 2Y9ZA 2HDCA 2DFFA 1S7OA 4BE0A 4GGGA 2V6EA 5HDNA 3L2QA 2L54A 2CS3A 3S3MA 1UG2A 2H6BA 1R4MB 2BXZA 4A3LJ 5DTDA 4EATA 1FOWA 1MGTA 1OYYA 1ETKA 3OL3A 2PX9A 1RRJA 3LQRA 2H6CA 1W0UA 1ETYA 1SVOA 2K5CA 4GYGA 2KIQA 4DYQA 4HA8A 2VASA 4R1HA 5IT9K 2LDUA 9ANTA 1OFCX 2HNHA 1UJ8A 3KX2A 3CO6C 1JJ8C 4DZPA 4ESBA 2IGNA 3HKZA 1X58A 4CHUA 2CMPA 3DF8A 2IW5A 5F64A 3ONQA 3VEPA 4UY8I 3CDHA 2HR3A 2PLYA 2E2JJ 4L5JA 1I1GA 4YIIA 1J2XA 2XPWA 5IT9Z 3CTAA 2Y0SA 5ICEA 3CCSI 3D5RC 2IA2A 3JRAA 2HTJA 2GA2A 2CW8A 3CF5F 1A04A 4M6YA 2P8TA 2IGKA 1HLVA 1XS9A 3ML6A 2EFWA 3K1PA 5GAEJ 2WV1A 4IOAF 2DA2A 1JKPC 4V19K 3N05A 2FNPA 2EV6A 2GIVA 2R7QA 5CVJA 5L3GA 3ZGKA 3H35A 3E97A 3G2BA 4DNCA 3R0JA 2W4SA 3W2AA 1Z91A 2CFXA 1U2WA 2CWEA 5HLGA 1ETOA 1OCZH 2K4JA 2AQEA 3FXOA 5K5QA 2O3FA 5HS8A 3T8TA 1IW7F 1XN7A 4KIBA 4XONA 2M4GA 3OYNA 2HQAA 3Q9SA 4BEHB 3ZMUA 2W7NA 4M9SA 4ENNA 2A69F 4RB3C 4AYBA 4D7NA 4NC6A 2LD5A 3CO7C 1K79A 4E7IA 2X6YA 3ECHA 3RIRA 4M6VA 1YHQI 2R5ZB 3OY9A 2A3SA 2IS4A 4DYCA 3TO7A 4I7HA 2ZNYA 5D4SA 1QO0D 3CMYA 4PSWA 5FLVA 2DU9A 2JA7J 4UUVA 4L9TA 2AO9A 2F2EA 5HLIA 1LE8A 1IXRC 3IH3A 3TW6A 2E36A 1VQNI 2PG4A 4Z6YA 3G71I 3VB2A 2NVQJ 3CMEI 4KICA 4ON0A 3IV5A 1W36C 1U78A 1KGSA 3R60A 1XMXA 2MLGA 2VJIA 5TJJA 1IJWC 4JOMA 1WJDA 2R7UA 4A0YA 1FPQA 3P5JA 5M3MJ 3F8BA 3MKYB 2LKXA 2OF7A 4ZTJA 3FXUA 4I0AA 2LSOA 1UCRA 3VYTB 4XRMA 4UVBA 1BBYA 2LOOA 4UVAA 2GAUA 4F92B 2VE9A 3TGNA 1FX7A 4A5MA 1W0TA 1F9NA 2GXGA 3KYLA 1S29A 4M3GA 1TWFJ 2JRMA 2HXIA 1T2KA 2M9HA 3GUDA 4BXUA 3M7GA 2YUSA 1QZEA 4EM0B 4DZJA 2K3PA 3I58A 2AQFA 3MAJA 3K0LA 1R4NB 4ZDLA 1MDMA 2R7TA 5FGMA 4RGRA 1IV8A 1GT0C 3VDXA 4D9JA 5CQGA 3CCQI 3LA3A 1VQ9I 3JTHA 1TNSA 5FKKA 5K7ZA 2XF7A 2IT0A 1ERDA 2G0EA 4LK1F 2JUGA 2FMLA 3CF2A 3CP2A 2ESNA 3EQLF 2LBFB 4A69C 4G94A 4WX9A 5LHGA 2OD5A 3IKVA 3FX3A 2OC6A 2XF5A 4BHCA 3GW2A 1HKQA 3HRTA 2GM4A 2VBZA 2QWWA 2DODA 1I3AA 2DQLA 1R7JA 5ILVA 2R92J 2MFZA 3NQOA 4MLOA 5GTIC 3IH2A 2BHZA 4YG2F 1MSFC 2GOXB 2F5CA 5HS9A 2OBPA 5K5RA 1FY7A 1F43A 3ZMDA 2VXZA 2VODA 3W2WA 4CUGA 4AIJA 2X6OA 2K27A 2HZDA 2HS5A 4KUMA 2VBWA 3MKLA 2FEZA 1MMSA 1ITYA 4PFOA 5DEQA 1V55H 2LLKA 3GFLA 2COBA 4CCKA 3ECOA 3G1MA 4HEA2 1FOXA 3FMQA 1DGWY 2NVUB 4RAYA 1IC8A 2ZKZA 1TLHB 4CO8A 1P9QC 1POGA 5IP9J 3HRUA 3WTUC 4GXOA 3ABLH 1BI1A 5GP9A 2CH0A 4XLNF 2IA0A 2W57A 3LFKA 1RKWA 2UUZA 3BY6A 3K70D 1LJ9A 1HW2A 3BTCA 3GXOA 1FT9A 3W2VA 2EIKH 2XGCA 3PUFA 5IOYA 2CQNA 2O6GE 3CESA 1JGGA 4HPQA 5J40A 2P7CB 3I4NJ 2L7ZA 3BG3A 4NUBA 2MH2A 5BMZA 2UXNA 2GIZA 1BR4A 2KZGA 3DPTA 3TOAA 3BPXA 3GEZA 1R1UA 1X1PA 4RB2C 2FOWA 1TT5B 4BE2A 4M3EA 2A5WA 1FOYA 1RESA 3LSRA 3IL2A 1EA3A 2ESHA 3K4LA 4J19A 2KP6A 3TQNA 1TT0A 3CLQA 3L2CA 1W5SA 4BS9A 4KIGA 3TEDA 2LKSA 5BQTA 3FK6A 3RPQA 3A02A 4BY1J 1MDMB 3M07A 3Q0WA 2HQRA 2M30A 4BE1A 3H36A 4XLCA 1SC7A 1MJ9A 3WGIA 2VQLA 3LAPA 4DGWB 4B47A 2DTRA 3T5XA 2JWTA 2WAFA 1AA7A 3MQ0A 3JRDA 1MIJA 2EZIA 1FBSA 2OTJI 4EM1A 1BM9A 4BUPA 1FSHA 1Z3YA 4MIMA 1NTCA 1A6QA 2HVRA 2OAZA 4AC0A 2OQRA 2LY9A 4NBQA 3F9KA 2WB1A 4PDKA 2LP0A 1DGRM 2M2EA 3BJAA 3OWTA 3H5RA 3S2DJ 1ACIA 5DM7F 4MTEA 3BTJA 1PP7U 3ZR8X 1XGMA 4PJLA 2XASA 4U0VA 1R71A 4Y33A 5EEHA 2DQRA 1D3YA 2VL8A 1UELB 2Z5UA 1WI3A 4FX4A 2HI3A 1IF1A 1FYLA 3FKIJ 3EYYA 1HC8A 2NVXJ 1I39A 3EETA 2P6TA 4HDUA 2OJED 3NWTA 4ZH4F 2EA4A 3E5XA 5ICCA 3S14J 2Z9OA 3BR3A 2GXBA 2M87A 3V7CA 1IN7A 1X1CA 3S1RJ 4YEJA 2ADUA 1F36A 3M4OJ 2L9SA 3DTKA 1IGNA 3OMYA 3GFMA 1IN8A 4EV0A 1L0OC 3I59B 4E7JA 3DCFA 3G4SI 1KONA 1JKQC 4L9JA 3U1KA 1E3PA 4UNOA 2VXDA 1SFEA 2F4IA 3U21A 3PO3J 4OIRF 1T8IA 2FBIA 3IRRA 1TBXA 1KU2A 1U8BA 2VJ4A 2XGEA 2O8KA 1J5YA 3LSPA 2UV1A 1GDTA 2M4KA 4D7MA 3FDYA 1YW9A 1WHUA 4C3IJ 4CZZA 1P6RA 4ZYEA 3DKYA 3BROA 4ZYHA 1E0EA 1X1BA 3S1QJ 1K61A 2MGQA 3QP6A 2NRAC 5LEKA 1IRZA 4JYKA 1IUYA 4LITA 1W36D 2NVTJ 1ZQ3P 2D2WA 2JMWA 2LF7A 3H5AA 5CQEA 3Q3SA 5JVGF 5GAHJ 1LQ1A 4WXDA 1G59A 2ECCA 2X1EA 1IG7A 3LA7A 1ZGAA 2RQQA 2LG4A 3OV8A 4PJNA 1NK3P 2X6XA 2KIMA 2DA3A 1IRXA 2WWYA 3QU3A 1ONVA 1ODDA 1G8XA 5TRDA 3PNYA 3LA2A 1VQMI 4AIDA 2XSDC 4DYRA 3AL0C 1WVRA 4RA2A 2X1CA 4XBFA 3Q5FA 1FEXA 1LFBA 1R9TJ 3HG9A 3OOUA 4PGGA 5DV5A 1GHCA 2GBYA 2Z1DA 3GTQJ 1H0MA 2DK5A 5CJ9A 1MBKA 3AG2H 4A5NA 5F1RA 1WH5A 5C4XJ 4XR6A 2QUFA 4D0PA 2PMHA 5FKOA 2GQQA 1TW3A 2CU7A 4XKWA 2EV0A 1Y1VJ 2KLOA 3HOVJ 4XQFA 3DBHB 5EF6A 2DFIA 2ETHA 4B43A 3M1EA 2CQKA 2HFHA 3TP0A 3ZN0A 3T1BA 1OKRA 2BZTA 3PNVA 4M3BA 3I5UA 4ENJA 1HQCA 4LD5A 5D5XB 4HQEA 2A68F 5D5UB 1MBJA 1GXPA 4I02A 4RAZA 4Y15A 2EFPA 2ELJA 4ZYAA 1DU0A 3LSJA 4GCVA 4BACA 1MBGA 3KPHA 4KN7X 4E7SA 4ETSA 2CQ7A 3OYJA 3CLOA 1KQ9A 5EZGA 1DDNA 1YJ9I 2X4HA 3FWEA 3E1SA 1FIPA 2M1BA 3S93A 1Q1VA 3W6VA 4HYEA 1FYMA 2WAQA 4UXNA 1QPMA 4P5OA 4CCNA 1JT0A 4EJUA 2MD5A 2BV6A 1X1DA 3GWZA 3ZQHA 4OIQF 1RETA 5LGUA 4JX5A 5J8CA 4P55A 4AWXB 2P0WA 2DOEA 3MMYB 4HZFA 1Z0XA 5KVRA 2E1MC 3ZQQA 4IKFA 3C2BA 4O3MA 4NNJA 3WE2A 3O6BB 2B63J 4HNUA 4HLXA 3VODA 4MFEA 2V9VA 1V5GA 4RDUA 4TV7A 2Q2EA 4KMUX 1TWAJ 3E6MA 2RAEA 2PBIA 3HOUJ 1JHHA 1QVUA 2E2IJ 1T08B 1X3ZB 1G3WA 3SEZA 1VFCA 5J4YA 2JTVA 5DUIA 1U5TA 3SYTA 1P7JA 4HX8A 2CV0A 4DIQA 1MMAA 3DU6A 3NRVA 2I8DA 4P9FA 1ZR4A 1G4DA 2MH9A 5BS6A 3E6BA 4UV8A 3VPRA 1ZHFA 2E7WA 3GTKJ 4RLQA 5AIPA 4ZDOA 2PJRB 1FP1D 4UVCA 1Z6RA 2VBYA 3C7JA 3MWMA 4BJ6C 1HOMA 4CCOA 4BQNA 3OYMA 3OYFA 3MD2A 3V8JA 3I4MJ 2K4BA 3OSFA 1BC7C 2XUBA 1J59A 2LFBA 1M1EB 4R79A 2VT3A 2A05A 2E1OA 1WJCA 2ZJRF 4M6XA 2X85A 4XLAA 3L9FA 3L1PA 6PAXA 2L2OA 5D8KB 4A3MJ 2VI6A 1S3JA 4XKBA 1B6AA 4XSXF 1K4TA 3CCLI 2PQ8A 2NVYJ 4BXFA 2IVMA 4IHXA 1S6LA 1XDSA 2L4AA 3V7RA 4U88A 2W1OA 3HZJA 1LVAA 3QQAA 3S2HJ 3DU5A 1YYVA 2RNGA 4NDLA 1CGPA 2HQNA 5FO5A 4IHYA 3KFWX 2A61A 2ZC2A 4FTHA 2OU2A 3KETA 3HUGB 3MCZA 4P1WA 1XSVA 2CGPA 2E1CA 2JA6J 4G7OF 2N8GA 2Y31A 1XPXA 3D1NI 1U6GA 5E3LA 3UR3C 3FMRA 2HU9A 3I71A 3A03A 4PJ0C 2KQRA 2K40A 2Q2EB 5LGNA 2EPFA 4A2UA 5L3FA 2G9WA 2DW4A 2FD5A 4MQ9F 5ERIA 3SFZA 4RAFA 5EYRA 2EA2A 2DMTA 1B8IA 2KMUA 3K70C 1Z3XA 3PO2J 3FISA 1VQ6I 3HRSA 1IN4A 2JZYA 2K86A 5LGTA 2ID3A 4CH7A 2FMYA 2WV0A 3F22A 2R7XA 3M8EA 3RZDJ 3MFKA 4BAYA 4M72A 1HSJA 1XG1A 2C6YA 4KT6A 5GADJ 4G6TB 3U9GA 3J7ZI 1LDJA 1BI2A 3LAJA 3AL0B 3WE3A 3QYBA 3DTIA 4DBRA 2JRTA 1ZG3A 2F48A 1KZHA 5EZHA 2M45A 2IP2A 3D0SA 3P9CA 1DP3A 3HHGA 1VQ4I 2XGXA 3GCMA 1JUSA 1JUPA 2TRTA 2V1DA 1UG0A 4F93B 2DXIA 4XMYA 4IOCF 5ICFA 2L0KA 4HBLA 5DCMA 4MEXF 2IXSA 3C3WA 5KHDA 2R5YB 1PP8F 3G6EI 2NNYA 2F5VA 1Q1HA 3M8FA 4XLPF 2IS1A 4CZCA 4OU0A 1ZGJA 1WJ5A 2XGDA 4F3QA 5JR3A 2RDPA 2O0YA 1KA8A 3MEXA 2O9LA 2BE5F 4IZZA 1H9TA 3RKXA 3FF5A 3S8PA 1VQ8I 3S3NA 2XPUA 1F1ZA 2XV4S 2KDZA 1LDKB 3SHFA 1RZ4A 2XAGA 2KT0A 3HTUA 5E8IA 1X19A 5BPIA 3S1NJ 5E1WA 4PK4A 3D5SC 4LG0A 3ZMZA 1HDPA 2BY2A 2Z3YA 4EM2A 1S7AA 1V5FA 5E3MA 3F8NA 2DOAA 3WGGA 4U0YA 1O3QA 3I0TA 1J0RA 2DO7A 2VQCA 2JN6A 4Q5SF 3DEWA 2W25A 1E2XA 1ENHA 3BT9A 5K7HA 1Y6IA 1G3SA 3VSLA 3WU2C 2E1MB 4QIWN 3DBRB 3HOZJ 1MMNA 5KCMA 4DQ2A 4ENMA 2QCOA 2E1NA 3M9AA 3OIPA 4PUSA 2ZFWA 1W5TA 2PEXA 2XIGA 2JVGA 4E70A 3OYAA 2H8WA 3BOQA 2Q8KA 3BC8A 5HDKA 2W82A 1N77A 2ZXJA 3LFUA 1EH6A 1FP2A 1ZAOA 5J1YA 1YW8A 4DW6A 4C3JJ 1BC8C 5CKTA 2H27A 2E5NA 3V7SA 5L3DA 3IHUA 4UV9A 2EJRA 2HQ5A 1FC3A 4B3AA 1FZPB 3DQVC 4F7ZA 5CVRA 1RKTA 3A0BC 1HF0A 3DXJF 1IDZA 1MSEC 3HGYA 3VFZA 2OV7A 3GVAA 5LHHA 4A93J 4AM3A 1H9GA 4Y4RA 3NEUA 1MBEA 5E79C 5FKNA 3OYIA 4I76A 4MGRA 4M71A 1I50J 2JPCA 4WF2A 1AU7A 2ME0A 1HCRA 3PQKA 3F6OA 4JBAA 4HNTA 2OCEA 3WTYC 1J7KA 2F5EA 3DFGA 4E7KA 1MNMC 4HNVA 4LG3A 1PYVA 4HX7A 3K4BA 2QVOA 3CCRI 3TW7A 3BTLA 2CW0F 1JTXA 3ZMSA 1HKTA 4E6KG 4OINF 3ZPLA 3FM3A 4XKCA 1YS6A 3H3ZA 2E35A 1BR1A 2A6EF 3G3ZA 4LIUA 5H6QA 5LHIA 4XICA 3WTXC 1FTTA 4BXXJ 1HXDA 4AIKA 4LG0B 3MZHA 1MNEA 2R0QC 2WY8Q 1GVDA 3DLLF 4IPAA 2M8EA 2R7VA 3H0GJ 3WHBA 1X3UA 4KA4A 5J6XA 5IY5H 3WODF 4KDPA 4C3HJ 5TISC 3PNTA 1WCMJ 1R22A 2QLZA 3CC2I 1P4XA 2XVCA 2J5OA 4DBQA 1AHDP 2W48A 3L2VA 1D1CA 2P6SA 2FE3A 3RPUA 2QZ8A 2E34A 4F55A 2ZJQF 4KISA 1A31A 2PMZA 5E1ZB 1QQIA 2VE8A 3SDBA 2D5VA 2ZNZA 3K4CA 4G9YA 2EFNA 2HZTA 4IRGA 1KQ0A 4IQJA 1HW5A 1DP7P 1OQYA 1X4OA 4ZYGA 3KCCA 3TKYA 4IO9F 3OYEA 2BY0A 1ZG5A 1YO5C 4NB5A 4PFPA 5FLXK 2E5ZA 2XAFA 3L7WA 3BR5A 3JRCA 1OCTC 5FLMJ 1LE8B 4PSXA 3HIFA 4HX4A 5EGOA 4A3JJ 3JRHA 1KYZA 2STWA 3R4KA 3FZVA 4CYDA 4WXHA 3FXQA 4XNFA 3IAM2 5F0CA 1LDDA 4BBRJ 4LJZF 2LY1A 3NAUA 5DCFA 1KU7A 1Y0NA 5FLXZ 4BBSJ 2Y69H 2X48A 3J81K 1YIOA 1O4XA 2DMPA 3QU6A 2OUMA 5B1BH 1GVJA 5K7FA 2BHYA 4G6QA 1AWCA 4EQQA 4BHPA 2O8XA 2VOOA 1HDDC 4WXCA 3LNQA 1O3SA 5IYCJ 3TP3A 3CJRB 2L9NA 4OOIA 2PJPA 1Z6TA 3C2GA 5F04A 1QA6A 4HRIA 2DT5A 3J81Z 3WTZA 2DYSH 2LKPA 2A6TA 3VYRB 3E5UA 1KU9A 1K78A 4B8XA 2IGMA 2DTZA 3NWSA 2A07F 2F4OB 1WJFA 4XK4A 1RPWA 1QRYA 1I6HJ 4ZZLA 3HPGA 1Z67A 3QAHA 5CLSA 3FXJA 3HRMA 4FCYA 1A5JA 4A6EA 1NG6A 2L5QA 3DP7A 2HKOA 5IPAA 2EILH 4HAMA 1OYIA 3DEEA 2EINH 4B48A 4D5CA 2VQHA 4KFCA 2CO5A 3OYGA 4JX6A 1O3TA 3AFHA 2R7OA 3GTLJ 3IC7A 4DJAA 3OOPA 1MMGA 1D1BA 2DMQA 2MW8A 3JCUC 1XMAA 3TDUC 3A0HC 3IRQA 4MTDA 3OL4A 4BQOA 2P5LC 5LEJA 4CICA 4LB5A 3M8JA 3TBIA 3U1DA 2W24A 4R8HA 2I10A 5JVTA 3OS2A 2EZLA 1OCCH 2XC7A 4I2OA 3FXMA 1VZ0A 2VLAA 2PMUA 4BU2A 5E20A 2VN2A 2XPVA 5CVVA 1BW6A 4LLGF 3RPUD 3ULQB 3L09A 2ZCWA 3HOXJ 1Z7UA 2EFQA 4JQFA 5EGOB 3KEYA 3HKZN 1ZRDA 1T95A 3RSNA 3O2PE 1NH3A 1FYKA 5IP6A 4QSHA 1D0ZA 4RGSA 2QKLB 3IWFA 2DAOA 5FRMA 1G3TA 1MBFA 1QVTA 3K1NA 4XRSG 5D4RA 3D5LA 3IUOA 5FROA 3BR1A 3PSIA 2LH9A 3W6KB 3V4GA 2CUZA 2MD0A 2DYRH 2AHQA 2VKVA 1QBJA 2RQPA 3HB9A 2KRCA 4AU7A 3FBIB 1I5ZA 3E5QA 1EJ9A 1TQPA 4A0XA 2EBIA 2JA8J 3F8MA 1IV6A 1QGPA 4C30A 3B6CA 3QP5A 3REOA 4PZJA 3O3KA 4A3EJ 4FASD 3B73A 4HOBA 2EFOA 1K7AA 2DCEA 2KJBA 3FIWA 1WJEA 3HEFA 1K78B 3RDIA 1WQ2A 3BTIA 2NYXA 5AONA 1ZRFA 2XF6A 1R1VA 3HDDA 4EJVA 3SZGA 3FXKA 2IEKA 3FBNB 4FE7A 4WCGA 2H09A 1B9MA 1WWXA 1MD0A 3IAS2 4AUXA 1APLC 3RI4A 3FHNA 5IOZA 3A2KA 1USTA 2R7DA 2BVLA 4E7HA 4XN3A 1K4SA 2R7RA 2Z16A 2ZFUA 4WK8F 3JW4A 5HODA 1JE8A 3R6SA 1U5TC 3O8HA 3QOEA 3K1MA 2F5DA 2XDVA 3JR9A 1XSDA 1A36A 4U7BA 3OSGA 5HNFA 2X1DA 2YS9A 3SXYA 4B1RA 4YRVA 3FKJA 2O7OA 4LGWA 1YG2A 1LEAA 3QYFA 3AAFA 1JI8A 2WADA 3G1LA 2E60A 3L00A 1U9OA 5H20A 4Y52J 4HF1A 5KAFC 4ZTFA 3BG7A 4KN4X 1DPRA 3HSEA 2EV5A 1OR7A 2LRDA 4IX7A 1D0XA 1U0JA 3RJPA 3DWLE 3F8FA 1RUOA 1QPIA 5DYMA 4A3KJ 3RTRA 5DM6F 2MC3A 2RGVA 1CQTA 4BQAA 1WI9A 3DLAA 1H88C 3AG4H 3C2HA 4BJ5C 4W1UA 1WZ2A 3H92A 1O57A 4L18B 5FB2A 1BN5A 1WJAA 2M34A 3K4KA 4E4HA 3KP5A 1ETQA 3ZXSA 2FF4A 3CC4I 3C1DA 2BY1A 5D6FA 2NNNA 3DPUA 5LRSA 2V9KA 4LLLA 1QHGA 1FBUA 2MYSA 1XB4A 5GPAA 4PGHA 1VQPI 2V1XA 4YIFA 1UHWA 2LREA 2YPRA 2CJJA 2ZSHB 3N97A 2XKOA 3EUKL 2HXOA 1MMDA 3KIOA 2CV2A 1SFKA 5L3CA 3ZRGA 1IUFA 2JSCA 3E0JB 5B3SH 5KAIC 3QPSA 5ICGA 2IAIA 2LK2A 3CDIA 3S32A 5C3EJ 4XORA 3WU1B 4UB6C 3V8KA 3C18A 3ZOBA 4CGZA 4BY7J 1YTYA 3SZTA 4F52A 1ETVA 2D1HA 2XB5A 3F8CA 3ZN1A 3P9IA 2ISZA 2F4MB 3HSFA 1EH8A 3WHCA 1VTNC 1SAXA 5L3BA 1TZLA 2CUJA 5FKLA 2K02A 1D5VA 1GV2A 3H5NA 4L5EA 4RS8A 3ABUA 3HGGA 2CUFA 1S8NA 4O6JA 4BL0B 5M5WJ 3M3YJ 1OMIA 5EG0A 3CCYA 1RC9A 3BJ6A 1VQ5I 2QF7A 1JJ6C 2KRHA 1JKOC 2K9QA 1RI7A 1YJWI 3A01A 3PUBA 4HLYA 4RM3A 3PSFA 2STTA 3E6DA 3JSOA 4OAYA 1RR8C 4Z2YA 4HF2A 3I54A 1GUUA 4GDFA 1XDUA 5EEGA 1ZYRF 3DKWA 4S0HB 1Y0UA 3QPTA 4J00A 1CF7A 2XKPA 1LKXA 1TWCJ 1FMWA 3J80K 2LF8A 4XLHA 3ZQGA 4RB1A 1F5TA 2W85A 3QWLA 3G1OA 4MNUA 2OA4A 2DI3A 3KP4A 4X0GA 3VOEA 2VOPA 2ZBKA 3CP8A 5EDNA 1ZGWA 3GTMJ 5M3FJ 3QPLA 4B09A 4U7DA 4BJTA 4OIPF 3J80Z 1YIJI 1ZK8A 1PVEA 2NS7A 3M1CA 4OAZA 4XRFA 1LVKA 1YX5A 5FFZA 1QZYA 3OYKA 2VBXA 3B6AA 5J4VA 5FKMA 1T56A 1OISA 3JRGA 5HLHA 2JQ7A 4JP0A 3OIOA 2K9NA 3MZYA 2QQAA 3GBGA 2M0MA 4K2EA 4G6DA 3QODA 3HJEA 5JHFA 1WGXA 4M9ZA 4J01A 4DOZA 2FXAA 2F5FA 5F27A 1IZ1A 4QLCU 2R7ZJ 1QHHD 4FX0A 4XSZF 1I6XA 1SMTA 1W1WE 4LMYA 2H94A 2IBDA 1H8AC 3ZCOA 2L4MA 2CG4A 5IP7J 3GO5A 1LB2A 2CV1A 3GTOJ 2FBKA 2ME6A 3IWZA 3K10A 2K9SA 1MNDA 1IXCA 1MW7A 5EEAA 4M9XA 1QU3A 1W5CC 1MJBA 2BGCA 2ISYA 3Q0VA 1D8JA 3BG5A 1SFUA 1V5EA 3K4MA 1XC5A 2A5YB 2R4GA 1IRGA 5DUKA 2HOEA 5EG0B 1ZARA 2CQXA 3DEUA 1SANA 4CCLA 4GFBA 2JUCA 3HL2A 3A01B 3KZZA 4ENKA 1FSEA 1ORKA 3H3UA 2HTSA 1U5TB 2MABA 4XL9A 3WU0A 4NHJA 1GV5A 1LFPA 3VSKA 2DDAA 3OYDA 3GLXA 1G2HA 1YI2I 3LSIA 4KNYA 3BQYA 1REPC 4L5IA 3W6JB 1O7FA 1JXSA 2DMNA 2WTEA 4HF0A 2OTLI 4XOPA 2FQ3A 1R00A 4ZC3A 3GFJA 3SZPA 4C9YA 4BEHA 3PL8A 1LEBA 4I0BA 4PJMA 1PUEE 5HVQC 1B4AA 5F0HA 3BDDA 5HOOA 1I1SA 3ABTA 1L3LA 4Q4ZF 2OQGA 1Z21A 1HA8A 2R5ZA 3MN2A 3E7LA 3W3CA 3X2QH 2KHMA 3MVPA 2IA1A 3J7AY 3LWFA 5ILUA 1KU3A 2HKXA 2Q1ZB 1QNTA 1R1TA 4A0ZA 4LB6B 1F4KA 1BR2A 3R0AA 4UUSA 1HBXG 3S17J 4M3FA 1TTYA 2BEOA 4YFNF 5BPDA 3FXRA 4GRIA 1P4AA 4RMNA 1ZRCA 2R3SA 4CA0A 1ZREA 5ED4A 3KP6A 4FT8A 1AOYA 2MC4A 2AS5F 2JT1A 1BI3A 1MBHA 1N25A 1S9HA 5D6EA 3LMMA
chains in the Genus database with same CATH topology
3VWBA 4IQJA 1X4OA 3HC7A 2VJ4A 1NG7A 3HOSA 4BDYA 1J09A 3A1YA 2UV1A 3OYEA 2M4KA 4HSRA 4FETA 3FDYA 4PFPA 2E5ZA 4PJJA 3DKYA 3OYBA 1E0EA 4PSXA 1X1BA 4IQ4A 3DKXA 2VJJA 4XNFA 3IAM2 2ZSIB 5HNHA 1UAAA 2LY1A 4LITA 2LYCA 1W36D 3QYEA 4H4KC 4ZJZA 1DQUA 3H5AA 5CQEA 2BVMA 2OUMA 1G59A 2X1EA 5TGTA 2BOLA 2RQQA 2LG4A 2DT7B 2JA2A 4PJNA 2X6XA 3OS0A 3OYHA 3CJRB 1IRXA 2L9NA 3C2GA 1YX3A 4HRIA 1G8XA 3PNYA 2NOJB 2A6TA 3VYRB 1PJRA 3AL0C 2X1CA 2Z2SB 3RCOA 2V1NA 2IGMA 2L7KA 3NWSA 3HG9A 2LBFA 3LSGA 1WJFA 3OOUA 3RQ4A 3PJRA 2JVHA 3DTEA 4QPOA 2Z1DA 3HPGA 4B44A 3V42A 4OWRB 2ZXHA 4XN0A 2O5RA 3H0DA 1NG6A 2L5QA 4XR6A 1ZELA 2KZVA 4E7LA 4XLFA 4XKWA 3DEEA 4B48A 2KLOA 2VQHA 4XQFA 3OIQA 4B43A 2HPMA 3OYGA 2M7AA 2VIXA 2VPLA 1BOBA 3H9QA 3AFHA 2R7OA 4DJAA 3LSKA 1MMGA 1D1BA 2XAUA 2W00A 3PNVA 3TMOA 2ZXIA 3BLYA 4HG2A 5FRNA 3OL4A 4BQOA 3H9GA 1Z7LA 2ELJA 4ZYAA 3M8JA 3TBIA 4BACA 3OS2A 3S3OA 4E7SA 2XC7A 2UWMA 1VZ0A 3OYJA 3BCAA 4BU2A 2VLAA 2QKMB 2V7FA 4XLEA 3PFYA 2FUG2 3HOTA 3RPUD 3E1SA 4XOTA 3S93A 1D1AA 4LIVA 4JQFA 5LFAA 3I3LA 2KPMA 2WAQA 3KEYA 4B3XA 4P5OA 4AVZA 2R7SA 4CCNA 1T95A 3RSNA 1X1DA 3LSMA 2WY7Q 3OYLA 2HDWA 4ANJA 1D0ZA 2QKLB 5FRMA 4BE0A 2P0WA 3MMYB 3ZQQA 3L2QA 2V6EA 2E1MC 2CS3A 3D5LA 3IUOA 5FROA 3PSIA 4IKFA 2LH9A 4NNJA 3S3MA 2CUZA 2MD0A 3A4CA 4EATA 4HNUA 2KRCA 4AU7A 3OL3A 3FBIB 1T0FC 1V5GA 3H9JA 4QPQA 3L2WA 3OR2C 2WA0A 2K5CA 4C30A 1YE9A 1SAUA 4RLFA 2VASA 2VKHA 4FASD 2HNHA 3KX2A 2DCEA 2DJIA 2HVQA 1WJEA 2IGNA 3HKZA 2CMPA 3SEZA 2XF6A 3K4NA 3SYTA 3ONQA 2CV0A 4DIQA 1MMAA 3DU6A 3SZGA 2I8DA 2XSJC 2V26A 3FBNB 4CSWA 3IAS2 1WJBA 2Y0SA 3EPZA 2CW7A 3D5RC 4RLQA 3FHNA 2PJRB 4ZDOA 1Y56A 2CW8A 3A2KA 2BVLA 4E7HA 4XN3A 4C2UA 2IGKA 2Z16A 2ZFUA 2R7RA 1N78A 2HVSA 4BJ6C 2M3AA 3QOEA 4ZDPA 4CCOA 2XDVA 4BQNA 3OYMA 1X4PA 3MD2A 3N05A 4U7BA 3OYFA 2R7QA 5HNFA 2X1DA 1K6YA 4YRVA 3FKJA 3ZGKA 3H35A 3G2BA 4R79A 2W4SA 4ITVA 3W2AA 2JSPA 3QYFA 3L2UA 1JI8A 1WJCA 2RREA 2WADA 2E60A 2AQEA 4II2A 2X85A 4XLAA 2M7BA 2L2OA 4XONA 2K9LA 2M4GA 4ZTFA 4XKBA 3BG7A 2LY2A 3OYNA 2HQAA 3VYSB 4BEHB 2WAEA 4XM3A 4N4NB 2W7NA 2LRDA 4IX7A 1D0XA 1U0JA 4BXFA 3DWLE 2R7WA 2W1OA 3RTRA 4AYBA 3DU5A 3DLAA 4E7IA 2RNGA 2X6YA 3C2HA 3MKZA 4BJ5C 3OY9A 2IS4A 2KL4A 3HUGB 2VJ5A 4P1WA 1WJAA 3K4KA 4E4HA 1OR7C 3HPHA 4PSWA 2BW3A 3ZXSA 4Y3OA 3DPUA 3L2RA 2V9KA 3UR3C 1QHGA 2MYSA 2HU9A 2KQRA 2LREA 2Q2EB 4N4OB 2ZSHB 3EUKL 1MMDA 2CV2A 1SFKA 4NC7A 3ZRGA 2CFOA 3E0JB 1W36C 2VJIA 1GLNA 4JOMA 2KMUA 1WJDA 2R7UA 3MKYB 3K70C 1Z3XA 1D0YA 3S32A 4ZTJA 4XORA 3SEQA 3VYTB 4CH7A 4KITB 4F52A 2R7XA 2LOOA 4F92B 2X51A 2LC2A 3TL4X 4KT6A 3HXLA 4G6TB 3KYLA 3AL0B 3QYBA 1TZLA 2CUJA 3DTIA 4DBRA 3H5NA 4HSTA 2K3PA 1DP3A 2AQFA 4BL0B 2DT6A 4ZDLA 2R7TA 2KRHA 3VDXA 1UG0A 4D9JA 4F93B 5CQGA 2DXIA 4XMYA 3PUBA 4RM3A 3PSFA 2IXSA 2XF7A 1ERDA 4YELA 5KHDA 4OAYA 2JUGA 3CP2A 3CF2A 2LBFB 4BGDA 2F5VA 3EUHC 2OC6A 2XF5A 4J00A 2IS1A 4CZCA 4F3QA 1WJ5A 1LKXA 1OLTA 1FMWA 4NC8A 2VKDA 3BG6A 4XLHA 2VQGA 2MFZA 2F6CA 4MLOA 4IZZA 2GOXB 3S8PA 3VYUB 3S3NA 2VXZA 4X0GA 3W2WA 4CUGA 1LDKB 2BW3B 3CP8A 2HZDA 4BJTA 1X19A 3LL7A 4PK4A 3D5SC 4KJZA 4PFOA 3IP4B 3M1CA 4OAZA 3OR1C 3OS1A 4CCKA 1LVKA 1YX5A 4HEA2 1V5FA 2X6WA 1DGWY 3OYKA 1P9QC 2DOAA 2VQCA 2CH0A 3GBGA 2UUZA 3K70D 1Y6IA 3EUAA 2M0MA 3VSLA 2E1MB 2IGOA 4F91B 1X1AA 4NQWB 3QODA 3W2VA 5JHFA 3CESA 3BCBA 4HPQA 1MMNA 5KCMA 4DOZA 4J01A 4PUSA 3OIPA 4E7ZA 4NUBA 1QHHD 2JVGA 3OYAA 1BR4A 3DPTA 3BC8A 2W82A 1N77A 3ZCOA 3LFUA 2CV1A 4D1QA 3K10A 1MNDA 1MW7A 4BE2A 2A5WA 5KNLA 5CKTA 1QU3A 2E5NA 1FMVA 1EA3A 3MKWB 3K4LA 2KP6A 5CPRB 1V5EA 3DPLC 1TT0A 3K4MA 3DQVC 4BQQA 4BS9A 2R4GA 2V4JC 3CZ6A 4U87A 3CMMA 2PJRA 4II3A 4BE1A 3LSHA 1WFXA 4XLCA 4CCLA 2VQLA 2OV7A 3HL2A 2HPIA 5LD2C 4DGWB 4Y4RA 4B47A 5HLTA 2WAFA 1AA7A 2KDOA 3OYIA 2MABA 3K6GA 4XL9A 3K4JA 3OYCA 1LFPA 4BUPA 3VSKA 4CCJA 3OYDA 4HNTA 1Z3YA 2WBMA 2HVRA 4E7KA 1N75A 3LSIA 4LG3A 1PYVA 3F9KA 3K4BA 2WB1A 2IS6A 2GOMA 4XOPA 3UNGC 1DGRM 3OWTA 4ZC3A 3H5RA 4C9YA 4E6KG 4C2TA 4BEHA 3PL8A 4XKCA 2VB6A 3ZR8X 4PJLA 4PJMA 1BR1A 3I9V2 4Y33A 4LIUA 3AKZA 3U21A 2IS2A 2VL8A 5HVQC 1UELB 4XKVA 5HOOA 1MNEA 4RM2A 4BDZA 2WY8Q 1Z21A 3CJQB 1HA8A 4CCMA 3W3CA 3NWTA 2KHMA 2R7VA 3J7AY 2K9MA 2Q1ZB 1R6RA 1X1CA 4YEJA 1BR2A 2L9SA 3DTKA 3PNTA 3OMYA 4GRIA 4DBQA 4RMNA 4E7JA 4CA0A 3L2VA 1D1CA 1KONA 4F55A 4KISA 2PMZA 2VXDA 3SDBA 2MC4A 2F4IA 1S9HA 3K4CA 3LMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEY A;  3K10 A; 
#chains in the Genus database with same CATH topology
 3VWB A;  2K7L A;  1MKM A;  2RV8 A;  2H1L A;  2FBH A;  3ERM A;  1PDN C;  1WRJ A;  3QPH A;  3ERE D;  1YS7 A;  2YSR A;  4IF4 A;  2QSG X;  1V3F A;  3SDG A;  3HOS A;  1OPC A;  5BNG A;  1J09 A;  3PM1 A;  3A1Y A;  1SMY F;  2VT2 A;  3S16 J;  2COM A;  1JT6 A;  4ASN A;  1VI0 A;  5D5V B;  4FET A;  4M3D A;  1JKR C;  4PJJ A;  2IPQ X;  3RQI A;  5EJC A;  1T38 A;  2LMD A;  3GTJ J;  4IQ4 A;  3KLO A;  2VJJ A;  1Y39 A;  4QWQ A;  1UB9 A;  1W7P A;  3EYI A;  1NHA A;  2JJ7 A;  2QQ9 A;  1YJN I;  1K83 J;  5HNH A;  4IEJ A;  1UAA A;  4KMF A;  2OCC H;  1IRF A;  4ZJZ A;  1B8I B;  1DQU A;  3FHZ A;  3WG9 A;  1EV7 A;  4BYY A;  5B1A H;  3IKT A;  2ZJ2 A;  2CRG A;  4EEF G;  1D5Y A;  1Y1W J;  2VON A;  1RNL A;  3OS0 A;  2EWN A;  3OYH A;  3RZO J;  2XRL A;  3HBL A;  3ZQF A;  3I53 A;  2XRO A;  1GXQ A;  1Z05 A;  4AVP A;  2NOJ B;  3K9T A;  1ZH5 A;  3J7Y J;  3CUQ C;  3IH4 A;  2Z2S B;  1BW5 A;  5GPC A;  1E3O C;  1UHM A;  2LBF A;  2L9V A;  3RQ4 A;  4EJW A;  3PJR A;  2JVH A;  3CJT B;  3F23 A;  4OWR B;  2ZXH A;  3S15 J;  1MH4 A;  4XN0 A;  2QYO A;  1FBQ A;  2P5V A;  2Q0O A;  4IRI A;  4I01 A;  1OJL A;  3F72 A;  1P2F A;  3ISP A;  1BL0 A;  1ZEL A;  3P9K A;  2P81 A;  4E7L A;  3H3V K;  3R61 A;  4BH9 A;  5JI6 A;  5DCM B;  5F08 A;  3E3V A;  3OIQ A;  3BR0 A;  2WAQ N;  4I98 B;  4UUS B;  1B1B A;  2HPM A;  3TO6 A;  2VIX A;  2QGU A;  3H9Q A;  2OPT A;  2B7E A;  1LUJ B;  3F0C A;  2ELH A;  2CYY A;  2KFD A;  3COA C;  2W00 A;  3T8R A;  2R7F A;  3HTS B;  4X6A J;  4FIS A;  5DD4 A;  1IN5 A;  3BLY A;  4HG2 A;  4G7Z F;  1V54 H;  2M5W A;  2FX0 A;  2M0C A;  3G73 A;  5FRN A;  5HDG A;  1JGS A;  3H9G A;  5JLW A;  1Z7L A;  1TL8 A;  2EZH A;  1MZB A;  1A35 A;  1Z9C A;  3TOB A;  3EDP A;  5KK1 A;  2DA7 A;  1X3W B;  2UWM A;  3BCA A;  2XAH A;  3WTS C;  3KZY A;  4O5V A;  3I64 A;  4XLE A;  4A3F J;  4XOT A;  2QM3 A;  2VC0 A;  4LIV A;  1R58 A;  3U2R A;  3BWG A;  2GXA A;  4IHW A;  2Z99 A;  2CQQ A;  2KPM A;  4B3X A;  1IO2 A;  4AVZ A;  2R7S A;  5A2Q K;  3BG9 A;  2L7M P;  5AIQ A;  1Z77 A;  5BOX A;  1W7P B;  2MA3 A;  1D8K A;  1YRN A;  3LSM A;  3OYL A;  1BI0 A;  2KIF A;  4A3C J;  2NOG A;  2DPD A;  5DDG A;  3K2Z A;  2HOA A;  2XAQ A;  2AXT C;  2QQB A;  4I09 A;  3A4C A;  4N9I A;  3DBL B;  2H8R A;  5A2Q Z;  1PUF A;  2FJ1 A;  2H1K A;  1T0F C;  3H9J A;  1XX5 A;  4QPQ A;  1X2M A;  3L2W A;  1W7P D;  2WA0 A;  3OR2 C;  5IYD J;  2FNA A;  1YE9 A;  1SAU A;  4RLF A;  3KLN A;  2VKH A;  1R5I D;  2ZJP F;  3KEO A;  2X0L A;  4S05 A;  5D8L B;  2DJI A;  2ECB A;  2HVQ A;  4IHS A;  4ABZ A;  1SFO J;  4PCQ A;  4GO1 A;  2VC1 A;  3GZN B;  2UZK A;  3K4N A;  2HGC A;  3PIP F;  1USS A;  2RKH A;  1FNN A;  2G7H A;  2XSJ C;  2V26 A;  4CSW A;  1T39 A;  1WJB A;  1U3E M;  2EIM H;  2ACJ A;  5LLQ A;  1SD7 A;  3EPZ A;  2CW7 A;  2V6C A;  1Y56 A;  1UMQ A;  3T0Y A;  4L0Z B;  4C2U A;  2DJN A;  5LRR A;  1N78 A;  4FQG A;  4M73 A;  2HVS A;  1IDY A;  1VQ7 I;  3CUQ A;  3ZQL A;  2M3A A;  4ZDP A;  3CCV I;  5CYV A;  1RUN A;  3UKG A;  1X4P A;  3BR2 A;  2ZXW H;  1K6Y A;  2DA5 A;  3LQQ A;  3AG1 H;  2JPB A;  4ITV A;  2JSP A;  1ON2 A;  4EMS A;  5IYB J;  3L2U A;  2RRE A;  4D5F A;  5M5X J;  2NAZ A;  4II2 A;  1LNW A;  3BZC A;  2M7B A;  4W97 A;  1UHS A;  2K9L A;  1ZN2 A;  2LY2 A;  1B72 A;  3K69 A;  3VYS B;  2WAE A;  5K5O A;  2DFH A;  4XM3 A;  4N4N B;  3HYI A;  4S04 A;  3HOW J;  1ZTR A;  3SJM A;  1P4W A;  2R7W A;  2ZME C;  3I59 A;  3K7A J;  5K1Y A;  5M5Y J;  4EJT A;  4Q47 A;  4G7H F;  1WSU A;  2IRF G;  1S7E A;  3MKZ A;  1YRN B;  2NXN B;  1RIO H;  5LBQ A;  5GTH C;  2KL4 A;  3ZQ7 A;  3S1M J;  2VJ5 A;  1ZKG A;  3AG3 H;  2V79 A;  3FMS A;  4I6Z A;  1OR7 C;  3HPH A;  4HDV A;  2BW3 A;  1XTA A;  2D1V A;  4Y3O A;  1HST A;  3I4P A;  3L2R A;  2MSY A;  4FE4 A;  2GLO A;  3LOC A;  3DV8 A;  3GZ6 A;  4BHB A;  3Q0U A;  3KEQ A;  1PUF B;  1JUM A;  3JRF A;  2QSF X;  1IN6 A;  1UFM A;  4MFD A;  4ESJ A;  2PFB A;  2D45 A;  2Y0M A;  4N4O B;  2NS0 A;  1YW7 A;  2GWR A;  3FM5 A;  2DPU A;  3ABK H;  4OMZ A;  1JHF A;  4NC7 A;  2FA5 A;  3ROU A;  4A3G J;  2CFO A;  1GLN A;  3BZ6 A;  5CVU A;  3KP7 A;  1D0Y A;  2HYJ A;  2X9D A;  4NQW A;  2EB7 A;  3BP8 A;  5JLX A;  3KP2 A;  3SEQ A;  2ZO4 A;  2L02 A;  4KIT B;  3KE2 A;  2TDX A;  2DOF A;  1XSX A;  2E7X A;  4Y13 A;  4EJO A;  1T0F A;  5L3E A;  1EKE A;  2YU9 J;  1C0W A;  2X51 A;  2LC2 A;  2VPR A;  2K85 A;  3TL4 X;  2LTP A;  2ZB9 A;  2XAJ A;  3WGH A;  1ETX A;  2L7F P;  1S72 I;  1FTZ A;  3HXL A;  5DD8 A;  4Y7N J;  3PFI A;  2JK3 A;  4JX4 A;  2DA6 A;  3GME A;  2TCT A;  2DLL A;  3CUQ B;  2DA1 A;  4BKX A;  1K6O A;  2Y0S N;  3BQZ A;  4HST A;  4AIH A;  4RGX A;  1YOV B;  3TDZ C;  2DT6 A;  2KRF A;  4P96 A;  3P7N A;  4IJA A;  1ZR2 A;  1T6S A;  2I5U A;  2EZK A;  2BXY A;  4QTR A;  3KYC B;  4KIF A;  3S2W A;  4YEL A;  1U9N A;  1XCB A;  1SVL A;  2G7U A;  1G6N A;  4IL6 C;  2FU4 A;  2LVS A;  5H6R A;  4ZZD A;  4BGD A;  3F21 A;  1B72 B;  1U8R A;  4P9U A;  3QOP A;  1DPU A;  1VND A;  3CQZ J;  1SD4 A;  2EQR A;  3EUH C;  1DUX C;  2QEN A;  4RAG A;  5C44 J;  4EGZ A;  2Y48 A;  2HYG D;  1OLT A;  4NC8 A;  2VKD A;  2E71 A;  3BG6 A;  1MJA A;  2VQG A;  1G3Y A;  2F6C A;  2KIU A;  2YU3 A;  3BZK A;  1P7I A;  4IXA A;  3VYU B;  2L9R A;  1T98 A;  3GZ5 A;  5FJ8 J;  4AYB N;  2BW3 B;  2B0L A;  3H1C A;  3LST A;  4KT5 C;  1FLI A;  2YR2 A;  3LL7 A;  4B4C A;  4ESF A;  4KJZ A;  3CCM I;  3IP4 B;  1TQM A;  2ZME A;  1TNT A;  1BJZ A;  1S5L C;  3HHH A;  3OR1 C;  1R49 A;  3OS1 A;  4CYC A;  5E3O A;  3WTV C;  2GZW A;  2X6W A;  2AXL A;  3CJN A;  1XMK A;  4BNC A;  2WC2 A;  1EH7 A;  5C4J J;  4RGU A;  4OMY A;  1FIA A;  1Z1D A;  2QSH X;  1BOA A;  5D5W B;  2ICW G;  4XID A;  1UZC A;  2Y2Z A;  3EUA A;  5F1J A;  1I27 A;  2IGO A;  4C2M J;  4F91 B;  1X1A A;  2FRH A;  2OZU A;  4NQW B;  3GTP J;  2Y9Y A;  3BCB A;  3GX4 X;  4UB8 C;  1OCR H;  4E7Z A;  1TWG J;  2QQ8 A;  3RKQ A;  2HDD A;  1XD7 A;  2LR8 A;  1ZLJ A;  3FXL A;  1B9N A;  1LFU P;  3GYH X;  4CXF A;  4D1Q A;  2HYF A;  1VQL I;  1XGN A;  1LPQ A;  4G12 A;  3Q9V A;  5HS7 A;  4YIR X;  5E8G A;  5GAG J;  5KNL A;  1FMV A;  3MKW B;  1ETW A;  1JTY A;  1TW2 A;  5CPR B;  3KP3 A;  2O03 A;  2XB0 X;  3DPL C;  3CCE I;  1IXS B;  4Q48 A;  4MHG A;  1WKM A;  4BQQ A;  5FFX A;  2RNJ A;  2HWV A;  1VF9 A;  2V4J C;  2DFE A;  2J5P A;  2DA4 A;  3CZ6 A;  3FK7 A;  4IRH A;  3BPV A;  4U87 A;  3CMM A;  2PJR A;  2ID6 A;  4II3 A;  3LSH A;  1WFX A;  3PQJ A;  1E3H A;  1IAW A;  5F0F A;  2HPI A;  5LD2 C;  1YIT I;  1V4R A;  5HLT A;  2P5K A;  1W4M A;  2KDO A;  2P7V B;  4A12 A;  2LNB A;  2E19 A;  3CCJ I;  5B66 C;  4FHT A;  3K6G A;  4OIO F;  3K4J A;  3OYC A;  2DDB A;  2FOK A;  2MBF A;  1SFX A;  4CCJ A;  3ZMV A;  1WH7 A;  2P4W A;  2YX7 A;  3ESW B;  3ZQC A;  2WBM A;  2E2H J;  4IHV A;  2PI0 A;  1N75 A;  3I55 I;  5JFR A;  4V2G A;  5B5E C;  4IVN A;  1P92 A;  2IS6 A;  2DBB A;  2GOM A;  2OZ6 A;  1ULY A;  3UNG C;  3NAR A;  5J8F A;  5FD5 A;  4C2T A;  5CVI A;  1XGO A;  2VB6 A;  4UHT A;  2CSO A;  2MG4 A;  2PMZ N;  3HM5 A;  2Z33 A;  5E18 F;  4M74 A;  2RN7 A;  4MO7 A;  3I9V 2;  3AKZ A;  1OYW A;  3TO9 A;  2IS2 A;  3ASO H;  4Y17 A;  4L0Y B;  4XKV A;  3EUH A;  2ZME B;  4YFK F;  4A3B J;  4RM2 A;  2L01 A;  4I99 C;  4CYC B;  4BDZ A;  3CJQ B;  5E1X A;  4CCM A;  3ZMT A;  5IT3 A;  4ZYD A;  4V2F A;  3HUG A;  2K9M A;  1BJA A;  4YFX F;  1TC3 C;  1R6R A;  4X1E A;  2DK8 A;  1T33 A;  3E6C C;  2B9S A;  1AKH A;  4L9N A;  1NK2 P;  2EH3 A;  5JHU A;  1SD6 A;  3BR6 A;  5J1U A;  1YLF A;  3JTG A;  3WTW C;  1BIA A;  4LK0 F;  5J1R A;  4RB0 A;  1BA5 A;  2Y30 A;  1E17 A;  1TQI A;  1R36 A;  3BJO A;  1O7L A;  2VKE A;  4U0W A;  3I56 I;  4UUT A;  3RYP A;  4A3I J;  4HQM A;  4MEY F;  4LLN A;  2W84 A;  4WWC A;  3ZP5 A;  3J7A O;  3GTG J;  3GF2 A;  2FSW A;  3HC7 A;  3CUO A;  1NG7 A;  2V9P A;  2Y75 A;  4EGY A;  4BDY A;  1J75 A;  2QBY A;  3ABM H;  2BBY A;  4HSR A;  3RKY A;  2YX4 A;  4H0E A;  2M8G X;  1J9I A;  3OYB A;  1Y8R B;  3KYD B;  3JAM K;  1H89 C;  2MLK A;  4A3D J;  3DKX A;  1ON1 A;  2VUM J;  1XGS A;  3F6V A;  2FQ4 A;  1SD5 A;  5FD6 A;  1VQO I;  2PN6 A;  1XCV A;  2ZSI B;  3F3X A;  1HKS A;  1YFH A;  3GLL A;  3PIO F;  2LYC A;  1B59 A;  2EK5 A;  4G8X A;  4MQV A;  1X2N A;  2V1U A;  3QYE A;  3ELK A;  1YQA A;  4H4K C;  4AD9 A;  2GA1 A;  2BVM A;  3SQN A;  3JAM Z;  3RKW A;  2QA4 I;  2DMU A;  1TP4 A;  2JA5 J;  2R93 J;  2ELK A;  2BOL A;  2BY3 A;  1OCO H;  1STZ A;  2DT7 B;  2JA2 A;  4L9V A;  2K3F A;  5TGT A;  3CMA I;  3CD6 I;  4IHT A;  4EVI A;  4RBO A;  5ILS A;  1R5G A;  1SVM A;  4CDG A;  1KQ8 A;  1YX3 A;  3JSP A;  2QEX I;  4LFU A;  2O61 A;  4KYW A;  1PJR A;  4JK1 X;  2XRN A;  5J3L A;  3RCO A;  1QZZ A;  2V1N A;  2L7K A;  3CDL A;  3N4M A;  3LSG A;  2R5Y A;  1VQK I;  3DTE A;  4QPO A;  3RYR A;  4B44 A;  1RR7 A;  3V42 A;  1R23 A;  2WB1 N;  2O5R A;  3MZ8 A;  1FJL A;  2IJL A;  3H0D A;  5F6F A;  2KKO A;  2UXX A;  1SEU A;  5J47 A;  5H2F C;  1O3R A;  2KZV A;  4XRS A;  3WG7 H;  1EF4 A;  2RVC A;  4N0B A;  4XLF A;  2HEO A;  2HOS A;  5E3N A;  3WTT C;  3QRF F;  1TWH J;  3O8G A;  2BYV E;  3B02 A;  1ZG1 A;  1AKH B;  1I3Q J;  2M7A A;  4N9H A;  3CC7 I;  1ZLK A;  1BOB A;  2VPL A;  1A6I A;  2RC4 A;  3LSK A;  3ZQI A;  2XAU A;  1Y8Q B;  2EIJ H;  5DS9 A;  1KYW A;  2DN0 A;  1CF7 B;  5E17 F;  1OCP A;  4HV6 A;  3JRB A;  3TMO A;  2ZXI A;  2HOT A;  1BIB A;  3GFI A;  2XHK A;  2NS8 A;  3KZI C;  2KIS A;  3JRE A;  4GYI A;  3ASN H;  1WPK A;  1R5H A;  3K2A A;  2QBY B;  3HSR A;  3S3O A;  2A6H F;  1FOK A;  1MH3 A;  4HV5 A;  1FWZ A;  3HOY J;  2QKM B;  2V7F A;  3PFY A;  2FUG 2;  3HOT A;  1D1A A;  2L3D A;  4HW0 A;  3JRI A;  5LFA A;  4LOC A;  3I3L A;  3SFI A;  3V8L A;  2CUE A;  1HW1 A;  2KJC A;  1DU6 A;  2WY7 Q;  4A6D A;  2HDW A;  4ANJ A;  3CCU I;  2Y9Z A;  2HDC A;  2DFF A;  1S7O A;  4BE0 A;  4GGG A;  2V6E A;  5HDN A;  3L2Q A;  2L54 A;  2CS3 A;  3S3M A;  1UG2 A;  2H6B A;  1R4M B;  2BXZ A;  4A3L J;  5DTD A;  4EAT A;  1FOW A;  1MGT A;  1OYY A;  1ETK A;  3OL3 A;  2PX9 A;  1RRJ A;  3LQR A;  2H6C A;  1W0U A;  1ETY A;  1SVO A;  2K5C A;  4GYG A;  2KIQ A;  4DYQ A;  4HA8 A;  2VAS A;  4R1H A;  5IT9 K;  2LDU A;  9ANT A;  1OFC X;  2HNH A;  1UJ8 A;  3KX2 A;  3CO6 C;  1JJ8 C;  4DZP A;  4ESB A;  2IGN A;  3HKZ A;  1X58 A;  4CHU A;  2CMP A;  3DF8 A;  2IW5 A;  5F64 A;  3ONQ A;  3VEP A;  4UY8 I;  3CDH A;  2HR3 A;  2PLY A;  2E2J J;  4L5J A;  1I1G A;  4YII A;  1J2X A;  2XPW A;  5IT9 Z;  3CTA A;  2Y0S A;  5ICE A;  3CCS I;  3D5R C;  2IA2 A;  3JRA A;  2HTJ A;  2GA2 A;  2CW8 A;  3CF5 F;  1A04 A;  4M6Y A;  2P8T A;  2IGK A;  1HLV A;  1XS9 A;  3ML6 A;  2EFW A;  3K1P A;  5GAE J;  2WV1 A;  4IOA F;  2DA2 A;  1JKP C;  4V19 K;  3N05 A;  2FNP A;  2EV6 A;  2GIV A;  2R7Q A;  5CVJ A;  5L3G A;  3ZGK A;  3H35 A;  3E97 A;  3G2B A;  4DNC A;  3R0J A;  2W4S A;  3W2A A;  1Z91 A;  2CFX A;  1U2W A;  2CWE A;  5HLG A;  1ETO A;  1OCZ H;  2K4J A;  2AQE A;  3FXO A;  5K5Q A;  2O3F A;  5HS8 A;  3T8T A;  1IW7 F;  1XN7 A;  4KIB A;  4XON A;  2M4G A;  3OYN A;  2HQA A;  3Q9S A;  4BEH B;  3ZMU A;  2W7N A;  4M9S A;  4ENN A;  2A69 F;  4RB3 C;  4AYB A;  4D7N A;  4NC6 A;  2LD5 A;  3CO7 C;  1K79 A;  4E7I A;  2X6Y A;  3ECH A;  3RIR A;  4M6V A;  1YHQ I;  2R5Z B;  3OY9 A;  2A3S A;  2IS4 A;  4DYC A;  3TO7 A;  4I7H A;  2ZNY A;  5D4S A;  1QO0 D;  3CMY A;  4PSW A;  5FLV A;  2DU9 A;  2JA7 J;  4UUV A;  4L9T A;  2AO9 A;  2F2E A;  5HLI A;  1LE8 A;  1IXR C;  3IH3 A;  3TW6 A;  2E36 A;  1VQN I;  2PG4 A;  4Z6Y A;  3G71 I;  3VB2 A;  2NVQ J;  3CME I;  4KIC A;  4ON0 A;  3IV5 A;  1W36 C;  1U78 A;  1KGS A;  3R60 A;  1XMX A;  2MLG A;  2VJI A;  5TJJ A;  1IJW C;  4JOM A;  1WJD A;  2R7U A;  4A0Y A;  1FPQ A;  3P5J A;  5M3M J;  3F8B A;  3MKY B;  2LKX A;  2OF7 A;  4ZTJ A;  3FXU A;  4I0A A;  2LSO A;  1UCR A;  3VYT B;  4XRM A;  4UVB A;  1BBY A;  2LOO A;  4UVA A;  2GAU A;  4F92 B;  2VE9 A;  3TGN A;  1FX7 A;  4A5M A;  1W0T A;  1F9N A;  2GXG A;  3KYL A;  1S29 A;  4M3G A;  1TWF J;  2JRM A;  2HXI A;  1T2K A;  2M9H A;  3GUD A;  4BXU A;  3M7G A;  2YUS A;  1QZE A;  4EM0 B;  4DZJ A;  2K3P A;  3I58 A;  2AQF A;  3MAJ A;  3K0L A;  1R4N B;  4ZDL A;  1MDM A;  2R7T A;  5FGM A;  4RGR A;  1IV8 A;  1GT0 C;  3VDX A;  4D9J A;  5CQG A;  3CCQ I;  3LA3 A;  1VQ9 I;  3JTH A;  1TNS A;  5FKK A;  5K7Z A;  2XF7 A;  2IT0 A;  1ERD A;  2G0E A;  4LK1 F;  2JUG A;  2FML A;  3CF2 A;  3CP2 A;  2ESN A;  3EQL F;  2LBF B;  4A69 C;  4G94 A;  4WX9 A;  5LHG A;  2OD5 A;  3IKV A;  3FX3 A;  2OC6 A;  2XF5 A;  4BHC A;  3GW2 A;  1HKQ A;  3HRT A;  2GM4 A;  2VBZ A;  2QWW A;  2DOD A;  1I3A A;  2DQL A;  1R7J A;  5ILV A;  2R92 J;  2MFZ A;  3NQO A;  4MLO A;  5GTI C;  3IH2 A;  2BHZ A;  4YG2 F;  1MSF C;  2GOX B;  2F5C A;  5HS9 A;  2OBP A;  5K5R A;  1FY7 A;  1F43 A;  3ZMD A;  2VXZ A;  2VOD A;  3W2W A;  4CUG A;  4AIJ A;  2X6O A;  2K27 A;  2HZD A;  2HS5 A;  4KUM A;  2VBW A;  3MKL A;  2FEZ A;  1MMS A;  1ITY A;  4PFO A;  5DEQ A;  1V55 H;  2LLK A;  3GFL A;  2COB A;  4CCK A;  3ECO A;  3G1M A;  4HEA 2;  1FOX A;  3FMQ A;  1DGW Y;  2NVU B;  4RAY A;  1IC8 A;  2ZKZ A;  1TLH B;  4CO8 A;  1P9Q C;  1POG A;  5IP9 J;  3HRU A;  3WTU C;  4GXO A;  3ABL H;  1BI1 A;  5GP9 A;  2CH0 A;  4XLN F;  2IA0 A;  2W57 A;  3LFK A;  1RKW A;  2UUZ A;  3BY6 A;  3K70 D;  1LJ9 A;  1HW2 A;  3BTC A;  3GXO A;  1FT9 A;  3W2V A;  2EIK H;  2XGC A;  3PUF A;  5IOY A;  2CQN A;  2O6G E;  3CES A;  1JGG A;  4HPQ A;  5J40 A;  2P7C B;  3I4N J;  2L7Z A;  3BG3 A;  4NUB A;  2MH2 A;  5BMZ A;  2UXN A;  2GIZ A;  1BR4 A;  2KZG A;  3DPT A;  3TOA A;  3BPX A;  3GEZ A;  1R1U A;  1X1P A;  4RB2 C;  2FOW A;  1TT5 B;  4BE2 A;  4M3E A;  2A5W A;  1FOY A;  1RES A;  3LSR A;  3IL2 A;  1EA3 A;  2ESH A;  3K4L A;  4J19 A;  2KP6 A;  3TQN A;  1TT0 A;  3CLQ A;  3L2C A;  1W5S A;  4BS9 A;  4KIG A;  3TED A;  2LKS A;  5BQT A;  3FK6 A;  3RPQ A;  3A02 A;  4BY1 J;  1MDM B;  3M07 A;  3Q0W A;  2HQR A;  2M30 A;  4BE1 A;  3H36 A;  4XLC A;  1SC7 A;  1MJ9 A;  3WGI A;  2VQL A;  3LAP A;  4DGW B;  4B47 A;  2DTR A;  3T5X A;  2JWT A;  2WAF A;  1AA7 A;  3MQ0 A;  3JRD A;  1MIJ A;  2EZI A;  1FBS A;  2OTJ I;  4EM1 A;  1BM9 A;  4BUP A;  1FSH A;  1Z3Y A;  4MIM A;  1NTC A;  1A6Q A;  2HVR A;  2OAZ A;  4AC0 A;  2OQR A;  2LY9 A;  4NBQ A;  3F9K A;  2WB1 A;  4PDK A;  2LP0 A;  1DGR M;  2M2E A;  3BJA A;  3OWT A;  3H5R A;  3S2D J;  1ACI A;  5DM7 F;  4MTE A;  3BTJ A;  1PP7 U;  3ZR8 X;  1XGM A;  4PJL A;  2XAS A;  4U0V A;  1R71 A;  4Y33 A;  5EEH A;  2DQR A;  1D3Y A;  2VL8 A;  1UEL B;  2Z5U A;  1WI3 A;  4FX4 A;  2HI3 A;  1IF1 A;  1FYL A;  3FKI J;  3EYY A;  1HC8 A;  2NVX J;  1I39 A;  3EET A;  2P6T A;  4HDU A;  2OJE D;  3NWT A;  4ZH4 F;  2EA4 A;  3E5X A;  5ICC A;  3S14 J;  2Z9O A;  3BR3 A;  2GXB A;  2M87 A;  3V7C A;  1IN7 A;  1X1C A;  3S1R J;  4YEJ A;  2ADU A;  1F36 A;  3M4O J;  2L9S A;  3DTK A;  1IGN A;  3OMY A;  3GFM A;  1IN8 A;  4EV0 A;  1L0O C;  3I59 B;  4E7J A;  3DCF A;  3G4S I;  1KON A;  1JKQ C;  4L9J A;  3U1K A;  1E3P A;  4UNO A;  2VXD A;  1SFE A;  2F4I A;  3U21 A;  3PO3 J;  4OIR F;  1T8I A;  2FBI A;  3IRR A;  1TBX A;  1KU2 A;  1U8B A;  2VJ4 A;  2XGE A;  2O8K A;  1J5Y A;  3LSP A;  2UV1 A;  1GDT A;  2M4K A;  4D7M A;  3FDY A;  1YW9 A;  1WHU A;  4C3I J;  4CZZ A;  1P6R A;  4ZYE A;  3DKY A;  3BRO A;  4ZYH A;  1E0E A;  1X1B A;  3S1Q J;  1K61 A;  2MGQ A;  3QP6 A;  2NRA C;  5LEK A;  1IRZ A;  4JYK A;  1IUY A;  4LIT A;  1W36 D;  2NVT J;  1ZQ3 P;  2D2W A;  2JMW A;  2LF7 A;  3H5A A;  5CQE A;  3Q3S A;  5JVG F;  5GAH J;  1LQ1 A;  4WXD A;  1G59 A;  2ECC A;  2X1E A;  1IG7 A;  3LA7 A;  1ZGA A;  2RQQ A;  2LG4 A;  3OV8 A;  4PJN A;  1NK3 P;  2X6X A;  2KIM A;  2DA3 A;  1IRX A;  2WWY A;  3QU3 A;  1ONV A;  1ODD A;  1G8X A;  5TRD A;  3PNY A;  3LA2 A;  1VQM I;  4AID A;  2XSD C;  4DYR A;  3AL0 C;  1WVR A;  4RA2 A;  2X1C A;  4XBF A;  3Q5F A;  1FEX A;  1LFB A;  1R9T J;  3HG9 A;  3OOU A;  4PGG A;  5DV5 A;  1GHC A;  2GBY A;  2Z1D A;  3GTQ J;  1H0M A;  2DK5 A;  5CJ9 A;  1MBK A;  3AG2 H;  4A5N A;  5F1R A;  1WH5 A;  5C4X J;  4XR6 A;  2QUF A;  4D0P A;  2PMH A;  5FKO A;  2GQQ A;  1TW3 A;  2CU7 A;  4XKW A;  2EV0 A;  1Y1V J;  2KLO A;  3HOV J;  4XQF A;  3DBH B;  5EF6 A;  2DFI A;  2ETH A;  4B43 A;  3M1E A;  2CQK A;  2HFH A;  3TP0 A;  3ZN0 A;  3T1B A;  1OKR A;  2BZT A;  3PNV A;  4M3B A;  3I5U A;  4ENJ A;  1HQC A;  4LD5 A;  5D5X B;  4HQE A;  2A68 F;  5D5U B;  1MBJ A;  1GXP A;  4I02 A;  4RAZ A;  4Y15 A;  2EFP A;  2ELJ A;  4ZYA A;  1DU0 A;  3LSJ A;  4GCV A;  4BAC A;  1MBG A;  3KPH A;  4KN7 X;  4E7S A;  4ETS A;  2CQ7 A;  3OYJ A;  3CLO A;  1KQ9 A;  5EZG A;  1DDN A;  1YJ9 I;  2X4H A;  3FWE A;  3E1S A;  1FIP A;  2M1B A;  3S93 A;  1Q1V A;  3W6V A;  4HYE A;  1FYM A;  2WAQ A;  4UXN A;  1QPM A;  4P5O A;  4CCN A;  1JT0 A;  4EJU A;  2MD5 A;  2BV6 A;  1X1D A;  3GWZ A;  3ZQH A;  4OIQ F;  1RET A;  5LGU A;  4JX5 A;  5J8C A;  4P55 A;  4AWX B;  2P0W A;  2DOE A;  3MMY B;  4HZF A;  1Z0X A;  5KVR A;  2E1M C;  3ZQQ A;  4IKF A;  3C2B A;  4O3M A;  4NNJ A;  3WE2 A;  3O6B B;  2B63 J;  4HNU A;  4HLX A;  3VOD A;  4MFE A;  2V9V A;  1V5G A;  4RDU A;  4TV7 A;  2Q2E A;  4KMU X;  1TWA J;  3E6M A;  2RAE A;  2PBI A;  3HOU J;  1JHH A;  1QVU A;  2E2I J;  1T08 B;  1X3Z B;  1G3W A;  3SEZ A;  1VFC A;  5J4Y A;  2JTV A;  5DUI A;  1U5T A;  3SYT A;  1P7J A;  4HX8 A;  2CV0 A;  4DIQ A;  1MMA A;  3DU6 A;  3NRV A;  2I8D A;  4P9F A;  1ZR4 A;  1G4D A;  2MH9 A;  5BS6 A;  3E6B A;  4UV8 A;  3VPR A;  1ZHF A;  2E7W A;  3GTK J;  4RLQ A;  5AIP A;  4ZDO A;  2PJR B;  1FP1 D;  4UVC A;  1Z6R A;  2VBY A;  3C7J A;  3MWM A;  4BJ6 C;  1HOM A;  4CCO A;  4BQN A;  3OYM A;  3OYF A;  3MD2 A;  3V8J A;  3I4M J;  2K4B A;  3OSF A;  1BC7 C;  2XUB A;  1J59 A;  2LFB A;  1M1E B;  4R79 A;  2VT3 A;  2A05 A;  2E1O A;  1WJC A;  2ZJR F;  4M6X A;  2X85 A;  4XLA A;  3L9F A;  3L1P A;  6PAX A;  2L2O A;  5D8K B;  4A3M J;  2VI6 A;  1S3J A;  4XKB A;  1B6A A;  4XSX F;  1K4T A;  3CCL I;  2PQ8 A;  2NVY J;  4BXF A;  2IVM A;  4IHX A;  1S6L A;  1XDS A;  2L4A A;  3V7R A;  4U88 A;  2W1O A;  3HZJ A;  1LVA A;  3QQA A;  3S2H J;  3DU5 A;  1YYV A;  2RNG A;  4NDL A;  1CGP A;  2HQN A;  5FO5 A;  4IHY A;  3KFW X;  2A61 A;  2ZC2 A;  4FTH A;  2OU2 A;  3KET A;  3HUG B;  3MCZ A;  4P1W A;  1XSV A;  2CGP A;  2E1C A;  2JA6 J;  4G7O F;  2N8G A;  2Y31 A;  1XPX A;  3D1N I;  1U6G A;  5E3L A;  3UR3 C;  3FMR A;  2HU9 A;  3I71 A;  3A03 A;  4PJ0 C;  2KQR A;  2K40 A;  2Q2E B;  5LGN A;  2EPF A;  4A2U A;  5L3F A;  2G9W A;  2DW4 A;  2FD5 A;  4MQ9 F;  5ERI A;  3SFZ A;  4RAF A;  5EYR A;  2EA2 A;  2DMT A;  1B8I A;  2KMU A;  3K70 C;  1Z3X A;  3PO2 J;  3FIS A;  1VQ6 I;  3HRS A;  1IN4 A;  2JZY A;  2K86 A;  5LGT A;  2ID3 A;  4CH7 A;  2FMY A;  2WV0 A;  3F22 A;  2R7X A;  3M8E A;  3RZD J;  3MFK A;  4BAY A;  4M72 A;  1HSJ A;  1XG1 A;  2C6Y A;  4KT6 A;  5GAD J;  4G6T B;  3U9G A;  3J7Z I;  1LDJ A;  1BI2 A;  3LAJ A;  3AL0 B;  3WE3 A;  3QYB A;  3DTI A;  4DBR A;  2JRT A;  1ZG3 A;  2F48 A;  1KZH A;  5EZH A;  2M45 A;  2IP2 A;  3D0S A;  3P9C A;  1DP3 A;  3HHG A;  1VQ4 I;  2XGX A;  3GCM A;  1JUS A;  1JUP A;  2TRT A;  2V1D A;  1UG0 A;  4F93 B;  2DXI A;  4XMY A;  4IOC F;  5ICF A;  2L0K A;  4HBL A;  5DCM A;  4MEX F;  2IXS A;  3C3W A;  5KHD A;  2R5Y B;  1PP8 F;  3G6E I;  2NNY A;  2F5V A;  1Q1H A;  3M8F A;  4XLP F;  2IS1 A;  4CZC A;  4OU0 A;  1ZGJ A;  1WJ5 A;  2XGD A;  4F3Q A;  5JR3 A;  2RDP A;  2O0Y A;  1KA8 A;  3MEX A;  2O9L A;  2BE5 F;  4IZZ A;  1H9T A;  3RKX A;  3FF5 A;  3S8P A;  1VQ8 I;  3S3N A;  2XPU A;  1F1Z A;  2XV4 S;  2KDZ A;  1LDK B;  3SHF A;  1RZ4 A;  2XAG A;  2KT0 A;  3HTU A;  5E8I A;  1X19 A;  5BPI A;  3S1N J;  5E1W A;  4PK4 A;  3D5S C;  4LG0 A;  3ZMZ A;  1HDP A;  2BY2 A;  2Z3Y A;  4EM2 A;  1S7A A;  1V5F A;  5E3M A;  3F8N A;  2DOA A;  3WGG A;  4U0Y A;  1O3Q A;  3I0T A;  1J0R A;  2DO7 A;  2VQC A;  2JN6 A;  4Q5S F;  3DEW A;  2W25 A;  1E2X A;  1ENH A;  3BT9 A;  5K7H A;  1Y6I A;  1G3S A;  3VSL A;  3WU2 C;  2E1M B;  4QIW N;  3DBR B;  3HOZ J;  1MMN A;  5KCM A;  4DQ2 A;  4ENM A;  2QCO A;  2E1N A;  3M9A A;  3OIP A;  4PUS A;  2ZFW A;  1W5T A;  2PEX A;  2XIG A;  2JVG A;  4E70 A;  3OYA A;  2H8W A;  3BOQ A;  2Q8K A;  3BC8 A;  5HDK A;  2W82 A;  1N77 A;  2ZXJ A;  3LFU A;  1EH6 A;  1FP2 A;  1ZAO A;  5J1Y A;  1YW8 A;  4DW6 A;  4C3J J;  1BC8 C;  5CKT A;  2H27 A;  2E5N A;  3V7S A;  5L3D A;  3IHU A;  4UV9 A;  2EJR A;  2HQ5 A;  1FC3 A;  4B3A A;  1FZP B;  3DQV C;  4F7Z A;  5CVR A;  1RKT A;  3A0B C;  1HF0 A;  3DXJ F;  1IDZ A;  1MSE C;  3HGY A;  3VFZ A;  2OV7 A;  3GVA A;  5LHH A;  4A93 J;  4AM3 A;  1H9G A;  4Y4R A;  3NEU A;  1MBE A;  5E79 C;  5FKN A;  3OYI A;  4I76 A;  4MGR A;  4M71 A;  1I50 J;  2JPC A;  4WF2 A;  1AU7 A;  2ME0 A;  1HCR A;  3PQK A;  3F6O A;  4JBA A;  4HNT A;  2OCE A;  3WTY C;  1J7K A;  2F5E A;  3DFG A;  4E7K A;  1MNM C;  4HNV A;  4LG3 A;  1PYV A;  4HX7 A;  3K4B A;  2QVO A;  3CCR I;  3TW7 A;  3BTL A;  2CW0 F;  1JTX A;  3ZMS A;  1HKT A;  4E6K G;  4OIN F;  3ZPL A;  3FM3 A;  4XKC A;  1YS6 A;  3H3Z A;  2E35 A;  1BR1 A;  2A6E F;  3G3Z A;  4LIU A;  5H6Q A;  5LHI A;  4XIC A;  3WTX C;  1FTT A;  4BXX J;  1HXD A;  4AIK A;  4LG0 B;  3MZH A;  1MNE A;  2R0Q C;  2WY8 Q;  1GVD A;  3DLL F;  4IPA A;  2M8E A;  2R7V A;  3H0G J;  3WHB A;  1X3U A;  4KA4 A;  5J6X A;  5IY5 H;  3WOD F;  4KDP A;  4C3H J;  5TIS C;  3PNT A;  1WCM J;  1R22 A;  2QLZ A;  3CC2 I;  1P4X A;  2XVC A;  2J5O A;  4DBQ A;  1AHD P;  2W48 A;  3L2V A;  1D1C A;  2P6S A;  2FE3 A;  3RPU A;  2QZ8 A;  2E34 A;  4F55 A;  2ZJQ F;  4KIS A;  1A31 A;  2PMZ A;  5E1Z B;  1QQI A;  2VE8 A;  3SDB A;  2D5V A;  2ZNZ A;  3K4C A;  4G9Y A;  2EFN A;  2HZT A;  4IRG A;  1KQ0 A;  4IQJ A;  1HW5 A;  1DP7 P;  1OQY A;  1X4O A;  4ZYG A;  3KCC A;  3TKY A;  4IO9 F;  3OYE A;  2BY0 A;  1ZG5 A;  1YO5 C;  4NB5 A;  4PFP A;  5FLX K;  2E5Z A;  2XAF A;  3L7W A;  3BR5 A;  3JRC A;  1OCT C;  5FLM J;  1LE8 B;  4PSX A;  3HIF A;  4HX4 A;  5EGO A;  4A3J J;  3JRH A;  1KYZ A;  2STW A;  3R4K A;  3FZV A;  4CYD A;  4WXH A;  3FXQ A;  4XNF A;  3IAM 2;  5F0C A;  1LDD A;  4BBR J;  4LJZ F;  2LY1 A;  3NAU A;  5DCF A;  1KU7 A;  1Y0N A;  5FLX Z;  4BBS J;  2Y69 H;  2X48 A;  3J81 K;  1YIO A;  1O4X A;  2DMP A;  3QU6 A;  2OUM A;  5B1B H;  1GVJ A;  5K7F A;  2BHY A;  4G6Q A;  1AWC A;  4EQQ A;  4BHP A;  2O8X A;  2VOO A;  1HDD C;  4WXC A;  3LNQ A;  1O3S A;  5IYC J;  3TP3 A;  3CJR B;  2L9N A;  4OOI A;  2PJP A;  1Z6T A;  3C2G A;  5F04 A;  1QA6 A;  4HRI A;  2DT5 A;  3J81 Z;  3WTZ A;  2DYS H;  2LKP A;  2A6T A;  3VYR B;  3E5U A;  1KU9 A;  1K78 A;  4B8X A;  2IGM A;  2DTZ A;  3NWS A;  2A07 F;  2F4O B;  1WJF A;  4XK4 A;  1RPW A;  1QRY A;  1I6H J;  4ZZL A;  3HPG A;  1Z67 A;  3QAH A;  5CLS A;  3FXJ A;  3HRM A;  4FCY A;  1A5J A;  4A6E A;  1NG6 A;  2L5Q A;  3DP7 A;  2HKO A;  5IPA A;  2EIL H;  4HAM A;  1OYI A;  3DEE A;  2EIN H;  4B48 A;  4D5C A;  2VQH A;  4KFC A;  2CO5 A;  3OYG A;  4JX6 A;  1O3T A;  3AFH A;  2R7O A;  3GTL J;  3IC7 A;  4DJA A;  3OOP A;  1MMG A;  1D1B A;  2DMQ A;  2MW8 A;  3JCU C;  1XMA A;  3TDU C;  3A0H C;  3IRQ A;  4MTD A;  3OL4 A;  4BQO A;  2P5L C;  5LEJ A;  4CIC A;  4LB5 A;  3M8J A;  3TBI A;  3U1D A;  2W24 A;  4R8H A;  2I10 A;  5JVT A;  3OS2 A;  2EZL A;  1OCC H;  2XC7 A;  4I2O A;  3FXM A;  1VZ0 A;  2VLA A;  2PMU A;  4BU2 A;  5E20 A;  2VN2 A;  2XPV A;  5CVV A;  1BW6 A;  4LLG F;  3RPU D;  3ULQ B;  3L09 A;  2ZCW A;  3HOX J;  1Z7U A;  2EFQ A;  4JQF A;  5EGO B;  3KEY A;  3HKZ N;  1ZRD A;  1T95 A;  3RSN A;  3O2P E;  1NH3 A;  1FYK A;  5IP6 A;  4QSH A;  1D0Z A;  4RGS A;  2QKL B;  3IWF A;  2DAO A;  5FRM A;  1G3T A;  1MBF A;  1QVT A;  3K1N A;  4XRS G;  5D4R A;  3D5L A;  3IUO A;  5FRO A;  3BR1 A;  3PSI A;  2LH9 A;  3W6K B;  3V4G A;  2CUZ A;  2MD0 A;  2DYR H;  2AHQ A;  2VKV A;  1QBJ A;  2RQP A;  3HB9 A;  2KRC A;  4AU7 A;  3FBI B;  1I5Z A;  3E5Q A;  1EJ9 A;  1TQP A;  4A0X A;  2EBI A;  2JA8 J;  3F8M A;  1IV6 A;  1QGP A;  4C30 A;  3B6C A;  3QP5 A;  3REO A;  4PZJ A;  3O3K A;  4A3E J;  4FAS D;  3B73 A;  4HOB A;  2EFO A;  1K7A A;  2DCE A;  2KJB A;  3FIW A;  1WJE A;  3HEF A;  1K78 B;  3RDI A;  1WQ2 A;  3BTI A;  2NYX A;  5AON A;  1ZRF A;  2XF6 A;  1R1V A;  3HDD A;  4EJV A;  3SZG A;  3FXK A;  2IEK A;  3FBN B;  4FE7 A;  4WCG A;  2H09 A;  1B9M A;  1WWX A;  1MD0 A;  3IAS 2;  4AUX A;  1APL C;  3RI4 A;  3FHN A;  5IOZ A;  3A2K A;  1UST A;  2R7D A;  2BVL A;  4E7H A;  4XN3 A;  1K4S A;  2R7R A;  2Z16 A;  2ZFU A;  4WK8 F;  3JW4 A;  5HOD A;  1JE8 A;  3R6S A;  1U5T C;  3O8H A;  3QOE A;  3K1M A;  2F5D A;  2XDV A;  3JR9 A;  1XSD A;  1A36 A;  4U7B A;  3OSG A;  5HNF A;  2X1D A;  2YS9 A;  3SXY A;  4B1R A;  4YRV A;  3FKJ A;  2O7O A;  4LGW A;  1YG2 A;  1LEA A;  3QYF A;  3AAF A;  1JI8 A;  2WAD A;  3G1L A;  2E60 A;  3L00 A;  1U9O A;  5H20 A;  4Y52 J;  4HF1 A;  5KAF C;  4ZTF A;  3BG7 A;  4KN4 X;  1DPR A;  3HSE A;  2EV5 A;  1OR7 A;  2LRD A;  4IX7 A;  1D0X A;  1U0J A;  3RJP A;  3DWL E;  3F8F A;  1RUO A;  1QPI A;  5DYM A;  4A3K J;  3RTR A;  5DM6 F;  2MC3 A;  2RGV A;  1CQT A;  4BQA A;  1WI9 A;  3DLA A;  1H88 C;  3AG4 H;  3C2H A;  4BJ5 C;  4W1U A;  1WZ2 A;  3H92 A;  1O57 A;  4L18 B;  5FB2 A;  1BN5 A;  1WJA A;  2M34 A;  3K4K A;  4E4H A;  3KP5 A;  1ETQ A;  3ZXS A;  2FF4 A;  3CC4 I;  3C1D A;  2BY1 A;  5D6F A;  2NNN A;  3DPU A;  5LRS A;  2V9K A;  4LLL A;  1QHG A;  1FBU A;  2MYS A;  1XB4 A;  5GPA A;  4PGH A;  1VQP I;  2V1X A;  4YIF A;  1UHW A;  2LRE A;  2YPR A;  2CJJ A;  2ZSH B;  3N97 A;  2XKO A;  3EUK L;  2HXO A;  1MMD A;  3KIO A;  2CV2 A;  1SFK A;  5L3C A;  3ZRG A;  1IUF A;  2JSC A;  3E0J B;  5B3S H;  5KAI C;  3QPS A;  5ICG A;  2IAI A;  2LK2 A;  3CDI A;  3S32 A;  5C3E J;  4XOR A;  3WU1 B;  4UB6 C;  3V8K A;  3C18 A;  3ZOB A;  4CGZ A;  4BY7 J;  1YTY A;  3SZT A;  4F52 A;  1ETV A;  2D1H A;  2XB5 A;  3F8C A;  3ZN1 A;  3P9I A;  2ISZ A;  2F4M B;  3HSF A;  1EH8 A;  3WHC A;  1VTN C;  1SAX A;  5L3B A;  1TZL A;  2CUJ A;  5FKL A;  2K02 A;  1D5V A;  1GV2 A;  3H5N A;  4L5E A;  4RS8 A;  3ABU A;  3HGG A;  2CUF A;  1S8N A;  4O6J A;  4BL0 B;  5M5W J;  3M3Y J;  1OMI A;  5EG0 A;  3CCY A;  1RC9 A;  3BJ6 A;  1VQ5 I;  2QF7 A;  1JJ6 C;  2KRH A;  1JKO C;  2K9Q A;  1RI7 A;  1YJW I;  3A01 A;  3PUB A;  4HLY A;  4RM3 A;  3PSF A;  2STT A;  3E6D A;  3JSO A;  4OAY A;  1RR8 C;  4Z2Y A;  4HF2 A;  3I54 A;  1GUU A;  4GDF A;  1XDU A;  5EEG A;  1ZYR F;  3DKW A;  4S0H B;  1Y0U A;  3QPT A;  4J00 A;  1CF7 A;  2XKP A;  1LKX A;  1TWC J;  1FMW A;  3J80 K;  2LF8 A;  4XLH A;  3ZQG A;  4RB1 A;  1F5T A;  2W85 A;  3QWL A;  3G1O A;  4MNU A;  2OA4 A;  2DI3 A;  3KP4 A;  4X0G A;  3VOE A;  2VOP A;  2ZBK A;  3CP8 A;  5EDN A;  1ZGW A;  3GTM J;  5M3F J;  3QPL A;  4B09 A;  4U7D A;  4BJT A;  4OIP F;  3J80 Z;  1YIJ I;  1ZK8 A;  1PVE A;  2NS7 A;  3M1C A;  4OAZ A;  4XRF A;  1LVK A;  1YX5 A;  5FFZ A;  1QZY A;  3OYK A;  2VBX A;  3B6A A;  5J4V A;  5FKM A;  1T56 A;  1OIS A;  3JRG A;  5HLH A;  2JQ7 A;  4JP0 A;  3OIO A;  2K9N A;  3MZY A;  2QQA A;  3GBG A;  2M0M A;  4K2E A;  4G6D A;  3QOD A;  3HJE A;  5JHF A;  1WGX A;  4M9Z A;  4J01 A;  4DOZ A;  2FXA A;  2F5F A;  5F27 A;  1IZ1 A;  4QLC U;  2R7Z J;  1QHH D;  4FX0 A;  4XSZ F;  1I6X A;  1SMT A;  1W1W E;  4LMY A;  2H94 A;  2IBD A;  1H8A C;  3ZCO A;  2L4M A;  2CG4 A;  5IP7 J;  3GO5 A;  1LB2 A;  2CV1 A;  3GTO J;  2FBK A;  2ME6 A;  3IWZ A;  3K10 A;  2K9S A;  1MND A;  1IXC A;  1MW7 A;  5EEA A;  4M9X A;  1QU3 A;  1W5C C;  1MJB A;  2BGC A;  2ISY A;  3Q0V A;  1D8J A;  3BG5 A;  1SFU A;  1V5E A;  3K4M A;  1XC5 A;  2A5Y B;  2R4G A;  1IRG A;  5DUK A;  2HOE A;  5EG0 B;  1ZAR A;  2CQX A;  3DEU A;  1SAN A;  4CCL A;  4GFB A;  2JUC A;  3HL2 A;  3A01 B;  3KZZ A;  4ENK A;  1FSE A;  1ORK A;  3H3U A;  2HTS A;  1U5T B;  2MAB A;  4XL9 A;  3WU0 A;  4NHJ A;  1GV5 A;  1LFP A;  3VSK A;  2DDA A;  3OYD A;  3GLX A;  1G2H A;  1YI2 I;  3LSI A;  4KNY A;  3BQY A;  1REP C;  4L5I A;  3W6J B;  1O7F A;  1JXS A;  2DMN A;  2WTE A;  4HF0 A;  2OTL I;  4XOP A;  2FQ3 A;  1R00 A;  4ZC3 A;  3GFJ A;  3SZP A;  4C9Y A;  4BEH A;  3PL8 A;  1LEB A;  4I0B A;  4PJM A;  1PUE E;  5HVQ C;  1B4A A;  5F0H A;  3BDD A;  5HOO A;  1I1S A;  3ABT A;  1L3L A;  4Q4Z F;  2OQG A;  1Z21 A;  1HA8 A;  2R5Z A;  3MN2 A;  3E7L A;  3W3C A;  3X2Q H;  2KHM A;  3MVP A;  2IA1 A;  3J7A Y;  3LWF A;  5ILU A;  1KU3 A;  2HKX A;  2Q1Z B;  1QNT A;  1R1T A;  4A0Z A;  4LB6 B;  1F4K A;  1BR2 A;  3R0A A;  4UUS A;  1HBX G;  3S17 J;  4M3F A;  1TTY A;  2BEO A;  4YFN F;  5BPD A;  3FXR A;  4GRI A;  1P4A A;  4RMN A;  1ZRC A;  2R3S A;  4CA0 A;  1ZRE A;  5ED4 A;  3KP6 A;  4FT8 A;  1AOY A;  2MC4 A;  2AS5 F;  2JT1 A;  1BI3 A;  1MBH A;  1N25 A;  1S9H A;  5D6E A;  3LMM A; 
#chains in the Genus database with same CATH homology
 3VWB A;  4IQJ A;  1X4O A;  3HC7 A;  2VJ4 A;  1NG7 A;  3HOS A;  4BDY A;  1J09 A;  3A1Y A;  2UV1 A;  3OYE A;  2M4K A;  4HSR A;  4FET A;  3FDY A;  4PFP A;  2E5Z A;  4PJJ A;  3DKY A;  3OYB A;  1E0E A;  4PSX A;  1X1B A;  4IQ4 A;  3DKX A;  2VJJ A;  4XNF A;  3IAM 2;  2ZSI B;  5HNH A;  1UAA A;  2LY1 A;  4LIT A;  2LYC A;  1W36 D;  3QYE A;  4H4K C;  4ZJZ A;  1DQU A;  3H5A A;  5CQE A;  2BVM A;  2OUM A;  1G59 A;  2X1E A;  5TGT A;  2BOL A;  2RQQ A;  2LG4 A;  2DT7 B;  2JA2 A;  4PJN A;  2X6X A;  3OS0 A;  3OYH A;  3CJR B;  1IRX A;  2L9N A;  3C2G A;  1YX3 A;  4HRI A;  1G8X A;  3PNY A;  2NOJ B;  2A6T A;  3VYR B;  1PJR A;  3AL0 C;  2X1C A;  2Z2S B;  3RCO A;  2V1N A;  2IGM A;  2L7K A;  3NWS A;  3HG9 A;  2LBF A;  3LSG A;  1WJF A;  3OOU A;  3RQ4 A;  3PJR A;  2JVH A;  3DTE A;  4QPO A;  2Z1D A;  3HPG A;  4B44 A;  3V42 A;  4OWR B;  2ZXH A;  4XN0 A;  2O5R A;  3H0D A;  1NG6 A;  2L5Q A;  4XR6 A;  1ZEL A;  2KZV A;  4E7L A;  4XLF A;  4XKW A;  3DEE A;  4B48 A;  2KLO A;  2VQH A;  4XQF A;  3OIQ A;  4B43 A;  2HPM A;  3OYG A;  2M7A A;  2VIX A;  2VPL A;  1BOB A;  3H9Q A;  3AFH A;  2R7O A;  4DJA A;  3LSK A;  1MMG A;  1D1B A;  2XAU A;  2W00 A;  3PNV A;  3TMO A;  2ZXI A;  3BLY A;  4HG2 A;  5FRN A;  3OL4 A;  4BQO A;  3H9G A;  1Z7L A;  2ELJ A;  4ZYA A;  3M8J A;  3TBI A;  4BAC A;  3OS2 A;  3S3O A;  4E7S A;  2XC7 A;  2UWM A;  1VZ0 A;  3OYJ A;  3BCA A;  4BU2 A;  2VLA A;  2QKM B;  2V7F A;  4XLE A;  3PFY A;  2FUG 2;  3HOT A;  3RPU D;  3E1S A;  4XOT A;  3S93 A;  1D1A A;  4LIV A;  4JQF A;  5LFA A;  3I3L A;  2KPM A;  2WAQ A;  3KEY A;  4B3X A;  4P5O A;  4AVZ A;  2R7S A;  4CCN A;  1T95 A;  3RSN A;  1X1D A;  3LSM A;  2WY7 Q;  3OYL A;  2HDW A;  4ANJ A;  1D0Z A;  2QKL B;  5FRM A;  4BE0 A;  2P0W A;  3MMY B;  3ZQQ A;  3L2Q A;  2V6E A;  2E1M C;  2CS3 A;  3D5L A;  3IUO A;  5FRO A;  3PSI A;  4IKF A;  2LH9 A;  4NNJ A;  3S3M A;  2CUZ A;  2MD0 A;  3A4C A;  4EAT A;  4HNU A;  2KRC A;  4AU7 A;  3OL3 A;  3FBI B;  1T0F C;  1V5G A;  3H9J A;  4QPQ A;  3L2W A;  3OR2 C;  2WA0 A;  2K5C A;  4C30 A;  1YE9 A;  1SAU A;  4RLF A;  2VAS A;  2VKH A;  4FAS D;  2HNH A;  3KX2 A;  2DCE A;  2DJI A;  2HVQ A;  1WJE A;  2IGN A;  3HKZ A;  2CMP A;  3SEZ A;  2XF6 A;  3K4N A;  3SYT A;  3ONQ A;  2CV0 A;  4DIQ A;  1MMA A;  3DU6 A;  3SZG A;  2I8D A;  2XSJ C;  2V26 A;  3FBN B;  4CSW A;  3IAS 2;  1WJB A;  2Y0S A;  3EPZ A;  2CW7 A;  3D5R C;  4RLQ A;  3FHN A;  2PJR B;  4ZDO A;  1Y56 A;  2CW8 A;  3A2K A;  2BVL A;  4E7H A;  4XN3 A;  4C2U A;  2IGK A;  2Z16 A;  2ZFU A;  2R7R A;  1N78 A;  2HVS A;  4BJ6 C;  2M3A A;  3QOE A;  4ZDP A;  4CCO A;  2XDV A;  4BQN A;  3OYM A;  1X4P A;  3MD2 A;  3N05 A;  4U7B A;  3OYF A;  2R7Q A;  5HNF A;  2X1D A;  1K6Y A;  4YRV A;  3FKJ A;  3ZGK A;  3H35 A;  3G2B A;  4R79 A;  2W4S A;  4ITV A;  3W2A A;  2JSP A;  3QYF A;  3L2U A;  1JI8 A;  1WJC A;  2RRE A;  2WAD A;  2E60 A;  2AQE A;  4II2 A;  2X85 A;  4XLA A;  2M7B A;  2L2O A;  4XON A;  2K9L A;  2M4G A;  4ZTF A;  4XKB A;  3BG7 A;  2LY2 A;  3OYN A;  2HQA A;  3VYS B;  4BEH B;  2WAE A;  4XM3 A;  4N4N B;  2W7N A;  2LRD A;  4IX7 A;  1D0X A;  1U0J A;  4BXF A;  3DWL E;  2R7W A;  2W1O A;  3RTR A;  4AYB A;  3DU5 A;  3DLA A;  4E7I A;  2RNG A;  2X6Y A;  3C2H A;  3MKZ A;  4BJ5 C;  3OY9 A;  2IS4 A;  2KL4 A;  3HUG B;  2VJ5 A;  4P1W A;  1WJA A;  3K4K A;  4E4H A;  1OR7 C;  3HPH A;  4PSW A;  2BW3 A;  3ZXS A;  4Y3O A;  3DPU A;  3L2R A;  2V9K A;  3UR3 C;  1QHG A;  2MYS A;  2HU9 A;  2KQR A;  2LRE A;  2Q2E B;  4N4O B;  2ZSH B;  3EUK L;  1MMD A;  2CV2 A;  1SFK A;  4NC7 A;  3ZRG A;  2CFO A;  3E0J B;  1W36 C;  2VJI A;  1GLN A;  4JOM A;  2KMU A;  1WJD A;  2R7U A;  3MKY B;  3K70 C;  1Z3X A;  1D0Y A;  3S32 A;  4ZTJ A;  4XOR A;  3SEQ A;  3VYT B;  4CH7 A;  4KIT B;  4F52 A;  2R7X A;  2LOO A;  4F92 B;  2X51 A;  2LC2 A;  3TL4 X;  4KT6 A;  3HXL A;  4G6T B;  3KYL A;  3AL0 B;  3QYB A;  1TZL A;  2CUJ A;  3DTI A;  4DBR A;  3H5N A;  4HST A;  2K3P A;  1DP3 A;  2AQF A;  4BL0 B;  2DT6 A;  4ZDL A;  2R7T A;  2KRH A;  3VDX A;  1UG0 A;  4D9J A;  4F93 B;  5CQG A;  2DXI A;  4XMY A;  3PUB A;  4RM3 A;  3PSF A;  2IXS A;  2XF7 A;  1ERD A;  4YEL A;  5KHD A;  4OAY A;  2JUG A;  3CP2 A;  3CF2 A;  2LBF B;  4BGD A;  2F5V A;  3EUH C;  2OC6 A;  2XF5 A;  4J00 A;  2IS1 A;  4CZC A;  4F3Q A;  1WJ5 A;  1LKX A;  1OLT A;  1FMW A;  4NC8 A;  2VKD A;  3BG6 A;  4XLH A;  2VQG A;  2MFZ A;  2F6C A;  4MLO A;  4IZZ A;  2GOX B;  3S8P A;  3VYU B;  3S3N A;  2VXZ A;  4X0G A;  3W2W A;  4CUG A;  1LDK B;  2BW3 B;  3CP8 A;  2HZD A;  4BJT A;  1X19 A;  3LL7 A;  4PK4 A;  3D5S C;  4KJZ A;  4PFO A;  3IP4 B;  3M1C A;  4OAZ A;  3OR1 C;  3OS1 A;  4CCK A;  1LVK A;  1YX5 A;  4HEA 2;  1V5F A;  2X6W A;  1DGW Y;  3OYK A;  1P9Q C;  2DOA A;  2VQC A;  2CH0 A;  3GBG A;  2UUZ A;  3K70 D;  1Y6I A;  3EUA A;  2M0M A;  3VSL A;  2E1M B;  2IGO A;  4F91 B;  1X1A A;  4NQW B;  3QOD A;  3W2V A;  5JHF A;  3CES A;  3BCB A;  4HPQ A;  1MMN A;  5KCM A;  4DOZ A;  4J01 A;  4PUS A;  3OIP A;  4E7Z A;  4NUB A;  1QHH D;  2JVG A;  3OYA A;  1BR4 A;  3DPT A;  3BC8 A;  2W82 A;  1N77 A;  3ZCO A;  3LFU A;  2CV1 A;  4D1Q A;  3K10 A;  1MND A;  1MW7 A;  4BE2 A;  2A5W A;  5KNL A;  5CKT A;  1QU3 A;  2E5N A;  1FMV A;  1EA3 A;  3MKW B;  3K4L A;  2KP6 A;  5CPR B;  1V5E A;  3DPL C;  1TT0 A;  3K4M A;  3DQV C;  4BQQ A;  4BS9 A;  2R4G A;  2V4J C;  3CZ6 A;  4U87 A;  3CMM A;  2PJR A;  4II3 A;  4BE1 A;  3LSH A;  1WFX A;  4XLC A;  4CCL A;  2VQL A;  2OV7 A;  3HL2 A;  2HPI A;  5LD2 C;  4DGW B;  4Y4R A;  4B47 A;  5HLT A;  2WAF A;  1AA7 A;  2KDO A;  3OYI A;  2MAB A;  3K6G A;  4XL9 A;  3K4J A;  3OYC A;  1LFP A;  4BUP A;  3VSK A;  4CCJ A;  3OYD A;  4HNT A;  1Z3Y A;  2WBM A;  2HVR A;  4E7K A;  1N75 A;  3LSI A;  4LG3 A;  1PYV A;  3F9K A;  3K4B A;  2WB1 A;  2IS6 A;  2GOM A;  4XOP A;  3UNG C;  1DGR M;  3OWT A;  4ZC3 A;  3H5R A;  4C9Y A;  4E6K G;  4C2T A;  4BEH A;  3PL8 A;  4XKC A;  2VB6 A;  3ZR8 X;  4PJL A;  4PJM A;  1BR1 A;  3I9V 2;  4Y33 A;  4LIU A;  3AKZ A;  3U21 A;  2IS2 A;  2VL8 A;  5HVQ C;  1UEL B;  4XKV A;  5HOO A;  1MNE A;  4RM2 A;  4BDZ A;  2WY8 Q;  1Z21 A;  3CJQ B;  1HA8 A;  4CCM A;  3W3C A;  3NWT A;  2KHM A;  2R7V A;  3J7A Y;  2K9M A;  2Q1Z B;  1R6R A;  1X1C A;  4YEJ A;  1BR2 A;  2L9S A;  3DTK A;  3PNT A;  3OMY A;  4GRI A;  4DBQ A;  4RMN A;  4E7J A;  4CA0 A;  3L2V A;  1D1C A;  1KON A;  4F55 A;  4KIS A;  2PMZ A;  2VXD A;  3SDB A;  2MC4 A;  2F4I A;  1S9H A;  3K4C A;  3LMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...