2E71A

Solution structure of the second ff domain of human transcription factor ca150
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
GSSGSSGERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription elongation regulator 1
publication title Solution structure of the second FF domain of human transcription factor CA150
rcsb
source organism Homo sapiens
total genus 17
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2e71A00
2DOEA 2JUCA 2K85A 2KZGA 2DOFA 2LKSA 4FQGA 2KIQA 2E71A 2KFDA 2L9VA 2B7EA 2KISA 1UZCA 2DODA 2CQNA
chains in the Genus database with same CATH superfamily
2UXNA 1OJLA 2R7XA 1IN8A 1LVKA 4HNTA 3R60A 1ZR4A 2DA3A 5IT3A 1STZA 3A02A 2F4MB 3C2BA 2LBFB 1JUSA 3HHHA 4C9YA 2DA2A 4BE0A 1IF1A 4MTEA 1IRXA 2LY1A 4E6KG 3IP4B 2KT0A 3V42A 4IHWA 2ECCA 3KLNA 5EG0B 2GIVA 2PJPA 4KMUX 4PZJA 1FBQA 1J59A 2BY3A 2LYCA 3WTXC 3DTEA 3SFZA 1EH6A 3FXRA 3TGNA 3KP4A 3PQJA 2TRTA 3E6CC 4WF2A 1Y39A 4HRIA 4IL6C 2OZUA 5DUIA 1ETXA 1XDUA 2MD0A 1H9TA 2XPUA 4EJOA 1P2FA 1IN4A 3KP3A 1VQLI 4GDFA 3K4NA 4LMYA 3ML6A 2PX9A 2LP0A 1B6AA 1JKQC 5IP9J 2JA5J 1N78A 3LSIA 2UXXA 1ETVA 1ACIA 2ZXHA 1IN5A 4DZPA 5J4VA 3G4SI 3BG7A 3QWLA 1I6XA 1SAXA 4HNUA 1E3HA 3I4PA 3BCAA 1SMTA 4F52A 4HQEA 1SVMA 3E5XA 4HW0A 4BHBA 1W36C 3G73A 1VQ8I 3LSJA 5LFAA 3ZR8X 4YRVA 3U1KA 2DJNA 1HQCA 3LA3A 3J80Z 1XDSA 2X6WA 3S32A 3BG9A 3W6VA 3M3YJ 3JRHA 2EIJH 2BYVE 2CV2A 2JPCA 1FY7A 2EZLA 2Z16A 2A6HF 1ZG3A 3ELKA 3MZ8A 4KT5C 2OQRA 5CQGA 3G3ZA 2I10A 3TBIA 5HOOA 2MSYA 1J5YA 3I64A 4LGWA 1HKTA 2DFIA 5D4SA 5CQEA 5K7ZA 3V7SA 3OYNA 3CCVI 2CSOA 1LQ1A 1PJRA 4PSXA 3GF2A 1MBKA 2LFBA 3M1CA 5F08A 1Z9CA 3DCFA 2V9VA 1G8XA 4IXAA 5L3GA 3GMEA 4M6VA 4NHJA 4C3JJ 5LGNA 2OU2A 4Y7NJ 2W48A 5C44J 3H3VK 4A3GJ 2FXAA 3NWTA 4NB5A 2FNPA 4LJZF 4ETSA 2DFEA 4ZDLA 1XD7A 2JUGA 4IHVA 3OR1C 1FPQA 3ZP5A 4XOPA 2RDPA 2VKDA 1SD7A 1UZCA 2HZDA 3K4JA 5ICEA 1MGTA 2HTJA 3FXQA 3RCOA 2M7BA 4RGSA 2FBHA 2XAUA 4XM3A 2OTLI 3M1EA 5FKKA 5FO5A 2X51A 4XRMA 4R1HA 1FP2A 2OD5A 2ZMEA 4LLNA 1WWXA 1FYKA 1GLNA 1H89C 1EF4A 4KN4X 2STWA 1UHWA 1XGNA 2FSWA 3QODA 2ISYA 1YX5A 4I7HA 4UY8I 4II2A 2PEXA 2Z3YA 3HG9A 3S2WA 2VIXA 1R1TA 1DUXC 2OCEA 1SFEA 3LSGA 4M72A 3E6MA 5LBQA 3WU1B 3ZXSA 3MD2A 4I76A 2RNGA 1TQPA 3RSNA 2BE5F 2O5RA 1BOBA 3DPTA 2W25A 4JX4A 5JHUA 2EH3A 2PN6A 3WTVC 3VSLA 3I3LA 1AU7A 3E7LA 5FJ8J 4RB3C 1LDDA 3DBLB 4CYCB 2EZIA 2MH2A 1RZ4A 2HNHA 2XKOA 4HF2A 1UELB 5EZHA 2JA6J 4XONA 2VBWA 2HYGD 1YJWI 1ZLKA 4BXXJ 1T33A 1FMWA 3WHCA 1LFPA 4FISA 1TNTA 1SVLA 3MCZA 2PQ8A 3F8MA 4PSWA 3L9FA 1GUUA 3NARA 1XMKA 2Z2SB 5DUKA 4OAYA 1A6IA 1B4AA 3DEUA 4U87A 1PVEA 4HOBA 5F0HA 3KP7A 4M6YA 1BJZA 4G9YA 3FM3A 1XGSA 1X1BA 3PNVA 3WE2A 1DP3A 2DTZA 2XRLA 3FBIB 3KX2A 2IS6A 3AG2H 1MBGA 1VTNC 1S29A 2OV7A 3ABKH 2W4SA 4JP0A 4RM3A 3L2UA 2WAFA 2JRMA 4LD5A 3U2RA 4DYCA 1Y1WJ 2M0CA 1Z91A 1VQMI 3JSOA 1LEAA 1WRJA 3I5UA 3R0JA 3V8JA 4RBOA 3ECHA 4AIDA 3JRAA 4Y4RA 3FHZA 5EEAA 4A5MA 2ID6A 2PJRB 4EQQA 2M45A 1X1AA 2WY8Q 3QP5A 2VT2A 3CQZJ 3N97A 2JSCA 3J7ZI 2EB7A 2XIGA 2AQFA 2VBYA 3S93A 2CUEA 2IRFG 2R7SA 1MBFA 4OIRF 2QQBA 4AYBN 5H2FC 2EIKH 2RQPA 3CCQI 3DLAA 4CGZA 1F43A 4A0YA 4Q5SF 3F8NA 3ZQHA 4IX7A 2ELJA 2OUMA 1QGPA 4II3A 1MH4A 5CVJA 3KCCA 3K4KA 3OIOA 3BZKA 4I02A 3PM1A 5F6FA 4B4CA 2CFOA 2HYFA 5TRDA 4L9TA 2LBFA 1XGMA 3LFUA 3ZMUA 3OYFA 2Y0SA 4XNFA 4U0WA 4B3XA 3IUOA 1DP7P 4BE1A 1G6NA 5HDGA 3A01B 3E5QA 4L5EA 1P92A 1MMGA 2VC0A 1TQIA 2P8TA 2QKLB 3ECOA 1P9QC 2RVCA 1ZH5A 2E1MB 3WG9A 2LG4A 1HCRA 2Y2ZA 5FLXK 3TP0A 2QLZA 2ZC2A 3OIPA 4A3IJ 2LVSA 2R5YA 1OR7A 2NVUB 3D0SA 2M4KA 4X1EA 2DJIA 1MMDA 2IGOA 4XKBA 2DXIA 1ENHA 2A5WA 2FMLA 3DF8A 3PL8A 4M71A 5B1AH 3HSRA 4LOCA 1LDKB 5D5VB 1MW7A 3HL2A 1BW5A 1WGXA 1XSXA 3I54A 3JREA 4ZYEA 1JUMA 2EFQA 3QAHA 2GXAA 2ECBA 3AAFA 4A3CJ 3IKVA 4ZJZA 4FTHA 1Q1VA 4G7HF 3TO9A 4AM3A 2P6SA 2DFHA 2OBPA 2WB1A 3FMRA 3RPUD 5DM6F 1E3OC 4XRFA 1JKRC 3S1MJ 2V6EA 2L3DA 3F6OA 4A69C 4S05A 4EJVA 4CO8A 1SANA 1MDMA 2HYJA 4JX5A 5F64A 3VEPA 2QSGX 3LAJA 3GW2A 4IPAA 4FASD 4PFOA 1KZHA 3HOUJ 2V1UA 2K9QA 2A5YB 2XB5A 4PGHA 1JTYA 4X6AJ 1VNDA 4NC7A 2JT1A 3GFIA 1LE8A 1BA5A 2JRTA 1IN6A 3B6CA 5EGOB 1J7KA 3JRBA 3G2BA 3HUGB 1OR7C 1BR4A 4NNJA 1RR7A 5BMZA 3GFLA 2O0YA 3I9V2 3L2CA 1K78A 2HWVA 1IDZA 1ZQ3P 3KE2A 4PUSA 2E60A 2VB6A 4B09A 4HSTA 1GT0C 4LG0A 3W6JB 1FP1D 4UXNA 5IT9Z 2VQLA 2NVQJ 2CO5A 1TT0A 5DS9A 3K2AA 3V4GA 4HV6A 1S6LA 1SMYF 4HF0A 2O6GE 1KU7A 4PK4A 5FGMA 3H9GA 1T39A 1EJ9A 3OL4A 3FDYA 1FNNA 2K3FA 1T08B 4RS8A 1VQNI 1IZ1A 2ME6A 2G7UA 2R3SA 3R61A 5L3FA 2DDAA 1HOMA 1P6RA 2HS5A 1HLVA 5DYMA 2DA1A 3ROUA 3HPGA 5J1YA 4KUMA 3K70D 2L9RA 5K1YA 1HF0A 4KMFA 3KIOA 2KIFA 1ZRDA 2HQRA 4E70A 3PUFA 5DD8A 1MJAA 3KP6A 2KHMA 1FEXA 4ANJA 3T1BA 2B0LA 3L2RA 3GZNB 2JMWA 1UMQA 3J80K 1FC3A 4XLFA 2L01A 3M8JA 1ZAOA 3ZMDA 2HVSA 5D5XB 4A6EA 3JRCA 2WTEA 2HDDA 1A6QA 1FTTA 1PUFA 4CYCA 3WE3A 1B59A 2EK5A 4CCMA 2HKOA 2TDXA 1X4PA 2HOSA 4G94A 1XX5A 3ABLH 3WGGA 2F2EA 2H8WA 2F48A 3QPHA 3P5JA 3HKZA 1AHDP 4XOTA 2BY1A 1Y6IA 2ZNYA 3QOEA 1MNMC 1U9OA 2ISZA 2HDWA 2WV1A 1H0MA 4ESJA 3AL0B 3KYCB 1X4OA 3DV8A 3BQZA 3Q0VA 5F1RA 1BM9A 1NTCA 4GO1A 2K40A 3WTYC 2CUFA 2M8GX 2COBA 4HF1A 4RLQA 1PP7U 1NH3A 2RNJA 2HVQA 1B9MA 1O57A 3RKXA 4XBFA 5E3NA 1YITI 1HSJA 4AU7A 3DLLF 4UVBA 4ENMA 3LSRA 4G12A 5D8LB 1MMAA 2BZTA 1BI3A 2CS3A 4YEJA 2LKPA 4E7KA 1BI0A 4OMZA 3BZCA 3JW4A 1O3QA 3M07A 4M73A 4C2TA 4FX0A 1S72I 1HA8A 2VPRA 2H8RA 1B72B 3TL4X 5HNHA 3KP2A 4D5FA 4LB5A 4KIBA 1O3SA 4MNUA 4G8XA 3O6BB 2RKHA 4R79A 5ICFA 2ZMEB 2BOLA 3CDHA 1BW6A 3QU3A 1JI8A 5AIQA 3OYKA 2P5LC 1YS6A 3DPLC 3EUAA 4PJMA 3OMYA 2NS0A 4RMNA 3D5SC 1IV6A 3F9KA 3DBRB 4UNOA 4M3FA 4IZZA 2X48A 4AIKA 3BDDA 3OYBA 3AFHA 4KISA 2J5OA 2DQRA 1D0XA 2P6TA 1HBXG 3HIFA 4C30A 1ZRCA 2A05A 3UNGC 3HSFA 4JK1X 1RI7A 4D0PA 5ILUA 2E35A 2JZYA 4PGGA 4B43A 2VLAA 1G3TA 2A6TA 3CJNA 5HS7A 4XRSA 4AD9A 2X9DA 2NVTJ 3QU6A 1YIOA 2ZBKA 1RKTA 3CP2A 3E5UA 2VL8A 4ASNA 3H3ZA 3S3OA 1D0ZA 4XN0A 4EATA 3OS0A 4F55A 4A3LJ 1UCRA 5HODA 4KT6A 5L3EA 3S2HJ 5IYCJ 1K7AA 2V9KA 3I4NJ 5K5QA 3ZQQA 5GPAA 2EFPA 1R00A 2HU9A 2CV1A 2IA0A 3BROA 4BQOA 3HOSA 3BLYA 4GYIA 2RQQA 3BZ6A 4CA0A 4J19A 3DWLE 3KZYA 4IJAA 1TC3C 3M8EA 5BPIA 3EUKL 3NEUA 1TW2A 4MGRA 5LGTA 3T8TA 4MQVA 1KU2A 2WY7Q 2KMUA 3WU0A 1ETQA 2JSPA 3F72A 3JAMZ 3MVPA 4RAGA 3W2WA 3VYRB 4XLNF 3MAJA 3HTSB 1GVDA 1E17A 1FYMA 3Q9VA 1TBXA 2ZKZA 4EGYA 3PFIA 2E7XA 3AG1H 3H35A 2M1BA 3RI4A 4I0AA 4PDKA 1KYWA 3H0DA 3I55I 4NC6A 3OS2A 2XDVA 5CYVA 4CCNA 1YI2I 4ZYAA 2Q0OA 4XSZF 2E1MC 2YX4A 4M3GA 4KA4A 4G6QA 4AUXA 3K10A 3S16J 2XROA 2BGCA 4I0BA 2V1DA 1XTAA 2K9NA 3GEZA 1AKHA 2L9SA 1NG6A 3FXKA 3WTTC 2JJ7A 3S3MA 3GLXA 1OMIA 4BXFA 4BBSJ 1TLHB 3BG3A 5M5YJ 3IHUA 3OYLA 3H1CA 4LG3A 1R49A 2HPMA 3O2PE 1AOYA 5HS8A 3PIOF 1JGGA 1J2XA 4F7ZA 1QRYA 3BR3A 5KHDA 3TOBA 3JTGA 2DDBA 4UHTA 2R7UA 3AG4H 2L7ZA 3K2ZA 3D1NI 2R93J 1V3FA 1OYYA 3OL3A 1L3LA 3TW6A 3TO7A 3SZPA 4BDZA 2XGXA 4UB6C 1S9HA 2MC4A 5E8IA 2JA2A 1D1CA 4XL9A 3K9TA 3H5RA 1X1DA 1MNEA 3GZ5A 4HAMA 1X1PA 2M2EA 1T0FA 1X3UA 2L0KA 3DKWA 3IH4A 1YLFA 1MIJA 5F27A 2JQ7A 2R5YB 2VQHA 2YR2A 4ZZLA 1T38A 2XGEA 1P7IA 2GA1A 2FD5A 1QO0D 2Q2EB 3TW7A 4LITA 1FX7A 1I39A 3JCUC 5B1BH 3K4LA 1O4XA 3F8CA 1D8JA 1LJ9A 4XN3A 3GXOA 3I53A 5LEKA 2Z5UA 1BBYA 3W2VA 3BPVA 2KLOA 4H0EA 1U8BA 1Y0NA 2KPMA 3HC7A 1FIAA 2NVYJ 3M8FA 2B63J 2DU9A 4M74A 1QVTA 4MO7A 2E19A 3KEYA 2F4OB 3KFWX 2DPUA 2O61A 1ZYRF 3A0BC 2IGMA 3PNYA 4I6ZA 5FLVA 1QBJA 1DGRM 2LDUA 3E97A 3CCUI 3ZN1A 2HTSA 3RPUA 1MDMB 2YU9J 1ZR2A 2BY2A 1E3PA 1IN7A 2OF7A 3J7AY 2B7EA 2R7QA 4Q47A 5IOZA 4Q4ZF 5K5RA 2QEXI 4RGRA 4CH7A 2ME0A 5EEHA 1LE8B 1T0FC 3SEZA 5IT9K 5GPCA 4N0BA 1R71A 4HA8A 4M9XA 2PFBA 4HEA2 5FRNA 3VSKA 2QQ8A 5E8GA 4IHTA 1QNTA 1T6SA 2DT6A 1F4KA 3K6GA 1F9NA 1RR8C 1K78B 2R4GA 2TCTA 3TP3A 2X6OA 1FZPB 2M3AA 4BQQA 3RKQA 3LL7A 5FKLA 4LG0B 4I99C 2NYXA 1WSUA 2W7NA 3FXJA 2GWRA 4ZYDA 3UKGA 2CYYA 2BXZA 3GTOJ 2R5ZA 2NXNB 4DJAA 5LEJA 2P7CB 2FOKA 1YIJI 5LD2C 2IP2A 4IO9F 4I2OA 5F0FA 1SEUA 1H8AC 2QGUA 2RREA 4IHXA 4BAYA 3KZZA 1B72A 3DEEA 1Y8RB 2MA3A 4ZTJA 1WI3A 3FKJA 3LA2A 3MWMA 1FBUA 1N25A 3H0GJ 5D8KB 2GAUA 2O8XA 2X1CA 3G6EI 1LB2A 1RUOA 3ABTA 3CCSI 1HW1A 1RPWA 4OOIA 2M9HA 2DN0A 4WWCA 2O9LA 2CW0F 5DTDA 4CDGA 2HQ5A 4NUBA 1UHMA 4A3JJ 3GTJJ 1A36A 2XPVA 2YPRA 5K5OA 3JTHA 2MW8A 5C4JJ 3WTSC 2HDCA 3ZQGA 3GBGA 3KYLA 3WODF 1N75A 2D1VA 5IOYA 1ZK8A 2Z99A 3AL0C 3BOQA 3F6VA 5J47A 3S2DJ 2W1OA 3OIQA 3GX4X 3HYIA 2EZKA 5KVRA 5B3SH 5IY5H 2AXLA 3SFIA 2NS7A 2BHZA 2QF7A 1WJBA 1PUFB 1D1BA 5E18F 2L54A 2KIMA 5M3MJ 1VQ7I 1D5YA 2DOEA 2O7OA 2GBYA 3MZHA 2ELKA 1BR2A 1Z77A 3P7NA 3FZVA 1XCVA 1JTXA 1WJDA 2OJED 5ILVA 2XUBA 3ESWB 4HQMA 3SYTA 2EILH 3B73A 3BG6A 5E3OA 5ILSA 1X2NA 2E1OA 3HSEA 4LFUA 4BXUA 3IC7A 2IS1A 3K7AJ 4MTDA 2EIMH 1ZN2A 3QQAA 2ZMEC 3I71A 2RN7A 2A07F 1U9NA 4YIRX 1V54H 3HXLA 5M5XJ 3K70C 2K4JA 4MQ9F 1E2XA 3CC7I 1FWZA 4ZYGA 3VFZA 2CW8A 4K2EA 3HM5A 5M5WJ 3BCBA 2V1XA 3PFYA 4AVPA 2L02A 4L9JA 2LLKA 2HGCA 2IPQX 1WJ5A 3HGYA 2BVLA 4IOAF 2OC6A 2D45A 2L7MP 3H36A 2LRDA 5HLTA 1XPXA 3QYFA 3R4KA 3DTIA 1RNLA 1U78A 4WXDA 3NRVA 5GAGJ 1UG0A 3CMAI 1G4DA 1TWHJ 4S04A 4QWQA 4HX4A 2XV4S 4Q48A 2VE8A 1K6OA 2HPIA 2X1EA 4C2UA 3MKLA 4P55A 2XF6A 1F1ZA 4CCJA 2JA7J 3H3UA 2KFDA 1TNSA 1QHHD 1ZG5A 4PFPA 4D5CA 4XIDA 5DCMA 1YW9A 2EJRA 3RTRA 4HG2A 2MLKA 2ZNZA 2NOJB 1LKXA 1FIPA 1XGOA 5LRSA 1W0UA 4C2MJ 4O6JA 4EJWA 2CQQA 5CKTA 2CH0A 2GLOA 3PSIA 5HLGA 1N77A 4ON0A 3GTKJ 3WG7H 1R36A 2JUCA 4D1QA 1LPQA 3BJAA 5J8FA 2IJLA 2DT7B 4GFBA 1V55H 1IUFA 4U7BA 1XSVA 2EA4A 1R5HA 1I1SA 3QPLA 1P4WA 1ZGWA 3S14J 5IP7J 5J40A 3H92A 4MEXF 4BBRJ 1FSHA 4M3DA 4FCYA 1O3RA 1ON1A 1I5ZA 2VOPA 4D7MA 3JRFA 3S3NA 3A4CA 1OQYA 5BNGA 3DXJF 2HR3A 4B48A 4LIUA 4BYYA 1Z21A 2P5VA 2ACJA 2VN2A 4A12A 2VJJA 5J8CA 3KEQA 1L0OC 4PJJA 1R1VA 3RZOJ 4WX9A 4W1UA 3SQNA 3OSGA 4AIHA 4QTRA 1NK2P 3K4MA 1F5TA 3W3CA 2VE9A 5J1RA 1YG2A 3HRSA 3JR9A 1IGNA 4QPOA 1WH5A 2E5ZA 2Q2EA 3RYRA 4BNCA 2MG4A 3LSMA 2LSOA 1MBJA 1USTA 4RB1A 3U9GA 1S8NA 2V79A 2DA6A 3HOZJ 1P4AA 1W5CC 1XMXA 2YS9A 3JAMK 1J9IA 2EFWA 2GQQA 5BS6A 1X1CA 3CC4I 2Y75A 2DO7A 2NVXJ 2QENA 2K85A 3VYSB 1Z0XA 3FXMA 1U8RA 3OS1A 1Z6TA 5J4YA 1YHQI 3BG5A 3M4OJ 2OQGA 3G1LA 1YFHA 5D5UB 2BW3A 2JTVA 3TDUC 2XAFA 1T2KA 2DMUA 1I50J 1IUYA 4JBAA 4AYBA 4O5VA 2CG4A 3JRDA 3OY9A 5D4RA 4RAZA 1FBSA 1TT5B 3FIWA 4A5NA 4BQNA 1YRNA 3DU6A 2QA4I 4FETA 1IXCA 1UHSA 1ULYA 4L0ZB 1YE9A 3DBHB 1AKHB 2FUG2 2V26A 4PJLA 4E7JA 1O7LA 2AS5F 4RLFA 2VASA 2XSDC 4DNCA 4F3QA 1ZLJA 5AONA 4A3DJ 3AG3H 2RGVA 1GDTA 1T56A 4BACA 2L2OA 1I3QJ 2LY2A 1ZRFA 2H6CA 2A3SA 2A6EF 2XPWA 1MJ9A 4BY7J 1UFMA 4P9FA 3GFMA 3EUHA 4RGXA 1ZGJA 4ABZA 2CWEA 3IRRA 4BHPA 2V1NA 3E6BA 3MKZA 2E1NA 2W84A 1T8IA 1IW7F 1H9GA 5CVIA 1TW3A 1KONA 4CCKA 3SJMA 3CDLA 3R0AA 5DCFA 4DW6A 5F1JA 2I5UA 5LGUA 1G2HA 3HRUA 1ONVA 2QZ8A 1K6YA 3F23A 1KQ0A 4PJ0C 4EEFG 2XAGA 2GOXB 2NNYA 2KKOA 1HDPA 2QQAA 2MD5A 3G71I 2K27A 2OA4A 5ED4A 2ICWG 1EKEA 3BP8A 3OYGA 1C0WA 2W00A 4QSHA 4EM2A 3MFKA 1D0YA 3ZPLA 4N4NB 4DYQA 2NOGA 1G3WA 4HV5A 2KQRA 3LSTA 4EM1A 5BPDA 1X3ZB 3WTWC 2CQ7A 2XB0X 4A0ZA 4EM0B 2WWYA 2EA2A 2DTRA 2L4AA 4TV7A 1K79A 1KU3A 2ZJRF 3A1YA 1MSEC 1XC5A 2ZXJA 5IPAA 3B02A 2YU3A 5BOXA 3BTLA 3ISPA 1WQ2A 1IG7A 2AXTC 3K4CA 1XMAA 3FMQA 4YELA 3SXYA 3ZRGA 3ZOBA 4HNVA 4A3KJ 1ZG1A 1UG2A 1UAAA 2IEKA 3O8GA 1YQAA 4UUSA 3FX3A 2QUFA 2K9MA 3REOA 1T95A 1IJWC 3C1DA 3L00A 4G6TB 2EPFA 2CV0A 1FOXA 2M4GA 2JK3A 2V4JC 3CCRI 1GV5A 1R22A 4IRHA 4ZYHA 5C3EJ 3LAPA 3PO2J 2Z1DA 2CFXA 3HOXJ 5DD4A 4XKWA 3VODA 1X19A 3IL2A 5KCMA 1GV2A 4ITVA 3E0JB 4M3EA 2IBDA 5JR3A 3CC2I 1A04A 3EDPA 4BH9A 2B9SA 2EBIA 1R7JA 1R1UA 4L0YB 2GOMA 6PAXA 3DP7A 4U0VA 5HDKA 2QBYB 4IRGA 2QVOA 2KL4A 1G59A 4BEHA 3J81Z 3C3WA 3FK7A 3GCMA 2R5ZB 1S3JA 3BR5A 2O3FA 1WJEA 3QPSA 2KRHA 4F93B 2DAOA 4NQWA 3PUBA 5JLXA 1CQTA 3N05A 1K61A 4A3MJ 3MMYB 4UB8C 5E1ZB 1R4NB 3IKTA 2Y31A 1IC8A 2OPTA 2IW5A 1OCCH 2VBXA 2WAQN 3CDIA 3HBLA 1JT0A 1D3YA 3G1MA 4AWXB 1ERDA 2LC2A 3MZYA 4F92B 3BC8A 5FFXA 2BV6A 1GVJA 3KYDB 4QIWN 1QU3A 3F8BA 3D5LA 1WKMA 2LKSA 2EQRA 1MH3A 3E1SA 4ENNA 2VPLA 2ELHA 5E1XA 2FA5A 2YSRA 4EVIA 1MD0A 4U7DA 3RJPA 4IKFA 3RKWA 4B47A 2Z33A 1O7FA 1DDNA 4BJ6C 3WGIA 2HEOA 2H6BA 1ETKA 4N4OB 3ZGKA 1LFBA 4E7LA 2VKHA 2E2IJ 1XG1A 4GRIA 4KIFA 5JHFA 2KZGA 3D5RC 1D1AA 1S7EA 3VWBA 2A61A 2Y0MA 1MBEA 2CJJA 3E3VA 5EJCA 1TTYA 4RB2C 2K9LA 5E20A 3TKYA 1WFXA 1CGPA 2HXIA 3GLLA 5CVVA 3GTQJ 1U5TB 4LLLA 2KRCA 1OYIA 4YG2F 5A2QZ 1OPCA 2HZTA 2H1KA 4G7OF 2QQ9A 4GYGA 2D2WA 2V9PA 2QYOA 1X58A 2LD5A 5J3LA 2MFZA 2P4WA 3HEFA 4XQFA 2E34A 3DQVC 4XR6A 3LNQA 4HLYA 1HW2A 4EJUA 3ZQCA 2AQEA 2XVCA 3BTIA 5C4XJ 5EYRA 3GUDA 2ZJQF 3HOYJ 3ZCOA 2L7FP 2DYRH 1USSA 3B6AA 2KISA 2E36A 1B9NA 5B66C 2EWNA 4WK8F 1APLC 3CCLI 3CLQA 2STTA 2E2JJ 1OCOH 3RPQA 3CD6I 4IVNA 4Y13A 1P7JA 4L9NA 2HVRA 4P1WA 4XLPF 1S5LC 2Q8KA 5EDNA 2WAQA 3H9QA 5BQTA 2DMNA 1W4MA 3CUQA 3C18A 2DI3A 2M7AA 3O3KA 2X85A 4D9JA 2E71A 5TGTA 4A6DA 4ESFA 1YJ9I 3FISA 3EQLF 4N9HA 3FHNA 3SZTA 3VOEA 4KFCA 4IHYA 2NAZA 2DYSH 3H9JA 2DQLA 2FQ4A 4LIVA 3Q9SA 2I8DA 4L5JA 1VQ4I 2H94A 2R7RA 1VQ5I 1KU9A 4OWRB 5DCMB 2EFOA 4A0XA 3VPRA 2YUSA 4AIJA 2IVMA 1SD4A 4XORA 2IA2A 3ZQLA 1YJNI 5L3CA 3GTGJ 4Y15A 5E17F 1E0EA 3CF5F 3F0CA 3V7CA 1IV8A 2EV5A 1HKSA 2K3PA 2K4BA 1BL0A 1S7OA 3BR6A 3OYIA 3Q5FA 2ZJ2A 2M8EA 4LK1F 5CVRA 4XICA 1I3AA 1FT9A 2CW7A 3CO6C 3GO5A 1OKRA 1ITYA 1YW8A 2XF5A 1IAWA 4LK0F 2CU7A 1D8KA 1SFOJ 1FOKA 4FX4A 2PBIA 3NAUA 3T8RA 3P9IA 4XSXF 4MFEA 4BL0B 1V5FA 1TP4A 4HLXA 4A3BJ 3WU2C 3S1NJ 3HOTA 5EF6A 5IP6A 1BC7C 3KLOA 2LNBA 5D6EA 2PMZN 3HRTA 5JI6A 2LK2A 2W85A 4DGWB 5TJJA 4FE4A 1XS9A 1A5JA 1JJ8C 1BOAA 1LUJB 3C2GA 4JX6A 2XHKA 2O8KA 3WHBA 5DV5A 5D5WB 5D6FA 2WC2A 1VQOI 1U2WA 5FKNA 2W82A 2E2HJ 1ZHFA 3HTUA 2GXGA 5HS9A 1BIAA 2K86A 5GAHJ 4EV0A 1LFUP 3RKYA 1R58A 4JQFA 1HXDA 2ADUA 1YOVB 1Z6RA 2AO9A 2JN6A 3OOUA 2QM3A 3SDGA 1J09A 1Z7LA 3T5XA 3OYEA 4F91B 3U1DA 3COAC 4Y3OA 2DOFA 2BEOA 3I56I 3PO3J 4V2FA 3FWEA 5ERIA 4UV9A 2M34A 4OMYA 4DIQA 3BTCA 1FJLA 2V7FA 3ZQIA 4HDVA 4GGGA 3KZIC 4RDUA 1CF7A 2IS4A 2BW3B 3ASOH 1WJFA 1D5VA 2XC7A 4RB0A 2XAQA 4ENJA 1VF9A 2R7ZJ 4BU2A 1UB9A 1QHGA 2LF8A 4ZDPA 1MMNA 2GA2A 3VB2A 4O3MA 3CF2A 1VFCA 1FMVA 5GTHC 5GADJ 2QSFX 1G3SA 1RESA 4JYKA 4CICA 1YRNB 2HQNA 5E3LA 1VQKI 3L7WA 4QLCU 3BY6A 2DK8A 2PG4A 2ZXIA 4J01A 4U88A 3BTJA 2CQXA 1A31A 4KYWA 5FRMA 1YO5C 1MJBA 2FNAA 2L9NA 2F5DA 3BJOA 1NK3P 1YTYA 2M5WA 1W7PA 1TWAJ 1SD6A 4HYEA 2QBYA 2VJ4A 2GM4A 2KIUA 4I09A 4WXHA 2DBBA 3CMEI 1WHUA 5IYBJ 1Y1VJ 1RUNA 4OIOF 3HHGA 2CQNA 3TOAA 4PCQA 2PMZA 1GHCA 2XGCA 1XB4A 3L09A 4IHSA 2KIQA 2WADA 3HB9A 3N4MA 2DA4A 2HOTA 3J7AO 1QPMA 2MABA 3A2KA 3CCJI 2XRNA 5DM7F 5FKOA 3F8FA 1ZGAA 3P9KA 2JA8J 2PI0A 5F04A 2HQAA 3BR0A 1QVUA 3S15J 1K83J 3K1NA 4QPQA 2FRHA 4A2UA 4BGDA 1Z05A 3LSHA 2FJ1A 4W97A 4YFXF 4A3EJ 3I59A 1LVAA 2F6CA 3CLOA 1UJ8A 5M3FJ 5LHHA 2Y9ZA 2M87A 5H6QA 3TO6A 3L1PA 2UV1A 2E7WA 4AVZA 2OAZA 1W5TA 3ABUA 1TL8A 3BR1A 2J5PA 3LFKA 2R7FA 3DFGA 2P5KA 3CJQB 2RC4A 4YFNF 2ZFWA 3TMOA 3LOCA 5F0CA 4B8XA 1JT6A 4H4KC 4E7SA 5LHGA 1B8IB 4FE7A 3GZ6A 3M7GA 1VQ9I 3Q3SA 4L9VA 3CP8A 3CCEI 4UUSB 5CVUA 1U5TA 1HSTA 1ON2A 2QSHX 1QPIA 2IT0A 2DFFA 5E79C 2CQKA 5FKMA 1FSEA 1MBHA 2LR8A 5H20A 3FMSA 2DOAA 5E1WA 1KYZA 5CLSA 4Y17A 3OYAA 2ZO4A 2CGPA 2UZKA 3UR3C 4BHCA 2VODA 1ZTRA 2XSJC 3EYYA 5ICGA 4OAZA 2COMA 3J81K 1JKOC 4YIFA 2D5VA 3BR2A 3FF5A 3S17J 5AIPA 1PYVA 1R5ID 3DKYA 3LQRA 4RAFA 5FROA 4ZC3A 2IA1A 5KK1A 3MN2A 3A0HC 5DEQA 5L3DA 2VQGA 5FD6A 2Y0SN 2FF4A 2R7DA 1U0JA 2W57A 3ZMVA 3Q0UA 3F21A 4BEHB 1TWGJ 1JUPA 2VBZA 2KRFA 2DMPA 1WVRA 3K0LA 1X2MA 4FHTA 4UVAA 3T0YA 1S7AA 3V8LA 4NQWB 4BKXA 2VI6A 2MH9A 1Y56A 4E7HA 5K7FA 2NNNA 1POGA 5DDGA 1HC8A 1A35A 3BT9A 4RM2A 1JHFA 4ENKA 1Q1HA 3CTAA 3IWZA 1JE8A 2H1LA 2DODA 1U5TC 3FK6A 3H5NA 4Y33A 4UVCA 1WJAA 1JKPC 1BJAA 2X0LA 1SFUA 1ZELA 2VXDA 3RIRA 1IRFA 5GAEJ 5JVGF 1BC8C 4WCGA 1BI1A 5IYDJ 1R6RA 2ID3A 3FXOA 3BQYA 3LWFA 3S8PA 4UUVA 2LTPA 3X2QH 3IH2A 3F3XA 3V8KA 1LDJA 3KETA 5CPRB 4Z2YA 5LRRA 5A2QK 2UWMA 3OSFA 3MEXA 2WB1N 1X3WB 3Q0WA 4HBLA 4KIGA 2IAIA 1Y8QB 2KZVA 5LLQA 3RYPA 3L2WA 5J1UA 5GTIC 1JHHA 4XLCA 2DCEA 2NRAC 1IO2A 2OCCH 3QPTA 4HZFA 3OYHA 5J6XA 3ZQFA 2DA5A 2OZ6A 3CCMI 3F22A 1BI2A 3H5AA 2OTJI 1W36D 3M9AA 2R7TA 2HKXA 1Y0UA 3HOVJ 3OYDA 4B44A 1B1BA 5JLWA 3HDDA 3DPUA 3P9CA 3MKYB 5CJ9A 4MIMA 3IWFA 3PQKA 3I4MJ 4E7IA 3KPHA 4UV8A 1W0TA 4CCOA 1TZLA 3FKIJ 1Z67A 1WH7A 4C3IJ 1ORKA 2HFHA 4RGUA 5FD5A 1I1GA 5EG0A 3S1QJ 1P4XA 1SD5A 1ZKGA 1OCPA 2AHQA 4V2GA 1OCTC 3C7JA 2K02A 1WJCA 2IXSA 3CCYA 1YS7A 1BIBA 2FEZA 2WA0A 4BUPA 2Z9OA 2QWWA 2PLYA 3ONQA 3QP6A 2FX0A 2VKEA 3JRIA 3LQQA 4G6DA 3HZJA 4CCLA 2VOOA 3CUQB 3FXUA 4ESBA 4E7ZA 5FLMJ 2BBYA 5FFZA 1OLTA 1BN5A 1ETWA 1HKQA 2ESHA 3GVAA 3LMMA 3J7YJ 1SFKA 2IGNA 3EETA 2ESNA 2N8GA 4YFKF 3W6KB 4A93J 2Y69H 1Z3XA 4KICA 3BJ6A 4X0GA 1OFCX 4RA2A 1K4SA 4IRIA 2F5VA 1DGWY 1KA8A 4NC8A 3GYHX 3ASNH 1FTZA 5JFRA 1QA6A 3DEWA 3CO7C 3ERED 4ZTFA 4C3HJ 1Z1DA 2E5NA 1RKWA 3OR2C 5EEGA 4AC0A 4EMSA 3CMYA 1RRJA 2XKPA 2R92J 4M3BA 2EV6A 1MMSA 4L5IA 2LREA 2NS8A 4LLGF 1W7PD 3I0TA 1XN7A 1NG7A 1T98A 1QZZA 1ZARA 2HOEA 1R9TJ 3L2QA 2R0QC 4IOCF 4IEJA 3FXLA 3JSPA 3DU5A 1FOWA 3K4BA 3TQNA 4DQ2A 5ICCA 3HOWJ 1OYWA 1EA3A 4GXOA 3GTLJ 3SEQA 2A68F 2R7WA 1R5GA 1R4MB 3EYIA 1DU0A 1WCMJ 1JXSA 4XLHA 2WBMA 3HKZN 3RQ4A 4DBQA 4HDUA 1IXRC 3PNTA 4ZZDA 2GXBA 1JGSA 1M1EB 5HNFA 3CJTB 3WGHA 1R23A 2FE3A 4S0HB 3HPHA 4CHUA 3ZMZA 1H88C 1WZ2A 2CRGA 1F36A 1OCRH 3A03A 5HDNA 4KITB 1U3EM 1FLIA 4MFDA 3JRGA 3VDXA 2JVHA 4NDLA 2DW4A 4NBQA 3FBNB 2WV0A 2VJ5A 2ZJPF 4A3FJ 3GFJA 3PIPF 3HGGA 4XRSG 3WTUC 2KDOA 5KAIC 3S1RJ 4EGZA 2BHYA 2P7VB 4UUTA 4CSWA 4HPQA 2GIZA 2X4HA 2E1CA 2CUZA 1RIOH 1LNWA 1U6GA 4B1RA 2DLLA 2HI3A 4XLEA 1B8IA 2L5QA 2FBKA 2XAJA 2K7LA 3QRFF 1V4RA 4OU0A 3EUHC 4GCVA 4N9IA 1CF7B 4KN7X 3KEOA 1TQMA 3NQOA 3LSPA 2F5CA 5TISC 4XKCA 1DQUA 2V6CA 3VYTB 2C6YA 2R7VA 4P5OA 4OIQF 2MBFA 2O03A 2R7OA 3U21A 1AWCA 5EZGA 2VC1A 4XLAA 4B3AA 4DZJA 4D7NA 4LB6B 5GP9A 1JJ6C 3PJRA 2G9WA 4DBRA 4FT8A 3R6SA 2L4MA 1DU6A 2VONA 2HXOA 3NWSA 2QKMB 3RDIA 3ZQ7A 3G1OA 3RQIA 1FOYA 3W2AA 2QCOA 2FOWA 3IH3A 1TWFJ 3GTMJ 3E6DA 1J75A 3CZ6A 1YX3A 3C2HA 3QOPA 5L3BA 4BY1J 2IS2A 1W7PB 4G7ZF 4M6XA 1IDYA 1Z7UA 1XCBA 1I27A 2D1HA 1VQPI 1I6HJ 3ULQB 5LHIA 3DKXA 3BPXA 2LY9A 3WTZA 2YX7A 2EV0A 1TWCJ 1SC7A 4BJ5C 2MC3A 1WPKA 5E3MA 2ZFUA 2A69F 4IQ4A 1RC9A 4CYDA 2PMUA 5HVQC 3AKZA 1IXSB 4XK4A 3DTKA 3OYMA 4KNYA 5KAFC 3IAS2 3FM5A 1NHAA 2X6XA 2W24A 4HX7A 4IF4A 2PMHA 4CZZA 4KDPA 4DYRA 4YIIA 1HDDC 2MLGA 4OINF 1AA7A 1VI0A 4BJTA 2Y9YA 2KP6A 3MQ0A 1LEBA 1GXPA 3I59B 2FBIA 2VUMJ 3QYBA 4HSRA 2LF7A 2X6YA 2CMPA 3LSKA 3VYUB 1G3YA 3O8HA 2DMTA 2F5FA 3ZN0A 1PUEE 2PJRA 3K1PA 1MKMA 4WXCA 2BXYA 3SHFA 2ZCWA 2F4IA 1Z3YA 4PJNA 1EH7A 2FU4A 3GWZA 3CMMA 4ZDOA 3IRQA 1W1WE 4RAYA 5H6RA 4IQJA 3SDBA 4BE2A 1ODDA 4FQGA 1V5EA 2BVMA 2KJCA 1MNDA 2UUZA 3ABMH 2DMQA 4XMYA 3IAM2 1W5SA 2JVGA 2M30A 4JOMA 1DPUA 2ZB9A 1J0RA 2DPDA 1PP8F 1XSDA 2X1DA 3V7RA 3K69A 2G0EA 2LMDA 4MHGA 1DPRA 2P81A 2VQCA 3HRMA 1KGSA 3L2VA 1HW5A 2L9VA 1FYLA 4E4HA 4BDYA 4I98B 2K9SA 1SVOA 2KDZA 1O3TA 2G7HA 1ETYA 2LOOA 3OV8A 4Z6YA 3TEDA 2DA7A 3CJRB 1KQ8A 3ERMA 3A01A 3OYJA 2BY0A 3SZGA 3PSFA 4U0YA 2VKVA 2FMYA 4Y52J 1OISA 2HOAA 2P0WA 4MLOA 2FQ3A 2LH9A 3ZMSA 4I01A 2LKXA 2EINH 3ZMTA 2ETHA 4XKVA 3CUOA 1QZYA 2DK5A 4MEYF 4DOZA 2XAHA 2L7KA 2WAEA 1WI9A 4HX8A 1RETA 3TDZC 5B5EC 2K5CA 1EV7A 2KJBA 2Y48A 1SFXA 9ANTA 1KQ9A 1VZ0A 3CESA 2IGKA 1ZREA 1QZEA 4BQAA 1PDNC 4CXFA 3OOPA 4CZCA 3I58A 2CUJA 1QQIA 2GZWA 2JWTA 5FLXZ 3RZDJ 4EJTA 1IRGA 3QYEA 4OIPF 2Q1ZB 4P9UA 1GXQA 2MYSA 1OCZH 4V19K 2VT3A 4J00A 4BS9A 3BWGA 1EH8A 2XASA 2M0MA 2Y30A 3K1MA 2XF7A 4M9ZA 5KNLA 3MKWB 1IRZA 1YYVA 2EZHA 2JPBA 2DT5A 2RAEA 2XGDA 2EFNA 2ZSHB 1YW7A 5FB2A 4KJZA 1V5GA 2RV8A 3OWTA 4L18B 3GTPJ 4CUGA 5K7HA 4ZH4F 1K4TA 1VQ6I 2F5EA 3KP5A 4P96A 5JVTA 2ZSIB 2H09A 3IV5A 1REPC 1ETOA 2MGQA 5EGOA 3OYCA 2H27A 1MSFC 3HUGA 4M9SA 3LA7A 5HLIA 5HLHA 2ZXWH 3HJEA 3EPZA 3CUQC 4R8HA 1SAUA 2VJIA 1MZBA 2VXZA 1BR1A
chains in the Genus database with same CATH topology
2DOEA 2JUCA 2K85A 2KZGA 2DOFA 2LKSA 4FQGA 2KIQA 2E71A 2KFDA 2L9VA 2B7EA 2KISA 1UZCA 2DODA 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOE A;  2JUC A;  2K85 A;  2KZG A;  2DOF A;  2LKS A;  4FQG A;  2KIQ A;  2E71 A;  2KFD A;  2L9V A;  2B7E A;  2KIS A;  1UZC A;  2DOD A;  2CQN A; 
#chains in the Genus database with same CATH topology
 2UXN A;  1OJL A;  2R7X A;  1IN8 A;  1LVK A;  4HNT A;  3R60 A;  1ZR4 A;  2DA3 A;  5IT3 A;  1STZ A;  3A02 A;  2F4M B;  3C2B A;  2LBF B;  1JUS A;  3HHH A;  4C9Y A;  2DA2 A;  4BE0 A;  1IF1 A;  4MTE A;  1IRX A;  2LY1 A;  4E6K G;  3IP4 B;  2KT0 A;  3V42 A;  4IHW A;  2ECC A;  3KLN A;  5EG0 B;  2GIV A;  2PJP A;  4KMU X;  4PZJ A;  1FBQ A;  1J59 A;  2BY3 A;  2LYC A;  3WTX C;  3DTE A;  3SFZ A;  1EH6 A;  3FXR A;  3TGN A;  3KP4 A;  3PQJ A;  2TRT A;  3E6C C;  4WF2 A;  1Y39 A;  4HRI A;  4IL6 C;  2OZU A;  5DUI A;  1ETX A;  1XDU A;  2MD0 A;  1H9T A;  2XPU A;  4EJO A;  1P2F A;  1IN4 A;  3KP3 A;  1VQL I;  4GDF A;  3K4N A;  4LMY A;  3ML6 A;  2PX9 A;  2LP0 A;  1B6A A;  1JKQ C;  5IP9 J;  2JA5 J;  1N78 A;  3LSI A;  2UXX A;  1ETV A;  1ACI A;  2ZXH A;  1IN5 A;  4DZP A;  5J4V A;  3G4S I;  3BG7 A;  3QWL A;  1I6X A;  1SAX A;  4HNU A;  1E3H A;  3I4P A;  3BCA A;  1SMT A;  4F52 A;  4HQE A;  1SVM A;  3E5X A;  4HW0 A;  4BHB A;  1W36 C;  3G73 A;  1VQ8 I;  3LSJ A;  5LFA A;  3ZR8 X;  4YRV A;  3U1K A;  2DJN A;  1HQC A;  3LA3 A;  3J80 Z;  1XDS A;  2X6W A;  3S32 A;  3BG9 A;  3W6V A;  3M3Y J;  3JRH A;  2EIJ H;  2BYV E;  2CV2 A;  2JPC A;  1FY7 A;  2EZL A;  2Z16 A;  2A6H F;  1ZG3 A;  3ELK A;  3MZ8 A;  4KT5 C;  2OQR A;  5CQG A;  3G3Z A;  2I10 A;  3TBI A;  5HOO A;  2MSY A;  1J5Y A;  3I64 A;  4LGW A;  1HKT A;  2DFI A;  5D4S A;  5CQE A;  5K7Z A;  3V7S A;  3OYN A;  3CCV I;  2CSO A;  1LQ1 A;  1PJR A;  4PSX A;  3GF2 A;  1MBK A;  2LFB A;  3M1C A;  5F08 A;  1Z9C A;  3DCF A;  2V9V A;  1G8X A;  4IXA A;  5L3G A;  3GME A;  4M6V A;  4NHJ A;  4C3J J;  5LGN A;  2OU2 A;  4Y7N J;  2W48 A;  5C44 J;  3H3V K;  4A3G J;  2FXA A;  3NWT A;  4NB5 A;  2FNP A;  4LJZ F;  4ETS A;  2DFE A;  4ZDL A;  1XD7 A;  2JUG A;  4IHV A;  3OR1 C;  1FPQ A;  3ZP5 A;  4XOP A;  2RDP A;  2VKD A;  1SD7 A;  1UZC A;  2HZD A;  3K4J A;  5ICE A;  1MGT A;  2HTJ A;  3FXQ A;  3RCO A;  2M7B A;  4RGS A;  2FBH A;  2XAU A;  4XM3 A;  2OTL I;  3M1E A;  5FKK A;  5FO5 A;  2X51 A;  4XRM A;  4R1H A;  1FP2 A;  2OD5 A;  2ZME A;  4LLN A;  1WWX A;  1FYK A;  1GLN A;  1H89 C;  1EF4 A;  4KN4 X;  2STW A;  1UHW A;  1XGN A;  2FSW A;  3QOD A;  2ISY A;  1YX5 A;  4I7H A;  4UY8 I;  4II2 A;  2PEX A;  2Z3Y A;  3HG9 A;  3S2W A;  2VIX A;  1R1T A;  1DUX C;  2OCE A;  1SFE A;  3LSG A;  4M72 A;  3E6M A;  5LBQ A;  3WU1 B;  3ZXS A;  3MD2 A;  4I76 A;  2RNG A;  1TQP A;  3RSN A;  2BE5 F;  2O5R A;  1BOB A;  3DPT A;  2W25 A;  4JX4 A;  5JHU A;  2EH3 A;  2PN6 A;  3WTV C;  3VSL A;  3I3L A;  1AU7 A;  3E7L A;  5FJ8 J;  4RB3 C;  1LDD A;  3DBL B;  4CYC B;  2EZI A;  2MH2 A;  1RZ4 A;  2HNH A;  2XKO A;  4HF2 A;  1UEL B;  5EZH A;  2JA6 J;  4XON A;  2VBW A;  2HYG D;  1YJW I;  1ZLK A;  4BXX J;  1T33 A;  1FMW A;  3WHC A;  1LFP A;  4FIS A;  1TNT A;  1SVL A;  3MCZ A;  2PQ8 A;  3F8M A;  4PSW A;  3L9F A;  1GUU A;  3NAR A;  1XMK A;  2Z2S B;  5DUK A;  4OAY A;  1A6I A;  1B4A A;  3DEU A;  4U87 A;  1PVE A;  4HOB A;  5F0H A;  3KP7 A;  4M6Y A;  1BJZ A;  4G9Y A;  3FM3 A;  1XGS A;  1X1B A;  3PNV A;  3WE2 A;  1DP3 A;  2DTZ A;  2XRL A;  3FBI B;  3KX2 A;  2IS6 A;  3AG2 H;  1MBG A;  1VTN C;  1S29 A;  2OV7 A;  3ABK H;  2W4S A;  4JP0 A;  4RM3 A;  3L2U A;  2WAF A;  2JRM A;  4LD5 A;  3U2R A;  4DYC A;  1Y1W J;  2M0C A;  1Z91 A;  1VQM I;  3JSO A;  1LEA A;  1WRJ A;  3I5U A;  3R0J A;  3V8J A;  4RBO A;  3ECH A;  4AID A;  3JRA A;  4Y4R A;  3FHZ A;  5EEA A;  4A5M A;  2ID6 A;  2PJR B;  4EQQ A;  2M45 A;  1X1A A;  2WY8 Q;  3QP5 A;  2VT2 A;  3CQZ J;  3N97 A;  2JSC A;  3J7Z I;  2EB7 A;  2XIG A;  2AQF A;  2VBY A;  3S93 A;  2CUE A;  2IRF G;  2R7S A;  1MBF A;  4OIR F;  2QQB A;  4AYB N;  5H2F C;  2EIK H;  2RQP A;  3CCQ I;  3DLA A;  4CGZ A;  1F43 A;  4A0Y A;  4Q5S F;  3F8N A;  3ZQH A;  4IX7 A;  2ELJ A;  2OUM A;  1QGP A;  4II3 A;  1MH4 A;  5CVJ A;  3KCC A;  3K4K A;  3OIO A;  3BZK A;  4I02 A;  3PM1 A;  5F6F A;  4B4C A;  2CFO A;  2HYF A;  5TRD A;  4L9T A;  2LBF A;  1XGM A;  3LFU A;  3ZMU A;  3OYF A;  2Y0S A;  4XNF A;  4U0W A;  4B3X A;  3IUO A;  1DP7 P;  4BE1 A;  1G6N A;  5HDG A;  3A01 B;  3E5Q A;  4L5E A;  1P92 A;  1MMG A;  2VC0 A;  1TQI A;  2P8T A;  2QKL B;  3ECO A;  1P9Q C;  2RVC A;  1ZH5 A;  2E1M B;  3WG9 A;  2LG4 A;  1HCR A;  2Y2Z A;  5FLX K;  3TP0 A;  2QLZ A;  2ZC2 A;  3OIP A;  4A3I J;  2LVS A;  2R5Y A;  1OR7 A;  2NVU B;  3D0S A;  2M4K A;  4X1E A;  2DJI A;  1MMD A;  2IGO A;  4XKB A;  2DXI A;  1ENH A;  2A5W A;  2FML A;  3DF8 A;  3PL8 A;  4M71 A;  5B1A H;  3HSR A;  4LOC A;  1LDK B;  5D5V B;  1MW7 A;  3HL2 A;  1BW5 A;  1WGX A;  1XSX A;  3I54 A;  3JRE A;  4ZYE A;  1JUM A;  2EFQ A;  3QAH A;  2GXA A;  2ECB A;  3AAF A;  4A3C J;  3IKV A;  4ZJZ A;  4FTH A;  1Q1V A;  4G7H F;  3TO9 A;  4AM3 A;  2P6S A;  2DFH A;  2OBP A;  2WB1 A;  3FMR A;  3RPU D;  5DM6 F;  1E3O C;  4XRF A;  1JKR C;  3S1M J;  2V6E A;  2L3D A;  3F6O A;  4A69 C;  4S05 A;  4EJV A;  4CO8 A;  1SAN A;  1MDM A;  2HYJ A;  4JX5 A;  5F64 A;  3VEP A;  2QSG X;  3LAJ A;  3GW2 A;  4IPA A;  4FAS D;  4PFO A;  1KZH A;  3HOU J;  2V1U A;  2K9Q A;  2A5Y B;  2XB5 A;  4PGH A;  1JTY A;  4X6A J;  1VND A;  4NC7 A;  2JT1 A;  3GFI A;  1LE8 A;  1BA5 A;  2JRT A;  1IN6 A;  3B6C A;  5EGO B;  1J7K A;  3JRB A;  3G2B A;  3HUG B;  1OR7 C;  1BR4 A;  4NNJ A;  1RR7 A;  5BMZ A;  3GFL A;  2O0Y A;  3I9V 2;  3L2C A;  1K78 A;  2HWV A;  1IDZ A;  1ZQ3 P;  3KE2 A;  4PUS A;  2E60 A;  2VB6 A;  4B09 A;  4HST A;  1GT0 C;  4LG0 A;  3W6J B;  1FP1 D;  4UXN A;  5IT9 Z;  2VQL A;  2NVQ J;  2CO5 A;  1TT0 A;  5DS9 A;  3K2A A;  3V4G A;  4HV6 A;  1S6L A;  1SMY F;  4HF0 A;  2O6G E;  1KU7 A;  4PK4 A;  5FGM A;  3H9G A;  1T39 A;  1EJ9 A;  3OL4 A;  3FDY A;  1FNN A;  2K3F A;  1T08 B;  4RS8 A;  1VQN I;  1IZ1 A;  2ME6 A;  2G7U A;  2R3S A;  3R61 A;  5L3F A;  2DDA A;  1HOM A;  1P6R A;  2HS5 A;  1HLV A;  5DYM A;  2DA1 A;  3ROU A;  3HPG A;  5J1Y A;  4KUM A;  3K70 D;  2L9R A;  5K1Y A;  1HF0 A;  4KMF A;  3KIO A;  2KIF A;  1ZRD A;  2HQR A;  4E70 A;  3PUF A;  5DD8 A;  1MJA A;  3KP6 A;  2KHM A;  1FEX A;  4ANJ A;  3T1B A;  2B0L A;  3L2R A;  3GZN B;  2JMW A;  1UMQ A;  3J80 K;  1FC3 A;  4XLF A;  2L01 A;  3M8J A;  1ZAO A;  3ZMD A;  2HVS A;  5D5X B;  4A6E A;  3JRC A;  2WTE A;  2HDD A;  1A6Q A;  1FTT A;  1PUF A;  4CYC A;  3WE3 A;  1B59 A;  2EK5 A;  4CCM A;  2HKO A;  2TDX A;  1X4P A;  2HOS A;  4G94 A;  1XX5 A;  3ABL H;  3WGG A;  2F2E A;  2H8W A;  2F48 A;  3QPH A;  3P5J A;  3HKZ A;  1AHD P;  4XOT A;  2BY1 A;  1Y6I A;  2ZNY A;  3QOE A;  1MNM C;  1U9O A;  2ISZ A;  2HDW A;  2WV1 A;  1H0M A;  4ESJ A;  3AL0 B;  3KYC B;  1X4O A;  3DV8 A;  3BQZ A;  3Q0V A;  5F1R A;  1BM9 A;  1NTC A;  4GO1 A;  2K40 A;  3WTY C;  2CUF A;  2M8G X;  2COB A;  4HF1 A;  4RLQ A;  1PP7 U;  1NH3 A;  2RNJ A;  2HVQ A;  1B9M A;  1O57 A;  3RKX A;  4XBF A;  5E3N A;  1YIT I;  1HSJ A;  4AU7 A;  3DLL F;  4UVB A;  4ENM A;  3LSR A;  4G12 A;  5D8L B;  1MMA A;  2BZT A;  1BI3 A;  2CS3 A;  4YEJ A;  2LKP A;  4E7K A;  1BI0 A;  4OMZ A;  3BZC A;  3JW4 A;  1O3Q A;  3M07 A;  4M73 A;  4C2T A;  4FX0 A;  1S72 I;  1HA8 A;  2VPR A;  2H8R A;  1B72 B;  3TL4 X;  5HNH A;  3KP2 A;  4D5F A;  4LB5 A;  4KIB A;  1O3S A;  4MNU A;  4G8X A;  3O6B B;  2RKH A;  4R79 A;  5ICF A;  2ZME B;  2BOL A;  3CDH A;  1BW6 A;  3QU3 A;  1JI8 A;  5AIQ A;  3OYK A;  2P5L C;  1YS6 A;  3DPL C;  3EUA A;  4PJM A;  3OMY A;  2NS0 A;  4RMN A;  3D5S C;  1IV6 A;  3F9K A;  3DBR B;  4UNO A;  4M3F A;  4IZZ A;  2X48 A;  4AIK A;  3BDD A;  3OYB A;  3AFH A;  4KIS A;  2J5O A;  2DQR A;  1D0X A;  2P6T A;  1HBX G;  3HIF A;  4C30 A;  1ZRC A;  2A05 A;  3UNG C;  3HSF A;  4JK1 X;  1RI7 A;  4D0P A;  5ILU A;  2E35 A;  2JZY A;  4PGG A;  4B43 A;  2VLA A;  1G3T A;  2A6T A;  3CJN A;  5HS7 A;  4XRS A;  4AD9 A;  2X9D A;  2NVT J;  3QU6 A;  1YIO A;  2ZBK A;  1RKT A;  3CP2 A;  3E5U A;  2VL8 A;  4ASN A;  3H3Z A;  3S3O A;  1D0Z A;  4XN0 A;  4EAT A;  3OS0 A;  4F55 A;  4A3L J;  1UCR A;  5HOD A;  4KT6 A;  5L3E A;  3S2H J;  5IYC J;  1K7A A;  2V9K A;  3I4N J;  5K5Q A;  3ZQQ A;  5GPA A;  2EFP A;  1R00 A;  2HU9 A;  2CV1 A;  2IA0 A;  3BRO A;  4BQO A;  3HOS A;  3BLY A;  4GYI A;  2RQQ A;  3BZ6 A;  4CA0 A;  4J19 A;  3DWL E;  3KZY A;  4IJA A;  1TC3 C;  3M8E A;  5BPI A;  3EUK L;  3NEU A;  1TW2 A;  4MGR A;  5LGT A;  3T8T A;  4MQV A;  1KU2 A;  2WY7 Q;  2KMU A;  3WU0 A;  1ETQ A;  2JSP A;  3F72 A;  3JAM Z;  3MVP A;  4RAG A;  3W2W A;  3VYR B;  4XLN F;  3MAJ A;  3HTS B;  1GVD A;  1E17 A;  1FYM A;  3Q9V A;  1TBX A;  2ZKZ A;  4EGY A;  3PFI A;  2E7X A;  3AG1 H;  3H35 A;  2M1B A;  3RI4 A;  4I0A A;  4PDK A;  1KYW A;  3H0D A;  3I55 I;  4NC6 A;  3OS2 A;  2XDV A;  5CYV A;  4CCN A;  1YI2 I;  4ZYA A;  2Q0O A;  4XSZ F;  2E1M C;  2YX4 A;  4M3G A;  4KA4 A;  4G6Q A;  4AUX A;  3K10 A;  3S16 J;  2XRO A;  2BGC A;  4I0B A;  2V1D A;  1XTA A;  2K9N A;  3GEZ A;  1AKH A;  2L9S A;  1NG6 A;  3FXK A;  3WTT C;  2JJ7 A;  3S3M A;  3GLX A;  1OMI A;  4BXF A;  4BBS J;  1TLH B;  3BG3 A;  5M5Y J;  3IHU A;  3OYL A;  3H1C A;  4LG3 A;  1R49 A;  2HPM A;  3O2P E;  1AOY A;  5HS8 A;  3PIO F;  1JGG A;  1J2X A;  4F7Z A;  1QRY A;  3BR3 A;  5KHD A;  3TOB A;  3JTG A;  2DDB A;  4UHT A;  2R7U A;  3AG4 H;  2L7Z A;  3K2Z A;  3D1N I;  2R93 J;  1V3F A;  1OYY A;  3OL3 A;  1L3L A;  3TW6 A;  3TO7 A;  3SZP A;  4BDZ A;  2XGX A;  4UB6 C;  1S9H A;  2MC4 A;  5E8I A;  2JA2 A;  1D1C A;  4XL9 A;  3K9T A;  3H5R A;  1X1D A;  1MNE A;  3GZ5 A;  4HAM A;  1X1P A;  2M2E A;  1T0F A;  1X3U A;  2L0K A;  3DKW A;  3IH4 A;  1YLF A;  1MIJ A;  5F27 A;  2JQ7 A;  2R5Y B;  2VQH A;  2YR2 A;  4ZZL A;  1T38 A;  2XGE A;  1P7I A;  2GA1 A;  2FD5 A;  1QO0 D;  2Q2E B;  3TW7 A;  4LIT A;  1FX7 A;  1I39 A;  3JCU C;  5B1B H;  3K4L A;  1O4X A;  3F8C A;  1D8J A;  1LJ9 A;  4XN3 A;  3GXO A;  3I53 A;  5LEK A;  2Z5U A;  1BBY A;  3W2V A;  3BPV A;  2KLO A;  4H0E A;  1U8B A;  1Y0N A;  2KPM A;  3HC7 A;  1FIA A;  2NVY J;  3M8F A;  2B63 J;  2DU9 A;  4M74 A;  1QVT A;  4MO7 A;  2E19 A;  3KEY A;  2F4O B;  3KFW X;  2DPU A;  2O61 A;  1ZYR F;  3A0B C;  2IGM A;  3PNY A;  4I6Z A;  5FLV A;  1QBJ A;  1DGR M;  2LDU A;  3E97 A;  3CCU I;  3ZN1 A;  2HTS A;  3RPU A;  1MDM B;  2YU9 J;  1ZR2 A;  2BY2 A;  1E3P A;  1IN7 A;  2OF7 A;  3J7A Y;  2B7E A;  2R7Q A;  4Q47 A;  5IOZ A;  4Q4Z F;  5K5R A;  2QEX I;  4RGR A;  4CH7 A;  2ME0 A;  5EEH A;  1LE8 B;  1T0F C;  3SEZ A;  5IT9 K;  5GPC A;  4N0B A;  1R71 A;  4HA8 A;  4M9X A;  2PFB A;  4HEA 2;  5FRN A;  3VSK A;  2QQ8 A;  5E8G A;  4IHT A;  1QNT A;  1T6S A;  2DT6 A;  1F4K A;  3K6G A;  1F9N A;  1RR8 C;  1K78 B;  2R4G A;  2TCT A;  3TP3 A;  2X6O A;  1FZP B;  2M3A A;  4BQQ A;  3RKQ A;  3LL7 A;  5FKL A;  4LG0 B;  4I99 C;  2NYX A;  1WSU A;  2W7N A;  3FXJ A;  2GWR A;  4ZYD A;  3UKG A;  2CYY A;  2BXZ A;  3GTO J;  2R5Z A;  2NXN B;  4DJA A;  5LEJ A;  2P7C B;  2FOK A;  1YIJ I;  5LD2 C;  2IP2 A;  4IO9 F;  4I2O A;  5F0F A;  1SEU A;  1H8A C;  2QGU A;  2RRE A;  4IHX A;  4BAY A;  3KZZ A;  1B72 A;  3DEE A;  1Y8R B;  2MA3 A;  4ZTJ A;  1WI3 A;  3FKJ A;  3LA2 A;  3MWM A;  1FBU A;  1N25 A;  3H0G J;  5D8K B;  2GAU A;  2O8X A;  2X1C A;  3G6E I;  1LB2 A;  1RUO A;  3ABT A;  3CCS I;  1HW1 A;  1RPW A;  4OOI A;  2M9H A;  2DN0 A;  4WWC A;  2O9L A;  2CW0 F;  5DTD A;  4CDG A;  2HQ5 A;  4NUB A;  1UHM A;  4A3J J;  3GTJ J;  1A36 A;  2XPV A;  2YPR A;  5K5O A;  3JTH A;  2MW8 A;  5C4J J;  3WTS C;  2HDC A;  3ZQG A;  3GBG A;  3KYL A;  3WOD F;  1N75 A;  2D1V A;  5IOY A;  1ZK8 A;  2Z99 A;  3AL0 C;  3BOQ A;  3F6V A;  5J47 A;  3S2D J;  2W1O A;  3OIQ A;  3GX4 X;  3HYI A;  2EZK A;  5KVR A;  5B3S H;  5IY5 H;  2AXL A;  3SFI A;  2NS7 A;  2BHZ A;  2QF7 A;  1WJB A;  1PUF B;  1D1B A;  5E18 F;  2L54 A;  2KIM A;  5M3M J;  1VQ7 I;  1D5Y A;  2DOE A;  2O7O A;  2GBY A;  3MZH A;  2ELK A;  1BR2 A;  1Z77 A;  3P7N A;  3FZV A;  1XCV A;  1JTX A;  1WJD A;  2OJE D;  5ILV A;  2XUB A;  3ESW B;  4HQM A;  3SYT A;  2EIL H;  3B73 A;  3BG6 A;  5E3O A;  5ILS A;  1X2N A;  2E1O A;  3HSE A;  4LFU A;  4BXU A;  3IC7 A;  2IS1 A;  3K7A J;  4MTD A;  2EIM H;  1ZN2 A;  3QQA A;  2ZME C;  3I71 A;  2RN7 A;  2A07 F;  1U9N A;  4YIR X;  1V54 H;  3HXL A;  5M5X J;  3K70 C;  2K4J A;  4MQ9 F;  1E2X A;  3CC7 I;  1FWZ A;  4ZYG A;  3VFZ A;  2CW8 A;  4K2E A;  3HM5 A;  5M5W J;  3BCB A;  2V1X A;  3PFY A;  4AVP A;  2L02 A;  4L9J A;  2LLK A;  2HGC A;  2IPQ X;  1WJ5 A;  3HGY A;  2BVL A;  4IOA F;  2OC6 A;  2D45 A;  2L7M P;  3H36 A;  2LRD A;  5HLT A;  1XPX A;  3QYF A;  3R4K A;  3DTI A;  1RNL A;  1U78 A;  4WXD A;  3NRV A;  5GAG J;  1UG0 A;  3CMA I;  1G4D A;  1TWH J;  4S04 A;  4QWQ A;  4HX4 A;  2XV4 S;  4Q48 A;  2VE8 A;  1K6O A;  2HPI A;  2X1E A;  4C2U A;  3MKL A;  4P55 A;  2XF6 A;  1F1Z A;  4CCJ A;  2JA7 J;  3H3U A;  2KFD A;  1TNS A;  1QHH D;  1ZG5 A;  4PFP A;  4D5C A;  4XID A;  5DCM A;  1YW9 A;  2EJR A;  3RTR A;  4HG2 A;  2MLK A;  2ZNZ A;  2NOJ B;  1LKX A;  1FIP A;  1XGO A;  5LRS A;  1W0U A;  4C2M J;  4O6J A;  4EJW A;  2CQQ A;  5CKT A;  2CH0 A;  2GLO A;  3PSI A;  5HLG A;  1N77 A;  4ON0 A;  3GTK J;  3WG7 H;  1R36 A;  2JUC A;  4D1Q A;  1LPQ A;  3BJA A;  5J8F A;  2IJL A;  2DT7 B;  4GFB A;  1V55 H;  1IUF A;  4U7B A;  1XSV A;  2EA4 A;  1R5H A;  1I1S A;  3QPL A;  1P4W A;  1ZGW A;  3S14 J;  5IP7 J;  5J40 A;  3H92 A;  4MEX F;  4BBR J;  1FSH A;  4M3D A;  4FCY A;  1O3R A;  1ON1 A;  1I5Z A;  2VOP A;  4D7M A;  3JRF A;  3S3N A;  3A4C A;  1OQY A;  5BNG A;  3DXJ F;  2HR3 A;  4B48 A;  4LIU A;  4BYY A;  1Z21 A;  2P5V A;  2ACJ A;  2VN2 A;  4A12 A;  2VJJ A;  5J8C A;  3KEQ A;  1L0O C;  4PJJ A;  1R1V A;  3RZO J;  4WX9 A;  4W1U A;  3SQN A;  3OSG A;  4AIH A;  4QTR A;  1NK2 P;  3K4M A;  1F5T A;  3W3C A;  2VE9 A;  5J1R A;  1YG2 A;  3HRS A;  3JR9 A;  1IGN A;  4QPO A;  1WH5 A;  2E5Z A;  2Q2E A;  3RYR A;  4BNC A;  2MG4 A;  3LSM A;  2LSO A;  1MBJ A;  1UST A;  4RB1 A;  3U9G A;  1S8N A;  2V79 A;  2DA6 A;  3HOZ J;  1P4A A;  1W5C C;  1XMX A;  2YS9 A;  3JAM K;  1J9I A;  2EFW A;  2GQQ A;  5BS6 A;  1X1C A;  3CC4 I;  2Y75 A;  2DO7 A;  2NVX J;  2QEN A;  2K85 A;  3VYS B;  1Z0X A;  3FXM A;  1U8R A;  3OS1 A;  1Z6T A;  5J4Y A;  1YHQ I;  3BG5 A;  3M4O J;  2OQG A;  3G1L A;  1YFH A;  5D5U B;  2BW3 A;  2JTV A;  3TDU C;  2XAF A;  1T2K A;  2DMU A;  1I50 J;  1IUY A;  4JBA A;  4AYB A;  4O5V A;  2CG4 A;  3JRD A;  3OY9 A;  5D4R A;  4RAZ A;  1FBS A;  1TT5 B;  3FIW A;  4A5N A;  4BQN A;  1YRN A;  3DU6 A;  2QA4 I;  4FET A;  1IXC A;  1UHS A;  1ULY A;  4L0Z B;  1YE9 A;  3DBH B;  1AKH B;  2FUG 2;  2V26 A;  4PJL A;  4E7J A;  1O7L A;  2AS5 F;  4RLF A;  2VAS A;  2XSD C;  4DNC A;  4F3Q A;  1ZLJ A;  5AON A;  4A3D J;  3AG3 H;  2RGV A;  1GDT A;  1T56 A;  4BAC A;  2L2O A;  1I3Q J;  2LY2 A;  1ZRF A;  2H6C A;  2A3S A;  2A6E F;  2XPW A;  1MJ9 A;  4BY7 J;  1UFM A;  4P9F A;  3GFM A;  3EUH A;  4RGX A;  1ZGJ A;  4ABZ A;  2CWE A;  3IRR A;  4BHP A;  2V1N A;  3E6B A;  3MKZ A;  2E1N A;  2W84 A;  1T8I A;  1IW7 F;  1H9G A;  5CVI A;  1TW3 A;  1KON A;  4CCK A;  3SJM A;  3CDL A;  3R0A A;  5DCF A;  4DW6 A;  5F1J A;  2I5U A;  5LGU A;  1G2H A;  3HRU A;  1ONV A;  2QZ8 A;  1K6Y A;  3F23 A;  1KQ0 A;  4PJ0 C;  4EEF G;  2XAG A;  2GOX B;  2NNY A;  2KKO A;  1HDP A;  2QQA A;  2MD5 A;  3G71 I;  2K27 A;  2OA4 A;  5ED4 A;  2ICW G;  1EKE A;  3BP8 A;  3OYG A;  1C0W A;  2W00 A;  4QSH A;  4EM2 A;  3MFK A;  1D0Y A;  3ZPL A;  4N4N B;  4DYQ A;  2NOG A;  1G3W A;  4HV5 A;  2KQR A;  3LST A;  4EM1 A;  5BPD A;  1X3Z B;  3WTW C;  2CQ7 A;  2XB0 X;  4A0Z A;  4EM0 B;  2WWY A;  2EA2 A;  2DTR A;  2L4A A;  4TV7 A;  1K79 A;  1KU3 A;  2ZJR F;  3A1Y A;  1MSE C;  1XC5 A;  2ZXJ A;  5IPA A;  3B02 A;  2YU3 A;  5BOX A;  3BTL A;  3ISP A;  1WQ2 A;  1IG7 A;  2AXT C;  3K4C A;  1XMA A;  3FMQ A;  4YEL A;  3SXY A;  3ZRG A;  3ZOB A;  4HNV A;  4A3K J;  1ZG1 A;  1UG2 A;  1UAA A;  2IEK A;  3O8G A;  1YQA A;  4UUS A;  3FX3 A;  2QUF A;  2K9M A;  3REO A;  1T95 A;  1IJW C;  3C1D A;  3L00 A;  4G6T B;  2EPF A;  2CV0 A;  1FOX A;  2M4G A;  2JK3 A;  2V4J C;  3CCR I;  1GV5 A;  1R22 A;  4IRH A;  4ZYH A;  5C3E J;  3LAP A;  3PO2 J;  2Z1D A;  2CFX A;  3HOX J;  5DD4 A;  4XKW A;  3VOD A;  1X19 A;  3IL2 A;  5KCM A;  1GV2 A;  4ITV A;  3E0J B;  4M3E A;  2IBD A;  5JR3 A;  3CC2 I;  1A04 A;  3EDP A;  4BH9 A;  2B9S A;  2EBI A;  1R7J A;  1R1U A;  4L0Y B;  2GOM A;  6PAX A;  3DP7 A;  4U0V A;  5HDK A;  2QBY B;  4IRG A;  2QVO A;  2KL4 A;  1G59 A;  4BEH A;  3J81 Z;  3C3W A;  3FK7 A;  3GCM A;  2R5Z B;  1S3J A;  3BR5 A;  2O3F A;  1WJE A;  3QPS A;  2KRH A;  4F93 B;  2DAO A;  4NQW A;  3PUB A;  5JLX A;  1CQT A;  3N05 A;  1K61 A;  4A3M J;  3MMY B;  4UB8 C;  5E1Z B;  1R4N B;  3IKT A;  2Y31 A;  1IC8 A;  2OPT A;  2IW5 A;  1OCC H;  2VBX A;  2WAQ N;  3CDI A;  3HBL A;  1JT0 A;  1D3Y A;  3G1M A;  4AWX B;  1ERD A;  2LC2 A;  3MZY A;  4F92 B;  3BC8 A;  5FFX A;  2BV6 A;  1GVJ A;  3KYD B;  4QIW N;  1QU3 A;  3F8B A;  3D5L A;  1WKM A;  2LKS A;  2EQR A;  1MH3 A;  3E1S A;  4ENN A;  2VPL A;  2ELH A;  5E1X A;  2FA5 A;  2YSR A;  4EVI A;  1MD0 A;  4U7D A;  3RJP A;  4IKF A;  3RKW A;  4B47 A;  2Z33 A;  1O7F A;  1DDN A;  4BJ6 C;  3WGI A;  2HEO A;  2H6B A;  1ETK A;  4N4O B;  3ZGK A;  1LFB A;  4E7L A;  2VKH A;  2E2I J;  1XG1 A;  4GRI A;  4KIF A;  5JHF A;  2KZG A;  3D5R C;  1D1A A;  1S7E A;  3VWB A;  2A61 A;  2Y0M A;  1MBE A;  2CJJ A;  3E3V A;  5EJC A;  1TTY A;  4RB2 C;  2K9L A;  5E20 A;  3TKY A;  1WFX A;  1CGP A;  2HXI A;  3GLL A;  5CVV A;  3GTQ J;  1U5T B;  4LLL A;  2KRC A;  1OYI A;  4YG2 F;  5A2Q Z;  1OPC A;  2HZT A;  2H1K A;  4G7O F;  2QQ9 A;  4GYG A;  2D2W A;  2V9P A;  2QYO A;  1X58 A;  2LD5 A;  5J3L A;  2MFZ A;  2P4W A;  3HEF A;  4XQF A;  2E34 A;  3DQV C;  4XR6 A;  3LNQ A;  4HLY A;  1HW2 A;  4EJU A;  3ZQC A;  2AQE A;  2XVC A;  3BTI A;  5C4X J;  5EYR A;  3GUD A;  2ZJQ F;  3HOY J;  3ZCO A;  2L7F P;  2DYR H;  1USS A;  3B6A A;  2KIS A;  2E36 A;  1B9N A;  5B66 C;  2EWN A;  4WK8 F;  1APL C;  3CCL I;  3CLQ A;  2STT A;  2E2J J;  1OCO H;  3RPQ A;  3CD6 I;  4IVN A;  4Y13 A;  1P7J A;  4L9N A;  2HVR A;  4P1W A;  4XLP F;  1S5L C;  2Q8K A;  5EDN A;  2WAQ A;  3H9Q A;  5BQT A;  2DMN A;  1W4M A;  3CUQ A;  3C18 A;  2DI3 A;  2M7A A;  3O3K A;  2X85 A;  4D9J A;  2E71 A;  5TGT A;  4A6D A;  4ESF A;  1YJ9 I;  3FIS A;  3EQL F;  4N9H A;  3FHN A;  3SZT A;  3VOE A;  4KFC A;  4IHY A;  2NAZ A;  2DYS H;  3H9J A;  2DQL A;  2FQ4 A;  4LIV A;  3Q9S A;  2I8D A;  4L5J A;  1VQ4 I;  2H94 A;  2R7R A;  1VQ5 I;  1KU9 A;  4OWR B;  5DCM B;  2EFO A;  4A0X A;  3VPR A;  2YUS A;  4AIJ A;  2IVM A;  1SD4 A;  4XOR A;  2IA2 A;  3ZQL A;  1YJN I;  5L3C A;  3GTG J;  4Y15 A;  5E17 F;  1E0E A;  3CF5 F;  3F0C A;  3V7C A;  1IV8 A;  2EV5 A;  1HKS A;  2K3P A;  2K4B A;  1BL0 A;  1S7O A;  3BR6 A;  3OYI A;  3Q5F A;  2ZJ2 A;  2M8E A;  4LK1 F;  5CVR A;  4XIC A;  1I3A A;  1FT9 A;  2CW7 A;  3CO6 C;  3GO5 A;  1OKR A;  1ITY A;  1YW8 A;  2XF5 A;  1IAW A;  4LK0 F;  2CU7 A;  1D8K A;  1SFO J;  1FOK A;  4FX4 A;  2PBI A;  3NAU A;  3T8R A;  3P9I A;  4XSX F;  4MFE A;  4BL0 B;  1V5F A;  1TP4 A;  4HLX A;  4A3B J;  3WU2 C;  3S1N J;  3HOT A;  5EF6 A;  5IP6 A;  1BC7 C;  3KLO A;  2LNB A;  5D6E A;  2PMZ N;  3HRT A;  5JI6 A;  2LK2 A;  2W85 A;  4DGW B;  5TJJ A;  4FE4 A;  1XS9 A;  1A5J A;  1JJ8 C;  1BOA A;  1LUJ B;  3C2G A;  4JX6 A;  2XHK A;  2O8K A;  3WHB A;  5DV5 A;  5D5W B;  5D6F A;  2WC2 A;  1VQO I;  1U2W A;  5FKN A;  2W82 A;  2E2H J;  1ZHF A;  3HTU A;  2GXG A;  5HS9 A;  1BIA A;  2K86 A;  5GAH J;  4EV0 A;  1LFU P;  3RKY A;  1R58 A;  4JQF A;  1HXD A;  2ADU A;  1YOV B;  1Z6R A;  2AO9 A;  2JN6 A;  3OOU A;  2QM3 A;  3SDG A;  1J09 A;  1Z7L A;  3T5X A;  3OYE A;  4F91 B;  3U1D A;  3COA C;  4Y3O A;  2DOF A;  2BEO A;  3I56 I;  3PO3 J;  4V2F A;  3FWE A;  5ERI A;  4UV9 A;  2M34 A;  4OMY A;  4DIQ A;  3BTC A;  1FJL A;  2V7F A;  3ZQI A;  4HDV A;  4GGG A;  3KZI C;  4RDU A;  1CF7 A;  2IS4 A;  2BW3 B;  3ASO H;  1WJF A;  1D5V A;  2XC7 A;  4RB0 A;  2XAQ A;  4ENJ A;  1VF9 A;  2R7Z J;  4BU2 A;  1UB9 A;  1QHG A;  2LF8 A;  4ZDP A;  1MMN A;  2GA2 A;  3VB2 A;  4O3M A;  3CF2 A;  1VFC A;  1FMV A;  5GTH C;  5GAD J;  2QSF X;  1G3S A;  1RES A;  4JYK A;  4CIC A;  1YRN B;  2HQN A;  5E3L A;  1VQK I;  3L7W A;  4QLC U;  3BY6 A;  2DK8 A;  2PG4 A;  2ZXI A;  4J01 A;  4U88 A;  3BTJ A;  2CQX A;  1A31 A;  4KYW A;  5FRM A;  1YO5 C;  1MJB A;  2FNA A;  2L9N A;  2F5D A;  3BJO A;  1NK3 P;  1YTY A;  2M5W A;  1W7P A;  1TWA J;  1SD6 A;  4HYE A;  2QBY A;  2VJ4 A;  2GM4 A;  2KIU A;  4I09 A;  4WXH A;  2DBB A;  3CME I;  1WHU A;  5IYB J;  1Y1V J;  1RUN A;  4OIO F;  3HHG A;  2CQN A;  3TOA A;  4PCQ A;  2PMZ A;  1GHC A;  2XGC A;  1XB4 A;  3L09 A;  4IHS A;  2KIQ A;  2WAD A;  3HB9 A;  3N4M A;  2DA4 A;  2HOT A;  3J7A O;  1QPM A;  2MAB A;  3A2K A;  3CCJ I;  2XRN A;  5DM7 F;  5FKO A;  3F8F A;  1ZGA A;  3P9K A;  2JA8 J;  2PI0 A;  5F04 A;  2HQA A;  3BR0 A;  1QVU A;  3S15 J;  1K83 J;  3K1N A;  4QPQ A;  2FRH A;  4A2U A;  4BGD A;  1Z05 A;  3LSH A;  2FJ1 A;  4W97 A;  4YFX F;  4A3E J;  3I59 A;  1LVA A;  2F6C A;  3CLO A;  1UJ8 A;  5M3F J;  5LHH A;  2Y9Z A;  2M87 A;  5H6Q A;  3TO6 A;  3L1P A;  2UV1 A;  2E7W A;  4AVZ A;  2OAZ A;  1W5T A;  3ABU A;  1TL8 A;  3BR1 A;  2J5P A;  3LFK A;  2R7F A;  3DFG A;  2P5K A;  3CJQ B;  2RC4 A;  4YFN F;  2ZFW A;  3TMO A;  3LOC A;  5F0C A;  4B8X A;  1JT6 A;  4H4K C;  4E7S A;  5LHG A;  1B8I B;  4FE7 A;  3GZ6 A;  3M7G A;  1VQ9 I;  3Q3S A;  4L9V A;  3CP8 A;  3CCE I;  4UUS B;  5CVU A;  1U5T A;  1HST A;  1ON2 A;  2QSH X;  1QPI A;  2IT0 A;  2DFF A;  5E79 C;  2CQK A;  5FKM A;  1FSE A;  1MBH A;  2LR8 A;  5H20 A;  3FMS A;  2DOA A;  5E1W A;  1KYZ A;  5CLS A;  4Y17 A;  3OYA A;  2ZO4 A;  2CGP A;  2UZK A;  3UR3 C;  4BHC A;  2VOD A;  1ZTR A;  2XSJ C;  3EYY A;  5ICG A;  4OAZ A;  2COM A;  3J81 K;  1JKO C;  4YIF A;  2D5V A;  3BR2 A;  3FF5 A;  3S17 J;  5AIP A;  1PYV A;  1R5I D;  3DKY A;  3LQR A;  4RAF A;  5FRO A;  4ZC3 A;  2IA1 A;  5KK1 A;  3MN2 A;  3A0H C;  5DEQ A;  5L3D A;  2VQG A;  5FD6 A;  2Y0S N;  2FF4 A;  2R7D A;  1U0J A;  2W57 A;  3ZMV A;  3Q0U A;  3F21 A;  4BEH B;  1TWG J;  1JUP A;  2VBZ A;  2KRF A;  2DMP A;  1WVR A;  3K0L A;  1X2M A;  4FHT A;  4UVA A;  3T0Y A;  1S7A A;  3V8L A;  4NQW B;  4BKX A;  2VI6 A;  2MH9 A;  1Y56 A;  4E7H A;  5K7F A;  2NNN A;  1POG A;  5DDG A;  1HC8 A;  1A35 A;  3BT9 A;  4RM2 A;  1JHF A;  4ENK A;  1Q1H A;  3CTA A;  3IWZ A;  1JE8 A;  2H1L A;  2DOD A;  1U5T C;  3FK6 A;  3H5N A;  4Y33 A;  4UVC A;  1WJA A;  1JKP C;  1BJA A;  2X0L A;  1SFU A;  1ZEL A;  2VXD A;  3RIR A;  1IRF A;  5GAE J;  5JVG F;  1BC8 C;  4WCG A;  1BI1 A;  5IYD J;  1R6R A;  2ID3 A;  3FXO A;  3BQY A;  3LWF A;  3S8P A;  4UUV A;  2LTP A;  3X2Q H;  3IH2 A;  3F3X A;  3V8K A;  1LDJ A;  3KET A;  5CPR B;  4Z2Y A;  5LRR A;  5A2Q K;  2UWM A;  3OSF A;  3MEX A;  2WB1 N;  1X3W B;  3Q0W A;  4HBL A;  4KIG A;  2IAI A;  1Y8Q B;  2KZV A;  5LLQ A;  3RYP A;  3L2W A;  5J1U A;  5GTI C;  1JHH A;  4XLC A;  2DCE A;  2NRA C;  1IO2 A;  2OCC H;  3QPT A;  4HZF A;  3OYH A;  5J6X A;  3ZQF A;  2DA5 A;  2OZ6 A;  3CCM I;  3F22 A;  1BI2 A;  3H5A A;  2OTJ I;  1W36 D;  3M9A A;  2R7T A;  2HKX A;  1Y0U A;  3HOV J;  3OYD A;  4B44 A;  1B1B A;  5JLW A;  3HDD A;  3DPU A;  3P9C A;  3MKY B;  5CJ9 A;  4MIM A;  3IWF A;  3PQK A;  3I4M J;  4E7I A;  3KPH A;  4UV8 A;  1W0T A;  4CCO A;  1TZL A;  3FKI J;  1Z67 A;  1WH7 A;  4C3I J;  1ORK A;  2HFH A;  4RGU A;  5FD5 A;  1I1G A;  5EG0 A;  3S1Q J;  1P4X A;  1SD5 A;  1ZKG A;  1OCP A;  2AHQ A;  4V2G A;  1OCT C;  3C7J A;  2K02 A;  1WJC A;  2IXS A;  3CCY A;  1YS7 A;  1BIB A;  2FEZ A;  2WA0 A;  4BUP A;  2Z9O A;  2QWW A;  2PLY A;  3ONQ A;  3QP6 A;  2FX0 A;  2VKE A;  3JRI A;  3LQQ A;  4G6D A;  3HZJ A;  4CCL A;  2VOO A;  3CUQ B;  3FXU A;  4ESB A;  4E7Z A;  5FLM J;  2BBY A;  5FFZ A;  1OLT A;  1BN5 A;  1ETW A;  1HKQ A;  2ESH A;  3GVA A;  3LMM A;  3J7Y J;  1SFK A;  2IGN A;  3EET A;  2ESN A;  2N8G A;  4YFK F;  3W6K B;  4A93 J;  2Y69 H;  1Z3X A;  4KIC A;  3BJ6 A;  4X0G A;  1OFC X;  4RA2 A;  1K4S A;  4IRI A;  2F5V A;  1DGW Y;  1KA8 A;  4NC8 A;  3GYH X;  3ASN H;  1FTZ A;  5JFR A;  1QA6 A;  3DEW A;  3CO7 C;  3ERE D;  4ZTF A;  4C3H J;  1Z1D A;  2E5N A;  1RKW A;  3OR2 C;  5EEG A;  4AC0 A;  4EMS A;  3CMY A;  1RRJ A;  2XKP A;  2R92 J;  4M3B A;  2EV6 A;  1MMS A;  4L5I A;  2LRE A;  2NS8 A;  4LLG F;  1W7P D;  3I0T A;  1XN7 A;  1NG7 A;  1T98 A;  1QZZ A;  1ZAR A;  2HOE A;  1R9T J;  3L2Q A;  2R0Q C;  4IOC F;  4IEJ A;  3FXL A;  3JSP A;  3DU5 A;  1FOW A;  3K4B A;  3TQN A;  4DQ2 A;  5ICC A;  3HOW J;  1OYW A;  1EA3 A;  4GXO A;  3GTL J;  3SEQ A;  2A68 F;  2R7W A;  1R5G A;  1R4M B;  3EYI A;  1DU0 A;  1WCM J;  1JXS A;  4XLH A;  2WBM A;  3HKZ N;  3RQ4 A;  4DBQ A;  4HDU A;  1IXR C;  3PNT A;  4ZZD A;  2GXB A;  1JGS A;  1M1E B;  5HNF A;  3CJT B;  3WGH A;  1R23 A;  2FE3 A;  4S0H B;  3HPH A;  4CHU A;  3ZMZ A;  1H88 C;  1WZ2 A;  2CRG A;  1F36 A;  1OCR H;  3A03 A;  5HDN A;  4KIT B;  1U3E M;  1FLI A;  4MFD A;  3JRG A;  3VDX A;  2JVH A;  4NDL A;  2DW4 A;  4NBQ A;  3FBN B;  2WV0 A;  2VJ5 A;  2ZJP F;  4A3F J;  3GFJ A;  3PIP F;  3HGG A;  4XRS G;  3WTU C;  2KDO A;  5KAI C;  3S1R J;  4EGZ A;  2BHY A;  2P7V B;  4UUT A;  4CSW A;  4HPQ A;  2GIZ A;  2X4H A;  2E1C A;  2CUZ A;  1RIO H;  1LNW A;  1U6G A;  4B1R A;  2DLL A;  2HI3 A;  4XLE A;  1B8I A;  2L5Q A;  2FBK A;  2XAJ A;  2K7L A;  3QRF F;  1V4R A;  4OU0 A;  3EUH C;  4GCV A;  4N9I A;  1CF7 B;  4KN7 X;  3KEO A;  1TQM A;  3NQO A;  3LSP A;  2F5C A;  5TIS C;  4XKC A;  1DQU A;  2V6C A;  3VYT B;  2C6Y A;  2R7V A;  4P5O A;  4OIQ F;  2MBF A;  2O03 A;  2R7O A;  3U21 A;  1AWC A;  5EZG A;  2VC1 A;  4XLA A;  4B3A A;  4DZJ A;  4D7N A;  4LB6 B;  5GP9 A;  1JJ6 C;  3PJR A;  2G9W A;  4DBR A;  4FT8 A;  3R6S A;  2L4M A;  1DU6 A;  2VON A;  2HXO A;  3NWS A;  2QKM B;  3RDI A;  3ZQ7 A;  3G1O A;  3RQI A;  1FOY A;  3W2A A;  2QCO A;  2FOW A;  3IH3 A;  1TWF J;  3GTM J;  3E6D A;  1J75 A;  3CZ6 A;  1YX3 A;  3C2H A;  3QOP A;  5L3B A;  4BY1 J;  2IS2 A;  1W7P B;  4G7Z F;  4M6X A;  1IDY A;  1Z7U A;  1XCB A;  1I27 A;  2D1H A;  1VQP I;  1I6H J;  3ULQ B;  5LHI A;  3DKX A;  3BPX A;  2LY9 A;  3WTZ A;  2YX7 A;  2EV0 A;  1TWC J;  1SC7 A;  4BJ5 C;  2MC3 A;  1WPK A;  5E3M A;  2ZFU A;  2A69 F;  4IQ4 A;  1RC9 A;  4CYD A;  2PMU A;  5HVQ C;  3AKZ A;  1IXS B;  4XK4 A;  3DTK A;  3OYM A;  4KNY A;  5KAF C;  3IAS 2;  3FM5 A;  1NHA A;  2X6X A;  2W24 A;  4HX7 A;  4IF4 A;  2PMH A;  4CZZ A;  4KDP A;  4DYR A;  4YII A;  1HDD C;  2MLG A;  4OIN F;  1AA7 A;  1VI0 A;  4BJT A;  2Y9Y A;  2KP6 A;  3MQ0 A;  1LEB A;  1GXP A;  3I59 B;  2FBI A;  2VUM J;  3QYB A;  4HSR A;  2LF7 A;  2X6Y A;  2CMP A;  3LSK A;  3VYU B;  1G3Y A;  3O8H A;  2DMT A;  2F5F A;  3ZN0 A;  1PUE E;  2PJR A;  3K1P A;  1MKM A;  4WXC A;  2BXY A;  3SHF A;  2ZCW A;  2F4I A;  1Z3Y A;  4PJN A;  1EH7 A;  2FU4 A;  3GWZ A;  3CMM A;  4ZDO A;  3IRQ A;  1W1W E;  4RAY A;  5H6R A;  4IQJ A;  3SDB A;  4BE2 A;  1ODD A;  4FQG A;  1V5E A;  2BVM A;  2KJC A;  1MND A;  2UUZ A;  3ABM H;  2DMQ A;  4XMY A;  3IAM 2;  1W5S A;  2JVG A;  2M30 A;  4JOM A;  1DPU A;  2ZB9 A;  1J0R A;  2DPD A;  1PP8 F;  1XSD A;  2X1D A;  3V7R A;  3K69 A;  2G0E A;  2LMD A;  4MHG A;  1DPR A;  2P81 A;  2VQC A;  3HRM A;  1KGS A;  3L2V A;  1HW5 A;  2L9V A;  1FYL A;  4E4H A;  4BDY A;  4I98 B;  2K9S A;  1SVO A;  2KDZ A;  1O3T A;  2G7H A;  1ETY A;  2LOO A;  3OV8 A;  4Z6Y A;  3TED A;  2DA7 A;  3CJR B;  1KQ8 A;  3ERM A;  3A01 A;  3OYJ A;  2BY0 A;  3SZG A;  3PSF A;  4U0Y A;  2VKV A;  2FMY A;  4Y52 J;  1OIS A;  2HOA A;  2P0W A;  4MLO A;  2FQ3 A;  2LH9 A;  3ZMS A;  4I01 A;  2LKX A;  2EIN H;  3ZMT A;  2ETH A;  4XKV A;  3CUO A;  1QZY A;  2DK5 A;  4MEY F;  4DOZ A;  2XAH A;  2L7K A;  2WAE A;  1WI9 A;  4HX8 A;  1RET A;  3TDZ C;  5B5E C;  2K5C A;  1EV7 A;  2KJB A;  2Y48 A;  1SFX A;  9ANT A;  1KQ9 A;  1VZ0 A;  3CES A;  2IGK A;  1ZRE A;  1QZE A;  4BQA A;  1PDN C;  4CXF A;  3OOP A;  4CZC A;  3I58 A;  2CUJ A;  1QQI A;  2GZW A;  2JWT A;  5FLX Z;  3RZD J;  4EJT A;  1IRG A;  3QYE A;  4OIP F;  2Q1Z B;  4P9U A;  1GXQ A;  2MYS A;  1OCZ H;  4V19 K;  2VT3 A;  4J00 A;  4BS9 A;  3BWG A;  1EH8 A;  2XAS A;  2M0M A;  2Y30 A;  3K1M A;  2XF7 A;  4M9Z A;  5KNL A;  3MKW B;  1IRZ A;  1YYV A;  2EZH A;  2JPB A;  2DT5 A;  2RAE A;  2XGD A;  2EFN A;  2ZSH B;  1YW7 A;  5FB2 A;  4KJZ A;  1V5G A;  2RV8 A;  3OWT A;  4L18 B;  3GTP J;  4CUG A;  5K7H A;  4ZH4 F;  1K4T A;  1VQ6 I;  2F5E A;  3KP5 A;  4P96 A;  5JVT A;  2ZSI B;  2H09 A;  3IV5 A;  1REP C;  1ETO A;  2MGQ A;  5EGO A;  3OYC A;  2H27 A;  1MSF C;  3HUG A;  4M9S A;  3LA7 A;  5HLI A;  5HLH A;  2ZXW H;  3HJE A;  3EPZ A;  3CUQ C;  4R8H A;  1SAU A;  2VJI A;  1MZB A;  2VXZ A;  1BR1 A; 
#chains in the Genus database with same CATH homology
 2DOE A;  2JUC A;  2K85 A;  2KZG A;  2DOF A;  2LKS A;  4FQG A;  2KIQ A;  2E71 A;  2KFD A;  2L9V A;  2B7E A;  2KIS A;  1UZC A;  2DOD A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...