2E71A

Solution structure of the second ff domain of human transcription factor ca150
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
GSSGSSGERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Solution structure of the second FF domain of human transcription factor CA150
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 17
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2e71A00
2DOEA 4FQGA 2L9VA 2E71A 2K85A 2KIQA 2B7EA 2LKSA 2KISA 2DOFA 2KZGA 2CQNA 2KFDA 1UZCA 2DODA 2JUCA
chains in the Genus database with same CATH superfamily
2PBIA 4LIUA 2K9SA 3LMMA 1QZEA 4CYCA 3I59B 1RR7A 4A2UA 2XV4S 4J19A 2IP2A 3BR3A 3MCZA 4P5OA 4XRSG 5JLXA 2KPMA 1KA8A 1V5EA 3EUAA 2RQQA 1Y0NA 1EKEA 1TW2A 4C3IJ 1EH7A 1WH5A 1XD7A 3SFZA 4OINF 1TTYA 2MG4A 5F0FA 3ML6A 1AA7A 2L4MA 4IQ4A 2CV2A 1F36A 1D1CA 1Z7LA 2XF7A 2Y2ZA 3KEQA 3GLLA 1UAAA 3K10A 5CQEA 2KRCA 3WU1B 2OD5A 3UR3C 3E5QA 4XLNF 4I7HA 4DGWB 1K6OA 1AHDP 3H1CA 5EZGA 5IYCJ 1IRFA 1JUPA 4CCJA 3HXLA 3KP6A 4A3EJ 1LNWA 2M30A 4S04A 3SDGA 2DMTA 2LBFB 3HKZN 4FCYA 3S93A 4RAFA 2P5KA 3FKIJ 2JTVA 4HV6A 2R7TA 4LLGF 2R3SA 3AKZA 2E36A 2VC1A 4EMSA 4WXDA 1A31A 3WGGA 1IF1A 3ASNH 1W5CC 4HRIA 2CUZA 3K70C 3GTLJ 2CW0F 2WAFA 4XL9A 1NHAA 3MZ8A 4KN4X 1NH3A 2DQRA 4RA2A 3VEPA 3PFIA 4EJOA 1R1UA 2CSOA 3UNGC 2EPFA 2JWTA 3V7SA 1FNNA 4Z6YA 1SAXA 1SMYF 2ZMEC 1N75A 3HOYJ 2KISA 3NARA 2A3SA 2QA4I 1T95A 2M8GX 4I09A 2HFHA 3H3ZA 5DTDA 4U7DA 1U6GA 3VB2A 1LEBA 1VTNC 4PSWA 3CZ6A 2Y9ZA 1DGRM 2E34A 1G8XA 3JTHA 3COAC 3RZOJ 3ERMA 4M3FA 4J01A 1OCTC 1JHHA 1R6RA 4U0VA 3A4CA 3AG2H 4IHXA 2DOAA 2IPQX 3IAM2 1KGSA 3ZOBA 1LEAA 3VYUB 1BIAA 2K86A 3GBGA 4IHYA 2L9RA 2LYCA 2M9HA 3ASOH 1S8NA 2XC7A 2ZXHA 3RKQA 1XDUA 4JX5A 1H9TA 2EINH 2LOOA 3ROUA 2QCOA 4HF2A 2FQ4A 1YX3A 5E17F 2XKPA 4GFBA 1B72B 1JI8A 1OCZH 2H27A 4QIWN 3HPHA 2QKLB 3ONQA 3WTWC 1W4MA 4CCLA 3JRCA 2IS1A 2PG4A 2WTEA 3KZYA 2R7UA 3BG7A 2M34A 3A02A 3GTQJ 1ZGJA 3WTZA 3J80Z 4MEXF 4BXXJ 4XM3A 1IDZA 1BBYA 3HZJA 3S8PA 2BHYA 3E97A 3ZMTA 2XUBA 4M3EA 1T08B 5LHHA 5H6QA 2DOFA 5HVQC 2W25A 2CH0A 1XSDA 2VQCA 3S17J 1S7AA 1SD6A 3CP2A 3OL4A 4DQ2A 1WFXA 1OCRH 2HI3A 1BI0A 1OQYA 2ACJA 1TNSA 1TBXA 3QYBA 1L3LA 2VN2A 3C1DA 4M73A 5CYVA 2NS7A 1G2HA 1O7FA 4XLEA 2BXYA 5LGNA 2E19A 3J7AY 1DPUA 1Z3XA 3IWFA 5F6FA 1MBFA 2CJJA 1U0JA 4HX7A 2K5CA 4AIDA 1MBGA 5D5XB 3KIOA 1XGSA 4BJ5C 3T1BA 4PJNA 3HOUJ 3F23A 2EA2A 1ZARA 2P5VA 4HPQA 2Y0SN 4UHTA 1JUSA 3CCMI 2HQ5A 3I64A 1NG7A 4YFXF 1P92A 4MEYF 5DCFA 4G6QA 1FP2A 5HLIA 4E7KA 4BE2A 4D0PA 5DEQA 4GCVA 1AOYA 5ICGA 2VXZA 4HOBA 1ZQ3P 1QZZA 3E5XA 4OIQF 2KJCA 1ULYA 1FSHA 2CQQA 4MGRA 1YRNB 3EDPA 1X4PA 2P5LC 1BI2A 2BEOA 3MD2A 1GV5A 1E2XA 1X2NA 1JTXA 3PUFA 3TW6A 4NQWA 4RM2A 3OYEA 5J6XA 1Y0UA 2H8WA 3B6AA 1A04A 1EV7A 1JT0A 1S6LA 1UB9A 3TL4X 2ZXIA 4ABZA 3ABKH 1UCRA 1W7PA 3TOAA 3VYTB 1ZKGA 4C2TA 4CYCB 1U9NA 1REPC 4C3HJ 3SZGA 2W4SA 1T0FA 3CJNA 2ZO4A 4AIJA 1MBJA 1FWZA 3FWEA 3T8TA 5EGOA 3GFJA 2CUEA 5FFXA 3TO9A 2D1HA 2DT6A 2V6CA 3B02A 3FHNA 3L1PA 3QRFF 1LFBA 3EUKL 3H5AA 1LVAA 3S1RJ 2YSRA 1ETKA 2VI6A 3TDZC 3PUBA 4BYYA 4RAYA 1DP3A 2GWRA 1L0OC 5IYBJ 5L3DA 1V5GA 4X6AJ 2EIJH 2FF4A 3CO7C 1Z9CA 2DOEA 4A93J 4DYQA 3JRHA 3KPHA 2DAOA 2DU9A 1OCOH 4AIHA 2RN7A 4MO7A 2CFOA 5KVRA 1H9GA 2EK5A 3QOPA 2EFPA 1MSFC 4ZZLA 5M5XJ 3HGGA 1ON2A 5EEAA 1ZREA 2UXNA 1B8IA 4D5FA 1ON1A 3DEWA 2B63J 1QGPA 1DGWY 2BGCA 1T56A 2R7DA 1ZLKA 1XMAA 2V7FA 1E3OC 3A01B 4XRFA 3GFIA 1JHFA 2F5EA 2W84A 3DKYA 2VBZA 4WX9A 1BC7C 1LVKA 3FM5A 1R1TA 1S9HA 1BW5A 1R00A 3WU0A 4XRMA 4UUSA 1XMXA 3V7RA 3GO5A 3CMAI 1R7JA 2HOAA 4IOCF 1XTAA 2K9QA 5L3GA 1QNTA 2M7BA 3OIQA 1PDNC 2DA5A 2B0LA 4WWCA 4B3XA 4Q4ZF 3GZNB 2HVSA 4I2OA 1DQUA 2F4MB 2V1XA 2EFOA 2J5OA 4XLPF 1BA5A 4HF1A 4XNFA 2O8XA 4MIMA 3ZMDA 2OCEA 2FEZA 3K70D 3FXLA 2IGMA 3KYCB 3CESA 3CCQI 4KNYA 3EYYA 3JREA 5CVIA 1FX7A 5HOOA 2R7SA 2MABA 2DFEA 3EPZA 2JA5J 3FX3A 3KYDB 1J9IA 2A68F 5F1RA 2KT0A 3E1SA 3AL0B 2QM3A 2Z3YA 4XKCA 2O5RA 1R9TJ 4G7OF 4L9JA 3H9GA 3CMEI 1UHSA 2P0WA 3NQOA 3ABTA 5FKNA 2Z9OA 3OV8A 3IH3A 1YOVB 2XF6A 1B59A 3G1MA 2HU9A 3WODF 1VNDA 4WXCA 4U88A 1UZCA 1BI1A 2A6HF 3M07A 1T38A 4N4OB 5C4JJ 2LF7A 1XMKA 3U21A 5D4SA 1YITI 3L09A 1W5SA 2F5DA 2L7FP 2QEXI 2ZNYA 3HRSA 3WTYC 5ICFA 4AC0A 4ETSA 1N25A 4O5VA 5LGUA 1MNDA 1U9OA 2W48A 2OAZA 2R7WA 4WK8F 1VQOI 3HDDA 2DFHA 2WAQN 3K4NA 1PP7U 4G6TB 4M72A 3CDIA 1QVUA 1VI0A 4LK1F 1Z6TA 3QYFA 5FKOA 2DJNA 2PI0A 2JT1A 3QPSA 3H3UA 3WU2C 4ESJA 1DDNA 1V5FA 3FIWA 4EM1A 3S2DJ 2K9MA 1Z21A 2KZVA 4K2EA 4OAYA 3KEYA 1T0FC 4XICA 2CS3A 4S05A 4RLQA 3FM3A 2R92J 1R36A 4B8XA 5BNGA 5DDGA 2X6OA 4W1UA 4PGHA 3ERED 2XB0X 1FIPA 2PMZN 3DU6A 5M5WJ 4QPOA 1O57A 3CCVI 1HCRA 2BHZA 5HLGA 2OCCH 3M8EA 2QSHX 2KIFA 9ANTA 5C44J 3IUOA 3GWZA 1PUFA 1T98A 4CXFA 1LPQA 3HG9A 4BQOA 3OL3A 4NQWB 4M3BA 1H88C 2HGCA 2IGKA 2HQNA 2Y30A 2BBYA 1D5VA 2WY7Q 1SANA 2DDBA 2KJBA 2AXLA 2EV6A 3R60A 4KITB 2O8KA 3GLXA 2HYGD 3M8JA 1W7PB 5DM7F 2HDWA 1TLHB 4ZYGA 2IGNA 2LC2A 3ECOA 4LITA 3DV8A 4XMYA 3GTGJ 1R5ID 4DBQA 3ZRGA 3DKXA 2R7QA 3X2QH 1B1BA 1TQPA 2CO5A 4F92B 5EGOB 3LA2A 3PNVA 2IA0A 2K02A 2WY8Q 2KP6A 2H6CA 5TGTA 4KA4A 1KU7A 2VJIA 1JTYA 4UY8I 3SEZA 2Z5UA 4MQ9F 1W0UA 3W2WA 5C4XJ 2X85A 1O3TA 2RNJA 4X1EA 4O6JA 2O6GE 2CQXA 2IAIA 2NS8A 2HPMA 3BLYA 5DUIA 5CVJA 1FC3A 3CJRB 5ILUA 2YR2A 3OYCA 5D5UB 1ZR4A 1ETXA 4JX6A 5DYMA 3N97A 4BQAA 2DA1A 4G12A 5K7ZA 3PQJA 3RKWA 2KZGA 4BH9A 2L9NA 5EZHA 3VYSB 4CO8A 2ZC2A 5E1XA 4A69C 4XONA 1ZLJA 3V8LA 3HTSB 3CUQA 1B8IB 4L5EA 3KFWX 3CCYA 3JW4A 3OIPA 2E71A 2L2OA 3S14J 1MSEC 4V2FA 2LR8A 2DMPA 1FYLA 2NXNB 2GOMA 3HRUA 4BXUA 4ZYEA 1FOYA 2FJ1A 3KX2A 1VQ9I 2VASA 4IHSA 5GAHJ 2TDXA 1MGTA 2DFFA 2DYSH 4NBQA 4UUSB 1ZH5A 1MMSA 1V4RA 3PSIA 4YRVA 2R5ZA 2O61A 3ZQ7A 4XLCA 4FX4A 3F72A 1JJ6C 3BWGA 2ELKA 2VJ5A 1YFHA 3HOSA 3OYFA 5IOZA 3J7ZI 4XOTA 2ID3A 1J59A 2DXIA 2MA3A 4Y7NJ 1IXCA 2EQRA 1APLC 2OTLI 1IZ1A 4IOAF 1HKSA 1MNEA 2MGQA 4FT8A 3A2KA 2XGDA 1IV6A 3G73A 2R7RA 4XSZF 3DFGA 2HXOA 4AU7A 2W57A 2GLOA 2R7ZJ 3BR0A 4Q48A 4OIOF 4L0ZB 3H0DA 1AWCA 3G4SI 1TZLA 2OQGA 1MJAA 1XGOA 4BEHA 3LSKA 3H92A 3JCUC 4MTDA 2JRMA 4HEA2 1WGXA 1ZR2A 4O3MA 1YS7A 2OUMA 3K6GA 1E3HA 4HLXA 3IH2A 4RGSA 2M0MA 4XN3A 1Q1HA 1IUYA 2OF7A 2DFIA 3DWLE 2YU9J 3E6BA 4RS8A 4UB8C 1MJBA 2L7ZA 1Z3YA 2FBIA 2XF5A 2OQRA 1FBUA 5BPDA 3J7AO 1TT5B 5CLSA 1Y6IA 3ZN0A 4BACA 1BN5A 2CQKA 1B6AA 1QHGA 5TJJA 4QPQA 5L3EA 2MSYA 1D0XA 2KKOA 1D3YA 1ACIA 1F1ZA 1G3SA 4PFPA 4OOIA 1A6IA 1FSEA 1J09A 4HDUA 3Q0UA 3E7LA 4ITVA 4JK1X 1ZRFA 3O2PE 4PJ0C 3C7JA 3KP7A 1WJCA 2OJED 3GTMJ 3G3ZA 3HSRA 1GHCA 2VPRA 2XB5A 5LEKA 4RDUA 2KRFA 2BY2A 2DPDA 4BL0B 3RYRA 1IW7F 5FO5A 3RQ4A 4UNOA 3BTCA 1QPMA 5FFZA 4D7MA 4ZDLA 2NOGA 3FKJA 3FXQA 3LSPA 2MD0A 4UV9A 1STZA 4EJVA 1XCVA 1LB2A 2XSDC 4Y13A 4KISA 1PUFB 4EJWA 1ZK8A 3BQZA 1RNLA 3R61A 4IRIA 3OYDA 4A5NA 4XLFA 2IA2A 1MMGA 4GO1A 3F8NA 3Q9VA 3RIRA 5GAGJ 2EFWA 2V79A 2LNBA 2TCTA 3DPTA 1W7PD 5B3SH 3J80K 4RGRA 3IRQA 2CYYA 2NVYJ 1YLFA 2F5CA 2GA2A 5IP9J 2X51A 3FDYA 5M3MJ 2ME6A 3VSKA 4YEJA 2EIMH 4IZZA 1SAUA 5FROA 3CUQC 2PX9A 4B09A 3PL8A 3JR9A 3MVPA 4PDKA 1K6YA 1SVMA 3FXJA 3VDXA 3SJMA 1VFCA 4D5CA 3KZZA 4U87A 4KICA 3U2RA 2VBYA 4GDFA 1J7KA 2DTZA 3FF5A 4BDYA 5HDGA 1LDJA 3L2WA 1F9NA 4ESFA 5LGTA 2X1EA 2RDPA 3QWLA 2LF8A 4BQNA 4IQJA 2KIQA 3SQNA 3ABUA 2ZSHB 4M3GA 4XIDA 1A36A 2ICWG 2ZJ2A 3A03A 4BJTA 2L02A 1T8IA 4XLAA 1K4SA 1GV2A 3IAS2 2RREA 4P96A 2E1MB 2EJRA 3QP5A 1G4DA 2UXXA 4KIFA 1R4MB 2FMLA 2AQFA 4A0ZA 2LKXA 2Z2SB 4UUTA 1DUXC 3CUQB 3IP4B 4G6DA 2I10A 3TW7A 3IL2A 3F9KA 3NAUA 3H5NA 4A3BJ 2XPUA 4UVBA 5ILVA 4EGYA 3TKYA 4HZFA 4XKBA 2E1CA 2DQLA 4YG2F 2M5WA 2WBMA 4RAZA 1HF0A 1HC8A 2PMUA 4CYDA 2EWNA 4AYBA 2VPLA 1OKRA 2WWYA 4IL6C 4YIRX 2R5ZB 2E1OA 1TWAJ 4ZDOA 1TWGJ 2ZCWA 4A6DA 2V1DA 3A0HC 5LRRA 3QPHA 4FE7A 3AG1H 2L0KA 2I8DA 1ITYA 1P4AA 1WQ2A 2JUCA 2KIUA 1YHQI 4HNUA 5CKTA 3FXKA 1OFCX 2G7HA 4CCMA 1G3WA 2KFDA 2Q8KA 5IOYA 4XR6A 2GQQA 2AQEA 2YPRA 3U9GA 4HA8A 3BROA 1ZG5A 2VOPA 2NRAC 1X3UA 4RBOA 2FD5A 2NNNA 1FP1D 2QF7A 4BEHB 1O4XA 5D5VB 2NOJB 2V26A 3LSGA 3L00A 4A5MA 3R6SA 1SVOA 2F5VA 5J8CA 3JSPA 1QQIA 3GYHX 2M87A 4Y52J 3BJOA 4CDGA 2BVMA 4CCKA 2R93J 2IEKA 4MTEA 4LLLA 3DEUA 2ZMEB 2DA6A 3W6KB 3Q0WA 4ZC3A 2HZTA 3S32A 1U8BA 4IEJA 4FX0A 3F8CA 2VONA 4W97A 2FXAA 2FUG2 3K4LA 1WJAA 4I01A 5E8IA 1FBSA 4ON0A 1P7JA 2A5YB 2HR3A 3CCUI 1YJNI 1IN4A 2IBDA 3BTLA 3G1LA 2IS2A 2Y48A 3S16J 3TOBA 2JQ7A 2BVLA 4HDVA 2K3FA 3OYGA 1FYMA 5FLXZ 2YX7A 3I54A 5HNFA 4KIBA 1LKXA 4EEFG 2OBPA 2IS4A 5J1RA 3HUGA 1BJAA 4JX4A 4A3CJ 4CGZA 1MH4A 1IJWC 1QHHD 3G2BA 3SXYA 3LNQA 2ZJQF 5FGMA 4Y4RA 2CFXA 1I3QJ 4LOCA 3HOXJ 4ASNA 1F4KA 1FBQA 3FXMA 4HF0A 2E2JJ 1HLVA 3ESWB 3HOZJ 3R0AA 4OMYA 3Q3SA 2VE8A 3W6VA 1HQCA 3L7WA 4LLNA 2FOWA 4M3DA 4M74A 4EJUA 1HOMA 1DU0A 3KP3A 3QQAA 1USSA 4P1WA 5J4YA 2D45A 1W36C 2BV6A 4BAYA 4V19K 4XSXF 1K7AA 2M2EA 1BW6A 2XSJC 1IN8A 3Q0VA 3KLOA 2DA3A 1ZELA 2R7XA 2XIGA 1QZYA 2DCEA 2JA2A 2IS6A 3NWSA 5K7FA 5F0HA 2NVTJ 3J81K 4Q47A 3OIOA 2XKOA 4R1HA 2VOOA 3I71A 3VPRA 2DO7A 3W3CA 2XAQA 1X1DA 3DBHB 3OWTA 4BKXA 5ED4A 1VQ4I 2EZHA 3CJTB 4IHWA 2R5YA 1ZAOA 3WGIA 2HVQA 2GOXB 2Y69H 4DYRA 3I55I 1GXPA 5E18F 1UJ8A 3HC7A 4BJ6C 4DOZA 1YO5C 2KIMA 3LQRA 2W1OA 4IHVA 4YIIA 4OIPF 4DYCA 1JKPC 4M71A 4C2MJ 1T2KA 3SZTA 1S72I 5DD4A 5LHIA 1ZRCA 4IVNA 2QENA 2DW4A 4MLOA 2BE5F 2F48A 1KONA 3FXOA 4BBRJ 3DP7A 1GXQA 3IKTA 3LL7A 3WTXC 3QAHA 1QRYA 3PFYA 4P55A 5B66C 1OLTA 2WA0A 3M7GA 1FOWA 2LKSA 3F0CA 1H0MA 3LSJA 2DDAA 2RAEA 2YX4A 3OR2C 4ZYAA 2AO9A 2FOKA 2Q2EA 2LD5A 4QSHA 2JZYA 2VJJA 3FHZA 1ZG1A 2ZFWA 1Y1WJ 5JLWA 3QP6A 1G3TA 3ZQQA 1MBKA 3H9JA 2V6EA 4KJZA 3RPUA 4CH7A 1R1VA 3LSTA 3IHUA 4WCGA 4C9YA 2NAZA 3CLOA 5KCMA 1NG6A 2E5NA 3AG3H 1SVLA 2K9LA 3SZPA 1EH8A 3CF2A 1IRXA 1WKMA 3ZXSA 3B73A 3KEOA 5J1UA 5LEJA 2K9NA 5FRNA 3DQVC 2O7OA 2ECBA 3P5JA 1BC8C 5HS9A 4FISA 4Q5SF 3BPVA 3JRFA 1HSTA 4XQFA 4LG0A 2JSPA 1KYZA 2XGCA 2V9PA 3DCFA 1XX5A 2WB1N 3H9QA 3HRTA 5EDNA 5IP7J 1HW2A 5CQGA 5GTIC 3DPUA 1X1CA 1ONVA 3OYMA 1IG7A 4NDLA 3HYIA 5FD5A 3P9KA 1MW7A 2L7KA 4BS9A 4Z2YA 5KHDA 5D4RA 2PN6A 4S0HB 4DW6A 3OSFA 1I1SA 5JFRA 1HDPA 2RC4A 3LA3A 2ZNZA 2DMUA 3ZMZA 2E2HJ 2COBA 3W2VA 2TRTA 3RSNA 4AWXB 1P6RA 3F6OA 3W2AA 2QWWA 3DPLC 1VQMI 3MKWB 1HBXG 3BR1A 3GZ6A 5D5WB 3CDLA 2DA2A 3ZQIA 1Y8RB 4Y3OA 4E7SA 5B5EC 2JA7J 4X0GA 3J81Z 4KYWA 2XAFA 5TISC 3W6JB 2V1UA 3BCBA 4XBFA 4NUBA 3ZQFA 1KQ0A 3BR5A 3K2AA 3MN2A 1XPXA 1TL8A 2FA5A 4N9HA 1N77A 4HX4A 2QKMB 3TEDA 3K7AJ 2HVRA 2XDVA 4GYIA 1X3WB 5DD8A 2EB7A 5F27A 2R4GA 2HPIA 2Q0OA 2VXDA 2LY1A 2YUSA 1OCPA 1R5GA 2FSWA 2LREA 4ZH4F 2QYOA 2HNHA 2B7EA 2VE9A 1WCMJ 2LDUA 2ZKZA 2E5ZA 3FBIB 1VZ0A 4I0BA 2M0CA 1T33A 4A6EA 2BY1A 3UKGA 2G7UA 2HYFA 5HDKA 4AIKA 3PO2J 4IPAA 1MJ9A 2PJRA 1I5ZA 2ELJA 4KMUX 2MC3A 3N05A 4CUGA 3QPLA 5KNLA 4CCNA 1VQ6I 2L5QA 1PUEE 2QBYA 2DI3A 4RM3A 1X19A 5IT3A 4F93B 2RV8A 1SFKA 2LG4A 3ISPA 2HYJA 3LSIA 3BCAA 5DS9A 3LOCA 2HDDA 3GFMA 2HOTA 4EATA 5JHUA 5EEGA 3JSOA 2XAUA 1ETOA 2HKXA 5AIPA 5CJ9A 3I4MJ 4M9SA 4U7BA 1E0EA 2CRGA 1RPWA 4ZTJA 2MW8A 4ZJZA 3MEXA 3WTSC 4MFEA 4RGUA 2LMDA 1MMNA 2MD5A 3WGHA 4D9JA 4F7ZA 3GX4X 3F21A 1XGNA 2EH3A 1OISA 3RJPA 4C2UA 2P6SA 3GTJJ 5HLTA 4HYEA 1W5TA 3C18A 3DBRB 3O6BB 2R5YB 1IN7A 4E70A 3CMMA 2X6YA 3DBLB 1IXRC 2ZBKA 5LHGA 1S5LC 4LJZF 1YYVA 4F91B 1R23A 5D6EA 2AXTC 1WVRA 2VT3A 3ABMH 3BJ6A 3HSFA 1FLIA 3F6VA 1YJ9I 3BG9A 4CSWA 1E17A 3E5UA 2JA6J 4PZJA 2ISYA 1QU3A 1I3AA 1ZGAA 1PYVA 1SC7A 1K61A 3BOQA 1K4TA 5F64A 2DK8A 4G9YA 5HODA 3N4MA 4LD5A 2M3AA 3BG6A 2MYSA 4I98B 4XORA 2VQGA 2XHKA 2EV0A 2P8TA 3QODA 2X9DA 3LSRA 4KFCA 3GTPJ 1YI2I 2L01A 2VKDA 5LFAA 3OYHA 1EA3A 2JSCA 5E79C 3L2VA 1WRJA 1WJBA 2HWVA 2QQ8A 1SEUA 1JGSA 2CG4A 3OY9A 3MKYB 2FNAA 5F0CA 4HNVA 3JRAA 1GUUA 3V4GA 3WE2A 2GXBA 5J47A 1SMTA 3KP2A 5GAEJ 3K2ZA 1N78A 3NEUA 3K4KA 3HOVJ 3HTUA 4L9TA 3HSEA 3WG9A 3CO6C 1Z05A 2WAQA 2W24A 1XG1A 2GM4A 4GXOA 3KCCA 1POGA 4LGWA 4L5IA 1O3QA 2L9SA 3M8FA 1DU6A 2JMWA 4YIFA 2K7LA 5FRMA 4Y17A 3ZN1A 3GMEA 1UHMA 1O3SA 1D8JA 1Z0XA 4LG0B 1OYYA 1YW9A 1U3EM 3MFKA 2NYXA 1X1AA 4HX8A 2UWMA 2EZLA 2A6EF 2QUFA 2ZB9A 3RCOA 3P9IA 3PM1A 5H6RA 2PMZA 2ESHA 3GEZA 3V7CA 1JUMA 1KU3A 4BHCA 5K7HA 5BQTA 5DV5A 2WAEA 2W00A 1MMAA 2E60A 5JI6A 5LBQA 1QPIA 5GPAA 4E7ZA 3C2HA 1IO2A 1IRZA 1LDKB 2HZDA 2Y75A 1RI7A 1A6QA 3DLLF 4UB6C 3D0SA 1R49A 2X6WA 3OMYA 3CCJI 3K69A 2M4GA 5JHFA 5ILSA 4M6XA 4UV8A 2JPBA 3WHBA 3PSFA 3CCLI 5DCMA 5M3FJ 1WZ2A 2GA1A 2L4AA 4JYKA 1CQTA 1D0YA 4I6ZA 1D5YA 1TWHJ 4J00A 3K4BA 4A3LJ 5LLQA 2CU7A 3EUHA 6PAXA 1SFUA 5CPRB 2WV0A 1IAWA 1HW5A 3OYBA 4I99C 3BG5A 3MKLA 4AD9A 1WJEA 2V4JC 4NC8A 3ZP5A 2JPCA 3WE3A 5CVUA 4KUMA 5D6FA 2GBYA 2G0EA 1KZHA 4YFNF 1VQ5I 4IKFA 2LY9A 2LLKA 3C3WA 4ZDPA 1FYKA 2PLYA 2PJRB 2JJ7A 2LH9A 2CWEA 3F22A 3D5LA 4A0XA 4AVPA 1SD5A 2COMA 2ETHA 2KHMA 4HAMA 1KQ8A 2QBYB 4CZCA 2BY3A 2JN6A 3DEEA 3K1MA 2VLAA 4IJAA 4DZJA 1OR7A 2AS5F 3KZIC 2XRNA 2KQRA 2MFZA 1I39A 5E1ZB 3DKWA 4XN0A 1ODDA 1RC9A 4HW0A 2A6TA 4AYBN 4NB5A 2HEOA 4LB5A 1NK2P 2PJPA 3GUDA 1CF7A 1CGPA 2HOEA 3C2BA 1UELB 3G6EI 1YJWI 4DBRA 1R5HA 2MH9A 2ECCA 2EILH 4NHJA 3K1PA 4ZYHA 3GW2A 1D8KA 4JP0A 1VQKI 1Y1VJ 1JE8A 2ZJPF 4UXNA 3CJQB 4NC6A 2W85A 2VQLA 2OPTA 1YTYA 4B1RA 1K83J 4AUXA 1ZG3A 2PEXA 3MZYA 2H1LA 5DM6F 2VBWA 3TP0A 3MKZA 2DN0A 2DLLA 1RRJA 3M9AA 2P7VB 2RQPA 3RKYA 3LSHA 1LDDA 1WPKA 4BE1A 1P4WA 3CF5F 4LB6B 4M9ZA 3LWFA 2EFNA 4D1QA 1HDDC 1FY7A 2V1NA 4EVIA 1HXDA 2H09A 4XLHA 1J5YA 5F08A 5J3LA 5FJ8J 3OYNA 2VJ4A 1MH3A 2DK5A 4MQVA 5FLXK 4FASD 4BU2A 3ZGKA 2K27A 3ZCOA 3JRIA 1GDTA 4IX7A 3ELKA 3CC7I 1S7EA 4LMYA 1JKRC 4PJJA 2OTJI 3KLNA 2P4WA 3OOUA 1WWXA 3KP4A 4M9XA 1Z1DA 1AU7A 4PK4A 2R7OA 2IXSA 1IV8A 3M1EA 5HLHA 1GLNA 3G71I 1VQ7I 1QO0D 3QYEA 2KMUA 2K85A 3FXRA 3HOWJ 1U78A 1TQMA 1Y8QB 3A1YA 5K1YA 3K9TA 1QA6A 1EJ9A 3L2QA 5J8FA 5HS8A 2XASA 2XPVA 5K5OA 2IJLA 1UG0A 3RPUD 1MD0A 5J40A 4HQEA 2DODA 1WI3A 3RDIA 3MMYB 2YS9A 3FK6A 3WTVC 2BY0A 1LFPA 1HA8A 4RLFA 2X1CA 1FTZA 3D5RC 2QZ8A 3OS1A 1B9NA 1P4XA 3AFHA 2HOSA 1XB4A 3R0JA 2LY2A 1X1BA 3JAMZ 2CUJA 4P9UA 1FPQA 2DMQA 1TT0A 3E6CC 4OIRF 3JRDA 3CLQA 1FMWA 2E7XA 3EUHC 4M6VA 4UVAA 2R0QC 5EG0A 1VQNI 2IRFG 2MC4A 2QSGX 3EYIA 1ENHA 2GXAA 3JRGA 3WG7H 4G8XA 5FB2A 1P7IA 1W0TA 3RYPA 1VQPI 4G94A 2M1BA 3A01A 2EZKA 2NVUB 2JK3A 2FX0A 2W7NA 2FU4A 3H3VK 2FRHA 4L9VA 1PP8F 4E7IA 3TO6A 3S3MA 3REOA 1K79A 2EA4A 4A12A 1RKWA 2HXIA 1T39A 3LFKA 3CCRI 1P9QC 3SHFA 2STWA 3JTGA 2NS0A 2ELHA 3ZMSA 2ME0A 2Y0MA 2VKVA 1Z67A 3LQQA 1HKQA 4R8HA 5EF6A 5DCMB 1IRGA 1OR7C 2FBKA 4ENKA 3GTOJ 5K5RA 2IVMA 4II2A 3U1KA 3L2UA 1O3RA 2A07F 2P7CB 1HW1A 2HS5A 2O03A 5LD2C 4ZYDA 5JVGF 1S3JA 3I56I 4XK4A 3CUOA 4Y33A 4F3QA 1IC8A 3P7NA 1TWCJ 2CV1A 5ICEA 3H5RA 4RB0A 2DYRH 1Y39A 1XN7A 2P81A 5D8KB 4E4HA 1U5TA 4UVCA 4XRSA 3LAPA 3G1OA 3MQ0A 5EYRA 2KLOA 2M8EA 1XSVA 4P9FA 3HHHA 1SD4A 4II3A 3IWZA 4XKVA 4U0YA 4A3DJ 1BJZA 1R71A 3A0BC 1ERDA 5L3BA 3OS2A 1OCCH 2VODA 5H20A 4FQGA 1B9MA 4BY1J 1U2WA 3BY6A 1I50J 2ID6A 4YFKF 1BR1A 1UMQA 1UFMA 1XS9A 5FLMJ 3V42A 3PNYA 1FIAA 1RUOA 4CA0A 1WHUA 4AVZA 1YS6A 3HKZA 4BY7J 2JUGA 1OYWA 1A5JA 1BM9A 1TQIA 4GGGA 2LVSA 3T5XA 4QTRA 2MBFA 5AONA 1AKHA 2QLZA 1CF7B 1MBEA 1TP4A 1Z91A 5GP9A 2QQ9A 3ABLH 2FNPA 3CP8A 3S1QJ 3WTTC 3FMRA 2H8RA 2L3DA 2X48A 1YW7A 4GRIA 1JJ8C 2CUFA 1X2MA 2PFBA 2CGPA 2NVXJ 1ETQA 4BE0A 3K4JA 2OZUA 4ZZDA 2VC0A 1W1WE 1EF4A 3Q9SA 1FOXA 1JT6A 4IRHA 5J4VA 1GVDA 3MWMA 1C0WA 4RB2C 1XGMA 3B6CA 4EGZA 2C6YA 2VT2A 5JVTA 3BTJA 1UG2A 2VB6A 2ESNA 3I53A 1ORKA 1JKQC 1NTCA 5GADJ 1LUJB 1A35A 2CV0A 3OYJA 3O3KA 3R4KA 4IRGA 2ZXJA 3HGYA 2UV1A 2XGXA 3C2GA 3I58A 1LE8A 3BQYA 3MZHA 4PGGA 1R58A 4PSXA 4I02A 2X0LA 1ZN2A 4KT6A 5ERIA 3LFUA 1NK3P 2F6CA 4U0WA 1RZ4A 5E20A 5E1WA 3BC8A 2E7WA 1ETWA 1RESA 2JVHA 4BHBA 2FMYA 2W82A 3H36A 4DJAA 1Q1VA 3WTUC 2EIKH 1TC3C 4L18B 4FE4A 4LIVA 1KQ9A 3RKXA 3F8MA 5BS6A 5FKLA 1GT0C 1J75A 3S1NJ 1GVJA 2CMPA 3TMOA 2RKHA 2BXZA 5KK1A 3HRMA 3CCSI 4N4NB 2HTJA 2EFQA 4EM2A 5L3CA 3SEQA 3L2CA 3O8GA 5TRDA 3S2WA 1WI9A 5E3LA 1UHWA 3LSMA 2LSOA 2LK2A 4N0BA 4HV5A 4XOPA 5B1BH 3O8HA 5D8LB 3HL2A 3H0GJ 4JQFA 1JXSA 3K4MA 3LAJA 2GAUA 2GIVA 4DIQA 2HDCA 3H35A 3FXUA 3T8RA 1G6NA 2DTRA 1YQAA 5E3MA 3D5SC 4PCQA 3S3OA 1Z7UA 2F4OB 4M6YA 3PIPF 1WH7A 2ZXWH 2F2EA 3VYRB 4BQQA 2DT7B 3TDUC 4L0YB 3I9V2 3OS0A 4KN7X 5LRSA 4QLCU 5EEHA 2CW8A 2Y0SA 3HM5A 3L9FA 5EG0B 4HG2A 4CCOA 1RIOH 3VOEA 3KYLA 1V55H 5IY5H 1MDMA 5IPAA 3ECHA 3ZPLA 2OA4A 3GXOA 5A2QK 3BZ6A 2A5WA 1R22A 3ZQGA 1HKTA 2D2WA 3BZKA 1IN5A 2QQAA 2GXGA 4MHGA 1U5TC 1BR4A 2XVCA 4I76A 1E3PA 4E7LA 3AL0C 2K4JA 3DXJF 3ULQB 1YG2A 4CZZA 4H4KC 1I6XA 2IT0A 4G7HF 2VIXA 2R7FA 3BR6A 3SFIA 4E7JA 2Z1DA 2BYVE 3DLAA 2ADUA 2LFBA 2V9VA 3DF8A 4A3IJ 3TGNA 1SFEA 5F1JA 5KAFC 4KDPA 3DU5A 4OWRB 2A05A 2VBXA 4E6KG 4ZTFA 2QSFX 2LKPA 1I1GA 1Z6RA 1U5TB 2OZ6A 3FMQA 2ZSIB 2ISZA 1BL0A 1MNMC 2DA4A 2G9WA 2LP0A 3FBNB 5DUKA 5FLVA 3IV5A 3E0JB 4NC7A 4RMNA 1OMIA 4YELA 3HUGB 2M7AA 2CW7A 3F8FA 4FHTA 3ZQCA 5IT9K 3HIFA 2Z33A 3GTKJ 4B4CA 1U8RA 1LFUP 4A3KJ 1PJRA 1RUNA 2H1KA 4AM3A 4BHPA 3GVAA 5FKMA 1JKOC 3NWTA 3HB9A 1IXSB 3RQIA 4HNTA 2Z16A 4WF2A 4ENJA 4HQMA 2AHQA 3IRRA 2BW3A 2WC2A 2V9KA 2XAHA 3GCMA 3BP8A 1AKHB 2L9VA 5HNHA 1MKMA 2E2IJ 2NVQJ 1OPCA 1R4NB 1J2XA 2JA8J 3M4OJ 4D7NA 1WJFA 1QVTA 1X4OA 3I3LA 4RB1A 4FTHA 1X1PA 4GYGA 4C30A 5HDNA 1I6HJ 4JOMA 2ZJRF 3TQNA 2D1VA 1RETA 3QPTA 2L54A 5CVVA 3K4CA 3I4PA 2QVOA 4Y15A 1S29A 1FJLA 1ETVA 1FMVA 4CICA 3PJRA 4HLYA 2VKHA 3K0LA 4ENMA 3PO3J 3KP5A 4B48A 2IGOA 4BDZA 1PVEA 1D1AA 2ZFUA 1QBJA 2P6TA 2OU2A 3BZCA 4RAGA 1DP7P 5ICCA 5FD6A 3VWBA 1KYWA 5A2QZ 2WB1A 2UZKA 2Y9YA 1RR8C 4HBLA 5H2FC 1MZBA 2J5PA 4MFDA 3BR2A 1FOKA 1OJLA 2OV7A 4B43A 2K3PA 1ETYA 1LE8B 1SFOJ 2EV5A 3P9CA 1XSXA 3EQLF 1W36D 2GZWA 2WADA 2I5UA 1SFXA 5M5YJ 2X6XA 1F5TA 3NRVA 4NNJA 3VSLA 4C3JJ 3IKVA 5JR3A 4F55A 4EJTA 3CD6I 5IYDJ 3J7YJ 3CQZJ 5IP6A 1I27A 1WJDA 3L2RA 3TP3A 3SYTA 4RB3C 1MMDA 5E3NA 1T6SA 5F04A 1K78A 4OMZA 3DTIA 1BR2A 2BZTA 4I0AA 1VQ8I 3VODA 3I59A 2RVCA 1B4AA 3DTKA 3RI4A 2L7MP 2KL4A 2DA7A 5EJCA 4BGDA 4DNCA 2YU3A 1TWFJ 2K40A 1YW8A 2Q2EB 2IW5A 4A3JJ 1LQ1A 3F8BA 3ZR8X 3D1NI 3M3YJ 1ZGWA 2DJIA 2XAGA 1G59A 5BMZA 2FBHA 3T0YA 1FEXA 2EBIA 2IA1A 2B9SA 3E3VA 4WXHA 2X4HA 2R7VA 4ANJA 3WHCA 2O3FA 1DPRA 1ZHFA 4KMFA 1ZTRA 2MLGA 2FQ3A 2KDOA 3K1NA 5IT9Z 5C3EJ 1JGGA 3OOPA 3F3XA 2KRHA 1O7LA 4KIGA 4BXFA 1USTA 2LBFA 1SD7A 1BOBA 2DT5A 2N8GA 1YIOA 4L9NA 1RKTA 2A61A 3GFLA 4PJLA 1MDMB 1TNTA 2XPWA 3HJEA 4H0EA 4E7HA 3ZQHA 3LA7A 1VQLI 2E1NA 2DMNA 3KE2A 2F5FA 1BOAA 1IGNA 3V8KA 2H6BA 4IXAA 3S1MJ 3BTIA 3AAFA 2HTSA 4EQQA 1WSUA 2K4BA 2UUZA 2Y31A 1H8AC 1KU2A 4PJMA 5L3FA 3CMYA 3CC4I 3TBIA 2M4KA 3S2HJ 3MAJA 3OR1C 1X58A 1EH6A 4IHTA 3FK7A 5KAIC 1D1BA 3PNTA 5BOXA 2O0YA 2PQ8A 2X1DA 2H94A 5BPIA 3CDHA 1V3FA 1KU9A 5E8GA 4A3GJ 3S3NA 2VUMJ 3JRBA 2FE3A 2Z99A 5CVRA 4KT5C 2BOLA 3E6MA 2NNYA 5K5QA 1MBHA 1X3ZB 3M1CA 1YE9A 3ZMUA 2VKEA 5AIQA 3I4NJ 2LRDA 4EV0A 3HEFA 1F43A 3GZ5A 4MNUA 4HSTA 3KETA 2M45A 3BDDA 3BJAA 2CQ7A 5GPCA 2RGVA 4LFUA 1B72A 3QU3A 3VFZA 3ZMVA 3I5UA 2F4IA 1J0RA 2VL8A 3PQKA 2MLKA 3GF2A 1P2FA 3SDBA 3CCEI 2ZMEA 1D0ZA 4F52A 1ZYRF 1BI3A 3JAMK 2JVGA 4G7ZF 4PUSA 5HS7A 4EM0B 2XGEA 4QWQA 2XROA 2BW3B 1YIJI 2QQBA 3AG4H 1Y56A 4IF4A 1YX5A 5FKKA 3FMSA 1LJ9A 5GTHC 3OYLA 3TO7A 4R79A 4DZPA 4XKWA 2EZIA 2HQRA 1IDYA 1TW3A 2PMHA 5J1YA 4IO9F 3EETA 2A69F 2HKOA 4LK0F 2VQHA 2KDZA 2DPUA 3V8JA 1VF9A 1HSJA 1IUFA 1G3YA 3OSGA 4BNCA 3DTEA 2STTA 1XDSA 2QGUA 3CC2I 3BG3A 3OYAA 3RPQA 1FTTA 1WJ5A 2O9LA 1S7OA 3BPXA 4V2GA 3RZDJ 3Q5FA 2DBBA 4A3MJ 4RGXA 4ENNA 3FZVA 3HBLA 4FETA 2E35A 2MH2A 1FZPB 4TV7A 4OAZA 4LG3A 2OC6A 4B3AA 2XRLA 2LTPA 3IC7A 3QOEA 3IH4A 2XAJA 1ZRDA 4ESBA 1V54H 3HHGA 4L5JA 3S15J 1M1EB 3HOTA 3RTRA 4BUPA 3I0TA 1YRNA 1XC5A 4B44A 1FT9A 3E6DA 4JBAA 4A0YA 4UUVA 2RNGA 4HSRA 3U1DA 5B1AH 4OU0A 3OYKA 3BT9A 3OYIA 4BBSJ 2Q1ZB 2HQAA 4CHUA 3CTAA 4A3FJ 2E1MC 4B47A 1OYIA 3HPGA 1IN6A 1Z77A 1BIBA 2JRTA 3ZQLA 3QU6A 3FISA 4N9IA 1XCBA 2GIZA 5E3OA 1H89C 2D5VA 1MIJA 2CQNA 4PFOA 3PIOF 1K78B 2WV1A
chains in the Genus database with same CATH topology
2DOEA 4FQGA 2L9VA 2E71A 2K85A 2KIQA 2B7EA 2LKSA 2KISA 2DOFA 2KZGA 2CQNA 2KFDA 1UZCA 2DODA 2JUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DOE A;  4FQG A;  2L9V A;  2E71 A;  2K85 A;  2KIQ A;  2B7E A;  2LKS A;  2KIS A;  2DOF A;  2KZG A;  2CQN A;  2KFD A;  1UZC A;  2DOD A;  2JUC A; 
#chains in the Genus database with same CATH topology
 2PBI A;  4LIU A;  2K9S A;  3LMM A;  1QZE A;  4CYC A;  3I59 B;  1RR7 A;  4A2U A;  2XV4 S;  4J19 A;  2IP2 A;  3BR3 A;  3MCZ A;  4P5O A;  4XRS G;  5JLX A;  2KPM A;  1KA8 A;  1V5E A;  3EUA A;  2RQQ A;  1Y0N A;  1EKE A;  1TW2 A;  4C3I J;  1EH7 A;  1WH5 A;  1XD7 A;  3SFZ A;  4OIN F;  1TTY A;  2MG4 A;  5F0F A;  3ML6 A;  1AA7 A;  2L4M A;  4IQ4 A;  2CV2 A;  1F36 A;  1D1C A;  1Z7L A;  2XF7 A;  2Y2Z A;  3KEQ A;  3GLL A;  1UAA A;  3K10 A;  5CQE A;  2KRC A;  3WU1 B;  2OD5 A;  3UR3 C;  3E5Q A;  4XLN F;  4I7H A;  4DGW B;  1K6O A;  1AHD P;  3H1C A;  5EZG A;  5IYC J;  1IRF A;  1JUP A;  4CCJ A;  3HXL A;  3KP6 A;  4A3E J;  1LNW A;  2M30 A;  4S04 A;  3SDG A;  2DMT A;  2LBF B;  3HKZ N;  4FCY A;  3S93 A;  4RAF A;  2P5K A;  3FKI J;  2JTV A;  4HV6 A;  2R7T A;  4LLG F;  2R3S A;  3AKZ A;  2E36 A;  2VC1 A;  4EMS A;  4WXD A;  1A31 A;  3WGG A;  1IF1 A;  3ASN H;  1W5C C;  4HRI A;  2CUZ A;  3K70 C;  3GTL J;  2CW0 F;  2WAF A;  4XL9 A;  1NHA A;  3MZ8 A;  4KN4 X;  1NH3 A;  2DQR A;  4RA2 A;  3VEP A;  3PFI A;  4EJO A;  1R1U A;  2CSO A;  3UNG C;  2EPF A;  2JWT A;  3V7S A;  1FNN A;  4Z6Y A;  1SAX A;  1SMY F;  2ZME C;  1N75 A;  3HOY J;  2KIS A;  3NAR A;  2A3S A;  2QA4 I;  1T95 A;  2M8G X;  4I09 A;  2HFH A;  3H3Z A;  5DTD A;  4U7D A;  1U6G A;  3VB2 A;  1LEB A;  1VTN C;  4PSW A;  3CZ6 A;  2Y9Z A;  1DGR M;  2E34 A;  1G8X A;  3JTH A;  3COA C;  3RZO J;  3ERM A;  4M3F A;  4J01 A;  1OCT C;  1JHH A;  1R6R A;  4U0V A;  3A4C A;  3AG2 H;  4IHX A;  2DOA A;  2IPQ X;  3IAM 2;  1KGS A;  3ZOB A;  1LEA A;  3VYU B;  1BIA A;  2K86 A;  3GBG A;  4IHY A;  2L9R A;  2LYC A;  2M9H A;  3ASO H;  1S8N A;  2XC7 A;  2ZXH A;  3RKQ A;  1XDU A;  4JX5 A;  1H9T A;  2EIN H;  2LOO A;  3ROU A;  2QCO A;  4HF2 A;  2FQ4 A;  1YX3 A;  5E17 F;  2XKP A;  4GFB A;  1B72 B;  1JI8 A;  1OCZ H;  2H27 A;  4QIW N;  3HPH A;  2QKL B;  3ONQ A;  3WTW C;  1W4M A;  4CCL A;  3JRC A;  2IS1 A;  2PG4 A;  2WTE A;  3KZY A;  2R7U A;  3BG7 A;  2M34 A;  3A02 A;  3GTQ J;  1ZGJ A;  3WTZ A;  3J80 Z;  4MEX F;  4BXX J;  4XM3 A;  1IDZ A;  1BBY A;  3HZJ A;  3S8P A;  2BHY A;  3E97 A;  3ZMT A;  2XUB A;  4M3E A;  1T08 B;  5LHH A;  5H6Q A;  2DOF A;  5HVQ C;  2W25 A;  2CH0 A;  1XSD A;  2VQC A;  3S17 J;  1S7A A;  1SD6 A;  3CP2 A;  3OL4 A;  4DQ2 A;  1WFX A;  1OCR H;  2HI3 A;  1BI0 A;  1OQY A;  2ACJ A;  1TNS A;  1TBX A;  3QYB A;  1L3L A;  2VN2 A;  3C1D A;  4M73 A;  5CYV A;  2NS7 A;  1G2H A;  1O7F A;  4XLE A;  2BXY A;  5LGN A;  2E19 A;  3J7A Y;  1DPU A;  1Z3X A;  3IWF A;  5F6F A;  1MBF A;  2CJJ A;  1U0J A;  4HX7 A;  2K5C A;  4AID A;  1MBG A;  5D5X B;  3KIO A;  1XGS A;  4BJ5 C;  3T1B A;  4PJN A;  3HOU J;  3F23 A;  2EA2 A;  1ZAR A;  2P5V A;  4HPQ A;  2Y0S N;  4UHT A;  1JUS A;  3CCM I;  2HQ5 A;  3I64 A;  1NG7 A;  4YFX F;  1P92 A;  4MEY F;  5DCF A;  4G6Q A;  1FP2 A;  5HLI A;  4E7K A;  4BE2 A;  4D0P A;  5DEQ A;  4GCV A;  1AOY A;  5ICG A;  2VXZ A;  4HOB A;  1ZQ3 P;  1QZZ A;  3E5X A;  4OIQ F;  2KJC A;  1ULY A;  1FSH A;  2CQQ A;  4MGR A;  1YRN B;  3EDP A;  1X4P A;  2P5L C;  1BI2 A;  2BEO A;  3MD2 A;  1GV5 A;  1E2X A;  1X2N A;  1JTX A;  3PUF A;  3TW6 A;  4NQW A;  4RM2 A;  3OYE A;  5J6X A;  1Y0U A;  2H8W A;  3B6A A;  1A04 A;  1EV7 A;  1JT0 A;  1S6L A;  1UB9 A;  3TL4 X;  2ZXI A;  4ABZ A;  3ABK H;  1UCR A;  1W7P A;  3TOA A;  3VYT B;  1ZKG A;  4C2T A;  4CYC B;  1U9N A;  1REP C;  4C3H J;  3SZG A;  2W4S A;  1T0F A;  3CJN A;  2ZO4 A;  4AIJ A;  1MBJ A;  1FWZ A;  3FWE A;  3T8T A;  5EGO A;  3GFJ A;  2CUE A;  5FFX A;  3TO9 A;  2D1H A;  2DT6 A;  2V6C A;  3B02 A;  3FHN A;  3L1P A;  3QRF F;  1LFB A;  3EUK L;  3H5A A;  1LVA A;  3S1R J;  2YSR A;  1ETK A;  2VI6 A;  3TDZ C;  3PUB A;  4BYY A;  4RAY A;  1DP3 A;  2GWR A;  1L0O C;  5IYB J;  5L3D A;  1V5G A;  4X6A J;  2EIJ H;  2FF4 A;  3CO7 C;  1Z9C A;  2DOE A;  4A93 J;  4DYQ A;  3JRH A;  3KPH A;  2DAO A;  2DU9 A;  1OCO H;  4AIH A;  2RN7 A;  4MO7 A;  2CFO A;  5KVR A;  1H9G A;  2EK5 A;  3QOP A;  2EFP A;  1MSF C;  4ZZL A;  5M5X J;  3HGG A;  1ON2 A;  5EEA A;  1ZRE A;  2UXN A;  1B8I A;  4D5F A;  1ON1 A;  3DEW A;  2B63 J;  1QGP A;  1DGW Y;  2BGC A;  1T56 A;  2R7D A;  1ZLK A;  1XMA A;  2V7F A;  1E3O C;  3A01 B;  4XRF A;  3GFI A;  1JHF A;  2F5E A;  2W84 A;  3DKY A;  2VBZ A;  4WX9 A;  1BC7 C;  1LVK A;  3FM5 A;  1R1T A;  1S9H A;  1BW5 A;  1R00 A;  3WU0 A;  4XRM A;  4UUS A;  1XMX A;  3V7R A;  3GO5 A;  3CMA I;  1R7J A;  2HOA A;  4IOC F;  1XTA A;  2K9Q A;  5L3G A;  1QNT A;  2M7B A;  3OIQ A;  1PDN C;  2DA5 A;  2B0L A;  4WWC A;  4B3X A;  4Q4Z F;  3GZN B;  2HVS A;  4I2O A;  1DQU A;  2F4M B;  2V1X A;  2EFO A;  2J5O A;  4XLP F;  1BA5 A;  4HF1 A;  4XNF A;  2O8X A;  4MIM A;  3ZMD A;  2OCE A;  2FEZ A;  3K70 D;  3FXL A;  2IGM A;  3KYC B;  3CES A;  3CCQ I;  4KNY A;  3EYY A;  3JRE A;  5CVI A;  1FX7 A;  5HOO A;  2R7S A;  2MAB A;  2DFE A;  3EPZ A;  2JA5 J;  3FX3 A;  3KYD B;  1J9I A;  2A68 F;  5F1R A;  2KT0 A;  3E1S A;  3AL0 B;  2QM3 A;  2Z3Y A;  4XKC A;  2O5R A;  1R9T J;  4G7O F;  4L9J A;  3H9G A;  3CME I;  1UHS A;  2P0W A;  3NQO A;  3ABT A;  5FKN A;  2Z9O A;  3OV8 A;  3IH3 A;  1YOV B;  2XF6 A;  1B59 A;  3G1M A;  2HU9 A;  3WOD F;  1VND A;  4WXC A;  4U88 A;  1UZC A;  1BI1 A;  2A6H F;  3M07 A;  1T38 A;  4N4O B;  5C4J J;  2LF7 A;  1XMK A;  3U21 A;  5D4S A;  1YIT I;  3L09 A;  1W5S A;  2F5D A;  2L7F P;  2QEX I;  2ZNY A;  3HRS A;  3WTY C;  5ICF A;  4AC0 A;  4ETS A;  1N25 A;  4O5V A;  5LGU A;  1MND A;  1U9O A;  2W48 A;  2OAZ A;  2R7W A;  4WK8 F;  1VQO I;  3HDD A;  2DFH A;  2WAQ N;  3K4N A;  1PP7 U;  4G6T B;  4M72 A;  3CDI A;  1QVU A;  1VI0 A;  4LK1 F;  1Z6T A;  3QYF A;  5FKO A;  2DJN A;  2PI0 A;  2JT1 A;  3QPS A;  3H3U A;  3WU2 C;  4ESJ A;  1DDN A;  1V5F A;  3FIW A;  4EM1 A;  3S2D J;  2K9M A;  1Z21 A;  2KZV A;  4K2E A;  4OAY A;  3KEY A;  1T0F C;  4XIC A;  2CS3 A;  4S05 A;  4RLQ A;  3FM3 A;  2R92 J;  1R36 A;  4B8X A;  5BNG A;  5DDG A;  2X6O A;  4W1U A;  4PGH A;  3ERE D;  2XB0 X;  1FIP A;  2PMZ N;  3DU6 A;  5M5W J;  4QPO A;  1O57 A;  3CCV I;  1HCR A;  2BHZ A;  5HLG A;  2OCC H;  3M8E A;  2QSH X;  2KIF A;  9ANT A;  5C44 J;  3IUO A;  3GWZ A;  1PUF A;  1T98 A;  4CXF A;  1LPQ A;  3HG9 A;  4BQO A;  3OL3 A;  4NQW B;  4M3B A;  1H88 C;  2HGC A;  2IGK A;  2HQN A;  2Y30 A;  2BBY A;  1D5V A;  2WY7 Q;  1SAN A;  2DDB A;  2KJB A;  2AXL A;  2EV6 A;  3R60 A;  4KIT B;  2O8K A;  3GLX A;  2HYG D;  3M8J A;  1W7P B;  5DM7 F;  2HDW A;  1TLH B;  4ZYG A;  2IGN A;  2LC2 A;  3ECO A;  4LIT A;  3DV8 A;  4XMY A;  3GTG J;  1R5I D;  4DBQ A;  3ZRG A;  3DKX A;  2R7Q A;  3X2Q H;  1B1B A;  1TQP A;  2CO5 A;  4F92 B;  5EGO B;  3LA2 A;  3PNV A;  2IA0 A;  2K02 A;  2WY8 Q;  2KP6 A;  2H6C A;  5TGT A;  4KA4 A;  1KU7 A;  2VJI A;  1JTY A;  4UY8 I;  3SEZ A;  2Z5U A;  4MQ9 F;  1W0U A;  3W2W A;  5C4X J;  2X85 A;  1O3T A;  2RNJ A;  4X1E A;  4O6J A;  2O6G E;  2CQX A;  2IAI A;  2NS8 A;  2HPM A;  3BLY A;  5DUI A;  5CVJ A;  1FC3 A;  3CJR B;  5ILU A;  2YR2 A;  3OYC A;  5D5U B;  1ZR4 A;  1ETX A;  4JX6 A;  5DYM A;  3N97 A;  4BQA A;  2DA1 A;  4G12 A;  5K7Z A;  3PQJ A;  3RKW A;  2KZG A;  4BH9 A;  2L9N A;  5EZH A;  3VYS B;  4CO8 A;  2ZC2 A;  5E1X A;  4A69 C;  4XON A;  1ZLJ A;  3V8L A;  3HTS B;  3CUQ A;  1B8I B;  4L5E A;  3KFW X;  3CCY A;  3JW4 A;  3OIP A;  2E71 A;  2L2O A;  3S14 J;  1MSE C;  4V2F A;  2LR8 A;  2DMP A;  1FYL A;  2NXN B;  2GOM A;  3HRU A;  4BXU A;  4ZYE A;  1FOY A;  2FJ1 A;  3KX2 A;  1VQ9 I;  2VAS A;  4IHS A;  5GAH J;  2TDX A;  1MGT A;  2DFF A;  2DYS H;  4NBQ A;  4UUS B;  1ZH5 A;  1MMS A;  1V4R A;  3PSI A;  4YRV A;  2R5Z A;  2O61 A;  3ZQ7 A;  4XLC A;  4FX4 A;  3F72 A;  1JJ6 C;  3BWG A;  2ELK A;  2VJ5 A;  1YFH A;  3HOS A;  3OYF A;  5IOZ A;  3J7Z I;  4XOT A;  2ID3 A;  1J59 A;  2DXI A;  2MA3 A;  4Y7N J;  1IXC A;  2EQR A;  1APL C;  2OTL I;  1IZ1 A;  4IOA F;  1HKS A;  1MNE A;  2MGQ A;  4FT8 A;  3A2K A;  2XGD A;  1IV6 A;  3G73 A;  2R7R A;  4XSZ F;  3DFG A;  2HXO A;  4AU7 A;  2W57 A;  2GLO A;  2R7Z J;  3BR0 A;  4Q48 A;  4OIO F;  4L0Z B;  3H0D A;  1AWC A;  3G4S I;  1TZL A;  2OQG A;  1MJA A;  1XGO A;  4BEH A;  3LSK A;  3H92 A;  3JCU C;  4MTD A;  2JRM A;  4HEA 2;  1WGX A;  1ZR2 A;  4O3M A;  1YS7 A;  2OUM A;  3K6G A;  1E3H A;  4HLX A;  3IH2 A;  4RGS A;  2M0M A;  4XN3 A;  1Q1H A;  1IUY A;  2OF7 A;  2DFI A;  3DWL E;  2YU9 J;  3E6B A;  4RS8 A;  4UB8 C;  1MJB A;  2L7Z A;  1Z3Y A;  2FBI A;  2XF5 A;  2OQR A;  1FBU A;  5BPD A;  3J7A O;  1TT5 B;  5CLS A;  1Y6I A;  3ZN0 A;  4BAC A;  1BN5 A;  2CQK A;  1B6A A;  1QHG A;  5TJJ A;  4QPQ A;  5L3E A;  2MSY A;  1D0X A;  2KKO A;  1D3Y A;  1ACI A;  1F1Z A;  1G3S A;  4PFP A;  4OOI A;  1A6I A;  1FSE A;  1J09 A;  4HDU A;  3Q0U A;  3E7L A;  4ITV A;  4JK1 X;  1ZRF A;  3O2P E;  4PJ0 C;  3C7J A;  3KP7 A;  1WJC A;  2OJE D;  3GTM J;  3G3Z A;  3HSR A;  1GHC A;  2VPR A;  2XB5 A;  5LEK A;  4RDU A;  2KRF A;  2BY2 A;  2DPD A;  4BL0 B;  3RYR A;  1IW7 F;  5FO5 A;  3RQ4 A;  4UNO A;  3BTC A;  1QPM A;  5FFZ A;  4D7M A;  4ZDL A;  2NOG A;  3FKJ A;  3FXQ A;  3LSP A;  2MD0 A;  4UV9 A;  1STZ A;  4EJV A;  1XCV A;  1LB2 A;  2XSD C;  4Y13 A;  4KIS A;  1PUF B;  4EJW A;  1ZK8 A;  3BQZ A;  1RNL A;  3R61 A;  4IRI A;  3OYD A;  4A5N A;  4XLF A;  2IA2 A;  1MMG A;  4GO1 A;  3F8N A;  3Q9V A;  3RIR A;  5GAG J;  2EFW A;  2V79 A;  2LNB A;  2TCT A;  3DPT A;  1W7P D;  5B3S H;  3J80 K;  4RGR A;  3IRQ A;  2CYY A;  2NVY J;  1YLF A;  2F5C A;  2GA2 A;  5IP9 J;  2X51 A;  3FDY A;  5M3M J;  2ME6 A;  3VSK A;  4YEJ A;  2EIM H;  4IZZ A;  1SAU A;  5FRO A;  3CUQ C;  2PX9 A;  4B09 A;  3PL8 A;  3JR9 A;  3MVP A;  4PDK A;  1K6Y A;  1SVM A;  3FXJ A;  3VDX A;  3SJM A;  1VFC A;  4D5C A;  3KZZ A;  4U87 A;  4KIC A;  3U2R A;  2VBY A;  4GDF A;  1J7K A;  2DTZ A;  3FF5 A;  4BDY A;  5HDG A;  1LDJ A;  3L2W A;  1F9N A;  4ESF A;  5LGT A;  2X1E A;  2RDP A;  3QWL A;  2LF8 A;  4BQN A;  4IQJ A;  2KIQ A;  3SQN A;  3ABU A;  2ZSH B;  4M3G A;  4XID A;  1A36 A;  2ICW G;  2ZJ2 A;  3A03 A;  4BJT A;  2L02 A;  1T8I A;  4XLA A;  1K4S A;  1GV2 A;  3IAS 2;  2RRE A;  4P96 A;  2E1M B;  2EJR A;  3QP5 A;  1G4D A;  2UXX A;  4KIF A;  1R4M B;  2FML A;  2AQF A;  4A0Z A;  2LKX A;  2Z2S B;  4UUT A;  1DUX C;  3CUQ B;  3IP4 B;  4G6D A;  2I10 A;  3TW7 A;  3IL2 A;  3F9K A;  3NAU A;  3H5N A;  4A3B J;  2XPU A;  4UVB A;  5ILV A;  4EGY A;  3TKY A;  4HZF A;  4XKB A;  2E1C A;  2DQL A;  4YG2 F;  2M5W A;  2WBM A;  4RAZ A;  1HF0 A;  1HC8 A;  2PMU A;  4CYD A;  2EWN A;  4AYB A;  2VPL A;  1OKR A;  2WWY A;  4IL6 C;  4YIR X;  2R5Z B;  2E1O A;  1TWA J;  4ZDO A;  1TWG J;  2ZCW A;  4A6D A;  2V1D A;  3A0H C;  5LRR A;  3QPH A;  4FE7 A;  3AG1 H;  2L0K A;  2I8D A;  1ITY A;  1P4A A;  1WQ2 A;  2JUC A;  2KIU A;  1YHQ I;  4HNU A;  5CKT A;  3FXK A;  1OFC X;  2G7H A;  4CCM A;  1G3W A;  2KFD A;  2Q8K A;  5IOY A;  4XR6 A;  2GQQ A;  2AQE A;  2YPR A;  3U9G A;  4HA8 A;  3BRO A;  1ZG5 A;  2VOP A;  2NRA C;  1X3U A;  4RBO A;  2FD5 A;  2NNN A;  1FP1 D;  2QF7 A;  4BEH B;  1O4X A;  5D5V B;  2NOJ B;  2V26 A;  3LSG A;  3L00 A;  4A5M A;  3R6S A;  1SVO A;  2F5V A;  5J8C A;  3JSP A;  1QQI A;  3GYH X;  2M87 A;  4Y52 J;  3BJO A;  4CDG A;  2BVM A;  4CCK A;  2R93 J;  2IEK A;  4MTE A;  4LLL A;  3DEU A;  2ZME B;  2DA6 A;  3W6K B;  3Q0W A;  4ZC3 A;  2HZT A;  3S32 A;  1U8B A;  4IEJ A;  4FX0 A;  3F8C A;  2VON A;  4W97 A;  2FXA A;  2FUG 2;  3K4L A;  1WJA A;  4I01 A;  5E8I A;  1FBS A;  4ON0 A;  1P7J A;  2A5Y B;  2HR3 A;  3CCU I;  1YJN I;  1IN4 A;  2IBD A;  3BTL A;  3G1L A;  2IS2 A;  2Y48 A;  3S16 J;  3TOB A;  2JQ7 A;  2BVL A;  4HDV A;  2K3F A;  3OYG A;  1FYM A;  5FLX Z;  2YX7 A;  3I54 A;  5HNF A;  4KIB A;  1LKX A;  4EEF G;  2OBP A;  2IS4 A;  5J1R A;  3HUG A;  1BJA A;  4JX4 A;  4A3C J;  4CGZ A;  1MH4 A;  1IJW C;  1QHH D;  3G2B A;  3SXY A;  3LNQ A;  2ZJQ F;  5FGM A;  4Y4R A;  2CFX A;  1I3Q J;  4LOC A;  3HOX J;  4ASN A;  1F4K A;  1FBQ A;  3FXM A;  4HF0 A;  2E2J J;  1HLV A;  3ESW B;  3HOZ J;  3R0A A;  4OMY A;  3Q3S A;  2VE8 A;  3W6V A;  1HQC A;  3L7W A;  4LLN A;  2FOW A;  4M3D A;  4M74 A;  4EJU A;  1HOM A;  1DU0 A;  3KP3 A;  3QQA A;  1USS A;  4P1W A;  5J4Y A;  2D45 A;  1W36 C;  2BV6 A;  4BAY A;  4V19 K;  4XSX F;  1K7A A;  2M2E A;  1BW6 A;  2XSJ C;  1IN8 A;  3Q0V A;  3KLO A;  2DA3 A;  1ZEL A;  2R7X A;  2XIG A;  1QZY A;  2DCE A;  2JA2 A;  2IS6 A;  3NWS A;  5K7F A;  5F0H A;  2NVT J;  3J81 K;  4Q47 A;  3OIO A;  2XKO A;  4R1H A;  2VOO A;  3I71 A;  3VPR A;  2DO7 A;  3W3C A;  2XAQ A;  1X1D A;  3DBH B;  3OWT A;  4BKX A;  5ED4 A;  1VQ4 I;  2EZH A;  3CJT B;  4IHW A;  2R5Y A;  1ZAO A;  3WGI A;  2HVQ A;  2GOX B;  2Y69 H;  4DYR A;  3I55 I;  1GXP A;  5E18 F;  1UJ8 A;  3HC7 A;  4BJ6 C;  4DOZ A;  1YO5 C;  2KIM A;  3LQR A;  2W1O A;  4IHV A;  4YII A;  4OIP F;  4DYC A;  1JKP C;  4M71 A;  4C2M J;  1T2K A;  3SZT A;  1S72 I;  5DD4 A;  5LHI A;  1ZRC A;  4IVN A;  2QEN A;  2DW4 A;  4MLO A;  2BE5 F;  2F48 A;  1KON A;  3FXO A;  4BBR J;  3DP7 A;  1GXQ A;  3IKT A;  3LL7 A;  3WTX C;  3QAH A;  1QRY A;  3PFY A;  4P55 A;  5B66 C;  1OLT A;  2WA0 A;  3M7G A;  1FOW A;  2LKS A;  3F0C A;  1H0M A;  3LSJ A;  2DDA A;  2RAE A;  2YX4 A;  3OR2 C;  4ZYA A;  2AO9 A;  2FOK A;  2Q2E A;  2LD5 A;  4QSH A;  2JZY A;  2VJJ A;  3FHZ A;  1ZG1 A;  2ZFW A;  1Y1W J;  5JLW A;  3QP6 A;  1G3T A;  3ZQQ A;  1MBK A;  3H9J A;  2V6E A;  4KJZ A;  3RPU A;  4CH7 A;  1R1V A;  3LST A;  3IHU A;  4WCG A;  4C9Y A;  2NAZ A;  3CLO A;  5KCM A;  1NG6 A;  2E5N A;  3AG3 H;  1SVL A;  2K9L A;  3SZP A;  1EH8 A;  3CF2 A;  1IRX A;  1WKM A;  3ZXS A;  3B73 A;  3KEO A;  5J1U A;  5LEJ A;  2K9N A;  5FRN A;  3DQV C;  2O7O A;  2ECB A;  3P5J A;  1BC8 C;  5HS9 A;  4FIS A;  4Q5S F;  3BPV A;  3JRF A;  1HST A;  4XQF A;  4LG0 A;  2JSP A;  1KYZ A;  2XGC A;  2V9P A;  3DCF A;  1XX5 A;  2WB1 N;  3H9Q A;  3HRT A;  5EDN A;  5IP7 J;  1HW2 A;  5CQG A;  5GTI C;  3DPU A;  1X1C A;  1ONV A;  3OYM A;  1IG7 A;  4NDL A;  3HYI A;  5FD5 A;  3P9K A;  1MW7 A;  2L7K A;  4BS9 A;  4Z2Y A;  5KHD A;  5D4R A;  2PN6 A;  4S0H B;  4DW6 A;  3OSF A;  1I1S A;  5JFR A;  1HDP A;  2RC4 A;  3LA3 A;  2ZNZ A;  2DMU A;  3ZMZ A;  2E2H J;  2COB A;  3W2V A;  2TRT A;  3RSN A;  4AWX B;  1P6R A;  3F6O A;  3W2A A;  2QWW A;  3DPL C;  1VQM I;  3MKW B;  1HBX G;  3BR1 A;  3GZ6 A;  5D5W B;  3CDL A;  2DA2 A;  3ZQI A;  1Y8R B;  4Y3O A;  4E7S A;  5B5E C;  2JA7 J;  4X0G A;  3J81 Z;  4KYW A;  2XAF A;  5TIS C;  3W6J B;  2V1U A;  3BCB A;  4XBF A;  4NUB A;  3ZQF A;  1KQ0 A;  3BR5 A;  3K2A A;  3MN2 A;  1XPX A;  1TL8 A;  2FA5 A;  4N9H A;  1N77 A;  4HX4 A;  2QKM B;  3TED A;  3K7A J;  2HVR A;  2XDV A;  4GYI A;  1X3W B;  5DD8 A;  2EB7 A;  5F27 A;  2R4G A;  2HPI A;  2Q0O A;  2VXD A;  2LY1 A;  2YUS A;  1OCP A;  1R5G A;  2FSW A;  2LRE A;  4ZH4 F;  2QYO A;  2HNH A;  2B7E A;  2VE9 A;  1WCM J;  2LDU A;  2ZKZ A;  2E5Z A;  3FBI B;  1VZ0 A;  4I0B A;  2M0C A;  1T33 A;  4A6E A;  2BY1 A;  3UKG A;  2G7U A;  2HYF A;  5HDK A;  4AIK A;  3PO2 J;  4IPA A;  1MJ9 A;  2PJR A;  1I5Z A;  2ELJ A;  4KMU X;  2MC3 A;  3N05 A;  4CUG A;  3QPL A;  5KNL A;  4CCN A;  1VQ6 I;  2L5Q A;  1PUE E;  2QBY A;  2DI3 A;  4RM3 A;  1X19 A;  5IT3 A;  4F93 B;  2RV8 A;  1SFK A;  2LG4 A;  3ISP A;  2HYJ A;  3LSI A;  3BCA A;  5DS9 A;  3LOC A;  2HDD A;  3GFM A;  2HOT A;  4EAT A;  5JHU A;  5EEG A;  3JSO A;  2XAU A;  1ETO A;  2HKX A;  5AIP A;  5CJ9 A;  3I4M J;  4M9S A;  4U7B A;  1E0E A;  2CRG A;  1RPW A;  4ZTJ A;  2MW8 A;  4ZJZ A;  3MEX A;  3WTS C;  4MFE A;  4RGU A;  2LMD A;  1MMN A;  2MD5 A;  3WGH A;  4D9J A;  4F7Z A;  3GX4 X;  3F21 A;  1XGN A;  2EH3 A;  1OIS A;  3RJP A;  4C2U A;  2P6S A;  3GTJ J;  5HLT A;  4HYE A;  1W5T A;  3C18 A;  3DBR B;  3O6B B;  2R5Y B;  1IN7 A;  4E70 A;  3CMM A;  2X6Y A;  3DBL B;  1IXR C;  2ZBK A;  5LHG A;  1S5L C;  4LJZ F;  1YYV A;  4F91 B;  1R23 A;  5D6E A;  2AXT C;  1WVR A;  2VT3 A;  3ABM H;  3BJ6 A;  3HSF A;  1FLI A;  3F6V A;  1YJ9 I;  3BG9 A;  4CSW A;  1E17 A;  3E5U A;  2JA6 J;  4PZJ A;  2ISY A;  1QU3 A;  1I3A A;  1ZGA A;  1PYV A;  1SC7 A;  1K61 A;  3BOQ A;  1K4T A;  5F64 A;  2DK8 A;  4G9Y A;  5HOD A;  3N4M A;  4LD5 A;  2M3A A;  3BG6 A;  2MYS A;  4I98 B;  4XOR A;  2VQG A;  2XHK A;  2EV0 A;  2P8T A;  3QOD A;  2X9D A;  3LSR A;  4KFC A;  3GTP J;  1YI2 I;  2L01 A;  2VKD A;  5LFA A;  3OYH A;  1EA3 A;  2JSC A;  5E79 C;  3L2V A;  1WRJ A;  1WJB A;  2HWV A;  2QQ8 A;  1SEU A;  1JGS A;  2CG4 A;  3OY9 A;  3MKY B;  2FNA A;  5F0C A;  4HNV A;  3JRA A;  1GUU A;  3V4G A;  3WE2 A;  2GXB A;  5J47 A;  1SMT A;  3KP2 A;  5GAE J;  3K2Z A;  1N78 A;  3NEU A;  3K4K A;  3HOV J;  3HTU A;  4L9T A;  3HSE A;  3WG9 A;  3CO6 C;  1Z05 A;  2WAQ A;  2W24 A;  1XG1 A;  2GM4 A;  4GXO A;  3KCC A;  1POG A;  4LGW A;  4L5I A;  1O3Q A;  2L9S A;  3M8F A;  1DU6 A;  2JMW A;  4YIF A;  2K7L A;  5FRM A;  4Y17 A;  3ZN1 A;  3GME A;  1UHM A;  1O3S A;  1D8J A;  1Z0X A;  4LG0 B;  1OYY A;  1YW9 A;  1U3E M;  3MFK A;  2NYX A;  1X1A A;  4HX8 A;  2UWM A;  2EZL A;  2A6E F;  2QUF A;  2ZB9 A;  3RCO A;  3P9I A;  3PM1 A;  5H6R A;  2PMZ A;  2ESH A;  3GEZ A;  3V7C A;  1JUM A;  1KU3 A;  4BHC A;  5K7H A;  5BQT A;  5DV5 A;  2WAE A;  2W00 A;  1MMA A;  2E60 A;  5JI6 A;  5LBQ A;  1QPI A;  5GPA A;  4E7Z A;  3C2H A;  1IO2 A;  1IRZ A;  1LDK B;  2HZD A;  2Y75 A;  1RI7 A;  1A6Q A;  3DLL F;  4UB6 C;  3D0S A;  1R49 A;  2X6W A;  3OMY A;  3CCJ I;  3K69 A;  2M4G A;  5JHF A;  5ILS A;  4M6X A;  4UV8 A;  2JPB A;  3WHB A;  3PSF A;  3CCL I;  5DCM A;  5M3F J;  1WZ2 A;  2GA1 A;  2L4A A;  4JYK A;  1CQT A;  1D0Y A;  4I6Z A;  1D5Y A;  1TWH J;  4J00 A;  3K4B A;  4A3L J;  5LLQ A;  2CU7 A;  3EUH A;  6PAX A;  1SFU A;  5CPR B;  2WV0 A;  1IAW A;  1HW5 A;  3OYB A;  4I99 C;  3BG5 A;  3MKL A;  4AD9 A;  1WJE A;  2V4J C;  4NC8 A;  3ZP5 A;  2JPC A;  3WE3 A;  5CVU A;  4KUM A;  5D6F A;  2GBY A;  2G0E A;  1KZH A;  4YFN F;  1VQ5 I;  4IKF A;  2LY9 A;  2LLK A;  3C3W A;  4ZDP A;  1FYK A;  2PLY A;  2PJR B;  2JJ7 A;  2LH9 A;  2CWE A;  3F22 A;  3D5L A;  4A0X A;  4AVP A;  1SD5 A;  2COM A;  2ETH A;  2KHM A;  4HAM A;  1KQ8 A;  2QBY B;  4CZC A;  2BY3 A;  2JN6 A;  3DEE A;  3K1M A;  2VLA A;  4IJA A;  4DZJ A;  1OR7 A;  2AS5 F;  3KZI C;  2XRN A;  2KQR A;  2MFZ A;  1I39 A;  5E1Z B;  3DKW A;  4XN0 A;  1ODD A;  1RC9 A;  4HW0 A;  2A6T A;  4AYB N;  4NB5 A;  2HEO A;  4LB5 A;  1NK2 P;  2PJP A;  3GUD A;  1CF7 A;  1CGP A;  2HOE A;  3C2B A;  1UEL B;  3G6E I;  1YJW I;  4DBR A;  1R5H A;  2MH9 A;  2ECC A;  2EIL H;  4NHJ A;  3K1P A;  4ZYH A;  3GW2 A;  1D8K A;  4JP0 A;  1VQK I;  1Y1V J;  1JE8 A;  2ZJP F;  4UXN A;  3CJQ B;  4NC6 A;  2W85 A;  2VQL A;  2OPT A;  1YTY A;  4B1R A;  1K83 J;  4AUX A;  1ZG3 A;  2PEX A;  3MZY A;  2H1L A;  5DM6 F;  2VBW A;  3TP0 A;  3MKZ A;  2DN0 A;  2DLL A;  1RRJ A;  3M9A A;  2P7V B;  2RQP A;  3RKY A;  3LSH A;  1LDD A;  1WPK A;  4BE1 A;  1P4W A;  3CF5 F;  4LB6 B;  4M9Z A;  3LWF A;  2EFN A;  4D1Q A;  1HDD C;  1FY7 A;  2V1N A;  4EVI A;  1HXD A;  2H09 A;  4XLH A;  1J5Y A;  5F08 A;  5J3L A;  5FJ8 J;  3OYN A;  2VJ4 A;  1MH3 A;  2DK5 A;  4MQV A;  5FLX K;  4FAS D;  4BU2 A;  3ZGK A;  2K27 A;  3ZCO A;  3JRI A;  1GDT A;  4IX7 A;  3ELK A;  3CC7 I;  1S7E A;  4LMY A;  1JKR C;  4PJJ A;  2OTJ I;  3KLN A;  2P4W A;  3OOU A;  1WWX A;  3KP4 A;  4M9X A;  1Z1D A;  1AU7 A;  4PK4 A;  2R7O A;  2IXS A;  1IV8 A;  3M1E A;  5HLH A;  1GLN A;  3G71 I;  1VQ7 I;  1QO0 D;  3QYE A;  2KMU A;  2K85 A;  3FXR A;  3HOW J;  1U78 A;  1TQM A;  1Y8Q B;  3A1Y A;  5K1Y A;  3K9T A;  1QA6 A;  1EJ9 A;  3L2Q A;  5J8F A;  5HS8 A;  2XAS A;  2XPV A;  5K5O A;  2IJL A;  1UG0 A;  3RPU D;  1MD0 A;  5J40 A;  4HQE A;  2DOD A;  1WI3 A;  3RDI A;  3MMY B;  2YS9 A;  3FK6 A;  3WTV C;  2BY0 A;  1LFP A;  1HA8 A;  4RLF A;  2X1C A;  1FTZ A;  3D5R C;  2QZ8 A;  3OS1 A;  1B9N A;  1P4X A;  3AFH A;  2HOS A;  1XB4 A;  3R0J A;  2LY2 A;  1X1B A;  3JAM Z;  2CUJ A;  4P9U A;  1FPQ A;  2DMQ A;  1TT0 A;  3E6C C;  4OIR F;  3JRD A;  3CLQ A;  1FMW A;  2E7X A;  3EUH C;  4M6V A;  4UVA A;  2R0Q C;  5EG0 A;  1VQN I;  2IRF G;  2MC4 A;  2QSG X;  3EYI A;  1ENH A;  2GXA A;  3JRG A;  3WG7 H;  4G8X A;  5FB2 A;  1P7I A;  1W0T A;  3RYP A;  1VQP I;  4G94 A;  2M1B A;  3A01 A;  2EZK A;  2NVU B;  2JK3 A;  2FX0 A;  2W7N A;  2FU4 A;  3H3V K;  2FRH A;  4L9V A;  1PP8 F;  4E7I A;  3TO6 A;  3S3M A;  3REO A;  1K79 A;  2EA4 A;  4A12 A;  1RKW A;  2HXI A;  1T39 A;  3LFK A;  3CCR I;  1P9Q C;  3SHF A;  2STW A;  3JTG A;  2NS0 A;  2ELH A;  3ZMS A;  2ME0 A;  2Y0M A;  2VKV A;  1Z67 A;  3LQQ A;  1HKQ A;  4R8H A;  5EF6 A;  5DCM B;  1IRG A;  1OR7 C;  2FBK A;  4ENK A;  3GTO J;  5K5R A;  2IVM A;  4II2 A;  3U1K A;  3L2U A;  1O3R A;  2A07 F;  2P7C B;  1HW1 A;  2HS5 A;  2O03 A;  5LD2 C;  4ZYD A;  5JVG F;  1S3J A;  3I56 I;  4XK4 A;  3CUO A;  4Y33 A;  4F3Q A;  1IC8 A;  3P7N A;  1TWC J;  2CV1 A;  5ICE A;  3H5R A;  4RB0 A;  2DYR H;  1Y39 A;  1XN7 A;  2P81 A;  5D8K B;  4E4H A;  1U5T A;  4UVC A;  4XRS A;  3LAP A;  3G1O A;  3MQ0 A;  5EYR A;  2KLO A;  2M8E A;  1XSV A;  4P9F A;  3HHH A;  1SD4 A;  4II3 A;  3IWZ A;  4XKV A;  4U0Y A;  4A3D J;  1BJZ A;  1R71 A;  3A0B C;  1ERD A;  5L3B A;  3OS2 A;  1OCC H;  2VOD A;  5H20 A;  4FQG A;  1B9M A;  4BY1 J;  1U2W A;  3BY6 A;  1I50 J;  2ID6 A;  4YFK F;  1BR1 A;  1UMQ A;  1UFM A;  1XS9 A;  5FLM J;  3V42 A;  3PNY A;  1FIA A;  1RUO A;  4CA0 A;  1WHU A;  4AVZ A;  1YS6 A;  3HKZ A;  4BY7 J;  2JUG A;  1OYW A;  1A5J A;  1BM9 A;  1TQI A;  4GGG A;  2LVS A;  3T5X A;  4QTR A;  2MBF A;  5AON A;  1AKH A;  2QLZ A;  1CF7 B;  1MBE A;  1TP4 A;  1Z91 A;  5GP9 A;  2QQ9 A;  3ABL H;  2FNP A;  3CP8 A;  3S1Q J;  3WTT C;  3FMR A;  2H8R A;  2L3D A;  2X48 A;  1YW7 A;  4GRI A;  1JJ8 C;  2CUF A;  1X2M A;  2PFB A;  2CGP A;  2NVX J;  1ETQ A;  4BE0 A;  3K4J A;  2OZU A;  4ZZD A;  2VC0 A;  1W1W E;  1EF4 A;  3Q9S A;  1FOX A;  1JT6 A;  4IRH A;  5J4V A;  1GVD A;  3MWM A;  1C0W A;  4RB2 C;  1XGM A;  3B6C A;  4EGZ A;  2C6Y A;  2VT2 A;  5JVT A;  3BTJ A;  1UG2 A;  2VB6 A;  2ESN A;  3I53 A;  1ORK A;  1JKQ C;  1NTC A;  5GAD J;  1LUJ B;  1A35 A;  2CV0 A;  3OYJ A;  3O3K A;  3R4K A;  4IRG A;  2ZXJ A;  3HGY A;  2UV1 A;  2XGX A;  3C2G A;  3I58 A;  1LE8 A;  3BQY A;  3MZH A;  4PGG A;  1R58 A;  4PSX A;  4I02 A;  2X0L A;  1ZN2 A;  4KT6 A;  5ERI A;  3LFU A;  1NK3 P;  2F6C A;  4U0W A;  1RZ4 A;  5E20 A;  5E1W A;  3BC8 A;  2E7W A;  1ETW A;  1RES A;  2JVH A;  4BHB A;  2FMY A;  2W82 A;  3H36 A;  4DJA A;  1Q1V A;  3WTU C;  2EIK H;  1TC3 C;  4L18 B;  4FE4 A;  4LIV A;  1KQ9 A;  3RKX A;  3F8M A;  5BS6 A;  5FKL A;  1GT0 C;  1J75 A;  3S1N J;  1GVJ A;  2CMP A;  3TMO A;  2RKH A;  2BXZ A;  5KK1 A;  3HRM A;  3CCS I;  4N4N B;  2HTJ A;  2EFQ A;  4EM2 A;  5L3C A;  3SEQ A;  3L2C A;  3O8G A;  5TRD A;  3S2W A;  1WI9 A;  5E3L A;  1UHW A;  3LSM A;  2LSO A;  2LK2 A;  4N0B A;  4HV5 A;  4XOP A;  5B1B H;  3O8H A;  5D8L B;  3HL2 A;  3H0G J;  4JQF A;  1JXS A;  3K4M A;  3LAJ A;  2GAU A;  2GIV A;  4DIQ A;  2HDC A;  3H35 A;  3FXU A;  3T8R A;  1G6N A;  2DTR A;  1YQA A;  5E3M A;  3D5S C;  4PCQ A;  3S3O A;  1Z7U A;  2F4O B;  4M6Y A;  3PIP F;  1WH7 A;  2ZXW H;  2F2E A;  3VYR B;  4BQQ A;  2DT7 B;  3TDU C;  4L0Y B;  3I9V 2;  3OS0 A;  4KN7 X;  5LRS A;  4QLC U;  5EEH A;  2CW8 A;  2Y0S A;  3HM5 A;  3L9F A;  5EG0 B;  4HG2 A;  4CCO A;  1RIO H;  3VOE A;  3KYL A;  1V55 H;  5IY5 H;  1MDM A;  5IPA A;  3ECH A;  3ZPL A;  2OA4 A;  3GXO A;  5A2Q K;  3BZ6 A;  2A5W A;  1R22 A;  3ZQG A;  1HKT A;  2D2W A;  3BZK A;  1IN5 A;  2QQA A;  2GXG A;  4MHG A;  1U5T C;  1BR4 A;  2XVC A;  4I76 A;  1E3P A;  4E7L A;  3AL0 C;  2K4J A;  3DXJ F;  3ULQ B;  1YG2 A;  4CZZ A;  4H4K C;  1I6X A;  2IT0 A;  4G7H F;  2VIX A;  2R7F A;  3BR6 A;  3SFI A;  4E7J A;  2Z1D A;  2BYV E;  3DLA A;  2ADU A;  2LFB A;  2V9V A;  3DF8 A;  4A3I J;  3TGN A;  1SFE A;  5F1J A;  5KAF C;  4KDP A;  3DU5 A;  4OWR B;  2A05 A;  2VBX A;  4E6K G;  4ZTF A;  2QSF X;  2LKP A;  1I1G A;  1Z6R A;  1U5T B;  2OZ6 A;  3FMQ A;  2ZSI B;  2ISZ A;  1BL0 A;  1MNM C;  2DA4 A;  2G9W A;  2LP0 A;  3FBN B;  5DUK A;  5FLV A;  3IV5 A;  3E0J B;  4NC7 A;  4RMN A;  1OMI A;  4YEL A;  3HUG B;  2M7A A;  2CW7 A;  3F8F A;  4FHT A;  3ZQC A;  5IT9 K;  3HIF A;  2Z33 A;  3GTK J;  4B4C A;  1U8R A;  1LFU P;  4A3K J;  1PJR A;  1RUN A;  2H1K A;  4AM3 A;  4BHP A;  3GVA A;  5FKM A;  1JKO C;  3NWT A;  3HB9 A;  1IXS B;  3RQI A;  4HNT A;  2Z16 A;  4WF2 A;  4ENJ A;  4HQM A;  2AHQ A;  3IRR A;  2BW3 A;  2WC2 A;  2V9K A;  2XAH A;  3GCM A;  3BP8 A;  1AKH B;  2L9V A;  5HNH A;  1MKM A;  2E2I J;  2NVQ J;  1OPC A;  1R4N B;  1J2X A;  2JA8 J;  3M4O J;  4D7N A;  1WJF A;  1QVT A;  1X4O A;  3I3L A;  4RB1 A;  4FTH A;  1X1P A;  4GYG A;  4C30 A;  5HDN A;  1I6H J;  4JOM A;  2ZJR F;  3TQN A;  2D1V A;  1RET A;  3QPT A;  2L54 A;  5CVV A;  3K4C A;  3I4P A;  2QVO A;  4Y15 A;  1S29 A;  1FJL A;  1ETV A;  1FMV A;  4CIC A;  3PJR A;  4HLY A;  2VKH A;  3K0L A;  4ENM A;  3PO3 J;  3KP5 A;  4B48 A;  2IGO A;  4BDZ A;  1PVE A;  1D1A A;  2ZFU A;  1QBJ A;  2P6T A;  2OU2 A;  3BZC A;  4RAG A;  1DP7 P;  5ICC A;  5FD6 A;  3VWB A;  1KYW A;  5A2Q Z;  2WB1 A;  2UZK A;  2Y9Y A;  1RR8 C;  4HBL A;  5H2F C;  1MZB A;  2J5P A;  4MFD A;  3BR2 A;  1FOK A;  1OJL A;  2OV7 A;  4B43 A;  2K3P A;  1ETY A;  1LE8 B;  1SFO J;  2EV5 A;  3P9C A;  1XSX A;  3EQL F;  1W36 D;  2GZW A;  2WAD A;  2I5U A;  1SFX A;  5M5Y J;  2X6X A;  1F5T A;  3NRV A;  4NNJ A;  3VSL A;  4C3J J;  3IKV A;  5JR3 A;  4F55 A;  4EJT A;  3CD6 I;  5IYD J;  3J7Y J;  3CQZ J;  5IP6 A;  1I27 A;  1WJD A;  3L2R A;  3TP3 A;  3SYT A;  4RB3 C;  1MMD A;  5E3N A;  1T6S A;  5F04 A;  1K78 A;  4OMZ A;  3DTI A;  1BR2 A;  2BZT A;  4I0A A;  1VQ8 I;  3VOD A;  3I59 A;  2RVC A;  1B4A A;  3DTK A;  3RI4 A;  2L7M P;  2KL4 A;  2DA7 A;  5EJC A;  4BGD A;  4DNC A;  2YU3 A;  1TWF J;  2K40 A;  1YW8 A;  2Q2E B;  2IW5 A;  4A3J J;  1LQ1 A;  3F8B A;  3ZR8 X;  3D1N I;  3M3Y J;  1ZGW A;  2DJI A;  2XAG A;  1G59 A;  5BMZ A;  2FBH A;  3T0Y A;  1FEX A;  2EBI A;  2IA1 A;  2B9S A;  3E3V A;  4WXH A;  2X4H A;  2R7V A;  4ANJ A;  3WHC A;  2O3F A;  1DPR A;  1ZHF A;  4KMF A;  1ZTR A;  2MLG A;  2FQ3 A;  2KDO A;  3K1N A;  5IT9 Z;  5C3E J;  1JGG A;  3OOP A;  3F3X A;  2KRH A;  1O7L A;  4KIG A;  4BXF A;  1UST A;  2LBF A;  1SD7 A;  1BOB A;  2DT5 A;  2N8G A;  1YIO A;  4L9N A;  1RKT A;  2A61 A;  3GFL A;  4PJL A;  1MDM B;  1TNT A;  2XPW A;  3HJE A;  4H0E A;  4E7H A;  3ZQH A;  3LA7 A;  1VQL I;  2E1N A;  2DMN A;  3KE2 A;  2F5F A;  1BOA A;  1IGN A;  3V8K A;  2H6B A;  4IXA A;  3S1M J;  3BTI A;  3AAF A;  2HTS A;  4EQQ A;  1WSU A;  2K4B A;  2UUZ A;  2Y31 A;  1H8A C;  1KU2 A;  4PJM A;  5L3F A;  3CMY A;  3CC4 I;  3TBI A;  2M4K A;  3S2H J;  3MAJ A;  3OR1 C;  1X58 A;  1EH6 A;  4IHT A;  3FK7 A;  5KAI C;  1D1B A;  3PNT A;  5BOX A;  2O0Y A;  2PQ8 A;  2X1D A;  2H94 A;  5BPI A;  3CDH A;  1V3F A;  1KU9 A;  5E8G A;  4A3G J;  3S3N A;  2VUM J;  3JRB A;  2FE3 A;  2Z99 A;  5CVR A;  4KT5 C;  2BOL A;  3E6M A;  2NNY A;  5K5Q A;  1MBH A;  1X3Z B;  3M1C A;  1YE9 A;  3ZMU A;  2VKE A;  5AIQ A;  3I4N J;  2LRD A;  4EV0 A;  3HEF A;  1F43 A;  3GZ5 A;  4MNU A;  4HST A;  3KET A;  2M45 A;  3BDD A;  3BJA A;  2CQ7 A;  5GPC A;  2RGV A;  4LFU A;  1B72 A;  3QU3 A;  3VFZ A;  3ZMV A;  3I5U A;  2F4I A;  1J0R A;  2VL8 A;  3PQK A;  2MLK A;  3GF2 A;  1P2F A;  3SDB A;  3CCE I;  2ZME A;  1D0Z A;  4F52 A;  1ZYR F;  1BI3 A;  3JAM K;  2JVG A;  4G7Z F;  4PUS A;  5HS7 A;  4EM0 B;  2XGE A;  4QWQ A;  2XRO A;  2BW3 B;  1YIJ I;  2QQB A;  3AG4 H;  1Y56 A;  4IF4 A;  1YX5 A;  5FKK A;  3FMS A;  1LJ9 A;  5GTH C;  3OYL A;  3TO7 A;  4R79 A;  4DZP A;  4XKW A;  2EZI A;  2HQR A;  1IDY A;  1TW3 A;  2PMH A;  5J1Y A;  4IO9 F;  3EET A;  2A69 F;  2HKO A;  4LK0 F;  2VQH A;  2KDZ A;  2DPU A;  3V8J A;  1VF9 A;  1HSJ A;  1IUF A;  1G3Y A;  3OSG A;  4BNC A;  3DTE A;  2STT A;  1XDS A;  2QGU A;  3CC2 I;  3BG3 A;  3OYA A;  3RPQ A;  1FTT A;  1WJ5 A;  2O9L A;  1S7O A;  3BPX A;  4V2G A;  3RZD J;  3Q5F A;  2DBB A;  4A3M J;  4RGX A;  4ENN A;  3FZV A;  3HBL A;  4FET A;  2E35 A;  2MH2 A;  1FZP B;  4TV7 A;  4OAZ A;  4LG3 A;  2OC6 A;  4B3A A;  2XRL A;  2LTP A;  3IC7 A;  3QOE A;  3IH4 A;  2XAJ A;  1ZRD A;  4ESB A;  1V54 H;  3HHG A;  4L5J A;  3S15 J;  1M1E B;  3HOT A;  3RTR A;  4BUP A;  3I0T A;  1YRN A;  1XC5 A;  4B44 A;  1FT9 A;  3E6D A;  4JBA A;  4A0Y A;  4UUV A;  2RNG A;  4HSR A;  3U1D A;  5B1A H;  4OU0 A;  3OYK A;  3BT9 A;  3OYI A;  4BBS J;  2Q1Z B;  2HQA A;  4CHU A;  3CTA A;  4A3F J;  2E1M C;  4B47 A;  1OYI A;  3HPG A;  1IN6 A;  1Z77 A;  1BIB A;  2JRT A;  3ZQL A;  3QU6 A;  3FIS A;  4N9I A;  1XCB A;  2GIZ A;  5E3O A;  1H89 C;  2D5V A;  1MIJ A;  2CQN A;  4PFO A;  3PIO F;  1K78 B;  2WV1 A; 
#chains in the Genus database with same CATH homology
 2DOE A;  4FQG A;  2L9V A;  2E71 A;  2K85 A;  2KIQ A;  2B7E A;  2LKS A;  2KIS A;  2DOF A;  2KZG A;  2CQN A;  2KFD A;  1UZC A;  2DOD A;  2JUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...