1AOYA

N-terminal domain of escherichia coli arginine repressor nmr, 23 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ARGININE REPRESSOR
publication title Solution structure of the DNA-binding domain and model for the complex of multifunctional hexameric arginine repressor with DNA.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1aoyA00
2D2WA 4HLXA 3RPQA 3HHHA 1F9NA 4CXFA 1OR7A 5HLIA 3W6KB 1BI1A 3QAHA 1O7FA 2HS5A 1OYYA 2IRFG 1J2XA 1G3SA 2XAHA 4HV6A 3F72A 5DCMB 5E1XA 3K0LA 1ZG3A 4O3MA 1K78B 1R58A 5D5VB 2VOOA 3WTXC 2JTVA 2RVCA 1MJ9A 1U3EM 4KN4X 5KK1A 1LVAA 2D1HA 4WXCA 1QQIA 2WTEA 3TO6A 1STZA 4IRIA 1G3YA 5E1ZB 1WKMA 4YFXF 2L01A 4NQWA 5D6FA 4AD9A 1ONVA 4P96A 1Z9CA 4S04A 1U2WA 3KP3A 1RZ4A 5D4SA 3I71A 1KU3A 3Q9VA 4HX8A 3RJPA 3D5LA 4EM0B 2UXNA 4IRGA 5HLHA 4DQ2A 3LA3A 3GO5A 3F23A 4HA8A 2RKHA 1U6GA 2WV0A 2EFNA 1IW7F 3O6BB 2KRFA 5DCFA 3BJOA 2QM3A 2GXGA 4U0WA 2V1UA 3K2ZA 4WK8F 1MKMA 3F8CA 1R5GA 1CF7B 1NHAA 4LLLA 2ESNA 3RKXA 2HQRA 3NEUA 1D5VA 5BMZA 1BIAA 4HF0A 2HOEA 2G7HA 1TBXA 1IAWA 3MQ0A 2XASA 2V1XA 2QENA 4BYYA 1J5YA 2Q0OA 4ZZDA 4KNYA 2DK8A 1BIBA 2H6CA 3F6OA 3GYHX 1RUNA 3Q9SA 3F8FA 2ESHA 3K1NA 3I58A 1MDMB 5CLSA 3FXQA 1U5TB 4KT5C 2YR2A 4LK0F 2CGPA 3OV8A 5TRDA 2O6GE 3JSOA 2OU2A 1YS6A 2P5KA 1P4AA 4HW0A 1V3FA 3P7NA 1FBUA 1JE8A 3V7SA 3C7JA 1BBYA 3KEOA 4MEYF 5DYMA 1DPRA 1FBQA 1HW1A 1HBXG 5FO5A 3BZ6A 3CO7C 3F21A 3K69A 2QQ9A 3ZMSA 1ZLJA 2DPDA 3MAJA 5J6XA 4BHBA 5F1RA 3HOSA 2F5DA 3HSFA 1XN7A 4ENNA 4NHJA 2IP2A 3BPVA 4ETSA 2QZ8A 1G4DA 4HOBA 2TDXA 2D45A 1LDJA 1IUYA 2V6CA 5ILVA 2K4BA 2FU4A 3WTYC 5K5OA 4U0YA 4CICA 2PFBA 2MH2A 3FHZA 1U8RA 5F6FA 2K7LA 4XLPF 1R23A 1MZBA 2NNNA 5E20A 5ICCA 1QO0D 1SMTA 3ZN1A 3JTGA 2COMA 3M7GA 2CW0F 5DUKA 1L3LA 3MFKA 2CO5A 2OQRA 3ABUA 4MGRA 3WGHA 3IHUA 4N9IA 4Q5SF 1TW3A 3U1DA 2LF7A 3GWZA 2FA5A 5HDNA 1XGMA 2QBYA 1E17A 6PAXA 2JT1A 5L3CA 3FF5A 3ECOA 3GFMA 1I27A 1SMYF 2BBYA 2R7DA 2PMUA 3BDDA 2JZYA 3WTVC 1QZZA 1RI7A 4AVPA 3ZMUA 1KYWA 1FYLA 2A5YB 4L9JA 2O3FA 4BHCA 2QUFA 1AOYA 2QYOA 4L18B 2FNPA 4Y17A 1YG2A 5ILSA 3I59B 3KP5A 2W85A 5K5RA 3WE3A 3HSEA 5DEQA 3N4MA 1LDKB 2HZTA 4Q47A 1DDNA 2ZMEB 3GZ6A 1T6SA 4EGZA 4KN7X 2ZO4A 1D8KA 4FX4A 3NRVA 1SD4A 2XAJA 3GW2A 3LSTA 2MLKA 1YW7A 4GO1A 3E6BA 1HQCA 1R1TA 2EFQA 4I7HA 3FMQA 5CJ9A 2XIGA 3E6CC 2VC1A 3ISPA 1H0MA 2KJCA 1BI3A 2VN2A 1FT9A 3BJAA 5LRRA 3HSRA 3D0SA 5HDKA 3I54A 1H9TA 1XDSA 3TO7A 2FOKA 2MLGA 1KA8A 1EH8A 5AIQA 2H94A 4A6DA 4KUMA 2FBKA 3HRSA 3L9FA 3BWGA 2DW4A 5HS9A 3HRTA 4G6DA 2IA0A 1B9MA 2WWYA 2GWRA 1GHCA 1O3RA 4ENMA 4I02A 3FMSA 2ELHA 1PUEE 4I0BA 1V4RA 1ZRFA 4HF2A 3PQKA 4ENJA 3H92A 5ED4A 4IVNA 5FD6A 3F8BA 2M45A 1XB4A 5H6QA 2Y75A 2ISYA 2M1BA 1RIOH 2R3SA 3R4KA 4WF2A 2IPQX 2W84A 1IRGA 3R0AA 5IT9Z 3SFZA 4A5NA 3ABTA 1IF1A 3FM5A 1W7PA 4ZYGA 2PN6A 4AWXB 1ZHFA 1IRFA 3IC7A 3DPLC 3SZPA 4RB3C 3KCCA 3FXRA 2YX7A 5HS8A 4H0EA 4PGHA 2K4JA 2JPBA 4U88A 3DPTA 3R60A 1YQAA 1PP7U 1OPCA 1TQIA 2DPUA 2ACJA 3HRMA 2ZCWA 4R79A 2OA4A 3MZYA 4EVIA 4RAZA 1LQ1A 5A2QK 2QLZA 3W6JB 4CZZA 1C0WA 2HKOA 3DV8A 3LFKA 4HLYA 1TNTA 3QP6A 5BPDA 2YPRA 2RC4A 4ENKA 2AXLA 4KMUX 4P9UA 1P6RA 3RTRA 3KP4A 2W25A 1XGNA 2VBZA 1ZH5A 4IRHA 4BH9A 3E5XA 3ZMDA 4FHTA 4ASNA 3EDPA 4R1HA 3CDHA 2Y0MA 4MTDA 2UZKA 4E70A 4N9HA 4WWCA 1HXDA 2HQNA 4A0ZA 5IT9K 4PCQA 1R00A 4NB5A 2EFPA 2ZNYA 1WI9A 3PQJA 3LAPA 1IN6A 3FX3A 1UHMA 4YFNF 1DPUA 5HLGA 3GEZA 5J8CA 2OZUA 4UVAA 2EFWA 5AIPA 3GLXA 4M71A 1T98A 1BM9A 1XGOA 5KVRA 1ZGAA 5E1WA 1B59A 1S8NA 2VODA 3CUQB 4BQAA 1S29A 4CHUA 4UNOA 1LB2A 2D1VA 1JXSA 1YIOA 4LGWA 4CGZA 1G6NA 1FP2A 1Y0UA 2EA2A 4U0VA 1UB9A 1Q1HA 4UVBA 5HS7A 3RI4A 2ZNZA 1ULYA 1WWXA 2L4MA 4KIBA 4XRFA 4EJWA 1IXCA 4ZYDA 4L5JA 1DUXC 1JHFA 5K5QA 1PDNC 2F5FA 4I2OA 3IWZA 1WSUA 1F5TA 1XSXA 1HW2A 4FX0A 2QQAA 4M9XA 5DCMA 2NAZA 3V8JA 3Q5FA 1K78A 4MHGA 1RNLA 3HIFA 3V7RA 2XAFA 2H09A 3SXYA 3GX4X 1WQ2A 2P5LC 2MC3A 4A6EA 4Q4ZF 3CO6C 4M6YA 2CFXA 3WE2A 4MQVA 4JK1X 1U5TC 3CTAA 2O03A 1B4AA 5DUIA 1T39A 3P9IA 2GQQA 1R36A 2NRAC 4MQ9F 5AONA 2P4WA 3V8KA 3QOPA 2QQBA 2FNAA 4ZZLA 1J75A 3IKTA 2DLLA 3BROA 2FF4A 3BPXA 1XSDA 2UXXA 5CVIA 3RPUA 3KLNA 2VT3A 3CUOA 3V4GA 1BI0A 3C1DA 5E17F 4WX9A 2C6YA 2EWNA 1W4MA 1LJ9A 4PDKA 2VE9A 3OOPA 1QPMA 4UVCA 1OYWA 4LB6B 2F5CA 3R61A 1FYMA 2W57A 4CO8A 2P6SA 1CF7A 5LHHA 4PGGA 1UFMA 2L4AA 2LF8A 2DFIA 2OZ6A 1BC7C 2PJPA 1FLIA 4WXHA 4RAYA 3WTSC 1D3YA 3KE2A 3B73A 3FXUA 4A0XA 1FZPB 2P8TA 3E6DA 5JR3A 3FZVA 1TQMA 1L0OC 3WTWC 1I6XA 2J5OA 2A6EF 4LB5A 1MDMA 4GCVA 2P7VB 1U5TA 3RKYA 2O0YA 3E5UA 1ZARA 2JRTA 5LBQA 5D8LB 3DXJF 2IT0A 2GZWA 4BNCA 2V9VA 2OD5A 1SFUA 4OIPF 3LAJA 3GUDA 4XLNF 1MJBA 5LRSA 2HTSA 1ZG1A 1RUOA 1R22A 4IHTA 1SD5A 4GYGA 4GYIA 3F3XA 1B6AA 1MJAA 2EA4A 3B02A 4Y15A 1ZGJA 2DO7A 5EEHA 3KP7A 2HR3A 4OIOF 4BXUA 3EYIA 4S05A 4M9ZA 3GZ5A 1P92A 2PEXA 1JGSA 1AWCA 3WODF 3WGIA 4YG2F 4A2UA 4AIKA 1ZLKA 2G7UA 4KYWA 4BAYA 1R7JA 4L0ZB 2VXZA 1QGPA 5DDGA 4EQQA 3SZTA 2ZXJA 4XBFA 2BE5F 4UXNA 3RYRA 2EB7A 2NYXA 2XKPA 1ZN2A 4KFCA 4LD5A 2F2EA 3WU0A 1XD7A 2A61A 2KKOA 3MZHA 2E1CA 3BJ6A 2M87A 4RB0A 3TOBA 3ZMZA 5D6EA 3QU6A 1SAXA 3U9GA 4EJTA 3DQVC 1O3SA 4JQFA 1W5TA 3KZYA 2OAZA 3ZQ7A 1YYVA 1QBJA 4M73A 5LEKA 2ZFWA 3RDIA 2RDPA 1XSVA 1TQPA 4D0PA 3GVAA 3HTUA 1KU9A 2HTJA 4UV9A 3DKWA 1FYKA 3HUGA 1K79A 2FXAA 4UHTA 2LSOA 2ZBKA 5ERIA 2XUBA 1FX7A 1LDDA 4HX4A 2E1NA 2RV8A 4I01A 4G9YA 3KZZA 2H6BA 1O7LA 2VBWA 1Z7UA 3I59A 1KQ8A 2P6TA 3L09A 3ZMVA 2P5VA 3V7CA 2ETHA 1SFXA 2ZMEA 3LA2A 5A2QZ 3O3KA 2PLYA 4HQMA 1QZYA 1KQ0A 3WG9A 3WU1B 3COAC 4Q48A 2YU3A 3M9AA 2K27A 1GVJA 1VTNC 4TV7A 1IN7A 1ON2A 3H3UA 1FP1D 4U7BA 1TNSA 2WC2A 1HKTA 5E18F 4Z2YA 3C3WA 4B09A 4U7DA 1OYIA 4ESFA 1J0RA 3T8RA 5TJJA 1SD7A 3ULQB 3ML6A 4A12A 1HSTA 3LA7A 4L5IA 1QNTA 5L3EA 2KIUA 4IJAA 3EUHA 5E8GA 1BOAA 2PQ8A 1XDUA 3VFZA 3WTZA 1MGTA 3ZN0A 4IXAA 4ZYEA 3FMRA 3N97A 2Z99A 1HKQA 1UCRA 5FD5A 4LG0B 1ZG5A 4B8XA 4N0BA 4O5VA 1JHHA 4RGXA 5IT3A 2VE8A 3VEPA 1IZ1A 5BPIA 3U2RA 3ZPLA 1EH6A 4OOIA 5CVUA 1IN8A 5EEGA 2LDUA 2BV6A 2XHKA 2FMLA 4Y13A 3R6SA 2XV4S 4HAMA 3MWMA 2MH9A 2B0LA 2FE3A 5JVTA 3V8LA 4AIHA 2XAGA 4G7HF 2V79A 1YTYA 4F7ZA 2RQPA 3CUQC 1TW2A 2DU9A 3EYYA 3E5QA 4LJZF 1KU7A 1FC3A 4G94A 2XROA 2LNBA 5L3GA 4OMYA 5K1YA 1K6OA 2PMHA 5H6RA 3F8MA 4L9NA 4L9TA 3TO9A 2HFHA 2GXBA 2FBIA 4HDVA 3TDUC 5D8KB 1OMIA 3F6VA 5LGNA 2A69F 1XGSA 2P7CB 4KDPA 3DEUA 3IRRA 2W24A 2DTRA 3ZP5A 3M8EA 3VB2A 1LEBA 1S3JA 4HZFA 4WXDA 4I0AA 3WGGA 4WCGA 2HKXA 2DBBA 2HYFA 4EM1A 3TQNA 2L3DA 4M72A 4L0YB 4LFUA 1FSEA 1GXQA 4EM2A 5CVJA 4HQEA 2M8EA 3E97A 3FM3A 2XRNA 3ERED 3WTUC 2ZKZA 2A3SA 1F1ZA 3K9TA 4FT8A 2E7WA 3BOQA 4QWQA 3S2WA 1ZREA 1IXSB 1SD6A 2DK5A 2EFOA 4IPAA 3LQRA 2JPCA 3NQOA 3GFJA 2ZJ2A 3DP7A 5LHIA 5LLQA 5JFRA 2M30A 3CUQA 1J7KA 2HDCA 2HYGD 1P4XA 1SFEA 4EMSA 2F5EA 3M8FA 2EV5A 1E2XA 3L7WA 2GA2A 4GXOA 5ILUA 1EV7A 2MD5A 2CG4A 1KYZA 4G8XA 4OINF 4K2EA 3L2CA 2JSCA 3QPTA 1T0FA 4KIFA 2IVMA 3I53A 2KIFA 5LEJA 4YIIA 5D5UB 4IF4A 2R7FA 2UWMA 2EV0A 1USTA 1R1UA 5D5XB 3WTTC 1A04A 1FY7A 3I0TA 5HDGA 2STTA 2GAUA 1R5HA 5E8IA 4RB1A 1O3TA 4M6XA 2PG4A 4HDUA 3PFIA 5ICEA 1Z05A 3HOTA 1R1VA 3HYIA 3O2PE 4XSZF 5CYVA 2FBHA 3I5UA 2EK5A 3MCZA 2PBIA 2HWVA 3P9CA 4KMFA 3TKYA 1G3WA 2XVCA 5F64A 3HHGA 4GGGA 4I09A 1IN4A 2J5PA 1BJAA 4A0YA 5FGMA 1FNNA 2YX4A 1ON1A 1XMKA 1O3QA 1ZYRF 1FBSA 4KIGA 1YW9A 2A68F 4P5OA 2DQLA 1YS7A 3QU3A 1P2FA 1Z91A 1WRJA 4ZH4F 2IJLA 5J8FA 5CVRA 1FPQA 2ADUA 3J80Z 5LHGA 4LK1F 2O61A 4UUVA 1YFHA 1OKRA 3T0YA 1O57A 5CVVA 4EV0A 3ZMTA 3K1PA 4PZJA 1EH7A 4ZYHA 4OMZA 2CWEA 3DF8A 4HX7A 4G6QA 3GF2A 3L00A 1REPC 2QBYB 3VOEA 1MD0A 3JSPA 3KP6A 3F22A 4MNUA 3GFLA 3R0JA 2RNJA 4EJVA 1YLFA 2L54A 1FOKA 4LLNA 1S7OA 2FMYA 5FLXZ 1XCVA 3QPHA 2VONA 3RKWA 4M9SA 5H20A 2KJBA 2VBYA 4RB2C 3RYPA 5LGTA 1HW5A 3BY6A 5FFZA 3HRUA 5FB2A 5ICGA 5FFXA 2VOPA 1ZAOA 3RIRA 3KP2A 4RGRA 3REOA 4MEXF 4UV8A 2K86A 1BN5A 1K7AA 2DI3A 5DD4A 1KQ9A 3QP5A 2Q8KA 3J80K 3KETA 3QRFF 4QLCU 3H3ZA 2PI0A 3KLOA 3T1BA 2Z33A 2X0LA 2H27A 1IXRC 2Z9OA 2GA1A 4P55A 4OU0A 3LWFA 4A5MA 1W7PD 3EQLF 4RGUA 3SQNA 2CSOA 4EJOA 2BYVE 2X4HA 1I1GA 5BOXA 3CLOA 3IWFA 4EJUA 2CQKA 1YW8A 1X3UA 3I4PA 5BS6A 5ICFA 2VBXA 2IW5A 5JI6A 2RGVA 1ZRDA 1Z6TA 1J9IA 4L9VA 1J59A 1XMAA 3GFIA 1UHWA 3CJNA 4OIRF 1S6LA 2Q2EA 2O8XA 4OIQF 5FLXK 5L3DA 3ECHA 3F8NA 1ZRCA 3ROUA 1ODDA 3GXOA 4M74A 4HV5A 1PP8F 1W5SA 2QVOA 1Z6RA 3FWEA 3KFWX 3TGNA 5DD8A 3P9KA 3K1MA 5JHUA 4CYDA 3BP8A 2STWA 4YIFA 1FSHA 3HTSB 1TLHB 2IA2A 5L3BA 1GXPA 2BEOA 2ISZA 3C18A 1B1BA 1BI2A 5D5WB 4HF1A 2A6HF 3IL2A 1W7PB 1LEAA 1USSA 3MEXA 2HEOA 1YO5C 1FWZA 2VC0A 1U78A 3J81Z 2V1DA 3KEQA 4JBAA 2DQRA 1KGSA 1T38A 2BGCA 3ELKA 3JAMZ 3JTHA 4LLGF 3E3VA 2NS0A 3E6MA 5HVQC 2FSWA 1I5ZA 3TDZC 1T2KA 3G3ZA 2Y48A 3LQQA 2A07F 1S7AA 4ON0A 3IRQA 2XKOA 4KA4A 2DAOA 5D4RA 1HKSA 4YFKF 2LKPA 5L3FA 2M5WA 1IN5A 5LGUA 1G3TA 1H9GA 1HSJA 3IKVA 1TTYA 2Z3YA 2E7XA 2VT2A 1KU2A 4CDGA 2YSRA 3VODA 3JW4A 4MTEA 3TOAA 2CYYA 2HGCA 2G9WA 2MBFA 2EV6A 4KICA 2MA3A 3G73A 2QWWA 4I98B 2IA1A 3J7AO 3M1EA 2FEZA 3I64A 4R8HA 2OQGA 4RS8A 4LG0A 2DT5A 1DP7P 4G7ZF 4RGSA 2OBPA 2RN7A 4BHPA 4O6JA 2AS5F 2NNYA 2KIMA 4EGYA 1I1SA 4ESJA 5DV5A 1Z1DA 3J81K 4P9FA 3T5XA 3EETA 3SHFA 4IHSA 4ESBA 4AIJA 2L02A 3JAMK 1XCBA 4DNCA 2XGXA 4G7OF 2GIVA 4XSXF 2FQ3A 1CGPA 1D8JA 4HBLA 4LMYA 5HOOA 2XAQA 1LNWA 3T8TA 1F4KA 5BQTA 1BC8C 2K02A 1B9NA 2Z5UA 2FRHA 1P4WA 2EJRA 3AAFA 3DFGA 4HYEA
chains in the Genus database with same CATH superfamily
1MBEA 2D2WA 4HLXA 3H0GJ 2V9PA 3HHHA 3RPQA 3RPUD 1F9NA 2HOAA 3ZQGA 4CXFA 2HVSA 1OR7A 2K85A 5HLIA 3W6KB 3OS1A 1RPWA 1BI1A 3QAHA 1ERDA 1O7FA 5IPAA 3M07A 2HS5A 1OYYA 4XLFA 5HNFA 2BY1A 2IRFG 1J2XA 4IEJA 4NC6A 1G3SA 2XAHA 4HRIA 1UG2A 3FXJA 3MKLA 2R5YA 2RREA 4HV6A 4Y52J 2F4IA 3F72A 5DCMB 5E1XA 3K0LA 1ZG3A 4O3MA 2LVSA 4PJLA 1K78B 3FHNA 1MNEA 3F9KA 1R58A 3PSIA 1RESA 2VQGA 5EZHA 5D5VB 2VOOA 3WTXC 1A6IA 2JTVA 2RVCA 1BL0A 1MJ9A 3M3YJ 1U3EM 2L9VA 3FK6A 4KN4X 3AL0C 5KK1A 1OCCH 1LVAA 2D1HA 4WXCA 3Q0WA 1QQIA 2KRHA 2VLAA 1LE8A 2WTEA 3G1LA 4C2TA 2V9KA 1STZA 3HXLA 4XLHA 3TO6A 4IRIA 1G3YA 1YE9A 5E1ZB 2DTZA 1WKMA 4M3BA 4FASD 4YFXF 2Y0SA 2L01A 4NQWA 3DU5A 5D6FA 3S2HJ 4AD9A 2EZIA 1ONVA 3HGGA 3OYCA 5J4YA 5C3EJ 4P96A 1Z9CA 2WADA 4S04A 3CCJI 1G8XA 1U2WA 1X1AA 3BCAA 4LOCA 3GTQJ 1FOWA 2Z16A 1LUJB 3A01A 3KP3A 1RZ4A 5D4SA 3I71A 3BG7A 1KU3A 1YI2I 1AKHA 2DOFA 3Q9VA 2JA8J 5FKOA 4HX8A 1RRJA 3B6CA 3RJPA 1JT0A 1QRYA 5GPAA 3D5LA 4IRGA 2UXNA 4EM0B 3K4NA 4I99C 5HLHA 4DQ2A 2IS6A 3LA3A 3GO5A 3F23A 1IJWC 5FRMA 3AL0B 1RKWA 3SJMA 1MMAA 4HA8A 4IZZA 2RKHA 4UB8C 1SFKA 1U6GA 2WV0A 2EFNA 3ASOH 1IW7F 3C2GA 4CCOA 3O6BB 5EF6A 3DBHB 2KRFA 5DCFA 2KDZA 1IDZA 3BJOA 2QM3A 1FMWA 2GXGA 1HDDC 4U0WA 2VQHA 2V1UA 3K2ZA 4WK8F 1MKMA 3F8CA 1R5GA 1CF7B 1NHAA 4LLLA 2ESNA 2KT0A 5E79C 2M4KA 3RKXA 1W5CC 4DZPA 4FISA 2HQRA 3NEUA 2BXZA 2KZGA 1D5VA 1R9TJ 3BG5A 5BMZA 2CV0A 2DFEA 1BIAA 2YUSA 4HF0A 4A93J 2HOEA 2G7HA 1TBXA 4DYRA 3GCMA 1IAWA 2QSFX 3BG9A 4D7NA 3MQ0A 2XF6A 2XASA 2OC6A 3MVPA 5M5WJ 3OYBA 3GBGA 2V1XA 2X6YA 2QENA 4BYYA 1WVRA 1H88C 1J5YA 2Q0OA 4ZZDA 4KNYA 2B63J 2DK8A 1UG0A 2XSDC 1IV6A 4XLCA 1BIBA 2H6CA 3F6OA 4JX6A 3GYHX 3Q9SA 1RUNA 3F8FA 2ESHA 3K1NA 4LIUA 3CMAI 3W3CA 3I58A 3FISA 1U0JA 5CLSA 3FXQA 1MDMB 3H3VK 1U5TB 4KT5C 4BQQA 5KAFC 3PUFA 2GLOA 3QOEA 4E7IA 4BE1A 1BR1A 2YR2A 4LK0F 3PO3J 1HLVA 2CGPA 2VKEA 3LSPA 3OV8A 5TRDA 2O6GE 5E3OA 2H8RA 1QVTA 2OU2A 4FQGA 3JSOA 1YS6A 2P5KA 1VFCA 1ETKA 1P4AA 3RQ4A 4AIDA 4D5CA 4HW0A 1V3FA 2ID6A 3P7NA 5GAHJ 1FBUA 3NWTA 4H4KC 1JE8A 1D0ZA 2WAEA 2CV1A 1MMGA 3V7SA 3DLAA 1DGRM 9ANTA 4XKBA 3C7JA 2M0CA 4D5FA 2W00A 1BBYA 3KEOA 2VKHA 4MEYF 5DYMA 4DJAA 4M6VA 1DPRA 1FBQA 1HW1A 1HBXG 5FO5A 3WG7H 1N75A 2XB0X 3BZ6A 3CO7C 3F21A 3K69A 2QQ9A 1YJNI 4A3FJ 2NVXJ 3ZMSA 1W0UA 2XF7A 1ZLJA 2DPDA 2L7FP 3MAJA 3MZ8A 1TC3C 5J6XA 3BLYA 4BHBA 1MNDA 5F1RA 2GXAA 3HOSA 4IHYA 2F5DA 3HSFA 3ZXSA 4B47A 1XN7A 2KISA 4XIDA 4ENNA 4NHJA 2IP2A 2R92J 3BPVA 3DKYA 3DTEA 2QZ8A 4ETSA 5DS9A 4HOBA 1G4DA 2TDXA 2D45A 4E7SA 1LDJA 1IUYA 2V6CA 2ZXWH 2LY2A 5ILVA 1K4SA 1W0TA 2BHYA 2K4BA 3CCSI 2E19A 2FU4A 1HDPA 3WTYC 2A6TA 2E1OA 4XOPA 4BL0B 2XRLA 3TP0A 5K5OA 1OLTA 4U0YA 4CICA 1Y1WJ 1MMSA 2PFBA 4X6AJ 2MH2A 3FHZA 3EUAA 5LFAA 1U8RA 1MSEC 2E5ZA 3ABMH 5F6FA 4UUSA 2K7LA 3PNYA 1X58A 4MLOA 4HNUA 2DDBA 4XLPF 2IS2A 2DJIA 1R23A 1R4MB 1WPKA 1MZBA 2OCEA 3OYLA 2NNNA 5E20A 2JK3A 5ICCA 1QO0D 3K4BA 1IGNA 1SMTA 3ZN1A 2X6WA 1N78A 3JTGA 5EGOB 2COMA 3MKYB 3HPGA 4Y4RA 3L2WA 3JR9A 2L7KA 3M7GA 2CW0F 5DUKA 1L3LA 3MFKA 1X19A 3H5NA 2IEKA 2XGDA 4BGDA 2CO5A 2OQRA 2VJIA 3A0HC 3ABUA 4MGRA 1VNDA 2GOMA 4XK4A 3WGHA 1TT5B 3IHUA 4N9IA 4Q5SF 1TW3A 3U1DA 1KONA 2LF7A 1B72B 3CMEI 3GWZA 3CCVI 1QHHD 3HM5A 3KYLA 2FA5A 5HDNA 1XGMA 1BW6A 3W6VA 2QBYA 5EJCA 4BE2A 1E17A 2BW3B 6PAXA 2JT1A 3FK7A 2HDDA 1RR7A 3Q0VA 5L3CA 1VQPI 1JKRC 3FF5A 3ECOA 3GFMA 1I27A 1SMYF 3OL3A 2DOAA 1X2MA 2BBYA 1TZLA 1WI3A 3JRBA 2R7DA 1UZCA 2PMUA 3S3OA 3BDDA 2JZYA 2DXIA 1GVDA 3WTVC 1VQLI 1QZZA 3HUGB 5K7ZA 3M1CA 4J01A 1RI7A 4AVPA 3CESA 4BY1J 3ZMUA 1KYWA 1FYLA 2HYJA 4M3EA 4BS9A 3D1NI 2XC7A 2A5YB 4L9JA 4C3HJ 3BQYA 2O3FA 4BHCA 2QUFA 1AOYA 3O8GA 2QYOA 4L18B 2FNPA 4Y17A 1ETYA 1YG2A 3CF5F 4DYQA 3UKGA 5ILSA 3I59B 3KP5A 4DYCA 3PIOF 1TWGJ 3OIPA 2W85A 5K5RA 2JA2A 3G1OA 3IV5A 3WE3A 1SVLA 2JUCA 3HSEA 5DEQA 3N4MA 2BXYA 2CQXA 1E3HA 1LDKB 1A31A 2HZTA 4Q47A 1DDNA 4RM2A 3IAM2 1RC9A 2LH9A 2ZMEB 5B1BH 4BQOA 3GZ6A 1T6SA 4E4HA 4EGZA 4KN7X 3PSFA 3L2QA 3OYMA 4A3GJ 2ZO4A 4XKVA 2JVGA 3ZR8X 1MH3A 1D8KA 3NRVA 4FX4A 1SD4A 2XAJA 3GW2A 3LSTA 1X3WB 2H1LA 2MLKA 1BOBA 2LLKA 1YW7A 4GO1A 1K4TA 3E6BA 1HQCA 2E1MB 1R1TA 2EFQA 2DFHA 4I7HA 2LY9A 4IKFA 4V2GA 3FMQA 5CJ9A 5CQEA 2XIGA 1FTTA 3E6CC 3CJTB 2VC1A 2F6CA 4AC0A 2X6XA 3S14J 2CS3A 2JN6A 1CQTA 1WFXA 3ISPA 1H0MA 1GDTA 4U87A 2KJCA 2HU9A 2R5ZB 4ZTJA 1BI3A 2VN2A 1FT9A 3BJAA 5LRRA 2XPUA 1A6QA 1I50J 2Y30A 4IOAF 1XTAA 4DW6A 2HOTA 3BTJA 3HSRA 3D0SA 5HDKA 4NC7A 1I6HJ 3I54A 3BG3A 1OCZH 1R5ID 1H9TA 4HPQA 1XDSA 2VI6A 3TO7A 2LBFA 4CYCB 2FOKA 2LG4A 2DA5A 2Y9YA 2MLGA 3PUBA 1KA8A 4B4CA 1EH8A 3OIQA 2H94A 5AIQA 4KUMA 5FKMA 2FBKA 2LY1A 3HRSA 3L9FA 2L9SA 3NAUA 4A6DA 2HI3A 3BWGA 2DW4A 1TP4A 5HS9A 3HRTA 4G6DA 2IA0A 3S32A 2CQNA 2Z1DA 1B9MA 2WWYA 4C2MJ 1VQ9I 2GWRA 3BT9A 1I3AA 1GHCA 1O3RA 2B9SA 4ENMA 3TEDA 4I02A 4CCKA 1MW7A 3MN2A 1WJCA 2DA1A 3FMSA 1V5EA 1WH5A 1PUFB 2ELHA 1XC5A 1ETVA 4II3A 4I0BA 1PUEE 1V4RA 1ZRFA 4CCJA 4QPQA 4HF2A 3QPLA 3PQKA 3DBRB 4ENJA 3H92A 5ED4A 2ZXHA 1VQ7I 1DP3A 4IVNA 4QSHA 2CQQA 2BY2A 5FD6A 3F8BA 2M45A 1WJEA 1XB4A 5H6QA 2BY0A 1Y8QB 2Y75A 3MKWB 2ISYA 2LYCA 2M1BA 1RIOH 2R3SA 4ZC3A 3R4KA 4MIMA 4WF2A 2IPQX 2DMUA 2W84A 1MMDA 1IRGA 3PNTA 3R0AA 2JA5J 1S7EA 5IT9Z 5JLWA 3QQAA 4XM3A 1UELB 3SFZA 2QEXI 1VQMI 4A5NA 3IUOA 3OS0A 4CCLA 3ZCOA 3ABTA 1PYVA 1JKQC 3ZOBA 1IF1A 3A4CA 3DLLF 3FM5A 1W7PA 4ZYGA 2PN6A 4XNFA 4AWXB 1ZHFA 4XRSG 1IRFA 4AUXA 3IC7A 3DPLC 2COBA 3SZPA 4RB3C 3KCCA 3I9V2 3FXRA 2YX7A 5HS8A 2I8DA 4H0EA 4PGHA 2K4JA 2JPBA 3ZQCA 2M7AA 4U88A 2QCOA 3DPTA 1MBGA 3R60A 1P7JA 3PL8A 1MNMC 1YQAA 5CQGA 1PP7U 1OPCA 2MG4A 3GLLA 1TQIA 4AYBN 3C2BA 3BZKA 4F91B 2DPUA 2ACJA 3HRMA 1JJ6C 2ZCWA 4XOTA 4R79A 1XG1A 2OA4A 3MZYA 4P1WA 4EVIA 2V26A 4RAZA 2KQRA 3CDLA 3CC2I 1YX5A 2HDWA 2E34A 1LQ1A 3H5RA 1UHSA 1E0EA 5A2QK 2K9MA 2QLZA 3W6JB 2VL8A 4CZZA 3JREA 1C0WA 5GAEJ 2HKOA 3MD2A 1MBKA 3DV8A 1ORKA 3LFKA 1JUSA 3VYUB 3H9GA 4HLYA 1TNTA 3QP6A 5J40A 3D5SC 5BPDA 2KHMA 2YPRA 2RC4A 3FBIB 4ENKA 2AXLA 1IUFA 4KMUX 3ZQIA 4NBQA 4AYBA 4P9UA 3RZOJ 2NVYJ 1P6RA 2HPIA 3RTRA 3KP4A 1QVUA 2W25A 3PIPF 2N8GA 3SDBA 3OYNA 1XGNA 2VBZA 1HA8A 1ZH5A 4IRHA 4BH9A 3E5XA 1OJLA 2UUZA 3ZMDA 5GADJ 3I3LA 4FHTA 4ASNA 3EDPA 4R1HA 3CDHA 1D8JA 2Y0MA 3OYEA 4MTDA 2UZKA 1ZGWA 4E70A 4A3KJ 1XPXA 4N9HA 4PK4A 3A2KA 4WWCA 4RA2A 5H2FC 4CA0A 1HXDA 2HQNA 3VSLA 4A0ZA 3K6GA 5IT9K 4PCQA 2CH0A 1R00A 4NB5A 2K9NA 2EFPA 2ZNYA 1WI9A 3N05A 3BG6A 3G4SI 1I3QJ 3PQJA 3LAPA 4BACA 5GP9A 3FXMA 3CJRB 1IN6A 1J09A 2KFDA 3FX3A 4EATA 2JSPA 5HODA 1UHMA 4YFNF 3CC4I 1QZEA 1DPUA 5HLGA 3GEZA 5J8CA 1Z3XA 2OZUA 4UVAA 2EFWA 5IP7J 2FQ4A 5AIPA 3GLXA 4M71A 1T98A 1BM9A 1FEXA 2ZXIA 5GTIC 1XGOA 1R71A 5KVRA 1ZGAA 3BR1A 5E1WA 1B59A 1S8NA 2CUEA 3GZNB 2VODA 4IX7A 3CUQB 2EZHA 3G1MA 2KL4A 4BQAA 1S29A 3L2RA 2EZKA 1MBHA 2QGUA 3CC7I 1YRNA 4CHUA 4UNOA 3L2UA 1LB2A 2D1VA 3NARA 1JXSA 1YIOA 4LGWA 3HC7A 3E0JB 4CGZA 1G6NA 2CRGA 4HNTA 1FP2A 1Y0UA 2L0KA 4V19K 2EA2A 4RLFA 4U0VA 4IHXA 1UB9A 1OCPA 1Q1HA 1ZR4A 4UVBA 4UB6C 5HS7A 2MYSA 2OTJI 1D5YA 1ZKGA 1ZQ3P 4FETA 2BY3A 3FBNB 3RI4A 2ZNZA 4JOMA 5IYBJ 3GMEA 1ULYA 1RR8C 1WWXA 2L4MA 1MIJA 1B8IA 1GV2A 4HSTA 4KIBA 5J1UA 1NG7A 4XRFA 5KAIC 5GAGJ 4EEFG 4EJWA 1WCMJ 1IXCA 3WU2C 4ABZA 2F4MB 4ZYDA 2LKXA 1XS9A 4L5JA 1DUXC 2LP0A 1JHFA 5IP6A 3OYJA 4FCYA 1T8IA 2GM4A 5K5QA 1PDNC 2X85A 4IO9F 2F5FA 4I2OA 3CP8A 3IWZA 1WSUA 1OCRH 3OY9A 1F5TA 1XSXA 5HNHA 4FX0A 1HW2A 2QQAA 3VSKA 4M9XA 2XPVA 2P0WA 2L7MP 4C3IJ 4Z6YA 5DCMA 3OYKA 3OR2C 2NAZA 3HZJA 3V8JA 4IQJA 3Q5FA 1K6YA 1K78A 4W1UA 1IRXA 2KDOA 4MHGA 1RNLA 2LC2A 2IGNA 2DMQA 3HIFA 3V7RA 2O7OA 2XAFA 2YS9A 2H09A 2LD5A 1OQYA 2DOEA 3SXYA 3GX4X 1WQ2A 2P5LC 5M3FJ 2E36A 2MC3A 4A6EA 3JRGA 4Q4ZF 3CO6C 5GPCA 1ACIA 3G6EI 4F93B 2EIJH 2CFXA 4M6YA 2XPWA 3WE2A 4MQVA 4JK1X 2R7SA 1U5TC 2R0QC 3L2VA 1D0YA 3CTAA 1LFPA 2O03A 3HOXJ 2MFZA 1JI8A 1B4AA 3PNVA 5DUIA 1T39A 2EIKH 3P9IA 2GQQA 1R36A 2NRAC 4MO7A 4MQ9F 2OF7A 2K40A 1GLNA 5AONA 3J7AY 1IC8A 2E5NA 4BY7J 4DOZA 1JKPC 2P4WA 3V8KA 3PJRA 3CCRI 3QOPA 2QQBA 2FNAA 3CD6I 4ZZLA 1J75A 2MGQA 3IKTA 2JMWA 2PJRB 2IS1A 1IRZA 2DLLA 3BROA 4F92B 2FF4A 3BPXA 1AA7A 2CW8A 3GTJJ 1XSDA 1WJ5A 4RDUA 2UXXA 2Y2ZA 5CVIA 3RPUA 3KLNA 1YX3A 2VT3A 4A3BJ 2ID3A 2X48A 3CUOA 3V4GA 4J19A 2IS4A 1BI0A 1A36A 1W36D 3CCYA 3W2WA 3C1DA 5E17F 4WX9A 2C6YA 5IOZA 2EWNA 2A5WA 1W4MA 1LJ9A 1OISA 2VJJA 1BA5A 4HEA2 4PDKA 3CDIA 2VE9A 3OOPA 1QPMA 4UVCA 1OYWA 4LB6B 1XMXA 4B3AA 3VYTB 2F5CA 2A05A 3R61A 1FYMA 1X3ZB 2W57A 5DTDA 4CO8A 2P6SA 1GV5A 3KIOA 2E2HJ 1CF7A 5LHHA 4PGGA 1UFMA 2L4AA 1W36C 3HOWJ 2QKLB 2LF8A 2NOGA 2DFIA 2OZ6A 1W1WE 1BC7C 4IHWA 3HB9A 1VQ8I 2PJPA 1FLIA 4WXHA 3K10A 1EKEA 4RAYA 3GTGJ 3WTSC 1D3YA 3KE2A 5JLXA 2AO9A 3OSFA 3B73A 4F52A 3FXUA 4A0XA 1FZPB 4A3DJ 2P8TA 3E6DA 5JR3A 2CMPA 1VQ4I 2E2IJ 3FZVA 4E7JA 1TQMA 1L0OC 3WTWC 1I6XA 2J5OA 2A6EF 1Y6IA 2XSJC 4LB5A 1M1EB 2M0MA 2LFBA 4N4OB 3PO2J 4JX4A 3HBLA 4YIRX 1MDMA 4GCVA 2FOWA 2P7VB 2R7VA 1U5TA 3RKYA 2RNGA 2O0YA 3E5UA 1T95A 1ZARA 2DCEA 1T33A 2JRTA 5LBQA 3RCOA 5D8LB 4AM3A 3BZCA 3DXJF 2IT0A 3A0BC 3H5AA 2GZWA 2PX9A 1UAAA 4BNCA 1DGWY 1Y56A 2OD5A 2V9VA 4XMYA 1SFUA 4OIPF 3LAJA 3AG1H 3GUDA 2R7WA 4XLNF 4XN0A 1MJBA 5LRSA 2HTSA 5J4VA 3W2AA 4DZJA 1ZG1A 1RUOA 1R22A 4IHTA 3DKXA 3BQZA 1SD5A 3LSMA 4S0HB 2VIXA 4GYGA 4GYIA 3F3XA 2IXSA 4PJ0C 4YELA 1B6AA 1MJAA 2EA4A 3B02A 3LL7A 4Y15A 2DMNA 2HZDA 1G59A 1ZGJA 4L5EA 5FROA 4XKWA 1JGGA 2DO7A 4BXXJ 1WH7A 3S8PA 5EEHA 4FE4A 3S15J 2OJED 2LREA 3OYAA 3KP7A 2HR3A 2JA6J 1SEUA 4OIOF 5C4XJ 4BXUA 3EYIA 4S05A 2WB1N 2DN0A 3K4JA 4M9ZA 3S2DJ 2HXIA 3GZ5A 4D9JA 1P92A 1KZHA 2PEXA 1JGSA 4C2UA 1AWCA 3CCUI 5E3NA 2ZMEC 3WODF 3WGIA 2BVMA 4YG2F 1ZTRA 4IQ4A 4A2UA 3O8HA 4YEJA 3RSNA 4AIKA 1ZLKA 1R4NB 2G7UA 4KYWA 4BAYA 2WY7Q 1R7JA 1T56A 1HCRA 4L0ZB 2VXZA 1QGPA 2WAFA 2TRTA 5DDGA 4EQQA 3SZTA 2VPLA 3E7LA 3OYFA 1JTXA 2E1MC 2ZXJA 4XBFA 2BE5F 4UXNA 3RYRA 3TP3A 2EB7A 1X4OA 2NYXA 4AVZA 2JQ7A 4E7KA 2ZSIB 2XKPA 1H8AC 1ZN2A 2WB1A 3TBIA 3ONQA 3LSGA 1LKXA 1FJLA 5EG0B 4KFCA 4LD5A 2R7RA 4A3EJ 1OCOH 5EGOA 2F2EA 3V42A 1VQKI 2HOSA 3WU0A 3S1RJ 1XD7A 2A61A 2KLOA 2KKOA 1TL8A 3MZHA 2E1CA 5B5EC 3BJ6A 2M87A 5K7HA 1Y39A 2Q2EB 4RB0A 2WBMA 3TOBA 3ZMZA 1JTYA 5D6EA 3QU6A 5LD2C 1SAXA 3U9GA 4EJTA 3DQVC 4Y33A 4E7ZA 1O3SA 1B72A 3BC8A 1AU7A 1ZR2A 4JQFA 1W5TA 2PMZN 2X6OA 3KZYA 3HGYA 3I56I 2MC4A 2OAZA 2JUGA 3ZQ7A 5FLVA 1YYVA 5IOYA 4M73A 1QBJA 1FIAA 3EUHC 5M5XJ 2BW3A 5LEKA 2JVHA 4FE7A 1V5GA 2NOJB 2ZFWA 3RDIA 2RDPA 2R7QA 4BJ5C 2DYRH 1XSVA 5JHFA 2LRDA 3A1YA 4CUGA 1TQPA 1IV8A 5B66C 3ZQLA 4D0PA 3GVAA 2VKVA 3HTUA 1KU9A 1PJRA 3IH2A 2HTJA 2ZFUA 4UV9A 3DKWA 1FYKA 2JWTA 5FRNA 2AQEA 3HUGA 3HL2A 1K79A 2FXAA 4UHTA 3S16J 2LSOA 2ZBKA 1Z77A 5ERIA 2PMZA 2XUBA 1FX7A 4D1QA 2R7OA 1LDDA 4HX4A 3HOUJ 1N25A 2E1NA 2QQ8A 3VDXA 2RV8A 4I01A 5C4JJ 1JUMA 4G9YA 2GOXB 4PJJA 3QYBA 3DTKA 4B44A 3KZZA 2H6BA 1O7LA 2VBWA 1Z7UA 1ETXA 3I59A 2W48A 1KQ8A 3QWLA 4J00A 2P6TA 3L09A 3ZMVA 5B1AH 4DBRA 2P5VA 2NS7A 3MMYB 3V7CA 2ETHA 1GUUA 1UJ8A 4HG2A 1SFXA 4BEHB 2ZMEA 2LR8A 3LA2A 5A2QZ 3O3KA 4II2A 1JKOC 2LKSA 1SAUA 1APLC 5F27A 4HQMA 1QZYA 1KQ0A 3WG9A 3JRCA 2PLYA 2YU9J 3WU1B 3COAC 2JA7J 4RMNA 1V5FA 2CW7A 4Q48A 2YU3A 3M9AA 2K27A 1YITI 1GVJA 1VTNC 1IDYA 1IN7A 4TV7A 1Z67A 2QSGX 3GTLJ 1ON2A 3H3UA 1FP1D 2DDAA 4U7BA 3CMYA 1FTZA 4CSWA 2F5VA 2QSHX 3ZGKA 3ESWB 1TNSA 2WC2A 5J3LA 3ZQFA 4PJMA 4B43A 3S3NA 2MABA 1HKTA 4E6KG 1QU3A 5E18F 4ZDOA 4Z2YA 2ZJRF 5IYDJ 3C3WA 4B09A 4U7DA 2R5ZA 1OYIA 2VQCA 4ESFA 2I10A 3BR6A 1J0RA 1F43A 2VUMJ 3T8RA 2W7NA 5TJJA 1SD7A 3ULQB 2UV1A 3ML6A 2EINH 4A12A 1HSTA 2NXNB 3LA7A 1TWHJ 5F0CA 3LSIA 4L5IA 1QNTA 1TWCJ 5L3EA 2JRMA 4CYCA 2RAEA 3WHCA 1HOMA 2KIUA 4IJAA 2DA3A 2WAQN 4RAGA 4PSWA 2NVTJ 3EUHA 5E8GA 1BOAA 2PQ8A 1XDUA 3IAS2 3P5JA 3HKZN 1EA3A 1E3PA 3VFZA 2IAIA 3CF2A 4C3JJ 3WTZA 1MGTA 3ZN0A 4IXAA 4ZYEA 3HDDA 3FMRA 3DTIA 3H35A 3N97A 2Z99A 1HKQA 1UCRA 2VJ4A 2VPRA 5FD5A 4XRMA 5C44J 2L9NA 4LG0B 1ZG5A 4B8XA 2K3FA 1PUFA 3D5RC 2W82A 3BTLA 4NDLA 4M3FA 3LFUA 2XDVA 3L1PA 3JRFA 1OR7C 4N0BA 3IP4B 3ZQQA 2V7FA 4DGWB 4O5VA 1JHHA 4AU7A 3J7YJ 2BZTA 3RZDJ 4OAYA 4RGXA 5IT3A 2VE8A 3LOCA 3VEPA 1IZ1A 2E71A 3U2RA 5BPIA 3ZPLA 2IGMA 2FUG2 1EH6A 4OOIA 5CVUA 1IN8A 5EEGA 2LDUA 4BXFA 4NNJA 2BV6A 3SFIA 2XHKA 3LSJA 2FMLA 4Y13A 2VKDA 3R6SA 4DIQA 2WY8Q 2XV4S 4IOCF 4HAMA 3SEQA 3MWMA 2AQFA 4IL6C 2MH9A 2B0LA 1BR4A 3A03A 2FE3A 5JVTA 3V8LA 4AIHA 2W1OA 2XAGA 2FD5A 2X9DA 4JX5A 5B3SH 1U9NA 4G7HF 2XF5A 2V79A 1YTYA 4F7ZA 2XB5A 2DYSH 5FKKA 3HJEA 2VJ5A 4ITVA 3S3MA 2RQPA 3CUQC 4BDZA 4KITB 1QPIA 3NWSA 5M5YJ 3S17J 3RQIA 1NG6A 1TW2A 2GBYA 2DU9A 3EYYA 3CJQB 3CMMA 3E5QA 1WJFA 3HOZJ 4LJZF 2R7XA 1KU7A 2HPMA 1FC3A 1Z0XA 4G94A 3M4OJ 2XROA 2LNBA 5L3GA 1MH4A 4OMYA 5K1YA 1K6OA 3VYSB 2PMHA 2ICWG 5H6RA 3F8MA 1GT0C 4L9NA 4L9TA 1FMVA 4LG3A 2R5YB 2WA0A 3TO9A 2HFHA 2E60A 2GXBA 2FBIA 4HDVA 1LVKA 3TDUC 5D8KB 2DODA 1OMIA 3EUKL 3F6VA 3KPHA 5LGNA 2A69F 4XONA 1XGSA 3BR0A 1OFCX 1I39A 4E7HA 1X1BA 2NS8A 2P7CB 1Y0NA 1T0FC 2CJJA 2IGOA 4KDPA 3DEUA 3IRRA 4HSRA 2CUJA 2W24A 4XRSA 2CU7A 2DTRA 3ZP5A 3M8EA 3U1KA 3VB2A 1LEBA 1UMQA 1LE8B 1S3JA 4HZFA 1VQ5I 4BBRJ 1Y8RB 3CCLI 4WXDA 4I0AA 3WGGA 4WCGA 2HKXA 2DBBA 1WJAA 2HYFA 1BJZA 4EM1A 3TQNA 2L3DA 4M72A 1D1BA 4N4NB 4NQWB 3DEEA 2Q1ZB 4L0YB 4G6TB 4LFUA 1FSEA 4V2FA 2QA4I 1GXQA 4G12A 4EM2A 5CVJA 2X1EA 4HQEA 2K9QA 2M8EA 3E97A 3FM3A 2XRNA 3ERED 2Y0SN 3WTUC 3A01B 1JJ8C 2ZKZA 2A3SA 1F1ZA 1AKHB 3K9TA 5FLMJ 4FT8A 2E7WA 3BOQA 5DM6F 4QWQA 1RKTA 3AG4H 3S2WA 1ZREA 1IXSB 3M8JA 3OYGA 1SD6A 2DK5A 2EFOA 4BUPA 3H9JA 3LQRA 1V55H 4IPAA 2MD0A 1VQ6I 4B48A 1NK2P 2JPCA 2OTLI 1YJ9I 3NQOA 3A02A 3GFJA 2ZJ2A 3DP7A 5LHIA 5LLQA 5JFRA 4BQNA 2P81A 3AG3H 2EPFA 3K2AA 2M30A 3CUQA 3UNGC 3K4KA 1ZK8A 1J7KA 2HDCA 2HYGD 1V54H 1P4XA 1SFEA 3CQZJ 4BDYA 4XLEA 1WJDA 1MMNA 1ENHA 4EMSA 2F5EA 3M8FA 4RBOA 2EV5A 1E2XA 1VQNI 4OAZA 2O5RA 3L7WA 2GA2A 3J7ZI 4GXOA 1POGA 5ILUA 2GIZA 5K7FA 1EV7A 4C9YA 2MD5A 1S5LC 3MKZA 2CG4A 1KYZA 4G8XA 4OINF 3BTIA 3OYDA 2ZC2A 2CUZA 3OL4A 5KCMA 4K2EA 3L2CA 2JSCA 5F08A 2HQAA 1VZ0A 3QPTA 1T0FA 4KIFA 5E3LA 5GTHC 2IVMA 3I53A 2KIFA 5LEJA 4YIIA 5D5UB 3LNQA 4IF4A 1G2HA 1FOXA 1ETQA 2R7FA 4Y7NJ 2UWMA 1LFBA 2EV0A 3I4MJ 3TMOA 1USTA 3CP2A 1R1UA 2LTPA 5D5XB 3CCMI 3BR5A 3WTTC 3VPRA 3S93A 2D5VA 1A04A 2EQRA 1FY7A 3G71I 2QKMB 4OWRB 1S9HA 3I0TA 1RETA 5HDGA 2E35A 5EYRA 2STTA 2GAUA 1R5HA 2EH3A 2CV2A 1F36A 2XAUA 3IH4A 5E8IA 4RB1A 2K5CA 1O3TA 4M6XA 1E3OC 2Z2SB 2PG4A 4HDUA 4LIVA 3PFIA 2V6EA 5ICEA 1D0XA 2OPTA 1Z05A 1FIPA 2Y9ZA 1QA6A 3JCUC 1YJWI 3OOUA 3HOTA 1R1VA 3HYIA 3W2VA 3O2PE 4XSZF 5CYVA 4M3GA 1T08B 2FBHA 3TL4X 5EEAA 3QYFA 2O8KA 4MFEA 3I5UA 2EK5A 1MBFA 1U9OA 3OS2A 4UY8I 4BKXA 2M9HA 1DU0A 3MCZA 2PBIA 4XR6A 2HWVA 4ZDPA 3LMMA 3P9CA 3UR3C 2L5QA 3FDYA 4KMFA 2Y69H 4X0GA 2ME0A 3TKYA 1G3WA 2XVCA 1WJBA 5F64A 1VQOI 2PJRA 5CPRB 3HHGA 4GGGA 4GRIA 4I09A 4ZYAA 1IN4A 1A35A 4XN3A 2J5PA 1BJAA 4M3DA 4LITA 4A0YA 5FGMA 1FNNA 2YX4A 3DWLE 1ON1A 2ECBA 1XMKA 1O3QA 1ZYRF 1BW5A 1FBSA 1U8BA 3DU6A 3WHBA 4KIGA 2LMDA 1YW9A 2A68F 4P5OA 3GTOJ 2CQ7A 2DQLA 1YS7A 3QU3A 1P2FA 1Z91A 1IG7A 1WRJA 4ZH4F 4UUSB 2EZLA 2IJLA 5J8FA 5CVRA 4A3JJ 1FPQA 1YOVB 2ADUA 3J80Z 4I6ZA 2I5UA 2TCTA 5LHGA 5EDNA 4LK1F 2HNHA 2O61A 4UUVA 1YFHA 1ETWA 2M7BA 1OKRA 3T0YA 1EJ9A 1O57A 4IHVA 3JRHA 5CVVA 5F0FA 3BCBA 4EV0A 3ZMTA 3K1PA 4NC8A 3PM1A 4PZJA 4PSXA 1WGXA 2L9RA 1EH7A 4ZYHA 1N77A 4OMZA 2CWEA 3DF8A 4HX7A 2HQ5A 2DMTA 4B3XA 4G6QA 3GF2A 3L00A 1REPC 1ITYA 3SDGA 2QBYB 3VOEA 4BE0A 2EBIA 1MD0A 1X1PA 2XGEA 3JSPA 3QPSA 4BJTA 3KP6A 3F22A 1LFUP 4MNUA 3GFLA 4PFOA 1QHGA 2LK2A 2RNJA 3R0JA 1NK3P 4GDFA 4ZJZA 4EJVA 1YLFA 2L54A 1FOKA 3FKJA 4LLNA 1S7OA 2EILH 2FMYA 2DFFA 3H9QA 5FLXZ 1YHQI 1XCVA 1X4PA 3QPHA 2KRCA 4A3IJ 2K9SA 2VONA 4CCMA 1X1CA 3RKWA 4A3LJ 4M9SA 5H20A 4A3MJ 2KJBA 2VBYA 3FKIJ 1D1AA 3FIWA 4RB2C 3RYPA 5LGTA 5DM7F 4XKCA 1JT6A 1HW5A 3BY6A 4E7LA 2K9LA 2L2OA 5FFZA 1HC8A 3HRUA 5FB2A 5ICGA 3CZ6A 5TISC 5FFXA 2VOPA 1ZAOA 3HEFA 1K61A 3RIRA 2WV1A 3KEYA 3KP2A 4RGRA 3REOA 4MEXF 4UV8A 2K86A 3K4MA 1WZ2A 1BN5A 1K7AA 2HVRA 2DI3A 5DD4A 3OIOA 1A5JA 2BVLA 2CFOA 3K4CA 1KQ9A 2H1KA 3QP5A 3OR1C 5JVGF 2R4GA 3Q0UA 2Q8KA 3TW6A 2ZJQF 3J80K 3CCQI 3KETA 5KHDA 3QRFF 1LPQA 2ELJA 4QLCU 1SFOJ 3H3ZA 2PI0A 3KLOA 3T1BA 2Z33A 3EPZA 2X0LA 2H27A 2M34A 1IXRC 2V1NA 5CKTA 2CUFA 3ZQHA 2Z9OA 2DT6A 2GA1A 4P55A 4OU0A 3LWFA 4A5MA 1D1CA 2ZB9A 4B1RA 4D7MA 2H8WA 3I4NJ 3TW7A 1W7PD 3EQLF 4RGUA 4FTHA 1OCTC 4ANJA 3SQNA 1PVEA 2CSOA 4EJOA 2BYVE 4KJZA 1K83J 2BHZA 2DJNA 2X4HA 4C30A 1I1GA 4I76A 2HXOA 3C2HA 5BOXA 3CLOA 3IWFA 4EJUA 4KISA 2CQKA 1YW8A 1X3UA 1H89C 3I4PA 1SC7A 2F48A 2X1CA 3VWBA 2R93J 5BS6A 2M4GA 5J1RA 1R49A 4CH7A 5ICFA 2LBFB 2VBXA 2IW5A 4W97A 4QPOA 5JI6A 3OWTA 5EG0A 2RGVA 3VYRB 1ZRDA 1XX5A 4JYKA 4BBSJ 2X1DA 1Z6TA 2X51A 1J9IA 1P7IA 3AKZA 4L9VA 1J59A 1XMAA 2RQQA 2K3PA 3GFIA 1UHWA 2OUMA 3CJNA 4OIRF 2ME6A 3GTPJ 1S6LA 2Q2EA 2O8XA 2LOOA 2DT7B 4OIQF 5FLXK 4RLQA 5L3DA 5HLTA 2DMPA 3ECHA 3F8NA 2OCCH 2G0EA 1ZRCA 1VF9A 3ROUA 1ODDA 1JUPA 3GXOA 4M74A 4HV5A 3K4LA 3ZRGA 2OV7A 3JRAA 5EZGA 1PP8F 1W5SA 2QVOA 1Z6RA 1S72I 3S1QJ 1WHUA 3FWEA 4GFBA 3KFWX 3TGNA 2NVQJ 5DD8A 3P9KA 3K1MA 2DA6A 3QYEA 3H1CA 4XL9A 1FOYA 5JHUA 3X2QH 1Y1VJ 3PFYA 2V4JC 4CYDA 3BP8A 4ZTFA 1IO2A 2STWA 4YIFA 4XQFA 1FSHA 3SYTA 3DPUA 1TLHB 3HTSB 3S1NJ 2IA2A 3QODA 5L3BA 3RKQA 2BEOA 1GXPA 3C18A 2ISZA 1B1BA 1BI2A 5D5WB 3H36A 4HF1A 2A6HF 3IL2A 1SVOA 1W7PB 3JRIA 2R7UA 4RM3A 1Z7LA 1AHDP 3ABKH 1LEAA 1USSA 5FKNA 3MEXA 2KZVA 2HEOA 1YO5C 1FWZA 1MBJA 4XORA 4NUBA 2VC0A 2B7EA 3J81Z 1U78A 2V1DA 3KEQA 4JBAA 2DQRA 4JP0A 1KGSA 1DU6A 1T38A 1Z3YA 4Y3OA 2DA7A 2BGCA 2VB6A 3ELKA 3JAMZ 2NVUB 2KPMA 3JTHA 2JJ7A 3E3VA 2NS0A 4LLGF 3E6MA 4BEHA 5HVQC 3DCFA 4BU2A 4RAFA 2ZJPF 3E1SA 2FSWA 2FJ1A 1MSFC 1I5ZA 3LSKA 3JRDA 3FXKA 3TDZC 1T2KA 3BTCA 4ZDLA 3G3ZA 2Y48A 2XGCA 3LQQA 2A07F 5F1JA 5IYCJ 1S7AA 4ON0A 3IRQA 2XKOA 2E2JJ 4KA4A 2DAOA 2DA4A 5D4RA 1HKSA 4YFKF 4PFPA 4XLAA 3H0DA 5F0HA 2LKPA 5L3FA 2M5WA 1IN5A 5LGUA 3DBLB 1G3TA 1H9GA 1HSJA 3HOVJ 2BOLA 5J1YA 1NH3A 2O9LA 5IY5H 5BNGA 3IKVA 2FX0A 5J47A 1TTYA 2Z3YA 1ZELA 2E7XA 2WAQA 2VT2A 1KU2A 2QF7A 3LSHA 1Z21A 4CDGA 3HOYJ 2YSRA 3VODA 4A3CJ 3JW4A 4MTEA 2IBDA 2W4SA 3B6AA 3TOAA 1ETOA 3KYCB 2CYYA 2HGCA 3HKZA 3SZGA 2G9WA 2MBFA 4F55A 2HVQA 2EV6A 4KICA 3U21A 5M3MJ 3OSGA 2R7TA 2EIMH 3GTMJ 5E3MA 4A69C 4UUTA 2MA3A 3IH3A 5TGTA 3G73A 1VI0A 1SVMA 2QWWA 3KYDB 5KNLA 1TT0A 2VQLA 3LSRA 4I98B 3AG2H 4PJNA 3KZIC 2M8GX 4YRVA 4F3QA 2VASA 2AXTC 2IA1A 2M2EA 3ERMA 3J7AO 3M1EA 1O4XA 2FEZA 3I64A 4R8HA 3F0CA 3ASNH 2AHQA 3K70D 4KT6A 2OQGA 1X2NA 3BR3A 4RS8A 1YIJI 1BR2A 4LG0A 2DT5A 3OYHA 2ZSHB 4G7ZF 1DP7P 4RGSA 5FKLA 2OBPA 1HF0A 2F4OB 2RN7A 4QIWN 3K7AJ 4BHPA 3I55I 4O6JA 2AS5F 2NNYA 1R6RA 2KIMA 4EGYA 1I1SA 1TWFJ 4ESJA 4CCNA 3BR2A 5F04A 5DV5A 3OMYA 4MFDA 1EF4A 2MSYA 3Q3SA 1Z1DA 2DA2A 3J81K 4P9FA 3T5XA 3OYIA 3EETA 3GTKJ 3SHFA 2KMUA 3K70C 4IHSA 4ESBA 2MW8A 2M3AA 3CCEI 4AIJA 2L02A 3JAMK 1XCBA 4X1EA 4DNCA 2XGXA 4QTRA 4PUSA 2VXDA 4G7OF 2KIQA 3SEZA 4DBQA 2ECCA 1Q1VA 3G2BA 1DQUA 4XICA 2GIVA 4XSXF 2FQ3A 3KX2A 4HNVA 4HBLA 4BJ6C 1CGPA 1YRNB 5IP9J 3HG9A 2L7ZA 4LMYA 2IGKA 3CLQA 5HOOA 2XAQA 3DEWA 1LNWA 3T8TA 3ABLH 1F4KA 1X1DA 2Y31A 3HPHA 3FXOA 3FXLA 5BQTA 2KP6A 4CZCA 2R7ZJ 1NTCA 1BC8C 2K02A 1B9NA 3S1MJ 2Z5UA 1TWAJ 2FRHA 3AFHA 5FJ8J 1P4WA 2EJRA 1P9QC 1B8IB 3AAFA 2ELKA 3DFGA 4HYEA 1SANA
chains in the Genus database with same CATH topology
2D2WA 4HLXA 3RPQA 3HHHA 1F9NA 4CXFA 1OR7A 5HLIA 3W6KB 1BI1A 3QAHA 1O7FA 2HS5A 1OYYA 2IRFG 1J2XA 1G3SA 2XAHA 4HV6A 3F72A 5DCMB 5E1XA 3K0LA 1ZG3A 4O3MA 1K78B 1R58A 5D5VB 2VOOA 3WTXC 2JTVA 2RVCA 1MJ9A 1U3EM 4KN4X 5KK1A 1LVAA 2D1HA 4WXCA 1QQIA 2WTEA 3TO6A 1STZA 4IRIA 1G3YA 5E1ZB 1WKMA 4YFXF 2L01A 4NQWA 5D6FA 4AD9A 1ONVA 4P96A 1Z9CA 4S04A 1U2WA 3KP3A 1RZ4A 5D4SA 3I71A 1KU3A 3Q9VA 4HX8A 3RJPA 3D5LA 4EM0B 2UXNA 4IRGA 5HLHA 4DQ2A 3LA3A 3GO5A 3F23A 4HA8A 2RKHA 1U6GA 2WV0A 2EFNA 1IW7F 3O6BB 2KRFA 5DCFA 3BJOA 2QM3A 2GXGA 4U0WA 2V1UA 3K2ZA 4WK8F 1MKMA 3F8CA 1R5GA 1CF7B 1NHAA 4LLLA 2ESNA 3RKXA 2HQRA 3NEUA 1D5VA 5BMZA 1BIAA 4HF0A 2HOEA 2G7HA 1TBXA 1IAWA 3MQ0A 2XASA 2V1XA 2QENA 4BYYA 1J5YA 2Q0OA 4ZZDA 4KNYA 2DK8A 1BIBA 2H6CA 3F6OA 3GYHX 1RUNA 3Q9SA 3F8FA 2ESHA 3K1NA 3I58A 1MDMB 5CLSA 3FXQA 1U5TB 4KT5C 2YR2A 4LK0F 2CGPA 3OV8A 5TRDA 2O6GE 3JSOA 2OU2A 1YS6A 2P5KA 1P4AA 4HW0A 1V3FA 3P7NA 1FBUA 1JE8A 3V7SA 3C7JA 1BBYA 3KEOA 4MEYF 5DYMA 1DPRA 1FBQA 1HW1A 1HBXG 5FO5A 3BZ6A 3CO7C 3F21A 3K69A 2QQ9A 3ZMSA 1ZLJA 2DPDA 3MAJA 5J6XA 4BHBA 5F1RA 3HOSA 2F5DA 3HSFA 1XN7A 4ENNA 4NHJA 2IP2A 3BPVA 4ETSA 2QZ8A 1G4DA 4HOBA 2TDXA 2D45A 1LDJA 1IUYA 2V6CA 5ILVA 2K4BA 2FU4A 3WTYC 5K5OA 4U0YA 4CICA 2PFBA 2MH2A 3FHZA 1U8RA 5F6FA 2K7LA 4XLPF 1R23A 1MZBA 2NNNA 5E20A 5ICCA 1QO0D 1SMTA 3ZN1A 3JTGA 2COMA 3M7GA 2CW0F 5DUKA 1L3LA 3MFKA 2CO5A 2OQRA 3ABUA 4MGRA 3WGHA 3IHUA 4N9IA 4Q5SF 1TW3A 3U1DA 2LF7A 3GWZA 2FA5A 5HDNA 1XGMA 2QBYA 1E17A 6PAXA 2JT1A 5L3CA 3FF5A 3ECOA 3GFMA 1I27A 1SMYF 2BBYA 2R7DA 2PMUA 3BDDA 2JZYA 3WTVC 1QZZA 1RI7A 4AVPA 3ZMUA 1KYWA 1FYLA 2A5YB 4L9JA 2O3FA 4BHCA 2QUFA 1AOYA 2QYOA 4L18B 2FNPA 4Y17A 1YG2A 5ILSA 3I59B 3KP5A 2W85A 5K5RA 3WE3A 3HSEA 5DEQA 3N4MA 1LDKB 2HZTA 4Q47A 1DDNA 2ZMEB 3GZ6A 1T6SA 4EGZA 4KN7X 2ZO4A 1D8KA 4FX4A 3NRVA 1SD4A 2XAJA 3GW2A 3LSTA 2MLKA 1YW7A 4GO1A 3E6BA 1HQCA 1R1TA 2EFQA 4I7HA 3FMQA 5CJ9A 2XIGA 3E6CC 2VC1A 3ISPA 1H0MA 2KJCA 1BI3A 2VN2A 1FT9A 3BJAA 5LRRA 3HSRA 3D0SA 5HDKA 3I54A 1H9TA 1XDSA 3TO7A 2FOKA 2MLGA 1KA8A 1EH8A 5AIQA 2H94A 4A6DA 4KUMA 2FBKA 3HRSA 3L9FA 3BWGA 2DW4A 5HS9A 3HRTA 4G6DA 2IA0A 1B9MA 2WWYA 2GWRA 1GHCA 1O3RA 4ENMA 4I02A 3FMSA 2ELHA 1PUEE 4I0BA 1V4RA 1ZRFA 4HF2A 3PQKA 4ENJA 3H92A 5ED4A 4IVNA 5FD6A 3F8BA 2M45A 1XB4A 5H6QA 2Y75A 2ISYA 2M1BA 1RIOH 2R3SA 3R4KA 4WF2A 2IPQX 2W84A 1IRGA 3R0AA 5IT9Z 3SFZA 4A5NA 3ABTA 1IF1A 3FM5A 1W7PA 4ZYGA 2PN6A 4AWXB 1ZHFA 1IRFA 3IC7A 3DPLC 3SZPA 4RB3C 3KCCA 3FXRA 2YX7A 5HS8A 4H0EA 4PGHA 2K4JA 2JPBA 4U88A 3DPTA 3R60A 1YQAA 1PP7U 1OPCA 1TQIA 2DPUA 2ACJA 3HRMA 2ZCWA 4R79A 2OA4A 3MZYA 4EVIA 4RAZA 1LQ1A 5A2QK 2QLZA 3W6JB 4CZZA 1C0WA 2HKOA 3DV8A 3LFKA 4HLYA 1TNTA 3QP6A 5BPDA 2YPRA 2RC4A 4ENKA 2AXLA 4KMUX 4P9UA 1P6RA 3RTRA 3KP4A 2W25A 1XGNA 2VBZA 1ZH5A 4IRHA 4BH9A 3E5XA 3ZMDA 4FHTA 4ASNA 3EDPA 4R1HA 3CDHA 2Y0MA 4MTDA 2UZKA 4E70A 4N9HA 4WWCA 1HXDA 2HQNA 4A0ZA 5IT9K 4PCQA 1R00A 4NB5A 2EFPA 2ZNYA 1WI9A 3PQJA 3LAPA 1IN6A 3FX3A 1UHMA 4YFNF 1DPUA 5HLGA 3GEZA 5J8CA 2OZUA 4UVAA 2EFWA 5AIPA 3GLXA 4M71A 1T98A 1BM9A 1XGOA 5KVRA 1ZGAA 5E1WA 1B59A 1S8NA 2VODA 3CUQB 4BQAA 1S29A 4CHUA 4UNOA 1LB2A 2D1VA 1JXSA 1YIOA 4LGWA 4CGZA 1G6NA 1FP2A 1Y0UA 2EA2A 4U0VA 1UB9A 1Q1HA 4UVBA 5HS7A 3RI4A 2ZNZA 1ULYA 1WWXA 2L4MA 4KIBA 4XRFA 4EJWA 1IXCA 4ZYDA 4L5JA 1DUXC 1JHFA 5K5QA 1PDNC 2F5FA 4I2OA 3IWZA 1WSUA 1F5TA 1XSXA 1HW2A 4FX0A 2QQAA 4M9XA 5DCMA 2NAZA 3V8JA 3Q5FA 1K78A 4MHGA 1RNLA 3HIFA 3V7RA 2XAFA 2H09A 3SXYA 3GX4X 1WQ2A 2P5LC 2MC3A 4A6EA 4Q4ZF 3CO6C 4M6YA 2CFXA 3WE2A 4MQVA 4JK1X 1U5TC 3CTAA 2O03A 1B4AA 5DUIA 1T39A 3P9IA 2GQQA 1R36A 2NRAC 4MQ9F 5AONA 2P4WA 3V8KA 3QOPA 2QQBA 2FNAA 4ZZLA 1J75A 3IKTA 2DLLA 3BROA 2FF4A 3BPXA 1XSDA 2UXXA 5CVIA 3RPUA 3KLNA 2VT3A 3CUOA 3V4GA 1BI0A 3C1DA 5E17F 4WX9A 2C6YA 2EWNA 1W4MA 1LJ9A 4PDKA 2VE9A 3OOPA 1QPMA 4UVCA 1OYWA 4LB6B 2F5CA 3R61A 1FYMA 2W57A 4CO8A 2P6SA 1CF7A 5LHHA 4PGGA 1UFMA 2L4AA 2LF8A 2DFIA 2OZ6A 1BC7C 2PJPA 1FLIA 4WXHA 4RAYA 3WTSC 1D3YA 3KE2A 3B73A 3FXUA 4A0XA 1FZPB 2P8TA 3E6DA 5JR3A 3FZVA 1TQMA 1L0OC 3WTWC 1I6XA 2J5OA 2A6EF 4LB5A 1MDMA 4GCVA 2P7VB 1U5TA 3RKYA 2O0YA 3E5UA 1ZARA 2JRTA 5LBQA 5D8LB 3DXJF 2IT0A 2GZWA 4BNCA 2V9VA 2OD5A 1SFUA 4OIPF 3LAJA 3GUDA 4XLNF 1MJBA 5LRSA 2HTSA 1ZG1A 1RUOA 1R22A 4IHTA 1SD5A 4GYGA 4GYIA 3F3XA 1B6AA 1MJAA 2EA4A 3B02A 4Y15A 1ZGJA 2DO7A 5EEHA 3KP7A 2HR3A 4OIOF 4BXUA 3EYIA 4S05A 4M9ZA 3GZ5A 1P92A 2PEXA 1JGSA 1AWCA 3WODF 3WGIA 4YG2F 4A2UA 4AIKA 1ZLKA 2G7UA 4KYWA 4BAYA 1R7JA 4L0ZB 2VXZA 1QGPA 5DDGA 4EQQA 3SZTA 2ZXJA 4XBFA 2BE5F 4UXNA 3RYRA 2EB7A 2NYXA 2XKPA 1ZN2A 4KFCA 4LD5A 2F2EA 3WU0A 1XD7A 2A61A 2KKOA 3MZHA 2E1CA 3BJ6A 2M87A 4RB0A 3TOBA 3ZMZA 5D6EA 3QU6A 1SAXA 3U9GA 4EJTA 3DQVC 1O3SA 4JQFA 1W5TA 3KZYA 2OAZA 3ZQ7A 1YYVA 1QBJA 4M73A 5LEKA 2ZFWA 3RDIA 2RDPA 1XSVA 1TQPA 4D0PA 3GVAA 3HTUA 1KU9A 2HTJA 4UV9A 3DKWA 1FYKA 3HUGA 1K79A 2FXAA 4UHTA 2LSOA 2ZBKA 5ERIA 2XUBA 1FX7A 1LDDA 4HX4A 2E1NA 2RV8A 4I01A 4G9YA 3KZZA 2H6BA 1O7LA 2VBWA 1Z7UA 3I59A 1KQ8A 2P6TA 3L09A 3ZMVA 2P5VA 3V7CA 2ETHA 1SFXA 2ZMEA 3LA2A 5A2QZ 3O3KA 2PLYA 4HQMA 1QZYA 1KQ0A 3WG9A 3WU1B 3COAC 4Q48A 2YU3A 3M9AA 2K27A 1GVJA 1VTNC 4TV7A 1IN7A 1ON2A 3H3UA 1FP1D 4U7BA 1TNSA 2WC2A 1HKTA 5E18F 4Z2YA 3C3WA 4B09A 4U7DA 1OYIA 4ESFA 1J0RA 3T8RA 5TJJA 1SD7A 3ULQB 3ML6A 4A12A 1HSTA 3LA7A 4L5IA 1QNTA 5L3EA 2KIUA 4IJAA 3EUHA 5E8GA 1BOAA 2PQ8A 1XDUA 3VFZA 3WTZA 1MGTA 3ZN0A 4IXAA 4ZYEA 3FMRA 3N97A 2Z99A 1HKQA 1UCRA 5FD5A 4LG0B 1ZG5A 4B8XA 4N0BA 4O5VA 1JHHA 4RGXA 5IT3A 2VE8A 3VEPA 1IZ1A 5BPIA 3U2RA 3ZPLA 1EH6A 4OOIA 5CVUA 1IN8A 5EEGA 2LDUA 2BV6A 2XHKA 2FMLA 4Y13A 3R6SA 2XV4S 4HAMA 3MWMA 2MH9A 2B0LA 2FE3A 5JVTA 3V8LA 4AIHA 2XAGA 4G7HF 2V79A 1YTYA 4F7ZA 2RQPA 3CUQC 1TW2A 2DU9A 3EYYA 3E5QA 4LJZF 1KU7A 1FC3A 4G94A 2XROA 2LNBA 5L3GA 4OMYA 5K1YA 1K6OA 2PMHA 5H6RA 3F8MA 4L9NA 4L9TA 3TO9A 2HFHA 2GXBA 2FBIA 4HDVA 3TDUC 5D8KB 1OMIA 3F6VA 5LGNA 2A69F 1XGSA 2P7CB 4KDPA 3DEUA 3IRRA 2W24A 2DTRA 3ZP5A 3M8EA 3VB2A 1LEBA 1S3JA 4HZFA 4WXDA 4I0AA 3WGGA 4WCGA 2HKXA 2DBBA 2HYFA 4EM1A 3TQNA 2L3DA 4M72A 4L0YB 4LFUA 1FSEA 1GXQA 4EM2A 5CVJA 4HQEA 2M8EA 3E97A 3FM3A 2XRNA 3ERED 3WTUC 2ZKZA 2A3SA 1F1ZA 3K9TA 4FT8A 2E7WA 3BOQA 4QWQA 3S2WA 1ZREA 1IXSB 1SD6A 2DK5A 2EFOA 4IPAA 3LQRA 2JPCA 3NQOA 3GFJA 2ZJ2A 3DP7A 5LHIA 5LLQA 5JFRA 2M30A 3CUQA 1J7KA 2HDCA 2HYGD 1P4XA 1SFEA 4EMSA 2F5EA 3M8FA 2EV5A 1E2XA 3L7WA 2GA2A 4GXOA 5ILUA 1EV7A 2MD5A 2CG4A 1KYZA 4G8XA 4OINF 4K2EA 3L2CA 2JSCA 3QPTA 1T0FA 4KIFA 2IVMA 3I53A 2KIFA 5LEJA 4YIIA 5D5UB 4IF4A 2R7FA 2UWMA 2EV0A 1USTA 1R1UA 5D5XB 3WTTC 1A04A 1FY7A 3I0TA 5HDGA 2STTA 2GAUA 1R5HA 5E8IA 4RB1A 1O3TA 4M6XA 2PG4A 4HDUA 3PFIA 5ICEA 1Z05A 3HOTA 1R1VA 3HYIA 3O2PE 4XSZF 5CYVA 2FBHA 3I5UA 2EK5A 3MCZA 2PBIA 2HWVA 3P9CA 4KMFA 3TKYA 1G3WA 2XVCA 5F64A 3HHGA 4GGGA 4I09A 1IN4A 2J5PA 1BJAA 4A0YA 5FGMA 1FNNA 2YX4A 1ON1A 1XMKA 1O3QA 1ZYRF 1FBSA 4KIGA 1YW9A 2A68F 4P5OA 2DQLA 1YS7A 3QU3A 1P2FA 1Z91A 1WRJA 4ZH4F 2IJLA 5J8FA 5CVRA 1FPQA 2ADUA 3J80Z 5LHGA 4LK1F 2O61A 4UUVA 1YFHA 1OKRA 3T0YA 1O57A 5CVVA 4EV0A 3ZMTA 3K1PA 4PZJA 1EH7A 4ZYHA 4OMZA 2CWEA 3DF8A 4HX7A 4G6QA 3GF2A 3L00A 1REPC 2QBYB 3VOEA 1MD0A 3JSPA 3KP6A 3F22A 4MNUA 3GFLA 3R0JA 2RNJA 4EJVA 1YLFA 2L54A 1FOKA 4LLNA 1S7OA 2FMYA 5FLXZ 1XCVA 3QPHA 2VONA 3RKWA 4M9SA 5H20A 2KJBA 2VBYA 4RB2C 3RYPA 5LGTA 1HW5A 3BY6A 5FFZA 3HRUA 5FB2A 5ICGA 5FFXA 2VOPA 1ZAOA 3RIRA 3KP2A 4RGRA 3REOA 4MEXF 4UV8A 2K86A 1BN5A 1K7AA 2DI3A 5DD4A 1KQ9A 3QP5A 2Q8KA 3J80K 3KETA 3QRFF 4QLCU 3H3ZA 2PI0A 3KLOA 3T1BA 2Z33A 2X0LA 2H27A 1IXRC 2Z9OA 2GA1A 4P55A 4OU0A 3LWFA 4A5MA 1W7PD 3EQLF 4RGUA 3SQNA 2CSOA 4EJOA 2BYVE 2X4HA 1I1GA 5BOXA 3CLOA 3IWFA 4EJUA 2CQKA 1YW8A 1X3UA 3I4PA 5BS6A 5ICFA 2VBXA 2IW5A 5JI6A 2RGVA 1ZRDA 1Z6TA 1J9IA 4L9VA 1J59A 1XMAA 3GFIA 1UHWA 3CJNA 4OIRF 1S6LA 2Q2EA 2O8XA 4OIQF 5FLXK 5L3DA 3ECHA 3F8NA 1ZRCA 3ROUA 1ODDA 3GXOA 4M74A 4HV5A 1PP8F 1W5SA 2QVOA 1Z6RA 3FWEA 3KFWX 3TGNA 5DD8A 3P9KA 3K1MA 5JHUA 4CYDA 3BP8A 2STWA 4YIFA 1FSHA 3HTSB 1TLHB 2IA2A 5L3BA 1GXPA 2BEOA 2ISZA 3C18A 1B1BA 1BI2A 5D5WB 4HF1A 2A6HF 3IL2A 1W7PB 1LEAA 1USSA 3MEXA 2HEOA 1YO5C 1FWZA 2VC0A 1U78A 3J81Z 2V1DA 3KEQA 4JBAA 2DQRA 1KGSA 1T38A 2BGCA 3ELKA 3JAMZ 3JTHA 4LLGF 3E3VA 2NS0A 3E6MA 5HVQC 2FSWA 1I5ZA 3TDZC 1T2KA 3G3ZA 2Y48A 3LQQA 2A07F 1S7AA 4ON0A 3IRQA 2XKOA 4KA4A 2DAOA 5D4RA 1HKSA 4YFKF 2LKPA 5L3FA 2M5WA 1IN5A 5LGUA 1G3TA 1H9GA 1HSJA 3IKVA 1TTYA 2Z3YA 2E7XA 2VT2A 1KU2A 4CDGA 2YSRA 3VODA 3JW4A 4MTEA 3TOAA 2CYYA 2HGCA 2G9WA 2MBFA 2EV6A 4KICA 2MA3A 3G73A 2QWWA 4I98B 2IA1A 3J7AO 3M1EA 2FEZA 3I64A 4R8HA 2OQGA 4RS8A 4LG0A 2DT5A 1DP7P 4G7ZF 4RGSA 2OBPA 2RN7A 4BHPA 4O6JA 2AS5F 2NNYA 2KIMA 4EGYA 1I1SA 4ESJA 5DV5A 1Z1DA 3J81K 4P9FA 3T5XA 3EETA 3SHFA 4IHSA 4ESBA 4AIJA 2L02A 3JAMK 1XCBA 4DNCA 2XGXA 4G7OF 2GIVA 4XSXF 2FQ3A 1CGPA 1D8JA 4HBLA 4LMYA 5HOOA 2XAQA 1LNWA 3T8TA 1F4KA 5BQTA 1BC8C 2K02A 1B9NA 2Z5UA 2FRHA 1P4WA 2EJRA 3AAFA 3DFGA 4HYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2W A;  4HLX A;  3RPQ A;  3HHH A;  1F9N A;  4CXF A;  1OR7 A;  5HLI A;  3W6K B;  1BI1 A;  3QAH A;  1O7F A;  2HS5 A;  1OYY A;  2IRF G;  1J2X A;  1G3S A;  2XAH A;  4HV6 A;  3F72 A;  5DCM B;  5E1X A;  3K0L A;  1ZG3 A;  4O3M A;  1K78 B;  1R58 A;  5D5V B;  2VOO A;  3WTX C;  2JTV A;  2RVC A;  1MJ9 A;  1U3E M;  4KN4 X;  5KK1 A;  1LVA A;  2D1H A;  4WXC A;  1QQI A;  2WTE A;  3TO6 A;  1STZ A;  4IRI A;  1G3Y A;  5E1Z B;  1WKM A;  4YFX F;  2L01 A;  4NQW A;  5D6F A;  4AD9 A;  1ONV A;  4P96 A;  1Z9C A;  4S04 A;  1U2W A;  3KP3 A;  1RZ4 A;  5D4S A;  3I71 A;  1KU3 A;  3Q9V A;  4HX8 A;  3RJP A;  3D5L A;  4EM0 B;  2UXN A;  4IRG A;  5HLH A;  4DQ2 A;  3LA3 A;  3GO5 A;  3F23 A;  4HA8 A;  2RKH A;  1U6G A;  2WV0 A;  2EFN A;  1IW7 F;  3O6B B;  2KRF A;  5DCF A;  3BJO A;  2QM3 A;  2GXG A;  4U0W A;  2V1U A;  3K2Z A;  4WK8 F;  1MKM A;  3F8C A;  1R5G A;  1CF7 B;  1NHA A;  4LLL A;  2ESN A;  3RKX A;  2HQR A;  3NEU A;  1D5V A;  5BMZ A;  1BIA A;  4HF0 A;  2HOE A;  2G7H A;  1TBX A;  1IAW A;  3MQ0 A;  2XAS A;  2V1X A;  2QEN A;  4BYY A;  1J5Y A;  2Q0O A;  4ZZD A;  4KNY A;  2DK8 A;  1BIB A;  2H6C A;  3F6O A;  3GYH X;  1RUN A;  3Q9S A;  3F8F A;  2ESH A;  3K1N A;  3I58 A;  1MDM B;  5CLS A;  3FXQ A;  1U5T B;  4KT5 C;  2YR2 A;  4LK0 F;  2CGP A;  3OV8 A;  5TRD A;  2O6G E;  3JSO A;  2OU2 A;  1YS6 A;  2P5K A;  1P4A A;  4HW0 A;  1V3F A;  3P7N A;  1FBU A;  1JE8 A;  3V7S A;  3C7J A;  1BBY A;  3KEO A;  4MEY F;  5DYM A;  1DPR A;  1FBQ A;  1HW1 A;  1HBX G;  5FO5 A;  3BZ6 A;  3CO7 C;  3F21 A;  3K69 A;  2QQ9 A;  3ZMS A;  1ZLJ A;  2DPD A;  3MAJ A;  5J6X A;  4BHB A;  5F1R A;  3HOS A;  2F5D A;  3HSF A;  1XN7 A;  4ENN A;  4NHJ A;  2IP2 A;  3BPV A;  4ETS A;  2QZ8 A;  1G4D A;  4HOB A;  2TDX A;  2D45 A;  1LDJ A;  1IUY A;  2V6C A;  5ILV A;  2K4B A;  2FU4 A;  3WTY C;  5K5O A;  4U0Y A;  4CIC A;  2PFB A;  2MH2 A;  3FHZ A;  1U8R A;  5F6F A;  2K7L A;  4XLP F;  1R23 A;  1MZB A;  2NNN A;  5E20 A;  5ICC A;  1QO0 D;  1SMT A;  3ZN1 A;  3JTG A;  2COM A;  3M7G A;  2CW0 F;  5DUK A;  1L3L A;  3MFK A;  2CO5 A;  2OQR A;  3ABU A;  4MGR A;  3WGH A;  3IHU A;  4N9I A;  4Q5S F;  1TW3 A;  3U1D A;  2LF7 A;  3GWZ A;  2FA5 A;  5HDN A;  1XGM A;  2QBY A;  1E17 A;  6PAX A;  2JT1 A;  5L3C A;  3FF5 A;  3ECO A;  3GFM A;  1I27 A;  1SMY F;  2BBY A;  2R7D A;  2PMU A;  3BDD A;  2JZY A;  3WTV C;  1QZZ A;  1RI7 A;  4AVP A;  3ZMU A;  1KYW A;  1FYL A;  2A5Y B;  4L9J A;  2O3F A;  4BHC A;  2QUF A;  1AOY A;  2QYO A;  4L18 B;  2FNP A;  4Y17 A;  1YG2 A;  5ILS A;  3I59 B;  3KP5 A;  2W85 A;  5K5R A;  3WE3 A;  3HSE A;  5DEQ A;  3N4M A;  1LDK B;  2HZT A;  4Q47 A;  1DDN A;  2ZME B;  3GZ6 A;  1T6S A;  4EGZ A;  4KN7 X;  2ZO4 A;  1D8K A;  4FX4 A;  3NRV A;  1SD4 A;  2XAJ A;  3GW2 A;  3LST A;  2MLK A;  1YW7 A;  4GO1 A;  3E6B A;  1HQC A;  1R1T A;  2EFQ A;  4I7H A;  3FMQ A;  5CJ9 A;  2XIG A;  3E6C C;  2VC1 A;  3ISP A;  1H0M A;  2KJC A;  1BI3 A;  2VN2 A;  1FT9 A;  3BJA A;  5LRR A;  3HSR A;  3D0S A;  5HDK A;  3I54 A;  1H9T A;  1XDS A;  3TO7 A;  2FOK A;  2MLG A;  1KA8 A;  1EH8 A;  5AIQ A;  2H94 A;  4A6D A;  4KUM A;  2FBK A;  3HRS A;  3L9F A;  3BWG A;  2DW4 A;  5HS9 A;  3HRT A;  4G6D A;  2IA0 A;  1B9M A;  2WWY A;  2GWR A;  1GHC A;  1O3R A;  4ENM A;  4I02 A;  3FMS A;  2ELH A;  1PUE E;  4I0B A;  1V4R A;  1ZRF A;  4HF2 A;  3PQK A;  4ENJ A;  3H92 A;  5ED4 A;  4IVN A;  5FD6 A;  3F8B A;  2M45 A;  1XB4 A;  5H6Q A;  2Y75 A;  2ISY A;  2M1B A;  1RIO H;  2R3S A;  3R4K A;  4WF2 A;  2IPQ X;  2W84 A;  1IRG A;  3R0A A;  5IT9 Z;  3SFZ A;  4A5N A;  3ABT A;  1IF1 A;  3FM5 A;  1W7P A;  4ZYG A;  2PN6 A;  4AWX B;  1ZHF A;  1IRF A;  3IC7 A;  3DPL C;  3SZP A;  4RB3 C;  3KCC A;  3FXR A;  2YX7 A;  5HS8 A;  4H0E A;  4PGH A;  2K4J A;  2JPB A;  4U88 A;  3DPT A;  3R60 A;  1YQA A;  1PP7 U;  1OPC A;  1TQI A;  2DPU A;  2ACJ A;  3HRM A;  2ZCW A;  4R79 A;  2OA4 A;  3MZY A;  4EVI A;  4RAZ A;  1LQ1 A;  5A2Q K;  2QLZ A;  3W6J B;  4CZZ A;  1C0W A;  2HKO A;  3DV8 A;  3LFK A;  4HLY A;  1TNT A;  3QP6 A;  5BPD A;  2YPR A;  2RC4 A;  4ENK A;  2AXL A;  4KMU X;  4P9U A;  1P6R A;  3RTR A;  3KP4 A;  2W25 A;  1XGN A;  2VBZ A;  1ZH5 A;  4IRH A;  4BH9 A;  3E5X A;  3ZMD A;  4FHT A;  4ASN A;  3EDP A;  4R1H A;  3CDH A;  2Y0M A;  4MTD A;  2UZK A;  4E70 A;  4N9H A;  4WWC A;  1HXD A;  2HQN A;  4A0Z A;  5IT9 K;  4PCQ A;  1R00 A;  4NB5 A;  2EFP A;  2ZNY A;  1WI9 A;  3PQJ A;  3LAP A;  1IN6 A;  3FX3 A;  1UHM A;  4YFN F;  1DPU A;  5HLG A;  3GEZ A;  5J8C A;  2OZU A;  4UVA A;  2EFW A;  5AIP A;  3GLX A;  4M71 A;  1T98 A;  1BM9 A;  1XGO A;  5KVR A;  1ZGA A;  5E1W A;  1B59 A;  1S8N A;  2VOD A;  3CUQ B;  4BQA A;  1S29 A;  4CHU A;  4UNO A;  1LB2 A;  2D1V A;  1JXS A;  1YIO A;  4LGW A;  4CGZ A;  1G6N A;  1FP2 A;  1Y0U A;  2EA2 A;  4U0V A;  1UB9 A;  1Q1H A;  4UVB A;  5HS7 A;  3RI4 A;  2ZNZ A;  1ULY A;  1WWX A;  2L4M A;  4KIB A;  4XRF A;  4EJW A;  1IXC A;  4ZYD A;  4L5J A;  1DUX C;  1JHF A;  5K5Q A;  1PDN C;  2F5F A;  4I2O A;  3IWZ A;  1WSU A;  1F5T A;  1XSX A;  1HW2 A;  4FX0 A;  2QQA A;  4M9X A;  5DCM A;  2NAZ A;  3V8J A;  3Q5F A;  1K78 A;  4MHG A;  1RNL A;  3HIF A;  3V7R A;  2XAF A;  2H09 A;  3SXY A;  3GX4 X;  1WQ2 A;  2P5L C;  2MC3 A;  4A6E A;  4Q4Z F;  3CO6 C;  4M6Y A;  2CFX A;  3WE2 A;  4MQV A;  4JK1 X;  1U5T C;  3CTA A;  2O03 A;  1B4A A;  5DUI A;  1T39 A;  3P9I A;  2GQQ A;  1R36 A;  2NRA C;  4MQ9 F;  5AON A;  2P4W A;  3V8K A;  3QOP A;  2QQB A;  2FNA A;  4ZZL A;  1J75 A;  3IKT A;  2DLL A;  3BRO A;  2FF4 A;  3BPX A;  1XSD A;  2UXX A;  5CVI A;  3RPU A;  3KLN A;  2VT3 A;  3CUO A;  3V4G A;  1BI0 A;  3C1D A;  5E17 F;  4WX9 A;  2C6Y A;  2EWN A;  1W4M A;  1LJ9 A;  4PDK A;  2VE9 A;  3OOP A;  1QPM A;  4UVC A;  1OYW A;  4LB6 B;  2F5C A;  3R61 A;  1FYM A;  2W57 A;  4CO8 A;  2P6S A;  1CF7 A;  5LHH A;  4PGG A;  1UFM A;  2L4A A;  2LF8 A;  2DFI A;  2OZ6 A;  1BC7 C;  2PJP A;  1FLI A;  4WXH A;  4RAY A;  3WTS C;  1D3Y A;  3KE2 A;  3B73 A;  3FXU A;  4A0X A;  1FZP B;  2P8T A;  3E6D A;  5JR3 A;  3FZV A;  1TQM A;  1L0O C;  3WTW C;  1I6X A;  2J5O A;  2A6E F;  4LB5 A;  1MDM A;  4GCV A;  2P7V B;  1U5T A;  3RKY A;  2O0Y A;  3E5U A;  1ZAR A;  2JRT A;  5LBQ A;  5D8L B;  3DXJ F;  2IT0 A;  2GZW A;  4BNC A;  2V9V A;  2OD5 A;  1SFU A;  4OIP F;  3LAJ A;  3GUD A;  4XLN F;  1MJB A;  5LRS A;  2HTS A;  1ZG1 A;  1RUO A;  1R22 A;  4IHT A;  1SD5 A;  4GYG A;  4GYI A;  3F3X A;  1B6A A;  1MJA A;  2EA4 A;  3B02 A;  4Y15 A;  1ZGJ A;  2DO7 A;  5EEH A;  3KP7 A;  2HR3 A;  4OIO F;  4BXU A;  3EYI A;  4S05 A;  4M9Z A;  3GZ5 A;  1P92 A;  2PEX A;  1JGS A;  1AWC A;  3WOD F;  3WGI A;  4YG2 F;  4A2U A;  4AIK A;  1ZLK A;  2G7U A;  4KYW A;  4BAY A;  1R7J A;  4L0Z B;  2VXZ A;  1QGP A;  5DDG A;  4EQQ A;  3SZT A;  2ZXJ A;  4XBF A;  2BE5 F;  4UXN A;  3RYR A;  2EB7 A;  2NYX A;  2XKP A;  1ZN2 A;  4KFC A;  4LD5 A;  2F2E A;  3WU0 A;  1XD7 A;  2A61 A;  2KKO A;  3MZH A;  2E1C A;  3BJ6 A;  2M87 A;  4RB0 A;  3TOB A;  3ZMZ A;  5D6E A;  3QU6 A;  1SAX A;  3U9G A;  4EJT A;  3DQV C;  1O3S A;  4JQF A;  1W5T A;  3KZY A;  2OAZ A;  3ZQ7 A;  1YYV A;  1QBJ A;  4M73 A;  5LEK A;  2ZFW A;  3RDI A;  2RDP A;  1XSV A;  1TQP A;  4D0P A;  3GVA A;  3HTU A;  1KU9 A;  2HTJ A;  4UV9 A;  3DKW A;  1FYK A;  3HUG A;  1K79 A;  2FXA A;  4UHT A;  2LSO A;  2ZBK A;  5ERI A;  2XUB A;  1FX7 A;  1LDD A;  4HX4 A;  2E1N A;  2RV8 A;  4I01 A;  4G9Y A;  3KZZ A;  2H6B A;  1O7L A;  2VBW A;  1Z7U A;  3I59 A;  1KQ8 A;  2P6T A;  3L09 A;  3ZMV A;  2P5V A;  3V7C A;  2ETH A;  1SFX A;  2ZME A;  3LA2 A;  5A2Q Z;  3O3K A;  2PLY A;  4HQM A;  1QZY A;  1KQ0 A;  3WG9 A;  3WU1 B;  3COA C;  4Q48 A;  2YU3 A;  3M9A A;  2K27 A;  1GVJ A;  1VTN C;  4TV7 A;  1IN7 A;  1ON2 A;  3H3U A;  1FP1 D;  4U7B A;  1TNS A;  2WC2 A;  1HKT A;  5E18 F;  4Z2Y A;  3C3W A;  4B09 A;  4U7D A;  1OYI A;  4ESF A;  1J0R A;  3T8R A;  5TJJ A;  1SD7 A;  3ULQ B;  3ML6 A;  4A12 A;  1HST A;  3LA7 A;  4L5I A;  1QNT A;  5L3E A;  2KIU A;  4IJA A;  3EUH A;  5E8G A;  1BOA A;  2PQ8 A;  1XDU A;  3VFZ A;  3WTZ A;  1MGT A;  3ZN0 A;  4IXA A;  4ZYE A;  3FMR A;  3N97 A;  2Z99 A;  1HKQ A;  1UCR A;  5FD5 A;  4LG0 B;  1ZG5 A;  4B8X A;  4N0B A;  4O5V A;  1JHH A;  4RGX A;  5IT3 A;  2VE8 A;  3VEP A;  1IZ1 A;  5BPI A;  3U2R A;  3ZPL A;  1EH6 A;  4OOI A;  5CVU A;  1IN8 A;  5EEG A;  2LDU A;  2BV6 A;  2XHK A;  2FML A;  4Y13 A;  3R6S A;  2XV4 S;  4HAM A;  3MWM A;  2MH9 A;  2B0L A;  2FE3 A;  5JVT A;  3V8L A;  4AIH A;  2XAG A;  4G7H F;  2V79 A;  1YTY A;  4F7Z A;  2RQP A;  3CUQ C;  1TW2 A;  2DU9 A;  3EYY A;  3E5Q A;  4LJZ F;  1KU7 A;  1FC3 A;  4G94 A;  2XRO A;  2LNB A;  5L3G A;  4OMY A;  5K1Y A;  1K6O A;  2PMH A;  5H6R A;  3F8M A;  4L9N A;  4L9T A;  3TO9 A;  2HFH A;  2GXB A;  2FBI A;  4HDV A;  3TDU C;  5D8K B;  1OMI A;  3F6V A;  5LGN A;  2A69 F;  1XGS A;  2P7C B;  4KDP A;  3DEU A;  3IRR A;  2W24 A;  2DTR A;  3ZP5 A;  3M8E A;  3VB2 A;  1LEB A;  1S3J A;  4HZF A;  4WXD A;  4I0A A;  3WGG A;  4WCG A;  2HKX A;  2DBB A;  2HYF A;  4EM1 A;  3TQN A;  2L3D A;  4M72 A;  4L0Y B;  4LFU A;  1FSE A;  1GXQ A;  4EM2 A;  5CVJ A;  4HQE A;  2M8E A;  3E97 A;  3FM3 A;  2XRN A;  3ERE D;  3WTU C;  2ZKZ A;  2A3S A;  1F1Z A;  3K9T A;  4FT8 A;  2E7W A;  3BOQ A;  4QWQ A;  3S2W A;  1ZRE A;  1IXS B;  1SD6 A;  2DK5 A;  2EFO A;  4IPA A;  3LQR A;  2JPC A;  3NQO A;  3GFJ A;  2ZJ2 A;  3DP7 A;  5LHI A;  5LLQ A;  5JFR A;  2M30 A;  3CUQ A;  1J7K A;  2HDC A;  2HYG D;  1P4X A;  1SFE A;  4EMS A;  2F5E A;  3M8F A;  2EV5 A;  1E2X A;  3L7W A;  2GA2 A;  4GXO A;  5ILU A;  1EV7 A;  2MD5 A;  2CG4 A;  1KYZ A;  4G8X A;  4OIN F;  4K2E A;  3L2C A;  2JSC A;  3QPT A;  1T0F A;  4KIF A;  2IVM A;  3I53 A;  2KIF A;  5LEJ A;  4YII A;  5D5U B;  4IF4 A;  2R7F A;  2UWM A;  2EV0 A;  1UST A;  1R1U A;  5D5X B;  3WTT C;  1A04 A;  1FY7 A;  3I0T A;  5HDG A;  2STT A;  2GAU A;  1R5H A;  5E8I A;  4RB1 A;  1O3T A;  4M6X A;  2PG4 A;  4HDU A;  3PFI A;  5ICE A;  1Z05 A;  3HOT A;  1R1V A;  3HYI A;  3O2P E;  4XSZ F;  5CYV A;  2FBH A;  3I5U A;  2EK5 A;  3MCZ A;  2PBI A;  2HWV A;  3P9C A;  4KMF A;  3TKY A;  1G3W A;  2XVC A;  5F64 A;  3HHG A;  4GGG A;  4I09 A;  1IN4 A;  2J5P A;  1BJA A;  4A0Y A;  5FGM A;  1FNN A;  2YX4 A;  1ON1 A;  1XMK A;  1O3Q A;  1ZYR F;  1FBS A;  4KIG A;  1YW9 A;  2A68 F;  4P5O A;  2DQL A;  1YS7 A;  3QU3 A;  1P2F A;  1Z91 A;  1WRJ A;  4ZH4 F;  2IJL A;  5J8F A;  5CVR A;  1FPQ A;  2ADU A;  3J80 Z;  5LHG A;  4LK1 F;  2O61 A;  4UUV A;  1YFH A;  1OKR A;  3T0Y A;  1O57 A;  5CVV A;  4EV0 A;  3ZMT A;  3K1P A;  4PZJ A;  1EH7 A;  4ZYH A;  4OMZ A;  2CWE A;  3DF8 A;  4HX7 A;  4G6Q A;  3GF2 A;  3L00 A;  1REP C;  2QBY B;  3VOE A;  1MD0 A;  3JSP A;  3KP6 A;  3F22 A;  4MNU A;  3GFL A;  3R0J A;  2RNJ A;  4EJV A;  1YLF A;  2L54 A;  1FOK A;  4LLN A;  1S7O A;  2FMY A;  5FLX Z;  1XCV A;  3QPH A;  2VON A;  3RKW A;  4M9S A;  5H20 A;  2KJB A;  2VBY A;  4RB2 C;  3RYP A;  5LGT A;  1HW5 A;  3BY6 A;  5FFZ A;  3HRU A;  5FB2 A;  5ICG A;  5FFX A;  2VOP A;  1ZAO A;  3RIR A;  3KP2 A;  4RGR A;  3REO A;  4MEX F;  4UV8 A;  2K86 A;  1BN5 A;  1K7A A;  2DI3 A;  5DD4 A;  1KQ9 A;  3QP5 A;  2Q8K A;  3J80 K;  3KET A;  3QRF F;  4QLC U;  3H3Z A;  2PI0 A;  3KLO A;  3T1B A;  2Z33 A;  2X0L A;  2H27 A;  1IXR C;  2Z9O A;  2GA1 A;  4P55 A;  4OU0 A;  3LWF A;  4A5M A;  1W7P D;  3EQL F;  4RGU A;  3SQN A;  2CSO A;  4EJO A;  2BYV E;  2X4H A;  1I1G A;  5BOX A;  3CLO A;  3IWF A;  4EJU A;  2CQK A;  1YW8 A;  1X3U A;  3I4P A;  5BS6 A;  5ICF A;  2VBX A;  2IW5 A;  5JI6 A;  2RGV A;  1ZRD A;  1Z6T A;  1J9I A;  4L9V A;  1J59 A;  1XMA A;  3GFI A;  1UHW A;  3CJN A;  4OIR F;  1S6L A;  2Q2E A;  2O8X A;  4OIQ F;  5FLX K;  5L3D A;  3ECH A;  3F8N A;  1ZRC A;  3ROU A;  1ODD A;  3GXO A;  4M74 A;  4HV5 A;  1PP8 F;  1W5S A;  2QVO A;  1Z6R A;  3FWE A;  3KFW X;  3TGN A;  5DD8 A;  3P9K A;  3K1M A;  5JHU A;  4CYD A;  3BP8 A;  2STW A;  4YIF A;  1FSH A;  3HTS B;  1TLH B;  2IA2 A;  5L3B A;  1GXP A;  2BEO A;  2ISZ A;  3C18 A;  1B1B A;  1BI2 A;  5D5W B;  4HF1 A;  2A6H F;  3IL2 A;  1W7P B;  1LEA A;  1USS A;  3MEX A;  2HEO A;  1YO5 C;  1FWZ A;  2VC0 A;  1U78 A;  3J81 Z;  2V1D A;  3KEQ A;  4JBA A;  2DQR A;  1KGS A;  1T38 A;  2BGC A;  3ELK A;  3JAM Z;  3JTH A;  4LLG F;  3E3V A;  2NS0 A;  3E6M A;  5HVQ C;  2FSW A;  1I5Z A;  3TDZ C;  1T2K A;  3G3Z A;  2Y48 A;  3LQQ A;  2A07 F;  1S7A A;  4ON0 A;  3IRQ A;  2XKO A;  4KA4 A;  2DAO A;  5D4R A;  1HKS A;  4YFK F;  2LKP A;  5L3F A;  2M5W A;  1IN5 A;  5LGU A;  1G3T A;  1H9G A;  1HSJ A;  3IKV A;  1TTY A;  2Z3Y A;  2E7X A;  2VT2 A;  1KU2 A;  4CDG A;  2YSR A;  3VOD A;  3JW4 A;  4MTE A;  3TOA A;  2CYY A;  2HGC A;  2G9W A;  2MBF A;  2EV6 A;  4KIC A;  2MA3 A;  3G73 A;  2QWW A;  4I98 B;  2IA1 A;  3J7A O;  3M1E A;  2FEZ A;  3I64 A;  4R8H A;  2OQG A;  4RS8 A;  4LG0 A;  2DT5 A;  1DP7 P;  4G7Z F;  4RGS A;  2OBP A;  2RN7 A;  4BHP A;  4O6J A;  2AS5 F;  2NNY A;  2KIM A;  4EGY A;  1I1S A;  4ESJ A;  5DV5 A;  1Z1D A;  3J81 K;  4P9F A;  3T5X A;  3EET A;  3SHF A;  4IHS A;  4ESB A;  4AIJ A;  2L02 A;  3JAM K;  1XCB A;  4DNC A;  2XGX A;  4G7O F;  2GIV A;  4XSX F;  2FQ3 A;  1CGP A;  1D8J A;  4HBL A;  4LMY A;  5HOO A;  2XAQ A;  1LNW A;  3T8T A;  1F4K A;  5BQT A;  1BC8 C;  2K02 A;  1B9N A;  2Z5U A;  2FRH A;  1P4W A;  2EJR A;  3AAF A;  3DFG A;  4HYE A; 
#chains in the Genus database with same CATH topology
 1MBE A;  2D2W A;  4HLX A;  3H0G J;  2V9P A;  3HHH A;  3RPQ A;  3RPU D;  1F9N A;  2HOA A;  3ZQG A;  4CXF A;  2HVS A;  1OR7 A;  2K85 A;  5HLI A;  3W6K B;  3OS1 A;  1RPW A;  1BI1 A;  3QAH A;  1ERD A;  1O7F A;  5IPA A;  3M07 A;  2HS5 A;  1OYY A;  4XLF A;  5HNF A;  2BY1 A;  2IRF G;  1J2X A;  4IEJ A;  4NC6 A;  1G3S A;  2XAH A;  4HRI A;  1UG2 A;  3FXJ A;  3MKL A;  2R5Y A;  2RRE A;  4HV6 A;  4Y52 J;  2F4I A;  3F72 A;  5DCM B;  5E1X A;  3K0L A;  1ZG3 A;  4O3M A;  2LVS A;  4PJL A;  1K78 B;  3FHN A;  1MNE A;  3F9K A;  1R58 A;  3PSI A;  1RES A;  2VQG A;  5EZH A;  5D5V B;  2VOO A;  3WTX C;  1A6I A;  2JTV A;  2RVC A;  1BL0 A;  1MJ9 A;  3M3Y J;  1U3E M;  2L9V A;  3FK6 A;  4KN4 X;  3AL0 C;  5KK1 A;  1OCC H;  1LVA A;  2D1H A;  4WXC A;  3Q0W A;  1QQI A;  2KRH A;  2VLA A;  1LE8 A;  2WTE A;  3G1L A;  4C2T A;  2V9K A;  1STZ A;  3HXL A;  4XLH A;  3TO6 A;  4IRI A;  1G3Y A;  1YE9 A;  5E1Z B;  2DTZ A;  1WKM A;  4M3B A;  4FAS D;  4YFX F;  2Y0S A;  2L01 A;  4NQW A;  3DU5 A;  5D6F A;  3S2H J;  4AD9 A;  2EZI A;  1ONV A;  3HGG A;  3OYC A;  5J4Y A;  5C3E J;  4P96 A;  1Z9C A;  2WAD A;  4S04 A;  3CCJ I;  1G8X A;  1U2W A;  1X1A A;  3BCA A;  4LOC A;  3GTQ J;  1FOW A;  2Z16 A;  1LUJ B;  3A01 A;  3KP3 A;  1RZ4 A;  5D4S A;  3I71 A;  3BG7 A;  1KU3 A;  1YI2 I;  1AKH A;  2DOF A;  3Q9V A;  2JA8 J;  5FKO A;  4HX8 A;  1RRJ A;  3B6C A;  3RJP A;  1JT0 A;  1QRY A;  5GPA A;  3D5L A;  4IRG A;  2UXN A;  4EM0 B;  3K4N A;  4I99 C;  5HLH A;  4DQ2 A;  2IS6 A;  3LA3 A;  3GO5 A;  3F23 A;  1IJW C;  5FRM A;  3AL0 B;  1RKW A;  3SJM A;  1MMA A;  4HA8 A;  4IZZ A;  2RKH A;  4UB8 C;  1SFK A;  1U6G A;  2WV0 A;  2EFN A;  3ASO H;  1IW7 F;  3C2G A;  4CCO A;  3O6B B;  5EF6 A;  3DBH B;  2KRF A;  5DCF A;  2KDZ A;  1IDZ A;  3BJO A;  2QM3 A;  1FMW A;  2GXG A;  1HDD C;  4U0W A;  2VQH A;  2V1U A;  3K2Z A;  4WK8 F;  1MKM A;  3F8C A;  1R5G A;  1CF7 B;  1NHA A;  4LLL A;  2ESN A;  2KT0 A;  5E79 C;  2M4K A;  3RKX A;  1W5C C;  4DZP A;  4FIS A;  2HQR A;  3NEU A;  2BXZ A;  2KZG A;  1D5V A;  1R9T J;  3BG5 A;  5BMZ A;  2CV0 A;  2DFE A;  1BIA A;  2YUS A;  4HF0 A;  4A93 J;  2HOE A;  2G7H A;  1TBX A;  4DYR A;  3GCM A;  1IAW A;  2QSF X;  3BG9 A;  4D7N A;  3MQ0 A;  2XF6 A;  2XAS A;  2OC6 A;  3MVP A;  5M5W J;  3OYB A;  3GBG A;  2V1X A;  2X6Y A;  2QEN A;  4BYY A;  1WVR A;  1H88 C;  1J5Y A;  2Q0O A;  4ZZD A;  4KNY A;  2B63 J;  2DK8 A;  1UG0 A;  2XSD C;  1IV6 A;  4XLC A;  1BIB A;  2H6C A;  3F6O A;  4JX6 A;  3GYH X;  3Q9S A;  1RUN A;  3F8F A;  2ESH A;  3K1N A;  4LIU A;  3CMA I;  3W3C A;  3I58 A;  3FIS A;  1U0J A;  5CLS A;  3FXQ A;  1MDM B;  3H3V K;  1U5T B;  4KT5 C;  4BQQ A;  5KAF C;  3PUF A;  2GLO A;  3QOE A;  4E7I A;  4BE1 A;  1BR1 A;  2YR2 A;  4LK0 F;  3PO3 J;  1HLV A;  2CGP A;  2VKE A;  3LSP A;  3OV8 A;  5TRD A;  2O6G E;  5E3O A;  2H8R A;  1QVT A;  2OU2 A;  4FQG A;  3JSO A;  1YS6 A;  2P5K A;  1VFC A;  1ETK A;  1P4A A;  3RQ4 A;  4AID A;  4D5C A;  4HW0 A;  1V3F A;  2ID6 A;  3P7N A;  5GAH J;  1FBU A;  3NWT A;  4H4K C;  1JE8 A;  1D0Z A;  2WAE A;  2CV1 A;  1MMG A;  3V7S A;  3DLA A;  1DGR M;  9ANT A;  4XKB A;  3C7J A;  2M0C A;  4D5F A;  2W00 A;  1BBY A;  3KEO A;  2VKH A;  4MEY F;  5DYM A;  4DJA A;  4M6V A;  1DPR A;  1FBQ A;  1HW1 A;  1HBX G;  5FO5 A;  3WG7 H;  1N75 A;  2XB0 X;  3BZ6 A;  3CO7 C;  3F21 A;  3K69 A;  2QQ9 A;  1YJN I;  4A3F J;  2NVX J;  3ZMS A;  1W0U A;  2XF7 A;  1ZLJ A;  2DPD A;  2L7F P;  3MAJ A;  3MZ8 A;  1TC3 C;  5J6X A;  3BLY A;  4BHB A;  1MND A;  5F1R A;  2GXA A;  3HOS A;  4IHY A;  2F5D A;  3HSF A;  3ZXS A;  4B47 A;  1XN7 A;  2KIS A;  4XID A;  4ENN A;  4NHJ A;  2IP2 A;  2R92 J;  3BPV A;  3DKY A;  3DTE A;  2QZ8 A;  4ETS A;  5DS9 A;  4HOB A;  1G4D A;  2TDX A;  2D45 A;  4E7S A;  1LDJ A;  1IUY A;  2V6C A;  2ZXW H;  2LY2 A;  5ILV A;  1K4S A;  1W0T A;  2BHY A;  2K4B A;  3CCS I;  2E19 A;  2FU4 A;  1HDP A;  3WTY C;  2A6T A;  2E1O A;  4XOP A;  4BL0 B;  2XRL A;  3TP0 A;  5K5O A;  1OLT A;  4U0Y A;  4CIC A;  1Y1W J;  1MMS A;  2PFB A;  4X6A J;  2MH2 A;  3FHZ A;  3EUA A;  5LFA A;  1U8R A;  1MSE C;  2E5Z A;  3ABM H;  5F6F A;  4UUS A;  2K7L A;  3PNY A;  1X58 A;  4MLO A;  4HNU A;  2DDB A;  4XLP F;  2IS2 A;  2DJI A;  1R23 A;  1R4M B;  1WPK A;  1MZB A;  2OCE A;  3OYL A;  2NNN A;  5E20 A;  2JK3 A;  5ICC A;  1QO0 D;  3K4B A;  1IGN A;  1SMT A;  3ZN1 A;  2X6W A;  1N78 A;  3JTG A;  5EGO B;  2COM A;  3MKY B;  3HPG A;  4Y4R A;  3L2W A;  3JR9 A;  2L7K A;  3M7G A;  2CW0 F;  5DUK A;  1L3L A;  3MFK A;  1X19 A;  3H5N A;  2IEK A;  2XGD A;  4BGD A;  2CO5 A;  2OQR A;  2VJI A;  3A0H C;  3ABU A;  4MGR A;  1VND A;  2GOM A;  4XK4 A;  3WGH A;  1TT5 B;  3IHU A;  4N9I A;  4Q5S F;  1TW3 A;  3U1D A;  1KON A;  2LF7 A;  1B72 B;  3CME I;  3GWZ A;  3CCV I;  1QHH D;  3HM5 A;  3KYL A;  2FA5 A;  5HDN A;  1XGM A;  1BW6 A;  3W6V A;  2QBY A;  5EJC A;  4BE2 A;  1E17 A;  2BW3 B;  6PAX A;  2JT1 A;  3FK7 A;  2HDD A;  1RR7 A;  3Q0V A;  5L3C A;  1VQP I;  1JKR C;  3FF5 A;  3ECO A;  3GFM A;  1I27 A;  1SMY F;  3OL3 A;  2DOA A;  1X2M A;  2BBY A;  1TZL A;  1WI3 A;  3JRB A;  2R7D A;  1UZC A;  2PMU A;  3S3O A;  3BDD A;  2JZY A;  2DXI A;  1GVD A;  3WTV C;  1VQL I;  1QZZ A;  3HUG B;  5K7Z A;  3M1C A;  4J01 A;  1RI7 A;  4AVP A;  3CES A;  4BY1 J;  3ZMU A;  1KYW A;  1FYL A;  2HYJ A;  4M3E A;  4BS9 A;  3D1N I;  2XC7 A;  2A5Y B;  4L9J A;  4C3H J;  3BQY A;  2O3F A;  4BHC A;  2QUF A;  1AOY A;  3O8G A;  2QYO A;  4L18 B;  2FNP A;  4Y17 A;  1ETY A;  1YG2 A;  3CF5 F;  4DYQ A;  3UKG A;  5ILS A;  3I59 B;  3KP5 A;  4DYC A;  3PIO F;  1TWG J;  3OIP A;  2W85 A;  5K5R A;  2JA2 A;  3G1O A;  3IV5 A;  3WE3 A;  1SVL A;  2JUC A;  3HSE A;  5DEQ A;  3N4M A;  2BXY A;  2CQX A;  1E3H A;  1LDK B;  1A31 A;  2HZT A;  4Q47 A;  1DDN A;  4RM2 A;  3IAM 2;  1RC9 A;  2LH9 A;  2ZME B;  5B1B H;  4BQO A;  3GZ6 A;  1T6S A;  4E4H A;  4EGZ A;  4KN7 X;  3PSF A;  3L2Q A;  3OYM A;  4A3G J;  2ZO4 A;  4XKV A;  2JVG A;  3ZR8 X;  1MH3 A;  1D8K A;  3NRV A;  4FX4 A;  1SD4 A;  2XAJ A;  3GW2 A;  3LST A;  1X3W B;  2H1L A;  2MLK A;  1BOB A;  2LLK A;  1YW7 A;  4GO1 A;  1K4T A;  3E6B A;  1HQC A;  2E1M B;  1R1T A;  2EFQ A;  2DFH A;  4I7H A;  2LY9 A;  4IKF A;  4V2G A;  3FMQ A;  5CJ9 A;  5CQE A;  2XIG A;  1FTT A;  3E6C C;  3CJT B;  2VC1 A;  2F6C A;  4AC0 A;  2X6X A;  3S14 J;  2CS3 A;  2JN6 A;  1CQT A;  1WFX A;  3ISP A;  1H0M A;  1GDT A;  4U87 A;  2KJC A;  2HU9 A;  2R5Z B;  4ZTJ A;  1BI3 A;  2VN2 A;  1FT9 A;  3BJA A;  5LRR A;  2XPU A;  1A6Q A;  1I50 J;  2Y30 A;  4IOA F;  1XTA A;  4DW6 A;  2HOT A;  3BTJ A;  3HSR A;  3D0S A;  5HDK A;  4NC7 A;  1I6H J;  3I54 A;  3BG3 A;  1OCZ H;  1R5I D;  1H9T A;  4HPQ A;  1XDS A;  2VI6 A;  3TO7 A;  2LBF A;  4CYC B;  2FOK A;  2LG4 A;  2DA5 A;  2Y9Y A;  2MLG A;  3PUB A;  1KA8 A;  4B4C A;  1EH8 A;  3OIQ A;  2H94 A;  5AIQ A;  4KUM A;  5FKM A;  2FBK A;  2LY1 A;  3HRS A;  3L9F A;  2L9S A;  3NAU A;  4A6D A;  2HI3 A;  3BWG A;  2DW4 A;  1TP4 A;  5HS9 A;  3HRT A;  4G6D A;  2IA0 A;  3S32 A;  2CQN A;  2Z1D A;  1B9M A;  2WWY A;  4C2M J;  1VQ9 I;  2GWR A;  3BT9 A;  1I3A A;  1GHC A;  1O3R A;  2B9S A;  4ENM A;  3TED A;  4I02 A;  4CCK A;  1MW7 A;  3MN2 A;  1WJC A;  2DA1 A;  3FMS A;  1V5E A;  1WH5 A;  1PUF B;  2ELH A;  1XC5 A;  1ETV A;  4II3 A;  4I0B A;  1PUE E;  1V4R A;  1ZRF A;  4CCJ A;  4QPQ A;  4HF2 A;  3QPL A;  3PQK A;  3DBR B;  4ENJ A;  3H92 A;  5ED4 A;  2ZXH A;  1VQ7 I;  1DP3 A;  4IVN A;  4QSH A;  2CQQ A;  2BY2 A;  5FD6 A;  3F8B A;  2M45 A;  1WJE A;  1XB4 A;  5H6Q A;  2BY0 A;  1Y8Q B;  2Y75 A;  3MKW B;  2ISY A;  2LYC A;  2M1B A;  1RIO H;  2R3S A;  4ZC3 A;  3R4K A;  4MIM A;  4WF2 A;  2IPQ X;  2DMU A;  2W84 A;  1MMD A;  1IRG A;  3PNT A;  3R0A A;  2JA5 J;  1S7E A;  5IT9 Z;  5JLW A;  3QQA A;  4XM3 A;  1UEL B;  3SFZ A;  2QEX I;  1VQM I;  4A5N A;  3IUO A;  3OS0 A;  4CCL A;  3ZCO A;  3ABT A;  1PYV A;  1JKQ C;  3ZOB A;  1IF1 A;  3A4C A;  3DLL F;  3FM5 A;  1W7P A;  4ZYG A;  2PN6 A;  4XNF A;  4AWX B;  1ZHF A;  4XRS G;  1IRF A;  4AUX A;  3IC7 A;  3DPL C;  2COB A;  3SZP A;  4RB3 C;  3KCC A;  3I9V 2;  3FXR A;  2YX7 A;  5HS8 A;  2I8D A;  4H0E A;  4PGH A;  2K4J A;  2JPB A;  3ZQC A;  2M7A A;  4U88 A;  2QCO A;  3DPT A;  1MBG A;  3R60 A;  1P7J A;  3PL8 A;  1MNM C;  1YQA A;  5CQG A;  1PP7 U;  1OPC A;  2MG4 A;  3GLL A;  1TQI A;  4AYB N;  3C2B A;  3BZK A;  4F91 B;  2DPU A;  2ACJ A;  3HRM A;  1JJ6 C;  2ZCW A;  4XOT A;  4R79 A;  1XG1 A;  2OA4 A;  3MZY A;  4P1W A;  4EVI A;  2V26 A;  4RAZ A;  2KQR A;  3CDL A;  3CC2 I;  1YX5 A;  2HDW A;  2E34 A;  1LQ1 A;  3H5R A;  1UHS A;  1E0E A;  5A2Q K;  2K9M A;  2QLZ A;  3W6J B;  2VL8 A;  4CZZ A;  3JRE A;  1C0W A;  5GAE J;  2HKO A;  3MD2 A;  1MBK A;  3DV8 A;  1ORK A;  3LFK A;  1JUS A;  3VYU B;  3H9G A;  4HLY A;  1TNT A;  3QP6 A;  5J40 A;  3D5S C;  5BPD A;  2KHM A;  2YPR A;  2RC4 A;  3FBI B;  4ENK A;  2AXL A;  1IUF A;  4KMU X;  3ZQI A;  4NBQ A;  4AYB A;  4P9U A;  3RZO J;  2NVY J;  1P6R A;  2HPI A;  3RTR A;  3KP4 A;  1QVU A;  2W25 A;  3PIP F;  2N8G A;  3SDB A;  3OYN A;  1XGN A;  2VBZ A;  1HA8 A;  1ZH5 A;  4IRH A;  4BH9 A;  3E5X A;  1OJL A;  2UUZ A;  3ZMD A;  5GAD J;  3I3L A;  4FHT A;  4ASN A;  3EDP A;  4R1H A;  3CDH A;  1D8J A;  2Y0M A;  3OYE A;  4MTD A;  2UZK A;  1ZGW A;  4E70 A;  4A3K J;  1XPX A;  4N9H A;  4PK4 A;  3A2K A;  4WWC A;  4RA2 A;  5H2F C;  4CA0 A;  1HXD A;  2HQN A;  3VSL A;  4A0Z A;  3K6G A;  5IT9 K;  4PCQ A;  2CH0 A;  1R00 A;  4NB5 A;  2K9N A;  2EFP A;  2ZNY A;  1WI9 A;  3N05 A;  3BG6 A;  3G4S I;  1I3Q J;  3PQJ A;  3LAP A;  4BAC A;  5GP9 A;  3FXM A;  3CJR B;  1IN6 A;  1J09 A;  2KFD A;  3FX3 A;  4EAT A;  2JSP A;  5HOD A;  1UHM A;  4YFN F;  3CC4 I;  1QZE A;  1DPU A;  5HLG A;  3GEZ A;  5J8C A;  1Z3X A;  2OZU A;  4UVA A;  2EFW A;  5IP7 J;  2FQ4 A;  5AIP A;  3GLX A;  4M71 A;  1T98 A;  1BM9 A;  1FEX A;  2ZXI A;  5GTI C;  1XGO A;  1R71 A;  5KVR A;  1ZGA A;  3BR1 A;  5E1W A;  1B59 A;  1S8N A;  2CUE A;  3GZN B;  2VOD A;  4IX7 A;  3CUQ B;  2EZH A;  3G1M A;  2KL4 A;  4BQA A;  1S29 A;  3L2R A;  2EZK A;  1MBH A;  2QGU A;  3CC7 I;  1YRN A;  4CHU A;  4UNO A;  3L2U A;  1LB2 A;  2D1V A;  3NAR A;  1JXS A;  1YIO A;  4LGW A;  3HC7 A;  3E0J B;  4CGZ A;  1G6N A;  2CRG A;  4HNT A;  1FP2 A;  1Y0U A;  2L0K A;  4V19 K;  2EA2 A;  4RLF A;  4U0V A;  4IHX A;  1UB9 A;  1OCP A;  1Q1H A;  1ZR4 A;  4UVB A;  4UB6 C;  5HS7 A;  2MYS A;  2OTJ I;  1D5Y A;  1ZKG A;  1ZQ3 P;  4FET A;  2BY3 A;  3FBN B;  3RI4 A;  2ZNZ A;  4JOM A;  5IYB J;  3GME A;  1ULY A;  1RR8 C;  1WWX A;  2L4M A;  1MIJ A;  1B8I A;  1GV2 A;  4HST A;  4KIB A;  5J1U A;  1NG7 A;  4XRF A;  5KAI C;  5GAG J;  4EEF G;  4EJW A;  1WCM J;  1IXC A;  3WU2 C;  4ABZ A;  2F4M B;  4ZYD A;  2LKX A;  1XS9 A;  4L5J A;  1DUX C;  2LP0 A;  1JHF A;  5IP6 A;  3OYJ A;  4FCY A;  1T8I A;  2GM4 A;  5K5Q A;  1PDN C;  2X85 A;  4IO9 F;  2F5F A;  4I2O A;  3CP8 A;  3IWZ A;  1WSU A;  1OCR H;  3OY9 A;  1F5T A;  1XSX A;  5HNH A;  4FX0 A;  1HW2 A;  2QQA A;  3VSK A;  4M9X A;  2XPV A;  2P0W A;  2L7M P;  4C3I J;  4Z6Y A;  5DCM A;  3OYK A;  3OR2 C;  2NAZ A;  3HZJ A;  3V8J A;  4IQJ A;  3Q5F A;  1K6Y A;  1K78 A;  4W1U A;  1IRX A;  2KDO A;  4MHG A;  1RNL A;  2LC2 A;  2IGN A;  2DMQ A;  3HIF A;  3V7R A;  2O7O A;  2XAF A;  2YS9 A;  2H09 A;  2LD5 A;  1OQY A;  2DOE A;  3SXY A;  3GX4 X;  1WQ2 A;  2P5L C;  5M3F J;  2E36 A;  2MC3 A;  4A6E A;  3JRG A;  4Q4Z F;  3CO6 C;  5GPC A;  1ACI A;  3G6E I;  4F93 B;  2EIJ H;  2CFX A;  4M6Y A;  2XPW A;  3WE2 A;  4MQV A;  4JK1 X;  2R7S A;  1U5T C;  2R0Q C;  3L2V A;  1D0Y A;  3CTA A;  1LFP A;  2O03 A;  3HOX J;  2MFZ A;  1JI8 A;  1B4A A;  3PNV A;  5DUI A;  1T39 A;  2EIK H;  3P9I A;  2GQQ A;  1R36 A;  2NRA C;  4MO7 A;  4MQ9 F;  2OF7 A;  2K40 A;  1GLN A;  5AON A;  3J7A Y;  1IC8 A;  2E5N A;  4BY7 J;  4DOZ A;  1JKP C;  2P4W A;  3V8K A;  3PJR A;  3CCR I;  3QOP A;  2QQB A;  2FNA A;  3CD6 I;  4ZZL A;  1J75 A;  2MGQ A;  3IKT A;  2JMW A;  2PJR B;  2IS1 A;  1IRZ A;  2DLL A;  3BRO A;  4F92 B;  2FF4 A;  3BPX A;  1AA7 A;  2CW8 A;  3GTJ J;  1XSD A;  1WJ5 A;  4RDU A;  2UXX A;  2Y2Z A;  5CVI A;  3RPU A;  3KLN A;  1YX3 A;  2VT3 A;  4A3B J;  2ID3 A;  2X48 A;  3CUO A;  3V4G A;  4J19 A;  2IS4 A;  1BI0 A;  1A36 A;  1W36 D;  3CCY A;  3W2W A;  3C1D A;  5E17 F;  4WX9 A;  2C6Y A;  5IOZ A;  2EWN A;  2A5W A;  1W4M A;  1LJ9 A;  1OIS A;  2VJJ A;  1BA5 A;  4HEA 2;  4PDK A;  3CDI A;  2VE9 A;  3OOP A;  1QPM A;  4UVC A;  1OYW A;  4LB6 B;  1XMX A;  4B3A A;  3VYT B;  2F5C A;  2A05 A;  3R61 A;  1FYM A;  1X3Z B;  2W57 A;  5DTD A;  4CO8 A;  2P6S A;  1GV5 A;  3KIO A;  2E2H J;  1CF7 A;  5LHH A;  4PGG A;  1UFM A;  2L4A A;  1W36 C;  3HOW J;  2QKL B;  2LF8 A;  2NOG A;  2DFI A;  2OZ6 A;  1W1W E;  1BC7 C;  4IHW A;  3HB9 A;  1VQ8 I;  2PJP A;  1FLI A;  4WXH A;  3K10 A;  1EKE A;  4RAY A;  3GTG J;  3WTS C;  1D3Y A;  3KE2 A;  5JLX A;  2AO9 A;  3OSF A;  3B73 A;  4F52 A;  3FXU A;  4A0X A;  1FZP B;  4A3D J;  2P8T A;  3E6D A;  5JR3 A;  2CMP A;  1VQ4 I;  2E2I J;  3FZV A;  4E7J A;  1TQM A;  1L0O C;  3WTW C;  1I6X A;  2J5O A;  2A6E F;  1Y6I A;  2XSJ C;  4LB5 A;  1M1E B;  2M0M A;  2LFB A;  4N4O B;  3PO2 J;  4JX4 A;  3HBL A;  4YIR X;  1MDM A;  4GCV A;  2FOW A;  2P7V B;  2R7V A;  1U5T A;  3RKY A;  2RNG A;  2O0Y A;  3E5U A;  1T95 A;  1ZAR A;  2DCE A;  1T33 A;  2JRT A;  5LBQ A;  3RCO A;  5D8L B;  4AM3 A;  3BZC A;  3DXJ F;  2IT0 A;  3A0B C;  3H5A A;  2GZW A;  2PX9 A;  1UAA A;  4BNC A;  1DGW Y;  1Y56 A;  2OD5 A;  2V9V A;  4XMY A;  1SFU A;  4OIP F;  3LAJ A;  3AG1 H;  3GUD A;  2R7W A;  4XLN F;  4XN0 A;  1MJB A;  5LRS A;  2HTS A;  5J4V A;  3W2A A;  4DZJ A;  1ZG1 A;  1RUO A;  1R22 A;  4IHT A;  3DKX A;  3BQZ A;  1SD5 A;  3LSM A;  4S0H B;  2VIX A;  4GYG A;  4GYI A;  3F3X A;  2IXS A;  4PJ0 C;  4YEL A;  1B6A A;  1MJA A;  2EA4 A;  3B02 A;  3LL7 A;  4Y15 A;  2DMN A;  2HZD A;  1G59 A;  1ZGJ A;  4L5E A;  5FRO A;  4XKW A;  1JGG A;  2DO7 A;  4BXX J;  1WH7 A;  3S8P A;  5EEH A;  4FE4 A;  3S15 J;  2OJE D;  2LRE A;  3OYA A;  3KP7 A;  2HR3 A;  2JA6 J;  1SEU A;  4OIO F;  5C4X J;  4BXU A;  3EYI A;  4S05 A;  2WB1 N;  2DN0 A;  3K4J A;  4M9Z A;  3S2D J;  2HXI A;  3GZ5 A;  4D9J A;  1P92 A;  1KZH A;  2PEX A;  1JGS A;  4C2U A;  1AWC A;  3CCU I;  5E3N A;  2ZME C;  3WOD F;  3WGI A;  2BVM A;  4YG2 F;  1ZTR A;  4IQ4 A;  4A2U A;  3O8H A;  4YEJ A;  3RSN A;  4AIK A;  1ZLK A;  1R4N B;  2G7U A;  4KYW A;  4BAY A;  2WY7 Q;  1R7J A;  1T56 A;  1HCR A;  4L0Z B;  2VXZ A;  1QGP A;  2WAF A;  2TRT A;  5DDG A;  4EQQ A;  3SZT A;  2VPL A;  3E7L A;  3OYF A;  1JTX A;  2E1M C;  2ZXJ A;  4XBF A;  2BE5 F;  4UXN A;  3RYR A;  3TP3 A;  2EB7 A;  1X4O A;  2NYX A;  4AVZ A;  2JQ7 A;  4E7K A;  2ZSI B;  2XKP A;  1H8A C;  1ZN2 A;  2WB1 A;  3TBI A;  3ONQ A;  3LSG A;  1LKX A;  1FJL A;  5EG0 B;  4KFC A;  4LD5 A;  2R7R A;  4A3E J;  1OCO H;  5EGO A;  2F2E A;  3V42 A;  1VQK I;  2HOS A;  3WU0 A;  3S1R J;  1XD7 A;  2A61 A;  2KLO A;  2KKO A;  1TL8 A;  3MZH A;  2E1C A;  5B5E C;  3BJ6 A;  2M87 A;  5K7H A;  1Y39 A;  2Q2E B;  4RB0 A;  2WBM A;  3TOB A;  3ZMZ A;  1JTY A;  5D6E A;  3QU6 A;  5LD2 C;  1SAX A;  3U9G A;  4EJT A;  3DQV C;  4Y33 A;  4E7Z A;  1O3S A;  1B72 A;  3BC8 A;  1AU7 A;  1ZR2 A;  4JQF A;  1W5T A;  2PMZ N;  2X6O A;  3KZY A;  3HGY A;  3I56 I;  2MC4 A;  2OAZ A;  2JUG A;  3ZQ7 A;  5FLV A;  1YYV A;  5IOY A;  4M73 A;  1QBJ A;  1FIA A;  3EUH C;  5M5X J;  2BW3 A;  5LEK A;  2JVH A;  4FE7 A;  1V5G A;  2NOJ B;  2ZFW A;  3RDI A;  2RDP A;  2R7Q A;  4BJ5 C;  2DYR H;  1XSV A;  5JHF A;  2LRD A;  3A1Y A;  4CUG A;  1TQP A;  1IV8 A;  5B66 C;  3ZQL A;  4D0P A;  3GVA A;  2VKV A;  3HTU A;  1KU9 A;  1PJR A;  3IH2 A;  2HTJ A;  2ZFU A;  4UV9 A;  3DKW A;  1FYK A;  2JWT A;  5FRN A;  2AQE A;  3HUG A;  3HL2 A;  1K79 A;  2FXA A;  4UHT A;  3S16 J;  2LSO A;  2ZBK A;  1Z77 A;  5ERI A;  2PMZ A;  2XUB A;  1FX7 A;  4D1Q A;  2R7O A;  1LDD A;  4HX4 A;  3HOU J;  1N25 A;  2E1N A;  2QQ8 A;  3VDX A;  2RV8 A;  4I01 A;  5C4J J;  1JUM A;  4G9Y A;  2GOX B;  4PJJ A;  3QYB A;  3DTK A;  4B44 A;  3KZZ A;  2H6B A;  1O7L A;  2VBW A;  1Z7U A;  1ETX A;  3I59 A;  2W48 A;  1KQ8 A;  3QWL A;  4J00 A;  2P6T A;  3L09 A;  3ZMV A;  5B1A H;  4DBR A;  2P5V A;  2NS7 A;  3MMY B;  3V7C A;  2ETH A;  1GUU A;  1UJ8 A;  4HG2 A;  1SFX A;  4BEH B;  2ZME A;  2LR8 A;  3LA2 A;  5A2Q Z;  3O3K A;  4II2 A;  1JKO C;  2LKS A;  1SAU A;  1APL C;  5F27 A;  4HQM A;  1QZY A;  1KQ0 A;  3WG9 A;  3JRC A;  2PLY A;  2YU9 J;  3WU1 B;  3COA C;  2JA7 J;  4RMN A;  1V5F A;  2CW7 A;  4Q48 A;  2YU3 A;  3M9A A;  2K27 A;  1YIT I;  1GVJ A;  1VTN C;  1IDY A;  1IN7 A;  4TV7 A;  1Z67 A;  2QSG X;  3GTL J;  1ON2 A;  3H3U A;  1FP1 D;  2DDA A;  4U7B A;  3CMY A;  1FTZ A;  4CSW A;  2F5V A;  2QSH X;  3ZGK A;  3ESW B;  1TNS A;  2WC2 A;  5J3L A;  3ZQF A;  4PJM A;  4B43 A;  3S3N A;  2MAB A;  1HKT A;  4E6K G;  1QU3 A;  5E18 F;  4ZDO A;  4Z2Y A;  2ZJR F;  5IYD J;  3C3W A;  4B09 A;  4U7D A;  2R5Z A;  1OYI A;  2VQC A;  4ESF A;  2I10 A;  3BR6 A;  1J0R A;  1F43 A;  2VUM J;  3T8R A;  2W7N A;  5TJJ A;  1SD7 A;  3ULQ B;  2UV1 A;  3ML6 A;  2EIN H;  4A12 A;  1HST A;  2NXN B;  3LA7 A;  1TWH J;  5F0C A;  3LSI A;  4L5I A;  1QNT A;  1TWC J;  5L3E A;  2JRM A;  4CYC A;  2RAE A;  3WHC A;  1HOM A;  2KIU A;  4IJA A;  2DA3 A;  2WAQ N;  4RAG A;  4PSW A;  2NVT J;  3EUH A;  5E8G A;  1BOA A;  2PQ8 A;  1XDU A;  3IAS 2;  3P5J A;  3HKZ N;  1EA3 A;  1E3P A;  3VFZ A;  2IAI A;  3CF2 A;  4C3J J;  3WTZ A;  1MGT A;  3ZN0 A;  4IXA A;  4ZYE A;  3HDD A;  3FMR A;  3DTI A;  3H35 A;  3N97 A;  2Z99 A;  1HKQ A;  1UCR A;  2VJ4 A;  2VPR A;  5FD5 A;  4XRM A;  5C44 J;  2L9N A;  4LG0 B;  1ZG5 A;  4B8X A;  2K3F A;  1PUF A;  3D5R C;  2W82 A;  3BTL A;  4NDL A;  4M3F A;  3LFU A;  2XDV A;  3L1P A;  3JRF A;  1OR7 C;  4N0B A;  3IP4 B;  3ZQQ A;  2V7F A;  4DGW B;  4O5V A;  1JHH A;  4AU7 A;  3J7Y J;  2BZT A;  3RZD J;  4OAY A;  4RGX A;  5IT3 A;  2VE8 A;  3LOC A;  3VEP A;  1IZ1 A;  2E71 A;  3U2R A;  5BPI A;  3ZPL A;  2IGM A;  2FUG 2;  1EH6 A;  4OOI A;  5CVU A;  1IN8 A;  5EEG A;  2LDU A;  4BXF A;  4NNJ A;  2BV6 A;  3SFI A;  2XHK A;  3LSJ A;  2FML A;  4Y13 A;  2VKD A;  3R6S A;  4DIQ A;  2WY8 Q;  2XV4 S;  4IOC F;  4HAM A;  3SEQ A;  3MWM A;  2AQF A;  4IL6 C;  2MH9 A;  2B0L A;  1BR4 A;  3A03 A;  2FE3 A;  5JVT A;  3V8L A;  4AIH A;  2W1O A;  2XAG A;  2FD5 A;  2X9D A;  4JX5 A;  5B3S H;  1U9N A;  4G7H F;  2XF5 A;  2V79 A;  1YTY A;  4F7Z A;  2XB5 A;  2DYS H;  5FKK A;  3HJE A;  2VJ5 A;  4ITV A;  3S3M A;  2RQP A;  3CUQ C;  4BDZ A;  4KIT B;  1QPI A;  3NWS A;  5M5Y J;  3S17 J;  3RQI A;  1NG6 A;  1TW2 A;  2GBY A;  2DU9 A;  3EYY A;  3CJQ B;  3CMM A;  3E5Q A;  1WJF A;  3HOZ J;  4LJZ F;  2R7X A;  1KU7 A;  2HPM A;  1FC3 A;  1Z0X A;  4G94 A;  3M4O J;  2XRO A;  2LNB A;  5L3G A;  1MH4 A;  4OMY A;  5K1Y A;  1K6O A;  3VYS B;  2PMH A;  2ICW G;  5H6R A;  3F8M A;  1GT0 C;  4L9N A;  4L9T A;  1FMV A;  4LG3 A;  2R5Y B;  2WA0 A;  3TO9 A;  2HFH A;  2E60 A;  2GXB A;  2FBI A;  4HDV A;  1LVK A;  3TDU C;  5D8K B;  2DOD A;  1OMI A;  3EUK L;  3F6V A;  3KPH A;  5LGN A;  2A69 F;  4XON A;  1XGS A;  3BR0 A;  1OFC X;  1I39 A;  4E7H A;  1X1B A;  2NS8 A;  2P7C B;  1Y0N A;  1T0F C;  2CJJ A;  2IGO A;  4KDP A;  3DEU A;  3IRR A;  4HSR A;  2CUJ A;  2W24 A;  4XRS A;  2CU7 A;  2DTR A;  3ZP5 A;  3M8E A;  3U1K A;  3VB2 A;  1LEB A;  1UMQ A;  1LE8 B;  1S3J A;  4HZF A;  1VQ5 I;  4BBR J;  1Y8R B;  3CCL I;  4WXD A;  4I0A A;  3WGG A;  4WCG A;  2HKX A;  2DBB A;  1WJA A;  2HYF A;  1BJZ A;  4EM1 A;  3TQN A;  2L3D A;  4M72 A;  1D1B A;  4N4N B;  4NQW B;  3DEE A;  2Q1Z B;  4L0Y B;  4G6T B;  4LFU A;  1FSE A;  4V2F A;  2QA4 I;  1GXQ A;  4G12 A;  4EM2 A;  5CVJ A;  2X1E A;  4HQE A;  2K9Q A;  2M8E A;  3E97 A;  3FM3 A;  2XRN A;  3ERE D;  2Y0S N;  3WTU C;  3A01 B;  1JJ8 C;  2ZKZ A;  2A3S A;  1F1Z A;  1AKH B;  3K9T A;  5FLM J;  4FT8 A;  2E7W A;  3BOQ A;  5DM6 F;  4QWQ A;  1RKT A;  3AG4 H;  3S2W A;  1ZRE A;  1IXS B;  3M8J A;  3OYG A;  1SD6 A;  2DK5 A;  2EFO A;  4BUP A;  3H9J A;  3LQR A;  1V55 H;  4IPA A;  2MD0 A;  1VQ6 I;  4B48 A;  1NK2 P;  2JPC A;  2OTL I;  1YJ9 I;  3NQO A;  3A02 A;  3GFJ A;  2ZJ2 A;  3DP7 A;  5LHI A;  5LLQ A;  5JFR A;  4BQN A;  2P81 A;  3AG3 H;  2EPF A;  3K2A A;  2M30 A;  3CUQ A;  3UNG C;  3K4K A;  1ZK8 A;  1J7K A;  2HDC A;  2HYG D;  1V54 H;  1P4X A;  1SFE A;  3CQZ J;  4BDY A;  4XLE A;  1WJD A;  1MMN A;  1ENH A;  4EMS A;  2F5E A;  3M8F A;  4RBO A;  2EV5 A;  1E2X A;  1VQN I;  4OAZ A;  2O5R A;  3L7W A;  2GA2 A;  3J7Z I;  4GXO A;  1POG A;  5ILU A;  2GIZ A;  5K7F A;  1EV7 A;  4C9Y A;  2MD5 A;  1S5L C;  3MKZ A;  2CG4 A;  1KYZ A;  4G8X A;  4OIN F;  3BTI A;  3OYD A;  2ZC2 A;  2CUZ A;  3OL4 A;  5KCM A;  4K2E A;  3L2C A;  2JSC A;  5F08 A;  2HQA A;  1VZ0 A;  3QPT A;  1T0F A;  4KIF A;  5E3L A;  5GTH C;  2IVM A;  3I53 A;  2KIF A;  5LEJ A;  4YII A;  5D5U B;  3LNQ A;  4IF4 A;  1G2H A;  1FOX A;  1ETQ A;  2R7F A;  4Y7N J;  2UWM A;  1LFB A;  2EV0 A;  3I4M J;  3TMO A;  1UST A;  3CP2 A;  1R1U A;  2LTP A;  5D5X B;  3CCM I;  3BR5 A;  3WTT C;  3VPR A;  3S93 A;  2D5V A;  1A04 A;  2EQR A;  1FY7 A;  3G71 I;  2QKM B;  4OWR B;  1S9H A;  3I0T A;  1RET A;  5HDG A;  2E35 A;  5EYR A;  2STT A;  2GAU A;  1R5H A;  2EH3 A;  2CV2 A;  1F36 A;  2XAU A;  3IH4 A;  5E8I A;  4RB1 A;  2K5C A;  1O3T A;  4M6X A;  1E3O C;  2Z2S B;  2PG4 A;  4HDU A;  4LIV A;  3PFI A;  2V6E A;  5ICE A;  1D0X A;  2OPT A;  1Z05 A;  1FIP A;  2Y9Z A;  1QA6 A;  3JCU C;  1YJW I;  3OOU A;  3HOT A;  1R1V A;  3HYI A;  3W2V A;  3O2P E;  4XSZ F;  5CYV A;  4M3G A;  1T08 B;  2FBH A;  3TL4 X;  5EEA A;  3QYF A;  2O8K A;  4MFE A;  3I5U A;  2EK5 A;  1MBF A;  1U9O A;  3OS2 A;  4UY8 I;  4BKX A;  2M9H A;  1DU0 A;  3MCZ A;  2PBI A;  4XR6 A;  2HWV A;  4ZDP A;  3LMM A;  3P9C A;  3UR3 C;  2L5Q A;  3FDY A;  4KMF A;  2Y69 H;  4X0G A;  2ME0 A;  3TKY A;  1G3W A;  2XVC A;  1WJB A;  5F64 A;  1VQO I;  2PJR A;  5CPR B;  3HHG A;  4GGG A;  4GRI A;  4I09 A;  4ZYA A;  1IN4 A;  1A35 A;  4XN3 A;  2J5P A;  1BJA A;  4M3D A;  4LIT A;  4A0Y A;  5FGM A;  1FNN A;  2YX4 A;  3DWL E;  1ON1 A;  2ECB A;  1XMK A;  1O3Q A;  1ZYR F;  1BW5 A;  1FBS A;  1U8B A;  3DU6 A;  3WHB A;  4KIG A;  2LMD A;  1YW9 A;  2A68 F;  4P5O A;  3GTO J;  2CQ7 A;  2DQL A;  1YS7 A;  3QU3 A;  1P2F A;  1Z91 A;  1IG7 A;  1WRJ A;  4ZH4 F;  4UUS B;  2EZL A;  2IJL A;  5J8F A;  5CVR A;  4A3J J;  1FPQ A;  1YOV B;  2ADU A;  3J80 Z;  4I6Z A;  2I5U A;  2TCT A;  5LHG A;  5EDN A;  4LK1 F;  2HNH A;  2O61 A;  4UUV A;  1YFH A;  1ETW A;  2M7B A;  1OKR A;  3T0Y A;  1EJ9 A;  1O57 A;  4IHV A;  3JRH A;  5CVV A;  5F0F A;  3BCB A;  4EV0 A;  3ZMT A;  3K1P A;  4NC8 A;  3PM1 A;  4PZJ A;  4PSX A;  1WGX A;  2L9R A;  1EH7 A;  4ZYH A;  1N77 A;  4OMZ A;  2CWE A;  3DF8 A;  4HX7 A;  2HQ5 A;  2DMT A;  4B3X A;  4G6Q A;  3GF2 A;  3L00 A;  1REP C;  1ITY A;  3SDG A;  2QBY B;  3VOE A;  4BE0 A;  2EBI A;  1MD0 A;  1X1P A;  2XGE A;  3JSP A;  3QPS A;  4BJT A;  3KP6 A;  3F22 A;  1LFU P;  4MNU A;  3GFL A;  4PFO A;  1QHG A;  2LK2 A;  2RNJ A;  3R0J A;  1NK3 P;  4GDF A;  4ZJZ A;  4EJV A;  1YLF A;  2L54 A;  1FOK A;  3FKJ A;  4LLN A;  1S7O A;  2EIL H;  2FMY A;  2DFF A;  3H9Q A;  5FLX Z;  1YHQ I;  1XCV A;  1X4P A;  3QPH A;  2KRC A;  4A3I J;  2K9S A;  2VON A;  4CCM A;  1X1C A;  3RKW A;  4A3L J;  4M9S A;  5H20 A;  4A3M J;  2KJB A;  2VBY A;  3FKI J;  1D1A A;  3FIW A;  4RB2 C;  3RYP A;  5LGT A;  5DM7 F;  4XKC A;  1JT6 A;  1HW5 A;  3BY6 A;  4E7L A;  2K9L A;  2L2O A;  5FFZ A;  1HC8 A;  3HRU A;  5FB2 A;  5ICG A;  3CZ6 A;  5TIS C;  5FFX A;  2VOP A;  1ZAO A;  3HEF A;  1K61 A;  3RIR A;  2WV1 A;  3KEY A;  3KP2 A;  4RGR A;  3REO A;  4MEX F;  4UV8 A;  2K86 A;  3K4M A;  1WZ2 A;  1BN5 A;  1K7A A;  2HVR A;  2DI3 A;  5DD4 A;  3OIO A;  1A5J A;  2BVL A;  2CFO A;  3K4C A;  1KQ9 A;  2H1K A;  3QP5 A;  3OR1 C;  5JVG F;  2R4G A;  3Q0U A;  2Q8K A;  3TW6 A;  2ZJQ F;  3J80 K;  3CCQ I;  3KET A;  5KHD A;  3QRF F;  1LPQ A;  2ELJ A;  4QLC U;  1SFO J;  3H3Z A;  2PI0 A;  3KLO A;  3T1B A;  2Z33 A;  3EPZ A;  2X0L A;  2H27 A;  2M34 A;  1IXR C;  2V1N A;  5CKT A;  2CUF A;  3ZQH A;  2Z9O A;  2DT6 A;  2GA1 A;  4P55 A;  4OU0 A;  3LWF A;  4A5M A;  1D1C A;  2ZB9 A;  4B1R A;  4D7M A;  2H8W A;  3I4N J;  3TW7 A;  1W7P D;  3EQL F;  4RGU A;  4FTH A;  1OCT C;  4ANJ A;  3SQN A;  1PVE A;  2CSO A;  4EJO A;  2BYV E;  4KJZ A;  1K83 J;  2BHZ A;  2DJN A;  2X4H A;  4C30 A;  1I1G A;  4I76 A;  2HXO A;  3C2H A;  5BOX A;  3CLO A;  3IWF A;  4EJU A;  4KIS A;  2CQK A;  1YW8 A;  1X3U A;  1H89 C;  3I4P A;  1SC7 A;  2F48 A;  2X1C A;  3VWB A;  2R93 J;  5BS6 A;  2M4G A;  5J1R A;  1R49 A;  4CH7 A;  5ICF A;  2LBF B;  2VBX A;  2IW5 A;  4W97 A;  4QPO A;  5JI6 A;  3OWT A;  5EG0 A;  2RGV A;  3VYR B;  1ZRD A;  1XX5 A;  4JYK A;  4BBS J;  2X1D A;  1Z6T A;  2X51 A;  1J9I A;  1P7I A;  3AKZ A;  4L9V A;  1J59 A;  1XMA A;  2RQQ A;  2K3P A;  3GFI A;  1UHW A;  2OUM A;  3CJN A;  4OIR F;  2ME6 A;  3GTP J;  1S6L A;  2Q2E A;  2O8X A;  2LOO A;  2DT7 B;  4OIQ F;  5FLX K;  4RLQ A;  5L3D A;  5HLT A;  2DMP A;  3ECH A;  3F8N A;  2OCC H;  2G0E A;  1ZRC A;  1VF9 A;  3ROU A;  1ODD A;  1JUP A;  3GXO A;  4M74 A;  4HV5 A;  3K4L A;  3ZRG A;  2OV7 A;  3JRA A;  5EZG A;  1PP8 F;  1W5S A;  2QVO A;  1Z6R A;  1S72 I;  3S1Q J;  1WHU A;  3FWE A;  4GFB A;  3KFW X;  3TGN A;  2NVQ J;  5DD8 A;  3P9K A;  3K1M A;  2DA6 A;  3QYE A;  3H1C A;  4XL9 A;  1FOY A;  5JHU A;  3X2Q H;  1Y1V J;  3PFY A;  2V4J C;  4CYD A;  3BP8 A;  4ZTF A;  1IO2 A;  2STW A;  4YIF A;  4XQF A;  1FSH A;  3SYT A;  3DPU A;  1TLH B;  3HTS B;  3S1N J;  2IA2 A;  3QOD A;  5L3B A;  3RKQ A;  2BEO A;  1GXP A;  3C18 A;  2ISZ A;  1B1B A;  1BI2 A;  5D5W B;  3H36 A;  4HF1 A;  2A6H F;  3IL2 A;  1SVO A;  1W7P B;  3JRI A;  2R7U A;  4RM3 A;  1Z7L A;  1AHD P;  3ABK H;  1LEA A;  1USS A;  5FKN A;  3MEX A;  2KZV A;  2HEO A;  1YO5 C;  1FWZ A;  1MBJ A;  4XOR A;  4NUB A;  2VC0 A;  2B7E A;  3J81 Z;  1U78 A;  2V1D A;  3KEQ A;  4JBA A;  2DQR A;  4JP0 A;  1KGS A;  1DU6 A;  1T38 A;  1Z3Y A;  4Y3O A;  2DA7 A;  2BGC A;  2VB6 A;  3ELK A;  3JAM Z;  2NVU B;  2KPM A;  3JTH A;  2JJ7 A;  3E3V A;  2NS0 A;  4LLG F;  3E6M A;  4BEH A;  5HVQ C;  3DCF A;  4BU2 A;  4RAF A;  2ZJP F;  3E1S A;  2FSW A;  2FJ1 A;  1MSF C;  1I5Z A;  3LSK A;  3JRD A;  3FXK A;  3TDZ C;  1T2K A;  3BTC A;  4ZDL A;  3G3Z A;  2Y48 A;  2XGC A;  3LQQ A;  2A07 F;  5F1J A;  5IYC J;  1S7A A;  4ON0 A;  3IRQ A;  2XKO A;  2E2J J;  4KA4 A;  2DAO A;  2DA4 A;  5D4R A;  1HKS A;  4YFK F;  4PFP A;  4XLA A;  3H0D A;  5F0H A;  2LKP A;  5L3F A;  2M5W A;  1IN5 A;  5LGU A;  3DBL B;  1G3T A;  1H9G A;  1HSJ A;  3HOV J;  2BOL A;  5J1Y A;  1NH3 A;  2O9L A;  5IY5 H;  5BNG A;  3IKV A;  2FX0 A;  5J47 A;  1TTY A;  2Z3Y A;  1ZEL A;  2E7X A;  2WAQ A;  2VT2 A;  1KU2 A;  2QF7 A;  3LSH A;  1Z21 A;  4CDG A;  3HOY J;  2YSR A;  3VOD A;  4A3C J;  3JW4 A;  4MTE A;  2IBD A;  2W4S A;  3B6A A;  3TOA A;  1ETO A;  3KYC B;  2CYY A;  2HGC A;  3HKZ A;  3SZG A;  2G9W A;  2MBF A;  4F55 A;  2HVQ A;  2EV6 A;  4KIC A;  3U21 A;  5M3M J;  3OSG A;  2R7T A;  2EIM H;  3GTM J;  5E3M A;  4A69 C;  4UUT A;  2MA3 A;  3IH3 A;  5TGT A;  3G73 A;  1VI0 A;  1SVM A;  2QWW A;  3KYD B;  5KNL A;  1TT0 A;  2VQL A;  3LSR A;  4I98 B;  3AG2 H;  4PJN A;  3KZI C;  2M8G X;  4YRV A;  4F3Q A;  2VAS A;  2AXT C;  2IA1 A;  2M2E A;  3ERM A;  3J7A O;  3M1E A;  1O4X A;  2FEZ A;  3I64 A;  4R8H A;  3F0C A;  3ASN H;  2AHQ A;  3K70 D;  4KT6 A;  2OQG A;  1X2N A;  3BR3 A;  4RS8 A;  1YIJ I;  1BR2 A;  4LG0 A;  2DT5 A;  3OYH A;  2ZSH B;  4G7Z F;  1DP7 P;  4RGS A;  5FKL A;  2OBP A;  1HF0 A;  2F4O B;  2RN7 A;  4QIW N;  3K7A J;  4BHP A;  3I55 I;  4O6J A;  2AS5 F;  2NNY A;  1R6R A;  2KIM A;  4EGY A;  1I1S A;  1TWF J;  4ESJ A;  4CCN A;  3BR2 A;  5F04 A;  5DV5 A;  3OMY A;  4MFD A;  1EF4 A;  2MSY A;  3Q3S A;  1Z1D A;  2DA2 A;  3J81 K;  4P9F A;  3T5X A;  3OYI A;  3EET A;  3GTK J;  3SHF A;  2KMU A;  3K70 C;  4IHS A;  4ESB A;  2MW8 A;  2M3A A;  3CCE I;  4AIJ A;  2L02 A;  3JAM K;  1XCB A;  4X1E A;  4DNC A;  2XGX A;  4QTR A;  4PUS A;  2VXD A;  4G7O F;  2KIQ A;  3SEZ A;  4DBQ A;  2ECC A;  1Q1V A;  3G2B A;  1DQU A;  4XIC A;  2GIV A;  4XSX F;  2FQ3 A;  3KX2 A;  4HNV A;  4HBL A;  4BJ6 C;  1CGP A;  1YRN B;  5IP9 J;  3HG9 A;  2L7Z A;  4LMY A;  2IGK A;  3CLQ A;  5HOO A;  2XAQ A;  3DEW A;  1LNW A;  3T8T A;  3ABL H;  1F4K A;  1X1D A;  2Y31 A;  3HPH A;  3FXO A;  3FXL A;  5BQT A;  2KP6 A;  4CZC A;  2R7Z J;  1NTC A;  1BC8 C;  2K02 A;  1B9N A;  3S1M J;  2Z5U A;  1TWA J;  2FRH A;  3AFH A;  5FJ8 J;  1P4W A;  2EJR A;  1P9Q C;  1B8I B;  3AAF A;  2ELK A;  3DFG A;  4HYE A;  1SAN A; 
#chains in the Genus database with same CATH homology
 2D2W A;  4HLX A;  3RPQ A;  3HHH A;  1F9N A;  4CXF A;  1OR7 A;  5HLI A;  3W6K B;  1BI1 A;  3QAH A;  1O7F A;  2HS5 A;  1OYY A;  2IRF G;  1J2X A;  1G3S A;  2XAH A;  4HV6 A;  3F72 A;  5DCM B;  5E1X A;  3K0L A;  1ZG3 A;  4O3M A;  1K78 B;  1R58 A;  5D5V B;  2VOO A;  3WTX C;  2JTV A;  2RVC A;  1MJ9 A;  1U3E M;  4KN4 X;  5KK1 A;  1LVA A;  2D1H A;  4WXC A;  1QQI A;  2WTE A;  3TO6 A;  1STZ A;  4IRI A;  1G3Y A;  5E1Z B;  1WKM A;  4YFX F;  2L01 A;  4NQW A;  5D6F A;  4AD9 A;  1ONV A;  4P96 A;  1Z9C A;  4S04 A;  1U2W A;  3KP3 A;  1RZ4 A;  5D4S A;  3I71 A;  1KU3 A;  3Q9V A;  4HX8 A;  3RJP A;  3D5L A;  4EM0 B;  2UXN A;  4IRG A;  5HLH A;  4DQ2 A;  3LA3 A;  3GO5 A;  3F23 A;  4HA8 A;  2RKH A;  1U6G A;  2WV0 A;  2EFN A;  1IW7 F;  3O6B B;  2KRF A;  5DCF A;  3BJO A;  2QM3 A;  2GXG A;  4U0W A;  2V1U A;  3K2Z A;  4WK8 F;  1MKM A;  3F8C A;  1R5G A;  1CF7 B;  1NHA A;  4LLL A;  2ESN A;  3RKX A;  2HQR A;  3NEU A;  1D5V A;  5BMZ A;  1BIA A;  4HF0 A;  2HOE A;  2G7H A;  1TBX A;  1IAW A;  3MQ0 A;  2XAS A;  2V1X A;  2QEN A;  4BYY A;  1J5Y A;  2Q0O A;  4ZZD A;  4KNY A;  2DK8 A;  1BIB A;  2H6C A;  3F6O A;  3GYH X;  1RUN A;  3Q9S A;  3F8F A;  2ESH A;  3K1N A;  3I58 A;  1MDM B;  5CLS A;  3FXQ A;  1U5T B;  4KT5 C;  2YR2 A;  4LK0 F;  2CGP A;  3OV8 A;  5TRD A;  2O6G E;  3JSO A;  2OU2 A;  1YS6 A;  2P5K A;  1P4A A;  4HW0 A;  1V3F A;  3P7N A;  1FBU A;  1JE8 A;  3V7S A;  3C7J A;  1BBY A;  3KEO A;  4MEY F;  5DYM A;  1DPR A;  1FBQ A;  1HW1 A;  1HBX G;  5FO5 A;  3BZ6 A;  3CO7 C;  3F21 A;  3K69 A;  2QQ9 A;  3ZMS A;  1ZLJ A;  2DPD A;  3MAJ A;  5J6X A;  4BHB A;  5F1R A;  3HOS A;  2F5D A;  3HSF A;  1XN7 A;  4ENN A;  4NHJ A;  2IP2 A;  3BPV A;  4ETS A;  2QZ8 A;  1G4D A;  4HOB A;  2TDX A;  2D45 A;  1LDJ A;  1IUY A;  2V6C A;  5ILV A;  2K4B A;  2FU4 A;  3WTY C;  5K5O A;  4U0Y A;  4CIC A;  2PFB A;  2MH2 A;  3FHZ A;  1U8R A;  5F6F A;  2K7L A;  4XLP F;  1R23 A;  1MZB A;  2NNN A;  5E20 A;  5ICC A;  1QO0 D;  1SMT A;  3ZN1 A;  3JTG A;  2COM A;  3M7G A;  2CW0 F;  5DUK A;  1L3L A;  3MFK A;  2CO5 A;  2OQR A;  3ABU A;  4MGR A;  3WGH A;  3IHU A;  4N9I A;  4Q5S F;  1TW3 A;  3U1D A;  2LF7 A;  3GWZ A;  2FA5 A;  5HDN A;  1XGM A;  2QBY A;  1E17 A;  6PAX A;  2JT1 A;  5L3C A;  3FF5 A;  3ECO A;  3GFM A;  1I27 A;  1SMY F;  2BBY A;  2R7D A;  2PMU A;  3BDD A;  2JZY A;  3WTV C;  1QZZ A;  1RI7 A;  4AVP A;  3ZMU A;  1KYW A;  1FYL A;  2A5Y B;  4L9J A;  2O3F A;  4BHC A;  2QUF A;  1AOY A;  2QYO A;  4L18 B;  2FNP A;  4Y17 A;  1YG2 A;  5ILS A;  3I59 B;  3KP5 A;  2W85 A;  5K5R A;  3WE3 A;  3HSE A;  5DEQ A;  3N4M A;  1LDK B;  2HZT A;  4Q47 A;  1DDN A;  2ZME B;  3GZ6 A;  1T6S A;  4EGZ A;  4KN7 X;  2ZO4 A;  1D8K A;  4FX4 A;  3NRV A;  1SD4 A;  2XAJ A;  3GW2 A;  3LST A;  2MLK A;  1YW7 A;  4GO1 A;  3E6B A;  1HQC A;  1R1T A;  2EFQ A;  4I7H A;  3FMQ A;  5CJ9 A;  2XIG A;  3E6C C;  2VC1 A;  3ISP A;  1H0M A;  2KJC A;  1BI3 A;  2VN2 A;  1FT9 A;  3BJA A;  5LRR A;  3HSR A;  3D0S A;  5HDK A;  3I54 A;  1H9T A;  1XDS A;  3TO7 A;  2FOK A;  2MLG A;  1KA8 A;  1EH8 A;  5AIQ A;  2H94 A;  4A6D A;  4KUM A;  2FBK A;  3HRS A;  3L9F A;  3BWG A;  2DW4 A;  5HS9 A;  3HRT A;  4G6D A;  2IA0 A;  1B9M A;  2WWY A;  2GWR A;  1GHC A;  1O3R A;  4ENM A;  4I02 A;  3FMS A;  2ELH A;  1PUE E;  4I0B A;  1V4R A;  1ZRF A;  4HF2 A;  3PQK A;  4ENJ A;  3H92 A;  5ED4 A;  4IVN A;  5FD6 A;  3F8B A;  2M45 A;  1XB4 A;  5H6Q A;  2Y75 A;  2ISY A;  2M1B A;  1RIO H;  2R3S A;  3R4K A;  4WF2 A;  2IPQ X;  2W84 A;  1IRG A;  3R0A A;  5IT9 Z;  3SFZ A;  4A5N A;  3ABT A;  1IF1 A;  3FM5 A;  1W7P A;  4ZYG A;  2PN6 A;  4AWX B;  1ZHF A;  1IRF A;  3IC7 A;  3DPL C;  3SZP A;  4RB3 C;  3KCC A;  3FXR A;  2YX7 A;  5HS8 A;  4H0E A;  4PGH A;  2K4J A;  2JPB A;  4U88 A;  3DPT A;  3R60 A;  1YQA A;  1PP7 U;  1OPC A;  1TQI A;  2DPU A;  2ACJ A;  3HRM A;  2ZCW A;  4R79 A;  2OA4 A;  3MZY A;  4EVI A;  4RAZ A;  1LQ1 A;  5A2Q K;  2QLZ A;  3W6J B;  4CZZ A;  1C0W A;  2HKO A;  3DV8 A;  3LFK A;  4HLY A;  1TNT A;  3QP6 A;  5BPD A;  2YPR A;  2RC4 A;  4ENK A;  2AXL A;  4KMU X;  4P9U A;  1P6R A;  3RTR A;  3KP4 A;  2W25 A;  1XGN A;  2VBZ A;  1ZH5 A;  4IRH A;  4BH9 A;  3E5X A;  3ZMD A;  4FHT A;  4ASN A;  3EDP A;  4R1H A;  3CDH A;  2Y0M A;  4MTD A;  2UZK A;  4E70 A;  4N9H A;  4WWC A;  1HXD A;  2HQN A;  4A0Z A;  5IT9 K;  4PCQ A;  1R00 A;  4NB5 A;  2EFP A;  2ZNY A;  1WI9 A;  3PQJ A;  3LAP A;  1IN6 A;  3FX3 A;  1UHM A;  4YFN F;  1DPU A;  5HLG A;  3GEZ A;  5J8C A;  2OZU A;  4UVA A;  2EFW A;  5AIP A;  3GLX A;  4M71 A;  1T98 A;  1BM9 A;  1XGO A;  5KVR A;  1ZGA A;  5E1W A;  1B59 A;  1S8N A;  2VOD A;  3CUQ B;  4BQA A;  1S29 A;  4CHU A;  4UNO A;  1LB2 A;  2D1V A;  1JXS A;  1YIO A;  4LGW A;  4CGZ A;  1G6N A;  1FP2 A;  1Y0U A;  2EA2 A;  4U0V A;  1UB9 A;  1Q1H A;  4UVB A;  5HS7 A;  3RI4 A;  2ZNZ A;  1ULY A;  1WWX A;  2L4M A;  4KIB A;  4XRF A;  4EJW A;  1IXC A;  4ZYD A;  4L5J A;  1DUX C;  1JHF A;  5K5Q A;  1PDN C;  2F5F A;  4I2O A;  3IWZ A;  1WSU A;  1F5T A;  1XSX A;  1HW2 A;  4FX0 A;  2QQA A;  4M9X A;  5DCM A;  2NAZ A;  3V8J A;  3Q5F A;  1K78 A;  4MHG A;  1RNL A;  3HIF A;  3V7R A;  2XAF A;  2H09 A;  3SXY A;  3GX4 X;  1WQ2 A;  2P5L C;  2MC3 A;  4A6E A;  4Q4Z F;  3CO6 C;  4M6Y A;  2CFX A;  3WE2 A;  4MQV A;  4JK1 X;  1U5T C;  3CTA A;  2O03 A;  1B4A A;  5DUI A;  1T39 A;  3P9I A;  2GQQ A;  1R36 A;  2NRA C;  4MQ9 F;  5AON A;  2P4W A;  3V8K A;  3QOP A;  2QQB A;  2FNA A;  4ZZL A;  1J75 A;  3IKT A;  2DLL A;  3BRO A;  2FF4 A;  3BPX A;  1XSD A;  2UXX A;  5CVI A;  3RPU A;  3KLN A;  2VT3 A;  3CUO A;  3V4G A;  1BI0 A;  3C1D A;  5E17 F;  4WX9 A;  2C6Y A;  2EWN A;  1W4M A;  1LJ9 A;  4PDK A;  2VE9 A;  3OOP A;  1QPM A;  4UVC A;  1OYW A;  4LB6 B;  2F5C A;  3R61 A;  1FYM A;  2W57 A;  4CO8 A;  2P6S A;  1CF7 A;  5LHH A;  4PGG A;  1UFM A;  2L4A A;  2LF8 A;  2DFI A;  2OZ6 A;  1BC7 C;  2PJP A;  1FLI A;  4WXH A;  4RAY A;  3WTS C;  1D3Y A;  3KE2 A;  3B73 A;  3FXU A;  4A0X A;  1FZP B;  2P8T A;  3E6D A;  5JR3 A;  3FZV A;  1TQM A;  1L0O C;  3WTW C;  1I6X A;  2J5O A;  2A6E F;  4LB5 A;  1MDM A;  4GCV A;  2P7V B;  1U5T A;  3RKY A;  2O0Y A;  3E5U A;  1ZAR A;  2JRT A;  5LBQ A;  5D8L B;  3DXJ F;  2IT0 A;  2GZW A;  4BNC A;  2V9V A;  2OD5 A;  1SFU A;  4OIP F;  3LAJ A;  3GUD A;  4XLN F;  1MJB A;  5LRS A;  2HTS A;  1ZG1 A;  1RUO A;  1R22 A;  4IHT A;  1SD5 A;  4GYG A;  4GYI A;  3F3X A;  1B6A A;  1MJA A;  2EA4 A;  3B02 A;  4Y15 A;  1ZGJ A;  2DO7 A;  5EEH A;  3KP7 A;  2HR3 A;  4OIO F;  4BXU A;  3EYI A;  4S05 A;  4M9Z A;  3GZ5 A;  1P92 A;  2PEX A;  1JGS A;  1AWC A;  3WOD F;  3WGI A;  4YG2 F;  4A2U A;  4AIK A;  1ZLK A;  2G7U A;  4KYW A;  4BAY A;  1R7J A;  4L0Z B;  2VXZ A;  1QGP A;  5DDG A;  4EQQ A;  3SZT A;  2ZXJ A;  4XBF A;  2BE5 F;  4UXN A;  3RYR A;  2EB7 A;  2NYX A;  2XKP A;  1ZN2 A;  4KFC A;  4LD5 A;  2F2E A;  3WU0 A;  1XD7 A;  2A61 A;  2KKO A;  3MZH A;  2E1C A;  3BJ6 A;  2M87 A;  4RB0 A;  3TOB A;  3ZMZ A;  5D6E A;  3QU6 A;  1SAX A;  3U9G A;  4EJT A;  3DQV C;  1O3S A;  4JQF A;  1W5T A;  3KZY A;  2OAZ A;  3ZQ7 A;  1YYV A;  1QBJ A;  4M73 A;  5LEK A;  2ZFW A;  3RDI A;  2RDP A;  1XSV A;  1TQP A;  4D0P A;  3GVA A;  3HTU A;  1KU9 A;  2HTJ A;  4UV9 A;  3DKW A;  1FYK A;  3HUG A;  1K79 A;  2FXA A;  4UHT A;  2LSO A;  2ZBK A;  5ERI A;  2XUB A;  1FX7 A;  1LDD A;  4HX4 A;  2E1N A;  2RV8 A;  4I01 A;  4G9Y A;  3KZZ A;  2H6B A;  1O7L A;  2VBW A;  1Z7U A;  3I59 A;  1KQ8 A;  2P6T A;  3L09 A;  3ZMV A;  2P5V A;  3V7C A;  2ETH A;  1SFX A;  2ZME A;  3LA2 A;  5A2Q Z;  3O3K A;  2PLY A;  4HQM A;  1QZY A;  1KQ0 A;  3WG9 A;  3WU1 B;  3COA C;  4Q48 A;  2YU3 A;  3M9A A;  2K27 A;  1GVJ A;  1VTN C;  4TV7 A;  1IN7 A;  1ON2 A;  3H3U A;  1FP1 D;  4U7B A;  1TNS A;  2WC2 A;  1HKT A;  5E18 F;  4Z2Y A;  3C3W A;  4B09 A;  4U7D A;  1OYI A;  4ESF A;  1J0R A;  3T8R A;  5TJJ A;  1SD7 A;  3ULQ B;  3ML6 A;  4A12 A;  1HST A;  3LA7 A;  4L5I A;  1QNT A;  5L3E A;  2KIU A;  4IJA A;  3EUH A;  5E8G A;  1BOA A;  2PQ8 A;  1XDU A;  3VFZ A;  3WTZ A;  1MGT A;  3ZN0 A;  4IXA A;  4ZYE A;  3FMR A;  3N97 A;  2Z99 A;  1HKQ A;  1UCR A;  5FD5 A;  4LG0 B;  1ZG5 A;  4B8X A;  4N0B A;  4O5V A;  1JHH A;  4RGX A;  5IT3 A;  2VE8 A;  3VEP A;  1IZ1 A;  5BPI A;  3U2R A;  3ZPL A;  1EH6 A;  4OOI A;  5CVU A;  1IN8 A;  5EEG A;  2LDU A;  2BV6 A;  2XHK A;  2FML A;  4Y13 A;  3R6S A;  2XV4 S;  4HAM A;  3MWM A;  2MH9 A;  2B0L A;  2FE3 A;  5JVT A;  3V8L A;  4AIH A;  2XAG A;  4G7H F;  2V79 A;  1YTY A;  4F7Z A;  2RQP A;  3CUQ C;  1TW2 A;  2DU9 A;  3EYY A;  3E5Q A;  4LJZ F;  1KU7 A;  1FC3 A;  4G94 A;  2XRO A;  2LNB A;  5L3G A;  4OMY A;  5K1Y A;  1K6O A;  2PMH A;  5H6R A;  3F8M A;  4L9N A;  4L9T A;  3TO9 A;  2HFH A;  2GXB A;  2FBI A;  4HDV A;  3TDU C;  5D8K B;  1OMI A;  3F6V A;  5LGN A;  2A69 F;  1XGS A;  2P7C B;  4KDP A;  3DEU A;  3IRR A;  2W24 A;  2DTR A;  3ZP5 A;  3M8E A;  3VB2 A;  1LEB A;  1S3J A;  4HZF A;  4WXD A;  4I0A A;  3WGG A;  4WCG A;  2HKX A;  2DBB A;  2HYF A;  4EM1 A;  3TQN A;  2L3D A;  4M72 A;  4L0Y B;  4LFU A;  1FSE A;  1GXQ A;  4EM2 A;  5CVJ A;  4HQE A;  2M8E A;  3E97 A;  3FM3 A;  2XRN A;  3ERE D;  3WTU C;  2ZKZ A;  2A3S A;  1F1Z A;  3K9T A;  4FT8 A;  2E7W A;  3BOQ A;  4QWQ A;  3S2W A;  1ZRE A;  1IXS B;  1SD6 A;  2DK5 A;  2EFO A;  4IPA A;  3LQR A;  2JPC A;  3NQO A;  3GFJ A;  2ZJ2 A;  3DP7 A;  5LHI A;  5LLQ A;  5JFR A;  2M30 A;  3CUQ A;  1J7K A;  2HDC A;  2HYG D;  1P4X A;  1SFE A;  4EMS A;  2F5E A;  3M8F A;  2EV5 A;  1E2X A;  3L7W A;  2GA2 A;  4GXO A;  5ILU A;  1EV7 A;  2MD5 A;  2CG4 A;  1KYZ A;  4G8X A;  4OIN F;  4K2E A;  3L2C A;  2JSC A;  3QPT A;  1T0F A;  4KIF A;  2IVM A;  3I53 A;  2KIF A;  5LEJ A;  4YII A;  5D5U B;  4IF4 A;  2R7F A;  2UWM A;  2EV0 A;  1UST A;  1R1U A;  5D5X B;  3WTT C;  1A04 A;  1FY7 A;  3I0T A;  5HDG A;  2STT A;  2GAU A;  1R5H A;  5E8I A;  4RB1 A;  1O3T A;  4M6X A;  2PG4 A;  4HDU A;  3PFI A;  5ICE A;  1Z05 A;  3HOT A;  1R1V A;  3HYI A;  3O2P E;  4XSZ F;  5CYV A;  2FBH A;  3I5U A;  2EK5 A;  3MCZ A;  2PBI A;  2HWV A;  3P9C A;  4KMF A;  3TKY A;  1G3W A;  2XVC A;  5F64 A;  3HHG A;  4GGG A;  4I09 A;  1IN4 A;  2J5P A;  1BJA A;  4A0Y A;  5FGM A;  1FNN A;  2YX4 A;  1ON1 A;  1XMK A;  1O3Q A;  1ZYR F;  1FBS A;  4KIG A;  1YW9 A;  2A68 F;  4P5O A;  2DQL A;  1YS7 A;  3QU3 A;  1P2F A;  1Z91 A;  1WRJ A;  4ZH4 F;  2IJL A;  5J8F A;  5CVR A;  1FPQ A;  2ADU A;  3J80 Z;  5LHG A;  4LK1 F;  2O61 A;  4UUV A;  1YFH A;  1OKR A;  3T0Y A;  1O57 A;  5CVV A;  4EV0 A;  3ZMT A;  3K1P A;  4PZJ A;  1EH7 A;  4ZYH A;  4OMZ A;  2CWE A;  3DF8 A;  4HX7 A;  4G6Q A;  3GF2 A;  3L00 A;  1REP C;  2QBY B;  3VOE A;  1MD0 A;  3JSP A;  3KP6 A;  3F22 A;  4MNU A;  3GFL A;  3R0J A;  2RNJ A;  4EJV A;  1YLF A;  2L54 A;  1FOK A;  4LLN A;  1S7O A;  2FMY A;  5FLX Z;  1XCV A;  3QPH A;  2VON A;  3RKW A;  4M9S A;  5H20 A;  2KJB A;  2VBY A;  4RB2 C;  3RYP A;  5LGT A;  1HW5 A;  3BY6 A;  5FFZ A;  3HRU A;  5FB2 A;  5ICG A;  5FFX A;  2VOP A;  1ZAO A;  3RIR A;  3KP2 A;  4RGR A;  3REO A;  4MEX F;  4UV8 A;  2K86 A;  1BN5 A;  1K7A A;  2DI3 A;  5DD4 A;  1KQ9 A;  3QP5 A;  2Q8K A;  3J80 K;  3KET A;  3QRF F;  4QLC U;  3H3Z A;  2PI0 A;  3KLO A;  3T1B A;  2Z33 A;  2X0L A;  2H27 A;  1IXR C;  2Z9O A;  2GA1 A;  4P55 A;  4OU0 A;  3LWF A;  4A5M A;  1W7P D;  3EQL F;  4RGU A;  3SQN A;  2CSO A;  4EJO A;  2BYV E;  2X4H A;  1I1G A;  5BOX A;  3CLO A;  3IWF A;  4EJU A;  2CQK A;  1YW8 A;  1X3U A;  3I4P A;  5BS6 A;  5ICF A;  2VBX A;  2IW5 A;  5JI6 A;  2RGV A;  1ZRD A;  1Z6T A;  1J9I A;  4L9V A;  1J59 A;  1XMA A;  3GFI A;  1UHW A;  3CJN A;  4OIR F;  1S6L A;  2Q2E A;  2O8X A;  4OIQ F;  5FLX K;  5L3D A;  3ECH A;  3F8N A;  1ZRC A;  3ROU A;  1ODD A;  3GXO A;  4M74 A;  4HV5 A;  1PP8 F;  1W5S A;  2QVO A;  1Z6R A;  3FWE A;  3KFW X;  3TGN A;  5DD8 A;  3P9K A;  3K1M A;  5JHU A;  4CYD A;  3BP8 A;  2STW A;  4YIF A;  1FSH A;  3HTS B;  1TLH B;  2IA2 A;  5L3B A;  1GXP A;  2BEO A;  2ISZ A;  3C18 A;  1B1B A;  1BI2 A;  5D5W B;  4HF1 A;  2A6H F;  3IL2 A;  1W7P B;  1LEA A;  1USS A;  3MEX A;  2HEO A;  1YO5 C;  1FWZ A;  2VC0 A;  1U78 A;  3J81 Z;  2V1D A;  3KEQ A;  4JBA A;  2DQR A;  1KGS A;  1T38 A;  2BGC A;  3ELK A;  3JAM Z;  3JTH A;  4LLG F;  3E3V A;  2NS0 A;  3E6M A;  5HVQ C;  2FSW A;  1I5Z A;  3TDZ C;  1T2K A;  3G3Z A;  2Y48 A;  3LQQ A;  2A07 F;  1S7A A;  4ON0 A;  3IRQ A;  2XKO A;  4KA4 A;  2DAO A;  5D4R A;  1HKS A;  4YFK F;  2LKP A;  5L3F A;  2M5W A;  1IN5 A;  5LGU A;  1G3T A;  1H9G A;  1HSJ A;  3IKV A;  1TTY A;  2Z3Y A;  2E7X A;  2VT2 A;  1KU2 A;  4CDG A;  2YSR A;  3VOD A;  3JW4 A;  4MTE A;  3TOA A;  2CYY A;  2HGC A;  2G9W A;  2MBF A;  2EV6 A;  4KIC A;  2MA3 A;  3G73 A;  2QWW A;  4I98 B;  2IA1 A;  3J7A O;  3M1E A;  2FEZ A;  3I64 A;  4R8H A;  2OQG A;  4RS8 A;  4LG0 A;  2DT5 A;  1DP7 P;  4G7Z F;  4RGS A;  2OBP A;  2RN7 A;  4BHP A;  4O6J A;  2AS5 F;  2NNY A;  2KIM A;  4EGY A;  1I1S A;  4ESJ A;  5DV5 A;  1Z1D A;  3J81 K;  4P9F A;  3T5X A;  3EET A;  3SHF A;  4IHS A;  4ESB A;  4AIJ A;  2L02 A;  3JAM K;  1XCB A;  4DNC A;  2XGX A;  4G7O F;  2GIV A;  4XSX F;  2FQ3 A;  1CGP A;  1D8J A;  4HBL A;  4LMY A;  5HOO A;  2XAQ A;  1LNW A;  3T8T A;  1F4K A;  5BQT A;  1BC8 C;  2K02 A;  1B9N A;  2Z5U A;  2FRH A;  1P4W A;  2EJR A;  3AAF A;  3DFG A;  4HYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...