1AOYA

N-terminal domain of escherichia coli arginine repressor nmr, 23 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGININE REPRESSOR
publication title Solution structure of the DNA-binding domain and model for the complex of multifunctional hexameric arginine repressor with DNA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 14
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1aoyA00
1R5HA 2EB7A 2QUFA 3WTZA 2HWVA 3ELKA 4MTEA 3GZ6A 2FNAA 3RYRA 2HFHA 2JPCA 4RB2C 2DFIA 1XSXA 4L9JA 2HR3A 3RTRA 3JSOA 1QPMA 5L3CA 4A5MA 2ZXJA 2RNJA 1XGSA 3F8CA 2K4JA 2R3SA 2W24A 2VN2A 3GX4X 4AIKA 2NAZA 2FOKA 1U5TC 2P4WA 1USTA 3R6SA 5LEJA 1J75A 4MHGA 4BAYA 1AWCA 5DUKA 4CYDA 3N97A 5E17F 1F5TA 5TRDA 3KLOA 5K5RA 4D0PA 3NRVA 2Y75A 3RKXA 4FX0A 3ZN1A 3M8FA 4RGUA 3JTGA 1SMYF 1IRGA 4FHTA 3D5LA 1I5ZA 2DQLA 1R7JA 2EK5A 4G6DA 2FBIA 4ASNA 2EWNA 2QWWA 4EJUA 1VTNC 3N4MA 2PMHA 4MTDA 2A07F 2PMUA 4EV0A 4UVCA 2JRTA 4KN4X 1FWZA 1QZYA 1K6OA 3SZPA 4AIHA 5CVIA 3EUHA 5EEHA 4M71A 1OPCA 2GA1A 2Z99A 4WCGA 4LLGF 3E5QA 2NS0A 5BS6A 3CUQA 1MDMA 2PI0A 5D5WB 2PLYA 3WU1B 4M73A 2A6HF 2MLKA 1ZARA 5LHHA 1FX7A 4G94A 2QBYA 3BDDA 1B1BA 2VONA 4YG2F 2MD5A 2O61A 1ZN2A 1WQ2A 3HTUA 1I6XA 4Y17A 1FYKA 2KJCA 3EYYA 3QOPA 1D3YA 3QAHA 1K78A 1QBJA 4UNOA 2BE5F 2MC3A 3RKWA 4M6XA 2KJBA 3GEZA 4TV7A 5L3DA 5D4RA 4KUMA 1ZLKA 4KICA 5EEGA 2XAFA 1DUXC 3CUQC 2FU4A 3IL2A 2HQRA 4HX4A 3HOTA 5DEQA 2Y0MA 2OQRA 3BROA 2WC2A 3FXRA 1E17A 1ZHFA 5JHUA 2V1UA 4Y15A 1KQ8A 1J0RA 1REPC 2RDPA 3J81Z 5DCMB 4HF1A 4S05A 1UHMA 2RGVA 2D1VA 3D0SA 1ZH5A 5FGMA 1G3YA 3GZ5A 1R1TA 5ICGA 1XGNA 3LSTA 4AD9A 3E97A 1FOKA 2F5EA 3KP4A 1OYYA 1W4MA 1KQ9A 5A2QK 4IVNA 3CUOA 1K7AA 1MZBA 2ISYA 2H6BA 1FBUA 3KZZA 2ZNZA 4KIBA 2B0LA 1HW1A 4EJOA 5LEKA 1U3EM 3IHUA 4LK0F 2QENA 3RIRA 4Z2YA 5LBQA 4L0YB 1ON1A 5BPDA 3DEUA 4CZZA 5E20A 2DTRA 4RGXA 3M8EA 3GLXA 4G8XA 3RDIA 2MLGA 2O3FA 2PEXA 3HIFA 4ZYDA 1W7PA 5LRSA 1EH6A 1QQIA 3LA2A 5DD4A 2H27A 1O3QA 5DD8A 2VE8A 5BQTA 3ZMSA 3QRFF 5JR3A 3T1BA 2ZMEA 2HKXA 4U0YA 3QPHA 2RQPA 4HDVA 1MJ9A 3L7WA 3FX3A 1S7AA 3L09A 2V1DA 3ECHA 2PN6A 3KP7A 3MQ0A 2HKOA 2PQ8A 2HEOA 4ZZLA 2E7WA 2STWA 4F7ZA 4NQWA 3EYIA 5K5OA 3ZMDA 3BJ6A 1R36A 4WXDA 2FSWA 2W57A 2M87A 1P4AA 4PCQA 3NQOA 3F8FA 4UVBA 3IKTA 3L2CA 2Y48A 1V3FA 3QP5A 1IN6A 2IA1A 4HF0A 1TLHB 1XCBA 4EJVA 1STZA 3V7CA 4AIJA 2GWRA 2BV6A 1YLFA 1ZYRF 4LFUA 4EVIA 4L9TA 3RI4A 5BOXA 3E6BA 4EGYA 5LLQA 4L18B 2HQNA 3JAMZ 3I64A 1CF7A 5HLGA 4HDUA 1L0OC 3H92A 1ODDA 4U0VA 1KGSA 4M72A 1YYVA 5D8KB 1AOYA 3J7AO 3I4PA 4RB3C 3BWGA 1H0MA 5DCFA 3EQLF 1G3WA 2HTSA 1RUNA 3ML6A 4EJTA 1U2WA 4JK1X 3TOBA 1USSA 2P5VA 5L3BA 3LWFA 2IRFG 2IP2A 3HRUA 3R0JA 3JSPA 2P6TA 4XLNF 1R22A 3P7NA 1MGTA 3HHHA 3FM3A 5AONA 3WODF 3K1NA 2VBWA 4LD5A 2EFWA 2NNYA 3KLNA 4I98B 1FNNA 5F1RA 3H3UA 3DF8A 5HOOA 1Y0UA 3J80K 2D45A 4WK8F 2DAOA 3KP3A 2A69F 2FRHA 5L3EA 1IAWA 2G7UA 2XAGA 4MEXF 1PP7U 1S7OA 3ZQ7A 2M1BA 3G73A 1Z6RA 3WG9A 3BJOA 4Q47A 3FF5A 5ED4A 4PZJA 3V4GA 2OZ6A 1ZG1A 1ON2A 1P6RA 2QBYB 3TDUC 3IC7A 5J8CA 2Z33A 5HDNA 5HS7A 4M9ZA 5K5QA 2HS5A 1U5TA 4EJWA 3R0AA 3DP7A 2CO5A 3DKWA 5D6FA 2LSOA 4EQQA 1K78B 3GXOA 5CVUA 2LKPA 1LEAA 4LMYA 1LJ9A 1BN5A 1QO0D 4YIFA 2OAZA 2VBYA 4DQ2A 1MJAA 3E6MA 3IRQA 1KA8A 3TOAA 1MJBA 4EM1A 3LA3A 1Z9CA 4ESFA 3WGHA 2EV0A 3KFWX 3L9FA 1H9TA 1XDUA 1MD0A 3L00A 1HW2A 3ZMZA 2YU3A 3FWEA 5AIPA 4WXHA 3EDPA 3O3KA 4HOBA 4HZFA 4UHTA 1YG2A 2JT1A 3HTSB 2FE3A 4L9NA 1SFXA 3QPTA 2LF8A 3I59A 3TKYA 3I0TA 3C7JA 1BIAA 1UFMA 2M8EA 4O3MA 4G7HF 2K27A 4ESJA 4NHJA 1BIBA 2VBXA 5CLSA 2M30A 2A5YB 4ENMA 2Q0OA 1A04A 4ENKA 2ETHA 1FY7A 4XLPF 4XSXF 3E6DA 4EMSA 2NRAC 5J6XA 2P6SA 1Z1DA 4LG0B 4YFXF 4I7HA 5FLXZ 4EM0B 2MH9A 3T0YA 3WTTC 4FT8A 4PGHA 1G3TA 3E5XA 1ULYA 2GXBA 1RIOH 4G7ZF 1HKQA 2ESHA 1ZGJA 2ZKZA 1IF1A 2M5WA 1ZRDA 2ZFWA 4RB0A 2QVOA 1I27A 1W5SA 2ZBKA 2GIVA 1TQMA 1PDNC 3WGGA 2WTEA 1IW7F 3KP6A 2J5PA 2EFQA 1XMKA 2F5DA 1R58A 2Z9OA 4LLNA 1BOAA 1F4KA 2ZMEB 3ZMUA 3K1MA 3MAJA 4MEYF 1ONVA 5JVTA 1YQAA 1HSTA 3I5UA 2IPQX 4S04A 5D8LB 5ICFA 4BNCA 2XUBA 3KEOA 1B9MA 4A5NA 4OIPF 5A2QZ 2LDUA 2RKHA 1IN8A 4M9XA 4HW0A 1P92A 1EV7A 2ZNYA 1SD6A 3TO7A 1BI1A 1TBXA 3IWZA 3LAPA 3E5UA 4M6YA 4P5OA 3Q5FA 1HKTA 5J8FA 2BEOA 4CGZA 1E2XA 3GO5A 5HDKA 2Q2EA 2DLLA 5HLHA 3HHGA 2XKPA 3ZN0A 4I0BA 5E1WA 3T8RA 3MZYA 1YW7A 4ZYGA 3B73A 2FA5A 4U7BA 2CG4A 1KU7A 1S8NA 4O6JA 1JHFA 3K9TA 2K86A 4R79A 1W5TA 1S3JA 1OYWA 1FSHA 4HLXA 5HS8A 1F9NA 3WGIA 3VODA 2VOPA 1V4RA 4ESBA 2OU2A 5ILVA 3VB2A 1FYMA 3W6KB 4HV5A 1P4XA 1B9NA 1IUYA 3HUGA 2X0LA 4G9YA 4ETSA 1ZLJA 2Q8KA 1BM9A 1G6NA 3M7GA 3ULQB 3KP5A 2PFBA 4WWCA 3F6OA 1D5VA 1PUEE 5E8IA 2W25A 1WWXA 5CVJA 5DUIA 3BPXA 2QQAA 1XN7A 2O8XA 3I54A 1RUOA 2NNNA 2DQRA 4N9IA 3ZPLA 2F5FA 3C3WA 1O3SA 3HRTA 4LB5A 3T8TA 2BGCA 4IXAA 4IJAA 1SAXA 3CLOA 2L02A 1R23A 3C18A 5D5UB 1FLIA 2OQGA 4LGWA 2BYVE 3BPVA 2KIFA 3BJAA 4M74A 4KA4A 2D1HA 3GWZA 5ICEA 1C0WA 4R1HA 1ZRFA 2H09A 3DQVC 3WTYC 4KT5C 1GXPA 5D6EA 1LQ1A 1RI7A 4Y13A 4RS8A 2CQKA 2CW0F 5IT9Z 3SFZA 2L3DA 5LGNA 1XDSA 3QU3A 2A3SA 2HZTA 2L01A 1S29A 1KQ0A 2CWEA 1R00A 2XAJA 3GUDA 1ZAOA 2JPBA 1P4WA 3WTWC 3GVAA 4I09A 3S2WA 4P9UA 4HAMA 1KU9A 3F72A 1JGSA 1QGPA 4RAZA 4L5JA 3FM5A 3HSRA 4MQ9F 3KEQA 5HVQC 1KU2A 3HOSA 5FO5A 2XVCA 3CTAA 2IVMA 2UXNA 1O57A 4OIRF 4PDKA 1TTYA 2P8TA 4LLLA 1B59A 3F8BA 3F8MA 1KYWA 3CJNA 4FX4A 4BH9A 3LA7A 1DDNA 2VT3A 4YFNF 2OA4A 2QQBA 5FD6A 5CJ9A 3T5XA 2VE9A 5H20A 1WSUA 2CFXA 1XD7A 3FXQA 2KKOA 3M1EA 1UHWA 3F8NA 2W85A 3MWMA 1IN7A 1T38A 2GA2A 3Q9VA 4M9SA 1FT9A 5F6FA 3GF2A 3WTUC 3ZP5A 3RPUA 2WWYA 1J59A 5L3FA 2RVCA 3FZVA 5DCMA 2L4AA 1R1VA 1BC7C 1SMTA 1YIOA 4MGRA 5D5XB 4P9FA 4ZYHA 1HW5A 1I1GA 2VC0A 4QLCU 4OU0A 4U88A 5ILSA 3MFKA 2JSCA 2DO7A 1WI9A 4CHUA 4IF4A 1YO5C 1KYZA 2HYGD 2ZCWA 3U1DA 4IRGA 1RNLA 1J5YA 1LDDA 4HX8A 2LNBA 2F2EA 3V7RA 2FBHA 1ZGAA 4MNUA 2YX7A 3HSFA 3WTSC 3GFIA 2P7CB 2ZO4A 2CYYA 2G7HA 1T39A 2YX4A 1FYLA 2AXLA 3FMSA 3CUQB 1Z7UA 1MDMB 1O3RA 3VOEA 4KYWA 2BBYA 3K69A 3LQQA 1OKRA 4BHBA 2L54A 1TNTA 2P5LC 3RKYA 4AVPA 1SFUA 3U9GA 2PG4A 2MBFA 4I0AA 1H9GA 4OIQF 2RN7A 1SD7A 1YTYA 3RPQA 3TO9A 1IRFA 4BHPA 2M45A 3FMRA 2EA4A 1P2FA 2V9VA 2O03A 1ZG3A 3DFGA 2AS5F 3RYPA 2UXXA 2VBZA 2O0YA 2PJPA 2GAUA 2QM3A 1XCVA 4RGRA 1B6AA 3V8KA 5FB2A 4ZYEA 4UXNA 3BZ6A 3M9AA 3K0LA 4ENNA 5HS9A 4RB1A 1GHCA 5DDGA 4IHTA 3K1PA 2DPUA 2UZKA 1SFEA 1LVAA 1DPUA 3KZYA 4KMFA 4JBAA 2GQQA 4RGSA 3MCZA 1IN5A 4I02A 4L0ZB 2FQ3A 4UVAA 3NEUA 1FP2A 5E18F 4H0EA 2FBKA 1LNWA 4ENJA 5F64A 3Q9SA 5FD5A 5KVRA 4KN7X 1TW2A 1D8KA 2V79A 1IZ1A 2KRFA 3B02A 2P7VB 1XGMA 2X4HA 2ADUA 1FZPB 5JI6A 3OOPA 4A6EA 2ACJA 3JW4A 1S6LA 1UCRA 3ZMVA 1BI3A 5DYMA 1FSEA 1YW8A 3QU6A 4HQEA 2XGXA 5LGUA 3GFMA 1X3UA 1ZREA 2IT0A 4Q4ZF 4XBFA 2RC4A 3O6BB 2VT2A 1EH7A 1XGOA 5LHGA 1HBXG 4Q5SF 2CSOA 3PQKA 1FBSA 1FP1D 1W7PB 2ELHA 2EFNA 4GGGA 5FFXA 2EV6A 5BMZA 1LB2A 3P9IA 2CGPA 2GZWA 4IPAA 5ERIA 5E8GA 1TQIA 2YPRA 4HLYA 2DT5A 3HSEA 4XSZF 5JFRA 2DK5A 4ZH4F 5E1ZB 3TQNA 3HRSA 2F5CA 4G6QA 3WE3A 2XASA 3RJPA 4N9HA 3BOQA 2EV5A 2DPDA 3BP8A 2FNPA 4IRIA 5AIQA 4CDGA 4KNYA 3GFJA 5HLIA 4B09A 2MH2A 4A12A 1HQCA 3V8JA 4XRFA 1W7PD 1LDJA 1SD4A 1BI0A 2E1CA 2LF7A 2HOEA 1QNTA 1GVJA 2WV0A 1XSVA 2XAHA 3ABUA 1TNSA 3CO6C 5FLXK 1DP7P 4LJZF 1YW9A 1OR7A 3CDHA 3ROUA 5KK1A 4LB6B 3AAFA 1XB4A 3VFZA 1IXCA 1MKMA 4I2OA 4OMZA 3WTVC 1Q1HA 2NYXA 3BY6A 4P96A 2KIMA 1U6GA 3F21A 4WF2A 2V6CA 4U0WA 3IRRA 3K2ZA 2Z3YA 3LAJA 1PP8F 2JZYA 1T0FA 2STTA 1CF7B 3TDZC 1J2XA 2DU9A 2EJRA 1QZZA 2YR2A 1FBQA 4KMUX 2ESNA 3O2PE 1R5GA 1SD5A 3G3ZA 2JTVA 4AWXB 1O3TA 3OV8A 2D2WA 1T98A 1U8RA 3HRMA 1WKMA 4JQFA 4OIOF 4RAYA 3ERED 4K2EA 4HA8A 3MEXA 4CICA 1JXSA 1BJAA 4BXUA 3F22A 3R60A 4HBLA 2XIGA 2QYOA 5TJJA 3COAC 2EFPA 1I1SA 4CO8A 5ILUA 3KCCA 3FHZA 1EH8A 4L5IA 5CVVA 3E3VA 5K1YA 2E7XA 3WU0A 3IWFA 2IA2A 2RV8A 4UV8A 4LG0A 3QP6A 3SHFA 5D5VB 3P9KA 4G7OF 1J9IA 4KFCA 4BHCA 2G9WA 4LK1F 3V8LA 2ZJ2A 5HDGA 4ZZDA 4A0ZA 1YS7A 4WX9A 3R61A 4KIGA 2ISZA 1YFHA 1B4AA 4OINF 1NHAA 4A2UA 2VXZA 4U7DA 3VEPA 2J5OA 3F3XA 4GO1A 3W6JB 1WRJA 1OYIA 3PQJA 4GCVA 1XSDA 4HF2A 1Z05A 5DV5A 2P5KA 3J81K 4A0XA 4B8XA 3GFLA 4P55A 2H94A 1BC8C 4Q48A 4A0YA 4BQAA 1J7KA 4A6DA 1R1UA 1U5TB 2DW4A 2OZUA 4IRHA 2XRNA 2IJLA 2EA2A 1HKSA 1G3SA 2VC1A 4HYEA 2FF4A 2HDCA 2A61A 3I53A 1ZRCA 1JHHA 2HYFA 3SXYA 3ECOA 2DK8A 1Z91A 2XHKA 3DPLC 3V7SA 1TW3A 4HV6A 4YIIA 1F1ZA 5IT3A 1OMIA 2DI3A 4OMYA 1LEBA 4UV9A 2OBPA 2W84A 5ICCA 1BI2A 3DV8A 2EFOA 3LFKA 2A68F 4GYIA 3I71A 3WTXC 1TQPA 2XROA 3TO6A 2VODA 4QWQA 3ABTA 1KU3A 4E70A 5H6QA 3J80Z 4MQVA 2OD5A 4CXFA 3TGNA 5LGTA 4YFKF 2UWMA 3P9CA 2E1NA 4KIFA 3I59B 4EGZA 4L9VA 3FXUA 2L4MA 4OOIA 2R7FA 1FPQA 3LQRA 5IT9K 2K4BA 5H6RA 1CGPA 4GYGA 2IW5A 2QLZA 3ZMTA 3WE2A 1G4DA 1L3LA 3I58A 1Z6TA 4PGGA 3KE2A 1JE8A 4IHSA 3GYHX 2A6EF 3CO7C 1IXRC 5FFZA 1BBYA 3ISPA 3FMQA 1T2KA 2O6GE 3F6VA 2XV4S 1HXDA 3IKVA 4I01A 3SZTA 2MA3A 2K02A 3U2RA 4GXOA 2H6CA 3KP2A 3E6CC 2GXGA 3REOA 5CVRA 4DNCA 2Z5UA 2HGCA 2FEZA 3JTHA 1IN4A 1DPRA 2V1XA 2YSRA 4ON0A 1ZG5A 1FC3A 3R4KA 1YS6A 3GW2A 1K79A 2XKOA 1LDKB 6PAXA 4UUVA 5LHIA 2COMA 2IA0A 3JAMK 2DBBA 3MZHA 4KDPA 2FMYA 1RZ4A 3F23A 3PFIA 2QQ9A 4HX7A 4BYYA 1O7FA 1UB9A 1HSJA 4R8HA 1GXQA 5LRRA 1XMAA 1O7LA 2PBIA 2VOOA 2R7DA 3KETA 1T6SA 5L3GA 5BPIA 2C6YA 3SQNA 3H3ZA 5E1XA 3C1DA 5D4SA 2FXAA 2TDXA 2XAQA 1U78A 1IXSB 3HYIA 2QZ8A 4WXCA 2FMLA 2KIUA 2HTJA 3EETA 4O5VA 3DPTA 5CYVA 2K7LA 4HQMA 4NB5A 4EM2A 1D8JA 4N0BA 3DXJF
chains in the Genus database with same CATH superfamily
1R5HA 1DQUA 2EB7A 3HKZA 2QUFA 3WTZA 5DM6F 5B1BH 1QA6A 3OR1C 3G1MA 2HWVA 4NC7A 4RAFA 1ETYA 3ELKA 4MTEA 2CQXA 3GZ6A 1R4MB 4XR6A 2FNAA 1ZK8A 3RYRA 2HFHA 1S7EA 2JPCA 4RB2C 1YJNI 2CUZA 2DFIA 2OTLI 1XSXA 1FTTA 3HUGB 2HR3A 4L9JA 3OIPA 4AC0A 3OIOA 3RTRA 2BVMA 3LSGA 3JSOA 4D7NA 1QPMA 5HNFA 4M3DA 5L3CA 2ZSIB 4A5MA 2ZXJA 2H1KA 5J1RA 2RNJA 3BZCA 1XGSA 2HXIA 3F8CA 3WG7H 2K4JA 2R3SA 2W24A 2VN2A 3CDIA 3GX4X 2NS7A 2BY3A 2WADA 4AIKA 3S3OA 2OCEA 2NAZA 1EKEA 4A3CJ 2FOKA 1U5TC 5IPAA 3HOZJ 2P4WA 1USTA 3R6SA 5LEJA 2QSHX 1J75A 3H5NA 3FDYA 4MHGA 3ESWB 3GZNB 3CLQA 4BAYA 4Y7NJ 2HOSA 1AWCA 2FQ4A 3DCFA 3IUOA 3W6VA 5DUKA 4CYDA 2DYSH 3SEZA 2DA4A 3N97A 5E17F 1F5TA 4XLEA 5B66C 2UV1A 2W48A 3IAM2 5TRDA 1UZCA 3KLOA 2VL8A 3JCUC 1ACIA 2NS8A 5J40A 3CCLI 5K5RA 4D0PA 4RDUA 3NRVA 3S2DJ 3I4MJ 2Y75A 2RAEA 3RKXA 3BR0A 4FX0A 3ZN1A 3M8FA 4OAZA 4RGUA 2W1OA 3JTGA 1UG2A 1SMYF 3AG1H 4S0HB 1IRGA 4FHTA 3G71I 3D5LA 1Z77A 1MMAA 2R5ZB 1I5ZA 2DQLA 2OPTA 1R7JA 1MH4A 2EK5A 1K6YA 4G6DA 2FBIA 4ASNA 2EWNA 2QWWA 4EJUA 4ZJZA 2V4JC 3W2WA 3ERMA 1VTNC 2WAQA 3N4MA 2PMHA 3OYBA 3GTLJ 2LP0A 4MTDA 2A07F 4NC8A 4BS9A 2PMUA 3FXJA 3SYTA 4EV0A 4UVCA 1A35A 2JRTA 4CCNA 4KN4X 1FWZA 1QZYA 4XN0A 1K6OA 4ZDPA 3SZPA 4AIHA 1FOXA 4E7JA 5CVIA 3EUHA 5M3MJ 3PL8A 3VWBA 3PM1A 5EEHA 4M71A 2ZC2A 1OPCA 2GA1A 2Z99A 4WCGA 4LLGF 2VQLA 4E7ZA 3LNQA 4I76A 3E5QA 2NS0A 5BS6A 4XIDA 3JRBA 3M07A 1JGGA 3CUQA 1MDMA 1VZ0A 2PI0A 5FJ8J 1IG7A 5D5WB 3IAS2 4FISA 2PLYA 1N25A 3WU1B 5KAFC 3F9KA 2F4OB 4KJZA 4M73A 2A6HF 1FOWA 2Q1ZB 3FBNB 2IAIA 3KZIC 3I9V2 4G6TB 3PNTA 2MLKA 2DFEA 1ZARA 5LHHA 2QSFX 2TCTA 1FX7A 3CC2I 4DW6A 4G94A 2QBYA 3CJTB 3BDDA 2L7MP 1B1BA 2VONA 2PJRA 2AQEA 1Z7LA 4YG2F 2MD5A 2O61A 1ZN2A 5J4YA 1WQ2A 3AG4H 3HTUA 3TMOA 3S93A 1I6XA 2M8GX 4Y17A 1FYKA 1MBHA 3LSPA 1SFKA 1DU0A 2KJCA 3EYYA 3QOPA 1D3YA 3AG3H 3QAHA 2XC7A 2L7ZA 4IZZA 1K78A 3J7AY 1QBJA 3Q0WA 4UNOA 2BE5F 4D7MA 1P7JA 4BU2A 1A5JA 1X1CA 2MC3A 3ONQA 3RKWA 1RKTA 2CUEA 2L9VA 3GTPJ 4M6XA 2KJBA 3GEZA 4TV7A 3H9QA 3EUHC 2XF6A 2CFOA 2QKMB 5L3DA 5D4RA 4KUMA 5DTDA 1Y56A 1ZLKA 4KICA 5EEGA 3L2QA 2DDBA 1ETWA 2XAFA 1I50J 1DUXC 3CUQC 4M3FA 1CQTA 3HGYA 2FU4A 3OIQA 3IL2A 2HQRA 3H5RA 4HX4A 4BJTA 1VNDA 3OYLA 1MBGA 3HOTA 4F93B 5DEQA 4M6VA 4B3XA 3S17J 2Y0MA 3PFYA 2OQRA 2WY7Q 3BROA 2WC2A 3FXRA 1E17A 1ZHFA 5JHUA 2V1UA 4Y15A 1MSFC 1KQ8A 1J0RA 1REPC 2RDPA 2WY8Q 3J81Z 5DCMB 5K7HA 1VQ4I 4S05A 1UHMA 4HF1A 5M5YJ 2RGVA 3I55I 2D1VA 3TW7A 3D0SA 5BNGA 5F04A 2XF5A 1ZH5A 2QA4I 5FGMA 1G3YA 4NBQA 2VKEA 3GZ5A 1R1TA 5ICGA 1IJWC 1XGNA 3LSTA 2BVLA 4AD9A 2Y30A 4N4NB 3E97A 1FOKA 4BBSJ 1U9OA 2F5EA 4FETA 4FE7A 1OCTC 3M3YJ 2K9QA 1B72B 3KP4A 1OYYA 3RCOA 2DT7B 1W4MA 1KQ9A 5A2QK 4IVNA 5IP9J 3CUOA 4BL0B 1W5CC 2LBFA 1K7AA 2CQQA 5F08A 1MZBA 2KRCA 4U87A 4B48A 2ISYA 2H6BA 1FBUA 2DMPA 3KZZA 2ZNZA 4KIBA 2B0LA 4IHWA 3GBGA 3OYMA 3LSRA 1HW1A 4RAGA 3ZQQA 2DODA 2JA7J 4LG3A 4EJOA 5LEKA 4CCOA 1U3EM 2VPLA 3IHUA 4A3JJ 4LK0F 2QENA 3ZQIA 3GLLA 3RIRA 4Z2YA 3KIOA 2EILH 5LBQA 4L0YB 1ON1A 5BPDA 3HOUJ 4E7HA 4B43A 3DEUA 4CZZA 5E20A 2DTRA 2JJ7A 2Y0SN 4RGXA 2DXIA 3M8EA 1K4SA 3GLXA 4G8XA 3RDIA 1DP3A 3BQYA 2R7RA 2MLGA 2O3FA 2PEXA 2NVQJ 2NVYJ 3HIFA 4ZYDA 1W7PA 4IEJA 1EH6A 2BOLA 3H36A 1QQIA 5LRSA 1R49A 5KCMA 3LA2A 3JRIA 3ABLH 3CQZJ 4RMNA 5DD4A 2H27A 2AQFA 3MVPA 2ECCA 1X4PA 4LIUA 3QPLA 1O3QA 5DD8A 2VE8A 5BQTA 3ZMSA 3QRFF 5JR3A 3T1BA 2ZMEA 2HKXA 2XPVA 4U0YA 3H35A 3QPHA 1PUFA 2RQPA 5DS9A 4HDVA 1MJ9A 3DLAA 3FX3A 3L7WA 4IQJA 3HB9A 2K9MA 2KP6A 1S7AA 3B6AA 3J7YJ 2M0CA 3L09A 3K7AJ 2V1DA 2XDVA 3ECHA 2PN6A 2EBIA 2EZKA 2JUCA 3KP7A 3EUAA 3MQ0A 2HKOA 2K9SA 2PQ8A 3PNVA 2HEOA 4ZZLA 2EIKH 5C3EJ 2E7WA 3HGGA 5FKOA 2OV7A 2STWA 4F7ZA 4NQWA 3S1RJ 3EYIA 5K5OA 3ZMDA 3BJ6A 3OYIA 2BW3B 2NOJB 2R7XA 1R36A 2CW8A 4WXDA 2FSWA 4ZTFA 2W57A 3DEEA 2M87A 1VI0A 5FRNA 1P4AA 3LOCA 5GP9A 2R7VA 3CMYA 4PCQA 4C30A 5FROA 1O4XA 1PYVA 3LSKA 4QSHA 3NQOA 3CJQB 1HLVA 3F8FA 4UVBA 3IKTA 1LE8A 4OAYA 3L2CA 2Y48A 1AKHA 1WJFA 1V3FA 3L2WA 3QP5A 2EIJH 4A3BJ 4BXFA 1V5GA 2Y9YA 1IN6A 4Y4RA 2IA1A 3PSIA 3OYCA 1TC3C 4HF0A 5IOZA 2WB1N 2NVXJ 1TLHB 1XCBA 1FEXA 1MIJA 4EJVA 1MH3A 1Y39A 1JJ8C 1STZA 2X6XA 3V7CA 4AIJA 2GWRA 1K61A 2R5YA 1OCCH 2BV6A 2X1CA 1YLFA 1ZYRF 4JX6A 3HG9A 5K7FA 3CCUI 2XPUA 4LFUA 1T8IA 1HC8A 3S3MA 4EVIA 4OWRB 2OF7A 4L9TA 3QYBA 3RI4A 5BOXA 2BY2A 3E6BA 3G2BA 4EGYA 5LLQA 4L18B 2HVQA 2HQNA 2CV0A 2CUJA 3JAMZ 3ZR8X 2GIZA 3I64A 1X1PA 1SVLA 1W36D 1CF7A 3GTQJ 2IGNA 4F91B 5HLGA 4DBRA 4HDUA 4PJLA 1L0OC 3H92A 1ODDA 4U0VA 1KGSA 5KNLA 4M72A 2Y9ZA 2E2IJ 4NUBA 1YYVA 5D8KB 1AOYA 2QGUA 1SANA 3J7AO 3I4PA 2X6OA 4RB3C 3BWGA 1H0MA 4E7LA 5CQGA 5DCFA 2IEKA 4XOTA 3MKWB 3VYTB 5EGOB 1XC5A 1G3WA 3EQLF 3OYHA 2HTSA 1QHGA 1WGXA 1RUNA 2IS4A 3ML6A 4EJTA 4HSRA 4E6KG 4XICA 4Y3OA 2XRLA 3W3CA 1SEUA 1U2WA 4JK1X 3J7ZI 2E19A 3MMYB 2O7OA 3TOBA 1USSA 1E0EA 4RBOA 2B9SA 5J3LA 2ID3A 4C3JJ 1Y1WJ 2MD0A 2P5VA 3PNYA 5L3BA 1XPXA 5GTIC 3LWFA 2IRFG 2IP2A 3HRUA 3R0JA 4EEFG 3JSPA 5E3LA 5IYDJ 3DTIA 2P6TA 1U8BA 3CD6I 4XLNF 1R22A 3OMYA 3P7NA 3S1QJ 4BQOA 4ZDLA 3FK7A 3MKLA 1MGTA 4IHXA 2L0KA 3HHHA 1I39A 1Z3XA 1G8XA 2BZTA 2TRTA 3FM3A 4RLFA 5AONA 3WODF 1JT6A 2IS1A 4CSWA 1NG7A 3K1NA 2VBWA 4LD5A 4AU7A 1G59A 1JTXA 2EFWA 1V5EA 2NNYA 3KLNA 1SVOA 2A5WA 4I98B 1FNNA 1TT5B 2PX9A 5F1RA 3H3UA 2ZJQF 4C2UA 1YX3A 3DF8A 3K4JA 5HOOA 5DM7F 1Y0UA 4PSXA 3J80K 2D45A 4WK8F 4JP0A 2VJIA 2DAOA 3KP3A 3KYCB 2A69F 2FRHA 2D5VA 5L3EA 1IAWA 2G7UA 2XAGA 3OL4A 4MEXF 1PP7U 2E36A 5M5WJ 3OOUA 1GVDA 1S7OA 3ZQ7A 2M1BA 4J00A 1FJLA 3G73A 1Z6RA 2HYJA 3WG9A 2QF7A 3BJOA 4Q47A 3FF5A 3S15J 3K4LA 5ED4A 2FD5A 4PZJA 4N4OB 3V4GA 2LRDA 2OZ6A 1ZG1A 2M2EA 4BY7J 1ON2A 1P6RA 2QBYB 1R6RA 3TDUC 2DOEA 3U21A 2LOOA 3IC7A 1OCZH 5J8CA 2Z33A 5HDNA 5HS7A 1SAUA 2JMWA 4M9ZA 2F5VA 5K5QA 2HS5A 3E7LA 1U5TA 3HBLA 4EJWA 3PJRA 1W1WE 3R0AA 3DP7A 2CO5A 3LSIA 1AA7A 3DKWA 5D6FA 1APLC 1VQ5I 2LSOA 4EQQA 1K78B 5JLXA 4NDLA 3S14J 4RA2A 1ETOA 3GXOA 5CVUA 2LKPA 1IDYA 1LEAA 4LMYA 2LR8A 1LJ9A 3FISA 4B44A 3AG2H 1BN5A 2IBDA 3K4NA 1QO0D 4YIFA 2OAZA 3D1NI 2VBYA 4DQ2A 1MJAA 4HPQA 3E6MA 3IRQA 2HOAA 2IS6A 1KA8A 1TP4A 2OCCH 1FMVA 3BC8A 3CCRI 4B47A 3HOVJ 2CS3A 3TOAA 1MJBA 4EM1A 2LG4A 3LA3A 1Z9CA 2EZIA 1ZR4A 3DTKA 3ZQHA 1F36A 3A2KA 4UUSA 4ESFA 2B63J 3WGHA 3DTEA 1T56A 2EV0A 3KFWX 3L9FA 1H9TA 2M0MA 3BR2A 4AYBN 1RKWA 1XDUA 1MD0A 3L00A 1HW2A 3ZMZA 2YU3A 2X9DA 3FWEA 5AIPA 3LFUA 4E7IA 4WXHA 1YIJI 1Z21A 4CYCA 3EDPA 3O3KA 4HOBA 4HZFA 4UHTA 1YG2A 2JT1A 3HTSB 1TT0A 2FE3A 4L9NA 2WAEA 1SFXA 3QPTA 1A6IA 3PIPF 4XNFA 3S32A 4DIQA 2LF8A 1N75A 2FJ1A 3I59A 3TKYA 2LC2A 3I0TA 1DGWY 3M1CA 3C7JA 3ASOH 1BIAA 1UFMA 2M8EA 4O3MA 4G7HF 3Q0UA 2K27A 4ESJA 2DMNA 4NHJA 4QTRA 2CW7A 1BIBA 2VBXA 5CLSA 3QODA 2M30A 2A5YB 2ZSHB 4ENMA 1MBKA 2Q0OA 1A04A 2XB0X 4ENKA 2CJJA 2H8WA 2ETHA 1FY7A 4XLPF 4BUPA 4XSXF 3L2UA 3E6DA 4EMSA 2XSJC 2NRAC 5J6XA 2P6SA 1Z1DA 4LG0B 2R93J 1Z67A 1MMDA 4I7HA 2BHZA 4AVZA 2DJNA 4YFXF 4AM3A 5FLXZ 4EM0B 2Z1DA 2R7QA 2HPMA 5B5EC 1I3AA 2MH9A 3T0YA 1FIPA 3WTTC 4FT8A 1JI8A 1UELB 3CESA 3CMEI 2WBMA 1A6QA 4PGHA 5FRMA 2KQRA 1G3TA 2MABA 4A3LJ 4CCKA 3E5XA 1ULYA 2GXBA 1IDZA 2DFHA 1RIOH 3CCQI 1WPKA 5EDNA 4G7ZF 1HKQA 5J47A 3U1KA 2ESHA 1ZGJA 2DOFA 2M4GA 2ZKZA 2M5WA 1IF1A 1ZRDA 3OSGA 1LFBA 2ZFWA 4RB0A 1YRNB 1ZELA 2QVOA 1I27A 1W5SA 3HOXJ 1XTAA 2ZBKA 2HPIA 3GTMJ 2GIVA 1TQMA 3IP4B 1T95A 1B8IA 1PDNC 3WGGA 3A0HC 3H5AA 2WTEA 1IW7F 1E3HA 2J5PA 3KP6A 2XPWA 2EFQA 1XMKA 2F5DA 4HNUA 4XKBA 1R58A 2Z9OA 4LLNA 1BOAA 2V9KA 1F4KA 2LY2A 4Y33A 2ZMEB 1VQLI 2KIQA 3WHCA 2W7NA 3QWLA 3ZMUA 3K1MA 3MAJA 1X4OA 3VYUB 3OYEA 3BTLA 4FE4A 4MEYF 1ONVA 5JVTA 4DZJA 1YQAA 3DBLB 1RESA 2EZHA 1HSTA 3I5UA 2IPQX 4S04A 1K4TA 1X1AA 2N8GA 3BTJA 2E2HJ 5D8LB 5ICFA 4BNCA 2VQCA 3HPHA 5HNHA 2XUBA 3KEOA 1MBEA 1B9MA 2BY0A 4A5NA 1GLNA 1Q1VA 4OIPF 5A2QZ 2LDUA 2RKHA 2XB5A 5CKTA 1IN8A 4NQWB 4M9XA 4HW0A 1P92A 1EV7A 3AL0B 2ZNYA 1SD6A 3TO7A 4B3AA 1BI1A 1TBXA 4HNVA 3IWZA 3LAPA 3C2BA 3E5UA 3P5JA 1T33A 4M6YA 4P5OA 3WHBA 2JRMA 4IHVA 3Q5FA 1HKTA 5J8FA 2BEOA 4CGZA 1E2XA 1DGRM 3GO5A 1IGNA 2LK2A 5HDKA 2Q2EA 3SFIA 2DLLA 5HLHA 5C4XJ 1AKHB 1JUPA 2EH3A 3HHGA 1HA8A 1RR8C 2JA2A 1YOVB 2XKPA 1MNEA 5IYCJ 3ZN0A 4I0BA 2K40A 1VQOI 2DT6A 3ABKH 1TWCJ 5E1WA 3T8RA 3MZYA 3LSJA 3K2AA 1YW7A 2YUSA 4ZYGA 2MW8A 1LPQA 2R7SA 3B73A 4BE0A 2FA5A 4U7BA 1ETQA 1UHSA 1RR7A 3Q0VA 5B1AH 1QPIA 2CG4A 1KU7A 3KEYA 1S8NA 3JRHA 4O6JA 3HXLA 2Y31A 1JHFA 3FXMA 3K4BA 2KRHA 3HDDA 3K9TA 2K86A 4A93J 4R79A 4XOPA 1W5TA 1S3JA 1OYWA 2NOGA 1FSHA 2MFZA 3FHNA 2OUMA 4HLXA 5HS8A 1F9NA 4IHYA 3WGIA 1VQMI 4XRMA 2F4IA 3VODA 1V4RA 4ESBA 2CQ7A 4F3QA 2VOPA 2LVSA 2OU2A 5ILVA 2NXNB 3VB2A 1FYMA 2M7BA 2XGEA 3HEFA 3W6KB 3HPGA 4HV5A 3GTKJ 1P4XA 1B9NA 3IH4A 1IUYA 1VQ8I 4DBQA 1WZ2A 2E5NA 3HUGA 2X0LA 4G9YA 4MO7A 4ETSA 1HF0A 1ZLJA 4CUGA 2L7KA 2Q8KA 1JUSA 1WHUA 3I56I 1BM9A 1Y8RB 4CCJA 1G6NA 1WH7A 3M7GA 3ULQB 2HZDA 3KP5A 1OCPA 2PFBA 4WWCA 3F6OA 2WB1A 1D5VA 4MIMA 3K4KA 4PSWA 1PUEE 4UB8C 1DU6A 1NH3A 1VQNI 2W82A 3TP0A 5E8IA 4BDYA 2W25A 1WWXA 1VF9A 3E0JB 3FIWA 4RLQA 4QPOA 2WAQN 5CVJA 4ZC3A 4BEHB 2OTJI 3FKIJ 5DUIA 2R7ZJ 3BPXA 3ZQFA 2QQAA 1MMSA 1WFXA 3ZQLA 2XSDC 3A01B 1XN7A 1YI2I 2O8XA 1Y1VJ 3I54A 4C3IJ 1RUOA 4X6AJ 3G1LA 2NNNA 2DQRA 3FXOA 1JTYA 4N9IA 3ZPLA 1OR7C 1BL0A 2HDDA 4G12A 2F5FA 3C3WA 1O3SA 3HRTA 4LB5A 2HDWA 4J01A 3T8TA 1ORKA 2BGCA 4IXAA 4IJAA 5IP7J 4D1QA 1SAXA 3CLOA 4W1UA 3QOEA 5E79C 2L02A 4B4CA 1R23A 2AXTC 3C18A 5M5XJ 4C2MJ 3CCJI 5D5UB 2G0EA 2BY1A 2DMUA 5EZGA 1FLIA 2CH0A 2IGOA 2OQGA 1IC8A 4LGWA 4YEJA 2BYVE 3BPVA 2KIFA 3WU2C 3BJAA 2F48A 4JX4A 3SZGA 3BR6A 4M74A 4KA4A 3FBIB 2IGKA 2R7TA 4KITB 2D1HA 2M4KA 2R5ZA 3GWZA 5ICEA 1OJLA 3QPSA 1C0WA 4R1HA 3RZDJ 2M9HA 1JT0A 1ZRFA 5EG0A 3E1SA 1S72I 5JVGF 1D1BA 3NWTA 2H09A 2IS2A 4PJMA 1JKOC 3DQVC 4J19A 3WTYC 3RQ4A 4KT5C 1GXPA 4FCYA 4BKXA 5D6EA 1LQ1A 1RI7A 4Y13A 4RS8A 3JRGA 4V19K 2CQKA 2CW0F 5IT9Z 1ZKGA 3SFZA 2L3DA 5LGNA 1XDSA 4IQ4A 3QU3A 3OL3A 2A3SA 2FUG2 2HZTA 4A69C 2L01A 1S29A 1KQ0A 2CWEA 1Z0XA 3BT9A 1E3PA 1IUFA 1M1EB 1R00A 2X6YA 2XAJA 4D5FA 5GAGJ 4QIWN 3GUDA 1ZAOA 2JPBA 1P4WA 1EA3A 3WTWC 1FIAA 5JLWA 1A31A 3GVAA 2XF7A 2E34A 4XRSG 4W97A 3W2VA 4I09A 3S2WA 3DU5A 2E1OA 3MKZA 4KYWA 4P9UA 4HAMA 3SDBA 2LMDA 1KU9A 3F72A 1JGSA 1QGPA 3KPHA 3JR9A 1MNDA 3OS0A 4RAZA 4L5JA 1X2MA 3FM5A 4PFOA 3VSLA 3HSRA 4MQ9F 2YU9J 3JRDA 3KEQA 1EF4A 3AKZA 3IH2A 1RC9A 5HVQC 5LFAA 1KU2A 3HOSA 3CC4I 5FO5A 2V26A 2XVCA 3CTAA 2IVMA 4H4KC 1YJ9I 2UXNA 2JWTA 3QQAA 1O57A 4OIRF 4IOAF 4PDKA 1TTYA 2KHMA 1MMGA 2P8TA 4B1RA 4LLLA 3MZ8A 4MLOA 1B59A 3F8BA 3H3VK 3F8MA 2ZXWH 1PVEA 1KYWA 3CJNA 1SC7A 4FX4A 4BH9A 3LA7A 3V42A 1DDNA 2VT3A 2VKDA 3GTOJ 4YFNF 1MW7A 2EPFA 4E4HA 2OA4A 2QQBA 5FD6A 1LFUP 5CJ9A 5FKNA 1H89C 1VQ7I 3T5XA 2VE9A 4ZTJA 2CV2A 3DKYA 3BR3A 5M3FJ 2LFBA 5H20A 1WSUA 2YS9A 2CFXA 2DDAA 3LSMA 4HRIA 2X6WA 2ELJA 4PK4A 1XD7A 4HNTA 5C44J 3CMMA 3FXQA 2KKOA 3M1EA 4A3DJ 1HDDC 3BCBA 2COBA 1UHWA 3F8NA 2W85A 2XGCA 4IO9F 3MWMA 1IN7A 1ETVA 1T38A 4YELA 1ZTRA 2GA2A 4CZCA 2H8RA 3Q9VA 1UMQA 4CYCB 4M9SA 1FT9A 4BQQA 5F6FA 1QRYA 5FLVA 3A02A 2CMPA 2W00A 2VB6A 3GF2A 3WTUC 2WV1A 3ZP5A 3RPUA 5F0CA 2DA3A 2WWYA 3UR3C 1J59A 2V6EA 5L3FA 2RVCA 1V5FA 3FZVA 2VLAA 2EINH 5DCMA 4BGDA 1QVTA 2L4AA 1LFPA 1R1VA 3JREA 1SFOJ 1RPWA 2BHYA 2IXSA 4EATA 1BC7C 1SMTA 1YIOA 4FTHA 4MGRA 5D5XB 4F52A 4P9FA 1W0TA 4II3A 2KT0A 1X3ZB 4ZYHA 4FQGA 1HW5A 1J09A 1I1GA 2VC0A 3ZOBA 1MNMC 4QLCU 3AL0C 4OU0A 3CCSI 4U88A 5ILSA 3ASNH 2V9PA 3MFKA 4I6ZA 5EF6A 4X1EA 2JSCA 2DO7A 1B72A 1WI9A 4CHUA 2P0WA 4IF4A 3CZ6A 4AYBA 1YO5C 1E3OC 4XRSA 1T08B 1KYZA 2X1DA 2HYGD 2ZCWA 3H9JA 2DA1A 3ABMH 3U1DA 1P9QC 2VQGA 5EZHA 2KZVA 3OYAA 3S1NJ 2JQ7A 4IRGA 1RNLA 1J5YA 2LY1A 1LDDA 4HX8A 5E3NA 2LNBA 2F2EA 3V7RA 2R92J 2FBHA 2QKLB 3CCMI 4A3FJ 1ZGAA 3DKXA 3O8GA 2O8KA 4MNUA 2YX7A 1XS9A 3HSFA 3WTSC 3GFIA 2GLOA 1VFCA 2LTPA 2HXOA 3BG6A 2P7CB 4XORA 2ZO4A 3VYRB 2CYYA 3PSFA 2VJ4A 2G7HA 1T39A 2YX4A 1FYLA 2AXLA 1X1DA 3FMSA 3CUQB 1Z7UA 1MDMB 1O3RA 1FMWA 3VOEA 3EUKL 5GAEJ 1SVMA 2KLOA 3OSFA 2BBYA 1R5ID 3K69A 3LQQA 1OKRA 4BHBA 2L54A 1TNTA 1KZHA 2P5LC 4JYKA 1JKQC 2ZXIA 5C4JJ 3RKYA 2CUFA 4AVPA 1SFUA 3U9GA 1UJ8A 2HVRA 2E1MB 2PG4A 2MBFA 4XKCA 5GAHJ 3CF5F 1ZQ3P 4I0AA 1H9GA 5F0FA 3QYFA 4OIQF 5TISC 2RN7A 1I3QJ 3C2GA 2PJRB 2KISA 1SD7A 1YTYA 2ECBA 3RPQA 1OISA 1MBJA 4HSTA 1X58A 1IRFA 3TO9A 3DU6A 4BHPA 5J4VA 2M45A 3D5SC 3FMRA 2EA4A 1P2FA 2V9VA 2O03A 1ZG3A 3DFGA 4GRIA 2R7UA 2EQRA 2VIXA 2AS5F 3RYPA 2UXXA 2VBZA 3TEDA 2O0YA 2PJPA 2GAUA 2QM3A 1XCVA 4UUTA 1IRXA 1Y0NA 4RGRA 1B6AA 2DYRH 3HC7A 1G2HA 1K83J 3V8KA 5FB2A 2DMQA 4ZYEA 4UXNA 3O8HA 2BW3A 3A03A 3BZ6A 3M9AA 3I3LA 2L7FP 1GV5A 3K0LA 4A3GJ 2JA6J 2Z2SB 1NK3P 3DEWA 4BY1J 4ENNA 3SJMA 5IY5H 4LOCA 5HS9A 4RB1A 1ENHA 1GHCA 3NARA 3LSHA 5DDGA 4IHTA 2K9LA 4A3EJ 3K1PA 2DPUA 4NC6A 4V2GA 5J1UA 2UZKA 1SFEA 1LVAA 3G6EI 1DPUA 2X48A 2GM4A 1OCRH 3KZYA 2GBYA 4KMFA 1Z3YA 2HQAA 4JBAA 2VI6A 2GQQA 3BR5A 4RGSA 3PIOF 4ZDOA 4IKFA 4ABZA 3G1OA 3MCZA 1IN5A 2ICWG 4I02A 4M3EA 4L0ZB 3SDGA 3FK6A 2FQ3A 2ZJPF 5IYBJ 3GMEA 1BR2A 4UVAA 3NEUA 4BE2A 1FP2A 5E18F 4H0EA 1EJ9A 2FBKA 2PMZN 1LNWA 4ENJA 3MN2A 4CCMA 3MKYB 2EZLA 5F64A 1F43A 3Q9SA 2GOXB 2M3AA 4MFEA 5FD5A 2XGDA 2X1EA 1TW2A 3IH3A 4KN7X 5KVRA 1D8KA 2DN0A 1AU7A 2V79A 1IZ1A 2CV1A 2KRFA 3B02A 2P7VB 1XGMA 1D0YA 1NK2P 3A4CA 2HVSA 3CCEI 1OCOH 2X4HA 2ADUA 3ZQCA 3L2RA 2CRGA 1FZPB 2DA7A 1R71A 5JI6A 2BXZA 3OOPA 4A6EA 2X51A 2ACJA 3BG3A 3JW4A 2DFFA 2IGMA 2LBFB 2LD5A 1S6LA 1UCRA 2A6TA 3ZMVA 4X0GA 1BI3A 1W36C 5DYMA 1FSEA 1YW8A 3QU6A 4HQEA 2XGXA 3ZCOA 1GT0C 2E5ZA 5LGUA 2K3FA 3NWSA 1JUMA 3GFMA 2GOMA 3CP8A 1X3UA 1ZREA 2IT0A 4Q4ZF 4XBFA 2ZJRF 2RC4A 3O6BB 2VT2A 1EH7A 3HM5A 5EGOA 1V54H 1D1AA 2VASA 4E7SA 1XMXA 2LY9A 1XGOA 1BJZA 2R0QC 4ITVA 3BQZA 3NAUA 3ZRGA 2VXDA 1JJ6C 1QU3A 3CMAI 5LHGA 3OY9A 1HBXG 4Q5SF 2I5UA 3FXLA 2CSOA 3PQKA 3H0GJ 3CJRB 2DA6A 4E7KA 1LUJB 1FBSA 2LREA 1FP1D 1W7PB 2E35A 1R4NB 3M4OJ 2ELHA 2EFNA 4GGGA 5FFXA 5GADJ 4PJNA 5EG0B 2O9LA 2EV6A 5K7ZA 3I4NJ 3A0BC 5BMZA 3P9IA 1LB2A 2CGPA 4XQFA 2GZWA 4IPAA 5ERIA 5E8GA 2RREA 2JA8J 1TQIA 1TZLA 2LLKA 2YPRA 2M34A 4HLYA 1P7IA 3Q3SA 1PUFB 2QSGX 2DT5A 3BZKA 3FKJA 3HSEA 4XSZF 5JFRA 1POGA 2DK5A 4F55A 4ZH4F 5F1JA 5E1ZB 3K4MA 3L1PA 3TQNA 1BW5A 3HRSA 5F0HA 2F5CA 4G6QA 3WE3A 2XASA 3RJPA 9ANTA 4N9HA 2K5CA 1LVKA 2Y0SA 3BOQA 2DOAA 2EV5A 2A05A 1GUUA 2DPDA 4XKVA 3K6GA 5F27A 3BP8A 2FNPA 4NNJA 4RM3A 4IRIA 2V1NA 5AIQA 4YIRX 3HKZN 3BTIA 4CDGA 1D0ZA 4KNYA 4XLHA 1U9NA 3GFJA 5HLIA 4B09A 2MH2A 1TWFJ 3TW6A 4A12A 1HQCA 2R7OA 5CPRB 3V8JA 4M3GA 4XRFA 1W7PD 1LDJA 1SD4A 1BI0A 2L2OA 4BDZA 3LL7A 1LE8B 1X1BA 2E1CA 1U0JA 2LF7A 2HOEA 1QNTA 1GVJA 2WV0A 1XSVA 2XAHA 1QVUA 3ABUA 1TNSA 3CO6C 4DYCA 5FLXK 1DP7P 1QHHD 2DA5A 3KX2A 3S1MJ 4LJZF 3JRCA 2JUGA 1YW9A 1OR7A 3A1YA 3CDHA 3ROUA 2R5YB 5FKMA 5KK1A 4XM3A 4LB6B 3AAFA 2KDZA 2QQ8A 1XB4A 3VFZA 5B3SH 2NVTJ 2F4MB 2OC6A 5E3OA 1IXCA 3GCMA 1MKMA 4XLAA 4OMZA 3WTVC 1Q1HA 2NYXA 3BY6A 4P96A 4I2OA 4Z6YA 2KIMA 1U6GA 4II2A 3F21A 4WF2A 2V6CA 4U0WA 5FLMJ 3IRRA 3BG7A 3PUBA 3K2ZA 2Z3YA 5TGTA 4UY8I 3LAJA 1PP8F 2JZYA 1T0FA 3UNGC 2STTA 2O5RA 1KONA 3RKQA 1JKRC 1CF7B 3TDZC 1J2XA 2DU9A 2HOTA 2EJRA 1QZZA 2YR2A 4HG2A 4AUXA 1FBQA 4C3HJ 4D9JA 4KMUX 2ESNA 3O2PE 3CC7I 2VJ5A 1R5GA 1SD5A 4IOCF 3TBIA 3G3ZA 2E1MC 2JTVA 1YITI 4AWXB 1NG6A 1O3TA 3OV8A 2D2WA 1T98A 2JK3A 1U8RA 3HRMA 1WJAA 2K85A 4IX7A 1WKMA 4JQFA 4OIOF 4RAYA 3ERED 3BG9A 4K2EA 2R7WA 2HQ5A 4HA8A 3MEXA 4CICA 2KPMA 3BCAA 1JXSA 1WI3A 3AFHA 1BJAA 3HOWJ 4CH7A 4BXUA 2QCOA 1YJWI 2E60A 3F22A 3R60A 4HBLA 3X2QH 2XIGA 2VKHA 1FOYA 2QYOA 5TJJA 3COAC 2EFPA 1I1SA 3S8PA 2RQQA 4XK4A 1HCRA 4CO8A 3MD2A 5ILUA 1H8AC 2VPRA 3KCCA 5GTHC 3FHZA 2MSYA 1HOMA 1EH8A 4L5IA 1W0UA 4KT6A 1TWAJ 1UG0A 5CVVA 3E3VA 2FX0A 3H9GA 4DJAA 2E7XA 5K1YA 1BOBA 2DCEA 3WU0A 5LD2C 3IWFA 4DZPA 2IA2A 2KL4A 2CU7A 2RV8A 3RZOJ 4UV8A 4LG0A 3QP6A 2L9NA 3SHFA 5D5VB 1ZR2A 3VPRA 3P9KA 2QEXI 4G7OF 1J9IA 4KFCA 3TP3A 1T0FC 2VKVA 4BHCA 2G9WA 4XKWA 4LK1F 3V8LA 4DOZA 2ZJ2A 5HDGA 3OYKA 3RPUD 4ZZDA 2DA2A 2W4SA 4A0ZA 1YS7A 4WX9A 3R61A 2VUMJ 4KIGA 3G4SI 2ISZA 4PFPA 3OS1A 1YFHA 1B4AA 1H88C 4OINF 1BR4A 1MBFA 1NHAA 3ZXSA 4A2UA 4BJ5C 2I8DA 2ZXHA 1Y8QB 2VXZA 5KAIC 4U7DA 4PJ0C 1VQ6I 3VEPA 1V55H 2J5OA 3F3XA 4GO1A 3W6JB 4ZYAA 1YHQI 1WRJA 1OYIA 3PQJA 4GCVA 3BG5A 5FKKA 1XSDA 4HF2A 1YRNA 5EEAA 2M7AA 1Z05A 2FOWA 4YRVA 5DV5A 2L5QA 3OYFA 2P5KA 4JOMA 4RM2A 3J81K 3B6CA 3BTCA 4A0XA 4GFBA 4FASD 4B8XA 3KYLA 4PJJA 3GFLA 4XONA 4P55A 2H94A 2RNGA 1BC8C 1VQKI 4Q48A 2R4GA 1MMNA 2DMTA 4A0YA 4BQAA 1J7KA 3PO3J 3K70D 4A6DA 3QYEA 1R1UA 1U5TB 2DW4A 2OZUA 3CP2A 3EPZA 4IRHA 2XRNA 2IJLA 2EA2A 3DBHB 3JRFA 1HKSA 2AO9A 1G3SA 2KFDA 2ID6A 1GDTA 2MG4A 2VC1A 4HYEA 3JRAA 2FF4A 4LIVA 2HDCA 2AHQA 3H1CA 2X85A 2A61A 2P81A 3I53A 1ZRCA 1JHHA 2HYFA 3SXYA 3ECOA 2DK8A 1Z91A 2XHKA 2ZB9A 3DPLC 3OYDA 2LKSA 3H0DA 3V7SA 4AIDA 1TW3A 4HV6A 4YIIA 1D0XA 1F1ZA 1OFCX 5IT3A 1OMIA 4DYQA 1PJRA 5KHDA 2DI3A 4OMYA 1LEBA 3D5RC 4UV9A 3OYJA 1ITYA 2OBPA 2W84A 4LITA 1MSEC 5ICCA 1BI2A 3DV8A 2EFOA 5J1YA 2GXAA 1TWHJ 1ETXA 3LFKA 3OYNA 2CQNA 2A68F 1S5LC 5EYRA 1OQYA 4UUSB 3ZQGA 4A3KJ 3SEQA 1HDPA 4GYIA 3I71A 3WTXC 1WCMJ 1TQPA 2XROA 3TO6A 2VODA 4QWQA 3ABTA 4XLFA 1KU3A 2VJJA 5GPCA 4E70A 3HJEA 3BR1A 5H6QA 2ZMEC 3J80Z 4MQVA 2OD5A 2NVUB 4CXFA 3TGNA 5LGTA 1TL8A 4YFKF 1Y6IA 3RSNA 2ZFUA 2H1LA 2UWMA 3P9CA 3VDXA 4C2TA 2E1NA 2I10A 4ANJA 1WJDA 4KIFA 3I59B 4JX5A 1WJBA 4EGZA 1VQ9I 4L9VA 3DLLF 3FXUA 3HZJA 2ME0A 2L4MA 4OOIA 2BXYA 2R7FA 1WH5A 1ZGWA 1FPQA 3LQRA 1D5YA 3PUFA 5IT9K 3N05A 2K4BA 5H6RA 2JN6A 2MGQA 1IO2A 1CGPA 1BR1A 4GYGA 2IW5A 4A3MJ 1XX5A 2QLZA 4V2FA 3ZMTA 4BJ6C 3WE2A 2E71A 1G4DA 2UUZA 4P1WA 1L3LA 2Y69H 4UB6C 3I58A 5E3MA 1Z6TA 2WAFA 2EIMH 4PGGA 3L2VA 2K9NA 1BA5A 2LH9A 3KE2A 4DYRA 1JE8A 2LKXA 3OR2C 4IHSA 3GYHX 2Y2ZA 2A6EF 3UKGA 2PMZA 3CO7C 1IXRC 4XL9A 5FFZA 1BBYA 3ISPA 3FMQA 5JHFA 1AHDP 3OWTA 4BEHA 4D5CA 1T2KA 4I99C 1R9TJ 2O6GE 3F6VA 2XV4S 1HXDA 1LKXA 2LYCA 3A01A 3DWLE 3IKVA 3HOYJ 2B7EA 2DTZA 1GV2A 4I01A 3SZTA 1OLTA 2MA3A 2K02A 3U2RA 4GXOA 5IOYA 2H6CA 1VQPI 1JKPC 1I6HJ 3KP2A 3E6CC 4CA0A 2GXGA 3REOA 3HL2A 5CVRA 4DNCA 3CCVI 2JSPA 1TWGJ 2Z5UA 3F0CA 5HLTA 2HGCA 2DJIA 2E2JJ 2HNHA 1N78A 2FEZA 4IL6C 2ELKA 3JTHA 5IP6A 1D1CA 1IN4A 2XAUA 3S3NA 3DPUA 1WJEA 1DPRA 2V1XA 4M3BA 1B8IB 2KDOA 2YSRA 3CDLA 4BQNA 1BW6A 1RETA 3LMMA 4ON0A 5HODA 1YX5A 1ZG5A 2KZGA 1WJCA 1XG1A 3PO2J 1FC3A 3R4KA 1YS6A 3M8JA 3W2AA 5FKLA 4PUSA 3GW2A 4XMYA 4BBRJ 3TL4X 1K79A 2XKOA 1LDKB 6PAXA 4QPQA 5GPAA 4UUVA 4HEA2 5LHIA 4BE1A 2Z16A 4XLCA 1QZEA 3CF2A 3VSKA 2COMA 2IA0A 1WVRA 3ZGKA 3JAMK 2VQHA 4F92B 2DBBA 3MZHA 2V7FA 1IV8A 2FMYA 4KDPA 1RZ4A 1IV6A 4GDFA 3K4CA 4MFDA 3F23A 4KISA 3PFIA 2QQ9A 4HX7A 5EJCA 3BLYA 4BYYA 1O7FA 1UB9A 1A36A 2JVHA 1YE9A 1HSJA 4R8HA 1WJ5A 1GXQA 5LRRA 1XMAA 2F6CA 1O7LA 1ETKA 2K3PA 2PBIA 2VOOA 2R7DA 3KYDB 3KETA 4Y52J 1T6SA 2MYSA 4A3IJ 4DGWB 3RQIA 5L3GA 3OYGA 4C9YA 5BPIA 1RRJA 2C6YA 2Q2EB 3SQNA 3H3ZA 5E1XA 3C1DA 5D4SA 2FXAA 2MC4A 1X2NA 1X19A 2TDXA 2XAQA 1U78A 2L9RA 1IXSB 3HYIA 2QZ8A 3VYSB 3K70C 3CCYA 2JA5J 4WXCA 3K10A 1UAAA 3S16J 2FMLA 3S2HJ 3DBRB 3FXKA 3C2HA 2HU9A 2KIUA 1S9HA 5H2FC 2HTJA 1FTZA 3EETA 4O5VA 2HI3A 2KMUA 4CCLA 3DPTA 2JVGA 4L5EA 5CYVA 2K7LA 4HQMA 1X3WB 4NB5A 1NTCA 5CQEA 4EM2A 3IV5A 3GTJJ 3GTGJ 2ME6A 1N77A 1D8JA 4XN3A 2OJED 2WA0A 1IRZA 3OS2A 2L9SA 1ERDA 4BXXJ 4N0BA 4BACA 3DXJF
chains in the Genus database with same CATH topology
1R5HA 2EB7A 2QUFA 3WTZA 2HWVA 3ELKA 4MTEA 3GZ6A 2FNAA 3RYRA 2HFHA 2JPCA 4RB2C 2DFIA 1XSXA 4L9JA 2HR3A 3RTRA 3JSOA 1QPMA 5L3CA 4A5MA 2ZXJA 2RNJA 1XGSA 3F8CA 2K4JA 2R3SA 2W24A 2VN2A 3GX4X 4AIKA 2NAZA 2FOKA 1U5TC 2P4WA 1USTA 3R6SA 5LEJA 1J75A 4MHGA 4BAYA 1AWCA 5DUKA 4CYDA 3N97A 5E17F 1F5TA 5TRDA 3KLOA 5K5RA 4D0PA 3NRVA 2Y75A 3RKXA 4FX0A 3ZN1A 3M8FA 4RGUA 3JTGA 1SMYF 1IRGA 4FHTA 3D5LA 1I5ZA 2DQLA 1R7JA 2EK5A 4G6DA 2FBIA 4ASNA 2EWNA 2QWWA 4EJUA 1VTNC 3N4MA 2PMHA 4MTDA 2A07F 2PMUA 4EV0A 4UVCA 2JRTA 4KN4X 1FWZA 1QZYA 1K6OA 3SZPA 4AIHA 5CVIA 3EUHA 5EEHA 4M71A 1OPCA 2GA1A 2Z99A 4WCGA 4LLGF 3E5QA 2NS0A 5BS6A 3CUQA 1MDMA 2PI0A 5D5WB 2PLYA 3WU1B 4M73A 2A6HF 2MLKA 1ZARA 5LHHA 1FX7A 4G94A 2QBYA 3BDDA 1B1BA 2VONA 4YG2F 2MD5A 2O61A 1ZN2A 1WQ2A 3HTUA 1I6XA 4Y17A 1FYKA 2KJCA 3EYYA 3QOPA 1D3YA 3QAHA 1K78A 1QBJA 4UNOA 2BE5F 2MC3A 3RKWA 4M6XA 2KJBA 3GEZA 4TV7A 5L3DA 5D4RA 4KUMA 1ZLKA 4KICA 5EEGA 2XAFA 1DUXC 3CUQC 2FU4A 3IL2A 2HQRA 4HX4A 3HOTA 5DEQA 2Y0MA 2OQRA 3BROA 2WC2A 3FXRA 1E17A 1ZHFA 5JHUA 2V1UA 4Y15A 1KQ8A 1J0RA 1REPC 2RDPA 3J81Z 5DCMB 4HF1A 4S05A 1UHMA 2RGVA 2D1VA 3D0SA 1ZH5A 5FGMA 1G3YA 3GZ5A 1R1TA 5ICGA 1XGNA 3LSTA 4AD9A 3E97A 1FOKA 2F5EA 3KP4A 1OYYA 1W4MA 1KQ9A 5A2QK 4IVNA 3CUOA 1K7AA 1MZBA 2ISYA 2H6BA 1FBUA 3KZZA 2ZNZA 4KIBA 2B0LA 1HW1A 4EJOA 5LEKA 1U3EM 3IHUA 4LK0F 2QENA 3RIRA 4Z2YA 5LBQA 4L0YB 1ON1A 5BPDA 3DEUA 4CZZA 5E20A 2DTRA 4RGXA 3M8EA 3GLXA 4G8XA 3RDIA 2MLGA 2O3FA 2PEXA 3HIFA 4ZYDA 1W7PA 5LRSA 1EH6A 1QQIA 3LA2A 5DD4A 2H27A 1O3QA 5DD8A 2VE8A 5BQTA 3ZMSA 3QRFF 5JR3A 3T1BA 2ZMEA 2HKXA 4U0YA 3QPHA 2RQPA 4HDVA 1MJ9A 3L7WA 3FX3A 1S7AA 3L09A 2V1DA 3ECHA 2PN6A 3KP7A 3MQ0A 2HKOA 2PQ8A 2HEOA 4ZZLA 2E7WA 2STWA 4F7ZA 4NQWA 3EYIA 5K5OA 3ZMDA 3BJ6A 1R36A 4WXDA 2FSWA 2W57A 2M87A 1P4AA 4PCQA 3NQOA 3F8FA 4UVBA 3IKTA 3L2CA 2Y48A 1V3FA 3QP5A 1IN6A 2IA1A 4HF0A 1TLHB 1XCBA 4EJVA 1STZA 3V7CA 4AIJA 2GWRA 2BV6A 1YLFA 1ZYRF 4LFUA 4EVIA 4L9TA 3RI4A 5BOXA 3E6BA 4EGYA 5LLQA 4L18B 2HQNA 3JAMZ 3I64A 1CF7A 5HLGA 4HDUA 1L0OC 3H92A 1ODDA 4U0VA 1KGSA 4M72A 1YYVA 5D8KB 1AOYA 3J7AO 3I4PA 4RB3C 3BWGA 1H0MA 5DCFA 3EQLF 1G3WA 2HTSA 1RUNA 3ML6A 4EJTA 1U2WA 4JK1X 3TOBA 1USSA 2P5VA 5L3BA 3LWFA 2IRFG 2IP2A 3HRUA 3R0JA 3JSPA 2P6TA 4XLNF 1R22A 3P7NA 1MGTA 3HHHA 3FM3A 5AONA 3WODF 3K1NA 2VBWA 4LD5A 2EFWA 2NNYA 3KLNA 4I98B 1FNNA 5F1RA 3H3UA 3DF8A 5HOOA 1Y0UA 3J80K 2D45A 4WK8F 2DAOA 3KP3A 2A69F 2FRHA 5L3EA 1IAWA 2G7UA 2XAGA 4MEXF 1PP7U 1S7OA 3ZQ7A 2M1BA 3G73A 1Z6RA 3WG9A 3BJOA 4Q47A 3FF5A 5ED4A 4PZJA 3V4GA 2OZ6A 1ZG1A 1ON2A 1P6RA 2QBYB 3TDUC 3IC7A 5J8CA 2Z33A 5HDNA 5HS7A 4M9ZA 5K5QA 2HS5A 1U5TA 4EJWA 3R0AA 3DP7A 2CO5A 3DKWA 5D6FA 2LSOA 4EQQA 1K78B 3GXOA 5CVUA 2LKPA 1LEAA 4LMYA 1LJ9A 1BN5A 1QO0D 4YIFA 2OAZA 2VBYA 4DQ2A 1MJAA 3E6MA 3IRQA 1KA8A 3TOAA 1MJBA 4EM1A 3LA3A 1Z9CA 4ESFA 3WGHA 2EV0A 3KFWX 3L9FA 1H9TA 1XDUA 1MD0A 3L00A 1HW2A 3ZMZA 2YU3A 3FWEA 5AIPA 4WXHA 3EDPA 3O3KA 4HOBA 4HZFA 4UHTA 1YG2A 2JT1A 3HTSB 2FE3A 4L9NA 1SFXA 3QPTA 2LF8A 3I59A 3TKYA 3I0TA 3C7JA 1BIAA 1UFMA 2M8EA 4O3MA 4G7HF 2K27A 4ESJA 4NHJA 1BIBA 2VBXA 5CLSA 2M30A 2A5YB 4ENMA 2Q0OA 1A04A 4ENKA 2ETHA 1FY7A 4XLPF 4XSXF 3E6DA 4EMSA 2NRAC 5J6XA 2P6SA 1Z1DA 4LG0B 4YFXF 4I7HA 5FLXZ 4EM0B 2MH9A 3T0YA 3WTTC 4FT8A 4PGHA 1G3TA 3E5XA 1ULYA 2GXBA 1RIOH 4G7ZF 1HKQA 2ESHA 1ZGJA 2ZKZA 1IF1A 2M5WA 1ZRDA 2ZFWA 4RB0A 2QVOA 1I27A 1W5SA 2ZBKA 2GIVA 1TQMA 1PDNC 3WGGA 2WTEA 1IW7F 3KP6A 2J5PA 2EFQA 1XMKA 2F5DA 1R58A 2Z9OA 4LLNA 1BOAA 1F4KA 2ZMEB 3ZMUA 3K1MA 3MAJA 4MEYF 1ONVA 5JVTA 1YQAA 1HSTA 3I5UA 2IPQX 4S04A 5D8LB 5ICFA 4BNCA 2XUBA 3KEOA 1B9MA 4A5NA 4OIPF 5A2QZ 2LDUA 2RKHA 1IN8A 4M9XA 4HW0A 1P92A 1EV7A 2ZNYA 1SD6A 3TO7A 1BI1A 1TBXA 3IWZA 3LAPA 3E5UA 4M6YA 4P5OA 3Q5FA 1HKTA 5J8FA 2BEOA 4CGZA 1E2XA 3GO5A 5HDKA 2Q2EA 2DLLA 5HLHA 3HHGA 2XKPA 3ZN0A 4I0BA 5E1WA 3T8RA 3MZYA 1YW7A 4ZYGA 3B73A 2FA5A 4U7BA 2CG4A 1KU7A 1S8NA 4O6JA 1JHFA 3K9TA 2K86A 4R79A 1W5TA 1S3JA 1OYWA 1FSHA 4HLXA 5HS8A 1F9NA 3WGIA 3VODA 2VOPA 1V4RA 4ESBA 2OU2A 5ILVA 3VB2A 1FYMA 3W6KB 4HV5A 1P4XA 1B9NA 1IUYA 3HUGA 2X0LA 4G9YA 4ETSA 1ZLJA 2Q8KA 1BM9A 1G6NA 3M7GA 3ULQB 3KP5A 2PFBA 4WWCA 3F6OA 1D5VA 1PUEE 5E8IA 2W25A 1WWXA 5CVJA 5DUIA 3BPXA 2QQAA 1XN7A 2O8XA 3I54A 1RUOA 2NNNA 2DQRA 4N9IA 3ZPLA 2F5FA 3C3WA 1O3SA 3HRTA 4LB5A 3T8TA 2BGCA 4IXAA 4IJAA 1SAXA 3CLOA 2L02A 1R23A 3C18A 5D5UB 1FLIA 2OQGA 4LGWA 2BYVE 3BPVA 2KIFA 3BJAA 4M74A 4KA4A 2D1HA 3GWZA 5ICEA 1C0WA 4R1HA 1ZRFA 2H09A 3DQVC 3WTYC 4KT5C 1GXPA 5D6EA 1LQ1A 1RI7A 4Y13A 4RS8A 2CQKA 2CW0F 5IT9Z 3SFZA 2L3DA 5LGNA 1XDSA 3QU3A 2A3SA 2HZTA 2L01A 1S29A 1KQ0A 2CWEA 1R00A 2XAJA 3GUDA 1ZAOA 2JPBA 1P4WA 3WTWC 3GVAA 4I09A 3S2WA 4P9UA 4HAMA 1KU9A 3F72A 1JGSA 1QGPA 4RAZA 4L5JA 3FM5A 3HSRA 4MQ9F 3KEQA 5HVQC 1KU2A 3HOSA 5FO5A 2XVCA 3CTAA 2IVMA 2UXNA 1O57A 4OIRF 4PDKA 1TTYA 2P8TA 4LLLA 1B59A 3F8BA 3F8MA 1KYWA 3CJNA 4FX4A 4BH9A 3LA7A 1DDNA 2VT3A 4YFNF 2OA4A 2QQBA 5FD6A 5CJ9A 3T5XA 2VE9A 5H20A 1WSUA 2CFXA 1XD7A 3FXQA 2KKOA 3M1EA 1UHWA 3F8NA 2W85A 3MWMA 1IN7A 1T38A 2GA2A 3Q9VA 4M9SA 1FT9A 5F6FA 3GF2A 3WTUC 3ZP5A 3RPUA 2WWYA 1J59A 5L3FA 2RVCA 3FZVA 5DCMA 2L4AA 1R1VA 1BC7C 1SMTA 1YIOA 4MGRA 5D5XB 4P9FA 4ZYHA 1HW5A 1I1GA 2VC0A 4QLCU 4OU0A 4U88A 5ILSA 3MFKA 2JSCA 2DO7A 1WI9A 4CHUA 4IF4A 1YO5C 1KYZA 2HYGD 2ZCWA 3U1DA 4IRGA 1RNLA 1J5YA 1LDDA 4HX8A 2LNBA 2F2EA 3V7RA 2FBHA 1ZGAA 4MNUA 2YX7A 3HSFA 3WTSC 3GFIA 2P7CB 2ZO4A 2CYYA 2G7HA 1T39A 2YX4A 1FYLA 2AXLA 3FMSA 3CUQB 1Z7UA 1MDMB 1O3RA 3VOEA 4KYWA 2BBYA 3K69A 3LQQA 1OKRA 4BHBA 2L54A 1TNTA 2P5LC 3RKYA 4AVPA 1SFUA 3U9GA 2PG4A 2MBFA 4I0AA 1H9GA 4OIQF 2RN7A 1SD7A 1YTYA 3RPQA 3TO9A 1IRFA 4BHPA 2M45A 3FMRA 2EA4A 1P2FA 2V9VA 2O03A 1ZG3A 3DFGA 2AS5F 3RYPA 2UXXA 2VBZA 2O0YA 2PJPA 2GAUA 2QM3A 1XCVA 4RGRA 1B6AA 3V8KA 5FB2A 4ZYEA 4UXNA 3BZ6A 3M9AA 3K0LA 4ENNA 5HS9A 4RB1A 1GHCA 5DDGA 4IHTA 3K1PA 2DPUA 2UZKA 1SFEA 1LVAA 1DPUA 3KZYA 4KMFA 4JBAA 2GQQA 4RGSA 3MCZA 1IN5A 4I02A 4L0ZB 2FQ3A 4UVAA 3NEUA 1FP2A 5E18F 4H0EA 2FBKA 1LNWA 4ENJA 5F64A 3Q9SA 5FD5A 5KVRA 4KN7X 1TW2A 1D8KA 2V79A 1IZ1A 2KRFA 3B02A 2P7VB 1XGMA 2X4HA 2ADUA 1FZPB 5JI6A 3OOPA 4A6EA 2ACJA 3JW4A 1S6LA 1UCRA 3ZMVA 1BI3A 5DYMA 1FSEA 1YW8A 3QU6A 4HQEA 2XGXA 5LGUA 3GFMA 1X3UA 1ZREA 2IT0A 4Q4ZF 4XBFA 2RC4A 3O6BB 2VT2A 1EH7A 1XGOA 5LHGA 1HBXG 4Q5SF 2CSOA 3PQKA 1FBSA 1FP1D 1W7PB 2ELHA 2EFNA 4GGGA 5FFXA 2EV6A 5BMZA 1LB2A 3P9IA 2CGPA 2GZWA 4IPAA 5ERIA 5E8GA 1TQIA 2YPRA 4HLYA 2DT5A 3HSEA 4XSZF 5JFRA 2DK5A 4ZH4F 5E1ZB 3TQNA 3HRSA 2F5CA 4G6QA 3WE3A 2XASA 3RJPA 4N9HA 3BOQA 2EV5A 2DPDA 3BP8A 2FNPA 4IRIA 5AIQA 4CDGA 4KNYA 3GFJA 5HLIA 4B09A 2MH2A 4A12A 1HQCA 3V8JA 4XRFA 1W7PD 1LDJA 1SD4A 1BI0A 2E1CA 2LF7A 2HOEA 1QNTA 1GVJA 2WV0A 1XSVA 2XAHA 3ABUA 1TNSA 3CO6C 5FLXK 1DP7P 4LJZF 1YW9A 1OR7A 3CDHA 3ROUA 5KK1A 4LB6B 3AAFA 1XB4A 3VFZA 1IXCA 1MKMA 4I2OA 4OMZA 3WTVC 1Q1HA 2NYXA 3BY6A 4P96A 2KIMA 1U6GA 3F21A 4WF2A 2V6CA 4U0WA 3IRRA 3K2ZA 2Z3YA 3LAJA 1PP8F 2JZYA 1T0FA 2STTA 1CF7B 3TDZC 1J2XA 2DU9A 2EJRA 1QZZA 2YR2A 1FBQA 4KMUX 2ESNA 3O2PE 1R5GA 1SD5A 3G3ZA 2JTVA 4AWXB 1O3TA 3OV8A 2D2WA 1T98A 1U8RA 3HRMA 1WKMA 4JQFA 4OIOF 4RAYA 3ERED 4K2EA 4HA8A 3MEXA 4CICA 1JXSA 1BJAA 4BXUA 3F22A 3R60A 4HBLA 2XIGA 2QYOA 5TJJA 3COAC 2EFPA 1I1SA 4CO8A 5ILUA 3KCCA 3FHZA 1EH8A 4L5IA 5CVVA 3E3VA 5K1YA 2E7XA 3WU0A 3IWFA 2IA2A 2RV8A 4UV8A 4LG0A 3QP6A 3SHFA 5D5VB 3P9KA 4G7OF 1J9IA 4KFCA 4BHCA 2G9WA 4LK1F 3V8LA 2ZJ2A 5HDGA 4ZZDA 4A0ZA 1YS7A 4WX9A 3R61A 4KIGA 2ISZA 1YFHA 1B4AA 4OINF 1NHAA 4A2UA 2VXZA 4U7DA 3VEPA 2J5OA 3F3XA 4GO1A 3W6JB 1WRJA 1OYIA 3PQJA 4GCVA 1XSDA 4HF2A 1Z05A 5DV5A 2P5KA 3J81K 4A0XA 4B8XA 3GFLA 4P55A 2H94A 1BC8C 4Q48A 4A0YA 4BQAA 1J7KA 4A6DA 1R1UA 1U5TB 2DW4A 2OZUA 4IRHA 2XRNA 2IJLA 2EA2A 1HKSA 1G3SA 2VC1A 4HYEA 2FF4A 2HDCA 2A61A 3I53A 1ZRCA 1JHHA 2HYFA 3SXYA 3ECOA 2DK8A 1Z91A 2XHKA 3DPLC 3V7SA 1TW3A 4HV6A 4YIIA 1F1ZA 5IT3A 1OMIA 2DI3A 4OMYA 1LEBA 4UV9A 2OBPA 2W84A 5ICCA 1BI2A 3DV8A 2EFOA 3LFKA 2A68F 4GYIA 3I71A 3WTXC 1TQPA 2XROA 3TO6A 2VODA 4QWQA 3ABTA 1KU3A 4E70A 5H6QA 3J80Z 4MQVA 2OD5A 4CXFA 3TGNA 5LGTA 4YFKF 2UWMA 3P9CA 2E1NA 4KIFA 3I59B 4EGZA 4L9VA 3FXUA 2L4MA 4OOIA 2R7FA 1FPQA 3LQRA 5IT9K 2K4BA 5H6RA 1CGPA 4GYGA 2IW5A 2QLZA 3ZMTA 3WE2A 1G4DA 1L3LA 3I58A 1Z6TA 4PGGA 3KE2A 1JE8A 4IHSA 3GYHX 2A6EF 3CO7C 1IXRC 5FFZA 1BBYA 3ISPA 3FMQA 1T2KA 2O6GE 3F6VA 2XV4S 1HXDA 3IKVA 4I01A 3SZTA 2MA3A 2K02A 3U2RA 4GXOA 2H6CA 3KP2A 3E6CC 2GXGA 3REOA 5CVRA 4DNCA 2Z5UA 2HGCA 2FEZA 3JTHA 1IN4A 1DPRA 2V1XA 2YSRA 4ON0A 1ZG5A 1FC3A 3R4KA 1YS6A 3GW2A 1K79A 2XKOA 1LDKB 6PAXA 4UUVA 5LHIA 2COMA 2IA0A 3JAMK 2DBBA 3MZHA 4KDPA 2FMYA 1RZ4A 3F23A 3PFIA 2QQ9A 4HX7A 4BYYA 1O7FA 1UB9A 1HSJA 4R8HA 1GXQA 5LRRA 1XMAA 1O7LA 2PBIA 2VOOA 2R7DA 3KETA 1T6SA 5L3GA 5BPIA 2C6YA 3SQNA 3H3ZA 5E1XA 3C1DA 5D4SA 2FXAA 2TDXA 2XAQA 1U78A 1IXSB 3HYIA 2QZ8A 4WXCA 2FMLA 2KIUA 2HTJA 3EETA 4O5VA 3DPTA 5CYVA 2K7LA 4HQMA 4NB5A 4EM2A 1D8JA 4N0BA 3DXJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5H A;  2EB7 A;  2QUF A;  3WTZ A;  2HWV A;  3ELK A;  4MTE A;  3GZ6 A;  2FNA A;  3RYR A;  2HFH A;  2JPC A;  4RB2 C;  2DFI A;  1XSX A;  4L9J A;  2HR3 A;  3RTR A;  3JSO A;  1QPM A;  5L3C A;  4A5M A;  2ZXJ A;  2RNJ A;  1XGS A;  3F8C A;  2K4J A;  2R3S A;  2W24 A;  2VN2 A;  3GX4 X;  4AIK A;  2NAZ A;  2FOK A;  1U5T C;  2P4W A;  1UST A;  3R6S A;  5LEJ A;  1J75 A;  4MHG A;  4BAY A;  1AWC A;  5DUK A;  4CYD A;  3N97 A;  5E17 F;  1F5T A;  5TRD A;  3KLO A;  5K5R A;  4D0P A;  3NRV A;  2Y75 A;  3RKX A;  4FX0 A;  3ZN1 A;  3M8F A;  4RGU A;  3JTG A;  1SMY F;  1IRG A;  4FHT A;  3D5L A;  1I5Z A;  2DQL A;  1R7J A;  2EK5 A;  4G6D A;  2FBI A;  4ASN A;  2EWN A;  2QWW A;  4EJU A;  1VTN C;  3N4M A;  2PMH A;  4MTD A;  2A07 F;  2PMU A;  4EV0 A;  4UVC A;  2JRT A;  4KN4 X;  1FWZ A;  1QZY A;  1K6O A;  3SZP A;  4AIH A;  5CVI A;  3EUH A;  5EEH A;  4M71 A;  1OPC A;  2GA1 A;  2Z99 A;  4WCG A;  4LLG F;  3E5Q A;  2NS0 A;  5BS6 A;  3CUQ A;  1MDM A;  2PI0 A;  5D5W B;  2PLY A;  3WU1 B;  4M73 A;  2A6H F;  2MLK A;  1ZAR A;  5LHH A;  1FX7 A;  4G94 A;  2QBY A;  3BDD A;  1B1B A;  2VON A;  4YG2 F;  2MD5 A;  2O61 A;  1ZN2 A;  1WQ2 A;  3HTU A;  1I6X A;  4Y17 A;  1FYK A;  2KJC A;  3EYY A;  3QOP A;  1D3Y A;  3QAH A;  1K78 A;  1QBJ A;  4UNO A;  2BE5 F;  2MC3 A;  3RKW A;  4M6X A;  2KJB A;  3GEZ A;  4TV7 A;  5L3D A;  5D4R A;  4KUM A;  1ZLK A;  4KIC A;  5EEG A;  2XAF A;  1DUX C;  3CUQ C;  2FU4 A;  3IL2 A;  2HQR A;  4HX4 A;  3HOT A;  5DEQ A;  2Y0M A;  2OQR A;  3BRO A;  2WC2 A;  3FXR A;  1E17 A;  1ZHF A;  5JHU A;  2V1U A;  4Y15 A;  1KQ8 A;  1J0R A;  1REP C;  2RDP A;  3J81 Z;  5DCM B;  4HF1 A;  4S05 A;  1UHM A;  2RGV A;  2D1V A;  3D0S A;  1ZH5 A;  5FGM A;  1G3Y A;  3GZ5 A;  1R1T A;  5ICG A;  1XGN A;  3LST A;  4AD9 A;  3E97 A;  1FOK A;  2F5E A;  3KP4 A;  1OYY A;  1W4M A;  1KQ9 A;  5A2Q K;  4IVN A;  3CUO A;  1K7A A;  1MZB A;  2ISY A;  2H6B A;  1FBU A;  3KZZ A;  2ZNZ A;  4KIB A;  2B0L A;  1HW1 A;  4EJO A;  5LEK A;  1U3E M;  3IHU A;  4LK0 F;  2QEN A;  3RIR A;  4Z2Y A;  5LBQ A;  4L0Y B;  1ON1 A;  5BPD A;  3DEU A;  4CZZ A;  5E20 A;  2DTR A;  4RGX A;  3M8E A;  3GLX A;  4G8X A;  3RDI A;  2MLG A;  2O3F A;  2PEX A;  3HIF A;  4ZYD A;  1W7P A;  5LRS A;  1EH6 A;  1QQI A;  3LA2 A;  5DD4 A;  2H27 A;  1O3Q A;  5DD8 A;  2VE8 A;  5BQT A;  3ZMS A;  3QRF F;  5JR3 A;  3T1B A;  2ZME A;  2HKX A;  4U0Y A;  3QPH A;  2RQP A;  4HDV A;  1MJ9 A;  3L7W A;  3FX3 A;  1S7A A;  3L09 A;  2V1D A;  3ECH A;  2PN6 A;  3KP7 A;  3MQ0 A;  2HKO A;  2PQ8 A;  2HEO A;  4ZZL A;  2E7W A;  2STW A;  4F7Z A;  4NQW A;  3EYI A;  5K5O A;  3ZMD A;  3BJ6 A;  1R36 A;  4WXD A;  2FSW A;  2W57 A;  2M87 A;  1P4A A;  4PCQ A;  3NQO A;  3F8F A;  4UVB A;  3IKT A;  3L2C A;  2Y48 A;  1V3F A;  3QP5 A;  1IN6 A;  2IA1 A;  4HF0 A;  1TLH B;  1XCB A;  4EJV A;  1STZ A;  3V7C A;  4AIJ A;  2GWR A;  2BV6 A;  1YLF A;  1ZYR F;  4LFU A;  4EVI A;  4L9T A;  3RI4 A;  5BOX A;  3E6B A;  4EGY A;  5LLQ A;  4L18 B;  2HQN A;  3JAM Z;  3I64 A;  1CF7 A;  5HLG A;  4HDU A;  1L0O C;  3H92 A;  1ODD A;  4U0V A;  1KGS A;  4M72 A;  1YYV A;  5D8K B;  1AOY A;  3J7A O;  3I4P A;  4RB3 C;  3BWG A;  1H0M A;  5DCF A;  3EQL F;  1G3W A;  2HTS A;  1RUN A;  3ML6 A;  4EJT A;  1U2W A;  4JK1 X;  3TOB A;  1USS A;  2P5V A;  5L3B A;  3LWF A;  2IRF G;  2IP2 A;  3HRU A;  3R0J A;  3JSP A;  2P6T A;  4XLN F;  1R22 A;  3P7N A;  1MGT A;  3HHH A;  3FM3 A;  5AON A;  3WOD F;  3K1N A;  2VBW A;  4LD5 A;  2EFW A;  2NNY A;  3KLN A;  4I98 B;  1FNN A;  5F1R A;  3H3U A;  3DF8 A;  5HOO A;  1Y0U A;  3J80 K;  2D45 A;  4WK8 F;  2DAO A;  3KP3 A;  2A69 F;  2FRH A;  5L3E A;  1IAW A;  2G7U A;  2XAG A;  4MEX F;  1PP7 U;  1S7O A;  3ZQ7 A;  2M1B A;  3G73 A;  1Z6R A;  3WG9 A;  3BJO A;  4Q47 A;  3FF5 A;  5ED4 A;  4PZJ A;  3V4G A;  2OZ6 A;  1ZG1 A;  1ON2 A;  1P6R A;  2QBY B;  3TDU C;  3IC7 A;  5J8C A;  2Z33 A;  5HDN A;  5HS7 A;  4M9Z A;  5K5Q A;  2HS5 A;  1U5T A;  4EJW A;  3R0A A;  3DP7 A;  2CO5 A;  3DKW A;  5D6F A;  2LSO A;  4EQQ A;  1K78 B;  3GXO A;  5CVU A;  2LKP A;  1LEA A;  4LMY A;  1LJ9 A;  1BN5 A;  1QO0 D;  4YIF A;  2OAZ A;  2VBY A;  4DQ2 A;  1MJA A;  3E6M A;  3IRQ A;  1KA8 A;  3TOA A;  1MJB A;  4EM1 A;  3LA3 A;  1Z9C A;  4ESF A;  3WGH A;  2EV0 A;  3KFW X;  3L9F A;  1H9T A;  1XDU A;  1MD0 A;  3L00 A;  1HW2 A;  3ZMZ A;  2YU3 A;  3FWE A;  5AIP A;  4WXH A;  3EDP A;  3O3K A;  4HOB A;  4HZF A;  4UHT A;  1YG2 A;  2JT1 A;  3HTS B;  2FE3 A;  4L9N A;  1SFX A;  3QPT A;  2LF8 A;  3I59 A;  3TKY A;  3I0T A;  3C7J A;  1BIA A;  1UFM A;  2M8E A;  4O3M A;  4G7H F;  2K27 A;  4ESJ A;  4NHJ A;  1BIB A;  2VBX A;  5CLS A;  2M30 A;  2A5Y B;  4ENM A;  2Q0O A;  1A04 A;  4ENK A;  2ETH A;  1FY7 A;  4XLP F;  4XSX F;  3E6D A;  4EMS A;  2NRA C;  5J6X A;  2P6S A;  1Z1D A;  4LG0 B;  4YFX F;  4I7H A;  5FLX Z;  4EM0 B;  2MH9 A;  3T0Y A;  3WTT C;  4FT8 A;  4PGH A;  1G3T A;  3E5X A;  1ULY A;  2GXB A;  1RIO H;  4G7Z F;  1HKQ A;  2ESH A;  1ZGJ A;  2ZKZ A;  1IF1 A;  2M5W A;  1ZRD A;  2ZFW A;  4RB0 A;  2QVO A;  1I27 A;  1W5S A;  2ZBK A;  2GIV A;  1TQM A;  1PDN C;  3WGG A;  2WTE A;  1IW7 F;  3KP6 A;  2J5P A;  2EFQ A;  1XMK A;  2F5D A;  1R58 A;  2Z9O A;  4LLN A;  1BOA A;  1F4K A;  2ZME B;  3ZMU A;  3K1M A;  3MAJ A;  4MEY F;  1ONV A;  5JVT A;  1YQA A;  1HST A;  3I5U A;  2IPQ X;  4S04 A;  5D8L B;  5ICF A;  4BNC A;  2XUB A;  3KEO A;  1B9M A;  4A5N A;  4OIP F;  5A2Q Z;  2LDU A;  2RKH A;  1IN8 A;  4M9X A;  4HW0 A;  1P92 A;  1EV7 A;  2ZNY A;  1SD6 A;  3TO7 A;  1BI1 A;  1TBX A;  3IWZ A;  3LAP A;  3E5U A;  4M6Y A;  4P5O A;  3Q5F A;  1HKT A;  5J8F A;  2BEO A;  4CGZ A;  1E2X A;  3GO5 A;  5HDK A;  2Q2E A;  2DLL A;  5HLH A;  3HHG A;  2XKP A;  3ZN0 A;  4I0B A;  5E1W A;  3T8R A;  3MZY A;  1YW7 A;  4ZYG A;  3B73 A;  2FA5 A;  4U7B A;  2CG4 A;  1KU7 A;  1S8N A;  4O6J A;  1JHF A;  3K9T A;  2K86 A;  4R79 A;  1W5T A;  1S3J A;  1OYW A;  1FSH A;  4HLX A;  5HS8 A;  1F9N A;  3WGI A;  3VOD A;  2VOP A;  1V4R A;  4ESB A;  2OU2 A;  5ILV A;  3VB2 A;  1FYM A;  3W6K B;  4HV5 A;  1P4X A;  1B9N A;  1IUY A;  3HUG A;  2X0L A;  4G9Y A;  4ETS A;  1ZLJ A;  2Q8K A;  1BM9 A;  1G6N A;  3M7G A;  3ULQ B;  3KP5 A;  2PFB A;  4WWC A;  3F6O A;  1D5V A;  1PUE E;  5E8I A;  2W25 A;  1WWX A;  5CVJ A;  5DUI A;  3BPX A;  2QQA A;  1XN7 A;  2O8X A;  3I54 A;  1RUO A;  2NNN A;  2DQR A;  4N9I A;  3ZPL A;  2F5F A;  3C3W A;  1O3S A;  3HRT A;  4LB5 A;  3T8T A;  2BGC A;  4IXA A;  4IJA A;  1SAX A;  3CLO A;  2L02 A;  1R23 A;  3C18 A;  5D5U B;  1FLI A;  2OQG A;  4LGW A;  2BYV E;  3BPV A;  2KIF A;  3BJA A;  4M74 A;  4KA4 A;  2D1H A;  3GWZ A;  5ICE A;  1C0W A;  4R1H A;  1ZRF A;  2H09 A;  3DQV C;  3WTY C;  4KT5 C;  1GXP A;  5D6E A;  1LQ1 A;  1RI7 A;  4Y13 A;  4RS8 A;  2CQK A;  2CW0 F;  5IT9 Z;  3SFZ A;  2L3D A;  5LGN A;  1XDS A;  3QU3 A;  2A3S A;  2HZT A;  2L01 A;  1S29 A;  1KQ0 A;  2CWE A;  1R00 A;  2XAJ A;  3GUD A;  1ZAO A;  2JPB A;  1P4W A;  3WTW C;  3GVA A;  4I09 A;  3S2W A;  4P9U A;  4HAM A;  1KU9 A;  3F72 A;  1JGS A;  1QGP A;  4RAZ A;  4L5J A;  3FM5 A;  3HSR A;  4MQ9 F;  3KEQ A;  5HVQ C;  1KU2 A;  3HOS A;  5FO5 A;  2XVC A;  3CTA A;  2IVM A;  2UXN A;  1O57 A;  4OIR F;  4PDK A;  1TTY A;  2P8T A;  4LLL A;  1B59 A;  3F8B A;  3F8M A;  1KYW A;  3CJN A;  4FX4 A;  4BH9 A;  3LA7 A;  1DDN A;  2VT3 A;  4YFN F;  2OA4 A;  2QQB A;  5FD6 A;  5CJ9 A;  3T5X A;  2VE9 A;  5H20 A;  1WSU A;  2CFX A;  1XD7 A;  3FXQ A;  2KKO A;  3M1E A;  1UHW A;  3F8N A;  2W85 A;  3MWM A;  1IN7 A;  1T38 A;  2GA2 A;  3Q9V A;  4M9S A;  1FT9 A;  5F6F A;  3GF2 A;  3WTU C;  3ZP5 A;  3RPU A;  2WWY A;  1J59 A;  5L3F A;  2RVC A;  3FZV A;  5DCM A;  2L4A A;  1R1V A;  1BC7 C;  1SMT A;  1YIO A;  4MGR A;  5D5X B;  4P9F A;  4ZYH A;  1HW5 A;  1I1G A;  2VC0 A;  4QLC U;  4OU0 A;  4U88 A;  5ILS A;  3MFK A;  2JSC A;  2DO7 A;  1WI9 A;  4CHU A;  4IF4 A;  1YO5 C;  1KYZ A;  2HYG D;  2ZCW A;  3U1D A;  4IRG A;  1RNL A;  1J5Y A;  1LDD A;  4HX8 A;  2LNB A;  2F2E A;  3V7R A;  2FBH A;  1ZGA A;  4MNU A;  2YX7 A;  3HSF A;  3WTS C;  3GFI A;  2P7C B;  2ZO4 A;  2CYY A;  2G7H A;  1T39 A;  2YX4 A;  1FYL A;  2AXL A;  3FMS A;  3CUQ B;  1Z7U A;  1MDM B;  1O3R A;  3VOE A;  4KYW A;  2BBY A;  3K69 A;  3LQQ A;  1OKR A;  4BHB A;  2L54 A;  1TNT A;  2P5L C;  3RKY A;  4AVP A;  1SFU A;  3U9G A;  2PG4 A;  2MBF A;  4I0A A;  1H9G A;  4OIQ F;  2RN7 A;  1SD7 A;  1YTY A;  3RPQ A;  3TO9 A;  1IRF A;  4BHP A;  2M45 A;  3FMR A;  2EA4 A;  1P2F A;  2V9V A;  2O03 A;  1ZG3 A;  3DFG A;  2AS5 F;  3RYP A;  2UXX A;  2VBZ A;  2O0Y A;  2PJP A;  2GAU A;  2QM3 A;  1XCV A;  4RGR A;  1B6A A;  3V8K A;  5FB2 A;  4ZYE A;  4UXN A;  3BZ6 A;  3M9A A;  3K0L A;  4ENN A;  5HS9 A;  4RB1 A;  1GHC A;  5DDG A;  4IHT A;  3K1P A;  2DPU A;  2UZK A;  1SFE A;  1LVA A;  1DPU A;  3KZY A;  4KMF A;  4JBA A;  2GQQ A;  4RGS A;  3MCZ A;  1IN5 A;  4I02 A;  4L0Z B;  2FQ3 A;  4UVA A;  3NEU A;  1FP2 A;  5E18 F;  4H0E A;  2FBK A;  1LNW A;  4ENJ A;  5F64 A;  3Q9S A;  5FD5 A;  5KVR A;  4KN7 X;  1TW2 A;  1D8K A;  2V79 A;  1IZ1 A;  2KRF A;  3B02 A;  2P7V B;  1XGM A;  2X4H A;  2ADU A;  1FZP B;  5JI6 A;  3OOP A;  4A6E A;  2ACJ A;  3JW4 A;  1S6L A;  1UCR A;  3ZMV A;  1BI3 A;  5DYM A;  1FSE A;  1YW8 A;  3QU6 A;  4HQE A;  2XGX A;  5LGU A;  3GFM A;  1X3U A;  1ZRE A;  2IT0 A;  4Q4Z F;  4XBF A;  2RC4 A;  3O6B B;  2VT2 A;  1EH7 A;  1XGO A;  5LHG A;  1HBX G;  4Q5S F;  2CSO A;  3PQK A;  1FBS A;  1FP1 D;  1W7P B;  2ELH A;  2EFN A;  4GGG A;  5FFX A;  2EV6 A;  5BMZ A;  1LB2 A;  3P9I A;  2CGP A;  2GZW A;  4IPA A;  5ERI A;  5E8G A;  1TQI A;  2YPR A;  4HLY A;  2DT5 A;  3HSE A;  4XSZ F;  5JFR A;  2DK5 A;  4ZH4 F;  5E1Z B;  3TQN A;  3HRS A;  2F5C A;  4G6Q A;  3WE3 A;  2XAS A;  3RJP A;  4N9H A;  3BOQ A;  2EV5 A;  2DPD A;  3BP8 A;  2FNP A;  4IRI A;  5AIQ A;  4CDG A;  4KNY A;  3GFJ A;  5HLI A;  4B09 A;  2MH2 A;  4A12 A;  1HQC A;  3V8J A;  4XRF A;  1W7P D;  1LDJ A;  1SD4 A;  1BI0 A;  2E1C A;  2LF7 A;  2HOE A;  1QNT A;  1GVJ A;  2WV0 A;  1XSV A;  2XAH A;  3ABU A;  1TNS A;  3CO6 C;  5FLX K;  1DP7 P;  4LJZ F;  1YW9 A;  1OR7 A;  3CDH A;  3ROU A;  5KK1 A;  4LB6 B;  3AAF A;  1XB4 A;  3VFZ A;  1IXC A;  1MKM A;  4I2O A;  4OMZ A;  3WTV C;  1Q1H A;  2NYX A;  3BY6 A;  4P96 A;  2KIM A;  1U6G A;  3F21 A;  4WF2 A;  2V6C A;  4U0W A;  3IRR A;  3K2Z A;  2Z3Y A;  3LAJ A;  1PP8 F;  2JZY A;  1T0F A;  2STT A;  1CF7 B;  3TDZ C;  1J2X A;  2DU9 A;  2EJR A;  1QZZ A;  2YR2 A;  1FBQ A;  4KMU X;  2ESN A;  3O2P E;  1R5G A;  1SD5 A;  3G3Z A;  2JTV A;  4AWX B;  1O3T A;  3OV8 A;  2D2W A;  1T98 A;  1U8R A;  3HRM A;  1WKM A;  4JQF A;  4OIO F;  4RAY A;  3ERE D;  4K2E A;  4HA8 A;  3MEX A;  4CIC A;  1JXS A;  1BJA A;  4BXU A;  3F22 A;  3R60 A;  4HBL A;  2XIG A;  2QYO A;  5TJJ A;  3COA C;  2EFP A;  1I1S A;  4CO8 A;  5ILU A;  3KCC A;  3FHZ A;  1EH8 A;  4L5I A;  5CVV A;  3E3V A;  5K1Y A;  2E7X A;  3WU0 A;  3IWF A;  2IA2 A;  2RV8 A;  4UV8 A;  4LG0 A;  3QP6 A;  3SHF A;  5D5V B;  3P9K A;  4G7O F;  1J9I A;  4KFC A;  4BHC A;  2G9W A;  4LK1 F;  3V8L A;  2ZJ2 A;  5HDG A;  4ZZD A;  4A0Z A;  1YS7 A;  4WX9 A;  3R61 A;  4KIG A;  2ISZ A;  1YFH A;  1B4A A;  4OIN F;  1NHA A;  4A2U A;  2VXZ A;  4U7D A;  3VEP A;  2J5O A;  3F3X A;  4GO1 A;  3W6J B;  1WRJ A;  1OYI A;  3PQJ A;  4GCV A;  1XSD A;  4HF2 A;  1Z05 A;  5DV5 A;  2P5K A;  3J81 K;  4A0X A;  4B8X A;  3GFL A;  4P55 A;  2H94 A;  1BC8 C;  4Q48 A;  4A0Y A;  4BQA A;  1J7K A;  4A6D A;  1R1U A;  1U5T B;  2DW4 A;  2OZU A;  4IRH A;  2XRN A;  2IJL A;  2EA2 A;  1HKS A;  1G3S A;  2VC1 A;  4HYE A;  2FF4 A;  2HDC A;  2A61 A;  3I53 A;  1ZRC A;  1JHH A;  2HYF A;  3SXY A;  3ECO A;  2DK8 A;  1Z91 A;  2XHK A;  3DPL C;  3V7S A;  1TW3 A;  4HV6 A;  4YII A;  1F1Z A;  5IT3 A;  1OMI A;  2DI3 A;  4OMY A;  1LEB A;  4UV9 A;  2OBP A;  2W84 A;  5ICC A;  1BI2 A;  3DV8 A;  2EFO A;  3LFK A;  2A68 F;  4GYI A;  3I71 A;  3WTX C;  1TQP A;  2XRO A;  3TO6 A;  2VOD A;  4QWQ A;  3ABT A;  1KU3 A;  4E70 A;  5H6Q A;  3J80 Z;  4MQV A;  2OD5 A;  4CXF A;  3TGN A;  5LGT A;  4YFK F;  2UWM A;  3P9C A;  2E1N A;  4KIF A;  3I59 B;  4EGZ A;  4L9V A;  3FXU A;  2L4M A;  4OOI A;  2R7F A;  1FPQ A;  3LQR A;  5IT9 K;  2K4B A;  5H6R A;  1CGP A;  4GYG A;  2IW5 A;  2QLZ A;  3ZMT A;  3WE2 A;  1G4D A;  1L3L A;  3I58 A;  1Z6T A;  4PGG A;  3KE2 A;  1JE8 A;  4IHS A;  3GYH X;  2A6E F;  3CO7 C;  1IXR C;  5FFZ A;  1BBY A;  3ISP A;  3FMQ A;  1T2K A;  2O6G E;  3F6V A;  2XV4 S;  1HXD A;  3IKV A;  4I01 A;  3SZT A;  2MA3 A;  2K02 A;  3U2R A;  4GXO A;  2H6C A;  3KP2 A;  3E6C C;  2GXG A;  3REO A;  5CVR A;  4DNC A;  2Z5U A;  2HGC A;  2FEZ A;  3JTH A;  1IN4 A;  1DPR A;  2V1X A;  2YSR A;  4ON0 A;  1ZG5 A;  1FC3 A;  3R4K A;  1YS6 A;  3GW2 A;  1K79 A;  2XKO A;  1LDK B;  6PAX A;  4UUV A;  5LHI A;  2COM A;  2IA0 A;  3JAM K;  2DBB A;  3MZH A;  4KDP A;  2FMY A;  1RZ4 A;  3F23 A;  3PFI A;  2QQ9 A;  4HX7 A;  4BYY A;  1O7F A;  1UB9 A;  1HSJ A;  4R8H A;  1GXQ A;  5LRR A;  1XMA A;  1O7L A;  2PBI A;  2VOO A;  2R7D A;  3KET A;  1T6S A;  5L3G A;  5BPI A;  2C6Y A;  3SQN A;  3H3Z A;  5E1X A;  3C1D A;  5D4S A;  2FXA A;  2TDX A;  2XAQ A;  1U78 A;  1IXS B;  3HYI A;  2QZ8 A;  4WXC A;  2FML A;  2KIU A;  2HTJ A;  3EET A;  4O5V A;  3DPT A;  5CYV A;  2K7L A;  4HQM A;  4NB5 A;  4EM2 A;  1D8J A;  4N0B A;  3DXJ F; 
#chains in the Genus database with same CATH topology
 1R5H A;  1DQU A;  2EB7 A;  3HKZ A;  2QUF A;  3WTZ A;  5DM6 F;  5B1B H;  1QA6 A;  3OR1 C;  3G1M A;  2HWV A;  4NC7 A;  4RAF A;  1ETY A;  3ELK A;  4MTE A;  2CQX A;  3GZ6 A;  1R4M B;  4XR6 A;  2FNA A;  1ZK8 A;  3RYR A;  2HFH A;  1S7E A;  2JPC A;  4RB2 C;  1YJN I;  2CUZ A;  2DFI A;  2OTL I;  1XSX A;  1FTT A;  3HUG B;  2HR3 A;  4L9J A;  3OIP A;  4AC0 A;  3OIO A;  3RTR A;  2BVM A;  3LSG A;  3JSO A;  4D7N A;  1QPM A;  5HNF A;  4M3D A;  5L3C A;  2ZSI B;  4A5M A;  2ZXJ A;  2H1K A;  5J1R A;  2RNJ A;  3BZC A;  1XGS A;  2HXI A;  3F8C A;  3WG7 H;  2K4J A;  2R3S A;  2W24 A;  2VN2 A;  3CDI A;  3GX4 X;  2NS7 A;  2BY3 A;  2WAD A;  4AIK A;  3S3O A;  2OCE A;  2NAZ A;  1EKE A;  4A3C J;  2FOK A;  1U5T C;  5IPA A;  3HOZ J;  2P4W A;  1UST A;  3R6S A;  5LEJ A;  2QSH X;  1J75 A;  3H5N A;  3FDY A;  4MHG A;  3ESW B;  3GZN B;  3CLQ A;  4BAY A;  4Y7N J;  2HOS A;  1AWC A;  2FQ4 A;  3DCF A;  3IUO A;  3W6V A;  5DUK A;  4CYD A;  2DYS H;  3SEZ A;  2DA4 A;  3N97 A;  5E17 F;  1F5T A;  4XLE A;  5B66 C;  2UV1 A;  2W48 A;  3IAM 2;  5TRD A;  1UZC A;  3KLO A;  2VL8 A;  3JCU C;  1ACI A;  2NS8 A;  5J40 A;  3CCL I;  5K5R A;  4D0P A;  4RDU A;  3NRV A;  3S2D J;  3I4M J;  2Y75 A;  2RAE A;  3RKX A;  3BR0 A;  4FX0 A;  3ZN1 A;  3M8F A;  4OAZ A;  4RGU A;  2W1O A;  3JTG A;  1UG2 A;  1SMY F;  3AG1 H;  4S0H B;  1IRG A;  4FHT A;  3G71 I;  3D5L A;  1Z77 A;  1MMA A;  2R5Z B;  1I5Z A;  2DQL A;  2OPT A;  1R7J A;  1MH4 A;  2EK5 A;  1K6Y A;  4G6D A;  2FBI A;  4ASN A;  2EWN A;  2QWW A;  4EJU A;  4ZJZ A;  2V4J C;  3W2W A;  3ERM A;  1VTN C;  2WAQ A;  3N4M A;  2PMH A;  3OYB A;  3GTL J;  2LP0 A;  4MTD A;  2A07 F;  4NC8 A;  4BS9 A;  2PMU A;  3FXJ A;  3SYT A;  4EV0 A;  4UVC A;  1A35 A;  2JRT A;  4CCN A;  4KN4 X;  1FWZ A;  1QZY A;  4XN0 A;  1K6O A;  4ZDP A;  3SZP A;  4AIH A;  1FOX A;  4E7J A;  5CVI A;  3EUH A;  5M3M J;  3PL8 A;  3VWB A;  3PM1 A;  5EEH A;  4M71 A;  2ZC2 A;  1OPC A;  2GA1 A;  2Z99 A;  4WCG A;  4LLG F;  2VQL A;  4E7Z A;  3LNQ A;  4I76 A;  3E5Q A;  2NS0 A;  5BS6 A;  4XID A;  3JRB A;  3M07 A;  1JGG A;  3CUQ A;  1MDM A;  1VZ0 A;  2PI0 A;  5FJ8 J;  1IG7 A;  5D5W B;  3IAS 2;  4FIS A;  2PLY A;  1N25 A;  3WU1 B;  5KAF C;  3F9K A;  2F4O B;  4KJZ A;  4M73 A;  2A6H F;  1FOW A;  2Q1Z B;  3FBN B;  2IAI A;  3KZI C;  3I9V 2;  4G6T B;  3PNT A;  2MLK A;  2DFE A;  1ZAR A;  5LHH A;  2QSF X;  2TCT A;  1FX7 A;  3CC2 I;  4DW6 A;  4G94 A;  2QBY A;  3CJT B;  3BDD A;  2L7M P;  1B1B A;  2VON A;  2PJR A;  2AQE A;  1Z7L A;  4YG2 F;  2MD5 A;  2O61 A;  1ZN2 A;  5J4Y A;  1WQ2 A;  3AG4 H;  3HTU A;  3TMO A;  3S93 A;  1I6X A;  2M8G X;  4Y17 A;  1FYK A;  1MBH A;  3LSP A;  1SFK A;  1DU0 A;  2KJC A;  3EYY A;  3QOP A;  1D3Y A;  3AG3 H;  3QAH A;  2XC7 A;  2L7Z A;  4IZZ A;  1K78 A;  3J7A Y;  1QBJ A;  3Q0W A;  4UNO A;  2BE5 F;  4D7M A;  1P7J A;  4BU2 A;  1A5J A;  1X1C A;  2MC3 A;  3ONQ A;  3RKW A;  1RKT A;  2CUE A;  2L9V A;  3GTP J;  4M6X A;  2KJB A;  3GEZ A;  4TV7 A;  3H9Q A;  3EUH C;  2XF6 A;  2CFO A;  2QKM B;  5L3D A;  5D4R A;  4KUM A;  5DTD A;  1Y56 A;  1ZLK A;  4KIC A;  5EEG A;  3L2Q A;  2DDB A;  1ETW A;  2XAF A;  1I50 J;  1DUX C;  3CUQ C;  4M3F A;  1CQT A;  3HGY A;  2FU4 A;  3OIQ A;  3IL2 A;  2HQR A;  3H5R A;  4HX4 A;  4BJT A;  1VND A;  3OYL A;  1MBG A;  3HOT A;  4F93 B;  5DEQ A;  4M6V A;  4B3X A;  3S17 J;  2Y0M A;  3PFY A;  2OQR A;  2WY7 Q;  3BRO A;  2WC2 A;  3FXR A;  1E17 A;  1ZHF A;  5JHU A;  2V1U A;  4Y15 A;  1MSF C;  1KQ8 A;  1J0R A;  1REP C;  2RDP A;  2WY8 Q;  3J81 Z;  5DCM B;  5K7H A;  1VQ4 I;  4S05 A;  1UHM A;  4HF1 A;  5M5Y J;  2RGV A;  3I55 I;  2D1V A;  3TW7 A;  3D0S A;  5BNG A;  5F04 A;  2XF5 A;  1ZH5 A;  2QA4 I;  5FGM A;  1G3Y A;  4NBQ A;  2VKE A;  3GZ5 A;  1R1T A;  5ICG A;  1IJW C;  1XGN A;  3LST A;  2BVL A;  4AD9 A;  2Y30 A;  4N4N B;  3E97 A;  1FOK A;  4BBS J;  1U9O A;  2F5E A;  4FET A;  4FE7 A;  1OCT C;  3M3Y J;  2K9Q A;  1B72 B;  3KP4 A;  1OYY A;  3RCO A;  2DT7 B;  1W4M A;  1KQ9 A;  5A2Q K;  4IVN A;  5IP9 J;  3CUO A;  4BL0 B;  1W5C C;  2LBF A;  1K7A A;  2CQQ A;  5F08 A;  1MZB A;  2KRC A;  4U87 A;  4B48 A;  2ISY A;  2H6B A;  1FBU A;  2DMP A;  3KZZ A;  2ZNZ A;  4KIB A;  2B0L A;  4IHW A;  3GBG A;  3OYM A;  3LSR A;  1HW1 A;  4RAG A;  3ZQQ A;  2DOD A;  2JA7 J;  4LG3 A;  4EJO A;  5LEK A;  4CCO A;  1U3E M;  2VPL A;  3IHU A;  4A3J J;  4LK0 F;  2QEN A;  3ZQI A;  3GLL A;  3RIR A;  4Z2Y A;  3KIO A;  2EIL H;  5LBQ A;  4L0Y B;  1ON1 A;  5BPD A;  3HOU J;  4E7H A;  4B43 A;  3DEU A;  4CZZ A;  5E20 A;  2DTR A;  2JJ7 A;  2Y0S N;  4RGX A;  2DXI A;  3M8E A;  1K4S A;  3GLX A;  4G8X A;  3RDI A;  1DP3 A;  3BQY A;  2R7R A;  2MLG A;  2O3F A;  2PEX A;  2NVQ J;  2NVY J;  3HIF A;  4ZYD A;  1W7P A;  4IEJ A;  1EH6 A;  2BOL A;  3H36 A;  1QQI A;  5LRS A;  1R49 A;  5KCM A;  3LA2 A;  3JRI A;  3ABL H;  3CQZ J;  4RMN A;  5DD4 A;  2H27 A;  2AQF A;  3MVP A;  2ECC A;  1X4P A;  4LIU A;  3QPL A;  1O3Q A;  5DD8 A;  2VE8 A;  5BQT A;  3ZMS A;  3QRF F;  5JR3 A;  3T1B A;  2ZME A;  2HKX A;  2XPV A;  4U0Y A;  3H35 A;  3QPH A;  1PUF A;  2RQP A;  5DS9 A;  4HDV A;  1MJ9 A;  3DLA A;  3FX3 A;  3L7W A;  4IQJ A;  3HB9 A;  2K9M A;  2KP6 A;  1S7A A;  3B6A A;  3J7Y J;  2M0C A;  3L09 A;  3K7A J;  2V1D A;  2XDV A;  3ECH A;  2PN6 A;  2EBI A;  2EZK A;  2JUC A;  3KP7 A;  3EUA A;  3MQ0 A;  2HKO A;  2K9S A;  2PQ8 A;  3PNV A;  2HEO A;  4ZZL A;  2EIK H;  5C3E J;  2E7W A;  3HGG A;  5FKO A;  2OV7 A;  2STW A;  4F7Z A;  4NQW A;  3S1R J;  3EYI A;  5K5O A;  3ZMD A;  3BJ6 A;  3OYI A;  2BW3 B;  2NOJ B;  2R7X A;  1R36 A;  2CW8 A;  4WXD A;  2FSW A;  4ZTF A;  2W57 A;  3DEE A;  2M87 A;  1VI0 A;  5FRN A;  1P4A A;  3LOC A;  5GP9 A;  2R7V A;  3CMY A;  4PCQ A;  4C30 A;  5FRO A;  1O4X A;  1PYV A;  3LSK A;  4QSH A;  3NQO A;  3CJQ B;  1HLV A;  3F8F A;  4UVB A;  3IKT A;  1LE8 A;  4OAY A;  3L2C A;  2Y48 A;  1AKH A;  1WJF A;  1V3F A;  3L2W A;  3QP5 A;  2EIJ H;  4A3B J;  4BXF A;  1V5G A;  2Y9Y A;  1IN6 A;  4Y4R A;  2IA1 A;  3PSI A;  3OYC A;  1TC3 C;  4HF0 A;  5IOZ A;  2WB1 N;  2NVX J;  1TLH B;  1XCB A;  1FEX A;  1MIJ A;  4EJV A;  1MH3 A;  1Y39 A;  1JJ8 C;  1STZ A;  2X6X A;  3V7C A;  4AIJ A;  2GWR A;  1K61 A;  2R5Y A;  1OCC H;  2BV6 A;  2X1C A;  1YLF A;  1ZYR F;  4JX6 A;  3HG9 A;  5K7F A;  3CCU I;  2XPU A;  4LFU A;  1T8I A;  1HC8 A;  3S3M A;  4EVI A;  4OWR B;  2OF7 A;  4L9T A;  3QYB A;  3RI4 A;  5BOX A;  2BY2 A;  3E6B A;  3G2B A;  4EGY A;  5LLQ A;  4L18 B;  2HVQ A;  2HQN A;  2CV0 A;  2CUJ A;  3JAM Z;  3ZR8 X;  2GIZ A;  3I64 A;  1X1P A;  1SVL A;  1W36 D;  1CF7 A;  3GTQ J;  2IGN A;  4F91 B;  5HLG A;  4DBR A;  4HDU A;  4PJL A;  1L0O C;  3H92 A;  1ODD A;  4U0V A;  1KGS A;  5KNL A;  4M72 A;  2Y9Z A;  2E2I J;  4NUB A;  1YYV A;  5D8K B;  1AOY A;  2QGU A;  1SAN A;  3J7A O;  3I4P A;  2X6O A;  4RB3 C;  3BWG A;  1H0M A;  4E7L A;  5CQG A;  5DCF A;  2IEK A;  4XOT A;  3MKW B;  3VYT B;  5EGO B;  1XC5 A;  1G3W A;  3EQL F;  3OYH A;  2HTS A;  1QHG A;  1WGX A;  1RUN A;  2IS4 A;  3ML6 A;  4EJT A;  4HSR A;  4E6K G;  4XIC A;  4Y3O A;  2XRL A;  3W3C A;  1SEU A;  1U2W A;  4JK1 X;  3J7Z I;  2E19 A;  3MMY B;  2O7O A;  3TOB A;  1USS A;  1E0E A;  4RBO A;  2B9S A;  5J3L A;  2ID3 A;  4C3J J;  1Y1W J;  2MD0 A;  2P5V A;  3PNY A;  5L3B A;  1XPX A;  5GTI C;  3LWF A;  2IRF G;  2IP2 A;  3HRU A;  3R0J A;  4EEF G;  3JSP A;  5E3L A;  5IYD J;  3DTI A;  2P6T A;  1U8B A;  3CD6 I;  4XLN F;  1R22 A;  3OMY A;  3P7N A;  3S1Q J;  4BQO A;  4ZDL A;  3FK7 A;  3MKL A;  1MGT A;  4IHX A;  2L0K A;  3HHH A;  1I39 A;  1Z3X A;  1G8X A;  2BZT A;  2TRT A;  3FM3 A;  4RLF A;  5AON A;  3WOD F;  1JT6 A;  2IS1 A;  4CSW A;  1NG7 A;  3K1N A;  2VBW A;  4LD5 A;  4AU7 A;  1G59 A;  1JTX A;  2EFW A;  1V5E A;  2NNY A;  3KLN A;  1SVO A;  2A5W A;  4I98 B;  1FNN A;  1TT5 B;  2PX9 A;  5F1R A;  3H3U A;  2ZJQ F;  4C2U A;  1YX3 A;  3DF8 A;  3K4J A;  5HOO A;  5DM7 F;  1Y0U A;  4PSX A;  3J80 K;  2D45 A;  4WK8 F;  4JP0 A;  2VJI A;  2DAO A;  3KP3 A;  3KYC B;  2A69 F;  2FRH A;  2D5V A;  5L3E A;  1IAW A;  2G7U A;  2XAG A;  3OL4 A;  4MEX F;  1PP7 U;  2E36 A;  5M5W J;  3OOU A;  1GVD A;  1S7O A;  3ZQ7 A;  2M1B A;  4J00 A;  1FJL A;  3G73 A;  1Z6R A;  2HYJ A;  3WG9 A;  2QF7 A;  3BJO A;  4Q47 A;  3FF5 A;  3S15 J;  3K4L A;  5ED4 A;  2FD5 A;  4PZJ A;  4N4O B;  3V4G A;  2LRD A;  2OZ6 A;  1ZG1 A;  2M2E A;  4BY7 J;  1ON2 A;  1P6R A;  2QBY B;  1R6R A;  3TDU C;  2DOE A;  3U21 A;  2LOO A;  3IC7 A;  1OCZ H;  5J8C A;  2Z33 A;  5HDN A;  5HS7 A;  1SAU A;  2JMW A;  4M9Z A;  2F5V A;  5K5Q A;  2HS5 A;  3E7L A;  1U5T A;  3HBL A;  4EJW A;  3PJR A;  1W1W E;  3R0A A;  3DP7 A;  2CO5 A;  3LSI A;  1AA7 A;  3DKW A;  5D6F A;  1APL C;  1VQ5 I;  2LSO A;  4EQQ A;  1K78 B;  5JLX A;  4NDL A;  3S14 J;  4RA2 A;  1ETO A;  3GXO A;  5CVU A;  2LKP A;  1IDY A;  1LEA A;  4LMY A;  2LR8 A;  1LJ9 A;  3FIS A;  4B44 A;  3AG2 H;  1BN5 A;  2IBD A;  3K4N A;  1QO0 D;  4YIF A;  2OAZ A;  3D1N I;  2VBY A;  4DQ2 A;  1MJA A;  4HPQ A;  3E6M A;  3IRQ A;  2HOA A;  2IS6 A;  1KA8 A;  1TP4 A;  2OCC H;  1FMV A;  3BC8 A;  3CCR I;  4B47 A;  3HOV J;  2CS3 A;  3TOA A;  1MJB A;  4EM1 A;  2LG4 A;  3LA3 A;  1Z9C A;  2EZI A;  1ZR4 A;  3DTK A;  3ZQH A;  1F36 A;  3A2K A;  4UUS A;  4ESF A;  2B63 J;  3WGH A;  3DTE A;  1T56 A;  2EV0 A;  3KFW X;  3L9F A;  1H9T A;  2M0M A;  3BR2 A;  4AYB N;  1RKW A;  1XDU A;  1MD0 A;  3L00 A;  1HW2 A;  3ZMZ A;  2YU3 A;  2X9D A;  3FWE A;  5AIP A;  3LFU A;  4E7I A;  4WXH A;  1YIJ I;  1Z21 A;  4CYC A;  3EDP A;  3O3K A;  4HOB A;  4HZF A;  4UHT A;  1YG2 A;  2JT1 A;  3HTS B;  1TT0 A;  2FE3 A;  4L9N A;  2WAE A;  1SFX A;  3QPT A;  1A6I A;  3PIP F;  4XNF A;  3S32 A;  4DIQ A;  2LF8 A;  1N75 A;  2FJ1 A;  3I59 A;  3TKY A;  2LC2 A;  3I0T A;  1DGW Y;  3M1C A;  3C7J A;  3ASO H;  1BIA A;  1UFM A;  2M8E A;  4O3M A;  4G7H F;  3Q0U A;  2K27 A;  4ESJ A;  2DMN A;  4NHJ A;  4QTR A;  2CW7 A;  1BIB A;  2VBX A;  5CLS A;  3QOD A;  2M30 A;  2A5Y B;  2ZSH B;  4ENM A;  1MBK A;  2Q0O A;  1A04 A;  2XB0 X;  4ENK A;  2CJJ A;  2H8W A;  2ETH A;  1FY7 A;  4XLP F;  4BUP A;  4XSX F;  3L2U A;  3E6D A;  4EMS A;  2XSJ C;  2NRA C;  5J6X A;  2P6S A;  1Z1D A;  4LG0 B;  2R93 J;  1Z67 A;  1MMD A;  4I7H A;  2BHZ A;  4AVZ A;  2DJN A;  4YFX F;  4AM3 A;  5FLX Z;  4EM0 B;  2Z1D A;  2R7Q A;  2HPM A;  5B5E C;  1I3A A;  2MH9 A;  3T0Y A;  1FIP A;  3WTT C;  4FT8 A;  1JI8 A;  1UEL B;  3CES A;  3CME I;  2WBM A;  1A6Q A;  4PGH A;  5FRM A;  2KQR A;  1G3T A;  2MAB A;  4A3L J;  4CCK A;  3E5X A;  1ULY A;  2GXB A;  1IDZ A;  2DFH A;  1RIO H;  3CCQ I;  1WPK A;  5EDN A;  4G7Z F;  1HKQ A;  5J47 A;  3U1K A;  2ESH A;  1ZGJ A;  2DOF A;  2M4G A;  2ZKZ A;  2M5W A;  1IF1 A;  1ZRD A;  3OSG A;  1LFB A;  2ZFW A;  4RB0 A;  1YRN B;  1ZEL A;  2QVO A;  1I27 A;  1W5S A;  3HOX J;  1XTA A;  2ZBK A;  2HPI A;  3GTM J;  2GIV A;  1TQM A;  3IP4 B;  1T95 A;  1B8I A;  1PDN C;  3WGG A;  3A0H C;  3H5A A;  2WTE A;  1IW7 F;  1E3H A;  2J5P A;  3KP6 A;  2XPW A;  2EFQ A;  1XMK A;  2F5D A;  4HNU A;  4XKB A;  1R58 A;  2Z9O A;  4LLN A;  1BOA A;  2V9K A;  1F4K A;  2LY2 A;  4Y33 A;  2ZME B;  1VQL I;  2KIQ A;  3WHC A;  2W7N A;  3QWL A;  3ZMU A;  3K1M A;  3MAJ A;  1X4O A;  3VYU B;  3OYE A;  3BTL A;  4FE4 A;  4MEY F;  1ONV A;  5JVT A;  4DZJ A;  1YQA A;  3DBL B;  1RES A;  2EZH A;  1HST A;  3I5U A;  2IPQ X;  4S04 A;  1K4T A;  1X1A A;  2N8G A;  3BTJ A;  2E2H J;  5D8L B;  5ICF A;  4BNC A;  2VQC A;  3HPH A;  5HNH A;  2XUB A;  3KEO A;  1MBE A;  1B9M A;  2BY0 A;  4A5N A;  1GLN A;  1Q1V A;  4OIP F;  5A2Q Z;  2LDU A;  2RKH A;  2XB5 A;  5CKT A;  1IN8 A;  4NQW B;  4M9X A;  4HW0 A;  1P92 A;  1EV7 A;  3AL0 B;  2ZNY A;  1SD6 A;  3TO7 A;  4B3A A;  1BI1 A;  1TBX A;  4HNV A;  3IWZ A;  3LAP A;  3C2B A;  3E5U A;  3P5J A;  1T33 A;  4M6Y A;  4P5O A;  3WHB A;  2JRM A;  4IHV A;  3Q5F A;  1HKT A;  5J8F A;  2BEO A;  4CGZ A;  1E2X A;  1DGR M;  3GO5 A;  1IGN A;  2LK2 A;  5HDK A;  2Q2E A;  3SFI A;  2DLL A;  5HLH A;  5C4X J;  1AKH B;  1JUP A;  2EH3 A;  3HHG A;  1HA8 A;  1RR8 C;  2JA2 A;  1YOV B;  2XKP A;  1MNE A;  5IYC J;  3ZN0 A;  4I0B A;  2K40 A;  1VQO I;  2DT6 A;  3ABK H;  1TWC J;  5E1W A;  3T8R A;  3MZY A;  3LSJ A;  3K2A A;  1YW7 A;  2YUS A;  4ZYG A;  2MW8 A;  1LPQ A;  2R7S A;  3B73 A;  4BE0 A;  2FA5 A;  4U7B A;  1ETQ A;  1UHS A;  1RR7 A;  3Q0V A;  5B1A H;  1QPI A;  2CG4 A;  1KU7 A;  3KEY A;  1S8N A;  3JRH A;  4O6J A;  3HXL A;  2Y31 A;  1JHF A;  3FXM A;  3K4B A;  2KRH A;  3HDD A;  3K9T A;  2K86 A;  4A93 J;  4R79 A;  4XOP A;  1W5T A;  1S3J A;  1OYW A;  2NOG A;  1FSH A;  2MFZ A;  3FHN A;  2OUM A;  4HLX A;  5HS8 A;  1F9N A;  4IHY A;  3WGI A;  1VQM I;  4XRM A;  2F4I A;  3VOD A;  1V4R A;  4ESB A;  2CQ7 A;  4F3Q A;  2VOP A;  2LVS A;  2OU2 A;  5ILV A;  2NXN B;  3VB2 A;  1FYM A;  2M7B A;  2XGE A;  3HEF A;  3W6K B;  3HPG A;  4HV5 A;  3GTK J;  1P4X A;  1B9N A;  3IH4 A;  1IUY A;  1VQ8 I;  4DBQ A;  1WZ2 A;  2E5N A;  3HUG A;  2X0L A;  4G9Y A;  4MO7 A;  4ETS A;  1HF0 A;  1ZLJ A;  4CUG A;  2L7K A;  2Q8K A;  1JUS A;  1WHU A;  3I56 I;  1BM9 A;  1Y8R B;  4CCJ A;  1G6N A;  1WH7 A;  3M7G A;  3ULQ B;  2HZD A;  3KP5 A;  1OCP A;  2PFB A;  4WWC A;  3F6O A;  2WB1 A;  1D5V A;  4MIM A;  3K4K A;  4PSW A;  1PUE E;  4UB8 C;  1DU6 A;  1NH3 A;  1VQN I;  2W82 A;  3TP0 A;  5E8I A;  4BDY A;  2W25 A;  1WWX A;  1VF9 A;  3E0J B;  3FIW A;  4RLQ A;  4QPO A;  2WAQ N;  5CVJ A;  4ZC3 A;  4BEH B;  2OTJ I;  3FKI J;  5DUI A;  2R7Z J;  3BPX A;  3ZQF A;  2QQA A;  1MMS A;  1WFX A;  3ZQL A;  2XSD C;  3A01 B;  1XN7 A;  1YI2 I;  2O8X A;  1Y1V J;  3I54 A;  4C3I J;  1RUO A;  4X6A J;  3G1L A;  2NNN A;  2DQR A;  3FXO A;  1JTY A;  4N9I A;  3ZPL A;  1OR7 C;  1BL0 A;  2HDD A;  4G12 A;  2F5F A;  3C3W A;  1O3S A;  3HRT A;  4LB5 A;  2HDW A;  4J01 A;  3T8T A;  1ORK A;  2BGC A;  4IXA A;  4IJA A;  5IP7 J;  4D1Q A;  1SAX A;  3CLO A;  4W1U A;  3QOE A;  5E79 C;  2L02 A;  4B4C A;  1R23 A;  2AXT C;  3C18 A;  5M5X J;  4C2M J;  3CCJ I;  5D5U B;  2G0E A;  2BY1 A;  2DMU A;  5EZG A;  1FLI A;  2CH0 A;  2IGO A;  2OQG A;  1IC8 A;  4LGW A;  4YEJ A;  2BYV E;  3BPV A;  2KIF A;  3WU2 C;  3BJA A;  2F48 A;  4JX4 A;  3SZG A;  3BR6 A;  4M74 A;  4KA4 A;  3FBI B;  2IGK A;  2R7T A;  4KIT B;  2D1H A;  2M4K A;  2R5Z A;  3GWZ A;  5ICE A;  1OJL A;  3QPS A;  1C0W A;  4R1H A;  3RZD J;  2M9H A;  1JT0 A;  1ZRF A;  5EG0 A;  3E1S A;  1S72 I;  5JVG F;  1D1B A;  3NWT A;  2H09 A;  2IS2 A;  4PJM A;  1JKO C;  3DQV C;  4J19 A;  3WTY C;  3RQ4 A;  4KT5 C;  1GXP A;  4FCY A;  4BKX A;  5D6E A;  1LQ1 A;  1RI7 A;  4Y13 A;  4RS8 A;  3JRG A;  4V19 K;  2CQK A;  2CW0 F;  5IT9 Z;  1ZKG A;  3SFZ A;  2L3D A;  5LGN A;  1XDS A;  4IQ4 A;  3QU3 A;  3OL3 A;  2A3S A;  2FUG 2;  2HZT A;  4A69 C;  2L01 A;  1S29 A;  1KQ0 A;  2CWE A;  1Z0X A;  3BT9 A;  1E3P A;  1IUF A;  1M1E B;  1R00 A;  2X6Y A;  2XAJ A;  4D5F A;  5GAG J;  4QIW N;  3GUD A;  1ZAO A;  2JPB A;  1P4W A;  1EA3 A;  3WTW C;  1FIA A;  5JLW A;  1A31 A;  3GVA A;  2XF7 A;  2E34 A;  4XRS G;  4W97 A;  3W2V A;  4I09 A;  3S2W A;  3DU5 A;  2E1O A;  3MKZ A;  4KYW A;  4P9U A;  4HAM A;  3SDB A;  2LMD A;  1KU9 A;  3F72 A;  1JGS A;  1QGP A;  3KPH A;  3JR9 A;  1MND A;  3OS0 A;  4RAZ A;  4L5J A;  1X2M A;  3FM5 A;  4PFO A;  3VSL A;  3HSR A;  4MQ9 F;  2YU9 J;  3JRD A;  3KEQ A;  1EF4 A;  3AKZ A;  3IH2 A;  1RC9 A;  5HVQ C;  5LFA A;  1KU2 A;  3HOS A;  3CC4 I;  5FO5 A;  2V26 A;  2XVC A;  3CTA A;  2IVM A;  4H4K C;  1YJ9 I;  2UXN A;  2JWT A;  3QQA A;  1O57 A;  4OIR F;  4IOA F;  4PDK A;  1TTY A;  2KHM A;  1MMG A;  2P8T A;  4B1R A;  4LLL A;  3MZ8 A;  4MLO A;  1B59 A;  3F8B A;  3H3V K;  3F8M A;  2ZXW H;  1PVE A;  1KYW A;  3CJN A;  1SC7 A;  4FX4 A;  4BH9 A;  3LA7 A;  3V42 A;  1DDN A;  2VT3 A;  2VKD A;  3GTO J;  4YFN F;  1MW7 A;  2EPF A;  4E4H A;  2OA4 A;  2QQB A;  5FD6 A;  1LFU P;  5CJ9 A;  5FKN A;  1H89 C;  1VQ7 I;  3T5X A;  2VE9 A;  4ZTJ A;  2CV2 A;  3DKY A;  3BR3 A;  5M3F J;  2LFB A;  5H20 A;  1WSU A;  2YS9 A;  2CFX A;  2DDA A;  3LSM A;  4HRI A;  2X6W A;  2ELJ A;  4PK4 A;  1XD7 A;  4HNT A;  5C44 J;  3CMM A;  3FXQ A;  2KKO A;  3M1E A;  4A3D J;  1HDD C;  3BCB A;  2COB A;  1UHW A;  3F8N A;  2W85 A;  2XGC A;  4IO9 F;  3MWM A;  1IN7 A;  1ETV A;  1T38 A;  4YEL A;  1ZTR A;  2GA2 A;  4CZC A;  2H8R A;  3Q9V A;  1UMQ A;  4CYC B;  4M9S A;  1FT9 A;  4BQQ A;  5F6F A;  1QRY A;  5FLV A;  3A02 A;  2CMP A;  2W00 A;  2VB6 A;  3GF2 A;  3WTU C;  2WV1 A;  3ZP5 A;  3RPU A;  5F0C A;  2DA3 A;  2WWY A;  3UR3 C;  1J59 A;  2V6E A;  5L3F A;  2RVC A;  1V5F A;  3FZV A;  2VLA A;  2EIN H;  5DCM A;  4BGD A;  1QVT A;  2L4A A;  1LFP A;  1R1V A;  3JRE A;  1SFO J;  1RPW A;  2BHY A;  2IXS A;  4EAT A;  1BC7 C;  1SMT A;  1YIO A;  4FTH A;  4MGR A;  5D5X B;  4F52 A;  4P9F A;  1W0T A;  4II3 A;  2KT0 A;  1X3Z B;  4ZYH A;  4FQG A;  1HW5 A;  1J09 A;  1I1G A;  2VC0 A;  3ZOB A;  1MNM C;  4QLC U;  3AL0 C;  4OU0 A;  3CCS I;  4U88 A;  5ILS A;  3ASN H;  2V9P A;  3MFK A;  4I6Z A;  5EF6 A;  4X1E A;  2JSC A;  2DO7 A;  1B72 A;  1WI9 A;  4CHU A;  2P0W A;  4IF4 A;  3CZ6 A;  4AYB A;  1YO5 C;  1E3O C;  4XRS A;  1T08 B;  1KYZ A;  2X1D A;  2HYG D;  2ZCW A;  3H9J A;  2DA1 A;  3ABM H;  3U1D A;  1P9Q C;  2VQG A;  5EZH A;  2KZV A;  3OYA A;  3S1N J;  2JQ7 A;  4IRG A;  1RNL A;  1J5Y A;  2LY1 A;  1LDD A;  4HX8 A;  5E3N A;  2LNB A;  2F2E A;  3V7R A;  2R92 J;  2FBH A;  2QKL B;  3CCM I;  4A3F J;  1ZGA A;  3DKX A;  3O8G A;  2O8K A;  4MNU A;  2YX7 A;  1XS9 A;  3HSF A;  3WTS C;  3GFI A;  2GLO A;  1VFC A;  2LTP A;  2HXO A;  3BG6 A;  2P7C B;  4XOR A;  2ZO4 A;  3VYR B;  2CYY A;  3PSF A;  2VJ4 A;  2G7H A;  1T39 A;  2YX4 A;  1FYL A;  2AXL A;  1X1D A;  3FMS A;  3CUQ B;  1Z7U A;  1MDM B;  1O3R A;  1FMW A;  3VOE A;  3EUK L;  5GAE J;  1SVM A;  2KLO A;  3OSF A;  2BBY A;  1R5I D;  3K69 A;  3LQQ A;  1OKR A;  4BHB A;  2L54 A;  1TNT A;  1KZH A;  2P5L C;  4JYK A;  1JKQ C;  2ZXI A;  5C4J J;  3RKY A;  2CUF A;  4AVP A;  1SFU A;  3U9G A;  1UJ8 A;  2HVR A;  2E1M B;  2PG4 A;  2MBF A;  4XKC A;  5GAH J;  3CF5 F;  1ZQ3 P;  4I0A A;  1H9G A;  5F0F A;  3QYF A;  4OIQ F;  5TIS C;  2RN7 A;  1I3Q J;  3C2G A;  2PJR B;  2KIS A;  1SD7 A;  1YTY A;  2ECB A;  3RPQ A;  1OIS A;  1MBJ A;  4HST A;  1X58 A;  1IRF A;  3TO9 A;  3DU6 A;  4BHP A;  5J4V A;  2M45 A;  3D5S C;  3FMR A;  2EA4 A;  1P2F A;  2V9V A;  2O03 A;  1ZG3 A;  3DFG A;  4GRI A;  2R7U A;  2EQR A;  2VIX A;  2AS5 F;  3RYP A;  2UXX A;  2VBZ A;  3TED A;  2O0Y A;  2PJP A;  2GAU A;  2QM3 A;  1XCV A;  4UUT A;  1IRX A;  1Y0N A;  4RGR A;  1B6A A;  2DYR H;  3HC7 A;  1G2H A;  1K83 J;  3V8K A;  5FB2 A;  2DMQ A;  4ZYE A;  4UXN A;  3O8H A;  2BW3 A;  3A03 A;  3BZ6 A;  3M9A A;  3I3L A;  2L7F P;  1GV5 A;  3K0L A;  4A3G J;  2JA6 J;  2Z2S B;  1NK3 P;  3DEW A;  4BY1 J;  4ENN A;  3SJM A;  5IY5 H;  4LOC A;  5HS9 A;  4RB1 A;  1ENH A;  1GHC A;  3NAR A;  3LSH A;  5DDG A;  4IHT A;  2K9L A;  4A3E J;  3K1P A;  2DPU A;  4NC6 A;  4V2G A;  5J1U A;  2UZK A;  1SFE A;  1LVA A;  3G6E I;  1DPU A;  2X48 A;  2GM4 A;  1OCR H;  3KZY A;  2GBY A;  4KMF A;  1Z3Y A;  2HQA A;  4JBA A;  2VI6 A;  2GQQ A;  3BR5 A;  4RGS A;  3PIO F;  4ZDO A;  4IKF A;  4ABZ A;  3G1O A;  3MCZ A;  1IN5 A;  2ICW G;  4I02 A;  4M3E A;  4L0Z B;  3SDG A;  3FK6 A;  2FQ3 A;  2ZJP F;  5IYB J;  3GME A;  1BR2 A;  4UVA A;  3NEU A;  4BE2 A;  1FP2 A;  5E18 F;  4H0E A;  1EJ9 A;  2FBK A;  2PMZ N;  1LNW A;  4ENJ A;  3MN2 A;  4CCM A;  3MKY B;  2EZL A;  5F64 A;  1F43 A;  3Q9S A;  2GOX B;  2M3A A;  4MFE A;  5FD5 A;  2XGD A;  2X1E A;  1TW2 A;  3IH3 A;  4KN7 X;  5KVR A;  1D8K A;  2DN0 A;  1AU7 A;  2V79 A;  1IZ1 A;  2CV1 A;  2KRF A;  3B02 A;  2P7V B;  1XGM A;  1D0Y A;  1NK2 P;  3A4C A;  2HVS A;  3CCE I;  1OCO H;  2X4H A;  2ADU A;  3ZQC A;  3L2R A;  2CRG A;  1FZP B;  2DA7 A;  1R71 A;  5JI6 A;  2BXZ A;  3OOP A;  4A6E A;  2X51 A;  2ACJ A;  3BG3 A;  3JW4 A;  2DFF A;  2IGM A;  2LBF B;  2LD5 A;  1S6L A;  1UCR A;  2A6T A;  3ZMV A;  4X0G A;  1BI3 A;  1W36 C;  5DYM A;  1FSE A;  1YW8 A;  3QU6 A;  4HQE A;  2XGX A;  3ZCO A;  1GT0 C;  2E5Z A;  5LGU A;  2K3F A;  3NWS A;  1JUM A;  3GFM A;  2GOM A;  3CP8 A;  1X3U A;  1ZRE A;  2IT0 A;  4Q4Z F;  4XBF A;  2ZJR F;  2RC4 A;  3O6B B;  2VT2 A;  1EH7 A;  3HM5 A;  5EGO A;  1V54 H;  1D1A A;  2VAS A;  4E7S A;  1XMX A;  2LY9 A;  1XGO A;  1BJZ A;  2R0Q C;  4ITV A;  3BQZ A;  3NAU A;  3ZRG A;  2VXD A;  1JJ6 C;  1QU3 A;  3CMA I;  5LHG A;  3OY9 A;  1HBX G;  4Q5S F;  2I5U A;  3FXL A;  2CSO A;  3PQK A;  3H0G J;  3CJR B;  2DA6 A;  4E7K A;  1LUJ B;  1FBS A;  2LRE A;  1FP1 D;  1W7P B;  2E35 A;  1R4N B;  3M4O J;  2ELH A;  2EFN A;  4GGG A;  5FFX A;  5GAD J;  4PJN A;  5EG0 B;  2O9L A;  2EV6 A;  5K7Z A;  3I4N J;  3A0B C;  5BMZ A;  3P9I A;  1LB2 A;  2CGP A;  4XQF A;  2GZW A;  4IPA A;  5ERI A;  5E8G A;  2RRE A;  2JA8 J;  1TQI A;  1TZL A;  2LLK A;  2YPR A;  2M34 A;  4HLY A;  1P7I A;  3Q3S A;  1PUF B;  2QSG X;  2DT5 A;  3BZK A;  3FKJ A;  3HSE A;  4XSZ F;  5JFR A;  1POG A;  2DK5 A;  4F55 A;  4ZH4 F;  5F1J A;  5E1Z B;  3K4M A;  3L1P A;  3TQN A;  1BW5 A;  3HRS A;  5F0H A;  2F5C A;  4G6Q A;  3WE3 A;  2XAS A;  3RJP A;  9ANT A;  4N9H A;  2K5C A;  1LVK A;  2Y0S A;  3BOQ A;  2DOA A;  2EV5 A;  2A05 A;  1GUU A;  2DPD A;  4XKV A;  3K6G A;  5F27 A;  3BP8 A;  2FNP A;  4NNJ A;  4RM3 A;  4IRI A;  2V1N A;  5AIQ A;  4YIR X;  3HKZ N;  3BTI A;  4CDG A;  1D0Z A;  4KNY A;  4XLH A;  1U9N A;  3GFJ A;  5HLI A;  4B09 A;  2MH2 A;  1TWF J;  3TW6 A;  4A12 A;  1HQC A;  2R7O A;  5CPR B;  3V8J A;  4M3G A;  4XRF A;  1W7P D;  1LDJ A;  1SD4 A;  1BI0 A;  2L2O A;  4BDZ A;  3LL7 A;  1LE8 B;  1X1B A;  2E1C A;  1U0J A;  2LF7 A;  2HOE A;  1QNT A;  1GVJ A;  2WV0 A;  1XSV A;  2XAH A;  1QVU A;  3ABU A;  1TNS A;  3CO6 C;  4DYC A;  5FLX K;  1DP7 P;  1QHH D;  2DA5 A;  3KX2 A;  3S1M J;  4LJZ F;  3JRC A;  2JUG A;  1YW9 A;  1OR7 A;  3A1Y A;  3CDH A;  3ROU A;  2R5Y B;  5FKM A;  5KK1 A;  4XM3 A;  4LB6 B;  3AAF A;  2KDZ A;  2QQ8 A;  1XB4 A;  3VFZ A;  5B3S H;  2NVT J;  2F4M B;  2OC6 A;  5E3O A;  1IXC A;  3GCM A;  1MKM A;  4XLA A;  4OMZ A;  3WTV C;  1Q1H A;  2NYX A;  3BY6 A;  4P96 A;  4I2O A;  4Z6Y A;  2KIM A;  1U6G A;  4II2 A;  3F21 A;  4WF2 A;  2V6C A;  4U0W A;  5FLM J;  3IRR A;  3BG7 A;  3PUB A;  3K2Z A;  2Z3Y A;  5TGT A;  4UY8 I;  3LAJ A;  1PP8 F;  2JZY A;  1T0F A;  3UNG C;  2STT A;  2O5R A;  1KON A;  3RKQ A;  1JKR C;  1CF7 B;  3TDZ C;  1J2X A;  2DU9 A;  2HOT A;  2EJR A;  1QZZ A;  2YR2 A;  4HG2 A;  4AUX A;  1FBQ A;  4C3H J;  4D9J A;  4KMU X;  2ESN A;  3O2P E;  3CC7 I;  2VJ5 A;  1R5G A;  1SD5 A;  4IOC F;  3TBI A;  3G3Z A;  2E1M C;  2JTV A;  1YIT I;  4AWX B;  1NG6 A;  1O3T A;  3OV8 A;  2D2W A;  1T98 A;  2JK3 A;  1U8R A;  3HRM A;  1WJA A;  2K85 A;  4IX7 A;  1WKM A;  4JQF A;  4OIO F;  4RAY A;  3ERE D;  3BG9 A;  4K2E A;  2R7W A;  2HQ5 A;  4HA8 A;  3MEX A;  4CIC A;  2KPM A;  3BCA A;  1JXS A;  1WI3 A;  3AFH A;  1BJA A;  3HOW J;  4CH7 A;  4BXU A;  2QCO A;  1YJW I;  2E60 A;  3F22 A;  3R60 A;  4HBL A;  3X2Q H;  2XIG A;  2VKH A;  1FOY A;  2QYO A;  5TJJ A;  3COA C;  2EFP A;  1I1S A;  3S8P A;  2RQQ A;  4XK4 A;  1HCR A;  4CO8 A;  3MD2 A;  5ILU A;  1H8A C;  2VPR A;  3KCC A;  5GTH C;  3FHZ A;  2MSY A;  1HOM A;  1EH8 A;  4L5I A;  1W0U A;  4KT6 A;  1TWA J;  1UG0 A;  5CVV A;  3E3V A;  2FX0 A;  3H9G A;  4DJA A;  2E7X A;  5K1Y A;  1BOB A;  2DCE A;  3WU0 A;  5LD2 C;  3IWF A;  4DZP A;  2IA2 A;  2KL4 A;  2CU7 A;  2RV8 A;  3RZO J;  4UV8 A;  4LG0 A;  3QP6 A;  2L9N A;  3SHF A;  5D5V B;  1ZR2 A;  3VPR A;  3P9K A;  2QEX I;  4G7O F;  1J9I A;  4KFC A;  3TP3 A;  1T0F C;  2VKV A;  4BHC A;  2G9W A;  4XKW A;  4LK1 F;  3V8L A;  4DOZ A;  2ZJ2 A;  5HDG A;  3OYK A;  3RPU D;  4ZZD A;  2DA2 A;  2W4S A;  4A0Z A;  1YS7 A;  4WX9 A;  3R61 A;  2VUM J;  4KIG A;  3G4S I;  2ISZ A;  4PFP A;  3OS1 A;  1YFH A;  1B4A A;  1H88 C;  4OIN F;  1BR4 A;  1MBF A;  1NHA A;  3ZXS A;  4A2U A;  4BJ5 C;  2I8D A;  2ZXH A;  1Y8Q B;  2VXZ A;  5KAI C;  4U7D A;  4PJ0 C;  1VQ6 I;  3VEP A;  1V55 H;  2J5O A;  3F3X A;  4GO1 A;  3W6J B;  4ZYA A;  1YHQ I;  1WRJ A;  1OYI A;  3PQJ A;  4GCV A;  3BG5 A;  5FKK A;  1XSD A;  4HF2 A;  1YRN A;  5EEA A;  2M7A A;  1Z05 A;  2FOW A;  4YRV A;  5DV5 A;  2L5Q A;  3OYF A;  2P5K A;  4JOM A;  4RM2 A;  3J81 K;  3B6C A;  3BTC A;  4A0X A;  4GFB A;  4FAS D;  4B8X A;  3KYL A;  4PJJ A;  3GFL A;  4XON A;  4P55 A;  2H94 A;  2RNG A;  1BC8 C;  1VQK I;  4Q48 A;  2R4G A;  1MMN A;  2DMT A;  4A0Y A;  4BQA A;  1J7K A;  3PO3 J;  3K70 D;  4A6D A;  3QYE A;  1R1U A;  1U5T B;  2DW4 A;  2OZU A;  3CP2 A;  3EPZ A;  4IRH A;  2XRN A;  2IJL A;  2EA2 A;  3DBH B;  3JRF A;  1HKS A;  2AO9 A;  1G3S A;  2KFD A;  2ID6 A;  1GDT A;  2MG4 A;  2VC1 A;  4HYE A;  3JRA A;  2FF4 A;  4LIV A;  2HDC A;  2AHQ A;  3H1C A;  2X85 A;  2A61 A;  2P81 A;  3I53 A;  1ZRC A;  1JHH A;  2HYF A;  3SXY A;  3ECO A;  2DK8 A;  1Z91 A;  2XHK A;  2ZB9 A;  3DPL C;  3OYD A;  2LKS A;  3H0D A;  3V7S A;  4AID A;  1TW3 A;  4HV6 A;  4YII A;  1D0X A;  1F1Z A;  1OFC X;  5IT3 A;  1OMI A;  4DYQ A;  1PJR A;  5KHD A;  2DI3 A;  4OMY A;  1LEB A;  3D5R C;  4UV9 A;  3OYJ A;  1ITY A;  2OBP A;  2W84 A;  4LIT A;  1MSE C;  5ICC A;  1BI2 A;  3DV8 A;  2EFO A;  5J1Y A;  2GXA A;  1TWH J;  1ETX A;  3LFK A;  3OYN A;  2CQN A;  2A68 F;  1S5L C;  5EYR A;  1OQY A;  4UUS B;  3ZQG A;  4A3K J;  3SEQ A;  1HDP A;  4GYI A;  3I71 A;  3WTX C;  1WCM J;  1TQP A;  2XRO A;  3TO6 A;  2VOD A;  4QWQ A;  3ABT A;  4XLF A;  1KU3 A;  2VJJ A;  5GPC A;  4E70 A;  3HJE A;  3BR1 A;  5H6Q A;  2ZME C;  3J80 Z;  4MQV A;  2OD5 A;  2NVU B;  4CXF A;  3TGN A;  5LGT A;  1TL8 A;  4YFK F;  1Y6I A;  3RSN A;  2ZFU A;  2H1L A;  2UWM A;  3P9C A;  3VDX A;  4C2T A;  2E1N A;  2I10 A;  4ANJ A;  1WJD A;  4KIF A;  3I59 B;  4JX5 A;  1WJB A;  4EGZ A;  1VQ9 I;  4L9V A;  3DLL F;  3FXU A;  3HZJ A;  2ME0 A;  2L4M A;  4OOI A;  2BXY A;  2R7F A;  1WH5 A;  1ZGW A;  1FPQ A;  3LQR A;  1D5Y A;  3PUF A;  5IT9 K;  3N05 A;  2K4B A;  5H6R A;  2JN6 A;  2MGQ A;  1IO2 A;  1CGP A;  1BR1 A;  4GYG A;  2IW5 A;  4A3M J;  1XX5 A;  2QLZ A;  4V2F A;  3ZMT A;  4BJ6 C;  3WE2 A;  2E71 A;  1G4D A;  2UUZ A;  4P1W A;  1L3L A;  2Y69 H;  4UB6 C;  3I58 A;  5E3M A;  1Z6T A;  2WAF A;  2EIM H;  4PGG A;  3L2V A;  2K9N A;  1BA5 A;  2LH9 A;  3KE2 A;  4DYR A;  1JE8 A;  2LKX A;  3OR2 C;  4IHS A;  3GYH X;  2Y2Z A;  2A6E F;  3UKG A;  2PMZ A;  3CO7 C;  1IXR C;  4XL9 A;  5FFZ A;  1BBY A;  3ISP A;  3FMQ A;  5JHF A;  1AHD P;  3OWT A;  4BEH A;  4D5C A;  1T2K A;  4I99 C;  1R9T J;  2O6G E;  3F6V A;  2XV4 S;  1HXD A;  1LKX A;  2LYC A;  3A01 A;  3DWL E;  3IKV A;  3HOY J;  2B7E A;  2DTZ A;  1GV2 A;  4I01 A;  3SZT A;  1OLT A;  2MA3 A;  2K02 A;  3U2R A;  4GXO A;  5IOY A;  2H6C A;  1VQP I;  1JKP C;  1I6H J;  3KP2 A;  3E6C C;  4CA0 A;  2GXG A;  3REO A;  3HL2 A;  5CVR A;  4DNC A;  3CCV I;  2JSP A;  1TWG J;  2Z5U A;  3F0C A;  5HLT A;  2HGC A;  2DJI A;  2E2J J;  2HNH A;  1N78 A;  2FEZ A;  4IL6 C;  2ELK A;  3JTH A;  5IP6 A;  1D1C A;  1IN4 A;  2XAU A;  3S3N A;  3DPU A;  1WJE A;  1DPR A;  2V1X A;  4M3B A;  1B8I B;  2KDO A;  2YSR A;  3CDL A;  4BQN A;  1BW6 A;  1RET A;  3LMM A;  4ON0 A;  5HOD A;  1YX5 A;  1ZG5 A;  2KZG A;  1WJC A;  1XG1 A;  3PO2 J;  1FC3 A;  3R4K A;  1YS6 A;  3M8J A;  3W2A A;  5FKL A;  4PUS A;  3GW2 A;  4XMY A;  4BBR J;  3TL4 X;  1K79 A;  2XKO A;  1LDK B;  6PAX A;  4QPQ A;  5GPA A;  4UUV A;  4HEA 2;  5LHI A;  4BE1 A;  2Z16 A;  4XLC A;  1QZE A;  3CF2 A;  3VSK A;  2COM A;  2IA0 A;  1WVR A;  3ZGK A;  3JAM K;  2VQH A;  4F92 B;  2DBB A;  3MZH A;  2V7F A;  1IV8 A;  2FMY A;  4KDP A;  1RZ4 A;  1IV6 A;  4GDF A;  3K4C A;  4MFD A;  3F23 A;  4KIS A;  3PFI A;  2QQ9 A;  4HX7 A;  5EJC A;  3BLY A;  4BYY A;  1O7F A;  1UB9 A;  1A36 A;  2JVH A;  1YE9 A;  1HSJ A;  4R8H A;  1WJ5 A;  1GXQ A;  5LRR A;  1XMA A;  2F6C A;  1O7L A;  1ETK A;  2K3P A;  2PBI A;  2VOO A;  2R7D A;  3KYD B;  3KET A;  4Y52 J;  1T6S A;  2MYS A;  4A3I J;  4DGW B;  3RQI A;  5L3G A;  3OYG A;  4C9Y A;  5BPI A;  1RRJ A;  2C6Y A;  2Q2E B;  3SQN A;  3H3Z A;  5E1X A;  3C1D A;  5D4S A;  2FXA A;  2MC4 A;  1X2N A;  1X19 A;  2TDX A;  2XAQ A;  1U78 A;  2L9R A;  1IXS B;  3HYI A;  2QZ8 A;  3VYS B;  3K70 C;  3CCY A;  2JA5 J;  4WXC A;  3K10 A;  1UAA A;  3S16 J;  2FML A;  3S2H J;  3DBR B;  3FXK A;  3C2H A;  2HU9 A;  2KIU A;  1S9H A;  5H2F C;  2HTJ A;  1FTZ A;  3EET A;  4O5V A;  2HI3 A;  2KMU A;  4CCL A;  3DPT A;  2JVG A;  4L5E A;  5CYV A;  2K7L A;  4HQM A;  1X3W B;  4NB5 A;  1NTC A;  5CQE A;  4EM2 A;  3IV5 A;  3GTJ J;  3GTG J;  2ME6 A;  1N77 A;  1D8J A;  4XN3 A;  2OJE D;  2WA0 A;  1IRZ A;  3OS2 A;  2L9S A;  1ERD A;  4BXX J;  4N0B A;  4BAC A;  3DXJ F; 
#chains in the Genus database with same CATH homology
 1R5H A;  2EB7 A;  2QUF A;  3WTZ A;  2HWV A;  3ELK A;  4MTE A;  3GZ6 A;  2FNA A;  3RYR A;  2HFH A;  2JPC A;  4RB2 C;  2DFI A;  1XSX A;  4L9J A;  2HR3 A;  3RTR A;  3JSO A;  1QPM A;  5L3C A;  4A5M A;  2ZXJ A;  2RNJ A;  1XGS A;  3F8C A;  2K4J A;  2R3S A;  2W24 A;  2VN2 A;  3GX4 X;  4AIK A;  2NAZ A;  2FOK A;  1U5T C;  2P4W A;  1UST A;  3R6S A;  5LEJ A;  1J75 A;  4MHG A;  4BAY A;  1AWC A;  5DUK A;  4CYD A;  3N97 A;  5E17 F;  1F5T A;  5TRD A;  3KLO A;  5K5R A;  4D0P A;  3NRV A;  2Y75 A;  3RKX A;  4FX0 A;  3ZN1 A;  3M8F A;  4RGU A;  3JTG A;  1SMY F;  1IRG A;  4FHT A;  3D5L A;  1I5Z A;  2DQL A;  1R7J A;  2EK5 A;  4G6D A;  2FBI A;  4ASN A;  2EWN A;  2QWW A;  4EJU A;  1VTN C;  3N4M A;  2PMH A;  4MTD A;  2A07 F;  2PMU A;  4EV0 A;  4UVC A;  2JRT A;  4KN4 X;  1FWZ A;  1QZY A;  1K6O A;  3SZP A;  4AIH A;  5CVI A;  3EUH A;  5EEH A;  4M71 A;  1OPC A;  2GA1 A;  2Z99 A;  4WCG A;  4LLG F;  3E5Q A;  2NS0 A;  5BS6 A;  3CUQ A;  1MDM A;  2PI0 A;  5D5W B;  2PLY A;  3WU1 B;  4M73 A;  2A6H F;  2MLK A;  1ZAR A;  5LHH A;  1FX7 A;  4G94 A;  2QBY A;  3BDD A;  1B1B A;  2VON A;  4YG2 F;  2MD5 A;  2O61 A;  1ZN2 A;  1WQ2 A;  3HTU A;  1I6X A;  4Y17 A;  1FYK A;  2KJC A;  3EYY A;  3QOP A;  1D3Y A;  3QAH A;  1K78 A;  1QBJ A;  4UNO A;  2BE5 F;  2MC3 A;  3RKW A;  4M6X A;  2KJB A;  3GEZ A;  4TV7 A;  5L3D A;  5D4R A;  4KUM A;  1ZLK A;  4KIC A;  5EEG A;  2XAF A;  1DUX C;  3CUQ C;  2FU4 A;  3IL2 A;  2HQR A;  4HX4 A;  3HOT A;  5DEQ A;  2Y0M A;  2OQR A;  3BRO A;  2WC2 A;  3FXR A;  1E17 A;  1ZHF A;  5JHU A;  2V1U A;  4Y15 A;  1KQ8 A;  1J0R A;  1REP C;  2RDP A;  3J81 Z;  5DCM B;  4HF1 A;  4S05 A;  1UHM A;  2RGV A;  2D1V A;  3D0S A;  1ZH5 A;  5FGM A;  1G3Y A;  3GZ5 A;  1R1T A;  5ICG A;  1XGN A;  3LST A;  4AD9 A;  3E97 A;  1FOK A;  2F5E A;  3KP4 A;  1OYY A;  1W4M A;  1KQ9 A;  5A2Q K;  4IVN A;  3CUO A;  1K7A A;  1MZB A;  2ISY A;  2H6B A;  1FBU A;  3KZZ A;  2ZNZ A;  4KIB A;  2B0L A;  1HW1 A;  4EJO A;  5LEK A;  1U3E M;  3IHU A;  4LK0 F;  2QEN A;  3RIR A;  4Z2Y A;  5LBQ A;  4L0Y B;  1ON1 A;  5BPD A;  3DEU A;  4CZZ A;  5E20 A;  2DTR A;  4RGX A;  3M8E A;  3GLX A;  4G8X A;  3RDI A;  2MLG A;  2O3F A;  2PEX A;  3HIF A;  4ZYD A;  1W7P A;  5LRS A;  1EH6 A;  1QQI A;  3LA2 A;  5DD4 A;  2H27 A;  1O3Q A;  5DD8 A;  2VE8 A;  5BQT A;  3ZMS A;  3QRF F;  5JR3 A;  3T1B A;  2ZME A;  2HKX A;  4U0Y A;  3QPH A;  2RQP A;  4HDV A;  1MJ9 A;  3L7W A;  3FX3 A;  1S7A A;  3L09 A;  2V1D A;  3ECH A;  2PN6 A;  3KP7 A;  3MQ0 A;  2HKO A;  2PQ8 A;  2HEO A;  4ZZL A;  2E7W A;  2STW A;  4F7Z A;  4NQW A;  3EYI A;  5K5O A;  3ZMD A;  3BJ6 A;  1R36 A;  4WXD A;  2FSW A;  2W57 A;  2M87 A;  1P4A A;  4PCQ A;  3NQO A;  3F8F A;  4UVB A;  3IKT A;  3L2C A;  2Y48 A;  1V3F A;  3QP5 A;  1IN6 A;  2IA1 A;  4HF0 A;  1TLH B;  1XCB A;  4EJV A;  1STZ A;  3V7C A;  4AIJ A;  2GWR A;  2BV6 A;  1YLF A;  1ZYR F;  4LFU A;  4EVI A;  4L9T A;  3RI4 A;  5BOX A;  3E6B A;  4EGY A;  5LLQ A;  4L18 B;  2HQN A;  3JAM Z;  3I64 A;  1CF7 A;  5HLG A;  4HDU A;  1L0O C;  3H92 A;  1ODD A;  4U0V A;  1KGS A;  4M72 A;  1YYV A;  5D8K B;  1AOY A;  3J7A O;  3I4P A;  4RB3 C;  3BWG A;  1H0M A;  5DCF A;  3EQL F;  1G3W A;  2HTS A;  1RUN A;  3ML6 A;  4EJT A;  1U2W A;  4JK1 X;  3TOB A;  1USS A;  2P5V A;  5L3B A;  3LWF A;  2IRF G;  2IP2 A;  3HRU A;  3R0J A;  3JSP A;  2P6T A;  4XLN F;  1R22 A;  3P7N A;  1MGT A;  3HHH A;  3FM3 A;  5AON A;  3WOD F;  3K1N A;  2VBW A;  4LD5 A;  2EFW A;  2NNY A;  3KLN A;  4I98 B;  1FNN A;  5F1R A;  3H3U A;  3DF8 A;  5HOO A;  1Y0U A;  3J80 K;  2D45 A;  4WK8 F;  2DAO A;  3KP3 A;  2A69 F;  2FRH A;  5L3E A;  1IAW A;  2G7U A;  2XAG A;  4MEX F;  1PP7 U;  1S7O A;  3ZQ7 A;  2M1B A;  3G73 A;  1Z6R A;  3WG9 A;  3BJO A;  4Q47 A;  3FF5 A;  5ED4 A;  4PZJ A;  3V4G A;  2OZ6 A;  1ZG1 A;  1ON2 A;  1P6R A;  2QBY B;  3TDU C;  3IC7 A;  5J8C A;  2Z33 A;  5HDN A;  5HS7 A;  4M9Z A;  5K5Q A;  2HS5 A;  1U5T A;  4EJW A;  3R0A A;  3DP7 A;  2CO5 A;  3DKW A;  5D6F A;  2LSO A;  4EQQ A;  1K78 B;  3GXO A;  5CVU A;  2LKP A;  1LEA A;  4LMY A;  1LJ9 A;  1BN5 A;  1QO0 D;  4YIF A;  2OAZ A;  2VBY A;  4DQ2 A;  1MJA A;  3E6M A;  3IRQ A;  1KA8 A;  3TOA A;  1MJB A;  4EM1 A;  3LA3 A;  1Z9C A;  4ESF A;  3WGH A;  2EV0 A;  3KFW X;  3L9F A;  1H9T A;  1XDU A;  1MD0 A;  3L00 A;  1HW2 A;  3ZMZ A;  2YU3 A;  3FWE A;  5AIP A;  4WXH A;  3EDP A;  3O3K A;  4HOB A;  4HZF A;  4UHT A;  1YG2 A;  2JT1 A;  3HTS B;  2FE3 A;  4L9N A;  1SFX A;  3QPT A;  2LF8 A;  3I59 A;  3TKY A;  3I0T A;  3C7J A;  1BIA A;  1UFM A;  2M8E A;  4O3M A;  4G7H F;  2K27 A;  4ESJ A;  4NHJ A;  1BIB A;  2VBX A;  5CLS A;  2M30 A;  2A5Y B;  4ENM A;  2Q0O A;  1A04 A;  4ENK A;  2ETH A;  1FY7 A;  4XLP F;  4XSX F;  3E6D A;  4EMS A;  2NRA C;  5J6X A;  2P6S A;  1Z1D A;  4LG0 B;  4YFX F;  4I7H A;  5FLX Z;  4EM0 B;  2MH9 A;  3T0Y A;  3WTT C;  4FT8 A;  4PGH A;  1G3T A;  3E5X A;  1ULY A;  2GXB A;  1RIO H;  4G7Z F;  1HKQ A;  2ESH A;  1ZGJ A;  2ZKZ A;  1IF1 A;  2M5W A;  1ZRD A;  2ZFW A;  4RB0 A;  2QVO A;  1I27 A;  1W5S A;  2ZBK A;  2GIV A;  1TQM A;  1PDN C;  3WGG A;  2WTE A;  1IW7 F;  3KP6 A;  2J5P A;  2EFQ A;  1XMK A;  2F5D A;  1R58 A;  2Z9O A;  4LLN A;  1BOA A;  1F4K A;  2ZME B;  3ZMU A;  3K1M A;  3MAJ A;  4MEY F;  1ONV A;  5JVT A;  1YQA A;  1HST A;  3I5U A;  2IPQ X;  4S04 A;  5D8L B;  5ICF A;  4BNC A;  2XUB A;  3KEO A;  1B9M A;  4A5N A;  4OIP F;  5A2Q Z;  2LDU A;  2RKH A;  1IN8 A;  4M9X A;  4HW0 A;  1P92 A;  1EV7 A;  2ZNY A;  1SD6 A;  3TO7 A;  1BI1 A;  1TBX A;  3IWZ A;  3LAP A;  3E5U A;  4M6Y A;  4P5O A;  3Q5F A;  1HKT A;  5J8F A;  2BEO A;  4CGZ A;  1E2X A;  3GO5 A;  5HDK A;  2Q2E A;  2DLL A;  5HLH A;  3HHG A;  2XKP A;  3ZN0 A;  4I0B A;  5E1W A;  3T8R A;  3MZY A;  1YW7 A;  4ZYG A;  3B73 A;  2FA5 A;  4U7B A;  2CG4 A;  1KU7 A;  1S8N A;  4O6J A;  1JHF A;  3K9T A;  2K86 A;  4R79 A;  1W5T A;  1S3J A;  1OYW A;  1FSH A;  4HLX A;  5HS8 A;  1F9N A;  3WGI A;  3VOD A;  2VOP A;  1V4R A;  4ESB A;  2OU2 A;  5ILV A;  3VB2 A;  1FYM A;  3W6K B;  4HV5 A;  1P4X A;  1B9N A;  1IUY A;  3HUG A;  2X0L A;  4G9Y A;  4ETS A;  1ZLJ A;  2Q8K A;  1BM9 A;  1G6N A;  3M7G A;  3ULQ B;  3KP5 A;  2PFB A;  4WWC A;  3F6O A;  1D5V A;  1PUE E;  5E8I A;  2W25 A;  1WWX A;  5CVJ A;  5DUI A;  3BPX A;  2QQA A;  1XN7 A;  2O8X A;  3I54 A;  1RUO A;  2NNN A;  2DQR A;  4N9I A;  3ZPL A;  2F5F A;  3C3W A;  1O3S A;  3HRT A;  4LB5 A;  3T8T A;  2BGC A;  4IXA A;  4IJA A;  1SAX A;  3CLO A;  2L02 A;  1R23 A;  3C18 A;  5D5U B;  1FLI A;  2OQG A;  4LGW A;  2BYV E;  3BPV A;  2KIF A;  3BJA A;  4M74 A;  4KA4 A;  2D1H A;  3GWZ A;  5ICE A;  1C0W A;  4R1H A;  1ZRF A;  2H09 A;  3DQV C;  3WTY C;  4KT5 C;  1GXP A;  5D6E A;  1LQ1 A;  1RI7 A;  4Y13 A;  4RS8 A;  2CQK A;  2CW0 F;  5IT9 Z;  3SFZ A;  2L3D A;  5LGN A;  1XDS A;  3QU3 A;  2A3S A;  2HZT A;  2L01 A;  1S29 A;  1KQ0 A;  2CWE A;  1R00 A;  2XAJ A;  3GUD A;  1ZAO A;  2JPB A;  1P4W A;  3WTW C;  3GVA A;  4I09 A;  3S2W A;  4P9U A;  4HAM A;  1KU9 A;  3F72 A;  1JGS A;  1QGP A;  4RAZ A;  4L5J A;  3FM5 A;  3HSR A;  4MQ9 F;  3KEQ A;  5HVQ C;  1KU2 A;  3HOS A;  5FO5 A;  2XVC A;  3CTA A;  2IVM A;  2UXN A;  1O57 A;  4OIR F;  4PDK A;  1TTY A;  2P8T A;  4LLL A;  1B59 A;  3F8B A;  3F8M A;  1KYW A;  3CJN A;  4FX4 A;  4BH9 A;  3LA7 A;  1DDN A;  2VT3 A;  4YFN F;  2OA4 A;  2QQB A;  5FD6 A;  5CJ9 A;  3T5X A;  2VE9 A;  5H20 A;  1WSU A;  2CFX A;  1XD7 A;  3FXQ A;  2KKO A;  3M1E A;  1UHW A;  3F8N A;  2W85 A;  3MWM A;  1IN7 A;  1T38 A;  2GA2 A;  3Q9V A;  4M9S A;  1FT9 A;  5F6F A;  3GF2 A;  3WTU C;  3ZP5 A;  3RPU A;  2WWY A;  1J59 A;  5L3F A;  2RVC A;  3FZV A;  5DCM A;  2L4A A;  1R1V A;  1BC7 C;  1SMT A;  1YIO A;  4MGR A;  5D5X B;  4P9F A;  4ZYH A;  1HW5 A;  1I1G A;  2VC0 A;  4QLC U;  4OU0 A;  4U88 A;  5ILS A;  3MFK A;  2JSC A;  2DO7 A;  1WI9 A;  4CHU A;  4IF4 A;  1YO5 C;  1KYZ A;  2HYG D;  2ZCW A;  3U1D A;  4IRG A;  1RNL A;  1J5Y A;  1LDD A;  4HX8 A;  2LNB A;  2F2E A;  3V7R A;  2FBH A;  1ZGA A;  4MNU A;  2YX7 A;  3HSF A;  3WTS C;  3GFI A;  2P7C B;  2ZO4 A;  2CYY A;  2G7H A;  1T39 A;  2YX4 A;  1FYL A;  2AXL A;  3FMS A;  3CUQ B;  1Z7U A;  1MDM B;  1O3R A;  3VOE A;  4KYW A;  2BBY A;  3K69 A;  3LQQ A;  1OKR A;  4BHB A;  2L54 A;  1TNT A;  2P5L C;  3RKY A;  4AVP A;  1SFU A;  3U9G A;  2PG4 A;  2MBF A;  4I0A A;  1H9G A;  4OIQ F;  2RN7 A;  1SD7 A;  1YTY A;  3RPQ A;  3TO9 A;  1IRF A;  4BHP A;  2M45 A;  3FMR A;  2EA4 A;  1P2F A;  2V9V A;  2O03 A;  1ZG3 A;  3DFG A;  2AS5 F;  3RYP A;  2UXX A;  2VBZ A;  2O0Y A;  2PJP A;  2GAU A;  2QM3 A;  1XCV A;  4RGR A;  1B6A A;  3V8K A;  5FB2 A;  4ZYE A;  4UXN A;  3BZ6 A;  3M9A A;  3K0L A;  4ENN A;  5HS9 A;  4RB1 A;  1GHC A;  5DDG A;  4IHT A;  3K1P A;  2DPU A;  2UZK A;  1SFE A;  1LVA A;  1DPU A;  3KZY A;  4KMF A;  4JBA A;  2GQQ A;  4RGS A;  3MCZ A;  1IN5 A;  4I02 A;  4L0Z B;  2FQ3 A;  4UVA A;  3NEU A;  1FP2 A;  5E18 F;  4H0E A;  2FBK A;  1LNW A;  4ENJ A;  5F64 A;  3Q9S A;  5FD5 A;  5KVR A;  4KN7 X;  1TW2 A;  1D8K A;  2V79 A;  1IZ1 A;  2KRF A;  3B02 A;  2P7V B;  1XGM A;  2X4H A;  2ADU A;  1FZP B;  5JI6 A;  3OOP A;  4A6E A;  2ACJ A;  3JW4 A;  1S6L A;  1UCR A;  3ZMV A;  1BI3 A;  5DYM A;  1FSE A;  1YW8 A;  3QU6 A;  4HQE A;  2XGX A;  5LGU A;  3GFM A;  1X3U A;  1ZRE A;  2IT0 A;  4Q4Z F;  4XBF A;  2RC4 A;  3O6B B;  2VT2 A;  1EH7 A;  1XGO A;  5LHG A;  1HBX G;  4Q5S F;  2CSO A;  3PQK A;  1FBS A;  1FP1 D;  1W7P B;  2ELH A;  2EFN A;  4GGG A;  5FFX A;  2EV6 A;  5BMZ A;  1LB2 A;  3P9I A;  2CGP A;  2GZW A;  4IPA A;  5ERI A;  5E8G A;  1TQI A;  2YPR A;  4HLY A;  2DT5 A;  3HSE A;  4XSZ F;  5JFR A;  2DK5 A;  4ZH4 F;  5E1Z B;  3TQN A;  3HRS A;  2F5C A;  4G6Q A;  3WE3 A;  2XAS A;  3RJP A;  4N9H A;  3BOQ A;  2EV5 A;  2DPD A;  3BP8 A;  2FNP A;  4IRI A;  5AIQ A;  4CDG A;  4KNY A;  3GFJ A;  5HLI A;  4B09 A;  2MH2 A;  4A12 A;  1HQC A;  3V8J A;  4XRF A;  1W7P D;  1LDJ A;  1SD4 A;  1BI0 A;  2E1C A;  2LF7 A;  2HOE A;  1QNT A;  1GVJ A;  2WV0 A;  1XSV A;  2XAH A;  3ABU A;  1TNS A;  3CO6 C;  5FLX K;  1DP7 P;  4LJZ F;  1YW9 A;  1OR7 A;  3CDH A;  3ROU A;  5KK1 A;  4LB6 B;  3AAF A;  1XB4 A;  3VFZ A;  1IXC A;  1MKM A;  4I2O A;  4OMZ A;  3WTV C;  1Q1H A;  2NYX A;  3BY6 A;  4P96 A;  2KIM A;  1U6G A;  3F21 A;  4WF2 A;  2V6C A;  4U0W A;  3IRR A;  3K2Z A;  2Z3Y A;  3LAJ A;  1PP8 F;  2JZY A;  1T0F A;  2STT A;  1CF7 B;  3TDZ C;  1J2X A;  2DU9 A;  2EJR A;  1QZZ A;  2YR2 A;  1FBQ A;  4KMU X;  2ESN A;  3O2P E;  1R5G A;  1SD5 A;  3G3Z A;  2JTV A;  4AWX B;  1O3T A;  3OV8 A;  2D2W A;  1T98 A;  1U8R A;  3HRM A;  1WKM A;  4JQF A;  4OIO F;  4RAY A;  3ERE D;  4K2E A;  4HA8 A;  3MEX A;  4CIC A;  1JXS A;  1BJA A;  4BXU A;  3F22 A;  3R60 A;  4HBL A;  2XIG A;  2QYO A;  5TJJ A;  3COA C;  2EFP A;  1I1S A;  4CO8 A;  5ILU A;  3KCC A;  3FHZ A;  1EH8 A;  4L5I A;  5CVV A;  3E3V A;  5K1Y A;  2E7X A;  3WU0 A;  3IWF A;  2IA2 A;  2RV8 A;  4UV8 A;  4LG0 A;  3QP6 A;  3SHF A;  5D5V B;  3P9K A;  4G7O F;  1J9I A;  4KFC A;  4BHC A;  2G9W A;  4LK1 F;  3V8L A;  2ZJ2 A;  5HDG A;  4ZZD A;  4A0Z A;  1YS7 A;  4WX9 A;  3R61 A;  4KIG A;  2ISZ A;  1YFH A;  1B4A A;  4OIN F;  1NHA A;  4A2U A;  2VXZ A;  4U7D A;  3VEP A;  2J5O A;  3F3X A;  4GO1 A;  3W6J B;  1WRJ A;  1OYI A;  3PQJ A;  4GCV A;  1XSD A;  4HF2 A;  1Z05 A;  5DV5 A;  2P5K A;  3J81 K;  4A0X A;  4B8X A;  3GFL A;  4P55 A;  2H94 A;  1BC8 C;  4Q48 A;  4A0Y A;  4BQA A;  1J7K A;  4A6D A;  1R1U A;  1U5T B;  2DW4 A;  2OZU A;  4IRH A;  2XRN A;  2IJL A;  2EA2 A;  1HKS A;  1G3S A;  2VC1 A;  4HYE A;  2FF4 A;  2HDC A;  2A61 A;  3I53 A;  1ZRC A;  1JHH A;  2HYF A;  3SXY A;  3ECO A;  2DK8 A;  1Z91 A;  2XHK A;  3DPL C;  3V7S A;  1TW3 A;  4HV6 A;  4YII A;  1F1Z A;  5IT3 A;  1OMI A;  2DI3 A;  4OMY A;  1LEB A;  4UV9 A;  2OBP A;  2W84 A;  5ICC A;  1BI2 A;  3DV8 A;  2EFO A;  3LFK A;  2A68 F;  4GYI A;  3I71 A;  3WTX C;  1TQP A;  2XRO A;  3TO6 A;  2VOD A;  4QWQ A;  3ABT A;  1KU3 A;  4E70 A;  5H6Q A;  3J80 Z;  4MQV A;  2OD5 A;  4CXF A;  3TGN A;  5LGT A;  4YFK F;  2UWM A;  3P9C A;  2E1N A;  4KIF A;  3I59 B;  4EGZ A;  4L9V A;  3FXU A;  2L4M A;  4OOI A;  2R7F A;  1FPQ A;  3LQR A;  5IT9 K;  2K4B A;  5H6R A;  1CGP A;  4GYG A;  2IW5 A;  2QLZ A;  3ZMT A;  3WE2 A;  1G4D A;  1L3L A;  3I58 A;  1Z6T A;  4PGG A;  3KE2 A;  1JE8 A;  4IHS A;  3GYH X;  2A6E F;  3CO7 C;  1IXR C;  5FFZ A;  1BBY A;  3ISP A;  3FMQ A;  1T2K A;  2O6G E;  3F6V A;  2XV4 S;  1HXD A;  3IKV A;  4I01 A;  3SZT A;  2MA3 A;  2K02 A;  3U2R A;  4GXO A;  2H6C A;  3KP2 A;  3E6C C;  2GXG A;  3REO A;  5CVR A;  4DNC A;  2Z5U A;  2HGC A;  2FEZ A;  3JTH A;  1IN4 A;  1DPR A;  2V1X A;  2YSR A;  4ON0 A;  1ZG5 A;  1FC3 A;  3R4K A;  1YS6 A;  3GW2 A;  1K79 A;  2XKO A;  1LDK B;  6PAX A;  4UUV A;  5LHI A;  2COM A;  2IA0 A;  3JAM K;  2DBB A;  3MZH A;  4KDP A;  2FMY A;  1RZ4 A;  3F23 A;  3PFI A;  2QQ9 A;  4HX7 A;  4BYY A;  1O7F A;  1UB9 A;  1HSJ A;  4R8H A;  1GXQ A;  5LRR A;  1XMA A;  1O7L A;  2PBI A;  2VOO A;  2R7D A;  3KET A;  1T6S A;  5L3G A;  5BPI A;  2C6Y A;  3SQN A;  3H3Z A;  5E1X A;  3C1D A;  5D4S A;  2FXA A;  2TDX A;  2XAQ A;  1U78 A;  1IXS B;  3HYI A;  2QZ8 A;  4WXC A;  2FML A;  2KIU A;  2HTJ A;  3EET A;  4O5V A;  3DPT A;  5CYV A;  2K7L A;  4HQM A;  4NB5 A;  4EM2 A;  1D8J A;  4N0B A;  3DXJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...