2EZHA

Solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
SEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the I gamma subdomain of the Mu end DNA-binding domain of phage Mu transposase.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords TRANSPOSASE
total genus 19
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1997-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezhA00
2NVXJ 3JRCA 3QPLA 5HODA 3BTIA 1MBGA 3ZQCA 1W0UA 1WPKA 2ELKA 2X6OA 2RAEA 1RKTA 9ANTA 3HOUJ 1X2NA 5DS9A 3A01B 2XPVA 1RETA 3JRHA 2MG4A 2HOTA 2R93J 1D5YA 3B6AA 4EEFG 1GT0C 2Y2ZA 4QSHA 1LE8B 3TW6A 3IH3A 2ID3A 3WHCA 3TP0A 1XS9A 4GFBA 2NVQJ 1GV2A 1ETYA 2XGDA 2HXIA 5IPAA 3IH2A 2VI6A 5J1YA 4JX5A 2DMNA 2WV1A 5EGOB 2IEKA 3BR6A 2L7ZA 1ZTRA 1H8AC 4D7MA 2N8GA 3FK7A 3HGYA 3BG9A 4FISA 3GTGJ 1A5JA 5FKKA 4W1UA 3SDGA 1MH3A 1Z77A 3LSGA 3BTLA 2HI3A 3ZQIA 2HOAA 2TRTA 5GP9A 1BA5A 3S17J 2NVTJ 3S1RJ 5K7ZA 2O7OA 2O9LA 2QF7A 2OPTA 1VFCA 4XICA 1QVUA 1HOMA 1B8IA 2M34A 4A3EJ 5DTDA 3BQYA 5E3OA 1JUPA 1UMQA 4I6ZA 1UHSA 1GVDA 2ID6A 2FQ4A 3M4OJ 1ETQA 5EG0A 3D1NI 4A3IJ 3NARA 4I76A 5E3NA 4AC0A 3F0CA 3QQAA 3I4MJ 1OFCX 3S1QJ 1H89C 1AKHA 2O8KA 5F1JA 3TW7A 3HM5A 1QVTA 1IGNA 1MBFA 4M3EA 2DA7A 4UUSB 2NOGA 2LTPA 5BNGA 5IP9J 3DCFA 3RKQA 2X9DA 4JX4A 4M3BA 1W0TA 2R0QC 3OSGA 3BR3A 4DZPA 1ETWA 1JKPC 1TWCJ 5C4JJ 3GTOJ 5EF6A 2ECCA 2LFBA 4CYCA 2L0KA 3BTJA 2LKXA 1JUSA 2JK3A 2JA5J 5EZHA 1RPWA 2JN6A 2E2JJ 5F0HA 3GTLJ 2L9RA 1FTZA 2DA5A 3OOUA 3L1PA 1NK2P 2LD5A 3BTCA 4AYBN 2M2EA 4AUXA 2EQRA 2K9SA 4BY7J 3RZOJ 4RDUA 2R5ZB 1I3QJ 2YS9A 5F0CA 5FLVA 4DW6A 4RBOA 5IOYA 4L5EA 4V2FA 1HDDC 1IUFA 2DMUA 1IRZA 5IOZA 4NDLA 4A3GJ 2DMQA 4X1EA 4D5CA 3FIWA 2D5VA 2L7MP 4XRSG 4BBSJ 4Y7NJ 3BR5A 2ZB9A 1TWFJ 2EZIA 3BG3A 4M3GA 3Q0VA 2MGQA 1O4XA 1TWHJ 3OSFA 4CYCB 1H88C 2X48A 5J3LA 1I6HJ 2E1OA 3BR1A 4FCYA 1ENHA 3E7LA 4XK4A 3QPSA 4XRMA 2YUSA 3M3YJ 1S7EA 1YRNB 2EZHA 1CQTA 2H8RA 2HXOA 3DEWA 1T33A 1IG7A 1MSFC 1PUFB 5FKMA 3A02A 2DTZA 3GTPJ 1JKOC 2KT0A 2WB1N 2NVYJ 3LNQA 3K2AA 1JJ8C 1LFUP 4X6AJ 1NK3P 1APLC 1P7IA 2LY9A 1ETOA 5FKLA 4Y52J 1JTYA 1HF0A 1FIPA 2TCTA 3GTKJ 1FIAA 3S14J 1JTXA 2R5YB 2XGEA 2NS7A 4A3LJ 3ZQGA 3A01A 2JWTA 1BW5A 5IP6A 4JP0A 3PO2J 3FK6A 4A3CJ 5M5XJ 5K7FA 2EBIA 3CQZJ 4B4CA 5EG0B 4A3DJ 5IYDJ 5FJ8J 1QRYA 2M0CA 4M3FA 3BR2A 1MSEC 1XG1A 1ETVA 1TWGJ 4D7NA 1ZR4A 1BL0A 2JJ7A 4A93J 1YRNA 2VPRA 3MKLA 1E3OC 2R7ZJ 4IHXA 3S2HJ 5GPAA 3JRFA 3CCYA 1UG2A 1MH4A 2EZLA 2GBYA 4FE4A 1AHDP 5J1UA 4D5FA 4J19A 3H3VK 5C44J 1MNMC 1U9NA 3BT9A 3ZOBA 1MBEA 1F36A 2EZKA 2FD5A 4IHYA 5JLWA 2AHQA 3GBGA 4XIDA 2W48A 1OCPA 2IBDA 4A3FJ 1QPIA 1POGA 1MBJA 1RKWA 1JT0A 2VKVA 2COBA 1Y1WJ 1ZK8A 3HKZN 4M6VA 5E3MA 3GTJJ 2OF7A 3B6CA 3PM1A 4ABZA 2XPWA 5F08A 2XGCA 5FKNA 2LVSA 1ZQ3P 3GTMJ 3CMYA 1RESA 5M3MJ 2JA6J 4B3AA 5C4XJ 1A6IA 1HLVA 2E2HJ 3PO3J 1ETKA 1F43A 4MFDA 4W97A 3LSJA 5IYBJ 4BXXJ 4G12A 2Y9YA 5C3EJ 3HOZJ 1XC5A 2IAIA 2Y9ZA 1DU0A 1ITYA 3SFIA 2DMTA 2QCOA 2DA2A 3IV5A 3RQIA 2Y30A 2JMWA 1NTCA 2K9QA 2M9HA 1WCMJ 2HOSA 2XSDC 3JRGA 3S15J 4DYQA 2K40A 4DYRA 3A03A 4C3IJ 2R5ZA 1IDYA 2AO9A 1Y1VJ 2MSYA 1JGGA 3HBLA 4HNVA 1FTTA 2K9NA 2HYJA 3NAUA 2LR8A 1JKQC 3LOCA 2NS8A 4IHVA 4UUTA 1IDZA 5F0FA 1TC3C 4A3MJ 1I50J 2DA6A 1K83J 2XPUA 3ZQHA 1EF4A 1P7JA 3MN2A 3JRDA 5E3LA 2DMPA 2HDDA 1B72B 5EEAA 3S16J 5F27A 1ZR2A 1ORKA 1ZKGA 3CDLA 1SFOJ 2Y31A 4A69C 1JUMA 1VF9A 3JRAA 2GM4A 4A3JJ 1AKHB 2H1KA 1IC8A 2YU9J 3HGGA 4DYCA 1IV6A 2PMZN 1JT6A 3O8GA 2CUEA 1HCRA 3ZQLA 3TP3A 2ME0A 1BJZA 1LE8A 2XB5A 3BG5A 5K7HA 4XRSA 2Y0SN 3VPRA 5IP7J 1B8IB 3HOWJ 1AU7A 3I4NJ 4QTRA 5J1RA 3S2DJ 3MVPA 2M8GX 3ZQFA 5GPCA 3JREA 1OCTC 1WGXA 1ZGWA 3HB9A 1G2HA 3Q0WA 4A3KJ 1SANA 4LOCA 1RR7A 1U78A 1WI3A 3BR0A 2R92J 4BKXA 3UKGA 2JA7J 2JA8J 4UUSA 4C3HJ 1U8BA 3LSPA 3G1LA 4JX6A 3G1MA 1FJLA 3HEFA 5IYCJ 2HQ5A 3S1NJ 4BY1J 1R9TJ 2ECBA 1B72A 5EDNA 2GLOA 3JRIA 1X58A 4MFEA 3RZDJ 1Q1VA 1ETXA 2CJJA 2E19A 3Q0UA 1VI0A 3JR9A 3HDDA 2R5YA 1JKRC 4IEJA 1BW6A 1WH7A 3GTQJ 1VNDA 4C3JJ 3OIOA 3HOYJ 3O8HA 2DA1A 1DU6A 2LK2A 2DA3A 5M3FJ 3G1OA 4FE7A 1GDTA 2DJNA 1IJWC 1MBKA 3FISA 2CU7A 2FJ1A 3S1MJ 2MW8A 4MO7A 2P81A 2DN0A 2KDZA 1K61A 3SJMA 3Q3SA 2E2IJ 2I10A 4DZJA 2EH3A 3LSRA 3W6VA 1MBHA 1TWAJ 4MIMA 1T56A 4A3BJ 1PUFA 2CUFA 3K7AJ 4FTHA 3HOXJ 4IHWA 3JRBA 2XB0X 5M5WJ 3TEDA 4QIWN 1JJ6C 5FKOA 2CRGA 4M3DA 1GUUA 5FLMJ 2G0EA 5EGOA 5EZGA 5M5YJ 2LLKA 3C2BA 4BBRJ 4JYKA 3IH4A 3WHBA 3FKIJ 5JLXA 4C2MJ 1X2MA 2FX0A 2CQQA 1OJLA 1LFBA 2B63J 3H0GJ 3HOVJ 5EYRA 2L7FP 1Z0XA 1FEXA 2LP0A 2XRLA 2WAQN 2VKEA 1GV5A 4V2GA 1HDPA 1WH5A 2ME6A 4B1RA 2VUMJ 5F04A 3BQZA 1U9OA 4MLOA 2CQXA 4S0HB 2DA4A
chains in the Genus database with same CATH superfamily
3JRCA 4LLLA 3QPLA 3GCMA 3S2WA 1X1DA 2M1BA 2GQQA 2UUZA 4QPQA 1W0UA 1ONVA 4N0BA 2FBKA 2CFOA 2RAEA 4YG2F 1J75A 1D0XA 1YO5C 3A01B 2XPVA 2K27A 1ZAOA 2VB6A 1XSXA 3X2QH 3LSHA 3B6AA 2A5YB 2ZMEC 4EEFG 1UCRA 3HKZA 4GGGA 3L2WA 3RI4A 2JUGA 4Y17A 3HTUA 1OLTA 1KU9A 4QSHA 3K9TA 3TW6A 1W7PB 2IS2A 1V5FA 3ABKH 2EIMH 5E8IA 2R7SA 2D1VA 2DU9A 2HXIA 1ODDA 2VQCA 2DQLA 2HQNA 4IO9F 1IV8A 1FNNA 2A6EF 2VI6A 2R7OA 3WU2C 4EJVA 1ERDA 2DMNA 2RV8A 4QWQA 2B9SA 5KAFC 2JRTA 2JVHA 4II2A 1MZBA 3ESWB 3HGYA 3PJRA 2BW3A 5H6RA 2R7XA 1I3AA 4KISA 1MH3A 2VJJA 3FXLA 3HSRA 5GP9A 2TRTA 1QGPA 4GYGA 2NVTJ 3N05A 5FD5A 3WTWC 3JAMK 2QF7A 2OPTA 2R3SA 2ZXJA 4U0WA 1VFCA 4OU0A 2P6SA 4IHSA 1QVUA 4JOMA 1XMKA 2LBFB 2F4IA 2GOMA 4EGZA 1DGWY 1X1AA 3BQYA 1JUPA 3KP5A 4AU7A 5E3OA 3DPUA 1RI7A 1U5TA 1XGSA 2O3FA 1G59A 3PQKA 1UZCA 2F5VA 2JSPA 2FSWA 2P5VA 5ICCA 5EG0A 3QPTA 2BXZA 3NARA 4N9HA 1WJBA 2VKDA 2ZNYA 4AC0A 3I71A 2Q2EB 4LG0B 1WZ2A 3S1QJ 1G8XA 4G6TB 1H89C 5HS8A 2IA2A 4A2UA 1AKHA 4HEA2 2O8KA 4PJLA 1DP3A 3TW7A 2IPQX 3LA3A 2P4WA 3I3LA 4UUSB 4OAYA 2NOGA 4UUVA 2LTPA 3KP6A 4ZH4F 1MMSA 5IP9J 4M3BA 2HDWA 2V1NA 4BAYA 5DD4A 5E20A 4BEHB 1ETWA 1TWCJ 3OL3A 4CDGA 2HVQA 1YQAA 2ECCA 3IP4B 2L0KA 5LLQA 3N97A 1UB9A 2W85A 4FX4A 2LKXA 1YFHA 4LIUA 3D5LA 2V4JC 1RPWA 5F64A 4BDYA 1YIJI 3C2HA 3GTLJ 2L9RA 3ABLH 3ONQA 3L1PA 4XMYA 4XKVA 3DPLC 2LF8A 3V8LA 2DFEA 5HNHA 3KYCB 2KIMA 2CGPA 2O6GE 4RDUA 4XKBA 2R5ZB 2AS5F 3WTXC 5FLVA 2BVMA 3OIQA 4DW6A 4HDUA 4EM2A 1Z9CA 5IOYA 4N4NB 4HF0A 4AVZA 1J7KA 4KN4X 1ZGAA 6PAXA 2XRNA 3J7ZI 4X1EA 2E1NA 3MD2A 4JQFA 2AXTC 1XN7A 2L7MP 2MABA 1R58A 4BACA 3BR5A 2ZB9A 4HSRA 2Z3YA 1C0WA 2F2EA 1W4MA 3Q0VA 2MC4A 1DQUA 3GZNB 4BXFA 4H0EA 3OSFA 1TW2A 4ITVA 1ZREA 3F8MA 3GFLA 1BIAA 5CVRA 2HKXA 2IA0A 2XUBA 2KIFA 4XRMA 1ZRCA 1WJ5A 1S7EA 1HA8A 1CQTA 3QODA 4OAZA 2H8RA 3DEWA 1IW7F 1PUFB 2K7LA 2BY0A 1U8RA 3U9GA 3A02A 4FX0A 2X51A 1VQ6I 4HQEA 3R6SA 3E1SA 1JKOC 3DF8A 3HTSB 3OR1C 1WJCA 2NVYJ 1JJ8C 1S7AA 1LFUP 3S3NA 1VQ9I 2HVRA 4X6AJ 1QZZA 4MEYF 2X6WA 1P2FA 4L5IA 5KNLA 1A35A 2MLKA 2WAQA 4CCNA 1ZRDA 3MKWB 3F8CA 2K9LA 4DGWB 1R23A 4LJZF 1WJAA 1XMAA 3K10A 4XSXF 2I5UA 2CW7A 1O7FA 3WGHA 1Y8QB 3OIPA 3CF5F 2IP2A 2BHZA 1E2XA 2ELJA 2NS7A 2QQAA 3ZQGA 5LRSA 3OS0A 4A3LJ 2A05A 1T95A 3HL2A 1BW5A 2DTRA 3BP8A 2VOPA 3BWGA 2V26A 4CCJA 5K7FA 4B44A 3I58A 3LSKA 3GYHX 5EG0B 3CQZJ 5IYDJ 5ICFA 3RSNA 3KLNA 3DTIA 2XIGA 3V8KA 1JGSA 2R7WA 4M3FA 5CVVA 4OIPF 1MSEC 1MNDA 1XG1A 4BE1A 1BOAA 4P55A 5LFAA 5ILUA 3T8RA 1YRNA 4A93J 1LDJA 2XAGA 1G3SA 4B48A 3ZMTA 1E3OC 2B7EA 2R7ZJ 4XNFA 3I64A 3CCRI 5DDGA 3C7JA 2L01A 3H3UA 2V6EA 2GZWA 3JTHA 1OYWA 1XDUA 1AHDP 3PNYA 4J19A 2OAZA 1I27A 3H3VK 1HKTA 4KDPA 2RQQA 3U21A 2DYSH 1EV7A 4KICA 1F36A 1T2KA 2FD5A 1T98A 1VQNI 5J4YA 4PUSA 3ERED 3RJPA 2RNJA 4BE2A 4XIDA 1V54H 2GA1A 1FC3A 5IT9K 2BZTA 1QPIA 1POGA 2ZJPF 4GO1A 3V42A 1FPQA 2EWNA 1RC9A 2KRHA 3BG6A 4IRIA 2VKVA 1E3PA 1YLFA 4BGDA 3CCVI 4IVNA 2EV0A 3HKZN 5FD6A 3SZGA 1X1BA 2PMHA 1BI1A 4Z2YA 3DEEA 1FOKA 1Q1HA 1R6RA 2XAFA 2IW5A 5M3MJ 3DTKA 1A6IA 4GYIA 1D5VA 2QSFX 3H5AA 3MKYB 4W97A 2IT0A 1MKMA 4BXXJ 1SD5A 5DUKA 1R5GA 3LAJA 1B59A 2W25A 4KIBA 1DU0A 4HRIA 1ZRFA 2CS3A 1W7PD 2QCOA 3C2GA 3K4JA 3OYJA 4NUBA 3CDHA 4HV6A 3GEZA 2K9QA 2DXIA 2HOSA 3ZMDA 2A6TA 3I59B 4F93B 2RQPA 3S15J 1WFXA 3LQRA 2K40A 2GXBA 3CJNA 2HTSA 2M8EA 4EJOA 4I2OA 2QQ9A 4XONA 1IN7A 4D0PA 1ON2A 4U0YA 2CG4A 1FTTA 3LOCA 2NS8A 3LL7A 4UUTA 5JHFA 3CMAI 1IDZA 2EILH 5HOOA 3PNVA 1I50J 2DA6A 1GXPA 1P4WA 3K4KA 2XPUA 3DWLE 4PJNA 3CD6I 1B6AA 4KIGA 2VN2A 3JRDA 5E3LA 1IAWA 2WAFA 2DMPA 3E3VA 3CLOA 3BDDA 1QO0D 5E1WA 3KE2A 1ORKA 1ZKGA 1H9GA 1SFOJ 3BOQA 1ZHFA 4XLNF 3JRAA 4A3JJ 3R0JA 2H1KA 2Y48A 2PBIA 4S05A 5FFZA 1BI0A 2PMZN 4X0GA 1MDMB 2NXNB 4UV8A 3TP3A 1BJZA 2K5CA 1LE8A 4ON0A 1UHMA 3PSFA 2PMZA 3ZN0A 5K7HA 2EPFA 1K79A 2VBWA 1NG7A 3EYYA 3IRRA 1AU7A 4IL6C 3JSOA 3M8FA 4QTRA 2V7FA 3K70D 5LGNA 3J7YJ 3IKTA 3I53A 2A68F 3KP3A 1OCTC 1WGXA 3NQOA 1OCOH 2KISA 1Z1DA 3HB9A 4CCOA 1SANA 4HX4A 2JQ7A 1PVEA 2Q2EA 4LG0A 5K5QA 2DFFA 4XN3A 3BR0A 1BI2A 4UUSA 1XTAA 1U8BA 5CVUA 2R7QA 4JX6A 2WV0A 1MMGA 3G1MA 5HS9A 3HZJA 1FJLA 4N9IA 2HQ5A 2DW4A 2YR2A 2KPMA 3KZYA 1DP7P 1B72A 2GLOA 5EDNA 1HW1A 3JRIA 1PP7U 3B02A 4LFUA 2OCEA 4C30A 3WODF 1F4KA 1OCCH 1NH3A 4C3JJ 3G3ZA 3H5NA 3FMSA 1UHWA 4OOIA 2DA1A 2LK2A 5CKTA 1GDTA 2DJNA 3C18A 4FT8A 1IJWC 3JAMZ 1QHHD 2P8TA 2CU7A 3S1MJ 4KN7X 2P81A 2DN0A 3RPUA 3ZQ7A 2KDZA 1GHCA 3SJMA 3Q3SA 1X19A 1EA3A 2FBIA 2VQHA 4KITB 2IS6A 5IT3A 1BN5A 2W57A 1PUFA 1S3JA 4CO8A 1FP1D 4QIWN 1D1BA 1CGPA 1UG0A 2CRGA 2HZTA 1KQ8A 3F6OA 5AONA 3C2BA 2VBZA 3M1EA 4HLXA 5CVIA 2IGOA 4AIDA 4DNCA 2FX0A 4BNCA 3EUHC 1OJLA 3ZCOA 5LRRA 3CDIA 4WXHA 2LC2A 1MMAA 3CESA 5KCMA 3KZIC 4B47A 2LOOA 4DQ2A 3F21A 2QBYB 4V2GA 1HDPA 3QPHA 1WH5A 2AQEA 3IAS2 5F04A 1U9OA 3E6MA 4S0HB 2DA4A 4CH7A 2LBFA 2NVXJ 1X3WB 5FO5A 5BPIA 1XGOA 2EFPA 1MBGA 2CUZA 3W6JB 3P7NA 2OA4A 1WPKA 2ELKA 1XX5A 1KYZA 2L9NA 3GZ5A 4HYEA 4LMYA 3RTRA 2PI0A 3K2ZA 2IGMA 3MFKA 3KZZA 2HOTA 1FSHA 2ESHA 4MQ9F 2CSOA 3DKYA 3H9JA 1Z6TA 2ZO4A 1BR4A 2Y2ZA 4HPQA 4ZDOA 1SAUA 2LKSA 1LE8B 2LG4A 3ASOH 3TKYA 3F22A 3IH3A 2FNPA 2ID3A 1XS9A 3W2WA 2XKPA 2Q0OA 4GFBA 2XGDA 5DM6F 1PYVA 2VE9A 1FP2A 2PFBA 4RM2A 3BR6A 5EGOB 1IN8A 1BC8C 3LA2A 5L3DA 1FYMA 1XD7A 1U5TB 2DO7A 4D7MA 5LHIA 2WA0A 3FK7A 1T0FA 2CQKA 4YEJA 4FISA 1SAXA 4RA2A 4W1UA 1FOWA 5DCFA 3P9CA 1ACIA 2QM3A 2OZUA 2HVSA 3TDUC 3E97A 4IOAF 2HOAA 2XVCA 3HXLA 1MIJA 2E71A 3ISPA 5H2FC 3K6GA 3S17J 2O7OA 3GFMA 3MWMA 3PSIA 4G6QA 4XOPA 2O9LA 2Z9OA 2FQ3A 3PUFA 4ZJZA 3FF5A 4B09A 1MJAA 2EA2A 2Z33A 2E1MB 3E5QA 3VB2A 2PEXA 3ZQQA 4CCMA 3OYFA 4A3EJ 1UHSA 4L18B 2JPCA 3M4OJ 1ETQA 2VBYA 1XCVA 4BHPA 4HNTA 2IVMA 4A3IJ 1YG2A 5EEGA 1IRGA 1S5LC 5E3NA 2Z5UA 3QQAA 1OFCX 3RIRA 2D2WA 1QPMA 1EH6A 1QVTA 1A6QA 1IGNA 1IF1A 1UELB 5LHGA 2EA4A 3RKWA 3OV8A 3RKQA 2X9DA 3QAHA 2L54A 4JX4A 3E0JB 1W0TA 2CW0F 1I6XA 4F52A 1E0EA 4BH9A 4DZPA 3IWFA 4F92B 5J4VA 2ACJA 1JKPC 1A36A 4CGZA 4EVIA 2KZGA 3CC2I 1VTNC 1YS6A 5EF6A 3AL0C 1N78A 2L4AA 3HG9A 2M0MA 2DDBA 5KVRA 1CF7A 5EZHA 2JA5J 2AQFA 3G71I 2E2JJ 1FTZA 2KIUA 2VXDA 4WCGA 2E5NA 2LD5A 3BTCA 3CZ6A 2M2EA 3IKVA 1X1PA 4BY7J 3RZOJ 5BPDA 3K70C 3LWFA 3OL4A 1L0OC 1N75A 5FGMA 1ZG3A 4RBOA 3RKXA 1LEAA 3V8JA 1ZGJA 3OYKA 1IUFA 5B5EC 2XKOA 3I55I 3I59A 4A3GJ 2A6HF 4A6EA 4D5CA 2VT3A 2F48A 2NS0A 5B3SH 5K5OA 3OR2C 4XBFA 5GAHJ 3NRVA 2MGQA 4ANJA 2WY8Q 1EH7A 3LSIA 2ISYA 5LEJA 2MH9A 4XLCA 3CO7C 1TNSA 3V7RA 4OINF 5J3LA 4NB5A 1HBXG 1I6HJ 2ZMEB 1ENHA 1OQYA 2K4BA 3E7LA 5GAGJ 2HNHA 1IN5A 2QYOA 3QPSA 3M3YJ 5D4SA 2HPMA 4CZZA 3QYEA 1U0JA 4JK1X 4G7ZF 2GIZA 1BR2A 2HXOA 3GMEA 4XLEA 3KFWX 4A12A 4LK0F 1YW7A 5FRNA 5FKMA 1T8IA 5BOXA 2QSGX 2ADUA 3VODA 3M8JA 5LHHA 3BZCA 2QSHX 3GTPJ 2DLLA 2XAQA 2WB1N 1JHHA 3BY6A 4G6DA 1A31A 4XSZF 3R60A 4WF2A 4WXDA 5IY5H 3P9IA 3HUGA 1V5GA 2RN7A 3WGIA 1J59A 4Y52J 3J7AY 1BOBA 2BHYA 5D8LB 3CP2A 1OCZH 2G7UA 3HPHA 4HSTA 3M9AA 3GTKJ 3MZHA 2XAHA 1FIAA 1G3YA 2OZ6A 4R1HA 3AG2H 4ENJA 3A01A 2JWTA 2G9WA 2EFOA 5IP6A 3PO2J 4KMFA 2BVLA 3QU6A 4B4CA 2ZSHB 3J80Z 3IRQA 5FJ8J 1QRYA 2M0CA 2WWYA 5KHDA 1LKXA 4LLGF 4Y13A 1ETVA 4BDZA 2OBPA 5ED4A 1DUXC 5HS7A 3GX4X 1WQ2A 2TDXA 2H27A 4G9YA 5GPAA 2DAOA 4C2UA 1VQPI 3CCYA 3TL4X 5GTIC 4FE4A 1YX3A 3WU0A 4D5FA 1YJNI 5FFXA 4A0XA 2BW3B 3BT9A 4HQMA 5HVQC 2W7NA 1Z6RA 3CCEI 4JBAA 1FX7A 2IS4A 2YX4A 3F3XA 1GLNA 4HZFA 2VKHA 1PDNC 2IBDA 2LDUA 3CMMA 1XSDA 3IAM2 1RKWA 2M4KA 5FB2A 1VQOI 4AWXB 4GRIA 3K4LA 3GTJJ 3B6CA 3PM1A 4BQNA 5L3EA 2XPWA 4BQAA 4E7JA 2QBYA 2V9KA 3K4CA 2CFXA 5HLIA 4PCQA 1OKRA 2C6YA 1ZQ3P 3CMYA 5K1YA 4B3AA 4C2TA 4OIRF 4Z6YA 4G7HF 1G3TA 2R7RA 4RLQA 2OQRA 3QU3A 4P1WA 4ZZLA 3PIOF 1R4MB 4G12A 4LG3A 1XC5A 2VBXA 1FWZA 3G73A 4L0YB 1TQPA 3OYLA 2A69F 3HOSA 2NVUB 4ASNA 4EM1A 1SVMA 3DKWA 2JRMA 2G7HA 2FA5A 2KJCA 2OTLI 2W24A 2QQBA 2Z99A 2XSDC 2VC1A 3H36A 3O3KA 1D1CA 3K0LA 4DYRA 2M4GA 3A03A 1Z67A 1IDYA 1DPUA 1FYKA 2E60A 2JZYA 4ZYAA 4AYBA 1Y1VJ 1OMIA 3HC7A 3HBLA 5JHUA 2XAUA 4M9SA 1HW2A 2AXLA 5JVTA 2LR8A 5KK1A 4IHVA 3GFJA 3A2KA 5AIPA 2F4MB 3FM5A 4PJJA 2K86A 4A3MJ 4DJAA 3OYDA 3HHHA 3GWZA 3PQJA 2XSJC 4LLNA 4HF1A 3T1BA 3I9V2 4M6XA 1R22A 2HDDA 1B72B 2CV1A 2RREA 3KP7A 4PDKA 2Y31A 3R0AA 4A69C 1V4RA 2FXAA 1ZARA 2GM4A 4J01A 1YI2I 4RMNA 3DBLB 2HYGD 3K69A 3O8GA 2ZFWA 3VYTB 1HCRA 2ME0A 2PJPA 4YIFA 1QQIA 4XLAA 1XGNA 4F55A 1ZG1A 1SMTA 4XRSA 2JTVA 2LREA 2J5PA 3I4NJ 5DYMA 4HNUA 4WWCA 5FROA 1U6GA 4MGRA 2DPUA 3MKZA 1HSJA 2P5LC 5GPCA 4YELA 1O57A 1ZGWA 1TP4A 3QP6A 1RIOH 2KRFA 4P5OA 3OYGA 1VQ7I 1RR7A 1X4OA 2CO5A 4M73A 5TISC 4BHBA 5CPRB 3H0DA 3WE3A 1CF7B 3MQ0A 2E7WA 2JA8J 4D9JA 3LSPA 3LSMA 5EJCA 5D5XB 3ABUA 2D45A 3BG7A 1KQ0A 3KETA 3L2RA 4LIVA 3AKZA 4IOCF 2ELHA 2HYFA 3J81K 5B66C 5L3FA 1FMWA 4BL0B 3WU1B 2NYXA 1X58A 1P9QC 4RS8A 3JW4A 4MFEA 3MMYB 3CUQC 1ZELA 1O3TA 4R79A 1Q1VA 2R7DA 2X1CA 2CJJA 3Q0UA 4RB1A 1UJ8A 4KNYA 3OMYA 4HX7A 3BPXA 1WH7A 3MCZA 1AOYA 1FMVA 3UNGC 2DA3A 2DOEA 5HDGA 5A2QZ 3G1OA 2V6CA 2QVOA 3SEZA 3FKJA 1MBKA 2FJ1A 2IGKA 1VQ5I 3GZ6A 3O2PE 1K61A 4B43A 2W4SA 1OYYA 2I10A 3ZMUA 2EV5A 1YS7A 1T56A 3REOA 1J09A 2XDVA 1GXQA 3KEYA 4L9NA 3K7AJ 4UVCA 4C9YA 3HOXJ 1P6RA 4PGHA 2X1EA 5HLGA 3TEDA 1MJ9A 3PFYA 4M3DA 5FLMJ 1I39A 5CLSA 5EZGA 2DI3A 2LLKA 2LNBA 3E6DA 3KLOA 2E35A 1YOVB 3ZXSA 3EETA 1LFBA 4E7SA 2B63J 3JTGA 2R7TA 1RRJA 5DUIA 2QA4I 4FQGA 1K7AA 3U1DA 4XKWA 2O03A 2XRLA 2M7AA 2PG4A 2VKEA 3FXRA 2HTJA 4RAFA 1MW7A 2KIQA 2VLAA 3BQZA 4IRGA 1KGSA 4MLOA 2CQXA 5LBQA 3MAJA 5L3BA 3G2BA 4G8XA 3ZMVA 5HODA 3BTIA 3E6BA 3M07A 3J7AO 4XLHA 3JSPA 1RKTA 3DP7A 1TLHB 2DOFA 5DS9A 3HOUJ 3ECHA 3I56I 1RETA 4EJWA 2MG4A 3K1PA 2X6YA 2R93J 3EUKL 1D5YA 2ZKZA 3RYRA 2WB1A 4LB5A 3WHCA 3CMEI 1R00A 1GV2A 4I02A 1ETYA 1MMDA 2O8XA 1D1AA 3IH2A 3LSTA 5J1YA 4HF2A 4PFPA 2WV1A 2BY1A 4NQWB 4XLPF 1R49A 2VJIA 3KYLA 2QQ8A 3EPZA 2MA3A 1FBSA 2Z16A 1H8AC 1N25A 4M72A 2N8GA 1S8NA 3L2UA 3BG9A 1A5JA 4IQJA 3CJTB 5FKKA 2OJED 4L9VA 1LDKB 3M1CA 2DT5A 2V1XA 1S72I 1F1ZA 1YW9A 3TO6A 3LSGA 3BTLA 2LKPA 1IO2A 1RNLA 1IZ1A 3VYUB 3L2CA 1U5TC 3OY9A 1KZHA 3S1RJ 5LGTA 5K7ZA 3ZR8X 2XROA 3IL2A 2XV4S 5CQGA 1A04A 3BJOA 4XICA 3CLQA 2OCCH 4ZZDA 3MZ8A 3SXYA 4RLFA 4CXFA 4O3MA 2IGNA 4ENKA 1YYVA 2M34A 2V79A 3F8NA 3ZPLA 1DDNA 5DTDA 2CWEA 3AAFA 4I6ZA 3O6BB 4PSWA 4MNUA 2BE5F 1GVDA 2DYRH 2ID6A 2FQ4A 2KHMA 2ZJRF 2MD5A 3GXOA 4I09A 4YFXF 3D1NI 4B8XA 4BXUA 4Q4ZF 3RKYA 5D8KB 3FXJA 5DV5A 1YJ9I 2YPRA 4AIHA 2RC4A 2F4OB 4F91B 4S04A 1O3RA 3HM5A 4BJ6C 2DA7A 2GWRA 3DCFA 1X3UA 1N77A 2R0QC 3OSGA 3TDZC 3BR3A 4CYDA 1IN4A 3ASNH 4M74A 4ZTFA 2J5OA 5D5VB 5C4JJ 1PUEE 3GTOJ 4ESJA 3J80K 2L9SA 2VIXA 2ESNA 2P7VB 3BTJA 4HA8A 1JUSA 3DKXA 2JK3A 2P6TA 2PMUA 2V9PA 2JN6A 1XMXA 3CUQA 1VQLI 2X1DA 2QKLB 5JVGF 3TO7A 3L9FA 3GW2A 3OOUA 1YJWI 3OYHA 1NK2P 2QUFA 2CMPA 1YIOA 5J40A 2K9SA 4UVBA 4DBQA 4HW0A 2BBYA 4M6YA 1QZYA 1IXRC 1I3QJ 2YS9A 1QHGA 4DBRA 2OD5A 1J5YA 4L5EA 3FMQA 1B4AA 4V2FA 2DMUA 3SZPA 2LRDA 3DEUA 2F5FA 1LVKA 3I4PA 4UXNA 2H6BA 1QU3A 2DMQA 1SD7A 4FASD 2P0WA 4U88A 3WTUC 3FIWA 3WG7H 4XRSG 5D6EA 4Y7NJ 1ZYRF 1RR8C 1TWFJ 1D0ZA 2EINH 3BG3A 2DT7B 3KCCA 2WC2A 4M3GA 1SFKA 2NAZA 1ULYA 3AG4H 2STWA 3QOPA 2XF6A 3I5UA 3JCUC 1Z7UA 1H88C 1TTYA 2M7BA 3M8EA 3BR1A 4FCYA 1X1CA 3KIOA 1BI3A 4E6KG 2QKMB 2VJ5A 3CP8A 2ZXHA 3KEOA 1G4DA 4A5MA 3S32A 3BJAA 1Y39A 3CCSI 5E79C 1IG7A 2P5KA 3QYBA 5F1RA 2HQAA 5DM7F 1S7OA 2DTZA 4ENMA 2M30A 1MNEA 3W6KB 3RQ4A 2KT0A 4F3QA 2DQRA 4U7DA 3HIFA 3N4MA 2CV0A 1HKSA 4UNOA 3OS2A 1APLC 1P7IA 1TNTA 4I0AA 5FKLA 2VQGA 1SFEA 5TRDA 2MFZA 2TCTA 1G3WA 4D1QA 3DQVC 3KYDB 3OYCA 5ICEA 4L0ZB 2E34A 3S14J 4E7KA 2FOWA 3VYRB 1JTXA 2VOOA 2R5YB 2XGEA 3KX2A 2KMUA 4EJUA 4YFNF 4JP0A 1B9MA 3FK6A 3RPUD 4A3CJ 3ABMH 3FWEA 5E8GA 1WWXA 1HQCA 1D8JA 3BPVA 1Z21A 2PJRA 4ESFA 4A3DJ 2DJIA 3FBNB 3PFIA 3UR3C 2O0YA 3WE2A 3BR2A 1YHQI 3EUHA 1S6LA 2Z2SB 4D7NA 2HR3A 1BL0A 3FBIB 1HXDA 4IRHA 4E4HA 1UAAA 3CCQI 2VPRA 1HSTA 2H8WA 4Y3OA 1TBXA 3JRFA 4M71A 5BMZA 5CJ9A 4BQQA 3L7WA 5D5WB 3WTVC 1YTYA 4KA4A 2FRHA 5J1UA 3A0BC 1VZ0A 1MD0A 3V7CA 2Y0SA 2CYYA 5C44J 2DT6A 1REPC 5GTHC 3L09A 5B1BH 2NRAC 3ZOBA 2R7VA 4NNJA 1FOXA 4MTDA 4DOZA 3NWTA 3DV8A 3F23A 2STTA 5IT9Z 4PJMA 4XORA 3ABTA 3GBGA 3W2AA 2FU4A 2MH2A 5E17F 4RB2C 1OCPA 4OIOF 4LK1F 4IKFA 2DODA 3SHFA 2MC3A 2COBA 4BJ5C 4NC8A 1Y1WJ 1R1VA 1ZK8A 3WTYC 3HSFA 2WTEA 4M6VA 5E3MA 2CQNA 2OF7A 2FUG2 2OQGA 5CYVA 4ABZA 5F08A 1MJBA 2XGCA 1V55H 3FHZA 4FHTA 2LVSA 2CQ7A 1LEBA 1RESA 2JA6J 2VQLA 3EYIA 2COMA 2A61A 1OYIA 1BBYA 1HLVA 3FXMA 2HKOA 3TOAA 3GLXA 1F43A 2JPBA 2R7FA 1QZEA 1T0FC 2RDPA 4PSXA 2E7XA 4RB0A 2Y9YA 5C3EJ 1W36C 3HOZJ 2NOJB 3J81Z 2XHKA 2IAIA 4BYYA 1ITYA 3SFIA 2BEOA 2DMTA 5ILSA 2DA2A 2BGCA 3D5RC 1TT0A 4Q47A 3SFZA 4IZZA 1YX5A 1NTCA 4LD5A 4A5NA 1J0RA 3DBHB 2M9HA 3LA7A 1WCMJ 4Q5SF 1K4SA 3JRGA 3P5JA 1E17A 4GDFA 4DYQA 4U7BA 3ZRGA 4C3IJ 3A4CA 2JSCA 1LPQA 3NEUA 3FXUA 2EIKH 2MYSA 3VWBA 1LDDA 2R4GA 1DGRM 3SDBA 4P96A 2VC0A 2X0LA 2HQRA 4B3XA 3RYPA 4HLYA 5F0FA 5JFRA 4OWRB 4QLCU 1K83J 3KP4A 3GUDA 2ZJQF 1MMNA 1R7JA 3GLLA 1EF4A 1PJRA 3MN2A 2QGUA 2OC6A 4RAYA 5EEAA 5F27A 3RCOA 2LY2A 2X6XA 2VONA 3BROA 2YU3A 3OYBA 2KDOA 3R4KA 5CQEA 5J8CA 3CC7I 1Z05A 1AKHB 1IC8A 3Q5FA 2YU9J 4R8HA 3A0HC 1JT6A 2KLOA 2CUEA 2XGXA 3ZQLA 2GOXB 2K02A 2XB5A 2NNYA 3BG5A 4AD9A 1K6OA 3DU6A 1QNTA 3ELKA 1K78B 1TT5B 3IC7A 1V5EA 5J1RA 2VXZA 3ZP5A 3T5XA 3U2RA 1FZPB 2M87A 2M8GX 3ZQFA 5LD2C 3ML6A 1W36D 1G2HA 3Q0WA 4A3KJ 3K4MA 1OR7A 4LOCA 5D6FA 3GF2A 5DEQA 1R36A 1QBJA 3KEQA 1WRJA 1WI3A 3UKGA 3OYAA 1W1WE 2ZJ2A 2DBBA 3G1LA 1AWCA 5IYCJ 2ZNZA 2KFDA 1FSEA 4KT6A 3T8TA 4CUGA 2FMYA 3P9KA 3ULQB 1TQIA 4E7ZA 2FEZA 2Q1ZB 3RZDJ 1LB2A 1FBQA 3JR9A 2EFNA 1LUJB 4IEJA 4BHCA 4II3A 3OS1A 4XR6A 1WSUA 3O8HA 1DU6A 3PUBA 4RGXA 3WTZA 4XQFA 1T39A 5M3FJ 4FE7A 4E7HA 1ZN2A 1Y6IA 2KKOA 1K6YA 3AG1H 2DK5A 2JVGA 4MO7A 1F5TA 3QWLA 1XPXA 3FXKA 1BIBA 3CTAA 1HW5A 5K5RA 2E2IJ 4DZJA 2OV7A 2BY3A 1MBHA 3QRFF 4KFCA 3CO6C 1L3LA 2CUFA 2HPIA 4FTHA 4IHWA 1TZLA 3COAC 4U0VA 1H9TA 3DPTA 2Q8KA 5M5WJ 1JJ6C 1GUUA 1K4TA 2G0EA 2PN6A 4EV0A 5M5YJ 1LNWA 4BBRJ 2MLGA 5JR3A 4PZJA 2IS1A 4JYKA 2VASA 4C2MJ 2FBHA 1X2MA 1HKQA 2CQQA 1J2XA 3H0GJ 2L9VA 1MDMA 3HOVJ 2ZBKA 2OTJI 2L7FP 4N4OB 3VSKA 4MTEA 2WAQN 2L5QA 1GV5A 3H9GA 2HDCA 4HOBA 3E6CC 1R5HA 2HS5A 2ME6A 4IX7A 1FOYA 4A0YA 1R71A 4TV7A 1F9NA 4A0ZA 1P4XA 3WTTC 4PFOA 3S93A 2HGCA 3E5XA 4PJ0C 3VSLA 2WY7Q 3ZQCA 4AIKA 2GIVA 1FLIA 5HDKA 2DPDA 2X6OA 9ANTA 1X2NA 1WI9A 3JRHA 4KMUX 1KA8A 3AL0B 2CH0A 4P9FA 3QYFA 2ZMEA 3WG9A 3H9QA 2ZXWH 1GT0C 2VPLA 1D3YA 1SD4A 1ZG5A 4BJTA 1G6NA 3VDXA 5ICGA 4GXOA 4UY8I 2L3DA 2ZC2A 1SMYF 2QLZA 4ESBA 1P4AA 2GAUA 3FX3A 3TP0A 4BUPA 1BJAA 2NVQJ 1WVRA 3FZVA 4RAGA 1RUNA 4XN0A 2V1DA 5IPAA 3ERMA 4JX5A 3LAPA 3BCBA 1R1UA 2D1HA 2IEKA 4MHGA 2M3AA 4UB8C 3HSEA 2PJRB 2L7ZA 4CZCA 4UHTA 1EJ9A 1ZTRA 4LB6B 2I8DA 3SQNA 3GTGJ 2ZCWA 3SDGA 2UZKA 1O3SA 1E3HA 2RNGA 2E1MC 1T6SA 4GCVA 1Z77A 1T08B 2HI3A 1UFMA 2F5EA 3ZQIA 3IUOA 5A2QK 1BA5A 5H20A 3KP2A 1LFPA 3TGNA 4I99C 1VQ8I 4I0BA 5JI6A 3HRUA 2JUCA 3F72A 3HYIA 5F6FA 3ZN1A 1HOMA 1TL8A 5L3GA 1B8IA 3ZGKA 4LGWA 1JI8A 1UMQA 1S29A 4EM0B 1IN6A 3CC4I 1XGMA 3HRTA 4CCLA 5DD8A 4M9XA 2ZFUA 4HG2A 4UVAA 5ERIA 2FNAA 4HDVA 4ZDPA 5J47A 4P9UA 4I76A 2BV6A 2HU9A 3F0CA 2WAEA 3I4MJ 2ZXIA 1KQ9A 4AVPA 5F1JA 2V1UA 1R4NB 1JHFA 2OUMA 3ZMZA 4F7ZA 2O5RA 1MBFA 3D0SA 4M3EA 4L5JA 1BR1A 2DK8A 5BNGA 5TGTA 1JXSA 3HOTA 2LYCA 4IHTA 2YX7A 3LFKA 4UV9A 1H0MA 3CJRB 2LFBA 3CCJI 4CYCA 1Z7LA 4IQ4A 1LVAA 1BM9A 3PL8A 1R1TA 2XF7A 5F0HA 4Y15A 1VQ4I 4Y33A 2DA5A 2LY1A 3U1KA 1U3EM 1GVJA 1W5CC 1Z91A 3K4NA 4AYBN 2H6CA 3BZ6A 2EQRA 4I7HA 4AUXA 4E7IA 2X4HA 1AA7A 3GVAA 5F0CA 3L2QA 4PGGA 2L4MA 5CVJA 5DCMB 4RGRA 2K4JA 4IPAA 1HDDC 4BU2A 5AIQA 3M7GA 2L2OA 1ZH5A 1IRZA 3VEPA 4EMSA 3MEXA 2K85A 3LMMA 5IOZA 4NDLA 1FT9A 4BS9A 2A07F 4ZTJA 2D5VA 4BBSJ 4NC7A 4BE0A 3I54A 4XL9A 4KUMA 4BQOA 4QPOA 2EZIA 1X3ZB 1SFXA 3E5UA 3HHGA 1O4XA 1TWHJ 3BLYA 4CYCB 2GXGA 2X48A 3CCLI 1NG6A 2E1OA 3LQQA 2VODA 3HRSA 1JE8A 4YIIA 5TJJA 2EJRA 4XK4A 2BYVE 5E1XA 2LH9A 2YUSA 1YRNB 4L9TA 3DBRB 2HWVA 2EZHA 2LSOA 1I5ZA 3DLLF 1Y0NA 3OYEA 3F6VA 3MZYA 3LFUA 5J8FA 1WJEA 1T33A 1VQKI 2BOLA 3F8BA 4I98B 1MSFC 1IRXA 2K3PA 4PK4A 1ZLKA 3S8PA 1EH8A 1IXSB 3LNQA 3K2AA 2B0LA 4E7LA 1XDSA 1NK3P 4WX9A 3SZTA 2LY9A 2EIJH 5FLXK 2F5CA 1ETOA 2KQRA 3TO9A 1JTYA 3Q9SA 1HF0A 1HC8A 5FLXZ 1FIPA 3K1NA 1K78A 1BC7C 5H6QA 1USSA 2K9MA 3AG3H 4IXAA 3H92A 3VOEA 2QZ8A 3OYMA 4I01A 1VQMI 3A1YA 4CCKA 2IXSA 1YW8A 4O5VA 4KJZA 5M5XJ 4NQWA 1OCRH 2CV2A 4OMZA 4YRVA 2EBIA 3BC8A 3PNTA 4MQVA 3G4SI 4CA0A 4Q48A 1T38A 2EK5A 5EEHA 4HAMA 4NC6A 1TWGJ 2JT1A 1D8KA 3QOEA 1ZR4A 1XSVA 2JJ7A 1Y0UA 1W5SA 2Y75A 2OU2A 2QEXI 3MKLA 2X85A 4OIQF 2VL8A 1EKEA 4IHXA 3HUGB 3S2HJ 5LGUA 2WBMA 3WTSC 1O3QA 1UG2A 1MH4A 2EZLA 2GBYA 3CUOA 4UB6C 1RUOA 3BZKA 2UWMA 1P92A 3H3ZA 1FYLA 4V19K 4A6DA 1MNMC 5E1ZB 1U9NA 3H35A 4YIRX 1MBEA 1KU3A 1Z3YA 2EZKA 2FF4A 4HX8A 4RM3A 4IHYA 2BY2A 5JLWA 3IHUA 2AHQA 2Y0MA 2EB7A 1ZLJA 2ISZA 2W48A 1NHAA 5J6XA 3EQLF 1B9NA 4LITA 4A3FJ 3W2VA 2XAJA 3B73A 3NWSA 1SEUA 4AIJA 1MBJA 4EGYA 1JT0A 3DTEA 4KYWA 2O61A 1KONA 1OISA 2KRCA 2W82A 2YSRA 2EV6A 3L2VA 4ZYHA 5FKNA 1Y8RB 3S3MA 3GTMJ 2P7CB 2L7KA 2RGVA 1SD6A 5C4XJ 2HOEA 4G94A 1OR7C 2NNNA 2E2HJ 3V7SA 3R61A 1ETKA 3PO3J 2E36A 3BCAA 4MFDA 3RPQA 1S9HA 1Z3XA 3LSJA 5FRMA 5IYBJ 1QA6A 2E5ZA 3OOPA 1O7LA 4WXCA 2DOAA 4XM3A 2Y9ZA 4ETSA 5E18F 5KAIC 4ZDLA 4RGUA 3IV5A 2EFQA 4Y4RA 5GAEJ 3RQIA 2Y30A 2ETHA 5LEKA 1LQ1A 2JMWA 1ON1A 2FE3A 3L00A 1KU7A 3K1MA 2MBFA 2QENA 4CHUA 2RVCA 5HLTA 3RDIA 2WADA 1WJFA 1WJDA 3D5SC 1X4PA 4HBLA 2R5ZA 2ICWG 2UXXA 2AO9A 2MSYA 3CUQB 1JGGA 3F8FA 4HNVA 2KP6A 3FXQA 5BQTA 3OYIA 2K9NA 3QP5A 3H1CA 3ROUA 2HYJA 3NAUA 1J9IA 1JKQC 1W5TA 2H09A 4NBQA 4RB3C 1TC3C 2M45A 4G7OF 4ZC3A 2W00A 4EATA 3ZQHA 1I1SA 1P7JA 3GFIA 2HZDA 3HPGA 1OPCA 2F6CA 2KJBA 2E1CA 3S16J 4WK8F 1ZR2A 2QWWA 3CDLA 4CSWA 2A5WA 3ECOA 3CF2A 1JUMA 1VF9A 3FHNA 3Q9VA 3H5RA 4DIQA 1SFUA 2VT2A 1TQMA 3FM3A 3TQNA 1STZA 1XB4A 4KT5C 1WHUA 1FBUA 4CICA 2EFWA 3HGGA 2KZVA 4DYCA 1IV6A 2H94A 4ZYDA 1WKMA 3DLAA 2UXNA 3F9KA 2Y0SN 3VPRA 5IP7J 1B8IB 4HV5A 3HOWJ 3SEQA 2FMLA 1IRFA 2VJ4A 1MGTA 5HLHA 1U2WA 3I0TA 2UV1A 4IJAA 5ILVA 2K3FA 3S2DJ 1KU2A 3MVPA 3BJ6A 4M9ZA 3JREA 1IUYA 4XRFA 1I1GA 4EQQA 1FY7A 2JA2A 2HFHA 5D4RA 3S3OA 2KL4A 3DFGA 2H1LA 3DXJF 1U78A 4EJTA 3CJQB 4MEXF 1LJ9A 2R92J 5DCMA 2W1OA 4BKXA 3C3WA 2XC7A 2JA7J 5HNFA 3SYTA 4C3HJ 3G6EI 2M5WA 4ZYGA 3FXOA 3ZMSA 3HEFA 2FOKA 3IWZA 2Y69H 1W7PA 3S1NJ 4AM3A 2BXYA 2DDAA 4BY1J 4YFKF 1IXCA 2W84A 2ECBA 3K4BA 1R9TJ 2ZSIB 3HJEA 2L02A 2GA2A 4RAZA 5HDNA 2LF7A 1R5ID 1ETXA 2E19A 4IF4A 1VI0A 3HDDA 1KYWA 2R5YA 4ENNA 1JKRC 1BW6A 4E70A 4NHJA 1VNDA 4J00A 3GTQJ 3OWTA 3OIOA 3HOYJ 3PIPF 4H4KC 1YITI 1D0YA 1SVLA 4OMYA 5BS6A 3FISA 3W3CA 2MW8A 1USTA 1DPRA 4XKCA 2IRFG 3TMOA 1Y56A 2EH3A 3LSRA 3W6VA 2XASA 3GO5A 1TWAJ 3EUAA 4MIMA 2GXAA 3AFHA 4A3BJ 2CUJA 1SVOA 3JRBA 2F5DA 3CCUI 2XB0X 5GADJ 1TW3A 4O6JA 4L9JA 2PQ8A 2IA1A 5FKOA 1B1BA 3T0YA 1PP8F 2R7UA 3V4GA 5B1AH 2PX9A 4ZYEA 3CCMI 3FDYA 2IJLA 2Z1DA 5EGOA 3C1DA 3VFZA 3DU5A 4XOTA 3IH4A 3WHBA 2LMDA 2VE8A 3FKIJ 4XLFA 5JLXA 5L3CA 3KPHA 3WGGA 3TBIA 5D5UB 3EDPA 3HRMA 5EYRA 4U87A 1YE9A 2DCEA 2RKHA 2MD0A 4K2EA 1Z0XA 3TOBA 3OYNA 1FEXA 4FETA 2LP0A 1V3FA 2HEOA 2XF5A 1M1EB 1XCBA 2DFHA 2V9VA 1SC7A 2PLYA 2CW8A 4RGSA 2DFIA 4B1RA 3FMRA 2VUMJ 1RZ4A 2A3SA 4BEHA 4KIFA 3VYSB
chains in the Genus database with same CATH topology
2NVXJ 3JRCA 3QPLA 5HODA 3BTIA 1MBGA 3ZQCA 1W0UA 1WPKA 2ELKA 2X6OA 2RAEA 1RKTA 9ANTA 3HOUJ 1X2NA 5DS9A 3A01B 2XPVA 1RETA 3JRHA 2MG4A 2HOTA 2R93J 1D5YA 3B6AA 4EEFG 1GT0C 2Y2ZA 4QSHA 1LE8B 3TW6A 3IH3A 2ID3A 3WHCA 3TP0A 1XS9A 4GFBA 2NVQJ 1GV2A 1ETYA 2XGDA 2HXIA 5IPAA 3IH2A 2VI6A 5J1YA 4JX5A 2DMNA 2WV1A 5EGOB 2IEKA 3BR6A 2L7ZA 1ZTRA 1H8AC 4D7MA 2N8GA 3FK7A 3HGYA 3BG9A 4FISA 3GTGJ 1A5JA 5FKKA 4W1UA 3SDGA 1MH3A 1Z77A 3LSGA 3BTLA 2HI3A 3ZQIA 2HOAA 2TRTA 5GP9A 1BA5A 3S17J 2NVTJ 3S1RJ 5K7ZA 2O7OA 2O9LA 2QF7A 2OPTA 1VFCA 4XICA 1QVUA 1HOMA 1B8IA 2M34A 4A3EJ 5DTDA 3BQYA 5E3OA 1JUPA 1UMQA 4I6ZA 1UHSA 1GVDA 2ID6A 2FQ4A 3M4OJ 1ETQA 5EG0A 3D1NI 4A3IJ 3NARA 4I76A 5E3NA 4AC0A 3F0CA 3QQAA 3I4MJ 1OFCX 3S1QJ 1H89C 1AKHA 2O8KA 5F1JA 3TW7A 3HM5A 1QVTA 1IGNA 1MBFA 4M3EA 2DA7A 4UUSB 2NOGA 2LTPA 5BNGA 5IP9J 3DCFA 3RKQA 2X9DA 4JX4A 4M3BA 1W0TA 2R0QC 3OSGA 3BR3A 4DZPA 1ETWA 1JKPC 1TWCJ 5C4JJ 3GTOJ 5EF6A 2ECCA 2LFBA 4CYCA 2L0KA 3BTJA 2LKXA 1JUSA 2JK3A 2JA5J 5EZHA 1RPWA 2JN6A 2E2JJ 5F0HA 3GTLJ 2L9RA 1FTZA 2DA5A 3OOUA 3L1PA 1NK2P 2LD5A 3BTCA 4AYBN 2M2EA 4AUXA 2EQRA 2K9SA 4BY7J 3RZOJ 4RDUA 2R5ZB 1I3QJ 2YS9A 5F0CA 5FLVA 4DW6A 4RBOA 5IOYA 4L5EA 4V2FA 1HDDC 1IUFA 2DMUA 1IRZA 5IOZA 4NDLA 4A3GJ 2DMQA 4X1EA 4D5CA 3FIWA 2D5VA 2L7MP 4XRSG 4BBSJ 4Y7NJ 3BR5A 2ZB9A 1TWFJ 2EZIA 3BG3A 4M3GA 3Q0VA 2MGQA 1O4XA 1TWHJ 3OSFA 4CYCB 1H88C 2X48A 5J3LA 1I6HJ 2E1OA 3BR1A 4FCYA 1ENHA 3E7LA 4XK4A 3QPSA 4XRMA 2YUSA 3M3YJ 1S7EA 1YRNB 2EZHA 1CQTA 2H8RA 2HXOA 3DEWA 1T33A 1IG7A 1MSFC 1PUFB 5FKMA 3A02A 2DTZA 3GTPJ 1JKOC 2KT0A 2WB1N 2NVYJ 3LNQA 3K2AA 1JJ8C 1LFUP 4X6AJ 1NK3P 1APLC 1P7IA 2LY9A 1ETOA 5FKLA 4Y52J 1JTYA 1HF0A 1FIPA 2TCTA 3GTKJ 1FIAA 3S14J 1JTXA 2R5YB 2XGEA 2NS7A 4A3LJ 3ZQGA 3A01A 2JWTA 1BW5A 5IP6A 4JP0A 3PO2J 3FK6A 4A3CJ 5M5XJ 5K7FA 2EBIA 3CQZJ 4B4CA 5EG0B 4A3DJ 5IYDJ 5FJ8J 1QRYA 2M0CA 4M3FA 3BR2A 1MSEC 1XG1A 1ETVA 1TWGJ 4D7NA 1ZR4A 1BL0A 2JJ7A 4A93J 1YRNA 2VPRA 3MKLA 1E3OC 2R7ZJ 4IHXA 3S2HJ 5GPAA 3JRFA 3CCYA 1UG2A 1MH4A 2EZLA 2GBYA 4FE4A 1AHDP 5J1UA 4D5FA 4J19A 3H3VK 5C44J 1MNMC 1U9NA 3BT9A 3ZOBA 1MBEA 1F36A 2EZKA 2FD5A 4IHYA 5JLWA 2AHQA 3GBGA 4XIDA 2W48A 1OCPA 2IBDA 4A3FJ 1QPIA 1POGA 1MBJA 1RKWA 1JT0A 2VKVA 2COBA 1Y1WJ 1ZK8A 3HKZN 4M6VA 5E3MA 3GTJJ 2OF7A 3B6CA 3PM1A 4ABZA 2XPWA 5F08A 2XGCA 5FKNA 2LVSA 1ZQ3P 3GTMJ 3CMYA 1RESA 5M3MJ 2JA6J 4B3AA 5C4XJ 1A6IA 1HLVA 2E2HJ 3PO3J 1ETKA 1F43A 4MFDA 4W97A 3LSJA 5IYBJ 4BXXJ 4G12A 2Y9YA 5C3EJ 3HOZJ 1XC5A 2IAIA 2Y9ZA 1DU0A 1ITYA 3SFIA 2DMTA 2QCOA 2DA2A 3IV5A 3RQIA 2Y30A 2JMWA 1NTCA 2K9QA 2M9HA 1WCMJ 2HOSA 2XSDC 3JRGA 3S15J 4DYQA 2K40A 4DYRA 3A03A 4C3IJ 2R5ZA 1IDYA 2AO9A 1Y1VJ 2MSYA 1JGGA 3HBLA 4HNVA 1FTTA 2K9NA 2HYJA 3NAUA 2LR8A 1JKQC 3LOCA 2NS8A 4IHVA 4UUTA 1IDZA 5F0FA 1TC3C 4A3MJ 1I50J 2DA6A 1K83J 2XPUA 3ZQHA 1EF4A 1P7JA 3MN2A 3JRDA 5E3LA 2DMPA 2HDDA 1B72B 5EEAA 3S16J 5F27A 1ZR2A 1ORKA 1ZKGA 3CDLA 1SFOJ 2Y31A 4A69C 1JUMA 1VF9A 3JRAA 2GM4A 4A3JJ 1AKHB 2H1KA 1IC8A 2YU9J 3HGGA 4DYCA 1IV6A 2PMZN 1JT6A 3O8GA 2CUEA 1HCRA 3ZQLA 3TP3A 2ME0A 1BJZA 1LE8A 2XB5A 3BG5A 5K7HA 4XRSA 2Y0SN 3VPRA 5IP7J 1B8IB 3HOWJ 1AU7A 3I4NJ 4QTRA 5J1RA 3S2DJ 3MVPA 2M8GX 3ZQFA 5GPCA 3JREA 1OCTC 1WGXA 1ZGWA 3HB9A 1G2HA 3Q0WA 4A3KJ 1SANA 4LOCA 1RR7A 1U78A 1WI3A 3BR0A 2R92J 4BKXA 3UKGA 2JA7J 2JA8J 4UUSA 4C3HJ 1U8BA 3LSPA 3G1LA 4JX6A 3G1MA 1FJLA 3HEFA 5IYCJ 2HQ5A 3S1NJ 4BY1J 1R9TJ 2ECBA 1B72A 5EDNA 2GLOA 3JRIA 1X58A 4MFEA 3RZDJ 1Q1VA 1ETXA 2CJJA 2E19A 3Q0UA 1VI0A 3JR9A 3HDDA 2R5YA 1JKRC 4IEJA 1BW6A 1WH7A 3GTQJ 1VNDA 4C3JJ 3OIOA 3HOYJ 3O8HA 2DA1A 1DU6A 2LK2A 2DA3A 5M3FJ 3G1OA 4FE7A 1GDTA 2DJNA 1IJWC 1MBKA 3FISA 2CU7A 2FJ1A 3S1MJ 2MW8A 4MO7A 2P81A 2DN0A 2KDZA 1K61A 3SJMA 3Q3SA 2E2IJ 2I10A 4DZJA 2EH3A 3LSRA 3W6VA 1MBHA 1TWAJ 4MIMA 1T56A 4A3BJ 1PUFA 2CUFA 3K7AJ 4FTHA 3HOXJ 4IHWA 3JRBA 2XB0X 5M5WJ 3TEDA 4QIWN 1JJ6C 5FKOA 2CRGA 4M3DA 1GUUA 5FLMJ 2G0EA 5EGOA 5EZGA 5M5YJ 2LLKA 3C2BA 4BBRJ 4JYKA 3IH4A 3WHBA 3FKIJ 5JLXA 4C2MJ 1X2MA 2FX0A 2CQQA 1OJLA 1LFBA 2B63J 3H0GJ 3HOVJ 5EYRA 2L7FP 1Z0XA 1FEXA 2LP0A 2XRLA 2WAQN 2VKEA 1GV5A 4V2GA 1HDPA 1WH5A 2ME6A 4B1RA 2VUMJ 5F04A 3BQZA 1U9OA 4MLOA 2CQXA 4S0HB 2DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX J;  3JRC A;  3QPL A;  5HOD A;  3BTI A;  1MBG A;  3ZQC A;  1W0U A;  1WPK A;  2ELK A;  2X6O A;  2RAE A;  1RKT A;  9ANT A;  3HOU J;  1X2N A;  5DS9 A;  3A01 B;  2XPV A;  1RET A;  3JRH A;  2MG4 A;  2HOT A;  2R93 J;  1D5Y A;  3B6A A;  4EEF G;  1GT0 C;  2Y2Z A;  4QSH A;  1LE8 B;  3TW6 A;  3IH3 A;  2ID3 A;  3WHC A;  3TP0 A;  1XS9 A;  4GFB A;  2NVQ J;  1GV2 A;  1ETY A;  2XGD A;  2HXI A;  5IPA A;  3IH2 A;  2VI6 A;  5J1Y A;  4JX5 A;  2DMN A;  2WV1 A;  5EGO B;  2IEK A;  3BR6 A;  2L7Z A;  1ZTR A;  1H8A C;  4D7M A;  2N8G A;  3FK7 A;  3HGY A;  3BG9 A;  4FIS A;  3GTG J;  1A5J A;  5FKK A;  4W1U A;  3SDG A;  1MH3 A;  1Z77 A;  3LSG A;  3BTL A;  2HI3 A;  3ZQI A;  2HOA A;  2TRT A;  5GP9 A;  1BA5 A;  3S17 J;  2NVT J;  3S1R J;  5K7Z A;  2O7O A;  2O9L A;  2QF7 A;  2OPT A;  1VFC A;  4XIC A;  1QVU A;  1HOM A;  1B8I A;  2M34 A;  4A3E J;  5DTD A;  3BQY A;  5E3O A;  1JUP A;  1UMQ A;  4I6Z A;  1UHS A;  1GVD A;  2ID6 A;  2FQ4 A;  3M4O J;  1ETQ A;  5EG0 A;  3D1N I;  4A3I J;  3NAR A;  4I76 A;  5E3N A;  4AC0 A;  3F0C A;  3QQA A;  3I4M J;  1OFC X;  3S1Q J;  1H89 C;  1AKH A;  2O8K A;  5F1J A;  3TW7 A;  3HM5 A;  1QVT A;  1IGN A;  1MBF A;  4M3E A;  2DA7 A;  4UUS B;  2NOG A;  2LTP A;  5BNG A;  5IP9 J;  3DCF A;  3RKQ A;  2X9D A;  4JX4 A;  4M3B A;  1W0T A;  2R0Q C;  3OSG A;  3BR3 A;  4DZP A;  1ETW A;  1JKP C;  1TWC J;  5C4J J;  3GTO J;  5EF6 A;  2ECC A;  2LFB A;  4CYC A;  2L0K A;  3BTJ A;  2LKX A;  1JUS A;  2JK3 A;  2JA5 J;  5EZH A;  1RPW A;  2JN6 A;  2E2J J;  5F0H A;  3GTL J;  2L9R A;  1FTZ A;  2DA5 A;  3OOU A;  3L1P A;  1NK2 P;  2LD5 A;  3BTC A;  4AYB N;  2M2E A;  4AUX A;  2EQR A;  2K9S A;  4BY7 J;  3RZO J;  4RDU A;  2R5Z B;  1I3Q J;  2YS9 A;  5F0C A;  5FLV A;  4DW6 A;  4RBO A;  5IOY A;  4L5E A;  4V2F A;  1HDD C;  1IUF A;  2DMU A;  1IRZ A;  5IOZ A;  4NDL A;  4A3G J;  2DMQ A;  4X1E A;  4D5C A;  3FIW A;  2D5V A;  2L7M P;  4XRS G;  4BBS J;  4Y7N J;  3BR5 A;  2ZB9 A;  1TWF J;  2EZI A;  3BG3 A;  4M3G A;  3Q0V A;  2MGQ A;  1O4X A;  1TWH J;  3OSF A;  4CYC B;  1H88 C;  2X48 A;  5J3L A;  1I6H J;  2E1O A;  3BR1 A;  4FCY A;  1ENH A;  3E7L A;  4XK4 A;  3QPS A;  4XRM A;  2YUS A;  3M3Y J;  1S7E A;  1YRN B;  2EZH A;  1CQT A;  2H8R A;  2HXO A;  3DEW A;  1T33 A;  1IG7 A;  1MSF C;  1PUF B;  5FKM A;  3A02 A;  2DTZ A;  3GTP J;  1JKO C;  2KT0 A;  2WB1 N;  2NVY J;  3LNQ A;  3K2A A;  1JJ8 C;  1LFU P;  4X6A J;  1NK3 P;  1APL C;  1P7I A;  2LY9 A;  1ETO A;  5FKL A;  4Y52 J;  1JTY A;  1HF0 A;  1FIP A;  2TCT A;  3GTK J;  1FIA A;  3S14 J;  1JTX A;  2R5Y B;  2XGE A;  2NS7 A;  4A3L J;  3ZQG A;  3A01 A;  2JWT A;  1BW5 A;  5IP6 A;  4JP0 A;  3PO2 J;  3FK6 A;  4A3C J;  5M5X J;  5K7F A;  2EBI A;  3CQZ J;  4B4C A;  5EG0 B;  4A3D J;  5IYD J;  5FJ8 J;  1QRY A;  2M0C A;  4M3F A;  3BR2 A;  1MSE C;  1XG1 A;  1ETV A;  1TWG J;  4D7N A;  1ZR4 A;  1BL0 A;  2JJ7 A;  4A93 J;  1YRN A;  2VPR A;  3MKL A;  1E3O C;  2R7Z J;  4IHX A;  3S2H J;  5GPA A;  3JRF A;  3CCY A;  1UG2 A;  1MH4 A;  2EZL A;  2GBY A;  4FE4 A;  1AHD P;  5J1U A;  4D5F A;  4J19 A;  3H3V K;  5C44 J;  1MNM C;  1U9N A;  3BT9 A;  3ZOB A;  1MBE A;  1F36 A;  2EZK A;  2FD5 A;  4IHY A;  5JLW A;  2AHQ A;  3GBG A;  4XID A;  2W48 A;  1OCP A;  2IBD A;  4A3F J;  1QPI A;  1POG A;  1MBJ A;  1RKW A;  1JT0 A;  2VKV A;  2COB A;  1Y1W J;  1ZK8 A;  3HKZ N;  4M6V A;  5E3M A;  3GTJ J;  2OF7 A;  3B6C A;  3PM1 A;  4ABZ A;  2XPW A;  5F08 A;  2XGC A;  5FKN A;  2LVS A;  1ZQ3 P;  3GTM J;  3CMY A;  1RES A;  5M3M J;  2JA6 J;  4B3A A;  5C4X J;  1A6I A;  1HLV A;  2E2H J;  3PO3 J;  1ETK A;  1F43 A;  4MFD A;  4W97 A;  3LSJ A;  5IYB J;  4BXX J;  4G12 A;  2Y9Y A;  5C3E J;  3HOZ J;  1XC5 A;  2IAI A;  2Y9Z A;  1DU0 A;  1ITY A;  3SFI A;  2DMT A;  2QCO A;  2DA2 A;  3IV5 A;  3RQI A;  2Y30 A;  2JMW A;  1NTC A;  2K9Q A;  2M9H A;  1WCM J;  2HOS A;  2XSD C;  3JRG A;  3S15 J;  4DYQ A;  2K40 A;  4DYR A;  3A03 A;  4C3I J;  2R5Z A;  1IDY A;  2AO9 A;  1Y1V J;  2MSY A;  1JGG A;  3HBL A;  4HNV A;  1FTT A;  2K9N A;  2HYJ A;  3NAU A;  2LR8 A;  1JKQ C;  3LOC A;  2NS8 A;  4IHV A;  4UUT A;  1IDZ A;  5F0F A;  1TC3 C;  4A3M J;  1I50 J;  2DA6 A;  1K83 J;  2XPU A;  3ZQH A;  1EF4 A;  1P7J A;  3MN2 A;  3JRD A;  5E3L A;  2DMP A;  2HDD A;  1B72 B;  5EEA A;  3S16 J;  5F27 A;  1ZR2 A;  1ORK A;  1ZKG A;  3CDL A;  1SFO J;  2Y31 A;  4A69 C;  1JUM A;  1VF9 A;  3JRA A;  2GM4 A;  4A3J J;  1AKH B;  2H1K A;  1IC8 A;  2YU9 J;  3HGG A;  4DYC A;  1IV6 A;  2PMZ N;  1JT6 A;  3O8G A;  2CUE A;  1HCR A;  3ZQL A;  3TP3 A;  2ME0 A;  1BJZ A;  1LE8 A;  2XB5 A;  3BG5 A;  5K7H A;  4XRS A;  2Y0S N;  3VPR A;  5IP7 J;  1B8I B;  3HOW J;  1AU7 A;  3I4N J;  4QTR A;  5J1R A;  3S2D J;  3MVP A;  2M8G X;  3ZQF A;  5GPC A;  3JRE A;  1OCT C;  1WGX A;  1ZGW A;  3HB9 A;  1G2H A;  3Q0W A;  4A3K J;  1SAN A;  4LOC A;  1RR7 A;  1U78 A;  1WI3 A;  3BR0 A;  2R92 J;  4BKX A;  3UKG A;  2JA7 J;  2JA8 J;  4UUS A;  4C3H J;  1U8B A;  3LSP A;  3G1L A;  4JX6 A;  3G1M A;  1FJL A;  3HEF A;  5IYC J;  2HQ5 A;  3S1N J;  4BY1 J;  1R9T J;  2ECB A;  1B72 A;  5EDN A;  2GLO A;  3JRI A;  1X58 A;  4MFE A;  3RZD J;  1Q1V A;  1ETX A;  2CJJ A;  2E19 A;  3Q0U A;  1VI0 A;  3JR9 A;  3HDD A;  2R5Y A;  1JKR C;  4IEJ A;  1BW6 A;  1WH7 A;  3GTQ J;  1VND A;  4C3J J;  3OIO A;  3HOY J;  3O8H A;  2DA1 A;  1DU6 A;  2LK2 A;  2DA3 A;  5M3F J;  3G1O A;  4FE7 A;  1GDT A;  2DJN A;  1IJW C;  1MBK A;  3FIS A;  2CU7 A;  2FJ1 A;  3S1M J;  2MW8 A;  4MO7 A;  2P81 A;  2DN0 A;  2KDZ A;  1K61 A;  3SJM A;  3Q3S A;  2E2I J;  2I10 A;  4DZJ A;  2EH3 A;  3LSR A;  3W6V A;  1MBH A;  1TWA J;  4MIM A;  1T56 A;  4A3B J;  1PUF A;  2CUF A;  3K7A J;  4FTH A;  3HOX J;  4IHW A;  3JRB A;  2XB0 X;  5M5W J;  3TED A;  4QIW N;  1JJ6 C;  5FKO A;  2CRG A;  4M3D A;  1GUU A;  5FLM J;  2G0E A;  5EGO A;  5EZG A;  5M5Y J;  2LLK A;  3C2B A;  4BBR J;  4JYK A;  3IH4 A;  3WHB A;  3FKI J;  5JLX A;  4C2M J;  1X2M A;  2FX0 A;  2CQQ A;  1OJL A;  1LFB A;  2B63 J;  3H0G J;  3HOV J;  5EYR A;  2L7F P;  1Z0X A;  1FEX A;  2LP0 A;  2XRL A;  2WAQ N;  2VKE A;  1GV5 A;  4V2G A;  1HDP A;  1WH5 A;  2ME6 A;  4B1R A;  2VUM J;  5F04 A;  3BQZ A;  1U9O A;  4MLO A;  2CQX A;  4S0H B;  2DA4 A; 
#chains in the Genus database with same CATH topology
 3JRC A;  4LLL A;  3QPL A;  3GCM A;  3S2W A;  1X1D A;  2M1B A;  2GQQ A;  2UUZ A;  4QPQ A;  1W0U A;  1ONV A;  4N0B A;  2FBK A;  2CFO A;  2RAE A;  4YG2 F;  1J75 A;  1D0X A;  1YO5 C;  3A01 B;  2XPV A;  2K27 A;  1ZAO A;  2VB6 A;  1XSX A;  3X2Q H;  3LSH A;  3B6A A;  2A5Y B;  2ZME C;  4EEF G;  1UCR A;  3HKZ A;  4GGG A;  3L2W A;  3RI4 A;  2JUG A;  4Y17 A;  3HTU A;  1OLT A;  1KU9 A;  4QSH A;  3K9T A;  3TW6 A;  1W7P B;  2IS2 A;  1V5F A;  3ABK H;  2EIM H;  5E8I A;  2R7S A;  2D1V A;  2DU9 A;  2HXI A;  1ODD A;  2VQC A;  2DQL A;  2HQN A;  4IO9 F;  1IV8 A;  1FNN A;  2A6E F;  2VI6 A;  2R7O A;  3WU2 C;  4EJV A;  1ERD A;  2DMN A;  2RV8 A;  4QWQ A;  2B9S A;  5KAF C;  2JRT A;  2JVH A;  4II2 A;  1MZB A;  3ESW B;  3HGY A;  3PJR A;  2BW3 A;  5H6R A;  2R7X A;  1I3A A;  4KIS A;  1MH3 A;  2VJJ A;  3FXL A;  3HSR A;  5GP9 A;  2TRT A;  1QGP A;  4GYG A;  2NVT J;  3N05 A;  5FD5 A;  3WTW C;  3JAM K;  2QF7 A;  2OPT A;  2R3S A;  2ZXJ A;  4U0W A;  1VFC A;  4OU0 A;  2P6S A;  4IHS A;  1QVU A;  4JOM A;  1XMK A;  2LBF B;  2F4I A;  2GOM A;  4EGZ A;  1DGW Y;  1X1A A;  3BQY A;  1JUP A;  3KP5 A;  4AU7 A;  5E3O A;  3DPU A;  1RI7 A;  1U5T A;  1XGS A;  2O3F A;  1G59 A;  3PQK A;  1UZC A;  2F5V A;  2JSP A;  2FSW A;  2P5V A;  5ICC A;  5EG0 A;  3QPT A;  2BXZ A;  3NAR A;  4N9H A;  1WJB A;  2VKD A;  2ZNY A;  4AC0 A;  3I71 A;  2Q2E B;  4LG0 B;  1WZ2 A;  3S1Q J;  1G8X A;  4G6T B;  1H89 C;  5HS8 A;  2IA2 A;  4A2U A;  1AKH A;  4HEA 2;  2O8K A;  4PJL A;  1DP3 A;  3TW7 A;  2IPQ X;  3LA3 A;  2P4W A;  3I3L A;  4UUS B;  4OAY A;  2NOG A;  4UUV A;  2LTP A;  3KP6 A;  4ZH4 F;  1MMS A;  5IP9 J;  4M3B A;  2HDW A;  2V1N A;  4BAY A;  5DD4 A;  5E20 A;  4BEH B;  1ETW A;  1TWC J;  3OL3 A;  4CDG A;  2HVQ A;  1YQA A;  2ECC A;  3IP4 B;  2L0K A;  5LLQ A;  3N97 A;  1UB9 A;  2W85 A;  4FX4 A;  2LKX A;  1YFH A;  4LIU A;  3D5L A;  2V4J C;  1RPW A;  5F64 A;  4BDY A;  1YIJ I;  3C2H A;  3GTL J;  2L9R A;  3ABL H;  3ONQ A;  3L1P A;  4XMY A;  4XKV A;  3DPL C;  2LF8 A;  3V8L A;  2DFE A;  5HNH A;  3KYC B;  2KIM A;  2CGP A;  2O6G E;  4RDU A;  4XKB A;  2R5Z B;  2AS5 F;  3WTX C;  5FLV A;  2BVM A;  3OIQ A;  4DW6 A;  4HDU A;  4EM2 A;  1Z9C A;  5IOY A;  4N4N B;  4HF0 A;  4AVZ A;  1J7K A;  4KN4 X;  1ZGA A;  6PAX A;  2XRN A;  3J7Z I;  4X1E A;  2E1N A;  3MD2 A;  4JQF A;  2AXT C;  1XN7 A;  2L7M P;  2MAB A;  1R58 A;  4BAC A;  3BR5 A;  2ZB9 A;  4HSR A;  2Z3Y A;  1C0W A;  2F2E A;  1W4M A;  3Q0V A;  2MC4 A;  1DQU A;  3GZN B;  4BXF A;  4H0E A;  3OSF A;  1TW2 A;  4ITV A;  1ZRE A;  3F8M A;  3GFL A;  1BIA A;  5CVR A;  2HKX A;  2IA0 A;  2XUB A;  2KIF A;  4XRM A;  1ZRC A;  1WJ5 A;  1S7E A;  1HA8 A;  1CQT A;  3QOD A;  4OAZ A;  2H8R A;  3DEW A;  1IW7 F;  1PUF B;  2K7L A;  2BY0 A;  1U8R A;  3U9G A;  3A02 A;  4FX0 A;  2X51 A;  1VQ6 I;  4HQE A;  3R6S A;  3E1S A;  1JKO C;  3DF8 A;  3HTS B;  3OR1 C;  1WJC A;  2NVY J;  1JJ8 C;  1S7A A;  1LFU P;  3S3N A;  1VQ9 I;  2HVR A;  4X6A J;  1QZZ A;  4MEY F;  2X6W A;  1P2F A;  4L5I A;  5KNL A;  1A35 A;  2MLK A;  2WAQ A;  4CCN A;  1ZRD A;  3MKW B;  3F8C A;  2K9L A;  4DGW B;  1R23 A;  4LJZ F;  1WJA A;  1XMA A;  3K10 A;  4XSX F;  2I5U A;  2CW7 A;  1O7F A;  3WGH A;  1Y8Q B;  3OIP A;  3CF5 F;  2IP2 A;  2BHZ A;  1E2X A;  2ELJ A;  2NS7 A;  2QQA A;  3ZQG A;  5LRS A;  3OS0 A;  4A3L J;  2A05 A;  1T95 A;  3HL2 A;  1BW5 A;  2DTR A;  3BP8 A;  2VOP A;  3BWG A;  2V26 A;  4CCJ A;  5K7F A;  4B44 A;  3I58 A;  3LSK A;  3GYH X;  5EG0 B;  3CQZ J;  5IYD J;  5ICF A;  3RSN A;  3KLN A;  3DTI A;  2XIG A;  3V8K A;  1JGS A;  2R7W A;  4M3F A;  5CVV A;  4OIP F;  1MSE C;  1MND A;  1XG1 A;  4BE1 A;  1BOA A;  4P55 A;  5LFA A;  5ILU A;  3T8R A;  1YRN A;  4A93 J;  1LDJ A;  2XAG A;  1G3S A;  4B48 A;  3ZMT A;  1E3O C;  2B7E A;  2R7Z J;  4XNF A;  3I64 A;  3CCR I;  5DDG A;  3C7J A;  2L01 A;  3H3U A;  2V6E A;  2GZW A;  3JTH A;  1OYW A;  1XDU A;  1AHD P;  3PNY A;  4J19 A;  2OAZ A;  1I27 A;  3H3V K;  1HKT A;  4KDP A;  2RQQ A;  3U21 A;  2DYS H;  1EV7 A;  4KIC A;  1F36 A;  1T2K A;  2FD5 A;  1T98 A;  1VQN I;  5J4Y A;  4PUS A;  3ERE D;  3RJP A;  2RNJ A;  4BE2 A;  4XID A;  1V54 H;  2GA1 A;  1FC3 A;  5IT9 K;  2BZT A;  1QPI A;  1POG A;  2ZJP F;  4GO1 A;  3V42 A;  1FPQ A;  2EWN A;  1RC9 A;  2KRH A;  3BG6 A;  4IRI A;  2VKV A;  1E3P A;  1YLF A;  4BGD A;  3CCV I;  4IVN A;  2EV0 A;  3HKZ N;  5FD6 A;  3SZG A;  1X1B A;  2PMH A;  1BI1 A;  4Z2Y A;  3DEE A;  1FOK A;  1Q1H A;  1R6R A;  2XAF A;  2IW5 A;  5M3M J;  3DTK A;  1A6I A;  4GYI A;  1D5V A;  2QSF X;  3H5A A;  3MKY B;  4W97 A;  2IT0 A;  1MKM A;  4BXX J;  1SD5 A;  5DUK A;  1R5G A;  3LAJ A;  1B59 A;  2W25 A;  4KIB A;  1DU0 A;  4HRI A;  1ZRF A;  2CS3 A;  1W7P D;  2QCO A;  3C2G A;  3K4J A;  3OYJ A;  4NUB A;  3CDH A;  4HV6 A;  3GEZ A;  2K9Q A;  2DXI A;  2HOS A;  3ZMD A;  2A6T A;  3I59 B;  4F93 B;  2RQP A;  3S15 J;  1WFX A;  3LQR A;  2K40 A;  2GXB A;  3CJN A;  2HTS A;  2M8E A;  4EJO A;  4I2O A;  2QQ9 A;  4XON A;  1IN7 A;  4D0P A;  1ON2 A;  4U0Y A;  2CG4 A;  1FTT A;  3LOC A;  2NS8 A;  3LL7 A;  4UUT A;  5JHF A;  3CMA I;  1IDZ A;  2EIL H;  5HOO A;  3PNV A;  1I50 J;  2DA6 A;  1GXP A;  1P4W A;  3K4K A;  2XPU A;  3DWL E;  4PJN A;  3CD6 I;  1B6A A;  4KIG A;  2VN2 A;  3JRD A;  5E3L A;  1IAW A;  2WAF A;  2DMP A;  3E3V A;  3CLO A;  3BDD A;  1QO0 D;  5E1W A;  3KE2 A;  1ORK A;  1ZKG A;  1H9G A;  1SFO J;  3BOQ A;  1ZHF A;  4XLN F;  3JRA A;  4A3J J;  3R0J A;  2H1K A;  2Y48 A;  2PBI A;  4S05 A;  5FFZ A;  1BI0 A;  2PMZ N;  4X0G A;  1MDM B;  2NXN B;  4UV8 A;  3TP3 A;  1BJZ A;  2K5C A;  1LE8 A;  4ON0 A;  1UHM A;  3PSF A;  2PMZ A;  3ZN0 A;  5K7H A;  2EPF A;  1K79 A;  2VBW A;  1NG7 A;  3EYY A;  3IRR A;  1AU7 A;  4IL6 C;  3JSO A;  3M8F A;  4QTR A;  2V7F A;  3K70 D;  5LGN A;  3J7Y J;  3IKT A;  3I53 A;  2A68 F;  3KP3 A;  1OCT C;  1WGX A;  3NQO A;  1OCO H;  2KIS A;  1Z1D A;  3HB9 A;  4CCO A;  1SAN A;  4HX4 A;  2JQ7 A;  1PVE A;  2Q2E A;  4LG0 A;  5K5Q A;  2DFF A;  4XN3 A;  3BR0 A;  1BI2 A;  4UUS A;  1XTA A;  1U8B A;  5CVU A;  2R7Q A;  4JX6 A;  2WV0 A;  1MMG A;  3G1M A;  5HS9 A;  3HZJ A;  1FJL A;  4N9I A;  2HQ5 A;  2DW4 A;  2YR2 A;  2KPM A;  3KZY A;  1DP7 P;  1B72 A;  2GLO A;  5EDN A;  1HW1 A;  3JRI A;  1PP7 U;  3B02 A;  4LFU A;  2OCE A;  4C30 A;  3WOD F;  1F4K A;  1OCC H;  1NH3 A;  4C3J J;  3G3Z A;  3H5N A;  3FMS A;  1UHW A;  4OOI A;  2DA1 A;  2LK2 A;  5CKT A;  1GDT A;  2DJN A;  3C18 A;  4FT8 A;  1IJW C;  3JAM Z;  1QHH D;  2P8T A;  2CU7 A;  3S1M J;  4KN7 X;  2P81 A;  2DN0 A;  3RPU A;  3ZQ7 A;  2KDZ A;  1GHC A;  3SJM A;  3Q3S A;  1X19 A;  1EA3 A;  2FBI A;  2VQH A;  4KIT B;  2IS6 A;  5IT3 A;  1BN5 A;  2W57 A;  1PUF A;  1S3J A;  4CO8 A;  1FP1 D;  4QIW N;  1D1B A;  1CGP A;  1UG0 A;  2CRG A;  2HZT A;  1KQ8 A;  3F6O A;  5AON A;  3C2B A;  2VBZ A;  3M1E A;  4HLX A;  5CVI A;  2IGO A;  4AID A;  4DNC A;  2FX0 A;  4BNC A;  3EUH C;  1OJL A;  3ZCO A;  5LRR A;  3CDI A;  4WXH A;  2LC2 A;  1MMA A;  3CES A;  5KCM A;  3KZI C;  4B47 A;  2LOO A;  4DQ2 A;  3F21 A;  2QBY B;  4V2G A;  1HDP A;  3QPH A;  1WH5 A;  2AQE A;  3IAS 2;  5F04 A;  1U9O A;  3E6M A;  4S0H B;  2DA4 A;  4CH7 A;  2LBF A;  2NVX J;  1X3W B;  5FO5 A;  5BPI A;  1XGO A;  2EFP A;  1MBG A;  2CUZ A;  3W6J B;  3P7N A;  2OA4 A;  1WPK A;  2ELK A;  1XX5 A;  1KYZ A;  2L9N A;  3GZ5 A;  4HYE A;  4LMY A;  3RTR A;  2PI0 A;  3K2Z A;  2IGM A;  3MFK A;  3KZZ A;  2HOT A;  1FSH A;  2ESH A;  4MQ9 F;  2CSO A;  3DKY A;  3H9J A;  1Z6T A;  2ZO4 A;  1BR4 A;  2Y2Z A;  4HPQ A;  4ZDO A;  1SAU A;  2LKS A;  1LE8 B;  2LG4 A;  3ASO H;  3TKY A;  3F22 A;  3IH3 A;  2FNP A;  2ID3 A;  1XS9 A;  3W2W A;  2XKP A;  2Q0O A;  4GFB A;  2XGD A;  5DM6 F;  1PYV A;  2VE9 A;  1FP2 A;  2PFB A;  4RM2 A;  3BR6 A;  5EGO B;  1IN8 A;  1BC8 C;  3LA2 A;  5L3D A;  1FYM A;  1XD7 A;  1U5T B;  2DO7 A;  4D7M A;  5LHI A;  2WA0 A;  3FK7 A;  1T0F A;  2CQK A;  4YEJ A;  4FIS A;  1SAX A;  4RA2 A;  4W1U A;  1FOW A;  5DCF A;  3P9C A;  1ACI A;  2QM3 A;  2OZU A;  2HVS A;  3TDU C;  3E97 A;  4IOA F;  2HOA A;  2XVC A;  3HXL A;  1MIJ A;  2E71 A;  3ISP A;  5H2F C;  3K6G A;  3S17 J;  2O7O A;  3GFM A;  3MWM A;  3PSI A;  4G6Q A;  4XOP A;  2O9L A;  2Z9O A;  2FQ3 A;  3PUF A;  4ZJZ A;  3FF5 A;  4B09 A;  1MJA A;  2EA2 A;  2Z33 A;  2E1M B;  3E5Q A;  3VB2 A;  2PEX A;  3ZQQ A;  4CCM A;  3OYF A;  4A3E J;  1UHS A;  4L18 B;  2JPC A;  3M4O J;  1ETQ A;  2VBY A;  1XCV A;  4BHP A;  4HNT A;  2IVM A;  4A3I J;  1YG2 A;  5EEG A;  1IRG A;  1S5L C;  5E3N A;  2Z5U A;  3QQA A;  1OFC X;  3RIR A;  2D2W A;  1QPM A;  1EH6 A;  1QVT A;  1A6Q A;  1IGN A;  1IF1 A;  1UEL B;  5LHG A;  2EA4 A;  3RKW A;  3OV8 A;  3RKQ A;  2X9D A;  3QAH A;  2L54 A;  4JX4 A;  3E0J B;  1W0T A;  2CW0 F;  1I6X A;  4F52 A;  1E0E A;  4BH9 A;  4DZP A;  3IWF A;  4F92 B;  5J4V A;  2ACJ A;  1JKP C;  1A36 A;  4CGZ A;  4EVI A;  2KZG A;  3CC2 I;  1VTN C;  1YS6 A;  5EF6 A;  3AL0 C;  1N78 A;  2L4A A;  3HG9 A;  2M0M A;  2DDB A;  5KVR A;  1CF7 A;  5EZH A;  2JA5 J;  2AQF A;  3G71 I;  2E2J J;  1FTZ A;  2KIU A;  2VXD A;  4WCG A;  2E5N A;  2LD5 A;  3BTC A;  3CZ6 A;  2M2E A;  3IKV A;  1X1P A;  4BY7 J;  3RZO J;  5BPD A;  3K70 C;  3LWF A;  3OL4 A;  1L0O C;  1N75 A;  5FGM A;  1ZG3 A;  4RBO A;  3RKX A;  1LEA A;  3V8J A;  1ZGJ A;  3OYK A;  1IUF A;  5B5E C;  2XKO A;  3I55 I;  3I59 A;  4A3G J;  2A6H F;  4A6E A;  4D5C A;  2VT3 A;  2F48 A;  2NS0 A;  5B3S H;  5K5O A;  3OR2 C;  4XBF A;  5GAH J;  3NRV A;  2MGQ A;  4ANJ A;  2WY8 Q;  1EH7 A;  3LSI A;  2ISY A;  5LEJ A;  2MH9 A;  4XLC A;  3CO7 C;  1TNS A;  3V7R A;  4OIN F;  5J3L A;  4NB5 A;  1HBX G;  1I6H J;  2ZME B;  1ENH A;  1OQY A;  2K4B A;  3E7L A;  5GAG J;  2HNH A;  1IN5 A;  2QYO A;  3QPS A;  3M3Y J;  5D4S A;  2HPM A;  4CZZ A;  3QYE A;  1U0J A;  4JK1 X;  4G7Z F;  2GIZ A;  1BR2 A;  2HXO A;  3GME A;  4XLE A;  3KFW X;  4A12 A;  4LK0 F;  1YW7 A;  5FRN A;  5FKM A;  1T8I A;  5BOX A;  2QSG X;  2ADU A;  3VOD A;  3M8J A;  5LHH A;  3BZC A;  2QSH X;  3GTP J;  2DLL A;  2XAQ A;  2WB1 N;  1JHH A;  3BY6 A;  4G6D A;  1A31 A;  4XSZ F;  3R60 A;  4WF2 A;  4WXD A;  5IY5 H;  3P9I A;  3HUG A;  1V5G A;  2RN7 A;  3WGI A;  1J59 A;  4Y52 J;  3J7A Y;  1BOB A;  2BHY A;  5D8L B;  3CP2 A;  1OCZ H;  2G7U A;  3HPH A;  4HST A;  3M9A A;  3GTK J;  3MZH A;  2XAH A;  1FIA A;  1G3Y A;  2OZ6 A;  4R1H A;  3AG2 H;  4ENJ A;  3A01 A;  2JWT A;  2G9W A;  2EFO A;  5IP6 A;  3PO2 J;  4KMF A;  2BVL A;  3QU6 A;  4B4C A;  2ZSH B;  3J80 Z;  3IRQ A;  5FJ8 J;  1QRY A;  2M0C A;  2WWY A;  5KHD A;  1LKX A;  4LLG F;  4Y13 A;  1ETV A;  4BDZ A;  2OBP A;  5ED4 A;  1DUX C;  5HS7 A;  3GX4 X;  1WQ2 A;  2TDX A;  2H27 A;  4G9Y A;  5GPA A;  2DAO A;  4C2U A;  1VQP I;  3CCY A;  3TL4 X;  5GTI C;  4FE4 A;  1YX3 A;  3WU0 A;  4D5F A;  1YJN I;  5FFX A;  4A0X A;  2BW3 B;  3BT9 A;  4HQM A;  5HVQ C;  2W7N A;  1Z6R A;  3CCE I;  4JBA A;  1FX7 A;  2IS4 A;  2YX4 A;  3F3X A;  1GLN A;  4HZF A;  2VKH A;  1PDN C;  2IBD A;  2LDU A;  3CMM A;  1XSD A;  3IAM 2;  1RKW A;  2M4K A;  5FB2 A;  1VQO I;  4AWX B;  4GRI A;  3K4L A;  3GTJ J;  3B6C A;  3PM1 A;  4BQN A;  5L3E A;  2XPW A;  4BQA A;  4E7J A;  2QBY A;  2V9K A;  3K4C A;  2CFX A;  5HLI A;  4PCQ A;  1OKR A;  2C6Y A;  1ZQ3 P;  3CMY A;  5K1Y A;  4B3A A;  4C2T A;  4OIR F;  4Z6Y A;  4G7H F;  1G3T A;  2R7R A;  4RLQ A;  2OQR A;  3QU3 A;  4P1W A;  4ZZL A;  3PIO F;  1R4M B;  4G12 A;  4LG3 A;  1XC5 A;  2VBX A;  1FWZ A;  3G73 A;  4L0Y B;  1TQP A;  3OYL A;  2A69 F;  3HOS A;  2NVU B;  4ASN A;  4EM1 A;  1SVM A;  3DKW A;  2JRM A;  2G7H A;  2FA5 A;  2KJC A;  2OTL I;  2W24 A;  2QQB A;  2Z99 A;  2XSD C;  2VC1 A;  3H36 A;  3O3K A;  1D1C A;  3K0L A;  4DYR A;  2M4G A;  3A03 A;  1Z67 A;  1IDY A;  1DPU A;  1FYK A;  2E60 A;  2JZY A;  4ZYA A;  4AYB A;  1Y1V J;  1OMI A;  3HC7 A;  3HBL A;  5JHU A;  2XAU A;  4M9S A;  1HW2 A;  2AXL A;  5JVT A;  2LR8 A;  5KK1 A;  4IHV A;  3GFJ A;  3A2K A;  5AIP A;  2F4M B;  3FM5 A;  4PJJ A;  2K86 A;  4A3M J;  4DJA A;  3OYD A;  3HHH A;  3GWZ A;  3PQJ A;  2XSJ C;  4LLN A;  4HF1 A;  3T1B A;  3I9V 2;  4M6X A;  1R22 A;  2HDD A;  1B72 B;  2CV1 A;  2RRE A;  3KP7 A;  4PDK A;  2Y31 A;  3R0A A;  4A69 C;  1V4R A;  2FXA A;  1ZAR A;  2GM4 A;  4J01 A;  1YI2 I;  4RMN A;  3DBL B;  2HYG D;  3K69 A;  3O8G A;  2ZFW A;  3VYT B;  1HCR A;  2ME0 A;  2PJP A;  4YIF A;  1QQI A;  4XLA A;  1XGN A;  4F55 A;  1ZG1 A;  1SMT A;  4XRS A;  2JTV A;  2LRE A;  2J5P A;  3I4N J;  5DYM A;  4HNU A;  4WWC A;  5FRO A;  1U6G A;  4MGR A;  2DPU A;  3MKZ A;  1HSJ A;  2P5L C;  5GPC A;  4YEL A;  1O57 A;  1ZGW A;  1TP4 A;  3QP6 A;  1RIO H;  2KRF A;  4P5O A;  3OYG A;  1VQ7 I;  1RR7 A;  1X4O A;  2CO5 A;  4M73 A;  5TIS C;  4BHB A;  5CPR B;  3H0D A;  3WE3 A;  1CF7 B;  3MQ0 A;  2E7W A;  2JA8 J;  4D9J A;  3LSP A;  3LSM A;  5EJC A;  5D5X B;  3ABU A;  2D45 A;  3BG7 A;  1KQ0 A;  3KET A;  3L2R A;  4LIV A;  3AKZ A;  4IOC F;  2ELH A;  2HYF A;  3J81 K;  5B66 C;  5L3F A;  1FMW A;  4BL0 B;  3WU1 B;  2NYX A;  1X58 A;  1P9Q C;  4RS8 A;  3JW4 A;  4MFE A;  3MMY B;  3CUQ C;  1ZEL A;  1O3T A;  4R79 A;  1Q1V A;  2R7D A;  2X1C A;  2CJJ A;  3Q0U A;  4RB1 A;  1UJ8 A;  4KNY A;  3OMY A;  4HX7 A;  3BPX A;  1WH7 A;  3MCZ A;  1AOY A;  1FMV A;  3UNG C;  2DA3 A;  2DOE A;  5HDG A;  5A2Q Z;  3G1O A;  2V6C A;  2QVO A;  3SEZ A;  3FKJ A;  1MBK A;  2FJ1 A;  2IGK A;  1VQ5 I;  3GZ6 A;  3O2P E;  1K61 A;  4B43 A;  2W4S A;  1OYY A;  2I10 A;  3ZMU A;  2EV5 A;  1YS7 A;  1T56 A;  3REO A;  1J09 A;  2XDV A;  1GXQ A;  3KEY A;  4L9N A;  3K7A J;  4UVC A;  4C9Y A;  3HOX J;  1P6R A;  4PGH A;  2X1E A;  5HLG A;  3TED A;  1MJ9 A;  3PFY A;  4M3D A;  5FLM J;  1I39 A;  5CLS A;  5EZG A;  2DI3 A;  2LLK A;  2LNB A;  3E6D A;  3KLO A;  2E35 A;  1YOV B;  3ZXS A;  3EET A;  1LFB A;  4E7S A;  2B63 J;  3JTG A;  2R7T A;  1RRJ A;  5DUI A;  2QA4 I;  4FQG A;  1K7A A;  3U1D A;  4XKW A;  2O03 A;  2XRL A;  2M7A A;  2PG4 A;  2VKE A;  3FXR A;  2HTJ A;  4RAF A;  1MW7 A;  2KIQ A;  2VLA A;  3BQZ A;  4IRG A;  1KGS A;  4MLO A;  2CQX A;  5LBQ A;  3MAJ A;  5L3B A;  3G2B A;  4G8X A;  3ZMV A;  5HOD A;  3BTI A;  3E6B A;  3M07 A;  3J7A O;  4XLH A;  3JSP A;  1RKT A;  3DP7 A;  1TLH B;  2DOF A;  5DS9 A;  3HOU J;  3ECH A;  3I56 I;  1RET A;  4EJW A;  2MG4 A;  3K1P A;  2X6Y A;  2R93 J;  3EUK L;  1D5Y A;  2ZKZ A;  3RYR A;  2WB1 A;  4LB5 A;  3WHC A;  3CME I;  1R00 A;  1GV2 A;  4I02 A;  1ETY A;  1MMD A;  2O8X A;  1D1A A;  3IH2 A;  3LST A;  5J1Y A;  4HF2 A;  4PFP A;  2WV1 A;  2BY1 A;  4NQW B;  4XLP F;  1R49 A;  2VJI A;  3KYL A;  2QQ8 A;  3EPZ A;  2MA3 A;  1FBS A;  2Z16 A;  1H8A C;  1N25 A;  4M72 A;  2N8G A;  1S8N A;  3L2U A;  3BG9 A;  1A5J A;  4IQJ A;  3CJT B;  5FKK A;  2OJE D;  4L9V A;  1LDK B;  3M1C A;  2DT5 A;  2V1X A;  1S72 I;  1F1Z A;  1YW9 A;  3TO6 A;  3LSG A;  3BTL A;  2LKP A;  1IO2 A;  1RNL A;  1IZ1 A;  3VYU B;  3L2C A;  1U5T C;  3OY9 A;  1KZH A;  3S1R J;  5LGT A;  5K7Z A;  3ZR8 X;  2XRO A;  3IL2 A;  2XV4 S;  5CQG A;  1A04 A;  3BJO A;  4XIC A;  3CLQ A;  2OCC H;  4ZZD A;  3MZ8 A;  3SXY A;  4RLF A;  4CXF A;  4O3M A;  2IGN A;  4ENK A;  1YYV A;  2M34 A;  2V79 A;  3F8N A;  3ZPL A;  1DDN A;  5DTD A;  2CWE A;  3AAF A;  4I6Z A;  3O6B B;  4PSW A;  4MNU A;  2BE5 F;  1GVD A;  2DYR H;  2ID6 A;  2FQ4 A;  2KHM A;  2ZJR F;  2MD5 A;  3GXO A;  4I09 A;  4YFX F;  3D1N I;  4B8X A;  4BXU A;  4Q4Z F;  3RKY A;  5D8K B;  3FXJ A;  5DV5 A;  1YJ9 I;  2YPR A;  4AIH A;  2RC4 A;  2F4O B;  4F91 B;  4S04 A;  1O3R A;  3HM5 A;  4BJ6 C;  2DA7 A;  2GWR A;  3DCF A;  1X3U A;  1N77 A;  2R0Q C;  3OSG A;  3TDZ C;  3BR3 A;  4CYD A;  1IN4 A;  3ASN H;  4M74 A;  4ZTF A;  2J5O A;  5D5V B;  5C4J J;  1PUE E;  3GTO J;  4ESJ A;  3J80 K;  2L9S A;  2VIX A;  2ESN A;  2P7V B;  3BTJ A;  4HA8 A;  1JUS A;  3DKX A;  2JK3 A;  2P6T A;  2PMU A;  2V9P A;  2JN6 A;  1XMX A;  3CUQ A;  1VQL I;  2X1D A;  2QKL B;  5JVG F;  3TO7 A;  3L9F A;  3GW2 A;  3OOU A;  1YJW I;  3OYH A;  1NK2 P;  2QUF A;  2CMP A;  1YIO A;  5J40 A;  2K9S A;  4UVB A;  4DBQ A;  4HW0 A;  2BBY A;  4M6Y A;  1QZY A;  1IXR C;  1I3Q J;  2YS9 A;  1QHG A;  4DBR A;  2OD5 A;  1J5Y A;  4L5E A;  3FMQ A;  1B4A A;  4V2F A;  2DMU A;  3SZP A;  2LRD A;  3DEU A;  2F5F A;  1LVK A;  3I4P A;  4UXN A;  2H6B A;  1QU3 A;  2DMQ A;  1SD7 A;  4FAS D;  2P0W A;  4U88 A;  3WTU C;  3FIW A;  3WG7 H;  4XRS G;  5D6E A;  4Y7N J;  1ZYR F;  1RR8 C;  1TWF J;  1D0Z A;  2EIN H;  3BG3 A;  2DT7 B;  3KCC A;  2WC2 A;  4M3G A;  1SFK A;  2NAZ A;  1ULY A;  3AG4 H;  2STW A;  3QOP A;  2XF6 A;  3I5U A;  3JCU C;  1Z7U A;  1H88 C;  1TTY A;  2M7B A;  3M8E A;  3BR1 A;  4FCY A;  1X1C A;  3KIO A;  1BI3 A;  4E6K G;  2QKM B;  2VJ5 A;  3CP8 A;  2ZXH A;  3KEO A;  1G4D A;  4A5M A;  3S32 A;  3BJA A;  1Y39 A;  3CCS I;  5E79 C;  1IG7 A;  2P5K A;  3QYB A;  5F1R A;  2HQA A;  5DM7 F;  1S7O A;  2DTZ A;  4ENM A;  2M30 A;  1MNE A;  3W6K B;  3RQ4 A;  2KT0 A;  4F3Q A;  2DQR A;  4U7D A;  3HIF A;  3N4M A;  2CV0 A;  1HKS A;  4UNO A;  3OS2 A;  1APL C;  1P7I A;  1TNT A;  4I0A A;  5FKL A;  2VQG A;  1SFE A;  5TRD A;  2MFZ A;  2TCT A;  1G3W A;  4D1Q A;  3DQV C;  3KYD B;  3OYC A;  5ICE A;  4L0Z B;  2E34 A;  3S14 J;  4E7K A;  2FOW A;  3VYR B;  1JTX A;  2VOO A;  2R5Y B;  2XGE A;  3KX2 A;  2KMU A;  4EJU A;  4YFN F;  4JP0 A;  1B9M A;  3FK6 A;  3RPU D;  4A3C J;  3ABM H;  3FWE A;  5E8G A;  1WWX A;  1HQC A;  1D8J A;  3BPV A;  1Z21 A;  2PJR A;  4ESF A;  4A3D J;  2DJI A;  3FBN B;  3PFI A;  3UR3 C;  2O0Y A;  3WE2 A;  3BR2 A;  1YHQ I;  3EUH A;  1S6L A;  2Z2S B;  4D7N A;  2HR3 A;  1BL0 A;  3FBI B;  1HXD A;  4IRH A;  4E4H A;  1UAA A;  3CCQ I;  2VPR A;  1HST A;  2H8W A;  4Y3O A;  1TBX A;  3JRF A;  4M71 A;  5BMZ A;  5CJ9 A;  4BQQ A;  3L7W A;  5D5W B;  3WTV C;  1YTY A;  4KA4 A;  2FRH A;  5J1U A;  3A0B C;  1VZ0 A;  1MD0 A;  3V7C A;  2Y0S A;  2CYY A;  5C44 J;  2DT6 A;  1REP C;  5GTH C;  3L09 A;  5B1B H;  2NRA C;  3ZOB A;  2R7V A;  4NNJ A;  1FOX A;  4MTD A;  4DOZ A;  3NWT A;  3DV8 A;  3F23 A;  2STT A;  5IT9 Z;  4PJM A;  4XOR A;  3ABT A;  3GBG A;  3W2A A;  2FU4 A;  2MH2 A;  5E17 F;  4RB2 C;  1OCP A;  4OIO F;  4LK1 F;  4IKF A;  2DOD A;  3SHF A;  2MC3 A;  2COB A;  4BJ5 C;  4NC8 A;  1Y1W J;  1R1V A;  1ZK8 A;  3WTY C;  3HSF A;  2WTE A;  4M6V A;  5E3M A;  2CQN A;  2OF7 A;  2FUG 2;  2OQG A;  5CYV A;  4ABZ A;  5F08 A;  1MJB A;  2XGC A;  1V55 H;  3FHZ A;  4FHT A;  2LVS A;  2CQ7 A;  1LEB A;  1RES A;  2JA6 J;  2VQL A;  3EYI A;  2COM A;  2A61 A;  1OYI A;  1BBY A;  1HLV A;  3FXM A;  2HKO A;  3TOA A;  3GLX A;  1F43 A;  2JPB A;  2R7F A;  1QZE A;  1T0F C;  2RDP A;  4PSX A;  2E7X A;  4RB0 A;  2Y9Y A;  5C3E J;  1W36 C;  3HOZ J;  2NOJ B;  3J81 Z;  2XHK A;  2IAI A;  4BYY A;  1ITY A;  3SFI A;  2BEO A;  2DMT A;  5ILS A;  2DA2 A;  2BGC A;  3D5R C;  1TT0 A;  4Q47 A;  3SFZ A;  4IZZ A;  1YX5 A;  1NTC A;  4LD5 A;  4A5N A;  1J0R A;  3DBH B;  2M9H A;  3LA7 A;  1WCM J;  4Q5S F;  1K4S A;  3JRG A;  3P5J A;  1E17 A;  4GDF A;  4DYQ A;  4U7B A;  3ZRG A;  4C3I J;  3A4C A;  2JSC A;  1LPQ A;  3NEU A;  3FXU A;  2EIK H;  2MYS A;  3VWB A;  1LDD A;  2R4G A;  1DGR M;  3SDB A;  4P96 A;  2VC0 A;  2X0L A;  2HQR A;  4B3X A;  3RYP A;  4HLY A;  5F0F A;  5JFR A;  4OWR B;  4QLC U;  1K83 J;  3KP4 A;  3GUD A;  2ZJQ F;  1MMN A;  1R7J A;  3GLL A;  1EF4 A;  1PJR A;  3MN2 A;  2QGU A;  2OC6 A;  4RAY A;  5EEA A;  5F27 A;  3RCO A;  2LY2 A;  2X6X A;  2VON A;  3BRO A;  2YU3 A;  3OYB A;  2KDO A;  3R4K A;  5CQE A;  5J8C A;  3CC7 I;  1Z05 A;  1AKH B;  1IC8 A;  3Q5F A;  2YU9 J;  4R8H A;  3A0H C;  1JT6 A;  2KLO A;  2CUE A;  2XGX A;  3ZQL A;  2GOX B;  2K02 A;  2XB5 A;  2NNY A;  3BG5 A;  4AD9 A;  1K6O A;  3DU6 A;  1QNT A;  3ELK A;  1K78 B;  1TT5 B;  3IC7 A;  1V5E A;  5J1R A;  2VXZ A;  3ZP5 A;  3T5X A;  3U2R A;  1FZP B;  2M87 A;  2M8G X;  3ZQF A;  5LD2 C;  3ML6 A;  1W36 D;  1G2H A;  3Q0W A;  4A3K J;  3K4M A;  1OR7 A;  4LOC A;  5D6F A;  3GF2 A;  5DEQ A;  1R36 A;  1QBJ A;  3KEQ A;  1WRJ A;  1WI3 A;  3UKG A;  3OYA A;  1W1W E;  2ZJ2 A;  2DBB A;  3G1L A;  1AWC A;  5IYC J;  2ZNZ A;  2KFD A;  1FSE A;  4KT6 A;  3T8T A;  4CUG A;  2FMY A;  3P9K A;  3ULQ B;  1TQI A;  4E7Z A;  2FEZ A;  2Q1Z B;  3RZD J;  1LB2 A;  1FBQ A;  3JR9 A;  2EFN A;  1LUJ B;  4IEJ A;  4BHC A;  4II3 A;  3OS1 A;  4XR6 A;  1WSU A;  3O8H A;  1DU6 A;  3PUB A;  4RGX A;  3WTZ A;  4XQF A;  1T39 A;  5M3F J;  4FE7 A;  4E7H A;  1ZN2 A;  1Y6I A;  2KKO A;  1K6Y A;  3AG1 H;  2DK5 A;  2JVG A;  4MO7 A;  1F5T A;  3QWL A;  1XPX A;  3FXK A;  1BIB A;  3CTA A;  1HW5 A;  5K5R A;  2E2I J;  4DZJ A;  2OV7 A;  2BY3 A;  1MBH A;  3QRF F;  4KFC A;  3CO6 C;  1L3L A;  2CUF A;  2HPI A;  4FTH A;  4IHW A;  1TZL A;  3COA C;  4U0V A;  1H9T A;  3DPT A;  2Q8K A;  5M5W J;  1JJ6 C;  1GUU A;  1K4T A;  2G0E A;  2PN6 A;  4EV0 A;  5M5Y J;  1LNW A;  4BBR J;  2MLG A;  5JR3 A;  4PZJ A;  2IS1 A;  4JYK A;  2VAS A;  4C2M J;  2FBH A;  1X2M A;  1HKQ A;  2CQQ A;  1J2X A;  3H0G J;  2L9V A;  1MDM A;  3HOV J;  2ZBK A;  2OTJ I;  2L7F P;  4N4O B;  3VSK A;  4MTE A;  2WAQ N;  2L5Q A;  1GV5 A;  3H9G A;  2HDC A;  4HOB A;  3E6C C;  1R5H A;  2HS5 A;  2ME6 A;  4IX7 A;  1FOY A;  4A0Y A;  1R71 A;  4TV7 A;  1F9N A;  4A0Z A;  1P4X A;  3WTT C;  4PFO A;  3S93 A;  2HGC A;  3E5X A;  4PJ0 C;  3VSL A;  2WY7 Q;  3ZQC A;  4AIK A;  2GIV A;  1FLI A;  5HDK A;  2DPD A;  2X6O A;  9ANT A;  1X2N A;  1WI9 A;  3JRH A;  4KMU X;  1KA8 A;  3AL0 B;  2CH0 A;  4P9F A;  3QYF A;  2ZME A;  3WG9 A;  3H9Q A;  2ZXW H;  1GT0 C;  2VPL A;  1D3Y A;  1SD4 A;  1ZG5 A;  4BJT A;  1G6N A;  3VDX A;  5ICG A;  4GXO A;  4UY8 I;  2L3D A;  2ZC2 A;  1SMY F;  2QLZ A;  4ESB A;  1P4A A;  2GAU A;  3FX3 A;  3TP0 A;  4BUP A;  1BJA A;  2NVQ J;  1WVR A;  3FZV A;  4RAG A;  1RUN A;  4XN0 A;  2V1D A;  5IPA A;  3ERM A;  4JX5 A;  3LAP A;  3BCB A;  1R1U A;  2D1H A;  2IEK A;  4MHG A;  2M3A A;  4UB8 C;  3HSE A;  2PJR B;  2L7Z A;  4CZC A;  4UHT A;  1EJ9 A;  1ZTR A;  4LB6 B;  2I8D A;  3SQN A;  3GTG J;  2ZCW A;  3SDG A;  2UZK A;  1O3S A;  1E3H A;  2RNG A;  2E1M C;  1T6S A;  4GCV A;  1Z77 A;  1T08 B;  2HI3 A;  1UFM A;  2F5E A;  3ZQI A;  3IUO A;  5A2Q K;  1BA5 A;  5H20 A;  3KP2 A;  1LFP A;  3TGN A;  4I99 C;  1VQ8 I;  4I0B A;  5JI6 A;  3HRU A;  2JUC A;  3F72 A;  3HYI A;  5F6F A;  3ZN1 A;  1HOM A;  1TL8 A;  5L3G A;  1B8I A;  3ZGK A;  4LGW A;  1JI8 A;  1UMQ A;  1S29 A;  4EM0 B;  1IN6 A;  3CC4 I;  1XGM A;  3HRT A;  4CCL A;  5DD8 A;  4M9X A;  2ZFU A;  4HG2 A;  4UVA A;  5ERI A;  2FNA A;  4HDV A;  4ZDP A;  5J47 A;  4P9U A;  4I76 A;  2BV6 A;  2HU9 A;  3F0C A;  2WAE A;  3I4M J;  2ZXI A;  1KQ9 A;  4AVP A;  5F1J A;  2V1U A;  1R4N B;  1JHF A;  2OUM A;  3ZMZ A;  4F7Z A;  2O5R A;  1MBF A;  3D0S A;  4M3E A;  4L5J A;  1BR1 A;  2DK8 A;  5BNG A;  5TGT A;  1JXS A;  3HOT A;  2LYC A;  4IHT A;  2YX7 A;  3LFK A;  4UV9 A;  1H0M A;  3CJR B;  2LFB A;  3CCJ I;  4CYC A;  1Z7L A;  4IQ4 A;  1LVA A;  1BM9 A;  3PL8 A;  1R1T A;  2XF7 A;  5F0H A;  4Y15 A;  1VQ4 I;  4Y33 A;  2DA5 A;  2LY1 A;  3U1K A;  1U3E M;  1GVJ A;  1W5C C;  1Z91 A;  3K4N A;  4AYB N;  2H6C A;  3BZ6 A;  2EQR A;  4I7H A;  4AUX A;  4E7I A;  2X4H A;  1AA7 A;  3GVA A;  5F0C A;  3L2Q A;  4PGG A;  2L4M A;  5CVJ A;  5DCM B;  4RGR A;  2K4J A;  4IPA A;  1HDD C;  4BU2 A;  5AIQ A;  3M7G A;  2L2O A;  1ZH5 A;  1IRZ A;  3VEP A;  4EMS A;  3MEX A;  2K85 A;  3LMM A;  5IOZ A;  4NDL A;  1FT9 A;  4BS9 A;  2A07 F;  4ZTJ A;  2D5V A;  4BBS J;  4NC7 A;  4BE0 A;  3I54 A;  4XL9 A;  4KUM A;  4BQO A;  4QPO A;  2EZI A;  1X3Z B;  1SFX A;  3E5U A;  3HHG A;  1O4X A;  1TWH J;  3BLY A;  4CYC B;  2GXG A;  2X48 A;  3CCL I;  1NG6 A;  2E1O A;  3LQQ A;  2VOD A;  3HRS A;  1JE8 A;  4YII A;  5TJJ A;  2EJR A;  4XK4 A;  2BYV E;  5E1X A;  2LH9 A;  2YUS A;  1YRN B;  4L9T A;  3DBR B;  2HWV A;  2EZH A;  2LSO A;  1I5Z A;  3DLL F;  1Y0N A;  3OYE A;  3F6V A;  3MZY A;  3LFU A;  5J8F A;  1WJE A;  1T33 A;  1VQK I;  2BOL A;  3F8B A;  4I98 B;  1MSF C;  1IRX A;  2K3P A;  4PK4 A;  1ZLK A;  3S8P A;  1EH8 A;  1IXS B;  3LNQ A;  3K2A A;  2B0L A;  4E7L A;  1XDS A;  1NK3 P;  4WX9 A;  3SZT A;  2LY9 A;  2EIJ H;  5FLX K;  2F5C A;  1ETO A;  2KQR A;  3TO9 A;  1JTY A;  3Q9S A;  1HF0 A;  1HC8 A;  5FLX Z;  1FIP A;  3K1N A;  1K78 A;  1BC7 C;  5H6Q A;  1USS A;  2K9M A;  3AG3 H;  4IXA A;  3H92 A;  3VOE A;  2QZ8 A;  3OYM A;  4I01 A;  1VQM I;  3A1Y A;  4CCK A;  2IXS A;  1YW8 A;  4O5V A;  4KJZ A;  5M5X J;  4NQW A;  1OCR H;  2CV2 A;  4OMZ A;  4YRV A;  2EBI A;  3BC8 A;  3PNT A;  4MQV A;  3G4S I;  4CA0 A;  4Q48 A;  1T38 A;  2EK5 A;  5EEH A;  4HAM A;  4NC6 A;  1TWG J;  2JT1 A;  1D8K A;  3QOE A;  1ZR4 A;  1XSV A;  2JJ7 A;  1Y0U A;  1W5S A;  2Y75 A;  2OU2 A;  2QEX I;  3MKL A;  2X85 A;  4OIQ F;  2VL8 A;  1EKE A;  4IHX A;  3HUG B;  3S2H J;  5LGU A;  2WBM A;  3WTS C;  1O3Q A;  1UG2 A;  1MH4 A;  2EZL A;  2GBY A;  3CUO A;  4UB6 C;  1RUO A;  3BZK A;  2UWM A;  1P92 A;  3H3Z A;  1FYL A;  4V19 K;  4A6D A;  1MNM C;  5E1Z B;  1U9N A;  3H35 A;  4YIR X;  1MBE A;  1KU3 A;  1Z3Y A;  2EZK A;  2FF4 A;  4HX8 A;  4RM3 A;  4IHY A;  2BY2 A;  5JLW A;  3IHU A;  2AHQ A;  2Y0M A;  2EB7 A;  1ZLJ A;  2ISZ A;  2W48 A;  1NHA A;  5J6X A;  3EQL F;  1B9N A;  4LIT A;  4A3F J;  3W2V A;  2XAJ A;  3B73 A;  3NWS A;  1SEU A;  4AIJ A;  1MBJ A;  4EGY A;  1JT0 A;  3DTE A;  4KYW A;  2O61 A;  1KON A;  1OIS A;  2KRC A;  2W82 A;  2YSR A;  2EV6 A;  3L2V A;  4ZYH A;  5FKN A;  1Y8R B;  3S3M A;  3GTM J;  2P7C B;  2L7K A;  2RGV A;  1SD6 A;  5C4X J;  2HOE A;  4G94 A;  1OR7 C;  2NNN A;  2E2H J;  3V7S A;  3R61 A;  1ETK A;  3PO3 J;  2E36 A;  3BCA A;  4MFD A;  3RPQ A;  1S9H A;  1Z3X A;  3LSJ A;  5FRM A;  5IYB J;  1QA6 A;  2E5Z A;  3OOP A;  1O7L A;  4WXC A;  2DOA A;  4XM3 A;  2Y9Z A;  4ETS A;  5E18 F;  5KAI C;  4ZDL A;  4RGU A;  3IV5 A;  2EFQ A;  4Y4R A;  5GAE J;  3RQI A;  2Y30 A;  2ETH A;  5LEK A;  1LQ1 A;  2JMW A;  1ON1 A;  2FE3 A;  3L00 A;  1KU7 A;  3K1M A;  2MBF A;  2QEN A;  4CHU A;  2RVC A;  5HLT A;  3RDI A;  2WAD A;  1WJF A;  1WJD A;  3D5S C;  1X4P A;  4HBL A;  2R5Z A;  2ICW G;  2UXX A;  2AO9 A;  2MSY A;  3CUQ B;  1JGG A;  3F8F A;  4HNV A;  2KP6 A;  3FXQ A;  5BQT A;  3OYI A;  2K9N A;  3QP5 A;  3H1C A;  3ROU A;  2HYJ A;  3NAU A;  1J9I A;  1JKQ C;  1W5T A;  2H09 A;  4NBQ A;  4RB3 C;  1TC3 C;  2M45 A;  4G7O F;  4ZC3 A;  2W00 A;  4EAT A;  3ZQH A;  1I1S A;  1P7J A;  3GFI A;  2HZD A;  3HPG A;  1OPC A;  2F6C A;  2KJB A;  2E1C A;  3S16 J;  4WK8 F;  1ZR2 A;  2QWW A;  3CDL A;  4CSW A;  2A5W A;  3ECO A;  3CF2 A;  1JUM A;  1VF9 A;  3FHN A;  3Q9V A;  3H5R A;  4DIQ A;  1SFU A;  2VT2 A;  1TQM A;  3FM3 A;  3TQN A;  1STZ A;  1XB4 A;  4KT5 C;  1WHU A;  1FBU A;  4CIC A;  2EFW A;  3HGG A;  2KZV A;  4DYC A;  1IV6 A;  2H94 A;  4ZYD A;  1WKM A;  3DLA A;  2UXN A;  3F9K A;  2Y0S N;  3VPR A;  5IP7 J;  1B8I B;  4HV5 A;  3HOW J;  3SEQ A;  2FML A;  1IRF A;  2VJ4 A;  1MGT A;  5HLH A;  1U2W A;  3I0T A;  2UV1 A;  4IJA A;  5ILV A;  2K3F A;  3S2D J;  1KU2 A;  3MVP A;  3BJ6 A;  4M9Z A;  3JRE A;  1IUY A;  4XRF A;  1I1G A;  4EQQ A;  1FY7 A;  2JA2 A;  2HFH A;  5D4R A;  3S3O A;  2KL4 A;  3DFG A;  2H1L A;  3DXJ F;  1U78 A;  4EJT A;  3CJQ B;  4MEX F;  1LJ9 A;  2R92 J;  5DCM A;  2W1O A;  4BKX A;  3C3W A;  2XC7 A;  2JA7 J;  5HNF A;  3SYT A;  4C3H J;  3G6E I;  2M5W A;  4ZYG A;  3FXO A;  3ZMS A;  3HEF A;  2FOK A;  3IWZ A;  2Y69 H;  1W7P A;  3S1N J;  4AM3 A;  2BXY A;  2DDA A;  4BY1 J;  4YFK F;  1IXC A;  2W84 A;  2ECB A;  3K4B A;  1R9T J;  2ZSI B;  3HJE A;  2L02 A;  2GA2 A;  4RAZ A;  5HDN A;  2LF7 A;  1R5I D;  1ETX A;  2E19 A;  4IF4 A;  1VI0 A;  3HDD A;  1KYW A;  2R5Y A;  4ENN A;  1JKR C;  1BW6 A;  4E70 A;  4NHJ A;  1VND A;  4J00 A;  3GTQ J;  3OWT A;  3OIO A;  3HOY J;  3PIP F;  4H4K C;  1YIT I;  1D0Y A;  1SVL A;  4OMY A;  5BS6 A;  3FIS A;  3W3C A;  2MW8 A;  1UST A;  1DPR A;  4XKC A;  2IRF G;  3TMO A;  1Y56 A;  2EH3 A;  3LSR A;  3W6V A;  2XAS A;  3GO5 A;  1TWA J;  3EUA A;  4MIM A;  2GXA A;  3AFH A;  4A3B J;  2CUJ A;  1SVO A;  3JRB A;  2F5D A;  3CCU I;  2XB0 X;  5GAD J;  1TW3 A;  4O6J A;  4L9J A;  2PQ8 A;  2IA1 A;  5FKO A;  1B1B A;  3T0Y A;  1PP8 F;  2R7U A;  3V4G A;  5B1A H;  2PX9 A;  4ZYE A;  3CCM I;  3FDY A;  2IJL A;  2Z1D A;  5EGO A;  3C1D A;  3VFZ A;  3DU5 A;  4XOT A;  3IH4 A;  3WHB A;  2LMD A;  2VE8 A;  3FKI J;  4XLF A;  5JLX A;  5L3C A;  3KPH A;  3WGG A;  3TBI A;  5D5U B;  3EDP A;  3HRM A;  5EYR A;  4U87 A;  1YE9 A;  2DCE A;  2RKH A;  2MD0 A;  4K2E A;  1Z0X A;  3TOB A;  3OYN A;  1FEX A;  4FET A;  2LP0 A;  1V3F A;  2HEO A;  2XF5 A;  1M1E B;  1XCB A;  2DFH A;  2V9V A;  1SC7 A;  2PLY A;  2CW8 A;  4RGS A;  2DFI A;  4B1R A;  3FMR A;  2VUM J;  1RZ4 A;  2A3S A;  4BEH A;  4KIF A;  3VYS B; 
#chains in the Genus database with same CATH homology
 2NVX J;  3JRC A;  3QPL A;  5HOD A;  3BTI A;  1MBG A;  3ZQC A;  1W0U A;  1WPK A;  2ELK A;  2X6O A;  2RAE A;  1RKT A;  9ANT A;  3HOU J;  1X2N A;  5DS9 A;  3A01 B;  2XPV A;  1RET A;  3JRH A;  2MG4 A;  2HOT A;  2R93 J;  1D5Y A;  3B6A A;  4EEF G;  1GT0 C;  2Y2Z A;  4QSH A;  1LE8 B;  3TW6 A;  3IH3 A;  2ID3 A;  3WHC A;  3TP0 A;  1XS9 A;  4GFB A;  2NVQ J;  1GV2 A;  1ETY A;  2XGD A;  2HXI A;  5IPA A;  3IH2 A;  2VI6 A;  5J1Y A;  4JX5 A;  2DMN A;  2WV1 A;  5EGO B;  2IEK A;  3BR6 A;  2L7Z A;  1ZTR A;  1H8A C;  4D7M A;  2N8G A;  3FK7 A;  3HGY A;  3BG9 A;  4FIS A;  3GTG J;  1A5J A;  5FKK A;  4W1U A;  3SDG A;  1MH3 A;  1Z77 A;  3LSG A;  3BTL A;  2HI3 A;  3ZQI A;  2HOA A;  2TRT A;  5GP9 A;  1BA5 A;  3S17 J;  2NVT J;  3S1R J;  5K7Z A;  2O7O A;  2O9L A;  2QF7 A;  2OPT A;  1VFC A;  4XIC A;  1QVU A;  1HOM A;  1B8I A;  2M34 A;  4A3E J;  5DTD A;  3BQY A;  5E3O A;  1JUP A;  1UMQ A;  4I6Z A;  1UHS A;  1GVD A;  2ID6 A;  2FQ4 A;  3M4O J;  1ETQ A;  5EG0 A;  3D1N I;  4A3I J;  3NAR A;  4I76 A;  5E3N A;  4AC0 A;  3F0C A;  3QQA A;  3I4M J;  1OFC X;  3S1Q J;  1H89 C;  1AKH A;  2O8K A;  5F1J A;  3TW7 A;  3HM5 A;  1QVT A;  1IGN A;  1MBF A;  4M3E A;  2DA7 A;  4UUS B;  2NOG A;  2LTP A;  5BNG A;  5IP9 J;  3DCF A;  3RKQ A;  2X9D A;  4JX4 A;  4M3B A;  1W0T A;  2R0Q C;  3OSG A;  3BR3 A;  4DZP A;  1ETW A;  1JKP C;  1TWC J;  5C4J J;  3GTO J;  5EF6 A;  2ECC A;  2LFB A;  4CYC A;  2L0K A;  3BTJ A;  2LKX A;  1JUS A;  2JK3 A;  2JA5 J;  5EZH A;  1RPW A;  2JN6 A;  2E2J J;  5F0H A;  3GTL J;  2L9R A;  1FTZ A;  2DA5 A;  3OOU A;  3L1P A;  1NK2 P;  2LD5 A;  3BTC A;  4AYB N;  2M2E A;  4AUX A;  2EQR A;  2K9S A;  4BY7 J;  3RZO J;  4RDU A;  2R5Z B;  1I3Q J;  2YS9 A;  5F0C A;  5FLV A;  4DW6 A;  4RBO A;  5IOY A;  4L5E A;  4V2F A;  1HDD C;  1IUF A;  2DMU A;  1IRZ A;  5IOZ A;  4NDL A;  4A3G J;  2DMQ A;  4X1E A;  4D5C A;  3FIW A;  2D5V A;  2L7M P;  4XRS G;  4BBS J;  4Y7N J;  3BR5 A;  2ZB9 A;  1TWF J;  2EZI A;  3BG3 A;  4M3G A;  3Q0V A;  2MGQ A;  1O4X A;  1TWH J;  3OSF A;  4CYC B;  1H88 C;  2X48 A;  5J3L A;  1I6H J;  2E1O A;  3BR1 A;  4FCY A;  1ENH A;  3E7L A;  4XK4 A;  3QPS A;  4XRM A;  2YUS A;  3M3Y J;  1S7E A;  1YRN B;  2EZH A;  1CQT A;  2H8R A;  2HXO A;  3DEW A;  1T33 A;  1IG7 A;  1MSF C;  1PUF B;  5FKM A;  3A02 A;  2DTZ A;  3GTP J;  1JKO C;  2KT0 A;  2WB1 N;  2NVY J;  3LNQ A;  3K2A A;  1JJ8 C;  1LFU P;  4X6A J;  1NK3 P;  1APL C;  1P7I A;  2LY9 A;  1ETO A;  5FKL A;  4Y52 J;  1JTY A;  1HF0 A;  1FIP A;  2TCT A;  3GTK J;  1FIA A;  3S14 J;  1JTX A;  2R5Y B;  2XGE A;  2NS7 A;  4A3L J;  3ZQG A;  3A01 A;  2JWT A;  1BW5 A;  5IP6 A;  4JP0 A;  3PO2 J;  3FK6 A;  4A3C J;  5M5X J;  5K7F A;  2EBI A;  3CQZ J;  4B4C A;  5EG0 B;  4A3D J;  5IYD J;  5FJ8 J;  1QRY A;  2M0C A;  4M3F A;  3BR2 A;  1MSE C;  1XG1 A;  1ETV A;  1TWG J;  4D7N A;  1ZR4 A;  1BL0 A;  2JJ7 A;  4A93 J;  1YRN A;  2VPR A;  3MKL A;  1E3O C;  2R7Z J;  4IHX A;  3S2H J;  5GPA A;  3JRF A;  3CCY A;  1UG2 A;  1MH4 A;  2EZL A;  2GBY A;  4FE4 A;  1AHD P;  5J1U A;  4D5F A;  4J19 A;  3H3V K;  5C44 J;  1MNM C;  1U9N A;  3BT9 A;  3ZOB A;  1MBE A;  1F36 A;  2EZK A;  2FD5 A;  4IHY A;  5JLW A;  2AHQ A;  3GBG A;  4XID A;  2W48 A;  1OCP A;  2IBD A;  4A3F J;  1QPI A;  1POG A;  1MBJ A;  1RKW A;  1JT0 A;  2VKV A;  2COB A;  1Y1W J;  1ZK8 A;  3HKZ N;  4M6V A;  5E3M A;  3GTJ J;  2OF7 A;  3B6C A;  3PM1 A;  4ABZ A;  2XPW A;  5F08 A;  2XGC A;  5FKN A;  2LVS A;  1ZQ3 P;  3GTM J;  3CMY A;  1RES A;  5M3M J;  2JA6 J;  4B3A A;  5C4X J;  1A6I A;  1HLV A;  2E2H J;  3PO3 J;  1ETK A;  1F43 A;  4MFD A;  4W97 A;  3LSJ A;  5IYB J;  4BXX J;  4G12 A;  2Y9Y A;  5C3E J;  3HOZ J;  1XC5 A;  2IAI A;  2Y9Z A;  1DU0 A;  1ITY A;  3SFI A;  2DMT A;  2QCO A;  2DA2 A;  3IV5 A;  3RQI A;  2Y30 A;  2JMW A;  1NTC A;  2K9Q A;  2M9H A;  1WCM J;  2HOS A;  2XSD C;  3JRG A;  3S15 J;  4DYQ A;  2K40 A;  4DYR A;  3A03 A;  4C3I J;  2R5Z A;  1IDY A;  2AO9 A;  1Y1V J;  2MSY A;  1JGG A;  3HBL A;  4HNV A;  1FTT A;  2K9N A;  2HYJ A;  3NAU A;  2LR8 A;  1JKQ C;  3LOC A;  2NS8 A;  4IHV A;  4UUT A;  1IDZ A;  5F0F A;  1TC3 C;  4A3M J;  1I50 J;  2DA6 A;  1K83 J;  2XPU A;  3ZQH A;  1EF4 A;  1P7J A;  3MN2 A;  3JRD A;  5E3L A;  2DMP A;  2HDD A;  1B72 B;  5EEA A;  3S16 J;  5F27 A;  1ZR2 A;  1ORK A;  1ZKG A;  3CDL A;  1SFO J;  2Y31 A;  4A69 C;  1JUM A;  1VF9 A;  3JRA A;  2GM4 A;  4A3J J;  1AKH B;  2H1K A;  1IC8 A;  2YU9 J;  3HGG A;  4DYC A;  1IV6 A;  2PMZ N;  1JT6 A;  3O8G A;  2CUE A;  1HCR A;  3ZQL A;  3TP3 A;  2ME0 A;  1BJZ A;  1LE8 A;  2XB5 A;  3BG5 A;  5K7H A;  4XRS A;  2Y0S N;  3VPR A;  5IP7 J;  1B8I B;  3HOW J;  1AU7 A;  3I4N J;  4QTR A;  5J1R A;  3S2D J;  3MVP A;  2M8G X;  3ZQF A;  5GPC A;  3JRE A;  1OCT C;  1WGX A;  1ZGW A;  3HB9 A;  1G2H A;  3Q0W A;  4A3K J;  1SAN A;  4LOC A;  1RR7 A;  1U78 A;  1WI3 A;  3BR0 A;  2R92 J;  4BKX A;  3UKG A;  2JA7 J;  2JA8 J;  4UUS A;  4C3H J;  1U8B A;  3LSP A;  3G1L A;  4JX6 A;  3G1M A;  1FJL A;  3HEF A;  5IYC J;  2HQ5 A;  3S1N J;  4BY1 J;  1R9T J;  2ECB A;  1B72 A;  5EDN A;  2GLO A;  3JRI A;  1X58 A;  4MFE A;  3RZD J;  1Q1V A;  1ETX A;  2CJJ A;  2E19 A;  3Q0U A;  1VI0 A;  3JR9 A;  3HDD A;  2R5Y A;  1JKR C;  4IEJ A;  1BW6 A;  1WH7 A;  3GTQ J;  1VND A;  4C3J J;  3OIO A;  3HOY J;  3O8H A;  2DA1 A;  1DU6 A;  2LK2 A;  2DA3 A;  5M3F J;  3G1O A;  4FE7 A;  1GDT A;  2DJN A;  1IJW C;  1MBK A;  3FIS A;  2CU7 A;  2FJ1 A;  3S1M J;  2MW8 A;  4MO7 A;  2P81 A;  2DN0 A;  2KDZ A;  1K61 A;  3SJM A;  3Q3S A;  2E2I J;  2I10 A;  4DZJ A;  2EH3 A;  3LSR A;  3W6V A;  1MBH A;  1TWA J;  4MIM A;  1T56 A;  4A3B J;  1PUF A;  2CUF A;  3K7A J;  4FTH A;  3HOX J;  4IHW A;  3JRB A;  2XB0 X;  5M5W J;  3TED A;  4QIW N;  1JJ6 C;  5FKO A;  2CRG A;  4M3D A;  1GUU A;  5FLM J;  2G0E A;  5EGO A;  5EZG A;  5M5Y J;  2LLK A;  3C2B A;  4BBR J;  4JYK A;  3IH4 A;  3WHB A;  3FKI J;  5JLX A;  4C2M J;  1X2M A;  2FX0 A;  2CQQ A;  1OJL A;  1LFB A;  2B63 J;  3H0G J;  3HOV J;  5EYR A;  2L7F P;  1Z0X A;  1FEX A;  2LP0 A;  2XRL A;  2WAQ N;  2VKE A;  1GV5 A;  4V2G A;  1HDP A;  1WH5 A;  2ME6 A;  4B1R A;  2VUM J;  5F04 A;  3BQZ A;  1U9O A;  4MLO A;  2CQX A;  4S0H B;  2DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...