2EZHA

Solution nmr structure of the igamma subdomain of the mu end dna binding domain of mu phage transposase, minimized average structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
65
structure length
65
Chain Sequence
SEFDEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords TRANSPOSASE
publication title Solution structure of the I gamma subdomain of the Mu end DNA-binding domain of phage Mu transposase.
pubmed doi rcsb
total genus 19
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1997-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ezhA00
1S7EA 2DA6A 2M34A 4HNVA 2NS8A 2X9DA 2DA2A 1ZTRA 2JK3A 1BW5A 4X6AJ 3A02A 1FIAA 3WHCA 3BR5A 2DN0A 2PMZN 2MW8A 4IEJA 1ZQ3P 4QIWN 3BTLA 2HDDA 3FIWA 3BTJA 4FISA 5F04A 4B3AA 3JRHA 3B6CA 4JYKA 3ZQGA 4A3KJ 2DA7A 2R5ZA 1LE8B 3Q0UA 2KT0A 1MBFA 3HOUJ 2G0EA 3OOUA 3LSRA 2XPUA 3G1LA 4NDLA 1FIPA 2AHQA 1D5YA 4M3EA 1ENHA 4UUSA 3HDDA 4RBOA 3BG9A 3BR2A 3SDGA 2NVXJ 2XGDA 4JP0A 2E19A 5C3EJ 5J1UA 2JA8J 4J19A 3S1QJ 2K9NA 2ID6A 2R5ZB 5F0CA 5K7ZA 2XPVA 4CYCA 1IC8A 3GTGJ 1GV2A 2X6OA 4GFBA 3W6VA 1T33A 2K9QA 3QPLA 1JUPA 2GBYA 2LR8A 5FKKA 2I10A 5E3NA 2E2HJ 4BY7J 4M3BA 4UUSB 1WH7A 3MN2A 2R93J 1NTCA 5M5WJ 3HOZJ 3JRFA 2L7FP 5J1RA 5M5XJ 2B63J 4FCYA 4JX5A 1RKTA 2HOSA 2XGCA 1PUFA 2MSYA 1TWFJ 5F27A 4B4CA 3IH4A 4XRMA 4A93J 5F1JA 1ZR2A 2W48A 4CYCB 4V2GA 1JKOC 3Q3SA 3S2HJ 5F0HA 3JRBA 2DMUA 1X2NA 1HF0A 3JR9A 5M3MJ 2L0KA 1I3QJ 1IUFA 5DTDA 1TWAJ 3GTQJ 4G12A 1PUFB 1TWHJ 3FKIJ 2ME6A 2EH3A 4M3FA 3HBLA 1E3OC 1IRZA 4AC0A 2HXIA 2M9HA 3TEDA 1NK3P 1AKHA 2ID3A 1OJLA 2FJ1A 4D5FA 3LOCA 1P7IA 2Y9YA 5C44J 2EBIA 1OCTC 3FK6A 1AU7A 2D5VA 4A3DJ 4FE4A 4Y7NJ 1JUSA 1DU0A 2COBA 5IP9J 3GBGA 2CUEA 2LKXA 3PO2J 3I4NJ 4A3FJ 2E1OA 2CRGA 4DZJA 2DMNA 2CQXA 2XB5A 1ZKGA 1FEXA 1UMQA 5IP7J 2HOAA 3NARA 5GP9A 3S17J 1AKHB 2VPRA 2NVQJ 3MKLA 3JRCA 2GLOA 5EEAA 1JKQC 2GM4A 1BA5A 2Y9ZA 1ORKA 1CQTA 2HOTA 2DA5A 3CCYA 3TP3A 1Q1VA 1RETA 5BNGA 1ETVA 3JRIA 2LD5A 5IYBJ 4IHXA 1SANA 1Z0XA 2IEKA 1U8BA 1ZR4A 2P81A 2WB1N 4LOCA 2R0QC 3QPSA 9ANTA 1H8AC 4BBRJ 4DW6A 4C3IJ 4D7NA 3SFIA 1LFUP 2Y2ZA 1MBHA 1MH4A 1JT0A 5EG0A 3LSJA 3S15J 4EEFG 1MSFC 3HKZN 2LTPA 2CUFA 3HOVJ 3H0GJ 5IYCJ 1AHDP 2R92J 1MSEC 3S16J 1BL0A 1H88C 3ZQFA 3GTLJ 1MBGA 4A3LJ 1T56A 5EZHA 4XK4A 1VI0A 4BXXJ 1SFOJ 5C4XJ 1ETKA 1EF4A 3I4MJ 2YS9A 2OF7A 1VF9A 5C4JJ 1GUUA 5J1YA 3ZQHA 2DA3A 5IOYA 2LFBA 5EG0B 2HQ5A 4V2FA 5M5YJ 3ZOBA 3S14J 2XRLA 3K2AA 4QSHA 2WAQN 3CMYA 2K40A 1RR7A 3HGGA 4XRSG 4L5EA 4S0HB 4A3JJ 1MNMC 4A3EJ 5IOZA 1IJWC 5FJ8J 1RPWA 1JGGA 5EGOA 1JKPC 5K7HA 1POGA 2VKVA 1B8IA 1JKRC 2WV1A 5F08A 4X1EA 2NVYJ 5FKLA 4A69C 5IYDJ 2JA7J 1IGNA 5E3LA 1WGXA 1RESA 3IH3A 3WHBA 4BY1J 1ITYA 1ETXA 1GVDA 1F43A 1FJLA 3S2DJ 2TCTA 2Y30A 3G1OA 3BR1A 1K61A 4FTHA 3BG3A 2O8KA 4JX4A 1APLC 3Q0WA 3BR0A 2JJ7A 5EGOB 5FLMJ 2LP0A 1B8IB 2XGEA 2JA5J 1Y1VJ 1HLVA 5K7FA 2N8GA 3H3VK 1MBJA 2JN6A 3BQYA 3B6AA 1IG7A 2IAIA 1IDZA 3TP0A 5EDNA 2E2JJ 2HI3A 1JTXA 1FTZA 2HXOA 3QQAA 3HOYJ 4D5CA 1R9TJ 2DMQA 3ZQIA 2XB0X 3S1NJ 2M0CA 1TWGJ 4M3DA 3DEWA 1HCRA 4M3GA 4FE7A 1I50J 1TC3C 2QF7A 2EQRA 3RKQA 2KDZA 3MVPA 1UHSA 1IDYA 1ETOA 1ETYA 1IV6A 3O8GA 2LY9A 2DA4A 4UUTA 3M4OJ 3NAUA 1RKWA 4JX6A 3GTOJ 2HYJA 3LSGA 1QRYA 2DMTA 2EZLA 1W0TA 3HM5A 5EF6A 1X2MA 1GT0C 3CDLA 2L7MP 5FKNA 4QTRA 1XG1A 3M3YJ 2FD5A 3RZDJ 1DU6A 3K7AJ 4A3IJ 2AO9A 5FKOA 4MLOA 1G2HA 5E3MA 1VNDA 3JRAA 1H89C 3RZOJ 1NK2P 1Z77A 3GTPJ 1K83J 2R7ZJ 2RAEA 1LFBA 2CU7A 3G1MA 3JRGA 3HOXJ 1YRNA 4XICA 1MH3A 2O9LA 4W1UA 2ZB9A 2E2IJ 2NS7A 4A3MJ 4BKXA 3CQZJ 4I6ZA 3PO3J 3JRDA 4XIDA 2R5YA 5GPCA 2FQ4A 5JLWA 2JMWA 3D1NI 3HB9A 4DYRA 4ABZA 2L7ZA 1JUMA 3Q0VA 2VI6A 2JWTA 5JLXA 1VFCA 3RQIA 3TW6A 2M8GX 1U9OA 2MG4A 3FISA 4IHVA 1U9NA 1YRNB 2K9SA 3DCFA 1MBEA 3HEFA 1GDTA 2Y31A 1JTYA 1JT6A 2O7OA 3SJMA 2EZHA 3S1RJ 1B72A 2H8RA 1A5JA 1HOMA 4XRSA 4C3HJ 3GTKJ 3A01A 2DMPA 1BJZA 2Y0SN 1MBKA 4DYQA 2XSDC 3LSPA 2R5YB 2VUMJ 3OIOA 2DTZA 4BBSJ 1X58A 3BTCA 2ECCA 4IHYA 1F36A 5EZGA 5EYRA 1ETQA 4MFEA 3HGYA 5FKMA 4B1RA 1QVUA 4A3CJ 3JREA 4A3GJ 1FTTA 1B72B 5J3LA 2JA6J 1HDPA 3BTIA 1XS9A 3A01B 1Y1WJ 1ZK8A 4W97A 2XPWA 4M6VA 1QVTA 4MIMA 1ETWA 4A3BJ 1WPKA 4D7MA 2CQQA 2CJJA 1TWCJ 1I6HJ 3BT9A 3GTJJ 1OCPA 1WI3A 1A6IA 3L1PA 1GV5A 3E7LA 3TW7A 5FLVA 2MGQA 5IP6A 2EZIA 1WH5A 3BR3A 1U78A 3BG5A 4C3JJ 2LK2A 3GTMJ 3OSGA 2ELKA 2LVSA 3IV5A 4MO7A 2ME0A 3HOWJ 2EZKA 2YU9J 2NOGA 5GPAA 1QPIA 2YUSA 1ZGWA 3BR6A 5E3OA 1OFCX 3VPRA 2DA1A 3PM1A 5IPAA 2OPTA 3C2BA 1BW6A 3LNQA 3UKGA 3OSFA 4RDUA 1HDDC 4IHWA 2L9RA 2QCOA 5F0FA 1W0UA 4Y52J 3S1MJ 2LLKA 5M3FJ 3ZQCA 4DYCA 1UG2A 1WCMJ 2IBDA 4I76A 5HODA 1XC5A 2H1KA 3A03A 4C2MJ 3ZQLA 2M2EA 4DZPA 2TRTA 2VKEA 3FK7A 2NVTJ 1JJ6C 2FX0A 3BQZA 4MFDA 2X48A 4AYBN 4AUXA 2DJNA 5DS9A 3F0CA 1P7JA 3IH2A 1O4XA 2ECBA 3O8HA 1JJ8C 1LE8A
chains in the Genus database with same CATH superfamily
1S7EA 1VQLI 4LFUA 4CH7A 2KFDA 2X9DA 2XKPA 1T98A 3AAFA 1ZHFA 2ESHA 4FQGA 4X6AJ 2IXSA 1E17A 1FIAA 2PMZN 2IS4A 5JI6A 3KPHA 4ZYGA 4FX4A 3BTLA 5JHFA 3CCUI 1VZ0A 3S93A 2VJJA 2L7KA 3HSRA 2HZDA 4B3AA 3N4MA 3B6CA 1ACIA 2ZJPF 2RN7A 3AG1H 5E20A 3QAHA 4WX9A 3OYJA 2KP6A 3NWSA 2M4GA 3Q0UA 4XLHA 3LSRA 4ZDOA 1XTAA 1IRFA 1MMSA 4KMFA 4NDLA 3J7AY 1RC9A 4M3EA 4UUSA 1LQ1A 3HDDA 5IT9Z 5BS6A 4ZZDA 2BW3A 3BDDA 3R0JA 5FROA 4LB6B 2YSRA 2OCEA 4J00A 3RDIA 3E6BA 2E7XA 3TO7A 1Y8RB 3F8NA 1EV7A 3LSMA 1P4XA 1Y6IA 3TBIA 2HFHA 4HEA2 2ZJ2A 2DI3A 2XPVA 4L9TA 2BVLA 1E3PA 4RAYA 2X6OA 4M6XA 4EJWA 4YRVA 1KQ8A 1DGRM 4RGXA 2VJ5A 2M7BA 1WFXA 2X1EA 4BY7J 2EIMH 5EJCA 3PUFA 4DBRA 1WH7A 5L3GA 3MN2A 3OYFA 4DIQA 2L2OA 5DYMA 4JX5A 1UZCA 1XDSA 1RKTA 5FFZA 4BDYA 3MEXA 1PUFA 4BNCA 3IH4A 1HKTA 2HR3A 4JBAA 5L3EA 4BEHA 3P7NA 4E7SA 4HQEA 3WTSC 3MFKA 1LUJB 3V7CA 4I09A 1J75A 2H94A 3EQLF 4MQVA 2DMUA 1X2NA 3I5UA 1FOXA 4G8XA 4A6EA 3LSTA 2JUGA 1IUFA 1BIBA 5DTDA 3QYFA 2FUG2 2EPFA 4YG2F 1WJDA 5KAFC 1OMIA 3GFIA 2QENA 2NYXA 2BHYA 3S8PA 3HBLA 3OWTA 3T8TA 3HSFA 1WJFA 4PJLA 2VQGA 4B43A 2M9HA 3DXJF 4D5FA 2EFOA 5J8FA 2JPBA 4KT6A 4E7KA 4GRIA 1LDJA 2EBIA 1QGPA 2DK8A 2L9NA 1AU7A 4J01A 1HW5A 3IP4B 4A3DJ 2HZTA 2CGPA 1JUSA 1DU0A 3ABTA 4P5OA 4Q47A 1NHAA 3DFGA 5LLQA 2WAQA 1TQPA 4XLFA 2IRFG 2CRGA 4DZJA 3OYHA 1YLFA 1DQUA 4ZDPA 4HRIA 3C18A 1PDNC 2P5KA 4GYIA 3IHUA 1AKHB 1IN5A 5CQEA 3KLNA 1YO5C 2BE5F 2VPRA 4M74A 4EJUA 4KITB 2VQHA 2M45A 4YEJA 1EJ9A 1MJBA 2Q2EA 3M1CA 4O5VA 2QYOA 1WJ5A 2RREA 4A12A 2OBPA 4IRIA 1SANA 2K27A 4YIFA 3KYCB 4A0YA 2LBFA 3W2WA 3P9KA 2D1VA 3IWFA 4D7NA 5FLXK 3MWMA 2Y2ZA 3WTXC 1NH3A 1MBHA 1MH4A 5CQGA 4OMZA 1ZREA 4CZCA 2M0MA 2ZXIA 4R79A 3HKZN 2W85A 3HOVJ 1X1DA 4Y17A 2DXIA 1ZG1A 4BHPA 1AHDP 1FT9A 3S16J 1BL0A 2P6SA 1H88C 3GTLJ 2M7AA 4A3LJ 1T56A 5DM7F 2LH9A 4PUSA 1W36C 1RUOA 5EZHA 5B66C 2LYCA 3RYRA 3BG7A 3NWTA 4BXXJ 3LA2A 1ETKA 4ENKA 3I4MJ 5B3SH 2HDCA 3GVAA 4RM2A 2XIGA 3N05A 3ZQHA 3F3XA 4OOIA 1I6XA 1R5HA 5M5YJ 3ZOBA 1R7JA 3S14J 4LIUA 1SAXA 1HC8A 3HGGA 3MCZA 4XRSG 4EM0B 2BV6A 4A3EJ 1MJAA 4D0PA 2KRHA 5FJ8J 1JGGA 3IRRA 2QQ9A 3VEPA 2NOJB 2VKVA 2ZXHA 1AA7A 1MKMA 2FBHA 4X1EA 5FKLA 2GXAA 2NRAC 4OIOF 2JRMA 5IYDJ 1IGNA 1WGXA 2STWA 2M5WA 3DBLB 1G6NA 3IH3A 3SDBA 1YG2A 3K1PA 1J9IA 4NBQA 2HWVA 2B7EA 1GVDA 2CFXA 2WY7Q 1FJLA 3OR2C 3S2DJ 2HPIA 3G1OA 3V42A 1B1BA 4ZYHA 3BG3A 2Z1DA 1ON1A 1NG6A 2FNPA 3PSIA 4ZTFA 5DM6F 1APLC 3O2PE 4Q48A 4CHUA 5FLMJ 3T1BA 1Z1DA 2XAUA 2E7WA 2ESNA 4RA2A 3QODA 1HLVA 1ZRFA 1Y0UA 3GMEA 1B9NA 2PMZA 4U0WA 2N8GA 4RB2C 2EV5A 3T0YA 3B6AA 4ON0A 1IG7A 5E1XA 2IAIA 5D4SA 3TP0A 3ISPA 2PMUA 1IZ1A 1JTXA 2QVOA 2A68F 3HOYJ 2MLGA 4D5CA 5KCMA 4RLFA 3QU6A 3EETA 3R4KA 3ZQIA 5GADJ 1YFHA 2XB0X 4H0EA 2IA0A 3EDPA 1HKSA 3DEWA 4IPAA 2ETHA 2PMHA 4YFNF 3QPHA 4C30A 3K9TA 2QF7A 3RKQA 2KDZA 3M07A 2HVSA 3KP2A 3GFLA 3E0JB 3H3UA 3J7ZI 2HQAA 3FX3A 4LK1F 3L00A 4EATA 2LY9A 3LSHA 4G6DA 2DA4A 4HF0A 4UUTA 3NAUA 3GTOJ 2HYJA 5GTIC 1QRYA 2FU4A 1D1CA 3IC7A 3C1DA 4ENNA 1XCVA 5FD6A 5AONA 3FXQA 2XF7A 3VOEA 2WY8Q 3CDLA 3B02A 4A5NA 2MH9A 5L3BA 2DPUA 4QTRA 2NS0A 2CYYA 3PFYA 3RZDJ 5E79C 5FKOA 3RKXA 1OYIA 5E3MA 4F55A 1H89C 5ILSA 3D5RC 1ZLKA 1NK2P 1Z77A 2D1HA 1K83J 3JSPA 2F5EA 3H0DA 4ASNA 1LFBA 2CU7A 4KN4X 3HOXJ 1YRNA 2KRFA 1MH3A 4W1UA 2HVQA 4XKWA 2VJ4A 3H3ZA 3CQZJ 1QBJA 2ICWG 3WU2C 4XIDA 4ZTJA 4I99C 4CXFA 2FQ4A 5JLWA 5J47A 5ICEA 4HQMA 4ABZA 1D0ZA 5JHUA 4PGHA 2JSCA 3HRTA 3TW6A 2MC3A 1XSVA 1B6AA 2IGMA 2KHMA 2R7DA 3ML6A 4RMNA 2E34A 4LITA 3S1RJ 1SD4A 2H8RA 3OYBA 5FLXZ 4BQQA 2JQ7A 3GTKJ 3A01A 2DMPA 3ASOH 2MFZA 2P0WA 3U9GA 5E17F 2LF7A 3K4MA 2R5YB 2CS3A 2WBMA 2Q8KA 1AWCA 2E1MC 1R1VA 3QP6A 1P4WA 4BJ5C 2DTZA 4BBSJ 1F36A 5J4YA 4HA8A 3FXRA 1ETQA 4P55A 3HL2A 2ZCWA 4B1RA 2QQBA 4A3CJ 3CESA 1DP3A 2AQEA 4CCOA 2GZWA 1LPQA 4B44A 1B72B 2X6WA 1IUYA 1HDPA 1BOBA 5IT3A 1R36A 1Y1WJ 2Y48A 2MA3A 1TQMA 4W97A 4NHJA 2X4HA 1QVTA 1ETWA 2LDUA 5L3DA 1SFKA 3OYCA 1HW2A 2CQQA 2CJJA 2PFBA 3QPTA 1TWCJ 2LC2A 4HAMA 3BT9A 1U6GA 3I54A 2UUZA 3S32A 2V6EA 1N77A 4XMYA 5LHHA 2O0YA 4B09A 4BQOA 3C7JA 1P2FA 1OKRA 1FSEA 1GV5A 3DLLF 1WSUA 5FLVA 4EJVA 2MGQA 1U5TA 2DBBA 2W4SA 2H09A 1J09A 2ZFUA 1WH5A 1F9NA 3JCUC 1SC7A 1Z05A 3G71I 1R49A 3BG5A 4NC7A 4UUVA 1QPMA 2W84A 3CLQA 3K69A 3WU1B 3OSGA 2ELKA 3EUKL 3I58A 3AFHA 4YIIA 1N78A 3HKZA 2ME0A 4MO7A 3PQJA 2W82A 3HOWJ 5E8IA 5LGTA 2DQLA 1FSHA 2LOOA 2IPQX 2VONA 2YUSA 4HYEA 1WHUA 2M1BA 4MTDA 3L2WA 4NC8A 1R58A 3PSFA 2WADA 1W7PB 2KKOA 3OSFA 1IN8A 3PL8A 4RDUA 3E5XA 1YTYA 2QCOA 5DEQA 3S1MJ 2Y75A 2LLKA 4BL0B 1J59A 1QA6A 4CDGA 2FA5A 3ZQCA 3ZQ7A 1WCMJ 4I76A 4HX7A 1BIAA 1U2WA 2NAZA 1XC5A 3MKZA 2P5LC 3ZQLA 4XN0A 4DZPA 2TRTA 3HUGB 3R6SA 1MD0A 2V1DA 3DKXA 3HTSB 2NVTJ 3FXJA 4C9YA 4MFDA 5BMZA 2K02A 4AYBN 1YIJI 3BCBA 5K5QA 2DK5A 1KONA 5LGNA 4LG0A 3OIPA 1JJ8C 4E7ZA 1D0XA 3G6EI 5GAEJ 2UZKA 3HPGA 2M34A 4YFKF 4UNOA 2NS8A 2NVUB 1WJAA 2DAOA 5DCMB 3V8JA 2JK3A 1TL8A 4KIGA 2Z9OA 2V9PA 3EUHA 3CCSI 3GZ5A 4I7HA 1MDMB 4IEJA 5AIPA 1JGSA 1TT0A 4QIWN 3OV8A 3FWEA 4F52A 3DTKA 3ZXSA 3DP7A 4IHTA 4XORA 3VYSB 2ZO4A 3WE3A 4AVZA 5L3CA 1AOYA 5E8GA 4OIPF 4Y4RA 1K6OA 3CTAA 2OUMA 4IXAA 1WVRA 2KT0A 3HRUA 5DDGA 3JW4A 3HPHA 3RPQA 4EMSA 1O3SA 2YR2A 1R5GA 1D5YA 1ENHA 3PJRA 1PJRA 2E19A 4IL6C 1ZGAA 3KP5A 2IGNA 1G3TA 3ZCOA 4PDKA 4O6JA 2E1CA 2DCEA 2K9NA 1YS6A 5CJ9A 2J5PA 4E4HA 4CYCA 1TTYA 2F48A 5HVQC 1IV8A 1T33A 2DFIA 1H9GA 2K9QA 2GBYA 3DU5A 5FKKA 3DU6A 5E3NA 3CMMA 4R8HA 3KP7A 4UUSB 2RC4A 1EH8A 4XN3A 4IO9F 2RNJA 2W57A 2M3AA 2BW3B 2R7RA 1NTCA 1TT5B 2QKMB 3JRFA 2K3PA 2L7FP 3WU0A 3ZMSA 2MBFA 4FCYA 3ZMDA 3OS0A 2BY3A 3HG9A 3KLOA 2KRCA 5F27A 3T5XA 4B4CA 4XRMA 4II2A 4HZFA 2ELHA 3DLAA 1ZR2A 3BPXA 2W48A 3F8CA 1IXSB 2GA2A 1XB4A 2OV7A 2HYGD 4A5MA 2M4KA 1Y8QB 1S7AA 1M1EB 3I53A 4I98B 1TNTA 3JRBA 1K4SA 3LAPA 1ZG3A 3A0HC 4AIJA 3CJNA 2Q1ZB 5M3MJ 5CLSA 3P9CA 3COAC 3F8BA 3L2QA 4ESBA 1TWAJ 2A6TA 3M8FA 2G7UA 1PUFB 4HBLA 1TWHJ 5HS7A 2CWEA 3PQKA 4PJ0C 2ZJRF 1F1ZA 3JTHA 2EH3A 4EGYA 1E3OC 3RYPA 4BEHB 1JHHA 1J0RA 2X51A 2STTA 1P9QC 2DYRH 3RQ4A 3TEDA 1OJLA 2R7XA 1YX3A 1V55H 1W5SA 1P4AA 3ECOA 1BR2A 3CC7I 3PFIA 4MEYF 4RAGA 4UB8C 4BXUA 3LQRA 2WAEA 3DQVC 1SMYF 4FE4A 3S3OA 4Y7NJ 3MD2A 2LKXA 1J2XA 1LEBA 4KICA 4A3FJ 2E1OA 2COMA 2RKHA 1CF7A 2BY2A 2DW4A 4A0XA 2CQXA 4BHBA 1YHQI 2XB5A 3HOSA 1FEXA 1ZH5A 1YW9A 4FT8A 3NARA 4XOPA 4E7IA 2FEZA 3S17J 3TQNA 4XSXF 1VTNC 3PIPF 3QU3A 2MABA 1IN6A 1LJ9A 2CO5A 4RAFA 1KZHA 4KT5C 5LBQA 3M7GA 2NVQJ 2GLOA 4V19K 2CQNA 2Y9ZA 1JE8A 1CQTA 1T8IA 1HW1A 2DOAA 2QA4I 1RETA 5BNGA 1XX5A 1GXQA 2VC0A 3JRIA 2LD5A 4BHCA 2P81A 3TL4X 2R0QC 3DBHB 4LLGF 4AIDA 1H8AC 3OOPA 1I1SA 4AD9A 3K4CA 4Y33A 4P9FA 3UR3C 2P7VB 4L9VA 2F4OB 4XLAA 4IRHA 1W5CC 5F64A 3MZHA 3VYUB 2E71A 5HLTA 1MSFC 1UB9A 2VODA 2LTPA 1ERDA 3H0GJ 3ZN1A 2Q2EB 1QNTA 1OR7A 1L0OC 1N25A 2FXAA 1WJCA 1BJAA 4GXOA 4LLNA 3CCRI 1WJBA 2LY2A 3K4JA 4OAYA 2WAFA 3OYAA 3DTEA 2K7LA 2HDWA 3EPZA 4XK4A 1VI0A 2LBFB 1SFOJ 2EWNA 1K4TA 1BR4A 3W2AA 2KQRA 3G2BA 2OF7A 3OY9A 1D8JA 3OYIA 2EINH 3OYDA 5J1YA 2X1DA 2LFBA 3KYDB 4V2FA 3CO6C 3VYRB 3K2AA 1A6QA 5B1BH 2K40A 1RR7A 4L5EA 1KYWA 2ISYA 2H27A 2O8XA 4A3JJ 4BE1A 3HZJA 1HSTA 3E5QA 5TISC 4ETSA 5IOZA 4U7DA 2E1NA 2P7CB 5K5OA 4AVPA 2FSWA 5K7HA 2E60A 1B8IA 1WQ2A 2VT2A 2WV1A 3K6GA 5F08A 4RM3A 4IKFA 2FBIA 1XGOA 5D8KB 3E6MA 3WHBA 4M73A 2QEXI 4AYBA 1BI0A 1LNWA 2E36A 4K2EA 3GLXA 1Z3XA 3FXLA 3HXLA 3IAS2 4FX0A 5LRRA 2KLOA 1Z6RA 5LEJA 4JX4A 1JI8A 2BXZA 2DPDA 2VE9A 3P5JA 3Q0WA 3BR0A 2JJ7A 3VFZA 1TNSA 3TOAA 4JQFA 4XR6A 4WWCA 4L5IA 1KYZA 4DGWB 2JSPA 2QLZA 5J8CA 3OL4A 2FF4A 2TDXA 1WRJA 3KYLA 2GWRA 1RRJA 3U1DA 5DCFA 3I4PA 3G73A 3IKVA 1QZYA 2JT1A 1O7FA 1DDNA 2A5WA 1TW2A 1OLTA 1SAUA 1FTZA 2HXOA 2R7UA 2B9SA 1R9TJ 2OZUA 2M30A 3LA3A 4BS9A 2RV8A 5JR3A 2A3SA 3ESWB 3CCQI 2M0CA 1KA8A 2AXLA 4M3DA 1FP2A 2DFFA 2LY1A 4HPQA 3KZYA 4FE7A 1I50J 1T08B 2EFPA 4XLEA 1ZN2A 3MVPA 1D8KA 3E1SA 4KIBA 2JZYA 1T95A 4N9IA 3ZR8X 1ETOA 1ETYA 1FOYA 1IV6A 3O8GA 1WJEA 2P5VA 2F5VA 4NQWA 3T8RA 4E6KG 4JX6A 3KFWX 3CO7C 5BPIA 3HC7A 2DMTA 1JXSA 3FKJA 2EZLA 4PJJA 4UVCA 1W0TA 1X2MA 2X1CA 2HS5A 1I27A 3D0SA 1STZA 4UB6C 1T39A 1GT0C 4XSZF 4UV8A 5CVJA 3TDZC 1XG1A 1OCRH 1G8XA 3OR1C 2AO9A 4IHSA 1USSA 2CSOA 1FC3A 1H9TA 3JRAA 2X85A 3DBRB 2R7ZJ 4HV5A 3H5NA 5TRDA 2RAEA 3A1YA 4C2TA 1A31A 4D1QA 2OCCH 2V9KA 1SFUA 1YYVA 3LFKA 3GLLA 4PSXA 1W36D 3ZMUA 2K4JA 2MLKA 5LHIA 1DUXC 4X0GA 4BKXA 3PO3J 1IXCA 3JRDA 1O57A 2PEXA 3VSKA 2GA1A 4LK0F 1XMKA 2XRNA 2M87A 5ICCA 1KQ9A 4DYRA 2VBWA 1FOKA 1YW7A 1R1TA 2F2EA 4G6TB 3UNGC 3OYEA 2QUFA 3RQIA 2M8GX 1U9OA 3TOBA 2R3SA 2VC1A 1G59A 1LB2A 2CW0F 3KEQA 5DV5A 1Z7LA 1IF1A 1YRNB 4IHVA 3EYYA 2CMPA 1MBEA 3HRMA 1GDTA 2KPMA 4XKCA 1JTYA 2O7OA 3BP8A 5FB2A 2EZHA 4XRSA 2V1XA 2L5QA 3C2HA 2RGVA 2EIJH 2M8EA 1T0FA 2ZMEA 3H9JA 3X2QH 3BWGA 4DYQA 2PX9A 1ZRDA 3GW2A 1FX7A 4OU0A 4PFPA 3CDHA 1YITI 3HIFA 1ON2A 1X58A 2ECCA 2I5UA 2UXXA 2Y0MA 4F3QA 5FGMA 2OU2A 3CJRB 4OMYA 4BE0A 1UHMA 4CZZA 4A3GJ 1FTTA 2A5YB 5J3LA 3SHFA 4E7JA 1ZLJA 3A01B 1BM9A 4CA0A 2XPWA 4ESFA 5AIQA 3LA7A 1PYVA 1LKXA 1VQOI 3H35A 1J7KA 3H9QA 2F4IA 2ISZA 2FQ3A 3MMYB 1I6HJ 1YS7A 1OCPA 2VKHA 1WI3A 3K1NA 2A05A 2EILH 2IT0A 3TW7A 2IJLA 4TV7A 1BOAA 1R71A 2ADUA 2XVCA 1X4PA 4CSWA 1U78A 4WK8F 3MZYA 1XD7A 4C3JJ 1MNDA 4HSRA 5J4VA 2K85A 1F5TA 3BPVA 4WXHA 2YU9J 5GPAA 1QPIA 3TGNA 1ZGWA 3BR6A 2H1LA 3I55I 2LG4A 5HOOA 4B3XA 3ABLH 1QU3A 3C2BA 5KHDA 1Z6TA 1SD7A 3GX4X 2CG4A 4B47A 2L9VA 1QQIA 1G3WA 1U5TB 2GOMA 3QYEA 4Y52J 4BE2A 4XKVA 4IRGA 2JVGA 2IA2A 1ZARA 5HODA 2H1KA 3A03A 4EGZA 3FK7A 3RI4A 3ZN0A 1JJ6C 2FX0A 3BQZA 1Q1HA 2X48A 3ABUA 4HLXA 3W2VA 2XAGA 1OYYA 3IH2A 3U21A 1O4XA 2ECBA 2IS2A 2VIXA 1LE8A 3JTGA 5BOXA 2L4AA 2XDVA 5E18F 4HNVA 4CCNA 2VT3A 3FBIB 3F72A 2W00A 3I9V2 1SMTA 1ZTRA 2R4GA 2WA0A 1BW5A 1SVOA 2HKOA 3WHCA 4EM2A 2DN0A 3D5SC 2MW8A 1H0MA 1I1GA 1MIJA 3DV8A 1F4KA 3FXUA 3GWZA 4FISA 1BC8C 4U0YA 3L9FA 5E1WA 4LG0B 4UV9A 3JRHA 4JYKA 3ZQGA 4N4NB 2DA7A 2DYSH 2FBKA 2R5ZA 2XROA 2CW8A 1MBFA 1GLNA 2PI0A 3HOUJ 2O61A 3MKWB 2P6TA 2XPUA 3I59A 4EVIA 1FIPA 3L09A 1O7LA 1KGSA 3E6CC 3N97A 2VASA 3BR2A 3SDGA 2ZSIB 2NVXJ 3PNVA 2XGDA 4JP0A 5GAHJ 5C3EJ 5J1UA 1BI1A 2KIUA 1O3QA 3O6BB 3FHNA 4CCKA 1FY7A 3WTUC 1ODDA 4WXCA 3WTZA 3S1QJ 4KISA 2EFWA 4KNYA 2A61A 4GGGA 1VQKI 2F5FA 5F0CA 3GXOA 3GTGJ 1HQCA 2QWWA 3GEZA 3R0AA 4GFBA 4BAYA 4BU2A 2AS5F 2A07F 2R7WA 2IGOA 3QPLA 1JUPA 3G4SI 2LR8A 2I10A 4YELA 1SD5A 4MGRA 4QPQA 1FBQA 3ZP5A 2XF6A 4EJOA 2R93J 5B5EC 5J1RA 1YJ9I 1R6RA 3HRSA 2OC6A 5J6XA 3HHHA 2HOSA 1XGSA 4JK1X 2XGCA 2AXTC 5KNLA 1TWFJ 3W6JB 5F1JA 5HNFA 2YX7A 4CYCB 3BLYA 4V2GA 3ULQB 1TZLA 3KZZA 3H5RA 4ENMA 2XGXA 1IRGA 2YU3A 2KIQA 2PN6A 3GYHX 3JR9A 2H8WA 2ZXJA 3KE2A 2BHZA 2OD5A 2H6BA 3WTVC 3CZ6A 4ZZLA 3K1MA 5ED4A 2RQQA 2Y69H 1OR7C 2VB6A 4UY8I 4II3A 2CH0A 2ME6A 1ZRCA 1IRZA 1MW7A 4AC0A 3MQ0A 3RCOA 3K4LA 3L2CA 2CUZA 2HXIA 4LD5A 1HKQA 1NK3P 1Y0NA 2BOLA 2FJ1A 1PVEA 3WTWC 2KISA 2ZNZA 2EK5A 2WC2A 1P7IA 2Y9YA 5C44J 3DWLE 3FK6A 2D5VA 4H4KC 3DPLC 1V5EA 5IP9J 1RZ4A 3ECHA 2VBZA 3PO2J 3IWZA 3TDUC 1FMVA 2K3FA 3DTIA 2OTLI 4KMUX 2DMNA 1R5ID 2F6CA 4XLCA 2OJED 4FHTA 4OINF 1BN5A 2QZ8A 5L3FA 1FBUA 4F92B 1VQ4I 3F23A 1PUEE 1UMQA 2DT6A 5IP7J 2DQRA 1D1AA 3ERMA 4KFCA 5GP9A 1RR8C 1TLHB 6PAXA 3AG2H 5CYVA 1MMAA 3JRCA 2HYFA 1JKQC 4PFOA 1KU2A 4E70A 1BA5A 3OYNA 2E5ZA 1Z9CA 1K78A 2HOTA 1E2XA 2DA5A 2G7HA 3CCYA 3TP3A 3WG9A 4D9JA 3DEEA 1ETVA 1X1CA 5IYBJ 4HDVA 4IHXA 1Z0XA 2IEKA 3HHGA 5LRSA 1ZR4A 1CF7B 2WB1N 4M6YA 3QPSA 9ANTA 3TKYA 4BBRJ 4C3IJ 4G94A 4CCMA 3RKYA 5D5VB 1OCOH 2W25A 1IN4A 4Z2YA 1V4RA 1ZYRF 4WXDA 1ZG5A 3KETA 5EG0A 1C0WA 1DGWY 2IGKA 3LSIA 1I3AA 3S15J 3DPUA 4EEFG 3A0BC 1J5YA 3GCMA 1LDKB 3BCAA 1RIOH 2DFEA 1QHGA 2R92J 2CQKA 4LB5A 1MSEC 4RLQA 2EB7A 2LSOA 2CV2A 2ZXWH 1XMAA 3I64A 4ZJZA 4PJMA 2V1UA 5C4XJ 1EF4A 1R4MB 3V4GA 1EKEA 4KIFA 3FXKA 5C4JJ 2UV1A 4AU7A 3V8KA 2DA3A 2F5CA 5IOYA 1VQ7I 4BGDA 5CVUA 2QQ8A 3KP6A 1B59A 1EH7A 3QWLA 4QSHA 2WAQN 3CMYA 2OQRA 2BEOA 1MNMC 2E35A 2HU9A 3KCCA 4HOBA 4LIVA 2EA4A 4U0VA 1IO2A 5ERIA 1RPWA 4DNCA 1VQ8I 5EGOA 1X3WB 4HX8A 3I3LA 1POGA 2QBYA 3HSEA 1JKRC 4IJAA 1X19A 1B9MA 2NVYJ 4A69C 5B1AH 2JA7J 2V6CA 1BI2A 2RVCA 3REOA 3L2RA 4ZYEA 2MYSA 2X6YA 1ETXA 2UWMA 3QP5A 1F43A 2BY0A 3FHZA 2TCTA 3SYTA 5H6QA 2A69F 2PJRA 1VQMI 2O8KA 4BH9A 2MC4A 1FYMA 2LNBA 3MAJA 1K6YA 2HQNA 2HQRA 2LP0A 2P4WA 4M72A 3RPUD 3K70D 1B8IB 3CCEI 2XGEA 1Y1VJ 3OYLA 2LKSA 3PNYA 4ESJA 3WODF 4HNTA 4YIRX 1LVAA 4Q4ZF 2A6HF 1MBJA 1OPCA 2BVMA 4RS8A 5HNHA 2ZNYA 3E6DA 1KQ0A 3KIOA 3ABMH 3E3VA 3GO5A 4Q5SF 3RIRA 3CCJI 3HTUA 4FASD 2DTRA 3CF5F 1FZPB 5LD2C 5HDNA 3J7AO 2HGCA 2PBIA 3LSKA 5D8LB 3S1NJ 3NRVA 2Z5UA 1D0YA 3M8JA 4G7ZF 1T0FC 4M3GA 1TC3C 1K7AA 3GFJA 1VQ9I 1SEUA 1HSJA 3W6KB 1OISA 4C2UA 4IQ4A 1UHSA 4HV6A 2OTJI 3OS1A 3IKTA 5D6EA 3M4OJ 4OAZA 5HLIA 4IX7A 2FMYA 3LSGA 2F5DA 4P1WA 1ZGJA 3EUAA 5KVRA 3SEQA 3V8LA 1YJNI 2NNYA 4L0ZB 3AL0B 5FD5A 5EF6A 2HVRA 1VQNI 5E1ZB 1KU9A 2XV4S 1V5FA 1Z3YA 1SD6A 2RNGA 3FDYA 3RTRA 2L7MP 3SZPA 2V9VA 4HW0A 1G2HA 1QO0D 1VNDA 2HPMA 2IA1A 3GTPJ 1OQYA 2PLYA 2V7FA 3JRGA 1YW8A 1IXRC 4PK4A 4EM1A 2FE3A 1UJ8A 4CCJA 4NQWB 4RB3C 3LQQA 2ZB9A 2DODA 2ZSHB 2NS7A 1OYWA 4I6ZA 2FNAA 1Z91A 2KDOA 1MMNA 4PZJA 2V26A 4WCGA 4A2UA 1UELB 2JMWA 3CUQA 2GAUA 2JPCA 2L7ZA 4RGUA 5FRNA 2XC7A 5H2FC 1E3HA 4EJTA 2VI6A 2JWTA 2XUBA 1VFCA 3TO9A 3WGHA 1UAAA 2KJBA 2MG4A 3FISA 1RI7A 1U9NA 3FXOA 3SQNA 2Y31A 1JT6A 4U87A 3SJMA 3SFZA 1HOMA 4WF2A 3M8EA 5FFXA 1XMXA 3SEZA 2Y0SN 2X0LA 5HS9A 4U88A 1MBKA 2DDBA 2XSDC 3LSPA 4BACA 4MTEA 2VUMJ 3F6VA 2DT7B 2Z33A 2L02A 1ZELA 3BTCA 3FZVA 3GF2A 1U8RA 4DQ2A 5EZGA 3WG7H 1VQ6I 5EYRA 3NEUA 3SZTA 3IL2A 1QZEA 3HGYA 3QYBA 2V1NA 5HDKA 5FKMA 4MEXF 1QVUA 1BR1A 4S05A 3ERED 3AG4H 3OL3A 3L2UA 1R4NB 2JA6J 1UFMA 4YFXF 4BXFA 2V79A 5CKTA 1ZK8A 2ZMEB 4CICA 4F7ZA 3VDXA 4A3BJ 3U2RA 2FOKA 3P9IA 2L54A 4EQQA 4ZYDA 2GIVA 2R7VA 4AM3A 5KAIC 1XSDA 3E7LA 2WB1A 3B73A 1O3TA 3CUOA 1NG7A 5IP6A 2EZIA 1FBSA 3ZGKA 3G3ZA 3LFUA 2EIKH 1SVLA 2XAJA 3BR3A 4E7LA 2LK2A 1IRXA 2LVSA 2QSFX 5LFAA 2NOGA 3Q5FA 1G4DA 3RJPA 2WV0A 5E3OA 1TBXA 4LJZF 4O3MA 5IPAA 3V7RA 2L3DA 3C2GA 1BW6A 3LNQA 4IZZA 3UKGA 1LVKA 3K4KA 1HDDC 3KZIC 3QOPA 5F0FA 5D5WB 3WTYC 5M3FJ 2VBYA 2VLAA 3L7WA 3MZ8A 4DYCA 2IBDA 1S6LA 4C2MJ 1W4MA 2XF5A 2DFHA 2R7TA 1IAWA 1VQ5I 4UVBA 5CVRA 3S3MA 4AUXA 3K2ZA 1A04A 5DS9A 3F0CA 4BQAA 1A35A 4G6QA 1GHCA 3GFMA 3AG3H 2EV6A 1XDUA 3BY6A 2HKXA 3O8HA 5H20A 4BUPA 3WTTC 2ZKZA 4NC6A 3CLOA 2DA6A 1FYLA 1KU3A 4MNUA 2AQFA 1U3EM 3BJ6A 4OIRF 2EJRA 2GXGA 2DA2A 1XPXA 1OCCH 4FETA 2ZC2A 3A02A 3BR5A 3CMAI 4IF4A 1ZQ3P 1BBYA 2VQCA 2HDDA 3FIWA 1U5TC 3BTJA 4ANJA 4ZDLA 5H6RA 5GTHC 3FM5A 5F04A 3KEYA 3Q9VA 5HLHA 1MMDA 4M71A 4XKBA 4G7HF 4A3KJ 3WGGA 1FMWA 1LE8B 1ONVA 5TGTA 1L3LA 2NNNA 3CCMI 2O3FA 2G0EA 3OOUA 4LMYA 3R60A 4B48A 3JAMK 3G1LA 2R7QA 4N9HA 4PCQA 2CQ7A 2FMLA 2AHQA 1IW7F 1YOVB 4HF2A 3BZCA 4RBOA 1LFPA 3BG9A 4XQFA 3RPUA 2R7SA 2BGCA 2PQ8A 5ICFA 3RKWA 3F22A 1UG0A 4LLLA 4RB0A 2JA8J 4J19A 1A36A 2HEOA 1S8NA 2XAQA 2ID6A 4IOCF 2R5ZB 4NNJA 5K7ZA 1IC8A 3DF8A 1GV2A 2NXNB 4BJ6C 4Y3OA 3SXYA 3ZMVA 4KDPA 2GIZA 3I59B 3W6VA 3U1KA 3SZGA 3PIOF 1ULYA 2E2HJ 4M3BA 1WZ2A 4MQ9F 1Y56A 4M9ZA 5DD8A 3ZMTA 4I02A 5M5WJ 3HOZJ 5M5XJ 2B63J 2MH2A 1OCZH 4IQJA 3VYTB 2DU9A 3EUHC 1T2KA 2MSYA 3ABKH 4A93J 1R23A 4Y13A 2IVMA 4G7OF 3E5UA 1JKOC 3Q3SA 1EA3A 5KK1A 3F6OA 3S2HJ 4XRFA 4XL9A 3CDIA 3D5LA 4ITVA 5F0HA 5DD4A 1HF0A 2KIMA 2L0KA 1I3QJ 2KJCA 3GUDA 3WGIA 2OA4A 3GTQJ 4G12A 5BQTA 5IY5H 3FKIJ 3H9GA 3OMYA 4M3FA 1QZZA 2QQAA 2D45A 4KYWA 4Y15A 3J80K 4CCLA 4KJZA 4S04A 2QM3A 1AKHA 2ID3A 1P92A 2J5OA 3VSLA 1VQPI 2VJIA 1G3YA 3S2WA 1S3JA 5F6FA 3LAJA 3LOCA 2BZTA 4XONA 5HS8A 4XBFA 5J40A 4XLPF 1OCTC 3Q9SA 2Z16A 2XSJC 3FF5A 2COBA 2GOXB 3GBGA 5FRMA 3L2VA 2CUEA 1S9HA 1P6RA 2D2WA 3I4NJ 4L9NA 3CC2I 2OQGA 2DJIA 2A6EF 2X6XA 2EV0A 2KIFA 2YX4A 4XM3A 2VE8A 2K86A 3K4BA 3HJEA 1ZKGA 3I71A 3CC4I 1DPRA 2FRHA 2HOAA 2Y0SA 2CV1A 3J81K 4RAZA 2PJPA 3H1CA 3CMEI 1R00A 2O6GE 1BI3A 3MKLA 1W7PD 5EEAA 2GM4A 1HA8A 2O5RA 4PGGA 1ORKA 4IVNA 4LGWA 4B8XA 1XGMA 3KEOA 1R22A 1FYKA 4GYGA 4OIQF 2LKPA 1Q1VA 2R7OA 4CO8A 5CVIA 4I0BA 4ZYAA 4P9UA 1Z21A 3CCVI 1U8BA 5LEKA 4LOCA 3FXMA 2GXBA 4JOMA 2QKLB 4DW6A 4XLNF 2E5NA 2O03A 2RQPA 3SFIA 1LFUP 3AKZA 3FMRA 2OAZA 4L5JA 1JT0A 3IAM2 2IS1A 1X3UA 1S7OA 3OYKA 3LSJA 5FO5A 2MD5A 1S72I 5EEHA 2CUFA 1GVJA 3K4NA 2K9LA 5A2QK 1ZAOA 5IYCJ 2L4MA 1K78B 2XAFA 1X1AA 3ZQFA 1MBGA 4I01A 3OIQA 5EEGA 2LF8A 3CJQB 2L01A 1V3FA 1V5GA 1CGPA 3FMSA 1TQIA 1R1UA 2YS9A 1B4AA 2EFNA 4ENJA 1VF9A 3I56I 3I0TA 1GUUA 1XCBA 1JHFA 1D1BA 4CUGA 5EG0B 2HQ5A 2XRLA 2OZ6A 3KP3A 3H5AA 2JUCA 2JRTA 4M9SA 4S0HB 2BXYA 4HDUA 4AIHA 2ACJA 3CD6I 1IJWC 2G9WA 3C3WA 1UHWA 3BC8A 3EYIA 2JTVA 1JKPC 4R1HA 2BY1A 4XOTA 4ZC3A 2WTEA 4N4OB 3JAMZ 1X1BA 1S5LC 3HYIA 4KN7X 5E3LA 4QWQA 1YQAA 1RESA 2RDPA 4BY1J 1ITYA 1YE9A 4E7HA 2C6YA 2P8TA 3VWBA 4HG2A 5D6FA 3IUOA 1IN7A 2Y30A 1FPQA 1DP7P 3BR1A 5TJJA 1XGNA 2HNHA 1K61A 2KL4A 4FTHA 1D3YA 2VKDA 5DUKA 2HTJA 5EGOB 1Z67A 5BPDA 4L0YB 2QBYB 4P96A 2JA5J 5F1RA 4PJNA 1X3ZB 1XSXA 4KUMA 3A4CA 3S3NA 2VOPA 5K7FA 2HTSA 4KA4A 4EV0A 3H3VK 5ILVA 5ILUA 3HOTA 1WWXA 2JN6A 3BQYA 3CUQC 4I0AA 1IDZA 5D5UB 2VXDA 1YI2I 2VBXA 3R61A 5EDNA 2PJRB 2E2JJ 2HI3A 4XNFA 1UCRA 3QQAA 2DMQA 2H6CA 1MNEA 1WKMA 3GZ6A 4RGRA 3VB2A 4HSTA 1USTA 1PP8F 2ZJQF 1TWGJ 1HCRA 2K5CA 3CCLI 1KU7A 3BROA 1MGTA 2EQRA 1N75A 2JVHA 1MZBA 4UXNA 2VN2A 1Y39A 1IDYA 2W24A 3QOEA 2CV0A 2ELJA 4AWXB 2V4JC 2KMUA 2ZBKA 1RKWA 4Z6YA 3KX2A 4A6DA 2LREA 3J80Z 5JFRA 1SVMA 3J7YJ 3HM5A 2ZFWA 2PG4A 2L9SA 4NUBA 5IT9K 2MD0A 4RB1A 3F21A 1DPUA 5FKNA 1GXPA 3O3KA 2JA2A 3M3YJ 1RUNA 2FD5A 1DU6A 3K7AJ 4BJTA 4A3IJ 3CF2A 4MLOA 1LDDA 3OYGA 3RZOJ 4OWRB 3K0LA 4GDFA 4UHTA 1TW3A 2F4MB 3CP2A 3G1MA 1RNLA 4BQNA 5DUIA 1FP1D 4XICA 3LL7A 3IRQA 2XAHA 2QSGX 2DOFA 3WE2A 2O9LA 2E1MB 5LGUA 1EH6A 2E2IJ 4L18B 4A3MJ 2HOEA 3TO6A 1REPC 3BG6A 3J81Z 2IW5A 2IP2A 2B0LA 3E97A 4QLCU 5GPCA 2R5YA 5K1YA 3D1NI 3HB9A 1I5ZA 1JUMA 2I8DA 3Q0VA 1XN7A 5JLXA 3W3CA 3AL0C 4CYDA 3F9KA 3V7SA 4DOZA 4DBQA 4G9YA 5LHGA 2K9SA 3BZ6A 3DCFA 1W1WE 2UXNA 2CUJA 1BC7C 4BDZA 4IOAF 3DKWA 1D5VA 3FM3A 3HEFA 2XASA 3M9AA 4BYYA 1B72A 1A5JA 2DDAA 3DEUA 1X1PA 2WWYA 4C3HJ 1BJZA 1TP4A 2DOEA 2CFOA 3FBNB 3DPTA 2VQLA 1G3SA 1Z7UA 3CJTB 1SFXA 4M9XA 3QRFF 2KZVA 3A2KA 2W1OA 3CUQB 4QPOA 3OIOA 2Z3YA 4HF1A 5A2QZ 1MJ9A 3VODA 4IHYA 2R7FA 3BJAA 1SFEA 4MFEA 2XHKA 3MKYB 4PSWA 2K9MA 4NB5A 4L9JA 4F93B 4A0ZA 1FWZA 1X4OA 3CP8A 3ZRGA 2DT5A 2LMDA 2Q0OA 5CVVA 5HLGA 3JREA 4AIKA 1K79A 3ROUA 2W7NA 1W5TA 3H92A 3KP4A 1U0JA 2DLLA 5D4RA 1XS9A 3BTIA 1FOWA 3DKYA 3OS2A 4CGZA 2CW7A 2XKOA 3GZNB 4ZH4F 3F8FA 4M6VA 3ZMZA 2LRDA 3LMMA 4MIMA 3ELKA 1WPKA 3LWFA 4HLYA 4D7MA 1LEAA 4F91B 2QGUA 4N0BA 1WI9A 3JSOA 4GO1A 2VOOA 4DJAA 3GTJJ 1V54H 1YX5A 2EA2A 1A6IA 1W7PA 3L1PA 2Z2SB 5D5XB 1I39A 4I2OA 1T38A 3BZKA 3BJOA 4RGSA 3F8MA 3RSNA 4UVAA 5GAGJ 3GTMJ 1FNNA 1QHHD 3HUGA 3M1EA 4MHGA 5CPRB 3IV5A 4HNUA 1O3RA 3BOQA 1MMGA 2EZKA 3PUBA 3K70C 3K10A 2IS6A 1PP7U 3ZPLA 1OFCX 1E0EA 3VPRA 2DA1A 3PM1A 3H36A 1T6SA 2ZMEC 2OPTA 3NQOA 2K4BA 1YJWI 2VPLA 4GCVA 2EFQA 2GQQA 1FLIA 5HDGA 3PNTA 4IHWA 2BBYA 2L9RA 2VL8A 5DCMA 1W0UA 4LG3A 1HBXG 2BYVE 3FMQA 1HXDA 2DO7A 3ONQA 5K5RA 1UG2A 2FOWA 1YIOA 1MDMA 2M2EA 2VKEA 2KZGA 5JVTA 3OYMA 3ZQQA 2DJNA 2Z99A 3TMOA 4U7BA 2QSHX 2VXZA 1P7JA 4HX4A 5JVGF 3ASNH 5ICGA 2YPRA 1S29A
chains in the Genus database with same CATH topology
1S7EA 2DA6A 2M34A 4HNVA 2NS8A 2X9DA 2DA2A 1ZTRA 2JK3A 1BW5A 4X6AJ 3A02A 1FIAA 3WHCA 3BR5A 2DN0A 2PMZN 2MW8A 4IEJA 1ZQ3P 4QIWN 3BTLA 2HDDA 3FIWA 3BTJA 4FISA 5F04A 4B3AA 3JRHA 3B6CA 4JYKA 3ZQGA 4A3KJ 2DA7A 2R5ZA 1LE8B 3Q0UA 2KT0A 1MBFA 3HOUJ 2G0EA 3OOUA 3LSRA 2XPUA 3G1LA 4NDLA 1FIPA 2AHQA 1D5YA 4M3EA 1ENHA 4UUSA 3HDDA 4RBOA 3BG9A 3BR2A 3SDGA 2NVXJ 2XGDA 4JP0A 2E19A 5C3EJ 5J1UA 2JA8J 4J19A 3S1QJ 2K9NA 2ID6A 2R5ZB 5F0CA 5K7ZA 2XPVA 4CYCA 1IC8A 3GTGJ 1GV2A 2X6OA 4GFBA 3W6VA 1T33A 2K9QA 3QPLA 1JUPA 2GBYA 2LR8A 5FKKA 2I10A 5E3NA 2E2HJ 4BY7J 4M3BA 4UUSB 1WH7A 3MN2A 2R93J 1NTCA 5M5WJ 3HOZJ 3JRFA 2L7FP 5J1RA 5M5XJ 2B63J 4FCYA 4JX5A 1RKTA 2HOSA 2XGCA 1PUFA 2MSYA 1TWFJ 5F27A 4B4CA 3IH4A 4XRMA 4A93J 5F1JA 1ZR2A 2W48A 4CYCB 4V2GA 1JKOC 3Q3SA 3S2HJ 5F0HA 3JRBA 2DMUA 1X2NA 1HF0A 3JR9A 5M3MJ 2L0KA 1I3QJ 1IUFA 5DTDA 1TWAJ 3GTQJ 4G12A 1PUFB 1TWHJ 3FKIJ 2ME6A 2EH3A 4M3FA 3HBLA 1E3OC 1IRZA 4AC0A 2HXIA 2M9HA 3TEDA 1NK3P 1AKHA 2ID3A 1OJLA 2FJ1A 4D5FA 3LOCA 1P7IA 2Y9YA 5C44J 2EBIA 1OCTC 3FK6A 1AU7A 2D5VA 4A3DJ 4FE4A 4Y7NJ 1JUSA 1DU0A 2COBA 5IP9J 3GBGA 2CUEA 2LKXA 3PO2J 3I4NJ 4A3FJ 2E1OA 2CRGA 4DZJA 2DMNA 2CQXA 2XB5A 1ZKGA 1FEXA 1UMQA 5IP7J 2HOAA 3NARA 5GP9A 3S17J 1AKHB 2VPRA 2NVQJ 3MKLA 3JRCA 2GLOA 5EEAA 1JKQC 2GM4A 1BA5A 2Y9ZA 1ORKA 1CQTA 2HOTA 2DA5A 3CCYA 3TP3A 1Q1VA 1RETA 5BNGA 1ETVA 3JRIA 2LD5A 5IYBJ 4IHXA 1SANA 1Z0XA 2IEKA 1U8BA 1ZR4A 2P81A 2WB1N 4LOCA 2R0QC 3QPSA 9ANTA 1H8AC 4BBRJ 4DW6A 4C3IJ 4D7NA 3SFIA 1LFUP 2Y2ZA 1MBHA 1MH4A 1JT0A 5EG0A 3LSJA 3S15J 4EEFG 1MSFC 3HKZN 2LTPA 2CUFA 3HOVJ 3H0GJ 5IYCJ 1AHDP 2R92J 1MSEC 3S16J 1BL0A 1H88C 3ZQFA 3GTLJ 1MBGA 4A3LJ 1T56A 5EZHA 4XK4A 1VI0A 4BXXJ 1SFOJ 5C4XJ 1ETKA 1EF4A 3I4MJ 2YS9A 2OF7A 1VF9A 5C4JJ 1GUUA 5J1YA 3ZQHA 2DA3A 5IOYA 2LFBA 5EG0B 2HQ5A 4V2FA 5M5YJ 3ZOBA 3S14J 2XRLA 3K2AA 4QSHA 2WAQN 3CMYA 2K40A 1RR7A 3HGGA 4XRSG 4L5EA 4S0HB 4A3JJ 1MNMC 4A3EJ 5IOZA 1IJWC 5FJ8J 1RPWA 1JGGA 5EGOA 1JKPC 5K7HA 1POGA 2VKVA 1B8IA 1JKRC 2WV1A 5F08A 4X1EA 2NVYJ 5FKLA 4A69C 5IYDJ 2JA7J 1IGNA 5E3LA 1WGXA 1RESA 3IH3A 3WHBA 4BY1J 1ITYA 1ETXA 1GVDA 1F43A 1FJLA 3S2DJ 2TCTA 2Y30A 3G1OA 3BR1A 1K61A 4FTHA 3BG3A 2O8KA 4JX4A 1APLC 3Q0WA 3BR0A 2JJ7A 5EGOB 5FLMJ 2LP0A 1B8IB 2XGEA 2JA5J 1Y1VJ 1HLVA 5K7FA 2N8GA 3H3VK 1MBJA 2JN6A 3BQYA 3B6AA 1IG7A 2IAIA 1IDZA 3TP0A 5EDNA 2E2JJ 2HI3A 1JTXA 1FTZA 2HXOA 3QQAA 3HOYJ 4D5CA 1R9TJ 2DMQA 3ZQIA 2XB0X 3S1NJ 2M0CA 1TWGJ 4M3DA 3DEWA 1HCRA 4M3GA 4FE7A 1I50J 1TC3C 2QF7A 2EQRA 3RKQA 2KDZA 3MVPA 1UHSA 1IDYA 1ETOA 1ETYA 1IV6A 3O8GA 2LY9A 2DA4A 4UUTA 3M4OJ 3NAUA 1RKWA 4JX6A 3GTOJ 2HYJA 3LSGA 1QRYA 2DMTA 2EZLA 1W0TA 3HM5A 5EF6A 1X2MA 1GT0C 3CDLA 2L7MP 5FKNA 4QTRA 1XG1A 3M3YJ 2FD5A 3RZDJ 1DU6A 3K7AJ 4A3IJ 2AO9A 5FKOA 4MLOA 1G2HA 5E3MA 1VNDA 3JRAA 1H89C 3RZOJ 1NK2P 1Z77A 3GTPJ 1K83J 2R7ZJ 2RAEA 1LFBA 2CU7A 3G1MA 3JRGA 3HOXJ 1YRNA 4XICA 1MH3A 2O9LA 4W1UA 2ZB9A 2E2IJ 2NS7A 4A3MJ 4BKXA 3CQZJ 4I6ZA 3PO3J 3JRDA 4XIDA 2R5YA 5GPCA 2FQ4A 5JLWA 2JMWA 3D1NI 3HB9A 4DYRA 4ABZA 2L7ZA 1JUMA 3Q0VA 2VI6A 2JWTA 5JLXA 1VFCA 3RQIA 3TW6A 2M8GX 1U9OA 2MG4A 3FISA 4IHVA 1U9NA 1YRNB 2K9SA 3DCFA 1MBEA 3HEFA 1GDTA 2Y31A 1JTYA 1JT6A 2O7OA 3SJMA 2EZHA 3S1RJ 1B72A 2H8RA 1A5JA 1HOMA 4XRSA 4C3HJ 3GTKJ 3A01A 2DMPA 1BJZA 2Y0SN 1MBKA 4DYQA 2XSDC 3LSPA 2R5YB 2VUMJ 3OIOA 2DTZA 4BBSJ 1X58A 3BTCA 2ECCA 4IHYA 1F36A 5EZGA 5EYRA 1ETQA 4MFEA 3HGYA 5FKMA 4B1RA 1QVUA 4A3CJ 3JREA 4A3GJ 1FTTA 1B72B 5J3LA 2JA6J 1HDPA 3BTIA 1XS9A 3A01B 1Y1WJ 1ZK8A 4W97A 2XPWA 4M6VA 1QVTA 4MIMA 1ETWA 4A3BJ 1WPKA 4D7MA 2CQQA 2CJJA 1TWCJ 1I6HJ 3BT9A 3GTJJ 1OCPA 1WI3A 1A6IA 3L1PA 1GV5A 3E7LA 3TW7A 5FLVA 2MGQA 5IP6A 2EZIA 1WH5A 3BR3A 1U78A 3BG5A 4C3JJ 2LK2A 3GTMJ 3OSGA 2ELKA 2LVSA 3IV5A 4MO7A 2ME0A 3HOWJ 2EZKA 2YU9J 2NOGA 5GPAA 1QPIA 2YUSA 1ZGWA 3BR6A 5E3OA 1OFCX 3VPRA 2DA1A 3PM1A 5IPAA 2OPTA 3C2BA 1BW6A 3LNQA 3UKGA 3OSFA 4RDUA 1HDDC 4IHWA 2L9RA 2QCOA 5F0FA 1W0UA 4Y52J 3S1MJ 2LLKA 5M3FJ 3ZQCA 4DYCA 1UG2A 1WCMJ 2IBDA 4I76A 5HODA 1XC5A 2H1KA 3A03A 4C2MJ 3ZQLA 2M2EA 4DZPA 2TRTA 2VKEA 3FK7A 2NVTJ 1JJ6C 2FX0A 3BQZA 4MFDA 2X48A 4AYBN 4AUXA 2DJNA 5DS9A 3F0CA 1P7JA 3IH2A 1O4XA 2ECBA 3O8HA 1JJ8C 1LE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  2DA6 A;  2M34 A;  4HNV A;  2NS8 A;  2X9D A;  2DA2 A;  1ZTR A;  2JK3 A;  1BW5 A;  4X6A J;  3A02 A;  1FIA A;  3WHC A;  3BR5 A;  2DN0 A;  2PMZ N;  2MW8 A;  4IEJ A;  1ZQ3 P;  4QIW N;  3BTL A;  2HDD A;  3FIW A;  3BTJ A;  4FIS A;  5F04 A;  4B3A A;  3JRH A;  3B6C A;  4JYK A;  3ZQG A;  4A3K J;  2DA7 A;  2R5Z A;  1LE8 B;  3Q0U A;  2KT0 A;  1MBF A;  3HOU J;  2G0E A;  3OOU A;  3LSR A;  2XPU A;  3G1L A;  4NDL A;  1FIP A;  2AHQ A;  1D5Y A;  4M3E A;  1ENH A;  4UUS A;  3HDD A;  4RBO A;  3BG9 A;  3BR2 A;  3SDG A;  2NVX J;  2XGD A;  4JP0 A;  2E19 A;  5C3E J;  5J1U A;  2JA8 J;  4J19 A;  3S1Q J;  2K9N A;  2ID6 A;  2R5Z B;  5F0C A;  5K7Z A;  2XPV A;  4CYC A;  1IC8 A;  3GTG J;  1GV2 A;  2X6O A;  4GFB A;  3W6V A;  1T33 A;  2K9Q A;  3QPL A;  1JUP A;  2GBY A;  2LR8 A;  5FKK A;  2I10 A;  5E3N A;  2E2H J;  4BY7 J;  4M3B A;  4UUS B;  1WH7 A;  3MN2 A;  2R93 J;  1NTC A;  5M5W J;  3HOZ J;  3JRF A;  2L7F P;  5J1R A;  5M5X J;  2B63 J;  4FCY A;  4JX5 A;  1RKT A;  2HOS A;  2XGC A;  1PUF A;  2MSY A;  1TWF J;  5F27 A;  4B4C A;  3IH4 A;  4XRM A;  4A93 J;  5F1J A;  1ZR2 A;  2W48 A;  4CYC B;  4V2G A;  1JKO C;  3Q3S A;  3S2H J;  5F0H A;  3JRB A;  2DMU A;  1X2N A;  1HF0 A;  3JR9 A;  5M3M J;  2L0K A;  1I3Q J;  1IUF A;  5DTD A;  1TWA J;  3GTQ J;  4G12 A;  1PUF B;  1TWH J;  3FKI J;  2ME6 A;  2EH3 A;  4M3F A;  3HBL A;  1E3O C;  1IRZ A;  4AC0 A;  2HXI A;  2M9H A;  3TED A;  1NK3 P;  1AKH A;  2ID3 A;  1OJL A;  2FJ1 A;  4D5F A;  3LOC A;  1P7I A;  2Y9Y A;  5C44 J;  2EBI A;  1OCT C;  3FK6 A;  1AU7 A;  2D5V A;  4A3D J;  4FE4 A;  4Y7N J;  1JUS A;  1DU0 A;  2COB A;  5IP9 J;  3GBG A;  2CUE A;  2LKX A;  3PO2 J;  3I4N J;  4A3F J;  2E1O A;  2CRG A;  4DZJ A;  2DMN A;  2CQX A;  2XB5 A;  1ZKG A;  1FEX A;  1UMQ A;  5IP7 J;  2HOA A;  3NAR A;  5GP9 A;  3S17 J;  1AKH B;  2VPR A;  2NVQ J;  3MKL A;  3JRC A;  2GLO A;  5EEA A;  1JKQ C;  2GM4 A;  1BA5 A;  2Y9Z A;  1ORK A;  1CQT A;  2HOT A;  2DA5 A;  3CCY A;  3TP3 A;  1Q1V A;  1RET A;  5BNG A;  1ETV A;  3JRI A;  2LD5 A;  5IYB J;  4IHX A;  1SAN A;  1Z0X A;  2IEK A;  1U8B A;  1ZR4 A;  2P81 A;  2WB1 N;  4LOC A;  2R0Q C;  3QPS A;  9ANT A;  1H8A C;  4BBR J;  4DW6 A;  4C3I J;  4D7N A;  3SFI A;  1LFU P;  2Y2Z A;  1MBH A;  1MH4 A;  1JT0 A;  5EG0 A;  3LSJ A;  3S15 J;  4EEF G;  1MSF C;  3HKZ N;  2LTP A;  2CUF A;  3HOV J;  3H0G J;  5IYC J;  1AHD P;  2R92 J;  1MSE C;  3S16 J;  1BL0 A;  1H88 C;  3ZQF A;  3GTL J;  1MBG A;  4A3L J;  1T56 A;  5EZH A;  4XK4 A;  1VI0 A;  4BXX J;  1SFO J;  5C4X J;  1ETK A;  1EF4 A;  3I4M J;  2YS9 A;  2OF7 A;  1VF9 A;  5C4J J;  1GUU A;  5J1Y A;  3ZQH A;  2DA3 A;  5IOY A;  2LFB A;  5EG0 B;  2HQ5 A;  4V2F A;  5M5Y J;  3ZOB A;  3S14 J;  2XRL A;  3K2A A;  4QSH A;  2WAQ N;  3CMY A;  2K40 A;  1RR7 A;  3HGG A;  4XRS G;  4L5E A;  4S0H B;  4A3J J;  1MNM C;  4A3E J;  5IOZ A;  1IJW C;  5FJ8 J;  1RPW A;  1JGG A;  5EGO A;  1JKP C;  5K7H A;  1POG A;  2VKV A;  1B8I A;  1JKR C;  2WV1 A;  5F08 A;  4X1E A;  2NVY J;  5FKL A;  4A69 C;  5IYD J;  2JA7 J;  1IGN A;  5E3L A;  1WGX A;  1RES A;  3IH3 A;  3WHB A;  4BY1 J;  1ITY A;  1ETX A;  1GVD A;  1F43 A;  1FJL A;  3S2D J;  2TCT A;  2Y30 A;  3G1O A;  3BR1 A;  1K61 A;  4FTH A;  3BG3 A;  2O8K A;  4JX4 A;  1APL C;  3Q0W A;  3BR0 A;  2JJ7 A;  5EGO B;  5FLM J;  2LP0 A;  1B8I B;  2XGE A;  2JA5 J;  1Y1V J;  1HLV A;  5K7F A;  2N8G A;  3H3V K;  1MBJ A;  2JN6 A;  3BQY A;  3B6A A;  1IG7 A;  2IAI A;  1IDZ A;  3TP0 A;  5EDN A;  2E2J J;  2HI3 A;  1JTX A;  1FTZ A;  2HXO A;  3QQA A;  3HOY J;  4D5C A;  1R9T J;  2DMQ A;  3ZQI A;  2XB0 X;  3S1N J;  2M0C A;  1TWG J;  4M3D A;  3DEW A;  1HCR A;  4M3G A;  4FE7 A;  1I50 J;  1TC3 C;  2QF7 A;  2EQR A;  3RKQ A;  2KDZ A;  3MVP A;  1UHS A;  1IDY A;  1ETO A;  1ETY A;  1IV6 A;  3O8G A;  2LY9 A;  2DA4 A;  4UUT A;  3M4O J;  3NAU A;  1RKW A;  4JX6 A;  3GTO J;  2HYJ A;  3LSG A;  1QRY A;  2DMT A;  2EZL A;  1W0T A;  3HM5 A;  5EF6 A;  1X2M A;  1GT0 C;  3CDL A;  2L7M P;  5FKN A;  4QTR A;  1XG1 A;  3M3Y J;  2FD5 A;  3RZD J;  1DU6 A;  3K7A J;  4A3I J;  2AO9 A;  5FKO A;  4MLO A;  1G2H A;  5E3M A;  1VND A;  3JRA A;  1H89 C;  3RZO J;  1NK2 P;  1Z77 A;  3GTP J;  1K83 J;  2R7Z J;  2RAE A;  1LFB A;  2CU7 A;  3G1M A;  3JRG A;  3HOX J;  1YRN A;  4XIC A;  1MH3 A;  2O9L A;  4W1U A;  2ZB9 A;  2E2I J;  2NS7 A;  4A3M J;  4BKX A;  3CQZ J;  4I6Z A;  3PO3 J;  3JRD A;  4XID A;  2R5Y A;  5GPC A;  2FQ4 A;  5JLW A;  2JMW A;  3D1N I;  3HB9 A;  4DYR A;  4ABZ A;  2L7Z A;  1JUM A;  3Q0V A;  2VI6 A;  2JWT A;  5JLX A;  1VFC A;  3RQI A;  3TW6 A;  2M8G X;  1U9O A;  2MG4 A;  3FIS A;  4IHV A;  1U9N A;  1YRN B;  2K9S A;  3DCF A;  1MBE A;  3HEF A;  1GDT A;  2Y31 A;  1JTY A;  1JT6 A;  2O7O A;  3SJM A;  2EZH A;  3S1R J;  1B72 A;  2H8R A;  1A5J A;  1HOM A;  4XRS A;  4C3H J;  3GTK J;  3A01 A;  2DMP A;  1BJZ A;  2Y0S N;  1MBK A;  4DYQ A;  2XSD C;  3LSP A;  2R5Y B;  2VUM J;  3OIO A;  2DTZ A;  4BBS J;  1X58 A;  3BTC A;  2ECC A;  4IHY A;  1F36 A;  5EZG A;  5EYR A;  1ETQ A;  4MFE A;  3HGY A;  5FKM A;  4B1R A;  1QVU A;  4A3C J;  3JRE A;  4A3G J;  1FTT A;  1B72 B;  5J3L A;  2JA6 J;  1HDP A;  3BTI A;  1XS9 A;  3A01 B;  1Y1W J;  1ZK8 A;  4W97 A;  2XPW A;  4M6V A;  1QVT A;  4MIM A;  1ETW A;  4A3B J;  1WPK A;  4D7M A;  2CQQ A;  2CJJ A;  1TWC J;  1I6H J;  3BT9 A;  3GTJ J;  1OCP A;  1WI3 A;  1A6I A;  3L1P A;  1GV5 A;  3E7L A;  3TW7 A;  5FLV A;  2MGQ A;  5IP6 A;  2EZI A;  1WH5 A;  3BR3 A;  1U78 A;  3BG5 A;  4C3J J;  2LK2 A;  3GTM J;  3OSG A;  2ELK A;  2LVS A;  3IV5 A;  4MO7 A;  2ME0 A;  3HOW J;  2EZK A;  2YU9 J;  2NOG A;  5GPA A;  1QPI A;  2YUS A;  1ZGW A;  3BR6 A;  5E3O A;  1OFC X;  3VPR A;  2DA1 A;  3PM1 A;  5IPA A;  2OPT A;  3C2B A;  1BW6 A;  3LNQ A;  3UKG A;  3OSF A;  4RDU A;  1HDD C;  4IHW A;  2L9R A;  2QCO A;  5F0F A;  1W0U A;  4Y52 J;  3S1M J;  2LLK A;  5M3F J;  3ZQC A;  4DYC A;  1UG2 A;  1WCM J;  2IBD A;  4I76 A;  5HOD A;  1XC5 A;  2H1K A;  3A03 A;  4C2M J;  3ZQL A;  2M2E A;  4DZP A;  2TRT A;  2VKE A;  3FK7 A;  2NVT J;  1JJ6 C;  2FX0 A;  3BQZ A;  4MFD A;  2X48 A;  4AYB N;  4AUX A;  2DJN A;  5DS9 A;  3F0C A;  1P7J A;  3IH2 A;  1O4X A;  2ECB A;  3O8H A;  1JJ8 C;  1LE8 A; 
#chains in the Genus database with same CATH topology
 1S7E A;  1VQL I;  4LFU A;  4CH7 A;  2KFD A;  2X9D A;  2XKP A;  1T98 A;  3AAF A;  1ZHF A;  2ESH A;  4FQG A;  4X6A J;  2IXS A;  1E17 A;  1FIA A;  2PMZ N;  2IS4 A;  5JI6 A;  3KPH A;  4ZYG A;  4FX4 A;  3BTL A;  5JHF A;  3CCU I;  1VZ0 A;  3S93 A;  2VJJ A;  2L7K A;  3HSR A;  2HZD A;  4B3A A;  3N4M A;  3B6C A;  1ACI A;  2ZJP F;  2RN7 A;  3AG1 H;  5E20 A;  3QAH A;  4WX9 A;  3OYJ A;  2KP6 A;  3NWS A;  2M4G A;  3Q0U A;  4XLH A;  3LSR A;  4ZDO A;  1XTA A;  1IRF A;  1MMS A;  4KMF A;  4NDL A;  3J7A Y;  1RC9 A;  4M3E A;  4UUS A;  1LQ1 A;  3HDD A;  5IT9 Z;  5BS6 A;  4ZZD A;  2BW3 A;  3BDD A;  3R0J A;  5FRO A;  4LB6 B;  2YSR A;  2OCE A;  4J00 A;  3RDI A;  3E6B A;  2E7X A;  3TO7 A;  1Y8R B;  3F8N A;  1EV7 A;  3LSM A;  1P4X A;  1Y6I A;  3TBI A;  2HFH A;  4HEA 2;  2ZJ2 A;  2DI3 A;  2XPV A;  4L9T A;  2BVL A;  1E3P A;  4RAY A;  2X6O A;  4M6X A;  4EJW A;  4YRV A;  1KQ8 A;  1DGR M;  4RGX A;  2VJ5 A;  2M7B A;  1WFX A;  2X1E A;  4BY7 J;  2EIM H;  5EJC A;  3PUF A;  4DBR A;  1WH7 A;  5L3G A;  3MN2 A;  3OYF A;  4DIQ A;  2L2O A;  5DYM A;  4JX5 A;  1UZC A;  1XDS A;  1RKT A;  5FFZ A;  4BDY A;  3MEX A;  1PUF A;  4BNC A;  3IH4 A;  1HKT A;  2HR3 A;  4JBA A;  5L3E A;  4BEH A;  3P7N A;  4E7S A;  4HQE A;  3WTS C;  3MFK A;  1LUJ B;  3V7C A;  4I09 A;  1J75 A;  2H94 A;  3EQL F;  4MQV A;  2DMU A;  1X2N A;  3I5U A;  1FOX A;  4G8X A;  4A6E A;  3LST A;  2JUG A;  1IUF A;  1BIB A;  5DTD A;  3QYF A;  2FUG 2;  2EPF A;  4YG2 F;  1WJD A;  5KAF C;  1OMI A;  3GFI A;  2QEN A;  2NYX A;  2BHY A;  3S8P A;  3HBL A;  3OWT A;  3T8T A;  3HSF A;  1WJF A;  4PJL A;  2VQG A;  4B43 A;  2M9H A;  3DXJ F;  4D5F A;  2EFO A;  5J8F A;  2JPB A;  4KT6 A;  4E7K A;  4GRI A;  1LDJ A;  2EBI A;  1QGP A;  2DK8 A;  2L9N A;  1AU7 A;  4J01 A;  1HW5 A;  3IP4 B;  4A3D J;  2HZT A;  2CGP A;  1JUS A;  1DU0 A;  3ABT A;  4P5O A;  4Q47 A;  1NHA A;  3DFG A;  5LLQ A;  2WAQ A;  1TQP A;  4XLF A;  2IRF G;  2CRG A;  4DZJ A;  3OYH A;  1YLF A;  1DQU A;  4ZDP A;  4HRI A;  3C18 A;  1PDN C;  2P5K A;  4GYI A;  3IHU A;  1AKH B;  1IN5 A;  5CQE A;  3KLN A;  1YO5 C;  2BE5 F;  2VPR A;  4M74 A;  4EJU A;  4KIT B;  2VQH A;  2M45 A;  4YEJ A;  1EJ9 A;  1MJB A;  2Q2E A;  3M1C A;  4O5V A;  2QYO A;  1WJ5 A;  2RRE A;  4A12 A;  2OBP A;  4IRI A;  1SAN A;  2K27 A;  4YIF A;  3KYC B;  4A0Y A;  2LBF A;  3W2W A;  3P9K A;  2D1V A;  3IWF A;  4D7N A;  5FLX K;  3MWM A;  2Y2Z A;  3WTX C;  1NH3 A;  1MBH A;  1MH4 A;  5CQG A;  4OMZ A;  1ZRE A;  4CZC A;  2M0M A;  2ZXI A;  4R79 A;  3HKZ N;  2W85 A;  3HOV J;  1X1D A;  4Y17 A;  2DXI A;  1ZG1 A;  4BHP A;  1AHD P;  1FT9 A;  3S16 J;  1BL0 A;  2P6S A;  1H88 C;  3GTL J;  2M7A A;  4A3L J;  1T56 A;  5DM7 F;  2LH9 A;  4PUS A;  1W36 C;  1RUO A;  5EZH A;  5B66 C;  2LYC A;  3RYR A;  3BG7 A;  3NWT A;  4BXX J;  3LA2 A;  1ETK A;  4ENK A;  3I4M J;  5B3S H;  2HDC A;  3GVA A;  4RM2 A;  2XIG A;  3N05 A;  3ZQH A;  3F3X A;  4OOI A;  1I6X A;  1R5H A;  5M5Y J;  3ZOB A;  1R7J A;  3S14 J;  4LIU A;  1SAX A;  1HC8 A;  3HGG A;  3MCZ A;  4XRS G;  4EM0 B;  2BV6 A;  4A3E J;  1MJA A;  4D0P A;  2KRH A;  5FJ8 J;  1JGG A;  3IRR A;  2QQ9 A;  3VEP A;  2NOJ B;  2VKV A;  2ZXH A;  1AA7 A;  1MKM A;  2FBH A;  4X1E A;  5FKL A;  2GXA A;  2NRA C;  4OIO F;  2JRM A;  5IYD J;  1IGN A;  1WGX A;  2STW A;  2M5W A;  3DBL B;  1G6N A;  3IH3 A;  3SDB A;  1YG2 A;  3K1P A;  1J9I A;  4NBQ A;  2HWV A;  2B7E A;  1GVD A;  2CFX A;  2WY7 Q;  1FJL A;  3OR2 C;  3S2D J;  2HPI A;  3G1O A;  3V42 A;  1B1B A;  4ZYH A;  3BG3 A;  2Z1D A;  1ON1 A;  1NG6 A;  2FNP A;  3PSI A;  4ZTF A;  5DM6 F;  1APL C;  3O2P E;  4Q48 A;  4CHU A;  5FLM J;  3T1B A;  1Z1D A;  2XAU A;  2E7W A;  2ESN A;  4RA2 A;  3QOD A;  1HLV A;  1ZRF A;  1Y0U A;  3GME A;  1B9N A;  2PMZ A;  4U0W A;  2N8G A;  4RB2 C;  2EV5 A;  3T0Y A;  3B6A A;  4ON0 A;  1IG7 A;  5E1X A;  2IAI A;  5D4S A;  3TP0 A;  3ISP A;  2PMU A;  1IZ1 A;  1JTX A;  2QVO A;  2A68 F;  3HOY J;  2MLG A;  4D5C A;  5KCM A;  4RLF A;  3QU6 A;  3EET A;  3R4K A;  3ZQI A;  5GAD J;  1YFH A;  2XB0 X;  4H0E A;  2IA0 A;  3EDP A;  1HKS A;  3DEW A;  4IPA A;  2ETH A;  2PMH A;  4YFN F;  3QPH A;  4C30 A;  3K9T A;  2QF7 A;  3RKQ A;  2KDZ A;  3M07 A;  2HVS A;  3KP2 A;  3GFL A;  3E0J B;  3H3U A;  3J7Z I;  2HQA A;  3FX3 A;  4LK1 F;  3L00 A;  4EAT A;  2LY9 A;  3LSH A;  4G6D A;  2DA4 A;  4HF0 A;  4UUT A;  3NAU A;  3GTO J;  2HYJ A;  5GTI C;  1QRY A;  2FU4 A;  1D1C A;  3IC7 A;  3C1D A;  4ENN A;  1XCV A;  5FD6 A;  5AON A;  3FXQ A;  2XF7 A;  3VOE A;  2WY8 Q;  3CDL A;  3B02 A;  4A5N A;  2MH9 A;  5L3B A;  2DPU A;  4QTR A;  2NS0 A;  2CYY A;  3PFY A;  3RZD J;  5E79 C;  5FKO A;  3RKX A;  1OYI A;  5E3M A;  4F55 A;  1H89 C;  5ILS A;  3D5R C;  1ZLK A;  1NK2 P;  1Z77 A;  2D1H A;  1K83 J;  3JSP A;  2F5E A;  3H0D A;  4ASN A;  1LFB A;  2CU7 A;  4KN4 X;  3HOX J;  1YRN A;  2KRF A;  1MH3 A;  4W1U A;  2HVQ A;  4XKW A;  2VJ4 A;  3H3Z A;  3CQZ J;  1QBJ A;  2ICW G;  3WU2 C;  4XID A;  4ZTJ A;  4I99 C;  4CXF A;  2FQ4 A;  5JLW A;  5J47 A;  5ICE A;  4HQM A;  4ABZ A;  1D0Z A;  5JHU A;  4PGH A;  2JSC A;  3HRT A;  3TW6 A;  2MC3 A;  1XSV A;  1B6A A;  2IGM A;  2KHM A;  2R7D A;  3ML6 A;  4RMN A;  2E34 A;  4LIT A;  3S1R J;  1SD4 A;  2H8R A;  3OYB A;  5FLX Z;  4BQQ A;  2JQ7 A;  3GTK J;  3A01 A;  2DMP A;  3ASO H;  2MFZ A;  2P0W A;  3U9G A;  5E17 F;  2LF7 A;  3K4M A;  2R5Y B;  2CS3 A;  2WBM A;  2Q8K A;  1AWC A;  2E1M C;  1R1V A;  3QP6 A;  1P4W A;  4BJ5 C;  2DTZ A;  4BBS J;  1F36 A;  5J4Y A;  4HA8 A;  3FXR A;  1ETQ A;  4P55 A;  3HL2 A;  2ZCW A;  4B1R A;  2QQB A;  4A3C J;  3CES A;  1DP3 A;  2AQE A;  4CCO A;  2GZW A;  1LPQ A;  4B44 A;  1B72 B;  2X6W A;  1IUY A;  1HDP A;  1BOB A;  5IT3 A;  1R36 A;  1Y1W J;  2Y48 A;  2MA3 A;  1TQM A;  4W97 A;  4NHJ A;  2X4H A;  1QVT A;  1ETW A;  2LDU A;  5L3D A;  1SFK A;  3OYC A;  1HW2 A;  2CQQ A;  2CJJ A;  2PFB A;  3QPT A;  1TWC J;  2LC2 A;  4HAM A;  3BT9 A;  1U6G A;  3I54 A;  2UUZ A;  3S32 A;  2V6E A;  1N77 A;  4XMY A;  5LHH A;  2O0Y A;  4B09 A;  4BQO A;  3C7J A;  1P2F A;  1OKR A;  1FSE A;  1GV5 A;  3DLL F;  1WSU A;  5FLV A;  4EJV A;  2MGQ A;  1U5T A;  2DBB A;  2W4S A;  2H09 A;  1J09 A;  2ZFU A;  1WH5 A;  1F9N A;  3JCU C;  1SC7 A;  1Z05 A;  3G71 I;  1R49 A;  3BG5 A;  4NC7 A;  4UUV A;  1QPM A;  2W84 A;  3CLQ A;  3K69 A;  3WU1 B;  3OSG A;  2ELK A;  3EUK L;  3I58 A;  3AFH A;  4YII A;  1N78 A;  3HKZ A;  2ME0 A;  4MO7 A;  3PQJ A;  2W82 A;  3HOW J;  5E8I A;  5LGT A;  2DQL A;  1FSH A;  2LOO A;  2IPQ X;  2VON A;  2YUS A;  4HYE A;  1WHU A;  2M1B A;  4MTD A;  3L2W A;  4NC8 A;  1R58 A;  3PSF A;  2WAD A;  1W7P B;  2KKO A;  3OSF A;  1IN8 A;  3PL8 A;  4RDU A;  3E5X A;  1YTY A;  2QCO A;  5DEQ A;  3S1M J;  2Y75 A;  2LLK A;  4BL0 B;  1J59 A;  1QA6 A;  4CDG A;  2FA5 A;  3ZQC A;  3ZQ7 A;  1WCM J;  4I76 A;  4HX7 A;  1BIA A;  1U2W A;  2NAZ A;  1XC5 A;  3MKZ A;  2P5L C;  3ZQL A;  4XN0 A;  4DZP A;  2TRT A;  3HUG B;  3R6S A;  1MD0 A;  2V1D A;  3DKX A;  3HTS B;  2NVT J;  3FXJ A;  4C9Y A;  4MFD A;  5BMZ A;  2K02 A;  4AYB N;  1YIJ I;  3BCB A;  5K5Q A;  2DK5 A;  1KON A;  5LGN A;  4LG0 A;  3OIP A;  1JJ8 C;  4E7Z A;  1D0X A;  3G6E I;  5GAE J;  2UZK A;  3HPG A;  2M34 A;  4YFK F;  4UNO A;  2NS8 A;  2NVU B;  1WJA A;  2DAO A;  5DCM B;  3V8J A;  2JK3 A;  1TL8 A;  4KIG A;  2Z9O A;  2V9P A;  3EUH A;  3CCS I;  3GZ5 A;  4I7H A;  1MDM B;  4IEJ A;  5AIP A;  1JGS A;  1TT0 A;  4QIW N;  3OV8 A;  3FWE A;  4F52 A;  3DTK A;  3ZXS A;  3DP7 A;  4IHT A;  4XOR A;  3VYS B;  2ZO4 A;  3WE3 A;  4AVZ A;  5L3C A;  1AOY A;  5E8G A;  4OIP F;  4Y4R A;  1K6O A;  3CTA A;  2OUM A;  4IXA A;  1WVR A;  2KT0 A;  3HRU A;  5DDG A;  3JW4 A;  3HPH A;  3RPQ A;  4EMS A;  1O3S A;  2YR2 A;  1R5G A;  1D5Y A;  1ENH A;  3PJR A;  1PJR A;  2E19 A;  4IL6 C;  1ZGA A;  3KP5 A;  2IGN A;  1G3T A;  3ZCO A;  4PDK A;  4O6J A;  2E1C A;  2DCE A;  2K9N A;  1YS6 A;  5CJ9 A;  2J5P A;  4E4H A;  4CYC A;  1TTY A;  2F48 A;  5HVQ C;  1IV8 A;  1T33 A;  2DFI A;  1H9G A;  2K9Q A;  2GBY A;  3DU5 A;  5FKK A;  3DU6 A;  5E3N A;  3CMM A;  4R8H A;  3KP7 A;  4UUS B;  2RC4 A;  1EH8 A;  4XN3 A;  4IO9 F;  2RNJ A;  2W57 A;  2M3A A;  2BW3 B;  2R7R A;  1NTC A;  1TT5 B;  2QKM B;  3JRF A;  2K3P A;  2L7F P;  3WU0 A;  3ZMS A;  2MBF A;  4FCY A;  3ZMD A;  3OS0 A;  2BY3 A;  3HG9 A;  3KLO A;  2KRC A;  5F27 A;  3T5X A;  4B4C A;  4XRM A;  4II2 A;  4HZF A;  2ELH A;  3DLA A;  1ZR2 A;  3BPX A;  2W48 A;  3F8C A;  1IXS B;  2GA2 A;  1XB4 A;  2OV7 A;  2HYG D;  4A5M A;  2M4K A;  1Y8Q B;  1S7A A;  1M1E B;  3I53 A;  4I98 B;  1TNT A;  3JRB A;  1K4S A;  3LAP A;  1ZG3 A;  3A0H C;  4AIJ A;  3CJN A;  2Q1Z B;  5M3M J;  5CLS A;  3P9C A;  3COA C;  3F8B A;  3L2Q A;  4ESB A;  1TWA J;  2A6T A;  3M8F A;  2G7U A;  1PUF B;  4HBL A;  1TWH J;  5HS7 A;  2CWE A;  3PQK A;  4PJ0 C;  2ZJR F;  1F1Z A;  3JTH A;  2EH3 A;  4EGY A;  1E3O C;  3RYP A;  4BEH B;  1JHH A;  1J0R A;  2X51 A;  2STT A;  1P9Q C;  2DYR H;  3RQ4 A;  3TED A;  1OJL A;  2R7X A;  1YX3 A;  1V55 H;  1W5S A;  1P4A A;  3ECO A;  1BR2 A;  3CC7 I;  3PFI A;  4MEY F;  4RAG A;  4UB8 C;  4BXU A;  3LQR A;  2WAE A;  3DQV C;  1SMY F;  4FE4 A;  3S3O A;  4Y7N J;  3MD2 A;  2LKX A;  1J2X A;  1LEB A;  4KIC A;  4A3F J;  2E1O A;  2COM A;  2RKH A;  1CF7 A;  2BY2 A;  2DW4 A;  4A0X A;  2CQX A;  4BHB A;  1YHQ I;  2XB5 A;  3HOS A;  1FEX A;  1ZH5 A;  1YW9 A;  4FT8 A;  3NAR A;  4XOP A;  4E7I A;  2FEZ A;  3S17 J;  3TQN A;  4XSX F;  1VTN C;  3PIP F;  3QU3 A;  2MAB A;  1IN6 A;  1LJ9 A;  2CO5 A;  4RAF A;  1KZH A;  4KT5 C;  5LBQ A;  3M7G A;  2NVQ J;  2GLO A;  4V19 K;  2CQN A;  2Y9Z A;  1JE8 A;  1CQT A;  1T8I A;  1HW1 A;  2DOA A;  2QA4 I;  1RET A;  5BNG A;  1XX5 A;  1GXQ A;  2VC0 A;  3JRI A;  2LD5 A;  4BHC A;  2P81 A;  3TL4 X;  2R0Q C;  3DBH B;  4LLG F;  4AID A;  1H8A C;  3OOP A;  1I1S A;  4AD9 A;  3K4C A;  4Y33 A;  4P9F A;  3UR3 C;  2P7V B;  4L9V A;  2F4O B;  4XLA A;  4IRH A;  1W5C C;  5F64 A;  3MZH A;  3VYU B;  2E71 A;  5HLT A;  1MSF C;  1UB9 A;  2VOD A;  2LTP A;  1ERD A;  3H0G J;  3ZN1 A;  2Q2E B;  1QNT A;  1OR7 A;  1L0O C;  1N25 A;  2FXA A;  1WJC A;  1BJA A;  4GXO A;  4LLN A;  3CCR I;  1WJB A;  2LY2 A;  3K4J A;  4OAY A;  2WAF A;  3OYA A;  3DTE A;  2K7L A;  2HDW A;  3EPZ A;  4XK4 A;  1VI0 A;  2LBF B;  1SFO J;  2EWN A;  1K4T A;  1BR4 A;  3W2A A;  2KQR A;  3G2B A;  2OF7 A;  3OY9 A;  1D8J A;  3OYI A;  2EIN H;  3OYD A;  5J1Y A;  2X1D A;  2LFB A;  3KYD B;  4V2F A;  3CO6 C;  3VYR B;  3K2A A;  1A6Q A;  5B1B H;  2K40 A;  1RR7 A;  4L5E A;  1KYW A;  2ISY A;  2H27 A;  2O8X A;  4A3J J;  4BE1 A;  3HZJ A;  1HST A;  3E5Q A;  5TIS C;  4ETS A;  5IOZ A;  4U7D A;  2E1N A;  2P7C B;  5K5O A;  4AVP A;  2FSW A;  5K7H A;  2E60 A;  1B8I A;  1WQ2 A;  2VT2 A;  2WV1 A;  3K6G A;  5F08 A;  4RM3 A;  4IKF A;  2FBI A;  1XGO A;  5D8K B;  3E6M A;  3WHB A;  4M73 A;  2QEX I;  4AYB A;  1BI0 A;  1LNW A;  2E36 A;  4K2E A;  3GLX A;  1Z3X A;  3FXL A;  3HXL A;  3IAS 2;  4FX0 A;  5LRR A;  2KLO A;  1Z6R A;  5LEJ A;  4JX4 A;  1JI8 A;  2BXZ A;  2DPD A;  2VE9 A;  3P5J A;  3Q0W A;  3BR0 A;  2JJ7 A;  3VFZ A;  1TNS A;  3TOA A;  4JQF A;  4XR6 A;  4WWC A;  4L5I A;  1KYZ A;  4DGW B;  2JSP A;  2QLZ A;  5J8C A;  3OL4 A;  2FF4 A;  2TDX A;  1WRJ A;  3KYL A;  2GWR A;  1RRJ A;  3U1D A;  5DCF A;  3I4P A;  3G73 A;  3IKV A;  1QZY A;  2JT1 A;  1O7F A;  1DDN A;  2A5W A;  1TW2 A;  1OLT A;  1SAU A;  1FTZ A;  2HXO A;  2R7U A;  2B9S A;  1R9T J;  2OZU A;  2M30 A;  3LA3 A;  4BS9 A;  2RV8 A;  5JR3 A;  2A3S A;  3ESW B;  3CCQ I;  2M0C A;  1KA8 A;  2AXL A;  4M3D A;  1FP2 A;  2DFF A;  2LY1 A;  4HPQ A;  3KZY A;  4FE7 A;  1I50 J;  1T08 B;  2EFP A;  4XLE A;  1ZN2 A;  3MVP A;  1D8K A;  3E1S A;  4KIB A;  2JZY A;  1T95 A;  4N9I A;  3ZR8 X;  1ETO A;  1ETY A;  1FOY A;  1IV6 A;  3O8G A;  1WJE A;  2P5V A;  2F5V A;  4NQW A;  3T8R A;  4E6K G;  4JX6 A;  3KFW X;  3CO7 C;  5BPI A;  3HC7 A;  2DMT A;  1JXS A;  3FKJ A;  2EZL A;  4PJJ A;  4UVC A;  1W0T A;  1X2M A;  2X1C A;  2HS5 A;  1I27 A;  3D0S A;  1STZ A;  4UB6 C;  1T39 A;  1GT0 C;  4XSZ F;  4UV8 A;  5CVJ A;  3TDZ C;  1XG1 A;  1OCR H;  1G8X A;  3OR1 C;  2AO9 A;  4IHS A;  1USS A;  2CSO A;  1FC3 A;  1H9T A;  3JRA A;  2X85 A;  3DBR B;  2R7Z J;  4HV5 A;  3H5N A;  5TRD A;  2RAE A;  3A1Y A;  4C2T A;  1A31 A;  4D1Q A;  2OCC H;  2V9K A;  1SFU A;  1YYV A;  3LFK A;  3GLL A;  4PSX A;  1W36 D;  3ZMU A;  2K4J A;  2MLK A;  5LHI A;  1DUX C;  4X0G A;  4BKX A;  3PO3 J;  1IXC A;  3JRD A;  1O57 A;  2PEX A;  3VSK A;  2GA1 A;  4LK0 F;  1XMK A;  2XRN A;  2M87 A;  5ICC A;  1KQ9 A;  4DYR A;  2VBW A;  1FOK A;  1YW7 A;  1R1T A;  2F2E A;  4G6T B;  3UNG C;  3OYE A;  2QUF A;  3RQI A;  2M8G X;  1U9O A;  3TOB A;  2R3S A;  2VC1 A;  1G59 A;  1LB2 A;  2CW0 F;  3KEQ A;  5DV5 A;  1Z7L A;  1IF1 A;  1YRN B;  4IHV A;  3EYY A;  2CMP A;  1MBE A;  3HRM A;  1GDT A;  2KPM A;  4XKC A;  1JTY A;  2O7O A;  3BP8 A;  5FB2 A;  2EZH A;  4XRS A;  2V1X A;  2L5Q A;  3C2H A;  2RGV A;  2EIJ H;  2M8E A;  1T0F A;  2ZME A;  3H9J A;  3X2Q H;  3BWG A;  4DYQ A;  2PX9 A;  1ZRD A;  3GW2 A;  1FX7 A;  4OU0 A;  4PFP A;  3CDH A;  1YIT I;  3HIF A;  1ON2 A;  1X58 A;  2ECC A;  2I5U A;  2UXX A;  2Y0M A;  4F3Q A;  5FGM A;  2OU2 A;  3CJR B;  4OMY A;  4BE0 A;  1UHM A;  4CZZ A;  4A3G J;  1FTT A;  2A5Y B;  5J3L A;  3SHF A;  4E7J A;  1ZLJ A;  3A01 B;  1BM9 A;  4CA0 A;  2XPW A;  4ESF A;  5AIQ A;  3LA7 A;  1PYV A;  1LKX A;  1VQO I;  3H35 A;  1J7K A;  3H9Q A;  2F4I A;  2ISZ A;  2FQ3 A;  3MMY B;  1I6H J;  1YS7 A;  1OCP A;  2VKH A;  1WI3 A;  3K1N A;  2A05 A;  2EIL H;  2IT0 A;  3TW7 A;  2IJL A;  4TV7 A;  1BOA A;  1R71 A;  2ADU A;  2XVC A;  1X4P A;  4CSW A;  1U78 A;  4WK8 F;  3MZY A;  1XD7 A;  4C3J J;  1MND A;  4HSR A;  5J4V A;  2K85 A;  1F5T A;  3BPV A;  4WXH A;  2YU9 J;  5GPA A;  1QPI A;  3TGN A;  1ZGW A;  3BR6 A;  2H1L A;  3I55 I;  2LG4 A;  5HOO A;  4B3X A;  3ABL H;  1QU3 A;  3C2B A;  5KHD A;  1Z6T A;  1SD7 A;  3GX4 X;  2CG4 A;  4B47 A;  2L9V A;  1QQI A;  1G3W A;  1U5T B;  2GOM A;  3QYE A;  4Y52 J;  4BE2 A;  4XKV A;  4IRG A;  2JVG A;  2IA2 A;  1ZAR A;  5HOD A;  2H1K A;  3A03 A;  4EGZ A;  3FK7 A;  3RI4 A;  3ZN0 A;  1JJ6 C;  2FX0 A;  3BQZ A;  1Q1H A;  2X48 A;  3ABU A;  4HLX A;  3W2V A;  2XAG A;  1OYY A;  3IH2 A;  3U21 A;  1O4X A;  2ECB A;  2IS2 A;  2VIX A;  1LE8 A;  3JTG A;  5BOX A;  2L4A A;  2XDV A;  5E18 F;  4HNV A;  4CCN A;  2VT3 A;  3FBI B;  3F72 A;  2W00 A;  3I9V 2;  1SMT A;  1ZTR A;  2R4G A;  2WA0 A;  1BW5 A;  1SVO A;  2HKO A;  3WHC A;  4EM2 A;  2DN0 A;  3D5S C;  2MW8 A;  1H0M A;  1I1G A;  1MIJ A;  3DV8 A;  1F4K A;  3FXU A;  3GWZ A;  4FIS A;  1BC8 C;  4U0Y A;  3L9F A;  5E1W A;  4LG0 B;  4UV9 A;  3JRH A;  4JYK A;  3ZQG A;  4N4N B;  2DA7 A;  2DYS H;  2FBK A;  2R5Z A;  2XRO A;  2CW8 A;  1MBF A;  1GLN A;  2PI0 A;  3HOU J;  2O61 A;  3MKW B;  2P6T A;  2XPU A;  3I59 A;  4EVI A;  1FIP A;  3L09 A;  1O7L A;  1KGS A;  3E6C C;  3N97 A;  2VAS A;  3BR2 A;  3SDG A;  2ZSI B;  2NVX J;  3PNV A;  2XGD A;  4JP0 A;  5GAH J;  5C3E J;  5J1U A;  1BI1 A;  2KIU A;  1O3Q A;  3O6B B;  3FHN A;  4CCK A;  1FY7 A;  3WTU C;  1ODD A;  4WXC A;  3WTZ A;  3S1Q J;  4KIS A;  2EFW A;  4KNY A;  2A61 A;  4GGG A;  1VQK I;  2F5F A;  5F0C A;  3GXO A;  3GTG J;  1HQC A;  2QWW A;  3GEZ A;  3R0A A;  4GFB A;  4BAY A;  4BU2 A;  2AS5 F;  2A07 F;  2R7W A;  2IGO A;  3QPL A;  1JUP A;  3G4S I;  2LR8 A;  2I10 A;  4YEL A;  1SD5 A;  4MGR A;  4QPQ A;  1FBQ A;  3ZP5 A;  2XF6 A;  4EJO A;  2R93 J;  5B5E C;  5J1R A;  1YJ9 I;  1R6R A;  3HRS A;  2OC6 A;  5J6X A;  3HHH A;  2HOS A;  1XGS A;  4JK1 X;  2XGC A;  2AXT C;  5KNL A;  1TWF J;  3W6J B;  5F1J A;  5HNF A;  2YX7 A;  4CYC B;  3BLY A;  4V2G A;  3ULQ B;  1TZL A;  3KZZ A;  3H5R A;  4ENM A;  2XGX A;  1IRG A;  2YU3 A;  2KIQ A;  2PN6 A;  3GYH X;  3JR9 A;  2H8W A;  2ZXJ A;  3KE2 A;  2BHZ A;  2OD5 A;  2H6B A;  3WTV C;  3CZ6 A;  4ZZL A;  3K1M A;  5ED4 A;  2RQQ A;  2Y69 H;  1OR7 C;  2VB6 A;  4UY8 I;  4II3 A;  2CH0 A;  2ME6 A;  1ZRC A;  1IRZ A;  1MW7 A;  4AC0 A;  3MQ0 A;  3RCO A;  3K4L A;  3L2C A;  2CUZ A;  2HXI A;  4LD5 A;  1HKQ A;  1NK3 P;  1Y0N A;  2BOL A;  2FJ1 A;  1PVE A;  3WTW C;  2KIS A;  2ZNZ A;  2EK5 A;  2WC2 A;  1P7I A;  2Y9Y A;  5C44 J;  3DWL E;  3FK6 A;  2D5V A;  4H4K C;  3DPL C;  1V5E A;  5IP9 J;  1RZ4 A;  3ECH A;  2VBZ A;  3PO2 J;  3IWZ A;  3TDU C;  1FMV A;  2K3F A;  3DTI A;  2OTL I;  4KMU X;  2DMN A;  1R5I D;  2F6C A;  4XLC A;  2OJE D;  4FHT A;  4OIN F;  1BN5 A;  2QZ8 A;  5L3F A;  1FBU A;  4F92 B;  1VQ4 I;  3F23 A;  1PUE E;  1UMQ A;  2DT6 A;  5IP7 J;  2DQR A;  1D1A A;  3ERM A;  4KFC A;  5GP9 A;  1RR8 C;  1TLH B;  6PAX A;  3AG2 H;  5CYV A;  1MMA A;  3JRC A;  2HYF A;  1JKQ C;  4PFO A;  1KU2 A;  4E70 A;  1BA5 A;  3OYN A;  2E5Z A;  1Z9C A;  1K78 A;  2HOT A;  1E2X A;  2DA5 A;  2G7H A;  3CCY A;  3TP3 A;  3WG9 A;  4D9J A;  3DEE A;  1ETV A;  1X1C A;  5IYB J;  4HDV A;  4IHX A;  1Z0X A;  2IEK A;  3HHG A;  5LRS A;  1ZR4 A;  1CF7 B;  2WB1 N;  4M6Y A;  3QPS A;  9ANT A;  3TKY A;  4BBR J;  4C3I J;  4G94 A;  4CCM A;  3RKY A;  5D5V B;  1OCO H;  2W25 A;  1IN4 A;  4Z2Y A;  1V4R A;  1ZYR F;  4WXD A;  1ZG5 A;  3KET A;  5EG0 A;  1C0W A;  1DGW Y;  2IGK A;  3LSI A;  1I3A A;  3S15 J;  3DPU A;  4EEF G;  3A0B C;  1J5Y A;  3GCM A;  1LDK B;  3BCA A;  1RIO H;  2DFE A;  1QHG A;  2R92 J;  2CQK A;  4LB5 A;  1MSE C;  4RLQ A;  2EB7 A;  2LSO A;  2CV2 A;  2ZXW H;  1XMA A;  3I64 A;  4ZJZ A;  4PJM A;  2V1U A;  5C4X J;  1EF4 A;  1R4M B;  3V4G A;  1EKE A;  4KIF A;  3FXK A;  5C4J J;  2UV1 A;  4AU7 A;  3V8K A;  2DA3 A;  2F5C A;  5IOY A;  1VQ7 I;  4BGD A;  5CVU A;  2QQ8 A;  3KP6 A;  1B59 A;  1EH7 A;  3QWL A;  4QSH A;  2WAQ N;  3CMY A;  2OQR A;  2BEO A;  1MNM C;  2E35 A;  2HU9 A;  3KCC A;  4HOB A;  4LIV A;  2EA4 A;  4U0V A;  1IO2 A;  5ERI A;  1RPW A;  4DNC A;  1VQ8 I;  5EGO A;  1X3W B;  4HX8 A;  3I3L A;  1POG A;  2QBY A;  3HSE A;  1JKR C;  4IJA A;  1X19 A;  1B9M A;  2NVY J;  4A69 C;  5B1A H;  2JA7 J;  2V6C A;  1BI2 A;  2RVC A;  3REO A;  3L2R A;  4ZYE A;  2MYS A;  2X6Y A;  1ETX A;  2UWM A;  3QP5 A;  1F43 A;  2BY0 A;  3FHZ A;  2TCT A;  3SYT A;  5H6Q A;  2A69 F;  2PJR A;  1VQM I;  2O8K A;  4BH9 A;  2MC4 A;  1FYM A;  2LNB A;  3MAJ A;  1K6Y A;  2HQN A;  2HQR A;  2LP0 A;  2P4W A;  4M72 A;  3RPU D;  3K70 D;  1B8I B;  3CCE I;  2XGE A;  1Y1V J;  3OYL A;  2LKS A;  3PNY A;  4ESJ A;  3WOD F;  4HNT A;  4YIR X;  1LVA A;  4Q4Z F;  2A6H F;  1MBJ A;  1OPC A;  2BVM A;  4RS8 A;  5HNH A;  2ZNY A;  3E6D A;  1KQ0 A;  3KIO A;  3ABM H;  3E3V A;  3GO5 A;  4Q5S F;  3RIR A;  3CCJ I;  3HTU A;  4FAS D;  2DTR A;  3CF5 F;  1FZP B;  5LD2 C;  5HDN A;  3J7A O;  2HGC A;  2PBI A;  3LSK A;  5D8L B;  3S1N J;  3NRV A;  2Z5U A;  1D0Y A;  3M8J A;  4G7Z F;  1T0F C;  4M3G A;  1TC3 C;  1K7A A;  3GFJ A;  1VQ9 I;  1SEU A;  1HSJ A;  3W6K B;  1OIS A;  4C2U A;  4IQ4 A;  1UHS A;  4HV6 A;  2OTJ I;  3OS1 A;  3IKT A;  5D6E A;  3M4O J;  4OAZ A;  5HLI A;  4IX7 A;  2FMY A;  3LSG A;  2F5D A;  4P1W A;  1ZGJ A;  3EUA A;  5KVR A;  3SEQ A;  3V8L A;  1YJN I;  2NNY A;  4L0Z B;  3AL0 B;  5FD5 A;  5EF6 A;  2HVR A;  1VQN I;  5E1Z B;  1KU9 A;  2XV4 S;  1V5F A;  1Z3Y A;  1SD6 A;  2RNG A;  3FDY A;  3RTR A;  2L7M P;  3SZP A;  2V9V A;  4HW0 A;  1G2H A;  1QO0 D;  1VND A;  2HPM A;  2IA1 A;  3GTP J;  1OQY A;  2PLY A;  2V7F A;  3JRG A;  1YW8 A;  1IXR C;  4PK4 A;  4EM1 A;  2FE3 A;  1UJ8 A;  4CCJ A;  4NQW B;  4RB3 C;  3LQQ A;  2ZB9 A;  2DOD A;  2ZSH B;  2NS7 A;  1OYW A;  4I6Z A;  2FNA A;  1Z91 A;  2KDO A;  1MMN A;  4PZJ A;  2V26 A;  4WCG A;  4A2U A;  1UEL B;  2JMW A;  3CUQ A;  2GAU A;  2JPC A;  2L7Z A;  4RGU A;  5FRN A;  2XC7 A;  5H2F C;  1E3H A;  4EJT A;  2VI6 A;  2JWT A;  2XUB A;  1VFC A;  3TO9 A;  3WGH A;  1UAA A;  2KJB A;  2MG4 A;  3FIS A;  1RI7 A;  1U9N A;  3FXO A;  3SQN A;  2Y31 A;  1JT6 A;  4U87 A;  3SJM A;  3SFZ A;  1HOM A;  4WF2 A;  3M8E A;  5FFX A;  1XMX A;  3SEZ A;  2Y0S N;  2X0L A;  5HS9 A;  4U88 A;  1MBK A;  2DDB A;  2XSD C;  3LSP A;  4BAC A;  4MTE A;  2VUM J;  3F6V A;  2DT7 B;  2Z33 A;  2L02 A;  1ZEL A;  3BTC A;  3FZV A;  3GF2 A;  1U8R A;  4DQ2 A;  5EZG A;  3WG7 H;  1VQ6 I;  5EYR A;  3NEU A;  3SZT A;  3IL2 A;  1QZE A;  3HGY A;  3QYB A;  2V1N A;  5HDK A;  5FKM A;  4MEX F;  1QVU A;  1BR1 A;  4S05 A;  3ERE D;  3AG4 H;  3OL3 A;  3L2U A;  1R4N B;  2JA6 J;  1UFM A;  4YFX F;  4BXF A;  2V79 A;  5CKT A;  1ZK8 A;  2ZME B;  4CIC A;  4F7Z A;  3VDX A;  4A3B J;  3U2R A;  2FOK A;  3P9I A;  2L54 A;  4EQQ A;  4ZYD A;  2GIV A;  2R7V A;  4AM3 A;  5KAI C;  1XSD A;  3E7L A;  2WB1 A;  3B73 A;  1O3T A;  3CUO A;  1NG7 A;  5IP6 A;  2EZI A;  1FBS A;  3ZGK A;  3G3Z A;  3LFU A;  2EIK H;  1SVL A;  2XAJ A;  3BR3 A;  4E7L A;  2LK2 A;  1IRX A;  2LVS A;  2QSF X;  5LFA A;  2NOG A;  3Q5F A;  1G4D A;  3RJP A;  2WV0 A;  5E3O A;  1TBX A;  4LJZ F;  4O3M A;  5IPA A;  3V7R A;  2L3D A;  3C2G A;  1BW6 A;  3LNQ A;  4IZZ A;  3UKG A;  1LVK A;  3K4K A;  1HDD C;  3KZI C;  3QOP A;  5F0F A;  5D5W B;  3WTY C;  5M3F J;  2VBY A;  2VLA A;  3L7W A;  3MZ8 A;  4DYC A;  2IBD A;  1S6L A;  4C2M J;  1W4M A;  2XF5 A;  2DFH A;  2R7T A;  1IAW A;  1VQ5 I;  4UVB A;  5CVR A;  3S3M A;  4AUX A;  3K2Z A;  1A04 A;  5DS9 A;  3F0C A;  4BQA A;  1A35 A;  4G6Q A;  1GHC A;  3GFM A;  3AG3 H;  2EV6 A;  1XDU A;  3BY6 A;  2HKX A;  3O8H A;  5H20 A;  4BUP A;  3WTT C;  2ZKZ A;  4NC6 A;  3CLO A;  2DA6 A;  1FYL A;  1KU3 A;  4MNU A;  2AQF A;  1U3E M;  3BJ6 A;  4OIR F;  2EJR A;  2GXG A;  2DA2 A;  1XPX A;  1OCC H;  4FET A;  2ZC2 A;  3A02 A;  3BR5 A;  3CMA I;  4IF4 A;  1ZQ3 P;  1BBY A;  2VQC A;  2HDD A;  3FIW A;  1U5T C;  3BTJ A;  4ANJ A;  4ZDL A;  5H6R A;  5GTH C;  3FM5 A;  5F04 A;  3KEY A;  3Q9V A;  5HLH A;  1MMD A;  4M71 A;  4XKB A;  4G7H F;  4A3K J;  3WGG A;  1FMW A;  1LE8 B;  1ONV A;  5TGT A;  1L3L A;  2NNN A;  3CCM I;  2O3F A;  2G0E A;  3OOU A;  4LMY A;  3R60 A;  4B48 A;  3JAM K;  3G1L A;  2R7Q A;  4N9H A;  4PCQ A;  2CQ7 A;  2FML A;  2AHQ A;  1IW7 F;  1YOV B;  4HF2 A;  3BZC A;  4RBO A;  1LFP A;  3BG9 A;  4XQF A;  3RPU A;  2R7S A;  2BGC A;  2PQ8 A;  5ICF A;  3RKW A;  3F22 A;  1UG0 A;  4LLL A;  4RB0 A;  2JA8 J;  4J19 A;  1A36 A;  2HEO A;  1S8N A;  2XAQ A;  2ID6 A;  4IOC F;  2R5Z B;  4NNJ A;  5K7Z A;  1IC8 A;  3DF8 A;  1GV2 A;  2NXN B;  4BJ6 C;  4Y3O A;  3SXY A;  3ZMV A;  4KDP A;  2GIZ A;  3I59 B;  3W6V A;  3U1K A;  3SZG A;  3PIO F;  1ULY A;  2E2H J;  4M3B A;  1WZ2 A;  4MQ9 F;  1Y56 A;  4M9Z A;  5DD8 A;  3ZMT A;  4I02 A;  5M5W J;  3HOZ J;  5M5X J;  2B63 J;  2MH2 A;  1OCZ H;  4IQJ A;  3VYT B;  2DU9 A;  3EUH C;  1T2K A;  2MSY A;  3ABK H;  4A93 J;  1R23 A;  4Y13 A;  2IVM A;  4G7O F;  3E5U A;  1JKO C;  3Q3S A;  1EA3 A;  5KK1 A;  3F6O A;  3S2H J;  4XRF A;  4XL9 A;  3CDI A;  3D5L A;  4ITV A;  5F0H A;  5DD4 A;  1HF0 A;  2KIM A;  2L0K A;  1I3Q J;  2KJC A;  3GUD A;  3WGI A;  2OA4 A;  3GTQ J;  4G12 A;  5BQT A;  5IY5 H;  3FKI J;  3H9G A;  3OMY A;  4M3F A;  1QZZ A;  2QQA A;  2D45 A;  4KYW A;  4Y15 A;  3J80 K;  4CCL A;  4KJZ A;  4S04 A;  2QM3 A;  1AKH A;  2ID3 A;  1P92 A;  2J5O A;  3VSL A;  1VQP I;  2VJI A;  1G3Y A;  3S2W A;  1S3J A;  5F6F A;  3LAJ A;  3LOC A;  2BZT A;  4XON A;  5HS8 A;  4XBF A;  5J40 A;  4XLP F;  1OCT C;  3Q9S A;  2Z16 A;  2XSJ C;  3FF5 A;  2COB A;  2GOX B;  3GBG A;  5FRM A;  3L2V A;  2CUE A;  1S9H A;  1P6R A;  2D2W A;  3I4N J;  4L9N A;  3CC2 I;  2OQG A;  2DJI A;  2A6E F;  2X6X A;  2EV0 A;  2KIF A;  2YX4 A;  4XM3 A;  2VE8 A;  2K86 A;  3K4B A;  3HJE A;  1ZKG A;  3I71 A;  3CC4 I;  1DPR A;  2FRH A;  2HOA A;  2Y0S A;  2CV1 A;  3J81 K;  4RAZ A;  2PJP A;  3H1C A;  3CME I;  1R00 A;  2O6G E;  1BI3 A;  3MKL A;  1W7P D;  5EEA A;  2GM4 A;  1HA8 A;  2O5R A;  4PGG A;  1ORK A;  4IVN A;  4LGW A;  4B8X A;  1XGM A;  3KEO A;  1R22 A;  1FYK A;  4GYG A;  4OIQ F;  2LKP A;  1Q1V A;  2R7O A;  4CO8 A;  5CVI A;  4I0B A;  4ZYA A;  4P9U A;  1Z21 A;  3CCV I;  1U8B A;  5LEK A;  4LOC A;  3FXM A;  2GXB A;  4JOM A;  2QKL B;  4DW6 A;  4XLN F;  2E5N A;  2O03 A;  2RQP A;  3SFI A;  1LFU P;  3AKZ A;  3FMR A;  2OAZ A;  4L5J A;  1JT0 A;  3IAM 2;  2IS1 A;  1X3U A;  1S7O A;  3OYK A;  3LSJ A;  5FO5 A;  2MD5 A;  1S72 I;  5EEH A;  2CUF A;  1GVJ A;  3K4N A;  2K9L A;  5A2Q K;  1ZAO A;  5IYC J;  2L4M A;  1K78 B;  2XAF A;  1X1A A;  3ZQF A;  1MBG A;  4I01 A;  3OIQ A;  5EEG A;  2LF8 A;  3CJQ B;  2L01 A;  1V3F A;  1V5G A;  1CGP A;  3FMS A;  1TQI A;  1R1U A;  2YS9 A;  1B4A A;  2EFN A;  4ENJ A;  1VF9 A;  3I56 I;  3I0T A;  1GUU A;  1XCB A;  1JHF A;  1D1B A;  4CUG A;  5EG0 B;  2HQ5 A;  2XRL A;  2OZ6 A;  3KP3 A;  3H5A A;  2JUC A;  2JRT A;  4M9S A;  4S0H B;  2BXY A;  4HDU A;  4AIH A;  2ACJ A;  3CD6 I;  1IJW C;  2G9W A;  3C3W A;  1UHW A;  3BC8 A;  3EYI A;  2JTV A;  1JKP C;  4R1H A;  2BY1 A;  4XOT A;  4ZC3 A;  2WTE A;  4N4O B;  3JAM Z;  1X1B A;  1S5L C;  3HYI A;  4KN7 X;  5E3L A;  4QWQ A;  1YQA A;  1RES A;  2RDP A;  4BY1 J;  1ITY A;  1YE9 A;  4E7H A;  2C6Y A;  2P8T A;  3VWB A;  4HG2 A;  5D6F A;  3IUO A;  1IN7 A;  2Y30 A;  1FPQ A;  1DP7 P;  3BR1 A;  5TJJ A;  1XGN A;  2HNH A;  1K61 A;  2KL4 A;  4FTH A;  1D3Y A;  2VKD A;  5DUK A;  2HTJ A;  5EGO B;  1Z67 A;  5BPD A;  4L0Y B;  2QBY B;  4P96 A;  2JA5 J;  5F1R A;  4PJN A;  1X3Z B;  1XSX A;  4KUM A;  3A4C A;  3S3N A;  2VOP A;  5K7F A;  2HTS A;  4KA4 A;  4EV0 A;  3H3V K;  5ILV A;  5ILU A;  3HOT A;  1WWX A;  2JN6 A;  3BQY A;  3CUQ C;  4I0A A;  1IDZ A;  5D5U B;  2VXD A;  1YI2 I;  2VBX A;  3R61 A;  5EDN A;  2PJR B;  2E2J J;  2HI3 A;  4XNF A;  1UCR A;  3QQA A;  2DMQ A;  2H6C A;  1MNE A;  1WKM A;  3GZ6 A;  4RGR A;  3VB2 A;  4HST A;  1UST A;  1PP8 F;  2ZJQ F;  1TWG J;  1HCR A;  2K5C A;  3CCL I;  1KU7 A;  3BRO A;  1MGT A;  2EQR A;  1N75 A;  2JVH A;  1MZB A;  4UXN A;  2VN2 A;  1Y39 A;  1IDY A;  2W24 A;  3QOE A;  2CV0 A;  2ELJ A;  4AWX B;  2V4J C;  2KMU A;  2ZBK A;  1RKW A;  4Z6Y A;  3KX2 A;  4A6D A;  2LRE A;  3J80 Z;  5JFR A;  1SVM A;  3J7Y J;  3HM5 A;  2ZFW A;  2PG4 A;  2L9S A;  4NUB A;  5IT9 K;  2MD0 A;  4RB1 A;  3F21 A;  1DPU A;  5FKN A;  1GXP A;  3O3K A;  2JA2 A;  3M3Y J;  1RUN A;  2FD5 A;  1DU6 A;  3K7A J;  4BJT A;  4A3I J;  3CF2 A;  4MLO A;  1LDD A;  3OYG A;  3RZO J;  4OWR B;  3K0L A;  4GDF A;  4UHT A;  1TW3 A;  2F4M B;  3CP2 A;  3G1M A;  1RNL A;  4BQN A;  5DUI A;  1FP1 D;  4XIC A;  3LL7 A;  3IRQ A;  2XAH A;  2QSG X;  2DOF A;  3WE2 A;  2O9L A;  2E1M B;  5LGU A;  1EH6 A;  2E2I J;  4L18 B;  4A3M J;  2HOE A;  3TO6 A;  1REP C;  3BG6 A;  3J81 Z;  2IW5 A;  2IP2 A;  2B0L A;  3E97 A;  4QLC U;  5GPC A;  2R5Y A;  5K1Y A;  3D1N I;  3HB9 A;  1I5Z A;  1JUM A;  2I8D A;  3Q0V A;  1XN7 A;  5JLX A;  3W3C A;  3AL0 C;  4CYD A;  3F9K A;  3V7S A;  4DOZ A;  4DBQ A;  4G9Y A;  5LHG A;  2K9S A;  3BZ6 A;  3DCF A;  1W1W E;  2UXN A;  2CUJ A;  1BC7 C;  4BDZ A;  4IOA F;  3DKW A;  1D5V A;  3FM3 A;  3HEF A;  2XAS A;  3M9A A;  4BYY A;  1B72 A;  1A5J A;  2DDA A;  3DEU A;  1X1P A;  2WWY A;  4C3H J;  1BJZ A;  1TP4 A;  2DOE A;  2CFO A;  3FBN B;  3DPT A;  2VQL A;  1G3S A;  1Z7U A;  3CJT B;  1SFX A;  4M9X A;  3QRF F;  2KZV A;  3A2K A;  2W1O A;  3CUQ B;  4QPO A;  3OIO A;  2Z3Y A;  4HF1 A;  5A2Q Z;  1MJ9 A;  3VOD A;  4IHY A;  2R7F A;  3BJA A;  1SFE A;  4MFE A;  2XHK A;  3MKY B;  4PSW A;  2K9M A;  4NB5 A;  4L9J A;  4F93 B;  4A0Z A;  1FWZ A;  1X4O A;  3CP8 A;  3ZRG A;  2DT5 A;  2LMD A;  2Q0O A;  5CVV A;  5HLG A;  3JRE A;  4AIK A;  1K79 A;  3ROU A;  2W7N A;  1W5T A;  3H92 A;  3KP4 A;  1U0J A;  2DLL A;  5D4R A;  1XS9 A;  3BTI A;  1FOW A;  3DKY A;  3OS2 A;  4CGZ A;  2CW7 A;  2XKO A;  3GZN B;  4ZH4 F;  3F8F A;  4M6V A;  3ZMZ A;  2LRD A;  3LMM A;  4MIM A;  3ELK A;  1WPK A;  3LWF A;  4HLY A;  4D7M A;  1LEA A;  4F91 B;  2QGU A;  4N0B A;  1WI9 A;  3JSO A;  4GO1 A;  2VOO A;  4DJA A;  3GTJ J;  1V54 H;  1YX5 A;  2EA2 A;  1A6I A;  1W7P A;  3L1P A;  2Z2S B;  5D5X B;  1I39 A;  4I2O A;  1T38 A;  3BZK A;  3BJO A;  4RGS A;  3F8M A;  3RSN A;  4UVA A;  5GAG J;  3GTM J;  1FNN A;  1QHH D;  3HUG A;  3M1E A;  4MHG A;  5CPR B;  3IV5 A;  4HNU A;  1O3R A;  3BOQ A;  1MMG A;  2EZK A;  3PUB A;  3K70 C;  3K10 A;  2IS6 A;  1PP7 U;  3ZPL A;  1OFC X;  1E0E A;  3VPR A;  2DA1 A;  3PM1 A;  3H36 A;  1T6S A;  2ZME C;  2OPT A;  3NQO A;  2K4B A;  1YJW I;  2VPL A;  4GCV A;  2EFQ A;  2GQQ A;  1FLI A;  5HDG A;  3PNT A;  4IHW A;  2BBY A;  2L9R A;  2VL8 A;  5DCM A;  1W0U A;  4LG3 A;  1HBX G;  2BYV E;  3FMQ A;  1HXD A;  2DO7 A;  3ONQ A;  5K5R A;  1UG2 A;  2FOW A;  1YIO A;  1MDM A;  2M2E A;  2VKE A;  2KZG A;  5JVT A;  3OYM A;  3ZQQ A;  2DJN A;  2Z99 A;  3TMO A;  4U7B A;  2QSH X;  2VXZ A;  1P7J A;  4HX4 A;  5JVG F;  3ASN H;  5ICG A;  2YPR A;  1S29 A; 
#chains in the Genus database with same CATH homology
 1S7E A;  2DA6 A;  2M34 A;  4HNV A;  2NS8 A;  2X9D A;  2DA2 A;  1ZTR A;  2JK3 A;  1BW5 A;  4X6A J;  3A02 A;  1FIA A;  3WHC A;  3BR5 A;  2DN0 A;  2PMZ N;  2MW8 A;  4IEJ A;  1ZQ3 P;  4QIW N;  3BTL A;  2HDD A;  3FIW A;  3BTJ A;  4FIS A;  5F04 A;  4B3A A;  3JRH A;  3B6C A;  4JYK A;  3ZQG A;  4A3K J;  2DA7 A;  2R5Z A;  1LE8 B;  3Q0U A;  2KT0 A;  1MBF A;  3HOU J;  2G0E A;  3OOU A;  3LSR A;  2XPU A;  3G1L A;  4NDL A;  1FIP A;  2AHQ A;  1D5Y A;  4M3E A;  1ENH A;  4UUS A;  3HDD A;  4RBO A;  3BG9 A;  3BR2 A;  3SDG A;  2NVX J;  2XGD A;  4JP0 A;  2E19 A;  5C3E J;  5J1U A;  2JA8 J;  4J19 A;  3S1Q J;  2K9N A;  2ID6 A;  2R5Z B;  5F0C A;  5K7Z A;  2XPV A;  4CYC A;  1IC8 A;  3GTG J;  1GV2 A;  2X6O A;  4GFB A;  3W6V A;  1T33 A;  2K9Q A;  3QPL A;  1JUP A;  2GBY A;  2LR8 A;  5FKK A;  2I10 A;  5E3N A;  2E2H J;  4BY7 J;  4M3B A;  4UUS B;  1WH7 A;  3MN2 A;  2R93 J;  1NTC A;  5M5W J;  3HOZ J;  3JRF A;  2L7F P;  5J1R A;  5M5X J;  2B63 J;  4FCY A;  4JX5 A;  1RKT A;  2HOS A;  2XGC A;  1PUF A;  2MSY A;  1TWF J;  5F27 A;  4B4C A;  3IH4 A;  4XRM A;  4A93 J;  5F1J A;  1ZR2 A;  2W48 A;  4CYC B;  4V2G A;  1JKO C;  3Q3S A;  3S2H J;  5F0H A;  3JRB A;  2DMU A;  1X2N A;  1HF0 A;  3JR9 A;  5M3M J;  2L0K A;  1I3Q J;  1IUF A;  5DTD A;  1TWA J;  3GTQ J;  4G12 A;  1PUF B;  1TWH J;  3FKI J;  2ME6 A;  2EH3 A;  4M3F A;  3HBL A;  1E3O C;  1IRZ A;  4AC0 A;  2HXI A;  2M9H A;  3TED A;  1NK3 P;  1AKH A;  2ID3 A;  1OJL A;  2FJ1 A;  4D5F A;  3LOC A;  1P7I A;  2Y9Y A;  5C44 J;  2EBI A;  1OCT C;  3FK6 A;  1AU7 A;  2D5V A;  4A3D J;  4FE4 A;  4Y7N J;  1JUS A;  1DU0 A;  2COB A;  5IP9 J;  3GBG A;  2CUE A;  2LKX A;  3PO2 J;  3I4N J;  4A3F J;  2E1O A;  2CRG A;  4DZJ A;  2DMN A;  2CQX A;  2XB5 A;  1ZKG A;  1FEX A;  1UMQ A;  5IP7 J;  2HOA A;  3NAR A;  5GP9 A;  3S17 J;  1AKH B;  2VPR A;  2NVQ J;  3MKL A;  3JRC A;  2GLO A;  5EEA A;  1JKQ C;  2GM4 A;  1BA5 A;  2Y9Z A;  1ORK A;  1CQT A;  2HOT A;  2DA5 A;  3CCY A;  3TP3 A;  1Q1V A;  1RET A;  5BNG A;  1ETV A;  3JRI A;  2LD5 A;  5IYB J;  4IHX A;  1SAN A;  1Z0X A;  2IEK A;  1U8B A;  1ZR4 A;  2P81 A;  2WB1 N;  4LOC A;  2R0Q C;  3QPS A;  9ANT A;  1H8A C;  4BBR J;  4DW6 A;  4C3I J;  4D7N A;  3SFI A;  1LFU P;  2Y2Z A;  1MBH A;  1MH4 A;  1JT0 A;  5EG0 A;  3LSJ A;  3S15 J;  4EEF G;  1MSF C;  3HKZ N;  2LTP A;  2CUF A;  3HOV J;  3H0G J;  5IYC J;  1AHD P;  2R92 J;  1MSE C;  3S16 J;  1BL0 A;  1H88 C;  3ZQF A;  3GTL J;  1MBG A;  4A3L J;  1T56 A;  5EZH A;  4XK4 A;  1VI0 A;  4BXX J;  1SFO J;  5C4X J;  1ETK A;  1EF4 A;  3I4M J;  2YS9 A;  2OF7 A;  1VF9 A;  5C4J J;  1GUU A;  5J1Y A;  3ZQH A;  2DA3 A;  5IOY A;  2LFB A;  5EG0 B;  2HQ5 A;  4V2F A;  5M5Y J;  3ZOB A;  3S14 J;  2XRL A;  3K2A A;  4QSH A;  2WAQ N;  3CMY A;  2K40 A;  1RR7 A;  3HGG A;  4XRS G;  4L5E A;  4S0H B;  4A3J J;  1MNM C;  4A3E J;  5IOZ A;  1IJW C;  5FJ8 J;  1RPW A;  1JGG A;  5EGO A;  1JKP C;  5K7H A;  1POG A;  2VKV A;  1B8I A;  1JKR C;  2WV1 A;  5F08 A;  4X1E A;  2NVY J;  5FKL A;  4A69 C;  5IYD J;  2JA7 J;  1IGN A;  5E3L A;  1WGX A;  1RES A;  3IH3 A;  3WHB A;  4BY1 J;  1ITY A;  1ETX A;  1GVD A;  1F43 A;  1FJL A;  3S2D J;  2TCT A;  2Y30 A;  3G1O A;  3BR1 A;  1K61 A;  4FTH A;  3BG3 A;  2O8K A;  4JX4 A;  1APL C;  3Q0W A;  3BR0 A;  2JJ7 A;  5EGO B;  5FLM J;  2LP0 A;  1B8I B;  2XGE A;  2JA5 J;  1Y1V J;  1HLV A;  5K7F A;  2N8G A;  3H3V K;  1MBJ A;  2JN6 A;  3BQY A;  3B6A A;  1IG7 A;  2IAI A;  1IDZ A;  3TP0 A;  5EDN A;  2E2J J;  2HI3 A;  1JTX A;  1FTZ A;  2HXO A;  3QQA A;  3HOY J;  4D5C A;  1R9T J;  2DMQ A;  3ZQI A;  2XB0 X;  3S1N J;  2M0C A;  1TWG J;  4M3D A;  3DEW A;  1HCR A;  4M3G A;  4FE7 A;  1I50 J;  1TC3 C;  2QF7 A;  2EQR A;  3RKQ A;  2KDZ A;  3MVP A;  1UHS A;  1IDY A;  1ETO A;  1ETY A;  1IV6 A;  3O8G A;  2LY9 A;  2DA4 A;  4UUT A;  3M4O J;  3NAU A;  1RKW A;  4JX6 A;  3GTO J;  2HYJ A;  3LSG A;  1QRY A;  2DMT A;  2EZL A;  1W0T A;  3HM5 A;  5EF6 A;  1X2M A;  1GT0 C;  3CDL A;  2L7M P;  5FKN A;  4QTR A;  1XG1 A;  3M3Y J;  2FD5 A;  3RZD J;  1DU6 A;  3K7A J;  4A3I J;  2AO9 A;  5FKO A;  4MLO A;  1G2H A;  5E3M A;  1VND A;  3JRA A;  1H89 C;  3RZO J;  1NK2 P;  1Z77 A;  3GTP J;  1K83 J;  2R7Z J;  2RAE A;  1LFB A;  2CU7 A;  3G1M A;  3JRG A;  3HOX J;  1YRN A;  4XIC A;  1MH3 A;  2O9L A;  4W1U A;  2ZB9 A;  2E2I J;  2NS7 A;  4A3M J;  4BKX A;  3CQZ J;  4I6Z A;  3PO3 J;  3JRD A;  4XID A;  2R5Y A;  5GPC A;  2FQ4 A;  5JLW A;  2JMW A;  3D1N I;  3HB9 A;  4DYR A;  4ABZ A;  2L7Z A;  1JUM A;  3Q0V A;  2VI6 A;  2JWT A;  5JLX A;  1VFC A;  3RQI A;  3TW6 A;  2M8G X;  1U9O A;  2MG4 A;  3FIS A;  4IHV A;  1U9N A;  1YRN B;  2K9S A;  3DCF A;  1MBE A;  3HEF A;  1GDT A;  2Y31 A;  1JTY A;  1JT6 A;  2O7O A;  3SJM A;  2EZH A;  3S1R J;  1B72 A;  2H8R A;  1A5J A;  1HOM A;  4XRS A;  4C3H J;  3GTK J;  3A01 A;  2DMP A;  1BJZ A;  2Y0S N;  1MBK A;  4DYQ A;  2XSD C;  3LSP A;  2R5Y B;  2VUM J;  3OIO A;  2DTZ A;  4BBS J;  1X58 A;  3BTC A;  2ECC A;  4IHY A;  1F36 A;  5EZG A;  5EYR A;  1ETQ A;  4MFE A;  3HGY A;  5FKM A;  4B1R A;  1QVU A;  4A3C J;  3JRE A;  4A3G J;  1FTT A;  1B72 B;  5J3L A;  2JA6 J;  1HDP A;  3BTI A;  1XS9 A;  3A01 B;  1Y1W J;  1ZK8 A;  4W97 A;  2XPW A;  4M6V A;  1QVT A;  4MIM A;  1ETW A;  4A3B J;  1WPK A;  4D7M A;  2CQQ A;  2CJJ A;  1TWC J;  1I6H J;  3BT9 A;  3GTJ J;  1OCP A;  1WI3 A;  1A6I A;  3L1P A;  1GV5 A;  3E7L A;  3TW7 A;  5FLV A;  2MGQ A;  5IP6 A;  2EZI A;  1WH5 A;  3BR3 A;  1U78 A;  3BG5 A;  4C3J J;  2LK2 A;  3GTM J;  3OSG A;  2ELK A;  2LVS A;  3IV5 A;  4MO7 A;  2ME0 A;  3HOW J;  2EZK A;  2YU9 J;  2NOG A;  5GPA A;  1QPI A;  2YUS A;  1ZGW A;  3BR6 A;  5E3O A;  1OFC X;  3VPR A;  2DA1 A;  3PM1 A;  5IPA A;  2OPT A;  3C2B A;  1BW6 A;  3LNQ A;  3UKG A;  3OSF A;  4RDU A;  1HDD C;  4IHW A;  2L9R A;  2QCO A;  5F0F A;  1W0U A;  4Y52 J;  3S1M J;  2LLK A;  5M3F J;  3ZQC A;  4DYC A;  1UG2 A;  1WCM J;  2IBD A;  4I76 A;  5HOD A;  1XC5 A;  2H1K A;  3A03 A;  4C2M J;  3ZQL A;  2M2E A;  4DZP A;  2TRT A;  2VKE A;  3FK7 A;  2NVT J;  1JJ6 C;  2FX0 A;  3BQZ A;  4MFD A;  2X48 A;  4AYB N;  4AUX A;  2DJN A;  5DS9 A;  3F0C A;  1P7J A;  3IH2 A;  1O4X A;  2ECB A;  3O8H A;  1JJ8 C;  1LE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...