5C4XJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c4xJ00
3IH4A 4X1EA 3SJMA 3I4NJ 2DA2A 1RPWA 1A5JA 3BG9A 3BG3A 5IP9J 2ID6A 5EZGA 2ZB9A 3RZOJ 3B6AA 4DYQA 2X48A 3BR3A 2WAQN 2XPVA 2XPUA 1IGNA 5K7ZA 1GVDA 5E3OA 1JT0A 2OPTA 2CQXA 4QIWN 3L1PA 1K61A 3C2BA 2K40A 5FLVA 5IYCJ 3PO3J 3ZQHA 1RR7A 2H1KA 4RDUA 5IYBJ 4A3JJ 2DMQA 1VNDA 2VUMJ 2L7MP 1BA5A 1R9TJ 3BTJA 2VKEA 4A3BJ 3PO2J 5IOYA 1AKHA 4FE4A 4A3CJ 1TWAJ 2VI6A 1ZQ3P 3FISA 1OFCX 2EZLA 1U9NA 1ETYA 2VPRA 3JRBA 2FD5A 4HNVA 2HXOA 1HDPA 1ETWA 3JR9A 2FQ4A 2FX0A 5EG0B 3ZQFA 4G12A 2H8RA 2M8GX 3S2DJ 5C4XJ 1MNMC 1I3QJ 4D7NA 3G1LA 1ZK8A 4FE7A 1P7JA 3HM5A 1W0TA 4M3EA 2CUEA 2DA5A 5EYRA 5BNGA 3HOVJ 2R5YB 1DU0A 3OSGA 2YUSA 2IAIA 5FKNA 4I6ZA 2XGEA 2R5ZB 2CUFA 2NVQJ 4MIMA 2XSDC 1YRNB 4A3MJ 3S16J 1MBHA 3BTLA 9ANTA 3S1NJ 3FKIJ 2Y30A 1GDTA 1HCRA 1I50J 3A01A 1W0UA 3QPLA 1Q1VA 1WPKA 1GUUA 2K9SA 2DMNA 2M0CA 1ETKA 1MBGA 4MFDA 1RETA 4XRSG 1TC3C 1JTXA 1QVTA 1ITYA 2R92J 1Z0XA 1VF9A 1IUFA 4A3DJ 5F04A 4FCYA 2KT0A 3ZQIA 2R0QC 4B3AA 5FKLA 5EZHA 2Y9YA 2YU9J 2JN6A 2HYJA 2JMWA 2E1OA 1NTCA 3FK6A 3MKLA 2W48A 3GTGJ 1ETQA 1VI0A 3HBLA 4MFEA 5JLWA 1Y1VJ 5FJ8J 1CQTA 3HKZN 3JRGA 2HQ5A 1OJLA 2JK3A 2RAEA 1HOMA 4Y7NJ 5HODA 1AKHB 4XK4A 2IEKA 2CJJA 4L5EA 4AC0A 5E3MA 3S17J 1O4XA 1P7IA 2M34A 2ID3A 5K7HA 1AHDP 2NOGA 1FJLA 1FIPA 2EQRA 4J19A 4BBRJ 4A3GJ 3K7AJ 3S1RJ 1D5YA 4A3LJ 3JRCA 2GM4A 4EEFG 1NK2P 3OSFA 1SFOJ 4UUSA 2N8GA 3GTJJ 1WH5A 3Q0WA 4ABZA 3ZQCA 1U78A 3I4MJ 2ME6A 2I10A 3CMYA 4JX4A 2L7ZA 1FTZA 3ZQGA 1H89C 3HGGA 1OCTC 1MH3A 5C3EJ 4CYCA 4A3FJ 3GTMJ 3HOWJ 4BY1J 1T56A 3DCFA 5IP6A 4RBOA 2K9NA 3FIWA 3OOUA 2NVXJ 4V2FA 2TCTA 5M5XJ 5M5YJ 5C44J 1MBJA 4JX5A 1MBFA 2AHQA 3IV5A 3Q3SA 3MN2A 5E3NA 4B1RA 4B4CA 5EGOA 3S2HJ 3W6VA 1JKOC 4JP0A 2PMZN 2DA4A 4M6VA 2MGQA 4D5FA 3RZDJ 4FISA 5J1RA 3A01B 3HEFA 3HOZJ 4FTHA 4QTRA 3O8HA 3BQZA 1TWGJ 5F0CA 3ZOBA 3HGYA 3SFIA 1MSEC 2MG4A 5FLMJ 2JA8J 2DMPA 1ZKGA 3CCYA 3TEDA 3S15J 3ZQLA 4S0HB 2Y2ZA 1WI3A 2JA6J 2COBA 3BR1A 1JTYA 4LOCA 3LOCA 3OIOA 5JLXA 1APLC 1MH4A 3S14J 4A3KJ 3MVPA 1I6HJ 4D5CA 3FK7A 4MLOA 2E2JJ 5F27A 2R7ZJ 3BR2A 2JWTA 4GFBA 3GTOJ 2JA7J 3BT9A 2DA7A 2EH3A 4Y52J 4JYKA 5EEAA 5M3FJ 4A3IJ 1LFUP 3QPSA 2M2EA 1BL0A 2CU7A 2Y31A 4D7MA 2HI3A 1B8IA 3JRIA 1RESA 2JA5J 4XIDA 3WHBA 1Y1WJ 1XS9A 1IRZA 2ECCA 1IDZA 3H0GJ 3GTKJ 4NDLA 1MBEA 2EZHA 3A02A 4C3JJ 2LP0A 4DZPA 4XICA 4XRSA 4DYRA 4IHVA 4UUSB 4DZJA 3BR6A 3BG5A 1RKTA 1FEXA 1JUPA 5E3LA 2CQQA 2WB1N 2WV1A 4CYCB 3A03A 2DA6A 2EBIA 4IHWA 2LK2A 1HLVA 2HOTA 5FKKA 1WH7A 2LKXA 2D5VA 4DYCA 2NS7A 2MSYA 1ZR4A 2X6OA 3TW7A 2L0KA 3JRDA 5EGOB 2G0EA 4M3FA 2EZKA 3CQZJ 1HDDC 2DTZA 2M9HA 1ZGWA 3BTCA 1IV6A 4IHYA 3TP3A 2LY9A 2E19A 3E7LA 1IJWC 1MSFC 2ELKA 5M3MJ 5F0FA 2HXIA 2NS8A 1K83J 1JKPC 1GV5A 4W1UA 5FKMA 1GV2A 2OF7A 3S1MJ 2HDDA 3HOUJ 4BXXJ 1ZR2A 2GBYA 5K7FA 3SDGA 1IG7A 5EF6A 2LLKA 1OCPA 3PM1A 4C2MJ 2P81A 1UG2A 1FTTA 5DTDA 4M3BA 2AO9A 5F08A 1IC8A 1T33A 3G1OA 3IH2A 2KDZA 3LSJA 4V2GA 5FKOA 2XB5A 3GBGA 3Q0UA 5IOZA 4A3EJ 3QQAA 3BQYA 1NK3P 2DN0A 1B8IB 1ORKA 5F1JA 1X2MA 2YS9A 1AU7A 2E2IJ 2LFBA 2JJ7A 1B72A 2DMTA 3RKQA 1RKWA 1LE8A 4UUTA 1X58A 3GTPJ 3BR0A 2IBDA 3F0CA 1TWCJ 2CRGA 3JREA 1F43A 2NVTJ 1ETOA 2K9QA 3HOYJ 1MBKA 2LVSA 1JT6A 2O7OA 3D1NI 1PUFA 5GP9A 5F0HA 5IYDJ 1DU6A 3TP0A 1JKRC 4C3IJ 5DS9A 2HOSA 3JRHA 1FIAA 3RQIA 2MW8A 4QSHA 1ETXA 1G2HA 4DW6A 3BR5A 1JUMA 2E2HJ 2B63J 4I76A 1U8BA 2DA1A 2NVYJ 5J1YA 1POGA 4MO7A 3LSPA 4C3HJ 1ETVA 2GLOA 1S7EA 1H88C 4JX6A 1UMQA 3Q0VA 3LSRA 1JGGA 1ZTRA 4M3DA 4BKXA 2ECBA 5M5WJ 2O8KA 1H8AC 5IP7J 5GPAA 3IH3A 5C4JJ 1U9OA 3WHCA 1GT0C 5EDNA 3DEWA 4AUXA 4BY7J 1JJ8C 1F36A 1UHSA 3GTLJ 4W97A 1JUSA 1BW6A 1JJ6C 3CDLA 2ME0A 2Y9ZA 3UKGA 1QRYA 3G1MA 1X2NA 5J1UA 3K2AA 1HF0A 2O9LA 2L9RA 1LFBA 5IPAA 1VFCA 3TW6A 3O8GA 4IEJA 4XRMA 3GTQJ 5EG0A 3JRFA 3M4OJ 2R93J 3JRAA 2FJ1A 2QCOA 1TWFJ 2XGDA 2L7FP 3LSGA 3LNQA 1BW5A 2EZIA 1Z77A 4AYBN 2HOAA 2DA3A 3NAUA 2VKVA 1B72B 2LD5A 1QPIA 4BBSJ 2QF7A 2XGCA 2XRLA 1A6IA 4M3GA 2R5YA 4A93J 1LE8B 2TRTA 1QVUA 2DJNA 2R5ZA 4IHXA 3S1QJ 1XC5A 3NARA 3VPRA 5GPCA 2XPWA 1WCMJ 1E3OC 3B6CA 3M3YJ 1TWHJ 3BTIA 1YRNA 1IDYA 4X6AJ 2XB0X 3HOXJ 2LTPA 2DMUA 2X9DA 1PUFB 3HDDA 1SANA 2Y0SN 1WGXA 3HB9A 1JKQC 1XG1A 5J3LA 3H3VK 1EF4A 2LR8A 4A69C 1ENHA 1BJZA
chains in the Genus database with same CATH superfamily
1XD7A 3F8CA 3FHZA 5LRRA 3IH4A 1A36A 4X1EA 3SJMA 1A5JA 3K4MA 3MZ8A 5EZGA 1O3QA 1X1BA 3P7NA 2D1VA 4MTEA 3X2QH 5A2QZ 3RKYA 5E3OA 3ZQ7A 2CW7A 4HF1A 3LAPA 1FMWA 4D1QA 4KICA 3E6MA 3FWEA 2P6SA 1QO0D 5IYBJ 4O3MA 4NQWA 3ZXSA 2X4HA 2VUMJ 2P5KA 3DFGA 3L9FA 2L7MP 1J5YA 4U87A 3BTJA 1SMYF 2EV6A 2Z9OA 2WV0A 2L01A 1GLNA 1XN7A 1J09A 1G3SA 5DCMB 3F6VA 4A3CJ 4HRIA 2E5NA 2JSPA 2K5CA 3G3ZA 2BE5F 4I99C 2FQ3A 1U9NA 1B59A 2K4BA 2VPRA 2E1CA 5E8GA 2FD5A 1W7PA 3TO9A 3I64A 2HXOA 4JQFA 4OOIA 4E7IA 4P55A 1FOXA 4Y3OA 1G3YA 2D45A 5IT9K 4IJAA 1VQNI 1KU9A 2M8GX 1JGSA 1DUXC 3S2DJ 4XORA 2BOLA 2AXLA 3SZGA 4WX9A 3F8FA 2HVRA 3QPTA 3L2UA 3DWLE 4FE7A 4Q47A 5EYRA 3ABUA 5BNGA 3HOVJ 1RUOA 2DPDA 2Y48A 2R5YB 2YX7A 2IAIA 5FKNA 3GZNB 2XGEA 4E7LA 4DBQA 1W4MA 3ULQB 3RYPA 4BJ5C 2FNPA 1V5EA 2CUFA 5DUKA 3T0YA 3FM5A 2NVQJ 4MIMA 2WBMA 1MMDA 1MBHA 4KN4X 5HDKA 2LKSA 3C2GA 1OR7C 2L7KA 3M9AA 1Q1VA 1WPKA 4PDKA 5D4RA 2F4IA 1IUYA 1GUUA 3J80Z 4A0XA 2E35A 2M0CA 3OOPA 3PNVA 1ETKA 3H9GA 4E7SA 3WU1B 2PLYA 1MBGA 4XRSG 1RETA 4ASNA 2O61A 4BHCA 2X6WA 5D6EA 2HGCA 2ELHA 4B44A 2R92J 5LHIA 5DM6F 1VF9A 5FFXA 1IUFA 5CQGA 4UVAA 4WXCA 2KT0A 2RKHA 4N4NB 1UHMA 2VOOA 3BPXA 3LA2A 3PFIA 4RAYA 1EA3A 4C30A 1W7PD 2IJLA 4EM2A 4BE0A 2R4GA 2DXIA 3ONQA 2R7QA 2JMWA 4HX8A 1KU7A 5E1WA 5EJCA 3PL8A 4ETSA 2KQRA 1ETQA 2NRAC 3HBLA 4MFEA 4PSXA 1Y1VJ 2CS3A 4CICA 4OIRF 1V4RA 3DU5A 2HQ5A 2IRFG 3MD2A 2EB7A 4XQFA 3MCZA 4L5EA 2VC0A 4A2UA 3VDXA 1O4XA 3A2KA 1ON2A 1FIPA 4MNUA 4HF0A 5HLTA 1IAWA 4BACA 4BBRJ 2ZO4A 4A3GJ 2QSGX 2DYRH 1SVLA 1B6AA 1Z05A 4EEFG 2RGVA 2XAGA 2BW3A 4A6DA 1KGSA 3GTJJ 1F4KA 3Q0WA 2FEZA 4EMSA 1QBJA 1LVAA 3ZQCA 3I4MJ 1IW7F 4L9JA 2R7WA 5KAIC 4HX7A 2XV4S 5FD6A 2L7ZA 3ZQGA 2HDWA 3TBIA 4I0AA 1R5HA 1Z3YA 4CYCA 1DGRM 2VONA 4LMYA 1T56A 4FETA 3FMSA 5CJ9A 1W36C 2PJRB 3DCFA 4RBOA 1G6NA 3OOUA 2NVXJ 1D0ZA 2TCTA 1MBJA 2H1LA 4JX5A 1LDDA 2M87A 3Q3SA 1MD0A 1QQIA 3MN2A 5EGOA 3QU3A 4Y13A 1N78A 4EJTA 3BJAA 4G94A 2QENA 3HL2A 1WJDA 4RGSA 3TDUC 2MGQA 4D5FA 2B7EA 1MMSA 2L4MA 2W85A 4YIFA 2RDPA 3HOZJ 2W82A 2X6XA 2DJIA 1TBXA 2XHKA 1TWGJ 2JT1A 2QQ8A 4ZJZA 1MSEC 4GYGA 5FFZA 3SFIA 5DYMA 2LREA 3I54A 4LJZF 3PFYA 1X1CA 2BXZA 2MD5A 4U7BA 3CCYA 3KLNA 1MJ9A 2H6BA 4S0HB 1Z6TA 2Y2ZA 2ZXHA 3ZMUA 1NG6A 3BR1A 1QHHD 3SQNA 3I59B 4A3KJ 3MVPA 1D8KA 4IRGA 4ESJA 3CLOA 4IF4A 4CA0A 4D5CA 5E8IA 3FK7A 1P2FA 1ZLJA 5KNLA 2IP2A 4P1WA 4LG0B 3FXJA 1A31A 4G6DA 2A05A 4GFBA 1QGPA 1HKSA 2HYGD 3BT9A 2LKPA 4Y17A 2DA7A 1OMIA 2VE8A 4BHBA 3ZN0A 3OYFA 3K1NA 1Z7LA 5KHDA 2GOXB 3H3UA 3PJRA 2KZVA 2PN6A 1H9TA 3PSFA 2WAEA 5FB2A 4XIDA 3JCUC 2ECCA 3WU0A 4LIVA 1TLHB 4C3JJ 2LP0A 1HKQA 2DPUA 2RC4A 5HLIA 1IXRC 5ILSA 6PAXA 2Z1DA 3RPUA 3BR6A 4ENKA 1RKTA 2Y0SA 3U2RA 4HNTA 2DK8A 5B1BH 5D4SA 4HSTA 4AIHA 5E3LA 4PFOA 3BWGA 4UV8A 2R7FA 3A03A 4N4OB 2CFXA 1ZRDA 1T0FA 2Z2SB 5HNHA 2VB6A 5HS9A 2HOTA 5FKKA 4Q48A 2CQNA 4IOCF 5FLXK 3RCOA 1ZR4A 1MNDA 2L0KA 4IXAA 2XF6A 3M7GA 1TQIA 5FD5A 3GFJA 2BHZA 3CQZJ 1HDDC 5KCMA 2M9HA 3BTCA 4IHYA 3WGGA 2FA5A 5CPRB 2LY9A 2E19A 3GUDA 2QA4I 2OD5A 4PFPA 4ZZDA 1KU2A 1MSFC 2ZJ2A 2F5FA 3HPHA 1YS6A 3FXOA 1GV5A 5FKMA 1HXDA 3C2HA 4LK0F 1BBYA 1NH3A 4XLNF 3BJ6A 1XDUA 1IRFA 2OF7A 3CO7C 3HOUJ 1BIBA 4G7OF 5K7FA 1REPC 3K4LA 2DQLA 2ZFUA 4KT6A 2K9MA 3HJEA 3HHHA 1UG2A 1D1BA 1XMKA 4S05A 4EJVA 5F08A 3BOQA 1T33A 1IC8A 1HW2A 2HVQA 4ZZLA 5FKOA 1LKXA 5IOZA 4A3EJ 2A6EF 2QM3A 2CV0A 1R4NB 1I5ZA 4YIIA 4I0BA 1BOBA 1SFEA 1OYIA 3I56I 1NK3P 1SFXA 3FX3A 3HRUA 2CV2A 1IXSB 3I58A 5F1JA 1X2MA 3DTEA 4UNOA 2E2IJ 2KISA 4JBAA 1B72A 2DMTA 1I1GA 2OZ6A 2DDBA 1FP2A 1N75A 1WKMA 5K1YA 1LE8A 1YOVB 1LDJA 5B5EC 4BE2A 1X58A 2M7BA 3GXOA 4CHUA 3F0CA 1PP7U 3IKTA 2RNGA 3WG7H 2ACJA 4O5VA 4ZH4F 2Z5UA 1JT6A 2A5WA 1K6YA 1XSDA 2IGKA 2X85A 5DS9A 1IRXA 2CUZA 3JRHA 3JSPA 2MW8A 4QSHA 1TZLA 3JW4A 2O3FA 2DFEA 3V42A 2O8XA 5DUIA 1E3PA 2EA2A 2B63J 2DA1A 2GA1A 2NVYJ 1KQ8A 3RPQA 2Y0MA 2K85A 4MO7A 2RQQA 4KIBA 4GCVA 5D5XB 4C3HJ 2GLOA 5F1RA 3GF2A 2HNHA 3JTHA 3CZ6A 4DBRA 3LSRA 1JGGA 4BEHB 4CH7A 4ENNA 1FYMA 4KDPA 2O8KA 5IP7J 3W2WA 4R8HA 3F8BA 4E7HA 3L2WA 2VPLA 1EH7A 3S3OA 2ISYA 3TDZC 1F36A 4W97A 1JUSA 4JOMA 2LG4A 2ME0A 5DCMA 3U1DA 4UHTA 4HLYA 1I6XA 1C0WA 3ML6A 1TQPA 2STTA 3OYJA 2F5EA 4EJWA 3VYRB 2F4MB 2L9RA 2MYSA 5IPAA 4PJJA 4XL9A 1ZG1A 2A07F 3TW6A 4XN3A 3O8GA 2V1UA 4ESBA 4XKBA 4XKWA 3CCSI 5L3EA 2R93J 3KE2A 2QCOA 1TWFJ 4DJAA 3QRFF 1Z77A 3HZJA 4AYBN 1NG7A 3WTSC 4ZTJA 1YFHA 2HOAA 3EUHA 2ESNA 5B1AH 2E1NA 1QPIA 2QF7A 4EATA 2HVSA 2R5YA 4OMZA 2VT3A 4AD9A 3FDYA 1BN5A 2VJIA 3CF5F 2QSHX 3K4KA 2R7UA 4G7HF 2ZMEC 4LK1F 1XC5A 4J01A 3NARA 1KONA 2EFPA 3S3MA 2XPWA 3BROA 1IDYA 3F9KA 2BV6A 4NUBA 5J8FA 1K4SA 1YLFA 2LTPA 1LQ1A 1VQKI 4L9NA 1SVOA 3HRTA 3OS1A 2LMDA 1L3LA 1JKQC 1XG1A 5J3LA 3KETA 1EF4A 1GHCA 2P0WA 4CCMA 3WG9A 4A69C 1YJ9I 2A5YB 2XROA 1MKMA 2QKLB 3U9GA 4IKFA 4MEXF 2M4KA 2DCEA 1S7AA 5H6RA 2EINH 2WTEA 3I4NJ 4MQ9F 1RPWA 1UELB 3IP4B 2PQ8A 3RZOJ 5K5OA 2WAQN 2XPUA 1BIAA 2CV1A 3EYIA 1IGNA 2HYFA 1GVDA 4OAZA 2OPTA 2JQ7A 4QIWN 5ICCA 3L1PA 2K7LA 4DIQA 4WXDA 2K40A 5IYCJ 3ZQHA 1XSVA 1RIOH 1TP4A 4RDUA 4A3JJ 1BR1A 5KAFC 2DMQA 4E6KG 1VNDA 4HV6A 3V4GA 1FOWA 3RDIA 1R9TJ 3HUGB 2ZCWA 4CXFA 3H35A 3OV8A 2ZXJA 4A3BJ 2HS5A 2DT7B 2R7DA 2XF5A 1YI2I 2EIJH 4FX0A 2LBFB 1FC3A 1XB4A 3G73A 2VI6A 1O3TA 2IGMA 3CESA 1ZQ3P 2EZLA 5E18F 3O3KA 4BJ6C 1I39A 1WQ2A 2DW4A 2GZWA 4M9XA 4HNVA 1HDPA 4CZCA 1ETWA 1VZ0A 2ZXWH 3JR9A 4EJOA 3CC4I 4G12A 3WE3A 3G4SI 1VQ6I 2G7UA 4C2TA 5C4XJ 1YX3A 2OU2A 3M8FA 1P92A 4F55A 2PMHA 1P6RA 4XLFA 4HSRA 5DCFA 2NNYA 4BH9A 4P96A 1ZK8A 4N9HA 1P7JA 3HM5A 3SFZA 4M3EA 4Y4RA 1MJBA 3LAJA 1J75A 5F6FA 3QP6A 1VQ8I 3KZZA 2EV0A 1P4AA 3K69A 4WXHA 1DU0A 2PJRA 3OSGA 1KYWA 4WWCA 5AIPA 2QKMB 2R5ZB 1HKTA 3NWSA 3LSKA 4YELA 4A3MJ 3S16J 2HZTA 3RI4A 2X1CA 1XGMA 2W1OA 3S1NJ 2Y30A 1HCRA 1I50J 4PJMA 4HYEA 1IXCA 4PJNA 3DEEA 1TQMA 2E1MC 4HZFA 1QNTA 1SFKA 2BY1A 1HW1A 1F1ZA 1JTXA 1QVTA 1VQLI 2HEOA 3CJNA 5B66C 3K10A 2DO7A 3T8TA 1Z0XA 5ERIA 3U1KA 2WADA 4A3DJ 1B4AA 2G7HA 5FKLA 3HHGA 3WU2C 2BBYA 4OMYA 3I59A 2HU9A 4PK4A 1FLIA 2YU9J 3CMAI 2JN6A 3KFWX 1KU3A 5LBQA 1LJ9A 5ICGA 1OYYA 3BG7A 4LG0A 2L02A 4FX4A 5FJ8J 5HNFA 3JRGA 2IT0A 2W7NA 3DKYA 1OJLA 1PDNC 4Y7NJ 1AKHB 2E5ZA 2XDVA 3K4NA 2V9PA 3K70D 3VSLA 3S17J 1BI3A 2Y75A 5JVGF 3QYFA 1AHDP 3H36A 3OYEA 1FJLA 3FMRA 2O6GE 1MIJA 3K7AJ 3Q9SA 4CZZA 2HOEA 2JPCA 3JRCA 3FXMA 4GDFA 2R7XA 4L5IA 1SFOJ 2GWRA 4HLXA 4IVNA 5D8KB 3GEZA 3S93A 3GW2A 4ZC3A 1X19A 4KFCA 2ME6A 3BCBA 3PQKA 2VE9A 3LWFA 1FTZA 1H89C 3VFZA 5C3EJ 4HDVA 1T08B 3V7CA 2GIZA 4G6TB 1HA8A 3FBNB 4B43A 2GOMA 4V2FA 5M5YJ 3BC8A 4E7ZA 4YFXF 1MBFA 3H0DA 3OS0A 4BYYA 1LNWA 4BAYA 4B4CA 1ULYA 2DI3A 5GTIC 2PMZN 2VKDA 4ENJA 2DA4A 1Z7UA 2PEXA 3LQQA 3TOBA 4I98B 3VYSB 5LGTA 2B0LA 1EKEA 2ELJA 1BI1A 1WZ2A 4CCNA 3J7ZI 3MZYA 2FXAA 1QZZA 3DPTA 3IAM2 2X1DA 3ZOBA 3ZMSA 4CSWA 1H0MA 2EWNA 1D0YA 2K27A 3D5RC 3I71A 2V6EA 1X3ZB 2P7CB 5LEKA 2DMPA 2PFBA 1TNTA 3LFKA 2KLOA 4IPAA 3ZQLA 1SAUA 2GIVA 1M1EB 1ZH5A 2JA6J 2K3FA 2VT2A 4AIJA 1LB2A 4QWQA 2LF8A 3LOCA 4U88A 5JLXA 2FOKA 1MH4A 5HOOA 1OCCH 5ICEA 1I6HJ 2DBBA 4EJUA 1Y8RB 1YW8A 3PIOF 2I5UA 2E2JJ 3DBHB 1UFMA 2K9LA 4M6YA 2KDOA 2R7ZJ 1X3WB 3BR2A 2DFIA 2JWTA 5LGNA 3RIRA 5FROA 4AYBA 2O03A 2XSJC 1KZHA 1EJ9A 2M4GA 4BHPA 5CLSA 4A3IJ 2IGNA 4BDZA 2WY8Q 2CU7A 5EEGA 3KYDB 2ZMEB 1T39A 4II2A 2CQ7A 2ISZA 2EV5A 1Y1WJ 5J4VA 3DPUA 5ED4A 3H0GJ 1G59A 3I55I 3A02A 4DZPA 1U3EM 3AG2H 5BQTA 3CUQC 2CW8A 1OR7A 3PUFA 4HBLA 4HQMA 2ZNZA 4HF2A 2CQKA 5H2FC 1FEXA 4XKCA 1DP7P 2IS2A 4NHJA 3SDBA 3ZN1A 2KIMA 2WB1N 2ZJQF 2DFHA 2EBIA 2L54A 2OUMA 3CCUI 4IRIA 2LK2A 1DP3A 3B73A 4LLNA 3I9V2 2W00A 3CCJI 2V1DA 2MSYA 1YHQI 4AU7A 3ESWB 1UCRA 3TW7A 3R61A 1O3SA 3DP7A 2KRCA 3BCAA 4KIFA 2WAQA 4LLLA 2A3SA 2G0EA 4FQGA 4M3FA 2EZKA 1STZA 3QOPA 2DTZA 5HDNA 1ZGWA 1USTA 2IA2A 2BHYA 3TP3A 1XMXA 1H9GA 3BJOA 1AOYA 2ELKA 5M3MJ 1CGPA 2VL8A 4F93B 2L4AA 4BEHA 1D0XA 1K83J 1U2WA 2Z16A 1SD7A 4AVZA 5GADJ 3S1MJ 2QWWA 4I09A 2P8TA 1JXSA 4XN0A 3S32A 1ZR2A 2VKHA 4P9FA 2GBYA 3EETA 2R7VA 1U5TB 1XTAA 2XAQA 3NEUA 5DD4A 4CGZA 3R60A 5D8LB 4CO8A 4HPQA 1Z1DA 2GXAA 5ICFA 1IRGA 1FTTA 2E7WA 5AONA 3ERED 3PNTA 1R1VA 4PSWA 3IH2A 2XB5A 1E0EA 3GBGA 4RM2A 3OYBA 1S6LA 3QQAA 2V7FA 2O0YA 4CCLA 2H94A 2K4JA 4YG2F 1ORKA 3DBLB 1DPUA 2LFBA 2VBZA 1YTYA 1QA6A 1OCZH 4KIGA 5IY5H 4M74A 2FNAA 4IOAF 3BZKA 3E1SA 4KN7X 3RKQA 3O2PE 4XOTA 3CDIA 1UHWA 3COAC 2E1MB 3JREA 1R5ID 3CMMA 2NVTJ 1ETOA 4PGHA 2V79A 1Y8QB 2JUGA 2Q2EB 3SYTA 3D1NI 5GP9A 2GQQA 2LSOA 1E3HA 3N05A 3AL0B 1FIAA 3RQIA 2CUJA 1S8NA 2AS5F 5CVRA 3QU6A 3HSRA 2VJ5A 4D9JA 1ZRCA 2OTJI 1IN6A 2W4SA 3FXQA 3CP8A 3LSTA 3GFLA 4I76A 1U8BA 3HSEA 2LDUA 3K1PA 4LGWA 2JRMA 2VXDA 5J1YA 2JPBA 2KIUA 1WVRA 1HC8A 1WJEA 1ETVA 5CVIA 3I0TA 4WF2A 3CCRI 3R6SA 4JX6A 3MMYB 3Q0VA 5BMZA 1SAXA 2F5VA 2F5DA 4HA8A 2DT5A 2UV1A 4BKXA 4XSXF 3ERMA 4L9VA 2RN7A 2IW5A 1GT0C 3C18A 3DEWA 4XRFA 4AUXA 1Y56A 5CYVA 3HUGA 2AQEA 4HQEA 2FBHA 1BW6A 3KEYA 3GLLA 3C3WA 3UKGA 2LBFA 1UAAA 4LB5A 4YFKF 2F4OB 4H0EA 5HS7A 1X2NA 2WY7Q 3K2AA 2PJPA 3FXLA 3J81K 1I27A 1FSEA 2CO5A 2D2WA 3H5RA 4E4HA 4EV0A 1Z3XA 2CFOA 4IEJA 5F64A 3K9TA 4M71A 1X1AA 5IT9Z 1T0FC 1XDSA 2JZYA 5FO5A 2WA0A 3WE2A 1J59A 1MNEA 2L7FP 2KIFA 3F8NA 2KRHA 3LNQA 2VLAA 1XMAA 2EZIA 4M9SA 2J5OA 1LVKA 2H27A 5GAHJ 3NAUA 5GTHC 2VKVA 5J40A 3TL4X 1A6IA 5E1XA 4A93J 1GXQA 1TT0A 1XGSA 2D1HA 3OYHA 2R5ZA 5GAEJ 1WI9A 2PMZA 3OY9A 3S1QJ 4AIDA 3VPRA 5GPCA 4X0GA 4Q5SF 2W25A 5CKTA 1TWHJ 3PQJA 2R7TA 3FKJA 4G7ZF 1WJFA 2L2OA 2DMUA 2X9DA 1PUFB 3VB2A 1SANA 4IO9F 5TJJA 4KJZA 3HDDA 3M1EA 1WGXA 3HB9A 2ICWG 4KA4A 5L3CA 1DPRA 2XVCA 3C7JA 2Z3YA 3JAMK 4GO1A 2NAZA 4RB1A 1W5SA 2DOFA 2OA4A 2DA2A 3RPUD 5AIQA 3BG9A 2ID6A 2ZB9A 2TDXA 3B6AA 1RNLA 4DYQA 4EVIA 3JSOA 2DYSH 2XPVA 1UB9A 1B1BA 5K7ZA 1JT0A 2MBFA 3ECOA 4LG3A 4UXNA 2CQXA 2M8EA 2FOWA 3LSMA 2R7SA 4G8XA 1K61A 3C2BA 3AG4H 4Y15A 1SD6A 5FLVA 1FBUA 3PO3J 1RR7A 2H1KA 3A1YA 4DQ2A 4XLAA 4JK1X 2PG4A 1S3JA 4YRVA 3WTTC 4AWXB 2MC3A 4XLEA 2VKEA 4H4KC 3AFHA 3GX4X 1V54H 1AKHA 5FRNA 4I02A 5D6FA 4P5OA 1SD5A 3CUQB 5LFAA 1TWAJ 4A0ZA 3FISA 3PUBA 2VODA 1R36A 3JRBA 1ZGJA 3EPZA 4B47A 1G4DA 1VQ5I 4B48A 4IRHA 3VOEA 4HG2A 1K7AA 4KISA 2GXBA 2M45A 1HBXG 3NQOA 2FX0A 5EG0B 3ZQFA 1FOKA 4RB0A 3G6EI 2QEXI 2HWVA 2WB1A 3DKWA 4HOBA 4CYDA 4MTDA 1R49A 1MNMC 1I3QJ 1S29A 2CW0F 4KMUX 3K4CA 3P9KA 2K02A 1BR2A 1A04A 2CUEA 3GVAA 3BZCA 1D5VA 4QPOA 5J47A 2YUSA 1LFPA 4LLGF 4I6ZA 3F8MA 2HPIA 3H5AA 4L9TA 3A4CA 4U0YA 3L2CA 1ZGAA 4LB6B 3BY6A 1FYLA 1JHFA 2XSDC 3V8KA 5D5WB 2KP6A 2UWMA 4KUMA 4LIUA 2EIKH 1GDTA 1W0UA 4OIPF 5JFRA 2LF7A 2NXNB 2DTRA 3ELKA 3T1BA 4MFDA 1TC3C 4ZDLA 4EGZA 3AG1H 2EIMH 3R4KA 5A2QK 2ZJRF 5F04A 5E20A 1R71A 2R0QC 4ON0A 5EZHA 2KFDA 2UXNA 3U21A 2QGUA 4CCJA 1CF7B 1IN7A 3VEPA 2E1OA 3MKLA 1R1TA 1VI0A 4M6XA 2MLKA 3EDPA 4B8XA 3HKZN 2MFZA 2YU3A 5E17F 2RAEA 3IHUA 5HODA 4XK4A 1YYVA 1BC7C 2IXSA 4KNYA 5J8CA 1MJAA 4AC0A 1MMGA 2UUZA 5E3MA 2W57A 2FMLA 3L00A 2ZMEA 2DK5A 4M9ZA 4RGRA 2ZC2A 2XAUA 5K7HA 5D5VB 1YIOA 2EQRA 3BP8A 2XAFA 3OL3A 1D5YA 4A3LJ 2GM4A 3OSFA 3OYGA 3WTUC 2IVMA 2N8GA 3P5JA 2X6YA 2I8DA 1WH5A 3OYDA 4ABZA 2XAHA 4OWRB 1J9IA 2HR3A 3UNGC 5LD2C 5FGMA 4JX4A 3K2ZA 4PGGA 3LFUA 5CVJA 3HGGA 3W2AA 1L0OC 1OCTC 3E97A 4IZZA 1MH3A 3GTMJ 1WWXA 4BY1J 3REOA 1K79A 5IP6A 2K9NA 3FIWA 1MDMB 3VYUB 1Z67A 5FLXZ 5C44J 3GLXA 2KJBA 3DV8A 5J4YA 3IV5A 3E6CC 2CG4A 5E3NA 4B1RA 3CCVI 3W6VA 3DU6A 3S2HJ 4JP0A 4EGYA 3KP6A 4A12A 2V1NA 1OLTA 3TKYA 3E0JB 3A01B 3HEFA 4GGGA 4NC8A 4QTRA 3Q5FA 1FX7A 3J80K 3O8HA 3BQZA 2KRFA 4UB6C 3ECHA 3V7RA 5FLMJ 4HEA2 2EFWA 1E17A 3S15J 4Q4ZF 3SEQA 2ZSIB 3MKYB 1UG0A 1YITI 2COBA 1U6GA 1U5TA 4M73A 3AKZA 3S14J 3CO6C 3KPHA 3WTVC 1IN8A 2YSRA 2VIXA 1X3UA 2DFFA 2XKPA 1RUNA 3IKVA 5DEQA 2VQGA 3CCQI 4OAYA 3QODA 3KCCA 5H6QA 1S72I 3K70C 2OC6A 3BLYA 3GTOJ 2GAUA 4N0BA 2EH3A 4Y52J 1D1AA 1Z21A 2Q1ZB 3ZPLA 2OZUA 2ADUA 3QPSA 1LFUP 1BL0A 4QLCU 3KP4A 4D7MA 2HI3A 2F48A 3JRIA 1BR4A 5CQEA 1XS9A 1IRZA 3OYNA 3DXJF 3EQLF 3GTKJ 4U0VA 5HLGA 5DDGA 2Z33A 4NDLA 1MBEA 1TT5B 2EZHA 4KT5C 5DM7F 1NHAA 4IHVA 2HKOA 4UUSB 1R4MB 3ZMTA 4XNFA 1V5GA 3AG3H 1XCBA 1OCRH 1HSTA 2KHMA 4ITVA 1JUPA 3KLOA 5JR3A 2DAOA 4BUPA 1R6RA 2CQQA 2WV1A 2Q2EA 2HTSA 2XASA 3WTWC 3MKWB 1EV7A 1XSXA 2DA6A 4ZYAA 4RLQA 4IHWA 2LC2A 1IN4A 1R5GA 4BNCA 3QYEA 1WH7A 2D5VA 1ZELA 2BYVE 3R0AA 5JHUA 4NC7A 4RAGA 2YX4A 4HW0A 2X6OA 1W5TA 2M0MA 4MHGA 2ZJPF 3HTSB 2JRTA 2OBPA 3DTKA 1HQCA 3KYCB 4BGDA 2M30A 3K4BA 1G3WA 1Z91A 1ONVA 3E7LA 1MGTA 1IJWC 3FXRA 3GWZA 1ZHFA 5F0FA 2HXIA 2NS8A 1WJCA 1IF1A 3FHNA 4II3A 4NNJA 2CWEA 3QYBA 2BY2A 4EM1A 3PIPF 1PVEA 2HDDA 3ZGKA 4BXXJ 3JTGA 1TNSA 4RAFA 5L3DA 3TOAA 3B02A 3CD6I 2H09A 2V1XA 1FSHA 1VQPI 2R7OA 4XKVA 2QQAA 4UVBA 1OCPA 3TQNA 3ASOH 4WK8F 3ISPA 2L9NA 2P81A 4C2MJ 3N4MA 4M3BA 2EFNA 1BOAA 4OINF 2P7VB 2OJED 2KDZA 2DDAA 3WGHA 3KP7A 2A6HF 1IN5A 4DGWB 3N97A 2BY0A 4IX7A 1XCVA 2UZKA 3BQYA 3EYYA 1ERDA 1E2XA 2KPMA 3S8PA 1IV8A 2JTVA 4L5JA 1DGWY 1B8IB 3CUOA 2YS9A 5J6XA 3OR1C 1AU7A 2IPQX 1Y39A 2RQPA 2JJ7A 3OIQA 1ZLKA 1R7JA 2JUCA 1AWCA 4MQVA 1R58A 3OR2C 4BL0B 2GXGA 3HIFA 3GTPJ 2VBWA 1YW9A 3I4PA 3TO7A 3BR0A 5BOXA 2IBDA 2IS4A 1F43A 2QVOA 3L2VA 4DOZA 4ESFA 3HOYJ 1S7OA 2HKXA 2PX9A 3IC7A 2BZTA 1PUFA 4AVPA 1FYKA 1JKRC 3H9JA 1OQYA 4C3IJ 1RI7A 2HOSA 4I2OA 1FNNA 5EEHA 3J7YJ 1SD4A 1JHHA 3ZR8X 1TL8A 2A69F 2XF7A 1ETXA 2P4WA 4DW6A 4PUSA 2E2HJ 4XR6A 3G2BA 2Z99A 1MMAA 2OQRA 2WC2A 2CSOA 1OCOH 5JHFA 2NYXA 4ZYDA 1J7KA 1RR8C 1Z6RA 2M1BA 1POGA 3LSPA 1YJWI 2X1EA 1S7EA 1MZBA 1H88C 3SXYA 2R3SA 2G9WA 3GO5A 3S3NA 4E70A 4GXOA 1ZTRA 3BG6A 2ECBA 4F3QA 5M5WJ 3HXLA 3HKZA 3V7SA 1S9HA 3L2QA 5GPAA 3IH3A 2P6TA 3O6BB 3QP5A 5C4JJ 1U9OA 2P5LC 2E34A 5L3FA 1T8IA 4UY8I 2A61A 3SZTA 1JJ8C 2QQBA 3IUOA 1K6OA 3OS2A 1QRYA 3ABLH 4K2EA 3CUQA 4XBFA 1O3RA 3H3ZA 5DD8A 1U8RA 1HF0A 2DOEA 1LFBA 1BI0A 3W6KB 4BQOA 2EK5A 2QSFX 4HX4A 4CDGA 4RAZA 5EG0A 3GFMA 3JRFA 4IQ4A 3GZ5A 4PJLA 2V6CA 4GYIA 2NVUB 4BE1A 3HPGA 2FJ1A 2XGDA 1WJBA 1AA7A 1WSUA 1O7LA 3D0SA 2F6CA 3OL4A 3Q9VA 2DQRA 3E3VA 4RB2C 2FU4A 1UZCA 4RGUA 3H1CA 1VQ7I 4ZDOA 1WJAA 1SEUA 2E7XA 2QBYB 3D5SC 2DA3A 2DLLA 1FMVA 2NOJB 2V9VA 5TGTA 4NBQA 1XX5A 2LD5A 4BXFA 2XGCA 4OU0A 1QVUA 5E1ZB 1K78B 1P4XA 4D0PA 2MD0A 4IHXA 2IGOA 3DLAA 4QPQA 3ROUA 3LL7A 1BJAA 1QZEA 3FXKA 1WCMJ 3HTUA 3B6CA 4U0WA 1E3OC 3M3YJ 1T95A 3BTIA 2DODA 4X6AJ 3WTYC 2FBIA 1V3FA 3HOXJ 1EH6A 2Q8KA 2FUG2 3DTIA 5L3GA 3H3VK 4UUVA 3KYLA 2BVLA 5L3BA 2ETHA 3WTXC 3LMMA 3BG3A 4XLCA 1RC9A 2QZ8A 5IP9J 2V4JC 4G9YA 1EH8A 1WFXA 4L0YB 1XPXA 2X48A 1TW3A 3CJQB 3D5LA 3BR3A 3S2WA 2VJ4A 3WTZA 2Q0OA 1J2XA 4BXUA 2FMYA 1QU3A 4A5MA 3HC7A 3F3XA 1FOYA 3VYTB 3J7AY 1LDKB 3M07A 2OTLI 3H5NA 4KYWA 2WAFA 2DOAA 1FWZA 4M72A 4A0YA 1V5FA 2BVMA 2KIQA 1CF7A 2C6YA 3KEQA 3CJRB 2XAJA 5TRDA 2LH9A 1BA5A 3RSNA 1LPQA 2L3DA 3F21A 3PO2J 2X51A 5IOYA 5LLQA 4FE4A 3IRRA 1P4WA 4L0ZB 3HOTA 4OIOF 3LA7A 1OFCX 4XLHA 5BPIA 4XSZF 1ETYA 3WODF 2DU9A 3MFKA 2MC4A 2FE3A 1Q1HA 2FQ4A 2M7AA 4MEYF 2F5CA 2OV7A 2H8RA 1IO2A 2O5RA 3F22A 4AM3A 1WHUA 2BGCA 3RQ4A 1X1DA 3K6GA 4D7NA 2HPMA 4BDYA 5JVTA 2EA4A 5CVVA 5HDGA 3G1LA 4C2UA 1W0TA 2PBIA 1HSJA 4IHTA 2DA5A 2RREA 2XIGA 2E60A 3HRMA 4DNCA 3QWLA 1YQAA 5IT3A 4UB8C 1Y0NA 2ESHA 3RTRA 4E7JA 2XGXA 1RRJA 4EM0B 4XOPA 1MDMA 4XM3A 1UJ8A 2VBYA 3LQRA 4HV5A 2YR2A 2JVHA 1W36D 1YRNB 1V55H 3P9CA 2VBXA 3BTLA 9ANTA 2KMUA 2NNNA 2WWYA 2ZSHB 3FKIJ 1YIJI 5FRMA 3MEXA 3A01A 3QPLA 4I01A 1X4PA 2M5WA 1X1PA 4BJTA 2K9SA 4R79A 1ZRFA 2DMNA 3GCMA 2E36A 1RZ4A 3M8EA 4RS8A 2DT6A 3L09A 1O7FA 1KYZA 4YEJA 4BU2A 1QPMA 2KKOA 1ITYA 2LRDA 2AXTC 3QPHA 4FCYA 5LHGA 1USSA 3ZQIA 3HSFA 4WCGA 4B3AA 4ZDPA 4ZTFA 2MLGA 2L5QA 2OQGA 2Y9YA 1G8XA 5TISC 3VWBA 1A6QA 1ZARA 3CMEI 4LD5A 3KX2A 2HYJA 3FM3A 2FF4A 4UV9A 1NTCA 3CF2A 3FK6A 4NQWB 2W48A 1FBQA 3GTGJ 2Y69H 5ILUA 5BPDA 4TV7A 1VQMI 4P9UA 5JLWA 5D5UB 1ZG5A 2MA3A 1CQTA 3SHFA 2HFHA 2JK3A 1HOMA 1R23A 1ODDA 3EUAA 3NRVA 4XONA 2IEKA 2CJJA 2JVGA 2VASA 2KL4A 4YIRX 2W24A 2LOOA 1OYWA 2H8WA 2VJJA 1P7IA 2M34A 2ID3A 3E5XA 1VQ4I 3J7AO 2NOGA 1W7PB 3I53A 4J19A 1YG2A 3FXUA 2LY2A 3S1RJ 5H20A 4U7DA 3HRSA 3RJPA 1NK2P 4A5NA 3E5UA 2OCEA 4XMYA 4UUSA 3OMYA 3M8JA 4J00A 2BY3A 3ZP5A 3V8JA 1U78A 3DBRB 2VXZA 2I10A 4IHSA 3CMYA 2E71A 2W84A 1PJRA 2NS0A 5GAGJ 1ZN2A 4A3FJ 1YO5C 4IQJA 3HOWJ 3KP2A 2V26A 4F52A 1SVMA 1VQ9I 2HQAA 2KJCA 3V8LA 2QYOA 3F6OA 4F92B 3SZPA 3T5XA 5M5XJ 4NB5A 4ZYEA 2AHQA 2FRHA 1S5LC 2LNBA 4ZYHA 1JKOC 3E6DA 3OYLA 2BEOA 2UXXA 4M6VA 1SFUA 2ZNYA 3K0LA 3RZDJ 2MH9A 3QOEA 4FISA 4O6JA 5J1RA 1YS7A 2F2EA 2ZKZA 4FTHA 4ENMA 1X4OA 1A35A 2XKOA 4PZJA 4RM3A 3HGYA 5F0CA 1GXPA 1I1SA 2MG4A 4ZYGA 4FT8A 4PCQA 2JA8J 5DV5A 1ZKGA 2FSWA 2V9KA 3TEDA 4RMNA 3H9QA 4Z2YA 3GYHX 3KP3A 1WI3A 3W3CA 2PI0A 3EUKL 3ABKH 1JTYA 2IA1A 4LOCA 3OIOA 3KEOA 1APLC 2IA0A 3C1DA 4YFNF 2LYCA 3CC2I 4MLOA 1PP8F 1G3TA 2P5VA 3FF5A 5F27A 3GZ6A 3K4JA 1VQOI 3IL2A 1MMNA 2HQRA 3ABMH 2KZGA 4CCOA 2QQ9A 3A0HC 1LEAA 1ZAOA 2JA7J 2JSCA 1T38A 5HS8A 2L9SA 4JYKA 5EEAA 2XRNA 4ANJA 3OYCA 5M3FJ 4KITB 2GA2A 1Y0UA 2M2EA 1B9MA 2Y31A 3IRQA 3CCLI 1FY7A 3E6BA 3W2VA 1B8IA 1RESA 3MAJA 2JA5J 1T2KA 1K4TA 3WHBA 1FBSA 3KP5A 1DDNA 1IDZA 2XUBA 4HNUA 4XICA 4NC6A 4XRSA 2BW3B 4DYRA 1XGOA 2QLZA 2XC7A 4DZJA 1D8JA 2OCCH 3AAFA 1GVJA 3BG5A 3TGNA 4AIKA 1VTNC 2HDCA 1FZPB 3FZVA 1LUJB 1T6SA 4B09A 1KA8A 5HLHA 3OYMA 4CYCB 2HTJA 1OPCA 1PUEE 1HLVA 2BXYA 2LKXA 3PSIA 1BC8C 1IZ1A 4DYCA 1P9QC 2NS7A 5KVRA 2CYYA 3CCEI 1FPQA 1QZYA 1T98A 3EUHC 1N25A 1D1CA 3JRDA 2QUFA 5EGOB 4Z6YA 4E7KA 5B3SH 3IWFA 4R1HA 2YPRA 3FMQA 2K86A 2A68F 5K5RA 3GMEA 1IV6A 2IS6A 3BDDA 5E79C 2STWA 1SC7A 5KK1A 3QAHA 3G71I 3LSHA 1BM9A 1JKPC 4FHTA 3KZYA 2ZBKA 3MZHA 1ZYRF 4W1UA 1TTYA 3VODA 1GV2A 1WRJA 1OISA 2VQLA 3OYKA 3CDHA 5LRSA 3MQ0A 3WGIA 3HYIA 3SDGA 3DLLF 1IG7A 5EF6A 2CMPA 3CLQA 3TMOA 3RKXA 2LLKA 1HW5A 2PMUA 1FT9A 2CGPA 4LITA 3PM1A 3KZIC 3P9IA 1YJNI 2ZFWA 5DTDA 2EJRA 4RA2A 2AO9A 3J81Z 4BQNA 1FP1D 3G1OA 3MKZA 3LSJA 4V2GA 3DKXA 4HDUA 2VC1A 3F72A 3Q0UA 5BS6A 4FASD 2ZXIA 2HQNA 3HG9A 3F23A 4EQQA 2DN0A 2VOPA 3GFIA 3DF8A 2COMA 2QBYA 3E5QA 1XGNA 3ZMZA 4BS9A 3IAS2 4OIQF 2X0LA 3K1MA 1ON1A 3BZ6A 1RKWA 3SEZA 4UUTA 1K78A 2EFQA 3ZCOA 4A6EA 2OAZA 3A0BC 1TWCJ 2CRGA 1ZREA 3NWTA 2K9QA 4RGXA 3RKWA 4F7ZA 1ZG3A 2A6TA 1MBKA 2EILH 1WJ5A 2LVSA 3DQVC 1W1WE 2O7OA 1DU6A 5F0HA 5IYDJ 4N9IA 3TP0A 3W6JB 4BQQA 4CUGA 4RLFA 3LSIA 3M1CA 1QHGA 1YX5A 3OWTA 3ZMVA 5LGUA 1U5TC 1TW2A 3T8RA 2B9SA 4HAMA 3KIOA 5K5QA 3JAMZ 1G2HA 3BR5A 1JUMA 4G6QA 1F5TA 4XLPF 1N77A 2R7RA 1MW7A 3CTAA 2CH0A 4C9YA 1KQ0A 1JE8A 2FBKA 2VQHA 4S04A 3MWMA 1UMQA 2JA2A 2K3PA 5CVUA 4M3DA 1F9NA 1OKRA 5LHHA 4MGRA 1H8AC 2LY1A 1DQUA 2J5PA 1B9NA 3WHCA 4UVCA 5EDNA 4B3XA 4BY7J 3I3LA 1UHSA 1YE9A 1SMTA 2RVCA 2VQCA 3L7WA 3GTLJ 1JJ6C 3CDLA 3ABTA 3OIPA 3HOSA 2Y9ZA 4RB3C 1R22A 3G1MA 4V19K 4L18B 2MH2A 1D3YA 5J1UA 3VSKA 2M3AA 2O9LA 1W5CC 3OYAA 2VN2A 1VFCA 2HZDA 3LA3A 4XRMA 3GTQJ 3R0JA 3M4OJ 2IS1A 4I7HA 1R00A 3CJTB 1YW7A 3JRAA 3AL0C 3ZMDA 3LSGA 1Z9CA 3L2RA 1BW5A 2RV8A 5HVQC 1BI2A 3I5UA 1O57A 3ZQQA 1KQ9A 4PJ0C 3ZRGA 2L9VA 4F91B 1LEBA 2EFOA 2RNJA 1B72B 3CC7I 3DPLC 2AQFA 4BBSJ 2XRLA 4M3GA 1ACIA 1J0RA 3ASNH 3IWZA 1LE8B 5ILVA 2TRTA 3FBIB 2MABA 3DEUA 2DJNA 3CP2A 4IL6C 5LEJA 3OYIA 4CCKA 3PNYA 3TO6A 1I3AA 1YRNA 2XB0X 1R1UA 1U0JA 3H92A 2Y0SN 3RYRA 4Y33A 3BPVA 4LFUA 1PYVA 2H6CA 2LR8A 5JI6A 1ENHA 3UR3C 2EPFA 1BJZA 1Y6IA 3CCMI 4BQAA 1JI8A 4GRIA 4KMFA
chains in the Genus database with same CATH topology
3IH4A 4X1EA 3SJMA 3I4NJ 2DA2A 1RPWA 1A5JA 3BG9A 3BG3A 5IP9J 2ID6A 5EZGA 2ZB9A 3RZOJ 3B6AA 4DYQA 2X48A 3BR3A 2WAQN 2XPVA 2XPUA 1IGNA 5K7ZA 1GVDA 5E3OA 1JT0A 2OPTA 2CQXA 4QIWN 3L1PA 1K61A 3C2BA 2K40A 5FLVA 5IYCJ 3PO3J 3ZQHA 1RR7A 2H1KA 4RDUA 5IYBJ 4A3JJ 2DMQA 1VNDA 2VUMJ 2L7MP 1BA5A 1R9TJ 3BTJA 2VKEA 4A3BJ 3PO2J 5IOYA 1AKHA 4FE4A 4A3CJ 1TWAJ 2VI6A 1ZQ3P 3FISA 1OFCX 2EZLA 1U9NA 1ETYA 2VPRA 3JRBA 2FD5A 4HNVA 2HXOA 1HDPA 1ETWA 3JR9A 2FQ4A 2FX0A 5EG0B 3ZQFA 4G12A 2H8RA 2M8GX 3S2DJ 5C4XJ 1MNMC 1I3QJ 4D7NA 3G1LA 1ZK8A 4FE7A 1P7JA 3HM5A 1W0TA 4M3EA 2CUEA 2DA5A 5EYRA 5BNGA 3HOVJ 2R5YB 1DU0A 3OSGA 2YUSA 2IAIA 5FKNA 4I6ZA 2XGEA 2R5ZB 2CUFA 2NVQJ 4MIMA 2XSDC 1YRNB 4A3MJ 3S16J 1MBHA 3BTLA 9ANTA 3S1NJ 3FKIJ 2Y30A 1GDTA 1HCRA 1I50J 3A01A 1W0UA 3QPLA 1Q1VA 1WPKA 1GUUA 2K9SA 2DMNA 2M0CA 1ETKA 1MBGA 4MFDA 1RETA 4XRSG 1TC3C 1JTXA 1QVTA 1ITYA 2R92J 1Z0XA 1VF9A 1IUFA 4A3DJ 5F04A 4FCYA 2KT0A 3ZQIA 2R0QC 4B3AA 5FKLA 5EZHA 2Y9YA 2YU9J 2JN6A 2HYJA 2JMWA 2E1OA 1NTCA 3FK6A 3MKLA 2W48A 3GTGJ 1ETQA 1VI0A 3HBLA 4MFEA 5JLWA 1Y1VJ 5FJ8J 1CQTA 3HKZN 3JRGA 2HQ5A 1OJLA 2JK3A 2RAEA 1HOMA 4Y7NJ 5HODA 1AKHB 4XK4A 2IEKA 2CJJA 4L5EA 4AC0A 5E3MA 3S17J 1O4XA 1P7IA 2M34A 2ID3A 5K7HA 1AHDP 2NOGA 1FJLA 1FIPA 2EQRA 4J19A 4BBRJ 4A3GJ 3K7AJ 3S1RJ 1D5YA 4A3LJ 3JRCA 2GM4A 4EEFG 1NK2P 3OSFA 1SFOJ 4UUSA 2N8GA 3GTJJ 1WH5A 3Q0WA 4ABZA 3ZQCA 1U78A 3I4MJ 2ME6A 2I10A 3CMYA 4JX4A 2L7ZA 1FTZA 3ZQGA 1H89C 3HGGA 1OCTC 1MH3A 5C3EJ 4CYCA 4A3FJ 3GTMJ 3HOWJ 4BY1J 1T56A 3DCFA 5IP6A 4RBOA 2K9NA 3FIWA 3OOUA 2NVXJ 4V2FA 2TCTA 5M5XJ 5M5YJ 5C44J 1MBJA 4JX5A 1MBFA 2AHQA 3IV5A 3Q3SA 3MN2A 5E3NA 4B1RA 4B4CA 5EGOA 3S2HJ 3W6VA 1JKOC 4JP0A 2PMZN 2DA4A 4M6VA 2MGQA 4D5FA 3RZDJ 4FISA 5J1RA 3A01B 3HEFA 3HOZJ 4FTHA 4QTRA 3O8HA 3BQZA 1TWGJ 5F0CA 3ZOBA 3HGYA 3SFIA 1MSEC 2MG4A 5FLMJ 2JA8J 2DMPA 1ZKGA 3CCYA 3TEDA 3S15J 3ZQLA 4S0HB 2Y2ZA 1WI3A 2JA6J 2COBA 3BR1A 1JTYA 4LOCA 3LOCA 3OIOA 5JLXA 1APLC 1MH4A 3S14J 4A3KJ 3MVPA 1I6HJ 4D5CA 3FK7A 4MLOA 2E2JJ 5F27A 2R7ZJ 3BR2A 2JWTA 4GFBA 3GTOJ 2JA7J 3BT9A 2DA7A 2EH3A 4Y52J 4JYKA 5EEAA 5M3FJ 4A3IJ 1LFUP 3QPSA 2M2EA 1BL0A 2CU7A 2Y31A 4D7MA 2HI3A 1B8IA 3JRIA 1RESA 2JA5J 4XIDA 3WHBA 1Y1WJ 1XS9A 1IRZA 2ECCA 1IDZA 3H0GJ 3GTKJ 4NDLA 1MBEA 2EZHA 3A02A 4C3JJ 2LP0A 4DZPA 4XICA 4XRSA 4DYRA 4IHVA 4UUSB 4DZJA 3BR6A 3BG5A 1RKTA 1FEXA 1JUPA 5E3LA 2CQQA 2WB1N 2WV1A 4CYCB 3A03A 2DA6A 2EBIA 4IHWA 2LK2A 1HLVA 2HOTA 5FKKA 1WH7A 2LKXA 2D5VA 4DYCA 2NS7A 2MSYA 1ZR4A 2X6OA 3TW7A 2L0KA 3JRDA 5EGOB 2G0EA 4M3FA 2EZKA 3CQZJ 1HDDC 2DTZA 2M9HA 1ZGWA 3BTCA 1IV6A 4IHYA 3TP3A 2LY9A 2E19A 3E7LA 1IJWC 1MSFC 2ELKA 5M3MJ 5F0FA 2HXIA 2NS8A 1K83J 1JKPC 1GV5A 4W1UA 5FKMA 1GV2A 2OF7A 3S1MJ 2HDDA 3HOUJ 4BXXJ 1ZR2A 2GBYA 5K7FA 3SDGA 1IG7A 5EF6A 2LLKA 1OCPA 3PM1A 4C2MJ 2P81A 1UG2A 1FTTA 5DTDA 4M3BA 2AO9A 5F08A 1IC8A 1T33A 3G1OA 3IH2A 2KDZA 3LSJA 4V2GA 5FKOA 2XB5A 3GBGA 3Q0UA 5IOZA 4A3EJ 3QQAA 3BQYA 1NK3P 2DN0A 1B8IB 1ORKA 5F1JA 1X2MA 2YS9A 1AU7A 2E2IJ 2LFBA 2JJ7A 1B72A 2DMTA 3RKQA 1RKWA 1LE8A 4UUTA 1X58A 3GTPJ 3BR0A 2IBDA 3F0CA 1TWCJ 2CRGA 3JREA 1F43A 2NVTJ 1ETOA 2K9QA 3HOYJ 1MBKA 2LVSA 1JT6A 2O7OA 3D1NI 1PUFA 5GP9A 5F0HA 5IYDJ 1DU6A 3TP0A 1JKRC 4C3IJ 5DS9A 2HOSA 3JRHA 1FIAA 3RQIA 2MW8A 4QSHA 1ETXA 1G2HA 4DW6A 3BR5A 1JUMA 2E2HJ 2B63J 4I76A 1U8BA 2DA1A 2NVYJ 5J1YA 1POGA 4MO7A 3LSPA 4C3HJ 1ETVA 2GLOA 1S7EA 1H88C 4JX6A 1UMQA 3Q0VA 3LSRA 1JGGA 1ZTRA 4M3DA 4BKXA 2ECBA 5M5WJ 2O8KA 1H8AC 5IP7J 5GPAA 3IH3A 5C4JJ 1U9OA 3WHCA 1GT0C 5EDNA 3DEWA 4AUXA 4BY7J 1JJ8C 1F36A 1UHSA 3GTLJ 4W97A 1JUSA 1BW6A 1JJ6C 3CDLA 2ME0A 2Y9ZA 3UKGA 1QRYA 3G1MA 1X2NA 5J1UA 3K2AA 1HF0A 2O9LA 2L9RA 1LFBA 5IPAA 1VFCA 3TW6A 3O8GA 4IEJA 4XRMA 3GTQJ 5EG0A 3JRFA 3M4OJ 2R93J 3JRAA 2FJ1A 2QCOA 1TWFJ 2XGDA 2L7FP 3LSGA 3LNQA 1BW5A 2EZIA 1Z77A 4AYBN 2HOAA 2DA3A 3NAUA 2VKVA 1B72B 2LD5A 1QPIA 4BBSJ 2QF7A 2XGCA 2XRLA 1A6IA 4M3GA 2R5YA 4A93J 1LE8B 2TRTA 1QVUA 2DJNA 2R5ZA 4IHXA 3S1QJ 1XC5A 3NARA 3VPRA 5GPCA 2XPWA 1WCMJ 1E3OC 3B6CA 3M3YJ 1TWHJ 3BTIA 1YRNA 1IDYA 4X6AJ 2XB0X 3HOXJ 2LTPA 2DMUA 2X9DA 1PUFB 3HDDA 1SANA 2Y0SN 1WGXA 3HB9A 1JKQC 1XG1A 5J3LA 3H3VK 1EF4A 2LR8A 4A69C 1ENHA 1BJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH4 A;  4X1E A;  3SJM A;  3I4N J;  2DA2 A;  1RPW A;  1A5J A;  3BG9 A;  3BG3 A;  5IP9 J;  2ID6 A;  5EZG A;  2ZB9 A;  3RZO J;  3B6A A;  4DYQ A;  2X48 A;  3BR3 A;  2WAQ N;  2XPV A;  2XPU A;  1IGN A;  5K7Z A;  1GVD A;  5E3O A;  1JT0 A;  2OPT A;  2CQX A;  4QIW N;  3L1P A;  1K61 A;  3C2B A;  2K40 A;  5FLV A;  5IYC J;  3PO3 J;  3ZQH A;  1RR7 A;  2H1K A;  4RDU A;  5IYB J;  4A3J J;  2DMQ A;  1VND A;  2VUM J;  2L7M P;  1BA5 A;  1R9T J;  3BTJ A;  2VKE A;  4A3B J;  3PO2 J;  5IOY A;  1AKH A;  4FE4 A;  4A3C J;  1TWA J;  2VI6 A;  1ZQ3 P;  3FIS A;  1OFC X;  2EZL A;  1U9N A;  1ETY A;  2VPR A;  3JRB A;  2FD5 A;  4HNV A;  2HXO A;  1HDP A;  1ETW A;  3JR9 A;  2FQ4 A;  2FX0 A;  5EG0 B;  3ZQF A;  4G12 A;  2H8R A;  2M8G X;  3S2D J;  5C4X J;  1MNM C;  1I3Q J;  4D7N A;  3G1L A;  1ZK8 A;  4FE7 A;  1P7J A;  3HM5 A;  1W0T A;  4M3E A;  2CUE A;  2DA5 A;  5EYR A;  5BNG A;  3HOV J;  2R5Y B;  1DU0 A;  3OSG A;  2YUS A;  2IAI A;  5FKN A;  4I6Z A;  2XGE A;  2R5Z B;  2CUF A;  2NVQ J;  4MIM A;  2XSD C;  1YRN B;  4A3M J;  3S16 J;  1MBH A;  3BTL A;  9ANT A;  3S1N J;  3FKI J;  2Y30 A;  1GDT A;  1HCR A;  1I50 J;  3A01 A;  1W0U A;  3QPL A;  1Q1V A;  1WPK A;  1GUU A;  2K9S A;  2DMN A;  2M0C A;  1ETK A;  1MBG A;  4MFD A;  1RET A;  4XRS G;  1TC3 C;  1JTX A;  1QVT A;  1ITY A;  2R92 J;  1Z0X A;  1VF9 A;  1IUF A;  4A3D J;  5F04 A;  4FCY A;  2KT0 A;  3ZQI A;  2R0Q C;  4B3A A;  5FKL A;  5EZH A;  2Y9Y A;  2YU9 J;  2JN6 A;  2HYJ A;  2JMW A;  2E1O A;  1NTC A;  3FK6 A;  3MKL A;  2W48 A;  3GTG J;  1ETQ A;  1VI0 A;  3HBL A;  4MFE A;  5JLW A;  1Y1V J;  5FJ8 J;  1CQT A;  3HKZ N;  3JRG A;  2HQ5 A;  1OJL A;  2JK3 A;  2RAE A;  1HOM A;  4Y7N J;  5HOD A;  1AKH B;  4XK4 A;  2IEK A;  2CJJ A;  4L5E A;  4AC0 A;  5E3M A;  3S17 J;  1O4X A;  1P7I A;  2M34 A;  2ID3 A;  5K7H A;  1AHD P;  2NOG A;  1FJL A;  1FIP A;  2EQR A;  4J19 A;  4BBR J;  4A3G J;  3K7A J;  3S1R J;  1D5Y A;  4A3L J;  3JRC A;  2GM4 A;  4EEF G;  1NK2 P;  3OSF A;  1SFO J;  4UUS A;  2N8G A;  3GTJ J;  1WH5 A;  3Q0W A;  4ABZ A;  3ZQC A;  1U78 A;  3I4M J;  2ME6 A;  2I10 A;  3CMY A;  4JX4 A;  2L7Z A;  1FTZ A;  3ZQG A;  1H89 C;  3HGG A;  1OCT C;  1MH3 A;  5C3E J;  4CYC A;  4A3F J;  3GTM J;  3HOW J;  4BY1 J;  1T56 A;  3DCF A;  5IP6 A;  4RBO A;  2K9N A;  3FIW A;  3OOU A;  2NVX J;  4V2F A;  2TCT A;  5M5X J;  5M5Y J;  5C44 J;  1MBJ A;  4JX5 A;  1MBF A;  2AHQ A;  3IV5 A;  3Q3S A;  3MN2 A;  5E3N A;  4B1R A;  4B4C A;  5EGO A;  3S2H J;  3W6V A;  1JKO C;  4JP0 A;  2PMZ N;  2DA4 A;  4M6V A;  2MGQ A;  4D5F A;  3RZD J;  4FIS A;  5J1R A;  3A01 B;  3HEF A;  3HOZ J;  4FTH A;  4QTR A;  3O8H A;  3BQZ A;  1TWG J;  5F0C A;  3ZOB A;  3HGY A;  3SFI A;  1MSE C;  2MG4 A;  5FLM J;  2JA8 J;  2DMP A;  1ZKG A;  3CCY A;  3TED A;  3S15 J;  3ZQL A;  4S0H B;  2Y2Z A;  1WI3 A;  2JA6 J;  2COB A;  3BR1 A;  1JTY A;  4LOC A;  3LOC A;  3OIO A;  5JLX A;  1APL C;  1MH4 A;  3S14 J;  4A3K J;  3MVP A;  1I6H J;  4D5C A;  3FK7 A;  4MLO A;  2E2J J;  5F27 A;  2R7Z J;  3BR2 A;  2JWT A;  4GFB A;  3GTO J;  2JA7 J;  3BT9 A;  2DA7 A;  2EH3 A;  4Y52 J;  4JYK A;  5EEA A;  5M3F J;  4A3I J;  1LFU P;  3QPS A;  2M2E A;  1BL0 A;  2CU7 A;  2Y31 A;  4D7M A;  2HI3 A;  1B8I A;  3JRI A;  1RES A;  2JA5 J;  4XID A;  3WHB A;  1Y1W J;  1XS9 A;  1IRZ A;  2ECC A;  1IDZ A;  3H0G J;  3GTK J;  4NDL A;  1MBE A;  2EZH A;  3A02 A;  4C3J J;  2LP0 A;  4DZP A;  4XIC A;  4XRS A;  4DYR A;  4IHV A;  4UUS B;  4DZJ A;  3BR6 A;  3BG5 A;  1RKT A;  1FEX A;  1JUP A;  5E3L A;  2CQQ A;  2WB1 N;  2WV1 A;  4CYC B;  3A03 A;  2DA6 A;  2EBI A;  4IHW A;  2LK2 A;  1HLV A;  2HOT A;  5FKK A;  1WH7 A;  2LKX A;  2D5V A;  4DYC A;  2NS7 A;  2MSY A;  1ZR4 A;  2X6O A;  3TW7 A;  2L0K A;  3JRD A;  5EGO B;  2G0E A;  4M3F A;  2EZK A;  3CQZ J;  1HDD C;  2DTZ A;  2M9H A;  1ZGW A;  3BTC A;  1IV6 A;  4IHY A;  3TP3 A;  2LY9 A;  2E19 A;  3E7L A;  1IJW C;  1MSF C;  2ELK A;  5M3M J;  5F0F A;  2HXI A;  2NS8 A;  1K83 J;  1JKP C;  1GV5 A;  4W1U A;  5FKM A;  1GV2 A;  2OF7 A;  3S1M J;  2HDD A;  3HOU J;  4BXX J;  1ZR2 A;  2GBY A;  5K7F A;  3SDG A;  1IG7 A;  5EF6 A;  2LLK A;  1OCP A;  3PM1 A;  4C2M J;  2P81 A;  1UG2 A;  1FTT A;  5DTD A;  4M3B A;  2AO9 A;  5F08 A;  1IC8 A;  1T33 A;  3G1O A;  3IH2 A;  2KDZ A;  3LSJ A;  4V2G A;  5FKO A;  2XB5 A;  3GBG A;  3Q0U A;  5IOZ A;  4A3E J;  3QQA A;  3BQY A;  1NK3 P;  2DN0 A;  1B8I B;  1ORK A;  5F1J A;  1X2M A;  2YS9 A;  1AU7 A;  2E2I J;  2LFB A;  2JJ7 A;  1B72 A;  2DMT A;  3RKQ A;  1RKW A;  1LE8 A;  4UUT A;  1X58 A;  3GTP J;  3BR0 A;  2IBD A;  3F0C A;  1TWC J;  2CRG A;  3JRE A;  1F43 A;  2NVT J;  1ETO A;  2K9Q A;  3HOY J;  1MBK A;  2LVS A;  1JT6 A;  2O7O A;  3D1N I;  1PUF A;  5GP9 A;  5F0H A;  5IYD J;  1DU6 A;  3TP0 A;  1JKR C;  4C3I J;  5DS9 A;  2HOS A;  3JRH A;  1FIA A;  3RQI A;  2MW8 A;  4QSH A;  1ETX A;  1G2H A;  4DW6 A;  3BR5 A;  1JUM A;  2E2H J;  2B63 J;  4I76 A;  1U8B A;  2DA1 A;  2NVY J;  5J1Y A;  1POG A;  4MO7 A;  3LSP A;  4C3H J;  1ETV A;  2GLO A;  1S7E A;  1H88 C;  4JX6 A;  1UMQ A;  3Q0V A;  3LSR A;  1JGG A;  1ZTR A;  4M3D A;  4BKX A;  2ECB A;  5M5W J;  2O8K A;  1H8A C;  5IP7 J;  5GPA A;  3IH3 A;  5C4J J;  1U9O A;  3WHC A;  1GT0 C;  5EDN A;  3DEW A;  4AUX A;  4BY7 J;  1JJ8 C;  1F36 A;  1UHS A;  3GTL J;  4W97 A;  1JUS A;  1BW6 A;  1JJ6 C;  3CDL A;  2ME0 A;  2Y9Z A;  3UKG A;  1QRY A;  3G1M A;  1X2N A;  5J1U A;  3K2A A;  1HF0 A;  2O9L A;  2L9R A;  1LFB A;  5IPA A;  1VFC A;  3TW6 A;  3O8G A;  4IEJ A;  4XRM A;  3GTQ J;  5EG0 A;  3JRF A;  3M4O J;  2R93 J;  3JRA A;  2FJ1 A;  2QCO A;  1TWF J;  2XGD A;  2L7F P;  3LSG A;  3LNQ A;  1BW5 A;  2EZI A;  1Z77 A;  4AYB N;  2HOA A;  2DA3 A;  3NAU A;  2VKV A;  1B72 B;  2LD5 A;  1QPI A;  4BBS J;  2QF7 A;  2XGC A;  2XRL A;  1A6I A;  4M3G A;  2R5Y A;  4A93 J;  1LE8 B;  2TRT A;  1QVU A;  2DJN A;  2R5Z A;  4IHX A;  3S1Q J;  1XC5 A;  3NAR A;  3VPR A;  5GPC A;  2XPW A;  1WCM J;  1E3O C;  3B6C A;  3M3Y J;  1TWH J;  3BTI A;  1YRN A;  1IDY A;  4X6A J;  2XB0 X;  3HOX J;  2LTP A;  2DMU A;  2X9D A;  1PUF B;  3HDD A;  1SAN A;  2Y0S N;  1WGX A;  3HB9 A;  1JKQ C;  1XG1 A;  5J3L A;  3H3V K;  1EF4 A;  2LR8 A;  4A69 C;  1ENH A;  1BJZ A; 
#chains in the Genus database with same CATH topology
 1XD7 A;  3F8C A;  3FHZ A;  5LRR A;  3IH4 A;  1A36 A;  4X1E A;  3SJM A;  1A5J A;  3K4M A;  3MZ8 A;  5EZG A;  1O3Q A;  1X1B A;  3P7N A;  2D1V A;  4MTE A;  3X2Q H;  5A2Q Z;  3RKY A;  5E3O A;  3ZQ7 A;  2CW7 A;  4HF1 A;  3LAP A;  1FMW A;  4D1Q A;  4KIC A;  3E6M A;  3FWE A;  2P6S A;  1QO0 D;  5IYB J;  4O3M A;  4NQW A;  3ZXS A;  2X4H A;  2VUM J;  2P5K A;  3DFG A;  3L9F A;  2L7M P;  1J5Y A;  4U87 A;  3BTJ A;  1SMY F;  2EV6 A;  2Z9O A;  2WV0 A;  2L01 A;  1GLN A;  1XN7 A;  1J09 A;  1G3S A;  5DCM B;  3F6V A;  4A3C J;  4HRI A;  2E5N A;  2JSP A;  2K5C A;  3G3Z A;  2BE5 F;  4I99 C;  2FQ3 A;  1U9N A;  1B59 A;  2K4B A;  2VPR A;  2E1C A;  5E8G A;  2FD5 A;  1W7P A;  3TO9 A;  3I64 A;  2HXO A;  4JQF A;  4OOI A;  4E7I A;  4P55 A;  1FOX A;  4Y3O A;  1G3Y A;  2D45 A;  5IT9 K;  4IJA A;  1VQN I;  1KU9 A;  2M8G X;  1JGS A;  1DUX C;  3S2D J;  4XOR A;  2BOL A;  2AXL A;  3SZG A;  4WX9 A;  3F8F A;  2HVR A;  3QPT A;  3L2U A;  3DWL E;  4FE7 A;  4Q47 A;  5EYR A;  3ABU A;  5BNG A;  3HOV J;  1RUO A;  2DPD A;  2Y48 A;  2R5Y B;  2YX7 A;  2IAI A;  5FKN A;  3GZN B;  2XGE A;  4E7L A;  4DBQ A;  1W4M A;  3ULQ B;  3RYP A;  4BJ5 C;  2FNP A;  1V5E A;  2CUF A;  5DUK A;  3T0Y A;  3FM5 A;  2NVQ J;  4MIM A;  2WBM A;  1MMD A;  1MBH A;  4KN4 X;  5HDK A;  2LKS A;  3C2G A;  1OR7 C;  2L7K A;  3M9A A;  1Q1V A;  1WPK A;  4PDK A;  5D4R A;  2F4I A;  1IUY A;  1GUU A;  3J80 Z;  4A0X A;  2E35 A;  2M0C A;  3OOP A;  3PNV A;  1ETK A;  3H9G A;  4E7S A;  3WU1 B;  2PLY A;  1MBG A;  4XRS G;  1RET A;  4ASN A;  2O61 A;  4BHC A;  2X6W A;  5D6E A;  2HGC A;  2ELH A;  4B44 A;  2R92 J;  5LHI A;  5DM6 F;  1VF9 A;  5FFX A;  1IUF A;  5CQG A;  4UVA A;  4WXC A;  2KT0 A;  2RKH A;  4N4N B;  1UHM A;  2VOO A;  3BPX A;  3LA2 A;  3PFI A;  4RAY A;  1EA3 A;  4C30 A;  1W7P D;  2IJL A;  4EM2 A;  4BE0 A;  2R4G A;  2DXI A;  3ONQ A;  2R7Q A;  2JMW A;  4HX8 A;  1KU7 A;  5E1W A;  5EJC A;  3PL8 A;  4ETS A;  2KQR A;  1ETQ A;  2NRA C;  3HBL A;  4MFE A;  4PSX A;  1Y1V J;  2CS3 A;  4CIC A;  4OIR F;  1V4R A;  3DU5 A;  2HQ5 A;  2IRF G;  3MD2 A;  2EB7 A;  4XQF A;  3MCZ A;  4L5E A;  2VC0 A;  4A2U A;  3VDX A;  1O4X A;  3A2K A;  1ON2 A;  1FIP A;  4MNU A;  4HF0 A;  5HLT A;  1IAW A;  4BAC A;  4BBR J;  2ZO4 A;  4A3G J;  2QSG X;  2DYR H;  1SVL A;  1B6A A;  1Z05 A;  4EEF G;  2RGV A;  2XAG A;  2BW3 A;  4A6D A;  1KGS A;  3GTJ J;  1F4K A;  3Q0W A;  2FEZ A;  4EMS A;  1QBJ A;  1LVA A;  3ZQC A;  3I4M J;  1IW7 F;  4L9J A;  2R7W A;  5KAI C;  4HX7 A;  2XV4 S;  5FD6 A;  2L7Z A;  3ZQG A;  2HDW A;  3TBI A;  4I0A A;  1R5H A;  1Z3Y A;  4CYC A;  1DGR M;  2VON A;  4LMY A;  1T56 A;  4FET A;  3FMS A;  5CJ9 A;  1W36 C;  2PJR B;  3DCF A;  4RBO A;  1G6N A;  3OOU A;  2NVX J;  1D0Z A;  2TCT A;  1MBJ A;  2H1L A;  4JX5 A;  1LDD A;  2M87 A;  3Q3S A;  1MD0 A;  1QQI A;  3MN2 A;  5EGO A;  3QU3 A;  4Y13 A;  1N78 A;  4EJT A;  3BJA A;  4G94 A;  2QEN A;  3HL2 A;  1WJD A;  4RGS A;  3TDU C;  2MGQ A;  4D5F A;  2B7E A;  1MMS A;  2L4M A;  2W85 A;  4YIF A;  2RDP A;  3HOZ J;  2W82 A;  2X6X A;  2DJI A;  1TBX A;  2XHK A;  1TWG J;  2JT1 A;  2QQ8 A;  4ZJZ A;  1MSE C;  4GYG A;  5FFZ A;  3SFI A;  5DYM A;  2LRE A;  3I54 A;  4LJZ F;  3PFY A;  1X1C A;  2BXZ A;  2MD5 A;  4U7B A;  3CCY A;  3KLN A;  1MJ9 A;  2H6B A;  4S0H B;  1Z6T A;  2Y2Z A;  2ZXH A;  3ZMU A;  1NG6 A;  3BR1 A;  1QHH D;  3SQN A;  3I59 B;  4A3K J;  3MVP A;  1D8K A;  4IRG A;  4ESJ A;  3CLO A;  4IF4 A;  4CA0 A;  4D5C A;  5E8I A;  3FK7 A;  1P2F A;  1ZLJ A;  5KNL A;  2IP2 A;  4P1W A;  4LG0 B;  3FXJ A;  1A31 A;  4G6D A;  2A05 A;  4GFB A;  1QGP A;  1HKS A;  2HYG D;  3BT9 A;  2LKP A;  4Y17 A;  2DA7 A;  1OMI A;  2VE8 A;  4BHB A;  3ZN0 A;  3OYF A;  3K1N A;  1Z7L A;  5KHD A;  2GOX B;  3H3U A;  3PJR A;  2KZV A;  2PN6 A;  1H9T A;  3PSF A;  2WAE A;  5FB2 A;  4XID A;  3JCU C;  2ECC A;  3WU0 A;  4LIV A;  1TLH B;  4C3J J;  2LP0 A;  1HKQ A;  2DPU A;  2RC4 A;  5HLI A;  1IXR C;  5ILS A;  6PAX A;  2Z1D A;  3RPU A;  3BR6 A;  4ENK A;  1RKT A;  2Y0S A;  3U2R A;  4HNT A;  2DK8 A;  5B1B H;  5D4S A;  4HST A;  4AIH A;  5E3L A;  4PFO A;  3BWG A;  4UV8 A;  2R7F A;  3A03 A;  4N4O B;  2CFX A;  1ZRD A;  1T0F A;  2Z2S B;  5HNH A;  2VB6 A;  5HS9 A;  2HOT A;  5FKK A;  4Q48 A;  2CQN A;  4IOC F;  5FLX K;  3RCO A;  1ZR4 A;  1MND A;  2L0K A;  4IXA A;  2XF6 A;  3M7G A;  1TQI A;  5FD5 A;  3GFJ A;  2BHZ A;  3CQZ J;  1HDD C;  5KCM A;  2M9H A;  3BTC A;  4IHY A;  3WGG A;  2FA5 A;  5CPR B;  2LY9 A;  2E19 A;  3GUD A;  2QA4 I;  2OD5 A;  4PFP A;  4ZZD A;  1KU2 A;  1MSF C;  2ZJ2 A;  2F5F A;  3HPH A;  1YS6 A;  3FXO A;  1GV5 A;  5FKM A;  1HXD A;  3C2H A;  4LK0 F;  1BBY A;  1NH3 A;  4XLN F;  3BJ6 A;  1XDU A;  1IRF A;  2OF7 A;  3CO7 C;  3HOU J;  1BIB A;  4G7O F;  5K7F A;  1REP C;  3K4L A;  2DQL A;  2ZFU A;  4KT6 A;  2K9M A;  3HJE A;  3HHH A;  1UG2 A;  1D1B A;  1XMK A;  4S05 A;  4EJV A;  5F08 A;  3BOQ A;  1T33 A;  1IC8 A;  1HW2 A;  2HVQ A;  4ZZL A;  5FKO A;  1LKX A;  5IOZ A;  4A3E J;  2A6E F;  2QM3 A;  2CV0 A;  1R4N B;  1I5Z A;  4YII A;  4I0B A;  1BOB A;  1SFE A;  1OYI A;  3I56 I;  1NK3 P;  1SFX A;  3FX3 A;  3HRU A;  2CV2 A;  1IXS B;  3I58 A;  5F1J A;  1X2M A;  3DTE A;  4UNO A;  2E2I J;  2KIS A;  4JBA A;  1B72 A;  2DMT A;  1I1G A;  2OZ6 A;  2DDB A;  1FP2 A;  1N75 A;  1WKM A;  5K1Y A;  1LE8 A;  1YOV B;  1LDJ A;  5B5E C;  4BE2 A;  1X58 A;  2M7B A;  3GXO A;  4CHU A;  3F0C A;  1PP7 U;  3IKT A;  2RNG A;  3WG7 H;  2ACJ A;  4O5V A;  4ZH4 F;  2Z5U A;  1JT6 A;  2A5W A;  1K6Y A;  1XSD A;  2IGK A;  2X85 A;  5DS9 A;  1IRX A;  2CUZ A;  3JRH A;  3JSP A;  2MW8 A;  4QSH A;  1TZL A;  3JW4 A;  2O3F A;  2DFE A;  3V42 A;  2O8X A;  5DUI A;  1E3P A;  2EA2 A;  2B63 J;  2DA1 A;  2GA1 A;  2NVY J;  1KQ8 A;  3RPQ A;  2Y0M A;  2K85 A;  4MO7 A;  2RQQ A;  4KIB A;  4GCV A;  5D5X B;  4C3H J;  2GLO A;  5F1R A;  3GF2 A;  2HNH A;  3JTH A;  3CZ6 A;  4DBR A;  3LSR A;  1JGG A;  4BEH B;  4CH7 A;  4ENN A;  1FYM A;  4KDP A;  2O8K A;  5IP7 J;  3W2W A;  4R8H A;  3F8B A;  4E7H A;  3L2W A;  2VPL A;  1EH7 A;  3S3O A;  2ISY A;  3TDZ C;  1F36 A;  4W97 A;  1JUS A;  4JOM A;  2LG4 A;  2ME0 A;  5DCM A;  3U1D A;  4UHT A;  4HLY A;  1I6X A;  1C0W A;  3ML6 A;  1TQP A;  2STT A;  3OYJ A;  2F5E A;  4EJW A;  3VYR B;  2F4M B;  2L9R A;  2MYS A;  5IPA A;  4PJJ A;  4XL9 A;  1ZG1 A;  2A07 F;  3TW6 A;  4XN3 A;  3O8G A;  2V1U A;  4ESB A;  4XKB A;  4XKW A;  3CCS I;  5L3E A;  2R93 J;  3KE2 A;  2QCO A;  1TWF J;  4DJA A;  3QRF F;  1Z77 A;  3HZJ A;  4AYB N;  1NG7 A;  3WTS C;  4ZTJ A;  1YFH A;  2HOA A;  3EUH A;  2ESN A;  5B1A H;  2E1N A;  1QPI A;  2QF7 A;  4EAT A;  2HVS A;  2R5Y A;  4OMZ A;  2VT3 A;  4AD9 A;  3FDY A;  1BN5 A;  2VJI A;  3CF5 F;  2QSH X;  3K4K A;  2R7U A;  4G7H F;  2ZME C;  4LK1 F;  1XC5 A;  4J01 A;  3NAR A;  1KON A;  2EFP A;  3S3M A;  2XPW A;  3BRO A;  1IDY A;  3F9K A;  2BV6 A;  4NUB A;  5J8F A;  1K4S A;  1YLF A;  2LTP A;  1LQ1 A;  1VQK I;  4L9N A;  1SVO A;  3HRT A;  3OS1 A;  2LMD A;  1L3L A;  1JKQ C;  1XG1 A;  5J3L A;  3KET A;  1EF4 A;  1GHC A;  2P0W A;  4CCM A;  3WG9 A;  4A69 C;  1YJ9 I;  2A5Y B;  2XRO A;  1MKM A;  2QKL B;  3U9G A;  4IKF A;  4MEX F;  2M4K A;  2DCE A;  1S7A A;  5H6R A;  2EIN H;  2WTE A;  3I4N J;  4MQ9 F;  1RPW A;  1UEL B;  3IP4 B;  2PQ8 A;  3RZO J;  5K5O A;  2WAQ N;  2XPU A;  1BIA A;  2CV1 A;  3EYI A;  1IGN A;  2HYF A;  1GVD A;  4OAZ A;  2OPT A;  2JQ7 A;  4QIW N;  5ICC A;  3L1P A;  2K7L A;  4DIQ A;  4WXD A;  2K40 A;  5IYC J;  3ZQH A;  1XSV A;  1RIO H;  1TP4 A;  4RDU A;  4A3J J;  1BR1 A;  5KAF C;  2DMQ A;  4E6K G;  1VND A;  4HV6 A;  3V4G A;  1FOW A;  3RDI A;  1R9T J;  3HUG B;  2ZCW A;  4CXF A;  3H35 A;  3OV8 A;  2ZXJ A;  4A3B J;  2HS5 A;  2DT7 B;  2R7D A;  2XF5 A;  1YI2 I;  2EIJ H;  4FX0 A;  2LBF B;  1FC3 A;  1XB4 A;  3G73 A;  2VI6 A;  1O3T A;  2IGM A;  3CES A;  1ZQ3 P;  2EZL A;  5E18 F;  3O3K A;  4BJ6 C;  1I39 A;  1WQ2 A;  2DW4 A;  2GZW A;  4M9X A;  4HNV A;  1HDP A;  4CZC A;  1ETW A;  1VZ0 A;  2ZXW H;  3JR9 A;  4EJO A;  3CC4 I;  4G12 A;  3WE3 A;  3G4S I;  1VQ6 I;  2G7U A;  4C2T A;  5C4X J;  1YX3 A;  2OU2 A;  3M8F A;  1P92 A;  4F55 A;  2PMH A;  1P6R A;  4XLF A;  4HSR A;  5DCF A;  2NNY A;  4BH9 A;  4P96 A;  1ZK8 A;  4N9H A;  1P7J A;  3HM5 A;  3SFZ A;  4M3E A;  4Y4R A;  1MJB A;  3LAJ A;  1J75 A;  5F6F A;  3QP6 A;  1VQ8 I;  3KZZ A;  2EV0 A;  1P4A A;  3K69 A;  4WXH A;  1DU0 A;  2PJR A;  3OSG A;  1KYW A;  4WWC A;  5AIP A;  2QKM B;  2R5Z B;  1HKT A;  3NWS A;  3LSK A;  4YEL A;  4A3M J;  3S16 J;  2HZT A;  3RI4 A;  2X1C A;  1XGM A;  2W1O A;  3S1N J;  2Y30 A;  1HCR A;  1I50 J;  4PJM A;  4HYE A;  1IXC A;  4PJN A;  3DEE A;  1TQM A;  2E1M C;  4HZF A;  1QNT A;  1SFK A;  2BY1 A;  1HW1 A;  1F1Z A;  1JTX A;  1QVT A;  1VQL I;  2HEO A;  3CJN A;  5B66 C;  3K10 A;  2DO7 A;  3T8T A;  1Z0X A;  5ERI A;  3U1K A;  2WAD A;  4A3D J;  1B4A A;  2G7H A;  5FKL A;  3HHG A;  3WU2 C;  2BBY A;  4OMY A;  3I59 A;  2HU9 A;  4PK4 A;  1FLI A;  2YU9 J;  3CMA I;  2JN6 A;  3KFW X;  1KU3 A;  5LBQ A;  1LJ9 A;  5ICG A;  1OYY A;  3BG7 A;  4LG0 A;  2L02 A;  4FX4 A;  5FJ8 J;  5HNF A;  3JRG A;  2IT0 A;  2W7N A;  3DKY A;  1OJL A;  1PDN C;  4Y7N J;  1AKH B;  2E5Z A;  2XDV A;  3K4N A;  2V9P A;  3K70 D;  3VSL A;  3S17 J;  1BI3 A;  2Y75 A;  5JVG F;  3QYF A;  1AHD P;  3H36 A;  3OYE A;  1FJL A;  3FMR A;  2O6G E;  1MIJ A;  3K7A J;  3Q9S A;  4CZZ A;  2HOE A;  2JPC A;  3JRC A;  3FXM A;  4GDF A;  2R7X A;  4L5I A;  1SFO J;  2GWR A;  4HLX A;  4IVN A;  5D8K B;  3GEZ A;  3S93 A;  3GW2 A;  4ZC3 A;  1X19 A;  4KFC A;  2ME6 A;  3BCB A;  3PQK A;  2VE9 A;  3LWF A;  1FTZ A;  1H89 C;  3VFZ A;  5C3E J;  4HDV A;  1T08 B;  3V7C A;  2GIZ A;  4G6T B;  1HA8 A;  3FBN B;  4B43 A;  2GOM A;  4V2F A;  5M5Y J;  3BC8 A;  4E7Z A;  4YFX F;  1MBF A;  3H0D A;  3OS0 A;  4BYY A;  1LNW A;  4BAY A;  4B4C A;  1ULY A;  2DI3 A;  5GTI C;  2PMZ N;  2VKD A;  4ENJ A;  2DA4 A;  1Z7U A;  2PEX A;  3LQQ A;  3TOB A;  4I98 B;  3VYS B;  5LGT A;  2B0L A;  1EKE A;  2ELJ A;  1BI1 A;  1WZ2 A;  4CCN A;  3J7Z I;  3MZY A;  2FXA A;  1QZZ A;  3DPT A;  3IAM 2;  2X1D A;  3ZOB A;  3ZMS A;  4CSW A;  1H0M A;  2EWN A;  1D0Y A;  2K27 A;  3D5R C;  3I71 A;  2V6E A;  1X3Z B;  2P7C B;  5LEK A;  2DMP A;  2PFB A;  1TNT A;  3LFK A;  2KLO A;  4IPA A;  3ZQL A;  1SAU A;  2GIV A;  1M1E B;  1ZH5 A;  2JA6 J;  2K3F A;  2VT2 A;  4AIJ A;  1LB2 A;  4QWQ A;  2LF8 A;  3LOC A;  4U88 A;  5JLX A;  2FOK A;  1MH4 A;  5HOO A;  1OCC H;  5ICE A;  1I6H J;  2DBB A;  4EJU A;  1Y8R B;  1YW8 A;  3PIO F;  2I5U A;  2E2J J;  3DBH B;  1UFM A;  2K9L A;  4M6Y A;  2KDO A;  2R7Z J;  1X3W B;  3BR2 A;  2DFI A;  2JWT A;  5LGN A;  3RIR A;  5FRO A;  4AYB A;  2O03 A;  2XSJ C;  1KZH A;  1EJ9 A;  2M4G A;  4BHP A;  5CLS A;  4A3I J;  2IGN A;  4BDZ A;  2WY8 Q;  2CU7 A;  5EEG A;  3KYD B;  2ZME B;  1T39 A;  4II2 A;  2CQ7 A;  2ISZ A;  2EV5 A;  1Y1W J;  5J4V A;  3DPU A;  5ED4 A;  3H0G J;  1G59 A;  3I55 I;  3A02 A;  4DZP A;  1U3E M;  3AG2 H;  5BQT A;  3CUQ C;  2CW8 A;  1OR7 A;  3PUF A;  4HBL A;  4HQM A;  2ZNZ A;  4HF2 A;  2CQK A;  5H2F C;  1FEX A;  4XKC A;  1DP7 P;  2IS2 A;  4NHJ A;  3SDB A;  3ZN1 A;  2KIM A;  2WB1 N;  2ZJQ F;  2DFH A;  2EBI A;  2L54 A;  2OUM A;  3CCU I;  4IRI A;  2LK2 A;  1DP3 A;  3B73 A;  4LLN A;  3I9V 2;  2W00 A;  3CCJ I;  2V1D A;  2MSY A;  1YHQ I;  4AU7 A;  3ESW B;  1UCR A;  3TW7 A;  3R61 A;  1O3S A;  3DP7 A;  2KRC A;  3BCA A;  4KIF A;  2WAQ A;  4LLL A;  2A3S A;  2G0E A;  4FQG A;  4M3F A;  2EZK A;  1STZ A;  3QOP A;  2DTZ A;  5HDN A;  1ZGW A;  1UST A;  2IA2 A;  2BHY A;  3TP3 A;  1XMX A;  1H9G A;  3BJO A;  1AOY A;  2ELK A;  5M3M J;  1CGP A;  2VL8 A;  4F93 B;  2L4A A;  4BEH A;  1D0X A;  1K83 J;  1U2W A;  2Z16 A;  1SD7 A;  4AVZ A;  5GAD J;  3S1M J;  2QWW A;  4I09 A;  2P8T A;  1JXS A;  4XN0 A;  3S32 A;  1ZR2 A;  2VKH A;  4P9F A;  2GBY A;  3EET A;  2R7V A;  1U5T B;  1XTA A;  2XAQ A;  3NEU A;  5DD4 A;  4CGZ A;  3R60 A;  5D8L B;  4CO8 A;  4HPQ A;  1Z1D A;  2GXA A;  5ICF A;  1IRG A;  1FTT A;  2E7W A;  5AON A;  3ERE D;  3PNT A;  1R1V A;  4PSW A;  3IH2 A;  2XB5 A;  1E0E A;  3GBG A;  4RM2 A;  3OYB A;  1S6L A;  3QQA A;  2V7F A;  2O0Y A;  4CCL A;  2H94 A;  2K4J A;  4YG2 F;  1ORK A;  3DBL B;  1DPU A;  2LFB A;  2VBZ A;  1YTY A;  1QA6 A;  1OCZ H;  4KIG A;  5IY5 H;  4M74 A;  2FNA A;  4IOA F;  3BZK A;  3E1S A;  4KN7 X;  3RKQ A;  3O2P E;  4XOT A;  3CDI A;  1UHW A;  3COA C;  2E1M B;  3JRE A;  1R5I D;  3CMM A;  2NVT J;  1ETO A;  4PGH A;  2V79 A;  1Y8Q B;  2JUG A;  2Q2E B;  3SYT A;  3D1N I;  5GP9 A;  2GQQ A;  2LSO A;  1E3H A;  3N05 A;  3AL0 B;  1FIA A;  3RQI A;  2CUJ A;  1S8N A;  2AS5 F;  5CVR A;  3QU6 A;  3HSR A;  2VJ5 A;  4D9J A;  1ZRC A;  2OTJ I;  1IN6 A;  2W4S A;  3FXQ A;  3CP8 A;  3LST A;  3GFL A;  4I76 A;  1U8B A;  3HSE A;  2LDU A;  3K1P A;  4LGW A;  2JRM A;  2VXD A;  5J1Y A;  2JPB A;  2KIU A;  1WVR A;  1HC8 A;  1WJE A;  1ETV A;  5CVI A;  3I0T A;  4WF2 A;  3CCR I;  3R6S A;  4JX6 A;  3MMY B;  3Q0V A;  5BMZ A;  1SAX A;  2F5V A;  2F5D A;  4HA8 A;  2DT5 A;  2UV1 A;  4BKX A;  4XSX F;  3ERM A;  4L9V A;  2RN7 A;  2IW5 A;  1GT0 C;  3C18 A;  3DEW A;  4XRF A;  4AUX A;  1Y56 A;  5CYV A;  3HUG A;  2AQE A;  4HQE A;  2FBH A;  1BW6 A;  3KEY A;  3GLL A;  3C3W A;  3UKG A;  2LBF A;  1UAA A;  4LB5 A;  4YFK F;  2F4O B;  4H0E A;  5HS7 A;  1X2N A;  2WY7 Q;  3K2A A;  2PJP A;  3FXL A;  3J81 K;  1I27 A;  1FSE A;  2CO5 A;  2D2W A;  3H5R A;  4E4H A;  4EV0 A;  1Z3X A;  2CFO A;  4IEJ A;  5F64 A;  3K9T A;  4M71 A;  1X1A A;  5IT9 Z;  1T0F C;  1XDS A;  2JZY A;  5FO5 A;  2WA0 A;  3WE2 A;  1J59 A;  1MNE A;  2L7F P;  2KIF A;  3F8N A;  2KRH A;  3LNQ A;  2VLA A;  1XMA A;  2EZI A;  4M9S A;  2J5O A;  1LVK A;  2H27 A;  5GAH J;  3NAU A;  5GTH C;  2VKV A;  5J40 A;  3TL4 X;  1A6I A;  5E1X A;  4A93 J;  1GXQ A;  1TT0 A;  1XGS A;  2D1H A;  3OYH A;  2R5Z A;  5GAE J;  1WI9 A;  2PMZ A;  3OY9 A;  3S1Q J;  4AID A;  3VPR A;  5GPC A;  4X0G A;  4Q5S F;  2W25 A;  5CKT A;  1TWH J;  3PQJ A;  2R7T A;  3FKJ A;  4G7Z F;  1WJF A;  2L2O A;  2DMU A;  2X9D A;  1PUF B;  3VB2 A;  1SAN A;  4IO9 F;  5TJJ A;  4KJZ A;  3HDD A;  3M1E A;  1WGX A;  3HB9 A;  2ICW G;  4KA4 A;  5L3C A;  1DPR A;  2XVC A;  3C7J A;  2Z3Y A;  3JAM K;  4GO1 A;  2NAZ A;  4RB1 A;  1W5S A;  2DOF A;  2OA4 A;  2DA2 A;  3RPU D;  5AIQ A;  3BG9 A;  2ID6 A;  2ZB9 A;  2TDX A;  3B6A A;  1RNL A;  4DYQ A;  4EVI A;  3JSO A;  2DYS H;  2XPV A;  1UB9 A;  1B1B A;  5K7Z A;  1JT0 A;  2MBF A;  3ECO A;  4LG3 A;  4UXN A;  2CQX A;  2M8E A;  2FOW A;  3LSM A;  2R7S A;  4G8X A;  1K61 A;  3C2B A;  3AG4 H;  4Y15 A;  1SD6 A;  5FLV A;  1FBU A;  3PO3 J;  1RR7 A;  2H1K A;  3A1Y A;  4DQ2 A;  4XLA A;  4JK1 X;  2PG4 A;  1S3J A;  4YRV A;  3WTT C;  4AWX B;  2MC3 A;  4XLE A;  2VKE A;  4H4K C;  3AFH A;  3GX4 X;  1V54 H;  1AKH A;  5FRN A;  4I02 A;  5D6F A;  4P5O A;  1SD5 A;  3CUQ B;  5LFA A;  1TWA J;  4A0Z A;  3FIS A;  3PUB A;  2VOD A;  1R36 A;  3JRB A;  1ZGJ A;  3EPZ A;  4B47 A;  1G4D A;  1VQ5 I;  4B48 A;  4IRH A;  3VOE A;  4HG2 A;  1K7A A;  4KIS A;  2GXB A;  2M45 A;  1HBX G;  3NQO A;  2FX0 A;  5EG0 B;  3ZQF A;  1FOK A;  4RB0 A;  3G6E I;  2QEX I;  2HWV A;  2WB1 A;  3DKW A;  4HOB A;  4CYD A;  4MTD A;  1R49 A;  1MNM C;  1I3Q J;  1S29 A;  2CW0 F;  4KMU X;  3K4C A;  3P9K A;  2K02 A;  1BR2 A;  1A04 A;  2CUE A;  3GVA A;  3BZC A;  1D5V A;  4QPO A;  5J47 A;  2YUS A;  1LFP A;  4LLG F;  4I6Z A;  3F8M A;  2HPI A;  3H5A A;  4L9T A;  3A4C A;  4U0Y A;  3L2C A;  1ZGA A;  4LB6 B;  3BY6 A;  1FYL A;  1JHF A;  2XSD C;  3V8K A;  5D5W B;  2KP6 A;  2UWM A;  4KUM A;  4LIU A;  2EIK H;  1GDT A;  1W0U A;  4OIP F;  5JFR A;  2LF7 A;  2NXN B;  2DTR A;  3ELK A;  3T1B A;  4MFD A;  1TC3 C;  4ZDL A;  4EGZ A;  3AG1 H;  2EIM H;  3R4K A;  5A2Q K;  2ZJR F;  5F04 A;  5E20 A;  1R71 A;  2R0Q C;  4ON0 A;  5EZH A;  2KFD A;  2UXN A;  3U21 A;  2QGU A;  4CCJ A;  1CF7 B;  1IN7 A;  3VEP A;  2E1O A;  3MKL A;  1R1T A;  1VI0 A;  4M6X A;  2MLK A;  3EDP A;  4B8X A;  3HKZ N;  2MFZ A;  2YU3 A;  5E17 F;  2RAE A;  3IHU A;  5HOD A;  4XK4 A;  1YYV A;  1BC7 C;  2IXS A;  4KNY A;  5J8C A;  1MJA A;  4AC0 A;  1MMG A;  2UUZ A;  5E3M A;  2W57 A;  2FML A;  3L00 A;  2ZME A;  2DK5 A;  4M9Z A;  4RGR A;  2ZC2 A;  2XAU A;  5K7H A;  5D5V B;  1YIO A;  2EQR A;  3BP8 A;  2XAF A;  3OL3 A;  1D5Y A;  4A3L J;  2GM4 A;  3OSF A;  3OYG A;  3WTU C;  2IVM A;  2N8G A;  3P5J A;  2X6Y A;  2I8D A;  1WH5 A;  3OYD A;  4ABZ A;  2XAH A;  4OWR B;  1J9I A;  2HR3 A;  3UNG C;  5LD2 C;  5FGM A;  4JX4 A;  3K2Z A;  4PGG A;  3LFU A;  5CVJ A;  3HGG A;  3W2A A;  1L0O C;  1OCT C;  3E97 A;  4IZZ A;  1MH3 A;  3GTM J;  1WWX A;  4BY1 J;  3REO A;  1K79 A;  5IP6 A;  2K9N A;  3FIW A;  1MDM B;  3VYU B;  1Z67 A;  5FLX Z;  5C44 J;  3GLX A;  2KJB A;  3DV8 A;  5J4Y A;  3IV5 A;  3E6C C;  2CG4 A;  5E3N A;  4B1R A;  3CCV I;  3W6V A;  3DU6 A;  3S2H J;  4JP0 A;  4EGY A;  3KP6 A;  4A12 A;  2V1N A;  1OLT A;  3TKY A;  3E0J B;  3A01 B;  3HEF A;  4GGG A;  4NC8 A;  4QTR A;  3Q5F A;  1FX7 A;  3J80 K;  3O8H A;  3BQZ A;  2KRF A;  4UB6 C;  3ECH A;  3V7R A;  5FLM J;  4HEA 2;  2EFW A;  1E17 A;  3S15 J;  4Q4Z F;  3SEQ A;  2ZSI B;  3MKY B;  1UG0 A;  1YIT I;  2COB A;  1U6G A;  1U5T A;  4M73 A;  3AKZ A;  3S14 J;  3CO6 C;  3KPH A;  3WTV C;  1IN8 A;  2YSR A;  2VIX A;  1X3U A;  2DFF A;  2XKP A;  1RUN A;  3IKV A;  5DEQ A;  2VQG A;  3CCQ I;  4OAY A;  3QOD A;  3KCC A;  5H6Q A;  1S72 I;  3K70 C;  2OC6 A;  3BLY A;  3GTO J;  2GAU A;  4N0B A;  2EH3 A;  4Y52 J;  1D1A A;  1Z21 A;  2Q1Z B;  3ZPL A;  2OZU A;  2ADU A;  3QPS A;  1LFU P;  1BL0 A;  4QLC U;  3KP4 A;  4D7M A;  2HI3 A;  2F48 A;  3JRI A;  1BR4 A;  5CQE A;  1XS9 A;  1IRZ A;  3OYN A;  3DXJ F;  3EQL F;  3GTK J;  4U0V A;  5HLG A;  5DDG A;  2Z33 A;  4NDL A;  1MBE A;  1TT5 B;  2EZH A;  4KT5 C;  5DM7 F;  1NHA A;  4IHV A;  2HKO A;  4UUS B;  1R4M B;  3ZMT A;  4XNF A;  1V5G A;  3AG3 H;  1XCB A;  1OCR H;  1HST A;  2KHM A;  4ITV A;  1JUP A;  3KLO A;  5JR3 A;  2DAO A;  4BUP A;  1R6R A;  2CQQ A;  2WV1 A;  2Q2E A;  2HTS A;  2XAS A;  3WTW C;  3MKW B;  1EV7 A;  1XSX A;  2DA6 A;  4ZYA A;  4RLQ A;  4IHW A;  2LC2 A;  1IN4 A;  1R5G A;  4BNC A;  3QYE A;  1WH7 A;  2D5V A;  1ZEL A;  2BYV E;  3R0A A;  5JHU A;  4NC7 A;  4RAG A;  2YX4 A;  4HW0 A;  2X6O A;  1W5T A;  2M0M A;  4MHG A;  2ZJP F;  3HTS B;  2JRT A;  2OBP A;  3DTK A;  1HQC A;  3KYC B;  4BGD A;  2M30 A;  3K4B A;  1G3W A;  1Z91 A;  1ONV A;  3E7L A;  1MGT A;  1IJW C;  3FXR A;  3GWZ A;  1ZHF A;  5F0F A;  2HXI A;  2NS8 A;  1WJC A;  1IF1 A;  3FHN A;  4II3 A;  4NNJ A;  2CWE A;  3QYB A;  2BY2 A;  4EM1 A;  3PIP F;  1PVE A;  2HDD A;  3ZGK A;  4BXX J;  3JTG A;  1TNS A;  4RAF A;  5L3D A;  3TOA A;  3B02 A;  3CD6 I;  2H09 A;  2V1X A;  1FSH A;  1VQP I;  2R7O A;  4XKV A;  2QQA A;  4UVB A;  1OCP A;  3TQN A;  3ASO H;  4WK8 F;  3ISP A;  2L9N A;  2P81 A;  4C2M J;  3N4M A;  4M3B A;  2EFN A;  1BOA A;  4OIN F;  2P7V B;  2OJE D;  2KDZ A;  2DDA A;  3WGH A;  3KP7 A;  2A6H F;  1IN5 A;  4DGW B;  3N97 A;  2BY0 A;  4IX7 A;  1XCV A;  2UZK A;  3BQY A;  3EYY A;  1ERD A;  1E2X A;  2KPM A;  3S8P A;  1IV8 A;  2JTV A;  4L5J A;  1DGW Y;  1B8I B;  3CUO A;  2YS9 A;  5J6X A;  3OR1 C;  1AU7 A;  2IPQ X;  1Y39 A;  2RQP A;  2JJ7 A;  3OIQ A;  1ZLK A;  1R7J A;  2JUC A;  1AWC A;  4MQV A;  1R58 A;  3OR2 C;  4BL0 B;  2GXG A;  3HIF A;  3GTP J;  2VBW A;  1YW9 A;  3I4P A;  3TO7 A;  3BR0 A;  5BOX A;  2IBD A;  2IS4 A;  1F43 A;  2QVO A;  3L2V A;  4DOZ A;  4ESF A;  3HOY J;  1S7O A;  2HKX A;  2PX9 A;  3IC7 A;  2BZT A;  1PUF A;  4AVP A;  1FYK A;  1JKR C;  3H9J A;  1OQY A;  4C3I J;  1RI7 A;  2HOS A;  4I2O A;  1FNN A;  5EEH A;  3J7Y J;  1SD4 A;  1JHH A;  3ZR8 X;  1TL8 A;  2A69 F;  2XF7 A;  1ETX A;  2P4W A;  4DW6 A;  4PUS A;  2E2H J;  4XR6 A;  3G2B A;  2Z99 A;  1MMA A;  2OQR A;  2WC2 A;  2CSO A;  1OCO H;  5JHF A;  2NYX A;  4ZYD A;  1J7K A;  1RR8 C;  1Z6R A;  2M1B A;  1POG A;  3LSP A;  1YJW I;  2X1E A;  1S7E A;  1MZB A;  1H88 C;  3SXY A;  2R3S A;  2G9W A;  3GO5 A;  3S3N A;  4E70 A;  4GXO A;  1ZTR A;  3BG6 A;  2ECB A;  4F3Q A;  5M5W J;  3HXL A;  3HKZ A;  3V7S A;  1S9H A;  3L2Q A;  5GPA A;  3IH3 A;  2P6T A;  3O6B B;  3QP5 A;  5C4J J;  1U9O A;  2P5L C;  2E34 A;  5L3F A;  1T8I A;  4UY8 I;  2A61 A;  3SZT A;  1JJ8 C;  2QQB A;  3IUO A;  1K6O A;  3OS2 A;  1QRY A;  3ABL H;  4K2E A;  3CUQ A;  4XBF A;  1O3R A;  3H3Z A;  5DD8 A;  1U8R A;  1HF0 A;  2DOE A;  1LFB A;  1BI0 A;  3W6K B;  4BQO A;  2EK5 A;  2QSF X;  4HX4 A;  4CDG A;  4RAZ A;  5EG0 A;  3GFM A;  3JRF A;  4IQ4 A;  3GZ5 A;  4PJL A;  2V6C A;  4GYI A;  2NVU B;  4BE1 A;  3HPG A;  2FJ1 A;  2XGD A;  1WJB A;  1AA7 A;  1WSU A;  1O7L A;  3D0S A;  2F6C A;  3OL4 A;  3Q9V A;  2DQR A;  3E3V A;  4RB2 C;  2FU4 A;  1UZC A;  4RGU A;  3H1C A;  1VQ7 I;  4ZDO A;  1WJA A;  1SEU A;  2E7X A;  2QBY B;  3D5S C;  2DA3 A;  2DLL A;  1FMV A;  2NOJ B;  2V9V A;  5TGT A;  4NBQ A;  1XX5 A;  2LD5 A;  4BXF A;  2XGC A;  4OU0 A;  1QVU A;  5E1Z B;  1K78 B;  1P4X A;  4D0P A;  2MD0 A;  4IHX A;  2IGO A;  3DLA A;  4QPQ A;  3ROU A;  3LL7 A;  1BJA A;  1QZE A;  3FXK A;  1WCM J;  3HTU A;  3B6C A;  4U0W A;  1E3O C;  3M3Y J;  1T95 A;  3BTI A;  2DOD A;  4X6A J;  3WTY C;  2FBI A;  1V3F A;  3HOX J;  1EH6 A;  2Q8K A;  2FUG 2;  3DTI A;  5L3G A;  3H3V K;  4UUV A;  3KYL A;  2BVL A;  5L3B A;  2ETH A;  3WTX C;  3LMM A;  3BG3 A;  4XLC A;  1RC9 A;  2QZ8 A;  5IP9 J;  2V4J C;  4G9Y A;  1EH8 A;  1WFX A;  4L0Y B;  1XPX A;  2X48 A;  1TW3 A;  3CJQ B;  3D5L A;  3BR3 A;  3S2W A;  2VJ4 A;  3WTZ A;  2Q0O A;  1J2X A;  4BXU A;  2FMY A;  1QU3 A;  4A5M A;  3HC7 A;  3F3X A;  1FOY A;  3VYT B;  3J7A Y;  1LDK B;  3M07 A;  2OTL I;  3H5N A;  4KYW A;  2WAF A;  2DOA A;  1FWZ A;  4M72 A;  4A0Y A;  1V5F A;  2BVM A;  2KIQ A;  1CF7 A;  2C6Y A;  3KEQ A;  3CJR B;  2XAJ A;  5TRD A;  2LH9 A;  1BA5 A;  3RSN A;  1LPQ A;  2L3D A;  3F21 A;  3PO2 J;  2X51 A;  5IOY A;  5LLQ A;  4FE4 A;  3IRR A;  1P4W A;  4L0Z B;  3HOT A;  4OIO F;  3LA7 A;  1OFC X;  4XLH A;  5BPI A;  4XSZ F;  1ETY A;  3WOD F;  2DU9 A;  3MFK A;  2MC4 A;  2FE3 A;  1Q1H A;  2FQ4 A;  2M7A A;  4MEY F;  2F5C A;  2OV7 A;  2H8R A;  1IO2 A;  2O5R A;  3F22 A;  4AM3 A;  1WHU A;  2BGC A;  3RQ4 A;  1X1D A;  3K6G A;  4D7N A;  2HPM A;  4BDY A;  5JVT A;  2EA4 A;  5CVV A;  5HDG A;  3G1L A;  4C2U A;  1W0T A;  2PBI A;  1HSJ A;  4IHT A;  2DA5 A;  2RRE A;  2XIG A;  2E60 A;  3HRM A;  4DNC A;  3QWL A;  1YQA A;  5IT3 A;  4UB8 C;  1Y0N A;  2ESH A;  3RTR A;  4E7J A;  2XGX A;  1RRJ A;  4EM0 B;  4XOP A;  1MDM A;  4XM3 A;  1UJ8 A;  2VBY A;  3LQR A;  4HV5 A;  2YR2 A;  2JVH A;  1W36 D;  1YRN B;  1V55 H;  3P9C A;  2VBX A;  3BTL A;  9ANT A;  2KMU A;  2NNN A;  2WWY A;  2ZSH B;  3FKI J;  1YIJ I;  5FRM A;  3MEX A;  3A01 A;  3QPL A;  4I01 A;  1X4P A;  2M5W A;  1X1P A;  4BJT A;  2K9S A;  4R79 A;  1ZRF A;  2DMN A;  3GCM A;  2E36 A;  1RZ4 A;  3M8E A;  4RS8 A;  2DT6 A;  3L09 A;  1O7F A;  1KYZ A;  4YEJ A;  4BU2 A;  1QPM A;  2KKO A;  1ITY A;  2LRD A;  2AXT C;  3QPH A;  4FCY A;  5LHG A;  1USS A;  3ZQI A;  3HSF A;  4WCG A;  4B3A A;  4ZDP A;  4ZTF A;  2MLG A;  2L5Q A;  2OQG A;  2Y9Y A;  1G8X A;  5TIS C;  3VWB A;  1A6Q A;  1ZAR A;  3CME I;  4LD5 A;  3KX2 A;  2HYJ A;  3FM3 A;  2FF4 A;  4UV9 A;  1NTC A;  3CF2 A;  3FK6 A;  4NQW B;  2W48 A;  1FBQ A;  3GTG J;  2Y69 H;  5ILU A;  5BPD A;  4TV7 A;  1VQM I;  4P9U A;  5JLW A;  5D5U B;  1ZG5 A;  2MA3 A;  1CQT A;  3SHF A;  2HFH A;  2JK3 A;  1HOM A;  1R23 A;  1ODD A;  3EUA A;  3NRV A;  4XON A;  2IEK A;  2CJJ A;  2JVG A;  2VAS A;  2KL4 A;  4YIR X;  2W24 A;  2LOO A;  1OYW A;  2H8W A;  2VJJ A;  1P7I A;  2M34 A;  2ID3 A;  3E5X A;  1VQ4 I;  3J7A O;  2NOG A;  1W7P B;  3I53 A;  4J19 A;  1YG2 A;  3FXU A;  2LY2 A;  3S1R J;  5H20 A;  4U7D A;  3HRS A;  3RJP A;  1NK2 P;  4A5N A;  3E5U A;  2OCE A;  4XMY A;  4UUS A;  3OMY A;  3M8J A;  4J00 A;  2BY3 A;  3ZP5 A;  3V8J A;  1U78 A;  3DBR B;  2VXZ A;  2I10 A;  4IHS A;  3CMY A;  2E71 A;  2W84 A;  1PJR A;  2NS0 A;  5GAG J;  1ZN2 A;  4A3F J;  1YO5 C;  4IQJ A;  3HOW J;  3KP2 A;  2V26 A;  4F52 A;  1SVM A;  1VQ9 I;  2HQA A;  2KJC A;  3V8L A;  2QYO A;  3F6O A;  4F92 B;  3SZP A;  3T5X A;  5M5X J;  4NB5 A;  4ZYE A;  2AHQ A;  2FRH A;  1S5L C;  2LNB A;  4ZYH A;  1JKO C;  3E6D A;  3OYL A;  2BEO A;  2UXX A;  4M6V A;  1SFU A;  2ZNY A;  3K0L A;  3RZD J;  2MH9 A;  3QOE A;  4FIS A;  4O6J A;  5J1R A;  1YS7 A;  2F2E A;  2ZKZ A;  4FTH A;  4ENM A;  1X4O A;  1A35 A;  2XKO A;  4PZJ A;  4RM3 A;  3HGY A;  5F0C A;  1GXP A;  1I1S A;  2MG4 A;  4ZYG A;  4FT8 A;  4PCQ A;  2JA8 J;  5DV5 A;  1ZKG A;  2FSW A;  2V9K A;  3TED A;  4RMN A;  3H9Q A;  4Z2Y A;  3GYH X;  3KP3 A;  1WI3 A;  3W3C A;  2PI0 A;  3EUK L;  3ABK H;  1JTY A;  2IA1 A;  4LOC A;  3OIO A;  3KEO A;  1APL C;  2IA0 A;  3C1D A;  4YFN F;  2LYC A;  3CC2 I;  4MLO A;  1PP8 F;  1G3T A;  2P5V A;  3FF5 A;  5F27 A;  3GZ6 A;  3K4J A;  1VQO I;  3IL2 A;  1MMN A;  2HQR A;  3ABM H;  2KZG A;  4CCO A;  2QQ9 A;  3A0H C;  1LEA A;  1ZAO A;  2JA7 J;  2JSC A;  1T38 A;  5HS8 A;  2L9S A;  4JYK A;  5EEA A;  2XRN A;  4ANJ A;  3OYC A;  5M3F J;  4KIT B;  2GA2 A;  1Y0U A;  2M2E A;  1B9M A;  2Y31 A;  3IRQ A;  3CCL I;  1FY7 A;  3E6B A;  3W2V A;  1B8I A;  1RES A;  3MAJ A;  2JA5 J;  1T2K A;  1K4T A;  3WHB A;  1FBS A;  3KP5 A;  1DDN A;  1IDZ A;  2XUB A;  4HNU A;  4XIC A;  4NC6 A;  4XRS A;  2BW3 B;  4DYR A;  1XGO A;  2QLZ A;  2XC7 A;  4DZJ A;  1D8J A;  2OCC H;  3AAF A;  1GVJ A;  3BG5 A;  3TGN A;  4AIK A;  1VTN C;  2HDC A;  1FZP B;  3FZV A;  1LUJ B;  1T6S A;  4B09 A;  1KA8 A;  5HLH A;  3OYM A;  4CYC B;  2HTJ A;  1OPC A;  1PUE E;  1HLV A;  2BXY A;  2LKX A;  3PSI A;  1BC8 C;  1IZ1 A;  4DYC A;  1P9Q C;  2NS7 A;  5KVR A;  2CYY A;  3CCE I;  1FPQ A;  1QZY A;  1T98 A;  3EUH C;  1N25 A;  1D1C A;  3JRD A;  2QUF A;  5EGO B;  4Z6Y A;  4E7K A;  5B3S H;  3IWF A;  4R1H A;  2YPR A;  3FMQ A;  2K86 A;  2A68 F;  5K5R A;  3GME A;  1IV6 A;  2IS6 A;  3BDD A;  5E79 C;  2STW A;  1SC7 A;  5KK1 A;  3QAH A;  3G71 I;  3LSH A;  1BM9 A;  1JKP C;  4FHT A;  3KZY A;  2ZBK A;  3MZH A;  1ZYR F;  4W1U A;  1TTY A;  3VOD A;  1GV2 A;  1WRJ A;  1OIS A;  2VQL A;  3OYK A;  3CDH A;  5LRS A;  3MQ0 A;  3WGI A;  3HYI A;  3SDG A;  3DLL F;  1IG7 A;  5EF6 A;  2CMP A;  3CLQ A;  3TMO A;  3RKX A;  2LLK A;  1HW5 A;  2PMU A;  1FT9 A;  2CGP A;  4LIT A;  3PM1 A;  3KZI C;  3P9I A;  1YJN I;  2ZFW A;  5DTD A;  2EJR A;  4RA2 A;  2AO9 A;  3J81 Z;  4BQN A;  1FP1 D;  3G1O A;  3MKZ A;  3LSJ A;  4V2G A;  3DKX A;  4HDU A;  2VC1 A;  3F72 A;  3Q0U A;  5BS6 A;  4FAS D;  2ZXI A;  2HQN A;  3HG9 A;  3F23 A;  4EQQ A;  2DN0 A;  2VOP A;  3GFI A;  3DF8 A;  2COM A;  2QBY A;  3E5Q A;  1XGN A;  3ZMZ A;  4BS9 A;  3IAS 2;  4OIQ F;  2X0L A;  3K1M A;  1ON1 A;  3BZ6 A;  1RKW A;  3SEZ A;  4UUT A;  1K78 A;  2EFQ A;  3ZCO A;  4A6E A;  2OAZ A;  3A0B C;  1TWC J;  2CRG A;  1ZRE A;  3NWT A;  2K9Q A;  4RGX A;  3RKW A;  4F7Z A;  1ZG3 A;  2A6T A;  1MBK A;  2EIL H;  1WJ5 A;  2LVS A;  3DQV C;  1W1W E;  2O7O A;  1DU6 A;  5F0H A;  5IYD J;  4N9I A;  3TP0 A;  3W6J B;  4BQQ A;  4CUG A;  4RLF A;  3LSI A;  3M1C A;  1QHG A;  1YX5 A;  3OWT A;  3ZMV A;  5LGU A;  1U5T C;  1TW2 A;  3T8R A;  2B9S A;  4HAM A;  3KIO A;  5K5Q A;  3JAM Z;  1G2H A;  3BR5 A;  1JUM A;  4G6Q A;  1F5T A;  4XLP F;  1N77 A;  2R7R A;  1MW7 A;  3CTA A;  2CH0 A;  4C9Y A;  1KQ0 A;  1JE8 A;  2FBK A;  2VQH A;  4S04 A;  3MWM A;  1UMQ A;  2JA2 A;  2K3P A;  5CVU A;  4M3D A;  1F9N A;  1OKR A;  5LHH A;  4MGR A;  1H8A C;  2LY1 A;  1DQU A;  2J5P A;  1B9N A;  3WHC A;  4UVC A;  5EDN A;  4B3X A;  4BY7 J;  3I3L A;  1UHS A;  1YE9 A;  1SMT A;  2RVC A;  2VQC A;  3L7W A;  3GTL J;  1JJ6 C;  3CDL A;  3ABT A;  3OIP A;  3HOS A;  2Y9Z A;  4RB3 C;  1R22 A;  3G1M A;  4V19 K;  4L18 B;  2MH2 A;  1D3Y A;  5J1U A;  3VSK A;  2M3A A;  2O9L A;  1W5C C;  3OYA A;  2VN2 A;  1VFC A;  2HZD A;  3LA3 A;  4XRM A;  3GTQ J;  3R0J A;  3M4O J;  2IS1 A;  4I7H A;  1R00 A;  3CJT B;  1YW7 A;  3JRA A;  3AL0 C;  3ZMD A;  3LSG A;  1Z9C A;  3L2R A;  1BW5 A;  2RV8 A;  5HVQ C;  1BI2 A;  3I5U A;  1O57 A;  3ZQQ A;  1KQ9 A;  4PJ0 C;  3ZRG A;  2L9V A;  4F91 B;  1LEB A;  2EFO A;  2RNJ A;  1B72 B;  3CC7 I;  3DPL C;  2AQF A;  4BBS J;  2XRL A;  4M3G A;  1ACI A;  1J0R A;  3ASN H;  3IWZ A;  1LE8 B;  5ILV A;  2TRT A;  3FBI B;  2MAB A;  3DEU A;  2DJN A;  3CP2 A;  4IL6 C;  5LEJ A;  3OYI A;  4CCK A;  3PNY A;  3TO6 A;  1I3A A;  1YRN A;  2XB0 X;  1R1U A;  1U0J A;  3H92 A;  2Y0S N;  3RYR A;  4Y33 A;  3BPV A;  4LFU A;  1PYV A;  2H6C A;  2LR8 A;  5JI6 A;  1ENH A;  3UR3 C;  2EPF A;  1BJZ A;  1Y6I A;  3CCM I;  4BQA A;  1JI8 A;  4GRI A;  4KMF A; 
#chains in the Genus database with same CATH homology
 3IH4 A;  4X1E A;  3SJM A;  3I4N J;  2DA2 A;  1RPW A;  1A5J A;  3BG9 A;  3BG3 A;  5IP9 J;  2ID6 A;  5EZG A;  2ZB9 A;  3RZO J;  3B6A A;  4DYQ A;  2X48 A;  3BR3 A;  2WAQ N;  2XPV A;  2XPU A;  1IGN A;  5K7Z A;  1GVD A;  5E3O A;  1JT0 A;  2OPT A;  2CQX A;  4QIW N;  3L1P A;  1K61 A;  3C2B A;  2K40 A;  5FLV A;  5IYC J;  3PO3 J;  3ZQH A;  1RR7 A;  2H1K A;  4RDU A;  5IYB J;  4A3J J;  2DMQ A;  1VND A;  2VUM J;  2L7M P;  1BA5 A;  1R9T J;  3BTJ A;  2VKE A;  4A3B J;  3PO2 J;  5IOY A;  1AKH A;  4FE4 A;  4A3C J;  1TWA J;  2VI6 A;  1ZQ3 P;  3FIS A;  1OFC X;  2EZL A;  1U9N A;  1ETY A;  2VPR A;  3JRB A;  2FD5 A;  4HNV A;  2HXO A;  1HDP A;  1ETW A;  3JR9 A;  2FQ4 A;  2FX0 A;  5EG0 B;  3ZQF A;  4G12 A;  2H8R A;  2M8G X;  3S2D J;  5C4X J;  1MNM C;  1I3Q J;  4D7N A;  3G1L A;  1ZK8 A;  4FE7 A;  1P7J A;  3HM5 A;  1W0T A;  4M3E A;  2CUE A;  2DA5 A;  5EYR A;  5BNG A;  3HOV J;  2R5Y B;  1DU0 A;  3OSG A;  2YUS A;  2IAI A;  5FKN A;  4I6Z A;  2XGE A;  2R5Z B;  2CUF A;  2NVQ J;  4MIM A;  2XSD C;  1YRN B;  4A3M J;  3S16 J;  1MBH A;  3BTL A;  9ANT A;  3S1N J;  3FKI J;  2Y30 A;  1GDT A;  1HCR A;  1I50 J;  3A01 A;  1W0U A;  3QPL A;  1Q1V A;  1WPK A;  1GUU A;  2K9S A;  2DMN A;  2M0C A;  1ETK A;  1MBG A;  4MFD A;  1RET A;  4XRS G;  1TC3 C;  1JTX A;  1QVT A;  1ITY A;  2R92 J;  1Z0X A;  1VF9 A;  1IUF A;  4A3D J;  5F04 A;  4FCY A;  2KT0 A;  3ZQI A;  2R0Q C;  4B3A A;  5FKL A;  5EZH A;  2Y9Y A;  2YU9 J;  2JN6 A;  2HYJ A;  2JMW A;  2E1O A;  1NTC A;  3FK6 A;  3MKL A;  2W48 A;  3GTG J;  1ETQ A;  1VI0 A;  3HBL A;  4MFE A;  5JLW A;  1Y1V J;  5FJ8 J;  1CQT A;  3HKZ N;  3JRG A;  2HQ5 A;  1OJL A;  2JK3 A;  2RAE A;  1HOM A;  4Y7N J;  5HOD A;  1AKH B;  4XK4 A;  2IEK A;  2CJJ A;  4L5E A;  4AC0 A;  5E3M A;  3S17 J;  1O4X A;  1P7I A;  2M34 A;  2ID3 A;  5K7H A;  1AHD P;  2NOG A;  1FJL A;  1FIP A;  2EQR A;  4J19 A;  4BBR J;  4A3G J;  3K7A J;  3S1R J;  1D5Y A;  4A3L J;  3JRC A;  2GM4 A;  4EEF G;  1NK2 P;  3OSF A;  1SFO J;  4UUS A;  2N8G A;  3GTJ J;  1WH5 A;  3Q0W A;  4ABZ A;  3ZQC A;  1U78 A;  3I4M J;  2ME6 A;  2I10 A;  3CMY A;  4JX4 A;  2L7Z A;  1FTZ A;  3ZQG A;  1H89 C;  3HGG A;  1OCT C;  1MH3 A;  5C3E J;  4CYC A;  4A3F J;  3GTM J;  3HOW J;  4BY1 J;  1T56 A;  3DCF A;  5IP6 A;  4RBO A;  2K9N A;  3FIW A;  3OOU A;  2NVX J;  4V2F A;  2TCT A;  5M5X J;  5M5Y J;  5C44 J;  1MBJ A;  4JX5 A;  1MBF A;  2AHQ A;  3IV5 A;  3Q3S A;  3MN2 A;  5E3N A;  4B1R A;  4B4C A;  5EGO A;  3S2H J;  3W6V A;  1JKO C;  4JP0 A;  2PMZ N;  2DA4 A;  4M6V A;  2MGQ A;  4D5F A;  3RZD J;  4FIS A;  5J1R A;  3A01 B;  3HEF A;  3HOZ J;  4FTH A;  4QTR A;  3O8H A;  3BQZ A;  1TWG J;  5F0C A;  3ZOB A;  3HGY A;  3SFI A;  1MSE C;  2MG4 A;  5FLM J;  2JA8 J;  2DMP A;  1ZKG A;  3CCY A;  3TED A;  3S15 J;  3ZQL A;  4S0H B;  2Y2Z A;  1WI3 A;  2JA6 J;  2COB A;  3BR1 A;  1JTY A;  4LOC A;  3LOC A;  3OIO A;  5JLX A;  1APL C;  1MH4 A;  3S14 J;  4A3K J;  3MVP A;  1I6H J;  4D5C A;  3FK7 A;  4MLO A;  2E2J J;  5F27 A;  2R7Z J;  3BR2 A;  2JWT A;  4GFB A;  3GTO J;  2JA7 J;  3BT9 A;  2DA7 A;  2EH3 A;  4Y52 J;  4JYK A;  5EEA A;  5M3F J;  4A3I J;  1LFU P;  3QPS A;  2M2E A;  1BL0 A;  2CU7 A;  2Y31 A;  4D7M A;  2HI3 A;  1B8I A;  3JRI A;  1RES A;  2JA5 J;  4XID A;  3WHB A;  1Y1W J;  1XS9 A;  1IRZ A;  2ECC A;  1IDZ A;  3H0G J;  3GTK J;  4NDL A;  1MBE A;  2EZH A;  3A02 A;  4C3J J;  2LP0 A;  4DZP A;  4XIC A;  4XRS A;  4DYR A;  4IHV A;  4UUS B;  4DZJ A;  3BR6 A;  3BG5 A;  1RKT A;  1FEX A;  1JUP A;  5E3L A;  2CQQ A;  2WB1 N;  2WV1 A;  4CYC B;  3A03 A;  2DA6 A;  2EBI A;  4IHW A;  2LK2 A;  1HLV A;  2HOT A;  5FKK A;  1WH7 A;  2LKX A;  2D5V A;  4DYC A;  2NS7 A;  2MSY A;  1ZR4 A;  2X6O A;  3TW7 A;  2L0K A;  3JRD A;  5EGO B;  2G0E A;  4M3F A;  2EZK A;  3CQZ J;  1HDD C;  2DTZ A;  2M9H A;  1ZGW A;  3BTC A;  1IV6 A;  4IHY A;  3TP3 A;  2LY9 A;  2E19 A;  3E7L A;  1IJW C;  1MSF C;  2ELK A;  5M3M J;  5F0F A;  2HXI A;  2NS8 A;  1K83 J;  1JKP C;  1GV5 A;  4W1U A;  5FKM A;  1GV2 A;  2OF7 A;  3S1M J;  2HDD A;  3HOU J;  4BXX J;  1ZR2 A;  2GBY A;  5K7F A;  3SDG A;  1IG7 A;  5EF6 A;  2LLK A;  1OCP A;  3PM1 A;  4C2M J;  2P81 A;  1UG2 A;  1FTT A;  5DTD A;  4M3B A;  2AO9 A;  5F08 A;  1IC8 A;  1T33 A;  3G1O A;  3IH2 A;  2KDZ A;  3LSJ A;  4V2G A;  5FKO A;  2XB5 A;  3GBG A;  3Q0U A;  5IOZ A;  4A3E J;  3QQA A;  3BQY A;  1NK3 P;  2DN0 A;  1B8I B;  1ORK A;  5F1J A;  1X2M A;  2YS9 A;  1AU7 A;  2E2I J;  2LFB A;  2JJ7 A;  1B72 A;  2DMT A;  3RKQ A;  1RKW A;  1LE8 A;  4UUT A;  1X58 A;  3GTP J;  3BR0 A;  2IBD A;  3F0C A;  1TWC J;  2CRG A;  3JRE A;  1F43 A;  2NVT J;  1ETO A;  2K9Q A;  3HOY J;  1MBK A;  2LVS A;  1JT6 A;  2O7O A;  3D1N I;  1PUF A;  5GP9 A;  5F0H A;  5IYD J;  1DU6 A;  3TP0 A;  1JKR C;  4C3I J;  5DS9 A;  2HOS A;  3JRH A;  1FIA A;  3RQI A;  2MW8 A;  4QSH A;  1ETX A;  1G2H A;  4DW6 A;  3BR5 A;  1JUM A;  2E2H J;  2B63 J;  4I76 A;  1U8B A;  2DA1 A;  2NVY J;  5J1Y A;  1POG A;  4MO7 A;  3LSP A;  4C3H J;  1ETV A;  2GLO A;  1S7E A;  1H88 C;  4JX6 A;  1UMQ A;  3Q0V A;  3LSR A;  1JGG A;  1ZTR A;  4M3D A;  4BKX A;  2ECB A;  5M5W J;  2O8K A;  1H8A C;  5IP7 J;  5GPA A;  3IH3 A;  5C4J J;  1U9O A;  3WHC A;  1GT0 C;  5EDN A;  3DEW A;  4AUX A;  4BY7 J;  1JJ8 C;  1F36 A;  1UHS A;  3GTL J;  4W97 A;  1JUS A;  1BW6 A;  1JJ6 C;  3CDL A;  2ME0 A;  2Y9Z A;  3UKG A;  1QRY A;  3G1M A;  1X2N A;  5J1U A;  3K2A A;  1HF0 A;  2O9L A;  2L9R A;  1LFB A;  5IPA A;  1VFC A;  3TW6 A;  3O8G A;  4IEJ A;  4XRM A;  3GTQ J;  5EG0 A;  3JRF A;  3M4O J;  2R93 J;  3JRA A;  2FJ1 A;  2QCO A;  1TWF J;  2XGD A;  2L7F P;  3LSG A;  3LNQ A;  1BW5 A;  2EZI A;  1Z77 A;  4AYB N;  2HOA A;  2DA3 A;  3NAU A;  2VKV A;  1B72 B;  2LD5 A;  1QPI A;  4BBS J;  2QF7 A;  2XGC A;  2XRL A;  1A6I A;  4M3G A;  2R5Y A;  4A93 J;  1LE8 B;  2TRT A;  1QVU A;  2DJN A;  2R5Z A;  4IHX A;  3S1Q J;  1XC5 A;  3NAR A;  3VPR A;  5GPC A;  2XPW A;  1WCM J;  1E3O C;  3B6C A;  3M3Y J;  1TWH J;  3BTI A;  1YRN A;  1IDY A;  4X6A J;  2XB0 X;  3HOX J;  2LTP A;  2DMU A;  2X9D A;  1PUF B;  3HDD A;  1SAN A;  2Y0S N;  1WGX A;  3HB9 A;  1JKQ C;  1XG1 A;  5J3L A;  3H3V K;  1EF4 A;  2LR8 A;  4A69 C;  1ENH A;  1BJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...