5C4XJ

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5c4xJ00
1U8BA 2JA8J 1MSFC 1PUFA 2JJ7A 1AKHA 1MBEA 3BTIA 1Q1VA 2GM4A 1FJLA 2DA1A 2O7OA 1GVDA 5IOZA 2COBA 1HCRA 1ORKA 1HLVA 4A3IJ 3S1RJ 1FIPA 1IGNA 1ZTRA 3GTKJ 1K61A 2R5ZB 2TCTA 4D5FA 1B72A 5DTDA 1F36A 4AUXA 5EGOA 4JP0A 3HOWJ 4A3FJ 5FJ8J 2LFBA 1ETYA 2DMPA 2DJNA 1CQTA 1DU6A 3TEDA 1E3OC 3Q0VA 4DZJA 2DTZA 2YS9A 5C4XJ 2N8GA 3BG9A 1AKHB 5IYCJ 2IEKA 2E1OA 2K9NA 1RPWA 5F0FA 1LFUP 3GTPJ 1ETVA 4M3FA 4ABZA 2JA7J 4A93J 3TW6A 3H3VK 3O8HA 3NAUA 3CQZJ 2L7MP 1U78A 4A3BJ 4A3KJ 1IJWC 3Q0UA 4QSHA 3JRDA 2DMQA 3GTOJ 1HDDC 2XGCA 5F04A 3OSFA 4UUTA 3MN2A 3DCFA 1IV6A 1UG2A 1F43A 2CRGA 1ETOA 2E2JJ 1JUSA 2DA2A 3JRAA 2HQ5A 3QPSA 3IH2A 1ETWA 1X2NA 2HXOA 5HODA 1AU7A 1K83J 5E3OA 2M0CA 3G1MA 5FKKA 3WHBA 4FISA 3B6CA 2ECCA 2CU7A 2NVYJ 1LE8A 2ECBA 1WCMJ 1FIAA 1WGXA 2K9QA 2LKXA 3S15J 2GBYA 3LSRA 1YRNA 4C2MJ 1IRZA 3MKLA 3WHCA 2CUFA 2I10A 4CYCB 1P7JA 2L7FP 2B63J 4MLOA 1LFBA 4FCYA 4BBSJ 1I6HJ 2NS8A 3C2BA 3RQIA 5IPAA 2L7ZA 2LY9A 3JREA 3LSGA 3GTLJ 2XGDA 3HEFA 4QIWN 3LNQA 3D1NI 2R5YB 1APLC 2HOSA 1S7EA 3ZQHA 3HOUJ 3BQZA 1ZK8A 4A3EJ 5IOYA 1Y1VJ 4A3CJ 3BG5A 2Y9YA 5FKMA 1H89C 3BR6A 2H1KA 4S0HB 4C3IJ 2X6OA 2LD5A 1PUFB 1I50J 1RETA 3BT9A 5M5YJ 2EH3A 3OOUA 3HB9A 5GPAA 4XICA 2HYJA 4XRSA 3ZQGA 2NVQJ 3Q3SA 1WH5A 4B1RA 3W6VA 4V2GA 1VF9A 1GUUA 2E2IJ 1JGGA 2DMTA 1RKTA 4X1EA 1HOMA 2GLOA 1JJ6C 2AHQA 3LOCA 1IC8A 5E3NA 1JUPA 5IP7J 5IP9J 4XRSG 2ZB9A 1NK2P 3G1LA 3FISA 1ETQA 5F1JA 4BBRJ 5C44J 2VUMJ 2YUSA 2JA6J 2R93J 2EBIA 2DMNA 5C4JJ 3GTQJ 4J19A 2IBDA 3UKGA 3IV5A 2MGQA 1IUFA 2K40A 2DMUA 2LP0A 1FTTA 5GPCA 1TC3C 5J1UA 2CQXA 2Y30A 3S1MJ 4JYKA 4IHXA 2H8RA 2XB5A 1JTXA 2MW8A 1JTYA 1MBHA 2Y2ZA 2HOAA 1MBKA 4JX6A 3BR2A 1W0TA 3S17J 3I4MJ 2W48A 1WI3A 1WPKA 2PMZN 2DN0A 1QRYA 1FTZA 1HDPA 1UMQA 1TWHJ 5JLWA 2NS7A 3LSJA 4W1UA 2VKVA 4A3MJ 3TP0A 2R7ZJ 1T33A 1BW5A 2LK2A 3Q0WA 1W0UA 3HOZJ 4M3EA 1QVTA 2NVXJ 1UHSA 3JRGA 4MIMA 1BJZA 1T56A 1OCTC 1A5JA 1TWFJ 1GT0C 3JRCA 1IDZA 5M5WJ 2HDDA 2DA7A 1GV2A 1XS9A 2L9RA 5C3EJ 4B3AA 1XC5A 2JN6A 1BW6A 5F0HA 3GTMJ 9ANTA 3A03A 4D5CA 2LTPA 3OIOA 5J1YA 1JKPC 1BA5A 3CMYA 5J3LA 4IHVA 3BTLA 4JX4A 1Z77A 3GTJJ 1JKOC 3IH4A 1QPIA 1YRNB 3DEWA 3JRBA 2FX0A 2XB0X 3BR5A 5IYBJ 3FKIJ 3HGYA 3A01A 1TWGJ 2HOTA 4IHYA 1VNDA 3L1PA 1MBJA 2M2EA 1B8IA 3MVPA 5M3FJ 2R5YA 1A6IA 1Z0XA 5EG0B 4Y52J 2QCOA 1VFCA 4C3HJ 2M34A 4BY7J 3RZDJ 1RESA 4M6VA 1GDTA 1I3QJ 4FTHA 2VI6A 2DA6A 1P7IA 1MH4A 1JKRC 4JX5A 1U9NA 4MFEA 4FE7A 4MO7A 3S2DJ 1ZQ3P 2OPTA 1IDYA 2EQRA 1U9OA 2XPWA 3HBLA 1MNMC 5EYRA 5FKNA 3ZQCA 4BXXJ 2XRLA 3HM5A 3K7AJ 5F0CA 1MBGA 3S14J 2NOGA 2TRTA 3OSGA 1SFOJ 1G2HA 2K9SA 3B6AA 5IYDJ 2MG4A 4RBOA 4RDUA 2JA5J 2AO9A 5JLXA 1AHDP 5M3MJ 2E2HJ 2E19A 5EZGA 4X6AJ 3BR1A 3TP3A 1X58A 5FLMJ 2JWTA 1NK3P 3JRFA 5EGOB 2ID6A 3QPLA 2YU9J 5IP6A 1RR7A 2X9DA 1Y1WJ 5F27A 1EF4A 3HDDA 1NTCA 3BQYA 1POGA 4A69C 2O8KA 4C3JJ 1OCPA 3CDLA 4XRMA 2O9LA 3A01B 4XIDA 2WV1A 2Y0SN 4AC0A 3RZOJ 2XPUA 5DS9A 2ME6A 4D7NA 2ELKA 1JKQC 3JRHA 2R92J 1X2MA 2WAQN 1MBFA 5K7HA 1MH3A 1VI0A 4B4CA 1D5YA 2FD5A 4M3BA 2KDZA 1TWAJ 4FE4A 4DYRA 1ZKGA 3RKQA 2HI3A 5EG0A 1B72B 3H0GJ 4A3GJ 3PM1A 2XPVA 5FLVA 2JMWA 3HGGA 4EEFG 3F0CA 4I6ZA 1SANA 1ZGWA 2MSYA 1HF0A 2Y9ZA 3M3YJ 5E3LA 1DU0A 2DA5A 4UUSA 3JRIA 5M5XJ 3GTGJ 4Y7NJ 3BR3A 2D5VA 4QTRA 2G0EA 1ENHA 2R5ZA 3ZQLA 2OF7A 2VKEA 2KT0A 1R9TJ 4A3LJ 2LLKA 2XGEA 4DW6A 4DYCA 1TWCJ 3NARA 2EZHA 4D7MA 1H88C 3HKZN 3BR0A 5E3MA 5K7ZA 3I4NJ 4I76A 5BNGA 1IG7A 4IHWA 2X48A 3FK7A 3PO2J 3S1QJ 3FK6A 4DYQA 3IH3A 2LR8A 1RKWA 2M9HA 4HNVA 3S16J 3S2HJ 5GP9A 4L5EA 2JK3A 1OJLA 3GBGA 4M3GA 1JJ8C 1ITYA 3ZQIA 3PO3J 1ZR4A 2LVSA 4GFBA 3K2AA 3CCYA 2IAIA 2CQQA 4LOCA 3SFIA 2FJ1A 4XK4A 1ZR2A 5K7FA 1JUMA 1JT0A 5EEAA 4M3DA 1LE8B 3VPRA 3S1NJ 2CJJA 5EZHA 4W97A 2P81A 2RAEA 4BKXA 1XG1A 3QQAA 1O4XA 3SDGA 1WH7A 3ZQFA 5F08A 1BL0A 5EF6A 2WB1N 3HOVJ 1MSEC 4UUSB 4NDLA 2HXIA 3SJMA 3A02A 4A3DJ 4A3JJ 2L0KA 3LSPA 2QF7A 1B8IB 3BTJA 3O8GA 1H8AC 3E7LA 5FKLA 3HOXJ 3HOYJ 3M4OJ 2NVTJ 3FIWA 2CUEA 3TW7A 5EDNA 2EZLA 2VPRA 3BG3A 1FEXA 4AYBN 2R0QC 4BY1J 1JT6A 2Y31A 1ETXA 4IEJA 2M8GX 4DZPA 3BTCA 5J1RA 5FKOA 2EZKA 3JR9A 4MFDA 1QVUA 1ETKA 1GV5A 2DA3A 4V2FA 2XSDC 1OFCX 2DA4A 3ZOBA 4CYCA 2ME0A 4G12A 2ID3A 2EZIA 2FQ4A 3G1OA
chains in the Genus database with same CATH superfamily
3CMMA 1XMKA 1VQ9I 3CDIA 4F91B 1PUFA 3BTIA 5JI6A 1Q1VA 4Q47A 3S3OA 2E1NA 2HTSA 3GMEA 3GZ6A 4E7HA 2E36A 2QKMB 1G6NA 1H9GA 4BDZA 2KZGA 3U21A 3QU6A 1P92A 4RAYA 5TJJA 1BI1A 4D5FA 1VQKI 1B72A 1F36A 3CLQA 3LAPA 3T8RA 5EGOA 4JP0A 3FXMA 3HOWJ 2VLAA 1ETYA 1WQ2A 2DMPA 3IWFA 2CQKA 2DJNA 5E8GA 2V9KA 3TEDA 2AQFA 2R7OA 5CPRB 3X2QH 4O3MA 3JW4A 4DZJA 2DTZA 3D5LA 3AG1H 2EA4A 1LVKA 1MNDA 2N8GA 2IXSA 3BG9A 4KN7X 2E1OA 4M9SA 3L2UA 1RPWA 2B7EA 1ETVA 4ABZA 4A93J 1CGPA 2BVLA 4KFCA 1XD7A 3K6GA 3CQZJ 3NWSA 1S7OA 3SZTA 3K4CA 4U87A 3OYFA 5FGMA 2XSJC 4BEHB 4ESBA 4ZJZA 2H6CA 1BR1A 5CVRA 2R7DA 1TQMA 1W7PB 1WJAA 4UV9A 3RPUD 5F04A 4OINF 3HRSA 2FNAA 2OAZA 3LL7A 3MN2A 4RB0A 2HTJA 1TBXA 1UG2A 1S7AA 3DU5A 1F43A 2CRGA 2X85A 2E2JJ 2VE9A 3MZ8A 1BC7C 1GLNA 3JRAA 5CQGA 2HQ5A 2G7HA 4DGWB 1ETWA 1X2NA 1WHUA 2HXOA 4LIUA 4R8HA 2C6YA 3CZ6A 5D4SA 5E3OA 3ZXSA 5A2QZ 4EATA 3CC2I 1ZG5A 4G9YA 1YS6A 4HAMA 5FRNA 1BR2A 1MMGA 2RC4A 2CU7A 3N97A 1HSJA 3M07A 2UUZA 2QA4I 2VASA 1WGXA 2ZCWA 5BS6A 3WGHA 1C0WA 3S15J 3TDUC 3LSRA 2IA2A 4F7ZA 4RGRA 1SD6A 2DDBA 2HEOA 1P7JA 3EPZA 4KYWA 2CGPA 2DU9A 2NS8A 5ICFA 3ERMA 2PQ8A 1EH7A 3GCMA 3JREA 1O3SA 4XONA 3KP7A 2HVQA 3GTLJ 2XGDA 2R5YB 5FLXZ 4AWXB 1B6AA 3S32A 1S7EA 3AL0B 1G3YA 2IVMA 3HOUJ 5D8KB 5DM6F 4A3EJ 3WTVC 2ZJQF 2Y9YA 3BOQA 3IC7A 1FX7A 2H1KA 5EEHA 2COMA 4HG2A 1PUFB 1YX5A 2LC2A 2WC2A 5DUKA 3OV8A 3QYEA 4FHTA 5GPAA 4ANJA 1R36A 1WH5A 2ZMEB 3BJAA 3Q3SA 3H9QA 1R58A 3TOBA 1VF9A 4M72A 4NBQA 2O3FA 3L2WA 3LSHA 2G7UA 3I58A 2ZC2A 2QSHX 1HOMA 3CD6I 2F4IA 3I59B 3LOCA 2OTLI 3SXYA 4HX8A 4EV0A 1WWXA 1L3LA 1FWZA 4CCNA 2ZB9A 3KIOA 3W6JB 2F4OB 4G6TB 4BBRJ 4L5JA 1J59A 5AIQA 5K1YA 2JA6J 2HQNA 4EM2A 2EBIA 3WTTC 2V9PA 5E1XA 4CH7A 2W7NA 2R7SA 4N4NB 2IS4A 1SFEA 1IN4A 2VJ5A 5IT3A 1W7PD 4AIJA 5GPCA 1FTTA 4M6XA 2CQXA 4XLAA 3S1MJ 4U88A 2K4JA 4JYKA 1YG2A 4C30A 1E17A 4IHXA 2XB5A 2MW8A 1MBHA 2CW0F 4CYDA 5ED4A 1W5CC 5H6QA 1HW1A 3BR2A 4IZZA 3K2ZA 5FO5A 3I56I 3I4MJ 3LAJA 2W48A 4A2UA 2K4BA 4E7IA 4L9JA 1LUJB 2PMZN 1U5TA 1TT5B 2VT2A 3CJRB 2NNYA 1FNNA 2AQEA 1ZG1A 4IQ4A 3CJNA 2HKOA 2NS7A 3SYTA 3TP0A 4HZFA 1SD4A 3KP5A 4I09A 3AKZA 4Y4RA 4B47A 3K70C 4A0ZA 1UHSA 1QPMA 2ELJA 2NAZA 1A5JA 1IRGA 4HF1A 2F5VA 1KU3A 2HQAA 1GT0C 3LA7A 3FX3A 5M5WJ 2VC0A 2M87A 2DA7A 4XLPF 2VKHA 3BPVA 3DBLB 4LLGF 3W2VA 4LG0A 4B3AA 1XC5A 2VBXA 1MKMA 3GTMJ 4A12A 2QQ9A 1PVEA 1Y56A 3OYEA 4Y13A 2HS5A 3PNTA 5J3LA 2IA0A 1Z9CA 4JX4A 1Z77A 2MH2A 3T0YA 2XC7A 2IT0A 2P7VB 5CQEA 2PBIA 1QPIA 2LMDA 1LDDA 4M9XA 4AIDA 3IWZA 2ZBKA 2XB0X 3L2RA 3CMAI 3A01A 3KZZA 4WX9A 2TDXA 3IUOA 1QZEA 1VNDA 1I39A 3L1PA 1U2WA 3J7ZI 1MBJA 2M2EA 3GYHX 2KL4A 3KE2A 1K4SA 1DP3A 1Z0XA 2A6TA 4BEHA 1R4NB 1GDTA 2M30A 1LDJA 1P7IA 4BQOA 2V7FA 3ULQB 2FOWA 3ABUA 4MO7A 4FE7A 4ZDPA 3TQNA 4IHSA 1R1UA 4L0ZB 3KPHA 1IDYA 2XPWA 4BH9A 4IRHA 3E5QA 3BROA 4RGXA 1ZLKA 2EB7A 3LWFA 2M4GA 1V5EA 3CCMI 2RDPA 4B3XA 4C2TA 1P4XA 1PJRA 2F6CA 3S14J 1D8KA 4A6DA 5IY5H 2E71A 4LITA 4ON0A 2XF7A 4M9ZA 2L9SA 4CCOA 1VZ0A 3WU2C 3DWLE 2PEXA 4UVBA 3GZNB 3BWGA 4RBOA 2DTRA 3I64A 2JA5J 2K3PA 1LPQA 2WAQA 2V1UA 4EJUA 1J0RA 5FLMJ 2CUZA 2OZ6A 5EGOB 3JRFA 2VPLA 2LOOA 3QPLA 5J4YA 5J47A 2JSPA 4WWCA 2RV8A 2HOEA 1Y1WJ 1W36C 1EF4A 3GFMA 4BQAA 1POGA 4A69C 2LDUA 3ZQ7A 3CDLA 1KU2A 3K69A 4XRMA 1XX5A 1ODDA 4AC0A 2XF5A 4YRVA 3J81Z 2IJLA 1OMIA 2ELKA 5L3BA 4B8XA 4EJTA 5LHIA 4LB5A 2MBFA 3JRHA 2EV5A 3BCAA 4ZZLA 4L9NA 5K7HA 3I0TA 5LLQA 3G4SI 2GWRA 3DPTA 1G3TA 4B4CA 4NC6A 1DPRA 2FBKA 4BQQA 3I5UA 2WWYA 2ZJPF 2L3DA 4M3BA 2KDZA 1O3QA 1TWAJ 4FE4A 1SVOA 4DYRA 3RKQA 2EV0A 5TISC 5ILVA 1TLHB 3PM1A 3KFWX 1T0FA 5FLVA 1CF7A 3ZMUA 3H5AA 2DLLA 3E5UA 2BE5F 4I6ZA 1ZLJA 1SANA 2VQHA 3BZKA 3A2KA 3B73A 1E0EA 2BYVE 4QWQA 5TGTA 3BPXA 4BU2A 5DCMB 4TV7A 4PSXA 3H5RA 4XLCA 3J80Z 1BI0A 1WKMA 3L7WA 4Y7NJ 3OYBA 4C9YA 3FF5A 2DAOA 3HPHA 3KEOA 4F92B 1D1AA 2OF7A 2QKLB 5JR3A 4K2EA 2O61A 3OYMA 4IX7A 1Y39A 2JVHA 5J6XA 1B59A 5LGNA 4DW6A 4YFXF 2W4SA 4X0GA 1TWCJ 1P6RA 1K6OA 3IL2A 2HDWA 1FOYA 5D6EA 4D7MA 3DKXA 3CUQA 1H88C 3HKZN 3BR0A 4N9HA 5J8FA 2Y48A 4PJJA 5HLIA 2RKHA 1MJBA 1LDKB 3OYJA 3FXUA 4I0BA 1IG7A 4XLEA 3PO2J 4XOPA 2EFQA 2L9NA 5E20A 2HQRA 2R7FA 1IN8A 3EUHA 4KNYA 3FDYA 5K5RA 3VYSB 4IL6C 3S16J 3TO7A 2EINH 2JK3A 1EV7A 4FT8A 3JCUC 1FT9A 1LEBA 1JJ8C 3OIPA 5F1RA 4MEYF 3VSKA 2VC1A 4GGGA 4PGHA 2ETHA 3K2AA 4KISA 1DP7P 4UXNA 3CCEI 2IAIA 2I8DA 3SQNA 4XK4A 2IGMA 4GXOA 3P7NA 2QBYB 3IRQA 1JUMA 5KNLA 3N05A 4XQFA 5EEAA 3KZIC 2DFIA 3R6SA 3H9JA 3GFJA 3OR2C 3VEPA 4XLNF 1H9TA 1NG7A 1FP2A 2P81A 4BKXA 2F48A 3QQAA 2M8EA 2CV2A 5HVQC 2WB1N 1MSEC 4UUSB 3OIQA 3Q9SA 2DFHA 4KITB 1W4MA 2Z1DA 3QRFF 3O8GA 3HOXJ 1UJ8A 1W5SA 3M4OJ 5EDNA 3G71I 5CLSA 5LHHA 2VPRA 3BG3A 1O3RA 3W3CA 2R4GA 1MDMB 2HDCA 3MWMA 3F8FA 1YQAA 2MABA 3V8LA 2CQ7A 5J1RA 2ESHA 3JR9A 1Z3YA 4GYIA 2L5QA 2H94A 2Q8KA 1UCRA 3FXJA 1TZLA 2ME0A 3E6MA 2CFOA 1LEAA 3H3ZA 2LYCA 2UV1A 3QP5A 2VBYA 3HHGA 1HKQA 2CYYA 3KEQA 2JA8J 2JJ7A 1AKHA 1YJ9I 2ESNA 3EQLF 5LGUA 2HVRA 3COAC 4KMUX 4LG3A 1BI3A 2O7OA 1G8XA 4XSZF 1I1SA 1AA7A 5IOZA 2COBA 1YLFA 5E79C 2DW4A 3HUGA 3ABKH 2BBYA 3VSLA 3GTKJ 1OR7A 1FP1D 3HRUA 1JE8A 3L09A 4AUXA 3DP7A 3F8NA 5F6FA 1B1BA 3A0HC 5GTIC 4XSXF 2BY0A 2IPQX 2H09A 4XR6A 2O0YA 2WTEA 2BW3B 2LRDA 4L5IA 1U5TB 1E3OC 4A0YA 4DNCA 1MZBA 4KICA 3NQOA 3PFYA 1AKHB 2IEKA 2K9NA 3T5XA 5F0FA 2PMZA 3VB2A 2Z3YA 4QLCU 4L9TA 2EWNA 2X51A 5LFAA 3O8HA 3MQ0A 3WTXC 2GZWA 2L7MP 2QQBA 4M74A 2L54A 1YW9A 3V7SA 4CGZA 2IGNA 1IJWC 2VQGA 4ZH4F 1XMXA 2VB6A 2HYGD 3JRDA 1R1TA 4WXCA 4WXHA 2P5VA 4I02A 2FEZA 4UUTA 3DCFA 3DBRB 4FETA 4BDYA 3I55I 5LHGA 4XL9A 2XROA 1XMAA 3R0AA 4I99C 5B66C 2LNBA 2IGKA 4M71A 3M7GA 3OOPA 3IH2A 2F2EA 3IAS2 3TBIA 1UG0A 3B02A 4LGWA 1H0MA 4E6KG 1A31A 1AU7A 2GXAA 4AM3A 4HNUA 3KX2A 3R61A 3G1MA 2AS5F 3AG2H 2BGCA 3HHHA 2M7AA 2L7KA 3GO5A 1X1PA 4R79A 3QU3A 2KIUA 5E8IA 3HTSB 1FIAA 5FLXK 2KRCA 4CCKA 3PSFA 3ML6A 2GBYA 1YRNA 4OMYA 4KIGA 5CYVA 1IRZA 2K02A 3OS2A 3MKLA 1EH6A 2KKOA 2CUFA 3WHCA 5LRRA 2L7FP 2F5FA 1T39A 4MLOA 3RPQA 1I6HJ 2ZSHB 1D5VA 1R7JA 1V3FA 2E7WA 1G3SA 2FOKA 3LSGA 2XAFA 3I53A 1K4TA 4QIWN 3LNQA 3D1NI 4BACA 1CF7B 3QPHA 2WV0A 3UR3C 3L00A 3QYBA 2IW5A 2L02A 2KLOA 3LSIA 4RA2A 5D5UB 1Y1VJ 4A3CJ 1H89C 3L2CA 3BR6A 4S0HB 4L0YB 4C3IJ 3GX4X 1R49A 4ENKA 2BY3A 4HPQA 1I3AA 3J7AO 2KRFA 3BT9A 3LSTA 3M8FA 5M5YJ 4XBFA 2OBPA 3OOUA 4XICA 5BMZA 2P5KA 1FOWA 3ZQGA 3DKYA 3W6VA 2EIKH 1R5GA 1Z05A 4KT6A 4V2GA 1B9MA 2YSRA 1GUUA 2DOFA 1A04A 1JGGA 2E7XA 2KP6A 2VBWA 2DMTA 1SMTA 1QZYA 2GLOA 4HBLA 4HNTA 2FUG2 3WU0A 1Y8RB 2A07F 3EYYA 4XKWA 2MC3A 4I2OA 1JUPA 1ZAOA 5IP9J 4XRSG 4MQ9F 3OYNA 1IW7F 1NK2P 2E34A 3G1LA 3NRVA 4Q4ZF 2IS2A 1HW5A 1ETQA 5F1JA 2KQRA 2A3SA 2YUSA 4N4OB 1VQLI 5C4JJ 2MC4A 3GTQJ 2IBDA 3CLOA 5DD8A 2RGVA 3IV5A 3QP6A 2VODA 1IUFA 2VL8A 5BQTA 2Y30A 4GDFA 4ZYGA 5CVJA 3Q5FA 1FYKA 3IHUA 3EDPA 4GRIA 1JTXA 2PMHA 4CSWA 3CJQB 3BG7A 3ZMZA 2Y2ZA 2ZNYA 5KK1A 2HOAA 1T6SA 2L4AA 4JX6A 1OKRA 3KP2A 3DXJF 1EKEA 3SZGA 4NHJA 4AVPA 1WI3A 1IRFA 2A61A 3KEYA 2CQNA 1QRYA 3ABTA 3L2QA 5GTHC 2L2OA 1TWHJ 1ERDA 4E4HA 2MH9A 3CCVI 2OUMA 5HNFA 2VKVA 3CC7I 4A3MJ 2R7ZJ 1BW5A 1T33A 4P5OA 3Q0WA 4EMSA 1Z1DA 2AXTC 1O57A 4NNJA 1VQ8I 2NVXJ 3JRGA 1BJZA 3ROUA 3ZN1A 4OU0A 3GZ5A 2BZTA 2M1BA 3FWEA 3CCSI 4P9FA 3J80K 1ON1A 1XS9A 3E6BA 1OYYA 4IJAA 1FSEA 1BM9A 2JN6A 4RMNA 2LSOA 1BW6A 5F0HA 3OYDA 2ZO4A 4EQQA 3OYKA 2LTPA 2OQGA 3FMRA 5J1YA 3ISPA 5HLGA 3FXOA 2JT1A 4BS9A 3GTJJ 5HS7A 2M3AA 3I9V2 3WGIA 3DEWA 5ICEA 3OR1C 5FB2A 1REPC 1UZCA 3FKIJ 2LKSA 4G94A 1FBQA 3CP2A 3SHFA 2DCEA 1VQ5I 2BW3A 1E2XA 4OIRF 5DUIA 3OMYA 3K1PA 5M3FJ 3F8MA 4NC8A 4DOZA 4H4KC 3FMQA 2QBYA 2A05A 1BN5A 2XKOA 4Y15A 4Y52J 3F72A 2W85A 4C3HJ 2GA2A 3BLYA 1Y0NA 3VYTB 3QOEA 2KJCA 2HPIA 4FTHA 2VI6A 3OYIA 2DA6A 1N78A 1JKRC 1P4WA 1UHWA 1U9NA 2BHYA 3ERED 4BE0A 2HWVA 3CF2A 4II2A 2V1XA 5L3EA 1ZQ3P 2OV7A 3G3ZA 1A6QA 2KJBA 1U9OA 2VOPA 3HBLA 3H35A 1MNMC 3DPLC 5FKNA 2K3FA 1X4OA 4HX7A 4U0WA 4BXXJ 2EK5A 3MZHA 5F0CA 1MW7A 1MBGA 2NOGA 5ILUA 2TRTA 2ZXIA 1IO2A 4XLHA 3OSGA 4L18B 4LMYA 1XB4A 3LFKA 2LY2A 4HLYA 5ILSA 2XIGA 1KU9A 3B6AA 4RM3A 2LF8A 4RLFA 1OQYA 2AO9A 2RQQA 5JLXA 2WY8Q 2GAUA 5M3MJ 2E2HJ 1YX3A 3S3MA 3QOPA 3M9AA 4EGYA 4GCVA 5D5WB 2R3SA 5FRMA 3K4MA 3ZGKA 3TO6A 1RR7A 3G73A 1P9QC 3CF5F 2NNNA 5F27A 2K27A 3R0JA 2FQ3A 3LA3A 2UXXA 3GWZA 4ZYAA 1OCPA 2XV4S 1WFXA 3A01B 2DT6A 4XIDA 2Z33A 1P4AA 3RZOJ 1BJAA 3FM3A 3U9GA 1MJAA 3JSPA 1YOVB 3RYRA 3JTGA 1S6LA 1SC7A 4G7OF 3DF8A 1KYZA 2XAQA 4MQVA 3BZCA 3OYLA 1X2MA 2PX9A 4OAYA 4UUVA 1MH3A 4XOTA 3T8TA 5HLHA 1R4MB 2XVCA 3J7YJ 2IGOA 1HKTA 1D5YA 3PUBA 1PDNC 2FD5A 4BJTA 4ZYHA 5GAEJ 2HZTA 2RN7A 5EG0A 1B72B 1VQ4I 5GADJ 3P9IA 2XPVA 4FQGA 2OA4A 1RC9A 2XAHA 2QSFX 4UV8A 3F0CA 2CV1A 2IS6A 1BBYA 3ECOA 1D0ZA 2OZUA 1SVLA 1DGWY 3G2BA 5CVIA 1HF0A 4JK1X 3H5NA 2YR2A 1Z7UA 2DYRH 3DLLF 3BZ6A 2JTVA 2CUJA 4RLQA 3J7AY 1RRJA 3BR3A 3HJEA 2X4HA 4F52A 1K79A 3IP4B 1T08B 1XGMA 2KT0A 1LKXA 3C3WA 2FE3A 3BJ6A 4ZTFA 3OY9A 3F8BA 2LLKA 2XGEA 4DYCA 5D4RA 1YTYA 3SEZA 2KPMA 1JHFA 2KMUA 5EEGA 3NARA 4KN4X 4XN0A 2DPUA 5E3MA 5K7ZA 4PFPA 5BNGA 1R6RA 3C18A 2E1MC 2KFDA 3PNYA 2NS0A 3FK7A 2L01A 3S1QJ 4Y17A 1X1BA 5L3CA 2CV0A 4E7SA 4H0EA 1RKWA 2M9HA 4CO8A 2Z9OA 1YIJI 3S2HJ 2XUBA 4L5EA 2K5CA 4A5MA 1EJ9A 4IRIA 4CZZA 2LY1A 1MMSA 1IUYA 3RKXA 3I3LA 1IN7A 3F3XA 1S3JA 3FHNA 1B9NA 5LRSA 4DQ2A 1IXCA 1FBUA 1JT0A 3K1MA 3MKZA 2VKDA 1WJBA 3W2AA 3VODA 3F23A 1Q1HA 3BJOA 5F64A 1YE9A 3IAM2 2EPFA 1LE8B 1Y6IA 3AAFA 4IHTA 3S1NJ 2NOJB 3OS0A 1MMNA 2LBFB 1OCOH 1XG1A 3LQQA 2HPMA 1R71A 4B43A 5F08A 1BL0A 5EF6A 2JUGA 1FC3A 3AL0C 4HF2A 2Q2EB 4NDLA 4DBQA 2HXIA 4YFNF 3MFKA 4ENMA 3QPTA 4MGRA 4A3DJ 1NHAA 1QHHD 4U7BA 3JTHA 3DU6A 2D1VA 2W57A 2Q1ZB 1B8IB 2GIVA 3E97A 3TW7A 2CUEA 4ASNA 4PK4A 2P4WA 3C2GA 1BR4A 4HLXA 2M7BA 3FM5A 4BYYA 4HRIA 1V5GA 2R0QC 3IRRA 2Y31A 4LB6B 3D5RC 5DM7F 2DT7B 2M8GX 4DZPA 3BTCA 2P6SA 2YX4A 2KIFA 4AVZA 4EM0B 2EZKA 3TKYA 2ZXHA 4MHGA 4HQEA 3EUHC 4RB2C 1ETKA 2DA3A 2V1DA 3FBIB 3DTIA 2DYSH 3U2RA 3ZOBA 3RCOA 2WA0A 2WB1A 2FQ4A 1XN7A 3ABMH 3P5JA 1U8BA 3FXLA 1MSFC 3HG9A 1K6YA 1FJLA 2R7VA 2BHZA 1XDUA 5E1WA 3CP8A 3K4LA 4NC7A 1ORKA 2V1NA 3A1YA 1ZTRA 1ON2A 4PCQA 5L3FA 1K61A 4B09A 2R5ZB 2TCTA 4N0BA 5DTDA 1QGPA 1S29A 3KYCB 3M1CA 1Z21A 2WY7Q 3VOEA 1PUEE 1P2FA 1SFKA 4A3FJ 5FJ8J 4D0PA 2FNPA 3E1SA 5B1AH 1QZZA 2W00A 2OD5A 1F9NA 3Q0VA 2IA1A 1K7AA 4EM1A 3L9FA 5IYCJ 1YJNI 3F9KA 1T0FC 2HU9A 1VTNC 2EILH 2LKPA 1R5ID 1IN6A 1X3UA 1USTA 3IKVA 2RVCA 4KMFA 3RTRA 3H3VK 1Z6TA 2PI0A 2DK8A 1TQIA 2R7TA 1U78A 4A3BJ 5FFXA 4U0YA 2Z5UA 4Y3OA 4QSHA 1TW2A 2K85A 2BXYA 2DMQA 3MZYA 1ZG3A 2H1LA 3BCBA 4RS8A 1QU3A 2E5NA 3KETA 1IV6A 2GIZA 2EA2A 1U5TC 5K5OA 3RKWA 1F1ZA 1K78A 4YIIA 1FOXA 2GXGA 4C2UA 3RKYA 1JUSA 2MLKA 2DA2A 1DPUA 4XNFA 3H0DA 3QPSA 2V4JC 3CCJI 3I54A 2O8XA 1K83J 4XKVA 1OCCH 1KZHA 3G6EI 2M0CA 4RM2A 3WHBA 1IXSB 2LBFA 4YG2F 4P96A 3B6CA 4Z6YA 2ECCA 3MKYB 1LE8A 3PQKA 2ECBA 3TL4X 1KONA 2A5WA 2CW7A 2R7QA 3CC4I 3RJPA 4KA4A 3DLAA 4BXUA 5JFRA 5LGTA 2QVOA 3VWBA 3CUQC 2DT5A 4C2MJ 4HV5A 2I10A 3WTUC 4AIKA 2B63J 1LFBA 4FCYA 4P55A 5IPAA 4BXFA 2YU3A 3EYIA 2L7ZA 3NEUA 4KUMA 2X1CA 2CS3A 1T2KA 1EA3A 3HEFA 4NUBA 3WE3A 4BHBA 4LK0F 4BUPA 3ZQHA 3BQZA 4ZC3A 1ZK8A 2FF4A 3TGNA 3V8JA 1HSTA 2BY2A 1T8IA 2PJRB 1KYWA 5FD6A 2Z2SB 4MTDA 2X6OA 5D5VB 2X1EA 4OIOF 1RETA 5JVGF 2STTA 1YO5C 3ZQQA 4BHPA 1DUXC 1ZH5A 4XRSA 3HB9A 2DPDA 1PP8F 3CDHA 1PP7U 2KDOA 3ABLH 3E6CC 3OL4A 2BVMA 1HW2A 5KHDA 3CCQI 1BC8C 2JZYA 1RKTA 4X1EA 4II3A 1F5TA 3SFZA 2AHQA 2V9VA 4JOMA 1IZ1A 3JAMZ 1IC8A 3LSKA 3M8EA 1MNEA 1YHQI 2QGUA 2OU2A 4CDGA 4AU7A 1IN5A 4UY8I 3FISA 2VIXA 4HSTA 5C44J 2QSGX 1D3YA 4CA0A 2RREA 2R93J 4KIBA 3UNGC 2FXAA 1MGTA 1R5HA 4XRFA 2Y0SA 1IRXA 3Q9VA 1WVRA 2QLZA 2LP0A 1TQPA 1SVMA 2XAJA 5J1UA 2FBHA 1J9IA 2MA3A 2OJED 2H8RA 3IKTA 2IP2A 4IQJA 2BXZA 1ZRDA 4LK1F 4IO9F 1VQOI 2M4KA 3LA2A 1MMAA 3SEQA 4M73A 1MBKA 3AG4H 1ZELA 2KHMA 4WK8F 4XM3A 2QEXI 4IXAA 2X6WA 1JI8A 3EUKL 2LREA 1LVAA 2F4MB 2CG4A 2GOXB 4DJAA 1RZ4A 2UZKA 1HDPA 1FTZA 2HFHA 4J00A 3TO9A 5JLWA 2EFWA 2DJIA 3LSJA 4BNCA 4RAFA 5JHFA 3KLOA 4M3EA 1ULYA 3J81K 1OCTC 1YITI 1T56A 2X0LA 1TWFJ 4EJVA 3JRCA 2BY1A 4G7HF 1J5YA 2HDDA 2DQLA 1GV2A 3WE2A 5FD5A 1QA6A 4IRGA 4EGZA 2JA2A 3HPGA 9ANTA 3K4NA 3F6VA 2X6YA 3S8PA 1IF1A 3OIOA 1TNTA 1J2XA 2XF6A 5K5QA 1BA5A 3CMYA 4IHVA 3PL8A 3I71A 1W36D 3BTLA 3RDIA 3HL2A 1JKOC 1WZ2A 5D6FA 1UHMA 4IOAF 2H8WA 3JRBA 2JRTA 3HYIA 5DCMA 1X1AA 3BR5A 5IYBJ 3HGYA 1XSVA 2HOTA 2HGCA 2ZKZA 3WU1B 4E7JA 2HYFA 1A36A 5GAHJ 1LQ1A 3H1CA 2WBMA 1BI2A 3OYHA 1IV8A 3V8KA 4HA8A 2R5YA 3RIRA 1A6IA 3C1DA 3ASOH 3ZN0A 4ESFA 5EG0B 1X3ZB 2P0WA 1VFCA 2MFZA 1RESA 2ZFWA 4HX4A 5DV5A 3MKWB 3DQVC 3CO7C 3LQRA 1BOAA 3W6KB 2OQRA 3WTZA 3DEUA 2G9WA 4Q48A 3ASNH 2DO7A 3S2DJ 4GO1A 5HS9A 4O6JA 2QUFA 3ZMTA 2IRFG 4PJLA 1YYVA 2MD0A 4PUSA 5EYRA 3OYGA 3ZQCA 1G4DA 3K7AJ 3K1NA 3KP6A 1J75A 3A4CA 2FMLA 4HSRA 4ZYDA 2BOLA 1SFOJ 1G2HA 2K9SA 1OYWA 5ERIA 5IYDJ 2O6GE 3WG7H 1FSHA 4IVNA 1AHDP 5EZGA 4EJWA 1ZRCA 4YEJA 3TP3A 1A35A 1NK3P 1ZYRF 2ADUA 2ZJRF 2VOOA 2ID6A 5E17F 3O3KA 3GFIA 2Z99A 5IP6A 1FLIA 1FMWA 1OCZH 3GEZA 3BP8A 2X9DA 4HF0A 1WJEA 1D0YA 3TDZC 2B9SA 1SFUA 1KGSA 3BQYA 2O8KA 4C3JJ 2O9LA 2ELHA 2GOMA 4MTEA 1V54H 2XPUA 5DS9A 5A2QK 1I27A 2ME6A 2V6EA 1LFPA 3H3UA 1JKQC 2FRHA 4LLNA 5L3DA 3A0BC 5E1ZB 2EFNA 5H2FC 2VN2A 1XGSA 2CSOA 2EV6A 1UAAA 3HXLA 4OAZA 2ZFUA 1XCVA 1VI0A 3CESA 1U8RA 4YIRX 3H36A 2GXBA 4P1WA 2F5EA 1YJWI 2YPRA 5CVVA 1QO0D 1KQ0A 2DI3A 4G8XA 2J5OA 3DV8A 5CJ9A 2W82A 3HGGA 2P5LC 4EEFG 4PSWA 4YIFA 2MSYA 3M3YJ 1YW7A 1T38A 4HDUA 2DA5A 4HYEA 2ZNZA 5KAFC 4HDVA 2ZXJA 1Z7LA 3FKJA 4ZDLA 5M5XJ 4OMZA 3S3NA 3GTGJ 1XDSA 4QTRA 2G0EA 1ENHA 3KP3A 3CCRI 3ZQLA 1XSXA 4RB1A 1YIOA 2VKEA 3DTKA 5CVUA 2QZ8A 2O03A 1LB2A 1HKSA 1XPXA 2UWMA 2O5RA 3JAMK 3EUAA 2D1HA 4PJMA 1SFXA 3ZR8X 4I76A 1VQ7I 3KCCA 4CCMA 4S05A 2ICWG 4I7HA 4IHWA 1T98A 4BE1A 1OYIA 3QWLA 4G6DA 3KYLA 4DYQA 1STZA 3IH3A 3ZPLA 2LR8A 2P7CB 3HC7A 4XKCA 4HNVA 3HOTA 1F4KA 3KLNA 2CFXA 5GP9A 2KIQA 3HOSA 1SMYF 5FFZA 4M3GA 3GBGA 1IXRC 1ITYA 4AIHA 5LEJA 3ZQIA 4XN3A 3PO3J 1WI9A 2LVSA 4GFBA 1USSA 1VQPI 3D5SC 4ETSA 3F8CA 2JPCA 4LOCA 3SFIA 1R1VA 2OCEA 2WAFA 1U3EM 4BE2A 3VPRA 3U1DA 2CJJA 5EZHA 3PIPF 3V42A 2LH9A 2X6XA 2RAEA 5FROA 3RSNA 1BIBA 3SDGA 3ZQFA 1FY7A 1TW3A 2RQPA 2DFEA 1FYMA 4HV6A 1L0OC 3SJMA 4HOBA 2JSCA 4CZCA 2EFOA 5LEKA 1TNSA 4MEXF 1AWCA 1ZGAA 3WODF 3ESWB 3BTJA 1H8AC 1E3HA 2CO5A 3E7LA 4XMYA 5FKLA 2E60A 1K78B 3HOYJ 2NVTJ 2PLYA 2QYOA 1S72I 4Y33A 4WXDA 2EZLA 2K86A 3V7CA 1FEXA 1FYLA 2HVSA 3I59A 1JT6A 4GYGA 1ETXA 3GFLA 2JPBA 4IEJA 5IT9K 2ZJ2A 3NWTA 2ISYA 1G59A 1QVUA 2CW8A 1GV5A 4E7ZA 1J09A 3D0SA 2DOAA 2DA4A 4FX4A 3GVAA 1OPCA 2W84A 4I0AA 4CUGA 1SD7A 4RB3C 2VUMJ 3G1OA 1W5TA 3OYAA 1MBEA 2GM4A 4HQMA 3GLLA 2DA1A 2ZSIB 2E1MB 2E5ZA 3HKZA 2K9MA 1GVDA 2VXZA 1Z6RA 1HCRA 1HLVA 4A3IJ 3S1RJ 1TP4A 1FIPA 1IGNA 2PJRA 1B4AA 5HDKA 3W2WA 5HNHA 1FZPB 2PFBA 3TOAA 2DODA 5JVTA 3PUFA 3DBHB 5JHUA 1GXQA 5J4VA 1ZHFA 4IF4A 2PJPA 2JUCA 3ZMDA 2LFBA 2CWEA 1CQTA 1QQIA 1DU6A 2A5YB 4U0VA 1RI7A 4RGUA 4IKFA 1V5FA 1X19A 1N25A 3CUQB 1O3TA 2YS9A 5C4XJ 5J40A 3FZVA 1LFUP 2XKPA 4M3FA 3KYDB 2JA7J 3GTPJ 1BOBA 2XHKA 2HR3A 3TW6A 4ENJA 3PIOF 3CCLI 3BC8A 5D8LB 2X1DA 3RI4A 1UB9A 3NAUA 3LFUA 1AOYA 1YS7A 1X1DA 4A3KJ 1XCBA 2Q2EA 3Q0UA 2EIJH 1EH8A 3GTOJ 1ZN2A 4BJ5C 3PFIA 2XGCA 4DIQA 3OSFA 2XASA 1HDDC 4XKBA 4BHCA 4ZZDA 4IOCF 3QAHA 1QNTA 5TRDA 3H9GA 2VJJA 1ETOA 4ITVA 1D8JA 3WG9A 2Q0OA 3P9CA 1I6XA 5DDGA 4CXFA 2EFPA 3E6DA 5HODA 1O7LA 4RGSA 5FKKA 4QPQA 4FISA 2FMYA 2A6HF 3FBNB 1FOKA 3HRTA 1GXPA 2NVYJ 2E1CA 2QWWA 1WCMJ 2HNHA 2K9QA 2LKXA 3GW2A 1R23A 2KRHA 1TT0A 5DCFA 4CYCB 4LFUA 3S93A 1ACIA 4G6QA 4BBSJ 4N9IA 3C2BA 3RQIA 4S04A 1SEUA 2LY9A 1U6GA 3HSRA 4KJZA 3HIFA 1KQ9A 4KIFA 1X3WB 1V4RA 4MNUA 5AONA 5D5XB 2A69F 2V26A 1APLC 2HOSA 3GUDA 1IAWA 2VXDA 5IOYA 1J7KA 1D1CA 4EJOA 4P9UA 3BG5A 3LMMA 5FKMA 5BOXA 4O5VA 3HTUA 2P8TA 2LD5A 3C7JA 1I50J 1E3PA 3F6OA 5DYMA 3MAJA 4R1HA 4WCGA 2EH3A 2HYJA 3PSIA 2NVQJ 2ZMEC 4B1RA 2DDAA 2B0LA 5ICCA 1YFHA 2E2IJ 3FMSA 5H20A 3GLXA 3ZCOA 5HDGA 2LF7A 1XGOA 3CTAA 3V7RA 3VYRB 1JJ6C 1MIJA 1WJ5A 4F55A 5E3NA 3MMYB 1DGRM 3BY6A 1WJFA 5IP7J 3ONQA 1NH3A 1Y0UA 2QM3A 2BEOA 3U1KA 3TMOA 2A68F 1PYVA 4J01A 1HQCA 4Z2YA 2KISA 2DMNA 1O7FA 4HW0A 5KAIC 1GVJA 4J19A 2M5WA 2ZXWH 3UKGA 2MGQA 3OWTA 2STWA 2K7LA 2FSWA 2K40A 2DMUA 1TC3C 4M6YA 5BPIA 5L3GA 1KU7A 2QQAA 3DTEA 2D45A 5HOOA 5H6RA 2VJIA 1JTYA 2BV6A 3L2VA 3FXQA 1VQNI 1ONVA 4E7KA 2WADA 4CCLA 2VJ4A 2P6TA 1W0TA 4EVIA 3S17J 1OCRH 2V79A 4JQFA 4CCJA 4UB8C 1WPKA 3PJRA 4AYBA 2DN0A 2GQQA 2W25A 3PNVA 3E5XA 1UMQA 4XORA 1OISA 5KVRA 4W1UA 2VQLA 3EETA 3DFGA 3CO6C 2JRMA 4NQWA 2LK2A 1W0UA 3HOZJ 3CUOA 1QVTA 2Y69H 4ZDOA 2I5UA 4MIMA 3SDBA 1HA8A 3QYFA 4ENNA 4IPAA 1IDZA 1MD0A 3V4GA 1W1WE 4G7ZF 1N75A 3MD2A 1V55H 4FASD 3WTWC 1HBXG 4U7DA 1W7PA 2L9RA 5C3EJ 3K0LA 4LIVA 5B5EC 1D0XA 3VYUB 4PGGA 4LD5A 1QBJA 3CJTB 1GHCA 1FMVA 3A03A 4D5CA 3M1EA 2XRNA 1N77A 5KCMA 1JKPC 2VT3A 2CMPA 4BJ6C 3OYCA 4NQWB 3IH4A 3DPUA 1YRNB 1OR7C 2L9VA 2DK5A 2FX0A 2W24A 1R22A 3PQJA 3ZMSA 1XTAA 4JBAA 2AXLA 3LSMA 3AFHA 2EIMH 1TWGJ 2M45A 4YFKF 2XAUA 4NB5A 4IHYA 3CCUI 1ZRFA 2VONA 4AD9A 1S9HA 1Z67A 2VQCA 1RUNA 1B8IA 4UHTA 3MVPA 4DBRA 2Y75A 4OIPF 2V6CA 4XLFA 1NG6A 3ZRGA 4PZJA 3H92A 2QCOA 3T1BA 4E7LA 3WTYC 2M34A 4BY7J 3RZDJ 2PG4A 3K4KA 3O6BB 3FHZA 1X1CA 4M6VA 1I3QJ 1ZREA 3I4PA 1MH4A 4KDPA 2D2WA 4JX5A 4MFEA 1QHGA 3ZP5A 4WF2A 2DXIA 1R00A 4D1QA 2GA1A 2OPTA 3GXOA 5BPDA 2EQRA 1HXDA 2FU4A 4ZYEA 4LLLA 1WJCA 2XRLA 3HM5A 1RNLA 2VE8A 2ISZA 3GF2A 2MLGA 3KZYA 3ELKA 1XSDA 4BGDA 5HS8A 2R7RA 4Q5SF 4L9VA 2MG4A 1LJ9A 3O2PE 4RDUA 2JVGA 1ZGJA 4YELA 1SAUA 2E19A 4X6AJ 1JXSA 3BR1A 1X58A 1RIOH 2JWTA 2KZVA 3F22A 2Z16A 1VQMI 1SD5A 2YU9J 3R60A 3HUGB 2JQ7A 3HDDA 4LJZF 1NTCA 1KQ8A 6PAXA 4KT5C 1WSUA 3C2HA 1S5LC 3K70D 4ZTJA 2R7WA 2WV1A 2Y0SN 4I01A 3VDXA 4D7NA 2L4MA 4V19K 1YI2I 4F3QA 3E3VA 2R92J 2DOEA 5AIPA 2W1OA 2WAQN 1FBSA 1FPQA 4OWRB 1MBFA 3N4MA 1JGSA 2QENA 2NVUB 1ZARA 2DBBA 1WJDA 2YX7A 3K4BA 4A3GJ 3HSEA 1ZKGA 1S8NA 2HI3A 2NYXA 1HC8A 3H0GJ 4PFOA 2OTJI 1BIAA 3F21A 1JHHA 3MEXA 4D9JA 2JMWA 5ICGA 1M1EB 3E0JB 4PJ0C 2FBIA 1DQUA 1X4PA 2F5DA 3OS1A 1ZGWA 2Y9ZA 1YW8A 2PN6A 3BG6A 5E3LA 4CICA 4A5NA 3WGGA 3ZMVA 1UFMA 3RPUA 3JSOA 1DU0A 4UUSA 2DQRA 3JRIA 4PJNA 1D1BA 5DD4A 2KIMA 2HKXA 3SZPA 2ACJA 2D5VA 1MDMA 2RNJA 4A0XA 2R5ZA 2RNGA 1I5ZA 1R9TJ 3REOA 4A3LJ 2FA5A 2UXNA 4BQNA 2MD5A 1TTYA 2R7XA 3BDDA 2NXNB 2M0MA 2R7UA 1TL8A 2A6EF 2XDVA 2EZHA 2DFFA 4UVCA 2H6BA 5B3SH 1DDNA 4BAYA 3K10A 1RUOA 4RAGA 3HSFA 4B44A 3I4NJ 3FXRA 1I1GA 1XGNA 4A6EA 1OLTA 1T95A 3P9KA 3FXKA 2X48A 3FK6A 3DKWA 4PDKA 2ZMEA 2VBZA 5LBQA 4UVAA 4OIQF 1Y8QB 2OCCH 3RQ4A 1SAXA 3ECHA 3K9TA 1OJLA 2XGXA 1LNWA 3K4JA 4OOIA 1ZR4A 4CHUA 5CKTA 1UELB 2K9LA 5HDNA 3CCYA 2CQQA 2J5PA 1WRJA 2FJ1A 1ZR2A 5K7FA 2QQ8A 1Z91A 1MJ9A 5EJCA 3QODA 3M8JA 4HEA2 2F5CA 5LD2C 2OC6A 4M3DA 3OL3A 4QPOA 4I98B 4F93B 2LG4A 4W97A 1U0JA 3VFZA 1RR8C 1VQ6I 1O4XA 3HZJA 1WH7A 2XAGA 4ESJA 3HOVJ 3RYPA 3A02A 3S2WA 4A3JJ 5HLTA 4FX0A 2IS1A 2L0KA 3LSPA 2QF7A 5J8CA 4UNOA 2NRAC 1G3WA 4B48A 2Y0MA 5GAGJ 3FIWA 3DEEA 4E70A 4UB6C 5DEQA 5E18F 2PMUA 4AYBN 4BY1J 2H27A 5B1BH 1KA8A 5IT9Z 3R4KA 2E35A 3AG3H 2MYSA 5FKOA 4BL0B 3WTSC 3KP4A 4MFDA 1MMDA 4V2FA 2EJRA 4RAZA 1Z3XA 2XSDC 2CH0A 1OFCX 3HRMA 4CYCA 3MCZA 4G12A 2WAEA 3CMEI 2HZDA 2ID3A 2EZIA 4LG0B
chains in the Genus database with same CATH topology
1U8BA 2JA8J 1MSFC 1PUFA 2JJ7A 1AKHA 1MBEA 3BTIA 1Q1VA 2GM4A 1FJLA 2DA1A 2O7OA 1GVDA 5IOZA 2COBA 1HCRA 1ORKA 1HLVA 4A3IJ 3S1RJ 1FIPA 1IGNA 1ZTRA 3GTKJ 1K61A 2R5ZB 2TCTA 4D5FA 1B72A 5DTDA 1F36A 4AUXA 5EGOA 4JP0A 3HOWJ 4A3FJ 5FJ8J 2LFBA 1ETYA 2DMPA 2DJNA 1CQTA 1DU6A 3TEDA 1E3OC 3Q0VA 4DZJA 2DTZA 2YS9A 5C4XJ 2N8GA 3BG9A 1AKHB 5IYCJ 2IEKA 2E1OA 2K9NA 1RPWA 5F0FA 1LFUP 3GTPJ 1ETVA 4M3FA 4ABZA 2JA7J 4A93J 3TW6A 3H3VK 3O8HA 3NAUA 3CQZJ 2L7MP 1U78A 4A3BJ 4A3KJ 1IJWC 3Q0UA 4QSHA 3JRDA 2DMQA 3GTOJ 1HDDC 2XGCA 5F04A 3OSFA 4UUTA 3MN2A 3DCFA 1IV6A 1UG2A 1F43A 2CRGA 1ETOA 2E2JJ 1JUSA 2DA2A 3JRAA 2HQ5A 3QPSA 3IH2A 1ETWA 1X2NA 2HXOA 5HODA 1AU7A 1K83J 5E3OA 2M0CA 3G1MA 5FKKA 3WHBA 4FISA 3B6CA 2ECCA 2CU7A 2NVYJ 1LE8A 2ECBA 1WCMJ 1FIAA 1WGXA 2K9QA 2LKXA 3S15J 2GBYA 3LSRA 1YRNA 4C2MJ 1IRZA 3MKLA 3WHCA 2CUFA 2I10A 4CYCB 1P7JA 2L7FP 2B63J 4MLOA 1LFBA 4FCYA 4BBSJ 1I6HJ 2NS8A 3C2BA 3RQIA 5IPAA 2L7ZA 2LY9A 3JREA 3LSGA 3GTLJ 2XGDA 3HEFA 4QIWN 3LNQA 3D1NI 2R5YB 1APLC 2HOSA 1S7EA 3ZQHA 3HOUJ 3BQZA 1ZK8A 4A3EJ 5IOYA 1Y1VJ 4A3CJ 3BG5A 2Y9YA 5FKMA 1H89C 3BR6A 2H1KA 4S0HB 4C3IJ 2X6OA 2LD5A 1PUFB 1I50J 1RETA 3BT9A 5M5YJ 2EH3A 3OOUA 3HB9A 5GPAA 4XICA 2HYJA 4XRSA 3ZQGA 2NVQJ 3Q3SA 1WH5A 4B1RA 3W6VA 4V2GA 1VF9A 1GUUA 2E2IJ 1JGGA 2DMTA 1RKTA 4X1EA 1HOMA 2GLOA 1JJ6C 2AHQA 3LOCA 1IC8A 5E3NA 1JUPA 5IP7J 5IP9J 4XRSG 2ZB9A 1NK2P 3G1LA 3FISA 1ETQA 5F1JA 4BBRJ 5C44J 2VUMJ 2YUSA 2JA6J 2R93J 2EBIA 2DMNA 5C4JJ 3GTQJ 4J19A 2IBDA 3UKGA 3IV5A 2MGQA 1IUFA 2K40A 2DMUA 2LP0A 1FTTA 5GPCA 1TC3C 5J1UA 2CQXA 2Y30A 3S1MJ 4JYKA 4IHXA 2H8RA 2XB5A 1JTXA 2MW8A 1JTYA 1MBHA 2Y2ZA 2HOAA 1MBKA 4JX6A 3BR2A 1W0TA 3S17J 3I4MJ 2W48A 1WI3A 1WPKA 2PMZN 2DN0A 1QRYA 1FTZA 1HDPA 1UMQA 1TWHJ 5JLWA 2NS7A 3LSJA 4W1UA 2VKVA 4A3MJ 3TP0A 2R7ZJ 1T33A 1BW5A 2LK2A 3Q0WA 1W0UA 3HOZJ 4M3EA 1QVTA 2NVXJ 1UHSA 3JRGA 4MIMA 1BJZA 1T56A 1OCTC 1A5JA 1TWFJ 1GT0C 3JRCA 1IDZA 5M5WJ 2HDDA 2DA7A 1GV2A 1XS9A 2L9RA 5C3EJ 4B3AA 1XC5A 2JN6A 1BW6A 5F0HA 3GTMJ 9ANTA 3A03A 4D5CA 2LTPA 3OIOA 5J1YA 1JKPC 1BA5A 3CMYA 5J3LA 4IHVA 3BTLA 4JX4A 1Z77A 3GTJJ 1JKOC 3IH4A 1QPIA 1YRNB 3DEWA 3JRBA 2FX0A 2XB0X 3BR5A 5IYBJ 3FKIJ 3HGYA 3A01A 1TWGJ 2HOTA 4IHYA 1VNDA 3L1PA 1MBJA 2M2EA 1B8IA 3MVPA 5M3FJ 2R5YA 1A6IA 1Z0XA 5EG0B 4Y52J 2QCOA 1VFCA 4C3HJ 2M34A 4BY7J 3RZDJ 1RESA 4M6VA 1GDTA 1I3QJ 4FTHA 2VI6A 2DA6A 1P7IA 1MH4A 1JKRC 4JX5A 1U9NA 4MFEA 4FE7A 4MO7A 3S2DJ 1ZQ3P 2OPTA 1IDYA 2EQRA 1U9OA 2XPWA 3HBLA 1MNMC 5EYRA 5FKNA 3ZQCA 4BXXJ 2XRLA 3HM5A 3K7AJ 5F0CA 1MBGA 3S14J 2NOGA 2TRTA 3OSGA 1SFOJ 1G2HA 2K9SA 3B6AA 5IYDJ 2MG4A 4RBOA 4RDUA 2JA5J 2AO9A 5JLXA 1AHDP 5M3MJ 2E2HJ 2E19A 5EZGA 4X6AJ 3BR1A 3TP3A 1X58A 5FLMJ 2JWTA 1NK3P 3JRFA 5EGOB 2ID6A 3QPLA 2YU9J 5IP6A 1RR7A 2X9DA 1Y1WJ 5F27A 1EF4A 3HDDA 1NTCA 3BQYA 1POGA 4A69C 2O8KA 4C3JJ 1OCPA 3CDLA 4XRMA 2O9LA 3A01B 4XIDA 2WV1A 2Y0SN 4AC0A 3RZOJ 2XPUA 5DS9A 2ME6A 4D7NA 2ELKA 1JKQC 3JRHA 2R92J 1X2MA 2WAQN 1MBFA 5K7HA 1MH3A 1VI0A 4B4CA 1D5YA 2FD5A 4M3BA 2KDZA 1TWAJ 4FE4A 4DYRA 1ZKGA 3RKQA 2HI3A 5EG0A 1B72B 3H0GJ 4A3GJ 3PM1A 2XPVA 5FLVA 2JMWA 3HGGA 4EEFG 3F0CA 4I6ZA 1SANA 1ZGWA 2MSYA 1HF0A 2Y9ZA 3M3YJ 5E3LA 1DU0A 2DA5A 4UUSA 3JRIA 5M5XJ 3GTGJ 4Y7NJ 3BR3A 2D5VA 4QTRA 2G0EA 1ENHA 2R5ZA 3ZQLA 2OF7A 2VKEA 2KT0A 1R9TJ 4A3LJ 2LLKA 2XGEA 4DW6A 4DYCA 1TWCJ 3NARA 2EZHA 4D7MA 1H88C 3HKZN 3BR0A 5E3MA 5K7ZA 3I4NJ 4I76A 5BNGA 1IG7A 4IHWA 2X48A 3FK7A 3PO2J 3S1QJ 3FK6A 4DYQA 3IH3A 2LR8A 1RKWA 2M9HA 4HNVA 3S16J 3S2HJ 5GP9A 4L5EA 2JK3A 1OJLA 3GBGA 4M3GA 1JJ8C 1ITYA 3ZQIA 3PO3J 1ZR4A 2LVSA 4GFBA 3K2AA 3CCYA 2IAIA 2CQQA 4LOCA 3SFIA 2FJ1A 4XK4A 1ZR2A 5K7FA 1JUMA 1JT0A 5EEAA 4M3DA 1LE8B 3VPRA 3S1NJ 2CJJA 5EZHA 4W97A 2P81A 2RAEA 4BKXA 1XG1A 3QQAA 1O4XA 3SDGA 1WH7A 3ZQFA 5F08A 1BL0A 5EF6A 2WB1N 3HOVJ 1MSEC 4UUSB 4NDLA 2HXIA 3SJMA 3A02A 4A3DJ 4A3JJ 2L0KA 3LSPA 2QF7A 1B8IB 3BTJA 3O8GA 1H8AC 3E7LA 5FKLA 3HOXJ 3HOYJ 3M4OJ 2NVTJ 3FIWA 2CUEA 3TW7A 5EDNA 2EZLA 2VPRA 3BG3A 1FEXA 4AYBN 2R0QC 4BY1J 1JT6A 2Y31A 1ETXA 4IEJA 2M8GX 4DZPA 3BTCA 5J1RA 5FKOA 2EZKA 3JR9A 4MFDA 1QVUA 1ETKA 1GV5A 2DA3A 4V2FA 2XSDC 1OFCX 2DA4A 3ZOBA 4CYCA 2ME0A 4G12A 2ID3A 2EZIA 2FQ4A 3G1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U8B A;  2JA8 J;  1MSF C;  1PUF A;  2JJ7 A;  1AKH A;  1MBE A;  3BTI A;  1Q1V A;  2GM4 A;  1FJL A;  2DA1 A;  2O7O A;  1GVD A;  5IOZ A;  2COB A;  1HCR A;  1ORK A;  1HLV A;  4A3I J;  3S1R J;  1FIP A;  1IGN A;  1ZTR A;  3GTK J;  1K61 A;  2R5Z B;  2TCT A;  4D5F A;  1B72 A;  5DTD A;  1F36 A;  4AUX A;  5EGO A;  4JP0 A;  3HOW J;  4A3F J;  5FJ8 J;  2LFB A;  1ETY A;  2DMP A;  2DJN A;  1CQT A;  1DU6 A;  3TED A;  1E3O C;  3Q0V A;  4DZJ A;  2DTZ A;  2YS9 A;  5C4X J;  2N8G A;  3BG9 A;  1AKH B;  5IYC J;  2IEK A;  2E1O A;  2K9N A;  1RPW A;  5F0F A;  1LFU P;  3GTP J;  1ETV A;  4M3F A;  4ABZ A;  2JA7 J;  4A93 J;  3TW6 A;  3H3V K;  3O8H A;  3NAU A;  3CQZ J;  2L7M P;  1U78 A;  4A3B J;  4A3K J;  1IJW C;  3Q0U A;  4QSH A;  3JRD A;  2DMQ A;  3GTO J;  1HDD C;  2XGC A;  5F04 A;  3OSF A;  4UUT A;  3MN2 A;  3DCF A;  1IV6 A;  1UG2 A;  1F43 A;  2CRG A;  1ETO A;  2E2J J;  1JUS A;  2DA2 A;  3JRA A;  2HQ5 A;  3QPS A;  3IH2 A;  1ETW A;  1X2N A;  2HXO A;  5HOD A;  1AU7 A;  1K83 J;  5E3O A;  2M0C A;  3G1M A;  5FKK A;  3WHB A;  4FIS A;  3B6C A;  2ECC A;  2CU7 A;  2NVY J;  1LE8 A;  2ECB A;  1WCM J;  1FIA A;  1WGX A;  2K9Q A;  2LKX A;  3S15 J;  2GBY A;  3LSR A;  1YRN A;  4C2M J;  1IRZ A;  3MKL A;  3WHC A;  2CUF A;  2I10 A;  4CYC B;  1P7J A;  2L7F P;  2B63 J;  4MLO A;  1LFB A;  4FCY A;  4BBS J;  1I6H J;  2NS8 A;  3C2B A;  3RQI A;  5IPA A;  2L7Z A;  2LY9 A;  3JRE A;  3LSG A;  3GTL J;  2XGD A;  3HEF A;  4QIW N;  3LNQ A;  3D1N I;  2R5Y B;  1APL C;  2HOS A;  1S7E A;  3ZQH A;  3HOU J;  3BQZ A;  1ZK8 A;  4A3E J;  5IOY A;  1Y1V J;  4A3C J;  3BG5 A;  2Y9Y A;  5FKM A;  1H89 C;  3BR6 A;  2H1K A;  4S0H B;  4C3I J;  2X6O A;  2LD5 A;  1PUF B;  1I50 J;  1RET A;  3BT9 A;  5M5Y J;  2EH3 A;  3OOU A;  3HB9 A;  5GPA A;  4XIC A;  2HYJ A;  4XRS A;  3ZQG A;  2NVQ J;  3Q3S A;  1WH5 A;  4B1R A;  3W6V A;  4V2G A;  1VF9 A;  1GUU A;  2E2I J;  1JGG A;  2DMT A;  1RKT A;  4X1E A;  1HOM A;  2GLO A;  1JJ6 C;  2AHQ A;  3LOC A;  1IC8 A;  5E3N A;  1JUP A;  5IP7 J;  5IP9 J;  4XRS G;  2ZB9 A;  1NK2 P;  3G1L A;  3FIS A;  1ETQ A;  5F1J A;  4BBR J;  5C44 J;  2VUM J;  2YUS A;  2JA6 J;  2R93 J;  2EBI A;  2DMN A;  5C4J J;  3GTQ J;  4J19 A;  2IBD A;  3UKG A;  3IV5 A;  2MGQ A;  1IUF A;  2K40 A;  2DMU A;  2LP0 A;  1FTT A;  5GPC A;  1TC3 C;  5J1U A;  2CQX A;  2Y30 A;  3S1M J;  4JYK A;  4IHX A;  2H8R A;  2XB5 A;  1JTX A;  2MW8 A;  1JTY A;  1MBH A;  2Y2Z A;  2HOA A;  1MBK A;  4JX6 A;  3BR2 A;  1W0T A;  3S17 J;  3I4M J;  2W48 A;  1WI3 A;  1WPK A;  2PMZ N;  2DN0 A;  1QRY A;  1FTZ A;  1HDP A;  1UMQ A;  1TWH J;  5JLW A;  2NS7 A;  3LSJ A;  4W1U A;  2VKV A;  4A3M J;  3TP0 A;  2R7Z J;  1T33 A;  1BW5 A;  2LK2 A;  3Q0W A;  1W0U A;  3HOZ J;  4M3E A;  1QVT A;  2NVX J;  1UHS A;  3JRG A;  4MIM A;  1BJZ A;  1T56 A;  1OCT C;  1A5J A;  1TWF J;  1GT0 C;  3JRC A;  1IDZ A;  5M5W J;  2HDD A;  2DA7 A;  1GV2 A;  1XS9 A;  2L9R A;  5C3E J;  4B3A A;  1XC5 A;  2JN6 A;  1BW6 A;  5F0H A;  3GTM J;  9ANT A;  3A03 A;  4D5C A;  2LTP A;  3OIO A;  5J1Y A;  1JKP C;  1BA5 A;  3CMY A;  5J3L A;  4IHV A;  3BTL A;  4JX4 A;  1Z77 A;  3GTJ J;  1JKO C;  3IH4 A;  1QPI A;  1YRN B;  3DEW A;  3JRB A;  2FX0 A;  2XB0 X;  3BR5 A;  5IYB J;  3FKI J;  3HGY A;  3A01 A;  1TWG J;  2HOT A;  4IHY A;  1VND A;  3L1P A;  1MBJ A;  2M2E A;  1B8I A;  3MVP A;  5M3F J;  2R5Y A;  1A6I A;  1Z0X A;  5EG0 B;  4Y52 J;  2QCO A;  1VFC A;  4C3H J;  2M34 A;  4BY7 J;  3RZD J;  1RES A;  4M6V A;  1GDT A;  1I3Q J;  4FTH A;  2VI6 A;  2DA6 A;  1P7I A;  1MH4 A;  1JKR C;  4JX5 A;  1U9N A;  4MFE A;  4FE7 A;  4MO7 A;  3S2D J;  1ZQ3 P;  2OPT A;  1IDY A;  2EQR A;  1U9O A;  2XPW A;  3HBL A;  1MNM C;  5EYR A;  5FKN A;  3ZQC A;  4BXX J;  2XRL A;  3HM5 A;  3K7A J;  5F0C A;  1MBG A;  3S14 J;  2NOG A;  2TRT A;  3OSG A;  1SFO J;  1G2H A;  2K9S A;  3B6A A;  5IYD J;  2MG4 A;  4RBO A;  4RDU A;  2JA5 J;  2AO9 A;  5JLX A;  1AHD P;  5M3M J;  2E2H J;  2E19 A;  5EZG A;  4X6A J;  3BR1 A;  3TP3 A;  1X58 A;  5FLM J;  2JWT A;  1NK3 P;  3JRF A;  5EGO B;  2ID6 A;  3QPL A;  2YU9 J;  5IP6 A;  1RR7 A;  2X9D A;  1Y1W J;  5F27 A;  1EF4 A;  3HDD A;  1NTC A;  3BQY A;  1POG A;  4A69 C;  2O8K A;  4C3J J;  1OCP A;  3CDL A;  4XRM A;  2O9L A;  3A01 B;  4XID A;  2WV1 A;  2Y0S N;  4AC0 A;  3RZO J;  2XPU A;  5DS9 A;  2ME6 A;  4D7N A;  2ELK A;  1JKQ C;  3JRH A;  2R92 J;  1X2M A;  2WAQ N;  1MBF A;  5K7H A;  1MH3 A;  1VI0 A;  4B4C A;  1D5Y A;  2FD5 A;  4M3B A;  2KDZ A;  1TWA J;  4FE4 A;  4DYR A;  1ZKG A;  3RKQ A;  2HI3 A;  5EG0 A;  1B72 B;  3H0G J;  4A3G J;  3PM1 A;  2XPV A;  5FLV A;  2JMW A;  3HGG A;  4EEF G;  3F0C A;  4I6Z A;  1SAN A;  1ZGW A;  2MSY A;  1HF0 A;  2Y9Z A;  3M3Y J;  5E3L A;  1DU0 A;  2DA5 A;  4UUS A;  3JRI A;  5M5X J;  3GTG J;  4Y7N J;  3BR3 A;  2D5V A;  4QTR A;  2G0E A;  1ENH A;  2R5Z A;  3ZQL A;  2OF7 A;  2VKE A;  2KT0 A;  1R9T J;  4A3L J;  2LLK A;  2XGE A;  4DW6 A;  4DYC A;  1TWC J;  3NAR A;  2EZH A;  4D7M A;  1H88 C;  3HKZ N;  3BR0 A;  5E3M A;  5K7Z A;  3I4N J;  4I76 A;  5BNG A;  1IG7 A;  4IHW A;  2X48 A;  3FK7 A;  3PO2 J;  3S1Q J;  3FK6 A;  4DYQ A;  3IH3 A;  2LR8 A;  1RKW A;  2M9H A;  4HNV A;  3S16 J;  3S2H J;  5GP9 A;  4L5E A;  2JK3 A;  1OJL A;  3GBG A;  4M3G A;  1JJ8 C;  1ITY A;  3ZQI A;  3PO3 J;  1ZR4 A;  2LVS A;  4GFB A;  3K2A A;  3CCY A;  2IAI A;  2CQQ A;  4LOC A;  3SFI A;  2FJ1 A;  4XK4 A;  1ZR2 A;  5K7F A;  1JUM A;  1JT0 A;  5EEA A;  4M3D A;  1LE8 B;  3VPR A;  3S1N J;  2CJJ A;  5EZH A;  4W97 A;  2P81 A;  2RAE A;  4BKX A;  1XG1 A;  3QQA A;  1O4X A;  3SDG A;  1WH7 A;  3ZQF A;  5F08 A;  1BL0 A;  5EF6 A;  2WB1 N;  3HOV J;  1MSE C;  4UUS B;  4NDL A;  2HXI A;  3SJM A;  3A02 A;  4A3D J;  4A3J J;  2L0K A;  3LSP A;  2QF7 A;  1B8I B;  3BTJ A;  3O8G A;  1H8A C;  3E7L A;  5FKL A;  3HOX J;  3HOY J;  3M4O J;  2NVT J;  3FIW A;  2CUE A;  3TW7 A;  5EDN A;  2EZL A;  2VPR A;  3BG3 A;  1FEX A;  4AYB N;  2R0Q C;  4BY1 J;  1JT6 A;  2Y31 A;  1ETX A;  4IEJ A;  2M8G X;  4DZP A;  3BTC A;  5J1R A;  5FKO A;  2EZK A;  3JR9 A;  4MFD A;  1QVU A;  1ETK A;  1GV5 A;  2DA3 A;  4V2F A;  2XSD C;  1OFC X;  2DA4 A;  3ZOB A;  4CYC A;  2ME0 A;  4G12 A;  2ID3 A;  2EZI A;  2FQ4 A;  3G1O A; 
#chains in the Genus database with same CATH topology
 3CMM A;  1XMK A;  1VQ9 I;  3CDI A;  4F91 B;  1PUF A;  3BTI A;  5JI6 A;  1Q1V A;  4Q47 A;  3S3O A;  2E1N A;  2HTS A;  3GME A;  3GZ6 A;  4E7H A;  2E36 A;  2QKM B;  1G6N A;  1H9G A;  4BDZ A;  2KZG A;  3U21 A;  3QU6 A;  1P92 A;  4RAY A;  5TJJ A;  1BI1 A;  4D5F A;  1VQK I;  1B72 A;  1F36 A;  3CLQ A;  3LAP A;  3T8R A;  5EGO A;  4JP0 A;  3FXM A;  3HOW J;  2VLA A;  1ETY A;  1WQ2 A;  2DMP A;  3IWF A;  2CQK A;  2DJN A;  5E8G A;  2V9K A;  3TED A;  2AQF A;  2R7O A;  5CPR B;  3X2Q H;  4O3M A;  3JW4 A;  4DZJ A;  2DTZ A;  3D5L A;  3AG1 H;  2EA4 A;  1LVK A;  1MND A;  2N8G A;  2IXS A;  3BG9 A;  4KN7 X;  2E1O A;  4M9S A;  3L2U A;  1RPW A;  2B7E A;  1ETV A;  4ABZ A;  4A93 J;  1CGP A;  2BVL A;  4KFC A;  1XD7 A;  3K6G A;  3CQZ J;  3NWS A;  1S7O A;  3SZT A;  3K4C A;  4U87 A;  3OYF A;  5FGM A;  2XSJ C;  4BEH B;  4ESB A;  4ZJZ A;  2H6C A;  1BR1 A;  5CVR A;  2R7D A;  1TQM A;  1W7P B;  1WJA A;  4UV9 A;  3RPU D;  5F04 A;  4OIN F;  3HRS A;  2FNA A;  2OAZ A;  3LL7 A;  3MN2 A;  4RB0 A;  2HTJ A;  1TBX A;  1UG2 A;  1S7A A;  3DU5 A;  1F43 A;  2CRG A;  2X85 A;  2E2J J;  2VE9 A;  3MZ8 A;  1BC7 C;  1GLN A;  3JRA A;  5CQG A;  2HQ5 A;  2G7H A;  4DGW B;  1ETW A;  1X2N A;  1WHU A;  2HXO A;  4LIU A;  4R8H A;  2C6Y A;  3CZ6 A;  5D4S A;  5E3O A;  3ZXS A;  5A2Q Z;  4EAT A;  3CC2 I;  1ZG5 A;  4G9Y A;  1YS6 A;  4HAM A;  5FRN A;  1BR2 A;  1MMG A;  2RC4 A;  2CU7 A;  3N97 A;  1HSJ A;  3M07 A;  2UUZ A;  2QA4 I;  2VAS A;  1WGX A;  2ZCW A;  5BS6 A;  3WGH A;  1C0W A;  3S15 J;  3TDU C;  3LSR A;  2IA2 A;  4F7Z A;  4RGR A;  1SD6 A;  2DDB A;  2HEO A;  1P7J A;  3EPZ A;  4KYW A;  2CGP A;  2DU9 A;  2NS8 A;  5ICF A;  3ERM A;  2PQ8 A;  1EH7 A;  3GCM A;  3JRE A;  1O3S A;  4XON A;  3KP7 A;  2HVQ A;  3GTL J;  2XGD A;  2R5Y B;  5FLX Z;  4AWX B;  1B6A A;  3S32 A;  1S7E A;  3AL0 B;  1G3Y A;  2IVM A;  3HOU J;  5D8K B;  5DM6 F;  4A3E J;  3WTV C;  2ZJQ F;  2Y9Y A;  3BOQ A;  3IC7 A;  1FX7 A;  2H1K A;  5EEH A;  2COM A;  4HG2 A;  1PUF B;  1YX5 A;  2LC2 A;  2WC2 A;  5DUK A;  3OV8 A;  3QYE A;  4FHT A;  5GPA A;  4ANJ A;  1R36 A;  1WH5 A;  2ZME B;  3BJA A;  3Q3S A;  3H9Q A;  1R58 A;  3TOB A;  1VF9 A;  4M72 A;  4NBQ A;  2O3F A;  3L2W A;  3LSH A;  2G7U A;  3I58 A;  2ZC2 A;  2QSH X;  1HOM A;  3CD6 I;  2F4I A;  3I59 B;  3LOC A;  2OTL I;  3SXY A;  4HX8 A;  4EV0 A;  1WWX A;  1L3L A;  1FWZ A;  4CCN A;  2ZB9 A;  3KIO A;  3W6J B;  2F4O B;  4G6T B;  4BBR J;  4L5J A;  1J59 A;  5AIQ A;  5K1Y A;  2JA6 J;  2HQN A;  4EM2 A;  2EBI A;  3WTT C;  2V9P A;  5E1X A;  4CH7 A;  2W7N A;  2R7S A;  4N4N B;  2IS4 A;  1SFE A;  1IN4 A;  2VJ5 A;  5IT3 A;  1W7P D;  4AIJ A;  5GPC A;  1FTT A;  4M6X A;  2CQX A;  4XLA A;  3S1M J;  4U88 A;  2K4J A;  4JYK A;  1YG2 A;  4C30 A;  1E17 A;  4IHX A;  2XB5 A;  2MW8 A;  1MBH A;  2CW0 F;  4CYD A;  5ED4 A;  1W5C C;  5H6Q A;  1HW1 A;  3BR2 A;  4IZZ A;  3K2Z A;  5FO5 A;  3I56 I;  3I4M J;  3LAJ A;  2W48 A;  4A2U A;  2K4B A;  4E7I A;  4L9J A;  1LUJ B;  2PMZ N;  1U5T A;  1TT5 B;  2VT2 A;  3CJR B;  2NNY A;  1FNN A;  2AQE A;  1ZG1 A;  4IQ4 A;  3CJN A;  2HKO A;  2NS7 A;  3SYT A;  3TP0 A;  4HZF A;  1SD4 A;  3KP5 A;  4I09 A;  3AKZ A;  4Y4R A;  4B47 A;  3K70 C;  4A0Z A;  1UHS A;  1QPM A;  2ELJ A;  2NAZ A;  1A5J A;  1IRG A;  4HF1 A;  2F5V A;  1KU3 A;  2HQA A;  1GT0 C;  3LA7 A;  3FX3 A;  5M5W J;  2VC0 A;  2M87 A;  2DA7 A;  4XLP F;  2VKH A;  3BPV A;  3DBL B;  4LLG F;  3W2V A;  4LG0 A;  4B3A A;  1XC5 A;  2VBX A;  1MKM A;  3GTM J;  4A12 A;  2QQ9 A;  1PVE A;  1Y56 A;  3OYE A;  4Y13 A;  2HS5 A;  3PNT A;  5J3L A;  2IA0 A;  1Z9C A;  4JX4 A;  1Z77 A;  2MH2 A;  3T0Y A;  2XC7 A;  2IT0 A;  2P7V B;  5CQE A;  2PBI A;  1QPI A;  2LMD A;  1LDD A;  4M9X A;  4AID A;  3IWZ A;  2ZBK A;  2XB0 X;  3L2R A;  3CMA I;  3A01 A;  3KZZ A;  4WX9 A;  2TDX A;  3IUO A;  1QZE A;  1VND A;  1I39 A;  3L1P A;  1U2W A;  3J7Z I;  1MBJ A;  2M2E A;  3GYH X;  2KL4 A;  3KE2 A;  1K4S A;  1DP3 A;  1Z0X A;  2A6T A;  4BEH A;  1R4N B;  1GDT A;  2M30 A;  1LDJ A;  1P7I A;  4BQO A;  2V7F A;  3ULQ B;  2FOW A;  3ABU A;  4MO7 A;  4FE7 A;  4ZDP A;  3TQN A;  4IHS A;  1R1U A;  4L0Z B;  3KPH A;  1IDY A;  2XPW A;  4BH9 A;  4IRH A;  3E5Q A;  3BRO A;  4RGX A;  1ZLK A;  2EB7 A;  3LWF A;  2M4G A;  1V5E A;  3CCM I;  2RDP A;  4B3X A;  4C2T A;  1P4X A;  1PJR A;  2F6C A;  3S14 J;  1D8K A;  4A6D A;  5IY5 H;  2E71 A;  4LIT A;  4ON0 A;  2XF7 A;  4M9Z A;  2L9S A;  4CCO A;  1VZ0 A;  3WU2 C;  3DWL E;  2PEX A;  4UVB A;  3GZN B;  3BWG A;  4RBO A;  2DTR A;  3I64 A;  2JA5 J;  2K3P A;  1LPQ A;  2WAQ A;  2V1U A;  4EJU A;  1J0R A;  5FLM J;  2CUZ A;  2OZ6 A;  5EGO B;  3JRF A;  2VPL A;  2LOO A;  3QPL A;  5J4Y A;  5J47 A;  2JSP A;  4WWC A;  2RV8 A;  2HOE A;  1Y1W J;  1W36 C;  1EF4 A;  3GFM A;  4BQA A;  1POG A;  4A69 C;  2LDU A;  3ZQ7 A;  3CDL A;  1KU2 A;  3K69 A;  4XRM A;  1XX5 A;  1ODD A;  4AC0 A;  2XF5 A;  4YRV A;  3J81 Z;  2IJL A;  1OMI A;  2ELK A;  5L3B A;  4B8X A;  4EJT A;  5LHI A;  4LB5 A;  2MBF A;  3JRH A;  2EV5 A;  3BCA A;  4ZZL A;  4L9N A;  5K7H A;  3I0T A;  5LLQ A;  3G4S I;  2GWR A;  3DPT A;  1G3T A;  4B4C A;  4NC6 A;  1DPR A;  2FBK A;  4BQQ A;  3I5U A;  2WWY A;  2ZJP F;  2L3D A;  4M3B A;  2KDZ A;  1O3Q A;  1TWA J;  4FE4 A;  1SVO A;  4DYR A;  3RKQ A;  2EV0 A;  5TIS C;  5ILV A;  1TLH B;  3PM1 A;  3KFW X;  1T0F A;  5FLV A;  1CF7 A;  3ZMU A;  3H5A A;  2DLL A;  3E5U A;  2BE5 F;  4I6Z A;  1ZLJ A;  1SAN A;  2VQH A;  3BZK A;  3A2K A;  3B73 A;  1E0E A;  2BYV E;  4QWQ A;  5TGT A;  3BPX A;  4BU2 A;  5DCM B;  4TV7 A;  4PSX A;  3H5R A;  4XLC A;  3J80 Z;  1BI0 A;  1WKM A;  3L7W A;  4Y7N J;  3OYB A;  4C9Y A;  3FF5 A;  2DAO A;  3HPH A;  3KEO A;  4F92 B;  1D1A A;  2OF7 A;  2QKL B;  5JR3 A;  4K2E A;  2O61 A;  3OYM A;  4IX7 A;  1Y39 A;  2JVH A;  5J6X A;  1B59 A;  5LGN A;  4DW6 A;  4YFX F;  2W4S A;  4X0G A;  1TWC J;  1P6R A;  1K6O A;  3IL2 A;  2HDW A;  1FOY A;  5D6E A;  4D7M A;  3DKX A;  3CUQ A;  1H88 C;  3HKZ N;  3BR0 A;  4N9H A;  5J8F A;  2Y48 A;  4PJJ A;  5HLI A;  2RKH A;  1MJB A;  1LDK B;  3OYJ A;  3FXU A;  4I0B A;  1IG7 A;  4XLE A;  3PO2 J;  4XOP A;  2EFQ A;  2L9N A;  5E20 A;  2HQR A;  2R7F A;  1IN8 A;  3EUH A;  4KNY A;  3FDY A;  5K5R A;  3VYS B;  4IL6 C;  3S16 J;  3TO7 A;  2EIN H;  2JK3 A;  1EV7 A;  4FT8 A;  3JCU C;  1FT9 A;  1LEB A;  1JJ8 C;  3OIP A;  5F1R A;  4MEY F;  3VSK A;  2VC1 A;  4GGG A;  4PGH A;  2ETH A;  3K2A A;  4KIS A;  1DP7 P;  4UXN A;  3CCE I;  2IAI A;  2I8D A;  3SQN A;  4XK4 A;  2IGM A;  4GXO A;  3P7N A;  2QBY B;  3IRQ A;  1JUM A;  5KNL A;  3N05 A;  4XQF A;  5EEA A;  3KZI C;  2DFI A;  3R6S A;  3H9J A;  3GFJ A;  3OR2 C;  3VEP A;  4XLN F;  1H9T A;  1NG7 A;  1FP2 A;  2P81 A;  4BKX A;  2F48 A;  3QQA A;  2M8E A;  2CV2 A;  5HVQ C;  2WB1 N;  1MSE C;  4UUS B;  3OIQ A;  3Q9S A;  2DFH A;  4KIT B;  1W4M A;  2Z1D A;  3QRF F;  3O8G A;  3HOX J;  1UJ8 A;  1W5S A;  3M4O J;  5EDN A;  3G71 I;  5CLS A;  5LHH A;  2VPR A;  3BG3 A;  1O3R A;  3W3C A;  2R4G A;  1MDM B;  2HDC A;  3MWM A;  3F8F A;  1YQA A;  2MAB A;  3V8L A;  2CQ7 A;  5J1R A;  2ESH A;  3JR9 A;  1Z3Y A;  4GYI A;  2L5Q A;  2H94 A;  2Q8K A;  1UCR A;  3FXJ A;  1TZL A;  2ME0 A;  3E6M A;  2CFO A;  1LEA A;  3H3Z A;  2LYC A;  2UV1 A;  3QP5 A;  2VBY A;  3HHG A;  1HKQ A;  2CYY A;  3KEQ A;  2JA8 J;  2JJ7 A;  1AKH A;  1YJ9 I;  2ESN A;  3EQL F;  5LGU A;  2HVR A;  3COA C;  4KMU X;  4LG3 A;  1BI3 A;  2O7O A;  1G8X A;  4XSZ F;  1I1S A;  1AA7 A;  5IOZ A;  2COB A;  1YLF A;  5E79 C;  2DW4 A;  3HUG A;  3ABK H;  2BBY A;  3VSL A;  3GTK J;  1OR7 A;  1FP1 D;  3HRU A;  1JE8 A;  3L09 A;  4AUX A;  3DP7 A;  3F8N A;  5F6F A;  1B1B A;  3A0H C;  5GTI C;  4XSX F;  2BY0 A;  2IPQ X;  2H09 A;  4XR6 A;  2O0Y A;  2WTE A;  2BW3 B;  2LRD A;  4L5I A;  1U5T B;  1E3O C;  4A0Y A;  4DNC A;  1MZB A;  4KIC A;  3NQO A;  3PFY A;  1AKH B;  2IEK A;  2K9N A;  3T5X A;  5F0F A;  2PMZ A;  3VB2 A;  2Z3Y A;  4QLC U;  4L9T A;  2EWN A;  2X51 A;  5LFA A;  3O8H A;  3MQ0 A;  3WTX C;  2GZW A;  2L7M P;  2QQB A;  4M74 A;  2L54 A;  1YW9 A;  3V7S A;  4CGZ A;  2IGN A;  1IJW C;  2VQG A;  4ZH4 F;  1XMX A;  2VB6 A;  2HYG D;  3JRD A;  1R1T A;  4WXC A;  4WXH A;  2P5V A;  4I02 A;  2FEZ A;  4UUT A;  3DCF A;  3DBR B;  4FET A;  4BDY A;  3I55 I;  5LHG A;  4XL9 A;  2XRO A;  1XMA A;  3R0A A;  4I99 C;  5B66 C;  2LNB A;  2IGK A;  4M71 A;  3M7G A;  3OOP A;  3IH2 A;  2F2E A;  3IAS 2;  3TBI A;  1UG0 A;  3B02 A;  4LGW A;  1H0M A;  4E6K G;  1A31 A;  1AU7 A;  2GXA A;  4AM3 A;  4HNU A;  3KX2 A;  3R61 A;  3G1M A;  2AS5 F;  3AG2 H;  2BGC A;  3HHH A;  2M7A A;  2L7K A;  3GO5 A;  1X1P A;  4R79 A;  3QU3 A;  2KIU A;  5E8I A;  3HTS B;  1FIA A;  5FLX K;  2KRC A;  4CCK A;  3PSF A;  3ML6 A;  2GBY A;  1YRN A;  4OMY A;  4KIG A;  5CYV A;  1IRZ A;  2K02 A;  3OS2 A;  3MKL A;  1EH6 A;  2KKO A;  2CUF A;  3WHC A;  5LRR A;  2L7F P;  2F5F A;  1T39 A;  4MLO A;  3RPQ A;  1I6H J;  2ZSH B;  1D5V A;  1R7J A;  1V3F A;  2E7W A;  1G3S A;  2FOK A;  3LSG A;  2XAF A;  3I53 A;  1K4T A;  4QIW N;  3LNQ A;  3D1N I;  4BAC A;  1CF7 B;  3QPH A;  2WV0 A;  3UR3 C;  3L00 A;  3QYB A;  2IW5 A;  2L02 A;  2KLO A;  3LSI A;  4RA2 A;  5D5U B;  1Y1V J;  4A3C J;  1H89 C;  3L2C A;  3BR6 A;  4S0H B;  4L0Y B;  4C3I J;  3GX4 X;  1R49 A;  4ENK A;  2BY3 A;  4HPQ A;  1I3A A;  3J7A O;  2KRF A;  3BT9 A;  3LST A;  3M8F A;  5M5Y J;  4XBF A;  2OBP A;  3OOU A;  4XIC A;  5BMZ A;  2P5K A;  1FOW A;  3ZQG A;  3DKY A;  3W6V A;  2EIK H;  1R5G A;  1Z05 A;  4KT6 A;  4V2G A;  1B9M A;  2YSR A;  1GUU A;  2DOF A;  1A04 A;  1JGG A;  2E7X A;  2KP6 A;  2VBW A;  2DMT A;  1SMT A;  1QZY A;  2GLO A;  4HBL A;  4HNT A;  2FUG 2;  3WU0 A;  1Y8R B;  2A07 F;  3EYY A;  4XKW A;  2MC3 A;  4I2O A;  1JUP A;  1ZAO A;  5IP9 J;  4XRS G;  4MQ9 F;  3OYN A;  1IW7 F;  1NK2 P;  2E34 A;  3G1L A;  3NRV A;  4Q4Z F;  2IS2 A;  1HW5 A;  1ETQ A;  5F1J A;  2KQR A;  2A3S A;  2YUS A;  4N4O B;  1VQL I;  5C4J J;  2MC4 A;  3GTQ J;  2IBD A;  3CLO A;  5DD8 A;  2RGV A;  3IV5 A;  3QP6 A;  2VOD A;  1IUF A;  2VL8 A;  5BQT A;  2Y30 A;  4GDF A;  4ZYG A;  5CVJ A;  3Q5F A;  1FYK A;  3IHU A;  3EDP A;  4GRI A;  1JTX A;  2PMH A;  4CSW A;  3CJQ B;  3BG7 A;  3ZMZ A;  2Y2Z A;  2ZNY A;  5KK1 A;  2HOA A;  1T6S A;  2L4A A;  4JX6 A;  1OKR A;  3KP2 A;  3DXJ F;  1EKE A;  3SZG A;  4NHJ A;  4AVP A;  1WI3 A;  1IRF A;  2A61 A;  3KEY A;  2CQN A;  1QRY A;  3ABT A;  3L2Q A;  5GTH C;  2L2O A;  1TWH J;  1ERD A;  4E4H A;  2MH9 A;  3CCV I;  2OUM A;  5HNF A;  2VKV A;  3CC7 I;  4A3M J;  2R7Z J;  1BW5 A;  1T33 A;  4P5O A;  3Q0W A;  4EMS A;  1Z1D A;  2AXT C;  1O57 A;  4NNJ A;  1VQ8 I;  2NVX J;  3JRG A;  1BJZ A;  3ROU A;  3ZN1 A;  4OU0 A;  3GZ5 A;  2BZT A;  2M1B A;  3FWE A;  3CCS I;  4P9F A;  3J80 K;  1ON1 A;  1XS9 A;  3E6B A;  1OYY A;  4IJA A;  1FSE A;  1BM9 A;  2JN6 A;  4RMN A;  2LSO A;  1BW6 A;  5F0H A;  3OYD A;  2ZO4 A;  4EQQ A;  3OYK A;  2LTP A;  2OQG A;  3FMR A;  5J1Y A;  3ISP A;  5HLG A;  3FXO A;  2JT1 A;  4BS9 A;  3GTJ J;  5HS7 A;  2M3A A;  3I9V 2;  3WGI A;  3DEW A;  5ICE A;  3OR1 C;  5FB2 A;  1REP C;  1UZC A;  3FKI J;  2LKS A;  4G94 A;  1FBQ A;  3CP2 A;  3SHF A;  2DCE A;  1VQ5 I;  2BW3 A;  1E2X A;  4OIR F;  5DUI A;  3OMY A;  3K1P A;  5M3F J;  3F8M A;  4NC8 A;  4DOZ A;  4H4K C;  3FMQ A;  2QBY A;  2A05 A;  1BN5 A;  2XKO A;  4Y15 A;  4Y52 J;  3F72 A;  2W85 A;  4C3H J;  2GA2 A;  3BLY A;  1Y0N A;  3VYT B;  3QOE A;  2KJC A;  2HPI A;  4FTH A;  2VI6 A;  3OYI A;  2DA6 A;  1N78 A;  1JKR C;  1P4W A;  1UHW A;  1U9N A;  2BHY A;  3ERE D;  4BE0 A;  2HWV A;  3CF2 A;  4II2 A;  2V1X A;  5L3E A;  1ZQ3 P;  2OV7 A;  3G3Z A;  1A6Q A;  2KJB A;  1U9O A;  2VOP A;  3HBL A;  3H35 A;  1MNM C;  3DPL C;  5FKN A;  2K3F A;  1X4O A;  4HX7 A;  4U0W A;  4BXX J;  2EK5 A;  3MZH A;  5F0C A;  1MW7 A;  1MBG A;  2NOG A;  5ILU A;  2TRT A;  2ZXI A;  1IO2 A;  4XLH A;  3OSG A;  4L18 B;  4LMY A;  1XB4 A;  3LFK A;  2LY2 A;  4HLY A;  5ILS A;  2XIG A;  1KU9 A;  3B6A A;  4RM3 A;  2LF8 A;  4RLF A;  1OQY A;  2AO9 A;  2RQQ A;  5JLX A;  2WY8 Q;  2GAU A;  5M3M J;  2E2H J;  1YX3 A;  3S3M A;  3QOP A;  3M9A A;  4EGY A;  4GCV A;  5D5W B;  2R3S A;  5FRM A;  3K4M A;  3ZGK A;  3TO6 A;  1RR7 A;  3G73 A;  1P9Q C;  3CF5 F;  2NNN A;  5F27 A;  2K27 A;  3R0J A;  2FQ3 A;  3LA3 A;  2UXX A;  3GWZ A;  4ZYA A;  1OCP A;  2XV4 S;  1WFX A;  3A01 B;  2DT6 A;  4XID A;  2Z33 A;  1P4A A;  3RZO J;  1BJA A;  3FM3 A;  3U9G A;  1MJA A;  3JSP A;  1YOV B;  3RYR A;  3JTG A;  1S6L A;  1SC7 A;  4G7O F;  3DF8 A;  1KYZ A;  2XAQ A;  4MQV A;  3BZC A;  3OYL A;  1X2M A;  2PX9 A;  4OAY A;  4UUV A;  1MH3 A;  4XOT A;  3T8T A;  5HLH A;  1R4M B;  2XVC A;  3J7Y J;  2IGO A;  1HKT A;  1D5Y A;  3PUB A;  1PDN C;  2FD5 A;  4BJT A;  4ZYH A;  5GAE J;  2HZT A;  2RN7 A;  5EG0 A;  1B72 B;  1VQ4 I;  5GAD J;  3P9I A;  2XPV A;  4FQG A;  2OA4 A;  1RC9 A;  2XAH A;  2QSF X;  4UV8 A;  3F0C A;  2CV1 A;  2IS6 A;  1BBY A;  3ECO A;  1D0Z A;  2OZU A;  1SVL A;  1DGW Y;  3G2B A;  5CVI A;  1HF0 A;  4JK1 X;  3H5N A;  2YR2 A;  1Z7U A;  2DYR H;  3DLL F;  3BZ6 A;  2JTV A;  2CUJ A;  4RLQ A;  3J7A Y;  1RRJ A;  3BR3 A;  3HJE A;  2X4H A;  4F52 A;  1K79 A;  3IP4 B;  1T08 B;  1XGM A;  2KT0 A;  1LKX A;  3C3W A;  2FE3 A;  3BJ6 A;  4ZTF A;  3OY9 A;  3F8B A;  2LLK A;  2XGE A;  4DYC A;  5D4R A;  1YTY A;  3SEZ A;  2KPM A;  1JHF A;  2KMU A;  5EEG A;  3NAR A;  4KN4 X;  4XN0 A;  2DPU A;  5E3M A;  5K7Z A;  4PFP A;  5BNG A;  1R6R A;  3C18 A;  2E1M C;  2KFD A;  3PNY A;  2NS0 A;  3FK7 A;  2L01 A;  3S1Q J;  4Y17 A;  1X1B A;  5L3C A;  2CV0 A;  4E7S A;  4H0E A;  1RKW A;  2M9H A;  4CO8 A;  2Z9O A;  1YIJ I;  3S2H J;  2XUB A;  4L5E A;  2K5C A;  4A5M A;  1EJ9 A;  4IRI A;  4CZZ A;  2LY1 A;  1MMS A;  1IUY A;  3RKX A;  3I3L A;  1IN7 A;  3F3X A;  1S3J A;  3FHN A;  1B9N A;  5LRS A;  4DQ2 A;  1IXC A;  1FBU A;  1JT0 A;  3K1M A;  3MKZ A;  2VKD A;  1WJB A;  3W2A A;  3VOD A;  3F23 A;  1Q1H A;  3BJO A;  5F64 A;  1YE9 A;  3IAM 2;  2EPF A;  1LE8 B;  1Y6I A;  3AAF A;  4IHT A;  3S1N J;  2NOJ B;  3OS0 A;  1MMN A;  2LBF B;  1OCO H;  1XG1 A;  3LQQ A;  2HPM A;  1R71 A;  4B43 A;  5F08 A;  1BL0 A;  5EF6 A;  2JUG A;  1FC3 A;  3AL0 C;  4HF2 A;  2Q2E B;  4NDL A;  4DBQ A;  2HXI A;  4YFN F;  3MFK A;  4ENM A;  3QPT A;  4MGR A;  4A3D J;  1NHA A;  1QHH D;  4U7B A;  3JTH A;  3DU6 A;  2D1V A;  2W57 A;  2Q1Z B;  1B8I B;  2GIV A;  3E97 A;  3TW7 A;  2CUE A;  4ASN A;  4PK4 A;  2P4W A;  3C2G A;  1BR4 A;  4HLX A;  2M7B A;  3FM5 A;  4BYY A;  4HRI A;  1V5G A;  2R0Q C;  3IRR A;  2Y31 A;  4LB6 B;  3D5R C;  5DM7 F;  2DT7 B;  2M8G X;  4DZP A;  3BTC A;  2P6S A;  2YX4 A;  2KIF A;  4AVZ A;  4EM0 B;  2EZK A;  3TKY A;  2ZXH A;  4MHG A;  4HQE A;  3EUH C;  4RB2 C;  1ETK A;  2DA3 A;  2V1D A;  3FBI B;  3DTI A;  2DYS H;  3U2R A;  3ZOB A;  3RCO A;  2WA0 A;  2WB1 A;  2FQ4 A;  1XN7 A;  3ABM H;  3P5J A;  1U8B A;  3FXL A;  1MSF C;  3HG9 A;  1K6Y A;  1FJL A;  2R7V A;  2BHZ A;  1XDU A;  5E1W A;  3CP8 A;  3K4L A;  4NC7 A;  1ORK A;  2V1N A;  3A1Y A;  1ZTR A;  1ON2 A;  4PCQ A;  5L3F A;  1K61 A;  4B09 A;  2R5Z B;  2TCT A;  4N0B A;  5DTD A;  1QGP A;  1S29 A;  3KYC B;  3M1C A;  1Z21 A;  2WY7 Q;  3VOE A;  1PUE E;  1P2F A;  1SFK A;  4A3F J;  5FJ8 J;  4D0P A;  2FNP A;  3E1S A;  5B1A H;  1QZZ A;  2W00 A;  2OD5 A;  1F9N A;  3Q0V A;  2IA1 A;  1K7A A;  4EM1 A;  3L9F A;  5IYC J;  1YJN I;  3F9K A;  1T0F C;  2HU9 A;  1VTN C;  2EIL H;  2LKP A;  1R5I D;  1IN6 A;  1X3U A;  1UST A;  3IKV A;  2RVC A;  4KMF A;  3RTR A;  3H3V K;  1Z6T A;  2PI0 A;  2DK8 A;  1TQI A;  2R7T A;  1U78 A;  4A3B J;  5FFX A;  4U0Y A;  2Z5U A;  4Y3O A;  4QSH A;  1TW2 A;  2K85 A;  2BXY A;  2DMQ A;  3MZY A;  1ZG3 A;  2H1L A;  3BCB A;  4RS8 A;  1QU3 A;  2E5N A;  3KET A;  1IV6 A;  2GIZ A;  2EA2 A;  1U5T C;  5K5O A;  3RKW A;  1F1Z A;  1K78 A;  4YII A;  1FOX A;  2GXG A;  4C2U A;  3RKY A;  1JUS A;  2MLK A;  2DA2 A;  1DPU A;  4XNF A;  3H0D A;  3QPS A;  2V4J C;  3CCJ I;  3I54 A;  2O8X A;  1K83 J;  4XKV A;  1OCC H;  1KZH A;  3G6E I;  2M0C A;  4RM2 A;  3WHB A;  1IXS B;  2LBF A;  4YG2 F;  4P96 A;  3B6C A;  4Z6Y A;  2ECC A;  3MKY B;  1LE8 A;  3PQK A;  2ECB A;  3TL4 X;  1KON A;  2A5W A;  2CW7 A;  2R7Q A;  3CC4 I;  3RJP A;  4KA4 A;  3DLA A;  4BXU A;  5JFR A;  5LGT A;  2QVO A;  3VWB A;  3CUQ C;  2DT5 A;  4C2M J;  4HV5 A;  2I10 A;  3WTU C;  4AIK A;  2B63 J;  1LFB A;  4FCY A;  4P55 A;  5IPA A;  4BXF A;  2YU3 A;  3EYI A;  2L7Z A;  3NEU A;  4KUM A;  2X1C A;  2CS3 A;  1T2K A;  1EA3 A;  3HEF A;  4NUB A;  3WE3 A;  4BHB A;  4LK0 F;  4BUP A;  3ZQH A;  3BQZ A;  4ZC3 A;  1ZK8 A;  2FF4 A;  3TGN A;  3V8J A;  1HST A;  2BY2 A;  1T8I A;  2PJR B;  1KYW A;  5FD6 A;  2Z2S B;  4MTD A;  2X6O A;  5D5V B;  2X1E A;  4OIO F;  1RET A;  5JVG F;  2STT A;  1YO5 C;  3ZQQ A;  4BHP A;  1DUX C;  1ZH5 A;  4XRS A;  3HB9 A;  2DPD A;  1PP8 F;  3CDH A;  1PP7 U;  2KDO A;  3ABL H;  3E6C C;  3OL4 A;  2BVM A;  1HW2 A;  5KHD A;  3CCQ I;  1BC8 C;  2JZY A;  1RKT A;  4X1E A;  4II3 A;  1F5T A;  3SFZ A;  2AHQ A;  2V9V A;  4JOM A;  1IZ1 A;  3JAM Z;  1IC8 A;  3LSK A;  3M8E A;  1MNE A;  1YHQ I;  2QGU A;  2OU2 A;  4CDG A;  4AU7 A;  1IN5 A;  4UY8 I;  3FIS A;  2VIX A;  4HST A;  5C44 J;  2QSG X;  1D3Y A;  4CA0 A;  2RRE A;  2R93 J;  4KIB A;  3UNG C;  2FXA A;  1MGT A;  1R5H A;  4XRF A;  2Y0S A;  1IRX A;  3Q9V A;  1WVR A;  2QLZ A;  2LP0 A;  1TQP A;  1SVM A;  2XAJ A;  5J1U A;  2FBH A;  1J9I A;  2MA3 A;  2OJE D;  2H8R A;  3IKT A;  2IP2 A;  4IQJ A;  2BXZ A;  1ZRD A;  4LK1 F;  4IO9 F;  1VQO I;  2M4K A;  3LA2 A;  1MMA A;  3SEQ A;  4M73 A;  1MBK A;  3AG4 H;  1ZEL A;  2KHM A;  4WK8 F;  4XM3 A;  2QEX I;  4IXA A;  2X6W A;  1JI8 A;  3EUK L;  2LRE A;  1LVA A;  2F4M B;  2CG4 A;  2GOX B;  4DJA A;  1RZ4 A;  2UZK A;  1HDP A;  1FTZ A;  2HFH A;  4J00 A;  3TO9 A;  5JLW A;  2EFW A;  2DJI A;  3LSJ A;  4BNC A;  4RAF A;  5JHF A;  3KLO A;  4M3E A;  1ULY A;  3J81 K;  1OCT C;  1YIT I;  1T56 A;  2X0L A;  1TWF J;  4EJV A;  3JRC A;  2BY1 A;  4G7H F;  1J5Y A;  2HDD A;  2DQL A;  1GV2 A;  3WE2 A;  5FD5 A;  1QA6 A;  4IRG A;  4EGZ A;  2JA2 A;  3HPG A;  9ANT A;  3K4N A;  3F6V A;  2X6Y A;  3S8P A;  1IF1 A;  3OIO A;  1TNT A;  1J2X A;  2XF6 A;  5K5Q A;  1BA5 A;  3CMY A;  4IHV A;  3PL8 A;  3I71 A;  1W36 D;  3BTL A;  3RDI A;  3HL2 A;  1JKO C;  1WZ2 A;  5D6F A;  1UHM A;  4IOA F;  2H8W A;  3JRB A;  2JRT A;  3HYI A;  5DCM A;  1X1A A;  3BR5 A;  5IYB J;  3HGY A;  1XSV A;  2HOT A;  2HGC A;  2ZKZ A;  3WU1 B;  4E7J A;  2HYF A;  1A36 A;  5GAH J;  1LQ1 A;  3H1C A;  2WBM A;  1BI2 A;  3OYH A;  1IV8 A;  3V8K A;  4HA8 A;  2R5Y A;  3RIR A;  1A6I A;  3C1D A;  3ASO H;  3ZN0 A;  4ESF A;  5EG0 B;  1X3Z B;  2P0W A;  1VFC A;  2MFZ A;  1RES A;  2ZFW A;  4HX4 A;  5DV5 A;  3MKW B;  3DQV C;  3CO7 C;  3LQR A;  1BOA A;  3W6K B;  2OQR A;  3WTZ A;  3DEU A;  2G9W A;  4Q48 A;  3ASN H;  2DO7 A;  3S2D J;  4GO1 A;  5HS9 A;  4O6J A;  2QUF A;  3ZMT A;  2IRF G;  4PJL A;  1YYV A;  2MD0 A;  4PUS A;  5EYR A;  3OYG A;  3ZQC A;  1G4D A;  3K7A J;  3K1N A;  3KP6 A;  1J75 A;  3A4C A;  2FML A;  4HSR A;  4ZYD A;  2BOL A;  1SFO J;  1G2H A;  2K9S A;  1OYW A;  5ERI A;  5IYD J;  2O6G E;  3WG7 H;  1FSH A;  4IVN A;  1AHD P;  5EZG A;  4EJW A;  1ZRC A;  4YEJ A;  3TP3 A;  1A35 A;  1NK3 P;  1ZYR F;  2ADU A;  2ZJR F;  2VOO A;  2ID6 A;  5E17 F;  3O3K A;  3GFI A;  2Z99 A;  5IP6 A;  1FLI A;  1FMW A;  1OCZ H;  3GEZ A;  3BP8 A;  2X9D A;  4HF0 A;  1WJE A;  1D0Y A;  3TDZ C;  2B9S A;  1SFU A;  1KGS A;  3BQY A;  2O8K A;  4C3J J;  2O9L A;  2ELH A;  2GOM A;  4MTE A;  1V54 H;  2XPU A;  5DS9 A;  5A2Q K;  1I27 A;  2ME6 A;  2V6E A;  1LFP A;  3H3U A;  1JKQ C;  2FRH A;  4LLN A;  5L3D A;  3A0B C;  5E1Z B;  2EFN A;  5H2F C;  2VN2 A;  1XGS A;  2CSO A;  2EV6 A;  1UAA A;  3HXL A;  4OAZ A;  2ZFU A;  1XCV A;  1VI0 A;  3CES A;  1U8R A;  4YIR X;  3H36 A;  2GXB A;  4P1W A;  2F5E A;  1YJW I;  2YPR A;  5CVV A;  1QO0 D;  1KQ0 A;  2DI3 A;  4G8X A;  2J5O A;  3DV8 A;  5CJ9 A;  2W82 A;  3HGG A;  2P5L C;  4EEF G;  4PSW A;  4YIF A;  2MSY A;  3M3Y J;  1YW7 A;  1T38 A;  4HDU A;  2DA5 A;  4HYE A;  2ZNZ A;  5KAF C;  4HDV A;  2ZXJ A;  1Z7L A;  3FKJ A;  4ZDL A;  5M5X J;  4OMZ A;  3S3N A;  3GTG J;  1XDS A;  4QTR A;  2G0E A;  1ENH A;  3KP3 A;  3CCR I;  3ZQL A;  1XSX A;  4RB1 A;  1YIO A;  2VKE A;  3DTK A;  5CVU A;  2QZ8 A;  2O03 A;  1LB2 A;  1HKS A;  1XPX A;  2UWM A;  2O5R A;  3JAM K;  3EUA A;  2D1H A;  4PJM A;  1SFX A;  3ZR8 X;  4I76 A;  1VQ7 I;  3KCC A;  4CCM A;  4S05 A;  2ICW G;  4I7H A;  4IHW A;  1T98 A;  4BE1 A;  1OYI A;  3QWL A;  4G6D A;  3KYL A;  4DYQ A;  1STZ A;  3IH3 A;  3ZPL A;  2LR8 A;  2P7C B;  3HC7 A;  4XKC A;  4HNV A;  3HOT A;  1F4K A;  3KLN A;  2CFX A;  5GP9 A;  2KIQ A;  3HOS A;  1SMY F;  5FFZ A;  4M3G A;  3GBG A;  1IXR C;  1ITY A;  4AIH A;  5LEJ A;  3ZQI A;  4XN3 A;  3PO3 J;  1WI9 A;  2LVS A;  4GFB A;  1USS A;  1VQP I;  3D5S C;  4ETS A;  3F8C A;  2JPC A;  4LOC A;  3SFI A;  1R1V A;  2OCE A;  2WAF A;  1U3E M;  4BE2 A;  3VPR A;  3U1D A;  2CJJ A;  5EZH A;  3PIP F;  3V42 A;  2LH9 A;  2X6X A;  2RAE A;  5FRO A;  3RSN A;  1BIB A;  3SDG A;  3ZQF A;  1FY7 A;  1TW3 A;  2RQP A;  2DFE A;  1FYM A;  4HV6 A;  1L0O C;  3SJM A;  4HOB A;  2JSC A;  4CZC A;  2EFO A;  5LEK A;  1TNS A;  4MEX F;  1AWC A;  1ZGA A;  3WOD F;  3ESW B;  3BTJ A;  1H8A C;  1E3H A;  2CO5 A;  3E7L A;  4XMY A;  5FKL A;  2E60 A;  1K78 B;  3HOY J;  2NVT J;  2PLY A;  2QYO A;  1S72 I;  4Y33 A;  4WXD A;  2EZL A;  2K86 A;  3V7C A;  1FEX A;  1FYL A;  2HVS A;  3I59 A;  1JT6 A;  4GYG A;  1ETX A;  3GFL A;  2JPB A;  4IEJ A;  5IT9 K;  2ZJ2 A;  3NWT A;  2ISY A;  1G59 A;  1QVU A;  2CW8 A;  1GV5 A;  4E7Z A;  1J09 A;  3D0S A;  2DOA A;  2DA4 A;  4FX4 A;  3GVA A;  1OPC A;  2W84 A;  4I0A A;  4CUG A;  1SD7 A;  4RB3 C;  2VUM J;  3G1O A;  1W5T A;  3OYA A;  1MBE A;  2GM4 A;  4HQM A;  3GLL A;  2DA1 A;  2ZSI B;  2E1M B;  2E5Z A;  3HKZ A;  2K9M A;  1GVD A;  2VXZ A;  1Z6R A;  1HCR A;  1HLV A;  4A3I J;  3S1R J;  1TP4 A;  1FIP A;  1IGN A;  2PJR A;  1B4A A;  5HDK A;  3W2W A;  5HNH A;  1FZP B;  2PFB A;  3TOA A;  2DOD A;  5JVT A;  3PUF A;  3DBH B;  5JHU A;  1GXQ A;  5J4V A;  1ZHF A;  4IF4 A;  2PJP A;  2JUC A;  3ZMD A;  2LFB A;  2CWE A;  1CQT A;  1QQI A;  1DU6 A;  2A5Y B;  4U0V A;  1RI7 A;  4RGU A;  4IKF A;  1V5F A;  1X19 A;  1N25 A;  3CUQ B;  1O3T A;  2YS9 A;  5C4X J;  5J40 A;  3FZV A;  1LFU P;  2XKP A;  4M3F A;  3KYD B;  2JA7 J;  3GTP J;  1BOB A;  2XHK A;  2HR3 A;  3TW6 A;  4ENJ A;  3PIO F;  3CCL I;  3BC8 A;  5D8L B;  2X1D A;  3RI4 A;  1UB9 A;  3NAU A;  3LFU A;  1AOY A;  1YS7 A;  1X1D A;  4A3K J;  1XCB A;  2Q2E A;  3Q0U A;  2EIJ H;  1EH8 A;  3GTO J;  1ZN2 A;  4BJ5 C;  3PFI A;  2XGC A;  4DIQ A;  3OSF A;  2XAS A;  1HDD C;  4XKB A;  4BHC A;  4ZZD A;  4IOC F;  3QAH A;  1QNT A;  5TRD A;  3H9G A;  2VJJ A;  1ETO A;  4ITV A;  1D8J A;  3WG9 A;  2Q0O A;  3P9C A;  1I6X A;  5DDG A;  4CXF A;  2EFP A;  3E6D A;  5HOD A;  1O7L A;  4RGS A;  5FKK A;  4QPQ A;  4FIS A;  2FMY A;  2A6H F;  3FBN B;  1FOK A;  3HRT A;  1GXP A;  2NVY J;  2E1C A;  2QWW A;  1WCM J;  2HNH A;  2K9Q A;  2LKX A;  3GW2 A;  1R23 A;  2KRH A;  1TT0 A;  5DCF A;  4CYC B;  4LFU A;  3S93 A;  1ACI A;  4G6Q A;  4BBS J;  4N9I A;  3C2B A;  3RQI A;  4S04 A;  1SEU A;  2LY9 A;  1U6G A;  3HSR A;  4KJZ A;  3HIF A;  1KQ9 A;  4KIF A;  1X3W B;  1V4R A;  4MNU A;  5AON A;  5D5X B;  2A69 F;  2V26 A;  1APL C;  2HOS A;  3GUD A;  1IAW A;  2VXD A;  5IOY A;  1J7K A;  1D1C A;  4EJO A;  4P9U A;  3BG5 A;  3LMM A;  5FKM A;  5BOX A;  4O5V A;  3HTU A;  2P8T A;  2LD5 A;  3C7J A;  1I50 J;  1E3P A;  3F6O A;  5DYM A;  3MAJ A;  4R1H A;  4WCG A;  2EH3 A;  2HYJ A;  3PSI A;  2NVQ J;  2ZME C;  4B1R A;  2DDA A;  2B0L A;  5ICC A;  1YFH A;  2E2I J;  3FMS A;  5H20 A;  3GLX A;  3ZCO A;  5HDG A;  2LF7 A;  1XGO A;  3CTA A;  3V7R A;  3VYR B;  1JJ6 C;  1MIJ A;  1WJ5 A;  4F55 A;  5E3N A;  3MMY B;  1DGR M;  3BY6 A;  1WJF A;  5IP7 J;  3ONQ A;  1NH3 A;  1Y0U A;  2QM3 A;  2BEO A;  3U1K A;  3TMO A;  2A68 F;  1PYV A;  4J01 A;  1HQC A;  4Z2Y A;  2KIS A;  2DMN A;  1O7F A;  4HW0 A;  5KAI C;  1GVJ A;  4J19 A;  2M5W A;  2ZXW H;  3UKG A;  2MGQ A;  3OWT A;  2STW A;  2K7L A;  2FSW A;  2K40 A;  2DMU A;  1TC3 C;  4M6Y A;  5BPI A;  5L3G A;  1KU7 A;  2QQA A;  3DTE A;  2D45 A;  5HOO A;  5H6R A;  2VJI A;  1JTY A;  2BV6 A;  3L2V A;  3FXQ A;  1VQN I;  1ONV A;  4E7K A;  2WAD A;  4CCL A;  2VJ4 A;  2P6T A;  1W0T A;  4EVI A;  3S17 J;  1OCR H;  2V79 A;  4JQF A;  4CCJ A;  4UB8 C;  1WPK A;  3PJR A;  4AYB A;  2DN0 A;  2GQQ A;  2W25 A;  3PNV A;  3E5X A;  1UMQ A;  4XOR A;  1OIS A;  5KVR A;  4W1U A;  2VQL A;  3EET A;  3DFG A;  3CO6 C;  2JRM A;  4NQW A;  2LK2 A;  1W0U A;  3HOZ J;  3CUO A;  1QVT A;  2Y69 H;  4ZDO A;  2I5U A;  4MIM A;  3SDB A;  1HA8 A;  3QYF A;  4ENN A;  4IPA A;  1IDZ A;  1MD0 A;  3V4G A;  1W1W E;  4G7Z F;  1N75 A;  3MD2 A;  1V55 H;  4FAS D;  3WTW C;  1HBX G;  4U7D A;  1W7P A;  2L9R A;  5C3E J;  3K0L A;  4LIV A;  5B5E C;  1D0X A;  3VYU B;  4PGG A;  4LD5 A;  1QBJ A;  3CJT B;  1GHC A;  1FMV A;  3A03 A;  4D5C A;  3M1E A;  2XRN A;  1N77 A;  5KCM A;  1JKP C;  2VT3 A;  2CMP A;  4BJ6 C;  3OYC A;  4NQW B;  3IH4 A;  3DPU A;  1YRN B;  1OR7 C;  2L9V A;  2DK5 A;  2FX0 A;  2W24 A;  1R22 A;  3PQJ A;  3ZMS A;  1XTA A;  4JBA A;  2AXL A;  3LSM A;  3AFH A;  2EIM H;  1TWG J;  2M45 A;  4YFK F;  2XAU A;  4NB5 A;  4IHY A;  3CCU I;  1ZRF A;  2VON A;  4AD9 A;  1S9H A;  1Z67 A;  2VQC A;  1RUN A;  1B8I A;  4UHT A;  3MVP A;  4DBR A;  2Y75 A;  4OIP F;  2V6C A;  4XLF A;  1NG6 A;  3ZRG A;  4PZJ A;  3H92 A;  2QCO A;  3T1B A;  4E7L A;  3WTY C;  2M34 A;  4BY7 J;  3RZD J;  2PG4 A;  3K4K A;  3O6B B;  3FHZ A;  1X1C A;  4M6V A;  1I3Q J;  1ZRE A;  3I4P A;  1MH4 A;  4KDP A;  2D2W A;  4JX5 A;  4MFE A;  1QHG A;  3ZP5 A;  4WF2 A;  2DXI A;  1R00 A;  4D1Q A;  2GA1 A;  2OPT A;  3GXO A;  5BPD A;  2EQR A;  1HXD A;  2FU4 A;  4ZYE A;  4LLL A;  1WJC A;  2XRL A;  3HM5 A;  1RNL A;  2VE8 A;  2ISZ A;  3GF2 A;  2MLG A;  3KZY A;  3ELK A;  1XSD A;  4BGD A;  5HS8 A;  2R7R A;  4Q5S F;  4L9V A;  2MG4 A;  1LJ9 A;  3O2P E;  4RDU A;  2JVG A;  1ZGJ A;  4YEL A;  1SAU A;  2E19 A;  4X6A J;  1JXS A;  3BR1 A;  1X58 A;  1RIO H;  2JWT A;  2KZV A;  3F22 A;  2Z16 A;  1VQM I;  1SD5 A;  2YU9 J;  3R60 A;  3HUG B;  2JQ7 A;  3HDD A;  4LJZ F;  1NTC A;  1KQ8 A;  6PAX A;  4KT5 C;  1WSU A;  3C2H A;  1S5L C;  3K70 D;  4ZTJ A;  2R7W A;  2WV1 A;  2Y0S N;  4I01 A;  3VDX A;  4D7N A;  2L4M A;  4V19 K;  1YI2 I;  4F3Q A;  3E3V A;  2R92 J;  2DOE A;  5AIP A;  2W1O A;  2WAQ N;  1FBS A;  1FPQ A;  4OWR B;  1MBF A;  3N4M A;  1JGS A;  2QEN A;  2NVU B;  1ZAR A;  2DBB A;  1WJD A;  2YX7 A;  3K4B A;  4A3G J;  3HSE A;  1ZKG A;  1S8N A;  2HI3 A;  2NYX A;  1HC8 A;  3H0G J;  4PFO A;  2OTJ I;  1BIA A;  3F21 A;  1JHH A;  3MEX A;  4D9J A;  2JMW A;  5ICG A;  1M1E B;  3E0J B;  4PJ0 C;  2FBI A;  1DQU A;  1X4P A;  2F5D A;  3OS1 A;  1ZGW A;  2Y9Z A;  1YW8 A;  2PN6 A;  3BG6 A;  5E3L A;  4CIC A;  4A5N A;  3WGG A;  3ZMV A;  1UFM A;  3RPU A;  3JSO A;  1DU0 A;  4UUS A;  2DQR A;  3JRI A;  4PJN A;  1D1B A;  5DD4 A;  2KIM A;  2HKX A;  3SZP A;  2ACJ A;  2D5V A;  1MDM A;  2RNJ A;  4A0X A;  2R5Z A;  2RNG A;  1I5Z A;  1R9T J;  3REO A;  4A3L J;  2FA5 A;  2UXN A;  4BQN A;  2MD5 A;  1TTY A;  2R7X A;  3BDD A;  2NXN B;  2M0M A;  2R7U A;  1TL8 A;  2A6E F;  2XDV A;  2EZH A;  2DFF A;  4UVC A;  2H6B A;  5B3S H;  1DDN A;  4BAY A;  3K10 A;  1RUO A;  4RAG A;  3HSF A;  4B44 A;  3I4N J;  3FXR A;  1I1G A;  1XGN A;  4A6E A;  1OLT A;  1T95 A;  3P9K A;  3FXK A;  2X48 A;  3FK6 A;  3DKW A;  4PDK A;  2ZME A;  2VBZ A;  5LBQ A;  4UVA A;  4OIQ F;  1Y8Q B;  2OCC H;  3RQ4 A;  1SAX A;  3ECH A;  3K9T A;  1OJL A;  2XGX A;  1LNW A;  3K4J A;  4OOI A;  1ZR4 A;  4CHU A;  5CKT A;  1UEL B;  2K9L A;  5HDN A;  3CCY A;  2CQQ A;  2J5P A;  1WRJ A;  2FJ1 A;  1ZR2 A;  5K7F A;  2QQ8 A;  1Z91 A;  1MJ9 A;  5EJC A;  3QOD A;  3M8J A;  4HEA 2;  2F5C A;  5LD2 C;  2OC6 A;  4M3D A;  3OL3 A;  4QPO A;  4I98 B;  4F93 B;  2LG4 A;  4W97 A;  1U0J A;  3VFZ A;  1RR8 C;  1VQ6 I;  1O4X A;  3HZJ A;  1WH7 A;  2XAG A;  4ESJ A;  3HOV J;  3RYP A;  3A02 A;  3S2W A;  4A3J J;  5HLT A;  4FX0 A;  2IS1 A;  2L0K A;  3LSP A;  2QF7 A;  5J8C A;  4UNO A;  2NRA C;  1G3W A;  4B48 A;  2Y0M A;  5GAG J;  3FIW A;  3DEE A;  4E70 A;  4UB6 C;  5DEQ A;  5E18 F;  2PMU A;  4AYB N;  4BY1 J;  2H27 A;  5B1B H;  1KA8 A;  5IT9 Z;  3R4K A;  2E35 A;  3AG3 H;  2MYS A;  5FKO A;  4BL0 B;  3WTS C;  3KP4 A;  4MFD A;  1MMD A;  4V2F A;  2EJR A;  4RAZ A;  1Z3X A;  2XSD C;  2CH0 A;  1OFC X;  3HRM A;  4CYC A;  3MCZ A;  4G12 A;  2WAE A;  3CME I;  2HZD A;  2ID3 A;  2EZI A;  4LG0 B; 
#chains in the Genus database with same CATH homology
 1U8B A;  2JA8 J;  1MSF C;  1PUF A;  2JJ7 A;  1AKH A;  1MBE A;  3BTI A;  1Q1V A;  2GM4 A;  1FJL A;  2DA1 A;  2O7O A;  1GVD A;  5IOZ A;  2COB A;  1HCR A;  1ORK A;  1HLV A;  4A3I J;  3S1R J;  1FIP A;  1IGN A;  1ZTR A;  3GTK J;  1K61 A;  2R5Z B;  2TCT A;  4D5F A;  1B72 A;  5DTD A;  1F36 A;  4AUX A;  5EGO A;  4JP0 A;  3HOW J;  4A3F J;  5FJ8 J;  2LFB A;  1ETY A;  2DMP A;  2DJN A;  1CQT A;  1DU6 A;  3TED A;  1E3O C;  3Q0V A;  4DZJ A;  2DTZ A;  2YS9 A;  5C4X J;  2N8G A;  3BG9 A;  1AKH B;  5IYC J;  2IEK A;  2E1O A;  2K9N A;  1RPW A;  5F0F A;  1LFU P;  3GTP J;  1ETV A;  4M3F A;  4ABZ A;  2JA7 J;  4A93 J;  3TW6 A;  3H3V K;  3O8H A;  3NAU A;  3CQZ J;  2L7M P;  1U78 A;  4A3B J;  4A3K J;  1IJW C;  3Q0U A;  4QSH A;  3JRD A;  2DMQ A;  3GTO J;  1HDD C;  2XGC A;  5F04 A;  3OSF A;  4UUT A;  3MN2 A;  3DCF A;  1IV6 A;  1UG2 A;  1F43 A;  2CRG A;  1ETO A;  2E2J J;  1JUS A;  2DA2 A;  3JRA A;  2HQ5 A;  3QPS A;  3IH2 A;  1ETW A;  1X2N A;  2HXO A;  5HOD A;  1AU7 A;  1K83 J;  5E3O A;  2M0C A;  3G1M A;  5FKK A;  3WHB A;  4FIS A;  3B6C A;  2ECC A;  2CU7 A;  2NVY J;  1LE8 A;  2ECB A;  1WCM J;  1FIA A;  1WGX A;  2K9Q A;  2LKX A;  3S15 J;  2GBY A;  3LSR A;  1YRN A;  4C2M J;  1IRZ A;  3MKL A;  3WHC A;  2CUF A;  2I10 A;  4CYC B;  1P7J A;  2L7F P;  2B63 J;  4MLO A;  1LFB A;  4FCY A;  4BBS J;  1I6H J;  2NS8 A;  3C2B A;  3RQI A;  5IPA A;  2L7Z A;  2LY9 A;  3JRE A;  3LSG A;  3GTL J;  2XGD A;  3HEF A;  4QIW N;  3LNQ A;  3D1N I;  2R5Y B;  1APL C;  2HOS A;  1S7E A;  3ZQH A;  3HOU J;  3BQZ A;  1ZK8 A;  4A3E J;  5IOY A;  1Y1V J;  4A3C J;  3BG5 A;  2Y9Y A;  5FKM A;  1H89 C;  3BR6 A;  2H1K A;  4S0H B;  4C3I J;  2X6O A;  2LD5 A;  1PUF B;  1I50 J;  1RET A;  3BT9 A;  5M5Y J;  2EH3 A;  3OOU A;  3HB9 A;  5GPA A;  4XIC A;  2HYJ A;  4XRS A;  3ZQG A;  2NVQ J;  3Q3S A;  1WH5 A;  4B1R A;  3W6V A;  4V2G A;  1VF9 A;  1GUU A;  2E2I J;  1JGG A;  2DMT A;  1RKT A;  4X1E A;  1HOM A;  2GLO A;  1JJ6 C;  2AHQ A;  3LOC A;  1IC8 A;  5E3N A;  1JUP A;  5IP7 J;  5IP9 J;  4XRS G;  2ZB9 A;  1NK2 P;  3G1L A;  3FIS A;  1ETQ A;  5F1J A;  4BBR J;  5C44 J;  2VUM J;  2YUS A;  2JA6 J;  2R93 J;  2EBI A;  2DMN A;  5C4J J;  3GTQ J;  4J19 A;  2IBD A;  3UKG A;  3IV5 A;  2MGQ A;  1IUF A;  2K40 A;  2DMU A;  2LP0 A;  1FTT A;  5GPC A;  1TC3 C;  5J1U A;  2CQX A;  2Y30 A;  3S1M J;  4JYK A;  4IHX A;  2H8R A;  2XB5 A;  1JTX A;  2MW8 A;  1JTY A;  1MBH A;  2Y2Z A;  2HOA A;  1MBK A;  4JX6 A;  3BR2 A;  1W0T A;  3S17 J;  3I4M J;  2W48 A;  1WI3 A;  1WPK A;  2PMZ N;  2DN0 A;  1QRY A;  1FTZ A;  1HDP A;  1UMQ A;  1TWH J;  5JLW A;  2NS7 A;  3LSJ A;  4W1U A;  2VKV A;  4A3M J;  3TP0 A;  2R7Z J;  1T33 A;  1BW5 A;  2LK2 A;  3Q0W A;  1W0U A;  3HOZ J;  4M3E A;  1QVT A;  2NVX J;  1UHS A;  3JRG A;  4MIM A;  1BJZ A;  1T56 A;  1OCT C;  1A5J A;  1TWF J;  1GT0 C;  3JRC A;  1IDZ A;  5M5W J;  2HDD A;  2DA7 A;  1GV2 A;  1XS9 A;  2L9R A;  5C3E J;  4B3A A;  1XC5 A;  2JN6 A;  1BW6 A;  5F0H A;  3GTM J;  9ANT A;  3A03 A;  4D5C A;  2LTP A;  3OIO A;  5J1Y A;  1JKP C;  1BA5 A;  3CMY A;  5J3L A;  4IHV A;  3BTL A;  4JX4 A;  1Z77 A;  3GTJ J;  1JKO C;  3IH4 A;  1QPI A;  1YRN B;  3DEW A;  3JRB A;  2FX0 A;  2XB0 X;  3BR5 A;  5IYB J;  3FKI J;  3HGY A;  3A01 A;  1TWG J;  2HOT A;  4IHY A;  1VND A;  3L1P A;  1MBJ A;  2M2E A;  1B8I A;  3MVP A;  5M3F J;  2R5Y A;  1A6I A;  1Z0X A;  5EG0 B;  4Y52 J;  2QCO A;  1VFC A;  4C3H J;  2M34 A;  4BY7 J;  3RZD J;  1RES A;  4M6V A;  1GDT A;  1I3Q J;  4FTH A;  2VI6 A;  2DA6 A;  1P7I A;  1MH4 A;  1JKR C;  4JX5 A;  1U9N A;  4MFE A;  4FE7 A;  4MO7 A;  3S2D J;  1ZQ3 P;  2OPT A;  1IDY A;  2EQR A;  1U9O A;  2XPW A;  3HBL A;  1MNM C;  5EYR A;  5FKN A;  3ZQC A;  4BXX J;  2XRL A;  3HM5 A;  3K7A J;  5F0C A;  1MBG A;  3S14 J;  2NOG A;  2TRT A;  3OSG A;  1SFO J;  1G2H A;  2K9S A;  3B6A A;  5IYD J;  2MG4 A;  4RBO A;  4RDU A;  2JA5 J;  2AO9 A;  5JLX A;  1AHD P;  5M3M J;  2E2H J;  2E19 A;  5EZG A;  4X6A J;  3BR1 A;  3TP3 A;  1X58 A;  5FLM J;  2JWT A;  1NK3 P;  3JRF A;  5EGO B;  2ID6 A;  3QPL A;  2YU9 J;  5IP6 A;  1RR7 A;  2X9D A;  1Y1W J;  5F27 A;  1EF4 A;  3HDD A;  1NTC A;  3BQY A;  1POG A;  4A69 C;  2O8K A;  4C3J J;  1OCP A;  3CDL A;  4XRM A;  2O9L A;  3A01 B;  4XID A;  2WV1 A;  2Y0S N;  4AC0 A;  3RZO J;  2XPU A;  5DS9 A;  2ME6 A;  4D7N A;  2ELK A;  1JKQ C;  3JRH A;  2R92 J;  1X2M A;  2WAQ N;  1MBF A;  5K7H A;  1MH3 A;  1VI0 A;  4B4C A;  1D5Y A;  2FD5 A;  4M3B A;  2KDZ A;  1TWA J;  4FE4 A;  4DYR A;  1ZKG A;  3RKQ A;  2HI3 A;  5EG0 A;  1B72 B;  3H0G J;  4A3G J;  3PM1 A;  2XPV A;  5FLV A;  2JMW A;  3HGG A;  4EEF G;  3F0C A;  4I6Z A;  1SAN A;  1ZGW A;  2MSY A;  1HF0 A;  2Y9Z A;  3M3Y J;  5E3L A;  1DU0 A;  2DA5 A;  4UUS A;  3JRI A;  5M5X J;  3GTG J;  4Y7N J;  3BR3 A;  2D5V A;  4QTR A;  2G0E A;  1ENH A;  2R5Z A;  3ZQL A;  2OF7 A;  2VKE A;  2KT0 A;  1R9T J;  4A3L J;  2LLK A;  2XGE A;  4DW6 A;  4DYC A;  1TWC J;  3NAR A;  2EZH A;  4D7M A;  1H88 C;  3HKZ N;  3BR0 A;  5E3M A;  5K7Z A;  3I4N J;  4I76 A;  5BNG A;  1IG7 A;  4IHW A;  2X48 A;  3FK7 A;  3PO2 J;  3S1Q J;  3FK6 A;  4DYQ A;  3IH3 A;  2LR8 A;  1RKW A;  2M9H A;  4HNV A;  3S16 J;  3S2H J;  5GP9 A;  4L5E A;  2JK3 A;  1OJL A;  3GBG A;  4M3G A;  1JJ8 C;  1ITY A;  3ZQI A;  3PO3 J;  1ZR4 A;  2LVS A;  4GFB A;  3K2A A;  3CCY A;  2IAI A;  2CQQ A;  4LOC A;  3SFI A;  2FJ1 A;  4XK4 A;  1ZR2 A;  5K7F A;  1JUM A;  1JT0 A;  5EEA A;  4M3D A;  1LE8 B;  3VPR A;  3S1N J;  2CJJ A;  5EZH A;  4W97 A;  2P81 A;  2RAE A;  4BKX A;  1XG1 A;  3QQA A;  1O4X A;  3SDG A;  1WH7 A;  3ZQF A;  5F08 A;  1BL0 A;  5EF6 A;  2WB1 N;  3HOV J;  1MSE C;  4UUS B;  4NDL A;  2HXI A;  3SJM A;  3A02 A;  4A3D J;  4A3J J;  2L0K A;  3LSP A;  2QF7 A;  1B8I B;  3BTJ A;  3O8G A;  1H8A C;  3E7L A;  5FKL A;  3HOX J;  3HOY J;  3M4O J;  2NVT J;  3FIW A;  2CUE A;  3TW7 A;  5EDN A;  2EZL A;  2VPR A;  3BG3 A;  1FEX A;  4AYB N;  2R0Q C;  4BY1 J;  1JT6 A;  2Y31 A;  1ETX A;  4IEJ A;  2M8G X;  4DZP A;  3BTC A;  5J1R A;  5FKO A;  2EZK A;  3JR9 A;  4MFD A;  1QVU A;  1ETK A;  1GV5 A;  2DA3 A;  4V2F A;  2XSD C;  1OFC X;  2DA4 A;  3ZOB A;  4CYC A;  2ME0 A;  4G12 A;  2ID3 A;  2EZI A;  2FQ4 A;  3G1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...