2LDUA

Solution nmr structure of heat shock factor protein 1 dna binding domain from homo sapiens, northeast structural genomics consortium target hr3023c
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
MGHHHHHHSHMAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock factor protein 1
publication title Northeast Structural Genomics Consortium Target HR3023C
rcsb
source organism Homo sapiens
total genus 24
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lduA01
1IN6A 2Z5UA 1FPQA 4IHSA 1RNLA 2VOPA 2A69F 4UHTA 2ZXJA 1FYKA 4WCGA 3HOTA 3GUDA 3KEQA 5L3EA 4ZZLA 1LNWA 2RGVA 3EYIA 4P96A 3BJOA 3HSFA 3WU1B 3WTSC 4U7BA 5KVRA 2FBHA 5ED4A 2VONA 4HLXA 3KP4A 3KP6A 1USTA 3LA3A 1D5VA 6PAXA 2HWVA 2J5PA 2COMA 3GEZA 2NRAC 3GLXA 1FSEA 2PQ8A 2JSCA 4KUMA 2XKOA 1RIOH 2BYVE 4YFNF 2W57A 1G4DA 4BH9A 3HHHA 3CUQA 2XUBA 4L9TA 4L0YB 2FXAA 1W7PD 4UVAA 2IPQX 1YW8A 2HTSA 2V1XA 3R4KA 4M71A 1SD5A 4I7HA 2F5CA 2LF7A 1QZZA 1K78A 4LFUA 4KT5C 2EV0A 1EH8A 5K1YA 2F5FA 2VBZA 2AS5F 4YFKF 2IA0A 1MDMB 1MJBA 4KICA 2FBIA 4M9XA 2XHKA 5FLXK 4PGGA 4M6XA 1MGTA 4TV7A 3KZYA 3C7JA 3GZ6A 1OPCA 4OOIA 2ESNA 1SMTA 2RC4A 4S05A 3HYIA 1BN5A 4L0ZB 1R1VA 4O5VA 1G3TA 3P9CA 4BXUA 5DCMA 1WQ2A 3HHGA 2CYYA 4A6DA 2D1VA 1YG2A 4EM2A 4BHCA 3T8TA 1ZRCA 1IF1A 1S8NA 4L18B 5L3CA 2Y48A 3HTUA 3RKXA 4HLYA 1FX7A 2MA3A 1XGOA 1W5SA 3F21A 5HOOA 4ZZDA 3KCCA 1ZH5A 3GF2A 2CQKA 2DU9A 4IHTA 4HX7A 3V8KA 5L3FA 4OIOF 2QYOA 4U88A 3S2WA 2A07F 4EGZA 1R23A 1KYZA 2ZFWA 3I59A 1V3FA 4XSXF 4G7OF 1EH7A 2EWNA 4EJOA 3IWFA 1J75A 5CVIA 1O3RA 2IVMA 4A12A 1UHMA 3I71A 4U0VA 5E17F 2YSRA 3ZMSA 3MZYA 4KIFA 2DPDA 4KIGA 3E6BA 1FYMA 1FP2A 3JAMZ 4F7ZA 4KIBA 3MZHA 1HBXG 1YW9A 3BJAA 5D5VB 1U5TC 3DF8A 4HZFA 5CYVA 5ILSA 1O3QA 1RI7A 3FXUA 1YLFA 2OZ6A 5DDGA 3VFZA 4G9YA 1KU2A 1KU7A 3P9KA 5D4RA 4LB5A 3FMQA 1XDUA 3SQNA 3IKVA 1O7LA 4A6EA 5HDKA 5ICGA 1O57A 1I6XA 2A3SA 1OKRA 2HS5A 3TOAA 1S29A 1T2KA 1ON1A 3HRMA 4KFCA 2IW5A 3V4GA 1J0RA 3F3XA 1QPMA 1R7JA 3WG9A 3O6BB 5CVUA 4CO8A 4ETSA 3FM3A 1UCRA 5E8IA 2Y75A 5E20A 1P4XA 2C6YA 2FRHA 2FF4A 2ZCWA 4I0BA 4FX0A 4KN4X 4ESJA 1YQAA 2DQLA 4HYEA 1Z6TA 1EH6A 2GAUA 4HF1A 3FHZA 4A2UA 3EUHA 2VOOA 2Z99A 3VODA 4LMYA 2FQ3A 4Q47A 2MLKA 2L4AA 3ERED 4HX4A 2O8XA 3GO5A 2JRTA 2BEOA 3IRQA 1Q1HA 2PFBA 3GZ5A 1J9IA 1REPC 2V6CA 4MHGA 1FT9A 2F5DA 1P4AA 4LK0F 5DD8A 5L3DA 4GCVA 2MC3A 4LG0A 1T6SA 3WGIA 1IN8A 3JTHA 4ON0A 3R0JA 1PP8F 4I2OA 1CF7B 1MKMA 4HF0A 1KU9A 1I1GA 1L0OC 1IAWA 4RGUA 1R22A 5FD5A 4YIIA 4HQEA 3J80Z 5ICFA 1O7FA 2EV5A 2OZUA 2XKPA 2R7FA 3JSOA 3IKTA 3I64A 4BHBA 3VOEA 4HA8A 2STTA 1FBUA 3QOPA 3WTZA 3JSPA 1TQIA 3FF5A 3K1PA 2JT1A 3V7SA 1IUYA 2P5VA 2Q8KA 4EJUA 2XROA 4G8XA 5JI6A 5DD4A 5FFZA 3EDPA 3PQKA 3ZMDA 5HDGA 2H6BA 2EV6A 3HTSB 4M73A 2HYGD 1ZLKA 2L3DA 3RJPA 1FLIA 2JPCA 3T0YA 5BMZA 3C3WA 2FNAA 1QGPA 1HW1A 1JGSA 2QQ9A 2HKOA 2FA5A 2BE5F 5ICEA 2Z9OA 2GWRA 4U0YA 3NRVA 2V1DA 1E2XA 4UVBA 3ELKA 3KP5A 1ZLJA 2FNPA 2F5EA 1DPUA 5IT9Z 3CLOA 2QQBA 3M1EA 4IJAA 2CGPA 2CW0F 2XRNA 4AIKA 3RPUA 3F6VA 1BIAA 4EJWA 2PMHA 3HRUA 4PDKA 1GVJA 1LDJA 2XAFA 3OOPA 1HW2A 1MJAA 2MLGA 2EA4A 3NQOA 1USSA 2EFQA 2Y0MA 4M6YA 1U78A 3TO6A 4ENNA 4MEXF 3F8MA 2L4MA 1Z9CA 4E70A 2W24A 2H94A 3K1MA 3SHFA 3FZVA 4ENJA 5D5WB 4UV9A 2NAZA 2PLYA 2OU2A 2HR3A 2O03A 4CZZA 2D45A 4JBAA 1B9NA 4YG2F 4EVIA 2K86A 1U5TA 3DFGA 2HQRA 2O6GE 4P9FA 2DO7A 4M9SA 3R60A 1XB4A 3WTVC 4BQAA 1F4KA 1LDDA 2YX4A 3F6OA 1DP7P 1MJ9A 1TQPA 4K2EA 3EQLF 1LQ1A 3L09A 5BQTA 5K5RA 2DBBA 4LB6B 1RUNA 2W84A 2HYFA 5F6FA 2RVCA 1ZHFA 3COAC 2UXXA 2ACJA 4B8XA 2Q0OA 3ZQ7A 3CO6C 1K7AA 2HEOA 5LGUA 4CHUA 1SD6A 1W7PA 3F8CA 2VN2A 3BPXA 3DPLC 3LSTA 1YFHA 3K1NA 2B0LA 2E1NA 2RKHA 3KZZA 1V4RA 2QUFA 2EFNA 1T0FA 2BV6A 3LAPA 3B02A 2FE3A 1T98A 2VT2A 5ICCA 2FEZA 2R7DA 3E5UA 4EV0A 4KMUX 4LD5A 3WGHA 4GYGA 1XD7A 4G7HF 2G9WA 5H20A 1W5TA 3WTYC 2D1HA 2RQPA 5AIQA 4G6DA 2G7HA 4HW0A 2IT0A 5K5QA 2ZNYA 2ZKZA 1R36A 3R6SA 5E1WA 4RGSA 1OYYA 1T38A 1A04A 2MH2A 3TGNA 1ZARA 2Z33A 2VC0A 4KA4A 1E17A 3J7AO 5J6XA 5J8FA 1XSXA 2VC1A 3K9TA 1UHWA 5CJ9A 1YYVA 2VXZA 3I0TA 1XSDA 1XSVA 3LWFA 1KYWA 2W85A 4DQ2A 4MGRA 3TO9A 3RKYA 2CSOA 2ISZA 1J2XA 1GXPA 4WF2A 4M74A 2M87A 5BS6A 4CXFA 5D5XB 2M5WA 4ZYDA 2UZKA 2OD5A 1HSTA 2KJCA 1BIBA 1YIOA 1LEAA 3PQJA 3E5QA 3JTGA 1YS6A 3CO7C 5AONA 2DLLA 1FBSA 3H3UA 2HTJA 4MQVA 1D8KA 1AOYA 4U0WA 2E7WA 2NNYA 1QZYA 1XGMA 4JQFA 2PN6A 5AIPA 3GFJA 3V7RA 2QBYB 4IRGA 1Y0UA 1FC3A 5LRRA 5H6RA 5JFRA 4WXDA 5LEJA 4LGWA 3E6DA 5E1ZB 3GXOA 4L5IA 3JAMK 1C0WA 3HRSA 3DKWA 2LDUA 2HQNA 3F8BA 5LLQA 3CUQB 2DFIA 2QLZA 1PDNC 1IXSB 1JXSA 2Z3YA 2HOEA 2WWYA 4S04A 1IXRC 1R5HA 1IW7F 2WC2A 2OQGA 1LEBA 1K79A 5D4SA 2QZ8A 3U9GA 4EMSA 2LF8A 1O3TA 1BC7C 4NQWA 2P6TA 2JTVA 3O3KA 3P9IA 1WSUA 1Z05A 3BDDA 2FBKA 3KETA 2R3SA 4KN7X 4LJZF 2P4WA 2ZNZA 3U2RA 4EJTA 2EK5A 1HW5A 2X4HA 1H9TA 1F5TA 2RV8A 1QBJA 4OMZA 4R1HA 3FMSA 2QWWA 5A2QZ 1FOKA 3MFKA 3ZMVA 2GXBA 1TBXA 4HDVA 2PMUA 4ENMA 3IWZA 2A68F 3R61A 4N9HA 2ETHA 5JR3A 2VT3A 4PGHA 3F8NA 4P5OA 3M7GA 3QPHA 2K27A 3D5LA 1DDNA 3RTRA 5DCMB 5L3BA 4UXNA 2XAHA 1S6LA 1BC8C 3N4MA 2IA2A 2K4BA 1OR7A 4RB0A 3EYYA 3LQQA 3RI4A 5ERIA 4ESBA 1F1ZA 5LHGA 3O2PE 4Y13A 2OA4A 3DV8A 2KKOA 1UB9A 4R8HA 3BWGA 2P7VB 2ESHA 2O3FA 4JK1X 3MAJA 4RAZA 1RZ4A 4GYIA 5J8CA 1MD0A 3I59B 2ZMEA 3RYRA 3HOSA 1U8RA 1WKMA 2L01A 2DT5A 1R1TA 1BJAA 1Z1DA 3C1DA 2RNJA 1ODDA 5EEHA 3J80K 1TLHB 5D6EA 2A5YB 1YW7A 2EJRA 1SD7A 1HXDA 3BP8A 3LAJA 2RN7A 2L02A 4LLNA 5HS8A 1G3WA 4KNYA 2VODA 2NS0A 3MCZA 2DPUA 4Y17A 1ZYRF 1WRJA 3TDUC 1J59A 3T1BA 4RAYA 1GHCA 2VBYA 4CYDA 3U1DA 1ZG5A 2VE8A 4O6JA 5DEQA 4WWCA 1HKSA 5LBQA 3D0SA 2KIUA 2LNBA 4XBFA 1FZPB 1SFXA 2L54A 2H6CA 5HLHA 1Z91A 1B1BA 3ZP5A 3KP3A 5HDNA 5E1XA 3WTTC 4Q4ZF 3I53A 4L9NA 1YTYA 4UV8A 2GIVA 2OQRA 3GX4X 2FU4A 4KDPA 2JZYA 1HKQA 4CDGA 1DUXC 3HUGA 3RPQA 3QAHA 2Q2EA 1IZ1A 2P5KA 3QRFF 2XVCA 4G7ZF 3T8RA 4A0XA 4Q5SF 3IC7A 4MEYF 5TJJA 5IT9K 4FX4A 4L9JA 2CWEA 4RGRA 1KQ9A 5D6FA 4EM0B 1R00A 4NHJA 1SD4A 1YS7A 5TRDA 2P6SA 5DV5A 2O61A 4RB3C 3FM5A 2QVOA 5LHIA 3C18A 4MTDA 4L9VA 5JVTA 2MD5A 2UXNA 3W6JB 4HDUA 4MNUA 2X0LA 5EEGA 4DNCA 3MWMA 3ZPLA 1R5GA 3CTAA 2A6EF 2QQAA 4EGYA 1XGSA 4ASNA 4HF2A 2FSWA 4LG0B 2AXLA 4QLCU 1ULYA 3PFIA 4ENKA 4HV5A 4UVCA 3L00A 1JE8A 4UUVA 1P92A 3AAFA 3LA7A 3DXJF 3RIRA 4G94A 5BPIA 3I54A 4LLGF 3FX3A 4I01A 2OBPA 1MDMA 5K5OA 1TTYA 3M8FA 1W4MA 2RDPA 5E18F 3M8EA 5JHUA 3SFZA 4BAYA 5IT3A 1OYWA 4HV6A 5CVJA 4UNOA 3RYPA 3V8JA 5DUIA 3J81Z 3E3VA 1AWCA 1SFEA 1FWZA 2E7XA 4YFXF 4OIRF 1H0MA 1R1UA 4BHPA 2K02A 1X3UA 3FMRA 2LSOA 3L7WA 1B9MA 3ABTA 4Q48A 1HKTA 3TO7A 3KFWX 4ESFA 3G73A 2HZTA 1IXCA 2F2EA 5FD6A 3GYHX 1J7KA 2G7UA 4GO1A 2A61A 3SZTA 4XRFA 1QNTA 2QBYA 2NYXA 3FXQA 4ZH4F 5L3GA 4N9IA 2DK5A 1XN7A 4RGXA 1XMAA 5HS7A 4G6QA 2OAZA 1LDKB 4BNCA 3I4PA 2D2WA 1FP1D 1DPRA 5D5UB 4LK1F 3ZMTA 5ILUA 1I27A 3ECOA 4M9ZA 4H0EA 1XMKA 1ON2A 1WI9A 1G3SA 4A5NA 5BPDA 2M8EA 3WODF 3F72A 5LGNA 4KYWA 3TQNA 2STWA 2K4JA 2EFPA 3DQVC 4IRHA 2EB7A 3TDZC 1PP7U 4XSZF 4GXOA 1U5TB 5D8KB 2QM3A 5FLXZ 3LA2A 5DYMA 4OMYA 3H92A 2K7LA 4M72A 1O3SA 5E8GA 2WTEA 1FNNA 5CVRA 2HKXA 3ZN1A 2VBWA 2YU3A 4Y15A 1Z7UA 3WTUC 5F64A 4FT8A 3CJNA 3LFKA 4WXHA 1F9NA 3KLNA 4WX9A 5LHHA 1U2WA 2TDXA 3F23A 2A6HF 3SZPA 3WTXC 1WWXA 3I58A 2E1CA 1SFUA 4CGZA 3F22A 2FMYA 1ZG3A 4AD9A 4FHTA 2EFOA 2GA1A 2DW4A 3G3ZA 1SAXA 1W7PB 1D8JA 3P7NA 2PJPA 2V1UA 1S7AA 2M1BA 1IRFA 1OYIA 5H6QA 4WK8F 4IRIA 3SXYA 1QQIA 3BJ6A 2LKPA 3GFIA 3ZMZA 5LRSA 1KGSA 1U6GA 3Q5FA 5FO5A 3BOQA 1P6RA 3WU0A 2IP2A 1CF7A 2YR2A 1IN5A 4NB5A 2H27A 4D0PA 2MBFA 4IF4A 1K78B 5HS9A 3B73A 2KJBA 1LVAA 5CVVA 2PI0A 4HBLA 1H9GA 1ZRDA 5A2QK 2CG4A 1MZBA 3EETA 3Q9SA 1I1SA 1QO0D 1XCBA 1KQ8A 2VBXA 2XGXA 4AWXB 2PG4A 2FMLA 3FXRA 1FBQA 3DP7A 3T5XA 2DI3A 2KIMA 3LQRA 3TKYA 3ZN0A 2ZBKA 4MQ9F 3K69A 2WV0A 4ZYGA 3N97A 4KMFA 4IVNA 2IRFG 4R79A 1LB2A 2HGCA 2ISYA 2GXGA 3GW2A 1IN7A 4L5JA 2UWMA 1ZAOA 3RDIA 4N0BA 2DTRA 1JHFA 1VTNC 2EFWA 2JPBA 2HDCA 2XIGA 1ZGJA 3Q9VA 3IHUA 2PEXA 1LJ9A 3CUQC 3E97A 3QP5A 2M30A 3HRTA 2YX7A 1OMIA 1RUOA 2W25A 4EQQA 1P2FA 3I5UA 1B59A 3RKWA 2PBIA 3CDHA 2IJLA 1YO5C 1U3EM 4XLPF 3ECHA 1B6AA 2BGCA 4ZYHA 1BBYA 1FYLA 3ZMUA 1ONVA 1KQ0A 2KRFA 3REOA 2V9VA 2GQQA 3ML6A 3E6CC 3GFLA 3HIFA 3TOBA 4AIHA 3IL2A 2XAQA 4CICA 5DUKA 4IPAA 4P9UA 2ELHA 5HLGA 1BI1A 1IN4A 2HFHA 1L3LA 4PZJA 4HX8A 3F8FA 5DCFA 2EA2A 3ABUA 3BROA 2QENA 3WE3A 3WGGA 5BOXA 3WTWC 3BY6A 3KP2A 4A0YA 4RB1A 2MH9A 1XDSA 4U7DA 4ZYEA 1FSHA 3VB2A 2J5OA 4P55A 1Z6RA 1UFMA 1ZRFA 4A5MA 2NNNA 3MEXA 3ROUA 2P7CB 2XV4S 1BI2A 1S7OA 4LLLA 2FOKA 1KU3A 5LGTA 3W6KB 1G6NA 3JW4A 3MQ0A 1I5ZA 1BOAA 1BI3A 1HSJA 5KK1A 3E5XA 3M9AA 1G3YA 5ILVA 1TW2A 1KA8A 2IA1A 1BM9A 3QU6A 4EM1A 2CO5A 3IRRA 5FB2A 3R0AA 1STZA 3L2CA 4GGGA 3K2ZA 4I0AA 1TNSA 2XAGA 5LEKA 2VE9A 1ZGAA 1CGPA 1K6OA 3DEUA 3CUOA 1GXQA 1ZG1A 2XASA 2CFXA 4OIQF 3KLOA 4WXCA 1T39A 1J5YA 3WE2A 4O3MA 2GA2A 4YIFA 2GZWA 3BZ6A 1JHHA 2H09A 3NEUA 1XCVA 3V8LA 1NHAA 1XGNA 2DAOA 1BI0A 4HOBA 2ZMEB 3OV8A 3HSRA 5HLIA 1SMYF 1PUEE 3FWEA 2ZJ2A 1IRGA 4XLNF 4RS8A 5CLSA 4OINF 2XAJA 3HSEA 4I09A 1P4WA 1TNTA 5F1RA 4AVPA 3GWZA 1FY7A 2ZO4A 4B09A 1TQMA 4MTEA 4QWQA 5HVQC 1EV7A 4EJVA 3DPTA 3KE2A 3H3ZA 3ISPA 4PCQA 4OU0A 4AIJA 3L9FA 1R58A 3KP7A 3QPTA 2ADUA 2M45A 5FFXA 3QP6A 5FGMA 3VEPA 3QU3A 4RB2C 4BYYA 4I98B 2P5LC 2KIFA 1ZN2A 2DQRA 4HAMA 4IXAA 3J81K 3GVAA 5D8LB 3ULQB 1S3JA 1B4AA 1ZREA 4HQMA 2DK8A 4I02A 3KEOA 1D3YA 2V79A 3BPVA 3V7CA 2BBYA 1TW3A 2P8TA 4OIPF 4A0ZA 3GFMA 2O0YA 3K0LA 3E6MA 4Z2YA 1HQCA 2YPRA
chains in the Genus database with same CATH superfamily
1IN6A 2Z5UA 2QKMB 3CMYA 4RBOA 1WJCA 1FPQA 4IHSA 1RNLA 2R7VA 2R5ZB 2VOPA 2A69F 2OC6A 3ZQHA 2XGDA 4UHTA 2ZXJA 1FYKA 1IJWC 1A6QA 2RNGA 4WCGA 3OYIA 3HOTA 2YU9J 2X6YA 3GUDA 3HUGB 3KEQA 3MKYB 5L3EA 4ZZLA 5FKKA 1LNWA 2RGVA 1Z77A 3EYIA 1FMWA 4P96A 3JRCA 3FXOA 4M3DA 1HLVA 3BJOA 3QPLA 2MYSA 3N05A 3HSFA 4MLOA 1NK2P 3WU1B 3WTSC 4AYBN 1R4MB 2WA0A 2HDWA 3CC2I 4U7BA 5KVRA 2FBHA 4RDUA 4HNTA 4N4NB 5ED4A 4DZPA 2YS9A 3PNVA 4BQQA 2VONA 4FTHA 4HLXA 2X6OA 2M34A 3BQZA 2CFOA 1X58A 3KP4A 1TZLA 1NG7A 3BR6A 3L2WA 5B66C 1JJ6C 2GBYA 3KP6A 3P5JA 1USTA 2EPFA 3LA3A 3C2HA 3TMOA 2O9LA 1D5VA 2HQ5A 5C4JJ 4IKFA 6PAXA 2HWVA 2FX0A 2J5PA 4ZDLA 4ZYAA 1JI8A 1Y56A 1G8XA 2COMA 3RSNA 3GEZA 2NRAC 3GLXA 1FSEA 2PQ8A 2GM4A 3I4MJ 2JSCA 2R7OA 4KUMA 5CKTA 2XKOA 1RIOH 2BYVE 4BACA 4YFNF 2UUZA 3KEYA 2L5QA 2W57A 2CJJA 1G4DA 2FJ1A 2M2EA 5B5EC 3S32A 4BH9A 3HHHA 3CUQA 2XUBA 5TISC 3UNGC 4L9TA 4L0YB 2FXAA 2DA3A 1W7PD 4V2GA 2IPQX 1YW8A 2HTSA 2V1XA 4UVAA 3DTIA 3R4KA 3W2VA 3OR2C 4M71A 1SD5A 4I7HA 4MIMA 5J4VA 2LTPA 3CCRI 3CP8A 2HYJA 3OMYA 2F5CA 2LF7A 1T08B 5CQGA 1QZZA 4HG2A 4BE0A 1K78A 4A3KJ 2A5WA 3H36A 4LFUA 4KT5C 2EV0A 3NARA 2WAQN 1EH8A 5K1YA 2F5FA 2VBZA 4CYCB 2AS5F 2VJ5A 4YFKF 3S3MA 1CQTA 4NBQA 3CC4I 2KFDA 2IA0A 3O8GA 1MDMB 1MJBA 4KICA 2FBIA 4M9XA 2XHKA 1WJDA 4PJ0C 5FLXK 1V55H 4C2MJ 4PGGA 3ZRGA 3E7LA 4EEFG 3K4LA 3HOUJ 3EPZA 3M4OJ 3LOCA 4M6XA 1MGTA 1VQKI 4TV7A 1JKQC 3KZYA 2K85A 2CRGA 4NC8A 3C7JA 2MD0A 1VQ8I 3GZ6A 1OPCA 4OOIA 3GLLA 1GV5A 2ESNA 2IGNA 1SMTA 2RC4A 1G59A 3ABMH 3HBLA 2RREA 4S05A 3HYIA 1BN5A 3M8JA 4L0ZB 4CUGA 1R1VA 2L9RA 4BJ6C 3IV5A 4O5VA 2JA6J 1G3TA 3P9CA 2LY9A 4BXUA 4XICA 5J40A 1TWAJ 2E34A 3TEDA 3SJMA 4J00A 5DCMA 1WQ2A 3BR5A 2ZJQF 1ETVA 3HHGA 2CYYA 4A6DA 2D1VA 1YG2A 3S3OA 2O7OA 4BHCA 4EM2A 1EJ9A 3T8TA 1ZRCA 4A3DJ 1IF1A 1S8NA 2MW8A 3BG5A 3PM1A 4L18B 5L3CA 3L2UA 2Y48A 3HTUA 3NWTA 3RKXA 1VQ9I 4HLYA 3H3VK 4J01A 1FX7A 2MA3A 1XGOA 2ID3A 1VQ5I 2LY2A 1W5SA 3GTJJ 5EG0A 3F21A 4OWRB 5HOOA 4ZZDA 2MGQA 1A5JA 3KCCA 1ZH5A 3GF2A 5J1UA 3LFUA 2CQKA 2JA5J 2DU9A 4IHTA 4NC7A 4HX7A 3V8KA 1WPKA 3BTIA 5L3FA 3VSKA 3A01B 2OCEA 4OIOF 2QYOA 3I4NJ 1ZGWA 3EUKL 2VQHA 4U88A 3C2GA 3H5AA 3S2WA 2A07F 4D1QA 5C3EJ 4EGZA 3HOYJ 1GT0C 3VYSB 2V6EA 1R23A 2CMPA 1X4OA 1KYZA 3PO3J 4IHVA 1FOYA 2X1DA 2ZFWA 3G2BA 3I59A 1V3FA 4XSXF 2BW3B 4G7OF 4A3FJ 1EH7A 3AL0C 2EWNA 4EJOA 3IWFA 1J75A 5CVIA 3G1MA 2EILH 3CCUI 2DMPA 1O3RA 2IVMA 4A12A 1UHMA 3I71A 4U0VA 5E17F 2YSRA 3ZQIA 3AFHA 3ZMSA 1EA3A 3MZYA 2XF7A 4KIFA 2VKDA 1UAAA 2KRCA 4PJLA 2DPDA 2Y0SN 4KIGA 3E6BA 1FYMA 1FIPA 1FP2A 3BCBA 3CC7I 3JAMZ 4F7ZA 4UUSB 3CCEI 3JR9A 1FOXA 4KIBA 5KAFC 3MZHA 4XMYA 3PO2J 1HBXG 3FK7A 4BUPA 1YW9A 3BJAA 3FDYA 4NDLA 3FXMA 5D5VB 1VZ0A 4A3EJ 1U5TC 3OYBA 3DF8A 4DBRA 3Q0WA 2DOFA 4HZFA 5CYVA 5ILSA 3G4SI 1O3QA 1RI7A 3KX2A 4Y3OA 3FXUA 1MNMC 4JOMA 4C2TA 1R9TJ 4DZJA 1YLFA 2OZ6A 5DDGA 3VFZA 1OQYA 4G9YA 3JRBA 3K70C 2E1MB 2VKEA 1KU2A 1KU7A 3P9KA 1D0YA 5D4RA 4NC6A 1WH7A 4LB5A 3FMQA 1XDUA 3SQNA 3I56I 3IKVA 1O7LA 3FK6A 2F4IA 3QYFA 4A6EA 5HDKA 4FQGA 1MW7A 5ICGA 3L2QA 1O57A 3ASOH 1I6XA 2LLKA 2A3SA 1OKRA 2M3AA 2TCTA 2CUZA 1OCRH 1YHQI 2HS5A 2X48A 3TOAA 4ZTJA 1S29A 1T2KA 1ON1A 1XPXA 4AIDA 3HRMA 1MSFC 4KFCA 2IW5A 3V4GA 1J0RA 3F3XA 4C3HJ 1QPMA 1R7JA 3ZQGA 1UELB 2BVLA 3WG9A 2HVQA 3O6BB 5CVUA 2PJRA 4CO8A 4ETSA 3FM3A 1UCRA 5E8IA 2KPMA 2Y75A 5E20A 1P4XA 2C6YA 2FRHA 2FF4A 2L9VA 5EGOA 2CV1A 3TL4X 1MNDA 1SVOA 3HOXJ 2ZCWA 4I0BA 2JSPA 3MKLA 4FX0A 4KN4X 4ESJA 1YQAA 1FEXA 2Z16A 3OIOA 1RPWA 2RQQA 2DQLA 4F93B 4HYEA 1Z6TA 2DYSH 1EH6A 2GOMA 1WVRA 2GAUA 4YIRX 2X9DA 4HF1A 3FHZA 4A2UA 4E7IA 1QVTA 3GTKJ 1X19A 3EUHA 3FBIB 2LKSA 5M3MJ 1I39A 2VOOA 2Z99A 2NVUB 3VODA 4LMYA 2FQ3A 4Q47A 2MLKA 1OISA 2L4AA 3ZCOA 3ERED 4HX4A 2O8XA 2NVYJ 2JRTA 3GO5A 2BEOA 1I6HJ 3AKZA 3IRQA 1Q1HA 1Y0NA 2PFBA 3GZ5A 4A69C 4FETA 3Q0UA 1J9IA 1REPC 2V6CA 3BR3A 2KZGA 4MHGA 1NTCA 3SZGA 4HRIA 1AKHA 3GTOJ 1FT9A 2F5DA 1P4AA 2BXZA 4LK0F 2BHYA 5DD8A 2R7TA 2QCOA 1P9QC 3MZ8A 5L3DA 4GCVA 2MC3A 4BEHA 3L2RA 4LG0A 3DU6A 1T6SA 2VKVA 3W3CA 3AG3H 3WGIA 2DMUA 4B44A 2LK2A 1IN8A 3ERMA 3S16J 3JTHA 3H1CA 4ON0A 1YE9A 3R0JA 1PP8F 4I2OA 4IQJA 3I9V2 1CF7B 2ZJPF 1MKMA 2HU9A 4HF0A 1JUMA 1KU9A 4UY8I 1IV6A 4ZDPA 4AM3A 3Q3SA 3BR2A 1TT5B 2E5ZA 1I1GA 4B3AA 3MKWB 1L0OC 5DTDA 1IAWA 4RGUA 1R22A 2CUFA 2L7FP 5FD5A 2Y9ZA 1ETQA 4YIIA 1H88C 4HQEA 3J80Z 3I3LA 4XM3A 5ICFA 1O7FA 2EV5A 2OZUA 2XF5A 2XKPA 1TWFJ 4IOCF 2R7FA 2LH9A 3JSOA 1IO2A 2BXYA 2WV1A 3I64A 3IKTA 4BHBA 4FASD 3L1PA 3VOEA 4HA8A 1YRNA 4ITVA 4B43A 1OCPA 3HGGA 2STTA 1FBUA 4FE7A 2FD5A 1IRXA 4DOZA 2P0WA 1S7EA 3QOPA 3WTZA 3JRFA 3JSPA 4JYKA 2H8RA 1TQIA 3FF5A 3K1PA 5M3FJ 2JT1A 3OL4A 3V7SA 3CDLA 5M5WJ 1VQLI 1IUYA 2P5VA 2Q8KA 4EJUA 2XROA 3A2KA 2HXIA 3DBLB 2LR8A 4G8XA 5JI6A 5DD4A 3OS2A 5FFZA 3EDPA 3PQKA 1WJEA 2DFEA 2F5VA 2WB1N 3HKZN 3ZMDA 4A3GJ 3M1CA 1Z0XA 5HDGA 3PIOF 2E19A 2R7SA 2H6BA 3ABLH 4FISA 2EV6A 3HTSB 2VL8A 4M73A 2HYGD 1ERDA 1ZLKA 2L7ZA 3OS1A 3ZGKA 2L3DA 3RJPA 1FLIA 2JPCA 3T0YA 5FKMA 5BMZA 2CW8A 2VQGA 3C3WA 4LG3A 2WAEA 3X2QH 2DDBA 2IS1A 3S14J 4ZC3A 4MFDA 3K10A 2KDZA 1YJWI 2FNAA 1QGPA 2OTLI 3VWBA 1MBHA 4B4CA 1HW1A 1JGSA 1ETOA 2QQ9A 4BBSJ 2EIKH 2HKOA 1ZK8A 3GTMJ 2XB5A 2FA5A 2BE5F 5ICEA 2Z9OA 1GLNA 3CJRB 4G12A 3V42A 2GWRA 3CCYA 3HJEA 4IHXA 4U0YA 1D1AA 3NRVA 2LP0A 2NOJB 5M5XJ 2V1DA 1E2XA 4UVBA 3BCAA 4GFBA 1WJAA 3BR0A 1UMQA 4YEJA 3ELKA 3KP5A 1ZLJA 1PUFB 2ECCA 2FNPA 1Z3YA 1HC8A 3OYFA 2F5EA 1VQ6I 1DPUA 5FRMA 5IT9Z 3CLOA 4HEA2 2VUMJ 2QQBA 3M1EA 4IJAA 1OCCH 2CGPA 4BL0B 2VQLA 1RR8C 2CW0F 2XRNA 2QEXI 4AIKA 2V7FA 3FHNA 3RPUA 3F6VA 2Z1DA 1BIAA 1X1DA 3MD2A 4EJWA 2PMHA 2E2IJ 1MSEC 3SEZA 3HRUA 4PDKA 1GVJA 3J7AY 1MNEA 1LDJA 2XAFA 2OTJI 2NS7A 3OOPA 3OYEA 1HW2A 1Q1VA 1DQUA 4PSWA 1MJAA 2MLGA 2EA4A 3NQOA 1USSA 3VPRA 2EFQA 3CJQB 2ZB9A 2Y0MA 4M6YA 1U78A 3TO6A 4ENNA 3M07A 3QODA 4MEXF 3F8MA 3ZQLA 2L4MA 4B48A 1WGXA 1Z9CA 2LVSA 4E70A 4XN0A 3TW6A 1A31A 3EUAA 2KQRA 2DJIA 2W24A 2H94A 3K1MA 3JRAA 3SHFA 3FZVA 4ENJA 5D5WB 3DLLF 4UV9A 2NAZA 4D7MA 2PLYA 3GTGJ 5HNHA 2OU2A 5KHDA 1B72A 3RKQA 2HR3A 1NG6A 2DA7A 2R7ZJ 2O03A 4CZZA 3CLQA 4HSTA 2D45A 4JBAA 1ITYA 1WZ2A 1B9NA 1AU7A 2QSHX 5EF6A 2Y2ZA 1MMGA 4YG2F 1SEUA 1T8IA 4EVIA 3CZ6A 2K86A 1W5CC 4E7SA 3W6VA 1U5TA 1S9HA 2DXIA 2EH3A 3DFGA 2HQRA 1W36D 2MSYA 4IEJA 2XSJC 2O6GE 4P9FA 2DO7A 4M9SA 4F91B 3R60A 3OYMA 1XB4A 3WTVC 3OSFA 1WJBA 4BQAA 3BTLA 1QRYA 1F4KA 2M7AA 1LDDA 2YX4A 3F6OA 1DP7P 1MJ9A 1TQPA 4K2EA 3EQLF 1LQ1A 2PMZN 3AG4H 3L09A 3VSLA 3A02A 5BQTA 2CU7A 2IS2A 5K5RA 4CCOA 3S1MJ 3PUBA 2MFZA 2DBBA 4LB6B 1RUNA 2W84A 2AQFA 2HYFA 5GAHJ 1Y39A 3K4NA 2Q2EB 5F6FA 3CF2A 1N77A 2RVCA 1ZHFA 3COAC 1E3OC 2QQ8A 2MC4A 2ZMEC 2UXXA 2QA4I 1RKWA 2ACJA 1LVKA 4B8XA 3I55I 2KHMA 1OCTC 3U21A 4D5CA 1Z21A 2Q0OA 3ZQ7A 3CO6C 1K7AA 2HOAA 1UJ8A 2L9NA 5LGUA 2HEOA 4CHUA 1SD6A 3IP4B 1W7PA 3F8CA 4B47A 4QPQA 2VN2A 3BPXA 1PJRA 3DPLC 5J47A 3PSFA 3A01A 1WCMJ 3LSTA 1YFHA 4PSXA 5IP7J 3K1NA 1JT0A 4DJAA 2B0LA 2E1NA 2RKHA 5DS9A 3KZZA 1XG1A 1V4RA 2QUFA 4RLFA 2OF7A 2EFNA 4RM2A 1T0FA 2BV6A 5E3LA 1RC9A 3E1SA 5GP9A 2K9NA 1FIAA 3LAPA 2ZC2A 3B02A 2FE3A 1VQNI 1T98A 5EYRA 2VT2A 2E35A 1MH3A 2EINH 5ICCA 2EZHA 5F0HA 4CSWA 2FEZA 2R7DA 1MMNA 2DA4A 3OSGA 1FMVA 3CMMA 3E5UA 4EV0A 1KONA 3A0BC 3DU5A 2LC2A 4KMUX 4LD5A 3WGHA 1YIJI 1LE8B 4GYGA 1XD7A 1JGGA 4G7HF 5J1RA 2VPRA 3GMEA 2G9WA 1X1AA 2R5YB 5H20A 1W5TA 1BW6A 4JP0A 1W0UA 3WTYC 2D1HA 1DU6A 2RQPA 5AIQA 3LSRA 5KAIC 3CESA 5KNLA 3OY9A 4G6DA 2G7HA 4HW0A 4XK4A 2KIQA 4LITA 2IT0A 2BY3A 1HDPA 5K5QA 2MABA 2XC7A 1MH4A 2ZKZA 2ZNYA 1R36A 3R6SA 3SFIA 2V9KA 2DMTA 2K9SA 3QWLA 5J4YA 2XAUA 5HNFA 5E1WA 3KYDB 4RGSA 2LY1A 1OYYA 2WAQA 2GOXB 3HGYA 2BY1A 1T38A 1A04A 3KYLA 2CV0A 5IOZA 2CS3A 2DYRH 2MH2A 3TGNA 1ZARA 3PL8A 2VC0A 2Z33A 4KA4A 4KT6A 1BL0A 5JHFA 1E17A 3L2VA 3J7AO 5J6XA 5J8FA 1XSXA 2VC1A 3HZJA 3K9TA 1UHWA 5CJ9A 1YYVA 3C2BA 4HPQA 2VXZA 2NS8A 3VYUB 1F36A 3BG6A 3I0TA 3D1NI 1XSDA 2O8KA 2DA2A 1XSVA 3LWFA 3OYDA 3G6EI 3CCLI 3HOWJ 1JKOC 3S1QJ 5LD2C 1KYWA 1YJNI 2W85A 4GRIA 4BY1J 1QHHD 3BG7A 4DQ2A 2KRHA 4MGRA 5FLVA 3TO9A 3RKYA 2RAEA 1RRJA 2CSOA 1ETWA 2ISZA 3PNYA 1J2XA 1GXPA 1O4XA 2ZXHA 5B3SH 4WF2A 4M74A 2M87A 5BS6A 2LMDA 2ECBA 4CXFA 3W2AA 5D5XB 1MBEA 2DMQA 4BJ5C 4S0HB 2K9MA 4LIUA 5HLTA 2M5WA 2OD5A 4ZYDA 2UZKA 2W1OA 4IOAF 1HSTA 2KJCA 3DBRB 1BIBA 4UB8C 1YIOA 1SFOJ 4DGWB 3A1YA 5HODA 1LEAA 4XQFA 3PQJA 3E5QA 5FJ8J 3JTGA 5K7HA 4IL6C 1IDYA 1YS6A 2M0MA 3CO7C 4M3FA 1I3QJ 5AONA 2DLLA 1FBSA 1TWHJ 3H3UA 1VF9A 2HTJA 3HXLA 3CCJI 4IO9F 4MQVA 1OCZH 1D8KA 1AOYA 1EKEA 4PFOA 4U0WA 2E7WA 4KITB 4BKXA 1P7JA 2NNYA 2DA6A 4N4OB 2JVHA 1QZYA 1XGMA 4JQFA 2PN6A 3ZQFA 1IDZA 5AIPA 4XIDA 2DTZA 3GFJA 3V7RA 1YX3A 2IS4A 1LKXA 2ZFUA 4DYRA 2QBYB 4IRGA 1Y0UA 2H1LA 1FC3A 5LRRA 5H6RA 2VJJA 4E4HA 5JFRA 4WXDA 5LEJA 4LGWA 3E6DA 4F52A 2JVGA 5E1ZB 3GXOA 4F3QA 4L5IA 3JAMK 1C0WA 2M9HA 1W36C 1RETA 3HRSA 3DKWA 3IH2A 4EATA 2MG4A 2LDUA 2HQNA 3F8BA 5LLQA 3CUQB 1R4NB 2DFIA 2QLZA 1IXSB 1PDNC 1JXSA 2BY2A 2Z3YA 4E7LA 5J1YA 2HOEA 2WWYA 1F43A 1TT0A 3OYHA 4S04A 1IXRC 1R5HA 3FKIJ 1VFCA 3OYNA 1LFUP 1IW7F 5M5YJ 2WC2A 1MBGA 1FTZA 2OQGA 1LEBA 1K79A 2B63J 5D4SA 2QZ8A 3U9GA 4QTRA 4LOCA 4EMSA 2JJ7A 2LF8A 1O3TA 1BC7C 2ME6A 4NQWA 2P6TA 3A0HC 3FKJA 3HC7A 4IHWA 2JTVA 2Y0SA 3O3KA 4UB6C 4LIVA 3P9IA 1WSUA 1Z05A 4XRSG 3BDDA 2FBKA 1U8BA 1ORKA 4KJZA 4M3EA 4RM3A 3KETA 2R3SA 3VDXA 2QGUA 4KN7X 4LJZF 2P4WA 2ZNZA 3U2RA 2DT7B 4EJTA 2EK5A 2DOEA 3Q0VA 1HW5A 4II2A 5F0FA 5GTIC 2OV7A 2ZSIB 2X4HA 2HOTA 5B1AH 5JLWA 1H9TA 1F5TA 2RV8A 1MBJA 3DKXA 1QBJA 4IHYA 4OMZA 4R1HA 2LBFA 1ZKGA 3HB9A 3S17J 3LSMA 5IOYA 5DM6F 3S15J 3FMSA 2NVTJ 2QWWA 5B1BH 5A2QZ 2Y31A 5DM7F 2CV2A 1FOKA 3MFKA 3ZMVA 2GXBA 2XGEA 1TBXA 2NVQJ 4HDVA 2PMUA 4HNVA 3IWZA 4BY7J 4ENMA 2A68F 1IG7A 2DN0A 4L5EA 3R61A 1ZR2A 4N9HA 5F08A 1R6RA 2X85A 2ETHA 5EEAA 5JR3A 1N75A 1X3ZB 4BGDA 2VT3A 4PGHA 3F8NA 4P5OA 3M7GA 3QPHA 2K27A 4MO7A 3D5LA 1DDNA 3RTRA 5DCMB 5L3BA 4D7NA 3K4MA 3CMEI 4UXNA 2B9SA 3JRIA 1T0FC 2XPVA 1LFBA 2XAHA 1S6LA 1BC8C 1ZTRA 3N4MA 2DODA 4QIWN 2IA2A 2M8GX 2K4BA 2XGCA 4AU7A 1DGRM 1OR7A 4RB0A 3MMYB 3EYYA 3LQQA 2IBDA 2E2HJ 3RI4A 1VQ4I 4A93J 5ERIA 4ESBA 3JCUC 3K6GA 1F1ZA 5LHGA 1IV8A 3O2PE 2X6XA 5EG0B 4Y13A 2OA4A 3DV8A 2KKOA 2V4JC 1UB9A 3DEEA 1G2HA 4R8HA 2R7XA 3BWGA 2P7VB 2AXTC 2ESHA 4FE4A 2W00A 2O3FA 4XLHA 3HG9A 1J09A 2KISA 4JK1X 3CCQI 3MAJA 4XOPA 5IP9J 1B8IA 4RAZA 1XX5A 1RZ4A 4GYIA 2JK3A 3OOUA 5J8CA 1MD0A 2TRTA 2ZMEA 3I59B 3LL7A 3RYRA 5FLMJ 3HOSA 1WKMA 2L01A 1U8RA 2LG4A 2DT5A 1R1TA 1BJAA 4UUTA 1Z1DA 2ELJA 3C1DA 2EZKA 2JRMA 2RNJA 3K2AA 2E1MC 1ODDA 3SDBA 2UV1A 1R5ID 5EEHA 3J80K 1MMSA 1TLHB 4XONA 5D6EA 2A5YB 1YW7A 4AC0A 2EJRA 1SD7A 2WADA 1PVEA 5FKLA 1Y6IA 3GTQJ 1HXDA 3BP8A 2FQ4A 3TW7A 1JUSA 3LAJA 2RN7A 3AG1H 2L02A 4LLNA 3RZOJ 5HS8A 1G3WA 4KNYA 2VODA 2NS0A 3MCZA 2DPUA 2ZXWH 1GV2A 4Y17A 4XOTA 1ZYRF 1E3PA 1WRJA 2E60A 3RZDJ 3TDUC 1IRZA 3LSJA 3FXJA 1W1WE 4QSHA 1J59A 4RA2A 4P1WA 3OIQA 3T1BA 3B6AA 4YRVA 4RAYA 1GHCA 2VBYA 4CYDA 2GLOA 2I10A 3U1DA 2VE8A 4O6JA 5DEQA 4WWCA 3SYTA 4A3MJ 1ZG5A 1HKSA 1IGNA 1M1EB 5LBQA 3DKYA 2CQQA 3UR3C 5E3NA 3D0SA 3BZKA 2KIUA 2LNBA 4XBFA 1FZPB 1SFXA 2L9SA 5JVGF 2L54A 3D5RC 3CJTB 4XLEA 2H6CA 3GBGA 4A3CJ 5HLHA 1Z91A 1B1BA 3ZP5A 2AHQA 3KP3A 4BBRJ 4IQ4A 3SEQA 1HCRA 4E7HA 1VQ7I 1N25A 5HDNA 3GCMA 5E1XA 4F92B 3DEWA 3WTTC 4XKCA 3HPGA 4Q4ZF 1HDDC 1ZQ3P 4CCLA 4F55A 4XKWA 3S1RJ 2OPTA 3GZNB 4PJMA 3OYKA 3I53A 2WB1A 4L9NA 2R5ZA 2COBA 1YTYA 4UV8A 2GIVA 2OQRA 4C3JJ 2R7RA 2VLAA 2PJRB 2M0CA 3GX4X 1OFCX 2FU4A 4KDPA 1QU3A 2JZYA 1HKQA 4CDGA 1DUXC 3HUGA 5CQEA 3BZCA 2M4GA 3RPQA 1XC5A 1Y1VJ 4U87A 3QAHA 2IGOA 1WJ5A 1FTTA 4ANJA 5K7ZA 2Q2EA 1IZ1A 2P5KA 3QRFF 3S3NA 2XVCA 4G7ZF 3T8RA 4CZCA 3FXKA 2G0EA 4A0XA 4Q5SF 3IC7A 4MEYF 5TJJA 5IT9K 4FX4A 4L9JA 2CWEA 4RGRA 1NK3P 1KQ9A 5D6FA 4EM0B 1GUUA 1R00A 4NHJA 2BVMA 1SD4A 1YS7A 2FOWA 4CH7A 2P6SA 5TRDA 2DFHA 5DV5A 1X2MA 3S8PA 2O61A 2KP6A 2KZVA 4RB3C 4IZZA 2HDDA 3FM5A 2I5UA 4II3A 2QVOA 4V2FA 5EJCA 5LHIA 3IUOA 4OAZA 3UKGA 1WH5A 1Z67A 3HM5A 3C18A 2WAFA 4BU2A 4MTDA 4L9VA 5JVTA 2MD5A 2UXNA 1QHGA 3NAUA 3A03A 3W6JB 4HDUA 4MNUA 1ENHA 2X0LA 3K4BA 5EEGA 4DNCA 2Y30A 3MWMA 3ZPLA 1POGA 2DMNA 1R5GA 2R7QA 3CTAA 4XN3A 1AKHB 2A6EF 3TP3A 1JJ8C 2QQAA 1D0ZA 4EGYA 1XGSA 1X4PA 4BXFA 1V5FA 4ASNA 4C30A 2FSWA 2R0QC 4HF2A 4LG0B 2AXLA 4QLCU 1GDTA 2E2JJ 2QSFX 3HEFA 1FOWA 1ULYA 3JRDA 4XRMA 1LE8A 2GIZA 3PFIA 3WHCA 4ENKA 1T56A 4HV5A 3FISA 4UVCA 3L00A 1JE8A 4UUVA 1P92A 1S72I 3AAFA 1U9OA 3LA7A 2HI3A 3ZQCA 2F48A 5FKNA 3DXJF 4BJTA 3J7YJ 2XDVA 3RIRA 1D1BA 4G94A 5BPIA 1E0EA 2K3PA 4QPOA 4D5FA 1IUFA 2LYCA 5EZGA 2VKHA 3I54A 2IAIA 4LLGF 3CF5F 4CYCA 1RESA 3FX3A 3H35A 3ESWB 4M3BA 1GVDA 4I01A 2HPIA 2OCCH 2L0KA 2OBPA 3BG3A 1SC7A 1MDMA 1AA7A 5K5OA 2BY0A 4Y4RA 3BTCA 4A3BJ 1TTYA 3K4KA 3M8FA 3CD6I 2H8WA 3IH4A 2LREA 1W4MA 2W48A 4DIQA 4C9YA 3DLAA 2RDPA 3LSGA 4D9JA 5E18F 1H89C 5FRNA 2JUCA 3M8EA 5IYCJ 5JHUA 1OR7C 3SFZA 4BAYA 5IT3A 5H2FC 3ZQQA 5FROA 2HQAA 1LPQA 1OYWA 4HV6A 2F4MB 3S2HJ 5CVJA 4UNOA 3RYPA 2ID6A 3V8JA 1MMAA 1SVMA 5DUIA 2HVRA 3J81Z 3E3VA 1AWCA 1SFEA 1X1PA 4Y52J 1FWZA 4AUXA 2E7XA 2NVXJ 4YFXF 4OIRF 1X3WB 2XPWA 1H0MA 3OS0A 1R1UA 4BHPA 3F0CA 4H4KC 2GXAA 2N8GA 1K61A 2K02A 2K5CA 3DBHB 2PMZA 1X3UA 4DYQA 3FMRA 2EQRA 3CQZJ 2LSOA 3L7WA 1EF4A 1B9MA 3ABTA 2XB0X 4PUSA 4Q48A 1A6IA 1HKTA 5E3MA 3TO7A 3KFWX 4ESFA 2JN6A 3G73A 3BT9A 2HZTA 1IXCA 1P7IA 2HZDA 4AYBA 4HNUA 2F2EA 5FD6A 1D0XA 3GYHX 3G1OA 3IH3A 1HF0A 1J7KA 3LSPA 5IPAA 3K70D 1OLTA 2DOAA 1WHUA 2LD5A 4CCKA 2R7UA 2G7UA 4GO1A 4FCYA 4B1RA 5E3OA 1T33A 1QZEA 2A61A 1U9NA 1WI3A 2EZLA 1UG0A 3SZTA 3FXLA 2E36A 4XRFA 3GTLJ 2BW3A 2VXDA 4A3IJ 4ABZA 5IYDJ 3OYJA 1V5EA 1QNTA 2LRDA 2QBYA 1DGWY 1A36A 2NYXA 3FIWA 4NUBA 3CDIA 3FXQA 2HPMA 3LSKA 2I8DA 4KISA 3KYCB 4ZH4F 5L3GA 2JA2A 2XSDC 4N9IA 4C3IJ 2DK5A 2ICWG 2LFBA 1XN7A 4RGXA 1XMAA 2X1EA 4BDYA 1W0TA 3F9KA 2OJED 4W1UA 4UUSA 4G6TB 5HS7A 4G6QA 2OAZA 1LDKB 4BNCA 1MMDA 3I4PA 2D2WA 2JWTA 1FP1D 4DYCA 3OIPA 1DPRA 2IGMA 3SDGA 5D5UB 3RQ4A 3OYAA 3DTKA 4LK1F 3ZMTA 1JUPA 5EZHA 3NWSA 4Y7NJ 1TWCJ 5ILUA 3AL0B 1I27A 3ECOA 2ELKA 3JRHA 4M9ZA 4H0EA 4RLQA 3GTPJ 1XMKA 1ON2A 1WI9A 2K3FA 1G3SA 4A5NA 1K4SA 5BPDA 3OR1C 3KPHA 3TBIA 2M8EA 3WODF 3D5SC 3F72A 1B72B 1K6YA 4DBQA 2WY7Q 5LGNA 1X1BA 3VYRB 1LUJB 4KYWA 2CQNA 3TQNA 2STWA 1XS9A 2K4JA 2QKLB 1SAUA 5GTHC 3CMAI 2EFPA 2LKXA 3DQVC 4IRHA 3H9GA 2EB7A 3DCFA 3TDZC 3DTEA 3PNTA 3K4CA 1PP7U 1HA8A 2HXOA 4XSZF 4GXOA 1ZR4A 1UG2A 3PJRA 1U5TB 5D8KB 1FJLA 2QM3A 2VQCA 1ZELA 3LA2A 5FLXZ 3M3YJ 5DYMA 4OMYA 3H92A 1R49A 4NNJA 2K7LA 4M72A 2DFFA 2WY8Q 5E8GA 1O3SA 5FKOA 3LSHA 2WTEA 1FNNA 5CVRA 2HKXA 3ZN1A 1AHDP 2VBWA 2YU3A 2L2OA 4Y15A 1E3HA 1Z7UA 3WTUC 2VASA 4FT8A 1UHSA 3CJNA 3LFKA 4WXHA 1F9NA 5F64A 4E6KG 3KLNA 5CPRB 2ZXIA 3K4JA 2X1CA 4WX9A 5IP6A 5LHHA 2HNHA 1X2NA 1QVUA 3O8HA 1U2WA 2TDXA 3BQYA 2IXSA 3F23A 2A6HF 2BHZA 3SZPA 3WTXC 3ZOBA 2HVSA 1WWXA 3I58A 4BQOA 3HL2A 2E1CA 1SFUA 4CGZA 1V54H 4CA0A 3F22A 2FMYA 1SANA 1ZG3A 4AD9A 5C44J 2Q1ZB 4FHTA 2XF6A 2EFOA 2GA1A 2DW4A 1VQMI 3G3ZA 3CCMI 1SVLA 3PFYA 1SAXA 3HDDA 2VB6A 1W7PB 1D8JA 3IAM2 3P7NA 2PJPA 2V1UA 1S7AA 2VIXA 2M1BA 4M3GA 1IRFA 1OYIA 5H6QA 2AO9A 1KZHA 4WK8F 3ABKH 4IRIA 3SXYA 1QQIA 5J3LA 3BJ6A 2LKPA 1BJZA 4I76A 3ZMZA 3PIPF 3GFIA 3CP2A 5LRSA 1KGSA 5F04A 1U6GA 3U1KA 3FBNB 2LOOA 3Q5FA 5FO5A 3BOQA 4JX6A 5GPAA 5LFAA 3ZR8X 4CCNA 2EZIA 2O5RA 1P6RA 2KDOA 3WU0A 1ETKA 2IP2A 1CF7A 3HOVJ 2YR2A 5F1JA 1ACIA 1HOMA 2PX9A 4ZJZA 2KMUA 5IY5H 4A3LJ 1SFKA 3DPUA 1IN5A 4NB5A 2OUMA 2H27A 1YJ9I 4D0PA 2MBFA 4IF4A 2R4GA 1K78B 5HS9A 4XLFA 3B73A 1R71A 2KJBA 1LVAA 3QQAA 5CVVA 2ZSHB 2IEKA 4HBLA 2PI0A 4XLAA 1H9GA 2M4KA 1D1CA 1H8AC 2VJ4A 3CCSI 2VJIA 1ZRDA 2YUSA 2R93J 3ZXSA 2F4OB 5A2QK 2CG4A 2QF7A 1MZBA 1S5LC 3EETA 3Q9SA 2EIMH 2HOSA 1I1SA 2V9PA 3S1NJ 4X6AJ 1QO0D 9ANTA 1ETYA 1XCBA 3H0DA 2CW7A 5E79C 2QSGX 1KQ8A 2DT6A 2VBXA 2XGXA 4AWXB 2PG4A 2FMLA 3FXRA 1FBQA 1OCOH 3WG7H 3DP7A 3T5XA 2DI3A 2KIMA 3JREA 5GPCA 3LQRA 2W7NA 3TKYA 1XMXA 2ZBKA 3BTJA 4MFEA 3ZN0A 4GDFA 2X6WA 1V5GA 4MQ9F 3H9QA 3K69A 2WV0A 2EIJH 2DCEA 3HOZJ 4ZYGA 3S93A 3N97A 4CCJA 4KMFA 1Y1WJ 1QPIA 4IVNA 3MVPA 1I50J 2A05A 2IRFG 4RMNA 4R79A 1UZCA 3LSIA 1I3AA 1LB2A 1OJLA 3RQIA 2HGCA 2ISYA 5GAGJ 2GXGA 3GW2A 1IN7A 5GAEJ 5K7FA 4L5JA 3CCVI 2UWMA 1YITI 1ZAOA 3RDIA 3OWTA 2E71A 2L7KA 4N0BA 1T95A 3OYGA 2K40A 1NH3A 4CCMA 1BA5A 4DW6A 4ZTFA 4YELA 2DTRA 1JHFA 1Z7LA 1VTNC 2EFWA 2DA5A 2XRLA 2JPBA 2HDCA 4B3XA 1WJFA 1YOVB 2XIGA 1ZGJA 3Q9VA 4BDZA 3IHUA 2PEXA 2L7MP 4XL9A 2ME0A 1LJ9A 3CUQC 3E97A 2BZTA 1PUFA 2DJNA 3QP5A 2M30A 4Y33A 3HRTA 3G71I 1RR7A 2YX7A 5EDNA 1OMIA 4W97A 1RUOA 1YX5A 1VNDA 2W25A 1IC8A 4EQQA 1P2FA 3I5UA 1A35A 4I6ZA 1QA6A 1B59A 5TGTA 3RKWA 2PBIA 3CDHA 1LFPA 2IJLA 1YO5C 2R92J 1U3EM 4XLPF 3ECHA 1B6AA 4OAYA 2BGCA 4ZYHA 1BBYA 4XORA 3VYTB 3LNQA 1FYLA 3ZMUA 2DDAA 3S2DJ 1ONVA 5C4XJ 1KQ0A 2KRFA 3REOA 2V9VA 4XR6A 4AVZA 2GQQA 3H5RA 1WFXA 3ML6A 3E6CC 1JT6A 3GFLA 3HIFA 2V26A 4J19A 3TOBA 4AIHA 1X1CA 4BS9A 3IL2A 2XAQA 1YI2I 4CICA 5DUKA 4IPAA 4P9UA 2E5NA 2ELHA 2BOLA 5HLGA 1BI1A 1IN4A 2HFHA 3OYLA 1L3LA 4PZJA 4HX8A 2IS6A 3H5NA 1ETXA 2KL4A 3F8FA 5DCFA 2EA2A 3ABUA 3RCOA 3BROA 2W82A 2QENA 2KLOA 2FUG2 3WE3A 3WGGA 4NQWB 5BOXA 3WTWC 4PFPA 3BY6A 5IYBJ 4RAFA 3KP2A 4A0YA 2F6CA 4RB1A 2MH9A 4X0GA 1XDSA 4JX5A 4U7DA 4ZYEA 2XPUA 1FSHA 3ONQA 3VB2A 2CQXA 2J5OA 3W2WA 2CUEA 2E1OA 2DA1A 2W4SA 2VI6A 4P55A 2R7WA 1Z6RA 2JA8J 1UFMA 1ZRFA 4PJNA 2LBFB 4A5MA 2NXNB 2NNNA 1VQPI 1JTYA 3HPHA 5BNGA 1BOBA 1TWGJ 3MEXA 3QOEA 3ROUA 2P7CB 2XV4S 1BI2A 4PK4A 3K7AJ 1S7OA 1XTAA 2JMWA 4X1EA 2NOGA 2FOKA 3HKZA 4LLLA 4BE1A 1KU3A 5LGTA 3W6KB 1Y8QB 1G6NA 5GADJ 4E7JA 3JW4A 4PJJA 1MBKA 4M6VA 2JA7J 3MQ0A 1Y8RB 3A4CA 3PSIA 5EGOB 4JX4A 4ZDOA 1I5ZA 1DU0A 3QYEA 5F0CA 1BOAA 1VI0A 1BI3A 1HSJA 5KK1A 3E5XA 3M9AA 1G3YA 5ILVA 2B7EA 1TW2A 1KA8A 2IA1A 2ZJRF 1BM9A 3QU6A 3AG2H 5JLXA 2V1NA 4EM1A 2CO5A 3PUFA 2EBIA 3IRRA 5FB2A 4E7ZA 3R0AA 1STZA 2AQEA 3L2CA 4GGGA 3K2ZA 4I0AA 1Z3XA 1TNSA 2XAGA 2JUGA 3OL3A 5LEKA 1N78A 2VE9A 1ZGAA 4HSRA 1K83J 1CGPA 1K6OA 2KT0A 3DEUA 2IGKA 3CUOA 1GXQA 1ZG1A 2XASA 2VPLA 2CFXA 1JTXA 4I99C 1PYVA 1MBFA 3KLOA 4OIQF 4WXCA 1T39A 1J5YA 3BLYA 3WE2A 4O3MA 2GA2A 4YIFA 1TP4A 1BR2A 2GZWA 3BZ6A 1JHHA 2H09A 3NEUA 1TC3C 1XCVA 3V8LA 1NHAA 2P81A 3BR1A 1B8IB 1XGNA 2DAOA 3H9JA 3MN2A 4BEHB 1BI0A 1DP3A 4HOBA 2ZMEB 3OV8A 4C2UA 3HSRA 4A3JJ 2Y9YA 5HLIA 1SMYF 2Z2SB 1PUEE 1RKTA 2CQ7A 3FWEA 5F27A 3BC8A 2ZJ2A 1IRGA 4XLNF 4RS8A 5CLSA 4OINF 2XAJA 3HSEA 2JQ7A 4I09A 2M7BA 2R5YA 1P4WA 1TNTA 1U0JA 4AVPA 5F1RA 3QPSA 4XNFA 3GWZA 1FY7A 2ZO4A 2X51A 3IAS2 4B09A 3DWLE 1TQMA 3WU2C 3ASNH 4MTEA 4QWQA 3RPUD 5HVQC 1TL8A 3E0JB 4E7KA 2D5VA 1EV7A 2Y69H 4EJVA 3DPTA 3G1LA 3KE2A 3KIOA 2K9LA 3H3ZA 3ISPA 4PCQA 4OU0A 4AIJA 4BQNA 3L9FA 1YRNB 4XRSA 1R58A 1BR4A 3KP7A 1BR1A 3QPTA 1BW5A 3J7ZI 1JKPC 5KCMA 4BE2A 2ADUA 2M45A 5FFXA 3H0GJ 3QP6A 5FGMA 2WBMA 3QU3A 3VEPA 4RB2C 4BYYA 4I98B 2P5LC 3B6CA 3LMMA 2KIFA 3WHBA 4Z6YA 2H1KA 3JRGA 1APLC 4BXXJ 1ZN2A 2CH0A 2DQRA 4HAMA 4RAGA 4IXAA 3J81K 4V19K 4XKBA 3GVAA 5D8LB 3KZIC 3ULQB 4XLCA 1S3JA 1B4AA 1MIJA 3BG9A 4HQMA 1ZREA 1VQOI 2DK8A 1K4TA 4I02A 3KEOA 4IX7A 2A6TA 1D3YA 2V79A 3BPVA 2K9QA 3V7CA 3QYBA 1D5YA 2BBYA 3TP0A 1TW3A 2P8TA 4OIPF 4A0ZA 3OYCA 3GFMA 2O0YA 3MKZA 1JKRC 3K0LA 3E6MA 4Z2YA 1HQCA 2YPRA 4XKVA 3EUHC 2CUJA
chains in the Genus database with same CATH topology
1IN6A 2Z5UA 1FPQA 4IHSA 1RNLA 2VOPA 2A69F 4UHTA 2ZXJA 1FYKA 4WCGA 3HOTA 3GUDA 3KEQA 5L3EA 4ZZLA 1LNWA 2RGVA 3EYIA 4P96A 3BJOA 3HSFA 3WU1B 3WTSC 4U7BA 5KVRA 2FBHA 5ED4A 2VONA 4HLXA 3KP4A 3KP6A 1USTA 3LA3A 1D5VA 6PAXA 2HWVA 2J5PA 2COMA 3GEZA 2NRAC 3GLXA 1FSEA 2PQ8A 2JSCA 4KUMA 2XKOA 1RIOH 2BYVE 4YFNF 2W57A 1G4DA 4BH9A 3HHHA 3CUQA 2XUBA 4L9TA 4L0YB 2FXAA 1W7PD 4UVAA 2IPQX 1YW8A 2HTSA 2V1XA 3R4KA 4M71A 1SD5A 4I7HA 2F5CA 2LF7A 1QZZA 1K78A 4LFUA 4KT5C 2EV0A 1EH8A 5K1YA 2F5FA 2VBZA 2AS5F 4YFKF 2IA0A 1MDMB 1MJBA 4KICA 2FBIA 4M9XA 2XHKA 5FLXK 4PGGA 4M6XA 1MGTA 4TV7A 3KZYA 3C7JA 3GZ6A 1OPCA 4OOIA 2ESNA 1SMTA 2RC4A 4S05A 3HYIA 1BN5A 4L0ZB 1R1VA 4O5VA 1G3TA 3P9CA 4BXUA 5DCMA 1WQ2A 3HHGA 2CYYA 4A6DA 2D1VA 1YG2A 4EM2A 4BHCA 3T8TA 1ZRCA 1IF1A 1S8NA 4L18B 5L3CA 2Y48A 3HTUA 3RKXA 4HLYA 1FX7A 2MA3A 1XGOA 1W5SA 3F21A 5HOOA 4ZZDA 3KCCA 1ZH5A 3GF2A 2CQKA 2DU9A 4IHTA 4HX7A 3V8KA 5L3FA 4OIOF 2QYOA 4U88A 3S2WA 2A07F 4EGZA 1R23A 1KYZA 2ZFWA 3I59A 1V3FA 4XSXF 4G7OF 1EH7A 2EWNA 4EJOA 3IWFA 1J75A 5CVIA 1O3RA 2IVMA 4A12A 1UHMA 3I71A 4U0VA 5E17F 2YSRA 3ZMSA 3MZYA 4KIFA 2DPDA 4KIGA 3E6BA 1FYMA 1FP2A 3JAMZ 4F7ZA 4KIBA 3MZHA 1HBXG 1YW9A 3BJAA 5D5VB 1U5TC 3DF8A 4HZFA 5CYVA 5ILSA 1O3QA 1RI7A 3FXUA 1YLFA 2OZ6A 5DDGA 3VFZA 4G9YA 1KU2A 1KU7A 3P9KA 5D4RA 4LB5A 3FMQA 1XDUA 3SQNA 3IKVA 1O7LA 4A6EA 5HDKA 5ICGA 1O57A 1I6XA 2A3SA 1OKRA 2HS5A 3TOAA 1S29A 1T2KA 1ON1A 3HRMA 4KFCA 2IW5A 3V4GA 1J0RA 3F3XA 1QPMA 1R7JA 3WG9A 3O6BB 5CVUA 4CO8A 4ETSA 3FM3A 1UCRA 5E8IA 2Y75A 5E20A 1P4XA 2C6YA 2FRHA 2FF4A 2ZCWA 4I0BA 4FX0A 4KN4X 4ESJA 1YQAA 2DQLA 4HYEA 1Z6TA 1EH6A 2GAUA 4HF1A 3FHZA 4A2UA 3EUHA 2VOOA 2Z99A 3VODA 4LMYA 2FQ3A 4Q47A 2MLKA 2L4AA 3ERED 4HX4A 2O8XA 3GO5A 2JRTA 2BEOA 3IRQA 1Q1HA 2PFBA 3GZ5A 1J9IA 1REPC 2V6CA 4MHGA 1FT9A 2F5DA 1P4AA 4LK0F 5DD8A 5L3DA 4GCVA 2MC3A 4LG0A 1T6SA 3WGIA 1IN8A 3JTHA 4ON0A 3R0JA 1PP8F 4I2OA 1CF7B 1MKMA 4HF0A 1KU9A 1I1GA 1L0OC 1IAWA 4RGUA 1R22A 5FD5A 4YIIA 4HQEA 3J80Z 5ICFA 1O7FA 2EV5A 2OZUA 2XKPA 2R7FA 3JSOA 3IKTA 3I64A 4BHBA 3VOEA 4HA8A 2STTA 1FBUA 3QOPA 3WTZA 3JSPA 1TQIA 3FF5A 3K1PA 2JT1A 3V7SA 1IUYA 2P5VA 2Q8KA 4EJUA 2XROA 4G8XA 5JI6A 5DD4A 5FFZA 3EDPA 3PQKA 3ZMDA 5HDGA 2H6BA 2EV6A 3HTSB 4M73A 2HYGD 1ZLKA 2L3DA 3RJPA 1FLIA 2JPCA 3T0YA 5BMZA 3C3WA 2FNAA 1QGPA 1HW1A 1JGSA 2QQ9A 2HKOA 2FA5A 2BE5F 5ICEA 2Z9OA 2GWRA 4U0YA 3NRVA 2V1DA 1E2XA 4UVBA 3ELKA 3KP5A 1ZLJA 2FNPA 2F5EA 1DPUA 5IT9Z 3CLOA 2QQBA 3M1EA 4IJAA 2CGPA 2CW0F 2XRNA 4AIKA 3RPUA 3F6VA 1BIAA 4EJWA 2PMHA 3HRUA 4PDKA 1GVJA 1LDJA 2XAFA 3OOPA 1HW2A 1MJAA 2MLGA 2EA4A 3NQOA 1USSA 2EFQA 2Y0MA 4M6YA 1U78A 3TO6A 4ENNA 4MEXF 3F8MA 2L4MA 1Z9CA 4E70A 2W24A 2H94A 3K1MA 3SHFA 3FZVA 4ENJA 5D5WB 4UV9A 2NAZA 2PLYA 2OU2A 2HR3A 2O03A 4CZZA 2D45A 4JBAA 1B9NA 4YG2F 4EVIA 2K86A 1U5TA 3DFGA 2HQRA 2O6GE 4P9FA 2DO7A 4M9SA 3R60A 1XB4A 3WTVC 4BQAA 1F4KA 1LDDA 2YX4A 3F6OA 1DP7P 1MJ9A 1TQPA 4K2EA 3EQLF 1LQ1A 3L09A 5BQTA 5K5RA 2DBBA 4LB6B 1RUNA 2W84A 2HYFA 5F6FA 2RVCA 1ZHFA 3COAC 2UXXA 2ACJA 4B8XA 2Q0OA 3ZQ7A 3CO6C 1K7AA 2HEOA 5LGUA 4CHUA 1SD6A 1W7PA 3F8CA 2VN2A 3BPXA 3DPLC 3LSTA 1YFHA 3K1NA 2B0LA 2E1NA 2RKHA 3KZZA 1V4RA 2QUFA 2EFNA 1T0FA 2BV6A 3LAPA 3B02A 2FE3A 1T98A 2VT2A 5ICCA 2FEZA 2R7DA 3E5UA 4EV0A 4KMUX 4LD5A 3WGHA 4GYGA 1XD7A 4G7HF 2G9WA 5H20A 1W5TA 3WTYC 2D1HA 2RQPA 5AIQA 4G6DA 2G7HA 4HW0A 2IT0A 5K5QA 2ZNYA 2ZKZA 1R36A 3R6SA 5E1WA 4RGSA 1OYYA 1T38A 1A04A 2MH2A 3TGNA 1ZARA 2Z33A 2VC0A 4KA4A 1E17A 3J7AO 5J6XA 5J8FA 1XSXA 2VC1A 3K9TA 1UHWA 5CJ9A 1YYVA 2VXZA 3I0TA 1XSDA 1XSVA 3LWFA 1KYWA 2W85A 4DQ2A 4MGRA 3TO9A 3RKYA 2CSOA 2ISZA 1J2XA 1GXPA 4WF2A 4M74A 2M87A 5BS6A 4CXFA 5D5XB 2M5WA 4ZYDA 2UZKA 2OD5A 1HSTA 2KJCA 1BIBA 1YIOA 1LEAA 3PQJA 3E5QA 3JTGA 1YS6A 3CO7C 5AONA 2DLLA 1FBSA 3H3UA 2HTJA 4MQVA 1D8KA 1AOYA 4U0WA 2E7WA 2NNYA 1QZYA 1XGMA 4JQFA 2PN6A 5AIPA 3GFJA 3V7RA 2QBYB 4IRGA 1Y0UA 1FC3A 5LRRA 5H6RA 5JFRA 4WXDA 5LEJA 4LGWA 3E6DA 5E1ZB 3GXOA 4L5IA 3JAMK 1C0WA 3HRSA 3DKWA 2LDUA 2HQNA 3F8BA 5LLQA 3CUQB 2DFIA 2QLZA 1PDNC 1IXSB 1JXSA 2Z3YA 2HOEA 2WWYA 4S04A 1IXRC 1R5HA 1IW7F 2WC2A 2OQGA 1LEBA 1K79A 5D4SA 2QZ8A 3U9GA 4EMSA 2LF8A 1O3TA 1BC7C 4NQWA 2P6TA 2JTVA 3O3KA 3P9IA 1WSUA 1Z05A 3BDDA 2FBKA 3KETA 2R3SA 4KN7X 4LJZF 2P4WA 2ZNZA 3U2RA 4EJTA 2EK5A 1HW5A 2X4HA 1H9TA 1F5TA 2RV8A 1QBJA 4OMZA 4R1HA 3FMSA 2QWWA 5A2QZ 1FOKA 3MFKA 3ZMVA 2GXBA 1TBXA 4HDVA 2PMUA 4ENMA 3IWZA 2A68F 3R61A 4N9HA 2ETHA 5JR3A 2VT3A 4PGHA 3F8NA 4P5OA 3M7GA 3QPHA 2K27A 3D5LA 1DDNA 3RTRA 5DCMB 5L3BA 4UXNA 2XAHA 1S6LA 1BC8C 3N4MA 2IA2A 2K4BA 1OR7A 4RB0A 3EYYA 3LQQA 3RI4A 5ERIA 4ESBA 1F1ZA 5LHGA 3O2PE 4Y13A 2OA4A 3DV8A 2KKOA 1UB9A 4R8HA 3BWGA 2P7VB 2ESHA 2O3FA 4JK1X 3MAJA 4RAZA 1RZ4A 4GYIA 5J8CA 1MD0A 3I59B 2ZMEA 3RYRA 3HOSA 1U8RA 1WKMA 2L01A 2DT5A 1R1TA 1BJAA 1Z1DA 3C1DA 2RNJA 1ODDA 5EEHA 3J80K 1TLHB 5D6EA 2A5YB 1YW7A 2EJRA 1SD7A 1HXDA 3BP8A 3LAJA 2RN7A 2L02A 4LLNA 5HS8A 1G3WA 4KNYA 2VODA 2NS0A 3MCZA 2DPUA 4Y17A 1ZYRF 1WRJA 3TDUC 1J59A 3T1BA 4RAYA 1GHCA 2VBYA 4CYDA 3U1DA 1ZG5A 2VE8A 4O6JA 5DEQA 4WWCA 1HKSA 5LBQA 3D0SA 2KIUA 2LNBA 4XBFA 1FZPB 1SFXA 2L54A 2H6CA 5HLHA 1Z91A 1B1BA 3ZP5A 3KP3A 5HDNA 5E1XA 3WTTC 4Q4ZF 3I53A 4L9NA 1YTYA 4UV8A 2GIVA 2OQRA 3GX4X 2FU4A 4KDPA 2JZYA 1HKQA 4CDGA 1DUXC 3HUGA 3RPQA 3QAHA 2Q2EA 1IZ1A 2P5KA 3QRFF 2XVCA 4G7ZF 3T8RA 4A0XA 4Q5SF 3IC7A 4MEYF 5TJJA 5IT9K 4FX4A 4L9JA 2CWEA 4RGRA 1KQ9A 5D6FA 4EM0B 1R00A 4NHJA 1SD4A 1YS7A 5TRDA 2P6SA 5DV5A 2O61A 4RB3C 3FM5A 2QVOA 5LHIA 3C18A 4MTDA 4L9VA 5JVTA 2MD5A 2UXNA 3W6JB 4HDUA 4MNUA 2X0LA 5EEGA 4DNCA 3MWMA 3ZPLA 1R5GA 3CTAA 2A6EF 2QQAA 4EGYA 1XGSA 4ASNA 4HF2A 2FSWA 4LG0B 2AXLA 4QLCU 1ULYA 3PFIA 4ENKA 4HV5A 4UVCA 3L00A 1JE8A 4UUVA 1P92A 3AAFA 3LA7A 3DXJF 3RIRA 4G94A 5BPIA 3I54A 4LLGF 3FX3A 4I01A 2OBPA 1MDMA 5K5OA 1TTYA 3M8FA 1W4MA 2RDPA 5E18F 3M8EA 5JHUA 3SFZA 4BAYA 5IT3A 1OYWA 4HV6A 5CVJA 4UNOA 3RYPA 3V8JA 5DUIA 3J81Z 3E3VA 1AWCA 1SFEA 1FWZA 2E7XA 4YFXF 4OIRF 1H0MA 1R1UA 4BHPA 2K02A 1X3UA 3FMRA 2LSOA 3L7WA 1B9MA 3ABTA 4Q48A 1HKTA 3TO7A 3KFWX 4ESFA 3G73A 2HZTA 1IXCA 2F2EA 5FD6A 3GYHX 1J7KA 2G7UA 4GO1A 2A61A 3SZTA 4XRFA 1QNTA 2QBYA 2NYXA 3FXQA 4ZH4F 5L3GA 4N9IA 2DK5A 1XN7A 4RGXA 1XMAA 5HS7A 4G6QA 2OAZA 1LDKB 4BNCA 3I4PA 2D2WA 1FP1D 1DPRA 5D5UB 4LK1F 3ZMTA 5ILUA 1I27A 3ECOA 4M9ZA 4H0EA 1XMKA 1ON2A 1WI9A 1G3SA 4A5NA 5BPDA 2M8EA 3WODF 3F72A 5LGNA 4KYWA 3TQNA 2STWA 2K4JA 2EFPA 3DQVC 4IRHA 2EB7A 3TDZC 1PP7U 4XSZF 4GXOA 1U5TB 5D8KB 2QM3A 5FLXZ 3LA2A 5DYMA 4OMYA 3H92A 2K7LA 4M72A 1O3SA 5E8GA 2WTEA 1FNNA 5CVRA 2HKXA 3ZN1A 2VBWA 2YU3A 4Y15A 1Z7UA 3WTUC 5F64A 4FT8A 3CJNA 3LFKA 4WXHA 1F9NA 3KLNA 4WX9A 5LHHA 1U2WA 2TDXA 3F23A 2A6HF 3SZPA 3WTXC 1WWXA 3I58A 2E1CA 1SFUA 4CGZA 3F22A 2FMYA 1ZG3A 4AD9A 4FHTA 2EFOA 2GA1A 2DW4A 3G3ZA 1SAXA 1W7PB 1D8JA 3P7NA 2PJPA 2V1UA 1S7AA 2M1BA 1IRFA 1OYIA 5H6QA 4WK8F 4IRIA 3SXYA 1QQIA 3BJ6A 2LKPA 3GFIA 3ZMZA 5LRSA 1KGSA 1U6GA 3Q5FA 5FO5A 3BOQA 1P6RA 3WU0A 2IP2A 1CF7A 2YR2A 1IN5A 4NB5A 2H27A 4D0PA 2MBFA 4IF4A 1K78B 5HS9A 3B73A 2KJBA 1LVAA 5CVVA 2PI0A 4HBLA 1H9GA 1ZRDA 5A2QK 2CG4A 1MZBA 3EETA 3Q9SA 1I1SA 1QO0D 1XCBA 1KQ8A 2VBXA 2XGXA 4AWXB 2PG4A 2FMLA 3FXRA 1FBQA 3DP7A 3T5XA 2DI3A 2KIMA 3LQRA 3TKYA 3ZN0A 2ZBKA 4MQ9F 3K69A 2WV0A 4ZYGA 3N97A 4KMFA 4IVNA 2IRFG 4R79A 1LB2A 2HGCA 2ISYA 2GXGA 3GW2A 1IN7A 4L5JA 2UWMA 1ZAOA 3RDIA 4N0BA 2DTRA 1JHFA 1VTNC 2EFWA 2JPBA 2HDCA 2XIGA 1ZGJA 3Q9VA 3IHUA 2PEXA 1LJ9A 3CUQC 3E97A 3QP5A 2M30A 3HRTA 2YX7A 1OMIA 1RUOA 2W25A 4EQQA 1P2FA 3I5UA 1B59A 3RKWA 2PBIA 3CDHA 2IJLA 1YO5C 1U3EM 4XLPF 3ECHA 1B6AA 2BGCA 4ZYHA 1BBYA 1FYLA 3ZMUA 1ONVA 1KQ0A 2KRFA 3REOA 2V9VA 2GQQA 3ML6A 3E6CC 3GFLA 3HIFA 3TOBA 4AIHA 3IL2A 2XAQA 4CICA 5DUKA 4IPAA 4P9UA 2ELHA 5HLGA 1BI1A 1IN4A 2HFHA 1L3LA 4PZJA 4HX8A 3F8FA 5DCFA 2EA2A 3ABUA 3BROA 2QENA 3WE3A 3WGGA 5BOXA 3WTWC 3BY6A 3KP2A 4A0YA 4RB1A 2MH9A 1XDSA 4U7DA 4ZYEA 1FSHA 3VB2A 2J5OA 4P55A 1Z6RA 1UFMA 1ZRFA 4A5MA 2NNNA 3MEXA 3ROUA 2P7CB 2XV4S 1BI2A 1S7OA 4LLLA 2FOKA 1KU3A 5LGTA 3W6KB 1G6NA 3JW4A 3MQ0A 1I5ZA 1BOAA 1BI3A 1HSJA 5KK1A 3E5XA 3M9AA 1G3YA 5ILVA 1TW2A 1KA8A 2IA1A 1BM9A 3QU6A 4EM1A 2CO5A 3IRRA 5FB2A 3R0AA 1STZA 3L2CA 4GGGA 3K2ZA 4I0AA 1TNSA 2XAGA 5LEKA 2VE9A 1ZGAA 1CGPA 1K6OA 3DEUA 3CUOA 1GXQA 1ZG1A 2XASA 2CFXA 4OIQF 3KLOA 4WXCA 1T39A 1J5YA 3WE2A 4O3MA 2GA2A 4YIFA 2GZWA 3BZ6A 1JHHA 2H09A 3NEUA 1XCVA 3V8LA 1NHAA 1XGNA 2DAOA 1BI0A 4HOBA 2ZMEB 3OV8A 3HSRA 5HLIA 1SMYF 1PUEE 3FWEA 2ZJ2A 1IRGA 4XLNF 4RS8A 5CLSA 4OINF 2XAJA 3HSEA 4I09A 1P4WA 1TNTA 5F1RA 4AVPA 3GWZA 1FY7A 2ZO4A 4B09A 1TQMA 4MTEA 4QWQA 5HVQC 1EV7A 4EJVA 3DPTA 3KE2A 3H3ZA 3ISPA 4PCQA 4OU0A 4AIJA 3L9FA 1R58A 3KP7A 3QPTA 2ADUA 2M45A 5FFXA 3QP6A 5FGMA 3VEPA 3QU3A 4RB2C 4BYYA 4I98B 2P5LC 2KIFA 1ZN2A 2DQRA 4HAMA 4IXAA 3J81K 3GVAA 5D8LB 3ULQB 1S3JA 1B4AA 1ZREA 4HQMA 2DK8A 4I02A 3KEOA 1D3YA 2V79A 3BPVA 3V7CA 2BBYA 1TW3A 2P8TA 4OIPF 4A0ZA 3GFMA 2O0YA 3K0LA 3E6MA 4Z2YA 1HQCA 2YPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IN6 A;  2Z5U A;  1FPQ A;  4IHS A;  1RNL A;  2VOP A;  2A69 F;  4UHT A;  2ZXJ A;  1FYK A;  4WCG A;  3HOT A;  3GUD A;  3KEQ A;  5L3E A;  4ZZL A;  1LNW A;  2RGV A;  3EYI A;  4P96 A;  3BJO A;  3HSF A;  3WU1 B;  3WTS C;  4U7B A;  5KVR A;  2FBH A;  5ED4 A;  2VON A;  4HLX A;  3KP4 A;  3KP6 A;  1UST A;  3LA3 A;  1D5V A;  6PAX A;  2HWV A;  2J5P A;  2COM A;  3GEZ A;  2NRA C;  3GLX A;  1FSE A;  2PQ8 A;  2JSC A;  4KUM A;  2XKO A;  1RIO H;  2BYV E;  4YFN F;  2W57 A;  1G4D A;  4BH9 A;  3HHH A;  3CUQ A;  2XUB A;  4L9T A;  4L0Y B;  2FXA A;  1W7P D;  4UVA A;  2IPQ X;  1YW8 A;  2HTS A;  2V1X A;  3R4K A;  4M71 A;  1SD5 A;  4I7H A;  2F5C A;  2LF7 A;  1QZZ A;  1K78 A;  4LFU A;  4KT5 C;  2EV0 A;  1EH8 A;  5K1Y A;  2F5F A;  2VBZ A;  2AS5 F;  4YFK F;  2IA0 A;  1MDM B;  1MJB A;  4KIC A;  2FBI A;  4M9X A;  2XHK A;  5FLX K;  4PGG A;  4M6X A;  1MGT A;  4TV7 A;  3KZY A;  3C7J A;  3GZ6 A;  1OPC A;  4OOI A;  2ESN A;  1SMT A;  2RC4 A;  4S05 A;  3HYI A;  1BN5 A;  4L0Z B;  1R1V A;  4O5V A;  1G3T A;  3P9C A;  4BXU A;  5DCM A;  1WQ2 A;  3HHG A;  2CYY A;  4A6D A;  2D1V A;  1YG2 A;  4EM2 A;  4BHC A;  3T8T A;  1ZRC A;  1IF1 A;  1S8N A;  4L18 B;  5L3C A;  2Y48 A;  3HTU A;  3RKX A;  4HLY A;  1FX7 A;  2MA3 A;  1XGO A;  1W5S A;  3F21 A;  5HOO A;  4ZZD A;  3KCC A;  1ZH5 A;  3GF2 A;  2CQK A;  2DU9 A;  4IHT A;  4HX7 A;  3V8K A;  5L3F A;  4OIO F;  2QYO A;  4U88 A;  3S2W A;  2A07 F;  4EGZ A;  1R23 A;  1KYZ A;  2ZFW A;  3I59 A;  1V3F A;  4XSX F;  4G7O F;  1EH7 A;  2EWN A;  4EJO A;  3IWF A;  1J75 A;  5CVI A;  1O3R A;  2IVM A;  4A12 A;  1UHM A;  3I71 A;  4U0V A;  5E17 F;  2YSR A;  3ZMS A;  3MZY A;  4KIF A;  2DPD A;  4KIG A;  3E6B A;  1FYM A;  1FP2 A;  3JAM Z;  4F7Z A;  4KIB A;  3MZH A;  1HBX G;  1YW9 A;  3BJA A;  5D5V B;  1U5T C;  3DF8 A;  4HZF A;  5CYV A;  5ILS A;  1O3Q A;  1RI7 A;  3FXU A;  1YLF A;  2OZ6 A;  5DDG A;  3VFZ A;  4G9Y A;  1KU2 A;  1KU7 A;  3P9K A;  5D4R A;  4LB5 A;  3FMQ A;  1XDU A;  3SQN A;  3IKV A;  1O7L A;  4A6E A;  5HDK A;  5ICG A;  1O57 A;  1I6X A;  2A3S A;  1OKR A;  2HS5 A;  3TOA A;  1S29 A;  1T2K A;  1ON1 A;  3HRM A;  4KFC A;  2IW5 A;  3V4G A;  1J0R A;  3F3X A;  1QPM A;  1R7J A;  3WG9 A;  3O6B B;  5CVU A;  4CO8 A;  4ETS A;  3FM3 A;  1UCR A;  5E8I A;  2Y75 A;  5E20 A;  1P4X A;  2C6Y A;  2FRH A;  2FF4 A;  2ZCW A;  4I0B A;  4FX0 A;  4KN4 X;  4ESJ A;  1YQA A;  2DQL A;  4HYE A;  1Z6T A;  1EH6 A;  2GAU A;  4HF1 A;  3FHZ A;  4A2U A;  3EUH A;  2VOO A;  2Z99 A;  3VOD A;  4LMY A;  2FQ3 A;  4Q47 A;  2MLK A;  2L4A A;  3ERE D;  4HX4 A;  2O8X A;  3GO5 A;  2JRT A;  2BEO A;  3IRQ A;  1Q1H A;  2PFB A;  3GZ5 A;  1J9I A;  1REP C;  2V6C A;  4MHG A;  1FT9 A;  2F5D A;  1P4A A;  4LK0 F;  5DD8 A;  5L3D A;  4GCV A;  2MC3 A;  4LG0 A;  1T6S A;  3WGI A;  1IN8 A;  3JTH A;  4ON0 A;  3R0J A;  1PP8 F;  4I2O A;  1CF7 B;  1MKM A;  4HF0 A;  1KU9 A;  1I1G A;  1L0O C;  1IAW A;  4RGU A;  1R22 A;  5FD5 A;  4YII A;  4HQE A;  3J80 Z;  5ICF A;  1O7F A;  2EV5 A;  2OZU A;  2XKP A;  2R7F A;  3JSO A;  3IKT A;  3I64 A;  4BHB A;  3VOE A;  4HA8 A;  2STT A;  1FBU A;  3QOP A;  3WTZ A;  3JSP A;  1TQI A;  3FF5 A;  3K1P A;  2JT1 A;  3V7S A;  1IUY A;  2P5V A;  2Q8K A;  4EJU A;  2XRO A;  4G8X A;  5JI6 A;  5DD4 A;  5FFZ A;  3EDP A;  3PQK A;  3ZMD A;  5HDG A;  2H6B A;  2EV6 A;  3HTS B;  4M73 A;  2HYG D;  1ZLK A;  2L3D A;  3RJP A;  1FLI A;  2JPC A;  3T0Y A;  5BMZ A;  3C3W A;  2FNA A;  1QGP A;  1HW1 A;  1JGS A;  2QQ9 A;  2HKO A;  2FA5 A;  2BE5 F;  5ICE A;  2Z9O A;  2GWR A;  4U0Y A;  3NRV A;  2V1D A;  1E2X A;  4UVB A;  3ELK A;  3KP5 A;  1ZLJ A;  2FNP A;  2F5E A;  1DPU A;  5IT9 Z;  3CLO A;  2QQB A;  3M1E A;  4IJA A;  2CGP A;  2CW0 F;  2XRN A;  4AIK A;  3RPU A;  3F6V A;  1BIA A;  4EJW A;  2PMH A;  3HRU A;  4PDK A;  1GVJ A;  1LDJ A;  2XAF A;  3OOP A;  1HW2 A;  1MJA A;  2MLG A;  2EA4 A;  3NQO A;  1USS A;  2EFQ A;  2Y0M A;  4M6Y A;  1U78 A;  3TO6 A;  4ENN A;  4MEX F;  3F8M A;  2L4M A;  1Z9C A;  4E70 A;  2W24 A;  2H94 A;  3K1M A;  3SHF A;  3FZV A;  4ENJ A;  5D5W B;  4UV9 A;  2NAZ A;  2PLY A;  2OU2 A;  2HR3 A;  2O03 A;  4CZZ A;  2D45 A;  4JBA A;  1B9N A;  4YG2 F;  4EVI A;  2K86 A;  1U5T A;  3DFG A;  2HQR A;  2O6G E;  4P9F A;  2DO7 A;  4M9S A;  3R60 A;  1XB4 A;  3WTV C;  4BQA A;  1F4K A;  1LDD A;  2YX4 A;  3F6O A;  1DP7 P;  1MJ9 A;  1TQP A;  4K2E A;  3EQL F;  1LQ1 A;  3L09 A;  5BQT A;  5K5R A;  2DBB A;  4LB6 B;  1RUN A;  2W84 A;  2HYF A;  5F6F A;  2RVC A;  1ZHF A;  3COA C;  2UXX A;  2ACJ A;  4B8X A;  2Q0O A;  3ZQ7 A;  3CO6 C;  1K7A A;  2HEO A;  5LGU A;  4CHU A;  1SD6 A;  1W7P A;  3F8C A;  2VN2 A;  3BPX A;  3DPL C;  3LST A;  1YFH A;  3K1N A;  2B0L A;  2E1N A;  2RKH A;  3KZZ A;  1V4R A;  2QUF A;  2EFN A;  1T0F A;  2BV6 A;  3LAP A;  3B02 A;  2FE3 A;  1T98 A;  2VT2 A;  5ICC A;  2FEZ A;  2R7D A;  3E5U A;  4EV0 A;  4KMU X;  4LD5 A;  3WGH A;  4GYG A;  1XD7 A;  4G7H F;  2G9W A;  5H20 A;  1W5T A;  3WTY C;  2D1H A;  2RQP A;  5AIQ A;  4G6D A;  2G7H A;  4HW0 A;  2IT0 A;  5K5Q A;  2ZNY A;  2ZKZ A;  1R36 A;  3R6S A;  5E1W A;  4RGS A;  1OYY A;  1T38 A;  1A04 A;  2MH2 A;  3TGN A;  1ZAR A;  2Z33 A;  2VC0 A;  4KA4 A;  1E17 A;  3J7A O;  5J6X A;  5J8F A;  1XSX A;  2VC1 A;  3K9T A;  1UHW A;  5CJ9 A;  1YYV A;  2VXZ A;  3I0T A;  1XSD A;  1XSV A;  3LWF A;  1KYW A;  2W85 A;  4DQ2 A;  4MGR A;  3TO9 A;  3RKY A;  2CSO A;  2ISZ A;  1J2X A;  1GXP A;  4WF2 A;  4M74 A;  2M87 A;  5BS6 A;  4CXF A;  5D5X B;  2M5W A;  4ZYD A;  2UZK A;  2OD5 A;  1HST A;  2KJC A;  1BIB A;  1YIO A;  1LEA A;  3PQJ A;  3E5Q A;  3JTG A;  1YS6 A;  3CO7 C;  5AON A;  2DLL A;  1FBS A;  3H3U A;  2HTJ A;  4MQV A;  1D8K A;  1AOY A;  4U0W A;  2E7W A;  2NNY A;  1QZY A;  1XGM A;  4JQF A;  2PN6 A;  5AIP A;  3GFJ A;  3V7R A;  2QBY B;  4IRG A;  1Y0U A;  1FC3 A;  5LRR A;  5H6R A;  5JFR A;  4WXD A;  5LEJ A;  4LGW A;  3E6D A;  5E1Z B;  3GXO A;  4L5I A;  3JAM K;  1C0W A;  3HRS A;  3DKW A;  2LDU A;  2HQN A;  3F8B A;  5LLQ A;  3CUQ B;  2DFI A;  2QLZ A;  1PDN C;  1IXS B;  1JXS A;  2Z3Y A;  2HOE A;  2WWY A;  4S04 A;  1IXR C;  1R5H A;  1IW7 F;  2WC2 A;  2OQG A;  1LEB A;  1K79 A;  5D4S A;  2QZ8 A;  3U9G A;  4EMS A;  2LF8 A;  1O3T A;  1BC7 C;  4NQW A;  2P6T A;  2JTV A;  3O3K A;  3P9I A;  1WSU A;  1Z05 A;  3BDD A;  2FBK A;  3KET A;  2R3S A;  4KN7 X;  4LJZ F;  2P4W A;  2ZNZ A;  3U2R A;  4EJT A;  2EK5 A;  1HW5 A;  2X4H A;  1H9T A;  1F5T A;  2RV8 A;  1QBJ A;  4OMZ A;  4R1H A;  3FMS A;  2QWW A;  5A2Q Z;  1FOK A;  3MFK A;  3ZMV A;  2GXB A;  1TBX A;  4HDV A;  2PMU A;  4ENM A;  3IWZ A;  2A68 F;  3R61 A;  4N9H A;  2ETH A;  5JR3 A;  2VT3 A;  4PGH A;  3F8N A;  4P5O A;  3M7G A;  3QPH A;  2K27 A;  3D5L A;  1DDN A;  3RTR A;  5DCM B;  5L3B A;  4UXN A;  2XAH A;  1S6L A;  1BC8 C;  3N4M A;  2IA2 A;  2K4B A;  1OR7 A;  4RB0 A;  3EYY A;  3LQQ A;  3RI4 A;  5ERI A;  4ESB A;  1F1Z A;  5LHG A;  3O2P E;  4Y13 A;  2OA4 A;  3DV8 A;  2KKO A;  1UB9 A;  4R8H A;  3BWG A;  2P7V B;  2ESH A;  2O3F A;  4JK1 X;  3MAJ A;  4RAZ A;  1RZ4 A;  4GYI A;  5J8C A;  1MD0 A;  3I59 B;  2ZME A;  3RYR A;  3HOS A;  1U8R A;  1WKM A;  2L01 A;  2DT5 A;  1R1T A;  1BJA A;  1Z1D A;  3C1D A;  2RNJ A;  1ODD A;  5EEH A;  3J80 K;  1TLH B;  5D6E A;  2A5Y B;  1YW7 A;  2EJR A;  1SD7 A;  1HXD A;  3BP8 A;  3LAJ A;  2RN7 A;  2L02 A;  4LLN A;  5HS8 A;  1G3W A;  4KNY A;  2VOD A;  2NS0 A;  3MCZ A;  2DPU A;  4Y17 A;  1ZYR F;  1WRJ A;  3TDU C;  1J59 A;  3T1B A;  4RAY A;  1GHC A;  2VBY A;  4CYD A;  3U1D A;  1ZG5 A;  2VE8 A;  4O6J A;  5DEQ A;  4WWC A;  1HKS A;  5LBQ A;  3D0S A;  2KIU A;  2LNB A;  4XBF A;  1FZP B;  1SFX A;  2L54 A;  2H6C A;  5HLH A;  1Z91 A;  1B1B A;  3ZP5 A;  3KP3 A;  5HDN A;  5E1X A;  3WTT C;  4Q4Z F;  3I53 A;  4L9N A;  1YTY A;  4UV8 A;  2GIV A;  2OQR A;  3GX4 X;  2FU4 A;  4KDP A;  2JZY A;  1HKQ A;  4CDG A;  1DUX C;  3HUG A;  3RPQ A;  3QAH A;  2Q2E A;  1IZ1 A;  2P5K A;  3QRF F;  2XVC A;  4G7Z F;  3T8R A;  4A0X A;  4Q5S F;  3IC7 A;  4MEY F;  5TJJ A;  5IT9 K;  4FX4 A;  4L9J A;  2CWE A;  4RGR A;  1KQ9 A;  5D6F A;  4EM0 B;  1R00 A;  4NHJ A;  1SD4 A;  1YS7 A;  5TRD A;  2P6S A;  5DV5 A;  2O61 A;  4RB3 C;  3FM5 A;  2QVO A;  5LHI A;  3C18 A;  4MTD A;  4L9V A;  5JVT A;  2MD5 A;  2UXN A;  3W6J B;  4HDU A;  4MNU A;  2X0L A;  5EEG A;  4DNC A;  3MWM A;  3ZPL A;  1R5G A;  3CTA A;  2A6E F;  2QQA A;  4EGY A;  1XGS A;  4ASN A;  4HF2 A;  2FSW A;  4LG0 B;  2AXL A;  4QLC U;  1ULY A;  3PFI A;  4ENK A;  4HV5 A;  4UVC A;  3L00 A;  1JE8 A;  4UUV A;  1P92 A;  3AAF A;  3LA7 A;  3DXJ F;  3RIR A;  4G94 A;  5BPI A;  3I54 A;  4LLG F;  3FX3 A;  4I01 A;  2OBP A;  1MDM A;  5K5O A;  1TTY A;  3M8F A;  1W4M A;  2RDP A;  5E18 F;  3M8E A;  5JHU A;  3SFZ A;  4BAY A;  5IT3 A;  1OYW A;  4HV6 A;  5CVJ A;  4UNO A;  3RYP A;  3V8J A;  5DUI A;  3J81 Z;  3E3V A;  1AWC A;  1SFE A;  1FWZ A;  2E7X A;  4YFX F;  4OIR F;  1H0M A;  1R1U A;  4BHP A;  2K02 A;  1X3U A;  3FMR A;  2LSO A;  3L7W A;  1B9M A;  3ABT A;  4Q48 A;  1HKT A;  3TO7 A;  3KFW X;  4ESF A;  3G73 A;  2HZT A;  1IXC A;  2F2E A;  5FD6 A;  3GYH X;  1J7K A;  2G7U A;  4GO1 A;  2A61 A;  3SZT A;  4XRF A;  1QNT A;  2QBY A;  2NYX A;  3FXQ A;  4ZH4 F;  5L3G A;  4N9I A;  2DK5 A;  1XN7 A;  4RGX A;  1XMA A;  5HS7 A;  4G6Q A;  2OAZ A;  1LDK B;  4BNC A;  3I4P A;  2D2W A;  1FP1 D;  1DPR A;  5D5U B;  4LK1 F;  3ZMT A;  5ILU A;  1I27 A;  3ECO A;  4M9Z A;  4H0E A;  1XMK A;  1ON2 A;  1WI9 A;  1G3S A;  4A5N A;  5BPD A;  2M8E A;  3WOD F;  3F72 A;  5LGN A;  4KYW A;  3TQN A;  2STW A;  2K4J A;  2EFP A;  3DQV C;  4IRH A;  2EB7 A;  3TDZ C;  1PP7 U;  4XSZ F;  4GXO A;  1U5T B;  5D8K B;  2QM3 A;  5FLX Z;  3LA2 A;  5DYM A;  4OMY A;  3H92 A;  2K7L A;  4M72 A;  1O3S A;  5E8G A;  2WTE A;  1FNN A;  5CVR A;  2HKX A;  3ZN1 A;  2VBW A;  2YU3 A;  4Y15 A;  1Z7U A;  3WTU C;  5F64 A;  4FT8 A;  3CJN A;  3LFK A;  4WXH A;  1F9N A;  3KLN A;  4WX9 A;  5LHH A;  1U2W A;  2TDX A;  3F23 A;  2A6H F;  3SZP A;  3WTX C;  1WWX A;  3I58 A;  2E1C A;  1SFU A;  4CGZ A;  3F22 A;  2FMY A;  1ZG3 A;  4AD9 A;  4FHT A;  2EFO A;  2GA1 A;  2DW4 A;  3G3Z A;  1SAX A;  1W7P B;  1D8J A;  3P7N A;  2PJP A;  2V1U A;  1S7A A;  2M1B A;  1IRF A;  1OYI A;  5H6Q A;  4WK8 F;  4IRI A;  3SXY A;  1QQI A;  3BJ6 A;  2LKP A;  3GFI A;  3ZMZ A;  5LRS A;  1KGS A;  1U6G A;  3Q5F A;  5FO5 A;  3BOQ A;  1P6R A;  3WU0 A;  2IP2 A;  1CF7 A;  2YR2 A;  1IN5 A;  4NB5 A;  2H27 A;  4D0P A;  2MBF A;  4IF4 A;  1K78 B;  5HS9 A;  3B73 A;  2KJB A;  1LVA A;  5CVV A;  2PI0 A;  4HBL A;  1H9G A;  1ZRD A;  5A2Q K;  2CG4 A;  1MZB A;  3EET A;  3Q9S A;  1I1S A;  1QO0 D;  1XCB A;  1KQ8 A;  2VBX A;  2XGX A;  4AWX B;  2PG4 A;  2FML A;  3FXR A;  1FBQ A;  3DP7 A;  3T5X A;  2DI3 A;  2KIM A;  3LQR A;  3TKY A;  3ZN0 A;  2ZBK A;  4MQ9 F;  3K69 A;  2WV0 A;  4ZYG A;  3N97 A;  4KMF A;  4IVN A;  2IRF G;  4R79 A;  1LB2 A;  2HGC A;  2ISY A;  2GXG A;  3GW2 A;  1IN7 A;  4L5J A;  2UWM A;  1ZAO A;  3RDI A;  4N0B A;  2DTR A;  1JHF A;  1VTN C;  2EFW A;  2JPB A;  2HDC A;  2XIG A;  1ZGJ A;  3Q9V A;  3IHU A;  2PEX A;  1LJ9 A;  3CUQ C;  3E97 A;  3QP5 A;  2M30 A;  3HRT A;  2YX7 A;  1OMI A;  1RUO A;  2W25 A;  4EQQ A;  1P2F A;  3I5U A;  1B59 A;  3RKW A;  2PBI A;  3CDH A;  2IJL A;  1YO5 C;  1U3E M;  4XLP F;  3ECH A;  1B6A A;  2BGC A;  4ZYH A;  1BBY A;  1FYL A;  3ZMU A;  1ONV A;  1KQ0 A;  2KRF A;  3REO A;  2V9V A;  2GQQ A;  3ML6 A;  3E6C C;  3GFL A;  3HIF A;  3TOB A;  4AIH A;  3IL2 A;  2XAQ A;  4CIC A;  5DUK A;  4IPA A;  4P9U A;  2ELH A;  5HLG A;  1BI1 A;  1IN4 A;  2HFH A;  1L3L A;  4PZJ A;  4HX8 A;  3F8F A;  5DCF A;  2EA2 A;  3ABU A;  3BRO A;  2QEN A;  3WE3 A;  3WGG A;  5BOX A;  3WTW C;  3BY6 A;  3KP2 A;  4A0Y A;  4RB1 A;  2MH9 A;  1XDS A;  4U7D A;  4ZYE A;  1FSH A;  3VB2 A;  2J5O A;  4P55 A;  1Z6R A;  1UFM A;  1ZRF A;  4A5M A;  2NNN A;  3MEX A;  3ROU A;  2P7C B;  2XV4 S;  1BI2 A;  1S7O A;  4LLL A;  2FOK A;  1KU3 A;  5LGT A;  3W6K B;  1G6N A;  3JW4 A;  3MQ0 A;  1I5Z A;  1BOA A;  1BI3 A;  1HSJ A;  5KK1 A;  3E5X A;  3M9A A;  1G3Y A;  5ILV A;  1TW2 A;  1KA8 A;  2IA1 A;  1BM9 A;  3QU6 A;  4EM1 A;  2CO5 A;  3IRR A;  5FB2 A;  3R0A A;  1STZ A;  3L2C A;  4GGG A;  3K2Z A;  4I0A A;  1TNS A;  2XAG A;  5LEK A;  2VE9 A;  1ZGA A;  1CGP A;  1K6O A;  3DEU A;  3CUO A;  1GXQ A;  1ZG1 A;  2XAS A;  2CFX A;  4OIQ F;  3KLO A;  4WXC A;  1T39 A;  1J5Y A;  3WE2 A;  4O3M A;  2GA2 A;  4YIF A;  2GZW A;  3BZ6 A;  1JHH A;  2H09 A;  3NEU A;  1XCV A;  3V8L A;  1NHA A;  1XGN A;  2DAO A;  1BI0 A;  4HOB A;  2ZME B;  3OV8 A;  3HSR A;  5HLI A;  1SMY F;  1PUE E;  3FWE A;  2ZJ2 A;  1IRG A;  4XLN F;  4RS8 A;  5CLS A;  4OIN F;  2XAJ A;  3HSE A;  4I09 A;  1P4W A;  1TNT A;  5F1R A;  4AVP A;  3GWZ A;  1FY7 A;  2ZO4 A;  4B09 A;  1TQM A;  4MTE A;  4QWQ A;  5HVQ C;  1EV7 A;  4EJV A;  3DPT A;  3KE2 A;  3H3Z A;  3ISP A;  4PCQ A;  4OU0 A;  4AIJ A;  3L9F A;  1R58 A;  3KP7 A;  3QPT A;  2ADU A;  2M45 A;  5FFX A;  3QP6 A;  5FGM A;  3VEP A;  3QU3 A;  4RB2 C;  4BYY A;  4I98 B;  2P5L C;  2KIF A;  1ZN2 A;  2DQR A;  4HAM A;  4IXA A;  3J81 K;  3GVA A;  5D8L B;  3ULQ B;  1S3J A;  1B4A A;  1ZRE A;  4HQM A;  2DK8 A;  4I02 A;  3KEO A;  1D3Y A;  2V79 A;  3BPV A;  3V7C A;  2BBY A;  1TW3 A;  2P8T A;  4OIP F;  4A0Z A;  3GFM A;  2O0Y A;  3K0L A;  3E6M A;  4Z2Y A;  1HQC A;  2YPR A; 
#chains in the Genus database with same CATH topology
 1IN6 A;  2Z5U A;  2QKM B;  3CMY A;  4RBO A;  1WJC A;  1FPQ A;  4IHS A;  1RNL A;  2R7V A;  2R5Z B;  2VOP A;  2A69 F;  2OC6 A;  3ZQH A;  2XGD A;  4UHT A;  2ZXJ A;  1FYK A;  1IJW C;  1A6Q A;  2RNG A;  4WCG A;  3OYI A;  3HOT A;  2YU9 J;  2X6Y A;  3GUD A;  3HUG B;  3KEQ A;  3MKY B;  5L3E A;  4ZZL A;  5FKK A;  1LNW A;  2RGV A;  1Z77 A;  3EYI A;  1FMW A;  4P96 A;  3JRC A;  3FXO A;  4M3D A;  1HLV A;  3BJO A;  3QPL A;  2MYS A;  3N05 A;  3HSF A;  4MLO A;  1NK2 P;  3WU1 B;  3WTS C;  4AYB N;  1R4M B;  2WA0 A;  2HDW A;  3CC2 I;  4U7B A;  5KVR A;  2FBH A;  4RDU A;  4HNT A;  4N4N B;  5ED4 A;  4DZP A;  2YS9 A;  3PNV A;  4BQQ A;  2VON A;  4FTH A;  4HLX A;  2X6O A;  2M34 A;  3BQZ A;  2CFO A;  1X58 A;  3KP4 A;  1TZL A;  1NG7 A;  3BR6 A;  3L2W A;  5B66 C;  1JJ6 C;  2GBY A;  3KP6 A;  3P5J A;  1UST A;  2EPF A;  3LA3 A;  3C2H A;  3TMO A;  2O9L A;  1D5V A;  2HQ5 A;  5C4J J;  4IKF A;  6PAX A;  2HWV A;  2FX0 A;  2J5P A;  4ZDL A;  4ZYA A;  1JI8 A;  1Y56 A;  1G8X A;  2COM A;  3RSN A;  3GEZ A;  2NRA C;  3GLX A;  1FSE A;  2PQ8 A;  2GM4 A;  3I4M J;  2JSC A;  2R7O A;  4KUM A;  5CKT A;  2XKO A;  1RIO H;  2BYV E;  4BAC A;  4YFN F;  2UUZ A;  3KEY A;  2L5Q A;  2W57 A;  2CJJ A;  1G4D A;  2FJ1 A;  2M2E A;  5B5E C;  3S32 A;  4BH9 A;  3HHH A;  3CUQ A;  2XUB A;  5TIS C;  3UNG C;  4L9T A;  4L0Y B;  2FXA A;  2DA3 A;  1W7P D;  4V2G A;  2IPQ X;  1YW8 A;  2HTS A;  2V1X A;  4UVA A;  3DTI A;  3R4K A;  3W2V A;  3OR2 C;  4M71 A;  1SD5 A;  4I7H A;  4MIM A;  5J4V A;  2LTP A;  3CCR I;  3CP8 A;  2HYJ A;  3OMY A;  2F5C A;  2LF7 A;  1T08 B;  5CQG A;  1QZZ A;  4HG2 A;  4BE0 A;  1K78 A;  4A3K J;  2A5W A;  3H36 A;  4LFU A;  4KT5 C;  2EV0 A;  3NAR A;  2WAQ N;  1EH8 A;  5K1Y A;  2F5F A;  2VBZ A;  4CYC B;  2AS5 F;  2VJ5 A;  4YFK F;  3S3M A;  1CQT A;  4NBQ A;  3CC4 I;  2KFD A;  2IA0 A;  3O8G A;  1MDM B;  1MJB A;  4KIC A;  2FBI A;  4M9X A;  2XHK A;  1WJD A;  4PJ0 C;  5FLX K;  1V55 H;  4C2M J;  4PGG A;  3ZRG A;  3E7L A;  4EEF G;  3K4L A;  3HOU J;  3EPZ A;  3M4O J;  3LOC A;  4M6X A;  1MGT A;  1VQK I;  4TV7 A;  1JKQ C;  3KZY A;  2K85 A;  2CRG A;  4NC8 A;  3C7J A;  2MD0 A;  1VQ8 I;  3GZ6 A;  1OPC A;  4OOI A;  3GLL A;  1GV5 A;  2ESN A;  2IGN A;  1SMT A;  2RC4 A;  1G59 A;  3ABM H;  3HBL A;  2RRE A;  4S05 A;  3HYI A;  1BN5 A;  3M8J A;  4L0Z B;  4CUG A;  1R1V A;  2L9R A;  4BJ6 C;  3IV5 A;  4O5V A;  2JA6 J;  1G3T A;  3P9C A;  2LY9 A;  4BXU A;  4XIC A;  5J40 A;  1TWA J;  2E34 A;  3TED A;  3SJM A;  4J00 A;  5DCM A;  1WQ2 A;  3BR5 A;  2ZJQ F;  1ETV A;  3HHG A;  2CYY A;  4A6D A;  2D1V A;  1YG2 A;  3S3O A;  2O7O A;  4BHC A;  4EM2 A;  1EJ9 A;  3T8T A;  1ZRC A;  4A3D J;  1IF1 A;  1S8N A;  2MW8 A;  3BG5 A;  3PM1 A;  4L18 B;  5L3C A;  3L2U A;  2Y48 A;  3HTU A;  3NWT A;  3RKX A;  1VQ9 I;  4HLY A;  3H3V K;  4J01 A;  1FX7 A;  2MA3 A;  1XGO A;  2ID3 A;  1VQ5 I;  2LY2 A;  1W5S A;  3GTJ J;  5EG0 A;  3F21 A;  4OWR B;  5HOO A;  4ZZD A;  2MGQ A;  1A5J A;  3KCC A;  1ZH5 A;  3GF2 A;  5J1U A;  3LFU A;  2CQK A;  2JA5 J;  2DU9 A;  4IHT A;  4NC7 A;  4HX7 A;  3V8K A;  1WPK A;  3BTI A;  5L3F A;  3VSK A;  3A01 B;  2OCE A;  4OIO F;  2QYO A;  3I4N J;  1ZGW A;  3EUK L;  2VQH A;  4U88 A;  3C2G A;  3H5A A;  3S2W A;  2A07 F;  4D1Q A;  5C3E J;  4EGZ A;  3HOY J;  1GT0 C;  3VYS B;  2V6E A;  1R23 A;  2CMP A;  1X4O A;  1KYZ A;  3PO3 J;  4IHV A;  1FOY A;  2X1D A;  2ZFW A;  3G2B A;  3I59 A;  1V3F A;  4XSX F;  2BW3 B;  4G7O F;  4A3F J;  1EH7 A;  3AL0 C;  2EWN A;  4EJO A;  3IWF A;  1J75 A;  5CVI A;  3G1M A;  2EIL H;  3CCU I;  2DMP A;  1O3R A;  2IVM A;  4A12 A;  1UHM A;  3I71 A;  4U0V A;  5E17 F;  2YSR A;  3ZQI A;  3AFH A;  3ZMS A;  1EA3 A;  3MZY A;  2XF7 A;  4KIF A;  2VKD A;  1UAA A;  2KRC A;  4PJL A;  2DPD A;  2Y0S N;  4KIG A;  3E6B A;  1FYM A;  1FIP A;  1FP2 A;  3BCB A;  3CC7 I;  3JAM Z;  4F7Z A;  4UUS B;  3CCE I;  3JR9 A;  1FOX A;  4KIB A;  5KAF C;  3MZH A;  4XMY A;  3PO2 J;  1HBX G;  3FK7 A;  4BUP A;  1YW9 A;  3BJA A;  3FDY A;  4NDL A;  3FXM A;  5D5V B;  1VZ0 A;  4A3E J;  1U5T C;  3OYB A;  3DF8 A;  4DBR A;  3Q0W A;  2DOF A;  4HZF A;  5CYV A;  5ILS A;  3G4S I;  1O3Q A;  1RI7 A;  3KX2 A;  4Y3O A;  3FXU A;  1MNM C;  4JOM A;  4C2T A;  1R9T J;  4DZJ A;  1YLF A;  2OZ6 A;  5DDG A;  3VFZ A;  1OQY A;  4G9Y A;  3JRB A;  3K70 C;  2E1M B;  2VKE A;  1KU2 A;  1KU7 A;  3P9K A;  1D0Y A;  5D4R A;  4NC6 A;  1WH7 A;  4LB5 A;  3FMQ A;  1XDU A;  3SQN A;  3I56 I;  3IKV A;  1O7L A;  3FK6 A;  2F4I A;  3QYF A;  4A6E A;  5HDK A;  4FQG A;  1MW7 A;  5ICG A;  3L2Q A;  1O57 A;  3ASO H;  1I6X A;  2LLK A;  2A3S A;  1OKR A;  2M3A A;  2TCT A;  2CUZ A;  1OCR H;  1YHQ I;  2HS5 A;  2X48 A;  3TOA A;  4ZTJ A;  1S29 A;  1T2K A;  1ON1 A;  1XPX A;  4AID A;  3HRM A;  1MSF C;  4KFC A;  2IW5 A;  3V4G A;  1J0R A;  3F3X A;  4C3H J;  1QPM A;  1R7J A;  3ZQG A;  1UEL B;  2BVL A;  3WG9 A;  2HVQ A;  3O6B B;  5CVU A;  2PJR A;  4CO8 A;  4ETS A;  3FM3 A;  1UCR A;  5E8I A;  2KPM A;  2Y75 A;  5E20 A;  1P4X A;  2C6Y A;  2FRH A;  2FF4 A;  2L9V A;  5EGO A;  2CV1 A;  3TL4 X;  1MND A;  1SVO A;  3HOX J;  2ZCW A;  4I0B A;  2JSP A;  3MKL A;  4FX0 A;  4KN4 X;  4ESJ A;  1YQA A;  1FEX A;  2Z16 A;  3OIO A;  1RPW A;  2RQQ A;  2DQL A;  4F93 B;  4HYE A;  1Z6T A;  2DYS H;  1EH6 A;  2GOM A;  1WVR A;  2GAU A;  4YIR X;  2X9D A;  4HF1 A;  3FHZ A;  4A2U A;  4E7I A;  1QVT A;  3GTK J;  1X19 A;  3EUH A;  3FBI B;  2LKS A;  5M3M J;  1I39 A;  2VOO A;  2Z99 A;  2NVU B;  3VOD A;  4LMY A;  2FQ3 A;  4Q47 A;  2MLK A;  1OIS A;  2L4A A;  3ZCO A;  3ERE D;  4HX4 A;  2O8X A;  2NVY J;  2JRT A;  3GO5 A;  2BEO A;  1I6H J;  3AKZ A;  3IRQ A;  1Q1H A;  1Y0N A;  2PFB A;  3GZ5 A;  4A69 C;  4FET A;  3Q0U A;  1J9I A;  1REP C;  2V6C A;  3BR3 A;  2KZG A;  4MHG A;  1NTC A;  3SZG A;  4HRI A;  1AKH A;  3GTO J;  1FT9 A;  2F5D A;  1P4A A;  2BXZ A;  4LK0 F;  2BHY A;  5DD8 A;  2R7T A;  2QCO A;  1P9Q C;  3MZ8 A;  5L3D A;  4GCV A;  2MC3 A;  4BEH A;  3L2R A;  4LG0 A;  3DU6 A;  1T6S A;  2VKV A;  3W3C A;  3AG3 H;  3WGI A;  2DMU A;  4B44 A;  2LK2 A;  1IN8 A;  3ERM A;  3S16 J;  3JTH A;  3H1C A;  4ON0 A;  1YE9 A;  3R0J A;  1PP8 F;  4I2O A;  4IQJ A;  3I9V 2;  1CF7 B;  2ZJP F;  1MKM A;  2HU9 A;  4HF0 A;  1JUM A;  1KU9 A;  4UY8 I;  1IV6 A;  4ZDP A;  4AM3 A;  3Q3S A;  3BR2 A;  1TT5 B;  2E5Z A;  1I1G A;  4B3A A;  3MKW B;  1L0O C;  5DTD A;  1IAW A;  4RGU A;  1R22 A;  2CUF A;  2L7F P;  5FD5 A;  2Y9Z A;  1ETQ A;  4YII A;  1H88 C;  4HQE A;  3J80 Z;  3I3L A;  4XM3 A;  5ICF A;  1O7F A;  2EV5 A;  2OZU A;  2XF5 A;  2XKP A;  1TWF J;  4IOC F;  2R7F A;  2LH9 A;  3JSO A;  1IO2 A;  2BXY A;  2WV1 A;  3I64 A;  3IKT A;  4BHB A;  4FAS D;  3L1P A;  3VOE A;  4HA8 A;  1YRN A;  4ITV A;  4B43 A;  1OCP A;  3HGG A;  2STT A;  1FBU A;  4FE7 A;  2FD5 A;  1IRX A;  4DOZ A;  2P0W A;  1S7E A;  3QOP A;  3WTZ A;  3JRF A;  3JSP A;  4JYK A;  2H8R A;  1TQI A;  3FF5 A;  3K1P A;  5M3F J;  2JT1 A;  3OL4 A;  3V7S A;  3CDL A;  5M5W J;  1VQL I;  1IUY A;  2P5V A;  2Q8K A;  4EJU A;  2XRO A;  3A2K A;  2HXI A;  3DBL B;  2LR8 A;  4G8X A;  5JI6 A;  5DD4 A;  3OS2 A;  5FFZ A;  3EDP A;  3PQK A;  1WJE A;  2DFE A;  2F5V A;  2WB1 N;  3HKZ N;  3ZMD A;  4A3G J;  3M1C A;  1Z0X A;  5HDG A;  3PIO F;  2E19 A;  2R7S A;  2H6B A;  3ABL H;  4FIS A;  2EV6 A;  3HTS B;  2VL8 A;  4M73 A;  2HYG D;  1ERD A;  1ZLK A;  2L7Z A;  3OS1 A;  3ZGK A;  2L3D A;  3RJP A;  1FLI A;  2JPC A;  3T0Y A;  5FKM A;  5BMZ A;  2CW8 A;  2VQG A;  3C3W A;  4LG3 A;  2WAE A;  3X2Q H;  2DDB A;  2IS1 A;  3S14 J;  4ZC3 A;  4MFD A;  3K10 A;  2KDZ A;  1YJW I;  2FNA A;  1QGP A;  2OTL I;  3VWB A;  1MBH A;  4B4C A;  1HW1 A;  1JGS A;  1ETO A;  2QQ9 A;  4BBS J;  2EIK H;  2HKO A;  1ZK8 A;  3GTM J;  2XB5 A;  2FA5 A;  2BE5 F;  5ICE A;  2Z9O A;  1GLN A;  3CJR B;  4G12 A;  3V42 A;  2GWR A;  3CCY A;  3HJE A;  4IHX A;  4U0Y A;  1D1A A;  3NRV A;  2LP0 A;  2NOJ B;  5M5X J;  2V1D A;  1E2X A;  4UVB A;  3BCA A;  4GFB A;  1WJA A;  3BR0 A;  1UMQ A;  4YEJ A;  3ELK A;  3KP5 A;  1ZLJ A;  1PUF B;  2ECC A;  2FNP A;  1Z3Y A;  1HC8 A;  3OYF A;  2F5E A;  1VQ6 I;  1DPU A;  5FRM A;  5IT9 Z;  3CLO A;  4HEA 2;  2VUM J;  2QQB A;  3M1E A;  4IJA A;  1OCC H;  2CGP A;  4BL0 B;  2VQL A;  1RR8 C;  2CW0 F;  2XRN A;  2QEX I;  4AIK A;  2V7F A;  3FHN A;  3RPU A;  3F6V A;  2Z1D A;  1BIA A;  1X1D A;  3MD2 A;  4EJW A;  2PMH A;  2E2I J;  1MSE C;  3SEZ A;  3HRU A;  4PDK A;  1GVJ A;  3J7A Y;  1MNE A;  1LDJ A;  2XAF A;  2OTJ I;  2NS7 A;  3OOP A;  3OYE A;  1HW2 A;  1Q1V A;  1DQU A;  4PSW A;  1MJA A;  2MLG A;  2EA4 A;  3NQO A;  1USS A;  3VPR A;  2EFQ A;  3CJQ B;  2ZB9 A;  2Y0M A;  4M6Y A;  1U78 A;  3TO6 A;  4ENN A;  3M07 A;  3QOD A;  4MEX F;  3F8M A;  3ZQL A;  2L4M A;  4B48 A;  1WGX A;  1Z9C A;  2LVS A;  4E70 A;  4XN0 A;  3TW6 A;  1A31 A;  3EUA A;  2KQR A;  2DJI A;  2W24 A;  2H94 A;  3K1M A;  3JRA A;  3SHF A;  3FZV A;  4ENJ A;  5D5W B;  3DLL F;  4UV9 A;  2NAZ A;  4D7M A;  2PLY A;  3GTG J;  5HNH A;  2OU2 A;  5KHD A;  1B72 A;  3RKQ A;  2HR3 A;  1NG6 A;  2DA7 A;  2R7Z J;  2O03 A;  4CZZ A;  3CLQ A;  4HST A;  2D45 A;  4JBA A;  1ITY A;  1WZ2 A;  1B9N A;  1AU7 A;  2QSH X;  5EF6 A;  2Y2Z A;  1MMG A;  4YG2 F;  1SEU A;  1T8I A;  4EVI A;  3CZ6 A;  2K86 A;  1W5C C;  4E7S A;  3W6V A;  1U5T A;  1S9H A;  2DXI A;  2EH3 A;  3DFG A;  2HQR A;  1W36 D;  2MSY A;  4IEJ A;  2XSJ C;  2O6G E;  4P9F A;  2DO7 A;  4M9S A;  4F91 B;  3R60 A;  3OYM A;  1XB4 A;  3WTV C;  3OSF A;  1WJB A;  4BQA A;  3BTL A;  1QRY A;  1F4K A;  2M7A A;  1LDD A;  2YX4 A;  3F6O A;  1DP7 P;  1MJ9 A;  1TQP A;  4K2E A;  3EQL F;  1LQ1 A;  2PMZ N;  3AG4 H;  3L09 A;  3VSL A;  3A02 A;  5BQT A;  2CU7 A;  2IS2 A;  5K5R A;  4CCO A;  3S1M J;  3PUB A;  2MFZ A;  2DBB A;  4LB6 B;  1RUN A;  2W84 A;  2AQF A;  2HYF A;  5GAH J;  1Y39 A;  3K4N A;  2Q2E B;  5F6F A;  3CF2 A;  1N77 A;  2RVC A;  1ZHF A;  3COA C;  1E3O C;  2QQ8 A;  2MC4 A;  2ZME C;  2UXX A;  2QA4 I;  1RKW A;  2ACJ A;  1LVK A;  4B8X A;  3I55 I;  2KHM A;  1OCT C;  3U21 A;  4D5C A;  1Z21 A;  2Q0O A;  3ZQ7 A;  3CO6 C;  1K7A A;  2HOA A;  1UJ8 A;  2L9N A;  5LGU A;  2HEO A;  4CHU A;  1SD6 A;  3IP4 B;  1W7P A;  3F8C A;  4B47 A;  4QPQ A;  2VN2 A;  3BPX A;  1PJR A;  3DPL C;  5J47 A;  3PSF A;  3A01 A;  1WCM J;  3LST A;  1YFH A;  4PSX A;  5IP7 J;  3K1N A;  1JT0 A;  4DJA A;  2B0L A;  2E1N A;  2RKH A;  5DS9 A;  3KZZ A;  1XG1 A;  1V4R A;  2QUF A;  4RLF A;  2OF7 A;  2EFN A;  4RM2 A;  1T0F A;  2BV6 A;  5E3L A;  1RC9 A;  3E1S A;  5GP9 A;  2K9N A;  1FIA A;  3LAP A;  2ZC2 A;  3B02 A;  2FE3 A;  1VQN I;  1T98 A;  5EYR A;  2VT2 A;  2E35 A;  1MH3 A;  2EIN H;  5ICC A;  2EZH A;  5F0H A;  4CSW A;  2FEZ A;  2R7D A;  1MMN A;  2DA4 A;  3OSG A;  1FMV A;  3CMM A;  3E5U A;  4EV0 A;  1KON A;  3A0B C;  3DU5 A;  2LC2 A;  4KMU X;  4LD5 A;  3WGH A;  1YIJ I;  1LE8 B;  4GYG A;  1XD7 A;  1JGG A;  4G7H F;  5J1R A;  2VPR A;  3GME A;  2G9W A;  1X1A A;  2R5Y B;  5H20 A;  1W5T A;  1BW6 A;  4JP0 A;  1W0U A;  3WTY C;  2D1H A;  1DU6 A;  2RQP A;  5AIQ A;  3LSR A;  5KAI C;  3CES A;  5KNL A;  3OY9 A;  4G6D A;  2G7H A;  4HW0 A;  4XK4 A;  2KIQ A;  4LIT A;  2IT0 A;  2BY3 A;  1HDP A;  5K5Q A;  2MAB A;  2XC7 A;  1MH4 A;  2ZKZ A;  2ZNY A;  1R36 A;  3R6S A;  3SFI A;  2V9K A;  2DMT A;  2K9S A;  3QWL A;  5J4Y A;  2XAU A;  5HNF A;  5E1W A;  3KYD B;  4RGS A;  2LY1 A;  1OYY A;  2WAQ A;  2GOX B;  3HGY A;  2BY1 A;  1T38 A;  1A04 A;  3KYL A;  2CV0 A;  5IOZ A;  2CS3 A;  2DYR H;  2MH2 A;  3TGN A;  1ZAR A;  3PL8 A;  2VC0 A;  2Z33 A;  4KA4 A;  4KT6 A;  1BL0 A;  5JHF A;  1E17 A;  3L2V A;  3J7A O;  5J6X A;  5J8F A;  1XSX A;  2VC1 A;  3HZJ A;  3K9T A;  1UHW A;  5CJ9 A;  1YYV A;  3C2B A;  4HPQ A;  2VXZ A;  2NS8 A;  3VYU B;  1F36 A;  3BG6 A;  3I0T A;  3D1N I;  1XSD A;  2O8K A;  2DA2 A;  1XSV A;  3LWF A;  3OYD A;  3G6E I;  3CCL I;  3HOW J;  1JKO C;  3S1Q J;  5LD2 C;  1KYW A;  1YJN I;  2W85 A;  4GRI A;  4BY1 J;  1QHH D;  3BG7 A;  4DQ2 A;  2KRH A;  4MGR A;  5FLV A;  3TO9 A;  3RKY A;  2RAE A;  1RRJ A;  2CSO A;  1ETW A;  2ISZ A;  3PNY A;  1J2X A;  1GXP A;  1O4X A;  2ZXH A;  5B3S H;  4WF2 A;  4M74 A;  2M87 A;  5BS6 A;  2LMD A;  2ECB A;  4CXF A;  3W2A A;  5D5X B;  1MBE A;  2DMQ A;  4BJ5 C;  4S0H B;  2K9M A;  4LIU A;  5HLT A;  2M5W A;  2OD5 A;  4ZYD A;  2UZK A;  2W1O A;  4IOA F;  1HST A;  2KJC A;  3DBR B;  1BIB A;  4UB8 C;  1YIO A;  1SFO J;  4DGW B;  3A1Y A;  5HOD A;  1LEA A;  4XQF A;  3PQJ A;  3E5Q A;  5FJ8 J;  3JTG A;  5K7H A;  4IL6 C;  1IDY A;  1YS6 A;  2M0M A;  3CO7 C;  4M3F A;  1I3Q J;  5AON A;  2DLL A;  1FBS A;  1TWH J;  3H3U A;  1VF9 A;  2HTJ A;  3HXL A;  3CCJ I;  4IO9 F;  4MQV A;  1OCZ H;  1D8K A;  1AOY A;  1EKE A;  4PFO A;  4U0W A;  2E7W A;  4KIT B;  4BKX A;  1P7J A;  2NNY A;  2DA6 A;  4N4O B;  2JVH A;  1QZY A;  1XGM A;  4JQF A;  2PN6 A;  3ZQF A;  1IDZ A;  5AIP A;  4XID A;  2DTZ A;  3GFJ A;  3V7R A;  1YX3 A;  2IS4 A;  1LKX A;  2ZFU A;  4DYR A;  2QBY B;  4IRG A;  1Y0U A;  2H1L A;  1FC3 A;  5LRR A;  5H6R A;  2VJJ A;  4E4H A;  5JFR A;  4WXD A;  5LEJ A;  4LGW A;  3E6D A;  4F52 A;  2JVG A;  5E1Z B;  3GXO A;  4F3Q A;  4L5I A;  3JAM K;  1C0W A;  2M9H A;  1W36 C;  1RET A;  3HRS A;  3DKW A;  3IH2 A;  4EAT A;  2MG4 A;  2LDU A;  2HQN A;  3F8B A;  5LLQ A;  3CUQ B;  1R4N B;  2DFI A;  2QLZ A;  1IXS B;  1PDN C;  1JXS A;  2BY2 A;  2Z3Y A;  4E7L A;  5J1Y A;  2HOE A;  2WWY A;  1F43 A;  1TT0 A;  3OYH A;  4S04 A;  1IXR C;  1R5H A;  3FKI J;  1VFC A;  3OYN A;  1LFU P;  1IW7 F;  5M5Y J;  2WC2 A;  1MBG A;  1FTZ A;  2OQG A;  1LEB A;  1K79 A;  2B63 J;  5D4S A;  2QZ8 A;  3U9G A;  4QTR A;  4LOC A;  4EMS A;  2JJ7 A;  2LF8 A;  1O3T A;  1BC7 C;  2ME6 A;  4NQW A;  2P6T A;  3A0H C;  3FKJ A;  3HC7 A;  4IHW A;  2JTV A;  2Y0S A;  3O3K A;  4UB6 C;  4LIV A;  3P9I A;  1WSU A;  1Z05 A;  4XRS G;  3BDD A;  2FBK A;  1U8B A;  1ORK A;  4KJZ A;  4M3E A;  4RM3 A;  3KET A;  2R3S A;  3VDX A;  2QGU A;  4KN7 X;  4LJZ F;  2P4W A;  2ZNZ A;  3U2R A;  2DT7 B;  4EJT A;  2EK5 A;  2DOE A;  3Q0V A;  1HW5 A;  4II2 A;  5F0F A;  5GTI C;  2OV7 A;  2ZSI B;  2X4H A;  2HOT A;  5B1A H;  5JLW A;  1H9T A;  1F5T A;  2RV8 A;  1MBJ A;  3DKX A;  1QBJ A;  4IHY A;  4OMZ A;  4R1H A;  2LBF A;  1ZKG A;  3HB9 A;  3S17 J;  3LSM A;  5IOY A;  5DM6 F;  3S15 J;  3FMS A;  2NVT J;  2QWW A;  5B1B H;  5A2Q Z;  2Y31 A;  5DM7 F;  2CV2 A;  1FOK A;  3MFK A;  3ZMV A;  2GXB A;  2XGE A;  1TBX A;  2NVQ J;  4HDV A;  2PMU A;  4HNV A;  3IWZ A;  4BY7 J;  4ENM A;  2A68 F;  1IG7 A;  2DN0 A;  4L5E A;  3R61 A;  1ZR2 A;  4N9H A;  5F08 A;  1R6R A;  2X85 A;  2ETH A;  5EEA A;  5JR3 A;  1N75 A;  1X3Z B;  4BGD A;  2VT3 A;  4PGH A;  3F8N A;  4P5O A;  3M7G A;  3QPH A;  2K27 A;  4MO7 A;  3D5L A;  1DDN A;  3RTR A;  5DCM B;  5L3B A;  4D7N A;  3K4M A;  3CME I;  4UXN A;  2B9S A;  3JRI A;  1T0F C;  2XPV A;  1LFB A;  2XAH A;  1S6L A;  1BC8 C;  1ZTR A;  3N4M A;  2DOD A;  4QIW N;  2IA2 A;  2M8G X;  2K4B A;  2XGC A;  4AU7 A;  1DGR M;  1OR7 A;  4RB0 A;  3MMY B;  3EYY A;  3LQQ A;  2IBD A;  2E2H J;  3RI4 A;  1VQ4 I;  4A93 J;  5ERI A;  4ESB A;  3JCU C;  3K6G A;  1F1Z A;  5LHG A;  1IV8 A;  3O2P E;  2X6X A;  5EG0 B;  4Y13 A;  2OA4 A;  3DV8 A;  2KKO A;  2V4J C;  1UB9 A;  3DEE A;  1G2H A;  4R8H A;  2R7X A;  3BWG A;  2P7V B;  2AXT C;  2ESH A;  4FE4 A;  2W00 A;  2O3F A;  4XLH A;  3HG9 A;  1J09 A;  2KIS A;  4JK1 X;  3CCQ I;  3MAJ A;  4XOP A;  5IP9 J;  1B8I A;  4RAZ A;  1XX5 A;  1RZ4 A;  4GYI A;  2JK3 A;  3OOU A;  5J8C A;  1MD0 A;  2TRT A;  2ZME A;  3I59 B;  3LL7 A;  3RYR A;  5FLM J;  3HOS A;  1WKM A;  2L01 A;  1U8R A;  2LG4 A;  2DT5 A;  1R1T A;  1BJA A;  4UUT A;  1Z1D A;  2ELJ A;  3C1D A;  2EZK A;  2JRM A;  2RNJ A;  3K2A A;  2E1M C;  1ODD A;  3SDB A;  2UV1 A;  1R5I D;  5EEH A;  3J80 K;  1MMS A;  1TLH B;  4XON A;  5D6E A;  2A5Y B;  1YW7 A;  4AC0 A;  2EJR A;  1SD7 A;  2WAD A;  1PVE A;  5FKL A;  1Y6I A;  3GTQ J;  1HXD A;  3BP8 A;  2FQ4 A;  3TW7 A;  1JUS A;  3LAJ A;  2RN7 A;  3AG1 H;  2L02 A;  4LLN A;  3RZO J;  5HS8 A;  1G3W A;  4KNY A;  2VOD A;  2NS0 A;  3MCZ A;  2DPU A;  2ZXW H;  1GV2 A;  4Y17 A;  4XOT A;  1ZYR F;  1E3P A;  1WRJ A;  2E60 A;  3RZD J;  3TDU C;  1IRZ A;  3LSJ A;  3FXJ A;  1W1W E;  4QSH A;  1J59 A;  4RA2 A;  4P1W A;  3OIQ A;  3T1B A;  3B6A A;  4YRV A;  4RAY A;  1GHC A;  2VBY A;  4CYD A;  2GLO A;  2I10 A;  3U1D A;  2VE8 A;  4O6J A;  5DEQ A;  4WWC A;  3SYT A;  4A3M J;  1ZG5 A;  1HKS A;  1IGN A;  1M1E B;  5LBQ A;  3DKY A;  2CQQ A;  3UR3 C;  5E3N A;  3D0S A;  3BZK A;  2KIU A;  2LNB A;  4XBF A;  1FZP B;  1SFX A;  2L9S A;  5JVG F;  2L54 A;  3D5R C;  3CJT B;  4XLE A;  2H6C A;  3GBG A;  4A3C J;  5HLH A;  1Z91 A;  1B1B A;  3ZP5 A;  2AHQ A;  3KP3 A;  4BBR J;  4IQ4 A;  3SEQ A;  1HCR A;  4E7H A;  1VQ7 I;  1N25 A;  5HDN A;  3GCM A;  5E1X A;  4F92 B;  3DEW A;  3WTT C;  4XKC A;  3HPG A;  4Q4Z F;  1HDD C;  1ZQ3 P;  4CCL A;  4F55 A;  4XKW A;  3S1R J;  2OPT A;  3GZN B;  4PJM A;  3OYK A;  3I53 A;  2WB1 A;  4L9N A;  2R5Z A;  2COB A;  1YTY A;  4UV8 A;  2GIV A;  2OQR A;  4C3J J;  2R7R A;  2VLA A;  2PJR B;  2M0C A;  3GX4 X;  1OFC X;  2FU4 A;  4KDP A;  1QU3 A;  2JZY A;  1HKQ A;  4CDG A;  1DUX C;  3HUG A;  5CQE A;  3BZC A;  2M4G A;  3RPQ A;  1XC5 A;  1Y1V J;  4U87 A;  3QAH A;  2IGO A;  1WJ5 A;  1FTT A;  4ANJ A;  5K7Z A;  2Q2E A;  1IZ1 A;  2P5K A;  3QRF F;  3S3N A;  2XVC A;  4G7Z F;  3T8R A;  4CZC A;  3FXK A;  2G0E A;  4A0X A;  4Q5S F;  3IC7 A;  4MEY F;  5TJJ A;  5IT9 K;  4FX4 A;  4L9J A;  2CWE A;  4RGR A;  1NK3 P;  1KQ9 A;  5D6F A;  4EM0 B;  1GUU A;  1R00 A;  4NHJ A;  2BVM A;  1SD4 A;  1YS7 A;  2FOW A;  4CH7 A;  2P6S A;  5TRD A;  2DFH A;  5DV5 A;  1X2M A;  3S8P A;  2O61 A;  2KP6 A;  2KZV A;  4RB3 C;  4IZZ A;  2HDD A;  3FM5 A;  2I5U A;  4II3 A;  2QVO A;  4V2F A;  5EJC A;  5LHI A;  3IUO A;  4OAZ A;  3UKG A;  1WH5 A;  1Z67 A;  3HM5 A;  3C18 A;  2WAF A;  4BU2 A;  4MTD A;  4L9V A;  5JVT A;  2MD5 A;  2UXN A;  1QHG A;  3NAU A;  3A03 A;  3W6J B;  4HDU A;  4MNU A;  1ENH A;  2X0L A;  3K4B A;  5EEG A;  4DNC A;  2Y30 A;  3MWM A;  3ZPL A;  1POG A;  2DMN A;  1R5G A;  2R7Q A;  3CTA A;  4XN3 A;  1AKH B;  2A6E F;  3TP3 A;  1JJ8 C;  2QQA A;  1D0Z A;  4EGY A;  1XGS A;  1X4P A;  4BXF A;  1V5F A;  4ASN A;  4C30 A;  2FSW A;  2R0Q C;  4HF2 A;  4LG0 B;  2AXL A;  4QLC U;  1GDT A;  2E2J J;  2QSF X;  3HEF A;  1FOW A;  1ULY A;  3JRD A;  4XRM A;  1LE8 A;  2GIZ A;  3PFI A;  3WHC A;  4ENK A;  1T56 A;  4HV5 A;  3FIS A;  4UVC A;  3L00 A;  1JE8 A;  4UUV A;  1P92 A;  1S72 I;  3AAF A;  1U9O A;  3LA7 A;  2HI3 A;  3ZQC A;  2F48 A;  5FKN A;  3DXJ F;  4BJT A;  3J7Y J;  2XDV A;  3RIR A;  1D1B A;  4G94 A;  5BPI A;  1E0E A;  2K3P A;  4QPO A;  4D5F A;  1IUF A;  2LYC A;  5EZG A;  2VKH A;  3I54 A;  2IAI A;  4LLG F;  3CF5 F;  4CYC A;  1RES A;  3FX3 A;  3H35 A;  3ESW B;  4M3B A;  1GVD A;  4I01 A;  2HPI A;  2OCC H;  2L0K A;  2OBP A;  3BG3 A;  1SC7 A;  1MDM A;  1AA7 A;  5K5O A;  2BY0 A;  4Y4R A;  3BTC A;  4A3B J;  1TTY A;  3K4K A;  3M8F A;  3CD6 I;  2H8W A;  3IH4 A;  2LRE A;  1W4M A;  2W48 A;  4DIQ A;  4C9Y A;  3DLA A;  2RDP A;  3LSG A;  4D9J A;  5E18 F;  1H89 C;  5FRN A;  2JUC A;  3M8E A;  5IYC J;  5JHU A;  1OR7 C;  3SFZ A;  4BAY A;  5IT3 A;  5H2F C;  3ZQQ A;  5FRO A;  2HQA A;  1LPQ A;  1OYW A;  4HV6 A;  2F4M B;  3S2H J;  5CVJ A;  4UNO A;  3RYP A;  2ID6 A;  3V8J A;  1MMA A;  1SVM A;  5DUI A;  2HVR A;  3J81 Z;  3E3V A;  1AWC A;  1SFE A;  1X1P A;  4Y52 J;  1FWZ A;  4AUX A;  2E7X A;  2NVX J;  4YFX F;  4OIR F;  1X3W B;  2XPW A;  1H0M A;  3OS0 A;  1R1U A;  4BHP A;  3F0C A;  4H4K C;  2GXA A;  2N8G A;  1K61 A;  2K02 A;  2K5C A;  3DBH B;  2PMZ A;  1X3U A;  4DYQ A;  3FMR A;  2EQR A;  3CQZ J;  2LSO A;  3L7W A;  1EF4 A;  1B9M A;  3ABT A;  2XB0 X;  4PUS A;  4Q48 A;  1A6I A;  1HKT A;  5E3M A;  3TO7 A;  3KFW X;  4ESF A;  2JN6 A;  3G73 A;  3BT9 A;  2HZT A;  1IXC A;  1P7I A;  2HZD A;  4AYB A;  4HNU A;  2F2E A;  5FD6 A;  1D0X A;  3GYH X;  3G1O A;  3IH3 A;  1HF0 A;  1J7K A;  3LSP A;  5IPA A;  3K70 D;  1OLT A;  2DOA A;  1WHU A;  2LD5 A;  4CCK A;  2R7U A;  2G7U A;  4GO1 A;  4FCY A;  4B1R A;  5E3O A;  1T33 A;  1QZE A;  2A61 A;  1U9N A;  1WI3 A;  2EZL A;  1UG0 A;  3SZT A;  3FXL A;  2E36 A;  4XRF A;  3GTL J;  2BW3 A;  2VXD A;  4A3I J;  4ABZ A;  5IYD J;  3OYJ A;  1V5E A;  1QNT A;  2LRD A;  2QBY A;  1DGW Y;  1A36 A;  2NYX A;  3FIW A;  4NUB A;  3CDI A;  3FXQ A;  2HPM A;  3LSK A;  2I8D A;  4KIS A;  3KYC B;  4ZH4 F;  5L3G A;  2JA2 A;  2XSD C;  4N9I A;  4C3I J;  2DK5 A;  2ICW G;  2LFB A;  1XN7 A;  4RGX A;  1XMA A;  2X1E A;  4BDY A;  1W0T A;  3F9K A;  2OJE D;  4W1U A;  4UUS A;  4G6T B;  5HS7 A;  4G6Q A;  2OAZ A;  1LDK B;  4BNC A;  1MMD A;  3I4P A;  2D2W A;  2JWT A;  1FP1 D;  4DYC A;  3OIP A;  1DPR A;  2IGM A;  3SDG A;  5D5U B;  3RQ4 A;  3OYA A;  3DTK A;  4LK1 F;  3ZMT A;  1JUP A;  5EZH A;  3NWS A;  4Y7N J;  1TWC J;  5ILU A;  3AL0 B;  1I27 A;  3ECO A;  2ELK A;  3JRH A;  4M9Z A;  4H0E A;  4RLQ A;  3GTP J;  1XMK A;  1ON2 A;  1WI9 A;  2K3F A;  1G3S A;  4A5N A;  1K4S A;  5BPD A;  3OR1 C;  3KPH A;  3TBI A;  2M8E A;  3WOD F;  3D5S C;  3F72 A;  1B72 B;  1K6Y A;  4DBQ A;  2WY7 Q;  5LGN A;  1X1B A;  3VYR B;  1LUJ B;  4KYW A;  2CQN A;  3TQN A;  2STW A;  1XS9 A;  2K4J A;  2QKL B;  1SAU A;  5GTH C;  3CMA I;  2EFP A;  2LKX A;  3DQV C;  4IRH A;  3H9G A;  2EB7 A;  3DCF A;  3TDZ C;  3DTE A;  3PNT A;  3K4C A;  1PP7 U;  1HA8 A;  2HXO A;  4XSZ F;  4GXO A;  1ZR4 A;  1UG2 A;  3PJR A;  1U5T B;  5D8K B;  1FJL A;  2QM3 A;  2VQC A;  1ZEL A;  3LA2 A;  5FLX Z;  3M3Y J;  5DYM A;  4OMY A;  3H92 A;  1R49 A;  4NNJ A;  2K7L A;  4M72 A;  2DFF A;  2WY8 Q;  5E8G A;  1O3S A;  5FKO A;  3LSH A;  2WTE A;  1FNN A;  5CVR A;  2HKX A;  3ZN1 A;  1AHD P;  2VBW A;  2YU3 A;  2L2O A;  4Y15 A;  1E3H A;  1Z7U A;  3WTU C;  2VAS A;  4FT8 A;  1UHS A;  3CJN A;  3LFK A;  4WXH A;  1F9N A;  5F64 A;  4E6K G;  3KLN A;  5CPR B;  2ZXI A;  3K4J A;  2X1C A;  4WX9 A;  5IP6 A;  5LHH A;  2HNH A;  1X2N A;  1QVU A;  3O8H A;  1U2W A;  2TDX A;  3BQY A;  2IXS A;  3F23 A;  2A6H F;  2BHZ A;  3SZP A;  3WTX C;  3ZOB A;  2HVS A;  1WWX A;  3I58 A;  4BQO A;  3HL2 A;  2E1C A;  1SFU A;  4CGZ A;  1V54 H;  4CA0 A;  3F22 A;  2FMY A;  1SAN A;  1ZG3 A;  4AD9 A;  5C44 J;  2Q1Z B;  4FHT A;  2XF6 A;  2EFO A;  2GA1 A;  2DW4 A;  1VQM I;  3G3Z A;  3CCM I;  1SVL A;  3PFY A;  1SAX A;  3HDD A;  2VB6 A;  1W7P B;  1D8J A;  3IAM 2;  3P7N A;  2PJP A;  2V1U A;  1S7A A;  2VIX A;  2M1B A;  4M3G A;  1IRF A;  1OYI A;  5H6Q A;  2AO9 A;  1KZH A;  4WK8 F;  3ABK H;  4IRI A;  3SXY A;  1QQI A;  5J3L A;  3BJ6 A;  2LKP A;  1BJZ A;  4I76 A;  3ZMZ A;  3PIP F;  3GFI A;  3CP2 A;  5LRS A;  1KGS A;  5F04 A;  1U6G A;  3U1K A;  3FBN B;  2LOO A;  3Q5F A;  5FO5 A;  3BOQ A;  4JX6 A;  5GPA A;  5LFA A;  3ZR8 X;  4CCN A;  2EZI A;  2O5R A;  1P6R A;  2KDO A;  3WU0 A;  1ETK A;  2IP2 A;  1CF7 A;  3HOV J;  2YR2 A;  5F1J A;  1ACI A;  1HOM A;  2PX9 A;  4ZJZ A;  2KMU A;  5IY5 H;  4A3L J;  1SFK A;  3DPU A;  1IN5 A;  4NB5 A;  2OUM A;  2H27 A;  1YJ9 I;  4D0P A;  2MBF A;  4IF4 A;  2R4G A;  1K78 B;  5HS9 A;  4XLF A;  3B73 A;  1R71 A;  2KJB A;  1LVA A;  3QQA A;  5CVV A;  2ZSH B;  2IEK A;  4HBL A;  2PI0 A;  4XLA A;  1H9G A;  2M4K A;  1D1C A;  1H8A C;  2VJ4 A;  3CCS I;  2VJI A;  1ZRD A;  2YUS A;  2R93 J;  3ZXS A;  2F4O B;  5A2Q K;  2CG4 A;  2QF7 A;  1MZB A;  1S5L C;  3EET A;  3Q9S A;  2EIM H;  2HOS A;  1I1S A;  2V9P A;  3S1N J;  4X6A J;  1QO0 D;  9ANT A;  1ETY A;  1XCB A;  3H0D A;  2CW7 A;  5E79 C;  2QSG X;  1KQ8 A;  2DT6 A;  2VBX A;  2XGX A;  4AWX B;  2PG4 A;  2FML A;  3FXR A;  1FBQ A;  1OCO H;  3WG7 H;  3DP7 A;  3T5X A;  2DI3 A;  2KIM A;  3JRE A;  5GPC A;  3LQR A;  2W7N A;  3TKY A;  1XMX A;  2ZBK A;  3BTJ A;  4MFE A;  3ZN0 A;  4GDF A;  2X6W A;  1V5G A;  4MQ9 F;  3H9Q A;  3K69 A;  2WV0 A;  2EIJ H;  2DCE A;  3HOZ J;  4ZYG A;  3S93 A;  3N97 A;  4CCJ A;  4KMF A;  1Y1W J;  1QPI A;  4IVN A;  3MVP A;  1I50 J;  2A05 A;  2IRF G;  4RMN A;  4R79 A;  1UZC A;  3LSI A;  1I3A A;  1LB2 A;  1OJL A;  3RQI A;  2HGC A;  2ISY A;  5GAG J;  2GXG A;  3GW2 A;  1IN7 A;  5GAE J;  5K7F A;  4L5J A;  3CCV I;  2UWM A;  1YIT I;  1ZAO A;  3RDI A;  3OWT A;  2E71 A;  2L7K A;  4N0B A;  1T95 A;  3OYG A;  2K40 A;  1NH3 A;  4CCM A;  1BA5 A;  4DW6 A;  4ZTF A;  4YEL A;  2DTR A;  1JHF A;  1Z7L A;  1VTN C;  2EFW A;  2DA5 A;  2XRL A;  2JPB A;  2HDC A;  4B3X A;  1WJF A;  1YOV B;  2XIG A;  1ZGJ A;  3Q9V A;  4BDZ A;  3IHU A;  2PEX A;  2L7M P;  4XL9 A;  2ME0 A;  1LJ9 A;  3CUQ C;  3E97 A;  2BZT A;  1PUF A;  2DJN A;  3QP5 A;  2M30 A;  4Y33 A;  3HRT A;  3G71 I;  1RR7 A;  2YX7 A;  5EDN A;  1OMI A;  4W97 A;  1RUO A;  1YX5 A;  1VND A;  2W25 A;  1IC8 A;  4EQQ A;  1P2F A;  3I5U A;  1A35 A;  4I6Z A;  1QA6 A;  1B59 A;  5TGT A;  3RKW A;  2PBI A;  3CDH A;  1LFP A;  2IJL A;  1YO5 C;  2R92 J;  1U3E M;  4XLP F;  3ECH A;  1B6A A;  4OAY A;  2BGC A;  4ZYH A;  1BBY A;  4XOR A;  3VYT B;  3LNQ A;  1FYL A;  3ZMU A;  2DDA A;  3S2D J;  1ONV A;  5C4X J;  1KQ0 A;  2KRF A;  3REO A;  2V9V A;  4XR6 A;  4AVZ A;  2GQQ A;  3H5R A;  1WFX A;  3ML6 A;  3E6C C;  1JT6 A;  3GFL A;  3HIF A;  2V26 A;  4J19 A;  3TOB A;  4AIH A;  1X1C A;  4BS9 A;  3IL2 A;  2XAQ A;  1YI2 I;  4CIC A;  5DUK A;  4IPA A;  4P9U A;  2E5N A;  2ELH A;  2BOL A;  5HLG A;  1BI1 A;  1IN4 A;  2HFH A;  3OYL A;  1L3L A;  4PZJ A;  4HX8 A;  2IS6 A;  3H5N A;  1ETX A;  2KL4 A;  3F8F A;  5DCF A;  2EA2 A;  3ABU A;  3RCO A;  3BRO A;  2W82 A;  2QEN A;  2KLO A;  2FUG 2;  3WE3 A;  3WGG A;  4NQW B;  5BOX A;  3WTW C;  4PFP A;  3BY6 A;  5IYB J;  4RAF A;  3KP2 A;  4A0Y A;  2F6C A;  4RB1 A;  2MH9 A;  4X0G A;  1XDS A;  4JX5 A;  4U7D A;  4ZYE A;  2XPU A;  1FSH A;  3ONQ A;  3VB2 A;  2CQX A;  2J5O A;  3W2W A;  2CUE A;  2E1O A;  2DA1 A;  2W4S A;  2VI6 A;  4P55 A;  2R7W A;  1Z6R A;  2JA8 J;  1UFM A;  1ZRF A;  4PJN A;  2LBF B;  4A5M A;  2NXN B;  2NNN A;  1VQP I;  1JTY A;  3HPH A;  5BNG A;  1BOB A;  1TWG J;  3MEX A;  3QOE A;  3ROU A;  2P7C B;  2XV4 S;  1BI2 A;  4PK4 A;  3K7A J;  1S7O A;  1XTA A;  2JMW A;  4X1E A;  2NOG A;  2FOK A;  3HKZ A;  4LLL A;  4BE1 A;  1KU3 A;  5LGT A;  3W6K B;  1Y8Q B;  1G6N A;  5GAD J;  4E7J A;  3JW4 A;  4PJJ A;  1MBK A;  4M6V A;  2JA7 J;  3MQ0 A;  1Y8R B;  3A4C A;  3PSI A;  5EGO B;  4JX4 A;  4ZDO A;  1I5Z A;  1DU0 A;  3QYE A;  5F0C A;  1BOA A;  1VI0 A;  1BI3 A;  1HSJ A;  5KK1 A;  3E5X A;  3M9A A;  1G3Y A;  5ILV A;  2B7E A;  1TW2 A;  1KA8 A;  2IA1 A;  2ZJR F;  1BM9 A;  3QU6 A;  3AG2 H;  5JLX A;  2V1N A;  4EM1 A;  2CO5 A;  3PUF A;  2EBI A;  3IRR A;  5FB2 A;  4E7Z A;  3R0A A;  1STZ A;  2AQE A;  3L2C A;  4GGG A;  3K2Z A;  4I0A A;  1Z3X A;  1TNS A;  2XAG A;  2JUG A;  3OL3 A;  5LEK A;  1N78 A;  2VE9 A;  1ZGA A;  4HSR A;  1K83 J;  1CGP A;  1K6O A;  2KT0 A;  3DEU A;  2IGK A;  3CUO A;  1GXQ A;  1ZG1 A;  2XAS A;  2VPL A;  2CFX A;  1JTX A;  4I99 C;  1PYV A;  1MBF A;  3KLO A;  4OIQ F;  4WXC A;  1T39 A;  1J5Y A;  3BLY A;  3WE2 A;  4O3M A;  2GA2 A;  4YIF A;  1TP4 A;  1BR2 A;  2GZW A;  3BZ6 A;  1JHH A;  2H09 A;  3NEU A;  1TC3 C;  1XCV A;  3V8L A;  1NHA A;  2P81 A;  3BR1 A;  1B8I B;  1XGN A;  2DAO A;  3H9J A;  3MN2 A;  4BEH B;  1BI0 A;  1DP3 A;  4HOB A;  2ZME B;  3OV8 A;  4C2U A;  3HSR A;  4A3J J;  2Y9Y A;  5HLI A;  1SMY F;  2Z2S B;  1PUE E;  1RKT A;  2CQ7 A;  3FWE A;  5F27 A;  3BC8 A;  2ZJ2 A;  1IRG A;  4XLN F;  4RS8 A;  5CLS A;  4OIN F;  2XAJ A;  3HSE A;  2JQ7 A;  4I09 A;  2M7B A;  2R5Y A;  1P4W A;  1TNT A;  1U0J A;  4AVP A;  5F1R A;  3QPS A;  4XNF A;  3GWZ A;  1FY7 A;  2ZO4 A;  2X51 A;  3IAS 2;  4B09 A;  3DWL E;  1TQM A;  3WU2 C;  3ASN H;  4MTE A;  4QWQ A;  3RPU D;  5HVQ C;  1TL8 A;  3E0J B;  4E7K A;  2D5V A;  1EV7 A;  2Y69 H;  4EJV A;  3DPT A;  3G1L A;  3KE2 A;  3KIO A;  2K9L A;  3H3Z A;  3ISP A;  4PCQ A;  4OU0 A;  4AIJ A;  4BQN A;  3L9F A;  1YRN B;  4XRS A;  1R58 A;  1BR4 A;  3KP7 A;  1BR1 A;  3QPT A;  1BW5 A;  3J7Z I;  1JKP C;  5KCM A;  4BE2 A;  2ADU A;  2M45 A;  5FFX A;  3H0G J;  3QP6 A;  5FGM A;  2WBM A;  3QU3 A;  3VEP A;  4RB2 C;  4BYY A;  4I98 B;  2P5L C;  3B6C A;  3LMM A;  2KIF A;  3WHB A;  4Z6Y A;  2H1K A;  3JRG A;  1APL C;  4BXX J;  1ZN2 A;  2CH0 A;  2DQR A;  4HAM A;  4RAG A;  4IXA A;  3J81 K;  4V19 K;  4XKB A;  3GVA A;  5D8L B;  3KZI C;  3ULQ B;  4XLC A;  1S3J A;  1B4A A;  1MIJ A;  3BG9 A;  4HQM A;  1ZRE A;  1VQO I;  2DK8 A;  1K4T A;  4I02 A;  3KEO A;  4IX7 A;  2A6T A;  1D3Y A;  2V79 A;  3BPV A;  2K9Q A;  3V7C A;  3QYB A;  1D5Y A;  2BBY A;  3TP0 A;  1TW3 A;  2P8T A;  4OIP F;  4A0Z A;  3OYC A;  3GFM A;  2O0Y A;  3MKZ A;  1JKR C;  3K0L A;  3E6M A;  4Z2Y A;  1HQC A;  2YPR A;  4XKV A;  3EUH C;  2CUJ A; 
#chains in the Genus database with same CATH homology
 1IN6 A;  2Z5U A;  1FPQ A;  4IHS A;  1RNL A;  2VOP A;  2A69 F;  4UHT A;  2ZXJ A;  1FYK A;  4WCG A;  3HOT A;  3GUD A;  3KEQ A;  5L3E A;  4ZZL A;  1LNW A;  2RGV A;  3EYI A;  4P96 A;  3BJO A;  3HSF A;  3WU1 B;  3WTS C;  4U7B A;  5KVR A;  2FBH A;  5ED4 A;  2VON A;  4HLX A;  3KP4 A;  3KP6 A;  1UST A;  3LA3 A;  1D5V A;  6PAX A;  2HWV A;  2J5P A;  2COM A;  3GEZ A;  2NRA C;  3GLX A;  1FSE A;  2PQ8 A;  2JSC A;  4KUM A;  2XKO A;  1RIO H;  2BYV E;  4YFN F;  2W57 A;  1G4D A;  4BH9 A;  3HHH A;  3CUQ A;  2XUB A;  4L9T A;  4L0Y B;  2FXA A;  1W7P D;  4UVA A;  2IPQ X;  1YW8 A;  2HTS A;  2V1X A;  3R4K A;  4M71 A;  1SD5 A;  4I7H A;  2F5C A;  2LF7 A;  1QZZ A;  1K78 A;  4LFU A;  4KT5 C;  2EV0 A;  1EH8 A;  5K1Y A;  2F5F A;  2VBZ A;  2AS5 F;  4YFK F;  2IA0 A;  1MDM B;  1MJB A;  4KIC A;  2FBI A;  4M9X A;  2XHK A;  5FLX K;  4PGG A;  4M6X A;  1MGT A;  4TV7 A;  3KZY A;  3C7J A;  3GZ6 A;  1OPC A;  4OOI A;  2ESN A;  1SMT A;  2RC4 A;  4S05 A;  3HYI A;  1BN5 A;  4L0Z B;  1R1V A;  4O5V A;  1G3T A;  3P9C A;  4BXU A;  5DCM A;  1WQ2 A;  3HHG A;  2CYY A;  4A6D A;  2D1V A;  1YG2 A;  4EM2 A;  4BHC A;  3T8T A;  1ZRC A;  1IF1 A;  1S8N A;  4L18 B;  5L3C A;  2Y48 A;  3HTU A;  3RKX A;  4HLY A;  1FX7 A;  2MA3 A;  1XGO A;  1W5S A;  3F21 A;  5HOO A;  4ZZD A;  3KCC A;  1ZH5 A;  3GF2 A;  2CQK A;  2DU9 A;  4IHT A;  4HX7 A;  3V8K A;  5L3F A;  4OIO F;  2QYO A;  4U88 A;  3S2W A;  2A07 F;  4EGZ A;  1R23 A;  1KYZ A;  2ZFW A;  3I59 A;  1V3F A;  4XSX F;  4G7O F;  1EH7 A;  2EWN A;  4EJO A;  3IWF A;  1J75 A;  5CVI A;  1O3R A;  2IVM A;  4A12 A;  1UHM A;  3I71 A;  4U0V A;  5E17 F;  2YSR A;  3ZMS A;  3MZY A;  4KIF A;  2DPD A;  4KIG A;  3E6B A;  1FYM A;  1FP2 A;  3JAM Z;  4F7Z A;  4KIB A;  3MZH A;  1HBX G;  1YW9 A;  3BJA A;  5D5V B;  1U5T C;  3DF8 A;  4HZF A;  5CYV A;  5ILS A;  1O3Q A;  1RI7 A;  3FXU A;  1YLF A;  2OZ6 A;  5DDG A;  3VFZ A;  4G9Y A;  1KU2 A;  1KU7 A;  3P9K A;  5D4R A;  4LB5 A;  3FMQ A;  1XDU A;  3SQN A;  3IKV A;  1O7L A;  4A6E A;  5HDK A;  5ICG A;  1O57 A;  1I6X A;  2A3S A;  1OKR A;  2HS5 A;  3TOA A;  1S29 A;  1T2K A;  1ON1 A;  3HRM A;  4KFC A;  2IW5 A;  3V4G A;  1J0R A;  3F3X A;  1QPM A;  1R7J A;  3WG9 A;  3O6B B;  5CVU A;  4CO8 A;  4ETS A;  3FM3 A;  1UCR A;  5E8I A;  2Y75 A;  5E20 A;  1P4X A;  2C6Y A;  2FRH A;  2FF4 A;  2ZCW A;  4I0B A;  4FX0 A;  4KN4 X;  4ESJ A;  1YQA A;  2DQL A;  4HYE A;  1Z6T A;  1EH6 A;  2GAU A;  4HF1 A;  3FHZ A;  4A2U A;  3EUH A;  2VOO A;  2Z99 A;  3VOD A;  4LMY A;  2FQ3 A;  4Q47 A;  2MLK A;  2L4A A;  3ERE D;  4HX4 A;  2O8X A;  3GO5 A;  2JRT A;  2BEO A;  3IRQ A;  1Q1H A;  2PFB A;  3GZ5 A;  1J9I A;  1REP C;  2V6C A;  4MHG A;  1FT9 A;  2F5D A;  1P4A A;  4LK0 F;  5DD8 A;  5L3D A;  4GCV A;  2MC3 A;  4LG0 A;  1T6S A;  3WGI A;  1IN8 A;  3JTH A;  4ON0 A;  3R0J A;  1PP8 F;  4I2O A;  1CF7 B;  1MKM A;  4HF0 A;  1KU9 A;  1I1G A;  1L0O C;  1IAW A;  4RGU A;  1R22 A;  5FD5 A;  4YII A;  4HQE A;  3J80 Z;  5ICF A;  1O7F A;  2EV5 A;  2OZU A;  2XKP A;  2R7F A;  3JSO A;  3IKT A;  3I64 A;  4BHB A;  3VOE A;  4HA8 A;  2STT A;  1FBU A;  3QOP A;  3WTZ A;  3JSP A;  1TQI A;  3FF5 A;  3K1P A;  2JT1 A;  3V7S A;  1IUY A;  2P5V A;  2Q8K A;  4EJU A;  2XRO A;  4G8X A;  5JI6 A;  5DD4 A;  5FFZ A;  3EDP A;  3PQK A;  3ZMD A;  5HDG A;  2H6B A;  2EV6 A;  3HTS B;  4M73 A;  2HYG D;  1ZLK A;  2L3D A;  3RJP A;  1FLI A;  2JPC A;  3T0Y A;  5BMZ A;  3C3W A;  2FNA A;  1QGP A;  1HW1 A;  1JGS A;  2QQ9 A;  2HKO A;  2FA5 A;  2BE5 F;  5ICE A;  2Z9O A;  2GWR A;  4U0Y A;  3NRV A;  2V1D A;  1E2X A;  4UVB A;  3ELK A;  3KP5 A;  1ZLJ A;  2FNP A;  2F5E A;  1DPU A;  5IT9 Z;  3CLO A;  2QQB A;  3M1E A;  4IJA A;  2CGP A;  2CW0 F;  2XRN A;  4AIK A;  3RPU A;  3F6V A;  1BIA A;  4EJW A;  2PMH A;  3HRU A;  4PDK A;  1GVJ A;  1LDJ A;  2XAF A;  3OOP A;  1HW2 A;  1MJA A;  2MLG A;  2EA4 A;  3NQO A;  1USS A;  2EFQ A;  2Y0M A;  4M6Y A;  1U78 A;  3TO6 A;  4ENN A;  4MEX F;  3F8M A;  2L4M A;  1Z9C A;  4E70 A;  2W24 A;  2H94 A;  3K1M A;  3SHF A;  3FZV A;  4ENJ A;  5D5W B;  4UV9 A;  2NAZ A;  2PLY A;  2OU2 A;  2HR3 A;  2O03 A;  4CZZ A;  2D45 A;  4JBA A;  1B9N A;  4YG2 F;  4EVI A;  2K86 A;  1U5T A;  3DFG A;  2HQR A;  2O6G E;  4P9F A;  2DO7 A;  4M9S A;  3R60 A;  1XB4 A;  3WTV C;  4BQA A;  1F4K A;  1LDD A;  2YX4 A;  3F6O A;  1DP7 P;  1MJ9 A;  1TQP A;  4K2E A;  3EQL F;  1LQ1 A;  3L09 A;  5BQT A;  5K5R A;  2DBB A;  4LB6 B;  1RUN A;  2W84 A;  2HYF A;  5F6F A;  2RVC A;  1ZHF A;  3COA C;  2UXX A;  2ACJ A;  4B8X A;  2Q0O A;  3ZQ7 A;  3CO6 C;  1K7A A;  2HEO A;  5LGU A;  4CHU A;  1SD6 A;  1W7P A;  3F8C A;  2VN2 A;  3BPX A;  3DPL C;  3LST A;  1YFH A;  3K1N A;  2B0L A;  2E1N A;  2RKH A;  3KZZ A;  1V4R A;  2QUF A;  2EFN A;  1T0F A;  2BV6 A;  3LAP A;  3B02 A;  2FE3 A;  1T98 A;  2VT2 A;  5ICC A;  2FEZ A;  2R7D A;  3E5U A;  4EV0 A;  4KMU X;  4LD5 A;  3WGH A;  4GYG A;  1XD7 A;  4G7H F;  2G9W A;  5H20 A;  1W5T A;  3WTY C;  2D1H A;  2RQP A;  5AIQ A;  4G6D A;  2G7H A;  4HW0 A;  2IT0 A;  5K5Q A;  2ZNY A;  2ZKZ A;  1R36 A;  3R6S A;  5E1W A;  4RGS A;  1OYY A;  1T38 A;  1A04 A;  2MH2 A;  3TGN A;  1ZAR A;  2Z33 A;  2VC0 A;  4KA4 A;  1E17 A;  3J7A O;  5J6X A;  5J8F A;  1XSX A;  2VC1 A;  3K9T A;  1UHW A;  5CJ9 A;  1YYV A;  2VXZ A;  3I0T A;  1XSD A;  1XSV A;  3LWF A;  1KYW A;  2W85 A;  4DQ2 A;  4MGR A;  3TO9 A;  3RKY A;  2CSO A;  2ISZ A;  1J2X A;  1GXP A;  4WF2 A;  4M74 A;  2M87 A;  5BS6 A;  4CXF A;  5D5X B;  2M5W A;  4ZYD A;  2UZK A;  2OD5 A;  1HST A;  2KJC A;  1BIB A;  1YIO A;  1LEA A;  3PQJ A;  3E5Q A;  3JTG A;  1YS6 A;  3CO7 C;  5AON A;  2DLL A;  1FBS A;  3H3U A;  2HTJ A;  4MQV A;  1D8K A;  1AOY A;  4U0W A;  2E7W A;  2NNY A;  1QZY A;  1XGM A;  4JQF A;  2PN6 A;  5AIP A;  3GFJ A;  3V7R A;  2QBY B;  4IRG A;  1Y0U A;  1FC3 A;  5LRR A;  5H6R A;  5JFR A;  4WXD A;  5LEJ A;  4LGW A;  3E6D A;  5E1Z B;  3GXO A;  4L5I A;  3JAM K;  1C0W A;  3HRS A;  3DKW A;  2LDU A;  2HQN A;  3F8B A;  5LLQ A;  3CUQ B;  2DFI A;  2QLZ A;  1PDN C;  1IXS B;  1JXS A;  2Z3Y A;  2HOE A;  2WWY A;  4S04 A;  1IXR C;  1R5H A;  1IW7 F;  2WC2 A;  2OQG A;  1LEB A;  1K79 A;  5D4S A;  2QZ8 A;  3U9G A;  4EMS A;  2LF8 A;  1O3T A;  1BC7 C;  4NQW A;  2P6T A;  2JTV A;  3O3K A;  3P9I A;  1WSU A;  1Z05 A;  3BDD A;  2FBK A;  3KET A;  2R3S A;  4KN7 X;  4LJZ F;  2P4W A;  2ZNZ A;  3U2R A;  4EJT A;  2EK5 A;  1HW5 A;  2X4H A;  1H9T A;  1F5T A;  2RV8 A;  1QBJ A;  4OMZ A;  4R1H A;  3FMS A;  2QWW A;  5A2Q Z;  1FOK A;  3MFK A;  3ZMV A;  2GXB A;  1TBX A;  4HDV A;  2PMU A;  4ENM A;  3IWZ A;  2A68 F;  3R61 A;  4N9H A;  2ETH A;  5JR3 A;  2VT3 A;  4PGH A;  3F8N A;  4P5O A;  3M7G A;  3QPH A;  2K27 A;  3D5L A;  1DDN A;  3RTR A;  5DCM B;  5L3B A;  4UXN A;  2XAH A;  1S6L A;  1BC8 C;  3N4M A;  2IA2 A;  2K4B A;  1OR7 A;  4RB0 A;  3EYY A;  3LQQ A;  3RI4 A;  5ERI A;  4ESB A;  1F1Z A;  5LHG A;  3O2P E;  4Y13 A;  2OA4 A;  3DV8 A;  2KKO A;  1UB9 A;  4R8H A;  3BWG A;  2P7V B;  2ESH A;  2O3F A;  4JK1 X;  3MAJ A;  4RAZ A;  1RZ4 A;  4GYI A;  5J8C A;  1MD0 A;  3I59 B;  2ZME A;  3RYR A;  3HOS A;  1U8R A;  1WKM A;  2L01 A;  2DT5 A;  1R1T A;  1BJA A;  1Z1D A;  3C1D A;  2RNJ A;  1ODD A;  5EEH A;  3J80 K;  1TLH B;  5D6E A;  2A5Y B;  1YW7 A;  2EJR A;  1SD7 A;  1HXD A;  3BP8 A;  3LAJ A;  2RN7 A;  2L02 A;  4LLN A;  5HS8 A;  1G3W A;  4KNY A;  2VOD A;  2NS0 A;  3MCZ A;  2DPU A;  4Y17 A;  1ZYR F;  1WRJ A;  3TDU C;  1J59 A;  3T1B A;  4RAY A;  1GHC A;  2VBY A;  4CYD A;  3U1D A;  1ZG5 A;  2VE8 A;  4O6J A;  5DEQ A;  4WWC A;  1HKS A;  5LBQ A;  3D0S A;  2KIU A;  2LNB A;  4XBF A;  1FZP B;  1SFX A;  2L54 A;  2H6C A;  5HLH A;  1Z91 A;  1B1B A;  3ZP5 A;  3KP3 A;  5HDN A;  5E1X A;  3WTT C;  4Q4Z F;  3I53 A;  4L9N A;  1YTY A;  4UV8 A;  2GIV A;  2OQR A;  3GX4 X;  2FU4 A;  4KDP A;  2JZY A;  1HKQ A;  4CDG A;  1DUX C;  3HUG A;  3RPQ A;  3QAH A;  2Q2E A;  1IZ1 A;  2P5K A;  3QRF F;  2XVC A;  4G7Z F;  3T8R A;  4A0X A;  4Q5S F;  3IC7 A;  4MEY F;  5TJJ A;  5IT9 K;  4FX4 A;  4L9J A;  2CWE A;  4RGR A;  1KQ9 A;  5D6F A;  4EM0 B;  1R00 A;  4NHJ A;  1SD4 A;  1YS7 A;  5TRD A;  2P6S A;  5DV5 A;  2O61 A;  4RB3 C;  3FM5 A;  2QVO A;  5LHI A;  3C18 A;  4MTD A;  4L9V A;  5JVT A;  2MD5 A;  2UXN A;  3W6J B;  4HDU A;  4MNU A;  2X0L A;  5EEG A;  4DNC A;  3MWM A;  3ZPL A;  1R5G A;  3CTA A;  2A6E F;  2QQA A;  4EGY A;  1XGS A;  4ASN A;  4HF2 A;  2FSW A;  4LG0 B;  2AXL A;  4QLC U;  1ULY A;  3PFI A;  4ENK A;  4HV5 A;  4UVC A;  3L00 A;  1JE8 A;  4UUV A;  1P92 A;  3AAF A;  3LA7 A;  3DXJ F;  3RIR A;  4G94 A;  5BPI A;  3I54 A;  4LLG F;  3FX3 A;  4I01 A;  2OBP A;  1MDM A;  5K5O A;  1TTY A;  3M8F A;  1W4M A;  2RDP A;  5E18 F;  3M8E A;  5JHU A;  3SFZ A;  4BAY A;  5IT3 A;  1OYW A;  4HV6 A;  5CVJ A;  4UNO A;  3RYP A;  3V8J A;  5DUI A;  3J81 Z;  3E3V A;  1AWC A;  1SFE A;  1FWZ A;  2E7X A;  4YFX F;  4OIR F;  1H0M A;  1R1U A;  4BHP A;  2K02 A;  1X3U A;  3FMR A;  2LSO A;  3L7W A;  1B9M A;  3ABT A;  4Q48 A;  1HKT A;  3TO7 A;  3KFW X;  4ESF A;  3G73 A;  2HZT A;  1IXC A;  2F2E A;  5FD6 A;  3GYH X;  1J7K A;  2G7U A;  4GO1 A;  2A61 A;  3SZT A;  4XRF A;  1QNT A;  2QBY A;  2NYX A;  3FXQ A;  4ZH4 F;  5L3G A;  4N9I A;  2DK5 A;  1XN7 A;  4RGX A;  1XMA A;  5HS7 A;  4G6Q A;  2OAZ A;  1LDK B;  4BNC A;  3I4P A;  2D2W A;  1FP1 D;  1DPR A;  5D5U B;  4LK1 F;  3ZMT A;  5ILU A;  1I27 A;  3ECO A;  4M9Z A;  4H0E A;  1XMK A;  1ON2 A;  1WI9 A;  1G3S A;  4A5N A;  5BPD A;  2M8E A;  3WOD F;  3F72 A;  5LGN A;  4KYW A;  3TQN A;  2STW A;  2K4J A;  2EFP A;  3DQV C;  4IRH A;  2EB7 A;  3TDZ C;  1PP7 U;  4XSZ F;  4GXO A;  1U5T B;  5D8K B;  2QM3 A;  5FLX Z;  3LA2 A;  5DYM A;  4OMY A;  3H92 A;  2K7L A;  4M72 A;  1O3S A;  5E8G A;  2WTE A;  1FNN A;  5CVR A;  2HKX A;  3ZN1 A;  2VBW A;  2YU3 A;  4Y15 A;  1Z7U A;  3WTU C;  5F64 A;  4FT8 A;  3CJN A;  3LFK A;  4WXH A;  1F9N A;  3KLN A;  4WX9 A;  5LHH A;  1U2W A;  2TDX A;  3F23 A;  2A6H F;  3SZP A;  3WTX C;  1WWX A;  3I58 A;  2E1C A;  1SFU A;  4CGZ A;  3F22 A;  2FMY A;  1ZG3 A;  4AD9 A;  4FHT A;  2EFO A;  2GA1 A;  2DW4 A;  3G3Z A;  1SAX A;  1W7P B;  1D8J A;  3P7N A;  2PJP A;  2V1U A;  1S7A A;  2M1B A;  1IRF A;  1OYI A;  5H6Q A;  4WK8 F;  4IRI A;  3SXY A;  1QQI A;  3BJ6 A;  2LKP A;  3GFI A;  3ZMZ A;  5LRS A;  1KGS A;  1U6G A;  3Q5F A;  5FO5 A;  3BOQ A;  1P6R A;  3WU0 A;  2IP2 A;  1CF7 A;  2YR2 A;  1IN5 A;  4NB5 A;  2H27 A;  4D0P A;  2MBF A;  4IF4 A;  1K78 B;  5HS9 A;  3B73 A;  2KJB A;  1LVA A;  5CVV A;  2PI0 A;  4HBL A;  1H9G A;  1ZRD A;  5A2Q K;  2CG4 A;  1MZB A;  3EET A;  3Q9S A;  1I1S A;  1QO0 D;  1XCB A;  1KQ8 A;  2VBX A;  2XGX A;  4AWX B;  2PG4 A;  2FML A;  3FXR A;  1FBQ A;  3DP7 A;  3T5X A;  2DI3 A;  2KIM A;  3LQR A;  3TKY A;  3ZN0 A;  2ZBK A;  4MQ9 F;  3K69 A;  2WV0 A;  4ZYG A;  3N97 A;  4KMF A;  4IVN A;  2IRF G;  4R79 A;  1LB2 A;  2HGC A;  2ISY A;  2GXG A;  3GW2 A;  1IN7 A;  4L5J A;  2UWM A;  1ZAO A;  3RDI A;  4N0B A;  2DTR A;  1JHF A;  1VTN C;  2EFW A;  2JPB A;  2HDC A;  2XIG A;  1ZGJ A;  3Q9V A;  3IHU A;  2PEX A;  1LJ9 A;  3CUQ C;  3E97 A;  3QP5 A;  2M30 A;  3HRT A;  2YX7 A;  1OMI A;  1RUO A;  2W25 A;  4EQQ A;  1P2F A;  3I5U A;  1B59 A;  3RKW A;  2PBI A;  3CDH A;  2IJL A;  1YO5 C;  1U3E M;  4XLP F;  3ECH A;  1B6A A;  2BGC A;  4ZYH A;  1BBY A;  1FYL A;  3ZMU A;  1ONV A;  1KQ0 A;  2KRF A;  3REO A;  2V9V A;  2GQQ A;  3ML6 A;  3E6C C;  3GFL A;  3HIF A;  3TOB A;  4AIH A;  3IL2 A;  2XAQ A;  4CIC A;  5DUK A;  4IPA A;  4P9U A;  2ELH A;  5HLG A;  1BI1 A;  1IN4 A;  2HFH A;  1L3L A;  4PZJ A;  4HX8 A;  3F8F A;  5DCF A;  2EA2 A;  3ABU A;  3BRO A;  2QEN A;  3WE3 A;  3WGG A;  5BOX A;  3WTW C;  3BY6 A;  3KP2 A;  4A0Y A;  4RB1 A;  2MH9 A;  1XDS A;  4U7D A;  4ZYE A;  1FSH A;  3VB2 A;  2J5O A;  4P55 A;  1Z6R A;  1UFM A;  1ZRF A;  4A5M A;  2NNN A;  3MEX A;  3ROU A;  2P7C B;  2XV4 S;  1BI2 A;  1S7O A;  4LLL A;  2FOK A;  1KU3 A;  5LGT A;  3W6K B;  1G6N A;  3JW4 A;  3MQ0 A;  1I5Z A;  1BOA A;  1BI3 A;  1HSJ A;  5KK1 A;  3E5X A;  3M9A A;  1G3Y A;  5ILV A;  1TW2 A;  1KA8 A;  2IA1 A;  1BM9 A;  3QU6 A;  4EM1 A;  2CO5 A;  3IRR A;  5FB2 A;  3R0A A;  1STZ A;  3L2C A;  4GGG A;  3K2Z A;  4I0A A;  1TNS A;  2XAG A;  5LEK A;  2VE9 A;  1ZGA A;  1CGP A;  1K6O A;  3DEU A;  3CUO A;  1GXQ A;  1ZG1 A;  2XAS A;  2CFX A;  4OIQ F;  3KLO A;  4WXC A;  1T39 A;  1J5Y A;  3WE2 A;  4O3M A;  2GA2 A;  4YIF A;  2GZW A;  3BZ6 A;  1JHH A;  2H09 A;  3NEU A;  1XCV A;  3V8L A;  1NHA A;  1XGN A;  2DAO A;  1BI0 A;  4HOB A;  2ZME B;  3OV8 A;  3HSR A;  5HLI A;  1SMY F;  1PUE E;  3FWE A;  2ZJ2 A;  1IRG A;  4XLN F;  4RS8 A;  5CLS A;  4OIN F;  2XAJ A;  3HSE A;  4I09 A;  1P4W A;  1TNT A;  5F1R A;  4AVP A;  3GWZ A;  1FY7 A;  2ZO4 A;  4B09 A;  1TQM A;  4MTE A;  4QWQ A;  5HVQ C;  1EV7 A;  4EJV A;  3DPT A;  3KE2 A;  3H3Z A;  3ISP A;  4PCQ A;  4OU0 A;  4AIJ A;  3L9F A;  1R58 A;  3KP7 A;  3QPT A;  2ADU A;  2M45 A;  5FFX A;  3QP6 A;  5FGM A;  3VEP A;  3QU3 A;  4RB2 C;  4BYY A;  4I98 B;  2P5L C;  2KIF A;  1ZN2 A;  2DQR A;  4HAM A;  4IXA A;  3J81 K;  3GVA A;  5D8L B;  3ULQ B;  1S3J A;  1B4A A;  1ZRE A;  4HQM A;  2DK8 A;  4I02 A;  3KEO A;  1D3Y A;  2V79 A;  3BPV A;  3V7C A;  2BBY A;  1TW3 A;  2P8T A;  4OIP F;  4A0Z A;  3GFM A;  2O0Y A;  3K0L A;  3E6M A;  4Z2Y A;  1HQC A;  2YPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...