2LDUA

Solution nmr structure of heat shock factor protein 1 dna binding domain from homo sapiens, northeast structural genomics consortium target hr3023c
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
MGHHHHHHSHMAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock factor protein 1
publication title Northeast Structural Genomics Consortium Target HR3023C
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 24
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2lduA01
2IA0A 4ENNA 2YSRA 3PQKA 5LEKA 4G94A 4B09A 2UZKA 1FZPB 1ZRDA 3SXYA 1OYWA 3E5UA 1R1VA 4ZZDA 5D4SA 4PCQA 3F6OA 5DYMA 3P9IA 3RPUA 4WXHA 2E7XA 4QLCU 1XCBA 5K5OA 3WTWC 4HQEA 4MEXF 1J0RA 5ICGA 2QM3A 3V4GA 3Q5FA 1BI2A 4I7HA 4IRIA 2WC2A 2OQGA 3BY6A 3MWMA 4S04A 5D5VB 4HDVA 1TQPA 3GFJA 1HXDA 4G6DA 1YW7A 4ESBA 1UCRA 3SZPA 2HKXA 2V1DA 1UHWA 2ETHA 4IHSA 3E3VA 1C0WA 3NQOA 4FT8A 1EV7A 5JI6A 4CXFA 3HSEA 1B9MA 2XRNA 4CDGA 4ZYHA 2OQRA 1ODDA 1MD0A 4HZFA 1YYVA 3FMRA 3E6BA 4UXNA 3GO5A 3EUHA 1T6SA 1BIAA 2QLZA 5DCFA 3N97A 3ECHA 2V6CA 2UWMA 1GXQA 2G9WA 3E6CC 3GW2A 2PJPA 5L3EA 3NEUA 2ESHA 2ZXJA 4YFNF 3F8MA 3R60A 1SFUA 3B02A 2HFHA 1KQ0A 4HA8A 5DUIA 1FSEA 2XAJA 1LVAA 2O3FA 1Z91A 1JGSA 4HX7A 4JK1X 1RIOH 3RPQA 2OU2A 1G6NA 3I5UA 4IVNA 4EMSA 4IRGA 1KQ9A 1IN6A 1Z05A 2FSWA 4AWXB 1XSXA 3RI4A 1ONVA 1O3SA 2P6TA 2BGCA 2G7UA 4ON0A 2RN7A 2ESNA 2GIVA 1FBQA 4U0YA 4BHPA 1O7FA 5BPIA 2PN6A 5HOOA 4IJAA 5LBQA 1ZG5A 3RIRA 3IL2A 2WV0A 2Q0OA 5JVTA 3HTSB 3R6SA 1HKQA 5LRSA 1R7JA 5DEQA 4WXDA 5HDNA 5EEHA 3HOTA 2VONA 4L0YB 1I27A 2LNBA 4I0BA 2XUBA 2OD5A 1QO0D 5HLHA 3R61A 4M72A 5K5RA 5LHIA 1R5HA 2E7WA 4MQVA 1IXRC 5HLIA 3M9AA 3ULQB 2CYYA 4HF1A 5FD6A 2NNYA 1H9GA 1XGMA 4UNOA 2IRFG 3TO6A 4HW0A 4OINF 2OBPA 3KP6A 4N9IA 2PI0A 4LK1F 3VFZA 2C6YA 1SMTA 3QP5A 2X4HA 3WTZA 3F21A 5HVQC 3E5QA 2YX4A 5DCMA 2XAHA 5L3FA 1RNLA 4U88A 2DLLA 3ZMSA 3K1PA 2L4MA 3KEOA 4P9FA 3C1DA 2FNAA 5KVRA 1D3YA 2P7CB 3ELKA 1ZYRF 1ZARA 3ML6A 2QENA 4WX9A 2HZTA 3U2RA 1LDJA 1L0OC 2MC3A 3DPTA 4LG0A 3HOSA 1K78A 4BH9A 2K27A 3U1DA 3W6JB 5ILUA 4A12A 5D5UB 4MQ9F 3F72A 2GA2A 5E17F 5JHUA 1HBXG 1KU9A 2Y75A 3L00A 4KNYA 1I5ZA 1S29A 2P4WA 1LQ1A 4M6XA 3M1EA 4L0ZB 1W7PD 3G3ZA 2VT3A 2PG4A 4P96A 3ERED 3I54A 4I2OA 4WXCA 2FQ3A 3TKYA 1A04A 3TQNA 2GXGA 2PMUA 2Y0MA 2A07F 2HS5A 5ICEA 1H0MA 5H6RA 3QP6A 4OU0A 3WU0A 1KGSA 4KN4X 2ZBKA 2M1BA 2ADUA 1W4MA 2XVCA 4ZZLA 2A6EF 3QPTA 1YW9A 3K1MA 4LFUA 2V1XA 4XBFA 3ABUA 1E2XA 1O7LA 4CYDA 5CVIA 3M7GA 2QUFA 2XV4S 3JAMZ 5E1WA 1LDKB 5TRDA 2FA5A 1SFXA 1KU2A 1T98A 2G7HA 5HDKA 3GUDA 2GA1A 1SD5A 3FMQA 3F8NA 3KCCA 3CO6C 2PMHA 3BP8A 4H0EA 1FPQA 1SD4A 5ILSA 1MDMB 1EH6A 1WWXA 1BBYA 4L9VA 4B8XA 4KIBA 2Z33A 3KEQA 5D8LB 3RKYA 3BJ6A 4MTEA 2VN2A 1UB9A 3CLOA 4HF0A 4M9XA 1K7AA 3T8RA 4L9TA 2FBIA 2X0LA 3DP7A 4U0VA 4GO1A 3M8FA 4YIIA 2Y48A 2H6CA 3I59B 2IJLA 3GYHX 3LQQA 4GYIA 5E20A 2HWVA 4KIGA 3BZ6A 3S2WA 4CGZA 4A6EA 3P9KA 3O6BB 3TO9A 1CGPA 2VC1A 2GZWA 4KUMA 3WTTC 4L5JA 3JTHA 4YIFA 1BN5A 2XHKA 2D45A 1F1ZA 1Z6TA 1BC8C 1TW3A 3DKWA 3HRTA 4EV0A 4A0ZA 1V4RA 5LHGA 5AIPA 3WGIA 1SD6A 3R4KA 5F6FA 3VODA 4UV9A 5A2QK 1XSDA 1XGNA 2WWYA 1YG2A 4LD5A 5FLXZ 1UFMA 2MH2A 4HV6A 2YX7A 3T1BA 2KIMA 4Y17A 5AIQA 1E17A 3U9GA 1B1BA 2IT0A 3LAPA 4WF2A 3WGHA 4HOBA 5CVVA 3E97A 2RGVA 3P7NA 3WGGA 2KIFA 5JFRA 3F22A 1XDUA 3FMSA 5E1XA 4ETSA 4XRFA 5L3BA 4AD9A 3CUOA 3FHZA 4RAYA 1SMYF 2NRAC 4LK0F 5E8IA 1IN8A 2M87A 3W6KB 1B59A 3K2ZA 2HOEA 3EETA 3VEPA 1OKRA 3Q9SA 2VC0A 2MD5A 1R36A 1BM9A 3I58A 3VB2A 4KDPA 4HLYA 1QZYA 3G73A 4LGWA 4EM2A 4MNUA 3KETA 3BWGA 4ENKA 2EFPA 1U5TA 1R1UA 3LWFA 3F23A 2VBZA 3NRVA 3BOQA 1QPMA 1J7KA 2ZKZA 2COMA 3V8JA 1ZREA 1I1SA 2CGPA 1HKTA 3WTUC 2QBYA 5FFXA 4RAZA 1WSUA 1T0FA 5L3GA 3MCZA 1P6RA 2FMLA 1S6LA 2FRHA 3K1NA 1YFHA 2CFXA 3IC7A 4RGUA 4EGYA 1YO5C 3K69A 4CHUA 1L3LA 4I98B 3CUQA 5KK1A 1I6XA 1USTA 3D0SA 4A5NA 1HSJA 2F5CA 1T39A 1YS7A 4U7DA 2A61A 2ZNYA 1ZGJA 1IXSB 3KFWX 2O0YA 5DDGA 1U8RA 3I64A 2GWRA 4RB2C 5J8FA 1HSTA 2FF4A 2KRFA 5FFZA 4HAMA 1D8JA 2EB7A 2O6GE 4OIPF 1ZLJA 3RJPA 1MJ9A 2ZJ2A 2VE9A 2RDPA 1G3YA 2EA2A 4CZZA 3HUGA 3QU6A 3TDUC 4ZYGA 2DFIA 2XAGA 1WQ2A 3IWFA 1JHFA 4LLLA 4LLNA 1Q1HA 2P6SA 1BC7C 2QZ8A 3GZ6A 4P9UA 1EH8A 3QOPA 4DNCA 4JQFA 5LGNA 3PQJA 5DCMB 4RB3C 4EQQA 2VBXA 3FF5A 3RKXA 4A6DA 5LHHA 1FYLA 2PEXA 3WG9A 3EQLF 5LLQA 1HKSA 1WI9A 5CVRA 3LA2A 4RB0A 2VBWA 3L9FA 1FP1D 3EDPA 5FB2A 4L9JA 4HF2A 2PBIA 2A69F 4AIHA 1UHMA 2VODA 3I53A 1OPCA 3JW4A 3TGNA 5ICCA 2PLYA 1IN5A 2QYOA 2DU9A 2QWWA 1S3JA 1IN4A 3F8FA 5LGTA 1FBUA 2XGXA 3F8CA 1JHHA 3ECOA 2KJBA 1P4AA 3LSTA 2DT5A 5D6EA 1WRJA 3V7RA 3RKWA 1FLIA 1Z1DA 4MTDA 1R00A 2EK5A 4ZH4F 4U0WA 4MEYF 3GEZA 1HW5A 5CLSA 4PGGA 4XSXF 2EV5A 1EH7A 1MGTA 1D8KA 5J8CA 3DF8A 2V79A 4UHTA 5IT3A 3QU3A 1J75A 2LKPA 3IHUA 4ZYEA 2OZ6A 3I0TA 1TQMA 1MKMA 1YQAA 3JAMK 1IZ1A 1TTYA 3WE3A 2IP2A 1GHCA 4WCGA 4I02A 4RGRA 2FEZA 4UVBA 3MZYA 1TBXA 4A0XA 2L01A 1T38A 1J9IA 1W5TA 4ENJA 3P9CA 2DQRA 3AAFA 3WE2A 4HV5A 1LB2A 2AS5F 3L09A 1XMAA 1DUXC 3TO7A 1IAWA 1XGSA 2HYFA 1MZBA 2R7DA 2EJRA 3HIFA 4GCVA 2GXBA 1KYWA 1P92A 2O03A 3HTUA 4UUVA 2VBYA 4G6QA 3J80K 2F5DA 2YU3A 2R7FA 3TOBA 1FT9A 3FZVA 2QQAA 2H09A 2DPUA 2Z9OA 2IW5A 4ESJA 1QNTA 4EJTA 4NHJA 1KQ8A 2M8EA 2FMYA 3KP7A 2XAQA 1ZN2A 1W7PB 3M8EA 2KKOA 4OIRF 2FNPA 4BHCA 2OA4A 1DP7P 2KIUA 3E6MA 3ZP5A 4PGHA 1R1TA 5K1YA 5BQTA 5HS8A 2RKHA 3C3WA 3COAC 1XB4A 4Q5SF 1O3RA 3FX3A 4KN7X 3E6DA 2ACJA 4EM1A 1ON2A 2ZMEB 1O57A 4RB1A 1FSHA 2HKOA 2K02A 1SAXA 3FXRA 2W25A 5LEJA 2HDCA 3V8LA 5E8GA 3H3ZA 4A5MA 3REOA 1S7OA 3RYRA 4Q48A 1HQCA 1PDNC 4XLNF 3IRRA 3WTVC 4DQ2A 2RNJA 3OOPA 2EFQA 2A5YB 3H92A 2O61A 3JSOA 1BI3A 3GFIA 1PP7U 3CJNA 4I09A 4ZYDA 4R79A 2P5VA 4HBLA 1FP2A 5EEGA 1F5TA 1B4AA 5J6XA 3HRUA 5BS6A 5H20A 4KICA 3HRSA 2H6BA 1ZHFA 1ZG3A 2XROA 1XDSA 3BDDA 4EJWA 1O3QA 1ON1A 3HSRA 4IHTA 2HGCA 1MDMA 2CQKA 1IF1A 3C18A 3DPLC 3FXQA 1OMIA 4RGSA 5DV5A 5ILVA 1QQIA 1V3FA 3R0JA 3T5XA 1FYMA 4OMYA 5HLGA 1XN7A 2M45A 2Z5UA 5D4RA 1R5GA 1RUNA 4M9ZA 1LEBA 4HX8A 1FY7A 1IW7F 1FOKA 3HSFA 1YTYA 4N9HA 3N4MA 2EV0A 2VOPA 4M71A 4FX4A 2IVMA 4LMYA 2NS0A 2BE5F 2L02A 2IA1A 3KP2A 3F6VA 1GXPA 2P5KA 5IT9Z 1ZGAA 3JTGA 4Q47A 5LRRA 4G7HF 4CICA 3D5LA 3PFIA 2VE8A 1FWZA 3KZYA 3SFZA 3LFKA 2BV6A 4YFXF 4KFCA 4IRHA 2W84A 3OV8A 3WODF 3HRMA 1REPC 1G3WA 4A2UA 2D1VA 4G7OF 3CUQB 2JRTA 4BYYA 1T2KA 5BMZA 2CG4A 2JPCA 2V9VA 2CSOA 1RI7A 3ZQ7A 1BI0A 2HQNA 1ZRFA 4M74A 1CF7A 5DD8A 1QGPA 3SZTA 3J81Z 2M30A 4KT5C 2RQPA 2P7VB 3RTRA 3H3UA 3KP4A 2MBFA 3ZN0A 1KU3A 2UXNA 5ICFA 2ZO4A 4FHTA 1K6OA 2Z99A 3KLOA 3V8KA 4FX0A 3CTAA 2FU4A 2QQ9A 5HDGA 1P4WA 1IN7A 3FWEA 3CDHA 4NB5A 2W24A 2NNNA 2WTEA 2XAFA 2RV8A 4OIQF 2H94A 3KZZA 1BOAA 4EVIA 5ED4A 5F1RA 3IKVA 4KMFA 5HS7A 1W5SA 2DAOA 2DW4A 1DDNA 3IKTA 4O3MA 1Y0UA 3WTSC 1K79A 1OYYA 1AWCA 5H6QA 3IRQA 3ZMDA 1IRFA 2VOOA 1ZLKA 2ISYA 3ZMUA 2TDXA 3KP3A 4K2EA 2VXZA 1RUOA 4G9YA 2K4JA 3C7JA 1R22A 1MJBA 3KLNA 3DFGA 3MFKA 1DPUA 1U5TC 3FM5A 2BYVE 3TDZC 3GXOA 1J5YA 2LF8A 1U3EM 3GWZA 2L54A 5BOXA 2DBBA 3GZ5A 2F5FA 2MH9A 3QPHA 1B9NA 1ULYA 1G3TA 1LJ9A 1FC3A 2PQ8A 4LLGF 2HTJA 3BPXA 2QVOA 2AXLA 3O2PE 3V7CA 2FBHA 1YW8A 2W57A 3GX4X 4LB6B 5BPDA 2BEOA 5FGMA 4O6JA 3ROUA 3LA3A 2MLKA 2STTA 3BROA 4I01A 3ZMVA 1QBJA 2EFNA 3GLXA 4ASNA 5LGUA 2MA3A 3CUQC 1WKMA 1IRGA 4TV7A 1KYZA 3B73A 3J7AO 1Z6RA 4LB5A 3MEXA 2J5OA 3I4PA 5CVUA 3MQ0A 1K78B 4LG0B 3FXUA 5E1ZB 4AIJA 1U78A 2HQRA 1R58A 1VTNC 2J5PA 4QWQA 4YFKF 3VOEA 1O3TA 5HS9A 2W85A 4BXUA 3FM3A 3SHFA 4JBAA 1KU7A 1USSA 1XMKA 3KP5A 4Z2YA 4BHBA 3MZHA 5FO5A 2RVCA 2DK8A 1F4KA 4NQWA 2RC4A 3T8TA 1BJAA 2P8TA 2OAZA 2GQQA 1MJAA 1FX7A 3HHHA 4KMUX 5AONA 2V1UA 4EM0B 4IPAA 2OZUA 1TNTA 4OOIA 1OYIA 2KJCA 1PP8F 1YLFA 3WTYC 5K5QA 4G8XA 4Y13A 3BPVA 1FYKA 4RS8A 4Y15A 1FBSA 3QRFF 4OMZA 4M6YA 4U7BA 2ZFWA 2MLGA 2Q2EA 3WU1B 1GVJA 1ZAOA 2HTSA 2UXXA 2JT1A 1J59A 2EFOA 4A0YA 2EWNA 4O5VA 2D2WA 4WK8F 3ISPA 3HYIA 4YG2F 1JE8A 5L3DA 3R0AA 2ZNZA 4S05A 2M5WA 2XKOA 4LJZF 1YS6A 1JXSA 1ZRCA 3DEUA 2GAUA 3RDIA 1DPRA 3I71A 1IXCA 2F5EA 2PFBA 2YPRA 1H9TA 4N0BA 4E70A 3GF2A 1YIOA 4G7ZF 2JPBA 1TNSA 5DD4A 3EYYA 2D1HA 4HYEA 4R1HA 3DQVC 2K86A 2XIGA 1G3SA 3GFMA 2DK5A 5D5XB 1LDDA 2HYGD 2YR2A 4EGZA 3T0YA 3MAJA 4EJUA 4M9SA 2FBKA 4M73A 3Q9VA 3IWZA 5TJJA 3CO7C 1D5VA 2DQLA 1SD7A 2ZCWA 1TLHB 3K0LA 2A68F 4XSZF 4KIFA 5E18F 5CVJA 3L2CA 2JTVA 2NAZA 2B0LA 1XD7A 5D6FA 4F7ZA 4HX4A 3BJOA 2VT2A 4P5OA 2FE3A 2STWA 4PZJA 5DUKA 2FXAA 1Z9CA 2DPDA 4MGRA 2LDUA 4IXAA 1XGOA 3KE2A 4Q4ZF 3ABTA 3E5XA 4UVCA 1AOYA 4HDUA 4MHGA 4KYWA 3O3KA 4RGXA 5ERIA 3GFLA 2O8XA 5CYVA 5FLXK 1IUYA 3ZPLA 2XKPA 2LF7A 4CO8A 4XLPF 3F3XA 4AVPA 2IA2A 1OR7A 2DI3A 2HR3A 3J80Z 3JSPA 2F2EA 5F64A 3LAJA 2E1CA 2NYXA 5CJ9A 4L5IA 2CO5A 4HQMA 2BBYA 3ZMZA 1TW2A 4PDKA 1BIBA 3BJAA 3DV8A 1W7PA 3GVAA 1PUEE 4OIOF 5IT9K 4UVAA 1J2XA 3QAHA 1G4DA 2E1NA 2Z3YA 1R23A 4AIKA 3LQRA 2H27A 4I0AA 2HEOA 1BI1A 2A6HF 1U6GA 2QQBA 3K9TA 2LSOA 2L3DA 4R8HA 2K7LA 1STZA 1RZ4A 2L4AA 2IPQX 1LEAA 4BNCA 2ZMEA 2JSCA 4KA4A 1S7AA 1X3UA 2ELHA 2EA4A 1CF7B 1FNNA 3TOAA 2FOKA 2CW0F 3DXJF 1U5TB 4BAYA 3L7WA 4ENMA 3J81K 1S8NA 4WWCA 1TQIA 4GXOA 4GGGA 4ESFA 4L18B 5D8KB 3WTXC 1B6AA 5L3CA 5D5WB 4EJOA 1P2FA 2QBYB 2R3SA 4P55A 3HHGA 3I59A 5FD5A 3ZMTA 1P4XA 3ZN1A 1LNWA 1SFEA 4D0PA 2CWEA 4BQAA 5JR3A 4IF4A 3F8BA 3V7SA 2K4BA 2DO7A 1HW2A 1ZH5A 1QZZA 2XASA 1HW1A 3SQNA 2Q8KA 6PAXA 1XSVA 2JZYA 4GYGA 2P5LC 4HLXA 1KA8A 4UV8A 3EYIA 1F9NA 1Z7UA 2ISZA 4EJVA 1XCVA 3LA7A 4L9NA 1NHAA 2DTRA 2A3SA 5A2QZ 1I1GA 1ZG1A 2EV6A 1U2WA 2EFWA 3RYPA
chains in the Genus database with same CATH superfamily
1NG7A 4NDLA 2IA0A 5IY5H 4ENNA 2YSRA 2I8DA 3PQKA 1YITI 5LEKA 4G94A 4B09A 2UZKA 1FZPB 1ZRDA 3CMAI 3SXYA 3VSLA 4QIWN 2BY1A 2R7WA 3H36A 1OYWA 2Z1DA 3H9JA 3Q0VA 4B3XA 3E5UA 2W4SA 2E35A 1WFXA 2E60A 1R1VA 4XLAA 4ZZDA 1WJFA 5D4SA 5FRMA 3C2GA 4XLHA 5F27A 4PCQA 3F6OA 1U9NA 5DYMA 5B3SH 1ERDA 3P9IA 1WI3A 3RPUA 2FUG2 4WXHA 3MN2A 2E7XA 4QLCU 1A31A 1XCBA 5K5OA 2DYRH 4A3MJ 3SEQA 1Y8RB 2CQNA 5B1AH 3WTWC 4HQEA 4MEXF 4UUTA 4ZC3A 4DBRA 1J0RA 1FOWA 1SVLA 5ICGA 1R4MB 4FCYA 3AG4H 2M4KA 3HEFA 5FKMA 2K9LA 2QM3A 3V4GA 3BR5A 2Y0SN 2VKHA 1BI2A 3L2RA 3Q5FA 4I7HA 3RCOA 4IRIA 2WC2A 2OQGA 3BY6A 3MWMA 4CSWA 3HBLA 4S04A 5D5VB 4HDVA 1TQPA 3DBHB 1MBGA 3GFJA 1Q1VA 1HXDA 4G6DA 1YW7A 4PJLA 4RDUA 4ESBA 3HXLA 1UCRA 3SZPA 2HKXA 2V1DA 1UHWA 3CQZJ 2ETHA 5B66C 4IHSA 3BR1A 3E3VA 2BY2A 1C0WA 3K6GA 3NQOA 3AG3H 4F93B 2KZGA 4A3FJ 4FT8A 4XRMA 5EJCA 2GM4A 2W48A 1LFBA 1EV7A 2CUZA 5JI6A 4CXFA 4J19A 2NS8A 3CCVI 3HSEA 1B9MA 2XRNA 4RLQA 4CDGA 4ZYHA 4C3IJ 1V5GA 2OQRA 3FXMA 5KAIC 2I10A 1ODDA 1MD0A 2WB1N 2ZXWH 4HZFA 3A01B 1YYVA 3FMRA 3E6BA 4UXNA 3GO5A 3EUHA 3BT9A 1UZCA 4F55A 1T6SA 2K9QA 2PMZA 5C4XJ 1J09A 4A3IJ 2OV7A 1BIAA 2QLZA 3S1RJ 2EH3A 4AIDA 2NXNB 5DCFA 4P1WA 1SFKA 4CZCA 3N97A 3ECHA 3OS2A 2V6CA 2UWMA 1GXQA 2G9WA 3E6CC 4HSRA 3GW2A 2XSJC 2PJPA 5L3EA 1I39A 3NEUA 1OCTC 2ESHA 2ZXJA 2VJ4A 3S3OA 3FXJA 4YFNF 4CYCB 2XF5A 1ZGWA 3F8MA 3R60A 1SFUA 3B02A 2HFHA 1KQ0A 4HA8A 3S17J 5DUIA 1FSEA 1EA3A 2XAJA 1LVAA 2DA3A 2O3FA 1Z91A 1X1CA 2F4IA 1I6HJ 1JGSA 2P81A 4HX7A 3PNYA 4PJJA 4XKBA 3CMYA 3S14J 4UUSA 4JK1X 1RIOH 3RPQA 2OU2A 3KEYA 5C3EJ 1G6NA 1X1AA 3CD6I 9ANTA 3I5UA 4IVNA 4EMSA 3WHBA 2VI6A 4IRGA 3BR3A 2GOMA 1KQ9A 1MH3A 1IN6A 2R7XA 1Z05A 2FSWA 1W5CC 4A3JJ 4AWXB 1XSXA 4B3AA 3RI4A 1ONVA 4M3GA 1O3SA 2P6TA 2KQRA 2QCOA 2BGCA 2G7UA 4ON0A 2LYCA 4BUPA 2RN7A 3C2BA 2ESNA 2V9PA 4BXFA 1V54H 3LSPA 1W36D 1MSEC 2GIVA 3DTIA 1FBQA 3DEEA 2VL8A 1QVUA 4U0YA 4D1QA 3EUKL 4BHPA 1O7FA 3OS0A 5BPIA 2PN6A 2EILH 3H5NA 5HOOA 4BDZA 4IJAA 3I3LA 4B48A 5LBQA 1ZG5A 3RIRA 2P0WA 3DLLF 3IL2A 2WV0A 2Q0OA 3JRBA 2H1KA 5JVTA 3HTSB 4OWRB 1HKQA 3R6SA 4MIMA 5LRSA 2XGEA 1R7JA 5DEQA 4WXDA 5HDNA 2JUCA 3AG2H 2BXZA 5EEHA 3HOTA 2VONA 3OYIA 4L0YB 1I27A 2LNBA 4F52A 4I0BA 5IYDJ 2XUBA 2OD5A 1QO0D 3S2DJ 2F4OB 2LFBA 5HLHA 1JUMA 3R61A 3BLYA 4M72A 5K5RA 5HODA 5H2FC 1G8XA 5LHIA 1OCPA 1R5HA 2PJRA 2E7WA 1QVTA 4MQVA 4HSTA 3Q0UA 1IXRC 5HLIA 3M9AA 3ULQB 2CYYA 4HF1A 5FD6A 5J1UA 3PUFA 2NNYA 2LY2A 1H9GA 1XGMA 3G1MA 2EBIA 5FRNA 4UNOA 1TT5B 2IRFG 3TO6A 4HW0A 4OINF 2OBPA 3KP6A 4N9IA 2PI0A 2XF6A 3S2HJ 3QPSA 4LK1F 3VFZA 2C6YA 1SMTA 2WAFA 3QP5A 2X4HA 3WTZA 3F21A 3JRAA 5HVQC 3E5QA 2YX4A 5DCMA 2XAHA 5L3FA 1RNLA 2BY0A 1QZEA 2DLLA 2V4JC 2M7AA 4U88A 1ZR2A 4A93J 3ZMSA 4FE4A 3K1PA 2L4MA 3KEOA 4JOMA 1A35A 4P9FA 3C1DA 1IUFA 2FNAA 1IRZA 5KVRA 3H9GA 1D3YA 2AQEA 2P7CB 3ELKA 5BNGA 5IP6A 1ZYRF 2XF7A 3HGYA 3IH3A 1ZARA 3ML6A 5J4VA 2QENA 4WX9A 2HZTA 2K9SA 3U2RA 1LDJA 1L0OC 2MC3A 3DPTA 3ESWB 4LG0A 3HOSA 1K78A 2IS1A 4XM3A 4BH9A 4DIQA 3CJQB 2K27A 2IEKA 3G4SI 3U1DA 4FASD 1ZK8A 2KMUA 3W6JB 2MABA 5ILUA 1XS9A 2AO9A 5D5UB 4A12A 4MQ9F 3I56I 3F72A 4FE7A 2O5RA 2BW3A 2GA2A 5E17F 5JHUA 1HBXG 3K2AA 4KISA 5FLVA 1KU9A 2Y75A 3L00A 4KNYA 1I5ZA 1S29A 2P4WA 3M1CA 4M6XA 4X1EA 3CJTB 4BQNA 1LQ1A 3M1EA 1TL8A 3LSIA 4L0ZB 5E3NA 4CCJA 3DKYA 3CMMA 1W7PD 1W0TA 1DU6A 1VF9A 3G3ZA 2VT3A 2PG4A 3ZQQA 5M5WJ 4P96A 2ZC2A 3GBGA 3ERED 3I54A 2LBFB 1Y1VJ 1X1BA 2QQ8A 4I2OA 4WXCA 3OY9A 2FQ3A 3OSFA 3TKYA 1A04A 1HLVA 2F5VA 3TQNA 2GXGA 2PMUA 2X6XA 2Y0MA 2Y69H 4NC6A 4YEJA 2LD5A 1TWCJ 2A07F 4IHYA 2HS5A 2CJJA 5ICEA 1H0MA 2DFEA 5H6RA 3ZGKA 3QP6A 4MFDA 4OU0A 3WU0A 1KGSA 3OYGA 3LNQA 2IGNA 2W00A 2WADA 4KN4X 2ZBKA 2M1BA 1VQ5I 2ADUA 1BW5A 4CCNA 1W4MA 2XVCA 3LSMA 4ZZLA 2IS6A 1TT0A 2A6EF 3QPTA 1IJWC 5DTDA 1YW9A 3K1MA 1X2MA 4LFUA 2V1XA 1IDYA 3SZGA 3BQYA 1QU3A 1MMNA 2VQHA 1P9QC 4XBFA 2ICWG 3K10A 3ABUA 1SC7A 4H4KC 1E2XA 1O7LA 4CYDA 2CUJA 3M7GA 5CVIA 2QUFA 2XV4S 4W1UA 4E7IA 3JAMZ 5E1WA 1LDKB 3HKZN 5TRDA 3MKYB 2FA5A 1SFXA 4OAZA 1KU2A 2NVYJ 1T98A 2ID6A 4C30A 3MZ8A 3D5SC 2G7HA 5HDKA 5EG0A 5JLWA 3GUDA 2RQQA 4EEFG 2GA1A 2HOAA 1SD5A 3FMQA 3F8NA 3HOUJ 3S16J 1MW7A 3GTMJ 3KCCA 4IO9F 3CO6C 1OJLA 2PMHA 3BP8A 1N25A 4GDFA 5K7ZA 1ZELA 4H0EA 5LFAA 1FTTA 2M7BA 1FPQA 1SD4A 3CJRB 5ILSA 1MDMB 3QODA 2LREA 1EH6A 3E1SA 3BTLA 1WWXA 1VQ6I 1LFPA 2K9NA 3AL0B 2IGOA 1ETWA 2VB6A 1BBYA 2NVXJ 1W36C 4L9VA 3L2UA 2VQGA 4B8XA 4KIBA 4BBRJ 4XMYA 2Z33A 3KEQA 3OIPA 5D8LB 4ZDOA 3RKYA 3BJ6A 2DT6A 4MTEA 1D0YA 2VN2A 3ZQIA 1UB9A 3CLOA 3BC8A 4HF0A 4M9XA 4W97A 1LPQA 1K7AA 5FJ8J 3T8RA 3CCMI 4L9TA 2XB5A 3BTIA 2FBIA 2X0LA 4BJTA 2QSHX 3DP7A 4U0VA 4GO1A 2VJIA 2M3AA 3M8FA 4YIIA 5TISC 4CCLA 2Y48A 3W2AA 2H6CA 2IS4A 3I59B 2IJLA 2D5VA 3GYHX 3FHNA 1Y39A 2KRCA 3BZKA 3BTCA 3LQQA 2E5ZA 4GYIA 3HB9A 5EGOA 4PJMA 5E20A 2HWVA 4KIGA 3BZ6A 3S2WA 4CGZA 4A6EA 3K4LA 4DJAA 3GTGJ 3P9KA 3HDDA 1M1EB 2DODA 1Z77A 4OAYA 3O6BB 1MBKA 2VQCA 3TO9A 1CGPA 1W1WE 2CV1A 2DA4A 3CDLA 2VC1A 2GZWA 1UELB 4KUMA 3RPUD 4AYBA 2LG4A 4L5JA 5IPAA 3WTTC 3O8GA 2B9SA 3JTHA 4IL6C 4YIFA 3LSRA 3MKWB 1BN5A 2XHKA 2D45A 1F1ZA 1Z6TA 1BC8C 5E79C 2HU9A 1H89C 1TW3A 2BVLA 4BS9A 1Z3YA 3DKWA 3HRTA 4EV0A 1ETXA 1R6RA 1LE8B 3I4MJ 4A0ZA 5JHFA 1V4RA 2LK2A 4QPOA 1TZLA 2ECBA 2HYJA 4DOZA 5LHGA 5AIPA 3WGIA 3BTJA 1B72B 1SD6A 2HZDA 1D1AA 3TBIA 1WJEA 4F92B 1OCCH 2M9HA 1VFCA 3R4KA 5F6FA 3VODA 1O4XA 3SJMA 4UV9A 2XPUA 5A2QK 1XSDA 2CQ7A 1XGNA 2WWYA 2B63J 2MW8A 1VQ4I 1YG2A 4LD5A 2LVSA 2X85A 5FLXZ 1UFMA 2MH2A 1T33A 2KISA 1TWGJ 4HV6A 1OR7C 2YX7A 3T1BA 2EIJH 3QYBA 3A2KA 2KIMA 4UB8C 4Y17A 5AIQA 3NWTA 1E17A 4CCMA 3U9GA 3U21A 1B1BA 2E19A 2K40A 2K3FA 3OR1C 5K7HA 4BKXA 2IT0A 3LAPA 1MBEA 4WF2A 3WGHA 2W7NA 4HOBA 5CVVA 3E97A 2RGVA 4CA0A 3P7NA 3WGGA 2KIFA 1D1CA 5E3LA 5JFRA 3F22A 1XDUA 1RR8C 1K61A 3FMSA 5E1XA 2NVQJ 1APLC 3OYHA 5DM6F 2BXYA 3N05A 4ETSA 4XRFA 2ZFUA 5L3BA 3CDIA 4AD9A 3CUOA 1VQNI 4C9YA 3FHZA 4RAYA 5EEAA 1SMYF 2NRAC 4LK0F 4I99C 2JMWA 3JR9A 3GTOJ 5E8IA 1IN8A 2M87A 4M6VA 5KCMA 1SFOJ 3W6KB 2BZTA 1B59A 3S1QJ 2VLAA 3K2ZA 2HOEA 3EETA 4XR6A 3VEPA 1OKRA 1RKTA 3Q9SA 4G6TB 2E5NA 2VC0A 1YX5A 2MD5A 4MO7A 1UHSA 4JP0A 1JT6A 1R36A 1BM9A 3I58A 4HNVA 4KT6A 3VB2A 2H8WA 4KDPA 3OYCA 2KIQA 4HLYA 3OYDA 2Y9YA 1QZYA 3G73A 4LGWA 4XICA 4EM2A 4MNUA 3MKLA 3H5AA 1K83J 1BR1A 1WJCA 3KETA 3BWGA 4ENKA 2KLOA 2V6EA 2E2HJ 2EFPA 1U5TA 3WU2C 1R1UA 1OLTA 2O9LA 3H9QA 1A36A 1JKOC 3IP4B 2DMPA 1Z3XA 3LWFA 3F23A 4BEHB 2LMDA 1TP4A 2VBZA 3NRVA 2XGCA 3BOQA 1QPMA 2QEXI 1J7KA 2I5UA 2ZKZA 5KNLA 1Z21A 2COMA 2XAUA 4MFEA 3V8JA 1ZREA 1OCZH 1I1SA 3H35A 1T08B 2OC6A 3ZCOA 2CGPA 1HKTA 3WTUC 2QBYA 3QOEA 4XQFA 2RAEA 4XLCA 5FFXA 4RAZA 3OYKA 1QRYA 4C2MJ 2HVSA 1WSUA 2JA5J 5FROA 1T0FA 2LP0A 4BE1A 5L3GA 3LSHA 1WPKA 3MCZA 1P6RA 3HPGA 4BU2A 2CW8A 2FMLA 3KYDB 1S6LA 4A3DJ 2FRHA 3K1NA 3QWLA 5CQGA 1YFHA 4BACA 2K85A 1GUUA 2CFXA 2ME0A 1LUJB 3IC7A 3ZQFA 1WJDA 1VQKI 3GTKJ 4RGUA 3OR2C 4EGYA 2LOOA 1YO5C 1QHHD 3K69A 4BE0A 3ASNH 3BG6A 4CHUA 2WAEA 2DFFA 1L3LA 4I98B 3CUQA 5KK1A 1I6XA 4IQJA 1USTA 1TWFJ 2OTJI 2VUMJ 4J01A 3D0SA 4XOTA 1D5YA 2Y2ZA 4A5NA 1HSJA 2F5CA 3FK7A 3H0DA 1T39A 1WZ2A 1YS7A 4U7DA 2A61A 2ZNYA 1ZGJA 1IXSB 2CUFA 1VQ7I 3OYNA 2AHQA 2DYSH 4BJ6C 3KFWX 2O0YA 1NH3A 5DDGA 1U8RA 3I64A 2GWRA 4RB2C 5J8FA 1HSTA 1DP3A 2FF4A 2R7OA 2KRFA 5FFZA 4HAMA 1VQOI 1D8JA 2EB7A 3IH2A 4PK4A 4A3GJ 2O6GE 2QSFX 3FXKA 4OIPF 2MG4A 1PJRA 1ZLJA 2KFDA 2DA1A 3CZ6A 4NQWB 3PIOF 3RJPA 1XX5A 1MJ9A 4GFBA 2ZJ2A 5F0HA 4XRSA 3D1NI 1X2NA 3G2BA 2VE9A 2RDPA 1MMSA 3W2WA 2HDWA 1WHUA 1G3YA 1I50J 2EA2A 4CZZA 5GAGJ 1Y1WJ 2PX9A 2HPIA 2HVRA 3HUGA 3TW7A 3IAM2 2R7TA 3QU6A 2N8GA 4BE2A 3TDUC 4ZYGA 2DFIA 2XAGA 2EZKA 1WQ2A 2CQXA 3IWFA 2DMUA 1JHFA 3G71I 4LLLA 1SEUA 1OISA 2HXOA 3LFUA 2ELKA 2NVUB 3L2WA 1G59A 4LLNA 1Q1HA 2P6SA 1AHDP 3A03A 1BC7C 1YI2I 3HOVJ 2E1OA 1EJ9A 2QZ8A 3S3NA 3GZ6A 3S15J 2OUMA 4P9UA 2R7UA 2EPFA 1EH8A 3QOPA 4DNCA 1X19A 4JQFA 4RM3A 5M3FJ 5LGNA 2LR8A 3PQJA 2FD5A 5DCMB 4RB3C 1SVOA 3A4CA 4BQOA 2VBXA 3FF5A 3RKXA 4A6DA 4DZJA 4EQQA 2WAQA 5LHHA 1FYLA 1A5JA 3JREA 2PEXA 3WG9A 1I3QJ 3CP8A 3EQLF 2ZSIB 1XPXA 3E7LA 1MSFC 2MFZA 4HG2A 5LLQA 1HDDC 1BJZA 1HKSA 1WI9A 5CVRA 3RSNA 3LA2A 5IYBJ 2R5ZB 4RB0A 2Q2EB 2VBWA 3I55I 3L9FA 1FP1D 3EDPA 2R7VA 2KDOA 5FB2A 4L9JA 3EUHC 4HF2A 3GTQJ 2PBIA 2A69F 4AIHA 1UHMA 2HQ5A 4XNFA 2E2JJ 2VODA 2XPVA 3I53A 1OPCA 2YUSA 3JW4A 1YRNB 3TGNA 1YIJI 5ICCA 3JRFA 2PLYA 1IN5A 2QYOA 2DU9A 2QKLB 2QWWA 1S3JA 2BW3B 5M5XJ 1SAUA 1N78A 3ABKH 1IN4A 3SEZA 1E3HA 3F8FA 1E3OC 4EATA 3ZQHA 3DBRB 4ABZA 5LGTA 1FBUA 2COBA 4AYBN 5HNFA 3CC2I 4ZTJA 3OL4A 2K9MA 1XC5A 2XGXA 3F8CA 1JHHA 2A05A 4HRIA 3ECOA 2BOLA 1P4AA 2KJBA 2DMTA 3LSTA 2DT5A 2AXTC 3Q0WA 5D6EA 3WHCA 2MD0A 2OTLI 5FLMJ 1WRJA 3V7RA 3RKWA 1XTAA 1FLIA 2FQ4A 2IBDA 1Z1DA 4MTDA 1IGNA 1VQPI 2CU7A 2QKMB 3CCUI 3DU6A 5EYRA 2R7RA 1R00A 4HPQA 4ANJA 2EK5A 4ZH4F 4XKCA 4U0WA 1T56A 5IP9J 3CCSI 3HGGA 4NUBA 2EZLA 4MEYF 3GEZA 1HW5A 5CLSA 4Y52J 2DOFA 4PGGA 3BR0A 4IOAF 4XSXF 1U8BA 2EV5A 1EH7A 1MGTA 1D8KA 5J8CA 4BDYA 3DF8A 2V79A 1Z0XA 3CLQA 2VASA 4UHTA 3QU3A 5IT3A 2V26A 1J75A 5GTIC 2LKPA 2DA5A 3IHUA 2HOSA 4ZYEA 3PNTA 2OZ6A 3I0TA 5F08A 1K4TA 1G2HA 3BCAA 1TQMA 4BJ5C 3UR3C 1MKMA 4IKFA 3IV5A 3LSKA 1B8IB 2DT7B 1FJLA 1YQAA 2X6OA 3JAMK 1IZ1A 1TTYA 2DOAA 3WE3A 2HPMA 1EKEA 2IP2A 3BR6A 4D7MA 5GPCA 1UAAA 1R49A 1GHCA 2JRMA 4WCGA 4I02A 4RGRA 2FEZA 4UVBA 4ZYAA 3J7ZI 3MZYA 1TBXA 1U0JA 4I6ZA 1S5LC 4A0XA 5FKOA 2L01A 3OMYA 1T38A 1J9IA 1W5TA 3VWBA 4ENJA 3P9CA 2L7MP 3WG7H 2DQRA 3AAFA 2UUZA 1DU0A 3WE2A 4HV5A 1LB2A 2AS5F 4LIVA 3GMEA 3L09A 3ZR8X 1XMAA 1DUXC 3BG5A 3HC7A 1ORKA 1BOBA 3TO7A 1IAWA 5F04A 1XGSA 2Z2SB 2HYFA 1X3ZB 1E0EA 2M0CA 3IH4A 4A3LJ 1MZBA 2R7DA 3IAS2 1RPWA 2EJRA 3HIFA 3RKQA 4AVZA 4E7KA 2UV1A 4DZPA 1MH4A 4GCVA 2HOTA 1JUPA 2GXBA 1KYWA 1P92A 2O03A 2DMNA 1LKXA 2OCEA 2MGQA 3BQZA 3HTUA 4UUVA 1ETVA 3K70D 3OYLA 4X6AJ 3BG7A 4M3DA 3LL7A 5GAEJ 2VBYA 4G6QA 5FKKA 2CH0A 3J80K 4E7JA 2F5DA 2XB0X 2YU3A 1BL0A 2R7FA 1QHGA 3TOBA 1FT9A 2XC7A 1GT0C 3FZVA 2DDBA 2QQAA 2H09A 3DPUA 5J1RA 2DPUA 5JLXA 4BGDA 2Z9OA 2IW5A 3VYSB 2GIZA 4DYQA 4ESJA 1QNTA 4EJTA 4NHJA 4XLEA 1KQ8A 2M8EA 2FMYA 3KP7A 2XAQA 2WB1A 4M3FA 3H5RA 3HOYJ 1ZN2A 1X4PA 3OYBA 1W7PB 3LOCA 3M8EA 2LTPA 2KKOA 4OIRF 4D7NA 1MNMC 4NNJA 4IHWA 2FNPA 4BHCA 2OA4A 3TMOA 4E7LA 1DP7P 2KIUA 2K5CA 3E6MA 3IUOA 3ZP5A 4AC0A 5F0CA 1ZQ3P 2F48A 4PGHA 1R1TA 5K1YA 3K4BA 2JA8J 5BQTA 5C44J 5HS8A 2IAIA 2LY1A 4XONA 2DTZA 2RKHA 3C3WA 3COAC 1XB4A 4Q5SF 1O3RA 3FX3A 2XSDC 1RESA 2LY9A 1X1DA 4U87A 4KN7X 3E6DA 2ACJA 4EM1A 1JJ6C 1ON2A 2ZMEB 3CC7I 2KPMA 1O57A 1Y56A 1PUFB 4RB1A 1FSHA 2HKOA 3HOWJ 3GCMA 2K02A 4XK4A 1SAXA 3MKZA 1MBJA 2EQRA 3FKJA 3FXRA 4PJ0C 3HG9A 2WV1A 2W25A 5LEJA 3LSJA 1PVEA 2LBFA 5TGTA 1JT0A 1JTXA 4DYCA 4E4HA 2HDCA 3V8LA 5E8GA 2M34A 3H3ZA 4A5MA 3REOA 1R5ID 1S7OA 1E3PA 3RYRA 4Q48A 3E0JB 2WA0A 2DA7A 1WGXA 2VJJA 1HQCA 4BY7J 4D5CA 4ZDPA 4YELA 3DBLB 2VKVA 1PDNC 4XLNF 1NK2P 3OIOA 2PMZN 2DA2A 3IRRA 4JX5A 2BHYA 3WTVC 5M5YJ 4DQ2A 1BA5A 1YX3A 3KYLA 2QSGX 2M0MA 1WVRA 1H8AC 1HDPA 4II2A 2RNJA 3OOPA 2EFQA 4F91B 3AG1H 3CCEI 2A5YB 3H92A 1AU7A 2JA7J 4XKVA 2O61A 2VIXA 4YIRX 5E3OA 3JSOA 1BI3A 5EF6A 3GFIA 1PP7U 3CJNA 2FOWA 4I09A 1YJWI 4ZYDA 1UMQA 4DBQA 2GOXB 2P5VA 3PNVA 4HBLA 1FP2A 4R79A 2JK3A 5EEGA 2EINH 2EFWA 3ASOH 2KT0A 2NOJB 1F5TA 3HJEA 2R7ZJ 1B4AA 5J6XA 3HRUA 3FBIB 1FTZA 5BS6A 5H20A 4KICA 3RZDJ 1WJAA 3HRSA 2ELJA 2H6BA 4ZJZA 2CV0A 2X48A 1ZHFA 4HNTA 2E2IJ 1ZG3A 2XROA 1XDSA 3BDDA 2G0EA 4EJWA 1S7EA 1RC9A 4PSWA 4ZDLA 1O3QA 2BHZA 1ON1A 2EZHA 3DTEA 3HSRA 4IHTA 2HGCA 2R4GA 2O7OA 1MDMA 1GVDA 2CQKA 5E3MA 1YHQI 1IF1A 4Y7NJ 4AM3A 3C18A 3DPLC 3FXQA 1OMIA 2F6CA 3RQ4A 4RGSA 5DV5A 4RA2A 2LH9A 1R4NB 5ILVA 1TWHJ 1HF0A 1QQIA 1V3FA 2YS9A 3R0JA 3S1MJ 3T5XA 1SVMA 3SYTA 1FYMA 4OMYA 2FX0A 3S32A 5HLGA 1XN7A 2M45A 2Z5UA 1VI0A 2GLOA 5D4RA 3MMYB 4B44A 2YU9J 1R5GA 2R7SA 1RUNA 4M9ZA 1LEBA 2L2OA 4HX8A 1FY7A 1P7JA 1IW7F 4N4NB 1FOKA 3HSFA 3JRIA 1YTYA 4N9HA 2X9DA 3N4MA 2EV0A 2VOPA 4M71A 3U1KA 3PSFA 2MYSA 2ECCA 4FX4A 2IVMA 5IP7J 4LIUA 4LMYA 1AA7A 2NS0A 3J7AY 2BE5F 2L02A 1X3WB 5CPRB 2IA1A 3HOXJ 3KP2A 3F6VA 1GXPA 2P5KA 2LKSA 5IT9Z 1ZGAA 4RM2A 3JTGA 4Q47A 5LRRA 3ZQGA 4Y33A 4G7HF 3VDXA 4CICA 1DQUA 2NOGA 3D5LA 3PFIA 2Y30A 5GTHC 2VE8A 3M8JA 1VQ9I 3CCQI 1FWZA 3KZYA 3SFZA 3LFKA 2BV6A 4YFXF 1MNEA 1X1PA 2DDAA 1IO2A 4KFCA 5F1JA 4IRHA 2W84A 3K70C 3OV8A 2ZMEC 4AU7A 3WODF 3CESA 1JJ8C 3HRMA 1REPC 1G3WA 4A2UA 3W3CA 3M3YJ 2M8GX 3H0GJ 1YJNI 2D1VA 4G7OF 3CUQB 4C3JJ 1MBFA 2JRTA 4BYYA 1T2KA 5BMZA 2CG4A 3AFHA 1WCMJ 1POGA 2JPCA 2V9VA 1LE8A 3ONQA 2CSOA 4ITVA 4XRSG 1RI7A 3ZQ7A 3SDBA 1BI0A 2HQNA 1ZRFA 4M74A 1CF7A 3K4JA 5DD8A 3CC4I 3TP0A 1QGPA 2BY3A 3SZTA 3J81Z 3L1PA 1B72A 2M30A 2R5YA 1BR2A 2X1DA 4KT5C 2X6YA 1FOXA 2RQPA 3H1CA 2ZSHB 2LKXA 2P7VB 4B4CA 5EDNA 3RTRA 3H3UA 3KP4A 1KZHA 2MBFA 1TWAJ 3ZN0A 1KU3A 3MVPA 4QPQA 4B43A 1MNDA 5IYCJ 2VPLA 1MBHA 2Y9ZA 2UXNA 5ICFA 2ZO4A 3S3MA 4FHTA 1K6OA 3FISA 1V5EA 2Z99A 4PSXA 3KLOA 3V8KA 4FX0A 3CTAA 4FISA 2FU4A 2QQ9A 5HDGA 1P4WA 1BR4A 1IN7A 3FWEA 4UUSB 3CDHA 4NB5A 3HKZA 2LLKA 2W24A 3HUGB 2NNNA 2WTEA 2XAFA 2RV8A 4OIQF 1A6QA 2H94A 3KZZA 1BOAA 4IHXA 4EVIA 4QSHA 5ED4A 2HVQA 5F1RA 3D5RC 3IKVA 3PUBA 2RNGA 4HEA2 5HS7A 2WY7Q 2HDDA 3V42A 1YJ9I 4KMFA 1W5SA 2DAOA 2DW4A 4FTHA 3HZJA 3GTJJ 1Z67A 1DDNA 5KAFC 3IKTA 4O3MA 1X4OA 3KYCB 1Y0UA 1WJBA 3WTSC 2KHMA 1K79A 2V9KA 4V19K 1OCOH 1OYYA 4PJNA 2DJIA 1AWCA 5H6QA 3IRQA 2JA2A 3ZMDA 1IRFA 2VOOA 3ZQLA 5K7FA 3P5JA 1ZLKA 3K7AJ 1RETA 4JX6A 3RQIA 1MMGA 2ISYA 3ZMUA 2TDXA 2DN0A 3KP3A 4K2EA 4RAFA 2VXZA 1RUOA 1HOMA 4G9YA 1VQLI 2K4JA 3C7JA 3Q3SA 1FEXA 2EIMH 1R22A 1MJBA 3KLNA 3JRDA 4C2UA 2Z16A 3LMMA 3O8HA 3DFGA 3OL3A 4PFOA 3MFKA 1DPUA 1U5TC 3FM5A 3FBNB 1MMAA 2BYVE 2HNHA 3GXOA 1J5YA 2LF8A 3K4NA 1U3EM 1AKHA 3GWZA 2L54A 5BOXA 2DBBA 3OS1A 2WY8Q 3FXLA 3GZ5A 2E1MB 2F5FA 2MH9A 3QPHA 3PJRA 1B9NA 1ULYA 1G3TA 1LJ9A 2W82A 1FC3A 2PQ8A 3S8PA 2L9SA 4LLGF 4CUGA 4BEHA 2WBMA 2HTJA 1UG2A 3L2VA 3BPXA 5GPAA 3OYAA 2QVOA 2AXLA 2ID3A 3O2PE 2DCEA 2JWTA 3V7CA 2PJRB 3OOUA 2FBHA 4AUXA 1YW8A 2W57A 1MMDA 4A69C 3GX4X 2ZJRF 2ME6A 2EIKH 4LB6B 3ZRGA 4BQQA 5BPDA 2BEOA 5FGMA 2KZVA 2IS2A 3ABLH 3DEWA 1T0FC 3M07A 1S9HA 1OFCX 4O6JA 2ZB9A 3QYFA 1V5FA 3ROUA 1WH7A 3DU5A 3LA3A 5GADJ 4A3BJ 2MLKA 2STTA 1IC8A 3EPZA 1FOYA 3BROA 4I01A 1H88C 4FQGA 3VYTB 3ZMVA 3CF5F 1QBJA 4UY8I 2EFNA 4I76A 3GLXA 3PO3J 4ASNA 1X58A 3CP2A 4RLFA 2L5QA 5LGUA 2DA6A 3TL4X 2MA3A 1V55H 1JKPC 3W2VA 4KITB 2ZXHA 3CUQC 4BBSJ 1WKMA 4N4OB 3PL8A 1IRGA 4TV7A 3ERMA 1KYZA 2DOEA 3B73A 1MIJA 1IG7A 3J7AO 1NG6A 1Z6RA 3VYUB 4LB5A 3QQAA 3MEXA 2GXAA 2J5OA 3QYEA 3DLAA 3I4PA 5CVUA 2EZIA 3MQ0A 1K78B 4LG0B 3CCYA 3FXUA 5E1ZB 4AIJA 1IDZA 1U78A 3KZIC 3A01A 3CCLI 3BR2A 4IOCF 2HQRA 1R58A 1VTNC 3A0BC 3FKIJ 2J5PA 3AKZA 1JGGA 1F36A 4QWQA 4YFKF 4E7HA 3VOEA 5HNHA 3C2HA 2DFHA 1O3TA 1QA6A 1GV2A 5HS9A 2W85A 4A3KJ 4BXUA 3FM3A 3G1OA 3SHFA 4JBAA 4KJZA 1KU7A 2W1OA 1USSA 4NBQA 5EZHA 2JQ7A 4HNUA 3RZOJ 1XMKA 3KP5A 1JKRC 4Z2YA 1HC8A 2NS7A 4BHBA 2R7QA 4CYCA 3JRGA 3MZHA 2JN6A 3KIOA 3TP3A 5FO5A 1WJ5A 4XORA 2RVCA 2DK8A 1F4KA 2X1CA 3BZCA 4RAGA 4NQWA 5GAHJ 2RC4A 3W6VA 3T8TA 4LOCA 1BJAA 2P8TA 3GZNB 2OAZA 1XMXA 2GQQA 2M2EA 2GBYA 4PUSA 2IXSA 1MJAA 1BW6A 5FKLA 1FX7A 3HHHA 4KMUX 4C2TA 1OQYA 1PYVA 5AONA 2V1UA 4G12A 2KRHA 4RBOA 4EM0B 4IPAA 4IEJA 3HL2A 4XN0A 2OZUA 1TNTA 3GLLA 4LG3A 4OOIA 1OYIA 3G1LA 3A1YA 2VPRA 2KJCA 2AQFA 1PP8F 1YLFA 1RRJA 3I9V2 3WTYC 5K5QA 4G8XA 4Y13A 3BG9A 4M3EA 3BPVA 1FYKA 4RS8A 1JKQC 1D0ZA 4Y15A 1FBSA 3NAUA 3GTPJ 2ZXIA 5B5EC 3QRFF 4RMNA 4OMZA 2IGKA 1Y0NA 3VPRA 4M6YA 4BL0B 4U7BA 2ZFWA 2MLGA 3A02A 4GRIA 3SFIA 2Q2EA 3JCUC 2R5ZA 1ACIA 1FIPA 3WU1B 2E1MC 2DXIA 1GVJA 5EG0B 3PIPF 1ETQA 1I3AA 1ZAOA 4FETA 2HTSA 1SANA 2UXXA 2JT1A 4C3HJ 1J59A 2EFOA 1YRNA 2ZJQF 4A0YA 2EWNA 2B7EA 5J47A 4O5VA 2X1EA 2D2WA 4WK8F 3ISPA 3HYIA 4YG2F 1JE8A 5L3DA 1P7IA 1Y6IA 2E71A 2OCCH 3R0AA 3CCJI 2ZNZA 2BVMA 4S05A 2M5WA 3H3VK 2XKOA 2Y0SA 4LJZF 1K6YA 1YS6A 4E7ZA 2CS3A 1JXSA 1ZRCA 3DEUA 2GAUA 3RDIA 1DPRA 3I71A 1IXCA 2F5EA 2PFBA 2YPRA 3OYFA 1H9TA 4N0BA 3VYRB 4E70A 5LD2C 3GF2A 5EZGA 4IHVA 3PFYA 4V2FA 5M3MJ 1YIOA 4DGWB 4G7ZF 2JPBA 2CW7A 4D5FA 3TEDA 2L9VA 1TNSA 5DD4A 3EYYA 2D1HA 3FIWA 4QTRA 4ZTFA 1D0XA 3FXOA 2VKDA 4HYEA 4R1HA 5GP9A 1ITYA 3DQVC 2K86A 4IQ4A 3F9KA 2XIGA 1G3SA 3B6CA 3GFMA 3KX2A 2IGMA 3J7YJ 2DK5A 1DGWY 2DMQA 5D5XB 2H8RA 1LDDA 2HYGD 2OF7A 2YR2A 4XN3A 3T0YA 4EGZA 3MAJA 1OCRH 1JTYA 4EJUA 4M9SA 2FBKA 4M73A 1D1BA 3UKGA 2JVGA 3Q9VA 4V2GA 3IWZA 5TJJA 1HA8A 3CO7C 1D5VA 1ZR4A 3DKXA 2DQLA 1N77A 1IV6A 5EGOB 1SD7A 2VJ5A 2R92J 2ZCWA 3OSGA 1TLHB 2JVHA 2K3PA 2A68F 3K0LA 2CMPA 3ZOBA 5J3LA 4XSZF 4KIFA 5E18F 5CVJA 1JI8A 2X51A 3L2CA 2CRGA 3PM1A 1U9OA 4J00A 2V1NA 2JTVA 2NAZA 1B8IA 2B0LA 1XG1A 4M3BA 1XD7A 1KONA 5D6FA 4F7ZA 1LVKA 2O8KA 5IOYA 1R71A 4HX4A 1IV8A 3BJOA 2VT2A 2L9RA 4P5OA 3F0CA 2FE3A 2JUGA 2STWA 4PZJA 5DUKA 3X2QH 1FMWA 2FXAA 3UNGC 1Z9CA 4BXXJ 2DPDA 3A0HC 1GV5A 3S93A 3GTLJ 4MGRA 2LDUA 4IXAA 1XGOA 4XLFA 2TRTA 2CFOA 4S0HB 3KE2A 4Q4ZF 3CCRI 3ABTA 3E5XA 4DYRA 4LITA 2CUEA 4NC8A 4UVCA 2X6WA 1AOYA 3ZQCA 4HDUA 5J4YA 4MHGA 4KYWA 3BCBA 3O3KA 4RGXA 4BY1J 2E34A 2KDZA 5ERIA 5FKNA 2ZJPF 1RKWA 3GFLA 2O8XA 3ZXSA 1VQMI 1IRXA 1YOVB 2XRLA 1YE9A 5CYVA 2NVTJ 2MSYA 5FLXK 1IUYA 3K4MA 3ZPLA 3OYJA 2XKPA 5C4JJ 3L2QA 3OYEA 2LF7A 1Z7LA 2LC2A 4CO8A 1S72I 4XLPF 3F3XA 1VQ8I 3DCFA 4AVPA 1W0UA 5JVGF 2DJNA 4CH7A 2IA2A 1OR7A 2DI3A 2H1LA 2HR3A 2HI3A 3K4KA 3J80Z 3HPHA 4JYKA 3JSPA 4F3QA 2F2EA 1FMVA 1VNDA 5F64A 3LAJA 2LRDA 3OIQA 3S1NJ 1ENHA 1RR7A 2E1CA 1FIAA 2NYXA 5CJ9A 2L0KA 4XL9A 4L5IA 2CO5A 4L5EA 4HQMA 3PSIA 4YRVA 5IOZA 2BBYA 3EUAA 3ZMZA 1JUSA 4A3CJ 1TW2A 4PDKA 4X0GA 1BIBA 2JJ7A 1ZTRA 4Z6YA 2XPWA 2A6TA 3BJAA 2VXDA 3K4CA 2OPTA 3DV8A 1W7PA 3GVAA 1LFUP 1PUEE 4OIOF 5IT9K 4UVAA 1J2XA 3QAHA 3G6EI 2RREA 2QF7A 2E1NA 1T8IA 1G4DA 2Z3YA 1R23A 4AIKA 3LQRA 2H27A 3DTKA 3NARA 1A6IA 1GLNA 4I0AA 5B1BH 2HEOA 2Q1ZB 4A3EJ 1BI1A 2A6HF 1U6GA 2FJ1A 2R0QC 5HLTA 2QQBA 3K9TA 2LSOA 1UJ8A 4MLOA 2L3DA 3FDYA 4R8HA 2K7LA 5DM7F 4E7SA 2M4GA 1STZA 1R9TJ 1RZ4A 4Y4RA 2L4AA 2KP6A 2L7ZA 2IPQX 2WAQN 3NWSA 2XDVA 2F4MB 1LEAA 1EF4A 3HOZJ 4BNCA 2ZMEA 2XGDA 2JSCA 4KA4A 3DWLE 1PUFA 5CQEA 3CF2A 1S7AA 1X3UA 2ELHA 2EA4A 4D9JA 1CF7B 1FNNA 3TOAA 5CKTA 2FOKA 5F0FA 2CW0F 3DXJF 1U5TB 4BAYA 3JRHA 2HQAA 3JRCA 3BG3A 3L7WA 4UB6C 4ENMA 2R5YB 3J81K 4B1RA 2VKEA 4IZZA 1S8NA 2KL4A 4DW6A 4WWCA 1GDTA 3VSKA 1TQIA 4XKWA 4IX7A 4GXOA 1TC3C 1WH5A 2CQQA 4GGGA 4PFPA 4ESFA 3CMEI 4L18B 5D8KB 5KHDA 3WTXC 1B6AA 2R93J 5L3CA 5D5WB 1ETOA 2JA6J 2VQLA 4EJOA 1P2FA 2OJED 2QBYB 2R3SA 2L7KA 4P55A 4CCKA 2Y31A 3HHGA 3I59A 3PO2J 3FK6A 5FD5A 3OWTA 3ZMTA 1P4XA 4XOPA 3ZN1A 1LNWA 3OYMA 1QPIA 2A5WA 1SFEA 2HXIA 2CWEA 4D0PA 4BQAA 3ABMH 1DGRM 1NK3P 5JR3A 4IF4A 3F8BA 3V7SA 2K4BA 4CCOA 1K4SA 2DO7A 1HW2A 4B47A 4II3A 3M4OJ 2L9NA 1ZH5A 1UG0A 1F43A 1QZZA 2XASA 1HW1A 3SQNA 2Q8KA 6PAXA 1T95A 1XSVA 2JZYA 4GYGA 3TW6A 4E6KG 2P5LC 2JSPA 1ETKA 4JX4A 2L7FP 3MD2A 4HLXA 1NTCA 3B6AA 2MC4A 3LSGA 3QPLA 3I4NJ 1KA8A 4UV8A 3EYIA 1N75A 1Y8QB 5J1YA 1F9NA 3HM5A 1Z7UA 2V7FA 3KPHA 3SDGA 4XIDA 2ISZA 2QGUA 2CV2A 4EJVA 1XCVA 3LA7A 1CQTA 4L9NA 5J40A 1NHAA 1HCRA 1VZ0A 2DTRA 2A3SA 1ETYA 3AL0C 5DS9A 2QA4I 1ZKGA 2TCTA 5A2QZ 1I1GA 1ZG1A 2E36A 2EV6A 4Y3OA 1U2WA 3TDZC 3RYPA 1AKHB 4NC7A
chains in the Genus database with same CATH topology
2IA0A 4ENNA 2YSRA 3PQKA 5LEKA 4G94A 4B09A 2UZKA 1FZPB 1ZRDA 3SXYA 1OYWA 3E5UA 1R1VA 4ZZDA 5D4SA 4PCQA 3F6OA 5DYMA 3P9IA 3RPUA 4WXHA 2E7XA 4QLCU 1XCBA 5K5OA 3WTWC 4HQEA 4MEXF 1J0RA 5ICGA 2QM3A 3V4GA 3Q5FA 1BI2A 4I7HA 4IRIA 2WC2A 2OQGA 3BY6A 3MWMA 4S04A 5D5VB 4HDVA 1TQPA 3GFJA 1HXDA 4G6DA 1YW7A 4ESBA 1UCRA 3SZPA 2HKXA 2V1DA 1UHWA 2ETHA 4IHSA 3E3VA 1C0WA 3NQOA 4FT8A 1EV7A 5JI6A 4CXFA 3HSEA 1B9MA 2XRNA 4CDGA 4ZYHA 2OQRA 1ODDA 1MD0A 4HZFA 1YYVA 3FMRA 3E6BA 4UXNA 3GO5A 3EUHA 1T6SA 1BIAA 2QLZA 5DCFA 3N97A 3ECHA 2V6CA 2UWMA 1GXQA 2G9WA 3E6CC 3GW2A 2PJPA 5L3EA 3NEUA 2ESHA 2ZXJA 4YFNF 3F8MA 3R60A 1SFUA 3B02A 2HFHA 1KQ0A 4HA8A 5DUIA 1FSEA 2XAJA 1LVAA 2O3FA 1Z91A 1JGSA 4HX7A 4JK1X 1RIOH 3RPQA 2OU2A 1G6NA 3I5UA 4IVNA 4EMSA 4IRGA 1KQ9A 1IN6A 1Z05A 2FSWA 4AWXB 1XSXA 3RI4A 1ONVA 1O3SA 2P6TA 2BGCA 2G7UA 4ON0A 2RN7A 2ESNA 2GIVA 1FBQA 4U0YA 4BHPA 1O7FA 5BPIA 2PN6A 5HOOA 4IJAA 5LBQA 1ZG5A 3RIRA 3IL2A 2WV0A 2Q0OA 5JVTA 3HTSB 3R6SA 1HKQA 5LRSA 1R7JA 5DEQA 4WXDA 5HDNA 5EEHA 3HOTA 2VONA 4L0YB 1I27A 2LNBA 4I0BA 2XUBA 2OD5A 1QO0D 5HLHA 3R61A 4M72A 5K5RA 5LHIA 1R5HA 2E7WA 4MQVA 1IXRC 5HLIA 3M9AA 3ULQB 2CYYA 4HF1A 5FD6A 2NNYA 1H9GA 1XGMA 4UNOA 2IRFG 3TO6A 4HW0A 4OINF 2OBPA 3KP6A 4N9IA 2PI0A 4LK1F 3VFZA 2C6YA 1SMTA 3QP5A 2X4HA 3WTZA 3F21A 5HVQC 3E5QA 2YX4A 5DCMA 2XAHA 5L3FA 1RNLA 4U88A 2DLLA 3ZMSA 3K1PA 2L4MA 3KEOA 4P9FA 3C1DA 2FNAA 5KVRA 1D3YA 2P7CB 3ELKA 1ZYRF 1ZARA 3ML6A 2QENA 4WX9A 2HZTA 3U2RA 1LDJA 1L0OC 2MC3A 3DPTA 4LG0A 3HOSA 1K78A 4BH9A 2K27A 3U1DA 3W6JB 5ILUA 4A12A 5D5UB 4MQ9F 3F72A 2GA2A 5E17F 5JHUA 1HBXG 1KU9A 2Y75A 3L00A 4KNYA 1I5ZA 1S29A 2P4WA 1LQ1A 4M6XA 3M1EA 4L0ZB 1W7PD 3G3ZA 2VT3A 2PG4A 4P96A 3ERED 3I54A 4I2OA 4WXCA 2FQ3A 3TKYA 1A04A 3TQNA 2GXGA 2PMUA 2Y0MA 2A07F 2HS5A 5ICEA 1H0MA 5H6RA 3QP6A 4OU0A 3WU0A 1KGSA 4KN4X 2ZBKA 2M1BA 2ADUA 1W4MA 2XVCA 4ZZLA 2A6EF 3QPTA 1YW9A 3K1MA 4LFUA 2V1XA 4XBFA 3ABUA 1E2XA 1O7LA 4CYDA 5CVIA 3M7GA 2QUFA 2XV4S 3JAMZ 5E1WA 1LDKB 5TRDA 2FA5A 1SFXA 1KU2A 1T98A 2G7HA 5HDKA 3GUDA 2GA1A 1SD5A 3FMQA 3F8NA 3KCCA 3CO6C 2PMHA 3BP8A 4H0EA 1FPQA 1SD4A 5ILSA 1MDMB 1EH6A 1WWXA 1BBYA 4L9VA 4B8XA 4KIBA 2Z33A 3KEQA 5D8LB 3RKYA 3BJ6A 4MTEA 2VN2A 1UB9A 3CLOA 4HF0A 4M9XA 1K7AA 3T8RA 4L9TA 2FBIA 2X0LA 3DP7A 4U0VA 4GO1A 3M8FA 4YIIA 2Y48A 2H6CA 3I59B 2IJLA 3GYHX 3LQQA 4GYIA 5E20A 2HWVA 4KIGA 3BZ6A 3S2WA 4CGZA 4A6EA 3P9KA 3O6BB 3TO9A 1CGPA 2VC1A 2GZWA 4KUMA 3WTTC 4L5JA 3JTHA 4YIFA 1BN5A 2XHKA 2D45A 1F1ZA 1Z6TA 1BC8C 1TW3A 3DKWA 3HRTA 4EV0A 4A0ZA 1V4RA 5LHGA 5AIPA 3WGIA 1SD6A 3R4KA 5F6FA 3VODA 4UV9A 5A2QK 1XSDA 1XGNA 2WWYA 1YG2A 4LD5A 5FLXZ 1UFMA 2MH2A 4HV6A 2YX7A 3T1BA 2KIMA 4Y17A 5AIQA 1E17A 3U9GA 1B1BA 2IT0A 3LAPA 4WF2A 3WGHA 4HOBA 5CVVA 3E97A 2RGVA 3P7NA 3WGGA 2KIFA 5JFRA 3F22A 1XDUA 3FMSA 5E1XA 4ETSA 4XRFA 5L3BA 4AD9A 3CUOA 3FHZA 4RAYA 1SMYF 2NRAC 4LK0F 5E8IA 1IN8A 2M87A 3W6KB 1B59A 3K2ZA 2HOEA 3EETA 3VEPA 1OKRA 3Q9SA 2VC0A 2MD5A 1R36A 1BM9A 3I58A 3VB2A 4KDPA 4HLYA 1QZYA 3G73A 4LGWA 4EM2A 4MNUA 3KETA 3BWGA 4ENKA 2EFPA 1U5TA 1R1UA 3LWFA 3F23A 2VBZA 3NRVA 3BOQA 1QPMA 1J7KA 2ZKZA 2COMA 3V8JA 1ZREA 1I1SA 2CGPA 1HKTA 3WTUC 2QBYA 5FFXA 4RAZA 1WSUA 1T0FA 5L3GA 3MCZA 1P6RA 2FMLA 1S6LA 2FRHA 3K1NA 1YFHA 2CFXA 3IC7A 4RGUA 4EGYA 1YO5C 3K69A 4CHUA 1L3LA 4I98B 3CUQA 5KK1A 1I6XA 1USTA 3D0SA 4A5NA 1HSJA 2F5CA 1T39A 1YS7A 4U7DA 2A61A 2ZNYA 1ZGJA 1IXSB 3KFWX 2O0YA 5DDGA 1U8RA 3I64A 2GWRA 4RB2C 5J8FA 1HSTA 2FF4A 2KRFA 5FFZA 4HAMA 1D8JA 2EB7A 2O6GE 4OIPF 1ZLJA 3RJPA 1MJ9A 2ZJ2A 2VE9A 2RDPA 1G3YA 2EA2A 4CZZA 3HUGA 3QU6A 3TDUC 4ZYGA 2DFIA 2XAGA 1WQ2A 3IWFA 1JHFA 4LLLA 4LLNA 1Q1HA 2P6SA 1BC7C 2QZ8A 3GZ6A 4P9UA 1EH8A 3QOPA 4DNCA 4JQFA 5LGNA 3PQJA 5DCMB 4RB3C 4EQQA 2VBXA 3FF5A 3RKXA 4A6DA 5LHHA 1FYLA 2PEXA 3WG9A 3EQLF 5LLQA 1HKSA 1WI9A 5CVRA 3LA2A 4RB0A 2VBWA 3L9FA 1FP1D 3EDPA 5FB2A 4L9JA 4HF2A 2PBIA 2A69F 4AIHA 1UHMA 2VODA 3I53A 1OPCA 3JW4A 3TGNA 5ICCA 2PLYA 1IN5A 2QYOA 2DU9A 2QWWA 1S3JA 1IN4A 3F8FA 5LGTA 1FBUA 2XGXA 3F8CA 1JHHA 3ECOA 2KJBA 1P4AA 3LSTA 2DT5A 5D6EA 1WRJA 3V7RA 3RKWA 1FLIA 1Z1DA 4MTDA 1R00A 2EK5A 4ZH4F 4U0WA 4MEYF 3GEZA 1HW5A 5CLSA 4PGGA 4XSXF 2EV5A 1EH7A 1MGTA 1D8KA 5J8CA 3DF8A 2V79A 4UHTA 5IT3A 3QU3A 1J75A 2LKPA 3IHUA 4ZYEA 2OZ6A 3I0TA 1TQMA 1MKMA 1YQAA 3JAMK 1IZ1A 1TTYA 3WE3A 2IP2A 1GHCA 4WCGA 4I02A 4RGRA 2FEZA 4UVBA 3MZYA 1TBXA 4A0XA 2L01A 1T38A 1J9IA 1W5TA 4ENJA 3P9CA 2DQRA 3AAFA 3WE2A 4HV5A 1LB2A 2AS5F 3L09A 1XMAA 1DUXC 3TO7A 1IAWA 1XGSA 2HYFA 1MZBA 2R7DA 2EJRA 3HIFA 4GCVA 2GXBA 1KYWA 1P92A 2O03A 3HTUA 4UUVA 2VBYA 4G6QA 3J80K 2F5DA 2YU3A 2R7FA 3TOBA 1FT9A 3FZVA 2QQAA 2H09A 2DPUA 2Z9OA 2IW5A 4ESJA 1QNTA 4EJTA 4NHJA 1KQ8A 2M8EA 2FMYA 3KP7A 2XAQA 1ZN2A 1W7PB 3M8EA 2KKOA 4OIRF 2FNPA 4BHCA 2OA4A 1DP7P 2KIUA 3E6MA 3ZP5A 4PGHA 1R1TA 5K1YA 5BQTA 5HS8A 2RKHA 3C3WA 3COAC 1XB4A 4Q5SF 1O3RA 3FX3A 4KN7X 3E6DA 2ACJA 4EM1A 1ON2A 2ZMEB 1O57A 4RB1A 1FSHA 2HKOA 2K02A 1SAXA 3FXRA 2W25A 5LEJA 2HDCA 3V8LA 5E8GA 3H3ZA 4A5MA 3REOA 1S7OA 3RYRA 4Q48A 1HQCA 1PDNC 4XLNF 3IRRA 3WTVC 4DQ2A 2RNJA 3OOPA 2EFQA 2A5YB 3H92A 2O61A 3JSOA 1BI3A 3GFIA 1PP7U 3CJNA 4I09A 4ZYDA 4R79A 2P5VA 4HBLA 1FP2A 5EEGA 1F5TA 1B4AA 5J6XA 3HRUA 5BS6A 5H20A 4KICA 3HRSA 2H6BA 1ZHFA 1ZG3A 2XROA 1XDSA 3BDDA 4EJWA 1O3QA 1ON1A 3HSRA 4IHTA 2HGCA 1MDMA 2CQKA 1IF1A 3C18A 3DPLC 3FXQA 1OMIA 4RGSA 5DV5A 5ILVA 1QQIA 1V3FA 3R0JA 3T5XA 1FYMA 4OMYA 5HLGA 1XN7A 2M45A 2Z5UA 5D4RA 1R5GA 1RUNA 4M9ZA 1LEBA 4HX8A 1FY7A 1IW7F 1FOKA 3HSFA 1YTYA 4N9HA 3N4MA 2EV0A 2VOPA 4M71A 4FX4A 2IVMA 4LMYA 2NS0A 2BE5F 2L02A 2IA1A 3KP2A 3F6VA 1GXPA 2P5KA 5IT9Z 1ZGAA 3JTGA 4Q47A 5LRRA 4G7HF 4CICA 3D5LA 3PFIA 2VE8A 1FWZA 3KZYA 3SFZA 3LFKA 2BV6A 4YFXF 4KFCA 4IRHA 2W84A 3OV8A 3WODF 3HRMA 1REPC 1G3WA 4A2UA 2D1VA 4G7OF 3CUQB 2JRTA 4BYYA 1T2KA 5BMZA 2CG4A 2JPCA 2V9VA 2CSOA 1RI7A 3ZQ7A 1BI0A 2HQNA 1ZRFA 4M74A 1CF7A 5DD8A 1QGPA 3SZTA 3J81Z 2M30A 4KT5C 2RQPA 2P7VB 3RTRA 3H3UA 3KP4A 2MBFA 3ZN0A 1KU3A 2UXNA 5ICFA 2ZO4A 4FHTA 1K6OA 2Z99A 3KLOA 3V8KA 4FX0A 3CTAA 2FU4A 2QQ9A 5HDGA 1P4WA 1IN7A 3FWEA 3CDHA 4NB5A 2W24A 2NNNA 2WTEA 2XAFA 2RV8A 4OIQF 2H94A 3KZZA 1BOAA 4EVIA 5ED4A 5F1RA 3IKVA 4KMFA 5HS7A 1W5SA 2DAOA 2DW4A 1DDNA 3IKTA 4O3MA 1Y0UA 3WTSC 1K79A 1OYYA 1AWCA 5H6QA 3IRQA 3ZMDA 1IRFA 2VOOA 1ZLKA 2ISYA 3ZMUA 2TDXA 3KP3A 4K2EA 2VXZA 1RUOA 4G9YA 2K4JA 3C7JA 1R22A 1MJBA 3KLNA 3DFGA 3MFKA 1DPUA 1U5TC 3FM5A 2BYVE 3TDZC 3GXOA 1J5YA 2LF8A 1U3EM 3GWZA 2L54A 5BOXA 2DBBA 3GZ5A 2F5FA 2MH9A 3QPHA 1B9NA 1ULYA 1G3TA 1LJ9A 1FC3A 2PQ8A 4LLGF 2HTJA 3BPXA 2QVOA 2AXLA 3O2PE 3V7CA 2FBHA 1YW8A 2W57A 3GX4X 4LB6B 5BPDA 2BEOA 5FGMA 4O6JA 3ROUA 3LA3A 2MLKA 2STTA 3BROA 4I01A 3ZMVA 1QBJA 2EFNA 3GLXA 4ASNA 5LGUA 2MA3A 3CUQC 1WKMA 1IRGA 4TV7A 1KYZA 3B73A 3J7AO 1Z6RA 4LB5A 3MEXA 2J5OA 3I4PA 5CVUA 3MQ0A 1K78B 4LG0B 3FXUA 5E1ZB 4AIJA 1U78A 2HQRA 1R58A 1VTNC 2J5PA 4QWQA 4YFKF 3VOEA 1O3TA 5HS9A 2W85A 4BXUA 3FM3A 3SHFA 4JBAA 1KU7A 1USSA 1XMKA 3KP5A 4Z2YA 4BHBA 3MZHA 5FO5A 2RVCA 2DK8A 1F4KA 4NQWA 2RC4A 3T8TA 1BJAA 2P8TA 2OAZA 2GQQA 1MJAA 1FX7A 3HHHA 4KMUX 5AONA 2V1UA 4EM0B 4IPAA 2OZUA 1TNTA 4OOIA 1OYIA 2KJCA 1PP8F 1YLFA 3WTYC 5K5QA 4G8XA 4Y13A 3BPVA 1FYKA 4RS8A 4Y15A 1FBSA 3QRFF 4OMZA 4M6YA 4U7BA 2ZFWA 2MLGA 2Q2EA 3WU1B 1GVJA 1ZAOA 2HTSA 2UXXA 2JT1A 1J59A 2EFOA 4A0YA 2EWNA 4O5VA 2D2WA 4WK8F 3ISPA 3HYIA 4YG2F 1JE8A 5L3DA 3R0AA 2ZNZA 4S05A 2M5WA 2XKOA 4LJZF 1YS6A 1JXSA 1ZRCA 3DEUA 2GAUA 3RDIA 1DPRA 3I71A 1IXCA 2F5EA 2PFBA 2YPRA 1H9TA 4N0BA 4E70A 3GF2A 1YIOA 4G7ZF 2JPBA 1TNSA 5DD4A 3EYYA 2D1HA 4HYEA 4R1HA 3DQVC 2K86A 2XIGA 1G3SA 3GFMA 2DK5A 5D5XB 1LDDA 2HYGD 2YR2A 4EGZA 3T0YA 3MAJA 4EJUA 4M9SA 2FBKA 4M73A 3Q9VA 3IWZA 5TJJA 3CO7C 1D5VA 2DQLA 1SD7A 2ZCWA 1TLHB 3K0LA 2A68F 4XSZF 4KIFA 5E18F 5CVJA 3L2CA 2JTVA 2NAZA 2B0LA 1XD7A 5D6FA 4F7ZA 4HX4A 3BJOA 2VT2A 4P5OA 2FE3A 2STWA 4PZJA 5DUKA 2FXAA 1Z9CA 2DPDA 4MGRA 2LDUA 4IXAA 1XGOA 3KE2A 4Q4ZF 3ABTA 3E5XA 4UVCA 1AOYA 4HDUA 4MHGA 4KYWA 3O3KA 4RGXA 5ERIA 3GFLA 2O8XA 5CYVA 5FLXK 1IUYA 3ZPLA 2XKPA 2LF7A 4CO8A 4XLPF 3F3XA 4AVPA 2IA2A 1OR7A 2DI3A 2HR3A 3J80Z 3JSPA 2F2EA 5F64A 3LAJA 2E1CA 2NYXA 5CJ9A 4L5IA 2CO5A 4HQMA 2BBYA 3ZMZA 1TW2A 4PDKA 1BIBA 3BJAA 3DV8A 1W7PA 3GVAA 1PUEE 4OIOF 5IT9K 4UVAA 1J2XA 3QAHA 1G4DA 2E1NA 2Z3YA 1R23A 4AIKA 3LQRA 2H27A 4I0AA 2HEOA 1BI1A 2A6HF 1U6GA 2QQBA 3K9TA 2LSOA 2L3DA 4R8HA 2K7LA 1STZA 1RZ4A 2L4AA 2IPQX 1LEAA 4BNCA 2ZMEA 2JSCA 4KA4A 1S7AA 1X3UA 2ELHA 2EA4A 1CF7B 1FNNA 3TOAA 2FOKA 2CW0F 3DXJF 1U5TB 4BAYA 3L7WA 4ENMA 3J81K 1S8NA 4WWCA 1TQIA 4GXOA 4GGGA 4ESFA 4L18B 5D8KB 3WTXC 1B6AA 5L3CA 5D5WB 4EJOA 1P2FA 2QBYB 2R3SA 4P55A 3HHGA 3I59A 5FD5A 3ZMTA 1P4XA 3ZN1A 1LNWA 1SFEA 4D0PA 2CWEA 4BQAA 5JR3A 4IF4A 3F8BA 3V7SA 2K4BA 2DO7A 1HW2A 1ZH5A 1QZZA 2XASA 1HW1A 3SQNA 2Q8KA 6PAXA 1XSVA 2JZYA 4GYGA 2P5LC 4HLXA 1KA8A 4UV8A 3EYIA 1F9NA 1Z7UA 2ISZA 4EJVA 1XCVA 3LA7A 4L9NA 1NHAA 2DTRA 2A3SA 5A2QZ 1I1GA 1ZG1A 2EV6A 1U2WA 2EFWA 3RYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA0 A;  4ENN A;  2YSR A;  3PQK A;  5LEK A;  4G94 A;  4B09 A;  2UZK A;  1FZP B;  1ZRD A;  3SXY A;  1OYW A;  3E5U A;  1R1V A;  4ZZD A;  5D4S A;  4PCQ A;  3F6O A;  5DYM A;  3P9I A;  3RPU A;  4WXH A;  2E7X A;  4QLC U;  1XCB A;  5K5O A;  3WTW C;  4HQE A;  4MEX F;  1J0R A;  5ICG A;  2QM3 A;  3V4G A;  3Q5F A;  1BI2 A;  4I7H A;  4IRI A;  2WC2 A;  2OQG A;  3BY6 A;  3MWM A;  4S04 A;  5D5V B;  4HDV A;  1TQP A;  3GFJ A;  1HXD A;  4G6D A;  1YW7 A;  4ESB A;  1UCR A;  3SZP A;  2HKX A;  2V1D A;  1UHW A;  2ETH A;  4IHS A;  3E3V A;  1C0W A;  3NQO A;  4FT8 A;  1EV7 A;  5JI6 A;  4CXF A;  3HSE A;  1B9M A;  2XRN A;  4CDG A;  4ZYH A;  2OQR A;  1ODD A;  1MD0 A;  4HZF A;  1YYV A;  3FMR A;  3E6B A;  4UXN A;  3GO5 A;  3EUH A;  1T6S A;  1BIA A;  2QLZ A;  5DCF A;  3N97 A;  3ECH A;  2V6C A;  2UWM A;  1GXQ A;  2G9W A;  3E6C C;  3GW2 A;  2PJP A;  5L3E A;  3NEU A;  2ESH A;  2ZXJ A;  4YFN F;  3F8M A;  3R60 A;  1SFU A;  3B02 A;  2HFH A;  1KQ0 A;  4HA8 A;  5DUI A;  1FSE A;  2XAJ A;  1LVA A;  2O3F A;  1Z91 A;  1JGS A;  4HX7 A;  4JK1 X;  1RIO H;  3RPQ A;  2OU2 A;  1G6N A;  3I5U A;  4IVN A;  4EMS A;  4IRG A;  1KQ9 A;  1IN6 A;  1Z05 A;  2FSW A;  4AWX B;  1XSX A;  3RI4 A;  1ONV A;  1O3S A;  2P6T A;  2BGC A;  2G7U A;  4ON0 A;  2RN7 A;  2ESN A;  2GIV A;  1FBQ A;  4U0Y A;  4BHP A;  1O7F A;  5BPI A;  2PN6 A;  5HOO A;  4IJA A;  5LBQ A;  1ZG5 A;  3RIR A;  3IL2 A;  2WV0 A;  2Q0O A;  5JVT A;  3HTS B;  3R6S A;  1HKQ A;  5LRS A;  1R7J A;  5DEQ A;  4WXD A;  5HDN A;  5EEH A;  3HOT A;  2VON A;  4L0Y B;  1I27 A;  2LNB A;  4I0B A;  2XUB A;  2OD5 A;  1QO0 D;  5HLH A;  3R61 A;  4M72 A;  5K5R A;  5LHI A;  1R5H A;  2E7W A;  4MQV A;  1IXR C;  5HLI A;  3M9A A;  3ULQ B;  2CYY A;  4HF1 A;  5FD6 A;  2NNY A;  1H9G A;  1XGM A;  4UNO A;  2IRF G;  3TO6 A;  4HW0 A;  4OIN F;  2OBP A;  3KP6 A;  4N9I A;  2PI0 A;  4LK1 F;  3VFZ A;  2C6Y A;  1SMT A;  3QP5 A;  2X4H A;  3WTZ A;  3F21 A;  5HVQ C;  3E5Q A;  2YX4 A;  5DCM A;  2XAH A;  5L3F A;  1RNL A;  4U88 A;  2DLL A;  3ZMS A;  3K1P A;  2L4M A;  3KEO A;  4P9F A;  3C1D A;  2FNA A;  5KVR A;  1D3Y A;  2P7C B;  3ELK A;  1ZYR F;  1ZAR A;  3ML6 A;  2QEN A;  4WX9 A;  2HZT A;  3U2R A;  1LDJ A;  1L0O C;  2MC3 A;  3DPT A;  4LG0 A;  3HOS A;  1K78 A;  4BH9 A;  2K27 A;  3U1D A;  3W6J B;  5ILU A;  4A12 A;  5D5U B;  4MQ9 F;  3F72 A;  2GA2 A;  5E17 F;  5JHU A;  1HBX G;  1KU9 A;  2Y75 A;  3L00 A;  4KNY A;  1I5Z A;  1S29 A;  2P4W A;  1LQ1 A;  4M6X A;  3M1E A;  4L0Z B;  1W7P D;  3G3Z A;  2VT3 A;  2PG4 A;  4P96 A;  3ERE D;  3I54 A;  4I2O A;  4WXC A;  2FQ3 A;  3TKY A;  1A04 A;  3TQN A;  2GXG A;  2PMU A;  2Y0M A;  2A07 F;  2HS5 A;  5ICE A;  1H0M A;  5H6R A;  3QP6 A;  4OU0 A;  3WU0 A;  1KGS A;  4KN4 X;  2ZBK A;  2M1B A;  2ADU A;  1W4M A;  2XVC A;  4ZZL A;  2A6E F;  3QPT A;  1YW9 A;  3K1M A;  4LFU A;  2V1X A;  4XBF A;  3ABU A;  1E2X A;  1O7L A;  4CYD A;  5CVI A;  3M7G A;  2QUF A;  2XV4 S;  3JAM Z;  5E1W A;  1LDK B;  5TRD A;  2FA5 A;  1SFX A;  1KU2 A;  1T98 A;  2G7H A;  5HDK A;  3GUD A;  2GA1 A;  1SD5 A;  3FMQ A;  3F8N A;  3KCC A;  3CO6 C;  2PMH A;  3BP8 A;  4H0E A;  1FPQ A;  1SD4 A;  5ILS A;  1MDM B;  1EH6 A;  1WWX A;  1BBY A;  4L9V A;  4B8X A;  4KIB A;  2Z33 A;  3KEQ A;  5D8L B;  3RKY A;  3BJ6 A;  4MTE A;  2VN2 A;  1UB9 A;  3CLO A;  4HF0 A;  4M9X A;  1K7A A;  3T8R A;  4L9T A;  2FBI A;  2X0L A;  3DP7 A;  4U0V A;  4GO1 A;  3M8F A;  4YII A;  2Y48 A;  2H6C A;  3I59 B;  2IJL A;  3GYH X;  3LQQ A;  4GYI A;  5E20 A;  2HWV A;  4KIG A;  3BZ6 A;  3S2W A;  4CGZ A;  4A6E A;  3P9K A;  3O6B B;  3TO9 A;  1CGP A;  2VC1 A;  2GZW A;  4KUM A;  3WTT C;  4L5J A;  3JTH A;  4YIF A;  1BN5 A;  2XHK A;  2D45 A;  1F1Z A;  1Z6T A;  1BC8 C;  1TW3 A;  3DKW A;  3HRT A;  4EV0 A;  4A0Z A;  1V4R A;  5LHG A;  5AIP A;  3WGI A;  1SD6 A;  3R4K A;  5F6F A;  3VOD A;  4UV9 A;  5A2Q K;  1XSD A;  1XGN A;  2WWY A;  1YG2 A;  4LD5 A;  5FLX Z;  1UFM A;  2MH2 A;  4HV6 A;  2YX7 A;  3T1B A;  2KIM A;  4Y17 A;  5AIQ A;  1E17 A;  3U9G A;  1B1B A;  2IT0 A;  3LAP A;  4WF2 A;  3WGH A;  4HOB A;  5CVV A;  3E97 A;  2RGV A;  3P7N A;  3WGG A;  2KIF A;  5JFR A;  3F22 A;  1XDU A;  3FMS A;  5E1X A;  4ETS A;  4XRF A;  5L3B A;  4AD9 A;  3CUO A;  3FHZ A;  4RAY A;  1SMY F;  2NRA C;  4LK0 F;  5E8I A;  1IN8 A;  2M87 A;  3W6K B;  1B59 A;  3K2Z A;  2HOE A;  3EET A;  3VEP A;  1OKR A;  3Q9S A;  2VC0 A;  2MD5 A;  1R36 A;  1BM9 A;  3I58 A;  3VB2 A;  4KDP A;  4HLY A;  1QZY A;  3G73 A;  4LGW A;  4EM2 A;  4MNU A;  3KET A;  3BWG A;  4ENK A;  2EFP A;  1U5T A;  1R1U A;  3LWF A;  3F23 A;  2VBZ A;  3NRV A;  3BOQ A;  1QPM A;  1J7K A;  2ZKZ A;  2COM A;  3V8J A;  1ZRE A;  1I1S A;  2CGP A;  1HKT A;  3WTU C;  2QBY A;  5FFX A;  4RAZ A;  1WSU A;  1T0F A;  5L3G A;  3MCZ A;  1P6R A;  2FML A;  1S6L A;  2FRH A;  3K1N A;  1YFH A;  2CFX A;  3IC7 A;  4RGU A;  4EGY A;  1YO5 C;  3K69 A;  4CHU A;  1L3L A;  4I98 B;  3CUQ A;  5KK1 A;  1I6X A;  1UST A;  3D0S A;  4A5N A;  1HSJ A;  2F5C A;  1T39 A;  1YS7 A;  4U7D A;  2A61 A;  2ZNY A;  1ZGJ A;  1IXS B;  3KFW X;  2O0Y A;  5DDG A;  1U8R A;  3I64 A;  2GWR A;  4RB2 C;  5J8F A;  1HST A;  2FF4 A;  2KRF A;  5FFZ A;  4HAM A;  1D8J A;  2EB7 A;  2O6G E;  4OIP F;  1ZLJ A;  3RJP A;  1MJ9 A;  2ZJ2 A;  2VE9 A;  2RDP A;  1G3Y A;  2EA2 A;  4CZZ A;  3HUG A;  3QU6 A;  3TDU C;  4ZYG A;  2DFI A;  2XAG A;  1WQ2 A;  3IWF A;  1JHF A;  4LLL A;  4LLN A;  1Q1H A;  2P6S A;  1BC7 C;  2QZ8 A;  3GZ6 A;  4P9U A;  1EH8 A;  3QOP A;  4DNC A;  4JQF A;  5LGN A;  3PQJ A;  5DCM B;  4RB3 C;  4EQQ A;  2VBX A;  3FF5 A;  3RKX A;  4A6D A;  5LHH A;  1FYL A;  2PEX A;  3WG9 A;  3EQL F;  5LLQ A;  1HKS A;  1WI9 A;  5CVR A;  3LA2 A;  4RB0 A;  2VBW A;  3L9F A;  1FP1 D;  3EDP A;  5FB2 A;  4L9J A;  4HF2 A;  2PBI A;  2A69 F;  4AIH A;  1UHM A;  2VOD A;  3I53 A;  1OPC A;  3JW4 A;  3TGN A;  5ICC A;  2PLY A;  1IN5 A;  2QYO A;  2DU9 A;  2QWW A;  1S3J A;  1IN4 A;  3F8F A;  5LGT A;  1FBU A;  2XGX A;  3F8C A;  1JHH A;  3ECO A;  2KJB A;  1P4A A;  3LST A;  2DT5 A;  5D6E A;  1WRJ A;  3V7R A;  3RKW A;  1FLI A;  1Z1D A;  4MTD A;  1R00 A;  2EK5 A;  4ZH4 F;  4U0W A;  4MEY F;  3GEZ A;  1HW5 A;  5CLS A;  4PGG A;  4XSX F;  2EV5 A;  1EH7 A;  1MGT A;  1D8K A;  5J8C A;  3DF8 A;  2V79 A;  4UHT A;  5IT3 A;  3QU3 A;  1J75 A;  2LKP A;  3IHU A;  4ZYE A;  2OZ6 A;  3I0T A;  1TQM A;  1MKM A;  1YQA A;  3JAM K;  1IZ1 A;  1TTY A;  3WE3 A;  2IP2 A;  1GHC A;  4WCG A;  4I02 A;  4RGR A;  2FEZ A;  4UVB A;  3MZY A;  1TBX A;  4A0X A;  2L01 A;  1T38 A;  1J9I A;  1W5T A;  4ENJ A;  3P9C A;  2DQR A;  3AAF A;  3WE2 A;  4HV5 A;  1LB2 A;  2AS5 F;  3L09 A;  1XMA A;  1DUX C;  3TO7 A;  1IAW A;  1XGS A;  2HYF A;  1MZB A;  2R7D A;  2EJR A;  3HIF A;  4GCV A;  2GXB A;  1KYW A;  1P92 A;  2O03 A;  3HTU A;  4UUV A;  2VBY A;  4G6Q A;  3J80 K;  2F5D A;  2YU3 A;  2R7F A;  3TOB A;  1FT9 A;  3FZV A;  2QQA A;  2H09 A;  2DPU A;  2Z9O A;  2IW5 A;  4ESJ A;  1QNT A;  4EJT A;  4NHJ A;  1KQ8 A;  2M8E A;  2FMY A;  3KP7 A;  2XAQ A;  1ZN2 A;  1W7P B;  3M8E A;  2KKO A;  4OIR F;  2FNP A;  4BHC A;  2OA4 A;  1DP7 P;  2KIU A;  3E6M A;  3ZP5 A;  4PGH A;  1R1T A;  5K1Y A;  5BQT A;  5HS8 A;  2RKH A;  3C3W A;  3COA C;  1XB4 A;  4Q5S F;  1O3R A;  3FX3 A;  4KN7 X;  3E6D A;  2ACJ A;  4EM1 A;  1ON2 A;  2ZME B;  1O57 A;  4RB1 A;  1FSH A;  2HKO A;  2K02 A;  1SAX A;  3FXR A;  2W25 A;  5LEJ A;  2HDC A;  3V8L A;  5E8G A;  3H3Z A;  4A5M A;  3REO A;  1S7O A;  3RYR A;  4Q48 A;  1HQC A;  1PDN C;  4XLN F;  3IRR A;  3WTV C;  4DQ2 A;  2RNJ A;  3OOP A;  2EFQ A;  2A5Y B;  3H92 A;  2O61 A;  3JSO A;  1BI3 A;  3GFI A;  1PP7 U;  3CJN A;  4I09 A;  4ZYD A;  4R79 A;  2P5V A;  4HBL A;  1FP2 A;  5EEG A;  1F5T A;  1B4A A;  5J6X A;  3HRU A;  5BS6 A;  5H20 A;  4KIC A;  3HRS A;  2H6B A;  1ZHF A;  1ZG3 A;  2XRO A;  1XDS A;  3BDD A;  4EJW A;  1O3Q A;  1ON1 A;  3HSR A;  4IHT A;  2HGC A;  1MDM A;  2CQK A;  1IF1 A;  3C18 A;  3DPL C;  3FXQ A;  1OMI A;  4RGS A;  5DV5 A;  5ILV A;  1QQI A;  1V3F A;  3R0J A;  3T5X A;  1FYM A;  4OMY A;  5HLG A;  1XN7 A;  2M45 A;  2Z5U A;  5D4R A;  1R5G A;  1RUN A;  4M9Z A;  1LEB A;  4HX8 A;  1FY7 A;  1IW7 F;  1FOK A;  3HSF A;  1YTY A;  4N9H A;  3N4M A;  2EV0 A;  2VOP A;  4M71 A;  4FX4 A;  2IVM A;  4LMY A;  2NS0 A;  2BE5 F;  2L02 A;  2IA1 A;  3KP2 A;  3F6V A;  1GXP A;  2P5K A;  5IT9 Z;  1ZGA A;  3JTG A;  4Q47 A;  5LRR A;  4G7H F;  4CIC A;  3D5L A;  3PFI A;  2VE8 A;  1FWZ A;  3KZY A;  3SFZ A;  3LFK A;  2BV6 A;  4YFX F;  4KFC A;  4IRH A;  2W84 A;  3OV8 A;  3WOD F;  3HRM A;  1REP C;  1G3W A;  4A2U A;  2D1V A;  4G7O F;  3CUQ B;  2JRT A;  4BYY A;  1T2K A;  5BMZ A;  2CG4 A;  2JPC A;  2V9V A;  2CSO A;  1RI7 A;  3ZQ7 A;  1BI0 A;  2HQN A;  1ZRF A;  4M74 A;  1CF7 A;  5DD8 A;  1QGP A;  3SZT A;  3J81 Z;  2M30 A;  4KT5 C;  2RQP A;  2P7V B;  3RTR A;  3H3U A;  3KP4 A;  2MBF A;  3ZN0 A;  1KU3 A;  2UXN A;  5ICF A;  2ZO4 A;  4FHT A;  1K6O A;  2Z99 A;  3KLO A;  3V8K A;  4FX0 A;  3CTA A;  2FU4 A;  2QQ9 A;  5HDG A;  1P4W A;  1IN7 A;  3FWE A;  3CDH A;  4NB5 A;  2W24 A;  2NNN A;  2WTE A;  2XAF A;  2RV8 A;  4OIQ F;  2H94 A;  3KZZ A;  1BOA A;  4EVI A;  5ED4 A;  5F1R A;  3IKV A;  4KMF A;  5HS7 A;  1W5S A;  2DAO A;  2DW4 A;  1DDN A;  3IKT A;  4O3M A;  1Y0U A;  3WTS C;  1K79 A;  1OYY A;  1AWC A;  5H6Q A;  3IRQ A;  3ZMD A;  1IRF A;  2VOO A;  1ZLK A;  2ISY A;  3ZMU A;  2TDX A;  3KP3 A;  4K2E A;  2VXZ A;  1RUO A;  4G9Y A;  2K4J A;  3C7J A;  1R22 A;  1MJB A;  3KLN A;  3DFG A;  3MFK A;  1DPU A;  1U5T C;  3FM5 A;  2BYV E;  3TDZ C;  3GXO A;  1J5Y A;  2LF8 A;  1U3E M;  3GWZ A;  2L54 A;  5BOX A;  2DBB A;  3GZ5 A;  2F5F A;  2MH9 A;  3QPH A;  1B9N A;  1ULY A;  1G3T A;  1LJ9 A;  1FC3 A;  2PQ8 A;  4LLG F;  2HTJ A;  3BPX A;  2QVO A;  2AXL A;  3O2P E;  3V7C A;  2FBH A;  1YW8 A;  2W57 A;  3GX4 X;  4LB6 B;  5BPD A;  2BEO A;  5FGM A;  4O6J A;  3ROU A;  3LA3 A;  2MLK A;  2STT A;  3BRO A;  4I01 A;  3ZMV A;  1QBJ A;  2EFN A;  3GLX A;  4ASN A;  5LGU A;  2MA3 A;  3CUQ C;  1WKM A;  1IRG A;  4TV7 A;  1KYZ A;  3B73 A;  3J7A O;  1Z6R A;  4LB5 A;  3MEX A;  2J5O A;  3I4P A;  5CVU A;  3MQ0 A;  1K78 B;  4LG0 B;  3FXU A;  5E1Z B;  4AIJ A;  1U78 A;  2HQR A;  1R58 A;  1VTN C;  2J5P A;  4QWQ A;  4YFK F;  3VOE A;  1O3T A;  5HS9 A;  2W85 A;  4BXU A;  3FM3 A;  3SHF A;  4JBA A;  1KU7 A;  1USS A;  1XMK A;  3KP5 A;  4Z2Y A;  4BHB A;  3MZH A;  5FO5 A;  2RVC A;  2DK8 A;  1F4K A;  4NQW A;  2RC4 A;  3T8T A;  1BJA A;  2P8T A;  2OAZ A;  2GQQ A;  1MJA A;  1FX7 A;  3HHH A;  4KMU X;  5AON A;  2V1U A;  4EM0 B;  4IPA A;  2OZU A;  1TNT A;  4OOI A;  1OYI A;  2KJC A;  1PP8 F;  1YLF A;  3WTY C;  5K5Q A;  4G8X A;  4Y13 A;  3BPV A;  1FYK A;  4RS8 A;  4Y15 A;  1FBS A;  3QRF F;  4OMZ A;  4M6Y A;  4U7B A;  2ZFW A;  2MLG A;  2Q2E A;  3WU1 B;  1GVJ A;  1ZAO A;  2HTS A;  2UXX A;  2JT1 A;  1J59 A;  2EFO A;  4A0Y A;  2EWN A;  4O5V A;  2D2W A;  4WK8 F;  3ISP A;  3HYI A;  4YG2 F;  1JE8 A;  5L3D A;  3R0A A;  2ZNZ A;  4S05 A;  2M5W A;  2XKO A;  4LJZ F;  1YS6 A;  1JXS A;  1ZRC A;  3DEU A;  2GAU A;  3RDI A;  1DPR A;  3I71 A;  1IXC A;  2F5E A;  2PFB A;  2YPR A;  1H9T A;  4N0B A;  4E70 A;  3GF2 A;  1YIO A;  4G7Z F;  2JPB A;  1TNS A;  5DD4 A;  3EYY A;  2D1H A;  4HYE A;  4R1H A;  3DQV C;  2K86 A;  2XIG A;  1G3S A;  3GFM A;  2DK5 A;  5D5X B;  1LDD A;  2HYG D;  2YR2 A;  4EGZ A;  3T0Y A;  3MAJ A;  4EJU A;  4M9S A;  2FBK A;  4M73 A;  3Q9V A;  3IWZ A;  5TJJ A;  3CO7 C;  1D5V A;  2DQL A;  1SD7 A;  2ZCW A;  1TLH B;  3K0L A;  2A68 F;  4XSZ F;  4KIF A;  5E18 F;  5CVJ A;  3L2C A;  2JTV A;  2NAZ A;  2B0L A;  1XD7 A;  5D6F A;  4F7Z A;  4HX4 A;  3BJO A;  2VT2 A;  4P5O A;  2FE3 A;  2STW A;  4PZJ A;  5DUK A;  2FXA A;  1Z9C A;  2DPD A;  4MGR A;  2LDU A;  4IXA A;  1XGO A;  3KE2 A;  4Q4Z F;  3ABT A;  3E5X A;  4UVC A;  1AOY A;  4HDU A;  4MHG A;  4KYW A;  3O3K A;  4RGX A;  5ERI A;  3GFL A;  2O8X A;  5CYV A;  5FLX K;  1IUY A;  3ZPL A;  2XKP A;  2LF7 A;  4CO8 A;  4XLP F;  3F3X A;  4AVP A;  2IA2 A;  1OR7 A;  2DI3 A;  2HR3 A;  3J80 Z;  3JSP A;  2F2E A;  5F64 A;  3LAJ A;  2E1C A;  2NYX A;  5CJ9 A;  4L5I A;  2CO5 A;  4HQM A;  2BBY A;  3ZMZ A;  1TW2 A;  4PDK A;  1BIB A;  3BJA A;  3DV8 A;  1W7P A;  3GVA A;  1PUE E;  4OIO F;  5IT9 K;  4UVA A;  1J2X A;  3QAH A;  1G4D A;  2E1N A;  2Z3Y A;  1R23 A;  4AIK A;  3LQR A;  2H27 A;  4I0A A;  2HEO A;  1BI1 A;  2A6H F;  1U6G A;  2QQB A;  3K9T A;  2LSO A;  2L3D A;  4R8H A;  2K7L A;  1STZ A;  1RZ4 A;  2L4A A;  2IPQ X;  1LEA A;  4BNC A;  2ZME A;  2JSC A;  4KA4 A;  1S7A A;  1X3U A;  2ELH A;  2EA4 A;  1CF7 B;  1FNN A;  3TOA A;  2FOK A;  2CW0 F;  3DXJ F;  1U5T B;  4BAY A;  3L7W A;  4ENM A;  3J81 K;  1S8N A;  4WWC A;  1TQI A;  4GXO A;  4GGG A;  4ESF A;  4L18 B;  5D8K B;  3WTX C;  1B6A A;  5L3C A;  5D5W B;  4EJO A;  1P2F A;  2QBY B;  2R3S A;  4P55 A;  3HHG A;  3I59 A;  5FD5 A;  3ZMT A;  1P4X A;  3ZN1 A;  1LNW A;  1SFE A;  4D0P A;  2CWE A;  4BQA A;  5JR3 A;  4IF4 A;  3F8B A;  3V7S A;  2K4B A;  2DO7 A;  1HW2 A;  1ZH5 A;  1QZZ A;  2XAS A;  1HW1 A;  3SQN A;  2Q8K A;  6PAX A;  1XSV A;  2JZY A;  4GYG A;  2P5L C;  4HLX A;  1KA8 A;  4UV8 A;  3EYI A;  1F9N A;  1Z7U A;  2ISZ A;  4EJV A;  1XCV A;  3LA7 A;  4L9N A;  1NHA A;  2DTR A;  2A3S A;  5A2Q Z;  1I1G A;  1ZG1 A;  2EV6 A;  1U2W A;  2EFW A;  3RYP A; 
#chains in the Genus database with same CATH topology
 1NG7 A;  4NDL A;  2IA0 A;  5IY5 H;  4ENN A;  2YSR A;  2I8D A;  3PQK A;  1YIT I;  5LEK A;  4G94 A;  4B09 A;  2UZK A;  1FZP B;  1ZRD A;  3CMA I;  3SXY A;  3VSL A;  4QIW N;  2BY1 A;  2R7W A;  3H36 A;  1OYW A;  2Z1D A;  3H9J A;  3Q0V A;  4B3X A;  3E5U A;  2W4S A;  2E35 A;  1WFX A;  2E60 A;  1R1V A;  4XLA A;  4ZZD A;  1WJF A;  5D4S A;  5FRM A;  3C2G A;  4XLH A;  5F27 A;  4PCQ A;  3F6O A;  1U9N A;  5DYM A;  5B3S H;  1ERD A;  3P9I A;  1WI3 A;  3RPU A;  2FUG 2;  4WXH A;  3MN2 A;  2E7X A;  4QLC U;  1A31 A;  1XCB A;  5K5O A;  2DYR H;  4A3M J;  3SEQ A;  1Y8R B;  2CQN A;  5B1A H;  3WTW C;  4HQE A;  4MEX F;  4UUT A;  4ZC3 A;  4DBR A;  1J0R A;  1FOW A;  1SVL A;  5ICG A;  1R4M B;  4FCY A;  3AG4 H;  2M4K A;  3HEF A;  5FKM A;  2K9L A;  2QM3 A;  3V4G A;  3BR5 A;  2Y0S N;  2VKH A;  1BI2 A;  3L2R A;  3Q5F A;  4I7H A;  3RCO A;  4IRI A;  2WC2 A;  2OQG A;  3BY6 A;  3MWM A;  4CSW A;  3HBL A;  4S04 A;  5D5V B;  4HDV A;  1TQP A;  3DBH B;  1MBG A;  3GFJ A;  1Q1V A;  1HXD A;  4G6D A;  1YW7 A;  4PJL A;  4RDU A;  4ESB A;  3HXL A;  1UCR A;  3SZP A;  2HKX A;  2V1D A;  1UHW A;  3CQZ J;  2ETH A;  5B66 C;  4IHS A;  3BR1 A;  3E3V A;  2BY2 A;  1C0W A;  3K6G A;  3NQO A;  3AG3 H;  4F93 B;  2KZG A;  4A3F J;  4FT8 A;  4XRM A;  5EJC A;  2GM4 A;  2W48 A;  1LFB A;  1EV7 A;  2CUZ A;  5JI6 A;  4CXF A;  4J19 A;  2NS8 A;  3CCV I;  3HSE A;  1B9M A;  2XRN A;  4RLQ A;  4CDG A;  4ZYH A;  4C3I J;  1V5G A;  2OQR A;  3FXM A;  5KAI C;  2I10 A;  1ODD A;  1MD0 A;  2WB1 N;  2ZXW H;  4HZF A;  3A01 B;  1YYV A;  3FMR A;  3E6B A;  4UXN A;  3GO5 A;  3EUH A;  3BT9 A;  1UZC A;  4F55 A;  1T6S A;  2K9Q A;  2PMZ A;  5C4X J;  1J09 A;  4A3I J;  2OV7 A;  1BIA A;  2QLZ A;  3S1R J;  2EH3 A;  4AID A;  2NXN B;  5DCF A;  4P1W A;  1SFK A;  4CZC A;  3N97 A;  3ECH A;  3OS2 A;  2V6C A;  2UWM A;  1GXQ A;  2G9W A;  3E6C C;  4HSR A;  3GW2 A;  2XSJ C;  2PJP A;  5L3E A;  1I39 A;  3NEU A;  1OCT C;  2ESH A;  2ZXJ A;  2VJ4 A;  3S3O A;  3FXJ A;  4YFN F;  4CYC B;  2XF5 A;  1ZGW A;  3F8M A;  3R60 A;  1SFU A;  3B02 A;  2HFH A;  1KQ0 A;  4HA8 A;  3S17 J;  5DUI A;  1FSE A;  1EA3 A;  2XAJ A;  1LVA A;  2DA3 A;  2O3F A;  1Z91 A;  1X1C A;  2F4I A;  1I6H J;  1JGS A;  2P81 A;  4HX7 A;  3PNY A;  4PJJ A;  4XKB A;  3CMY A;  3S14 J;  4UUS A;  4JK1 X;  1RIO H;  3RPQ A;  2OU2 A;  3KEY A;  5C3E J;  1G6N A;  1X1A A;  3CD6 I;  9ANT A;  3I5U A;  4IVN A;  4EMS A;  3WHB A;  2VI6 A;  4IRG A;  3BR3 A;  2GOM A;  1KQ9 A;  1MH3 A;  1IN6 A;  2R7X A;  1Z05 A;  2FSW A;  1W5C C;  4A3J J;  4AWX B;  1XSX A;  4B3A A;  3RI4 A;  1ONV A;  4M3G A;  1O3S A;  2P6T A;  2KQR A;  2QCO A;  2BGC A;  2G7U A;  4ON0 A;  2LYC A;  4BUP A;  2RN7 A;  3C2B A;  2ESN A;  2V9P A;  4BXF A;  1V54 H;  3LSP A;  1W36 D;  1MSE C;  2GIV A;  3DTI A;  1FBQ A;  3DEE A;  2VL8 A;  1QVU A;  4U0Y A;  4D1Q A;  3EUK L;  4BHP A;  1O7F A;  3OS0 A;  5BPI A;  2PN6 A;  2EIL H;  3H5N A;  5HOO A;  4BDZ A;  4IJA A;  3I3L A;  4B48 A;  5LBQ A;  1ZG5 A;  3RIR A;  2P0W A;  3DLL F;  3IL2 A;  2WV0 A;  2Q0O A;  3JRB A;  2H1K A;  5JVT A;  3HTS B;  4OWR B;  1HKQ A;  3R6S A;  4MIM A;  5LRS A;  2XGE A;  1R7J A;  5DEQ A;  4WXD A;  5HDN A;  2JUC A;  3AG2 H;  2BXZ A;  5EEH A;  3HOT A;  2VON A;  3OYI A;  4L0Y B;  1I27 A;  2LNB A;  4F52 A;  4I0B A;  5IYD J;  2XUB A;  2OD5 A;  1QO0 D;  3S2D J;  2F4O B;  2LFB A;  5HLH A;  1JUM A;  3R61 A;  3BLY A;  4M72 A;  5K5R A;  5HOD A;  5H2F C;  1G8X A;  5LHI A;  1OCP A;  1R5H A;  2PJR A;  2E7W A;  1QVT A;  4MQV A;  4HST A;  3Q0U A;  1IXR C;  5HLI A;  3M9A A;  3ULQ B;  2CYY A;  4HF1 A;  5FD6 A;  5J1U A;  3PUF A;  2NNY A;  2LY2 A;  1H9G A;  1XGM A;  3G1M A;  2EBI A;  5FRN A;  4UNO A;  1TT5 B;  2IRF G;  3TO6 A;  4HW0 A;  4OIN F;  2OBP A;  3KP6 A;  4N9I A;  2PI0 A;  2XF6 A;  3S2H J;  3QPS A;  4LK1 F;  3VFZ A;  2C6Y A;  1SMT A;  2WAF A;  3QP5 A;  2X4H A;  3WTZ A;  3F21 A;  3JRA A;  5HVQ C;  3E5Q A;  2YX4 A;  5DCM A;  2XAH A;  5L3F A;  1RNL A;  2BY0 A;  1QZE A;  2DLL A;  2V4J C;  2M7A A;  4U88 A;  1ZR2 A;  4A93 J;  3ZMS A;  4FE4 A;  3K1P A;  2L4M A;  3KEO A;  4JOM A;  1A35 A;  4P9F A;  3C1D A;  1IUF A;  2FNA A;  1IRZ A;  5KVR A;  3H9G A;  1D3Y A;  2AQE A;  2P7C B;  3ELK A;  5BNG A;  5IP6 A;  1ZYR F;  2XF7 A;  3HGY A;  3IH3 A;  1ZAR A;  3ML6 A;  5J4V A;  2QEN A;  4WX9 A;  2HZT A;  2K9S A;  3U2R A;  1LDJ A;  1L0O C;  2MC3 A;  3DPT A;  3ESW B;  4LG0 A;  3HOS A;  1K78 A;  2IS1 A;  4XM3 A;  4BH9 A;  4DIQ A;  3CJQ B;  2K27 A;  2IEK A;  3G4S I;  3U1D A;  4FAS D;  1ZK8 A;  2KMU A;  3W6J B;  2MAB A;  5ILU A;  1XS9 A;  2AO9 A;  5D5U B;  4A12 A;  4MQ9 F;  3I56 I;  3F72 A;  4FE7 A;  2O5R A;  2BW3 A;  2GA2 A;  5E17 F;  5JHU A;  1HBX G;  3K2A A;  4KIS A;  5FLV A;  1KU9 A;  2Y75 A;  3L00 A;  4KNY A;  1I5Z A;  1S29 A;  2P4W A;  3M1C A;  4M6X A;  4X1E A;  3CJT B;  4BQN A;  1LQ1 A;  3M1E A;  1TL8 A;  3LSI A;  4L0Z B;  5E3N A;  4CCJ A;  3DKY A;  3CMM A;  1W7P D;  1W0T A;  1DU6 A;  1VF9 A;  3G3Z A;  2VT3 A;  2PG4 A;  3ZQQ A;  5M5W J;  4P96 A;  2ZC2 A;  3GBG A;  3ERE D;  3I54 A;  2LBF B;  1Y1V J;  1X1B A;  2QQ8 A;  4I2O A;  4WXC A;  3OY9 A;  2FQ3 A;  3OSF A;  3TKY A;  1A04 A;  1HLV A;  2F5V A;  3TQN A;  2GXG A;  2PMU A;  2X6X A;  2Y0M A;  2Y69 H;  4NC6 A;  4YEJ A;  2LD5 A;  1TWC J;  2A07 F;  4IHY A;  2HS5 A;  2CJJ A;  5ICE A;  1H0M A;  2DFE A;  5H6R A;  3ZGK A;  3QP6 A;  4MFD A;  4OU0 A;  3WU0 A;  1KGS A;  3OYG A;  3LNQ A;  2IGN A;  2W00 A;  2WAD A;  4KN4 X;  2ZBK A;  2M1B A;  1VQ5 I;  2ADU A;  1BW5 A;  4CCN A;  1W4M A;  2XVC A;  3LSM A;  4ZZL A;  2IS6 A;  1TT0 A;  2A6E F;  3QPT A;  1IJW C;  5DTD A;  1YW9 A;  3K1M A;  1X2M A;  4LFU A;  2V1X A;  1IDY A;  3SZG A;  3BQY A;  1QU3 A;  1MMN A;  2VQH A;  1P9Q C;  4XBF A;  2ICW G;  3K10 A;  3ABU A;  1SC7 A;  4H4K C;  1E2X A;  1O7L A;  4CYD A;  2CUJ A;  3M7G A;  5CVI A;  2QUF A;  2XV4 S;  4W1U A;  4E7I A;  3JAM Z;  5E1W A;  1LDK B;  3HKZ N;  5TRD A;  3MKY B;  2FA5 A;  1SFX A;  4OAZ A;  1KU2 A;  2NVY J;  1T98 A;  2ID6 A;  4C30 A;  3MZ8 A;  3D5S C;  2G7H A;  5HDK A;  5EG0 A;  5JLW A;  3GUD A;  2RQQ A;  4EEF G;  2GA1 A;  2HOA A;  1SD5 A;  3FMQ A;  3F8N A;  3HOU J;  3S16 J;  1MW7 A;  3GTM J;  3KCC A;  4IO9 F;  3CO6 C;  1OJL A;  2PMH A;  3BP8 A;  1N25 A;  4GDF A;  5K7Z A;  1ZEL A;  4H0E A;  5LFA A;  1FTT A;  2M7B A;  1FPQ A;  1SD4 A;  3CJR B;  5ILS A;  1MDM B;  3QOD A;  2LRE A;  1EH6 A;  3E1S A;  3BTL A;  1WWX A;  1VQ6 I;  1LFP A;  2K9N A;  3AL0 B;  2IGO A;  1ETW A;  2VB6 A;  1BBY A;  2NVX J;  1W36 C;  4L9V A;  3L2U A;  2VQG A;  4B8X A;  4KIB A;  4BBR J;  4XMY A;  2Z33 A;  3KEQ A;  3OIP A;  5D8L B;  4ZDO A;  3RKY A;  3BJ6 A;  2DT6 A;  4MTE A;  1D0Y A;  2VN2 A;  3ZQI A;  1UB9 A;  3CLO A;  3BC8 A;  4HF0 A;  4M9X A;  4W97 A;  1LPQ A;  1K7A A;  5FJ8 J;  3T8R A;  3CCM I;  4L9T A;  2XB5 A;  3BTI A;  2FBI A;  2X0L A;  4BJT A;  2QSH X;  3DP7 A;  4U0V A;  4GO1 A;  2VJI A;  2M3A A;  3M8F A;  4YII A;  5TIS C;  4CCL A;  2Y48 A;  3W2A A;  2H6C A;  2IS4 A;  3I59 B;  2IJL A;  2D5V A;  3GYH X;  3FHN A;  1Y39 A;  2KRC A;  3BZK A;  3BTC A;  3LQQ A;  2E5Z A;  4GYI A;  3HB9 A;  5EGO A;  4PJM A;  5E20 A;  2HWV A;  4KIG A;  3BZ6 A;  3S2W A;  4CGZ A;  4A6E A;  3K4L A;  4DJA A;  3GTG J;  3P9K A;  3HDD A;  1M1E B;  2DOD A;  1Z77 A;  4OAY A;  3O6B B;  1MBK A;  2VQC A;  3TO9 A;  1CGP A;  1W1W E;  2CV1 A;  2DA4 A;  3CDL A;  2VC1 A;  2GZW A;  1UEL B;  4KUM A;  3RPU D;  4AYB A;  2LG4 A;  4L5J A;  5IPA A;  3WTT C;  3O8G A;  2B9S A;  3JTH A;  4IL6 C;  4YIF A;  3LSR A;  3MKW B;  1BN5 A;  2XHK A;  2D45 A;  1F1Z A;  1Z6T A;  1BC8 C;  5E79 C;  2HU9 A;  1H89 C;  1TW3 A;  2BVL A;  4BS9 A;  1Z3Y A;  3DKW A;  3HRT A;  4EV0 A;  1ETX A;  1R6R A;  1LE8 B;  3I4M J;  4A0Z A;  5JHF A;  1V4R A;  2LK2 A;  4QPO A;  1TZL A;  2ECB A;  2HYJ A;  4DOZ A;  5LHG A;  5AIP A;  3WGI A;  3BTJ A;  1B72 B;  1SD6 A;  2HZD A;  1D1A A;  3TBI A;  1WJE A;  4F92 B;  1OCC H;  2M9H A;  1VFC A;  3R4K A;  5F6F A;  3VOD A;  1O4X A;  3SJM A;  4UV9 A;  2XPU A;  5A2Q K;  1XSD A;  2CQ7 A;  1XGN A;  2WWY A;  2B63 J;  2MW8 A;  1VQ4 I;  1YG2 A;  4LD5 A;  2LVS A;  2X85 A;  5FLX Z;  1UFM A;  2MH2 A;  1T33 A;  2KIS A;  1TWG J;  4HV6 A;  1OR7 C;  2YX7 A;  3T1B A;  2EIJ H;  3QYB A;  3A2K A;  2KIM A;  4UB8 C;  4Y17 A;  5AIQ A;  3NWT A;  1E17 A;  4CCM A;  3U9G A;  3U21 A;  1B1B A;  2E19 A;  2K40 A;  2K3F A;  3OR1 C;  5K7H A;  4BKX A;  2IT0 A;  3LAP A;  1MBE A;  4WF2 A;  3WGH A;  2W7N A;  4HOB A;  5CVV A;  3E97 A;  2RGV A;  4CA0 A;  3P7N A;  3WGG A;  2KIF A;  1D1C A;  5E3L A;  5JFR A;  3F22 A;  1XDU A;  1RR8 C;  1K61 A;  3FMS A;  5E1X A;  2NVQ J;  1APL C;  3OYH A;  5DM6 F;  2BXY A;  3N05 A;  4ETS A;  4XRF A;  2ZFU A;  5L3B A;  3CDI A;  4AD9 A;  3CUO A;  1VQN I;  4C9Y A;  3FHZ A;  4RAY A;  5EEA A;  1SMY F;  2NRA C;  4LK0 F;  4I99 C;  2JMW A;  3JR9 A;  3GTO J;  5E8I A;  1IN8 A;  2M87 A;  4M6V A;  5KCM A;  1SFO J;  3W6K B;  2BZT A;  1B59 A;  3S1Q J;  2VLA A;  3K2Z A;  2HOE A;  3EET A;  4XR6 A;  3VEP A;  1OKR A;  1RKT A;  3Q9S A;  4G6T B;  2E5N A;  2VC0 A;  1YX5 A;  2MD5 A;  4MO7 A;  1UHS A;  4JP0 A;  1JT6 A;  1R36 A;  1BM9 A;  3I58 A;  4HNV A;  4KT6 A;  3VB2 A;  2H8W A;  4KDP A;  3OYC A;  2KIQ A;  4HLY A;  3OYD A;  2Y9Y A;  1QZY A;  3G73 A;  4LGW A;  4XIC A;  4EM2 A;  4MNU A;  3MKL A;  3H5A A;  1K83 J;  1BR1 A;  1WJC A;  3KET A;  3BWG A;  4ENK A;  2KLO A;  2V6E A;  2E2H J;  2EFP A;  1U5T A;  3WU2 C;  1R1U A;  1OLT A;  2O9L A;  3H9Q A;  1A36 A;  1JKO C;  3IP4 B;  2DMP A;  1Z3X A;  3LWF A;  3F23 A;  4BEH B;  2LMD A;  1TP4 A;  2VBZ A;  3NRV A;  2XGC A;  3BOQ A;  1QPM A;  2QEX I;  1J7K A;  2I5U A;  2ZKZ A;  5KNL A;  1Z21 A;  2COM A;  2XAU A;  4MFE A;  3V8J A;  1ZRE A;  1OCZ H;  1I1S A;  3H35 A;  1T08 B;  2OC6 A;  3ZCO A;  2CGP A;  1HKT A;  3WTU C;  2QBY A;  3QOE A;  4XQF A;  2RAE A;  4XLC A;  5FFX A;  4RAZ A;  3OYK A;  1QRY A;  4C2M J;  2HVS A;  1WSU A;  2JA5 J;  5FRO A;  1T0F A;  2LP0 A;  4BE1 A;  5L3G A;  3LSH A;  1WPK A;  3MCZ A;  1P6R A;  3HPG A;  4BU2 A;  2CW8 A;  2FML A;  3KYD B;  1S6L A;  4A3D J;  2FRH A;  3K1N A;  3QWL A;  5CQG A;  1YFH A;  4BAC A;  2K85 A;  1GUU A;  2CFX A;  2ME0 A;  1LUJ B;  3IC7 A;  3ZQF A;  1WJD A;  1VQK I;  3GTK J;  4RGU A;  3OR2 C;  4EGY A;  2LOO A;  1YO5 C;  1QHH D;  3K69 A;  4BE0 A;  3ASN H;  3BG6 A;  4CHU A;  2WAE A;  2DFF A;  1L3L A;  4I98 B;  3CUQ A;  5KK1 A;  1I6X A;  4IQJ A;  1UST A;  1TWF J;  2OTJ I;  2VUM J;  4J01 A;  3D0S A;  4XOT A;  1D5Y A;  2Y2Z A;  4A5N A;  1HSJ A;  2F5C A;  3FK7 A;  3H0D A;  1T39 A;  1WZ2 A;  1YS7 A;  4U7D A;  2A61 A;  2ZNY A;  1ZGJ A;  1IXS B;  2CUF A;  1VQ7 I;  3OYN A;  2AHQ A;  2DYS H;  4BJ6 C;  3KFW X;  2O0Y A;  1NH3 A;  5DDG A;  1U8R A;  3I64 A;  2GWR A;  4RB2 C;  5J8F A;  1HST A;  1DP3 A;  2FF4 A;  2R7O A;  2KRF A;  5FFZ A;  4HAM A;  1VQO I;  1D8J A;  2EB7 A;  3IH2 A;  4PK4 A;  4A3G J;  2O6G E;  2QSF X;  3FXK A;  4OIP F;  2MG4 A;  1PJR A;  1ZLJ A;  2KFD A;  2DA1 A;  3CZ6 A;  4NQW B;  3PIO F;  3RJP A;  1XX5 A;  1MJ9 A;  4GFB A;  2ZJ2 A;  5F0H A;  4XRS A;  3D1N I;  1X2N A;  3G2B A;  2VE9 A;  2RDP A;  1MMS A;  3W2W A;  2HDW A;  1WHU A;  1G3Y A;  1I50 J;  2EA2 A;  4CZZ A;  5GAG J;  1Y1W J;  2PX9 A;  2HPI A;  2HVR A;  3HUG A;  3TW7 A;  3IAM 2;  2R7T A;  3QU6 A;  2N8G A;  4BE2 A;  3TDU C;  4ZYG A;  2DFI A;  2XAG A;  2EZK A;  1WQ2 A;  2CQX A;  3IWF A;  2DMU A;  1JHF A;  3G71 I;  4LLL A;  1SEU A;  1OIS A;  2HXO A;  3LFU A;  2ELK A;  2NVU B;  3L2W A;  1G59 A;  4LLN A;  1Q1H A;  2P6S A;  1AHD P;  3A03 A;  1BC7 C;  1YI2 I;  3HOV J;  2E1O A;  1EJ9 A;  2QZ8 A;  3S3N A;  3GZ6 A;  3S15 J;  2OUM A;  4P9U A;  2R7U A;  2EPF A;  1EH8 A;  3QOP A;  4DNC A;  1X19 A;  4JQF A;  4RM3 A;  5M3F J;  5LGN A;  2LR8 A;  3PQJ A;  2FD5 A;  5DCM B;  4RB3 C;  1SVO A;  3A4C A;  4BQO A;  2VBX A;  3FF5 A;  3RKX A;  4A6D A;  4DZJ A;  4EQQ A;  2WAQ A;  5LHH A;  1FYL A;  1A5J A;  3JRE A;  2PEX A;  3WG9 A;  1I3Q J;  3CP8 A;  3EQL F;  2ZSI B;  1XPX A;  3E7L A;  1MSF C;  2MFZ A;  4HG2 A;  5LLQ A;  1HDD C;  1BJZ A;  1HKS A;  1WI9 A;  5CVR A;  3RSN A;  3LA2 A;  5IYB J;  2R5Z B;  4RB0 A;  2Q2E B;  2VBW A;  3I55 I;  3L9F A;  1FP1 D;  3EDP A;  2R7V A;  2KDO A;  5FB2 A;  4L9J A;  3EUH C;  4HF2 A;  3GTQ J;  2PBI A;  2A69 F;  4AIH A;  1UHM A;  2HQ5 A;  4XNF A;  2E2J J;  2VOD A;  2XPV A;  3I53 A;  1OPC A;  2YUS A;  3JW4 A;  1YRN B;  3TGN A;  1YIJ I;  5ICC A;  3JRF A;  2PLY A;  1IN5 A;  2QYO A;  2DU9 A;  2QKL B;  2QWW A;  1S3J A;  2BW3 B;  5M5X J;  1SAU A;  1N78 A;  3ABK H;  1IN4 A;  3SEZ A;  1E3H A;  3F8F A;  1E3O C;  4EAT A;  3ZQH A;  3DBR B;  4ABZ A;  5LGT A;  1FBU A;  2COB A;  4AYB N;  5HNF A;  3CC2 I;  4ZTJ A;  3OL4 A;  2K9M A;  1XC5 A;  2XGX A;  3F8C A;  1JHH A;  2A05 A;  4HRI A;  3ECO A;  2BOL A;  1P4A A;  2KJB A;  2DMT A;  3LST A;  2DT5 A;  2AXT C;  3Q0W A;  5D6E A;  3WHC A;  2MD0 A;  2OTL I;  5FLM J;  1WRJ A;  3V7R A;  3RKW A;  1XTA A;  1FLI A;  2FQ4 A;  2IBD A;  1Z1D A;  4MTD A;  1IGN A;  1VQP I;  2CU7 A;  2QKM B;  3CCU I;  3DU6 A;  5EYR A;  2R7R A;  1R00 A;  4HPQ A;  4ANJ A;  2EK5 A;  4ZH4 F;  4XKC A;  4U0W A;  1T56 A;  5IP9 J;  3CCS I;  3HGG A;  4NUB A;  2EZL A;  4MEY F;  3GEZ A;  1HW5 A;  5CLS A;  4Y52 J;  2DOF A;  4PGG A;  3BR0 A;  4IOA F;  4XSX F;  1U8B A;  2EV5 A;  1EH7 A;  1MGT A;  1D8K A;  5J8C A;  4BDY A;  3DF8 A;  2V79 A;  1Z0X A;  3CLQ A;  2VAS A;  4UHT A;  3QU3 A;  5IT3 A;  2V26 A;  1J75 A;  5GTI C;  2LKP A;  2DA5 A;  3IHU A;  2HOS A;  4ZYE A;  3PNT A;  2OZ6 A;  3I0T A;  5F08 A;  1K4T A;  1G2H A;  3BCA A;  1TQM A;  4BJ5 C;  3UR3 C;  1MKM A;  4IKF A;  3IV5 A;  3LSK A;  1B8I B;  2DT7 B;  1FJL A;  1YQA A;  2X6O A;  3JAM K;  1IZ1 A;  1TTY A;  2DOA A;  3WE3 A;  2HPM A;  1EKE A;  2IP2 A;  3BR6 A;  4D7M A;  5GPC A;  1UAA A;  1R49 A;  1GHC A;  2JRM A;  4WCG A;  4I02 A;  4RGR A;  2FEZ A;  4UVB A;  4ZYA A;  3J7Z I;  3MZY A;  1TBX A;  1U0J A;  4I6Z A;  1S5L C;  4A0X A;  5FKO A;  2L01 A;  3OMY A;  1T38 A;  1J9I A;  1W5T A;  3VWB A;  4ENJ A;  3P9C A;  2L7M P;  3WG7 H;  2DQR A;  3AAF A;  2UUZ A;  1DU0 A;  3WE2 A;  4HV5 A;  1LB2 A;  2AS5 F;  4LIV A;  3GME A;  3L09 A;  3ZR8 X;  1XMA A;  1DUX C;  3BG5 A;  3HC7 A;  1ORK A;  1BOB A;  3TO7 A;  1IAW A;  5F04 A;  1XGS A;  2Z2S B;  2HYF A;  1X3Z B;  1E0E A;  2M0C A;  3IH4 A;  4A3L J;  1MZB A;  2R7D A;  3IAS 2;  1RPW A;  2EJR A;  3HIF A;  3RKQ A;  4AVZ A;  4E7K A;  2UV1 A;  4DZP A;  1MH4 A;  4GCV A;  2HOT A;  1JUP A;  2GXB A;  1KYW A;  1P92 A;  2O03 A;  2DMN A;  1LKX A;  2OCE A;  2MGQ A;  3BQZ A;  3HTU A;  4UUV A;  1ETV A;  3K70 D;  3OYL A;  4X6A J;  3BG7 A;  4M3D A;  3LL7 A;  5GAE J;  2VBY A;  4G6Q A;  5FKK A;  2CH0 A;  3J80 K;  4E7J A;  2F5D A;  2XB0 X;  2YU3 A;  1BL0 A;  2R7F A;  1QHG A;  3TOB A;  1FT9 A;  2XC7 A;  1GT0 C;  3FZV A;  2DDB A;  2QQA A;  2H09 A;  3DPU A;  5J1R A;  2DPU A;  5JLX A;  4BGD A;  2Z9O A;  2IW5 A;  3VYS B;  2GIZ A;  4DYQ A;  4ESJ A;  1QNT A;  4EJT A;  4NHJ A;  4XLE A;  1KQ8 A;  2M8E A;  2FMY A;  3KP7 A;  2XAQ A;  2WB1 A;  4M3F A;  3H5R A;  3HOY J;  1ZN2 A;  1X4P A;  3OYB A;  1W7P B;  3LOC A;  3M8E A;  2LTP A;  2KKO A;  4OIR F;  4D7N A;  1MNM C;  4NNJ A;  4IHW A;  2FNP A;  4BHC A;  2OA4 A;  3TMO A;  4E7L A;  1DP7 P;  2KIU A;  2K5C A;  3E6M A;  3IUO A;  3ZP5 A;  4AC0 A;  5F0C A;  1ZQ3 P;  2F48 A;  4PGH A;  1R1T A;  5K1Y A;  3K4B A;  2JA8 J;  5BQT A;  5C44 J;  5HS8 A;  2IAI A;  2LY1 A;  4XON A;  2DTZ A;  2RKH A;  3C3W A;  3COA C;  1XB4 A;  4Q5S F;  1O3R A;  3FX3 A;  2XSD C;  1RES A;  2LY9 A;  1X1D A;  4U87 A;  4KN7 X;  3E6D A;  2ACJ A;  4EM1 A;  1JJ6 C;  1ON2 A;  2ZME B;  3CC7 I;  2KPM A;  1O57 A;  1Y56 A;  1PUF B;  4RB1 A;  1FSH A;  2HKO A;  3HOW J;  3GCM A;  2K02 A;  4XK4 A;  1SAX A;  3MKZ A;  1MBJ A;  2EQR A;  3FKJ A;  3FXR A;  4PJ0 C;  3HG9 A;  2WV1 A;  2W25 A;  5LEJ A;  3LSJ A;  1PVE A;  2LBF A;  5TGT A;  1JT0 A;  1JTX A;  4DYC A;  4E4H A;  2HDC A;  3V8L A;  5E8G A;  2M34 A;  3H3Z A;  4A5M A;  3REO A;  1R5I D;  1S7O A;  1E3P A;  3RYR A;  4Q48 A;  3E0J B;  2WA0 A;  2DA7 A;  1WGX A;  2VJJ A;  1HQC A;  4BY7 J;  4D5C A;  4ZDP A;  4YEL A;  3DBL B;  2VKV A;  1PDN C;  4XLN F;  1NK2 P;  3OIO A;  2PMZ N;  2DA2 A;  3IRR A;  4JX5 A;  2BHY A;  3WTV C;  5M5Y J;  4DQ2 A;  1BA5 A;  1YX3 A;  3KYL A;  2QSG X;  2M0M A;  1WVR A;  1H8A C;  1HDP A;  4II2 A;  2RNJ A;  3OOP A;  2EFQ A;  4F91 B;  3AG1 H;  3CCE I;  2A5Y B;  3H92 A;  1AU7 A;  2JA7 J;  4XKV A;  2O61 A;  2VIX A;  4YIR X;  5E3O A;  3JSO A;  1BI3 A;  5EF6 A;  3GFI A;  1PP7 U;  3CJN A;  2FOW A;  4I09 A;  1YJW I;  4ZYD A;  1UMQ A;  4DBQ A;  2GOX B;  2P5V A;  3PNV A;  4HBL A;  1FP2 A;  4R79 A;  2JK3 A;  5EEG A;  2EIN H;  2EFW A;  3ASO H;  2KT0 A;  2NOJ B;  1F5T A;  3HJE A;  2R7Z J;  1B4A A;  5J6X A;  3HRU A;  3FBI B;  1FTZ A;  5BS6 A;  5H20 A;  4KIC A;  3RZD J;  1WJA A;  3HRS A;  2ELJ A;  2H6B A;  4ZJZ A;  2CV0 A;  2X48 A;  1ZHF A;  4HNT A;  2E2I J;  1ZG3 A;  2XRO A;  1XDS A;  3BDD A;  2G0E A;  4EJW A;  1S7E A;  1RC9 A;  4PSW A;  4ZDL A;  1O3Q A;  2BHZ A;  1ON1 A;  2EZH A;  3DTE A;  3HSR A;  4IHT A;  2HGC A;  2R4G A;  2O7O A;  1MDM A;  1GVD A;  2CQK A;  5E3M A;  1YHQ I;  1IF1 A;  4Y7N J;  4AM3 A;  3C18 A;  3DPL C;  3FXQ A;  1OMI A;  2F6C A;  3RQ4 A;  4RGS A;  5DV5 A;  4RA2 A;  2LH9 A;  1R4N B;  5ILV A;  1TWH J;  1HF0 A;  1QQI A;  1V3F A;  2YS9 A;  3R0J A;  3S1M J;  3T5X A;  1SVM A;  3SYT A;  1FYM A;  4OMY A;  2FX0 A;  3S32 A;  5HLG A;  1XN7 A;  2M45 A;  2Z5U A;  1VI0 A;  2GLO A;  5D4R A;  3MMY B;  4B44 A;  2YU9 J;  1R5G A;  2R7S A;  1RUN A;  4M9Z A;  1LEB A;  2L2O A;  4HX8 A;  1FY7 A;  1P7J A;  1IW7 F;  4N4N B;  1FOK A;  3HSF A;  3JRI A;  1YTY A;  4N9H A;  2X9D A;  3N4M A;  2EV0 A;  2VOP A;  4M71 A;  3U1K A;  3PSF A;  2MYS A;  2ECC A;  4FX4 A;  2IVM A;  5IP7 J;  4LIU A;  4LMY A;  1AA7 A;  2NS0 A;  3J7A Y;  2BE5 F;  2L02 A;  1X3W B;  5CPR B;  2IA1 A;  3HOX J;  3KP2 A;  3F6V A;  1GXP A;  2P5K A;  2LKS A;  5IT9 Z;  1ZGA A;  4RM2 A;  3JTG A;  4Q47 A;  5LRR A;  3ZQG A;  4Y33 A;  4G7H F;  3VDX A;  4CIC A;  1DQU A;  2NOG A;  3D5L A;  3PFI A;  2Y30 A;  5GTH C;  2VE8 A;  3M8J A;  1VQ9 I;  3CCQ I;  1FWZ A;  3KZY A;  3SFZ A;  3LFK A;  2BV6 A;  4YFX F;  1MNE A;  1X1P A;  2DDA A;  1IO2 A;  4KFC A;  5F1J A;  4IRH A;  2W84 A;  3K70 C;  3OV8 A;  2ZME C;  4AU7 A;  3WOD F;  3CES A;  1JJ8 C;  3HRM A;  1REP C;  1G3W A;  4A2U A;  3W3C A;  3M3Y J;  2M8G X;  3H0G J;  1YJN I;  2D1V A;  4G7O F;  3CUQ B;  4C3J J;  1MBF A;  2JRT A;  4BYY A;  1T2K A;  5BMZ A;  2CG4 A;  3AFH A;  1WCM J;  1POG A;  2JPC A;  2V9V A;  1LE8 A;  3ONQ A;  2CSO A;  4ITV A;  4XRS G;  1RI7 A;  3ZQ7 A;  3SDB A;  1BI0 A;  2HQN A;  1ZRF A;  4M74 A;  1CF7 A;  3K4J A;  5DD8 A;  3CC4 I;  3TP0 A;  1QGP A;  2BY3 A;  3SZT A;  3J81 Z;  3L1P A;  1B72 A;  2M30 A;  2R5Y A;  1BR2 A;  2X1D A;  4KT5 C;  2X6Y A;  1FOX A;  2RQP A;  3H1C A;  2ZSH B;  2LKX A;  2P7V B;  4B4C A;  5EDN A;  3RTR A;  3H3U A;  3KP4 A;  1KZH A;  2MBF A;  1TWA J;  3ZN0 A;  1KU3 A;  3MVP A;  4QPQ A;  4B43 A;  1MND A;  5IYC J;  2VPL A;  1MBH A;  2Y9Z A;  2UXN A;  5ICF A;  2ZO4 A;  3S3M A;  4FHT A;  1K6O A;  3FIS A;  1V5E A;  2Z99 A;  4PSX A;  3KLO A;  3V8K A;  4FX0 A;  3CTA A;  4FIS A;  2FU4 A;  2QQ9 A;  5HDG A;  1P4W A;  1BR4 A;  1IN7 A;  3FWE A;  4UUS B;  3CDH A;  4NB5 A;  3HKZ A;  2LLK A;  2W24 A;  3HUG B;  2NNN A;  2WTE A;  2XAF A;  2RV8 A;  4OIQ F;  1A6Q A;  2H94 A;  3KZZ A;  1BOA A;  4IHX A;  4EVI A;  4QSH A;  5ED4 A;  2HVQ A;  5F1R A;  3D5R C;  3IKV A;  3PUB A;  2RNG A;  4HEA 2;  5HS7 A;  2WY7 Q;  2HDD A;  3V42 A;  1YJ9 I;  4KMF A;  1W5S A;  2DAO A;  2DW4 A;  4FTH A;  3HZJ A;  3GTJ J;  1Z67 A;  1DDN A;  5KAF C;  3IKT A;  4O3M A;  1X4O A;  3KYC B;  1Y0U A;  1WJB A;  3WTS C;  2KHM A;  1K79 A;  2V9K A;  4V19 K;  1OCO H;  1OYY A;  4PJN A;  2DJI A;  1AWC A;  5H6Q A;  3IRQ A;  2JA2 A;  3ZMD A;  1IRF A;  2VOO A;  3ZQL A;  5K7F A;  3P5J A;  1ZLK A;  3K7A J;  1RET A;  4JX6 A;  3RQI A;  1MMG A;  2ISY A;  3ZMU A;  2TDX A;  2DN0 A;  3KP3 A;  4K2E A;  4RAF A;  2VXZ A;  1RUO A;  1HOM A;  4G9Y A;  1VQL I;  2K4J A;  3C7J A;  3Q3S A;  1FEX A;  2EIM H;  1R22 A;  1MJB A;  3KLN A;  3JRD A;  4C2U A;  2Z16 A;  3LMM A;  3O8H A;  3DFG A;  3OL3 A;  4PFO A;  3MFK A;  1DPU A;  1U5T C;  3FM5 A;  3FBN B;  1MMA A;  2BYV E;  2HNH A;  3GXO A;  1J5Y A;  2LF8 A;  3K4N A;  1U3E M;  1AKH A;  3GWZ A;  2L54 A;  5BOX A;  2DBB A;  3OS1 A;  2WY8 Q;  3FXL A;  3GZ5 A;  2E1M B;  2F5F A;  2MH9 A;  3QPH A;  3PJR A;  1B9N A;  1ULY A;  1G3T A;  1LJ9 A;  2W82 A;  1FC3 A;  2PQ8 A;  3S8P A;  2L9S A;  4LLG F;  4CUG A;  4BEH A;  2WBM A;  2HTJ A;  1UG2 A;  3L2V A;  3BPX A;  5GPA A;  3OYA A;  2QVO A;  2AXL A;  2ID3 A;  3O2P E;  2DCE A;  2JWT A;  3V7C A;  2PJR B;  3OOU A;  2FBH A;  4AUX A;  1YW8 A;  2W57 A;  1MMD A;  4A69 C;  3GX4 X;  2ZJR F;  2ME6 A;  2EIK H;  4LB6 B;  3ZRG A;  4BQQ A;  5BPD A;  2BEO A;  5FGM A;  2KZV A;  2IS2 A;  3ABL H;  3DEW A;  1T0F C;  3M07 A;  1S9H A;  1OFC X;  4O6J A;  2ZB9 A;  3QYF A;  1V5F A;  3ROU A;  1WH7 A;  3DU5 A;  3LA3 A;  5GAD J;  4A3B J;  2MLK A;  2STT A;  1IC8 A;  3EPZ A;  1FOY A;  3BRO A;  4I01 A;  1H88 C;  4FQG A;  3VYT B;  3ZMV A;  3CF5 F;  1QBJ A;  4UY8 I;  2EFN A;  4I76 A;  3GLX A;  3PO3 J;  4ASN A;  1X58 A;  3CP2 A;  4RLF A;  2L5Q A;  5LGU A;  2DA6 A;  3TL4 X;  2MA3 A;  1V55 H;  1JKP C;  3W2V A;  4KIT B;  2ZXH A;  3CUQ C;  4BBS J;  1WKM A;  4N4O B;  3PL8 A;  1IRG A;  4TV7 A;  3ERM A;  1KYZ A;  2DOE A;  3B73 A;  1MIJ A;  1IG7 A;  3J7A O;  1NG6 A;  1Z6R A;  3VYU B;  4LB5 A;  3QQA A;  3MEX A;  2GXA A;  2J5O A;  3QYE A;  3DLA A;  3I4P A;  5CVU A;  2EZI A;  3MQ0 A;  1K78 B;  4LG0 B;  3CCY A;  3FXU A;  5E1Z B;  4AIJ A;  1IDZ A;  1U78 A;  3KZI C;  3A01 A;  3CCL I;  3BR2 A;  4IOC F;  2HQR A;  1R58 A;  1VTN C;  3A0B C;  3FKI J;  2J5P A;  3AKZ A;  1JGG A;  1F36 A;  4QWQ A;  4YFK F;  4E7H A;  3VOE A;  5HNH A;  3C2H A;  2DFH A;  1O3T A;  1QA6 A;  1GV2 A;  5HS9 A;  2W85 A;  4A3K J;  4BXU A;  3FM3 A;  3G1O A;  3SHF A;  4JBA A;  4KJZ A;  1KU7 A;  2W1O A;  1USS A;  4NBQ A;  5EZH A;  2JQ7 A;  4HNU A;  3RZO J;  1XMK A;  3KP5 A;  1JKR C;  4Z2Y A;  1HC8 A;  2NS7 A;  4BHB A;  2R7Q A;  4CYC A;  3JRG A;  3MZH A;  2JN6 A;  3KIO A;  3TP3 A;  5FO5 A;  1WJ5 A;  4XOR A;  2RVC A;  2DK8 A;  1F4K A;  2X1C A;  3BZC A;  4RAG A;  4NQW A;  5GAH J;  2RC4 A;  3W6V A;  3T8T A;  4LOC A;  1BJA A;  2P8T A;  3GZN B;  2OAZ A;  1XMX A;  2GQQ A;  2M2E A;  2GBY A;  4PUS A;  2IXS A;  1MJA A;  1BW6 A;  5FKL A;  1FX7 A;  3HHH A;  4KMU X;  4C2T A;  1OQY A;  1PYV A;  5AON A;  2V1U A;  4G12 A;  2KRH A;  4RBO A;  4EM0 B;  4IPA A;  4IEJ A;  3HL2 A;  4XN0 A;  2OZU A;  1TNT A;  3GLL A;  4LG3 A;  4OOI A;  1OYI A;  3G1L A;  3A1Y A;  2VPR A;  2KJC A;  2AQF A;  1PP8 F;  1YLF A;  1RRJ A;  3I9V 2;  3WTY C;  5K5Q A;  4G8X A;  4Y13 A;  3BG9 A;  4M3E A;  3BPV A;  1FYK A;  4RS8 A;  1JKQ C;  1D0Z A;  4Y15 A;  1FBS A;  3NAU A;  3GTP J;  2ZXI A;  5B5E C;  3QRF F;  4RMN A;  4OMZ A;  2IGK A;  1Y0N A;  3VPR A;  4M6Y A;  4BL0 B;  4U7B A;  2ZFW A;  2MLG A;  3A02 A;  4GRI A;  3SFI A;  2Q2E A;  3JCU C;  2R5Z A;  1ACI A;  1FIP A;  3WU1 B;  2E1M C;  2DXI A;  1GVJ A;  5EG0 B;  3PIP F;  1ETQ A;  1I3A A;  1ZAO A;  4FET A;  2HTS A;  1SAN A;  2UXX A;  2JT1 A;  4C3H J;  1J59 A;  2EFO A;  1YRN A;  2ZJQ F;  4A0Y A;  2EWN A;  2B7E A;  5J47 A;  4O5V A;  2X1E A;  2D2W A;  4WK8 F;  3ISP A;  3HYI A;  4YG2 F;  1JE8 A;  5L3D A;  1P7I A;  1Y6I A;  2E71 A;  2OCC H;  3R0A A;  3CCJ I;  2ZNZ A;  2BVM A;  4S05 A;  2M5W A;  3H3V K;  2XKO A;  2Y0S A;  4LJZ F;  1K6Y A;  1YS6 A;  4E7Z A;  2CS3 A;  1JXS A;  1ZRC A;  3DEU A;  2GAU A;  3RDI A;  1DPR A;  3I71 A;  1IXC A;  2F5E A;  2PFB A;  2YPR A;  3OYF A;  1H9T A;  4N0B A;  3VYR B;  4E70 A;  5LD2 C;  3GF2 A;  5EZG A;  4IHV A;  3PFY A;  4V2F A;  5M3M J;  1YIO A;  4DGW B;  4G7Z F;  2JPB A;  2CW7 A;  4D5F A;  3TED A;  2L9V A;  1TNS A;  5DD4 A;  3EYY A;  2D1H A;  3FIW A;  4QTR A;  4ZTF A;  1D0X A;  3FXO A;  2VKD A;  4HYE A;  4R1H A;  5GP9 A;  1ITY A;  3DQV C;  2K86 A;  4IQ4 A;  3F9K A;  2XIG A;  1G3S A;  3B6C A;  3GFM A;  3KX2 A;  2IGM A;  3J7Y J;  2DK5 A;  1DGW Y;  2DMQ A;  5D5X B;  2H8R A;  1LDD A;  2HYG D;  2OF7 A;  2YR2 A;  4XN3 A;  3T0Y A;  4EGZ A;  3MAJ A;  1OCR H;  1JTY A;  4EJU A;  4M9S A;  2FBK A;  4M73 A;  1D1B A;  3UKG A;  2JVG A;  3Q9V A;  4V2G A;  3IWZ A;  5TJJ A;  1HA8 A;  3CO7 C;  1D5V A;  1ZR4 A;  3DKX A;  2DQL A;  1N77 A;  1IV6 A;  5EGO B;  1SD7 A;  2VJ5 A;  2R92 J;  2ZCW A;  3OSG A;  1TLH B;  2JVH A;  2K3P A;  2A68 F;  3K0L A;  2CMP A;  3ZOB A;  5J3L A;  4XSZ F;  4KIF A;  5E18 F;  5CVJ A;  1JI8 A;  2X51 A;  3L2C A;  2CRG A;  3PM1 A;  1U9O A;  4J00 A;  2V1N A;  2JTV A;  2NAZ A;  1B8I A;  2B0L A;  1XG1 A;  4M3B A;  1XD7 A;  1KON A;  5D6F A;  4F7Z A;  1LVK A;  2O8K A;  5IOY A;  1R71 A;  4HX4 A;  1IV8 A;  3BJO A;  2VT2 A;  2L9R A;  4P5O A;  3F0C A;  2FE3 A;  2JUG A;  2STW A;  4PZJ A;  5DUK A;  3X2Q H;  1FMW A;  2FXA A;  3UNG C;  1Z9C A;  4BXX J;  2DPD A;  3A0H C;  1GV5 A;  3S93 A;  3GTL J;  4MGR A;  2LDU A;  4IXA A;  1XGO A;  4XLF A;  2TRT A;  2CFO A;  4S0H B;  3KE2 A;  4Q4Z F;  3CCR I;  3ABT A;  3E5X A;  4DYR A;  4LIT A;  2CUE A;  4NC8 A;  4UVC A;  2X6W A;  1AOY A;  3ZQC A;  4HDU A;  5J4Y A;  4MHG A;  4KYW A;  3BCB A;  3O3K A;  4RGX A;  4BY1 J;  2E34 A;  2KDZ A;  5ERI A;  5FKN A;  2ZJP F;  1RKW A;  3GFL A;  2O8X A;  3ZXS A;  1VQM I;  1IRX A;  1YOV B;  2XRL A;  1YE9 A;  5CYV A;  2NVT J;  2MSY A;  5FLX K;  1IUY A;  3K4M A;  3ZPL A;  3OYJ A;  2XKP A;  5C4J J;  3L2Q A;  3OYE A;  2LF7 A;  1Z7L A;  2LC2 A;  4CO8 A;  1S72 I;  4XLP F;  3F3X A;  1VQ8 I;  3DCF A;  4AVP A;  1W0U A;  5JVG F;  2DJN A;  4CH7 A;  2IA2 A;  1OR7 A;  2DI3 A;  2H1L A;  2HR3 A;  2HI3 A;  3K4K A;  3J80 Z;  3HPH A;  4JYK A;  3JSP A;  4F3Q A;  2F2E A;  1FMV A;  1VND A;  5F64 A;  3LAJ A;  2LRD A;  3OIQ A;  3S1N J;  1ENH A;  1RR7 A;  2E1C A;  1FIA A;  2NYX A;  5CJ9 A;  2L0K A;  4XL9 A;  4L5I A;  2CO5 A;  4L5E A;  4HQM A;  3PSI A;  4YRV A;  5IOZ A;  2BBY A;  3EUA A;  3ZMZ A;  1JUS A;  4A3C J;  1TW2 A;  4PDK A;  4X0G A;  1BIB A;  2JJ7 A;  1ZTR A;  4Z6Y A;  2XPW A;  2A6T A;  3BJA A;  2VXD A;  3K4C A;  2OPT A;  3DV8 A;  1W7P A;  3GVA A;  1LFU P;  1PUE E;  4OIO F;  5IT9 K;  4UVA A;  1J2X A;  3QAH A;  3G6E I;  2RRE A;  2QF7 A;  2E1N A;  1T8I A;  1G4D A;  2Z3Y A;  1R23 A;  4AIK A;  3LQR A;  2H27 A;  3DTK A;  3NAR A;  1A6I A;  1GLN A;  4I0A A;  5B1B H;  2HEO A;  2Q1Z B;  4A3E J;  1BI1 A;  2A6H F;  1U6G A;  2FJ1 A;  2R0Q C;  5HLT A;  2QQB A;  3K9T A;  2LSO A;  1UJ8 A;  4MLO A;  2L3D A;  3FDY A;  4R8H A;  2K7L A;  5DM7 F;  4E7S A;  2M4G A;  1STZ A;  1R9T J;  1RZ4 A;  4Y4R A;  2L4A A;  2KP6 A;  2L7Z A;  2IPQ X;  2WAQ N;  3NWS A;  2XDV A;  2F4M B;  1LEA A;  1EF4 A;  3HOZ J;  4BNC A;  2ZME A;  2XGD A;  2JSC A;  4KA4 A;  3DWL E;  1PUF A;  5CQE A;  3CF2 A;  1S7A A;  1X3U A;  2ELH A;  2EA4 A;  4D9J A;  1CF7 B;  1FNN A;  3TOA A;  5CKT A;  2FOK A;  5F0F A;  2CW0 F;  3DXJ F;  1U5T B;  4BAY A;  3JRH A;  2HQA A;  3JRC A;  3BG3 A;  3L7W A;  4UB6 C;  4ENM A;  2R5Y B;  3J81 K;  4B1R A;  2VKE A;  4IZZ A;  1S8N A;  2KL4 A;  4DW6 A;  4WWC A;  1GDT A;  3VSK A;  1TQI A;  4XKW A;  4IX7 A;  4GXO A;  1TC3 C;  1WH5 A;  2CQQ A;  4GGG A;  4PFP A;  4ESF A;  3CME I;  4L18 B;  5D8K B;  5KHD A;  3WTX C;  1B6A A;  2R93 J;  5L3C A;  5D5W B;  1ETO A;  2JA6 J;  2VQL A;  4EJO A;  1P2F A;  2OJE D;  2QBY B;  2R3S A;  2L7K A;  4P55 A;  4CCK A;  2Y31 A;  3HHG A;  3I59 A;  3PO2 J;  3FK6 A;  5FD5 A;  3OWT A;  3ZMT A;  1P4X A;  4XOP A;  3ZN1 A;  1LNW A;  3OYM A;  1QPI A;  2A5W A;  1SFE A;  2HXI A;  2CWE A;  4D0P A;  4BQA A;  3ABM H;  1DGR M;  1NK3 P;  5JR3 A;  4IF4 A;  3F8B A;  3V7S A;  2K4B A;  4CCO A;  1K4S A;  2DO7 A;  1HW2 A;  4B47 A;  4II3 A;  3M4O J;  2L9N A;  1ZH5 A;  1UG0 A;  1F43 A;  1QZZ A;  2XAS A;  1HW1 A;  3SQN A;  2Q8K A;  6PAX A;  1T95 A;  1XSV A;  2JZY A;  4GYG A;  3TW6 A;  4E6K G;  2P5L C;  2JSP A;  1ETK A;  4JX4 A;  2L7F P;  3MD2 A;  4HLX A;  1NTC A;  3B6A A;  2MC4 A;  3LSG A;  3QPL A;  3I4N J;  1KA8 A;  4UV8 A;  3EYI A;  1N75 A;  1Y8Q B;  5J1Y A;  1F9N A;  3HM5 A;  1Z7U A;  2V7F A;  3KPH A;  3SDG A;  4XID A;  2ISZ A;  2QGU A;  2CV2 A;  4EJV A;  1XCV A;  3LA7 A;  1CQT A;  4L9N A;  5J40 A;  1NHA A;  1HCR A;  1VZ0 A;  2DTR A;  2A3S A;  1ETY A;  3AL0 C;  5DS9 A;  2QA4 I;  1ZKG A;  2TCT A;  5A2Q Z;  1I1G A;  1ZG1 A;  2E36 A;  2EV6 A;  4Y3O A;  1U2W A;  3TDZ C;  3RYP A;  1AKH B;  4NC7 A; 
#chains in the Genus database with same CATH homology
 2IA0 A;  4ENN A;  2YSR A;  3PQK A;  5LEK A;  4G94 A;  4B09 A;  2UZK A;  1FZP B;  1ZRD A;  3SXY A;  1OYW A;  3E5U A;  1R1V A;  4ZZD A;  5D4S A;  4PCQ A;  3F6O A;  5DYM A;  3P9I A;  3RPU A;  4WXH A;  2E7X A;  4QLC U;  1XCB A;  5K5O A;  3WTW C;  4HQE A;  4MEX F;  1J0R A;  5ICG A;  2QM3 A;  3V4G A;  3Q5F A;  1BI2 A;  4I7H A;  4IRI A;  2WC2 A;  2OQG A;  3BY6 A;  3MWM A;  4S04 A;  5D5V B;  4HDV A;  1TQP A;  3GFJ A;  1HXD A;  4G6D A;  1YW7 A;  4ESB A;  1UCR A;  3SZP A;  2HKX A;  2V1D A;  1UHW A;  2ETH A;  4IHS A;  3E3V A;  1C0W A;  3NQO A;  4FT8 A;  1EV7 A;  5JI6 A;  4CXF A;  3HSE A;  1B9M A;  2XRN A;  4CDG A;  4ZYH A;  2OQR A;  1ODD A;  1MD0 A;  4HZF A;  1YYV A;  3FMR A;  3E6B A;  4UXN A;  3GO5 A;  3EUH A;  1T6S A;  1BIA A;  2QLZ A;  5DCF A;  3N97 A;  3ECH A;  2V6C A;  2UWM A;  1GXQ A;  2G9W A;  3E6C C;  3GW2 A;  2PJP A;  5L3E A;  3NEU A;  2ESH A;  2ZXJ A;  4YFN F;  3F8M A;  3R60 A;  1SFU A;  3B02 A;  2HFH A;  1KQ0 A;  4HA8 A;  5DUI A;  1FSE A;  2XAJ A;  1LVA A;  2O3F A;  1Z91 A;  1JGS A;  4HX7 A;  4JK1 X;  1RIO H;  3RPQ A;  2OU2 A;  1G6N A;  3I5U A;  4IVN A;  4EMS A;  4IRG A;  1KQ9 A;  1IN6 A;  1Z05 A;  2FSW A;  4AWX B;  1XSX A;  3RI4 A;  1ONV A;  1O3S A;  2P6T A;  2BGC A;  2G7U A;  4ON0 A;  2RN7 A;  2ESN A;  2GIV A;  1FBQ A;  4U0Y A;  4BHP A;  1O7F A;  5BPI A;  2PN6 A;  5HOO A;  4IJA A;  5LBQ A;  1ZG5 A;  3RIR A;  3IL2 A;  2WV0 A;  2Q0O A;  5JVT A;  3HTS B;  3R6S A;  1HKQ A;  5LRS A;  1R7J A;  5DEQ A;  4WXD A;  5HDN A;  5EEH A;  3HOT A;  2VON A;  4L0Y B;  1I27 A;  2LNB A;  4I0B A;  2XUB A;  2OD5 A;  1QO0 D;  5HLH A;  3R61 A;  4M72 A;  5K5R A;  5LHI A;  1R5H A;  2E7W A;  4MQV A;  1IXR C;  5HLI A;  3M9A A;  3ULQ B;  2CYY A;  4HF1 A;  5FD6 A;  2NNY A;  1H9G A;  1XGM A;  4UNO A;  2IRF G;  3TO6 A;  4HW0 A;  4OIN F;  2OBP A;  3KP6 A;  4N9I A;  2PI0 A;  4LK1 F;  3VFZ A;  2C6Y A;  1SMT A;  3QP5 A;  2X4H A;  3WTZ A;  3F21 A;  5HVQ C;  3E5Q A;  2YX4 A;  5DCM A;  2XAH A;  5L3F A;  1RNL A;  4U88 A;  2DLL A;  3ZMS A;  3K1P A;  2L4M A;  3KEO A;  4P9F A;  3C1D A;  2FNA A;  5KVR A;  1D3Y A;  2P7C B;  3ELK A;  1ZYR F;  1ZAR A;  3ML6 A;  2QEN A;  4WX9 A;  2HZT A;  3U2R A;  1LDJ A;  1L0O C;  2MC3 A;  3DPT A;  4LG0 A;  3HOS A;  1K78 A;  4BH9 A;  2K27 A;  3U1D A;  3W6J B;  5ILU A;  4A12 A;  5D5U B;  4MQ9 F;  3F72 A;  2GA2 A;  5E17 F;  5JHU A;  1HBX G;  1KU9 A;  2Y75 A;  3L00 A;  4KNY A;  1I5Z A;  1S29 A;  2P4W A;  1LQ1 A;  4M6X A;  3M1E A;  4L0Z B;  1W7P D;  3G3Z A;  2VT3 A;  2PG4 A;  4P96 A;  3ERE D;  3I54 A;  4I2O A;  4WXC A;  2FQ3 A;  3TKY A;  1A04 A;  3TQN A;  2GXG A;  2PMU A;  2Y0M A;  2A07 F;  2HS5 A;  5ICE A;  1H0M A;  5H6R A;  3QP6 A;  4OU0 A;  3WU0 A;  1KGS A;  4KN4 X;  2ZBK A;  2M1B A;  2ADU A;  1W4M A;  2XVC A;  4ZZL A;  2A6E F;  3QPT A;  1YW9 A;  3K1M A;  4LFU A;  2V1X A;  4XBF A;  3ABU A;  1E2X A;  1O7L A;  4CYD A;  5CVI A;  3M7G A;  2QUF A;  2XV4 S;  3JAM Z;  5E1W A;  1LDK B;  5TRD A;  2FA5 A;  1SFX A;  1KU2 A;  1T98 A;  2G7H A;  5HDK A;  3GUD A;  2GA1 A;  1SD5 A;  3FMQ A;  3F8N A;  3KCC A;  3CO6 C;  2PMH A;  3BP8 A;  4H0E A;  1FPQ A;  1SD4 A;  5ILS A;  1MDM B;  1EH6 A;  1WWX A;  1BBY A;  4L9V A;  4B8X A;  4KIB A;  2Z33 A;  3KEQ A;  5D8L B;  3RKY A;  3BJ6 A;  4MTE A;  2VN2 A;  1UB9 A;  3CLO A;  4HF0 A;  4M9X A;  1K7A A;  3T8R A;  4L9T A;  2FBI A;  2X0L A;  3DP7 A;  4U0V A;  4GO1 A;  3M8F A;  4YII A;  2Y48 A;  2H6C A;  3I59 B;  2IJL A;  3GYH X;  3LQQ A;  4GYI A;  5E20 A;  2HWV A;  4KIG A;  3BZ6 A;  3S2W A;  4CGZ A;  4A6E A;  3P9K A;  3O6B B;  3TO9 A;  1CGP A;  2VC1 A;  2GZW A;  4KUM A;  3WTT C;  4L5J A;  3JTH A;  4YIF A;  1BN5 A;  2XHK A;  2D45 A;  1F1Z A;  1Z6T A;  1BC8 C;  1TW3 A;  3DKW A;  3HRT A;  4EV0 A;  4A0Z A;  1V4R A;  5LHG A;  5AIP A;  3WGI A;  1SD6 A;  3R4K A;  5F6F A;  3VOD A;  4UV9 A;  5A2Q K;  1XSD A;  1XGN A;  2WWY A;  1YG2 A;  4LD5 A;  5FLX Z;  1UFM A;  2MH2 A;  4HV6 A;  2YX7 A;  3T1B A;  2KIM A;  4Y17 A;  5AIQ A;  1E17 A;  3U9G A;  1B1B A;  2IT0 A;  3LAP A;  4WF2 A;  3WGH A;  4HOB A;  5CVV A;  3E97 A;  2RGV A;  3P7N A;  3WGG A;  2KIF A;  5JFR A;  3F22 A;  1XDU A;  3FMS A;  5E1X A;  4ETS A;  4XRF A;  5L3B A;  4AD9 A;  3CUO A;  3FHZ A;  4RAY A;  1SMY F;  2NRA C;  4LK0 F;  5E8I A;  1IN8 A;  2M87 A;  3W6K B;  1B59 A;  3K2Z A;  2HOE A;  3EET A;  3VEP A;  1OKR A;  3Q9S A;  2VC0 A;  2MD5 A;  1R36 A;  1BM9 A;  3I58 A;  3VB2 A;  4KDP A;  4HLY A;  1QZY A;  3G73 A;  4LGW A;  4EM2 A;  4MNU A;  3KET A;  3BWG A;  4ENK A;  2EFP A;  1U5T A;  1R1U A;  3LWF A;  3F23 A;  2VBZ A;  3NRV A;  3BOQ A;  1QPM A;  1J7K A;  2ZKZ A;  2COM A;  3V8J A;  1ZRE A;  1I1S A;  2CGP A;  1HKT A;  3WTU C;  2QBY A;  5FFX A;  4RAZ A;  1WSU A;  1T0F A;  5L3G A;  3MCZ A;  1P6R A;  2FML A;  1S6L A;  2FRH A;  3K1N A;  1YFH A;  2CFX A;  3IC7 A;  4RGU A;  4EGY A;  1YO5 C;  3K69 A;  4CHU A;  1L3L A;  4I98 B;  3CUQ A;  5KK1 A;  1I6X A;  1UST A;  3D0S A;  4A5N A;  1HSJ A;  2F5C A;  1T39 A;  1YS7 A;  4U7D A;  2A61 A;  2ZNY A;  1ZGJ A;  1IXS B;  3KFW X;  2O0Y A;  5DDG A;  1U8R A;  3I64 A;  2GWR A;  4RB2 C;  5J8F A;  1HST A;  2FF4 A;  2KRF A;  5FFZ A;  4HAM A;  1D8J A;  2EB7 A;  2O6G E;  4OIP F;  1ZLJ A;  3RJP A;  1MJ9 A;  2ZJ2 A;  2VE9 A;  2RDP A;  1G3Y A;  2EA2 A;  4CZZ A;  3HUG A;  3QU6 A;  3TDU C;  4ZYG A;  2DFI A;  2XAG A;  1WQ2 A;  3IWF A;  1JHF A;  4LLL A;  4LLN A;  1Q1H A;  2P6S A;  1BC7 C;  2QZ8 A;  3GZ6 A;  4P9U A;  1EH8 A;  3QOP A;  4DNC A;  4JQF A;  5LGN A;  3PQJ A;  5DCM B;  4RB3 C;  4EQQ A;  2VBX A;  3FF5 A;  3RKX A;  4A6D A;  5LHH A;  1FYL A;  2PEX A;  3WG9 A;  3EQL F;  5LLQ A;  1HKS A;  1WI9 A;  5CVR A;  3LA2 A;  4RB0 A;  2VBW A;  3L9F A;  1FP1 D;  3EDP A;  5FB2 A;  4L9J A;  4HF2 A;  2PBI A;  2A69 F;  4AIH A;  1UHM A;  2VOD A;  3I53 A;  1OPC A;  3JW4 A;  3TGN A;  5ICC A;  2PLY A;  1IN5 A;  2QYO A;  2DU9 A;  2QWW A;  1S3J A;  1IN4 A;  3F8F A;  5LGT A;  1FBU A;  2XGX A;  3F8C A;  1JHH A;  3ECO A;  2KJB A;  1P4A A;  3LST A;  2DT5 A;  5D6E A;  1WRJ A;  3V7R A;  3RKW A;  1FLI A;  1Z1D A;  4MTD A;  1R00 A;  2EK5 A;  4ZH4 F;  4U0W A;  4MEY F;  3GEZ A;  1HW5 A;  5CLS A;  4PGG A;  4XSX F;  2EV5 A;  1EH7 A;  1MGT A;  1D8K A;  5J8C A;  3DF8 A;  2V79 A;  4UHT A;  5IT3 A;  3QU3 A;  1J75 A;  2LKP A;  3IHU A;  4ZYE A;  2OZ6 A;  3I0T A;  1TQM A;  1MKM A;  1YQA A;  3JAM K;  1IZ1 A;  1TTY A;  3WE3 A;  2IP2 A;  1GHC A;  4WCG A;  4I02 A;  4RGR A;  2FEZ A;  4UVB A;  3MZY A;  1TBX A;  4A0X A;  2L01 A;  1T38 A;  1J9I A;  1W5T A;  4ENJ A;  3P9C A;  2DQR A;  3AAF A;  3WE2 A;  4HV5 A;  1LB2 A;  2AS5 F;  3L09 A;  1XMA A;  1DUX C;  3TO7 A;  1IAW A;  1XGS A;  2HYF A;  1MZB A;  2R7D A;  2EJR A;  3HIF A;  4GCV A;  2GXB A;  1KYW A;  1P92 A;  2O03 A;  3HTU A;  4UUV A;  2VBY A;  4G6Q A;  3J80 K;  2F5D A;  2YU3 A;  2R7F A;  3TOB A;  1FT9 A;  3FZV A;  2QQA A;  2H09 A;  2DPU A;  2Z9O A;  2IW5 A;  4ESJ A;  1QNT A;  4EJT A;  4NHJ A;  1KQ8 A;  2M8E A;  2FMY A;  3KP7 A;  2XAQ A;  1ZN2 A;  1W7P B;  3M8E A;  2KKO A;  4OIR F;  2FNP A;  4BHC A;  2OA4 A;  1DP7 P;  2KIU A;  3E6M A;  3ZP5 A;  4PGH A;  1R1T A;  5K1Y A;  5BQT A;  5HS8 A;  2RKH A;  3C3W A;  3COA C;  1XB4 A;  4Q5S F;  1O3R A;  3FX3 A;  4KN7 X;  3E6D A;  2ACJ A;  4EM1 A;  1ON2 A;  2ZME B;  1O57 A;  4RB1 A;  1FSH A;  2HKO A;  2K02 A;  1SAX A;  3FXR A;  2W25 A;  5LEJ A;  2HDC A;  3V8L A;  5E8G A;  3H3Z A;  4A5M A;  3REO A;  1S7O A;  3RYR A;  4Q48 A;  1HQC A;  1PDN C;  4XLN F;  3IRR A;  3WTV C;  4DQ2 A;  2RNJ A;  3OOP A;  2EFQ A;  2A5Y B;  3H92 A;  2O61 A;  3JSO A;  1BI3 A;  3GFI A;  1PP7 U;  3CJN A;  4I09 A;  4ZYD A;  4R79 A;  2P5V A;  4HBL A;  1FP2 A;  5EEG A;  1F5T A;  1B4A A;  5J6X A;  3HRU A;  5BS6 A;  5H20 A;  4KIC A;  3HRS A;  2H6B A;  1ZHF A;  1ZG3 A;  2XRO A;  1XDS A;  3BDD A;  4EJW A;  1O3Q A;  1ON1 A;  3HSR A;  4IHT A;  2HGC A;  1MDM A;  2CQK A;  1IF1 A;  3C18 A;  3DPL C;  3FXQ A;  1OMI A;  4RGS A;  5DV5 A;  5ILV A;  1QQI A;  1V3F A;  3R0J A;  3T5X A;  1FYM A;  4OMY A;  5HLG A;  1XN7 A;  2M45 A;  2Z5U A;  5D4R A;  1R5G A;  1RUN A;  4M9Z A;  1LEB A;  4HX8 A;  1FY7 A;  1IW7 F;  1FOK A;  3HSF A;  1YTY A;  4N9H A;  3N4M A;  2EV0 A;  2VOP A;  4M71 A;  4FX4 A;  2IVM A;  4LMY A;  2NS0 A;  2BE5 F;  2L02 A;  2IA1 A;  3KP2 A;  3F6V A;  1GXP A;  2P5K A;  5IT9 Z;  1ZGA A;  3JTG A;  4Q47 A;  5LRR A;  4G7H F;  4CIC A;  3D5L A;  3PFI A;  2VE8 A;  1FWZ A;  3KZY A;  3SFZ A;  3LFK A;  2BV6 A;  4YFX F;  4KFC A;  4IRH A;  2W84 A;  3OV8 A;  3WOD F;  3HRM A;  1REP C;  1G3W A;  4A2U A;  2D1V A;  4G7O F;  3CUQ B;  2JRT A;  4BYY A;  1T2K A;  5BMZ A;  2CG4 A;  2JPC A;  2V9V A;  2CSO A;  1RI7 A;  3ZQ7 A;  1BI0 A;  2HQN A;  1ZRF A;  4M74 A;  1CF7 A;  5DD8 A;  1QGP A;  3SZT A;  3J81 Z;  2M30 A;  4KT5 C;  2RQP A;  2P7V B;  3RTR A;  3H3U A;  3KP4 A;  2MBF A;  3ZN0 A;  1KU3 A;  2UXN A;  5ICF A;  2ZO4 A;  4FHT A;  1K6O A;  2Z99 A;  3KLO A;  3V8K A;  4FX0 A;  3CTA A;  2FU4 A;  2QQ9 A;  5HDG A;  1P4W A;  1IN7 A;  3FWE A;  3CDH A;  4NB5 A;  2W24 A;  2NNN A;  2WTE A;  2XAF A;  2RV8 A;  4OIQ F;  2H94 A;  3KZZ A;  1BOA A;  4EVI A;  5ED4 A;  5F1R A;  3IKV A;  4KMF A;  5HS7 A;  1W5S A;  2DAO A;  2DW4 A;  1DDN A;  3IKT A;  4O3M A;  1Y0U A;  3WTS C;  1K79 A;  1OYY A;  1AWC A;  5H6Q A;  3IRQ A;  3ZMD A;  1IRF A;  2VOO A;  1ZLK A;  2ISY A;  3ZMU A;  2TDX A;  3KP3 A;  4K2E A;  2VXZ A;  1RUO A;  4G9Y A;  2K4J A;  3C7J A;  1R22 A;  1MJB A;  3KLN A;  3DFG A;  3MFK A;  1DPU A;  1U5T C;  3FM5 A;  2BYV E;  3TDZ C;  3GXO A;  1J5Y A;  2LF8 A;  1U3E M;  3GWZ A;  2L54 A;  5BOX A;  2DBB A;  3GZ5 A;  2F5F A;  2MH9 A;  3QPH A;  1B9N A;  1ULY A;  1G3T A;  1LJ9 A;  1FC3 A;  2PQ8 A;  4LLG F;  2HTJ A;  3BPX A;  2QVO A;  2AXL A;  3O2P E;  3V7C A;  2FBH A;  1YW8 A;  2W57 A;  3GX4 X;  4LB6 B;  5BPD A;  2BEO A;  5FGM A;  4O6J A;  3ROU A;  3LA3 A;  2MLK A;  2STT A;  3BRO A;  4I01 A;  3ZMV A;  1QBJ A;  2EFN A;  3GLX A;  4ASN A;  5LGU A;  2MA3 A;  3CUQ C;  1WKM A;  1IRG A;  4TV7 A;  1KYZ A;  3B73 A;  3J7A O;  1Z6R A;  4LB5 A;  3MEX A;  2J5O A;  3I4P A;  5CVU A;  3MQ0 A;  1K78 B;  4LG0 B;  3FXU A;  5E1Z B;  4AIJ A;  1U78 A;  2HQR A;  1R58 A;  1VTN C;  2J5P A;  4QWQ A;  4YFK F;  3VOE A;  1O3T A;  5HS9 A;  2W85 A;  4BXU A;  3FM3 A;  3SHF A;  4JBA A;  1KU7 A;  1USS A;  1XMK A;  3KP5 A;  4Z2Y A;  4BHB A;  3MZH A;  5FO5 A;  2RVC A;  2DK8 A;  1F4K A;  4NQW A;  2RC4 A;  3T8T A;  1BJA A;  2P8T A;  2OAZ A;  2GQQ A;  1MJA A;  1FX7 A;  3HHH A;  4KMU X;  5AON A;  2V1U A;  4EM0 B;  4IPA A;  2OZU A;  1TNT A;  4OOI A;  1OYI A;  2KJC A;  1PP8 F;  1YLF A;  3WTY C;  5K5Q A;  4G8X A;  4Y13 A;  3BPV A;  1FYK A;  4RS8 A;  4Y15 A;  1FBS A;  3QRF F;  4OMZ A;  4M6Y A;  4U7B A;  2ZFW A;  2MLG A;  2Q2E A;  3WU1 B;  1GVJ A;  1ZAO A;  2HTS A;  2UXX A;  2JT1 A;  1J59 A;  2EFO A;  4A0Y A;  2EWN A;  4O5V A;  2D2W A;  4WK8 F;  3ISP A;  3HYI A;  4YG2 F;  1JE8 A;  5L3D A;  3R0A A;  2ZNZ A;  4S05 A;  2M5W A;  2XKO A;  4LJZ F;  1YS6 A;  1JXS A;  1ZRC A;  3DEU A;  2GAU A;  3RDI A;  1DPR A;  3I71 A;  1IXC A;  2F5E A;  2PFB A;  2YPR A;  1H9T A;  4N0B A;  4E70 A;  3GF2 A;  1YIO A;  4G7Z F;  2JPB A;  1TNS A;  5DD4 A;  3EYY A;  2D1H A;  4HYE A;  4R1H A;  3DQV C;  2K86 A;  2XIG A;  1G3S A;  3GFM A;  2DK5 A;  5D5X B;  1LDD A;  2HYG D;  2YR2 A;  4EGZ A;  3T0Y A;  3MAJ A;  4EJU A;  4M9S A;  2FBK A;  4M73 A;  3Q9V A;  3IWZ A;  5TJJ A;  3CO7 C;  1D5V A;  2DQL A;  1SD7 A;  2ZCW A;  1TLH B;  3K0L A;  2A68 F;  4XSZ F;  4KIF A;  5E18 F;  5CVJ A;  3L2C A;  2JTV A;  2NAZ A;  2B0L A;  1XD7 A;  5D6F A;  4F7Z A;  4HX4 A;  3BJO A;  2VT2 A;  4P5O A;  2FE3 A;  2STW A;  4PZJ A;  5DUK A;  2FXA A;  1Z9C A;  2DPD A;  4MGR A;  2LDU A;  4IXA A;  1XGO A;  3KE2 A;  4Q4Z F;  3ABT A;  3E5X A;  4UVC A;  1AOY A;  4HDU A;  4MHG A;  4KYW A;  3O3K A;  4RGX A;  5ERI A;  3GFL A;  2O8X A;  5CYV A;  5FLX K;  1IUY A;  3ZPL A;  2XKP A;  2LF7 A;  4CO8 A;  4XLP F;  3F3X A;  4AVP A;  2IA2 A;  1OR7 A;  2DI3 A;  2HR3 A;  3J80 Z;  3JSP A;  2F2E A;  5F64 A;  3LAJ A;  2E1C A;  2NYX A;  5CJ9 A;  4L5I A;  2CO5 A;  4HQM A;  2BBY A;  3ZMZ A;  1TW2 A;  4PDK A;  1BIB A;  3BJA A;  3DV8 A;  1W7P A;  3GVA A;  1PUE E;  4OIO F;  5IT9 K;  4UVA A;  1J2X A;  3QAH A;  1G4D A;  2E1N A;  2Z3Y A;  1R23 A;  4AIK A;  3LQR A;  2H27 A;  4I0A A;  2HEO A;  1BI1 A;  2A6H F;  1U6G A;  2QQB A;  3K9T A;  2LSO A;  2L3D A;  4R8H A;  2K7L A;  1STZ A;  1RZ4 A;  2L4A A;  2IPQ X;  1LEA A;  4BNC A;  2ZME A;  2JSC A;  4KA4 A;  1S7A A;  1X3U A;  2ELH A;  2EA4 A;  1CF7 B;  1FNN A;  3TOA A;  2FOK A;  2CW0 F;  3DXJ F;  1U5T B;  4BAY A;  3L7W A;  4ENM A;  3J81 K;  1S8N A;  4WWC A;  1TQI A;  4GXO A;  4GGG A;  4ESF A;  4L18 B;  5D8K B;  3WTX C;  1B6A A;  5L3C A;  5D5W B;  4EJO A;  1P2F A;  2QBY B;  2R3S A;  4P55 A;  3HHG A;  3I59 A;  5FD5 A;  3ZMT A;  1P4X A;  3ZN1 A;  1LNW A;  1SFE A;  4D0P A;  2CWE A;  4BQA A;  5JR3 A;  4IF4 A;  3F8B A;  3V7S A;  2K4B A;  2DO7 A;  1HW2 A;  1ZH5 A;  1QZZ A;  2XAS A;  1HW1 A;  3SQN A;  2Q8K A;  6PAX A;  1XSV A;  2JZY A;  4GYG A;  2P5L C;  4HLX A;  1KA8 A;  4UV8 A;  3EYI A;  1F9N A;  1Z7U A;  2ISZ A;  4EJV A;  1XCV A;  3LA7 A;  4L9N A;  1NHA A;  2DTR A;  2A3S A;  5A2Q Z;  1I1G A;  1ZG1 A;  2EV6 A;  1U2W A;  2EFW A;  3RYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...