5B1BH

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 5b1bH00
5B1BH 3ABKH 2DYSH 1V55H 3WG7H 3X2QH 3AG3H 3AG1H 3ABLH 3AG4H 3AG2H 5IY5H 2DYRH 5B3SH 1OCRH 2EIKH 3ASNH 1OCZH 2OCCH 1V54H 2Y69H 3ASOH 3ABMH 5B1AH 1OCCH 1OCOH 2ZXWH 2EINH 2EILH 2EIJH 2EIMH
chains in the Genus database with same CATH superfamily
3MQ0A 1YIJI 4P9FA 4A0ZA 2IGMA 2BY2A 4ENKA 3FXLA 5EGOB 4RAGA 1KQ0A 4UB8C 3K4MA 4IHSA 4ENMA 3DKYA 1K4SA 2CRGA 1UFMA 2R4GA 2DBBA 2R7OA 3E0JB 5GADJ 1RZ4A 2JPBA 3HZJA 5AONA 4LLNA 3QODA 2RQPA 4PFOA 2GBYA 3BQYA 4RB1A 4FHTA 5HDGA 2PQ8A 2ICWG 3D1NI 3FWEA 3K9TA 3ECOA 3HM5A 3ZQQA 3T8TA 3CMYA 1ETWA 1KU3A 1IZ1A 3JSPA 3GTOJ 4ZH4F 1SD7A 5ILSA 1H89C 3E1SA 1LNWA 4UY8I 1TT5B 1B8IB 2VJIA 2AHQA 3BT9A 1XTAA 4PFPA 3HEFA 3MN2A 3ZPLA 2OUMA 4IF4A 4JQFA 1STZA 1IW7F 3BLYA 3W3CA 2UWMA 1K78A 2VN2A 1YJ9I 4XKWA 1MNDA 4DYQA 3OYAA 3PO3J 2YX7A 4Q48A 4K2EA 3MKLA 4Z2YA 3RJPA 5JHFA 2Z16A 1MBFA 1DPUA 3G71I 2DA1A 4A5NA 1SFKA 1G3TA 2HVRA 2LR8A 2QENA 3OWTA 4ZDLA 2JA8J 4F52A 3HOUJ 5AIQA 5LFAA 3WTZA 2YR2A 2M1BA 2O5RA 2FBKA 2V1NA 1BN5A 2GOXB 3M1CA 1RUOA 5DS9A 1VQ8I 3W6VA 3KLNA 1TBXA 2ECCA 3VYSB 4BNCA 2NVXJ 5BQTA 2JA5J 4OIRF 2K9LA 3CC2I 4U87A 2PI0A 3C2BA 1U6GA 3R61A 4KT5C 3E6BA 3HIFA 5JI6A 1UG0A 3L00A 1I6XA 3JRBA 2IVMA 3SJMA 1WJAA 2VQGA 5HOOA 3JR9A 1R4NB 1W4MA 4HOBA 5DD4A 4KMUX 1BOBA 2ME0A 3GVAA 1X1CA 3H92A 1DGWY 2XF6A 3EUHC 1WVRA 1XGMA 2DK5A 1J2XA 3CCSI 2ZJQF 2F5DA 1PP8F 2ZSHB 4XNFA 1Y39A 4MIMA 1UG2A 3OYBA 3TDUC 2KQRA 2AQFA 2L7ZA 2ZJRF 4E7HA 3S2HJ 3M4OJ 3F9KA 1YRNB 4JK1X 4ESJA 4L9NA 3CO6C 1A04A 1HDDC 2QA4I 5DDGA 4YELA 4PJLA 5J40A 4Y4RA 3LSPA 1QO0D 2DT6A 3NARA 2K7LA 4CSWA 4TV7A 3I4MJ 2A68F 3H9QA 3G6EI 1EJ9A 5F64A 4HQMA 2IA1A 1VTNC 3O6BB 2L0KA 4KYWA 2ZMEC 1XSDA 1E2XA 1K6YA 2DN0A 1Z6RA 2OJED 3KZIC 2TRTA 1XGNA 5IP9J 3HPGA 1D3YA 3WGGA 1XCVA 3H5AA 4A6EA 2IJLA 1ZARA 2R5ZB 4FETA 1SFEA 1IN6A 3DTKA 4HV5A 5D6EA 4NNJA 3H3UA 1ZK8A 1T95A 1B59A 1MMDA 3D5SC 3R60A 5IOZA 3L9FA 4E7LA 2NS7A 1SVLA 1LDJA 2FU4A 3C1DA 4ZTFA 3A4CA 3T8RA 3GFLA 1ZH5A 2ZXJA 3W6JB 1S29A 2CV1A 2E7WA 3K6GA 1G59A 2Y2ZA 3AG3H 2VONA 2GA2A 4CZZA 3VOEA 3HTUA 2XHKA 2P4WA 1CGPA 1ZREA 5EG0A 5J8CA 4I99C 2VJJA 3Q9VA 2HPMA 4BH9A 2HNHA 3L2QA 4M3GA 1VQLI 3HGGA 2MLGA 2MA3A 1DU6A 5HS7A 3PUBA 2FA5A 4NHJA 2H8WA 3J7AO 2RV8A 1R5GA 3LAJA 4IRHA 4GO1A 2ISYA 1ACIA 1KU9A 4BDZA 1JT0A 3DCFA 1WCMJ 1X19A 5JLWA 5H6RA 1XS9A 2X4HA 1D5VA 3BR6A 3CUQC 5F0CA 4RGUA 5CJ9A 2R3SA 1ETOA 3V7SA 3SFIA 3PJRA 4XLPF 4EQQA 4E7ZA 4XLNF 3MKZA 4F55A 3FK6A 2H09A 3PSIA 3U1KA 1NHAA 2RAEA 3OYEA 4JX5A 3PNVA 4HAMA 2Y69H 1T6SA 1XN7A 2NVQJ 3IH3A 3Q9SA 4BQNA 1BOAA 4KIBA 2PJPA 2K9QA 1ZYRF 1TWAJ 2QQ8A 3ZQLA 2XAGA 3S3NA 2DAOA 1IN5A 1Z7UA 3EETA 9ANTA 5TJJA 1EF4A 5E3LA 2OC6A 1V3FA 1TZLA 2LYCA 1XMAA 1H88C 2HXOA 2LY9A 2EPFA 5DYMA 2CU7A 4XMYA 4KFCA 3UNGC 1Y56A 1MMAA 4UVCA 5D8KB 4HRIA 3AKZA 2XGEA 1EA3A 1OCCH 2JZYA 3OR1C 1MBEA 1ZTRA 4DZJA 3BZKA 1SFUA 3CMMA 1G3YA 5CLSA 4HBLA 3E7LA 3ABKH 2FJ1A 3COAC 4HDVA 1VI0A 1OCPA 4BBRJ 3MCZA 1K78B 1TQIA 3TW7A 1X58A 1J7KA 2Y0SA 1HKTA 2RDPA 4HNVA 5CVUA 3V8LA 1IN4A 1O3RA 1ERDA 1U5TC 3TBIA 3B6AA 3GXOA 3S3OA 2DA7A 1V5GA 2JUGA 2RNGA 1ULYA 5JVTA 5IPAA 1N25A 3TL4X 2EFQA 3R6SA 3F21A 1GXQA 4N4OB 1BBYA 2MSYA 3LQRA 4U0VA 1T39A 5EYRA 2R7VA 2K4JA 2Z99A 5HNHA 3S15J 1OMIA 2FRHA 1Z6TA 1KU2A 1A36A 4KUMA 1U78A 2V9KA 3DPLC 2NOJB 3MKYB 4HQEA 2QVOA 2VT2A 1FBSA 4CH7A 5LEJA 3MD2A 2Z3YA 2X0LA 3CCUI 3WODF 4D7NA 5FRMA 2E34A 3RPUD 3OIQA 4A3LJ 4Y17A 4XL9A 2VUMJ 1I6HJ 4CYDA 1TNTA 3EYYA 2XF7A 2OF7A 1A31A 1POGA 2HFHA 2LREA 1FP1D 5FD6A 4ZYEA 5IP7J 1JGGA 2GLOA 2VOOA 1HW1A 3KP4A 1IRXA 5IY5H 2LD5A 4A93J 1ZGJA 1MH3A 1D8JA 2DFEA 1QNTA 5EZGA 4HNTA 3UKGA 3PFYA 2E2IJ 2R7TA 2KJBA 1FX7A 2IGOA 4I0AA 2WY7Q 4XN0A 1V54H 4P1WA 2XVCA 5BS6A 1D5YA 3PNYA 4XORA 3KEYA 2RNJA 3HRUA 2E5ZA 1B72A 1AA7A 2EIMH 3DFGA 2MYSA 4EEFG 1RIOH 2X85A 4S05A 1WJEA 5E18F 1YG2A 5L3GA 2KZVA 3Q0WA 3P7NA 5DUKA 4M3DA 3O3KA 4QTRA 4A6DA 3CCEI 3TOBA 2MH2A 3K4CA 2Q1ZB 3F8NA 1FLIA 1F9NA 3QPSA 1SC7A 1B1BA 4EJWA 1FSHA 2XAQA 2IEKA 1GHCA 1TW2A 1ETXA 1WJBA 4FISA 4CO8A 3Q3SA 1DUXC 2DOAA 5DV5A 2NRAC 1HF0A 4M73A 2F4OB 5FLXZ 1W7PB 4CCMA 1FMVA 1H8AC 4X0GA 2CYYA 1QVTA 1S6LA 1GDTA 4CDGA 1X1BA 2QF7A 3SHFA 4C2MJ 2KL4A 4ZC3A 4PJNA 3QPHA 2QWWA 2L7MP 3DBRB 2HTSA 1R6RA 1XMXA 2OBPA 4ETSA 4WXHA 1XG1A 3JRDA 4LG0B 1TC3C 1N77A 2I10A 4FT8A 2ZSIB 2IS2A 1LVKA 3L2VA 5GPAA 3PIPF 3SYTA 4B09A 1R36A 1TWFJ 2J5OA 1ORKA 4I76A 1T33A 2A07F 2KKOA 2K3FA 1IAWA 2KPMA 1BI2A 2IS6A 4KJZA 5F0FA 3WGHA 2TCTA 3E5QA 2X1DA 2DU9A 1WJFA 2VLAA 1FIPA 4XRFA 2JVHA 3I55I 2XASA 1O3QA 4KIFA 4Z6YA 3SEZA 2K85A 3WU0A 5ILVA 3M8FA 3MZ8A 3HSRA 5CVRA 1AWCA 3F3XA 3KP3A 2F5EA 1SEUA 1OYWA 4C9YA 4BAYA 2DMNA 3WU2C 2LY2A 4KN7X 2DTZA 4L9VA 3E6DA 1N75A 1PYVA 3VODA 3IKVA 4BHBA 5FJ8J 3OYMA 2CW0F 2BV6A 3BR5A 2M7BA 2R7FA 4BHPA 2LF7A 1VQKI 3CJTB 4RAZA 2XSJC 3P9CA 1MH4A 3AFHA 3PIOF 1R22A 3GLLA 2BY1A 3DKWA 4BY1J 4L0YB 4GYGA 5KAIC 4N4NB 5M3FJ 1YHQI 5E1WA 1N78A 1A6QA 4AIKA 3S16J 2EK5A 3BP8A 3I53A 4G7ZF 5IYBJ 3GO5A 3MMYB 3S93A 1Z9CA 4KA4A 1HW5A 3U21A 5F0HA 3QU6A 5IYDJ 2MLKA 1IV6A 2JJ7A 4CCOA 3BG6A 3BCAA 2K02A 5ILUA 2A5WA 3EUHA 4J19A 3G2BA 1FIAA 1AKHA 4V19K 2RN7A 4OMYA 3Q5FA 1DP7P 4HNUA 3DLLF 3VYRB 3WU1B 3MAJA 1SMTA 2KJCA 3JAMZ 4GDFA 3ABLH 2LF8A 2W24A 2F48A 4MHGA 3VSLA 1BA5A 3D0SA 4DJAA 1XGSA 5JR3A 1AU7A 4NDLA 3MVPA 3IUOA 3B02A 1YW8A 2QUFA 3QP5A 2FD5A 1YI2I 1FWZA 4L5EA 2W7NA 2NAZA 4I2OA 1GVJA 3FHZA 3K4NA 1P7IA 2EJRA 2DK8A 1OISA 4KICA 4DBQA 4AIJA 1ZG5A 2MABA 3K2ZA 3TW6A 1OJLA 4S04A 3GEZA 1Z1DA 5E20A 1VQPI 1YITI 4XN3A 1BC7C 2Y30A 3P9IA 3DXJF 2RREA 3A1YA 2LK2A 2LOOA 3OMYA 1X3UA 2X1CA 4IKFA 1ZRDA 1KYWA 3OYNA 1BR2A 3I5UA 4CCKA 3HB9A 3K0LA 1IN7A 2IAIA 3GFIA 2GM4A 1O7FA 2CFXA 2E36A 2R5ZA 2CV2A 3M7GA 3OL3A 4IHYA 3CTAA 5JFRA 2OTJI 3TP3A 5HNFA 2VKDA 2CQQA 1B72B 2XPWA 4XKCA 3R4KA 5K7HA 1BM9A 2V7FA 3BDDA 4A0XA 4IRGA 4M6YA 3RPUA 3FF5A 4NQWA 4KN4X 3FXJA 2HOTA 1W0UA 3NRVA 2CUFA 4MEXF 3JSOA 2V9VA 3L2RA 3ABTA 1KYZA 2X48A 3K7AJ 4MGRA 2H27A 2KIFA 1MMGA 2J5PA 2ZXWH 3ZQ7A 4RLQA 4IOCF 3FKJA 5CYVA 4A69C 3RKQA 1F5TA 3MZHA 3CDHA 1WI3A 2QSHX 1F1ZA 2XAFA 3M1EA 5F08A 3W2AA 3C2HA 3CUQA 1ITYA 2Y9ZA 2K27A 4NC8A 1HDPA 4I6ZA 5C4XJ 2FQ4A 1MBHA 1RI7A 2P7CB 2VASA 2HYGD 5E79C 2IBDA 3REOA 4A5MA 3DEWA 4RDUA 1QBJA 1Y1VJ 1HXDA 1EH8A 5EDNA 3LOCA 3C7JA 2FOKA 5H20A 1T08B 5HLTA 2MGQA 1SAUA 3TMOA 4EATA 3BWGA 3DP7A 4F3QA 5LGUA 4U7BA 3OYGA 5D5VB 4ZYAA 2VBXA 3BZCA 4WX9A 4RGXA 4GRIA 2HPIA 2CW8A 3TEDA 3OYKA 3KYCB 3W2VA 4B1RA 1Y1WJ 3SFZA 2BBYA 2DXIA 4W1UA 3AL0B 2PBIA 3GBGA 2RKHA 1IF1A 1MNMC 3PM1A 4HX7A 5CQEA 2GZWA 1P4XA 3HRMA 3V7RA 5ICCA 5B3SH 1MW7A 4B3XA 3P9KA 2JWTA 3BROA 2B0LA 4Q47A 3CUOA 3IWFA 2DA5A 2RQQA 2VXZA 3GZ5A 5LEKA 2H6BA 3FMRA 2F4IA 4M3EA 3GTMJ 2M87A 3JRFA 3S3MA 2OU2A 2UXXA 4QPQA 2CQXA 2QKMB 1V4RA 2L02A 3CESA 5E8IA 1WJCA 2BE5F 1W5SA 4CICA 1A35A 5FB2A 3AG1H 3F6VA 3VWBA 2HKXA 1U2WA 2LY1A 2FE3A 4HG2A 4ESBA 1IC8A 5CVJA 5L3EA 4BYYA 2LTPA 5B5EC 1U5TA 1IRZA 4I7HA 2E7XA 3HL2A 3S32A 2DOEA 3ASOH 2PMHA 2W57A 3C2GA 5L3DA 4HDUA 1SD5A 1YS6A 4CXFA 3LMMA 2JT1A 3QYEA 1VQMI 1QVUA 4IEJA 2DMUA 3EQLF 3ISPA 5HLHA 3M3YJ 4XQFA 4RAYA 4RM3A 4EM1A 1GVDA 2VIXA 4OU0A 1HKQA 3ECHA 4CCNA 2IRFG 2ZB9A 3F8CA 2DLLA 3E6MA 3WE3A 3I64A 4RAFA 3KP5A 5L3FA 1E17A 2MBFA 1WFXA 1ETYA 3HHGA 3QOPA 4UHTA 2IS1A 1I1GA 2FBHA 5TISC 5D4SA 5ED4A 1WWXA 3WG7H 1AKHB 5J4VA 5CQGA 3S1MJ 5GAHJ 1ZLJA 3FXOA 3E5UA 2KHMA 3W6KB 2E71A 1CF7B 2P8TA 4BXUA 1R5ID 2X6OA 2Q8KA 4BXFA 4EJTA 1X1DA 4BJ6C 2K4BA 1BJZA 1FOKA 3BJOA 3RPQA 3CZ6A 3CLQA 2GXBA 2VODA 2M8GX 1FSEA 1M1EB 2E5NA 3DEUA 5BMZA 2ZXIA 4MFDA 1YIOA 3FXMA 4MTDA 3KPHA 3M8EA 4KIGA 1LE8A 2HTJA 3EPZA 5LRSA 2KIQA 2QM3A 1AHDP 3J7AY 1ZLKA 2K9SA 4YEJA 1R58A 2DA2A 5E17F 4ZDPA 4B47A 1FC3A 4EVIA 3F8MA 3ROUA 1IXCA 3L2CA 2DA6A 1YE9A 5E1ZB 3HDDA 1ENHA 3GLXA 4DGWB 5D6FA 3ERMA 1R00A 1G4DA 3LFUA 3ZMTA 3OOUA 5J1UA 3BR0A 5LGNA 1B4AA 1Z91A 3Q0VA 4D7MA 2DDAA 2MD5A 2E2HJ 2M8EA 3LSKA 5FGMA 3WTUC 2KT0A 3V42A 4XRMA 4RB2C 1XC5A 1HC8A 4PDKA 1I39A 4AC0A 2HDWA 3JRGA 5E3MA 2XKPA 1IRFA 1LUJB 1A5JA 2M2EA 6PAXA 1QRYA 2M3AA 3I56I 2EA2A 2HR3A 4HV6A 1DP3A 1HW2A 2CJJA 2VE9A 3CCRI 3PL8A 2P5LC 1X1AA 4N0BA 1K7AA 4NQWB 5B1AH 3HOYJ 2M4GA 4RB0A 4M9XA 5D4RA 3QP6A 2X6XA 2QQAA 1RETA 4UUTA 3LSGA 1FTTA 2CQKA 4Q4ZF 3JTGA 1W7PA 5KCMA 2PG4A 2W4SA 2ME6A 2DA4A 2HU9A 2LDUA 1OR7A 1LVAA 5K7ZA 3FXKA 4FX0A 3CUQB 4MEYF 1SD4A 3RKXA 1RPWA 2WC2A 4G12A 4PZJA 1UELB 4LG0A 2O8XA 3O8GA 2QGUA 2DODA 4KNYA 2HKOA 1OCOH 1QU3A 1VQOI 1B6AA 1PUEE 3G73A 4I0BA 3OS0A 3ZQIA 1ZR2A 4YFKF 4A2UA 3IAM2 1Z05A 3RI4A 3BY6A 2NVYJ 2ECBA 1YTYA 1D0YA 2M0MA 5LBQA 3BR1A 2A05A 5F27A 2JN6A 2LLKA 3H3VK 3ESWB 2CUEA 2D1HA 3RCOA 3OYIA 4YIRX 2ZBKA 5FD5A 2MC3A 2VB6A 4HX8A 4E6KG 1MBGA 4XKBA 5BPDA 1KGSA 3TOAA 2R7UA 4P5OA 1NK2P 5KNLA 4IOAF 3FDYA 2A6EF 3NQOA 2WAQA 4M9SA 2R7RA 4RB3C 1W36D 2H1KA 3S2DJ 1ON1A 3ZQFA 3LSRA 3U2RA 2JSPA 4AWXB 3OS1A 2YUSA 2ELKA 1JT6A 3OR2C 4LLGF 4A3JJ 2V6EA 2FMLA 3F23A 4EM0B 3IHUA 5J47A 3S2WA 5IOYA 3OYFA 4LIUA 2ZJPF 2VKVA 4XOPA 4XRSG 3BQZA 1I3AA 2QYOA 1Z21A 3OSFA 1YFHA 2FOWA 1OPCA 2ISZA 1SAXA 1YJNI 1X1PA 3QPTA 2EB7A 2DMQA 1U5TB 5GP9A 3JREA 2EILH 2L01A 4NC7A 2EIJH 3F0CA 3FM5A 3ZQCA 3LA3A 5J6XA 3C3WA 1KQ9A 2STWA 1IDZA 2COMA 1MMNA 2M45A 1J59A 3HUGB 3CF5F 1S5LC 1LKXA 1WH5A 2IW5A 4V2GA 3CMAI 1U9NA 5C3EJ 2LBFA 1O4XA 3BTJA 4Y33A 3GZ6A 4BXXJ 4BGDA 1E0EA 4E7KA 3E5XA 2VBZA 1Y6IA 3ZGKA 3K4JA 4ZTJA 2VPLA 4GXOA 1USSA 3NAUA 1SANA 4HW0A 5DM7F 1G2HA 1D0ZA 2L7FP 2HQ5A 2L9VA 1Z77A 1BR4A 4IPAA 3T5XA 2C6YA 1ODDA 3H0DA 2L7KA 2JPCA 5GTHC 1B9NA 1XDUA 2A5YB 2CGPA 3L7WA 2NS8A 2IXSA 3CJQB 1MDMA 1ONVA 3H9JA 2I8DA 4XKVA 4DOZA 1JHFA 2P0WA 2F5CA 4A3EJ 4GYIA 2EZLA 4C3HJ 3EDPA 4I98B 3FXQA 2QQBA 2QQ9A 3M9AA 4BY7J 1I3QJ 1T0FA 3HOZJ 4EV0A 3S1RJ 1OYYA 2HWVA 1SMYF 2VBYA 4XK4A 2QKLB 4AIDA 3ZMDA 5FLXK 2V79A 5K5RA 3G4SI 3WG9A 1LB2A 4C2TA 5DCMA 1GUUA 4HSRA 2HXIA 2DQRA 2MD0A 3DBHB 3HJEA 3ZN1A 4AM3A 2FXAA 3BR2A 1UHSA 3LA2A 4AU7A 2M34A 1LE8B 5LHHA 2VE8A 1XX5A 4L18B 3MWMA 2GA1A 2EZHA 3G1OA 1JKPC 4IX7A 1TTYA 2PN6A 2XGDA 5KK1A 3VFZA 1X3WB 5GPCA 1ZRCA 3G1LA 2L9RA 3KE2A 1QHHD 3S14J 4F92B 1RKTA 4IRIA 3HGYA 1GV2A 2UXNA 1HOMA 2FSWA 4BEHA 3GWZA 1YX5A 4PGGA 3ZN0A 2Y48A 4I01A 2W48A 2B9SA 3CCQI 1LDKB 1NTCA 3KIOA 3RZDJ 3OOPA 3HSFA 2L5QA 4OIOF 1TWHJ 1VZ0A 2L2OA 3O2PE 4UXNA 2OPTA 3KX2A 3J80Z 1P4WA 4KDPA 4G7OF 3DF8A 2GOMA 2W85A 3L2WA 1LJ9A 2R92J 5C4JJ 2JA7J 1ZAOA 3GZNB 3KP6A 3MEXA 1FTZA 4M72A 2ZFUA 2LMDA 2ID6A 4HF0A 4R79A 4HLXA 2VJ4A 1YX3A 2X51A 4B48A 5DD8A 5JHUA 2QSGX 1RUNA 3OYJA 2VKEA 1U9OA 2FUG2 4M3BA 2YU3A 1W0TA 2Y0SN 1QGPA 2JUCA 1D8KA 4RA2A 2LC2A 2XRNA 4G6DA 4CZCA 1R71A 5DTDA 3IV5A 2EIKH 4MQVA 1MJAA 2E1OA 2V9PA 5F1RA 2BXZA 3BZ6A 4BQAA 3NWTA 3OYCA 4UUSA 1FZPB 5J8FA 1GLNA 3HOTA 2A61A 1PUFA 2XC7A 1BIBA 2M0CA 2Y9YA 2XGXA 1LEBA 4NBQA 3M07A 3GFMA 3I58A 1R7JA 2XAUA 1JUPA 4DNCA 2M5WA 2R7QA 2G0EA 1QPIA 3AAFA 1ETQA 3OYLA 2ZJ2A 1IUFA 2IA2A 4UV8A 1YS7A 3QRFF 1D1CA 2BW3A 3DLAA 2XGCA 3S17J 1J0RA 3KYDB 2NOGA 3G1MA 1V5EA 4P55A 3V8KA 2VC0A 3JAMK 1S7EA 1D1AA 1W5TA 5LRRA 3IH2A 2V26A 1S72I 4LB5A 3QYBA 4OOIA 2LKSA 5JVGF 1USTA 2R7DA 3ULQB 4AIHA 3CDLA 4AYBA 2P81A 2GIZA 3D5LA 3H5NA 2L9NA 4XBFA 2JA6J 2CV0A 1BW5A 2PLYA 1K79A 2D5VA 2KDOA 4A3CJ 3FX3A 1WKMA 2VQLA 1NK3P 3NEUA 1YW9A 2ZXHA 5EEAA 4KMFA 1FPQA 1BI3A 1ZR4A 2NXNB 4EM2A 1KONA 1QHGA 1Y8RB 2KMUA 5J1YA 1DPRA 3QOEA 4YIFA 5HS8A 3CCLI 1Q1HA 3KFWX 1UCRA 2WB1A 5HDNA 3I59A 5K5OA 1J75A 3RYPA 2WBMA 2RGVA 1JTYA 3WHBA 3WTTC 4MTEA 1T2KA 4A3DJ 3A03A 4UNOA 3KETA 3BG5A 2LBFB 1B9MA 4EGYA 3KEQA 1ETKA 2V6CA 3FXRA 5F04A 4S0HB 1QPMA 5DEQA 4OWRB 3LAPA 4A3IJ 3RDIA 4ABZA 2AS5F 4ZZDA 3ZOBA 3HKZA 3TP0A 4D5CA 4YFNF 3GMEA 4PJJA 1FBQA 5FFXA 3BTLA 2OZUA 1G6NA 1CF7A 2V1XA 1JXSA 2DFIA 5FLVA 4FASD 4A3KJ 4AVZA 1JJ6C 1CQTA 2CO5A 2HQNA 1MDMB 5EZHA 3CCJI 1P2FA 5FLMJ 1QA6A 1UB9A 5B66C 3HHHA 2MW8A 1UZCA 3GF2A 3H1CA 4OMZA 3ZR8X 4PSWA 1JTXA 2STTA 1A6IA 3I54A 5CKTA 2CUZA 2JRTA 2ZMEA 3CP2A 1UHWA 1XGOA 1JKQC 2WAFA 1V55H 3IWZA 2A6HF 3SDGA 5A2QZ 2CWEA 1ZGWA 2E1MC 3E3VA 4GGGA 2KRFA 5DCMB 4AD9A 5HDKA 3S1NJ 3TQNA 1E3HA 2FQ3A 1ZELA 5L3CA 2Y0MA 5FKKA 4R1HA 3ASNH 2CQ7A 2PJRA 3N05A 1ETVA 1OQYA 5K5QA 3IKTA 3FMQA 1R1VA 5K1YA 3WTWC 4JYKA 3RQ4A 4PJMA 5GTIC 5E1XA 5FKNA 2DT5A 1PJRA 1HKSA 3GFJA 3LFKA 2G9WA 2DJNA 1Z0XA 2XDVA 3F8BA 2HQAA 2D45A 1JKRC 2CSOA 4BEHB 3IRQA 1VNDA 5K7FA 1U8RA 1LEAA 3LNQA 3P5JA 4G6TB 3HSEA 2O03A 1BC8C 2ADUA 3O8HA 1XMKA 1IJWC 2XB5A 5F6FA 2KRCA 4Y52J 4BACA 2XB0X 1EH7A 2VKHA 3CLOA 1FOYA 3ZP5A 3VSKA 3FK7A 4MNUA 3QU3A 1PDNC 1HLVA 4G6QA 3K1MA 4BQQA 2VQHA 2WB1N 1JE8A 2DO7A 4ZYDA 1VQ5I 2CG4A 1HBXG 4G7HF 4WK8F 3CJRB 1MBJA 3SZTA 3FMSA 3MFKA 3IC7A 2GAUA 4N9HA 2NNYA 1K61A 2VL8A 2B63J 2IS4A 1FYKA 2ELJA 5TGTA 3RKWA 5D5WB 2O0YA 2V1DA 5E8GA 4U88A 4XSXF 2W82A 3CCMI 2IT0A 2OV7A 3KCCA 5J4YA 3I71A 1LFBA 2VXDA 1LPQA 5LD2C 4WCGA 2XRLA 3N97A 4G94A 2PEXA 4XSZF 3BTCA 4NUBA 4P9UA 2NVTJ 2EFNA 2L4MA 4W97A 4R8HA 4UUSB 5J3LA 1PUFB 2DYSH 3BJ6A 3KEOA 1P92A 2ESHA 2ZC2A 4QIWN 1Z67A 3CMEI 2HYJA 1JUSA 2IA0A 4M3FA 2BXYA 3PFIA 3K70D 1VQ6I 5LHIA 3K10A 1D0XA 2V1UA 4HSTA 4FX4A 2H6CA 1XB4A 2XKOA 4DYRA 4ZYGA 1YLFA 4OAYA 5C44J 2BW3B 1Z3YA 2N8GA 4BKXA 3IL2A 2ZFWA 4HX4A 4DYCA 3JRCA 2HZDA 3A0BC 2VOPA 2X6WA 3GCMA 1SVOA 1H9GA 1T98A 1GT0C 4IJAA 4YG2F 2QZ8A 2H1LA 2E1NA 3VYTB 5H6QA 3DBLB 1L0OC 3HOVJ 2AQEA 3GX4X 3BC8A 3LSIA 2OCEA 5FKMA 1H9TA 2P5KA 4UUVA 3DEEA 2W84A 3FISA 4IQ4A 4HLYA 3SEQA 4PJ0C 3ZMZA 4LK1F 4J01A 1WI9A 2NYXA 4LG3A 2BGCA 3RIRA 1F4KA 3AL0C 3CQZJ 3DPTA 2HS5A 2MFZA 3HUGA 3F8FA 2OZ6A 3K1PA 3HTSB 3B73A 5B1BH 2IGKA 4C2UA 1S9HA 3ONQA 3WTXC 1I27A 5AIPA 3ERED 5EJCA 4MO7A 4H0EA 4HYEA 1EKEA 1JUMA 1W5CC 2OD5A 5JLXA 2F6CA 4OAZA 3I59B 2OA4A 3BPXA 1FJLA 2XROA 3JRHA 4HZFA 2LG4A 3KZYA 4NC6A 5KAFC 4LIVA 5D8LB 1VQNI 3F6OA 4IQJA 2O6GE 2UUZA 2BY0A 5FFZA 3A02A 2XSDC 1UHMA 4ASNA 1DU0A 1S7OA 4BUPA 2PMUA 4L5JA 4F93B 2O9LA 4PGHA 1VFCA 4U0YA 2EZIA 4PCQA 3RTRA 4A3FJ 1RESA 2HGCA 2FMYA 2X1EA 3LL7A 1OFCX 2CS3A 2ZO4A 3F72A 2XPVA 1YQAA 5IP6A 2K86A 3GUDA 2HOSA 3V4GA 3C18A 1W36C 4D0PA 3BG3A 2HOAA 4JX4A 1LDDA 2DA3A 3S1QJ 3DPUA 2VQCA 3IAS2 3LSHA 3L09A 1MBKA 2HZTA 1TP4A 1O7LA 2DT7B 5EEGA 4RS8A 4A3MJ 1MSEC 4EJVA 4X1EA 5D5UB 4XOTA 2ZMEB 1L3LA 2MC4A 1FEXA 5FKOA 5D5XB 1WQ2A 3IH4A 4I09A 4HF1A 3FZVA 2OCCH 3ZXSA 4ZYHA 4UVBA 4OIQF 1O57A 4B3AA 4ENJA 3CD6I 2L4AA 2PJRB 1HSTA 2KIUA 1MIJA 2NNNA 1H0MA 2OQRA 2ESNA 3SZGA 2YS9A 3LQQA 4DBRA 1YOVB 4LJZF 3CCYA 4E4HA 4II3A 3A2KA 1R4MB 1WH7A 2DYRH 2PX9A 1R5HA 1P7JA 2DDBA 2JMWA 3B6CA 3EYIA 3R0JA 5CVVA 1O3SA 3QWLA 3HOXJ 4N9IA 1VQ4I 3KZZA 2GIVA 3ZCOA 3BPVA 4FE7A 3TKYA 3U1DA 2XIGA 2OQGA 1Y8QB 1U3EM 1X4OA 1MSFC 4DIQA 3HPHA 1AOYA 3RYRA 2DTRA 1IN8A 5DCFA 3WTYC 4Y7NJ 4C30A 3ZQGA 2HVQA 4RGRA 3G3ZA 2CW7A 4LOCA 1BI0A 1IV8A 4ANJA 1YYVA 3DU5A 4UVAA 4E7JA 2ACJA 3CF2A 2L54A 4L9TA 3GTPJ 4H4KC 3HOSA 2Y75A 3QAHA 4I02A 3JCUC 2D1VA 1SFOJ 1P4AA 4ESFA 2QBYA 4O5VA 5IYCJ 1F43A 4UV9A 1IXSB 4EGZA 3H5RA 3K1NA 3RZOJ 3CJNA 2ZNYA 3TO6A 2BVMA 2GQQA 4YIIA 1UJ8A 5CPRB 4BQOA 1WHUA 3SDBA 2OAZA 5TRDA 2F5VA 3N4MA 1P6RA 1R9TJ 2BHYA 1XCBA 3TGNA 2LKXA 4L0ZB 3GW2A 1TT0A 1TLHB 2VPRA 2XAJA 4E7IA 4A12A 4CUGA 1Z3XA 5DUIA 2FX0A 1WZ2A 1T38A 2K3PA 2JK3A 2LFBA 3A01A 3OSGA 3K69A 2JA2A 3FHNA 2L9SA 5GAEJ 2WADA 4O3MA 3H3ZA 4IHTA 4B4CA 2AXTC 4IHXA 3HOWJ 3FXUA 2I5UA 2YX4A 1TWGJ 2GWRA 2R7ZJ 1EH6A 2XUBA 2KRHA 1GV5A 2P5VA 5FO5A 1FMWA 2OTLI 3ELKA 4MFEA 2F2EA 3BG9A 4LD5A 2VBWA 2R7WA 1WRJA 3WTVC 4GCVA 2JVGA 2EBIA 3CC7I 2LVSA 4G8XA 4F91B 1VQ9I 4XLEA 4XR6A 2HDCA 1RNLA 1LFPA 2MG4A 3QPLA 2DMTA 2DI3A 2DQLA 2YPRA 5GAGJ 1IG7A 2O61A 2GXAA 2VT3A 1IUYA 3UR3C 2EFWA 1PVEA 2LKPA 3I3LA 5EF6A 1HSJA 1S8NA 1OCRH 5M5XJ 4RGSA 4RLFA 2LNBA 2KIMA 4FTHA 1J09A 2O7OA 4XLHA 4A3BJ 5LHGA 2QCOA 3KP2A 5FROA 4A0YA 2QLZA 2Z2SB 1FNNA 3ZMUA 5IT3A 3A0HC 3OYHA 3T0YA 1FP2A 3J80K 4XM3A 4LK0F 1WJDA 1E3PA 4A3GJ 4JP0A 4CA0A 2XAHA 1XSVA 1QZEA 1K4TA 4CCJA 2R5YA 3R0AA 2DFHA 3BOQA 2ETHA 2UV1A 1QZYA 2Q2EA 2VI6A 1RKWA 2WTEA 3L1PA 4BE2A 4Q5SF 2O8KA 2IGNA 2NS0A 4DQ2A 4ENNA 1DDNA 4ZJZA 3DU6A 4LITA 2Z33A 2EZKA 2BY3A 2R7XA 3BJAA 4U0WA 2WWYA 3RSNA 3OS2A 2KDZA 2XV4S 3ML6A 3U9GA 1XPXA 1TQPA 3DWLE 5EEHA 1BW6A 4ZDOA 5BOXA 3NWSA 2Y31A 2K40A 4CYCA 3L2UA 4D1QA 3S8PA 3DKXA 4M6XA 1Y0UA 4XONA 2E60A 2F5FA 3GTQJ 1E3OC 2JRMA 1EV7A 1XSXA 2KP6A 2RVCA 3WGIA 5HS9A 5KVRA 2CMPA 3GTKJ 2L3DA 2K5CA 2NVUB 4WXCA 1U0JA 2A3SA 2GXGA 2Q0OA 2W00A 2PFBA 4O6JA 4WWCA 2KFDA 3I9V2 2WAQN 2BYVE 4LGWA 3VEPA 4DW6A 3WTSC 1JHHA 1ZG1A 1ZRFA 3EUKL 4D5FA 5HLIA 3ZMSA 3CDIA 3LSTA 2WY8Q 4XRSA 4V2FA 5BNGA 1ZQ3P 3H9GA 3M8JA 3TO9A 3HC7A 4Y3OA 2X9DA 5ERIA 2VC1A 5M5YJ 4IXAA 4B8XA 1XDSA 2DPDA 2R7SA 2BHZA 2EV0A 3D5RC 3SQNA 4RMNA 1MMSA 3LSJA 1WJ5A 3HRTA 2HOEA 5CVIA 1FT9A 4XLFA 3OL4A 3H36A 2WV0A 2CFOA 2XF5A 4EJUA 4PSXA 3J81K 1J9IA 3HYIA 2HYFA 2PMZA 3I4NJ 4JBAA 1FYMA 2DCEA 2EV6A 1W1WE 4LMYA 1IRGA 3OIOA 4QSHA 3JW4A 3BG7A 4L5IA 1OCTC 2M30A 2JQ7A 2FF4A 5M3MJ 2H8RA 4KITB 5BPIA 2FEZA 4BHCA 1WSUA 4X6AJ 4BS9A 2JTVA 3GTLJ 1OYIA 2VJ5A 3PO2J 1JGSA 2ID3A 2W25A 1TL8A 5L3BA 2YSRA 4HA8A 4XICA 2F4MB 1MJBA 4P96A 4QWQA 4EMSA 4OIPF 2K9MA 4E70A 5HLGA 1NG7A 3ZRGA 2QBYB 5DM6F 4BE0A 1D1BA 4HF2A 4ITVA 2D2WA 3MKWB 3IRRA 1S7AA 1ZHFA 4QPOA 2WAEA 2Z9OA 2DJIA 4C3IJ 2X6YA 4F7ZA 2BEOA 3OIPA 2B7EA 1JI8A 1TQMA 3OY9A 1KA8A 2BOLA 3CO7C 5EG0B 3HXLA 4BJ5C 1TWCJ 4ON0A 1TW3A 1K83J 5EGOA 2FNAA 1WGXA 2O3FA 4J00A 4NB5A 2BZTA 2ELHA 1IGNA 3WE2A 1U8BA 2E1CA 1G8XA 2Z1DA 1QQIA 3A01B 4XLCA 2IPQX 3AG4H 3J81Z 1FBUA 2E35A 1LQ1A 1YW7A 1OR7C 2CH0A 3PSFA 4FQGA 2IP2A 3Q0UA 1G3SA 1NG6A 2DFFA 3QYFA 1C0WA 4PUSA 3RKYA 1F36A 2YU9J 1FY7A 3K4LA 1ZGAA 4FCYA 3OYDA 2E19A 5A2QK 1Y0NA 1BR1A 2MH9A 3CC4I 3ABMH 4YFXF 1PP7U 1IXRC 3VDXA 1XD7A 1X3ZB 2HI3A 4B44A 3EUAA 4PK4A 1ZKGA 2EH3A 3JRIA 5HODA 1S3JA 1T8IA 1ON2A 1P9QC 1B8IA 4L9JA 2ZKZA 2LRDA 1HA8A 3RQIA 3J7ZI 2HDDA 2EQRA 1UAAA 1OKRA 4EJOA 1BL0A 4CHUA 4IHWA 4M9ZA 2HVSA 1J5YA 2M4KA 4C3JJ 2DOFA 1APLC 2W1OA 2HEOA 5ICEA 3FIWA 2PMZN 3SZPA 4QLCU 1YO5C 3JTHA 3TO7A 3IP4B 1SVMA 1NH3A 1HCRA 4CGZA 5FKLA 3H35A 1MNEA 2FNPA 4CCLA 1IO2A 1GXPA 3FBIB 5H2FC 4AUXA 3K70C 1TNSA 4LLLA 1QZZA 3I0TA 5E3OA 3GTJJ 4M6VA 4JOMA 3V8JA 1MJ9A 4YRVA 4IL6C 3GTGJ 1YJWI 3DTEA 1X2NA 2R5YB 5F1JA 3VYUB 1SD6A 4KT6A 2E1MB 2DPUA 3W2WA 2Q2EB 1DGRM 4WF2A 3PQJA 4ZZLA 3T1BA 3F22A 2LH9A 5LLQA 4LFUA 3E6CC 5ICGA 5M5WJ 4BJTA 2A6TA 1FYLA 1I50J 1ZG3A 2P7VB 2EFOA 2RC4A 3KP7A 4M74A 4RM2A 3X2QH 2BVLA 1LFUP 3V7CA 3GYHX 4CYCB 1REPC 2KLOA 1ZN2A 1UMQA 2EA4A 4JX6A 1OCZH 3DV8A 2M7AA 3MZYA 4MQ9F 1MKMA 3TDZC 3VB2A 4RBOA 2R0QC 2QEXI 3K2AA 3WHCA 1KQ8A 2EINH 5HVQC 4D9JA 1WPKA 3K4KA 1JJ8C 4BDYA 2V4JC 1YRNA 3I4PA 1SFXA 2XPUA 1R1UA 1RC9A 5IT9K 1DQUA 4AYBN 2E2JJ 3SXYA 1VF9A 3DTIA 3LSMA 5FRNA 1RRJA 1Q1VA 4UB6C 3AG2H 1BI1A 2HQRA 5E3NA 1V5FA 2EFPA 2KISA 1W7PD 4IO9F 5LGTA 4U7DA 2CQNA 1BIAA 4BL0B 3PQKA 2COBA 4B43A 2TDXA 1HQCA 1MGTA 1T0FC 1BJAA 3JRAA 1R1TA 2EWNA 3VPRA 1VQ7I 2Z5UA 1K6OA 4BU2A 4Y15A 3HBLA 1I5ZA 3PUFA 4WXDA 2EV5A 3LA7A 2CUJA 1RR7A 5J1RA 1MD0A 2G7HA 2AXLA 4M71A 3H0GJ 4BE1A 1KU7A 5KHDA 4GFBA 1OLTA 1FOWA 1IDYA 3ZMVA 3PNTA 4HPQA 3QQAA 1RR8C 3BTIA 4XIDA 4Y13A 2ZCWA 3CP8A 4IVNA 3KYLA 2K9NA 3ABUA 1JKOC 2ZNZA 4MLOA 2DMPA 4II2A 2P6SA 2QSFX 3HKZN 3HRSA 4LB6B 2P6TA 4AVPA 2A69F 2KZGA 3FBNB 3FM3A 2WV1A 3E97A 3KLOA 5ICFA 4OINF 2R93J 3OV8A 2JSCA 2UZKA 2LP0A 4BBSJ 1T56A 4KISA 3BCBA 2LSOA 4IHVA 1X4PA 1FOXA 2H94A 3BR3A 1KZHA 2AO9A 1X2MA 2FBIA 3LWFA 1G3WA 2WA0A 2M9HA 4HEA2 3J7YJ 5IT9Z 4DZPA 4E7SA 3HG9A 1R49A 3FKIJ 3CCVI 4IZZA 1I1SA 1R23A 4FE4A 1Z7LA 3K4BA 1O3TA 1MZBA 3DQVC 3ZQHA 4XLAA 2DW4A 2G7UA 4G9YA
chains in the Genus database with same CATH topology
5B1BH 3ABKH 2DYSH 1V55H 3WG7H 3X2QH 3AG3H 3AG1H 3ABLH 3AG4H 3AG2H 5IY5H 2DYRH 5B3SH 1OCRH 2EIKH 3ASNH 1OCZH 2OCCH 1V54H 2Y69H 3ASOH 3ABMH 5B1AH 1OCCH 1OCOH 2ZXWH 2EINH 2EILH 2EIJH 2EIMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1B H;  3ABK H;  2DYS H;  1V55 H;  3WG7 H;  3X2Q H;  3AG3 H;  3AG1 H;  3ABL H;  3AG4 H;  3AG2 H;  5IY5 H;  2DYR H;  5B3S H;  1OCR H;  2EIK H;  3ASN H;  1OCZ H;  2OCC H;  1V54 H;  2Y69 H;  3ASO H;  3ABM H;  5B1A H;  1OCC H;  1OCO H;  2ZXW H;  2EIN H;  2EIL H;  2EIJ H;  2EIM H; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  1YIJ I;  4P9F A;  4A0Z A;  2IGM A;  2BY2 A;  4ENK A;  3FXL A;  5EGO B;  4RAG A;  1KQ0 A;  4UB8 C;  3K4M A;  4IHS A;  4ENM A;  3DKY A;  1K4S A;  2CRG A;  1UFM A;  2R4G A;  2DBB A;  2R7O A;  3E0J B;  5GAD J;  1RZ4 A;  2JPB A;  3HZJ A;  5AON A;  4LLN A;  3QOD A;  2RQP A;  4PFO A;  2GBY A;  3BQY A;  4RB1 A;  4FHT A;  5HDG A;  2PQ8 A;  2ICW G;  3D1N I;  3FWE A;  3K9T A;  3ECO A;  3HM5 A;  3ZQQ A;  3T8T A;  3CMY A;  1ETW A;  1KU3 A;  1IZ1 A;  3JSP A;  3GTO J;  4ZH4 F;  1SD7 A;  5ILS A;  1H89 C;  3E1S A;  1LNW A;  4UY8 I;  1TT5 B;  1B8I B;  2VJI A;  2AHQ A;  3BT9 A;  1XTA A;  4PFP A;  3HEF A;  3MN2 A;  3ZPL A;  2OUM A;  4IF4 A;  4JQF A;  1STZ A;  1IW7 F;  3BLY A;  3W3C A;  2UWM A;  1K78 A;  2VN2 A;  1YJ9 I;  4XKW A;  1MND A;  4DYQ A;  3OYA A;  3PO3 J;  2YX7 A;  4Q48 A;  4K2E A;  3MKL A;  4Z2Y A;  3RJP A;  5JHF A;  2Z16 A;  1MBF A;  1DPU A;  3G71 I;  2DA1 A;  4A5N A;  1SFK A;  1G3T A;  2HVR A;  2LR8 A;  2QEN A;  3OWT A;  4ZDL A;  2JA8 J;  4F52 A;  3HOU J;  5AIQ A;  5LFA A;  3WTZ A;  2YR2 A;  2M1B A;  2O5R A;  2FBK A;  2V1N A;  1BN5 A;  2GOX B;  3M1C A;  1RUO A;  5DS9 A;  1VQ8 I;  3W6V A;  3KLN A;  1TBX A;  2ECC A;  3VYS B;  4BNC A;  2NVX J;  5BQT A;  2JA5 J;  4OIR F;  2K9L A;  3CC2 I;  4U87 A;  2PI0 A;  3C2B A;  1U6G A;  3R61 A;  4KT5 C;  3E6B A;  3HIF A;  5JI6 A;  1UG0 A;  3L00 A;  1I6X A;  3JRB A;  2IVM A;  3SJM A;  1WJA A;  2VQG A;  5HOO A;  3JR9 A;  1R4N B;  1W4M A;  4HOB A;  5DD4 A;  4KMU X;  1BOB A;  2ME0 A;  3GVA A;  1X1C A;  3H92 A;  1DGW Y;  2XF6 A;  3EUH C;  1WVR A;  1XGM A;  2DK5 A;  1J2X A;  3CCS I;  2ZJQ F;  2F5D A;  1PP8 F;  2ZSH B;  4XNF A;  1Y39 A;  4MIM A;  1UG2 A;  3OYB A;  3TDU C;  2KQR A;  2AQF A;  2L7Z A;  2ZJR F;  4E7H A;  3S2H J;  3M4O J;  3F9K A;  1YRN B;  4JK1 X;  4ESJ A;  4L9N A;  3CO6 C;  1A04 A;  1HDD C;  2QA4 I;  5DDG A;  4YEL A;  4PJL A;  5J40 A;  4Y4R A;  3LSP A;  1QO0 D;  2DT6 A;  3NAR A;  2K7L A;  4CSW A;  4TV7 A;  3I4M J;  2A68 F;  3H9Q A;  3G6E I;  1EJ9 A;  5F64 A;  4HQM A;  2IA1 A;  1VTN C;  3O6B B;  2L0K A;  4KYW A;  2ZME C;  1XSD A;  1E2X A;  1K6Y A;  2DN0 A;  1Z6R A;  2OJE D;  3KZI C;  2TRT A;  1XGN A;  5IP9 J;  3HPG A;  1D3Y A;  3WGG A;  1XCV A;  3H5A A;  4A6E A;  2IJL A;  1ZAR A;  2R5Z B;  4FET A;  1SFE A;  1IN6 A;  3DTK A;  4HV5 A;  5D6E A;  4NNJ A;  3H3U A;  1ZK8 A;  1T95 A;  1B59 A;  1MMD A;  3D5S C;  3R60 A;  5IOZ A;  3L9F A;  4E7L A;  2NS7 A;  1SVL A;  1LDJ A;  2FU4 A;  3C1D A;  4ZTF A;  3A4C A;  3T8R A;  3GFL A;  1ZH5 A;  2ZXJ A;  3W6J B;  1S29 A;  2CV1 A;  2E7W A;  3K6G A;  1G59 A;  2Y2Z A;  3AG3 H;  2VON A;  2GA2 A;  4CZZ A;  3VOE A;  3HTU A;  2XHK A;  2P4W A;  1CGP A;  1ZRE A;  5EG0 A;  5J8C A;  4I99 C;  2VJJ A;  3Q9V A;  2HPM A;  4BH9 A;  2HNH A;  3L2Q A;  4M3G A;  1VQL I;  3HGG A;  2MLG A;  2MA3 A;  1DU6 A;  5HS7 A;  3PUB A;  2FA5 A;  4NHJ A;  2H8W A;  3J7A O;  2RV8 A;  1R5G A;  3LAJ A;  4IRH A;  4GO1 A;  2ISY A;  1ACI A;  1KU9 A;  4BDZ A;  1JT0 A;  3DCF A;  1WCM J;  1X19 A;  5JLW A;  5H6R A;  1XS9 A;  2X4H A;  1D5V A;  3BR6 A;  3CUQ C;  5F0C A;  4RGU A;  5CJ9 A;  2R3S A;  1ETO A;  3V7S A;  3SFI A;  3PJR A;  4XLP F;  4EQQ A;  4E7Z A;  4XLN F;  3MKZ A;  4F55 A;  3FK6 A;  2H09 A;  3PSI A;  3U1K A;  1NHA A;  2RAE A;  3OYE A;  4JX5 A;  3PNV A;  4HAM A;  2Y69 H;  1T6S A;  1XN7 A;  2NVQ J;  3IH3 A;  3Q9S A;  4BQN A;  1BOA A;  4KIB A;  2PJP A;  2K9Q A;  1ZYR F;  1TWA J;  2QQ8 A;  3ZQL A;  2XAG A;  3S3N A;  2DAO A;  1IN5 A;  1Z7U A;  3EET A;  9ANT A;  5TJJ A;  1EF4 A;  5E3L A;  2OC6 A;  1V3F A;  1TZL A;  2LYC A;  1XMA A;  1H88 C;  2HXO A;  2LY9 A;  2EPF A;  5DYM A;  2CU7 A;  4XMY A;  4KFC A;  3UNG C;  1Y56 A;  1MMA A;  4UVC A;  5D8K B;  4HRI A;  3AKZ A;  2XGE A;  1EA3 A;  1OCC H;  2JZY A;  3OR1 C;  1MBE A;  1ZTR A;  4DZJ A;  3BZK A;  1SFU A;  3CMM A;  1G3Y A;  5CLS A;  4HBL A;  3E7L A;  3ABK H;  2FJ1 A;  3COA C;  4HDV A;  1VI0 A;  1OCP A;  4BBR J;  3MCZ A;  1K78 B;  1TQI A;  3TW7 A;  1X58 A;  1J7K A;  2Y0S A;  1HKT A;  2RDP A;  4HNV A;  5CVU A;  3V8L A;  1IN4 A;  1O3R A;  1ERD A;  1U5T C;  3TBI A;  3B6A A;  3GXO A;  3S3O A;  2DA7 A;  1V5G A;  2JUG A;  2RNG A;  1ULY A;  5JVT A;  5IPA A;  1N25 A;  3TL4 X;  2EFQ A;  3R6S A;  3F21 A;  1GXQ A;  4N4O B;  1BBY A;  2MSY A;  3LQR A;  4U0V A;  1T39 A;  5EYR A;  2R7V A;  2K4J A;  2Z99 A;  5HNH A;  3S15 J;  1OMI A;  2FRH A;  1Z6T A;  1KU2 A;  1A36 A;  4KUM A;  1U78 A;  2V9K A;  3DPL C;  2NOJ B;  3MKY B;  4HQE A;  2QVO A;  2VT2 A;  1FBS A;  4CH7 A;  5LEJ A;  3MD2 A;  2Z3Y A;  2X0L A;  3CCU I;  3WOD F;  4D7N A;  5FRM A;  2E34 A;  3RPU D;  3OIQ A;  4A3L J;  4Y17 A;  4XL9 A;  2VUM J;  1I6H J;  4CYD A;  1TNT A;  3EYY A;  2XF7 A;  2OF7 A;  1A31 A;  1POG A;  2HFH A;  2LRE A;  1FP1 D;  5FD6 A;  4ZYE A;  5IP7 J;  1JGG A;  2GLO A;  2VOO A;  1HW1 A;  3KP4 A;  1IRX A;  5IY5 H;  2LD5 A;  4A93 J;  1ZGJ A;  1MH3 A;  1D8J A;  2DFE A;  1QNT A;  5EZG A;  4HNT A;  3UKG A;  3PFY A;  2E2I J;  2R7T A;  2KJB A;  1FX7 A;  2IGO A;  4I0A A;  2WY7 Q;  4XN0 A;  1V54 H;  4P1W A;  2XVC A;  5BS6 A;  1D5Y A;  3PNY A;  4XOR A;  3KEY A;  2RNJ A;  3HRU A;  2E5Z A;  1B72 A;  1AA7 A;  2EIM H;  3DFG A;  2MYS A;  4EEF G;  1RIO H;  2X85 A;  4S05 A;  1WJE A;  5E18 F;  1YG2 A;  5L3G A;  2KZV A;  3Q0W A;  3P7N A;  5DUK A;  4M3D A;  3O3K A;  4QTR A;  4A6D A;  3CCE I;  3TOB A;  2MH2 A;  3K4C A;  2Q1Z B;  3F8N A;  1FLI A;  1F9N A;  3QPS A;  1SC7 A;  1B1B A;  4EJW A;  1FSH A;  2XAQ A;  2IEK A;  1GHC A;  1TW2 A;  1ETX A;  1WJB A;  4FIS A;  4CO8 A;  3Q3S A;  1DUX C;  2DOA A;  5DV5 A;  2NRA C;  1HF0 A;  4M73 A;  2F4O B;  5FLX Z;  1W7P B;  4CCM A;  1FMV A;  1H8A C;  4X0G A;  2CYY A;  1QVT A;  1S6L A;  1GDT A;  4CDG A;  1X1B A;  2QF7 A;  3SHF A;  4C2M J;  2KL4 A;  4ZC3 A;  4PJN A;  3QPH A;  2QWW A;  2L7M P;  3DBR B;  2HTS A;  1R6R A;  1XMX A;  2OBP A;  4ETS A;  4WXH A;  1XG1 A;  3JRD A;  4LG0 B;  1TC3 C;  1N77 A;  2I10 A;  4FT8 A;  2ZSI B;  2IS2 A;  1LVK A;  3L2V A;  5GPA A;  3PIP F;  3SYT A;  4B09 A;  1R36 A;  1TWF J;  2J5O A;  1ORK A;  4I76 A;  1T33 A;  2A07 F;  2KKO A;  2K3F A;  1IAW A;  2KPM A;  1BI2 A;  2IS6 A;  4KJZ A;  5F0F A;  3WGH A;  2TCT A;  3E5Q A;  2X1D A;  2DU9 A;  1WJF A;  2VLA A;  1FIP A;  4XRF A;  2JVH A;  3I55 I;  2XAS A;  1O3Q A;  4KIF A;  4Z6Y A;  3SEZ A;  2K85 A;  3WU0 A;  5ILV A;  3M8F A;  3MZ8 A;  3HSR A;  5CVR A;  1AWC A;  3F3X A;  3KP3 A;  2F5E A;  1SEU A;  1OYW A;  4C9Y A;  4BAY A;  2DMN A;  3WU2 C;  2LY2 A;  4KN7 X;  2DTZ A;  4L9V A;  3E6D A;  1N75 A;  1PYV A;  3VOD A;  3IKV A;  4BHB A;  5FJ8 J;  3OYM A;  2CW0 F;  2BV6 A;  3BR5 A;  2M7B A;  2R7F A;  4BHP A;  2LF7 A;  1VQK I;  3CJT B;  4RAZ A;  2XSJ C;  3P9C A;  1MH4 A;  3AFH A;  3PIO F;  1R22 A;  3GLL A;  2BY1 A;  3DKW A;  4BY1 J;  4L0Y B;  4GYG A;  5KAI C;  4N4N B;  5M3F J;  1YHQ I;  5E1W A;  1N78 A;  1A6Q A;  4AIK A;  3S16 J;  2EK5 A;  3BP8 A;  3I53 A;  4G7Z F;  5IYB J;  3GO5 A;  3MMY B;  3S93 A;  1Z9C A;  4KA4 A;  1HW5 A;  3U21 A;  5F0H A;  3QU6 A;  5IYD J;  2MLK A;  1IV6 A;  2JJ7 A;  4CCO A;  3BG6 A;  3BCA A;  2K02 A;  5ILU A;  2A5W A;  3EUH A;  4J19 A;  3G2B A;  1FIA A;  1AKH A;  4V19 K;  2RN7 A;  4OMY A;  3Q5F A;  1DP7 P;  4HNU A;  3DLL F;  3VYR B;  3WU1 B;  3MAJ A;  1SMT A;  2KJC A;  3JAM Z;  4GDF A;  3ABL H;  2LF8 A;  2W24 A;  2F48 A;  4MHG A;  3VSL A;  1BA5 A;  3D0S A;  4DJA A;  1XGS A;  5JR3 A;  1AU7 A;  4NDL A;  3MVP A;  3IUO A;  3B02 A;  1YW8 A;  2QUF A;  3QP5 A;  2FD5 A;  1YI2 I;  1FWZ A;  4L5E A;  2W7N A;  2NAZ A;  4I2O A;  1GVJ A;  3FHZ A;  3K4N A;  1P7I A;  2EJR A;  2DK8 A;  1OIS A;  4KIC A;  4DBQ A;  4AIJ A;  1ZG5 A;  2MAB A;  3K2Z A;  3TW6 A;  1OJL A;  4S04 A;  3GEZ A;  1Z1D A;  5E20 A;  1VQP I;  1YIT I;  4XN3 A;  1BC7 C;  2Y30 A;  3P9I A;  3DXJ F;  2RRE A;  3A1Y A;  2LK2 A;  2LOO A;  3OMY A;  1X3U A;  2X1C A;  4IKF A;  1ZRD A;  1KYW A;  3OYN A;  1BR2 A;  3I5U A;  4CCK A;  3HB9 A;  3K0L A;  1IN7 A;  2IAI A;  3GFI A;  2GM4 A;  1O7F A;  2CFX A;  2E36 A;  2R5Z A;  2CV2 A;  3M7G A;  3OL3 A;  4IHY A;  3CTA A;  5JFR A;  2OTJ I;  3TP3 A;  5HNF A;  2VKD A;  2CQQ A;  1B72 B;  2XPW A;  4XKC A;  3R4K A;  5K7H A;  1BM9 A;  2V7F A;  3BDD A;  4A0X A;  4IRG A;  4M6Y A;  3RPU A;  3FF5 A;  4NQW A;  4KN4 X;  3FXJ A;  2HOT A;  1W0U A;  3NRV A;  2CUF A;  4MEX F;  3JSO A;  2V9V A;  3L2R A;  3ABT A;  1KYZ A;  2X48 A;  3K7A J;  4MGR A;  2H27 A;  2KIF A;  1MMG A;  2J5P A;  2ZXW H;  3ZQ7 A;  4RLQ A;  4IOC F;  3FKJ A;  5CYV A;  4A69 C;  3RKQ A;  1F5T A;  3MZH A;  3CDH A;  1WI3 A;  2QSH X;  1F1Z A;  2XAF A;  3M1E A;  5F08 A;  3W2A A;  3C2H A;  3CUQ A;  1ITY A;  2Y9Z A;  2K27 A;  4NC8 A;  1HDP A;  4I6Z A;  5C4X J;  2FQ4 A;  1MBH A;  1RI7 A;  2P7C B;  2VAS A;  2HYG D;  5E79 C;  2IBD A;  3REO A;  4A5M A;  3DEW A;  4RDU A;  1QBJ A;  1Y1V J;  1HXD A;  1EH8 A;  5EDN A;  3LOC A;  3C7J A;  2FOK A;  5H20 A;  1T08 B;  5HLT A;  2MGQ A;  1SAU A;  3TMO A;  4EAT A;  3BWG A;  3DP7 A;  4F3Q A;  5LGU A;  4U7B A;  3OYG A;  5D5V B;  4ZYA A;  2VBX A;  3BZC A;  4WX9 A;  4RGX A;  4GRI A;  2HPI A;  2CW8 A;  3TED A;  3OYK A;  3KYC B;  3W2V A;  4B1R A;  1Y1W J;  3SFZ A;  2BBY A;  2DXI A;  4W1U A;  3AL0 B;  2PBI A;  3GBG A;  2RKH A;  1IF1 A;  1MNM C;  3PM1 A;  4HX7 A;  5CQE A;  2GZW A;  1P4X A;  3HRM A;  3V7R A;  5ICC A;  5B3S H;  1MW7 A;  4B3X A;  3P9K A;  2JWT A;  3BRO A;  2B0L A;  4Q47 A;  3CUO A;  3IWF A;  2DA5 A;  2RQQ A;  2VXZ A;  3GZ5 A;  5LEK A;  2H6B A;  3FMR A;  2F4I A;  4M3E A;  3GTM J;  2M87 A;  3JRF A;  3S3M A;  2OU2 A;  2UXX A;  4QPQ A;  2CQX A;  2QKM B;  1V4R A;  2L02 A;  3CES A;  5E8I A;  1WJC A;  2BE5 F;  1W5S A;  4CIC A;  1A35 A;  5FB2 A;  3AG1 H;  3F6V A;  3VWB A;  2HKX A;  1U2W A;  2LY1 A;  2FE3 A;  4HG2 A;  4ESB A;  1IC8 A;  5CVJ A;  5L3E A;  4BYY A;  2LTP A;  5B5E C;  1U5T A;  1IRZ A;  4I7H A;  2E7X A;  3HL2 A;  3S32 A;  2DOE A;  3ASO H;  2PMH A;  2W57 A;  3C2G A;  5L3D A;  4HDU A;  1SD5 A;  1YS6 A;  4CXF A;  3LMM A;  2JT1 A;  3QYE A;  1VQM I;  1QVU A;  4IEJ A;  2DMU A;  3EQL F;  3ISP A;  5HLH A;  3M3Y J;  4XQF A;  4RAY A;  4RM3 A;  4EM1 A;  1GVD A;  2VIX A;  4OU0 A;  1HKQ A;  3ECH A;  4CCN A;  2IRF G;  2ZB9 A;  3F8C A;  2DLL A;  3E6M A;  3WE3 A;  3I64 A;  4RAF A;  3KP5 A;  5L3F A;  1E17 A;  2MBF A;  1WFX A;  1ETY A;  3HHG A;  3QOP A;  4UHT A;  2IS1 A;  1I1G A;  2FBH A;  5TIS C;  5D4S A;  5ED4 A;  1WWX A;  3WG7 H;  1AKH B;  5J4V A;  5CQG A;  3S1M J;  5GAH J;  1ZLJ A;  3FXO A;  3E5U A;  2KHM A;  3W6K B;  2E71 A;  1CF7 B;  2P8T A;  4BXU A;  1R5I D;  2X6O A;  2Q8K A;  4BXF A;  4EJT A;  1X1D A;  4BJ6 C;  2K4B A;  1BJZ A;  1FOK A;  3BJO A;  3RPQ A;  3CZ6 A;  3CLQ A;  2GXB A;  2VOD A;  2M8G X;  1FSE A;  1M1E B;  2E5N A;  3DEU A;  5BMZ A;  2ZXI A;  4MFD A;  1YIO A;  3FXM A;  4MTD A;  3KPH A;  3M8E A;  4KIG A;  1LE8 A;  2HTJ A;  3EPZ A;  5LRS A;  2KIQ A;  2QM3 A;  1AHD P;  3J7A Y;  1ZLK A;  2K9S A;  4YEJ A;  1R58 A;  2DA2 A;  5E17 F;  4ZDP A;  4B47 A;  1FC3 A;  4EVI A;  3F8M A;  3ROU A;  1IXC A;  3L2C A;  2DA6 A;  1YE9 A;  5E1Z B;  3HDD A;  1ENH A;  3GLX A;  4DGW B;  5D6F A;  3ERM A;  1R00 A;  1G4D A;  3LFU A;  3ZMT A;  3OOU A;  5J1U A;  3BR0 A;  5LGN A;  1B4A A;  1Z91 A;  3Q0V A;  4D7M A;  2DDA A;  2MD5 A;  2E2H J;  2M8E A;  3LSK A;  5FGM A;  3WTU C;  2KT0 A;  3V42 A;  4XRM A;  4RB2 C;  1XC5 A;  1HC8 A;  4PDK A;  1I39 A;  4AC0 A;  2HDW A;  3JRG A;  5E3M A;  2XKP A;  1IRF A;  1LUJ B;  1A5J A;  2M2E A;  6PAX A;  1QRY A;  2M3A A;  3I56 I;  2EA2 A;  2HR3 A;  4HV6 A;  1DP3 A;  1HW2 A;  2CJJ A;  2VE9 A;  3CCR I;  3PL8 A;  2P5L C;  1X1A A;  4N0B A;  1K7A A;  4NQW B;  5B1A H;  3HOY J;  2M4G A;  4RB0 A;  4M9X A;  5D4R A;  3QP6 A;  2X6X A;  2QQA A;  1RET A;  4UUT A;  3LSG A;  1FTT A;  2CQK A;  4Q4Z F;  3JTG A;  1W7P A;  5KCM A;  2PG4 A;  2W4S A;  2ME6 A;  2DA4 A;  2HU9 A;  2LDU A;  1OR7 A;  1LVA A;  5K7Z A;  3FXK A;  4FX0 A;  3CUQ B;  4MEY F;  1SD4 A;  3RKX A;  1RPW A;  2WC2 A;  4G12 A;  4PZJ A;  1UEL B;  4LG0 A;  2O8X A;  3O8G A;  2QGU A;  2DOD A;  4KNY A;  2HKO A;  1OCO H;  1QU3 A;  1VQO I;  1B6A A;  1PUE E;  3G73 A;  4I0B A;  3OS0 A;  3ZQI A;  1ZR2 A;  4YFK F;  4A2U A;  3IAM 2;  1Z05 A;  3RI4 A;  3BY6 A;  2NVY J;  2ECB A;  1YTY A;  1D0Y A;  2M0M A;  5LBQ A;  3BR1 A;  2A05 A;  5F27 A;  2JN6 A;  2LLK A;  3H3V K;  3ESW B;  2CUE A;  2D1H A;  3RCO A;  3OYI A;  4YIR X;  2ZBK A;  5FD5 A;  2MC3 A;  2VB6 A;  4HX8 A;  4E6K G;  1MBG A;  4XKB A;  5BPD A;  1KGS A;  3TOA A;  2R7U A;  4P5O A;  1NK2 P;  5KNL A;  4IOA F;  3FDY A;  2A6E F;  3NQO A;  2WAQ A;  4M9S A;  2R7R A;  4RB3 C;  1W36 D;  2H1K A;  3S2D J;  1ON1 A;  3ZQF A;  3LSR A;  3U2R A;  2JSP A;  4AWX B;  3OS1 A;  2YUS A;  2ELK A;  1JT6 A;  3OR2 C;  4LLG F;  4A3J J;  2V6E A;  2FML A;  3F23 A;  4EM0 B;  3IHU A;  5J47 A;  3S2W A;  5IOY A;  3OYF A;  4LIU A;  2ZJP F;  2VKV A;  4XOP A;  4XRS G;  3BQZ A;  1I3A A;  2QYO A;  1Z21 A;  3OSF A;  1YFH A;  2FOW A;  1OPC A;  2ISZ A;  1SAX A;  1YJN I;  1X1P A;  3QPT A;  2EB7 A;  2DMQ A;  1U5T B;  5GP9 A;  3JRE A;  2EIL H;  2L01 A;  4NC7 A;  2EIJ H;  3F0C A;  3FM5 A;  3ZQC A;  3LA3 A;  5J6X A;  3C3W A;  1KQ9 A;  2STW A;  1IDZ A;  2COM A;  1MMN A;  2M45 A;  1J59 A;  3HUG B;  3CF5 F;  1S5L C;  1LKX A;  1WH5 A;  2IW5 A;  4V2G A;  3CMA I;  1U9N A;  5C3E J;  2LBF A;  1O4X A;  3BTJ A;  4Y33 A;  3GZ6 A;  4BXX J;  4BGD A;  1E0E A;  4E7K A;  3E5X A;  2VBZ A;  1Y6I A;  3ZGK A;  3K4J A;  4ZTJ A;  2VPL A;  4GXO A;  1USS A;  3NAU A;  1SAN A;  4HW0 A;  5DM7 F;  1G2H A;  1D0Z A;  2L7F P;  2HQ5 A;  2L9V A;  1Z77 A;  1BR4 A;  4IPA A;  3T5X A;  2C6Y A;  1ODD A;  3H0D A;  2L7K A;  2JPC A;  5GTH C;  1B9N A;  1XDU A;  2A5Y B;  2CGP A;  3L7W A;  2NS8 A;  2IXS A;  3CJQ B;  1MDM A;  1ONV A;  3H9J A;  2I8D A;  4XKV A;  4DOZ A;  1JHF A;  2P0W A;  2F5C A;  4A3E J;  4GYI A;  2EZL A;  4C3H J;  3EDP A;  4I98 B;  3FXQ A;  2QQB A;  2QQ9 A;  3M9A A;  4BY7 J;  1I3Q J;  1T0F A;  3HOZ J;  4EV0 A;  3S1R J;  1OYY A;  2HWV A;  1SMY F;  2VBY A;  4XK4 A;  2QKL B;  4AID A;  3ZMD A;  5FLX K;  2V79 A;  5K5R A;  3G4S I;  3WG9 A;  1LB2 A;  4C2T A;  5DCM A;  1GUU A;  4HSR A;  2HXI A;  2DQR A;  2MD0 A;  3DBH B;  3HJE A;  3ZN1 A;  4AM3 A;  2FXA A;  3BR2 A;  1UHS A;  3LA2 A;  4AU7 A;  2M34 A;  1LE8 B;  5LHH A;  2VE8 A;  1XX5 A;  4L18 B;  3MWM A;  2GA1 A;  2EZH A;  3G1O A;  1JKP C;  4IX7 A;  1TTY A;  2PN6 A;  2XGD A;  5KK1 A;  3VFZ A;  1X3W B;  5GPC A;  1ZRC A;  3G1L A;  2L9R A;  3KE2 A;  1QHH D;  3S14 J;  4F92 B;  1RKT A;  4IRI A;  3HGY A;  1GV2 A;  2UXN A;  1HOM A;  2FSW A;  4BEH A;  3GWZ A;  1YX5 A;  4PGG A;  3ZN0 A;  2Y48 A;  4I01 A;  2W48 A;  2B9S A;  3CCQ I;  1LDK B;  1NTC A;  3KIO A;  3RZD J;  3OOP A;  3HSF A;  2L5Q A;  4OIO F;  1TWH J;  1VZ0 A;  2L2O A;  3O2P E;  4UXN A;  2OPT A;  3KX2 A;  3J80 Z;  1P4W A;  4KDP A;  4G7O F;  3DF8 A;  2GOM A;  2W85 A;  3L2W A;  1LJ9 A;  2R92 J;  5C4J J;  2JA7 J;  1ZAO A;  3GZN B;  3KP6 A;  3MEX A;  1FTZ A;  4M72 A;  2ZFU A;  2LMD A;  2ID6 A;  4HF0 A;  4R79 A;  4HLX A;  2VJ4 A;  1YX3 A;  2X51 A;  4B48 A;  5DD8 A;  5JHU A;  2QSG X;  1RUN A;  3OYJ A;  2VKE A;  1U9O A;  2FUG 2;  4M3B A;  2YU3 A;  1W0T A;  2Y0S N;  1QGP A;  2JUC A;  1D8K A;  4RA2 A;  2LC2 A;  2XRN A;  4G6D A;  4CZC A;  1R71 A;  5DTD A;  3IV5 A;  2EIK H;  4MQV A;  1MJA A;  2E1O A;  2V9P A;  5F1R A;  2BXZ A;  3BZ6 A;  4BQA A;  3NWT A;  3OYC A;  4UUS A;  1FZP B;  5J8F A;  1GLN A;  3HOT A;  2A61 A;  1PUF A;  2XC7 A;  1BIB A;  2M0C A;  2Y9Y A;  2XGX A;  1LEB A;  4NBQ A;  3M07 A;  3GFM A;  3I58 A;  1R7J A;  2XAU A;  1JUP A;  4DNC A;  2M5W A;  2R7Q A;  2G0E A;  1QPI A;  3AAF A;  1ETQ A;  3OYL A;  2ZJ2 A;  1IUF A;  2IA2 A;  4UV8 A;  1YS7 A;  3QRF F;  1D1C A;  2BW3 A;  3DLA A;  2XGC A;  3S17 J;  1J0R A;  3KYD B;  2NOG A;  3G1M A;  1V5E A;  4P55 A;  3V8K A;  2VC0 A;  3JAM K;  1S7E A;  1D1A A;  1W5T A;  5LRR A;  3IH2 A;  2V26 A;  1S72 I;  4LB5 A;  3QYB A;  4OOI A;  2LKS A;  5JVG F;  1UST A;  2R7D A;  3ULQ B;  4AIH A;  3CDL A;  4AYB A;  2P81 A;  2GIZ A;  3D5L A;  3H5N A;  2L9N A;  4XBF A;  2JA6 J;  2CV0 A;  1BW5 A;  2PLY A;  1K79 A;  2D5V A;  2KDO A;  4A3C J;  3FX3 A;  1WKM A;  2VQL A;  1NK3 P;  3NEU A;  1YW9 A;  2ZXH A;  5EEA A;  4KMF A;  1FPQ A;  1BI3 A;  1ZR4 A;  2NXN B;  4EM2 A;  1KON A;  1QHG A;  1Y8R B;  2KMU A;  5J1Y A;  1DPR A;  3QOE A;  4YIF A;  5HS8 A;  3CCL I;  1Q1H A;  3KFW X;  1UCR A;  2WB1 A;  5HDN A;  3I59 A;  5K5O A;  1J75 A;  3RYP A;  2WBM A;  2RGV A;  1JTY A;  3WHB A;  3WTT C;  4MTE A;  1T2K A;  4A3D J;  3A03 A;  4UNO A;  3KET A;  3BG5 A;  2LBF B;  1B9M A;  4EGY A;  3KEQ A;  1ETK A;  2V6C A;  3FXR A;  5F04 A;  4S0H B;  1QPM A;  5DEQ A;  4OWR B;  3LAP A;  4A3I J;  3RDI A;  4ABZ A;  2AS5 F;  4ZZD A;  3ZOB A;  3HKZ A;  3TP0 A;  4D5C A;  4YFN F;  3GME A;  4PJJ A;  1FBQ A;  5FFX A;  3BTL A;  2OZU A;  1G6N A;  1CF7 A;  2V1X A;  1JXS A;  2DFI A;  5FLV A;  4FAS D;  4A3K J;  4AVZ A;  1JJ6 C;  1CQT A;  2CO5 A;  2HQN A;  1MDM B;  5EZH A;  3CCJ I;  1P2F A;  5FLM J;  1QA6 A;  1UB9 A;  5B66 C;  3HHH A;  2MW8 A;  1UZC A;  3GF2 A;  3H1C A;  4OMZ A;  3ZR8 X;  4PSW A;  1JTX A;  2STT A;  1A6I A;  3I54 A;  5CKT A;  2CUZ A;  2JRT A;  2ZME A;  3CP2 A;  1UHW A;  1XGO A;  1JKQ C;  2WAF A;  1V55 H;  3IWZ A;  2A6H F;  3SDG A;  5A2Q Z;  2CWE A;  1ZGW A;  2E1M C;  3E3V A;  4GGG A;  2KRF A;  5DCM B;  4AD9 A;  5HDK A;  3S1N J;  3TQN A;  1E3H A;  2FQ3 A;  1ZEL A;  5L3C A;  2Y0M A;  5FKK A;  4R1H A;  3ASN H;  2CQ7 A;  2PJR A;  3N05 A;  1ETV A;  1OQY A;  5K5Q A;  3IKT A;  3FMQ A;  1R1V A;  5K1Y A;  3WTW C;  4JYK A;  3RQ4 A;  4PJM A;  5GTI C;  5E1X A;  5FKN A;  2DT5 A;  1PJR A;  1HKS A;  3GFJ A;  3LFK A;  2G9W A;  2DJN A;  1Z0X A;  2XDV A;  3F8B A;  2HQA A;  2D45 A;  1JKR C;  2CSO A;  4BEH B;  3IRQ A;  1VND A;  5K7F A;  1U8R A;  1LEA A;  3LNQ A;  3P5J A;  4G6T B;  3HSE A;  2O03 A;  1BC8 C;  2ADU A;  3O8H A;  1XMK A;  1IJW C;  2XB5 A;  5F6F A;  2KRC A;  4Y52 J;  4BAC A;  2XB0 X;  1EH7 A;  2VKH A;  3CLO A;  1FOY A;  3ZP5 A;  3VSK A;  3FK7 A;  4MNU A;  3QU3 A;  1PDN C;  1HLV A;  4G6Q A;  3K1M A;  4BQQ A;  2VQH A;  2WB1 N;  1JE8 A;  2DO7 A;  4ZYD A;  1VQ5 I;  2CG4 A;  1HBX G;  4G7H F;  4WK8 F;  3CJR B;  1MBJ A;  3SZT A;  3FMS A;  3MFK A;  3IC7 A;  2GAU A;  4N9H A;  2NNY A;  1K61 A;  2VL8 A;  2B63 J;  2IS4 A;  1FYK A;  2ELJ A;  5TGT A;  3RKW A;  5D5W B;  2O0Y A;  2V1D A;  5E8G A;  4U88 A;  4XSX F;  2W82 A;  3CCM I;  2IT0 A;  2OV7 A;  3KCC A;  5J4Y A;  3I71 A;  1LFB A;  2VXD A;  1LPQ A;  5LD2 C;  4WCG A;  2XRL A;  3N97 A;  4G94 A;  2PEX A;  4XSZ F;  3BTC A;  4NUB A;  4P9U A;  2NVT J;  2EFN A;  2L4M A;  4W97 A;  4R8H A;  4UUS B;  5J3L A;  1PUF B;  2DYS H;  3BJ6 A;  3KEO A;  1P92 A;  2ESH A;  2ZC2 A;  4QIW N;  1Z67 A;  3CME I;  2HYJ A;  1JUS A;  2IA0 A;  4M3F A;  2BXY A;  3PFI A;  3K70 D;  1VQ6 I;  5LHI A;  3K10 A;  1D0X A;  2V1U A;  4HST A;  4FX4 A;  2H6C A;  1XB4 A;  2XKO A;  4DYR A;  4ZYG A;  1YLF A;  4OAY A;  5C44 J;  2BW3 B;  1Z3Y A;  2N8G A;  4BKX A;  3IL2 A;  2ZFW A;  4HX4 A;  4DYC A;  3JRC A;  2HZD A;  3A0B C;  2VOP A;  2X6W A;  3GCM A;  1SVO A;  1H9G A;  1T98 A;  1GT0 C;  4IJA A;  4YG2 F;  2QZ8 A;  2H1L A;  2E1N A;  3VYT B;  5H6Q A;  3DBL B;  1L0O C;  3HOV J;  2AQE A;  3GX4 X;  3BC8 A;  3LSI A;  2OCE A;  5FKM A;  1H9T A;  2P5K A;  4UUV A;  3DEE A;  2W84 A;  3FIS A;  4IQ4 A;  4HLY A;  3SEQ A;  4PJ0 C;  3ZMZ A;  4LK1 F;  4J01 A;  1WI9 A;  2NYX A;  4LG3 A;  2BGC A;  3RIR A;  1F4K A;  3AL0 C;  3CQZ J;  3DPT A;  2HS5 A;  2MFZ A;  3HUG A;  3F8F A;  2OZ6 A;  3K1P A;  3HTS B;  3B73 A;  5B1B H;  2IGK A;  4C2U A;  1S9H A;  3ONQ A;  3WTX C;  1I27 A;  5AIP A;  3ERE D;  5EJC A;  4MO7 A;  4H0E A;  4HYE A;  1EKE A;  1JUM A;  1W5C C;  2OD5 A;  5JLX A;  2F6C A;  4OAZ A;  3I59 B;  2OA4 A;  3BPX A;  1FJL A;  2XRO A;  3JRH A;  4HZF A;  2LG4 A;  3KZY A;  4NC6 A;  5KAF C;  4LIV A;  5D8L B;  1VQN I;  3F6O A;  4IQJ A;  2O6G E;  2UUZ A;  2BY0 A;  5FFZ A;  3A02 A;  2XSD C;  1UHM A;  4ASN A;  1DU0 A;  1S7O A;  4BUP A;  2PMU A;  4L5J A;  4F93 B;  2O9L A;  4PGH A;  1VFC A;  4U0Y A;  2EZI A;  4PCQ A;  3RTR A;  4A3F J;  1RES A;  2HGC A;  2FMY A;  2X1E A;  3LL7 A;  1OFC X;  2CS3 A;  2ZO4 A;  3F72 A;  2XPV A;  1YQA A;  5IP6 A;  2K86 A;  3GUD A;  2HOS A;  3V4G A;  3C18 A;  1W36 C;  4D0P A;  3BG3 A;  2HOA A;  4JX4 A;  1LDD A;  2DA3 A;  3S1Q J;  3DPU A;  2VQC A;  3IAS 2;  3LSH A;  3L09 A;  1MBK A;  2HZT A;  1TP4 A;  1O7L A;  2DT7 B;  5EEG A;  4RS8 A;  4A3M J;  1MSE C;  4EJV A;  4X1E A;  5D5U B;  4XOT A;  2ZME B;  1L3L A;  2MC4 A;  1FEX A;  5FKO A;  5D5X B;  1WQ2 A;  3IH4 A;  4I09 A;  4HF1 A;  3FZV A;  2OCC H;  3ZXS A;  4ZYH A;  4UVB A;  4OIQ F;  1O57 A;  4B3A A;  4ENJ A;  3CD6 I;  2L4A A;  2PJR B;  1HST A;  2KIU A;  1MIJ A;  2NNN A;  1H0M A;  2OQR A;  2ESN A;  3SZG A;  2YS9 A;  3LQQ A;  4DBR A;  1YOV B;  4LJZ F;  3CCY A;  4E4H A;  4II3 A;  3A2K A;  1R4M B;  1WH7 A;  2DYR H;  2PX9 A;  1R5H A;  1P7J A;  2DDB A;  2JMW A;  3B6C A;  3EYI A;  3R0J A;  5CVV A;  1O3S A;  3QWL A;  3HOX J;  4N9I A;  1VQ4 I;  3KZZ A;  2GIV A;  3ZCO A;  3BPV A;  4FE7 A;  3TKY A;  3U1D A;  2XIG A;  2OQG A;  1Y8Q B;  1U3E M;  1X4O A;  1MSF C;  4DIQ A;  3HPH A;  1AOY A;  3RYR A;  2DTR A;  1IN8 A;  5DCF A;  3WTY C;  4Y7N J;  4C30 A;  3ZQG A;  2HVQ A;  4RGR A;  3G3Z A;  2CW7 A;  4LOC A;  1BI0 A;  1IV8 A;  4ANJ A;  1YYV A;  3DU5 A;  4UVA A;  4E7J A;  2ACJ A;  3CF2 A;  2L54 A;  4L9T A;  3GTP J;  4H4K C;  3HOS A;  2Y75 A;  3QAH A;  4I02 A;  3JCU C;  2D1V A;  1SFO J;  1P4A A;  4ESF A;  2QBY A;  4O5V A;  5IYC J;  1F43 A;  4UV9 A;  1IXS B;  4EGZ A;  3H5R A;  3K1N A;  3RZO J;  3CJN A;  2ZNY A;  3TO6 A;  2BVM A;  2GQQ A;  4YII A;  1UJ8 A;  5CPR B;  4BQO A;  1WHU A;  3SDB A;  2OAZ A;  5TRD A;  2F5V A;  3N4M A;  1P6R A;  1R9T J;  2BHY A;  1XCB A;  3TGN A;  2LKX A;  4L0Z B;  3GW2 A;  1TT0 A;  1TLH B;  2VPR A;  2XAJ A;  4E7I A;  4A12 A;  4CUG A;  1Z3X A;  5DUI A;  2FX0 A;  1WZ2 A;  1T38 A;  2K3P A;  2JK3 A;  2LFB A;  3A01 A;  3OSG A;  3K69 A;  2JA2 A;  3FHN A;  2L9S A;  5GAE J;  2WAD A;  4O3M A;  3H3Z A;  4IHT A;  4B4C A;  2AXT C;  4IHX A;  3HOW J;  3FXU A;  2I5U A;  2YX4 A;  1TWG J;  2GWR A;  2R7Z J;  1EH6 A;  2XUB A;  2KRH A;  1GV5 A;  2P5V A;  5FO5 A;  1FMW A;  2OTL I;  3ELK A;  4MFE A;  2F2E A;  3BG9 A;  4LD5 A;  2VBW A;  2R7W A;  1WRJ A;  3WTV C;  4GCV A;  2JVG A;  2EBI A;  3CC7 I;  2LVS A;  4G8X A;  4F91 B;  1VQ9 I;  4XLE A;  4XR6 A;  2HDC A;  1RNL A;  1LFP A;  2MG4 A;  3QPL A;  2DMT A;  2DI3 A;  2DQL A;  2YPR A;  5GAG J;  1IG7 A;  2O61 A;  2GXA A;  2VT3 A;  1IUY A;  3UR3 C;  2EFW A;  1PVE A;  2LKP A;  3I3L A;  5EF6 A;  1HSJ A;  1S8N A;  1OCR H;  5M5X J;  4RGS A;  4RLF A;  2LNB A;  2KIM A;  4FTH A;  1J09 A;  2O7O A;  4XLH A;  4A3B J;  5LHG A;  2QCO A;  3KP2 A;  5FRO A;  4A0Y A;  2QLZ A;  2Z2S B;  1FNN A;  3ZMU A;  5IT3 A;  3A0H C;  3OYH A;  3T0Y A;  1FP2 A;  3J80 K;  4XM3 A;  4LK0 F;  1WJD A;  1E3P A;  4A3G J;  4JP0 A;  4CA0 A;  2XAH A;  1XSV A;  1QZE A;  1K4T A;  4CCJ A;  2R5Y A;  3R0A A;  2DFH A;  3BOQ A;  2ETH A;  2UV1 A;  1QZY A;  2Q2E A;  2VI6 A;  1RKW A;  2WTE A;  3L1P A;  4BE2 A;  4Q5S F;  2O8K A;  2IGN A;  2NS0 A;  4DQ2 A;  4ENN A;  1DDN A;  4ZJZ A;  3DU6 A;  4LIT A;  2Z33 A;  2EZK A;  2BY3 A;  2R7X A;  3BJA A;  4U0W A;  2WWY A;  3RSN A;  3OS2 A;  2KDZ A;  2XV4 S;  3ML6 A;  3U9G A;  1XPX A;  1TQP A;  3DWL E;  5EEH A;  1BW6 A;  4ZDO A;  5BOX A;  3NWS A;  2Y31 A;  2K40 A;  4CYC A;  3L2U A;  4D1Q A;  3S8P A;  3DKX A;  4M6X A;  1Y0U A;  4XON A;  2E60 A;  2F5F A;  3GTQ J;  1E3O C;  2JRM A;  1EV7 A;  1XSX A;  2KP6 A;  2RVC A;  3WGI A;  5HS9 A;  5KVR A;  2CMP A;  3GTK J;  2L3D A;  2K5C A;  2NVU B;  4WXC A;  1U0J A;  2A3S A;  2GXG A;  2Q0O A;  2W00 A;  2PFB A;  4O6J A;  4WWC A;  2KFD A;  3I9V 2;  2WAQ N;  2BYV E;  4LGW A;  3VEP A;  4DW6 A;  3WTS C;  1JHH A;  1ZG1 A;  1ZRF A;  3EUK L;  4D5F A;  5HLI A;  3ZMS A;  3CDI A;  3LST A;  2WY8 Q;  4XRS A;  4V2F A;  5BNG A;  1ZQ3 P;  3H9G A;  3M8J A;  3TO9 A;  3HC7 A;  4Y3O A;  2X9D A;  5ERI A;  2VC1 A;  5M5Y J;  4IXA A;  4B8X A;  1XDS A;  2DPD A;  2R7S A;  2BHZ A;  2EV0 A;  3D5R C;  3SQN A;  4RMN A;  1MMS A;  3LSJ A;  1WJ5 A;  3HRT A;  2HOE A;  5CVI A;  1FT9 A;  4XLF A;  3OL4 A;  3H36 A;  2WV0 A;  2CFO A;  2XF5 A;  4EJU A;  4PSX A;  3J81 K;  1J9I A;  3HYI A;  2HYF A;  2PMZ A;  3I4N J;  4JBA A;  1FYM A;  2DCE A;  2EV6 A;  1W1W E;  4LMY A;  1IRG A;  3OIO A;  4QSH A;  3JW4 A;  3BG7 A;  4L5I A;  1OCT C;  2M30 A;  2JQ7 A;  2FF4 A;  5M3M J;  2H8R A;  4KIT B;  5BPI A;  2FEZ A;  4BHC A;  1WSU A;  4X6A J;  4BS9 A;  2JTV A;  3GTL J;  1OYI A;  2VJ5 A;  3PO2 J;  1JGS A;  2ID3 A;  2W25 A;  1TL8 A;  5L3B A;  2YSR A;  4HA8 A;  4XIC A;  2F4M B;  1MJB A;  4P96 A;  4QWQ A;  4EMS A;  4OIP F;  2K9M A;  4E70 A;  5HLG A;  1NG7 A;  3ZRG A;  2QBY B;  5DM6 F;  4BE0 A;  1D1B A;  4HF2 A;  4ITV A;  2D2W A;  3MKW B;  3IRR A;  1S7A A;  1ZHF A;  4QPO A;  2WAE A;  2Z9O A;  2DJI A;  4C3I J;  2X6Y A;  4F7Z A;  2BEO A;  3OIP A;  2B7E A;  1JI8 A;  1TQM A;  3OY9 A;  1KA8 A;  2BOL A;  3CO7 C;  5EG0 B;  3HXL A;  4BJ5 C;  1TWC J;  4ON0 A;  1TW3 A;  1K83 J;  5EGO A;  2FNA A;  1WGX A;  2O3F A;  4J00 A;  4NB5 A;  2BZT A;  2ELH A;  1IGN A;  3WE2 A;  1U8B A;  2E1C A;  1G8X A;  2Z1D A;  1QQI A;  3A01 B;  4XLC A;  2IPQ X;  3AG4 H;  3J81 Z;  1FBU A;  2E35 A;  1LQ1 A;  1YW7 A;  1OR7 C;  2CH0 A;  3PSF A;  4FQG A;  2IP2 A;  3Q0U A;  1G3S A;  1NG6 A;  2DFF A;  3QYF A;  1C0W A;  4PUS A;  3RKY A;  1F36 A;  2YU9 J;  1FY7 A;  3K4L A;  1ZGA A;  4FCY A;  3OYD A;  2E19 A;  5A2Q K;  1Y0N A;  1BR1 A;  2MH9 A;  3CC4 I;  3ABM H;  4YFX F;  1PP7 U;  1IXR C;  3VDX A;  1XD7 A;  1X3Z B;  2HI3 A;  4B44 A;  3EUA A;  4PK4 A;  1ZKG A;  2EH3 A;  3JRI A;  5HOD A;  1S3J A;  1T8I A;  1ON2 A;  1P9Q C;  1B8I A;  4L9J A;  2ZKZ A;  2LRD A;  1HA8 A;  3RQI A;  3J7Z I;  2HDD A;  2EQR A;  1UAA A;  1OKR A;  4EJO A;  1BL0 A;  4CHU A;  4IHW A;  4M9Z A;  2HVS A;  1J5Y A;  2M4K A;  4C3J J;  2DOF A;  1APL C;  2W1O A;  2HEO A;  5ICE A;  3FIW A;  2PMZ N;  3SZP A;  4QLC U;  1YO5 C;  3JTH A;  3TO7 A;  3IP4 B;  1SVM A;  1NH3 A;  1HCR A;  4CGZ A;  5FKL A;  3H35 A;  1MNE A;  2FNP A;  4CCL A;  1IO2 A;  1GXP A;  3FBI B;  5H2F C;  4AUX A;  3K70 C;  1TNS A;  4LLL A;  1QZZ A;  3I0T A;  5E3O A;  3GTJ J;  4M6V A;  4JOM A;  3V8J A;  1MJ9 A;  4YRV A;  4IL6 C;  3GTG J;  1YJW I;  3DTE A;  1X2N A;  2R5Y B;  5F1J A;  3VYU B;  1SD6 A;  4KT6 A;  2E1M B;  2DPU A;  3W2W A;  2Q2E B;  1DGR M;  4WF2 A;  3PQJ A;  4ZZL A;  3T1B A;  3F22 A;  2LH9 A;  5LLQ A;  4LFU A;  3E6C C;  5ICG A;  5M5W J;  4BJT A;  2A6T A;  1FYL A;  1I50 J;  1ZG3 A;  2P7V B;  2EFO A;  2RC4 A;  3KP7 A;  4M74 A;  4RM2 A;  3X2Q H;  2BVL A;  1LFU P;  3V7C A;  3GYH X;  4CYC B;  1REP C;  2KLO A;  1ZN2 A;  1UMQ A;  2EA4 A;  4JX6 A;  1OCZ H;  3DV8 A;  2M7A A;  3MZY A;  4MQ9 F;  1MKM A;  3TDZ C;  3VB2 A;  4RBO A;  2R0Q C;  2QEX I;  3K2A A;  3WHC A;  1KQ8 A;  2EIN H;  5HVQ C;  4D9J A;  1WPK A;  3K4K A;  1JJ8 C;  4BDY A;  2V4J C;  1YRN A;  3I4P A;  1SFX A;  2XPU A;  1R1U A;  1RC9 A;  5IT9 K;  1DQU A;  4AYB N;  2E2J J;  3SXY A;  1VF9 A;  3DTI A;  3LSM A;  5FRN A;  1RRJ A;  1Q1V A;  4UB6 C;  3AG2 H;  1BI1 A;  2HQR A;  5E3N A;  1V5F A;  2EFP A;  2KIS A;  1W7P D;  4IO9 F;  5LGT A;  4U7D A;  2CQN A;  1BIA A;  4BL0 B;  3PQK A;  2COB A;  4B43 A;  2TDX A;  1HQC A;  1MGT A;  1T0F C;  1BJA A;  3JRA A;  1R1T A;  2EWN A;  3VPR A;  1VQ7 I;  2Z5U A;  1K6O A;  4BU2 A;  4Y15 A;  3HBL A;  1I5Z A;  3PUF A;  4WXD A;  2EV5 A;  3LA7 A;  2CUJ A;  1RR7 A;  5J1R A;  1MD0 A;  2G7H A;  2AXL A;  4M71 A;  3H0G J;  4BE1 A;  1KU7 A;  5KHD A;  4GFB A;  1OLT A;  1FOW A;  1IDY A;  3ZMV A;  3PNT A;  4HPQ A;  3QQA A;  1RR8 C;  3BTI A;  4XID A;  4Y13 A;  2ZCW A;  3CP8 A;  4IVN A;  3KYL A;  2K9N A;  3ABU A;  1JKO C;  2ZNZ A;  4MLO A;  2DMP A;  4II2 A;  2P6S A;  2QSF X;  3HKZ N;  3HRS A;  4LB6 B;  2P6T A;  4AVP A;  2A69 F;  2KZG A;  3FBN B;  3FM3 A;  2WV1 A;  3E97 A;  3KLO A;  5ICF A;  4OIN F;  2R93 J;  3OV8 A;  2JSC A;  2UZK A;  2LP0 A;  4BBS J;  1T56 A;  4KIS A;  3BCB A;  2LSO A;  4IHV A;  1X4P A;  1FOX A;  2H94 A;  3BR3 A;  1KZH A;  2AO9 A;  1X2M A;  2FBI A;  3LWF A;  1G3W A;  2WA0 A;  2M9H A;  4HEA 2;  3J7Y J;  5IT9 Z;  4DZP A;  4E7S A;  3HG9 A;  1R49 A;  3FKI J;  3CCV I;  4IZZ A;  1I1S A;  1R23 A;  4FE4 A;  1Z7L A;  3K4B A;  1O3T A;  1MZB A;  3DQV C;  3ZQH A;  4XLA A;  2DW4 A;  2G7U A;  4G9Y A; 
#chains in the Genus database with same CATH homology
 5B1B H;  3ABK H;  2DYS H;  1V55 H;  3WG7 H;  3X2Q H;  3AG3 H;  3AG1 H;  3ABL H;  3AG4 H;  3AG2 H;  5IY5 H;  2DYR H;  5B3S H;  1OCR H;  2EIK H;  3ASN H;  1OCZ H;  2OCC H;  1V54 H;  2Y69 H;  3ASO H;  3ABM H;  5B1A H;  1OCC H;  1OCO H;  2ZXW H;  2EIN H;  2EIL H;  2EIJ H;  2EIM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...