2HZTA

Crystal structure of a putative hth-type transcriptional regulator ytcd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
95
Chain Sequence
MSLVEATLEVIGGKWKVILHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLAWGANHINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative HTH-type transcription regulator ytcD
rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords Putative HTH-type transcriptional regulator ytcD
total genus 23
structure length 95
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hztA00
1MDMB 3BROA 3V7CA 1YFHA 1Q1HA 4BNCA 2IA0A 4ZYDA 2FF4A 4XSXF 2VBZA 4WXHA 3DEUA 2Z99A 4WF2A 1HSTA 4KA4A 3VB2A 3EYYA 2XIGA 1F1ZA 1YLFA 3L2CA 1O3SA 1G3WA 2XUBA 3DFGA 3F22A 2A3SA 3HIFA 2QQAA 3ZMDA 2GXBA 1BBYA 3I59B 1R5GA 4HV6A 3IKTA 2F5FA 3GUDA 2PMHA 3WODF 1T38A 3TOAA 2UXXA 3P9CA 2HQNA 3E97A 2ZCWA 1R5HA 4AIHA 3QP5A 1R7JA 4PGHA 2MBFA 3CUQC 4CXFA 1WQ2A 4MQ9F 3T1BA 3V8JA 1RUOA 4L9TA 2MA3A 3C3WA 3QU3A 3RKXA 2G9WA 1JHHA 3J81K 4I09A 2V9VA 4IF4A 5ICGA 2A07F 4RB0A 1R1UA 4RGUA 3Q9SA 1PUEE 2PJPA 3FMQA 1ZRCA 3KZZA 3W6JB 1IUYA 3MZHA 4LG0A 1B59A 1B9NA 2UXNA 3P9IA 5E1XA 5ICEA 4RB2C 1XB4A 4EQQA 3I59A 4U7DA 3P9KA 3O2PE 3WTYC 4YFKF 2Z3YA 3BP8A 5LRRA 4U88A 2WTEA 4G6QA 4IRIA 1OYWA 2B0LA 1KU3A 1T39A 3D5LA 5DUIA 2P6TA 5K5QA 1W4MA 3K0LA 4BHPA 1ZH5A 1P92A 3I71A 1HSJA 2VONA 1STZA 1V4RA 5CVVA 1LDJA 1Y0UA 4XLNF 3F6VA 3DPTA 3WTZA 3WU1B 1R1TA 1BIBA 1FLIA 3ABTA 1IN4A 2GZWA 3I0TA 1O57A 1UCRA 5ILVA 2ZO4A 1J2XA 3HOTA 2W25A 4HBLA 3WG9A 4KYWA 2J5OA 4LLNA 1HW1A 4O3MA 2QQ9A 3WTSC 3RPUA 4G7HF 1FPQA 2LDUA 2M87A 3M8EA 1U5TC 1XGSA 1Z6RA 2F5DA 1J7KA 4EGZA 3MWMA 4PDKA 3CUQB 4A6EA 4R8HA 5ED4A 2STTA 4WX9A 2CQKA 1FSEA 1HBXG 4OU0A 4FT8A 3DF8A 4L5JA 3N97A 4M72A 1D8JA 1FBUA 3RYPA 2HS5A 5H6QA 4LLGF 1S3JA 1KU2A 3BJOA 1DPRA 2OQRA 2CFXA 1QZYA 4B09A 1BI1A 5L3BA 1IN8A 2A6HF 3IHUA 1DUXC 4ESFA 2ESNA 1HW5A 4KDPA 4I01A 2RDPA 4S05A 3ZMSA 3I58A 2WWYA 4NHJA 3FHZA 1EV7A 4Z2YA 3U1DA 1U78A 1D8KA 3IRQA 1EH8A 1TQPA 3FMRA 3WU0A 4E70A 4N9IA 4O6JA 2DPUA 2V6CA 4CDGA 4RAZA 2CG4A 1IN7A 2HYGD 1U5TB 1FT9A 2HFHA 4A6DA 4ESBA 3DXJF 2QUFA 2BBYA 3F23A 2G7UA 4P55A 4RGSA 2ZJ2A 2HWVA 3F8FA 2LSOA 1I1GA 4U0YA 1LQ1A 3FXQA 3CO6C 4S04A 3ZMUA 4HV5A 1LNWA 1TLHB 3HSRA 2MLKA 4RB1A 3K1NA 1R36A 3JW4A 2MH9A 3LAJA 3T8RA 4KIFA 2X0LA 5JHUA 1T0FA 3DPLC 2QBYA 5ERIA 3EETA 1SD4A 4KIBA 2O03A 1IRGA 3I54A 2AXLA 3M8FA 5DCFA 3IKVA 1I27A 4UUVA 2GAUA 2EA4A 4MQVA 3ULQB 3GEZA 3BDDA 2C6YA 1XSXA 2M8EA 1LDDA 3GYHX 4FX0A 3H3UA 4I2OA 4BH9A 3CDHA 1MGTA 1YTYA 1XN7A 1YS6A 5H20A 3QRFF 2MLGA 3MCZA 1K78B 4OIRF 3SXYA 1MKMA 2KRFA 3TO7A 2ETHA 1ULYA 5FFZA 4HOBA 3EDPA 4HDUA 3KP5A 4HF2A 1P4WA 1ON2A 3FM3A 1ZRFA 5AIPA 4IHTA 2PG4A 3B73A 3KEQA 1W7PD 4M74A 3R0JA 5LGTA 2V1DA 5HS9A 4A5MA 2YPRA 2OZUA 4EVIA 4OIPF 5ILUA 3JAMZ 1R00A 5FD5A 1IF1A 2EK5A 2DT5A 1XGNA 3J7AO 3GFIA 3T0YA 2P5VA 5JVTA 4EM0B 3HOSA 2XRNA 3Q5FA 1CF7B 3V4GA 2P6SA 3KP6A 2EV0A 5F6FA 1XDSA 2UWMA 5HLGA 1LB2A 2Y48A 2QLZA 2RVCA 3TOBA 5F1RA 1QBJA 1GHCA 4LMYA 1G4DA 4AIJA 1FYMA 3ZMTA 3QPHA 2VODA 2CSOA 3TDZC 3MFKA 2V1UA 2KJCA 2ZMEA 2OD5A 3RKWA 2ZNZA 3RTRA 4EJOA 5JFRA 1XCVA 2O8XA 1FYLA 4MTEA 4LFUA 5FO5A 3F6OA 3RIRA 5E18F 5BPDA 2QVOA 3BWGA 1AOYA 1SMTA 1KGSA 1UHWA 5HLHA 2E7WA 2FNPA 1HKQA 4LD5A 4YIFA 2HGCA 1IRFA 1JGSA 3GWZA 1R58A 2P8TA 5D5UB 2ISZA 2R7DA 3LQQA 4AD9A 2Y75A 3FXRA 1D5VA 3RDIA 5IT9Z 2FBHA 4ENKA 2Z33A 2BYVE 1I5ZA 4K2EA 4N0BA 1MZBA 1YS7A 1BI2A 1Z6TA 4BYYA 4UNOA 3KP2A 2XHKA 4CYDA 2HDCA 1K78A 2CWEA 2M1BA 2YR2A 1BJAA 3H3ZA 3KZYA 3NQOA 4RS8A 5TRDA 1QO0D 1XGMA 3HRTA 3KLNA 3ZPLA 4LG0B 1TW3A 3J81Z 3K69A 2QBYB 1SD7A 4JBAA 2XASA 1S7AA 4UXNA 2P4WA 4EJTA 2HTJA 5D8LB 4CZZA 2QWWA 3RI4A 1E17A 2RV8A 4HLYA 1QZZA 1LEBA 5HS7A 2DFIA 2QM3A 1BOAA 2DLLA 1ZGAA 5LBQA 3BPXA 1WRJA 4OOIA 4P9FA 1SFEA 3ZMZA 4CICA 1F5TA 2P7VB 5D6FA 5L3FA 2ZXJA 2GIVA 5LGNA 3JAMK 3ZP5A 4MHGA 1OKRA 2EFNA 2FQ3A 2BV6A 4HX4A 2E7XA 2PFBA 4ENMA 3KP7A 4WK8F 2EFWA 4UV8A 4ENNA 1Z05A 1HKTA 4WXCA 1YO5C 4KUMA 1TTYA 1TNSA 1YW7A 3FZVA 2ACJA 2KIMA 3CO7C 5DDGA 3WTUC 3D0SA 4YG2F 2FEZA 2P7CB 4Q48A 1MD0A 2UZKA 2VBYA 4IXAA 3RKYA 5D6EA 1JXSA 1IN5A 2DPDA 3GZ5A 3K1PA 4M73A 1ZG3A 3ZQ7A 1LVAA 2K7LA 4L0YB 1XGOA 3R0AA 2Q0OA 3WTTC 5L3CA 3LA3A 3GXOA 3ECHA 5ICFA 5L3GA 5FFXA 2LF8A 2BE5F 3WTVC 4U7BA 1OPCA 1REPC 2FNAA 5E8IA 2H27A 2PEXA 4ZYEA 2DTRA 1QPMA 4JQFA 4HF0A 2VN2A 1D3YA 2OZ6A 1B9MA 2PLYA 4G6DA 4ZYHA 3VFZA 4UVCA 1FP1D 4CHUA 3C7JA 5J8FA 5J6XA 2FRHA 1BM9A 2VT3A 3KFWX 4I0BA 2V79A 1SD6A 3I64A 3BJAA 2Q2EA 2ZNYA 2HTSA 1FC3A 3FF5A 3GVAA 4UHTA 3MEXA 2GWRA 2DQRA 1T2KA 1U8RA 4NB5A 2DK5A 3BJ6A 3EUHA 2EJRA 2H6CA 5A2QK 1IXSB 2JT1A 5J8CA 2PQ8A 2Y0MA 4GXOA 5CJ9A 1LJ9A 4KIGA 2FMLA 5CVJA 1XSDA 3F21A 1QQIA 5LEJA 4CGZA 3HRUA 4PCQA 3GO5A 4M6XA 3CLOA 1JHFA 4B8XA 4EV0A 2DU9A 1QNTA 4ZYGA 2FMYA 1RZ4A 1G3YA 2FSWA 1H0MA 3L7WA 3N4MA 4IRHA 3KEOA 2L01A 1K79A 3WGHA 4HW0A 5LHGA 4U0VA 2VOOA 2D1VA 3EQLF 4OINF 3F8NA 1KU9A 4AVPA 1HKSA 4MTDA 3CTAA 2XAQA 3FMSA 4EMSA 5CVIA 5KVRA 1XMAA 2D2WA 2V1XA 2VBWA 3E5UA 4WXDA 2ADUA 1U2WA 2BEOA 5BMZA 5HDNA 3TQNA 2QQBA 3F72A 2HQRA 3E6BA 5K5OA 4MEXF 2JPCA 1KU7A 3L09A 5HVQC 5ILSA 3QU6A 3LA2A 4IJAA 4IRGA 2IP2A 2RN7A 2NYXA 1ZREA 1ZLKA 2KIFA 2XAJA 2AS5F 2CW0F 2FBKA 4YFXF 2A68F 4HZFA 1GVJA 5D4SA 2D45A 1HXDA 2IA1A 1ZYRF 3HTUA 3IWFA 3LFKA 4R1HA 2Q8KA 2KJBA 4RGRA 1KQ9A 2IPQX 4BHBA 1TNTA 2CO5A 3E5QA 3K9TA 4XBFA 2JPBA 4P96A 3KLOA 2GA2A 4PGGA 3PQKA 1FY7A 2VE8A 1DP7P 2VC0A 1SFXA 3RJPA 4HYEA 5DD8A 4I98B 5E1ZB 3V8LA 3W6KB 1WSUA 3DV8A 2JSCA 1UFMA 3R4KA 1I6XA 5FGMA 2L3DA 2DI3A 5IT9K 4H0EA 3HRSA 1RIOH 1J9IA 2NRAC 5BOXA 2MD5A 1U6GA 2STWA 4IVNA 3G73A 1YIOA 4A0YA 4ZZDA 2LNBA 2F2EA 1O3TA 4LLLA 1I1SA 2ZBKA 2XGXA 2HZTA 4LJZF 4DQ2A 2Z9OA 2R7FA 2E1NA 2DO7A 5DCMB 3ECOA 3ABUA 4YFNF 3TGNA 1W7PA 3CUQA 3M1EA 3V8KA 1VTNC 2LF7A 1IW7F 2OA4A 3IC7A 4NQWA 2EA2A 1PP8F 4UVBA 3QPTA 1MJBA 1XD7A 2EFOA 1BN5A 1GXPA 2A6EF 5TJJA 5LLQA 3C18A 2J5PA 2E1CA 5F64A 2OQGA 4MNUA 1P4XA 2O3FA 2A61A 3R60A 5K5RA 1T98A 2YSRA 1ZHFA 1R22A 3QP6A 3ZMVA 1A04A 4G7ZF 1O3QA 4KNYA 1ON1A 4KN7X 4ZZLA 1XDUA 4GYGA 1XCBA 2EV5A 5E1WA 1ZN2A 2FE3A 1ZARA 1RUNA 1X3UA 3DP7A 3F8BA 1OYYA 2EFPA 4TV7A 2QYOA 2FBIA 3ZN1A 2K02A 4ON0A 4MGRA 1FYKA 3M9AA 2VOPA 4MEYF 3FWEA 1W7PB 1FSHA 3P7NA 4RGXA 1Z91A 4Y17A 4ESJA 3IRRA 4IHSA 1YYVA 1F4KA 2GA1A 4EJUA 1J75A 5ICCA 3GFLA 2DQLA 4HA8A 2GQQA 4Q4ZF 3VODA 4L0ZB 5HS8A 2HEOA 1XSVA 2XV4S 2A5YB 2VXZA 3G3ZA 3ML6A 2PN6A 4CO8A 1K7AA 2O61A 2JTVA 1FZPB 2NS0A 2L4MA 5DCMA 3GFMA 2TDXA 4P5OA 3Q9VA 4G7OF 3OV8A 2O6GE 1G3SA 5AIQA 5E17F 3TDUC 4AIKA 1YW8A 3ZN0A 1ZAOA 3I4PA 1SD5A 4WCGA 1MJ9A 4KMFA 3CJNA 4HLXA 5AONA 4KMUX 2XAFA 4M9XA 3ELKA 3REOA 3CUOA 3GZ6A 2CYYA 3TKYA 3C1DA 3O3KA 2VE9A 3BOQA 5BS6A 4ETSA 4A2UA 3WGGA 4A12A 1LEAA 4LK1F 1U3EM 2Z5UA 1YQAA 3IWZA 2EWNA 4L5IA 1EH7A 2HYFA 2VBXA 1O7LA 1K6OA 4Y15A 3GFJA 4L18B 1EH6A 3MAJA 2IVMA 1S7OA 2DW4A 2YX7A 2RC4A 3U9GA 2XKPA 4R79A 4IPAA 5JR3A 2EB7A 2IRFG 4OIOF 3GW2A 1TQMA 1J5YA 2IT0A 4G8XA 1O7FA 1BI3A 1Z9CA 3LQRA 3HSEA 1J0RA 1RI7A 4ZH4F 3JTGA 3K2ZA 3DKWA 3HTSB 1QGPA 4A0XA 3E3VA 1BIAA 2ELHA 4M9SA 5KK1A 3T8TA 4D0PA 4O5VA 2K27A 5A2QZ 3LA7A 4HF1A 3VOEA 4LB5A 1FNNA 4QWQA 2HOEA 1Z7UA 3VEPA 5FLXZ 2W24A 1BC8C 3R6SA 3ROUA 2COMA 5H6RA 3SZTA 3FXUA 2HKXA 1CF7A 1KYWA 1W5TA 5D5XB 2K4BA 2NNNA 5HDGA 4GYIA 1SMYF 5BQTA 3O6BB 2L4AA 2RGVA 4KICA 3L9FA 3GLXA 4EJVA 3F8MA 3V7RA 1R1VA 5BPIA 5LRSA 1ZGJA 1AWCA 1YW9A 2ZMEB 1PDNC 2YU3A 2FXAA 4I0AA 3KP3A 3LAPA 1IXRC 4GCVA 1OMIA 1P2FA 2BGCA 2JRTA 2KKOA 3IL2A 5DUKA 5D4RA 1ZG1A 2XVCA 2NAZA 2FOKA 1WWXA 4HX7A 3BPVA 1IAWA 2VC1A 5IT3A 5EEGA 1HQCA 2JZYA 2M5WA 2RQPA 3ERED 3KCCA 5CVRA 2DK8A 4EM1A 5JI6A 1W5SA 5K1YA 4HAMA 4XRFA 4RB3C 1G6NA 2K4JA 3HHGA 5DEQA 1YG2A 3SHFA 5L3EA 2FA5A 3JSPA 2M30A 2XAHA 2QENA 2PI0A 4Q5SF 5LHHA 4HDVA 2NNYA 3PQJA 1P4AA 2MH2A 2XKOA 3RYRA 4UVAA 3L00A 1JE8A 2ISYA 3WTXC 1UHMA 1S29A 3HRMA 3J80K 4EJWA 2H09A 4KFCA 3HYIA 3EYIA 4U0WA 5D8KB 1KA8A 2GXGA 2VT2A 1ZG5A 4KT5C 1RNLA 5DV5A 3R61A 3SQNA 1KYZA 2DAOA 4M6YA 4BAYA 3WTWC 1O3RA 4I7HA 3MZYA 3NEUA 3FX3A 1Z1DA 3HHHA 2RKHA 1T6SA 1MDMA 1CGPA 3T5XA 3S2WA 2EFQA 1L0OC 4UV9A 2M45A 5CYVA 1DPUA 1WI9A 1ZLJA 4Y13A 2F5EA 2O0YA 3ISPA 4I02A 3PFIA 1OR7A 3U2RA 4WWCA 3QOPA 4HX8A 1B4AA 2W57A 1KQ0A 2RNJA 4PZJA 1SAXA 1V3FA 2IA2A 1WKMA 2LKPA 5CVUA 1TBXA 3FM5A 1F9NA 5DYMA 3WE3A 3E6CC 3KP4A 4JK1X 3OOPA 1UB9A 4GGGA 3F3XA 2DBBA 2IJLA 2H6BA 4LB6B 1OYIA 1ODDA 2G7HA 4LK0F 3F8CA 4FHTA 3E5XA 4BQAA 2P5KA 2ZKZA 4G9YA 1DDNA 2OBPA 1U5TA 4P9UA 3QAHA 1USSA 2X4HA 1HW2A 5LGUA 1IN6A 2W84A 2L02A 1XMKA 4YIIA 1B1BA 4A5NA 2QZ8A 2W85A 1P6RA 1S8NA 3E6DA 3GF2A 4ASNA 2F5CA 4Q47A 3SZPA 2K86A 5CLSA 2L54A 1TW2A 1FBSA 4ENJA 5HDKA 5L3DA 3E6MA 3I5UA 5LEKA 4EGYA 1BC7C 3V7SA 2R3SA 4L9VA 1J59A 4L9NA 1ONVA 3LSTA 5E20A 3H92A 4RAYA 1H9GA 4OIQF 3BY6A 3LWFA 1FX7A 2P5LC 1ZRDA 5EEHA 3JTHA 1H9TA 4M9ZA 4HQEA 2OAZA 3I53A 4QLCU 6PAXA 5D5VB 3SFZA 2D1HA 5FB2A 2H94A 5HLIA 3TO6A 1B6AA 4DNCA 1FWZA 1MJAA 4KN4X 2ZFWA 3J80Z 3K1MA 2YX4A 2XROA 3WE2A 3MQ0A 4XSZF 3COAC 5HOOA 2WC2A 1USTA 4EM2A 3WGIA 1GXQA 3HUGA 1S6LA 2OU2A 1FBQA 4GO1A 1BI0A 1E2XA 3KETA 1PP7U 3AAFA 4OMZA 4A0ZA 4LGWA 1IXCA 4N9HA 2HKOA 5D5WB 5E8GA 4HQMA 1SFUA 2WV0A 4BHCA 5FD6A 2A69F 1TQIA 4AWXB 4G94A 4FX4A 1FP2A 1L3LA 2FU4A 3DQVC 1NHAA 3GX4X 2KIUA 5DD4A 1LDKB 3M7GA 2CGPA 4M71A 3KE2A 1G3TA 3JSOA 1IZ1A 2XAGA 3TO9A 1KQ8A 2MC3A 4OMYA 5LHIA 2PBIA 2HR3A 3HSFA 4BXUA 3RPQA 2IW5A 2EV6A 3NRVA 1C0WA 4L9JA 5FLXK 4XLPF 3BZ6A 2PMUA 2ESHA 3B02A 1R23A 4F7ZA 1FOKA
chains in the Genus database with same CATH superfamily
3TP3A 3OS0A 1P7JA 2FUG2 3EUAA 1MDMB 2KZGA 3BROA 5IY5H 3V7CA 1YFHA 1Q1HA 4BNCA 2IA0A 4ZYDA 1SEUA 2FF4A 4XSXF 2VBZA 4FE4A 4WXHA 3DEUA 2Z99A 5DTDA 4WF2A 1ENHA 1HSTA 2KDOA 4KA4A 3PNTA 1VQKI 3VB2A 4U87A 5B1AH 2XPVA 3EYYA 2XIGA 1F1ZA 1T95A 3JRHA 4QIWN 1YLFA 3AKZA 2R7XA 4MIMA 2K5CA 3L2CA 2BHYA 1O3SA 1G3WA 2XUBA 3DFGA 1JTYA 3F22A 3BQZA 2A3SA 4BY7J 3HIFA 3RQ4A 3IAM2 2QQAA 3ZMDA 2L0KA 1Y8QB 3VSLA 4F7ZA 4A3DJ 2GXBA 4CYCA 1BW5A 1BBYA 3I59B 5F0FA 5KHDA 3KIOA 1R5GA 2LKSA 3QYEA 3OY9A 2K9LA 1IDZA 4HV6A 4E7LA 1TWCJ 3AL0C 3IKTA 3K4MA 2F5FA 2JA7J 3GUDA 3PIPF 4LIUA 2PMHA 1Z7LA 3WODF 4YELA 2W48A 3VYSB 1T38A 3TOAA 2UXXA 3P9CA 2HQNA 3E97A 2X6OA 1VQ4I 3M07A 2ZCWA 4XM3A 1R5HA 4AIHA 1QVTA 3QP5A 5LFAA 2R7SA 1R7JA 3OYMA 4II2A 4PGHA 2UUZA 3I55I 5H2FC 2MBFA 3PUFA 2XB0X 4XLAA 3CP8A 3CUQC 4CXFA 1WQ2A 3S1NJ 4MQ9F 3T1BA 3V8JA 3IV5A 1RUOA 4BQNA 2VB6A 2HXOA 4L9TA 2LYCA 4HSRA 4A3KJ 2MA3A 3QYBA 3C3WA 3QU3A 1AHDP 3RKXA 3S1RJ 2G9WA 5CKTA 5GP9A 2QA4I 1JHHA 2AQEA 1N75A 3HBLA 3J81K 1LPQA 5KCMA 4I09A 2V9VA 2VJ5A 4IF4A 3NWSA 5ICGA 2A07F 3HEFA 3HUGB 3VWBA 4RB0A 2R7WA 1MSEC 1R1UA 4RGUA 3Q9SA 4MLOA 1PUEE 2PJPA 3FMQA 5J40A 1S7EA 3CJRB 2ZJQF 1ZRCA 3TP0A 2DYRH 4I76A 2FJ1A 1NH3A 2IAIA 3KZZA 2WAQA 3W6JB 4E7ZA 2VQCA 3BR5A 1IUYA 3MZHA 3ZQCA 4LG0A 3ZRGA 1CQTA 1B59A 1B9NA 2UXNA 2VIXA 5GAGJ 3P9IA 2DXIA 3QODA 5E1XA 5ICEA 3M8JA 4RB2C 1XB4A 2JQ7A 1V5FA 1F43A 4EQQA 4J19A 3I59A 5EJCA 4U7DA 3P9KA 3O2PE 3WTYC 4YFKF 2Z3YA 3BP8A 1M1EB 2UV1A 5LRRA 2CMPA 4U88A 1OCCH 2ZXIA 2WTEA 4G6QA 2QSHX 4RM3A 2XSJC 3HM5A 9ANTA 1VQ6I 4IRIA 3OS2A 1OYWA 2B0LA 1KU3A 1T39A 3D5LA 5DUIA 2P6TA 3G1OA 5K5QA 1W4MA 3K0LA 4BHPA 1ZH5A 2HDWA 1P92A 1IO2A 3AG2H 2V9KA 1Z67A 3I71A 1HSJA 4CA0A 1R5ID 3ZQIA 2VONA 1STZA 1UJ8A 1V4RA 5CVVA 1PUFA 1LDJA 1Y0UA 4XLNF 4FISA 3PIOF 2JK3A 3F6VA 3Q0VA 2YU9J 3DPTA 3WTZA 4RMNA 4II3A 5K7FA 3WU1B 1R1TA 1BIBA 3FXMA 1FLIA 3LSRA 3ABTA 5JLWA 1IN4A 2K3FA 2GOMA 4OWRB 1IRZA 3BTLA 3H9GA 1ZTRA 2GZWA 3I0TA 2NS7A 1X4OA 2N8GA 1ETQA 1O57A 1UCRA 5ILVA 1IV8A 2DA5A 2ZO4A 1FTZA 3RCOA 1J2XA 3HOTA 4E7IA 1JKRC 2W25A 3HB9A 3SDGA 4HBLA 4YEJA 3FXLA 3WG9A 4KYWA 2KIQA 2DMUA 3JRFA 3CCYA 2J5OA 4XOTA 1K4TA 4LLNA 1HW1A 4O3MA 3ESWB 2KDZA 2QQ9A 3WTSC 3RPUA 2ZMEC 4G7HF 1FPQA 2LDUA 5J3LA 4UUTA 2BY2A 3UKGA 1XMXA 2LMDA 2M87A 2NVUB 3M8EA 5IP6A 4BS9A 1U5TC 1XGSA 1Z6RA 2F5DA 1J7KA 1TWFJ 3MWMA 4EGZA 1OCPA 4PDKA 3CUQB 2WAEA 4A6EA 3ZQGA 1D1CA 1JT0A 4R8HA 1OCZH 3ZCOA 2ZXHA 2L7KA 5ED4A 2CV1A 2STTA 3CF2A 4WX9A 1V55H 3H9QA 2CQKA 1S5LC 1DU0A 1Y39A 3SEZA 3RZOJ 1FSEA 3QYFA 1HBXG 4OU0A 3SYTA 1V5EA 3B6CA 4FT8A 4HG2A 2R7QA 3DF8A 1X1BA 4L5JA 3N97A 1VQ8I 4M72A 1D8JA 2DFFA 1FBUA 3QPSA 3RYPA 4E7SA 1R9TJ 2HS5A 1JKQC 4B4CA 2VKHA 5FKOA 5H6QA 4XIDA 1I6HJ 4LLGF 3OSGA 1A35A 1S3JA 1KU2A 3BJOA 4B44A 1X2NA 2EZKA 5F27A 3CC2I 1DPRA 2OQRA 2CFXA 1NTCA 1QZYA 4B09A 1VZ0A 1BI1A 5L3BA 1ERDA 1IN8A 2A6HF 3TW6A 3IHUA 1DUXC 2XB5A 4ESFA 2ESNA 4BQQA 2XF6A 1HW5A 1TWGJ 2CQXA 4KDPA 4XKCA 4W97A 4I01A 1YIJI 2PJRB 2RDPA 3BR3A 2QKMB 4NUBA 4S05A 3ZQLA 3ZMSA 3I58A 3G1LA 2WWYA 3GTLJ 3A2KA 2L7ZA 2BW3A 5IYBJ 4Y3OA 4NHJA 1EV7A 2BY3A 4Z2YA 3U1DA 3FHZA 4IO9F 4AVZA 1U78A 4F3QA 2TCTA 3G1MA 5E79C 2EPFA 1IG7A 4Z6YA 1HLVA 1D8KA 3IRQA 1EH8A 1TQPA 3FMRA 3CP2A 3WU0A 2LFBA 4E70A 4I99C 4N9IA 2CS3A 4O6JA 3JRDA 2DPUA 2H1KA 5K7ZA 2V6CA 3VDXA 3CF5F 4CDGA 3N05A 2JWTA 4RAZA 1RPWA 3OL4A 4IL6C 2CG4A 1I3QJ 5JHFA 1IN7A 1EJ9A 2HYGD 2WAQN 2E5NA 5EG0A 1U5TB 1PUFB 1FT9A 2HFHA 3S2HJ 4A6DA 2L9SA 4ESBA 1MSFC 3DXJF 2QUFA 2BBYA 3F23A 2G7UA 4P55A 2JRMA 4RGSA 2ZJ2A 2V9PA 1QA6A 2HWVA 1QHHD 3L2WA 2VI6A 3F8FA 2NVTJ 2DA7A 2LSOA 2CUJA 1RKTA 2WA0A 3WHCA 1I1GA 2WB1A 4U0YA 4AU7A 1LQ1A 3CCMI 3FXQA 3CO6C 4DYCA 4S04A 2VQGA 2BY1A 3ZMUA 4HV5A 3HC7A 3BR1A 1UHSA 1LNWA 1TLHB 3HSRA 4DYQA 4H4KC 2MLKA 4RB1A 3K1NA 1R36A 4M3FA 3JW4A 2MH9A 1NG6A 3OIOA 3LAJA 2R5YA 1QU3A 3T8RA 4KIFA 2ICWG 4DBQA 2X0LA 5JHUA 1XTAA 1T0FA 3DPLC 5EZGA 2QBYA 1GVDA 5ERIA 3EETA 4XRSA 1HDDC 1SD4A 2F4IA 4KIBA 2W1OA 2O03A 2GIZA 3PM1A 1IRGA 3I54A 5JLXA 2AXLA 4JX5A 1E3OC 1R4NB 3M8FA 5DCFA 3IKVA 2KL4A 1I27A 4UUVA 4RLQA 4CCLA 2GAUA 2EA4A 4AIDA 3OYHA 3AL0B 4MQVA 2ME6A 3OYNA 4CCJA 3ULQB 2R5ZA 3GEZA 3BDDA 2C6YA 1XSXA 2M8EA 2MGQA 1LDDA 3GYHX 3M4OJ 4FX0A 2I8DA 4C3IJ 3H3UA 4I2OA 4BH9A 3CDHA 5IP9J 1X3ZB 1MGTA 2E71A 3K6GA 1V5GA 3S93A 1QPIA 1YTYA 1XN7A 2FQ4A 4PJMA 5EG0B 1YS6A 4DBRA 4BJTA 5E3MA 5H20A 3HXLA 1YJNI 3QRFF 2MLGA 2R7OA 3MCZA 4BDYA 1FMVA 3G4SI 1K78B 4EEFG 1ETYA 4KJZA 4OIRF 1GLNA 1VNDA 5FRMA 3SXYA 2XSDC 1MKMA 1SANA 2KRFA 3TO7A 3MKYB 3FBNB 2ETHA 1ULYA 3C2BA 5FFZA 3MKWB 4HOBA 2WV1A 3EDPA 4HDUA 3KP5A 2CUFA 4HF2A 3OL3A 3ABKH 3S2DJ 3DKXA 1P4WA 3H9JA 3VYUB 1ON2A 3FM3A 1ZRFA 5AIPA 4IHTA 3E1SA 2PG4A 2GM4A 1ETXA 2CRGA 3B73A 4RBOA 3KEQA 3LSGA 2KISA 1W7PD 4M74A 3R0JA 4HRIA 5LGTA 1MBHA 2V1DA 5HS9A 4A5MA 2YPRA 2R5YB 2OZUA 4EVIA 2ID3A 3GLLA 4OIPF 3BCAA 5ILUA 3JAMZ 1RR8C 4M3DA 2W00A 2M34A 4Y33A 1R00A 5FD5A 1IF1A 4FE7A 2EK5A 2DT5A 1XGNA 3DTKA 3J7AO 2WBMA 4BE2A 5FROA 5IOZA 3GFIA 3JRGA 3T0YA 5J47A 3S3OA 2P5VA 2XDVA 2XPUA 5JVTA 2M7AA 4DGWB 4EM0B 3RKQA 3HOSA 3X2QH 1Y1VJ 2X9DA 2XRNA 2G0EA 4CCNA 3HKZN 3V4GA 5IYCJ 5DM7F 3Q5FA 1CF7B 2DT6A 2P6SA 2Y2ZA 3KP6A 2MW8A 2EV0A 5F6FA 1XDSA 4AM3A 2P81A 2UWMA 5HLGA 1LB2A 1OR7C 2OC6A 1BOBA 3S1MJ 2Y48A 3M3YJ 3IAS2 5C4XJ 3OYFA 2E2HJ 4BJ6C 3H5RA 2JMWA 2QLZA 2RVCA 2NOGA 4NC8A 3TOBA 3SJMA 5F1RA 1QBJA 1GHCA 2DA2A 2QGUA 4LMYA 2CQNA 4AIJA 4BACA 1G4DA 1FYMA 2X1CA 3ZMTA 3VYRB 3QPHA 2VODA 2CSOA 3TDZC 2B9SA 2EIMH 1POGA 4B3AA 1Y1WJ 3MFKA 2V1UA 2KJCA 2ZMEA 2OD5A 3RKWA 2ZNZA 3IH2A 1MBEA 3RTRA 4EJOA 5JFRA 3LSJA 1XCVA 2O8XA 3FISA 1FYLA 4MTEA 2RQQA 4LFUA 1WI3A 4RAFA 5FO5A 2VXDA 3F6OA 3RIRA 2DMQA 5E18F 5BPDA 2QVOA 3BWGA 1N78A 1AOYA 1UHWA 1SMTA 1KGSA 1E3PA 3I4MJ 1OCOH 5HLHA 2E7WA 2FNPA 2IXSA 1HKQA 2BW3B 4IX7A 3BR2A 1EKEA 1RRJA 2DDAA 4LD5A 1FMWA 1ZKGA 4ZJZA 4XQFA 3CCJI 3F0CA 4YIFA 1OISA 5EGOA 4A3JJ 3ZQFA 1B72B 2HGCA 4DZJA 1IRFA 1JGSA 3GWZA 1R58A 2P8TA 5DM6F 2OCCH 5D5UB 1A5JA 4Y7NJ 2ISZA 2R7DA 3LQQA 4AD9A 2Y75A 3FXRA 1T0FC 1X58A 1Z77A 1D5VA 4A3IJ 1JT6A 1XPXA 3RDIA 1SC7A 5IT9Z 3FDYA 2GOXB 2FBHA 4ENKA 2Z33A 2BYVE 1I5ZA 4K2EA 4UB6C 4N0BA 1IC8A 1MZBA 1RR7A 1YS7A 3SZGA 1BI2A 3J7ZI 3CC4I 1Z6TA 2VASA 1YRNB 3F9KA 4BYYA 4UNOA 2R5ZB 2OTLI 3KP2A 2XHKA 4CYDA 4ZTFA 2HDCA 1IDYA 1OJLA 3O8HA 5EDNA 1K78A 1U9OA 3W6VA 1JUPA 2CWEA 2M1BA 2YR2A 1BJAA 2Y30A 3H3ZA 3KZYA 3NQOA 4RS8A 5TRDA 3LSKA 1QO0D 2XF7A 1XGMA 1K6YA 1Z3YA 2QQ8A 3EPZA 2TRTA 3HRTA 3KLNA 4BEHB 3ZPLA 4LG0B 4IEJA 2LH9A 1TW3A 3J81Z 3K69A 2QBYB 4MFEA 1Y0NA 1SD7A 3OYDA 2M4KA 2FOWA 4B48A 3LSPA 4JBAA 3CC7I 1A36A 2HOSA 5CPRB 5FRNA 4XMYA 4ZDLA 2XASA 1S7AA 4ITVA 4XLCA 4UXNA 3GTMJ 1T33A 1Z3XA 2P4WA 2HTJA 5D8LB 4EJTA 3ONQA 4CZZA 2PMZN 4M3GA 2CV2A 2QWWA 3VPRA 4CYCB 3RI4A 2ZJRF 2JVHA 3A0HC 2E34A 1E17A 2RV8A 2BOLA 4HLYA 1QZZA 3MZ8A 1LEBA 5HS7A 2DFIA 2QM3A 1BOAA 2DLLA 3B6AA 4P1WA 3E7LA 2K40A 3CJTB 1ZGAA 5LBQA 1IJWC 4B47A 2XC7A 3BPXA 1WRJA 2NXNB 4OOIA 4P9FA 1LE8B 2LREA 1SFEA 3S15J 3ZMZA 1TWHJ 1YOVB 4CICA 1F5TA 2P7VB 2CH0A 2HU9A 5D6FA 1W0UA 3H36A 1LFBA 2KRCA 5L3FA 2BZTA 2ZXJA 4G12A 2GIVA 5LGNA 4A3FJ 1FOXA 3JAMK 3ZP5A 1MIJA 4MHGA 1OKRA 2CW7A 2EFNA 2FQ3A 2BV6A 4HX4A 2E7XA 2PFBA 4ENMA 2DMPA 3KP7A 4WK8F 2EFWA 4UV8A 3S8PA 3WU2C 4ENNA 1Z05A 1HKTA 2Y9YA 4WXCA 2K85A 4KUMA 1YO5C 2I10A 3DU5A 2Z1DA 1TTYA 1TNSA 1YW7A 1Z0XA 5F0HA 3J7AY 3FKIJ 3FZVA 2ACJA 2M3AA 2KIMA 3CO7C 5DDGA 4F52A 3WTUC 1LFPA 3D0SA 4YG2F 4PFPA 2FEZA 2P7CB 3ZQHA 2YUSA 4YIRX 3K70D 1JKOC 4Q48A 1MD0A 3TW7A 4E7KA 3GTKJ 2UZKA 2VBYA 4IXAA 2HZDA 3RKYA 3RZDJ 2F6CA 5D6EA 4AUXA 1JXSA 3BG9A 1IN5A 1B8IA 2DPDA 1U0JA 3GZ5A 1LVKA 2Y31A 3K1PA 1GT0C 2PMZA 4M73A 1ZG3A 3TMOA 2IBDA 3ZQ7A 1YI2I 1LVAA 3CJQB 2K7LA 4EATA 1G59A 1I3AA 4L0YB 1MBKA 1XGOA 4UUSB 4CUGA 3R0AA 3OYLA 2Q0OA 4GRIA 4E7HA 4CH7A 3WTTC 3OYEA 5L3CA 1JI8A 3LA3A 3GXOA 3ECHA 1ZK8A 3BG7A 5GTHC 2F4OB 5ICFA 1B72A 5L3GA 5FFXA 2LF8A 3AG1H 4OAYA 3ZGKA 2BE5F 2EINH 1UG0A 2OUMA 3BCBA 3HG9A 2X51A 3WTVC 4M6VA 4U7BA 1OPCA 2JVGA 1REPC 1BA5A 1MNMC 1HF0A 3PSIA 2FNAA 5E8IA 1VQOI 2CQ7A 2H27A 2JN6A 2PEXA 4IQ4A 2K9SA 4ZYEA 2F48A 1JGGA 4NDLA 1H8AC 2DTRA 3PFYA 1QPMA 2EZLA 1AKHB 1DGRM 3G2BA 3LL7A 1MBGA 4JQFA 2GBYA 3DBRB 2Y0SN 4BBRJ 1I39A 4HF0A 4HNUA 2VN2A 2COBA 4XR6A 1D3YA 2OZ6A 4D7MA 1XG1A 1PJRA 1B9MA 2PLYA 4G6DA 4ZYHA 3VFZA 4RDUA 2DOEA 4UVCA 1FP1D 1RC9A 3BLYA 3JRIA 1ETOA 2DCEA 2KP6A 1ORKA 3CCUI 4CHUA 3C7JA 4BXXJ 5J8FA 2V26A 2OV7A 5J6XA 2FRHA 1KONA 4QTRA 3JR9A 1BM9A 2DA3A 2VT3A 4AYBN 1APLC 2M2EA 4XKVA 3KFWX 4I0BA 2ECBA 2DJIA 1N25A 4C9YA 2V79A 2B7EA 1SD6A 2P0WA 3I64A 3BJAA 2Q2EA 2XGDA 3HDDA 3QWLA 1XX5A 2ZNYA 2ECCA 2W4SA 2HTSA 4YRVA 2BY0A 1FC3A 3IH3A 4LOCA 2VKEA 2NVYJ 3KEYA 5B1BH 2IEKA 3HL2A 4C2TA 1GV5A 2DOAA 2MFZA 3FF5A 3K4LA 3GVAA 4UHTA 3CCQI 2XRLA 3MEXA 2GWRA 2M4GA 2DQRA 2DA6A 1U8RA 1T2KA 4NB5A 2DK5A 3BJ6A 2E1OA 1UZCA 4HEA2 1BL0A 1R6RA 2IGNA 3EUHA 2EJRA 2H6CA 4DIQA 2PX9A 1R71A 2GLOA 5K7HA 5A2QK 1VQLI 2CJJA 1IXSB 4XLHA 2JT1A 3W2WA 5J8CA 3C2HA 2PQ8A 2MD0A 2Y0MA 2XF5A 4GXOA 1FIPA 5CJ9A 1LJ9A 2VQHA 2A6TA 1JTXA 4KIGA 2FMLA 1SVMA 4F92B 2Y0SA 5CVJA 2BHZA 2QCOA 3K4JA 1XSDA 3DKYA 4FETA 3F21A 1QQIA 3H5AA 5LEJA 4IQJA 4CGZA 1DGWY 1LUJB 3HRUA 2B63J 4PCQA 1DP3A 3GO5A 2ZC2A 4S0HB 2VL8A 3L2RA 4M6XA 3CLOA 1JHFA 2K3PA 3EUKL 4B8XA 4EV0A 3L2UA 2X48A 1ZR2A 2DU9A 1QNTA 1YRNA 3KPHA 2FMYA 4ZYGA 1A31A 1RZ4A 3A02A 5F04A 2HPMA 2Z16A 1G3YA 2FSWA 1H0MA 2M0CA 3SDBA 3L7WA 4B43A 1W5CC 1WJAA 3KEOA 4IRHA 3N4MA 2AQFA 2L01A 1X19A 1K79A 4OAZA 4IHVA 3CMMA 4CCOA 3WGHA 4XRMA 4HW0A 5LHGA 1LKXA 4U0VA 3L1PA 2VOOA 3PO2J 1D0XA 2D1VA 1HA8A 3EQLF 4OINF 4UB8C 3F8NA 2VUMJ 4JP0A 3MD2A 3HJEA 1KU9A 4AVPA 1OCTC 2V4JC 1HKSA 1ZR4A 4MTDA 3CTAA 2X1DA 2XAQA 3FMSA 4EMSA 5CVIA 2IS4A 1NG7A 1WZ2A 5KVRA 1FJLA 5C4JJ 1XMAA 2D2WA 1NK2P 2V1XA 2VBWA 3E5UA 1W36C 4WXDA 2ADUA 3BTCA 2VPLA 1U2WA 2BEOA 3IUOA 1S9HA 4XK4A 4QSHA 5BMZA 4AC0A 5HDNA 4CCMA 5FKKA 4A3EJ 1WH7A 2R7TA 3TQNA 3NWTA 2QQBA 3F72A 2HQRA 2W7NA 2LBFB 1OQYA 2O9LA 3E6BA 5K5OA 1ETKA 4MEXF 2JPCA 1KU7A 3L09A 5B66C 1A6QA 2AHQA 5HVQC 3I56I 2BXZA 3MVPA 2OPTA 2EIJH 3BR0A 3QU6A 5ILSA 3LA2A 3J7YJ 1VQ7I 4IJAA 2IS2A 4IRGA 1X2MA 2IP2A 5B3SH 1FEXA 2HQAA 2RN7A 2NYXA 4JX4A 2DT7B 1ZREA 4FTHA 1ZLKA 2KIFA 2XAJA 4V2GA 1TP4A 2AS5F 2CW0F 2ELKA 2FBKA 2HYJA 1T8IA 2VKVA 4YFXF 2A68F 2JA5J 4HZFA 2NVXJ 4E7JA 3CQZJ 1GVJA 5D4SA 2D45A 5M5XJ 1HXDA 2IA1A 1ZYRF 3HTUA 3IWFA 3LFKA 4R1HA 2Q8KA 2KJBA 4RGRA 2MYSA 3C2GA 1KQ9A 1FOWA 2IPQX 4BHBA 1YITI 2K9QA 1TNTA 3KZIC 3D5SC 2CO5A 3GTPJ 3E5QA 4RAGA 3K9TA 3KYDB 5KNLA 1EA3A 1TC3C 1TL8A 4A3LJ 2ZSHB 4XBFA 1WFXA 2BVLA 2JPBA 4P96A 3KLOA 1A6IA 2DFHA 2GA2A 4PGGA 3OMYA 3PQKA 2DMTA 4KISA 1FY7A 2VE8A 1WJBA 1DP7P 2R7ZJ 2VC0A 1WPKA 1SFXA 1UMQA 3RJPA 4HYEA 5DD8A 4I98B 5E1ZB 1Z21A 3V8LA 4FASD 3W6KB 2RREA 2LLKA 5IYDJ 1WSUA 1PYVA 3DV8A 2JSCA 1UFMA 1F36A 4Y52J 3R4KA 1I6XA 2R7UA 5FGMA 4A93J 2L3DA 2DI3A 1W0TA 1QVUA 5IT9K 1EF4A 2BXYA 4H0EA 3HRSA 1RIOH 1J9IA 2NRAC 5BOXA 2WY8Q 4G6TB 3LSHA 2MD5A 3ABMH 2X6WA 1U6GA 3DPUA 2LKXA 2R0QC 2M7BA 5E3NA 2STWA 3CDLA 4IVNA 3ZXSA 3G73A 1YIOA 4A0YA 4ZZDA 2LNBA 3W2AA 4C2MJ 3GMEA 2VJIA 2F2EA 3OIQA 3FXOA 1O3TA 4LLLA 3CCLI 2ZBKA 5HNHA 1I1SA 2XGXA 2HZTA 3HPGA 4LJZF 4M3BA 4DQ2A 2Z9OA 2R7FA 2E1NA 3P5JA 2DO7A 5DCMB 3ECOA 4N4OB 3ABUA 4XKBA 5J4YA 1YHQI 4YFNF 3MKLA 3TGNA 2KLOA 4IKFA 1W7PA 3CUQA 3M1EA 5EF6A 2QSGX 3FK6A 3V8KA 4B3XA 3OR2C 1VTNC 4XONA 2LF7A 1IW7F 2OA4A 3CCSI 3TBIA 2Q2EB 3IC7A 4NQWA 3HGYA 2EA2A 1PP8F 4UVBA 1WH5A 1I50J 3QPTA 2ID6A 4BU2A 1MJBA 1XD7A 3BQYA 2EFOA 4A3CJ 2H1LA 1BN5A 4CSWA 1GXPA 2A6EF 5TJJA 3JRBA 2XAUA 2R7RA 5LLQA 3C18A 2IGOA 2J5PA 1RETA 2E1CA 5F64A 1VQPI 3SFIA 2OQGA 1IRXA 2DA4A 4MNUA 1P4XA 1MMDA 3OOUA 5FLMJ 2O3FA 1OLTA 2A61A 3R60A 5K5RA 1T98A 2YSRA 1ZHFA 1R22A 3ASNH 3QP6A 1A04A 3ZMVA 4G7ZF 1O3QA 3ASOH 4KNYA 3BTJA 3OYKA 4BGDA 2HVSA 1ON1A 2HQ5A 4KN7X 4ZZLA 1XDUA 4GYGA 2L9NA 1XCBA 2EV5A 3DBHB 2LBFA 1ACIA 5E1WA 3U1KA 4UY8I 1MBJA 1ZN2A 1ZELA 1BR4A 4XL9A 2MSYA 4D5FA 5GPAA 2NOJB 2FE3A 1ZARA 3JREA 2K9NA 4JX6A 2EQRA 2W82A 3A01A 4MO7A 4ZC3A 4PSXA 4XRSG 1X1DA 1RUNA 1X3UA 3BG6A 3DP7A 2VPRA 3F8BA 5FJ8J 1OYYA 1AU7A 3E0JB 2GXAA 2O7OA 2EFPA 1TT0A 4TV7A 1R49A 4IZZA 2QYOA 2FBIA 3ZN1A 5J1UA 2K02A 4ON0A 4ABZA 4MGRA 3FXKA 4BDZA 1FYKA 2KHMA 1SFKA 2HPIA 3M9AA 3OR1C 2VOPA 4MEYF 4BQOA 3FWEA 1W7PB 3Q3SA 1BR2A 2JA2A 2Y9ZA 2I5UA 1VFCA 1FSHA 1WJEA 3P7NA 4RGXA 1Z91A 4Y17A 4ESJA 1T56A 3IRRA 1ITYA 4IHSA 3AFHA 1YYVA 1F4KA 2GA1A 2L9RA 4EJUA 5IP7J 1J75A 5ICCA 3GFLA 2DQLA 4HA8A 3VYTB 4BXFA 3OYAA 3K10A 2GQQA 3G71I 3CMAI 4Q4ZF 3VODA 3G6EI 2E5ZA 4L0ZB 5HS8A 2CU7A 2WB1N 1XSVA 2HEOA 3OWTA 2HVQA 2XV4S 4BKXA 2A5YB 2VXZA 3G3ZA 3ML6A 2M8GX 2PN6A 4X0GA 4CO8A 1K7AA 2DJNA 2O61A 2JTVA 4ZDPA 1FZPB 2NS0A 2KFDA 2L4MA 1MW7A 2QSFX 5DCMA 3GFMA 2TDXA 4P5OA 3Q9VA 3Q0UA 3LOCA 4G7OF 4IHWA 2VKDA 3OV8A 2O6GE 1YX5A 1G3SA 5AIQA 5E17F 3TDUC 4JYKA 4DOZA 4AIKA 1ETWA 1YW8A 3ZN0A 5HNFA 1ZAOA 3HOZJ 5F0CA 3JRCA 3I4PA 1SD5A 4WCGA 1MJ9A 4KMFA 5M3FJ 3CJNA 3KYCB 1VF9A 2FD5A 2ZXWH 1ETVA 1BJZA 4HLXA 4LITA 3GTQJ 1QZEA 4LG3A 5AONA 4KMUX 2JUGA 2XAFA 1P7IA 3HZJA 2LOOA 3PL8A 4M9XA 3ELKA 3PNVA 3REOA 3CUOA 3GZ6A 1DQUA 2CYYA 4RLFA 3TKYA 1O4XA 3LSIA 3WG7H 4IOAF 2QKLB 3C1DA 2DMNA 3O3KA 2VE9A 3BOQA 4XORA 1H88C 5BS6A 2HVRA 4ETSA 4NNJA 5CQGA 2L7FP 1T08B 1B8IB 4A2UA 3WGGA 3HOVJ 3DEEA 1R4MB 4A12A 1LEAA 4LK1F 5TISC 1U3EM 2Z5UA 1YQAA 3IWZA 3OS1A 3HOXJ 3OYIA 2EWNA 2E19A 1SVLA 3BG3A 4F91B 4L5IA 1EH7A 2HYFA 4ZDOA 3LMMA 2VBXA 1O7LA 3K70C 2CV0A 1K6OA 4Y15A 2LVSA 3GFJA 4L18B 1EH6A 3MAJA 2IVMA 1S7OA 2X6YA 3A03A 2DODA 5EEAA 3DLLF 1RESA 1MH3A 3LFUA 3RPUD 2DW4A 2LP0A 2YX7A 3CESA 3CCEI 4XLFA 2RC4A 1K83J 3U9GA 3DU6A 2CUZA 2XKPA 1LE8A 3I4NJ 4R79A 3DEWA 4IPAA 5JR3A 2IS1A 5CQEA 2EB7A 2IRFG 5J1RA 1GUUA 4OIOF 4V2FA 3GW2A 1TQMA 1J5YA 5F08A 2IT0A 2OF7A 4G8XA 5DS9A 4F93B 4NC7A 1O7FA 1PVEA 4XLEA 1BI3A 1Z9CA 2XGEA 3LSMA 3LQRA 3HSEA 3A0BC 1J0RA 1RI7A 4HNTA 5LD2C 1GV2A 4ZH4F 2A05A 2V1NA 3JTGA 3K2ZA 3FKJA 4IOCF 3GCMA 4BBSJ 1E0EA 3DKWA 3HTSB 1QGPA 3ABLH 5EYRA 4A0XA 1Y6IA 4NBQA 3E3VA 3L2VA 1BIAA 2ELHA 4M9SA 5KK1A 1Q1VA 1QHGA 4RM2A 2R7VA 4BE0A 3T8TA 1QRYA 2E60A 4D0PA 3ERMA 4O5VA 2K27A 5A2QZ 1WGXA 3BZCA 5FKNA 3LA7A 4HF1A 1S72I 1JUSA 2E35A 3VOEA 4LB5A 1FNNA 2MABA 4QWQA 4XNFA 2HOEA 2VQLA 1Z7UA 4XKWA 3VEPA 5FLXZ 3MMYB 2W24A 4CCKA 3R6SA 3ROUA 1BC8C 2COMA 1WVRA 5H6RA 2HOAA 4L5EA 1X1PA 2WAFA 2WY7Q 3SZTA 3FXUA 2HKXA 1CF7A 1VQ9I 1KYWA 1W5TA 4NC6A 1JJ8C 5D5XB 2K4BA 4DW6A 1JUMA 1HCRA 3NAUA 2LY2A 2NNNA 3K4KA 5HDGA 2KPMA 2Y69H 3AG4H 4GYIA 1SMYF 2F5VA 3O6BB 5BQTA 1FOYA 1UG2A 2L4AA 2RGVA 3PUBA 4KICA 1X1AA 1UELB 3GLXA 3L9FA 4EJVA 3CMYA 3F8MA 5GAEJ 3V7RA 2IS6A 1R1VA 5BPIA 4E4HA 4XN3A 5LRSA 4PK4A 2EBIA 1ZGJA 1G2HA 3H0DA 2H8WA 1AWCA 1YW9A 5J4VA 1D0YA 2ZMEB 1PDNC 1MBFA 2YU3A 2FXAA 4FQGA 3K7AJ 4I0AA 2X85A 3KP3A 3LAPA 1IXRC 4GCVA 1OMIA 3BTIA 2HI3A 1YX3A 5F1JA 2LY9A 4IHYA 1P2FA 2BGCA 4HSTA 2JRTA 2KKOA 3QOEA 3IL2A 5DUKA 5D4RA 1ZG1A 3PJRA 2V7FA 2XVCA 2NAZA 1WHUA 2FOKA 2HOTA 1HOMA 5KAIC 1WWXA 2L2OA 4HX7A 3BPVA 5GTIC 3BC8A 1IAWA 2VC1A 5IT3A 5EEGA 3CZ6A 2HDDA 2HXIA 1HQCA 1U8BA 2JZYA 5EGOB 2M5WA 2RQPA 2ZB9A 3S14J 4PJLA 3ERED 3KCCA 2E2JJ 3I9V2 5CVRA 5M5YJ 3DWLE 1N77A 1XS9A 2DK8A 3DTIA 3FHNA 4EM1A 3S1QJ 3NARA 3U21A 5JI6A 3H1CA 4D9JA 1W5SA 2ZFUA 3GTGJ 5K1YA 4HAMA 4XRFA 4BL0B 2DFEA 4RB3C 3A4CA 1MMGA 1G6NA 2K4JA 2L9VA 2RNGA 5EZHA 1TWAJ 4J01A 1WJDA 3HHGA 5DEQA 1ZGWA 1YG2A 2LK2A 4ANJA 3L2QA 1VQMI 3SHFA 5L3EA 2ELJA 3QPLA 2E36A 2FA5A 3JSPA 2ZJPF 2M30A 3BT9A 3S17J 3DTEA 2A5WA 2QENA 2XAHA 2PI0A 4Q5SF 5LHHA 2AXTC 1K4SA 2LRDA 4HDVA 2VLAA 4FCYA 2NNYA 2CUEA 3PQJA 1P4AA 1MMSA 2QEXI 2MH2A 3GBGA 2XKOA 3RYRA 2IGMA 3Q0WA 2KT0A 1SFOJ 2E1MC 2DOFA 1WJFA 2L7MP 4UVAA 2HNHA 3BR6A 4M3EA 3L00A 1JE8A 3K2AA 4BJ5C 2Q1ZB 2F4MB 1J09A 4A3BJ 1AA7A 2ISYA 3GZNB 2ME0A 3WTXC 1BW6A 4KITB 1UHMA 1S29A 1X3WB 3HRMA 4HNVA 3J80K 2JA6J 3IP4B 3S3MA 1W36D 3CD6I 4QPQA 4EJWA 2H09A 1MH4A 3S3NA 4KFCA 3H35A 3HYIA 4PFOA 3EYIA 4U0WA 3H3VK 3OYCA 3FK7A 2JSPA 5J1YA 1OCRH 5D8KB 1KA8A 2GXGA 4QPOA 2QF7A 2VT2A 2PJRA 1ZG5A 4KT5C 1IGNA 2JJ7A 1RNLA 3OYJA 4N4NB 4PJ0C 5DV5A 1XC5A 4HPQA 3R61A 3AG3H 3SQNA 3GTOJ 1KYZA 2DAOA 4M6YA 4PUSA 4BAYA 3WTWC 1O3RA 4I7HA 3MZYA 2E1MB 1WJ5A 3NEUA 5TGTA 3W3CA 1JJ6C 3K4CA 5C44J 3FX3A 1Z1DA 1K61A 3HHHA 2LTPA 3DCFA 1T6SA 2RKHA 1MDMA 1W1WE 4RA2A 2Z2SB 1CGPA 1MMNA 2XGCA 5GAHJ 3T5XA 4C2UA 3S2WA 1LFUP 3IH4A 2EFQA 1L0OC 1IUFA 4UV9A 2M45A 5CYVA 1DPUA 4C30A 2R93J 1WI9A 1ZLJA 3HPHA 4Y13A 3ZOBA 4LIVA 2F5EA 2O0YA 2KRHA 3EUHC 1FIAA 3ISPA 4C3HJ 4I02A 3BZKA 2JUCA 1U9NA 3PFIA 3S32A 4BE1A 2RAEA 1FTTA 1OR7A 3U2RA 4WWCA 1IV6A 1VQ5I 2LR8A 3QOPA 4HX8A 1B4AA 4GFBA 2W57A 2JA8J 3CCRI 2RNJA 1KQ0A 4PZJA 3TL4X 1SAXA 1V3FA 2EZIA 2IA2A 1YJ9I 1JKPC 5GADJ 2FX0A 1WKMA 2LKPA 5CVUA 1TBXA 5HLTA 3FM5A 1F9NA 3MKZA 1MNEA 2LG4A 3BG5A 5DYMA 3S16J 3PSFA 3WE3A 3E6CC 2M0MA 1SVOA 3KP4A 2R4GA 4JK1X 3HOWJ 3OOPA 1UB9A 4GGGA 3F3XA 1H89C 2NVQJ 2DBBA 2WADA 4W1UA 4DZPA 3HOYJ 2IJLA 4DJAA 3HOUJ 3QQAA 2H6BA 4XN0A 4LB6B 4AYBA 1HDPA 1OYIA 1ODDA 2OJED 2G7HA 4LK0F 2X1EA 3F8CA 2LC2A 4FHTA 1X1CA 4PSWA 2L5QA 3UR3C 4A3GJ 3E5XA 4BQAA 5E3LA 2P5KA 2ZKZA 4UUSA 3CCVI 4G9YA 1D0ZA 2EH3A 3TEDA 1DDNA 4BEHA 2OBPA 4X6AJ 1HC8A 1U5TA 3OYBA 3CDIA 4Y4RA 3PO3J 4P9UA 3QAHA 1USSA 2X4HA 1HW2A 1DU6A 5FKMA 5LGUA 3D1NI 1IN6A 2AO9A 2W84A 4MFDA 4JOMA 2L02A 1XMKA 4YIIA 1B1BA 3HKZA 4A5NA 2QZ8A 1UAAA 2W85A 3RSNA 1YJWI 1P6RA 1S8NA 1WCMJ 3JCUC 3E6DA 2O5RA 3GF2A 4ASNA 2F5CA 1VI0A 4XOPA 4Q47A 4BY1J 3SZPA 3OYGA 2BVMA 3JRAA 2K86A 5CLSA 4D1QA 2L54A 2LD5A 1TW2A 1D1BA 1FBSA 4ENJA 2E2IJ 2DN0A 5HDKA 5L3DA 4D5CA 3E6MA 2EZHA 4ZYAA 1V54H 1Y56A 3I5UA 2DYSH 5LEKA 3D5RC 4EGYA 1BC7C 3V7SA 2R3SA 2DTZA 5IPAA 3CMEI 2LY1A 4L9VA 1J59A 1RKWA 2M9HA 4A69C 4DYRA 4ZTJA 2EIKH 4L9NA 3H0GJ 3MN2A 1ONVA 4C3JJ 3LSTA 5E20A 3H92A 4RAYA 1TZLA 2ZSIB 2H8RA 2O8KA 2CQQA 2DDBA 2OCEA 1KZHA 1H9GA 4OIQF 2MC4A 3UNGC 3GTJJ 3RQIA 3BY6A 3LWFA 5HODA 1D1AA 1MNDA 1FX7A 2P5LC 3ZQQA 3OSFA 4NQWB 1ZRDA 5EEHA 3JTHA 3KX2A 1H9TA 4M9ZA 5BNGA 4KT6A 2IGKA 1X4PA 4HQEA 3O8GA 2OAZA 4CZCA 3A1YA 3PNYA 3I53A 5M5WJ 4QLCU 3OIPA 5KAFC 6PAXA 2MG4A 5D5VB 3SFZA 2D1HA 4J00A 5FB2A 2H94A 4F55A 5HLIA 5IOYA 3TO6A 1B6AA 3DBLB 3H5NA 1FWZA 4DNCA 1MJAA 4KN4X 1YE9A 2ZFWA 3J80Z 4I6ZA 3K4NA 3K1MA 4D7NA 4IHXA 2YX4A 2XROA 3WE2A 3MQ0A 4XSZF 2CFOA 3HGGA 1NK3P 1ZQ3P 2KMUA 3COAC 2VJ4A 5HOOA 5M3MJ 2WC2A 1USTA 4EM2A 3WGIA 5GPCA 1GXQA 1P9QC 3VSKA 3HUGA 4X1EA 3A01B 1E3HA 1AKHA 3LNQA 1S6LA 4PJJA 1D5YA 1TT5B 2OU2A 1FBQA 4GO1A 1G8XA 2VJJA 2D5VA 2KZVA 1OFCX 1BI0A 1E2XA 3KETA 1PP7U 3AAFA 1BR1A 4A3MJ 3W2VA 4OMZA 3I3LA 4A0ZA 4LGWA 4B1RA 1IXCA 4N9HA 1WJCA 2HKOA 5D5WB 5E8GA 4HQMA 2CW8A 1SFUA 2WV0A 4BHCA 5FD6A 2A69F 3DLAA 3M1CA 1TQIA 4AWXB 3SEQA 4G94A 3K4BA 3WHBA 2EILH 1FP2A 3ZR8X 2FU4A 4FX4A 1L3LA 2KQRA 1GDTA 4GDFA 1SAUA 1NHAA 3DQVC 5DD4A 2KIUA 3GX4X 2YS9A 1LDKB 3M7GA 2CGPA 4M71A 3KE2A 1G3TA 2K9MA 1IZ1A 3JSOA 2XAGA 3KYLA 4PJNA 3TO9A 1KQ8A 2MC3A 3CLQA 2DA1A 3FBIB 4OMYA 1VQNI 5B5EC 5LHIA 2PBIA 2HR3A 3HSFA 4BXUA 5E3OA 3RPQA 2OTJI 2IW5A 4V19K 2EV6A 4XICA 2X6XA 3NRVA 1C0WA 4L9JA 5FKLA 5FLVA 5FLXK 5C3EJ 3V42A 4XLPF 2NS8A 3BZ6A 4E6KG 1MMAA 1Y8RB 3FXJA 2PMUA 2XPWA 2ESHA 5JVGF 3B02A 1R23A 2V6EA 2R92J 4BUPA 3FIWA 1FOKA
chains in the Genus database with same CATH topology
1MDMB 3BROA 3V7CA 1YFHA 1Q1HA 4BNCA 2IA0A 4ZYDA 2FF4A 4XSXF 2VBZA 4WXHA 3DEUA 2Z99A 4WF2A 1HSTA 4KA4A 3VB2A 3EYYA 2XIGA 1F1ZA 1YLFA 3L2CA 1O3SA 1G3WA 2XUBA 3DFGA 3F22A 2A3SA 3HIFA 2QQAA 3ZMDA 2GXBA 1BBYA 3I59B 1R5GA 4HV6A 3IKTA 2F5FA 3GUDA 2PMHA 3WODF 1T38A 3TOAA 2UXXA 3P9CA 2HQNA 3E97A 2ZCWA 1R5HA 4AIHA 3QP5A 1R7JA 4PGHA 2MBFA 3CUQC 4CXFA 1WQ2A 4MQ9F 3T1BA 3V8JA 1RUOA 4L9TA 2MA3A 3C3WA 3QU3A 3RKXA 2G9WA 1JHHA 3J81K 4I09A 2V9VA 4IF4A 5ICGA 2A07F 4RB0A 1R1UA 4RGUA 3Q9SA 1PUEE 2PJPA 3FMQA 1ZRCA 3KZZA 3W6JB 1IUYA 3MZHA 4LG0A 1B59A 1B9NA 2UXNA 3P9IA 5E1XA 5ICEA 4RB2C 1XB4A 4EQQA 3I59A 4U7DA 3P9KA 3O2PE 3WTYC 4YFKF 2Z3YA 3BP8A 5LRRA 4U88A 2WTEA 4G6QA 4IRIA 1OYWA 2B0LA 1KU3A 1T39A 3D5LA 5DUIA 2P6TA 5K5QA 1W4MA 3K0LA 4BHPA 1ZH5A 1P92A 3I71A 1HSJA 2VONA 1STZA 1V4RA 5CVVA 1LDJA 1Y0UA 4XLNF 3F6VA 3DPTA 3WTZA 3WU1B 1R1TA 1BIBA 1FLIA 3ABTA 1IN4A 2GZWA 3I0TA 1O57A 1UCRA 5ILVA 2ZO4A 1J2XA 3HOTA 2W25A 4HBLA 3WG9A 4KYWA 2J5OA 4LLNA 1HW1A 4O3MA 2QQ9A 3WTSC 3RPUA 4G7HF 1FPQA 2LDUA 2M87A 3M8EA 1U5TC 1XGSA 1Z6RA 2F5DA 1J7KA 4EGZA 3MWMA 4PDKA 3CUQB 4A6EA 4R8HA 5ED4A 2STTA 4WX9A 2CQKA 1FSEA 1HBXG 4OU0A 4FT8A 3DF8A 4L5JA 3N97A 4M72A 1D8JA 1FBUA 3RYPA 2HS5A 5H6QA 4LLGF 1S3JA 1KU2A 3BJOA 1DPRA 2OQRA 2CFXA 1QZYA 4B09A 1BI1A 5L3BA 1IN8A 2A6HF 3IHUA 1DUXC 4ESFA 2ESNA 1HW5A 4KDPA 4I01A 2RDPA 4S05A 3ZMSA 3I58A 2WWYA 4NHJA 3FHZA 1EV7A 4Z2YA 3U1DA 1U78A 1D8KA 3IRQA 1EH8A 1TQPA 3FMRA 3WU0A 4E70A 4N9IA 4O6JA 2DPUA 2V6CA 4CDGA 4RAZA 2CG4A 1IN7A 2HYGD 1U5TB 1FT9A 2HFHA 4A6DA 4ESBA 3DXJF 2QUFA 2BBYA 3F23A 2G7UA 4P55A 4RGSA 2ZJ2A 2HWVA 3F8FA 2LSOA 1I1GA 4U0YA 1LQ1A 3FXQA 3CO6C 4S04A 3ZMUA 4HV5A 1LNWA 1TLHB 3HSRA 2MLKA 4RB1A 3K1NA 1R36A 3JW4A 2MH9A 3LAJA 3T8RA 4KIFA 2X0LA 5JHUA 1T0FA 3DPLC 2QBYA 5ERIA 3EETA 1SD4A 4KIBA 2O03A 1IRGA 3I54A 2AXLA 3M8FA 5DCFA 3IKVA 1I27A 4UUVA 2GAUA 2EA4A 4MQVA 3ULQB 3GEZA 3BDDA 2C6YA 1XSXA 2M8EA 1LDDA 3GYHX 4FX0A 3H3UA 4I2OA 4BH9A 3CDHA 1MGTA 1YTYA 1XN7A 1YS6A 5H20A 3QRFF 2MLGA 3MCZA 1K78B 4OIRF 3SXYA 1MKMA 2KRFA 3TO7A 2ETHA 1ULYA 5FFZA 4HOBA 3EDPA 4HDUA 3KP5A 4HF2A 1P4WA 1ON2A 3FM3A 1ZRFA 5AIPA 4IHTA 2PG4A 3B73A 3KEQA 1W7PD 4M74A 3R0JA 5LGTA 2V1DA 5HS9A 4A5MA 2YPRA 2OZUA 4EVIA 4OIPF 5ILUA 3JAMZ 1R00A 5FD5A 1IF1A 2EK5A 2DT5A 1XGNA 3J7AO 3GFIA 3T0YA 2P5VA 5JVTA 4EM0B 3HOSA 2XRNA 3Q5FA 1CF7B 3V4GA 2P6SA 3KP6A 2EV0A 5F6FA 1XDSA 2UWMA 5HLGA 1LB2A 2Y48A 2QLZA 2RVCA 3TOBA 5F1RA 1QBJA 1GHCA 4LMYA 1G4DA 4AIJA 1FYMA 3ZMTA 3QPHA 2VODA 2CSOA 3TDZC 3MFKA 2V1UA 2KJCA 2ZMEA 2OD5A 3RKWA 2ZNZA 3RTRA 4EJOA 5JFRA 1XCVA 2O8XA 1FYLA 4MTEA 4LFUA 5FO5A 3F6OA 3RIRA 5E18F 5BPDA 2QVOA 3BWGA 1AOYA 1SMTA 1KGSA 1UHWA 5HLHA 2E7WA 2FNPA 1HKQA 4LD5A 4YIFA 2HGCA 1IRFA 1JGSA 3GWZA 1R58A 2P8TA 5D5UB 2ISZA 2R7DA 3LQQA 4AD9A 2Y75A 3FXRA 1D5VA 3RDIA 5IT9Z 2FBHA 4ENKA 2Z33A 2BYVE 1I5ZA 4K2EA 4N0BA 1MZBA 1YS7A 1BI2A 1Z6TA 4BYYA 4UNOA 3KP2A 2XHKA 4CYDA 2HDCA 1K78A 2CWEA 2M1BA 2YR2A 1BJAA 3H3ZA 3KZYA 3NQOA 4RS8A 5TRDA 1QO0D 1XGMA 3HRTA 3KLNA 3ZPLA 4LG0B 1TW3A 3J81Z 3K69A 2QBYB 1SD7A 4JBAA 2XASA 1S7AA 4UXNA 2P4WA 4EJTA 2HTJA 5D8LB 4CZZA 2QWWA 3RI4A 1E17A 2RV8A 4HLYA 1QZZA 1LEBA 5HS7A 2DFIA 2QM3A 1BOAA 2DLLA 1ZGAA 5LBQA 3BPXA 1WRJA 4OOIA 4P9FA 1SFEA 3ZMZA 4CICA 1F5TA 2P7VB 5D6FA 5L3FA 2ZXJA 2GIVA 5LGNA 3JAMK 3ZP5A 4MHGA 1OKRA 2EFNA 2FQ3A 2BV6A 4HX4A 2E7XA 2PFBA 4ENMA 3KP7A 4WK8F 2EFWA 4UV8A 4ENNA 1Z05A 1HKTA 4WXCA 1YO5C 4KUMA 1TTYA 1TNSA 1YW7A 3FZVA 2ACJA 2KIMA 3CO7C 5DDGA 3WTUC 3D0SA 4YG2F 2FEZA 2P7CB 4Q48A 1MD0A 2UZKA 2VBYA 4IXAA 3RKYA 5D6EA 1JXSA 1IN5A 2DPDA 3GZ5A 3K1PA 4M73A 1ZG3A 3ZQ7A 1LVAA 2K7LA 4L0YB 1XGOA 3R0AA 2Q0OA 3WTTC 5L3CA 3LA3A 3GXOA 3ECHA 5ICFA 5L3GA 5FFXA 2LF8A 2BE5F 3WTVC 4U7BA 1OPCA 1REPC 2FNAA 5E8IA 2H27A 2PEXA 4ZYEA 2DTRA 1QPMA 4JQFA 4HF0A 2VN2A 1D3YA 2OZ6A 1B9MA 2PLYA 4G6DA 4ZYHA 3VFZA 4UVCA 1FP1D 4CHUA 3C7JA 5J8FA 5J6XA 2FRHA 1BM9A 2VT3A 3KFWX 4I0BA 2V79A 1SD6A 3I64A 3BJAA 2Q2EA 2ZNYA 2HTSA 1FC3A 3FF5A 3GVAA 4UHTA 3MEXA 2GWRA 2DQRA 1T2KA 1U8RA 4NB5A 2DK5A 3BJ6A 3EUHA 2EJRA 2H6CA 5A2QK 1IXSB 2JT1A 5J8CA 2PQ8A 2Y0MA 4GXOA 5CJ9A 1LJ9A 4KIGA 2FMLA 5CVJA 1XSDA 3F21A 1QQIA 5LEJA 4CGZA 3HRUA 4PCQA 3GO5A 4M6XA 3CLOA 1JHFA 4B8XA 4EV0A 2DU9A 1QNTA 4ZYGA 2FMYA 1RZ4A 1G3YA 2FSWA 1H0MA 3L7WA 3N4MA 4IRHA 3KEOA 2L01A 1K79A 3WGHA 4HW0A 5LHGA 4U0VA 2VOOA 2D1VA 3EQLF 4OINF 3F8NA 1KU9A 4AVPA 1HKSA 4MTDA 3CTAA 2XAQA 3FMSA 4EMSA 5CVIA 5KVRA 1XMAA 2D2WA 2V1XA 2VBWA 3E5UA 4WXDA 2ADUA 1U2WA 2BEOA 5BMZA 5HDNA 3TQNA 2QQBA 3F72A 2HQRA 3E6BA 5K5OA 4MEXF 2JPCA 1KU7A 3L09A 5HVQC 5ILSA 3QU6A 3LA2A 4IJAA 4IRGA 2IP2A 2RN7A 2NYXA 1ZREA 1ZLKA 2KIFA 2XAJA 2AS5F 2CW0F 2FBKA 4YFXF 2A68F 4HZFA 1GVJA 5D4SA 2D45A 1HXDA 2IA1A 1ZYRF 3HTUA 3IWFA 3LFKA 4R1HA 2Q8KA 2KJBA 4RGRA 1KQ9A 2IPQX 4BHBA 1TNTA 2CO5A 3E5QA 3K9TA 4XBFA 2JPBA 4P96A 3KLOA 2GA2A 4PGGA 3PQKA 1FY7A 2VE8A 1DP7P 2VC0A 1SFXA 3RJPA 4HYEA 5DD8A 4I98B 5E1ZB 3V8LA 3W6KB 1WSUA 3DV8A 2JSCA 1UFMA 3R4KA 1I6XA 5FGMA 2L3DA 2DI3A 5IT9K 4H0EA 3HRSA 1RIOH 1J9IA 2NRAC 5BOXA 2MD5A 1U6GA 2STWA 4IVNA 3G73A 1YIOA 4A0YA 4ZZDA 2LNBA 2F2EA 1O3TA 4LLLA 1I1SA 2ZBKA 2XGXA 2HZTA 4LJZF 4DQ2A 2Z9OA 2R7FA 2E1NA 2DO7A 5DCMB 3ECOA 3ABUA 4YFNF 3TGNA 1W7PA 3CUQA 3M1EA 3V8KA 1VTNC 2LF7A 1IW7F 2OA4A 3IC7A 4NQWA 2EA2A 1PP8F 4UVBA 3QPTA 1MJBA 1XD7A 2EFOA 1BN5A 1GXPA 2A6EF 5TJJA 5LLQA 3C18A 2J5PA 2E1CA 5F64A 2OQGA 4MNUA 1P4XA 2O3FA 2A61A 3R60A 5K5RA 1T98A 2YSRA 1ZHFA 1R22A 3QP6A 3ZMVA 1A04A 4G7ZF 1O3QA 4KNYA 1ON1A 4KN7X 4ZZLA 1XDUA 4GYGA 1XCBA 2EV5A 5E1WA 1ZN2A 2FE3A 1ZARA 1RUNA 1X3UA 3DP7A 3F8BA 1OYYA 2EFPA 4TV7A 2QYOA 2FBIA 3ZN1A 2K02A 4ON0A 4MGRA 1FYKA 3M9AA 2VOPA 4MEYF 3FWEA 1W7PB 1FSHA 3P7NA 4RGXA 1Z91A 4Y17A 4ESJA 3IRRA 4IHSA 1YYVA 1F4KA 2GA1A 4EJUA 1J75A 5ICCA 3GFLA 2DQLA 4HA8A 2GQQA 4Q4ZF 3VODA 4L0ZB 5HS8A 2HEOA 1XSVA 2XV4S 2A5YB 2VXZA 3G3ZA 3ML6A 2PN6A 4CO8A 1K7AA 2O61A 2JTVA 1FZPB 2NS0A 2L4MA 5DCMA 3GFMA 2TDXA 4P5OA 3Q9VA 4G7OF 3OV8A 2O6GE 1G3SA 5AIQA 5E17F 3TDUC 4AIKA 1YW8A 3ZN0A 1ZAOA 3I4PA 1SD5A 4WCGA 1MJ9A 4KMFA 3CJNA 4HLXA 5AONA 4KMUX 2XAFA 4M9XA 3ELKA 3REOA 3CUOA 3GZ6A 2CYYA 3TKYA 3C1DA 3O3KA 2VE9A 3BOQA 5BS6A 4ETSA 4A2UA 3WGGA 4A12A 1LEAA 4LK1F 1U3EM 2Z5UA 1YQAA 3IWZA 2EWNA 4L5IA 1EH7A 2HYFA 2VBXA 1O7LA 1K6OA 4Y15A 3GFJA 4L18B 1EH6A 3MAJA 2IVMA 1S7OA 2DW4A 2YX7A 2RC4A 3U9GA 2XKPA 4R79A 4IPAA 5JR3A 2EB7A 2IRFG 4OIOF 3GW2A 1TQMA 1J5YA 2IT0A 4G8XA 1O7FA 1BI3A 1Z9CA 3LQRA 3HSEA 1J0RA 1RI7A 4ZH4F 3JTGA 3K2ZA 3DKWA 3HTSB 1QGPA 4A0XA 3E3VA 1BIAA 2ELHA 4M9SA 5KK1A 3T8TA 4D0PA 4O5VA 2K27A 5A2QZ 3LA7A 4HF1A 3VOEA 4LB5A 1FNNA 4QWQA 2HOEA 1Z7UA 3VEPA 5FLXZ 2W24A 1BC8C 3R6SA 3ROUA 2COMA 5H6RA 3SZTA 3FXUA 2HKXA 1CF7A 1KYWA 1W5TA 5D5XB 2K4BA 2NNNA 5HDGA 4GYIA 1SMYF 5BQTA 3O6BB 2L4AA 2RGVA 4KICA 3L9FA 3GLXA 4EJVA 3F8MA 3V7RA 1R1VA 5BPIA 5LRSA 1ZGJA 1AWCA 1YW9A 2ZMEB 1PDNC 2YU3A 2FXAA 4I0AA 3KP3A 3LAPA 1IXRC 4GCVA 1OMIA 1P2FA 2BGCA 2JRTA 2KKOA 3IL2A 5DUKA 5D4RA 1ZG1A 2XVCA 2NAZA 2FOKA 1WWXA 4HX7A 3BPVA 1IAWA 2VC1A 5IT3A 5EEGA 1HQCA 2JZYA 2M5WA 2RQPA 3ERED 3KCCA 5CVRA 2DK8A 4EM1A 5JI6A 1W5SA 5K1YA 4HAMA 4XRFA 4RB3C 1G6NA 2K4JA 3HHGA 5DEQA 1YG2A 3SHFA 5L3EA 2FA5A 3JSPA 2M30A 2XAHA 2QENA 2PI0A 4Q5SF 5LHHA 4HDVA 2NNYA 3PQJA 1P4AA 2MH2A 2XKOA 3RYRA 4UVAA 3L00A 1JE8A 2ISYA 3WTXC 1UHMA 1S29A 3HRMA 3J80K 4EJWA 2H09A 4KFCA 3HYIA 3EYIA 4U0WA 5D8KB 1KA8A 2GXGA 2VT2A 1ZG5A 4KT5C 1RNLA 5DV5A 3R61A 3SQNA 1KYZA 2DAOA 4M6YA 4BAYA 3WTWC 1O3RA 4I7HA 3MZYA 3NEUA 3FX3A 1Z1DA 3HHHA 2RKHA 1T6SA 1MDMA 1CGPA 3T5XA 3S2WA 2EFQA 1L0OC 4UV9A 2M45A 5CYVA 1DPUA 1WI9A 1ZLJA 4Y13A 2F5EA 2O0YA 3ISPA 4I02A 3PFIA 1OR7A 3U2RA 4WWCA 3QOPA 4HX8A 1B4AA 2W57A 1KQ0A 2RNJA 4PZJA 1SAXA 1V3FA 2IA2A 1WKMA 2LKPA 5CVUA 1TBXA 3FM5A 1F9NA 5DYMA 3WE3A 3E6CC 3KP4A 4JK1X 3OOPA 1UB9A 4GGGA 3F3XA 2DBBA 2IJLA 2H6BA 4LB6B 1OYIA 1ODDA 2G7HA 4LK0F 3F8CA 4FHTA 3E5XA 4BQAA 2P5KA 2ZKZA 4G9YA 1DDNA 2OBPA 1U5TA 4P9UA 3QAHA 1USSA 2X4HA 1HW2A 5LGUA 1IN6A 2W84A 2L02A 1XMKA 4YIIA 1B1BA 4A5NA 2QZ8A 2W85A 1P6RA 1S8NA 3E6DA 3GF2A 4ASNA 2F5CA 4Q47A 3SZPA 2K86A 5CLSA 2L54A 1TW2A 1FBSA 4ENJA 5HDKA 5L3DA 3E6MA 3I5UA 5LEKA 4EGYA 1BC7C 3V7SA 2R3SA 4L9VA 1J59A 4L9NA 1ONVA 3LSTA 5E20A 3H92A 4RAYA 1H9GA 4OIQF 3BY6A 3LWFA 1FX7A 2P5LC 1ZRDA 5EEHA 3JTHA 1H9TA 4M9ZA 4HQEA 2OAZA 3I53A 4QLCU 6PAXA 5D5VB 3SFZA 2D1HA 5FB2A 2H94A 5HLIA 3TO6A 1B6AA 4DNCA 1FWZA 1MJAA 4KN4X 2ZFWA 3J80Z 3K1MA 2YX4A 2XROA 3WE2A 3MQ0A 4XSZF 3COAC 5HOOA 2WC2A 1USTA 4EM2A 3WGIA 1GXQA 3HUGA 1S6LA 2OU2A 1FBQA 4GO1A 1BI0A 1E2XA 3KETA 1PP7U 3AAFA 4OMZA 4A0ZA 4LGWA 1IXCA 4N9HA 2HKOA 5D5WB 5E8GA 4HQMA 1SFUA 2WV0A 4BHCA 5FD6A 2A69F 1TQIA 4AWXB 4G94A 4FX4A 1FP2A 1L3LA 2FU4A 3DQVC 1NHAA 3GX4X 2KIUA 5DD4A 1LDKB 3M7GA 2CGPA 4M71A 3KE2A 1G3TA 3JSOA 1IZ1A 2XAGA 3TO9A 1KQ8A 2MC3A 4OMYA 5LHIA 2PBIA 2HR3A 3HSFA 4BXUA 3RPQA 2IW5A 2EV6A 3NRVA 1C0WA 4L9JA 5FLXK 4XLPF 3BZ6A 2PMUA 2ESHA 3B02A 1R23A 4F7ZA 1FOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDM B;  3BRO A;  3V7C A;  1YFH A;  1Q1H A;  4BNC A;  2IA0 A;  4ZYD A;  2FF4 A;  4XSX F;  2VBZ A;  4WXH A;  3DEU A;  2Z99 A;  4WF2 A;  1HST A;  4KA4 A;  3VB2 A;  3EYY A;  2XIG A;  1F1Z A;  1YLF A;  3L2C A;  1O3S A;  1G3W A;  2XUB A;  3DFG A;  3F22 A;  2A3S A;  3HIF A;  2QQA A;  3ZMD A;  2GXB A;  1BBY A;  3I59 B;  1R5G A;  4HV6 A;  3IKT A;  2F5F A;  3GUD A;  2PMH A;  3WOD F;  1T38 A;  3TOA A;  2UXX A;  3P9C A;  2HQN A;  3E97 A;  2ZCW A;  1R5H A;  4AIH A;  3QP5 A;  1R7J A;  4PGH A;  2MBF A;  3CUQ C;  4CXF A;  1WQ2 A;  4MQ9 F;  3T1B A;  3V8J A;  1RUO A;  4L9T A;  2MA3 A;  3C3W A;  3QU3 A;  3RKX A;  2G9W A;  1JHH A;  3J81 K;  4I09 A;  2V9V A;  4IF4 A;  5ICG A;  2A07 F;  4RB0 A;  1R1U A;  4RGU A;  3Q9S A;  1PUE E;  2PJP A;  3FMQ A;  1ZRC A;  3KZZ A;  3W6J B;  1IUY A;  3MZH A;  4LG0 A;  1B59 A;  1B9N A;  2UXN A;  3P9I A;  5E1X A;  5ICE A;  4RB2 C;  1XB4 A;  4EQQ A;  3I59 A;  4U7D A;  3P9K A;  3O2P E;  3WTY C;  4YFK F;  2Z3Y A;  3BP8 A;  5LRR A;  4U88 A;  2WTE A;  4G6Q A;  4IRI A;  1OYW A;  2B0L A;  1KU3 A;  1T39 A;  3D5L A;  5DUI A;  2P6T A;  5K5Q A;  1W4M A;  3K0L A;  4BHP A;  1ZH5 A;  1P92 A;  3I71 A;  1HSJ A;  2VON A;  1STZ A;  1V4R A;  5CVV A;  1LDJ A;  1Y0U A;  4XLN F;  3F6V A;  3DPT A;  3WTZ A;  3WU1 B;  1R1T A;  1BIB A;  1FLI A;  3ABT A;  1IN4 A;  2GZW A;  3I0T A;  1O57 A;  1UCR A;  5ILV A;  2ZO4 A;  1J2X A;  3HOT A;  2W25 A;  4HBL A;  3WG9 A;  4KYW A;  2J5O A;  4LLN A;  1HW1 A;  4O3M A;  2QQ9 A;  3WTS C;  3RPU A;  4G7H F;  1FPQ A;  2LDU A;  2M87 A;  3M8E A;  1U5T C;  1XGS A;  1Z6R A;  2F5D A;  1J7K A;  4EGZ A;  3MWM A;  4PDK A;  3CUQ B;  4A6E A;  4R8H A;  5ED4 A;  2STT A;  4WX9 A;  2CQK A;  1FSE A;  1HBX G;  4OU0 A;  4FT8 A;  3DF8 A;  4L5J A;  3N97 A;  4M72 A;  1D8J A;  1FBU A;  3RYP A;  2HS5 A;  5H6Q A;  4LLG F;  1S3J A;  1KU2 A;  3BJO A;  1DPR A;  2OQR A;  2CFX A;  1QZY A;  4B09 A;  1BI1 A;  5L3B A;  1IN8 A;  2A6H F;  3IHU A;  1DUX C;  4ESF A;  2ESN A;  1HW5 A;  4KDP A;  4I01 A;  2RDP A;  4S05 A;  3ZMS A;  3I58 A;  2WWY A;  4NHJ A;  3FHZ A;  1EV7 A;  4Z2Y A;  3U1D A;  1U78 A;  1D8K A;  3IRQ A;  1EH8 A;  1TQP A;  3FMR A;  3WU0 A;  4E70 A;  4N9I A;  4O6J A;  2DPU A;  2V6C A;  4CDG A;  4RAZ A;  2CG4 A;  1IN7 A;  2HYG D;  1U5T B;  1FT9 A;  2HFH A;  4A6D A;  4ESB A;  3DXJ F;  2QUF A;  2BBY A;  3F23 A;  2G7U A;  4P55 A;  4RGS A;  2ZJ2 A;  2HWV A;  3F8F A;  2LSO A;  1I1G A;  4U0Y A;  1LQ1 A;  3FXQ A;  3CO6 C;  4S04 A;  3ZMU A;  4HV5 A;  1LNW A;  1TLH B;  3HSR A;  2MLK A;  4RB1 A;  3K1N A;  1R36 A;  3JW4 A;  2MH9 A;  3LAJ A;  3T8R A;  4KIF A;  2X0L A;  5JHU A;  1T0F A;  3DPL C;  2QBY A;  5ERI A;  3EET A;  1SD4 A;  4KIB A;  2O03 A;  1IRG A;  3I54 A;  2AXL A;  3M8F A;  5DCF A;  3IKV A;  1I27 A;  4UUV A;  2GAU A;  2EA4 A;  4MQV A;  3ULQ B;  3GEZ A;  3BDD A;  2C6Y A;  1XSX A;  2M8E A;  1LDD A;  3GYH X;  4FX0 A;  3H3U A;  4I2O A;  4BH9 A;  3CDH A;  1MGT A;  1YTY A;  1XN7 A;  1YS6 A;  5H20 A;  3QRF F;  2MLG A;  3MCZ A;  1K78 B;  4OIR F;  3SXY A;  1MKM A;  2KRF A;  3TO7 A;  2ETH A;  1ULY A;  5FFZ A;  4HOB A;  3EDP A;  4HDU A;  3KP5 A;  4HF2 A;  1P4W A;  1ON2 A;  3FM3 A;  1ZRF A;  5AIP A;  4IHT A;  2PG4 A;  3B73 A;  3KEQ A;  1W7P D;  4M74 A;  3R0J A;  5LGT A;  2V1D A;  5HS9 A;  4A5M A;  2YPR A;  2OZU A;  4EVI A;  4OIP F;  5ILU A;  3JAM Z;  1R00 A;  5FD5 A;  1IF1 A;  2EK5 A;  2DT5 A;  1XGN A;  3J7A O;  3GFI A;  3T0Y A;  2P5V A;  5JVT A;  4EM0 B;  3HOS A;  2XRN A;  3Q5F A;  1CF7 B;  3V4G A;  2P6S A;  3KP6 A;  2EV0 A;  5F6F A;  1XDS A;  2UWM A;  5HLG A;  1LB2 A;  2Y48 A;  2QLZ A;  2RVC A;  3TOB A;  5F1R A;  1QBJ A;  1GHC A;  4LMY A;  1G4D A;  4AIJ A;  1FYM A;  3ZMT A;  3QPH A;  2VOD A;  2CSO A;  3TDZ C;  3MFK A;  2V1U A;  2KJC A;  2ZME A;  2OD5 A;  3RKW A;  2ZNZ A;  3RTR A;  4EJO A;  5JFR A;  1XCV A;  2O8X A;  1FYL A;  4MTE A;  4LFU A;  5FO5 A;  3F6O A;  3RIR A;  5E18 F;  5BPD A;  2QVO A;  3BWG A;  1AOY A;  1SMT A;  1KGS A;  1UHW A;  5HLH A;  2E7W A;  2FNP A;  1HKQ A;  4LD5 A;  4YIF A;  2HGC A;  1IRF A;  1JGS A;  3GWZ A;  1R58 A;  2P8T A;  5D5U B;  2ISZ A;  2R7D A;  3LQQ A;  4AD9 A;  2Y75 A;  3FXR A;  1D5V A;  3RDI A;  5IT9 Z;  2FBH A;  4ENK A;  2Z33 A;  2BYV E;  1I5Z A;  4K2E A;  4N0B A;  1MZB A;  1YS7 A;  1BI2 A;  1Z6T A;  4BYY A;  4UNO A;  3KP2 A;  2XHK A;  4CYD A;  2HDC A;  1K78 A;  2CWE A;  2M1B A;  2YR2 A;  1BJA A;  3H3Z A;  3KZY A;  3NQO A;  4RS8 A;  5TRD A;  1QO0 D;  1XGM A;  3HRT A;  3KLN A;  3ZPL A;  4LG0 B;  1TW3 A;  3J81 Z;  3K69 A;  2QBY B;  1SD7 A;  4JBA A;  2XAS A;  1S7A A;  4UXN A;  2P4W A;  4EJT A;  2HTJ A;  5D8L B;  4CZZ A;  2QWW A;  3RI4 A;  1E17 A;  2RV8 A;  4HLY A;  1QZZ A;  1LEB A;  5HS7 A;  2DFI A;  2QM3 A;  1BOA A;  2DLL A;  1ZGA A;  5LBQ A;  3BPX A;  1WRJ A;  4OOI A;  4P9F A;  1SFE A;  3ZMZ A;  4CIC A;  1F5T A;  2P7V B;  5D6F A;  5L3F A;  2ZXJ A;  2GIV A;  5LGN A;  3JAM K;  3ZP5 A;  4MHG A;  1OKR A;  2EFN A;  2FQ3 A;  2BV6 A;  4HX4 A;  2E7X A;  2PFB A;  4ENM A;  3KP7 A;  4WK8 F;  2EFW A;  4UV8 A;  4ENN A;  1Z05 A;  1HKT A;  4WXC A;  1YO5 C;  4KUM A;  1TTY A;  1TNS A;  1YW7 A;  3FZV A;  2ACJ A;  2KIM A;  3CO7 C;  5DDG A;  3WTU C;  3D0S A;  4YG2 F;  2FEZ A;  2P7C B;  4Q48 A;  1MD0 A;  2UZK A;  2VBY A;  4IXA A;  3RKY A;  5D6E A;  1JXS A;  1IN5 A;  2DPD A;  3GZ5 A;  3K1P A;  4M73 A;  1ZG3 A;  3ZQ7 A;  1LVA A;  2K7L A;  4L0Y B;  1XGO A;  3R0A A;  2Q0O A;  3WTT C;  5L3C A;  3LA3 A;  3GXO A;  3ECH A;  5ICF A;  5L3G A;  5FFX A;  2LF8 A;  2BE5 F;  3WTV C;  4U7B A;  1OPC A;  1REP C;  2FNA A;  5E8I A;  2H27 A;  2PEX A;  4ZYE A;  2DTR A;  1QPM A;  4JQF A;  4HF0 A;  2VN2 A;  1D3Y A;  2OZ6 A;  1B9M A;  2PLY A;  4G6D A;  4ZYH A;  3VFZ A;  4UVC A;  1FP1 D;  4CHU A;  3C7J A;  5J8F A;  5J6X A;  2FRH A;  1BM9 A;  2VT3 A;  3KFW X;  4I0B A;  2V79 A;  1SD6 A;  3I64 A;  3BJA A;  2Q2E A;  2ZNY A;  2HTS A;  1FC3 A;  3FF5 A;  3GVA A;  4UHT A;  3MEX A;  2GWR A;  2DQR A;  1T2K A;  1U8R A;  4NB5 A;  2DK5 A;  3BJ6 A;  3EUH A;  2EJR A;  2H6C A;  5A2Q K;  1IXS B;  2JT1 A;  5J8C A;  2PQ8 A;  2Y0M A;  4GXO A;  5CJ9 A;  1LJ9 A;  4KIG A;  2FML A;  5CVJ A;  1XSD A;  3F21 A;  1QQI A;  5LEJ A;  4CGZ A;  3HRU A;  4PCQ A;  3GO5 A;  4M6X A;  3CLO A;  1JHF A;  4B8X A;  4EV0 A;  2DU9 A;  1QNT A;  4ZYG A;  2FMY A;  1RZ4 A;  1G3Y A;  2FSW A;  1H0M A;  3L7W A;  3N4M A;  4IRH A;  3KEO A;  2L01 A;  1K79 A;  3WGH A;  4HW0 A;  5LHG A;  4U0V A;  2VOO A;  2D1V A;  3EQL F;  4OIN F;  3F8N A;  1KU9 A;  4AVP A;  1HKS A;  4MTD A;  3CTA A;  2XAQ A;  3FMS A;  4EMS A;  5CVI A;  5KVR A;  1XMA A;  2D2W A;  2V1X A;  2VBW A;  3E5U A;  4WXD A;  2ADU A;  1U2W A;  2BEO A;  5BMZ A;  5HDN A;  3TQN A;  2QQB A;  3F72 A;  2HQR A;  3E6B A;  5K5O A;  4MEX F;  2JPC A;  1KU7 A;  3L09 A;  5HVQ C;  5ILS A;  3QU6 A;  3LA2 A;  4IJA A;  4IRG A;  2IP2 A;  2RN7 A;  2NYX A;  1ZRE A;  1ZLK A;  2KIF A;  2XAJ A;  2AS5 F;  2CW0 F;  2FBK A;  4YFX F;  2A68 F;  4HZF A;  1GVJ A;  5D4S A;  2D45 A;  1HXD A;  2IA1 A;  1ZYR F;  3HTU A;  3IWF A;  3LFK A;  4R1H A;  2Q8K A;  2KJB A;  4RGR A;  1KQ9 A;  2IPQ X;  4BHB A;  1TNT A;  2CO5 A;  3E5Q A;  3K9T A;  4XBF A;  2JPB A;  4P96 A;  3KLO A;  2GA2 A;  4PGG A;  3PQK A;  1FY7 A;  2VE8 A;  1DP7 P;  2VC0 A;  1SFX A;  3RJP A;  4HYE A;  5DD8 A;  4I98 B;  5E1Z B;  3V8L A;  3W6K B;  1WSU A;  3DV8 A;  2JSC A;  1UFM A;  3R4K A;  1I6X A;  5FGM A;  2L3D A;  2DI3 A;  5IT9 K;  4H0E A;  3HRS A;  1RIO H;  1J9I A;  2NRA C;  5BOX A;  2MD5 A;  1U6G A;  2STW A;  4IVN A;  3G73 A;  1YIO A;  4A0Y A;  4ZZD A;  2LNB A;  2F2E A;  1O3T A;  4LLL A;  1I1S A;  2ZBK A;  2XGX A;  2HZT A;  4LJZ F;  4DQ2 A;  2Z9O A;  2R7F A;  2E1N A;  2DO7 A;  5DCM B;  3ECO A;  3ABU A;  4YFN F;  3TGN A;  1W7P A;  3CUQ A;  3M1E A;  3V8K A;  1VTN C;  2LF7 A;  1IW7 F;  2OA4 A;  3IC7 A;  4NQW A;  2EA2 A;  1PP8 F;  4UVB A;  3QPT A;  1MJB A;  1XD7 A;  2EFO A;  1BN5 A;  1GXP A;  2A6E F;  5TJJ A;  5LLQ A;  3C18 A;  2J5P A;  2E1C A;  5F64 A;  2OQG A;  4MNU A;  1P4X A;  2O3F A;  2A61 A;  3R60 A;  5K5R A;  1T98 A;  2YSR A;  1ZHF A;  1R22 A;  3QP6 A;  3ZMV A;  1A04 A;  4G7Z F;  1O3Q A;  4KNY A;  1ON1 A;  4KN7 X;  4ZZL A;  1XDU A;  4GYG A;  1XCB A;  2EV5 A;  5E1W A;  1ZN2 A;  2FE3 A;  1ZAR A;  1RUN A;  1X3U A;  3DP7 A;  3F8B A;  1OYY A;  2EFP A;  4TV7 A;  2QYO A;  2FBI A;  3ZN1 A;  2K02 A;  4ON0 A;  4MGR A;  1FYK A;  3M9A A;  2VOP A;  4MEY F;  3FWE A;  1W7P B;  1FSH A;  3P7N A;  4RGX A;  1Z91 A;  4Y17 A;  4ESJ A;  3IRR A;  4IHS A;  1YYV A;  1F4K A;  2GA1 A;  4EJU A;  1J75 A;  5ICC A;  3GFL A;  2DQL A;  4HA8 A;  2GQQ A;  4Q4Z F;  3VOD A;  4L0Z B;  5HS8 A;  2HEO A;  1XSV A;  2XV4 S;  2A5Y B;  2VXZ A;  3G3Z A;  3ML6 A;  2PN6 A;  4CO8 A;  1K7A A;  2O61 A;  2JTV A;  1FZP B;  2NS0 A;  2L4M A;  5DCM A;  3GFM A;  2TDX A;  4P5O A;  3Q9V A;  4G7O F;  3OV8 A;  2O6G E;  1G3S A;  5AIQ A;  5E17 F;  3TDU C;  4AIK A;  1YW8 A;  3ZN0 A;  1ZAO A;  3I4P A;  1SD5 A;  4WCG A;  1MJ9 A;  4KMF A;  3CJN A;  4HLX A;  5AON A;  4KMU X;  2XAF A;  4M9X A;  3ELK A;  3REO A;  3CUO A;  3GZ6 A;  2CYY A;  3TKY A;  3C1D A;  3O3K A;  2VE9 A;  3BOQ A;  5BS6 A;  4ETS A;  4A2U A;  3WGG A;  4A12 A;  1LEA A;  4LK1 F;  1U3E M;  2Z5U A;  1YQA A;  3IWZ A;  2EWN A;  4L5I A;  1EH7 A;  2HYF A;  2VBX A;  1O7L A;  1K6O A;  4Y15 A;  3GFJ A;  4L18 B;  1EH6 A;  3MAJ A;  2IVM A;  1S7O A;  2DW4 A;  2YX7 A;  2RC4 A;  3U9G A;  2XKP A;  4R79 A;  4IPA A;  5JR3 A;  2EB7 A;  2IRF G;  4OIO F;  3GW2 A;  1TQM A;  1J5Y A;  2IT0 A;  4G8X A;  1O7F A;  1BI3 A;  1Z9C A;  3LQR A;  3HSE A;  1J0R A;  1RI7 A;  4ZH4 F;  3JTG A;  3K2Z A;  3DKW A;  3HTS B;  1QGP A;  4A0X A;  3E3V A;  1BIA A;  2ELH A;  4M9S A;  5KK1 A;  3T8T A;  4D0P A;  4O5V A;  2K27 A;  5A2Q Z;  3LA7 A;  4HF1 A;  3VOE A;  4LB5 A;  1FNN A;  4QWQ A;  2HOE A;  1Z7U A;  3VEP A;  5FLX Z;  2W24 A;  1BC8 C;  3R6S A;  3ROU A;  2COM A;  5H6R A;  3SZT A;  3FXU A;  2HKX A;  1CF7 A;  1KYW A;  1W5T A;  5D5X B;  2K4B A;  2NNN A;  5HDG A;  4GYI A;  1SMY F;  5BQT A;  3O6B B;  2L4A A;  2RGV A;  4KIC A;  3L9F A;  3GLX A;  4EJV A;  3F8M A;  3V7R A;  1R1V A;  5BPI A;  5LRS A;  1ZGJ A;  1AWC A;  1YW9 A;  2ZME B;  1PDN C;  2YU3 A;  2FXA A;  4I0A A;  3KP3 A;  3LAP A;  1IXR C;  4GCV A;  1OMI A;  1P2F A;  2BGC A;  2JRT A;  2KKO A;  3IL2 A;  5DUK A;  5D4R A;  1ZG1 A;  2XVC A;  2NAZ A;  2FOK A;  1WWX A;  4HX7 A;  3BPV A;  1IAW A;  2VC1 A;  5IT3 A;  5EEG A;  1HQC A;  2JZY A;  2M5W A;  2RQP A;  3ERE D;  3KCC A;  5CVR A;  2DK8 A;  4EM1 A;  5JI6 A;  1W5S A;  5K1Y A;  4HAM A;  4XRF A;  4RB3 C;  1G6N A;  2K4J A;  3HHG A;  5DEQ A;  1YG2 A;  3SHF A;  5L3E A;  2FA5 A;  3JSP A;  2M30 A;  2XAH A;  2QEN A;  2PI0 A;  4Q5S F;  5LHH A;  4HDV A;  2NNY A;  3PQJ A;  1P4A A;  2MH2 A;  2XKO A;  3RYR A;  4UVA A;  3L00 A;  1JE8 A;  2ISY A;  3WTX C;  1UHM A;  1S29 A;  3HRM A;  3J80 K;  4EJW A;  2H09 A;  4KFC A;  3HYI A;  3EYI A;  4U0W A;  5D8K B;  1KA8 A;  2GXG A;  2VT2 A;  1ZG5 A;  4KT5 C;  1RNL A;  5DV5 A;  3R61 A;  3SQN A;  1KYZ A;  2DAO A;  4M6Y A;  4BAY A;  3WTW C;  1O3R A;  4I7H A;  3MZY A;  3NEU A;  3FX3 A;  1Z1D A;  3HHH A;  2RKH A;  1T6S A;  1MDM A;  1CGP A;  3T5X A;  3S2W A;  2EFQ A;  1L0O C;  4UV9 A;  2M45 A;  5CYV A;  1DPU A;  1WI9 A;  1ZLJ A;  4Y13 A;  2F5E A;  2O0Y A;  3ISP A;  4I02 A;  3PFI A;  1OR7 A;  3U2R A;  4WWC A;  3QOP A;  4HX8 A;  1B4A A;  2W57 A;  1KQ0 A;  2RNJ A;  4PZJ A;  1SAX A;  1V3F A;  2IA2 A;  1WKM A;  2LKP A;  5CVU A;  1TBX A;  3FM5 A;  1F9N A;  5DYM A;  3WE3 A;  3E6C C;  3KP4 A;  4JK1 X;  3OOP A;  1UB9 A;  4GGG A;  3F3X A;  2DBB A;  2IJL A;  2H6B A;  4LB6 B;  1OYI A;  1ODD A;  2G7H A;  4LK0 F;  3F8C A;  4FHT A;  3E5X A;  4BQA A;  2P5K A;  2ZKZ A;  4G9Y A;  1DDN A;  2OBP A;  1U5T A;  4P9U A;  3QAH A;  1USS A;  2X4H A;  1HW2 A;  5LGU A;  1IN6 A;  2W84 A;  2L02 A;  1XMK A;  4YII A;  1B1B A;  4A5N A;  2QZ8 A;  2W85 A;  1P6R A;  1S8N A;  3E6D A;  3GF2 A;  4ASN A;  2F5C A;  4Q47 A;  3SZP A;  2K86 A;  5CLS A;  2L54 A;  1TW2 A;  1FBS A;  4ENJ A;  5HDK A;  5L3D A;  3E6M A;  3I5U A;  5LEK A;  4EGY A;  1BC7 C;  3V7S A;  2R3S A;  4L9V A;  1J59 A;  4L9N A;  1ONV A;  3LST A;  5E20 A;  3H92 A;  4RAY A;  1H9G A;  4OIQ F;  3BY6 A;  3LWF A;  1FX7 A;  2P5L C;  1ZRD A;  5EEH A;  3JTH A;  1H9T A;  4M9Z A;  4HQE A;  2OAZ A;  3I53 A;  4QLC U;  6PAX A;  5D5V B;  3SFZ A;  2D1H A;  5FB2 A;  2H94 A;  5HLI A;  3TO6 A;  1B6A A;  4DNC A;  1FWZ A;  1MJA A;  4KN4 X;  2ZFW A;  3J80 Z;  3K1M A;  2YX4 A;  2XRO A;  3WE2 A;  3MQ0 A;  4XSZ F;  3COA C;  5HOO A;  2WC2 A;  1UST A;  4EM2 A;  3WGI A;  1GXQ A;  3HUG A;  1S6L A;  2OU2 A;  1FBQ A;  4GO1 A;  1BI0 A;  1E2X A;  3KET A;  1PP7 U;  3AAF A;  4OMZ A;  4A0Z A;  4LGW A;  1IXC A;  4N9H A;  2HKO A;  5D5W B;  5E8G A;  4HQM A;  1SFU A;  2WV0 A;  4BHC A;  5FD6 A;  2A69 F;  1TQI A;  4AWX B;  4G94 A;  4FX4 A;  1FP2 A;  1L3L A;  2FU4 A;  3DQV C;  1NHA A;  3GX4 X;  2KIU A;  5DD4 A;  1LDK B;  3M7G A;  2CGP A;  4M71 A;  3KE2 A;  1G3T A;  3JSO A;  1IZ1 A;  2XAG A;  3TO9 A;  1KQ8 A;  2MC3 A;  4OMY A;  5LHI A;  2PBI A;  2HR3 A;  3HSF A;  4BXU A;  3RPQ A;  2IW5 A;  2EV6 A;  3NRV A;  1C0W A;  4L9J A;  5FLX K;  4XLP F;  3BZ6 A;  2PMU A;  2ESH A;  3B02 A;  1R23 A;  4F7Z A;  1FOK A; 
#chains in the Genus database with same CATH topology
 3TP3 A;  3OS0 A;  1P7J A;  2FUG 2;  3EUA A;  1MDM B;  2KZG A;  3BRO A;  5IY5 H;  3V7C A;  1YFH A;  1Q1H A;  4BNC A;  2IA0 A;  4ZYD A;  1SEU A;  2FF4 A;  4XSX F;  2VBZ A;  4FE4 A;  4WXH A;  3DEU A;  2Z99 A;  5DTD A;  4WF2 A;  1ENH A;  1HST A;  2KDO A;  4KA4 A;  3PNT A;  1VQK I;  3VB2 A;  4U87 A;  5B1A H;  2XPV A;  3EYY A;  2XIG A;  1F1Z A;  1T95 A;  3JRH A;  4QIW N;  1YLF A;  3AKZ A;  2R7X A;  4MIM A;  2K5C A;  3L2C A;  2BHY A;  1O3S A;  1G3W A;  2XUB A;  3DFG A;  1JTY A;  3F22 A;  3BQZ A;  2A3S A;  4BY7 J;  3HIF A;  3RQ4 A;  3IAM 2;  2QQA A;  3ZMD A;  2L0K A;  1Y8Q B;  3VSL A;  4F7Z A;  4A3D J;  2GXB A;  4CYC A;  1BW5 A;  1BBY A;  3I59 B;  5F0F A;  5KHD A;  3KIO A;  1R5G A;  2LKS A;  3QYE A;  3OY9 A;  2K9L A;  1IDZ A;  4HV6 A;  4E7L A;  1TWC J;  3AL0 C;  3IKT A;  3K4M A;  2F5F A;  2JA7 J;  3GUD A;  3PIP F;  4LIU A;  2PMH A;  1Z7L A;  3WOD F;  4YEL A;  2W48 A;  3VYS B;  1T38 A;  3TOA A;  2UXX A;  3P9C A;  2HQN A;  3E97 A;  2X6O A;  1VQ4 I;  3M07 A;  2ZCW A;  4XM3 A;  1R5H A;  4AIH A;  1QVT A;  3QP5 A;  5LFA A;  2R7S A;  1R7J A;  3OYM A;  4II2 A;  4PGH A;  2UUZ A;  3I55 I;  5H2F C;  2MBF A;  3PUF A;  2XB0 X;  4XLA A;  3CP8 A;  3CUQ C;  4CXF A;  1WQ2 A;  3S1N J;  4MQ9 F;  3T1B A;  3V8J A;  3IV5 A;  1RUO A;  4BQN A;  2VB6 A;  2HXO A;  4L9T A;  2LYC A;  4HSR A;  4A3K J;  2MA3 A;  3QYB A;  3C3W A;  3QU3 A;  1AHD P;  3RKX A;  3S1R J;  2G9W A;  5CKT A;  5GP9 A;  2QA4 I;  1JHH A;  2AQE A;  1N75 A;  3HBL A;  3J81 K;  1LPQ A;  5KCM A;  4I09 A;  2V9V A;  2VJ5 A;  4IF4 A;  3NWS A;  5ICG A;  2A07 F;  3HEF A;  3HUG B;  3VWB A;  4RB0 A;  2R7W A;  1MSE C;  1R1U A;  4RGU A;  3Q9S A;  4MLO A;  1PUE E;  2PJP A;  3FMQ A;  5J40 A;  1S7E A;  3CJR B;  2ZJQ F;  1ZRC A;  3TP0 A;  2DYR H;  4I76 A;  2FJ1 A;  1NH3 A;  2IAI A;  3KZZ A;  2WAQ A;  3W6J B;  4E7Z A;  2VQC A;  3BR5 A;  1IUY A;  3MZH A;  3ZQC A;  4LG0 A;  3ZRG A;  1CQT A;  1B59 A;  1B9N A;  2UXN A;  2VIX A;  5GAG J;  3P9I A;  2DXI A;  3QOD A;  5E1X A;  5ICE A;  3M8J A;  4RB2 C;  1XB4 A;  2JQ7 A;  1V5F A;  1F43 A;  4EQQ A;  4J19 A;  3I59 A;  5EJC A;  4U7D A;  3P9K A;  3O2P E;  3WTY C;  4YFK F;  2Z3Y A;  3BP8 A;  1M1E B;  2UV1 A;  5LRR A;  2CMP A;  4U88 A;  1OCC H;  2ZXI A;  2WTE A;  4G6Q A;  2QSH X;  4RM3 A;  2XSJ C;  3HM5 A;  9ANT A;  1VQ6 I;  4IRI A;  3OS2 A;  1OYW A;  2B0L A;  1KU3 A;  1T39 A;  3D5L A;  5DUI A;  2P6T A;  3G1O A;  5K5Q A;  1W4M A;  3K0L A;  4BHP A;  1ZH5 A;  2HDW A;  1P92 A;  1IO2 A;  3AG2 H;  2V9K A;  1Z67 A;  3I71 A;  1HSJ A;  4CA0 A;  1R5I D;  3ZQI A;  2VON A;  1STZ A;  1UJ8 A;  1V4R A;  5CVV A;  1PUF A;  1LDJ A;  1Y0U A;  4XLN F;  4FIS A;  3PIO F;  2JK3 A;  3F6V A;  3Q0V A;  2YU9 J;  3DPT A;  3WTZ A;  4RMN A;  4II3 A;  5K7F A;  3WU1 B;  1R1T A;  1BIB A;  3FXM A;  1FLI A;  3LSR A;  3ABT A;  5JLW A;  1IN4 A;  2K3F A;  2GOM A;  4OWR B;  1IRZ A;  3BTL A;  3H9G A;  1ZTR A;  2GZW A;  3I0T A;  2NS7 A;  1X4O A;  2N8G A;  1ETQ A;  1O57 A;  1UCR A;  5ILV A;  1IV8 A;  2DA5 A;  2ZO4 A;  1FTZ A;  3RCO A;  1J2X A;  3HOT A;  4E7I A;  1JKR C;  2W25 A;  3HB9 A;  3SDG A;  4HBL A;  4YEJ A;  3FXL A;  3WG9 A;  4KYW A;  2KIQ A;  2DMU A;  3JRF A;  3CCY A;  2J5O A;  4XOT A;  1K4T A;  4LLN A;  1HW1 A;  4O3M A;  3ESW B;  2KDZ A;  2QQ9 A;  3WTS C;  3RPU A;  2ZME C;  4G7H F;  1FPQ A;  2LDU A;  5J3L A;  4UUT A;  2BY2 A;  3UKG A;  1XMX A;  2LMD A;  2M87 A;  2NVU B;  3M8E A;  5IP6 A;  4BS9 A;  1U5T C;  1XGS A;  1Z6R A;  2F5D A;  1J7K A;  1TWF J;  3MWM A;  4EGZ A;  1OCP A;  4PDK A;  3CUQ B;  2WAE A;  4A6E A;  3ZQG A;  1D1C A;  1JT0 A;  4R8H A;  1OCZ H;  3ZCO A;  2ZXH A;  2L7K A;  5ED4 A;  2CV1 A;  2STT A;  3CF2 A;  4WX9 A;  1V55 H;  3H9Q A;  2CQK A;  1S5L C;  1DU0 A;  1Y39 A;  3SEZ A;  3RZO J;  1FSE A;  3QYF A;  1HBX G;  4OU0 A;  3SYT A;  1V5E A;  3B6C A;  4FT8 A;  4HG2 A;  2R7Q A;  3DF8 A;  1X1B A;  4L5J A;  3N97 A;  1VQ8 I;  4M72 A;  1D8J A;  2DFF A;  1FBU A;  3QPS A;  3RYP A;  4E7S A;  1R9T J;  2HS5 A;  1JKQ C;  4B4C A;  2VKH A;  5FKO A;  5H6Q A;  4XID A;  1I6H J;  4LLG F;  3OSG A;  1A35 A;  1S3J A;  1KU2 A;  3BJO A;  4B44 A;  1X2N A;  2EZK A;  5F27 A;  3CC2 I;  1DPR A;  2OQR A;  2CFX A;  1NTC A;  1QZY A;  4B09 A;  1VZ0 A;  1BI1 A;  5L3B A;  1ERD A;  1IN8 A;  2A6H F;  3TW6 A;  3IHU A;  1DUX C;  2XB5 A;  4ESF A;  2ESN A;  4BQQ A;  2XF6 A;  1HW5 A;  1TWG J;  2CQX A;  4KDP A;  4XKC A;  4W97 A;  4I01 A;  1YIJ I;  2PJR B;  2RDP A;  3BR3 A;  2QKM B;  4NUB A;  4S05 A;  3ZQL A;  3ZMS A;  3I58 A;  3G1L A;  2WWY A;  3GTL J;  3A2K A;  2L7Z A;  2BW3 A;  5IYB J;  4Y3O A;  4NHJ A;  1EV7 A;  2BY3 A;  4Z2Y A;  3U1D A;  3FHZ A;  4IO9 F;  4AVZ A;  1U78 A;  4F3Q A;  2TCT A;  3G1M A;  5E79 C;  2EPF A;  1IG7 A;  4Z6Y A;  1HLV A;  1D8K A;  3IRQ A;  1EH8 A;  1TQP A;  3FMR A;  3CP2 A;  3WU0 A;  2LFB A;  4E70 A;  4I99 C;  4N9I A;  2CS3 A;  4O6J A;  3JRD A;  2DPU A;  2H1K A;  5K7Z A;  2V6C A;  3VDX A;  3CF5 F;  4CDG A;  3N05 A;  2JWT A;  4RAZ A;  1RPW A;  3OL4 A;  4IL6 C;  2CG4 A;  1I3Q J;  5JHF A;  1IN7 A;  1EJ9 A;  2HYG D;  2WAQ N;  2E5N A;  5EG0 A;  1U5T B;  1PUF B;  1FT9 A;  2HFH A;  3S2H J;  4A6D A;  2L9S A;  4ESB A;  1MSF C;  3DXJ F;  2QUF A;  2BBY A;  3F23 A;  2G7U A;  4P55 A;  2JRM A;  4RGS A;  2ZJ2 A;  2V9P A;  1QA6 A;  2HWV A;  1QHH D;  3L2W A;  2VI6 A;  3F8F A;  2NVT J;  2DA7 A;  2LSO A;  2CUJ A;  1RKT A;  2WA0 A;  3WHC A;  1I1G A;  2WB1 A;  4U0Y A;  4AU7 A;  1LQ1 A;  3CCM I;  3FXQ A;  3CO6 C;  4DYC A;  4S04 A;  2VQG A;  2BY1 A;  3ZMU A;  4HV5 A;  3HC7 A;  3BR1 A;  1UHS A;  1LNW A;  1TLH B;  3HSR A;  4DYQ A;  4H4K C;  2MLK A;  4RB1 A;  3K1N A;  1R36 A;  4M3F A;  3JW4 A;  2MH9 A;  1NG6 A;  3OIO A;  3LAJ A;  2R5Y A;  1QU3 A;  3T8R A;  4KIF A;  2ICW G;  4DBQ A;  2X0L A;  5JHU A;  1XTA A;  1T0F A;  3DPL C;  5EZG A;  2QBY A;  1GVD A;  5ERI A;  3EET A;  4XRS A;  1HDD C;  1SD4 A;  2F4I A;  4KIB A;  2W1O A;  2O03 A;  2GIZ A;  3PM1 A;  1IRG A;  3I54 A;  5JLX A;  2AXL A;  4JX5 A;  1E3O C;  1R4N B;  3M8F A;  5DCF A;  3IKV A;  2KL4 A;  1I27 A;  4UUV A;  4RLQ A;  4CCL A;  2GAU A;  2EA4 A;  4AID A;  3OYH A;  3AL0 B;  4MQV A;  2ME6 A;  3OYN A;  4CCJ A;  3ULQ B;  2R5Z A;  3GEZ A;  3BDD A;  2C6Y A;  1XSX A;  2M8E A;  2MGQ A;  1LDD A;  3GYH X;  3M4O J;  4FX0 A;  2I8D A;  4C3I J;  3H3U A;  4I2O A;  4BH9 A;  3CDH A;  5IP9 J;  1X3Z B;  1MGT A;  2E71 A;  3K6G A;  1V5G A;  3S93 A;  1QPI A;  1YTY A;  1XN7 A;  2FQ4 A;  4PJM A;  5EG0 B;  1YS6 A;  4DBR A;  4BJT A;  5E3M A;  5H20 A;  3HXL A;  1YJN I;  3QRF F;  2MLG A;  2R7O A;  3MCZ A;  4BDY A;  1FMV A;  3G4S I;  1K78 B;  4EEF G;  1ETY A;  4KJZ A;  4OIR F;  1GLN A;  1VND A;  5FRM A;  3SXY A;  2XSD C;  1MKM A;  1SAN A;  2KRF A;  3TO7 A;  3MKY B;  3FBN B;  2ETH A;  1ULY A;  3C2B A;  5FFZ A;  3MKW B;  4HOB A;  2WV1 A;  3EDP A;  4HDU A;  3KP5 A;  2CUF A;  4HF2 A;  3OL3 A;  3ABK H;  3S2D J;  3DKX A;  1P4W A;  3H9J A;  3VYU B;  1ON2 A;  3FM3 A;  1ZRF A;  5AIP A;  4IHT A;  3E1S A;  2PG4 A;  2GM4 A;  1ETX A;  2CRG A;  3B73 A;  4RBO A;  3KEQ A;  3LSG A;  2KIS A;  1W7P D;  4M74 A;  3R0J A;  4HRI A;  5LGT A;  1MBH A;  2V1D A;  5HS9 A;  4A5M A;  2YPR A;  2R5Y B;  2OZU A;  4EVI A;  2ID3 A;  3GLL A;  4OIP F;  3BCA A;  5ILU A;  3JAM Z;  1RR8 C;  4M3D A;  2W00 A;  2M34 A;  4Y33 A;  1R00 A;  5FD5 A;  1IF1 A;  4FE7 A;  2EK5 A;  2DT5 A;  1XGN A;  3DTK A;  3J7A O;  2WBM A;  4BE2 A;  5FRO A;  5IOZ A;  3GFI A;  3JRG A;  3T0Y A;  5J47 A;  3S3O A;  2P5V A;  2XDV A;  2XPU A;  5JVT A;  2M7A A;  4DGW B;  4EM0 B;  3RKQ A;  3HOS A;  3X2Q H;  1Y1V J;  2X9D A;  2XRN A;  2G0E A;  4CCN A;  3HKZ N;  3V4G A;  5IYC J;  5DM7 F;  3Q5F A;  1CF7 B;  2DT6 A;  2P6S A;  2Y2Z A;  3KP6 A;  2MW8 A;  2EV0 A;  5F6F A;  1XDS A;  4AM3 A;  2P81 A;  2UWM A;  5HLG A;  1LB2 A;  1OR7 C;  2OC6 A;  1BOB A;  3S1M J;  2Y48 A;  3M3Y J;  3IAS 2;  5C4X J;  3OYF A;  2E2H J;  4BJ6 C;  3H5R A;  2JMW A;  2QLZ A;  2RVC A;  2NOG A;  4NC8 A;  3TOB A;  3SJM A;  5F1R A;  1QBJ A;  1GHC A;  2DA2 A;  2QGU A;  4LMY A;  2CQN A;  4AIJ A;  4BAC A;  1G4D A;  1FYM A;  2X1C A;  3ZMT A;  3VYR B;  3QPH A;  2VOD A;  2CSO A;  3TDZ C;  2B9S A;  2EIM H;  1POG A;  4B3A A;  1Y1W J;  3MFK A;  2V1U A;  2KJC A;  2ZME A;  2OD5 A;  3RKW A;  2ZNZ A;  3IH2 A;  1MBE A;  3RTR A;  4EJO A;  5JFR A;  3LSJ A;  1XCV A;  2O8X A;  3FIS A;  1FYL A;  4MTE A;  2RQQ A;  4LFU A;  1WI3 A;  4RAF A;  5FO5 A;  2VXD A;  3F6O A;  3RIR A;  2DMQ A;  5E18 F;  5BPD A;  2QVO A;  3BWG A;  1N78 A;  1AOY A;  1UHW A;  1SMT A;  1KGS A;  1E3P A;  3I4M J;  1OCO H;  5HLH A;  2E7W A;  2FNP A;  2IXS A;  1HKQ A;  2BW3 B;  4IX7 A;  3BR2 A;  1EKE A;  1RRJ A;  2DDA A;  4LD5 A;  1FMW A;  1ZKG A;  4ZJZ A;  4XQF A;  3CCJ I;  3F0C A;  4YIF A;  1OIS A;  5EGO A;  4A3J J;  3ZQF A;  1B72 B;  2HGC A;  4DZJ A;  1IRF A;  1JGS A;  3GWZ A;  1R58 A;  2P8T A;  5DM6 F;  2OCC H;  5D5U B;  1A5J A;  4Y7N J;  2ISZ A;  2R7D A;  3LQQ A;  4AD9 A;  2Y75 A;  3FXR A;  1T0F C;  1X58 A;  1Z77 A;  1D5V A;  4A3I J;  1JT6 A;  1XPX A;  3RDI A;  1SC7 A;  5IT9 Z;  3FDY A;  2GOX B;  2FBH A;  4ENK A;  2Z33 A;  2BYV E;  1I5Z A;  4K2E A;  4UB6 C;  4N0B A;  1IC8 A;  1MZB A;  1RR7 A;  1YS7 A;  3SZG A;  1BI2 A;  3J7Z I;  3CC4 I;  1Z6T A;  2VAS A;  1YRN B;  3F9K A;  4BYY A;  4UNO A;  2R5Z B;  2OTL I;  3KP2 A;  2XHK A;  4CYD A;  4ZTF A;  2HDC A;  1IDY A;  1OJL A;  3O8H A;  5EDN A;  1K78 A;  1U9O A;  3W6V A;  1JUP A;  2CWE A;  2M1B A;  2YR2 A;  1BJA A;  2Y30 A;  3H3Z A;  3KZY A;  3NQO A;  4RS8 A;  5TRD A;  3LSK A;  1QO0 D;  2XF7 A;  1XGM A;  1K6Y A;  1Z3Y A;  2QQ8 A;  3EPZ A;  2TRT A;  3HRT A;  3KLN A;  4BEH B;  3ZPL A;  4LG0 B;  4IEJ A;  2LH9 A;  1TW3 A;  3J81 Z;  3K69 A;  2QBY B;  4MFE A;  1Y0N A;  1SD7 A;  3OYD A;  2M4K A;  2FOW A;  4B48 A;  3LSP A;  4JBA A;  3CC7 I;  1A36 A;  2HOS A;  5CPR B;  5FRN A;  4XMY A;  4ZDL A;  2XAS A;  1S7A A;  4ITV A;  4XLC A;  4UXN A;  3GTM J;  1T33 A;  1Z3X A;  2P4W A;  2HTJ A;  5D8L B;  4EJT A;  3ONQ A;  4CZZ A;  2PMZ N;  4M3G A;  2CV2 A;  2QWW A;  3VPR A;  4CYC B;  3RI4 A;  2ZJR F;  2JVH A;  3A0H C;  2E34 A;  1E17 A;  2RV8 A;  2BOL A;  4HLY A;  1QZZ A;  3MZ8 A;  1LEB A;  5HS7 A;  2DFI A;  2QM3 A;  1BOA A;  2DLL A;  3B6A A;  4P1W A;  3E7L A;  2K40 A;  3CJT B;  1ZGA A;  5LBQ A;  1IJW C;  4B47 A;  2XC7 A;  3BPX A;  1WRJ A;  2NXN B;  4OOI A;  4P9F A;  1LE8 B;  2LRE A;  1SFE A;  3S15 J;  3ZMZ A;  1TWH J;  1YOV B;  4CIC A;  1F5T A;  2P7V B;  2CH0 A;  2HU9 A;  5D6F A;  1W0U A;  3H36 A;  1LFB A;  2KRC A;  5L3F A;  2BZT A;  2ZXJ A;  4G12 A;  2GIV A;  5LGN A;  4A3F J;  1FOX A;  3JAM K;  3ZP5 A;  1MIJ A;  4MHG A;  1OKR A;  2CW7 A;  2EFN A;  2FQ3 A;  2BV6 A;  4HX4 A;  2E7X A;  2PFB A;  4ENM A;  2DMP A;  3KP7 A;  4WK8 F;  2EFW A;  4UV8 A;  3S8P A;  3WU2 C;  4ENN A;  1Z05 A;  1HKT A;  2Y9Y A;  4WXC A;  2K85 A;  4KUM A;  1YO5 C;  2I10 A;  3DU5 A;  2Z1D A;  1TTY A;  1TNS A;  1YW7 A;  1Z0X A;  5F0H A;  3J7A Y;  3FKI J;  3FZV A;  2ACJ A;  2M3A A;  2KIM A;  3CO7 C;  5DDG A;  4F52 A;  3WTU C;  1LFP A;  3D0S A;  4YG2 F;  4PFP A;  2FEZ A;  2P7C B;  3ZQH A;  2YUS A;  4YIR X;  3K70 D;  1JKO C;  4Q48 A;  1MD0 A;  3TW7 A;  4E7K A;  3GTK J;  2UZK A;  2VBY A;  4IXA A;  2HZD A;  3RKY A;  3RZD J;  2F6C A;  5D6E A;  4AUX A;  1JXS A;  3BG9 A;  1IN5 A;  1B8I A;  2DPD A;  1U0J A;  3GZ5 A;  1LVK A;  2Y31 A;  3K1P A;  1GT0 C;  2PMZ A;  4M73 A;  1ZG3 A;  3TMO A;  2IBD A;  3ZQ7 A;  1YI2 I;  1LVA A;  3CJQ B;  2K7L A;  4EAT A;  1G59 A;  1I3A A;  4L0Y B;  1MBK A;  1XGO A;  4UUS B;  4CUG A;  3R0A A;  3OYL A;  2Q0O A;  4GRI A;  4E7H A;  4CH7 A;  3WTT C;  3OYE A;  5L3C A;  1JI8 A;  3LA3 A;  3GXO A;  3ECH A;  1ZK8 A;  3BG7 A;  5GTH C;  2F4O B;  5ICF A;  1B72 A;  5L3G A;  5FFX A;  2LF8 A;  3AG1 H;  4OAY A;  3ZGK A;  2BE5 F;  2EIN H;  1UG0 A;  2OUM A;  3BCB A;  3HG9 A;  2X51 A;  3WTV C;  4M6V A;  4U7B A;  1OPC A;  2JVG A;  1REP C;  1BA5 A;  1MNM C;  1HF0 A;  3PSI A;  2FNA A;  5E8I A;  1VQO I;  2CQ7 A;  2H27 A;  2JN6 A;  2PEX A;  4IQ4 A;  2K9S A;  4ZYE A;  2F48 A;  1JGG A;  4NDL A;  1H8A C;  2DTR A;  3PFY A;  1QPM A;  2EZL A;  1AKH B;  1DGR M;  3G2B A;  3LL7 A;  1MBG A;  4JQF A;  2GBY A;  3DBR B;  2Y0S N;  4BBR J;  1I39 A;  4HF0 A;  4HNU A;  2VN2 A;  2COB A;  4XR6 A;  1D3Y A;  2OZ6 A;  4D7M A;  1XG1 A;  1PJR A;  1B9M A;  2PLY A;  4G6D A;  4ZYH A;  3VFZ A;  4RDU A;  2DOE A;  4UVC A;  1FP1 D;  1RC9 A;  3BLY A;  3JRI A;  1ETO A;  2DCE A;  2KP6 A;  1ORK A;  3CCU I;  4CHU A;  3C7J A;  4BXX J;  5J8F A;  2V26 A;  2OV7 A;  5J6X A;  2FRH A;  1KON A;  4QTR A;  3JR9 A;  1BM9 A;  2DA3 A;  2VT3 A;  4AYB N;  1APL C;  2M2E A;  4XKV A;  3KFW X;  4I0B A;  2ECB A;  2DJI A;  1N25 A;  4C9Y A;  2V79 A;  2B7E A;  1SD6 A;  2P0W A;  3I64 A;  3BJA A;  2Q2E A;  2XGD A;  3HDD A;  3QWL A;  1XX5 A;  2ZNY A;  2ECC A;  2W4S A;  2HTS A;  4YRV A;  2BY0 A;  1FC3 A;  3IH3 A;  4LOC A;  2VKE A;  2NVY J;  3KEY A;  5B1B H;  2IEK A;  3HL2 A;  4C2T A;  1GV5 A;  2DOA A;  2MFZ A;  3FF5 A;  3K4L A;  3GVA A;  4UHT A;  3CCQ I;  2XRL A;  3MEX A;  2GWR A;  2M4G A;  2DQR A;  2DA6 A;  1U8R A;  1T2K A;  4NB5 A;  2DK5 A;  3BJ6 A;  2E1O A;  1UZC A;  4HEA 2;  1BL0 A;  1R6R A;  2IGN A;  3EUH A;  2EJR A;  2H6C A;  4DIQ A;  2PX9 A;  1R71 A;  2GLO A;  5K7H A;  5A2Q K;  1VQL I;  2CJJ A;  1IXS B;  4XLH A;  2JT1 A;  3W2W A;  5J8C A;  3C2H A;  2PQ8 A;  2MD0 A;  2Y0M A;  2XF5 A;  4GXO A;  1FIP A;  5CJ9 A;  1LJ9 A;  2VQH A;  2A6T A;  1JTX A;  4KIG A;  2FML A;  1SVM A;  4F92 B;  2Y0S A;  5CVJ A;  2BHZ A;  2QCO A;  3K4J A;  1XSD A;  3DKY A;  4FET A;  3F21 A;  1QQI A;  3H5A A;  5LEJ A;  4IQJ A;  4CGZ A;  1DGW Y;  1LUJ B;  3HRU A;  2B63 J;  4PCQ A;  1DP3 A;  3GO5 A;  2ZC2 A;  4S0H B;  2VL8 A;  3L2R A;  4M6X A;  3CLO A;  1JHF A;  2K3P A;  3EUK L;  4B8X A;  4EV0 A;  3L2U A;  2X48 A;  1ZR2 A;  2DU9 A;  1QNT A;  1YRN A;  3KPH A;  2FMY A;  4ZYG A;  1A31 A;  1RZ4 A;  3A02 A;  5F04 A;  2HPM A;  2Z16 A;  1G3Y A;  2FSW A;  1H0M A;  2M0C A;  3SDB A;  3L7W A;  4B43 A;  1W5C C;  1WJA A;  3KEO A;  4IRH A;  3N4M A;  2AQF A;  2L01 A;  1X19 A;  1K79 A;  4OAZ A;  4IHV A;  3CMM A;  4CCO A;  3WGH A;  4XRM A;  4HW0 A;  5LHG A;  1LKX A;  4U0V A;  3L1P A;  2VOO A;  3PO2 J;  1D0X A;  2D1V A;  1HA8 A;  3EQL F;  4OIN F;  4UB8 C;  3F8N A;  2VUM J;  4JP0 A;  3MD2 A;  3HJE A;  1KU9 A;  4AVP A;  1OCT C;  2V4J C;  1HKS A;  1ZR4 A;  4MTD A;  3CTA A;  2X1D A;  2XAQ A;  3FMS A;  4EMS A;  5CVI A;  2IS4 A;  1NG7 A;  1WZ2 A;  5KVR A;  1FJL A;  5C4J J;  1XMA A;  2D2W A;  1NK2 P;  2V1X A;  2VBW A;  3E5U A;  1W36 C;  4WXD A;  2ADU A;  3BTC A;  2VPL A;  1U2W A;  2BEO A;  3IUO A;  1S9H A;  4XK4 A;  4QSH A;  5BMZ A;  4AC0 A;  5HDN A;  4CCM A;  5FKK A;  4A3E J;  1WH7 A;  2R7T A;  3TQN A;  3NWT A;  2QQB A;  3F72 A;  2HQR A;  2W7N A;  2LBF B;  1OQY A;  2O9L A;  3E6B A;  5K5O A;  1ETK A;  4MEX F;  2JPC A;  1KU7 A;  3L09 A;  5B66 C;  1A6Q A;  2AHQ A;  5HVQ C;  3I56 I;  2BXZ A;  3MVP A;  2OPT A;  2EIJ H;  3BR0 A;  3QU6 A;  5ILS A;  3LA2 A;  3J7Y J;  1VQ7 I;  4IJA A;  2IS2 A;  4IRG A;  1X2M A;  2IP2 A;  5B3S H;  1FEX A;  2HQA A;  2RN7 A;  2NYX A;  4JX4 A;  2DT7 B;  1ZRE A;  4FTH A;  1ZLK A;  2KIF A;  2XAJ A;  4V2G A;  1TP4 A;  2AS5 F;  2CW0 F;  2ELK A;  2FBK A;  2HYJ A;  1T8I A;  2VKV A;  4YFX F;  2A68 F;  2JA5 J;  4HZF A;  2NVX J;  4E7J A;  3CQZ J;  1GVJ A;  5D4S A;  2D45 A;  5M5X J;  1HXD A;  2IA1 A;  1ZYR F;  3HTU A;  3IWF A;  3LFK A;  4R1H A;  2Q8K A;  2KJB A;  4RGR A;  2MYS A;  3C2G A;  1KQ9 A;  1FOW A;  2IPQ X;  4BHB A;  1YIT I;  2K9Q A;  1TNT A;  3KZI C;  3D5S C;  2CO5 A;  3GTP J;  3E5Q A;  4RAG A;  3K9T A;  3KYD B;  5KNL A;  1EA3 A;  1TC3 C;  1TL8 A;  4A3L J;  2ZSH B;  4XBF A;  1WFX A;  2BVL A;  2JPB A;  4P96 A;  3KLO A;  1A6I A;  2DFH A;  2GA2 A;  4PGG A;  3OMY A;  3PQK A;  2DMT A;  4KIS A;  1FY7 A;  2VE8 A;  1WJB A;  1DP7 P;  2R7Z J;  2VC0 A;  1WPK A;  1SFX A;  1UMQ A;  3RJP A;  4HYE A;  5DD8 A;  4I98 B;  5E1Z B;  1Z21 A;  3V8L A;  4FAS D;  3W6K B;  2RRE A;  2LLK A;  5IYD J;  1WSU A;  1PYV A;  3DV8 A;  2JSC A;  1UFM A;  1F36 A;  4Y52 J;  3R4K A;  1I6X A;  2R7U A;  5FGM A;  4A93 J;  2L3D A;  2DI3 A;  1W0T A;  1QVU A;  5IT9 K;  1EF4 A;  2BXY A;  4H0E A;  3HRS A;  1RIO H;  1J9I A;  2NRA C;  5BOX A;  2WY8 Q;  4G6T B;  3LSH A;  2MD5 A;  3ABM H;  2X6W A;  1U6G A;  3DPU A;  2LKX A;  2R0Q C;  2M7B A;  5E3N A;  2STW A;  3CDL A;  4IVN A;  3ZXS A;  3G73 A;  1YIO A;  4A0Y A;  4ZZD A;  2LNB A;  3W2A A;  4C2M J;  3GME A;  2VJI A;  2F2E A;  3OIQ A;  3FXO A;  1O3T A;  4LLL A;  3CCL I;  2ZBK A;  5HNH A;  1I1S A;  2XGX A;  2HZT A;  3HPG A;  4LJZ F;  4M3B A;  4DQ2 A;  2Z9O A;  2R7F A;  2E1N A;  3P5J A;  2DO7 A;  5DCM B;  3ECO A;  4N4O B;  3ABU A;  4XKB A;  5J4Y A;  1YHQ I;  4YFN F;  3MKL A;  3TGN A;  2KLO A;  4IKF A;  1W7P A;  3CUQ A;  3M1E A;  5EF6 A;  2QSG X;  3FK6 A;  3V8K A;  4B3X A;  3OR2 C;  1VTN C;  4XON A;  2LF7 A;  1IW7 F;  2OA4 A;  3CCS I;  3TBI A;  2Q2E B;  3IC7 A;  4NQW A;  3HGY A;  2EA2 A;  1PP8 F;  4UVB A;  1WH5 A;  1I50 J;  3QPT A;  2ID6 A;  4BU2 A;  1MJB A;  1XD7 A;  3BQY A;  2EFO A;  4A3C J;  2H1L A;  1BN5 A;  4CSW A;  1GXP A;  2A6E F;  5TJJ A;  3JRB A;  2XAU A;  2R7R A;  5LLQ A;  3C18 A;  2IGO A;  2J5P A;  1RET A;  2E1C A;  5F64 A;  1VQP I;  3SFI A;  2OQG A;  1IRX A;  2DA4 A;  4MNU A;  1P4X A;  1MMD A;  3OOU A;  5FLM J;  2O3F A;  1OLT A;  2A61 A;  3R60 A;  5K5R A;  1T98 A;  2YSR A;  1ZHF A;  1R22 A;  3ASN H;  3QP6 A;  1A04 A;  3ZMV A;  4G7Z F;  1O3Q A;  3ASO H;  4KNY A;  3BTJ A;  3OYK A;  4BGD A;  2HVS A;  1ON1 A;  2HQ5 A;  4KN7 X;  4ZZL A;  1XDU A;  4GYG A;  2L9N A;  1XCB A;  2EV5 A;  3DBH B;  2LBF A;  1ACI A;  5E1W A;  3U1K A;  4UY8 I;  1MBJ A;  1ZN2 A;  1ZEL A;  1BR4 A;  4XL9 A;  2MSY A;  4D5F A;  5GPA A;  2NOJ B;  2FE3 A;  1ZAR A;  3JRE A;  2K9N A;  4JX6 A;  2EQR A;  2W82 A;  3A01 A;  4MO7 A;  4ZC3 A;  4PSX A;  4XRS G;  1X1D A;  1RUN A;  1X3U A;  3BG6 A;  3DP7 A;  2VPR A;  3F8B A;  5FJ8 J;  1OYY A;  1AU7 A;  3E0J B;  2GXA A;  2O7O A;  2EFP A;  1TT0 A;  4TV7 A;  1R49 A;  4IZZ A;  2QYO A;  2FBI A;  3ZN1 A;  5J1U A;  2K02 A;  4ON0 A;  4ABZ A;  4MGR A;  3FXK A;  4BDZ A;  1FYK A;  2KHM A;  1SFK A;  2HPI A;  3M9A A;  3OR1 C;  2VOP A;  4MEY F;  4BQO A;  3FWE A;  1W7P B;  3Q3S A;  1BR2 A;  2JA2 A;  2Y9Z A;  2I5U A;  1VFC A;  1FSH A;  1WJE A;  3P7N A;  4RGX A;  1Z91 A;  4Y17 A;  4ESJ A;  1T56 A;  3IRR A;  1ITY A;  4IHS A;  3AFH A;  1YYV A;  1F4K A;  2GA1 A;  2L9R A;  4EJU A;  5IP7 J;  1J75 A;  5ICC A;  3GFL A;  2DQL A;  4HA8 A;  3VYT B;  4BXF A;  3OYA A;  3K10 A;  2GQQ A;  3G71 I;  3CMA I;  4Q4Z F;  3VOD A;  3G6E I;  2E5Z A;  4L0Z B;  5HS8 A;  2CU7 A;  2WB1 N;  1XSV A;  2HEO A;  3OWT A;  2HVQ A;  2XV4 S;  4BKX A;  2A5Y B;  2VXZ A;  3G3Z A;  3ML6 A;  2M8G X;  2PN6 A;  4X0G A;  4CO8 A;  1K7A A;  2DJN A;  2O61 A;  2JTV A;  4ZDP A;  1FZP B;  2NS0 A;  2KFD A;  2L4M A;  1MW7 A;  2QSF X;  5DCM A;  3GFM A;  2TDX A;  4P5O A;  3Q9V A;  3Q0U A;  3LOC A;  4G7O F;  4IHW A;  2VKD A;  3OV8 A;  2O6G E;  1YX5 A;  1G3S A;  5AIQ A;  5E17 F;  3TDU C;  4JYK A;  4DOZ A;  4AIK A;  1ETW A;  1YW8 A;  3ZN0 A;  5HNF A;  1ZAO A;  3HOZ J;  5F0C A;  3JRC A;  3I4P A;  1SD5 A;  4WCG A;  1MJ9 A;  4KMF A;  5M3F J;  3CJN A;  3KYC B;  1VF9 A;  2FD5 A;  2ZXW H;  1ETV A;  1BJZ A;  4HLX A;  4LIT A;  3GTQ J;  1QZE A;  4LG3 A;  5AON A;  4KMU X;  2JUG A;  2XAF A;  1P7I A;  3HZJ A;  2LOO A;  3PL8 A;  4M9X A;  3ELK A;  3PNV A;  3REO A;  3CUO A;  3GZ6 A;  1DQU A;  2CYY A;  4RLF A;  3TKY A;  1O4X A;  3LSI A;  3WG7 H;  4IOA F;  2QKL B;  3C1D A;  2DMN A;  3O3K A;  2VE9 A;  3BOQ A;  4XOR A;  1H88 C;  5BS6 A;  2HVR A;  4ETS A;  4NNJ A;  5CQG A;  2L7F P;  1T08 B;  1B8I B;  4A2U A;  3WGG A;  3HOV J;  3DEE A;  1R4M B;  4A12 A;  1LEA A;  4LK1 F;  5TIS C;  1U3E M;  2Z5U A;  1YQA A;  3IWZ A;  3OS1 A;  3HOX J;  3OYI A;  2EWN A;  2E19 A;  1SVL A;  3BG3 A;  4F91 B;  4L5I A;  1EH7 A;  2HYF A;  4ZDO A;  3LMM A;  2VBX A;  1O7L A;  3K70 C;  2CV0 A;  1K6O A;  4Y15 A;  2LVS A;  3GFJ A;  4L18 B;  1EH6 A;  3MAJ A;  2IVM A;  1S7O A;  2X6Y A;  3A03 A;  2DOD A;  5EEA A;  3DLL F;  1RES A;  1MH3 A;  3LFU A;  3RPU D;  2DW4 A;  2LP0 A;  2YX7 A;  3CES A;  3CCE I;  4XLF A;  2RC4 A;  1K83 J;  3U9G A;  3DU6 A;  2CUZ A;  2XKP A;  1LE8 A;  3I4N J;  4R79 A;  3DEW A;  4IPA A;  5JR3 A;  2IS1 A;  5CQE A;  2EB7 A;  2IRF G;  5J1R A;  1GUU A;  4OIO F;  4V2F A;  3GW2 A;  1TQM A;  1J5Y A;  5F08 A;  2IT0 A;  2OF7 A;  4G8X A;  5DS9 A;  4F93 B;  4NC7 A;  1O7F A;  1PVE A;  4XLE A;  1BI3 A;  1Z9C A;  2XGE A;  3LSM A;  3LQR A;  3HSE A;  3A0B C;  1J0R A;  1RI7 A;  4HNT A;  5LD2 C;  1GV2 A;  4ZH4 F;  2A05 A;  2V1N A;  3JTG A;  3K2Z A;  3FKJ A;  4IOC F;  3GCM A;  4BBS J;  1E0E A;  3DKW A;  3HTS B;  1QGP A;  3ABL H;  5EYR A;  4A0X A;  1Y6I A;  4NBQ A;  3E3V A;  3L2V A;  1BIA A;  2ELH A;  4M9S A;  5KK1 A;  1Q1V A;  1QHG A;  4RM2 A;  2R7V A;  4BE0 A;  3T8T A;  1QRY A;  2E60 A;  4D0P A;  3ERM A;  4O5V A;  2K27 A;  5A2Q Z;  1WGX A;  3BZC A;  5FKN A;  3LA7 A;  4HF1 A;  1S72 I;  1JUS A;  2E35 A;  3VOE A;  4LB5 A;  1FNN A;  2MAB A;  4QWQ A;  4XNF A;  2HOE A;  2VQL A;  1Z7U A;  4XKW A;  3VEP A;  5FLX Z;  3MMY B;  2W24 A;  4CCK A;  3R6S A;  3ROU A;  1BC8 C;  2COM A;  1WVR A;  5H6R A;  2HOA A;  4L5E A;  1X1P A;  2WAF A;  2WY7 Q;  3SZT A;  3FXU A;  2HKX A;  1CF7 A;  1VQ9 I;  1KYW A;  1W5T A;  4NC6 A;  1JJ8 C;  5D5X B;  2K4B A;  4DW6 A;  1JUM A;  1HCR A;  3NAU A;  2LY2 A;  2NNN A;  3K4K A;  5HDG A;  2KPM A;  2Y69 H;  3AG4 H;  4GYI A;  1SMY F;  2F5V A;  3O6B B;  5BQT A;  1FOY A;  1UG2 A;  2L4A A;  2RGV A;  3PUB A;  4KIC A;  1X1A A;  1UEL B;  3GLX A;  3L9F A;  4EJV A;  3CMY A;  3F8M A;  5GAE J;  3V7R A;  2IS6 A;  1R1V A;  5BPI A;  4E4H A;  4XN3 A;  5LRS A;  4PK4 A;  2EBI A;  1ZGJ A;  1G2H A;  3H0D A;  2H8W A;  1AWC A;  1YW9 A;  5J4V A;  1D0Y A;  2ZME B;  1PDN C;  1MBF A;  2YU3 A;  2FXA A;  4FQG A;  3K7A J;  4I0A A;  2X85 A;  3KP3 A;  3LAP A;  1IXR C;  4GCV A;  1OMI A;  3BTI A;  2HI3 A;  1YX3 A;  5F1J A;  2LY9 A;  4IHY A;  1P2F A;  2BGC A;  4HST A;  2JRT A;  2KKO A;  3QOE A;  3IL2 A;  5DUK A;  5D4R A;  1ZG1 A;  3PJR A;  2V7F A;  2XVC A;  2NAZ A;  1WHU A;  2FOK A;  2HOT A;  1HOM A;  5KAI C;  1WWX A;  2L2O A;  4HX7 A;  3BPV A;  5GTI C;  3BC8 A;  1IAW A;  2VC1 A;  5IT3 A;  5EEG A;  3CZ6 A;  2HDD A;  2HXI A;  1HQC A;  1U8B A;  2JZY A;  5EGO B;  2M5W A;  2RQP A;  2ZB9 A;  3S14 J;  4PJL A;  3ERE D;  3KCC A;  2E2J J;  3I9V 2;  5CVR A;  5M5Y J;  3DWL E;  1N77 A;  1XS9 A;  2DK8 A;  3DTI A;  3FHN A;  4EM1 A;  3S1Q J;  3NAR A;  3U21 A;  5JI6 A;  3H1C A;  4D9J A;  1W5S A;  2ZFU A;  3GTG J;  5K1Y A;  4HAM A;  4XRF A;  4BL0 B;  2DFE A;  4RB3 C;  3A4C A;  1MMG A;  1G6N A;  2K4J A;  2L9V A;  2RNG A;  5EZH A;  1TWA J;  4J01 A;  1WJD A;  3HHG A;  5DEQ A;  1ZGW A;  1YG2 A;  2LK2 A;  4ANJ A;  3L2Q A;  1VQM I;  3SHF A;  5L3E A;  2ELJ A;  3QPL A;  2E36 A;  2FA5 A;  3JSP A;  2ZJP F;  2M30 A;  3BT9 A;  3S17 J;  3DTE A;  2A5W A;  2QEN A;  2XAH A;  2PI0 A;  4Q5S F;  5LHH A;  2AXT C;  1K4S A;  2LRD A;  4HDV A;  2VLA A;  4FCY A;  2NNY A;  2CUE A;  3PQJ A;  1P4A A;  1MMS A;  2QEX I;  2MH2 A;  3GBG A;  2XKO A;  3RYR A;  2IGM A;  3Q0W A;  2KT0 A;  1SFO J;  2E1M C;  2DOF A;  1WJF A;  2L7M P;  4UVA A;  2HNH A;  3BR6 A;  4M3E A;  3L00 A;  1JE8 A;  3K2A A;  4BJ5 C;  2Q1Z B;  2F4M B;  1J09 A;  4A3B J;  1AA7 A;  2ISY A;  3GZN B;  2ME0 A;  3WTX C;  1BW6 A;  4KIT B;  1UHM A;  1S29 A;  1X3W B;  3HRM A;  4HNV A;  3J80 K;  2JA6 J;  3IP4 B;  3S3M A;  1W36 D;  3CD6 I;  4QPQ A;  4EJW A;  2H09 A;  1MH4 A;  3S3N A;  4KFC A;  3H35 A;  3HYI A;  4PFO A;  3EYI A;  4U0W A;  3H3V K;  3OYC A;  3FK7 A;  2JSP A;  5J1Y A;  1OCR H;  5D8K B;  1KA8 A;  2GXG A;  4QPO A;  2QF7 A;  2VT2 A;  2PJR A;  1ZG5 A;  4KT5 C;  1IGN A;  2JJ7 A;  1RNL A;  3OYJ A;  4N4N B;  4PJ0 C;  5DV5 A;  1XC5 A;  4HPQ A;  3R61 A;  3AG3 H;  3SQN A;  3GTO J;  1KYZ A;  2DAO A;  4M6Y A;  4PUS A;  4BAY A;  3WTW C;  1O3R A;  4I7H A;  3MZY A;  2E1M B;  1WJ5 A;  3NEU A;  5TGT A;  3W3C A;  1JJ6 C;  3K4C A;  5C44 J;  3FX3 A;  1Z1D A;  1K61 A;  3HHH A;  2LTP A;  3DCF A;  1T6S A;  2RKH A;  1MDM A;  1W1W E;  4RA2 A;  2Z2S B;  1CGP A;  1MMN A;  2XGC A;  5GAH J;  3T5X A;  4C2U A;  3S2W A;  1LFU P;  3IH4 A;  2EFQ A;  1L0O C;  1IUF A;  4UV9 A;  2M45 A;  5CYV A;  1DPU A;  4C30 A;  2R93 J;  1WI9 A;  1ZLJ A;  3HPH A;  4Y13 A;  3ZOB A;  4LIV A;  2F5E A;  2O0Y A;  2KRH A;  3EUH C;  1FIA A;  3ISP A;  4C3H J;  4I02 A;  3BZK A;  2JUC A;  1U9N A;  3PFI A;  3S32 A;  4BE1 A;  2RAE A;  1FTT A;  1OR7 A;  3U2R A;  4WWC A;  1IV6 A;  1VQ5 I;  2LR8 A;  3QOP A;  4HX8 A;  1B4A A;  4GFB A;  2W57 A;  2JA8 J;  3CCR I;  2RNJ A;  1KQ0 A;  4PZJ A;  3TL4 X;  1SAX A;  1V3F A;  2EZI A;  2IA2 A;  1YJ9 I;  1JKP C;  5GAD J;  2FX0 A;  1WKM A;  2LKP A;  5CVU A;  1TBX A;  5HLT A;  3FM5 A;  1F9N A;  3MKZ A;  1MNE A;  2LG4 A;  3BG5 A;  5DYM A;  3S16 J;  3PSF A;  3WE3 A;  3E6C C;  2M0M A;  1SVO A;  3KP4 A;  2R4G A;  4JK1 X;  3HOW J;  3OOP A;  1UB9 A;  4GGG A;  3F3X A;  1H89 C;  2NVQ J;  2DBB A;  2WAD A;  4W1U A;  4DZP A;  3HOY J;  2IJL A;  4DJA A;  3HOU J;  3QQA A;  2H6B A;  4XN0 A;  4LB6 B;  4AYB A;  1HDP A;  1OYI A;  1ODD A;  2OJE D;  2G7H A;  4LK0 F;  2X1E A;  3F8C A;  2LC2 A;  4FHT A;  1X1C A;  4PSW A;  2L5Q A;  3UR3 C;  4A3G J;  3E5X A;  4BQA A;  5E3L A;  2P5K A;  2ZKZ A;  4UUS A;  3CCV I;  4G9Y A;  1D0Z A;  2EH3 A;  3TED A;  1DDN A;  4BEH A;  2OBP A;  4X6A J;  1HC8 A;  1U5T A;  3OYB A;  3CDI A;  4Y4R A;  3PO3 J;  4P9U A;  3QAH A;  1USS A;  2X4H A;  1HW2 A;  1DU6 A;  5FKM A;  5LGU A;  3D1N I;  1IN6 A;  2AO9 A;  2W84 A;  4MFD A;  4JOM A;  2L02 A;  1XMK A;  4YII A;  1B1B A;  3HKZ A;  4A5N A;  2QZ8 A;  1UAA A;  2W85 A;  3RSN A;  1YJW I;  1P6R A;  1S8N A;  1WCM J;  3JCU C;  3E6D A;  2O5R A;  3GF2 A;  4ASN A;  2F5C A;  1VI0 A;  4XOP A;  4Q47 A;  4BY1 J;  3SZP A;  3OYG A;  2BVM A;  3JRA A;  2K86 A;  5CLS A;  4D1Q A;  2L54 A;  2LD5 A;  1TW2 A;  1D1B A;  1FBS A;  4ENJ A;  2E2I J;  2DN0 A;  5HDK A;  5L3D A;  4D5C A;  3E6M A;  2EZH A;  4ZYA A;  1V54 H;  1Y56 A;  3I5U A;  2DYS H;  5LEK A;  3D5R C;  4EGY A;  1BC7 C;  3V7S A;  2R3S A;  2DTZ A;  5IPA A;  3CME I;  2LY1 A;  4L9V A;  1J59 A;  1RKW A;  2M9H A;  4A69 C;  4DYR A;  4ZTJ A;  2EIK H;  4L9N A;  3H0G J;  3MN2 A;  1ONV A;  4C3J J;  3LST A;  5E20 A;  3H92 A;  4RAY A;  1TZL A;  2ZSI B;  2H8R A;  2O8K A;  2CQQ A;  2DDB A;  2OCE A;  1KZH A;  1H9G A;  4OIQ F;  2MC4 A;  3UNG C;  3GTJ J;  3RQI A;  3BY6 A;  3LWF A;  5HOD A;  1D1A A;  1MND A;  1FX7 A;  2P5L C;  3ZQQ A;  3OSF A;  4NQW B;  1ZRD A;  5EEH A;  3JTH A;  3KX2 A;  1H9T A;  4M9Z A;  5BNG A;  4KT6 A;  2IGK A;  1X4P A;  4HQE A;  3O8G A;  2OAZ A;  4CZC A;  3A1Y A;  3PNY A;  3I53 A;  5M5W J;  4QLC U;  3OIP A;  5KAF C;  6PAX A;  2MG4 A;  5D5V B;  3SFZ A;  2D1H A;  4J00 A;  5FB2 A;  2H94 A;  4F55 A;  5HLI A;  5IOY A;  3TO6 A;  1B6A A;  3DBL B;  3H5N A;  1FWZ A;  4DNC A;  1MJA A;  4KN4 X;  1YE9 A;  2ZFW A;  3J80 Z;  4I6Z A;  3K4N A;  3K1M A;  4D7N A;  4IHX A;  2YX4 A;  2XRO A;  3WE2 A;  3MQ0 A;  4XSZ F;  2CFO A;  3HGG A;  1NK3 P;  1ZQ3 P;  2KMU A;  3COA C;  2VJ4 A;  5HOO A;  5M3M J;  2WC2 A;  1UST A;  4EM2 A;  3WGI A;  5GPC A;  1GXQ A;  1P9Q C;  3VSK A;  3HUG A;  4X1E A;  3A01 B;  1E3H A;  1AKH A;  3LNQ A;  1S6L A;  4PJJ A;  1D5Y A;  1TT5 B;  2OU2 A;  1FBQ A;  4GO1 A;  1G8X A;  2VJJ A;  2D5V A;  2KZV A;  1OFC X;  1BI0 A;  1E2X A;  3KET A;  1PP7 U;  3AAF A;  1BR1 A;  4A3M J;  3W2V A;  4OMZ A;  3I3L A;  4A0Z A;  4LGW A;  4B1R A;  1IXC A;  4N9H A;  1WJC A;  2HKO A;  5D5W B;  5E8G A;  4HQM A;  2CW8 A;  1SFU A;  2WV0 A;  4BHC A;  5FD6 A;  2A69 F;  3DLA A;  3M1C A;  1TQI A;  4AWX B;  3SEQ A;  4G94 A;  3K4B A;  3WHB A;  2EIL H;  1FP2 A;  3ZR8 X;  2FU4 A;  4FX4 A;  1L3L A;  2KQR A;  1GDT A;  4GDF A;  1SAU A;  1NHA A;  3DQV C;  5DD4 A;  2KIU A;  3GX4 X;  2YS9 A;  1LDK B;  3M7G A;  2CGP A;  4M71 A;  3KE2 A;  1G3T A;  2K9M A;  1IZ1 A;  3JSO A;  2XAG A;  3KYL A;  4PJN A;  3TO9 A;  1KQ8 A;  2MC3 A;  3CLQ A;  2DA1 A;  3FBI B;  4OMY A;  1VQN I;  5B5E C;  5LHI A;  2PBI A;  2HR3 A;  3HSF A;  4BXU A;  5E3O A;  3RPQ A;  2OTJ I;  2IW5 A;  4V19 K;  2EV6 A;  4XIC A;  2X6X A;  3NRV A;  1C0W A;  4L9J A;  5FKL A;  5FLV A;  5FLX K;  5C3E J;  3V42 A;  4XLP F;  2NS8 A;  3BZ6 A;  4E6K G;  1MMA A;  1Y8R B;  3FXJ A;  2PMU A;  2XPW A;  2ESH A;  5JVG F;  3B02 A;  1R23 A;  2V6E A;  2R92 J;  4BUP A;  3FIW A;  1FOK A; 
#chains in the Genus database with same CATH homology
 1MDM B;  3BRO A;  3V7C A;  1YFH A;  1Q1H A;  4BNC A;  2IA0 A;  4ZYD A;  2FF4 A;  4XSX F;  2VBZ A;  4WXH A;  3DEU A;  2Z99 A;  4WF2 A;  1HST A;  4KA4 A;  3VB2 A;  3EYY A;  2XIG A;  1F1Z A;  1YLF A;  3L2C A;  1O3S A;  1G3W A;  2XUB A;  3DFG A;  3F22 A;  2A3S A;  3HIF A;  2QQA A;  3ZMD A;  2GXB A;  1BBY A;  3I59 B;  1R5G A;  4HV6 A;  3IKT A;  2F5F A;  3GUD A;  2PMH A;  3WOD F;  1T38 A;  3TOA A;  2UXX A;  3P9C A;  2HQN A;  3E97 A;  2ZCW A;  1R5H A;  4AIH A;  3QP5 A;  1R7J A;  4PGH A;  2MBF A;  3CUQ C;  4CXF A;  1WQ2 A;  4MQ9 F;  3T1B A;  3V8J A;  1RUO A;  4L9T A;  2MA3 A;  3C3W A;  3QU3 A;  3RKX A;  2G9W A;  1JHH A;  3J81 K;  4I09 A;  2V9V A;  4IF4 A;  5ICG A;  2A07 F;  4RB0 A;  1R1U A;  4RGU A;  3Q9S A;  1PUE E;  2PJP A;  3FMQ A;  1ZRC A;  3KZZ A;  3W6J B;  1IUY A;  3MZH A;  4LG0 A;  1B59 A;  1B9N A;  2UXN A;  3P9I A;  5E1X A;  5ICE A;  4RB2 C;  1XB4 A;  4EQQ A;  3I59 A;  4U7D A;  3P9K A;  3O2P E;  3WTY C;  4YFK F;  2Z3Y A;  3BP8 A;  5LRR A;  4U88 A;  2WTE A;  4G6Q A;  4IRI A;  1OYW A;  2B0L A;  1KU3 A;  1T39 A;  3D5L A;  5DUI A;  2P6T A;  5K5Q A;  1W4M A;  3K0L A;  4BHP A;  1ZH5 A;  1P92 A;  3I71 A;  1HSJ A;  2VON A;  1STZ A;  1V4R A;  5CVV A;  1LDJ A;  1Y0U A;  4XLN F;  3F6V A;  3DPT A;  3WTZ A;  3WU1 B;  1R1T A;  1BIB A;  1FLI A;  3ABT A;  1IN4 A;  2GZW A;  3I0T A;  1O57 A;  1UCR A;  5ILV A;  2ZO4 A;  1J2X A;  3HOT A;  2W25 A;  4HBL A;  3WG9 A;  4KYW A;  2J5O A;  4LLN A;  1HW1 A;  4O3M A;  2QQ9 A;  3WTS C;  3RPU A;  4G7H F;  1FPQ A;  2LDU A;  2M87 A;  3M8E A;  1U5T C;  1XGS A;  1Z6R A;  2F5D A;  1J7K A;  4EGZ A;  3MWM A;  4PDK A;  3CUQ B;  4A6E A;  4R8H A;  5ED4 A;  2STT A;  4WX9 A;  2CQK A;  1FSE A;  1HBX G;  4OU0 A;  4FT8 A;  3DF8 A;  4L5J A;  3N97 A;  4M72 A;  1D8J A;  1FBU A;  3RYP A;  2HS5 A;  5H6Q A;  4LLG F;  1S3J A;  1KU2 A;  3BJO A;  1DPR A;  2OQR A;  2CFX A;  1QZY A;  4B09 A;  1BI1 A;  5L3B A;  1IN8 A;  2A6H F;  3IHU A;  1DUX C;  4ESF A;  2ESN A;  1HW5 A;  4KDP A;  4I01 A;  2RDP A;  4S05 A;  3ZMS A;  3I58 A;  2WWY A;  4NHJ A;  3FHZ A;  1EV7 A;  4Z2Y A;  3U1D A;  1U78 A;  1D8K A;  3IRQ A;  1EH8 A;  1TQP A;  3FMR A;  3WU0 A;  4E70 A;  4N9I A;  4O6J A;  2DPU A;  2V6C A;  4CDG A;  4RAZ A;  2CG4 A;  1IN7 A;  2HYG D;  1U5T B;  1FT9 A;  2HFH A;  4A6D A;  4ESB A;  3DXJ F;  2QUF A;  2BBY A;  3F23 A;  2G7U A;  4P55 A;  4RGS A;  2ZJ2 A;  2HWV A;  3F8F A;  2LSO A;  1I1G A;  4U0Y A;  1LQ1 A;  3FXQ A;  3CO6 C;  4S04 A;  3ZMU A;  4HV5 A;  1LNW A;  1TLH B;  3HSR A;  2MLK A;  4RB1 A;  3K1N A;  1R36 A;  3JW4 A;  2MH9 A;  3LAJ A;  3T8R A;  4KIF A;  2X0L A;  5JHU A;  1T0F A;  3DPL C;  2QBY A;  5ERI A;  3EET A;  1SD4 A;  4KIB A;  2O03 A;  1IRG A;  3I54 A;  2AXL A;  3M8F A;  5DCF A;  3IKV A;  1I27 A;  4UUV A;  2GAU A;  2EA4 A;  4MQV A;  3ULQ B;  3GEZ A;  3BDD A;  2C6Y A;  1XSX A;  2M8E A;  1LDD A;  3GYH X;  4FX0 A;  3H3U A;  4I2O A;  4BH9 A;  3CDH A;  1MGT A;  1YTY A;  1XN7 A;  1YS6 A;  5H20 A;  3QRF F;  2MLG A;  3MCZ A;  1K78 B;  4OIR F;  3SXY A;  1MKM A;  2KRF A;  3TO7 A;  2ETH A;  1ULY A;  5FFZ A;  4HOB A;  3EDP A;  4HDU A;  3KP5 A;  4HF2 A;  1P4W A;  1ON2 A;  3FM3 A;  1ZRF A;  5AIP A;  4IHT A;  2PG4 A;  3B73 A;  3KEQ A;  1W7P D;  4M74 A;  3R0J A;  5LGT A;  2V1D A;  5HS9 A;  4A5M A;  2YPR A;  2OZU A;  4EVI A;  4OIP F;  5ILU A;  3JAM Z;  1R00 A;  5FD5 A;  1IF1 A;  2EK5 A;  2DT5 A;  1XGN A;  3J7A O;  3GFI A;  3T0Y A;  2P5V A;  5JVT A;  4EM0 B;  3HOS A;  2XRN A;  3Q5F A;  1CF7 B;  3V4G A;  2P6S A;  3KP6 A;  2EV0 A;  5F6F A;  1XDS A;  2UWM A;  5HLG A;  1LB2 A;  2Y48 A;  2QLZ A;  2RVC A;  3TOB A;  5F1R A;  1QBJ A;  1GHC A;  4LMY A;  1G4D A;  4AIJ A;  1FYM A;  3ZMT A;  3QPH A;  2VOD A;  2CSO A;  3TDZ C;  3MFK A;  2V1U A;  2KJC A;  2ZME A;  2OD5 A;  3RKW A;  2ZNZ A;  3RTR A;  4EJO A;  5JFR A;  1XCV A;  2O8X A;  1FYL A;  4MTE A;  4LFU A;  5FO5 A;  3F6O A;  3RIR A;  5E18 F;  5BPD A;  2QVO A;  3BWG A;  1AOY A;  1SMT A;  1KGS A;  1UHW A;  5HLH A;  2E7W A;  2FNP A;  1HKQ A;  4LD5 A;  4YIF A;  2HGC A;  1IRF A;  1JGS A;  3GWZ A;  1R58 A;  2P8T A;  5D5U B;  2ISZ A;  2R7D A;  3LQQ A;  4AD9 A;  2Y75 A;  3FXR A;  1D5V A;  3RDI A;  5IT9 Z;  2FBH A;  4ENK A;  2Z33 A;  2BYV E;  1I5Z A;  4K2E A;  4N0B A;  1MZB A;  1YS7 A;  1BI2 A;  1Z6T A;  4BYY A;  4UNO A;  3KP2 A;  2XHK A;  4CYD A;  2HDC A;  1K78 A;  2CWE A;  2M1B A;  2YR2 A;  1BJA A;  3H3Z A;  3KZY A;  3NQO A;  4RS8 A;  5TRD A;  1QO0 D;  1XGM A;  3HRT A;  3KLN A;  3ZPL A;  4LG0 B;  1TW3 A;  3J81 Z;  3K69 A;  2QBY B;  1SD7 A;  4JBA A;  2XAS A;  1S7A A;  4UXN A;  2P4W A;  4EJT A;  2HTJ A;  5D8L B;  4CZZ A;  2QWW A;  3RI4 A;  1E17 A;  2RV8 A;  4HLY A;  1QZZ A;  1LEB A;  5HS7 A;  2DFI A;  2QM3 A;  1BOA A;  2DLL A;  1ZGA A;  5LBQ A;  3BPX A;  1WRJ A;  4OOI A;  4P9F A;  1SFE A;  3ZMZ A;  4CIC A;  1F5T A;  2P7V B;  5D6F A;  5L3F A;  2ZXJ A;  2GIV A;  5LGN A;  3JAM K;  3ZP5 A;  4MHG A;  1OKR A;  2EFN A;  2FQ3 A;  2BV6 A;  4HX4 A;  2E7X A;  2PFB A;  4ENM A;  3KP7 A;  4WK8 F;  2EFW A;  4UV8 A;  4ENN A;  1Z05 A;  1HKT A;  4WXC A;  1YO5 C;  4KUM A;  1TTY A;  1TNS A;  1YW7 A;  3FZV A;  2ACJ A;  2KIM A;  3CO7 C;  5DDG A;  3WTU C;  3D0S A;  4YG2 F;  2FEZ A;  2P7C B;  4Q48 A;  1MD0 A;  2UZK A;  2VBY A;  4IXA A;  3RKY A;  5D6E A;  1JXS A;  1IN5 A;  2DPD A;  3GZ5 A;  3K1P A;  4M73 A;  1ZG3 A;  3ZQ7 A;  1LVA A;  2K7L A;  4L0Y B;  1XGO A;  3R0A A;  2Q0O A;  3WTT C;  5L3C A;  3LA3 A;  3GXO A;  3ECH A;  5ICF A;  5L3G A;  5FFX A;  2LF8 A;  2BE5 F;  3WTV C;  4U7B A;  1OPC A;  1REP C;  2FNA A;  5E8I A;  2H27 A;  2PEX A;  4ZYE A;  2DTR A;  1QPM A;  4JQF A;  4HF0 A;  2VN2 A;  1D3Y A;  2OZ6 A;  1B9M A;  2PLY A;  4G6D A;  4ZYH A;  3VFZ A;  4UVC A;  1FP1 D;  4CHU A;  3C7J A;  5J8F A;  5J6X A;  2FRH A;  1BM9 A;  2VT3 A;  3KFW X;  4I0B A;  2V79 A;  1SD6 A;  3I64 A;  3BJA A;  2Q2E A;  2ZNY A;  2HTS A;  1FC3 A;  3FF5 A;  3GVA A;  4UHT A;  3MEX A;  2GWR A;  2DQR A;  1T2K A;  1U8R A;  4NB5 A;  2DK5 A;  3BJ6 A;  3EUH A;  2EJR A;  2H6C A;  5A2Q K;  1IXS B;  2JT1 A;  5J8C A;  2PQ8 A;  2Y0M A;  4GXO A;  5CJ9 A;  1LJ9 A;  4KIG A;  2FML A;  5CVJ A;  1XSD A;  3F21 A;  1QQI A;  5LEJ A;  4CGZ A;  3HRU A;  4PCQ A;  3GO5 A;  4M6X A;  3CLO A;  1JHF A;  4B8X A;  4EV0 A;  2DU9 A;  1QNT A;  4ZYG A;  2FMY A;  1RZ4 A;  1G3Y A;  2FSW A;  1H0M A;  3L7W A;  3N4M A;  4IRH A;  3KEO A;  2L01 A;  1K79 A;  3WGH A;  4HW0 A;  5LHG A;  4U0V A;  2VOO A;  2D1V A;  3EQL F;  4OIN F;  3F8N A;  1KU9 A;  4AVP A;  1HKS A;  4MTD A;  3CTA A;  2XAQ A;  3FMS A;  4EMS A;  5CVI A;  5KVR A;  1XMA A;  2D2W A;  2V1X A;  2VBW A;  3E5U A;  4WXD A;  2ADU A;  1U2W A;  2BEO A;  5BMZ A;  5HDN A;  3TQN A;  2QQB A;  3F72 A;  2HQR A;  3E6B A;  5K5O A;  4MEX F;  2JPC A;  1KU7 A;  3L09 A;  5HVQ C;  5ILS A;  3QU6 A;  3LA2 A;  4IJA A;  4IRG A;  2IP2 A;  2RN7 A;  2NYX A;  1ZRE A;  1ZLK A;  2KIF A;  2XAJ A;  2AS5 F;  2CW0 F;  2FBK A;  4YFX F;  2A68 F;  4HZF A;  1GVJ A;  5D4S A;  2D45 A;  1HXD A;  2IA1 A;  1ZYR F;  3HTU A;  3IWF A;  3LFK A;  4R1H A;  2Q8K A;  2KJB A;  4RGR A;  1KQ9 A;  2IPQ X;  4BHB A;  1TNT A;  2CO5 A;  3E5Q A;  3K9T A;  4XBF A;  2JPB A;  4P96 A;  3KLO A;  2GA2 A;  4PGG A;  3PQK A;  1FY7 A;  2VE8 A;  1DP7 P;  2VC0 A;  1SFX A;  3RJP A;  4HYE A;  5DD8 A;  4I98 B;  5E1Z B;  3V8L A;  3W6K B;  1WSU A;  3DV8 A;  2JSC A;  1UFM A;  3R4K A;  1I6X A;  5FGM A;  2L3D A;  2DI3 A;  5IT9 K;  4H0E A;  3HRS A;  1RIO H;  1J9I A;  2NRA C;  5BOX A;  2MD5 A;  1U6G A;  2STW A;  4IVN A;  3G73 A;  1YIO A;  4A0Y A;  4ZZD A;  2LNB A;  2F2E A;  1O3T A;  4LLL A;  1I1S A;  2ZBK A;  2XGX A;  2HZT A;  4LJZ F;  4DQ2 A;  2Z9O A;  2R7F A;  2E1N A;  2DO7 A;  5DCM B;  3ECO A;  3ABU A;  4YFN F;  3TGN A;  1W7P A;  3CUQ A;  3M1E A;  3V8K A;  1VTN C;  2LF7 A;  1IW7 F;  2OA4 A;  3IC7 A;  4NQW A;  2EA2 A;  1PP8 F;  4UVB A;  3QPT A;  1MJB A;  1XD7 A;  2EFO A;  1BN5 A;  1GXP A;  2A6E F;  5TJJ A;  5LLQ A;  3C18 A;  2J5P A;  2E1C A;  5F64 A;  2OQG A;  4MNU A;  1P4X A;  2O3F A;  2A61 A;  3R60 A;  5K5R A;  1T98 A;  2YSR A;  1ZHF A;  1R22 A;  3QP6 A;  3ZMV A;  1A04 A;  4G7Z F;  1O3Q A;  4KNY A;  1ON1 A;  4KN7 X;  4ZZL A;  1XDU A;  4GYG A;  1XCB A;  2EV5 A;  5E1W A;  1ZN2 A;  2FE3 A;  1ZAR A;  1RUN A;  1X3U A;  3DP7 A;  3F8B A;  1OYY A;  2EFP A;  4TV7 A;  2QYO A;  2FBI A;  3ZN1 A;  2K02 A;  4ON0 A;  4MGR A;  1FYK A;  3M9A A;  2VOP A;  4MEY F;  3FWE A;  1W7P B;  1FSH A;  3P7N A;  4RGX A;  1Z91 A;  4Y17 A;  4ESJ A;  3IRR A;  4IHS A;  1YYV A;  1F4K A;  2GA1 A;  4EJU A;  1J75 A;  5ICC A;  3GFL A;  2DQL A;  4HA8 A;  2GQQ A;  4Q4Z F;  3VOD A;  4L0Z B;  5HS8 A;  2HEO A;  1XSV A;  2XV4 S;  2A5Y B;  2VXZ A;  3G3Z A;  3ML6 A;  2PN6 A;  4CO8 A;  1K7A A;  2O61 A;  2JTV A;  1FZP B;  2NS0 A;  2L4M A;  5DCM A;  3GFM A;  2TDX A;  4P5O A;  3Q9V A;  4G7O F;  3OV8 A;  2O6G E;  1G3S A;  5AIQ A;  5E17 F;  3TDU C;  4AIK A;  1YW8 A;  3ZN0 A;  1ZAO A;  3I4P A;  1SD5 A;  4WCG A;  1MJ9 A;  4KMF A;  3CJN A;  4HLX A;  5AON A;  4KMU X;  2XAF A;  4M9X A;  3ELK A;  3REO A;  3CUO A;  3GZ6 A;  2CYY A;  3TKY A;  3C1D A;  3O3K A;  2VE9 A;  3BOQ A;  5BS6 A;  4ETS A;  4A2U A;  3WGG A;  4A12 A;  1LEA A;  4LK1 F;  1U3E M;  2Z5U A;  1YQA A;  3IWZ A;  2EWN A;  4L5I A;  1EH7 A;  2HYF A;  2VBX A;  1O7L A;  1K6O A;  4Y15 A;  3GFJ A;  4L18 B;  1EH6 A;  3MAJ A;  2IVM A;  1S7O A;  2DW4 A;  2YX7 A;  2RC4 A;  3U9G A;  2XKP A;  4R79 A;  4IPA A;  5JR3 A;  2EB7 A;  2IRF G;  4OIO F;  3GW2 A;  1TQM A;  1J5Y A;  2IT0 A;  4G8X A;  1O7F A;  1BI3 A;  1Z9C A;  3LQR A;  3HSE A;  1J0R A;  1RI7 A;  4ZH4 F;  3JTG A;  3K2Z A;  3DKW A;  3HTS B;  1QGP A;  4A0X A;  3E3V A;  1BIA A;  2ELH A;  4M9S A;  5KK1 A;  3T8T A;  4D0P A;  4O5V A;  2K27 A;  5A2Q Z;  3LA7 A;  4HF1 A;  3VOE A;  4LB5 A;  1FNN A;  4QWQ A;  2HOE A;  1Z7U A;  3VEP A;  5FLX Z;  2W24 A;  1BC8 C;  3R6S A;  3ROU A;  2COM A;  5H6R A;  3SZT A;  3FXU A;  2HKX A;  1CF7 A;  1KYW A;  1W5T A;  5D5X B;  2K4B A;  2NNN A;  5HDG A;  4GYI A;  1SMY F;  5BQT A;  3O6B B;  2L4A A;  2RGV A;  4KIC A;  3L9F A;  3GLX A;  4EJV A;  3F8M A;  3V7R A;  1R1V A;  5BPI A;  5LRS A;  1ZGJ A;  1AWC A;  1YW9 A;  2ZME B;  1PDN C;  2YU3 A;  2FXA A;  4I0A A;  3KP3 A;  3LAP A;  1IXR C;  4GCV A;  1OMI A;  1P2F A;  2BGC A;  2JRT A;  2KKO A;  3IL2 A;  5DUK A;  5D4R A;  1ZG1 A;  2XVC A;  2NAZ A;  2FOK A;  1WWX A;  4HX7 A;  3BPV A;  1IAW A;  2VC1 A;  5IT3 A;  5EEG A;  1HQC A;  2JZY A;  2M5W A;  2RQP A;  3ERE D;  3KCC A;  5CVR A;  2DK8 A;  4EM1 A;  5JI6 A;  1W5S A;  5K1Y A;  4HAM A;  4XRF A;  4RB3 C;  1G6N A;  2K4J A;  3HHG A;  5DEQ A;  1YG2 A;  3SHF A;  5L3E A;  2FA5 A;  3JSP A;  2M30 A;  2XAH A;  2QEN A;  2PI0 A;  4Q5S F;  5LHH A;  4HDV A;  2NNY A;  3PQJ A;  1P4A A;  2MH2 A;  2XKO A;  3RYR A;  4UVA A;  3L00 A;  1JE8 A;  2ISY A;  3WTX C;  1UHM A;  1S29 A;  3HRM A;  3J80 K;  4EJW A;  2H09 A;  4KFC A;  3HYI A;  3EYI A;  4U0W A;  5D8K B;  1KA8 A;  2GXG A;  2VT2 A;  1ZG5 A;  4KT5 C;  1RNL A;  5DV5 A;  3R61 A;  3SQN A;  1KYZ A;  2DAO A;  4M6Y A;  4BAY A;  3WTW C;  1O3R A;  4I7H A;  3MZY A;  3NEU A;  3FX3 A;  1Z1D A;  3HHH A;  2RKH A;  1T6S A;  1MDM A;  1CGP A;  3T5X A;  3S2W A;  2EFQ A;  1L0O C;  4UV9 A;  2M45 A;  5CYV A;  1DPU A;  1WI9 A;  1ZLJ A;  4Y13 A;  2F5E A;  2O0Y A;  3ISP A;  4I02 A;  3PFI A;  1OR7 A;  3U2R A;  4WWC A;  3QOP A;  4HX8 A;  1B4A A;  2W57 A;  1KQ0 A;  2RNJ A;  4PZJ A;  1SAX A;  1V3F A;  2IA2 A;  1WKM A;  2LKP A;  5CVU A;  1TBX A;  3FM5 A;  1F9N A;  5DYM A;  3WE3 A;  3E6C C;  3KP4 A;  4JK1 X;  3OOP A;  1UB9 A;  4GGG A;  3F3X A;  2DBB A;  2IJL A;  2H6B A;  4LB6 B;  1OYI A;  1ODD A;  2G7H A;  4LK0 F;  3F8C A;  4FHT A;  3E5X A;  4BQA A;  2P5K A;  2ZKZ A;  4G9Y A;  1DDN A;  2OBP A;  1U5T A;  4P9U A;  3QAH A;  1USS A;  2X4H A;  1HW2 A;  5LGU A;  1IN6 A;  2W84 A;  2L02 A;  1XMK A;  4YII A;  1B1B A;  4A5N A;  2QZ8 A;  2W85 A;  1P6R A;  1S8N A;  3E6D A;  3GF2 A;  4ASN A;  2F5C A;  4Q47 A;  3SZP A;  2K86 A;  5CLS A;  2L54 A;  1TW2 A;  1FBS A;  4ENJ A;  5HDK A;  5L3D A;  3E6M A;  3I5U A;  5LEK A;  4EGY A;  1BC7 C;  3V7S A;  2R3S A;  4L9V A;  1J59 A;  4L9N A;  1ONV A;  3LST A;  5E20 A;  3H92 A;  4RAY A;  1H9G A;  4OIQ F;  3BY6 A;  3LWF A;  1FX7 A;  2P5L C;  1ZRD A;  5EEH A;  3JTH A;  1H9T A;  4M9Z A;  4HQE A;  2OAZ A;  3I53 A;  4QLC U;  6PAX A;  5D5V B;  3SFZ A;  2D1H A;  5FB2 A;  2H94 A;  5HLI A;  3TO6 A;  1B6A A;  4DNC A;  1FWZ A;  1MJA A;  4KN4 X;  2ZFW A;  3J80 Z;  3K1M A;  2YX4 A;  2XRO A;  3WE2 A;  3MQ0 A;  4XSZ F;  3COA C;  5HOO A;  2WC2 A;  1UST A;  4EM2 A;  3WGI A;  1GXQ A;  3HUG A;  1S6L A;  2OU2 A;  1FBQ A;  4GO1 A;  1BI0 A;  1E2X A;  3KET A;  1PP7 U;  3AAF A;  4OMZ A;  4A0Z A;  4LGW A;  1IXC A;  4N9H A;  2HKO A;  5D5W B;  5E8G A;  4HQM A;  1SFU A;  2WV0 A;  4BHC A;  5FD6 A;  2A69 F;  1TQI A;  4AWX B;  4G94 A;  4FX4 A;  1FP2 A;  1L3L A;  2FU4 A;  3DQV C;  1NHA A;  3GX4 X;  2KIU A;  5DD4 A;  1LDK B;  3M7G A;  2CGP A;  4M71 A;  3KE2 A;  1G3T A;  3JSO A;  1IZ1 A;  2XAG A;  3TO9 A;  1KQ8 A;  2MC3 A;  4OMY A;  5LHI A;  2PBI A;  2HR3 A;  3HSF A;  4BXU A;  3RPQ A;  2IW5 A;  2EV6 A;  3NRV A;  1C0W A;  4L9J A;  5FLX K;  4XLP F;  3BZ6 A;  2PMU A;  2ESH A;  3B02 A;  1R23 A;  4F7Z A;  1FOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...