2HZTA

Crystal structure of a putative hth-type transcriptional regulator ytcd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
95
Chain Sequence
MSLVEATLEVIGGKWKVILHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLAWGANHINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative HTH-type transcriptional regulator ytcD
publication title Crystal Structure of a putative HTH-type transcription regulator ytcD
rcsb
source organism Bacillus subtilis
total genus 23
structure length 95
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hztA00
1BI1A 5EEHA 1BIBA 4RB0A 2M30A 1IZ1A 5E8GA 2P8TA 5D4RA 3ABTA 2EFOA 1YYVA 1GHCA 3ZMZA 5FFZA 3Q9SA 3WU1B 1MDMA 2UXXA 2UZKA 2L01A 2ADUA 1S6LA 1TQMA 2EA2A 1FYMA 1MJ9A 3CDHA 1IN8A 5ILVA 3TO6A 2V1DA 6PAXA 5DD8A 2DPDA 3TDUC 2D1VA 4XLPF 2F2EA 5FO5A 2RC4A 1Y0UA 2LSOA 5JI6A 2A61A 5ED4A 5CJ9A 1ZG3A 1K7AA 2MLGA 3BDDA 3WODF 3R61A 4UVAA 4GGGA 1F5TA 2H94A 2EV0A 3WTWC 2W85A 2EFWA 4EM0B 5LEKA 1ON2A 2O03A 4RAZA 2WWYA 2PJPA 4BXUA 3M8FA 2HYGD 4S05A 5F64A 2ESNA 1F1ZA 1YS6A 4L18B 1R1TA 4BYYA 1G3YA 1FBQA 2QENA 3QOPA 2DTRA 1TNTA 4IXAA 3LQRA 5LEJA 1RUNA 1W7PA 1YFHA 2HQRA 5J8CA 4IHTA 4RB3C 1STZA 1OR7A 2M8EA 1KQ9A 3EDPA 5DDGA 3DEUA 4UHTA 2IRFG 2FA5A 1KU3A 1U5TB 4HLYA 4WCGA 2JSCA 4U0YA 4PGGA 2O6GE 3Q9VA 1QNTA 4PZJA 5L3GA 2RN7A 1T39A 1KU9A 2PQ8A 2STTA 3BZ6A 2ZXJA 2XAFA 4A0ZA 1LDKB 4ESBA 1B59A 1P4AA 5BPIA 4EM1A 3MAJA 4EGYA 1H9GA 1FOKA 4K2EA 4MEXF 4ENNA 2OBPA 1I27A 3F8FA 1JHFA 5DYMA 2JRTA 4UV8A 5D8LB 2FMLA 4O6JA 3J7AO 1TLHB 2B0LA 2YX4A 1ZRDA 5BQTA 4HF1A 1LEBA 4Y17A 2OAZA 3LAPA 3K1MA 3E5XA 3WGHA 5JFRA 4KFCA 3D5LA 3L2CA 2DU9A 4ZZDA 2PI0A 4CGZA 4UVCA 2EFNA 1UCRA 3K2ZA 3GX4X 3ULQB 4LGWA 1BI0A 4M9XA 3U2RA 1GVJA 4HAMA 4LB5A 3IC7A 2CGPA 4U7BA 2XIGA 4ENJA 2P5VA 3FMSA 4B09A 2A6EF 2X4HA 2LF7A 4HF2A 4OMYA 1BC7C 5L3CA 4H0EA 3EETA 1XSXA 1Q1HA 3ZMVA 1ZREA 4M9SA 5K5QA 2HKOA 1HKSA 2Y48A 1OYIA 1B1BA 1KYZA 3HSRA 4HYEA 4HDUA 1T98A 2HTSA 5CVJA 5A2QZ 2LKPA 4IRIA 3FF5A 4QWQA 1KQ0A 3KETA 4MTDA 1R36A 1ZGAA 3GFLA 5DUIA 3GFMA 4JBAA 4L9JA 4HX8A 3C3WA 4KICA 3GXOA 2E7XA 5CYVA 2RV8A 2W57A 1LNWA 4MEYF 3Q5FA 2Z3YA 3V7SA 2HYFA 1RI7A 3RPUA 2Z9OA 3V8KA 2QUFA 1RZ4A 5KK1A 4RGSA 4OIOF 1BIAA 4U0VA 2XKPA 3ML6A 3ZQ7A 5HDGA 1S7AA 4HX7A 4P9FA 5LHHA 2D2WA 1J0RA 3QPTA 1BBYA 2VBWA 2FE3A 5DV5A 3GLXA 1P4XA 3KLNA 2E1CA 4N0BA 4L9VA 1WKMA 2L4AA 2R3SA 3H92A 2MBFA 1B6AA 5D6FA 3SHFA 4PGHA 1XGMA 2GZWA 1H9TA 1HSTA 2GWRA 1FYKA 1W7PD 3BY6A 1QQIA 3N4MA 2EV5A 2PLYA 4ENMA 1FPQA 1BN5A 1XN7A 1WSUA 4ESJA 3WTYC 1IXRC 5F1RA 3GWZA 2KRFA 3QP6A 4G7ZF 1SD5A 2OZUA 1QPMA 1R1UA 1K78A 1D8JA 1XD7A 2HGCA 2HDCA 2IT0A 2VT3A 3TO7A 3E6DA 3E3VA 1CF7A 1MJAA 3PFIA 2DK8A 1YS7A 1Z6TA 4FHTA 2WC2A 3RKYA 1FYLA 1ONVA 1YTYA 3V4GA 2FNPA 3F6OA 2VC1A 1RIOH 2ZBKA 2MH2A 2G7UA 2YSRA 4YFKF 4I09A 5FD5A 2XAQA 3HTUA 5D6EA 2COMA 2ZMEB 2W84A 4IJAA 2V79A 1HKQA 2ESHA 4A5MA 2O61A 2DQLA 3GVAA 1T0FA 3F3XA 3R6SA 2XASA 2GA1A 3REOA 1B9NA 1EH8A 2FRHA 4MQ9F 4ZZLA 3F22A 4ON0A 3LQQA 3WTUC 2QBYA 2EV6A 1S7OA 1TBXA 2OA4A 3JTHA 4XSXF 4MTEA 4M6YA 2GAUA 2DAOA 4OIRF 4DQ2A 1A04A 4WF2A 5L3DA 1O3RA 4AIKA 2IA1A 1ZHFA 4HF0A 3JTGA 3GW2A 4ZYEA 2RGVA 5FD6A 4WWCA 3JW4A 3C7JA 4Z2YA 5DCMA 1HQCA 2W24A 3FMQA 3EYYA 4MQVA 2X0LA 5A2QK 4CO8A 4EJOA 2M5WA 1USTA 1ZN2A 5AIPA 3RTRA 1J2XA 3KP5A 2FQ3A 3E6BA 2A3SA 3P9IA 1MKMA 2H6CA 4GYIA 3MCZA 4ZH4F 4Y13A 2MLKA 2A07F 2EFQA 3V7CA 3LFKA 1XCBA 1R5HA 1Z9CA 3HUGA 4M6XA 3E6MA 4YIFA 5IT3A 2R7FA 1SMYF 3BJAA 2FBKA 2CO5A 3VFZA 4KN7X 2FSWA 3RKWA 4BHPA 4CHUA 3I53A 3O6BB 1ZRCA 1B9MA 1S3JA 3CTAA 4WK8F 1TNSA 1QZYA 4LFUA 4HA8A 2H6BA 2QM3A 5L3EA 1XGOA 3DPLC 1G3WA 1YG2A 2XROA 5ERIA 2BBYA 1USSA 1F4KA 1ODDA 1ZARA 1UFMA 3M9AA 4I01A 3I64A 4BHCA 5E1WA 2K4JA 2L3DA 3SZTA 4GCVA 4HV5A 1TTYA 3I59A 1K6OA 3ECOA 5JR3A 3FZVA 2M1BA 5K1YA 1FX7A 3I71A 2P7VB 3BJ6A 3HRSA 2QQ9A 3WTZA 1O57A 3O3KA 4F7ZA 1K78B 2PEXA 2VC0A 4Q4ZF 3DP7A 2DPUA 2H27A 2EFPA 3R60A 4OINF 1SMTA 3ISPA 3T5XA 4EJWA 1ZG1A 4LJZF 3QU6A 3DFGA 3V7RA 2P7CB 2F5DA 3TOBA 3KP7A 1LVAA 1SD6A 3KP4A 1QBJA 3G73A 1WQ2A 3LA7A 3TO9A 3J81K 2V1XA 2KIFA 5ICEA 3KCCA 1KYWA 3FXUA 2VXZA 1PUEE 5FB2A 3QU3A 4ESFA 3OOPA 3QAHA 1OPCA 4EJUA 2MH9A 4Q5SF 2QZ8A 2HZTA 4FT8A 2D1HA 1XDSA 1EV7A 1ZLKA 4YIIA 5E20A 3HRUA 5ICCA 5BMZA 2K4BA 1QGPA 3KP2A 3RJPA 3KFWX 1ZRFA 3VB2A 4MGRA 3GFJA 1E17A 5J6XA 2NNNA 1Z6RA 4D0PA 4CZZA 4XBFA 4ZYGA 4LG0A 1KA8A 1GXPA 2IA0A 2L02A 2EJRA 5LGTA 2BV6A 4P96A 1FWZA 5BOXA 3J80K 2XUBA 5LBQA 3ZPLA 2VODA 3CUQA 2VBZA 4OIPF 3LSTA 5BS6A 3RDIA 1FP1D 5HLHA 3IWFA 3L7WA 5ICGA 2LNBA 4WXDA 3VOEA 2KJCA 4I0AA 3TOAA 5DCMB 3SQNA 1JHHA 2CYYA 3W6JB 1PP7U 3IKVA 2O3FA 1TQIA 3BP8A 1HW1A 2EB7A 1FP2A 1XMAA 3JSPA 2ZJ2A 3LAJA 1UHMA 4LD5A 1ZG5A 2Z5UA 5HS7A 2CWEA 1SFUA 2GQQA 3BOQA 4M71A 1F9NA 3HIFA 3FXRA 1YQAA 3QPHA 2YPRA 2BGCA 4HBLA 3F72A 3RIRA 4G94A 1I1GA 4NB5A 4G9YA 2EA4A 4KT5C 1FZPB 1YW7A 2DBBA 3GZ5A 1FBSA 3O2PE 1IUYA 4G6DA 2F5FA 5DEQA 1K79A 2YR2A 5CVIA 4Q48A 5HS8A 1R5GA 1BI3A 4G8XA 2E1NA 3MFKA 1P6RA 2VN2A 1O7LA 3HSFA 4WX9A 1B4AA 2AXLA 1OMIA 2EWNA 3WTTC 1MDMB 1E2XA 2ACJA 2RQPA 2P4WA 1OYWA 4A5NA 2MA3A 1XSVA 2CFXA 5HLGA 3EQLF 2XV4S 3FM3A 3CO6C 1LJ9A 4P9UA 4KNYA 2VBXA 1ULYA 3K9TA 1IN5A 3ABUA 2XHKA 2KIMA 4HQMA 1X3UA 3SZPA 5K5RA 4S04A 1IF1A 1O3TA 3DXJF 3WTSC 5FGMA 4LMYA 4O3MA 1Z7UA 3ZN0A 1ON1A 3M8EA 4A2UA 3T8TA 5F6FA 4HW0A 3WGGA 1YLFA 1MD0A 2VE9A 1XGSA 2CG4A 3NQOA 3RKXA 1IXCA 2IVMA 1FLIA 2HS5A 5E18F 1W7PB 4BH9A 1I1SA 2RKHA 2JT1A 2FNAA 3E5QA 1L0OC 1XCVA 5DCFA 2DO7A 3JSOA 1SFXA 1LDDA 4BAYA 3TGNA 3PQJA 4IRHA 4YG2F 4KMUX 2Q0OA 4EJTA 1IW7F 5ILUA 1SFEA 3BWGA 5D5UB 4I0BA 2K86A 3K0LA 1Z1DA 2NAZA 2RVCA 3IKTA 3F8MA 1R23A 3WTXC 4EJVA 4UVBA 3S2WA 1IXSB 5EEGA 3NRVA 4MNUA 5E8IA 5HLIA 3DV8A 5H20A 1TW2A 2VONA 2A6HF 5ICFA 3CLOA 3N97A 1TW3A 4KUMA 2JZYA 3GUDA 3F21A 2IJLA 2HR3A 2O8XA 2WV0A 4OOIA 1FC3A 2PG4A 1IN4A 1U5TA 3IHUA 4LLNA 2BEOA 2DFIA 3PQKA 2HFHA 3V8LA 3I4PA 2ETHA 1YW9A 4EMSA 3C1DA 2VOPA 1JXSA 1G6NA 4R79A 4BHBA 3HOSA 3F8BA 4L5IA 1IAWA 1H0MA 3U9GA 1S8NA 3ERED 4E70A 3GZ6A 2FU4A 2HKXA 2Z33A 1FBUA 2XAGA 1Z05A 4UUVA 3KZZA 1O3SA 2STWA 4EQQA 2ELHA 4I02A 2G7HA 4G7OF 1V3FA 5BPDA 1ZYRF 3RYPA 4R1HA 3E5UA 3LA3A 4KIGA 4L0ZB 4P5OA 5LGUA 3R0AA 2FF4A 4KIFA 1WRJA 1J7KA 2IA2A 1OYYA 3SFZA 4XSZF 2QQBA 1FSHA 3ECHA 2L4MA 3F8NA 1C0WA 1Z91A 4A0XA 1OKRA 5H6RA 1R00A 1XMKA 4EVIA 4R8HA 2VT2A 5D5VB 3RYRA 1QZZA 3ZMSA 3KEQA 1W5SA 4U0WA 3I58A 5E17F 1GXQA 2HTJA 5KVRA 5CVRA 4ZYDA 2XKOA 1KQ8A 4KDPA 3HSEA 4LK0F 2ZKZA 2ZO4A 4EGZA 1DDNA 1J59A 2QVOA 3ZP5A 2OZ6A 4UNOA 2H09A 2EK5A 2Y75A 4N9IA 1I5ZA 4YFNF 2PFBA 2FMYA 3FM5A 2FOKA 2DI3A 2XAJA 4AIJA 5DD4A 2LF8A 2UWMA 2DLLA 3FXQA 3L9FA 2MD5A 4I98B 1IN6A 2JPBA 1MJBA 3ZMTA 4RB2C 1J5YA 1HW2A 2QYOA 4Y15A 2R7DA 2PMHA 1ZLJA 2DT5A 1U3EM 4KMFA 2W25A 3VODA 5FLXZ 4ZYHA 4NQWA 4U7DA 3ZMDA 3W6KB 5E1XA 3MEXA 2QLZA 3WU0A 1ZAOA 2HQNA 2GXBA 1EH6A 2JPCA 2V1UA 1O7FA 1QO0D 4JQFA 3GF2A 1XGNA 2L54A 1RUOA 1CF7B 3L09A 4QLCU 2MC3A 2CQKA 4B8XA 1J75A 1G4DA 3TDZC 2RNJA 1HW5A 2CSOA 2DW4A 3KE2A 3NEUA 2P6SA 5LRRA 2NRAC 3QRFF 3P9KA 5LLQA 4XRFA 4M72A 2IPQX 1YIOA 1W4MA 3R4KA 5TJJA 3T0YA 2OD5A 3L00A 1BI2A 2KIUA 1T2KA 4L9NA 3QP5A 1REPC 3K69A 3HOTA 2V6CA 4KYWA 1PDNC 3KEOA 2IP2A 2NNYA 1CGPA 4EV0A 2F5EA 3JAMZ 5LHGA 1LEAA 2PBIA 3F6VA 4M74A 2QBYB 4G6QA 3WTVC 4ENKA 3CO7C 1XDUA 2J5PA 2GIVA 2HWVA 3COAC 2PMUA 2GXGA 2XRNA 4ASNA 2IW5A 1FY7A 1VTNC 5D5XB 2ZNYA 4JK1X 2K27A 3BPVA 1PP8F 3KP3A 5L3BA 3FMRA 1T38A 4WXCA 3TKYA 4M73A 3P9CA 1BJAA 4IVNA 4BNCA 5AIQA 1DUXC 1MGTA 3GFIA 4OU0A 2KJBA 2ZMEA 3I54A 4CICA 4HZFA 5LGNA 1HKTA 4LK1F 4IF4A 1IRGA 1JE8A 4RB1A 2C6YA 4BQAA 2VOOA 2DK5A 4LLGF 4EM2A 2F5CA 2LDUA 2NYXA 4ETSA 3K1PA 4G7HF 1SD7A 1YW8A 2O0YA 3B02A 3KZYA 3K1NA 1D8KA 3WG9A 1DPRA 4OIQF 1BC8C 5CVUA 1L3LA 3EUHA 1T6SA 3M7GA 3CJNA 1XSDA 4LLLA 3CUQC 1R1VA 2VE8A 3E97A 3BPXA 1MZBA 1LB2A 4Q47A 2J5OA 4L5JA 4HX4A 3BJOA 1R22A 3FWEA 5JHUA 1EH7A 4NHJA 2ZFWA 3IRQA 1WWXA 4AWXB 4FX4A 4IRGA 1WI9A 1P92A 2DQRA 2M45A 1LQ1A 2WTEA 3MZYA 3U1DA 3WE2A 3DF8A 2QWWA 1BOAA 4HLXA 3IRRA 4I7HA 2V9VA 2G9WA 2CW0F 2OQRA 3FHZA 2A69F 4XLNF 3I0TA 2YU3A 2FBIA 5HS9A 3I59B 2BYVE 4FX0A 5FLXK 1ZH5A 4PDKA 1P4WA 4MHGA 2FEZA 5IT9Z 5HDKA 3GEZA 4A0YA 1DP7P 1HBXG 4CDGA 2Y0MA 3MWMA 4U88A 3WGIA 2GA2A 3HHHA 2XVCA 2FXAA 2A5YB 1SAXA 1LDJA 1IN7A 5H6QA 5DUKA 5AONA 3ZN1A 3DKWA 1U8RA 3MZHA 5LHIA 2RDPA 5K5OA 3WE3A 2HEOA 1FT9A 1R58A 4HQEA 2OU2A 1KU2A 2YX7A 4KIBA 4A6EA 4RGUA 2AS5F 1V4RA 2ZNZA 4A6DA 2VBYA 1UB9A 3T8RA 3I5UA 3IL2A 5D8KB 1FNNA 2E7WA 3HRMA 3KP6A 3F8CA 2K7LA 2D45A 3JAMK 4KA4A 5TRDA 3KLOA 4M9ZA 5LRSA 5L3FA 3H3UA 3RI4A 1AOYA 5CLSA 4LG0B 1DPUA 2Z99A 4HV6A 4KN4X 4I2OA 4DNCA 1R7JA 3AAFA 1UHWA 2OQGA 2QQAA 3EYIA 4WXHA 1U6GA 3CUQB 4GYGA 4UV9A 2ZCWA 3T1BA 3TQNA 1HSJA 1NHAA 4IHSA 3DPTA 2P5KA 1KU7A 4RS8A 4P55A 3V8JA 2M87A 4OMZA 3J81Z 1FSEA 3RPQA 1AWCA 2Q2EA 4AIHA 3OV8A 3MQ0A 1XB4A 5D4SA 3HTSB 5D5WB 1U78A 2KKOA 1RNLA 2ISYA 3M1EA 2NS0A 3G3ZA 1TQPA 4RAYA 3ZMUA 4CXFA 3B73A 5J8FA 1BM9A 1W5TA 3HRTA 1O3QA 2JTVA 4O5VA 2TDXA 5FFXA 4HDVA 3FX3A 2FBHA 5HOOA 4RGXA 1J9IA 3HYIA 3P7NA 2XAHA 1P2FA 4AD9A 2A68F 1HXDA 1S29A 3ROUA 3H3ZA 2XGXA 2ISZA 4RGRA 3F23A 3DQVC 4YFXF 1I6XA 1D5VA 3J80Z 1JGSA 4IPAA 5HDNA 5E1ZB 4HOBA 4N9HA 1U5TC 3VEPA 5HVQC 3R0JA 1G3SA 2BE5F 1KGSA 5JVTA 2Q8KA 4LB6B 4CYDA 4A12A 1IRFA 5ILSA 3LWFA 4AVPA 1D3YA 5CVVA 3GO5A 2PN6A 1U2WA 1G3TA 4TV7A 3HHGA 4GO1A 3GYHX 2UXNA 1SD4A 3ELKA 3E6CC 2HOEA 3IWZA 2K02A 3D0SA 3SXYA 2P6TA 1YO5C 2P5LC 5IT9K 1ZGJA 4L9TA 4UXNA 4L0YB 4GXOA 3C18A 4PCQA 3BROA 3LA2A 3CUOA
chains in the Genus database with same CATH superfamily
3BCBA 2X51A 1K4TA 1BI1A 2LRDA 1KONA 4I76A 5EEHA 4M3DA 3MKLA 1BIBA 5F1JA 4PJJA 3MKYB 4RB0A 2M30A 1IZ1A 5E8GA 3G2BA 1JT0A 2KDZA 2P8TA 5D4RA 3ABTA 2EFOA 4JP0A 1O4XA 1YYVA 4IX7A 1TZLA 3H0GJ 1GHCA 2R0QC 4XRSG 2IXSA 3CP2A 3K4CA 3ZMZA 5FFZA 3ABMH 3Q9SA 4EATA 2DA4A 3WU1B 1VQKI 1MDMA 1Y0NA 2UXXA 2UZKA 2L01A 2LY2A 2ADUA 2EZKA 4NDLA 1S6LA 1TQMA 2WAQA 2EA2A 1FYMA 1MJ9A 3CDHA 1IN8A 4C3IJ 2AQFA 3TO6A 5ILVA 2V1DA 2M7AA 1MH4A 4X1EA 6PAXA 5DD8A 2DPDA 3OYKA 4IKFA 3TDUC 1BL0A 2D1VA 4XLPF 2F2EA 3S16J 3SEQA 1R71A 5FO5A 2HDWA 2K9LA 2RC4A 1Y0UA 4XRMA 4J00A 3P5JA 3OIQA 4RA2A 2LSOA 5JI6A 1YJNI 3BTCA 2A61A 1W0TA 5ED4A 2ZSIB 3OR2C 1A6IA 5CJ9A 4GFBA 1ZG3A 1K7AA 2MLGA 1WJCA 3BDDA 3FK7A 3WODF 1JJ6C 2K3PA 3R61A 4UVAA 4GGGA 1F5TA 5EF6A 2H94A 1X1BA 2EV0A 3WTWC 2W85A 3FBIB 2EFWA 4EM0B 1N25A 4C3JJ 5LEKA 5HNFA 1ON2A 2Z1DA 4JOMA 2R7VA 3GBGA 4AYBA 2O03A 1MMSA 9ANTA 3U21A 4RAZA 4E7IA 3OYIA 2WWYA 2PJPA 2P81A 3FK6A 4W97A 4BXUA 3M8FA 2HYGD 2IS4A 1GV5A 4S05A 5F64A 1P7JA 1MBGA 2ESNA 1F1ZA 2VJ4A 1YS6A 2R7QA 3ONQA 4L18B 1R1TA 1JJ8C 2VQCA 4BYYA 2JA5J 3HEFA 3BT9A 1G3YA 1FBQA 2OTLI 4S0HB 2CV2A 2QENA 3HKZA 2R7SA 2EQRA 4BBSJ 3QOPA 1AA7A 2YUSA 5E3MA 1H8AC 1YE9A 2BY1A 2DYSH 2JUCA 2KHMA 2DTRA 1TNTA 4ZTFA 3A01A 4IXAA 4OAZA 3LQRA 3BG3A 1BR1A 1IV6A 5LEJA 4ABZA 1RUNA 1W7PA 5FLMJ 2LH9A 1YFHA 4N4NB 1NK2P 4V2GA 2HQRA 5J8CA 2V6EA 3D5RC 4IHTA 3S14J 4RB3C 2A5WA 1STZA 1OR7A 2M8EA 1SEUA 3L2QA 1HLVA 3ZQLA 1KQ9A 2DYRH 4QTRA 3EDPA 3FKIJ 4BBRJ 5DDGA 3C2BA 3DEUA 4UUSA 3OS2A 1ETXA 4UHTA 2IRFG 4A3LJ 2MABA 2FA5A 5IYBJ 4C2MJ 2IGNA 3OYLA 3TW7A 1KU3A 1YITI 1U5TB 3MN2A 2LFBA 3UNGC 1QPIA 4HLYA 4WCGA 2IBDA 2JSCA 1FMVA 2W7NA 3FXKA 4U0YA 3CCUI 1X2MA 4PGGA 1P9QC 2O6GE 2DOFA 3Q9VA 4DYQA 1QNTA 1IG7A 2O9LA 4PZJA 5L3GA 3N05A 3ZQHA 4V19K 2JSPA 2MG4A 2RN7A 4IQJA 4KJZA 1T39A 1KU9A 3I56I 2PQ8A 2STTA 5J1YA 3BZ6A 2ZXJA 2XPUA 4LIUA 4CA0A 4C2UA 3MVPA 2XAFA 4A0ZA 1LDKB 3W6VA 4ESBA 3F9KA 2MYSA 1B59A 1P4AA 5BPIA 4EM1A 3MAJA 4EGYA 3Q0WA 1H9GA 1FOKA 3OS0A 3BQYA 4K2EA 3SEZA 4MEXF 1JKQC 4ENNA 2OBPA 1I27A 3DU5A 3JRBA 3F8FA 1SC7A 5C44J 1JHFA 3QYFA 3EPZA 5DYMA 3BG9A 2JRTA 2ZXHA 1W5CC 4UV8A 1B72A 5D8LB 3IV5A 1XX5A 1GVDA 2FMLA 1ZQ3P 4UUTA 4O6JA 3PJRA 3J7AO 1TLHB 2B0LA 2L0KA 2YX4A 1XG1A 4X0GA 1ZRDA 5BQTA 3QOEA 2H1LA 4HF1A 1LEBA 2BHZA 4Y17A 2OAZA 3LAPA 3K1MA 3E5XA 2JVHA 3WGHA 2NXNB 2XGEA 5JFRA 4KFCA 2E60A 3D5LA 5B1AH 3L2CA 2NVQJ 4I99C 2DU9A 4ZZDA 4BE0A 1A36A 2PI0A 2EH3A 2OPTA 2R5ZA 4UVCA 4CGZA 2EFNA 2PX9A 1A5JA 1UCRA 3CQZJ 3LSHA 4RDUA 3K2ZA 3GX4X 3CD6I 3ULQB 2DOAA 1R4NB 4LGWA 4J01A 3CESA 2WAQN 3RZDJ 5EGOA 5KAIC 3S8PA 1BI0A 4M9XA 3U2RA 4CCMA 1GVJA 1WGXA 4HAMA 2QCOA 3JCUC 4LB5A 1PVEA 2DJNA 1WZ2A 4IHVA 4Y4RA 3IC7A 5B1BH 2CGPA 1BOBA 4U7BA 2XIGA 3DCFA 4ZDLA 4ENJA 3S3MA 2P5VA 5JVGF 4BE2A 2DXIA 2ECBA 4JX4A 1MSFC 3H1CA 3FMSA 1H88C 3S1MJ 4B09A 1GT0C 2A6EF 2X4HA 2FOWA 2KQRA 1WJEA 3W3CA 2LF7A 4HF2A 2M0CA 2IGKA 4OMYA 1BC7C 5L3CA 3BZCA 4H0EA 1T56A 3EETA 5LD2C 2KIQA 1XSXA 1Q1HA 3ZMVA 2LREA 1ZREA 4M9SA 3LSPA 2X6WA 5K5QA 2HKOA 1HKSA 2Y48A 2AHQA 1OYIA 5C4XJ 2ZMEC 5HODA 1R4MB 4II3A 3BTJA 1B1BA 2JQ7A 1MNEA 2GBYA 1KYZA 3HSRA 4AYBN 4HYEA 4HDUA 1Z67A 4BE1A 1T98A 2HTSA 5CVJA 5A2QZ 2LKPA 3IUOA 4IRIA 1LKXA 2HOTA 2LD5A 2AXTC 2DMTA 3FF5A 1KQ0A 4QWQA 2LR8A 1Z21A 3L2WA 3KETA 1LE8B 1AKHA 3E1SA 1R36A 4MTDA 2Y30A 3JRAA 2ZSHB 3M4OJ 1ZGAA 4IHWA 3GFLA 3HKZN 5DUIA 2EZLA 2ZXWH 4IZZA 3GFMA 4JBAA 5JLWA 4L9JA 4HX8A 3C3WA 3LL7A 4NC8A 4KICA 4IHXA 3GXOA 1JKPC 2E7XA 5CYVA 3SDGA 2RV8A 3HZJA 3ZXSA 2W57A 1ETWA 1VQ7I 1LNWA 4MEYF 1JUPA 5FKKA 5J47A 1P7IA 5JHFA 3Q5FA 2Z3YA 3V7SA 2HYFA 3EUHC 1RI7A 3RPUA 1QA6A 2Z9OA 5J1RA 3V8KA 2QUFA 1RZ4A 4NQWB 5KK1A 4I6ZA 4XOTA 3SJMA 4RGSA 4OIOF 1BIAA 4HPQA 4U0VA 2XKPA 4CUGA 3IH3A 3ML6A 3ZQ7A 1UJ8A 1TWGJ 5HDGA 3SDBA 5FRMA 1S7AA 2NVYJ 3LFUA 4HX7A 4P9FA 5LHHA 3J7YJ 3MKZA 1SVLA 3D1NI 2D2WA 4NNJA 1J0RA 3QPTA 1BBYA 3HPHA 2VBWA 2FE3A 5DV5A 5GTIC 3GLXA 1P4XA 1WFXA 3KLNA 5IYCJ 5TISC 2HQ5A 4ZDOA 2E1CA 4N0BA 4M3EA 4L9VA 1WKMA 2L4AA 1FOYA 2R3SA 1EKEA 4XKCA 3H92A 1V5GA 1BW5A 4IL6C 3H9QA 1VQ8I 2MBFA 2E2IJ 1B6AA 3A01B 5D6FA 4G12A 3AG4H 2OF7A 4E7JA 3SHFA 4PGHA 2OJED 2WADA 1XGMA 2F6CA 2GZWA 3QYEA 2XDVA 4FQGA 3S93A 3VYUB 3CJQB 1H9TA 1HSTA 2GWRA 4PJ0C 1FYKA 4RAGA 1W7PD 2R7OA 1QQIA 3BY6A 1XPXA 1IUFA 2BW3B 3WHBA 3N4MA 2M4KA 2EV5A 2PLYA 4ENMA 1FPQA 3GLLA 5F0FA 1BN5A 1XN7A 3MZ8A 4FASD 4MO7A 1WSUA 4ESJA 3WTYC 1LFPA 4ITVA 1IXRC 3DEWA 5F1RA 3GWZA 2NS7A 3FIWA 1RR7A 2HYJA 2KRFA 2ICWG 3QP6A 1SD5A 2OZUA 4G7ZF 1QPMA 1R1UA 1K78A 3LMMA 4OWRB 5C4JJ 2DA5A 3CCLI 1T8IA 1D8JA 1SFOJ 5CKTA 1XD7A 2HGCA 1HCRA 2HDCA 5E3NA 2IT0A 2OCCH 4M3BA 4LOCA 2VT3A 2H8RA 2L9NA 3TO7A 3BTLA 3E6DA 1BR4A 4LG3A 1I50J 2CU7A 3E3VA 3JRIA 1CF7A 1FIAA 1MJAA 2K40A 3PFIA 2BY0A 1X58A 1YS7A 2DK8A 2EIJH 3H0DA 1N77A 2TCTA 1Z6TA 2WC2A 4FHTA 4XLHA 3OYMA 3G1MA 2HPMA 3RKYA 1FYLA 3BG5A 1ONVA 2M7BA 3OSGA 1YTYA 3V4GA 4U87A 2DDAA 5B5EC 2LC2A 3OYCA 2FNPA 4Y3OA 3F6OA 2VC1A 4D7MA 4XICA 1RIOH 2ZBKA 3MKWB 5J4YA 2HU9A 2MH2A 1E3OC 2G7UA 3I9V2 1YRNB 2E2HJ 4BU2A 2YSRA 4YFKF 4I09A 3AG3H 4GRIA 4XN3A 5FD5A 2XAQA 3HTUA 2FUG2 5D6EA 3TW6A 2COMA 2ZMEB 2W84A 4IJAA 2CV0A 2M34A 3K6GA 4CCKA 1WCMJ 5GAGJ 3CCSI 3HDDA 2V79A 1HKQA 2ESHA 4A5MA 2O61A 2DQLA 2DA7A 3GVAA 1T0FA 2KP6A 3F3XA 3IAS2 3R6SA 3S1RJ 1OCZH 2XASA 2GA1A 3REOA 2CMPA 3CMAI 4E7KA 1B9NA 2LG4A 2JA6J 2JK3A 2LKXA 1EH8A 2FRHA 4MQ9F 4ZZLA 3F22A 4ON0A 3LQQA 3WTUC 2QBYA 2EV6A 2HVSA 1S7OA 3H5RA 3Q0UA 4HG2A 2DMPA 1TBXA 2OA4A 3JTHA 4XSXF 4PFOA 5TGTA 2CUJA 4M6YA 2GAUA 4MTEA 3OOUA 4DJAA 2DAOA 3PM1A 2LTPA 4OIRF 4DQ2A 1A04A 1NG7A 1MMGA 2RAEA 4WF2A 5L3DA 1O3RA 4AIKA 4UB8C 2IA1A 1ZHFA 4JX5A 4XK4A 1XS9A 4HF0A 1OQYA 1M1EB 4ZJZA 3JTGA 4M6VA 1IJWC 3GW2A 4ZYEA 3L1PA 2RGVA 5FD6A 4WWCA 3JW4A 3C7JA 3OSFA 1JKRC 4Z2YA 4PJLA 4XLCA 3RQIA 1AHDP 1FTTA 3FBNB 2QA4I 5DCMA 5F27A 2GOXB 3HXLA 1HQCA 2W24A 3FMQA 2NVTJ 1T08B 3EYYA 1ERDA 4MQVA 2X0LA 5A2QK 2DA1A 4CO8A 1ITYA 4EJOA 2M5WA 1USTA 3SFIA 1ZN2A 2CUZA 1VQMI 4JYKA 2WAFA 5AIPA 3RTRA 1J2XA 3KP5A 2FQ3A 1QZEA 2K9NA 3H5AA 4D9JA 4X6AJ 3E6BA 3K70C 1WH5A 3CDIA 2ZFUA 2JUGA 2KRHA 4PUSA 3IH4A 3UR3C 1ZK8A 4IHYA 2A3SA 3P9IA 1MKMA 4D7NA 2H6CA 4GYIA 4C3HJ 3MCZA 2JWTA 4ZH4F 3KIOA 4M3GA 1K4SA 1KZHA 3W2WA 4Y13A 2MLKA 2A07F 2VKEA 2EFQA 3WG7H 3KEYA 2G0EA 3V7CA 4B44A 3LFKA 1XCBA 1FMWA 2A6TA 2P0WA 2X6XA 1R5HA 1Z9CA 1RKWA 3HUGA 1U0JA 4M6XA 3E6MA 4YIFA 3OYDA 1D0XA 5IT3A 3CCQI 2PJRA 2R7FA 1DU6A 1SMYF 1BR2A 3BJAA 2FBKA 2CO5A 3VFZA 4KN7X 1X1AA 2K3FA 5EDNA 3AG2H 2VB6A 2HPIA 1UELB 2FSWA 3RKWA 3RPUD 3G1LA 1Y39A 1Z0XA 2BXYA 4BHPA 4CHUA 3I53A 3U1KA 2AQEA 2DOEA 1WH7A 5JLXA 1WHUA 3O6BB 1ETYA 1B9MA 4BJ5C 1ZRCA 1S3JA 3CTAA 4NC7A 2WB1A 4WK8F 1K61A 3CDLA 3I4NJ 1TNSA 3FDYA 1QZYA 4LFUA 4HA8A 2H6BA 2QM3A 2VJ5A 5L3EA 1XGOA 3DPLC 1G3WA 1YG2A 2XROA 2X1CA 5ERIA 3ZGKA 2BBYA 1USSA 2GXAA 1F4KA 1V5FA 1MBFA 5KHDA 1ODDA 1ZARA 1UFMA 3AL0C 1S9HA 3ZQIA 2D5VA 2VIXA 1WI3A 3M9AA 4I01A 3I64A 4BHCA 5E1WA 4B4CA 2K4JA 3DPUA 2L3DA 3SZTA 4GCVA 4HV5A 1TTYA 3C2HA 1W36D 3RZOJ 4A3EJ 5KCMA 5KNLA 3I59A 1K6OA 5HNHA 3PNTA 2LLKA 2DT6A 3ECOA 2QSHX 1N78A 5JR3A 3FZVA 2M1BA 2FD5A 2X1EA 2M9HA 5IPAA 3S2HJ 5K1YA 1FX7A 2KMUA 3I71A 1FJLA 2P7VB 1Z3YA 3BJ6A 1B8IB 3HRSA 2QQ9A 3WTZA 1O57A 3HB9A 3BG7A 1Y8RB 3O3KA 5DTDA 1DU0A 2I5UA 4F7ZA 2CRGA 1K78B 2PEXA 2VC0A 3M1CA 4Q4ZF 5GP9A 3DP7A 3TP0A 3A03A 2DPUA 2R4GA 2H27A 2EFPA 3R60A 2EBIA 2ZJPF 4OINF 1SMTA 3PSFA 2L9SA 4XL9A 3ISPA 3CCJI 2LYCA 2X6OA 3T5XA 4EJWA 3UKGA 1ZG1A 1D1BA 4LJZF 3HGGA 3QU6A 3DFGA 3V7RA 3S1NJ 1IV8A 2P7CB 3O8HA 1QRYA 2F5DA 2E1MC 2R93J 4BDZA 5B66C 3PL8A 4RM2A 3TOBA 2O5RA 2LK2A 3KP7A 1LVAA 1SD6A 3KP4A 3OYJA 1QBJA 2V7FA 3A1YA 1MMAA 3M3YJ 1YIJI 4DYCA 3G73A 2M0MA 4MLOA 1WQ2A 2EZHA 3LA7A 3TO9A 3J81K 2V1XA 4DOZA 2KIFA 5ICEA 3KCCA 1KYWA 3FXUA 2VXZA 1PUEE 5FB2A 1OLTA 3QU3A 4ESFA 3OOPA 4CYCA 3QAHA 1OPCA 4YIRX 4EJUA 2Q2EB 3HG9A 3G4SI 2MH9A 2XPWA 3IP4B 4Q5SF 2QZ8A 2HZTA 3HOYJ 1R6RA 4FISA 4FT8A 2D1HA 2DCEA 3CMEI 1XDSA 3HM5A 1EV7A 1ZLKA 1DGWY 5GPCA 4YIIA 2EINH 5E20A 4KT6A 4QPQA 3HRUA 5ICCA 5FKOA 5BMZA 2K4BA 2GM4A 1QGPA 5FJ8J 3KP2A 3RJPA 3KFWX 1YOVB 4BXFA 1ZRFA 1LPQA 1I6HJ 3VB2A 4MGRA 3GFJA 1VFCA 1RKTA 1E17A 2HXIA 5J6XA 3BG6A 2NNNA 1Z6RA 4D0PA 5EG0B 1Y6IA 4CZZA 1FOXA 4XBFA 1VQOI 4ZYGA 1FIPA 4LG0A 3CC2I 1KA8A 1SANA 1GXPA 1SVMA 4ZC3A 1V54H 3LSRA 2IA0A 3BQZA 1RESA 2L02A 2EJRA 1S7EA 5LGTA 1GLNA 1NTCA 3EUKL 4ZTJA 2BV6A 4P96A 2DA6A 1FWZA 1TT0A 5BOXA 1OR7C 3J80K 1IO2A 2XUBA 5LBQA 3ZPLA 2VODA 3CUQA 2VBZA 4OIPF 4UY8I 4XKVA 3LSTA 5BS6A 3RDIA 1FP1D 4B3AA 3GTOJ 4DBRA 1RPWA 3IWFA 4B47A 5HLHA 4B3XA 3L7WA 5ICGA 2LNBA 4WXDA 3VOEA 2KJCA 1LFUP 4I0AA 3K4KA 3TOAA 5DCMB 3SQNA 1JHHA 2CYYA 2LBFB 3W6JB 2M4GA 3IKVA 1PP7U 1D5YA 2O3FA 1TQIA 2DODA 3BP8A 4Y52J 2E2JJ 1HW1A 1Z7LA 2EB7A 2OCEA 1FP2A 1XMAA 2JN6A 2IS6A 3ZCOA 2R5YA 2NOGA 3ZQGA 1WJDA 2XAUA 3JSPA 2ZJ2A 3LAJA 2CFOA 2WB1N 1UHMA 4LD5A 4D5CA 1ZG5A 5EZGA 1G59A 2OC6A 1T95A 2Z5UA 3M8JA 2CWEA 1Y8QB 5HS7A 2CQ7A 2GQQA 1D1CA 1VNDA 2KT0A 1SFUA 2X6YA 2LKSA 2VUMJ 3BOQA 2R7TA 1X1CA 2VXDA 1E3HA 4LIVA 1F9NA 4M71A 4A3CJ 3HIFA 1OCOH 1MMNA 3L2VA 1N75A 3AL0B 3FXRA 2JVGA 3FISA 1YQAA 4BQQA 3MMYB 3QPHA 2YPRA 2ZJQF 2BGCA 5M3FJ 1W1WE 4HBLA 1R49A 1ETVA 3DLAA 1DGRM 2CJJA 3TL4X 3F72A 2VJIA 3TP3A 3K4NA 3RIRA 3LOCA 4G94A 3NWTA 1I1GA 1ETKA 3OL4A 4NB5A 4G9YA 2EA4A 4KT5C 1FZPB 3JRCA 1YW7A 3IH2A 5C3EJ 2ID6A 2DBBA 3GZ5A 3WHCA 2IGMA 2M3AA 4NBQA 1FBSA 3O2PE 3OY9A 3KYLA 1JGGA 1IUYA 3V42A 3EUAA 2K9SA 4KITB 4G6DA 2O8KA 5FKMA 2F5FA 3GCMA 2OV7A 5DEQA 1DP3A 2QEXI 4ZYAA 1K79A 2HQAA 2YR2A 5CVIA 4Q48A 5HS8A 1R5GA 4XIDA 1BI3A 3KX2A 4G8XA 3RCOA 3BR2A 2E1NA 1P6RA 2VN2A 4C30A 3MFKA 1O7LA 3HSFA 1K83J 4WX9A 1B4AA 2AXLA 1OMIA 2EWNA 3WTTC 1MDMB 1E2XA 2ACJA 2RQPA 4E4HA 3G1OA 1VI0A 1G2HA 2P4WA 3HOUJ 1OYWA 4A5NA 2WAEA 2MA3A 2KL4A 1XSVA 2CFXA 5HLGA 5EZHA 3EQLF 4H4KC 2E1MB 2H1KA 2XV4S 3FM3A 1EJ9A 2ID3A 3CO6C 2QKLB 1LJ9A 4P9UA 2NOJB 1V5EA 4PJMA 2DMNA 3B6CA 4KNYA 2VBXA 1ULYA 3K9TA 3FXOA 1IN5A 1T33A 3PSIA 3ABUA 2KPMA 3H35A 2UV1A 1FTZA 1ZR4A 2XHKA 5E3OA 2X9DA 1APLC 2KIMA 1ETOA 4HQMA 1TWFJ 3CJRB 1X3UA 2DTZA 3SZPA 5K5RA 2K5CA 4S04A 3PNVA 4F93B 3ESWB 1IF1A 1O3TA 3DXJF 3OYEA 3WTSC 5FGMA 3K7AJ 2R7UA 2EZIA 4LMYA 2VKHA 3OMYA 4P1WA 4O3MA 3HOZJ 1Z7UA 3ZN0A 1ON1A 2DFEA 1WJAA 3M8EA 4A2UA 3T8TA 5EEAA 3G6EI 1HF0A 5F6FA 4HW0A 3WGGA 1YLFA 1D0ZA 2R7XA 1MD0A 2VE9A 1Q1VA 3DTKA 3G71I 1XGSA 2CG4A 4BY7J 1MSEC 2L7MP 3PUBA 4DW6A 3NQOA 1OJLA 1A31A 3RKXA 4HNVA 1IXCA 2IVMA 2XB5A 3JR9A 1FLIA 2HS5A 5E18F 2HXOA 4Y33A 3OIOA 1W7PB 4BH9A 4BQOA 1I1SA 2RKHA 2JT1A 4W1UA 2FNAA 4QSHA 3E5QA 1L0OC 1XCVA 5DCFA 3W2VA 3JREA 1UAAA 3JRGA 2VQLA 3HBLA 2DO7A 3JSOA 2DJIA 3OR1C 1SFXA 1LDDA 1U9OA 4XOPA 2BY2A 1WPKA 4UUSB 4BAYA 1S72I 4LITA 3TGNA 2Y9YA 2KZGA 3PQJA 4PJNA 3BR6A 4IRHA 1JI8A 3B6AA 3K4JA 4YG2F 4RLFA 4KMUX 5CQGA 2W1OA 4UB6C 5K7HA 2Q0OA 2QGUA 1S5LC 1IW7F 4EJTA 4AVZA 2MD0A 5BNGA 5ILUA 2X1DA 3GTPJ 1Z3XA 1BW6A 1SFEA 1VQ9I 3BWGA 3IAM2 2VKVA 2XF6A 5D5UB 4FCYA 1MBHA 4I0BA 2K86A 3Q0VA 3K0LA 3X2QH 1Z1DA 2NAZA 3BCAA 2RVCA 4OAYA 5J40A 1X19A 3IKTA 3K2AA 4A3KJ 2QF7A 3J7AY 3F8MA 1R23A 3WTXC 2WBMA 4EJVA 2DT7B 4UVBA 2DDBA 4BY1J 1ACIA 3S2WA 2CH0A 1IXSB 3L2RA 5EEGA 3AKZA 5F04A 4CSWA 1W36C 2WA0A 2MW8A 3NRVA 4MNUA 5E8IA 4XLFA 3TBIA 3GZNB 5HLIA 3CC7I 3DV8A 3QPLA 5H20A 2B63J 1TW2A 2VONA 2A6HF 5ICFA 3VYTB 4XQFA 3CLOA 3N97A 1TW3A 4KUMA 3HOWJ 3NAUA 1B72B 2JZYA 3GUDA 3F21A 2IJLA 2K9QA 2HR3A 1YJ9I 2O8XA 2WV0A 3LSIA 3H9JA 3HJEA 2L9RA 4PSXA 4YEJA 4OOIA 2HI3A 4QIWN 1FC3A 2PG4A 1IN4A 1U5TA 1JUMA 3HL2A 1SAUA 2N8GA 3DLLF 2CUEA 3IHUA 2X48A 5J3LA 2XPVA 1WJFA 4LLNA 2BEOA 2DFIA 2R5ZB 4MFEA 5B3SH 3PQKA 3S3OA 2HFHA 3V8LA 1LUJB 3I4PA 1SVOA 2F48A 2ETHA 1D1AA 2DMUA 5EGOB 1YW9A 4EMSA 2FQ4A 1MNMC 1QHGA 2IS2A 3C1DA 2VOPA 3H5NA 1JXSA 1G6NA 2V4JC 4R79A 1Y1WJ 4FE7A 4RM3A 2E5ZA 3QODA 3WU2C 4BHBA 3HGYA 5GTHC 3F8BA 3MD2A 3HOSA 4L5IA 4XLEA 1IAWA 2IGOA 1H0MA 2H8WA 3U9GA 3CF5F 1S8NA 3ERED 2XSJC 4E70A 1NK3P 3GZ6A 2FU4A 2HKXA 3BLYA 2Z33A 5FKLA 1FBUA 2XAGA 1Z05A 3ZQFA 3PIOF 4UUVA 3KZZA 1O3SA 2STWA 2IS1A 4EQQA 2ELHA 4I02A 3I55I 2G7HA 3ERMA 5M5XJ 3OYAA 4G7OF 2E36A 4FE4A 4E7SA 1V3FA 5BPDA 1ZYRF 2HOAA 3RYPA 1JTYA 3K4BA 4R1HA 1MBEA 2L9VA 3E5UA 4RMNA 3CC4I 4XONA 4II2A 4FETA 3LA3A 1MBKA 4KIGA 2HVQA 4L0ZB 4P5OA 1I3QJ 3CP8A 4PK4A 1T0FC 5LGUA 3R0AA 3PO3J 2FF4A 1AKHB 2XF5A 4PFPA 4KIFA 4MIMA 4AC0A 1WRJA 1J7KA 2IA2A 3CMYA 1OYYA 3SFZA 4XSZF 3OWTA 2KLOA 4F55A 1MW7A 2QQBA 2QSGX 2KFDA 3K10A 4V2FA 1FSHA 2L7KA 5IP7J 3ECHA 2L4MA 4NUBA 5M5YJ 3HOXJ 3F8NA 2MGQA 1C0WA 3VYSB 2LP0A 2W82A 1Z91A 4BUPA 4A0XA 2VKDA 3GTLJ 2A05A 5M3MJ 2Q1ZB 2E19A 1OKRA 5H6RA 1R00A 1AU7A 1X3WB 1XMKA 2CQQA 3HOVJ 4EVIA 3L2UA 2VPLA 4R8HA 2VT2A 5D5VB 1X1PA 2BOLA 3RYRA 3DBHB 2Y0SA 1QZZA 3ZMSA 3KEQA 1W5SA 1G8XA 4HSRA 4U0WA 4Z6YA 3BZKA 3Q3SA 3ZR8X 3I58A 5E17F 1GXQA 2MSYA 4G6TB 3OYHA 5LFAA 2KRCA 1V55H 2HTJA 4BXXJ 4HNUA 3A0BC 5KVRA 1OCPA 5CVRA 4ZYDA 4KISA 3FXMA 2EIKH 2XKOA 2XRLA 4HNTA 2FJ1A 3OYFA 1I39A 3FXJA 1E0EA 1KQ8A 1MNDA 2ELJA 3RSNA 4KDPA 3HSEA 4E7ZA 4LK0F 2ZKZA 2ZO4A 4EGZA 5CPRB 1DDNA 2W00A 5IYDJ 1J59A 2QVOA 3ZP5A 2HDDA 1VQ6I 1QVTA 2OZ6A 4UNOA 3QPSA 2DFFA 4BKXA 2H09A 2EK5A 2Y75A 3VSLA 2JRMA 4CCOA 4N9IA 4YRVA 1I5ZA 1LE8A 4YFNF 2PFBA 2XGDA 2FMYA 1JTXA 3FM5A 5EYRA 2FOKA 2DI3A 2XAJA 1DQUA 4AIJA 4GDFA 3DWLE 4XKBA 5DD4A 2LF8A 2UWMA 2ECCA 2DLLA 1UZCA 3FXQA 1D0YA 3L9FA 2MD5A 2L7FP 3CCYA 4I98B 1IN6A 2JPBA 4CH7A 1MJBA 3ZMTA 1SFKA 1TT5B 5FKNA 4RB2C 5IOZA 1J5YA 4M3FA 1HW2A 2QYOA 4Y15A 2R7DA 4NC6A 2PMHA 3H3VK 1ZLJA 2DT5A 4RAFA 1U3EM 4XN0A 4KMFA 2W25A 3H36A 3VODA 4AM3A 1GV2A 5FLXZ 4ZYHA 2VJJA 4NQWA 2E34A 4U7DA 4L5EA 2EILH 3ZMDA 3W6KB 1CQTA 5E1XA 1ZAOA 2HQNA 2QLZA 3MEXA 2Y69H 3WU0A 2ME0A 1EH6A 2JPCA 2GXBA 2V1UA 1IGNA 3CCEI 3BR3A 4HRIA 1O7FA 1QO0D 4BEHA 2M8GX 1QHHD 4F92B 1K6YA 2QSFX 1RETA 4AUXA 4JQFA 3GF2A 1XGNA 4DZPA 2JJ7A 4F3QA 2L54A 1RUOA 4BACA 2L2OA 1TP4A 3QYBA 2E1OA 3LSGA 1RC9A 3L09A 1CF7B 4QLCU 2MC3A 2CQKA 4B8XA 1J75A 2YU9J 4IEJA 1E3PA 1G4DA 3TDZC 3I4MJ 2RNJA 1YJWI 1HW5A 2VQHA 1X4PA 2CSOA 2DW4A 3KE2A 3NEUA 1LVKA 2P6SA 4CCJA 2GIZA 3NWSA 2MC4A 5LRRA 2NRAC 3QRFF 2UUZA 2Y9ZA 1FEXA 3ASNH 1NG6A 3P9KA 5DM7F 1X1DA 5LLQA 4XRFA 4M72A 3CJTB 1YX3A 2IPQX 1YIOA 4DGWB 4A69C 1W4MA 5IOYA 3R4KA 5TJJA 2BW3A 1TC3C 3T0YA 2OD5A 3SZGA 3L00A 1BI2A 2KIUA 3VYRB 1T2KA 4L9NA 3QP5A 1REPC 1IDYA 1TWHJ 3K69A 4B1RA 3J7ZI 1MH3A 3HOTA 4RBOA 2V6CA 2EIMH 4KYWA 1PDNC 3KEOA 2IP2A 2NNYA 1CGPA 3LSKA 5GPAA 2L5QA 4EV0A 2VI6A 2F5EA 4CCLA 3JAMZ 5LHGA 1GDTA 3VPRA 2CV1A 1LEAA 2JA8J 2EPFA 2ZJRF 5K7FA 2PBIA 3F6VA 4M74A 2QBYB 4G6QA 3WTVC 3CMMA 4ENKA 2CUFA 1OCTC 3OYBA 3CO7C 1XDUA 4A3IJ 1LFBA 2J5PA 5J4VA 2DA3A 2GIVA 2HWVA 3COAC 5IY5H 2PMUA 2GXGA 4C2TA 2HVRA 3OYNA 3BR1A 2XRNA 3DTEA 4ASNA 2IW5A 1FY7A 5J1UA 1VTNC 2I8DA 5D5XB 2ZNYA 4JK1X 2JA7J 2K27A 5E79C 2F4OB 3K70D 2MFZA 3BPVA 1PP8F 3KP3A 5M5WJ 2DN0A 3PNYA 1VZ0A 5HLTA 1MBJA 5L3BA 3KYDB 3FMRA 2HOSA 1T38A 4BDYA 2IAIA 4WXCA 3TKYA 4ZDPA 2VLAA 2Y0SN 4M73A 3P9CA 1BJAA 2YS9A 1FOWA 4XM3A 1YRNA 2W4SA 4IVNA 4BNCA 5AIQA 1DUXC 4A3JJ 4BJTA 1ORKA 2V9KA 3ZOBA 1MGTA 3GFIA 4OU0A 4IOAF 1HDDC 1UG0A 2KJBA 2ZMEA 3I54A 5F0HA 1ZTRA 1RRJA 4CICA 3ABLH 4HZFA 4XORA 3E7LA 5LGNA 1HKTA 4LK1F 4IF4A 2BY3A 1IRGA 1PUFA 2VPRA 2ZXIA 5DM6F 1JE8A 1YX5A 1U8BA 3CCRI 4RB1A 2C6YA 1F36A 4BQAA 2VOOA 2AO9A 2DK5A 4LLGF 5CQEA 4EM2A 2F5CA 2VL8A 3KYCB 2LY9A 4XRSA 3K4LA 4D1QA 1ZGWA 2LDUA 2NYXA 1X2NA 4C9YA 1VQPI 2I10A 3DEEA 4ETSA 3K1PA 4G7HF 1SD7A 1YW8A 2O0YA 4MFDA 4F52A 1A35A 3O8GA 4BQNA 3B02A 2B7EA 1R9TJ 3KZYA 3K1NA 1IC8A 3HUGB 1D8KA 3WG9A 1DPRA 4OIQF 1BC8C 2PJRB 5CVUA 1L3LA 3EUHA 1T6SA 2F4MB 3CJNA 2HZDA 2XF7A 3M7GA 1XSDA 4LLLA 2HNHA 3BR5A 3CUQC 1R1VA 3OL3A 2VE8A 5FRNA 3E97A 3BPXA 1MZBA 2WV1A 3ZRGA 4CCNA 1LB2A 3JRFA 3CLQA 3DKYA 3S2DJ 4B48A 4Q47A 4AIDA 3HC7A 5FLVA 2J5OA 4L5JA 1H89C 2XB0X 2B9SA 4HX4A 4YELA 3BJOA 1R22A 3FWEA 3S1QJ 5JHUA 1EH7A 4NHJA 2ZFWA 2V1NA 3IRQA 1TWAJ 1WWXA 4AWXB 1YHQI 1IDZA 5GAEJ 1TWCJ 4FX4A 4IRGA 3H9GA 1WI9A 1P92A 4A3MJ 2DQRA 1I3AA 2M45A 1LQ1A 2WTEA 3MZYA 3U1DA 3WE2A 3C2GA 3GTGJ 1HA8A 3DF8A 2CW7A 2QWWA 2COBA 1BOAA 3HPGA 2XSDC 4HLXA 3IRRA 3DU6A 1BA5A 2W48A 4I7HA 2V9VA 1QU3A 1Y56A 2BXZA 2F4IA 3VSKA 2DA2A 2G9WA 3GMEA 2CW0F 2OQRA 3OYGA 3FHZA 2A69F 4XLNF 3A02A 4A93J 4E7LA 3PIPF 3I0TA 4E6KG 2XGCA 2YU3A 2FBIA 3A0HC 5HS9A 3I59B 2BYVE 4FX0A 5H2FC 5FLXK 1ZH5A 2K85A 4PDKA 3QQAA 4N4OB 3K4MA 1P4WA 4MHGA 2FEZA 3VDXA 5IT9Z 5HDKA 1XMXA 3CZ6A 3ABKH 5GAHJ 3GEZA 4A0YA 2E71A 1DP7P 2XC7A 1HBXG 3GTKJ 2KDOA 2PMZA 2X85A 2Y0MA 3MWMA 4CDGA 4U88A 3WGIA 2GA2A 3HHHA 1ZR2A 2XVCA 2FXAA 3BR0A 1NH3A 2CQNA 5F08A 2A5YB 1SAXA 1LDJA 1IN7A 4XR6A 5DUKA 5H6QA 4DBQA 2E35A 1XC5A 3SYTA 4BEHB 5AONA 3ZN1A 3DKWA 3E0JB 1U8RA 1UMQA 2Y2ZA 3MZHA 2CQXA 5FROA 4E7HA 5IP6A 2WY8Q 5LHIA 1EF4A 2RDPA 2ELKA 2LOOA 1VF9A 5K5OA 4BS9A 2GLOA 2Z2SB 3WE3A 2R7RA 4A3FJ 4IO9F 2HEOA 1F43A 2M2EA 1FT9A 2BZTA 3S15J 1Y1VJ 2R7WA 3PFYA 3M07A 1IRXA 2IEKA 4CZCA 1R58A 4HQEA 3A4CA 5F0CA 2OU2A 2KISA 3TEDA 1KU2A 2YX7A 2RQQA 4KIBA 1HOMA 4A6EA 3JRDA 4RGUA 2AS5F 4CYCB 1V4RA 2ZNZA 4A6DA 3LNQA 4A3BJ 2VBYA 5KAFC 1Z77A 1UB9A 3T8RA 3I5UA 3IL2A 2LY1A 2CW8A 3PO2J 5D8KB 1FNNA 2E7WA 1MMDA 3HRMA 3KP6A 4ANJA 3F8CA 1WJ5A 2K7LA 2ZC2A 1OFCX 1B8IA 2D45A 3JAMK 3OIPA 1JT6A 1HC8A 1WVRA 4KA4A 5TRDA 3KLOA 4M9ZA 3JRHA 1X4OA 5LRSA 5L3FA 3H3UA 3RI4A 1EA3A 2BVMA 1RR8C 3RKQA 1AOYA 2V26A 3CCVI 1VQLI 5CLSA 4F91B 4LG0B 2LVSA 1R5ID 4A3GJ 1GUUA 4PSWA 1DPUA 3QWLA 2DMQA 2ZB9A 2Z99A 4HV6A 4A3DJ 4KN4X 5K7ZA 4I2OA 3ASOH 2NS8A 4DNCA 3GTMJ 1A6QA 1R7JA 2JMWA 3F0CA 4JX6A 3KPHA 1PJRA 2RREA 3AAFA 1UHWA 4QPOA 4IQ4A 3PUFA 2OQGA 2QQAA 3EYIA 4WXHA 1U6GA 3CUQB 3S3NA 4GYGA 4UV9A 2ZCWA 3T1BA 3TQNA 1HSJA 1NHAA 4IHSA 4HEA2 3DPTA 2P5KA 3OS1A 1KU7A 4RS8A 4HSTA 3RQ4A 1J09A 3GTJJ 1X3ZB 5IP9J 2ME6A 4P55A 3V8JA 2R7ZJ 2M87A 3D5SC 1QVUA 4OMZA 4IOCF 1UG2A 2VASA 3J81Z 1FSEA 3RPQA 1AWCA 2Q2EA 4AIHA 3OV8A 5DS9A 2R5YB 3MQ0A 1XB4A 1BJZA 3BC8A 2R92J 5D4SA 1WJBA 5D5WB 1U78A 2KKOA 1RNLA 3HTSB 3I3LA 2ISYA 2DFHA 3KZIC 2NS0A 3M1EA 4D5FA 2VQGA 4BL0B 1PUFB 3G3ZA 1TQPA 1ZKGA 1JUSA 1POGA 2LMDA 4RAYA 4J19A 3TMOA 3ZMUA 2Z16A 3AFHA 1VQ4I 1VQ5I 3S17J 1UHSA 1ENHA 1MIJA 2KZVA 4CXFA 3B73A 4DIQA 2NVXJ 5EG0A 2TRTA 5J8FA 3ZQQA 1BM9A 1W5TA 3DTIA 3HRTA 1O3QA 3FXLA 2JTVA 2GOMA 2TDXA 4O5VA 5FFXA 2F5VA 2V9PA 5E3LA 4HDVA 3FX3A 2FBHA 5HOOA 4RGXA 4RLQA 1J9IA 5EJCA 4XLAA 3HYIA 3LSMA 2XAHA 1P2FA 2A68F 3P7NA 4AD9A 4B43A 1HXDA 1S29A 4EEFG 3ROUA 3H3ZA 2RNGA 2OUMA 2XGXA 1OCRH 2ISZA 4RGRA 3FKJA 3F23A 3DQVC 3FHNA 4YFXF 3S32A 2Y31A 1I6XA 1D5VA 2K9MA 3J80Z 1JGSA 1OCCH 1PYVA 1W0UA 1IRZA 3ZQCA 4IPAA 1U9NA 2PMZN 5HDNA 5E1ZB 1XTAA 2LBFA 2FX0A 4HOBA 4N9HA 1U5TC 1TL8A 3VEPA 3CCMI 3DBRB 4FTHA 5HVQC 3CF2A 4XMYA 4BJ6C 1YI2I 3R0JA 4Y7NJ 1G3SA 4DYRA 3DKXA 1ZELA 2BE5F 3NARA 2NVUB 1KGSA 5JVTA 2Q8KA 4LB6B 1VQNI 4CYDA 4A12A 4AU7A 5GADJ 1IRFA 2E5NA 5ILSA 2JA2A 3LWFA 4AVPA 1D3YA 5CVVA 3VWBA 3GO5A 2PN6A 1U2WA 1G3TA 1ETQA 3DBLB 4TV7A 2QKMB 3HHGA 4GO1A 3GYHX 3LSJA 2UXNA 3BTIA 1SD4A 3W2AA 1JKOC 3GTQJ 3ELKA 3E6CC 2O7OA 2BHYA 2BVLA 2HOEA 2K02A 3IWZA 3D0SA 3AG1H 3SXYA 4XNFA 2CS3A 2P6TA 2QQ8A 1YO5C 2P5LC 2OTJI 5IT9K 4XKWA 1ZGJA 2L7ZA 4L9TA 4UXNA 4BGDA 4L0YB 1OISA 4GXOA 3C18A 4PCQA 2WY7Q 3BROA 4DZJA 1HDPA 3A2KA 3LA2A 3CUOA
chains in the Genus database with same CATH topology
1BI1A 5EEHA 1BIBA 4RB0A 2M30A 1IZ1A 5E8GA 2P8TA 5D4RA 3ABTA 2EFOA 1YYVA 1GHCA 3ZMZA 5FFZA 3Q9SA 3WU1B 1MDMA 2UXXA 2UZKA 2L01A 2ADUA 1S6LA 1TQMA 2EA2A 1FYMA 1MJ9A 3CDHA 1IN8A 5ILVA 3TO6A 2V1DA 6PAXA 5DD8A 2DPDA 3TDUC 2D1VA 4XLPF 2F2EA 5FO5A 2RC4A 1Y0UA 2LSOA 5JI6A 2A61A 5ED4A 5CJ9A 1ZG3A 1K7AA 2MLGA 3BDDA 3WODF 3R61A 4UVAA 4GGGA 1F5TA 2H94A 2EV0A 3WTWC 2W85A 2EFWA 4EM0B 5LEKA 1ON2A 2O03A 4RAZA 2WWYA 2PJPA 4BXUA 3M8FA 2HYGD 4S05A 5F64A 2ESNA 1F1ZA 1YS6A 4L18B 1R1TA 4BYYA 1G3YA 1FBQA 2QENA 3QOPA 2DTRA 1TNTA 4IXAA 3LQRA 5LEJA 1RUNA 1W7PA 1YFHA 2HQRA 5J8CA 4IHTA 4RB3C 1STZA 1OR7A 2M8EA 1KQ9A 3EDPA 5DDGA 3DEUA 4UHTA 2IRFG 2FA5A 1KU3A 1U5TB 4HLYA 4WCGA 2JSCA 4U0YA 4PGGA 2O6GE 3Q9VA 1QNTA 4PZJA 5L3GA 2RN7A 1T39A 1KU9A 2PQ8A 2STTA 3BZ6A 2ZXJA 2XAFA 4A0ZA 1LDKB 4ESBA 1B59A 1P4AA 5BPIA 4EM1A 3MAJA 4EGYA 1H9GA 1FOKA 4K2EA 4MEXF 4ENNA 2OBPA 1I27A 3F8FA 1JHFA 5DYMA 2JRTA 4UV8A 5D8LB 2FMLA 4O6JA 3J7AO 1TLHB 2B0LA 2YX4A 1ZRDA 5BQTA 4HF1A 1LEBA 4Y17A 2OAZA 3LAPA 3K1MA 3E5XA 3WGHA 5JFRA 4KFCA 3D5LA 3L2CA 2DU9A 4ZZDA 2PI0A 4CGZA 4UVCA 2EFNA 1UCRA 3K2ZA 3GX4X 3ULQB 4LGWA 1BI0A 4M9XA 3U2RA 1GVJA 4HAMA 4LB5A 3IC7A 2CGPA 4U7BA 2XIGA 4ENJA 2P5VA 3FMSA 4B09A 2A6EF 2X4HA 2LF7A 4HF2A 4OMYA 1BC7C 5L3CA 4H0EA 3EETA 1XSXA 1Q1HA 3ZMVA 1ZREA 4M9SA 5K5QA 2HKOA 1HKSA 2Y48A 1OYIA 1B1BA 1KYZA 3HSRA 4HYEA 4HDUA 1T98A 2HTSA 5CVJA 5A2QZ 2LKPA 4IRIA 3FF5A 4QWQA 1KQ0A 3KETA 4MTDA 1R36A 1ZGAA 3GFLA 5DUIA 3GFMA 4JBAA 4L9JA 4HX8A 3C3WA 4KICA 3GXOA 2E7XA 5CYVA 2RV8A 2W57A 1LNWA 4MEYF 3Q5FA 2Z3YA 3V7SA 2HYFA 1RI7A 3RPUA 2Z9OA 3V8KA 2QUFA 1RZ4A 5KK1A 4RGSA 4OIOF 1BIAA 4U0VA 2XKPA 3ML6A 3ZQ7A 5HDGA 1S7AA 4HX7A 4P9FA 5LHHA 2D2WA 1J0RA 3QPTA 1BBYA 2VBWA 2FE3A 5DV5A 3GLXA 1P4XA 3KLNA 2E1CA 4N0BA 4L9VA 1WKMA 2L4AA 2R3SA 3H92A 2MBFA 1B6AA 5D6FA 3SHFA 4PGHA 1XGMA 2GZWA 1H9TA 1HSTA 2GWRA 1FYKA 1W7PD 3BY6A 1QQIA 3N4MA 2EV5A 2PLYA 4ENMA 1FPQA 1BN5A 1XN7A 1WSUA 4ESJA 3WTYC 1IXRC 5F1RA 3GWZA 2KRFA 3QP6A 4G7ZF 1SD5A 2OZUA 1QPMA 1R1UA 1K78A 1D8JA 1XD7A 2HGCA 2HDCA 2IT0A 2VT3A 3TO7A 3E6DA 3E3VA 1CF7A 1MJAA 3PFIA 2DK8A 1YS7A 1Z6TA 4FHTA 2WC2A 3RKYA 1FYLA 1ONVA 1YTYA 3V4GA 2FNPA 3F6OA 2VC1A 1RIOH 2ZBKA 2MH2A 2G7UA 2YSRA 4YFKF 4I09A 5FD5A 2XAQA 3HTUA 5D6EA 2COMA 2ZMEB 2W84A 4IJAA 2V79A 1HKQA 2ESHA 4A5MA 2O61A 2DQLA 3GVAA 1T0FA 3F3XA 3R6SA 2XASA 2GA1A 3REOA 1B9NA 1EH8A 2FRHA 4MQ9F 4ZZLA 3F22A 4ON0A 3LQQA 3WTUC 2QBYA 2EV6A 1S7OA 1TBXA 2OA4A 3JTHA 4XSXF 4MTEA 4M6YA 2GAUA 2DAOA 4OIRF 4DQ2A 1A04A 4WF2A 5L3DA 1O3RA 4AIKA 2IA1A 1ZHFA 4HF0A 3JTGA 3GW2A 4ZYEA 2RGVA 5FD6A 4WWCA 3JW4A 3C7JA 4Z2YA 5DCMA 1HQCA 2W24A 3FMQA 3EYYA 4MQVA 2X0LA 5A2QK 4CO8A 4EJOA 2M5WA 1USTA 1ZN2A 5AIPA 3RTRA 1J2XA 3KP5A 2FQ3A 3E6BA 2A3SA 3P9IA 1MKMA 2H6CA 4GYIA 3MCZA 4ZH4F 4Y13A 2MLKA 2A07F 2EFQA 3V7CA 3LFKA 1XCBA 1R5HA 1Z9CA 3HUGA 4M6XA 3E6MA 4YIFA 5IT3A 2R7FA 1SMYF 3BJAA 2FBKA 2CO5A 3VFZA 4KN7X 2FSWA 3RKWA 4BHPA 4CHUA 3I53A 3O6BB 1ZRCA 1B9MA 1S3JA 3CTAA 4WK8F 1TNSA 1QZYA 4LFUA 4HA8A 2H6BA 2QM3A 5L3EA 1XGOA 3DPLC 1G3WA 1YG2A 2XROA 5ERIA 2BBYA 1USSA 1F4KA 1ODDA 1ZARA 1UFMA 3M9AA 4I01A 3I64A 4BHCA 5E1WA 2K4JA 2L3DA 3SZTA 4GCVA 4HV5A 1TTYA 3I59A 1K6OA 3ECOA 5JR3A 3FZVA 2M1BA 5K1YA 1FX7A 3I71A 2P7VB 3BJ6A 3HRSA 2QQ9A 3WTZA 1O57A 3O3KA 4F7ZA 1K78B 2PEXA 2VC0A 4Q4ZF 3DP7A 2DPUA 2H27A 2EFPA 3R60A 4OINF 1SMTA 3ISPA 3T5XA 4EJWA 1ZG1A 4LJZF 3QU6A 3DFGA 3V7RA 2P7CB 2F5DA 3TOBA 3KP7A 1LVAA 1SD6A 3KP4A 1QBJA 3G73A 1WQ2A 3LA7A 3TO9A 3J81K 2V1XA 2KIFA 5ICEA 3KCCA 1KYWA 3FXUA 2VXZA 1PUEE 5FB2A 3QU3A 4ESFA 3OOPA 3QAHA 1OPCA 4EJUA 2MH9A 4Q5SF 2QZ8A 2HZTA 4FT8A 2D1HA 1XDSA 1EV7A 1ZLKA 4YIIA 5E20A 3HRUA 5ICCA 5BMZA 2K4BA 1QGPA 3KP2A 3RJPA 3KFWX 1ZRFA 3VB2A 4MGRA 3GFJA 1E17A 5J6XA 2NNNA 1Z6RA 4D0PA 4CZZA 4XBFA 4ZYGA 4LG0A 1KA8A 1GXPA 2IA0A 2L02A 2EJRA 5LGTA 2BV6A 4P96A 1FWZA 5BOXA 3J80K 2XUBA 5LBQA 3ZPLA 2VODA 3CUQA 2VBZA 4OIPF 3LSTA 5BS6A 3RDIA 1FP1D 5HLHA 3IWFA 3L7WA 5ICGA 2LNBA 4WXDA 3VOEA 2KJCA 4I0AA 3TOAA 5DCMB 3SQNA 1JHHA 2CYYA 3W6JB 1PP7U 3IKVA 2O3FA 1TQIA 3BP8A 1HW1A 2EB7A 1FP2A 1XMAA 3JSPA 2ZJ2A 3LAJA 1UHMA 4LD5A 1ZG5A 2Z5UA 5HS7A 2CWEA 1SFUA 2GQQA 3BOQA 4M71A 1F9NA 3HIFA 3FXRA 1YQAA 3QPHA 2YPRA 2BGCA 4HBLA 3F72A 3RIRA 4G94A 1I1GA 4NB5A 4G9YA 2EA4A 4KT5C 1FZPB 1YW7A 2DBBA 3GZ5A 1FBSA 3O2PE 1IUYA 4G6DA 2F5FA 5DEQA 1K79A 2YR2A 5CVIA 4Q48A 5HS8A 1R5GA 1BI3A 4G8XA 2E1NA 3MFKA 1P6RA 2VN2A 1O7LA 3HSFA 4WX9A 1B4AA 2AXLA 1OMIA 2EWNA 3WTTC 1MDMB 1E2XA 2ACJA 2RQPA 2P4WA 1OYWA 4A5NA 2MA3A 1XSVA 2CFXA 5HLGA 3EQLF 2XV4S 3FM3A 3CO6C 1LJ9A 4P9UA 4KNYA 2VBXA 1ULYA 3K9TA 1IN5A 3ABUA 2XHKA 2KIMA 4HQMA 1X3UA 3SZPA 5K5RA 4S04A 1IF1A 1O3TA 3DXJF 3WTSC 5FGMA 4LMYA 4O3MA 1Z7UA 3ZN0A 1ON1A 3M8EA 4A2UA 3T8TA 5F6FA 4HW0A 3WGGA 1YLFA 1MD0A 2VE9A 1XGSA 2CG4A 3NQOA 3RKXA 1IXCA 2IVMA 1FLIA 2HS5A 5E18F 1W7PB 4BH9A 1I1SA 2RKHA 2JT1A 2FNAA 3E5QA 1L0OC 1XCVA 5DCFA 2DO7A 3JSOA 1SFXA 1LDDA 4BAYA 3TGNA 3PQJA 4IRHA 4YG2F 4KMUX 2Q0OA 4EJTA 1IW7F 5ILUA 1SFEA 3BWGA 5D5UB 4I0BA 2K86A 3K0LA 1Z1DA 2NAZA 2RVCA 3IKTA 3F8MA 1R23A 3WTXC 4EJVA 4UVBA 3S2WA 1IXSB 5EEGA 3NRVA 4MNUA 5E8IA 5HLIA 3DV8A 5H20A 1TW2A 2VONA 2A6HF 5ICFA 3CLOA 3N97A 1TW3A 4KUMA 2JZYA 3GUDA 3F21A 2IJLA 2HR3A 2O8XA 2WV0A 4OOIA 1FC3A 2PG4A 1IN4A 1U5TA 3IHUA 4LLNA 2BEOA 2DFIA 3PQKA 2HFHA 3V8LA 3I4PA 2ETHA 1YW9A 4EMSA 3C1DA 2VOPA 1JXSA 1G6NA 4R79A 4BHBA 3HOSA 3F8BA 4L5IA 1IAWA 1H0MA 3U9GA 1S8NA 3ERED 4E70A 3GZ6A 2FU4A 2HKXA 2Z33A 1FBUA 2XAGA 1Z05A 4UUVA 3KZZA 1O3SA 2STWA 4EQQA 2ELHA 4I02A 2G7HA 4G7OF 1V3FA 5BPDA 1ZYRF 3RYPA 4R1HA 3E5UA 3LA3A 4KIGA 4L0ZB 4P5OA 5LGUA 3R0AA 2FF4A 4KIFA 1WRJA 1J7KA 2IA2A 1OYYA 3SFZA 4XSZF 2QQBA 1FSHA 3ECHA 2L4MA 3F8NA 1C0WA 1Z91A 4A0XA 1OKRA 5H6RA 1R00A 1XMKA 4EVIA 4R8HA 2VT2A 5D5VB 3RYRA 1QZZA 3ZMSA 3KEQA 1W5SA 4U0WA 3I58A 5E17F 1GXQA 2HTJA 5KVRA 5CVRA 4ZYDA 2XKOA 1KQ8A 4KDPA 3HSEA 4LK0F 2ZKZA 2ZO4A 4EGZA 1DDNA 1J59A 2QVOA 3ZP5A 2OZ6A 4UNOA 2H09A 2EK5A 2Y75A 4N9IA 1I5ZA 4YFNF 2PFBA 2FMYA 3FM5A 2FOKA 2DI3A 2XAJA 4AIJA 5DD4A 2LF8A 2UWMA 2DLLA 3FXQA 3L9FA 2MD5A 4I98B 1IN6A 2JPBA 1MJBA 3ZMTA 4RB2C 1J5YA 1HW2A 2QYOA 4Y15A 2R7DA 2PMHA 1ZLJA 2DT5A 1U3EM 4KMFA 2W25A 3VODA 5FLXZ 4ZYHA 4NQWA 4U7DA 3ZMDA 3W6KB 5E1XA 3MEXA 2QLZA 3WU0A 1ZAOA 2HQNA 2GXBA 1EH6A 2JPCA 2V1UA 1O7FA 1QO0D 4JQFA 3GF2A 1XGNA 2L54A 1RUOA 1CF7B 3L09A 4QLCU 2MC3A 2CQKA 4B8XA 1J75A 1G4DA 3TDZC 2RNJA 1HW5A 2CSOA 2DW4A 3KE2A 3NEUA 2P6SA 5LRRA 2NRAC 3QRFF 3P9KA 5LLQA 4XRFA 4M72A 2IPQX 1YIOA 1W4MA 3R4KA 5TJJA 3T0YA 2OD5A 3L00A 1BI2A 2KIUA 1T2KA 4L9NA 3QP5A 1REPC 3K69A 3HOTA 2V6CA 4KYWA 1PDNC 3KEOA 2IP2A 2NNYA 1CGPA 4EV0A 2F5EA 3JAMZ 5LHGA 1LEAA 2PBIA 3F6VA 4M74A 2QBYB 4G6QA 3WTVC 4ENKA 3CO7C 1XDUA 2J5PA 2GIVA 2HWVA 3COAC 2PMUA 2GXGA 2XRNA 4ASNA 2IW5A 1FY7A 1VTNC 5D5XB 2ZNYA 4JK1X 2K27A 3BPVA 1PP8F 3KP3A 5L3BA 3FMRA 1T38A 4WXCA 3TKYA 4M73A 3P9CA 1BJAA 4IVNA 4BNCA 5AIQA 1DUXC 1MGTA 3GFIA 4OU0A 2KJBA 2ZMEA 3I54A 4CICA 4HZFA 5LGNA 1HKTA 4LK1F 4IF4A 1IRGA 1JE8A 4RB1A 2C6YA 4BQAA 2VOOA 2DK5A 4LLGF 4EM2A 2F5CA 2LDUA 2NYXA 4ETSA 3K1PA 4G7HF 1SD7A 1YW8A 2O0YA 3B02A 3KZYA 3K1NA 1D8KA 3WG9A 1DPRA 4OIQF 1BC8C 5CVUA 1L3LA 3EUHA 1T6SA 3M7GA 3CJNA 1XSDA 4LLLA 3CUQC 1R1VA 2VE8A 3E97A 3BPXA 1MZBA 1LB2A 4Q47A 2J5OA 4L5JA 4HX4A 3BJOA 1R22A 3FWEA 5JHUA 1EH7A 4NHJA 2ZFWA 3IRQA 1WWXA 4AWXB 4FX4A 4IRGA 1WI9A 1P92A 2DQRA 2M45A 1LQ1A 2WTEA 3MZYA 3U1DA 3WE2A 3DF8A 2QWWA 1BOAA 4HLXA 3IRRA 4I7HA 2V9VA 2G9WA 2CW0F 2OQRA 3FHZA 2A69F 4XLNF 3I0TA 2YU3A 2FBIA 5HS9A 3I59B 2BYVE 4FX0A 5FLXK 1ZH5A 4PDKA 1P4WA 4MHGA 2FEZA 5IT9Z 5HDKA 3GEZA 4A0YA 1DP7P 1HBXG 4CDGA 2Y0MA 3MWMA 4U88A 3WGIA 2GA2A 3HHHA 2XVCA 2FXAA 2A5YB 1SAXA 1LDJA 1IN7A 5H6QA 5DUKA 5AONA 3ZN1A 3DKWA 1U8RA 3MZHA 5LHIA 2RDPA 5K5OA 3WE3A 2HEOA 1FT9A 1R58A 4HQEA 2OU2A 1KU2A 2YX7A 4KIBA 4A6EA 4RGUA 2AS5F 1V4RA 2ZNZA 4A6DA 2VBYA 1UB9A 3T8RA 3I5UA 3IL2A 5D8KB 1FNNA 2E7WA 3HRMA 3KP6A 3F8CA 2K7LA 2D45A 3JAMK 4KA4A 5TRDA 3KLOA 4M9ZA 5LRSA 5L3FA 3H3UA 3RI4A 1AOYA 5CLSA 4LG0B 1DPUA 2Z99A 4HV6A 4KN4X 4I2OA 4DNCA 1R7JA 3AAFA 1UHWA 2OQGA 2QQAA 3EYIA 4WXHA 1U6GA 3CUQB 4GYGA 4UV9A 2ZCWA 3T1BA 3TQNA 1HSJA 1NHAA 4IHSA 3DPTA 2P5KA 1KU7A 4RS8A 4P55A 3V8JA 2M87A 4OMZA 3J81Z 1FSEA 3RPQA 1AWCA 2Q2EA 4AIHA 3OV8A 3MQ0A 1XB4A 5D4SA 3HTSB 5D5WB 1U78A 2KKOA 1RNLA 2ISYA 3M1EA 2NS0A 3G3ZA 1TQPA 4RAYA 3ZMUA 4CXFA 3B73A 5J8FA 1BM9A 1W5TA 3HRTA 1O3QA 2JTVA 4O5VA 2TDXA 5FFXA 4HDVA 3FX3A 2FBHA 5HOOA 4RGXA 1J9IA 3HYIA 3P7NA 2XAHA 1P2FA 4AD9A 2A68F 1HXDA 1S29A 3ROUA 3H3ZA 2XGXA 2ISZA 4RGRA 3F23A 3DQVC 4YFXF 1I6XA 1D5VA 3J80Z 1JGSA 4IPAA 5HDNA 5E1ZB 4HOBA 4N9HA 1U5TC 3VEPA 5HVQC 3R0JA 1G3SA 2BE5F 1KGSA 5JVTA 2Q8KA 4LB6B 4CYDA 4A12A 1IRFA 5ILSA 3LWFA 4AVPA 1D3YA 5CVVA 3GO5A 2PN6A 1U2WA 1G3TA 4TV7A 3HHGA 4GO1A 3GYHX 2UXNA 1SD4A 3ELKA 3E6CC 2HOEA 3IWZA 2K02A 3D0SA 3SXYA 2P6TA 1YO5C 2P5LC 5IT9K 1ZGJA 4L9TA 4UXNA 4L0YB 4GXOA 3C18A 4PCQA 3BROA 3LA2A 3CUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI1 A;  5EEH A;  1BIB A;  4RB0 A;  2M30 A;  1IZ1 A;  5E8G A;  2P8T A;  5D4R A;  3ABT A;  2EFO A;  1YYV A;  1GHC A;  3ZMZ A;  5FFZ A;  3Q9S A;  3WU1 B;  1MDM A;  2UXX A;  2UZK A;  2L01 A;  2ADU A;  1S6L A;  1TQM A;  2EA2 A;  1FYM A;  1MJ9 A;  3CDH A;  1IN8 A;  5ILV A;  3TO6 A;  2V1D A;  6PAX A;  5DD8 A;  2DPD A;  3TDU C;  2D1V A;  4XLP F;  2F2E A;  5FO5 A;  2RC4 A;  1Y0U A;  2LSO A;  5JI6 A;  2A61 A;  5ED4 A;  5CJ9 A;  1ZG3 A;  1K7A A;  2MLG A;  3BDD A;  3WOD F;  3R61 A;  4UVA A;  4GGG A;  1F5T A;  2H94 A;  2EV0 A;  3WTW C;  2W85 A;  2EFW A;  4EM0 B;  5LEK A;  1ON2 A;  2O03 A;  4RAZ A;  2WWY A;  2PJP A;  4BXU A;  3M8F A;  2HYG D;  4S05 A;  5F64 A;  2ESN A;  1F1Z A;  1YS6 A;  4L18 B;  1R1T A;  4BYY A;  1G3Y A;  1FBQ A;  2QEN A;  3QOP A;  2DTR A;  1TNT A;  4IXA A;  3LQR A;  5LEJ A;  1RUN A;  1W7P A;  1YFH A;  2HQR A;  5J8C A;  4IHT A;  4RB3 C;  1STZ A;  1OR7 A;  2M8E A;  1KQ9 A;  3EDP A;  5DDG A;  3DEU A;  4UHT A;  2IRF G;  2FA5 A;  1KU3 A;  1U5T B;  4HLY A;  4WCG A;  2JSC A;  4U0Y A;  4PGG A;  2O6G E;  3Q9V A;  1QNT A;  4PZJ A;  5L3G A;  2RN7 A;  1T39 A;  1KU9 A;  2PQ8 A;  2STT A;  3BZ6 A;  2ZXJ A;  2XAF A;  4A0Z A;  1LDK B;  4ESB A;  1B59 A;  1P4A A;  5BPI A;  4EM1 A;  3MAJ A;  4EGY A;  1H9G A;  1FOK A;  4K2E A;  4MEX F;  4ENN A;  2OBP A;  1I27 A;  3F8F A;  1JHF A;  5DYM A;  2JRT A;  4UV8 A;  5D8L B;  2FML A;  4O6J A;  3J7A O;  1TLH B;  2B0L A;  2YX4 A;  1ZRD A;  5BQT A;  4HF1 A;  1LEB A;  4Y17 A;  2OAZ A;  3LAP A;  3K1M A;  3E5X A;  3WGH A;  5JFR A;  4KFC A;  3D5L A;  3L2C A;  2DU9 A;  4ZZD A;  2PI0 A;  4CGZ A;  4UVC A;  2EFN A;  1UCR A;  3K2Z A;  3GX4 X;  3ULQ B;  4LGW A;  1BI0 A;  4M9X A;  3U2R A;  1GVJ A;  4HAM A;  4LB5 A;  3IC7 A;  2CGP A;  4U7B A;  2XIG A;  4ENJ A;  2P5V A;  3FMS A;  4B09 A;  2A6E F;  2X4H A;  2LF7 A;  4HF2 A;  4OMY A;  1BC7 C;  5L3C A;  4H0E A;  3EET A;  1XSX A;  1Q1H A;  3ZMV A;  1ZRE A;  4M9S A;  5K5Q A;  2HKO A;  1HKS A;  2Y48 A;  1OYI A;  1B1B A;  1KYZ A;  3HSR A;  4HYE A;  4HDU A;  1T98 A;  2HTS A;  5CVJ A;  5A2Q Z;  2LKP A;  4IRI A;  3FF5 A;  4QWQ A;  1KQ0 A;  3KET A;  4MTD A;  1R36 A;  1ZGA A;  3GFL A;  5DUI A;  3GFM A;  4JBA A;  4L9J A;  4HX8 A;  3C3W A;  4KIC A;  3GXO A;  2E7X A;  5CYV A;  2RV8 A;  2W57 A;  1LNW A;  4MEY F;  3Q5F A;  2Z3Y A;  3V7S A;  2HYF A;  1RI7 A;  3RPU A;  2Z9O A;  3V8K A;  2QUF A;  1RZ4 A;  5KK1 A;  4RGS A;  4OIO F;  1BIA A;  4U0V A;  2XKP A;  3ML6 A;  3ZQ7 A;  5HDG A;  1S7A A;  4HX7 A;  4P9F A;  5LHH A;  2D2W A;  1J0R A;  3QPT A;  1BBY A;  2VBW A;  2FE3 A;  5DV5 A;  3GLX A;  1P4X A;  3KLN A;  2E1C A;  4N0B A;  4L9V A;  1WKM A;  2L4A A;  2R3S A;  3H92 A;  2MBF A;  1B6A A;  5D6F A;  3SHF A;  4PGH A;  1XGM A;  2GZW A;  1H9T A;  1HST A;  2GWR A;  1FYK A;  1W7P D;  3BY6 A;  1QQI A;  3N4M A;  2EV5 A;  2PLY A;  4ENM A;  1FPQ A;  1BN5 A;  1XN7 A;  1WSU A;  4ESJ A;  3WTY C;  1IXR C;  5F1R A;  3GWZ A;  2KRF A;  3QP6 A;  4G7Z F;  1SD5 A;  2OZU A;  1QPM A;  1R1U A;  1K78 A;  1D8J A;  1XD7 A;  2HGC A;  2HDC A;  2IT0 A;  2VT3 A;  3TO7 A;  3E6D A;  3E3V A;  1CF7 A;  1MJA A;  3PFI A;  2DK8 A;  1YS7 A;  1Z6T A;  4FHT A;  2WC2 A;  3RKY A;  1FYL A;  1ONV A;  1YTY A;  3V4G A;  2FNP A;  3F6O A;  2VC1 A;  1RIO H;  2ZBK A;  2MH2 A;  2G7U A;  2YSR A;  4YFK F;  4I09 A;  5FD5 A;  2XAQ A;  3HTU A;  5D6E A;  2COM A;  2ZME B;  2W84 A;  4IJA A;  2V79 A;  1HKQ A;  2ESH A;  4A5M A;  2O61 A;  2DQL A;  3GVA A;  1T0F A;  3F3X A;  3R6S A;  2XAS A;  2GA1 A;  3REO A;  1B9N A;  1EH8 A;  2FRH A;  4MQ9 F;  4ZZL A;  3F22 A;  4ON0 A;  3LQQ A;  3WTU C;  2QBY A;  2EV6 A;  1S7O A;  1TBX A;  2OA4 A;  3JTH A;  4XSX F;  4MTE A;  4M6Y A;  2GAU A;  2DAO A;  4OIR F;  4DQ2 A;  1A04 A;  4WF2 A;  5L3D A;  1O3R A;  4AIK A;  2IA1 A;  1ZHF A;  4HF0 A;  3JTG A;  3GW2 A;  4ZYE A;  2RGV A;  5FD6 A;  4WWC A;  3JW4 A;  3C7J A;  4Z2Y A;  5DCM A;  1HQC A;  2W24 A;  3FMQ A;  3EYY A;  4MQV A;  2X0L A;  5A2Q K;  4CO8 A;  4EJO A;  2M5W A;  1UST A;  1ZN2 A;  5AIP A;  3RTR A;  1J2X A;  3KP5 A;  2FQ3 A;  3E6B A;  2A3S A;  3P9I A;  1MKM A;  2H6C A;  4GYI A;  3MCZ A;  4ZH4 F;  4Y13 A;  2MLK A;  2A07 F;  2EFQ A;  3V7C A;  3LFK A;  1XCB A;  1R5H A;  1Z9C A;  3HUG A;  4M6X A;  3E6M A;  4YIF A;  5IT3 A;  2R7F A;  1SMY F;  3BJA A;  2FBK A;  2CO5 A;  3VFZ A;  4KN7 X;  2FSW A;  3RKW A;  4BHP A;  4CHU A;  3I53 A;  3O6B B;  1ZRC A;  1B9M A;  1S3J A;  3CTA A;  4WK8 F;  1TNS A;  1QZY A;  4LFU A;  4HA8 A;  2H6B A;  2QM3 A;  5L3E A;  1XGO A;  3DPL C;  1G3W A;  1YG2 A;  2XRO A;  5ERI A;  2BBY A;  1USS A;  1F4K A;  1ODD A;  1ZAR A;  1UFM A;  3M9A A;  4I01 A;  3I64 A;  4BHC A;  5E1W A;  2K4J A;  2L3D A;  3SZT A;  4GCV A;  4HV5 A;  1TTY A;  3I59 A;  1K6O A;  3ECO A;  5JR3 A;  3FZV A;  2M1B A;  5K1Y A;  1FX7 A;  3I71 A;  2P7V B;  3BJ6 A;  3HRS A;  2QQ9 A;  3WTZ A;  1O57 A;  3O3K A;  4F7Z A;  1K78 B;  2PEX A;  2VC0 A;  4Q4Z F;  3DP7 A;  2DPU A;  2H27 A;  2EFP A;  3R60 A;  4OIN F;  1SMT A;  3ISP A;  3T5X A;  4EJW A;  1ZG1 A;  4LJZ F;  3QU6 A;  3DFG A;  3V7R A;  2P7C B;  2F5D A;  3TOB A;  3KP7 A;  1LVA A;  1SD6 A;  3KP4 A;  1QBJ A;  3G73 A;  1WQ2 A;  3LA7 A;  3TO9 A;  3J81 K;  2V1X A;  2KIF A;  5ICE A;  3KCC A;  1KYW A;  3FXU A;  2VXZ A;  1PUE E;  5FB2 A;  3QU3 A;  4ESF A;  3OOP A;  3QAH A;  1OPC A;  4EJU A;  2MH9 A;  4Q5S F;  2QZ8 A;  2HZT A;  4FT8 A;  2D1H A;  1XDS A;  1EV7 A;  1ZLK A;  4YII A;  5E20 A;  3HRU A;  5ICC A;  5BMZ A;  2K4B A;  1QGP A;  3KP2 A;  3RJP A;  3KFW X;  1ZRF A;  3VB2 A;  4MGR A;  3GFJ A;  1E17 A;  5J6X A;  2NNN A;  1Z6R A;  4D0P A;  4CZZ A;  4XBF A;  4ZYG A;  4LG0 A;  1KA8 A;  1GXP A;  2IA0 A;  2L02 A;  2EJR A;  5LGT A;  2BV6 A;  4P96 A;  1FWZ A;  5BOX A;  3J80 K;  2XUB A;  5LBQ A;  3ZPL A;  2VOD A;  3CUQ A;  2VBZ A;  4OIP F;  3LST A;  5BS6 A;  3RDI A;  1FP1 D;  5HLH A;  3IWF A;  3L7W A;  5ICG A;  2LNB A;  4WXD A;  3VOE A;  2KJC A;  4I0A A;  3TOA A;  5DCM B;  3SQN A;  1JHH A;  2CYY A;  3W6J B;  1PP7 U;  3IKV A;  2O3F A;  1TQI A;  3BP8 A;  1HW1 A;  2EB7 A;  1FP2 A;  1XMA A;  3JSP A;  2ZJ2 A;  3LAJ A;  1UHM A;  4LD5 A;  1ZG5 A;  2Z5U A;  5HS7 A;  2CWE A;  1SFU A;  2GQQ A;  3BOQ A;  4M71 A;  1F9N A;  3HIF A;  3FXR A;  1YQA A;  3QPH A;  2YPR A;  2BGC A;  4HBL A;  3F72 A;  3RIR A;  4G94 A;  1I1G A;  4NB5 A;  4G9Y A;  2EA4 A;  4KT5 C;  1FZP B;  1YW7 A;  2DBB A;  3GZ5 A;  1FBS A;  3O2P E;  1IUY A;  4G6D A;  2F5F A;  5DEQ A;  1K79 A;  2YR2 A;  5CVI A;  4Q48 A;  5HS8 A;  1R5G A;  1BI3 A;  4G8X A;  2E1N A;  3MFK A;  1P6R A;  2VN2 A;  1O7L A;  3HSF A;  4WX9 A;  1B4A A;  2AXL A;  1OMI A;  2EWN A;  3WTT C;  1MDM B;  1E2X A;  2ACJ A;  2RQP A;  2P4W A;  1OYW A;  4A5N A;  2MA3 A;  1XSV A;  2CFX A;  5HLG A;  3EQL F;  2XV4 S;  3FM3 A;  3CO6 C;  1LJ9 A;  4P9U A;  4KNY A;  2VBX A;  1ULY A;  3K9T A;  1IN5 A;  3ABU A;  2XHK A;  2KIM A;  4HQM A;  1X3U A;  3SZP A;  5K5R A;  4S04 A;  1IF1 A;  1O3T A;  3DXJ F;  3WTS C;  5FGM A;  4LMY A;  4O3M A;  1Z7U A;  3ZN0 A;  1ON1 A;  3M8E A;  4A2U A;  3T8T A;  5F6F A;  4HW0 A;  3WGG A;  1YLF A;  1MD0 A;  2VE9 A;  1XGS A;  2CG4 A;  3NQO A;  3RKX A;  1IXC A;  2IVM A;  1FLI A;  2HS5 A;  5E18 F;  1W7P B;  4BH9 A;  1I1S A;  2RKH A;  2JT1 A;  2FNA A;  3E5Q A;  1L0O C;  1XCV A;  5DCF A;  2DO7 A;  3JSO A;  1SFX A;  1LDD A;  4BAY A;  3TGN A;  3PQJ A;  4IRH A;  4YG2 F;  4KMU X;  2Q0O A;  4EJT A;  1IW7 F;  5ILU A;  1SFE A;  3BWG A;  5D5U B;  4I0B A;  2K86 A;  3K0L A;  1Z1D A;  2NAZ A;  2RVC A;  3IKT A;  3F8M A;  1R23 A;  3WTX C;  4EJV A;  4UVB A;  3S2W A;  1IXS B;  5EEG A;  3NRV A;  4MNU A;  5E8I A;  5HLI A;  3DV8 A;  5H20 A;  1TW2 A;  2VON A;  2A6H F;  5ICF A;  3CLO A;  3N97 A;  1TW3 A;  4KUM A;  2JZY A;  3GUD A;  3F21 A;  2IJL A;  2HR3 A;  2O8X A;  2WV0 A;  4OOI A;  1FC3 A;  2PG4 A;  1IN4 A;  1U5T A;  3IHU A;  4LLN A;  2BEO A;  2DFI A;  3PQK A;  2HFH A;  3V8L A;  3I4P A;  2ETH A;  1YW9 A;  4EMS A;  3C1D A;  2VOP A;  1JXS A;  1G6N A;  4R79 A;  4BHB A;  3HOS A;  3F8B A;  4L5I A;  1IAW A;  1H0M A;  3U9G A;  1S8N A;  3ERE D;  4E70 A;  3GZ6 A;  2FU4 A;  2HKX A;  2Z33 A;  1FBU A;  2XAG A;  1Z05 A;  4UUV A;  3KZZ A;  1O3S A;  2STW A;  4EQQ A;  2ELH A;  4I02 A;  2G7H A;  4G7O F;  1V3F A;  5BPD A;  1ZYR F;  3RYP A;  4R1H A;  3E5U A;  3LA3 A;  4KIG A;  4L0Z B;  4P5O A;  5LGU A;  3R0A A;  2FF4 A;  4KIF A;  1WRJ A;  1J7K A;  2IA2 A;  1OYY A;  3SFZ A;  4XSZ F;  2QQB A;  1FSH A;  3ECH A;  2L4M A;  3F8N A;  1C0W A;  1Z91 A;  4A0X A;  1OKR A;  5H6R A;  1R00 A;  1XMK A;  4EVI A;  4R8H A;  2VT2 A;  5D5V B;  3RYR A;  1QZZ A;  3ZMS A;  3KEQ A;  1W5S A;  4U0W A;  3I58 A;  5E17 F;  1GXQ A;  2HTJ A;  5KVR A;  5CVR A;  4ZYD A;  2XKO A;  1KQ8 A;  4KDP A;  3HSE A;  4LK0 F;  2ZKZ A;  2ZO4 A;  4EGZ A;  1DDN A;  1J59 A;  2QVO A;  3ZP5 A;  2OZ6 A;  4UNO A;  2H09 A;  2EK5 A;  2Y75 A;  4N9I A;  1I5Z A;  4YFN F;  2PFB A;  2FMY A;  3FM5 A;  2FOK A;  2DI3 A;  2XAJ A;  4AIJ A;  5DD4 A;  2LF8 A;  2UWM A;  2DLL A;  3FXQ A;  3L9F A;  2MD5 A;  4I98 B;  1IN6 A;  2JPB A;  1MJB A;  3ZMT A;  4RB2 C;  1J5Y A;  1HW2 A;  2QYO A;  4Y15 A;  2R7D A;  2PMH A;  1ZLJ A;  2DT5 A;  1U3E M;  4KMF A;  2W25 A;  3VOD A;  5FLX Z;  4ZYH A;  4NQW A;  4U7D A;  3ZMD A;  3W6K B;  5E1X A;  3MEX A;  2QLZ A;  3WU0 A;  1ZAO A;  2HQN A;  2GXB A;  1EH6 A;  2JPC A;  2V1U A;  1O7F A;  1QO0 D;  4JQF A;  3GF2 A;  1XGN A;  2L54 A;  1RUO A;  1CF7 B;  3L09 A;  4QLC U;  2MC3 A;  2CQK A;  4B8X A;  1J75 A;  1G4D A;  3TDZ C;  2RNJ A;  1HW5 A;  2CSO A;  2DW4 A;  3KE2 A;  3NEU A;  2P6S A;  5LRR A;  2NRA C;  3QRF F;  3P9K A;  5LLQ A;  4XRF A;  4M72 A;  2IPQ X;  1YIO A;  1W4M A;  3R4K A;  5TJJ A;  3T0Y A;  2OD5 A;  3L00 A;  1BI2 A;  2KIU A;  1T2K A;  4L9N A;  3QP5 A;  1REP C;  3K69 A;  3HOT A;  2V6C A;  4KYW A;  1PDN C;  3KEO A;  2IP2 A;  2NNY A;  1CGP A;  4EV0 A;  2F5E A;  3JAM Z;  5LHG A;  1LEA A;  2PBI A;  3F6V A;  4M74 A;  2QBY B;  4G6Q A;  3WTV C;  4ENK A;  3CO7 C;  1XDU A;  2J5P A;  2GIV A;  2HWV A;  3COA C;  2PMU A;  2GXG A;  2XRN A;  4ASN A;  2IW5 A;  1FY7 A;  1VTN C;  5D5X B;  2ZNY A;  4JK1 X;  2K27 A;  3BPV A;  1PP8 F;  3KP3 A;  5L3B A;  3FMR A;  1T38 A;  4WXC A;  3TKY A;  4M73 A;  3P9C A;  1BJA A;  4IVN A;  4BNC A;  5AIQ A;  1DUX C;  1MGT A;  3GFI A;  4OU0 A;  2KJB A;  2ZME A;  3I54 A;  4CIC A;  4HZF A;  5LGN A;  1HKT A;  4LK1 F;  4IF4 A;  1IRG A;  1JE8 A;  4RB1 A;  2C6Y A;  4BQA A;  2VOO A;  2DK5 A;  4LLG F;  4EM2 A;  2F5C A;  2LDU A;  2NYX A;  4ETS A;  3K1P A;  4G7H F;  1SD7 A;  1YW8 A;  2O0Y A;  3B02 A;  3KZY A;  3K1N A;  1D8K A;  3WG9 A;  1DPR A;  4OIQ F;  1BC8 C;  5CVU A;  1L3L A;  3EUH A;  1T6S A;  3M7G A;  3CJN A;  1XSD A;  4LLL A;  3CUQ C;  1R1V A;  2VE8 A;  3E97 A;  3BPX A;  1MZB A;  1LB2 A;  4Q47 A;  2J5O A;  4L5J A;  4HX4 A;  3BJO A;  1R22 A;  3FWE A;  5JHU A;  1EH7 A;  4NHJ A;  2ZFW A;  3IRQ A;  1WWX A;  4AWX B;  4FX4 A;  4IRG A;  1WI9 A;  1P92 A;  2DQR A;  2M45 A;  1LQ1 A;  2WTE A;  3MZY A;  3U1D A;  3WE2 A;  3DF8 A;  2QWW A;  1BOA A;  4HLX A;  3IRR A;  4I7H A;  2V9V A;  2G9W A;  2CW0 F;  2OQR A;  3FHZ A;  2A69 F;  4XLN F;  3I0T A;  2YU3 A;  2FBI A;  5HS9 A;  3I59 B;  2BYV E;  4FX0 A;  5FLX K;  1ZH5 A;  4PDK A;  1P4W A;  4MHG A;  2FEZ A;  5IT9 Z;  5HDK A;  3GEZ A;  4A0Y A;  1DP7 P;  1HBX G;  4CDG A;  2Y0M A;  3MWM A;  4U88 A;  3WGI A;  2GA2 A;  3HHH A;  2XVC A;  2FXA A;  2A5Y B;  1SAX A;  1LDJ A;  1IN7 A;  5H6Q A;  5DUK A;  5AON A;  3ZN1 A;  3DKW A;  1U8R A;  3MZH A;  5LHI A;  2RDP A;  5K5O A;  3WE3 A;  2HEO A;  1FT9 A;  1R58 A;  4HQE A;  2OU2 A;  1KU2 A;  2YX7 A;  4KIB A;  4A6E A;  4RGU A;  2AS5 F;  1V4R A;  2ZNZ A;  4A6D A;  2VBY A;  1UB9 A;  3T8R A;  3I5U A;  3IL2 A;  5D8K B;  1FNN A;  2E7W A;  3HRM A;  3KP6 A;  3F8C A;  2K7L A;  2D45 A;  3JAM K;  4KA4 A;  5TRD A;  3KLO A;  4M9Z A;  5LRS A;  5L3F A;  3H3U A;  3RI4 A;  1AOY A;  5CLS A;  4LG0 B;  1DPU A;  2Z99 A;  4HV6 A;  4KN4 X;  4I2O A;  4DNC A;  1R7J A;  3AAF A;  1UHW A;  2OQG A;  2QQA A;  3EYI A;  4WXH A;  1U6G A;  3CUQ B;  4GYG A;  4UV9 A;  2ZCW A;  3T1B A;  3TQN A;  1HSJ A;  1NHA A;  4IHS A;  3DPT A;  2P5K A;  1KU7 A;  4RS8 A;  4P55 A;  3V8J A;  2M87 A;  4OMZ A;  3J81 Z;  1FSE A;  3RPQ A;  1AWC A;  2Q2E A;  4AIH A;  3OV8 A;  3MQ0 A;  1XB4 A;  5D4S A;  3HTS B;  5D5W B;  1U78 A;  2KKO A;  1RNL A;  2ISY A;  3M1E A;  2NS0 A;  3G3Z A;  1TQP A;  4RAY A;  3ZMU A;  4CXF A;  3B73 A;  5J8F A;  1BM9 A;  1W5T A;  3HRT A;  1O3Q A;  2JTV A;  4O5V A;  2TDX A;  5FFX A;  4HDV A;  3FX3 A;  2FBH A;  5HOO A;  4RGX A;  1J9I A;  3HYI A;  3P7N A;  2XAH A;  1P2F A;  4AD9 A;  2A68 F;  1HXD A;  1S29 A;  3ROU A;  3H3Z A;  2XGX A;  2ISZ A;  4RGR A;  3F23 A;  3DQV C;  4YFX F;  1I6X A;  1D5V A;  3J80 Z;  1JGS A;  4IPA A;  5HDN A;  5E1Z B;  4HOB A;  4N9H A;  1U5T C;  3VEP A;  5HVQ C;  3R0J A;  1G3S A;  2BE5 F;  1KGS A;  5JVT A;  2Q8K A;  4LB6 B;  4CYD A;  4A12 A;  1IRF A;  5ILS A;  3LWF A;  4AVP A;  1D3Y A;  5CVV A;  3GO5 A;  2PN6 A;  1U2W A;  1G3T A;  4TV7 A;  3HHG A;  4GO1 A;  3GYH X;  2UXN A;  1SD4 A;  3ELK A;  3E6C C;  2HOE A;  3IWZ A;  2K02 A;  3D0S A;  3SXY A;  2P6T A;  1YO5 C;  2P5L C;  5IT9 K;  1ZGJ A;  4L9T A;  4UXN A;  4L0Y B;  4GXO A;  3C18 A;  4PCQ A;  3BRO A;  3LA2 A;  3CUO A; 
#chains in the Genus database with same CATH topology
 3BCB A;  2X51 A;  1K4T A;  1BI1 A;  2LRD A;  1KON A;  4I76 A;  5EEH A;  4M3D A;  3MKL A;  1BIB A;  5F1J A;  4PJJ A;  3MKY B;  4RB0 A;  2M30 A;  1IZ1 A;  5E8G A;  3G2B A;  1JT0 A;  2KDZ A;  2P8T A;  5D4R A;  3ABT A;  2EFO A;  4JP0 A;  1O4X A;  1YYV A;  4IX7 A;  1TZL A;  3H0G J;  1GHC A;  2R0Q C;  4XRS G;  2IXS A;  3CP2 A;  3K4C A;  3ZMZ A;  5FFZ A;  3ABM H;  3Q9S A;  4EAT A;  2DA4 A;  3WU1 B;  1VQK I;  1MDM A;  1Y0N A;  2UXX A;  2UZK A;  2L01 A;  2LY2 A;  2ADU A;  2EZK A;  4NDL A;  1S6L A;  1TQM A;  2WAQ A;  2EA2 A;  1FYM A;  1MJ9 A;  3CDH A;  1IN8 A;  4C3I J;  2AQF A;  3TO6 A;  5ILV A;  2V1D A;  2M7A A;  1MH4 A;  4X1E A;  6PAX A;  5DD8 A;  2DPD A;  3OYK A;  4IKF A;  3TDU C;  1BL0 A;  2D1V A;  4XLP F;  2F2E A;  3S16 J;  3SEQ A;  1R71 A;  5FO5 A;  2HDW A;  2K9L A;  2RC4 A;  1Y0U A;  4XRM A;  4J00 A;  3P5J A;  3OIQ A;  4RA2 A;  2LSO A;  5JI6 A;  1YJN I;  3BTC A;  2A61 A;  1W0T A;  5ED4 A;  2ZSI B;  3OR2 C;  1A6I A;  5CJ9 A;  4GFB A;  1ZG3 A;  1K7A A;  2MLG A;  1WJC A;  3BDD A;  3FK7 A;  3WOD F;  1JJ6 C;  2K3P A;  3R61 A;  4UVA A;  4GGG A;  1F5T A;  5EF6 A;  2H94 A;  1X1B A;  2EV0 A;  3WTW C;  2W85 A;  3FBI B;  2EFW A;  4EM0 B;  1N25 A;  4C3J J;  5LEK A;  5HNF A;  1ON2 A;  2Z1D A;  4JOM A;  2R7V A;  3GBG A;  4AYB A;  2O03 A;  1MMS A;  9ANT A;  3U21 A;  4RAZ A;  4E7I A;  3OYI A;  2WWY A;  2PJP A;  2P81 A;  3FK6 A;  4W97 A;  4BXU A;  3M8F A;  2HYG D;  2IS4 A;  1GV5 A;  4S05 A;  5F64 A;  1P7J A;  1MBG A;  2ESN A;  1F1Z A;  2VJ4 A;  1YS6 A;  2R7Q A;  3ONQ A;  4L18 B;  1R1T A;  1JJ8 C;  2VQC A;  4BYY A;  2JA5 J;  3HEF A;  3BT9 A;  1G3Y A;  1FBQ A;  2OTL I;  4S0H B;  2CV2 A;  2QEN A;  3HKZ A;  2R7S A;  2EQR A;  4BBS J;  3QOP A;  1AA7 A;  2YUS A;  5E3M A;  1H8A C;  1YE9 A;  2BY1 A;  2DYS H;  2JUC A;  2KHM A;  2DTR A;  1TNT A;  4ZTF A;  3A01 A;  4IXA A;  4OAZ A;  3LQR A;  3BG3 A;  1BR1 A;  1IV6 A;  5LEJ A;  4ABZ A;  1RUN A;  1W7P A;  5FLM J;  2LH9 A;  1YFH A;  4N4N B;  1NK2 P;  4V2G A;  2HQR A;  5J8C A;  2V6E A;  3D5R C;  4IHT A;  3S14 J;  4RB3 C;  2A5W A;  1STZ A;  1OR7 A;  2M8E A;  1SEU A;  3L2Q A;  1HLV A;  3ZQL A;  1KQ9 A;  2DYR H;  4QTR A;  3EDP A;  3FKI J;  4BBR J;  5DDG A;  3C2B A;  3DEU A;  4UUS A;  3OS2 A;  1ETX A;  4UHT A;  2IRF G;  4A3L J;  2MAB A;  2FA5 A;  5IYB J;  4C2M J;  2IGN A;  3OYL A;  3TW7 A;  1KU3 A;  1YIT I;  1U5T B;  3MN2 A;  2LFB A;  3UNG C;  1QPI A;  4HLY A;  4WCG A;  2IBD A;  2JSC A;  1FMV A;  2W7N A;  3FXK A;  4U0Y A;  3CCU I;  1X2M A;  4PGG A;  1P9Q C;  2O6G E;  2DOF A;  3Q9V A;  4DYQ A;  1QNT A;  1IG7 A;  2O9L A;  4PZJ A;  5L3G A;  3N05 A;  3ZQH A;  4V19 K;  2JSP A;  2MG4 A;  2RN7 A;  4IQJ A;  4KJZ A;  1T39 A;  1KU9 A;  3I56 I;  2PQ8 A;  2STT A;  5J1Y A;  3BZ6 A;  2ZXJ A;  2XPU A;  4LIU A;  4CA0 A;  4C2U A;  3MVP A;  2XAF A;  4A0Z A;  1LDK B;  3W6V A;  4ESB A;  3F9K A;  2MYS A;  1B59 A;  1P4A A;  5BPI A;  4EM1 A;  3MAJ A;  4EGY A;  3Q0W A;  1H9G A;  1FOK A;  3OS0 A;  3BQY A;  4K2E A;  3SEZ A;  4MEX F;  1JKQ C;  4ENN A;  2OBP A;  1I27 A;  3DU5 A;  3JRB A;  3F8F A;  1SC7 A;  5C44 J;  1JHF A;  3QYF A;  3EPZ A;  5DYM A;  3BG9 A;  2JRT A;  2ZXH A;  1W5C C;  4UV8 A;  1B72 A;  5D8L B;  3IV5 A;  1XX5 A;  1GVD A;  2FML A;  1ZQ3 P;  4UUT A;  4O6J A;  3PJR A;  3J7A O;  1TLH B;  2B0L A;  2L0K A;  2YX4 A;  1XG1 A;  4X0G A;  1ZRD A;  5BQT A;  3QOE A;  2H1L A;  4HF1 A;  1LEB A;  2BHZ A;  4Y17 A;  2OAZ A;  3LAP A;  3K1M A;  3E5X A;  2JVH A;  3WGH A;  2NXN B;  2XGE A;  5JFR A;  4KFC A;  2E60 A;  3D5L A;  5B1A H;  3L2C A;  2NVQ J;  4I99 C;  2DU9 A;  4ZZD A;  4BE0 A;  1A36 A;  2PI0 A;  2EH3 A;  2OPT A;  2R5Z A;  4UVC A;  4CGZ A;  2EFN A;  2PX9 A;  1A5J A;  1UCR A;  3CQZ J;  3LSH A;  4RDU A;  3K2Z A;  3GX4 X;  3CD6 I;  3ULQ B;  2DOA A;  1R4N B;  4LGW A;  4J01 A;  3CES A;  2WAQ N;  3RZD J;  5EGO A;  5KAI C;  3S8P A;  1BI0 A;  4M9X A;  3U2R A;  4CCM A;  1GVJ A;  1WGX A;  4HAM A;  2QCO A;  3JCU C;  4LB5 A;  1PVE A;  2DJN A;  1WZ2 A;  4IHV A;  4Y4R A;  3IC7 A;  5B1B H;  2CGP A;  1BOB A;  4U7B A;  2XIG A;  3DCF A;  4ZDL A;  4ENJ A;  3S3M A;  2P5V A;  5JVG F;  4BE2 A;  2DXI A;  2ECB A;  4JX4 A;  1MSF C;  3H1C A;  3FMS A;  1H88 C;  3S1M J;  4B09 A;  1GT0 C;  2A6E F;  2X4H A;  2FOW A;  2KQR A;  1WJE A;  3W3C A;  2LF7 A;  4HF2 A;  2M0C A;  2IGK A;  4OMY A;  1BC7 C;  5L3C A;  3BZC A;  4H0E A;  1T56 A;  3EET A;  5LD2 C;  2KIQ A;  1XSX A;  1Q1H A;  3ZMV A;  2LRE A;  1ZRE A;  4M9S A;  3LSP A;  2X6W A;  5K5Q A;  2HKO A;  1HKS A;  2Y48 A;  2AHQ A;  1OYI A;  5C4X J;  2ZME C;  5HOD A;  1R4M B;  4II3 A;  3BTJ A;  1B1B A;  2JQ7 A;  1MNE A;  2GBY A;  1KYZ A;  3HSR A;  4AYB N;  4HYE A;  4HDU A;  1Z67 A;  4BE1 A;  1T98 A;  2HTS A;  5CVJ A;  5A2Q Z;  2LKP A;  3IUO A;  4IRI A;  1LKX A;  2HOT A;  2LD5 A;  2AXT C;  2DMT A;  3FF5 A;  1KQ0 A;  4QWQ A;  2LR8 A;  1Z21 A;  3L2W A;  3KET A;  1LE8 B;  1AKH A;  3E1S A;  1R36 A;  4MTD A;  2Y30 A;  3JRA A;  2ZSH B;  3M4O J;  1ZGA A;  4IHW A;  3GFL A;  3HKZ N;  5DUI A;  2EZL A;  2ZXW H;  4IZZ A;  3GFM A;  4JBA A;  5JLW A;  4L9J A;  4HX8 A;  3C3W A;  3LL7 A;  4NC8 A;  4KIC A;  4IHX A;  3GXO A;  1JKP C;  2E7X A;  5CYV A;  3SDG A;  2RV8 A;  3HZJ A;  3ZXS A;  2W57 A;  1ETW A;  1VQ7 I;  1LNW A;  4MEY F;  1JUP A;  5FKK A;  5J47 A;  1P7I A;  5JHF A;  3Q5F A;  2Z3Y A;  3V7S A;  2HYF A;  3EUH C;  1RI7 A;  3RPU A;  1QA6 A;  2Z9O A;  5J1R A;  3V8K A;  2QUF A;  1RZ4 A;  4NQW B;  5KK1 A;  4I6Z A;  4XOT A;  3SJM A;  4RGS A;  4OIO F;  1BIA A;  4HPQ A;  4U0V A;  2XKP A;  4CUG A;  3IH3 A;  3ML6 A;  3ZQ7 A;  1UJ8 A;  1TWG J;  5HDG A;  3SDB A;  5FRM A;  1S7A A;  2NVY J;  3LFU A;  4HX7 A;  4P9F A;  5LHH A;  3J7Y J;  3MKZ A;  1SVL A;  3D1N I;  2D2W A;  4NNJ A;  1J0R A;  3QPT A;  1BBY A;  3HPH A;  2VBW A;  2FE3 A;  5DV5 A;  5GTI C;  3GLX A;  1P4X A;  1WFX A;  3KLN A;  5IYC J;  5TIS C;  2HQ5 A;  4ZDO A;  2E1C A;  4N0B A;  4M3E A;  4L9V A;  1WKM A;  2L4A A;  1FOY A;  2R3S A;  1EKE A;  4XKC A;  3H92 A;  1V5G A;  1BW5 A;  4IL6 C;  3H9Q A;  1VQ8 I;  2MBF A;  2E2I J;  1B6A A;  3A01 B;  5D6F A;  4G12 A;  3AG4 H;  2OF7 A;  4E7J A;  3SHF A;  4PGH A;  2OJE D;  2WAD A;  1XGM A;  2F6C A;  2GZW A;  3QYE A;  2XDV A;  4FQG A;  3S93 A;  3VYU B;  3CJQ B;  1H9T A;  1HST A;  2GWR A;  4PJ0 C;  1FYK A;  4RAG A;  1W7P D;  2R7O A;  1QQI A;  3BY6 A;  1XPX A;  1IUF A;  2BW3 B;  3WHB A;  3N4M A;  2M4K A;  2EV5 A;  2PLY A;  4ENM A;  1FPQ A;  3GLL A;  5F0F A;  1BN5 A;  1XN7 A;  3MZ8 A;  4FAS D;  4MO7 A;  1WSU A;  4ESJ A;  3WTY C;  1LFP A;  4ITV A;  1IXR C;  3DEW A;  5F1R A;  3GWZ A;  2NS7 A;  3FIW A;  1RR7 A;  2HYJ A;  2KRF A;  2ICW G;  3QP6 A;  1SD5 A;  2OZU A;  4G7Z F;  1QPM A;  1R1U A;  1K78 A;  3LMM A;  4OWR B;  5C4J J;  2DA5 A;  3CCL I;  1T8I A;  1D8J A;  1SFO J;  5CKT A;  1XD7 A;  2HGC A;  1HCR A;  2HDC A;  5E3N A;  2IT0 A;  2OCC H;  4M3B A;  4LOC A;  2VT3 A;  2H8R A;  2L9N A;  3TO7 A;  3BTL A;  3E6D A;  1BR4 A;  4LG3 A;  1I50 J;  2CU7 A;  3E3V A;  3JRI A;  1CF7 A;  1FIA A;  1MJA A;  2K40 A;  3PFI A;  2BY0 A;  1X58 A;  1YS7 A;  2DK8 A;  2EIJ H;  3H0D A;  1N77 A;  2TCT A;  1Z6T A;  2WC2 A;  4FHT A;  4XLH A;  3OYM A;  3G1M A;  2HPM A;  3RKY A;  1FYL A;  3BG5 A;  1ONV A;  2M7B A;  3OSG A;  1YTY A;  3V4G A;  4U87 A;  2DDA A;  5B5E C;  2LC2 A;  3OYC A;  2FNP A;  4Y3O A;  3F6O A;  2VC1 A;  4D7M A;  4XIC A;  1RIO H;  2ZBK A;  3MKW B;  5J4Y A;  2HU9 A;  2MH2 A;  1E3O C;  2G7U A;  3I9V 2;  1YRN B;  2E2H J;  4BU2 A;  2YSR A;  4YFK F;  4I09 A;  3AG3 H;  4GRI A;  4XN3 A;  5FD5 A;  2XAQ A;  3HTU A;  2FUG 2;  5D6E A;  3TW6 A;  2COM A;  2ZME B;  2W84 A;  4IJA A;  2CV0 A;  2M34 A;  3K6G A;  4CCK A;  1WCM J;  5GAG J;  3CCS I;  3HDD A;  2V79 A;  1HKQ A;  2ESH A;  4A5M A;  2O61 A;  2DQL A;  2DA7 A;  3GVA A;  1T0F A;  2KP6 A;  3F3X A;  3IAS 2;  3R6S A;  3S1R J;  1OCZ H;  2XAS A;  2GA1 A;  3REO A;  2CMP A;  3CMA I;  4E7K A;  1B9N A;  2LG4 A;  2JA6 J;  2JK3 A;  2LKX A;  1EH8 A;  2FRH A;  4MQ9 F;  4ZZL A;  3F22 A;  4ON0 A;  3LQQ A;  3WTU C;  2QBY A;  2EV6 A;  2HVS A;  1S7O A;  3H5R A;  3Q0U A;  4HG2 A;  2DMP A;  1TBX A;  2OA4 A;  3JTH A;  4XSX F;  4PFO A;  5TGT A;  2CUJ A;  4M6Y A;  2GAU A;  4MTE A;  3OOU A;  4DJA A;  2DAO A;  3PM1 A;  2LTP A;  4OIR F;  4DQ2 A;  1A04 A;  1NG7 A;  1MMG A;  2RAE A;  4WF2 A;  5L3D A;  1O3R A;  4AIK A;  4UB8 C;  2IA1 A;  1ZHF A;  4JX5 A;  4XK4 A;  1XS9 A;  4HF0 A;  1OQY A;  1M1E B;  4ZJZ A;  3JTG A;  4M6V A;  1IJW C;  3GW2 A;  4ZYE A;  3L1P A;  2RGV A;  5FD6 A;  4WWC A;  3JW4 A;  3C7J A;  3OSF A;  1JKR C;  4Z2Y A;  4PJL A;  4XLC A;  3RQI A;  1AHD P;  1FTT A;  3FBN B;  2QA4 I;  5DCM A;  5F27 A;  2GOX B;  3HXL A;  1HQC A;  2W24 A;  3FMQ A;  2NVT J;  1T08 B;  3EYY A;  1ERD A;  4MQV A;  2X0L A;  5A2Q K;  2DA1 A;  4CO8 A;  1ITY A;  4EJO A;  2M5W A;  1UST A;  3SFI A;  1ZN2 A;  2CUZ A;  1VQM I;  4JYK A;  2WAF A;  5AIP A;  3RTR A;  1J2X A;  3KP5 A;  2FQ3 A;  1QZE A;  2K9N A;  3H5A A;  4D9J A;  4X6A J;  3E6B A;  3K70 C;  1WH5 A;  3CDI A;  2ZFU A;  2JUG A;  2KRH A;  4PUS A;  3IH4 A;  3UR3 C;  1ZK8 A;  4IHY A;  2A3S A;  3P9I A;  1MKM A;  4D7N A;  2H6C A;  4GYI A;  4C3H J;  3MCZ A;  2JWT A;  4ZH4 F;  3KIO A;  4M3G A;  1K4S A;  1KZH A;  3W2W A;  4Y13 A;  2MLK A;  2A07 F;  2VKE A;  2EFQ A;  3WG7 H;  3KEY A;  2G0E A;  3V7C A;  4B44 A;  3LFK A;  1XCB A;  1FMW A;  2A6T A;  2P0W A;  2X6X A;  1R5H A;  1Z9C A;  1RKW A;  3HUG A;  1U0J A;  4M6X A;  3E6M A;  4YIF A;  3OYD A;  1D0X A;  5IT3 A;  3CCQ I;  2PJR A;  2R7F A;  1DU6 A;  1SMY F;  1BR2 A;  3BJA A;  2FBK A;  2CO5 A;  3VFZ A;  4KN7 X;  1X1A A;  2K3F A;  5EDN A;  3AG2 H;  2VB6 A;  2HPI A;  1UEL B;  2FSW A;  3RKW A;  3RPU D;  3G1L A;  1Y39 A;  1Z0X A;  2BXY A;  4BHP A;  4CHU A;  3I53 A;  3U1K A;  2AQE A;  2DOE A;  1WH7 A;  5JLX A;  1WHU A;  3O6B B;  1ETY A;  1B9M A;  4BJ5 C;  1ZRC A;  1S3J A;  3CTA A;  4NC7 A;  2WB1 A;  4WK8 F;  1K61 A;  3CDL A;  3I4N J;  1TNS A;  3FDY A;  1QZY A;  4LFU A;  4HA8 A;  2H6B A;  2QM3 A;  2VJ5 A;  5L3E A;  1XGO A;  3DPL C;  1G3W A;  1YG2 A;  2XRO A;  2X1C A;  5ERI A;  3ZGK A;  2BBY A;  1USS A;  2GXA A;  1F4K A;  1V5F A;  1MBF A;  5KHD A;  1ODD A;  1ZAR A;  1UFM A;  3AL0 C;  1S9H A;  3ZQI A;  2D5V A;  2VIX A;  1WI3 A;  3M9A A;  4I01 A;  3I64 A;  4BHC A;  5E1W A;  4B4C A;  2K4J A;  3DPU A;  2L3D A;  3SZT A;  4GCV A;  4HV5 A;  1TTY A;  3C2H A;  1W36 D;  3RZO J;  4A3E J;  5KCM A;  5KNL A;  3I59 A;  1K6O A;  5HNH A;  3PNT A;  2LLK A;  2DT6 A;  3ECO A;  2QSH X;  1N78 A;  5JR3 A;  3FZV A;  2M1B A;  2FD5 A;  2X1E A;  2M9H A;  5IPA A;  3S2H J;  5K1Y A;  1FX7 A;  2KMU A;  3I71 A;  1FJL A;  2P7V B;  1Z3Y A;  3BJ6 A;  1B8I B;  3HRS A;  2QQ9 A;  3WTZ A;  1O57 A;  3HB9 A;  3BG7 A;  1Y8R B;  3O3K A;  5DTD A;  1DU0 A;  2I5U A;  4F7Z A;  2CRG A;  1K78 B;  2PEX A;  2VC0 A;  3M1C A;  4Q4Z F;  5GP9 A;  3DP7 A;  3TP0 A;  3A03 A;  2DPU A;  2R4G A;  2H27 A;  2EFP A;  3R60 A;  2EBI A;  2ZJP F;  4OIN F;  1SMT A;  3PSF A;  2L9S A;  4XL9 A;  3ISP A;  3CCJ I;  2LYC A;  2X6O A;  3T5X A;  4EJW A;  3UKG A;  1ZG1 A;  1D1B A;  4LJZ F;  3HGG A;  3QU6 A;  3DFG A;  3V7R A;  3S1N J;  1IV8 A;  2P7C B;  3O8H A;  1QRY A;  2F5D A;  2E1M C;  2R93 J;  4BDZ A;  5B66 C;  3PL8 A;  4RM2 A;  3TOB A;  2O5R A;  2LK2 A;  3KP7 A;  1LVA A;  1SD6 A;  3KP4 A;  3OYJ A;  1QBJ A;  2V7F A;  3A1Y A;  1MMA A;  3M3Y J;  1YIJ I;  4DYC A;  3G73 A;  2M0M A;  4MLO A;  1WQ2 A;  2EZH A;  3LA7 A;  3TO9 A;  3J81 K;  2V1X A;  4DOZ A;  2KIF A;  5ICE A;  3KCC A;  1KYW A;  3FXU A;  2VXZ A;  1PUE E;  5FB2 A;  1OLT A;  3QU3 A;  4ESF A;  3OOP A;  4CYC A;  3QAH A;  1OPC A;  4YIR X;  4EJU A;  2Q2E B;  3HG9 A;  3G4S I;  2MH9 A;  2XPW A;  3IP4 B;  4Q5S F;  2QZ8 A;  2HZT A;  3HOY J;  1R6R A;  4FIS A;  4FT8 A;  2D1H A;  2DCE A;  3CME I;  1XDS A;  3HM5 A;  1EV7 A;  1ZLK A;  1DGW Y;  5GPC A;  4YII A;  2EIN H;  5E20 A;  4KT6 A;  4QPQ A;  3HRU A;  5ICC A;  5FKO A;  5BMZ A;  2K4B A;  2GM4 A;  1QGP A;  5FJ8 J;  3KP2 A;  3RJP A;  3KFW X;  1YOV B;  4BXF A;  1ZRF A;  1LPQ A;  1I6H J;  3VB2 A;  4MGR A;  3GFJ A;  1VFC A;  1RKT A;  1E17 A;  2HXI A;  5J6X A;  3BG6 A;  2NNN A;  1Z6R A;  4D0P A;  5EG0 B;  1Y6I A;  4CZZ A;  1FOX A;  4XBF A;  1VQO I;  4ZYG A;  1FIP A;  4LG0 A;  3CC2 I;  1KA8 A;  1SAN A;  1GXP A;  1SVM A;  4ZC3 A;  1V54 H;  3LSR A;  2IA0 A;  3BQZ A;  1RES A;  2L02 A;  2EJR A;  1S7E A;  5LGT A;  1GLN A;  1NTC A;  3EUK L;  4ZTJ A;  2BV6 A;  4P96 A;  2DA6 A;  1FWZ A;  1TT0 A;  5BOX A;  1OR7 C;  3J80 K;  1IO2 A;  2XUB A;  5LBQ A;  3ZPL A;  2VOD A;  3CUQ A;  2VBZ A;  4OIP F;  4UY8 I;  4XKV A;  3LST A;  5BS6 A;  3RDI A;  1FP1 D;  4B3A A;  3GTO J;  4DBR A;  1RPW A;  3IWF A;  4B47 A;  5HLH A;  4B3X A;  3L7W A;  5ICG A;  2LNB A;  4WXD A;  3VOE A;  2KJC A;  1LFU P;  4I0A A;  3K4K A;  3TOA A;  5DCM B;  3SQN A;  1JHH A;  2CYY A;  2LBF B;  3W6J B;  2M4G A;  3IKV A;  1PP7 U;  1D5Y A;  2O3F A;  1TQI A;  2DOD A;  3BP8 A;  4Y52 J;  2E2J J;  1HW1 A;  1Z7L A;  2EB7 A;  2OCE A;  1FP2 A;  1XMA A;  2JN6 A;  2IS6 A;  3ZCO A;  2R5Y A;  2NOG A;  3ZQG A;  1WJD A;  2XAU A;  3JSP A;  2ZJ2 A;  3LAJ A;  2CFO A;  2WB1 N;  1UHM A;  4LD5 A;  4D5C A;  1ZG5 A;  5EZG A;  1G59 A;  2OC6 A;  1T95 A;  2Z5U A;  3M8J A;  2CWE A;  1Y8Q B;  5HS7 A;  2CQ7 A;  2GQQ A;  1D1C A;  1VND A;  2KT0 A;  1SFU A;  2X6Y A;  2LKS A;  2VUM J;  3BOQ A;  2R7T A;  1X1C A;  2VXD A;  1E3H A;  4LIV A;  1F9N A;  4M71 A;  4A3C J;  3HIF A;  1OCO H;  1MMN A;  3L2V A;  1N75 A;  3AL0 B;  3FXR A;  2JVG A;  3FIS A;  1YQA A;  4BQQ A;  3MMY B;  3QPH A;  2YPR A;  2ZJQ F;  2BGC A;  5M3F J;  1W1W E;  4HBL A;  1R49 A;  1ETV A;  3DLA A;  1DGR M;  2CJJ A;  3TL4 X;  3F72 A;  2VJI A;  3TP3 A;  3K4N A;  3RIR A;  3LOC A;  4G94 A;  3NWT A;  1I1G A;  1ETK A;  3OL4 A;  4NB5 A;  4G9Y A;  2EA4 A;  4KT5 C;  1FZP B;  3JRC A;  1YW7 A;  3IH2 A;  5C3E J;  2ID6 A;  2DBB A;  3GZ5 A;  3WHC A;  2IGM A;  2M3A A;  4NBQ A;  1FBS A;  3O2P E;  3OY9 A;  3KYL A;  1JGG A;  1IUY A;  3V42 A;  3EUA A;  2K9S A;  4KIT B;  4G6D A;  2O8K A;  5FKM A;  2F5F A;  3GCM A;  2OV7 A;  5DEQ A;  1DP3 A;  2QEX I;  4ZYA A;  1K79 A;  2HQA A;  2YR2 A;  5CVI A;  4Q48 A;  5HS8 A;  1R5G A;  4XID A;  1BI3 A;  3KX2 A;  4G8X A;  3RCO A;  3BR2 A;  2E1N A;  1P6R A;  2VN2 A;  4C30 A;  3MFK A;  1O7L A;  3HSF A;  1K83 J;  4WX9 A;  1B4A A;  2AXL A;  1OMI A;  2EWN A;  3WTT C;  1MDM B;  1E2X A;  2ACJ A;  2RQP A;  4E4H A;  3G1O A;  1VI0 A;  1G2H A;  2P4W A;  3HOU J;  1OYW A;  4A5N A;  2WAE A;  2MA3 A;  2KL4 A;  1XSV A;  2CFX A;  5HLG A;  5EZH A;  3EQL F;  4H4K C;  2E1M B;  2H1K A;  2XV4 S;  3FM3 A;  1EJ9 A;  2ID3 A;  3CO6 C;  2QKL B;  1LJ9 A;  4P9U A;  2NOJ B;  1V5E A;  4PJM A;  2DMN A;  3B6C A;  4KNY A;  2VBX A;  1ULY A;  3K9T A;  3FXO A;  1IN5 A;  1T33 A;  3PSI A;  3ABU A;  2KPM A;  3H35 A;  2UV1 A;  1FTZ A;  1ZR4 A;  2XHK A;  5E3O A;  2X9D A;  1APL C;  2KIM A;  1ETO A;  4HQM A;  1TWF J;  3CJR B;  1X3U A;  2DTZ A;  3SZP A;  5K5R A;  2K5C A;  4S04 A;  3PNV A;  4F93 B;  3ESW B;  1IF1 A;  1O3T A;  3DXJ F;  3OYE A;  3WTS C;  5FGM A;  3K7A J;  2R7U A;  2EZI A;  4LMY A;  2VKH A;  3OMY A;  4P1W A;  4O3M A;  3HOZ J;  1Z7U A;  3ZN0 A;  1ON1 A;  2DFE A;  1WJA A;  3M8E A;  4A2U A;  3T8T A;  5EEA A;  3G6E I;  1HF0 A;  5F6F A;  4HW0 A;  3WGG A;  1YLF A;  1D0Z A;  2R7X A;  1MD0 A;  2VE9 A;  1Q1V A;  3DTK A;  3G71 I;  1XGS A;  2CG4 A;  4BY7 J;  1MSE C;  2L7M P;  3PUB A;  4DW6 A;  3NQO A;  1OJL A;  1A31 A;  3RKX A;  4HNV A;  1IXC A;  2IVM A;  2XB5 A;  3JR9 A;  1FLI A;  2HS5 A;  5E18 F;  2HXO A;  4Y33 A;  3OIO A;  1W7P B;  4BH9 A;  4BQO A;  1I1S A;  2RKH A;  2JT1 A;  4W1U A;  2FNA A;  4QSH A;  3E5Q A;  1L0O C;  1XCV A;  5DCF A;  3W2V A;  3JRE A;  1UAA A;  3JRG A;  2VQL A;  3HBL A;  2DO7 A;  3JSO A;  2DJI A;  3OR1 C;  1SFX A;  1LDD A;  1U9O A;  4XOP A;  2BY2 A;  1WPK A;  4UUS B;  4BAY A;  1S72 I;  4LIT A;  3TGN A;  2Y9Y A;  2KZG A;  3PQJ A;  4PJN A;  3BR6 A;  4IRH A;  1JI8 A;  3B6A A;  3K4J A;  4YG2 F;  4RLF A;  4KMU X;  5CQG A;  2W1O A;  4UB6 C;  5K7H A;  2Q0O A;  2QGU A;  1S5L C;  1IW7 F;  4EJT A;  4AVZ A;  2MD0 A;  5BNG A;  5ILU A;  2X1D A;  3GTP J;  1Z3X A;  1BW6 A;  1SFE A;  1VQ9 I;  3BWG A;  3IAM 2;  2VKV A;  2XF6 A;  5D5U B;  4FCY A;  1MBH A;  4I0B A;  2K86 A;  3Q0V A;  3K0L A;  3X2Q H;  1Z1D A;  2NAZ A;  3BCA A;  2RVC A;  4OAY A;  5J40 A;  1X19 A;  3IKT A;  3K2A A;  4A3K J;  2QF7 A;  3J7A Y;  3F8M A;  1R23 A;  3WTX C;  2WBM A;  4EJV A;  2DT7 B;  4UVB A;  2DDB A;  4BY1 J;  1ACI A;  3S2W A;  2CH0 A;  1IXS B;  3L2R A;  5EEG A;  3AKZ A;  5F04 A;  4CSW A;  1W36 C;  2WA0 A;  2MW8 A;  3NRV A;  4MNU A;  5E8I A;  4XLF A;  3TBI A;  3GZN B;  5HLI A;  3CC7 I;  3DV8 A;  3QPL A;  5H20 A;  2B63 J;  1TW2 A;  2VON A;  2A6H F;  5ICF A;  3VYT B;  4XQF A;  3CLO A;  3N97 A;  1TW3 A;  4KUM A;  3HOW J;  3NAU A;  1B72 B;  2JZY A;  3GUD A;  3F21 A;  2IJL A;  2K9Q A;  2HR3 A;  1YJ9 I;  2O8X A;  2WV0 A;  3LSI A;  3H9J A;  3HJE A;  2L9R A;  4PSX A;  4YEJ A;  4OOI A;  2HI3 A;  4QIW N;  1FC3 A;  2PG4 A;  1IN4 A;  1U5T A;  1JUM A;  3HL2 A;  1SAU A;  2N8G A;  3DLL F;  2CUE A;  3IHU A;  2X48 A;  5J3L A;  2XPV A;  1WJF A;  4LLN A;  2BEO A;  2DFI A;  2R5Z B;  4MFE A;  5B3S H;  3PQK A;  3S3O A;  2HFH A;  3V8L A;  1LUJ B;  3I4P A;  1SVO A;  2F48 A;  2ETH A;  1D1A A;  2DMU A;  5EGO B;  1YW9 A;  4EMS A;  2FQ4 A;  1MNM C;  1QHG A;  2IS2 A;  3C1D A;  2VOP A;  3H5N A;  1JXS A;  1G6N A;  2V4J C;  4R79 A;  1Y1W J;  4FE7 A;  4RM3 A;  2E5Z A;  3QOD A;  3WU2 C;  4BHB A;  3HGY A;  5GTH C;  3F8B A;  3MD2 A;  3HOS A;  4L5I A;  4XLE A;  1IAW A;  2IGO A;  1H0M A;  2H8W A;  3U9G A;  3CF5 F;  1S8N A;  3ERE D;  2XSJ C;  4E70 A;  1NK3 P;  3GZ6 A;  2FU4 A;  2HKX A;  3BLY A;  2Z33 A;  5FKL A;  1FBU A;  2XAG A;  1Z05 A;  3ZQF A;  3PIO F;  4UUV A;  3KZZ A;  1O3S A;  2STW A;  2IS1 A;  4EQQ A;  2ELH A;  4I02 A;  3I55 I;  2G7H A;  3ERM A;  5M5X J;  3OYA A;  4G7O F;  2E36 A;  4FE4 A;  4E7S A;  1V3F A;  5BPD A;  1ZYR F;  2HOA A;  3RYP A;  1JTY A;  3K4B A;  4R1H A;  1MBE A;  2L9V A;  3E5U A;  4RMN A;  3CC4 I;  4XON A;  4II2 A;  4FET A;  3LA3 A;  1MBK A;  4KIG A;  2HVQ A;  4L0Z B;  4P5O A;  1I3Q J;  3CP8 A;  4PK4 A;  1T0F C;  5LGU A;  3R0A A;  3PO3 J;  2FF4 A;  1AKH B;  2XF5 A;  4PFP A;  4KIF A;  4MIM A;  4AC0 A;  1WRJ A;  1J7K A;  2IA2 A;  3CMY A;  1OYY A;  3SFZ A;  4XSZ F;  3OWT A;  2KLO A;  4F55 A;  1MW7 A;  2QQB A;  2QSG X;  2KFD A;  3K10 A;  4V2F A;  1FSH A;  2L7K A;  5IP7 J;  3ECH A;  2L4M A;  4NUB A;  5M5Y J;  3HOX J;  3F8N A;  2MGQ A;  1C0W A;  3VYS B;  2LP0 A;  2W82 A;  1Z91 A;  4BUP A;  4A0X A;  2VKD A;  3GTL J;  2A05 A;  5M3M J;  2Q1Z B;  2E19 A;  1OKR A;  5H6R A;  1R00 A;  1AU7 A;  1X3W B;  1XMK A;  2CQQ A;  3HOV J;  4EVI A;  3L2U A;  2VPL A;  4R8H A;  2VT2 A;  5D5V B;  1X1P A;  2BOL A;  3RYR A;  3DBH B;  2Y0S A;  1QZZ A;  3ZMS A;  3KEQ A;  1W5S A;  1G8X A;  4HSR A;  4U0W A;  4Z6Y A;  3BZK A;  3Q3S A;  3ZR8 X;  3I58 A;  5E17 F;  1GXQ A;  2MSY A;  4G6T B;  3OYH A;  5LFA A;  2KRC A;  1V55 H;  2HTJ A;  4BXX J;  4HNU A;  3A0B C;  5KVR A;  1OCP A;  5CVR A;  4ZYD A;  4KIS A;  3FXM A;  2EIK H;  2XKO A;  2XRL A;  4HNT A;  2FJ1 A;  3OYF A;  1I39 A;  3FXJ A;  1E0E A;  1KQ8 A;  1MND A;  2ELJ A;  3RSN A;  4KDP A;  3HSE A;  4E7Z A;  4LK0 F;  2ZKZ A;  2ZO4 A;  4EGZ A;  5CPR B;  1DDN A;  2W00 A;  5IYD J;  1J59 A;  2QVO A;  3ZP5 A;  2HDD A;  1VQ6 I;  1QVT A;  2OZ6 A;  4UNO A;  3QPS A;  2DFF A;  4BKX A;  2H09 A;  2EK5 A;  2Y75 A;  3VSL A;  2JRM A;  4CCO A;  4N9I A;  4YRV A;  1I5Z A;  1LE8 A;  4YFN F;  2PFB A;  2XGD A;  2FMY A;  1JTX A;  3FM5 A;  5EYR A;  2FOK A;  2DI3 A;  2XAJ A;  1DQU A;  4AIJ A;  4GDF A;  3DWL E;  4XKB A;  5DD4 A;  2LF8 A;  2UWM A;  2ECC A;  2DLL A;  1UZC A;  3FXQ A;  1D0Y A;  3L9F A;  2MD5 A;  2L7F P;  3CCY A;  4I98 B;  1IN6 A;  2JPB A;  4CH7 A;  1MJB A;  3ZMT A;  1SFK A;  1TT5 B;  5FKN A;  4RB2 C;  5IOZ A;  1J5Y A;  4M3F A;  1HW2 A;  2QYO A;  4Y15 A;  2R7D A;  4NC6 A;  2PMH A;  3H3V K;  1ZLJ A;  2DT5 A;  4RAF A;  1U3E M;  4XN0 A;  4KMF A;  2W25 A;  3H36 A;  3VOD A;  4AM3 A;  1GV2 A;  5FLX Z;  4ZYH A;  2VJJ A;  4NQW A;  2E34 A;  4U7D A;  4L5E A;  2EIL H;  3ZMD A;  3W6K B;  1CQT A;  5E1X A;  1ZAO A;  2HQN A;  2QLZ A;  3MEX A;  2Y69 H;  3WU0 A;  2ME0 A;  1EH6 A;  2JPC A;  2GXB A;  2V1U A;  1IGN A;  3CCE I;  3BR3 A;  4HRI A;  1O7F A;  1QO0 D;  4BEH A;  2M8G X;  1QHH D;  4F92 B;  1K6Y A;  2QSF X;  1RET A;  4AUX A;  4JQF A;  3GF2 A;  1XGN A;  4DZP A;  2JJ7 A;  4F3Q A;  2L54 A;  1RUO A;  4BAC A;  2L2O A;  1TP4 A;  3QYB A;  2E1O A;  3LSG A;  1RC9 A;  3L09 A;  1CF7 B;  4QLC U;  2MC3 A;  2CQK A;  4B8X A;  1J75 A;  2YU9 J;  4IEJ A;  1E3P A;  1G4D A;  3TDZ C;  3I4M J;  2RNJ A;  1YJW I;  1HW5 A;  2VQH A;  1X4P A;  2CSO A;  2DW4 A;  3KE2 A;  3NEU A;  1LVK A;  2P6S A;  4CCJ A;  2GIZ A;  3NWS A;  2MC4 A;  5LRR A;  2NRA C;  3QRF F;  2UUZ A;  2Y9Z A;  1FEX A;  3ASN H;  1NG6 A;  3P9K A;  5DM7 F;  1X1D A;  5LLQ A;  4XRF A;  4M72 A;  3CJT B;  1YX3 A;  2IPQ X;  1YIO A;  4DGW B;  4A69 C;  1W4M A;  5IOY A;  3R4K A;  5TJJ A;  2BW3 A;  1TC3 C;  3T0Y A;  2OD5 A;  3SZG A;  3L00 A;  1BI2 A;  2KIU A;  3VYR B;  1T2K A;  4L9N A;  3QP5 A;  1REP C;  1IDY A;  1TWH J;  3K69 A;  4B1R A;  3J7Z I;  1MH3 A;  3HOT A;  4RBO A;  2V6C A;  2EIM H;  4KYW A;  1PDN C;  3KEO A;  2IP2 A;  2NNY A;  1CGP A;  3LSK A;  5GPA A;  2L5Q A;  4EV0 A;  2VI6 A;  2F5E A;  4CCL A;  3JAM Z;  5LHG A;  1GDT A;  3VPR A;  2CV1 A;  1LEA A;  2JA8 J;  2EPF A;  2ZJR F;  5K7F A;  2PBI A;  3F6V A;  4M74 A;  2QBY B;  4G6Q A;  3WTV C;  3CMM A;  4ENK A;  2CUF A;  1OCT C;  3OYB A;  3CO7 C;  1XDU A;  4A3I J;  1LFB A;  2J5P A;  5J4V A;  2DA3 A;  2GIV A;  2HWV A;  3COA C;  5IY5 H;  2PMU A;  2GXG A;  4C2T A;  2HVR A;  3OYN A;  3BR1 A;  2XRN A;  3DTE A;  4ASN A;  2IW5 A;  1FY7 A;  5J1U A;  1VTN C;  2I8D A;  5D5X B;  2ZNY A;  4JK1 X;  2JA7 J;  2K27 A;  5E79 C;  2F4O B;  3K70 D;  2MFZ A;  3BPV A;  1PP8 F;  3KP3 A;  5M5W J;  2DN0 A;  3PNY A;  1VZ0 A;  5HLT A;  1MBJ A;  5L3B A;  3KYD B;  3FMR A;  2HOS A;  1T38 A;  4BDY A;  2IAI A;  4WXC A;  3TKY A;  4ZDP A;  2VLA A;  2Y0S N;  4M73 A;  3P9C A;  1BJA A;  2YS9 A;  1FOW A;  4XM3 A;  1YRN A;  2W4S A;  4IVN A;  4BNC A;  5AIQ A;  1DUX C;  4A3J J;  4BJT A;  1ORK A;  2V9K A;  3ZOB A;  1MGT A;  3GFI A;  4OU0 A;  4IOA F;  1HDD C;  1UG0 A;  2KJB A;  2ZME A;  3I54 A;  5F0H A;  1ZTR A;  1RRJ A;  4CIC A;  3ABL H;  4HZF A;  4XOR A;  3E7L A;  5LGN A;  1HKT A;  4LK1 F;  4IF4 A;  2BY3 A;  1IRG A;  1PUF A;  2VPR A;  2ZXI A;  5DM6 F;  1JE8 A;  1YX5 A;  1U8B A;  3CCR I;  4RB1 A;  2C6Y A;  1F36 A;  4BQA A;  2VOO A;  2AO9 A;  2DK5 A;  4LLG F;  5CQE A;  4EM2 A;  2F5C A;  2VL8 A;  3KYC B;  2LY9 A;  4XRS A;  3K4L A;  4D1Q A;  1ZGW A;  2LDU A;  2NYX A;  1X2N A;  4C9Y A;  1VQP I;  2I10 A;  3DEE A;  4ETS A;  3K1P A;  4G7H F;  1SD7 A;  1YW8 A;  2O0Y A;  4MFD A;  4F52 A;  1A35 A;  3O8G A;  4BQN A;  3B02 A;  2B7E A;  1R9T J;  3KZY A;  3K1N A;  1IC8 A;  3HUG B;  1D8K A;  3WG9 A;  1DPR A;  4OIQ F;  1BC8 C;  2PJR B;  5CVU A;  1L3L A;  3EUH A;  1T6S A;  2F4M B;  3CJN A;  2HZD A;  2XF7 A;  3M7G A;  1XSD A;  4LLL A;  2HNH A;  3BR5 A;  3CUQ C;  1R1V A;  3OL3 A;  2VE8 A;  5FRN A;  3E97 A;  3BPX A;  1MZB A;  2WV1 A;  3ZRG A;  4CCN A;  1LB2 A;  3JRF A;  3CLQ A;  3DKY A;  3S2D J;  4B48 A;  4Q47 A;  4AID A;  3HC7 A;  5FLV A;  2J5O A;  4L5J A;  1H89 C;  2XB0 X;  2B9S A;  4HX4 A;  4YEL A;  3BJO A;  1R22 A;  3FWE A;  3S1Q J;  5JHU A;  1EH7 A;  4NHJ A;  2ZFW A;  2V1N A;  3IRQ A;  1TWA J;  1WWX A;  4AWX B;  1YHQ I;  1IDZ A;  5GAE J;  1TWC J;  4FX4 A;  4IRG A;  3H9G A;  1WI9 A;  1P92 A;  4A3M J;  2DQR A;  1I3A A;  2M45 A;  1LQ1 A;  2WTE A;  3MZY A;  3U1D A;  3WE2 A;  3C2G A;  3GTG J;  1HA8 A;  3DF8 A;  2CW7 A;  2QWW A;  2COB A;  1BOA A;  3HPG A;  2XSD C;  4HLX A;  3IRR A;  3DU6 A;  1BA5 A;  2W48 A;  4I7H A;  2V9V A;  1QU3 A;  1Y56 A;  2BXZ A;  2F4I A;  3VSK A;  2DA2 A;  2G9W A;  3GME A;  2CW0 F;  2OQR A;  3OYG A;  3FHZ A;  2A69 F;  4XLN F;  3A02 A;  4A93 J;  4E7L A;  3PIP F;  3I0T A;  4E6K G;  2XGC A;  2YU3 A;  2FBI A;  3A0H C;  5HS9 A;  3I59 B;  2BYV E;  4FX0 A;  5H2F C;  5FLX K;  1ZH5 A;  2K85 A;  4PDK A;  3QQA A;  4N4O B;  3K4M A;  1P4W A;  4MHG A;  2FEZ A;  3VDX A;  5IT9 Z;  5HDK A;  1XMX A;  3CZ6 A;  3ABK H;  5GAH J;  3GEZ A;  4A0Y A;  2E71 A;  1DP7 P;  2XC7 A;  1HBX G;  3GTK J;  2KDO A;  2PMZ A;  2X85 A;  2Y0M A;  3MWM A;  4CDG A;  4U88 A;  3WGI A;  2GA2 A;  3HHH A;  1ZR2 A;  2XVC A;  2FXA A;  3BR0 A;  1NH3 A;  2CQN A;  5F08 A;  2A5Y B;  1SAX A;  1LDJ A;  1IN7 A;  4XR6 A;  5DUK A;  5H6Q A;  4DBQ A;  2E35 A;  1XC5 A;  3SYT A;  4BEH B;  5AON A;  3ZN1 A;  3DKW A;  3E0J B;  1U8R A;  1UMQ A;  2Y2Z A;  3MZH A;  2CQX A;  5FRO A;  4E7H A;  5IP6 A;  2WY8 Q;  5LHI A;  1EF4 A;  2RDP A;  2ELK A;  2LOO A;  1VF9 A;  5K5O A;  4BS9 A;  2GLO A;  2Z2S B;  3WE3 A;  2R7R A;  4A3F J;  4IO9 F;  2HEO A;  1F43 A;  2M2E A;  1FT9 A;  2BZT A;  3S15 J;  1Y1V J;  2R7W A;  3PFY A;  3M07 A;  1IRX A;  2IEK A;  4CZC A;  1R58 A;  4HQE A;  3A4C A;  5F0C A;  2OU2 A;  2KIS A;  3TED A;  1KU2 A;  2YX7 A;  2RQQ A;  4KIB A;  1HOM A;  4A6E A;  3JRD A;  4RGU A;  2AS5 F;  4CYC B;  1V4R A;  2ZNZ A;  4A6D A;  3LNQ A;  4A3B J;  2VBY A;  5KAF C;  1Z77 A;  1UB9 A;  3T8R A;  3I5U A;  3IL2 A;  2LY1 A;  2CW8 A;  3PO2 J;  5D8K B;  1FNN A;  2E7W A;  1MMD A;  3HRM A;  3KP6 A;  4ANJ A;  3F8C A;  1WJ5 A;  2K7L A;  2ZC2 A;  1OFC X;  1B8I A;  2D45 A;  3JAM K;  3OIP A;  1JT6 A;  1HC8 A;  1WVR A;  4KA4 A;  5TRD A;  3KLO A;  4M9Z A;  3JRH A;  1X4O A;  5LRS A;  5L3F A;  3H3U A;  3RI4 A;  1EA3 A;  2BVM A;  1RR8 C;  3RKQ A;  1AOY A;  2V26 A;  3CCV I;  1VQL I;  5CLS A;  4F91 B;  4LG0 B;  2LVS A;  1R5I D;  4A3G J;  1GUU A;  4PSW A;  1DPU A;  3QWL A;  2DMQ A;  2ZB9 A;  2Z99 A;  4HV6 A;  4A3D J;  4KN4 X;  5K7Z A;  4I2O A;  3ASO H;  2NS8 A;  4DNC A;  3GTM J;  1A6Q A;  1R7J A;  2JMW A;  3F0C A;  4JX6 A;  3KPH A;  1PJR A;  2RRE A;  3AAF A;  1UHW A;  4QPO A;  4IQ4 A;  3PUF A;  2OQG A;  2QQA A;  3EYI A;  4WXH A;  1U6G A;  3CUQ B;  3S3N A;  4GYG A;  4UV9 A;  2ZCW A;  3T1B A;  3TQN A;  1HSJ A;  1NHA A;  4IHS A;  4HEA 2;  3DPT A;  2P5K A;  3OS1 A;  1KU7 A;  4RS8 A;  4HST A;  3RQ4 A;  1J09 A;  3GTJ J;  1X3Z B;  5IP9 J;  2ME6 A;  4P55 A;  3V8J A;  2R7Z J;  2M87 A;  3D5S C;  1QVU A;  4OMZ A;  4IOC F;  1UG2 A;  2VAS A;  3J81 Z;  1FSE A;  3RPQ A;  1AWC A;  2Q2E A;  4AIH A;  3OV8 A;  5DS9 A;  2R5Y B;  3MQ0 A;  1XB4 A;  1BJZ A;  3BC8 A;  2R92 J;  5D4S A;  1WJB A;  5D5W B;  1U78 A;  2KKO A;  1RNL A;  3HTS B;  3I3L A;  2ISY A;  2DFH A;  3KZI C;  2NS0 A;  3M1E A;  4D5F A;  2VQG A;  4BL0 B;  1PUF B;  3G3Z A;  1TQP A;  1ZKG A;  1JUS A;  1POG A;  2LMD A;  4RAY A;  4J19 A;  3TMO A;  3ZMU A;  2Z16 A;  3AFH A;  1VQ4 I;  1VQ5 I;  3S17 J;  1UHS A;  1ENH A;  1MIJ A;  2KZV A;  4CXF A;  3B73 A;  4DIQ A;  2NVX J;  5EG0 A;  2TRT A;  5J8F A;  3ZQQ A;  1BM9 A;  1W5T A;  3DTI A;  3HRT A;  1O3Q A;  3FXL A;  2JTV A;  2GOM A;  2TDX A;  4O5V A;  5FFX A;  2F5V A;  2V9P A;  5E3L A;  4HDV A;  3FX3 A;  2FBH A;  5HOO A;  4RGX A;  4RLQ A;  1J9I A;  5EJC A;  4XLA A;  3HYI A;  3LSM A;  2XAH A;  1P2F A;  2A68 F;  3P7N A;  4AD9 A;  4B43 A;  1HXD A;  1S29 A;  4EEF G;  3ROU A;  3H3Z A;  2RNG A;  2OUM A;  2XGX A;  1OCR H;  2ISZ A;  4RGR A;  3FKJ A;  3F23 A;  3DQV C;  3FHN A;  4YFX F;  3S32 A;  2Y31 A;  1I6X A;  1D5V A;  2K9M A;  3J80 Z;  1JGS A;  1OCC H;  1PYV A;  1W0U A;  1IRZ A;  3ZQC A;  4IPA A;  1U9N A;  2PMZ N;  5HDN A;  5E1Z B;  1XTA A;  2LBF A;  2FX0 A;  4HOB A;  4N9H A;  1U5T C;  1TL8 A;  3VEP A;  3CCM I;  3DBR B;  4FTH A;  5HVQ C;  3CF2 A;  4XMY A;  4BJ6 C;  1YI2 I;  3R0J A;  4Y7N J;  1G3S A;  4DYR A;  3DKX A;  1ZEL A;  2BE5 F;  3NAR A;  2NVU B;  1KGS A;  5JVT A;  2Q8K A;  4LB6 B;  1VQN I;  4CYD A;  4A12 A;  4AU7 A;  5GAD J;  1IRF A;  2E5N A;  5ILS A;  2JA2 A;  3LWF A;  4AVP A;  1D3Y A;  5CVV A;  3VWB A;  3GO5 A;  2PN6 A;  1U2W A;  1G3T A;  1ETQ A;  3DBL B;  4TV7 A;  2QKM B;  3HHG A;  4GO1 A;  3GYH X;  3LSJ A;  2UXN A;  3BTI A;  1SD4 A;  3W2A A;  1JKO C;  3GTQ J;  3ELK A;  3E6C C;  2O7O A;  2BHY A;  2BVL A;  2HOE A;  2K02 A;  3IWZ A;  3D0S A;  3AG1 H;  3SXY A;  4XNF A;  2CS3 A;  2P6T A;  2QQ8 A;  1YO5 C;  2P5L C;  2OTJ I;  5IT9 K;  4XKW A;  1ZGJ A;  2L7Z A;  4L9T A;  4UXN A;  4BGD A;  4L0Y B;  1OIS A;  4GXO A;  3C18 A;  4PCQ A;  2WY7 Q;  3BRO A;  4DZJ A;  1HDP A;  3A2K A;  3LA2 A;  3CUO A; 
#chains in the Genus database with same CATH homology
 1BI1 A;  5EEH A;  1BIB A;  4RB0 A;  2M30 A;  1IZ1 A;  5E8G A;  2P8T A;  5D4R A;  3ABT A;  2EFO A;  1YYV A;  1GHC A;  3ZMZ A;  5FFZ A;  3Q9S A;  3WU1 B;  1MDM A;  2UXX A;  2UZK A;  2L01 A;  2ADU A;  1S6L A;  1TQM A;  2EA2 A;  1FYM A;  1MJ9 A;  3CDH A;  1IN8 A;  5ILV A;  3TO6 A;  2V1D A;  6PAX A;  5DD8 A;  2DPD A;  3TDU C;  2D1V A;  4XLP F;  2F2E A;  5FO5 A;  2RC4 A;  1Y0U A;  2LSO A;  5JI6 A;  2A61 A;  5ED4 A;  5CJ9 A;  1ZG3 A;  1K7A A;  2MLG A;  3BDD A;  3WOD F;  3R61 A;  4UVA A;  4GGG A;  1F5T A;  2H94 A;  2EV0 A;  3WTW C;  2W85 A;  2EFW A;  4EM0 B;  5LEK A;  1ON2 A;  2O03 A;  4RAZ A;  2WWY A;  2PJP A;  4BXU A;  3M8F A;  2HYG D;  4S05 A;  5F64 A;  2ESN A;  1F1Z A;  1YS6 A;  4L18 B;  1R1T A;  4BYY A;  1G3Y A;  1FBQ A;  2QEN A;  3QOP A;  2DTR A;  1TNT A;  4IXA A;  3LQR A;  5LEJ A;  1RUN A;  1W7P A;  1YFH A;  2HQR A;  5J8C A;  4IHT A;  4RB3 C;  1STZ A;  1OR7 A;  2M8E A;  1KQ9 A;  3EDP A;  5DDG A;  3DEU A;  4UHT A;  2IRF G;  2FA5 A;  1KU3 A;  1U5T B;  4HLY A;  4WCG A;  2JSC A;  4U0Y A;  4PGG A;  2O6G E;  3Q9V A;  1QNT A;  4PZJ A;  5L3G A;  2RN7 A;  1T39 A;  1KU9 A;  2PQ8 A;  2STT A;  3BZ6 A;  2ZXJ A;  2XAF A;  4A0Z A;  1LDK B;  4ESB A;  1B59 A;  1P4A A;  5BPI A;  4EM1 A;  3MAJ A;  4EGY A;  1H9G A;  1FOK A;  4K2E A;  4MEX F;  4ENN A;  2OBP A;  1I27 A;  3F8F A;  1JHF A;  5DYM A;  2JRT A;  4UV8 A;  5D8L B;  2FML A;  4O6J A;  3J7A O;  1TLH B;  2B0L A;  2YX4 A;  1ZRD A;  5BQT A;  4HF1 A;  1LEB A;  4Y17 A;  2OAZ A;  3LAP A;  3K1M A;  3E5X A;  3WGH A;  5JFR A;  4KFC A;  3D5L A;  3L2C A;  2DU9 A;  4ZZD A;  2PI0 A;  4CGZ A;  4UVC A;  2EFN A;  1UCR A;  3K2Z A;  3GX4 X;  3ULQ B;  4LGW A;  1BI0 A;  4M9X A;  3U2R A;  1GVJ A;  4HAM A;  4LB5 A;  3IC7 A;  2CGP A;  4U7B A;  2XIG A;  4ENJ A;  2P5V A;  3FMS A;  4B09 A;  2A6E F;  2X4H A;  2LF7 A;  4HF2 A;  4OMY A;  1BC7 C;  5L3C A;  4H0E A;  3EET A;  1XSX A;  1Q1H A;  3ZMV A;  1ZRE A;  4M9S A;  5K5Q A;  2HKO A;  1HKS A;  2Y48 A;  1OYI A;  1B1B A;  1KYZ A;  3HSR A;  4HYE A;  4HDU A;  1T98 A;  2HTS A;  5CVJ A;  5A2Q Z;  2LKP A;  4IRI A;  3FF5 A;  4QWQ A;  1KQ0 A;  3KET A;  4MTD A;  1R36 A;  1ZGA A;  3GFL A;  5DUI A;  3GFM A;  4JBA A;  4L9J A;  4HX8 A;  3C3W A;  4KIC A;  3GXO A;  2E7X A;  5CYV A;  2RV8 A;  2W57 A;  1LNW A;  4MEY F;  3Q5F A;  2Z3Y A;  3V7S A;  2HYF A;  1RI7 A;  3RPU A;  2Z9O A;  3V8K A;  2QUF A;  1RZ4 A;  5KK1 A;  4RGS A;  4OIO F;  1BIA A;  4U0V A;  2XKP A;  3ML6 A;  3ZQ7 A;  5HDG A;  1S7A A;  4HX7 A;  4P9F A;  5LHH A;  2D2W A;  1J0R A;  3QPT A;  1BBY A;  2VBW A;  2FE3 A;  5DV5 A;  3GLX A;  1P4X A;  3KLN A;  2E1C A;  4N0B A;  4L9V A;  1WKM A;  2L4A A;  2R3S A;  3H92 A;  2MBF A;  1B6A A;  5D6F A;  3SHF A;  4PGH A;  1XGM A;  2GZW A;  1H9T A;  1HST A;  2GWR A;  1FYK A;  1W7P D;  3BY6 A;  1QQI A;  3N4M A;  2EV5 A;  2PLY A;  4ENM A;  1FPQ A;  1BN5 A;  1XN7 A;  1WSU A;  4ESJ A;  3WTY C;  1IXR C;  5F1R A;  3GWZ A;  2KRF A;  3QP6 A;  4G7Z F;  1SD5 A;  2OZU A;  1QPM A;  1R1U A;  1K78 A;  1D8J A;  1XD7 A;  2HGC A;  2HDC A;  2IT0 A;  2VT3 A;  3TO7 A;  3E6D A;  3E3V A;  1CF7 A;  1MJA A;  3PFI A;  2DK8 A;  1YS7 A;  1Z6T A;  4FHT A;  2WC2 A;  3RKY A;  1FYL A;  1ONV A;  1YTY A;  3V4G A;  2FNP A;  3F6O A;  2VC1 A;  1RIO H;  2ZBK A;  2MH2 A;  2G7U A;  2YSR A;  4YFK F;  4I09 A;  5FD5 A;  2XAQ A;  3HTU A;  5D6E A;  2COM A;  2ZME B;  2W84 A;  4IJA A;  2V79 A;  1HKQ A;  2ESH A;  4A5M A;  2O61 A;  2DQL A;  3GVA A;  1T0F A;  3F3X A;  3R6S A;  2XAS A;  2GA1 A;  3REO A;  1B9N A;  1EH8 A;  2FRH A;  4MQ9 F;  4ZZL A;  3F22 A;  4ON0 A;  3LQQ A;  3WTU C;  2QBY A;  2EV6 A;  1S7O A;  1TBX A;  2OA4 A;  3JTH A;  4XSX F;  4MTE A;  4M6Y A;  2GAU A;  2DAO A;  4OIR F;  4DQ2 A;  1A04 A;  4WF2 A;  5L3D A;  1O3R A;  4AIK A;  2IA1 A;  1ZHF A;  4HF0 A;  3JTG A;  3GW2 A;  4ZYE A;  2RGV A;  5FD6 A;  4WWC A;  3JW4 A;  3C7J A;  4Z2Y A;  5DCM A;  1HQC A;  2W24 A;  3FMQ A;  3EYY A;  4MQV A;  2X0L A;  5A2Q K;  4CO8 A;  4EJO A;  2M5W A;  1UST A;  1ZN2 A;  5AIP A;  3RTR A;  1J2X A;  3KP5 A;  2FQ3 A;  3E6B A;  2A3S A;  3P9I A;  1MKM A;  2H6C A;  4GYI A;  3MCZ A;  4ZH4 F;  4Y13 A;  2MLK A;  2A07 F;  2EFQ A;  3V7C A;  3LFK A;  1XCB A;  1R5H A;  1Z9C A;  3HUG A;  4M6X A;  3E6M A;  4YIF A;  5IT3 A;  2R7F A;  1SMY F;  3BJA A;  2FBK A;  2CO5 A;  3VFZ A;  4KN7 X;  2FSW A;  3RKW A;  4BHP A;  4CHU A;  3I53 A;  3O6B B;  1ZRC A;  1B9M A;  1S3J A;  3CTA A;  4WK8 F;  1TNS A;  1QZY A;  4LFU A;  4HA8 A;  2H6B A;  2QM3 A;  5L3E A;  1XGO A;  3DPL C;  1G3W A;  1YG2 A;  2XRO A;  5ERI A;  2BBY A;  1USS A;  1F4K A;  1ODD A;  1ZAR A;  1UFM A;  3M9A A;  4I01 A;  3I64 A;  4BHC A;  5E1W A;  2K4J A;  2L3D A;  3SZT A;  4GCV A;  4HV5 A;  1TTY A;  3I59 A;  1K6O A;  3ECO A;  5JR3 A;  3FZV A;  2M1B A;  5K1Y A;  1FX7 A;  3I71 A;  2P7V B;  3BJ6 A;  3HRS A;  2QQ9 A;  3WTZ A;  1O57 A;  3O3K A;  4F7Z A;  1K78 B;  2PEX A;  2VC0 A;  4Q4Z F;  3DP7 A;  2DPU A;  2H27 A;  2EFP A;  3R60 A;  4OIN F;  1SMT A;  3ISP A;  3T5X A;  4EJW A;  1ZG1 A;  4LJZ F;  3QU6 A;  3DFG A;  3V7R A;  2P7C B;  2F5D A;  3TOB A;  3KP7 A;  1LVA A;  1SD6 A;  3KP4 A;  1QBJ A;  3G73 A;  1WQ2 A;  3LA7 A;  3TO9 A;  3J81 K;  2V1X A;  2KIF A;  5ICE A;  3KCC A;  1KYW A;  3FXU A;  2VXZ A;  1PUE E;  5FB2 A;  3QU3 A;  4ESF A;  3OOP A;  3QAH A;  1OPC A;  4EJU A;  2MH9 A;  4Q5S F;  2QZ8 A;  2HZT A;  4FT8 A;  2D1H A;  1XDS A;  1EV7 A;  1ZLK A;  4YII A;  5E20 A;  3HRU A;  5ICC A;  5BMZ A;  2K4B A;  1QGP A;  3KP2 A;  3RJP A;  3KFW X;  1ZRF A;  3VB2 A;  4MGR A;  3GFJ A;  1E17 A;  5J6X A;  2NNN A;  1Z6R A;  4D0P A;  4CZZ A;  4XBF A;  4ZYG A;  4LG0 A;  1KA8 A;  1GXP A;  2IA0 A;  2L02 A;  2EJR A;  5LGT A;  2BV6 A;  4P96 A;  1FWZ A;  5BOX A;  3J80 K;  2XUB A;  5LBQ A;  3ZPL A;  2VOD A;  3CUQ A;  2VBZ A;  4OIP F;  3LST A;  5BS6 A;  3RDI A;  1FP1 D;  5HLH A;  3IWF A;  3L7W A;  5ICG A;  2LNB A;  4WXD A;  3VOE A;  2KJC A;  4I0A A;  3TOA A;  5DCM B;  3SQN A;  1JHH A;  2CYY A;  3W6J B;  1PP7 U;  3IKV A;  2O3F A;  1TQI A;  3BP8 A;  1HW1 A;  2EB7 A;  1FP2 A;  1XMA A;  3JSP A;  2ZJ2 A;  3LAJ A;  1UHM A;  4LD5 A;  1ZG5 A;  2Z5U A;  5HS7 A;  2CWE A;  1SFU A;  2GQQ A;  3BOQ A;  4M71 A;  1F9N A;  3HIF A;  3FXR A;  1YQA A;  3QPH A;  2YPR A;  2BGC A;  4HBL A;  3F72 A;  3RIR A;  4G94 A;  1I1G A;  4NB5 A;  4G9Y A;  2EA4 A;  4KT5 C;  1FZP B;  1YW7 A;  2DBB A;  3GZ5 A;  1FBS A;  3O2P E;  1IUY A;  4G6D A;  2F5F A;  5DEQ A;  1K79 A;  2YR2 A;  5CVI A;  4Q48 A;  5HS8 A;  1R5G A;  1BI3 A;  4G8X A;  2E1N A;  3MFK A;  1P6R A;  2VN2 A;  1O7L A;  3HSF A;  4WX9 A;  1B4A A;  2AXL A;  1OMI A;  2EWN A;  3WTT C;  1MDM B;  1E2X A;  2ACJ A;  2RQP A;  2P4W A;  1OYW A;  4A5N A;  2MA3 A;  1XSV A;  2CFX A;  5HLG A;  3EQL F;  2XV4 S;  3FM3 A;  3CO6 C;  1LJ9 A;  4P9U A;  4KNY A;  2VBX A;  1ULY A;  3K9T A;  1IN5 A;  3ABU A;  2XHK A;  2KIM A;  4HQM A;  1X3U A;  3SZP A;  5K5R A;  4S04 A;  1IF1 A;  1O3T A;  3DXJ F;  3WTS C;  5FGM A;  4LMY A;  4O3M A;  1Z7U A;  3ZN0 A;  1ON1 A;  3M8E A;  4A2U A;  3T8T A;  5F6F A;  4HW0 A;  3WGG A;  1YLF A;  1MD0 A;  2VE9 A;  1XGS A;  2CG4 A;  3NQO A;  3RKX A;  1IXC A;  2IVM A;  1FLI A;  2HS5 A;  5E18 F;  1W7P B;  4BH9 A;  1I1S A;  2RKH A;  2JT1 A;  2FNA A;  3E5Q A;  1L0O C;  1XCV A;  5DCF A;  2DO7 A;  3JSO A;  1SFX A;  1LDD A;  4BAY A;  3TGN A;  3PQJ A;  4IRH A;  4YG2 F;  4KMU X;  2Q0O A;  4EJT A;  1IW7 F;  5ILU A;  1SFE A;  3BWG A;  5D5U B;  4I0B A;  2K86 A;  3K0L A;  1Z1D A;  2NAZ A;  2RVC A;  3IKT A;  3F8M A;  1R23 A;  3WTX C;  4EJV A;  4UVB A;  3S2W A;  1IXS B;  5EEG A;  3NRV A;  4MNU A;  5E8I A;  5HLI A;  3DV8 A;  5H20 A;  1TW2 A;  2VON A;  2A6H F;  5ICF A;  3CLO A;  3N97 A;  1TW3 A;  4KUM A;  2JZY A;  3GUD A;  3F21 A;  2IJL A;  2HR3 A;  2O8X A;  2WV0 A;  4OOI A;  1FC3 A;  2PG4 A;  1IN4 A;  1U5T A;  3IHU A;  4LLN A;  2BEO A;  2DFI A;  3PQK A;  2HFH A;  3V8L A;  3I4P A;  2ETH A;  1YW9 A;  4EMS A;  3C1D A;  2VOP A;  1JXS A;  1G6N A;  4R79 A;  4BHB A;  3HOS A;  3F8B A;  4L5I A;  1IAW A;  1H0M A;  3U9G A;  1S8N A;  3ERE D;  4E70 A;  3GZ6 A;  2FU4 A;  2HKX A;  2Z33 A;  1FBU A;  2XAG A;  1Z05 A;  4UUV A;  3KZZ A;  1O3S A;  2STW A;  4EQQ A;  2ELH A;  4I02 A;  2G7H A;  4G7O F;  1V3F A;  5BPD A;  1ZYR F;  3RYP A;  4R1H A;  3E5U A;  3LA3 A;  4KIG A;  4L0Z B;  4P5O A;  5LGU A;  3R0A A;  2FF4 A;  4KIF A;  1WRJ A;  1J7K A;  2IA2 A;  1OYY A;  3SFZ A;  4XSZ F;  2QQB A;  1FSH A;  3ECH A;  2L4M A;  3F8N A;  1C0W A;  1Z91 A;  4A0X A;  1OKR A;  5H6R A;  1R00 A;  1XMK A;  4EVI A;  4R8H A;  2VT2 A;  5D5V B;  3RYR A;  1QZZ A;  3ZMS A;  3KEQ A;  1W5S A;  4U0W A;  3I58 A;  5E17 F;  1GXQ A;  2HTJ A;  5KVR A;  5CVR A;  4ZYD A;  2XKO A;  1KQ8 A;  4KDP A;  3HSE A;  4LK0 F;  2ZKZ A;  2ZO4 A;  4EGZ A;  1DDN A;  1J59 A;  2QVO A;  3ZP5 A;  2OZ6 A;  4UNO A;  2H09 A;  2EK5 A;  2Y75 A;  4N9I A;  1I5Z A;  4YFN F;  2PFB A;  2FMY A;  3FM5 A;  2FOK A;  2DI3 A;  2XAJ A;  4AIJ A;  5DD4 A;  2LF8 A;  2UWM A;  2DLL A;  3FXQ A;  3L9F A;  2MD5 A;  4I98 B;  1IN6 A;  2JPB A;  1MJB A;  3ZMT A;  4RB2 C;  1J5Y A;  1HW2 A;  2QYO A;  4Y15 A;  2R7D A;  2PMH A;  1ZLJ A;  2DT5 A;  1U3E M;  4KMF A;  2W25 A;  3VOD A;  5FLX Z;  4ZYH A;  4NQW A;  4U7D A;  3ZMD A;  3W6K B;  5E1X A;  3MEX A;  2QLZ A;  3WU0 A;  1ZAO A;  2HQN A;  2GXB A;  1EH6 A;  2JPC A;  2V1U A;  1O7F A;  1QO0 D;  4JQF A;  3GF2 A;  1XGN A;  2L54 A;  1RUO A;  1CF7 B;  3L09 A;  4QLC U;  2MC3 A;  2CQK A;  4B8X A;  1J75 A;  1G4D A;  3TDZ C;  2RNJ A;  1HW5 A;  2CSO A;  2DW4 A;  3KE2 A;  3NEU A;  2P6S A;  5LRR A;  2NRA C;  3QRF F;  3P9K A;  5LLQ A;  4XRF A;  4M72 A;  2IPQ X;  1YIO A;  1W4M A;  3R4K A;  5TJJ A;  3T0Y A;  2OD5 A;  3L00 A;  1BI2 A;  2KIU A;  1T2K A;  4L9N A;  3QP5 A;  1REP C;  3K69 A;  3HOT A;  2V6C A;  4KYW A;  1PDN C;  3KEO A;  2IP2 A;  2NNY A;  1CGP A;  4EV0 A;  2F5E A;  3JAM Z;  5LHG A;  1LEA A;  2PBI A;  3F6V A;  4M74 A;  2QBY B;  4G6Q A;  3WTV C;  4ENK A;  3CO7 C;  1XDU A;  2J5P A;  2GIV A;  2HWV A;  3COA C;  2PMU A;  2GXG A;  2XRN A;  4ASN A;  2IW5 A;  1FY7 A;  1VTN C;  5D5X B;  2ZNY A;  4JK1 X;  2K27 A;  3BPV A;  1PP8 F;  3KP3 A;  5L3B A;  3FMR A;  1T38 A;  4WXC A;  3TKY A;  4M73 A;  3P9C A;  1BJA A;  4IVN A;  4BNC A;  5AIQ A;  1DUX C;  1MGT A;  3GFI A;  4OU0 A;  2KJB A;  2ZME A;  3I54 A;  4CIC A;  4HZF A;  5LGN A;  1HKT A;  4LK1 F;  4IF4 A;  1IRG A;  1JE8 A;  4RB1 A;  2C6Y A;  4BQA A;  2VOO A;  2DK5 A;  4LLG F;  4EM2 A;  2F5C A;  2LDU A;  2NYX A;  4ETS A;  3K1P A;  4G7H F;  1SD7 A;  1YW8 A;  2O0Y A;  3B02 A;  3KZY A;  3K1N A;  1D8K A;  3WG9 A;  1DPR A;  4OIQ F;  1BC8 C;  5CVU A;  1L3L A;  3EUH A;  1T6S A;  3M7G A;  3CJN A;  1XSD A;  4LLL A;  3CUQ C;  1R1V A;  2VE8 A;  3E97 A;  3BPX A;  1MZB A;  1LB2 A;  4Q47 A;  2J5O A;  4L5J A;  4HX4 A;  3BJO A;  1R22 A;  3FWE A;  5JHU A;  1EH7 A;  4NHJ A;  2ZFW A;  3IRQ A;  1WWX A;  4AWX B;  4FX4 A;  4IRG A;  1WI9 A;  1P92 A;  2DQR A;  2M45 A;  1LQ1 A;  2WTE A;  3MZY A;  3U1D A;  3WE2 A;  3DF8 A;  2QWW A;  1BOA A;  4HLX A;  3IRR A;  4I7H A;  2V9V A;  2G9W A;  2CW0 F;  2OQR A;  3FHZ A;  2A69 F;  4XLN F;  3I0T A;  2YU3 A;  2FBI A;  5HS9 A;  3I59 B;  2BYV E;  4FX0 A;  5FLX K;  1ZH5 A;  4PDK A;  1P4W A;  4MHG A;  2FEZ A;  5IT9 Z;  5HDK A;  3GEZ A;  4A0Y A;  1DP7 P;  1HBX G;  4CDG A;  2Y0M A;  3MWM A;  4U88 A;  3WGI A;  2GA2 A;  3HHH A;  2XVC A;  2FXA A;  2A5Y B;  1SAX A;  1LDJ A;  1IN7 A;  5H6Q A;  5DUK A;  5AON A;  3ZN1 A;  3DKW A;  1U8R A;  3MZH A;  5LHI A;  2RDP A;  5K5O A;  3WE3 A;  2HEO A;  1FT9 A;  1R58 A;  4HQE A;  2OU2 A;  1KU2 A;  2YX7 A;  4KIB A;  4A6E A;  4RGU A;  2AS5 F;  1V4R A;  2ZNZ A;  4A6D A;  2VBY A;  1UB9 A;  3T8R A;  3I5U A;  3IL2 A;  5D8K B;  1FNN A;  2E7W A;  3HRM A;  3KP6 A;  3F8C A;  2K7L A;  2D45 A;  3JAM K;  4KA4 A;  5TRD A;  3KLO A;  4M9Z A;  5LRS A;  5L3F A;  3H3U A;  3RI4 A;  1AOY A;  5CLS A;  4LG0 B;  1DPU A;  2Z99 A;  4HV6 A;  4KN4 X;  4I2O A;  4DNC A;  1R7J A;  3AAF A;  1UHW A;  2OQG A;  2QQA A;  3EYI A;  4WXH A;  1U6G A;  3CUQ B;  4GYG A;  4UV9 A;  2ZCW A;  3T1B A;  3TQN A;  1HSJ A;  1NHA A;  4IHS A;  3DPT A;  2P5K A;  1KU7 A;  4RS8 A;  4P55 A;  3V8J A;  2M87 A;  4OMZ A;  3J81 Z;  1FSE A;  3RPQ A;  1AWC A;  2Q2E A;  4AIH A;  3OV8 A;  3MQ0 A;  1XB4 A;  5D4S A;  3HTS B;  5D5W B;  1U78 A;  2KKO A;  1RNL A;  2ISY A;  3M1E A;  2NS0 A;  3G3Z A;  1TQP A;  4RAY A;  3ZMU A;  4CXF A;  3B73 A;  5J8F A;  1BM9 A;  1W5T A;  3HRT A;  1O3Q A;  2JTV A;  4O5V A;  2TDX A;  5FFX A;  4HDV A;  3FX3 A;  2FBH A;  5HOO A;  4RGX A;  1J9I A;  3HYI A;  3P7N A;  2XAH A;  1P2F A;  4AD9 A;  2A68 F;  1HXD A;  1S29 A;  3ROU A;  3H3Z A;  2XGX A;  2ISZ A;  4RGR A;  3F23 A;  3DQV C;  4YFX F;  1I6X A;  1D5V A;  3J80 Z;  1JGS A;  4IPA A;  5HDN A;  5E1Z B;  4HOB A;  4N9H A;  1U5T C;  3VEP A;  5HVQ C;  3R0J A;  1G3S A;  2BE5 F;  1KGS A;  5JVT A;  2Q8K A;  4LB6 B;  4CYD A;  4A12 A;  1IRF A;  5ILS A;  3LWF A;  4AVP A;  1D3Y A;  5CVV A;  3GO5 A;  2PN6 A;  1U2W A;  1G3T A;  4TV7 A;  3HHG A;  4GO1 A;  3GYH X;  2UXN A;  1SD4 A;  3ELK A;  3E6C C;  2HOE A;  3IWZ A;  2K02 A;  3D0S A;  3SXY A;  2P6T A;  1YO5 C;  2P5L C;  5IT9 K;  1ZGJ A;  4L9T A;  4UXN A;  4L0Y B;  4GXO A;  3C18 A;  4PCQ A;  3BRO A;  3LA2 A;  3CUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...