2HZTA

Crystal structure of a putative hth-type transcriptional regulator ytcd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
95
Chain Sequence
b'MSLVEATLEVIGGKWKVILHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLAWGANHINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator ytcD
publication title Crystal Structure of a putative HTH-type transcription regulator ytcD
rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 23
structure length 95
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hztA00
3J80Z 4MQVA 1IUYA 4EVIA 2OU2A 4P9UA 2EJRA 3JAMK 2HS5A 1TNTA 5D4RA 3TKYA 1R23A 4Y13A 1JHHA 1CF7B 3BPVA 2JT1A 3CJNA 3IWFA 4EM0B 3ECOA 3VOEA 3C18A 1YW7A 4HX8A 3G73A 2IA0A 3KLNA 1H0MA 4A0XA 1D3YA 2BYVE 4RB3C 2O61A 2O03A 2E7XA 2X4HA 5H20A 2J5PA 2ZJ2A 1HSJA 2V9VA 2ACJA 3WTXC 3DP7A 2HKOA 3LQQA 2OQGA 2HYGD 4ESBA 2M45A 4HQMA 5CVUA 4M9SA 4BH9A 4FX0A 1ZG3A 4A0ZA 5JVTA 4EJTA 1U5TA 1YYVA 4U0WA 1KYZA 4MGRA 4ON0A 1WSUA 1T6SA 3EYIA 4HBLA 1Y0UA 5CJ9A 2VBYA 2OA4A 3P9IA 2ZCWA 2K27A 3SZTA 1DPRA 2CW0F 4PGHA 4KIBA 4P9FA 4LK1F 1FBQA 1XGOA 2Y48A 1YW9A 1FPQA 2ADUA 2HFHA 2M87A 4FT8A 4A6EA 4ASNA 1OPCA 2W24A 3IKVA 1BOAA 3DEUA 1P2FA 1Z1DA 4EGZA 2L01A 4I09A 3SZPA 1R58A 1J59A 4RAZA 5CVIA 1XDUA 2DQLA 1RUOA 4LGWA 4MEYF 4ZZLA 5D6FA 5JI6A 2GXBA 1T39A 3OOPA 1IN5A 1TTYA 2V79A 5LHHA 3JSOA 1J5YA 5E8IA 5DDGA 3R6SA 5ILVA 1YO5C 1FYKA 4GYGA 4F7ZA 2ELHA 3V7RA 1MD0A 2Y75A 3D5LA 3BPXA 3Q5FA 5ERIA 3QU3A 4LB6B 1Z9CA 5HOOA 2Z9OA 4ESJA 1QZZA 5LRRA 3TQNA 2JPBA 1FX7A 2FA5A 1XCVA 5FLXZ 1G3SA 1IXSB 3P7NA 2XKPA 3AAFA 2ESHA 4WXDA 1Z6TA 1FYMA 4HZFA 3ZMTA 3NRVA 3HRUA 2G7UA 1R5HA 4KUMA 4IPAA 4LJZF 1S7AA 1RIOH 1WRJA 2GQQA 5ICGA 1ZG1A 2A61A 2FBIA 3ROUA 1V3FA 5DEQA 1BIAA 1J9IA 3GUDA 4KA4A 4CDGA 4YG2F 4M74A 4BNCA 2L54A 1T98A 2O8XA 2EA2A 4S04A 1BI1A 3GO5A 1T2KA 1FBSA 1LDKB 4N9IA 1OR7A 3QAHA 1MJAA 1Z7UA 4XSXF 3I53A 4HDVA 4ZH4F 2G7HA 1KQ0A 3I64A 1FT9A 2RVCA 1TQIA 1XGSA 2BBYA 2IJLA 1R36A 4GCVA 4QLCU 3KP3A 1ZRFA 2RC4A 2GIVA 1JGSA 3FZVA 3K1PA 1K7AA 3QPTA 4P55A 1HW5A 4EJOA 3V4GA 4OU0A 3RYPA 3GFMA 1K79A 1GXPA 4BQAA 5K5QA 5DCMA 2MBFA 1FSEA 5K5RA 2EWNA 2MA3A 5ILSA 1O3RA 1LEAA 2UXXA 3E5UA 2OQRA 2PEXA 1BI2A 1FP2A 3F8BA 3WE3A 2FSWA 2VXZA 3K1MA 2VT3A 2LNBA 2KKOA 3S2WA 2W25A 5D6EA 4EJVA 1B6AA 5L3CA 1FBUA 3J80K 1PP7U 3K2ZA 5LRSA 1B4AA 4ENMA 4KICA 4GO1A 1E17A 2WWYA 3O6BB 1G3WA 3L00A 1W7PA 5CYVA 3COAC 2B0LA 2FNAA 4EJWA 2CQKA 3I0TA 5HLIA 4ENKA 3K0LA 4KMUX 3GX4X 5IT9Z 2ISZA 4HYEA 4RB1A 4KIGA 1U5TC 2YPRA 2RDPA 3KP6A 2G9WA 2X0LA 1D8KA 5DYMA 3F22A 3TOAA 1HQCA 1QNTA 4R1HA 5ED4A 1J2XA 2VC0A 3FMRA 2MD5A 5FD5A 1ZARA 2GWRA 3R60A 2PJPA 1R7JA 3R4KA 3JTGA 3KZZA 4OOIA 2RNJA 4UNOA 3F72A 5L3EA 4KT5C 3CTAA 3I59B 1H9TA 5L3FA 3GF2A 2MH2A 4OIRF 2FOKA 1KQ9A 1OKRA 4MEXF 1U6GA 3K9TA 3LFKA 2Q0OA 4ESFA 2L4MA 4I2OA 3BZ6A 1GHCA 3I5UA 1GXQA 2WTEA 4HAMA 2IA2A 3U2RA 2DAOA 2F2EA 4Y17A 1SD7A 2D1HA 5DCFA 3W6KB 4CGZA 1FP1D 2QWWA 3IL2A 2ZNYA 1QBJA 2P4WA 4YFNF 2NNNA 1XN7A 2Z5UA 4CO8A 3HRMA 1FWZA 5HS8A 1SAXA 3O2PE 4I02A 1CGPA 3KP5A 1YQAA 3RKYA 5BMZA 1O7FA 2KRFA 1PP8F 2EB7A 4UVBA 5J8CA 2XROA 2Z99A 1W7PD 1WQ2A 3VB2A 3LQRA 1FSHA 3WU1B 3EETA 4O6JA 1TBXA 5DV5A 5BPIA 1ZHFA 5L3GA 1YS6A 2VC1A 1P6RA 3GEZA 5DD8A 3ZMZA 4UHTA 4KNYA 4AIHA 1MDMA 3ABTA 2HGCA 4YIIA 1Q1HA 2XVCA 1B1BA 1YTYA 2EFNA 2LSOA 1IAWA 2F5CA 1KQ8A 1LDJA 5HDKA 2VE9A 5FLXK 2DT5A 3PQJA 5HS9A 5H6QA 4AIJA 2YX7A 2W57A 1SD6A 1XSVA 4HF0A 1RZ4A 4LD5A 3V7SA 4NQWA 2XAQA 3E5XA 1O3SA 1MJBA 2P5LC 3GYHX 3MZHA 4XSZF 3N97A 2KIMA 2RN7A 3I4PA 3WTWC 1U2WA 3FXRA 1J75A 1V4RA 2VOOA 4QWQA 1IF1A 2HDCA 2PFBA 2DK5A 2QZ8A 3F21A 1UHMA 3WGGA 2D45A 1STZA 3BJAA 4JK1X 3EUHA 3J81Z 1F9NA 2XAJA 3F8CA 1ZGJA 4HX4A 1OYWA 3C7JA 4M73A 2NS0A 4A5NA 5J6XA 3HOSA 3E6DA 4HQEA 2HYFA 1AWCA 5EEGA 2YR2A 5E20A 2L4AA 3KCCA 3RDIA 1EH6A 3IRRA 1O3TA 4G7ZF 3E5QA 2ZKZA 4CYDA 1U5TB 3M8FA 2HQNA 3V8KA 4Q47A 1K6OA 4LG0A 4CZZA 5ICCA 4M6XA 3E6BA 3T0YA 1YFHA 2XKOA 3BOQA 3HSFA 3HRTA 3ZPLA 1BI3A 3RJPA 3C1DA 1HBXG 2XIGA 3ABUA 5E8GA 1IXRC 2PG4A 1LEBA 1TQMA 5F6FA 2BGCA 4AIKA 3HSRA 2EV5A 2OZUA 1WI9A 4JQFA 3MWMA 4O3MA 2K4JA 3TO6A 1JE8A 2M5WA 5KVRA 1HW1A 2QQAA 2ZMEA 5LGUA 1HKQA 1LNWA 3B02A 5D5UB 2FF4A 1W5SA 2DU9A 1W5TA 2JZYA 4L9TA 1FY7A 4GXOA 4JBAA 1ZLKA 1XGMA 1HSTA 3MQ0A 3KP4A 4R79A 4XLPF 3DPTA 3R0AA 4KFCA 3LA7A 1XD7A 2F5FA 2FMLA 5LBQA 5LHIA 1SFUA 5IT9K 5IT3A 3FX3A 5D5WB 4IXAA 4RB2C 4U7DA 2GA1A 2A6EF 1UB9A 3M1EA 2D2WA 5BQTA 2O0YA 1ZN2A 1XCBA 1YW8A 3DFGA 4ZYDA 1Z91A 3RI4A 3GW2A 3HHHA 3IHUA 5L3DA 5E1WA 2K7LA 4A0YA 2ZFWA 1MKMA 3BP8A 4KDPA 3M7GA 2KIFA 4IF4A 3EYYA 2OD5A 2QBYA 3FWEA 2FE3A 4HF2A 4Q4ZF 3ML6A 4MTEA 2HTJA 3JTHA 1XGNA 3U1DA 4LLGF 2VN2A 2ZBKA 1JXSA 4MTDA 2MC3A 4K2EA 5F64A 2LF8A 1SFXA 1Z05A 3NQOA 2J5OA 1S6LA 4ETSA 4KMFA 1U3EM 4RGRA 3SFZA 1D5VA 4I01A 3R61A 5D8KB 4RB0A 3RKWA 3WE2A 2XUBA 1FYLA 3VFZA 3CLOA 3L2CA 1RI7A 4P5OA 2LDUA 4IJAA 3KZYA 1O57A 4YFKF 5BOXA 3QRFF 2Q2EA 1KU7A 1F5TA 5FFZA 1TQPA 4M9ZA 4ZYHA 5HLHA 1ZRDA 3WTYC 2UXNA 4Q48A 1XMAA 2QLZA 1P4AA 3G3ZA 4BXUA 4WXHA 2P8TA 1IN4A 3WGIA 2ISYA 2HOEA 1G3TA 5BS6A 3LA2A 1U78A 1DP7P 2VT2A 2K4BA 5DCMB 3EQLF 3TOBA 5K1YA 4AD9A 4L5JA 3M9AA 5HDGA 2JRTA 2O6GE 3TO7A 4A6DA 5DD4A 5EEHA 2Q8KA 2D1VA 4G7OF 2Y0MA 2NNYA 5HS7A 1BC8C 3VODA 2QQBA 5FO5A 2F5EA 3RIRA 4PGGA 1ODDA 2JPCA 2YSRA 4HX7A 2P5KA 2FQ3A 2CFXA 4EGYA 2IT0A 3CUQA 2Z33A 1W7PB 4ZYEA 1C0WA 2RGVA 2HEOA 1ON1A 2FRHA 3J81K 3RYRA 1TNSA 3P9KA 2PI0A 1JHFA 1KU2A 3E3VA 3LSTA 1QO0D 1R22A 3T5XA 3KE2A 2IVMA 4N9HA 1XB4A 4CICA 4XRFA 3F6VA 3FMSA 2VODA 3KP7A 1XSXA 1S29A 2CSOA 2OZ6A 4HA8A 4BAYA 3H92A 4ZYGA 2FBHA 2V1UA 1ZGAA 3DF8A 4G9YA 1Z6RA 3J7AO 2L02A 1ZAOA 3RKXA 3BJ6A 1ZRCA 1BC7C 3V8JA 4HF1A 4LB5A 4BHPA 1U8RA 4IHSA 5E1ZB 5CVJA 3GFJA 4OMYA 1XDSA 2CYYA 5LGTA 4N0BA 3HOTA 1ZLJA 4FHTA 4KN7X 2DW4A 3PFIA 1UHWA 2EFQA 4I0BA 2A69F 1X3UA 4LK0F 5CVVA 1LVAA 3QOPA 4I98B 4BYYA 4MQ9F 5FGMA 3EDPA 5F1RA 2NYXA 2LF7A 3TDUC 3RPUA 4HV6A 3BJOA 5E1XA 5K5OA 1MDMB 4I7HA 3K69A 1ZG5A 3W6JB 5CVRA 1H9GA 1SMYF 4BHBA 3I58A 3HIFA 2HR3A 4RAYA 1MZBA 3CUOA 4M71A 5TJJA 3KFWX 2P5VA 2H09A 3NEUA 4EJUA 2VOPA 2A68F 2XGXA 1TW2A 5E17F 2V6CA 3FXUA 2QM3A 3E6MA 4EMSA 4TV7A 1PUEE 1MGTA 1SFEA 2DBBA 4EQQA 2E1CA 1HKTA 3L7WA 4UVCA 1L3LA 2GZWA 4R8HA 2JTVA 1D8JA 5TRDA 4HV5A 2ZO4A 4WK8F 4EV0A 4L18B 2L3DA 4WF2A 3WTUC 3MEXA 1KGSA 2GXGA 6PAXA 4AVPA 4IVNA 3MCZA 2FEZA 2STTA 2H94A 3WTZA 3R0JA 3TGNA 2K02A 2DPUA 4WWCA 1EV7A 5D8LB 5D5VB 3F8FA 4RGXA 3I71A 1S3JA 3SXYA 4YIFA 5AIQA 5LEKA 2KJBA 1O3QA 2STWA 3ISPA 4LG0B 1DPUA 1FC3A 5DUIA 5HLGA 1LQ1A 4WXCA 1YG2A 3GZ6A 4CHUA 2IA1A 4UV8A 4MHGA 5JHUA 3WU0A 4LMYA 3O3KA 4UXNA 1ULYA 1S7OA 4WCGA 1I27A 1KA8A 2F5DA 1LB2A 1E2XA 4Z2YA 1QPMA 4RGUA 2FU4A 3OV8A 4NB5A 3ZN1A 4G6QA 2CO5A 3FXQA 4HOBA 3T8RA 2AXLA 3P9CA 1YLFA 1KU9A 3LAPA 2ZMEB 1F1ZA 2XAFA 4M72A 3FHZA 3CUQC 2DPDA 4ENJA 1O7LA 1QGPA 1QQIA 4U0VA 2ETHA 1IZ1A 2P6TA 2CWEA 3V7CA 5A2QK 4KN4X 4S05A 3QP6A 5KK1A 4H0EA 3DPLC 3N4MA 3DQVC 5JFRA 3WGHA 1L0OC 2FXAA 4OIQF 2BEOA 4PDKA 3QPHA 3DXJF 3FF5A 3ECHA 2A07F 2HKXA 3L09A 1BI0A 2HZTA 4OIOF 1G6NA 1CF7A 3FM3A 5FFXA 4PCQA 4U88A 1R1UA 4G6DA 2EA4A 2ZXJA 4KYWA 4MNUA 3F23A 3M8EA 2IP2A 5AIPA 4IHTA 1KU3A 3QU6A 3HUGA 4U0YA 2H6CA 2EFPA 5JR3A 1XMKA 2QBYB 1GVJA 3B73A 2OBPA 1I5ZA 4OIPF 3REOA 2FNPA 1VTNC 2P7VB 1PDNC 1J0RA 4KIFA 1ZH5A 4NHJA 2AS5F 2HWVA 1EH7A 3E97A 4ZZDA 3ZQ7A 3LA3A 1G4DA 1BN5A 3T1BA 1R5GA 3CDHA 2V1XA 2RV8A 2CG4A 2WV0A 4UUVA 3WTTC 3JW4A 3RPQA 3F8NA 3MFKA 1UCRA 4OINF 1MJ9A 1R00A 3TO9A 4ENNA 2DQRA 2W85A 4L9VA 3SHFA 2MH9A 2EK5A 1HKSA 1BJAA 1IRGA 1G3YA 1OYYA 2K86A 1F4KA 3VEPA 1P4WA 5L3BA 5E18F 1XSDA 1IXCA 3K1NA 3C3WA 4RGSA 4DNCA 3PQKA 2FMYA 2TDXA 1ZYRF 1P92A 2IPQX 2XAHA 4AWXB 3IWZA 3WG9A 5HDNA 3F3XA 3KEOA 4G94A 2IW5A 1QZYA 1LDDA 3GVAA 1EH8A 4XBFA 1K78B 3BROA 5D4SA 3F8MA 4EM2A 2KIUA 2BV6A 2QUFA 3L9FA 1ON2A 3HRSA 5DUKA 2WC2A 1SD4A 3HSEA 3LAJA 5LHGA 3F6OA 3CUQB 3HHGA 4Y15A 4DQ2A 5FB2A 4Q5SF 1R1TA 2C6YA 1WKMA 2PMUA 3JAMZ 1OYIA 3FMQA 1YS7A 1B9NA 4XLNF 4EM1A 4U7BA 1K78A 2RQPA 2NRAC 1KYWA 5ILUA 3GWZA 1A04A 3ERED 5A2QZ 2M8EA 2A5YB 3MZYA 4YFXF 1ZREA 4L0YB 2IRFG 1WWXA 4D0PA 2MLKA 3Q9VA 2RKHA 3I54A 2CGPA 1S8NA 2H6BA 2HTSA 3KP2A 4P96A 2Z3YA 2R7FA 4RS8A 3GXOA 3IRQA 4M9XA 4HLYA 2H27A 3WODF 4HLXA 4O5VA 4PZJA 1NHAA 5HVQC 2XV4S 5ICFA 2EV0A 5J8FA 3HTSB 1IN8A 1IN7A 4OMZA 1DDNA 1USTA 2ZNZA 3JSPA 3IKTA 1BBYA 4IRHA 3GFIA 4LLNA 2QVOA 3QP5A 2JSCA 1T0FA 4IRIA 2ESNA 2QQ9A 2HQRA 2VE8A 2QENA 1OMIA 4LFUA 3WTSC 2UZKA 1IRFA 5FD6A 4L9NA 3GFLA 2A3SA 2DLLA 3ZMDA 2COMA 3ZMSA 2PMHA 3V8LA 2P7CB 3SQNA 2EFWA 2EFOA 3T8TA 1SMTA 4WX9A 2DI3A 4FX4A 2XRNA 2M1BA 5D5XB 1FZPB 3MAJA 4GGGA 3H3ZA 1TW3A 4B8XA 2P6SA 3KETA 3ELKA 1UFMA 1T38A 4A5MA 2R7DA 1J7KA 1FLIA 3LWFA 2QYOA 4B09A 3E6CC 1R1VA 1TLHB 4L9JA 3HYIA 3RTRA 4HW0A 1I1GA 3WTVC 2A6HF 3D0SA 2LKPA 4IRGA 1IN6A 2E1NA 3ZMUA 3DV8A 2YX4A 3H3UA 2XHKA 5LGNA 3U9GA 2DTRA 2DO7A 1I1SA 3GLXA 3I59A 3HTUA 2E7WA 3KLOA 4G8XA 1B59A 4G7HF 2BE5F 3Q9SA 2O3FA 2MLGA 5LEJA 4E70A 2YU3A 2KJCA 4A12A 1BM9A 1IW7F 3ZMVA 2GAUA 2R3SA 3ZP5A 3BWGA 2PQ8A 4UV9A 3TDZC 3BY6A 2VONA 3FM5A 2XASA 2UWMA 1YIOA 5BPDA 1P4XA 2DK8A 1I6XA 1W4MA 2OAZA 4GYIA 2PN6A 2EV6A 3CO7C 4CXFA 1USSA 5ICEA 5AONA 3BDDA 2W84A 1RNLA 3CO6C 3GZ5A 5LLQA 3DKWA 1ONVA 4LLLA 2DFIA 2PBIA 4HDUA 1DUXC 1REPC 5H6RA 1HW2A 1BIBA 1FNNA 3ZN0A 4UVAA 2XAGA 1HXDA 1AOYA 1FOKA 1SD5A 4BHCA 2M30A 4L0ZB 1B9MA 2GA2A 2PLYA 4A2UA 2VBZA 4L5IA 5CLSA 4M6YA 3ULQB 2VBXA 4I0AA 1LJ9A 2V1DA 3IC7A 2VBWA 3KEQA 1RUNA 2NAZA 2FBKA
chains in the Genus database with same CATH superfamily
2E2HJ 2XSJC 3M8JA 3J80Z 4MQVA 3QYBA 1IUYA 4I6ZA 4EVIA 2OU2A 4P9UA 3BR1A 2EJRA 3JAMK 3OSFA 1FTTA 2HS5A 1TNTA 5JHFA 5D4RA 3TKYA 1R23A 4Y13A 2W7NA 3ZQGA 1B8IB 1JHHA 1U0JA 1H88C 4Y4RA 1CF7B 3BPVA 2JT1A 1ETOA 3CJNA 3IWFA 4NC6A 4EM0B 3ECOA 3VOEA 2BY2A 3G71I 1E3HA 2OCCH 3H35A 3C18A 1YW7A 4HX8A 3ZR8X 2CUFA 3G73A 2IA0A 3KLNA 5EGOB 3A01B 1IO2A 2G0EA 1GLNA 4BBRJ 1JUPA 1H0MA 4A0XA 2HVRA 2IS1A 1D3YA 1QPIA 2DXIA 1UZCA 3IUOA 2ME6A 2BYVE 2FQ4A 4RB3C 2O03A 1K6YA 2E7XA 2X4HA 4M3FA 1JJ8C 5H20A 4IQJA 1WVRA 2J5PA 1X3ZB 2ZJ2A 2DA2A 3A4CA 1HSJA 3KIOA 3HUGB 2F4MB 1IUFA 2VXDA 2V9VA 2ACJA 1EF4A 3WTXC 2LY9A 3DP7A 3PIOF 1NH3A 2I5UA 3IP4B 2HKOA 1WJBA 3BG6A 3DWLE 3S1MJ 4BDYA 3LQQA 2OQGA 2HYGD 4ESBA 2M45A 4HQMA 5CVUA 5J4VA 3OIQA 4M9SA 4BH9A 4FX0A 1ZG3A 4C9YA 4XLCA 1E3OC 4A0ZA 2CFOA 5JVTA 4EJTA 1U5TA 2UUZA 1MBFA 2E35A 1YYVA 3DU5A 4U0WA 1KYZA 4MGRA 5EGOA 4ON0A 3CC7I 1TZLA 3CDLA 5EEAA 1WSUA 1T6SA 3DBHB 4YRVA 3EYIA 4HBLA 3D5SC 1Y0UA 2W48A 5CJ9A 4BXFA 2VBYA 2OA4A 2R7QA 3O8HA 3P9IA 2E71A 4ANJA 1ETYA 2ZCWA 2K27A 4ZTJA 3SZTA 1DPRA 2CW0F 3EPZA 4DZJA 3AG4H 4PGHA 4KIBA 4P9FA 4LK1F 4PJNA 5E79C 1FBQA 1XGOA 2Y48A 2R7TA 1MMAA 1YW9A 1FPQA 2ADUA 2HFHA 2M87A 1RKTA 4FT8A 3SJMA 2BHZA 2TCTA 2XC7A 4A6EA 3M1CA 4ASNA 4E7LA 2DFEA 1WJ5A 4XOPA 1OPCA 2W24A 3C2HA 3IKVA 3H1CA 3S14J 1BOAA 3DEUA 1P2FA 1Z1DA 2X1EA 1I39A 3L2VA 2L01A 4EGZA 3JR9A 2DA4A 4I09A 3SZPA 1ZGWA 1R58A 2OF7A 3K4LA 2BY3A 1J59A 4RAZA 1N75A 4LG3A 5CVIA 1XDUA 2DQLA 2LFBA 1RUOA 3KZIC 1DU6A 4LGWA 3D5RC 4MEYF 1FMWA 4ZZLA 4KISA 1IDZA 5KAFC 3BTIA 3BR0A 5D6FA 4AIDA 2KFDA 5JI6A 3GTGJ 2LMDA 2GXBA 1T39A 2HNHA 3OOPA 1IN5A 1TTYA 2DA1A 2V79A 5LHHA 1JKQC 3JSOA 5CKTA 1J5YA 5E8IA 3L2UA 1ERDA 1HDDC 1Z21A 5DDGA 1XG1A 2LH9A 4CCKA 3MKWB 4XKWA 3IH3A 3R6SA 5ILVA 1SVLA 1YO5C 5TISC 1FYKA 1YRNA 4GYGA 4F7ZA 2ELHA 2XRLA 1PVEA 2K9NA 3W2AA 3V7RA 5M5WJ 1MD0A 2XGDA 3A0HC 1HF0A 2DDAA 4IZZA 1WH5A 2CUJA 2M3AA 2Y75A 1MNEA 3D5LA 5B1BH 3KEYA 2VQLA 3BPXA 3Q5FA 5ERIA 3QU3A 5GPAA 4LB6B 5IOYA 3PIPF 1Z9CA 2KL4A 5HOOA 1MMGA 1A36A 3GTLJ 2Z9OA 3QPLA 9ANTA 4ESJA 3OYGA 3H9QA 1BW5A 2KLOA 1QZZA 5LRRA 3TQNA 2JPBA 1F36A 1FX7A 2FA5A 1XCVA 5FLXZ 2DMQA 2XPVA 1G3SA 1IXSB 3P7NA 4C3JJ 2XKPA 1YX3A 3AAFA 1A6QA 4XL9A 4M6VA 2ESHA 3LSHA 3MN2A 2CRGA 4WXDA 3OYFA 2OPTA 1D1CA 1Y0NA 1Z6TA 1FYMA 2X6WA 4HZFA 3ZMTA 3OWTA 1U9NA 3NRVA 3HRUA 2G7UA 3J7AY 1R5HA 3F9KA 3WU2C 4KUMA 4IPAA 4LJZF 1S7AA 3I55I 1RIOH 1MBKA 4E7KA 1WRJA 2GQQA 5E3LA 5ICGA 1K83J 3IV5A 1WCMJ 2KZVA 4HG2A 1A5JA 1ZG1A 2A61A 2FBIA 3ROUA 1V3FA 5DEQA 1BIAA 1J9IA 5E3MA 1RR7A 3GUDA 1SC7A 3PO2J 4KA4A 4CDGA 4YG2F 4M74A 4BNCA 2L54A 1T98A 5DM6F 2ZSHB 1R71A 1BA5A 2O8XA 2EA2A 3LL7A 1BI1A 3GO5A 4S04A 2LC2A 1T2KA 3FK7A 4DIQA 2EZLA 5C3EJ 2R7RA 1FBSA 1LDKB 1QHGA 4N9IA 1OR7A 3QAHA 1MJAA 2DJNA 2VUMJ 1AA7A 2JJ7A 1Z7UA 4XSXF 1APLC 5IPAA 1VZ0A 3I53A 3FK6A 5HODA 4HDVA 3FISA 3AL0C 3HGGA 5F0FA 3OYHA 2HPMA 4ZH4F 3C2BA 2JVHA 4DW6A 3HC7A 2G7HA 1KQ0A 3I64A 2CV2A 3C2GA 1FT9A 2RVCA 2R5ZB 2H8WA 3CCRI 4BE2A 1TQIA 1G2HA 4V2FA 2KZGA 2DOEA 1XGSA 2M8GX 4EATA 2BBYA 2F5VA 2IJLA 2M34A 1R36A 4GCVA 2IGNA 2JUCA 2WAQA 4QLCU 3KP3A 1A6IA 1ZRFA 2M0MA 2OV7A 2RC4A 4CA0A 2GIVA 1JGSA 5F04A 1W0TA 1YJ9I 1T33A 3FZVA 4BU2A 2V1NA 3PSFA 3K1PA 1K7AA 3JRIA 3PL8A 5BNGA 3QPTA 3LSRA 3EUHC 4P55A 1HW5A 4EJOA 3D1NI 3V4GA 2V7FA 4OU0A 3RYPA 2QSHX 3GFMA 1K79A 3ONQA 1GXPA 4BQAA 5K5QA 1VQ8I 2R92J 2EPFA 2DMUA 4X1EA 5DCMA 2MBFA 1FSEA 5K5RA 2XF6A 2EWNA 2MA3A 5ILSA 1O3RA 1LEAA 2UXXA 1ORKA 2IGOA 1Y8RB 3SEZA 3E5UA 2PEXA 2OQRA 1BI2A 1FP2A 2XAUA 1Z0XA 3F8BA 3WE3A 2FSWA 2KPMA 2L9SA 2VXZA 2DFFA 5C4XJ 3H5RA 3K1MA 2Y69H 3ZQHA 2VT3A 3TW7A 2LNBA 3K4KA 2M7BA 2KKOA 3S2WA 2DA6A 2W25A 3HOWJ 5D6EA 4EJVA 2M4GA 3PSIA 1B6AA 2I10A 3PNVA 5F0CA 5L3CA 1IG7A 1FBUA 3J80K 2B9SA 1PP7U 2OTLI 2WV1A 3K2ZA 4XOTA 3CESA 4D9JA 5KAIC 4II3A 5LRSA 2WB1N 1B4AA 4ENMA 2VJJA 1VQMI 1PJRA 4KICA 4GO1A 1E17A 2YS9A 1MSFC 2WWYA 3DTKA 1D1BA 3O6BB 3OYNA 1G3WA 3L00A 1W7PA 5CYVA 3COAC 1V5GA 2B0LA 2FNAA 4ZYAA 4EJWA 4BJTA 2CQKA 3I0TA 2LR8A 1X58A 1J09A 5HLIA 5B3SH 4ENKA 3K0LA 1JUMA 2E5ZA 4KMUX 1D0YA 4U87A 5IP7J 4GFBA 3GX4X 3UKGA 5IT9Z 2ISZA 5FKNA 3PNYA 4HYEA 2R5YB 4RB1A 2E36A 4KIGA 1U5TC 2YPRA 2BXYA 2ECCA 2RQQA 4HRIA 1WJEA 2RDPA 2VASA 3K7AJ 3KP6A 2G9WA 2X0LA 1D8KA 5DYMA 3OYMA 3F22A 2NVTJ 3TOAA 5KNLA 3U1KA 4BL0B 1HQCA 1QNTA 2GM4A 2MD0A 4R1HA 5IYCJ 4D5FA 5ED4A 1J2XA 2KDZA 3TP0A 2B7EA 2NVUB 2VC0A 1WHUA 3FMRA 3JRFA 2MD5A 1JT0A 5FD5A 1ZARA 2GWRA 3R60A 2PJPA 1R7JA 4FE4A 2L5QA 3R4KA 2O61A 3JTGA 3HKZN 3KZZA 4OOIA 3ZQCA 2RNJA 2KISA 4UNOA 3F72A 4M3DA 3BZCA 1E3PA 1P9QC 4KT5C 3CTAA 3I59B 3K4BA 4PJ0C 2LKSA 3GF2A 2MH2A 4OIRF 5KHDA 2FOKA 5L3FA 1H9TA 2CS3A 1KQ9A 1OKRA 2HXIA 4UUSB 4MEXF 1U6GA 3K9TA 2CQ7A 2XF7A 3LFKA 2Q0OA 4RA2A 2CW7A 4ESFA 2L4MA 1LE8B 4XN3A 4I2OA 3BZ6A 1GHCA 3I5UA 4RLQA 1GXQA 2HDWA 2WTEA 1R6RA 3S8PA 4HAMA 4CCNA 2IA2A 3DLLF 1X3WB 3U2RA 3A03A 2DAOA 2F2EA 4Y17A 1SD7A 2D1HA 5DCFA 3BR3A 4E7ZA 3W6KB 4CGZA 1FP1D 2QWWA 3IL2A 1N78A 2BY0A 2ZNYA 1QBJA 5IP9J 2P4WA 4YFNF 3LSPA 2NNNA 1XN7A 4DZPA 2X48A 2Z5UA 4CO8A 3HRMA 1FWZA 5HS8A 1SAXA 1FOXA 4N4OB 3O2PE 4I02A 4UUSA 3CMAI 2HVQA 3KP5A 1CGPA 2MFZA 1YQAA 2A05A 4B1RA 4CYCB 5FKMA 3ZXSA 2BXZA 2HOTA 2JSPA 3RKYA 5BMZA 2LY1A 1LE8A 4D7NA 4AYBN 1O7FA 2KRFA 1YIJI 2EB7A 3BLYA 4UVBA 3OR1C 5J8CA 1PP8F 3CDIA 2XROA 2Z99A 3HOYJ 1W7PD 5F0HA 5FLMJ 1LFPA 1WQ2A 3VB2A 3NWSA 3LQRA 1FSHA 3WU1B 3EETA 4O6JA 3NARA 1OCRH 1TBXA 3CC2I 5DV5A 5BPIA 1YJNI 4XKVA 1ZHFA 5L3GA 3QOEA 3AL0B 1YS6A 2VC1A 4DYQA 3MMYB 1P6RA 3GEZA 5DD8A 3ZMZA 4UHTA 4KNYA 3OL3A 4AIHA 2V9PA 1MDMA 3S2HJ 3ABTA 1NG7A 2Q1ZB 3VYUB 2HGCA 3H9GA 4YIIA 3DKXA 3VSLA 3OL4A 1Q1HA 5GPCA 2GOMA 2F6CA 2XVCA 2DT6A 1B1BA 3QYFA 2EFNA 2CUZA 1YTYA 2LSOA 1IAWA 2F5CA 4A3FJ 4RBOA 1KQ8A 1LDJA 5HDKA 2VE9A 2XDVA 5FLXK 5JLXA 2DT5A 3PQJA 2QSFX 5HS9A 5H6QA 4AIJA 1ETXA 4RM3A 2M2EA 2YX7A 4ABZA 2W57A 1SD6A 3W6VA 1XSVA 4JOMA 4HF0A 1RZ4A 4LD5A 3V7SA 4NQWA 4J01A 2XAQA 3A1YA 2E19A 3E5XA 2E2JJ 1O3SA 1UG0A 4B4CA 2MYSA 2B63J 1MJBA 2P5LC 3GYHX 3K70D 3MZHA 2CH0A 2OUMA 4XSZF 5J1UA 3N97A 1HLVA 2KIMA 2RN7A 3BR2A 3I4PA 1FIPA 2ZJQF 3WTWC 1U2WA 1VNDA 3FXRA 4MO7A 3CF5F 1J75A 1V4RA 3IAS2 2VOOA 1OR7C 1R4MB 3BT9A 4QWQA 4Y33A 1IF1A 2HDCA 2PFBA 2DK5A 2QZ8A 3H0GJ 3F21A 1UHMA 3OIPA 3WGGA 1STZA 2D45A 3BJAA 4XICA 2EZHA 4JK1X 3EUHA 4B44A 3J81Z 1F9NA 1S5LC 2XAJA 3F8CA 3CMYA 1YI2I 1ZGJA 1ETVA 4HX4A 1OYWA 2DA5A 3C7JA 4M73A 2NS0A 1ZKGA 4A5NA 5J6XA 3HOSA 2ZC2A 3E6DA 2XGEA 4HQEA 2HYFA 1AWCA 5EEGA 1Z3XA 2YR2A 3UR3C 5E20A 2E5NA 2L4AA 2DMNA 3MKYB 3KCCA 3RDIA 2LOOA 1EH6A 3IRRA 1ETKA 1O3TA 4G7ZF 3E5QA 2ZKZA 3GLLA 1JT6A 2VQGA 4CYDA 1XS9A 1U5TB 3M8FA 2HQNA 3V8KA 4Q47A 1YITI 1K6OA 3CF2A 2N8GA 4PSXA 4CCMA 4LG0A 3S3OA 1TC3C 2YUSA 4CZZA 5ICCA 4M6XA 4BGDA 3E6BA 3T0YA 1YFHA 2PJRA 2CU7A 2XKOA 3BOQA 3HSFA 1ETWA 1Y6IA 3HRTA 3QQAA 3ZPLA 1BI3A 4OAYA 2R7SA 3FBNB 3RJPA 3Q0UA 3K6GA 3C1DA 1X1PA 1HBXG 2XIGA 1W1WE 3ABUA 2NS8A 4IX7A 5E8GA 1IXRC 2VKDA 2PG4A 2VIXA 2IS2A 1LEBA 1TQMA 2GXAA 2BZTA 1TWFJ 2WB1A 2BGCA 5F6FA 2K9MA 1OCCH 2NVYJ 4DGWB 4AIKA 3VDXA 3S2DJ 4PFOA 4NC7A 3HSRA 4B47A 2EV5A 2OZUA 1WI9A 3K10A 3GTPJ 3RKQA 2X6YA 4JQFA 2AHQA 3U21A 3MWMA 4HEA2 5J3LA 4O3MA 3OIOA 1TWAJ 5GAGJ 2K4JA 3ASOH 3TO6A 1JE8A 1LPQA 3FKJA 4FE7A 3S1RJ 1ETQA 2M5WA 1U9OA 2AQEA 5KVRA 1HW1A 2QQAA 2ZMEA 4BBSJ 1UHSA 5LGUA 2MABA 1HKQA 1LNWA 3B02A 4X0GA 4IHYA 5D5UB 1JI8A 3HB9A 3JRGA 2FF4A 4DOZA 2LTPA 2E2IJ 3HG9A 5GAEJ 1TL8A 1W5SA 2DU9A 3E1SA 3JRCA 1QA6A 4H4KC 1W5TA 2GIZA 2JZYA 4PSWA 4L9TA 1FY7A 2VJ5A 4GXOA 4NUBA 4JBAA 2JA5J 1ZLKA 2K40A 1XGMA 1HSTA 5FRMA 2H1LA 3MQ0A 3S93A 4A3MJ 3KP4A 4R79A 3CCMI 5IP6A 4XLPF 3CP2A 3DPTA 4I99C 3R0AA 4KFCA 3CCQI 3LA7A 1N77A 2TRTA 1XD7A 2F5FA 2FMLA 5LBQA 1YRNB 3HKZA 4D5CA 5LHIA 3VWBA 3JRAA 1SFUA 5IT9K 3LMMA 5IT3A 3FX3A 5D5WB 4IXAA 4RB2C 1G59A 3CQZJ 3TL4X 4U7DA 2GA1A 2A6EF 3DLAA 1UB9A 3M1EA 2D2WA 5BQTA 2O0YA 2ME0A 1ZN2A 1XCBA 1W0UA 1YW8A 2CMPA 3DFGA 4ZYDA 1NG6A 3TW6A 5EJCA 1Z91A 3RI4A 3GW2A 3HHHA 3IHUA 3MD2A 5L3DA 3MKZA 2JQ7A 5E1WA 4XRMA 2K7LA 3K70C 4A0YA 1IRXA 4AVZA 2ZFWA 1MKMA 5EZGA 4KT6A 3FXMA 3TBIA 2JA7J 5JVGF 5C44J 2IAIA 3BP8A 4KDPA 3M7GA 4FASD 1OQYA 2KIFA 1W5CC 4I76A 4IF4A 1EA3A 1WZ2A 4YIRX 1T8IA 3EYYA 2OD5A 1D5YA 1NK3P 4GRIA 4DBRA 1RESA 2QBYA 3FWEA 2FE3A 2LREA 4HF2A 4Q4ZF 3GTQJ 1UG2A 3ML6A 4QPQA 2FUG2 4MTEA 2X9DA 2W82A 3RCOA 3S3MA 4XKCA 1IRZA 2Y30A 2L7FP 4BDZA 2HTJA 3JTHA 1XGNA 3AFHA 2L9RA 2Z1DA 2COBA 3U1DA 5LD2C 2VJ4A 1B72A 2GBYA 4AYBA 5F27A 2Q2EB 4LLGF 5HLTA 4A69C 2VN2A 4J00A 2DFHA 2DN0A 3HZJA 1MMNA 3HM5A 2ZBKA 3G1MA 5M5YJ 1RR8C 1JXSA 4MTDA 2MC3A 4K2EA 5F64A 2LF8A 1BR4A 1SFXA 1Z05A 1WI3A 3K4NA 3NQOA 3M3YJ 2J5OA 1S6LA 4ETSA 3FHNA 4KMFA 1U3EM 1T95A 4RGRA 2M7AA 3SFZA 1D5VA 4I01A 3FIWA 3R61A 4RB0A 3RKWA 3WE2A 5D8KB 2WY7Q 2XUBA 1D1AA 2DTZA 3VFZA 1FYLA 1Y39A 3CLOA 3L2CA 3S32A 2QF7A 1RI7A 1R4NB 3OYLA 4P5OA 1K4SA 2LDUA 2VB6A 4JYKA 5H2FC 5GTHC 2A6TA 4BEHA 2OC6A 4IJAA 1D0XA 3KZYA 1O57A 1VF9A 5FKOA 4E4HA 4YFKF 1OISA 3QRFF 5BOXA 3G4SI 3DKYA 2Q2EA 1KU7A 5J4YA 3PUFA 5FFZA 1F5TA 1TQPA 2NVQJ 1EJ9A 4M9ZA 2Y31A 4NDLA 4ZYHA 5HLHA 1ZRDA 4A3BJ 2K9QA 1GUUA 3WTYC 4AUXA 3HL2A 2UXNA 4Q48A 1XMAA 2QLZA 4MFDA 4XM3A 5EF6A 1P4AA 3G3ZA 4BXUA 5M3FJ 2R7ZJ 3MKLA 4WXHA 4MIMA 1POGA 2P8TA 1VQKI 1IN4A 4RAFA 3WGIA 1YE9A 2ISYA 2HOEA 3E7LA 1G3TA 2KQRA 4XLAA 5BS6A 1X1AA 3LA2A 3CJRB 1U78A 1JKOC 1DP7P 1V5EA 2KP6A 1MBGA 2VT2A 2K4BA 5DCMB 2X1CA 2X6OA 3EQLF 2QKLB 3TOBA 1JTYA 5K1YA 4AD9A 4L5JA 2V26A 4KITB 2VI6A 2E60A 2L7MP 3M9AA 4PUSA 5M3MJ 3OSGA 3FBIB 2HXOA 4ZDPA 1LFUP 5HDGA 2JRTA 2O6GE 3TO7A 1MH3A 4A6DA 5DD4A 2CV1A 5EEHA 2Q8KA 2D1VA 4G7OF 2Y0MA 2NNYA 1KZHA 4P1WA 2NVXJ 2JUGA 5HS7A 4FTHA 1BC8C 3GCMA 2FOWA 4F52A 3VODA 2QQBA 1NTCA 2F5EA 2LLKA 3ABLH 5FO5A 3RIRA 1IJWC 4PGGA 1ODDA 2JPCA 2YSRA 4HX7A 2P5KA 2FQ3A 2CFXA 3LSMA 1MMDA 4EGYA 2WY8Q 2IT0A 3CUQA 2Z33A 1W7PB 1GV5A 3HPHA 2CQXA 4IOCF 2NOJB 2V9KA 2L2OA 3BTCA 4ZYEA 1C0WA 2RGVA 5F08A 4FCYA 3GTMJ 2HEOA 1ON1A 2FRHA 3J81K 3RYRA 1WJAA 4MLOA 3X2QH 2BVLA 5FROA 3H5NA 1TNSA 3CMEI 2CV0A 1MBEA 3P9KA 4QIWN 2PI0A 5IOZA 1T08B 1JHFA 1KU2A 1XC5A 2L9VA 3E3VA 5J40A 4CCOA 3KYLA 4C2UA 2DMPA 3LSTA 4DBQA 1SFKA 1XTAA 2IXSA 2LP0A 3RSNA 3B6CA 3ABKH 5FLVA 1QO0D 1RETA 1R22A 3T5XA 3KE2A 3AG1H 4A3LJ 2IVMA 1A35A 4DYCA 2DODA 2DA7A 4ZTFA 1ZR4A 2LG4A 2R4GA 4N9HA 1XB4A 1QRYA 1FOYA 1V5FA 4CICA 1MW7A 2VPLA 4XRFA 3F6VA 3SZGA 3FMSA 3ZGKA 2VODA 2CUEA 2K9LA 3KP7A 1K61A 1XSXA 1S29A 2CSOA 2OZ6A 2BHYA 3OS0A 4HA8A 3CCVI 4PJJA 3DPUA 4B48A 2ZMEC 4BAYA 1OCZH 1P7IA 3H92A 4ZYGA 4Y52J 2FBHA 4CUGA 3CD6I 4BY1J 2V1UA 1ZGAA 1H8AC 3DF8A 2F4IA 4G9YA 4ZC3A 1Z6RA 2LRDA 2ZJPF 1MNDA 2XB5A 3J7AO 2L02A 1ZAOA 3RKXA 3BJ6A 1ZRCA 3ESWB 1BC7C 3V8JA 2LYCA 4AU7A 4NC8A 1V54H 4HF1A 4LB5A 1T56A 2W1OA 2XPWA 4BHPA 1I3QJ 1U8RA 1DU0A 3N05A 4BY7J 1JUSA 4IHSA 3JRBA 4B3AA 5E1ZB 1WJCA 3MVPA 5CVJA 4XRSG 5KCMA 3A0BC 2XF5A 3GFJA 4XRSA 1OCTC 1SFOJ 2PX9A 1LVKA 1XDSA 2CYYA 4M3BA 5LGTA 4OMYA 2DJIA 3HEFA 2H8RA 1X2MA 2EH3A 4DYRA 4IO9F 1X1DA 2FD5A 4N0BA 3HOTA 3VYSB 1ZLJA 4FHTA 4KN7X 2DW4A 4L5EA 3RQ4A 3PFIA 1UHWA 2EFQA 2WADA 4I0BA 2A69F 3ABMH 1X3UA 4LK0F 3QYEA 2Z16A 5CVVA 1LVAA 3QOPA 1UJ8A 4I98B 4BYYA 4MQ9F 5FGMA 4XQFA 4C3HJ 3EDPA 1RC9A 5F1RA 5LFAA 2NYXA 2LF7A 3TDUC 1X1BA 1KONA 3RPUA 4HV6A 3OYAA 2HZDA 3FXLA 4IHXA 3BJOA 4XN0A 5E1XA 5K5OA 3SFIA 1ZR2A 1MDMB 2O9LA 5HNHA 4I7HA 3K69A 4IOAF 1BJZA 2VKEA 1ZG5A 3W6JB 5B66C 5CVRA 4J19A 1H9GA 1SMYF 1QVUA 2WA0A 1TWHJ 4XKBA 1TT5B 2AQFA 4BHBA 3G6EI 3I58A 3HIFA 2HR3A 2HDDA 2LD5A 2I8DA 4RAYA 1MZBA 1RRJA 3CUOA 1OCOH 5IYDJ 2NS7A 4M71A 5TJJA 1IV8A 2RAEA 3KFWX 2NOGA 2P5VA 3OYBA 2H09A 2EBIA 3I4NJ 3LSJA 4V19K 3LFUA 3H9JA 3NEUA 4EJUA 2E1MC 4NQWB 2O8KA 2VOPA 2A68F 2XGXA 1TW2A 5E17F 2V6CA 1ZTRA 1BW6A 2M4KA 3FXUA 4C30A 4ZJZA 2QM3A 2LBFB 3E6MA 4EMSA 2GOXB 4TV7A 2X51A 1R49A 4PK4A 1PUEE 1MGTA 1SFEA 2DBBA 4EQQA 2E1CA 1HKTA 3L7WA 4UVCA 3AG2H 1L3LA 2GZWA 3E0JB 4R8HA 2R0QC 2EZIA 2JTVA 4G6TB 4EEFG 1FJLA 2Y0SN 1VQOI 1D8JA 3K4MA 2QQ8A 1OLTA 5TRDA 1LUJB 4HV5A 2ZO4A 4WK8F 1NK2P 4EV0A 2AO9A 4L18B 1FIAA 3GTKJ 2L3DA 4WF2A 3WTUC 3MEXA 1ITYA 3P5JA 4CZCA 1KGSA 5EYRA 4PJMA 3RQIA 3RZDJ 3OMYA 2HQ5A 2GXGA 6PAXA 3OYCA 4AVPA 2A5WA 4IVNA 3MCZA 2JVGA 2LBFA 3K4JA 2FEZA 1ENHA 2STTA 3FKIJ 3WHBA 1XPXA 4X6AJ 2H94A 3WTZA 3R0JA 1SVMA 3TGNA 2K02A 3BG3A 4WWCA 2DPUA 1F43A 1EV7A 5D8LB 3IAM2 2KHMA 5D5VB 3F8FA 2XSDC 1V55H 4RGXA 4HSTA 3I71A 1S3JA 3SXYA 4YIFA 5AIQA 5LEKA 2KJBA 1O3QA 4W97A 2STWA 3DEWA 2JWTA 3ISPA 4LG0B 3W2VA 1DPUA 1FC3A 5DUIA 5HLGA 3BCBA 2PJRB 4BQOA 1LQ1A 4WXCA 1YG2A 3GZ6A 2BY1A 3DU6A 4A3KJ 4CHUA 1FOWA 2IA1A 1PUFA 2Y9YA 4UV8A 2XPUA 4MHGA 5EG0A 5JHUA 3KPHA 3RPUD 3WU0A 2MG4A 2MC4A 5J1YA 1UAAA 4LMYA 3O3KA 4A3IJ 4UXNA 1ULYA 2O7OA 1S7OA 2VQCA 4WCGA 4A3DJ 3HDDA 4CSWA 1I27A 1KA8A 4BQNA 3CMMA 2ZB9A 2F5DA 2OTJI 1LB2A 4E6KG 3LSGA 1E2XA 4Z2YA 5IYBJ 3UNGC 3HBLA 1QPMA 4RGUA 2FU4A 2MGQA 3OV8A 1N25A 4NB5A 1VQPI 3ZN1A 4G6QA 5E3NA 2CO5A 3FXQA 4HOBA 3QODA 3T8RA 2AXLA 3P9CA 3ZRGA 1YLFA 1KU9A 3FXKA 1GT0C 5DM7F 3TMOA 3LAPA 4XONA 2ZMEB 5CPRB 3DCFA 1F1ZA 2XAFA 4M72A 2DOFA 3FHZA 3CUQC 2DPDA 4ENJA 3H36A 1JTXA 1O7LA 1QGPA 3ZQLA 1VQNI 1HOMA 1QQIA 4BXXJ 4D1QA 4U0VA 2ETHA 2L0KA 1IZ1A 2P6TA 2CWEA 3DBLB 1DGRM 2W00A 1RKWA 3BQZA 3HGYA 3V7CA 3ZCOA 2EINH 1W36C 3CP8A 2EILH 1JJ6C 4ITVA 2P0WA 4PFPA 2VPRA 4JX5A 2CQQA 2WAEA 5A2QK 3BTJA 1GV2A 4KN4X 4S05A 3QP6A 5KK1A 4H0EA 1WJFA 3DPLC 4XMYA 2QCOA 5DS9A 3N4MA 3M4OJ 2IS4A 2DYSH 3DQVC 5JFRA 3WGHA 1IV6A 2ZFUA 3NWTA 1L0OC 2FXAA 3L2RA 4OIQF 3I4MJ 1GDTA 3S17J 2BEOA 3BG7A 3PFYA 3QPHA 3DXJF 3FF5A 4PDKA 3WHCA 1QHHD 1JKPC 1VQ5I 4NBQA 4OWRB 3ECHA 2EIMH 2A07F 2HKXA 4FQGA 3L09A 1BI0A 2HZTA 2VLAA 4JX6A 5EDNA 4XK4A 1Y1WJ 3J7YJ 2BOLA 1B8IA 4OIOF 1DGWY 1G6NA 3NAUA 2ZXHA 2ID3A 1CF7A 5FRNA 2DDBA 4RMNA 3FM3A 5FFXA 5IY5H 4PCQA 2DCEA 1U8BA 2E1OA 1Q1VA 1R1UA 4U88A 2KDOA 4G6DA 5GAHJ 2EA4A 3ZQQA 3A01A 3S1QJ 2VKVA 2ZXJA 4KYWA 4MNUA 2JA2A 3F23A 1K4TA 2JMWA 3M8EA 2IP2A 4HSRA 5JLWA 1T0FC 5AIPA 4IHTA 1KU3A 3QU6A 5J47A 3HUGA 3CJQB 5GTIC 4U0YA 1ZQ3P 2H6CA 3DEEA 2EFPA 5JR3A 3BG9A 3VYTB 4ZDOA 3K2AA 3ASNH 1XMKA 2QBYB 1GVJA 5DTDA 3M07A 3B73A 4UB8C 1Y56A 4LIVA 1SEUA 2OBPA 3PUBA 4W1UA 2K3PA 1I5ZA 2ICWG 4OIPF 1VQLI 1HA8A 1R9TJ 3REOA 4E7JA 2FNPA 1XX5A 1WH7A 1TWCJ 1VTNC 3JRDA 4C2TA 1B72B 2ZXWH 2P7VB 1H89C 3OR2C 2X85A 2K85A 1PDNC 3WG7H 1J0RA 3A2KA 4RM2A 4UY8I 2R7WA 2KT0A 2E1MB 4KIFA 1ZH5A 4RDUA 5E3OA 4NHJA 2ELKA 1LKXA 3RZOJ 1RPWA 2AS5F 2M9HA 4IHVA 2HWVA 3OOUA 4Z6YA 1EH7A 2WAFA 2K5CA 1S7EA 1TWGJ 3E97A 4ZZDA 3L1PA 4XLEA 3ZQ7A 3CCJI 3LA3A 1G4DA 1BN5A 3T1BA 1R5GA 2PMZN 3CDHA 2V1XA 2RV8A 2CG4A 3S3NA 4FISA 4RLFA 1FEXA 3H5AA 1EKEA 2WV0A 4UUVA 1MBHA 2FJ1A 3WTTC 1JGGA 3V42A 3JW4A 3RPQA 4BS9A 3F8NA 2DYRH 2HQAA 3CCYA 3MFKA 4BEHB 1UCRA 3HXLA 4A93J 4QPOA 4OINF 3G1LA 1MJ9A 1R00A 2LVSA 3TO9A 4ENNA 2DQRA 2W85A 2JA6J 4L9VA 3SHFA 5B5EC 2EIJH 2MH9A 2EK5A 3JRHA 4RAGA 1ZELA 1VQ9I 1HKSA 1UELB 3QWLA 1BJAA 1MH4A 2O5RA 1IRGA 1G3YA 1SANA 4A3CJ 1UMQA 5M5XJ 1Z3YA 1PYVA 1OYYA 4XNFA 2F48A 3G1OA 2K86A 4JP0A 3LNQA 2CQNA 1F4KA 3VEPA 3IH2A 1P4WA 5L3BA 5E18F 2KRCA 1LFBA 2FX0A 1XSDA 1IXCA 3K1NA 3O8GA 3C3WA 4RGSA 4DNCA 4A3EJ 2Y0SA 3HJEA 4HPQA 2LKXA 3PQKA 2KRHA 4BE1A 5FJ8J 4F93B 2FMYA 2AXTC 2TDXA 2R7UA 1ZYRF 1P92A 3BCAA 2IPQX 2XAHA 3QPSA 1JKRC 4AWXB 3CCUI 3IWZA 3WG9A 1Y1VJ 4UB6C 3F3XA 2DMTA 3KEOA 5HDNA 4G94A 3OYEA 2IW5A 2Z2SB 1QZYA 4E7SA 1LDDA 3GVAA 1EH8A 4XBFA 1K78B 3BROA 5D4SA 1Z77A 3F8MA 4N4NB 2BVMA 4EM2A 2KIUA 2BV6A 3I56I 2Y2ZA 1QU3A 2QUFA 3L9FA 3K4CA 2V6EA 4IEJA 1ON2A 3HRSA 5DUKA 1HCRA 2WC2A 1VQ7I 1SD4A 3HSEA 4IL6C 3LAJA 4M3GA 3DTIA 1YX5A 5LHGA 3F6OA 5GADJ 3B6AA 2DA3A 3CLQA 4HNUA 4BQQA 2K9SA 5K7ZA 3CUQB 3HHGA 4II2A 4Y15A 4CH7A 4DQ2A 2EQRA 1D0ZA 5FB2A 3CCLI 4Q5SF 1R1TA 2C6YA 1WKMA 2KMUA 2PMUA 3JAMZ 2DOAA 3S16J 1OYIA 2P81A 3GTOJ 1OCPA 1HC8A 1S72I 3FMQA 2D5VA 4HNTA 1YS7A 3OYKA 1B9NA 2HPIA 4XLNF 4EM1A 4U7BA 2VJIA 1K78A 2RQPA 1VFCA 1MMSA 2NRAC 2E34A 5F1JA 1KYWA 1MSEC 5ILUA 1OJLA 2BW3B 3GWZA 1A04A 3HOXJ 5A2QZ 3ERED 3I3LA 3BQYA 2M8EA 2A5YB 2L7KA 2VKHA 1S9HA 3ZQFA 2OCEA 3MZYA 4YFXF 1ZREA 3JREA 4L0YB 5B1AH 1X1CA 2WBMA 3CCEI 2IRFG 1M1EB 3J7ZI 1WWXA 3HPGA 3KYCB 2IGKA 4D0PA 4V2GA 2MLKA 3Q9VA 3OY9A 2RKHA 1YHQI 3I54A 1BOBA 4DJAA 2CGPA 3CCSI 1S8NA 3FXJA 2H6BA 2HTSA 3OYJA 3PO3J 2OJED 3KP2A 4P96A 2Z3YA 2R7FA 1TP4A 4RS8A 3GXOA 3IRQA 2M0CA 4M9XA 4HLYA 2R5ZA 2R7VA 4QTRA 3HOUJ 3HOVJ 2H27A 3WODF 4HLXA 4O5VA 1BR2A 2BW3A 4PZJA 3W2WA 3G2BA 1NHAA 3BC8A 5HVQC 2XV4S 2QGUA 5ICFA 3EUAA 1IDYA 2EV0A 4YELA 5J8FA 1QZEA 2HOSA 4PJLA 3HTSB 2UV1A 1IN8A 1IN7A 4OMZA 5FKLA 1DDNA 2YU9J 2IGMA 4XLHA 1USTA 2ZNZA 3JSPA 3GZNB 3IKTA 3IH4A 4XIDA 1BBYA 2LY2A 2QSGX 3LSKA 4IRHA 3GFIA 2IBDA 1CQTA 4AM3A 4LLNA 1I50J 5C4JJ 1X4PA 2QVOA 1YJWI 1X19A 3QP5A 2JSCA 2HYJA 4XR6A 1T0FA 3BG5A 4IRIA 2ESNA 2QQ9A 3W3CA 2HQRA 3EUKL 2IEKA 1SVOA 3OYIA 2VE8A 2QKMB 1VI0A 2QENA 2MSYA 4LITA 2HVSA 1OMIA 4BUPA 4LFUA 4UUTA 1A31A 2DT7B 3WTSC 2UZKA 1IRFA 4XLFA 2R93J 5FD6A 3CJTB 4L9NA 3GFLA 2A3SA 5HNFA 3L2WA 1VQ6I 3ZOBA 2ZXIA 4GDFA 2DLLA 5GP9A 3GMEA 4MFEA 4BJ6C 3JCUC 1WGXA 1Y8QB 3ZMDA 4YEJA 2COMA 4A3JJ 3ZMSA 2PMHA 3FDYA 4D7MA 3SYTA 3TP3A 3V8LA 1FTZA 3VSKA 2P7CB 3SQNA 4CCLA 3S1NJ 1DQUA 2EFWA 2EFOA 3T8TA 1X2NA 1SMTA 4WX9A 2HI3A 1FMVA 2DI3A 4FX4A 2K3FA 3CZ6A 2XRNA 2M1BA 5D5XB 1FZPB 2ID6A 3OS1A 1MBJA 3MAJA 4B3XA 2R5YA 4GGGA 3H3ZA 4Y3OA 1TW3A 1OFCX 4B8XA 2P6SA 3PJRA 3KETA 3ELKA 3GTJJ 1UFMA 1T38A 3A02A 4A5MA 2VL8A 1W36D 2R7DA 1J7KA 3H0DA 3HOZJ 3LWFA 3SEQA 2QYOA 4B09A 4BE0A 1FLIA 3E6CC 1R1VA 3BTLA 1TLHB 4L9JA 4C2MJ 2PMZA 4IHWA 3HYIA 3RTRA 4HW0A 1WJDA 1I1GA 3Q3SA 3L2QA 2MW8A 3WTVC 2A6HF 3D0SA 2LKPA 1VQ4I 4IRGA 1IN6A 2E1NA 3ZMUA 5J1RA 3DV8A 2YX4A 4A3GJ 1G8XA 3H3UA 2XHKA 3H3VK 3DBRB 2EIKH 5LGNA 3U9GA 1GVDA 1XMXA 2JK3A 2X1DA 3MZ8A 1DP3A 2H1KA 3OS2A 2DTRA 3TEDA 5K7FA 1ACIA 4LOCA 2RNGA 2DO7A 2HOAA 2NXNB 1I1SA 3GLXA 3I59A 5L3EA 3HTUA 2HU9A 5K7HA 2E7WA 3KLOA 4G8XA 1B59A 1AHDP 3PM1A 2QEXI 4AC0A 1Z7LA 4IQ4A 1ZK8A 4G7HF 2BE5F 2GLOA 3Q9SA 2O3FA 2MLGA 4JX4A 4LIUA 5LEJA 1O4XA 4E70A 3LSIA 2YU3A 5FKKA 4F55A 2KJCA 3ERMA 4BACA 1E0EA 4A12A 2F4OB 3SDBA 1BM9A 4HNVA 1IW7F 3ZMVA 5TGTA 2GAUA 1WFXA 2R3SA 4QSHA 1AKHB 4S0HB 3ZP5A 3BWGA 4B43A 3Q0VA 4IKFA 2PQ8A 2Y9ZA 2ECBA 1WPKA 3CC4I 5EZHA 2EZKA 1R5ID 4UV9A 3TDZC 3BY6A 3GBGA 2VONA 3FM5A 1TT0A 2XASA 2UWMA 1YIOA 2QA4I 1QVTA 1Z67A 2CW8A 2IS6A 2ZSIB 3DTEA 4E7HA 2LK2A 5CQGA 5BPDA 1P4XA 2DK8A 1PUFB 2ELJA 2R7OA 5EG0B 3BR5A 1I6XA 1X4OA 4G12A 4CYCA 2X6XA 3BR6A 4F91B 3LOCA 2W4SA 3VYRB 1W4MA 3Q0WA 2OAZA 4OAZA 2V4JC 3OYDA 2RREA 4GYIA 4BKXA 3AG3H 1P7JA 2R7XA 2KIQA 1IC8A 2PN6A 1MNMC 2EV6A 3CO7C 4CXFA 1USSA 1BR1A 4BJ5C 1AKHA 4F92B 5ICEA 2JN6A 5AONA 3KYDB 3BDDA 2W84A 1BL0A 1RNLA 3SDGA 3CO6C 3GZ5A 5LLQA 2JA8J 1MIJA 3PNTA 3DKWA 1ONVA 3BZKA 4LLLA 2DFIA 4E7IA 4M3EA 2PBIA 4HDUA 2XGCA 1DUXC 1REPC 2ZJRF 1SAUA 3ZQIA 5H6RA 1I3AA 3AKZA 1HW2A 1BIBA 1HDPA 2CJJA 1FNNA 3F0CA 3ZN0A 4UVAA 3KX2A 2XAGA 1HXDA 5CQEA 1YOVB 1AOYA 2L7ZA 3S15J 1FOKA 2JRMA 4CCJA 1SD5A 4C3IJ 4BHCA 1AU7A 4ZDLA 2M30A 4L0ZB 3VPRA 1B9MA 3I9V2 2GA2A 2PLYA 4F3QA 1I6HJ 4FETA 4KJZA 4A2UA 3FXOA 2VBZA 4L5IA 5CLSA 4M6YA 3ULQB 2VBXA 2XB0X 4Y7NJ 4I0AA 1LJ9A 2L9NA 2V1DA 3IC7A 2WAQN 1IGNA 2VBWA 3KEQA 1RUNA 2NAZA 4NNJA 2VQHA 2FBKA 4XORA
chains in the Genus database with same CATH topology
3J80Z 4MQVA 1IUYA 4EVIA 2OU2A 4P9UA 2EJRA 3JAMK 2HS5A 1TNTA 5D4RA 3TKYA 1R23A 4Y13A 1JHHA 1CF7B 3BPVA 2JT1A 3CJNA 3IWFA 4EM0B 3ECOA 3VOEA 3C18A 1YW7A 4HX8A 3G73A 2IA0A 3KLNA 1H0MA 4A0XA 1D3YA 2BYVE 4RB3C 2O61A 2O03A 2E7XA 2X4HA 5H20A 2J5PA 2ZJ2A 1HSJA 2V9VA 2ACJA 3WTXC 3DP7A 2HKOA 3LQQA 2OQGA 2HYGD 4ESBA 2M45A 4HQMA 5CVUA 4M9SA 4BH9A 4FX0A 1ZG3A 4A0ZA 5JVTA 4EJTA 1U5TA 1YYVA 4U0WA 1KYZA 4MGRA 4ON0A 1WSUA 1T6SA 3EYIA 4HBLA 1Y0UA 5CJ9A 2VBYA 2OA4A 3P9IA 2ZCWA 2K27A 3SZTA 1DPRA 2CW0F 4PGHA 4KIBA 4P9FA 4LK1F 1FBQA 1XGOA 2Y48A 1YW9A 1FPQA 2ADUA 2HFHA 2M87A 4FT8A 4A6EA 4ASNA 1OPCA 2W24A 3IKVA 1BOAA 3DEUA 1P2FA 1Z1DA 4EGZA 2L01A 4I09A 3SZPA 1R58A 1J59A 4RAZA 5CVIA 1XDUA 2DQLA 1RUOA 4LGWA 4MEYF 4ZZLA 5D6FA 5JI6A 2GXBA 1T39A 3OOPA 1IN5A 1TTYA 2V79A 5LHHA 3JSOA 1J5YA 5E8IA 5DDGA 3R6SA 5ILVA 1YO5C 1FYKA 4GYGA 4F7ZA 2ELHA 3V7RA 1MD0A 2Y75A 3D5LA 3BPXA 3Q5FA 5ERIA 3QU3A 4LB6B 1Z9CA 5HOOA 2Z9OA 4ESJA 1QZZA 5LRRA 3TQNA 2JPBA 1FX7A 2FA5A 1XCVA 5FLXZ 1G3SA 1IXSB 3P7NA 2XKPA 3AAFA 2ESHA 4WXDA 1Z6TA 1FYMA 4HZFA 3ZMTA 3NRVA 3HRUA 2G7UA 1R5HA 4KUMA 4IPAA 4LJZF 1S7AA 1RIOH 1WRJA 2GQQA 5ICGA 1ZG1A 2A61A 2FBIA 3ROUA 1V3FA 5DEQA 1BIAA 1J9IA 3GUDA 4KA4A 4CDGA 4YG2F 4M74A 4BNCA 2L54A 1T98A 2O8XA 2EA2A 4S04A 1BI1A 3GO5A 1T2KA 1FBSA 1LDKB 4N9IA 1OR7A 3QAHA 1MJAA 1Z7UA 4XSXF 3I53A 4HDVA 4ZH4F 2G7HA 1KQ0A 3I64A 1FT9A 2RVCA 1TQIA 1XGSA 2BBYA 2IJLA 1R36A 4GCVA 4QLCU 3KP3A 1ZRFA 2RC4A 2GIVA 1JGSA 3FZVA 3K1PA 1K7AA 3QPTA 4P55A 1HW5A 4EJOA 3V4GA 4OU0A 3RYPA 3GFMA 1K79A 1GXPA 4BQAA 5K5QA 5DCMA 2MBFA 1FSEA 5K5RA 2EWNA 2MA3A 5ILSA 1O3RA 1LEAA 2UXXA 3E5UA 2OQRA 2PEXA 1BI2A 1FP2A 3F8BA 3WE3A 2FSWA 2VXZA 3K1MA 2VT3A 2LNBA 2KKOA 3S2WA 2W25A 5D6EA 4EJVA 1B6AA 5L3CA 1FBUA 3J80K 1PP7U 3K2ZA 5LRSA 1B4AA 4ENMA 4KICA 4GO1A 1E17A 2WWYA 3O6BB 1G3WA 3L00A 1W7PA 5CYVA 3COAC 2B0LA 2FNAA 4EJWA 2CQKA 3I0TA 5HLIA 4ENKA 3K0LA 4KMUX 3GX4X 5IT9Z 2ISZA 4HYEA 4RB1A 4KIGA 1U5TC 2YPRA 2RDPA 3KP6A 2G9WA 2X0LA 1D8KA 5DYMA 3F22A 3TOAA 1HQCA 1QNTA 4R1HA 5ED4A 1J2XA 2VC0A 3FMRA 2MD5A 5FD5A 1ZARA 2GWRA 3R60A 2PJPA 1R7JA 3R4KA 3JTGA 3KZZA 4OOIA 2RNJA 4UNOA 3F72A 5L3EA 4KT5C 3CTAA 3I59B 1H9TA 5L3FA 3GF2A 2MH2A 4OIRF 2FOKA 1KQ9A 1OKRA 4MEXF 1U6GA 3K9TA 3LFKA 2Q0OA 4ESFA 2L4MA 4I2OA 3BZ6A 1GHCA 3I5UA 1GXQA 2WTEA 4HAMA 2IA2A 3U2RA 2DAOA 2F2EA 4Y17A 1SD7A 2D1HA 5DCFA 3W6KB 4CGZA 1FP1D 2QWWA 3IL2A 2ZNYA 1QBJA 2P4WA 4YFNF 2NNNA 1XN7A 2Z5UA 4CO8A 3HRMA 1FWZA 5HS8A 1SAXA 3O2PE 4I02A 1CGPA 3KP5A 1YQAA 3RKYA 5BMZA 1O7FA 2KRFA 1PP8F 2EB7A 4UVBA 5J8CA 2XROA 2Z99A 1W7PD 1WQ2A 3VB2A 3LQRA 1FSHA 3WU1B 3EETA 4O6JA 1TBXA 5DV5A 5BPIA 1ZHFA 5L3GA 1YS6A 2VC1A 1P6RA 3GEZA 5DD8A 3ZMZA 4UHTA 4KNYA 4AIHA 1MDMA 3ABTA 2HGCA 4YIIA 1Q1HA 2XVCA 1B1BA 1YTYA 2EFNA 2LSOA 1IAWA 2F5CA 1KQ8A 1LDJA 5HDKA 2VE9A 5FLXK 2DT5A 3PQJA 5HS9A 5H6QA 4AIJA 2YX7A 2W57A 1SD6A 1XSVA 4HF0A 1RZ4A 4LD5A 3V7SA 4NQWA 2XAQA 3E5XA 1O3SA 1MJBA 2P5LC 3GYHX 3MZHA 4XSZF 3N97A 2KIMA 2RN7A 3I4PA 3WTWC 1U2WA 3FXRA 1J75A 1V4RA 2VOOA 4QWQA 1IF1A 2HDCA 2PFBA 2DK5A 2QZ8A 3F21A 1UHMA 3WGGA 2D45A 1STZA 3BJAA 4JK1X 3EUHA 3J81Z 1F9NA 2XAJA 3F8CA 1ZGJA 4HX4A 1OYWA 3C7JA 4M73A 2NS0A 4A5NA 5J6XA 3HOSA 3E6DA 4HQEA 2HYFA 1AWCA 5EEGA 2YR2A 5E20A 2L4AA 3KCCA 3RDIA 1EH6A 3IRRA 1O3TA 4G7ZF 3E5QA 2ZKZA 4CYDA 1U5TB 3M8FA 2HQNA 3V8KA 4Q47A 1K6OA 4LG0A 4CZZA 5ICCA 4M6XA 3E6BA 3T0YA 1YFHA 2XKOA 3BOQA 3HSFA 3HRTA 3ZPLA 1BI3A 3RJPA 3C1DA 1HBXG 2XIGA 3ABUA 5E8GA 1IXRC 2PG4A 1LEBA 1TQMA 5F6FA 2BGCA 4AIKA 3HSRA 2EV5A 2OZUA 1WI9A 4JQFA 3MWMA 4O3MA 2K4JA 3TO6A 1JE8A 2M5WA 5KVRA 1HW1A 2QQAA 2ZMEA 5LGUA 1HKQA 1LNWA 3B02A 5D5UB 2FF4A 1W5SA 2DU9A 1W5TA 2JZYA 4L9TA 1FY7A 4GXOA 4JBAA 1ZLKA 1XGMA 1HSTA 3MQ0A 3KP4A 4R79A 4XLPF 3DPTA 3R0AA 4KFCA 3LA7A 1XD7A 2F5FA 2FMLA 5LBQA 5LHIA 1SFUA 5IT9K 5IT3A 3FX3A 5D5WB 4IXAA 4RB2C 4U7DA 2GA1A 2A6EF 1UB9A 3M1EA 2D2WA 5BQTA 2O0YA 1ZN2A 1XCBA 1YW8A 3DFGA 4ZYDA 1Z91A 3RI4A 3GW2A 3HHHA 3IHUA 5L3DA 5E1WA 2K7LA 4A0YA 2ZFWA 1MKMA 3BP8A 4KDPA 3M7GA 2KIFA 4IF4A 3EYYA 2OD5A 2QBYA 3FWEA 2FE3A 4HF2A 4Q4ZF 3ML6A 4MTEA 2HTJA 3JTHA 1XGNA 3U1DA 4LLGF 2VN2A 2ZBKA 1JXSA 4MTDA 2MC3A 4K2EA 5F64A 2LF8A 1SFXA 1Z05A 3NQOA 2J5OA 1S6LA 4ETSA 4KMFA 1U3EM 4RGRA 3SFZA 1D5VA 4I01A 3R61A 5D8KB 4RB0A 3RKWA 3WE2A 2XUBA 1FYLA 3VFZA 3CLOA 3L2CA 1RI7A 4P5OA 2LDUA 4IJAA 3KZYA 1O57A 4YFKF 5BOXA 3QRFF 2Q2EA 1KU7A 1F5TA 5FFZA 1TQPA 4M9ZA 4ZYHA 5HLHA 1ZRDA 3WTYC 2UXNA 4Q48A 1XMAA 2QLZA 1P4AA 3G3ZA 4BXUA 4WXHA 2P8TA 1IN4A 3WGIA 2ISYA 2HOEA 1G3TA 5BS6A 3LA2A 1U78A 1DP7P 2VT2A 2K4BA 5DCMB 3EQLF 3TOBA 5K1YA 4AD9A 4L5JA 3M9AA 5HDGA 2JRTA 2O6GE 3TO7A 4A6DA 5DD4A 5EEHA 2Q8KA 2D1VA 4G7OF 2Y0MA 2NNYA 5HS7A 1BC8C 3VODA 2QQBA 5FO5A 2F5EA 3RIRA 4PGGA 1ODDA 2JPCA 2YSRA 4HX7A 2P5KA 2FQ3A 2CFXA 4EGYA 2IT0A 3CUQA 2Z33A 1W7PB 4ZYEA 1C0WA 2RGVA 2HEOA 1ON1A 2FRHA 3J81K 3RYRA 1TNSA 3P9KA 2PI0A 1JHFA 1KU2A 3E3VA 3LSTA 1QO0D 1R22A 3T5XA 3KE2A 2IVMA 4N9HA 1XB4A 4CICA 4XRFA 3F6VA 3FMSA 2VODA 3KP7A 1XSXA 1S29A 2CSOA 2OZ6A 4HA8A 4BAYA 3H92A 4ZYGA 2FBHA 2V1UA 1ZGAA 3DF8A 4G9YA 1Z6RA 3J7AO 2L02A 1ZAOA 3RKXA 3BJ6A 1ZRCA 1BC7C 3V8JA 4HF1A 4LB5A 4BHPA 1U8RA 4IHSA 5E1ZB 5CVJA 3GFJA 4OMYA 1XDSA 2CYYA 5LGTA 4N0BA 3HOTA 1ZLJA 4FHTA 4KN7X 2DW4A 3PFIA 1UHWA 2EFQA 4I0BA 2A69F 1X3UA 4LK0F 5CVVA 1LVAA 3QOPA 4I98B 4BYYA 4MQ9F 5FGMA 3EDPA 5F1RA 2NYXA 2LF7A 3TDUC 3RPUA 4HV6A 3BJOA 5E1XA 5K5OA 1MDMB 4I7HA 3K69A 1ZG5A 3W6JB 5CVRA 1H9GA 1SMYF 4BHBA 3I58A 3HIFA 2HR3A 4RAYA 1MZBA 3CUOA 4M71A 5TJJA 3KFWX 2P5VA 2H09A 3NEUA 4EJUA 2VOPA 2A68F 2XGXA 1TW2A 5E17F 2V6CA 3FXUA 2QM3A 3E6MA 4EMSA 4TV7A 1PUEE 1MGTA 1SFEA 2DBBA 4EQQA 2E1CA 1HKTA 3L7WA 4UVCA 1L3LA 2GZWA 4R8HA 2JTVA 1D8JA 5TRDA 4HV5A 2ZO4A 4WK8F 4EV0A 4L18B 2L3DA 4WF2A 3WTUC 3MEXA 1KGSA 2GXGA 6PAXA 4AVPA 4IVNA 3MCZA 2FEZA 2STTA 2H94A 3WTZA 3R0JA 3TGNA 2K02A 2DPUA 4WWCA 1EV7A 5D8LB 5D5VB 3F8FA 4RGXA 3I71A 1S3JA 3SXYA 4YIFA 5AIQA 5LEKA 2KJBA 1O3QA 2STWA 3ISPA 4LG0B 1DPUA 1FC3A 5DUIA 5HLGA 1LQ1A 4WXCA 1YG2A 3GZ6A 4CHUA 2IA1A 4UV8A 4MHGA 5JHUA 3WU0A 4LMYA 3O3KA 4UXNA 1ULYA 1S7OA 4WCGA 1I27A 1KA8A 2F5DA 1LB2A 1E2XA 4Z2YA 1QPMA 4RGUA 2FU4A 3OV8A 4NB5A 3ZN1A 4G6QA 2CO5A 3FXQA 4HOBA 3T8RA 2AXLA 3P9CA 1YLFA 1KU9A 3LAPA 2ZMEB 1F1ZA 2XAFA 4M72A 3FHZA 3CUQC 2DPDA 4ENJA 1O7LA 1QGPA 1QQIA 4U0VA 2ETHA 1IZ1A 2P6TA 2CWEA 3V7CA 5A2QK 4KN4X 4S05A 3QP6A 5KK1A 4H0EA 3DPLC 3N4MA 3DQVC 5JFRA 3WGHA 1L0OC 2FXAA 4OIQF 2BEOA 4PDKA 3QPHA 3DXJF 3FF5A 3ECHA 2A07F 2HKXA 3L09A 1BI0A 2HZTA 4OIOF 1G6NA 1CF7A 3FM3A 5FFXA 4PCQA 4U88A 1R1UA 4G6DA 2EA4A 2ZXJA 4KYWA 4MNUA 3F23A 3M8EA 2IP2A 5AIPA 4IHTA 1KU3A 3QU6A 3HUGA 4U0YA 2H6CA 2EFPA 5JR3A 1XMKA 2QBYB 1GVJA 3B73A 2OBPA 1I5ZA 4OIPF 3REOA 2FNPA 1VTNC 2P7VB 1PDNC 1J0RA 4KIFA 1ZH5A 4NHJA 2AS5F 2HWVA 1EH7A 3E97A 4ZZDA 3ZQ7A 3LA3A 1G4DA 1BN5A 3T1BA 1R5GA 3CDHA 2V1XA 2RV8A 2CG4A 2WV0A 4UUVA 3WTTC 3JW4A 3RPQA 3F8NA 3MFKA 1UCRA 4OINF 1MJ9A 1R00A 3TO9A 4ENNA 2DQRA 2W85A 4L9VA 3SHFA 2MH9A 2EK5A 1HKSA 1BJAA 1IRGA 1G3YA 1OYYA 2K86A 1F4KA 3VEPA 1P4WA 5L3BA 5E18F 1XSDA 1IXCA 3K1NA 3C3WA 4RGSA 4DNCA 3PQKA 2FMYA 2TDXA 1ZYRF 1P92A 2IPQX 2XAHA 4AWXB 3IWZA 3WG9A 5HDNA 3F3XA 3KEOA 4G94A 2IW5A 1QZYA 1LDDA 3GVAA 1EH8A 4XBFA 1K78B 3BROA 5D4SA 3F8MA 4EM2A 2KIUA 2BV6A 2QUFA 3L9FA 1ON2A 3HRSA 5DUKA 2WC2A 1SD4A 3HSEA 3LAJA 5LHGA 3F6OA 3CUQB 3HHGA 4Y15A 4DQ2A 5FB2A 4Q5SF 1R1TA 2C6YA 1WKMA 2PMUA 3JAMZ 1OYIA 3FMQA 1YS7A 1B9NA 4XLNF 4EM1A 4U7BA 1K78A 2RQPA 2NRAC 1KYWA 5ILUA 3GWZA 1A04A 3ERED 5A2QZ 2M8EA 2A5YB 3MZYA 4YFXF 1ZREA 4L0YB 2IRFG 1WWXA 4D0PA 2MLKA 3Q9VA 2RKHA 3I54A 2CGPA 1S8NA 2H6BA 2HTSA 3KP2A 4P96A 2Z3YA 2R7FA 4RS8A 3GXOA 3IRQA 4M9XA 4HLYA 2H27A 3WODF 4HLXA 4O5VA 4PZJA 1NHAA 5HVQC 2XV4S 5ICFA 2EV0A 5J8FA 3HTSB 1IN8A 1IN7A 4OMZA 1DDNA 1USTA 2ZNZA 3JSPA 3IKTA 1BBYA 4IRHA 3GFIA 4LLNA 2QVOA 3QP5A 2JSCA 1T0FA 4IRIA 2ESNA 2QQ9A 2HQRA 2VE8A 2QENA 1OMIA 4LFUA 3WTSC 2UZKA 1IRFA 5FD6A 4L9NA 3GFLA 2A3SA 2DLLA 3ZMDA 2COMA 3ZMSA 2PMHA 3V8LA 2P7CB 3SQNA 2EFWA 2EFOA 3T8TA 1SMTA 4WX9A 2DI3A 4FX4A 2XRNA 2M1BA 5D5XB 1FZPB 3MAJA 4GGGA 3H3ZA 1TW3A 4B8XA 2P6SA 3KETA 3ELKA 1UFMA 1T38A 4A5MA 2R7DA 1J7KA 1FLIA 3LWFA 2QYOA 4B09A 3E6CC 1R1VA 1TLHB 4L9JA 3HYIA 3RTRA 4HW0A 1I1GA 3WTVC 2A6HF 3D0SA 2LKPA 4IRGA 1IN6A 2E1NA 3ZMUA 3DV8A 2YX4A 3H3UA 2XHKA 5LGNA 3U9GA 2DTRA 2DO7A 1I1SA 3GLXA 3I59A 3HTUA 2E7WA 3KLOA 4G8XA 1B59A 4G7HF 2BE5F 3Q9SA 2O3FA 2MLGA 5LEJA 4E70A 2YU3A 2KJCA 4A12A 1BM9A 1IW7F 3ZMVA 2GAUA 2R3SA 3ZP5A 3BWGA 2PQ8A 4UV9A 3TDZC 3BY6A 2VONA 3FM5A 2XASA 2UWMA 1YIOA 5BPDA 1P4XA 2DK8A 1I6XA 1W4MA 2OAZA 4GYIA 2PN6A 2EV6A 3CO7C 4CXFA 1USSA 5ICEA 5AONA 3BDDA 2W84A 1RNLA 3CO6C 3GZ5A 5LLQA 3DKWA 1ONVA 4LLLA 2DFIA 2PBIA 4HDUA 1DUXC 1REPC 5H6RA 1HW2A 1BIBA 1FNNA 3ZN0A 4UVAA 2XAGA 1HXDA 1AOYA 1FOKA 1SD5A 4BHCA 2M30A 4L0ZB 1B9MA 2GA2A 2PLYA 4A2UA 2VBZA 4L5IA 5CLSA 4M6YA 3ULQB 2VBXA 4I0AA 1LJ9A 2V1DA 3IC7A 2VBWA 3KEQA 1RUNA 2NAZA 2FBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 Z;  4MQV A;  1IUY A;  4EVI A;  2OU2 A;  4P9U A;  2EJR A;  3JAM K;  2HS5 A;  1TNT A;  5D4R A;  3TKY A;  1R23 A;  4Y13 A;  1JHH A;  1CF7 B;  3BPV A;  2JT1 A;  3CJN A;  3IWF A;  4EM0 B;  3ECO A;  3VOE A;  3C18 A;  1YW7 A;  4HX8 A;  3G73 A;  2IA0 A;  3KLN A;  1H0M A;  4A0X A;  1D3Y A;  2BYV E;  4RB3 C;  2O61 A;  2O03 A;  2E7X A;  2X4H A;  5H20 A;  2J5P A;  2ZJ2 A;  1HSJ A;  2V9V A;  2ACJ A;  3WTX C;  3DP7 A;  2HKO A;  3LQQ A;  2OQG A;  2HYG D;  4ESB A;  2M45 A;  4HQM A;  5CVU A;  4M9S A;  4BH9 A;  4FX0 A;  1ZG3 A;  4A0Z A;  5JVT A;  4EJT A;  1U5T A;  1YYV A;  4U0W A;  1KYZ A;  4MGR A;  4ON0 A;  1WSU A;  1T6S A;  3EYI A;  4HBL A;  1Y0U A;  5CJ9 A;  2VBY A;  2OA4 A;  3P9I A;  2ZCW A;  2K27 A;  3SZT A;  1DPR A;  2CW0 F;  4PGH A;  4KIB A;  4P9F A;  4LK1 F;  1FBQ A;  1XGO A;  2Y48 A;  1YW9 A;  1FPQ A;  2ADU A;  2HFH A;  2M87 A;  4FT8 A;  4A6E A;  4ASN A;  1OPC A;  2W24 A;  3IKV A;  1BOA A;  3DEU A;  1P2F A;  1Z1D A;  4EGZ A;  2L01 A;  4I09 A;  3SZP A;  1R58 A;  1J59 A;  4RAZ A;  5CVI A;  1XDU A;  2DQL A;  1RUO A;  4LGW A;  4MEY F;  4ZZL A;  5D6F A;  5JI6 A;  2GXB A;  1T39 A;  3OOP A;  1IN5 A;  1TTY A;  2V79 A;  5LHH A;  3JSO A;  1J5Y A;  5E8I A;  5DDG A;  3R6S A;  5ILV A;  1YO5 C;  1FYK A;  4GYG A;  4F7Z A;  2ELH A;  3V7R A;  1MD0 A;  2Y75 A;  3D5L A;  3BPX A;  3Q5F A;  5ERI A;  3QU3 A;  4LB6 B;  1Z9C A;  5HOO A;  2Z9O A;  4ESJ A;  1QZZ A;  5LRR A;  3TQN A;  2JPB A;  1FX7 A;  2FA5 A;  1XCV A;  5FLX Z;  1G3S A;  1IXS B;  3P7N A;  2XKP A;  3AAF A;  2ESH A;  4WXD A;  1Z6T A;  1FYM A;  4HZF A;  3ZMT A;  3NRV A;  3HRU A;  2G7U A;  1R5H A;  4KUM A;  4IPA A;  4LJZ F;  1S7A A;  1RIO H;  1WRJ A;  2GQQ A;  5ICG A;  1ZG1 A;  2A61 A;  2FBI A;  3ROU A;  1V3F A;  5DEQ A;  1BIA A;  1J9I A;  3GUD A;  4KA4 A;  4CDG A;  4YG2 F;  4M74 A;  4BNC A;  2L54 A;  1T98 A;  2O8X A;  2EA2 A;  4S04 A;  1BI1 A;  3GO5 A;  1T2K A;  1FBS A;  1LDK B;  4N9I A;  1OR7 A;  3QAH A;  1MJA A;  1Z7U A;  4XSX F;  3I53 A;  4HDV A;  4ZH4 F;  2G7H A;  1KQ0 A;  3I64 A;  1FT9 A;  2RVC A;  1TQI A;  1XGS A;  2BBY A;  2IJL A;  1R36 A;  4GCV A;  4QLC U;  3KP3 A;  1ZRF A;  2RC4 A;  2GIV A;  1JGS A;  3FZV A;  3K1P A;  1K7A A;  3QPT A;  4P55 A;  1HW5 A;  4EJO A;  3V4G A;  4OU0 A;  3RYP A;  3GFM A;  1K79 A;  1GXP A;  4BQA A;  5K5Q A;  5DCM A;  2MBF A;  1FSE A;  5K5R A;  2EWN A;  2MA3 A;  5ILS A;  1O3R A;  1LEA A;  2UXX A;  3E5U A;  2OQR A;  2PEX A;  1BI2 A;  1FP2 A;  3F8B A;  3WE3 A;  2FSW A;  2VXZ A;  3K1M A;  2VT3 A;  2LNB A;  2KKO A;  3S2W A;  2W25 A;  5D6E A;  4EJV A;  1B6A A;  5L3C A;  1FBU A;  3J80 K;  1PP7 U;  3K2Z A;  5LRS A;  1B4A A;  4ENM A;  4KIC A;  4GO1 A;  1E17 A;  2WWY A;  3O6B B;  1G3W A;  3L00 A;  1W7P A;  5CYV A;  3COA C;  2B0L A;  2FNA A;  4EJW A;  2CQK A;  3I0T A;  5HLI A;  4ENK A;  3K0L A;  4KMU X;  3GX4 X;  5IT9 Z;  2ISZ A;  4HYE A;  4RB1 A;  4KIG A;  1U5T C;  2YPR A;  2RDP A;  3KP6 A;  2G9W A;  2X0L A;  1D8K A;  5DYM A;  3F22 A;  3TOA A;  1HQC A;  1QNT A;  4R1H A;  5ED4 A;  1J2X A;  2VC0 A;  3FMR A;  2MD5 A;  5FD5 A;  1ZAR A;  2GWR A;  3R60 A;  2PJP A;  1R7J A;  3R4K A;  3JTG A;  3KZZ A;  4OOI A;  2RNJ A;  4UNO A;  3F72 A;  5L3E A;  4KT5 C;  3CTA A;  3I59 B;  1H9T A;  5L3F A;  3GF2 A;  2MH2 A;  4OIR F;  2FOK A;  1KQ9 A;  1OKR A;  4MEX F;  1U6G A;  3K9T A;  3LFK A;  2Q0O A;  4ESF A;  2L4M A;  4I2O A;  3BZ6 A;  1GHC A;  3I5U A;  1GXQ A;  2WTE A;  4HAM A;  2IA2 A;  3U2R A;  2DAO A;  2F2E A;  4Y17 A;  1SD7 A;  2D1H A;  5DCF A;  3W6K B;  4CGZ A;  1FP1 D;  2QWW A;  3IL2 A;  2ZNY A;  1QBJ A;  2P4W A;  4YFN F;  2NNN A;  1XN7 A;  2Z5U A;  4CO8 A;  3HRM A;  1FWZ A;  5HS8 A;  1SAX A;  3O2P E;  4I02 A;  1CGP A;  3KP5 A;  1YQA A;  3RKY A;  5BMZ A;  1O7F A;  2KRF A;  1PP8 F;  2EB7 A;  4UVB A;  5J8C A;  2XRO A;  2Z99 A;  1W7P D;  1WQ2 A;  3VB2 A;  3LQR A;  1FSH A;  3WU1 B;  3EET A;  4O6J A;  1TBX A;  5DV5 A;  5BPI A;  1ZHF A;  5L3G A;  1YS6 A;  2VC1 A;  1P6R A;  3GEZ A;  5DD8 A;  3ZMZ A;  4UHT A;  4KNY A;  4AIH A;  1MDM A;  3ABT A;  2HGC A;  4YII A;  1Q1H A;  2XVC A;  1B1B A;  1YTY A;  2EFN A;  2LSO A;  1IAW A;  2F5C A;  1KQ8 A;  1LDJ A;  5HDK A;  2VE9 A;  5FLX K;  2DT5 A;  3PQJ A;  5HS9 A;  5H6Q A;  4AIJ A;  2YX7 A;  2W57 A;  1SD6 A;  1XSV A;  4HF0 A;  1RZ4 A;  4LD5 A;  3V7S A;  4NQW A;  2XAQ A;  3E5X A;  1O3S A;  1MJB A;  2P5L C;  3GYH X;  3MZH A;  4XSZ F;  3N97 A;  2KIM A;  2RN7 A;  3I4P A;  3WTW C;  1U2W A;  3FXR A;  1J75 A;  1V4R A;  2VOO A;  4QWQ A;  1IF1 A;  2HDC A;  2PFB A;  2DK5 A;  2QZ8 A;  3F21 A;  1UHM A;  3WGG A;  2D45 A;  1STZ A;  3BJA A;  4JK1 X;  3EUH A;  3J81 Z;  1F9N A;  2XAJ A;  3F8C A;  1ZGJ A;  4HX4 A;  1OYW A;  3C7J A;  4M73 A;  2NS0 A;  4A5N A;  5J6X A;  3HOS A;  3E6D A;  4HQE A;  2HYF A;  1AWC A;  5EEG A;  2YR2 A;  5E20 A;  2L4A A;  3KCC A;  3RDI A;  1EH6 A;  3IRR A;  1O3T A;  4G7Z F;  3E5Q A;  2ZKZ A;  4CYD A;  1U5T B;  3M8F A;  2HQN A;  3V8K A;  4Q47 A;  1K6O A;  4LG0 A;  4CZZ A;  5ICC A;  4M6X A;  3E6B A;  3T0Y A;  1YFH A;  2XKO A;  3BOQ A;  3HSF A;  3HRT A;  3ZPL A;  1BI3 A;  3RJP A;  3C1D A;  1HBX G;  2XIG A;  3ABU A;  5E8G A;  1IXR C;  2PG4 A;  1LEB A;  1TQM A;  5F6F A;  2BGC A;  4AIK A;  3HSR A;  2EV5 A;  2OZU A;  1WI9 A;  4JQF A;  3MWM A;  4O3M A;  2K4J A;  3TO6 A;  1JE8 A;  2M5W A;  5KVR A;  1HW1 A;  2QQA A;  2ZME A;  5LGU A;  1HKQ A;  1LNW A;  3B02 A;  5D5U B;  2FF4 A;  1W5S A;  2DU9 A;  1W5T A;  2JZY A;  4L9T A;  1FY7 A;  4GXO A;  4JBA A;  1ZLK A;  1XGM A;  1HST A;  3MQ0 A;  3KP4 A;  4R79 A;  4XLP F;  3DPT A;  3R0A A;  4KFC A;  3LA7 A;  1XD7 A;  2F5F A;  2FML A;  5LBQ A;  5LHI A;  1SFU A;  5IT9 K;  5IT3 A;  3FX3 A;  5D5W B;  4IXA A;  4RB2 C;  4U7D A;  2GA1 A;  2A6E F;  1UB9 A;  3M1E A;  2D2W A;  5BQT A;  2O0Y A;  1ZN2 A;  1XCB A;  1YW8 A;  3DFG A;  4ZYD A;  1Z91 A;  3RI4 A;  3GW2 A;  3HHH A;  3IHU A;  5L3D A;  5E1W A;  2K7L A;  4A0Y A;  2ZFW A;  1MKM A;  3BP8 A;  4KDP A;  3M7G A;  2KIF A;  4IF4 A;  3EYY A;  2OD5 A;  2QBY A;  3FWE A;  2FE3 A;  4HF2 A;  4Q4Z F;  3ML6 A;  4MTE A;  2HTJ A;  3JTH A;  1XGN A;  3U1D A;  4LLG F;  2VN2 A;  2ZBK A;  1JXS A;  4MTD A;  2MC3 A;  4K2E A;  5F64 A;  2LF8 A;  1SFX A;  1Z05 A;  3NQO A;  2J5O A;  1S6L A;  4ETS A;  4KMF A;  1U3E M;  4RGR A;  3SFZ A;  1D5V A;  4I01 A;  3R61 A;  5D8K B;  4RB0 A;  3RKW A;  3WE2 A;  2XUB A;  1FYL A;  3VFZ A;  3CLO A;  3L2C A;  1RI7 A;  4P5O A;  2LDU A;  4IJA A;  3KZY A;  1O57 A;  4YFK F;  5BOX A;  3QRF F;  2Q2E A;  1KU7 A;  1F5T A;  5FFZ A;  1TQP A;  4M9Z A;  4ZYH A;  5HLH A;  1ZRD A;  3WTY C;  2UXN A;  4Q48 A;  1XMA A;  2QLZ A;  1P4A A;  3G3Z A;  4BXU A;  4WXH A;  2P8T A;  1IN4 A;  3WGI A;  2ISY A;  2HOE A;  1G3T A;  5BS6 A;  3LA2 A;  1U78 A;  1DP7 P;  2VT2 A;  2K4B A;  5DCM B;  3EQL F;  3TOB A;  5K1Y A;  4AD9 A;  4L5J A;  3M9A A;  5HDG A;  2JRT A;  2O6G E;  3TO7 A;  4A6D A;  5DD4 A;  5EEH A;  2Q8K A;  2D1V A;  4G7O F;  2Y0M A;  2NNY A;  5HS7 A;  1BC8 C;  3VOD A;  2QQB A;  5FO5 A;  2F5E A;  3RIR A;  4PGG A;  1ODD A;  2JPC A;  2YSR A;  4HX7 A;  2P5K A;  2FQ3 A;  2CFX A;  4EGY A;  2IT0 A;  3CUQ A;  2Z33 A;  1W7P B;  4ZYE A;  1C0W A;  2RGV A;  2HEO A;  1ON1 A;  2FRH A;  3J81 K;  3RYR A;  1TNS A;  3P9K A;  2PI0 A;  1JHF A;  1KU2 A;  3E3V A;  3LST A;  1QO0 D;  1R22 A;  3T5X A;  3KE2 A;  2IVM A;  4N9H A;  1XB4 A;  4CIC A;  4XRF A;  3F6V A;  3FMS A;  2VOD A;  3KP7 A;  1XSX A;  1S29 A;  2CSO A;  2OZ6 A;  4HA8 A;  4BAY A;  3H92 A;  4ZYG A;  2FBH A;  2V1U A;  1ZGA A;  3DF8 A;  4G9Y A;  1Z6R A;  3J7A O;  2L02 A;  1ZAO A;  3RKX A;  3BJ6 A;  1ZRC A;  1BC7 C;  3V8J A;  4HF1 A;  4LB5 A;  4BHP A;  1U8R A;  4IHS A;  5E1Z B;  5CVJ A;  3GFJ A;  4OMY A;  1XDS A;  2CYY A;  5LGT A;  4N0B A;  3HOT A;  1ZLJ A;  4FHT A;  4KN7 X;  2DW4 A;  3PFI A;  1UHW A;  2EFQ A;  4I0B A;  2A69 F;  1X3U A;  4LK0 F;  5CVV A;  1LVA A;  3QOP A;  4I98 B;  4BYY A;  4MQ9 F;  5FGM A;  3EDP A;  5F1R A;  2NYX A;  2LF7 A;  3TDU C;  3RPU A;  4HV6 A;  3BJO A;  5E1X A;  5K5O A;  1MDM B;  4I7H A;  3K69 A;  1ZG5 A;  3W6J B;  5CVR A;  1H9G A;  1SMY F;  4BHB A;  3I58 A;  3HIF A;  2HR3 A;  4RAY A;  1MZB A;  3CUO A;  4M71 A;  5TJJ A;  3KFW X;  2P5V A;  2H09 A;  3NEU A;  4EJU A;  2VOP A;  2A68 F;  2XGX A;  1TW2 A;  5E17 F;  2V6C A;  3FXU A;  2QM3 A;  3E6M A;  4EMS A;  4TV7 A;  1PUE E;  1MGT A;  1SFE A;  2DBB A;  4EQQ A;  2E1C A;  1HKT A;  3L7W A;  4UVC A;  1L3L A;  2GZW A;  4R8H A;  2JTV A;  1D8J A;  5TRD A;  4HV5 A;  2ZO4 A;  4WK8 F;  4EV0 A;  4L18 B;  2L3D A;  4WF2 A;  3WTU C;  3MEX A;  1KGS A;  2GXG A;  6PAX A;  4AVP A;  4IVN A;  3MCZ A;  2FEZ A;  2STT A;  2H94 A;  3WTZ A;  3R0J A;  3TGN A;  2K02 A;  2DPU A;  4WWC A;  1EV7 A;  5D8L B;  5D5V B;  3F8F A;  4RGX A;  3I71 A;  1S3J A;  3SXY A;  4YIF A;  5AIQ A;  5LEK A;  2KJB A;  1O3Q A;  2STW A;  3ISP A;  4LG0 B;  1DPU A;  1FC3 A;  5DUI A;  5HLG A;  1LQ1 A;  4WXC A;  1YG2 A;  3GZ6 A;  4CHU A;  2IA1 A;  4UV8 A;  4MHG A;  5JHU A;  3WU0 A;  4LMY A;  3O3K A;  4UXN A;  1ULY A;  1S7O A;  4WCG A;  1I27 A;  1KA8 A;  2F5D A;  1LB2 A;  1E2X A;  4Z2Y A;  1QPM A;  4RGU A;  2FU4 A;  3OV8 A;  4NB5 A;  3ZN1 A;  4G6Q A;  2CO5 A;  3FXQ A;  4HOB A;  3T8R A;  2AXL A;  3P9C A;  1YLF A;  1KU9 A;  3LAP A;  2ZME B;  1F1Z A;  2XAF A;  4M72 A;  3FHZ A;  3CUQ C;  2DPD A;  4ENJ A;  1O7L A;  1QGP A;  1QQI A;  4U0V A;  2ETH A;  1IZ1 A;  2P6T A;  2CWE A;  3V7C A;  5A2Q K;  4KN4 X;  4S05 A;  3QP6 A;  5KK1 A;  4H0E A;  3DPL C;  3N4M A;  3DQV C;  5JFR A;  3WGH A;  1L0O C;  2FXA A;  4OIQ F;  2BEO A;  4PDK A;  3QPH A;  3DXJ F;  3FF5 A;  3ECH A;  2A07 F;  2HKX A;  3L09 A;  1BI0 A;  2HZT A;  4OIO F;  1G6N A;  1CF7 A;  3FM3 A;  5FFX A;  4PCQ A;  4U88 A;  1R1U A;  4G6D A;  2EA4 A;  2ZXJ A;  4KYW A;  4MNU A;  3F23 A;  3M8E A;  2IP2 A;  5AIP A;  4IHT A;  1KU3 A;  3QU6 A;  3HUG A;  4U0Y A;  2H6C A;  2EFP A;  5JR3 A;  1XMK A;  2QBY B;  1GVJ A;  3B73 A;  2OBP A;  1I5Z A;  4OIP F;  3REO A;  2FNP A;  1VTN C;  2P7V B;  1PDN C;  1J0R A;  4KIF A;  1ZH5 A;  4NHJ A;  2AS5 F;  2HWV A;  1EH7 A;  3E97 A;  4ZZD A;  3ZQ7 A;  3LA3 A;  1G4D A;  1BN5 A;  3T1B A;  1R5G A;  3CDH A;  2V1X A;  2RV8 A;  2CG4 A;  2WV0 A;  4UUV A;  3WTT C;  3JW4 A;  3RPQ A;  3F8N A;  3MFK A;  1UCR A;  4OIN F;  1MJ9 A;  1R00 A;  3TO9 A;  4ENN A;  2DQR A;  2W85 A;  4L9V A;  3SHF A;  2MH9 A;  2EK5 A;  1HKS A;  1BJA A;  1IRG A;  1G3Y A;  1OYY A;  2K86 A;  1F4K A;  3VEP A;  1P4W A;  5L3B A;  5E18 F;  1XSD A;  1IXC A;  3K1N A;  3C3W A;  4RGS A;  4DNC A;  3PQK A;  2FMY A;  2TDX A;  1ZYR F;  1P92 A;  2IPQ X;  2XAH A;  4AWX B;  3IWZ A;  3WG9 A;  5HDN A;  3F3X A;  3KEO A;  4G94 A;  2IW5 A;  1QZY A;  1LDD A;  3GVA A;  1EH8 A;  4XBF A;  1K78 B;  3BRO A;  5D4S A;  3F8M A;  4EM2 A;  2KIU A;  2BV6 A;  2QUF A;  3L9F A;  1ON2 A;  3HRS A;  5DUK A;  2WC2 A;  1SD4 A;  3HSE A;  3LAJ A;  5LHG A;  3F6O A;  3CUQ B;  3HHG A;  4Y15 A;  4DQ2 A;  5FB2 A;  4Q5S F;  1R1T A;  2C6Y A;  1WKM A;  2PMU A;  3JAM Z;  1OYI A;  3FMQ A;  1YS7 A;  1B9N A;  4XLN F;  4EM1 A;  4U7B A;  1K78 A;  2RQP A;  2NRA C;  1KYW A;  5ILU A;  3GWZ A;  1A04 A;  3ERE D;  5A2Q Z;  2M8E A;  2A5Y B;  3MZY A;  4YFX F;  1ZRE A;  4L0Y B;  2IRF G;  1WWX A;  4D0P A;  2MLK A;  3Q9V A;  2RKH A;  3I54 A;  2CGP A;  1S8N A;  2H6B A;  2HTS A;  3KP2 A;  4P96 A;  2Z3Y A;  2R7F A;  4RS8 A;  3GXO A;  3IRQ A;  4M9X A;  4HLY A;  2H27 A;  3WOD F;  4HLX A;  4O5V A;  4PZJ A;  1NHA A;  5HVQ C;  2XV4 S;  5ICF A;  2EV0 A;  5J8F A;  3HTS B;  1IN8 A;  1IN7 A;  4OMZ A;  1DDN A;  1UST A;  2ZNZ A;  3JSP A;  3IKT A;  1BBY A;  4IRH A;  3GFI A;  4LLN A;  2QVO A;  3QP5 A;  2JSC A;  1T0F A;  4IRI A;  2ESN A;  2QQ9 A;  2HQR A;  2VE8 A;  2QEN A;  1OMI A;  4LFU A;  3WTS C;  2UZK A;  1IRF A;  5FD6 A;  4L9N A;  3GFL A;  2A3S A;  2DLL A;  3ZMD A;  2COM A;  3ZMS A;  2PMH A;  3V8L A;  2P7C B;  3SQN A;  2EFW A;  2EFO A;  3T8T A;  1SMT A;  4WX9 A;  2DI3 A;  4FX4 A;  2XRN A;  2M1B A;  5D5X B;  1FZP B;  3MAJ A;  4GGG A;  3H3Z A;  1TW3 A;  4B8X A;  2P6S A;  3KET A;  3ELK A;  1UFM A;  1T38 A;  4A5M A;  2R7D A;  1J7K A;  1FLI A;  3LWF A;  2QYO A;  4B09 A;  3E6C C;  1R1V A;  1TLH B;  4L9J A;  3HYI A;  3RTR A;  4HW0 A;  1I1G A;  3WTV C;  2A6H F;  3D0S A;  2LKP A;  4IRG A;  1IN6 A;  2E1N A;  3ZMU A;  3DV8 A;  2YX4 A;  3H3U A;  2XHK A;  5LGN A;  3U9G A;  2DTR A;  2DO7 A;  1I1S A;  3GLX A;  3I59 A;  3HTU A;  2E7W A;  3KLO A;  4G8X A;  1B59 A;  4G7H F;  2BE5 F;  3Q9S A;  2O3F A;  2MLG A;  5LEJ A;  4E70 A;  2YU3 A;  2KJC A;  4A12 A;  1BM9 A;  1IW7 F;  3ZMV A;  2GAU A;  2R3S A;  3ZP5 A;  3BWG A;  2PQ8 A;  4UV9 A;  3TDZ C;  3BY6 A;  2VON A;  3FM5 A;  2XAS A;  2UWM A;  1YIO A;  5BPD A;  1P4X A;  2DK8 A;  1I6X A;  1W4M A;  2OAZ A;  4GYI A;  2PN6 A;  2EV6 A;  3CO7 C;  4CXF A;  1USS A;  5ICE A;  5AON A;  3BDD A;  2W84 A;  1RNL A;  3CO6 C;  3GZ5 A;  5LLQ A;  3DKW A;  1ONV A;  4LLL A;  2DFI A;  2PBI A;  4HDU A;  1DUX C;  1REP C;  5H6R A;  1HW2 A;  1BIB A;  1FNN A;  3ZN0 A;  4UVA A;  2XAG A;  1HXD A;  1AOY A;  1FOK A;  1SD5 A;  4BHC A;  2M30 A;  4L0Z B;  1B9M A;  2GA2 A;  2PLY A;  4A2U A;  2VBZ A;  4L5I A;  5CLS A;  4M6Y A;  3ULQ B;  2VBX A;  4I0A A;  1LJ9 A;  2V1D A;  3IC7 A;  2VBW A;  3KEQ A;  1RUN A;  2NAZ A;  2FBK A; 
#chains in the Genus database with same CATH topology
 2E2H J;  2XSJ C;  3M8J A;  3J80 Z;  4MQV A;  3QYB A;  1IUY A;  4I6Z A;  4EVI A;  2OU2 A;  4P9U A;  3BR1 A;  2EJR A;  3JAM K;  3OSF A;  1FTT A;  2HS5 A;  1TNT A;  5JHF A;  5D4R A;  3TKY A;  1R23 A;  4Y13 A;  2W7N A;  3ZQG A;  1B8I B;  1JHH A;  1U0J A;  1H88 C;  4Y4R A;  1CF7 B;  3BPV A;  2JT1 A;  1ETO A;  3CJN A;  3IWF A;  4NC6 A;  4EM0 B;  3ECO A;  3VOE A;  2BY2 A;  3G71 I;  1E3H A;  2OCC H;  3H35 A;  3C18 A;  1YW7 A;  4HX8 A;  3ZR8 X;  2CUF A;  3G73 A;  2IA0 A;  3KLN A;  5EGO B;  3A01 B;  1IO2 A;  2G0E A;  1GLN A;  4BBR J;  1JUP A;  1H0M A;  4A0X A;  2HVR A;  2IS1 A;  1D3Y A;  1QPI A;  2DXI A;  1UZC A;  3IUO A;  2ME6 A;  2BYV E;  2FQ4 A;  4RB3 C;  2O03 A;  1K6Y A;  2E7X A;  2X4H A;  4M3F A;  1JJ8 C;  5H20 A;  4IQJ A;  1WVR A;  2J5P A;  1X3Z B;  2ZJ2 A;  2DA2 A;  3A4C A;  1HSJ A;  3KIO A;  3HUG B;  2F4M B;  1IUF A;  2VXD A;  2V9V A;  2ACJ A;  1EF4 A;  3WTX C;  2LY9 A;  3DP7 A;  3PIO F;  1NH3 A;  2I5U A;  3IP4 B;  2HKO A;  1WJB A;  3BG6 A;  3DWL E;  3S1M J;  4BDY A;  3LQQ A;  2OQG A;  2HYG D;  4ESB A;  2M45 A;  4HQM A;  5CVU A;  5J4V A;  3OIQ A;  4M9S A;  4BH9 A;  4FX0 A;  1ZG3 A;  4C9Y A;  4XLC A;  1E3O C;  4A0Z A;  2CFO A;  5JVT A;  4EJT A;  1U5T A;  2UUZ A;  1MBF A;  2E35 A;  1YYV A;  3DU5 A;  4U0W A;  1KYZ A;  4MGR A;  5EGO A;  4ON0 A;  3CC7 I;  1TZL A;  3CDL A;  5EEA A;  1WSU A;  1T6S A;  3DBH B;  4YRV A;  3EYI A;  4HBL A;  3D5S C;  1Y0U A;  2W48 A;  5CJ9 A;  4BXF A;  2VBY A;  2OA4 A;  2R7Q A;  3O8H A;  3P9I A;  2E71 A;  4ANJ A;  1ETY A;  2ZCW A;  2K27 A;  4ZTJ A;  3SZT A;  1DPR A;  2CW0 F;  3EPZ A;  4DZJ A;  3AG4 H;  4PGH A;  4KIB A;  4P9F A;  4LK1 F;  4PJN A;  5E79 C;  1FBQ A;  1XGO A;  2Y48 A;  2R7T A;  1MMA A;  1YW9 A;  1FPQ A;  2ADU A;  2HFH A;  2M87 A;  1RKT A;  4FT8 A;  3SJM A;  2BHZ A;  2TCT A;  2XC7 A;  4A6E A;  3M1C A;  4ASN A;  4E7L A;  2DFE A;  1WJ5 A;  4XOP A;  1OPC A;  2W24 A;  3C2H A;  3IKV A;  3H1C A;  3S14 J;  1BOA A;  3DEU A;  1P2F A;  1Z1D A;  2X1E A;  1I39 A;  3L2V A;  2L01 A;  4EGZ A;  3JR9 A;  2DA4 A;  4I09 A;  3SZP A;  1ZGW A;  1R58 A;  2OF7 A;  3K4L A;  2BY3 A;  1J59 A;  4RAZ A;  1N75 A;  4LG3 A;  5CVI A;  1XDU A;  2DQL A;  2LFB A;  1RUO A;  3KZI C;  1DU6 A;  4LGW A;  3D5R C;  4MEY F;  1FMW A;  4ZZL A;  4KIS A;  1IDZ A;  5KAF C;  3BTI A;  3BR0 A;  5D6F A;  4AID A;  2KFD A;  5JI6 A;  3GTG J;  2LMD A;  2GXB A;  1T39 A;  2HNH A;  3OOP A;  1IN5 A;  1TTY A;  2DA1 A;  2V79 A;  5LHH A;  1JKQ C;  3JSO A;  5CKT A;  1J5Y A;  5E8I A;  3L2U A;  1ERD A;  1HDD C;  1Z21 A;  5DDG A;  1XG1 A;  2LH9 A;  4CCK A;  3MKW B;  4XKW A;  3IH3 A;  3R6S A;  5ILV A;  1SVL A;  1YO5 C;  5TIS C;  1FYK A;  1YRN A;  4GYG A;  4F7Z A;  2ELH A;  2XRL A;  1PVE A;  2K9N A;  3W2A A;  3V7R A;  5M5W J;  1MD0 A;  2XGD A;  3A0H C;  1HF0 A;  2DDA A;  4IZZ A;  1WH5 A;  2CUJ A;  2M3A A;  2Y75 A;  1MNE A;  3D5L A;  5B1B H;  3KEY A;  2VQL A;  3BPX A;  3Q5F A;  5ERI A;  3QU3 A;  5GPA A;  4LB6 B;  5IOY A;  3PIP F;  1Z9C A;  2KL4 A;  5HOO A;  1MMG A;  1A36 A;  3GTL J;  2Z9O A;  3QPL A;  9ANT A;  4ESJ A;  3OYG A;  3H9Q A;  1BW5 A;  2KLO A;  1QZZ A;  5LRR A;  3TQN A;  2JPB A;  1F36 A;  1FX7 A;  2FA5 A;  1XCV A;  5FLX Z;  2DMQ A;  2XPV A;  1G3S A;  1IXS B;  3P7N A;  4C3J J;  2XKP A;  1YX3 A;  3AAF A;  1A6Q A;  4XL9 A;  4M6V A;  2ESH A;  3LSH A;  3MN2 A;  2CRG A;  4WXD A;  3OYF A;  2OPT A;  1D1C A;  1Y0N A;  1Z6T A;  1FYM A;  2X6W A;  4HZF A;  3ZMT A;  3OWT A;  1U9N A;  3NRV A;  3HRU A;  2G7U A;  3J7A Y;  1R5H A;  3F9K A;  3WU2 C;  4KUM A;  4IPA A;  4LJZ F;  1S7A A;  3I55 I;  1RIO H;  1MBK A;  4E7K A;  1WRJ A;  2GQQ A;  5E3L A;  5ICG A;  1K83 J;  3IV5 A;  1WCM J;  2KZV A;  4HG2 A;  1A5J A;  1ZG1 A;  2A61 A;  2FBI A;  3ROU A;  1V3F A;  5DEQ A;  1BIA A;  1J9I A;  5E3M A;  1RR7 A;  3GUD A;  1SC7 A;  3PO2 J;  4KA4 A;  4CDG A;  4YG2 F;  4M74 A;  4BNC A;  2L54 A;  1T98 A;  5DM6 F;  2ZSH B;  1R71 A;  1BA5 A;  2O8X A;  2EA2 A;  3LL7 A;  1BI1 A;  3GO5 A;  4S04 A;  2LC2 A;  1T2K A;  3FK7 A;  4DIQ A;  2EZL A;  5C3E J;  2R7R A;  1FBS A;  1LDK B;  1QHG A;  4N9I A;  1OR7 A;  3QAH A;  1MJA A;  2DJN A;  2VUM J;  1AA7 A;  2JJ7 A;  1Z7U A;  4XSX F;  1APL C;  5IPA A;  1VZ0 A;  3I53 A;  3FK6 A;  5HOD A;  4HDV A;  3FIS A;  3AL0 C;  3HGG A;  5F0F A;  3OYH A;  2HPM A;  4ZH4 F;  3C2B A;  2JVH A;  4DW6 A;  3HC7 A;  2G7H A;  1KQ0 A;  3I64 A;  2CV2 A;  3C2G A;  1FT9 A;  2RVC A;  2R5Z B;  2H8W A;  3CCR I;  4BE2 A;  1TQI A;  1G2H A;  4V2F A;  2KZG A;  2DOE A;  1XGS A;  2M8G X;  4EAT A;  2BBY A;  2F5V A;  2IJL A;  2M34 A;  1R36 A;  4GCV A;  2IGN A;  2JUC A;  2WAQ A;  4QLC U;  3KP3 A;  1A6I A;  1ZRF A;  2M0M A;  2OV7 A;  2RC4 A;  4CA0 A;  2GIV A;  1JGS A;  5F04 A;  1W0T A;  1YJ9 I;  1T33 A;  3FZV A;  4BU2 A;  2V1N A;  3PSF A;  3K1P A;  1K7A A;  3JRI A;  3PL8 A;  5BNG A;  3QPT A;  3LSR A;  3EUH C;  4P55 A;  1HW5 A;  4EJO A;  3D1N I;  3V4G A;  2V7F A;  4OU0 A;  3RYP A;  2QSH X;  3GFM A;  1K79 A;  3ONQ A;  1GXP A;  4BQA A;  5K5Q A;  1VQ8 I;  2R92 J;  2EPF A;  2DMU A;  4X1E A;  5DCM A;  2MBF A;  1FSE A;  5K5R A;  2XF6 A;  2EWN A;  2MA3 A;  5ILS A;  1O3R A;  1LEA A;  2UXX A;  1ORK A;  2IGO A;  1Y8R B;  3SEZ A;  3E5U A;  2PEX A;  2OQR A;  1BI2 A;  1FP2 A;  2XAU A;  1Z0X A;  3F8B A;  3WE3 A;  2FSW A;  2KPM A;  2L9S A;  2VXZ A;  2DFF A;  5C4X J;  3H5R A;  3K1M A;  2Y69 H;  3ZQH A;  2VT3 A;  3TW7 A;  2LNB A;  3K4K A;  2M7B A;  2KKO A;  3S2W A;  2DA6 A;  2W25 A;  3HOW J;  5D6E A;  4EJV A;  2M4G A;  3PSI A;  1B6A A;  2I10 A;  3PNV A;  5F0C A;  5L3C A;  1IG7 A;  1FBU A;  3J80 K;  2B9S A;  1PP7 U;  2OTL I;  2WV1 A;  3K2Z A;  4XOT A;  3CES A;  4D9J A;  5KAI C;  4II3 A;  5LRS A;  2WB1 N;  1B4A A;  4ENM A;  2VJJ A;  1VQM I;  1PJR A;  4KIC A;  4GO1 A;  1E17 A;  2YS9 A;  1MSF C;  2WWY A;  3DTK A;  1D1B A;  3O6B B;  3OYN A;  1G3W A;  3L00 A;  1W7P A;  5CYV A;  3COA C;  1V5G A;  2B0L A;  2FNA A;  4ZYA A;  4EJW A;  4BJT A;  2CQK A;  3I0T A;  2LR8 A;  1X58 A;  1J09 A;  5HLI A;  5B3S H;  4ENK A;  3K0L A;  1JUM A;  2E5Z A;  4KMU X;  1D0Y A;  4U87 A;  5IP7 J;  4GFB A;  3GX4 X;  3UKG A;  5IT9 Z;  2ISZ A;  5FKN A;  3PNY A;  4HYE A;  2R5Y B;  4RB1 A;  2E36 A;  4KIG A;  1U5T C;  2YPR A;  2BXY A;  2ECC A;  2RQQ A;  4HRI A;  1WJE A;  2RDP A;  2VAS A;  3K7A J;  3KP6 A;  2G9W A;  2X0L A;  1D8K A;  5DYM A;  3OYM A;  3F22 A;  2NVT J;  3TOA A;  5KNL A;  3U1K A;  4BL0 B;  1HQC A;  1QNT A;  2GM4 A;  2MD0 A;  4R1H A;  5IYC J;  4D5F A;  5ED4 A;  1J2X A;  2KDZ A;  3TP0 A;  2B7E A;  2NVU B;  2VC0 A;  1WHU A;  3FMR A;  3JRF A;  2MD5 A;  1JT0 A;  5FD5 A;  1ZAR A;  2GWR A;  3R60 A;  2PJP A;  1R7J A;  4FE4 A;  2L5Q A;  3R4K A;  2O61 A;  3JTG A;  3HKZ N;  3KZZ A;  4OOI A;  3ZQC A;  2RNJ A;  2KIS A;  4UNO A;  3F72 A;  4M3D A;  3BZC A;  1E3P A;  1P9Q C;  4KT5 C;  3CTA A;  3I59 B;  3K4B A;  4PJ0 C;  2LKS A;  3GF2 A;  2MH2 A;  4OIR F;  5KHD A;  2FOK A;  5L3F A;  1H9T A;  2CS3 A;  1KQ9 A;  1OKR A;  2HXI A;  4UUS B;  4MEX F;  1U6G A;  3K9T A;  2CQ7 A;  2XF7 A;  3LFK A;  2Q0O A;  4RA2 A;  2CW7 A;  4ESF A;  2L4M A;  1LE8 B;  4XN3 A;  4I2O A;  3BZ6 A;  1GHC A;  3I5U A;  4RLQ A;  1GXQ A;  2HDW A;  2WTE A;  1R6R A;  3S8P A;  4HAM A;  4CCN A;  2IA2 A;  3DLL F;  1X3W B;  3U2R A;  3A03 A;  2DAO A;  2F2E A;  4Y17 A;  1SD7 A;  2D1H A;  5DCF A;  3BR3 A;  4E7Z A;  3W6K B;  4CGZ A;  1FP1 D;  2QWW A;  3IL2 A;  1N78 A;  2BY0 A;  2ZNY A;  1QBJ A;  5IP9 J;  2P4W A;  4YFN F;  3LSP A;  2NNN A;  1XN7 A;  4DZP A;  2X48 A;  2Z5U A;  4CO8 A;  3HRM A;  1FWZ A;  5HS8 A;  1SAX A;  1FOX A;  4N4O B;  3O2P E;  4I02 A;  4UUS A;  3CMA I;  2HVQ A;  3KP5 A;  1CGP A;  2MFZ A;  1YQA A;  2A05 A;  4B1R A;  4CYC B;  5FKM A;  3ZXS A;  2BXZ A;  2HOT A;  2JSP A;  3RKY A;  5BMZ A;  2LY1 A;  1LE8 A;  4D7N A;  4AYB N;  1O7F A;  2KRF A;  1YIJ I;  2EB7 A;  3BLY A;  4UVB A;  3OR1 C;  5J8C A;  1PP8 F;  3CDI A;  2XRO A;  2Z99 A;  3HOY J;  1W7P D;  5F0H A;  5FLM J;  1LFP A;  1WQ2 A;  3VB2 A;  3NWS A;  3LQR A;  1FSH A;  3WU1 B;  3EET A;  4O6J A;  3NAR A;  1OCR H;  1TBX A;  3CC2 I;  5DV5 A;  5BPI A;  1YJN I;  4XKV A;  1ZHF A;  5L3G A;  3QOE A;  3AL0 B;  1YS6 A;  2VC1 A;  4DYQ A;  3MMY B;  1P6R A;  3GEZ A;  5DD8 A;  3ZMZ A;  4UHT A;  4KNY A;  3OL3 A;  4AIH A;  2V9P A;  1MDM A;  3S2H J;  3ABT A;  1NG7 A;  2Q1Z B;  3VYU B;  2HGC A;  3H9G A;  4YII A;  3DKX A;  3VSL A;  3OL4 A;  1Q1H A;  5GPC A;  2GOM A;  2F6C A;  2XVC A;  2DT6 A;  1B1B A;  3QYF A;  2EFN A;  2CUZ A;  1YTY A;  2LSO A;  1IAW A;  2F5C A;  4A3F J;  4RBO A;  1KQ8 A;  1LDJ A;  5HDK A;  2VE9 A;  2XDV A;  5FLX K;  5JLX A;  2DT5 A;  3PQJ A;  2QSF X;  5HS9 A;  5H6Q A;  4AIJ A;  1ETX A;  4RM3 A;  2M2E A;  2YX7 A;  4ABZ A;  2W57 A;  1SD6 A;  3W6V A;  1XSV A;  4JOM A;  4HF0 A;  1RZ4 A;  4LD5 A;  3V7S A;  4NQW A;  4J01 A;  2XAQ A;  3A1Y A;  2E19 A;  3E5X A;  2E2J J;  1O3S A;  1UG0 A;  4B4C A;  2MYS A;  2B63 J;  1MJB A;  2P5L C;  3GYH X;  3K70 D;  3MZH A;  2CH0 A;  2OUM A;  4XSZ F;  5J1U A;  3N97 A;  1HLV A;  2KIM A;  2RN7 A;  3BR2 A;  3I4P A;  1FIP A;  2ZJQ F;  3WTW C;  1U2W A;  1VND A;  3FXR A;  4MO7 A;  3CF5 F;  1J75 A;  1V4R A;  3IAS 2;  2VOO A;  1OR7 C;  1R4M B;  3BT9 A;  4QWQ A;  4Y33 A;  1IF1 A;  2HDC A;  2PFB A;  2DK5 A;  2QZ8 A;  3H0G J;  3F21 A;  1UHM A;  3OIP A;  3WGG A;  1STZ A;  2D45 A;  3BJA A;  4XIC A;  2EZH A;  4JK1 X;  3EUH A;  4B44 A;  3J81 Z;  1F9N A;  1S5L C;  2XAJ A;  3F8C A;  3CMY A;  1YI2 I;  1ZGJ A;  1ETV A;  4HX4 A;  1OYW A;  2DA5 A;  3C7J A;  4M73 A;  2NS0 A;  1ZKG A;  4A5N A;  5J6X A;  3HOS A;  2ZC2 A;  3E6D A;  2XGE A;  4HQE A;  2HYF A;  1AWC A;  5EEG A;  1Z3X A;  2YR2 A;  3UR3 C;  5E20 A;  2E5N A;  2L4A A;  2DMN A;  3MKY B;  3KCC A;  3RDI A;  2LOO A;  1EH6 A;  3IRR A;  1ETK A;  1O3T A;  4G7Z F;  3E5Q A;  2ZKZ A;  3GLL A;  1JT6 A;  2VQG A;  4CYD A;  1XS9 A;  1U5T B;  3M8F A;  2HQN A;  3V8K A;  4Q47 A;  1YIT I;  1K6O A;  3CF2 A;  2N8G A;  4PSX A;  4CCM A;  4LG0 A;  3S3O A;  1TC3 C;  2YUS A;  4CZZ A;  5ICC A;  4M6X A;  4BGD A;  3E6B A;  3T0Y A;  1YFH A;  2PJR A;  2CU7 A;  2XKO A;  3BOQ A;  3HSF A;  1ETW A;  1Y6I A;  3HRT A;  3QQA A;  3ZPL A;  1BI3 A;  4OAY A;  2R7S A;  3FBN B;  3RJP A;  3Q0U A;  3K6G A;  3C1D A;  1X1P A;  1HBX G;  2XIG A;  1W1W E;  3ABU A;  2NS8 A;  4IX7 A;  5E8G A;  1IXR C;  2VKD A;  2PG4 A;  2VIX A;  2IS2 A;  1LEB A;  1TQM A;  2GXA A;  2BZT A;  1TWF J;  2WB1 A;  2BGC A;  5F6F A;  2K9M A;  1OCC H;  2NVY J;  4DGW B;  4AIK A;  3VDX A;  3S2D J;  4PFO A;  4NC7 A;  3HSR A;  4B47 A;  2EV5 A;  2OZU A;  1WI9 A;  3K10 A;  3GTP J;  3RKQ A;  2X6Y A;  4JQF A;  2AHQ A;  3U21 A;  3MWM A;  4HEA 2;  5J3L A;  4O3M A;  3OIO A;  1TWA J;  5GAG J;  2K4J A;  3ASO H;  3TO6 A;  1JE8 A;  1LPQ A;  3FKJ A;  4FE7 A;  3S1R J;  1ETQ A;  2M5W A;  1U9O A;  2AQE A;  5KVR A;  1HW1 A;  2QQA A;  2ZME A;  4BBS J;  1UHS A;  5LGU A;  2MAB A;  1HKQ A;  1LNW A;  3B02 A;  4X0G A;  4IHY A;  5D5U B;  1JI8 A;  3HB9 A;  3JRG A;  2FF4 A;  4DOZ A;  2LTP A;  2E2I J;  3HG9 A;  5GAE J;  1TL8 A;  1W5S A;  2DU9 A;  3E1S A;  3JRC A;  1QA6 A;  4H4K C;  1W5T A;  2GIZ A;  2JZY A;  4PSW A;  4L9T A;  1FY7 A;  2VJ5 A;  4GXO A;  4NUB A;  4JBA A;  2JA5 J;  1ZLK A;  2K40 A;  1XGM A;  1HST A;  5FRM A;  2H1L A;  3MQ0 A;  3S93 A;  4A3M J;  3KP4 A;  4R79 A;  3CCM I;  5IP6 A;  4XLP F;  3CP2 A;  3DPT A;  4I99 C;  3R0A A;  4KFC A;  3CCQ I;  3LA7 A;  1N77 A;  2TRT A;  1XD7 A;  2F5F A;  2FML A;  5LBQ A;  1YRN B;  3HKZ A;  4D5C A;  5LHI A;  3VWB A;  3JRA A;  1SFU A;  5IT9 K;  3LMM A;  5IT3 A;  3FX3 A;  5D5W B;  4IXA A;  4RB2 C;  1G59 A;  3CQZ J;  3TL4 X;  4U7D A;  2GA1 A;  2A6E F;  3DLA A;  1UB9 A;  3M1E A;  2D2W A;  5BQT A;  2O0Y A;  2ME0 A;  1ZN2 A;  1XCB A;  1W0U A;  1YW8 A;  2CMP A;  3DFG A;  4ZYD A;  1NG6 A;  3TW6 A;  5EJC A;  1Z91 A;  3RI4 A;  3GW2 A;  3HHH A;  3IHU A;  3MD2 A;  5L3D A;  3MKZ A;  2JQ7 A;  5E1W A;  4XRM A;  2K7L A;  3K70 C;  4A0Y A;  1IRX A;  4AVZ A;  2ZFW A;  1MKM A;  5EZG A;  4KT6 A;  3FXM A;  3TBI A;  2JA7 J;  5JVG F;  5C44 J;  2IAI A;  3BP8 A;  4KDP A;  3M7G A;  4FAS D;  1OQY A;  2KIF A;  1W5C C;  4I76 A;  4IF4 A;  1EA3 A;  1WZ2 A;  4YIR X;  1T8I A;  3EYY A;  2OD5 A;  1D5Y A;  1NK3 P;  4GRI A;  4DBR A;  1RES A;  2QBY A;  3FWE A;  2FE3 A;  2LRE A;  4HF2 A;  4Q4Z F;  3GTQ J;  1UG2 A;  3ML6 A;  4QPQ A;  2FUG 2;  4MTE A;  2X9D A;  2W82 A;  3RCO A;  3S3M A;  4XKC A;  1IRZ A;  2Y30 A;  2L7F P;  4BDZ A;  2HTJ A;  3JTH A;  1XGN A;  3AFH A;  2L9R A;  2Z1D A;  2COB A;  3U1D A;  5LD2 C;  2VJ4 A;  1B72 A;  2GBY A;  4AYB A;  5F27 A;  2Q2E B;  4LLG F;  5HLT A;  4A69 C;  2VN2 A;  4J00 A;  2DFH A;  2DN0 A;  3HZJ A;  1MMN A;  3HM5 A;  2ZBK A;  3G1M A;  5M5Y J;  1RR8 C;  1JXS A;  4MTD A;  2MC3 A;  4K2E A;  5F64 A;  2LF8 A;  1BR4 A;  1SFX A;  1Z05 A;  1WI3 A;  3K4N A;  3NQO A;  3M3Y J;  2J5O A;  1S6L A;  4ETS A;  3FHN A;  4KMF A;  1U3E M;  1T95 A;  4RGR A;  2M7A A;  3SFZ A;  1D5V A;  4I01 A;  3FIW A;  3R61 A;  4RB0 A;  3RKW A;  3WE2 A;  5D8K B;  2WY7 Q;  2XUB A;  1D1A A;  2DTZ A;  3VFZ A;  1FYL A;  1Y39 A;  3CLO A;  3L2C A;  3S32 A;  2QF7 A;  1RI7 A;  1R4N B;  3OYL A;  4P5O A;  1K4S A;  2LDU A;  2VB6 A;  4JYK A;  5H2F C;  5GTH C;  2A6T A;  4BEH A;  2OC6 A;  4IJA A;  1D0X A;  3KZY A;  1O57 A;  1VF9 A;  5FKO A;  4E4H A;  4YFK F;  1OIS A;  3QRF F;  5BOX A;  3G4S I;  3DKY A;  2Q2E A;  1KU7 A;  5J4Y A;  3PUF A;  5FFZ A;  1F5T A;  1TQP A;  2NVQ J;  1EJ9 A;  4M9Z A;  2Y31 A;  4NDL A;  4ZYH A;  5HLH A;  1ZRD A;  4A3B J;  2K9Q A;  1GUU A;  3WTY C;  4AUX A;  3HL2 A;  2UXN A;  4Q48 A;  1XMA A;  2QLZ A;  4MFD A;  4XM3 A;  5EF6 A;  1P4A A;  3G3Z A;  4BXU A;  5M3F J;  2R7Z J;  3MKL A;  4WXH A;  4MIM A;  1POG A;  2P8T A;  1VQK I;  1IN4 A;  4RAF A;  3WGI A;  1YE9 A;  2ISY A;  2HOE A;  3E7L A;  1G3T A;  2KQR A;  4XLA A;  5BS6 A;  1X1A A;  3LA2 A;  3CJR B;  1U78 A;  1JKO C;  1DP7 P;  1V5E A;  2KP6 A;  1MBG A;  2VT2 A;  2K4B A;  5DCM B;  2X1C A;  2X6O A;  3EQL F;  2QKL B;  3TOB A;  1JTY A;  5K1Y A;  4AD9 A;  4L5J A;  2V26 A;  4KIT B;  2VI6 A;  2E60 A;  2L7M P;  3M9A A;  4PUS A;  5M3M J;  3OSG A;  3FBI B;  2HXO A;  4ZDP A;  1LFU P;  5HDG A;  2JRT A;  2O6G E;  3TO7 A;  1MH3 A;  4A6D A;  5DD4 A;  2CV1 A;  5EEH A;  2Q8K A;  2D1V A;  4G7O F;  2Y0M A;  2NNY A;  1KZH A;  4P1W A;  2NVX J;  2JUG A;  5HS7 A;  4FTH A;  1BC8 C;  3GCM A;  2FOW A;  4F52 A;  3VOD A;  2QQB A;  1NTC A;  2F5E A;  2LLK A;  3ABL H;  5FO5 A;  3RIR A;  1IJW C;  4PGG A;  1ODD A;  2JPC A;  2YSR A;  4HX7 A;  2P5K A;  2FQ3 A;  2CFX A;  3LSM A;  1MMD A;  4EGY A;  2WY8 Q;  2IT0 A;  3CUQ A;  2Z33 A;  1W7P B;  1GV5 A;  3HPH A;  2CQX A;  4IOC F;  2NOJ B;  2V9K A;  2L2O A;  3BTC A;  4ZYE A;  1C0W A;  2RGV A;  5F08 A;  4FCY A;  3GTM J;  2HEO A;  1ON1 A;  2FRH A;  3J81 K;  3RYR A;  1WJA A;  4MLO A;  3X2Q H;  2BVL A;  5FRO A;  3H5N A;  1TNS A;  3CME I;  2CV0 A;  1MBE A;  3P9K A;  4QIW N;  2PI0 A;  5IOZ A;  1T08 B;  1JHF A;  1KU2 A;  1XC5 A;  2L9V A;  3E3V A;  5J40 A;  4CCO A;  3KYL A;  4C2U A;  2DMP A;  3LST A;  4DBQ A;  1SFK A;  1XTA A;  2IXS A;  2LP0 A;  3RSN A;  3B6C A;  3ABK H;  5FLV A;  1QO0 D;  1RET A;  1R22 A;  3T5X A;  3KE2 A;  3AG1 H;  4A3L J;  2IVM A;  1A35 A;  4DYC A;  2DOD A;  2DA7 A;  4ZTF A;  1ZR4 A;  2LG4 A;  2R4G A;  4N9H A;  1XB4 A;  1QRY A;  1FOY A;  1V5F A;  4CIC A;  1MW7 A;  2VPL A;  4XRF A;  3F6V A;  3SZG A;  3FMS A;  3ZGK A;  2VOD A;  2CUE A;  2K9L A;  3KP7 A;  1K61 A;  1XSX A;  1S29 A;  2CSO A;  2OZ6 A;  2BHY A;  3OS0 A;  4HA8 A;  3CCV I;  4PJJ A;  3DPU A;  4B48 A;  2ZME C;  4BAY A;  1OCZ H;  1P7I A;  3H92 A;  4ZYG A;  4Y52 J;  2FBH A;  4CUG A;  3CD6 I;  4BY1 J;  2V1U A;  1ZGA A;  1H8A C;  3DF8 A;  2F4I A;  4G9Y A;  4ZC3 A;  1Z6R A;  2LRD A;  2ZJP F;  1MND A;  2XB5 A;  3J7A O;  2L02 A;  1ZAO A;  3RKX A;  3BJ6 A;  1ZRC A;  3ESW B;  1BC7 C;  3V8J A;  2LYC A;  4AU7 A;  4NC8 A;  1V54 H;  4HF1 A;  4LB5 A;  1T56 A;  2W1O A;  2XPW A;  4BHP A;  1I3Q J;  1U8R A;  1DU0 A;  3N05 A;  4BY7 J;  1JUS A;  4IHS A;  3JRB A;  4B3A A;  5E1Z B;  1WJC A;  3MVP A;  5CVJ A;  4XRS G;  5KCM A;  3A0B C;  2XF5 A;  3GFJ A;  4XRS A;  1OCT C;  1SFO J;  2PX9 A;  1LVK A;  1XDS A;  2CYY A;  4M3B A;  5LGT A;  4OMY A;  2DJI A;  3HEF A;  2H8R A;  1X2M A;  2EH3 A;  4DYR A;  4IO9 F;  1X1D A;  2FD5 A;  4N0B A;  3HOT A;  3VYS B;  1ZLJ A;  4FHT A;  4KN7 X;  2DW4 A;  4L5E A;  3RQ4 A;  3PFI A;  1UHW A;  2EFQ A;  2WAD A;  4I0B A;  2A69 F;  3ABM H;  1X3U A;  4LK0 F;  3QYE A;  2Z16 A;  5CVV A;  1LVA A;  3QOP A;  1UJ8 A;  4I98 B;  4BYY A;  4MQ9 F;  5FGM A;  4XQF A;  4C3H J;  3EDP A;  1RC9 A;  5F1R A;  5LFA A;  2NYX A;  2LF7 A;  3TDU C;  1X1B A;  1KON A;  3RPU A;  4HV6 A;  3OYA A;  2HZD A;  3FXL A;  4IHX A;  3BJO A;  4XN0 A;  5E1X A;  5K5O A;  3SFI A;  1ZR2 A;  1MDM B;  2O9L A;  5HNH A;  4I7H A;  3K69 A;  4IOA F;  1BJZ A;  2VKE A;  1ZG5 A;  3W6J B;  5B66 C;  5CVR A;  4J19 A;  1H9G A;  1SMY F;  1QVU A;  2WA0 A;  1TWH J;  4XKB A;  1TT5 B;  2AQF A;  4BHB A;  3G6E I;  3I58 A;  3HIF A;  2HR3 A;  2HDD A;  2LD5 A;  2I8D A;  4RAY A;  1MZB A;  1RRJ A;  3CUO A;  1OCO H;  5IYD J;  2NS7 A;  4M71 A;  5TJJ A;  1IV8 A;  2RAE A;  3KFW X;  2NOG A;  2P5V A;  3OYB A;  2H09 A;  2EBI A;  3I4N J;  3LSJ A;  4V19 K;  3LFU A;  3H9J A;  3NEU A;  4EJU A;  2E1M C;  4NQW B;  2O8K A;  2VOP A;  2A68 F;  2XGX A;  1TW2 A;  5E17 F;  2V6C A;  1ZTR A;  1BW6 A;  2M4K A;  3FXU A;  4C30 A;  4ZJZ A;  2QM3 A;  2LBF B;  3E6M A;  4EMS A;  2GOX B;  4TV7 A;  2X51 A;  1R49 A;  4PK4 A;  1PUE E;  1MGT A;  1SFE A;  2DBB A;  4EQQ A;  2E1C A;  1HKT A;  3L7W A;  4UVC A;  3AG2 H;  1L3L A;  2GZW A;  3E0J B;  4R8H A;  2R0Q C;  2EZI A;  2JTV A;  4G6T B;  4EEF G;  1FJL A;  2Y0S N;  1VQO I;  1D8J A;  3K4M A;  2QQ8 A;  1OLT A;  5TRD A;  1LUJ B;  4HV5 A;  2ZO4 A;  4WK8 F;  1NK2 P;  4EV0 A;  2AO9 A;  4L18 B;  1FIA A;  3GTK J;  2L3D A;  4WF2 A;  3WTU C;  3MEX A;  1ITY A;  3P5J A;  4CZC A;  1KGS A;  5EYR A;  4PJM A;  3RQI A;  3RZD J;  3OMY A;  2HQ5 A;  2GXG A;  6PAX A;  3OYC A;  4AVP A;  2A5W A;  4IVN A;  3MCZ A;  2JVG A;  2LBF A;  3K4J A;  2FEZ A;  1ENH A;  2STT A;  3FKI J;  3WHB A;  1XPX A;  4X6A J;  2H94 A;  3WTZ A;  3R0J A;  1SVM A;  3TGN A;  2K02 A;  3BG3 A;  4WWC A;  2DPU A;  1F43 A;  1EV7 A;  5D8L B;  3IAM 2;  2KHM A;  5D5V B;  3F8F A;  2XSD C;  1V55 H;  4RGX A;  4HST A;  3I71 A;  1S3J A;  3SXY A;  4YIF A;  5AIQ A;  5LEK A;  2KJB A;  1O3Q A;  4W97 A;  2STW A;  3DEW A;  2JWT A;  3ISP A;  4LG0 B;  3W2V A;  1DPU A;  1FC3 A;  5DUI A;  5HLG A;  3BCB A;  2PJR B;  4BQO A;  1LQ1 A;  4WXC A;  1YG2 A;  3GZ6 A;  2BY1 A;  3DU6 A;  4A3K J;  4CHU A;  1FOW A;  2IA1 A;  1PUF A;  2Y9Y A;  4UV8 A;  2XPU A;  4MHG A;  5EG0 A;  5JHU A;  3KPH A;  3RPU D;  3WU0 A;  2MG4 A;  2MC4 A;  5J1Y A;  1UAA A;  4LMY A;  3O3K A;  4A3I J;  4UXN A;  1ULY A;  2O7O A;  1S7O A;  2VQC A;  4WCG A;  4A3D J;  3HDD A;  4CSW A;  1I27 A;  1KA8 A;  4BQN A;  3CMM A;  2ZB9 A;  2F5D A;  2OTJ I;  1LB2 A;  4E6K G;  3LSG A;  1E2X A;  4Z2Y A;  5IYB J;  3UNG C;  3HBL A;  1QPM A;  4RGU A;  2FU4 A;  2MGQ A;  3OV8 A;  1N25 A;  4NB5 A;  1VQP I;  3ZN1 A;  4G6Q A;  5E3N A;  2CO5 A;  3FXQ A;  4HOB A;  3QOD A;  3T8R A;  2AXL A;  3P9C A;  3ZRG A;  1YLF A;  1KU9 A;  3FXK A;  1GT0 C;  5DM7 F;  3TMO A;  3LAP A;  4XON A;  2ZME B;  5CPR B;  3DCF A;  1F1Z A;  2XAF A;  4M72 A;  2DOF A;  3FHZ A;  3CUQ C;  2DPD A;  4ENJ A;  3H36 A;  1JTX A;  1O7L A;  1QGP A;  3ZQL A;  1VQN I;  1HOM A;  1QQI A;  4BXX J;  4D1Q A;  4U0V A;  2ETH A;  2L0K A;  1IZ1 A;  2P6T A;  2CWE A;  3DBL B;  1DGR M;  2W00 A;  1RKW A;  3BQZ A;  3HGY A;  3V7C A;  3ZCO A;  2EIN H;  1W36 C;  3CP8 A;  2EIL H;  1JJ6 C;  4ITV A;  2P0W A;  4PFP A;  2VPR A;  4JX5 A;  2CQQ A;  2WAE A;  5A2Q K;  3BTJ A;  1GV2 A;  4KN4 X;  4S05 A;  3QP6 A;  5KK1 A;  4H0E A;  1WJF A;  3DPL C;  4XMY A;  2QCO A;  5DS9 A;  3N4M A;  3M4O J;  2IS4 A;  2DYS H;  3DQV C;  5JFR A;  3WGH A;  1IV6 A;  2ZFU A;  3NWT A;  1L0O C;  2FXA A;  3L2R A;  4OIQ F;  3I4M J;  1GDT A;  3S17 J;  2BEO A;  3BG7 A;  3PFY A;  3QPH A;  3DXJ F;  3FF5 A;  4PDK A;  3WHC A;  1QHH D;  1JKP C;  1VQ5 I;  4NBQ A;  4OWR B;  3ECH A;  2EIM H;  2A07 F;  2HKX A;  4FQG A;  3L09 A;  1BI0 A;  2HZT A;  2VLA A;  4JX6 A;  5EDN A;  4XK4 A;  1Y1W J;  3J7Y J;  2BOL A;  1B8I A;  4OIO F;  1DGW Y;  1G6N A;  3NAU A;  2ZXH A;  2ID3 A;  1CF7 A;  5FRN A;  2DDB A;  4RMN A;  3FM3 A;  5FFX A;  5IY5 H;  4PCQ A;  2DCE A;  1U8B A;  2E1O A;  1Q1V A;  1R1U A;  4U88 A;  2KDO A;  4G6D A;  5GAH J;  2EA4 A;  3ZQQ A;  3A01 A;  3S1Q J;  2VKV A;  2ZXJ A;  4KYW A;  4MNU A;  2JA2 A;  3F23 A;  1K4T A;  2JMW A;  3M8E A;  2IP2 A;  4HSR A;  5JLW A;  1T0F C;  5AIP A;  4IHT A;  1KU3 A;  3QU6 A;  5J47 A;  3HUG A;  3CJQ B;  5GTI C;  4U0Y A;  1ZQ3 P;  2H6C A;  3DEE A;  2EFP A;  5JR3 A;  3BG9 A;  3VYT B;  4ZDO A;  3K2A A;  3ASN H;  1XMK A;  2QBY B;  1GVJ A;  5DTD A;  3M07 A;  3B73 A;  4UB8 C;  1Y56 A;  4LIV A;  1SEU A;  2OBP A;  3PUB A;  4W1U A;  2K3P A;  1I5Z A;  2ICW G;  4OIP F;  1VQL I;  1HA8 A;  1R9T J;  3REO A;  4E7J A;  2FNP A;  1XX5 A;  1WH7 A;  1TWC J;  1VTN C;  3JRD A;  4C2T A;  1B72 B;  2ZXW H;  2P7V B;  1H89 C;  3OR2 C;  2X85 A;  2K85 A;  1PDN C;  3WG7 H;  1J0R A;  3A2K A;  4RM2 A;  4UY8 I;  2R7W A;  2KT0 A;  2E1M B;  4KIF A;  1ZH5 A;  4RDU A;  5E3O A;  4NHJ A;  2ELK A;  1LKX A;  3RZO J;  1RPW A;  2AS5 F;  2M9H A;  4IHV A;  2HWV A;  3OOU A;  4Z6Y A;  1EH7 A;  2WAF A;  2K5C A;  1S7E A;  1TWG J;  3E97 A;  4ZZD A;  3L1P A;  4XLE A;  3ZQ7 A;  3CCJ I;  3LA3 A;  1G4D A;  1BN5 A;  3T1B A;  1R5G A;  2PMZ N;  3CDH A;  2V1X A;  2RV8 A;  2CG4 A;  3S3N A;  4FIS A;  4RLF A;  1FEX A;  3H5A A;  1EKE A;  2WV0 A;  4UUV A;  1MBH A;  2FJ1 A;  3WTT C;  1JGG A;  3V42 A;  3JW4 A;  3RPQ A;  4BS9 A;  3F8N A;  2DYR H;  2HQA A;  3CCY A;  3MFK A;  4BEH B;  1UCR A;  3HXL A;  4A93 J;  4QPO A;  4OIN F;  3G1L A;  1MJ9 A;  1R00 A;  2LVS A;  3TO9 A;  4ENN A;  2DQR A;  2W85 A;  2JA6 J;  4L9V A;  3SHF A;  5B5E C;  2EIJ H;  2MH9 A;  2EK5 A;  3JRH A;  4RAG A;  1ZEL A;  1VQ9 I;  1HKS A;  1UEL B;  3QWL A;  1BJA A;  1MH4 A;  2O5R A;  1IRG A;  1G3Y A;  1SAN A;  4A3C J;  1UMQ A;  5M5X J;  1Z3Y A;  1PYV A;  1OYY A;  4XNF A;  2F48 A;  3G1O A;  2K86 A;  4JP0 A;  3LNQ A;  2CQN A;  1F4K A;  3VEP A;  3IH2 A;  1P4W A;  5L3B A;  5E18 F;  2KRC A;  1LFB A;  2FX0 A;  1XSD A;  1IXC A;  3K1N A;  3O8G A;  3C3W A;  4RGS A;  4DNC A;  4A3E J;  2Y0S A;  3HJE A;  4HPQ A;  2LKX A;  3PQK A;  2KRH A;  4BE1 A;  5FJ8 J;  4F93 B;  2FMY A;  2AXT C;  2TDX A;  2R7U A;  1ZYR F;  1P92 A;  3BCA A;  2IPQ X;  2XAH A;  3QPS A;  1JKR C;  4AWX B;  3CCU I;  3IWZ A;  3WG9 A;  1Y1V J;  4UB6 C;  3F3X A;  2DMT A;  3KEO A;  5HDN A;  4G94 A;  3OYE A;  2IW5 A;  2Z2S B;  1QZY A;  4E7S A;  1LDD A;  3GVA A;  1EH8 A;  4XBF A;  1K78 B;  3BRO A;  5D4S A;  1Z77 A;  3F8M A;  4N4N B;  2BVM A;  4EM2 A;  2KIU A;  2BV6 A;  3I56 I;  2Y2Z A;  1QU3 A;  2QUF A;  3L9F A;  3K4C A;  2V6E A;  4IEJ A;  1ON2 A;  3HRS A;  5DUK A;  1HCR A;  2WC2 A;  1VQ7 I;  1SD4 A;  3HSE A;  4IL6 C;  3LAJ A;  4M3G A;  3DTI A;  1YX5 A;  5LHG A;  3F6O A;  5GAD J;  3B6A A;  2DA3 A;  3CLQ A;  4HNU A;  4BQQ A;  2K9S A;  5K7Z A;  3CUQ B;  3HHG A;  4II2 A;  4Y15 A;  4CH7 A;  4DQ2 A;  2EQR A;  1D0Z A;  5FB2 A;  3CCL I;  4Q5S F;  1R1T A;  2C6Y A;  1WKM A;  2KMU A;  2PMU A;  3JAM Z;  2DOA A;  3S16 J;  1OYI A;  2P81 A;  3GTO J;  1OCP A;  1HC8 A;  1S72 I;  3FMQ A;  2D5V A;  4HNT A;  1YS7 A;  3OYK A;  1B9N A;  2HPI A;  4XLN F;  4EM1 A;  4U7B A;  2VJI A;  1K78 A;  2RQP A;  1VFC A;  1MMS A;  2NRA C;  2E34 A;  5F1J A;  1KYW A;  1MSE C;  5ILU A;  1OJL A;  2BW3 B;  3GWZ A;  1A04 A;  3HOX J;  5A2Q Z;  3ERE D;  3I3L A;  3BQY A;  2M8E A;  2A5Y B;  2L7K A;  2VKH A;  1S9H A;  3ZQF A;  2OCE A;  3MZY A;  4YFX F;  1ZRE A;  3JRE A;  4L0Y B;  5B1A H;  1X1C A;  2WBM A;  3CCE I;  2IRF G;  1M1E B;  3J7Z I;  1WWX A;  3HPG A;  3KYC B;  2IGK A;  4D0P A;  4V2G A;  2MLK A;  3Q9V A;  3OY9 A;  2RKH A;  1YHQ I;  3I54 A;  1BOB A;  4DJA A;  2CGP A;  3CCS I;  1S8N A;  3FXJ A;  2H6B A;  2HTS A;  3OYJ A;  3PO3 J;  2OJE D;  3KP2 A;  4P96 A;  2Z3Y A;  2R7F A;  1TP4 A;  4RS8 A;  3GXO A;  3IRQ A;  2M0C A;  4M9X A;  4HLY A;  2R5Z A;  2R7V A;  4QTR A;  3HOU J;  3HOV J;  2H27 A;  3WOD F;  4HLX A;  4O5V A;  1BR2 A;  2BW3 A;  4PZJ A;  3W2W A;  3G2B A;  1NHA A;  3BC8 A;  5HVQ C;  2XV4 S;  2QGU A;  5ICF A;  3EUA A;  1IDY A;  2EV0 A;  4YEL A;  5J8F A;  1QZE A;  2HOS A;  4PJL A;  3HTS B;  2UV1 A;  1IN8 A;  1IN7 A;  4OMZ A;  5FKL A;  1DDN A;  2YU9 J;  2IGM A;  4XLH A;  1UST A;  2ZNZ A;  3JSP A;  3GZN B;  3IKT A;  3IH4 A;  4XID A;  1BBY A;  2LY2 A;  2QSG X;  3LSK A;  4IRH A;  3GFI A;  2IBD A;  1CQT A;  4AM3 A;  4LLN A;  1I50 J;  5C4J J;  1X4P A;  2QVO A;  1YJW I;  1X19 A;  3QP5 A;  2JSC A;  2HYJ A;  4XR6 A;  1T0F A;  3BG5 A;  4IRI A;  2ESN A;  2QQ9 A;  3W3C A;  2HQR A;  3EUK L;  2IEK A;  1SVO A;  3OYI A;  2VE8 A;  2QKM B;  1VI0 A;  2QEN A;  2MSY A;  4LIT A;  2HVS A;  1OMI A;  4BUP A;  4LFU A;  4UUT A;  1A31 A;  2DT7 B;  3WTS C;  2UZK A;  1IRF A;  4XLF A;  2R93 J;  5FD6 A;  3CJT B;  4L9N A;  3GFL A;  2A3S A;  5HNF A;  3L2W A;  1VQ6 I;  3ZOB A;  2ZXI A;  4GDF A;  2DLL A;  5GP9 A;  3GME A;  4MFE A;  4BJ6 C;  3JCU C;  1WGX A;  1Y8Q B;  3ZMD A;  4YEJ A;  2COM A;  4A3J J;  3ZMS A;  2PMH A;  3FDY A;  4D7M A;  3SYT A;  3TP3 A;  3V8L A;  1FTZ A;  3VSK A;  2P7C B;  3SQN A;  4CCL A;  3S1N J;  1DQU A;  2EFW A;  2EFO A;  3T8T A;  1X2N A;  1SMT A;  4WX9 A;  2HI3 A;  1FMV A;  2DI3 A;  4FX4 A;  2K3F A;  3CZ6 A;  2XRN A;  2M1B A;  5D5X B;  1FZP B;  2ID6 A;  3OS1 A;  1MBJ A;  3MAJ A;  4B3X A;  2R5Y A;  4GGG A;  3H3Z A;  4Y3O A;  1TW3 A;  1OFC X;  4B8X A;  2P6S A;  3PJR A;  3KET A;  3ELK A;  3GTJ J;  1UFM A;  1T38 A;  3A02 A;  4A5M A;  2VL8 A;  1W36 D;  2R7D A;  1J7K A;  3H0D A;  3HOZ J;  3LWF A;  3SEQ A;  2QYO A;  4B09 A;  4BE0 A;  1FLI A;  3E6C C;  1R1V A;  3BTL A;  1TLH B;  4L9J A;  4C2M J;  2PMZ A;  4IHW A;  3HYI A;  3RTR A;  4HW0 A;  1WJD A;  1I1G A;  3Q3S A;  3L2Q A;  2MW8 A;  3WTV C;  2A6H F;  3D0S A;  2LKP A;  1VQ4 I;  4IRG A;  1IN6 A;  2E1N A;  3ZMU A;  5J1R A;  3DV8 A;  2YX4 A;  4A3G J;  1G8X A;  3H3U A;  2XHK A;  3H3V K;  3DBR B;  2EIK H;  5LGN A;  3U9G A;  1GVD A;  1XMX A;  2JK3 A;  2X1D A;  3MZ8 A;  1DP3 A;  2H1K A;  3OS2 A;  2DTR A;  3TED A;  5K7F A;  1ACI A;  4LOC A;  2RNG A;  2DO7 A;  2HOA A;  2NXN B;  1I1S A;  3GLX A;  3I59 A;  5L3E A;  3HTU A;  2HU9 A;  5K7H A;  2E7W A;  3KLO A;  4G8X A;  1B59 A;  1AHD P;  3PM1 A;  2QEX I;  4AC0 A;  1Z7L A;  4IQ4 A;  1ZK8 A;  4G7H F;  2BE5 F;  2GLO A;  3Q9S A;  2O3F A;  2MLG A;  4JX4 A;  4LIU A;  5LEJ A;  1O4X A;  4E70 A;  3LSI A;  2YU3 A;  5FKK A;  4F55 A;  2KJC A;  3ERM A;  4BAC A;  1E0E A;  4A12 A;  2F4O B;  3SDB A;  1BM9 A;  4HNV A;  1IW7 F;  3ZMV A;  5TGT A;  2GAU A;  1WFX A;  2R3S A;  4QSH A;  1AKH B;  4S0H B;  3ZP5 A;  3BWG A;  4B43 A;  3Q0V A;  4IKF A;  2PQ8 A;  2Y9Z A;  2ECB A;  1WPK A;  3CC4 I;  5EZH A;  2EZK A;  1R5I D;  4UV9 A;  3TDZ C;  3BY6 A;  3GBG A;  2VON A;  3FM5 A;  1TT0 A;  2XAS A;  2UWM A;  1YIO A;  2QA4 I;  1QVT A;  1Z67 A;  2CW8 A;  2IS6 A;  2ZSI B;  3DTE A;  4E7H A;  2LK2 A;  5CQG A;  5BPD A;  1P4X A;  2DK8 A;  1PUF B;  2ELJ A;  2R7O A;  5EG0 B;  3BR5 A;  1I6X A;  1X4O A;  4G12 A;  4CYC A;  2X6X A;  3BR6 A;  4F91 B;  3LOC A;  2W4S A;  3VYR B;  1W4M A;  3Q0W A;  2OAZ A;  4OAZ A;  2V4J C;  3OYD A;  2RRE A;  4GYI A;  4BKX A;  3AG3 H;  1P7J A;  2R7X A;  2KIQ A;  1IC8 A;  2PN6 A;  1MNM C;  2EV6 A;  3CO7 C;  4CXF A;  1USS A;  1BR1 A;  4BJ5 C;  1AKH A;  4F92 B;  5ICE A;  2JN6 A;  5AON A;  3KYD B;  3BDD A;  2W84 A;  1BL0 A;  1RNL A;  3SDG A;  3CO6 C;  3GZ5 A;  5LLQ A;  2JA8 J;  1MIJ A;  3PNT A;  3DKW A;  1ONV A;  3BZK A;  4LLL A;  2DFI A;  4E7I A;  4M3E A;  2PBI A;  4HDU A;  2XGC A;  1DUX C;  1REP C;  2ZJR F;  1SAU A;  3ZQI A;  5H6R A;  1I3A A;  3AKZ A;  1HW2 A;  1BIB A;  1HDP A;  2CJJ A;  1FNN A;  3F0C A;  3ZN0 A;  4UVA A;  3KX2 A;  2XAG A;  1HXD A;  5CQE A;  1YOV B;  1AOY A;  2L7Z A;  3S15 J;  1FOK A;  2JRM A;  4CCJ A;  1SD5 A;  4C3I J;  4BHC A;  1AU7 A;  4ZDL A;  2M30 A;  4L0Z B;  3VPR A;  1B9M A;  3I9V 2;  2GA2 A;  2PLY A;  4F3Q A;  1I6H J;  4FET A;  4KJZ A;  4A2U A;  3FXO A;  2VBZ A;  4L5I A;  5CLS A;  4M6Y A;  3ULQ B;  2VBX A;  2XB0 X;  4Y7N J;  4I0A A;  1LJ9 A;  2L9N A;  2V1D A;  3IC7 A;  2WAQ N;  1IGN A;  2VBW A;  3KEQ A;  1RUN A;  2NAZ A;  4NNJ A;  2VQH A;  2FBK A;  4XOR A; 
#chains in the Genus database with same CATH homology
 3J80 Z;  4MQV A;  1IUY A;  4EVI A;  2OU2 A;  4P9U A;  2EJR A;  3JAM K;  2HS5 A;  1TNT A;  5D4R A;  3TKY A;  1R23 A;  4Y13 A;  1JHH A;  1CF7 B;  3BPV A;  2JT1 A;  3CJN A;  3IWF A;  4EM0 B;  3ECO A;  3VOE A;  3C18 A;  1YW7 A;  4HX8 A;  3G73 A;  2IA0 A;  3KLN A;  1H0M A;  4A0X A;  1D3Y A;  2BYV E;  4RB3 C;  2O61 A;  2O03 A;  2E7X A;  2X4H A;  5H20 A;  2J5P A;  2ZJ2 A;  1HSJ A;  2V9V A;  2ACJ A;  3WTX C;  3DP7 A;  2HKO A;  3LQQ A;  2OQG A;  2HYG D;  4ESB A;  2M45 A;  4HQM A;  5CVU A;  4M9S A;  4BH9 A;  4FX0 A;  1ZG3 A;  4A0Z A;  5JVT A;  4EJT A;  1U5T A;  1YYV A;  4U0W A;  1KYZ A;  4MGR A;  4ON0 A;  1WSU A;  1T6S A;  3EYI A;  4HBL A;  1Y0U A;  5CJ9 A;  2VBY A;  2OA4 A;  3P9I A;  2ZCW A;  2K27 A;  3SZT A;  1DPR A;  2CW0 F;  4PGH A;  4KIB A;  4P9F A;  4LK1 F;  1FBQ A;  1XGO A;  2Y48 A;  1YW9 A;  1FPQ A;  2ADU A;  2HFH A;  2M87 A;  4FT8 A;  4A6E A;  4ASN A;  1OPC A;  2W24 A;  3IKV A;  1BOA A;  3DEU A;  1P2F A;  1Z1D A;  4EGZ A;  2L01 A;  4I09 A;  3SZP A;  1R58 A;  1J59 A;  4RAZ A;  5CVI A;  1XDU A;  2DQL A;  1RUO A;  4LGW A;  4MEY F;  4ZZL A;  5D6F A;  5JI6 A;  2GXB A;  1T39 A;  3OOP A;  1IN5 A;  1TTY A;  2V79 A;  5LHH A;  3JSO A;  1J5Y A;  5E8I A;  5DDG A;  3R6S A;  5ILV A;  1YO5 C;  1FYK A;  4GYG A;  4F7Z A;  2ELH A;  3V7R A;  1MD0 A;  2Y75 A;  3D5L A;  3BPX A;  3Q5F A;  5ERI A;  3QU3 A;  4LB6 B;  1Z9C A;  5HOO A;  2Z9O A;  4ESJ A;  1QZZ A;  5LRR A;  3TQN A;  2JPB A;  1FX7 A;  2FA5 A;  1XCV A;  5FLX Z;  1G3S A;  1IXS B;  3P7N A;  2XKP A;  3AAF A;  2ESH A;  4WXD A;  1Z6T A;  1FYM A;  4HZF A;  3ZMT A;  3NRV A;  3HRU A;  2G7U A;  1R5H A;  4KUM A;  4IPA A;  4LJZ F;  1S7A A;  1RIO H;  1WRJ A;  2GQQ A;  5ICG A;  1ZG1 A;  2A61 A;  2FBI A;  3ROU A;  1V3F A;  5DEQ A;  1BIA A;  1J9I A;  3GUD A;  4KA4 A;  4CDG A;  4YG2 F;  4M74 A;  4BNC A;  2L54 A;  1T98 A;  2O8X A;  2EA2 A;  4S04 A;  1BI1 A;  3GO5 A;  1T2K A;  1FBS A;  1LDK B;  4N9I A;  1OR7 A;  3QAH A;  1MJA A;  1Z7U A;  4XSX F;  3I53 A;  4HDV A;  4ZH4 F;  2G7H A;  1KQ0 A;  3I64 A;  1FT9 A;  2RVC A;  1TQI A;  1XGS A;  2BBY A;  2IJL A;  1R36 A;  4GCV A;  4QLC U;  3KP3 A;  1ZRF A;  2RC4 A;  2GIV A;  1JGS A;  3FZV A;  3K1P A;  1K7A A;  3QPT A;  4P55 A;  1HW5 A;  4EJO A;  3V4G A;  4OU0 A;  3RYP A;  3GFM A;  1K79 A;  1GXP A;  4BQA A;  5K5Q A;  5DCM A;  2MBF A;  1FSE A;  5K5R A;  2EWN A;  2MA3 A;  5ILS A;  1O3R A;  1LEA A;  2UXX A;  3E5U A;  2OQR A;  2PEX A;  1BI2 A;  1FP2 A;  3F8B A;  3WE3 A;  2FSW A;  2VXZ A;  3K1M A;  2VT3 A;  2LNB A;  2KKO A;  3S2W A;  2W25 A;  5D6E A;  4EJV A;  1B6A A;  5L3C A;  1FBU A;  3J80 K;  1PP7 U;  3K2Z A;  5LRS A;  1B4A A;  4ENM A;  4KIC A;  4GO1 A;  1E17 A;  2WWY A;  3O6B B;  1G3W A;  3L00 A;  1W7P A;  5CYV A;  3COA C;  2B0L A;  2FNA A;  4EJW A;  2CQK A;  3I0T A;  5HLI A;  4ENK A;  3K0L A;  4KMU X;  3GX4 X;  5IT9 Z;  2ISZ A;  4HYE A;  4RB1 A;  4KIG A;  1U5T C;  2YPR A;  2RDP A;  3KP6 A;  2G9W A;  2X0L A;  1D8K A;  5DYM A;  3F22 A;  3TOA A;  1HQC A;  1QNT A;  4R1H A;  5ED4 A;  1J2X A;  2VC0 A;  3FMR A;  2MD5 A;  5FD5 A;  1ZAR A;  2GWR A;  3R60 A;  2PJP A;  1R7J A;  3R4K A;  3JTG A;  3KZZ A;  4OOI A;  2RNJ A;  4UNO A;  3F72 A;  5L3E A;  4KT5 C;  3CTA A;  3I59 B;  1H9T A;  5L3F A;  3GF2 A;  2MH2 A;  4OIR F;  2FOK A;  1KQ9 A;  1OKR A;  4MEX F;  1U6G A;  3K9T A;  3LFK A;  2Q0O A;  4ESF A;  2L4M A;  4I2O A;  3BZ6 A;  1GHC A;  3I5U A;  1GXQ A;  2WTE A;  4HAM A;  2IA2 A;  3U2R A;  2DAO A;  2F2E A;  4Y17 A;  1SD7 A;  2D1H A;  5DCF A;  3W6K B;  4CGZ A;  1FP1 D;  2QWW A;  3IL2 A;  2ZNY A;  1QBJ A;  2P4W A;  4YFN F;  2NNN A;  1XN7 A;  2Z5U A;  4CO8 A;  3HRM A;  1FWZ A;  5HS8 A;  1SAX A;  3O2P E;  4I02 A;  1CGP A;  3KP5 A;  1YQA A;  3RKY A;  5BMZ A;  1O7F A;  2KRF A;  1PP8 F;  2EB7 A;  4UVB A;  5J8C A;  2XRO A;  2Z99 A;  1W7P D;  1WQ2 A;  3VB2 A;  3LQR A;  1FSH A;  3WU1 B;  3EET A;  4O6J A;  1TBX A;  5DV5 A;  5BPI A;  1ZHF A;  5L3G A;  1YS6 A;  2VC1 A;  1P6R A;  3GEZ A;  5DD8 A;  3ZMZ A;  4UHT A;  4KNY A;  4AIH A;  1MDM A;  3ABT A;  2HGC A;  4YII A;  1Q1H A;  2XVC A;  1B1B A;  1YTY A;  2EFN A;  2LSO A;  1IAW A;  2F5C A;  1KQ8 A;  1LDJ A;  5HDK A;  2VE9 A;  5FLX K;  2DT5 A;  3PQJ A;  5HS9 A;  5H6Q A;  4AIJ A;  2YX7 A;  2W57 A;  1SD6 A;  1XSV A;  4HF0 A;  1RZ4 A;  4LD5 A;  3V7S A;  4NQW A;  2XAQ A;  3E5X A;  1O3S A;  1MJB A;  2P5L C;  3GYH X;  3MZH A;  4XSZ F;  3N97 A;  2KIM A;  2RN7 A;  3I4P A;  3WTW C;  1U2W A;  3FXR A;  1J75 A;  1V4R A;  2VOO A;  4QWQ A;  1IF1 A;  2HDC A;  2PFB A;  2DK5 A;  2QZ8 A;  3F21 A;  1UHM A;  3WGG A;  2D45 A;  1STZ A;  3BJA A;  4JK1 X;  3EUH A;  3J81 Z;  1F9N A;  2XAJ A;  3F8C A;  1ZGJ A;  4HX4 A;  1OYW A;  3C7J A;  4M73 A;  2NS0 A;  4A5N A;  5J6X A;  3HOS A;  3E6D A;  4HQE A;  2HYF A;  1AWC A;  5EEG A;  2YR2 A;  5E20 A;  2L4A A;  3KCC A;  3RDI A;  1EH6 A;  3IRR A;  1O3T A;  4G7Z F;  3E5Q A;  2ZKZ A;  4CYD A;  1U5T B;  3M8F A;  2HQN A;  3V8K A;  4Q47 A;  1K6O A;  4LG0 A;  4CZZ A;  5ICC A;  4M6X A;  3E6B A;  3T0Y A;  1YFH A;  2XKO A;  3BOQ A;  3HSF A;  3HRT A;  3ZPL A;  1BI3 A;  3RJP A;  3C1D A;  1HBX G;  2XIG A;  3ABU A;  5E8G A;  1IXR C;  2PG4 A;  1LEB A;  1TQM A;  5F6F A;  2BGC A;  4AIK A;  3HSR A;  2EV5 A;  2OZU A;  1WI9 A;  4JQF A;  3MWM A;  4O3M A;  2K4J A;  3TO6 A;  1JE8 A;  2M5W A;  5KVR A;  1HW1 A;  2QQA A;  2ZME A;  5LGU A;  1HKQ A;  1LNW A;  3B02 A;  5D5U B;  2FF4 A;  1W5S A;  2DU9 A;  1W5T A;  2JZY A;  4L9T A;  1FY7 A;  4GXO A;  4JBA A;  1ZLK A;  1XGM A;  1HST A;  3MQ0 A;  3KP4 A;  4R79 A;  4XLP F;  3DPT A;  3R0A A;  4KFC A;  3LA7 A;  1XD7 A;  2F5F A;  2FML A;  5LBQ A;  5LHI A;  1SFU A;  5IT9 K;  5IT3 A;  3FX3 A;  5D5W B;  4IXA A;  4RB2 C;  4U7D A;  2GA1 A;  2A6E F;  1UB9 A;  3M1E A;  2D2W A;  5BQT A;  2O0Y A;  1ZN2 A;  1XCB A;  1YW8 A;  3DFG A;  4ZYD A;  1Z91 A;  3RI4 A;  3GW2 A;  3HHH A;  3IHU A;  5L3D A;  5E1W A;  2K7L A;  4A0Y A;  2ZFW A;  1MKM A;  3BP8 A;  4KDP A;  3M7G A;  2KIF A;  4IF4 A;  3EYY A;  2OD5 A;  2QBY A;  3FWE A;  2FE3 A;  4HF2 A;  4Q4Z F;  3ML6 A;  4MTE A;  2HTJ A;  3JTH A;  1XGN A;  3U1D A;  4LLG F;  2VN2 A;  2ZBK A;  1JXS A;  4MTD A;  2MC3 A;  4K2E A;  5F64 A;  2LF8 A;  1SFX A;  1Z05 A;  3NQO A;  2J5O A;  1S6L A;  4ETS A;  4KMF A;  1U3E M;  4RGR A;  3SFZ A;  1D5V A;  4I01 A;  3R61 A;  5D8K B;  4RB0 A;  3RKW A;  3WE2 A;  2XUB A;  1FYL A;  3VFZ A;  3CLO A;  3L2C A;  1RI7 A;  4P5O A;  2LDU A;  4IJA A;  3KZY A;  1O57 A;  4YFK F;  5BOX A;  3QRF F;  2Q2E A;  1KU7 A;  1F5T A;  5FFZ A;  1TQP A;  4M9Z A;  4ZYH A;  5HLH A;  1ZRD A;  3WTY C;  2UXN A;  4Q48 A;  1XMA A;  2QLZ A;  1P4A A;  3G3Z A;  4BXU A;  4WXH A;  2P8T A;  1IN4 A;  3WGI A;  2ISY A;  2HOE A;  1G3T A;  5BS6 A;  3LA2 A;  1U78 A;  1DP7 P;  2VT2 A;  2K4B A;  5DCM B;  3EQL F;  3TOB A;  5K1Y A;  4AD9 A;  4L5J A;  3M9A A;  5HDG A;  2JRT A;  2O6G E;  3TO7 A;  4A6D A;  5DD4 A;  5EEH A;  2Q8K A;  2D1V A;  4G7O F;  2Y0M A;  2NNY A;  5HS7 A;  1BC8 C;  3VOD A;  2QQB A;  5FO5 A;  2F5E A;  3RIR A;  4PGG A;  1ODD A;  2JPC A;  2YSR A;  4HX7 A;  2P5K A;  2FQ3 A;  2CFX A;  4EGY A;  2IT0 A;  3CUQ A;  2Z33 A;  1W7P B;  4ZYE A;  1C0W A;  2RGV A;  2HEO A;  1ON1 A;  2FRH A;  3J81 K;  3RYR A;  1TNS A;  3P9K A;  2PI0 A;  1JHF A;  1KU2 A;  3E3V A;  3LST A;  1QO0 D;  1R22 A;  3T5X A;  3KE2 A;  2IVM A;  4N9H A;  1XB4 A;  4CIC A;  4XRF A;  3F6V A;  3FMS A;  2VOD A;  3KP7 A;  1XSX A;  1S29 A;  2CSO A;  2OZ6 A;  4HA8 A;  4BAY A;  3H92 A;  4ZYG A;  2FBH A;  2V1U A;  1ZGA A;  3DF8 A;  4G9Y A;  1Z6R A;  3J7A O;  2L02 A;  1ZAO A;  3RKX A;  3BJ6 A;  1ZRC A;  1BC7 C;  3V8J A;  4HF1 A;  4LB5 A;  4BHP A;  1U8R A;  4IHS A;  5E1Z B;  5CVJ A;  3GFJ A;  4OMY A;  1XDS A;  2CYY A;  5LGT A;  4N0B A;  3HOT A;  1ZLJ A;  4FHT A;  4KN7 X;  2DW4 A;  3PFI A;  1UHW A;  2EFQ A;  4I0B A;  2A69 F;  1X3U A;  4LK0 F;  5CVV A;  1LVA A;  3QOP A;  4I98 B;  4BYY A;  4MQ9 F;  5FGM A;  3EDP A;  5F1R A;  2NYX A;  2LF7 A;  3TDU C;  3RPU A;  4HV6 A;  3BJO A;  5E1X A;  5K5O A;  1MDM B;  4I7H A;  3K69 A;  1ZG5 A;  3W6J B;  5CVR A;  1H9G A;  1SMY F;  4BHB A;  3I58 A;  3HIF A;  2HR3 A;  4RAY A;  1MZB A;  3CUO A;  4M71 A;  5TJJ A;  3KFW X;  2P5V A;  2H09 A;  3NEU A;  4EJU A;  2VOP A;  2A68 F;  2XGX A;  1TW2 A;  5E17 F;  2V6C A;  3FXU A;  2QM3 A;  3E6M A;  4EMS A;  4TV7 A;  1PUE E;  1MGT A;  1SFE A;  2DBB A;  4EQQ A;  2E1C A;  1HKT A;  3L7W A;  4UVC A;  1L3L A;  2GZW A;  4R8H A;  2JTV A;  1D8J A;  5TRD A;  4HV5 A;  2ZO4 A;  4WK8 F;  4EV0 A;  4L18 B;  2L3D A;  4WF2 A;  3WTU C;  3MEX A;  1KGS A;  2GXG A;  6PAX A;  4AVP A;  4IVN A;  3MCZ A;  2FEZ A;  2STT A;  2H94 A;  3WTZ A;  3R0J A;  3TGN A;  2K02 A;  2DPU A;  4WWC A;  1EV7 A;  5D8L B;  5D5V B;  3F8F A;  4RGX A;  3I71 A;  1S3J A;  3SXY A;  4YIF A;  5AIQ A;  5LEK A;  2KJB A;  1O3Q A;  2STW A;  3ISP A;  4LG0 B;  1DPU A;  1FC3 A;  5DUI A;  5HLG A;  1LQ1 A;  4WXC A;  1YG2 A;  3GZ6 A;  4CHU A;  2IA1 A;  4UV8 A;  4MHG A;  5JHU A;  3WU0 A;  4LMY A;  3O3K A;  4UXN A;  1ULY A;  1S7O A;  4WCG A;  1I27 A;  1KA8 A;  2F5D A;  1LB2 A;  1E2X A;  4Z2Y A;  1QPM A;  4RGU A;  2FU4 A;  3OV8 A;  4NB5 A;  3ZN1 A;  4G6Q A;  2CO5 A;  3FXQ A;  4HOB A;  3T8R A;  2AXL A;  3P9C A;  1YLF A;  1KU9 A;  3LAP A;  2ZME B;  1F1Z A;  2XAF A;  4M72 A;  3FHZ A;  3CUQ C;  2DPD A;  4ENJ A;  1O7L A;  1QGP A;  1QQI A;  4U0V A;  2ETH A;  1IZ1 A;  2P6T A;  2CWE A;  3V7C A;  5A2Q K;  4KN4 X;  4S05 A;  3QP6 A;  5KK1 A;  4H0E A;  3DPL C;  3N4M A;  3DQV C;  5JFR A;  3WGH A;  1L0O C;  2FXA A;  4OIQ F;  2BEO A;  4PDK A;  3QPH A;  3DXJ F;  3FF5 A;  3ECH A;  2A07 F;  2HKX A;  3L09 A;  1BI0 A;  2HZT A;  4OIO F;  1G6N A;  1CF7 A;  3FM3 A;  5FFX A;  4PCQ A;  4U88 A;  1R1U A;  4G6D A;  2EA4 A;  2ZXJ A;  4KYW A;  4MNU A;  3F23 A;  3M8E A;  2IP2 A;  5AIP A;  4IHT A;  1KU3 A;  3QU6 A;  3HUG A;  4U0Y A;  2H6C A;  2EFP A;  5JR3 A;  1XMK A;  2QBY B;  1GVJ A;  3B73 A;  2OBP A;  1I5Z A;  4OIP F;  3REO A;  2FNP A;  1VTN C;  2P7V B;  1PDN C;  1J0R A;  4KIF A;  1ZH5 A;  4NHJ A;  2AS5 F;  2HWV A;  1EH7 A;  3E97 A;  4ZZD A;  3ZQ7 A;  3LA3 A;  1G4D A;  1BN5 A;  3T1B A;  1R5G A;  3CDH A;  2V1X A;  2RV8 A;  2CG4 A;  2WV0 A;  4UUV A;  3WTT C;  3JW4 A;  3RPQ A;  3F8N A;  3MFK A;  1UCR A;  4OIN F;  1MJ9 A;  1R00 A;  3TO9 A;  4ENN A;  2DQR A;  2W85 A;  4L9V A;  3SHF A;  2MH9 A;  2EK5 A;  1HKS A;  1BJA A;  1IRG A;  1G3Y A;  1OYY A;  2K86 A;  1F4K A;  3VEP A;  1P4W A;  5L3B A;  5E18 F;  1XSD A;  1IXC A;  3K1N A;  3C3W A;  4RGS A;  4DNC A;  3PQK A;  2FMY A;  2TDX A;  1ZYR F;  1P92 A;  2IPQ X;  2XAH A;  4AWX B;  3IWZ A;  3WG9 A;  5HDN A;  3F3X A;  3KEO A;  4G94 A;  2IW5 A;  1QZY A;  1LDD A;  3GVA A;  1EH8 A;  4XBF A;  1K78 B;  3BRO A;  5D4S A;  3F8M A;  4EM2 A;  2KIU A;  2BV6 A;  2QUF A;  3L9F A;  1ON2 A;  3HRS A;  5DUK A;  2WC2 A;  1SD4 A;  3HSE A;  3LAJ A;  5LHG A;  3F6O A;  3CUQ B;  3HHG A;  4Y15 A;  4DQ2 A;  5FB2 A;  4Q5S F;  1R1T A;  2C6Y A;  1WKM A;  2PMU A;  3JAM Z;  1OYI A;  3FMQ A;  1YS7 A;  1B9N A;  4XLN F;  4EM1 A;  4U7B A;  1K78 A;  2RQP A;  2NRA C;  1KYW A;  5ILU A;  3GWZ A;  1A04 A;  3ERE D;  5A2Q Z;  2M8E A;  2A5Y B;  3MZY A;  4YFX F;  1ZRE A;  4L0Y B;  2IRF G;  1WWX A;  4D0P A;  2MLK A;  3Q9V A;  2RKH A;  3I54 A;  2CGP A;  1S8N A;  2H6B A;  2HTS A;  3KP2 A;  4P96 A;  2Z3Y A;  2R7F A;  4RS8 A;  3GXO A;  3IRQ A;  4M9X A;  4HLY A;  2H27 A;  3WOD F;  4HLX A;  4O5V A;  4PZJ A;  1NHA A;  5HVQ C;  2XV4 S;  5ICF A;  2EV0 A;  5J8F A;  3HTS B;  1IN8 A;  1IN7 A;  4OMZ A;  1DDN A;  1UST A;  2ZNZ A;  3JSP A;  3IKT A;  1BBY A;  4IRH A;  3GFI A;  4LLN A;  2QVO A;  3QP5 A;  2JSC A;  1T0F A;  4IRI A;  2ESN A;  2QQ9 A;  2HQR A;  2VE8 A;  2QEN A;  1OMI A;  4LFU A;  3WTS C;  2UZK A;  1IRF A;  5FD6 A;  4L9N A;  3GFL A;  2A3S A;  2DLL A;  3ZMD A;  2COM A;  3ZMS A;  2PMH A;  3V8L A;  2P7C B;  3SQN A;  2EFW A;  2EFO A;  3T8T A;  1SMT A;  4WX9 A;  2DI3 A;  4FX4 A;  2XRN A;  2M1B A;  5D5X B;  1FZP B;  3MAJ A;  4GGG A;  3H3Z A;  1TW3 A;  4B8X A;  2P6S A;  3KET A;  3ELK A;  1UFM A;  1T38 A;  4A5M A;  2R7D A;  1J7K A;  1FLI A;  3LWF A;  2QYO A;  4B09 A;  3E6C C;  1R1V A;  1TLH B;  4L9J A;  3HYI A;  3RTR A;  4HW0 A;  1I1G A;  3WTV C;  2A6H F;  3D0S A;  2LKP A;  4IRG A;  1IN6 A;  2E1N A;  3ZMU A;  3DV8 A;  2YX4 A;  3H3U A;  2XHK A;  5LGN A;  3U9G A;  2DTR A;  2DO7 A;  1I1S A;  3GLX A;  3I59 A;  3HTU A;  2E7W A;  3KLO A;  4G8X A;  1B59 A;  4G7H F;  2BE5 F;  3Q9S A;  2O3F A;  2MLG A;  5LEJ A;  4E70 A;  2YU3 A;  2KJC A;  4A12 A;  1BM9 A;  1IW7 F;  3ZMV A;  2GAU A;  2R3S A;  3ZP5 A;  3BWG A;  2PQ8 A;  4UV9 A;  3TDZ C;  3BY6 A;  2VON A;  3FM5 A;  2XAS A;  2UWM A;  1YIO A;  5BPD A;  1P4X A;  2DK8 A;  1I6X A;  1W4M A;  2OAZ A;  4GYI A;  2PN6 A;  2EV6 A;  3CO7 C;  4CXF A;  1USS A;  5ICE A;  5AON A;  3BDD A;  2W84 A;  1RNL A;  3CO6 C;  3GZ5 A;  5LLQ A;  3DKW A;  1ONV A;  4LLL A;  2DFI A;  2PBI A;  4HDU A;  1DUX C;  1REP C;  5H6R A;  1HW2 A;  1BIB A;  1FNN A;  3ZN0 A;  4UVA A;  2XAG A;  1HXD A;  1AOY A;  1FOK A;  1SD5 A;  4BHC A;  2M30 A;  4L0Z B;  1B9M A;  2GA2 A;  2PLY A;  4A2U A;  2VBZ A;  4L5I A;  5CLS A;  4M6Y A;  3ULQ B;  2VBX A;  4I0A A;  1LJ9 A;  2V1D A;  3IC7 A;  2VBW A;  3KEQ A;  1RUN A;  2NAZ A;  2FBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...