2HZTA

Crystal structure of a putative hth-type transcriptional regulator ytcd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
95
Chain Sequence
MSLVEATLEVIGGKWKVILHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLAWGANHINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative HTH-type transcription regulator ytcD
rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords Putative HTH-type transcriptional regulator ytcD
total genus 23
structure length 95
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hztA00
2HEOA 3RPQA 1BI3A 2GIVA 3JSPA 1LB2A 5ERIA 3ZMZA 3EUHA 1G3WA 3GZ5A 3I59B 1ON1A 3M8EA 3HOTA 3K1PA 2FE3A 4RAYA 2QBYA 3QPHA 2DU9A 4CDGA 2ZMEB 1HW5A 4HW0A 2CQKA 3F8CA 1BBYA 3QRFF 4UNOA 3FMRA 4EJTA 1YG2A 4L9TA 3CTAA 2PN6A 5HDGA 4GGGA 2ZNZA 4Y15A 2A69F 3Q9VA 4I0AA 3E5QA 1KYZA 5D8LB 1QO0D 4RB0A 3RKYA 3FHZA 1MDMA 1H9GA 1ZRDA 2DLLA 1XSVA 1QBJA 3H3UA 2COMA 1K6OA 3DKWA 2IW5A 5LRSA 4MQ9F 2V1UA 4RB3C 4CYDA 1FBQA 3F22A 1UFMA 3LWFA 4LG0A 5IT3A 1W5SA 1FBUA 3JTGA 1IUYA 4KIBA 1NHAA 4G7ZF 4DNCA 1T0FA 1U5TC 2JT1A 3FMQA 4LK1F 1WSUA 3WE3A 1OKRA 2Z5UA 3RIRA 2XKOA 3EDPA 3K69A 4P55A 2IA0A 2F5CA 2GA1A 3CDHA 3I59A 1Z9CA 1ZH5A 4RB2C 2QM3A 1MD0A 3BPXA 2OQGA 5K1YA 3V8KA 1WKMA 4CGZA 4KNYA 1Z1DA 2HS5A 4JBAA 4ZZDA 1D5VA 5AIPA 2A3SA 1O3SA 4IRGA 2MLKA 3BJAA 2EFQA 1HSTA 3MWMA 2UXNA 2FQ3A 2K86A 1USSA 2VT3A 4D0PA 3ZMUA 2CSOA 3DEUA 1FBSA 1KQ0A 3RJPA 5K5OA 4HOBA 3EYYA 1R58A 3LFKA 1DUXC 4LJZF 3E5UA 4M73A 2M30A 2PG4A 5FLXK 2OBPA 2PMHA 4GO1A 2H6BA 1HKSA 1EH6A 1IN7A 3HSEA 1CF7A 2EV5A 1R00A 4BXUA 2O6GE 1IN6A 2YR2A 1FSEA 4N9HA 4IF4A 4RS8A 4FX0A 4R79A 1LVAA 3DFGA 3FXRA 3BP8A 2DTRA 1QZYA 4EV0A 4IPAA 2XAFA 1O7FA 5CVRA 1C0WA 5H6RA 3E6CC 3WTXC 4HV6A 1R36A 4HX4A 4G7HF 2A07F 4GYIA 4RGSA 4LFUA 2ELHA 1FLIA 1BOAA 4XLNF 2RVCA 3HSFA 3VEPA 3GZ6A 4CO8A 3ABUA 4I09A 1HKTA 4LMYA 4YFKF 2YPRA 4MTEA 2W25A 1XMKA 3WU0A 1BN5A 2MD5A 3TO6A 3FWEA 3R0AA 1TQIA 2RC4A 3EETA 4WCGA 1RNLA 1FWZA 1ZGJA 2FSWA 2K02A 2E1CA 1UHMA 2H09A 1DP7P 1P92A 3P9IA 1Y0UA 2IPQX 2H27A 1S6LA 2L4AA 1YO5C 4LB5A 1T38A 2JZYA 1J0RA 1ZLKA 4OOIA 4EM0B 5A2QK 1YTYA 4BQAA 2R3SA 4G6QA 2EK5A 1SMTA 5DUIA 2PFBA 4U7DA 4QWQA 2K4BA 4UHTA 3F72A 4HAMA 2CWEA 4WX9A 1XGNA 4MEXF 3KEQA 1B6AA 2FU4A 2JPCA 2QUFA 5K5RA 5J6XA 4UV9A 2LNBA 5D8KB 3GYHX 3REOA 4U0VA 2FNPA 3IWZA 2OD5A 3GUDA 4AWXB 1TNTA 2Z9OA 3F8MA 3DF8A 2EB7A 1ON2A 1FYMA 3GXOA 4FHTA 1RUNA 2P6SA 3K1MA 5JR3A 2C6YA 2M1BA 4G9YA 2A6EF 4HYEA 1LDDA 2ZBKA 3CO6C 2LSOA 2DI3A 4ZYDA 4UVAA 3V7RA 1G6NA 1V3FA 5LHIA 4HDUA 1K78A 3V7SA 3FMSA 3WG9A 4K2EA 3HHGA 1YW8A 2K7LA 5L3BA 2D1VA 2HTJA 2ESHA 5ILVA 2UZKA 2V1DA 3C7JA 5FLXZ 4EVIA 3BZ6A 5HDKA 3KEOA 1TLHB 2XVCA 2EA2A 1FOKA 5FO5A 3CLOA 4M9SA 3FM3A 5FFZA 5FGMA 4UUVA 2P5KA 4XSXF 1J2XA 1W7PB 4ESJA 5DCMA 3R4KA 3TO7A 3JW4A 3FXUA 3Q9SA 1KQ9A 1P6RA 5L3EA 3FM5A 1ZHFA 5LRRA 5E1ZB 1F4KA 1ODDA 1R5GA 5LGUA 1A04A 2L3DA 5E8GA 3V4GA 3JSOA 2W24A 2M5WA 4PZJA 4M71A 2Y48A 3I53A 1P4XA 2VOPA 4ZYGA 4ENKA 3WTTC 1ZG1A 1BIAA 2VOOA 3KP7A 1DPRA 5AIQA 1IRFA 3IRRA 2FBHA 4O5VA 5L3FA 4B8XA 3AAFA 4GYGA 2QQ9A 1GVJA 4XBFA 1IXSB 2JSCA 4PDKA 3O2PE 2RN7A 2DFIA 2XKPA 4CICA 4HX8A 1F9NA 4WF2A 5DUKA 3I0TA 3DP7A 2GQQA 4I98B 5F1RA 4G94A 1SFXA 2EV0A 1XGSA 4S04A 4EQQA 2FEZA 4L9VA 4O3MA 3RYPA 1IAWA 1Z91A 1I1SA 2OU2A 2ZKZA 1RI7A 6PAXA 2JTVA 1YLFA 2VODA 2QBYB 1GXQA 3M9AA 3TKYA 3KETA 1J59A 2VONA 4EJUA 2CO5A 3E6DA 2XAQA 2RNJA 3TQNA 2YU3A 1PP7U 4I0BA 3CUOA 4HF2A 5ILSA 3L2CA 4BAYA 2VE8A 4L5JA 1F5TA 3F6VA 3EQLF 2EWNA 4EM1A 4KYWA 2J5PA 3C1DA 2FOKA 4LB6B 2JRTA 1WWXA 2ISZA 3RI4A 4A12A 1KU7A 2DBBA 2ZJ2A 1U5TA 1IF1A 3KP2A 5BS6A 5LEKA 2V1XA 3S2WA 4HLYA 3K1NA 3O6BB 3L7WA 1IN8A 1KQ8A 4I02A 2IP2A 5HS9A 2HOEA 4RGXA 4CXFA 3SZPA 3RDIA 5JI6A 4ESFA 2DK8A 1JXSA 1D8JA 5D6EA 1UCRA 3MZYA 1G4DA 4LGWA 3ECOA 5F64A 3C18A 1U78A 4CHUA 1O7LA 1O57A 2XROA 3I4PA 1CGPA 1G3SA 4HZFA 2YX4A 2H6CA 2F5EA 1XN7A 1ONVA 4LK0F 3V8LA 3GW2A 5F6FA 3I71A 1JHFA 4F7ZA 3K9TA 3KE2A 4RGRA 5E8IA 1USTA 1U2WA 1SD6A 4HBLA 2FBIA 3PQJA 4Y17A 1ZGAA 4ZYHA 1DDNA 4EGYA 2RV8A 4P9FA 1FZPB 4M6YA 2FF4A 1HKQA 2L02A 5EEGA 5HDNA 1REPC 2P7VB 5DCFA 1FNNA 2JPBA 1P4WA 1JHHA 4E70A 5J8FA 3GX4X 3QP6A 5CVVA 2BBYA 1OYYA 5DD8A 1TNSA 3RPUA 4KUMA 1OPCA 2PEXA 5ICEA 2E7WA 2VBZA 1HQCA 4M6XA 2OQRA 2VC1A 3CJNA 5ICGA 5HOOA 1KU3A 2L01A 5IT9K 2CGPA 4JK1X 1H9TA 1OYWA 2HZTA 3WGGA 3U2RA 3IL2A 5D5WB 1AWCA 4KIGA 1MJAA 2XV4S 3W6JB 3VFZA 1HSJA 3JAMZ 2P7CB 3ML6A 1Z7UA 4NQWA 4R1HA 1LJ9A 5LEJA 2PLYA 3FXQA 2XAJA 5E1XA 1K78B 1X3UA 4B09A 4A5NA 1KU2A 1H0MA 3CO7C 2W84A 2KIMA 2PI0A 1LDJA 3GFMA 2MH2A 2HFHA 3JTHA 1J7KA 3QU3A 2G7UA 4U0YA 4MGRA 4N0BA 1MKMA 2NYXA 3B73A 1KU9A 4A0XA 3BWGA 4UVBA 2HKXA 2J5OA 4A6EA 1MZBA 3T1BA 1FYKA 1EV7A 3LQRA 1LQ1A 4U0WA 4HQEA 2YSRA 1WRJA 3ZN0A 3JAMK 4BHCA 5ICFA 4KFCA 3C3WA 4WXHA 4UXNA 2W57A 3SFZA 2QVOA 2EFOA 1IN4A 5HLGA 1S29A 2QQAA 2QWWA 5D4SA 2RDPA 5FD6A 4LLNA 3PFIA 4IHSA 4BYYA 4EGZA 4N9IA 1YS7A 5D5UB 4U7BA 3KP4A 5FB2A 3P7NA 1I1GA 4ON0A 4EMSA 4KIFA 1LEAA 1LDKB 4O6JA 2KIFA 4KA4A 3O3KA 2Q2EA 3LAPA 3F21A 2NNYA 2M45A 3RYRA 4LLLA 1IZ1A 1LNWA 3WTZA 1JE8A 3N4MA 1R7JA 1QGPA 3HRSA 1ZAOA 4Y13A 4MHGA 1Z05A 3EYIA 2FXAA 2ZO4A 5DEQA 1BI0A 2GXGA 4A6DA 1GXPA 1ULYA 3ECHA 1R22A 2IVMA 3T8TA 1V4RA 3GEZA 1L3LA 1PP8F 3ERED 1PUEE 3I58A 3T5XA 3E3VA 5LHHA 4WWCA 3K2ZA 3WTVC 4MNUA 2HQRA 5LHGA 1YQAA 2ESNA 3F8NA 3ZP5A 1J9IA 3OV8A 4A5MA 5EEHA 3WE2A 4HF1A 2XRNA 2AS5F 2DPDA 5D5XB 1F1ZA 3L00A 3G3ZA 2W85A 2L54A 3NEUA 5D4RA 3QU6A 2X0LA 4HF0A 3H92A 4KICA 1O3TA 4LD5A 3M1EA 3OOPA 5AONA 3F23A 1G3YA 1ZG5A 4H0EA 4YFNF 4PGHA 4EJVA 1BI1A 2M87A 2GWRA 2KJCA 2VT2A 3GF2A 3B02A 1B9MA 3DPTA 4YFXF 2FRHA 3H3ZA 1YW7A 5LGTA 5ED4A 2VBYA 5DDGA 1D3YA 5ILUA 2P6TA 2NRAC 2G7HA 4G6DA 3I54A 3KP5A 3HTSB 4M72A 3CUQA 3DV8A 2HYGD 2HTSA 3P9KA 3HOSA 1P2FA 5HS7A 1DPUA 3GWZA 2P4WA 3WGIA 4DQ2A 4ENMA 2MA3A 4L5IA 2QYOA 1T39A 5BMZA 1BC7C 3IKTA 4XLPF 3LAJA 5E1WA 2IRFG 2RKHA 3I5UA 4ASNA 3L9FA 1SFUA 1IN5A 5A2QZ 2AXLA 3DXJF 1GHCA 3E97A 2L4MA 4M9ZA 3BJOA 4KDPA 4HX7A 1T98A 1KYWA 3F6OA 5JHUA 1SD4A 2Q0OA 5CVUA 1XSDA 4I01A 3LA2A 3GFIA 4ZZLA 4EJOA 5K5QA 2QZ8A 3GVAA 4OIPF 5BPDA 2KJBA 2R7FA 5DYMA 4AIHA 2Z33A 5HLHA 3IKVA 4M74A 3BDDA 4UVCA 2TDXA 1HXDA 3HSRA 3E6BA 1CF7B 2D45A 2GXBA 1IRGA 3WTWC 1FYLA 3R0JA 4YIFA 2DPUA 2O61A 5LBQA 3HRMA 4I2OA 5D5VB 1P4AA 4Q5SF 3TDZC 1R1UA 3M8FA 3RKWA 3DQVC 2ACJA 3F8FA 2MLGA 4AD9A 1QQIA 2ZFWA 2Z3YA 2YX7A 1Z6RA 1ZLJA 5CJ9A 4GXOA 4LG0B 4NHJA 1JGSA 3KCCA 3ROUA 3RTRA 1EH7A 3GLXA 2HKOA 2HGCA 3ZN1A 2V9VA 4Q4ZF 3Q5FA 2NAZA 1SFEA 2P5LC 3R61A 4L9JA 4KT5C 2XHKA 1S8NA 4BNCA 4I7HA 1HW1A 4ENNA 3I64A 5ICCA 2RQPA 3HYIA 4UV8A 4P9UA 1Q1HA 1QNTA 4MQVA 4IRIA 2G9WA 3HRTA 2STTA 2HWVA 3WGHA 5HVQC 1HBXG 2CFXA 1VTNC 1TQMA 2XAGA 5LLQA 1OR7A 3ZMDA 2OZUA 3BJ6A 4Q47A 4PGGA 3QPTA 3E6MA 3T8RA 1XCBA 4WK8F 4EM2A 1OMIA 5DCMB 2LKPA 4BHBA 2XASA 3VB2A 2VXZA 5L3DA 1RIOH 4A0ZA 3SQNA 2VN2A 1SD5A 2FMLA 2PBIA 1K79A 2O3FA 1BI2A 2HQNA 1K7AA 3GFJA 4OIRF 3QOPA 4TV7A 1MJ9A 4AIKA 1YIOA 1Z6TA 2Y75A 4L0ZB 4P96A 2EFWA 1TW3A 1U5TB 2O03A 5CVJA 2R7DA 4OMYA 5J8CA 2EA4A 3ZPLA 1XB4A 4HA8A 4HQMA 2ZNYA 3NQOA 2PJPA 2DQRA 2ZXJA 4A0YA 1QZZA 2GZWA 2CG4A 4AIJA 4GCVA 2H94A 1FPQA 3SZTA 1ZN2A 3ULQB 1WI9A 1PDNC 3ZMTA 3IRQA 2NNNA 1BJAA 2P8TA 1R1VA 4MTDA 5H20A 1SD7A 1I27A 1O3QA 2RGVA 1IW7F 4ETSA 2CYYA 2ADUA 2Y0MA 4A2UA 4YG2F 4OIQF 3KP3A 2F5DA 2VBWA 2B0LA 4CZZA 1B4AA 1W7PD 1FP1D 2EV6A 3LSTA 4IXAA 2NS0A 2E1NA 3LA3A 3KZZA 5BOXA 2LF7A 4L18B 1UHWA 1FP2A 1TTYA 1R1TA 3IC7A 4ZH4F 3HTUA 3TGNA 3ZQ7A 1ZRCA 3HRUA 1SAXA 2GA2A 4QLCU 3WODF 2MBFA 2WC2A 5E20A 2MH9A 2K27A 3WU1B 1BC8C 2K4JA 2KIUA 2LDUA 3HHHA 4IVNA 4ENJA 1HW2A 3LQQA 3ISPA 2HYFA 1YS6A 1I5ZA 1IXCA 3TO9A 3WTYC 3V8JA 1G3TA 2KRFA 2IJLA 2OZ6A 4ESBA 5E17F 1XSXA 5KVRA 5LGNA 2D1HA 3IHUA 4KN7X 1E17A 4Q48A 3HIFA 2LF8A 2GAUA 4PCQA 3CUQC 3KLNA 5FFXA 4OIOF 5CLSA 1MGTA 2A61A 3M7GA 1LEBA 5BPIA 5HS8A 2D2WA 1BIBA 3HUGA 4BH9A 2BV6A 3V7CA 4KMFA 1MJBA 2EFPA 1TQPA 2P5VA 1ZREA 1TBXA 2A68F 1W7PA 3SXYA 4OU0A 4RAZA 4HLXA 3ZMVA 5L3GA 1XGMA 3IWFA 4L9NA 4BHPA 1FSHA 2IA1A 1R23A 4MEYF 4R8HA 1STZA 1B1BA 3T0YA 1D8KA 1FX7A 1B9NA 3DPLC 1RZ4A 1S7AA 4IJAA 4OMZA 2HDCA 4RGUA 1J5YA 3CUQB 1AOYA 2Z99A 1ZG3A 1O3RA 1YW9A 5CVIA 4HV5A 1UB9A 2VBXA 2QENA 3QAHA 2E7XA 3W6KB 1T6SA 3GFLA 1EH8A 2BEOA 1R5HA 4M9XA 3NRVA 3G73A 3COAC 4LLGF 4FX4A 1B59A 1SMYF 3WTUC 3MFKA 5H6QA 4G8XA 3R6SA 4G7OF 1BM9A 2F5FA 3MEXA 3ELKA 2MC3A 4HDVA 2STWA 1YYVA 2V79A 5KK1A 1OYIA 4S05A 3FF5A 5IT9Z 3D0SA 3P9CA 2X4HA 4XSZF 2DW4A 3R60A 3U1DA 4OINF 2XIGA 2VE9A 1FT9A 3VOEA 4KMUX 1ZYRF 1KGSA 3TOBA 2FMYA 5E18F 3J81K 3J7AO 1S3JA 1QPMA 5L3CA 2ETHA 2EFNA 1ZARA 2WV0A 1YFHA 2QLZA 5JVTA 1XD7A 4EJWA 2UXXA 2BYVE 2DAOA 5D6FA 2F2EA 3MQ0A 1U8RA 5DD4A 2QQBA 2OA4A 4YIIA 3QP5A 3FZVA 2DQLA 1IXRC 3GO5A 2EJRA 4KN4X 2BE5F 2ZCWA 3SHFA 3L09A 2XAHA 1I6XA 4NB5A 5TJJA 2HR3A 4Z2YA 4IHTA 2DT5A 4JQFA 1KA8A 2FNAA 5HLIA 3K0LA 3PQKA 2ZMEA 3TOAA 2WTEA 3KLOA 2UWMA 3KFWX 5DV5A 4IRHA 2PQ8A 3J80Z 1MDMB 3J80K 4L0YB 1TW2A 3BPVA 4AVPA 1E2XA 2XUBA 1XMAA 3BOQA 2A5YB 1XDUA 2VC0A 1U3EM 4U88A 1L0OC 5TRDA 2OAZA 3D5LA 1XGOA 3BROA 2XGXA 2M8EA 2FBKA 4FT8A 5JFRA 3MAJA 1T2KA 5CYVA 2Q8KA 2V6CA 2PMUA 2ISYA 3LA7A 3KP6A 1RUOA 3ZMSA 3F8BA 4WXDA 3KZYA 4XRFA 1S7OA 5BQTA 3VODA 3F3XA 1XCVA 1U6GA 2FA5A 1XDSA 1ZRFA 2IT0A 2DO7A 4RB1A 3MZHA 3BY6A 2O0YA 3FX3A 1J75A 1W4MA 2KKOA 3WTSC 1FC3A 1FY7A 3J81Z 2BGCA 3E5XA 1W5TA 4ZYEA 3N97A 2A6HF 3RKXA 3TDUC 5FD5A 2CW0F 1WQ2A 2IA2A 3MCZA 2DK5A 4P5OA 2O8XA 3U9GA 2WWYA 4WXCA 3ABTA
chains in the Genus database with same CATH superfamily
3IUOA 2HEOA 3FISA 1MBHA 3RPQA 1BI3A 2GIVA 4DBQA 3JSPA 1ETVA 1LB2A 2JA2A 5ERIA 4IHWA 3ZMZA 3EUHA 1G3WA 2VQLA 3GZ5A 3I59B 3DEWA 3GLLA 3KYLA 1ON1A 3M8EA 3HOTA 3K1PA 3L2UA 2FE3A 4RAYA 4ZDLA 2QBYA 1RESA 3QPHA 4HEA2 2HOSA 4M6VA 2DU9A 1PJRA 1FOYA 3NAUA 3VSKA 4B48A 4CDGA 3GTOJ 2ZMEB 1NK2P 1HW5A 2NVYJ 4HW0A 2CQKA 3F8CA 1BBYA 1EKEA 3QRFF 4BE1A 4UNOA 4C3HJ 3FMRA 3E0JB 3VYSB 3FXJA 3GMEA 3H35A 5K7ZA 1R4MB 1I6HJ 4EJTA 1YG2A 4L9TA 3CTAA 1GV5A 1WJCA 3KZIC 1UG2A 2PN6A 5HDGA 4GGGA 2ZNZA 4UUTA 4Y15A 2A69F 3Q9VA 4J01A 4I0AA 4XNFA 3CCYA 4AM3A 3E5QA 3HXLA 5F1JA 3SDBA 1KYZA 5EZHA 2R7QA 5D8LB 1QO0D 3JCUC 4RB0A 4RMNA 3RKYA 3OYKA 3FHZA 1MDMA 1H9GA 1YITI 1ZRDA 3OL3A 2DLLA 2CMPA 1XSVA 1AHDP 1QBJA 3H3UA 4KJZA 3FKJA 5HLTA 2COMA 1K6OA 3DKWA 2IW5A 5LRSA 3JRAA 3M07A 4MQ9F 2V1UA 3TBIA 5GAHJ 4RB3C 2R7TA 4CYDA 1FBQA 3HKZA 3F22A 1UFMA 3ZOBA 3LWFA 3CZ6A 4LG0A 5IT3A 4A3DJ 1W5SA 1QHHD 2P81A 1FBUA 3JTGA 1IUYA 1HF0A 1IC8A 4KIBA 2CV0A 2CRGA 1NHAA 2VJ5A 4G7ZF 4DNCA 1T0FA 3H9GA 1BW5A 1U5TC 2XGEA 2JT1A 1R71A 3FMQA 3HUGB 4LK1F 2RNGA 1WSUA 3WE3A 3OYJA 1OKRA 1B8IB 4G12A 4RAGA 2Z5UA 3RIRA 2XKOA 3EDPA 4QTRA 3K69A 1X4OA 2LY9A 2H8RA 3G1OA 4P55A 2IA0A 2F5CA 2GA1A 1JT6A 4YELA 2B9SA 3W6VA 3CDHA 3FBIB 3I59A 1Z9CA 3H0DA 1ZH5A 4RB2C 2N8GA 2QM3A 3CCMI 4CA0A 1MD0A 1MMAA 4ZC3A 2Y30A 3BPXA 3ERMA 2OQGA 2R7WA 5K1YA 3U1KA 1N25A 3V8KA 1WKMA 4CGZA 4KNYA 2XDVA 1Z1DA 2HS5A 4JBAA 4ZZDA 3JRBA 1WGXA 1D5VA 3GTPJ 2JQ7A 3CCVI 2L9RA 3H5RA 2JVGA 5AIPA 3CCUI 2GLOA 2A3SA 1ZTRA 1O3SA 4IRGA 4LIUA 2MLKA 4BE0A 3BJAA 1A36A 3GZNB 2E60A 3U21A 2YU9J 2EFQA 3QODA 1HSTA 1OR7C 1MNDA 3MWMA 2UXNA 2FQ3A 2QEXI 2K86A 1USSA 3FIWA 3MD2A 2VT3A 4D0PA 3ZMUA 2CSOA 3DEUA 4FE4A 3K10A 2B7EA 1FBSA 3ZXSA 3RQ4A 5J1YA 1AA7A 1KQ0A 3RJPA 5K5OA 4HOBA 3B6CA 2ZXHA 3DBRB 1ZKGA 1R58A 3EYYA 3OYHA 1E3PA 3LFKA 1DUXC 4LJZF 3E5UA 4M73A 4HNUA 4XLAA 4IHXA 2M30A 5HNHA 1Z3XA 2PG4A 5FLXK 2EQRA 3LSHA 2DMPA 2OBPA 2PMHA 2X6OA 4GO1A 2H6BA 2L2OA 1HKSA 3QYEA 4JYKA 2DA7A 1EH6A 1IN7A 3HSEA 1CF7A 3I4MJ 2EV5A 1R00A 2IGKA 4BXUA 1GV2A 3QYFA 2O6GE 1IN6A 1MBFA 4OAZA 2WB1N 2YR2A 1FSEA 4N9HA 5LFAA 4IF4A 4RS8A 4FX0A 4R79A 1IO2A 5IOYA 1GT0C 1LVAA 3DFGA 2IS2A 1MMGA 3MMYB 3FXRA 3K70D 3BP8A 2DTRA 1QZYA 1OCRH 3MN2A 4EV0A 2R0QC 4IPAA 2DN0A 1Z7LA 1D1CA 2XAFA 1O7FA 5CVRA 1C0WA 5H6RA 2EZKA 3DBLB 5JLXA 1HA8A 3E6CC 3WTXC 4HV6A 1R36A 4HX4A 2VKVA 2IS6A 3A1YA 4G7HF 2A07F 5C4JJ 4GYIA 4Z6YA 2IXSA 4RGSA 2LD5A 5IYCJ 2Q2EB 4LFUA 2ELHA 5JLWA 1FLIA 1BOAA 4XLNF 1K4TA 2VQCA 2RVCA 3HSFA 3VEPA 3GZ6A 4CO8A 3DBHB 1E3HA 3ABUA 4I09A 3ESWB 1HKTA 4LMYA 4YFKF 2YPRA 3M3YJ 2LTPA 4MTEA 2QSFX 1SAUA 1DQUA 2W25A 3ZR8X 3TP3A 4FISA 1MSFC 3AG2H 1XMKA 4NNJA 1S5LC 3WU0A 1BN5A 1R9TJ 4FQGA 2MD5A 3TO6A 3K4LA 2JA6J 3FWEA 3R0AA 1ETYA 3EETA 1TQIA 2RC4A 2W00A 3Q0WA 2AQEA 4HG2A 5KNLA 1MBGA 2V4JC 3PNVA 4WCGA 3I9V2 1RNLA 1FWZA 4IL6C 1ZGJA 2FSWA 1Z67A 2O5RA 2K02A 2E1CA 4XKWA 4BBSJ 1UHMA 5CQGA 1GLNA 1X1AA 2H09A 2BXZA 1DP7P 1IDYA 1ETOA 1P92A 3P9IA 1Y0UA 4J19A 2IPQX 2FJ1A 1BJZA 1ETQA 2H27A 1S6LA 3HL2A 4ANJA 1P7IA 4I76A 2L4AA 1YO5C 4LB5A 3LMMA 1T38A 4RM2A 3H1CA 2HU9A 1VQOI 5FLMJ 3C2GA 2PMZN 2JZYA 1J0RA 1ZLKA 1I39A 4OOIA 4EM0B 5A2QK 1RC9A 3BTIA 1YTYA 4BQAA 2R3SA 4G6QA 2EK5A 1SMTA 1YRNA 5DUIA 2LOOA 3OL4A 1HCRA 3HG9A 2BXYA 2PFBA 4LITA 4U7DA 4QWQA 5FRNA 4LG3A 2K4BA 4UHTA 3CJTB 3F72A 1WJFA 4XQFA 4XONA 3CP2A 4HAMA 3S3OA 2CWEA 4WX9A 1XGNA 1XMXA 3BR2A 1M1EB 4XLHA 1TWHJ 1VQKI 2Y31A 4MEXF 3KEQA 1B6AA 3S32A 4CCOA 5JVGF 2FU4A 2JPCA 2QUFA 5K5RA 5J6XA 4UV9A 2LNBA 5FKLA 1JKOC 5D8KB 4NC6A 3GYHX 2DA3A 4XICA 3REOA 4QIWN 4U0VA 1A6QA 4FCYA 2FNPA 3IWZA 2MW8A 1EF4A 2X48A 5HNFA 2OD5A 3GUDA 2CQ7A 4AWXB 2OV7A 5GPAA 2HYJA 4A3JJ 1TNTA 2Z9OA 3F8MA 3DF8A 2EB7A 4ZYAA 3QPLA 3WU2C 1ON2A 1FYMA 3GXOA 2HDDA 2ZB9A 4FHTA 1RUNA 2P6SA 3K1MA 3VPRA 3RCOA 5JR3A 2C6YA 2M1BA 2BZTA 4G9YA 2A6EF 2VKDA 4HYEA 3HGYA 1LKXA 1LDDA 2ZBKA 4CCLA 3CO6C 2DDAA 2LSOA 3A2KA 1OCOH 4M3BA 1XTAA 2DI3A 4ZYDA 4UVAA 3V7RA 1G6NA 1JUSA 1V3FA 3SFIA 5LHIA 4HDUA 2BY3A 1Z21A 5E3LA 3GTLJ 1X2MA 3HOWJ 1K78A 3V7SA 1WPKA 2A6TA 3FMSA 3WG9A 4K2EA 3HHGA 1YW8A 2EPFA 3PO3J 2K7LA 5L3BA 2EIMH 3ABKH 3S93A 2D1VA 2F4MB 2HTJA 3LSPA 2XSDC 1F43A 2ESHA 5ILVA 2ZFUA 3H9JA 2UZKA 2V1DA 4E6KG 2VASA 3C7JA 3EUKL 1NTCA 5FLXZ 5E3MA 4EVIA 3BZ6A 5HDKA 2X1EA 2ZSHB 3KEOA 1TLHB 2XVCA 2LREA 1SVOA 2EA2A 3UKGA 1FOKA 2X6XA 5FO5A 3CLOA 3Q0VA 4BXFA 4M9SA 3FM3A 4FTHA 5FFZA 1DU6A 5FGMA 4UUVA 2CQNA 2LFBA 2P5KA 4MFDA 4XOTA 3IAM2 4XSXF 2W1OA 1J2XA 2Y0SN 1W7PB 4XKBA 2R7OA 4ESJA 5DCMA 3R4KA 2Z1DA 3K6GA 4IEJA 4D7MA 1A6IA 3TO7A 3JW4A 3FXUA 3Q9SA 3BG5A 1KQ9A 5KHDA 1P6RA 5L3EA 3FM5A 2LG4A 1ZHFA 5LRRA 4DOZA 3AKZA 3HDDA 3TP0A 5E1ZB 1WZ2A 1F4KA 2X6YA 1ODDA 1QVUA 1R5GA 2GIZA 2K85A 5LGUA 4IKFA 2IS1A 4JOMA 2EZIA 5EZGA 1A04A 2L3DA 2M9HA 5E8GA 3V4GA 3JSOA 2E2JJ 3H5NA 2BHZA 3EUHC 2W24A 2M5WA 4PZJA 3VYTB 4KISA 4QSHA 3RZDJ 2CS3A 4M71A 2Y48A 2G0EA 3I53A 4AIDA 4AU7A 1P4XA 4MLOA 2JRMA 2VOPA 2QKLB 4ZYGA 4PJNA 3OYCA 4ENKA 3OSGA 3WTTC 1ZG1A 1WJBA 1BIAA 2VOOA 3KP7A 3Q3SA 3OYAA 1VQ4I 1DPRA 1YJNI 5AIQA 3OR1C 4C3IJ 1IRFA 3IRRA 2FBHA 4AC0A 2CUZA 4O5VA 5L3FA 4B8XA 2R7RA 3CESA 3AAFA 2L9NA 4UUSB 2DYSH 4A3KJ 4GYGA 2V6EA 1FIAA 2OF7A 1WFXA 2QQ9A 1GVJA 1N75A 3BZKA 1F36A 4XBFA 4E7LA 1IXSB 1MW7A 2JSCA 4ABZA 2I5UA 4PDKA 3O2PE 2RN7A 2DFIA 2XKPA 4CICA 2ECCA 3MVPA 1ENHA 4HX8A 1E3OC 1F9NA 4WF2A 2K9QA 2NVUB 5DUKA 1T95A 2DMUA 3VWBA 3I0TA 3DP7A 2DXIA 1BR1A 1IRXA 2GQQA 1Z0XA 2DJNA 2ME6A 2LH9A 3SZGA 2WY7Q 4I98B 5F1RA 3BT9A 4G94A 4CCJA 1SFXA 1CQTA 2R7UA 5M5XJ 3K4BA 3I55I 2EV0A 1LPQA 1XGSA 4B47A 4S04A 2DT7B 3OS0A 1YIJI 4EQQA 2FEZA 2MFZA 4L9VA 4O3MA 4B3XA 1WH5A 3HZJA 3RYPA 2EILH 3HC7A 1IAWA 1Z91A 3DU6A 4BXXJ 1IUFA 1I1SA 1X2NA 2OU2A 2ZKZA 2LMDA 1RI7A 6PAXA 4JX6A 2JTVA 1YLFA 3O8HA 2LLKA 1WJ5A 2VODA 2QBYB 1GXQA 3JR9A 3CCQI 1VQ8I 3M9AA 3KX2A 3TKYA 3KETA 4PJLA 4UB8C 1J59A 2VONA 2KPMA 4XKCA 3BC8A 4EJUA 2CO5A 3E6DA 2XC7A 2XAQA 2HPMA 3PM1A 3DLLF 3ZQCA 2NS7A 3DTKA 2FX0A 2RNJA 3TQNA 1Y6IA 2YU3A 1PP7U 4I0BA 3CUOA 4HF2A 5ILSA 3UR3C 2JA5J 3L2CA 2GOMA 4BAYA 2VE8A 3BQYA 2CH0A 4L5JA 3DEEA 4CZCA 2HQAA 1F5TA 3F6VA 1JKQC 3EQLF 1SANA 2EWNA 2VB6A 5B5EC 2E35A 4EM1A 1HC8A 2WBMA 2JA7J 4KYWA 2J5PA 3C1DA 3FXLA 5F04A 2FOKA 5M3FJ 3CC2I 4LB6B 2JRTA 4PJJA 1WWXA 3BR3A 4NBQA 2ISZA 3RI4A 4A12A 1KU7A 2DYRH 2L0KA 2LBFB 5F0HA 2DBBA 2VPLA 2ZJ2A 2X6WA 1U5TA 1IF1A 1UZCA 3KP2A 3QYBA 3ABMH 4BBRJ 5BS6A 5LEKA 1Y8RB 2V1XA 2F4OB 1YX3A 3S2WA 3W2WA 4HLYA 1IDZA 3K1NA 4Y33A 2WAFA 3O6BB 2KZGA 3CMYA 3BG9A 3L7WA 1IN8A 1KQ8A 4I02A 2WA0A 4BGDA 1BL0A 2W48A 2IP2A 1WI3A 2KQRA 2V9PA 5HS9A 2DOEA 3H0GJ 3LSGA 1MMNA 2WB1A 2HOEA 1B8IA 2B63J 4RGXA 5IPAA 2MC4A 4CXFA 2DOFA 3SZPA 3RDIA 1DGWY 5JI6A 2HPIA 4ESFA 4YIRX 1VQ7I 2DK8A 1JXSA 1ZQ3P 1I3QJ 2EZLA 4GRIA 3FBNB 1D8JA 5D6EA 1UCRA 2EINH 3MZYA 1AKHB 1B72B 1G4DA 4LGWA 3ECOA 2R92J 5F64A 3C18A 4EATA 2X51A 4A3EJ 2IEKA 1U78A 2GXAA 5GPCA 4CHUA 1O7LA 1O57A 1POGA 2VJIA 2ZMEC 2XROA 4E7KA 2QKMB 3I4PA 4N4OB 2HOAA 5E3NA 1CGPA 1G3SA 4E7SA 2ZJRF 4E4HA 3CC4I 1U9NA 4HZFA 4CCNA 2YX4A 2H6CA 1JUMA 2F5EA 1XN7A 5M5YJ 1X19A 3BG7A 3UNGC 3DWLE 4XM3A 1ONVA 2DT6A 2WAEA 4LK0F 4RAFA 5IP9J 1Z77A 5J4YA 3V8LA 3OY9A 1H88C 3OWTA 2MABA 2FD5A 3GW2A 5KCMA 5F6FA 3I71A 1JHFA 3L2RA 4F7ZA 3K9TA 3KE2A 4RGRA 3HEFA 3S16J 1GUUA 5E8IA 1A35A 1USTA 3FXMA 1U2WA 1SD6A 1SEUA 4MFEA 1BW6A 4HBLA 3PSIA 2FBIA 2FUG2 5B1BH 1OCTC 3PQJA 4Y17A 5IP7J 3CCJI 4V2FA 1ZGAA 2X1CA 3A0HC 4ZYHA 3A01A 3SDGA 2KDZA 3DKXA 1DDNA 4EGYA 2RV8A 4P9FA 4HNVA 1FZPB 4M6YA 4E7HA 4F92B 4A3BJ 2FF4A 1WH7A 1HKQA 3CQZJ 1IJWC 2L02A 1JI8A 5EEGA 5HDNA 4BUPA 3FXOA 1REPC 3S17J 2P7VB 4PFPA 5DCFA 2BHYA 1FNNA 3S3MA 2OTLI 2BVMA 2E36A 2LC2A 2JPBA 1P4WA 3ASNH 1JHHA 1U0JA 2M4KA 5F08A 2W82A 3G1LA 3HM5A 2DMQA 1KONA 4E70A 5J8FA 2RREA 3GX4X 3OYLA 5GAGJ 3ZQLA 3BTJA 2NS8A 3K7AJ 3QP6A 1DP3A 5CVVA 2BBYA 4U87A 3JRIA 2DODA 1OYYA 5DD8A 3PJRA 3L2QA 1TNSA 2NVQJ 3RPUA 4KUMA 1OPCA 2DCEA 2EH3A 2PEXA 3LL7A 2E7WA 2VBZA 5ICEA 3JRHA 4IHVA 1HQCA 4M6XA 4V19K 2OQRA 2VC1A 3CJNA 2Y0SA 2M7BA 3D5SC 1OQYA 5ICGA 1HDDC 2E1OA 5HOOA 3IP4B 4IOCF 1KU3A 2DA2A 2L01A 4XKVA 5IT9K 1ERDA 2NVTJ 3OMYA 2CGPA 4JK1X 1H9TA 1OYWA 2HZTA 3WGGA 3BR5A 2WV1A 3U2RA 3IL2A 5D5WB 1LFUP 1AWCA 4KIGA 1G59A 2XF5A 1MJAA 2XV4S 3W6JB 4B1RA 2Y9ZA 3VFZA 1HSJA 3JAMZ 2P7CB 3ML6A 2GM4A 1Z7UA 2K5CA 2LY2A 4NQWA 1LFPA 4R1HA 1LJ9A 5IY5H 5LEJA 2PLYA 3FXQA 4JP0A 3FK7A 2XAJA 5E1XA 1K78B 2M4GA 1X3UA 4B09A 3H9QA 3TW6A 4A5NA 1KU2A 1H0MA 3CO7C 4CCKA 2VQGA 2W84A 1YJ9I 2R93J 2CUJA 2KIMA 2PI0A 1LDJA 3GFMA 3D5RC 2MH2A 2HFHA 2MSYA 4DYQA 1VQLI 3JTHA 1J7KA 3QU3A 2G7UA 1VQMI 2AO9A 4U0YA 4MGRA 4N0BA 3CCEI 1MKMA 4XLEA 5GADJ 1VF9A 4PK4A 1W36D 2NYXA 3B73A 1ZELA 1GDTA 3I4NJ 1KU9A 4A0XA 5C44J 2CFOA 3BWGA 4UVBA 2HKXA 2J5OA 2CJJA 2WAQN 4A6EA 1OCZH 3OSFA 1MZBA 3T1BA 1FYKA 1EV7A 2VJJA 3LQRA 1LQ1A 1UHSA 2HXOA 2DFEA 5FROA 2HVQA 4C3JJ 3K4KA 4U0WA 4HQEA 4NQWB 3LSIA 4DW6A 2YSRA 1WRJA 3ZN0A 3JAMK 2DMNA 3ZRGA 4BHCA 5ICFA 1VQNI 4KFCA 3C3WA 4WXHA 2NVXJ 4UXNA 2W57A 3SFZA 4BL0B 5GTHC 1JJ8C 1PYVA 2QVOA 2EFOA 1QA6A 1W1WE 1IN4A 5HLGA 1S29A 2QQAA 2QWWA 5D4SA 2RDPA 5FD6A 4LLNA 4F93B 4D5FA 3OYDA 3ZGKA 1APLC 2O8KA 3PFIA 4IHSA 3G1MA 4PUSA 4BYYA 5M5WJ 2IGNA 4EGZA 4N9IA 1YS7A 1HLVA 1AU7A 5D5UB 2FQ4A 1LVKA 4U7BA 1YI2I 1K83J 3KP4A 5FB2A 3P7NA 5EDNA 1I1GA 4BDYA 3A01B 4ON0A 1FTTA 4EMSA 4AYBA 3L2WA 4KIFA 2K9MA 1LEAA 2F48A 1ORKA 1LDKB 2E5ZA 4O6JA 3S1RJ 2Y9YA 3DPUA 2KIFA 4KA4A 2CW7A 3O3KA 4KITB 3EUAA 4CYCA 2Q2EA 2BW3A 2V7FA 4DBRA 3LAPA 2KL4A 3F21A 2O9LA 4IOAF 2NXNB 4F91B 3K2AA 3HBLA 1FMVA 3BTLA 2NNYA 2M45A 3S2HJ 3HKZN 3RYRA 5EF6A 4LLLA 1IZ1A 3D1NI 1LNWA 1IV8A 3WTZA 4A93J 4BY7J 1NG6A 2IGOA 1JE8A 3S2DJ 1WJDA 2VLAA 4M3EA 3N4MA 2F6CA 1R7JA 1QGPA 3HRSA 1ZAOA 1LFBA 4Y13A 2W7NA 2M34A 1MNMC 4MHGA 1Z05A 2I10A 2LR8A 2LK2A 3EYIA 2VI6A 2E2IJ 2FXAA 2ZO4A 3W3CA 3OS2A 3PNYA 5DEQA 4GDFA 1BI0A 1S7EA 2GXGA 4HSTA 2KP6A 1S72I 4A6DA 2GOXB 4PSWA 1GXPA 3MKWB 5KAFC 2KDOA 1EA3A 1ULYA 1YX5A 3S14J 2R5ZB 2QSGX 3ECHA 1R22A 2IVMA 3T8TA 1V4RA 3GEZA 4BQQA 1L3LA 1PP8F 1TL8A 1JGGA 3OR2C 1NK3P 3ERED 1PUEE 2YS9A 3HPGA 3I58A 3GTMJ 3T5XA 1RKWA 3E3VA 5LHHA 1MSEC 4WWCA 3K2ZA 3WTVC 4MNUA 2M0CA 2HQRA 5LHGA 1YQAA 2ESNA 2M8GX 5F27A 2VUMJ 4XRMA 3KYDB 1WCMJ 3F8NA 5GP9A 3ZP5A 1J09A 1J9IA 3OV8A 4A5MA 3IH3A 4B44A 1R49A 5EEHA 2TRTA 1PVEA 3WE2A 2HI3A 4P1WA 4HF1A 3S1NJ 2XRNA 1XC5A 2AS5F 3RKQA 2DPDA 5D5XB 5FKKA 1F1ZA 2NOJB 3L00A 4DZPA 1ZK8A 1P7JA 2W85A 3G3ZA 2L54A 4JX5A 3E1SA 2PMZA 2DA1A 3NEUA 5D4RA 3QU6A 2X0LA 1G8XA 1U9OA 3H92A 4HF0A 4KICA 4JX4A 4DYRA 1O3TA 2X9DA 2QCOA 3HPHA 4LD5A 4RLQA 3M1EA 3S3NA 3NARA 3OOPA 1NG7A 2DA4A 2JK3A 5AONA 3H36A 3F23A 1RKTA 3OYMA 1G3YA 1ZG5A 1OCPA 2QA4I 4H0EA 4YFNF 4PGHA 1T56A 4EJVA 5B1AH 1BI1A 2L7KA 4EEFG 2PJRB 1MBKA 3HGGA 2CUFA 2M87A 5FJ8J 2AXTC 1ITYA 4IQJA 1MBJA 2GWRA 2JN6A 2KHMA 2KJCA 2VT2A 3WHBA 3PIPF 3GF2A 3SEZA 3B02A 2MG4A 1B9MA 3DPTA 4YFXF 2FRHA 4OAYA 2JWTA 3H3ZA 4N4NB 2OJED 1YW7A 3BCAA 2IBDA 5LGTA 3WHCA 2GBYA 4XLFA 5ED4A 3JREA 2VBYA 5DDGA 2VXDA 3I3LA 1D3YA 5ILUA 1QU3A 1W0UA 4CSWA 4CYCB 2P6TA 3PFYA 3I56I 2NRAC 2G7HA 4G6DA 3I54A 2XF6A 1TZLA 3KP5A 3HTSB 4M72A 5J40A 3CUQA 3DV8A 2HYGD 2JUCA 2HTSA 1LE8A 1WHUA 3P9KA 2H8WA 3OYFA 1DU0A 3HOSA 1P2FA 1IGNA 1MH4A 1WJAA 1R6RA 3SJMA 5HS7A 2ELKA 3HOZJ 1DPUA 3GWZA 2R7VA 2P4WA 1RR7A 3WGIA 4DQ2A 4ENMA 3G71I 3HOXJ 5C3EJ 4ZTFA 2CUEA 2DFFA 1FMWA 2MA3A 5CQEA 4L5IA 2D5VA 2QYOA 5FLVA 1UAAA 4Y3OA 1T39A 5J47A 1VNDA 2L7ZA 4NDLA 5BMZA 1BC7C 2K9NA 1VFCA 2ZXIA 4A3LJ 1BOBA 3IKTA 4XLPF 1T08B 3G2BA 1ETKA 3LAJA 4BQOA 5E1WA 1OCCH 2HVSA 2IRFG 2RKHA 2I8DA 3I5UA 3JRGA 4ASNA 3L9FA 1SFUA 1IN5A 2E2HJ 3VYRB 1X1DA 5A2QZ 2AXLA 3DXJF 1GHCA 3E97A 2L4MA 2CV2A 4M9ZA 3BJOA 4PFOA 2W4SA 4BU2A 4KDPA 2HXIA 3A4CA 4HX7A 1T98A 1KYWA 3F6OA 3CDLA 1SD4A 5JHUA 2Q0OA 1G2HA 1Z3YA 5CVUA 1XSDA 4I01A 4II3A 1D0YA 4ZDOA 3LA2A 3GFIA 2VKHA 3FDYA 4ZZLA 3CMEI 4EJOA 2QSHX 2ZJQF 1X4PA 3G4SI 4RBOA 3OYNA 1N78A 5K5QA 2QZ8A 3GVAA 5J1RA 1EJ9A 4OIPF 5BPDA 2KJBA 1V5FA 2R7FA 5DYMA 2L9SA 4AIHA 2Z33A 2ZSIB 5HLHA 2BY2A 2AHQA 3IKVA 3RQIA 2XSJC 4M74A 3BDDA 5E79C 2F4IA 2TDXA 4UVCA 1HXDA 1MMDA 3HSRA 3E6BA 1CF7B 2D45A 2GXBA 1IRGA 3WTWC 1FYLA 3R0JA 3LNQA 1SC7A 4YIFA 1RRJA 2VPRA 2DPUA 2O61A 3CC7I 2ZJPF 2Y2ZA 5LBQA 2LRDA 4DJAA 4BQNA 4J00A 3HRMA 4I2OA 5D5VB 1P4AA 4Q5SF 4F3QA 3TDZC 1R1UA 1V54H 1JTYA 1Y56A 1K61A 1UJ8A 5F0FA 2O7OA 3M8FA 5EJCA 4A3GJ 3RKWA 3DQVC 4AYBN 4FASD 2ACJA 3GTGJ 4LOCA 1MNEA 3F8FA 2MLGA 3ZQQA 4AD9A 1QQIA 2ZFWA 2Z3YA 2YX7A 1Z6RA 1ZLJA 5CJ9A 4BE2A 4GXOA 1TWGJ 2JMWA 4LG0B 1R5ID 2BVLA 4NHJA 3M1CA 3BTCA 2ME0A 3JRFA 1Y1VJ 1FTZA 1JGSA 3KCCA 2H1KA 1T33A 3ROUA 3RTRA 3BR0A 3OIPA 4X1EA 1EH7A 3GLXA 1ZR2A 2HKOA 1D0ZA 3BR6A 2HGCA 3ZN1A 2V9VA 4BDZA 2OCCH 4Q4ZF 3Q5FA 2NAZA 1BR4A 2IAIA 4E7JA 4KT6A 4UB6C 1SFEA 4LIVA 5BNGA 3CJRB 2P5LC 3R61A 4L9JA 1H89C 1Y8QB 2QQ8A 3WG7H 4KT5C 1IV6A 4F55A 2XHKA 3IV5A 1S8NA 4BNCA 1JTXA 4I7HA 5EGOB 2JVHA 1HW1A 2XPVA 2KIQA 2R5YA 4ENNA 3I64A 5ICCA 1XG1A 3FXKA 3QPSA 2RQPA 2LKXA 3HYIA 3ONQA 3H3VK 2BY1A 3IAS2 1P9QC 4UV8A 4P9UA 1Q1HA 1QNTA 2COBA 4MQVA 4PJ0C 2G9WA 2KZVA 3HRTA 4IRIA 4B4CA 3CMAI 1BA5A 1TWCJ 2STTA 3AFHA 2HWVA 3WGHA 5HVQC 2CFXA 1HBXG 3OYGA 1JJ6C 2OC6A 3H5AA 1VTNC 4YRVA 5EYRA 2XPUA 1TQMA 4E7ZA 2DA6A 3O8GA 4XN0A 4S0HB 1ETWA 3BG6A 4C30A 2XAGA 5LLQA 1OR7A 3ZMDA 2OZUA 3BJ6A 4Q47A 1BR2A 4D7NA 4PGGA 3QPTA 2L9VA 3E6MA 3T8RA 2K3PA 1XCBA 4WK8F 4EM2A 1OMIA 5DCMB 2ZC2A 2VIXA 2EIKH 4G6TB 2JA8J 2XAUA 2LKPA 4BHBA 3M4OJ 2XASA 3VB2A 2VXZA 5L3DA 1RIOH 3DTEA 4A0ZA 4C2MJ 3SQNA 2VN2A 1FIPA 1SD5A 4CUGA 3W2VA 2FMLA 2PBIA 1K79A 2O3FA 1BI2A 4C2UA 1XX5A 2HQNA 1K7AA 2AQFA 3CP8A 3GFJA 1TWAJ 4OIRF 3RZOJ 3QOPA 4TV7A 1MJ9A 4AIKA 3QQAA 1YIOA 1QVTA 1Z6TA 3PUFA 2LP0A 3OOUA 2MYSA 2Y75A 4L0ZB 4P96A 3RSNA 2EFWA 5TISC 4BEHB 4UUSA 4MO7A 4E7IA 1TW3A 1U5TB 5CKTA 1LE8B 2E71A 2O03A 3LFUA 3HB9A 5CVJA 3PIOF 2R7DA 2Y69H 4A3MJ 4H4KC 4OMYA 2JSPA 5J8CA 2EA4A 3ZPLA 3L1PA 2R5YB 1XB4A 2DOAA 2ECBA 3AG1H 3N05A 4HA8A 4HQMA 1X3ZB 2ZNYA 4BJTA 3NQOA 5EGOA 2PJPA 1JUPA 2JUGA 2DQRA 4L5EA 3PNTA 4DIQA 3S1MJ 2ZXJA 4XL9A 1OISA 1QZZA 4A0YA 3DKYA 2GZWA 2CG4A 3TEDA 3OS1A 4XRSA 4AIJA 1VZ0A 4IO9F 4GCVA 2H94A 1FPQA 3SZTA 3GTJJ 1ZN2A 1I3AA 3ULQB 2X85A 1WI9A 3IH4A 5IYDJ 1PDNC 2ID3A 4OWRB 4NC7A 5DS9A 1XS9A 3KYCB 3ZMTA 3VSLA 2ID6A 3IRQA 2VL8A 1QZEA 3CMMA 2X1DA 2NNNA 1BJAA 5F0CA 2P8TA 3LSKA 1R1VA 2HQ5A 4W97A 1Y0NA 4F52A 1WJEA 4C9YA 4MTDA 1QPIA 5H20A 3J7YJ 3EPZA 2K9SA 2R7XA 1SD7A 3PL8A 1I27A 3K4MA 1V55H 1O3QA 2Q1ZB 4BEHA 2RGVA 2E1MB 1PUFB 1IW7F 1UG0A 1A5JA 2HVRA 1W5CC 4ETSA 2R4GA 1UMQA 2CYYA 2ADUA 5E3OA 3J7AY 2Y0MA 4A2UA 4YG2F 4OIQF 1SFKA 1I50J 2XGCA 3KP3A 2XF7A 4FE7A 3ABLH 4ZTJA 5FRMA 2CQQA 2F5DA 2VBWA 3BCBA 3NWTA 1D1AA 2B0LA 1SVMA 4CZZA 5IP6A 1SVLA 1B4AA 1W7PD 2HDWA 1FP1D 2EV6A 3LSTA 4IXAA 1IRZA 2NS0A 2KLOA 2KISA 2E1NA 3LA3A 3F9KA 3KZZA 1JKPC 4AVZA 5BOXA 2XGDA 2LF7A 1MIJA 2CW8A 1FEXA 4RA2A 3ZQIA 4L18B 1UHWA 2DTZA 4I99C 1FP2A 1TTYA 1R1TA 3IC7A 4ZH4F 4X6AJ 3HTUA 3TGNA 4W1UA 3OYIA 4DGWB 3ZQ7A 1ZRCA 1V5EA 3HRUA 4XOPA 1SAXA 9ANTA 5FKOA 2GA2A 2VJ4A 4QLCU 3GCMA 3WODF 2MBFA 2KT0A 2WC2A 5E20A 3S1QJ 2MH9A 2K27A 2MGQA 5EEAA 3WU1B 1BC8C 2K4JA 2KIUA 5B3SH 2LDUA 1YRNB 4DYCA 4ZJZA 3JRCA 2Z16A 3BZCA 4B3AA 5HODA 2QF7A 3HHHA 4IVNA 4Y4RA 4ENJA 1SFOJ 4B43A 4BY1J 2EZHA 1HW2A 3LQQA 3ISPA 2HYFA 4XIDA 1YS6A 1I5ZA 1W0TA 1IXCA 2F5VA 3TO9A 2L7FP 3HJEA 3V8JA 1G3TA 3WTYC 5TGTA 2KRFA 2IJLA 2OZ6A 3TL4X 2E1MC 4ESBA 4D5CA 2HZDA 3KIOA 5E17F 4D9JA 1XSXA 5KVRA 5GAEJ 5IOZA 1X1BA 5LGNA 2D1HA 3IHUA 2OUMA 3DTIA 3B6AA 4KN7X 1E17A 4Q48A 3HIFA 1VQPI 2LF8A 2GAUA 4MIMA 3OYBA 4PCQA 3F0CA 2M2EA 3CUQC 3KLNA 2V9KA 3RPUD 1LUJB 2ICWG 5FFXA 3Q0UA 2IGMA 4OIOF 3KEYA 2FOWA 3BR1A 1H8AC 3PSFA 3MZ8A 2DA5A 5CLSA 1YJWI 1MGTA 4IQ4A 2A61A 3BQZA 3M7GA 1LEBA 2ELJA 4PJMA 1OFCX 1ACIA 5BPIA 5HS8A 1MMSA 2D2WA 4RM3A 1BIBA 3HUGA 3G6EI 1N77A 4BH9A 4ITVA 2BV6A 3V7CA 4RDUA 1B72A 4Y52J 4KMFA 4V2GA 2ZXWH 1MJBA 4M3GA 2EFPA 1TQPA 2P5VA 2L5QA 1ZREA 2CU7A 4RLFA 3ZQHA 1TBXA 2A68F 3OIQA 1W7PA 1D5YA 3SXYA 4OU0A 4A3CJ 1UELB 2WAQA 1W36C 3DU5A 4XMYA 2V1NA 1X1CA 2UV1A 4RAZA 2HNHA 4HLXA 3ZMVA 5L3GA 1XGMA 2LY1A 3QWLA 2LYCA 3IWFA 4QPOA 4L9NA 3K70C 2YUSA 1TC3C 4BHPA 1QHGA 3PO2J 1VQ9I 1IG7A 1FSHA 2IA1A 2DDBA 1R23A 4MEYF 4R8HA 2K3FA 2R7ZJ 1STZA 4Y7NJ 1B1BA 4HSRA 4BACA 3T0YA 1K6YA 1JT0A 1D8KA 1FX7A 2JJ7A 1B9NA 3GTQJ 2HOTA 2VKEA 3MKYB 3DPLC 2DFHA 1RETA 1RZ4A 1D0XA 2QGUA 1S7AA 1D1BA 2A5WA 4IJAA 3W2AA 3CJQB 1TT5B 4X0GA 4OMZA 2HDCA 2H1LA 1JKRC 1RR8C 3S8PA 1GVDA 4RGUA 5LD2C 1J5YA 2PX9A 3CUQB 1AOYA 2Z99A 3A02A 1ZG3A 2M3AA 1WVRA 3AG3H 1O3RA 1YW9A 5CVIA 4HV5A 5M3MJ 5J1UA 1UB9A 3S15J 3LSRA 2VBXA 3LSJA 3CCLI 3AG4H 2QENA 3LOCA 3QAHA 2E7XA 1Q1VA 3W6KB 1T6SA 4IX7A 4CH7A 1OJLA 3GFLA 1EH8A 2BEOA 1R5HA 1YOVB 4M9XA 4HRIA 3VDXA 3NRVA 3G73A 1FOWA 3COAC 5DM7F 4LLGF 4FX4A 3FK6A 1B59A 1SMYF 3WTUC 3DLAA 3MFKA 4ZDPA 1DGRM 4M3DA 5H6QA 4BJ5C 4G8XA 3R6SA 3IH2A 4M3FA 3GTKJ 4G7OF 2RQQA 1BM9A 3MKZA 2F5FA 3MEXA 3SEQA 3ELKA 2MC3A 5FKNA 2DMTA 4HDVA 1MH3A 4HPQA 3LSMA 2STWA 1Y39A 1HDPA 1YYVA 2R5ZA 2V79A 5KK1A 1OYIA 4S05A 3FF5A 5IT9Z 1QRYA 3D0SA 3P9CA 1O4XA 4II2A 2X4HA 4XSZF 2DW4A 2KFDA 3R60A 2E19A 3U1DA 2OTJI 3P5JA 4OINF 2XIGA 3M8JA 4C2TA 2VE9A 1Y1WJ 1FT9A 3VOEA 2IS4A 4KMUX 2KMUA 1ZYRF 1KGSA 3TOBA 1VI0A 3DCFA 2FMYA 5E18F 5H2FC 3QOEA 3J81K 3MKLA 4PSXA 3J7AO 1NH3A 1S3JA 3GBGA 3C2BA 2Z2SB 5DM6F 1QPMA 2E34A 5L3CA 2K40A 2ETHA 3K4CA 3TMOA 2EFNA 1ZARA 1FJLA 2WV0A 1YFHA 2QLZA 5JVTA 1XD7A 2XPWA 3C2HA 4EJWA 3HOVJ 2UXXA 2BYVE 2DAOA 2VQHA 5D6FA 2F2EA 1T8IA 2RAEA 3MQ0A 1MBEA 4BJ6C 1U8RA 2P0WA 5DD4A 1K4SA 1OLTA 2QQBA 2OA4A 3V42A 4YIIA 1ZR4A 3JRDA 1TWFJ 2BW3B 3E7LA 3QP5A 3FZVA 2DQLA 1IXRC 2XB0X 3A0BC 3GO5A 1FOXA 2EJRA 4KN4X 4GFBA 2BE5F 2ZCWA 1ETXA 3SHFA 4FETA 2A05A 1U8BA 2NOGA 1AKHA 3L09A 2XAHA 2KRCA 3HOUJ 1I6XA 4NB5A 1TP4A 4YEJA 5TJJA 2HR3A 4Z2YA 3L2VA 1V5GA 4BS9A 2DT5A 2TCTA 4JQFA 4IHTA 2WADA 1KA8A 5J4VA 2FNAA 2OPTA 5HLIA 3K0LA 3PQKA 5KAIC 2ZMEA 1YHQI 3CF2A 4HNTA 3TOAA 4A69C 5JHFA 2OCEA 3AL0B 2WTEA 5J3LA 1KZHA 3KLOA 5IYBJ 2UWMA 3KFWX 5DV5A 5EG0B 4IRHA 4CCMA 2PQ8A 3J80Z 1MDMB 1X58A 3FKIJ 3J80K 3CCSI 2EBIA 4L0YB 4UY8I 5EG0A 1TW2A 3BPVA 4AVPA 3CD6I 4DZJA 4XORA 4XN3A 1E2XA 2XUBA 1XMAA 3BOQA 5FKMA 2A5YB 1XDUA 2VC0A 1U3EM 4U88A 1L0OC 5TRDA 2OAZA 3D5LA 2R7SA 1TT0A 3CLQA 1XGOA 3BROA 2XGXA 3TW7A 1VQ6I 2M8EA 2E5NA 4XLCA 2M0MA 1A31A 2DJIA 2FBKA 3VYUB 3PUBA 5C4XJ 4FT8A 5JFRA 3MAJA 1T2KA 2XRLA 5CYVA 2Q8KA 3CF5F 4BKXA 4A3FJ 2V6CA 2PMUA 2ISYA 3LA7A 3ZCOA 1S9HA 3KP6A 3A03A 2UUZA 1RUOA 3ZMSA 1ZGWA 3F8BA 4WXDA 1YE9A 2CV1A 2KRHA 5CPRB 3KZYA 2LKSA 4XRFA 4QPQA 1VQ5I 1S7OA 5BQTA 3VODA 1PUFA 1R4NB 3F3XA 1RPWA 1XCVA 2BOLA 4A3IJ 1U6GA 3KPHA 2FA5A 3FHNA 1XDSA 4D1QA 4IZZA 2PJRA 1ZRFA 3BG3A 2XB5A 2IT0A 2BY0A 3SYTA 2DO7A 3OIOA 4RB1A 3MZHA 2V26A 3BY6A 1X3WB 5K7FA 3K4JA 1T0FC 3CCRI 2O0YA 2L7MP 3FX3A 2EIJH 1J75A 2M7AA 1W4MA 2KKOA 2LBFA 3CDIA 3WTSC 4IHYA 1FC3A 1FY7A 3J81Z 2BGCA 3E5XA 1W5TA 5DTDA 4XRSG 4ZYEA 3AL0C 4XR6A 3ASOH 1X1PA 3N97A 3OYEA 2A6HF 2K9LA 4XK4A 3RKXA 5FD5A 3TDUC 2CQXA 5B66C 2CW0F 5K7HA 1WQ2A 3J7ZI 2LVSA 3ZQFA 2IA2A 3X2QH 5GTIC 3K4NA 3BLYA 3MCZA 3NWSA 2DK5A 4NC8A 1E0EA 2MD0A 2WY8Q 4AUXA 4P5OA 1HOMA 3ZQGA 2O8XA 4NUBA 1XPXA 3U9GA 2WWYA 4WXCA 3ABTA 4I6ZA 3HOYJ
chains in the Genus database with same CATH topology
2HEOA 3RPQA 1BI3A 2GIVA 3JSPA 1LB2A 5ERIA 3ZMZA 3EUHA 1G3WA 3GZ5A 3I59B 1ON1A 3M8EA 3HOTA 3K1PA 2FE3A 4RAYA 2QBYA 3QPHA 2DU9A 4CDGA 2ZMEB 1HW5A 4HW0A 2CQKA 3F8CA 1BBYA 3QRFF 4UNOA 3FMRA 4EJTA 1YG2A 4L9TA 3CTAA 2PN6A 5HDGA 4GGGA 2ZNZA 4Y15A 2A69F 3Q9VA 4I0AA 3E5QA 1KYZA 5D8LB 1QO0D 4RB0A 3RKYA 3FHZA 1MDMA 1H9GA 1ZRDA 2DLLA 1XSVA 1QBJA 3H3UA 2COMA 1K6OA 3DKWA 2IW5A 5LRSA 4MQ9F 2V1UA 4RB3C 4CYDA 1FBQA 3F22A 1UFMA 3LWFA 4LG0A 5IT3A 1W5SA 1FBUA 3JTGA 1IUYA 4KIBA 1NHAA 4G7ZF 4DNCA 1T0FA 1U5TC 2JT1A 3FMQA 4LK1F 1WSUA 3WE3A 1OKRA 2Z5UA 3RIRA 2XKOA 3EDPA 3K69A 4P55A 2IA0A 2F5CA 2GA1A 3CDHA 3I59A 1Z9CA 1ZH5A 4RB2C 2QM3A 1MD0A 3BPXA 2OQGA 5K1YA 3V8KA 1WKMA 4CGZA 4KNYA 1Z1DA 2HS5A 4JBAA 4ZZDA 1D5VA 5AIPA 2A3SA 1O3SA 4IRGA 2MLKA 3BJAA 2EFQA 1HSTA 3MWMA 2UXNA 2FQ3A 2K86A 1USSA 2VT3A 4D0PA 3ZMUA 2CSOA 3DEUA 1FBSA 1KQ0A 3RJPA 5K5OA 4HOBA 3EYYA 1R58A 3LFKA 1DUXC 4LJZF 3E5UA 4M73A 2M30A 2PG4A 5FLXK 2OBPA 2PMHA 4GO1A 2H6BA 1HKSA 1EH6A 1IN7A 3HSEA 1CF7A 2EV5A 1R00A 4BXUA 2O6GE 1IN6A 2YR2A 1FSEA 4N9HA 4IF4A 4RS8A 4FX0A 4R79A 1LVAA 3DFGA 3FXRA 3BP8A 2DTRA 1QZYA 4EV0A 4IPAA 2XAFA 1O7FA 5CVRA 1C0WA 5H6RA 3E6CC 3WTXC 4HV6A 1R36A 4HX4A 4G7HF 2A07F 4GYIA 4RGSA 4LFUA 2ELHA 1FLIA 1BOAA 4XLNF 2RVCA 3HSFA 3VEPA 3GZ6A 4CO8A 3ABUA 4I09A 1HKTA 4LMYA 4YFKF 2YPRA 4MTEA 2W25A 1XMKA 3WU0A 1BN5A 2MD5A 3TO6A 3FWEA 3R0AA 1TQIA 2RC4A 3EETA 4WCGA 1RNLA 1FWZA 1ZGJA 2FSWA 2K02A 2E1CA 1UHMA 2H09A 1DP7P 1P92A 3P9IA 1Y0UA 2IPQX 2H27A 1S6LA 2L4AA 1YO5C 4LB5A 1T38A 2JZYA 1J0RA 1ZLKA 4OOIA 4EM0B 5A2QK 1YTYA 4BQAA 2R3SA 4G6QA 2EK5A 1SMTA 5DUIA 2PFBA 4U7DA 4QWQA 2K4BA 4UHTA 3F72A 4HAMA 2CWEA 4WX9A 1XGNA 4MEXF 3KEQA 1B6AA 2FU4A 2JPCA 2QUFA 5K5RA 5J6XA 4UV9A 2LNBA 5D8KB 3GYHX 3REOA 4U0VA 2FNPA 3IWZA 2OD5A 3GUDA 4AWXB 1TNTA 2Z9OA 3F8MA 3DF8A 2EB7A 1ON2A 1FYMA 3GXOA 4FHTA 1RUNA 2P6SA 3K1MA 5JR3A 2C6YA 2M1BA 4G9YA 2A6EF 4HYEA 1LDDA 2ZBKA 3CO6C 2LSOA 2DI3A 4ZYDA 4UVAA 3V7RA 1G6NA 1V3FA 5LHIA 4HDUA 1K78A 3V7SA 3FMSA 3WG9A 4K2EA 3HHGA 1YW8A 2K7LA 5L3BA 2D1VA 2HTJA 2ESHA 5ILVA 2UZKA 2V1DA 3C7JA 5FLXZ 4EVIA 3BZ6A 5HDKA 3KEOA 1TLHB 2XVCA 2EA2A 1FOKA 5FO5A 3CLOA 4M9SA 3FM3A 5FFZA 5FGMA 4UUVA 2P5KA 4XSXF 1J2XA 1W7PB 4ESJA 5DCMA 3R4KA 3TO7A 3JW4A 3FXUA 3Q9SA 1KQ9A 1P6RA 5L3EA 3FM5A 1ZHFA 5LRRA 5E1ZB 1F4KA 1ODDA 1R5GA 5LGUA 1A04A 2L3DA 5E8GA 3V4GA 3JSOA 2W24A 2M5WA 4PZJA 4M71A 2Y48A 3I53A 1P4XA 2VOPA 4ZYGA 4ENKA 3WTTC 1ZG1A 1BIAA 2VOOA 3KP7A 1DPRA 5AIQA 1IRFA 3IRRA 2FBHA 4O5VA 5L3FA 4B8XA 3AAFA 4GYGA 2QQ9A 1GVJA 4XBFA 1IXSB 2JSCA 4PDKA 3O2PE 2RN7A 2DFIA 2XKPA 4CICA 4HX8A 1F9NA 4WF2A 5DUKA 3I0TA 3DP7A 2GQQA 4I98B 5F1RA 4G94A 1SFXA 2EV0A 1XGSA 4S04A 4EQQA 2FEZA 4L9VA 4O3MA 3RYPA 1IAWA 1Z91A 1I1SA 2OU2A 2ZKZA 1RI7A 6PAXA 2JTVA 1YLFA 2VODA 2QBYB 1GXQA 3M9AA 3TKYA 3KETA 1J59A 2VONA 4EJUA 2CO5A 3E6DA 2XAQA 2RNJA 3TQNA 2YU3A 1PP7U 4I0BA 3CUOA 4HF2A 5ILSA 3L2CA 4BAYA 2VE8A 4L5JA 1F5TA 3F6VA 3EQLF 2EWNA 4EM1A 4KYWA 2J5PA 3C1DA 2FOKA 4LB6B 2JRTA 1WWXA 2ISZA 3RI4A 4A12A 1KU7A 2DBBA 2ZJ2A 1U5TA 1IF1A 3KP2A 5BS6A 5LEKA 2V1XA 3S2WA 4HLYA 3K1NA 3O6BB 3L7WA 1IN8A 1KQ8A 4I02A 2IP2A 5HS9A 2HOEA 4RGXA 4CXFA 3SZPA 3RDIA 5JI6A 4ESFA 2DK8A 1JXSA 1D8JA 5D6EA 1UCRA 3MZYA 1G4DA 4LGWA 3ECOA 5F64A 3C18A 1U78A 4CHUA 1O7LA 1O57A 2XROA 3I4PA 1CGPA 1G3SA 4HZFA 2YX4A 2H6CA 2F5EA 1XN7A 1ONVA 4LK0F 3V8LA 3GW2A 5F6FA 3I71A 1JHFA 4F7ZA 3K9TA 3KE2A 4RGRA 5E8IA 1USTA 1U2WA 1SD6A 4HBLA 2FBIA 3PQJA 4Y17A 1ZGAA 4ZYHA 1DDNA 4EGYA 2RV8A 4P9FA 1FZPB 4M6YA 2FF4A 1HKQA 2L02A 5EEGA 5HDNA 1REPC 2P7VB 5DCFA 1FNNA 2JPBA 1P4WA 1JHHA 4E70A 5J8FA 3GX4X 3QP6A 5CVVA 2BBYA 1OYYA 5DD8A 1TNSA 3RPUA 4KUMA 1OPCA 2PEXA 5ICEA 2E7WA 2VBZA 1HQCA 4M6XA 2OQRA 2VC1A 3CJNA 5ICGA 5HOOA 1KU3A 2L01A 5IT9K 2CGPA 4JK1X 1H9TA 1OYWA 2HZTA 3WGGA 3U2RA 3IL2A 5D5WB 1AWCA 4KIGA 1MJAA 2XV4S 3W6JB 3VFZA 1HSJA 3JAMZ 2P7CB 3ML6A 1Z7UA 4NQWA 4R1HA 1LJ9A 5LEJA 2PLYA 3FXQA 2XAJA 5E1XA 1K78B 1X3UA 4B09A 4A5NA 1KU2A 1H0MA 3CO7C 2W84A 2KIMA 2PI0A 1LDJA 3GFMA 2MH2A 2HFHA 3JTHA 1J7KA 3QU3A 2G7UA 4U0YA 4MGRA 4N0BA 1MKMA 2NYXA 3B73A 1KU9A 4A0XA 3BWGA 4UVBA 2HKXA 2J5OA 4A6EA 1MZBA 3T1BA 1FYKA 1EV7A 3LQRA 1LQ1A 4U0WA 4HQEA 2YSRA 1WRJA 3ZN0A 3JAMK 4BHCA 5ICFA 4KFCA 3C3WA 4WXHA 4UXNA 2W57A 3SFZA 2QVOA 2EFOA 1IN4A 5HLGA 1S29A 2QQAA 2QWWA 5D4SA 2RDPA 5FD6A 4LLNA 3PFIA 4IHSA 4BYYA 4EGZA 4N9IA 1YS7A 5D5UB 4U7BA 3KP4A 5FB2A 3P7NA 1I1GA 4ON0A 4EMSA 4KIFA 1LEAA 1LDKB 4O6JA 2KIFA 4KA4A 3O3KA 2Q2EA 3LAPA 3F21A 2NNYA 2M45A 3RYRA 4LLLA 1IZ1A 1LNWA 3WTZA 1JE8A 3N4MA 1R7JA 1QGPA 3HRSA 1ZAOA 4Y13A 4MHGA 1Z05A 3EYIA 2FXAA 2ZO4A 5DEQA 1BI0A 2GXGA 4A6DA 1GXPA 1ULYA 3ECHA 1R22A 2IVMA 3T8TA 1V4RA 3GEZA 1L3LA 1PP8F 3ERED 1PUEE 3I58A 3T5XA 3E3VA 5LHHA 4WWCA 3K2ZA 3WTVC 4MNUA 2HQRA 5LHGA 1YQAA 2ESNA 3F8NA 3ZP5A 1J9IA 3OV8A 4A5MA 5EEHA 3WE2A 4HF1A 2XRNA 2AS5F 2DPDA 5D5XB 1F1ZA 3L00A 3G3ZA 2W85A 2L54A 3NEUA 5D4RA 3QU6A 2X0LA 4HF0A 3H92A 4KICA 1O3TA 4LD5A 3M1EA 3OOPA 5AONA 3F23A 1G3YA 1ZG5A 4H0EA 4YFNF 4PGHA 4EJVA 1BI1A 2M87A 2GWRA 2KJCA 2VT2A 3GF2A 3B02A 1B9MA 3DPTA 4YFXF 2FRHA 3H3ZA 1YW7A 5LGTA 5ED4A 2VBYA 5DDGA 1D3YA 5ILUA 2P6TA 2NRAC 2G7HA 4G6DA 3I54A 3KP5A 3HTSB 4M72A 3CUQA 3DV8A 2HYGD 2HTSA 3P9KA 3HOSA 1P2FA 5HS7A 1DPUA 3GWZA 2P4WA 3WGIA 4DQ2A 4ENMA 2MA3A 4L5IA 2QYOA 1T39A 5BMZA 1BC7C 3IKTA 4XLPF 3LAJA 5E1WA 2IRFG 2RKHA 3I5UA 4ASNA 3L9FA 1SFUA 1IN5A 5A2QZ 2AXLA 3DXJF 1GHCA 3E97A 2L4MA 4M9ZA 3BJOA 4KDPA 4HX7A 1T98A 1KYWA 3F6OA 5JHUA 1SD4A 2Q0OA 5CVUA 1XSDA 4I01A 3LA2A 3GFIA 4ZZLA 4EJOA 5K5QA 2QZ8A 3GVAA 4OIPF 5BPDA 2KJBA 2R7FA 5DYMA 4AIHA 2Z33A 5HLHA 3IKVA 4M74A 3BDDA 4UVCA 2TDXA 1HXDA 3HSRA 3E6BA 1CF7B 2D45A 2GXBA 1IRGA 3WTWC 1FYLA 3R0JA 4YIFA 2DPUA 2O61A 5LBQA 3HRMA 4I2OA 5D5VB 1P4AA 4Q5SF 3TDZC 1R1UA 3M8FA 3RKWA 3DQVC 2ACJA 3F8FA 2MLGA 4AD9A 1QQIA 2ZFWA 2Z3YA 2YX7A 1Z6RA 1ZLJA 5CJ9A 4GXOA 4LG0B 4NHJA 1JGSA 3KCCA 3ROUA 3RTRA 1EH7A 3GLXA 2HKOA 2HGCA 3ZN1A 2V9VA 4Q4ZF 3Q5FA 2NAZA 1SFEA 2P5LC 3R61A 4L9JA 4KT5C 2XHKA 1S8NA 4BNCA 4I7HA 1HW1A 4ENNA 3I64A 5ICCA 2RQPA 3HYIA 4UV8A 4P9UA 1Q1HA 1QNTA 4MQVA 4IRIA 2G9WA 3HRTA 2STTA 2HWVA 3WGHA 5HVQC 1HBXG 2CFXA 1VTNC 1TQMA 2XAGA 5LLQA 1OR7A 3ZMDA 2OZUA 3BJ6A 4Q47A 4PGGA 3QPTA 3E6MA 3T8RA 1XCBA 4WK8F 4EM2A 1OMIA 5DCMB 2LKPA 4BHBA 2XASA 3VB2A 2VXZA 5L3DA 1RIOH 4A0ZA 3SQNA 2VN2A 1SD5A 2FMLA 2PBIA 1K79A 2O3FA 1BI2A 2HQNA 1K7AA 3GFJA 4OIRF 3QOPA 4TV7A 1MJ9A 4AIKA 1YIOA 1Z6TA 2Y75A 4L0ZB 4P96A 2EFWA 1TW3A 1U5TB 2O03A 5CVJA 2R7DA 4OMYA 5J8CA 2EA4A 3ZPLA 1XB4A 4HA8A 4HQMA 2ZNYA 3NQOA 2PJPA 2DQRA 2ZXJA 4A0YA 1QZZA 2GZWA 2CG4A 4AIJA 4GCVA 2H94A 1FPQA 3SZTA 1ZN2A 3ULQB 1WI9A 1PDNC 3ZMTA 3IRQA 2NNNA 1BJAA 2P8TA 1R1VA 4MTDA 5H20A 1SD7A 1I27A 1O3QA 2RGVA 1IW7F 4ETSA 2CYYA 2ADUA 2Y0MA 4A2UA 4YG2F 4OIQF 3KP3A 2F5DA 2VBWA 2B0LA 4CZZA 1B4AA 1W7PD 1FP1D 2EV6A 3LSTA 4IXAA 2NS0A 2E1NA 3LA3A 3KZZA 5BOXA 2LF7A 4L18B 1UHWA 1FP2A 1TTYA 1R1TA 3IC7A 4ZH4F 3HTUA 3TGNA 3ZQ7A 1ZRCA 3HRUA 1SAXA 2GA2A 4QLCU 3WODF 2MBFA 2WC2A 5E20A 2MH9A 2K27A 3WU1B 1BC8C 2K4JA 2KIUA 2LDUA 3HHHA 4IVNA 4ENJA 1HW2A 3LQQA 3ISPA 2HYFA 1YS6A 1I5ZA 1IXCA 3TO9A 3WTYC 3V8JA 1G3TA 2KRFA 2IJLA 2OZ6A 4ESBA 5E17F 1XSXA 5KVRA 5LGNA 2D1HA 3IHUA 4KN7X 1E17A 4Q48A 3HIFA 2LF8A 2GAUA 4PCQA 3CUQC 3KLNA 5FFXA 4OIOF 5CLSA 1MGTA 2A61A 3M7GA 1LEBA 5BPIA 5HS8A 2D2WA 1BIBA 3HUGA 4BH9A 2BV6A 3V7CA 4KMFA 1MJBA 2EFPA 1TQPA 2P5VA 1ZREA 1TBXA 2A68F 1W7PA 3SXYA 4OU0A 4RAZA 4HLXA 3ZMVA 5L3GA 1XGMA 3IWFA 4L9NA 4BHPA 1FSHA 2IA1A 1R23A 4MEYF 4R8HA 1STZA 1B1BA 3T0YA 1D8KA 1FX7A 1B9NA 3DPLC 1RZ4A 1S7AA 4IJAA 4OMZA 2HDCA 4RGUA 1J5YA 3CUQB 1AOYA 2Z99A 1ZG3A 1O3RA 1YW9A 5CVIA 4HV5A 1UB9A 2VBXA 2QENA 3QAHA 2E7XA 3W6KB 1T6SA 3GFLA 1EH8A 2BEOA 1R5HA 4M9XA 3NRVA 3G73A 3COAC 4LLGF 4FX4A 1B59A 1SMYF 3WTUC 3MFKA 5H6QA 4G8XA 3R6SA 4G7OF 1BM9A 2F5FA 3MEXA 3ELKA 2MC3A 4HDVA 2STWA 1YYVA 2V79A 5KK1A 1OYIA 4S05A 3FF5A 5IT9Z 3D0SA 3P9CA 2X4HA 4XSZF 2DW4A 3R60A 3U1DA 4OINF 2XIGA 2VE9A 1FT9A 3VOEA 4KMUX 1ZYRF 1KGSA 3TOBA 2FMYA 5E18F 3J81K 3J7AO 1S3JA 1QPMA 5L3CA 2ETHA 2EFNA 1ZARA 2WV0A 1YFHA 2QLZA 5JVTA 1XD7A 4EJWA 2UXXA 2BYVE 2DAOA 5D6FA 2F2EA 3MQ0A 1U8RA 5DD4A 2QQBA 2OA4A 4YIIA 3QP5A 3FZVA 2DQLA 1IXRC 3GO5A 2EJRA 4KN4X 2BE5F 2ZCWA 3SHFA 3L09A 2XAHA 1I6XA 4NB5A 5TJJA 2HR3A 4Z2YA 4IHTA 2DT5A 4JQFA 1KA8A 2FNAA 5HLIA 3K0LA 3PQKA 2ZMEA 3TOAA 2WTEA 3KLOA 2UWMA 3KFWX 5DV5A 4IRHA 2PQ8A 3J80Z 1MDMB 3J80K 4L0YB 1TW2A 3BPVA 4AVPA 1E2XA 2XUBA 1XMAA 3BOQA 2A5YB 1XDUA 2VC0A 1U3EM 4U88A 1L0OC 5TRDA 2OAZA 3D5LA 1XGOA 3BROA 2XGXA 2M8EA 2FBKA 4FT8A 5JFRA 3MAJA 1T2KA 5CYVA 2Q8KA 2V6CA 2PMUA 2ISYA 3LA7A 3KP6A 1RUOA 3ZMSA 3F8BA 4WXDA 3KZYA 4XRFA 1S7OA 5BQTA 3VODA 3F3XA 1XCVA 1U6GA 2FA5A 1XDSA 1ZRFA 2IT0A 2DO7A 4RB1A 3MZHA 3BY6A 2O0YA 3FX3A 1J75A 1W4MA 2KKOA 3WTSC 1FC3A 1FY7A 3J81Z 2BGCA 3E5XA 1W5TA 4ZYEA 3N97A 2A6HF 3RKXA 3TDUC 5FD5A 2CW0F 1WQ2A 2IA2A 3MCZA 2DK5A 4P5OA 2O8XA 3U9GA 2WWYA 4WXCA 3ABTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEO A;  3RPQ A;  1BI3 A;  2GIV A;  3JSP A;  1LB2 A;  5ERI A;  3ZMZ A;  3EUH A;  1G3W A;  3GZ5 A;  3I59 B;  1ON1 A;  3M8E A;  3HOT A;  3K1P A;  2FE3 A;  4RAY A;  2QBY A;  3QPH A;  2DU9 A;  4CDG A;  2ZME B;  1HW5 A;  4HW0 A;  2CQK A;  3F8C A;  1BBY A;  3QRF F;  4UNO A;  3FMR A;  4EJT A;  1YG2 A;  4L9T A;  3CTA A;  2PN6 A;  5HDG A;  4GGG A;  2ZNZ A;  4Y15 A;  2A69 F;  3Q9V A;  4I0A A;  3E5Q A;  1KYZ A;  5D8L B;  1QO0 D;  4RB0 A;  3RKY A;  3FHZ A;  1MDM A;  1H9G A;  1ZRD A;  2DLL A;  1XSV A;  1QBJ A;  3H3U A;  2COM A;  1K6O A;  3DKW A;  2IW5 A;  5LRS A;  4MQ9 F;  2V1U A;  4RB3 C;  4CYD A;  1FBQ A;  3F22 A;  1UFM A;  3LWF A;  4LG0 A;  5IT3 A;  1W5S A;  1FBU A;  3JTG A;  1IUY A;  4KIB A;  1NHA A;  4G7Z F;  4DNC A;  1T0F A;  1U5T C;  2JT1 A;  3FMQ A;  4LK1 F;  1WSU A;  3WE3 A;  1OKR A;  2Z5U A;  3RIR A;  2XKO A;  3EDP A;  3K69 A;  4P55 A;  2IA0 A;  2F5C A;  2GA1 A;  3CDH A;  3I59 A;  1Z9C A;  1ZH5 A;  4RB2 C;  2QM3 A;  1MD0 A;  3BPX A;  2OQG A;  5K1Y A;  3V8K A;  1WKM A;  4CGZ A;  4KNY A;  1Z1D A;  2HS5 A;  4JBA A;  4ZZD A;  1D5V A;  5AIP A;  2A3S A;  1O3S A;  4IRG A;  2MLK A;  3BJA A;  2EFQ A;  1HST A;  3MWM A;  2UXN A;  2FQ3 A;  2K86 A;  1USS A;  2VT3 A;  4D0P A;  3ZMU A;  2CSO A;  3DEU A;  1FBS A;  1KQ0 A;  3RJP A;  5K5O A;  4HOB A;  3EYY A;  1R58 A;  3LFK A;  1DUX C;  4LJZ F;  3E5U A;  4M73 A;  2M30 A;  2PG4 A;  5FLX K;  2OBP A;  2PMH A;  4GO1 A;  2H6B A;  1HKS A;  1EH6 A;  1IN7 A;  3HSE A;  1CF7 A;  2EV5 A;  1R00 A;  4BXU A;  2O6G E;  1IN6 A;  2YR2 A;  1FSE A;  4N9H A;  4IF4 A;  4RS8 A;  4FX0 A;  4R79 A;  1LVA A;  3DFG A;  3FXR A;  3BP8 A;  2DTR A;  1QZY A;  4EV0 A;  4IPA A;  2XAF A;  1O7F A;  5CVR A;  1C0W A;  5H6R A;  3E6C C;  3WTX C;  4HV6 A;  1R36 A;  4HX4 A;  4G7H F;  2A07 F;  4GYI A;  4RGS A;  4LFU A;  2ELH A;  1FLI A;  1BOA A;  4XLN F;  2RVC A;  3HSF A;  3VEP A;  3GZ6 A;  4CO8 A;  3ABU A;  4I09 A;  1HKT A;  4LMY A;  4YFK F;  2YPR A;  4MTE A;  2W25 A;  1XMK A;  3WU0 A;  1BN5 A;  2MD5 A;  3TO6 A;  3FWE A;  3R0A A;  1TQI A;  2RC4 A;  3EET A;  4WCG A;  1RNL A;  1FWZ A;  1ZGJ A;  2FSW A;  2K02 A;  2E1C A;  1UHM A;  2H09 A;  1DP7 P;  1P92 A;  3P9I A;  1Y0U A;  2IPQ X;  2H27 A;  1S6L A;  2L4A A;  1YO5 C;  4LB5 A;  1T38 A;  2JZY A;  1J0R A;  1ZLK A;  4OOI A;  4EM0 B;  5A2Q K;  1YTY A;  4BQA A;  2R3S A;  4G6Q A;  2EK5 A;  1SMT A;  5DUI A;  2PFB A;  4U7D A;  4QWQ A;  2K4B A;  4UHT A;  3F72 A;  4HAM A;  2CWE A;  4WX9 A;  1XGN A;  4MEX F;  3KEQ A;  1B6A A;  2FU4 A;  2JPC A;  2QUF A;  5K5R A;  5J6X A;  4UV9 A;  2LNB A;  5D8K B;  3GYH X;  3REO A;  4U0V A;  2FNP A;  3IWZ A;  2OD5 A;  3GUD A;  4AWX B;  1TNT A;  2Z9O A;  3F8M A;  3DF8 A;  2EB7 A;  1ON2 A;  1FYM A;  3GXO A;  4FHT A;  1RUN A;  2P6S A;  3K1M A;  5JR3 A;  2C6Y A;  2M1B A;  4G9Y A;  2A6E F;  4HYE A;  1LDD A;  2ZBK A;  3CO6 C;  2LSO A;  2DI3 A;  4ZYD A;  4UVA A;  3V7R A;  1G6N A;  1V3F A;  5LHI A;  4HDU A;  1K78 A;  3V7S A;  3FMS A;  3WG9 A;  4K2E A;  3HHG A;  1YW8 A;  2K7L A;  5L3B A;  2D1V A;  2HTJ A;  2ESH A;  5ILV A;  2UZK A;  2V1D A;  3C7J A;  5FLX Z;  4EVI A;  3BZ6 A;  5HDK A;  3KEO A;  1TLH B;  2XVC A;  2EA2 A;  1FOK A;  5FO5 A;  3CLO A;  4M9S A;  3FM3 A;  5FFZ A;  5FGM A;  4UUV A;  2P5K A;  4XSX F;  1J2X A;  1W7P B;  4ESJ A;  5DCM A;  3R4K A;  3TO7 A;  3JW4 A;  3FXU A;  3Q9S A;  1KQ9 A;  1P6R A;  5L3E A;  3FM5 A;  1ZHF A;  5LRR A;  5E1Z B;  1F4K A;  1ODD A;  1R5G A;  5LGU A;  1A04 A;  2L3D A;  5E8G A;  3V4G A;  3JSO A;  2W24 A;  2M5W A;  4PZJ A;  4M71 A;  2Y48 A;  3I53 A;  1P4X A;  2VOP A;  4ZYG A;  4ENK A;  3WTT C;  1ZG1 A;  1BIA A;  2VOO A;  3KP7 A;  1DPR A;  5AIQ A;  1IRF A;  3IRR A;  2FBH A;  4O5V A;  5L3F A;  4B8X A;  3AAF A;  4GYG A;  2QQ9 A;  1GVJ A;  4XBF A;  1IXS B;  2JSC A;  4PDK A;  3O2P E;  2RN7 A;  2DFI A;  2XKP A;  4CIC A;  4HX8 A;  1F9N A;  4WF2 A;  5DUK A;  3I0T A;  3DP7 A;  2GQQ A;  4I98 B;  5F1R A;  4G94 A;  1SFX A;  2EV0 A;  1XGS A;  4S04 A;  4EQQ A;  2FEZ A;  4L9V A;  4O3M A;  3RYP A;  1IAW A;  1Z91 A;  1I1S A;  2OU2 A;  2ZKZ A;  1RI7 A;  6PAX A;  2JTV A;  1YLF A;  2VOD A;  2QBY B;  1GXQ A;  3M9A A;  3TKY A;  3KET A;  1J59 A;  2VON A;  4EJU A;  2CO5 A;  3E6D A;  2XAQ A;  2RNJ A;  3TQN A;  2YU3 A;  1PP7 U;  4I0B A;  3CUO A;  4HF2 A;  5ILS A;  3L2C A;  4BAY A;  2VE8 A;  4L5J A;  1F5T A;  3F6V A;  3EQL F;  2EWN A;  4EM1 A;  4KYW A;  2J5P A;  3C1D A;  2FOK A;  4LB6 B;  2JRT A;  1WWX A;  2ISZ A;  3RI4 A;  4A12 A;  1KU7 A;  2DBB A;  2ZJ2 A;  1U5T A;  1IF1 A;  3KP2 A;  5BS6 A;  5LEK A;  2V1X A;  3S2W A;  4HLY A;  3K1N A;  3O6B B;  3L7W A;  1IN8 A;  1KQ8 A;  4I02 A;  2IP2 A;  5HS9 A;  2HOE A;  4RGX A;  4CXF A;  3SZP A;  3RDI A;  5JI6 A;  4ESF A;  2DK8 A;  1JXS A;  1D8J A;  5D6E A;  1UCR A;  3MZY A;  1G4D A;  4LGW A;  3ECO A;  5F64 A;  3C18 A;  1U78 A;  4CHU A;  1O7L A;  1O57 A;  2XRO A;  3I4P A;  1CGP A;  1G3S A;  4HZF A;  2YX4 A;  2H6C A;  2F5E A;  1XN7 A;  1ONV A;  4LK0 F;  3V8L A;  3GW2 A;  5F6F A;  3I71 A;  1JHF A;  4F7Z A;  3K9T A;  3KE2 A;  4RGR A;  5E8I A;  1UST A;  1U2W A;  1SD6 A;  4HBL A;  2FBI A;  3PQJ A;  4Y17 A;  1ZGA A;  4ZYH A;  1DDN A;  4EGY A;  2RV8 A;  4P9F A;  1FZP B;  4M6Y A;  2FF4 A;  1HKQ A;  2L02 A;  5EEG A;  5HDN A;  1REP C;  2P7V B;  5DCF A;  1FNN A;  2JPB A;  1P4W A;  1JHH A;  4E70 A;  5J8F A;  3GX4 X;  3QP6 A;  5CVV A;  2BBY A;  1OYY A;  5DD8 A;  1TNS A;  3RPU A;  4KUM A;  1OPC A;  2PEX A;  5ICE A;  2E7W A;  2VBZ A;  1HQC A;  4M6X A;  2OQR A;  2VC1 A;  3CJN A;  5ICG A;  5HOO A;  1KU3 A;  2L01 A;  5IT9 K;  2CGP A;  4JK1 X;  1H9T A;  1OYW A;  2HZT A;  3WGG A;  3U2R A;  3IL2 A;  5D5W B;  1AWC A;  4KIG A;  1MJA A;  2XV4 S;  3W6J B;  3VFZ A;  1HSJ A;  3JAM Z;  2P7C B;  3ML6 A;  1Z7U A;  4NQW A;  4R1H A;  1LJ9 A;  5LEJ A;  2PLY A;  3FXQ A;  2XAJ A;  5E1X A;  1K78 B;  1X3U A;  4B09 A;  4A5N A;  1KU2 A;  1H0M A;  3CO7 C;  2W84 A;  2KIM A;  2PI0 A;  1LDJ A;  3GFM A;  2MH2 A;  2HFH A;  3JTH A;  1J7K A;  3QU3 A;  2G7U A;  4U0Y A;  4MGR A;  4N0B A;  1MKM A;  2NYX A;  3B73 A;  1KU9 A;  4A0X A;  3BWG A;  4UVB A;  2HKX A;  2J5O A;  4A6E A;  1MZB A;  3T1B A;  1FYK A;  1EV7 A;  3LQR A;  1LQ1 A;  4U0W A;  4HQE A;  2YSR A;  1WRJ A;  3ZN0 A;  3JAM K;  4BHC A;  5ICF A;  4KFC A;  3C3W A;  4WXH A;  4UXN A;  2W57 A;  3SFZ A;  2QVO A;  2EFO A;  1IN4 A;  5HLG A;  1S29 A;  2QQA A;  2QWW A;  5D4S A;  2RDP A;  5FD6 A;  4LLN A;  3PFI A;  4IHS A;  4BYY A;  4EGZ A;  4N9I A;  1YS7 A;  5D5U B;  4U7B A;  3KP4 A;  5FB2 A;  3P7N A;  1I1G A;  4ON0 A;  4EMS A;  4KIF A;  1LEA A;  1LDK B;  4O6J A;  2KIF A;  4KA4 A;  3O3K A;  2Q2E A;  3LAP A;  3F21 A;  2NNY A;  2M45 A;  3RYR A;  4LLL A;  1IZ1 A;  1LNW A;  3WTZ A;  1JE8 A;  3N4M A;  1R7J A;  1QGP A;  3HRS A;  1ZAO A;  4Y13 A;  4MHG A;  1Z05 A;  3EYI A;  2FXA A;  2ZO4 A;  5DEQ A;  1BI0 A;  2GXG A;  4A6D A;  1GXP A;  1ULY A;  3ECH A;  1R22 A;  2IVM A;  3T8T A;  1V4R A;  3GEZ A;  1L3L A;  1PP8 F;  3ERE D;  1PUE E;  3I58 A;  3T5X A;  3E3V A;  5LHH A;  4WWC A;  3K2Z A;  3WTV C;  4MNU A;  2HQR A;  5LHG A;  1YQA A;  2ESN A;  3F8N A;  3ZP5 A;  1J9I A;  3OV8 A;  4A5M A;  5EEH A;  3WE2 A;  4HF1 A;  2XRN A;  2AS5 F;  2DPD A;  5D5X B;  1F1Z A;  3L00 A;  3G3Z A;  2W85 A;  2L54 A;  3NEU A;  5D4R A;  3QU6 A;  2X0L A;  4HF0 A;  3H92 A;  4KIC A;  1O3T A;  4LD5 A;  3M1E A;  3OOP A;  5AON A;  3F23 A;  1G3Y A;  1ZG5 A;  4H0E A;  4YFN F;  4PGH A;  4EJV A;  1BI1 A;  2M87 A;  2GWR A;  2KJC A;  2VT2 A;  3GF2 A;  3B02 A;  1B9M A;  3DPT A;  4YFX F;  2FRH A;  3H3Z A;  1YW7 A;  5LGT A;  5ED4 A;  2VBY A;  5DDG A;  1D3Y A;  5ILU A;  2P6T A;  2NRA C;  2G7H A;  4G6D A;  3I54 A;  3KP5 A;  3HTS B;  4M72 A;  3CUQ A;  3DV8 A;  2HYG D;  2HTS A;  3P9K A;  3HOS A;  1P2F A;  5HS7 A;  1DPU A;  3GWZ A;  2P4W A;  3WGI A;  4DQ2 A;  4ENM A;  2MA3 A;  4L5I A;  2QYO A;  1T39 A;  5BMZ A;  1BC7 C;  3IKT A;  4XLP F;  3LAJ A;  5E1W A;  2IRF G;  2RKH A;  3I5U A;  4ASN A;  3L9F A;  1SFU A;  1IN5 A;  5A2Q Z;  2AXL A;  3DXJ F;  1GHC A;  3E97 A;  2L4M A;  4M9Z A;  3BJO A;  4KDP A;  4HX7 A;  1T98 A;  1KYW A;  3F6O A;  5JHU A;  1SD4 A;  2Q0O A;  5CVU A;  1XSD A;  4I01 A;  3LA2 A;  3GFI A;  4ZZL A;  4EJO A;  5K5Q A;  2QZ8 A;  3GVA A;  4OIP F;  5BPD A;  2KJB A;  2R7F A;  5DYM A;  4AIH A;  2Z33 A;  5HLH A;  3IKV A;  4M74 A;  3BDD A;  4UVC A;  2TDX A;  1HXD A;  3HSR A;  3E6B A;  1CF7 B;  2D45 A;  2GXB A;  1IRG A;  3WTW C;  1FYL A;  3R0J A;  4YIF A;  2DPU A;  2O61 A;  5LBQ A;  3HRM A;  4I2O A;  5D5V B;  1P4A A;  4Q5S F;  3TDZ C;  1R1U A;  3M8F A;  3RKW A;  3DQV C;  2ACJ A;  3F8F A;  2MLG A;  4AD9 A;  1QQI A;  2ZFW A;  2Z3Y A;  2YX7 A;  1Z6R A;  1ZLJ A;  5CJ9 A;  4GXO A;  4LG0 B;  4NHJ A;  1JGS A;  3KCC A;  3ROU A;  3RTR A;  1EH7 A;  3GLX A;  2HKO A;  2HGC A;  3ZN1 A;  2V9V A;  4Q4Z F;  3Q5F A;  2NAZ A;  1SFE A;  2P5L C;  3R61 A;  4L9J A;  4KT5 C;  2XHK A;  1S8N A;  4BNC A;  4I7H A;  1HW1 A;  4ENN A;  3I64 A;  5ICC A;  2RQP A;  3HYI A;  4UV8 A;  4P9U A;  1Q1H A;  1QNT A;  4MQV A;  4IRI A;  2G9W A;  3HRT A;  2STT A;  2HWV A;  3WGH A;  5HVQ C;  1HBX G;  2CFX A;  1VTN C;  1TQM A;  2XAG A;  5LLQ A;  1OR7 A;  3ZMD A;  2OZU A;  3BJ6 A;  4Q47 A;  4PGG A;  3QPT A;  3E6M A;  3T8R A;  1XCB A;  4WK8 F;  4EM2 A;  1OMI A;  5DCM B;  2LKP A;  4BHB A;  2XAS A;  3VB2 A;  2VXZ A;  5L3D A;  1RIO H;  4A0Z A;  3SQN A;  2VN2 A;  1SD5 A;  2FML A;  2PBI A;  1K79 A;  2O3F A;  1BI2 A;  2HQN A;  1K7A A;  3GFJ A;  4OIR F;  3QOP A;  4TV7 A;  1MJ9 A;  4AIK A;  1YIO A;  1Z6T A;  2Y75 A;  4L0Z B;  4P96 A;  2EFW A;  1TW3 A;  1U5T B;  2O03 A;  5CVJ A;  2R7D A;  4OMY A;  5J8C A;  2EA4 A;  3ZPL A;  1XB4 A;  4HA8 A;  4HQM A;  2ZNY A;  3NQO A;  2PJP A;  2DQR A;  2ZXJ A;  4A0Y A;  1QZZ A;  2GZW A;  2CG4 A;  4AIJ A;  4GCV A;  2H94 A;  1FPQ A;  3SZT A;  1ZN2 A;  3ULQ B;  1WI9 A;  1PDN C;  3ZMT A;  3IRQ A;  2NNN A;  1BJA A;  2P8T A;  1R1V A;  4MTD A;  5H20 A;  1SD7 A;  1I27 A;  1O3Q A;  2RGV A;  1IW7 F;  4ETS A;  2CYY A;  2ADU A;  2Y0M A;  4A2U A;  4YG2 F;  4OIQ F;  3KP3 A;  2F5D A;  2VBW A;  2B0L A;  4CZZ A;  1B4A A;  1W7P D;  1FP1 D;  2EV6 A;  3LST A;  4IXA A;  2NS0 A;  2E1N A;  3LA3 A;  3KZZ A;  5BOX A;  2LF7 A;  4L18 B;  1UHW A;  1FP2 A;  1TTY A;  1R1T A;  3IC7 A;  4ZH4 F;  3HTU A;  3TGN A;  3ZQ7 A;  1ZRC A;  3HRU A;  1SAX A;  2GA2 A;  4QLC U;  3WOD F;  2MBF A;  2WC2 A;  5E20 A;  2MH9 A;  2K27 A;  3WU1 B;  1BC8 C;  2K4J A;  2KIU A;  2LDU A;  3HHH A;  4IVN A;  4ENJ A;  1HW2 A;  3LQQ A;  3ISP A;  2HYF A;  1YS6 A;  1I5Z A;  1IXC A;  3TO9 A;  3WTY C;  3V8J A;  1G3T A;  2KRF A;  2IJL A;  2OZ6 A;  4ESB A;  5E17 F;  1XSX A;  5KVR A;  5LGN A;  2D1H A;  3IHU A;  4KN7 X;  1E17 A;  4Q48 A;  3HIF A;  2LF8 A;  2GAU A;  4PCQ A;  3CUQ C;  3KLN A;  5FFX A;  4OIO F;  5CLS A;  1MGT A;  2A61 A;  3M7G A;  1LEB A;  5BPI A;  5HS8 A;  2D2W A;  1BIB A;  3HUG A;  4BH9 A;  2BV6 A;  3V7C A;  4KMF A;  1MJB A;  2EFP A;  1TQP A;  2P5V A;  1ZRE A;  1TBX A;  2A68 F;  1W7P A;  3SXY A;  4OU0 A;  4RAZ A;  4HLX A;  3ZMV A;  5L3G A;  1XGM A;  3IWF A;  4L9N A;  4BHP A;  1FSH A;  2IA1 A;  1R23 A;  4MEY F;  4R8H A;  1STZ A;  1B1B A;  3T0Y A;  1D8K A;  1FX7 A;  1B9N A;  3DPL C;  1RZ4 A;  1S7A A;  4IJA A;  4OMZ A;  2HDC A;  4RGU A;  1J5Y A;  3CUQ B;  1AOY A;  2Z99 A;  1ZG3 A;  1O3R A;  1YW9 A;  5CVI A;  4HV5 A;  1UB9 A;  2VBX A;  2QEN A;  3QAH A;  2E7X A;  3W6K B;  1T6S A;  3GFL A;  1EH8 A;  2BEO A;  1R5H A;  4M9X A;  3NRV A;  3G73 A;  3COA C;  4LLG F;  4FX4 A;  1B59 A;  1SMY F;  3WTU C;  3MFK A;  5H6Q A;  4G8X A;  3R6S A;  4G7O F;  1BM9 A;  2F5F A;  3MEX A;  3ELK A;  2MC3 A;  4HDV A;  2STW A;  1YYV A;  2V79 A;  5KK1 A;  1OYI A;  4S05 A;  3FF5 A;  5IT9 Z;  3D0S A;  3P9C A;  2X4H A;  4XSZ F;  2DW4 A;  3R60 A;  3U1D A;  4OIN F;  2XIG A;  2VE9 A;  1FT9 A;  3VOE A;  4KMU X;  1ZYR F;  1KGS A;  3TOB A;  2FMY A;  5E18 F;  3J81 K;  3J7A O;  1S3J A;  1QPM A;  5L3C A;  2ETH A;  2EFN A;  1ZAR A;  2WV0 A;  1YFH A;  2QLZ A;  5JVT A;  1XD7 A;  4EJW A;  2UXX A;  2BYV E;  2DAO A;  5D6F A;  2F2E A;  3MQ0 A;  1U8R A;  5DD4 A;  2QQB A;  2OA4 A;  4YII A;  3QP5 A;  3FZV A;  2DQL A;  1IXR C;  3GO5 A;  2EJR A;  4KN4 X;  2BE5 F;  2ZCW A;  3SHF A;  3L09 A;  2XAH A;  1I6X A;  4NB5 A;  5TJJ A;  2HR3 A;  4Z2Y A;  4IHT A;  2DT5 A;  4JQF A;  1KA8 A;  2FNA A;  5HLI A;  3K0L A;  3PQK A;  2ZME A;  3TOA A;  2WTE A;  3KLO A;  2UWM A;  3KFW X;  5DV5 A;  4IRH A;  2PQ8 A;  3J80 Z;  1MDM B;  3J80 K;  4L0Y B;  1TW2 A;  3BPV A;  4AVP A;  1E2X A;  2XUB A;  1XMA A;  3BOQ A;  2A5Y B;  1XDU A;  2VC0 A;  1U3E M;  4U88 A;  1L0O C;  5TRD A;  2OAZ A;  3D5L A;  1XGO A;  3BRO A;  2XGX A;  2M8E A;  2FBK A;  4FT8 A;  5JFR A;  3MAJ A;  1T2K A;  5CYV A;  2Q8K A;  2V6C A;  2PMU A;  2ISY A;  3LA7 A;  3KP6 A;  1RUO A;  3ZMS A;  3F8B A;  4WXD A;  3KZY A;  4XRF A;  1S7O A;  5BQT A;  3VOD A;  3F3X A;  1XCV A;  1U6G A;  2FA5 A;  1XDS A;  1ZRF A;  2IT0 A;  2DO7 A;  4RB1 A;  3MZH A;  3BY6 A;  2O0Y A;  3FX3 A;  1J75 A;  1W4M A;  2KKO A;  3WTS C;  1FC3 A;  1FY7 A;  3J81 Z;  2BGC A;  3E5X A;  1W5T A;  4ZYE A;  3N97 A;  2A6H F;  3RKX A;  3TDU C;  5FD5 A;  2CW0 F;  1WQ2 A;  2IA2 A;  3MCZ A;  2DK5 A;  4P5O A;  2O8X A;  3U9G A;  2WWY A;  4WXC A;  3ABT A; 
#chains in the Genus database with same CATH topology
 3IUO A;  2HEO A;  3FIS A;  1MBH A;  3RPQ A;  1BI3 A;  2GIV A;  4DBQ A;  3JSP A;  1ETV A;  1LB2 A;  2JA2 A;  5ERI A;  4IHW A;  3ZMZ A;  3EUH A;  1G3W A;  2VQL A;  3GZ5 A;  3I59 B;  3DEW A;  3GLL A;  3KYL A;  1ON1 A;  3M8E A;  3HOT A;  3K1P A;  3L2U A;  2FE3 A;  4RAY A;  4ZDL A;  2QBY A;  1RES A;  3QPH A;  4HEA 2;  2HOS A;  4M6V A;  2DU9 A;  1PJR A;  1FOY A;  3NAU A;  3VSK A;  4B48 A;  4CDG A;  3GTO J;  2ZME B;  1NK2 P;  1HW5 A;  2NVY J;  4HW0 A;  2CQK A;  3F8C A;  1BBY A;  1EKE A;  3QRF F;  4BE1 A;  4UNO A;  4C3H J;  3FMR A;  3E0J B;  3VYS B;  3FXJ A;  3GME A;  3H35 A;  5K7Z A;  1R4M B;  1I6H J;  4EJT A;  1YG2 A;  4L9T A;  3CTA A;  1GV5 A;  1WJC A;  3KZI C;  1UG2 A;  2PN6 A;  5HDG A;  4GGG A;  2ZNZ A;  4UUT A;  4Y15 A;  2A69 F;  3Q9V A;  4J01 A;  4I0A A;  4XNF A;  3CCY A;  4AM3 A;  3E5Q A;  3HXL A;  5F1J A;  3SDB A;  1KYZ A;  5EZH A;  2R7Q A;  5D8L B;  1QO0 D;  3JCU C;  4RB0 A;  4RMN A;  3RKY A;  3OYK A;  3FHZ A;  1MDM A;  1H9G A;  1YIT I;  1ZRD A;  3OL3 A;  2DLL A;  2CMP A;  1XSV A;  1AHD P;  1QBJ A;  3H3U A;  4KJZ A;  3FKJ A;  5HLT A;  2COM A;  1K6O A;  3DKW A;  2IW5 A;  5LRS A;  3JRA A;  3M07 A;  4MQ9 F;  2V1U A;  3TBI A;  5GAH J;  4RB3 C;  2R7T A;  4CYD A;  1FBQ A;  3HKZ A;  3F22 A;  1UFM A;  3ZOB A;  3LWF A;  3CZ6 A;  4LG0 A;  5IT3 A;  4A3D J;  1W5S A;  1QHH D;  2P81 A;  1FBU A;  3JTG A;  1IUY A;  1HF0 A;  1IC8 A;  4KIB A;  2CV0 A;  2CRG A;  1NHA A;  2VJ5 A;  4G7Z F;  4DNC A;  1T0F A;  3H9G A;  1BW5 A;  1U5T C;  2XGE A;  2JT1 A;  1R71 A;  3FMQ A;  3HUG B;  4LK1 F;  2RNG A;  1WSU A;  3WE3 A;  3OYJ A;  1OKR A;  1B8I B;  4G12 A;  4RAG A;  2Z5U A;  3RIR A;  2XKO A;  3EDP A;  4QTR A;  3K69 A;  1X4O A;  2LY9 A;  2H8R A;  3G1O A;  4P55 A;  2IA0 A;  2F5C A;  2GA1 A;  1JT6 A;  4YEL A;  2B9S A;  3W6V A;  3CDH A;  3FBI B;  3I59 A;  1Z9C A;  3H0D A;  1ZH5 A;  4RB2 C;  2N8G A;  2QM3 A;  3CCM I;  4CA0 A;  1MD0 A;  1MMA A;  4ZC3 A;  2Y30 A;  3BPX A;  3ERM A;  2OQG A;  2R7W A;  5K1Y A;  3U1K A;  1N25 A;  3V8K A;  1WKM A;  4CGZ A;  4KNY A;  2XDV A;  1Z1D A;  2HS5 A;  4JBA A;  4ZZD A;  3JRB A;  1WGX A;  1D5V A;  3GTP J;  2JQ7 A;  3CCV I;  2L9R A;  3H5R A;  2JVG A;  5AIP A;  3CCU I;  2GLO A;  2A3S A;  1ZTR A;  1O3S A;  4IRG A;  4LIU A;  2MLK A;  4BE0 A;  3BJA A;  1A36 A;  3GZN B;  2E60 A;  3U21 A;  2YU9 J;  2EFQ A;  3QOD A;  1HST A;  1OR7 C;  1MND A;  3MWM A;  2UXN A;  2FQ3 A;  2QEX I;  2K86 A;  1USS A;  3FIW A;  3MD2 A;  2VT3 A;  4D0P A;  3ZMU A;  2CSO A;  3DEU A;  4FE4 A;  3K10 A;  2B7E A;  1FBS A;  3ZXS A;  3RQ4 A;  5J1Y A;  1AA7 A;  1KQ0 A;  3RJP A;  5K5O A;  4HOB A;  3B6C A;  2ZXH A;  3DBR B;  1ZKG A;  1R58 A;  3EYY A;  3OYH A;  1E3P A;  3LFK A;  1DUX C;  4LJZ F;  3E5U A;  4M73 A;  4HNU A;  4XLA A;  4IHX A;  2M30 A;  5HNH A;  1Z3X A;  2PG4 A;  5FLX K;  2EQR A;  3LSH A;  2DMP A;  2OBP A;  2PMH A;  2X6O A;  4GO1 A;  2H6B A;  2L2O A;  1HKS A;  3QYE A;  4JYK A;  2DA7 A;  1EH6 A;  1IN7 A;  3HSE A;  1CF7 A;  3I4M J;  2EV5 A;  1R00 A;  2IGK A;  4BXU A;  1GV2 A;  3QYF A;  2O6G E;  1IN6 A;  1MBF A;  4OAZ A;  2WB1 N;  2YR2 A;  1FSE A;  4N9H A;  5LFA A;  4IF4 A;  4RS8 A;  4FX0 A;  4R79 A;  1IO2 A;  5IOY A;  1GT0 C;  1LVA A;  3DFG A;  2IS2 A;  1MMG A;  3MMY B;  3FXR A;  3K70 D;  3BP8 A;  2DTR A;  1QZY A;  1OCR H;  3MN2 A;  4EV0 A;  2R0Q C;  4IPA A;  2DN0 A;  1Z7L A;  1D1C A;  2XAF A;  1O7F A;  5CVR A;  1C0W A;  5H6R A;  2EZK A;  3DBL B;  5JLX A;  1HA8 A;  3E6C C;  3WTX C;  4HV6 A;  1R36 A;  4HX4 A;  2VKV A;  2IS6 A;  3A1Y A;  4G7H F;  2A07 F;  5C4J J;  4GYI A;  4Z6Y A;  2IXS A;  4RGS A;  2LD5 A;  5IYC J;  2Q2E B;  4LFU A;  2ELH A;  5JLW A;  1FLI A;  1BOA A;  4XLN F;  1K4T A;  2VQC A;  2RVC A;  3HSF A;  3VEP A;  3GZ6 A;  4CO8 A;  3DBH B;  1E3H A;  3ABU A;  4I09 A;  3ESW B;  1HKT A;  4LMY A;  4YFK F;  2YPR A;  3M3Y J;  2LTP A;  4MTE A;  2QSF X;  1SAU A;  1DQU A;  2W25 A;  3ZR8 X;  3TP3 A;  4FIS A;  1MSF C;  3AG2 H;  1XMK A;  4NNJ A;  1S5L C;  3WU0 A;  1BN5 A;  1R9T J;  4FQG A;  2MD5 A;  3TO6 A;  3K4L A;  2JA6 J;  3FWE A;  3R0A A;  1ETY A;  3EET A;  1TQI A;  2RC4 A;  2W00 A;  3Q0W A;  2AQE A;  4HG2 A;  5KNL A;  1MBG A;  2V4J C;  3PNV A;  4WCG A;  3I9V 2;  1RNL A;  1FWZ A;  4IL6 C;  1ZGJ A;  2FSW A;  1Z67 A;  2O5R A;  2K02 A;  2E1C A;  4XKW A;  4BBS J;  1UHM A;  5CQG A;  1GLN A;  1X1A A;  2H09 A;  2BXZ A;  1DP7 P;  1IDY A;  1ETO A;  1P92 A;  3P9I A;  1Y0U A;  4J19 A;  2IPQ X;  2FJ1 A;  1BJZ A;  1ETQ A;  2H27 A;  1S6L A;  3HL2 A;  4ANJ A;  1P7I A;  4I76 A;  2L4A A;  1YO5 C;  4LB5 A;  3LMM A;  1T38 A;  4RM2 A;  3H1C A;  2HU9 A;  1VQO I;  5FLM J;  3C2G A;  2PMZ N;  2JZY A;  1J0R A;  1ZLK A;  1I39 A;  4OOI A;  4EM0 B;  5A2Q K;  1RC9 A;  3BTI A;  1YTY A;  4BQA A;  2R3S A;  4G6Q A;  2EK5 A;  1SMT A;  1YRN A;  5DUI A;  2LOO A;  3OL4 A;  1HCR A;  3HG9 A;  2BXY A;  2PFB A;  4LIT A;  4U7D A;  4QWQ A;  5FRN A;  4LG3 A;  2K4B A;  4UHT A;  3CJT B;  3F72 A;  1WJF A;  4XQF A;  4XON A;  3CP2 A;  4HAM A;  3S3O A;  2CWE A;  4WX9 A;  1XGN A;  1XMX A;  3BR2 A;  1M1E B;  4XLH A;  1TWH J;  1VQK I;  2Y31 A;  4MEX F;  3KEQ A;  1B6A A;  3S32 A;  4CCO A;  5JVG F;  2FU4 A;  2JPC A;  2QUF A;  5K5R A;  5J6X A;  4UV9 A;  2LNB A;  5FKL A;  1JKO C;  5D8K B;  4NC6 A;  3GYH X;  2DA3 A;  4XIC A;  3REO A;  4QIW N;  4U0V A;  1A6Q A;  4FCY A;  2FNP A;  3IWZ A;  2MW8 A;  1EF4 A;  2X48 A;  5HNF A;  2OD5 A;  3GUD A;  2CQ7 A;  4AWX B;  2OV7 A;  5GPA A;  2HYJ A;  4A3J J;  1TNT A;  2Z9O A;  3F8M A;  3DF8 A;  2EB7 A;  4ZYA A;  3QPL A;  3WU2 C;  1ON2 A;  1FYM A;  3GXO A;  2HDD A;  2ZB9 A;  4FHT A;  1RUN A;  2P6S A;  3K1M A;  3VPR A;  3RCO A;  5JR3 A;  2C6Y A;  2M1B A;  2BZT A;  4G9Y A;  2A6E F;  2VKD A;  4HYE A;  3HGY A;  1LKX A;  1LDD A;  2ZBK A;  4CCL A;  3CO6 C;  2DDA A;  2LSO A;  3A2K A;  1OCO H;  4M3B A;  1XTA A;  2DI3 A;  4ZYD A;  4UVA A;  3V7R A;  1G6N A;  1JUS A;  1V3F A;  3SFI A;  5LHI A;  4HDU A;  2BY3 A;  1Z21 A;  5E3L A;  3GTL J;  1X2M A;  3HOW J;  1K78 A;  3V7S A;  1WPK A;  2A6T A;  3FMS A;  3WG9 A;  4K2E A;  3HHG A;  1YW8 A;  2EPF A;  3PO3 J;  2K7L A;  5L3B A;  2EIM H;  3ABK H;  3S93 A;  2D1V A;  2F4M B;  2HTJ A;  3LSP A;  2XSD C;  1F43 A;  2ESH A;  5ILV A;  2ZFU A;  3H9J A;  2UZK A;  2V1D A;  4E6K G;  2VAS A;  3C7J A;  3EUK L;  1NTC A;  5FLX Z;  5E3M A;  4EVI A;  3BZ6 A;  5HDK A;  2X1E A;  2ZSH B;  3KEO A;  1TLH B;  2XVC A;  2LRE A;  1SVO A;  2EA2 A;  3UKG A;  1FOK A;  2X6X A;  5FO5 A;  3CLO A;  3Q0V A;  4BXF A;  4M9S A;  3FM3 A;  4FTH A;  5FFZ A;  1DU6 A;  5FGM A;  4UUV A;  2CQN A;  2LFB A;  2P5K A;  4MFD A;  4XOT A;  3IAM 2;  4XSX F;  2W1O A;  1J2X A;  2Y0S N;  1W7P B;  4XKB A;  2R7O A;  4ESJ A;  5DCM A;  3R4K A;  2Z1D A;  3K6G A;  4IEJ A;  4D7M A;  1A6I A;  3TO7 A;  3JW4 A;  3FXU A;  3Q9S A;  3BG5 A;  1KQ9 A;  5KHD A;  1P6R A;  5L3E A;  3FM5 A;  2LG4 A;  1ZHF A;  5LRR A;  4DOZ A;  3AKZ A;  3HDD A;  3TP0 A;  5E1Z B;  1WZ2 A;  1F4K A;  2X6Y A;  1ODD A;  1QVU A;  1R5G A;  2GIZ A;  2K85 A;  5LGU A;  4IKF A;  2IS1 A;  4JOM A;  2EZI A;  5EZG A;  1A04 A;  2L3D A;  2M9H A;  5E8G A;  3V4G A;  3JSO A;  2E2J J;  3H5N A;  2BHZ A;  3EUH C;  2W24 A;  2M5W A;  4PZJ A;  3VYT B;  4KIS A;  4QSH A;  3RZD J;  2CS3 A;  4M71 A;  2Y48 A;  2G0E A;  3I53 A;  4AID A;  4AU7 A;  1P4X A;  4MLO A;  2JRM A;  2VOP A;  2QKL B;  4ZYG A;  4PJN A;  3OYC A;  4ENK A;  3OSG A;  3WTT C;  1ZG1 A;  1WJB A;  1BIA A;  2VOO A;  3KP7 A;  3Q3S A;  3OYA A;  1VQ4 I;  1DPR A;  1YJN I;  5AIQ A;  3OR1 C;  4C3I J;  1IRF A;  3IRR A;  2FBH A;  4AC0 A;  2CUZ A;  4O5V A;  5L3F A;  4B8X A;  2R7R A;  3CES A;  3AAF A;  2L9N A;  4UUS B;  2DYS H;  4A3K J;  4GYG A;  2V6E A;  1FIA A;  2OF7 A;  1WFX A;  2QQ9 A;  1GVJ A;  1N75 A;  3BZK A;  1F36 A;  4XBF A;  4E7L A;  1IXS B;  1MW7 A;  2JSC A;  4ABZ A;  2I5U A;  4PDK A;  3O2P E;  2RN7 A;  2DFI A;  2XKP A;  4CIC A;  2ECC A;  3MVP A;  1ENH A;  4HX8 A;  1E3O C;  1F9N A;  4WF2 A;  2K9Q A;  2NVU B;  5DUK A;  1T95 A;  2DMU A;  3VWB A;  3I0T A;  3DP7 A;  2DXI A;  1BR1 A;  1IRX A;  2GQQ A;  1Z0X A;  2DJN A;  2ME6 A;  2LH9 A;  3SZG A;  2WY7 Q;  4I98 B;  5F1R A;  3BT9 A;  4G94 A;  4CCJ A;  1SFX A;  1CQT A;  2R7U A;  5M5X J;  3K4B A;  3I55 I;  2EV0 A;  1LPQ A;  1XGS A;  4B47 A;  4S04 A;  2DT7 B;  3OS0 A;  1YIJ I;  4EQQ A;  2FEZ A;  2MFZ A;  4L9V A;  4O3M A;  4B3X A;  1WH5 A;  3HZJ A;  3RYP A;  2EIL H;  3HC7 A;  1IAW A;  1Z91 A;  3DU6 A;  4BXX J;  1IUF A;  1I1S A;  1X2N A;  2OU2 A;  2ZKZ A;  2LMD A;  1RI7 A;  6PAX A;  4JX6 A;  2JTV A;  1YLF A;  3O8H A;  2LLK A;  1WJ5 A;  2VOD A;  2QBY B;  1GXQ A;  3JR9 A;  3CCQ I;  1VQ8 I;  3M9A A;  3KX2 A;  3TKY A;  3KET A;  4PJL A;  4UB8 C;  1J59 A;  2VON A;  2KPM A;  4XKC A;  3BC8 A;  4EJU A;  2CO5 A;  3E6D A;  2XC7 A;  2XAQ A;  2HPM A;  3PM1 A;  3DLL F;  3ZQC A;  2NS7 A;  3DTK A;  2FX0 A;  2RNJ A;  3TQN A;  1Y6I A;  2YU3 A;  1PP7 U;  4I0B A;  3CUO A;  4HF2 A;  5ILS A;  3UR3 C;  2JA5 J;  3L2C A;  2GOM A;  4BAY A;  2VE8 A;  3BQY A;  2CH0 A;  4L5J A;  3DEE A;  4CZC A;  2HQA A;  1F5T A;  3F6V A;  1JKQ C;  3EQL F;  1SAN A;  2EWN A;  2VB6 A;  5B5E C;  2E35 A;  4EM1 A;  1HC8 A;  2WBM A;  2JA7 J;  4KYW A;  2J5P A;  3C1D A;  3FXL A;  5F04 A;  2FOK A;  5M3F J;  3CC2 I;  4LB6 B;  2JRT A;  4PJJ A;  1WWX A;  3BR3 A;  4NBQ A;  2ISZ A;  3RI4 A;  4A12 A;  1KU7 A;  2DYR H;  2L0K A;  2LBF B;  5F0H A;  2DBB A;  2VPL A;  2ZJ2 A;  2X6W A;  1U5T A;  1IF1 A;  1UZC A;  3KP2 A;  3QYB A;  3ABM H;  4BBR J;  5BS6 A;  5LEK A;  1Y8R B;  2V1X A;  2F4O B;  1YX3 A;  3S2W A;  3W2W A;  4HLY A;  1IDZ A;  3K1N A;  4Y33 A;  2WAF A;  3O6B B;  2KZG A;  3CMY A;  3BG9 A;  3L7W A;  1IN8 A;  1KQ8 A;  4I02 A;  2WA0 A;  4BGD A;  1BL0 A;  2W48 A;  2IP2 A;  1WI3 A;  2KQR A;  2V9P A;  5HS9 A;  2DOE A;  3H0G J;  3LSG A;  1MMN A;  2WB1 A;  2HOE A;  1B8I A;  2B63 J;  4RGX A;  5IPA A;  2MC4 A;  4CXF A;  2DOF A;  3SZP A;  3RDI A;  1DGW Y;  5JI6 A;  2HPI A;  4ESF A;  4YIR X;  1VQ7 I;  2DK8 A;  1JXS A;  1ZQ3 P;  1I3Q J;  2EZL A;  4GRI A;  3FBN B;  1D8J A;  5D6E A;  1UCR A;  2EIN H;  3MZY A;  1AKH B;  1B72 B;  1G4D A;  4LGW A;  3ECO A;  2R92 J;  5F64 A;  3C18 A;  4EAT A;  2X51 A;  4A3E J;  2IEK A;  1U78 A;  2GXA A;  5GPC A;  4CHU A;  1O7L A;  1O57 A;  1POG A;  2VJI A;  2ZME C;  2XRO A;  4E7K A;  2QKM B;  3I4P A;  4N4O B;  2HOA A;  5E3N A;  1CGP A;  1G3S A;  4E7S A;  2ZJR F;  4E4H A;  3CC4 I;  1U9N A;  4HZF A;  4CCN A;  2YX4 A;  2H6C A;  1JUM A;  2F5E A;  1XN7 A;  5M5Y J;  1X19 A;  3BG7 A;  3UNG C;  3DWL E;  4XM3 A;  1ONV A;  2DT6 A;  2WAE A;  4LK0 F;  4RAF A;  5IP9 J;  1Z77 A;  5J4Y A;  3V8L A;  3OY9 A;  1H88 C;  3OWT A;  2MAB A;  2FD5 A;  3GW2 A;  5KCM A;  5F6F A;  3I71 A;  1JHF A;  3L2R A;  4F7Z A;  3K9T A;  3KE2 A;  4RGR A;  3HEF A;  3S16 J;  1GUU A;  5E8I A;  1A35 A;  1UST A;  3FXM A;  1U2W A;  1SD6 A;  1SEU A;  4MFE A;  1BW6 A;  4HBL A;  3PSI A;  2FBI A;  2FUG 2;  5B1B H;  1OCT C;  3PQJ A;  4Y17 A;  5IP7 J;  3CCJ I;  4V2F A;  1ZGA A;  2X1C A;  3A0H C;  4ZYH A;  3A01 A;  3SDG A;  2KDZ A;  3DKX A;  1DDN A;  4EGY A;  2RV8 A;  4P9F A;  4HNV A;  1FZP B;  4M6Y A;  4E7H A;  4F92 B;  4A3B J;  2FF4 A;  1WH7 A;  1HKQ A;  3CQZ J;  1IJW C;  2L02 A;  1JI8 A;  5EEG A;  5HDN A;  4BUP A;  3FXO A;  1REP C;  3S17 J;  2P7V B;  4PFP A;  5DCF A;  2BHY A;  1FNN A;  3S3M A;  2OTL I;  2BVM A;  2E36 A;  2LC2 A;  2JPB A;  1P4W A;  3ASN H;  1JHH A;  1U0J A;  2M4K A;  5F08 A;  2W82 A;  3G1L A;  3HM5 A;  2DMQ A;  1KON A;  4E70 A;  5J8F A;  2RRE A;  3GX4 X;  3OYL A;  5GAG J;  3ZQL A;  3BTJ A;  2NS8 A;  3K7A J;  3QP6 A;  1DP3 A;  5CVV A;  2BBY A;  4U87 A;  3JRI A;  2DOD A;  1OYY A;  5DD8 A;  3PJR A;  3L2Q A;  1TNS A;  2NVQ J;  3RPU A;  4KUM A;  1OPC A;  2DCE A;  2EH3 A;  2PEX A;  3LL7 A;  2E7W A;  2VBZ A;  5ICE A;  3JRH A;  4IHV A;  1HQC A;  4M6X A;  4V19 K;  2OQR A;  2VC1 A;  3CJN A;  2Y0S A;  2M7B A;  3D5S C;  1OQY A;  5ICG A;  1HDD C;  2E1O A;  5HOO A;  3IP4 B;  4IOC F;  1KU3 A;  2DA2 A;  2L01 A;  4XKV A;  5IT9 K;  1ERD A;  2NVT J;  3OMY A;  2CGP A;  4JK1 X;  1H9T A;  1OYW A;  2HZT A;  3WGG A;  3BR5 A;  2WV1 A;  3U2R A;  3IL2 A;  5D5W B;  1LFU P;  1AWC A;  4KIG A;  1G59 A;  2XF5 A;  1MJA A;  2XV4 S;  3W6J B;  4B1R A;  2Y9Z A;  3VFZ A;  1HSJ A;  3JAM Z;  2P7C B;  3ML6 A;  2GM4 A;  1Z7U A;  2K5C A;  2LY2 A;  4NQW A;  1LFP A;  4R1H A;  1LJ9 A;  5IY5 H;  5LEJ A;  2PLY A;  3FXQ A;  4JP0 A;  3FK7 A;  2XAJ A;  5E1X A;  1K78 B;  2M4G A;  1X3U A;  4B09 A;  3H9Q A;  3TW6 A;  4A5N A;  1KU2 A;  1H0M A;  3CO7 C;  4CCK A;  2VQG A;  2W84 A;  1YJ9 I;  2R93 J;  2CUJ A;  2KIM A;  2PI0 A;  1LDJ A;  3GFM A;  3D5R C;  2MH2 A;  2HFH A;  2MSY A;  4DYQ A;  1VQL I;  3JTH A;  1J7K A;  3QU3 A;  2G7U A;  1VQM I;  2AO9 A;  4U0Y A;  4MGR A;  4N0B A;  3CCE I;  1MKM A;  4XLE A;  5GAD J;  1VF9 A;  4PK4 A;  1W36 D;  2NYX A;  3B73 A;  1ZEL A;  1GDT A;  3I4N J;  1KU9 A;  4A0X A;  5C44 J;  2CFO A;  3BWG A;  4UVB A;  2HKX A;  2J5O A;  2CJJ A;  2WAQ N;  4A6E A;  1OCZ H;  3OSF A;  1MZB A;  3T1B A;  1FYK A;  1EV7 A;  2VJJ A;  3LQR A;  1LQ1 A;  1UHS A;  2HXO A;  2DFE A;  5FRO A;  2HVQ A;  4C3J J;  3K4K A;  4U0W A;  4HQE A;  4NQW B;  3LSI A;  4DW6 A;  2YSR A;  1WRJ A;  3ZN0 A;  3JAM K;  2DMN A;  3ZRG A;  4BHC A;  5ICF A;  1VQN I;  4KFC A;  3C3W A;  4WXH A;  2NVX J;  4UXN A;  2W57 A;  3SFZ A;  4BL0 B;  5GTH C;  1JJ8 C;  1PYV A;  2QVO A;  2EFO A;  1QA6 A;  1W1W E;  1IN4 A;  5HLG A;  1S29 A;  2QQA A;  2QWW A;  5D4S A;  2RDP A;  5FD6 A;  4LLN A;  4F93 B;  4D5F A;  3OYD A;  3ZGK A;  1APL C;  2O8K A;  3PFI A;  4IHS A;  3G1M A;  4PUS A;  4BYY A;  5M5W J;  2IGN A;  4EGZ A;  4N9I A;  1YS7 A;  1HLV A;  1AU7 A;  5D5U B;  2FQ4 A;  1LVK A;  4U7B A;  1YI2 I;  1K83 J;  3KP4 A;  5FB2 A;  3P7N A;  5EDN A;  1I1G A;  4BDY A;  3A01 B;  4ON0 A;  1FTT A;  4EMS A;  4AYB A;  3L2W A;  4KIF A;  2K9M A;  1LEA A;  2F48 A;  1ORK A;  1LDK B;  2E5Z A;  4O6J A;  3S1R J;  2Y9Y A;  3DPU A;  2KIF A;  4KA4 A;  2CW7 A;  3O3K A;  4KIT B;  3EUA A;  4CYC A;  2Q2E A;  2BW3 A;  2V7F A;  4DBR A;  3LAP A;  2KL4 A;  3F21 A;  2O9L A;  4IOA F;  2NXN B;  4F91 B;  3K2A A;  3HBL A;  1FMV A;  3BTL A;  2NNY A;  2M45 A;  3S2H J;  3HKZ N;  3RYR A;  5EF6 A;  4LLL A;  1IZ1 A;  3D1N I;  1LNW A;  1IV8 A;  3WTZ A;  4A93 J;  4BY7 J;  1NG6 A;  2IGO A;  1JE8 A;  3S2D J;  1WJD A;  2VLA A;  4M3E A;  3N4M A;  2F6C A;  1R7J A;  1QGP A;  3HRS A;  1ZAO A;  1LFB A;  4Y13 A;  2W7N A;  2M34 A;  1MNM C;  4MHG A;  1Z05 A;  2I10 A;  2LR8 A;  2LK2 A;  3EYI A;  2VI6 A;  2E2I J;  2FXA A;  2ZO4 A;  3W3C A;  3OS2 A;  3PNY A;  5DEQ A;  4GDF A;  1BI0 A;  1S7E A;  2GXG A;  4HST A;  2KP6 A;  1S72 I;  4A6D A;  2GOX B;  4PSW A;  1GXP A;  3MKW B;  5KAF C;  2KDO A;  1EA3 A;  1ULY A;  1YX5 A;  3S14 J;  2R5Z B;  2QSG X;  3ECH A;  1R22 A;  2IVM A;  3T8T A;  1V4R A;  3GEZ A;  4BQQ A;  1L3L A;  1PP8 F;  1TL8 A;  1JGG A;  3OR2 C;  1NK3 P;  3ERE D;  1PUE E;  2YS9 A;  3HPG A;  3I58 A;  3GTM J;  3T5X A;  1RKW A;  3E3V A;  5LHH A;  1MSE C;  4WWC A;  3K2Z A;  3WTV C;  4MNU A;  2M0C A;  2HQR A;  5LHG A;  1YQA A;  2ESN A;  2M8G X;  5F27 A;  2VUM J;  4XRM A;  3KYD B;  1WCM J;  3F8N A;  5GP9 A;  3ZP5 A;  1J09 A;  1J9I A;  3OV8 A;  4A5M A;  3IH3 A;  4B44 A;  1R49 A;  5EEH A;  2TRT A;  1PVE A;  3WE2 A;  2HI3 A;  4P1W A;  4HF1 A;  3S1N J;  2XRN A;  1XC5 A;  2AS5 F;  3RKQ A;  2DPD A;  5D5X B;  5FKK A;  1F1Z A;  2NOJ B;  3L00 A;  4DZP A;  1ZK8 A;  1P7J A;  2W85 A;  3G3Z A;  2L54 A;  4JX5 A;  3E1S A;  2PMZ A;  2DA1 A;  3NEU A;  5D4R A;  3QU6 A;  2X0L A;  1G8X A;  1U9O A;  3H92 A;  4HF0 A;  4KIC A;  4JX4 A;  4DYR A;  1O3T A;  2X9D A;  2QCO A;  3HPH A;  4LD5 A;  4RLQ A;  3M1E A;  3S3N A;  3NAR A;  3OOP A;  1NG7 A;  2DA4 A;  2JK3 A;  5AON A;  3H36 A;  3F23 A;  1RKT A;  3OYM A;  1G3Y A;  1ZG5 A;  1OCP A;  2QA4 I;  4H0E A;  4YFN F;  4PGH A;  1T56 A;  4EJV A;  5B1A H;  1BI1 A;  2L7K A;  4EEF G;  2PJR B;  1MBK A;  3HGG A;  2CUF A;  2M87 A;  5FJ8 J;  2AXT C;  1ITY A;  4IQJ A;  1MBJ A;  2GWR A;  2JN6 A;  2KHM A;  2KJC A;  2VT2 A;  3WHB A;  3PIP F;  3GF2 A;  3SEZ A;  3B02 A;  2MG4 A;  1B9M A;  3DPT A;  4YFX F;  2FRH A;  4OAY A;  2JWT A;  3H3Z A;  4N4N B;  2OJE D;  1YW7 A;  3BCA A;  2IBD A;  5LGT A;  3WHC A;  2GBY A;  4XLF A;  5ED4 A;  3JRE A;  2VBY A;  5DDG A;  2VXD A;  3I3L A;  1D3Y A;  5ILU A;  1QU3 A;  1W0U A;  4CSW A;  4CYC B;  2P6T A;  3PFY A;  3I56 I;  2NRA C;  2G7H A;  4G6D A;  3I54 A;  2XF6 A;  1TZL A;  3KP5 A;  3HTS B;  4M72 A;  5J40 A;  3CUQ A;  3DV8 A;  2HYG D;  2JUC A;  2HTS A;  1LE8 A;  1WHU A;  3P9K A;  2H8W A;  3OYF A;  1DU0 A;  3HOS A;  1P2F A;  1IGN A;  1MH4 A;  1WJA A;  1R6R A;  3SJM A;  5HS7 A;  2ELK A;  3HOZ J;  1DPU A;  3GWZ A;  2R7V A;  2P4W A;  1RR7 A;  3WGI A;  4DQ2 A;  4ENM A;  3G71 I;  3HOX J;  5C3E J;  4ZTF A;  2CUE A;  2DFF A;  1FMW A;  2MA3 A;  5CQE A;  4L5I A;  2D5V A;  2QYO A;  5FLV A;  1UAA A;  4Y3O A;  1T39 A;  5J47 A;  1VND A;  2L7Z A;  4NDL A;  5BMZ A;  1BC7 C;  2K9N A;  1VFC A;  2ZXI A;  4A3L J;  1BOB A;  3IKT A;  4XLP F;  1T08 B;  3G2B A;  1ETK A;  3LAJ A;  4BQO A;  5E1W A;  1OCC H;  2HVS A;  2IRF G;  2RKH A;  2I8D A;  3I5U A;  3JRG A;  4ASN A;  3L9F A;  1SFU A;  1IN5 A;  2E2H J;  3VYR B;  1X1D A;  5A2Q Z;  2AXL A;  3DXJ F;  1GHC A;  3E97 A;  2L4M A;  2CV2 A;  4M9Z A;  3BJO A;  4PFO A;  2W4S A;  4BU2 A;  4KDP A;  2HXI A;  3A4C A;  4HX7 A;  1T98 A;  1KYW A;  3F6O A;  3CDL A;  1SD4 A;  5JHU A;  2Q0O A;  1G2H A;  1Z3Y A;  5CVU A;  1XSD A;  4I01 A;  4II3 A;  1D0Y A;  4ZDO A;  3LA2 A;  3GFI A;  2VKH A;  3FDY A;  4ZZL A;  3CME I;  4EJO A;  2QSH X;  2ZJQ F;  1X4P A;  3G4S I;  4RBO A;  3OYN A;  1N78 A;  5K5Q A;  2QZ8 A;  3GVA A;  5J1R A;  1EJ9 A;  4OIP F;  5BPD A;  2KJB A;  1V5F A;  2R7F A;  5DYM A;  2L9S A;  4AIH A;  2Z33 A;  2ZSI B;  5HLH A;  2BY2 A;  2AHQ A;  3IKV A;  3RQI A;  2XSJ C;  4M74 A;  3BDD A;  5E79 C;  2F4I A;  2TDX A;  4UVC A;  1HXD A;  1MMD A;  3HSR A;  3E6B A;  1CF7 B;  2D45 A;  2GXB A;  1IRG A;  3WTW C;  1FYL A;  3R0J A;  3LNQ A;  1SC7 A;  4YIF A;  1RRJ A;  2VPR A;  2DPU A;  2O61 A;  3CC7 I;  2ZJP F;  2Y2Z A;  5LBQ A;  2LRD A;  4DJA A;  4BQN A;  4J00 A;  3HRM A;  4I2O A;  5D5V B;  1P4A A;  4Q5S F;  4F3Q A;  3TDZ C;  1R1U A;  1V54 H;  1JTY A;  1Y56 A;  1K61 A;  1UJ8 A;  5F0F A;  2O7O A;  3M8F A;  5EJC A;  4A3G J;  3RKW A;  3DQV C;  4AYB N;  4FAS D;  2ACJ A;  3GTG J;  4LOC A;  1MNE A;  3F8F A;  2MLG A;  3ZQQ A;  4AD9 A;  1QQI A;  2ZFW A;  2Z3Y A;  2YX7 A;  1Z6R A;  1ZLJ A;  5CJ9 A;  4BE2 A;  4GXO A;  1TWG J;  2JMW A;  4LG0 B;  1R5I D;  2BVL A;  4NHJ A;  3M1C A;  3BTC A;  2ME0 A;  3JRF A;  1Y1V J;  1FTZ A;  1JGS A;  3KCC A;  2H1K A;  1T33 A;  3ROU A;  3RTR A;  3BR0 A;  3OIP A;  4X1E A;  1EH7 A;  3GLX A;  1ZR2 A;  2HKO A;  1D0Z A;  3BR6 A;  2HGC A;  3ZN1 A;  2V9V A;  4BDZ A;  2OCC H;  4Q4Z F;  3Q5F A;  2NAZ A;  1BR4 A;  2IAI A;  4E7J A;  4KT6 A;  4UB6 C;  1SFE A;  4LIV A;  5BNG A;  3CJR B;  2P5L C;  3R61 A;  4L9J A;  1H89 C;  1Y8Q B;  2QQ8 A;  3WG7 H;  4KT5 C;  1IV6 A;  4F55 A;  2XHK A;  3IV5 A;  1S8N A;  4BNC A;  1JTX A;  4I7H A;  5EGO B;  2JVH A;  1HW1 A;  2XPV A;  2KIQ A;  2R5Y A;  4ENN A;  3I64 A;  5ICC A;  1XG1 A;  3FXK A;  3QPS A;  2RQP A;  2LKX A;  3HYI A;  3ONQ A;  3H3V K;  2BY1 A;  3IAS 2;  1P9Q C;  4UV8 A;  4P9U A;  1Q1H A;  1QNT A;  2COB A;  4MQV A;  4PJ0 C;  2G9W A;  2KZV A;  3HRT A;  4IRI A;  4B4C A;  3CMA I;  1BA5 A;  1TWC J;  2STT A;  3AFH A;  2HWV A;  3WGH A;  5HVQ C;  2CFX A;  1HBX G;  3OYG A;  1JJ6 C;  2OC6 A;  3H5A A;  1VTN C;  4YRV A;  5EYR A;  2XPU A;  1TQM A;  4E7Z A;  2DA6 A;  3O8G A;  4XN0 A;  4S0H B;  1ETW A;  3BG6 A;  4C30 A;  2XAG A;  5LLQ A;  1OR7 A;  3ZMD A;  2OZU A;  3BJ6 A;  4Q47 A;  1BR2 A;  4D7N A;  4PGG A;  3QPT A;  2L9V A;  3E6M A;  3T8R A;  2K3P A;  1XCB A;  4WK8 F;  4EM2 A;  1OMI A;  5DCM B;  2ZC2 A;  2VIX A;  2EIK H;  4G6T B;  2JA8 J;  2XAU A;  2LKP A;  4BHB A;  3M4O J;  2XAS A;  3VB2 A;  2VXZ A;  5L3D A;  1RIO H;  3DTE A;  4A0Z A;  4C2M J;  3SQN A;  2VN2 A;  1FIP A;  1SD5 A;  4CUG A;  3W2V A;  2FML A;  2PBI A;  1K79 A;  2O3F A;  1BI2 A;  4C2U A;  1XX5 A;  2HQN A;  1K7A A;  2AQF A;  3CP8 A;  3GFJ A;  1TWA J;  4OIR F;  3RZO J;  3QOP A;  4TV7 A;  1MJ9 A;  4AIK A;  3QQA A;  1YIO A;  1QVT A;  1Z6T A;  3PUF A;  2LP0 A;  3OOU A;  2MYS A;  2Y75 A;  4L0Z B;  4P96 A;  3RSN A;  2EFW A;  5TIS C;  4BEH B;  4UUS A;  4MO7 A;  4E7I A;  1TW3 A;  1U5T B;  5CKT A;  1LE8 B;  2E71 A;  2O03 A;  3LFU A;  3HB9 A;  5CVJ A;  3PIO F;  2R7D A;  2Y69 H;  4A3M J;  4H4K C;  4OMY A;  2JSP A;  5J8C A;  2EA4 A;  3ZPL A;  3L1P A;  2R5Y B;  1XB4 A;  2DOA A;  2ECB A;  3AG1 H;  3N05 A;  4HA8 A;  4HQM A;  1X3Z B;  2ZNY A;  4BJT A;  3NQO A;  5EGO A;  2PJP A;  1JUP A;  2JUG A;  2DQR A;  4L5E A;  3PNT A;  4DIQ A;  3S1M J;  2ZXJ A;  4XL9 A;  1OIS A;  1QZZ A;  4A0Y A;  3DKY A;  2GZW A;  2CG4 A;  3TED A;  3OS1 A;  4XRS A;  4AIJ A;  1VZ0 A;  4IO9 F;  4GCV A;  2H94 A;  1FPQ A;  3SZT A;  3GTJ J;  1ZN2 A;  1I3A A;  3ULQ B;  2X85 A;  1WI9 A;  3IH4 A;  5IYD J;  1PDN C;  2ID3 A;  4OWR B;  4NC7 A;  5DS9 A;  1XS9 A;  3KYC B;  3ZMT A;  3VSL A;  2ID6 A;  3IRQ A;  2VL8 A;  1QZE A;  3CMM A;  2X1D A;  2NNN A;  1BJA A;  5F0C A;  2P8T A;  3LSK A;  1R1V A;  2HQ5 A;  4W97 A;  1Y0N A;  4F52 A;  1WJE A;  4C9Y A;  4MTD A;  1QPI A;  5H20 A;  3J7Y J;  3EPZ A;  2K9S A;  2R7X A;  1SD7 A;  3PL8 A;  1I27 A;  3K4M A;  1V55 H;  1O3Q A;  2Q1Z B;  4BEH A;  2RGV A;  2E1M B;  1PUF B;  1IW7 F;  1UG0 A;  1A5J A;  2HVR A;  1W5C C;  4ETS A;  2R4G A;  1UMQ A;  2CYY A;  2ADU A;  5E3O A;  3J7A Y;  2Y0M A;  4A2U A;  4YG2 F;  4OIQ F;  1SFK A;  1I50 J;  2XGC A;  3KP3 A;  2XF7 A;  4FE7 A;  3ABL H;  4ZTJ A;  5FRM A;  2CQQ A;  2F5D A;  2VBW A;  3BCB A;  3NWT A;  1D1A A;  2B0L A;  1SVM A;  4CZZ A;  5IP6 A;  1SVL A;  1B4A A;  1W7P D;  2HDW A;  1FP1 D;  2EV6 A;  3LST A;  4IXA A;  1IRZ A;  2NS0 A;  2KLO A;  2KIS A;  2E1N A;  3LA3 A;  3F9K A;  3KZZ A;  1JKP C;  4AVZ A;  5BOX A;  2XGD A;  2LF7 A;  1MIJ A;  2CW8 A;  1FEX A;  4RA2 A;  3ZQI A;  4L18 B;  1UHW A;  2DTZ A;  4I99 C;  1FP2 A;  1TTY A;  1R1T A;  3IC7 A;  4ZH4 F;  4X6A J;  3HTU A;  3TGN A;  4W1U A;  3OYI A;  4DGW B;  3ZQ7 A;  1ZRC A;  1V5E A;  3HRU A;  4XOP A;  1SAX A;  9ANT A;  5FKO A;  2GA2 A;  2VJ4 A;  4QLC U;  3GCM A;  3WOD F;  2MBF A;  2KT0 A;  2WC2 A;  5E20 A;  3S1Q J;  2MH9 A;  2K27 A;  2MGQ A;  5EEA A;  3WU1 B;  1BC8 C;  2K4J A;  2KIU A;  5B3S H;  2LDU A;  1YRN B;  4DYC A;  4ZJZ A;  3JRC A;  2Z16 A;  3BZC A;  4B3A A;  5HOD A;  2QF7 A;  3HHH A;  4IVN A;  4Y4R A;  4ENJ A;  1SFO J;  4B43 A;  4BY1 J;  2EZH A;  1HW2 A;  3LQQ A;  3ISP A;  2HYF A;  4XID A;  1YS6 A;  1I5Z A;  1W0T A;  1IXC A;  2F5V A;  3TO9 A;  2L7F P;  3HJE A;  3V8J A;  1G3T A;  3WTY C;  5TGT A;  2KRF A;  2IJL A;  2OZ6 A;  3TL4 X;  2E1M C;  4ESB A;  4D5C A;  2HZD A;  3KIO A;  5E17 F;  4D9J A;  1XSX A;  5KVR A;  5GAE J;  5IOZ A;  1X1B A;  5LGN A;  2D1H A;  3IHU A;  2OUM A;  3DTI A;  3B6A A;  4KN7 X;  1E17 A;  4Q48 A;  3HIF A;  1VQP I;  2LF8 A;  2GAU A;  4MIM A;  3OYB A;  4PCQ A;  3F0C A;  2M2E A;  3CUQ C;  3KLN A;  2V9K A;  3RPU D;  1LUJ B;  2ICW G;  5FFX A;  3Q0U A;  2IGM A;  4OIO F;  3KEY A;  2FOW A;  3BR1 A;  1H8A C;  3PSF A;  3MZ8 A;  2DA5 A;  5CLS A;  1YJW I;  1MGT A;  4IQ4 A;  2A61 A;  3BQZ A;  3M7G A;  1LEB A;  2ELJ A;  4PJM A;  1OFC X;  1ACI A;  5BPI A;  5HS8 A;  1MMS A;  2D2W A;  4RM3 A;  1BIB A;  3HUG A;  3G6E I;  1N77 A;  4BH9 A;  4ITV A;  2BV6 A;  3V7C A;  4RDU A;  1B72 A;  4Y52 J;  4KMF A;  4V2G A;  2ZXW H;  1MJB A;  4M3G A;  2EFP A;  1TQP A;  2P5V A;  2L5Q A;  1ZRE A;  2CU7 A;  4RLF A;  3ZQH A;  1TBX A;  2A68 F;  3OIQ A;  1W7P A;  1D5Y A;  3SXY A;  4OU0 A;  4A3C J;  1UEL B;  2WAQ A;  1W36 C;  3DU5 A;  4XMY A;  2V1N A;  1X1C A;  2UV1 A;  4RAZ A;  2HNH A;  4HLX A;  3ZMV A;  5L3G A;  1XGM A;  2LY1 A;  3QWL A;  2LYC A;  3IWF A;  4QPO A;  4L9N A;  3K70 C;  2YUS A;  1TC3 C;  4BHP A;  1QHG A;  3PO2 J;  1VQ9 I;  1IG7 A;  1FSH A;  2IA1 A;  2DDB A;  1R23 A;  4MEY F;  4R8H A;  2K3F A;  2R7Z J;  1STZ A;  4Y7N J;  1B1B A;  4HSR A;  4BAC A;  3T0Y A;  1K6Y A;  1JT0 A;  1D8K A;  1FX7 A;  2JJ7 A;  1B9N A;  3GTQ J;  2HOT A;  2VKE A;  3MKY B;  3DPL C;  2DFH A;  1RET A;  1RZ4 A;  1D0X A;  2QGU A;  1S7A A;  1D1B A;  2A5W A;  4IJA A;  3W2A A;  3CJQ B;  1TT5 B;  4X0G A;  4OMZ A;  2HDC A;  2H1L A;  1JKR C;  1RR8 C;  3S8P A;  1GVD A;  4RGU A;  5LD2 C;  1J5Y A;  2PX9 A;  3CUQ B;  1AOY A;  2Z99 A;  3A02 A;  1ZG3 A;  2M3A A;  1WVR A;  3AG3 H;  1O3R A;  1YW9 A;  5CVI A;  4HV5 A;  5M3M J;  5J1U A;  1UB9 A;  3S15 J;  3LSR A;  2VBX A;  3LSJ A;  3CCL I;  3AG4 H;  2QEN A;  3LOC A;  3QAH A;  2E7X A;  1Q1V A;  3W6K B;  1T6S A;  4IX7 A;  4CH7 A;  1OJL A;  3GFL A;  1EH8 A;  2BEO A;  1R5H A;  1YOV B;  4M9X A;  4HRI A;  3VDX A;  3NRV A;  3G73 A;  1FOW A;  3COA C;  5DM7 F;  4LLG F;  4FX4 A;  3FK6 A;  1B59 A;  1SMY F;  3WTU C;  3DLA A;  3MFK A;  4ZDP A;  1DGR M;  4M3D A;  5H6Q A;  4BJ5 C;  4G8X A;  3R6S A;  3IH2 A;  4M3F A;  3GTK J;  4G7O F;  2RQQ A;  1BM9 A;  3MKZ A;  2F5F A;  3MEX A;  3SEQ A;  3ELK A;  2MC3 A;  5FKN A;  2DMT A;  4HDV A;  1MH3 A;  4HPQ A;  3LSM A;  2STW A;  1Y39 A;  1HDP A;  1YYV A;  2R5Z A;  2V79 A;  5KK1 A;  1OYI A;  4S05 A;  3FF5 A;  5IT9 Z;  1QRY A;  3D0S A;  3P9C A;  1O4X A;  4II2 A;  2X4H A;  4XSZ F;  2DW4 A;  2KFD A;  3R60 A;  2E19 A;  3U1D A;  2OTJ I;  3P5J A;  4OIN F;  2XIG A;  3M8J A;  4C2T A;  2VE9 A;  1Y1W J;  1FT9 A;  3VOE A;  2IS4 A;  4KMU X;  2KMU A;  1ZYR F;  1KGS A;  3TOB A;  1VI0 A;  3DCF A;  2FMY A;  5E18 F;  5H2F C;  3QOE A;  3J81 K;  3MKL A;  4PSX A;  3J7A O;  1NH3 A;  1S3J A;  3GBG A;  3C2B A;  2Z2S B;  5DM6 F;  1QPM A;  2E34 A;  5L3C A;  2K40 A;  2ETH A;  3K4C A;  3TMO A;  2EFN A;  1ZAR A;  1FJL A;  2WV0 A;  1YFH A;  2QLZ A;  5JVT A;  1XD7 A;  2XPW A;  3C2H A;  4EJW A;  3HOV J;  2UXX A;  2BYV E;  2DAO A;  2VQH A;  5D6F A;  2F2E A;  1T8I A;  2RAE A;  3MQ0 A;  1MBE A;  4BJ6 C;  1U8R A;  2P0W A;  5DD4 A;  1K4S A;  1OLT A;  2QQB A;  2OA4 A;  3V42 A;  4YII A;  1ZR4 A;  3JRD A;  1TWF J;  2BW3 B;  3E7L A;  3QP5 A;  3FZV A;  2DQL A;  1IXR C;  2XB0 X;  3A0B C;  3GO5 A;  1FOX A;  2EJR A;  4KN4 X;  4GFB A;  2BE5 F;  2ZCW A;  1ETX A;  3SHF A;  4FET A;  2A05 A;  1U8B A;  2NOG A;  1AKH A;  3L09 A;  2XAH A;  2KRC A;  3HOU J;  1I6X A;  4NB5 A;  1TP4 A;  4YEJ A;  5TJJ A;  2HR3 A;  4Z2Y A;  3L2V A;  1V5G A;  4BS9 A;  2DT5 A;  2TCT A;  4JQF A;  4IHT A;  2WAD A;  1KA8 A;  5J4V A;  2FNA A;  2OPT A;  5HLI A;  3K0L A;  3PQK A;  5KAI C;  2ZME A;  1YHQ I;  3CF2 A;  4HNT A;  3TOA A;  4A69 C;  5JHF A;  2OCE A;  3AL0 B;  2WTE A;  5J3L A;  1KZH A;  3KLO A;  5IYB J;  2UWM A;  3KFW X;  5DV5 A;  5EG0 B;  4IRH A;  4CCM A;  2PQ8 A;  3J80 Z;  1MDM B;  1X58 A;  3FKI J;  3J80 K;  3CCS I;  2EBI A;  4L0Y B;  4UY8 I;  5EG0 A;  1TW2 A;  3BPV A;  4AVP A;  3CD6 I;  4DZJ A;  4XOR A;  4XN3 A;  1E2X A;  2XUB A;  1XMA A;  3BOQ A;  5FKM A;  2A5Y B;  1XDU A;  2VC0 A;  1U3E M;  4U88 A;  1L0O C;  5TRD A;  2OAZ A;  3D5L A;  2R7S A;  1TT0 A;  3CLQ A;  1XGO A;  3BRO A;  2XGX A;  3TW7 A;  1VQ6 I;  2M8E A;  2E5N A;  4XLC A;  2M0M A;  1A31 A;  2DJI A;  2FBK A;  3VYU B;  3PUB A;  5C4X J;  4FT8 A;  5JFR A;  3MAJ A;  1T2K A;  2XRL A;  5CYV A;  2Q8K A;  3CF5 F;  4BKX A;  4A3F J;  2V6C A;  2PMU A;  2ISY A;  3LA7 A;  3ZCO A;  1S9H A;  3KP6 A;  3A03 A;  2UUZ A;  1RUO A;  3ZMS A;  1ZGW A;  3F8B A;  4WXD A;  1YE9 A;  2CV1 A;  2KRH A;  5CPR B;  3KZY A;  2LKS A;  4XRF A;  4QPQ A;  1VQ5 I;  1S7O A;  5BQT A;  3VOD A;  1PUF A;  1R4N B;  3F3X A;  1RPW A;  1XCV A;  2BOL A;  4A3I J;  1U6G A;  3KPH A;  2FA5 A;  3FHN A;  1XDS A;  4D1Q A;  4IZZ A;  2PJR A;  1ZRF A;  3BG3 A;  2XB5 A;  2IT0 A;  2BY0 A;  3SYT A;  2DO7 A;  3OIO A;  4RB1 A;  3MZH A;  2V26 A;  3BY6 A;  1X3W B;  5K7F A;  3K4J A;  1T0F C;  3CCR I;  2O0Y A;  2L7M P;  3FX3 A;  2EIJ H;  1J75 A;  2M7A A;  1W4M A;  2KKO A;  2LBF A;  3CDI A;  3WTS C;  4IHY A;  1FC3 A;  1FY7 A;  3J81 Z;  2BGC A;  3E5X A;  1W5T A;  5DTD A;  4XRS G;  4ZYE A;  3AL0 C;  4XR6 A;  3ASO H;  1X1P A;  3N97 A;  3OYE A;  2A6H F;  2K9L A;  4XK4 A;  3RKX A;  5FD5 A;  3TDU C;  2CQX A;  5B66 C;  2CW0 F;  5K7H A;  1WQ2 A;  3J7Z I;  2LVS A;  3ZQF A;  2IA2 A;  3X2Q H;  5GTI C;  3K4N A;  3BLY A;  3MCZ A;  3NWS A;  2DK5 A;  4NC8 A;  1E0E A;  2MD0 A;  2WY8 Q;  4AUX A;  4P5O A;  1HOM A;  3ZQG A;  2O8X A;  4NUB A;  1XPX A;  3U9G A;  2WWY A;  4WXC A;  3ABT A;  4I6Z A;  3HOY J; 
#chains in the Genus database with same CATH homology
 2HEO A;  3RPQ A;  1BI3 A;  2GIV A;  3JSP A;  1LB2 A;  5ERI A;  3ZMZ A;  3EUH A;  1G3W A;  3GZ5 A;  3I59 B;  1ON1 A;  3M8E A;  3HOT A;  3K1P A;  2FE3 A;  4RAY A;  2QBY A;  3QPH A;  2DU9 A;  4CDG A;  2ZME B;  1HW5 A;  4HW0 A;  2CQK A;  3F8C A;  1BBY A;  3QRF F;  4UNO A;  3FMR A;  4EJT A;  1YG2 A;  4L9T A;  3CTA A;  2PN6 A;  5HDG A;  4GGG A;  2ZNZ A;  4Y15 A;  2A69 F;  3Q9V A;  4I0A A;  3E5Q A;  1KYZ A;  5D8L B;  1QO0 D;  4RB0 A;  3RKY A;  3FHZ A;  1MDM A;  1H9G A;  1ZRD A;  2DLL A;  1XSV A;  1QBJ A;  3H3U A;  2COM A;  1K6O A;  3DKW A;  2IW5 A;  5LRS A;  4MQ9 F;  2V1U A;  4RB3 C;  4CYD A;  1FBQ A;  3F22 A;  1UFM A;  3LWF A;  4LG0 A;  5IT3 A;  1W5S A;  1FBU A;  3JTG A;  1IUY A;  4KIB A;  1NHA A;  4G7Z F;  4DNC A;  1T0F A;  1U5T C;  2JT1 A;  3FMQ A;  4LK1 F;  1WSU A;  3WE3 A;  1OKR A;  2Z5U A;  3RIR A;  2XKO A;  3EDP A;  3K69 A;  4P55 A;  2IA0 A;  2F5C A;  2GA1 A;  3CDH A;  3I59 A;  1Z9C A;  1ZH5 A;  4RB2 C;  2QM3 A;  1MD0 A;  3BPX A;  2OQG A;  5K1Y A;  3V8K A;  1WKM A;  4CGZ A;  4KNY A;  1Z1D A;  2HS5 A;  4JBA A;  4ZZD A;  1D5V A;  5AIP A;  2A3S A;  1O3S A;  4IRG A;  2MLK A;  3BJA A;  2EFQ A;  1HST A;  3MWM A;  2UXN A;  2FQ3 A;  2K86 A;  1USS A;  2VT3 A;  4D0P A;  3ZMU A;  2CSO A;  3DEU A;  1FBS A;  1KQ0 A;  3RJP A;  5K5O A;  4HOB A;  3EYY A;  1R58 A;  3LFK A;  1DUX C;  4LJZ F;  3E5U A;  4M73 A;  2M30 A;  2PG4 A;  5FLX K;  2OBP A;  2PMH A;  4GO1 A;  2H6B A;  1HKS A;  1EH6 A;  1IN7 A;  3HSE A;  1CF7 A;  2EV5 A;  1R00 A;  4BXU A;  2O6G E;  1IN6 A;  2YR2 A;  1FSE A;  4N9H A;  4IF4 A;  4RS8 A;  4FX0 A;  4R79 A;  1LVA A;  3DFG A;  3FXR A;  3BP8 A;  2DTR A;  1QZY A;  4EV0 A;  4IPA A;  2XAF A;  1O7F A;  5CVR A;  1C0W A;  5H6R A;  3E6C C;  3WTX C;  4HV6 A;  1R36 A;  4HX4 A;  4G7H F;  2A07 F;  4GYI A;  4RGS A;  4LFU A;  2ELH A;  1FLI A;  1BOA A;  4XLN F;  2RVC A;  3HSF A;  3VEP A;  3GZ6 A;  4CO8 A;  3ABU A;  4I09 A;  1HKT A;  4LMY A;  4YFK F;  2YPR A;  4MTE A;  2W25 A;  1XMK A;  3WU0 A;  1BN5 A;  2MD5 A;  3TO6 A;  3FWE A;  3R0A A;  1TQI A;  2RC4 A;  3EET A;  4WCG A;  1RNL A;  1FWZ A;  1ZGJ A;  2FSW A;  2K02 A;  2E1C A;  1UHM A;  2H09 A;  1DP7 P;  1P92 A;  3P9I A;  1Y0U A;  2IPQ X;  2H27 A;  1S6L A;  2L4A A;  1YO5 C;  4LB5 A;  1T38 A;  2JZY A;  1J0R A;  1ZLK A;  4OOI A;  4EM0 B;  5A2Q K;  1YTY A;  4BQA A;  2R3S A;  4G6Q A;  2EK5 A;  1SMT A;  5DUI A;  2PFB A;  4U7D A;  4QWQ A;  2K4B A;  4UHT A;  3F72 A;  4HAM A;  2CWE A;  4WX9 A;  1XGN A;  4MEX F;  3KEQ A;  1B6A A;  2FU4 A;  2JPC A;  2QUF A;  5K5R A;  5J6X A;  4UV9 A;  2LNB A;  5D8K B;  3GYH X;  3REO A;  4U0V A;  2FNP A;  3IWZ A;  2OD5 A;  3GUD A;  4AWX B;  1TNT A;  2Z9O A;  3F8M A;  3DF8 A;  2EB7 A;  1ON2 A;  1FYM A;  3GXO A;  4FHT A;  1RUN A;  2P6S A;  3K1M A;  5JR3 A;  2C6Y A;  2M1B A;  4G9Y A;  2A6E F;  4HYE A;  1LDD A;  2ZBK A;  3CO6 C;  2LSO A;  2DI3 A;  4ZYD A;  4UVA A;  3V7R A;  1G6N A;  1V3F A;  5LHI A;  4HDU A;  1K78 A;  3V7S A;  3FMS A;  3WG9 A;  4K2E A;  3HHG A;  1YW8 A;  2K7L A;  5L3B A;  2D1V A;  2HTJ A;  2ESH A;  5ILV A;  2UZK A;  2V1D A;  3C7J A;  5FLX Z;  4EVI A;  3BZ6 A;  5HDK A;  3KEO A;  1TLH B;  2XVC A;  2EA2 A;  1FOK A;  5FO5 A;  3CLO A;  4M9S A;  3FM3 A;  5FFZ A;  5FGM A;  4UUV A;  2P5K A;  4XSX F;  1J2X A;  1W7P B;  4ESJ A;  5DCM A;  3R4K A;  3TO7 A;  3JW4 A;  3FXU A;  3Q9S A;  1KQ9 A;  1P6R A;  5L3E A;  3FM5 A;  1ZHF A;  5LRR A;  5E1Z B;  1F4K A;  1ODD A;  1R5G A;  5LGU A;  1A04 A;  2L3D A;  5E8G A;  3V4G A;  3JSO A;  2W24 A;  2M5W A;  4PZJ A;  4M71 A;  2Y48 A;  3I53 A;  1P4X A;  2VOP A;  4ZYG A;  4ENK A;  3WTT C;  1ZG1 A;  1BIA A;  2VOO A;  3KP7 A;  1DPR A;  5AIQ A;  1IRF A;  3IRR A;  2FBH A;  4O5V A;  5L3F A;  4B8X A;  3AAF A;  4GYG A;  2QQ9 A;  1GVJ A;  4XBF A;  1IXS B;  2JSC A;  4PDK A;  3O2P E;  2RN7 A;  2DFI A;  2XKP A;  4CIC A;  4HX8 A;  1F9N A;  4WF2 A;  5DUK A;  3I0T A;  3DP7 A;  2GQQ A;  4I98 B;  5F1R A;  4G94 A;  1SFX A;  2EV0 A;  1XGS A;  4S04 A;  4EQQ A;  2FEZ A;  4L9V A;  4O3M A;  3RYP A;  1IAW A;  1Z91 A;  1I1S A;  2OU2 A;  2ZKZ A;  1RI7 A;  6PAX A;  2JTV A;  1YLF A;  2VOD A;  2QBY B;  1GXQ A;  3M9A A;  3TKY A;  3KET A;  1J59 A;  2VON A;  4EJU A;  2CO5 A;  3E6D A;  2XAQ A;  2RNJ A;  3TQN A;  2YU3 A;  1PP7 U;  4I0B A;  3CUO A;  4HF2 A;  5ILS A;  3L2C A;  4BAY A;  2VE8 A;  4L5J A;  1F5T A;  3F6V A;  3EQL F;  2EWN A;  4EM1 A;  4KYW A;  2J5P A;  3C1D A;  2FOK A;  4LB6 B;  2JRT A;  1WWX A;  2ISZ A;  3RI4 A;  4A12 A;  1KU7 A;  2DBB A;  2ZJ2 A;  1U5T A;  1IF1 A;  3KP2 A;  5BS6 A;  5LEK A;  2V1X A;  3S2W A;  4HLY A;  3K1N A;  3O6B B;  3L7W A;  1IN8 A;  1KQ8 A;  4I02 A;  2IP2 A;  5HS9 A;  2HOE A;  4RGX A;  4CXF A;  3SZP A;  3RDI A;  5JI6 A;  4ESF A;  2DK8 A;  1JXS A;  1D8J A;  5D6E A;  1UCR A;  3MZY A;  1G4D A;  4LGW A;  3ECO A;  5F64 A;  3C18 A;  1U78 A;  4CHU A;  1O7L A;  1O57 A;  2XRO A;  3I4P A;  1CGP A;  1G3S A;  4HZF A;  2YX4 A;  2H6C A;  2F5E A;  1XN7 A;  1ONV A;  4LK0 F;  3V8L A;  3GW2 A;  5F6F A;  3I71 A;  1JHF A;  4F7Z A;  3K9T A;  3KE2 A;  4RGR A;  5E8I A;  1UST A;  1U2W A;  1SD6 A;  4HBL A;  2FBI A;  3PQJ A;  4Y17 A;  1ZGA A;  4ZYH A;  1DDN A;  4EGY A;  2RV8 A;  4P9F A;  1FZP B;  4M6Y A;  2FF4 A;  1HKQ A;  2L02 A;  5EEG A;  5HDN A;  1REP C;  2P7V B;  5DCF A;  1FNN A;  2JPB A;  1P4W A;  1JHH A;  4E70 A;  5J8F A;  3GX4 X;  3QP6 A;  5CVV A;  2BBY A;  1OYY A;  5DD8 A;  1TNS A;  3RPU A;  4KUM A;  1OPC A;  2PEX A;  5ICE A;  2E7W A;  2VBZ A;  1HQC A;  4M6X A;  2OQR A;  2VC1 A;  3CJN A;  5ICG A;  5HOO A;  1KU3 A;  2L01 A;  5IT9 K;  2CGP A;  4JK1 X;  1H9T A;  1OYW A;  2HZT A;  3WGG A;  3U2R A;  3IL2 A;  5D5W B;  1AWC A;  4KIG A;  1MJA A;  2XV4 S;  3W6J B;  3VFZ A;  1HSJ A;  3JAM Z;  2P7C B;  3ML6 A;  1Z7U A;  4NQW A;  4R1H A;  1LJ9 A;  5LEJ A;  2PLY A;  3FXQ A;  2XAJ A;  5E1X A;  1K78 B;  1X3U A;  4B09 A;  4A5N A;  1KU2 A;  1H0M A;  3CO7 C;  2W84 A;  2KIM A;  2PI0 A;  1LDJ A;  3GFM A;  2MH2 A;  2HFH A;  3JTH A;  1J7K A;  3QU3 A;  2G7U A;  4U0Y A;  4MGR A;  4N0B A;  1MKM A;  2NYX A;  3B73 A;  1KU9 A;  4A0X A;  3BWG A;  4UVB A;  2HKX A;  2J5O A;  4A6E A;  1MZB A;  3T1B A;  1FYK A;  1EV7 A;  3LQR A;  1LQ1 A;  4U0W A;  4HQE A;  2YSR A;  1WRJ A;  3ZN0 A;  3JAM K;  4BHC A;  5ICF A;  4KFC A;  3C3W A;  4WXH A;  4UXN A;  2W57 A;  3SFZ A;  2QVO A;  2EFO A;  1IN4 A;  5HLG A;  1S29 A;  2QQA A;  2QWW A;  5D4S A;  2RDP A;  5FD6 A;  4LLN A;  3PFI A;  4IHS A;  4BYY A;  4EGZ A;  4N9I A;  1YS7 A;  5D5U B;  4U7B A;  3KP4 A;  5FB2 A;  3P7N A;  1I1G A;  4ON0 A;  4EMS A;  4KIF A;  1LEA A;  1LDK B;  4O6J A;  2KIF A;  4KA4 A;  3O3K A;  2Q2E A;  3LAP A;  3F21 A;  2NNY A;  2M45 A;  3RYR A;  4LLL A;  1IZ1 A;  1LNW A;  3WTZ A;  1JE8 A;  3N4M A;  1R7J A;  1QGP A;  3HRS A;  1ZAO A;  4Y13 A;  4MHG A;  1Z05 A;  3EYI A;  2FXA A;  2ZO4 A;  5DEQ A;  1BI0 A;  2GXG A;  4A6D A;  1GXP A;  1ULY A;  3ECH A;  1R22 A;  2IVM A;  3T8T A;  1V4R A;  3GEZ A;  1L3L A;  1PP8 F;  3ERE D;  1PUE E;  3I58 A;  3T5X A;  3E3V A;  5LHH A;  4WWC A;  3K2Z A;  3WTV C;  4MNU A;  2HQR A;  5LHG A;  1YQA A;  2ESN A;  3F8N A;  3ZP5 A;  1J9I A;  3OV8 A;  4A5M A;  5EEH A;  3WE2 A;  4HF1 A;  2XRN A;  2AS5 F;  2DPD A;  5D5X B;  1F1Z A;  3L00 A;  3G3Z A;  2W85 A;  2L54 A;  3NEU A;  5D4R A;  3QU6 A;  2X0L A;  4HF0 A;  3H92 A;  4KIC A;  1O3T A;  4LD5 A;  3M1E A;  3OOP A;  5AON A;  3F23 A;  1G3Y A;  1ZG5 A;  4H0E A;  4YFN F;  4PGH A;  4EJV A;  1BI1 A;  2M87 A;  2GWR A;  2KJC A;  2VT2 A;  3GF2 A;  3B02 A;  1B9M A;  3DPT A;  4YFX F;  2FRH A;  3H3Z A;  1YW7 A;  5LGT A;  5ED4 A;  2VBY A;  5DDG A;  1D3Y A;  5ILU A;  2P6T A;  2NRA C;  2G7H A;  4G6D A;  3I54 A;  3KP5 A;  3HTS B;  4M72 A;  3CUQ A;  3DV8 A;  2HYG D;  2HTS A;  3P9K A;  3HOS A;  1P2F A;  5HS7 A;  1DPU A;  3GWZ A;  2P4W A;  3WGI A;  4DQ2 A;  4ENM A;  2MA3 A;  4L5I A;  2QYO A;  1T39 A;  5BMZ A;  1BC7 C;  3IKT A;  4XLP F;  3LAJ A;  5E1W A;  2IRF G;  2RKH A;  3I5U A;  4ASN A;  3L9F A;  1SFU A;  1IN5 A;  5A2Q Z;  2AXL A;  3DXJ F;  1GHC A;  3E97 A;  2L4M A;  4M9Z A;  3BJO A;  4KDP A;  4HX7 A;  1T98 A;  1KYW A;  3F6O A;  5JHU A;  1SD4 A;  2Q0O A;  5CVU A;  1XSD A;  4I01 A;  3LA2 A;  3GFI A;  4ZZL A;  4EJO A;  5K5Q A;  2QZ8 A;  3GVA A;  4OIP F;  5BPD A;  2KJB A;  2R7F A;  5DYM A;  4AIH A;  2Z33 A;  5HLH A;  3IKV A;  4M74 A;  3BDD A;  4UVC A;  2TDX A;  1HXD A;  3HSR A;  3E6B A;  1CF7 B;  2D45 A;  2GXB A;  1IRG A;  3WTW C;  1FYL A;  3R0J A;  4YIF A;  2DPU A;  2O61 A;  5LBQ A;  3HRM A;  4I2O A;  5D5V B;  1P4A A;  4Q5S F;  3TDZ C;  1R1U A;  3M8F A;  3RKW A;  3DQV C;  2ACJ A;  3F8F A;  2MLG A;  4AD9 A;  1QQI A;  2ZFW A;  2Z3Y A;  2YX7 A;  1Z6R A;  1ZLJ A;  5CJ9 A;  4GXO A;  4LG0 B;  4NHJ A;  1JGS A;  3KCC A;  3ROU A;  3RTR A;  1EH7 A;  3GLX A;  2HKO A;  2HGC A;  3ZN1 A;  2V9V A;  4Q4Z F;  3Q5F A;  2NAZ A;  1SFE A;  2P5L C;  3R61 A;  4L9J A;  4KT5 C;  2XHK A;  1S8N A;  4BNC A;  4I7H A;  1HW1 A;  4ENN A;  3I64 A;  5ICC A;  2RQP A;  3HYI A;  4UV8 A;  4P9U A;  1Q1H A;  1QNT A;  4MQV A;  4IRI A;  2G9W A;  3HRT A;  2STT A;  2HWV A;  3WGH A;  5HVQ C;  1HBX G;  2CFX A;  1VTN C;  1TQM A;  2XAG A;  5LLQ A;  1OR7 A;  3ZMD A;  2OZU A;  3BJ6 A;  4Q47 A;  4PGG A;  3QPT A;  3E6M A;  3T8R A;  1XCB A;  4WK8 F;  4EM2 A;  1OMI A;  5DCM B;  2LKP A;  4BHB A;  2XAS A;  3VB2 A;  2VXZ A;  5L3D A;  1RIO H;  4A0Z A;  3SQN A;  2VN2 A;  1SD5 A;  2FML A;  2PBI A;  1K79 A;  2O3F A;  1BI2 A;  2HQN A;  1K7A A;  3GFJ A;  4OIR F;  3QOP A;  4TV7 A;  1MJ9 A;  4AIK A;  1YIO A;  1Z6T A;  2Y75 A;  4L0Z B;  4P96 A;  2EFW A;  1TW3 A;  1U5T B;  2O03 A;  5CVJ A;  2R7D A;  4OMY A;  5J8C A;  2EA4 A;  3ZPL A;  1XB4 A;  4HA8 A;  4HQM A;  2ZNY A;  3NQO A;  2PJP A;  2DQR A;  2ZXJ A;  4A0Y A;  1QZZ A;  2GZW A;  2CG4 A;  4AIJ A;  4GCV A;  2H94 A;  1FPQ A;  3SZT A;  1ZN2 A;  3ULQ B;  1WI9 A;  1PDN C;  3ZMT A;  3IRQ A;  2NNN A;  1BJA A;  2P8T A;  1R1V A;  4MTD A;  5H20 A;  1SD7 A;  1I27 A;  1O3Q A;  2RGV A;  1IW7 F;  4ETS A;  2CYY A;  2ADU A;  2Y0M A;  4A2U A;  4YG2 F;  4OIQ F;  3KP3 A;  2F5D A;  2VBW A;  2B0L A;  4CZZ A;  1B4A A;  1W7P D;  1FP1 D;  2EV6 A;  3LST A;  4IXA A;  2NS0 A;  2E1N A;  3LA3 A;  3KZZ A;  5BOX A;  2LF7 A;  4L18 B;  1UHW A;  1FP2 A;  1TTY A;  1R1T A;  3IC7 A;  4ZH4 F;  3HTU A;  3TGN A;  3ZQ7 A;  1ZRC A;  3HRU A;  1SAX A;  2GA2 A;  4QLC U;  3WOD F;  2MBF A;  2WC2 A;  5E20 A;  2MH9 A;  2K27 A;  3WU1 B;  1BC8 C;  2K4J A;  2KIU A;  2LDU A;  3HHH A;  4IVN A;  4ENJ A;  1HW2 A;  3LQQ A;  3ISP A;  2HYF A;  1YS6 A;  1I5Z A;  1IXC A;  3TO9 A;  3WTY C;  3V8J A;  1G3T A;  2KRF A;  2IJL A;  2OZ6 A;  4ESB A;  5E17 F;  1XSX A;  5KVR A;  5LGN A;  2D1H A;  3IHU A;  4KN7 X;  1E17 A;  4Q48 A;  3HIF A;  2LF8 A;  2GAU A;  4PCQ A;  3CUQ C;  3KLN A;  5FFX A;  4OIO F;  5CLS A;  1MGT A;  2A61 A;  3M7G A;  1LEB A;  5BPI A;  5HS8 A;  2D2W A;  1BIB A;  3HUG A;  4BH9 A;  2BV6 A;  3V7C A;  4KMF A;  1MJB A;  2EFP A;  1TQP A;  2P5V A;  1ZRE A;  1TBX A;  2A68 F;  1W7P A;  3SXY A;  4OU0 A;  4RAZ A;  4HLX A;  3ZMV A;  5L3G A;  1XGM A;  3IWF A;  4L9N A;  4BHP A;  1FSH A;  2IA1 A;  1R23 A;  4MEY F;  4R8H A;  1STZ A;  1B1B A;  3T0Y A;  1D8K A;  1FX7 A;  1B9N A;  3DPL C;  1RZ4 A;  1S7A A;  4IJA A;  4OMZ A;  2HDC A;  4RGU A;  1J5Y A;  3CUQ B;  1AOY A;  2Z99 A;  1ZG3 A;  1O3R A;  1YW9 A;  5CVI A;  4HV5 A;  1UB9 A;  2VBX A;  2QEN A;  3QAH A;  2E7X A;  3W6K B;  1T6S A;  3GFL A;  1EH8 A;  2BEO A;  1R5H A;  4M9X A;  3NRV A;  3G73 A;  3COA C;  4LLG F;  4FX4 A;  1B59 A;  1SMY F;  3WTU C;  3MFK A;  5H6Q A;  4G8X A;  3R6S A;  4G7O F;  1BM9 A;  2F5F A;  3MEX A;  3ELK A;  2MC3 A;  4HDV A;  2STW A;  1YYV A;  2V79 A;  5KK1 A;  1OYI A;  4S05 A;  3FF5 A;  5IT9 Z;  3D0S A;  3P9C A;  2X4H A;  4XSZ F;  2DW4 A;  3R60 A;  3U1D A;  4OIN F;  2XIG A;  2VE9 A;  1FT9 A;  3VOE A;  4KMU X;  1ZYR F;  1KGS A;  3TOB A;  2FMY A;  5E18 F;  3J81 K;  3J7A O;  1S3J A;  1QPM A;  5L3C A;  2ETH A;  2EFN A;  1ZAR A;  2WV0 A;  1YFH A;  2QLZ A;  5JVT A;  1XD7 A;  4EJW A;  2UXX A;  2BYV E;  2DAO A;  5D6F A;  2F2E A;  3MQ0 A;  1U8R A;  5DD4 A;  2QQB A;  2OA4 A;  4YII A;  3QP5 A;  3FZV A;  2DQL A;  1IXR C;  3GO5 A;  2EJR A;  4KN4 X;  2BE5 F;  2ZCW A;  3SHF A;  3L09 A;  2XAH A;  1I6X A;  4NB5 A;  5TJJ A;  2HR3 A;  4Z2Y A;  4IHT A;  2DT5 A;  4JQF A;  1KA8 A;  2FNA A;  5HLI A;  3K0L A;  3PQK A;  2ZME A;  3TOA A;  2WTE A;  3KLO A;  2UWM A;  3KFW X;  5DV5 A;  4IRH A;  2PQ8 A;  3J80 Z;  1MDM B;  3J80 K;  4L0Y B;  1TW2 A;  3BPV A;  4AVP A;  1E2X A;  2XUB A;  1XMA A;  3BOQ A;  2A5Y B;  1XDU A;  2VC0 A;  1U3E M;  4U88 A;  1L0O C;  5TRD A;  2OAZ A;  3D5L A;  1XGO A;  3BRO A;  2XGX A;  2M8E A;  2FBK A;  4FT8 A;  5JFR A;  3MAJ A;  1T2K A;  5CYV A;  2Q8K A;  2V6C A;  2PMU A;  2ISY A;  3LA7 A;  3KP6 A;  1RUO A;  3ZMS A;  3F8B A;  4WXD A;  3KZY A;  4XRF A;  1S7O A;  5BQT A;  3VOD A;  3F3X A;  1XCV A;  1U6G A;  2FA5 A;  1XDS A;  1ZRF A;  2IT0 A;  2DO7 A;  4RB1 A;  3MZH A;  3BY6 A;  2O0Y A;  3FX3 A;  1J75 A;  1W4M A;  2KKO A;  3WTS C;  1FC3 A;  1FY7 A;  3J81 Z;  2BGC A;  3E5X A;  1W5T A;  4ZYE A;  3N97 A;  2A6H F;  3RKX A;  3TDU C;  5FD5 A;  2CW0 F;  1WQ2 A;  2IA2 A;  3MCZ A;  2DK5 A;  4P5O A;  2O8X A;  3U9G A;  2WWY A;  4WXC A;  3ABT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...