2HZTA

Crystal structure of a putative hth-type transcriptional regulator ytcd
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
95
Chain Sequence
MSLVEATLEVIGGKWKVILHLTHGKKRTSELKRLMPNITQKMLTQQLRELEADGVINRIVYNQVPPKVEYELSEYGRSLEGILDMLAWGANHINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative HTH-type transcriptional regulator ytcD
publication title Crystal Structure of a putative HTH-type transcription regulator ytcD
rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 23
structure length 95
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hztA00
2QBYB 4WX9A 2VN2A 3LQRA 4LLLA 2VXZA 2YU3A 3FWEA 4EMSA 1EV7A 1HQCA 2RV8A 3BJOA 2OQGA 1LQ1A 1ZG5A 4BQAA 2E7WA 4G9YA 2A6EF 1RZ4A 2O0YA 3FM5A 5HVQC 1ZRFA 5ERIA 5IT3A 3RPUA 4ENNA 2VODA 3FMQA 2G7UA 3DKWA 5DD4A 4UHTA 5FO5A 3WTZA 3J81K 5BMZA 4B8XA 2F5DA 2V1DA 4BH9A 2Q8KA 1ZREA 3E5UA 1FLIA 5E1XA 2ZBKA 3KP3A 1BC8C 1HKQA 3PQKA 4P5OA 3IL2A 3GW2A 3BOQA 3WTVC 2CYYA 3VB2A 5DEQA 1Y0UA 2K27A 4EJVA 2ZNZA 2RGVA 4HLYA 4CGZA 3O3KA 1CGPA 2IVMA 2MA3A 1FT9A 1HSTA 4A6EA 3P9IA 4P9FA 1VTNC 6PAXA 3E5QA 5JI6A 2L02A 2Q0OA 4KN4X 1PP7U 5JHUA 2CO5A 1G4DA 4G6DA 5FB2A 4A0ZA 3SZTA 4L9JA 1H0MA 2M30A 3HOSA 4LB5A 1FP1D 3RTRA 1R1TA 3P9CA 2K86A 1P4WA 1I27A 4HF0A 3V7RA 2AS5F 2QYOA 4S05A 5ICCA 5DV5A 4HQMA 3C7JA 4UV8A 1EH8A 4AWXB 3BZ6A 1J0RA 4UNOA 3MQ0A 2EFOA 1U5TC 3TOAA 2MBFA 3LA3A 2X4HA 1OYWA 2ZJ2A 1FP2A 5DD8A 1WKMA 3FF5A 3TO6A 3HRTA 3NEUA 2EV0A 2G9WA 4MEXF 2HZTA 3TGNA 2GXBA 1R00A 1U3EM 1P2FA 5CVVA 5ICGA 2V6CA 2NNNA 3OOPA 2EWNA 3JAMZ 4MTEA 2UZKA 2ESNA 4G94A 1FBUA 2HQRA 1ZH5A 1RUNA 1BIAA 2HS5A 3QP6A 3SHFA 5L3BA 2XIGA 2KJBA 2XKPA 5DCFA 4KUMA 1XN7A 3CO6C 2BEOA 4KIBA 4XBFA 3JTHA 4U0WA 2D1VA 2MLGA 2HTJA 4IVNA 5K5OA 1V3FA 4RS8A 4ON0A 2YX4A 3KLOA 3F6OA 3PFIA 3GEZA 3KZYA 3JW4A 1JHHA 2LF8A 3CJNA 1FX7A 3KETA 1DDNA 2E1NA 3H3UA 2W24A 1L0OC 4OIRF 1FYMA 3E5XA 2QBYA 2VOOA 4JK1X 5E17F 3K1MA 4A6DA 1STZA 1KYWA 2B0LA 3F6VA 5E18F 2A5YB 4A12A 1XB4A 1T38A 2AXLA 2Z9OA 4IRIA 5EEGA 2FF4A 2V1UA 4HLXA 1SFUA 1O3QA 1JXSA 3LAPA 1P92A 3V8KA 1PUEE 2GQQA 1V4RA 2DW4A 4IHTA 1MJ9A 3HHHA 1XGNA 3BP8A 2ZXJA 5ILUA 2JPBA 4UVCA 4EQQA 2DFIA 3SXYA 4HV6A 4A2UA 2A6HF 3REOA 3F72A 3F8NA 1IN4A 4LG0B 2Q2EA 2WV0A 4U7BA 1ZGAA 3SZPA 4IXAA 3WTUC 2QWWA 2ETHA 3WTTC 1LDJA 5HLIA 2RKHA 2UXNA 1UFMA 3QU6A 1BC7C 2ZFWA 1BI3A 2QQBA 2K4JA 5A2QK 1LEBA 3GF2A 5LEJA 1LNWA 3EDPA 4HA8A 2P7CB 5FGMA 4ZYDA 2QLZA 3RJPA 2GXGA 4DQ2A 3LQQA 1ZRDA 3R4KA 3WGIA 1KGSA 4RGRA 1G3WA 2FNAA 3RYRA 2ZCWA 4KIGA 1XCBA 1QNTA 3D0SA 2LSOA 1KQ8A 4Y17A 3GVAA 3HRUA 1J75A 1G3SA 3F3XA 3P9KA 2PN6A 3Q9SA 5LRSA 5K1YA 4RGUA 3BROA 1IZ1A 1GXPA 4EJTA 5FLXK 2DPUA 1SD6A 4U0VA 2COMA 2W84A 2TDXA 3IHUA 3B02A 3TDUC 4I0BA 3FMRA 4WXHA 2CG4A 3BPXA 1KU3A 2DTRA 1Z91A 1WRJA 2CW0F 5LHGA 4KFCA 5DCMB 3V7SA 3CO7C 3F8MA 3JSOA 2KJCA 2PMHA 4KN7X 5DUKA 2JT1A 3BY6A 5LBQA 1KU9A 2PLYA 1HXDA 1TLHB 2NYXA 2JZYA 2P4WA 3SQNA 5L3FA 3KCCA 4M6XA 1IXCA 4QLCU 3ECOA 2H27A 1OYYA 1XSVA 4EVIA 2M8EA 1EH7A 4L5JA 1K79A 2EV5A 2PI0A 2KRFA 4A0YA 5FD6A 5HLGA 2PMUA 3C18A 4MQ9F 3RI4A 2XAJA 2XASA 4AD9A 2F5EA 4HQEA 3WTSC 2DK5A 5IT9K 4ZH4F 4ZZDA 1KQ0A 1QO0D 2FMLA 1J59A 1TQIA 3MZYA 4L9TA 3T8RA 2XRNA 3ZPLA 2KIUA 2FA5A 3MWMA 4N0BA 4CDGA 2R3SA 2A3SA 3COAC 3NRVA 2DU9A 5L3EA 4GYGA 3L7WA 5D8LB 5ILSA 4WCGA 3HHGA 1QGPA 1HW2A 4GXOA 4LG0A 1RNLA 2WTEA 5CVIA 3FXUA 1DUXC 5LEKA 1GXQA 1TNSA 2BYVE 2H94A 4H0EA 4CO8A 3EQLF 2STTA 2YX7A 1R1UA 2RN7A 4OMZA 2IA0A 2GA1A 3TO9A 4HX4A 1U6GA 3DV8A 5AONA 3O6BB 3I58A 2PG4A 3V8JA 2IA2A 3KP2A 4WK8F 1F9NA 4D0PA 1R1VA 3V4GA 2CQKA 4NB5A 1U8RA 3TQNA 3F23A 2CWEA 5ED4A 1W7PD 1ZRCA 2W57A 1HW1A 5LLQA 1MDMB 3FXRA 4LFUA 5LHIA 4KDPA 4LGWA 5D6FA 3K0LA 4KYWA 2O61A 4G7OF 5F6FA 4HF1A 3I71A 4UV9A 4L9NA 5DDGA 4HDUA 2D1HA 1BI2A 2ISZA 2YR2A 1HKTA 1B4AA 2ESHA 3H3ZA 4LB6B 1HW5A 1I6XA 1MKMA 4Y15A 5HOOA 4IF4A 4ZYEA 1KU2A 3M1EA 2J5OA 2G7HA 2IRFG 4FX4A 2HQNA 1J2XA 3K1NA 1R36A 4I98B 4OIQF 1XGOA 2FNPA 2FMYA 4FX0A 4N9IA 2X0LA 3KP7A 2O3FA 4I02A 5E20A 5DCMA 4YFNF 1LVAA 1SFXA 2HYFA 1IXRC 4WF2A 3MZHA 5D6EA 1IAWA 4M9XA 2Z5UA 4I2OA 5FD5A 1E17A 2EB7A 2F5CA 3F8BA 4P9UA 4EJWA 1FWZA 3KLNA 1ODDA 4DNCA 5E8IA 1SFEA 2CSOA 4EJUA 5LGNA 1SD7A 2HR3A 4HAMA 3RDIA 2GA2A 2PEXA 4WXDA 1W5SA 1JGSA 2PQ8A 1XCVA 2GIVA 3GFMA 2ACJA 4FT8A 3QPTA 3R0AA 1XGMA 2F2EA 5AIQA 1IW7F 2VBWA 4CICA 1YTYA 2RNJA 2A69F 1TQMA 1REPC 2EA4A 5CVUA 1O3TA 2L01A 2KIMA 4XSXF 5F64A 1S7AA 4R1HA 3GZ5A 2DPDA 1FC3A 1C0WA 4CXFA 3ML6A 1GVJA 1TW3A 3TDZC 1G3YA 1QBJA 4YIFA 3G73A 1FSEA 4CZZA 1U5TA 5HDGA 1IXSB 1G6NA 1X3UA 2IJLA 4MNUA 2EFNA 3GWZA 4EM2A 3QPHA 3ABTA 2QZ8A 4HZFA 2JPCA 1PDNC 3M8EA 3KFWX 4ESFA 5J6XA 3GX4X 1FPQA 3BWGA 3V8LA 2DAOA 2PBIA 1BJAA 2D45A 4BHBA 1LDDA 4CHUA 2VE8A 5J8FA 4NQWA 5D5WB 2XVCA 3ABUA 2IT0A 3WE2A 4M9SA 1YW9A 2DBBA 4I7HA 2P6TA 4MTDA 2Y0MA 2IW5A 1MDMA 5CVRA 1F1ZA 1BIBA 3FXQA 2M45A 1UHMA 1ULYA 1IUYA 1LDKB 1HSJA 5HS8A 1S6LA 3DPTA 3ULQB 1UB9A 3SFZA 3HSFA 3L9FA 3J7AO 3T1BA 5JR3A 3K2ZA 2WWYA 5HDNA 4G8XA 2Z33A 1FSHA 1RI7A 3IWFA 2EFQA 1HBXG 2DI3A 4RAYA 1ON1A 2UXXA 5BOXA 1AOYA 4AIKA 4LK1F 3HRSA 4E70A 2A07F 2OQRA 4Z2YA 2Z3YA 3C1DA 3GUDA 3HSRA 5EEHA 2VT2A 3EETA 2ELHA 2FBIA 4BAYA 5D5VB 4ETSA 5K5RA 2JSCA 4RB3C 1ZYRF 3J80Z 3KP5A 1O7LA 1IRGA 1D8KA 3BPVA 3S2WA 1P4AA 1B6AA 1YIOA 4KIFA 3IWZA 4BNCA 3WU0A 1Z6TA 1J9IA 4RAZA 3FMSA 4PDKA 3MFKA 2XAHA 3Q5FA 4RGSA 4MQVA 4M6YA 2FRHA 3WG9A 2K7LA 2VOPA 3LAJA 3E6DA 5JFRA 3K9TA 4HX8A 4KMFA 3WTWC 3WU1B 3JAMK 5HS9A 2VC0A 3ELKA 1W7PB 4MGRA 3IKTA 1T0FA 2ZNYA 4HV5A 4LLNA 5H20A 3ZN1A 4R79A 2QQAA 3RKYA 2M87A 1ON2A 2P7VB 1O57A 1IN8A 2KKOA 3Q9VA 2VBYA 2OU2A 3I64A 2O8XA 3KEQA 5BS6A 4RB1A 2XAQA 3R0JA 4YIIA 3GO5A 1S7OA 3TOBA 1CF7B 3QOPA 4MHGA 3I0TA 1DP7P 5TRDA 1SD4A 1EH6A 2XGXA 2K4BA 2EJRA 1LB2A 2MH2A 3EUHA 4OOIA 1SMYF 2VBXA 2QUFA 2J5PA 3R60A 3WGGA 1KYZA 2ZO4A 3PQJA 3L2CA 1TW2A 4GO1A 4OINF 2KIFA 4KICA 3QRFF 4EGZA 2P6SA 3P7NA 1F5TA 3U1DA 3J81Z 3ZMUA 5DYMA 4UVBA 3KEOA 1B59A 2L4AA 5E8GA 4PCQA 4EJOA 4M72A 1YS6A 3WODF 2V9VA 3BJ6A 4UXNA 2W85A 1B9MA 2OZUA 1BBYA 2FU4A 3VFZA 2XROA 4OIOF 3ERED 2NNYA 4LJZF 5LGTA 1W5TA 3WE3A 5ILVA 4U7DA 3D5LA 4L9VA 1ZLKA 5FFXA 4XLNF 2WC2A 3O2PE 4QWQA 4RB2C 1FBSA 1OKRA 1LEAA 2L3DA 1YQAA 4P55A 4L0YB 2M5WA 1IN6A 2ZKZA 4N9HA 4IPAA 3EYIA 3ZMTA 3DXJF 1K78B 2FXAA 1YW7A 3WTYC 3HTSB 2OBPA 5JVTA 2D2WA 5BPIA 4ZYHA 4EM0B 4EV0A 2C6YA 5E1WA 2A68F 3LWFA 1SAXA 1WWXA 5CLSA 4KA4A 4OIPF 1D5VA 1ONVA 1H9GA 2P8TA 4JQFA 1YS7A 4M74A 2PJPA 2JTVA 3HIFA 1U78A 2XAGA 3N97A 2FE3A 1YLFA 1IN7A 2VC1A 4IRGA 4I0AA 3T8TA 1D8JA 3T0YA 3RYPA 4R8HA 1XDSA 5CJ9A 1FNNA 3HTUA 5CVJA 3TO7A 4F7ZA 3GFIA 5H6QA 3K1PA 1S3JA 3HYIA 1O3SA 2HEOA 3WGHA 1QQIA 2JRTA 2OA4A 1YG2A 2MH9A 3CUOA 4HX7A 1ZLJA 4L5IA 1T98A 4P96A 2BV6A 4EM1A 1SD5A 1P6RA 1XSXA 2BBYA 2O03A 4Q47A 3JSPA 3E3VA 3F8CA 1I1GA 4L0ZB 2VE9A 4GGGA 4PGHA 4A5NA 4Y13A 5D4SA 4YFKF 1H9TA 1B9NA 1XMAA 3ECHA 1ZG3A 1XDUA 4KT5C 1CF7A 3GFLA 3B73A 3LFKA 3R61A 2F5FA 3CUQB 3MCZA 3K69A 1UCRA 3CDHA 4TV7A 5HS7A 5D5UB 1U2WA 4A5MA 2RDPA 2CFXA 3MEXA 4UVAA 2FOKA 1R5GA 5ICEA 1MJAA 4S04A 4PZJA 1F4KA 1XGSA 2FEZA 1O3RA 1I5ZA 3NQOA 2OD5A 2YPRA 1AWCA 1XMKA 3L00A 3IRQA 4HDVA 1I1SA 4AVPA 4RGXA 2GWRA 1FY7A 3GFJA 2K02A 5E1ZB 1Z05A 2HFHA 5D8KB 5ICFA 1S8NA 3VEPA 2CGPA 4YFXF 2QVOA 1KQ9A 2QQ9A 1OMIA 2LDUA 4KNYA 4O3MA 3RPQA 3VODA 3C3WA 3ZMSA 2HYGD 4ESJA 3ZMVA 3ZQ7A 4ZYGA 2HKOA 2MC3A 4L18B 1ZGJA 3DPLC 3KP4A 1T39A 1WSUA 4G6QA 4M71A 4BHPA 3L09A 3W6KB 1YFHA 4ENJA 1IF1A 2EFWA 3BDDA 2R7FA 4IRHA 3EYYA 1R22A 4B09A 1OYIA 2EK5A 1K78A 2LKPA 4U88A 5A2QZ 3I53A 3FX3A 2XHKA 5D5XB 1Z1DA 3DP7A 5L3GA 3CLOA 5CYVA 3MAJA 3LSTA 2OAZA 4Q5SF 2VBZA 2DLLA 4XLPF 2UWMA 1MZBA 3E6CC 4GCVA 3QP5A 2ZMEB 4ZZLA 1BM9A 1R58A 2L54A 4IJAA 3DQVC 3M7GA 2HKXA 3FM3A 1K6OA 1IN5A 4RB0A 3GXOA 3HUGA 1O7FA 1S29A 3OV8A 3G3ZA 1BN5A 5L3DA 2EV6A 5KK1A 5FLXZ 3GYHX 3T5XA 3CUQC 3DF8A 4LD5A 3F22A 2ADUA 4BXUA 1OPCA 2DT5A 1KA8A 4G7HF 1Z7UA 4MEYF 1MGTA 3GLXA 4AIHA 3IC7A 2PFBA 2Y75A 4U0YA 2O6GE 2MLKA 5HLHA 1YW8A 1RIOH 1ZAOA 1FBQA 4O6JA 5BPDA 2M1BA 2DK8A 5L3CA 1L3LA 1XSDA 2EA2A 1BOAA 5BQTA 2HTSA 4OU0A 1FOKA 4AIJA 2E7XA 2P5LC 4GYIA 4I09A 3RIRA 3CUQA 3HSEA 4ENKA 2NS0A 2GZWA 2HDCA 1JE8A 2IA1A 2MD5A 2LNBA 2EFPA 2BE5F 2NAZA 3TKYA 3ZN0A 4WWCA 2W25A 3I59B 4A0XA 4YG2F 3QU3A 2HWVA 3AAFA 1TQPA 2DO7A 4WXCA 4G7ZF 5IT9Z 2DQLA 1ZARA 1QZYA 4PGGA 2Y48A 2QENA 3ZP5A 4JBAA 4ESBA 4I01A 3RKWA 3M9AA 1DPUA 2FSWA 4ENMA 3F8FA 5KVRA 1RUOA 1W4MA 2V79A 4M73A 1MJBA 1HKSA 3DFGA 1LJ9A 1ZHFA 3I5UA 3FZVA 1USTA 1R23A 4HOBA 2YSRA 3IRRA 1D3YA 2LF7A 2ISYA 1TBXA 4Q48A 2H6BA 2XUBA 4HYEA 3LA2A 3IKVA 1DPRA 2HOEA 2VT3A 4O5VA 5DUIA 3DEUA 3QAHA 4ASNA 1SMTA 2H6CA 2FQ3A 1Z9CA 5AIPA 1P4XA 2OZ6A 1FYKA 1T6SA 4OMYA 5FFZA 2XAFA 1A04A 2GAUA 1YO5C 2V1XA 4UUVA 2NRAC 5TJJA 1QPMA 2P5VA 2ZMEA 3W6JB 3M8FA 2Z99A 3WTXC 3HOTA 4HBLA 2QM3A 1J7KA 2FBHA 3E97A 1FYLA 3JTGA 4FHTA 2RQPA 3VOEA 1GHCA 3I4PA 2E1CA 1B1BA 3I54A 4NHJA 3FHZA 1QZZA 4HW0A 2R7DA 1BI1A 1NHAA 2RC4A 2IPQX 1USSA 5F1RA 3KP6A 5LHHA 2H09A 3F21A 3ISPA 4BHCA 2VONA 3KZZA 3E6MA 3H92A 5D4RA 4LLGF 1R7JA 3BJAA 1Z6RA 1ZN2A 3ZMDA 4M9ZA 2FBKA 1YYVA 3GZ6A 1MD0A 5J8CA 4HF2A 1K7AA 3U9GA 2P5KA 4KMUX 2L4MA 3J80K 5K5QA 1OR7A 1UHWA 2XV4S 4Q4ZF 1KU7A 3V7CA 2IP2A 4XSZF 2XKOA 4LK0F 2A61A 5LGUA 3I59A 3U2RA 1BI0A 1T2KA 3CTAA 3ROUA 1WQ2A 2RVCA 3RKXA 3N4MA 1G3TA 1XD7A 4XRFA 2STWA 3R6SA 1TNTA 2BGCA 1U5TB 3HRMA 3LA7A 1E2XA 4CYDA 2HGCA 4LMYA 1R5HA 3ZMZA 5HDKA 1JHFA 4K2EA 4EGYA 4BYYA 4IHSA 2DQRA 1IRFA 3KE2A 1WI9A 1Q1HA 5H6RA 1FZPB 1J5YA 5LRRA 1TTYA 1W7PA 3E6BA 1PP8F 1ZG1A
chains in the Genus database with same CATH superfamily
2QBYB 2BY0A 4WX9A 4E4HA 4PJLA 2VN2A 3LQRA 4LLLA 1S5LC 2VXZA 2X1CA 3LSGA 2YU3A 3FWEA 1Z77A 1IG7A 2MSYA 2HDDA 4EMSA 1EV7A 1HQCA 3Q0WA 3PSIA 2RV8A 3BJOA 3L2UA 5EZGA 1X2NA 3VPRA 2OQGA 4QTRA 1LQ1A 1ZG5A 4BQAA 2ELJA 1PUFB 1GV2A 4YIRX 2E7WA 3KEYA 4XM3A 5CPRB 4G9YA 4C3JJ 1MNMC 2A6EF 1RZ4A 2O0YA 3FM5A 4YEJA 5HVQC 5GAEJ 1ZRFA 5ERIA 3HPGA 3RPUA 5IT3A 2HZDA 4ENNA 2VODA 1FMWA 4H4KC 3FMQA 2G7UA 2V1NA 3DKWA 5DD4A 4UHTA 2GOXB 5FO5A 3WTZA 3J81K 5BMZA 3EUKL 5F1JA 4B8XA 5DS9A 1WI3A 2F5DA 2V1DA 4BH9A 1T95A 2Q8KA 3ZQLA 1ZREA 2H8RA 2KP6A 4G12A 3E5UA 3M07A 4D5CA 1FLIA 1HOMA 4PSXA 3ZQQA 5E1XA 2XPWA 2ZBKA 2X1EA 3KP3A 1BC8C 1HKQA 3PQKA 4P5OA 2ELKA 3IL2A 3GW2A 3BOQA 3WHBA 3WTVC 2CYYA 3VB2A 5DEQA 1Y0UA 2K27A 2DMPA 2ZNZA 4XK4A 4EJVA 4F52A 4ZTJA 1YRNB 4M3EA 2RGVA 1ZR4A 1VQOI 1Z67A 2X51A 4HLYA 4CGZA 3OR1C 3O3KA 1CGPA 3LOCA 2IVMA 4XLEA 2MA3A 1FT9A 1HSTA 1V55H 1FOWA 4A6EA 2DFEA 3P9IA 3A0BC 3L2WA 4P9FA 4X6AJ 1VTNC 4PSWA 6PAXA 2EINH 2FX0A 3E5QA 2L02A 5JI6A 2Q0OA 2DTZA 3KYDB 4KN4X 4JYKA 1PP7U 2LFBA 5JHUA 4E7LA 2CO5A 1XMXA 2L2OA 1G4DA 3RQ4A 3OYMA 4G6DA 4A0ZA 5FB2A 2OTJI 2E1MC 2F48A 3SZTA 1IGNA 4L9JA 1H0MA 2M30A 2CJJA 3I3LA 1UELB 3HOSA 1YJWI 1FP1D 4LB5A 3RTRA 1R1TA 3P9CA 2K86A 1P4WA 1I27A 4HF0A 3V7RA 2AS5F 2ID3A 5GTHC 3CP2A 1JTYA 4YELA 1G59A 2QYOA 2Y2ZA 4S05A 5ICCA 3OYBA 3CC2I 5DV5A 3PUFA 3WG7H 2MYSA 4XMYA 3HL2A 4HQMA 1OJLA 1RETA 3C7JA 1BA5A 4Y3OA 2F4OB 2QSGX 3LSJA 4UV8A 3NAUA 4XLCA 1JTXA 3BCBA 1R4NB 2NS7A 1EH8A 1H8AC 4AWXB 3F9KA 3BZ6A 1AHDP 1J0RA 4UNOA 3MQ0A 2EFOA 1U5TC 5J3LA 1XC5A 2DDBA 2MBFA 3LA3A 3TOAA 2X4HA 1OYWA 2ZJ2A 1FP2A 5DD8A 1WKMA 3FF5A 3QYFA 3TO6A 4A69C 3HRTA 3NEUA 3S2DJ 2Z2SB 2EV0A 3FKJA 2G9WA 1IO2A 4MEXF 2KMUA 2HZTA 3TGNA 4BACA 2GXBA 1K83J 1D1CA 1GLNA 1R00A 2ID6A 1BR4A 1U3EM 1P2FA 1FJLA 5CVVA 1WJBA 4HSTA 3RZDJ 5ICGA 2V6CA 2NNNA 3OOPA 2EWNA 4NC7A 4CA0A 3ZQFA 3JAMZ 3BG7A 4MTEA 2UZKA 2ESNA 4G94A 1FBUA 2HQRA 1ZH5A 3W6VA 1RUNA 1BIAA 2CQXA 2HS5A 3QP6A 3OL4A 4RLFA 3SHFA 5JLWA 2QGUA 5L3BA 2XIGA 1DP3A 2KJBA 2XKPA 5DCFA 2KDZA 2LBFA 2JA8J 4KUMA 3DEEA 2L5QA 3SFIA 1XN7A 3CO6C 2BEOA 4KIBA 3I55I 4XBFA 2ZSIB 3CP8A 3F0CA 3JTHA 3K4CA 4U0WA 2D1VA 4AM3A 2MLGA 2HTJA 4IVNA 5K5OA 3ZQGA 1B8IB 1V3FA 1MBJA 3A2KA 3C2GA 4RS8A 4HEA2 3PO3J 3W2VA 3SYTA 4ON0A 2YX4A 3KLOA 3F6OA 4HNUA 2BXZA 3OIOA 4Y33A 3PFIA 3GEZA 4XR6A 3GTPJ 1QZEA 1X1PA 3KZYA 1A31A 2M8GX 3JW4A 1JHHA 2DMQA 2LF8A 1D1BA 4CZCA 3CJNA 2R5YA 4M3GA 4ZJZA 1FX7A 3S1NJ 3KETA 2L7FP 4II3A 2R7VA 1DDNA 2E1NA 3H3UA 2W24A 1L0OC 1WJDA 4OIRF 1FYMA 3E5XA 2QBYA 2VOOA 4JK1X 2WA0A 5E17F 3K1MA 4A6DA 1STZA 1KYWA 2DODA 2B0LA 3F6VA 2DJIA 5E18F 2A5YB 4A12A 1WJEA 1XB4A 1T38A 3A0HC 5KNLA 2AXLA 2Z9OA 1PUFA 1MH4A 1VZ0A 1BW5A 2QQ8A 4BJ6C 4IRIA 5EEGA 5GP9A 4BBRJ 2FF4A 2V1UA 2KRCA 3BZCA 4HLXA 2KQRA 1HCRA 4M3FA 1SFUA 1O3QA 4PUSA 5F08A 1NK2P 1JXSA 3LAPA 1P92A 2EZKA 3IH4A 3V8KA 2IAIA 1BR2A 1PUEE 3HM5A 1ETKA 1AU7A 1ACIA 2GQQA 2LD5A 1V4RA 2DW4A 4BEHB 3RZOJ 4IHTA 1MJ9A 3HHHA 3AG4H 1JKPC 1XGNA 3BP8A 2ZXJA 1I39A 3HEFA 1FMVA 2M0MA 5ILUA 2JPBA 3A02A 4UVCA 4EQQA 2DFIA 3SXYA 4HV6A 4A2UA 3S2HJ 2LY2A 2A6HF 1RPWA 3WU2C 3REOA 2FJ1A 3F72A 5B1BH 3VYRB 3V42A 2EZIA 3F8NA 3JCUC 3A01B 3ASOH 1XG1A 2Z16A 1IN4A 4LG0B 3M4OJ 4DGWB 2Q2EA 3G1OA 2WV0A 3A03A 2HQAA 5FKKA 4U7BA 3CESA 1ZGAA 3EUAA 2M4KA 3H1CA 3SZPA 2JA5J 4BY7J 3U21A 1OLTA 3DWLE 4IXAA 4E7IA 4A3IJ 4XICA 1V5GA 3BR5A 3WTUC 2QWWA 1QPIA 2ETHA 1K6YA 2VI6A 3WTTC 1LDJA 5HLIA 2AQFA 2RKHA 3D1NI 2UXNA 2DJNA 3MKZA 1UFMA 4N4OB 3QU6A 1BC7C 5FRMA 2ZFWA 1BI3A 4B4CA 2QQBA 3FK6A 4FASD 2K4JA 2VQCA 5A2QK 2AQEA 1LEBA 1N78A 3GF2A 3SZGA 1MBFA 3D5RC 5LEJA 3DEWA 1LNWA 2R93J 4C3IJ 4NBQA 4BGDA 3EDPA 1VQKI 2Y9ZA 4HA8A 1BL0A 2P7CB 5FGMA 3BTJA 4ZYDA 2QLZA 3S17J 3RJPA 2GXGA 1MBHA 4DQ2A 3LQQA 1ZRDA 3R4KA 1W36C 3ZQIA 2R7UA 3WGIA 1KGSA 3Q0VA 2DN0A 4RGRA 1G3WA 2FNAA 3RYRA 4DBRA 2IGNA 2ZCWA 5JHFA 4XKVA 2GLOA 3OS2A 2CQQA 4X0GA 4KIGA 1XCBA 1QNTA 3D0SA 4B43A 2NVXJ 2LSOA 2LC2A 2QKLB 1VQ6I 1KQ8A 4Y17A 3GVAA 2JVHA 3HRUA 1J75A 3FISA 1G3SA 3HOUJ 3CCLI 1D0YA 2COBA 3F3XA 4DJAA 3P9KA 3OOUA 2PN6A 3X2QH 5EDNA 1IC8A 3Q9SA 5LRSA 2GXAA 2TCTA 2IS4A 4J00A 5K1YA 2EH3A 2MC4A 4C30A 4RGUA 4LIVA 2W7NA 1ERDA 2M3AA 2OV7A 3BROA 1IZ1A 1GXPA 2ZB9A 4EJTA 1WZ2A 1T8IA 5FLXK 2DPUA 1SD6A 4PJJA 3BC8A 5LD2C 4U0VA 3BLYA 2COMA 2QSHX 4LG3A 3DBLB 5F0FA 2W84A 2TDXA 3IHUA 5M5XJ 2HYJA 3B02A 1R4MB 3TDUC 3SDGA 4I0BA 3FMRA 2ME6A 3BR2A 4WXHA 2CG4A 3BPXA 3BR1A 2X9DA 1KU3A 2DTRA 3PUBA 4LIUA 2OC6A 1Z91A 1WRJA 4XN0A 2CW0F 5LHGA 4KFCA 5DCMB 3K4NA 3V7SA 4B44A 3CO7C 2PJRB 3A4CA 3PFYA 3F8MA 3JSOA 2MG4A 2KJCA 4DZJA 2JA2A 2PMHA 4RMNA 4RAGA 4PFPA 2DA5A 3MKLA 2CU7A 4KN7X 4B47A 5DUKA 2JUCA 2JT1A 3BY6A 5LBQA 1KU9A 2CFOA 2ME0A 3L1PA 1HDDC 2VQLA 2PLYA 3CDLA 1X1DA 1I3QJ 1HXDA 2ZSHB 2EZLA 2E5NA 4YRVA 4A3LJ 1TLHB 3ZGKA 3HKZA 4IOCF 2L9SA 1XX5A 2NYXA 2JZYA 2P4WA 3SQNA 3TMOA 5L3FA 3KCCA 4M6XA 1IXCA 4CCMA 4QLCU 4BQQA 3ECOA 5HNHA 4BE0A 1B72B 2H27A 1OYYA 1XSVA 3SEQA 4E7SA 4HSRA 2M8EA 1EH7A 4EVIA 4MIMA 1Q1VA 4L5JA 1K79A 2EV5A 2PI0A 2KRFA 4A0YA 5FD6A 5HLGA 2PMUA 3C18A 4NC8A 4MQ9F 2K5CA 3RI4A 4NC6A 3QPLA 2K3PA 2DOEA 2XAJA 2XASA 4D9JA 4AD9A 2F5EA 1YOVB 3TBIA 4XORA 4HQEA 3WTSC 2DK5A 4XONA 2YU9J 3K70C 5IT9K 4FISA 4ZH4F 3ABKH 4ZZDA 4A3JJ 1KQ0A 5CQEA 2X6YA 1QO0D 2FMLA 1J59A 2M7BA 1TQIA 4MFDA 3MZYA 2DYRH 4L9TA 4B3XA 3M1CA 5EGOB 3T8RA 2V26A 3KYCB 2XRNA 2BHZA 1PJRA 3CF2A 4A3BJ 2I5UA 3ZPLA 3HOXJ 3QOEA 2KIUA 2FA5A 3MWMA 4N0BA 4CDGA 2R3SA 2A3SA 1S7EA 3COAC 1A36A 1I3AA 4PJMA 3JRHA 3NRVA 2DU9A 5L3EA 2Y0SN 4GYGA 3L7WA 1OCTC 5D8LB 5ILSA 4WCGA 4X1EA 1YITI 2O7OA 1XTAA 3FXMA 1A6QA 2CV0A 1IV6A 3HHGA 1UZCA 1QGPA 3QYEA 1HW2A 2K9MA 2JN6A 4GXOA 4LG0A 2NVTJ 1RNLA 2WTEA 3L2QA 5CVIA 3FXUA 2I10A 2Y69H 1DUXC 5LEKA 1TWCJ 1GXQA 1TNSA 1X3WB 3VSKA 2BYVE 3CC7I 2H94A 1SVLA 4CO8A 1Y8RB 2AHQA 4H0EA 3EQLF 2STTA 2YX7A 4A3FJ 2NVUB 2JK3A 1R1UA 3BTLA 1X1CA 1QVTA 1ETQA 4AIDA 2RN7A 3HDDA 4OMZA 2IA0A 5KHDA 2GA1A 3TO9A 4ITVA 2XF5A 4HX4A 1U6GA 1BW6A 2WAEA 1E0EA 3DV8A 5AONA 2DA1A 3O6BB 1JKOC 3I58A 1MNDA 2PG4A 3V8JA 1WH7A 2IA2A 1XPXA 2XGCA 3KP2A 4WK8F 5J4YA 3CMYA 1F9NA 2VKDA 2B63J 3PNTA 4D0PA 4BDZA 4FE4A 4BE1A 2E5ZA 1P7JA 1R1VA 3V4GA 2LMDA 2CQKA 2Y9YA 4KITB 4NB5A 5DTDA 3OYFA 2XPUA 4QSHA 1U8RA 3TQNA 4I6ZA 5E3LA 1VQPI 3LSMA 3F23A 4PFOA 2CWEA 5ED4A 1W7PD 4NNJA 3H9GA 1ZRCA 2W57A 4NUBA 1HW1A 5LLQA 3CCQI 4W1UA 1MDMB 3FXRA 3DU5A 4LFUA 5LHIA 4KDPA 2LR8A 4BBSJ 4LGWA 2VLAA 2DA6A 2E2IJ 5D6FA 3K0LA 2Z1DA 4KYWA 2O61A 2R7TA 5KCMA 4G7OF 5F6FA 4HF1A 2XDVA 3I71A 2R0QC 1YX5A 4UV9A 2FOWA 1R71A 3LFUA 1IDZA 2E1OA 5F0HA 2PMZA 4L9NA 5DDGA 4HDUA 2ZJRF 3H5AA 1SVOA 1X1BA 2D1HA 1BI2A 3RPUD 2ISZA 2YR2A 1HKTA 2LYCA 3OL3A 1B4AA 2ESHA 2GBYA 2LTPA 2L9VA 2F6CA 3H3ZA 4LB6B 2RNGA 3GLLA 2Y30A 2R7WA 1HW5A 1I6XA 2IS2A 1MKMA 4Y15A 5HOOA 4IF4A 3ONQA 3MZ8A 1RESA 4ZYEA 2E19A 1KU2A 3M1EA 2J5OA 4XQFA 2G7HA 2K9NA 4J19A 2IRFG 4FX4A 4PJNA 2HQNA 1J2XA 3GZNB 1LUJB 3H36A 1YX3A 1R36A 3K1NA 4I98B 4OIQF 4I99C 2F4MB 5C3EJ 4C2UA 1XGOA 1OCPA 3KPHA 2FNPA 3HGGA 2FMYA 4CCLA 4FX0A 4N9IA 3DKYA 2X0LA 2BY2A 3KP7A 1Y8QB 2O3FA 4I02A 4PK4A 5E20A 5DCMA 2RQQA 4YFNF 2CW8A 1LVAA 1SFXA 2HYFA 2L9NA 2WBMA 4B48A 1ITYA 1FEXA 1NH3A 1IXRC 1YIJI 4WF2A 3OYKA 2KFDA 3MZHA 5D6EA 2DMTA 3DU6A 1IAWA 4I76A 4M9XA 2VQGA 2Z5UA 5FKMA 4AUXA 4I2OA 5FD5A 1DU0A 3K4KA 4BXXJ 3I56I 2P0WA 1E17A 4RDUA 2EB7A 1FTZA 3CMAI 2F5CA 5FKNA 4E6KG 1MBGA 2FD5A 3F8BA 4P9UA 1VQ5I 4EJWA 3L2VA 1FWZA 4Y4RA 1B72A 2W82A 3KLNA 4A93J 1ODDA 1JKRC 4DNCA 5E8IA 1SFEA 5FLVA 1X4OA 5TGTA 4QIWN 2CSOA 2WV1A 4EJUA 4UY8I 3AG1H 5LGNA 1SD7A 2HR3A 4HAMA 3JR9A 3RDIA 2GA2A 3CDIA 4IHVA 2PEXA 4WXDA 2M7AA 3RSNA 2QCOA 1W5SA 3CJQB 2MABA 1OISA 1JGSA 2HQ5A 2PQ8A 1XCVA 4FCYA 2GIVA 3GFMA 2E2HJ 3G2BA 1K4SA 4KT6A 4EATA 2EBIA 2ACJA 2LH9A 1GDTA 1Y39A 1A35A 1FIAA 3UNGC 4FT8A 2BW3B 2LG4A 3QPTA 3R0AA 2IGKA 1XGMA 2F2EA 4DZPA 5AIQA 1IW7F 1AKHB 2JVGA 2VBWA 4CICA 2ECCA 1YTYA 2RNJA 1X3ZB 2LKSA 2A69F 5C4JJ 1TQMA 1REPC 2EA4A 5CVUA 4AU7A 1O3TA 2L01A 2KIMA 4XSXF 4IHXA 3W2AA 5F64A 1S7AA 2LY9A 4R1HA 5HLTA 3GZ5A 2HVQA 2DPDA 1S72I 2WY7Q 1FC3A 2L0KA 4BQOA 3BCAA 2DMNA 4CXFA 5EEAA 1C0WA 3FDYA 3ML6A 2AO9A 3HXLA 1GVJA 1TW3A 2OJED 3TDZC 3CMEI 1G3YA 1QBJA 1MH3A 1GVDA 4D7NA 4YIFA 3G73A 3FXOA 1FSEA 2KISA 3IH2A 4CZZA 3CCSI 2YUSA 1LFBA 1Z7LA 3G6EI 2XB0X 4D7MA 1U5TA 5HDGA 2X48A 5E3OA 1OFCX 4RLQA 1IXSB 1G6NA 3U1KA 1X3UA 1X2MA 1U8BA 2IJLA 4MNUA 2EFNA 2OCEA 3GWZA 4EM2A 3QPHA 4JOMA 3ABTA 5M5YJ 3S15J 2QZ8A 2LK2A 4HZFA 2DA7A 5H2FC 4KISA 2JPCA 1PDNC 3M8EA 2MD0A 1EKEA 2LREA 3KFWX 3IP4B 4ESFA 5IP6A 3PIOF 5J6XA 3HJEA 2W00A 2VXDA 3DCFA 2KIQA 3IAS2 2F4IA 1SFOJ 3ZR8X 3GX4X 3H35A 2DOFA 1HA8A 1FPQA 3BWGA 3V8LA 2DAOA 2PBIA 1BJAA 2D45A 4BHBA 1LDDA 3K10A 3MN2A 3BG6A 4CHUA 2V9PA 2VE8A 3H5NA 5J8FA 4NQWA 4Z6YA 5D5WB 3L2RA 2XVCA 2QF7A 3ABUA 2IT0A 3HOWJ 3WE2A 1D0ZA 1N25A 1YW9A 2DBBA 4M9SA 3JRGA 4I7HA 2P6TA 4MTDA 2Y0MA 2IW5A 3ZOBA 1MDMA 2EPFA 3Q0UA 2XSDC 5CVRA 1F1ZA 1BIBA 3FXQA 2M45A 2W1OA 1UHMA 1ULYA 1IUYA 2B9SA 3QQAA 3PIPF 1LDKB 3LSIA 2ZXIA 1HSJA 1UHSA 3H0DA 1MSEC 3I4MJ 3TL4X 3NARA 2WY8Q 3OSFA 5HS8A 1S6LA 4S0HB 1VQ4I 3DPTA 4F91B 3ULQB 1UB9A 3SFZA 3CLQA 3HSFA 3L9FA 2KZVA 2XB5A 4C9YA 1ZK8A 2WAFA 5CKTA 3J7AO 4A3GJ 3T1BA 5JR3A 1Z3YA 1DU6A 3K2ZA 4JX5A 2WWYA 3OYJA 3I4NJ 5HDNA 1AA7A 1A6IA 3TP0A 2XGDA 4G8XA 3BTIA 3IV5A 4MLOA 2JQ7A 2Z33A 1SAUA 1FSHA 4A3CJ 1RI7A 3IWFA 3RKQA 4A3DJ 2EFQA 1LVKA 3VWBA 3S32A 1HBXG 3SDBA 1GV5A 3OSGA 4OAYA 2DI3A 4RAYA 3GTOJ 5GAGJ 2HVRA 1ON1A 2UXXA 5BOXA 3S1MJ 1R6RA 4AIKA 4LK1F 1AOYA 3HRSA 3PO2J 1ETWA 2L7MP 4E70A 5GTIC 2A07F 1YRNA 3KIOA 4BU2A 2OQRA 4Z2YA 2Z3YA 3C1DA 2IS6A 3GUDA 3HSRA 4QPQA 4D5FA 5EF6A 3K2AA 4XLFA 5EEHA 3SEZA 1SC7A 2VT2A 3EETA 2ELHA 2NOJB 4XOPA 2FBIA 4BAYA 4A3EJ 5D5VB 2BOLA 4ETSA 1OCOH 3LSHA 2K9SA 2K9QA 4DW6A 3JRAA 2KLOA 5K5RA 3AKZA 9ANTA 2JSCA 1WJFA 4RB3C 2R7ZJ 1I6HJ 1ZYRF 5EZHA 2K9LA 2F5VA 2LOOA 3K6GA 3J80Z 3KP5A 1O7LA 1FOYA 1IRGA 1T0FC 2R4GA 2R5ZB 2A5WA 5E79C 1D8KA 5FROA 3BPVA 1WJ5A 5KAFC 3S2WA 1P4AA 2DFHA 5M5WJ 2VUMJ 3QYBA 1B6AA 4CYCB 1YIOA 2Q1ZB 1VQMI 4ANJA 1WH5A 4KIFA 3J7YJ 3IWZA 2HDWA 4BNCA 3WU0A 2HXIA 1Z6TA 1HLVA 1J9IA 1MMDA 2HPIA 4RAZA 3FMSA 4PDKA 2WAQN 4BE2A 2JRMA 3HC7A 3LL7A 4AYBN 3MFKA 2DA3A 2XAHA 1RR7A 2VKHA 1RC9A 4LOCA 3Q5FA 4IHWA 4RGSA 1D0XA 1RKWA 3CF5F 4MQVA 4M6YA 2FRHA 4ZC3A 3WG9A 2E60A 2K7LA 2VOPA 3EUHC 3LAJA 3NWSA 3E6DA 3UR3C 1Y6IA 1RKTA 3K9TA 4HX8A 1NTCA 2X6WA 4RA2A 5JFRA 4KMFA 3GTQJ 3MMYB 3WTWC 3JAMK 3WU1B 5HS9A 1TWHJ 2CW7A 1MBEA 2VC0A 1W7PB 3ELKA 4MGRA 3IKTA 3VYUB 4A3KJ 4D1QA 1T0FA 3HPHA 4XRSG 2ZNYA 2KZGA 4HV5A 5H20A 4LLNA 3ZN1A 4ZYAA 5EJCA 4R79A 2BW3A 2QQAA 3RKYA 4BKXA 2M87A 1ON2A 2P7VB 2LRDA 2VJJA 1VQLI 3S1QJ 1O57A 1IN8A 2L7KA 2KKOA 3Q9VA 3PNYA 2V7FA 2VBYA 2DMUA 1TC3C 2OU2A 3I64A 2E36A 2O8XA 3I9V2 1DGRM 3KEQA 5BS6A 3OS0A 3JRIA 4RB1A 3OWTA 2XAQA 3R0JA 3H9QA 2VKEA 4YIIA 3GO5A 1S7OA 3TOBA 1CF7B 2B7EA 3QOPA 4MHGA 3I0TA 1DP7P 5TRDA 1SD4A 4F92B 3CC4I 1MW7A 1EH6A 1ETVA 2YS9A 2XGXA 2K4BA 2EJRA 1LB2A 2MH2A 3AG2H 2V4JC 4EEFG 1JJ8C 3EUHA 2BY1A 4OOIA 1SMYF 2VBXA 2QUFA 2WB1N 2J5PA 2O5RA 1W36D 3R60A 3WGGA 1KYZA 2ZO4A 3PQJA 3L2CA 1TW2A 4GO1A 4OINF 2KIFA 5HODA 4C2TA 3DPUA 4XKCA 4KICA 5K7HA 2I8DA 3B6CA 1W1WE 5IP9J 1B8IA 1LPQA 3GTKJ 3DTKA 3QRFF 4EGZA 2P6SA 3P7NA 1F5TA 2LVSA 1QHHD 3U1DA 4CH7A 1D1AA 3J81Z 5M3FJ 2JUGA 1NG6A 1YI2I 2NOGA 4DIQA 3ZMUA 5DYMA 2CV2A 4UVBA 2M2EA 2XAUA 2GOMA 3KEOA 1B59A 2AXTC 2L4AA 5E8GA 4PCQA 5CQGA 4EJOA 2HXOA 4M72A 3CCUI 1YS6A 5JLXA 2CUEA 2DT7B 3WODF 1ZTRA 2QEXI 1UAAA 2V9VA 3BJ6A 4UXNA 2W85A 1B9MA 5B3SH 3BT9A 2OZUA 2HNHA 1BBYA 2FU4A 3VFZA 2XROA 4OIOF 3ERED 3S3OA 5IP7J 1MSFC 2NNYA 2CQ7A 4LJZF 4DYRA 5LGTA 1W5TA 3PNVA 3W3CA 5HNFA 1T08B 3DBHB 1CQTA 3WE3A 3A1YA 3BQYA 5ILVA 4U7DA 3D5LA 4L9VA 1VQNI 1ZLKA 3LSKA 2M4GA 4HNTA 3UKGA 2OPTA 5FFXA 2E2JJ 4XLNF 2WC2A 3O2PE 4OWRB 4QWQA 4RB2C 1JKQC 5IYBJ 1FBSA 1OKRA 1LEAA 2L3DA 1YQAA 4P55A 4L0YB 1ETOA 1X19A 5J47A 2M5WA 1IN6A 2ZKZA 4N9HA 1IJWC 4IX7A 4IPAA 3CMMA 1K61A 1UG0A 3ZMTA 3EYIA 1QHGA 2JA6J 1Z21A 2VQHA 3DXJF 2L7ZA 1T56A 4II2A 1E3OC 1K78B 2FXAA 1YW7A 3WTYC 4BEHA 3HTSB 1TT5B 2OBPA 4UUTA 2VL8A 5JVTA 2Y0SA 2D2WA 5GAHJ 3FKIJ 5BPIA 3MKYB 1DQUA 4DYQA 2P81A 4ZYHA 1WVRA 2M9HA 2XF6A 4EM0B 4EV0A 1JJ6C 2C6YA 5E1WA 3HOVJ 3OYGA 2A68F 3J7ZI 3HGYA 3O8GA 3CQZJ 3LWFA 2EIKH 4BQNA 3CJTB 2O8KA 1SAXA 2HOSA 1WWXA 1TT0A 5CLSA 5J1RA 4KA4A 2TRTA 3A01A 4OIPF 4HPQA 1D5VA 1OCRH 1ONVA 1H9GA 2P8TA 4JQFA 1YE9A 1MNEA 1YS7A 2RREA 4M74A 2PJPA 2JTVA 1VNDA 3HIFA 1U78A 2M0CA 2ZFUA 2XAGA 3TEDA 4JP0A 5B5EC 3N97A 2FE3A 1YLFA 1IV8A 1IN7A 2VC1A 2LLKA 3K70D 4IRGA 2R5ZA 4I0AA 2LBFB 3T8TA 1D8JA 5EG0B 3T0YA 1IUFA 3RYPA 4R8HA 5FKOA 3MKWB 1XDSA 5FKLA 2DFFA 3ESWB 5CJ9A 1FNNA 2CUJA 2CUFA 3FIWA 3HTUA 5CVJA 4CYCA 3TO7A 1WCMJ 4F7ZA 3MD2A 3GFIA 5H6QA 3K1PA 5B1AH 1S3JA 4BY1J 3KX2A 3PL8A 3HUGB 2K40A 3HYIA 5J1UA 1O3SA 3AL0B 2HEOA 3OYDA 3WGHA 5E3NA 3C2BA 1QQIA 2JRTA 2L9RA 2OA4A 1YG2A 2MH9A 3CUOA 4XOTA 4E7HA 4HX7A 1FIPA 1ZLJA 3BR0A 4IZZA 1V5FA 4L5IA 2X6XA 4UB6C 1T98A 2CUZA 3FXLA 3ZCOA 1WGXA 4IOAF 1YJNI 2R5YB 3HOYJ 4P96A 2BV6A 2XSJC 4EM1A 2H1KA 4J01A 1SD5A 1P6RA 3FXJA 4XKWA 5B66C 5IPAA 1XSXA 2BBYA 1RR8C 1JUPA 2O03A 3HG9A 4Q47A 4M6VA 1Y1VJ 3JSPA 4IKFA 1JUSA 1NG7A 3OMYA 2R7XA 4DBQA 4IQ4A 3E3VA 5DM6F 3F8CA 2KT0A 1I1GA 1KONA 1U0JA 2VE9A 4GGGA 4PGHA 4L0ZB 4A5NA 1POGA 2BHYA 3QPSA 4Y13A 5D4SA 4YFKF 1H9TA 2XPVA 1B9NA 1XMAA 3ECHA 1ZG3A 1LE8B 1XDUA 3ZRGA 4E7JA 4KT5C 2VJIA 1CF7A 3BR3A 2VB6A 3GFLA 1QVUA 3B73A 3LFKA 4FQGA 2PMZN 3JRFA 4JX6A 3R61A 2F5FA 3CUQB 3OYHA 2JMWA 3MCZA 1ENHA 2M34A 2NVQJ 2KRHA 1DGWY 1FTTA 4BUPA 3MVPA 3K69A 3J7AY 1UCRA 3CDHA 3FBNB 4TV7A 1IDYA 5HS7A 5D5UB 1U2WA 3FK7A 4A5MA 1W0UA 5IOYA 2RDPA 3RCOA 3FHNA 2CFXA 3DTIA 4XLHA 1MMSA 1E3HA 3FXKA 1MMNA 3GTGJ 3MEXA 1N75A 2PJRA 4UVAA 2FOKA 1R5GA 1EJ9A 5ICEA 3M8JA 1MJAA 4S04A 4PZJA 1F4KA 1XGSA 2FEZA 3HB9A 3M3YJ 1V54H 1O3RA 2HI3A 5LFAA 1I5ZA 3NQOA 2OD5A 2YPRA 1AWCA 1XMKA 2UUZA 3ZQHA 1QA6A 3L00A 4ZTFA 3IRQA 4HDVA 1I1SA 4AVPA 3EPZA 3G4SI 4RGXA 2Q2EB 2GWRA 4QPOA 2DDAA 1FY7A 3DLLF 3H3VK 3GFJA 2K02A 4CCKA 4Y7NJ 3BG5A 5E1ZB 1Z05A 2HU9A 4FTHA 2HFHA 2OCCH 1U9NA 5D8KB 5ICFA 1S8NA 2CH0A 3VEPA 4V19K 2CGPA 4YFXF 2QVOA 4XRSA 1KQ9A 2QQ9A 1OMIA 3H9JA 2LDUA 2V6EA 3ABMH 4KNYA 4O3MA 2PX9A 3GBGA 4HG2A 3RPQA 2JJ7A 3VODA 5J1YA 2EILH 3C3WA 3ZMSA 3CCRI 2HYGD 4ESJA 3ZMVA 3ZQ7A 4ZYGA 1EF4A 2HKOA 2MC3A 4L18B 1ZGJA 3DPLC 2XRLA 3FBIB 3KP4A 2VPLA 1T39A 1X1AA 1WSUA 4G6QA 4M71A 4BHPA 3L09A 4U87A 3W6KB 1LKXA 2VPRA 1YFHA 1IRZA 2K3FA 4ENJA 2BVMA 2N8GA 1IF1A 1V5EA 2EFWA 5EGOA 2A6TA 3N05A 3BDDA 2R7FA 4IRHA 3EYYA 3K4MA 1R22A 1OYIA 2EK5A 4B09A 1F36A 1K78A 2LKPA 2NS8A 2MW8A 3OYIA 4U88A 5A2QZ 2O9LA 3I53A 1LFPA 3BZKA 3CJRB 3FX3A 2XHKA 4N4NB 2ZXHA 1MMAA 1VQ8I 5D5XB 1Z1DA 3AL0C 3SJMA 2LP0A 2BZTA 3DP7A 4M3DA 5L3GA 4IO9F 2R7OA 3CLOA 2WADA 5CYVA 5F0CA 2RAEA 2E35A 3MAJA 3LSTA 3ERMA 4XRMA 2OAZA 4Q5SF 2VBZA 3CCEI 2DLLA 4XLPF 3VDXA 2FQ4A 2UWMA 1MZBA 1ORKA 3E6CC 4GCVA 2IEKA 3QP5A 3AG3H 2X6OA 2ZMEB 4ZZLA 1BM9A 4E7KA 1R58A 3VSLA 5EG0A 1XS9A 2L54A 4KJZA 4FE7A 4IJAA 5F04A 1SEUA 4ZDLA 2QSFX 3DQVC 3M7GA 2HKXA 1BOBA 3FM3A 1ZQ3P 3PSFA 4W97A 1ETXA 4BJTA 3JRDA 1A5JA 1K6OA 5FRNA 3CCJI 1IN5A 3HZJA 4RB0A 5IYDJ 1TWFJ 3GXOA 3OYCA 3HUGA 1O7FA 1S29A 1VI0A 3OV8A 1J09A 3G3ZA 1BN5A 5L3DA 2EV6A 5FLMJ 1MMGA 5KK1A 4AC0A 5FLXZ 2OTLI 4F3QA 3GYHX 2MFZA 4UUSB 3T5XA 4XN3A 4IQJA 3E0JB 3CUQC 2ZJPF 3JRBA 3DF8A 4LD5A 3F22A 2ADUA 2EIMH 3O8HA 4BXUA 1OPCA 4HRIA 3GCMA 2DT5A 1KA8A 4G7HF 1Z7UA 4MEYF 2LKXA 1MGTA 3GLXA 4MO7A 4AIHA 3IC7A 3GTMJ 2PFBA 1JUMA 4CUGA 2Y75A 4U0YA 2O6GE 2MLKA 5GPCA 1ZKGA 2EIJH 1YW8A 3S93A 5HLHA 1RIOH 3GMEA 4P1WA 5F27A 2JWTA 1ZAOA 1FBQA 4O6JA 5BPDA 3G1MA 4RBOA 3K4LA 3H5RA 2M1BA 2DK8A 5L3CA 5C44J 2DYSH 1L3LA 2HPMA 1XSDA 2EA2A 2KHMA 1SANA 1SFKA 3TW6A 3AFHA 1UG2A 1RRJA 4BDYA 2HOTA 3OYEA 2X1DA 3K4JA 3LSPA 1BOAA 2EZHA 1TWGJ 2A05A 5BQTA 1LE8A 1R49A 1D5YA 2DA4A 1YJ9I 2H8WA 2HTSA 4OU0A 1FOKA 5GADJ 3VYTB 4AIJA 2R92J 2E7XA 2P5LC 2IBDA 2VKVA 1ZGWA 1JGGA 4GYIA 3BR6A 4I09A 1YHQI 3RIRA 3CUQA 3HSEA 4ENKA 2NS0A 1H89C 2GZWA 2W48A 3OYAA 2HDCA 1JE8A 2FUG2 2IA1A 4RM2A 4XL9A 2R7SA 3G71I 2MD5A 2LNBA 3HOZJ 2EFPA 2OUMA 3NWTA 1QU3A 2BE5F 1P9QC 3B6AA 2DCEA 3OY9A 2D5VA 2NAZA 3TKYA 4IL6C 3ZN0A 4WWCA 4V2FA 2W25A 3I59B 4FETA 1JT0A 3BQZA 4A0XA 2VJ5A 4YG2F 3QU3A 2HWVA 1BR1A 5IYCJ 2NXNB 2BXYA 4Y52J 2E34A 3AAFA 2QKMB 1TQPA 4GDFA 2DO7A 4WXCA 3OIPA 4G7ZF 1NK3P 5IT9Z 2DQLA 1ZARA 3IUOA 1QZYA 3PM1A 4PGGA 2XF7A 2Y48A 1VF9A 2QENA 3ZP5A 4JBAA 1IRXA 4ESBA 4I01A 1F43A 3RKWA 2BVLA 2CV1A 1TWAJ 3M9AA 1OQYA 4IEJA 1DPUA 2FSWA 1MIJA 1W0TA 2DT6A 1FOXA 4ENMA 4CCJA 5IY5H 1VFCA 3H0GJ 3F8FA 2WAQA 4E7ZA 4V2GA 4AYBA 5KVRA 1RUOA 3K4BA 3KZIC 3LMMA 1W4MA 3S14J 2QA4I 2V79A 4M73A 2GM4A 3QWLA 1MJBA 4GRIA 1HKSA 3DFGA 1LJ9A 2KDOA 5J40A 3BG3A 5FJ8J 4IHYA 3E7LA 3RQIA 1MBKA 1Z0XA 1ZHFA 3I5UA 4DYCA 3FZVA 4B3AA 1USTA 4LITA 1G8XA 4BL0B 1R23A 2CQNA 4HOBA 1KZHA 2YSRA 3TP3A 3HBLA 3KYLA 1GUUA 2ZMEC 3IRRA 1D3YA 4ABZA 2LF7A 2ISYA 3JRCA 3P5JA 1OCZH 1TBXA 1AKHA 3CZ6A 4Q48A 1TP4A 2H1LA 3S8PA 2H6BA 2OF7A 2XUBA 3DBRB 3LSRA 2R7RA 4UB8C 1WFXA 4HYEA 3LA2A 4GFBA 3IKVA 4ZDOA 2W4SA 1M1EB 1DPRA 1VQ9I 2GIZA 2HOEA 2VT3A 4O5VA 3JREA 1UMQA 1R5ID 5DUIA 3DEUA 5M3MJ 3QAHA 4ASNA 1HC8A 3K7AJ 4JX4A 1SMTA 4ZDPA 2H6CA 2FQ3A 3QODA 3TW7A 1Z9CA 2WB1A 4F55A 3DTEA 5AIPA 1P4XA 3OS1A 3VYSB 2OZ6A 1FYKA 1T6SA 4L5EA 4OMYA 2ZC2A 5FFZA 5K7ZA 2XAFA 1LFUP 1A04A 2GAUA 1YO5C 2V1XA 2VIXA 2CS3A 4AVZA 4UUVA 2NRAC 5TISC 4C3HJ 4CCOA 5TJJA 1WHUA 5IOZA 2JSPA 1GT0C 1QPMA 2P5VA 2ZMEA 1W5CC 3W6JB 1X58A 1T33A 3DKXA 3M8FA 1WJCA 2Z99A 2HOAA 3WTXC 3HOTA 1QRYA 4HBLA 2QM3A 1J7KA 1X4PA 3W2WA 3BG9A 2DOAA 3ZQCA 2JA7J 2FBHA 3E97A 1FYLA 3JTGA 4FHTA 2VJ4A 2RQPA 3VOEA 1GHCA 3I4PA 1TL8A 2E1CA 1TZLA 3D5SC 3OYLA 1O4XA 1B1BA 4RM3A 5C4XJ 2KPMA 2V9KA 4UUSA 3I54A 4NHJA 3FHZA 1QZZA 1OR7C 4HW0A 2R7DA 2UV1A 1BI1A 1NHAA 2RC4A 2IPQX 1I50J 3OYNA 4NDLA 1H88C 4XNFA 3C2HA 1PYVA 3IAM2 1USSA 3CCMI 1BJZA 3HKZN 1PVEA 1G2HA 5F1RA 4XKBA 3S1RJ 2BY3A 5KAIC 3KP6A 1ZR2A 2G0EA 3OR2C 5LHHA 2H09A 3ISPA 3F21A 4BHCA 2VONA 3KZZA 3E6MA 2IGMA 2HVSA 1P7IA 2KL4A 3PJRA 3H92A 5E3MA 1APLC 5D4RA 5DM7F 4PJ0C 3ZXSA 1Y1WJ 4LLGF 1R7JA 3BJAA 5GPAA 1Z6RA 2CMPA 1ZN2A 1ETYA 4HNVA 3ZMDA 4F93B 1OCCH 3E1SA 4M9ZA 5EYRA 1UJ8A 2FBKA 1YYVA 3GZ6A 1MD0A 5J8CA 4HF2A 1K7AA 3S3NA 3U9GA 1Y56A 1HF0A 2P5KA 4KMUX 2L4MA 3J80K 3G1LA 5K5QA 3S16J 5BNGA 1E3PA 1OR7A 2E1MB 1WJAA 3BTCA 4BXFA 2IS1A 1UHWA 3GTJJ 2XV4S 1S9HA 4Q4ZF 2ZJQF 3CCVI 1N77A 1KU7A 1HDPA 1WPKA 3V7CA 1JT6A 3LNQA 2IP2A 1ZELA 2LY1A 4XSZF 2XKOA 4LK0F 2A61A 3DLAA 5LGUA 2XC7A 4XIDA 2MGQA 4BJ5C 3WHCA 1JI8A 2DA2A 3I59A 1Z3XA 3U2RA 1BI0A 1T2KA 3CTAA 3ROUA 4DOZA 1WQ2A 2RVCA 2X85A 3RKXA 3N4MA 1G3TA 4B1RA 4CSWA 1XD7A 5JVGF 4XRFA 3ASNH 2STWA 3R6SA 4A3MJ 2VASA 2R7QA 2K85A 1TNTA 2BGCA 3CD6I 4CCNA 2ICWG 2NVYJ 1U5TB 5K7FA 3HRMA 3LA7A 2EQRA 1Y0NA 1E2XA 5J4VA 4C2MJ 1K4TA 3IH3A 4CYDA 1SVMA 2HGCA 2Y31A 1R5HA 4LMYA 3CCYA 3ZMZA 5HDKA 3GTLJ 1JHFA 4K2EA 4EGYA 1U9OA 4BYYA 2XGEA 2IGOA 2CRGA 4MFEA 1VQ7I 4IHSA 2DQRA 3OIQA 3ABLH 4RAFA 4XLAA 1EA3A 1IRFA 3KE2A 1R9TJ 4OAZA 1WI9A 2ECBA 4BS9A 1Q1HA 5H6RA 4M3BA 3Q3SA 1FZPB 1J5YA 2E71A 5LRRA 1TTYA 1W7PA 4NQWB 2IXSA 3E6BA 4G6TB 2DXIA 1PP8F 2ZXWH 3S3MA 1ZG1A
chains in the Genus database with same CATH topology
2QBYB 4WX9A 2VN2A 3LQRA 4LLLA 2VXZA 2YU3A 3FWEA 4EMSA 1EV7A 1HQCA 2RV8A 3BJOA 2OQGA 1LQ1A 1ZG5A 4BQAA 2E7WA 4G9YA 2A6EF 1RZ4A 2O0YA 3FM5A 5HVQC 1ZRFA 5ERIA 5IT3A 3RPUA 4ENNA 2VODA 3FMQA 2G7UA 3DKWA 5DD4A 4UHTA 5FO5A 3WTZA 3J81K 5BMZA 4B8XA 2F5DA 2V1DA 4BH9A 2Q8KA 1ZREA 3E5UA 1FLIA 5E1XA 2ZBKA 3KP3A 1BC8C 1HKQA 3PQKA 4P5OA 3IL2A 3GW2A 3BOQA 3WTVC 2CYYA 3VB2A 5DEQA 1Y0UA 2K27A 4EJVA 2ZNZA 2RGVA 4HLYA 4CGZA 3O3KA 1CGPA 2IVMA 2MA3A 1FT9A 1HSTA 4A6EA 3P9IA 4P9FA 1VTNC 6PAXA 3E5QA 5JI6A 2L02A 2Q0OA 4KN4X 1PP7U 5JHUA 2CO5A 1G4DA 4G6DA 5FB2A 4A0ZA 3SZTA 4L9JA 1H0MA 2M30A 3HOSA 4LB5A 1FP1D 3RTRA 1R1TA 3P9CA 2K86A 1P4WA 1I27A 4HF0A 3V7RA 2AS5F 2QYOA 4S05A 5ICCA 5DV5A 4HQMA 3C7JA 4UV8A 1EH8A 4AWXB 3BZ6A 1J0RA 4UNOA 3MQ0A 2EFOA 1U5TC 3TOAA 2MBFA 3LA3A 2X4HA 1OYWA 2ZJ2A 1FP2A 5DD8A 1WKMA 3FF5A 3TO6A 3HRTA 3NEUA 2EV0A 2G9WA 4MEXF 2HZTA 3TGNA 2GXBA 1R00A 1U3EM 1P2FA 5CVVA 5ICGA 2V6CA 2NNNA 3OOPA 2EWNA 3JAMZ 4MTEA 2UZKA 2ESNA 4G94A 1FBUA 2HQRA 1ZH5A 1RUNA 1BIAA 2HS5A 3QP6A 3SHFA 5L3BA 2XIGA 2KJBA 2XKPA 5DCFA 4KUMA 1XN7A 3CO6C 2BEOA 4KIBA 4XBFA 3JTHA 4U0WA 2D1VA 2MLGA 2HTJA 4IVNA 5K5OA 1V3FA 4RS8A 4ON0A 2YX4A 3KLOA 3F6OA 3PFIA 3GEZA 3KZYA 3JW4A 1JHHA 2LF8A 3CJNA 1FX7A 3KETA 1DDNA 2E1NA 3H3UA 2W24A 1L0OC 4OIRF 1FYMA 3E5XA 2QBYA 2VOOA 4JK1X 5E17F 3K1MA 4A6DA 1STZA 1KYWA 2B0LA 3F6VA 5E18F 2A5YB 4A12A 1XB4A 1T38A 2AXLA 2Z9OA 4IRIA 5EEGA 2FF4A 2V1UA 4HLXA 1SFUA 1O3QA 1JXSA 3LAPA 1P92A 3V8KA 1PUEE 2GQQA 1V4RA 2DW4A 4IHTA 1MJ9A 3HHHA 1XGNA 3BP8A 2ZXJA 5ILUA 2JPBA 4UVCA 4EQQA 2DFIA 3SXYA 4HV6A 4A2UA 2A6HF 3REOA 3F72A 3F8NA 1IN4A 4LG0B 2Q2EA 2WV0A 4U7BA 1ZGAA 3SZPA 4IXAA 3WTUC 2QWWA 2ETHA 3WTTC 1LDJA 5HLIA 2RKHA 2UXNA 1UFMA 3QU6A 1BC7C 2ZFWA 1BI3A 2QQBA 2K4JA 5A2QK 1LEBA 3GF2A 5LEJA 1LNWA 3EDPA 4HA8A 2P7CB 5FGMA 4ZYDA 2QLZA 3RJPA 2GXGA 4DQ2A 3LQQA 1ZRDA 3R4KA 3WGIA 1KGSA 4RGRA 1G3WA 2FNAA 3RYRA 2ZCWA 4KIGA 1XCBA 1QNTA 3D0SA 2LSOA 1KQ8A 4Y17A 3GVAA 3HRUA 1J75A 1G3SA 3F3XA 3P9KA 2PN6A 3Q9SA 5LRSA 5K1YA 4RGUA 3BROA 1IZ1A 1GXPA 4EJTA 5FLXK 2DPUA 1SD6A 4U0VA 2COMA 2W84A 2TDXA 3IHUA 3B02A 3TDUC 4I0BA 3FMRA 4WXHA 2CG4A 3BPXA 1KU3A 2DTRA 1Z91A 1WRJA 2CW0F 5LHGA 4KFCA 5DCMB 3V7SA 3CO7C 3F8MA 3JSOA 2KJCA 2PMHA 4KN7X 5DUKA 2JT1A 3BY6A 5LBQA 1KU9A 2PLYA 1HXDA 1TLHB 2NYXA 2JZYA 2P4WA 3SQNA 5L3FA 3KCCA 4M6XA 1IXCA 4QLCU 3ECOA 2H27A 1OYYA 1XSVA 4EVIA 2M8EA 1EH7A 4L5JA 1K79A 2EV5A 2PI0A 2KRFA 4A0YA 5FD6A 5HLGA 2PMUA 3C18A 4MQ9F 3RI4A 2XAJA 2XASA 4AD9A 2F5EA 4HQEA 3WTSC 2DK5A 5IT9K 4ZH4F 4ZZDA 1KQ0A 1QO0D 2FMLA 1J59A 1TQIA 3MZYA 4L9TA 3T8RA 2XRNA 3ZPLA 2KIUA 2FA5A 3MWMA 4N0BA 4CDGA 2R3SA 2A3SA 3COAC 3NRVA 2DU9A 5L3EA 4GYGA 3L7WA 5D8LB 5ILSA 4WCGA 3HHGA 1QGPA 1HW2A 4GXOA 4LG0A 1RNLA 2WTEA 5CVIA 3FXUA 1DUXC 5LEKA 1GXQA 1TNSA 2BYVE 2H94A 4H0EA 4CO8A 3EQLF 2STTA 2YX7A 1R1UA 2RN7A 4OMZA 2IA0A 2GA1A 3TO9A 4HX4A 1U6GA 3DV8A 5AONA 3O6BB 3I58A 2PG4A 3V8JA 2IA2A 3KP2A 4WK8F 1F9NA 4D0PA 1R1VA 3V4GA 2CQKA 4NB5A 1U8RA 3TQNA 3F23A 2CWEA 5ED4A 1W7PD 1ZRCA 2W57A 1HW1A 5LLQA 1MDMB 3FXRA 4LFUA 5LHIA 4KDPA 4LGWA 5D6FA 3K0LA 4KYWA 2O61A 4G7OF 5F6FA 4HF1A 3I71A 4UV9A 4L9NA 5DDGA 4HDUA 2D1HA 1BI2A 2ISZA 2YR2A 1HKTA 1B4AA 2ESHA 3H3ZA 4LB6B 1HW5A 1I6XA 1MKMA 4Y15A 5HOOA 4IF4A 4ZYEA 1KU2A 3M1EA 2J5OA 2G7HA 2IRFG 4FX4A 2HQNA 1J2XA 3K1NA 1R36A 4I98B 4OIQF 1XGOA 2FNPA 2FMYA 4FX0A 4N9IA 2X0LA 3KP7A 2O3FA 4I02A 5E20A 5DCMA 4YFNF 1LVAA 1SFXA 2HYFA 1IXRC 4WF2A 3MZHA 5D6EA 1IAWA 4M9XA 2Z5UA 4I2OA 5FD5A 1E17A 2EB7A 2F5CA 3F8BA 4P9UA 4EJWA 1FWZA 3KLNA 1ODDA 4DNCA 5E8IA 1SFEA 2CSOA 4EJUA 5LGNA 1SD7A 2HR3A 4HAMA 3RDIA 2GA2A 2PEXA 4WXDA 1W5SA 1JGSA 2PQ8A 1XCVA 2GIVA 3GFMA 2ACJA 4FT8A 3QPTA 3R0AA 1XGMA 2F2EA 5AIQA 1IW7F 2VBWA 4CICA 1YTYA 2RNJA 2A69F 1TQMA 1REPC 2EA4A 5CVUA 1O3TA 2L01A 2KIMA 4XSXF 5F64A 1S7AA 4R1HA 3GZ5A 2DPDA 1FC3A 1C0WA 4CXFA 3ML6A 1GVJA 1TW3A 3TDZC 1G3YA 1QBJA 4YIFA 3G73A 1FSEA 4CZZA 1U5TA 5HDGA 1IXSB 1G6NA 1X3UA 2IJLA 4MNUA 2EFNA 3GWZA 4EM2A 3QPHA 3ABTA 2QZ8A 4HZFA 2JPCA 1PDNC 3M8EA 3KFWX 4ESFA 5J6XA 3GX4X 1FPQA 3BWGA 3V8LA 2DAOA 2PBIA 1BJAA 2D45A 4BHBA 1LDDA 4CHUA 2VE8A 5J8FA 4NQWA 5D5WB 2XVCA 3ABUA 2IT0A 3WE2A 4M9SA 1YW9A 2DBBA 4I7HA 2P6TA 4MTDA 2Y0MA 2IW5A 1MDMA 5CVRA 1F1ZA 1BIBA 3FXQA 2M45A 1UHMA 1ULYA 1IUYA 1LDKB 1HSJA 5HS8A 1S6LA 3DPTA 3ULQB 1UB9A 3SFZA 3HSFA 3L9FA 3J7AO 3T1BA 5JR3A 3K2ZA 2WWYA 5HDNA 4G8XA 2Z33A 1FSHA 1RI7A 3IWFA 2EFQA 1HBXG 2DI3A 4RAYA 1ON1A 2UXXA 5BOXA 1AOYA 4AIKA 4LK1F 3HRSA 4E70A 2A07F 2OQRA 4Z2YA 2Z3YA 3C1DA 3GUDA 3HSRA 5EEHA 2VT2A 3EETA 2ELHA 2FBIA 4BAYA 5D5VB 4ETSA 5K5RA 2JSCA 4RB3C 1ZYRF 3J80Z 3KP5A 1O7LA 1IRGA 1D8KA 3BPVA 3S2WA 1P4AA 1B6AA 1YIOA 4KIFA 3IWZA 4BNCA 3WU0A 1Z6TA 1J9IA 4RAZA 3FMSA 4PDKA 3MFKA 2XAHA 3Q5FA 4RGSA 4MQVA 4M6YA 2FRHA 3WG9A 2K7LA 2VOPA 3LAJA 3E6DA 5JFRA 3K9TA 4HX8A 4KMFA 3WTWC 3WU1B 3JAMK 5HS9A 2VC0A 3ELKA 1W7PB 4MGRA 3IKTA 1T0FA 2ZNYA 4HV5A 4LLNA 5H20A 3ZN1A 4R79A 2QQAA 3RKYA 2M87A 1ON2A 2P7VB 1O57A 1IN8A 2KKOA 3Q9VA 2VBYA 2OU2A 3I64A 2O8XA 3KEQA 5BS6A 4RB1A 2XAQA 3R0JA 4YIIA 3GO5A 1S7OA 3TOBA 1CF7B 3QOPA 4MHGA 3I0TA 1DP7P 5TRDA 1SD4A 1EH6A 2XGXA 2K4BA 2EJRA 1LB2A 2MH2A 3EUHA 4OOIA 1SMYF 2VBXA 2QUFA 2J5PA 3R60A 3WGGA 1KYZA 2ZO4A 3PQJA 3L2CA 1TW2A 4GO1A 4OINF 2KIFA 4KICA 3QRFF 4EGZA 2P6SA 3P7NA 1F5TA 3U1DA 3J81Z 3ZMUA 5DYMA 4UVBA 3KEOA 1B59A 2L4AA 5E8GA 4PCQA 4EJOA 4M72A 1YS6A 3WODF 2V9VA 3BJ6A 4UXNA 2W85A 1B9MA 2OZUA 1BBYA 2FU4A 3VFZA 2XROA 4OIOF 3ERED 2NNYA 4LJZF 5LGTA 1W5TA 3WE3A 5ILVA 4U7DA 3D5LA 4L9VA 1ZLKA 5FFXA 4XLNF 2WC2A 3O2PE 4QWQA 4RB2C 1FBSA 1OKRA 1LEAA 2L3DA 1YQAA 4P55A 4L0YB 2M5WA 1IN6A 2ZKZA 4N9HA 4IPAA 3EYIA 3ZMTA 3DXJF 1K78B 2FXAA 1YW7A 3WTYC 3HTSB 2OBPA 5JVTA 2D2WA 5BPIA 4ZYHA 4EM0B 4EV0A 2C6YA 5E1WA 2A68F 3LWFA 1SAXA 1WWXA 5CLSA 4KA4A 4OIPF 1D5VA 1ONVA 1H9GA 2P8TA 4JQFA 1YS7A 4M74A 2PJPA 2JTVA 3HIFA 1U78A 2XAGA 3N97A 2FE3A 1YLFA 1IN7A 2VC1A 4IRGA 4I0AA 3T8TA 1D8JA 3T0YA 3RYPA 4R8HA 1XDSA 5CJ9A 1FNNA 3HTUA 5CVJA 3TO7A 4F7ZA 3GFIA 5H6QA 3K1PA 1S3JA 3HYIA 1O3SA 2HEOA 3WGHA 1QQIA 2JRTA 2OA4A 1YG2A 2MH9A 3CUOA 4HX7A 1ZLJA 4L5IA 1T98A 4P96A 2BV6A 4EM1A 1SD5A 1P6RA 1XSXA 2BBYA 2O03A 4Q47A 3JSPA 3E3VA 3F8CA 1I1GA 4L0ZB 2VE9A 4GGGA 4PGHA 4A5NA 4Y13A 5D4SA 4YFKF 1H9TA 1B9NA 1XMAA 3ECHA 1ZG3A 1XDUA 4KT5C 1CF7A 3GFLA 3B73A 3LFKA 3R61A 2F5FA 3CUQB 3MCZA 3K69A 1UCRA 3CDHA 4TV7A 5HS7A 5D5UB 1U2WA 4A5MA 2RDPA 2CFXA 3MEXA 4UVAA 2FOKA 1R5GA 5ICEA 1MJAA 4S04A 4PZJA 1F4KA 1XGSA 2FEZA 1O3RA 1I5ZA 3NQOA 2OD5A 2YPRA 1AWCA 1XMKA 3L00A 3IRQA 4HDVA 1I1SA 4AVPA 4RGXA 2GWRA 1FY7A 3GFJA 2K02A 5E1ZB 1Z05A 2HFHA 5D8KB 5ICFA 1S8NA 3VEPA 2CGPA 4YFXF 2QVOA 1KQ9A 2QQ9A 1OMIA 2LDUA 4KNYA 4O3MA 3RPQA 3VODA 3C3WA 3ZMSA 2HYGD 4ESJA 3ZMVA 3ZQ7A 4ZYGA 2HKOA 2MC3A 4L18B 1ZGJA 3DPLC 3KP4A 1T39A 1WSUA 4G6QA 4M71A 4BHPA 3L09A 3W6KB 1YFHA 4ENJA 1IF1A 2EFWA 3BDDA 2R7FA 4IRHA 3EYYA 1R22A 4B09A 1OYIA 2EK5A 1K78A 2LKPA 4U88A 5A2QZ 3I53A 3FX3A 2XHKA 5D5XB 1Z1DA 3DP7A 5L3GA 3CLOA 5CYVA 3MAJA 3LSTA 2OAZA 4Q5SF 2VBZA 2DLLA 4XLPF 2UWMA 1MZBA 3E6CC 4GCVA 3QP5A 2ZMEB 4ZZLA 1BM9A 1R58A 2L54A 4IJAA 3DQVC 3M7GA 2HKXA 3FM3A 1K6OA 1IN5A 4RB0A 3GXOA 3HUGA 1O7FA 1S29A 3OV8A 3G3ZA 1BN5A 5L3DA 2EV6A 5KK1A 5FLXZ 3GYHX 3T5XA 3CUQC 3DF8A 4LD5A 3F22A 2ADUA 4BXUA 1OPCA 2DT5A 1KA8A 4G7HF 1Z7UA 4MEYF 1MGTA 3GLXA 4AIHA 3IC7A 2PFBA 2Y75A 4U0YA 2O6GE 2MLKA 5HLHA 1YW8A 1RIOH 1ZAOA 1FBQA 4O6JA 5BPDA 2M1BA 2DK8A 5L3CA 1L3LA 1XSDA 2EA2A 1BOAA 5BQTA 2HTSA 4OU0A 1FOKA 4AIJA 2E7XA 2P5LC 4GYIA 4I09A 3RIRA 3CUQA 3HSEA 4ENKA 2NS0A 2GZWA 2HDCA 1JE8A 2IA1A 2MD5A 2LNBA 2EFPA 2BE5F 2NAZA 3TKYA 3ZN0A 4WWCA 2W25A 3I59B 4A0XA 4YG2F 3QU3A 2HWVA 3AAFA 1TQPA 2DO7A 4WXCA 4G7ZF 5IT9Z 2DQLA 1ZARA 1QZYA 4PGGA 2Y48A 2QENA 3ZP5A 4JBAA 4ESBA 4I01A 3RKWA 3M9AA 1DPUA 2FSWA 4ENMA 3F8FA 5KVRA 1RUOA 1W4MA 2V79A 4M73A 1MJBA 1HKSA 3DFGA 1LJ9A 1ZHFA 3I5UA 3FZVA 1USTA 1R23A 4HOBA 2YSRA 3IRRA 1D3YA 2LF7A 2ISYA 1TBXA 4Q48A 2H6BA 2XUBA 4HYEA 3LA2A 3IKVA 1DPRA 2HOEA 2VT3A 4O5VA 5DUIA 3DEUA 3QAHA 4ASNA 1SMTA 2H6CA 2FQ3A 1Z9CA 5AIPA 1P4XA 2OZ6A 1FYKA 1T6SA 4OMYA 5FFZA 2XAFA 1A04A 2GAUA 1YO5C 2V1XA 4UUVA 2NRAC 5TJJA 1QPMA 2P5VA 2ZMEA 3W6JB 3M8FA 2Z99A 3WTXC 3HOTA 4HBLA 2QM3A 1J7KA 2FBHA 3E97A 1FYLA 3JTGA 4FHTA 2RQPA 3VOEA 1GHCA 3I4PA 2E1CA 1B1BA 3I54A 4NHJA 3FHZA 1QZZA 4HW0A 2R7DA 1BI1A 1NHAA 2RC4A 2IPQX 1USSA 5F1RA 3KP6A 5LHHA 2H09A 3F21A 3ISPA 4BHCA 2VONA 3KZZA 3E6MA 3H92A 5D4RA 4LLGF 1R7JA 3BJAA 1Z6RA 1ZN2A 3ZMDA 4M9ZA 2FBKA 1YYVA 3GZ6A 1MD0A 5J8CA 4HF2A 1K7AA 3U9GA 2P5KA 4KMUX 2L4MA 3J80K 5K5QA 1OR7A 1UHWA 2XV4S 4Q4ZF 1KU7A 3V7CA 2IP2A 4XSZF 2XKOA 4LK0F 2A61A 5LGUA 3I59A 3U2RA 1BI0A 1T2KA 3CTAA 3ROUA 1WQ2A 2RVCA 3RKXA 3N4MA 1G3TA 1XD7A 4XRFA 2STWA 3R6SA 1TNTA 2BGCA 1U5TB 3HRMA 3LA7A 1E2XA 4CYDA 2HGCA 4LMYA 1R5HA 3ZMZA 5HDKA 1JHFA 4K2EA 4EGYA 4BYYA 4IHSA 2DQRA 1IRFA 3KE2A 1WI9A 1Q1HA 5H6RA 1FZPB 1J5YA 5LRRA 1TTYA 1W7PA 3E6BA 1PP8F 1ZG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QBY B;  4WX9 A;  2VN2 A;  3LQR A;  4LLL A;  2VXZ A;  2YU3 A;  3FWE A;  4EMS A;  1EV7 A;  1HQC A;  2RV8 A;  3BJO A;  2OQG A;  1LQ1 A;  1ZG5 A;  4BQA A;  2E7W A;  4G9Y A;  2A6E F;  1RZ4 A;  2O0Y A;  3FM5 A;  5HVQ C;  1ZRF A;  5ERI A;  5IT3 A;  3RPU A;  4ENN A;  2VOD A;  3FMQ A;  2G7U A;  3DKW A;  5DD4 A;  4UHT A;  5FO5 A;  3WTZ A;  3J81 K;  5BMZ A;  4B8X A;  2F5D A;  2V1D A;  4BH9 A;  2Q8K A;  1ZRE A;  3E5U A;  1FLI A;  5E1X A;  2ZBK A;  3KP3 A;  1BC8 C;  1HKQ A;  3PQK A;  4P5O A;  3IL2 A;  3GW2 A;  3BOQ A;  3WTV C;  2CYY A;  3VB2 A;  5DEQ A;  1Y0U A;  2K27 A;  4EJV A;  2ZNZ A;  2RGV A;  4HLY A;  4CGZ A;  3O3K A;  1CGP A;  2IVM A;  2MA3 A;  1FT9 A;  1HST A;  4A6E A;  3P9I A;  4P9F A;  1VTN C;  6PAX A;  3E5Q A;  5JI6 A;  2L02 A;  2Q0O A;  4KN4 X;  1PP7 U;  5JHU A;  2CO5 A;  1G4D A;  4G6D A;  5FB2 A;  4A0Z A;  3SZT A;  4L9J A;  1H0M A;  2M30 A;  3HOS A;  4LB5 A;  1FP1 D;  3RTR A;  1R1T A;  3P9C A;  2K86 A;  1P4W A;  1I27 A;  4HF0 A;  3V7R A;  2AS5 F;  2QYO A;  4S05 A;  5ICC A;  5DV5 A;  4HQM A;  3C7J A;  4UV8 A;  1EH8 A;  4AWX B;  3BZ6 A;  1J0R A;  4UNO A;  3MQ0 A;  2EFO A;  1U5T C;  3TOA A;  2MBF A;  3LA3 A;  2X4H A;  1OYW A;  2ZJ2 A;  1FP2 A;  5DD8 A;  1WKM A;  3FF5 A;  3TO6 A;  3HRT A;  3NEU A;  2EV0 A;  2G9W A;  4MEX F;  2HZT A;  3TGN A;  2GXB A;  1R00 A;  1U3E M;  1P2F A;  5CVV A;  5ICG A;  2V6C A;  2NNN A;  3OOP A;  2EWN A;  3JAM Z;  4MTE A;  2UZK A;  2ESN A;  4G94 A;  1FBU A;  2HQR A;  1ZH5 A;  1RUN A;  1BIA A;  2HS5 A;  3QP6 A;  3SHF A;  5L3B A;  2XIG A;  2KJB A;  2XKP A;  5DCF A;  4KUM A;  1XN7 A;  3CO6 C;  2BEO A;  4KIB A;  4XBF A;  3JTH A;  4U0W A;  2D1V A;  2MLG A;  2HTJ A;  4IVN A;  5K5O A;  1V3F A;  4RS8 A;  4ON0 A;  2YX4 A;  3KLO A;  3F6O A;  3PFI A;  3GEZ A;  3KZY A;  3JW4 A;  1JHH A;  2LF8 A;  3CJN A;  1FX7 A;  3KET A;  1DDN A;  2E1N A;  3H3U A;  2W24 A;  1L0O C;  4OIR F;  1FYM A;  3E5X A;  2QBY A;  2VOO A;  4JK1 X;  5E17 F;  3K1M A;  4A6D A;  1STZ A;  1KYW A;  2B0L A;  3F6V A;  5E18 F;  2A5Y B;  4A12 A;  1XB4 A;  1T38 A;  2AXL A;  2Z9O A;  4IRI A;  5EEG A;  2FF4 A;  2V1U A;  4HLX A;  1SFU A;  1O3Q A;  1JXS A;  3LAP A;  1P92 A;  3V8K A;  1PUE E;  2GQQ A;  1V4R A;  2DW4 A;  4IHT A;  1MJ9 A;  3HHH A;  1XGN A;  3BP8 A;  2ZXJ A;  5ILU A;  2JPB A;  4UVC A;  4EQQ A;  2DFI A;  3SXY A;  4HV6 A;  4A2U A;  2A6H F;  3REO A;  3F72 A;  3F8N A;  1IN4 A;  4LG0 B;  2Q2E A;  2WV0 A;  4U7B A;  1ZGA A;  3SZP A;  4IXA A;  3WTU C;  2QWW A;  2ETH A;  3WTT C;  1LDJ A;  5HLI A;  2RKH A;  2UXN A;  1UFM A;  3QU6 A;  1BC7 C;  2ZFW A;  1BI3 A;  2QQB A;  2K4J A;  5A2Q K;  1LEB A;  3GF2 A;  5LEJ A;  1LNW A;  3EDP A;  4HA8 A;  2P7C B;  5FGM A;  4ZYD A;  2QLZ A;  3RJP A;  2GXG A;  4DQ2 A;  3LQQ A;  1ZRD A;  3R4K A;  3WGI A;  1KGS A;  4RGR A;  1G3W A;  2FNA A;  3RYR A;  2ZCW A;  4KIG A;  1XCB A;  1QNT A;  3D0S A;  2LSO A;  1KQ8 A;  4Y17 A;  3GVA A;  3HRU A;  1J75 A;  1G3S A;  3F3X A;  3P9K A;  2PN6 A;  3Q9S A;  5LRS A;  5K1Y A;  4RGU A;  3BRO A;  1IZ1 A;  1GXP A;  4EJT A;  5FLX K;  2DPU A;  1SD6 A;  4U0V A;  2COM A;  2W84 A;  2TDX A;  3IHU A;  3B02 A;  3TDU C;  4I0B A;  3FMR A;  4WXH A;  2CG4 A;  3BPX A;  1KU3 A;  2DTR A;  1Z91 A;  1WRJ A;  2CW0 F;  5LHG A;  4KFC A;  5DCM B;  3V7S A;  3CO7 C;  3F8M A;  3JSO A;  2KJC A;  2PMH A;  4KN7 X;  5DUK A;  2JT1 A;  3BY6 A;  5LBQ A;  1KU9 A;  2PLY A;  1HXD A;  1TLH B;  2NYX A;  2JZY A;  2P4W A;  3SQN A;  5L3F A;  3KCC A;  4M6X A;  1IXC A;  4QLC U;  3ECO A;  2H27 A;  1OYY A;  1XSV A;  4EVI A;  2M8E A;  1EH7 A;  4L5J A;  1K79 A;  2EV5 A;  2PI0 A;  2KRF A;  4A0Y A;  5FD6 A;  5HLG A;  2PMU A;  3C18 A;  4MQ9 F;  3RI4 A;  2XAJ A;  2XAS A;  4AD9 A;  2F5E A;  4HQE A;  3WTS C;  2DK5 A;  5IT9 K;  4ZH4 F;  4ZZD A;  1KQ0 A;  1QO0 D;  2FML A;  1J59 A;  1TQI A;  3MZY A;  4L9T A;  3T8R A;  2XRN A;  3ZPL A;  2KIU A;  2FA5 A;  3MWM A;  4N0B A;  4CDG A;  2R3S A;  2A3S A;  3COA C;  3NRV A;  2DU9 A;  5L3E A;  4GYG A;  3L7W A;  5D8L B;  5ILS A;  4WCG A;  3HHG A;  1QGP A;  1HW2 A;  4GXO A;  4LG0 A;  1RNL A;  2WTE A;  5CVI A;  3FXU A;  1DUX C;  5LEK A;  1GXQ A;  1TNS A;  2BYV E;  2H94 A;  4H0E A;  4CO8 A;  3EQL F;  2STT A;  2YX7 A;  1R1U A;  2RN7 A;  4OMZ A;  2IA0 A;  2GA1 A;  3TO9 A;  4HX4 A;  1U6G A;  3DV8 A;  5AON A;  3O6B B;  3I58 A;  2PG4 A;  3V8J A;  2IA2 A;  3KP2 A;  4WK8 F;  1F9N A;  4D0P A;  1R1V A;  3V4G A;  2CQK A;  4NB5 A;  1U8R A;  3TQN A;  3F23 A;  2CWE A;  5ED4 A;  1W7P D;  1ZRC A;  2W57 A;  1HW1 A;  5LLQ A;  1MDM B;  3FXR A;  4LFU A;  5LHI A;  4KDP A;  4LGW A;  5D6F A;  3K0L A;  4KYW A;  2O61 A;  4G7O F;  5F6F A;  4HF1 A;  3I71 A;  4UV9 A;  4L9N A;  5DDG A;  4HDU A;  2D1H A;  1BI2 A;  2ISZ A;  2YR2 A;  1HKT A;  1B4A A;  2ESH A;  3H3Z A;  4LB6 B;  1HW5 A;  1I6X A;  1MKM A;  4Y15 A;  5HOO A;  4IF4 A;  4ZYE A;  1KU2 A;  3M1E A;  2J5O A;  2G7H A;  2IRF G;  4FX4 A;  2HQN A;  1J2X A;  3K1N A;  1R36 A;  4I98 B;  4OIQ F;  1XGO A;  2FNP A;  2FMY A;  4FX0 A;  4N9I A;  2X0L A;  3KP7 A;  2O3F A;  4I02 A;  5E20 A;  5DCM A;  4YFN F;  1LVA A;  1SFX A;  2HYF A;  1IXR C;  4WF2 A;  3MZH A;  5D6E A;  1IAW A;  4M9X A;  2Z5U A;  4I2O A;  5FD5 A;  1E17 A;  2EB7 A;  2F5C A;  3F8B A;  4P9U A;  4EJW A;  1FWZ A;  3KLN A;  1ODD A;  4DNC A;  5E8I A;  1SFE A;  2CSO A;  4EJU A;  5LGN A;  1SD7 A;  2HR3 A;  4HAM A;  3RDI A;  2GA2 A;  2PEX A;  4WXD A;  1W5S A;  1JGS A;  2PQ8 A;  1XCV A;  2GIV A;  3GFM A;  2ACJ A;  4FT8 A;  3QPT A;  3R0A A;  1XGM A;  2F2E A;  5AIQ A;  1IW7 F;  2VBW A;  4CIC A;  1YTY A;  2RNJ A;  2A69 F;  1TQM A;  1REP C;  2EA4 A;  5CVU A;  1O3T A;  2L01 A;  2KIM A;  4XSX F;  5F64 A;  1S7A A;  4R1H A;  3GZ5 A;  2DPD A;  1FC3 A;  1C0W A;  4CXF A;  3ML6 A;  1GVJ A;  1TW3 A;  3TDZ C;  1G3Y A;  1QBJ A;  4YIF A;  3G73 A;  1FSE A;  4CZZ A;  1U5T A;  5HDG A;  1IXS B;  1G6N A;  1X3U A;  2IJL A;  4MNU A;  2EFN A;  3GWZ A;  4EM2 A;  3QPH A;  3ABT A;  2QZ8 A;  4HZF A;  2JPC A;  1PDN C;  3M8E A;  3KFW X;  4ESF A;  5J6X A;  3GX4 X;  1FPQ A;  3BWG A;  3V8L A;  2DAO A;  2PBI A;  1BJA A;  2D45 A;  4BHB A;  1LDD A;  4CHU A;  2VE8 A;  5J8F A;  4NQW A;  5D5W B;  2XVC A;  3ABU A;  2IT0 A;  3WE2 A;  4M9S A;  1YW9 A;  2DBB A;  4I7H A;  2P6T A;  4MTD A;  2Y0M A;  2IW5 A;  1MDM A;  5CVR A;  1F1Z A;  1BIB A;  3FXQ A;  2M45 A;  1UHM A;  1ULY A;  1IUY A;  1LDK B;  1HSJ A;  5HS8 A;  1S6L A;  3DPT A;  3ULQ B;  1UB9 A;  3SFZ A;  3HSF A;  3L9F A;  3J7A O;  3T1B A;  5JR3 A;  3K2Z A;  2WWY A;  5HDN A;  4G8X A;  2Z33 A;  1FSH A;  1RI7 A;  3IWF A;  2EFQ A;  1HBX G;  2DI3 A;  4RAY A;  1ON1 A;  2UXX A;  5BOX A;  1AOY A;  4AIK A;  4LK1 F;  3HRS A;  4E70 A;  2A07 F;  2OQR A;  4Z2Y A;  2Z3Y A;  3C1D A;  3GUD A;  3HSR A;  5EEH A;  2VT2 A;  3EET A;  2ELH A;  2FBI A;  4BAY A;  5D5V B;  4ETS A;  5K5R A;  2JSC A;  4RB3 C;  1ZYR F;  3J80 Z;  3KP5 A;  1O7L A;  1IRG A;  1D8K A;  3BPV A;  3S2W A;  1P4A A;  1B6A A;  1YIO A;  4KIF A;  3IWZ A;  4BNC A;  3WU0 A;  1Z6T A;  1J9I A;  4RAZ A;  3FMS A;  4PDK A;  3MFK A;  2XAH A;  3Q5F A;  4RGS A;  4MQV A;  4M6Y A;  2FRH A;  3WG9 A;  2K7L A;  2VOP A;  3LAJ A;  3E6D A;  5JFR A;  3K9T A;  4HX8 A;  4KMF A;  3WTW C;  3WU1 B;  3JAM K;  5HS9 A;  2VC0 A;  3ELK A;  1W7P B;  4MGR A;  3IKT A;  1T0F A;  2ZNY A;  4HV5 A;  4LLN A;  5H20 A;  3ZN1 A;  4R79 A;  2QQA A;  3RKY A;  2M87 A;  1ON2 A;  2P7V B;  1O57 A;  1IN8 A;  2KKO A;  3Q9V A;  2VBY A;  2OU2 A;  3I64 A;  2O8X A;  3KEQ A;  5BS6 A;  4RB1 A;  2XAQ A;  3R0J A;  4YII A;  3GO5 A;  1S7O A;  3TOB A;  1CF7 B;  3QOP A;  4MHG A;  3I0T A;  1DP7 P;  5TRD A;  1SD4 A;  1EH6 A;  2XGX A;  2K4B A;  2EJR A;  1LB2 A;  2MH2 A;  3EUH A;  4OOI A;  1SMY F;  2VBX A;  2QUF A;  2J5P A;  3R60 A;  3WGG A;  1KYZ A;  2ZO4 A;  3PQJ A;  3L2C A;  1TW2 A;  4GO1 A;  4OIN F;  2KIF A;  4KIC A;  3QRF F;  4EGZ A;  2P6S A;  3P7N A;  1F5T A;  3U1D A;  3J81 Z;  3ZMU A;  5DYM A;  4UVB A;  3KEO A;  1B59 A;  2L4A A;  5E8G A;  4PCQ A;  4EJO A;  4M72 A;  1YS6 A;  3WOD F;  2V9V A;  3BJ6 A;  4UXN A;  2W85 A;  1B9M A;  2OZU A;  1BBY A;  2FU4 A;  3VFZ A;  2XRO A;  4OIO F;  3ERE D;  2NNY A;  4LJZ F;  5LGT A;  1W5T A;  3WE3 A;  5ILV A;  4U7D A;  3D5L A;  4L9V A;  1ZLK A;  5FFX A;  4XLN F;  2WC2 A;  3O2P E;  4QWQ A;  4RB2 C;  1FBS A;  1OKR A;  1LEA A;  2L3D A;  1YQA A;  4P55 A;  4L0Y B;  2M5W A;  1IN6 A;  2ZKZ A;  4N9H A;  4IPA A;  3EYI A;  3ZMT A;  3DXJ F;  1K78 B;  2FXA A;  1YW7 A;  3WTY C;  3HTS B;  2OBP A;  5JVT A;  2D2W A;  5BPI A;  4ZYH A;  4EM0 B;  4EV0 A;  2C6Y A;  5E1W A;  2A68 F;  3LWF A;  1SAX A;  1WWX A;  5CLS A;  4KA4 A;  4OIP F;  1D5V A;  1ONV A;  1H9G A;  2P8T A;  4JQF A;  1YS7 A;  4M74 A;  2PJP A;  2JTV A;  3HIF A;  1U78 A;  2XAG A;  3N97 A;  2FE3 A;  1YLF A;  1IN7 A;  2VC1 A;  4IRG A;  4I0A A;  3T8T A;  1D8J A;  3T0Y A;  3RYP A;  4R8H A;  1XDS A;  5CJ9 A;  1FNN A;  3HTU A;  5CVJ A;  3TO7 A;  4F7Z A;  3GFI A;  5H6Q A;  3K1P A;  1S3J A;  3HYI A;  1O3S A;  2HEO A;  3WGH A;  1QQI A;  2JRT A;  2OA4 A;  1YG2 A;  2MH9 A;  3CUO A;  4HX7 A;  1ZLJ A;  4L5I A;  1T98 A;  4P96 A;  2BV6 A;  4EM1 A;  1SD5 A;  1P6R A;  1XSX A;  2BBY A;  2O03 A;  4Q47 A;  3JSP A;  3E3V A;  3F8C A;  1I1G A;  4L0Z B;  2VE9 A;  4GGG A;  4PGH A;  4A5N A;  4Y13 A;  5D4S A;  4YFK F;  1H9T A;  1B9N A;  1XMA A;  3ECH A;  1ZG3 A;  1XDU A;  4KT5 C;  1CF7 A;  3GFL A;  3B73 A;  3LFK A;  3R61 A;  2F5F A;  3CUQ B;  3MCZ A;  3K69 A;  1UCR A;  3CDH A;  4TV7 A;  5HS7 A;  5D5U B;  1U2W A;  4A5M A;  2RDP A;  2CFX A;  3MEX A;  4UVA A;  2FOK A;  1R5G A;  5ICE A;  1MJA A;  4S04 A;  4PZJ A;  1F4K A;  1XGS A;  2FEZ A;  1O3R A;  1I5Z A;  3NQO A;  2OD5 A;  2YPR A;  1AWC A;  1XMK A;  3L00 A;  3IRQ A;  4HDV A;  1I1S A;  4AVP A;  4RGX A;  2GWR A;  1FY7 A;  3GFJ A;  2K02 A;  5E1Z B;  1Z05 A;  2HFH A;  5D8K B;  5ICF A;  1S8N A;  3VEP A;  2CGP A;  4YFX F;  2QVO A;  1KQ9 A;  2QQ9 A;  1OMI A;  2LDU A;  4KNY A;  4O3M A;  3RPQ A;  3VOD A;  3C3W A;  3ZMS A;  2HYG D;  4ESJ A;  3ZMV A;  3ZQ7 A;  4ZYG A;  2HKO A;  2MC3 A;  4L18 B;  1ZGJ A;  3DPL C;  3KP4 A;  1T39 A;  1WSU A;  4G6Q A;  4M71 A;  4BHP A;  3L09 A;  3W6K B;  1YFH A;  4ENJ A;  1IF1 A;  2EFW A;  3BDD A;  2R7F A;  4IRH A;  3EYY A;  1R22 A;  4B09 A;  1OYI A;  2EK5 A;  1K78 A;  2LKP A;  4U88 A;  5A2Q Z;  3I53 A;  3FX3 A;  2XHK A;  5D5X B;  1Z1D A;  3DP7 A;  5L3G A;  3CLO A;  5CYV A;  3MAJ A;  3LST A;  2OAZ A;  4Q5S F;  2VBZ A;  2DLL A;  4XLP F;  2UWM A;  1MZB A;  3E6C C;  4GCV A;  3QP5 A;  2ZME B;  4ZZL A;  1BM9 A;  1R58 A;  2L54 A;  4IJA A;  3DQV C;  3M7G A;  2HKX A;  3FM3 A;  1K6O A;  1IN5 A;  4RB0 A;  3GXO A;  3HUG A;  1O7F A;  1S29 A;  3OV8 A;  3G3Z A;  1BN5 A;  5L3D A;  2EV6 A;  5KK1 A;  5FLX Z;  3GYH X;  3T5X A;  3CUQ C;  3DF8 A;  4LD5 A;  3F22 A;  2ADU A;  4BXU A;  1OPC A;  2DT5 A;  1KA8 A;  4G7H F;  1Z7U A;  4MEY F;  1MGT A;  3GLX A;  4AIH A;  3IC7 A;  2PFB A;  2Y75 A;  4U0Y A;  2O6G E;  2MLK A;  5HLH A;  1YW8 A;  1RIO H;  1ZAO A;  1FBQ A;  4O6J A;  5BPD A;  2M1B A;  2DK8 A;  5L3C A;  1L3L A;  1XSD A;  2EA2 A;  1BOA A;  5BQT A;  2HTS A;  4OU0 A;  1FOK A;  4AIJ A;  2E7X A;  2P5L C;  4GYI A;  4I09 A;  3RIR A;  3CUQ A;  3HSE A;  4ENK A;  2NS0 A;  2GZW A;  2HDC A;  1JE8 A;  2IA1 A;  2MD5 A;  2LNB A;  2EFP A;  2BE5 F;  2NAZ A;  3TKY A;  3ZN0 A;  4WWC A;  2W25 A;  3I59 B;  4A0X A;  4YG2 F;  3QU3 A;  2HWV A;  3AAF A;  1TQP A;  2DO7 A;  4WXC A;  4G7Z F;  5IT9 Z;  2DQL A;  1ZAR A;  1QZY A;  4PGG A;  2Y48 A;  2QEN A;  3ZP5 A;  4JBA A;  4ESB A;  4I01 A;  3RKW A;  3M9A A;  1DPU A;  2FSW A;  4ENM A;  3F8F A;  5KVR A;  1RUO A;  1W4M A;  2V79 A;  4M73 A;  1MJB A;  1HKS A;  3DFG A;  1LJ9 A;  1ZHF A;  3I5U A;  3FZV A;  1UST A;  1R23 A;  4HOB A;  2YSR A;  3IRR A;  1D3Y A;  2LF7 A;  2ISY A;  1TBX A;  4Q48 A;  2H6B A;  2XUB A;  4HYE A;  3LA2 A;  3IKV A;  1DPR A;  2HOE A;  2VT3 A;  4O5V A;  5DUI A;  3DEU A;  3QAH A;  4ASN A;  1SMT A;  2H6C A;  2FQ3 A;  1Z9C A;  5AIP A;  1P4X A;  2OZ6 A;  1FYK A;  1T6S A;  4OMY A;  5FFZ A;  2XAF A;  1A04 A;  2GAU A;  1YO5 C;  2V1X A;  4UUV A;  2NRA C;  5TJJ A;  1QPM A;  2P5V A;  2ZME A;  3W6J B;  3M8F A;  2Z99 A;  3WTX C;  3HOT A;  4HBL A;  2QM3 A;  1J7K A;  2FBH A;  3E97 A;  1FYL A;  3JTG A;  4FHT A;  2RQP A;  3VOE A;  1GHC A;  3I4P A;  2E1C A;  1B1B A;  3I54 A;  4NHJ A;  3FHZ A;  1QZZ A;  4HW0 A;  2R7D A;  1BI1 A;  1NHA A;  2RC4 A;  2IPQ X;  1USS A;  5F1R A;  3KP6 A;  5LHH A;  2H09 A;  3F21 A;  3ISP A;  4BHC A;  2VON A;  3KZZ A;  3E6M A;  3H92 A;  5D4R A;  4LLG F;  1R7J A;  3BJA A;  1Z6R A;  1ZN2 A;  3ZMD A;  4M9Z A;  2FBK A;  1YYV A;  3GZ6 A;  1MD0 A;  5J8C A;  4HF2 A;  1K7A A;  3U9G A;  2P5K A;  4KMU X;  2L4M A;  3J80 K;  5K5Q A;  1OR7 A;  1UHW A;  2XV4 S;  4Q4Z F;  1KU7 A;  3V7C A;  2IP2 A;  4XSZ F;  2XKO A;  4LK0 F;  2A61 A;  5LGU A;  3I59 A;  3U2R A;  1BI0 A;  1T2K A;  3CTA A;  3ROU A;  1WQ2 A;  2RVC A;  3RKX A;  3N4M A;  1G3T A;  1XD7 A;  4XRF A;  2STW A;  3R6S A;  1TNT A;  2BGC A;  1U5T B;  3HRM A;  3LA7 A;  1E2X A;  4CYD A;  2HGC A;  4LMY A;  1R5H A;  3ZMZ A;  5HDK A;  1JHF A;  4K2E A;  4EGY A;  4BYY A;  4IHS A;  2DQR A;  1IRF A;  3KE2 A;  1WI9 A;  1Q1H A;  5H6R A;  1FZP B;  1J5Y A;  5LRR A;  1TTY A;  1W7P A;  3E6B A;  1PP8 F;  1ZG1 A; 
#chains in the Genus database with same CATH topology
 2QBY B;  2BY0 A;  4WX9 A;  4E4H A;  4PJL A;  2VN2 A;  3LQR A;  4LLL A;  1S5L C;  2VXZ A;  2X1C A;  3LSG A;  2YU3 A;  3FWE A;  1Z77 A;  1IG7 A;  2MSY A;  2HDD A;  4EMS A;  1EV7 A;  1HQC A;  3Q0W A;  3PSI A;  2RV8 A;  3BJO A;  3L2U A;  5EZG A;  1X2N A;  3VPR A;  2OQG A;  4QTR A;  1LQ1 A;  1ZG5 A;  4BQA A;  2ELJ A;  1PUF B;  1GV2 A;  4YIR X;  2E7W A;  3KEY A;  4XM3 A;  5CPR B;  4G9Y A;  4C3J J;  1MNM C;  2A6E F;  1RZ4 A;  2O0Y A;  3FM5 A;  4YEJ A;  5HVQ C;  5GAE J;  1ZRF A;  5ERI A;  3HPG A;  3RPU A;  5IT3 A;  2HZD A;  4ENN A;  2VOD A;  1FMW A;  4H4K C;  3FMQ A;  2G7U A;  2V1N A;  3DKW A;  5DD4 A;  4UHT A;  2GOX B;  5FO5 A;  3WTZ A;  3J81 K;  5BMZ A;  3EUK L;  5F1J A;  4B8X A;  5DS9 A;  1WI3 A;  2F5D A;  2V1D A;  4BH9 A;  1T95 A;  2Q8K A;  3ZQL A;  1ZRE A;  2H8R A;  2KP6 A;  4G12 A;  3E5U A;  3M07 A;  4D5C A;  1FLI A;  1HOM A;  4PSX A;  3ZQQ A;  5E1X A;  2XPW A;  2ZBK A;  2X1E A;  3KP3 A;  1BC8 C;  1HKQ A;  3PQK A;  4P5O A;  2ELK A;  3IL2 A;  3GW2 A;  3BOQ A;  3WHB A;  3WTV C;  2CYY A;  3VB2 A;  5DEQ A;  1Y0U A;  2K27 A;  2DMP A;  2ZNZ A;  4XK4 A;  4EJV A;  4F52 A;  4ZTJ A;  1YRN B;  4M3E A;  2RGV A;  1ZR4 A;  1VQO I;  1Z67 A;  2X51 A;  4HLY A;  4CGZ A;  3OR1 C;  3O3K A;  1CGP A;  3LOC A;  2IVM A;  4XLE A;  2MA3 A;  1FT9 A;  1HST A;  1V55 H;  1FOW A;  4A6E A;  2DFE A;  3P9I A;  3A0B C;  3L2W A;  4P9F A;  4X6A J;  1VTN C;  4PSW A;  6PAX A;  2EIN H;  2FX0 A;  3E5Q A;  2L02 A;  5JI6 A;  2Q0O A;  2DTZ A;  3KYD B;  4KN4 X;  4JYK A;  1PP7 U;  2LFB A;  5JHU A;  4E7L A;  2CO5 A;  1XMX A;  2L2O A;  1G4D A;  3RQ4 A;  3OYM A;  4G6D A;  4A0Z A;  5FB2 A;  2OTJ I;  2E1M C;  2F48 A;  3SZT A;  1IGN A;  4L9J A;  1H0M A;  2M30 A;  2CJJ A;  3I3L A;  1UEL B;  3HOS A;  1YJW I;  1FP1 D;  4LB5 A;  3RTR A;  1R1T A;  3P9C A;  2K86 A;  1P4W A;  1I27 A;  4HF0 A;  3V7R A;  2AS5 F;  2ID3 A;  5GTH C;  3CP2 A;  1JTY A;  4YEL A;  1G59 A;  2QYO A;  2Y2Z A;  4S05 A;  5ICC A;  3OYB A;  3CC2 I;  5DV5 A;  3PUF A;  3WG7 H;  2MYS A;  4XMY A;  3HL2 A;  4HQM A;  1OJL A;  1RET A;  3C7J A;  1BA5 A;  4Y3O A;  2F4O B;  2QSG X;  3LSJ A;  4UV8 A;  3NAU A;  4XLC A;  1JTX A;  3BCB A;  1R4N B;  2NS7 A;  1EH8 A;  1H8A C;  4AWX B;  3F9K A;  3BZ6 A;  1AHD P;  1J0R A;  4UNO A;  3MQ0 A;  2EFO A;  1U5T C;  5J3L A;  1XC5 A;  2DDB A;  2MBF A;  3LA3 A;  3TOA A;  2X4H A;  1OYW A;  2ZJ2 A;  1FP2 A;  5DD8 A;  1WKM A;  3FF5 A;  3QYF A;  3TO6 A;  4A69 C;  3HRT A;  3NEU A;  3S2D J;  2Z2S B;  2EV0 A;  3FKJ A;  2G9W A;  1IO2 A;  4MEX F;  2KMU A;  2HZT A;  3TGN A;  4BAC A;  2GXB A;  1K83 J;  1D1C A;  1GLN A;  1R00 A;  2ID6 A;  1BR4 A;  1U3E M;  1P2F A;  1FJL A;  5CVV A;  1WJB A;  4HST A;  3RZD J;  5ICG A;  2V6C A;  2NNN A;  3OOP A;  2EWN A;  4NC7 A;  4CA0 A;  3ZQF A;  3JAM Z;  3BG7 A;  4MTE A;  2UZK A;  2ESN A;  4G94 A;  1FBU A;  2HQR A;  1ZH5 A;  3W6V A;  1RUN A;  1BIA A;  2CQX A;  2HS5 A;  3QP6 A;  3OL4 A;  4RLF A;  3SHF A;  5JLW A;  2QGU A;  5L3B A;  2XIG A;  1DP3 A;  2KJB A;  2XKP A;  5DCF A;  2KDZ A;  2LBF A;  2JA8 J;  4KUM A;  3DEE A;  2L5Q A;  3SFI A;  1XN7 A;  3CO6 C;  2BEO A;  4KIB A;  3I55 I;  4XBF A;  2ZSI B;  3CP8 A;  3F0C A;  3JTH A;  3K4C A;  4U0W A;  2D1V A;  4AM3 A;  2MLG A;  2HTJ A;  4IVN A;  5K5O A;  3ZQG A;  1B8I B;  1V3F A;  1MBJ A;  3A2K A;  3C2G A;  4RS8 A;  4HEA 2;  3PO3 J;  3W2V A;  3SYT A;  4ON0 A;  2YX4 A;  3KLO A;  3F6O A;  4HNU A;  2BXZ A;  3OIO A;  4Y33 A;  3PFI A;  3GEZ A;  4XR6 A;  3GTP J;  1QZE A;  1X1P A;  3KZY A;  1A31 A;  2M8G X;  3JW4 A;  1JHH A;  2DMQ A;  2LF8 A;  1D1B A;  4CZC A;  3CJN A;  2R5Y A;  4M3G A;  4ZJZ A;  1FX7 A;  3S1N J;  3KET A;  2L7F P;  4II3 A;  2R7V A;  1DDN A;  2E1N A;  3H3U A;  2W24 A;  1L0O C;  1WJD A;  4OIR F;  1FYM A;  3E5X A;  2QBY A;  2VOO A;  4JK1 X;  2WA0 A;  5E17 F;  3K1M A;  4A6D A;  1STZ A;  1KYW A;  2DOD A;  2B0L A;  3F6V A;  2DJI A;  5E18 F;  2A5Y B;  4A12 A;  1WJE A;  1XB4 A;  1T38 A;  3A0H C;  5KNL A;  2AXL A;  2Z9O A;  1PUF A;  1MH4 A;  1VZ0 A;  1BW5 A;  2QQ8 A;  4BJ6 C;  4IRI A;  5EEG A;  5GP9 A;  4BBR J;  2FF4 A;  2V1U A;  2KRC A;  3BZC A;  4HLX A;  2KQR A;  1HCR A;  4M3F A;  1SFU A;  1O3Q A;  4PUS A;  5F08 A;  1NK2 P;  1JXS A;  3LAP A;  1P92 A;  2EZK A;  3IH4 A;  3V8K A;  2IAI A;  1BR2 A;  1PUE E;  3HM5 A;  1ETK A;  1AU7 A;  1ACI A;  2GQQ A;  2LD5 A;  1V4R A;  2DW4 A;  4BEH B;  3RZO J;  4IHT A;  1MJ9 A;  3HHH A;  3AG4 H;  1JKP C;  1XGN A;  3BP8 A;  2ZXJ A;  1I39 A;  3HEF A;  1FMV A;  2M0M A;  5ILU A;  2JPB A;  3A02 A;  4UVC A;  4EQQ A;  2DFI A;  3SXY A;  4HV6 A;  4A2U A;  3S2H J;  2LY2 A;  2A6H F;  1RPW A;  3WU2 C;  3REO A;  2FJ1 A;  3F72 A;  5B1B H;  3VYR B;  3V42 A;  2EZI A;  3F8N A;  3JCU C;  3A01 B;  3ASO H;  1XG1 A;  2Z16 A;  1IN4 A;  4LG0 B;  3M4O J;  4DGW B;  2Q2E A;  3G1O A;  2WV0 A;  3A03 A;  2HQA A;  5FKK A;  4U7B A;  3CES A;  1ZGA A;  3EUA A;  2M4K A;  3H1C A;  3SZP A;  2JA5 J;  4BY7 J;  3U21 A;  1OLT A;  3DWL E;  4IXA A;  4E7I A;  4A3I J;  4XIC A;  1V5G A;  3BR5 A;  3WTU C;  2QWW A;  1QPI A;  2ETH A;  1K6Y A;  2VI6 A;  3WTT C;  1LDJ A;  5HLI A;  2AQF A;  2RKH A;  3D1N I;  2UXN A;  2DJN A;  3MKZ A;  1UFM A;  4N4O B;  3QU6 A;  1BC7 C;  5FRM A;  2ZFW A;  1BI3 A;  4B4C A;  2QQB A;  3FK6 A;  4FAS D;  2K4J A;  2VQC A;  5A2Q K;  2AQE A;  1LEB A;  1N78 A;  3GF2 A;  3SZG A;  1MBF A;  3D5R C;  5LEJ A;  3DEW A;  1LNW A;  2R93 J;  4C3I J;  4NBQ A;  4BGD A;  3EDP A;  1VQK I;  2Y9Z A;  4HA8 A;  1BL0 A;  2P7C B;  5FGM A;  3BTJ A;  4ZYD A;  2QLZ A;  3S17 J;  3RJP A;  2GXG A;  1MBH A;  4DQ2 A;  3LQQ A;  1ZRD A;  3R4K A;  1W36 C;  3ZQI A;  2R7U A;  3WGI A;  1KGS A;  3Q0V A;  2DN0 A;  4RGR A;  1G3W A;  2FNA A;  3RYR A;  4DBR A;  2IGN A;  2ZCW A;  5JHF A;  4XKV A;  2GLO A;  3OS2 A;  2CQQ A;  4X0G A;  4KIG A;  1XCB A;  1QNT A;  3D0S A;  4B43 A;  2NVX J;  2LSO A;  2LC2 A;  2QKL B;  1VQ6 I;  1KQ8 A;  4Y17 A;  3GVA A;  2JVH A;  3HRU A;  1J75 A;  3FIS A;  1G3S A;  3HOU J;  3CCL I;  1D0Y A;  2COB A;  3F3X A;  4DJA A;  3P9K A;  3OOU A;  2PN6 A;  3X2Q H;  5EDN A;  1IC8 A;  3Q9S A;  5LRS A;  2GXA A;  2TCT A;  2IS4 A;  4J00 A;  5K1Y A;  2EH3 A;  2MC4 A;  4C30 A;  4RGU A;  4LIV A;  2W7N A;  1ERD A;  2M3A A;  2OV7 A;  3BRO A;  1IZ1 A;  1GXP A;  2ZB9 A;  4EJT A;  1WZ2 A;  1T8I A;  5FLX K;  2DPU A;  1SD6 A;  4PJJ A;  3BC8 A;  5LD2 C;  4U0V A;  3BLY A;  2COM A;  2QSH X;  4LG3 A;  3DBL B;  5F0F A;  2W84 A;  2TDX A;  3IHU A;  5M5X J;  2HYJ A;  3B02 A;  1R4M B;  3TDU C;  3SDG A;  4I0B A;  3FMR A;  2ME6 A;  3BR2 A;  4WXH A;  2CG4 A;  3BPX A;  3BR1 A;  2X9D A;  1KU3 A;  2DTR A;  3PUB A;  4LIU A;  2OC6 A;  1Z91 A;  1WRJ A;  4XN0 A;  2CW0 F;  5LHG A;  4KFC A;  5DCM B;  3K4N A;  3V7S A;  4B44 A;  3CO7 C;  2PJR B;  3A4C A;  3PFY A;  3F8M A;  3JSO A;  2MG4 A;  2KJC A;  4DZJ A;  2JA2 A;  2PMH A;  4RMN A;  4RAG A;  4PFP A;  2DA5 A;  3MKL A;  2CU7 A;  4KN7 X;  4B47 A;  5DUK A;  2JUC A;  2JT1 A;  3BY6 A;  5LBQ A;  1KU9 A;  2CFO A;  2ME0 A;  3L1P A;  1HDD C;  2VQL A;  2PLY A;  3CDL A;  1X1D A;  1I3Q J;  1HXD A;  2ZSH B;  2EZL A;  2E5N A;  4YRV A;  4A3L J;  1TLH B;  3ZGK A;  3HKZ A;  4IOC F;  2L9S A;  1XX5 A;  2NYX A;  2JZY A;  2P4W A;  3SQN A;  3TMO A;  5L3F A;  3KCC A;  4M6X A;  1IXC A;  4CCM A;  4QLC U;  4BQQ A;  3ECO A;  5HNH A;  4BE0 A;  1B72 B;  2H27 A;  1OYY A;  1XSV A;  3SEQ A;  4E7S A;  4HSR A;  2M8E A;  1EH7 A;  4EVI A;  4MIM A;  1Q1V A;  4L5J A;  1K79 A;  2EV5 A;  2PI0 A;  2KRF A;  4A0Y A;  5FD6 A;  5HLG A;  2PMU A;  3C18 A;  4NC8 A;  4MQ9 F;  2K5C A;  3RI4 A;  4NC6 A;  3QPL A;  2K3P A;  2DOE A;  2XAJ A;  2XAS A;  4D9J A;  4AD9 A;  2F5E A;  1YOV B;  3TBI A;  4XOR A;  4HQE A;  3WTS C;  2DK5 A;  4XON A;  2YU9 J;  3K70 C;  5IT9 K;  4FIS A;  4ZH4 F;  3ABK H;  4ZZD A;  4A3J J;  1KQ0 A;  5CQE A;  2X6Y A;  1QO0 D;  2FML A;  1J59 A;  2M7B A;  1TQI A;  4MFD A;  3MZY A;  2DYR H;  4L9T A;  4B3X A;  3M1C A;  5EGO B;  3T8R A;  2V26 A;  3KYC B;  2XRN A;  2BHZ A;  1PJR A;  3CF2 A;  4A3B J;  2I5U A;  3ZPL A;  3HOX J;  3QOE A;  2KIU A;  2FA5 A;  3MWM A;  4N0B A;  4CDG A;  2R3S A;  2A3S A;  1S7E A;  3COA C;  1A36 A;  1I3A A;  4PJM A;  3JRH A;  3NRV A;  2DU9 A;  5L3E A;  2Y0S N;  4GYG A;  3L7W A;  1OCT C;  5D8L B;  5ILS A;  4WCG A;  4X1E A;  1YIT I;  2O7O A;  1XTA A;  3FXM A;  1A6Q A;  2CV0 A;  1IV6 A;  3HHG A;  1UZC A;  1QGP A;  3QYE A;  1HW2 A;  2K9M A;  2JN6 A;  4GXO A;  4LG0 A;  2NVT J;  1RNL A;  2WTE A;  3L2Q A;  5CVI A;  3FXU A;  2I10 A;  2Y69 H;  1DUX C;  5LEK A;  1TWC J;  1GXQ A;  1TNS A;  1X3W B;  3VSK A;  2BYV E;  3CC7 I;  2H94 A;  1SVL A;  4CO8 A;  1Y8R B;  2AHQ A;  4H0E A;  3EQL F;  2STT A;  2YX7 A;  4A3F J;  2NVU B;  2JK3 A;  1R1U A;  3BTL A;  1X1C A;  1QVT A;  1ETQ A;  4AID A;  2RN7 A;  3HDD A;  4OMZ A;  2IA0 A;  5KHD A;  2GA1 A;  3TO9 A;  4ITV A;  2XF5 A;  4HX4 A;  1U6G A;  1BW6 A;  2WAE A;  1E0E A;  3DV8 A;  5AON A;  2DA1 A;  3O6B B;  1JKO C;  3I58 A;  1MND A;  2PG4 A;  3V8J A;  1WH7 A;  2IA2 A;  1XPX A;  2XGC A;  3KP2 A;  4WK8 F;  5J4Y A;  3CMY A;  1F9N A;  2VKD A;  2B63 J;  3PNT A;  4D0P A;  4BDZ A;  4FE4 A;  4BE1 A;  2E5Z A;  1P7J A;  1R1V A;  3V4G A;  2LMD A;  2CQK A;  2Y9Y A;  4KIT B;  4NB5 A;  5DTD A;  3OYF A;  2XPU A;  4QSH A;  1U8R A;  3TQN A;  4I6Z A;  5E3L A;  1VQP I;  3LSM A;  3F23 A;  4PFO A;  2CWE A;  5ED4 A;  1W7P D;  4NNJ A;  3H9G A;  1ZRC A;  2W57 A;  4NUB A;  1HW1 A;  5LLQ A;  3CCQ I;  4W1U A;  1MDM B;  3FXR A;  3DU5 A;  4LFU A;  5LHI A;  4KDP A;  2LR8 A;  4BBS J;  4LGW A;  2VLA A;  2DA6 A;  2E2I J;  5D6F A;  3K0L A;  2Z1D A;  4KYW A;  2O61 A;  2R7T A;  5KCM A;  4G7O F;  5F6F A;  4HF1 A;  2XDV A;  3I71 A;  2R0Q C;  1YX5 A;  4UV9 A;  2FOW A;  1R71 A;  3LFU A;  1IDZ A;  2E1O A;  5F0H A;  2PMZ A;  4L9N A;  5DDG A;  4HDU A;  2ZJR F;  3H5A A;  1SVO A;  1X1B A;  2D1H A;  1BI2 A;  3RPU D;  2ISZ A;  2YR2 A;  1HKT A;  2LYC A;  3OL3 A;  1B4A A;  2ESH A;  2GBY A;  2LTP A;  2L9V A;  2F6C A;  3H3Z A;  4LB6 B;  2RNG A;  3GLL A;  2Y30 A;  2R7W A;  1HW5 A;  1I6X A;  2IS2 A;  1MKM A;  4Y15 A;  5HOO A;  4IF4 A;  3ONQ A;  3MZ8 A;  1RES A;  4ZYE A;  2E19 A;  1KU2 A;  3M1E A;  2J5O A;  4XQF A;  2G7H A;  2K9N A;  4J19 A;  2IRF G;  4FX4 A;  4PJN A;  2HQN A;  1J2X A;  3GZN B;  1LUJ B;  3H36 A;  1YX3 A;  1R36 A;  3K1N A;  4I98 B;  4OIQ F;  4I99 C;  2F4M B;  5C3E J;  4C2U A;  1XGO A;  1OCP A;  3KPH A;  2FNP A;  3HGG A;  2FMY A;  4CCL A;  4FX0 A;  4N9I A;  3DKY A;  2X0L A;  2BY2 A;  3KP7 A;  1Y8Q B;  2O3F A;  4I02 A;  4PK4 A;  5E20 A;  5DCM A;  2RQQ A;  4YFN F;  2CW8 A;  1LVA A;  1SFX A;  2HYF A;  2L9N A;  2WBM A;  4B48 A;  1ITY A;  1FEX A;  1NH3 A;  1IXR C;  1YIJ I;  4WF2 A;  3OYK A;  2KFD A;  3MZH A;  5D6E A;  2DMT A;  3DU6 A;  1IAW A;  4I76 A;  4M9X A;  2VQG A;  2Z5U A;  5FKM A;  4AUX A;  4I2O A;  5FD5 A;  1DU0 A;  3K4K A;  4BXX J;  3I56 I;  2P0W A;  1E17 A;  4RDU A;  2EB7 A;  1FTZ A;  3CMA I;  2F5C A;  5FKN A;  4E6K G;  1MBG A;  2FD5 A;  3F8B A;  4P9U A;  1VQ5 I;  4EJW A;  3L2V A;  1FWZ A;  4Y4R A;  1B72 A;  2W82 A;  3KLN A;  4A93 J;  1ODD A;  1JKR C;  4DNC A;  5E8I A;  1SFE A;  5FLV A;  1X4O A;  5TGT A;  4QIW N;  2CSO A;  2WV1 A;  4EJU A;  4UY8 I;  3AG1 H;  5LGN A;  1SD7 A;  2HR3 A;  4HAM A;  3JR9 A;  3RDI A;  2GA2 A;  3CDI A;  4IHV A;  2PEX A;  4WXD A;  2M7A A;  3RSN A;  2QCO A;  1W5S A;  3CJQ B;  2MAB A;  1OIS A;  1JGS A;  2HQ5 A;  2PQ8 A;  1XCV A;  4FCY A;  2GIV A;  3GFM A;  2E2H J;  3G2B A;  1K4S A;  4KT6 A;  4EAT A;  2EBI A;  2ACJ A;  2LH9 A;  1GDT A;  1Y39 A;  1A35 A;  1FIA A;  3UNG C;  4FT8 A;  2BW3 B;  2LG4 A;  3QPT A;  3R0A A;  2IGK A;  1XGM A;  2F2E A;  4DZP A;  5AIQ A;  1IW7 F;  1AKH B;  2JVG A;  2VBW A;  4CIC A;  2ECC A;  1YTY A;  2RNJ A;  1X3Z B;  2LKS A;  2A69 F;  5C4J J;  1TQM A;  1REP C;  2EA4 A;  5CVU A;  4AU7 A;  1O3T A;  2L01 A;  2KIM A;  4XSX F;  4IHX A;  3W2A A;  5F64 A;  1S7A A;  2LY9 A;  4R1H A;  5HLT A;  3GZ5 A;  2HVQ A;  2DPD A;  1S72 I;  2WY7 Q;  1FC3 A;  2L0K A;  4BQO A;  3BCA A;  2DMN A;  4CXF A;  5EEA A;  1C0W A;  3FDY A;  3ML6 A;  2AO9 A;  3HXL A;  1GVJ A;  1TW3 A;  2OJE D;  3TDZ C;  3CME I;  1G3Y A;  1QBJ A;  1MH3 A;  1GVD A;  4D7N A;  4YIF A;  3G73 A;  3FXO A;  1FSE A;  2KIS A;  3IH2 A;  4CZZ A;  3CCS I;  2YUS A;  1LFB A;  1Z7L A;  3G6E I;  2XB0 X;  4D7M A;  1U5T A;  5HDG A;  2X48 A;  5E3O A;  1OFC X;  4RLQ A;  1IXS B;  1G6N A;  3U1K A;  1X3U A;  1X2M A;  1U8B A;  2IJL A;  4MNU A;  2EFN A;  2OCE A;  3GWZ A;  4EM2 A;  3QPH A;  4JOM A;  3ABT A;  5M5Y J;  3S15 J;  2QZ8 A;  2LK2 A;  4HZF A;  2DA7 A;  5H2F C;  4KIS A;  2JPC A;  1PDN C;  3M8E A;  2MD0 A;  1EKE A;  2LRE A;  3KFW X;  3IP4 B;  4ESF A;  5IP6 A;  3PIO F;  5J6X A;  3HJE A;  2W00 A;  2VXD A;  3DCF A;  2KIQ A;  3IAS 2;  2F4I A;  1SFO J;  3ZR8 X;  3GX4 X;  3H35 A;  2DOF A;  1HA8 A;  1FPQ A;  3BWG A;  3V8L A;  2DAO A;  2PBI A;  1BJA A;  2D45 A;  4BHB A;  1LDD A;  3K10 A;  3MN2 A;  3BG6 A;  4CHU A;  2V9P A;  2VE8 A;  3H5N A;  5J8F A;  4NQW A;  4Z6Y A;  5D5W B;  3L2R A;  2XVC A;  2QF7 A;  3ABU A;  2IT0 A;  3HOW J;  3WE2 A;  1D0Z A;  1N25 A;  1YW9 A;  2DBB A;  4M9S A;  3JRG A;  4I7H A;  2P6T A;  4MTD A;  2Y0M A;  2IW5 A;  3ZOB A;  1MDM A;  2EPF A;  3Q0U A;  2XSD C;  5CVR A;  1F1Z A;  1BIB A;  3FXQ A;  2M45 A;  2W1O A;  1UHM A;  1ULY A;  1IUY A;  2B9S A;  3QQA A;  3PIP F;  1LDK B;  3LSI A;  2ZXI A;  1HSJ A;  1UHS A;  3H0D A;  1MSE C;  3I4M J;  3TL4 X;  3NAR A;  2WY8 Q;  3OSF A;  5HS8 A;  1S6L A;  4S0H B;  1VQ4 I;  3DPT A;  4F91 B;  3ULQ B;  1UB9 A;  3SFZ A;  3CLQ A;  3HSF A;  3L9F A;  2KZV A;  2XB5 A;  4C9Y A;  1ZK8 A;  2WAF A;  5CKT A;  3J7A O;  4A3G J;  3T1B A;  5JR3 A;  1Z3Y A;  1DU6 A;  3K2Z A;  4JX5 A;  2WWY A;  3OYJ A;  3I4N J;  5HDN A;  1AA7 A;  1A6I A;  3TP0 A;  2XGD A;  4G8X A;  3BTI A;  3IV5 A;  4MLO A;  2JQ7 A;  2Z33 A;  1SAU A;  1FSH A;  4A3C J;  1RI7 A;  3IWF A;  3RKQ A;  4A3D J;  2EFQ A;  1LVK A;  3VWB A;  3S32 A;  1HBX G;  3SDB A;  1GV5 A;  3OSG A;  4OAY A;  2DI3 A;  4RAY A;  3GTO J;  5GAG J;  2HVR A;  1ON1 A;  2UXX A;  5BOX A;  3S1M J;  1R6R A;  4AIK A;  4LK1 F;  1AOY A;  3HRS A;  3PO2 J;  1ETW A;  2L7M P;  4E70 A;  5GTI C;  2A07 F;  1YRN A;  3KIO A;  4BU2 A;  2OQR A;  4Z2Y A;  2Z3Y A;  3C1D A;  2IS6 A;  3GUD A;  3HSR A;  4QPQ A;  4D5F A;  5EF6 A;  3K2A A;  4XLF A;  5EEH A;  3SEZ A;  1SC7 A;  2VT2 A;  3EET A;  2ELH A;  2NOJ B;  4XOP A;  2FBI A;  4BAY A;  4A3E J;  5D5V B;  2BOL A;  4ETS A;  1OCO H;  3LSH A;  2K9S A;  2K9Q A;  4DW6 A;  3JRA A;  2KLO A;  5K5R A;  3AKZ A;  9ANT A;  2JSC A;  1WJF A;  4RB3 C;  2R7Z J;  1I6H J;  1ZYR F;  5EZH A;  2K9L A;  2F5V A;  2LOO A;  3K6G A;  3J80 Z;  3KP5 A;  1O7L A;  1FOY A;  1IRG A;  1T0F C;  2R4G A;  2R5Z B;  2A5W A;  5E79 C;  1D8K A;  5FRO A;  3BPV A;  1WJ5 A;  5KAF C;  3S2W A;  1P4A A;  2DFH A;  5M5W J;  2VUM J;  3QYB A;  1B6A A;  4CYC B;  1YIO A;  2Q1Z B;  1VQM I;  4ANJ A;  1WH5 A;  4KIF A;  3J7Y J;  3IWZ A;  2HDW A;  4BNC A;  3WU0 A;  2HXI A;  1Z6T A;  1HLV A;  1J9I A;  1MMD A;  2HPI A;  4RAZ A;  3FMS A;  4PDK A;  2WAQ N;  4BE2 A;  2JRM A;  3HC7 A;  3LL7 A;  4AYB N;  3MFK A;  2DA3 A;  2XAH A;  1RR7 A;  2VKH A;  1RC9 A;  4LOC A;  3Q5F A;  4IHW A;  4RGS A;  1D0X A;  1RKW A;  3CF5 F;  4MQV A;  4M6Y A;  2FRH A;  4ZC3 A;  3WG9 A;  2E60 A;  2K7L A;  2VOP A;  3EUH C;  3LAJ A;  3NWS A;  3E6D A;  3UR3 C;  1Y6I A;  1RKT A;  3K9T A;  4HX8 A;  1NTC A;  2X6W A;  4RA2 A;  5JFR A;  4KMF A;  3GTQ J;  3MMY B;  3WTW C;  3JAM K;  3WU1 B;  5HS9 A;  1TWH J;  2CW7 A;  1MBE A;  2VC0 A;  1W7P B;  3ELK A;  4MGR A;  3IKT A;  3VYU B;  4A3K J;  4D1Q A;  1T0F A;  3HPH A;  4XRS G;  2ZNY A;  2KZG A;  4HV5 A;  5H20 A;  4LLN A;  3ZN1 A;  4ZYA A;  5EJC A;  4R79 A;  2BW3 A;  2QQA A;  3RKY A;  4BKX A;  2M87 A;  1ON2 A;  2P7V B;  2LRD A;  2VJJ A;  1VQL I;  3S1Q J;  1O57 A;  1IN8 A;  2L7K A;  2KKO A;  3Q9V A;  3PNY A;  2V7F A;  2VBY A;  2DMU A;  1TC3 C;  2OU2 A;  3I64 A;  2E36 A;  2O8X A;  3I9V 2;  1DGR M;  3KEQ A;  5BS6 A;  3OS0 A;  3JRI A;  4RB1 A;  3OWT A;  2XAQ A;  3R0J A;  3H9Q A;  2VKE A;  4YII A;  3GO5 A;  1S7O A;  3TOB A;  1CF7 B;  2B7E A;  3QOP A;  4MHG A;  3I0T A;  1DP7 P;  5TRD A;  1SD4 A;  4F92 B;  3CC4 I;  1MW7 A;  1EH6 A;  1ETV A;  2YS9 A;  2XGX A;  2K4B A;  2EJR A;  1LB2 A;  2MH2 A;  3AG2 H;  2V4J C;  4EEF G;  1JJ8 C;  3EUH A;  2BY1 A;  4OOI A;  1SMY F;  2VBX A;  2QUF A;  2WB1 N;  2J5P A;  2O5R A;  1W36 D;  3R60 A;  3WGG A;  1KYZ A;  2ZO4 A;  3PQJ A;  3L2C A;  1TW2 A;  4GO1 A;  4OIN F;  2KIF A;  5HOD A;  4C2T A;  3DPU A;  4XKC A;  4KIC A;  5K7H A;  2I8D A;  3B6C A;  1W1W E;  5IP9 J;  1B8I A;  1LPQ A;  3GTK J;  3DTK A;  3QRF F;  4EGZ A;  2P6S A;  3P7N A;  1F5T A;  2LVS A;  1QHH D;  3U1D A;  4CH7 A;  1D1A A;  3J81 Z;  5M3F J;  2JUG A;  1NG6 A;  1YI2 I;  2NOG A;  4DIQ A;  3ZMU A;  5DYM A;  2CV2 A;  4UVB A;  2M2E A;  2XAU A;  2GOM A;  3KEO A;  1B59 A;  2AXT C;  2L4A A;  5E8G A;  4PCQ A;  5CQG A;  4EJO A;  2HXO A;  4M72 A;  3CCU I;  1YS6 A;  5JLX A;  2CUE A;  2DT7 B;  3WOD F;  1ZTR A;  2QEX I;  1UAA A;  2V9V A;  3BJ6 A;  4UXN A;  2W85 A;  1B9M A;  5B3S H;  3BT9 A;  2OZU A;  2HNH A;  1BBY A;  2FU4 A;  3VFZ A;  2XRO A;  4OIO F;  3ERE D;  3S3O A;  5IP7 J;  1MSF C;  2NNY A;  2CQ7 A;  4LJZ F;  4DYR A;  5LGT A;  1W5T A;  3PNV A;  3W3C A;  5HNF A;  1T08 B;  3DBH B;  1CQT A;  3WE3 A;  3A1Y A;  3BQY A;  5ILV A;  4U7D A;  3D5L A;  4L9V A;  1VQN I;  1ZLK A;  3LSK A;  2M4G A;  4HNT A;  3UKG A;  2OPT A;  5FFX A;  2E2J J;  4XLN F;  2WC2 A;  3O2P E;  4OWR B;  4QWQ A;  4RB2 C;  1JKQ C;  5IYB J;  1FBS A;  1OKR A;  1LEA A;  2L3D A;  1YQA A;  4P55 A;  4L0Y B;  1ETO A;  1X19 A;  5J47 A;  2M5W A;  1IN6 A;  2ZKZ A;  4N9H A;  1IJW C;  4IX7 A;  4IPA A;  3CMM A;  1K61 A;  1UG0 A;  3ZMT A;  3EYI A;  1QHG A;  2JA6 J;  1Z21 A;  2VQH A;  3DXJ F;  2L7Z A;  1T56 A;  4II2 A;  1E3O C;  1K78 B;  2FXA A;  1YW7 A;  3WTY C;  4BEH A;  3HTS B;  1TT5 B;  2OBP A;  4UUT A;  2VL8 A;  5JVT A;  2Y0S A;  2D2W A;  5GAH J;  3FKI J;  5BPI A;  3MKY B;  1DQU A;  4DYQ A;  2P81 A;  4ZYH A;  1WVR A;  2M9H A;  2XF6 A;  4EM0 B;  4EV0 A;  1JJ6 C;  2C6Y A;  5E1W A;  3HOV J;  3OYG A;  2A68 F;  3J7Z I;  3HGY A;  3O8G A;  3CQZ J;  3LWF A;  2EIK H;  4BQN A;  3CJT B;  2O8K A;  1SAX A;  2HOS A;  1WWX A;  1TT0 A;  5CLS A;  5J1R A;  4KA4 A;  2TRT A;  3A01 A;  4OIP F;  4HPQ A;  1D5V A;  1OCR H;  1ONV A;  1H9G A;  2P8T A;  4JQF A;  1YE9 A;  1MNE A;  1YS7 A;  2RRE A;  4M74 A;  2PJP A;  2JTV A;  1VND A;  3HIF A;  1U78 A;  2M0C A;  2ZFU A;  2XAG A;  3TED A;  4JP0 A;  5B5E C;  3N97 A;  2FE3 A;  1YLF A;  1IV8 A;  1IN7 A;  2VC1 A;  2LLK A;  3K70 D;  4IRG A;  2R5Z A;  4I0A A;  2LBF B;  3T8T A;  1D8J A;  5EG0 B;  3T0Y A;  1IUF A;  3RYP A;  4R8H A;  5FKO A;  3MKW B;  1XDS A;  5FKL A;  2DFF A;  3ESW B;  5CJ9 A;  1FNN A;  2CUJ A;  2CUF A;  3FIW A;  3HTU A;  5CVJ A;  4CYC A;  3TO7 A;  1WCM J;  4F7Z A;  3MD2 A;  3GFI A;  5H6Q A;  3K1P A;  5B1A H;  1S3J A;  4BY1 J;  3KX2 A;  3PL8 A;  3HUG B;  2K40 A;  3HYI A;  5J1U A;  1O3S A;  3AL0 B;  2HEO A;  3OYD A;  3WGH A;  5E3N A;  3C2B A;  1QQI A;  2JRT A;  2L9R A;  2OA4 A;  1YG2 A;  2MH9 A;  3CUO A;  4XOT A;  4E7H A;  4HX7 A;  1FIP A;  1ZLJ A;  3BR0 A;  4IZZ A;  1V5F A;  4L5I A;  2X6X A;  4UB6 C;  1T98 A;  2CUZ A;  3FXL A;  3ZCO A;  1WGX A;  4IOA F;  1YJN I;  2R5Y B;  3HOY J;  4P96 A;  2BV6 A;  2XSJ C;  4EM1 A;  2H1K A;  4J01 A;  1SD5 A;  1P6R A;  3FXJ A;  4XKW A;  5B66 C;  5IPA A;  1XSX A;  2BBY A;  1RR8 C;  1JUP A;  2O03 A;  3HG9 A;  4Q47 A;  4M6V A;  1Y1V J;  3JSP A;  4IKF A;  1JUS A;  1NG7 A;  3OMY A;  2R7X A;  4DBQ A;  4IQ4 A;  3E3V A;  5DM6 F;  3F8C A;  2KT0 A;  1I1G A;  1KON A;  1U0J A;  2VE9 A;  4GGG A;  4PGH A;  4L0Z B;  4A5N A;  1POG A;  2BHY A;  3QPS A;  4Y13 A;  5D4S A;  4YFK F;  1H9T A;  2XPV A;  1B9N A;  1XMA A;  3ECH A;  1ZG3 A;  1LE8 B;  1XDU A;  3ZRG A;  4E7J A;  4KT5 C;  2VJI A;  1CF7 A;  3BR3 A;  2VB6 A;  3GFL A;  1QVU A;  3B73 A;  3LFK A;  4FQG A;  2PMZ N;  3JRF A;  4JX6 A;  3R61 A;  2F5F A;  3CUQ B;  3OYH A;  2JMW A;  3MCZ A;  1ENH A;  2M34 A;  2NVQ J;  2KRH A;  1DGW Y;  1FTT A;  4BUP A;  3MVP A;  3K69 A;  3J7A Y;  1UCR A;  3CDH A;  3FBN B;  4TV7 A;  1IDY A;  5HS7 A;  5D5U B;  1U2W A;  3FK7 A;  4A5M A;  1W0U A;  5IOY A;  2RDP A;  3RCO A;  3FHN A;  2CFX A;  3DTI A;  4XLH A;  1MMS A;  1E3H A;  3FXK A;  1MMN A;  3GTG J;  3MEX A;  1N75 A;  2PJR A;  4UVA A;  2FOK A;  1R5G A;  1EJ9 A;  5ICE A;  3M8J A;  1MJA A;  4S04 A;  4PZJ A;  1F4K A;  1XGS A;  2FEZ A;  3HB9 A;  3M3Y J;  1V54 H;  1O3R A;  2HI3 A;  5LFA A;  1I5Z A;  3NQO A;  2OD5 A;  2YPR A;  1AWC A;  1XMK A;  2UUZ A;  3ZQH A;  1QA6 A;  3L00 A;  4ZTF A;  3IRQ A;  4HDV A;  1I1S A;  4AVP A;  3EPZ A;  3G4S I;  4RGX A;  2Q2E B;  2GWR A;  4QPO A;  2DDA A;  1FY7 A;  3DLL F;  3H3V K;  3GFJ A;  2K02 A;  4CCK A;  4Y7N J;  3BG5 A;  5E1Z B;  1Z05 A;  2HU9 A;  4FTH A;  2HFH A;  2OCC H;  1U9N A;  5D8K B;  5ICF A;  1S8N A;  2CH0 A;  3VEP A;  4V19 K;  2CGP A;  4YFX F;  2QVO A;  4XRS A;  1KQ9 A;  2QQ9 A;  1OMI A;  3H9J A;  2LDU A;  2V6E A;  3ABM H;  4KNY A;  4O3M A;  2PX9 A;  3GBG A;  4HG2 A;  3RPQ A;  2JJ7 A;  3VOD A;  5J1Y A;  2EIL H;  3C3W A;  3ZMS A;  3CCR I;  2HYG D;  4ESJ A;  3ZMV A;  3ZQ7 A;  4ZYG A;  1EF4 A;  2HKO A;  2MC3 A;  4L18 B;  1ZGJ A;  3DPL C;  2XRL A;  3FBI B;  3KP4 A;  2VPL A;  1T39 A;  1X1A A;  1WSU A;  4G6Q A;  4M71 A;  4BHP A;  3L09 A;  4U87 A;  3W6K B;  1LKX A;  2VPR A;  1YFH A;  1IRZ A;  2K3F A;  4ENJ A;  2BVM A;  2N8G A;  1IF1 A;  1V5E A;  2EFW A;  5EGO A;  2A6T A;  3N05 A;  3BDD A;  2R7F A;  4IRH A;  3EYY A;  3K4M A;  1R22 A;  1OYI A;  2EK5 A;  4B09 A;  1F36 A;  1K78 A;  2LKP A;  2NS8 A;  2MW8 A;  3OYI A;  4U88 A;  5A2Q Z;  2O9L A;  3I53 A;  1LFP A;  3BZK A;  3CJR B;  3FX3 A;  2XHK A;  4N4N B;  2ZXH A;  1MMA A;  1VQ8 I;  5D5X B;  1Z1D A;  3AL0 C;  3SJM A;  2LP0 A;  2BZT A;  3DP7 A;  4M3D A;  5L3G A;  4IO9 F;  2R7O A;  3CLO A;  2WAD A;  5CYV A;  5F0C A;  2RAE A;  2E35 A;  3MAJ A;  3LST A;  3ERM A;  4XRM A;  2OAZ A;  4Q5S F;  2VBZ A;  3CCE I;  2DLL A;  4XLP F;  3VDX A;  2FQ4 A;  2UWM A;  1MZB A;  1ORK A;  3E6C C;  4GCV A;  2IEK A;  3QP5 A;  3AG3 H;  2X6O A;  2ZME B;  4ZZL A;  1BM9 A;  4E7K A;  1R58 A;  3VSL A;  5EG0 A;  1XS9 A;  2L54 A;  4KJZ A;  4FE7 A;  4IJA A;  5F04 A;  1SEU A;  4ZDL A;  2QSF X;  3DQV C;  3M7G A;  2HKX A;  1BOB A;  3FM3 A;  1ZQ3 P;  3PSF A;  4W97 A;  1ETX A;  4BJT A;  3JRD A;  1A5J A;  1K6O A;  5FRN A;  3CCJ I;  1IN5 A;  3HZJ A;  4RB0 A;  5IYD J;  1TWF J;  3GXO A;  3OYC A;  3HUG A;  1O7F A;  1S29 A;  1VI0 A;  3OV8 A;  1J09 A;  3G3Z A;  1BN5 A;  5L3D A;  2EV6 A;  5FLM J;  1MMG A;  5KK1 A;  4AC0 A;  5FLX Z;  2OTL I;  4F3Q A;  3GYH X;  2MFZ A;  4UUS B;  3T5X A;  4XN3 A;  4IQJ A;  3E0J B;  3CUQ C;  2ZJP F;  3JRB A;  3DF8 A;  4LD5 A;  3F22 A;  2ADU A;  2EIM H;  3O8H A;  4BXU A;  1OPC A;  4HRI A;  3GCM A;  2DT5 A;  1KA8 A;  4G7H F;  1Z7U A;  4MEY F;  2LKX A;  1MGT A;  3GLX A;  4MO7 A;  4AIH A;  3IC7 A;  3GTM J;  2PFB A;  1JUM A;  4CUG A;  2Y75 A;  4U0Y A;  2O6G E;  2MLK A;  5GPC A;  1ZKG A;  2EIJ H;  1YW8 A;  3S93 A;  5HLH A;  1RIO H;  3GME A;  4P1W A;  5F27 A;  2JWT A;  1ZAO A;  1FBQ A;  4O6J A;  5BPD A;  3G1M A;  4RBO A;  3K4L A;  3H5R A;  2M1B A;  2DK8 A;  5L3C A;  5C44 J;  2DYS H;  1L3L A;  2HPM A;  1XSD A;  2EA2 A;  2KHM A;  1SAN A;  1SFK A;  3TW6 A;  3AFH A;  1UG2 A;  1RRJ A;  4BDY A;  2HOT A;  3OYE A;  2X1D A;  3K4J A;  3LSP A;  1BOA A;  2EZH A;  1TWG J;  2A05 A;  5BQT A;  1LE8 A;  1R49 A;  1D5Y A;  2DA4 A;  1YJ9 I;  2H8W A;  2HTS A;  4OU0 A;  1FOK A;  5GAD J;  3VYT B;  4AIJ A;  2R92 J;  2E7X A;  2P5L C;  2IBD A;  2VKV A;  1ZGW A;  1JGG A;  4GYI A;  3BR6 A;  4I09 A;  1YHQ I;  3RIR A;  3CUQ A;  3HSE A;  4ENK A;  2NS0 A;  1H89 C;  2GZW A;  2W48 A;  3OYA A;  2HDC A;  1JE8 A;  2FUG 2;  2IA1 A;  4RM2 A;  4XL9 A;  2R7S A;  3G71 I;  2MD5 A;  2LNB A;  3HOZ J;  2EFP A;  2OUM A;  3NWT A;  1QU3 A;  2BE5 F;  1P9Q C;  3B6A A;  2DCE A;  3OY9 A;  2D5V A;  2NAZ A;  3TKY A;  4IL6 C;  3ZN0 A;  4WWC A;  4V2F A;  2W25 A;  3I59 B;  4FET A;  1JT0 A;  3BQZ A;  4A0X A;  2VJ5 A;  4YG2 F;  3QU3 A;  2HWV A;  1BR1 A;  5IYC J;  2NXN B;  2BXY A;  4Y52 J;  2E34 A;  3AAF A;  2QKM B;  1TQP A;  4GDF A;  2DO7 A;  4WXC A;  3OIP A;  4G7Z F;  1NK3 P;  5IT9 Z;  2DQL A;  1ZAR A;  3IUO A;  1QZY A;  3PM1 A;  4PGG A;  2XF7 A;  2Y48 A;  1VF9 A;  2QEN A;  3ZP5 A;  4JBA A;  1IRX A;  4ESB A;  4I01 A;  1F43 A;  3RKW A;  2BVL A;  2CV1 A;  1TWA J;  3M9A A;  1OQY A;  4IEJ A;  1DPU A;  2FSW A;  1MIJ A;  1W0T A;  2DT6 A;  1FOX A;  4ENM A;  4CCJ A;  5IY5 H;  1VFC A;  3H0G J;  3F8F A;  2WAQ A;  4E7Z A;  4V2G A;  4AYB A;  5KVR A;  1RUO A;  3K4B A;  3KZI C;  3LMM A;  1W4M A;  3S14 J;  2QA4 I;  2V79 A;  4M73 A;  2GM4 A;  3QWL A;  1MJB A;  4GRI A;  1HKS A;  3DFG A;  1LJ9 A;  2KDO A;  5J40 A;  3BG3 A;  5FJ8 J;  4IHY A;  3E7L A;  3RQI A;  1MBK A;  1Z0X A;  1ZHF A;  3I5U A;  4DYC A;  3FZV A;  4B3A A;  1UST A;  4LIT A;  1G8X A;  4BL0 B;  1R23 A;  2CQN A;  4HOB A;  1KZH A;  2YSR A;  3TP3 A;  3HBL A;  3KYL A;  1GUU A;  2ZME C;  3IRR A;  1D3Y A;  4ABZ A;  2LF7 A;  2ISY A;  3JRC A;  3P5J A;  1OCZ H;  1TBX A;  1AKH A;  3CZ6 A;  4Q48 A;  1TP4 A;  2H1L A;  3S8P A;  2H6B A;  2OF7 A;  2XUB A;  3DBR B;  3LSR A;  2R7R A;  4UB8 C;  1WFX A;  4HYE A;  3LA2 A;  4GFB A;  3IKV A;  4ZDO A;  2W4S A;  1M1E B;  1DPR A;  1VQ9 I;  2GIZ A;  2HOE A;  2VT3 A;  4O5V A;  3JRE A;  1UMQ A;  1R5I D;  5DUI A;  3DEU A;  5M3M J;  3QAH A;  4ASN A;  1HC8 A;  3K7A J;  4JX4 A;  1SMT A;  4ZDP A;  2H6C A;  2FQ3 A;  3QOD A;  3TW7 A;  1Z9C A;  2WB1 A;  4F55 A;  3DTE A;  5AIP A;  1P4X A;  3OS1 A;  3VYS B;  2OZ6 A;  1FYK A;  1T6S A;  4L5E A;  4OMY A;  2ZC2 A;  5FFZ A;  5K7Z A;  2XAF A;  1LFU P;  1A04 A;  2GAU A;  1YO5 C;  2V1X A;  2VIX A;  2CS3 A;  4AVZ A;  4UUV A;  2NRA C;  5TIS C;  4C3H J;  4CCO A;  5TJJ A;  1WHU A;  5IOZ A;  2JSP A;  1GT0 C;  1QPM A;  2P5V A;  2ZME A;  1W5C C;  3W6J B;  1X58 A;  1T33 A;  3DKX A;  3M8F A;  1WJC A;  2Z99 A;  2HOA A;  3WTX C;  3HOT A;  1QRY A;  4HBL A;  2QM3 A;  1J7K A;  1X4P A;  3W2W A;  3BG9 A;  2DOA A;  3ZQC A;  2JA7 J;  2FBH A;  3E97 A;  1FYL A;  3JTG A;  4FHT A;  2VJ4 A;  2RQP A;  3VOE A;  1GHC A;  3I4P A;  1TL8 A;  2E1C A;  1TZL A;  3D5S C;  3OYL A;  1O4X A;  1B1B A;  4RM3 A;  5C4X J;  2KPM A;  2V9K A;  4UUS A;  3I54 A;  4NHJ A;  3FHZ A;  1QZZ A;  1OR7 C;  4HW0 A;  2R7D A;  2UV1 A;  1BI1 A;  1NHA A;  2RC4 A;  2IPQ X;  1I50 J;  3OYN A;  4NDL A;  1H88 C;  4XNF A;  3C2H A;  1PYV A;  3IAM 2;  1USS A;  3CCM I;  1BJZ A;  3HKZ N;  1PVE A;  1G2H A;  5F1R A;  4XKB A;  3S1R J;  2BY3 A;  5KAI C;  3KP6 A;  1ZR2 A;  2G0E A;  3OR2 C;  5LHH A;  2H09 A;  3ISP A;  3F21 A;  4BHC A;  2VON A;  3KZZ A;  3E6M A;  2IGM A;  2HVS A;  1P7I A;  2KL4 A;  3PJR A;  3H92 A;  5E3M A;  1APL C;  5D4R A;  5DM7 F;  4PJ0 C;  3ZXS A;  1Y1W J;  4LLG F;  1R7J A;  3BJA A;  5GPA A;  1Z6R A;  2CMP A;  1ZN2 A;  1ETY A;  4HNV A;  3ZMD A;  4F93 B;  1OCC H;  3E1S A;  4M9Z A;  5EYR A;  1UJ8 A;  2FBK A;  1YYV A;  3GZ6 A;  1MD0 A;  5J8C A;  4HF2 A;  1K7A A;  3S3N A;  3U9G A;  1Y56 A;  1HF0 A;  2P5K A;  4KMU X;  2L4M A;  3J80 K;  3G1L A;  5K5Q A;  3S16 J;  5BNG A;  1E3P A;  1OR7 A;  2E1M B;  1WJA A;  3BTC A;  4BXF A;  2IS1 A;  1UHW A;  3GTJ J;  2XV4 S;  1S9H A;  4Q4Z F;  2ZJQ F;  3CCV I;  1N77 A;  1KU7 A;  1HDP A;  1WPK A;  3V7C A;  1JT6 A;  3LNQ A;  2IP2 A;  1ZEL A;  2LY1 A;  4XSZ F;  2XKO A;  4LK0 F;  2A61 A;  3DLA A;  5LGU A;  2XC7 A;  4XID A;  2MGQ A;  4BJ5 C;  3WHC A;  1JI8 A;  2DA2 A;  3I59 A;  1Z3X A;  3U2R A;  1BI0 A;  1T2K A;  3CTA A;  3ROU A;  4DOZ A;  1WQ2 A;  2RVC A;  2X85 A;  3RKX A;  3N4M A;  1G3T A;  4B1R A;  4CSW A;  1XD7 A;  5JVG F;  4XRF A;  3ASN H;  2STW A;  3R6S A;  4A3M J;  2VAS A;  2R7Q A;  2K85 A;  1TNT A;  2BGC A;  3CD6 I;  4CCN A;  2ICW G;  2NVY J;  1U5T B;  5K7F A;  3HRM A;  3LA7 A;  2EQR A;  1Y0N A;  1E2X A;  5J4V A;  4C2M J;  1K4T A;  3IH3 A;  4CYD A;  1SVM A;  2HGC A;  2Y31 A;  1R5H A;  4LMY A;  3CCY A;  3ZMZ A;  5HDK A;  3GTL J;  1JHF A;  4K2E A;  4EGY A;  1U9O A;  4BYY A;  2XGE A;  2IGO A;  2CRG A;  4MFE A;  1VQ7 I;  4IHS A;  2DQR A;  3OIQ A;  3ABL H;  4RAF A;  4XLA A;  1EA3 A;  1IRF A;  3KE2 A;  1R9T J;  4OAZ A;  1WI9 A;  2ECB A;  4BS9 A;  1Q1H A;  5H6R A;  4M3B A;  3Q3S A;  1FZP B;  1J5Y A;  2E71 A;  5LRR A;  1TTY A;  1W7P A;  4NQW B;  2IXS A;  3E6B A;  4G6T B;  2DXI A;  1PP8 F;  2ZXW H;  3S3M A;  1ZG1 A; 
#chains in the Genus database with same CATH homology
 2QBY B;  4WX9 A;  2VN2 A;  3LQR A;  4LLL A;  2VXZ A;  2YU3 A;  3FWE A;  4EMS A;  1EV7 A;  1HQC A;  2RV8 A;  3BJO A;  2OQG A;  1LQ1 A;  1ZG5 A;  4BQA A;  2E7W A;  4G9Y A;  2A6E F;  1RZ4 A;  2O0Y A;  3FM5 A;  5HVQ C;  1ZRF A;  5ERI A;  5IT3 A;  3RPU A;  4ENN A;  2VOD A;  3FMQ A;  2G7U A;  3DKW A;  5DD4 A;  4UHT A;  5FO5 A;  3WTZ A;  3J81 K;  5BMZ A;  4B8X A;  2F5D A;  2V1D A;  4BH9 A;  2Q8K A;  1ZRE A;  3E5U A;  1FLI A;  5E1X A;  2ZBK A;  3KP3 A;  1BC8 C;  1HKQ A;  3PQK A;  4P5O A;  3IL2 A;  3GW2 A;  3BOQ A;  3WTV C;  2CYY A;  3VB2 A;  5DEQ A;  1Y0U A;  2K27 A;  4EJV A;  2ZNZ A;  2RGV A;  4HLY A;  4CGZ A;  3O3K A;  1CGP A;  2IVM A;  2MA3 A;  1FT9 A;  1HST A;  4A6E A;  3P9I A;  4P9F A;  1VTN C;  6PAX A;  3E5Q A;  5JI6 A;  2L02 A;  2Q0O A;  4KN4 X;  1PP7 U;  5JHU A;  2CO5 A;  1G4D A;  4G6D A;  5FB2 A;  4A0Z A;  3SZT A;  4L9J A;  1H0M A;  2M30 A;  3HOS A;  4LB5 A;  1FP1 D;  3RTR A;  1R1T A;  3P9C A;  2K86 A;  1P4W A;  1I27 A;  4HF0 A;  3V7R A;  2AS5 F;  2QYO A;  4S05 A;  5ICC A;  5DV5 A;  4HQM A;  3C7J A;  4UV8 A;  1EH8 A;  4AWX B;  3BZ6 A;  1J0R A;  4UNO A;  3MQ0 A;  2EFO A;  1U5T C;  3TOA A;  2MBF A;  3LA3 A;  2X4H A;  1OYW A;  2ZJ2 A;  1FP2 A;  5DD8 A;  1WKM A;  3FF5 A;  3TO6 A;  3HRT A;  3NEU A;  2EV0 A;  2G9W A;  4MEX F;  2HZT A;  3TGN A;  2GXB A;  1R00 A;  1U3E M;  1P2F A;  5CVV A;  5ICG A;  2V6C A;  2NNN A;  3OOP A;  2EWN A;  3JAM Z;  4MTE A;  2UZK A;  2ESN A;  4G94 A;  1FBU A;  2HQR A;  1ZH5 A;  1RUN A;  1BIA A;  2HS5 A;  3QP6 A;  3SHF A;  5L3B A;  2XIG A;  2KJB A;  2XKP A;  5DCF A;  4KUM A;  1XN7 A;  3CO6 C;  2BEO A;  4KIB A;  4XBF A;  3JTH A;  4U0W A;  2D1V A;  2MLG A;  2HTJ A;  4IVN A;  5K5O A;  1V3F A;  4RS8 A;  4ON0 A;  2YX4 A;  3KLO A;  3F6O A;  3PFI A;  3GEZ A;  3KZY A;  3JW4 A;  1JHH A;  2LF8 A;  3CJN A;  1FX7 A;  3KET A;  1DDN A;  2E1N A;  3H3U A;  2W24 A;  1L0O C;  4OIR F;  1FYM A;  3E5X A;  2QBY A;  2VOO A;  4JK1 X;  5E17 F;  3K1M A;  4A6D A;  1STZ A;  1KYW A;  2B0L A;  3F6V A;  5E18 F;  2A5Y B;  4A12 A;  1XB4 A;  1T38 A;  2AXL A;  2Z9O A;  4IRI A;  5EEG A;  2FF4 A;  2V1U A;  4HLX A;  1SFU A;  1O3Q A;  1JXS A;  3LAP A;  1P92 A;  3V8K A;  1PUE E;  2GQQ A;  1V4R A;  2DW4 A;  4IHT A;  1MJ9 A;  3HHH A;  1XGN A;  3BP8 A;  2ZXJ A;  5ILU A;  2JPB A;  4UVC A;  4EQQ A;  2DFI A;  3SXY A;  4HV6 A;  4A2U A;  2A6H F;  3REO A;  3F72 A;  3F8N A;  1IN4 A;  4LG0 B;  2Q2E A;  2WV0 A;  4U7B A;  1ZGA A;  3SZP A;  4IXA A;  3WTU C;  2QWW A;  2ETH A;  3WTT C;  1LDJ A;  5HLI A;  2RKH A;  2UXN A;  1UFM A;  3QU6 A;  1BC7 C;  2ZFW A;  1BI3 A;  2QQB A;  2K4J A;  5A2Q K;  1LEB A;  3GF2 A;  5LEJ A;  1LNW A;  3EDP A;  4HA8 A;  2P7C B;  5FGM A;  4ZYD A;  2QLZ A;  3RJP A;  2GXG A;  4DQ2 A;  3LQQ A;  1ZRD A;  3R4K A;  3WGI A;  1KGS A;  4RGR A;  1G3W A;  2FNA A;  3RYR A;  2ZCW A;  4KIG A;  1XCB A;  1QNT A;  3D0S A;  2LSO A;  1KQ8 A;  4Y17 A;  3GVA A;  3HRU A;  1J75 A;  1G3S A;  3F3X A;  3P9K A;  2PN6 A;  3Q9S A;  5LRS A;  5K1Y A;  4RGU A;  3BRO A;  1IZ1 A;  1GXP A;  4EJT A;  5FLX K;  2DPU A;  1SD6 A;  4U0V A;  2COM A;  2W84 A;  2TDX A;  3IHU A;  3B02 A;  3TDU C;  4I0B A;  3FMR A;  4WXH A;  2CG4 A;  3BPX A;  1KU3 A;  2DTR A;  1Z91 A;  1WRJ A;  2CW0 F;  5LHG A;  4KFC A;  5DCM B;  3V7S A;  3CO7 C;  3F8M A;  3JSO A;  2KJC A;  2PMH A;  4KN7 X;  5DUK A;  2JT1 A;  3BY6 A;  5LBQ A;  1KU9 A;  2PLY A;  1HXD A;  1TLH B;  2NYX A;  2JZY A;  2P4W A;  3SQN A;  5L3F A;  3KCC A;  4M6X A;  1IXC A;  4QLC U;  3ECO A;  2H27 A;  1OYY A;  1XSV A;  4EVI A;  2M8E A;  1EH7 A;  4L5J A;  1K79 A;  2EV5 A;  2PI0 A;  2KRF A;  4A0Y A;  5FD6 A;  5HLG A;  2PMU A;  3C18 A;  4MQ9 F;  3RI4 A;  2XAJ A;  2XAS A;  4AD9 A;  2F5E A;  4HQE A;  3WTS C;  2DK5 A;  5IT9 K;  4ZH4 F;  4ZZD A;  1KQ0 A;  1QO0 D;  2FML A;  1J59 A;  1TQI A;  3MZY A;  4L9T A;  3T8R A;  2XRN A;  3ZPL A;  2KIU A;  2FA5 A;  3MWM A;  4N0B A;  4CDG A;  2R3S A;  2A3S A;  3COA C;  3NRV A;  2DU9 A;  5L3E A;  4GYG A;  3L7W A;  5D8L B;  5ILS A;  4WCG A;  3HHG A;  1QGP A;  1HW2 A;  4GXO A;  4LG0 A;  1RNL A;  2WTE A;  5CVI A;  3FXU A;  1DUX C;  5LEK A;  1GXQ A;  1TNS A;  2BYV E;  2H94 A;  4H0E A;  4CO8 A;  3EQL F;  2STT A;  2YX7 A;  1R1U A;  2RN7 A;  4OMZ A;  2IA0 A;  2GA1 A;  3TO9 A;  4HX4 A;  1U6G A;  3DV8 A;  5AON A;  3O6B B;  3I58 A;  2PG4 A;  3V8J A;  2IA2 A;  3KP2 A;  4WK8 F;  1F9N A;  4D0P A;  1R1V A;  3V4G A;  2CQK A;  4NB5 A;  1U8R A;  3TQN A;  3F23 A;  2CWE A;  5ED4 A;  1W7P D;  1ZRC A;  2W57 A;  1HW1 A;  5LLQ A;  1MDM B;  3FXR A;  4LFU A;  5LHI A;  4KDP A;  4LGW A;  5D6F A;  3K0L A;  4KYW A;  2O61 A;  4G7O F;  5F6F A;  4HF1 A;  3I71 A;  4UV9 A;  4L9N A;  5DDG A;  4HDU A;  2D1H A;  1BI2 A;  2ISZ A;  2YR2 A;  1HKT A;  1B4A A;  2ESH A;  3H3Z A;  4LB6 B;  1HW5 A;  1I6X A;  1MKM A;  4Y15 A;  5HOO A;  4IF4 A;  4ZYE A;  1KU2 A;  3M1E A;  2J5O A;  2G7H A;  2IRF G;  4FX4 A;  2HQN A;  1J2X A;  3K1N A;  1R36 A;  4I98 B;  4OIQ F;  1XGO A;  2FNP A;  2FMY A;  4FX0 A;  4N9I A;  2X0L A;  3KP7 A;  2O3F A;  4I02 A;  5E20 A;  5DCM A;  4YFN F;  1LVA A;  1SFX A;  2HYF A;  1IXR C;  4WF2 A;  3MZH A;  5D6E A;  1IAW A;  4M9X A;  2Z5U A;  4I2O A;  5FD5 A;  1E17 A;  2EB7 A;  2F5C A;  3F8B A;  4P9U A;  4EJW A;  1FWZ A;  3KLN A;  1ODD A;  4DNC A;  5E8I A;  1SFE A;  2CSO A;  4EJU A;  5LGN A;  1SD7 A;  2HR3 A;  4HAM A;  3RDI A;  2GA2 A;  2PEX A;  4WXD A;  1W5S A;  1JGS A;  2PQ8 A;  1XCV A;  2GIV A;  3GFM A;  2ACJ A;  4FT8 A;  3QPT A;  3R0A A;  1XGM A;  2F2E A;  5AIQ A;  1IW7 F;  2VBW A;  4CIC A;  1YTY A;  2RNJ A;  2A69 F;  1TQM A;  1REP C;  2EA4 A;  5CVU A;  1O3T A;  2L01 A;  2KIM A;  4XSX F;  5F64 A;  1S7A A;  4R1H A;  3GZ5 A;  2DPD A;  1FC3 A;  1C0W A;  4CXF A;  3ML6 A;  1GVJ A;  1TW3 A;  3TDZ C;  1G3Y A;  1QBJ A;  4YIF A;  3G73 A;  1FSE A;  4CZZ A;  1U5T A;  5HDG A;  1IXS B;  1G6N A;  1X3U A;  2IJL A;  4MNU A;  2EFN A;  3GWZ A;  4EM2 A;  3QPH A;  3ABT A;  2QZ8 A;  4HZF A;  2JPC A;  1PDN C;  3M8E A;  3KFW X;  4ESF A;  5J6X A;  3GX4 X;  1FPQ A;  3BWG A;  3V8L A;  2DAO A;  2PBI A;  1BJA A;  2D45 A;  4BHB A;  1LDD A;  4CHU A;  2VE8 A;  5J8F A;  4NQW A;  5D5W B;  2XVC A;  3ABU A;  2IT0 A;  3WE2 A;  4M9S A;  1YW9 A;  2DBB A;  4I7H A;  2P6T A;  4MTD A;  2Y0M A;  2IW5 A;  1MDM A;  5CVR A;  1F1Z A;  1BIB A;  3FXQ A;  2M45 A;  1UHM A;  1ULY A;  1IUY A;  1LDK B;  1HSJ A;  5HS8 A;  1S6L A;  3DPT A;  3ULQ B;  1UB9 A;  3SFZ A;  3HSF A;  3L9F A;  3J7A O;  3T1B A;  5JR3 A;  3K2Z A;  2WWY A;  5HDN A;  4G8X A;  2Z33 A;  1FSH A;  1RI7 A;  3IWF A;  2EFQ A;  1HBX G;  2DI3 A;  4RAY A;  1ON1 A;  2UXX A;  5BOX A;  1AOY A;  4AIK A;  4LK1 F;  3HRS A;  4E70 A;  2A07 F;  2OQR A;  4Z2Y A;  2Z3Y A;  3C1D A;  3GUD A;  3HSR A;  5EEH A;  2VT2 A;  3EET A;  2ELH A;  2FBI A;  4BAY A;  5D5V B;  4ETS A;  5K5R A;  2JSC A;  4RB3 C;  1ZYR F;  3J80 Z;  3KP5 A;  1O7L A;  1IRG A;  1D8K A;  3BPV A;  3S2W A;  1P4A A;  1B6A A;  1YIO A;  4KIF A;  3IWZ A;  4BNC A;  3WU0 A;  1Z6T A;  1J9I A;  4RAZ A;  3FMS A;  4PDK A;  3MFK A;  2XAH A;  3Q5F A;  4RGS A;  4MQV A;  4M6Y A;  2FRH A;  3WG9 A;  2K7L A;  2VOP A;  3LAJ A;  3E6D A;  5JFR A;  3K9T A;  4HX8 A;  4KMF A;  3WTW C;  3WU1 B;  3JAM K;  5HS9 A;  2VC0 A;  3ELK A;  1W7P B;  4MGR A;  3IKT A;  1T0F A;  2ZNY A;  4HV5 A;  4LLN A;  5H20 A;  3ZN1 A;  4R79 A;  2QQA A;  3RKY A;  2M87 A;  1ON2 A;  2P7V B;  1O57 A;  1IN8 A;  2KKO A;  3Q9V A;  2VBY A;  2OU2 A;  3I64 A;  2O8X A;  3KEQ A;  5BS6 A;  4RB1 A;  2XAQ A;  3R0J A;  4YII A;  3GO5 A;  1S7O A;  3TOB A;  1CF7 B;  3QOP A;  4MHG A;  3I0T A;  1DP7 P;  5TRD A;  1SD4 A;  1EH6 A;  2XGX A;  2K4B A;  2EJR A;  1LB2 A;  2MH2 A;  3EUH A;  4OOI A;  1SMY F;  2VBX A;  2QUF A;  2J5P A;  3R60 A;  3WGG A;  1KYZ A;  2ZO4 A;  3PQJ A;  3L2C A;  1TW2 A;  4GO1 A;  4OIN F;  2KIF A;  4KIC A;  3QRF F;  4EGZ A;  2P6S A;  3P7N A;  1F5T A;  3U1D A;  3J81 Z;  3ZMU A;  5DYM A;  4UVB A;  3KEO A;  1B59 A;  2L4A A;  5E8G A;  4PCQ A;  4EJO A;  4M72 A;  1YS6 A;  3WOD F;  2V9V A;  3BJ6 A;  4UXN A;  2W85 A;  1B9M A;  2OZU A;  1BBY A;  2FU4 A;  3VFZ A;  2XRO A;  4OIO F;  3ERE D;  2NNY A;  4LJZ F;  5LGT A;  1W5T A;  3WE3 A;  5ILV A;  4U7D A;  3D5L A;  4L9V A;  1ZLK A;  5FFX A;  4XLN F;  2WC2 A;  3O2P E;  4QWQ A;  4RB2 C;  1FBS A;  1OKR A;  1LEA A;  2L3D A;  1YQA A;  4P55 A;  4L0Y B;  2M5W A;  1IN6 A;  2ZKZ A;  4N9H A;  4IPA A;  3EYI A;  3ZMT A;  3DXJ F;  1K78 B;  2FXA A;  1YW7 A;  3WTY C;  3HTS B;  2OBP A;  5JVT A;  2D2W A;  5BPI A;  4ZYH A;  4EM0 B;  4EV0 A;  2C6Y A;  5E1W A;  2A68 F;  3LWF A;  1SAX A;  1WWX A;  5CLS A;  4KA4 A;  4OIP F;  1D5V A;  1ONV A;  1H9G A;  2P8T A;  4JQF A;  1YS7 A;  4M74 A;  2PJP A;  2JTV A;  3HIF A;  1U78 A;  2XAG A;  3N97 A;  2FE3 A;  1YLF A;  1IN7 A;  2VC1 A;  4IRG A;  4I0A A;  3T8T A;  1D8J A;  3T0Y A;  3RYP A;  4R8H A;  1XDS A;  5CJ9 A;  1FNN A;  3HTU A;  5CVJ A;  3TO7 A;  4F7Z A;  3GFI A;  5H6Q A;  3K1P A;  1S3J A;  3HYI A;  1O3S A;  2HEO A;  3WGH A;  1QQI A;  2JRT A;  2OA4 A;  1YG2 A;  2MH9 A;  3CUO A;  4HX7 A;  1ZLJ A;  4L5I A;  1T98 A;  4P96 A;  2BV6 A;  4EM1 A;  1SD5 A;  1P6R A;  1XSX A;  2BBY A;  2O03 A;  4Q47 A;  3JSP A;  3E3V A;  3F8C A;  1I1G A;  4L0Z B;  2VE9 A;  4GGG A;  4PGH A;  4A5N A;  4Y13 A;  5D4S A;  4YFK F;  1H9T A;  1B9N A;  1XMA A;  3ECH A;  1ZG3 A;  1XDU A;  4KT5 C;  1CF7 A;  3GFL A;  3B73 A;  3LFK A;  3R61 A;  2F5F A;  3CUQ B;  3MCZ A;  3K69 A;  1UCR A;  3CDH A;  4TV7 A;  5HS7 A;  5D5U B;  1U2W A;  4A5M A;  2RDP A;  2CFX A;  3MEX A;  4UVA A;  2FOK A;  1R5G A;  5ICE A;  1MJA A;  4S04 A;  4PZJ A;  1F4K A;  1XGS A;  2FEZ A;  1O3R A;  1I5Z A;  3NQO A;  2OD5 A;  2YPR A;  1AWC A;  1XMK A;  3L00 A;  3IRQ A;  4HDV A;  1I1S A;  4AVP A;  4RGX A;  2GWR A;  1FY7 A;  3GFJ A;  2K02 A;  5E1Z B;  1Z05 A;  2HFH A;  5D8K B;  5ICF A;  1S8N A;  3VEP A;  2CGP A;  4YFX F;  2QVO A;  1KQ9 A;  2QQ9 A;  1OMI A;  2LDU A;  4KNY A;  4O3M A;  3RPQ A;  3VOD A;  3C3W A;  3ZMS A;  2HYG D;  4ESJ A;  3ZMV A;  3ZQ7 A;  4ZYG A;  2HKO A;  2MC3 A;  4L18 B;  1ZGJ A;  3DPL C;  3KP4 A;  1T39 A;  1WSU A;  4G6Q A;  4M71 A;  4BHP A;  3L09 A;  3W6K B;  1YFH A;  4ENJ A;  1IF1 A;  2EFW A;  3BDD A;  2R7F A;  4IRH A;  3EYY A;  1R22 A;  4B09 A;  1OYI A;  2EK5 A;  1K78 A;  2LKP A;  4U88 A;  5A2Q Z;  3I53 A;  3FX3 A;  2XHK A;  5D5X B;  1Z1D A;  3DP7 A;  5L3G A;  3CLO A;  5CYV A;  3MAJ A;  3LST A;  2OAZ A;  4Q5S F;  2VBZ A;  2DLL A;  4XLP F;  2UWM A;  1MZB A;  3E6C C;  4GCV A;  3QP5 A;  2ZME B;  4ZZL A;  1BM9 A;  1R58 A;  2L54 A;  4IJA A;  3DQV C;  3M7G A;  2HKX A;  3FM3 A;  1K6O A;  1IN5 A;  4RB0 A;  3GXO A;  3HUG A;  1O7F A;  1S29 A;  3OV8 A;  3G3Z A;  1BN5 A;  5L3D A;  2EV6 A;  5KK1 A;  5FLX Z;  3GYH X;  3T5X A;  3CUQ C;  3DF8 A;  4LD5 A;  3F22 A;  2ADU A;  4BXU A;  1OPC A;  2DT5 A;  1KA8 A;  4G7H F;  1Z7U A;  4MEY F;  1MGT A;  3GLX A;  4AIH A;  3IC7 A;  2PFB A;  2Y75 A;  4U0Y A;  2O6G E;  2MLK A;  5HLH A;  1YW8 A;  1RIO H;  1ZAO A;  1FBQ A;  4O6J A;  5BPD A;  2M1B A;  2DK8 A;  5L3C A;  1L3L A;  1XSD A;  2EA2 A;  1BOA A;  5BQT A;  2HTS A;  4OU0 A;  1FOK A;  4AIJ A;  2E7X A;  2P5L C;  4GYI A;  4I09 A;  3RIR A;  3CUQ A;  3HSE A;  4ENK A;  2NS0 A;  2GZW A;  2HDC A;  1JE8 A;  2IA1 A;  2MD5 A;  2LNB A;  2EFP A;  2BE5 F;  2NAZ A;  3TKY A;  3ZN0 A;  4WWC A;  2W25 A;  3I59 B;  4A0X A;  4YG2 F;  3QU3 A;  2HWV A;  3AAF A;  1TQP A;  2DO7 A;  4WXC A;  4G7Z F;  5IT9 Z;  2DQL A;  1ZAR A;  1QZY A;  4PGG A;  2Y48 A;  2QEN A;  3ZP5 A;  4JBA A;  4ESB A;  4I01 A;  3RKW A;  3M9A A;  1DPU A;  2FSW A;  4ENM A;  3F8F A;  5KVR A;  1RUO A;  1W4M A;  2V79 A;  4M73 A;  1MJB A;  1HKS A;  3DFG A;  1LJ9 A;  1ZHF A;  3I5U A;  3FZV A;  1UST A;  1R23 A;  4HOB A;  2YSR A;  3IRR A;  1D3Y A;  2LF7 A;  2ISY A;  1TBX A;  4Q48 A;  2H6B A;  2XUB A;  4HYE A;  3LA2 A;  3IKV A;  1DPR A;  2HOE A;  2VT3 A;  4O5V A;  5DUI A;  3DEU A;  3QAH A;  4ASN A;  1SMT A;  2H6C A;  2FQ3 A;  1Z9C A;  5AIP A;  1P4X A;  2OZ6 A;  1FYK A;  1T6S A;  4OMY A;  5FFZ A;  2XAF A;  1A04 A;  2GAU A;  1YO5 C;  2V1X A;  4UUV A;  2NRA C;  5TJJ A;  1QPM A;  2P5V A;  2ZME A;  3W6J B;  3M8F A;  2Z99 A;  3WTX C;  3HOT A;  4HBL A;  2QM3 A;  1J7K A;  2FBH A;  3E97 A;  1FYL A;  3JTG A;  4FHT A;  2RQP A;  3VOE A;  1GHC A;  3I4P A;  2E1C A;  1B1B A;  3I54 A;  4NHJ A;  3FHZ A;  1QZZ A;  4HW0 A;  2R7D A;  1BI1 A;  1NHA A;  2RC4 A;  2IPQ X;  1USS A;  5F1R A;  3KP6 A;  5LHH A;  2H09 A;  3F21 A;  3ISP A;  4BHC A;  2VON A;  3KZZ A;  3E6M A;  3H92 A;  5D4R A;  4LLG F;  1R7J A;  3BJA A;  1Z6R A;  1ZN2 A;  3ZMD A;  4M9Z A;  2FBK A;  1YYV A;  3GZ6 A;  1MD0 A;  5J8C A;  4HF2 A;  1K7A A;  3U9G A;  2P5K A;  4KMU X;  2L4M A;  3J80 K;  5K5Q A;  1OR7 A;  1UHW A;  2XV4 S;  4Q4Z F;  1KU7 A;  3V7C A;  2IP2 A;  4XSZ F;  2XKO A;  4LK0 F;  2A61 A;  5LGU A;  3I59 A;  3U2R A;  1BI0 A;  1T2K A;  3CTA A;  3ROU A;  1WQ2 A;  2RVC A;  3RKX A;  3N4M A;  1G3T A;  1XD7 A;  4XRF A;  2STW A;  3R6S A;  1TNT A;  2BGC A;  1U5T B;  3HRM A;  3LA7 A;  1E2X A;  4CYD A;  2HGC A;  4LMY A;  1R5H A;  3ZMZ A;  5HDK A;  1JHF A;  4K2E A;  4EGY A;  4BYY A;  4IHS A;  2DQR A;  1IRF A;  3KE2 A;  1WI9 A;  1Q1H A;  5H6R A;  1FZP B;  1J5Y A;  5LRR A;  1TTY A;  1W7P A;  3E6B A;  1PP8 F;  1ZG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...