2HGCA

Solution nmr structure of the yjcq protein from bacillus subtilis. northeast structural genomics target sr346.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
KLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YjcQ protein
publication title Solution NMR structure of the YjcQ protein from Bacillus subtilis. Northeast Structural Genomics target SR346. (CASP Target)
rcsb
source organism Bacillus subtilis
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09639 YjcQ YjcQ protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hgcA00
1IRGA 3T0YA 4ENJA 3L2CA 2QUFA 2CO5A 2HTJA 2VBYA 1JGSA 3FXUA 4KT5C 2VBXA 4I01A 4N9IA 4XSXF 4PZJA 4QWQA 3BJOA 3LA2A 5HDNA 2BEOA 1GXQA 1PDNC 3V8KA 3MAJA 2MD5A 4NHJA 3KETA 5L3DA 2QLZA 2BE5F 1YFHA 2DQRA 3QPTA 2HWVA 1ZRFA 4G8XA 4BXUA 3W6JB 4LGWA 2ZNZA 5CVRA 1H0MA 1GXPA 4A6EA 1IN6A 3O2PE 1J7KA 3FM3A 1KQ8A 2W57A 4N0BA 5FLXZ 1RIOH 3KZYA 3WTYC 1FBQA 3V8JA 2OD5A 4EJUA 1BI3A 4WXDA 2QBYA 1ZREA 3W6KB 3IWZA 3M7GA 1S7OA 1XDSA 1F9NA 5LHHA 4D0PA 2IA1A 3EUHA 2AS5F 1ONVA 2MA3A 4CO8A 2PJPA 2M30A 2QVOA 5A2QK 2QZ8A 1B59A 1P2FA 2P5LC 3V7CA 5LLQA 4I0BA 3GLXA 3DPLC 2L54A 2D45A 1D8JA 2J5PA 4FHTA 2PI0A 3U2RA 4NQWA 4ZH4F 3WG9A 2EFNA 3R4KA 3F72A 3VEPA 3R61A 1E2XA 2DK8A 3MZYA 2VC1A 3TOAA 2F5FA 2HYFA 2V6CA 4GXOA 5L3FA 2YX7A 1IRFA 3LWFA 4ZYGA 3HRTA 2PN6A 4U7DA 3RPUA 1KU3A 3E5XA 1EH7A 3G3ZA 3C1DA 1TW2A 1FC3A 1LVAA 5FFZA 5FD5A 1H9TA 3HOSA 4LK0F 5JFRA 3CTAA 2W25A 4ENKA 4CYDA 3KP6A 1R22A 5DUIA 2P4WA 1AOYA 3P7NA 2K27A 1T0FA 3HRUA 1BIBA 2DT5A 1R7JA 3T8RA 4KN4X 2FEZA 4OIRF 1BC8C 2STTA 4UVCA 3FZVA 3VOEA 3KFWX 5L3EA 3T8TA 5JHUA 3JAMK 3IRRA 3K1PA 1JE8A 3J81Z 2JT1A 4LG0B 4LLGF 1KYWA 1V4RA 2H6BA 1R23A 3CUOA 1MZBA 3GO5A 4IRGA 3REOA 3JTGA 2L4MA 2NAZA 5BQTA 2IJLA 1CGPA 1X3UA 1R58A 3QOPA 4KIBA 4G9YA 4KIGA 1JHHA 5DCMB 3BWGA 2KIFA 1FZPB 4BHCA 1IN7A 2COMA 4RB1A 4M72A 1SAXA 3GXOA 1Z6TA 5K5RA 3RDIA 3F8MA 3FXRA 2KIUA 6PAXA 3ISPA 4G6QA 2V1UA 3WGHA 3I0TA 1BIAA 2P7CB 5E20A 3E5QA 1OR7A 1UFMA 4RB3C 4HV5A 2MBFA 2W85A 2QQAA 3QP5A 4KA4A 4MHGA 3IKVA 5LBQA 1QNTA 2LKPA 2RKHA 3FHZA 3JW4A 4MNUA 1BJAA 2VT3A 5H6RA 4IXAA 4I7HA 1FSHA 5ILVA 3CO7C 4A2UA 4UHTA 3CUQC 3BY6A 3KEOA 3RKXA 1YS7A 2BYVE 1ULYA 4RGRA 4HA8A 1G3TA 3ABUA 2RNJA 3PQJA 1S29A 1HW2A 1W7PA 4KMFA 3TO9A 3ELKA 1ZG5A 5HS9A 2M8EA 2CWEA 4MQVA 2QQBA 1I5ZA 1KYZA 4IF4A 2PBIA 2X4HA 4IJAA 3RKWA 1EH6A 1IXCA 3QP6A 1XCBA 3L7WA 4AIKA 2HKXA 1L3LA 3GVAA 2OU2A 2YX4A 1SFEA 1OYWA 3HSEA 4BAYA 1FP1D 2ADUA 2FF4A 4H0EA 2HQNA 1FWZA 5IT3A 4WF2A 3EQLF 4OMZA 3GWZA 3K9TA 2QYOA 4HX7A 2F5EA 5IT9K 2DTRA 4RGXA 5D4SA 3ROUA 5D6FA 3S2WA 4CGZA 4L9TA 3M1EA 3P9KA 5EEHA 4WWCA 2XHKA 3WODF 1Z7UA 5DCFA 3Q5FA 1Z05A 2KKOA 3U9GA 1B9MA 3DQVC 4MTEA 3VODA 4Q5SF 4OOIA 5HOOA 4GCVA 3L00A 4GO1A 2FOKA 3NQOA 1T38A 4HYEA 5E1WA 2A6EF 2CQKA 2F2EA 1OMIA 4RB0A 1FPQA 1LDJA 4UNOA 3GFMA 2Q2EA 5ICEA 3KZZA 3BPXA 4L9VA 4XLNF 1FYMA 1LNWA 2LF7A 2IW5A 5CVUA 4O5VA 4HLXA 2K4JA 4Y15A 4JBAA 5JR3A 4HQEA 2HFHA 2RV8A 5D5VB 3JSPA 1SMTA 2GXBA 4KNYA 3FWEA 4WX9A 4B09A 2PEXA 5ERIA 3RPQA 1XGMA 2ESHA 5LHIA 2ETHA 4LMYA 2E1NA 1O3SA 2XKOA 2P5KA 4A5NA 2HEOA 1FLIA 1FOKA 4DQ2A 3HHGA 1XMKA 5BMZA 2WTEA 2M45A 4Q48A 4LJZF 2H27A 2GA1A 1ZLKA 1ZH5A 1YS6A 4KYWA 4F7ZA 1UB9A 1BI2A 1YTYA 2GA2A 1REPC 1ZGJA 5LEJA 4KMUX 4GYIA 1OYYA 3E5UA 5E8IA 4OIQF 4EJVA 3NEUA 1QBJA 4YFNF 3KCCA 2VBZA 2FBHA 4A0XA 1Z1DA 1NHAA 1Z6RA 1RNLA 5K5OA 4UV9A 5L3GA 3DP7A 4ZYEA 5H20A 2PLYA 4CHUA 2VXZA 3BZ6A 1QQIA 3LFKA 2P6SA 2XAGA 3L09A 4ASNA 4KDPA 4U0WA 1O3QA 2FNPA 1IN8A 1FNNA 3OV8A 1O7FA 5L3BA 1XD7A 3U1DA 4LB6B 3F3XA 4L18B 2RQPA 1HSTA 4WCGA 2JZYA 1R00A 1LJ9A 4HV6A 2HDCA 1XMAA 4IRHA 3ZMTA 2JRTA 1R5HA 3H3UA 3GX4X 2HYGD 1JHFA 3J80K 4OMYA 2EFOA 2M87A 1QO0D 4RAZA 1YG2A 3P9CA 3F8BA 1WKMA 1WSUA 2KJBA 2BV6A 3BOQA 1FY7A 2XKPA 2FU4A 4BHBA 2QBYB 1ODDA 2FBIA 1P4AA 4NB5A 3T1BA 2XAHA 1SFXA 4RS8A 2B0LA 1U5TC 1TNSA 1I1GA 2ZKZA 5LRSA 1FYLA 2ACJA 5LRRA 1MDMB 2VE8A 4HZFA 4G7OF 1P6RA 4Q47A 5E1XA 4EM2A 2GAUA 2VN2A 4M6XA 3I71A 1R36A 4O3MA 2XIGA 3N4MA 1XCVA 1D3YA 1O3TA 2VOOA 3BROA 1T2KA 1MDMA 5F6FA 2XVCA 5FFXA 1ZHFA 2STWA 3FF5A 4ZYHA 3TDUC 1OPCA 2IPQX 4OINF 2OQGA 3SXYA 2E7WA 4P96A 2H94A 4Y13A 1FSEA 2GXGA 4KFCA 2BBYA 3DV8A 1TLHB 2OBPA 1BBYA 1XGSA 1I6XA 4JQFA 3R60A 3RJPA 4M73A 1IAWA 3NRVA 1B9NA 3WE2A 3HUGA 4G94A 4EQQA 3LA7A 4B8XA 3BP8A 3RKYA 2OZUA 4Y17A 2FA5A 3K1MA 4KN7X 2O03A 1ZRDA 2CFXA 2HS5A 2ZNYA 1IF1A 2WWYA 4A0YA 2LF8A 1S7AA 1HKSA 3LAJA 3LQQA 1HW1A 2V1XA 3ML6A 2IVMA 4U0VA 4TV7A 3WU1B 4FX0A 3IC7A 5TRDA 1QGPA 1FT9A 5H6QA 3B73A 2IA0A 4I0AA 3RYPA 1Z9CA 3CDHA 5ED4A 3I5UA 3F22A 2EFQA 3E6BA 5KVRA 4WK8F 3ZMDA 1HXDA 1HSJA 1K79A 1YW7A 4HQMA 3FMSA 3BJAA 5D5XB 3T5XA 3F6VA 1D8KA 1U8RA 1HW5A 1ON2A 2DPUA 3WU0A 1GHCA 3I58A 1G3WA 3E6DA 3P9IA 3CO6C 2FQ3A 3K69A 2NS0A 2Y48A 4RAYA 2CGPA 1KQ0A 3RYRA 1S3JA 3WTSC 5AIPA 1ZG1A 2GQQA 4MGRA 2DQLA 3DPTA 1G3SA 2HKOA 2OAZA 4BHPA 4HDUA 2YSRA 1TQPA 5DDGA 5D8LB 4HOBA 4YFXF 1S8NA 1SD6A 1T39A 2ISZA 4S05A 3DF8A 1WI9A 3COAC 4OIOF 4RGSA 1TNTA 2TDXA 3E97A 3O3KA 4MEXF 4AIHA 1YO5C 4PGHA 1D5VA 1XGNA 2RN7A 3ZMSA 2G7HA 2ZO4A 3IWFA 3JSOA 1IXRC 2Z9OA 2OZ6A 2VT2A 3N97A 4A6DA 3CUQB 5DYMA 1W7PB 1W4MA 1OYIA 1ZLJA 2M1BA 3ZMUA 1DP7P 1MD0A 2EFWA 4AIJA 2Q8KA 4EGYA 1Z91A 1U6GA 3V4GA 3E6MA 2EJRA 3GZ5A 4PCQA 4LD5A 3CUQA 4G7HF 4N9HA 4EM0B 5LGUA 2HR3A 4LB5A 2G7UA 3GFJA 2VC0A 3ZPLA 1HQCA 3R0JA 5HS7A 4KICA 3ABTA 4L9NA 2CW0F 4XBFA 3HTUA 1FBUA 4YIIA 2IT0A 3GFIA 2RGVA 5JVTA 3QPHA 5HLHA 1MKMA 3V8LA 4WXCA 5CJ9A 2IRFG 2DBBA 2R7FA 3Q9SA 3F8CA 2LDUA 2UWMA 4HBLA 1J5YA 1ZGAA 4IVNA 1IW7F 1LQ1A 2GIVA 2JSCA 4CICA 1PUEE 2JTVA 2RC4A 4MTDA 2UZKA 2R7DA 3H92A 3R6SA 5E17F 2QQ9A 3TOBA 1DPUA 1EH8A 2CG4A 3DXJF 4P55A 1WRJA 3DEUA 2ZBKA 3E6CC 1DDNA 4M71A 3ZMZA 5IT9Z 1LDKB 2KIMA 4EJWA 4M9SA 3HSRA 5J6XA 1KQ9A 3C7JA 4U0YA 3F23A 1J59A 3WTTC 1BOAA 1SD5A 2XV4S 5LGNA 1YW8A 3MZHA 3I59A 3MQ0A 5L3CA 1KGSA 2FMYA 1P92A 1YQAA 1TTYA 2XAQA 4L0YB 5BOXA 2OQRA 2H6CA 3O6BB 3ERED 5HLIA 1KU9A 5HVQC 1SFUA 3K2ZA 3QAHA 2QENA 5EEGA 3K0LA 4ENNA 5FO5A 4GGGA 5DV5A 5J8FA 3I64A 4ZZDA 4A0ZA 2XROA 1XSDA 3FX3A 1LEBA 2FXAA 1K6OA 4FT8A 1IN5A 1BC7C 3HHHA 5BPIA 2XAFA 1J2XA 1S6LA 1XSVA 2V9VA 2W84A 3WGGA 3RIRA 4ESJA 2XAJA 2A61A 2D1HA 5CVVA 4G6DA 2YPRA 4EM1A 3TO7A 1K7AA 1R5GA 2MH2A 2GZWA 1DUXC 2K02A 2G9WA 3GUDA 1K78A 1Q1HA 2LNBA 5CVJA 2K7LA 2P6TA 3RTRA 4ESBA 2GWRA 3JTHA 1IXSB 2F5DA 3ZN1A 2PMUA 5AIQA 3HTSB 1IN4A 5ICFA 5F64A 1J0RA 2WV0A 4EMSA 1BI0A 3KLNA 2XASA 5E18F 3QU3A 2DI3A 5JI6A 1HKQA 4HF2A 1FP2A 3ZMVA 2ZFWA 4RGUA 3FM5A 1BI1A 4ON0A 2C6YA 2FSWA 2ESNA 4LFUA 2XRNA 3KP4A 4HAMA 5TJJA 5FD6A 1MJ9A 2XGXA 3WTUC 1XB4A 5KK1A 2NNYA 4BYYA 1V3FA 5BS6A 1U5TB 5CYVA 2UXXA 1QZYA 2PG4A 4I09A 3R0AA 1J9IA 1RI7A 2PMHA 4PDKA 3D5LA 1USTA 3FMRA 2QM3A 4CDGA 2VONA 4ZYDA 4M6YA 4XSZF 3J80Z 4U7BA 3ZP5A 4IHSA 4EJOA 4HX4A 4UUVA 1E17A 1U5TA 4I98B 1B4AA 2PFBA 2VOPA 4AWXB 3LA3A 5FLXK 1MJBA 2IA2A 4Q4ZF 1W5TA 4PGGA 3LQRA 3KP5A 2D2WA 1G3YA 2JPBA 4DNCA 1ZAOA 3WTXC 4A12A 1UHMA 2DAOA 2EB7A 1B1BA 1PP8F 4K2EA 4QLCU 5ICGA 1IUYA 1FBSA 3F21A 1H9GA 1VTNC 2E1CA 1T98A 3PQKA 5D6EA 3KP3A 3FMQA 1EV7A 3H3ZA 1I1SA 3C18A 1QZZA 1L0OC 4XLPF 1O57A 1F5TA 5A2QZ 3GF2A 1BM9A 4M9XA 2PQ8A 2YU3A 3L9FA 3M8FA 4IHTA 2ZCWA 2EK5A 2O8XA 2EA4A 4L0ZB 3FXQA 3HSFA 5K5QA 3KP7A 4YG2F 2O61A 1UHWA 5ILSA 2OA4A 4XRFA 4LK1F 2MH9A 2XUBA 2NRAC 1YW9A 3EYYA 3TDZC 2W24A 1LDDA 2JPCA 3E3VA 2ELHA 1HBXG 1C0WA 4KUMA 1A04A 4I02A 1HKTA 4EGZA 1GVJA 4BQAA 4G7ZF 3I54A 2D1VA 3WTVC 2MLKA 4CZZA 1XN7A 4HF1A 3VB2A 5HLGA 1R1UA 1KU7A 1SD4A 3GYHX 4YFKF 3V7RA 1W5SA 3EYIA 2ZXJA 2ISYA 1ZRCA 2DLLA 3SFZA 2H09A 4IRIA 4M74A 3MEXA 3WGIA 4BH9A 1U2WA 1TBXA 5HS8A 5E1ZB 2K4BA 3CLOA 1R1VA 5D4RA 3KLOA 3J81K 4U88A 4A5MA 2J5OA 4EVIA 5HDKA 2Y75A 2VE9A 1R1TA 2DPDA 3SZPA 3ECOA 3EDPA 2K86A 2HOEA 4R79A 2E7XA 3F8FA 3Q9VA 2FNAA 3JAMZ 1KA8A 2DU9A 4UXNA 1ZYRF 2CSOA 1FYKA 1ON1A 1KU2A 3VFZA 1TQMA 2LSOA 1G4DA 3C3WA 3WTZA 2NNNA 2ZJ2A 1DPRA 2EV0A 4P9FA 1WWXA 5J8CA 4MEYF 5ILUA 2V1DA 2Z33A 2A5YB 3RI4A 4LG0A 4HW0A 1F1ZA 1XSXA 1LEAA 3KEQA 1UCRA 3KP2A 1SD7A 3MCZA 2Y0MA 4EJTA 4E70A 4GYGA 2A68F 4ETSA 2YR2A 2RVCA 2EFPA 5DCMA 1ZG3A 2O3FA 4BNCA 1YYVA 2Q0OA 4HF0A 2L3DA 1YIOA 2MC3A 3SZTA 4WXHA 5ICCA 1USSA 4LLLA 1OKRA 3HOTA 3GEZA 5DD4A 3I53A 1W7PD 3HRSA 4YIFA 3ECHA 3I4PA 1U78A 4P5OA 1TQIA 2FBKA 3IHUA 2O0YA 4R8HA 3QU6A 5K1YA 2EV5A 5FGMA 2P5VA 2A3SA 3BJ6A 2M5WA 3DFGA 2HTSA 1XGOA 1LB2A 5D8KB 1G6NA 3LSTA 1CF7B 5LEKA 4RB2C 4EV0A 5LGTA 1STZA 2WC2A 2EWNA 3GZ6A 5BPDA 2HGCA 2HQRA 5F1RA 2MLGA 5HDGA 4MQ9F 1FX7A 3KE2A 2L4AA 5D5UB 1CF7A 4UVBA 4M9ZA 1I27A 3M9AA 2VBWA 4AD9A 4HDVA 2EA2A 1YLFA 3PFIA 1F4KA 2X0LA 3F8NA 4ZZLA 5DEQA 1RUOA 1O7LA 3SHFA 3I59B 4L5IA 3BDDA 1O3RA 1B6AA 3G73A 1BN5A 2BGCA 2HZTA 3D0SA 2IP2A 4UV8A 3ZN0A 4ESFA 1U3EM 4OIPF 4AVPA 4ENMA 3V7SA 4S04A 5FB2A 1J75A 5D5WB 2CYYA 3HRMA 4LLNA 2FRHA 2V79A 2A69F 1MGTA 1WQ2A 3TKYA 4IPAA 4KIFA 3F6OA 3ZQ7A 2R3SA 2QWWA 4CXFA 4L9JA 5LHGA 3IL2A 3WTWC 4FX4A 1TW3A 1P4WA 2FE3A 1Y0UA 2L02A 3TO6A 2UXNA 3WE3A 3AAFA 2Z5UA 4L5JA 2DK5A 3M8EA 5DUKA 2DW4A 2ZMEB 3IKTA 3CJNA 2AXLA 3SQNA 1K78B 2DFIA 5CVIA 1ZARA 4R1HA 4OU0A 4HLYA 2NYXA 3EETA 1RUNA 1JXSA 4JK1X 3K1NA 1MJAA 3QRFF 3OOPA 1P4XA 2RDPA 2ZMEA 3ULQB 2Z99A 2KJCA 3IRQA 2L01A 3HIFA 1AWCA 1T6SA 3HYIA 4P9UA 2P8TA 1XDUA 3DKWA 5CLSA 2A07F 2Z3YA 3GW2A 3GFLA 5DD8A 2DO7A 1SMYF 5AONA 3TGNA 3TQNA 4Z2YA 2F5CA 4I2OA 1RZ4A 4HX8A 1PP7U 1IZ1A 3B02A 3MWMA 2P7VB 3LAPA 2FMLA 2KRFA 1QPMA 3BPVA 3MFKA 5E8GA 4O6JA 1ZN2A 4UVAA 3J7AO 2VODA 2A6HF 2EV6A 2O6GE
chains in the Genus database with same CATH superfamily
1IRGA 3T0YA 4ENJA 3L2CA 2QUFA 1K79A 1WJEA 2BVLA 2CO5A 2HTJA 1JGSA 2VBYA 3FXUA 2LLKA 4KT5C 4IO9F 1X58A 5E3NA 2CUZA 4B44A 2R4GA 2VBXA 4I01A 1IRZA 4N9IA 4XSXF 2G0EA 4PZJA 4QWQA 1EF4A 3BJOA 3LA2A 1T95A 5HDNA 2BEOA 1GXQA 1PDNC 2V9PA 2L7KA 2KDZA 1CQTA 2ZC2A 3V8KA 1KONA 3MAJA 4QIWN 1JUSA 2MD5A 4NHJA 3KETA 5L3DA 2QLZA 1RKTA 5DS9A 2E35A 2BE5F 1YFHA 2DQRA 2RQQA 3QPTA 2HWVA 1VZ0A 3K70D 1ZRFA 4G8XA 4BXUA 3W6JB 4LGWA 3RQ4A 2ZNZA 4RA2A 1K6YA 2VI6A 3KIOA 5CVRA 1H0MA 1GXPA 2TRTA 4A6EA 2MW8A 4D7NA 3A0HC 1IN6A 3O2PE 1J7KA 2QSGX 3FM3A 1KQ8A 3KEYA 2W57A 1J09A 3ZR8X 4N0BA 4B3XA 5FJ8J 2E5NA 5FLXZ 4J00A 3KZYA 2LD5A 3WTYC 1FBQA 3V8JA 1RIOH 3S2HJ 2MGQA 2OD5A 5CPRB 3DTEA 4EJUA 2NS7A 1BI3A 1FTZA 4WXDA 2QBYA 1ZREA 3W6KB 2E2IJ 3IWZA 3M7GA 1S7OA 1XDSA 1F9NA 2LKSA 2LYCA 4F93B 5LHHA 4D0PA 1LFPA 2IA1A 2I8DA 3HM5A 3OS0A 3EUHA 2AS5F 3OYNA 5E79C 2CUFA 1ONVA 3P5JA 5C4XJ 2MA3A 4CO8A 2WAEA 1D1CA 2PJPA 2M30A 5B1AH 4C2UA 1TWGJ 1S7EA 2QVOA 4C9YA 5A2QK 2QZ8A 3FHNA 4CA0A 1B59A 1WH7A 1V5EA 1P2FA 2P5LC 1MMGA 3V7CA 1K83J 5LLQA 4I0BA 1IJWC 1TC3C 3GLXA 2OC6A 5CKTA 2JN6A 1X3WB 2K9SA 1MW7A 3DPLC 2L54A 4W97A 1OCOH 3HKZN 2OPTA 2D45A 2B9SA 4GFBA 2IGOA 1UG2A 1D8JA 2J5PA 1HDDC 4FHTA 5E3LA 2PI0A 2VJIA 3CDLA 2JA5J 3H35A 3U2RA 3FXOA 1YJWI 1YI2I 4NQWA 4ZH4F 4CCKA 3WG9A 2EFNA 3R4KA 3F72A 3VEPA 3R61A 2CQXA 4XLEA 3VYSB 1E2XA 2DK8A 3MZYA 2VC1A 1XTAA 3H5NA 3CJTB 1EA3A 2R7XA 5FKLA 2BHZA 2H8RA 2VKHA 2WB1N 1R6RA 2K85A 5J4YA 3S32A 2DFFA 3TOAA 2A6TA 2F5FA 2PMZN 1U9NA 1XPXA 4AYBN 2HYFA 2V6CA 4GXOA 5L3FA 2YX7A 1B72B 2R7VA 3HC7A 1IRFA 3C2GA 2XB0X 3LWFA 4XLHA 5FRMA 4ZYGA 1SANA 2DOFA 3HRTA 2HVQA 2PN6A 3SZGA 3O8HA 2M0MA 4U7DA 3DTIA 1X1PA 3RPUA 1KU3A 2X1CA 3JRFA 2DN0A 3E5XA 1EH7A 1ETYA 1ETWA 3G3ZA 1NG6A 3C1DA 3K4MA 1TW2A 3ZQLA 1FC3A 1LVAA 5FFZA 2BVMA 3TP0A 5HNHA 5TGTA 5FD5A 1H9TA 2ICWG 3HOXJ 3HOSA 1ETKA 4LK0F 1B72A 2KZVA 1S5LC 2AQEA 3GTPJ 5JFRA 3OSGA 3CTAA 1VQNI 2W25A 4ENKA 1H88C 2DFHA 4CYDA 4HG2A 3KP6A 2ZJRF 3J7AY 1QVUA 1R22A 1Y56A 5DUIA 2P4WA 3HDDA 4HPQA 1MBKA 1AOYA 1G8XA 3P7NA 2K27A 2M34A 3S17J 1T0FA 3TP3A 4F3QA 3HRUA 1BIBA 1NG7A 2DT5A 3SJMA 1R7JA 2EZIA 3QYFA 3GCMA 4V2GA 3T8RA 2GLOA 2K3FA 2KRHA 4KN4X 2FEZA 4OIRF 1BC8C 2STTA 4UVCA 3FZVA 1ZQ3P 2BY1A 3VOEA 3KFWX 5L3EA 3T8TA 5JHUA 3JAMK 4B3AA 5B5EC 3OYMA 1ZTRA 3IRRA 3K1PA 1JE8A 3J81Z 2B63J 2LRDA 3LMMA 1Y8QB 2JT1A 4OAZA 4LG0B 1T56A 4BBRJ 4LLGF 4CSWA 3A01B 1BW5A 1KYWA 1V4RA 4DBQA 3MMYB 4C30A 4F55A 3M1CA 2H6BA 1R23A 3OMYA 1XMXA 4HSRA 3CUOA 1MZBA 3GO5A 4IRGA 3REOA 3JTGA 2KZGA 1JKQC 4AU7A 2L4MA 2EIKH 3Q0WA 1FTTA 2NAZA 2L2OA 3SYTA 5BQTA 3ERMA 2IJLA 1CGPA 1X3UA 1R58A 3QOPA 4KIBA 2FX0A 4G9YA 1JHHA 4KIGA 3TW6A 3X2QH 5M5XJ 2W7NA 3JRDA 5DCMB 1AKHB 3BWGA 2E2JJ 2KIFA 1FZPB 4BHCA 1UJ8A 3QOEA 1IN7A 2COMA 4RB1A 4M72A 1SAXA 3S16J 4X1EA 3GXOA 2O5RA 2QF7A 1Z6TA 4JX5A 5K5RA 3RDIA 3BG3A 2VJ5A 3F8MA 3FXRA 2VKVA 3G1MA 5FRNA 4XORA 3ABMH 2KIUA 2XF5A 6PAXA 2KDOA 4ZTJA 3ISPA 4G6QA 1WI3A 2V1UA 1OR7C 3WGHA 3I0TA 4A3BJ 1GLNA 1BIAA 2P7CB 5E20A 3OYLA 3E5QA 1OR7A 1AKHA 1UFMA 1OCTC 1APLC 1MBEA 4RB3C 2WY8Q 4XM3A 4HV5A 2OF7A 3OYBA 2MBFA 1VFCA 2W85A 1ETOA 4NDLA 3I3LA 2QQAA 3QP5A 4KA4A 4MHGA 4ABZA 2M8GX 3IKVA 5LBQA 1QNTA 2LKPA 3FXKA 1IDYA 2ELKA 5F1JA 1LPQA 2CU7A 2RKHA 4HNUA 4XRMA 3FHZA 3JW4A 3VYUB 1X4PA 4MNUA 4E7HA 1BJAA 4W1UA 2VT3A 2OTLI 5H6RA 4IXAA 4I7HA 4RM2A 1FSHA 4AM3A 3OWTA 1X2MA 1Y8RB 5ILVA 2V4JC 3GTGJ 5C3EJ 4BUPA 4XONA 3IH2A 3CO7C 2X6OA 4A2UA 4UHTA 3CUQC 3BY6A 3KEOA 3RKXA 3CC4I 1YS7A 3HBLA 4D5CA 2BYVE 1ULYA 4RGRA 4HA8A 1G3TA 1MMNA 2LH9A 3ABUA 3BC8A 3VWBA 2RNJA 4II2A 3H9JA 4CH7A 2LREA 3PQJA 2NVQJ 1S29A 1HW2A 1W7PA 1A31A 4KMFA 4M3BA 3TO9A 1JI8A 3ELKA 3B6CA 1ZG5A 2LBFB 2ID6A 5HS9A 4L5EA 4I6ZA 2KRCA 1QVTA 2M8EA 4ZTFA 3HKZA 4CYCB 2CWEA 4M3DA 2EZKA 2E71A 4MQVA 1A5JA 3BR2A 2QQBA 4XNFA 1I5ZA 1KYZA 1Z7LA 4IF4A 3WHBA 2R5ZA 2PBIA 1W36D 2X4HA 4IJAA 2L0KA 1SAUA 2EINH 1EH6A 1IXCA 3QP6A 3RKWA 1XCBA 5GADJ 3L7WA 4AIKA 3NAUA 1MMAA 5B66C 2HKXA 2M3AA 1L3LA 5K7ZA 3GVAA 2GXAA 2F4IA 4LITA 2OU2A 2YX4A 4CCMA 2VJ4A 3GTMJ 1SFEA 1SC7A 3OS1A 2CV2A 2GIZA 1OYWA 3HSEA 4BAYA 1FP1D 2ADUA 2LBFA 2FF4A 3Q3SA 4H0EA 2HQNA 2WB1A 3QYEA 1FWZA 5IT3A 2Z2SB 4WF2A 3EQLF 2PMZA 2HI3A 4OMZA 3GWZA 3AG1H 4IEJA 4AYBA 3K9TA 1M1EB 2QYOA 4ITVA 4RLFA 4HX7A 2FD5A 2F5EA 5JLXA 5IT9K 3RZOJ 2DTRA 3KYCB 5F08A 4RGXA 1H89C 5D4SA 1ERDA 5JHFA 3ROUA 5D6FA 3S2WA 4CGZA 1WJ5A 1YOVB 5LD2C 4L9TA 3CP8A 3M1EA 3P9KA 5EEHA 4A3JJ 2E36A 4WWCA 3S3MA 2XHKA 3WODF 1Z7UA 4PJJA 5DCFA 3CDIA 3Q5FA 1Z05A 2KKOA 3PO2J 1DU0A 2R7UA 1NH3A 3OR1C 2Q2EB 3U9GA 1B9MA 1TL8A 3DQVC 4MTEA 3JCUC 3VODA 4Q5SF 4OOIA 1HC8A 5HOOA 4GCVA 2VPLA 3L00A 2WADA 2NOJB 4GO1A 2FOKA 3NQOA 2VKEA 3DBRB 1E3PA 3CCQI 1JKPC 1YHQI 1K4SA 1Y0NA 2XGEA 3VYRB 4HYEA 1T38A 2IBDA 4B1RA 3JRAA 1Y6IA 1IGNA 5E1WA 2A6EF 3KPHA 3IH4A 2L9NA 4BS9A 2CQKA 2F2EA 1OMIA 4RB0A 2HXOA 3FIWA 4CZCA 3NWSA 4CUGA 1FPQA 1LDJA 4FCYA 4UNOA 3GFMA 2Q2EA 5ICEA 3KZZA 4GRIA 1EJ9A 3BPXA 2P81A 3CD6I 4C3JJ 1TWHJ 2ID3A 4L9VA 4XLNF 1FYMA 2TCTA 1S9HA 1LNWA 2ZSIB 2LF7A 2IW5A 5CVUA 4O5VA 3JRHA 4HLXA 2K4JA 4Y15A 1UHSA 4JBAA 3KYDB 4PFPA 5JR3A 4HQEA 2HFHA 2XB5A 2RV8A 5D5VB 4PSXA 3JSPA 4NC6A 2DTZA 1ETVA 2X51A 5GPCA 1SMTA 2GXBA 3AG4H 4KNYA 3FWEA 4WX9A 3H3VK 3OYKA 2RNGA 4B09A 2PEXA 5ERIA 3RPQA 1XGMA 1YIJI 4P1WA 2ESHA 3U1KA 5LHIA 2ETHA 1VQ4I 4LMYA 2E1NA 1O3SA 4BY1J 2XKOA 2P5KA 4A5NA 2HEOA 4XMYA 4E7KA 2AQFA 1FLIA 1FOKA 4BJ5C 2F48A 3L1PA 4DQ2A 2K9QA 3HHGA 3G6EI 1XMKA 1BW6A 2NXNB 2W1OA 1AA7A 5BMZA 2WTEA 2M45A 4E7IA 1WZ2A 3PNYA 3HOWJ 1WJBA 2VIXA 4LJZF 4Q48A 4QPQA 2H27A 3S3OA 4DBRA 3H9GA 3RKQA 2GA1A 4IQJA 1ZLKA 3KX2A 3CP2A 1ZH5A 3OYDA 3DBHB 2L7MP 4Z6YA 1YS6A 4KYWA 4F7ZA 5IY5H 1UB9A 2M0CA 3OIOA 3RSNA 1BI2A 5IOZA 1FIAA 1YTYA 4XQFA 3BR3A 2GA2A 1REPC 3PNVA 2DODA 1ZGJA 5LEJA 5EZGA 4YEJA 3VSKA 4KMUX 3TEDA 1WJAA 4GYIA 4BU2A 2E34A 1IDZA 1OYYA 3E5UA 5E8IA 4OIQF 4EJVA 1U0JA 3NEUA 4FQGA 2GM4A 1QBJA 4XRSG 2CMPA 2ME0A 4YFNF 2ZXIA 3LSRA 3KCCA 4XKVA 2VBZA 3IH3A 1OCRH 2QEXI 2FBHA 1TP4A 1WJDA 2HOTA 4A0XA 1X4OA 1Z1DA 1NHAA 1Z6RA 1RNLA 2X6YA 2QQ8A 5K5OA 3CCMI 3S1RJ 4UV9A 2X85A 5L3GA 2V6EA 3DP7A 4A3FJ 4XKWA 4ZYEA 5H20A 2PLYA 4CHUA 2VXZA 2DA2A 3BZ6A 1R4NB 2JSPA 1QQIA 3LFKA 2R7RA 2P6SA 4X6AJ 2XAGA 1LKXA 1SVOA 2FQ4A 1O4XA 3L09A 1SVLA 4ASNA 4KDPA 1BL0A 1VF9A 3I56I 1IRXA 4U0WA 1O3QA 2FNPA 1IN8A 1FNNA 1GDTA 4A69C 3OIQA 3OV8A 1O7FA 1JKRC 5L3BA 1HOMA 1XD7A 3U1DA 4LB6B 3DTKA 3F3XA 1F36A 4G6TB 4AC0A 4L18B 2RQPA 5CQEA 4RLQA 4GDFA 1HSTA 4WCGA 1BR4A 2JZYA 1ZELA 1R00A 1LJ9A 1RPWA 2CW7A 4HV6A 2HDCA 1XMAA 4IRHA 3HOYJ 3ZMTA 2JRTA 1VQPI 1R5HA 5J1UA 3H3UA 5K7FA 3GX4X 1X1BA 2RAEA 2HYGD 1JHFA 2R7WA 3J80K 4OMYA 2EFOA 3CJRB 2M87A 2HVSA 1QO0D 4RAZA 1YG2A 4A3LJ 3P9CA 3F8BA 1WKMA 3NARA 1UG0A 1WSUA 2KJBA 5F0FA 2BV6A 2CW8A 3BOQA 3PNTA 2DA6A 2HPIA 1FY7A 1T08B 4HNTA 3SEZA 2XKPA 2FU4A 2F4OB 4BHBA 2QBYB 1MNEA 1ODDA 1TZLA 2FBIA 1P4AA 3B6AA 4NB5A 3T1BA 2XAHA 2WY7Q 1SFXA 3H1CA 4RS8A 2B0LA 4D7MA 1U5TC 4DYRA 3A2KA 1TNSA 1I1GA 3S1QJ 2ZKZA 5LRSA 1FYLA 1N78A 2ACJA 1WPKA 5LRRA 4X0GA 3MKWB 2UV1A 1MDMB 2Y0SN 3M3YJ 2R7QA 3S93A 5GTIC 4BDYA 1N77A 2VE8A 4HZFA 2QGUA 3CCUI 3FXJA 4G7OF 5DM6F 4FETA 1P6RA 3C2HA 2VKDA 4Q47A 2E19A 2NOGA 4N4NB 5E1XA 3K70C 4EM2A 2GAUA 2VN2A 4M6XA 1OLTA 3I71A 1R36A 4BL0B 4O3MA 2XIGA 3Q0VA 3K4LA 3N4MA 4LOCA 2K3PA 1XCVA 1D3YA 3I9V2 4ZJZA 1O3TA 2VOOA 1I50J 3BROA 1T2KA 3I4MJ 1MDMA 5F6FA 2JA2A 2X6WA 2XVCA 3D5RC 5FFXA 1ZHFA 2STWA 3FF5A 2ZJQF 4XN3A 4PJ0C 4ZYHA 3TDUC 3HUGB 1OPCA 2IPQX 4OINF 1K61A 2OQGA 3QPLA 1LVKA 4NQWB 3SXYA 2E7WA 4P96A 4QPOA 3S3NA 4A3DJ 2H94A 4CCJA 4Y13A 1FSEA 2GXGA 1Y1WJ 4KFCA 2BBYA 3DV8A 5GPAA 2YUSA 1TLHB 2OBPA 1BBYA 3L2VA 2E5ZA 1XGSA 2WBMA 1I6XA 3LSIA 4JQFA 3R60A 3RJPA 4M73A 3QPSA 5K7HA 3PUBA 2H8WA 1IAWA 2BY2A 3NRVA 1B9NA 3WE2A 3HUGA 4G94A 2OUMA 3OYFA 1T33A 4EQQA 3LA7A 3HZJA 4B8XA 5J1RA 3BP8A 3RKYA 2EBIA 2ME6A 2OZUA 4Y17A 2EILH 3ZOBA 2FA5A 3AG2H 5EEAA 1MH4A 1ENHA 4YIRX 5EG0A 3FISA 3K1MA 4XL9A 4KN7X 5M3FJ 1QA6A 2MC4A 2O03A 5IOYA 3BZKA 3K6GA 4RDUA 1T8IA 1ZRDA 3VDXA 3LSHA 2CFXA 2JUCA 2M7AA 4FTHA 2HS5A 1RKWA 3CF2A 2ZNYA 1IF1A 2WWYA 3RPUD 1VQKI 3BG7A 4A0YA 1FOYA 4KT6A 1MIJA 2LF8A 3MKLA 2Q1ZB 1S7AA 3OYHA 1HKSA 3LAJA 4YELA 4PFOA 1P7JA 3BG9A 3OSFA 3BR0A 2I10A 1MSFC 3LQQA 1HW1A 2V1XA 2V9KA 3ML6A 1VI0A 3E1SA 3DKYA 1PUFA 2IVMA 4U0VA 4TV7A 2LY2A 3KYLA 2JVGA 3WU1B 4FX0A 3HXLA 3GMEA 3IC7A 5TRDA 1QGPA 2DJNA 4XR6A 1IC8A 5FKMA 1FT9A 4V19K 5H6QA 2JVHA 3B73A 5EF6A 2IA0A 4I0AA 1MBHA 3D1NI 3LSJA 1RRJA 4NC8A 3RYPA 3G2BA 1Z9CA 4UB6C 3CDHA 1ACIA 5ED4A 4A3EJ 3I5UA 1PYVA 3BG5A 3F22A 3AL0C 5M5YJ 2EFQA 3FBIB 2V7FA 3E6BA 5KVRA 2K9NA 4WK8F 4XK4A 3ZMDA 1HXDA 1HSJA 1UMQA 3G4SI 1YW7A 2GBYA 2XAUA 3FMSA 4HQMA 3BJAA 5D5XB 3T5XA 1UZCA 3F6VA 5IP7J 1D8KA 1U8RA 2CV0A 1HW5A 1PJRA 1ON2A 2H1LA 2DPUA 1EKEA 5EYRA 3WU0A 2XF6A 1JGGA 1GHCA 3CMAI 1BR1A 3I58A 4YRVA 1G3WA 3HOZJ 3E6DA 4CCOA 3S15J 4M3FA 2JJ7A 1SVMA 3P9IA 3CO6C 1WFXA 2FQ3A 2JUGA 3K69A 4IKFA 2NS0A 3CMEI 2Y48A 4RAYA 2CGPA 1KQ0A 3RYRA 1S3JA 3LSGA 3WTSC 2CRGA 5DM7F 3TL4X 3RQIA 2Z16A 3G1OA 5AIPA 1TWCJ 1ZG1A 2GQQA 3PL8A 4MGRA 2DQLA 3DPTA 1G3SA 2HKOA 2OAZA 4BHPA 4RAFA 2M2EA 1FMVA 4HDUA 2YSRA 2XSDC 1TQPA 3HEFA 5DDGA 1IUFA 3ZGKA 5J40A 5D8LB 3AKZA 4HOBA 2X1EA 4YFXF 1FJLA 2IS4A 2KMUA 1S8NA 1ITYA 3S2DJ 1SD6A 1T39A 1ZKGA 2ISZA 4S05A 3DF8A 4IHYA 1WI9A 3COAC 5KAFC 4OIOF 4RGSA 2VLAA 3AG3H 1TNTA 2TDXA 2XSJC 2Y2ZA 2OV7A 4DW6A 4V2FA 3E97A 3UNGC 4A3CJ 1ZR2A 3O3KA 2KLOA 3FXMA 4BACA 4MEXF 1E0EA 4AIHA 1YO5C 4PGHA 1D5VA 3GTJJ 2R7SA 1XGNA 3H5AA 2RN7A 3ZMSA 1G59A 1JT6A 2G7HA 5EJCA 1ETXA 2HYJA 5DTDA 2RREA 1GUUA 2ZO4A 1MNMC 1F43A 3FK6A 3IWFA 3JSOA 1IXRC 2KP6A 2Y0SA 2CQQA 5FLMJ 3BTJA 2Z9OA 4M3EA 4XRSA 1D5YA 2NVXJ 2KFDA 2X9DA 4PJLA 2OZ6A 4XKBA 1TWFJ 2VT2A 3N97A 4A6DA 3CUQB 5DYMA 3W6VA 3HL2A 1W7PB 1W4MA 3K10A 5J1YA 3QODA 2EIJH 1I3QJ 1OYIA 1ZLJA 2M1BA 2VL8A 3ZMUA 4RMNA 1R49A 2ZB9A 1MD0A 1DP7P 2EFWA 4CCLA 4AIJA 2Q8KA 4EATA 4EGYA 1Z91A 1U6GA 4KJZA 3V4GA 3E6MA 2R5ZB 2Z1DA 1HF0A 2EJRA 4PK4A 2LR8A 3GZ5A 2ZJPF 3L2WA 4PCQA 3ASOH 2WAQA 4LD5A 3CUQA 4G7HF 4N9HA 5F27A 2R0QC 4EM0B 5LGUA 2HR3A 4IL6C 4DZPA 2R92J 2OCEA 4LB5A 2G7UA 4BXFA 3GFJA 1JTYA 1YX5A 2VC0A 1RR8C 3H0DA 3ZPLA 1OCZH 1HQCA 2NS8A 3R0JA 2HOSA 5HS7A 3IV5A 4KICA 3ZRGA 1U9OA 3ABTA 4L9NA 2CW0F 4XBFA 1GVDA 3MZ8A 4C2TA 3HTUA 1QZEA 3CF5F 1FBUA 3CESA 4YIIA 5IP6A 2IT0A 3JREA 2MD0A 3GBGA 2JK3A 3GFIA 3OL3A 5GAGJ 2RGVA 5JVTA 2QKLB 5IP9J 3QPHA 5HLHA 1MKMA 2W48A 2CH0A 4OAYA 2L9RA 4S0HB 3V8LA 2DJIA 4WXCA 4B47A 1AU7A 5CJ9A 2ZSHB 2IRFG 1MH3A 2DBBA 3CCYA 4N4OB 1W36C 2R7FA 1R9TJ 3DCFA 3J7ZI 3DBLB 3Q9SA 2L7FP 2L7ZA 4MFEA 3F8CA 2LDUA 2UWMA 3TMOA 4HBLA 1B8IB 1J5YA 2Y69H 1ZGAA 4G12A 4IVNA 3LNQA 1IW7F 1LQ1A 2QSFX 2GIVA 2JSCA 3PUFA 4CICA 1A35A 3CCRI 2OTJI 2CFOA 1PUEE 2QCOA 5TISC 2HNHA 2JTVA 1WJFA 2RC4A 2XC7A 4MTDA 2UZKA 2R7DA 3H92A 3R6SA 3ZQFA 5E17F 2QQ9A 3TOBA 4BJ6C 1DPUA 1X19A 4NC7A 1EH8A 2CG4A 2HXIA 3PSFA 1FEXA 3DXJF 2DT7B 4P55A 1WRJA 3DEUA 2ZBKA 3FBNB 3E6CC 3OYJA 1QU3A 4E4HA 1DDNA 4ANJA 4M71A 3ZMZA 5IT9Z 1LDKB 2KIMA 1Z77A 1IG7A 4EJWA 3H36A 1B8IA 4M9SA 3W2WA 1MBJA 3HSRA 5J6XA 1Z0XA 1KQ9A 3C7JA 4IHWA 3IAS2 1MNDA 2HPMA 4U0YA 1QHHD 2FUG2 2HU9A 1G2HA 2E1MC 3E0JB 3F23A 3SEQA 1J59A 4PUSA 1YRNA 4AIDA 3K4KA 3WTTC 1BOAA 1BR2A 1SD5A 2CS3A 2XV4S 3CCJI 3OIPA 5LGNA 3W2AA 1YW8A 2DDBA 3MZHA 2VXDA 3BR5A 3I59A 3MQ0A 5L3CA 2HOAA 3DLLF 1KGSA 2FMYA 1P92A 1YQAA 5F04A 1TTYA 3HB9A 5M3MJ 2XAQA 4L0YB 2CV1A 1VQ9I 2ZFUA 3K7AJ 4HSTA 5BOXA 4IOCF 2OQRA 3FKJA 2H6CA 3O6BB 3S8PA 4XLAA 1WJCA 4UUTA 2PX9A 2ZXWH 3ERED 5HLIA 2FOWA 4IZZA 1KU9A 3I55I 5HVQC 1SFUA 3K2ZA 4UB8C 3LSPA 2N8GA 3QAHA 2QENA 5EEGA 5BNGA 3OS2A 3K0LA 1DGWY 4JYKA 1X1CA 4ENNA 5FO5A 3ZCOA 4GGGA 2DDAA 5DV5A 5J8FA 3I64A 4ZZDA 1WVRA 4A0ZA 1OQYA 2XROA 1XSDA 1A36A 3FX3A 1LEBA 2FXAA 1W1WE 3OR2C 1K6OA 4FT8A 1IN5A 1BC7C 3HHHA 5BPIA 2XAFA 1LE8A 2EPFA 2XGCA 1J2XA 1GT0C 1S6LA 1XSVA 2V9VA 2CJJA 1LFUP 2W84A 3MN2A 4DZJA 3WGGA 2LY1A 3RIRA 3VPRA 4ESJA 3W3CA 4IOAF 3HG9A 2WAFA 2XAJA 1P9QC 4Y7NJ 4KITB 2A61A 2D1HA 5CVVA 4G6DA 2ZMEC 4AVZA 5JLWA 2BW3B 2JWTA 2R93J 2HDWA 2YPRA 4EM1A 2M4GA 3TO7A 1K7AA 1R5GA 2MH2A 4D9JA 2GZWA 2K9MA 3G71I 2DA7A 4KISA 1DUXC 2XGDA 2K02A 2X48A 4D5FA 2G9WA 3IP4B 3GUDA 2MYSA 1Q1HA 1K78A 2LNBA 3BT9A 1KZHA 5CVJA 2K7LA 5FKOA 1YJ9I 2P6TA 3RTRA 4BQOA 3KZIC 4ESBA 2F6CA 4BQQA 2HVRA 4XLCA 2GWRA 3JTHA 1IXSB 2F5DA 3ZN1A 2PMUA 5AIQA 5HODA 2BW3A 1D1BA 2VB6A 3HTSB 1IN4A 2KQRA 5ICFA 3VYTB 3E7LA 3BTCA 1J0RA 2WV0A 5F64A 4EMSA 5IYBJ 1BI0A 3KLNA 3VSLA 2XASA 5E18F 3QU3A 2K5CA 2VQLA 3GTKJ 2DFEA 2DI3A 5JI6A 1HKQA 4DOZA 4HF2A 3BCAA 1MMSA 2GOXB 3DEWA 4XKCA 1FP2A 3ZMVA 1VNDA 2ZFWA 3JRIA 2CUJA 4RGUA 3MKZA 3FM5A 1BI1A 2E1OA 4ON0A 2C6YA 2FSWA 2ESNA 4LFUA 2XPUA 2XRNA 3K4BA 1JJ6C 4QSHA 3WG7H 4BE2A 4PJNA 1VQ5I 3KP4A 4HAMA 5TJJA 5FD6A 4NUBA 1MJ9A 2XGXA 2JA8J 2XPVA 3WTUC 1XB4A 2AXTC 3LSMA 5KK1A 2F5VA 2DMUA 2DMPA 2NNYA 4BYYA 3QQAA 1V3FA 4RAGA 4BBSJ 5BS6A 1U5TB 5CYVA 2UXXA 1QZYA 2PG4A 4I09A 3R0AA 1J9IA 5IYDJ 1RI7A 2OJED 2PMHA 2LP0A 4XICA 1N25A 4PDKA 2YS9A 3D5LA 2X1DA 4FE7A 1USTA 3FMRA 2QM3A 2NVYJ 4CDGA 2V26A 2VONA 4ZYDA 5GP9A 4M6YA 4XSZF 4Y4RA 3J80Z 4FISA 4U7BA 3ZP5A 4IHSA 4EJOA 3F9KA 2LOOA 3LOCA 4RBOA 4HX4A 5IPAA 4UUVA 1E17A 1U5TA 4I98B 5GAEJ 1H8AC 1B4AA 1X2NA 4Y33A 1GV2A 2K9LA 2PFBA 4AWXB 4C2MJ 2VOPA 3LA3A 5FLXK 1MJBA 2IA2A 4Q4ZF 1W5TA 2W00A 1ORKA 3LQRA 4PGGA 4BDZA 4M3GA 2BY0A 1X1DA 3K4NA 3KP5A 2D2WA 3CQZJ 1G3YA 2JPBA 2DYRH 3H0GJ 1VQLI 2IGNA 4DNCA 1ZAOA 3PM1A 3WTXC 4A12A 3D5SC 1UHMA 2DAOA 2VASA 1YITI 4Y3OA 1DU6A 1Y1VJ 2EB7A 1B1BA 2BHYA 3EUAA 2COBA 3K2AA 3SDGA 3JRCA 1PP8F 4ZDLA 4K2EA 4QLCU 2BY3A 2O8KA 2Y9YA 5ICGA 5C44J 1V5GA 1IUYA 1FBSA 3M4OJ 3EUHC 3F21A 2XPWA 4UY8I 2D5VA 2WAQN 1H9GA 1FMWA 3HPHA 1VTNC 2E1CA 1FIPA 1T98A 3PQKA 5D6EA 3KP3A 3FMQA 2VQCA 4FE4A 5EG0B 3M8JA 1EV7A 4H4KC 2UUZA 2IXSA 3H3ZA 1RETA 1I1SA 2ZXHA 5J4VA 3C18A 3UKGA 1QZZA 3K4CA 3DKXA 1L0OC 4XLPF 1BOBA 2IS2A 1O57A 1F5TA 5A2QZ 2KPMA 3GF2A 1BM9A 4M9XA 2EQRA 4Y52J 3LSKA 2PQ8A 2YU3A 1VQ7I 1MBGA 3L9FA 2Y31A 3M8FA 4IHTA 2ZCWA 2EK5A 2O8XA 2EA4A 1XS9A 4L0ZB 3FXQA 2R7ZJ 3HSFA 5K5QA 3KP7A 4JX6A 4YG2F 2O61A 1UHWA 5ILSA 3CC7I 4IHXA 1XX5A 2K40A 2OA4A 3M07A 4XRFA 2XDVA 4NBQA 3WU2C 4LK1F 2MH9A 5E3OA 2XUBA 2NRAC 1YW9A 2VQHA 1Z3YA 1PUFB 1MSEC 2JA6J 3EYYA 3TDZC 3ASNH 1D1AA 2W24A 1LDDA 2DOAA 2JPCA 3E3VA 2R5YB 1JUMA 2KISA 1WHUA 3QYBA 4HEA2 1HDPA 2I5UA 3K4JA 2IAIA 2ELHA 1HBXG 2IGMA 4PJMA 4E7SA 3LFUA 1JT0A 1C0WA 2AHQA 1R5ID 1YX3A 2HDDA 1D0ZA 1Z21A 1A04A 4KUMA 4I02A 3SFIA 1HA8A 1HKTA 1IV6A 3JRGA 2LK2A 3BCBA 3EPZA 2DMNA 4EGZA 1GVJA 1LUJB 4BQAA 4BJTA 3LL7A 3I54A 4G7ZF 2O7OA 3H9QA 2QA4I 4ZDOA 2D1VA 3WTVC 2MLKA 2R5YA 4JP0A 5EZHA 3AL0B 4CZZA 1XN7A 4HF1A 3VB2A 5HLGA 1R1UA 1KU7A 5FLVA 4D1QA 2KT0A 1W0TA 1SD4A 3GYHX 3A03A 2H1KA 3UR3C 3DU6A 4YFKF 2DT6A 3BZCA 3V7RA 1W5SA 3EYIA 1E3OC 2LFBA 4XIDA 2E2HJ 2ZXJA 5HLTA 2ISYA 2DA3A 2DCEA 1ZRCA 3HOVJ 2DLLA 3SFZA 2H09A 1ZK8A 4IRIA 3ABLH 3DPUA 4M74A 3MEXA 4OWRB 3WGIA 3TW7A 1JJ8C 3EUKL 2IGKA 2DA1A 5IYCJ 2DA4A 4BH9A 5F0HA 1FOXA 1U2WA 2R7TA 1TBXA 5HS8A 5E1ZB 2LMDA 2K4BA 3CLOA 1D0YA 2LKXA 1X3ZB 3W2VA 4DGWB 4BGDA 1T0FC 1SFOJ 1VQ8I 5F0CA 1R1VA 2NVUB 5D4RA 3KLOA 2W4SA 3J81K 3GTQJ 4F91B 3Q0UA 4U88A 3ZXSA 3A02A 2J5OA 4A5MA 4EVIA 1HLVA 5HDKA 1QPIA 2Y75A 2BOLA 2VE9A 1R1TA 2A05A 2DPDA 2L9SA 4MO7A 2YU9J 1UAAA 4NNJA 3SZPA 1GV5A 3ECOA 2NVTJ 3OYEA 3EDPA 2K86A 1A6QA 2HOEA 2WA0A 1TWAJ 2E7XA 4R79A 3F8FA 3Q9VA 4BXXJ 2FNAA 3OYCA 3JAMZ 1KA8A 4F52A 3GTLJ 1JTXA 4XOTA 2DU9A 1JKOC 4UXNA 1ZYRF 1Y39A 1TT5B 2CSOA 1FYKA 1ON1A 1KU2A 3VFZA 5LFAA 4QTRA 2EZLA 1TQMA 2LSOA 1G4DA 4DJAA 2A5WA 1WGXA 3ESWB 2X6XA 3C3WA 1UELB 3GLLA 4BY7J 3IAM2 1ZGWA 3WTZA 1R71A 4C3IJ 2NNNA 3BG6A 5FROA 2ZJ2A 3DU5A 1DPRA 2EV0A 2DA5A 4P9FA 1VQ6I 3JR9A 1BA5A 4F92B 1WWXA 2JRMA 1OISA 5J8CA 4MEYF 5ILUA 3CCVI 2V1DA 2Z33A 2A5YB 1R4MB 3OOUA 3RI4A 4LG0A 2XRLA 5J47A 3A01A 1P7IA 1F1ZA 2DYSH 4HW0A 1V55H 3ZQCA 1E3HA 1MBFA 1XSXA 2F4MB 4E7LA 1LEAA 3KEQA 1D0XA 3S1NJ 1UCRA 3KP2A 1SD7A 3MCZA 3HOUJ 2Y0MA 4EJTA 3A1YA 1SFKA 4E70A 3G1LA 4HNVA 4GYGA 2A68F 4ETSA 2YR2A 1OCPA 3ZQQA 3RCOA 2RVCA 2EFPA 5DCMA 1ZG3A 2O3FA 4BNCA 2LC2A 1YYVA 2ELJA 2KIQA 2LVSA 2Q0OA 3BLYA 2MG4A 4HF0A 5EGOB 2L3DA 2VPRA 4BQNA 3CCEI 1YIOA 2IS1A 2MC3A 1NTCA 4WXHA 3SZTA 2LY9A 1WCMJ 4M6VA 5ICCA 1DGRM 1USSA 3ZQGA 3OYIA 1FOWA 4LLLA 1OKRA 3HOTA 3L2RA 3GEZA 3OYAA 2OCCH 5DD4A 3I53A 1W7PD 4MFDA 3CC2I 2VJJA 5M5WJ 2P0WA 3BTLA 3HRSA 3DEEA 3IUOA 4A3KJ 3A4CA 4YIFA 3A0BC 5B1BH 5E3MA 3ZQHA 3MD2A 3S1MJ 1QHGA 3ECHA 1XG1A 1HCRA 4IX7A 5EGOA 4I76A 3FK7A 4ZYAA 2XF7A 4MIMA 3DLAA 2CQNA 3I4PA 1U78A 2VQGA 1RC9A 4P5OA 1Z3XA 1TQIA 2FBKA 4IHVA 3IHUA 3PJRA 2HQAA 1POGA 3BTIA 3MVPA 2O0YA 4R8HA 4DYCA 3QU6A 4HRIA 4J19A 5K1YA 2EV5A 5FGMA 2P5VA 5KNLA 3JRBA 2A3SA 3BJ6A 1OCCH 5EDNA 5J3LA 5KCMA 2W82A 2M5WA 2WV1A 2CUEA 3DFGA 2HTSA 4JOMA 1RR7A 1XGOA 3CZ6A 2QKMB 2IS6A 1LB2A 3CCLI 3S14J 5D8KB 2LG4A 1G6NA 3LSTA 5H2FC 2VUMJ 1CF7B 5LEKA 4RB2C 4EV0A 5LGTA 2M4KA 1STZA 2WC2A 2EWNA 3GZ6A 5BPDA 2GOMA 2HGCA 3PIOF 4A93J 2HQRA 2DMTA 3DWLE 3N05A 3GTOJ 5F1RA 2MLGA 5CQGA 1NK3P 1IO2A 5HDGA 4MQ9F 4E6KG 1FX7A 5GAHJ 2QSHX 3KE2A 5B3SH 2L4AA 3CCSI 3HGGA 4J01A 3WHCA 4A3IJ 1NK2P 4LG3A 4CYCA 4LIUA 2Y30A 5D5UB 1U8BA 1CF7A 4UVBA 4M9ZA 1I27A 3M9AA 3PIPF 2VBWA 2DMQA 4AD9A 2CQ7A 4UUSB 4HDVA 4PSWA 2EA2A 2O9LA 1YLFA 1YRNB 3PFIA 5JVGF 1F4KA 2MABA 1VQOI 2V1NA 1TT0A 3FDYA 2X0LA 3F8NA 4ZZLA 2E1MB 2L5QA 5DEQA 1RUOA 3F0CA 1O7LA 2PJRB 3SHFA 3I59B 1W0UA 2DXIA 4L5IA 1X1AA 4A3GJ 3BDDA 1O3RA 1B6AA 2JQ7A 3G73A 2JA7J 1BN5A 3BQYA 2BGCA 4B48A 2HZTA 3D0SA 5FKNA 2IP2A 4UV8A 3ZN0A 4B4CA 4ESFA 1U3EM 4OIPF 4UUSA 1IV8A 3L2UA 2DOEA 4AVPA 1I6HJ 1WH5A 4ENMA 3TBIA 3V7SA 4S04A 5FB2A 2MSYA 1J75A 5D5WB 2CYYA 3HRMA 4LLNA 2FRHA 1SEUA 1YE9A 2V79A 3AFHA 2A69F 3OY9A 4JX4A 2PJRA 2R7OA 9ANTA 1MGTA 1WQ2A 4MLOA 3TKYA 1Z67A 4I99C 4IPAA 2FJ1A 4KIFA 3F6OA 3ZQ7A 3FKIJ 3ZQIA 2R3SA 3ONQA 1OFCX 2QWWA 4CXFA 2LTPA 4L9JA 1RESA 5LHGA 5GTHC 3IL2A 3ABKH 3WTWC 1LE8B 4E7JA 1I39A 2Y9ZA 4FX4A 1TW3A 1P4WA 1DQUA 2FE3A 4AUXA 1ZR4A 3CMYA 1N75A 3NWTA 3C2BA 4BEHB 1Y0UA 2EIMH 2IEKA 2L02A 3CMMA 4DYQA 3CJQB 3TO6A 2UXNA 3WE3A 3MKYB 3AAFA 4FASD 2Z5UA 4L5JA 2DK5A 3M8EA 3BR1A 5DUKA 3CLQA 1S72I 3V42A 2DW4A 2KHMA 3OYGA 2B7EA 2ZMEB 1VQMI 3IKTA 3CJNA 2AXLA 4B43A 2HQ5A 1PVEA 3SDBA 3SQNA 1K78B 2DFIA 5CVIA 1ZARA 4ZDPA 4R1HA 4OU0A 4BEHA 3O8GA 4HLYA 2NYXA 3U21A 1Q1VA 4U87A 4C3HJ 3PO3J 2M9HA 3EETA 1RUNA 1JXSA 4JK1X 3K1NA 1MJAA 4LIVA 5KHDA 2ECCA 1BJZA 3QRFF 2L9VA 5KAIC 3OOPA 3HJEA 1P4XA 4XN0A 4BKXA 2RDPA 3HGYA 4E7ZA 2ZMEA 3ULQB 2BXZA 2ECBA 1I3AA 1DP3A 2KL4A 1V5FA 2Z99A 2KJCA 4DIQA 1QRYA 2L01A 3IRQA 3HIFA 2M7BA 2EZHA 2EH3A 3GZNB 1AWCA 1T6SA 4ZC3A 2BZTA 4BE1A 3HYIA 4P9UA 3OL4A 2P8TA 1XDUA 2HZDA 3DKWA 3RZDJ 5CLSA 2A07F 3H5RA 2Z3YA 3GW2A 3GFLA 5DD8A 2DO7A 1SMYF 3HPGA 5AONA 3PFYA 3FXLA 3TGNA 3TQNA 3QWLA 4Z2YA 2MFZA 1JUPA 2F5CA 3J7YJ 4A3MJ 2BXYA 4I2OA 1W5CC 4EEFG 5C4JJ 1ETQA 1RZ4A 3BR6A 4HX8A 4II3A 1YJNI 1IZ1A 3B02A 1XC5A 3BQZA 1PP7U 3MWMA 2P7VB 3LAPA 3PSIA 2FMLA 1V54H 3L2QA 2E60A 1AHDP 2AO9A 2KRFA 4BE0A 1QPMA 3BPVA 4CCNA 2JMWA 3MFKA 4XLFA 1LFBA 1A6IA 5E8GA 4O6JA 4XOPA 1MMDA 1ZN2A 4UVAA 5FKKA 1K4TA 3J7AO 2VODA 2A6HF 2EV6A 2O6GE 4RM3A 3I4NJ 4IQ4A 5HNFA 1OJLA
chains in the Genus database with same CATH topology
1IRGA 3T0YA 4ENJA 3L2CA 2QUFA 2CO5A 2HTJA 2VBYA 1JGSA 3FXUA 4KT5C 2VBXA 4I01A 4N9IA 4XSXF 4PZJA 4QWQA 3BJOA 3LA2A 5HDNA 2BEOA 1GXQA 1PDNC 3V8KA 3MAJA 2MD5A 4NHJA 3KETA 5L3DA 2QLZA 2BE5F 1YFHA 2DQRA 3QPTA 2HWVA 1ZRFA 4G8XA 4BXUA 3W6JB 4LGWA 2ZNZA 5CVRA 1H0MA 1GXPA 4A6EA 1IN6A 3O2PE 1J7KA 3FM3A 1KQ8A 2W57A 4N0BA 5FLXZ 1RIOH 3KZYA 3WTYC 1FBQA 3V8JA 2OD5A 4EJUA 1BI3A 4WXDA 2QBYA 1ZREA 3W6KB 3IWZA 3M7GA 1S7OA 1XDSA 1F9NA 5LHHA 4D0PA 2IA1A 3EUHA 2AS5F 1ONVA 2MA3A 4CO8A 2PJPA 2M30A 2QVOA 5A2QK 2QZ8A 1B59A 1P2FA 2P5LC 3V7CA 5LLQA 4I0BA 3GLXA 3DPLC 2L54A 2D45A 1D8JA 2J5PA 4FHTA 2PI0A 3U2RA 4NQWA 4ZH4F 3WG9A 2EFNA 3R4KA 3F72A 3VEPA 3R61A 1E2XA 2DK8A 3MZYA 2VC1A 3TOAA 2F5FA 2HYFA 2V6CA 4GXOA 5L3FA 2YX7A 1IRFA 3LWFA 4ZYGA 3HRTA 2PN6A 4U7DA 3RPUA 1KU3A 3E5XA 1EH7A 3G3ZA 3C1DA 1TW2A 1FC3A 1LVAA 5FFZA 5FD5A 1H9TA 3HOSA 4LK0F 5JFRA 3CTAA 2W25A 4ENKA 4CYDA 3KP6A 1R22A 5DUIA 2P4WA 1AOYA 3P7NA 2K27A 1T0FA 3HRUA 1BIBA 2DT5A 1R7JA 3T8RA 4KN4X 2FEZA 4OIRF 1BC8C 2STTA 4UVCA 3FZVA 3VOEA 3KFWX 5L3EA 3T8TA 5JHUA 3JAMK 3IRRA 3K1PA 1JE8A 3J81Z 2JT1A 4LG0B 4LLGF 1KYWA 1V4RA 2H6BA 1R23A 3CUOA 1MZBA 3GO5A 4IRGA 3REOA 3JTGA 2L4MA 2NAZA 5BQTA 2IJLA 1CGPA 1X3UA 1R58A 3QOPA 4KIBA 4G9YA 4KIGA 1JHHA 5DCMB 3BWGA 2KIFA 1FZPB 4BHCA 1IN7A 2COMA 4RB1A 4M72A 1SAXA 3GXOA 1Z6TA 5K5RA 3RDIA 3F8MA 3FXRA 2KIUA 6PAXA 3ISPA 4G6QA 2V1UA 3WGHA 3I0TA 1BIAA 2P7CB 5E20A 3E5QA 1OR7A 1UFMA 4RB3C 4HV5A 2MBFA 2W85A 2QQAA 3QP5A 4KA4A 4MHGA 3IKVA 5LBQA 1QNTA 2LKPA 2RKHA 3FHZA 3JW4A 4MNUA 1BJAA 2VT3A 5H6RA 4IXAA 4I7HA 1FSHA 5ILVA 3CO7C 4A2UA 4UHTA 3CUQC 3BY6A 3KEOA 3RKXA 1YS7A 2BYVE 1ULYA 4RGRA 4HA8A 1G3TA 3ABUA 2RNJA 3PQJA 1S29A 1HW2A 1W7PA 4KMFA 3TO9A 3ELKA 1ZG5A 5HS9A 2M8EA 2CWEA 4MQVA 2QQBA 1I5ZA 1KYZA 4IF4A 2PBIA 2X4HA 4IJAA 3RKWA 1EH6A 1IXCA 3QP6A 1XCBA 3L7WA 4AIKA 2HKXA 1L3LA 3GVAA 2OU2A 2YX4A 1SFEA 1OYWA 3HSEA 4BAYA 1FP1D 2ADUA 2FF4A 4H0EA 2HQNA 1FWZA 5IT3A 4WF2A 3EQLF 4OMZA 3GWZA 3K9TA 2QYOA 4HX7A 2F5EA 5IT9K 2DTRA 4RGXA 5D4SA 3ROUA 5D6FA 3S2WA 4CGZA 4L9TA 3M1EA 3P9KA 5EEHA 4WWCA 2XHKA 3WODF 1Z7UA 5DCFA 3Q5FA 1Z05A 2KKOA 3U9GA 1B9MA 3DQVC 4MTEA 3VODA 4Q5SF 4OOIA 5HOOA 4GCVA 3L00A 4GO1A 2FOKA 3NQOA 1T38A 4HYEA 5E1WA 2A6EF 2CQKA 2F2EA 1OMIA 4RB0A 1FPQA 1LDJA 4UNOA 3GFMA 2Q2EA 5ICEA 3KZZA 3BPXA 4L9VA 4XLNF 1FYMA 1LNWA 2LF7A 2IW5A 5CVUA 4O5VA 4HLXA 2K4JA 4Y15A 4JBAA 5JR3A 4HQEA 2HFHA 2RV8A 5D5VB 3JSPA 1SMTA 2GXBA 4KNYA 3FWEA 4WX9A 4B09A 2PEXA 5ERIA 3RPQA 1XGMA 2ESHA 5LHIA 2ETHA 4LMYA 2E1NA 1O3SA 2XKOA 2P5KA 4A5NA 2HEOA 1FLIA 1FOKA 4DQ2A 3HHGA 1XMKA 5BMZA 2WTEA 2M45A 4Q48A 4LJZF 2H27A 2GA1A 1ZLKA 1ZH5A 1YS6A 4KYWA 4F7ZA 1UB9A 1BI2A 1YTYA 2GA2A 1REPC 1ZGJA 5LEJA 4KMUX 4GYIA 1OYYA 3E5UA 5E8IA 4OIQF 4EJVA 3NEUA 1QBJA 4YFNF 3KCCA 2VBZA 2FBHA 4A0XA 1Z1DA 1NHAA 1Z6RA 1RNLA 5K5OA 4UV9A 5L3GA 3DP7A 4ZYEA 5H20A 2PLYA 4CHUA 2VXZA 3BZ6A 1QQIA 3LFKA 2P6SA 2XAGA 3L09A 4ASNA 4KDPA 4U0WA 1O3QA 2FNPA 1IN8A 1FNNA 3OV8A 1O7FA 5L3BA 1XD7A 3U1DA 4LB6B 3F3XA 4L18B 2RQPA 1HSTA 4WCGA 2JZYA 1R00A 1LJ9A 4HV6A 2HDCA 1XMAA 4IRHA 3ZMTA 2JRTA 1R5HA 3H3UA 3GX4X 2HYGD 1JHFA 3J80K 4OMYA 2EFOA 2M87A 1QO0D 4RAZA 1YG2A 3P9CA 3F8BA 1WKMA 1WSUA 2KJBA 2BV6A 3BOQA 1FY7A 2XKPA 2FU4A 4BHBA 2QBYB 1ODDA 2FBIA 1P4AA 4NB5A 3T1BA 2XAHA 1SFXA 4RS8A 2B0LA 1U5TC 1TNSA 1I1GA 2ZKZA 5LRSA 1FYLA 2ACJA 5LRRA 1MDMB 2VE8A 4HZFA 4G7OF 1P6RA 4Q47A 5E1XA 4EM2A 2GAUA 2VN2A 4M6XA 3I71A 1R36A 4O3MA 2XIGA 3N4MA 1XCVA 1D3YA 1O3TA 2VOOA 3BROA 1T2KA 1MDMA 5F6FA 2XVCA 5FFXA 1ZHFA 2STWA 3FF5A 4ZYHA 3TDUC 1OPCA 2IPQX 4OINF 2OQGA 3SXYA 2E7WA 4P96A 2H94A 4Y13A 1FSEA 2GXGA 4KFCA 2BBYA 3DV8A 1TLHB 2OBPA 1BBYA 1XGSA 1I6XA 4JQFA 3R60A 3RJPA 4M73A 1IAWA 3NRVA 1B9NA 3WE2A 3HUGA 4G94A 4EQQA 3LA7A 4B8XA 3BP8A 3RKYA 2OZUA 4Y17A 2FA5A 3K1MA 4KN7X 2O03A 1ZRDA 2CFXA 2HS5A 2ZNYA 1IF1A 2WWYA 4A0YA 2LF8A 1S7AA 1HKSA 3LAJA 3LQQA 1HW1A 2V1XA 3ML6A 2IVMA 4U0VA 4TV7A 3WU1B 4FX0A 3IC7A 5TRDA 1QGPA 1FT9A 5H6QA 3B73A 2IA0A 4I0AA 3RYPA 1Z9CA 3CDHA 5ED4A 3I5UA 3F22A 2EFQA 3E6BA 5KVRA 4WK8F 3ZMDA 1HXDA 1HSJA 1K79A 1YW7A 4HQMA 3FMSA 3BJAA 5D5XB 3T5XA 3F6VA 1D8KA 1U8RA 1HW5A 1ON2A 2DPUA 3WU0A 1GHCA 3I58A 1G3WA 3E6DA 3P9IA 3CO6C 2FQ3A 3K69A 2NS0A 2Y48A 4RAYA 2CGPA 1KQ0A 3RYRA 1S3JA 3WTSC 5AIPA 1ZG1A 2GQQA 4MGRA 2DQLA 3DPTA 1G3SA 2HKOA 2OAZA 4BHPA 4HDUA 2YSRA 1TQPA 5DDGA 5D8LB 4HOBA 4YFXF 1S8NA 1SD6A 1T39A 2ISZA 4S05A 3DF8A 1WI9A 3COAC 4OIOF 4RGSA 1TNTA 2TDXA 3E97A 3O3KA 4MEXF 4AIHA 1YO5C 4PGHA 1D5VA 1XGNA 2RN7A 3ZMSA 2G7HA 2ZO4A 3IWFA 3JSOA 1IXRC 2Z9OA 2OZ6A 2VT2A 3N97A 4A6DA 3CUQB 5DYMA 1W7PB 1W4MA 1OYIA 1ZLJA 2M1BA 3ZMUA 1DP7P 1MD0A 2EFWA 4AIJA 2Q8KA 4EGYA 1Z91A 1U6GA 3V4GA 3E6MA 2EJRA 3GZ5A 4PCQA 4LD5A 3CUQA 4G7HF 4N9HA 4EM0B 5LGUA 2HR3A 4LB5A 2G7UA 3GFJA 2VC0A 3ZPLA 1HQCA 3R0JA 5HS7A 4KICA 3ABTA 4L9NA 2CW0F 4XBFA 3HTUA 1FBUA 4YIIA 2IT0A 3GFIA 2RGVA 5JVTA 3QPHA 5HLHA 1MKMA 3V8LA 4WXCA 5CJ9A 2IRFG 2DBBA 2R7FA 3Q9SA 3F8CA 2LDUA 2UWMA 4HBLA 1J5YA 1ZGAA 4IVNA 1IW7F 1LQ1A 2GIVA 2JSCA 4CICA 1PUEE 2JTVA 2RC4A 4MTDA 2UZKA 2R7DA 3H92A 3R6SA 5E17F 2QQ9A 3TOBA 1DPUA 1EH8A 2CG4A 3DXJF 4P55A 1WRJA 3DEUA 2ZBKA 3E6CC 1DDNA 4M71A 3ZMZA 5IT9Z 1LDKB 2KIMA 4EJWA 4M9SA 3HSRA 5J6XA 1KQ9A 3C7JA 4U0YA 3F23A 1J59A 3WTTC 1BOAA 1SD5A 2XV4S 5LGNA 1YW8A 3MZHA 3I59A 3MQ0A 5L3CA 1KGSA 2FMYA 1P92A 1YQAA 1TTYA 2XAQA 4L0YB 5BOXA 2OQRA 2H6CA 3O6BB 3ERED 5HLIA 1KU9A 5HVQC 1SFUA 3K2ZA 3QAHA 2QENA 5EEGA 3K0LA 4ENNA 5FO5A 4GGGA 5DV5A 5J8FA 3I64A 4ZZDA 4A0ZA 2XROA 1XSDA 3FX3A 1LEBA 2FXAA 1K6OA 4FT8A 1IN5A 1BC7C 3HHHA 5BPIA 2XAFA 1J2XA 1S6LA 1XSVA 2V9VA 2W84A 3WGGA 3RIRA 4ESJA 2XAJA 2A61A 2D1HA 5CVVA 4G6DA 2YPRA 4EM1A 3TO7A 1K7AA 1R5GA 2MH2A 2GZWA 1DUXC 2K02A 2G9WA 3GUDA 1K78A 1Q1HA 2LNBA 5CVJA 2K7LA 2P6TA 3RTRA 4ESBA 2GWRA 3JTHA 1IXSB 2F5DA 3ZN1A 2PMUA 5AIQA 3HTSB 1IN4A 5ICFA 5F64A 1J0RA 2WV0A 4EMSA 1BI0A 3KLNA 2XASA 5E18F 3QU3A 2DI3A 5JI6A 1HKQA 4HF2A 1FP2A 3ZMVA 2ZFWA 4RGUA 3FM5A 1BI1A 4ON0A 2C6YA 2FSWA 2ESNA 4LFUA 2XRNA 3KP4A 4HAMA 5TJJA 5FD6A 1MJ9A 2XGXA 3WTUC 1XB4A 5KK1A 2NNYA 4BYYA 1V3FA 5BS6A 1U5TB 5CYVA 2UXXA 1QZYA 2PG4A 4I09A 3R0AA 1J9IA 1RI7A 2PMHA 4PDKA 3D5LA 1USTA 3FMRA 2QM3A 4CDGA 2VONA 4ZYDA 4M6YA 4XSZF 3J80Z 4U7BA 3ZP5A 4IHSA 4EJOA 4HX4A 4UUVA 1E17A 1U5TA 4I98B 1B4AA 2PFBA 2VOPA 4AWXB 3LA3A 5FLXK 1MJBA 2IA2A 4Q4ZF 1W5TA 4PGGA 3LQRA 3KP5A 2D2WA 1G3YA 2JPBA 4DNCA 1ZAOA 3WTXC 4A12A 1UHMA 2DAOA 2EB7A 1B1BA 1PP8F 4K2EA 4QLCU 5ICGA 1IUYA 1FBSA 3F21A 1H9GA 1VTNC 2E1CA 1T98A 3PQKA 5D6EA 3KP3A 3FMQA 1EV7A 3H3ZA 1I1SA 3C18A 1QZZA 1L0OC 4XLPF 1O57A 1F5TA 5A2QZ 3GF2A 1BM9A 4M9XA 2PQ8A 2YU3A 3L9FA 3M8FA 4IHTA 2ZCWA 2EK5A 2O8XA 2EA4A 4L0ZB 3FXQA 3HSFA 5K5QA 3KP7A 4YG2F 2O61A 1UHWA 5ILSA 2OA4A 4XRFA 4LK1F 2MH9A 2XUBA 2NRAC 1YW9A 3EYYA 3TDZC 2W24A 1LDDA 2JPCA 3E3VA 2ELHA 1HBXG 1C0WA 4KUMA 1A04A 4I02A 1HKTA 4EGZA 1GVJA 4BQAA 4G7ZF 3I54A 2D1VA 3WTVC 2MLKA 4CZZA 1XN7A 4HF1A 3VB2A 5HLGA 1R1UA 1KU7A 1SD4A 3GYHX 4YFKF 3V7RA 1W5SA 3EYIA 2ZXJA 2ISYA 1ZRCA 2DLLA 3SFZA 2H09A 4IRIA 4M74A 3MEXA 3WGIA 4BH9A 1U2WA 1TBXA 5HS8A 5E1ZB 2K4BA 3CLOA 1R1VA 5D4RA 3KLOA 3J81K 4U88A 4A5MA 2J5OA 4EVIA 5HDKA 2Y75A 2VE9A 1R1TA 2DPDA 3SZPA 3ECOA 3EDPA 2K86A 2HOEA 4R79A 2E7XA 3F8FA 3Q9VA 2FNAA 3JAMZ 1KA8A 2DU9A 4UXNA 1ZYRF 2CSOA 1FYKA 1ON1A 1KU2A 3VFZA 1TQMA 2LSOA 1G4DA 3C3WA 3WTZA 2NNNA 2ZJ2A 1DPRA 2EV0A 4P9FA 1WWXA 5J8CA 4MEYF 5ILUA 2V1DA 2Z33A 2A5YB 3RI4A 4LG0A 4HW0A 1F1ZA 1XSXA 1LEAA 3KEQA 1UCRA 3KP2A 1SD7A 3MCZA 2Y0MA 4EJTA 4E70A 4GYGA 2A68F 4ETSA 2YR2A 2RVCA 2EFPA 5DCMA 1ZG3A 2O3FA 4BNCA 1YYVA 2Q0OA 4HF0A 2L3DA 1YIOA 2MC3A 3SZTA 4WXHA 5ICCA 1USSA 4LLLA 1OKRA 3HOTA 3GEZA 5DD4A 3I53A 1W7PD 3HRSA 4YIFA 3ECHA 3I4PA 1U78A 4P5OA 1TQIA 2FBKA 3IHUA 2O0YA 4R8HA 3QU6A 5K1YA 2EV5A 5FGMA 2P5VA 2A3SA 3BJ6A 2M5WA 3DFGA 2HTSA 1XGOA 1LB2A 5D8KB 1G6NA 3LSTA 1CF7B 5LEKA 4RB2C 4EV0A 5LGTA 1STZA 2WC2A 2EWNA 3GZ6A 5BPDA 2HGCA 2HQRA 5F1RA 2MLGA 5HDGA 4MQ9F 1FX7A 3KE2A 2L4AA 5D5UB 1CF7A 4UVBA 4M9ZA 1I27A 3M9AA 2VBWA 4AD9A 4HDVA 2EA2A 1YLFA 3PFIA 1F4KA 2X0LA 3F8NA 4ZZLA 5DEQA 1RUOA 1O7LA 3SHFA 3I59B 4L5IA 3BDDA 1O3RA 1B6AA 3G73A 1BN5A 2BGCA 2HZTA 3D0SA 2IP2A 4UV8A 3ZN0A 4ESFA 1U3EM 4OIPF 4AVPA 4ENMA 3V7SA 4S04A 5FB2A 1J75A 5D5WB 2CYYA 3HRMA 4LLNA 2FRHA 2V79A 2A69F 1MGTA 1WQ2A 3TKYA 4IPAA 4KIFA 3F6OA 3ZQ7A 2R3SA 2QWWA 4CXFA 4L9JA 5LHGA 3IL2A 3WTWC 4FX4A 1TW3A 1P4WA 2FE3A 1Y0UA 2L02A 3TO6A 2UXNA 3WE3A 3AAFA 2Z5UA 4L5JA 2DK5A 3M8EA 5DUKA 2DW4A 2ZMEB 3IKTA 3CJNA 2AXLA 3SQNA 1K78B 2DFIA 5CVIA 1ZARA 4R1HA 4OU0A 4HLYA 2NYXA 3EETA 1RUNA 1JXSA 4JK1X 3K1NA 1MJAA 3QRFF 3OOPA 1P4XA 2RDPA 2ZMEA 3ULQB 2Z99A 2KJCA 3IRQA 2L01A 3HIFA 1AWCA 1T6SA 3HYIA 4P9UA 2P8TA 1XDUA 3DKWA 5CLSA 2A07F 2Z3YA 3GW2A 3GFLA 5DD8A 2DO7A 1SMYF 5AONA 3TGNA 3TQNA 4Z2YA 2F5CA 4I2OA 1RZ4A 4HX8A 1PP7U 1IZ1A 3B02A 3MWMA 2P7VB 3LAPA 2FMLA 2KRFA 1QPMA 3BPVA 3MFKA 5E8GA 4O6JA 1ZN2A 4UVAA 3J7AO 2VODA 2A6HF 2EV6A 2O6GE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRG A;  3T0Y A;  4ENJ A;  3L2C A;  2QUF A;  2CO5 A;  2HTJ A;  2VBY A;  1JGS A;  3FXU A;  4KT5 C;  2VBX A;  4I01 A;  4N9I A;  4XSX F;  4PZJ A;  4QWQ A;  3BJO A;  3LA2 A;  5HDN A;  2BEO A;  1GXQ A;  1PDN C;  3V8K A;  3MAJ A;  2MD5 A;  4NHJ A;  3KET A;  5L3D A;  2QLZ A;  2BE5 F;  1YFH A;  2DQR A;  3QPT A;  2HWV A;  1ZRF A;  4G8X A;  4BXU A;  3W6J B;  4LGW A;  2ZNZ A;  5CVR A;  1H0M A;  1GXP A;  4A6E A;  1IN6 A;  3O2P E;  1J7K A;  3FM3 A;  1KQ8 A;  2W57 A;  4N0B A;  5FLX Z;  1RIO H;  3KZY A;  3WTY C;  1FBQ A;  3V8J A;  2OD5 A;  4EJU A;  1BI3 A;  4WXD A;  2QBY A;  1ZRE A;  3W6K B;  3IWZ A;  3M7G A;  1S7O A;  1XDS A;  1F9N A;  5LHH A;  4D0P A;  2IA1 A;  3EUH A;  2AS5 F;  1ONV A;  2MA3 A;  4CO8 A;  2PJP A;  2M30 A;  2QVO A;  5A2Q K;  2QZ8 A;  1B59 A;  1P2F A;  2P5L C;  3V7C A;  5LLQ A;  4I0B A;  3GLX A;  3DPL C;  2L54 A;  2D45 A;  1D8J A;  2J5P A;  4FHT A;  2PI0 A;  3U2R A;  4NQW A;  4ZH4 F;  3WG9 A;  2EFN A;  3R4K A;  3F72 A;  3VEP A;  3R61 A;  1E2X A;  2DK8 A;  3MZY A;  2VC1 A;  3TOA A;  2F5F A;  2HYF A;  2V6C A;  4GXO A;  5L3F A;  2YX7 A;  1IRF A;  3LWF A;  4ZYG A;  3HRT A;  2PN6 A;  4U7D A;  3RPU A;  1KU3 A;  3E5X A;  1EH7 A;  3G3Z A;  3C1D A;  1TW2 A;  1FC3 A;  1LVA A;  5FFZ A;  5FD5 A;  1H9T A;  3HOS A;  4LK0 F;  5JFR A;  3CTA A;  2W25 A;  4ENK A;  4CYD A;  3KP6 A;  1R22 A;  5DUI A;  2P4W A;  1AOY A;  3P7N A;  2K27 A;  1T0F A;  3HRU A;  1BIB A;  2DT5 A;  1R7J A;  3T8R A;  4KN4 X;  2FEZ A;  4OIR F;  1BC8 C;  2STT A;  4UVC A;  3FZV A;  3VOE A;  3KFW X;  5L3E A;  3T8T A;  5JHU A;  3JAM K;  3IRR A;  3K1P A;  1JE8 A;  3J81 Z;  2JT1 A;  4LG0 B;  4LLG F;  1KYW A;  1V4R A;  2H6B A;  1R23 A;  3CUO A;  1MZB A;  3GO5 A;  4IRG A;  3REO A;  3JTG A;  2L4M A;  2NAZ A;  5BQT A;  2IJL A;  1CGP A;  1X3U A;  1R58 A;  3QOP A;  4KIB A;  4G9Y A;  4KIG A;  1JHH A;  5DCM B;  3BWG A;  2KIF A;  1FZP B;  4BHC A;  1IN7 A;  2COM A;  4RB1 A;  4M72 A;  1SAX A;  3GXO A;  1Z6T A;  5K5R A;  3RDI A;  3F8M A;  3FXR A;  2KIU A;  6PAX A;  3ISP A;  4G6Q A;  2V1U A;  3WGH A;  3I0T A;  1BIA A;  2P7C B;  5E20 A;  3E5Q A;  1OR7 A;  1UFM A;  4RB3 C;  4HV5 A;  2MBF A;  2W85 A;  2QQA A;  3QP5 A;  4KA4 A;  4MHG A;  3IKV A;  5LBQ A;  1QNT A;  2LKP A;  2RKH A;  3FHZ A;  3JW4 A;  4MNU A;  1BJA A;  2VT3 A;  5H6R A;  4IXA A;  4I7H A;  1FSH A;  5ILV A;  3CO7 C;  4A2U A;  4UHT A;  3CUQ C;  3BY6 A;  3KEO A;  3RKX A;  1YS7 A;  2BYV E;  1ULY A;  4RGR A;  4HA8 A;  1G3T A;  3ABU A;  2RNJ A;  3PQJ A;  1S29 A;  1HW2 A;  1W7P A;  4KMF A;  3TO9 A;  3ELK A;  1ZG5 A;  5HS9 A;  2M8E A;  2CWE A;  4MQV A;  2QQB A;  1I5Z A;  1KYZ A;  4IF4 A;  2PBI A;  2X4H A;  4IJA A;  3RKW A;  1EH6 A;  1IXC A;  3QP6 A;  1XCB A;  3L7W A;  4AIK A;  2HKX A;  1L3L A;  3GVA A;  2OU2 A;  2YX4 A;  1SFE A;  1OYW A;  3HSE A;  4BAY A;  1FP1 D;  2ADU A;  2FF4 A;  4H0E A;  2HQN A;  1FWZ A;  5IT3 A;  4WF2 A;  3EQL F;  4OMZ A;  3GWZ A;  3K9T A;  2QYO A;  4HX7 A;  2F5E A;  5IT9 K;  2DTR A;  4RGX A;  5D4S A;  3ROU A;  5D6F A;  3S2W A;  4CGZ A;  4L9T A;  3M1E A;  3P9K A;  5EEH A;  4WWC A;  2XHK A;  3WOD F;  1Z7U A;  5DCF A;  3Q5F A;  1Z05 A;  2KKO A;  3U9G A;  1B9M A;  3DQV C;  4MTE A;  3VOD A;  4Q5S F;  4OOI A;  5HOO A;  4GCV A;  3L00 A;  4GO1 A;  2FOK A;  3NQO A;  1T38 A;  4HYE A;  5E1W A;  2A6E F;  2CQK A;  2F2E A;  1OMI A;  4RB0 A;  1FPQ A;  1LDJ A;  4UNO A;  3GFM A;  2Q2E A;  5ICE A;  3KZZ A;  3BPX A;  4L9V A;  4XLN F;  1FYM A;  1LNW A;  2LF7 A;  2IW5 A;  5CVU A;  4O5V A;  4HLX A;  2K4J A;  4Y15 A;  4JBA A;  5JR3 A;  4HQE A;  2HFH A;  2RV8 A;  5D5V B;  3JSP A;  1SMT A;  2GXB A;  4KNY A;  3FWE A;  4WX9 A;  4B09 A;  2PEX A;  5ERI A;  3RPQ A;  1XGM A;  2ESH A;  5LHI A;  2ETH A;  4LMY A;  2E1N A;  1O3S A;  2XKO A;  2P5K A;  4A5N A;  2HEO A;  1FLI A;  1FOK A;  4DQ2 A;  3HHG A;  1XMK A;  5BMZ A;  2WTE A;  2M45 A;  4Q48 A;  4LJZ F;  2H27 A;  2GA1 A;  1ZLK A;  1ZH5 A;  1YS6 A;  4KYW A;  4F7Z A;  1UB9 A;  1BI2 A;  1YTY A;  2GA2 A;  1REP C;  1ZGJ A;  5LEJ A;  4KMU X;  4GYI A;  1OYY A;  3E5U A;  5E8I A;  4OIQ F;  4EJV A;  3NEU A;  1QBJ A;  4YFN F;  3KCC A;  2VBZ A;  2FBH A;  4A0X A;  1Z1D A;  1NHA A;  1Z6R A;  1RNL A;  5K5O A;  4UV9 A;  5L3G A;  3DP7 A;  4ZYE A;  5H20 A;  2PLY A;  4CHU A;  2VXZ A;  3BZ6 A;  1QQI A;  3LFK A;  2P6S A;  2XAG A;  3L09 A;  4ASN A;  4KDP A;  4U0W A;  1O3Q A;  2FNP A;  1IN8 A;  1FNN A;  3OV8 A;  1O7F A;  5L3B A;  1XD7 A;  3U1D A;  4LB6 B;  3F3X A;  4L18 B;  2RQP A;  1HST A;  4WCG A;  2JZY A;  1R00 A;  1LJ9 A;  4HV6 A;  2HDC A;  1XMA A;  4IRH A;  3ZMT A;  2JRT A;  1R5H A;  3H3U A;  3GX4 X;  2HYG D;  1JHF A;  3J80 K;  4OMY A;  2EFO A;  2M87 A;  1QO0 D;  4RAZ A;  1YG2 A;  3P9C A;  3F8B A;  1WKM A;  1WSU A;  2KJB A;  2BV6 A;  3BOQ A;  1FY7 A;  2XKP A;  2FU4 A;  4BHB A;  2QBY B;  1ODD A;  2FBI A;  1P4A A;  4NB5 A;  3T1B A;  2XAH A;  1SFX A;  4RS8 A;  2B0L A;  1U5T C;  1TNS A;  1I1G A;  2ZKZ A;  5LRS A;  1FYL A;  2ACJ A;  5LRR A;  1MDM B;  2VE8 A;  4HZF A;  4G7O F;  1P6R A;  4Q47 A;  5E1X A;  4EM2 A;  2GAU A;  2VN2 A;  4M6X A;  3I71 A;  1R36 A;  4O3M A;  2XIG A;  3N4M A;  1XCV A;  1D3Y A;  1O3T A;  2VOO A;  3BRO A;  1T2K A;  1MDM A;  5F6F A;  2XVC A;  5FFX A;  1ZHF A;  2STW A;  3FF5 A;  4ZYH A;  3TDU C;  1OPC A;  2IPQ X;  4OIN F;  2OQG A;  3SXY A;  2E7W A;  4P96 A;  2H94 A;  4Y13 A;  1FSE A;  2GXG A;  4KFC A;  2BBY A;  3DV8 A;  1TLH B;  2OBP A;  1BBY A;  1XGS A;  1I6X A;  4JQF A;  3R60 A;  3RJP A;  4M73 A;  1IAW A;  3NRV A;  1B9N A;  3WE2 A;  3HUG A;  4G94 A;  4EQQ A;  3LA7 A;  4B8X A;  3BP8 A;  3RKY A;  2OZU A;  4Y17 A;  2FA5 A;  3K1M A;  4KN7 X;  2O03 A;  1ZRD A;  2CFX A;  2HS5 A;  2ZNY A;  1IF1 A;  2WWY A;  4A0Y A;  2LF8 A;  1S7A A;  1HKS A;  3LAJ A;  3LQQ A;  1HW1 A;  2V1X A;  3ML6 A;  2IVM A;  4U0V A;  4TV7 A;  3WU1 B;  4FX0 A;  3IC7 A;  5TRD A;  1QGP A;  1FT9 A;  5H6Q A;  3B73 A;  2IA0 A;  4I0A A;  3RYP A;  1Z9C A;  3CDH A;  5ED4 A;  3I5U A;  3F22 A;  2EFQ A;  3E6B A;  5KVR A;  4WK8 F;  3ZMD A;  1HXD A;  1HSJ A;  1K79 A;  1YW7 A;  4HQM A;  3FMS A;  3BJA A;  5D5X B;  3T5X A;  3F6V A;  1D8K A;  1U8R A;  1HW5 A;  1ON2 A;  2DPU A;  3WU0 A;  1GHC A;  3I58 A;  1G3W A;  3E6D A;  3P9I A;  3CO6 C;  2FQ3 A;  3K69 A;  2NS0 A;  2Y48 A;  4RAY A;  2CGP A;  1KQ0 A;  3RYR A;  1S3J A;  3WTS C;  5AIP A;  1ZG1 A;  2GQQ A;  4MGR A;  2DQL A;  3DPT A;  1G3S A;  2HKO A;  2OAZ A;  4BHP A;  4HDU A;  2YSR A;  1TQP A;  5DDG A;  5D8L B;  4HOB A;  4YFX F;  1S8N A;  1SD6 A;  1T39 A;  2ISZ A;  4S05 A;  3DF8 A;  1WI9 A;  3COA C;  4OIO F;  4RGS A;  1TNT A;  2TDX A;  3E97 A;  3O3K A;  4MEX F;  4AIH A;  1YO5 C;  4PGH A;  1D5V A;  1XGN A;  2RN7 A;  3ZMS A;  2G7H A;  2ZO4 A;  3IWF A;  3JSO A;  1IXR C;  2Z9O A;  2OZ6 A;  2VT2 A;  3N97 A;  4A6D A;  3CUQ B;  5DYM A;  1W7P B;  1W4M A;  1OYI A;  1ZLJ A;  2M1B A;  3ZMU A;  1DP7 P;  1MD0 A;  2EFW A;  4AIJ A;  2Q8K A;  4EGY A;  1Z91 A;  1U6G A;  3V4G A;  3E6M A;  2EJR A;  3GZ5 A;  4PCQ A;  4LD5 A;  3CUQ A;  4G7H F;  4N9H A;  4EM0 B;  5LGU A;  2HR3 A;  4LB5 A;  2G7U A;  3GFJ A;  2VC0 A;  3ZPL A;  1HQC A;  3R0J A;  5HS7 A;  4KIC A;  3ABT A;  4L9N A;  2CW0 F;  4XBF A;  3HTU A;  1FBU A;  4YII A;  2IT0 A;  3GFI A;  2RGV A;  5JVT A;  3QPH A;  5HLH A;  1MKM A;  3V8L A;  4WXC A;  5CJ9 A;  2IRF G;  2DBB A;  2R7F A;  3Q9S A;  3F8C A;  2LDU A;  2UWM A;  4HBL A;  1J5Y A;  1ZGA A;  4IVN A;  1IW7 F;  1LQ1 A;  2GIV A;  2JSC A;  4CIC A;  1PUE E;  2JTV A;  2RC4 A;  4MTD A;  2UZK A;  2R7D A;  3H92 A;  3R6S A;  5E17 F;  2QQ9 A;  3TOB A;  1DPU A;  1EH8 A;  2CG4 A;  3DXJ F;  4P55 A;  1WRJ A;  3DEU A;  2ZBK A;  3E6C C;  1DDN A;  4M71 A;  3ZMZ A;  5IT9 Z;  1LDK B;  2KIM A;  4EJW A;  4M9S A;  3HSR A;  5J6X A;  1KQ9 A;  3C7J A;  4U0Y A;  3F23 A;  1J59 A;  3WTT C;  1BOA A;  1SD5 A;  2XV4 S;  5LGN A;  1YW8 A;  3MZH A;  3I59 A;  3MQ0 A;  5L3C A;  1KGS A;  2FMY A;  1P92 A;  1YQA A;  1TTY A;  2XAQ A;  4L0Y B;  5BOX A;  2OQR A;  2H6C A;  3O6B B;  3ERE D;  5HLI A;  1KU9 A;  5HVQ C;  1SFU A;  3K2Z A;  3QAH A;  2QEN A;  5EEG A;  3K0L A;  4ENN A;  5FO5 A;  4GGG A;  5DV5 A;  5J8F A;  3I64 A;  4ZZD A;  4A0Z A;  2XRO A;  1XSD A;  3FX3 A;  1LEB A;  2FXA A;  1K6O A;  4FT8 A;  1IN5 A;  1BC7 C;  3HHH A;  5BPI A;  2XAF A;  1J2X A;  1S6L A;  1XSV A;  2V9V A;  2W84 A;  3WGG A;  3RIR A;  4ESJ A;  2XAJ A;  2A61 A;  2D1H A;  5CVV A;  4G6D A;  2YPR A;  4EM1 A;  3TO7 A;  1K7A A;  1R5G A;  2MH2 A;  2GZW A;  1DUX C;  2K02 A;  2G9W A;  3GUD A;  1K78 A;  1Q1H A;  2LNB A;  5CVJ A;  2K7L A;  2P6T A;  3RTR A;  4ESB A;  2GWR A;  3JTH A;  1IXS B;  2F5D A;  3ZN1 A;  2PMU A;  5AIQ A;  3HTS B;  1IN4 A;  5ICF A;  5F64 A;  1J0R A;  2WV0 A;  4EMS A;  1BI0 A;  3KLN A;  2XAS A;  5E18 F;  3QU3 A;  2DI3 A;  5JI6 A;  1HKQ A;  4HF2 A;  1FP2 A;  3ZMV A;  2ZFW A;  4RGU A;  3FM5 A;  1BI1 A;  4ON0 A;  2C6Y A;  2FSW A;  2ESN A;  4LFU A;  2XRN A;  3KP4 A;  4HAM A;  5TJJ A;  5FD6 A;  1MJ9 A;  2XGX A;  3WTU C;  1XB4 A;  5KK1 A;  2NNY A;  4BYY A;  1V3F A;  5BS6 A;  1U5T B;  5CYV A;  2UXX A;  1QZY A;  2PG4 A;  4I09 A;  3R0A A;  1J9I A;  1RI7 A;  2PMH A;  4PDK A;  3D5L A;  1UST A;  3FMR A;  2QM3 A;  4CDG A;  2VON A;  4ZYD A;  4M6Y A;  4XSZ F;  3J80 Z;  4U7B A;  3ZP5 A;  4IHS A;  4EJO A;  4HX4 A;  4UUV A;  1E17 A;  1U5T A;  4I98 B;  1B4A A;  2PFB A;  2VOP A;  4AWX B;  3LA3 A;  5FLX K;  1MJB A;  2IA2 A;  4Q4Z F;  1W5T A;  4PGG A;  3LQR A;  3KP5 A;  2D2W A;  1G3Y A;  2JPB A;  4DNC A;  1ZAO A;  3WTX C;  4A12 A;  1UHM A;  2DAO A;  2EB7 A;  1B1B A;  1PP8 F;  4K2E A;  4QLC U;  5ICG A;  1IUY A;  1FBS A;  3F21 A;  1H9G A;  1VTN C;  2E1C A;  1T98 A;  3PQK A;  5D6E A;  3KP3 A;  3FMQ A;  1EV7 A;  3H3Z A;  1I1S A;  3C18 A;  1QZZ A;  1L0O C;  4XLP F;  1O57 A;  1F5T A;  5A2Q Z;  3GF2 A;  1BM9 A;  4M9X A;  2PQ8 A;  2YU3 A;  3L9F A;  3M8F A;  4IHT A;  2ZCW A;  2EK5 A;  2O8X A;  2EA4 A;  4L0Z B;  3FXQ A;  3HSF A;  5K5Q A;  3KP7 A;  4YG2 F;  2O61 A;  1UHW A;  5ILS A;  2OA4 A;  4XRF A;  4LK1 F;  2MH9 A;  2XUB A;  2NRA C;  1YW9 A;  3EYY A;  3TDZ C;  2W24 A;  1LDD A;  2JPC A;  3E3V A;  2ELH A;  1HBX G;  1C0W A;  4KUM A;  1A04 A;  4I02 A;  1HKT A;  4EGZ A;  1GVJ A;  4BQA A;  4G7Z F;  3I54 A;  2D1V A;  3WTV C;  2MLK A;  4CZZ A;  1XN7 A;  4HF1 A;  3VB2 A;  5HLG A;  1R1U A;  1KU7 A;  1SD4 A;  3GYH X;  4YFK F;  3V7R A;  1W5S A;  3EYI A;  2ZXJ A;  2ISY A;  1ZRC A;  2DLL A;  3SFZ A;  2H09 A;  4IRI A;  4M74 A;  3MEX A;  3WGI A;  4BH9 A;  1U2W A;  1TBX A;  5HS8 A;  5E1Z B;  2K4B A;  3CLO A;  1R1V A;  5D4R A;  3KLO A;  3J81 K;  4U88 A;  4A5M A;  2J5O A;  4EVI A;  5HDK A;  2Y75 A;  2VE9 A;  1R1T A;  2DPD A;  3SZP A;  3ECO A;  3EDP A;  2K86 A;  2HOE A;  4R79 A;  2E7X A;  3F8F A;  3Q9V A;  2FNA A;  3JAM Z;  1KA8 A;  2DU9 A;  4UXN A;  1ZYR F;  2CSO A;  1FYK A;  1ON1 A;  1KU2 A;  3VFZ A;  1TQM A;  2LSO A;  1G4D A;  3C3W A;  3WTZ A;  2NNN A;  2ZJ2 A;  1DPR A;  2EV0 A;  4P9F A;  1WWX A;  5J8C A;  4MEY F;  5ILU A;  2V1D A;  2Z33 A;  2A5Y B;  3RI4 A;  4LG0 A;  4HW0 A;  1F1Z A;  1XSX A;  1LEA A;  3KEQ A;  1UCR A;  3KP2 A;  1SD7 A;  3MCZ A;  2Y0M A;  4EJT A;  4E70 A;  4GYG A;  2A68 F;  4ETS A;  2YR2 A;  2RVC A;  2EFP A;  5DCM A;  1ZG3 A;  2O3F A;  4BNC A;  1YYV A;  2Q0O A;  4HF0 A;  2L3D A;  1YIO A;  2MC3 A;  3SZT A;  4WXH A;  5ICC A;  1USS A;  4LLL A;  1OKR A;  3HOT A;  3GEZ A;  5DD4 A;  3I53 A;  1W7P D;  3HRS A;  4YIF A;  3ECH A;  3I4P A;  1U78 A;  4P5O A;  1TQI A;  2FBK A;  3IHU A;  2O0Y A;  4R8H A;  3QU6 A;  5K1Y A;  2EV5 A;  5FGM A;  2P5V A;  2A3S A;  3BJ6 A;  2M5W A;  3DFG A;  2HTS A;  1XGO A;  1LB2 A;  5D8K B;  1G6N A;  3LST A;  1CF7 B;  5LEK A;  4RB2 C;  4EV0 A;  5LGT A;  1STZ A;  2WC2 A;  2EWN A;  3GZ6 A;  5BPD A;  2HGC A;  2HQR A;  5F1R A;  2MLG A;  5HDG A;  4MQ9 F;  1FX7 A;  3KE2 A;  2L4A A;  5D5U B;  1CF7 A;  4UVB A;  4M9Z A;  1I27 A;  3M9A A;  2VBW A;  4AD9 A;  4HDV A;  2EA2 A;  1YLF A;  3PFI A;  1F4K A;  2X0L A;  3F8N A;  4ZZL A;  5DEQ A;  1RUO A;  1O7L A;  3SHF A;  3I59 B;  4L5I A;  3BDD A;  1O3R A;  1B6A A;  3G73 A;  1BN5 A;  2BGC A;  2HZT A;  3D0S A;  2IP2 A;  4UV8 A;  3ZN0 A;  4ESF A;  1U3E M;  4OIP F;  4AVP A;  4ENM A;  3V7S A;  4S04 A;  5FB2 A;  1J75 A;  5D5W B;  2CYY A;  3HRM A;  4LLN A;  2FRH A;  2V79 A;  2A69 F;  1MGT A;  1WQ2 A;  3TKY A;  4IPA A;  4KIF A;  3F6O A;  3ZQ7 A;  2R3S A;  2QWW A;  4CXF A;  4L9J A;  5LHG A;  3IL2 A;  3WTW C;  4FX4 A;  1TW3 A;  1P4W A;  2FE3 A;  1Y0U A;  2L02 A;  3TO6 A;  2UXN A;  3WE3 A;  3AAF A;  2Z5U A;  4L5J A;  2DK5 A;  3M8E A;  5DUK A;  2DW4 A;  2ZME B;  3IKT A;  3CJN A;  2AXL A;  3SQN A;  1K78 B;  2DFI A;  5CVI A;  1ZAR A;  4R1H A;  4OU0 A;  4HLY A;  2NYX A;  3EET A;  1RUN A;  1JXS A;  4JK1 X;  3K1N A;  1MJA A;  3QRF F;  3OOP A;  1P4X A;  2RDP A;  2ZME A;  3ULQ B;  2Z99 A;  2KJC A;  3IRQ A;  2L01 A;  3HIF A;  1AWC A;  1T6S A;  3HYI A;  4P9U A;  2P8T A;  1XDU A;  3DKW A;  5CLS A;  2A07 F;  2Z3Y A;  3GW2 A;  3GFL A;  5DD8 A;  2DO7 A;  1SMY F;  5AON A;  3TGN A;  3TQN A;  4Z2Y A;  2F5C A;  4I2O A;  1RZ4 A;  4HX8 A;  1PP7 U;  1IZ1 A;  3B02 A;  3MWM A;  2P7V B;  3LAP A;  2FML A;  2KRF A;  1QPM A;  3BPV A;  3MFK A;  5E8G A;  4O6J A;  1ZN2 A;  4UVA A;  3J7A O;  2VOD A;  2A6H F;  2EV6 A;  2O6G E; 
#chains in the Genus database with same CATH topology
 1IRG A;  3T0Y A;  4ENJ A;  3L2C A;  2QUF A;  1K79 A;  1WJE A;  2BVL A;  2CO5 A;  2HTJ A;  1JGS A;  2VBY A;  3FXU A;  2LLK A;  4KT5 C;  4IO9 F;  1X58 A;  5E3N A;  2CUZ A;  4B44 A;  2R4G A;  2VBX A;  4I01 A;  1IRZ A;  4N9I A;  4XSX F;  2G0E A;  4PZJ A;  4QWQ A;  1EF4 A;  3BJO A;  3LA2 A;  1T95 A;  5HDN A;  2BEO A;  1GXQ A;  1PDN C;  2V9P A;  2L7K A;  2KDZ A;  1CQT A;  2ZC2 A;  3V8K A;  1KON A;  3MAJ A;  4QIW N;  1JUS A;  2MD5 A;  4NHJ A;  3KET A;  5L3D A;  2QLZ A;  1RKT A;  5DS9 A;  2E35 A;  2BE5 F;  1YFH A;  2DQR A;  2RQQ A;  3QPT A;  2HWV A;  1VZ0 A;  3K70 D;  1ZRF A;  4G8X A;  4BXU A;  3W6J B;  4LGW A;  3RQ4 A;  2ZNZ A;  4RA2 A;  1K6Y A;  2VI6 A;  3KIO A;  5CVR A;  1H0M A;  1GXP A;  2TRT A;  4A6E A;  2MW8 A;  4D7N A;  3A0H C;  1IN6 A;  3O2P E;  1J7K A;  2QSG X;  3FM3 A;  1KQ8 A;  3KEY A;  2W57 A;  1J09 A;  3ZR8 X;  4N0B A;  4B3X A;  5FJ8 J;  2E5N A;  5FLX Z;  4J00 A;  3KZY A;  2LD5 A;  3WTY C;  1FBQ A;  3V8J A;  1RIO H;  3S2H J;  2MGQ A;  2OD5 A;  5CPR B;  3DTE A;  4EJU A;  2NS7 A;  1BI3 A;  1FTZ A;  4WXD A;  2QBY A;  1ZRE A;  3W6K B;  2E2I J;  3IWZ A;  3M7G A;  1S7O A;  1XDS A;  1F9N A;  2LKS A;  2LYC A;  4F93 B;  5LHH A;  4D0P A;  1LFP A;  2IA1 A;  2I8D A;  3HM5 A;  3OS0 A;  3EUH A;  2AS5 F;  3OYN A;  5E79 C;  2CUF A;  1ONV A;  3P5J A;  5C4X J;  2MA3 A;  4CO8 A;  2WAE A;  1D1C A;  2PJP A;  2M30 A;  5B1A H;  4C2U A;  1TWG J;  1S7E A;  2QVO A;  4C9Y A;  5A2Q K;  2QZ8 A;  3FHN A;  4CA0 A;  1B59 A;  1WH7 A;  1V5E A;  1P2F A;  2P5L C;  1MMG A;  3V7C A;  1K83 J;  5LLQ A;  4I0B A;  1IJW C;  1TC3 C;  3GLX A;  2OC6 A;  5CKT A;  2JN6 A;  1X3W B;  2K9S A;  1MW7 A;  3DPL C;  2L54 A;  4W97 A;  1OCO H;  3HKZ N;  2OPT A;  2D45 A;  2B9S A;  4GFB A;  2IGO A;  1UG2 A;  1D8J A;  2J5P A;  1HDD C;  4FHT A;  5E3L A;  2PI0 A;  2VJI A;  3CDL A;  2JA5 J;  3H35 A;  3U2R A;  3FXO A;  1YJW I;  1YI2 I;  4NQW A;  4ZH4 F;  4CCK A;  3WG9 A;  2EFN A;  3R4K A;  3F72 A;  3VEP A;  3R61 A;  2CQX A;  4XLE A;  3VYS B;  1E2X A;  2DK8 A;  3MZY A;  2VC1 A;  1XTA A;  3H5N A;  3CJT B;  1EA3 A;  2R7X A;  5FKL A;  2BHZ A;  2H8R A;  2VKH A;  2WB1 N;  1R6R A;  2K85 A;  5J4Y A;  3S32 A;  2DFF A;  3TOA A;  2A6T A;  2F5F A;  2PMZ N;  1U9N A;  1XPX A;  4AYB N;  2HYF A;  2V6C A;  4GXO A;  5L3F A;  2YX7 A;  1B72 B;  2R7V A;  3HC7 A;  1IRF A;  3C2G A;  2XB0 X;  3LWF A;  4XLH A;  5FRM A;  4ZYG A;  1SAN A;  2DOF A;  3HRT A;  2HVQ A;  2PN6 A;  3SZG A;  3O8H A;  2M0M A;  4U7D A;  3DTI A;  1X1P A;  3RPU A;  1KU3 A;  2X1C A;  3JRF A;  2DN0 A;  3E5X A;  1EH7 A;  1ETY A;  1ETW A;  3G3Z A;  1NG6 A;  3C1D A;  3K4M A;  1TW2 A;  3ZQL A;  1FC3 A;  1LVA A;  5FFZ A;  2BVM A;  3TP0 A;  5HNH A;  5TGT A;  5FD5 A;  1H9T A;  2ICW G;  3HOX J;  3HOS A;  1ETK A;  4LK0 F;  1B72 A;  2KZV A;  1S5L C;  2AQE A;  3GTP J;  5JFR A;  3OSG A;  3CTA A;  1VQN I;  2W25 A;  4ENK A;  1H88 C;  2DFH A;  4CYD A;  4HG2 A;  3KP6 A;  2ZJR F;  3J7A Y;  1QVU A;  1R22 A;  1Y56 A;  5DUI A;  2P4W A;  3HDD A;  4HPQ A;  1MBK A;  1AOY A;  1G8X A;  3P7N A;  2K27 A;  2M34 A;  3S17 J;  1T0F A;  3TP3 A;  4F3Q A;  3HRU A;  1BIB A;  1NG7 A;  2DT5 A;  3SJM A;  1R7J A;  2EZI A;  3QYF A;  3GCM A;  4V2G A;  3T8R A;  2GLO A;  2K3F A;  2KRH A;  4KN4 X;  2FEZ A;  4OIR F;  1BC8 C;  2STT A;  4UVC A;  3FZV A;  1ZQ3 P;  2BY1 A;  3VOE A;  3KFW X;  5L3E A;  3T8T A;  5JHU A;  3JAM K;  4B3A A;  5B5E C;  3OYM A;  1ZTR A;  3IRR A;  3K1P A;  1JE8 A;  3J81 Z;  2B63 J;  2LRD A;  3LMM A;  1Y8Q B;  2JT1 A;  4OAZ A;  4LG0 B;  1T56 A;  4BBR J;  4LLG F;  4CSW A;  3A01 B;  1BW5 A;  1KYW A;  1V4R A;  4DBQ A;  3MMY B;  4C30 A;  4F55 A;  3M1C A;  2H6B A;  1R23 A;  3OMY A;  1XMX A;  4HSR A;  3CUO A;  1MZB A;  3GO5 A;  4IRG A;  3REO A;  3JTG A;  2KZG A;  1JKQ C;  4AU7 A;  2L4M A;  2EIK H;  3Q0W A;  1FTT A;  2NAZ A;  2L2O A;  3SYT A;  5BQT A;  3ERM A;  2IJL A;  1CGP A;  1X3U A;  1R58 A;  3QOP A;  4KIB A;  2FX0 A;  4G9Y A;  1JHH A;  4KIG A;  3TW6 A;  3X2Q H;  5M5X J;  2W7N A;  3JRD A;  5DCM B;  1AKH B;  3BWG A;  2E2J J;  2KIF A;  1FZP B;  4BHC A;  1UJ8 A;  3QOE A;  1IN7 A;  2COM A;  4RB1 A;  4M72 A;  1SAX A;  3S16 J;  4X1E A;  3GXO A;  2O5R A;  2QF7 A;  1Z6T A;  4JX5 A;  5K5R A;  3RDI A;  3BG3 A;  2VJ5 A;  3F8M A;  3FXR A;  2VKV A;  3G1M A;  5FRN A;  4XOR A;  3ABM H;  2KIU A;  2XF5 A;  6PAX A;  2KDO A;  4ZTJ A;  3ISP A;  4G6Q A;  1WI3 A;  2V1U A;  1OR7 C;  3WGH A;  3I0T A;  4A3B J;  1GLN A;  1BIA A;  2P7C B;  5E20 A;  3OYL A;  3E5Q A;  1OR7 A;  1AKH A;  1UFM A;  1OCT C;  1APL C;  1MBE A;  4RB3 C;  2WY8 Q;  4XM3 A;  4HV5 A;  2OF7 A;  3OYB A;  2MBF A;  1VFC A;  2W85 A;  1ETO A;  4NDL A;  3I3L A;  2QQA A;  3QP5 A;  4KA4 A;  4MHG A;  4ABZ A;  2M8G X;  3IKV A;  5LBQ A;  1QNT A;  2LKP A;  3FXK A;  1IDY A;  2ELK A;  5F1J A;  1LPQ A;  2CU7 A;  2RKH A;  4HNU A;  4XRM A;  3FHZ A;  3JW4 A;  3VYU B;  1X4P A;  4MNU A;  4E7H A;  1BJA A;  4W1U A;  2VT3 A;  2OTL I;  5H6R A;  4IXA A;  4I7H A;  4RM2 A;  1FSH A;  4AM3 A;  3OWT A;  1X2M A;  1Y8R B;  5ILV A;  2V4J C;  3GTG J;  5C3E J;  4BUP A;  4XON A;  3IH2 A;  3CO7 C;  2X6O A;  4A2U A;  4UHT A;  3CUQ C;  3BY6 A;  3KEO A;  3RKX A;  3CC4 I;  1YS7 A;  3HBL A;  4D5C A;  2BYV E;  1ULY A;  4RGR A;  4HA8 A;  1G3T A;  1MMN A;  2LH9 A;  3ABU A;  3BC8 A;  3VWB A;  2RNJ A;  4II2 A;  3H9J A;  4CH7 A;  2LRE A;  3PQJ A;  2NVQ J;  1S29 A;  1HW2 A;  1W7P A;  1A31 A;  4KMF A;  4M3B A;  3TO9 A;  1JI8 A;  3ELK A;  3B6C A;  1ZG5 A;  2LBF B;  2ID6 A;  5HS9 A;  4L5E A;  4I6Z A;  2KRC A;  1QVT A;  2M8E A;  4ZTF A;  3HKZ A;  4CYC B;  2CWE A;  4M3D A;  2EZK A;  2E71 A;  4MQV A;  1A5J A;  3BR2 A;  2QQB A;  4XNF A;  1I5Z A;  1KYZ A;  1Z7L A;  4IF4 A;  3WHB A;  2R5Z A;  2PBI A;  1W36 D;  2X4H A;  4IJA A;  2L0K A;  1SAU A;  2EIN H;  1EH6 A;  1IXC A;  3QP6 A;  3RKW A;  1XCB A;  5GAD J;  3L7W A;  4AIK A;  3NAU A;  1MMA A;  5B66 C;  2HKX A;  2M3A A;  1L3L A;  5K7Z A;  3GVA A;  2GXA A;  2F4I A;  4LIT A;  2OU2 A;  2YX4 A;  4CCM A;  2VJ4 A;  3GTM J;  1SFE A;  1SC7 A;  3OS1 A;  2CV2 A;  2GIZ A;  1OYW A;  3HSE A;  4BAY A;  1FP1 D;  2ADU A;  2LBF A;  2FF4 A;  3Q3S A;  4H0E A;  2HQN A;  2WB1 A;  3QYE A;  1FWZ A;  5IT3 A;  2Z2S B;  4WF2 A;  3EQL F;  2PMZ A;  2HI3 A;  4OMZ A;  3GWZ A;  3AG1 H;  4IEJ A;  4AYB A;  3K9T A;  1M1E B;  2QYO A;  4ITV A;  4RLF A;  4HX7 A;  2FD5 A;  2F5E A;  5JLX A;  5IT9 K;  3RZO J;  2DTR A;  3KYC B;  5F08 A;  4RGX A;  1H89 C;  5D4S A;  1ERD A;  5JHF A;  3ROU A;  5D6F A;  3S2W A;  4CGZ A;  1WJ5 A;  1YOV B;  5LD2 C;  4L9T A;  3CP8 A;  3M1E A;  3P9K A;  5EEH A;  4A3J J;  2E36 A;  4WWC A;  3S3M A;  2XHK A;  3WOD F;  1Z7U A;  4PJJ A;  5DCF A;  3CDI A;  3Q5F A;  1Z05 A;  2KKO A;  3PO2 J;  1DU0 A;  2R7U A;  1NH3 A;  3OR1 C;  2Q2E B;  3U9G A;  1B9M A;  1TL8 A;  3DQV C;  4MTE A;  3JCU C;  3VOD A;  4Q5S F;  4OOI A;  1HC8 A;  5HOO A;  4GCV A;  2VPL A;  3L00 A;  2WAD A;  2NOJ B;  4GO1 A;  2FOK A;  3NQO A;  2VKE A;  3DBR B;  1E3P A;  3CCQ I;  1JKP C;  1YHQ I;  1K4S A;  1Y0N A;  2XGE A;  3VYR B;  4HYE A;  1T38 A;  2IBD A;  4B1R A;  3JRA A;  1Y6I A;  1IGN A;  5E1W A;  2A6E F;  3KPH A;  3IH4 A;  2L9N A;  4BS9 A;  2CQK A;  2F2E A;  1OMI A;  4RB0 A;  2HXO A;  3FIW A;  4CZC A;  3NWS A;  4CUG A;  1FPQ A;  1LDJ A;  4FCY A;  4UNO A;  3GFM A;  2Q2E A;  5ICE A;  3KZZ A;  4GRI A;  1EJ9 A;  3BPX A;  2P81 A;  3CD6 I;  4C3J J;  1TWH J;  2ID3 A;  4L9V A;  4XLN F;  1FYM A;  2TCT A;  1S9H A;  1LNW A;  2ZSI B;  2LF7 A;  2IW5 A;  5CVU A;  4O5V A;  3JRH A;  4HLX A;  2K4J A;  4Y15 A;  1UHS A;  4JBA A;  3KYD B;  4PFP A;  5JR3 A;  4HQE A;  2HFH A;  2XB5 A;  2RV8 A;  5D5V B;  4PSX A;  3JSP A;  4NC6 A;  2DTZ A;  1ETV A;  2X51 A;  5GPC A;  1SMT A;  2GXB A;  3AG4 H;  4KNY A;  3FWE A;  4WX9 A;  3H3V K;  3OYK A;  2RNG A;  4B09 A;  2PEX A;  5ERI A;  3RPQ A;  1XGM A;  1YIJ I;  4P1W A;  2ESH A;  3U1K A;  5LHI A;  2ETH A;  1VQ4 I;  4LMY A;  2E1N A;  1O3S A;  4BY1 J;  2XKO A;  2P5K A;  4A5N A;  2HEO A;  4XMY A;  4E7K A;  2AQF A;  1FLI A;  1FOK A;  4BJ5 C;  2F48 A;  3L1P A;  4DQ2 A;  2K9Q A;  3HHG A;  3G6E I;  1XMK A;  1BW6 A;  2NXN B;  2W1O A;  1AA7 A;  5BMZ A;  2WTE A;  2M45 A;  4E7I A;  1WZ2 A;  3PNY A;  3HOW J;  1WJB A;  2VIX A;  4LJZ F;  4Q48 A;  4QPQ A;  2H27 A;  3S3O A;  4DBR A;  3H9G A;  3RKQ A;  2GA1 A;  4IQJ A;  1ZLK A;  3KX2 A;  3CP2 A;  1ZH5 A;  3OYD A;  3DBH B;  2L7M P;  4Z6Y A;  1YS6 A;  4KYW A;  4F7Z A;  5IY5 H;  1UB9 A;  2M0C A;  3OIO A;  3RSN A;  1BI2 A;  5IOZ A;  1FIA A;  1YTY A;  4XQF A;  3BR3 A;  2GA2 A;  1REP C;  3PNV A;  2DOD A;  1ZGJ A;  5LEJ A;  5EZG A;  4YEJ A;  3VSK A;  4KMU X;  3TED A;  1WJA A;  4GYI A;  4BU2 A;  2E34 A;  1IDZ A;  1OYY A;  3E5U A;  5E8I A;  4OIQ F;  4EJV A;  1U0J A;  3NEU A;  4FQG A;  2GM4 A;  1QBJ A;  4XRS G;  2CMP A;  2ME0 A;  4YFN F;  2ZXI A;  3LSR A;  3KCC A;  4XKV A;  2VBZ A;  3IH3 A;  1OCR H;  2QEX I;  2FBH A;  1TP4 A;  1WJD A;  2HOT A;  4A0X A;  1X4O A;  1Z1D A;  1NHA A;  1Z6R A;  1RNL A;  2X6Y A;  2QQ8 A;  5K5O A;  3CCM I;  3S1R J;  4UV9 A;  2X85 A;  5L3G A;  2V6E A;  3DP7 A;  4A3F J;  4XKW A;  4ZYE A;  5H20 A;  2PLY A;  4CHU A;  2VXZ A;  2DA2 A;  3BZ6 A;  1R4N B;  2JSP A;  1QQI A;  3LFK A;  2R7R A;  2P6S A;  4X6A J;  2XAG A;  1LKX A;  1SVO A;  2FQ4 A;  1O4X A;  3L09 A;  1SVL A;  4ASN A;  4KDP A;  1BL0 A;  1VF9 A;  3I56 I;  1IRX A;  4U0W A;  1O3Q A;  2FNP A;  1IN8 A;  1FNN A;  1GDT A;  4A69 C;  3OIQ A;  3OV8 A;  1O7F A;  1JKR C;  5L3B A;  1HOM A;  1XD7 A;  3U1D A;  4LB6 B;  3DTK A;  3F3X A;  1F36 A;  4G6T B;  4AC0 A;  4L18 B;  2RQP A;  5CQE A;  4RLQ A;  4GDF A;  1HST A;  4WCG A;  1BR4 A;  2JZY A;  1ZEL A;  1R00 A;  1LJ9 A;  1RPW A;  2CW7 A;  4HV6 A;  2HDC A;  1XMA A;  4IRH A;  3HOY J;  3ZMT A;  2JRT A;  1VQP I;  1R5H A;  5J1U A;  3H3U A;  5K7F A;  3GX4 X;  1X1B A;  2RAE A;  2HYG D;  1JHF A;  2R7W A;  3J80 K;  4OMY A;  2EFO A;  3CJR B;  2M87 A;  2HVS A;  1QO0 D;  4RAZ A;  1YG2 A;  4A3L J;  3P9C A;  3F8B A;  1WKM A;  3NAR A;  1UG0 A;  1WSU A;  2KJB A;  5F0F A;  2BV6 A;  2CW8 A;  3BOQ A;  3PNT A;  2DA6 A;  2HPI A;  1FY7 A;  1T08 B;  4HNT A;  3SEZ A;  2XKP A;  2FU4 A;  2F4O B;  4BHB A;  2QBY B;  1MNE A;  1ODD A;  1TZL A;  2FBI A;  1P4A A;  3B6A A;  4NB5 A;  3T1B A;  2XAH A;  2WY7 Q;  1SFX A;  3H1C A;  4RS8 A;  2B0L A;  4D7M A;  1U5T C;  4DYR A;  3A2K A;  1TNS A;  1I1G A;  3S1Q J;  2ZKZ A;  5LRS A;  1FYL A;  1N78 A;  2ACJ A;  1WPK A;  5LRR A;  4X0G A;  3MKW B;  2UV1 A;  1MDM B;  2Y0S N;  3M3Y J;  2R7Q A;  3S93 A;  5GTI C;  4BDY A;  1N77 A;  2VE8 A;  4HZF A;  2QGU A;  3CCU I;  3FXJ A;  4G7O F;  5DM6 F;  4FET A;  1P6R A;  3C2H A;  2VKD A;  4Q47 A;  2E19 A;  2NOG A;  4N4N B;  5E1X A;  3K70 C;  4EM2 A;  2GAU A;  2VN2 A;  4M6X A;  1OLT A;  3I71 A;  1R36 A;  4BL0 B;  4O3M A;  2XIG A;  3Q0V A;  3K4L A;  3N4M A;  4LOC A;  2K3P A;  1XCV A;  1D3Y A;  3I9V 2;  4ZJZ A;  1O3T A;  2VOO A;  1I50 J;  3BRO A;  1T2K A;  3I4M J;  1MDM A;  5F6F A;  2JA2 A;  2X6W A;  2XVC A;  3D5R C;  5FFX A;  1ZHF A;  2STW A;  3FF5 A;  2ZJQ F;  4XN3 A;  4PJ0 C;  4ZYH A;  3TDU C;  3HUG B;  1OPC A;  2IPQ X;  4OIN F;  1K61 A;  2OQG A;  3QPL A;  1LVK A;  4NQW B;  3SXY A;  2E7W A;  4P96 A;  4QPO A;  3S3N A;  4A3D J;  2H94 A;  4CCJ A;  4Y13 A;  1FSE A;  2GXG A;  1Y1W J;  4KFC A;  2BBY A;  3DV8 A;  5GPA A;  2YUS A;  1TLH B;  2OBP A;  1BBY A;  3L2V A;  2E5Z A;  1XGS A;  2WBM A;  1I6X A;  3LSI A;  4JQF A;  3R60 A;  3RJP A;  4M73 A;  3QPS A;  5K7H A;  3PUB A;  2H8W A;  1IAW A;  2BY2 A;  3NRV A;  1B9N A;  3WE2 A;  3HUG A;  4G94 A;  2OUM A;  3OYF A;  1T33 A;  4EQQ A;  3LA7 A;  3HZJ A;  4B8X A;  5J1R A;  3BP8 A;  3RKY A;  2EBI A;  2ME6 A;  2OZU A;  4Y17 A;  2EIL H;  3ZOB A;  2FA5 A;  3AG2 H;  5EEA A;  1MH4 A;  1ENH A;  4YIR X;  5EG0 A;  3FIS A;  3K1M A;  4XL9 A;  4KN7 X;  5M3F J;  1QA6 A;  2MC4 A;  2O03 A;  5IOY A;  3BZK A;  3K6G A;  4RDU A;  1T8I A;  1ZRD A;  3VDX A;  3LSH A;  2CFX A;  2JUC A;  2M7A A;  4FTH A;  2HS5 A;  1RKW A;  3CF2 A;  2ZNY A;  1IF1 A;  2WWY A;  3RPU D;  1VQK I;  3BG7 A;  4A0Y A;  1FOY A;  4KT6 A;  1MIJ A;  2LF8 A;  3MKL A;  2Q1Z B;  1S7A A;  3OYH A;  1HKS A;  3LAJ A;  4YEL A;  4PFO A;  1P7J A;  3BG9 A;  3OSF A;  3BR0 A;  2I10 A;  1MSF C;  3LQQ A;  1HW1 A;  2V1X A;  2V9K A;  3ML6 A;  1VI0 A;  3E1S A;  3DKY A;  1PUF A;  2IVM A;  4U0V A;  4TV7 A;  2LY2 A;  3KYL A;  2JVG A;  3WU1 B;  4FX0 A;  3HXL A;  3GME A;  3IC7 A;  5TRD A;  1QGP A;  2DJN A;  4XR6 A;  1IC8 A;  5FKM A;  1FT9 A;  4V19 K;  5H6Q A;  2JVH A;  3B73 A;  5EF6 A;  2IA0 A;  4I0A A;  1MBH A;  3D1N I;  3LSJ A;  1RRJ A;  4NC8 A;  3RYP A;  3G2B A;  1Z9C A;  4UB6 C;  3CDH A;  1ACI A;  5ED4 A;  4A3E J;  3I5U A;  1PYV A;  3BG5 A;  3F22 A;  3AL0 C;  5M5Y J;  2EFQ A;  3FBI B;  2V7F A;  3E6B A;  5KVR A;  2K9N A;  4WK8 F;  4XK4 A;  3ZMD A;  1HXD A;  1HSJ A;  1UMQ A;  3G4S I;  1YW7 A;  2GBY A;  2XAU A;  3FMS A;  4HQM A;  3BJA A;  5D5X B;  3T5X A;  1UZC A;  3F6V A;  5IP7 J;  1D8K A;  1U8R A;  2CV0 A;  1HW5 A;  1PJR A;  1ON2 A;  2H1L A;  2DPU A;  1EKE A;  5EYR A;  3WU0 A;  2XF6 A;  1JGG A;  1GHC A;  3CMA I;  1BR1 A;  3I58 A;  4YRV A;  1G3W A;  3HOZ J;  3E6D A;  4CCO A;  3S15 J;  4M3F A;  2JJ7 A;  1SVM A;  3P9I A;  3CO6 C;  1WFX A;  2FQ3 A;  2JUG A;  3K69 A;  4IKF A;  2NS0 A;  3CME I;  2Y48 A;  4RAY A;  2CGP A;  1KQ0 A;  3RYR A;  1S3J A;  3LSG A;  3WTS C;  2CRG A;  5DM7 F;  3TL4 X;  3RQI A;  2Z16 A;  3G1O A;  5AIP A;  1TWC J;  1ZG1 A;  2GQQ A;  3PL8 A;  4MGR A;  2DQL A;  3DPT A;  1G3S A;  2HKO A;  2OAZ A;  4BHP A;  4RAF A;  2M2E A;  1FMV A;  4HDU A;  2YSR A;  2XSD C;  1TQP A;  3HEF A;  5DDG A;  1IUF A;  3ZGK A;  5J40 A;  5D8L B;  3AKZ A;  4HOB A;  2X1E A;  4YFX F;  1FJL A;  2IS4 A;  2KMU A;  1S8N A;  1ITY A;  3S2D J;  1SD6 A;  1T39 A;  1ZKG A;  2ISZ A;  4S05 A;  3DF8 A;  4IHY A;  1WI9 A;  3COA C;  5KAF C;  4OIO F;  4RGS A;  2VLA A;  3AG3 H;  1TNT A;  2TDX A;  2XSJ C;  2Y2Z A;  2OV7 A;  4DW6 A;  4V2F A;  3E97 A;  3UNG C;  4A3C J;  1ZR2 A;  3O3K A;  2KLO A;  3FXM A;  4BAC A;  4MEX F;  1E0E A;  4AIH A;  1YO5 C;  4PGH A;  1D5V A;  3GTJ J;  2R7S A;  1XGN A;  3H5A A;  2RN7 A;  3ZMS A;  1G59 A;  1JT6 A;  2G7H A;  5EJC A;  1ETX A;  2HYJ A;  5DTD A;  2RRE A;  1GUU A;  2ZO4 A;  1MNM C;  1F43 A;  3FK6 A;  3IWF A;  3JSO A;  1IXR C;  2KP6 A;  2Y0S A;  2CQQ A;  5FLM J;  3BTJ A;  2Z9O A;  4M3E A;  4XRS A;  1D5Y A;  2NVX J;  2KFD A;  2X9D A;  4PJL A;  2OZ6 A;  4XKB A;  1TWF J;  2VT2 A;  3N97 A;  4A6D A;  3CUQ B;  5DYM A;  3W6V A;  3HL2 A;  1W7P B;  1W4M A;  3K10 A;  5J1Y A;  3QOD A;  2EIJ H;  1I3Q J;  1OYI A;  1ZLJ A;  2M1B A;  2VL8 A;  3ZMU A;  4RMN A;  1R49 A;  2ZB9 A;  1MD0 A;  1DP7 P;  2EFW A;  4CCL A;  4AIJ A;  2Q8K A;  4EAT A;  4EGY A;  1Z91 A;  1U6G A;  4KJZ A;  3V4G A;  3E6M A;  2R5Z B;  2Z1D A;  1HF0 A;  2EJR A;  4PK4 A;  2LR8 A;  3GZ5 A;  2ZJP F;  3L2W A;  4PCQ A;  3ASO H;  2WAQ A;  4LD5 A;  3CUQ A;  4G7H F;  4N9H A;  5F27 A;  2R0Q C;  4EM0 B;  5LGU A;  2HR3 A;  4IL6 C;  4DZP A;  2R92 J;  2OCE A;  4LB5 A;  2G7U A;  4BXF A;  3GFJ A;  1JTY A;  1YX5 A;  2VC0 A;  1RR8 C;  3H0D A;  3ZPL A;  1OCZ H;  1HQC A;  2NS8 A;  3R0J A;  2HOS A;  5HS7 A;  3IV5 A;  4KIC A;  3ZRG A;  1U9O A;  3ABT A;  4L9N A;  2CW0 F;  4XBF A;  1GVD A;  3MZ8 A;  4C2T A;  3HTU A;  1QZE A;  3CF5 F;  1FBU A;  3CES A;  4YII A;  5IP6 A;  2IT0 A;  3JRE A;  2MD0 A;  3GBG A;  2JK3 A;  3GFI A;  3OL3 A;  5GAG J;  2RGV A;  5JVT A;  2QKL B;  5IP9 J;  3QPH A;  5HLH A;  1MKM A;  2W48 A;  2CH0 A;  4OAY A;  2L9R A;  4S0H B;  3V8L A;  2DJI A;  4WXC A;  4B47 A;  1AU7 A;  5CJ9 A;  2ZSH B;  2IRF G;  1MH3 A;  2DBB A;  3CCY A;  4N4O B;  1W36 C;  2R7F A;  1R9T J;  3DCF A;  3J7Z I;  3DBL B;  3Q9S A;  2L7F P;  2L7Z A;  4MFE A;  3F8C A;  2LDU A;  2UWM A;  3TMO A;  4HBL A;  1B8I B;  1J5Y A;  2Y69 H;  1ZGA A;  4G12 A;  4IVN A;  3LNQ A;  1IW7 F;  1LQ1 A;  2QSF X;  2GIV A;  2JSC A;  3PUF A;  4CIC A;  1A35 A;  3CCR I;  2OTJ I;  2CFO A;  1PUE E;  2QCO A;  5TIS C;  2HNH A;  2JTV A;  1WJF A;  2RC4 A;  2XC7 A;  4MTD A;  2UZK A;  2R7D A;  3H92 A;  3R6S A;  3ZQF A;  5E17 F;  2QQ9 A;  3TOB A;  4BJ6 C;  1DPU A;  1X19 A;  4NC7 A;  1EH8 A;  2CG4 A;  2HXI A;  3PSF A;  1FEX A;  3DXJ F;  2DT7 B;  4P55 A;  1WRJ A;  3DEU A;  2ZBK A;  3FBN B;  3E6C C;  3OYJ A;  1QU3 A;  4E4H A;  1DDN A;  4ANJ A;  4M71 A;  3ZMZ A;  5IT9 Z;  1LDK B;  2KIM A;  1Z77 A;  1IG7 A;  4EJW A;  3H36 A;  1B8I A;  4M9S A;  3W2W A;  1MBJ A;  3HSR A;  5J6X A;  1Z0X A;  1KQ9 A;  3C7J A;  4IHW A;  3IAS 2;  1MND A;  2HPM A;  4U0Y A;  1QHH D;  2FUG 2;  2HU9 A;  1G2H A;  2E1M C;  3E0J B;  3F23 A;  3SEQ A;  1J59 A;  4PUS A;  1YRN A;  4AID A;  3K4K A;  3WTT C;  1BOA A;  1BR2 A;  1SD5 A;  2CS3 A;  2XV4 S;  3CCJ I;  3OIP A;  5LGN A;  3W2A A;  1YW8 A;  2DDB A;  3MZH A;  2VXD A;  3BR5 A;  3I59 A;  3MQ0 A;  5L3C A;  2HOA A;  3DLL F;  1KGS A;  2FMY A;  1P92 A;  1YQA A;  5F04 A;  1TTY A;  3HB9 A;  5M3M J;  2XAQ A;  4L0Y B;  2CV1 A;  1VQ9 I;  2ZFU A;  3K7A J;  4HST A;  5BOX A;  4IOC F;  2OQR A;  3FKJ A;  2H6C A;  3O6B B;  3S8P A;  4XLA A;  1WJC A;  4UUT A;  2PX9 A;  2ZXW H;  3ERE D;  5HLI A;  2FOW A;  4IZZ A;  1KU9 A;  3I55 I;  5HVQ C;  1SFU A;  3K2Z A;  4UB8 C;  3LSP A;  2N8G A;  3QAH A;  2QEN A;  5EEG A;  5BNG A;  3OS2 A;  3K0L A;  1DGW Y;  4JYK A;  1X1C A;  4ENN A;  5FO5 A;  3ZCO A;  4GGG A;  2DDA A;  5DV5 A;  5J8F A;  3I64 A;  4ZZD A;  1WVR A;  4A0Z A;  1OQY A;  2XRO A;  1XSD A;  1A36 A;  3FX3 A;  1LEB A;  2FXA A;  1W1W E;  3OR2 C;  1K6O A;  4FT8 A;  1IN5 A;  1BC7 C;  3HHH A;  5BPI A;  2XAF A;  1LE8 A;  2EPF A;  2XGC A;  1J2X A;  1GT0 C;  1S6L A;  1XSV A;  2V9V A;  2CJJ A;  1LFU P;  2W84 A;  3MN2 A;  4DZJ A;  3WGG A;  2LY1 A;  3RIR A;  3VPR A;  4ESJ A;  3W3C A;  4IOA F;  3HG9 A;  2WAF A;  2XAJ A;  1P9Q C;  4Y7N J;  4KIT B;  2A61 A;  2D1H A;  5CVV A;  4G6D A;  2ZME C;  4AVZ A;  5JLW A;  2BW3 B;  2JWT A;  2R93 J;  2HDW A;  2YPR A;  4EM1 A;  2M4G A;  3TO7 A;  1K7A A;  1R5G A;  2MH2 A;  4D9J A;  2GZW A;  2K9M A;  3G71 I;  2DA7 A;  4KIS A;  1DUX C;  2XGD A;  2K02 A;  2X48 A;  4D5F A;  2G9W A;  3IP4 B;  3GUD A;  2MYS A;  1Q1H A;  1K78 A;  2LNB A;  3BT9 A;  1KZH A;  5CVJ A;  2K7L A;  5FKO A;  1YJ9 I;  2P6T A;  3RTR A;  4BQO A;  3KZI C;  4ESB A;  2F6C A;  4BQQ A;  2HVR A;  4XLC A;  2GWR A;  3JTH A;  1IXS B;  2F5D A;  3ZN1 A;  2PMU A;  5AIQ A;  5HOD A;  2BW3 A;  1D1B A;  2VB6 A;  3HTS B;  1IN4 A;  2KQR A;  5ICF A;  3VYT B;  3E7L A;  3BTC A;  1J0R A;  2WV0 A;  5F64 A;  4EMS A;  5IYB J;  1BI0 A;  3KLN A;  3VSL A;  2XAS A;  5E18 F;  3QU3 A;  2K5C A;  2VQL A;  3GTK J;  2DFE A;  2DI3 A;  5JI6 A;  1HKQ A;  4DOZ A;  4HF2 A;  3BCA A;  1MMS A;  2GOX B;  3DEW A;  4XKC A;  1FP2 A;  3ZMV A;  1VND A;  2ZFW A;  3JRI A;  2CUJ A;  4RGU A;  3MKZ A;  3FM5 A;  1BI1 A;  2E1O A;  4ON0 A;  2C6Y A;  2FSW A;  2ESN A;  4LFU A;  2XPU A;  2XRN A;  3K4B A;  1JJ6 C;  4QSH A;  3WG7 H;  4BE2 A;  4PJN A;  1VQ5 I;  3KP4 A;  4HAM A;  5TJJ A;  5FD6 A;  4NUB A;  1MJ9 A;  2XGX A;  2JA8 J;  2XPV A;  3WTU C;  1XB4 A;  2AXT C;  3LSM A;  5KK1 A;  2F5V A;  2DMU A;  2DMP A;  2NNY A;  4BYY A;  3QQA A;  1V3F A;  4RAG A;  4BBS J;  5BS6 A;  1U5T B;  5CYV A;  2UXX A;  1QZY A;  2PG4 A;  4I09 A;  3R0A A;  1J9I A;  5IYD J;  1RI7 A;  2OJE D;  2PMH A;  2LP0 A;  4XIC A;  1N25 A;  4PDK A;  2YS9 A;  3D5L A;  2X1D A;  4FE7 A;  1UST A;  3FMR A;  2QM3 A;  2NVY J;  4CDG A;  2V26 A;  2VON A;  4ZYD A;  5GP9 A;  4M6Y A;  4XSZ F;  4Y4R A;  3J80 Z;  4FIS A;  4U7B A;  3ZP5 A;  4IHS A;  4EJO A;  3F9K A;  2LOO A;  3LOC A;  4RBO A;  4HX4 A;  5IPA A;  4UUV A;  1E17 A;  1U5T A;  4I98 B;  5GAE J;  1H8A C;  1B4A A;  1X2N A;  4Y33 A;  1GV2 A;  2K9L A;  2PFB A;  4AWX B;  4C2M J;  2VOP A;  3LA3 A;  5FLX K;  1MJB A;  2IA2 A;  4Q4Z F;  1W5T A;  2W00 A;  1ORK A;  3LQR A;  4PGG A;  4BDZ A;  4M3G A;  2BY0 A;  1X1D A;  3K4N A;  3KP5 A;  2D2W A;  3CQZ J;  1G3Y A;  2JPB A;  2DYR H;  3H0G J;  1VQL I;  2IGN A;  4DNC A;  1ZAO A;  3PM1 A;  3WTX C;  4A12 A;  3D5S C;  1UHM A;  2DAO A;  2VAS A;  1YIT I;  4Y3O A;  1DU6 A;  1Y1V J;  2EB7 A;  1B1B A;  2BHY A;  3EUA A;  2COB A;  3K2A A;  3SDG A;  3JRC A;  1PP8 F;  4ZDL A;  4K2E A;  4QLC U;  2BY3 A;  2O8K A;  2Y9Y A;  5ICG A;  5C44 J;  1V5G A;  1IUY A;  1FBS A;  3M4O J;  3EUH C;  3F21 A;  2XPW A;  4UY8 I;  2D5V A;  2WAQ N;  1H9G A;  1FMW A;  3HPH A;  1VTN C;  2E1C A;  1FIP A;  1T98 A;  3PQK A;  5D6E A;  3KP3 A;  3FMQ A;  2VQC A;  4FE4 A;  5EG0 B;  3M8J A;  1EV7 A;  4H4K C;  2UUZ A;  2IXS A;  3H3Z A;  1RET A;  1I1S A;  2ZXH A;  5J4V A;  3C18 A;  3UKG A;  1QZZ A;  3K4C A;  3DKX A;  1L0O C;  4XLP F;  1BOB A;  2IS2 A;  1O57 A;  1F5T A;  5A2Q Z;  2KPM A;  3GF2 A;  1BM9 A;  4M9X A;  2EQR A;  4Y52 J;  3LSK A;  2PQ8 A;  2YU3 A;  1VQ7 I;  1MBG A;  3L9F A;  2Y31 A;  3M8F A;  4IHT A;  2ZCW A;  2EK5 A;  2O8X A;  2EA4 A;  1XS9 A;  4L0Z B;  3FXQ A;  2R7Z J;  3HSF A;  5K5Q A;  3KP7 A;  4JX6 A;  4YG2 F;  2O61 A;  1UHW A;  5ILS A;  3CC7 I;  4IHX A;  1XX5 A;  2K40 A;  2OA4 A;  3M07 A;  4XRF A;  2XDV A;  4NBQ A;  3WU2 C;  4LK1 F;  2MH9 A;  5E3O A;  2XUB A;  2NRA C;  1YW9 A;  2VQH A;  1Z3Y A;  1PUF B;  1MSE C;  2JA6 J;  3EYY A;  3TDZ C;  3ASN H;  1D1A A;  2W24 A;  1LDD A;  2DOA A;  2JPC A;  3E3V A;  2R5Y B;  1JUM A;  2KIS A;  1WHU A;  3QYB A;  4HEA 2;  1HDP A;  2I5U A;  3K4J A;  2IAI A;  2ELH A;  1HBX G;  2IGM A;  4PJM A;  4E7S A;  3LFU A;  1JT0 A;  1C0W A;  2AHQ A;  1R5I D;  1YX3 A;  2HDD A;  1D0Z A;  1Z21 A;  1A04 A;  4KUM A;  4I02 A;  3SFI A;  1HA8 A;  1HKT A;  1IV6 A;  3JRG A;  2LK2 A;  3BCB A;  3EPZ A;  2DMN A;  4EGZ A;  1GVJ A;  1LUJ B;  4BQA A;  4BJT A;  3LL7 A;  3I54 A;  4G7Z F;  2O7O A;  3H9Q A;  2QA4 I;  4ZDO A;  2D1V A;  3WTV C;  2MLK A;  2R5Y A;  4JP0 A;  5EZH A;  3AL0 B;  4CZZ A;  1XN7 A;  4HF1 A;  3VB2 A;  5HLG A;  1R1U A;  1KU7 A;  5FLV A;  4D1Q A;  2KT0 A;  1W0T A;  1SD4 A;  3GYH X;  3A03 A;  2H1K A;  3UR3 C;  3DU6 A;  4YFK F;  2DT6 A;  3BZC A;  3V7R A;  1W5S A;  3EYI A;  1E3O C;  2LFB A;  4XID A;  2E2H J;  2ZXJ A;  5HLT A;  2ISY A;  2DA3 A;  2DCE A;  1ZRC A;  3HOV J;  2DLL A;  3SFZ A;  2H09 A;  1ZK8 A;  4IRI A;  3ABL H;  3DPU A;  4M74 A;  3MEX A;  4OWR B;  3WGI A;  3TW7 A;  1JJ8 C;  3EUK L;  2IGK A;  2DA1 A;  5IYC J;  2DA4 A;  4BH9 A;  5F0H A;  1FOX A;  1U2W A;  2R7T A;  1TBX A;  5HS8 A;  5E1Z B;  2LMD A;  2K4B A;  3CLO A;  1D0Y A;  2LKX A;  1X3Z B;  3W2V A;  4DGW B;  4BGD A;  1T0F C;  1SFO J;  1VQ8 I;  5F0C A;  1R1V A;  2NVU B;  5D4R A;  3KLO A;  2W4S A;  3J81 K;  3GTQ J;  4F91 B;  3Q0U A;  4U88 A;  3ZXS A;  3A02 A;  2J5O A;  4A5M A;  4EVI A;  1HLV A;  5HDK A;  1QPI A;  2Y75 A;  2BOL A;  2VE9 A;  1R1T A;  2A05 A;  2DPD A;  2L9S A;  4MO7 A;  2YU9 J;  1UAA A;  4NNJ A;  3SZP A;  1GV5 A;  3ECO A;  2NVT J;  3OYE A;  3EDP A;  2K86 A;  1A6Q A;  2HOE A;  2WA0 A;  1TWA J;  2E7X A;  4R79 A;  3F8F A;  3Q9V A;  4BXX J;  2FNA A;  3OYC A;  3JAM Z;  1KA8 A;  4F52 A;  3GTL J;  1JTX A;  4XOT A;  2DU9 A;  1JKO C;  4UXN A;  1ZYR F;  1Y39 A;  1TT5 B;  2CSO A;  1FYK A;  1ON1 A;  1KU2 A;  3VFZ A;  5LFA A;  4QTR A;  2EZL A;  1TQM A;  2LSO A;  1G4D A;  4DJA A;  2A5W A;  1WGX A;  3ESW B;  2X6X A;  3C3W A;  1UEL B;  3GLL A;  4BY7 J;  3IAM 2;  1ZGW A;  3WTZ A;  1R71 A;  4C3I J;  2NNN A;  3BG6 A;  5FRO A;  2ZJ2 A;  3DU5 A;  1DPR A;  2EV0 A;  2DA5 A;  4P9F A;  1VQ6 I;  3JR9 A;  1BA5 A;  4F92 B;  1WWX A;  2JRM A;  1OIS A;  5J8C A;  4MEY F;  5ILU A;  3CCV I;  2V1D A;  2Z33 A;  2A5Y B;  1R4M B;  3OOU A;  3RI4 A;  4LG0 A;  2XRL A;  5J47 A;  3A01 A;  1P7I A;  1F1Z A;  2DYS H;  4HW0 A;  1V55 H;  3ZQC A;  1E3H A;  1MBF A;  1XSX A;  2F4M B;  4E7L A;  1LEA A;  3KEQ A;  1D0X A;  3S1N J;  1UCR A;  3KP2 A;  1SD7 A;  3MCZ A;  3HOU J;  2Y0M A;  4EJT A;  3A1Y A;  1SFK A;  4E70 A;  3G1L A;  4HNV A;  4GYG A;  2A68 F;  4ETS A;  2YR2 A;  1OCP A;  3ZQQ A;  3RCO A;  2RVC A;  2EFP A;  5DCM A;  1ZG3 A;  2O3F A;  4BNC A;  2LC2 A;  1YYV A;  2ELJ A;  2KIQ A;  2LVS A;  2Q0O A;  3BLY A;  2MG4 A;  4HF0 A;  5EGO B;  2L3D A;  2VPR A;  4BQN A;  3CCE I;  1YIO A;  2IS1 A;  2MC3 A;  1NTC A;  4WXH A;  3SZT A;  2LY9 A;  1WCM J;  4M6V A;  5ICC A;  1DGR M;  1USS A;  3ZQG A;  3OYI A;  1FOW A;  4LLL A;  1OKR A;  3HOT A;  3L2R A;  3GEZ A;  3OYA A;  2OCC H;  5DD4 A;  3I53 A;  1W7P D;  4MFD A;  3CC2 I;  2VJJ A;  5M5W J;  2P0W A;  3BTL A;  3HRS A;  3DEE A;  3IUO A;  4A3K J;  3A4C A;  4YIF A;  3A0B C;  5B1B H;  5E3M A;  3ZQH A;  3MD2 A;  3S1M J;  1QHG A;  3ECH A;  1XG1 A;  1HCR A;  4IX7 A;  5EGO A;  4I76 A;  3FK7 A;  4ZYA A;  2XF7 A;  4MIM A;  3DLA A;  2CQN A;  3I4P A;  1U78 A;  2VQG A;  1RC9 A;  4P5O A;  1Z3X A;  1TQI A;  2FBK A;  4IHV A;  3IHU A;  3PJR A;  2HQA A;  1POG A;  3BTI A;  3MVP A;  2O0Y A;  4R8H A;  4DYC A;  3QU6 A;  4HRI A;  4J19 A;  5K1Y A;  2EV5 A;  5FGM A;  2P5V A;  5KNL A;  3JRB A;  2A3S A;  3BJ6 A;  1OCC H;  5EDN A;  5J3L A;  5KCM A;  2W82 A;  2M5W A;  2WV1 A;  2CUE A;  3DFG A;  2HTS A;  4JOM A;  1RR7 A;  1XGO A;  3CZ6 A;  2QKM B;  2IS6 A;  1LB2 A;  3CCL I;  3S14 J;  5D8K B;  2LG4 A;  1G6N A;  3LST A;  5H2F C;  2VUM J;  1CF7 B;  5LEK A;  4RB2 C;  4EV0 A;  5LGT A;  2M4K A;  1STZ A;  2WC2 A;  2EWN A;  3GZ6 A;  5BPD A;  2GOM A;  2HGC A;  3PIO F;  4A93 J;  2HQR A;  2DMT A;  3DWL E;  3N05 A;  3GTO J;  5F1R A;  2MLG A;  5CQG A;  1NK3 P;  1IO2 A;  5HDG A;  4MQ9 F;  4E6K G;  1FX7 A;  5GAH J;  2QSH X;  3KE2 A;  5B3S H;  2L4A A;  3CCS I;  3HGG A;  4J01 A;  3WHC A;  4A3I J;  1NK2 P;  4LG3 A;  4CYC A;  4LIU A;  2Y30 A;  5D5U B;  1U8B A;  1CF7 A;  4UVB A;  4M9Z A;  1I27 A;  3M9A A;  3PIP F;  2VBW A;  2DMQ A;  4AD9 A;  2CQ7 A;  4UUS B;  4HDV A;  4PSW A;  2EA2 A;  2O9L A;  1YLF A;  1YRN B;  3PFI A;  5JVG F;  1F4K A;  2MAB A;  1VQO I;  2V1N A;  1TT0 A;  3FDY A;  2X0L A;  3F8N A;  4ZZL A;  2E1M B;  2L5Q A;  5DEQ A;  1RUO A;  3F0C A;  1O7L A;  2PJR B;  3SHF A;  3I59 B;  1W0U A;  2DXI A;  4L5I A;  1X1A A;  4A3G J;  3BDD A;  1O3R A;  1B6A A;  2JQ7 A;  3G73 A;  2JA7 J;  1BN5 A;  3BQY A;  2BGC A;  4B48 A;  2HZT A;  3D0S A;  5FKN A;  2IP2 A;  4UV8 A;  3ZN0 A;  4B4C A;  4ESF A;  1U3E M;  4OIP F;  4UUS A;  1IV8 A;  3L2U A;  2DOE A;  4AVP A;  1I6H J;  1WH5 A;  4ENM A;  3TBI A;  3V7S A;  4S04 A;  5FB2 A;  2MSY A;  1J75 A;  5D5W B;  2CYY A;  3HRM A;  4LLN A;  2FRH A;  1SEU A;  1YE9 A;  2V79 A;  3AFH A;  2A69 F;  3OY9 A;  4JX4 A;  2PJR A;  2R7O A;  9ANT A;  1MGT A;  1WQ2 A;  4MLO A;  3TKY A;  1Z67 A;  4I99 C;  4IPA A;  2FJ1 A;  4KIF A;  3F6O A;  3ZQ7 A;  3FKI J;  3ZQI A;  2R3S A;  3ONQ A;  1OFC X;  2QWW A;  4CXF A;  2LTP A;  4L9J A;  1RES A;  5LHG A;  5GTH C;  3IL2 A;  3ABK H;  3WTW C;  1LE8 B;  4E7J A;  1I39 A;  2Y9Z A;  4FX4 A;  1TW3 A;  1P4W A;  1DQU A;  2FE3 A;  4AUX A;  1ZR4 A;  3CMY A;  1N75 A;  3NWT A;  3C2B A;  4BEH B;  1Y0U A;  2EIM H;  2IEK A;  2L02 A;  3CMM A;  4DYQ A;  3CJQ B;  3TO6 A;  2UXN A;  3WE3 A;  3MKY B;  3AAF A;  4FAS D;  2Z5U A;  4L5J A;  2DK5 A;  3M8E A;  3BR1 A;  5DUK A;  3CLQ A;  1S72 I;  3V42 A;  2DW4 A;  2KHM A;  3OYG A;  2B7E A;  2ZME B;  1VQM I;  3IKT A;  3CJN A;  2AXL A;  4B43 A;  2HQ5 A;  1PVE A;  3SDB A;  3SQN A;  1K78 B;  2DFI A;  5CVI A;  1ZAR A;  4ZDP A;  4R1H A;  4OU0 A;  4BEH A;  3O8G A;  4HLY A;  2NYX A;  3U21 A;  1Q1V A;  4U87 A;  4C3H J;  3PO3 J;  2M9H A;  3EET A;  1RUN A;  1JXS A;  4JK1 X;  3K1N A;  1MJA A;  4LIV A;  5KHD A;  2ECC A;  1BJZ A;  3QRF F;  2L9V A;  5KAI C;  3OOP A;  3HJE A;  1P4X A;  4XN0 A;  4BKX A;  2RDP A;  3HGY A;  4E7Z A;  2ZME A;  3ULQ B;  2BXZ A;  2ECB A;  1I3A A;  1DP3 A;  2KL4 A;  1V5F A;  2Z99 A;  2KJC A;  4DIQ A;  1QRY A;  2L01 A;  3IRQ A;  3HIF A;  2M7B A;  2EZH A;  2EH3 A;  3GZN B;  1AWC A;  1T6S A;  4ZC3 A;  2BZT A;  4BE1 A;  3HYI A;  4P9U A;  3OL4 A;  2P8T A;  1XDU A;  2HZD A;  3DKW A;  3RZD J;  5CLS A;  2A07 F;  3H5R A;  2Z3Y A;  3GW2 A;  3GFL A;  5DD8 A;  2DO7 A;  1SMY F;  3HPG A;  5AON A;  3PFY A;  3FXL A;  3TGN A;  3TQN A;  3QWL A;  4Z2Y A;  2MFZ A;  1JUP A;  2F5C A;  3J7Y J;  4A3M J;  2BXY A;  4I2O A;  1W5C C;  4EEF G;  5C4J J;  1ETQ A;  1RZ4 A;  3BR6 A;  4HX8 A;  4II3 A;  1YJN I;  1IZ1 A;  3B02 A;  1XC5 A;  3BQZ A;  1PP7 U;  3MWM A;  2P7V B;  3LAP A;  3PSI A;  2FML A;  1V54 H;  3L2Q A;  2E60 A;  1AHD P;  2AO9 A;  2KRF A;  4BE0 A;  1QPM A;  3BPV A;  4CCN A;  2JMW A;  3MFK A;  4XLF A;  1LFB A;  1A6I A;  5E8G A;  4O6J A;  4XOP A;  1MMD A;  1ZN2 A;  4UVA A;  5FKK A;  1K4T A;  3J7A O;  2VOD A;  2A6H F;  2EV6 A;  2O6G E;  4RM3 A;  3I4N J;  4IQ4 A;  5HNF A;  1OJL A; 
#chains in the Genus database with same CATH homology
 1IRG A;  3T0Y A;  4ENJ A;  3L2C A;  2QUF A;  2CO5 A;  2HTJ A;  2VBY A;  1JGS A;  3FXU A;  4KT5 C;  2VBX A;  4I01 A;  4N9I A;  4XSX F;  4PZJ A;  4QWQ A;  3BJO A;  3LA2 A;  5HDN A;  2BEO A;  1GXQ A;  1PDN C;  3V8K A;  3MAJ A;  2MD5 A;  4NHJ A;  3KET A;  5L3D A;  2QLZ A;  2BE5 F;  1YFH A;  2DQR A;  3QPT A;  2HWV A;  1ZRF A;  4G8X A;  4BXU A;  3W6J B;  4LGW A;  2ZNZ A;  5CVR A;  1H0M A;  1GXP A;  4A6E A;  1IN6 A;  3O2P E;  1J7K A;  3FM3 A;  1KQ8 A;  2W57 A;  4N0B A;  5FLX Z;  1RIO H;  3KZY A;  3WTY C;  1FBQ A;  3V8J A;  2OD5 A;  4EJU A;  1BI3 A;  4WXD A;  2QBY A;  1ZRE A;  3W6K B;  3IWZ A;  3M7G A;  1S7O A;  1XDS A;  1F9N A;  5LHH A;  4D0P A;  2IA1 A;  3EUH A;  2AS5 F;  1ONV A;  2MA3 A;  4CO8 A;  2PJP A;  2M30 A;  2QVO A;  5A2Q K;  2QZ8 A;  1B59 A;  1P2F A;  2P5L C;  3V7C A;  5LLQ A;  4I0B A;  3GLX A;  3DPL C;  2L54 A;  2D45 A;  1D8J A;  2J5P A;  4FHT A;  2PI0 A;  3U2R A;  4NQW A;  4ZH4 F;  3WG9 A;  2EFN A;  3R4K A;  3F72 A;  3VEP A;  3R61 A;  1E2X A;  2DK8 A;  3MZY A;  2VC1 A;  3TOA A;  2F5F A;  2HYF A;  2V6C A;  4GXO A;  5L3F A;  2YX7 A;  1IRF A;  3LWF A;  4ZYG A;  3HRT A;  2PN6 A;  4U7D A;  3RPU A;  1KU3 A;  3E5X A;  1EH7 A;  3G3Z A;  3C1D A;  1TW2 A;  1FC3 A;  1LVA A;  5FFZ A;  5FD5 A;  1H9T A;  3HOS A;  4LK0 F;  5JFR A;  3CTA A;  2W25 A;  4ENK A;  4CYD A;  3KP6 A;  1R22 A;  5DUI A;  2P4W A;  1AOY A;  3P7N A;  2K27 A;  1T0F A;  3HRU A;  1BIB A;  2DT5 A;  1R7J A;  3T8R A;  4KN4 X;  2FEZ A;  4OIR F;  1BC8 C;  2STT A;  4UVC A;  3FZV A;  3VOE A;  3KFW X;  5L3E A;  3T8T A;  5JHU A;  3JAM K;  3IRR A;  3K1P A;  1JE8 A;  3J81 Z;  2JT1 A;  4LG0 B;  4LLG F;  1KYW A;  1V4R A;  2H6B A;  1R23 A;  3CUO A;  1MZB A;  3GO5 A;  4IRG A;  3REO A;  3JTG A;  2L4M A;  2NAZ A;  5BQT A;  2IJL A;  1CGP A;  1X3U A;  1R58 A;  3QOP A;  4KIB A;  4G9Y A;  4KIG A;  1JHH A;  5DCM B;  3BWG A;  2KIF A;  1FZP B;  4BHC A;  1IN7 A;  2COM A;  4RB1 A;  4M72 A;  1SAX A;  3GXO A;  1Z6T A;  5K5R A;  3RDI A;  3F8M A;  3FXR A;  2KIU A;  6PAX A;  3ISP A;  4G6Q A;  2V1U A;  3WGH A;  3I0T A;  1BIA A;  2P7C B;  5E20 A;  3E5Q A;  1OR7 A;  1UFM A;  4RB3 C;  4HV5 A;  2MBF A;  2W85 A;  2QQA A;  3QP5 A;  4KA4 A;  4MHG A;  3IKV A;  5LBQ A;  1QNT A;  2LKP A;  2RKH A;  3FHZ A;  3JW4 A;  4MNU A;  1BJA A;  2VT3 A;  5H6R A;  4IXA A;  4I7H A;  1FSH A;  5ILV A;  3CO7 C;  4A2U A;  4UHT A;  3CUQ C;  3BY6 A;  3KEO A;  3RKX A;  1YS7 A;  2BYV E;  1ULY A;  4RGR A;  4HA8 A;  1G3T A;  3ABU A;  2RNJ A;  3PQJ A;  1S29 A;  1HW2 A;  1W7P A;  4KMF A;  3TO9 A;  3ELK A;  1ZG5 A;  5HS9 A;  2M8E A;  2CWE A;  4MQV A;  2QQB A;  1I5Z A;  1KYZ A;  4IF4 A;  2PBI A;  2X4H A;  4IJA A;  3RKW A;  1EH6 A;  1IXC A;  3QP6 A;  1XCB A;  3L7W A;  4AIK A;  2HKX A;  1L3L A;  3GVA A;  2OU2 A;  2YX4 A;  1SFE A;  1OYW A;  3HSE A;  4BAY A;  1FP1 D;  2ADU A;  2FF4 A;  4H0E A;  2HQN A;  1FWZ A;  5IT3 A;  4WF2 A;  3EQL F;  4OMZ A;  3GWZ A;  3K9T A;  2QYO A;  4HX7 A;  2F5E A;  5IT9 K;  2DTR A;  4RGX A;  5D4S A;  3ROU A;  5D6F A;  3S2W A;  4CGZ A;  4L9T A;  3M1E A;  3P9K A;  5EEH A;  4WWC A;  2XHK A;  3WOD F;  1Z7U A;  5DCF A;  3Q5F A;  1Z05 A;  2KKO A;  3U9G A;  1B9M A;  3DQV C;  4MTE A;  3VOD A;  4Q5S F;  4OOI A;  5HOO A;  4GCV A;  3L00 A;  4GO1 A;  2FOK A;  3NQO A;  1T38 A;  4HYE A;  5E1W A;  2A6E F;  2CQK A;  2F2E A;  1OMI A;  4RB0 A;  1FPQ A;  1LDJ A;  4UNO A;  3GFM A;  2Q2E A;  5ICE A;  3KZZ A;  3BPX A;  4L9V A;  4XLN F;  1FYM A;  1LNW A;  2LF7 A;  2IW5 A;  5CVU A;  4O5V A;  4HLX A;  2K4J A;  4Y15 A;  4JBA A;  5JR3 A;  4HQE A;  2HFH A;  2RV8 A;  5D5V B;  3JSP A;  1SMT A;  2GXB A;  4KNY A;  3FWE A;  4WX9 A;  4B09 A;  2PEX A;  5ERI A;  3RPQ A;  1XGM A;  2ESH A;  5LHI A;  2ETH A;  4LMY A;  2E1N A;  1O3S A;  2XKO A;  2P5K A;  4A5N A;  2HEO A;  1FLI A;  1FOK A;  4DQ2 A;  3HHG A;  1XMK A;  5BMZ A;  2WTE A;  2M45 A;  4Q48 A;  4LJZ F;  2H27 A;  2GA1 A;  1ZLK A;  1ZH5 A;  1YS6 A;  4KYW A;  4F7Z A;  1UB9 A;  1BI2 A;  1YTY A;  2GA2 A;  1REP C;  1ZGJ A;  5LEJ A;  4KMU X;  4GYI A;  1OYY A;  3E5U A;  5E8I A;  4OIQ F;  4EJV A;  3NEU A;  1QBJ A;  4YFN F;  3KCC A;  2VBZ A;  2FBH A;  4A0X A;  1Z1D A;  1NHA A;  1Z6R A;  1RNL A;  5K5O A;  4UV9 A;  5L3G A;  3DP7 A;  4ZYE A;  5H20 A;  2PLY A;  4CHU A;  2VXZ A;  3BZ6 A;  1QQI A;  3LFK A;  2P6S A;  2XAG A;  3L09 A;  4ASN A;  4KDP A;  4U0W A;  1O3Q A;  2FNP A;  1IN8 A;  1FNN A;  3OV8 A;  1O7F A;  5L3B A;  1XD7 A;  3U1D A;  4LB6 B;  3F3X A;  4L18 B;  2RQP A;  1HST A;  4WCG A;  2JZY A;  1R00 A;  1LJ9 A;  4HV6 A;  2HDC A;  1XMA A;  4IRH A;  3ZMT A;  2JRT A;  1R5H A;  3H3U A;  3GX4 X;  2HYG D;  1JHF A;  3J80 K;  4OMY A;  2EFO A;  2M87 A;  1QO0 D;  4RAZ A;  1YG2 A;  3P9C A;  3F8B A;  1WKM A;  1WSU A;  2KJB A;  2BV6 A;  3BOQ A;  1FY7 A;  2XKP A;  2FU4 A;  4BHB A;  2QBY B;  1ODD A;  2FBI A;  1P4A A;  4NB5 A;  3T1B A;  2XAH A;  1SFX A;  4RS8 A;  2B0L A;  1U5T C;  1TNS A;  1I1G A;  2ZKZ A;  5LRS A;  1FYL A;  2ACJ A;  5LRR A;  1MDM B;  2VE8 A;  4HZF A;  4G7O F;  1P6R A;  4Q47 A;  5E1X A;  4EM2 A;  2GAU A;  2VN2 A;  4M6X A;  3I71 A;  1R36 A;  4O3M A;  2XIG A;  3N4M A;  1XCV A;  1D3Y A;  1O3T A;  2VOO A;  3BRO A;  1T2K A;  1MDM A;  5F6F A;  2XVC A;  5FFX A;  1ZHF A;  2STW A;  3FF5 A;  4ZYH A;  3TDU C;  1OPC A;  2IPQ X;  4OIN F;  2OQG A;  3SXY A;  2E7W A;  4P96 A;  2H94 A;  4Y13 A;  1FSE A;  2GXG A;  4KFC A;  2BBY A;  3DV8 A;  1TLH B;  2OBP A;  1BBY A;  1XGS A;  1I6X A;  4JQF A;  3R60 A;  3RJP A;  4M73 A;  1IAW A;  3NRV A;  1B9N A;  3WE2 A;  3HUG A;  4G94 A;  4EQQ A;  3LA7 A;  4B8X A;  3BP8 A;  3RKY A;  2OZU A;  4Y17 A;  2FA5 A;  3K1M A;  4KN7 X;  2O03 A;  1ZRD A;  2CFX A;  2HS5 A;  2ZNY A;  1IF1 A;  2WWY A;  4A0Y A;  2LF8 A;  1S7A A;  1HKS A;  3LAJ A;  3LQQ A;  1HW1 A;  2V1X A;  3ML6 A;  2IVM A;  4U0V A;  4TV7 A;  3WU1 B;  4FX0 A;  3IC7 A;  5TRD A;  1QGP A;  1FT9 A;  5H6Q A;  3B73 A;  2IA0 A;  4I0A A;  3RYP A;  1Z9C A;  3CDH A;  5ED4 A;  3I5U A;  3F22 A;  2EFQ A;  3E6B A;  5KVR A;  4WK8 F;  3ZMD A;  1HXD A;  1HSJ A;  1K79 A;  1YW7 A;  4HQM A;  3FMS A;  3BJA A;  5D5X B;  3T5X A;  3F6V A;  1D8K A;  1U8R A;  1HW5 A;  1ON2 A;  2DPU A;  3WU0 A;  1GHC A;  3I58 A;  1G3W A;  3E6D A;  3P9I A;  3CO6 C;  2FQ3 A;  3K69 A;  2NS0 A;  2Y48 A;  4RAY A;  2CGP A;  1KQ0 A;  3RYR A;  1S3J A;  3WTS C;  5AIP A;  1ZG1 A;  2GQQ A;  4MGR A;  2DQL A;  3DPT A;  1G3S A;  2HKO A;  2OAZ A;  4BHP A;  4HDU A;  2YSR A;  1TQP A;  5DDG A;  5D8L B;  4HOB A;  4YFX F;  1S8N A;  1SD6 A;  1T39 A;  2ISZ A;  4S05 A;  3DF8 A;  1WI9 A;  3COA C;  4OIO F;  4RGS A;  1TNT A;  2TDX A;  3E97 A;  3O3K A;  4MEX F;  4AIH A;  1YO5 C;  4PGH A;  1D5V A;  1XGN A;  2RN7 A;  3ZMS A;  2G7H A;  2ZO4 A;  3IWF A;  3JSO A;  1IXR C;  2Z9O A;  2OZ6 A;  2VT2 A;  3N97 A;  4A6D A;  3CUQ B;  5DYM A;  1W7P B;  1W4M A;  1OYI A;  1ZLJ A;  2M1B A;  3ZMU A;  1DP7 P;  1MD0 A;  2EFW A;  4AIJ A;  2Q8K A;  4EGY A;  1Z91 A;  1U6G A;  3V4G A;  3E6M A;  2EJR A;  3GZ5 A;  4PCQ A;  4LD5 A;  3CUQ A;  4G7H F;  4N9H A;  4EM0 B;  5LGU A;  2HR3 A;  4LB5 A;  2G7U A;  3GFJ A;  2VC0 A;  3ZPL A;  1HQC A;  3R0J A;  5HS7 A;  4KIC A;  3ABT A;  4L9N A;  2CW0 F;  4XBF A;  3HTU A;  1FBU A;  4YII A;  2IT0 A;  3GFI A;  2RGV A;  5JVT A;  3QPH A;  5HLH A;  1MKM A;  3V8L A;  4WXC A;  5CJ9 A;  2IRF G;  2DBB A;  2R7F A;  3Q9S A;  3F8C A;  2LDU A;  2UWM A;  4HBL A;  1J5Y A;  1ZGA A;  4IVN A;  1IW7 F;  1LQ1 A;  2GIV A;  2JSC A;  4CIC A;  1PUE E;  2JTV A;  2RC4 A;  4MTD A;  2UZK A;  2R7D A;  3H92 A;  3R6S A;  5E17 F;  2QQ9 A;  3TOB A;  1DPU A;  1EH8 A;  2CG4 A;  3DXJ F;  4P55 A;  1WRJ A;  3DEU A;  2ZBK A;  3E6C C;  1DDN A;  4M71 A;  3ZMZ A;  5IT9 Z;  1LDK B;  2KIM A;  4EJW A;  4M9S A;  3HSR A;  5J6X A;  1KQ9 A;  3C7J A;  4U0Y A;  3F23 A;  1J59 A;  3WTT C;  1BOA A;  1SD5 A;  2XV4 S;  5LGN A;  1YW8 A;  3MZH A;  3I59 A;  3MQ0 A;  5L3C A;  1KGS A;  2FMY A;  1P92 A;  1YQA A;  1TTY A;  2XAQ A;  4L0Y B;  5BOX A;  2OQR A;  2H6C A;  3O6B B;  3ERE D;  5HLI A;  1KU9 A;  5HVQ C;  1SFU A;  3K2Z A;  3QAH A;  2QEN A;  5EEG A;  3K0L A;  4ENN A;  5FO5 A;  4GGG A;  5DV5 A;  5J8F A;  3I64 A;  4ZZD A;  4A0Z A;  2XRO A;  1XSD A;  3FX3 A;  1LEB A;  2FXA A;  1K6O A;  4FT8 A;  1IN5 A;  1BC7 C;  3HHH A;  5BPI A;  2XAF A;  1J2X A;  1S6L A;  1XSV A;  2V9V A;  2W84 A;  3WGG A;  3RIR A;  4ESJ A;  2XAJ A;  2A61 A;  2D1H A;  5CVV A;  4G6D A;  2YPR A;  4EM1 A;  3TO7 A;  1K7A A;  1R5G A;  2MH2 A;  2GZW A;  1DUX C;  2K02 A;  2G9W A;  3GUD A;  1K78 A;  1Q1H A;  2LNB A;  5CVJ A;  2K7L A;  2P6T A;  3RTR A;  4ESB A;  2GWR A;  3JTH A;  1IXS B;  2F5D A;  3ZN1 A;  2PMU A;  5AIQ A;  3HTS B;  1IN4 A;  5ICF A;  5F64 A;  1J0R A;  2WV0 A;  4EMS A;  1BI0 A;  3KLN A;  2XAS A;  5E18 F;  3QU3 A;  2DI3 A;  5JI6 A;  1HKQ A;  4HF2 A;  1FP2 A;  3ZMV A;  2ZFW A;  4RGU A;  3FM5 A;  1BI1 A;  4ON0 A;  2C6Y A;  2FSW A;  2ESN A;  4LFU A;  2XRN A;  3KP4 A;  4HAM A;  5TJJ A;  5FD6 A;  1MJ9 A;  2XGX A;  3WTU C;  1XB4 A;  5KK1 A;  2NNY A;  4BYY A;  1V3F A;  5BS6 A;  1U5T B;  5CYV A;  2UXX A;  1QZY A;  2PG4 A;  4I09 A;  3R0A A;  1J9I A;  1RI7 A;  2PMH A;  4PDK A;  3D5L A;  1UST A;  3FMR A;  2QM3 A;  4CDG A;  2VON A;  4ZYD A;  4M6Y A;  4XSZ F;  3J80 Z;  4U7B A;  3ZP5 A;  4IHS A;  4EJO A;  4HX4 A;  4UUV A;  1E17 A;  1U5T A;  4I98 B;  1B4A A;  2PFB A;  2VOP A;  4AWX B;  3LA3 A;  5FLX K;  1MJB A;  2IA2 A;  4Q4Z F;  1W5T A;  4PGG A;  3LQR A;  3KP5 A;  2D2W A;  1G3Y A;  2JPB A;  4DNC A;  1ZAO A;  3WTX C;  4A12 A;  1UHM A;  2DAO A;  2EB7 A;  1B1B A;  1PP8 F;  4K2E A;  4QLC U;  5ICG A;  1IUY A;  1FBS A;  3F21 A;  1H9G A;  1VTN C;  2E1C A;  1T98 A;  3PQK A;  5D6E A;  3KP3 A;  3FMQ A;  1EV7 A;  3H3Z A;  1I1S A;  3C18 A;  1QZZ A;  1L0O C;  4XLP F;  1O57 A;  1F5T A;  5A2Q Z;  3GF2 A;  1BM9 A;  4M9X A;  2PQ8 A;  2YU3 A;  3L9F A;  3M8F A;  4IHT A;  2ZCW A;  2EK5 A;  2O8X A;  2EA4 A;  4L0Z B;  3FXQ A;  3HSF A;  5K5Q A;  3KP7 A;  4YG2 F;  2O61 A;  1UHW A;  5ILS A;  2OA4 A;  4XRF A;  4LK1 F;  2MH9 A;  2XUB A;  2NRA C;  1YW9 A;  3EYY A;  3TDZ C;  2W24 A;  1LDD A;  2JPC A;  3E3V A;  2ELH A;  1HBX G;  1C0W A;  4KUM A;  1A04 A;  4I02 A;  1HKT A;  4EGZ A;  1GVJ A;  4BQA A;  4G7Z F;  3I54 A;  2D1V A;  3WTV C;  2MLK A;  4CZZ A;  1XN7 A;  4HF1 A;  3VB2 A;  5HLG A;  1R1U A;  1KU7 A;  1SD4 A;  3GYH X;  4YFK F;  3V7R A;  1W5S A;  3EYI A;  2ZXJ A;  2ISY A;  1ZRC A;  2DLL A;  3SFZ A;  2H09 A;  4IRI A;  4M74 A;  3MEX A;  3WGI A;  4BH9 A;  1U2W A;  1TBX A;  5HS8 A;  5E1Z B;  2K4B A;  3CLO A;  1R1V A;  5D4R A;  3KLO A;  3J81 K;  4U88 A;  4A5M A;  2J5O A;  4EVI A;  5HDK A;  2Y75 A;  2VE9 A;  1R1T A;  2DPD A;  3SZP A;  3ECO A;  3EDP A;  2K86 A;  2HOE A;  4R79 A;  2E7X A;  3F8F A;  3Q9V A;  2FNA A;  3JAM Z;  1KA8 A;  2DU9 A;  4UXN A;  1ZYR F;  2CSO A;  1FYK A;  1ON1 A;  1KU2 A;  3VFZ A;  1TQM A;  2LSO A;  1G4D A;  3C3W A;  3WTZ A;  2NNN A;  2ZJ2 A;  1DPR A;  2EV0 A;  4P9F A;  1WWX A;  5J8C A;  4MEY F;  5ILU A;  2V1D A;  2Z33 A;  2A5Y B;  3RI4 A;  4LG0 A;  4HW0 A;  1F1Z A;  1XSX A;  1LEA A;  3KEQ A;  1UCR A;  3KP2 A;  1SD7 A;  3MCZ A;  2Y0M A;  4EJT A;  4E70 A;  4GYG A;  2A68 F;  4ETS A;  2YR2 A;  2RVC A;  2EFP A;  5DCM A;  1ZG3 A;  2O3F A;  4BNC A;  1YYV A;  2Q0O A;  4HF0 A;  2L3D A;  1YIO A;  2MC3 A;  3SZT A;  4WXH A;  5ICC A;  1USS A;  4LLL A;  1OKR A;  3HOT A;  3GEZ A;  5DD4 A;  3I53 A;  1W7P D;  3HRS A;  4YIF A;  3ECH A;  3I4P A;  1U78 A;  4P5O A;  1TQI A;  2FBK A;  3IHU A;  2O0Y A;  4R8H A;  3QU6 A;  5K1Y A;  2EV5 A;  5FGM A;  2P5V A;  2A3S A;  3BJ6 A;  2M5W A;  3DFG A;  2HTS A;  1XGO A;  1LB2 A;  5D8K B;  1G6N A;  3LST A;  1CF7 B;  5LEK A;  4RB2 C;  4EV0 A;  5LGT A;  1STZ A;  2WC2 A;  2EWN A;  3GZ6 A;  5BPD A;  2HGC A;  2HQR A;  5F1R A;  2MLG A;  5HDG A;  4MQ9 F;  1FX7 A;  3KE2 A;  2L4A A;  5D5U B;  1CF7 A;  4UVB A;  4M9Z A;  1I27 A;  3M9A A;  2VBW A;  4AD9 A;  4HDV A;  2EA2 A;  1YLF A;  3PFI A;  1F4K A;  2X0L A;  3F8N A;  4ZZL A;  5DEQ A;  1RUO A;  1O7L A;  3SHF A;  3I59 B;  4L5I A;  3BDD A;  1O3R A;  1B6A A;  3G73 A;  1BN5 A;  2BGC A;  2HZT A;  3D0S A;  2IP2 A;  4UV8 A;  3ZN0 A;  4ESF A;  1U3E M;  4OIP F;  4AVP A;  4ENM A;  3V7S A;  4S04 A;  5FB2 A;  1J75 A;  5D5W B;  2CYY A;  3HRM A;  4LLN A;  2FRH A;  2V79 A;  2A69 F;  1MGT A;  1WQ2 A;  3TKY A;  4IPA A;  4KIF A;  3F6O A;  3ZQ7 A;  2R3S A;  2QWW A;  4CXF A;  4L9J A;  5LHG A;  3IL2 A;  3WTW C;  4FX4 A;  1TW3 A;  1P4W A;  2FE3 A;  1Y0U A;  2L02 A;  3TO6 A;  2UXN A;  3WE3 A;  3AAF A;  2Z5U A;  4L5J A;  2DK5 A;  3M8E A;  5DUK A;  2DW4 A;  2ZME B;  3IKT A;  3CJN A;  2AXL A;  3SQN A;  1K78 B;  2DFI A;  5CVI A;  1ZAR A;  4R1H A;  4OU0 A;  4HLY A;  2NYX A;  3EET A;  1RUN A;  1JXS A;  4JK1 X;  3K1N A;  1MJA A;  3QRF F;  3OOP A;  1P4X A;  2RDP A;  2ZME A;  3ULQ B;  2Z99 A;  2KJC A;  3IRQ A;  2L01 A;  3HIF A;  1AWC A;  1T6S A;  3HYI A;  4P9U A;  2P8T A;  1XDU A;  3DKW A;  5CLS A;  2A07 F;  2Z3Y A;  3GW2 A;  3GFL A;  5DD8 A;  2DO7 A;  1SMY F;  5AON A;  3TGN A;  3TQN A;  4Z2Y A;  2F5C A;  4I2O A;  1RZ4 A;  4HX8 A;  1PP7 U;  1IZ1 A;  3B02 A;  3MWM A;  2P7V B;  3LAP A;  2FML A;  2KRF A;  1QPM A;  3BPV A;  3MFK A;  5E8G A;  4O6J A;  1ZN2 A;  4UVA A;  3J7A O;  2VOD A;  2A6H F;  2EV6 A;  2O6G E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...