2HGCA

Solution nmr structure of the yjcq protein from bacillus subtilis. northeast structural genomics target sr346.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
KLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YjcQ protein
publication title Solution NMR structure of the YjcQ protein from Bacillus subtilis. Northeast Structural Genomics target SR346. (CASP Target)
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09639 YjcQ YjcQ protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hgcA00
5K5QA 2OZUA 4A5NA 1QO0D 2QLZA 2VC0A 3GO5A 1UCRA 2PI0A 3VFZA 4BQAA 1ZN2A 3CDHA 1TTYA 2EFNA 3M9AA 1O7FA 5LLQA 5LEJA 2H6CA 4HZFA 1K78A 2EFOA 4A0ZA 3SFZA 3J80K 1DP7P 4KMUX 2BEOA 1PP7U 3HOSA 4CDGA 3W6JB 1IXCA 1F1ZA 1QPMA 2CGPA 1BIBA 2VBYA 5FD6A 4ZH4F 4WXHA 3BWGA 2CSOA 3BPXA 4I09A 4KNYA 2PFBA 3QPHA 2F5CA 2HEOA 1FY7A 3IWZA 4I7HA 4BAYA 1Z9CA 5H6QA 5CVJA 4O3MA 3OV8A 4LGWA 1SFXA 5D6EA 1FP1D 1SD5A 2CO5A 3FXUA 4ON0A 1BC8C 3SQNA 4P9UA 2OA4A 3CUQA 3ZN1A 3BY6A 5J6XA 1FC3A 2XKPA 4BHCA 5DDGA 3D5LA 3RKXA 1YYVA 5CLSA 4NQWA 1R5GA 2CW0F 3GFIA 1H9TA 4GO1A 3SXYA 2JSCA 1MGTA 1HKQA 1XD7A 3K2ZA 1SD7A 3RKYA 2HR3A 1A04A 3CLOA 5FFXA 2MH9A 4YFNF 3KEQA 1B9MA 3M8FA 1DUXC 4AVPA 3BJ6A 3ZMUA 4F7ZA 3TO6A 4HQEA 3HRTA 2V1XA 1P92A 1ZAOA 2QBYA 1IN5A 1OR7A 2ADUA 4EJOA 5TJJA 2RQPA 2GZWA 3LQQA 2ZO4A 1K79A 3WTZA 3V7CA 5ERIA 5HS8A 5JVTA 4TV7A 3DKWA 5FGMA 1FSEA 5L3BA 3BZ6A 1ON2A 3GFJA 4LG0B 2IJLA 3HUGA 4EM1A 3VB2A 1KQ0A 4CXFA 4DQ2A 2IA0A 4CO8A 2DK5A 2XHKA 2DPUA 3L9FA 1G6NA 1ZRDA 3LAPA 3E6BA 5BOXA 1RIOH 2LDUA 3K69A 2Y0MA 2Z99A 1NHAA 5D8LB 1FBUA 1L3LA 5FLXZ 2XIGA 3RJPA 4OMYA 3FMSA 2VBWA 2JZYA 1ZGJA 4BH9A 2LSOA 4S05A 1T0FA 2VN2A 2DPDA 3ZMVA 2MH2A 4P5OA 1U5TB 1XB4A 5L3GA 3L00A 3F21A 4CHUA 1HXDA 3BP8A 3TOAA 3ROUA 2K4JA 3LQRA 3ZQ7A 2FBKA 4G9YA 4ZYDA 2YX7A 1R5HA 3NQOA 2UXNA 2O03A 2VE8A 3I0TA 2CFXA 4HDUA 1SFUA 1YS6A 2FMYA 3F8FA 3FM3A 2BE5F 2FA5A 3COAC 2G7HA 2R7FA 4RB1A 1P2FA 2L01A 1ZH5A 5AIQA 2OQRA 3KP3A 5F64A 3KFWX 3R61A 5ILSA 4UVAA 2EWNA 1FP2A 1P4WA 3V8JA 3ZPLA 1S7OA 2HS5A 3HHGA 4M72A 1Z6RA 5LHGA 4G94A 2L54A 1Z05A 2P4WA 1WI9A 5CVRA 5E20A 1TQMA 1O57A 4N0BA 3I53A 1HBXG 1IUYA 3VODA 3E5XA 4OIQF 5CJ9A 2MD5A 1QNTA 1LJ9A 1YTYA 2IA2A 4LB5A 5EEGA 2JRTA 3DP7A 3AAFA 1J75A 1W4MA 1IN8A 3IRQA 1YW9A 3L7WA 3LAJA 2RKHA 2GQQA 2L3DA 1HW2A 4LFUA 5LBQA 3ERED 1G3WA 2FXAA 2LF8A 3NEUA 3KEOA 3G73A 4KIBA 5EEHA 1D3YA 2R7DA 3ZMTA 4WF2A 1TNTA 3NRVA 4ENMA 2MBFA 4UV8A 4U0WA 1HKTA 2NS0A 1ONVA 3CJNA 2GXGA 4KMFA 4G6QA 2EB7A 4M6XA 1IRFA 1J9IA 3EDPA 1IN7A 4LK0F 3KZZA 4HW0A 2K4BA 3WU0A 1EV7A 4FT8A 3WTWC 6PAXA 1XDUA 2HYFA 1XDSA 3MWMA 4PCQA 3RYPA 2IRFG 2B0LA 2FOKA 2MLKA 1V3FA 1MDMA 1V4RA 2MC3A 1FPQA 1XCVA 1PDNC 1PUEE 3J81K 1XSVA 2P7VB 4S04A 2STTA 3VEPA 3V7RA 1B1BA 1ULYA 1IXSB 2V1DA 2BBYA 3T1BA 1FSHA 4RAYA 1S3JA 2H27A 5H6RA 2QQBA 2XUBA 3LA3A 2E7XA 3DPTA 2O6GE 2J5PA 3T5XA 1RUNA 1MZBA 3Q5FA 5E17F 4MQ9F 4WCGA 2A07F 1J0RA 1YLFA 2WWYA 2HWVA 4N9HA 2IP2A 2XRNA 4HF2A 3TOBA 1EH7A 1BM9A 1H0MA 2FNAA 5HVQC 3E6DA 2QZ8A 1XSXA 1YIOA 1ZYRF 3EYYA 3SZPA 3DFGA 1OYIA 5ICEA 4KUMA 2PG4A 1E17A 3F72A 4RAZA 2D2WA 2A6EF 5DEQA 3QRFF 4XSZF 4L5IA 3WTVC 1U8RA 1WRJA 5DCMB 3CUQC 1D8JA 1E2XA 4IPAA 4UVCA 1GXPA 1F4KA 3MZHA 3E3VA 4RGXA 4Q47A 1CF7A 1OKRA 1DPRA 5J8FA 4IXAA 1KQ9A 4RB3C 5JHUA 1BIAA 4FHTA 3K1NA 3WTXC 1HSJA 5L3CA 1OMIA 4CICA 1DPUA 4AWXB 2EA2A 2HDCA 2YU3A 4I02A 1HW1A 3RDIA 1ZG5A 4HX7A 1XN7A 2QENA 4AIHA 5HDKA 2DU9A 4FX0A 1LB2A 3V8KA 1FNNA 4U88A 4KICA 1UHMA 4G6DA 1Z7UA 2O0YA 2GWRA 1D8KA 3WTSC 3WG9A 4U7DA 4M9XA 3HYIA 4BXUA 4IHTA 4ASNA 4MQVA 3ABTA 3RYRA 1T38A 4M6YA 2VBXA 4ENKA 4YFXF 5DYMA 5FO5A 3ZMDA 1MKMA 2EJRA 4B09A 3TGNA 1R23A 4I0AA 3HHHA 3BROA 5JR3A 3JW4A 1U6GA 2FF4A 3DV8A 1UFMA 5LRSA 1R1VA 2R3SA 4HV6A 4BYYA 1LDDA 4OU0A 3QOPA 4UUVA 2H09A 4L9JA 5E1XA 4LLGF 2ISYA 5TRDA 2FQ3A 4EMSA 5K5RA 5FLXK 4EJWA 1KU7A 3ISPA 5BMZA 4UXNA 1JXSA 1I1SA 1YG2A 1U3EM 4P9FA 2ZKZA 3ABUA 1DDNA 2A5YB 5JFRA 3I54A 3JTGA 4RS8A 3K1PA 2VODA 4D0PA 2A6HF 3F8CA 2CG4A 1J5YA 1U5TA 2LKPA 1GVJA 1BN5A 2YSRA 1QQIA 3GUDA 1J2XA 2X4HA 1BI2A 3CO6C 2JT1A 2IPQX 2EFWA 2P6TA 1RI7A 2DBBA 5CVUA 5ICCA 3IWFA 3O6BB 4GCVA 3CUOA 2DAOA 2ETHA 2FBHA 1WKMA 1Q1HA 1IAWA 1KYZA 1IRGA 3E5UA 2HGCA 2Z3YA 3K0LA 4EJVA 2PN6A 2ZMEA 3GEZA 3RTRA 5JI6A 2Q0OA 2L4AA 2C6YA 3TKYA 2XV4S 4RB0A 2VT3A 4U7BA 2IVMA 3R0JA 3S2WA 3QAHA 3C7JA 2M5WA 4JBAA 2QQAA 1R1TA 4UV9A 3K9TA 3GW2A 4XSXF 3HOTA 3ELKA 2DT5A 3R60A 5DUKA 1K78B 2Q8KA 2RN7A 3FMQA 3L2CA 1AOYA 3WE2A 2A61A 2YR2A 2P5KA 5D4SA 2PBIA 1F5TA 4ZYHA 4Q48A 1F9NA 2KJBA 3HSFA 1XCBA 4ESBA 3EUHA 4YIIA 4IRHA 3ECOA 2FRHA 2HKOA 1T39A 3I71A 4WWCA 4AD9A 3ULQB 4L18B 1LEAA 3CUQB 2Y75A 2PMUA 1G3YA 2L02A 2OQGA 4L0ZB 4GYGA 2BGCA 5H20A 2HZTA 4XRFA 1T98A 1O3SA 2V1UA 1Z6TA 2FMLA 2KIMA 1LEBA 3VOEA 3TDZC 3F8NA 4RGUA 1B9NA 4CZZA 1FT9A 3WTUC 4KFCA 1Y0UA 4IRIA 4ESFA 1STZA 4BHBA 4G7OF 4I01A 4KYWA 3BJOA 3GFLA 4I0BA 2W25A 2ZNYA 3MAJA 2F5FA 1O3QA 5ILVA 3I59A 1P6RA 2FEZA 2M8EA 2UXXA 3M7GA 3IKVA 4IRGA 5DD4A 3MFKA 1QZZA 2W85A 3ZMZA 4A0YA 5LHHA 2M1BA 2ESHA 4UHTA 4AIJA 3R0AA 3V4GA 1R58A 2XGXA 1TW3A 3I5UA 1USSA 5D5UB 4IF4A 1R7JA 2FBIA 2XAGA 4CYDA 2GIVA 2VOOA 4A5MA 2ZFWA 3C18A 3LA2A 4LLLA 3GYHX 2AXLA 5HLHA 3C1DA 5D5WB 2BYVE 3GF2A 2K27A 5IT3A 3E6CC 1IN6A 4A6EA 1ODDA 3B73A 2HTJA 3IHUA 4I2OA 1LVAA 1FZPB 2G9WA 1J7KA 4BHPA 3FWEA 4KDPA 1XMAA 4EM2A 2WTEA 3T0YA 2CWEA 2XROA 2XAHA 4HF0A 2UZKA 4BNCA 3FMRA 1PP8F 5IT9Z 1I6XA 4LB6B 3IC7A 1K6OA 3P9CA 4B8XA 2DI3A 4Q4ZF 4GYIA 4R8HA 1CGPA 2E1NA 4HDVA 2A68F 1TW2A 2ESNA 1JHFA 2XAJA 4IJAA 2PLYA 1BC7C 2D45A 2MA3A 3WTYC 5AIPA 3LWFA 2ZJ2A 3REOA 2K02A 5K5OA 1ZREA 1S8NA 3I4PA 4LJZF 2VONA 1JGSA 1W7PA 2HQNA 3RPUA 3DF8A 4AIKA 1IZ1A 4O6JA 3HRUA 2VT2A 4Y17A 3GZ5A 4YG2F 2PQ8A 4M73A 2RNJA 3QPTA 4WK8F 1I1GA 1SMYF 2VXZA 4EVIA 3SHFA 3V8LA 2P6SA 5ED4A 2V79A 4PGHA 3T8RA 2NAZA 5E8IA 5KVRA 2XAFA 3GLXA 1R36A 1WWXA 3LA7A 1FYMA 4WXCA 4ZZDA 3KP7A 5BQTA 1UB9A 2KIUA 5E18F 5BPIA 4MEYF 1LNWA 1TQPA 3QU6A 2KKOA 5KK1A 4IHSA 4KT5C 4YFKF 1KQ8A 2A3SA 1GHCA 4M71A 1EH6A 3F6VA 1XSDA 1QGPA 3TQNA 4YIFA 1R1UA 2D1VA 2DQRA 4M9SA 3KLOA 3ZMSA 1YS7A 2O3FA 3O3KA 2QVOA 5A2QZ 3JTHA 2CYYA 1FBQA 2XKOA 3KZYA 4G7HF 3GFMA 2EA4A 4MTEA 4ETSA 3IRRA 5CVVA 1B4AA 3U1DA 4Z2YA 1HW5A 2QWWA 4KA4A 1FX7A 2JPBA 3ML6A 5CYVA 3I58A 3TDUC 4U0VA 1P4XA 2PEXA 4ENNA 3K1MA 1TBXA 2H6BA 1XGOA 3E5QA 3OOPA 1C0WA 2O61A 3Q9VA 1XGSA 1LDJA 4IVNA 2FU4A 1MDMB 4L9TA 1SMTA 2OAZA 3WE3A 3W6KB 1UHWA 1QZYA 2W24A 1U2WA 1D5VA 5LHIA 5ICGA 3RIRA 1T6SA 2Z33A 4KIGA 5D5XB 2GAUA 2IW5A 3R4KA 1HKSA 1U78A 3E6MA 2Z9OA 5HLIA 4E70A 2NNYA 2HYGD 3RI4A 5L3EA 5ICFA 3HRMA 2EFQA 2CQKA 4MGRA 3FXQA 1VTNC 1TQIA 1OPCA 1G4DA 1B59A 4OIPF 2K7LA 2YX4A 4HX8A 5LRRA 2ZCWA 1SFEA 3N4MA 1FBSA 3GWZA 4LG0A 3CTAA 4R79A 1AWCA 2STWA 1L0OC 2H94A 3M8EA 2EV0A 2ZXJA 2NYXA 1BI1A 2M30A 1YW8A 4OIOF 2ISZA 1XGNA 3KP5A 3C3WA 5ILUA 4EJUA 1ZG3A 1FLIA 1O7LA 5DV5A 3MEXA 2RV8A 3CO7C 4P55A 4WXDA 3U2RA 3LFKA 3G3ZA 2L4MA 2M45A 1ZARA 5F6FA 2JTVA 4PZJA 2MLGA 3WU1B 1O3TA 4LMYA 3WTTC 5DCFA 3T8TA 4R1HA 3Q9SA 4EJTA 2VE9A 1TNSA 1SAXA 1HQCA 1CF7B 3HSRA 4Y13A 2D1HA 3H92A 3TO7A 1OYWA 2OU2A 3RKWA 2NNNA 1EH8A 1SD6A 2Z5UA 4KN7X 3JAMZ 1K7AA 2XVCA 4HA8A 2E7WA 2RDPA 4JQFA 1O3RA 4NB5A 2KIFA 5AONA 1BBYA 1I5ZA 4RGSA 3I64A 2ZBKA 1BJAA 2OZ6A 1Z91A 3H3UA 2VBZA 2V6CA 3BDDA 4UVBA 5HOOA 4RB2C 2EFPA 4G7ZF 4HF1A 5J8CA 3KETA 4GXOA 2WC2A 3IL2A 3GZ6A 4K2EA 3EYIA 1ZG1A 3BOQA 3J80Z 1FWZA 2DQLA 3WGIA 5D4RA 3E97A 2DFIA 1G3SA 2RGVA 3F23A 2HOEA 3IKTA 2IA1A 4A12A 1QBJA 3KP6A 2P5LC 3BJAA 3RPQA 2G7UA 1LQ1A 3GVAA 1ZLKA 1SD4A 2V9VA 3EQLF 4HV5A 1T2KA 2P5VA 3N97A 1G3TA 2OD5A 3R6SA 1IW7F 2RC4A 5IT9K 2WV0A 2DTRA 3KE2A 1XGMA 2PMHA 2FE3A 3JSPA 4RGRA 3M1EA 2X0LA 4HBLA 5HS7A 4MHGA 5L3DA 4HLYA 1RUOA 3WODF 5FFZA 3D0SA 4ZZLA 3DQVC 3L09A 1ZGAA 4GGGA 3MCZA 4M74A 5E1ZB 2VOPA 4EQQA 3V7SA 2K86A 2QBYB 4JK1X 5LGUA 1HSTA 2DK8A 4EGZA 2AS5F 2ZMEB 1LDKB 3HIFA 4HQMA 4OIRF 3ZP5A 3QP5A 1XMKA 3JSOA 4QLCU 4MNUA 1RNLA 4Y15A 3O2PE 1IXRC 2JPCA 3H3ZA 4NHJA 2DLLA 4A2UA 1WQ2A 4XLNF 4XLPF 4CGZA 4N9IA 3QP6A 4I98B 1MJAA 1FYLA 2EV6A 4O5VA 1YFHA 5HS9A 2HQRA 1ZRCA 5FD5A 3MZYA 2HFHA 3KP4A 5DD8A 1TLHB 3DPLC 3PFIA 2GXBA 4LLNA 4H0EA 4ESJA 4EV0A 1KU2A 3EETA 3P9IA 3MQ0A 1FOKA 4M9ZA 1GXQA 1WSUA 1YO5C 4ENJA 3F3XA 4L9VA 1ZHFA 3FF5A 4PDKA 5A2QK 2BV6A 2QM3A 1YQAA 2KRFA 2A69F 1OYYA 2UWMA 4P96A 2ELHA 3F8MA 4PGGA 5BPDA 3WGGA 3FZVA 2QUFA 3J7AO 5K1YA 5FB2A 5BS6A 4KIFA 2GA1A 4ZYEA 5DCMA 3HSEA 1H9GA 3DXJF 5HLGA 3HTUA 1BI0A 3P7NA 4ZYGA 1MJ9A 5D6FA 4KN4X 1KU9A 3PQKA 1IF1A 2IT0A 4MEXF 3F6OA 4QWQA 3SZTA 3I59B 2FNPA 3WGHA 3KLNA 2F2EA 1W5SA 1RZ4A 2TDXA 3F22A 1S29A 1REPC 2F5DA 2P7CB 1I27A 3BPVA 4MTDA 2XAQA 2O8XA 4OINF 1MJBA 2GA2A 5D8KB 1S6LA 2COMA 5E8GA 1KYWA 4HOBA 5L3FA 1BOAA 5F1RA 1W7PD 2RVCA 3HRSA 4U0YA 5E1WA 4EGYA 4LD5A 2KJCA 3TO9A 4L0YB 2VC1A 2QYOA 4L5JA 2W84A 4Q5SF 2DO7A 4LK1F 3FX3A 3KCCA 1ON1A 1BI3A 1JE8A 4UNOA 3FHZA 4FX4A 4A0XA 1JHHA 5HDNA 4HAMA 4OOIA 5LGTA 2M87A 2NRAC 2DW4A 1YW7A 4HLXA 3GXOA 1IN4A 2ACJA 4HX4A 1KA8A 3ZN0A 1MD0A 3FXRA 3DEUA 4WX9A 1U5TC 3B02A 5DUIA 4DNCA 3HTSB 2HKXA 2LNBA 3QU3A 5HDGA 1ZRFA 2FSWA 2YPRA 3ECHA 4G8XA 3LSTA 2OBPA 2ZNZA 3P9KA 4XBFA 5CVIA 2F5EA 1W7PB 1KGSA 1Z1DA 5LGNA 2XASA 1J59A 2HTSA 5LEKA 2W57A 1B6AA 4HYEA 1USTA 3JAMK 1KU3A 2QQ9A 3J81Z 1ZLJA 2EV5A 4L9NA 4OMZA 2E1CA 1P4AA 3F8BA 4A6DA 2EK5A 3KP2A 2Q2EA 1S7AA 5D5VB 1R00A 4EM0B 2P8TA 3FM5A 2Y48A 2J5OA 2PJPA 1R22A 1W5TA 1X3UA 1FYKA 3U9GA 3PQJA 3GX4X 2LF7A
chains in the Genus database with same CATH superfamily
1HOMA 2NS8A 5K5QA 4RLFA 5DTDA 4DYQA 2OZUA 1N75A 4A5NA 1QO0D 3MD2A 2QLZA 2EQRA 3BQYA 3CCLI 2VC0A 3GO5A 1UCRA 1HA8A 2PI0A 3N05A 3VFZA 4BQAA 1ZN2A 3CDHA 2Y9YA 2ZFUA 1JTYA 1TTYA 1ETQA 2EFNA 3M9AA 1O7FA 5LLQA 5LEJA 2H6CA 4HZFA 3D5SC 3PM1A 1K78A 3BR1A 2EFOA 4A0ZA 2H8WA 3SFZA 3J80K 1DP7P 1LFUP 3EUHC 4KMUX 2JVHA 2WAFA 1R49A 5K7FA 1MMNA 1NG7A 3OOUA 2BEOA 4A93J 4FISA 1PP7U 2HI3A 3HOSA 1OFCX 4CDGA 4PJJA 5FKNA 3W6JB 1IXCA 1D5YA 1F1ZA 5B66C 2F5VA 1QPMA 4NNJA 2XGDA 3MVPA 2CGPA 2VJ5A 3GTOJ 2QQ8A 1BIBA 2VBYA 4L5EA 1RETA 5FD6A 4ZH4F 2FJ1A 4WXHA 5EZGA 2HPMA 5KNLA 3BWGA 2CSOA 3BPXA 4I09A 4KNYA 2M2EA 2PFBA 3QPHA 2F5CA 2HEOA 1FY7A 3IWZA 4I7HA 4BAYA 2O7OA 4AYBA 2QKMB 4BACA 5H6QA 5CVJA 1Z9CA 4O3MA 3PNVA 3OV8A 4LGWA 1SFXA 5D6EA 1FP1D 1SD5A 2LY9A 1JJ6C 2CO5A 3FXUA 4ON0A 1BC8C 2MSYA 3SQNA 2R0QC 3K4NA 4P9UA 2OA4A 2YUSA 2Y69H 3CUQA 3ZN1A 2IBDA 3ERMA 3PO3J 3BY6A 5J6XA 1FC3A 2XKPA 1DU6A 2OUMA 4BHCA 3MKWB 1RRJA 4D5FA 2X6WA 1T33A 5DDGA 2Y0SN 1GV2A 1YYVA 3D5LA 5CLSA 3RKXA 1H8AC 4NQWA 4FCYA 1R5GA 2CW0F 3GFIA 1H9TA 3AG3H 4XLEA 3BLYA 3WG7H 4GO1A 3SXYA 2JSCA 5M5XJ 1MGTA 1HKQA 1XD7A 3K10A 4XK4A 5E3MA 3K2ZA 1Y1VJ 1SD7A 3LFUA 4DGWB 3BQZA 3RKYA 1POGA 1H88C 1D1AA 2HR3A 2BHZA 1A04A 1OCRH 2N8GA 4CUGA 2XPUA 3CLOA 5FFXA 3DEWA 2MH9A 2F4MB 4YFNF 3GLLA 3KEQA 2A05A 1B9MA 3S8PA 4C30A 3M8FA 1A5JA 1FTTA 4BU2A 3VPRA 1DUXC 4AVPA 3CCJI 3H9JA 3BJ6A 3ZMUA 1ERDA 4F7ZA 3TO6A 3MKZA 4HQEA 4BE1A 3HRTA 1R4MB 2V1XA 1P92A 1QHGA 1ZAOA 2QBYA 1IN5A 4QPQA 1OR7A 5KAIC 2DMNA 2VI6A 2ADUA 3JR9A 4IHVA 4EJOA 5TJJA 2RQPA 2GZWA 4RM2A 3LQQA 2ZO4A 4AYBN 1MW7A 4A3EJ 1K79A 1MBJA 3WTZA 1Y56A 3OYJA 3M1CA 5F1JA 3V7CA 5ERIA 4JP0A 5HS8A 2W82A 1ETYA 5JVTA 4FQGA 4RDUA 4TV7A 4JX6A 3ZRGA 3DKWA 5FGMA 2B63J 1FSEA 5L3BA 3BZ6A 1ON2A 3GFJA 2KIQA 4LG0B 5IOZA 2IJLA 1IDYA 3HUGA 4EM1A 5M5WJ 5E79C 1FMWA 5F0HA 3VB2A 1KQ0A 3KYLA 2L2OA 2OCCH 1LFBA 5K7ZA 4CXFA 3OIOA 3P5JA 4DQ2A 3RKQA 2LD5A 2IA0A 4CO8A 2DK5A 2XHKA 4BQQA 2DPUA 3VWBA 3L9FA 4A3BJ 1G6NA 3CP2A 2XPVA 1ZRDA 2Z1DA 1LUJB 3AG1H 3LAPA 3E6BA 3GTGJ 3HEFA 2M4GA 3BTLA 4CA0A 5BOXA 3I9V2 1RIOH 2DOAA 4CYCA 2LDUA 3K69A 5GPCA 2Y0MA 2Z99A 1NHAA 4XLFA 9ANTA 1B8IA 5D8LB 1FBUA 1L3LA 3HGGA 1A6QA 5FLXZ 2XIGA 3RJPA 4OMYA 3K70D 3FMSA 2DMUA 4I99C 3RZOJ 3J7AY 4BXXJ 2VBWA 3JRIA 1SVLA 2JZYA 1ZGJA 3JRAA 4CCLA 2F4IA 2VASA 3TEDA 4BH9A 2LSOA 4S05A 1T0FA 2VN2A 5HNHA 2R7WA 2DPDA 1Z0XA 3ZMVA 3G1LA 2MH2A 2WB1N 1U5TB 2E36A 2MD0A 4P5OA 1XB4A 4PJNA 5L3GA 1OQYA 3L00A 3F21A 4CHUA 1HXDA 3BP8A 3FK6A 3ABKH 4S0HB 2QEXI 3TOAA 3ROUA 1XMXA 5JVGF 2K4JA 3CESA 1NK2P 4JOMA 1WCMJ 3FXOA 3TBIA 1MBFA 3LQRA 3ZQ7A 2VL8A 1IV8A 2FBKA 2VJ4A 1X58A 4G9YA 2TRTA 1VFCA 3G71I 4ZYDA 3ASOH 1NTCA 1W36C 1FIAA 2YX7A 1R5HA 3NQOA 2E1OA 2Y2ZA 3W2AA 2UXNA 3FXLA 2O03A 2VE8A 3I0TA 2CFXA 3S3MA 4HDUA 1SFUA 2NOJB 3LSRA 2BY2A 1R6RA 1TT0A 1YS6A 2XPWA 2FMYA 3FXKA 3IV5A 4XR6A 1MMSA 3F8FA 1U9OA 3HOYJ 2GXAA 4IO9F 3FM3A 2IGNA 3CMEI 2BE5F 4BY1J 2FA5A 2ID6A 3COAC 2G7HA 2LOOA 2XGEA 2R7SA 2R7FA 2VKVA 2JA2A 1P2FA 4RB1A 1Z7LA 2JK3A 3DCFA 2I5UA 2L01A 2Z16A 1RKTA 1ZH5A 1N78A 1K83J 1WJDA 5AIQA 2LR8A 2OQRA 3KP3A 4N4NB 4CZCA 4QPOA 5F64A 3KFWX 3FXJA 4C9YA 3CJRB 3R61A 5ILSA 4UVAA 3BZCA 4RA2A 2EWNA 1FP2A 2HDDA 1P4WA 4YEJA 3TW7A 2CV1A 1LKXA 3V8JA 3ZPLA 1S7OA 2HS5A 3HHGA 4ANJA 3VYTB 3S32A 4M72A 1Z6RA 3HOWJ 5LHGA 1MMAA 4G94A 2L54A 1Z05A 2P4WA 1WI9A 5CVRA 5E20A 2M9HA 1TQMA 1O57A 4N0BA 3I53A 4E7JA 3LL7A 1HBXG 2DFHA 1IUYA 3VODA 1EA3A 2LY1A 5GAGJ 2GLOA 3E5XA 4OIQF 1EF4A 1QVTA 5CJ9A 2VKEA 4BBSJ 2XAUA 4XM3A 2UV1A 2MD5A 1QNTA 3RZDJ 3SEQA 2CUFA 1LJ9A 1YTYA 1GUUA 2IA2A 4LB5A 1YRNA 5EEGA 2JRTA 3DP7A 3AAFA 1J75A 3K6GA 1W4MA 3GTPJ 2QSFX 2ECBA 1IN8A 2NVYJ 3IRQA 1YW9A 3HB9A 1LFPA 1VQLI 2OV7A 2LKXA 3L7WA 2VUMJ 3V42A 3LAJA 1DGWY 1WJCA 1E3HA 4Y52J 2RKHA 2L5QA 2GQQA 2L3DA 3BG5A 1HW2A 2QA4I 1QHHD 4LFUA 5CQEA 4FE4A 5LBQA 3ERED 1G3WA 2W4SA 2FXAA 4BEHA 3A0HC 3BG3A 1OISA 3K2AA 2LF8A 3NEUA 5IYDJ 3KEOA 3QQAA 3JRCA 4KIBA 5H2FC 3G73A 5EEHA 3IH3A 1D3YA 3A0BC 4D7NA 1VQKI 2R7DA 3ZMTA 4F92B 3PNYA 2K9QA 2CV0A 4A3JJ 3ONQA 2QGUA 4WF2A 4IX7A 1TNTA 2K3PA 3OIPA 3QWLA 3NRVA 4ENMA 5IPAA 2MBFA 4UV8A 3L2QA 3H1CA 4U0WA 3ZQCA 1FEXA 1YE9A 4XRMA 1Y8QB 3HZJA 1HKTA 3U21A 1PVEA 2NS0A 1ONVA 3CJNA 5FKLA 4DW6A 3S15J 3ESWB 3OIQA 3MZ8A 2ID3A 4HSRA 3DBHB 5CQGA 2GXGA 4B44A 4KMFA 5EJCA 4G6QA 2EB7A 4M6VA 4M6XA 1IRFA 4KJZA 1IRXA 5FRMA 1J9IA 1SFKA 3EDPA 1IN7A 2NOGA 4LK0F 1W0UA 3KZZA 3M3YJ 4HW0A 1SFOJ 2K4BA 3WU0A 1EV7A 4FT8A 3WTWC 6PAXA 1XDUA 2HYFA 2XF7A 1MIJA 1XDSA 3MWMA 4PCQA 3RYPA 4IOCF 2QF7A 2IRFG 5C4XJ 2B0LA 2FOKA 2MLKA 1YJNI 1V3FA 1MDMA 1V4RA 2MC3A 1FPQA 3OYNA 1XCVA 1PDNC 1PUEE 3JRGA 3J81K 1WZ2A 4YELA 1XSVA 1GVDA 4BQOA 3M07A 3GCMA 4IHYA 2P7VB 1UAAA 4XN3A 4S04A 1ZKGA 2STTA 3VEPA 1DU0A 3V7RA 1B1BA 1JUSA 1ULYA 1W36D 1IXSB 2KDZA 2V1DA 2BBYA 3T1BA 1OCOH 2IS2A 2K9MA 1FSHA 4RAYA 3CJTB 1S3JA 3TL4X 3ZQHA 2H27A 5H6RA 4D9JA 3OYAA 2QQBA 3ZQLA 2XUBA 4B3AA 3G4SI 3FKJA 3LA3A 2E7XA 3RPUD 4XN0A 3DPTA 4UB6C 3LSGA 2J5PA 3T5XA 1RUNA 2O6GE 5FLVA 1MZBA 3Q5FA 5E17F 1MH3A 4MQ9F 1FTZA 4WCGA 3WU2C 2A07F 2L9VA 1FOYA 1J0RA 1YLFA 2E2JJ 4FASD 5EEAA 2WWYA 1EJ9A 1X2NA 4P1WA 3Q3SA 2HWVA 1IGNA 1Y39A 2Y30A 4N9HA 1I3QJ 2IP2A 2XRNA 4HF2A 2CRGA 3TOBA 1EH7A 1B72B 2EILH 1BM9A 3S3NA 1BR4A 1H0MA 2FNAA 1JT6A 3BTJA 5HVQC 2L0KA 2Y31A 2JA7J 4A3FJ 2MW8A 3E6DA 2QZ8A 1XSXA 1YIOA 3ZXSA 1ZYRF 4AC0A 2DXIA 3EYYA 2X48A 2DDBA 2QKLB 3SZPA 3DFGA 2DOEA 1OYIA 3I55I 3W2VA 2DA7A 5ICEA 2CFOA 2CH0A 3EUAA 4KUMA 2PG4A 1TP4A 3GTQJ 4M3BA 1E17A 1ETKA 2BW3B 3F72A 4RAZA 2D2WA 5M3FJ 2A6EF 5DEQA 1ACIA 3QRFF 2EZLA 3K7AJ 1BOBA 3LSHA 4XSZF 2DA1A 4KT6A 1YX3A 4L5IA 3WTVC 1U8RA 3GMEA 1WJFA 1VQ4I 1WRJA 3JRBA 5DCMB 5FKKA 1A6IA 4DIQA 3CUQC 2ZC2A 2X9DA 1D8JA 1E2XA 4IPAA 2M0CA 4UVCA 1GXPA 1F4KA 3MZHA 3AFHA 2CV2A 3E3VA 4RGXA 4Q47A 1RR7A 2XGCA 1QVUA 2JMWA 2H1KA 4EEFG 1S9HA 1OKRA 1CF7A 1DPRA 4HPQA 3RSNA 5J8FA 4IXAA 3DTIA 1KQ9A 2PMZN 4RB3C 5JHUA 1BIAA 1R9TJ 4FHTA 3K1NA 1WH5A 1RKWA 3WTXC 2GM4A 1HSJA 3H0GJ 1OMIA 3A03A 4CICA 5L3CA 4AWXB 1DPUA 2EA2A 3E0JB 3Q0WA 2I10A 1XS9A 2HDCA 2LBFB 4X1EA 2YU3A 2LTPA 4I02A 1HW1A 1HC8A 2BZTA 3EUKL 3RDIA 1LE8A 4BY7J 1ETXA 4BXFA 1ZG5A 3H9GA 4NC7A 4HX7A 4LIUA 1XN7A 2QENA 4AIHA 5HDKA 2DU9A 4FX0A 1LB2A 1R5ID 3V8KA 1FNNA 4J00A 4U88A 1IJWC 2IEKA 1GV5A 2Z2SB 4NDLA 4KICA 3OYEA 3CC4I 4HEA2 1UHMA 4G6DA 2HPIA 1Z7UA 1UJ8A 2RNGA 2O0YA 3AL0B 2Y0SA 2GWRA 1D8KA 2K9SA 2X6XA 3WTSC 3WG9A 3J7YJ 2IAIA 1AKHB 4U7DA 2HU9A 4M9XA 2O8KA 3HYIA 1JI8A 3RQ4A 4BXUA 4IHTA 3CP8A 2VQCA 1SC7A 4ASNA 3C2BA 3QOEA 4XICA 4MQVA 3ABTA 2QSHX 3RYRA 1T38A 4M6YA 2VBXA 2R5YB 4YFXF 4ENKA 2DFEA 5DYMA 5FO5A 1JUPA 1OLTA 1MKMA 3ZMDA 2EJRA 4CSWA 4B09A 4II2A 4LIVA 3TGNA 3HOZJ 1R23A 1VQ6I 1MNEA 1BJZA 3LSPA 4I0AA 1IO2A 3HHHA 3BROA 2DTZA 3D5RC 5JR3A 2LP0A 3JW4A 2HOSA 3AG2H 1U6GA 2FF4A 3DV8A 1UFMA 1YOVB 2JSPA 5LRSA 1R1VA 2R3SA 4DZPA 4HV6A 3VYRB 4BYYA 5J4YA 2X1DA 1PYVA 1LDDA 4OU0A 1K6YA 1MBEA 3L2UA 2Q1ZB 3FKIJ 3QOPA 4UUVA 4NBQA 2H09A 4L9JA 5E1XA 3NAUA 1RPWA 4LLGF 2ISYA 5TRDA 1Y0NA 2FQ3A 3MKYB 4EMSA 1TWHJ 4ABZA 5K5RA 1YJWI 2VB6A 5FLXK 2E2HJ 4EJWA 1KU7A 2KDOA 2VJIA 3BCBA 1TZLA 3HOXJ 1PUFB 2CQ7A 3ISPA 5BMZA 4UXNA 4G6TB 1JXSA 4XNFA 1I1SA 1YG2A 4X0GA 4P9FA 1U3EM 2ZKZA 5B5EC 3ABUA 3O8HA 2DMTA 1DDNA 2A5YB 2DT6A 5EG0A 1UELB 4RAGA 3I54A 5JFRA 2XF6A 4RS8A 3TP0A 2M8GX 4HG2A 3JTGA 3K1PA 2VODA 3S2DJ 4D0PA 2KZVA 1KZHA 2A6HF 3F8CA 2CG4A 1J5YA 1U5TA 2HVQA 2OF7A 3A4CA 3DTEA 2LKPA 1R4NB 3WHCA 1JKRC 5IP6A 1GVJA 2BHYA 5GP9A 1BN5A 2YSRA 1QQIA 2R5ZA 3GUDA 1JT0A 1J2XA 2X4HA 1BI2A 4DBRA 3CO6C 2JT1A 2IPQX 1VI0A 4B47A 5J1YA 2EFWA 2P6TA 1RI7A 3W2WA 1OCZH 2DBBA 5CVUA 5ICCA 3RQIA 3IWFA 3O6BB 4GCVA 2EPFA 3A01A 3CUOA 2DAOA 2ETHA 2FBHA 5DM6F 2Q2EB 1WKMA 2KQRA 1Q1HA 4C2TA 3S1MJ 3S14J 1OJLA 3FHNA 4UUSA 2IGMA 3E7LA 4E7ZA 2DA4A 2WB1A 1JKPC 1IAWA 1KYZA 3Q0VA 1IRGA 3E5UA 3HPGA 2HGCA 2Z3YA 3H5AA 3K0LA 3BG9A 1P7JA 2DDAA 4EJVA 2JWTA 2PN6A 2X51A 2ZMEA 3GEZA 3RTRA 5JI6A 1GDTA 2Q0OA 4ZTFA 2L4AA 2PJRB 2C6YA 3TKYA 2XV4S 4BKXA 4RB0A 2VT3A 4U7BA 5C44J 2IVMA 4IOAF 2LC2A 4DOZA 3S16J 3KIOA 4ZYAA 3R0JA 3S2WA 4UB8C 4I6ZA 3OR1C 5IYCJ 1BW5A 3QAHA 4CCOA 3C7JA 2M5WA 4JBAA 2QQAA 1R1TA 1JKOC 4UV9A 3K9TA 3CF5F 4NC8A 2JQ7A 2WAEA 3GW2A 4XSXF 4IQJA 1D0YA 3HOTA 3ELKA 2K85A 4JYKA 3W3CA 1YJ9I 2DT5A 3R60A 5DUKA 1K78B 1TWAJ 2Q8KA 4XLHA 2RN7A 2L9RA 2OCEA 3FMQA 3L2CA 3SYTA 4UY8I 1AOYA 3WE2A 4A3MJ 1N25A 3JREA 2XC7A 2A61A 2YR2A 3L1PA 4A3DJ 2P5KA 5D4SA 2PBIA 1F5TA 1QA6A 4Q48A 4ZYHA 3OS2A 3HOUJ 1F9NA 1OCPA 2KJBA 3HSFA 4OAYA 1XCBA 4ESBA 3EUHA 3I4MJ 3CJQB 2CS3A 4YIIA 3OYMA 3IUOA 1X4PA 4AIDA 1SEUA 3DBRB 4IRHA 2BY0A 2E5ZA 3ECOA 2FRHA 1A35A 2RAEA 2HKOA 1T39A 3I71A 5FRNA 5J47A 2X6OA 4WWCA 3K4JA 3ZQQA 2MGQA 5IYBJ 3MN2A 2EINH 4AD9A 3ULQB 4DZJA 4L18B 5B1BH 1UG0A 4ITVA 2IS4A 1LEAA 1V5FA 3CUQB 2L7ZA 1PJRA 2KFDA 1YX5A 3SZGA 2Y75A 3OYLA 2PMUA 1D0XA 1G3YA 3WHBA 2L02A 4ZC3A 3U1KA 2OQGA 4L0ZB 4PSWA 4GYGA 3TP3A 4NQWB 2BGCA 4BUPA 3LSIA 4NUBA 4BDZA 3DBLB 2R7TA 2WY8Q 2E5NA 5H20A 2MYSA 2HZTA 3DWLE 4XRFA 1T98A 5FKMA 1O3SA 2V1UA 3CLQA 1Z6TA 2FMLA 1X1DA 3KEYA 3G1OA 2KIMA 1LEBA 2AO9A 3CDLA 2IGOA 3CCQI 3OMYA 3VOEA 3TDZC 3F8NA 3PL8A 2Y9ZA 4RGUA 3CMAI 1B9NA 4CZZA 2NVUB 1FT9A 5GADJ 4CCJA 3WTUC 4KFCA 4V19K 1Y0UA 4IRIA 3M4OJ 4ESFA 1STZA 4OWRB 4BHBA 3CDIA 4G7OF 1TWGJ 4IL6C 4I01A 4KYWA 3BJOA 1MNMC 3GFLA 3CMMA 4I0BA 3OSGA 1VQ5I 4J19A 2W25A 4BE0A 2CQNA 2ZNYA 3MAJA 2F5FA 3IAM2 4B43A 3UNGC 1O3QA 5ILVA 4XKBA 2BVMA 4XL9A 3I59A 2HXIA 1P6RA 2FEZA 2M8EA 1O4XA 2UXXA 3BC8A 1X1PA 4PUSA 4PJMA 3OYGA 3M7GA 3IKVA 3BT9A 5KAFC 4XLAA 4QIWN 4IRGA 1X2MA 5TISC 5DD4A 4IKFA 1QZZA 3MFKA 3AL0C 2YS9A 1WVRA 2W85A 3BZKA 3ZMZA 4A0YA 5LHHA 2DA5A 2M1BA 2ESHA 2ZSIB 4UHTA 4AIJA 3R0AA 3V4GA 4HNUA 1R58A 3SJMA 1T95A 2XGXA 1TW3A 2P0WA 3I5UA 4YIRX 4B3XA 1USSA 3OYDA 5D5UB 1IV6A 2NVQJ 2F6CA 4IF4A 1P9QC 1RESA 2WV1A 1R7JA 1Z3XA 3DU6A 4PFPA 4XOTA 2LMDA 2FBIA 3PSIA 2F48A 2CMPA 2XAGA 1K61A 4CYDA 3IH2A 3OYHA 5F27A 2GIVA 2VOOA 2BY1A 2XB5A 4A5MA 2ZFWA 3C18A 2KPMA 3LA2A 4LLLA 1VQ9I 3GYHX 2AXLA 3ZR8X 2ZXWH 5HLHA 2KISA 1B8IB 3C1DA 5D5WB 5M5YJ 2BYVE 3GF2A 3QYFA 5DS9A 2K27A 5IT3A 3E6CC 3IAS2 3SEZA 1IN6A 2DODA 4A6EA 1ODDA 3B73A 4E7IA 2E1MB 3MMYB 4HRIA 2HTJA 3IHUA 4I2OA 1LVAA 4M3FA 1ZGWA 1FZPB 2G9WA 1J7KA 2EZHA 3FWEA 4BHPA 4KDPA 1XMAA 4RMNA 4EM2A 2WTEA 3T0YA 2CWEA 4FE7A 1VQPI 1WHUA 2XROA 2XAHA 4HF0A 2UZKA 4BNCA 3M8JA 3QPLA 3FMRA 1PP8F 5IT9Z 1OCTC 3C2GA 1I6XA 2WY7Q 1MBKA 4LB6B 3OYBA 1TWFJ 4XKVA 5C3EJ 1BR1A 4A3KJ 2CU7A 4C3IJ 3IC7A 1EKEA 4QTRA 1K6OA 3P9CA 4B8XA 2R7QA 2W00A 2HOAA 2VPRA 2DI3A 4Q4ZF 1VQNI 4GYIA 4R8HA 1CGPA 2E1NA 5EZHA 4HDVA 5F0CA 1NG6A 2A68F 1TW2A 2ESNA 3OYKA 1JHFA 2XAJA 4IJAA 1G2HA 4II3A 2PLYA 3SFIA 1BC7C 2D45A 1TWCJ 2MA3A 3WTYC 3A1YA 1QU3A 3ABMH 3I3LA 2OTLI 2LYCA 1U8BA 5AIPA 3LWFA 2ZJ2A 3REOA 2K02A 2UUZA 5K5OA 2EIJH 1ZREA 3HDDA 3KPHA 1RR8C 5IP9J 1P7IA 1S8NA 3I4PA 4LJZF 4PFOA 2VONA 1JGSA 1W7PA 2HQNA 4LG3A 5GTHC 1Q1VA 3RPUA 3DF8A 4AIKA 4JX5A 1IZ1A 4O6JA 4E4HA 3HRUA 2KLOA 2VT2A 4Y17A 3GZ5A 3KYCB 4YG2F 3ZQIA 2PQ8A 4M73A 2RNJA 3PNTA 3QPTA 4WK8F 5J4VA 2E19A 5FROA 1I1GA 1SMYF 2VXZA 4EVIA 4IZZA 3CCSI 3HPHA 3SHFA 3V8LA 1SAUA 5F0FA 2P6SA 5ED4A 4B48A 2K3FA 2V79A 2ME6A 1ZR2A 2AXTC 4BS9A 2A6TA 4PGHA 3T8RA 4BBRJ 2NAZA 5E8IA 2AHQA 5KVRA 2XAFA 3JRFA 3GLXA 1X4OA 5HODA 1R36A 4AUXA 1VQOI 1WWXA 2HVRA 1S72I 1NH3A 3LA7A 2PMZA 3GTJJ 3X2QH 2DMPA 3PUBA 1FYMA 1ZK8A 2IXSA 4WXCA 4BQNA 4ZZDA 4DYRA 3KP7A 5BQTA 1UB9A 2KIUA 5EGOB 3GTMJ 5E18F 1I6HJ 5BPIA 2EZKA 4MEYF 1LNWA 2ZXHA 4D1QA 2EIMH 1YRNB 1TQPA 3QU6A 2LREA 3CZ6A 4XOPA 2KKOA 5KK1A 4C3HJ 4IHSA 1ETOA 4KT5C 2QCOA 4YFKF 1K4TA 1IDZA 2A3SA 1KQ8A 3KZIC 4Y7NJ 1GHCA 4M71A 1EH6A 3F6VA 1XSDA 1QGPA 3TQNA 4YIFA 3MKLA 1R1UA 2FX0A 2DJIA 2D1VA 4IHWA 2R7XA 2FD5A 2DQRA 2E2IJ 2HDWA 4M9SA 3KLOA 1D0ZA 2HNHA 3BR0A 3ZMSA 1YS7A 2O3FA 3O3KA 2QVOA 5A2QZ 2E34A 2V9PA 3OL3A 2V26A 3BTCA 3JTHA 4RM3A 4BEHB 4CCKA 3PFYA 4BDYA 1Z77A 1OCCH 4KITB 2VPLA 1V54H 5JLWA 4XIDA 2CYYA 2K9LA 1FBQA 5B3SH 2XKOA 2COBA 3KYDB 3LSJA 3KZYA 4G7HF 2R93J 2IS6A 3GFMA 3ZQGA 2OJED 3H3VK 2DMQA 4Y4RA 2EA4A 1XPXA 1V5EA 4MTEA 4ETSA 1MMGA 2GOMA 1F43A 4A69C 3IRRA 5JLXA 4D5CA 1JTXA 5CVVA 1B4AA 3U1DA 1YI2I 4Z2YA 5M3MJ 1HW5A 4RBOA 2HXOA 2QWWA 4KA4A 2VQGA 1FX7A 2JPBA 2VQHA 3ML6A 4X6AJ 1D1CA 3CCEI 2IS1A 5CYVA 1SVMA 1UHSA 3I58A 3TDUC 4U0VA 1LVKA 2H1LA 1P4XA 2PEXA 4ENNA 3K1MA 4F3QA 1TBXA 2H6BA 1XGOA 3E5QA 3OOPA 3OYIA 1C0WA 2O61A 3Q9VA 2KP6A 1XGSA 1J09A 2AQEA 3UKGA 1LDJA 4IVNA 1GLNA 2FU4A 1MDMB 5CKTA 4L9TA 1AHDP 1UG2A 1VQ7I 1SMTA 3GZNB 2OAZA 4XLCA 3WE3A 2R7VA 2LG4A 1T56A 2ICWG 3W6KB 1UHWA 1QZYA 2VQLA 2CUZA 2W24A 1U2WA 3OR2C 2M0MA 1D5VA 5LHIA 3DLAA 2W48A 4A3CJ 2LY2A 3HL2A 5ICGA 3RIRA 5J40A 1T6SA 2Z33A 1JKQC 1OR7C 1V55H 1YIJI 4KIGA 1VQ8I 5D5XB 2CJJA 2GAUA 1DQUA 2IW5A 1S5LC 3R4KA 2CQXA 3DEEA 1HKSA 2ZMEC 1U78A 3IP4B 1FOXA 1KONA 5EDNA 3E6MA 4C2MJ 2Z9OA 5HLIA 3PUFA 1Y6IA 4E70A 2NNYA 5CPRB 2HYGD 3SDGA 2EZIA 3FDYA 3RI4A 5L3EA 5ICFA 2V4JC 2EFQA 3HRMA 2IGKA 4E6KG 2CQKA 4MGRA 3FXQA 3OSFA 4LOCA 4AU7A 1TQIA 1VTNC 1W0TA 3DKYA 3FK7A 1OPCA 3K70C 1G4DA 1B59A 2LVSA 2VIXA 5HNFA 4FTHA 5C4JJ 5J3LA 4OIPF 1RC9A 3A02A 2K7LA 2YX4A 4HX8A 5LRRA 2ZCWA 1WPKA 1SFEA 2WAQA 3N4MA 1FBSA 3GWZA 1VQMI 4LG0A 3CTAA 4R79A 1AWCA 2LLKA 1M1EB 2STWA 4E7LA 1L0OC 4B1RA 2H94A 2VXDA 3S93A 2KRHA 2EV0A 3HXLA 3M8EA 2X1EA 2ZXJA 3TW6A 4EATA 4KISA 2NYXA 1Z3YA 1VNDA 1BI1A 2M30A 1YW8A 4OIOF 3PIOF 3H0DA 2ISZA 2V6EA 3BTIA 1XGNA 4FETA 1JJ8C 3KP5A 3C3WA 4HNVA 5ILUA 4EJUA 1ZG3A 1FLIA 1O7LA 5DV5A 1QPIA 2E1MC 5GAHJ 3MEXA 3S1QJ 2RV8A 2EH3A 2HQ5A 4RAFA 3CO7C 4P55A 4WXDA 3CCYA 3U2RA 5GPAA 3LFKA 1HCRA 1FJLA 3G2BA 3B6AA 1T0FC 3G3ZA 1LPQA 2L4MA 2KT0A 2M45A 1ZARA 2JA8J 5F6FA 1TT5B 2JTVA 3VYUB 2RQQA 4PZJA 2MLGA 3WU1B 3FXMA 1X19A 1O3TA 3CCMI 4ZTJA 4LMYA 2HYJA 3WTTC 3IH4A 5DCFA 3T8TA 4R1HA 2ZB9A 3BR2A 3Q9SA 4A3LJ 2DN0A 4EJTA 3DKXA 2VE9A 3OS0A 1TNSA 1SAXA 1JUMA 2VLAA 2CW7A 3HG9A 1HQCA 1CF7B 3OYFA 1D1BA 1E3OC 3Q0UA 1FOWA 2WADA 3HSRA 4M3DA 2JUGA 4Y13A 3PIPF 1ZELA 3I56I 3D1NI 2D1HA 1N77A 2KHMA 2W1OA 1TL8A 3H92A 3TO7A 5F08A 1OYWA 1IG7A 2OU2A 1GT0C 3RKWA 1IC8A 2E35A 2NNNA 1EH8A 4M3EA 1SD6A 2Z5UA 5J1UA 3CCUI 2M7AA 2O9LA 3DPUA 2V7FA 3ZCOA 4KN7X 2WAQN 3FBIB 3JAMZ 1K7AA 5FJ8J 3F9KA 1LE8B 1ORKA 2WA0A 2XVCA 4D7MA 3KX2A 4HA8A 2E7WA 2RDPA 4JQFA 1WGXA 1O3RA 2KIFA 4NB5A 1BBYA 1I5ZA 5AONA 4RGSA 1XG1A 2R4GA 3I64A 4F93B 1UZCA 1NK3P 1W1WE 2R7RA 2ZBKA 4UUTA 1BJAA 2ECCA 2X1CA 2V9KA 1T08B 2NVXJ 1MSEC 3VSLA 2FUG2 2B9SA 2OZ6A 5GTIC 1Z91A 3H3UA 3K4LA 4C2UA 2WBMA 3LOCA 2VBZA 1U9NA 2V6CA 2L7KA 3BDDA 4IQ4A 4ZJZA 4UVBA 4XKCA 4V2GA 5HOOA 4RB2C 2DA2A 2EFPA 1BW6A 4MFEA 4G7ZF 4HF1A 4PJ0C 2XRLA 1ETVA 1Z21A 5J8CA 1E0EA 2L7FP 3KETA 4GXOA 3NWSA 2WC2A 4U87A 1X3WB 3IL2A 4MFDA 3GZ6A 4K2EA 2KRCA 3EYIA 4GRIA 5TGTA 1ZG1A 3LSKA 3BOQA 2HOTA 3BR5A 3JRHA 1XTAA 1MBHA 3J80Z 1DP3A 1X1CA 1FWZA 1U0JA 2DQLA 5IP7J 3WGIA 5D4RA 2XF5A 2DA3A 3E97A 2DFIA 1G3SA 1JGGA 1X1BA 3GTKJ 1MMDA 2RGVA 3F23A 2HOEA 3IKTA 2JUCA 1ZTRA 1WFXA 2IA1A 3AKZA 4A12A 2K5CA 1QBJA 4XKWA 2EBIA 2GBYA 3S17J 2DCEA 3KP6A 2P5LC 3BJAA 3RPQA 2G7UA 1LQ1A 5K7HA 3JCUC 2LKSA 3GVAA 1ZLKA 1SD4A 4ZDPA 2V9VA 1FIPA 3EQLF 4MLOA 1WJAA 4DBQA 4HV5A 2X85A 1T2KA 2P5VA 2R92J 4G12A 3N97A 1G3TA 2OD5A 2HZDA 3DU5A 3R6SA 4E7SA 1IW7F 3H5RA 2KL4A 5EG0B 2MABA 4F55A 2RC4A 3FBNB 4C3JJ 5IT9K 2WV0A 3O8GA 1G59A 3OWTA 4AVZA 2DTRA 3KE2A 2FQ4A 3S2HJ 3HKZA 1XGMA 2PMHA 2FE3A 2BXZA 3JSPA 4RGRA 3M1EA 1XC5A 1ZQ3P 2X0LA 2XSJC 2R5ZB 4HBLA 5HS7A 4XRSG 1AA7A 1WJ5A 2DT7B 4PK4A 4MHGA 1ENHA 5L3DA 2DJNA 4Z6YA 1BL0A 1BR2A 4HLYA 1RUOA 3GTLJ 3WODF 1A31A 5FFZA 3D0SA 4ZZLA 3DQVC 2HQAA 3L09A 1ZGAA 3BR6A 2DYSH 5HLTA 2LRDA 4GGGA 3MCZA 3A01B 2LH9A 2F4OB 4XRSA 4M74A 4UUSB 3H9QA 5E1ZB 1AU7A 2VOPA 4EQQA 3V7SA 2K86A 2QBYB 3H5NA 5GAEJ 1WJEA 3FISA 4ZDLA 2ZJPF 4JK1X 5LGUA 2P81A 3CMYA 4I76A 1HSTA 1I39A 2DK8A 4EGZA 2OTJI 2AS5F 2ZMEB 2DYRH 1LDKB 2W7NA 3HIFA 4HQMA 4OIRF 3ZP5A 3QPSA 3QP5A 1XMKA 3JSOA 2DOFA 1YHQI 4QLCU 4MNUA 1V5GA 1RNLA 4Y15A 4JX4A 1ETWA 3O2PE 1IXRC 4HSTA 2JPCA 3H3ZA 4V2FA 4E7KA 4NHJA 2DLLA 4A2UA 1WQ2A 1R71A 1BA5A 5EYRA 3HUGB 2CQQA 3DLLF 2YU9J 4XLNF 4XLPF 4CGZA 4N9IA 1CQTA 3QP6A 4I98B 1MJAA 5BNGA 2L9NA 3HJEA 1DGRM 4LITA 5KHDA 2H8RA 3UR3C 4BL0B 4BGDA 2NXNB 1X3ZB 3CF2A 1FYLA 3HKZN 1F36A 2EV6A 4Y3OA 4O5VA 3TMOA 1YFHA 3C2HA 5HS9A 3PO2J 2BXYA 2HQRA 4CYCB 3BG7A 4XMYA 1ZRCA 5FD5A 3MZYA 2VKHA 3ZQFA 2HFHA 1WI3A 3KP4A 5DD8A 1TLHB 3S1NJ 3DPLC 3PFIA 1A36A 4OAZA 5EGOA 2V1NA 2GXBA 2KMUA 4LLNA 4H0EA 2CUEA 4M3GA 3BR3A 3VDXA 4EV0A 4YRVA 4ESJA 1KU2A 3EETA 3HC7A 3P9IA 2E60A 3MQ0A 1HF0A 1B72A 1WJBA 1FOKA 4M9ZA 4J01A 3ASNH 2JA5J 1GXQA 2L7MP 1WSUA 1YO5C 1X1AA 4ENJA 3F3XA 2M3AA 4L9VA 1ZHFA 3FF5A 1Z67A 4PDKA 5A2QK 1G8XA 2BV6A 2ELJA 2QM3A 3RCOA 1YQAA 3HOVJ 1HDDC 2NS7A 4H4KC 2KRFA 2A69F 1OYYA 2UWMA 2CW8A 4PJLA 5EF6A 5DM7F 4P96A 2XB0X 2ELKA 2ELHA 2EIKH 2BW3A 3F8MA 4PGGA 2ZJQF 2BY3A 4CCMA 3WGGA 5BPDA 3FZVA 2QUFA 4CH7A 2R7UA 3QODA 3J7AO 2B7EA 3L2RA 3PJRA 4XORA 5FLMJ 1S7EA 4QSHA 5K1YA 5FB2A 5BS6A 2R7ZJ 2TCTA 4KIFA 2GA1A 4ZYEA 3G1MA 5DCMA 3HSEA 1MBGA 4HNTA 5B1AH 3S3OA 4DJAA 2FOWA 1H9GA 3AG4H 2NVTJ 5E3OA 3HBLA 2AQFA 3DXJF 1WH7A 3GBGA 3K4KA 3H35A 5HLGA 3ZGKA 3HTUA 1BI0A 3K4CA 3P7NA 3J7ZI 3CQZJ 2E71A 4ZYGA 1MJ9A 2L9SA 3ABLH 5D6FA 3LMMA 4N4OB 3OYCA 4KN4X 2JA6J 2BVLA 1KU9A 3DTKA 3CD6I 2DFFA 1I3AA 3PQKA 2R7OA 1IF1A 2IT0A 1UMQA 4MEXF 3I4NJ 5LD2C 3CC2I 3F6OA 4QWQA 3GX4X 2DA6A 3SZTA 2BOLA 2LK2A 3I59B 1SVOA 1VZ0A 1TC3C 2LBFA 1T8IA 2FNPA 4GDFA 3WGHA 3K4MA 4NC6A 2ZJRF 3KLNA 2VJJA 3QYEA 4E7HA 4DYCA 3CCRI 2F2EA 2M34A 3L2VA 3S1RJ 1W5SA 3CCVI 1RZ4A 2MFZA 2TDXA 3F22A 1S29A 1REPC 3E1SA 2F5DA 2GIZA 3HM5A 1ZR4A 2P7CB 3A2KA 1I27A 3BPVA 4Y33A 4MTDA 1IRZA 2XAQA 1HDPA 2O8XA 4OINF 1MJBA 4GFBA 2GA2A 5D8KB 1S6LA 2COMA 5E3LA 5E8GA 5F04A 2GOXB 1KYWA 4HOBA 4F52A 2M4KA 1AKHA 1MH4A 5L3FA 1BOAA 3L2WA 5F1RA 1W7PD 2RVCA 3HRSA 4MO7A 2A5WA 4U0YA 1HLVA 4AM3A 4BJ5C 5IOYA 2LFBA 4BJ6C 5E1WA 1ITYA 2I8DA 4EGYA 4LD5A 2R5YA 2JRMA 2KJCA 3HGYA 2JJ7A 3TO9A 4L0YB 2VKDA 2VC1A 2QYOA 4L5JA 3BCAA 4IEJA 2W84A 4Q5SF 2DO7A 5IY5H 1IUFA 4LK1F 2JVGA 2MC4A 3FX3A 3KCCA 3K4BA 3ZOBA 1Y8RB 1ON1A 1BI3A 5FKOA 1JE8A 3W6VA 3H36A 4UNOA 5E3NA 3FHZA 2HVSA 4FX4A 4A0XA 2QSGX 4IHXA 3QYBA 3G6EI 4MIMA 1JHHA 5HDNA 4HAMA 4F91B 3OY9A 1QRYA 3FIWA 2XSDC 4OOIA 5KCMA 5LGTA 1I50J 2M87A 4W1UA 5JHFA 2NRAC 2DW4A 1YW7A 2ZXIA 4W97A 3EPZA 4HLXA 3GXOA 1IN4A 2O5RA 4CCNA 1PUFA 2XDVA 2ACJA 4ZDOA 2CUJA 1KA8A 2KZGA 4HX4A 3ZN0A 1MD0A 4B4CA 1Y1WJ 2MG4A 3FXRA 3DEUA 4WX9A 1U5TC 1XX5A 1YITI 3B02A 5DUIA 1H89C 2G0EA 4DNCA 4BE2A 2RREA 3HTSB 4PSXA 2HKXA 2LNBA 3QU3A 2X6YA 5HDGA 1ZRFA 3VYSB 2FSWA 2JN6A 1MNDA 2YPRA 3ECHA 4G8XA 3LSTA 4A3GJ 2OBPA 2ZNZA 3P9KA 1FMVA 4XBFA 5CVIA 2F5EA 5LFAA 3LNQA 1W7PB 1KGSA 1Z1DA 3OL4A 2XASA 5LGNA 1J59A 2HTSA 2OPTA 5LEKA 2W57A 4XONA 1K4SA 1B6AA 3NWTA 4HYEA 5J1RA 1E3PA 3VSKA 2OC6A 1USTA 3OS1A 3JAMK 1KU3A 4RLQA 2QQ9A 3F0CA 4XQFA 2K9NA 3B6CA 3J81Z 1MSFC 1ZLJA 1W5CC 2EV5A 4L9NA 4OMZA 3BG6A 2E1CA 1P4AA 2ZSHB 2ME0A 3F8BA 4A6DA 2EK5A 3PSFA 3KP2A 2Q2EA 1S7AA 5D5VB 1VF9A 3CC7I 3NARA 1R00A 3SDBA 2P8TA 3FM5A 4EM0B 2M7BA 2Y48A 2J5OA 2PJPA 1R22A 1W5TA 1APLC 1SANA 3JRDA 1X3UA 4A3IJ 3LSMA 1FYKA 2PX9A 3U9GA 3PQJA 2PJRA 1QZEA 2K40A 2D5VA 4BJTA 2LF7A
chains in the Genus database with same CATH topology
5K5QA 2OZUA 4A5NA 1QO0D 2QLZA 2VC0A 3GO5A 1UCRA 2PI0A 3VFZA 4BQAA 1ZN2A 3CDHA 1TTYA 2EFNA 3M9AA 1O7FA 5LLQA 5LEJA 2H6CA 4HZFA 1K78A 2EFOA 4A0ZA 3SFZA 3J80K 1DP7P 4KMUX 2BEOA 1PP7U 3HOSA 4CDGA 3W6JB 1IXCA 1F1ZA 1QPMA 2CGPA 1BIBA 2VBYA 5FD6A 4ZH4F 4WXHA 3BWGA 2CSOA 3BPXA 4I09A 4KNYA 2PFBA 3QPHA 2F5CA 2HEOA 1FY7A 3IWZA 4I7HA 4BAYA 1Z9CA 5H6QA 5CVJA 4O3MA 3OV8A 4LGWA 1SFXA 5D6EA 1FP1D 1SD5A 2CO5A 3FXUA 4ON0A 1BC8C 3SQNA 4P9UA 2OA4A 3CUQA 3ZN1A 3BY6A 5J6XA 1FC3A 2XKPA 4BHCA 5DDGA 3D5LA 3RKXA 1YYVA 5CLSA 4NQWA 1R5GA 2CW0F 3GFIA 1H9TA 4GO1A 3SXYA 2JSCA 1MGTA 1HKQA 1XD7A 3K2ZA 1SD7A 3RKYA 2HR3A 1A04A 3CLOA 5FFXA 2MH9A 4YFNF 3KEQA 1B9MA 3M8FA 1DUXC 4AVPA 3BJ6A 3ZMUA 4F7ZA 3TO6A 4HQEA 3HRTA 2V1XA 1P92A 1ZAOA 2QBYA 1IN5A 1OR7A 2ADUA 4EJOA 5TJJA 2RQPA 2GZWA 3LQQA 2ZO4A 1K79A 3WTZA 3V7CA 5ERIA 5HS8A 5JVTA 4TV7A 3DKWA 5FGMA 1FSEA 5L3BA 3BZ6A 1ON2A 3GFJA 4LG0B 2IJLA 3HUGA 4EM1A 3VB2A 1KQ0A 4CXFA 4DQ2A 2IA0A 4CO8A 2DK5A 2XHKA 2DPUA 3L9FA 1G6NA 1ZRDA 3LAPA 3E6BA 5BOXA 1RIOH 2LDUA 3K69A 2Y0MA 2Z99A 1NHAA 5D8LB 1FBUA 1L3LA 5FLXZ 2XIGA 3RJPA 4OMYA 3FMSA 2VBWA 2JZYA 1ZGJA 4BH9A 2LSOA 4S05A 1T0FA 2VN2A 2DPDA 3ZMVA 2MH2A 4P5OA 1U5TB 1XB4A 5L3GA 3L00A 3F21A 4CHUA 1HXDA 3BP8A 3TOAA 3ROUA 2K4JA 3LQRA 3ZQ7A 2FBKA 4G9YA 4ZYDA 2YX7A 1R5HA 3NQOA 2UXNA 2O03A 2VE8A 3I0TA 2CFXA 4HDUA 1SFUA 1YS6A 2FMYA 3F8FA 3FM3A 2BE5F 2FA5A 3COAC 2G7HA 2R7FA 4RB1A 1P2FA 2L01A 1ZH5A 5AIQA 2OQRA 3KP3A 5F64A 3KFWX 3R61A 5ILSA 4UVAA 2EWNA 1FP2A 1P4WA 3V8JA 3ZPLA 1S7OA 2HS5A 3HHGA 4M72A 1Z6RA 5LHGA 4G94A 2L54A 1Z05A 2P4WA 1WI9A 5CVRA 5E20A 1TQMA 1O57A 4N0BA 3I53A 1HBXG 1IUYA 3VODA 3E5XA 4OIQF 5CJ9A 2MD5A 1QNTA 1LJ9A 1YTYA 2IA2A 4LB5A 5EEGA 2JRTA 3DP7A 3AAFA 1J75A 1W4MA 1IN8A 3IRQA 1YW9A 3L7WA 3LAJA 2RKHA 2GQQA 2L3DA 1HW2A 4LFUA 5LBQA 3ERED 1G3WA 2FXAA 2LF8A 3NEUA 3KEOA 3G73A 4KIBA 5EEHA 1D3YA 2R7DA 3ZMTA 4WF2A 1TNTA 3NRVA 4ENMA 2MBFA 4UV8A 4U0WA 1HKTA 2NS0A 1ONVA 3CJNA 2GXGA 4KMFA 4G6QA 2EB7A 4M6XA 1IRFA 1J9IA 3EDPA 1IN7A 4LK0F 3KZZA 4HW0A 2K4BA 3WU0A 1EV7A 4FT8A 3WTWC 6PAXA 1XDUA 2HYFA 1XDSA 3MWMA 4PCQA 3RYPA 2IRFG 2B0LA 2FOKA 2MLKA 1V3FA 1MDMA 1V4RA 2MC3A 1FPQA 1XCVA 1PDNC 1PUEE 3J81K 1XSVA 2P7VB 4S04A 2STTA 3VEPA 3V7RA 1B1BA 1ULYA 1IXSB 2V1DA 2BBYA 3T1BA 1FSHA 4RAYA 1S3JA 2H27A 5H6RA 2QQBA 2XUBA 3LA3A 2E7XA 3DPTA 2O6GE 2J5PA 3T5XA 1RUNA 1MZBA 3Q5FA 5E17F 4MQ9F 4WCGA 2A07F 1J0RA 1YLFA 2WWYA 2HWVA 4N9HA 2IP2A 2XRNA 4HF2A 3TOBA 1EH7A 1BM9A 1H0MA 2FNAA 5HVQC 3E6DA 2QZ8A 1XSXA 1YIOA 1ZYRF 3EYYA 3SZPA 3DFGA 1OYIA 5ICEA 4KUMA 2PG4A 1E17A 3F72A 4RAZA 2D2WA 2A6EF 5DEQA 3QRFF 4XSZF 4L5IA 3WTVC 1U8RA 1WRJA 5DCMB 3CUQC 1D8JA 1E2XA 4IPAA 4UVCA 1GXPA 1F4KA 3MZHA 3E3VA 4RGXA 4Q47A 1CF7A 1OKRA 1DPRA 5J8FA 4IXAA 1KQ9A 4RB3C 5JHUA 1BIAA 4FHTA 3K1NA 3WTXC 1HSJA 5L3CA 1OMIA 4CICA 1DPUA 4AWXB 2EA2A 2HDCA 2YU3A 4I02A 1HW1A 3RDIA 1ZG5A 4HX7A 1XN7A 2QENA 4AIHA 5HDKA 2DU9A 4FX0A 1LB2A 3V8KA 1FNNA 4U88A 4KICA 1UHMA 4G6DA 1Z7UA 2O0YA 2GWRA 1D8KA 3WTSC 3WG9A 4U7DA 4M9XA 3HYIA 4BXUA 4IHTA 4ASNA 4MQVA 3ABTA 3RYRA 1T38A 4M6YA 2VBXA 4ENKA 4YFXF 5DYMA 5FO5A 3ZMDA 1MKMA 2EJRA 4B09A 3TGNA 1R23A 4I0AA 3HHHA 3BROA 5JR3A 3JW4A 1U6GA 2FF4A 3DV8A 1UFMA 5LRSA 1R1VA 2R3SA 4HV6A 4BYYA 1LDDA 4OU0A 3QOPA 4UUVA 2H09A 4L9JA 5E1XA 4LLGF 2ISYA 5TRDA 2FQ3A 4EMSA 5K5RA 5FLXK 4EJWA 1KU7A 3ISPA 5BMZA 4UXNA 1JXSA 1I1SA 1YG2A 1U3EM 4P9FA 2ZKZA 3ABUA 1DDNA 2A5YB 5JFRA 3I54A 3JTGA 4RS8A 3K1PA 2VODA 4D0PA 2A6HF 3F8CA 2CG4A 1J5YA 1U5TA 2LKPA 1GVJA 1BN5A 2YSRA 1QQIA 3GUDA 1J2XA 2X4HA 1BI2A 3CO6C 2JT1A 2IPQX 2EFWA 2P6TA 1RI7A 2DBBA 5CVUA 5ICCA 3IWFA 3O6BB 4GCVA 3CUOA 2DAOA 2ETHA 2FBHA 1WKMA 1Q1HA 1IAWA 1KYZA 1IRGA 3E5UA 2HGCA 2Z3YA 3K0LA 4EJVA 2PN6A 2ZMEA 3GEZA 3RTRA 5JI6A 2Q0OA 2L4AA 2C6YA 3TKYA 2XV4S 4RB0A 2VT3A 4U7BA 2IVMA 3R0JA 3S2WA 3QAHA 3C7JA 2M5WA 4JBAA 2QQAA 1R1TA 4UV9A 3K9TA 3GW2A 4XSXF 3HOTA 3ELKA 2DT5A 3R60A 5DUKA 1K78B 2Q8KA 2RN7A 3FMQA 3L2CA 1AOYA 3WE2A 2A61A 2YR2A 2P5KA 5D4SA 2PBIA 1F5TA 4ZYHA 4Q48A 1F9NA 2KJBA 3HSFA 1XCBA 4ESBA 3EUHA 4YIIA 4IRHA 3ECOA 2FRHA 2HKOA 1T39A 3I71A 4WWCA 4AD9A 3ULQB 4L18B 1LEAA 3CUQB 2Y75A 2PMUA 1G3YA 2L02A 2OQGA 4L0ZB 4GYGA 2BGCA 5H20A 2HZTA 4XRFA 1T98A 1O3SA 2V1UA 1Z6TA 2FMLA 2KIMA 1LEBA 3VOEA 3TDZC 3F8NA 4RGUA 1B9NA 4CZZA 1FT9A 3WTUC 4KFCA 1Y0UA 4IRIA 4ESFA 1STZA 4BHBA 4G7OF 4I01A 4KYWA 3BJOA 3GFLA 4I0BA 2W25A 2ZNYA 3MAJA 2F5FA 1O3QA 5ILVA 3I59A 1P6RA 2FEZA 2M8EA 2UXXA 3M7GA 3IKVA 4IRGA 5DD4A 3MFKA 1QZZA 2W85A 3ZMZA 4A0YA 5LHHA 2M1BA 2ESHA 4UHTA 4AIJA 3R0AA 3V4GA 1R58A 2XGXA 1TW3A 3I5UA 1USSA 5D5UB 4IF4A 1R7JA 2FBIA 2XAGA 4CYDA 2GIVA 2VOOA 4A5MA 2ZFWA 3C18A 3LA2A 4LLLA 3GYHX 2AXLA 5HLHA 3C1DA 5D5WB 2BYVE 3GF2A 2K27A 5IT3A 3E6CC 1IN6A 4A6EA 1ODDA 3B73A 2HTJA 3IHUA 4I2OA 1LVAA 1FZPB 2G9WA 1J7KA 4BHPA 3FWEA 4KDPA 1XMAA 4EM2A 2WTEA 3T0YA 2CWEA 2XROA 2XAHA 4HF0A 2UZKA 4BNCA 3FMRA 1PP8F 5IT9Z 1I6XA 4LB6B 3IC7A 1K6OA 3P9CA 4B8XA 2DI3A 4Q4ZF 4GYIA 4R8HA 1CGPA 2E1NA 4HDVA 2A68F 1TW2A 2ESNA 1JHFA 2XAJA 4IJAA 2PLYA 1BC7C 2D45A 2MA3A 3WTYC 5AIPA 3LWFA 2ZJ2A 3REOA 2K02A 5K5OA 1ZREA 1S8NA 3I4PA 4LJZF 2VONA 1JGSA 1W7PA 2HQNA 3RPUA 3DF8A 4AIKA 1IZ1A 4O6JA 3HRUA 2VT2A 4Y17A 3GZ5A 4YG2F 2PQ8A 4M73A 2RNJA 3QPTA 4WK8F 1I1GA 1SMYF 2VXZA 4EVIA 3SHFA 3V8LA 2P6SA 5ED4A 2V79A 4PGHA 3T8RA 2NAZA 5E8IA 5KVRA 2XAFA 3GLXA 1R36A 1WWXA 3LA7A 1FYMA 4WXCA 4ZZDA 3KP7A 5BQTA 1UB9A 2KIUA 5E18F 5BPIA 4MEYF 1LNWA 1TQPA 3QU6A 2KKOA 5KK1A 4IHSA 4KT5C 4YFKF 1KQ8A 2A3SA 1GHCA 4M71A 1EH6A 3F6VA 1XSDA 1QGPA 3TQNA 4YIFA 1R1UA 2D1VA 2DQRA 4M9SA 3KLOA 3ZMSA 1YS7A 2O3FA 3O3KA 2QVOA 5A2QZ 3JTHA 2CYYA 1FBQA 2XKOA 3KZYA 4G7HF 3GFMA 2EA4A 4MTEA 4ETSA 3IRRA 5CVVA 1B4AA 3U1DA 4Z2YA 1HW5A 2QWWA 4KA4A 1FX7A 2JPBA 3ML6A 5CYVA 3I58A 3TDUC 4U0VA 1P4XA 2PEXA 4ENNA 3K1MA 1TBXA 2H6BA 1XGOA 3E5QA 3OOPA 1C0WA 2O61A 3Q9VA 1XGSA 1LDJA 4IVNA 2FU4A 1MDMB 4L9TA 1SMTA 2OAZA 3WE3A 3W6KB 1UHWA 1QZYA 2W24A 1U2WA 1D5VA 5LHIA 5ICGA 3RIRA 1T6SA 2Z33A 4KIGA 5D5XB 2GAUA 2IW5A 3R4KA 1HKSA 1U78A 3E6MA 2Z9OA 5HLIA 4E70A 2NNYA 2HYGD 3RI4A 5L3EA 5ICFA 3HRMA 2EFQA 2CQKA 4MGRA 3FXQA 1VTNC 1TQIA 1OPCA 1G4DA 1B59A 4OIPF 2K7LA 2YX4A 4HX8A 5LRRA 2ZCWA 1SFEA 3N4MA 1FBSA 3GWZA 4LG0A 3CTAA 4R79A 1AWCA 2STWA 1L0OC 2H94A 3M8EA 2EV0A 2ZXJA 2NYXA 1BI1A 2M30A 1YW8A 4OIOF 2ISZA 1XGNA 3KP5A 3C3WA 5ILUA 4EJUA 1ZG3A 1FLIA 1O7LA 5DV5A 3MEXA 2RV8A 3CO7C 4P55A 4WXDA 3U2RA 3LFKA 3G3ZA 2L4MA 2M45A 1ZARA 5F6FA 2JTVA 4PZJA 2MLGA 3WU1B 1O3TA 4LMYA 3WTTC 5DCFA 3T8TA 4R1HA 3Q9SA 4EJTA 2VE9A 1TNSA 1SAXA 1HQCA 1CF7B 3HSRA 4Y13A 2D1HA 3H92A 3TO7A 1OYWA 2OU2A 3RKWA 2NNNA 1EH8A 1SD6A 2Z5UA 4KN7X 3JAMZ 1K7AA 2XVCA 4HA8A 2E7WA 2RDPA 4JQFA 1O3RA 4NB5A 2KIFA 5AONA 1BBYA 1I5ZA 4RGSA 3I64A 2ZBKA 1BJAA 2OZ6A 1Z91A 3H3UA 2VBZA 2V6CA 3BDDA 4UVBA 5HOOA 4RB2C 2EFPA 4G7ZF 4HF1A 5J8CA 3KETA 4GXOA 2WC2A 3IL2A 3GZ6A 4K2EA 3EYIA 1ZG1A 3BOQA 3J80Z 1FWZA 2DQLA 3WGIA 5D4RA 3E97A 2DFIA 1G3SA 2RGVA 3F23A 2HOEA 3IKTA 2IA1A 4A12A 1QBJA 3KP6A 2P5LC 3BJAA 3RPQA 2G7UA 1LQ1A 3GVAA 1ZLKA 1SD4A 2V9VA 3EQLF 4HV5A 1T2KA 2P5VA 3N97A 1G3TA 2OD5A 3R6SA 1IW7F 2RC4A 5IT9K 2WV0A 2DTRA 3KE2A 1XGMA 2PMHA 2FE3A 3JSPA 4RGRA 3M1EA 2X0LA 4HBLA 5HS7A 4MHGA 5L3DA 4HLYA 1RUOA 3WODF 5FFZA 3D0SA 4ZZLA 3DQVC 3L09A 1ZGAA 4GGGA 3MCZA 4M74A 5E1ZB 2VOPA 4EQQA 3V7SA 2K86A 2QBYB 4JK1X 5LGUA 1HSTA 2DK8A 4EGZA 2AS5F 2ZMEB 1LDKB 3HIFA 4HQMA 4OIRF 3ZP5A 3QP5A 1XMKA 3JSOA 4QLCU 4MNUA 1RNLA 4Y15A 3O2PE 1IXRC 2JPCA 3H3ZA 4NHJA 2DLLA 4A2UA 1WQ2A 4XLNF 4XLPF 4CGZA 4N9IA 3QP6A 4I98B 1MJAA 1FYLA 2EV6A 4O5VA 1YFHA 5HS9A 2HQRA 1ZRCA 5FD5A 3MZYA 2HFHA 3KP4A 5DD8A 1TLHB 3DPLC 3PFIA 2GXBA 4LLNA 4H0EA 4ESJA 4EV0A 1KU2A 3EETA 3P9IA 3MQ0A 1FOKA 4M9ZA 1GXQA 1WSUA 1YO5C 4ENJA 3F3XA 4L9VA 1ZHFA 3FF5A 4PDKA 5A2QK 2BV6A 2QM3A 1YQAA 2KRFA 2A69F 1OYYA 2UWMA 4P96A 2ELHA 3F8MA 4PGGA 5BPDA 3WGGA 3FZVA 2QUFA 3J7AO 5K1YA 5FB2A 5BS6A 4KIFA 2GA1A 4ZYEA 5DCMA 3HSEA 1H9GA 3DXJF 5HLGA 3HTUA 1BI0A 3P7NA 4ZYGA 1MJ9A 5D6FA 4KN4X 1KU9A 3PQKA 1IF1A 2IT0A 4MEXF 3F6OA 4QWQA 3SZTA 3I59B 2FNPA 3WGHA 3KLNA 2F2EA 1W5SA 1RZ4A 2TDXA 3F22A 1S29A 1REPC 2F5DA 2P7CB 1I27A 3BPVA 4MTDA 2XAQA 2O8XA 4OINF 1MJBA 2GA2A 5D8KB 1S6LA 2COMA 5E8GA 1KYWA 4HOBA 5L3FA 1BOAA 5F1RA 1W7PD 2RVCA 3HRSA 4U0YA 5E1WA 4EGYA 4LD5A 2KJCA 3TO9A 4L0YB 2VC1A 2QYOA 4L5JA 2W84A 4Q5SF 2DO7A 4LK1F 3FX3A 3KCCA 1ON1A 1BI3A 1JE8A 4UNOA 3FHZA 4FX4A 4A0XA 1JHHA 5HDNA 4HAMA 4OOIA 5LGTA 2M87A 2NRAC 2DW4A 1YW7A 4HLXA 3GXOA 1IN4A 2ACJA 4HX4A 1KA8A 3ZN0A 1MD0A 3FXRA 3DEUA 4WX9A 1U5TC 3B02A 5DUIA 4DNCA 3HTSB 2HKXA 2LNBA 3QU3A 5HDGA 1ZRFA 2FSWA 2YPRA 3ECHA 4G8XA 3LSTA 2OBPA 2ZNZA 3P9KA 4XBFA 5CVIA 2F5EA 1W7PB 1KGSA 1Z1DA 5LGNA 2XASA 1J59A 2HTSA 5LEKA 2W57A 1B6AA 4HYEA 1USTA 3JAMK 1KU3A 2QQ9A 3J81Z 1ZLJA 2EV5A 4L9NA 4OMZA 2E1CA 1P4AA 3F8BA 4A6DA 2EK5A 3KP2A 2Q2EA 1S7AA 5D5VB 1R00A 4EM0B 2P8TA 3FM5A 2Y48A 2J5OA 2PJPA 1R22A 1W5TA 1X3UA 1FYKA 3U9GA 3PQJA 3GX4X 2LF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5Q A;  2OZU A;  4A5N A;  1QO0 D;  2QLZ A;  2VC0 A;  3GO5 A;  1UCR A;  2PI0 A;  3VFZ A;  4BQA A;  1ZN2 A;  3CDH A;  1TTY A;  2EFN A;  3M9A A;  1O7F A;  5LLQ A;  5LEJ A;  2H6C A;  4HZF A;  1K78 A;  2EFO A;  4A0Z A;  3SFZ A;  3J80 K;  1DP7 P;  4KMU X;  2BEO A;  1PP7 U;  3HOS A;  4CDG A;  3W6J B;  1IXC A;  1F1Z A;  1QPM A;  2CGP A;  1BIB A;  2VBY A;  5FD6 A;  4ZH4 F;  4WXH A;  3BWG A;  2CSO A;  3BPX A;  4I09 A;  4KNY A;  2PFB A;  3QPH A;  2F5C A;  2HEO A;  1FY7 A;  3IWZ A;  4I7H A;  4BAY A;  1Z9C A;  5H6Q A;  5CVJ A;  4O3M A;  3OV8 A;  4LGW A;  1SFX A;  5D6E A;  1FP1 D;  1SD5 A;  2CO5 A;  3FXU A;  4ON0 A;  1BC8 C;  3SQN A;  4P9U A;  2OA4 A;  3CUQ A;  3ZN1 A;  3BY6 A;  5J6X A;  1FC3 A;  2XKP A;  4BHC A;  5DDG A;  3D5L A;  3RKX A;  1YYV A;  5CLS A;  4NQW A;  1R5G A;  2CW0 F;  3GFI A;  1H9T A;  4GO1 A;  3SXY A;  2JSC A;  1MGT A;  1HKQ A;  1XD7 A;  3K2Z A;  1SD7 A;  3RKY A;  2HR3 A;  1A04 A;  3CLO A;  5FFX A;  2MH9 A;  4YFN F;  3KEQ A;  1B9M A;  3M8F A;  1DUX C;  4AVP A;  3BJ6 A;  3ZMU A;  4F7Z A;  3TO6 A;  4HQE A;  3HRT A;  2V1X A;  1P92 A;  1ZAO A;  2QBY A;  1IN5 A;  1OR7 A;  2ADU A;  4EJO A;  5TJJ A;  2RQP A;  2GZW A;  3LQQ A;  2ZO4 A;  1K79 A;  3WTZ A;  3V7C A;  5ERI A;  5HS8 A;  5JVT A;  4TV7 A;  3DKW A;  5FGM A;  1FSE A;  5L3B A;  3BZ6 A;  1ON2 A;  3GFJ A;  4LG0 B;  2IJL A;  3HUG A;  4EM1 A;  3VB2 A;  1KQ0 A;  4CXF A;  4DQ2 A;  2IA0 A;  4CO8 A;  2DK5 A;  2XHK A;  2DPU A;  3L9F A;  1G6N A;  1ZRD A;  3LAP A;  3E6B A;  5BOX A;  1RIO H;  2LDU A;  3K69 A;  2Y0M A;  2Z99 A;  1NHA A;  5D8L B;  1FBU A;  1L3L A;  5FLX Z;  2XIG A;  3RJP A;  4OMY A;  3FMS A;  2VBW A;  2JZY A;  1ZGJ A;  4BH9 A;  2LSO A;  4S05 A;  1T0F A;  2VN2 A;  2DPD A;  3ZMV A;  2MH2 A;  4P5O A;  1U5T B;  1XB4 A;  5L3G A;  3L00 A;  3F21 A;  4CHU A;  1HXD A;  3BP8 A;  3TOA A;  3ROU A;  2K4J A;  3LQR A;  3ZQ7 A;  2FBK A;  4G9Y A;  4ZYD A;  2YX7 A;  1R5H A;  3NQO A;  2UXN A;  2O03 A;  2VE8 A;  3I0T A;  2CFX A;  4HDU A;  1SFU A;  1YS6 A;  2FMY A;  3F8F A;  3FM3 A;  2BE5 F;  2FA5 A;  3COA C;  2G7H A;  2R7F A;  4RB1 A;  1P2F A;  2L01 A;  1ZH5 A;  5AIQ A;  2OQR A;  3KP3 A;  5F64 A;  3KFW X;  3R61 A;  5ILS A;  4UVA A;  2EWN A;  1FP2 A;  1P4W A;  3V8J A;  3ZPL A;  1S7O A;  2HS5 A;  3HHG A;  4M72 A;  1Z6R A;  5LHG A;  4G94 A;  2L54 A;  1Z05 A;  2P4W A;  1WI9 A;  5CVR A;  5E20 A;  1TQM A;  1O57 A;  4N0B A;  3I53 A;  1HBX G;  1IUY A;  3VOD A;  3E5X A;  4OIQ F;  5CJ9 A;  2MD5 A;  1QNT A;  1LJ9 A;  1YTY A;  2IA2 A;  4LB5 A;  5EEG A;  2JRT A;  3DP7 A;  3AAF A;  1J75 A;  1W4M A;  1IN8 A;  3IRQ A;  1YW9 A;  3L7W A;  3LAJ A;  2RKH A;  2GQQ A;  2L3D A;  1HW2 A;  4LFU A;  5LBQ A;  3ERE D;  1G3W A;  2FXA A;  2LF8 A;  3NEU A;  3KEO A;  3G73 A;  4KIB A;  5EEH A;  1D3Y A;  2R7D A;  3ZMT A;  4WF2 A;  1TNT A;  3NRV A;  4ENM A;  2MBF A;  4UV8 A;  4U0W A;  1HKT A;  2NS0 A;  1ONV A;  3CJN A;  2GXG A;  4KMF A;  4G6Q A;  2EB7 A;  4M6X A;  1IRF A;  1J9I A;  3EDP A;  1IN7 A;  4LK0 F;  3KZZ A;  4HW0 A;  2K4B A;  3WU0 A;  1EV7 A;  4FT8 A;  3WTW C;  6PAX A;  1XDU A;  2HYF A;  1XDS A;  3MWM A;  4PCQ A;  3RYP A;  2IRF G;  2B0L A;  2FOK A;  2MLK A;  1V3F A;  1MDM A;  1V4R A;  2MC3 A;  1FPQ A;  1XCV A;  1PDN C;  1PUE E;  3J81 K;  1XSV A;  2P7V B;  4S04 A;  2STT A;  3VEP A;  3V7R A;  1B1B A;  1ULY A;  1IXS B;  2V1D A;  2BBY A;  3T1B A;  1FSH A;  4RAY A;  1S3J A;  2H27 A;  5H6R A;  2QQB A;  2XUB A;  3LA3 A;  2E7X A;  3DPT A;  2O6G E;  2J5P A;  3T5X A;  1RUN A;  1MZB A;  3Q5F A;  5E17 F;  4MQ9 F;  4WCG A;  2A07 F;  1J0R A;  1YLF A;  2WWY A;  2HWV A;  4N9H A;  2IP2 A;  2XRN A;  4HF2 A;  3TOB A;  1EH7 A;  1BM9 A;  1H0M A;  2FNA A;  5HVQ C;  3E6D A;  2QZ8 A;  1XSX A;  1YIO A;  1ZYR F;  3EYY A;  3SZP A;  3DFG A;  1OYI A;  5ICE A;  4KUM A;  2PG4 A;  1E17 A;  3F72 A;  4RAZ A;  2D2W A;  2A6E F;  5DEQ A;  3QRF F;  4XSZ F;  4L5I A;  3WTV C;  1U8R A;  1WRJ A;  5DCM B;  3CUQ C;  1D8J A;  1E2X A;  4IPA A;  4UVC A;  1GXP A;  1F4K A;  3MZH A;  3E3V A;  4RGX A;  4Q47 A;  1CF7 A;  1OKR A;  1DPR A;  5J8F A;  4IXA A;  1KQ9 A;  4RB3 C;  5JHU A;  1BIA A;  4FHT A;  3K1N A;  3WTX C;  1HSJ A;  5L3C A;  1OMI A;  4CIC A;  1DPU A;  4AWX B;  2EA2 A;  2HDC A;  2YU3 A;  4I02 A;  1HW1 A;  3RDI A;  1ZG5 A;  4HX7 A;  1XN7 A;  2QEN A;  4AIH A;  5HDK A;  2DU9 A;  4FX0 A;  1LB2 A;  3V8K A;  1FNN A;  4U88 A;  4KIC A;  1UHM A;  4G6D A;  1Z7U A;  2O0Y A;  2GWR A;  1D8K A;  3WTS C;  3WG9 A;  4U7D A;  4M9X A;  3HYI A;  4BXU A;  4IHT A;  4ASN A;  4MQV A;  3ABT A;  3RYR A;  1T38 A;  4M6Y A;  2VBX A;  4ENK A;  4YFX F;  5DYM A;  5FO5 A;  3ZMD A;  1MKM A;  2EJR A;  4B09 A;  3TGN A;  1R23 A;  4I0A A;  3HHH A;  3BRO A;  5JR3 A;  3JW4 A;  1U6G A;  2FF4 A;  3DV8 A;  1UFM A;  5LRS A;  1R1V A;  2R3S A;  4HV6 A;  4BYY A;  1LDD A;  4OU0 A;  3QOP A;  4UUV A;  2H09 A;  4L9J A;  5E1X A;  4LLG F;  2ISY A;  5TRD A;  2FQ3 A;  4EMS A;  5K5R A;  5FLX K;  4EJW A;  1KU7 A;  3ISP A;  5BMZ A;  4UXN A;  1JXS A;  1I1S A;  1YG2 A;  1U3E M;  4P9F A;  2ZKZ A;  3ABU A;  1DDN A;  2A5Y B;  5JFR A;  3I54 A;  3JTG A;  4RS8 A;  3K1P A;  2VOD A;  4D0P A;  2A6H F;  3F8C A;  2CG4 A;  1J5Y A;  1U5T A;  2LKP A;  1GVJ A;  1BN5 A;  2YSR A;  1QQI A;  3GUD A;  1J2X A;  2X4H A;  1BI2 A;  3CO6 C;  2JT1 A;  2IPQ X;  2EFW A;  2P6T A;  1RI7 A;  2DBB A;  5CVU A;  5ICC A;  3IWF A;  3O6B B;  4GCV A;  3CUO A;  2DAO A;  2ETH A;  2FBH A;  1WKM A;  1Q1H A;  1IAW A;  1KYZ A;  1IRG A;  3E5U A;  2HGC A;  2Z3Y A;  3K0L A;  4EJV A;  2PN6 A;  2ZME A;  3GEZ A;  3RTR A;  5JI6 A;  2Q0O A;  2L4A A;  2C6Y A;  3TKY A;  2XV4 S;  4RB0 A;  2VT3 A;  4U7B A;  2IVM A;  3R0J A;  3S2W A;  3QAH A;  3C7J A;  2M5W A;  4JBA A;  2QQA A;  1R1T A;  4UV9 A;  3K9T A;  3GW2 A;  4XSX F;  3HOT A;  3ELK A;  2DT5 A;  3R60 A;  5DUK A;  1K78 B;  2Q8K A;  2RN7 A;  3FMQ A;  3L2C A;  1AOY A;  3WE2 A;  2A61 A;  2YR2 A;  2P5K A;  5D4S A;  2PBI A;  1F5T A;  4ZYH A;  4Q48 A;  1F9N A;  2KJB A;  3HSF A;  1XCB A;  4ESB A;  3EUH A;  4YII A;  4IRH A;  3ECO A;  2FRH A;  2HKO A;  1T39 A;  3I71 A;  4WWC A;  4AD9 A;  3ULQ B;  4L18 B;  1LEA A;  3CUQ B;  2Y75 A;  2PMU A;  1G3Y A;  2L02 A;  2OQG A;  4L0Z B;  4GYG A;  2BGC A;  5H20 A;  2HZT A;  4XRF A;  1T98 A;  1O3S A;  2V1U A;  1Z6T A;  2FML A;  2KIM A;  1LEB A;  3VOE A;  3TDZ C;  3F8N A;  4RGU A;  1B9N A;  4CZZ A;  1FT9 A;  3WTU C;  4KFC A;  1Y0U A;  4IRI A;  4ESF A;  1STZ A;  4BHB A;  4G7O F;  4I01 A;  4KYW A;  3BJO A;  3GFL A;  4I0B A;  2W25 A;  2ZNY A;  3MAJ A;  2F5F A;  1O3Q A;  5ILV A;  3I59 A;  1P6R A;  2FEZ A;  2M8E A;  2UXX A;  3M7G A;  3IKV A;  4IRG A;  5DD4 A;  3MFK A;  1QZZ A;  2W85 A;  3ZMZ A;  4A0Y A;  5LHH A;  2M1B A;  2ESH A;  4UHT A;  4AIJ A;  3R0A A;  3V4G A;  1R58 A;  2XGX A;  1TW3 A;  3I5U A;  1USS A;  5D5U B;  4IF4 A;  1R7J A;  2FBI A;  2XAG A;  4CYD A;  2GIV A;  2VOO A;  4A5M A;  2ZFW A;  3C18 A;  3LA2 A;  4LLL A;  3GYH X;  2AXL A;  5HLH A;  3C1D A;  5D5W B;  2BYV E;  3GF2 A;  2K27 A;  5IT3 A;  3E6C C;  1IN6 A;  4A6E A;  1ODD A;  3B73 A;  2HTJ A;  3IHU A;  4I2O A;  1LVA A;  1FZP B;  2G9W A;  1J7K A;  4BHP A;  3FWE A;  4KDP A;  1XMA A;  4EM2 A;  2WTE A;  3T0Y A;  2CWE A;  2XRO A;  2XAH A;  4HF0 A;  2UZK A;  4BNC A;  3FMR A;  1PP8 F;  5IT9 Z;  1I6X A;  4LB6 B;  3IC7 A;  1K6O A;  3P9C A;  4B8X A;  2DI3 A;  4Q4Z F;  4GYI A;  4R8H A;  1CGP A;  2E1N A;  4HDV A;  2A68 F;  1TW2 A;  2ESN A;  1JHF A;  2XAJ A;  4IJA A;  2PLY A;  1BC7 C;  2D45 A;  2MA3 A;  3WTY C;  5AIP A;  3LWF A;  2ZJ2 A;  3REO A;  2K02 A;  5K5O A;  1ZRE A;  1S8N A;  3I4P A;  4LJZ F;  2VON A;  1JGS A;  1W7P A;  2HQN A;  3RPU A;  3DF8 A;  4AIK A;  1IZ1 A;  4O6J A;  3HRU A;  2VT2 A;  4Y17 A;  3GZ5 A;  4YG2 F;  2PQ8 A;  4M73 A;  2RNJ A;  3QPT A;  4WK8 F;  1I1G A;  1SMY F;  2VXZ A;  4EVI A;  3SHF A;  3V8L A;  2P6S A;  5ED4 A;  2V79 A;  4PGH A;  3T8R A;  2NAZ A;  5E8I A;  5KVR A;  2XAF A;  3GLX A;  1R36 A;  1WWX A;  3LA7 A;  1FYM A;  4WXC A;  4ZZD A;  3KP7 A;  5BQT A;  1UB9 A;  2KIU A;  5E18 F;  5BPI A;  4MEY F;  1LNW A;  1TQP A;  3QU6 A;  2KKO A;  5KK1 A;  4IHS A;  4KT5 C;  4YFK F;  1KQ8 A;  2A3S A;  1GHC A;  4M71 A;  1EH6 A;  3F6V A;  1XSD A;  1QGP A;  3TQN A;  4YIF A;  1R1U A;  2D1V A;  2DQR A;  4M9S A;  3KLO A;  3ZMS A;  1YS7 A;  2O3F A;  3O3K A;  2QVO A;  5A2Q Z;  3JTH A;  2CYY A;  1FBQ A;  2XKO A;  3KZY A;  4G7H F;  3GFM A;  2EA4 A;  4MTE A;  4ETS A;  3IRR A;  5CVV A;  1B4A A;  3U1D A;  4Z2Y A;  1HW5 A;  2QWW A;  4KA4 A;  1FX7 A;  2JPB A;  3ML6 A;  5CYV A;  3I58 A;  3TDU C;  4U0V A;  1P4X A;  2PEX A;  4ENN A;  3K1M A;  1TBX A;  2H6B A;  1XGO A;  3E5Q A;  3OOP A;  1C0W A;  2O61 A;  3Q9V A;  1XGS A;  1LDJ A;  4IVN A;  2FU4 A;  1MDM B;  4L9T A;  1SMT A;  2OAZ A;  3WE3 A;  3W6K B;  1UHW A;  1QZY A;  2W24 A;  1U2W A;  1D5V A;  5LHI A;  5ICG A;  3RIR A;  1T6S A;  2Z33 A;  4KIG A;  5D5X B;  2GAU A;  2IW5 A;  3R4K A;  1HKS A;  1U78 A;  3E6M A;  2Z9O A;  5HLI A;  4E70 A;  2NNY A;  2HYG D;  3RI4 A;  5L3E A;  5ICF A;  3HRM A;  2EFQ A;  2CQK A;  4MGR A;  3FXQ A;  1VTN C;  1TQI A;  1OPC A;  1G4D A;  1B59 A;  4OIP F;  2K7L A;  2YX4 A;  4HX8 A;  5LRR A;  2ZCW A;  1SFE A;  3N4M A;  1FBS A;  3GWZ A;  4LG0 A;  3CTA A;  4R79 A;  1AWC A;  2STW A;  1L0O C;  2H94 A;  3M8E A;  2EV0 A;  2ZXJ A;  2NYX A;  1BI1 A;  2M30 A;  1YW8 A;  4OIO F;  2ISZ A;  1XGN A;  3KP5 A;  3C3W A;  5ILU A;  4EJU A;  1ZG3 A;  1FLI A;  1O7L A;  5DV5 A;  3MEX A;  2RV8 A;  3CO7 C;  4P55 A;  4WXD A;  3U2R A;  3LFK A;  3G3Z A;  2L4M A;  2M45 A;  1ZAR A;  5F6F A;  2JTV A;  4PZJ A;  2MLG A;  3WU1 B;  1O3T A;  4LMY A;  3WTT C;  5DCF A;  3T8T A;  4R1H A;  3Q9S A;  4EJT A;  2VE9 A;  1TNS A;  1SAX A;  1HQC A;  1CF7 B;  3HSR A;  4Y13 A;  2D1H A;  3H92 A;  3TO7 A;  1OYW A;  2OU2 A;  3RKW A;  2NNN A;  1EH8 A;  1SD6 A;  2Z5U A;  4KN7 X;  3JAM Z;  1K7A A;  2XVC A;  4HA8 A;  2E7W A;  2RDP A;  4JQF A;  1O3R A;  4NB5 A;  2KIF A;  5AON A;  1BBY A;  1I5Z A;  4RGS A;  3I64 A;  2ZBK A;  1BJA A;  2OZ6 A;  1Z91 A;  3H3U A;  2VBZ A;  2V6C A;  3BDD A;  4UVB A;  5HOO A;  4RB2 C;  2EFP A;  4G7Z F;  4HF1 A;  5J8C A;  3KET A;  4GXO A;  2WC2 A;  3IL2 A;  3GZ6 A;  4K2E A;  3EYI A;  1ZG1 A;  3BOQ A;  3J80 Z;  1FWZ A;  2DQL A;  3WGI A;  5D4R A;  3E97 A;  2DFI A;  1G3S A;  2RGV A;  3F23 A;  2HOE A;  3IKT A;  2IA1 A;  4A12 A;  1QBJ A;  3KP6 A;  2P5L C;  3BJA A;  3RPQ A;  2G7U A;  1LQ1 A;  3GVA A;  1ZLK A;  1SD4 A;  2V9V A;  3EQL F;  4HV5 A;  1T2K A;  2P5V A;  3N97 A;  1G3T A;  2OD5 A;  3R6S A;  1IW7 F;  2RC4 A;  5IT9 K;  2WV0 A;  2DTR A;  3KE2 A;  1XGM A;  2PMH A;  2FE3 A;  3JSP A;  4RGR A;  3M1E A;  2X0L A;  4HBL A;  5HS7 A;  4MHG A;  5L3D A;  4HLY A;  1RUO A;  3WOD F;  5FFZ A;  3D0S A;  4ZZL A;  3DQV C;  3L09 A;  1ZGA A;  4GGG A;  3MCZ A;  4M74 A;  5E1Z B;  2VOP A;  4EQQ A;  3V7S A;  2K86 A;  2QBY B;  4JK1 X;  5LGU A;  1HST A;  2DK8 A;  4EGZ A;  2AS5 F;  2ZME B;  1LDK B;  3HIF A;  4HQM A;  4OIR F;  3ZP5 A;  3QP5 A;  1XMK A;  3JSO A;  4QLC U;  4MNU A;  1RNL A;  4Y15 A;  3O2P E;  1IXR C;  2JPC A;  3H3Z A;  4NHJ A;  2DLL A;  4A2U A;  1WQ2 A;  4XLN F;  4XLP F;  4CGZ A;  4N9I A;  3QP6 A;  4I98 B;  1MJA A;  1FYL A;  2EV6 A;  4O5V A;  1YFH A;  5HS9 A;  2HQR A;  1ZRC A;  5FD5 A;  3MZY A;  2HFH A;  3KP4 A;  5DD8 A;  1TLH B;  3DPL C;  3PFI A;  2GXB A;  4LLN A;  4H0E A;  4ESJ A;  4EV0 A;  1KU2 A;  3EET A;  3P9I A;  3MQ0 A;  1FOK A;  4M9Z A;  1GXQ A;  1WSU A;  1YO5 C;  4ENJ A;  3F3X A;  4L9V A;  1ZHF A;  3FF5 A;  4PDK A;  5A2Q K;  2BV6 A;  2QM3 A;  1YQA A;  2KRF A;  2A69 F;  1OYY A;  2UWM A;  4P96 A;  2ELH A;  3F8M A;  4PGG A;  5BPD A;  3WGG A;  3FZV A;  2QUF A;  3J7A O;  5K1Y A;  5FB2 A;  5BS6 A;  4KIF A;  2GA1 A;  4ZYE A;  5DCM A;  3HSE A;  1H9G A;  3DXJ F;  5HLG A;  3HTU A;  1BI0 A;  3P7N A;  4ZYG A;  1MJ9 A;  5D6F A;  4KN4 X;  1KU9 A;  3PQK A;  1IF1 A;  2IT0 A;  4MEX F;  3F6O A;  4QWQ A;  3SZT A;  3I59 B;  2FNP A;  3WGH A;  3KLN A;  2F2E A;  1W5S A;  1RZ4 A;  2TDX A;  3F22 A;  1S29 A;  1REP C;  2F5D A;  2P7C B;  1I27 A;  3BPV A;  4MTD A;  2XAQ A;  2O8X A;  4OIN F;  1MJB A;  2GA2 A;  5D8K B;  1S6L A;  2COM A;  5E8G A;  1KYW A;  4HOB A;  5L3F A;  1BOA A;  5F1R A;  1W7P D;  2RVC A;  3HRS A;  4U0Y A;  5E1W A;  4EGY A;  4LD5 A;  2KJC A;  3TO9 A;  4L0Y B;  2VC1 A;  2QYO A;  4L5J A;  2W84 A;  4Q5S F;  2DO7 A;  4LK1 F;  3FX3 A;  3KCC A;  1ON1 A;  1BI3 A;  1JE8 A;  4UNO A;  3FHZ A;  4FX4 A;  4A0X A;  1JHH A;  5HDN A;  4HAM A;  4OOI A;  5LGT A;  2M87 A;  2NRA C;  2DW4 A;  1YW7 A;  4HLX A;  3GXO A;  1IN4 A;  2ACJ A;  4HX4 A;  1KA8 A;  3ZN0 A;  1MD0 A;  3FXR A;  3DEU A;  4WX9 A;  1U5T C;  3B02 A;  5DUI A;  4DNC A;  3HTS B;  2HKX A;  2LNB A;  3QU3 A;  5HDG A;  1ZRF A;  2FSW A;  2YPR A;  3ECH A;  4G8X A;  3LST A;  2OBP A;  2ZNZ A;  3P9K A;  4XBF A;  5CVI A;  2F5E A;  1W7P B;  1KGS A;  1Z1D A;  5LGN A;  2XAS A;  1J59 A;  2HTS A;  5LEK A;  2W57 A;  1B6A A;  4HYE A;  1UST A;  3JAM K;  1KU3 A;  2QQ9 A;  3J81 Z;  1ZLJ A;  2EV5 A;  4L9N A;  4OMZ A;  2E1C A;  1P4A A;  3F8B A;  4A6D A;  2EK5 A;  3KP2 A;  2Q2E A;  1S7A A;  5D5V B;  1R00 A;  4EM0 B;  2P8T A;  3FM5 A;  2Y48 A;  2J5O A;  2PJP A;  1R22 A;  1W5T A;  1X3U A;  1FYK A;  3U9G A;  3PQJ A;  3GX4 X;  2LF7 A; 
#chains in the Genus database with same CATH topology
 1HOM A;  2NS8 A;  5K5Q A;  4RLF A;  5DTD A;  4DYQ A;  2OZU A;  1N75 A;  4A5N A;  1QO0 D;  3MD2 A;  2QLZ A;  2EQR A;  3BQY A;  3CCL I;  2VC0 A;  3GO5 A;  1UCR A;  1HA8 A;  2PI0 A;  3N05 A;  3VFZ A;  4BQA A;  1ZN2 A;  3CDH A;  2Y9Y A;  2ZFU A;  1JTY A;  1TTY A;  1ETQ A;  2EFN A;  3M9A A;  1O7F A;  5LLQ A;  5LEJ A;  2H6C A;  4HZF A;  3D5S C;  3PM1 A;  1K78 A;  3BR1 A;  2EFO A;  4A0Z A;  2H8W A;  3SFZ A;  3J80 K;  1DP7 P;  1LFU P;  3EUH C;  4KMU X;  2JVH A;  2WAF A;  1R49 A;  5K7F A;  1MMN A;  1NG7 A;  3OOU A;  2BEO A;  4A93 J;  4FIS A;  1PP7 U;  2HI3 A;  3HOS A;  1OFC X;  4CDG A;  4PJJ A;  5FKN A;  3W6J B;  1IXC A;  1D5Y A;  1F1Z A;  5B66 C;  2F5V A;  1QPM A;  4NNJ A;  2XGD A;  3MVP A;  2CGP A;  2VJ5 A;  3GTO J;  2QQ8 A;  1BIB A;  2VBY A;  4L5E A;  1RET A;  5FD6 A;  4ZH4 F;  2FJ1 A;  4WXH A;  5EZG A;  2HPM A;  5KNL A;  3BWG A;  2CSO A;  3BPX A;  4I09 A;  4KNY A;  2M2E A;  2PFB A;  3QPH A;  2F5C A;  2HEO A;  1FY7 A;  3IWZ A;  4I7H A;  4BAY A;  2O7O A;  4AYB A;  2QKM B;  4BAC A;  5H6Q A;  5CVJ A;  1Z9C A;  4O3M A;  3PNV A;  3OV8 A;  4LGW A;  1SFX A;  5D6E A;  1FP1 D;  1SD5 A;  2LY9 A;  1JJ6 C;  2CO5 A;  3FXU A;  4ON0 A;  1BC8 C;  2MSY A;  3SQN A;  2R0Q C;  3K4N A;  4P9U A;  2OA4 A;  2YUS A;  2Y69 H;  3CUQ A;  3ZN1 A;  2IBD A;  3ERM A;  3PO3 J;  3BY6 A;  5J6X A;  1FC3 A;  2XKP A;  1DU6 A;  2OUM A;  4BHC A;  3MKW B;  1RRJ A;  4D5F A;  2X6W A;  1T33 A;  5DDG A;  2Y0S N;  1GV2 A;  1YYV A;  3D5L A;  5CLS A;  3RKX A;  1H8A C;  4NQW A;  4FCY A;  1R5G A;  2CW0 F;  3GFI A;  1H9T A;  3AG3 H;  4XLE A;  3BLY A;  3WG7 H;  4GO1 A;  3SXY A;  2JSC A;  5M5X J;  1MGT A;  1HKQ A;  1XD7 A;  3K10 A;  4XK4 A;  5E3M A;  3K2Z A;  1Y1V J;  1SD7 A;  3LFU A;  4DGW B;  3BQZ A;  3RKY A;  1POG A;  1H88 C;  1D1A A;  2HR3 A;  2BHZ A;  1A04 A;  1OCR H;  2N8G A;  4CUG A;  2XPU A;  3CLO A;  5FFX A;  3DEW A;  2MH9 A;  2F4M B;  4YFN F;  3GLL A;  3KEQ A;  2A05 A;  1B9M A;  3S8P A;  4C30 A;  3M8F A;  1A5J A;  1FTT A;  4BU2 A;  3VPR A;  1DUX C;  4AVP A;  3CCJ I;  3H9J A;  3BJ6 A;  3ZMU A;  1ERD A;  4F7Z A;  3TO6 A;  3MKZ A;  4HQE A;  4BE1 A;  3HRT A;  1R4M B;  2V1X A;  1P92 A;  1QHG A;  1ZAO A;  2QBY A;  1IN5 A;  4QPQ A;  1OR7 A;  5KAI C;  2DMN A;  2VI6 A;  2ADU A;  3JR9 A;  4IHV A;  4EJO A;  5TJJ A;  2RQP A;  2GZW A;  4RM2 A;  3LQQ A;  2ZO4 A;  4AYB N;  1MW7 A;  4A3E J;  1K79 A;  1MBJ A;  3WTZ A;  1Y56 A;  3OYJ A;  3M1C A;  5F1J A;  3V7C A;  5ERI A;  4JP0 A;  5HS8 A;  2W82 A;  1ETY A;  5JVT A;  4FQG A;  4RDU A;  4TV7 A;  4JX6 A;  3ZRG A;  3DKW A;  5FGM A;  2B63 J;  1FSE A;  5L3B A;  3BZ6 A;  1ON2 A;  3GFJ A;  2KIQ A;  4LG0 B;  5IOZ A;  2IJL A;  1IDY A;  3HUG A;  4EM1 A;  5M5W J;  5E79 C;  1FMW A;  5F0H A;  3VB2 A;  1KQ0 A;  3KYL A;  2L2O A;  2OCC H;  1LFB A;  5K7Z A;  4CXF A;  3OIO A;  3P5J A;  4DQ2 A;  3RKQ A;  2LD5 A;  2IA0 A;  4CO8 A;  2DK5 A;  2XHK A;  4BQQ A;  2DPU A;  3VWB A;  3L9F A;  4A3B J;  1G6N A;  3CP2 A;  2XPV A;  1ZRD A;  2Z1D A;  1LUJ B;  3AG1 H;  3LAP A;  3E6B A;  3GTG J;  3HEF A;  2M4G A;  3BTL A;  4CA0 A;  5BOX A;  3I9V 2;  1RIO H;  2DOA A;  4CYC A;  2LDU A;  3K69 A;  5GPC A;  2Y0M A;  2Z99 A;  1NHA A;  4XLF A;  9ANT A;  1B8I A;  5D8L B;  1FBU A;  1L3L A;  3HGG A;  1A6Q A;  5FLX Z;  2XIG A;  3RJP A;  4OMY A;  3K70 D;  3FMS A;  2DMU A;  4I99 C;  3RZO J;  3J7A Y;  4BXX J;  2VBW A;  3JRI A;  1SVL A;  2JZY A;  1ZGJ A;  3JRA A;  4CCL A;  2F4I A;  2VAS A;  3TED A;  4BH9 A;  2LSO A;  4S05 A;  1T0F A;  2VN2 A;  5HNH A;  2R7W A;  2DPD A;  1Z0X A;  3ZMV A;  3G1L A;  2MH2 A;  2WB1 N;  1U5T B;  2E36 A;  2MD0 A;  4P5O A;  1XB4 A;  4PJN A;  5L3G A;  1OQY A;  3L00 A;  3F21 A;  4CHU A;  1HXD A;  3BP8 A;  3FK6 A;  3ABK H;  4S0H B;  2QEX I;  3TOA A;  3ROU A;  1XMX A;  5JVG F;  2K4J A;  3CES A;  1NK2 P;  4JOM A;  1WCM J;  3FXO A;  3TBI A;  1MBF A;  3LQR A;  3ZQ7 A;  2VL8 A;  1IV8 A;  2FBK A;  2VJ4 A;  1X58 A;  4G9Y A;  2TRT A;  1VFC A;  3G71 I;  4ZYD A;  3ASO H;  1NTC A;  1W36 C;  1FIA A;  2YX7 A;  1R5H A;  3NQO A;  2E1O A;  2Y2Z A;  3W2A A;  2UXN A;  3FXL A;  2O03 A;  2VE8 A;  3I0T A;  2CFX A;  3S3M A;  4HDU A;  1SFU A;  2NOJ B;  3LSR A;  2BY2 A;  1R6R A;  1TT0 A;  1YS6 A;  2XPW A;  2FMY A;  3FXK A;  3IV5 A;  4XR6 A;  1MMS A;  3F8F A;  1U9O A;  3HOY J;  2GXA A;  4IO9 F;  3FM3 A;  2IGN A;  3CME I;  2BE5 F;  4BY1 J;  2FA5 A;  2ID6 A;  3COA C;  2G7H A;  2LOO A;  2XGE A;  2R7S A;  2R7F A;  2VKV A;  2JA2 A;  1P2F A;  4RB1 A;  1Z7L A;  2JK3 A;  3DCF A;  2I5U A;  2L01 A;  2Z16 A;  1RKT A;  1ZH5 A;  1N78 A;  1K83 J;  1WJD A;  5AIQ A;  2LR8 A;  2OQR A;  3KP3 A;  4N4N B;  4CZC A;  4QPO A;  5F64 A;  3KFW X;  3FXJ A;  4C9Y A;  3CJR B;  3R61 A;  5ILS A;  4UVA A;  3BZC A;  4RA2 A;  2EWN A;  1FP2 A;  2HDD A;  1P4W A;  4YEJ A;  3TW7 A;  2CV1 A;  1LKX A;  3V8J A;  3ZPL A;  1S7O A;  2HS5 A;  3HHG A;  4ANJ A;  3VYT B;  3S32 A;  4M72 A;  1Z6R A;  3HOW J;  5LHG A;  1MMA A;  4G94 A;  2L54 A;  1Z05 A;  2P4W A;  1WI9 A;  5CVR A;  5E20 A;  2M9H A;  1TQM A;  1O57 A;  4N0B A;  3I53 A;  4E7J A;  3LL7 A;  1HBX G;  2DFH A;  1IUY A;  3VOD A;  1EA3 A;  2LY1 A;  5GAG J;  2GLO A;  3E5X A;  4OIQ F;  1EF4 A;  1QVT A;  5CJ9 A;  2VKE A;  4BBS J;  2XAU A;  4XM3 A;  2UV1 A;  2MD5 A;  1QNT A;  3RZD J;  3SEQ A;  2CUF A;  1LJ9 A;  1YTY A;  1GUU A;  2IA2 A;  4LB5 A;  1YRN A;  5EEG A;  2JRT A;  3DP7 A;  3AAF A;  1J75 A;  3K6G A;  1W4M A;  3GTP J;  2QSF X;  2ECB A;  1IN8 A;  2NVY J;  3IRQ A;  1YW9 A;  3HB9 A;  1LFP A;  1VQL I;  2OV7 A;  2LKX A;  3L7W A;  2VUM J;  3V42 A;  3LAJ A;  1DGW Y;  1WJC A;  1E3H A;  4Y52 J;  2RKH A;  2L5Q A;  2GQQ A;  2L3D A;  3BG5 A;  1HW2 A;  2QA4 I;  1QHH D;  4LFU A;  5CQE A;  4FE4 A;  5LBQ A;  3ERE D;  1G3W A;  2W4S A;  2FXA A;  4BEH A;  3A0H C;  3BG3 A;  1OIS A;  3K2A A;  2LF8 A;  3NEU A;  5IYD J;  3KEO A;  3QQA A;  3JRC A;  4KIB A;  5H2F C;  3G73 A;  5EEH A;  3IH3 A;  1D3Y A;  3A0B C;  4D7N A;  1VQK I;  2R7D A;  3ZMT A;  4F92 B;  3PNY A;  2K9Q A;  2CV0 A;  4A3J J;  3ONQ A;  2QGU A;  4WF2 A;  4IX7 A;  1TNT A;  2K3P A;  3OIP A;  3QWL A;  3NRV A;  4ENM A;  5IPA A;  2MBF A;  4UV8 A;  3L2Q A;  3H1C A;  4U0W A;  3ZQC A;  1FEX A;  1YE9 A;  4XRM A;  1Y8Q B;  3HZJ A;  1HKT A;  3U21 A;  1PVE A;  2NS0 A;  1ONV A;  3CJN A;  5FKL A;  4DW6 A;  3S15 J;  3ESW B;  3OIQ A;  3MZ8 A;  2ID3 A;  4HSR A;  3DBH B;  5CQG A;  2GXG A;  4B44 A;  4KMF A;  5EJC A;  4G6Q A;  2EB7 A;  4M6V A;  4M6X A;  1IRF A;  4KJZ A;  1IRX A;  5FRM A;  1J9I A;  1SFK A;  3EDP A;  1IN7 A;  2NOG A;  4LK0 F;  1W0U A;  3KZZ A;  3M3Y J;  4HW0 A;  1SFO J;  2K4B A;  3WU0 A;  1EV7 A;  4FT8 A;  3WTW C;  6PAX A;  1XDU A;  2HYF A;  2XF7 A;  1MIJ A;  1XDS A;  3MWM A;  4PCQ A;  3RYP A;  4IOC F;  2QF7 A;  2IRF G;  5C4X J;  2B0L A;  2FOK A;  2MLK A;  1YJN I;  1V3F A;  1MDM A;  1V4R A;  2MC3 A;  1FPQ A;  3OYN A;  1XCV A;  1PDN C;  1PUE E;  3JRG A;  3J81 K;  1WZ2 A;  4YEL A;  1XSV A;  1GVD A;  4BQO A;  3M07 A;  3GCM A;  4IHY A;  2P7V B;  1UAA A;  4XN3 A;  4S04 A;  1ZKG A;  2STT A;  3VEP A;  1DU0 A;  3V7R A;  1B1B A;  1JUS A;  1ULY A;  1W36 D;  1IXS B;  2KDZ A;  2V1D A;  2BBY A;  3T1B A;  1OCO H;  2IS2 A;  2K9M A;  1FSH A;  4RAY A;  3CJT B;  1S3J A;  3TL4 X;  3ZQH A;  2H27 A;  5H6R A;  4D9J A;  3OYA A;  2QQB A;  3ZQL A;  2XUB A;  4B3A A;  3G4S I;  3FKJ A;  3LA3 A;  2E7X A;  3RPU D;  4XN0 A;  3DPT A;  4UB6 C;  3LSG A;  2J5P A;  3T5X A;  1RUN A;  2O6G E;  5FLV A;  1MZB A;  3Q5F A;  5E17 F;  1MH3 A;  4MQ9 F;  1FTZ A;  4WCG A;  3WU2 C;  2A07 F;  2L9V A;  1FOY A;  1J0R A;  1YLF A;  2E2J J;  4FAS D;  5EEA A;  2WWY A;  1EJ9 A;  1X2N A;  4P1W A;  3Q3S A;  2HWV A;  1IGN A;  1Y39 A;  2Y30 A;  4N9H A;  1I3Q J;  2IP2 A;  2XRN A;  4HF2 A;  2CRG A;  3TOB A;  1EH7 A;  1B72 B;  2EIL H;  1BM9 A;  3S3N A;  1BR4 A;  1H0M A;  2FNA A;  1JT6 A;  3BTJ A;  5HVQ C;  2L0K A;  2Y31 A;  2JA7 J;  4A3F J;  2MW8 A;  3E6D A;  2QZ8 A;  1XSX A;  1YIO A;  3ZXS A;  1ZYR F;  4AC0 A;  2DXI A;  3EYY A;  2X48 A;  2DDB A;  2QKL B;  3SZP A;  3DFG A;  2DOE A;  1OYI A;  3I55 I;  3W2V A;  2DA7 A;  5ICE A;  2CFO A;  2CH0 A;  3EUA A;  4KUM A;  2PG4 A;  1TP4 A;  3GTQ J;  4M3B A;  1E17 A;  1ETK A;  2BW3 B;  3F72 A;  4RAZ A;  2D2W A;  5M3F J;  2A6E F;  5DEQ A;  1ACI A;  3QRF F;  2EZL A;  3K7A J;  1BOB A;  3LSH A;  4XSZ F;  2DA1 A;  4KT6 A;  1YX3 A;  4L5I A;  3WTV C;  1U8R A;  3GME A;  1WJF A;  1VQ4 I;  1WRJ A;  3JRB A;  5DCM B;  5FKK A;  1A6I A;  4DIQ A;  3CUQ C;  2ZC2 A;  2X9D A;  1D8J A;  1E2X A;  4IPA A;  2M0C A;  4UVC A;  1GXP A;  1F4K A;  3MZH A;  3AFH A;  2CV2 A;  3E3V A;  4RGX A;  4Q47 A;  1RR7 A;  2XGC A;  1QVU A;  2JMW A;  2H1K A;  4EEF G;  1S9H A;  1OKR A;  1CF7 A;  1DPR A;  4HPQ A;  3RSN A;  5J8F A;  4IXA A;  3DTI A;  1KQ9 A;  2PMZ N;  4RB3 C;  5JHU A;  1BIA A;  1R9T J;  4FHT A;  3K1N A;  1WH5 A;  1RKW A;  3WTX C;  2GM4 A;  1HSJ A;  3H0G J;  1OMI A;  3A03 A;  4CIC A;  5L3C A;  4AWX B;  1DPU A;  2EA2 A;  3E0J B;  3Q0W A;  2I10 A;  1XS9 A;  2HDC A;  2LBF B;  4X1E A;  2YU3 A;  2LTP A;  4I02 A;  1HW1 A;  1HC8 A;  2BZT A;  3EUK L;  3RDI A;  1LE8 A;  4BY7 J;  1ETX A;  4BXF A;  1ZG5 A;  3H9G A;  4NC7 A;  4HX7 A;  4LIU A;  1XN7 A;  2QEN A;  4AIH A;  5HDK A;  2DU9 A;  4FX0 A;  1LB2 A;  1R5I D;  3V8K A;  1FNN A;  4J00 A;  4U88 A;  1IJW C;  2IEK A;  1GV5 A;  2Z2S B;  4NDL A;  4KIC A;  3OYE A;  3CC4 I;  4HEA 2;  1UHM A;  4G6D A;  2HPI A;  1Z7U A;  1UJ8 A;  2RNG A;  2O0Y A;  3AL0 B;  2Y0S A;  2GWR A;  1D8K A;  2K9S A;  2X6X A;  3WTS C;  3WG9 A;  3J7Y J;  2IAI A;  1AKH B;  4U7D A;  2HU9 A;  4M9X A;  2O8K A;  3HYI A;  1JI8 A;  3RQ4 A;  4BXU A;  4IHT A;  3CP8 A;  2VQC A;  1SC7 A;  4ASN A;  3C2B A;  3QOE A;  4XIC A;  4MQV A;  3ABT A;  2QSH X;  3RYR A;  1T38 A;  4M6Y A;  2VBX A;  2R5Y B;  4YFX F;  4ENK A;  2DFE A;  5DYM A;  5FO5 A;  1JUP A;  1OLT A;  1MKM A;  3ZMD A;  2EJR A;  4CSW A;  4B09 A;  4II2 A;  4LIV A;  3TGN A;  3HOZ J;  1R23 A;  1VQ6 I;  1MNE A;  1BJZ A;  3LSP A;  4I0A A;  1IO2 A;  3HHH A;  3BRO A;  2DTZ A;  3D5R C;  5JR3 A;  2LP0 A;  3JW4 A;  2HOS A;  3AG2 H;  1U6G A;  2FF4 A;  3DV8 A;  1UFM A;  1YOV B;  2JSP A;  5LRS A;  1R1V A;  2R3S A;  4DZP A;  4HV6 A;  3VYR B;  4BYY A;  5J4Y A;  2X1D A;  1PYV A;  1LDD A;  4OU0 A;  1K6Y A;  1MBE A;  3L2U A;  2Q1Z B;  3FKI J;  3QOP A;  4UUV A;  4NBQ A;  2H09 A;  4L9J A;  5E1X A;  3NAU A;  1RPW A;  4LLG F;  2ISY A;  5TRD A;  1Y0N A;  2FQ3 A;  3MKY B;  4EMS A;  1TWH J;  4ABZ A;  5K5R A;  1YJW I;  2VB6 A;  5FLX K;  2E2H J;  4EJW A;  1KU7 A;  2KDO A;  2VJI A;  3BCB A;  1TZL A;  3HOX J;  1PUF B;  2CQ7 A;  3ISP A;  5BMZ A;  4UXN A;  4G6T B;  1JXS A;  4XNF A;  1I1S A;  1YG2 A;  4X0G A;  4P9F A;  1U3E M;  2ZKZ A;  5B5E C;  3ABU A;  3O8H A;  2DMT A;  1DDN A;  2A5Y B;  2DT6 A;  5EG0 A;  1UEL B;  4RAG A;  3I54 A;  5JFR A;  2XF6 A;  4RS8 A;  3TP0 A;  2M8G X;  4HG2 A;  3JTG A;  3K1P A;  2VOD A;  3S2D J;  4D0P A;  2KZV A;  1KZH A;  2A6H F;  3F8C A;  2CG4 A;  1J5Y A;  1U5T A;  2HVQ A;  2OF7 A;  3A4C A;  3DTE A;  2LKP A;  1R4N B;  3WHC A;  1JKR C;  5IP6 A;  1GVJ A;  2BHY A;  5GP9 A;  1BN5 A;  2YSR A;  1QQI A;  2R5Z A;  3GUD A;  1JT0 A;  1J2X A;  2X4H A;  1BI2 A;  4DBR A;  3CO6 C;  2JT1 A;  2IPQ X;  1VI0 A;  4B47 A;  5J1Y A;  2EFW A;  2P6T A;  1RI7 A;  3W2W A;  1OCZ H;  2DBB A;  5CVU A;  5ICC A;  3RQI A;  3IWF A;  3O6B B;  4GCV A;  2EPF A;  3A01 A;  3CUO A;  2DAO A;  2ETH A;  2FBH A;  5DM6 F;  2Q2E B;  1WKM A;  2KQR A;  1Q1H A;  4C2T A;  3S1M J;  3S14 J;  1OJL A;  3FHN A;  4UUS A;  2IGM A;  3E7L A;  4E7Z A;  2DA4 A;  2WB1 A;  1JKP C;  1IAW A;  1KYZ A;  3Q0V A;  1IRG A;  3E5U A;  3HPG A;  2HGC A;  2Z3Y A;  3H5A A;  3K0L A;  3BG9 A;  1P7J A;  2DDA A;  4EJV A;  2JWT A;  2PN6 A;  2X51 A;  2ZME A;  3GEZ A;  3RTR A;  5JI6 A;  1GDT A;  2Q0O A;  4ZTF A;  2L4A A;  2PJR B;  2C6Y A;  3TKY A;  2XV4 S;  4BKX A;  4RB0 A;  2VT3 A;  4U7B A;  5C44 J;  2IVM A;  4IOA F;  2LC2 A;  4DOZ A;  3S16 J;  3KIO A;  4ZYA A;  3R0J A;  3S2W A;  4UB8 C;  4I6Z A;  3OR1 C;  5IYC J;  1BW5 A;  3QAH A;  4CCO A;  3C7J A;  2M5W A;  4JBA A;  2QQA A;  1R1T A;  1JKO C;  4UV9 A;  3K9T A;  3CF5 F;  4NC8 A;  2JQ7 A;  2WAE A;  3GW2 A;  4XSX F;  4IQJ A;  1D0Y A;  3HOT A;  3ELK A;  2K85 A;  4JYK A;  3W3C A;  1YJ9 I;  2DT5 A;  3R60 A;  5DUK A;  1K78 B;  1TWA J;  2Q8K A;  4XLH A;  2RN7 A;  2L9R A;  2OCE A;  3FMQ A;  3L2C A;  3SYT A;  4UY8 I;  1AOY A;  3WE2 A;  4A3M J;  1N25 A;  3JRE A;  2XC7 A;  2A61 A;  2YR2 A;  3L1P A;  4A3D J;  2P5K A;  5D4S A;  2PBI A;  1F5T A;  1QA6 A;  4Q48 A;  4ZYH A;  3OS2 A;  3HOU J;  1F9N A;  1OCP A;  2KJB A;  3HSF A;  4OAY A;  1XCB A;  4ESB A;  3EUH A;  3I4M J;  3CJQ B;  2CS3 A;  4YII A;  3OYM A;  3IUO A;  1X4P A;  4AID A;  1SEU A;  3DBR B;  4IRH A;  2BY0 A;  2E5Z A;  3ECO A;  2FRH A;  1A35 A;  2RAE A;  2HKO A;  1T39 A;  3I71 A;  5FRN A;  5J47 A;  2X6O A;  4WWC A;  3K4J A;  3ZQQ A;  2MGQ A;  5IYB J;  3MN2 A;  2EIN H;  4AD9 A;  3ULQ B;  4DZJ A;  4L18 B;  5B1B H;  1UG0 A;  4ITV A;  2IS4 A;  1LEA A;  1V5F A;  3CUQ B;  2L7Z A;  1PJR A;  2KFD A;  1YX5 A;  3SZG A;  2Y75 A;  3OYL A;  2PMU A;  1D0X A;  1G3Y A;  3WHB A;  2L02 A;  4ZC3 A;  3U1K A;  2OQG A;  4L0Z B;  4PSW A;  4GYG A;  3TP3 A;  4NQW B;  2BGC A;  4BUP A;  3LSI A;  4NUB A;  4BDZ A;  3DBL B;  2R7T A;  2WY8 Q;  2E5N A;  5H20 A;  2MYS A;  2HZT A;  3DWL E;  4XRF A;  1T98 A;  5FKM A;  1O3S A;  2V1U A;  3CLQ A;  1Z6T A;  2FML A;  1X1D A;  3KEY A;  3G1O A;  2KIM A;  1LEB A;  2AO9 A;  3CDL A;  2IGO A;  3CCQ I;  3OMY A;  3VOE A;  3TDZ C;  3F8N A;  3PL8 A;  2Y9Z A;  4RGU A;  3CMA I;  1B9N A;  4CZZ A;  2NVU B;  1FT9 A;  5GAD J;  4CCJ A;  3WTU C;  4KFC A;  4V19 K;  1Y0U A;  4IRI A;  3M4O J;  4ESF A;  1STZ A;  4OWR B;  4BHB A;  3CDI A;  4G7O F;  1TWG J;  4IL6 C;  4I01 A;  4KYW A;  3BJO A;  1MNM C;  3GFL A;  3CMM A;  4I0B A;  3OSG A;  1VQ5 I;  4J19 A;  2W25 A;  4BE0 A;  2CQN A;  2ZNY A;  3MAJ A;  2F5F A;  3IAM 2;  4B43 A;  3UNG C;  1O3Q A;  5ILV A;  4XKB A;  2BVM A;  4XL9 A;  3I59 A;  2HXI A;  1P6R A;  2FEZ A;  2M8E A;  1O4X A;  2UXX A;  3BC8 A;  1X1P A;  4PUS A;  4PJM A;  3OYG A;  3M7G A;  3IKV A;  3BT9 A;  5KAF C;  4XLA A;  4QIW N;  4IRG A;  1X2M A;  5TIS C;  5DD4 A;  4IKF A;  1QZZ A;  3MFK A;  3AL0 C;  2YS9 A;  1WVR A;  2W85 A;  3BZK A;  3ZMZ A;  4A0Y A;  5LHH A;  2DA5 A;  2M1B A;  2ESH A;  2ZSI B;  4UHT A;  4AIJ A;  3R0A A;  3V4G A;  4HNU A;  1R58 A;  3SJM A;  1T95 A;  2XGX A;  1TW3 A;  2P0W A;  3I5U A;  4YIR X;  4B3X A;  1USS A;  3OYD A;  5D5U B;  1IV6 A;  2NVQ J;  2F6C A;  4IF4 A;  1P9Q C;  1RES A;  2WV1 A;  1R7J A;  1Z3X A;  3DU6 A;  4PFP A;  4XOT A;  2LMD A;  2FBI A;  3PSI A;  2F48 A;  2CMP A;  2XAG A;  1K61 A;  4CYD A;  3IH2 A;  3OYH A;  5F27 A;  2GIV A;  2VOO A;  2BY1 A;  2XB5 A;  4A5M A;  2ZFW A;  3C18 A;  2KPM A;  3LA2 A;  4LLL A;  1VQ9 I;  3GYH X;  2AXL A;  3ZR8 X;  2ZXW H;  5HLH A;  2KIS A;  1B8I B;  3C1D A;  5D5W B;  5M5Y J;  2BYV E;  3GF2 A;  3QYF A;  5DS9 A;  2K27 A;  5IT3 A;  3E6C C;  3IAS 2;  3SEZ A;  1IN6 A;  2DOD A;  4A6E A;  1ODD A;  3B73 A;  4E7I A;  2E1M B;  3MMY B;  4HRI A;  2HTJ A;  3IHU A;  4I2O A;  1LVA A;  4M3F A;  1ZGW A;  1FZP B;  2G9W A;  1J7K A;  2EZH A;  3FWE A;  4BHP A;  4KDP A;  1XMA A;  4RMN A;  4EM2 A;  2WTE A;  3T0Y A;  2CWE A;  4FE7 A;  1VQP I;  1WHU A;  2XRO A;  2XAH A;  4HF0 A;  2UZK A;  4BNC A;  3M8J A;  3QPL A;  3FMR A;  1PP8 F;  5IT9 Z;  1OCT C;  3C2G A;  1I6X A;  2WY7 Q;  1MBK A;  4LB6 B;  3OYB A;  1TWF J;  4XKV A;  5C3E J;  1BR1 A;  4A3K J;  2CU7 A;  4C3I J;  3IC7 A;  1EKE A;  4QTR A;  1K6O A;  3P9C A;  4B8X A;  2R7Q A;  2W00 A;  2HOA A;  2VPR A;  2DI3 A;  4Q4Z F;  1VQN I;  4GYI A;  4R8H A;  1CGP A;  2E1N A;  5EZH A;  4HDV A;  5F0C A;  1NG6 A;  2A68 F;  1TW2 A;  2ESN A;  3OYK A;  1JHF A;  2XAJ A;  4IJA A;  1G2H A;  4II3 A;  2PLY A;  3SFI A;  1BC7 C;  2D45 A;  1TWC J;  2MA3 A;  3WTY C;  3A1Y A;  1QU3 A;  3ABM H;  3I3L A;  2OTL I;  2LYC A;  1U8B A;  5AIP A;  3LWF A;  2ZJ2 A;  3REO A;  2K02 A;  2UUZ A;  5K5O A;  2EIJ H;  1ZRE A;  3HDD A;  3KPH A;  1RR8 C;  5IP9 J;  1P7I A;  1S8N A;  3I4P A;  4LJZ F;  4PFO A;  2VON A;  1JGS A;  1W7P A;  2HQN A;  4LG3 A;  5GTH C;  1Q1V A;  3RPU A;  3DF8 A;  4AIK A;  4JX5 A;  1IZ1 A;  4O6J A;  4E4H A;  3HRU A;  2KLO A;  2VT2 A;  4Y17 A;  3GZ5 A;  3KYC B;  4YG2 F;  3ZQI A;  2PQ8 A;  4M73 A;  2RNJ A;  3PNT A;  3QPT A;  4WK8 F;  5J4V A;  2E19 A;  5FRO A;  1I1G A;  1SMY F;  2VXZ A;  4EVI A;  4IZZ A;  3CCS I;  3HPH A;  3SHF A;  3V8L A;  1SAU A;  5F0F A;  2P6S A;  5ED4 A;  4B48 A;  2K3F A;  2V79 A;  2ME6 A;  1ZR2 A;  2AXT C;  4BS9 A;  2A6T A;  4PGH A;  3T8R A;  4BBR J;  2NAZ A;  5E8I A;  2AHQ A;  5KVR A;  2XAF A;  3JRF A;  3GLX A;  1X4O A;  5HOD A;  1R36 A;  4AUX A;  1VQO I;  1WWX A;  2HVR A;  1S72 I;  1NH3 A;  3LA7 A;  2PMZ A;  3GTJ J;  3X2Q H;  2DMP A;  3PUB A;  1FYM A;  1ZK8 A;  2IXS A;  4WXC A;  4BQN A;  4ZZD A;  4DYR A;  3KP7 A;  5BQT A;  1UB9 A;  2KIU A;  5EGO B;  3GTM J;  5E18 F;  1I6H J;  5BPI A;  2EZK A;  4MEY F;  1LNW A;  2ZXH A;  4D1Q A;  2EIM H;  1YRN B;  1TQP A;  3QU6 A;  2LRE A;  3CZ6 A;  4XOP A;  2KKO A;  5KK1 A;  4C3H J;  4IHS A;  1ETO A;  4KT5 C;  2QCO A;  4YFK F;  1K4T A;  1IDZ A;  2A3S A;  1KQ8 A;  3KZI C;  4Y7N J;  1GHC A;  4M71 A;  1EH6 A;  3F6V A;  1XSD A;  1QGP A;  3TQN A;  4YIF A;  3MKL A;  1R1U A;  2FX0 A;  2DJI A;  2D1V A;  4IHW A;  2R7X A;  2FD5 A;  2DQR A;  2E2I J;  2HDW A;  4M9S A;  3KLO A;  1D0Z A;  2HNH A;  3BR0 A;  3ZMS A;  1YS7 A;  2O3F A;  3O3K A;  2QVO A;  5A2Q Z;  2E34 A;  2V9P A;  3OL3 A;  2V26 A;  3BTC A;  3JTH A;  4RM3 A;  4BEH B;  4CCK A;  3PFY A;  4BDY A;  1Z77 A;  1OCC H;  4KIT B;  2VPL A;  1V54 H;  5JLW A;  4XID A;  2CYY A;  2K9L A;  1FBQ A;  5B3S H;  2XKO A;  2COB A;  3KYD B;  3LSJ A;  3KZY A;  4G7H F;  2R93 J;  2IS6 A;  3GFM A;  3ZQG A;  2OJE D;  3H3V K;  2DMQ A;  4Y4R A;  2EA4 A;  1XPX A;  1V5E A;  4MTE A;  4ETS A;  1MMG A;  2GOM A;  1F43 A;  4A69 C;  3IRR A;  5JLX A;  4D5C A;  1JTX A;  5CVV A;  1B4A A;  3U1D A;  1YI2 I;  4Z2Y A;  5M3M J;  1HW5 A;  4RBO A;  2HXO A;  2QWW A;  4KA4 A;  2VQG A;  1FX7 A;  2JPB A;  2VQH A;  3ML6 A;  4X6A J;  1D1C A;  3CCE I;  2IS1 A;  5CYV A;  1SVM A;  1UHS A;  3I58 A;  3TDU C;  4U0V A;  1LVK A;  2H1L A;  1P4X A;  2PEX A;  4ENN A;  3K1M A;  4F3Q A;  1TBX A;  2H6B A;  1XGO A;  3E5Q A;  3OOP A;  3OYI A;  1C0W A;  2O61 A;  3Q9V A;  2KP6 A;  1XGS A;  1J09 A;  2AQE A;  3UKG A;  1LDJ A;  4IVN A;  1GLN A;  2FU4 A;  1MDM B;  5CKT A;  4L9T A;  1AHD P;  1UG2 A;  1VQ7 I;  1SMT A;  3GZN B;  2OAZ A;  4XLC A;  3WE3 A;  2R7V A;  2LG4 A;  1T56 A;  2ICW G;  3W6K B;  1UHW A;  1QZY A;  2VQL A;  2CUZ A;  2W24 A;  1U2W A;  3OR2 C;  2M0M A;  1D5V A;  5LHI A;  3DLA A;  2W48 A;  4A3C J;  2LY2 A;  3HL2 A;  5ICG A;  3RIR A;  5J40 A;  1T6S A;  2Z33 A;  1JKQ C;  1OR7 C;  1V55 H;  1YIJ I;  4KIG A;  1VQ8 I;  5D5X B;  2CJJ A;  2GAU A;  1DQU A;  2IW5 A;  1S5L C;  3R4K A;  2CQX A;  3DEE A;  1HKS A;  2ZME C;  1U78 A;  3IP4 B;  1FOX A;  1KON A;  5EDN A;  3E6M A;  4C2M J;  2Z9O A;  5HLI A;  3PUF A;  1Y6I A;  4E70 A;  2NNY A;  5CPR B;  2HYG D;  3SDG A;  2EZI A;  3FDY A;  3RI4 A;  5L3E A;  5ICF A;  2V4J C;  2EFQ A;  3HRM A;  2IGK A;  4E6K G;  2CQK A;  4MGR A;  3FXQ A;  3OSF A;  4LOC A;  4AU7 A;  1TQI A;  1VTN C;  1W0T A;  3DKY A;  3FK7 A;  1OPC A;  3K70 C;  1G4D A;  1B59 A;  2LVS A;  2VIX A;  5HNF A;  4FTH A;  5C4J J;  5J3L A;  4OIP F;  1RC9 A;  3A02 A;  2K7L A;  2YX4 A;  4HX8 A;  5LRR A;  2ZCW A;  1WPK A;  1SFE A;  2WAQ A;  3N4M A;  1FBS A;  3GWZ A;  1VQM I;  4LG0 A;  3CTA A;  4R79 A;  1AWC A;  2LLK A;  1M1E B;  2STW A;  4E7L A;  1L0O C;  4B1R A;  2H94 A;  2VXD A;  3S93 A;  2KRH A;  2EV0 A;  3HXL A;  3M8E A;  2X1E A;  2ZXJ A;  3TW6 A;  4EAT A;  4KIS A;  2NYX A;  1Z3Y A;  1VND A;  1BI1 A;  2M30 A;  1YW8 A;  4OIO F;  3PIO F;  3H0D A;  2ISZ A;  2V6E A;  3BTI A;  1XGN A;  4FET A;  1JJ8 C;  3KP5 A;  3C3W A;  4HNV A;  5ILU A;  4EJU A;  1ZG3 A;  1FLI A;  1O7L A;  5DV5 A;  1QPI A;  2E1M C;  5GAH J;  3MEX A;  3S1Q J;  2RV8 A;  2EH3 A;  2HQ5 A;  4RAF A;  3CO7 C;  4P55 A;  4WXD A;  3CCY A;  3U2R A;  5GPA A;  3LFK A;  1HCR A;  1FJL A;  3G2B A;  3B6A A;  1T0F C;  3G3Z A;  1LPQ A;  2L4M A;  2KT0 A;  2M45 A;  1ZAR A;  2JA8 J;  5F6F A;  1TT5 B;  2JTV A;  3VYU B;  2RQQ A;  4PZJ A;  2MLG A;  3WU1 B;  3FXM A;  1X19 A;  1O3T A;  3CCM I;  4ZTJ A;  4LMY A;  2HYJ A;  3WTT C;  3IH4 A;  5DCF A;  3T8T A;  4R1H A;  2ZB9 A;  3BR2 A;  3Q9S A;  4A3L J;  2DN0 A;  4EJT A;  3DKX A;  2VE9 A;  3OS0 A;  1TNS A;  1SAX A;  1JUM A;  2VLA A;  2CW7 A;  3HG9 A;  1HQC A;  1CF7 B;  3OYF A;  1D1B A;  1E3O C;  3Q0U A;  1FOW A;  2WAD A;  3HSR A;  4M3D A;  2JUG A;  4Y13 A;  3PIP F;  1ZEL A;  3I56 I;  3D1N I;  2D1H A;  1N77 A;  2KHM A;  2W1O A;  1TL8 A;  3H92 A;  3TO7 A;  5F08 A;  1OYW A;  1IG7 A;  2OU2 A;  1GT0 C;  3RKW A;  1IC8 A;  2E35 A;  2NNN A;  1EH8 A;  4M3E A;  1SD6 A;  2Z5U A;  5J1U A;  3CCU I;  2M7A A;  2O9L A;  3DPU A;  2V7F A;  3ZCO A;  4KN7 X;  2WAQ N;  3FBI B;  3JAM Z;  1K7A A;  5FJ8 J;  3F9K A;  1LE8 B;  1ORK A;  2WA0 A;  2XVC A;  4D7M A;  3KX2 A;  4HA8 A;  2E7W A;  2RDP A;  4JQF A;  1WGX A;  1O3R A;  2KIF A;  4NB5 A;  1BBY A;  1I5Z A;  5AON A;  4RGS A;  1XG1 A;  2R4G A;  3I64 A;  4F93 B;  1UZC A;  1NK3 P;  1W1W E;  2R7R A;  2ZBK A;  4UUT A;  1BJA A;  2ECC A;  2X1C A;  2V9K A;  1T08 B;  2NVX J;  1MSE C;  3VSL A;  2FUG 2;  2B9S A;  2OZ6 A;  5GTI C;  1Z91 A;  3H3U A;  3K4L A;  4C2U A;  2WBM A;  3LOC A;  2VBZ A;  1U9N A;  2V6C A;  2L7K A;  3BDD A;  4IQ4 A;  4ZJZ A;  4UVB A;  4XKC A;  4V2G A;  5HOO A;  4RB2 C;  2DA2 A;  2EFP A;  1BW6 A;  4MFE A;  4G7Z F;  4HF1 A;  4PJ0 C;  2XRL A;  1ETV A;  1Z21 A;  5J8C A;  1E0E A;  2L7F P;  3KET A;  4GXO A;  3NWS A;  2WC2 A;  4U87 A;  1X3W B;  3IL2 A;  4MFD A;  3GZ6 A;  4K2E A;  2KRC A;  3EYI A;  4GRI A;  5TGT A;  1ZG1 A;  3LSK A;  3BOQ A;  2HOT A;  3BR5 A;  3JRH A;  1XTA A;  1MBH A;  3J80 Z;  1DP3 A;  1X1C A;  1FWZ A;  1U0J A;  2DQL A;  5IP7 J;  3WGI A;  5D4R A;  2XF5 A;  2DA3 A;  3E97 A;  2DFI A;  1G3S A;  1JGG A;  1X1B A;  3GTK J;  1MMD A;  2RGV A;  3F23 A;  2HOE A;  3IKT A;  2JUC A;  1ZTR A;  1WFX A;  2IA1 A;  3AKZ A;  4A12 A;  2K5C A;  1QBJ A;  4XKW A;  2EBI A;  2GBY A;  3S17 J;  2DCE A;  3KP6 A;  2P5L C;  3BJA A;  3RPQ A;  2G7U A;  1LQ1 A;  5K7H A;  3JCU C;  2LKS A;  3GVA A;  1ZLK A;  1SD4 A;  4ZDP A;  2V9V A;  1FIP A;  3EQL F;  4MLO A;  1WJA A;  4DBQ A;  4HV5 A;  2X85 A;  1T2K A;  2P5V A;  2R92 J;  4G12 A;  3N97 A;  1G3T A;  2OD5 A;  2HZD A;  3DU5 A;  3R6S A;  4E7S A;  1IW7 F;  3H5R A;  2KL4 A;  5EG0 B;  2MAB A;  4F55 A;  2RC4 A;  3FBN B;  4C3J J;  5IT9 K;  2WV0 A;  3O8G A;  1G59 A;  3OWT A;  4AVZ A;  2DTR A;  3KE2 A;  2FQ4 A;  3S2H J;  3HKZ A;  1XGM A;  2PMH A;  2FE3 A;  2BXZ A;  3JSP A;  4RGR A;  3M1E A;  1XC5 A;  1ZQ3 P;  2X0L A;  2XSJ C;  2R5Z B;  4HBL A;  5HS7 A;  4XRS G;  1AA7 A;  1WJ5 A;  2DT7 B;  4PK4 A;  4MHG A;  1ENH A;  5L3D A;  2DJN A;  4Z6Y A;  1BL0 A;  1BR2 A;  4HLY A;  1RUO A;  3GTL J;  3WOD F;  1A31 A;  5FFZ A;  3D0S A;  4ZZL A;  3DQV C;  2HQA A;  3L09 A;  1ZGA A;  3BR6 A;  2DYS H;  5HLT A;  2LRD A;  4GGG A;  3MCZ A;  3A01 B;  2LH9 A;  2F4O B;  4XRS A;  4M74 A;  4UUS B;  3H9Q A;  5E1Z B;  1AU7 A;  2VOP A;  4EQQ A;  3V7S A;  2K86 A;  2QBY B;  3H5N A;  5GAE J;  1WJE A;  3FIS A;  4ZDL A;  2ZJP F;  4JK1 X;  5LGU A;  2P81 A;  3CMY A;  4I76 A;  1HST A;  1I39 A;  2DK8 A;  4EGZ A;  2OTJ I;  2AS5 F;  2ZME B;  2DYR H;  1LDK B;  2W7N A;  3HIF A;  4HQM A;  4OIR F;  3ZP5 A;  3QPS A;  3QP5 A;  1XMK A;  3JSO A;  2DOF A;  1YHQ I;  4QLC U;  4MNU A;  1V5G A;  1RNL A;  4Y15 A;  4JX4 A;  1ETW A;  3O2P E;  1IXR C;  4HST A;  2JPC A;  3H3Z A;  4V2F A;  4E7K A;  4NHJ A;  2DLL A;  4A2U A;  1WQ2 A;  1R71 A;  1BA5 A;  5EYR A;  3HUG B;  2CQQ A;  3DLL F;  2YU9 J;  4XLN F;  4XLP F;  4CGZ A;  4N9I A;  1CQT A;  3QP6 A;  4I98 B;  1MJA A;  5BNG A;  2L9N A;  3HJE A;  1DGR M;  4LIT A;  5KHD A;  2H8R A;  3UR3 C;  4BL0 B;  4BGD A;  2NXN B;  1X3Z B;  3CF2 A;  1FYL A;  3HKZ N;  1F36 A;  2EV6 A;  4Y3O A;  4O5V A;  3TMO A;  1YFH A;  3C2H A;  5HS9 A;  3PO2 J;  2BXY A;  2HQR A;  4CYC B;  3BG7 A;  4XMY A;  1ZRC A;  5FD5 A;  3MZY A;  2VKH A;  3ZQF A;  2HFH A;  1WI3 A;  3KP4 A;  5DD8 A;  1TLH B;  3S1N J;  3DPL C;  3PFI A;  1A36 A;  4OAZ A;  5EGO A;  2V1N A;  2GXB A;  2KMU A;  4LLN A;  4H0E A;  2CUE A;  4M3G A;  3BR3 A;  3VDX A;  4EV0 A;  4YRV A;  4ESJ A;  1KU2 A;  3EET A;  3HC7 A;  3P9I A;  2E60 A;  3MQ0 A;  1HF0 A;  1B72 A;  1WJB A;  1FOK A;  4M9Z A;  4J01 A;  3ASN H;  2JA5 J;  1GXQ A;  2L7M P;  1WSU A;  1YO5 C;  1X1A A;  4ENJ A;  3F3X A;  2M3A A;  4L9V A;  1ZHF A;  3FF5 A;  1Z67 A;  4PDK A;  5A2Q K;  1G8X A;  2BV6 A;  2ELJ A;  2QM3 A;  3RCO A;  1YQA A;  3HOV J;  1HDD C;  2NS7 A;  4H4K C;  2KRF A;  2A69 F;  1OYY A;  2UWM A;  2CW8 A;  4PJL A;  5EF6 A;  5DM7 F;  4P96 A;  2XB0 X;  2ELK A;  2ELH A;  2EIK H;  2BW3 A;  3F8M A;  4PGG A;  2ZJQ F;  2BY3 A;  4CCM A;  3WGG A;  5BPD A;  3FZV A;  2QUF A;  4CH7 A;  2R7U A;  3QOD A;  3J7A O;  2B7E A;  3L2R A;  3PJR A;  4XOR A;  5FLM J;  1S7E A;  4QSH A;  5K1Y A;  5FB2 A;  5BS6 A;  2R7Z J;  2TCT A;  4KIF A;  2GA1 A;  4ZYE A;  3G1M A;  5DCM A;  3HSE A;  1MBG A;  4HNT A;  5B1A H;  3S3O A;  4DJA A;  2FOW A;  1H9G A;  3AG4 H;  2NVT J;  5E3O A;  3HBL A;  2AQF A;  3DXJ F;  1WH7 A;  3GBG A;  3K4K A;  3H35 A;  5HLG A;  3ZGK A;  3HTU A;  1BI0 A;  3K4C A;  3P7N A;  3J7Z I;  3CQZ J;  2E71 A;  4ZYG A;  1MJ9 A;  2L9S A;  3ABL H;  5D6F A;  3LMM A;  4N4O B;  3OYC A;  4KN4 X;  2JA6 J;  2BVL A;  1KU9 A;  3DTK A;  3CD6 I;  2DFF A;  1I3A A;  3PQK A;  2R7O A;  1IF1 A;  2IT0 A;  1UMQ A;  4MEX F;  3I4N J;  5LD2 C;  3CC2 I;  3F6O A;  4QWQ A;  3GX4 X;  2DA6 A;  3SZT A;  2BOL A;  2LK2 A;  3I59 B;  1SVO A;  1VZ0 A;  1TC3 C;  2LBF A;  1T8I A;  2FNP A;  4GDF A;  3WGH A;  3K4M A;  4NC6 A;  2ZJR F;  3KLN A;  2VJJ A;  3QYE A;  4E7H A;  4DYC A;  3CCR I;  2F2E A;  2M34 A;  3L2V A;  3S1R J;  1W5S A;  3CCV I;  1RZ4 A;  2MFZ A;  2TDX A;  3F22 A;  1S29 A;  1REP C;  3E1S A;  2F5D A;  2GIZ A;  3HM5 A;  1ZR4 A;  2P7C B;  3A2K A;  1I27 A;  3BPV A;  4Y33 A;  4MTD A;  1IRZ A;  2XAQ A;  1HDP A;  2O8X A;  4OIN F;  1MJB A;  4GFB A;  2GA2 A;  5D8K B;  1S6L A;  2COM A;  5E3L A;  5E8G A;  5F04 A;  2GOX B;  1KYW A;  4HOB A;  4F52 A;  2M4K A;  1AKH A;  1MH4 A;  5L3F A;  1BOA A;  3L2W A;  5F1R A;  1W7P D;  2RVC A;  3HRS A;  4MO7 A;  2A5W A;  4U0Y A;  1HLV A;  4AM3 A;  4BJ5 C;  5IOY A;  2LFB A;  4BJ6 C;  5E1W A;  1ITY A;  2I8D A;  4EGY A;  4LD5 A;  2R5Y A;  2JRM A;  2KJC A;  3HGY A;  2JJ7 A;  3TO9 A;  4L0Y B;  2VKD A;  2VC1 A;  2QYO A;  4L5J A;  3BCA A;  4IEJ A;  2W84 A;  4Q5S F;  2DO7 A;  5IY5 H;  1IUF A;  4LK1 F;  2JVG A;  2MC4 A;  3FX3 A;  3KCC A;  3K4B A;  3ZOB A;  1Y8R B;  1ON1 A;  1BI3 A;  5FKO A;  1JE8 A;  3W6V A;  3H36 A;  4UNO A;  5E3N A;  3FHZ A;  2HVS A;  4FX4 A;  4A0X A;  2QSG X;  4IHX A;  3QYB A;  3G6E I;  4MIM A;  1JHH A;  5HDN A;  4HAM A;  4F91 B;  3OY9 A;  1QRY A;  3FIW A;  2XSD C;  4OOI A;  5KCM A;  5LGT A;  1I50 J;  2M87 A;  4W1U A;  5JHF A;  2NRA C;  2DW4 A;  1YW7 A;  2ZXI A;  4W97 A;  3EPZ A;  4HLX A;  3GXO A;  1IN4 A;  2O5R A;  4CCN A;  1PUF A;  2XDV A;  2ACJ A;  4ZDO A;  2CUJ A;  1KA8 A;  2KZG A;  4HX4 A;  3ZN0 A;  1MD0 A;  4B4C A;  1Y1W J;  2MG4 A;  3FXR A;  3DEU A;  4WX9 A;  1U5T C;  1XX5 A;  1YIT I;  3B02 A;  5DUI A;  1H89 C;  2G0E A;  4DNC A;  4BE2 A;  2RRE A;  3HTS B;  4PSX A;  2HKX A;  2LNB A;  3QU3 A;  2X6Y A;  5HDG A;  1ZRF A;  3VYS B;  2FSW A;  2JN6 A;  1MND A;  2YPR A;  3ECH A;  4G8X A;  3LST A;  4A3G J;  2OBP A;  2ZNZ A;  3P9K A;  1FMV A;  4XBF A;  5CVI A;  2F5E A;  5LFA A;  3LNQ A;  1W7P B;  1KGS A;  1Z1D A;  3OL4 A;  2XAS A;  5LGN A;  1J59 A;  2HTS A;  2OPT A;  5LEK A;  2W57 A;  4XON A;  1K4S A;  1B6A A;  3NWT A;  4HYE A;  5J1R A;  1E3P A;  3VSK A;  2OC6 A;  1UST A;  3OS1 A;  3JAM K;  1KU3 A;  4RLQ A;  2QQ9 A;  3F0C A;  4XQF A;  2K9N A;  3B6C A;  3J81 Z;  1MSF C;  1ZLJ A;  1W5C C;  2EV5 A;  4L9N A;  4OMZ A;  3BG6 A;  2E1C A;  1P4A A;  2ZSH B;  2ME0 A;  3F8B A;  4A6D A;  2EK5 A;  3PSF A;  3KP2 A;  2Q2E A;  1S7A A;  5D5V B;  1VF9 A;  3CC7 I;  3NAR A;  1R00 A;  3SDB A;  2P8T A;  3FM5 A;  4EM0 B;  2M7B A;  2Y48 A;  2J5O A;  2PJP A;  1R22 A;  1W5T A;  1APL C;  1SAN A;  3JRD A;  1X3U A;  4A3I J;  3LSM A;  1FYK A;  2PX9 A;  3U9G A;  3PQJ A;  2PJR A;  1QZE A;  2K40 A;  2D5V A;  4BJT A;  2LF7 A; 
#chains in the Genus database with same CATH homology
 5K5Q A;  2OZU A;  4A5N A;  1QO0 D;  2QLZ A;  2VC0 A;  3GO5 A;  1UCR A;  2PI0 A;  3VFZ A;  4BQA A;  1ZN2 A;  3CDH A;  1TTY A;  2EFN A;  3M9A A;  1O7F A;  5LLQ A;  5LEJ A;  2H6C A;  4HZF A;  1K78 A;  2EFO A;  4A0Z A;  3SFZ A;  3J80 K;  1DP7 P;  4KMU X;  2BEO A;  1PP7 U;  3HOS A;  4CDG A;  3W6J B;  1IXC A;  1F1Z A;  1QPM A;  2CGP A;  1BIB A;  2VBY A;  5FD6 A;  4ZH4 F;  4WXH A;  3BWG A;  2CSO A;  3BPX A;  4I09 A;  4KNY A;  2PFB A;  3QPH A;  2F5C A;  2HEO A;  1FY7 A;  3IWZ A;  4I7H A;  4BAY A;  1Z9C A;  5H6Q A;  5CVJ A;  4O3M A;  3OV8 A;  4LGW A;  1SFX A;  5D6E A;  1FP1 D;  1SD5 A;  2CO5 A;  3FXU A;  4ON0 A;  1BC8 C;  3SQN A;  4P9U A;  2OA4 A;  3CUQ A;  3ZN1 A;  3BY6 A;  5J6X A;  1FC3 A;  2XKP A;  4BHC A;  5DDG A;  3D5L A;  3RKX A;  1YYV A;  5CLS A;  4NQW A;  1R5G A;  2CW0 F;  3GFI A;  1H9T A;  4GO1 A;  3SXY A;  2JSC A;  1MGT A;  1HKQ A;  1XD7 A;  3K2Z A;  1SD7 A;  3RKY A;  2HR3 A;  1A04 A;  3CLO A;  5FFX A;  2MH9 A;  4YFN F;  3KEQ A;  1B9M A;  3M8F A;  1DUX C;  4AVP A;  3BJ6 A;  3ZMU A;  4F7Z A;  3TO6 A;  4HQE A;  3HRT A;  2V1X A;  1P92 A;  1ZAO A;  2QBY A;  1IN5 A;  1OR7 A;  2ADU A;  4EJO A;  5TJJ A;  2RQP A;  2GZW A;  3LQQ A;  2ZO4 A;  1K79 A;  3WTZ A;  3V7C A;  5ERI A;  5HS8 A;  5JVT A;  4TV7 A;  3DKW A;  5FGM A;  1FSE A;  5L3B A;  3BZ6 A;  1ON2 A;  3GFJ A;  4LG0 B;  2IJL A;  3HUG A;  4EM1 A;  3VB2 A;  1KQ0 A;  4CXF A;  4DQ2 A;  2IA0 A;  4CO8 A;  2DK5 A;  2XHK A;  2DPU A;  3L9F A;  1G6N A;  1ZRD A;  3LAP A;  3E6B A;  5BOX A;  1RIO H;  2LDU A;  3K69 A;  2Y0M A;  2Z99 A;  1NHA A;  5D8L B;  1FBU A;  1L3L A;  5FLX Z;  2XIG A;  3RJP A;  4OMY A;  3FMS A;  2VBW A;  2JZY A;  1ZGJ A;  4BH9 A;  2LSO A;  4S05 A;  1T0F A;  2VN2 A;  2DPD A;  3ZMV A;  2MH2 A;  4P5O A;  1U5T B;  1XB4 A;  5L3G A;  3L00 A;  3F21 A;  4CHU A;  1HXD A;  3BP8 A;  3TOA A;  3ROU A;  2K4J A;  3LQR A;  3ZQ7 A;  2FBK A;  4G9Y A;  4ZYD A;  2YX7 A;  1R5H A;  3NQO A;  2UXN A;  2O03 A;  2VE8 A;  3I0T A;  2CFX A;  4HDU A;  1SFU A;  1YS6 A;  2FMY A;  3F8F A;  3FM3 A;  2BE5 F;  2FA5 A;  3COA C;  2G7H A;  2R7F A;  4RB1 A;  1P2F A;  2L01 A;  1ZH5 A;  5AIQ A;  2OQR A;  3KP3 A;  5F64 A;  3KFW X;  3R61 A;  5ILS A;  4UVA A;  2EWN A;  1FP2 A;  1P4W A;  3V8J A;  3ZPL A;  1S7O A;  2HS5 A;  3HHG A;  4M72 A;  1Z6R A;  5LHG A;  4G94 A;  2L54 A;  1Z05 A;  2P4W A;  1WI9 A;  5CVR A;  5E20 A;  1TQM A;  1O57 A;  4N0B A;  3I53 A;  1HBX G;  1IUY A;  3VOD A;  3E5X A;  4OIQ F;  5CJ9 A;  2MD5 A;  1QNT A;  1LJ9 A;  1YTY A;  2IA2 A;  4LB5 A;  5EEG A;  2JRT A;  3DP7 A;  3AAF A;  1J75 A;  1W4M A;  1IN8 A;  3IRQ A;  1YW9 A;  3L7W A;  3LAJ A;  2RKH A;  2GQQ A;  2L3D A;  1HW2 A;  4LFU A;  5LBQ A;  3ERE D;  1G3W A;  2FXA A;  2LF8 A;  3NEU A;  3KEO A;  3G73 A;  4KIB A;  5EEH A;  1D3Y A;  2R7D A;  3ZMT A;  4WF2 A;  1TNT A;  3NRV A;  4ENM A;  2MBF A;  4UV8 A;  4U0W A;  1HKT A;  2NS0 A;  1ONV A;  3CJN A;  2GXG A;  4KMF A;  4G6Q A;  2EB7 A;  4M6X A;  1IRF A;  1J9I A;  3EDP A;  1IN7 A;  4LK0 F;  3KZZ A;  4HW0 A;  2K4B A;  3WU0 A;  1EV7 A;  4FT8 A;  3WTW C;  6PAX A;  1XDU A;  2HYF A;  1XDS A;  3MWM A;  4PCQ A;  3RYP A;  2IRF G;  2B0L A;  2FOK A;  2MLK A;  1V3F A;  1MDM A;  1V4R A;  2MC3 A;  1FPQ A;  1XCV A;  1PDN C;  1PUE E;  3J81 K;  1XSV A;  2P7V B;  4S04 A;  2STT A;  3VEP A;  3V7R A;  1B1B A;  1ULY A;  1IXS B;  2V1D A;  2BBY A;  3T1B A;  1FSH A;  4RAY A;  1S3J A;  2H27 A;  5H6R A;  2QQB A;  2XUB A;  3LA3 A;  2E7X A;  3DPT A;  2O6G E;  2J5P A;  3T5X A;  1RUN A;  1MZB A;  3Q5F A;  5E17 F;  4MQ9 F;  4WCG A;  2A07 F;  1J0R A;  1YLF A;  2WWY A;  2HWV A;  4N9H A;  2IP2 A;  2XRN A;  4HF2 A;  3TOB A;  1EH7 A;  1BM9 A;  1H0M A;  2FNA A;  5HVQ C;  3E6D A;  2QZ8 A;  1XSX A;  1YIO A;  1ZYR F;  3EYY A;  3SZP A;  3DFG A;  1OYI A;  5ICE A;  4KUM A;  2PG4 A;  1E17 A;  3F72 A;  4RAZ A;  2D2W A;  2A6E F;  5DEQ A;  3QRF F;  4XSZ F;  4L5I A;  3WTV C;  1U8R A;  1WRJ A;  5DCM B;  3CUQ C;  1D8J A;  1E2X A;  4IPA A;  4UVC A;  1GXP A;  1F4K A;  3MZH A;  3E3V A;  4RGX A;  4Q47 A;  1CF7 A;  1OKR A;  1DPR A;  5J8F A;  4IXA A;  1KQ9 A;  4RB3 C;  5JHU A;  1BIA A;  4FHT A;  3K1N A;  3WTX C;  1HSJ A;  5L3C A;  1OMI A;  4CIC A;  1DPU A;  4AWX B;  2EA2 A;  2HDC A;  2YU3 A;  4I02 A;  1HW1 A;  3RDI A;  1ZG5 A;  4HX7 A;  1XN7 A;  2QEN A;  4AIH A;  5HDK A;  2DU9 A;  4FX0 A;  1LB2 A;  3V8K A;  1FNN A;  4U88 A;  4KIC A;  1UHM A;  4G6D A;  1Z7U A;  2O0Y A;  2GWR A;  1D8K A;  3WTS C;  3WG9 A;  4U7D A;  4M9X A;  3HYI A;  4BXU A;  4IHT A;  4ASN A;  4MQV A;  3ABT A;  3RYR A;  1T38 A;  4M6Y A;  2VBX A;  4ENK A;  4YFX F;  5DYM A;  5FO5 A;  3ZMD A;  1MKM A;  2EJR A;  4B09 A;  3TGN A;  1R23 A;  4I0A A;  3HHH A;  3BRO A;  5JR3 A;  3JW4 A;  1U6G A;  2FF4 A;  3DV8 A;  1UFM A;  5LRS A;  1R1V A;  2R3S A;  4HV6 A;  4BYY A;  1LDD A;  4OU0 A;  3QOP A;  4UUV A;  2H09 A;  4L9J A;  5E1X A;  4LLG F;  2ISY A;  5TRD A;  2FQ3 A;  4EMS A;  5K5R A;  5FLX K;  4EJW A;  1KU7 A;  3ISP A;  5BMZ A;  4UXN A;  1JXS A;  1I1S A;  1YG2 A;  1U3E M;  4P9F A;  2ZKZ A;  3ABU A;  1DDN A;  2A5Y B;  5JFR A;  3I54 A;  3JTG A;  4RS8 A;  3K1P A;  2VOD A;  4D0P A;  2A6H F;  3F8C A;  2CG4 A;  1J5Y A;  1U5T A;  2LKP A;  1GVJ A;  1BN5 A;  2YSR A;  1QQI A;  3GUD A;  1J2X A;  2X4H A;  1BI2 A;  3CO6 C;  2JT1 A;  2IPQ X;  2EFW A;  2P6T A;  1RI7 A;  2DBB A;  5CVU A;  5ICC A;  3IWF A;  3O6B B;  4GCV A;  3CUO A;  2DAO A;  2ETH A;  2FBH A;  1WKM A;  1Q1H A;  1IAW A;  1KYZ A;  1IRG A;  3E5U A;  2HGC A;  2Z3Y A;  3K0L A;  4EJV A;  2PN6 A;  2ZME A;  3GEZ A;  3RTR A;  5JI6 A;  2Q0O A;  2L4A A;  2C6Y A;  3TKY A;  2XV4 S;  4RB0 A;  2VT3 A;  4U7B A;  2IVM A;  3R0J A;  3S2W A;  3QAH A;  3C7J A;  2M5W A;  4JBA A;  2QQA A;  1R1T A;  4UV9 A;  3K9T A;  3GW2 A;  4XSX F;  3HOT A;  3ELK A;  2DT5 A;  3R60 A;  5DUK A;  1K78 B;  2Q8K A;  2RN7 A;  3FMQ A;  3L2C A;  1AOY A;  3WE2 A;  2A61 A;  2YR2 A;  2P5K A;  5D4S A;  2PBI A;  1F5T A;  4ZYH A;  4Q48 A;  1F9N A;  2KJB A;  3HSF A;  1XCB A;  4ESB A;  3EUH A;  4YII A;  4IRH A;  3ECO A;  2FRH A;  2HKO A;  1T39 A;  3I71 A;  4WWC A;  4AD9 A;  3ULQ B;  4L18 B;  1LEA A;  3CUQ B;  2Y75 A;  2PMU A;  1G3Y A;  2L02 A;  2OQG A;  4L0Z B;  4GYG A;  2BGC A;  5H20 A;  2HZT A;  4XRF A;  1T98 A;  1O3S A;  2V1U A;  1Z6T A;  2FML A;  2KIM A;  1LEB A;  3VOE A;  3TDZ C;  3F8N A;  4RGU A;  1B9N A;  4CZZ A;  1FT9 A;  3WTU C;  4KFC A;  1Y0U A;  4IRI A;  4ESF A;  1STZ A;  4BHB A;  4G7O F;  4I01 A;  4KYW A;  3BJO A;  3GFL A;  4I0B A;  2W25 A;  2ZNY A;  3MAJ A;  2F5F A;  1O3Q A;  5ILV A;  3I59 A;  1P6R A;  2FEZ A;  2M8E A;  2UXX A;  3M7G A;  3IKV A;  4IRG A;  5DD4 A;  3MFK A;  1QZZ A;  2W85 A;  3ZMZ A;  4A0Y A;  5LHH A;  2M1B A;  2ESH A;  4UHT A;  4AIJ A;  3R0A A;  3V4G A;  1R58 A;  2XGX A;  1TW3 A;  3I5U A;  1USS A;  5D5U B;  4IF4 A;  1R7J A;  2FBI A;  2XAG A;  4CYD A;  2GIV A;  2VOO A;  4A5M A;  2ZFW A;  3C18 A;  3LA2 A;  4LLL A;  3GYH X;  2AXL A;  5HLH A;  3C1D A;  5D5W B;  2BYV E;  3GF2 A;  2K27 A;  5IT3 A;  3E6C C;  1IN6 A;  4A6E A;  1ODD A;  3B73 A;  2HTJ A;  3IHU A;  4I2O A;  1LVA A;  1FZP B;  2G9W A;  1J7K A;  4BHP A;  3FWE A;  4KDP A;  1XMA A;  4EM2 A;  2WTE A;  3T0Y A;  2CWE A;  2XRO A;  2XAH A;  4HF0 A;  2UZK A;  4BNC A;  3FMR A;  1PP8 F;  5IT9 Z;  1I6X A;  4LB6 B;  3IC7 A;  1K6O A;  3P9C A;  4B8X A;  2DI3 A;  4Q4Z F;  4GYI A;  4R8H A;  1CGP A;  2E1N A;  4HDV A;  2A68 F;  1TW2 A;  2ESN A;  1JHF A;  2XAJ A;  4IJA A;  2PLY A;  1BC7 C;  2D45 A;  2MA3 A;  3WTY C;  5AIP A;  3LWF A;  2ZJ2 A;  3REO A;  2K02 A;  5K5O A;  1ZRE A;  1S8N A;  3I4P A;  4LJZ F;  2VON A;  1JGS A;  1W7P A;  2HQN A;  3RPU A;  3DF8 A;  4AIK A;  1IZ1 A;  4O6J A;  3HRU A;  2VT2 A;  4Y17 A;  3GZ5 A;  4YG2 F;  2PQ8 A;  4M73 A;  2RNJ A;  3QPT A;  4WK8 F;  1I1G A;  1SMY F;  2VXZ A;  4EVI A;  3SHF A;  3V8L A;  2P6S A;  5ED4 A;  2V79 A;  4PGH A;  3T8R A;  2NAZ A;  5E8I A;  5KVR A;  2XAF A;  3GLX A;  1R36 A;  1WWX A;  3LA7 A;  1FYM A;  4WXC A;  4ZZD A;  3KP7 A;  5BQT A;  1UB9 A;  2KIU A;  5E18 F;  5BPI A;  4MEY F;  1LNW A;  1TQP A;  3QU6 A;  2KKO A;  5KK1 A;  4IHS A;  4KT5 C;  4YFK F;  1KQ8 A;  2A3S A;  1GHC A;  4M71 A;  1EH6 A;  3F6V A;  1XSD A;  1QGP A;  3TQN A;  4YIF A;  1R1U A;  2D1V A;  2DQR A;  4M9S A;  3KLO A;  3ZMS A;  1YS7 A;  2O3F A;  3O3K A;  2QVO A;  5A2Q Z;  3JTH A;  2CYY A;  1FBQ A;  2XKO A;  3KZY A;  4G7H F;  3GFM A;  2EA4 A;  4MTE A;  4ETS A;  3IRR A;  5CVV A;  1B4A A;  3U1D A;  4Z2Y A;  1HW5 A;  2QWW A;  4KA4 A;  1FX7 A;  2JPB A;  3ML6 A;  5CYV A;  3I58 A;  3TDU C;  4U0V A;  1P4X A;  2PEX A;  4ENN A;  3K1M A;  1TBX A;  2H6B A;  1XGO A;  3E5Q A;  3OOP A;  1C0W A;  2O61 A;  3Q9V A;  1XGS A;  1LDJ A;  4IVN A;  2FU4 A;  1MDM B;  4L9T A;  1SMT A;  2OAZ A;  3WE3 A;  3W6K B;  1UHW A;  1QZY A;  2W24 A;  1U2W A;  1D5V A;  5LHI A;  5ICG A;  3RIR A;  1T6S A;  2Z33 A;  4KIG A;  5D5X B;  2GAU A;  2IW5 A;  3R4K A;  1HKS A;  1U78 A;  3E6M A;  2Z9O A;  5HLI A;  4E70 A;  2NNY A;  2HYG D;  3RI4 A;  5L3E A;  5ICF A;  3HRM A;  2EFQ A;  2CQK A;  4MGR A;  3FXQ A;  1VTN C;  1TQI A;  1OPC A;  1G4D A;  1B59 A;  4OIP F;  2K7L A;  2YX4 A;  4HX8 A;  5LRR A;  2ZCW A;  1SFE A;  3N4M A;  1FBS A;  3GWZ A;  4LG0 A;  3CTA A;  4R79 A;  1AWC A;  2STW A;  1L0O C;  2H94 A;  3M8E A;  2EV0 A;  2ZXJ A;  2NYX A;  1BI1 A;  2M30 A;  1YW8 A;  4OIO F;  2ISZ A;  1XGN A;  3KP5 A;  3C3W A;  5ILU A;  4EJU A;  1ZG3 A;  1FLI A;  1O7L A;  5DV5 A;  3MEX A;  2RV8 A;  3CO7 C;  4P55 A;  4WXD A;  3U2R A;  3LFK A;  3G3Z A;  2L4M A;  2M45 A;  1ZAR A;  5F6F A;  2JTV A;  4PZJ A;  2MLG A;  3WU1 B;  1O3T A;  4LMY A;  3WTT C;  5DCF A;  3T8T A;  4R1H A;  3Q9S A;  4EJT A;  2VE9 A;  1TNS A;  1SAX A;  1HQC A;  1CF7 B;  3HSR A;  4Y13 A;  2D1H A;  3H92 A;  3TO7 A;  1OYW A;  2OU2 A;  3RKW A;  2NNN A;  1EH8 A;  1SD6 A;  2Z5U A;  4KN7 X;  3JAM Z;  1K7A A;  2XVC A;  4HA8 A;  2E7W A;  2RDP A;  4JQF A;  1O3R A;  4NB5 A;  2KIF A;  5AON A;  1BBY A;  1I5Z A;  4RGS A;  3I64 A;  2ZBK A;  1BJA A;  2OZ6 A;  1Z91 A;  3H3U A;  2VBZ A;  2V6C A;  3BDD A;  4UVB A;  5HOO A;  4RB2 C;  2EFP A;  4G7Z F;  4HF1 A;  5J8C A;  3KET A;  4GXO A;  2WC2 A;  3IL2 A;  3GZ6 A;  4K2E A;  3EYI A;  1ZG1 A;  3BOQ A;  3J80 Z;  1FWZ A;  2DQL A;  3WGI A;  5D4R A;  3E97 A;  2DFI A;  1G3S A;  2RGV A;  3F23 A;  2HOE A;  3IKT A;  2IA1 A;  4A12 A;  1QBJ A;  3KP6 A;  2P5L C;  3BJA A;  3RPQ A;  2G7U A;  1LQ1 A;  3GVA A;  1ZLK A;  1SD4 A;  2V9V A;  3EQL F;  4HV5 A;  1T2K A;  2P5V A;  3N97 A;  1G3T A;  2OD5 A;  3R6S A;  1IW7 F;  2RC4 A;  5IT9 K;  2WV0 A;  2DTR A;  3KE2 A;  1XGM A;  2PMH A;  2FE3 A;  3JSP A;  4RGR A;  3M1E A;  2X0L A;  4HBL A;  5HS7 A;  4MHG A;  5L3D A;  4HLY A;  1RUO A;  3WOD F;  5FFZ A;  3D0S A;  4ZZL A;  3DQV C;  3L09 A;  1ZGA A;  4GGG A;  3MCZ A;  4M74 A;  5E1Z B;  2VOP A;  4EQQ A;  3V7S A;  2K86 A;  2QBY B;  4JK1 X;  5LGU A;  1HST A;  2DK8 A;  4EGZ A;  2AS5 F;  2ZME B;  1LDK B;  3HIF A;  4HQM A;  4OIR F;  3ZP5 A;  3QP5 A;  1XMK A;  3JSO A;  4QLC U;  4MNU A;  1RNL A;  4Y15 A;  3O2P E;  1IXR C;  2JPC A;  3H3Z A;  4NHJ A;  2DLL A;  4A2U A;  1WQ2 A;  4XLN F;  4XLP F;  4CGZ A;  4N9I A;  3QP6 A;  4I98 B;  1MJA A;  1FYL A;  2EV6 A;  4O5V A;  1YFH A;  5HS9 A;  2HQR A;  1ZRC A;  5FD5 A;  3MZY A;  2HFH A;  3KP4 A;  5DD8 A;  1TLH B;  3DPL C;  3PFI A;  2GXB A;  4LLN A;  4H0E A;  4ESJ A;  4EV0 A;  1KU2 A;  3EET A;  3P9I A;  3MQ0 A;  1FOK A;  4M9Z A;  1GXQ A;  1WSU A;  1YO5 C;  4ENJ A;  3F3X A;  4L9V A;  1ZHF A;  3FF5 A;  4PDK A;  5A2Q K;  2BV6 A;  2QM3 A;  1YQA A;  2KRF A;  2A69 F;  1OYY A;  2UWM A;  4P96 A;  2ELH A;  3F8M A;  4PGG A;  5BPD A;  3WGG A;  3FZV A;  2QUF A;  3J7A O;  5K1Y A;  5FB2 A;  5BS6 A;  4KIF A;  2GA1 A;  4ZYE A;  5DCM A;  3HSE A;  1H9G A;  3DXJ F;  5HLG A;  3HTU A;  1BI0 A;  3P7N A;  4ZYG A;  1MJ9 A;  5D6F A;  4KN4 X;  1KU9 A;  3PQK A;  1IF1 A;  2IT0 A;  4MEX F;  3F6O A;  4QWQ A;  3SZT A;  3I59 B;  2FNP A;  3WGH A;  3KLN A;  2F2E A;  1W5S A;  1RZ4 A;  2TDX A;  3F22 A;  1S29 A;  1REP C;  2F5D A;  2P7C B;  1I27 A;  3BPV A;  4MTD A;  2XAQ A;  2O8X A;  4OIN F;  1MJB A;  2GA2 A;  5D8K B;  1S6L A;  2COM A;  5E8G A;  1KYW A;  4HOB A;  5L3F A;  1BOA A;  5F1R A;  1W7P D;  2RVC A;  3HRS A;  4U0Y A;  5E1W A;  4EGY A;  4LD5 A;  2KJC A;  3TO9 A;  4L0Y B;  2VC1 A;  2QYO A;  4L5J A;  2W84 A;  4Q5S F;  2DO7 A;  4LK1 F;  3FX3 A;  3KCC A;  1ON1 A;  1BI3 A;  1JE8 A;  4UNO A;  3FHZ A;  4FX4 A;  4A0X A;  1JHH A;  5HDN A;  4HAM A;  4OOI A;  5LGT A;  2M87 A;  2NRA C;  2DW4 A;  1YW7 A;  4HLX A;  3GXO A;  1IN4 A;  2ACJ A;  4HX4 A;  1KA8 A;  3ZN0 A;  1MD0 A;  3FXR A;  3DEU A;  4WX9 A;  1U5T C;  3B02 A;  5DUI A;  4DNC A;  3HTS B;  2HKX A;  2LNB A;  3QU3 A;  5HDG A;  1ZRF A;  2FSW A;  2YPR A;  3ECH A;  4G8X A;  3LST A;  2OBP A;  2ZNZ A;  3P9K A;  4XBF A;  5CVI A;  2F5E A;  1W7P B;  1KGS A;  1Z1D A;  5LGN A;  2XAS A;  1J59 A;  2HTS A;  5LEK A;  2W57 A;  1B6A A;  4HYE A;  1UST A;  3JAM K;  1KU3 A;  2QQ9 A;  3J81 Z;  1ZLJ A;  2EV5 A;  4L9N A;  4OMZ A;  2E1C A;  1P4A A;  3F8B A;  4A6D A;  2EK5 A;  3KP2 A;  2Q2E A;  1S7A A;  5D5V B;  1R00 A;  4EM0 B;  2P8T A;  3FM5 A;  2Y48 A;  2J5O A;  2PJP A;  1R22 A;  1W5T A;  1X3U A;  1FYK A;  3U9G A;  3PQJ A;  3GX4 X;  2LF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...