2HGCA

Solution nmr structure of the yjcq protein from bacillus subtilis. northeast structural genomics target sr346.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
KLRYAILKEIFEGNTPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the YjcQ protein from Bacillus subtilis. Northeast Structural Genomics target SR346. (CASP Target)
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YjcQ protein
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09639 YjcQ YjcQ protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hgcA00
1X3UA 2R7DA 2A6HF 4G8XA 3C3WA 3NRVA 3QPHA 3RTRA 4Y13A 3R61A 1LDDA 3P9CA 3F22A 2D45A 5ILVA 4N0BA 1OR7A 4EJTA 1OYWA 2XAHA 4ESFA 4ESJA 4A5MA 1T38A 2YU3A 2PN6A 2CO5A 2HKOA 3SFZA 2HGCA 3LA7A 1JXSA 5JI6A 1LEAA 2BGCA 3FHZA 3K69A 4CHUA 1J7KA 4EVIA 5HS8A 1MD0A 4HAMA 4LFUA 2YSRA 2A07F 1WSUA 3ECHA 3GO5A 3F72A 4MTEA 4AIJA 4BXUA 2G7HA 3TOBA 2DBBA 2P5KA 1XN7A 4TV7A 2NRAC 4GCVA 3V4GA 5LRRA 2ZNYA 1BJAA 4HYEA 4ZZLA 2PQ8A 3F6VA 2LDUA 4RB3C 2K7LA 1G3WA 3KP4A 4G6QA 2P7VB 2HDCA 3I5UA 3IL2A 3MQ0A 4HOBA 2ESHA 5LEKA 1YIOA 4MGRA 1P92A 1R5GA 3ZN0A 4OIQF 4UV8A 5HDNA 1SD4A 4OIRF 5BOXA 4BAYA 2QBYA 2KJCA 4U0VA 3V7RA 3VFZA 2ACJA 4EJWA 5J8CA 4LLLA 2HQNA 2KRFA 3GF2A 3JTGA 5E8IA 2Z99A 1QNTA 5ICEA 1Z1DA 2OU2A 3CUOA 4KDPA 4MHGA 1SMYF 5EEHA 1KYZA 3FM3A 2XGXA 3G73A 4UVCA 1V4RA 1IRGA 2HR3A 2EFWA 3HSEA 2D2WA 1YFHA 3BP8A 4UVAA 3F8MA 5KVRA 3MZHA 1U5TC 2P7CB 5HDGA 1TW2A 4YFNF 2WV0A 2FF4A 3WTVC 3B73A 5H6RA 1J2XA 3GX4X 1TNTA 5FD6A 2JPBA 1DPUA 3ML6A 1O7FA 2ESNA 4JBAA 1ZH5A 1SD7A 1PDNC 4I0AA 1TQMA 5BPIA 1UHMA 3ZMTA 4BHPA 1U6GA 4PDKA 1TW3A 3B02A 1FP1D 4ZYHA 5BQTA 1HW5A 2QZ8A 3C7JA 1XDUA 3LQRA 4OMYA 3EETA 1B9MA 1LB2A 1R00A 3LQQA 1G3YA 2H6BA 5ED4A 1KU3A 1R1VA 2UZKA 1ON2A 2FRHA 1MKMA 5FO5A 4GO1A 3N4MA 4JK1X 2K27A 2E1CA 2Z5UA 3HSRA 1FSEA 3E3VA 3FF5A 4GYIA 1SFUA 2DPUA 3E5UA 2OD5A 3KFWX 2DLLA 1G3SA 3MWMA 2OZ6A 1LEBA 2D1VA 5AONA 3SQNA 4HF1A 4BHCA 4I09A 4L9JA 1HBXG 1ZGAA 2V79A 2K86A 1ZAOA 2P5LC 3M8EA 3MEXA 1ZLJA 2P4WA 2ZJ2A 1H0MA 3BPXA 3GZ5A 3K1NA 4HZFA 3QPTA 4ENMA 3HOSA 4S04A 1ZARA 4MQ9F 1KQ8A 3BWGA 2A3SA 1ULYA 3ABUA 4CO8A 2QVOA 5DUKA 2Z33A 2OBPA 4BHBA 4ESBA 4KUMA 2DI3A 2CFXA 2KIFA 1P6RA 1BC7C 3J81K 4I98B 2COMA 1S7OA 5L3EA 2RC4A 1HW1A 5F6FA 2A5YB 2O3FA 5DUIA 2BBYA 3V7CA 1K7AA 1L3LA 4O3MA 5BS6A 1R1UA 3BJAA 5HS9A 1S29A 3SZTA 3J80Z 4WX9A 1GXQA 1JGSA 1D5VA 3H3ZA 2G9WA 4RAZA 2XASA 2HOEA 1AOYA 1HQCA 1PP8F 4M71A 1YW9A 2XKPA 2O6GE 3E6DA 3BJ6A 4KNYA 3I59B 3KEQA 2Z3YA 1BI0A 2XIGA 1HW2A 2CG4A 1KYWA 4XRFA 3H92A 3ZMVA 4Q4ZF 2L4MA 1GVJA 1QGPA 4G7HF 1EH8A 1V3FA 5DD4A 4HF2A 3K2ZA 2X4HA 5HLGA 4WK8F 5DCMB 2NNNA 2CQKA 3LA2A 2L54A 5D4RA 1L0OC 4M6XA 2O8XA 1XSDA 1IN7A 3P9IA 2IA2A 3MAJA 4Q47A 2BYVE 1FBUA 2DPDA 3PQJA 2QBYB 1BN5A 3TGNA 3QP6A 5K1YA 3V7SA 4R8HA 1T98A 4L9TA 1SFXA 3WGIA 4UUVA 4CDGA 3R60A 1KU7A 2WTEA 2A69F 3GUDA 2MLKA 2Z9OA 2FBKA 1W7PA 3SXYA 1U3EM 2OQGA 3F8CA 1RI7A 2CWEA 2VC0A 1Z7UA 4HQMA 3MFKA 3EYYA 5FFXA 4YIFA 1S8NA 1I27A 3ZP5A 2A61A 1XGMA 1XMKA 2CW0F 4IRGA 1FX7A 2MH9A 5JR3A 2DK8A 2QQAA 4N9IA 1XSVA 4RAYA 3BOQA 4RB1A 3WG9A 1ZLKA 2FNPA 4OU0A 1RIOH 2FOKA 4KIBA 4EJVA 1IRFA 5HS7A 2KKOA 5LGNA 1MJ9A 3KETA 1TTYA 4KN7X 4M72A 1FBSA 2FU4A 4BYYA 5LEJA 2A6EF 3MZYA 4D0PA 4NQWA 5J6XA 3JW4A 1TNSA 4Z2YA 4HDUA 4LGWA 4PGGA 2VBZA 1FPQA 3HRMA 4O5VA 3IRRA 3IWZA 2V1XA 1BM9A 4HX8A 4L9NA 1SMTA 1W5SA 1U5TA 2EA4A 4HA8A 1XCVA 4I01A 5E1WA 3RJPA 1JHFA 3WGGA 4KIGA 3U9GA 1TQIA 4L0ZB 1FYMA 2O03A 3BPVA 1P4AA 2KJBA 3IWFA 2ELHA 4R79A 3DFGA 4LG0A 3L09A 4HLYA 1TLHB 5F1RA 1B59A 1R58A 1I5ZA 2ZO4A 1MZBA 2ADUA 2GA2A 5LGUA 3Q9SA 1RUOA 2HKXA 4MNUA 2R3SA 3KCCA 2XAJA 4BNCA 1QO0D 4NHJA 4CGZA 1C0WA 3P9KA 2H09A 4UNOA 3BJOA 5CVIA 3S2WA 1AWCA 4G9YA 2M45A 1RNLA 3HHGA 2DK5A 1J59A 1HKTA 4ENKA 1KGSA 3DPLC 4HV6A 2QM3A 3FXRA 1D3YA 2EWNA 3WTZA 2XVCA 3WE3A 1ZRDA 1ON1A 1B4AA 3EYIA 3ULQB 4I0BA 1Y0UA 1G4DA 3E5QA 1REPC 4Y15A 1W7PD 3WTTC 4K2EA 4ENJA 3E6MA 1ZN2A 1IAWA 1ZRCA 2E7WA 2W57A 2FSWA 1LJ9A 4EM1A 4IHSA 4PGHA 2VT3A 4ZH4F 3F8BA 3GFIA 1DPRA 1YS7A 4PCQA 2EFOA 1LDJA 1K79A 2FMLA 3E6BA 5DCFA 1D8KA 1I6XA 4WWCA 2B0LA 3RPQA 3RPUA 4RGSA 2J5OA 2VE8A 2HYGD 4P9UA 3I54A 5F64A 4G6DA 2HTSA 2VT2A 1YW8A 1IN6A 2JZYA 3SHFA 1BI3A 1ZG1A 5L3DA 4Q5SF 5KK1A 1ODDA 2HFHA 2J5PA 5CYVA 3DF8A 2RNJA 4U88A 2VN2A 4UXNA 2XUBA 4DNCA 2HYFA 4M9SA 3CO6C 5D5XB 1OYIA 5LHGA 2ISZA 4HBLA 4R1HA 1W4MA 4HV5A 3HRTA 2NYXA 2W84A 4I02A 1BIAA 2OZUA 2W24A 2IRFG 4HF0A 2JT1A 2EFQA 4G94A 3HTUA 3RKXA 3ZMSA 3AAFA 4A2UA 2DTRA 4A5NA 2XHKA 2W85A 4P55A 5AIPA 3GLXA 2EV6A 3LA3A 3OOPA 2RQPA 1UHWA 3DQVC 4ZYGA 3FXUA 3J80K 3K1MA 1CF7B 4O6JA 5CVVA 1K78A 1FZPB 2IA0A 4I2OA 4GXOA 4IRHA 2FE3A 3GEZA 2E7XA 1FY7A 3IKVA 4KN4X 2V1DA 1YTYA 1G3TA 3GFJA 4I7HA 4ZYDA 4LJZF 2A68F 3G3ZA 4FHTA 2ZKZA 4L18B 3DKWA 3NQOA 2P6TA 2ETHA 1TBXA 5HOOA 2C6YA 2EFPA 1PUEE 5E1ZB 2MA3A 4YFXF 4ASNA 4P9FA 3FMRA 2GZWA 4XLPF 5ICGA 3Q5FA 3T0YA 2GWRA 4L0YB 3L2CA 4AIKA 3R6SA 3JSPA 2EJRA 4FX0A 5IT9K 2L01A 5E8GA 3DPTA 2NNYA 1TQPA 3K0LA 2FMYA 2Y0MA 2QQBA 2DU9A 3HRSA 3I4PA 3KP7A 3F8NA 2UWMA 4A6DA 3GVAA 1O3QA 1Z9CA 3HRUA 1EH6A 1UB9A 3F8FA 4H0EA 3F23A 2VOPA 4RGRA 3HIFA 1QZZA 3KP2A 4B8XA 1JE8A 3ISPA 5FLXZ 1GXPA 3GFMA 4Y17A 2MH2A 1WQ2A 3U2RA 2VODA 3F21A 2OAZA 4ON0A 1Z6RA 4HX4A 3FZVA 2XV4S 5FGMA 3I71A 2M8EA 1R36A 1U78A 5FD5A 2M1BA 4EJUA 2IA1A 1IW7F 1MGTA 2IVMA 4EQQA 1LNWA 1SFEA 4NB5A 1E2XA 4IXAA 1QQIA 2GIVA 3VB2A 4BQAA 3ZPLA 1XSXA 5FFZA 4YFKF 4HQEA 2FQ3A 4U7BA 2FBHA 1B6AA 2V6CA 1JHHA 2EV5A 3EQLF 2QLZA 2EFNA 1XGNA 3HUGA 1QPMA 4HLXA 2RKHA 1QBJA 3GFLA 3O6BB 2DW4A 3WGHA 2EA2A 2YX7A 3GW2A 1T6SA 1FP2A 1MJBA 2EB7A 5CVJA 5LGTA 2H27A 3KLNA 4MEYF 3ZMZA 3LAPA 3RIRA 4M9ZA 2V9VA 1OMIA 1O7LA 2Y75A 3QU3A 1I1GA 2CYYA 1FLIA 2FBIA 2TDXA 3GXOA 2AXLA 1IXSB 2LF8A 1BOAA 1S7AA 2ZBKA 2BV6A 5CLSA 1ZGJA 2ZXJA 2JTVA 3I58A 4U0WA 4IHTA 3ZMDA 4AIHA 5DDGA 2P6SA 4S05A 1LDKB 5J8FA 2XAQA 4EV0A 2QENA 3EUHA 4KICA 2STWA 1QZYA 5DCMA 1BI1A 3M9AA 1ZG5A 3TO7A 3T1BA 1XGOA 2E1NA 5E1XA 4EGYA 2H6CA 2FXAA 4LMYA 3FX3A 2LNBA 3J81Z 1HSTA 1STZA 4JQFA 3BDDA 5D4SA 2PFBA 1P4WA 2XRNA 5HVQC 2VONA 3LWFA 3TQNA 2R7FA 5CJ9A 3BROA 1O3RA 4HW0A 5FB2A 2PI0A 2L3DA 3WTXC 2F5DA 4QLCU 5D6EA 1IXCA 3IC7A 3CJNA 1OYYA 4EMSA 2ZFWA 1XGSA 3L00A 1IN5A 5D5WB 2YR2A 4HDVA 2ZNZA 2X0LA 4XLNF 4WXDA 2KIUA 1DDNA 4KFCA 3KP5A 1MJAA 2AS5F 2ZMEA 1KQ0A 4AVPA 4RGUA 3QRFF 2QYOA 5IT3A 2RGVA 1O3SA 1YW7A 5K5QA 4G7OF 3R0JA 1YO5C 2IW5A 1FNNA 4EM2A 5DV5A 3HHHA 2DO7A 5LHIA 5L3BA 2JSCA 2IJLA 4GGGA 3K9TA 3ERED 4A0XA 3KZZA 5LLQA 2XAFA 4HX7A 3HOTA 5BPDA 4EJOA 5HDKA 1LVAA 4P5OA 2LKPA 3KLOA 4OOIA 2F5CA 2F2EA 1IXRC 4A6EA 2V1UA 3HYIA 2MBFA 3ROUA 1WWXA 3ELKA 2STTA 5LRSA 4YIIA 3E5XA 2MD5A 2MLGA 3DEUA 4M74A 2HWVA 4OMZA 3E97A 2DQLA 1PP7U 3V8LA 3OV8A 3WTWC 2HS5A 3M1EA 1T0FA 1E17A 2IT0A 3SZPA 1FOKA 1USSA 1T39A 2BE5F 5BMZA 3TDUC 2DQRA 3GWZA 1FT9A 4LB5A 4F7ZA 5HLHA 4U7DA 2YX4A 3TDZC 1FYLA 5D5VB 1XDSA 2QUFA 3T8RA 3KEOA 4LB6B 3CUQA 1J5YA 5E18F 3QU6A 3TO6A 4Q48A 3M8FA 4PZJA 1RUNA 1SAXA 4L5JA 2KIMA 2HZTA 5A2QK 1F1ZA 4CYDA 2ISYA 3IHUA 3VODA 3O3KA 3JTHA 3I53A 1U5TB 1SD5A 2PEXA 5HLIA 4ZYEA 2MC3A 2NAZA 1CGPA 3LSTA 3D0SA 1F4KA 1OPCA 3W6KB 2RV8A 4KYWA 4LLNA 1G6NA 1XD7A 1OKRA 4LD5A 2W25A 4KIFA 2OQRA 2WC2A 4BH9A 3V8KA 2LF7A 1FWZA 4CZZA 2XROA 3R4KA 1F9NA 4MTDA 5E17F 3I64A 2VBYA 5ERIA 4KT5C 3COAC 5D8KB 1VTNC 1R23A 1IZ1A 3BZ6A 2L02A 3T5XA 2IPQX 3Q9VA 2JRTA 1BIBA 2XKOA 3D5LA 4WXHA 5K5OA 2HQRA 4RGXA 2VBWA 1Q1HA 2CSOA 3W6JB 1XB4A 4B09A 4MQVA 3IKTA 4A0YA 1W5TA 1D8JA 4M73A 4G7ZF 4GYGA 3H3UA 5EEGA 2GQQA 3VEPA 5TJJA 1ZREA 2FA5A 1H9TA 1IUYA 4WCGA 4KA4A 1ZG3A 4RS8A 2UXXA 1F5TA 2G7UA 2EV0A 1Z91A 1WRJA 5TRDA 1KQ9A 1S3JA 3ZMUA 5DD8A 1EH7A 3DV8A 4IRIA 4P96A 4OIOF 5L3GA 1KU9A 5CVRA 5ICCA 4DQ2A 1ONVA 2M87A 4M6YA 5FLXK 1RZ4A 5JHUA 1CF7A 2OA4A 3V8JA 2P5VA 4FT8A 4ENNA 3CTAA 2GXBA 1XMAA 1GHCA 3WTSC 2O61A 2Q8KA 4LLGF 4KMFA 2GAUA 1O3TA 3QAHA 4XSZF 2M30A 3FM5A 2RN7A 4E70A 4XSXF 3BY6A 1O57A 4EGZA 3NEUA 3PFIA 1DP7P 1R1TA 1FSHA 4L9VA 3LFKA 4OIPF 2PG4A 1FBQA 4IVNA 1WKMA 3CUQC 2L4AA 4CICA 1WI9A 2XAGA 4A0ZA 4IJAA 3WE2A 3IRQA 4IF4A 2Y48A 3C18A 5E20A 3N97A 3KZYA 4WXCA 5D8LB 4L5IA 1R7JA 4LK1F 5JFRA 5L3CA 1IF1A 3REOA 3JAMZ 2Q2EA 3LAJA 1KA8A 1DUXC 3ABTA 2DAOA 5A2QZ 4UVBA 4CXFA 4AD9A 5LBQA 3JAMK 2CGPA 2DT5A 4OINF 3K1PA 1B9NA 2QQ9A 2PBIA 3J7AO 1SD6A 1J9IA 1FYKA 2FNAA 3WTYC 2PLYA 5D6FA 1T2KA 2PJPA 2YPRA 1HXDA 5ICFA 1ZRFA 3DP7A 1B1BA 3WODF 5DYMA 1EV7A 1YG2A 4ZZDA 2WWYA 2M5WA 5ILUA 3M7GA 2LSOA 2F5FA 1H9GA 3L9FA 3F3XA 3QOPA 3RKWA 3RYPA 1BC8C 5K5RA 2FEZA 3P7NA 3RYRA 2O0YA 3TOAA 4UHTA 3QP5A 1XCBA 5CVUA 2UXNA 4FX4A 1P4XA 4KMUX 4LK0F 3JSOA 1MDMA 1FC3A 5IT9Z 1U2WA 2K4JA 3RKYA 1ZYRF 1MDMB 2GXGA 2PMHA 4WF2A 3E6CC 3TO9A 1R22A 3HSFA 3TKYA 5ILSA 3EDPA 1J75A 3L7WA 1UFMA 3KP3A 1UCRA 5H6QA 3RI4A 1NHAA 5AIQA 4M9XA 2P8TA 5JVTA 3CO7C 1KU2A 4UV9A 3CLOA 2PMUA 3CDHA 4N9HA 6PAXA 2RDPA 2HTJA 5D5UB 3RDIA 3GZ6A 2VOOA 3C1DA 2RVCA 3KE2A 4ETSA 4LG0B 1Z05A 2VBXA 1S6LA 3KP6A 2VC1A 2F5EA 2VXZA 2Q0OA 1P2FA 3ZQ7A 3DXJF 5H20A 1R5HA 1HKSA 1IN8A 2NS0A 3HTSB 2ZCWA 2GA1A 4EM0B 1YYVA 3T8TA 4QWQA 3FXQA 1LQ1A 1HSJA 3FWEA 1U8RA 1W7PB 1YS6A 4RB2C 4IPAA 1K78B 4RB0A 1ZHFA 1J0RA 3PQKA 3ZN1A 2QWWA 2HEOA 2ZMEB 1K6OA 1I1SA 1BI2A 2EK5A 2K4BA 3F6OA 3I0TA 3O2PE 3WU0A 1IN4A 1Z6TA 1YQAA 2VE9A 5LHHA 2K02A 1HKQA 2H94A 3FMSA 3WU1B 1A04A 3I59A 4MEXF 2BEOA 1BBYA 3WTUC 4XBFA 3VOEA 3GYHX 2JPCA 3R0AA 4YG2F 3ECOA 4U0YA 2D1HA 3CUQB 1YLFA 2IP2A 3U1DA 4AWXB 5DEQA 3FMQA 4A12A 1USTA 5L3FA 2DFIA 3MCZA
chains in the Genus database with same CATH superfamily
1X3UA 2R7DA 2A6HF 4G8XA 1K83J 1RETA 3C3WA 3NRVA 3QPHA 2WAFA 3MKLA 4F55A 3RTRA 4Y13A 3R61A 1LDDA 3P9CA 2OUMA 1MBHA 3N05A 3F22A 5ILVA 2D45A 1VQNI 4N0BA 1OR7A 4EJTA 1OYWA 3ZQQA 2BXYA 2V1NA 3H0DA 2XAHA 1FMVA 4ESFA 4ESJA 4A5MA 2VUMJ 1T38A 2YU3A 2L9RA 2PN6A 3DLAA 3CCUI 2CO5A 3OMYA 2HKOA 2BOLA 2CUJA 3SFZA 2HGCA 3LA7A 1JXSA 5JI6A 3UKGA 1X1AA 3OYAA 1LEAA 1PUFB 1R6RA 2BGCA 2CW7A 3FHZA 1Y8QB 3JRAA 3S32A 3W2VA 4ZJZA 3K69A 3JR9A 1J7KA 4CHUA 2DOAA 4EVIA 1MNEA 5HS8A 1MD0A 2KLOA 1WCMJ 3WG7H 1A36A 4HAMA 4IOCF 1HCRA 2R7XA 4LFUA 2YSRA 4C3JJ 2CQNA 2A07F 1WSUA 2CJJA 3ECHA 2DJIA 3GO5A 3F72A 1D0XA 4MTEA 4C30A 4AIJA 4V19K 5FLVA 4BXUA 5E3OA 2G7HA 3TOBA 2DBBA 3I56I 2P5KA 4DZPA 4FETA 5CQGA 1XN7A 4I76A 1Z7LA 2HOTA 4TV7A 5HNFA 5IYBJ 2NRAC 3BR2A 4E6KG 3OYKA 4CCOA 1W5CC 4GCVA 2MABA 3OYDA 3V4GA 5LRRA 2ZNYA 1BJAA 2LR8A 2M34A 4HYEA 2HPMA 1D1AA 4ZZLA 2PQ8A 3F6VA 4BXFA 4QPQA 1Y8RB 2LDUA 4RB3C 1ZR2A 2R92J 2K7LA 1LE8A 4BDZA 3C2GA 3LL7A 1G3WA 3KP4A 1NK2P 2LMDA 4G6QA 5M5WJ 2P7VB 3BG3A 4IHWA 2HDCA 1V54H 3I5UA 4IO9F 2IGKA 3IL2A 3MQ0A 2DN0A 1IDZA 5F0HA 3LMMA 2OPTA 4HOBA 2ESHA 3GZNB 5LEKA 3M3YJ 2V4JC 1YIOA 2R7WA 4MGRA 1P92A 1RRJA 2WB1A 1R5GA 3ZN0A 2WBMA 4OIQF 2KL4A 3LNQA 3MKWB 4UV8A 5HDNA 3CESA 1SD4A 3CJQB 2WAQN 3HG9A 4OIRF 9ANTA 5BOXA 4BAYA 2QBYA 2KDOA 1JTXA 4QPOA 2K85A 2Y30A 3RZDJ 2KJCA 1KZHA 4U0VA 3GTMJ 2JSPA 3V7RA 3VFZA 2ACJA 4EJWA 5J8CA 2IXSA 4LLLA 2HQNA 2LFBA 2KRFA 2VIXA 2JUCA 3GF2A 3JTGA 4D7MA 1QZEA 5E8IA 3FKIJ 2Z99A 1QNTA 1U9NA 1Y39A 1D0ZA 3J7ZI 5B5EC 5ICEA 1Z1DA 2OU2A 3CUOA 4KDPA 1Y6IA 4MHGA 1SMYF 3ZQFA 5EEHA 1WJAA 3H5AA 3TBIA 4XKCA 3ZQLA 1KYZA 3F9KA 3FM3A 2XGXA 2CV1A 3G73A 4UVCA 1MMSA 2XSDC 1V4RA 1IRGA 2HR3A 3DCFA 2EFWA 3HSEA 1RR7A 3ASOH 2WB1N 4RM3A 2D2WA 2LC2A 2EIKH 1YFHA 1VQOI 3BP8A 3QPLA 4UVAA 3F8MA 5KVRA 3MZHA 1YHQI 1U5TC 4B1RA 3PNYA 1FOWA 4FQGA 1FOYA 2P7CB 3K10A 5HDGA 1TW2A 4YFNF 1MMGA 1VQ8I 1RC9A 2WV0A 2FF4A 3WTVC 1TP4A 4HNVA 3B73A 3DU5A 1I3QJ 5H6RA 1J2XA 4AYBN 1JJ8C 2M9HA 3G6EI 2KP6A 1FOXA 2VQCA 4Y33A 3GX4X 1TNTA 3QPSA 5FD6A 2JPBA 1QHGA 1DPUA 3ML6A 1O7FA 5KCMA 2ESNA 5IOZA 4JBAA 2KZGA 1ZH5A 1SD7A 4B44A 3LOCA 3L2UA 1PDNC 4I0AA 2BHZA 2FX0A 1JUSA 1TQMA 5BPIA 3AFHA 4HEA2 1VQ5I 1YI2I 4UUTA 4KISA 2Y9YA 5JLXA 5FRMA 1UHMA 3ZMTA 1ZTRA 2BY0A 4BHPA 1U6GA 2JA6J 4PDKA 1TW3A 5KHDA 3B02A 1FP1D 2L0KA 4ZYHA 4PJJA 5BQTA 2DFFA 1HW5A 3SYTA 4X0GA 2QZ8A 3C7JA 3L2QA 2Z16A 1XDUA 3LQRA 3I4MJ 1SFOJ 1DGRM 4OMYA 3HZJA 4XIDA 3EETA 1B9MA 1LB2A 5JHFA 4XLAA 1R00A 1KONA 4A3MJ 4DIQA 3LQQA 4RBOA 1MBFA 2JA7J 3H36A 1G3YA 2JA8J 2NOGA 2H6BA 1R71A 2DA7A 5ED4A 1KU3A 1R1VA 2UZKA 1ON2A 2FRHA 4XLFA 1MKMA 1W1WE 3IAM2 5FO5A 3LSJA 1TWHJ 4BACA 2DOFA 4GO1A 3N4MA 5HNHA 2MYSA 2F6CA 5B1AH 4JK1X 3BTCA 2K27A 2IGNA 4HNTA 4HNUA 2E1CA 2Z5UA 3HSRA 4AUXA 2JA5J 1FSEA 2EZHA 2ZXWH 3GTGJ 5HLTA 2LKSA 1MMDA 1V55H 3E3VA 3FF5A 4GYIA 1Z3YA 2LK2A 5J1RA 4P1WA 1SFUA 2OF7A 2DPUA 4IKFA 3X2QH 3E5UA 1TC3C 5JLWA 3H9QA 2OD5A 3BT9A 3KFWX 2DLLA 1G3SA 4BKXA 3MWMA 2OZ6A 3RQIA 1LEBA 3VDXA 3K70C 2Z2SB 3W6VA 3BC8A 2D1VA 3TP0A 5AONA 4OAYA 3SQNA 3A2KA 4XOTA 3IV5A 2WY7Q 4HF1A 3DKXA 3HOYJ 4BHCA 3LSRA 4I09A 1XX5A 4L9JA 3HOVJ 1HBXG 2BW3B 1ZGAA 2V79A 2K86A 3AG2H 3CMAI 5E3MA 1ZAOA 3K4BA 3OYBA 2P5LC 3VYRB 3M8EA 3MEXA 1S5LC 3S17J 1UZCA 2LRDA 1ZLJA 1V5EA 2P4WA 2IEKA 2BHYA 2ZJ2A 5B3SH 1H0MA 4M3DA 2DMUA 3BPXA 3GZ5A 3HDDA 2MW8A 3K1NA 2LY2A 4GDFA 2EILH 3A03A 2M4KA 4HZFA 1AKHB 3CQZJ 4UY8I 3S1RJ 1FTZA 3QPTA 2X51A 4ENMA 2JVHA 3HOSA 1T8IA 3JRFA 4HSRA 4S04A 1ZARA 4MQ9F 1GUUA 1KQ8A 4XRMA 3BWGA 2A3SA 2PJRB 3S3NA 1D1BA 1ULYA 3ABUA 4CO8A 2QVOA 3KPHA 2QKMB 5DUKA 2Z33A 2OBPA 4BHBA 2QQ8A 1QHHD 4DJAA 3PFYA 4ESBA 2A5WA 4RAFA 2R5YB 4B47A 4DOZA 4KUMA 4PSWA 2DI3A 2CFXA 2KIFA 2LBFA 2LG4A 1P6RA 1BC7C 4UUSB 2CUFA 3J81K 2DMPA 4XKVA 4I98B 2COMA 3ABKH 1H89C 1S7OA 5L3EA 2RC4A 1HW1A 2CH0A 5F6FA 3AL0C 2A5YB 2O3FA 5DUIA 2F5VA 2BBYA 3H9JA 4D1QA 4BY7J 3V7CA 1K7AA 1Y1VJ 2H1LA 1L3LA 1WJ5A 3CLQA 3ZGKA 4O3MA 5BS6A 1R1UA 4II3A 3BQYA 2EZKA 3BJAA 5HS9A 3HOWJ 1S29A 3SZTA 3PO2J 3A0BC 3J80Z 1HC8A 1MIJA 4WX9A 2GM4A 2JWTA 1GXQA 1JGSA 1D5VA 1VNDA 2AQEA 4XR6A 3OS1A 2KMUA 1IUFA 3H3ZA 4B3XA 2G9WA 4PK4A 3SFIA 4RAZA 4S0HB 2KQRA 2XASA 2HOEA 2GXAA 1AOYA 2VQLA 1HQCA 2F4OB 2XF5A 1PP8F 4J00A 4AM3A 5F0FA 4M71A 1YW9A 5IP7J 2XRLA 4X6AJ 2XKPA 5GAHJ 2O6GE 3E6DA 3BJ6A 4KNYA 1PYVA 3I59B 3KEQA 4L5EA 1UELB 2Z3YA 1BI0A 4YIRX 2XIGA 1HW2A 2CG4A 1KYWA 1AA7A 4XRFA 1RKTA 3H92A 3ZMVA 4Q4ZF 1E3OC 2L4MA 1GVJA 1QGPA 4G7HF 1EH8A 1V3FA 2M3AA 3I4NJ 5DD4A 4DW6A 2LKXA 1NG7A 1LFPA 4HF2A 3K2ZA 2X4HA 3HKZN 2NVUB 4LITA 5HLGA 1OCOH 4WK8F 2HQ5A 5DCMB 2NNNA 1PUFA 1YRNA 2CQKA 3OS2A 5IPAA 5E79C 4IHVA 2RREA 3LA2A 3PIPF 1TWAJ 2L54A 5FKLA 3SDBA 4BBSJ 5D4RA 2COBA 1L0OC 4M6XA 5CKTA 2O8XA 3L1PA 1XSDA 1IN7A 3P9IA 2IA2A 2AO9A 1VQMI 5GADJ 3MAJA 4Q47A 1S72I 2DMQA 2QKLB 2L2OA 4AYBA 2BYVE 1FBUA 2DPDA 3PQJA 2QBYB 4N4NB 3HB9A 1BN5A 1ETKA 1Z21A 3ZR8X 4BE2A 3TGNA 1YE9A 3QP6A 5K1YA 2VB6A 3V7SA 4R8HA 1T98A 1Z67A 4L9TA 1HLVA 1SFXA 3WGIA 4QTRA 4UUVA 4CDGA 2RAEA 2I5UA 1NH3A 3R60A 1SVLA 3CJRB 3G1MA 3G2BA 1KU7A 2WTEA 2A69F 3S3OA 2M2EA 3GUDA 2K9NA 2MLKA 2Z9OA 2KRCA 2FBKA 3K4NA 1W7PA 3SXYA 2R7ZJ 3RSNA 3H1CA 1U3EM 2OQGA 2IGOA 3S93A 3F8CA 5GAGJ 1RI7A 2CWEA 2VC0A 3CC7I 2LY9A 3BTIA 1Z7UA 4HQMA 3MFKA 3EYYA 1A5JA 5FFXA 4YIFA 1XPXA 1S8NA 3PM1A 2R7QA 3DLLF 3FXLA 1I27A 3ZP5A 3CMMA 2QF7A 3WHBA 3HUGB 1MBKA 2TCTA 2A61A 1XGMA 1A6QA 1XMKA 2CW0F 4Y3OA 4IRGA 4BQOA 1FX7A 5EF6A 4M3BA 2MH9A 5JR3A 2KISA 2DK8A 2QQAA 2E36A 4DYRA 3LSPA 4N9IA 4YRVA 1TWFJ 4II2A 5JVGF 1XSVA 4RAYA 3BOQA 2R93J 4RB1A 1YX5A 1N25A 3WG9A 1ZLKA 1SVMA 2FNPA 3DPUA 5HODA 1D0YA 1YX3A 4OU0A 1RIOH 1ENHA 1JT6A 1NTCA 2FOKA 4KIBA 3PUFA 4LOCA 4EJVA 1IRFA 1TZLA 5HS7A 2KKOA 2OTJI 5LGNA 1MJ9A 3KETA 1TTYA 3S15J 2OCCH 2X1EA 4KN7X 5H2FC 2RNGA 1JKQC 1I3AA 4M72A 1FBSA 2FU4A 3A02A 4HSTA 3UNGC 4BYYA 5LEJA 2A6EF 4KT6A 3MZYA 4D0PA 4NQWA 5J6XA 4XK4A 3DEWA 3JW4A 3PSFA 1APLC 5B1BH 2VPRA 1TNSA 4Z2YA 4HDUA 2H8RA 4LGWA 1E3PA 4PGGA 3SZGA 2VBZA 1V5GA 1FPQA 1OCZH 1IRZA 1DGWY 3HRMA 3KYDB 3MVPA 4O5VA 3IRRA 5FKKA 2W00A 3IWZA 2FD5A 2V1XA 1BM9A 2B9SA 4HX8A 4L9NA 3FHNA 4RM2A 1SMTA 5EG0B 1W5SA 3OOUA 2JUGA 2L7MP 1TWCJ 4UB6C 1U5TA 2JMWA 2EA4A 4HA8A 1XCVA 4I01A 5E1WA 2VL8A 3RJPA 2E34A 5B66C 1JHFA 2NOJB 3WGGA 4KIGA 3U9GA 3LSIA 1TQIA 4L0ZB 1FYMA 4BGDA 3EUHC 1U9OA 2O03A 3BPVA 1P4AA 4NQWB 2KJBA 3CCQI 2MFZA 3IWFA 1UHSA 2L7ZA 2IAIA 2BVLA 3NAUA 3ABMH 2ELHA 2LTPA 1G8XA 4NC6A 1A6IA 4R79A 4PFPA 1T33A 3P5JA 4N4OB 2WA0A 3DFGA 3TW7A 1ERDA 4LG0A 2GIZA 1ETQA 3IUOA 3L09A 3NARA 4HLYA 2XF6A 1TLHB 1YJ9I 2WY8Q 4DYCA 4JOMA 5F1RA 1B59A 1R58A 1I5ZA 4PUSA 2ZO4A 3UR3C 2FJ1A 4A3DJ 1MZBA 2O7OA 2ADUA 2GA2A 5LGUA 3Q9SA 4LIVA 1M1EB 1RUOA 2HKXA 4MNUA 4W97A 4BBRJ 3CCEI 2IS1A 1MMAA 2R3SA 2XAUA 3KCCA 4DGWB 1LFUP 2DCEA 5EZGA 2XAJA 3F0CA 1QO0D 5FLMJ 4BNCA 2KFDA 4NHJA 4CGZA 1C0WA 3A1YA 2DA2A 2XGCA 4E7LA 3P9KA 2H09A 4UNOA 5F0CA 3FXOA 4BEHB 3BJOA 5EJCA 4G6TB 4E7HA 5CVIA 3GTQJ 4HRIA 2B7EA 3S2WA 1AWCA 2LY1A 4G9YA 2M45A 3G4SI 3HHGA 1RNLA 2DK5A 4IEJA 1J59A 2EZIA 1HKTA 2GOXB 1R4NB 4JX5A 1KGSA 3FXKA 4ENKA 3KIOA 1ACIA 1VQLI 1UMQA 1VQPI 3BZKA 2JN6A 3DPLC 2Y0SA 4HV6A 2O5RA 2QM3A 2X85A 3FXRA 2Z1DA 1D3YA 4I6ZA 2EWNA 2R7TA 1IGNA 3HPGA 2P81A 3WTZA 4CZCA 1JI8A 1GV5A 2XVCA 3WE3A 3RZOJ 2R5YA 4XLEA 2L7KA 1ZRDA 1ON1A 3C2HA 5E3LA 3HC7A 2XPWA 1B4AA 5GP9A 4ZDLA 3EYIA 3ULQB 4I0BA 1WJBA 3PNVA 1Y0UA 4XONA 1QPIA 2CV0A 3A4CA 1G4DA 4AU7A 3E5QA 5E3NA 1JGGA 3EUKL 1REPC 1ORKA 4Y15A 1W7PD 3WTTC 4K2EA 3EPZA 3K6GA 4ENJA 1LE8B 3ABLH 3E6MA 2ZJRF 2VQHA 1ZN2A 1IAWA 1ZRCA 2E7WA 2M0MA 2ZC2A 2W57A 4DYQA 1I50J 2BY2A 3QWLA 3QQAA 4A3LJ 2FSWA 5FKOA 2DDBA 4YEJA 3D1NI 1LJ9A 4EM1A 4IHSA 4NNJA 3Q3SA 3LSHA 4PGHA 2VT3A 4ZH4F 3BTJA 3F8BA 3GFIA 3PSIA 1DPRA 4PJMA 1VFCA 5C44J 1YS7A 1SANA 1WVRA 2EFOA 4PCQA 1LDJA 1T95A 3CDIA 3K7AJ 1K79A 4A3BJ 2FMLA 3E6BA 1ZQ3P 1PJRA 1SVOA 5DCFA 1D8KA 1I6XA 4LIUA 4WWCA 2B0LA 2K9MA 4CH7A 1WJCA 3MD2A 3RPQA 3RPUA 5DM6F 4RGSA 4J01A 2J5OA 2O8KA 2VE8A 2HYGD 2OV7A 4P9UA 3I54A 5F64A 4G6DA 4NUBA 2HTSA 2VT2A 1YW8A 1IN6A 2JZYA 3HKZA 3SHFA 1BI3A 1ZG1A 5L3DA 2DOEA 4Q5SF 2ELKA 2F48A 5KK1A 1ODDA 4C2TA 2HFHA 3HOZJ 2J5PA 1MSFC 5CYVA 1IO2A 2LREA 3DF8A 2IBDA 2RNJA 2DTZA 4U88A 4FE4A 2VN2A 4UXNA 2XUBA 4DNCA 2HYFA 2X9DA 4M9SA 1ZR4A 1OCPA 2ZJPF 3CO6C 5D5XB 2PMZA 2VKHA 2VLAA 1OYIA 5LHGA 2ISZA 4HBLA 4R1HA 1W4MA 3VYUB 4HV5A 4DBQA 3U21A 1BJZA 2Q1ZB 3DTIA 3HRTA 2OCEA 4XM3A 2NYXA 2W84A 4I02A 1BIAA 2OZUA 2W24A 2IRFG 4HF0A 2JT1A 2EFQA 4G94A 3HTUA 3RKXA 3ZMSA 3AAFA 4A2UA 2DTRA 3BG7A 4A5NA 2A05A 2W85A 2XHKA 4BDYA 4IQJA 2CRGA 1TT0A 4P55A 5AIPA 4FCYA 3GLXA 2EV6A 2IGMA 3LA3A 2RQPA 1BR2A 3OOPA 1MNDA 2XPVA 1UHWA 3DQVC 4D7NA 4ZYGA 2R5ZA 3FXUA 5J4VA 3J80K 3K1MA 1SEUA 1CF7B 3K4MA 4O6JA 3O8HA 2DA1A 5CVVA 2R5ZB 1K78A 1FZPB 1GVDA 1BL0A 2X48A 2IA0A 4I2OA 2HVSA 4GXOA 3PL8A 3W3CA 3K4CA 4IRHA 2XC7A 2FE3A 3GEZA 2E7XA 1FY7A 2V9PA 3GBGA 3IKVA 3OIPA 3OYEA 2E35A 2QSHX 3GTJJ 2MC4A 3H3VK 3QYEA 1QU3A 3LFUA 2V1DA 4KN4X 5GTIC 1YTYA 1VF9A 2X1DA 2VJ4A 1W0TA 1EJ9A 4A93J 2OJED 1G3TA 3GFJA 4I7HA 3ONQA 4ZYDA 4LJZF 2A68F 4I99C 1X1CA 2HI3A 5IP9J 2X6XA 4IHXA 1ETWA 2E60A 2ECBA 2HDWA 3K4KA 3G3ZA 4FHTA 2M4GA 3K4JA 2ZKZA 3DKWA 4L18B 2IS6A 5C3EJ 4YELA 3NQOA 2P6TA 2ETHA 1TBXA 5HOOA 1VQ6I 2C6YA 2EFPA 5E1ZB 1PUEE 2MA3A 4YFXF 4ASNA 4P9FA 2DFEA 5DM7F 3FMRA 1A35A 2GZWA 4XLPF 5ICGA 2R7SA 3Q5FA 3PUBA 3T0YA 3ZRGA 2GWRA 1Z3XA 1OQYA 1P7IA 4L0YB 2EIJH 3M4OJ 3L2CA 4AIKA 3R6SA 3JSPA 4H4KC 2CQQA 2XPUA 2EJRA 4FX0A 5IT9K 2L01A 3SDGA 3OS0A 5E8GA 1EA3A 4C2MJ 3DPTA 4CCMA 3BTLA 4XNFA 2NNYA 3CJTB 3KX2A 1TQPA 2W48A 3TMOA 4AVZA 2H8WA 4XOPA 3CD6I 3K0LA 2FMYA 2Y0MA 2QQBA 2DT7B 1X2MA 2DU9A 1K61A 1RR8C 2V6EA 1WJEA 3HRSA 2MSYA 3PNTA 3I4PA 3CP2A 3KP7A 3F8NA 3I9V2 3LSKA 2UWMA 4A3KJ 3S2HJ 4A6DA 1SC7A 3GVAA 3CC4I 1O3QA 3OYCA 1QVUA 3I3LA 3JRDA 4UUSA 5FJ8J 1Z9CA 4MIMA 5FROA 1JKPC 1UAAA 3JRGA 3HRUA 1TWGJ 2QSFX 1YJWI 2M8GX 3JRIA 2LVSA 5EG0A 1EH6A 1UB9A 2DYRH 3F8FA 2JRMA 3F23A 5GTHC 4H0EA 2VOPA 4A3GJ 2I10A 1JUMA 4RGRA 3FKJA 2X1CA 3BR1A 3WU2C 3HIFA 3IH3A 1WGXA 3K2AA 3L2VA 4ANJA 1QZZA 4V2GA 3KP2A 1HA8A 3RPUD 2DXIA 4B8XA 1JE8A 3ISPA 4FISA 5FLXZ 1GXPA 3GFMA 4Y17A 3GTOJ 2MH2A 1WQ2A 2LLKA 3QODA 3U2RA 2VODA 1IV6A 3F21A 2OAZA 4ON0A 1Z6RA 4HX4A 3FZVA 2XV4S 5FGMA 3PIOF 3I71A 2XB0X 3MN2A 4BE1A 2M8EA 2EIMH 4CSWA 2HVRA 1NG6A 1R36A 1U78A 5FD5A 2M1BA 4EJUA 2IA1A 1IW7F 2ZMEC 4D9JA 1MGTA 2LOOA 3S3MA 3QYFA 2IVMA 2DFHA 4EQQA 1LNWA 1SFEA 1WI3A 2CMPA 4JP0A 4NB5A 3K4LA 4ZDPA 1E2XA 2PX9A 4IXAA 1QQIA 3BG6A 4EATA 3HOUJ 1MBGA 2GIVA 3H0GJ 1VZ0A 2NS8A 1T0FC 3QYBA 3VB2A 4BQAA 4NC8A 3ZPLA 1N75A 3CF2A 3TP3A 1N77A 1XSXA 5FFZA 4YFKF 1R9TJ 3HPHA 2FQ3A 4HQEA 1K4SA 2K3PA 3RCOA 5CQEA 4U7BA 2DMNA 3E7LA 2FBHA 1A31A 3S16J 1B6AA 2V6CA 1JHHA 2HVQA 2EV5A 3EQLF 2AQFA 2QLZA 2EFNA 2YUSA 1XGNA 3HUGA 1QPMA 4HLXA 2RKHA 1QBJA 3GFLA 4OAZA 1R4MB 3O6BB 2DW4A 3GTLJ 3WGHA 2EA2A 3HOXJ 2YX7A 1JKRC 2W82A 3BLYA 3GW2A 3M1CA 1T6SA 2CV2A 4DZJA 2IS2A 1FP2A 1MJBA 2EB7A 5CVJA 5LGTA 2H27A 4A3FJ 3KLNA 1JTYA 4MEYF 3GCMA 3ZMZA 1FTTA 2AXTC 3RIRA 3LAPA 3DKYA 4B4CA 3FK7A 2Y69H 4M9ZA 2CUZA 3HGGA 3OIQA 2V9VA 1D1CA 1X3ZB 4MLOA 4ZDOA 5IP6A 3PO3J 4OWRB 4IQ4A 1OMIA 1O7LA 2L9SA 2Y75A 2D5VA 1X1BA 3QU3A 1I1GA 2CYYA 2RQQA 3BG5A 2W1OA 4E4HA 1FLIA 2FBIA 5M5YJ 2TDXA 4ZTJA 4E7IA 4C9YA 3GXOA 2AXLA 1IXSB 2HZDA 1JJ6C 2LF8A 3OY9A 1BOAA 1S7AA 2ZBKA 4AC0A 2BV6A 5CLSA 2HQAA 1ZGJA 5TGTA 3NWTA 2ZXJA 2ZFUA 1LPQA 1RPWA 2JTVA 1FIPA 3I58A 1OCRH 4U0WA 4IHTA 3ZMDA 1WZ2A 1X1PA 4AIHA 4JX6A 5DDGA 1XTAA 2P6SA 3GTPJ 3EUAA 4S05A 1LDKB 5J8FA 3S1NJ 2XAQA 4EV0A 2QENA 3EUHA 4RDUA 4KICA 1O4XA 2STWA 2LBFB 1QZYA 5DCMA 1BI1A 3BQZA 1BW5A 3M9AA 3D5SC 3SEZA 1ZG5A 2E5NA 1DP3A 3TO7A 5M3MJ 3T1BA 1XGOA 2E1NA 1W36C 1VI0A 5E1XA 2QEXI 1BR4A 4EGYA 2H6CA 1Z77A 2OTLI 2FXAA 4LMYA 3FX3A 3HXLA 2LNBA 3IH4A 5FKMA 2Y0SN 1WHUA 3J81Z 1HSTA 1UJ8A 3S1QJ 1STZA 3DTKA 1RKWA 1ETOA 4JQFA 4F93B 1LKXA 4CYCA 4J19A 3BDDA 3HEFA 5D4SA 2PFBA 1P4WA 2XRNA 5HVQC 2VONA 3JREA 3LWFA 2R7FA 1UG2A 5CJ9A 3TQNA 3BROA 1O3RA 4HW0A 5FB2A 2PI0A 3OR1C 3DWLE 1I39A 2HXOA 2L3DA 3WTXC 2F5DA 4QLCU 5D6EA 1IXCA 3IC7A 2BVMA 1OYYA 3CJNA 4EMSA 2ZFWA 1R49A 3LSMA 3CCSI 3CMEI 4MFDA 1XGSA 3L00A 1IN5A 4M3GA 5D5WB 2YR2A 2CW8A 4HDVA 2M0CA 4BU2A 2VJ5A 2KPMA 2WAQA 1X4OA 1GT0C 2DA3A 3AKZA 3RKQA 2JVGA 2ZNZA 4XMYA 2X0LA 1SFKA 2MG4A 4XLNF 2ZSIB 4WXDA 4ABZA 2R7RA 3H5RA 3S1MJ 2KIUA 1JKOC 1BW6A 1DDNA 4BXXJ 4U87A 4KFCA 1D5YA 2MD0A 3KP5A 1MJAA 2LH9A 1LVKA 3AG4H 2HDDA 4QIWN 4G12A 3KZIC 5LD2C 2AS5F 2ZMEA 1B8IB 2DA4A 3FBNB 1KQ0A 4AVPA 4RGUA 3QRFF 3TEDA 2HYJA 2QYOA 4XL9A 5IT3A 2TRTA 2RGVA 3FXJA 5IYCJ 1MBEA 1O3SA 2QA4I 2EH3A 1YW7A 4BS9A 5K5QA 5LFAA 4G7OF 2Y31A 3R0JA 2VKVA 1YO5C 2IW5A 4RLQA 1F43A 1FNNA 1AKHA 4EM2A 2R7OA 4BQQA 1IDYA 5DV5A 3HJEA 3SJMA 1X19A 3ZXSA 3HHHA 2DO7A 5LHIA 1CQTA 2E1MB 5L3BA 4LG3A 1POGA 4KJZA 1XS9A 3ESWB 2JSCA 2IJLA 2ZJQF 4GGGA 3K9TA 2VQGA 3ERED 4A0XA 3KZZA 5LLQA 2XAFA 4HX7A 3HOTA 2N8GA 2F4IA 1Z0XA 4EJOA 5BPDA 5HDKA 1VQ7I 1HDDC 1LVAA 4A3JJ 4P5OA 2LKPA 3KLOA 4OOIA 5FRNA 4BJTA 4E7KA 2F5CA 2F2EA 4Y4RA 4BQNA 3TW6A 2DDAA 1B72A 1IXRC 3OYLA 4A6EA 2Y9ZA 3HYIA 2V1UA 2MBFA 3ROUA 1WWXA 2KRHA 2M7BA 3ELKA 2STTA 4BJ6C 3BR5A 1J09A 3ZQHA 5LRSA 3B6AA 2Y2ZA 4YIIA 4CCLA 4F91B 4IZZA 3E5XA 1XC5A 2R4GA 4XRSG 3ZQGA 4F3QA 4KITB 5IY5H 2MD5A 2MLGA 4BL0B 1MSEC 2B63J 3DEUA 4M74A 2HWVA 2M7AA 1TT5B 4OMZA 2FQ4A 2I8DA 3E97A 2K9SA 2DQLA 1VQKI 1ZGWA 3V8LA 1PP7U 3OV8A 3WTWC 2HS5A 1T0FA 2UUZA 3M1EA 3VYTB 1E17A 2IT0A 2ID3A 3SZPA 2NVYJ 1FOKA 1E3HA 1USSA 1T39A 2BE5F 5BMZA 1S9HA 3TDUC 2AHQA 2DQRA 3S2DJ 3GWZA 4XLCA 4GFBA 1FT9A 2GLOA 5CPRB 4LB5A 4F7ZA 3Q0VA 5J47A 1WPKA 5HLHA 1ZELA 4U7DA 2YX4A 4X1EA 1H8AC 3W2AA 3TDZC 5J1YA 3FBIB 2E1OA 1WH5A 2BY1A 1Y56A 1NK3P 2XGDA 3MZ8A 3M8JA 3LSGA 2EQRA 1FYLA 5D5VB 3G1LA 1W36D 1XDSA 2QUFA 3OL4A 3T8RA 2K40A 3KEOA 2NXNB 4LB6B 3CUQA 1J5YA 5E18F 3QU6A 4CA0A 4XN3A 1OCCH 2DA6A 3TO6A 4Q48A 3CMYA 3M8FA 4D5CA 4PZJA 3ERMA 4F92B 1RUNA 1SAXA 4L5JA 2CQ7A 2KIMA 1JT0A 2WAEA 1X2NA 2HZTA 5A2QK 1F1ZA 4CYDA 2ISYA 4HPQA 1FIAA 3IHUA 3VODA 3JTHA 3O3KA 3I53A 3H9GA 1U5TB 1SD5A 2Q2EB 2ICWG 2PEXA 1BOBA 5HLIA 4ZYEA 4XORA 2MC3A 2NAZA 2VPLA 1MBJA 4RA2A 1CGPA 3LSTA 3DU6A 3D0SA 2GBYA 1WH7A 3J7YJ 1F4KA 3D5RC 1WJDA 2BW3A 2CUEA 2VJJA 4UB8C 1OPCA 2YU9J 3W6KB 1E0EA 3ZQCA 4C3HJ 2WADA 1OR7C 1W0UA 3ZCOA 2RV8A 4B3AA 2FUG2 4KYWA 1X4PA 3AG1H 1GDTA 3H5NA 4LLNA 1G6NA 1XD7A 4GRIA 2HNHA 4XLHA 1OKRA 4LD5A 2W25A 4KIFA 3CCLI 2L7FP 3CCVI 2OQRA 2WC2A 4C3IJ 2DODA 4BH9A 3V8KA 5EYRA 2LF7A 1FWZA 4CZZA 2O9LA 2XROA 3OYJA 3IAS2 3A01B 3R4KA 1F9NA 4MTDA 5E17F 3GMEA 2EZLA 2JJ7A 4PJLA 3I64A 1PVEA 2VBYA 1H88C 1IJWC 5ERIA 3U1KA 3CDLA 3OYHA 4KT5C 3COAC 5D8KB 1VTNC 3RQ4A 1R23A 1I6HJ 1OFCX 1IZ1A 3BZ6A 4XICA 3GTKJ 2L02A 3T5XA 3M07A 3O8GA 4EEFG 5GAEJ 2IPQX 2KZVA 4XQFA 4C2UA 3Q9VA 2JRTA 4E7SA 1BIBA 1X1DA 3FXMA 2XKOA 4NC7A 3OSFA 1Y1WJ 3D5LA 3BR6A 2W4SA 4WXHA 5K5OA 5GPAA 2HQRA 4Z6YA 4RGXA 2VBWA 3L2RA 4IL6C 1Q1HA 3V42A 2CSOA 3W6JB 1XB4A 4B09A 3CCJI 4MQVA 3IKTA 2KIQA 1T08B 4A0YA 1W5TA 3QOEA 4FTHA 1D8JA 1GLNA 4M73A 4G7ZF 1MMNA 4GYGA 4BJ5C 4M3FA 4A3CJ 3H3UA 4JYKA 5EEGA 1K6YA 3TL4X 2GQQA 1WJFA 3L2WA 3VEPA 2MGQA 5TJJA 1ZREA 2FA5A 2E2IJ 2V7FA 5BNGA 1H9TA 3MKYB 1IUYA 2X6WA 4WCGA 1SAUA 2DMTA 4KA4A 1ZG3A 4RS8A 1VQ9I 2UXXA 1F5TA 2G7UA 3J7AY 2EV0A 1FJLA 4M6VA 1Z91A 1IV8A 1WRJA 5TRDA 1KQ9A 4Y52J 3FK6A 1S3JA 4RLFA 3ZMUA 2R7VA 5DD8A 3VSKA 1EH7A 3DV8A 4IRIA 5DTDA 2VKDA 2XDVA 2JQ7A 4P96A 4OIOF 5GPCA 2V9KA 5L3GA 1KU9A 4ZC3A 2E19A 5CVRA 4B48A 5ICCA 2LD5A 3CC2I 4DQ2A 1ONVA 3DBRB 4RAGA 2CS3A 2G0EA 2M87A 4M6YA 1RZ4A 5JHUA 3K70D 1OCTC 5FLXK 1BR1A 2IS4A 5EDNA 1YOVB 1CF7A 2OA4A 3V8JA 2P5VA 4FT8A 4ENNA 5J3LA 1B72B 3CTAA 2GXBA 1XMAA 4PJ0C 1GHCA 3WTSC 2O61A 5EGOB 2Q8KA 3C2BA 4LLGF 4KMFA 4NBQA 2GAUA 1DQUA 2CU7A 1O3TA 3BZCA 3QAHA 5IYDJ 1OLTA 2H1KA 1K4TA 4XSZF 2M30A 2ME6A 2YS9A 1X3WB 4IHYA 3FM5A 2RN7A 4E70A 1ETVA 2XSJC 2HU9A 3IH2A 3IP4B 2VJIA 2KHMA 2L5QA 4XSXF 4M3EA 2QGUA 3KEYA 3BY6A 3BCBA 1O57A 3OR2C 4EGZA 3NEUA 1AU7A 3JRHA 3FDYA 1YITI 2P0WA 2BZTA 3HM5A 3PFIA 1MH4A 4MO7A 1DP7P 1R1TA 1FSHA 4L9VA 1ZK8A 2LYCA 3OIOA 3LFKA 1AHDP 4OIPF 2PG4A 1FBQA 3BCAA 2E1MC 4IVNA 1WKMA 3HBLA 3CUQC 3NWSA 3VPRA 4CYCB 2L4AA 2A6TA 4CICA 2X6YA 1WI9A 2XAGA 4A0ZA 1Y0NA 2NS7A 4RMNA 3A01A 2CQXA 4IJAA 3WE2A 3IRQA 4IF4A 2VKEA 2Y48A 3C18A 5E20A 3N97A 3KZYA 4WXCA 5D8LB 3GLLA 4BUPA 2BXZA 1TL8A 2HOAA 4W1UA 5EZHA 3CCMI 3H35A 4PJNA 2UV1A 4L5IA 1R7JA 4LK1F 5JFRA 5L3CA 5M3FJ 1IF1A 3REOA 1HOMA 3JAMZ 2DJNA 2Q2EA 3LAJA 1KA8A 1DUXC 4V2FA 5DS9A 3ASNH 3DEEA 3ABTA 2DAOA 1OJLA 3CZ6A 5A2QZ 2F4MB 4UVBA 5F04A 1MH3A 2ELJA 1ETXA 4CXFA 2XGEA 2L9NA 5EEAA 3OYFA 4AD9A 5LBQA 3JAMK 1YRNB 2CGPA 1S7EA 2DT5A 1U0JA 4OINF 2E5ZA 5IOYA 3K1PA 1B9NA 4BE0A 1MW7A 1XMXA 2QQ9A 2PBIA 1LFBA 3J7AO 1SD6A 1IRXA 3JCUC 2E2HJ 2ECCA 1J9IA 1ZKGA 1FYKA 2ME0A 3HGYA 2FNAA 4D5FA 3WTYC 2E71A 2LP0A 2PLYA 5D6FA 1T2KA 1IG7A 2PJPA 2YPRA 2ZXHA 5KAFC 1HXDA 5ICFA 5EGOA 1DU6A 1ZRFA 3DP7A 1QA6A 2HXIA 2DA5A 1B1BA 3WODF 5DYMA 1EV7A 1YG2A 4ZZDA 2WWYA 4XRSA 5M5XJ 3ZQIA 2M5WA 3DBLB 5ILUA 3M7GA 3AG3H 2LSOA 2F5FA 1H9GA 3L9FA 4E7JA 3F3XA 5C4JJ 3QOPA 3RKWA 3RYPA 3VSLA 4E7ZA 1BC8C 1DU0A 2CFOA 5K5RA 3G1OA 2VI6A 2FEZA 3DTEA 3Q0UA 1RESA 3P7NA 3RYRA 1U8BA 4HG2A 2O0YA 3TOAA 4UHTA 4AIDA 2V26A 3QP5A 4B43A 5F1JA 3OYNA 4Y7NJ 5K7FA 3OWTA 1UG0A 3B6CA 5J4YA 1XCBA 5J1UA 2R0QC 2HOSA 2EPFA 4CCNA 5CVUA 2PMZN 5F27A 2UXNA 4FX4A 1N78A 1P4XA 4KMUX 4LK0F 1R5ID 2ZSHB 3JSOA 1MDMA 1FC3A 5IT9Z 1U2WA 3I55I 2JA2A 2PJRA 2K4JA 2QSGX 3RKYA 2ZXIA 1ZYRF 3BG9A 1MDMB 2GXGA 2PMHA 3MKZA 4WF2A 3E6CC 2L9VA 3G71I 3TO9A 4A69C 1V5FA 2QCOA 4ZTFA 1R22A 3HSFA 3FISA 2JK3A 3TKYA 5ILSA 3EDPA 1HF0A 2NVQJ 1J75A 3L7WA 2VXDA 3CP8A 3FIWA 1UFMA 3KP3A 1UCRA 5H6QA 3CCRI 1FMWA 3RI4A 2DT6A 4CCKA 1NHAA 5AIQA 4XKBA 1B8IA 1BA5A 5FKNA 4M9XA 1YIJI 2K3FA 2P8TA 5JVTA 4A3EJ 1Q1VA 3CO7C 1KU2A 1X58A 4UV9A 3CLOA 2PMUA 3CDHA 3HL2A 4N9HA 6PAXA 2NVTJ 2RDPA 3KYCB 2HTJA 5D5UB 4JX4A 3RDIA 1ITYA 3GZ6A 4ITVA 2VOOA 4IOAF 3AL0B 1XG1A 3C1DA 1FEXA 2EBIA 2RVCA 3KE2A 4ETSA 4LG0B 1Z05A 2VBXA 1S6LA 4CUGA 3MMYB 3KP6A 2VC1A 1G59A 1IC8A 2F5EA 3OL3A 2R7UA 2VXZA 4IX7A 1HDPA 2Q0OA 4PFOA 1MNMC 1P2FA 5F08A 1QVTA 3DXJF 4NDLA 3ZQ7A 2EINH 5H20A 5K7ZA 5KAIC 1R5HA 1QRYA 3DBHB 4PSXA 2HPIA 1OISA 1HKSA 3PJRA 3E1SA 2XB5A 2ZB9A 1GV2A 1IN8A 2NS0A 2ZCWA 3HTSB 2GA1A 1EKEA 4EM0B 1YYVA 2VASA 1F36A 2NVXJ 3CF5F 3T8TA 3S8PA 4QWQA 3FXQA 1ETYA 2W7NA 1HSJA 3FWEA 1LQ1A 1U8RA 1W7PB 4CCJA 1G2HA 1YS6A 2K9LA 4RB2C 1YJNI 4IPAA 2KDZA 4RB0A 1K78B 1EF4A 1ZHFA 1J0RA 3PQKA 3JRCA 2OC6A 3ZN1A 3E0JB 2BY3A 2QWWA 2HEOA 2X6OA 2ZMEB 1K6OA 1I1SA 5K7HA 4MFEA 3BR3A 3OYMA 3JRBA 4FE7A 3ZOBA 3OSGA 1BI2A 3VWBA 2EK5A 1WFXA 2K4BA 3F6OA 3W2WA 3I0TA 3O2PE 3WU0A 2XF7A 4QSHA 1IN4A 1Z6TA 1YQAA 1P9QC 2KT0A 2VE9A 5LHHA 4XKWA 2K02A 1HKQA 3VYSB 1JUPA 2H94A 3FMSA 3KYLA 1A04A 3WU1B 3I59A 2GOMA 4MEXF 2BEOA 4FASD 1BBYA 2K5CA 5J40A 2DYSH 4BY1J 4ZYAA 2ID6A 3CCYA 3OYIA 1VQ4I 5KNLA 3WTUC 4XBFA 3OYGA 4BEHA 3VOEA 3GYHX 2E2JJ 2WV1A 2JPCA 3R0AA 1P7JA 4DBRA 4YG2F 1T56A 3ECOA 3SEQA 4U0YA 3S14J 1LUJB 2D1HA 3CUQB 1YLFA 2IP2A 2FOWA 5C4XJ 3U1DA 4AWXB 4A3IJ 3A0HC 5DEQA 3BR0A 5TISC 2K9QA 3FMQA 4A12A 1USTA 5L3FA 2DFIA 3Q0WA 3MCZA 3WHCA 4F52A 4XN0A
chains in the Genus database with same CATH topology
1X3UA 2R7DA 2A6HF 4G8XA 3C3WA 3NRVA 3QPHA 3RTRA 4Y13A 3R61A 1LDDA 3P9CA 3F22A 2D45A 5ILVA 4N0BA 1OR7A 4EJTA 1OYWA 2XAHA 4ESFA 4ESJA 4A5MA 1T38A 2YU3A 2PN6A 2CO5A 2HKOA 3SFZA 2HGCA 3LA7A 1JXSA 5JI6A 1LEAA 2BGCA 3FHZA 3K69A 4CHUA 1J7KA 4EVIA 5HS8A 1MD0A 4HAMA 4LFUA 2YSRA 2A07F 1WSUA 3ECHA 3GO5A 3F72A 4MTEA 4AIJA 4BXUA 2G7HA 3TOBA 2DBBA 2P5KA 1XN7A 4TV7A 2NRAC 4GCVA 3V4GA 5LRRA 2ZNYA 1BJAA 4HYEA 4ZZLA 2PQ8A 3F6VA 2LDUA 4RB3C 2K7LA 1G3WA 3KP4A 4G6QA 2P7VB 2HDCA 3I5UA 3IL2A 3MQ0A 4HOBA 2ESHA 5LEKA 1YIOA 4MGRA 1P92A 1R5GA 3ZN0A 4OIQF 4UV8A 5HDNA 1SD4A 4OIRF 5BOXA 4BAYA 2QBYA 2KJCA 4U0VA 3V7RA 3VFZA 2ACJA 4EJWA 5J8CA 4LLLA 2HQNA 2KRFA 3GF2A 3JTGA 5E8IA 2Z99A 1QNTA 5ICEA 1Z1DA 2OU2A 3CUOA 4KDPA 4MHGA 1SMYF 5EEHA 1KYZA 3FM3A 2XGXA 3G73A 4UVCA 1V4RA 1IRGA 2HR3A 2EFWA 3HSEA 2D2WA 1YFHA 3BP8A 4UVAA 3F8MA 5KVRA 3MZHA 1U5TC 2P7CB 5HDGA 1TW2A 4YFNF 2WV0A 2FF4A 3WTVC 3B73A 5H6RA 1J2XA 3GX4X 1TNTA 5FD6A 2JPBA 1DPUA 3ML6A 1O7FA 2ESNA 4JBAA 1ZH5A 1SD7A 1PDNC 4I0AA 1TQMA 5BPIA 1UHMA 3ZMTA 4BHPA 1U6GA 4PDKA 1TW3A 3B02A 1FP1D 4ZYHA 5BQTA 1HW5A 2QZ8A 3C7JA 1XDUA 3LQRA 4OMYA 3EETA 1B9MA 1LB2A 1R00A 3LQQA 1G3YA 2H6BA 5ED4A 1KU3A 1R1VA 2UZKA 1ON2A 2FRHA 1MKMA 5FO5A 4GO1A 3N4MA 4JK1X 2K27A 2E1CA 2Z5UA 3HSRA 1FSEA 3E3VA 3FF5A 4GYIA 1SFUA 2DPUA 3E5UA 2OD5A 3KFWX 2DLLA 1G3SA 3MWMA 2OZ6A 1LEBA 2D1VA 5AONA 3SQNA 4HF1A 4BHCA 4I09A 4L9JA 1HBXG 1ZGAA 2V79A 2K86A 1ZAOA 2P5LC 3M8EA 3MEXA 1ZLJA 2P4WA 2ZJ2A 1H0MA 3BPXA 3GZ5A 3K1NA 4HZFA 3QPTA 4ENMA 3HOSA 4S04A 1ZARA 4MQ9F 1KQ8A 3BWGA 2A3SA 1ULYA 3ABUA 4CO8A 2QVOA 5DUKA 2Z33A 2OBPA 4BHBA 4ESBA 4KUMA 2DI3A 2CFXA 2KIFA 1P6RA 1BC7C 3J81K 4I98B 2COMA 1S7OA 5L3EA 2RC4A 1HW1A 5F6FA 2A5YB 2O3FA 5DUIA 2BBYA 3V7CA 1K7AA 1L3LA 4O3MA 5BS6A 1R1UA 3BJAA 5HS9A 1S29A 3SZTA 3J80Z 4WX9A 1GXQA 1JGSA 1D5VA 3H3ZA 2G9WA 4RAZA 2XASA 2HOEA 1AOYA 1HQCA 1PP8F 4M71A 1YW9A 2XKPA 2O6GE 3E6DA 3BJ6A 4KNYA 3I59B 3KEQA 2Z3YA 1BI0A 2XIGA 1HW2A 2CG4A 1KYWA 4XRFA 3H92A 3ZMVA 4Q4ZF 2L4MA 1GVJA 1QGPA 4G7HF 1EH8A 1V3FA 5DD4A 4HF2A 3K2ZA 2X4HA 5HLGA 4WK8F 5DCMB 2NNNA 2CQKA 3LA2A 2L54A 5D4RA 1L0OC 4M6XA 2O8XA 1XSDA 1IN7A 3P9IA 2IA2A 3MAJA 4Q47A 2BYVE 1FBUA 2DPDA 3PQJA 2QBYB 1BN5A 3TGNA 3QP6A 5K1YA 3V7SA 4R8HA 1T98A 4L9TA 1SFXA 3WGIA 4UUVA 4CDGA 3R60A 1KU7A 2WTEA 2A69F 3GUDA 2MLKA 2Z9OA 2FBKA 1W7PA 3SXYA 1U3EM 2OQGA 3F8CA 1RI7A 2CWEA 2VC0A 1Z7UA 4HQMA 3MFKA 3EYYA 5FFXA 4YIFA 1S8NA 1I27A 3ZP5A 2A61A 1XGMA 1XMKA 2CW0F 4IRGA 1FX7A 2MH9A 5JR3A 2DK8A 2QQAA 4N9IA 1XSVA 4RAYA 3BOQA 4RB1A 3WG9A 1ZLKA 2FNPA 4OU0A 1RIOH 2FOKA 4KIBA 4EJVA 1IRFA 5HS7A 2KKOA 5LGNA 1MJ9A 3KETA 1TTYA 4KN7X 4M72A 1FBSA 2FU4A 4BYYA 5LEJA 2A6EF 3MZYA 4D0PA 4NQWA 5J6XA 3JW4A 1TNSA 4Z2YA 4HDUA 4LGWA 4PGGA 2VBZA 1FPQA 3HRMA 4O5VA 3IRRA 3IWZA 2V1XA 1BM9A 4HX8A 4L9NA 1SMTA 1W5SA 1U5TA 2EA4A 4HA8A 1XCVA 4I01A 5E1WA 3RJPA 1JHFA 3WGGA 4KIGA 3U9GA 1TQIA 4L0ZB 1FYMA 2O03A 3BPVA 1P4AA 2KJBA 3IWFA 2ELHA 4R79A 3DFGA 4LG0A 3L09A 4HLYA 1TLHB 5F1RA 1B59A 1R58A 1I5ZA 2ZO4A 1MZBA 2ADUA 2GA2A 5LGUA 3Q9SA 1RUOA 2HKXA 4MNUA 2R3SA 3KCCA 2XAJA 4BNCA 1QO0D 4NHJA 4CGZA 1C0WA 3P9KA 2H09A 4UNOA 3BJOA 5CVIA 3S2WA 1AWCA 4G9YA 2M45A 1RNLA 3HHGA 2DK5A 1J59A 1HKTA 4ENKA 1KGSA 3DPLC 4HV6A 2QM3A 3FXRA 1D3YA 2EWNA 3WTZA 2XVCA 3WE3A 1ZRDA 1ON1A 1B4AA 3EYIA 3ULQB 4I0BA 1Y0UA 1G4DA 3E5QA 1REPC 4Y15A 1W7PD 3WTTC 4K2EA 4ENJA 3E6MA 1ZN2A 1IAWA 1ZRCA 2E7WA 2W57A 2FSWA 1LJ9A 4EM1A 4IHSA 4PGHA 2VT3A 4ZH4F 3F8BA 3GFIA 1DPRA 1YS7A 4PCQA 2EFOA 1LDJA 1K79A 2FMLA 3E6BA 5DCFA 1D8KA 1I6XA 4WWCA 2B0LA 3RPQA 3RPUA 4RGSA 2J5OA 2VE8A 2HYGD 4P9UA 3I54A 5F64A 4G6DA 2HTSA 2VT2A 1YW8A 1IN6A 2JZYA 3SHFA 1BI3A 1ZG1A 5L3DA 4Q5SF 5KK1A 1ODDA 2HFHA 2J5PA 5CYVA 3DF8A 2RNJA 4U88A 2VN2A 4UXNA 2XUBA 4DNCA 2HYFA 4M9SA 3CO6C 5D5XB 1OYIA 5LHGA 2ISZA 4HBLA 4R1HA 1W4MA 4HV5A 3HRTA 2NYXA 2W84A 4I02A 1BIAA 2OZUA 2W24A 2IRFG 4HF0A 2JT1A 2EFQA 4G94A 3HTUA 3RKXA 3ZMSA 3AAFA 4A2UA 2DTRA 4A5NA 2XHKA 2W85A 4P55A 5AIPA 3GLXA 2EV6A 3LA3A 3OOPA 2RQPA 1UHWA 3DQVC 4ZYGA 3FXUA 3J80K 3K1MA 1CF7B 4O6JA 5CVVA 1K78A 1FZPB 2IA0A 4I2OA 4GXOA 4IRHA 2FE3A 3GEZA 2E7XA 1FY7A 3IKVA 4KN4X 2V1DA 1YTYA 1G3TA 3GFJA 4I7HA 4ZYDA 4LJZF 2A68F 3G3ZA 4FHTA 2ZKZA 4L18B 3DKWA 3NQOA 2P6TA 2ETHA 1TBXA 5HOOA 2C6YA 2EFPA 1PUEE 5E1ZB 2MA3A 4YFXF 4ASNA 4P9FA 3FMRA 2GZWA 4XLPF 5ICGA 3Q5FA 3T0YA 2GWRA 4L0YB 3L2CA 4AIKA 3R6SA 3JSPA 2EJRA 4FX0A 5IT9K 2L01A 5E8GA 3DPTA 2NNYA 1TQPA 3K0LA 2FMYA 2Y0MA 2QQBA 2DU9A 3HRSA 3I4PA 3KP7A 3F8NA 2UWMA 4A6DA 3GVAA 1O3QA 1Z9CA 3HRUA 1EH6A 1UB9A 3F8FA 4H0EA 3F23A 2VOPA 4RGRA 3HIFA 1QZZA 3KP2A 4B8XA 1JE8A 3ISPA 5FLXZ 1GXPA 3GFMA 4Y17A 2MH2A 1WQ2A 3U2RA 2VODA 3F21A 2OAZA 4ON0A 1Z6RA 4HX4A 3FZVA 2XV4S 5FGMA 3I71A 2M8EA 1R36A 1U78A 5FD5A 2M1BA 4EJUA 2IA1A 1IW7F 1MGTA 2IVMA 4EQQA 1LNWA 1SFEA 4NB5A 1E2XA 4IXAA 1QQIA 2GIVA 3VB2A 4BQAA 3ZPLA 1XSXA 5FFZA 4YFKF 4HQEA 2FQ3A 4U7BA 2FBHA 1B6AA 2V6CA 1JHHA 2EV5A 3EQLF 2QLZA 2EFNA 1XGNA 3HUGA 1QPMA 4HLXA 2RKHA 1QBJA 3GFLA 3O6BB 2DW4A 3WGHA 2EA2A 2YX7A 3GW2A 1T6SA 1FP2A 1MJBA 2EB7A 5CVJA 5LGTA 2H27A 3KLNA 4MEYF 3ZMZA 3LAPA 3RIRA 4M9ZA 2V9VA 1OMIA 1O7LA 2Y75A 3QU3A 1I1GA 2CYYA 1FLIA 2FBIA 2TDXA 3GXOA 2AXLA 1IXSB 2LF8A 1BOAA 1S7AA 2ZBKA 2BV6A 5CLSA 1ZGJA 2ZXJA 2JTVA 3I58A 4U0WA 4IHTA 3ZMDA 4AIHA 5DDGA 2P6SA 4S05A 1LDKB 5J8FA 2XAQA 4EV0A 2QENA 3EUHA 4KICA 2STWA 1QZYA 5DCMA 1BI1A 3M9AA 1ZG5A 3TO7A 3T1BA 1XGOA 2E1NA 5E1XA 4EGYA 2H6CA 2FXAA 4LMYA 3FX3A 2LNBA 3J81Z 1HSTA 1STZA 4JQFA 3BDDA 5D4SA 2PFBA 1P4WA 2XRNA 5HVQC 2VONA 3LWFA 3TQNA 2R7FA 5CJ9A 3BROA 1O3RA 4HW0A 5FB2A 2PI0A 2L3DA 3WTXC 2F5DA 4QLCU 5D6EA 1IXCA 3IC7A 3CJNA 1OYYA 4EMSA 2ZFWA 1XGSA 3L00A 1IN5A 5D5WB 2YR2A 4HDVA 2ZNZA 2X0LA 4XLNF 4WXDA 2KIUA 1DDNA 4KFCA 3KP5A 1MJAA 2AS5F 2ZMEA 1KQ0A 4AVPA 4RGUA 3QRFF 2QYOA 5IT3A 2RGVA 1O3SA 1YW7A 5K5QA 4G7OF 3R0JA 1YO5C 2IW5A 1FNNA 4EM2A 5DV5A 3HHHA 2DO7A 5LHIA 5L3BA 2JSCA 2IJLA 4GGGA 3K9TA 3ERED 4A0XA 3KZZA 5LLQA 2XAFA 4HX7A 3HOTA 5BPDA 4EJOA 5HDKA 1LVAA 4P5OA 2LKPA 3KLOA 4OOIA 2F5CA 2F2EA 1IXRC 4A6EA 2V1UA 3HYIA 2MBFA 3ROUA 1WWXA 3ELKA 2STTA 5LRSA 4YIIA 3E5XA 2MD5A 2MLGA 3DEUA 4M74A 2HWVA 4OMZA 3E97A 2DQLA 1PP7U 3V8LA 3OV8A 3WTWC 2HS5A 3M1EA 1T0FA 1E17A 2IT0A 3SZPA 1FOKA 1USSA 1T39A 2BE5F 5BMZA 3TDUC 2DQRA 3GWZA 1FT9A 4LB5A 4F7ZA 5HLHA 4U7DA 2YX4A 3TDZC 1FYLA 5D5VB 1XDSA 2QUFA 3T8RA 3KEOA 4LB6B 3CUQA 1J5YA 5E18F 3QU6A 3TO6A 4Q48A 3M8FA 4PZJA 1RUNA 1SAXA 4L5JA 2KIMA 2HZTA 5A2QK 1F1ZA 4CYDA 2ISYA 3IHUA 3VODA 3O3KA 3JTHA 3I53A 1U5TB 1SD5A 2PEXA 5HLIA 4ZYEA 2MC3A 2NAZA 1CGPA 3LSTA 3D0SA 1F4KA 1OPCA 3W6KB 2RV8A 4KYWA 4LLNA 1G6NA 1XD7A 1OKRA 4LD5A 2W25A 4KIFA 2OQRA 2WC2A 4BH9A 3V8KA 2LF7A 1FWZA 4CZZA 2XROA 3R4KA 1F9NA 4MTDA 5E17F 3I64A 2VBYA 5ERIA 4KT5C 3COAC 5D8KB 1VTNC 1R23A 1IZ1A 3BZ6A 2L02A 3T5XA 2IPQX 3Q9VA 2JRTA 1BIBA 2XKOA 3D5LA 4WXHA 5K5OA 2HQRA 4RGXA 2VBWA 1Q1HA 2CSOA 3W6JB 1XB4A 4B09A 4MQVA 3IKTA 4A0YA 1W5TA 1D8JA 4M73A 4G7ZF 4GYGA 3H3UA 5EEGA 2GQQA 3VEPA 5TJJA 1ZREA 2FA5A 1H9TA 1IUYA 4WCGA 4KA4A 1ZG3A 4RS8A 2UXXA 1F5TA 2G7UA 2EV0A 1Z91A 1WRJA 5TRDA 1KQ9A 1S3JA 3ZMUA 5DD8A 1EH7A 3DV8A 4IRIA 4P96A 4OIOF 5L3GA 1KU9A 5CVRA 5ICCA 4DQ2A 1ONVA 2M87A 4M6YA 5FLXK 1RZ4A 5JHUA 1CF7A 2OA4A 3V8JA 2P5VA 4FT8A 4ENNA 3CTAA 2GXBA 1XMAA 1GHCA 3WTSC 2O61A 2Q8KA 4LLGF 4KMFA 2GAUA 1O3TA 3QAHA 4XSZF 2M30A 3FM5A 2RN7A 4E70A 4XSXF 3BY6A 1O57A 4EGZA 3NEUA 3PFIA 1DP7P 1R1TA 1FSHA 4L9VA 3LFKA 4OIPF 2PG4A 1FBQA 4IVNA 1WKMA 3CUQC 2L4AA 4CICA 1WI9A 2XAGA 4A0ZA 4IJAA 3WE2A 3IRQA 4IF4A 2Y48A 3C18A 5E20A 3N97A 3KZYA 4WXCA 5D8LB 4L5IA 1R7JA 4LK1F 5JFRA 5L3CA 1IF1A 3REOA 3JAMZ 2Q2EA 3LAJA 1KA8A 1DUXC 3ABTA 2DAOA 5A2QZ 4UVBA 4CXFA 4AD9A 5LBQA 3JAMK 2CGPA 2DT5A 4OINF 3K1PA 1B9NA 2QQ9A 2PBIA 3J7AO 1SD6A 1J9IA 1FYKA 2FNAA 3WTYC 2PLYA 5D6FA 1T2KA 2PJPA 2YPRA 1HXDA 5ICFA 1ZRFA 3DP7A 1B1BA 3WODF 5DYMA 1EV7A 1YG2A 4ZZDA 2WWYA 2M5WA 5ILUA 3M7GA 2LSOA 2F5FA 1H9GA 3L9FA 3F3XA 3QOPA 3RKWA 3RYPA 1BC8C 5K5RA 2FEZA 3P7NA 3RYRA 2O0YA 3TOAA 4UHTA 3QP5A 1XCBA 5CVUA 2UXNA 4FX4A 1P4XA 4KMUX 4LK0F 3JSOA 1MDMA 1FC3A 5IT9Z 1U2WA 2K4JA 3RKYA 1ZYRF 1MDMB 2GXGA 2PMHA 4WF2A 3E6CC 3TO9A 1R22A 3HSFA 3TKYA 5ILSA 3EDPA 1J75A 3L7WA 1UFMA 3KP3A 1UCRA 5H6QA 3RI4A 1NHAA 5AIQA 4M9XA 2P8TA 5JVTA 3CO7C 1KU2A 4UV9A 3CLOA 2PMUA 3CDHA 4N9HA 6PAXA 2RDPA 2HTJA 5D5UB 3RDIA 3GZ6A 2VOOA 3C1DA 2RVCA 3KE2A 4ETSA 4LG0B 1Z05A 2VBXA 1S6LA 3KP6A 2VC1A 2F5EA 2VXZA 2Q0OA 1P2FA 3ZQ7A 3DXJF 5H20A 1R5HA 1HKSA 1IN8A 2NS0A 3HTSB 2ZCWA 2GA1A 4EM0B 1YYVA 3T8TA 4QWQA 3FXQA 1LQ1A 1HSJA 3FWEA 1U8RA 1W7PB 1YS6A 4RB2C 4IPAA 1K78B 4RB0A 1ZHFA 1J0RA 3PQKA 3ZN1A 2QWWA 2HEOA 2ZMEB 1K6OA 1I1SA 1BI2A 2EK5A 2K4BA 3F6OA 3I0TA 3O2PE 3WU0A 1IN4A 1Z6TA 1YQAA 2VE9A 5LHHA 2K02A 1HKQA 2H94A 3FMSA 3WU1B 1A04A 3I59A 4MEXF 2BEOA 1BBYA 3WTUC 4XBFA 3VOEA 3GYHX 2JPCA 3R0AA 4YG2F 3ECOA 4U0YA 2D1HA 3CUQB 1YLFA 2IP2A 3U1DA 4AWXB 5DEQA 3FMQA 4A12A 1USTA 5L3FA 2DFIA 3MCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3U A;  2R7D A;  2A6H F;  4G8X A;  3C3W A;  3NRV A;  3QPH A;  3RTR A;  4Y13 A;  3R61 A;  1LDD A;  3P9C A;  3F22 A;  2D45 A;  5ILV A;  4N0B A;  1OR7 A;  4EJT A;  1OYW A;  2XAH A;  4ESF A;  4ESJ A;  4A5M A;  1T38 A;  2YU3 A;  2PN6 A;  2CO5 A;  2HKO A;  3SFZ A;  2HGC A;  3LA7 A;  1JXS A;  5JI6 A;  1LEA A;  2BGC A;  3FHZ A;  3K69 A;  4CHU A;  1J7K A;  4EVI A;  5HS8 A;  1MD0 A;  4HAM A;  4LFU A;  2YSR A;  2A07 F;  1WSU A;  3ECH A;  3GO5 A;  3F72 A;  4MTE A;  4AIJ A;  4BXU A;  2G7H A;  3TOB A;  2DBB A;  2P5K A;  1XN7 A;  4TV7 A;  2NRA C;  4GCV A;  3V4G A;  5LRR A;  2ZNY A;  1BJA A;  4HYE A;  4ZZL A;  2PQ8 A;  3F6V A;  2LDU A;  4RB3 C;  2K7L A;  1G3W A;  3KP4 A;  4G6Q A;  2P7V B;  2HDC A;  3I5U A;  3IL2 A;  3MQ0 A;  4HOB A;  2ESH A;  5LEK A;  1YIO A;  4MGR A;  1P92 A;  1R5G A;  3ZN0 A;  4OIQ F;  4UV8 A;  5HDN A;  1SD4 A;  4OIR F;  5BOX A;  4BAY A;  2QBY A;  2KJC A;  4U0V A;  3V7R A;  3VFZ A;  2ACJ A;  4EJW A;  5J8C A;  4LLL A;  2HQN A;  2KRF A;  3GF2 A;  3JTG A;  5E8I A;  2Z99 A;  1QNT A;  5ICE A;  1Z1D A;  2OU2 A;  3CUO A;  4KDP A;  4MHG A;  1SMY F;  5EEH A;  1KYZ A;  3FM3 A;  2XGX A;  3G73 A;  4UVC A;  1V4R A;  1IRG A;  2HR3 A;  2EFW A;  3HSE A;  2D2W A;  1YFH A;  3BP8 A;  4UVA A;  3F8M A;  5KVR A;  3MZH A;  1U5T C;  2P7C B;  5HDG A;  1TW2 A;  4YFN F;  2WV0 A;  2FF4 A;  3WTV C;  3B73 A;  5H6R A;  1J2X A;  3GX4 X;  1TNT A;  5FD6 A;  2JPB A;  1DPU A;  3ML6 A;  1O7F A;  2ESN A;  4JBA A;  1ZH5 A;  1SD7 A;  1PDN C;  4I0A A;  1TQM A;  5BPI A;  1UHM A;  3ZMT A;  4BHP A;  1U6G A;  4PDK A;  1TW3 A;  3B02 A;  1FP1 D;  4ZYH A;  5BQT A;  1HW5 A;  2QZ8 A;  3C7J A;  1XDU A;  3LQR A;  4OMY A;  3EET A;  1B9M A;  1LB2 A;  1R00 A;  3LQQ A;  1G3Y A;  2H6B A;  5ED4 A;  1KU3 A;  1R1V A;  2UZK A;  1ON2 A;  2FRH A;  1MKM A;  5FO5 A;  4GO1 A;  3N4M A;  4JK1 X;  2K27 A;  2E1C A;  2Z5U A;  3HSR A;  1FSE A;  3E3V A;  3FF5 A;  4GYI A;  1SFU A;  2DPU A;  3E5U A;  2OD5 A;  3KFW X;  2DLL A;  1G3S A;  3MWM A;  2OZ6 A;  1LEB A;  2D1V A;  5AON A;  3SQN A;  4HF1 A;  4BHC A;  4I09 A;  4L9J A;  1HBX G;  1ZGA A;  2V79 A;  2K86 A;  1ZAO A;  2P5L C;  3M8E A;  3MEX A;  1ZLJ A;  2P4W A;  2ZJ2 A;  1H0M A;  3BPX A;  3GZ5 A;  3K1N A;  4HZF A;  3QPT A;  4ENM A;  3HOS A;  4S04 A;  1ZAR A;  4MQ9 F;  1KQ8 A;  3BWG A;  2A3S A;  1ULY A;  3ABU A;  4CO8 A;  2QVO A;  5DUK A;  2Z33 A;  2OBP A;  4BHB A;  4ESB A;  4KUM A;  2DI3 A;  2CFX A;  2KIF A;  1P6R A;  1BC7 C;  3J81 K;  4I98 B;  2COM A;  1S7O A;  5L3E A;  2RC4 A;  1HW1 A;  5F6F A;  2A5Y B;  2O3F A;  5DUI A;  2BBY A;  3V7C A;  1K7A A;  1L3L A;  4O3M A;  5BS6 A;  1R1U A;  3BJA A;  5HS9 A;  1S29 A;  3SZT A;  3J80 Z;  4WX9 A;  1GXQ A;  1JGS A;  1D5V A;  3H3Z A;  2G9W A;  4RAZ A;  2XAS A;  2HOE A;  1AOY A;  1HQC A;  1PP8 F;  4M71 A;  1YW9 A;  2XKP A;  2O6G E;  3E6D A;  3BJ6 A;  4KNY A;  3I59 B;  3KEQ A;  2Z3Y A;  1BI0 A;  2XIG A;  1HW2 A;  2CG4 A;  1KYW A;  4XRF A;  3H92 A;  3ZMV A;  4Q4Z F;  2L4M A;  1GVJ A;  1QGP A;  4G7H F;  1EH8 A;  1V3F A;  5DD4 A;  4HF2 A;  3K2Z A;  2X4H A;  5HLG A;  4WK8 F;  5DCM B;  2NNN A;  2CQK A;  3LA2 A;  2L54 A;  5D4R A;  1L0O C;  4M6X A;  2O8X A;  1XSD A;  1IN7 A;  3P9I A;  2IA2 A;  3MAJ A;  4Q47 A;  2BYV E;  1FBU A;  2DPD A;  3PQJ A;  2QBY B;  1BN5 A;  3TGN A;  3QP6 A;  5K1Y A;  3V7S A;  4R8H A;  1T98 A;  4L9T A;  1SFX A;  3WGI A;  4UUV A;  4CDG A;  3R60 A;  1KU7 A;  2WTE A;  2A69 F;  3GUD A;  2MLK A;  2Z9O A;  2FBK A;  1W7P A;  3SXY A;  1U3E M;  2OQG A;  3F8C A;  1RI7 A;  2CWE A;  2VC0 A;  1Z7U A;  4HQM A;  3MFK A;  3EYY A;  5FFX A;  4YIF A;  1S8N A;  1I27 A;  3ZP5 A;  2A61 A;  1XGM A;  1XMK A;  2CW0 F;  4IRG A;  1FX7 A;  2MH9 A;  5JR3 A;  2DK8 A;  2QQA A;  4N9I A;  1XSV A;  4RAY A;  3BOQ A;  4RB1 A;  3WG9 A;  1ZLK A;  2FNP A;  4OU0 A;  1RIO H;  2FOK A;  4KIB A;  4EJV A;  1IRF A;  5HS7 A;  2KKO A;  5LGN A;  1MJ9 A;  3KET A;  1TTY A;  4KN7 X;  4M72 A;  1FBS A;  2FU4 A;  4BYY A;  5LEJ A;  2A6E F;  3MZY A;  4D0P A;  4NQW A;  5J6X A;  3JW4 A;  1TNS A;  4Z2Y A;  4HDU A;  4LGW A;  4PGG A;  2VBZ A;  1FPQ A;  3HRM A;  4O5V A;  3IRR A;  3IWZ A;  2V1X A;  1BM9 A;  4HX8 A;  4L9N A;  1SMT A;  1W5S A;  1U5T A;  2EA4 A;  4HA8 A;  1XCV A;  4I01 A;  5E1W A;  3RJP A;  1JHF A;  3WGG A;  4KIG A;  3U9G A;  1TQI A;  4L0Z B;  1FYM A;  2O03 A;  3BPV A;  1P4A A;  2KJB A;  3IWF A;  2ELH A;  4R79 A;  3DFG A;  4LG0 A;  3L09 A;  4HLY A;  1TLH B;  5F1R A;  1B59 A;  1R58 A;  1I5Z A;  2ZO4 A;  1MZB A;  2ADU A;  2GA2 A;  5LGU A;  3Q9S A;  1RUO A;  2HKX A;  4MNU A;  2R3S A;  3KCC A;  2XAJ A;  4BNC A;  1QO0 D;  4NHJ A;  4CGZ A;  1C0W A;  3P9K A;  2H09 A;  4UNO A;  3BJO A;  5CVI A;  3S2W A;  1AWC A;  4G9Y A;  2M45 A;  1RNL A;  3HHG A;  2DK5 A;  1J59 A;  1HKT A;  4ENK A;  1KGS A;  3DPL C;  4HV6 A;  2QM3 A;  3FXR A;  1D3Y A;  2EWN A;  3WTZ A;  2XVC A;  3WE3 A;  1ZRD A;  1ON1 A;  1B4A A;  3EYI A;  3ULQ B;  4I0B A;  1Y0U A;  1G4D A;  3E5Q A;  1REP C;  4Y15 A;  1W7P D;  3WTT C;  4K2E A;  4ENJ A;  3E6M A;  1ZN2 A;  1IAW A;  1ZRC A;  2E7W A;  2W57 A;  2FSW A;  1LJ9 A;  4EM1 A;  4IHS A;  4PGH A;  2VT3 A;  4ZH4 F;  3F8B A;  3GFI A;  1DPR A;  1YS7 A;  4PCQ A;  2EFO A;  1LDJ A;  1K79 A;  2FML A;  3E6B A;  5DCF A;  1D8K A;  1I6X A;  4WWC A;  2B0L A;  3RPQ A;  3RPU A;  4RGS A;  2J5O A;  2VE8 A;  2HYG D;  4P9U A;  3I54 A;  5F64 A;  4G6D A;  2HTS A;  2VT2 A;  1YW8 A;  1IN6 A;  2JZY A;  3SHF A;  1BI3 A;  1ZG1 A;  5L3D A;  4Q5S F;  5KK1 A;  1ODD A;  2HFH A;  2J5P A;  5CYV A;  3DF8 A;  2RNJ A;  4U88 A;  2VN2 A;  4UXN A;  2XUB A;  4DNC A;  2HYF A;  4M9S A;  3CO6 C;  5D5X B;  1OYI A;  5LHG A;  2ISZ A;  4HBL A;  4R1H A;  1W4M A;  4HV5 A;  3HRT A;  2NYX A;  2W84 A;  4I02 A;  1BIA A;  2OZU A;  2W24 A;  2IRF G;  4HF0 A;  2JT1 A;  2EFQ A;  4G94 A;  3HTU A;  3RKX A;  3ZMS A;  3AAF A;  4A2U A;  2DTR A;  4A5N A;  2XHK A;  2W85 A;  4P55 A;  5AIP A;  3GLX A;  2EV6 A;  3LA3 A;  3OOP A;  2RQP A;  1UHW A;  3DQV C;  4ZYG A;  3FXU A;  3J80 K;  3K1M A;  1CF7 B;  4O6J A;  5CVV A;  1K78 A;  1FZP B;  2IA0 A;  4I2O A;  4GXO A;  4IRH A;  2FE3 A;  3GEZ A;  2E7X A;  1FY7 A;  3IKV A;  4KN4 X;  2V1D A;  1YTY A;  1G3T A;  3GFJ A;  4I7H A;  4ZYD A;  4LJZ F;  2A68 F;  3G3Z A;  4FHT A;  2ZKZ A;  4L18 B;  3DKW A;  3NQO A;  2P6T A;  2ETH A;  1TBX A;  5HOO A;  2C6Y A;  2EFP A;  1PUE E;  5E1Z B;  2MA3 A;  4YFX F;  4ASN A;  4P9F A;  3FMR A;  2GZW A;  4XLP F;  5ICG A;  3Q5F A;  3T0Y A;  2GWR A;  4L0Y B;  3L2C A;  4AIK A;  3R6S A;  3JSP A;  2EJR A;  4FX0 A;  5IT9 K;  2L01 A;  5E8G A;  3DPT A;  2NNY A;  1TQP A;  3K0L A;  2FMY A;  2Y0M A;  2QQB A;  2DU9 A;  3HRS A;  3I4P A;  3KP7 A;  3F8N A;  2UWM A;  4A6D A;  3GVA A;  1O3Q A;  1Z9C A;  3HRU A;  1EH6 A;  1UB9 A;  3F8F A;  4H0E A;  3F23 A;  2VOP A;  4RGR A;  3HIF A;  1QZZ A;  3KP2 A;  4B8X A;  1JE8 A;  3ISP A;  5FLX Z;  1GXP A;  3GFM A;  4Y17 A;  2MH2 A;  1WQ2 A;  3U2R A;  2VOD A;  3F21 A;  2OAZ A;  4ON0 A;  1Z6R A;  4HX4 A;  3FZV A;  2XV4 S;  5FGM A;  3I71 A;  2M8E A;  1R36 A;  1U78 A;  5FD5 A;  2M1B A;  4EJU A;  2IA1 A;  1IW7 F;  1MGT A;  2IVM A;  4EQQ A;  1LNW A;  1SFE A;  4NB5 A;  1E2X A;  4IXA A;  1QQI A;  2GIV A;  3VB2 A;  4BQA A;  3ZPL A;  1XSX A;  5FFZ A;  4YFK F;  4HQE A;  2FQ3 A;  4U7B A;  2FBH A;  1B6A A;  2V6C A;  1JHH A;  2EV5 A;  3EQL F;  2QLZ A;  2EFN A;  1XGN A;  3HUG A;  1QPM A;  4HLX A;  2RKH A;  1QBJ A;  3GFL A;  3O6B B;  2DW4 A;  3WGH A;  2EA2 A;  2YX7 A;  3GW2 A;  1T6S A;  1FP2 A;  1MJB A;  2EB7 A;  5CVJ A;  5LGT A;  2H27 A;  3KLN A;  4MEY F;  3ZMZ A;  3LAP A;  3RIR A;  4M9Z A;  2V9V A;  1OMI A;  1O7L A;  2Y75 A;  3QU3 A;  1I1G A;  2CYY A;  1FLI A;  2FBI A;  2TDX A;  3GXO A;  2AXL A;  1IXS B;  2LF8 A;  1BOA A;  1S7A A;  2ZBK A;  2BV6 A;  5CLS A;  1ZGJ A;  2ZXJ A;  2JTV A;  3I58 A;  4U0W A;  4IHT A;  3ZMD A;  4AIH A;  5DDG A;  2P6S A;  4S05 A;  1LDK B;  5J8F A;  2XAQ A;  4EV0 A;  2QEN A;  3EUH A;  4KIC A;  2STW A;  1QZY A;  5DCM A;  1BI1 A;  3M9A A;  1ZG5 A;  3TO7 A;  3T1B A;  1XGO A;  2E1N A;  5E1X A;  4EGY A;  2H6C A;  2FXA A;  4LMY A;  3FX3 A;  2LNB A;  3J81 Z;  1HST A;  1STZ A;  4JQF A;  3BDD A;  5D4S A;  2PFB A;  1P4W A;  2XRN A;  5HVQ C;  2VON A;  3LWF A;  3TQN A;  2R7F A;  5CJ9 A;  3BRO A;  1O3R A;  4HW0 A;  5FB2 A;  2PI0 A;  2L3D A;  3WTX C;  2F5D A;  4QLC U;  5D6E A;  1IXC A;  3IC7 A;  3CJN A;  1OYY A;  4EMS A;  2ZFW A;  1XGS A;  3L00 A;  1IN5 A;  5D5W B;  2YR2 A;  4HDV A;  2ZNZ A;  2X0L A;  4XLN F;  4WXD A;  2KIU A;  1DDN A;  4KFC A;  3KP5 A;  1MJA A;  2AS5 F;  2ZME A;  1KQ0 A;  4AVP A;  4RGU A;  3QRF F;  2QYO A;  5IT3 A;  2RGV A;  1O3S A;  1YW7 A;  5K5Q A;  4G7O F;  3R0J A;  1YO5 C;  2IW5 A;  1FNN A;  4EM2 A;  5DV5 A;  3HHH A;  2DO7 A;  5LHI A;  5L3B A;  2JSC A;  2IJL A;  4GGG A;  3K9T A;  3ERE D;  4A0X A;  3KZZ A;  5LLQ A;  2XAF A;  4HX7 A;  3HOT A;  5BPD A;  4EJO A;  5HDK A;  1LVA A;  4P5O A;  2LKP A;  3KLO A;  4OOI A;  2F5C A;  2F2E A;  1IXR C;  4A6E A;  2V1U A;  3HYI A;  2MBF A;  3ROU A;  1WWX A;  3ELK A;  2STT A;  5LRS A;  4YII A;  3E5X A;  2MD5 A;  2MLG A;  3DEU A;  4M74 A;  2HWV A;  4OMZ A;  3E97 A;  2DQL A;  1PP7 U;  3V8L A;  3OV8 A;  3WTW C;  2HS5 A;  3M1E A;  1T0F A;  1E17 A;  2IT0 A;  3SZP A;  1FOK A;  1USS A;  1T39 A;  2BE5 F;  5BMZ A;  3TDU C;  2DQR A;  3GWZ A;  1FT9 A;  4LB5 A;  4F7Z A;  5HLH A;  4U7D A;  2YX4 A;  3TDZ C;  1FYL A;  5D5V B;  1XDS A;  2QUF A;  3T8R A;  3KEO A;  4LB6 B;  3CUQ A;  1J5Y A;  5E18 F;  3QU6 A;  3TO6 A;  4Q48 A;  3M8F A;  4PZJ A;  1RUN A;  1SAX A;  4L5J A;  2KIM A;  2HZT A;  5A2Q K;  1F1Z A;  4CYD A;  2ISY A;  3IHU A;  3VOD A;  3O3K A;  3JTH A;  3I53 A;  1U5T B;  1SD5 A;  2PEX A;  5HLI A;  4ZYE A;  2MC3 A;  2NAZ A;  1CGP A;  3LST A;  3D0S A;  1F4K A;  1OPC A;  3W6K B;  2RV8 A;  4KYW A;  4LLN A;  1G6N A;  1XD7 A;  1OKR A;  4LD5 A;  2W25 A;  4KIF A;  2OQR A;  2WC2 A;  4BH9 A;  3V8K A;  2LF7 A;  1FWZ A;  4CZZ A;  2XRO A;  3R4K A;  1F9N A;  4MTD A;  5E17 F;  3I64 A;  2VBY A;  5ERI A;  4KT5 C;  3COA C;  5D8K B;  1VTN C;  1R23 A;  1IZ1 A;  3BZ6 A;  2L02 A;  3T5X A;  2IPQ X;  3Q9V A;  2JRT A;  1BIB A;  2XKO A;  3D5L A;  4WXH A;  5K5O A;  2HQR A;  4RGX A;  2VBW A;  1Q1H A;  2CSO A;  3W6J B;  1XB4 A;  4B09 A;  4MQV A;  3IKT A;  4A0Y A;  1W5T A;  1D8J A;  4M73 A;  4G7Z F;  4GYG A;  3H3U A;  5EEG A;  2GQQ A;  3VEP A;  5TJJ A;  1ZRE A;  2FA5 A;  1H9T A;  1IUY A;  4WCG A;  4KA4 A;  1ZG3 A;  4RS8 A;  2UXX A;  1F5T A;  2G7U A;  2EV0 A;  1Z91 A;  1WRJ A;  5TRD A;  1KQ9 A;  1S3J A;  3ZMU A;  5DD8 A;  1EH7 A;  3DV8 A;  4IRI A;  4P96 A;  4OIO F;  5L3G A;  1KU9 A;  5CVR A;  5ICC A;  4DQ2 A;  1ONV A;  2M87 A;  4M6Y A;  5FLX K;  1RZ4 A;  5JHU A;  1CF7 A;  2OA4 A;  3V8J A;  2P5V A;  4FT8 A;  4ENN A;  3CTA A;  2GXB A;  1XMA A;  1GHC A;  3WTS C;  2O61 A;  2Q8K A;  4LLG F;  4KMF A;  2GAU A;  1O3T A;  3QAH A;  4XSZ F;  2M30 A;  3FM5 A;  2RN7 A;  4E70 A;  4XSX F;  3BY6 A;  1O57 A;  4EGZ A;  3NEU A;  3PFI A;  1DP7 P;  1R1T A;  1FSH A;  4L9V A;  3LFK A;  4OIP F;  2PG4 A;  1FBQ A;  4IVN A;  1WKM A;  3CUQ C;  2L4A A;  4CIC A;  1WI9 A;  2XAG A;  4A0Z A;  4IJA A;  3WE2 A;  3IRQ A;  4IF4 A;  2Y48 A;  3C18 A;  5E20 A;  3N97 A;  3KZY A;  4WXC A;  5D8L B;  4L5I A;  1R7J A;  4LK1 F;  5JFR A;  5L3C A;  1IF1 A;  3REO A;  3JAM Z;  2Q2E A;  3LAJ A;  1KA8 A;  1DUX C;  3ABT A;  2DAO A;  5A2Q Z;  4UVB A;  4CXF A;  4AD9 A;  5LBQ A;  3JAM K;  2CGP A;  2DT5 A;  4OIN F;  3K1P A;  1B9N A;  2QQ9 A;  2PBI A;  3J7A O;  1SD6 A;  1J9I A;  1FYK A;  2FNA A;  3WTY C;  2PLY A;  5D6F A;  1T2K A;  2PJP A;  2YPR A;  1HXD A;  5ICF A;  1ZRF A;  3DP7 A;  1B1B A;  3WOD F;  5DYM A;  1EV7 A;  1YG2 A;  4ZZD A;  2WWY A;  2M5W A;  5ILU A;  3M7G A;  2LSO A;  2F5F A;  1H9G A;  3L9F A;  3F3X A;  3QOP A;  3RKW A;  3RYP A;  1BC8 C;  5K5R A;  2FEZ A;  3P7N A;  3RYR A;  2O0Y A;  3TOA A;  4UHT A;  3QP5 A;  1XCB A;  5CVU A;  2UXN A;  4FX4 A;  1P4X A;  4KMU X;  4LK0 F;  3JSO A;  1MDM A;  1FC3 A;  5IT9 Z;  1U2W A;  2K4J A;  3RKY A;  1ZYR F;  1MDM B;  2GXG A;  2PMH A;  4WF2 A;  3E6C C;  3TO9 A;  1R22 A;  3HSF A;  3TKY A;  5ILS A;  3EDP A;  1J75 A;  3L7W A;  1UFM A;  3KP3 A;  1UCR A;  5H6Q A;  3RI4 A;  1NHA A;  5AIQ A;  4M9X A;  2P8T A;  5JVT A;  3CO7 C;  1KU2 A;  4UV9 A;  3CLO A;  2PMU A;  3CDH A;  4N9H A;  6PAX A;  2RDP A;  2HTJ A;  5D5U B;  3RDI A;  3GZ6 A;  2VOO A;  3C1D A;  2RVC A;  3KE2 A;  4ETS A;  4LG0 B;  1Z05 A;  2VBX A;  1S6L A;  3KP6 A;  2VC1 A;  2F5E A;  2VXZ A;  2Q0O A;  1P2F A;  3ZQ7 A;  3DXJ F;  5H20 A;  1R5H A;  1HKS A;  1IN8 A;  2NS0 A;  3HTS B;  2ZCW A;  2GA1 A;  4EM0 B;  1YYV A;  3T8T A;  4QWQ A;  3FXQ A;  1LQ1 A;  1HSJ A;  3FWE A;  1U8R A;  1W7P B;  1YS6 A;  4RB2 C;  4IPA A;  1K78 B;  4RB0 A;  1ZHF A;  1J0R A;  3PQK A;  3ZN1 A;  2QWW A;  2HEO A;  2ZME B;  1K6O A;  1I1S A;  1BI2 A;  2EK5 A;  2K4B A;  3F6O A;  3I0T A;  3O2P E;  3WU0 A;  1IN4 A;  1Z6T A;  1YQA A;  2VE9 A;  5LHH A;  2K02 A;  1HKQ A;  2H94 A;  3FMS A;  3WU1 B;  1A04 A;  3I59 A;  4MEX F;  2BEO A;  1BBY A;  3WTU C;  4XBF A;  3VOE A;  3GYH X;  2JPC A;  3R0A A;  4YG2 F;  3ECO A;  4U0Y A;  2D1H A;  3CUQ B;  1YLF A;  2IP2 A;  3U1D A;  4AWX B;  5DEQ A;  3FMQ A;  4A12 A;  1UST A;  5L3F A;  2DFI A;  3MCZ A; 
#chains in the Genus database with same CATH topology
 1X3U A;  2R7D A;  2A6H F;  4G8X A;  1K83 J;  1RET A;  3C3W A;  3NRV A;  3QPH A;  2WAF A;  3MKL A;  4F55 A;  3RTR A;  4Y13 A;  3R61 A;  1LDD A;  3P9C A;  2OUM A;  1MBH A;  3N05 A;  3F22 A;  5ILV A;  2D45 A;  1VQN I;  4N0B A;  1OR7 A;  4EJT A;  1OYW A;  3ZQQ A;  2BXY A;  2V1N A;  3H0D A;  2XAH A;  1FMV A;  4ESF A;  4ESJ A;  4A5M A;  2VUM J;  1T38 A;  2YU3 A;  2L9R A;  2PN6 A;  3DLA A;  3CCU I;  2CO5 A;  3OMY A;  2HKO A;  2BOL A;  2CUJ A;  3SFZ A;  2HGC A;  3LA7 A;  1JXS A;  5JI6 A;  3UKG A;  1X1A A;  3OYA A;  1LEA A;  1PUF B;  1R6R A;  2BGC A;  2CW7 A;  3FHZ A;  1Y8Q B;  3JRA A;  3S32 A;  3W2V A;  4ZJZ A;  3K69 A;  3JR9 A;  1J7K A;  4CHU A;  2DOA A;  4EVI A;  1MNE A;  5HS8 A;  1MD0 A;  2KLO A;  1WCM J;  3WG7 H;  1A36 A;  4HAM A;  4IOC F;  1HCR A;  2R7X A;  4LFU A;  2YSR A;  4C3J J;  2CQN A;  2A07 F;  1WSU A;  2CJJ A;  3ECH A;  2DJI A;  3GO5 A;  3F72 A;  1D0X A;  4MTE A;  4C30 A;  4AIJ A;  4V19 K;  5FLV A;  4BXU A;  5E3O A;  2G7H A;  3TOB A;  2DBB A;  3I56 I;  2P5K A;  4DZP A;  4FET A;  5CQG A;  1XN7 A;  4I76 A;  1Z7L A;  2HOT A;  4TV7 A;  5HNF A;  5IYB J;  2NRA C;  3BR2 A;  4E6K G;  3OYK A;  4CCO A;  1W5C C;  4GCV A;  2MAB A;  3OYD A;  3V4G A;  5LRR A;  2ZNY A;  1BJA A;  2LR8 A;  2M34 A;  4HYE A;  2HPM A;  1D1A A;  4ZZL A;  2PQ8 A;  3F6V A;  4BXF A;  4QPQ A;  1Y8R B;  2LDU A;  4RB3 C;  1ZR2 A;  2R92 J;  2K7L A;  1LE8 A;  4BDZ A;  3C2G A;  3LL7 A;  1G3W A;  3KP4 A;  1NK2 P;  2LMD A;  4G6Q A;  5M5W J;  2P7V B;  3BG3 A;  4IHW A;  2HDC A;  1V54 H;  3I5U A;  4IO9 F;  2IGK A;  3IL2 A;  3MQ0 A;  2DN0 A;  1IDZ A;  5F0H A;  3LMM A;  2OPT A;  4HOB A;  2ESH A;  3GZN B;  5LEK A;  3M3Y J;  2V4J C;  1YIO A;  2R7W A;  4MGR A;  1P92 A;  1RRJ A;  2WB1 A;  1R5G A;  3ZN0 A;  2WBM A;  4OIQ F;  2KL4 A;  3LNQ A;  3MKW B;  4UV8 A;  5HDN A;  3CES A;  1SD4 A;  3CJQ B;  2WAQ N;  3HG9 A;  4OIR F;  9ANT A;  5BOX A;  4BAY A;  2QBY A;  2KDO A;  1JTX A;  4QPO A;  2K85 A;  2Y30 A;  3RZD J;  2KJC A;  1KZH A;  4U0V A;  3GTM J;  2JSP A;  3V7R A;  3VFZ A;  2ACJ A;  4EJW A;  5J8C A;  2IXS A;  4LLL A;  2HQN A;  2LFB A;  2KRF A;  2VIX A;  2JUC A;  3GF2 A;  3JTG A;  4D7M A;  1QZE A;  5E8I A;  3FKI J;  2Z99 A;  1QNT A;  1U9N A;  1Y39 A;  1D0Z A;  3J7Z I;  5B5E C;  5ICE A;  1Z1D A;  2OU2 A;  3CUO A;  4KDP A;  1Y6I A;  4MHG A;  1SMY F;  3ZQF A;  5EEH A;  1WJA A;  3H5A A;  3TBI A;  4XKC A;  3ZQL A;  1KYZ A;  3F9K A;  3FM3 A;  2XGX A;  2CV1 A;  3G73 A;  4UVC A;  1MMS A;  2XSD C;  1V4R A;  1IRG A;  2HR3 A;  3DCF A;  2EFW A;  3HSE A;  1RR7 A;  3ASO H;  2WB1 N;  4RM3 A;  2D2W A;  2LC2 A;  2EIK H;  1YFH A;  1VQO I;  3BP8 A;  3QPL A;  4UVA A;  3F8M A;  5KVR A;  3MZH A;  1YHQ I;  1U5T C;  4B1R A;  3PNY A;  1FOW A;  4FQG A;  1FOY A;  2P7C B;  3K10 A;  5HDG A;  1TW2 A;  4YFN F;  1MMG A;  1VQ8 I;  1RC9 A;  2WV0 A;  2FF4 A;  3WTV C;  1TP4 A;  4HNV A;  3B73 A;  3DU5 A;  1I3Q J;  5H6R A;  1J2X A;  4AYB N;  1JJ8 C;  2M9H A;  3G6E I;  2KP6 A;  1FOX A;  2VQC A;  4Y33 A;  3GX4 X;  1TNT A;  3QPS A;  5FD6 A;  2JPB A;  1QHG A;  1DPU A;  3ML6 A;  1O7F A;  5KCM A;  2ESN A;  5IOZ A;  4JBA A;  2KZG A;  1ZH5 A;  1SD7 A;  4B44 A;  3LOC A;  3L2U A;  1PDN C;  4I0A A;  2BHZ A;  2FX0 A;  1JUS A;  1TQM A;  5BPI A;  3AFH A;  4HEA 2;  1VQ5 I;  1YI2 I;  4UUT A;  4KIS A;  2Y9Y A;  5JLX A;  5FRM A;  1UHM A;  3ZMT A;  1ZTR A;  2BY0 A;  4BHP A;  1U6G A;  2JA6 J;  4PDK A;  1TW3 A;  5KHD A;  3B02 A;  1FP1 D;  2L0K A;  4ZYH A;  4PJJ A;  5BQT A;  2DFF A;  1HW5 A;  3SYT A;  4X0G A;  2QZ8 A;  3C7J A;  3L2Q A;  2Z16 A;  1XDU A;  3LQR A;  3I4M J;  1SFO J;  1DGR M;  4OMY A;  3HZJ A;  4XID A;  3EET A;  1B9M A;  1LB2 A;  5JHF A;  4XLA A;  1R00 A;  1KON A;  4A3M J;  4DIQ A;  3LQQ A;  4RBO A;  1MBF A;  2JA7 J;  3H36 A;  1G3Y A;  2JA8 J;  2NOG A;  2H6B A;  1R71 A;  2DA7 A;  5ED4 A;  1KU3 A;  1R1V A;  2UZK A;  1ON2 A;  2FRH A;  4XLF A;  1MKM A;  1W1W E;  3IAM 2;  5FO5 A;  3LSJ A;  1TWH J;  4BAC A;  2DOF A;  4GO1 A;  3N4M A;  5HNH A;  2MYS A;  2F6C A;  5B1A H;  4JK1 X;  3BTC A;  2K27 A;  2IGN A;  4HNT A;  4HNU A;  2E1C A;  2Z5U A;  3HSR A;  4AUX A;  2JA5 J;  1FSE A;  2EZH A;  2ZXW H;  3GTG J;  5HLT A;  2LKS A;  1MMD A;  1V55 H;  3E3V A;  3FF5 A;  4GYI A;  1Z3Y A;  2LK2 A;  5J1R A;  4P1W A;  1SFU A;  2OF7 A;  2DPU A;  4IKF A;  3X2Q H;  3E5U A;  1TC3 C;  5JLW A;  3H9Q A;  2OD5 A;  3BT9 A;  3KFW X;  2DLL A;  1G3S A;  4BKX A;  3MWM A;  2OZ6 A;  3RQI A;  1LEB A;  3VDX A;  3K70 C;  2Z2S B;  3W6V A;  3BC8 A;  2D1V A;  3TP0 A;  5AON A;  4OAY A;  3SQN A;  3A2K A;  4XOT A;  3IV5 A;  2WY7 Q;  4HF1 A;  3DKX A;  3HOY J;  4BHC A;  3LSR A;  4I09 A;  1XX5 A;  4L9J A;  3HOV J;  1HBX G;  2BW3 B;  1ZGA A;  2V79 A;  2K86 A;  3AG2 H;  3CMA I;  5E3M A;  1ZAO A;  3K4B A;  3OYB A;  2P5L C;  3VYR B;  3M8E A;  3MEX A;  1S5L C;  3S17 J;  1UZC A;  2LRD A;  1ZLJ A;  1V5E A;  2P4W A;  2IEK A;  2BHY A;  2ZJ2 A;  5B3S H;  1H0M A;  4M3D A;  2DMU A;  3BPX A;  3GZ5 A;  3HDD A;  2MW8 A;  3K1N A;  2LY2 A;  4GDF A;  2EIL H;  3A03 A;  2M4K A;  4HZF A;  1AKH B;  3CQZ J;  4UY8 I;  3S1R J;  1FTZ A;  3QPT A;  2X51 A;  4ENM A;  2JVH A;  3HOS A;  1T8I A;  3JRF A;  4HSR A;  4S04 A;  1ZAR A;  4MQ9 F;  1GUU A;  1KQ8 A;  4XRM A;  3BWG A;  2A3S A;  2PJR B;  3S3N A;  1D1B A;  1ULY A;  3ABU A;  4CO8 A;  2QVO A;  3KPH A;  2QKM B;  5DUK A;  2Z33 A;  2OBP A;  4BHB A;  2QQ8 A;  1QHH D;  4DJA A;  3PFY A;  4ESB A;  2A5W A;  4RAF A;  2R5Y B;  4B47 A;  4DOZ A;  4KUM A;  4PSW A;  2DI3 A;  2CFX A;  2KIF A;  2LBF A;  2LG4 A;  1P6R A;  1BC7 C;  4UUS B;  2CUF A;  3J81 K;  2DMP A;  4XKV A;  4I98 B;  2COM A;  3ABK H;  1H89 C;  1S7O A;  5L3E A;  2RC4 A;  1HW1 A;  2CH0 A;  5F6F A;  3AL0 C;  2A5Y B;  2O3F A;  5DUI A;  2F5V A;  2BBY A;  3H9J A;  4D1Q A;  4BY7 J;  3V7C A;  1K7A A;  1Y1V J;  2H1L A;  1L3L A;  1WJ5 A;  3CLQ A;  3ZGK A;  4O3M A;  5BS6 A;  1R1U A;  4II3 A;  3BQY A;  2EZK A;  3BJA A;  5HS9 A;  3HOW J;  1S29 A;  3SZT A;  3PO2 J;  3A0B C;  3J80 Z;  1HC8 A;  1MIJ A;  4WX9 A;  2GM4 A;  2JWT A;  1GXQ A;  1JGS A;  1D5V A;  1VND A;  2AQE A;  4XR6 A;  3OS1 A;  2KMU A;  1IUF A;  3H3Z A;  4B3X A;  2G9W A;  4PK4 A;  3SFI A;  4RAZ A;  4S0H B;  2KQR A;  2XAS A;  2HOE A;  2GXA A;  1AOY A;  2VQL A;  1HQC A;  2F4O B;  2XF5 A;  1PP8 F;  4J00 A;  4AM3 A;  5F0F A;  4M71 A;  1YW9 A;  5IP7 J;  2XRL A;  4X6A J;  2XKP A;  5GAH J;  2O6G E;  3E6D A;  3BJ6 A;  4KNY A;  1PYV A;  3I59 B;  3KEQ A;  4L5E A;  1UEL B;  2Z3Y A;  1BI0 A;  4YIR X;  2XIG A;  1HW2 A;  2CG4 A;  1KYW A;  1AA7 A;  4XRF A;  1RKT A;  3H92 A;  3ZMV A;  4Q4Z F;  1E3O C;  2L4M A;  1GVJ A;  1QGP A;  4G7H F;  1EH8 A;  1V3F A;  2M3A A;  3I4N J;  5DD4 A;  4DW6 A;  2LKX A;  1NG7 A;  1LFP A;  4HF2 A;  3K2Z A;  2X4H A;  3HKZ N;  2NVU B;  4LIT A;  5HLG A;  1OCO H;  4WK8 F;  2HQ5 A;  5DCM B;  2NNN A;  1PUF A;  1YRN A;  2CQK A;  3OS2 A;  5IPA A;  5E79 C;  4IHV A;  2RRE A;  3LA2 A;  3PIP F;  1TWA J;  2L54 A;  5FKL A;  3SDB A;  4BBS J;  5D4R A;  2COB A;  1L0O C;  4M6X A;  5CKT A;  2O8X A;  3L1P A;  1XSD A;  1IN7 A;  3P9I A;  2IA2 A;  2AO9 A;  1VQM I;  5GAD J;  3MAJ A;  4Q47 A;  1S72 I;  2DMQ A;  2QKL B;  2L2O A;  4AYB A;  2BYV E;  1FBU A;  2DPD A;  3PQJ A;  2QBY B;  4N4N B;  3HB9 A;  1BN5 A;  1ETK A;  1Z21 A;  3ZR8 X;  4BE2 A;  3TGN A;  1YE9 A;  3QP6 A;  5K1Y A;  2VB6 A;  3V7S A;  4R8H A;  1T98 A;  1Z67 A;  4L9T A;  1HLV A;  1SFX A;  3WGI A;  4QTR A;  4UUV A;  4CDG A;  2RAE A;  2I5U A;  1NH3 A;  3R60 A;  1SVL A;  3CJR B;  3G1M A;  3G2B A;  1KU7 A;  2WTE A;  2A69 F;  3S3O A;  2M2E A;  3GUD A;  2K9N A;  2MLK A;  2Z9O A;  2KRC A;  2FBK A;  3K4N A;  1W7P A;  3SXY A;  2R7Z J;  3RSN A;  3H1C A;  1U3E M;  2OQG A;  2IGO A;  3S93 A;  3F8C A;  5GAG J;  1RI7 A;  2CWE A;  2VC0 A;  3CC7 I;  2LY9 A;  3BTI A;  1Z7U A;  4HQM A;  3MFK A;  3EYY A;  1A5J A;  5FFX A;  4YIF A;  1XPX A;  1S8N A;  3PM1 A;  2R7Q A;  3DLL F;  3FXL A;  1I27 A;  3ZP5 A;  3CMM A;  2QF7 A;  3WHB A;  3HUG B;  1MBK A;  2TCT A;  2A61 A;  1XGM A;  1A6Q A;  1XMK A;  2CW0 F;  4Y3O A;  4IRG A;  4BQO A;  1FX7 A;  5EF6 A;  4M3B A;  2MH9 A;  5JR3 A;  2KIS A;  2DK8 A;  2QQA A;  2E36 A;  4DYR A;  3LSP A;  4N9I A;  4YRV A;  1TWF J;  4II2 A;  5JVG F;  1XSV A;  4RAY A;  3BOQ A;  2R93 J;  4RB1 A;  1YX5 A;  1N25 A;  3WG9 A;  1ZLK A;  1SVM A;  2FNP A;  3DPU A;  5HOD A;  1D0Y A;  1YX3 A;  4OU0 A;  1RIO H;  1ENH A;  1JT6 A;  1NTC A;  2FOK A;  4KIB A;  3PUF A;  4LOC A;  4EJV A;  1IRF A;  1TZL A;  5HS7 A;  2KKO A;  2OTJ I;  5LGN A;  1MJ9 A;  3KET A;  1TTY A;  3S15 J;  2OCC H;  2X1E A;  4KN7 X;  5H2F C;  2RNG A;  1JKQ C;  1I3A A;  4M72 A;  1FBS A;  2FU4 A;  3A02 A;  4HST A;  3UNG C;  4BYY A;  5LEJ A;  2A6E F;  4KT6 A;  3MZY A;  4D0P A;  4NQW A;  5J6X A;  4XK4 A;  3DEW A;  3JW4 A;  3PSF A;  1APL C;  5B1B H;  2VPR A;  1TNS A;  4Z2Y A;  4HDU A;  2H8R A;  4LGW A;  1E3P A;  4PGG A;  3SZG A;  2VBZ A;  1V5G A;  1FPQ A;  1OCZ H;  1IRZ A;  1DGW Y;  3HRM A;  3KYD B;  3MVP A;  4O5V A;  3IRR A;  5FKK A;  2W00 A;  3IWZ A;  2FD5 A;  2V1X A;  1BM9 A;  2B9S A;  4HX8 A;  4L9N A;  3FHN A;  4RM2 A;  1SMT A;  5EG0 B;  1W5S A;  3OOU A;  2JUG A;  2L7M P;  1TWC J;  4UB6 C;  1U5T A;  2JMW A;  2EA4 A;  4HA8 A;  1XCV A;  4I01 A;  5E1W A;  2VL8 A;  3RJP A;  2E34 A;  5B66 C;  1JHF A;  2NOJ B;  3WGG A;  4KIG A;  3U9G A;  3LSI A;  1TQI A;  4L0Z B;  1FYM A;  4BGD A;  3EUH C;  1U9O A;  2O03 A;  3BPV A;  1P4A A;  4NQW B;  2KJB A;  3CCQ I;  2MFZ A;  3IWF A;  1UHS A;  2L7Z A;  2IAI A;  2BVL A;  3NAU A;  3ABM H;  2ELH A;  2LTP A;  1G8X A;  4NC6 A;  1A6I A;  4R79 A;  4PFP A;  1T33 A;  3P5J A;  4N4O B;  2WA0 A;  3DFG A;  3TW7 A;  1ERD A;  4LG0 A;  2GIZ A;  1ETQ A;  3IUO A;  3L09 A;  3NAR A;  4HLY A;  2XF6 A;  1TLH B;  1YJ9 I;  2WY8 Q;  4DYC A;  4JOM A;  5F1R A;  1B59 A;  1R58 A;  1I5Z A;  4PUS A;  2ZO4 A;  3UR3 C;  2FJ1 A;  4A3D J;  1MZB A;  2O7O A;  2ADU A;  2GA2 A;  5LGU A;  3Q9S A;  4LIV A;  1M1E B;  1RUO A;  2HKX A;  4MNU A;  4W97 A;  4BBR J;  3CCE I;  2IS1 A;  1MMA A;  2R3S A;  2XAU A;  3KCC A;  4DGW B;  1LFU P;  2DCE A;  5EZG A;  2XAJ A;  3F0C A;  1QO0 D;  5FLM J;  4BNC A;  2KFD A;  4NHJ A;  4CGZ A;  1C0W A;  3A1Y A;  2DA2 A;  2XGC A;  4E7L A;  3P9K A;  2H09 A;  4UNO A;  5F0C A;  3FXO A;  4BEH B;  3BJO A;  5EJC A;  4G6T B;  4E7H A;  5CVI A;  3GTQ J;  4HRI A;  2B7E A;  3S2W A;  1AWC A;  2LY1 A;  4G9Y A;  2M45 A;  3G4S I;  3HHG A;  1RNL A;  2DK5 A;  4IEJ A;  1J59 A;  2EZI A;  1HKT A;  2GOX B;  1R4N B;  4JX5 A;  1KGS A;  3FXK A;  4ENK A;  3KIO A;  1ACI A;  1VQL I;  1UMQ A;  1VQP I;  3BZK A;  2JN6 A;  3DPL C;  2Y0S A;  4HV6 A;  2O5R A;  2QM3 A;  2X85 A;  3FXR A;  2Z1D A;  1D3Y A;  4I6Z A;  2EWN A;  2R7T A;  1IGN A;  3HPG A;  2P81 A;  3WTZ A;  4CZC A;  1JI8 A;  1GV5 A;  2XVC A;  3WE3 A;  3RZO J;  2R5Y A;  4XLE A;  2L7K A;  1ZRD A;  1ON1 A;  3C2H A;  5E3L A;  3HC7 A;  2XPW A;  1B4A A;  5GP9 A;  4ZDL A;  3EYI A;  3ULQ B;  4I0B A;  1WJB A;  3PNV A;  1Y0U A;  4XON A;  1QPI A;  2CV0 A;  3A4C A;  1G4D A;  4AU7 A;  3E5Q A;  5E3N A;  1JGG A;  3EUK L;  1REP C;  1ORK A;  4Y15 A;  1W7P D;  3WTT C;  4K2E A;  3EPZ A;  3K6G A;  4ENJ A;  1LE8 B;  3ABL H;  3E6M A;  2ZJR F;  2VQH A;  1ZN2 A;  1IAW A;  1ZRC A;  2E7W A;  2M0M A;  2ZC2 A;  2W57 A;  4DYQ A;  1I50 J;  2BY2 A;  3QWL A;  3QQA A;  4A3L J;  2FSW A;  5FKO A;  2DDB A;  4YEJ A;  3D1N I;  1LJ9 A;  4EM1 A;  4IHS A;  4NNJ A;  3Q3S A;  3LSH A;  4PGH A;  2VT3 A;  4ZH4 F;  3BTJ A;  3F8B A;  3GFI A;  3PSI A;  1DPR A;  4PJM A;  1VFC A;  5C44 J;  1YS7 A;  1SAN A;  1WVR A;  2EFO A;  4PCQ A;  1LDJ A;  1T95 A;  3CDI A;  3K7A J;  1K79 A;  4A3B J;  2FML A;  3E6B A;  1ZQ3 P;  1PJR A;  1SVO A;  5DCF A;  1D8K A;  1I6X A;  4LIU A;  4WWC A;  2B0L A;  2K9M A;  4CH7 A;  1WJC A;  3MD2 A;  3RPQ A;  3RPU A;  5DM6 F;  4RGS A;  4J01 A;  2J5O A;  2O8K A;  2VE8 A;  2HYG D;  2OV7 A;  4P9U A;  3I54 A;  5F64 A;  4G6D A;  4NUB A;  2HTS A;  2VT2 A;  1YW8 A;  1IN6 A;  2JZY A;  3HKZ A;  3SHF A;  1BI3 A;  1ZG1 A;  5L3D A;  2DOE A;  4Q5S F;  2ELK A;  2F48 A;  5KK1 A;  1ODD A;  4C2T A;  2HFH A;  3HOZ J;  2J5P A;  1MSF C;  5CYV A;  1IO2 A;  2LRE A;  3DF8 A;  2IBD A;  2RNJ A;  2DTZ A;  4U88 A;  4FE4 A;  2VN2 A;  4UXN A;  2XUB A;  4DNC A;  2HYF A;  2X9D A;  4M9S A;  1ZR4 A;  1OCP A;  2ZJP F;  3CO6 C;  5D5X B;  2PMZ A;  2VKH A;  2VLA A;  1OYI A;  5LHG A;  2ISZ A;  4HBL A;  4R1H A;  1W4M A;  3VYU B;  4HV5 A;  4DBQ A;  3U21 A;  1BJZ A;  2Q1Z B;  3DTI A;  3HRT A;  2OCE A;  4XM3 A;  2NYX A;  2W84 A;  4I02 A;  1BIA A;  2OZU A;  2W24 A;  2IRF G;  4HF0 A;  2JT1 A;  2EFQ A;  4G94 A;  3HTU A;  3RKX A;  3ZMS A;  3AAF A;  4A2U A;  2DTR A;  3BG7 A;  4A5N A;  2A05 A;  2W85 A;  2XHK A;  4BDY A;  4IQJ A;  2CRG A;  1TT0 A;  4P55 A;  5AIP A;  4FCY A;  3GLX A;  2EV6 A;  2IGM A;  3LA3 A;  2RQP A;  1BR2 A;  3OOP A;  1MND A;  2XPV A;  1UHW A;  3DQV C;  4D7N A;  4ZYG A;  2R5Z A;  3FXU A;  5J4V A;  3J80 K;  3K1M A;  1SEU A;  1CF7 B;  3K4M A;  4O6J A;  3O8H A;  2DA1 A;  5CVV A;  2R5Z B;  1K78 A;  1FZP B;  1GVD A;  1BL0 A;  2X48 A;  2IA0 A;  4I2O A;  2HVS A;  4GXO A;  3PL8 A;  3W3C A;  3K4C A;  4IRH A;  2XC7 A;  2FE3 A;  3GEZ A;  2E7X A;  1FY7 A;  2V9P A;  3GBG A;  3IKV A;  3OIP A;  3OYE A;  2E35 A;  2QSH X;  3GTJ J;  2MC4 A;  3H3V K;  3QYE A;  1QU3 A;  3LFU A;  2V1D A;  4KN4 X;  5GTI C;  1YTY A;  1VF9 A;  2X1D A;  2VJ4 A;  1W0T A;  1EJ9 A;  4A93 J;  2OJE D;  1G3T A;  3GFJ A;  4I7H A;  3ONQ A;  4ZYD A;  4LJZ F;  2A68 F;  4I99 C;  1X1C A;  2HI3 A;  5IP9 J;  2X6X A;  4IHX A;  1ETW A;  2E60 A;  2ECB A;  2HDW A;  3K4K A;  3G3Z A;  4FHT A;  2M4G A;  3K4J A;  2ZKZ A;  3DKW A;  4L18 B;  2IS6 A;  5C3E J;  4YEL A;  3NQO A;  2P6T A;  2ETH A;  1TBX A;  5HOO A;  1VQ6 I;  2C6Y A;  2EFP A;  5E1Z B;  1PUE E;  2MA3 A;  4YFX F;  4ASN A;  4P9F A;  2DFE A;  5DM7 F;  3FMR A;  1A35 A;  2GZW A;  4XLP F;  5ICG A;  2R7S A;  3Q5F A;  3PUB A;  3T0Y A;  3ZRG A;  2GWR A;  1Z3X A;  1OQY A;  1P7I A;  4L0Y B;  2EIJ H;  3M4O J;  3L2C A;  4AIK A;  3R6S A;  3JSP A;  4H4K C;  2CQQ A;  2XPU A;  2EJR A;  4FX0 A;  5IT9 K;  2L01 A;  3SDG A;  3OS0 A;  5E8G A;  1EA3 A;  4C2M J;  3DPT A;  4CCM A;  3BTL A;  4XNF A;  2NNY A;  3CJT B;  3KX2 A;  1TQP A;  2W48 A;  3TMO A;  4AVZ A;  2H8W A;  4XOP A;  3CD6 I;  3K0L A;  2FMY A;  2Y0M A;  2QQB A;  2DT7 B;  1X2M A;  2DU9 A;  1K61 A;  1RR8 C;  2V6E A;  1WJE A;  3HRS A;  2MSY A;  3PNT A;  3I4P A;  3CP2 A;  3KP7 A;  3F8N A;  3I9V 2;  3LSK A;  2UWM A;  4A3K J;  3S2H J;  4A6D A;  1SC7 A;  3GVA A;  3CC4 I;  1O3Q A;  3OYC A;  1QVU A;  3I3L A;  3JRD A;  4UUS A;  5FJ8 J;  1Z9C A;  4MIM A;  5FRO A;  1JKP C;  1UAA A;  3JRG A;  3HRU A;  1TWG J;  2QSF X;  1YJW I;  2M8G X;  3JRI A;  2LVS A;  5EG0 A;  1EH6 A;  1UB9 A;  2DYR H;  3F8F A;  2JRM A;  3F23 A;  5GTH C;  4H0E A;  2VOP A;  4A3G J;  2I10 A;  1JUM A;  4RGR A;  3FKJ A;  2X1C A;  3BR1 A;  3WU2 C;  3HIF A;  3IH3 A;  1WGX A;  3K2A A;  3L2V A;  4ANJ A;  1QZZ A;  4V2G A;  3KP2 A;  1HA8 A;  3RPU D;  2DXI A;  4B8X A;  1JE8 A;  3ISP A;  4FIS A;  5FLX Z;  1GXP A;  3GFM A;  4Y17 A;  3GTO J;  2MH2 A;  1WQ2 A;  2LLK A;  3QOD A;  3U2R A;  2VOD A;  1IV6 A;  3F21 A;  2OAZ A;  4ON0 A;  1Z6R A;  4HX4 A;  3FZV A;  2XV4 S;  5FGM A;  3PIO F;  3I71 A;  2XB0 X;  3MN2 A;  4BE1 A;  2M8E A;  2EIM H;  4CSW A;  2HVR A;  1NG6 A;  1R36 A;  1U78 A;  5FD5 A;  2M1B A;  4EJU A;  2IA1 A;  1IW7 F;  2ZME C;  4D9J A;  1MGT A;  2LOO A;  3S3M A;  3QYF A;  2IVM A;  2DFH A;  4EQQ A;  1LNW A;  1SFE A;  1WI3 A;  2CMP A;  4JP0 A;  4NB5 A;  3K4L A;  4ZDP A;  1E2X A;  2PX9 A;  4IXA A;  1QQI A;  3BG6 A;  4EAT A;  3HOU J;  1MBG A;  2GIV A;  3H0G J;  1VZ0 A;  2NS8 A;  1T0F C;  3QYB A;  3VB2 A;  4BQA A;  4NC8 A;  3ZPL A;  1N75 A;  3CF2 A;  3TP3 A;  1N77 A;  1XSX A;  5FFZ A;  4YFK F;  1R9T J;  3HPH A;  2FQ3 A;  4HQE A;  1K4S A;  2K3P A;  3RCO A;  5CQE A;  4U7B A;  2DMN A;  3E7L A;  2FBH A;  1A31 A;  3S16 J;  1B6A A;  2V6C A;  1JHH A;  2HVQ A;  2EV5 A;  3EQL F;  2AQF A;  2QLZ A;  2EFN A;  2YUS A;  1XGN A;  3HUG A;  1QPM A;  4HLX A;  2RKH A;  1QBJ A;  3GFL A;  4OAZ A;  1R4M B;  3O6B B;  2DW4 A;  3GTL J;  3WGH A;  2EA2 A;  3HOX J;  2YX7 A;  1JKR C;  2W82 A;  3BLY A;  3GW2 A;  3M1C A;  1T6S A;  2CV2 A;  4DZJ A;  2IS2 A;  1FP2 A;  1MJB A;  2EB7 A;  5CVJ A;  5LGT A;  2H27 A;  4A3F J;  3KLN A;  1JTY A;  4MEY F;  3GCM A;  3ZMZ A;  1FTT A;  2AXT C;  3RIR A;  3LAP A;  3DKY A;  4B4C A;  3FK7 A;  2Y69 H;  4M9Z A;  2CUZ A;  3HGG A;  3OIQ A;  2V9V A;  1D1C A;  1X3Z B;  4MLO A;  4ZDO A;  5IP6 A;  3PO3 J;  4OWR B;  4IQ4 A;  1OMI A;  1O7L A;  2L9S A;  2Y75 A;  2D5V A;  1X1B A;  3QU3 A;  1I1G A;  2CYY A;  2RQQ A;  3BG5 A;  2W1O A;  4E4H A;  1FLI A;  2FBI A;  5M5Y J;  2TDX A;  4ZTJ A;  4E7I A;  4C9Y A;  3GXO A;  2AXL A;  1IXS B;  2HZD A;  1JJ6 C;  2LF8 A;  3OY9 A;  1BOA A;  1S7A A;  2ZBK A;  4AC0 A;  2BV6 A;  5CLS A;  2HQA A;  1ZGJ A;  5TGT A;  3NWT A;  2ZXJ A;  2ZFU A;  1LPQ A;  1RPW A;  2JTV A;  1FIP A;  3I58 A;  1OCR H;  4U0W A;  4IHT A;  3ZMD A;  1WZ2 A;  1X1P A;  4AIH A;  4JX6 A;  5DDG A;  1XTA A;  2P6S A;  3GTP J;  3EUA A;  4S05 A;  1LDK B;  5J8F A;  3S1N J;  2XAQ A;  4EV0 A;  2QEN A;  3EUH A;  4RDU A;  4KIC A;  1O4X A;  2STW A;  2LBF B;  1QZY A;  5DCM A;  1BI1 A;  3BQZ A;  1BW5 A;  3M9A A;  3D5S C;  3SEZ A;  1ZG5 A;  2E5N A;  1DP3 A;  3TO7 A;  5M3M J;  3T1B A;  1XGO A;  2E1N A;  1W36 C;  1VI0 A;  5E1X A;  2QEX I;  1BR4 A;  4EGY A;  2H6C A;  1Z77 A;  2OTL I;  2FXA A;  4LMY A;  3FX3 A;  3HXL A;  2LNB A;  3IH4 A;  5FKM A;  2Y0S N;  1WHU A;  3J81 Z;  1HST A;  1UJ8 A;  3S1Q J;  1STZ A;  3DTK A;  1RKW A;  1ETO A;  4JQF A;  4F93 B;  1LKX A;  4CYC A;  4J19 A;  3BDD A;  3HEF A;  5D4S A;  2PFB A;  1P4W A;  2XRN A;  5HVQ C;  2VON A;  3JRE A;  3LWF A;  2R7F A;  1UG2 A;  5CJ9 A;  3TQN A;  3BRO A;  1O3R A;  4HW0 A;  5FB2 A;  2PI0 A;  3OR1 C;  3DWL E;  1I39 A;  2HXO A;  2L3D A;  3WTX C;  2F5D A;  4QLC U;  5D6E A;  1IXC A;  3IC7 A;  2BVM A;  1OYY A;  3CJN A;  4EMS A;  2ZFW A;  1R49 A;  3LSM A;  3CCS I;  3CME I;  4MFD A;  1XGS A;  3L00 A;  1IN5 A;  4M3G A;  5D5W B;  2YR2 A;  2CW8 A;  4HDV A;  2M0C A;  4BU2 A;  2VJ5 A;  2KPM A;  2WAQ A;  1X4O A;  1GT0 C;  2DA3 A;  3AKZ A;  3RKQ A;  2JVG A;  2ZNZ A;  4XMY A;  2X0L A;  1SFK A;  2MG4 A;  4XLN F;  2ZSI B;  4WXD A;  4ABZ A;  2R7R A;  3H5R A;  3S1M J;  2KIU A;  1JKO C;  1BW6 A;  1DDN A;  4BXX J;  4U87 A;  4KFC A;  1D5Y A;  2MD0 A;  3KP5 A;  1MJA A;  2LH9 A;  1LVK A;  3AG4 H;  2HDD A;  4QIW N;  4G12 A;  3KZI C;  5LD2 C;  2AS5 F;  2ZME A;  1B8I B;  2DA4 A;  3FBN B;  1KQ0 A;  4AVP A;  4RGU A;  3QRF F;  3TED A;  2HYJ A;  2QYO A;  4XL9 A;  5IT3 A;  2TRT A;  2RGV A;  3FXJ A;  5IYC J;  1MBE A;  1O3S A;  2QA4 I;  2EH3 A;  1YW7 A;  4BS9 A;  5K5Q A;  5LFA A;  4G7O F;  2Y31 A;  3R0J A;  2VKV A;  1YO5 C;  2IW5 A;  4RLQ A;  1F43 A;  1FNN A;  1AKH A;  4EM2 A;  2R7O A;  4BQQ A;  1IDY A;  5DV5 A;  3HJE A;  3SJM A;  1X19 A;  3ZXS A;  3HHH A;  2DO7 A;  5LHI A;  1CQT A;  2E1M B;  5L3B A;  4LG3 A;  1POG A;  4KJZ A;  1XS9 A;  3ESW B;  2JSC A;  2IJL A;  2ZJQ F;  4GGG A;  3K9T A;  2VQG A;  3ERE D;  4A0X A;  3KZZ A;  5LLQ A;  2XAF A;  4HX7 A;  3HOT A;  2N8G A;  2F4I A;  1Z0X A;  4EJO A;  5BPD A;  5HDK A;  1VQ7 I;  1HDD C;  1LVA A;  4A3J J;  4P5O A;  2LKP A;  3KLO A;  4OOI A;  5FRN A;  4BJT A;  4E7K A;  2F5C A;  2F2E A;  4Y4R A;  4BQN A;  3TW6 A;  2DDA A;  1B72 A;  1IXR C;  3OYL A;  4A6E A;  2Y9Z A;  3HYI A;  2V1U A;  2MBF A;  3ROU A;  1WWX A;  2KRH A;  2M7B A;  3ELK A;  2STT A;  4BJ6 C;  3BR5 A;  1J09 A;  3ZQH A;  5LRS A;  3B6A A;  2Y2Z A;  4YII A;  4CCL A;  4F91 B;  4IZZ A;  3E5X A;  1XC5 A;  2R4G A;  4XRS G;  3ZQG A;  4F3Q A;  4KIT B;  5IY5 H;  2MD5 A;  2MLG A;  4BL0 B;  1MSE C;  2B63 J;  3DEU A;  4M74 A;  2HWV A;  2M7A A;  1TT5 B;  4OMZ A;  2FQ4 A;  2I8D A;  3E97 A;  2K9S A;  2DQL A;  1VQK I;  1ZGW A;  3V8L A;  1PP7 U;  3OV8 A;  3WTW C;  2HS5 A;  1T0F A;  2UUZ A;  3M1E A;  3VYT B;  1E17 A;  2IT0 A;  2ID3 A;  3SZP A;  2NVY J;  1FOK A;  1E3H A;  1USS A;  1T39 A;  2BE5 F;  5BMZ A;  1S9H A;  3TDU C;  2AHQ A;  2DQR A;  3S2D J;  3GWZ A;  4XLC A;  4GFB A;  1FT9 A;  2GLO A;  5CPR B;  4LB5 A;  4F7Z A;  3Q0V A;  5J47 A;  1WPK A;  5HLH A;  1ZEL A;  4U7D A;  2YX4 A;  4X1E A;  1H8A C;  3W2A A;  3TDZ C;  5J1Y A;  3FBI B;  2E1O A;  1WH5 A;  2BY1 A;  1Y56 A;  1NK3 P;  2XGD A;  3MZ8 A;  3M8J A;  3LSG A;  2EQR A;  1FYL A;  5D5V B;  3G1L A;  1W36 D;  1XDS A;  2QUF A;  3OL4 A;  3T8R A;  2K40 A;  3KEO A;  2NXN B;  4LB6 B;  3CUQ A;  1J5Y A;  5E18 F;  3QU6 A;  4CA0 A;  4XN3 A;  1OCC H;  2DA6 A;  3TO6 A;  4Q48 A;  3CMY A;  3M8F A;  4D5C A;  4PZJ A;  3ERM A;  4F92 B;  1RUN A;  1SAX A;  4L5J A;  2CQ7 A;  2KIM A;  1JT0 A;  2WAE A;  1X2N A;  2HZT A;  5A2Q K;  1F1Z A;  4CYD A;  2ISY A;  4HPQ A;  1FIA A;  3IHU A;  3VOD A;  3JTH A;  3O3K A;  3I53 A;  3H9G A;  1U5T B;  1SD5 A;  2Q2E B;  2ICW G;  2PEX A;  1BOB A;  5HLI A;  4ZYE A;  4XOR A;  2MC3 A;  2NAZ A;  2VPL A;  1MBJ A;  4RA2 A;  1CGP A;  3LST A;  3DU6 A;  3D0S A;  2GBY A;  1WH7 A;  3J7Y J;  1F4K A;  3D5R C;  1WJD A;  2BW3 A;  2CUE A;  2VJJ A;  4UB8 C;  1OPC A;  2YU9 J;  3W6K B;  1E0E A;  3ZQC A;  4C3H J;  2WAD A;  1OR7 C;  1W0U A;  3ZCO A;  2RV8 A;  4B3A A;  2FUG 2;  4KYW A;  1X4P A;  3AG1 H;  1GDT A;  3H5N A;  4LLN A;  1G6N A;  1XD7 A;  4GRI A;  2HNH A;  4XLH A;  1OKR A;  4LD5 A;  2W25 A;  4KIF A;  3CCL I;  2L7F P;  3CCV I;  2OQR A;  2WC2 A;  4C3I J;  2DOD A;  4BH9 A;  3V8K A;  5EYR A;  2LF7 A;  1FWZ A;  4CZZ A;  2O9L A;  2XRO A;  3OYJ A;  3IAS 2;  3A01 B;  3R4K A;  1F9N A;  4MTD A;  5E17 F;  3GME A;  2EZL A;  2JJ7 A;  4PJL A;  3I64 A;  1PVE A;  2VBY A;  1H88 C;  1IJW C;  5ERI A;  3U1K A;  3CDL A;  3OYH A;  4KT5 C;  3COA C;  5D8K B;  1VTN C;  3RQ4 A;  1R23 A;  1I6H J;  1OFC X;  1IZ1 A;  3BZ6 A;  4XIC A;  3GTK J;  2L02 A;  3T5X A;  3M07 A;  3O8G A;  4EEF G;  5GAE J;  2IPQ X;  2KZV A;  4XQF A;  4C2U A;  3Q9V A;  2JRT A;  4E7S A;  1BIB A;  1X1D A;  3FXM A;  2XKO A;  4NC7 A;  3OSF A;  1Y1W J;  3D5L A;  3BR6 A;  2W4S A;  4WXH A;  5K5O A;  5GPA A;  2HQR A;  4Z6Y A;  4RGX A;  2VBW A;  3L2R A;  4IL6 C;  1Q1H A;  3V42 A;  2CSO A;  3W6J B;  1XB4 A;  4B09 A;  3CCJ I;  4MQV A;  3IKT A;  2KIQ A;  1T08 B;  4A0Y A;  1W5T A;  3QOE A;  4FTH A;  1D8J A;  1GLN A;  4M73 A;  4G7Z F;  1MMN A;  4GYG A;  4BJ5 C;  4M3F A;  4A3C J;  3H3U A;  4JYK A;  5EEG A;  1K6Y A;  3TL4 X;  2GQQ A;  1WJF A;  3L2W A;  3VEP A;  2MGQ A;  5TJJ A;  1ZRE A;  2FA5 A;  2E2I J;  2V7F A;  5BNG A;  1H9T A;  3MKY B;  1IUY A;  2X6W A;  4WCG A;  1SAU A;  2DMT A;  4KA4 A;  1ZG3 A;  4RS8 A;  1VQ9 I;  2UXX A;  1F5T A;  2G7U A;  3J7A Y;  2EV0 A;  1FJL A;  4M6V A;  1Z91 A;  1IV8 A;  1WRJ A;  5TRD A;  1KQ9 A;  4Y52 J;  3FK6 A;  1S3J A;  4RLF A;  3ZMU A;  2R7V A;  5DD8 A;  3VSK A;  1EH7 A;  3DV8 A;  4IRI A;  5DTD A;  2VKD A;  2XDV A;  2JQ7 A;  4P96 A;  4OIO F;  5GPC A;  2V9K A;  5L3G A;  1KU9 A;  4ZC3 A;  2E19 A;  5CVR A;  4B48 A;  5ICC A;  2LD5 A;  3CC2 I;  4DQ2 A;  1ONV A;  3DBR B;  4RAG A;  2CS3 A;  2G0E A;  2M87 A;  4M6Y A;  1RZ4 A;  5JHU A;  3K70 D;  1OCT C;  5FLX K;  1BR1 A;  2IS4 A;  5EDN A;  1YOV B;  1CF7 A;  2OA4 A;  3V8J A;  2P5V A;  4FT8 A;  4ENN A;  5J3L A;  1B72 B;  3CTA A;  2GXB A;  1XMA A;  4PJ0 C;  1GHC A;  3WTS C;  2O61 A;  5EGO B;  2Q8K A;  3C2B A;  4LLG F;  4KMF A;  4NBQ A;  2GAU A;  1DQU A;  2CU7 A;  1O3T A;  3BZC A;  3QAH A;  5IYD J;  1OLT A;  2H1K A;  1K4T A;  4XSZ F;  2M30 A;  2ME6 A;  2YS9 A;  1X3W B;  4IHY A;  3FM5 A;  2RN7 A;  4E70 A;  1ETV A;  2XSJ C;  2HU9 A;  3IH2 A;  3IP4 B;  2VJI A;  2KHM A;  2L5Q A;  4XSX F;  4M3E A;  2QGU A;  3KEY A;  3BY6 A;  3BCB A;  1O57 A;  3OR2 C;  4EGZ A;  3NEU A;  1AU7 A;  3JRH A;  3FDY A;  1YIT I;  2P0W A;  2BZT A;  3HM5 A;  3PFI A;  1MH4 A;  4MO7 A;  1DP7 P;  1R1T A;  1FSH A;  4L9V A;  1ZK8 A;  2LYC A;  3OIO A;  3LFK A;  1AHD P;  4OIP F;  2PG4 A;  1FBQ A;  3BCA A;  2E1M C;  4IVN A;  1WKM A;  3HBL A;  3CUQ C;  3NWS A;  3VPR A;  4CYC B;  2L4A A;  2A6T A;  4CIC A;  2X6Y A;  1WI9 A;  2XAG A;  4A0Z A;  1Y0N A;  2NS7 A;  4RMN A;  3A01 A;  2CQX A;  4IJA A;  3WE2 A;  3IRQ A;  4IF4 A;  2VKE A;  2Y48 A;  3C18 A;  5E20 A;  3N97 A;  3KZY A;  4WXC A;  5D8L B;  3GLL A;  4BUP A;  2BXZ A;  1TL8 A;  2HOA A;  4W1U A;  5EZH A;  3CCM I;  3H35 A;  4PJN A;  2UV1 A;  4L5I A;  1R7J A;  4LK1 F;  5JFR A;  5L3C A;  5M3F J;  1IF1 A;  3REO A;  1HOM A;  3JAM Z;  2DJN A;  2Q2E A;  3LAJ A;  1KA8 A;  1DUX C;  4V2F A;  5DS9 A;  3ASN H;  3DEE A;  3ABT A;  2DAO A;  1OJL A;  3CZ6 A;  5A2Q Z;  2F4M B;  4UVB A;  5F04 A;  1MH3 A;  2ELJ A;  1ETX A;  4CXF A;  2XGE A;  2L9N A;  5EEA A;  3OYF A;  4AD9 A;  5LBQ A;  3JAM K;  1YRN B;  2CGP A;  1S7E A;  2DT5 A;  1U0J A;  4OIN F;  2E5Z A;  5IOY A;  3K1P A;  1B9N A;  4BE0 A;  1MW7 A;  1XMX A;  2QQ9 A;  2PBI A;  1LFB A;  3J7A O;  1SD6 A;  1IRX A;  3JCU C;  2E2H J;  2ECC A;  1J9I A;  1ZKG A;  1FYK A;  2ME0 A;  3HGY A;  2FNA A;  4D5F A;  3WTY C;  2E71 A;  2LP0 A;  2PLY A;  5D6F A;  1T2K A;  1IG7 A;  2PJP A;  2YPR A;  2ZXH A;  5KAF C;  1HXD A;  5ICF A;  5EGO A;  1DU6 A;  1ZRF A;  3DP7 A;  1QA6 A;  2HXI A;  2DA5 A;  1B1B A;  3WOD F;  5DYM A;  1EV7 A;  1YG2 A;  4ZZD A;  2WWY A;  4XRS A;  5M5X J;  3ZQI A;  2M5W A;  3DBL B;  5ILU A;  3M7G A;  3AG3 H;  2LSO A;  2F5F A;  1H9G A;  3L9F A;  4E7J A;  3F3X A;  5C4J J;  3QOP A;  3RKW A;  3RYP A;  3VSL A;  4E7Z A;  1BC8 C;  1DU0 A;  2CFO A;  5K5R A;  3G1O A;  2VI6 A;  2FEZ A;  3DTE A;  3Q0U A;  1RES A;  3P7N A;  3RYR A;  1U8B A;  4HG2 A;  2O0Y A;  3TOA A;  4UHT A;  4AID A;  2V26 A;  3QP5 A;  4B43 A;  5F1J A;  3OYN A;  4Y7N J;  5K7F A;  3OWT A;  1UG0 A;  3B6C A;  5J4Y A;  1XCB A;  5J1U A;  2R0Q C;  2HOS A;  2EPF A;  4CCN A;  5CVU A;  2PMZ N;  5F27 A;  2UXN A;  4FX4 A;  1N78 A;  1P4X A;  4KMU X;  4LK0 F;  1R5I D;  2ZSH B;  3JSO A;  1MDM A;  1FC3 A;  5IT9 Z;  1U2W A;  3I55 I;  2JA2 A;  2PJR A;  2K4J A;  2QSG X;  3RKY A;  2ZXI A;  1ZYR F;  3BG9 A;  1MDM B;  2GXG A;  2PMH A;  3MKZ A;  4WF2 A;  3E6C C;  2L9V A;  3G71 I;  3TO9 A;  4A69 C;  1V5F A;  2QCO A;  4ZTF A;  1R22 A;  3HSF A;  3FIS A;  2JK3 A;  3TKY A;  5ILS A;  3EDP A;  1HF0 A;  2NVQ J;  1J75 A;  3L7W A;  2VXD A;  3CP8 A;  3FIW A;  1UFM A;  3KP3 A;  1UCR A;  5H6Q A;  3CCR I;  1FMW A;  3RI4 A;  2DT6 A;  4CCK A;  1NHA A;  5AIQ A;  4XKB A;  1B8I A;  1BA5 A;  5FKN A;  4M9X A;  1YIJ I;  2K3F A;  2P8T A;  5JVT A;  4A3E J;  1Q1V A;  3CO7 C;  1KU2 A;  1X58 A;  4UV9 A;  3CLO A;  2PMU A;  3CDH A;  3HL2 A;  4N9H A;  6PAX A;  2NVT J;  2RDP A;  3KYC B;  2HTJ A;  5D5U B;  4JX4 A;  3RDI A;  1ITY A;  3GZ6 A;  4ITV A;  2VOO A;  4IOA F;  3AL0 B;  1XG1 A;  3C1D A;  1FEX A;  2EBI A;  2RVC A;  3KE2 A;  4ETS A;  4LG0 B;  1Z05 A;  2VBX A;  1S6L A;  4CUG A;  3MMY B;  3KP6 A;  2VC1 A;  1G59 A;  1IC8 A;  2F5E A;  3OL3 A;  2R7U A;  2VXZ A;  4IX7 A;  1HDP A;  2Q0O A;  4PFO A;  1MNM C;  1P2F A;  5F08 A;  1QVT A;  3DXJ F;  4NDL A;  3ZQ7 A;  2EIN H;  5H20 A;  5K7Z A;  5KAI C;  1R5H A;  1QRY A;  3DBH B;  4PSX A;  2HPI A;  1OIS A;  1HKS A;  3PJR A;  3E1S A;  2XB5 A;  2ZB9 A;  1GV2 A;  1IN8 A;  2NS0 A;  2ZCW A;  3HTS B;  2GA1 A;  1EKE A;  4EM0 B;  1YYV A;  2VAS A;  1F36 A;  2NVX J;  3CF5 F;  3T8T A;  3S8P A;  4QWQ A;  3FXQ A;  1ETY A;  2W7N A;  1HSJ A;  3FWE A;  1LQ1 A;  1U8R A;  1W7P B;  4CCJ A;  1G2H A;  1YS6 A;  2K9L A;  4RB2 C;  1YJN I;  4IPA A;  2KDZ A;  4RB0 A;  1K78 B;  1EF4 A;  1ZHF A;  1J0R A;  3PQK A;  3JRC A;  2OC6 A;  3ZN1 A;  3E0J B;  2BY3 A;  2QWW A;  2HEO A;  2X6O A;  2ZME B;  1K6O A;  1I1S A;  5K7H A;  4MFE A;  3BR3 A;  3OYM A;  3JRB A;  4FE7 A;  3ZOB A;  3OSG A;  1BI2 A;  3VWB A;  2EK5 A;  1WFX A;  2K4B A;  3F6O A;  3W2W A;  3I0T A;  3O2P E;  3WU0 A;  2XF7 A;  4QSH A;  1IN4 A;  1Z6T A;  1YQA A;  1P9Q C;  2KT0 A;  2VE9 A;  5LHH A;  4XKW A;  2K02 A;  1HKQ A;  3VYS B;  1JUP A;  2H94 A;  3FMS A;  3KYL A;  1A04 A;  3WU1 B;  3I59 A;  2GOM A;  4MEX F;  2BEO A;  4FAS D;  1BBY A;  2K5C A;  5J40 A;  2DYS H;  4BY1 J;  4ZYA A;  2ID6 A;  3CCY A;  3OYI A;  1VQ4 I;  5KNL A;  3WTU C;  4XBF A;  3OYG A;  4BEH A;  3VOE A;  3GYH X;  2E2J J;  2WV1 A;  2JPC A;  3R0A A;  1P7J A;  4DBR A;  4YG2 F;  1T56 A;  3ECO A;  3SEQ A;  4U0Y A;  3S14 J;  1LUJ B;  2D1H A;  3CUQ B;  1YLF A;  2IP2 A;  2FOW A;  5C4X J;  3U1D A;  4AWX B;  4A3I J;  3A0H C;  5DEQ A;  3BR0 A;  5TIS C;  2K9Q A;  3FMQ A;  4A12 A;  1UST A;  5L3F A;  2DFI A;  3Q0W A;  3MCZ A;  3WHC A;  4F52 A;  4XN0 A; 
#chains in the Genus database with same CATH homology
 1X3U A;  2R7D A;  2A6H F;  4G8X A;  3C3W A;  3NRV A;  3QPH A;  3RTR A;  4Y13 A;  3R61 A;  1LDD A;  3P9C A;  3F22 A;  2D45 A;  5ILV A;  4N0B A;  1OR7 A;  4EJT A;  1OYW A;  2XAH A;  4ESF A;  4ESJ A;  4A5M A;  1T38 A;  2YU3 A;  2PN6 A;  2CO5 A;  2HKO A;  3SFZ A;  2HGC A;  3LA7 A;  1JXS A;  5JI6 A;  1LEA A;  2BGC A;  3FHZ A;  3K69 A;  4CHU A;  1J7K A;  4EVI A;  5HS8 A;  1MD0 A;  4HAM A;  4LFU A;  2YSR A;  2A07 F;  1WSU A;  3ECH A;  3GO5 A;  3F72 A;  4MTE A;  4AIJ A;  4BXU A;  2G7H A;  3TOB A;  2DBB A;  2P5K A;  1XN7 A;  4TV7 A;  2NRA C;  4GCV A;  3V4G A;  5LRR A;  2ZNY A;  1BJA A;  4HYE A;  4ZZL A;  2PQ8 A;  3F6V A;  2LDU A;  4RB3 C;  2K7L A;  1G3W A;  3KP4 A;  4G6Q A;  2P7V B;  2HDC A;  3I5U A;  3IL2 A;  3MQ0 A;  4HOB A;  2ESH A;  5LEK A;  1YIO A;  4MGR A;  1P92 A;  1R5G A;  3ZN0 A;  4OIQ F;  4UV8 A;  5HDN A;  1SD4 A;  4OIR F;  5BOX A;  4BAY A;  2QBY A;  2KJC A;  4U0V A;  3V7R A;  3VFZ A;  2ACJ A;  4EJW A;  5J8C A;  4LLL A;  2HQN A;  2KRF A;  3GF2 A;  3JTG A;  5E8I A;  2Z99 A;  1QNT A;  5ICE A;  1Z1D A;  2OU2 A;  3CUO A;  4KDP A;  4MHG A;  1SMY F;  5EEH A;  1KYZ A;  3FM3 A;  2XGX A;  3G73 A;  4UVC A;  1V4R A;  1IRG A;  2HR3 A;  2EFW A;  3HSE A;  2D2W A;  1YFH A;  3BP8 A;  4UVA A;  3F8M A;  5KVR A;  3MZH A;  1U5T C;  2P7C B;  5HDG A;  1TW2 A;  4YFN F;  2WV0 A;  2FF4 A;  3WTV C;  3B73 A;  5H6R A;  1J2X A;  3GX4 X;  1TNT A;  5FD6 A;  2JPB A;  1DPU A;  3ML6 A;  1O7F A;  2ESN A;  4JBA A;  1ZH5 A;  1SD7 A;  1PDN C;  4I0A A;  1TQM A;  5BPI A;  1UHM A;  3ZMT A;  4BHP A;  1U6G A;  4PDK A;  1TW3 A;  3B02 A;  1FP1 D;  4ZYH A;  5BQT A;  1HW5 A;  2QZ8 A;  3C7J A;  1XDU A;  3LQR A;  4OMY A;  3EET A;  1B9M A;  1LB2 A;  1R00 A;  3LQQ A;  1G3Y A;  2H6B A;  5ED4 A;  1KU3 A;  1R1V A;  2UZK A;  1ON2 A;  2FRH A;  1MKM A;  5FO5 A;  4GO1 A;  3N4M A;  4JK1 X;  2K27 A;  2E1C A;  2Z5U A;  3HSR A;  1FSE A;  3E3V A;  3FF5 A;  4GYI A;  1SFU A;  2DPU A;  3E5U A;  2OD5 A;  3KFW X;  2DLL A;  1G3S A;  3MWM A;  2OZ6 A;  1LEB A;  2D1V A;  5AON A;  3SQN A;  4HF1 A;  4BHC A;  4I09 A;  4L9J A;  1HBX G;  1ZGA A;  2V79 A;  2K86 A;  1ZAO A;  2P5L C;  3M8E A;  3MEX A;  1ZLJ A;  2P4W A;  2ZJ2 A;  1H0M A;  3BPX A;  3GZ5 A;  3K1N A;  4HZF A;  3QPT A;  4ENM A;  3HOS A;  4S04 A;  1ZAR A;  4MQ9 F;  1KQ8 A;  3BWG A;  2A3S A;  1ULY A;  3ABU A;  4CO8 A;  2QVO A;  5DUK A;  2Z33 A;  2OBP A;  4BHB A;  4ESB A;  4KUM A;  2DI3 A;  2CFX A;  2KIF A;  1P6R A;  1BC7 C;  3J81 K;  4I98 B;  2COM A;  1S7O A;  5L3E A;  2RC4 A;  1HW1 A;  5F6F A;  2A5Y B;  2O3F A;  5DUI A;  2BBY A;  3V7C A;  1K7A A;  1L3L A;  4O3M A;  5BS6 A;  1R1U A;  3BJA A;  5HS9 A;  1S29 A;  3SZT A;  3J80 Z;  4WX9 A;  1GXQ A;  1JGS A;  1D5V A;  3H3Z A;  2G9W A;  4RAZ A;  2XAS A;  2HOE A;  1AOY A;  1HQC A;  1PP8 F;  4M71 A;  1YW9 A;  2XKP A;  2O6G E;  3E6D A;  3BJ6 A;  4KNY A;  3I59 B;  3KEQ A;  2Z3Y A;  1BI0 A;  2XIG A;  1HW2 A;  2CG4 A;  1KYW A;  4XRF A;  3H92 A;  3ZMV A;  4Q4Z F;  2L4M A;  1GVJ A;  1QGP A;  4G7H F;  1EH8 A;  1V3F A;  5DD4 A;  4HF2 A;  3K2Z A;  2X4H A;  5HLG A;  4WK8 F;  5DCM B;  2NNN A;  2CQK A;  3LA2 A;  2L54 A;  5D4R A;  1L0O C;  4M6X A;  2O8X A;  1XSD A;  1IN7 A;  3P9I A;  2IA2 A;  3MAJ A;  4Q47 A;  2BYV E;  1FBU A;  2DPD A;  3PQJ A;  2QBY B;  1BN5 A;  3TGN A;  3QP6 A;  5K1Y A;  3V7S A;  4R8H A;  1T98 A;  4L9T A;  1SFX A;  3WGI A;  4UUV A;  4CDG A;  3R60 A;  1KU7 A;  2WTE A;  2A69 F;  3GUD A;  2MLK A;  2Z9O A;  2FBK A;  1W7P A;  3SXY A;  1U3E M;  2OQG A;  3F8C A;  1RI7 A;  2CWE A;  2VC0 A;  1Z7U A;  4HQM A;  3MFK A;  3EYY A;  5FFX A;  4YIF A;  1S8N A;  1I27 A;  3ZP5 A;  2A61 A;  1XGM A;  1XMK A;  2CW0 F;  4IRG A;  1FX7 A;  2MH9 A;  5JR3 A;  2DK8 A;  2QQA A;  4N9I A;  1XSV A;  4RAY A;  3BOQ A;  4RB1 A;  3WG9 A;  1ZLK A;  2FNP A;  4OU0 A;  1RIO H;  2FOK A;  4KIB A;  4EJV A;  1IRF A;  5HS7 A;  2KKO A;  5LGN A;  1MJ9 A;  3KET A;  1TTY A;  4KN7 X;  4M72 A;  1FBS A;  2FU4 A;  4BYY A;  5LEJ A;  2A6E F;  3MZY A;  4D0P A;  4NQW A;  5J6X A;  3JW4 A;  1TNS A;  4Z2Y A;  4HDU A;  4LGW A;  4PGG A;  2VBZ A;  1FPQ A;  3HRM A;  4O5V A;  3IRR A;  3IWZ A;  2V1X A;  1BM9 A;  4HX8 A;  4L9N A;  1SMT A;  1W5S A;  1U5T A;  2EA4 A;  4HA8 A;  1XCV A;  4I01 A;  5E1W A;  3RJP A;  1JHF A;  3WGG A;  4KIG A;  3U9G A;  1TQI A;  4L0Z B;  1FYM A;  2O03 A;  3BPV A;  1P4A A;  2KJB A;  3IWF A;  2ELH A;  4R79 A;  3DFG A;  4LG0 A;  3L09 A;  4HLY A;  1TLH B;  5F1R A;  1B59 A;  1R58 A;  1I5Z A;  2ZO4 A;  1MZB A;  2ADU A;  2GA2 A;  5LGU A;  3Q9S A;  1RUO A;  2HKX A;  4MNU A;  2R3S A;  3KCC A;  2XAJ A;  4BNC A;  1QO0 D;  4NHJ A;  4CGZ A;  1C0W A;  3P9K A;  2H09 A;  4UNO A;  3BJO A;  5CVI A;  3S2W A;  1AWC A;  4G9Y A;  2M45 A;  1RNL A;  3HHG A;  2DK5 A;  1J59 A;  1HKT A;  4ENK A;  1KGS A;  3DPL C;  4HV6 A;  2QM3 A;  3FXR A;  1D3Y A;  2EWN A;  3WTZ A;  2XVC A;  3WE3 A;  1ZRD A;  1ON1 A;  1B4A A;  3EYI A;  3ULQ B;  4I0B A;  1Y0U A;  1G4D A;  3E5Q A;  1REP C;  4Y15 A;  1W7P D;  3WTT C;  4K2E A;  4ENJ A;  3E6M A;  1ZN2 A;  1IAW A;  1ZRC A;  2E7W A;  2W57 A;  2FSW A;  1LJ9 A;  4EM1 A;  4IHS A;  4PGH A;  2VT3 A;  4ZH4 F;  3F8B A;  3GFI A;  1DPR A;  1YS7 A;  4PCQ A;  2EFO A;  1LDJ A;  1K79 A;  2FML A;  3E6B A;  5DCF A;  1D8K A;  1I6X A;  4WWC A;  2B0L A;  3RPQ A;  3RPU A;  4RGS A;  2J5O A;  2VE8 A;  2HYG D;  4P9U A;  3I54 A;  5F64 A;  4G6D A;  2HTS A;  2VT2 A;  1YW8 A;  1IN6 A;  2JZY A;  3SHF A;  1BI3 A;  1ZG1 A;  5L3D A;  4Q5S F;  5KK1 A;  1ODD A;  2HFH A;  2J5P A;  5CYV A;  3DF8 A;  2RNJ A;  4U88 A;  2VN2 A;  4UXN A;  2XUB A;  4DNC A;  2HYF A;  4M9S A;  3CO6 C;  5D5X B;  1OYI A;  5LHG A;  2ISZ A;  4HBL A;  4R1H A;  1W4M A;  4HV5 A;  3HRT A;  2NYX A;  2W84 A;  4I02 A;  1BIA A;  2OZU A;  2W24 A;  2IRF G;  4HF0 A;  2JT1 A;  2EFQ A;  4G94 A;  3HTU A;  3RKX A;  3ZMS A;  3AAF A;  4A2U A;  2DTR A;  4A5N A;  2XHK A;  2W85 A;  4P55 A;  5AIP A;  3GLX A;  2EV6 A;  3LA3 A;  3OOP A;  2RQP A;  1UHW A;  3DQV C;  4ZYG A;  3FXU A;  3J80 K;  3K1M A;  1CF7 B;  4O6J A;  5CVV A;  1K78 A;  1FZP B;  2IA0 A;  4I2O A;  4GXO A;  4IRH A;  2FE3 A;  3GEZ A;  2E7X A;  1FY7 A;  3IKV A;  4KN4 X;  2V1D A;  1YTY A;  1G3T A;  3GFJ A;  4I7H A;  4ZYD A;  4LJZ F;  2A68 F;  3G3Z A;  4FHT A;  2ZKZ A;  4L18 B;  3DKW A;  3NQO A;  2P6T A;  2ETH A;  1TBX A;  5HOO A;  2C6Y A;  2EFP A;  1PUE E;  5E1Z B;  2MA3 A;  4YFX F;  4ASN A;  4P9F A;  3FMR A;  2GZW A;  4XLP F;  5ICG A;  3Q5F A;  3T0Y A;  2GWR A;  4L0Y B;  3L2C A;  4AIK A;  3R6S A;  3JSP A;  2EJR A;  4FX0 A;  5IT9 K;  2L01 A;  5E8G A;  3DPT A;  2NNY A;  1TQP A;  3K0L A;  2FMY A;  2Y0M A;  2QQB A;  2DU9 A;  3HRS A;  3I4P A;  3KP7 A;  3F8N A;  2UWM A;  4A6D A;  3GVA A;  1O3Q A;  1Z9C A;  3HRU A;  1EH6 A;  1UB9 A;  3F8F A;  4H0E A;  3F23 A;  2VOP A;  4RGR A;  3HIF A;  1QZZ A;  3KP2 A;  4B8X A;  1JE8 A;  3ISP A;  5FLX Z;  1GXP A;  3GFM A;  4Y17 A;  2MH2 A;  1WQ2 A;  3U2R A;  2VOD A;  3F21 A;  2OAZ A;  4ON0 A;  1Z6R A;  4HX4 A;  3FZV A;  2XV4 S;  5FGM A;  3I71 A;  2M8E A;  1R36 A;  1U78 A;  5FD5 A;  2M1B A;  4EJU A;  2IA1 A;  1IW7 F;  1MGT A;  2IVM A;  4EQQ A;  1LNW A;  1SFE A;  4NB5 A;  1E2X A;  4IXA A;  1QQI A;  2GIV A;  3VB2 A;  4BQA A;  3ZPL A;  1XSX A;  5FFZ A;  4YFK F;  4HQE A;  2FQ3 A;  4U7B A;  2FBH A;  1B6A A;  2V6C A;  1JHH A;  2EV5 A;  3EQL F;  2QLZ A;  2EFN A;  1XGN A;  3HUG A;  1QPM A;  4HLX A;  2RKH A;  1QBJ A;  3GFL A;  3O6B B;  2DW4 A;  3WGH A;  2EA2 A;  2YX7 A;  3GW2 A;  1T6S A;  1FP2 A;  1MJB A;  2EB7 A;  5CVJ A;  5LGT A;  2H27 A;  3KLN A;  4MEY F;  3ZMZ A;  3LAP A;  3RIR A;  4M9Z A;  2V9V A;  1OMI A;  1O7L A;  2Y75 A;  3QU3 A;  1I1G A;  2CYY A;  1FLI A;  2FBI A;  2TDX A;  3GXO A;  2AXL A;  1IXS B;  2LF8 A;  1BOA A;  1S7A A;  2ZBK A;  2BV6 A;  5CLS A;  1ZGJ A;  2ZXJ A;  2JTV A;  3I58 A;  4U0W A;  4IHT A;  3ZMD A;  4AIH A;  5DDG A;  2P6S A;  4S05 A;  1LDK B;  5J8F A;  2XAQ A;  4EV0 A;  2QEN A;  3EUH A;  4KIC A;  2STW A;  1QZY A;  5DCM A;  1BI1 A;  3M9A A;  1ZG5 A;  3TO7 A;  3T1B A;  1XGO A;  2E1N A;  5E1X A;  4EGY A;  2H6C A;  2FXA A;  4LMY A;  3FX3 A;  2LNB A;  3J81 Z;  1HST A;  1STZ A;  4JQF A;  3BDD A;  5D4S A;  2PFB A;  1P4W A;  2XRN A;  5HVQ C;  2VON A;  3LWF A;  3TQN A;  2R7F A;  5CJ9 A;  3BRO A;  1O3R A;  4HW0 A;  5FB2 A;  2PI0 A;  2L3D A;  3WTX C;  2F5D A;  4QLC U;  5D6E A;  1IXC A;  3IC7 A;  3CJN A;  1OYY A;  4EMS A;  2ZFW A;  1XGS A;  3L00 A;  1IN5 A;  5D5W B;  2YR2 A;  4HDV A;  2ZNZ A;  2X0L A;  4XLN F;  4WXD A;  2KIU A;  1DDN A;  4KFC A;  3KP5 A;  1MJA A;  2AS5 F;  2ZME A;  1KQ0 A;  4AVP A;  4RGU A;  3QRF F;  2QYO A;  5IT3 A;  2RGV A;  1O3S A;  1YW7 A;  5K5Q A;  4G7O F;  3R0J A;  1YO5 C;  2IW5 A;  1FNN A;  4EM2 A;  5DV5 A;  3HHH A;  2DO7 A;  5LHI A;  5L3B A;  2JSC A;  2IJL A;  4GGG A;  3K9T A;  3ERE D;  4A0X A;  3KZZ A;  5LLQ A;  2XAF A;  4HX7 A;  3HOT A;  5BPD A;  4EJO A;  5HDK A;  1LVA A;  4P5O A;  2LKP A;  3KLO A;  4OOI A;  2F5C A;  2F2E A;  1IXR C;  4A6E A;  2V1U A;  3HYI A;  2MBF A;  3ROU A;  1WWX A;  3ELK A;  2STT A;  5LRS A;  4YII A;  3E5X A;  2MD5 A;  2MLG A;  3DEU A;  4M74 A;  2HWV A;  4OMZ A;  3E97 A;  2DQL A;  1PP7 U;  3V8L A;  3OV8 A;  3WTW C;  2HS5 A;  3M1E A;  1T0F A;  1E17 A;  2IT0 A;  3SZP A;  1FOK A;  1USS A;  1T39 A;  2BE5 F;  5BMZ A;  3TDU C;  2DQR A;  3GWZ A;  1FT9 A;  4LB5 A;  4F7Z A;  5HLH A;  4U7D A;  2YX4 A;  3TDZ C;  1FYL A;  5D5V B;  1XDS A;  2QUF A;  3T8R A;  3KEO A;  4LB6 B;  3CUQ A;  1J5Y A;  5E18 F;  3QU6 A;  3TO6 A;  4Q48 A;  3M8F A;  4PZJ A;  1RUN A;  1SAX A;  4L5J A;  2KIM A;  2HZT A;  5A2Q K;  1F1Z A;  4CYD A;  2ISY A;  3IHU A;  3VOD A;  3O3K A;  3JTH A;  3I53 A;  1U5T B;  1SD5 A;  2PEX A;  5HLI A;  4ZYE A;  2MC3 A;  2NAZ A;  1CGP A;  3LST A;  3D0S A;  1F4K A;  1OPC A;  3W6K B;  2RV8 A;  4KYW A;  4LLN A;  1G6N A;  1XD7 A;  1OKR A;  4LD5 A;  2W25 A;  4KIF A;  2OQR A;  2WC2 A;  4BH9 A;  3V8K A;  2LF7 A;  1FWZ A;  4CZZ A;  2XRO A;  3R4K A;  1F9N A;  4MTD A;  5E17 F;  3I64 A;  2VBY A;  5ERI A;  4KT5 C;  3COA C;  5D8K B;  1VTN C;  1R23 A;  1IZ1 A;  3BZ6 A;  2L02 A;  3T5X A;  2IPQ X;  3Q9V A;  2JRT A;  1BIB A;  2XKO A;  3D5L A;  4WXH A;  5K5O A;  2HQR A;  4RGX A;  2VBW A;  1Q1H A;  2CSO A;  3W6J B;  1XB4 A;  4B09 A;  4MQV A;  3IKT A;  4A0Y A;  1W5T A;  1D8J A;  4M73 A;  4G7Z F;  4GYG A;  3H3U A;  5EEG A;  2GQQ A;  3VEP A;  5TJJ A;  1ZRE A;  2FA5 A;  1H9T A;  1IUY A;  4WCG A;  4KA4 A;  1ZG3 A;  4RS8 A;  2UXX A;  1F5T A;  2G7U A;  2EV0 A;  1Z91 A;  1WRJ A;  5TRD A;  1KQ9 A;  1S3J A;  3ZMU A;  5DD8 A;  1EH7 A;  3DV8 A;  4IRI A;  4P96 A;  4OIO F;  5L3G A;  1KU9 A;  5CVR A;  5ICC A;  4DQ2 A;  1ONV A;  2M87 A;  4M6Y A;  5FLX K;  1RZ4 A;  5JHU A;  1CF7 A;  2OA4 A;  3V8J A;  2P5V A;  4FT8 A;  4ENN A;  3CTA A;  2GXB A;  1XMA A;  1GHC A;  3WTS C;  2O61 A;  2Q8K A;  4LLG F;  4KMF A;  2GAU A;  1O3T A;  3QAH A;  4XSZ F;  2M30 A;  3FM5 A;  2RN7 A;  4E70 A;  4XSX F;  3BY6 A;  1O57 A;  4EGZ A;  3NEU A;  3PFI A;  1DP7 P;  1R1T A;  1FSH A;  4L9V A;  3LFK A;  4OIP F;  2PG4 A;  1FBQ A;  4IVN A;  1WKM A;  3CUQ C;  2L4A A;  4CIC A;  1WI9 A;  2XAG A;  4A0Z A;  4IJA A;  3WE2 A;  3IRQ A;  4IF4 A;  2Y48 A;  3C18 A;  5E20 A;  3N97 A;  3KZY A;  4WXC A;  5D8L B;  4L5I A;  1R7J A;  4LK1 F;  5JFR A;  5L3C A;  1IF1 A;  3REO A;  3JAM Z;  2Q2E A;  3LAJ A;  1KA8 A;  1DUX C;  3ABT A;  2DAO A;  5A2Q Z;  4UVB A;  4CXF A;  4AD9 A;  5LBQ A;  3JAM K;  2CGP A;  2DT5 A;  4OIN F;  3K1P A;  1B9N A;  2QQ9 A;  2PBI A;  3J7A O;  1SD6 A;  1J9I A;  1FYK A;  2FNA A;  3WTY C;  2PLY A;  5D6F A;  1T2K A;  2PJP A;  2YPR A;  1HXD A;  5ICF A;  1ZRF A;  3DP7 A;  1B1B A;  3WOD F;  5DYM A;  1EV7 A;  1YG2 A;  4ZZD A;  2WWY A;  2M5W A;  5ILU A;  3M7G A;  2LSO A;  2F5F A;  1H9G A;  3L9F A;  3F3X A;  3QOP A;  3RKW A;  3RYP A;  1BC8 C;  5K5R A;  2FEZ A;  3P7N A;  3RYR A;  2O0Y A;  3TOA A;  4UHT A;  3QP5 A;  1XCB A;  5CVU A;  2UXN A;  4FX4 A;  1P4X A;  4KMU X;  4LK0 F;  3JSO A;  1MDM A;  1FC3 A;  5IT9 Z;  1U2W A;  2K4J A;  3RKY A;  1ZYR F;  1MDM B;  2GXG A;  2PMH A;  4WF2 A;  3E6C C;  3TO9 A;  1R22 A;  3HSF A;  3TKY A;  5ILS A;  3EDP A;  1J75 A;  3L7W A;  1UFM A;  3KP3 A;  1UCR A;  5H6Q A;  3RI4 A;  1NHA A;  5AIQ A;  4M9X A;  2P8T A;  5JVT A;  3CO7 C;  1KU2 A;  4UV9 A;  3CLO A;  2PMU A;  3CDH A;  4N9H A;  6PAX A;  2RDP A;  2HTJ A;  5D5U B;  3RDI A;  3GZ6 A;  2VOO A;  3C1D A;  2RVC A;  3KE2 A;  4ETS A;  4LG0 B;  1Z05 A;  2VBX A;  1S6L A;  3KP6 A;  2VC1 A;  2F5E A;  2VXZ A;  2Q0O A;  1P2F A;  3ZQ7 A;  3DXJ F;  5H20 A;  1R5H A;  1HKS A;  1IN8 A;  2NS0 A;  3HTS B;  2ZCW A;  2GA1 A;  4EM0 B;  1YYV A;  3T8T A;  4QWQ A;  3FXQ A;  1LQ1 A;  1HSJ A;  3FWE A;  1U8R A;  1W7P B;  1YS6 A;  4RB2 C;  4IPA A;  1K78 B;  4RB0 A;  1ZHF A;  1J0R A;  3PQK A;  3ZN1 A;  2QWW A;  2HEO A;  2ZME B;  1K6O A;  1I1S A;  1BI2 A;  2EK5 A;  2K4B A;  3F6O A;  3I0T A;  3O2P E;  3WU0 A;  1IN4 A;  1Z6T A;  1YQA A;  2VE9 A;  5LHH A;  2K02 A;  1HKQ A;  2H94 A;  3FMS A;  3WU1 B;  1A04 A;  3I59 A;  4MEX F;  2BEO A;  1BBY A;  3WTU C;  4XBF A;  3VOE A;  3GYH X;  2JPC A;  3R0A A;  4YG2 F;  3ECO A;  4U0Y A;  2D1H A;  3CUQ B;  1YLF A;  2IP2 A;  3U1D A;  4AWX B;  5DEQ A;  3FMQ A;  4A12 A;  1UST A;  5L3F A;  2DFI A;  3MCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...