3EPZA

Structure of the replication foci-targeting sequence of human dna cytosine methyltransferase dnmt1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
250
structure length
227
Chain Sequence
b'GPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIPGGVNGKNLGPINEWWITGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDQPIFLTPCMRDLIKLAGVTLGQRRAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (cytosine-5)-methyltransferase 1
publication title The replication focus targeting sequence (RFTS) domain is a DNA-competitive inhibitor of Dnmt1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 227
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12047 DNMT1-RFD Cytosine specific DNA methyltransferase replication foci domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2230 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3epzA02
3EPZA
chains in the Genus database with same CATH superfamily
1WVRA 3OYJA 2MW8A 3GFLA 2QBYB 1BW5A 4CCOA 1JGSA 1MH3A 1BR2A 3I59B 4NDLA 3FXUA 5D8KB 2X6WA 1ZK8A 4BQOA 4RLFA 1TWCJ 4A12A 1R4NB 4BHBA 4II3A 4N9HA 2E60A 2CRGA 1D1BA 5DD4A 5EJCA 3V8LA 2XAJA 1BJAA 3NWSA 3SFIA 3K2ZA 3CC7I 3DP7A 5FJ8J 2DA3A 2GBYA 1VQ4I 4OIOF 2ELHA 2A05A 4E6KG 3CC4I 3A02A 4NQWB 3LSHA 4RMNA 2JA5J 3ABTA 1Z3XA 3F8BA 3NQOA 2EBIA 4IRGA 3Q9SA 5FFXA 2DW4A 1YFHA 1NK3P 3LSKA 4GYIA 4Q4ZF 3S1RJ 1GT0C 1WFXA 3CDHA 2OC6A 3JRIA 1Z7LA 3C2GA 2K40A 3E5UA 3K4BA 4RAGA 2KQRA 4Y33A 3VDXA 2H8RA 4JK1X 4IHVA 1X58A 4NC8A 1O7LA 1R36A 1UJ8A 1FOYA 4OINF 2MFZA 1WH5A 2V1DA 1ZQ3P 1MZBA 2BE5F 2LTPA 1ON1A 2EFNA 3TEDA 4GRIA 3BOQA 3S8PA 3MFKA 2L4MA 3L7WA 2BY2A 1JE8A 1JTYA 2RDPA 3EETA 1TBXA 1R5ID 3K7AJ 5J47A 1B8IB 2CQQA 2EZIA 1YJNI 2PMZA 2R5YB 4XRMA 5C44J 2M30A 1Z77A 1XTAA 4G9YA 2M1BA 2RNJA 1MJAA 3G1MA 4KA4A 3GFJA 3PNYA 1HDPA 1U5TA 3WTVC 2CGPA 2A61A 5HODA 2VT2A 2EZKA 2JPBA 3IKVA 1XMKA 4A3DJ 1IXRC 4BJ5C 4EEFG 1K6YA 4D1QA 2W24A 3P9CA 2FOWA 2X51A 1G3YA 2HEOA 2VBXA 3C2HA 2JSPA 2WAEA 2Y0SN 3JREA 1YIOA 2QUFA 2DODA 2R7UA 3KLOA 1TZLA 2PG4A 5TRDA 1JXSA 2PN6A 3LSRA 2GAUA 2ID6A 2KISA 2V9VA 2BHZA 2QQAA 4A3FJ 2HNHA 3ZQGA 3DPUA 3J7AO 2X6YA 1T39A 4IL6C 3B6CA 1IV6A 3NWTA 2CUFA 5D6FA 2CH0A 3QQAA 4ZDLA 5A2QZ 4BXXJ 3BR3A 1V55H 3BZCA 2JA2A 4GGGA 2HTJA 1RKWA 1QVUA 2M0MA 3ZMZA 1Y6IA 4RGXA 3KP5A 5GTIC 2FE3A 3PQJA 2GIZA 2E5NA 5F6FA 3KP7A 5H6QA 4B43A 2QYOA 4ZTFA 2OJED 4CCJA 2XAFA 3I58A 1ODDA 1ULYA 3CJRB 4K2EA 1D8KA 2V1NA 4HQMA 3HIFA 1JT0A 4I2OA 4RAZA 1TT5B 2XVCA 3OIQA 4BKXA 2R7RA 2WY8Q 3ZR8X 2HQ5A 4IHWA 1D0YA 1USSA 1IDZA 5CVJA 1Q1VA 5GAEJ 5FKMA 5J1RA 3M8FA 3QYBA 4IVNA 4DYCA 4AVZA 1CGPA 4BJ6C 1D8JA 3K1PA 4A3KJ 2FQ4A 4MFDA 3ROUA 2WTEA 3H5AA 3LFUA 2VXZA 3ZMDA 4BHCA 2QLZA 4RGUA 4RGSA 3EUAA 1FJLA 2HVRA 2L7ZA 1S3JA 2ZMEA 3JW4A 4F7ZA 1U8BA 4UNOA 1JKPC 1IAWA 1E2XA 3IRRA 5FLVA 4XKBA 1HQCA 1B9NA 3V7CA 1IF1A 3GZNB 2DTRA 3K6GA 1H89C 4Y13A 1FTTA 3K1NA 2OCEA 3TO9A 3S2DJ 1SFXA 4GYGA 4UUTA 3WE3A 1YG2A 2ZJPF 4HLYA 2VXDA 3PUBA 2DJIA 1T33A 5FROA 3CDIA 4XSXF 5DYMA 3JAMK 2AQEA 3D0SA 5GTHC 1BJZA 2DI3A 5KHDA 2V4JC 3HOTA 1B72B 4XR6A 4ENJA 3D5SC 1A31A 3M3YJ 3DEEA 4D7NA 3M8JA 2X9DA 2HKOA 4XL9A 1QNTA 1JUSA 1FSHA 3I3LA 2A69F 4OMYA 1DUXC 1MNDA 2LH9A 3JTHA 5E1XA 2WADA 2QKMB 5IYBJ 2EQRA 1HOMA 1MBGA 3D5LA 1WJEA 1YS7A 2W00A 3CCVI 2LBFB 2HPIA 2VJIA 3OL4A 4BGDA 5LRRA 5H2FC 3ECOA 3CCJI 3L00A 2E34A 5IT3A 1U3EM 1R1VA 3ELKA 5BS6A 1I6HJ 1WJAA 4Y4RA 4IKFA 3LSTA 1G8XA 4IXAA 1YS6A 4PJ0C 1A04A 3QU3A 2CUZA 2V26A 1SAUA 1OR7C 1MW7A 5K7HA 3M4OJ 2QCOA 5ICFA 5E3MA 2KZVA 3TDZC 2H1LA 3K4LA 3JRAA 4A3JJ 1BOAA 5GP9A 1HF0A 4FISA 3CMAI 5L3DA 4IOCF 3BDDA 4HZFA 3SZGA 1EH6A 1UHSA 4WK8F 4KMFA 3GTLJ 5LBQA 1EH8A 4XOPA 2YU9J 1LVAA 3QP5A 3JRFA 2W25A 5DUIA 2X1EA 4I7HA 1TQMA 2JPCA 3HUGB 5K5RA 1JHHA 3B02A 3VYRB 3HPGA 4F93B 1WWXA 2VPRA 1G4DA 1FYLA 4DOZA 1F5TA 4YIFA 1ETWA 2EWNA 3TW7A 2P81A 1ZKGA 2F2EA 1LFBA 2JTVA 4OAZA 4KYWA 1HA8A 2ECBA 3K4MA 3BLYA 3UNGC 2ISYA 2DK5A 4B48A 4M3BA 4XN3A 2XAHA 3DPLC 3FK6A 2X4HA 4KIFA 3ZQCA 2K9NA 3JRDA 3MZHA 1R71A 4KIBA 1T98A 4JX5A 4DIQA 3I53A 2WWYA 5FRNA 2Y0MA 2JZYA 2IGNA 2LG4A 1MKMA 4M3DA 4Y15A 3PFYA 2VASA 1SFOJ 4YG2F 2XC7A 4E7JA 3E6DA 3AG1H 3F9KA 3GZ6A 1BIAA 3A2KA 1U8RA 4XQFA 2AS5F 2HU9A 3DBRB 5FD5A 3I4MJ 4WF2A 2E36A 3KEOA 3FDYA 1LEBA 3F8FA 1MNEA 2R3SA 1KQ8A 4BE2A 2EFPA 1X3ZB 3O3KA 1P4WA 5CQEA 2DQLA 2FRHA 3W2AA 1D3YA 2M0CA 4XRSA 4MGRA 5FGMA 4YRVA 2DXIA 1DPRA 4BEHA 2XDVA 4RAFA 4X6AJ 2LF8A 1WKMA 2CV0A 2WA0A 3H92A 1ZGAA 5LGUA 4S04A 4M3GA 3J80Z 1FNNA 2XHKA 5FLXZ 3I56I 1VQ7I 4KDPA 5E20A 4A5NA 1XDSA 1BC8C 3CUQB 5C4XJ 4LK1F 4BQQA 2A68F 1JT6A 2UZKA 1HSJA 1W4MA 1W1WE 3C2BA 3JSOA 5DCMB 4IZZA 1PUFB 1UHMA 1MNMC 3GUDA 2LY2A 3U1KA 4AWXB 2HQRA 5D5UB 3LSGA 3ZRGA 3OY9A 1XDUA 1ZAOA 1O3RA 2XASA 1NH3A 2Z1DA 4V19K 1QVTA 1W7PB 4EQQA 2H94A 1GV5A 2F4OB 4JYKA 3H5RA 4O5VA 4ESBA 4FTHA 2O0YA 2DK8A 5KAFC 4H0EA 2CV2A 2CQKA 2LP0A 1PVEA 3NRVA 1GXPA 2F4MB 3BC8A 2VQCA 5HNFA 3OYNA 2LD5A 2W1OA 1DGRM 3CCYA 4JQFA 3EDPA 4LITA 3WTWC 1MMDA 3L2RA 4L9TA 3KFWX 3O8GA 4XRFA 4QIWN 1EV7A 4BQNA 2G7UA 2HS5A 3GCMA 1A6IA 3W6JB 3DTEA 3HG9A 3QPSA 1IO2A 3AL0B 1YX5A 4ASNA 1ZR2A 1XMXA 2XPUA 1O3SA 3JRGA 1MDMA 2OTJI 4GXOA 1IG7A 2B7EA 2HOEA 4Q48A 3PIPF 4BBSJ 4Y3OA 1GXQA 3DU6A 5FKOA 2DA1A 3RJPA 3LAJA 3TW6A 1T8IA 2LVSA 4WCGA 3L2UA 2MD0A 2EV0A 3TOAA 4A6EA 3F22A 3BP8A 2LRDA 2HYJA 1M1EB 1IN8A 4BU2A 1P92A 4I98B 5CVIA 5LLQA 2ZJRF 1D1AA 1FT9A 2ELJA 2NNNA 2V79A 5EDNA 1J5YA 4GFBA 1QZZA 2K85A 2L3DA 2ZC2A 5IOYA 4KICA 4HA8A 2R93J 3BG9A 2KP6A 1MMNA 1ZGWA 1JKQC 2RAEA 2M87A 4L0ZB 3S16J 1Y1VJ 3BTLA 5LEJA 1WJDA 2EV6A 3S2HJ 4C2TA 4I99C 4ZTJA 1A6QA 3ABMH 4ANJA 2EFQA 2HVSA 1Z0XA 3I55I 3L9FA 2XAGA 3DLAA 1MBFA 2BZTA 1MJBA 1P2FA 1T0FC 2IEKA 4G7HF 3LQQA 3CLOA 4KN4X 5HLTA 2VE9A 2DYRH 2KRHA 3P9KA 4BNCA 3LA2A 1OCTC 2MLGA 1EH7A 2XF6A 2XV4S 4AUXA 1PP7U 1B6AA 1KU7A 4M71A 1S72I 5J3LA 3DBLB 4AIHA 1KONA 3HXLA 4RGRA 3GW2A 3Q0VA 4XIDA 1XPXA 1BI2A 4LG0B 1FWZA 2HQNA 1X2MA 4C9YA 2XGDA 3FKJA 1ZG3A 2F5EA 2XSJC 2RV8A 2M45A 1POGA 1VI0A 2OV7A 1FTZA 2XB5A 3CESA 5EEAA 3ZN1A 1S7OA 1BIBA 2E2HJ 3A0BC 2L9NA 3DWLE 4KMUX 3ZCOA 2O8KA 1HC8A 1J9IA 3ZXSA 2PJRA 4FX4A 4IHSA 2PFBA 4EJWA 1G3SA 4XKCA 3E97A 3E6CC 5KVRA 4WWCA 2DA2A 2MLKA 1ZLKA 2NXNB 3DPTA 4YFKF 4CDGA 4M6YA 1KYZA 4BXFA 3CCSI 2IS2A 3KIOA 1DU0A 3IAM2 2L0KA 3KYDB 5J6XA 3ZMUA 3VSKA 3KZIC 5IYCJ 3CMMA 3IAS2 1YHQI 2VI6A 3SZPA 1SAXA 2DQRA 3BG3A 1J59A 2QSGX 5DCFA 3WG7H 2EZHA 5ICEA 3OR1C 1LB2A 1KU9A 4DYQA 1YO5C 1BM9A 4UHTA 4G7ZF 2ETHA 4XBFA 2A5WA 3UR3C 3V7SA 2YPRA 5JVTA 3IH3A 1PDNC 1J2XA 3BJ6A 1VQPI 3SHFA 4JX4A 5DS9A 2VBZA 1Z1DA 4CO8A 4ZYGA 3L2CA 2MYSA 5EZHA 3IC7A 3K70C 1WZ2A 3TO7A 4IOAF 1R4MB 1ORKA 4B3AA 2GXBA 3ZOBA 4RM2A 2YX4A 3CLQA 4AM3A 3EUKL 3QP6A 4ZYEA 1JTXA 4HNUA 2JN6A 2L9VA 1N75A 3G3ZA 5E8GA 3OYFA 3RDIA 4A0ZA 3LL7A 1OMIA 1HKSA 2XF7A 4O3MA 4Z2YA 1K78B 4EM2A 2IBDA 2H09A 4IHYA 4A3IJ 3F6VA 2GWRA 1J09A 3OOPA 1BN5A 5LHGA 2VN2A 2O8XA 2ZXIA 4A69C 2K3FA 2DU9A 3LAPA 5CYVA 2BW3B 3BCBA 5C3EJ 2BXYA 1BL0A 2R92J 3CCEI 5M3FJ 1IJWC 3ERMA 1U2WA 4OMZA 2VLAA 2GA1A 3GTKJ 1UCRA 1X4OA 5TJJA 2EH3A 1O7FA 1YQAA 3W2VA 2XGEA 2Y48A 3MVPA 3MZ8A 1FMVA 3HM5A 2LKXA 1TT0A 1OCRH 1X1CA 3ML6A 5IP7J 2O6GE 2RGVA 3E1SA 4U7DA 4ZH4F 1BC7C 1SD7A 5LRSA 5DUKA 3CF2A 1DDNA 1IRZA 1FMWA 2ZJQF 3PJRA 3GYHX 2DA4A 3SXYA 9ANTA 3FXOA 5GPCA 1U5TC 1P7IA 2EA4A 1FYKA 2F5FA 3I54A 1RETA 4A6DA 4D7MA 1DP3A 1ON2A 4BDZA 2OQGA 4FCYA 2XGCA 4UUSA 4A3EJ 1LPQA 4U0YA 1LEAA 2MH9A 3ZP5A 2XPVA 5JHFA 2KDZA 3FXKA 4KN7X 4UB6C 1EKEA 2M8EA 5CQGA 1KGSA 3BG7A 3H36A 4CCMA 5JHUA 1R9TJ 2M3AA 5E3NA 2DMTA 1RUNA 1VNDA 2RREA 4XKWA 2FBHA 1QA6A 3FKIJ 3BR1A 5FKLA 2ZXHA 1UB9A 4XKVA 3R61A 4MHGA 1P4XA 4AU7A 2KIFA 3I64A 2KRFA 1BR4A 1IDYA 3MMYB 2ESHA 1G59A 4A3CJ 3Q0WA 2VQHA 5B1AH 3FMSA 2ZJ2A 3HPHA 3RCOA 3CF5F 3GTJJ 1YW8A 3PSIA 3BJAA 4JX6A 1CF7A 3EUHA 4OIQF 1K7AA 1TNSA 2LNBA 4YFXF 3A0HC 4RLQA 2JA7J 2QZ8A 2IA0A 3JRHA 1U0JA 3PIOF 1Y8RB 2A6EF 4HAMA 2LKSA 2HOSA 2CW8A 4BY7J 4MIMA 3LWFA 3V7RA 4YIRX 3OL3A 1E3PA 3HHHA 4HV5A 3DTIA 2G0EA 2CUEA 3M07A 4BXUA 1WJ5A 1R49A 2MC3A 2PBIA 4A93J 3E7LA 1LDDA 2KHMA 2L4AA 2R7SA 1O3TA 2GZWA 2BOLA 2JMWA 1KZHA 4P1WA 2VC0A 1KU2A 4PJMA 5E1ZB 2D1HA 4HX4A 3QYFA 3PM1A 4JP0A 3K4KA 2F4IA 5EG0A 3HRTA 1TWHJ 2GQQA 3JAMZ 2X1CA 1RRJA 3M1EA 4ZYAA 3O2PE 4P9UA 1QPIA 2K5CA 1BA5A 2JRMA 1OCZH 3CZ6A 1LDKB 3G2BA 3C3WA 3GEZA 3E3VA 5GPAA 2L5QA 3I59A 1TC3C 2GOMA 1BBYA 2MD5A 3A01A 3GLLA 4ZZDA 4RB3C 4AIJA 3V8KA 1DQUA 2VKEA 1H9GA 1QRYA 1JJ8C 3CJTB 3HEFA 1PP8F 1YLFA 5BMZA 3Q3SA 2EA2A 4HOBA 2F5CA 1DPUA 2Y69H 3M9AA 4IRIA 4R79A 4OOIA 3OYDA 2R7QA 4RDUA 3AFHA 5F27A 4A3MJ 1XGNA 2VJ4A 4UVCA 2DA6A 1FEXA 3SZTA 3OYBA 1LQ1A 2R4GA 1JGGA 3HHGA 1D5YA 2E1MC 2ZBKA 2DBBA 4EJOA 4CYCB 1R1UA 2L7FP 2P5VA 2PX9A 4LLGF 4IPAA 4EJVA 1FOXA 2W57A 3KETA 4L9VA 1FSEA 3I9V2 2XGXA 4Z6YA 1IXCA 3VB2A 3S1QJ 4Y52J 2QF7A 4F3QA 2PI0A 1MBKA 4LJZF 5E8IA 2HR3A 3HRMA 4KITB 1HKTA 2E1MB 1E3HA 2Y0SA 3BROA 4E7LA 5HS8A 2DOFA 2DT7B 3U1DA 1Z6RA 2UWMA 2HDDA 4L5IA 4ZDOA 3WU1B 2MA3A 2R5YA 3DKWA 3IH4A 3N97A 1ERDA 4Y7NJ 2Q8KA 1BI1A 2YX7A 4BACA 2E1CA 2P7VB 2L2OA 4QSHA 1T6SA 1SFEA 1XGMA 2WB1A 4PGGA 5LHHA 2BBYA 3WU2C 1FBUA 1SD5A 1BR1A 4G6TB 2V9PA 4DJAA 2QSHX 3E6MA 1LFUP 5ILVA 2NVTJ 3F8NA 4BY1J 2ZO4A 4IQ4A 1QHHD 2BYVE 3BZ6A 1LVKA 3W3CA 4GDFA 2EIJH 2D1VA 2IPQX 4RM3A 1YJWI 4M6VA 3GTOJ 4I02A 3RKWA 2NAZA 3BT9A 5H20A 3DEUA 2KMUA 3GMEA 1VQ6I 1ETXA 2QENA 3HDDA 3F21A 1REPC 4HLXA 4HEA2 4D5FA 1IC8A 2YS9A 5FD6A 2RQPA 3AKZA 1TP4A 4ENKA 1F1ZA 2FU4A 1R5GA 3IP4B 5JR3A 4MLOA 4BS9A 4D9JA 4F91B 1K4TA 1AHDP 4M74A 2DPUA 4IO9F 4WXHA 2HOTA 3I0TA 3ONQA 2NS8A 2CG4A 4HSTA 5EYRA 1T95A 3QAHA 5L3EA 2OPTA 4E7SA 1QQIA 2KJCA 1W7PD 2NOJB 3EPZA 1Z3YA 2FMLA 2FMYA 1MJ9A 4WX9A 5DM7F 4QTRA 2JK3A 5JI6A 5KCMA 1FIAA 5J1YA 3RI4A 4HPQA 1H88C 1EJ9A 2ICWG 1UG0A 3EYYA 2VC1A 3BR5A 1BI0A 3VFZA 3ERED 2LF7A 3WGHA 2MSYA 2DMUA 2A07F 2H6CA 3F8MA 3R4KA 2ZFWA 3D1NI 3LNQA 1D1CA 3DFGA 4UVAA 2IGMA 2O61A 2K3PA 2PMUA 5D6EA 3T5XA 2E1NA 3WTTC 2IXSA 3FM3A 2B63J 3H0DA 4TV7A 2PQ8A 3DKYA 2R5ZA 3QPTA 1OCPA 4XNFA 1YRNA 4PUSA 2L9SA 1E17A 4M3EA 4KT6A 2LC2A 3B6AA 3AAFA 3P5JA 4R1HA 3OYHA 2KIMA 1ZTRA 2K86A 3L1PA 4XN0A 2KDOA 2P6TA 1R00A 2KFDA 4HX7A 2EILH 3G6EI 1OCCH 2XSDC 3QPHA 1IN7A 2CU7A 4EMSA 4WXDA 1R22A 3WTXC 2OF7A 4HDUA 1HCRA 5HLGA 2EK5A 4A0XA 3HRSA 3M8EA 3ZQ7A 2HXOA 2I10A 1TNTA 2L7KA 4DW6A 1AA7A 4AIKA 4CYDA 3J7ZI 2A6HF 3PNVA 3TQNA 4ETSA 2ZCWA 2LBFA 2JVHA 4FX0A 4FASD 1WH7A 1R23A 1HBXG 2P8TA 3MQ0A 1WI3A 2CQNA 3HSEA 3S17J 3G1OA 2Y2ZA 2HFHA 3RYPA 1OLTA 3CO7C 3SYTA 5F0FA 5TGTA 3FIWA 3QOPA 5LD2C 5F0CA 1MDMB 1YX3A 1UG2A 2R7XA 1KYWA 2EV5A 2V6EA 4OIPF 1FPQA 2CV1A 1OYYA 1YOVB 3M1CA 3PFIA 3V8JA 4B09A 1I3AA 2DFHA 3H3ZA 2DMQA 4KISA 4EVIA 5KAIC 2X0LA 1QZYA 2IS1A 1S7EA 3MN2A 4A3BJ 1YYVA 5B66C 2KJBA 4I0BA 2PJPA 3H3VK 1QGPA 2E71A 3RQ4A 1W5SA 3NEUA 2DYSH 5HLIA 4LB6B 3VYTB 3HSRA 1Z91A 4BBRJ 2VIXA 4DZJA 4E7KA 1TQIA 2BEOA 3QODA 5D5VB 1IGNA 1V5FA 1ZN2A 4IHTA 4XLFA 5L3BA 2NOGA 1HXDA 3BR2A 4L0YB 2B0LA 4WXCA 2P7CB 2W82A 2L01A 2JUCA 4EM0B 3WTYC 4MEXF 2JUGA 4V2FA 5KK1A 1U6GA 2R7OA 4G94A 2AO9A 2HYGD 1IRGA 2Z2SB 3VOEA 3BZKA 1JJ6C 2F5VA 2FQ3A 3IKTA 1Z7UA 1WJCA 2M34A 1P4AA 3K0LA 2PMHA 1BW6A 3K10A 2BXZA 4RAYA 4AVPA 4M9XA 2LMDA 2M2EA 1MBHA 4HRIA 3MWMA 3L2WA 3RKQA 1FOWA 1IXSB 3ULQB 4S0HB 5D8LB 1SVOA 1VF9A 4BE1A 2XRLA 4A3GJ 1FX7A 2XAQA 2V7FA 1ACIA 4L5JA 1Z05A 2IRFG 2H8WA 3LSMA 4MFEA 4AYBN 5F1RA 1IUFA 3T1BA 1R7JA 5J40A 4F55A 2JA6J 2O3FA 1LUJB 1STZA 1W0UA 2ME0A 1W36D 1UHWA 2DTZA 3VYSB 5JLWA 3L2VA 1QU3A 1K6OA 3CUQA 6PAXA 3I71A 4Q5SF 2QM3A 5FB2A 5HDGA 1XGSA 4YELA 3OWTA 3F8CA 3FZVA 1MMAA 5DCMA 3NAUA 1GUUA 4LG3A 1PUFA 2GM4A 4QPOA 3TOBA 5D4SA 2DOEA 1VQ9I 1FY7A 5TISC 2QWWA 3ECHA 3H9GA 3MD2A 2AXLA 4NC7A 3RQIA 4HF0A 3WE2A 2OCCH 2OD5A 3W6VA 2L02A 3R60A 1G2HA 2CUJA 3MKYB 3HGYA 1QBJA 3ABLH 4EV0A 1W7PA 5L3GA 1LKXA 1ZYRF 2EFWA 3CQZJ 5BQTA 2B9SA 4RB2C 1XG1A 4DGWB 3CDLA 4X1EA 2KT0A 3ZMVA 3ASOH 1B9MA 2M9HA 1DGWY 1WJBA 2E1OA 4R8HA 4AD9A 2W84A 5J8CA 3S3MA 1G6NA 2XKPA 1RKTA 4CZCA 3NARA 2HKXA 2JT1A 2RKHA 1ZH5A 3IRQA 5LGNA 4BJTA 3MKLA 5M5YJ 3WHBA 3OSFA 1RNLA 3J81K 2AXTC 1F4KA 2VT3A 3V4GA 1G3WA 3G1LA 5E1WA 4G7OF 2ISZA 3U9GA 1ZHFA 1T2KA 2NVYJ 4I09A 2Y9ZA 2JQ7A 5IT9K 2CW0F 2DFFA 1C0WA 4G6QA 3JR9A 4UY8I 3HKZN 1FC3A 3SEQA 2VONA 3FISA 5JVGF 1HSTA 5EEHA 4XLAA 1U9OA 2LK2A 1FP1D 2XF5A 3WTUC 4U0VA 2C6YA 2Q2EB 4MEYF 3OIPA 1YW7A 1A36A 1YE9A 1RC9A 2N8GA 1XS9A 3OYKA 1EF4A 2HZDA 1PJRA 3ZQIA 2VPLA 2CFXA 2EIKH 2WAQN 3FF5A 3KYLA 2E7WA 1S6LA 2KLOA 3GX4X 1HW1A 4XLCA 4XICA 3OYIA 2GXAA 1QZEA 2DFEA 3IHUA 2K9LA 2KRCA 2W85A 5B3SH 4JBAA 2XRNA 2R7DA 4DQ2A 5IOZA 4HW0A 2VUMJ 1U9NA 4A3LJ 2MC4A 1XB4A 4LK0F 4M3FA 3OV8A 4HG2A 4PSXA 1IV8A 2DMPA 2HI3A 2VJJA 2XUBA 2FNPA 1S29A 5FKKA 5CVUA 5M3MJ 3GBGA 2ZSIB 4ON0A 1VFCA 3FX3A 4CCNA 4GO1A 1NTCA 2IP2A 2ZFUA 1JHFA 2VKDA 2V1XA 2AHQA 1S5LC 2XIGA 2AQFA 5JFRA 3VSLA 1RI7A 3HOSA 2WV1A 2ECCA 1XD7A 3EUHC 3U21A 1QPMA 1OCOH 4XK4A 1RPWA 1PUEE 3HC7A 5E18F 2H6BA 4KT5C 3TBIA 1JUPA 1G3TA 1V5EA 4LLLA 5M5WJ 2VQGA 3BR0A 1IW7F 3DEWA 2KPMA 3HL2A 3DLLF 3WTSC 2K4JA 2X85A 5EGOA 1B59A 2CFOA 1U78A 2R7TA 2UXXA 2WBMA 3C1DA 3VWBA 3FMRA 4ITVA 1KA8A 2HWVA 1ZREA 4ZYDA 2DCEA 1XN7A 4B4CA 1VZ0A 4UB8C 1WHUA 2VL8A 3E5QA 4JOMA 3S15J 2DDAA 2V6CA 2YUSA 3GVAA 4OU0A 1I6XA 3W2WA 1GDTA 4MO7A 4BAYA 2DLLA 2GA2A 1W0TA 5FLMJ 5CKTA 3QOEA 3QRFF 2HDWA 1YJ9I 4FETA 5AIQA 2X1DA 3E5XA 2LREA 3LA3A 2BY3A 3ABKH 3LA7A 4MNUA 4BL0B 4E7IA 3ZMTA 1X1AA 1TQPA 2P0WA 3B73A 3BPXA 5ILSA 4BH9A 1ZRDA 3KP3A 5D5XB 4RBOA 3DKXA 5CLSA 4I76A 3LSPA 1U5TB 4U7BA 1LE8A 3FBIB 5IP6A 4GCVA 5BOXA 1ZR4A 3OIOA 4ZZLA 3BWGA 3GLXA 5DV5A 3ISPA 4FT8A 1R5HA 4QWQA 2OUMA 3RSNA 3A01B 4DBRA 4BDYA 3BG6A 3HOUJ 3HTSB 4XMYA 2XROA 2M4GA 1SD6A 2K02A 1AOYA 1K78A 2NNYA 2PMZN 3F0CA 4PFPA 2GLOA 3FMQA 2P4WA 3T8TA 5DD8A 3G4SI 1WGXA 3KEYA 1Z9CA 2EJRA 3ASNH 5F64A 4FE7A 4G6DA 4A0YA 2BW3A 1FBSA 3CCRI 4E7HA 1L3LA 5FRMA 2F48A 3K2AA 2OZ6A 3I4NJ 4M6XA 1X2NA 4J00A 1YIJI 1ETQA 3CCLI 3RIRA 3HJEA 4LB5A 1AKHA 4G12A 4IEJA 4XM3A 4KJZA 1RR7A 2LYCA 3BTIA 1XCVA 2EZLA 4DZPA 2K7LA 4C3HJ 1D5VA 1TL8A 2RN7A 2FNAA 2DPDA 1N78A 5F1JA 3CTAA 3BQYA 3CO6C 3MCZA 2ZMEC 4HQEA 2RC4A 1NG6A 1HLVA 2CSOA 3S3NA 2E2IJ 4KFCA 4XLEA 4IJAA 3WODF 4FE4A 1OKRA 5K5OA 2VODA 4N9IA 2ZB9A 5LFAA 3BG5A 1W5CC 2QBYA 4PJNA 4U87A 1X4PA 2OZUA 2ZSHB 3R6SA 1LFPA 4OWRB 1Y39A 1OFCX 3KX2A 3TDUC 1PYVA 4ABZA 1OPCA 4XLNF 3REOA 1H9TA 3BY6A 2DT6A 2ZMEB 2JWTA 3FXRA 4RB1A 3SFZA 4A5MA 3DF8A 5HVQC 5K5QA 4ENMA 4ZDPA 2JA8J 4E70A 3Q5FA 2CWEA 5E79C 1SVMA 3FHNA 1ZRFA 2KL4A 3IL2A 4NQWA 3CMYA 5D4RA 1XSVA 5J4YA 3MKWB 2GXGA 2E5ZA 4LLNA 1N77A 2O5RA 2W48A 2FJ1A 1KQ0A 5B5EC 5D5WB 3LFKA 1CQTA 3DTKA 1TWGJ 1R58A 1I39A 2FSWA 5DEQA 5EF6A 3S3OA 1SMYF 3MKZA 3OR2C 2VBWA 1MBJA 3JRCA 2WB1N 1EA3A 4ZJZA 5KNLA 1R6RA 2EINH 5E17F 2I8DA 1B1BA 2DDBA 1WSUA 3TGNA 2DN0A 2CW7A 4P5OA 3CCUI 1J0RA 3ZPLA 5FFZA 2BY0A 5L3FA 4E7ZA 3KP4A 1VQLI 1ITYA 2DJNA 3P9IA 4RS8A 1N25A 1RZ4A 3A03A 3RPUA 3RZDJ 3OYLA 1X1BA 2IGOA 2LR8A 1QHGA 3OS1A 2UV1A 3S14J 2LY9A 3D5RC 4Q47A 4HV6A 1B8IA 1Y0NA 2K9MA 1X3WB 2WC2A 5ERIA 1A5JA 3TL4X 3OSGA 2M4KA 3QPLA 4XOTA 4CH7A 4BE0A 3KCCA 2O9LA 3H3UA 2D45A 4BUPA 1R1TA 1AU7A 1MH4A 1Y8QB 5J8FA 2H27A 4DBQA 2KIQA 1P6RA 3KP6A 3UKGA 3KLNA 5JLXA 4NB5A 4IQJA 3ZQHA 3OYCA 3HTUA 2QQ8A 5ED4A 5M5XJ 3I4PA 1OYIA 3C18A 1ZLJA 2CS3A 5B1BH 4HF1A 3V42A 2QVOA 2NYXA 1F9NA 1XC5A 3O6BB 3I5UA 4M9ZA 1YITI 2XB0X 4CICA 3GTPJ 3S1MJ 4BQAA 2J5PA 3BJOA 1H0MA 2PLYA 3QYEA 1LNWA 5F08A 1UFMA 3F23A 4EGYA 3HOVJ 1SANA 5GAGJ 1HDDC 3HOYJ 2HVQA 1FYMA 4CGZA 2QSFX 2WY7Q 3FXLA 4XLPF 4C2UA 2R7ZJ 2ZXWH 4FQGA 1QO0D 3VODA 4MTEA 3MAJA 1GVDA 3X2QH 2Y9YA 3K9TA 1RIOH 2R5ZB 3AG3H 2IT0A 3G71I 1YRNB 4FHTA 3QU6A 1VQ5I 3H9JA 3WGGA 3BCAA 3PO2J 2OA4A 1X3UA 3S32A 5IY5H 3OOUA 3KZZA 4CYCA 4P9FA 1FP2A 2HTSA 2XAUA 5HS7A 1B4AA 1O4XA 1K83J 2ZNYA 3TMOA 4ZYHA 1VQMI 2A6TA 2VQLA 2QEXI 3JCUC 5HNHA 3RYRA 4EM1A 4UVBA 2LFBA 4EATA 4C30A 1V54H 4LD5A 4IF4A 2NS7A 2HXIA 1JKOC 5IYDJ 1IN5A 4HYEA 2K4BA 4ESJA 2Y75A 4J19A 5E3OA 3OS2A 1FZPB 1DU6A 3TP0A 5CVRA 4B8XA 1V5GA 5C4JJ 1T56A 2MG4A 2QGUA 2M7BA 3HOWJ 2ZNZA 1FBQA 2X6XA 3PNTA 2E2JJ 2IW5A 3RKXA 1YTYA 4L9NA 4HNVA 3EQLF 5A2QK 2BHYA 4M72A 5CJ9A 1Z21A 4KUMA 4LIVA 5H6RA 3OYAA 1GHCA 2TCTA 2STTA 1XCBA 4XRSG 2R7VA 3CCMI 4IRHA 4XORA 3S93A 2OU2A 1J7KA 5EZGA 4BEHB 2A5YB 2QQBA 3JSPA 5LHIA 1I5ZA 3A1YA 3KP2A 3CMEI 5AIPA 3P7NA 4I6ZA 2COBA 3G73A 4HNTA 3GZ5A 1IUYA 4CCLA 4V2GA 4B3XA 1ONVA 3JTGA 1WPKA 3GXOA 1Y0UA 4LIUA 1SEUA 2UXNA 1ETYA 3FXMA 2VJ5A 2EPFA 4F52A 2BY1A 1B72A 1V3FA 3J7YJ 2VB6A 3OYMA 1RR8C 2LY1A 3VEPA 2MH2A 4EJUA 1USTA 1MIJA 1I3QJ 2ADUA 3HGGA 3HSFA 4G8XA 4P55A 1SFKA 1ZGJA 3LSIA 1KQ9A 2Z5UA 1HW2A 2Z99A 1TWAJ 4PDKA 3ABUA 4W1UA 3ZN0A 5IP9J 1E3OC 1WJFA 1SFUA 4YFNF 1I27A 3L09A 2FA5A 4MQ9F 4PJJA 2STWA 4H4KC 4C2MJ 1FOKA 1NHAA 3WGIA 1X1DA 2FUG2 1BOBA 3F6OA 5CPRB 2FF4A 2BVLA 1MBEA 3COAC 1XSXA 3R0AA 5BPIA 1D0XA 3WU0A 2DA7A 4UV9A 1BI3A 3FHZA 3O8HA 2P5LC 5ILUA 2EFOA 3RPQA 2PEXA 1H8AC 4N4NB 3KPHA 2XPWA 2DAOA 4RB0A 2NVQJ 1LJ9A 2M7AA 4XONA 3HOZJ 3GTGJ 1Y1WJ 3VYUB 1GLNA 2EIMH 2DT5A 4S05A 3M7GA 2X6OA 3K4JA 1KU3A 4W97A 1GV2A 2IAIA 3JRBA 3IH2A 1K79A 3CUQC 3K69A 4D5CA 2M5WA 3ZMSA 2RVCA 3RTRA 1VQKI 3KZYA 2NVXJ 2Z9OA 4L18B 3E6BA 1FLIA 2TRTA 2YSRA 1JKRC 2CJJA 1ZRCA 2ZKZA 2MBFA 2RNGA 4BHPA 1OR7A 1D0ZA 3QWLA 4PZJA 1NG7A 1LDJA 2K27A 2X48A 4PSWA 3HUGA 5K7FA 1K4SA 1J75A 5F0HA 1E0EA 1XX5A 3KEQA 3DU5A 2P6SA 2M8GX 3MZYA 4AIDA 1ETKA 4ZC3A 4I0AA 1UMQA 2IA1A 2OBPA 1VQNI 3L2QA 3HOXJ 3T8RA 3J81Z 1SVLA 1TW3A 1O3QA 5J4VA 1WRJA 3IUOA 5HLHA 2FX0A 2G7HA 1MMSA 5IT9Z 4DNCA 4KNYA 4Y17A 4CHUA 4HF2A 2UUZA 2WAFA 1V4RA 4D0PA 1UZCA 1NK2P 2K9QA 4PGHA 4B44A 2IS4A 4NHJA 3AL0C 2IJLA 4OIRF 4HSRA 1AWCA 3GF2A 3DBHB 3HRUA 2F6CA 5DDGA 1MMGA 3FBNB 4NUBA 4IX7A 3H35A 3DQVC 2CQ7A 2E19A 4CZZA 1L0OC 1K61A 4UUVA 4LOCA 1TWFJ 2NS0A 3CJNA 1MSEC 5HDNA 3SDGA 3H1CA 1IRFA 3A4CA 1UELB 3H9QA 4LGWA 1Q1HA 2HYFA 3AG2H 1VTNC 2MABA 3T0YA 1UAAA 2PJRB 1APLC 1XGOA 1HKQA 2FXAA 3SEZA 1P9QC 2DOAA 1X1PA 1SC7A 2D5VA 2H1KA 3HBLA 2JJ7A 2HQAA 3LQRA 3IWZA 3TO6A 2IVMA 5J1UA 4OAYA 3MEXA 2ELKA 2KIUA 3FXQA 4EJTA 3K70D 1W5TA 5EEGA 5ICCA 1GVJA 1I1GA 2J5OA 1S7AA 2MGQA 3FK7A 1TLHB 4NC6A 1I50J 1WQ2A 3CUOA 2IGKA 3KYCB 3N05A 4PFOA 4UV8A 4BYYA 3KE2A 5IPAA 3OS0A 1RUOA 3F3XA 4N0BA 1OYWA 1OISA 4EGZA 2VOOA 2Y30A 3WTZA 2YR2A 1IRXA 2A3SA 3DV8A 3VPRA 4B1RA 5FO5A 5LGTA 4HBLA 2DMNA 5HS9A 3PO3J 1IZ1A 1Y56A 3GTQJ 3SDBA 2FEZA 3J7AY 1I1SA 2I5UA 3SQNA 3WHCA 1X19A 3BTJA 3S1NJ 2F5DA 2GOXB 1F43A 2Z3YA 2CMPA 5LEKA 3LMMA 2OAZA 4NBQA 2JSCA 2Z33A 4AYBA 3J80K 2CQXA 4ENNA 5FLXK 2GIVA 1JI8A 1T38A 2ESNA 2LSOA 5FKNA 4B47A 1IN6A 1MD0A 4P96A 2E35A 4IHXA 2TDXA 4HX8A 2NVUB 2L7MP 2ACJA 4PK4A 1O57A 2HZTA 4O6JA 1TW2A 2L54A 4NNJA 2KZGA 2FD5A 3RKYA 3ZGKA 3H0GJ 4CSWA 4N4OB 5HOOA 2WV0A 4PCQA 1TTYA 4DYRA 4HDVA 5K1YA 2BVMA 4CCKA 4LMYA 3FM5A 2CO5A 2Q1ZB 2VKHA 4F92B 1HW5A 1YW9A 1IN4A 2FBKA 1ZELA 2EB7A 3CP2A 1Z67A 3CD6I 4U0WA 4ESFA 2RQQA 5EGOB 1ZG1A 1XMAA 3BTCA 5L3CA 2XKOA 2IS6A 3BR6A 2D2WA 2O7OA 4PJLA 4J01A 3FXJA 3S2WA 1OQYA 4QPQA 3LOCA 5DM6F 2JRTA 4L5EA 1RESA 2LDUA 3ZQQA 4CXFA 3GWZA 3Q9VA 5AONA 2YU3A 3HYIA 4UXNA 5K7ZA 3GFIA 2DO7A 3PUFA 2OQRA 4M73A 2R0QC 3ESWB 3R0JA 5BPDA 4CUGA 1FIPA 3W6KB 2QA4I 2R7WA 2L9RA 3OMYA 1WCMJ 2W4SA 3OYGA 4X0GA 2R7FA 1XSDA 2OTLI 1T08B 4MQVA 2VE8A 3RPUD 5E3LA 4C3IJ 4UUSB 1W36C 2QKLB 3HB9A 4LG0A 3IWFA 4MTDA 3HKZA 1T0FA 4E4HA 2ZXJA 3IV5A 5F04A 3TKYA 1A35A 3AG4H 3PL8A 5ICGA 1VQOI 4II2A 2E7XA 5DTDA 2CYYA 1LE8B 3CJQB 1ZARA 3F72A 4KIGA 2Z16A 1ETOA 4LFUA 4XSZF 2FOKA 3ZQLA 2FBIA 1OJLA 2HGCA 3BQZA 3PSFA 4M9SA 4XLHA 3WG9A 1WI9A 3OYEA 2LOOA 1ENHA 4RA2A 2WAQA 2ID3A 2VOPA 2G9WA 2HPMA 3GFMA 3CC2I 5BNGA 3CCQI 1CF7B 2BV6A 2V9KA 2V1UA 3H5NA 1P7JA 2LKPA 1F36A 3TP3A 3RZOJ 1MSFC 2DA5A 2ME6A 2VKVA 2W7NA 3K4NA 1SMTA 2KKOA 3LSJA 4CA0A 3HZJA 2Q2EA 2COMA 2Q0OA 1S8NA 4C3JJ 4QLCU 1YI2I 2HOAA 3ZQFA 5GAHJ 4I01A 2QQ9A 3DXJF 3DCFA 3E0JB 1S9HA 1MGTA 2O03A 1SD4A 1ZG5A 1JUMA 2JVGA 3CP8A 1AKHB 1Z6TA 2HDCA 1ETVA 3U2RA 2IA2A 1VQ8I 3FWEA 2LLKA 4L9JA 2K9SA 4U88A 3C7JA 3BPVA 5EG0B 2NRAC 4AC0A 3K4CA 5GADJ 3PQKA 3SJMA 3K1MA 4YEJA 3GO5A 2DFIA 2Y31A 3GTMJ 2BGCA 3Q0UA 1DP7P 4YIIA 4A2UA 2P5KA 5CVVA 3N4MA 5HDKA 2VBYA 3EYIA
chains in the Genus database with same CATH topology
3OYJA 4CCOA 4DBQA 1BR2A 1OLTA 2OV7A 4IQJA 2X6WA 3OYCA 3SYTA 3CESA 5TGTA 4BQOA 4RLFA 5LD2C 2L9NA 3DWLE 3ZCOA 1YX3A 2CS3A 2R7XA 4II3A 3V42A 3ZXSA 2V6EA 2E60A 2PJRA 1D1BA 2CV1A 4XKCA 3M1CA 3NWSA 3QYEA 3DPTA 4KISA 4E6KG 4NQWB 3LSHA 4RMNA 2IS1A 2HVQA 4BXFA 1Z3XA 2WY7Q 4C2UA 2IS2A 3LSKA 3RQ4A 1WFXA 2OC6A 3IAM2 1Z7LA 3C2GA 3VSKA 3VYTB 3CMMA 3IAS2 3K4BA 4Y33A 2KQRA 3VDXA 2VIXA 3H9JA 3BCAA 3QODA 4E7KA 3S32A 3OOUA 1V5FA 4NC8A 2XAUA 4XLFA 2W82A 3TMOA 3OR1C 2A6TA 2MFZA 2VQLA 5HNHA 2JUGA 4C30A 4EATA 2R7OA 3UR3C 2A5WA 2Z2SB 4GRIA 3S8PA 2F5VA 3OS2A 1WJCA 2MYSA 2PMZA 3K70C 1V5GA 3K10A 2M7BA 2X6XA 3PNTA 4HRIA 4RM2A 3L2WA 3PNYA 3EUKL 1Z21A 4BE1A 4HNUA 4LIVA 3OYAA 1N75A 2R7VA 2V7FA 4BJ5C 1K6YA 4XORA 3OYFA 3LL7A 4D1QA 3S93A 2X51A 4BEHB 3LSMA 2XF7A 2WAEA 3C2HA 2JSPA 2R7UA 3A1YA 4F55A 1TZLA 1J09A 4HNTA 4CCLA 4B3XA 2ZXIA 3VYSB 1W36D 3L2VA 1QU3A 2HNHA 3DPUA 2X6YA 4LIUA 2BW3B 3BCBA 2VJ5A 3NWTA 4F52A 2VB6A 2CH0A 3OYMA 2LY1A 4ZDLA 4YELA 3OWTA 1MMAA 2VLAA 1X4OA 4LG3A 2JA2A 4QPOA 1SFKA 2M0MA 3W2VA 1Y6IA 1FMVA 3LSIA 1TT0A 1X1CA 3H9GA 3MD2A 4NC7A 3E1SA 2CUJA 3MKYB 1WJFA 2E5NA 4B43A 3CF2A 4PJJA 4ZTFA 4H4KC 1FMWA 4CCJA 3PJRA 1LKXA 3CJRB 1X1DA 2FUG2 1BOBA 5CPRB 2V1NA 2BVLA 4DGWB 1D0XA 1DP3A 4BDZA 1DGWY 3OIQA 1WJBA 2R7RA 2WY8Q 4N4NB 3ZR8X 1D0YA 5JHFA 2M7AA 3QYBA 4XONA 3S3MA 4AVZA 4BJ6C 4CCMA 5CQGA 3VYUB 4CZCA 1GLNA 3BG7A 2M3AA 3K4JA 3H5AA 3LFUA 2VXZA 4BJTA 2RREA 2HVRA 3EUAA 4XKWA 2ZXHA 4XKVA 3RTRA 4AU7A 4XKBA 1BR4A 3MMYB 3K6GA 1G59A 2VQHA 3HPHA 3SEQA 3RCOA 3PSIA 2RNGA 4XLAA 1D0ZA 2VXDA 3PUBA 1NG7A 4RLQA 2DJIA 4PSWA 2XF5A 1E0EA 5FROA 3DU5A 1U0JA 2Q2EB 2AQEA 3OIPA 5KHDA 2V4JC 4ZC3A 3HOTA 4XR6A 2CW8A 3D5SC 1YE9A 3DEEA 3M8JA 3L2QA 3OYKA 2HZDA 1PJRA 3OL3A 4XL9A 2VPLA 3DTIA 3KYLA 3IUOA 1WJ5A 2KLOA 3I3LA 4XLCA 3OYIA 1MNDA 2KHMA 2R7SA 2LH9A 2K9LA 2KRCA 2UUZA 2WAFA 2BOLA 2WADA 4P1WA 2QKMB 4PJMA 2IS4A 4B44A 3D5LA 3AL0C 1WJEA 3QYFA 2MC4A 4HSRA 3K4KA 2F4IA 2W00A 4PSXA 4HG2A 2LBFB 2HPIA 2F6CA 2VJJA 2VJIA 3OL4A 4BGDA 1MMGA 3FBNB 4NUBA 4IX7A 2X1CA 3H35A 3DQVC 3GBGA 2ZSIB 4ZYAA 4CCNA 2K5CA 2ZFUA 2VKDA 1WJAA 3CZ6A 4Y4RA 1LDKB 2AQFA 4IKFA 3G2BA 3VSLA 3HOSA 1G8XA 2L5QA 2CUZA 3A4CA 2V26A 1UELB 3H9QA 1SAUA 1OR7C 2GOMA 3EUHC 1MW7A 3U21A 2MABA 2KZVA 1UAAA 2PJRB 3HC7A 3K4LA 3TBIA 3SEZA 1V5EA 1DQUA 1P9QC 2VQGA 2DOAA 2KPMA 3SZGA 2HQAA 3HL2A 4OAYA 2X85A 4XOPA 2CFOA 2R7TA 4R79A 3OYDA 3K70D 2R7QA 2WBMA 2X1EA 3AFHA 3VWBA 4BQQA 2VJ4A 4ITVA 3N05A 2IGKA 3HUGB 4PFOA 3OS0A 2DCEA 3VYRB 3HPGA 4F93B 3OYBA 2R4GA 1VZ0A 2E1MC 2VL8A 4DOZA 4JOMA 1IRXA 1HA8A 4OAZA 3W2WA 3K4MA 3BLYA 3UNGC 3I9V2 4B48A 4XN3A 1Y56A 3DPLC 5CKTA 3SDBA 3QOEA 3J7AY 2HDWA 4F3QA 1X19A 4FETA 2X1DA 4DIQA 2GOXB 2LREA 5FRNA 2CMPA 2LG4A 2IGNA 3LMMA 4KITB 2E1MB 4AYBA 4BL0B 4E7IA 2Y0SA 3PFYA 2VASA 2XC7A 1JI8A 4E7JA 3F9KA 4E7LA 1X1AA 2P0WA 4B47A 2DT7B 3A2KA 4XQFA 2UWMA 4ZDOA 2HU9A 3DKXA 3FDYA 4U7BA 1ERDA 3FBIB 4BACA 1MNEA 4PK4A 2L2OA 4BE2A 4NNJA 3ZGKA 2WB1A 4CSWA 4N4OB 5HOOA 5CQEA 3W2AA 1BR1A 4G6TB 2OUMA 2BVMA 4DJAA 3RSNA 4DBRA 4YRVA 4BDYA 2DXIA 3BG6A 4CCKA 4XMYA 4IQ4A 4BEHA 1QHHD 2XDVA 2M4GA 1LVKA 2Q1ZB 3W3CA 2CV0A 2VKHA 4RM3A 2WA0A 4F92B 1ZELA 4PFPA 3CP2A 2KMUA 2RQQA 3KEYA 2IS6A 4PJLA 4J01A 2BW3A 4QPQA 4E7HA 5FRMA 4IZZA 4J00A 2LY2A 3ZQQA 3LSGA 4HEA2 3ZRGA 3OY9A 3AKZA 4XM3A 3IP4B 4KJZA 2Z1DA 2LYCA 4MLOA 4BS9A 4D9JA 4F91B 3H5RA 4CUGA 2CV2A 2R7WA 1N78A 3ONQA 3OMYA 4HSTA 2W4SA 1NG6A 3BC8A 1T95A 2VQCA 4X0GA 3OYGA 3S3NA 5HNFA 3OYNA 4XLEA 3RPUD 2W1OA 1DGRM 4JQFA 4LITA 4E7SA 1W36C 2QKLB 1MMDA 3L2RA 2NOJB 3EPZA 5LFAA 3HKZA 1Z3YA 4E4HA 4BQNA 4PJNA 4U87A 1X4PA 3DTEA 2ZSHB 3HG9A 5KCMA 1LFPA 4OWRB 3PL8A 4HPQA 3AL0B 3KX2A 1YX5A 4II2A 1PYVA 1UG0A 3CJQB 2Z16A 2DT6A 4XLHA 3PSFA 4Y3OA 3DU6A 5HVQC 4ZDPA 2LOOA 3OYEA 3FHNA 2KL4A 3L2UA 2WAQA 1D1CA 2MD0A 2IGMA 2LRDA 2HPMA 2K3PA 3MKWB 2V9KA 2E5ZA 4BU2A 3H5NA 1N77A 2O5RA 2IXSA 1D1AA 2ELJA 3H0DA 3DKYA 2W7NA 3DTKA 3K4NA 4XNFA 4PUSA 2L9SA 2KP6A 1MMNA 4CA0A 3S3OA 4KT6A 2LC2A 3MKZA 3OR2C 3OYHA 1WJDA 4XN0A 1EA3A 4ZJZA 2KDOA 5KNLA 1R6RA 4ZTJA 4C2TA 3E0JB 4ANJA 1S9HA 2I8DA 2JVGA 2HVSA 2CW7A 3CP8A 3DLAA 4P5OA 1T0FC 4E7ZA 5HLTA 3OYLA 2KRHA 1X1BA 2IGOA 3OS1A 1QHGA 2UV1A 3D5RC 2K9MA 2L7KA 2XF6A 3K4CA 1AA7A 4YEJA 3TL4X 1KONA 3PNVA 2M4KA 3HXLA 4XOTA 2LBFA 2JVHA 4CH7A 4FASD 4BE0A 4BUPA 4C9YA 3FKJA 2XSJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPZ A; 
#chains in the Genus database with same CATH topology
 1WVR A;  3OYJ A;  2MW8 A;  3GFL A;  2QBY B;  1BW5 A;  4CCO A;  1JGS A;  1MH3 A;  1BR2 A;  3I59 B;  4NDL A;  3FXU A;  5D8K B;  2X6W A;  1ZK8 A;  4BQO A;  4RLF A;  1TWC J;  4A12 A;  1R4N B;  4BHB A;  4II3 A;  4N9H A;  2E60 A;  2CRG A;  1D1B A;  5DD4 A;  5EJC A;  3V8L A;  2XAJ A;  1BJA A;  3NWS A;  3SFI A;  3K2Z A;  3CC7 I;  3DP7 A;  5FJ8 J;  2DA3 A;  2GBY A;  1VQ4 I;  4OIO F;  2ELH A;  2A05 A;  4E6K G;  3CC4 I;  3A02 A;  4NQW B;  3LSH A;  4RMN A;  2JA5 J;  3ABT A;  1Z3X A;  3F8B A;  3NQO A;  2EBI A;  4IRG A;  3Q9S A;  5FFX A;  2DW4 A;  1YFH A;  1NK3 P;  3LSK A;  4GYI A;  4Q4Z F;  3S1R J;  1GT0 C;  1WFX A;  3CDH A;  2OC6 A;  3JRI A;  1Z7L A;  3C2G A;  2K40 A;  3E5U A;  3K4B A;  4RAG A;  2KQR A;  4Y33 A;  3VDX A;  2H8R A;  4JK1 X;  4IHV A;  1X58 A;  4NC8 A;  1O7L A;  1R36 A;  1UJ8 A;  1FOY A;  4OIN F;  2MFZ A;  1WH5 A;  2V1D A;  1ZQ3 P;  1MZB A;  2BE5 F;  2LTP A;  1ON1 A;  2EFN A;  3TED A;  4GRI A;  3BOQ A;  3S8P A;  3MFK A;  2L4M A;  3L7W A;  2BY2 A;  1JE8 A;  1JTY A;  2RDP A;  3EET A;  1TBX A;  1R5I D;  3K7A J;  5J47 A;  1B8I B;  2CQQ A;  2EZI A;  1YJN I;  2PMZ A;  2R5Y B;  4XRM A;  5C44 J;  2M30 A;  1Z77 A;  1XTA A;  4G9Y A;  2M1B A;  2RNJ A;  1MJA A;  3G1M A;  4KA4 A;  3GFJ A;  3PNY A;  1HDP A;  1U5T A;  3WTV C;  2CGP A;  2A61 A;  5HOD A;  2VT2 A;  2EZK A;  2JPB A;  3IKV A;  1XMK A;  4A3D J;  1IXR C;  4BJ5 C;  4EEF G;  1K6Y A;  4D1Q A;  2W24 A;  3P9C A;  2FOW A;  2X51 A;  1G3Y A;  2HEO A;  2VBX A;  3C2H A;  2JSP A;  2WAE A;  2Y0S N;  3JRE A;  1YIO A;  2QUF A;  2DOD A;  2R7U A;  3KLO A;  1TZL A;  2PG4 A;  5TRD A;  1JXS A;  2PN6 A;  3LSR A;  2GAU A;  2ID6 A;  2KIS A;  2V9V A;  2BHZ A;  2QQA A;  4A3F J;  2HNH A;  3ZQG A;  3DPU A;  3J7A O;  2X6Y A;  1T39 A;  4IL6 C;  3B6C A;  1IV6 A;  3NWT A;  2CUF A;  5D6F A;  2CH0 A;  3QQA A;  4ZDL A;  5A2Q Z;  4BXX J;  3BR3 A;  1V55 H;  3BZC A;  2JA2 A;  4GGG A;  2HTJ A;  1RKW A;  1QVU A;  2M0M A;  3ZMZ A;  1Y6I A;  4RGX A;  3KP5 A;  5GTI C;  2FE3 A;  3PQJ A;  2GIZ A;  2E5N A;  5F6F A;  3KP7 A;  5H6Q A;  4B43 A;  2QYO A;  4ZTF A;  2OJE D;  4CCJ A;  2XAF A;  3I58 A;  1ODD A;  1ULY A;  3CJR B;  4K2E A;  1D8K A;  2V1N A;  4HQM A;  3HIF A;  1JT0 A;  4I2O A;  4RAZ A;  1TT5 B;  2XVC A;  3OIQ A;  4BKX A;  2R7R A;  2WY8 Q;  3ZR8 X;  2HQ5 A;  4IHW A;  1D0Y A;  1USS A;  1IDZ A;  5CVJ A;  1Q1V A;  5GAE J;  5FKM A;  5J1R A;  3M8F A;  3QYB A;  4IVN A;  4DYC A;  4AVZ A;  1CGP A;  4BJ6 C;  1D8J A;  3K1P A;  4A3K J;  2FQ4 A;  4MFD A;  3ROU A;  2WTE A;  3H5A A;  3LFU A;  2VXZ A;  3ZMD A;  4BHC A;  2QLZ A;  4RGU A;  4RGS A;  3EUA A;  1FJL A;  2HVR A;  2L7Z A;  1S3J A;  2ZME A;  3JW4 A;  4F7Z A;  1U8B A;  4UNO A;  1JKP C;  1IAW A;  1E2X A;  3IRR A;  5FLV A;  4XKB A;  1HQC A;  1B9N A;  3V7C A;  1IF1 A;  3GZN B;  2DTR A;  3K6G A;  1H89 C;  4Y13 A;  1FTT A;  3K1N A;  2OCE A;  3TO9 A;  3S2D J;  1SFX A;  4GYG A;  4UUT A;  3WE3 A;  1YG2 A;  2ZJP F;  4HLY A;  2VXD A;  3PUB A;  2DJI A;  1T33 A;  5FRO A;  3CDI A;  4XSX F;  5DYM A;  3JAM K;  2AQE A;  3D0S A;  5GTH C;  1BJZ A;  2DI3 A;  5KHD A;  2V4J C;  3HOT A;  1B72 B;  4XR6 A;  4ENJ A;  3D5S C;  1A31 A;  3M3Y J;  3DEE A;  4D7N A;  3M8J A;  2X9D A;  2HKO A;  4XL9 A;  1QNT A;  1JUS A;  1FSH A;  3I3L A;  2A69 F;  4OMY A;  1DUX C;  1MND A;  2LH9 A;  3JTH A;  5E1X A;  2WAD A;  2QKM B;  5IYB J;  2EQR A;  1HOM A;  1MBG A;  3D5L A;  1WJE A;  1YS7 A;  2W00 A;  3CCV I;  2LBF B;  2HPI A;  2VJI A;  3OL4 A;  4BGD A;  5LRR A;  5H2F C;  3ECO A;  3CCJ I;  3L00 A;  2E34 A;  5IT3 A;  1U3E M;  1R1V A;  3ELK A;  5BS6 A;  1I6H J;  1WJA A;  4Y4R A;  4IKF A;  3LST A;  1G8X A;  4IXA A;  1YS6 A;  4PJ0 C;  1A04 A;  3QU3 A;  2CUZ A;  2V26 A;  1SAU A;  1OR7 C;  1MW7 A;  5K7H A;  3M4O J;  2QCO A;  5ICF A;  5E3M A;  2KZV A;  3TDZ C;  2H1L A;  3K4L A;  3JRA A;  4A3J J;  1BOA A;  5GP9 A;  1HF0 A;  4FIS A;  3CMA I;  5L3D A;  4IOC F;  3BDD A;  4HZF A;  3SZG A;  1EH6 A;  1UHS A;  4WK8 F;  4KMF A;  3GTL J;  5LBQ A;  1EH8 A;  4XOP A;  2YU9 J;  1LVA A;  3QP5 A;  3JRF A;  2W25 A;  5DUI A;  2X1E A;  4I7H A;  1TQM A;  2JPC A;  3HUG B;  5K5R A;  1JHH A;  3B02 A;  3VYR B;  3HPG A;  4F93 B;  1WWX A;  2VPR A;  1G4D A;  1FYL A;  4DOZ A;  1F5T A;  4YIF A;  1ETW A;  2EWN A;  3TW7 A;  2P81 A;  1ZKG A;  2F2E A;  1LFB A;  2JTV A;  4OAZ A;  4KYW A;  1HA8 A;  2ECB A;  3K4M A;  3BLY A;  3UNG C;  2ISY A;  2DK5 A;  4B48 A;  4M3B A;  4XN3 A;  2XAH A;  3DPL C;  3FK6 A;  2X4H A;  4KIF A;  3ZQC A;  2K9N A;  3JRD A;  3MZH A;  1R71 A;  4KIB A;  1T98 A;  4JX5 A;  4DIQ A;  3I53 A;  2WWY A;  5FRN A;  2Y0M A;  2JZY A;  2IGN A;  2LG4 A;  1MKM A;  4M3D A;  4Y15 A;  3PFY A;  2VAS A;  1SFO J;  4YG2 F;  2XC7 A;  4E7J A;  3E6D A;  3AG1 H;  3F9K A;  3GZ6 A;  1BIA A;  3A2K A;  1U8R A;  4XQF A;  2AS5 F;  2HU9 A;  3DBR B;  5FD5 A;  3I4M J;  4WF2 A;  2E36 A;  3KEO A;  3FDY A;  1LEB A;  3F8F A;  1MNE A;  2R3S A;  1KQ8 A;  4BE2 A;  2EFP A;  1X3Z B;  3O3K A;  1P4W A;  5CQE A;  2DQL A;  2FRH A;  3W2A A;  1D3Y A;  2M0C A;  4XRS A;  4MGR A;  5FGM A;  4YRV A;  2DXI A;  1DPR A;  4BEH A;  2XDV A;  4RAF A;  4X6A J;  2LF8 A;  1WKM A;  2CV0 A;  2WA0 A;  3H92 A;  1ZGA A;  5LGU A;  4S04 A;  4M3G A;  3J80 Z;  1FNN A;  2XHK A;  5FLX Z;  3I56 I;  1VQ7 I;  4KDP A;  5E20 A;  4A5N A;  1XDS A;  1BC8 C;  3CUQ B;  5C4X J;  4LK1 F;  4BQQ A;  2A68 F;  1JT6 A;  2UZK A;  1HSJ A;  1W4M A;  1W1W E;  3C2B A;  3JSO A;  5DCM B;  4IZZ A;  1PUF B;  1UHM A;  1MNM C;  3GUD A;  2LY2 A;  3U1K A;  4AWX B;  2HQR A;  5D5U B;  3LSG A;  3ZRG A;  3OY9 A;  1XDU A;  1ZAO A;  1O3R A;  2XAS A;  1NH3 A;  2Z1D A;  4V19 K;  1QVT A;  1W7P B;  4EQQ A;  2H94 A;  1GV5 A;  2F4O B;  4JYK A;  3H5R A;  4O5V A;  4ESB A;  4FTH A;  2O0Y A;  2DK8 A;  5KAF C;  4H0E A;  2CV2 A;  2CQK A;  2LP0 A;  1PVE A;  3NRV A;  1GXP A;  2F4M B;  3BC8 A;  2VQC A;  5HNF A;  3OYN A;  2LD5 A;  2W1O A;  1DGR M;  3CCY A;  4JQF A;  3EDP A;  4LIT A;  3WTW C;  1MMD A;  3L2R A;  4L9T A;  3KFW X;  3O8G A;  4XRF A;  4QIW N;  1EV7 A;  4BQN A;  2G7U A;  2HS5 A;  3GCM A;  1A6I A;  3W6J B;  3DTE A;  3HG9 A;  3QPS A;  1IO2 A;  3AL0 B;  1YX5 A;  4ASN A;  1ZR2 A;  1XMX A;  2XPU A;  1O3S A;  3JRG A;  1MDM A;  2OTJ I;  4GXO A;  1IG7 A;  2B7E A;  2HOE A;  4Q48 A;  3PIP F;  4BBS J;  4Y3O A;  1GXQ A;  3DU6 A;  5FKO A;  2DA1 A;  3RJP A;  3LAJ A;  3TW6 A;  1T8I A;  2LVS A;  4WCG A;  3L2U A;  2MD0 A;  2EV0 A;  3TOA A;  4A6E A;  3F22 A;  3BP8 A;  2LRD A;  2HYJ A;  1M1E B;  1IN8 A;  4BU2 A;  1P92 A;  4I98 B;  5CVI A;  5LLQ A;  2ZJR F;  1D1A A;  1FT9 A;  2ELJ A;  2NNN A;  2V79 A;  5EDN A;  1J5Y A;  4GFB A;  1QZZ A;  2K85 A;  2L3D A;  2ZC2 A;  5IOY A;  4KIC A;  4HA8 A;  2R93 J;  3BG9 A;  2KP6 A;  1MMN A;  1ZGW A;  1JKQ C;  2RAE A;  2M87 A;  4L0Z B;  3S16 J;  1Y1V J;  3BTL A;  5LEJ A;  1WJD A;  2EV6 A;  3S2H J;  4C2T A;  4I99 C;  4ZTJ A;  1A6Q A;  3ABM H;  4ANJ A;  2EFQ A;  2HVS A;  1Z0X A;  3I55 I;  3L9F A;  2XAG A;  3DLA A;  1MBF A;  2BZT A;  1MJB A;  1P2F A;  1T0F C;  2IEK A;  4G7H F;  3LQQ A;  3CLO A;  4KN4 X;  5HLT A;  2VE9 A;  2DYR H;  2KRH A;  3P9K A;  4BNC A;  3LA2 A;  1OCT C;  2MLG A;  1EH7 A;  2XF6 A;  2XV4 S;  4AUX A;  1PP7 U;  1B6A A;  1KU7 A;  4M71 A;  1S72 I;  5J3L A;  3DBL B;  4AIH A;  1KON A;  3HXL A;  4RGR A;  3GW2 A;  3Q0V A;  4XID A;  1XPX A;  1BI2 A;  4LG0 B;  1FWZ A;  2HQN A;  1X2M A;  4C9Y A;  2XGD A;  3FKJ A;  1ZG3 A;  2F5E A;  2XSJ C;  2RV8 A;  2M45 A;  1POG A;  1VI0 A;  2OV7 A;  1FTZ A;  2XB5 A;  3CES A;  5EEA A;  3ZN1 A;  1S7O A;  1BIB A;  2E2H J;  3A0B C;  2L9N A;  3DWL E;  4KMU X;  3ZCO A;  2O8K A;  1HC8 A;  1J9I A;  3ZXS A;  2PJR A;  4FX4 A;  4IHS A;  2PFB A;  4EJW A;  1G3S A;  4XKC A;  3E97 A;  3E6C C;  5KVR A;  4WWC A;  2DA2 A;  2MLK A;  1ZLK A;  2NXN B;  3DPT A;  4YFK F;  4CDG A;  4M6Y A;  1KYZ A;  4BXF A;  3CCS I;  2IS2 A;  3KIO A;  1DU0 A;  3IAM 2;  2L0K A;  3KYD B;  5J6X A;  3ZMU A;  3VSK A;  3KZI C;  5IYC J;  3CMM A;  3IAS 2;  1YHQ I;  2VI6 A;  3SZP A;  1SAX A;  2DQR A;  3BG3 A;  1J59 A;  2QSG X;  5DCF A;  3WG7 H;  2EZH A;  5ICE A;  3OR1 C;  1LB2 A;  1KU9 A;  4DYQ A;  1YO5 C;  1BM9 A;  4UHT A;  4G7Z F;  2ETH A;  4XBF A;  2A5W A;  3UR3 C;  3V7S A;  2YPR A;  5JVT A;  3IH3 A;  1PDN C;  1J2X A;  3BJ6 A;  1VQP I;  3SHF A;  4JX4 A;  5DS9 A;  2VBZ A;  1Z1D A;  4CO8 A;  4ZYG A;  3L2C A;  2MYS A;  5EZH A;  3IC7 A;  3K70 C;  1WZ2 A;  3TO7 A;  4IOA F;  1R4M B;  1ORK A;  4B3A A;  2GXB A;  3ZOB A;  4RM2 A;  2YX4 A;  3CLQ A;  4AM3 A;  3EUK L;  3QP6 A;  4ZYE A;  1JTX A;  4HNU A;  2JN6 A;  2L9V A;  1N75 A;  3G3Z A;  5E8G A;  3OYF A;  3RDI A;  4A0Z A;  3LL7 A;  1OMI A;  1HKS A;  2XF7 A;  4O3M A;  4Z2Y A;  1K78 B;  4EM2 A;  2IBD A;  2H09 A;  4IHY A;  4A3I J;  3F6V A;  2GWR A;  1J09 A;  3OOP A;  1BN5 A;  5LHG A;  2VN2 A;  2O8X A;  2ZXI A;  4A69 C;  2K3F A;  2DU9 A;  3LAP A;  5CYV A;  2BW3 B;  3BCB A;  5C3E J;  2BXY A;  1BL0 A;  2R92 J;  3CCE I;  5M3F J;  1IJW C;  3ERM A;  1U2W A;  4OMZ A;  2VLA A;  2GA1 A;  3GTK J;  1UCR A;  1X4O A;  5TJJ A;  2EH3 A;  1O7F A;  1YQA A;  3W2V A;  2XGE A;  2Y48 A;  3MVP A;  3MZ8 A;  1FMV A;  3HM5 A;  2LKX A;  1TT0 A;  1OCR H;  1X1C A;  3ML6 A;  5IP7 J;  2O6G E;  2RGV A;  3E1S A;  4U7D A;  4ZH4 F;  1BC7 C;  1SD7 A;  5LRS A;  5DUK A;  3CF2 A;  1DDN A;  1IRZ A;  1FMW A;  2ZJQ F;  3PJR A;  3GYH X;  2DA4 A;  3SXY A;  9ANT A;  3FXO A;  5GPC A;  1U5T C;  1P7I A;  2EA4 A;  1FYK A;  2F5F A;  3I54 A;  1RET A;  4A6D A;  4D7M A;  1DP3 A;  1ON2 A;  4BDZ A;  2OQG A;  4FCY A;  2XGC A;  4UUS A;  4A3E J;  1LPQ A;  4U0Y A;  1LEA A;  2MH9 A;  3ZP5 A;  2XPV A;  5JHF A;  2KDZ A;  3FXK A;  4KN7 X;  4UB6 C;  1EKE A;  2M8E A;  5CQG A;  1KGS A;  3BG7 A;  3H36 A;  4CCM A;  5JHU A;  1R9T J;  2M3A A;  5E3N A;  2DMT A;  1RUN A;  1VND A;  2RRE A;  4XKW A;  2FBH A;  1QA6 A;  3FKI J;  3BR1 A;  5FKL A;  2ZXH A;  1UB9 A;  4XKV A;  3R61 A;  4MHG A;  1P4X A;  4AU7 A;  2KIF A;  3I64 A;  2KRF A;  1BR4 A;  1IDY A;  3MMY B;  2ESH A;  1G59 A;  4A3C J;  3Q0W A;  2VQH A;  5B1A H;  3FMS A;  2ZJ2 A;  3HPH A;  3RCO A;  3CF5 F;  3GTJ J;  1YW8 A;  3PSI A;  3BJA A;  4JX6 A;  1CF7 A;  3EUH A;  4OIQ F;  1K7A A;  1TNS A;  2LNB A;  4YFX F;  3A0H C;  4RLQ A;  2JA7 J;  2QZ8 A;  2IA0 A;  3JRH A;  1U0J A;  3PIO F;  1Y8R B;  2A6E F;  4HAM A;  2LKS A;  2HOS A;  2CW8 A;  4BY7 J;  4MIM A;  3LWF A;  3V7R A;  4YIR X;  3OL3 A;  1E3P A;  3HHH A;  4HV5 A;  3DTI A;  2G0E A;  2CUE A;  3M07 A;  4BXU A;  1WJ5 A;  1R49 A;  2MC3 A;  2PBI A;  4A93 J;  3E7L A;  1LDD A;  2KHM A;  2L4A A;  2R7S A;  1O3T A;  2GZW A;  2BOL A;  2JMW A;  1KZH A;  4P1W A;  2VC0 A;  1KU2 A;  4PJM A;  5E1Z B;  2D1H A;  4HX4 A;  3QYF A;  3PM1 A;  4JP0 A;  3K4K A;  2F4I A;  5EG0 A;  3HRT A;  1TWH J;  2GQQ A;  3JAM Z;  2X1C A;  1RRJ A;  3M1E A;  4ZYA A;  3O2P E;  4P9U A;  1QPI A;  2K5C A;  1BA5 A;  2JRM A;  1OCZ H;  3CZ6 A;  1LDK B;  3G2B A;  3C3W A;  3GEZ A;  3E3V A;  5GPA A;  2L5Q A;  3I59 A;  1TC3 C;  2GOM A;  1BBY A;  2MD5 A;  3A01 A;  3GLL A;  4ZZD A;  4RB3 C;  4AIJ A;  3V8K A;  1DQU A;  2VKE A;  1H9G A;  1QRY A;  1JJ8 C;  3CJT B;  3HEF A;  1PP8 F;  1YLF A;  5BMZ A;  3Q3S A;  2EA2 A;  4HOB A;  2F5C A;  1DPU A;  2Y69 H;  3M9A A;  4IRI A;  4R79 A;  4OOI A;  3OYD A;  2R7Q A;  4RDU A;  3AFH A;  5F27 A;  4A3M J;  1XGN A;  2VJ4 A;  4UVC A;  2DA6 A;  1FEX A;  3SZT A;  3OYB A;  1LQ1 A;  2R4G A;  1JGG A;  3HHG A;  1D5Y A;  2E1M C;  2ZBK A;  2DBB A;  4EJO A;  4CYC B;  1R1U A;  2L7F P;  2P5V A;  2PX9 A;  4LLG F;  4IPA A;  4EJV A;  1FOX A;  2W57 A;  3KET A;  4L9V A;  1FSE A;  3I9V 2;  2XGX A;  4Z6Y A;  1IXC A;  3VB2 A;  3S1Q J;  4Y52 J;  2QF7 A;  4F3Q A;  2PI0 A;  1MBK A;  4LJZ F;  5E8I A;  2HR3 A;  3HRM A;  4KIT B;  1HKT A;  2E1M B;  1E3H A;  2Y0S A;  3BRO A;  4E7L A;  5HS8 A;  2DOF A;  2DT7 B;  3U1D A;  1Z6R A;  2UWM A;  2HDD A;  4L5I A;  4ZDO A;  3WU1 B;  2MA3 A;  2R5Y A;  3DKW A;  3IH4 A;  3N97 A;  1ERD A;  4Y7N J;  2Q8K A;  1BI1 A;  2YX7 A;  4BAC A;  2E1C A;  2P7V B;  2L2O A;  4QSH A;  1T6S A;  1SFE A;  1XGM A;  2WB1 A;  4PGG A;  5LHH A;  2BBY A;  3WU2 C;  1FBU A;  1SD5 A;  1BR1 A;  4G6T B;  2V9P A;  4DJA A;  2QSH X;  3E6M A;  1LFU P;  5ILV A;  2NVT J;  3F8N A;  4BY1 J;  2ZO4 A;  4IQ4 A;  1QHH D;  2BYV E;  3BZ6 A;  1LVK A;  3W3C A;  4GDF A;  2EIJ H;  2D1V A;  2IPQ X;  4RM3 A;  1YJW I;  4M6V A;  3GTO J;  4I02 A;  3RKW A;  2NAZ A;  3BT9 A;  5H20 A;  3DEU A;  2KMU A;  3GME A;  1VQ6 I;  1ETX A;  2QEN A;  3HDD A;  3F21 A;  1REP C;  4HLX A;  4HEA 2;  4D5F A;  1IC8 A;  2YS9 A;  5FD6 A;  2RQP A;  3AKZ A;  1TP4 A;  4ENK A;  1F1Z A;  2FU4 A;  1R5G A;  3IP4 B;  5JR3 A;  4MLO A;  4BS9 A;  4D9J A;  4F91 B;  1K4T A;  1AHD P;  4M74 A;  2DPU A;  4IO9 F;  4WXH A;  2HOT A;  3I0T A;  3ONQ A;  2NS8 A;  2CG4 A;  4HST A;  5EYR A;  1T95 A;  3QAH A;  5L3E A;  2OPT A;  4E7S A;  1QQI A;  2KJC A;  1W7P D;  2NOJ B;  3EPZ A;  1Z3Y A;  2FML A;  2FMY A;  1MJ9 A;  4WX9 A;  5DM7 F;  4QTR A;  2JK3 A;  5JI6 A;  5KCM A;  1FIA A;  5J1Y A;  3RI4 A;  4HPQ A;  1H88 C;  1EJ9 A;  2ICW G;  1UG0 A;  3EYY A;  2VC1 A;  3BR5 A;  1BI0 A;  3VFZ A;  3ERE D;  2LF7 A;  3WGH A;  2MSY A;  2DMU A;  2A07 F;  2H6C A;  3F8M A;  3R4K A;  2ZFW A;  3D1N I;  3LNQ A;  1D1C A;  3DFG A;  4UVA A;  2IGM A;  2O61 A;  2K3P A;  2PMU A;  5D6E A;  3T5X A;  2E1N A;  3WTT C;  2IXS A;  3FM3 A;  2B63 J;  3H0D A;  4TV7 A;  2PQ8 A;  3DKY A;  2R5Z A;  3QPT A;  1OCP A;  4XNF A;  1YRN A;  4PUS A;  2L9S A;  1E17 A;  4M3E A;  4KT6 A;  2LC2 A;  3B6A A;  3AAF A;  3P5J A;  4R1H A;  3OYH A;  2KIM A;  1ZTR A;  2K86 A;  3L1P A;  4XN0 A;  2KDO A;  2P6T A;  1R00 A;  2KFD A;  4HX7 A;  2EIL H;  3G6E I;  1OCC H;  2XSD C;  3QPH A;  1IN7 A;  2CU7 A;  4EMS A;  4WXD A;  1R22 A;  3WTX C;  2OF7 A;  4HDU A;  1HCR A;  5HLG A;  2EK5 A;  4A0X A;  3HRS A;  3M8E A;  3ZQ7 A;  2HXO A;  2I10 A;  1TNT A;  2L7K A;  4DW6 A;  1AA7 A;  4AIK A;  4CYD A;  3J7Z I;  2A6H F;  3PNV A;  3TQN A;  4ETS A;  2ZCW A;  2LBF A;  2JVH A;  4FX0 A;  4FAS D;  1WH7 A;  1R23 A;  1HBX G;  2P8T A;  3MQ0 A;  1WI3 A;  2CQN A;  3HSE A;  3S17 J;  3G1O A;  2Y2Z A;  2HFH A;  3RYP A;  1OLT A;  3CO7 C;  3SYT A;  5F0F A;  5TGT A;  3FIW A;  3QOP A;  5LD2 C;  5F0C A;  1MDM B;  1YX3 A;  1UG2 A;  2R7X A;  1KYW A;  2EV5 A;  2V6E A;  4OIP F;  1FPQ A;  2CV1 A;  1OYY A;  1YOV B;  3M1C A;  3PFI A;  3V8J A;  4B09 A;  1I3A A;  2DFH A;  3H3Z A;  2DMQ A;  4KIS A;  4EVI A;  5KAI C;  2X0L A;  1QZY A;  2IS1 A;  1S7E A;  3MN2 A;  4A3B J;  1YYV A;  5B66 C;  2KJB A;  4I0B A;  2PJP A;  3H3V K;  1QGP A;  2E71 A;  3RQ4 A;  1W5S A;  3NEU A;  2DYS H;  5HLI A;  4LB6 B;  3VYT B;  3HSR A;  1Z91 A;  4BBR J;  2VIX A;  4DZJ A;  4E7K A;  1TQI A;  2BEO A;  3QOD A;  5D5V B;  1IGN A;  1V5F A;  1ZN2 A;  4IHT A;  4XLF A;  5L3B A;  2NOG A;  1HXD A;  3BR2 A;  4L0Y B;  2B0L A;  4WXC A;  2P7C B;  2W82 A;  2L01 A;  2JUC A;  4EM0 B;  3WTY C;  4MEX F;  2JUG A;  4V2F A;  5KK1 A;  1U6G A;  2R7O A;  4G94 A;  2AO9 A;  2HYG D;  1IRG A;  2Z2S B;  3VOE A;  3BZK A;  1JJ6 C;  2F5V A;  2FQ3 A;  3IKT A;  1Z7U A;  1WJC A;  2M34 A;  1P4A A;  3K0L A;  2PMH A;  1BW6 A;  3K10 A;  2BXZ A;  4RAY A;  4AVP A;  4M9X A;  2LMD A;  2M2E A;  1MBH A;  4HRI A;  3MWM A;  3L2W A;  3RKQ A;  1FOW A;  1IXS B;  3ULQ B;  4S0H B;  5D8L B;  1SVO A;  1VF9 A;  4BE1 A;  2XRL A;  4A3G J;  1FX7 A;  2XAQ A;  2V7F A;  1ACI A;  4L5J A;  1Z05 A;  2IRF G;  2H8W A;  3LSM A;  4MFE A;  4AYB N;  5F1R A;  1IUF A;  3T1B A;  1R7J A;  5J40 A;  4F55 A;  2JA6 J;  2O3F A;  1LUJ B;  1STZ A;  1W0U A;  2ME0 A;  1W36 D;  1UHW A;  2DTZ A;  3VYS B;  5JLW A;  3L2V A;  1QU3 A;  1K6O A;  3CUQ A;  6PAX A;  3I71 A;  4Q5S F;  2QM3 A;  5FB2 A;  5HDG A;  1XGS A;  4YEL A;  3OWT A;  3F8C A;  3FZV A;  1MMA A;  5DCM A;  3NAU A;  1GUU A;  4LG3 A;  1PUF A;  2GM4 A;  4QPO A;  3TOB A;  5D4S A;  2DOE A;  1VQ9 I;  1FY7 A;  5TIS C;  2QWW A;  3ECH A;  3H9G A;  3MD2 A;  2AXL A;  4NC7 A;  3RQI A;  4HF0 A;  3WE2 A;  2OCC H;  2OD5 A;  3W6V A;  2L02 A;  3R60 A;  1G2H A;  2CUJ A;  3MKY B;  3HGY A;  1QBJ A;  3ABL H;  4EV0 A;  1W7P A;  5L3G A;  1LKX A;  1ZYR F;  2EFW A;  3CQZ J;  5BQT A;  2B9S A;  4RB2 C;  1XG1 A;  4DGW B;  3CDL A;  4X1E A;  2KT0 A;  3ZMV A;  3ASO H;  1B9M A;  2M9H A;  1DGW Y;  1WJB A;  2E1O A;  4R8H A;  4AD9 A;  2W84 A;  5J8C A;  3S3M A;  1G6N A;  2XKP A;  1RKT A;  4CZC A;  3NAR A;  2HKX A;  2JT1 A;  2RKH A;  1ZH5 A;  3IRQ A;  5LGN A;  4BJT A;  3MKL A;  5M5Y J;  3WHB A;  3OSF A;  1RNL A;  3J81 K;  2AXT C;  1F4K A;  2VT3 A;  3V4G A;  1G3W A;  3G1L A;  5E1W A;  4G7O F;  2ISZ A;  3U9G A;  1ZHF A;  1T2K A;  2NVY J;  4I09 A;  2Y9Z A;  2JQ7 A;  5IT9 K;  2CW0 F;  2DFF A;  1C0W A;  4G6Q A;  3JR9 A;  4UY8 I;  3HKZ N;  1FC3 A;  3SEQ A;  2VON A;  3FIS A;  5JVG F;  1HST A;  5EEH A;  4XLA A;  1U9O A;  2LK2 A;  1FP1 D;  2XF5 A;  3WTU C;  4U0V A;  2C6Y A;  2Q2E B;  4MEY F;  3OIP A;  1YW7 A;  1A36 A;  1YE9 A;  1RC9 A;  2N8G A;  1XS9 A;  3OYK A;  1EF4 A;  2HZD A;  1PJR A;  3ZQI A;  2VPL A;  2CFX A;  2EIK H;  2WAQ N;  3FF5 A;  3KYL A;  2E7W A;  1S6L A;  2KLO A;  3GX4 X;  1HW1 A;  4XLC A;  4XIC A;  3OYI A;  2GXA A;  1QZE A;  2DFE A;  3IHU A;  2K9L A;  2KRC A;  2W85 A;  5B3S H;  4JBA A;  2XRN A;  2R7D A;  4DQ2 A;  5IOZ A;  4HW0 A;  2VUM J;  1U9N A;  4A3L J;  2MC4 A;  1XB4 A;  4LK0 F;  4M3F A;  3OV8 A;  4HG2 A;  4PSX A;  1IV8 A;  2DMP A;  2HI3 A;  2VJJ A;  2XUB A;  2FNP A;  1S29 A;  5FKK A;  5CVU A;  5M3M J;  3GBG A;  2ZSI B;  4ON0 A;  1VFC A;  3FX3 A;  4CCN A;  4GO1 A;  1NTC A;  2IP2 A;  2ZFU A;  1JHF A;  2VKD A;  2V1X A;  2AHQ A;  1S5L C;  2XIG A;  2AQF A;  5JFR A;  3VSL A;  1RI7 A;  3HOS A;  2WV1 A;  2ECC A;  1XD7 A;  3EUH C;  3U21 A;  1QPM A;  1OCO H;  4XK4 A;  1RPW A;  1PUE E;  3HC7 A;  5E18 F;  2H6B A;  4KT5 C;  3TBI A;  1JUP A;  1G3T A;  1V5E A;  4LLL A;  5M5W J;  2VQG A;  3BR0 A;  1IW7 F;  3DEW A;  2KPM A;  3HL2 A;  3DLL F;  3WTS C;  2K4J A;  2X85 A;  5EGO A;  1B59 A;  2CFO A;  1U78 A;  2R7T A;  2UXX A;  2WBM A;  3C1D A;  3VWB A;  3FMR A;  4ITV A;  1KA8 A;  2HWV A;  1ZRE A;  4ZYD A;  2DCE A;  1XN7 A;  4B4C A;  1VZ0 A;  4UB8 C;  1WHU A;  2VL8 A;  3E5Q A;  4JOM A;  3S15 J;  2DDA A;  2V6C A;  2YUS A;  3GVA A;  4OU0 A;  1I6X A;  3W2W A;  1GDT A;  4MO7 A;  4BAY A;  2DLL A;  2GA2 A;  1W0T A;  5FLM J;  5CKT A;  3QOE A;  3QRF F;  2HDW A;  1YJ9 I;  4FET A;  5AIQ A;  2X1D A;  3E5X A;  2LRE A;  3LA3 A;  2BY3 A;  3ABK H;  3LA7 A;  4MNU A;  4BL0 B;  4E7I A;  3ZMT A;  1X1A A;  1TQP A;  2P0W A;  3B73 A;  3BPX A;  5ILS A;  4BH9 A;  1ZRD A;  3KP3 A;  5D5X B;  4RBO A;  3DKX A;  5CLS A;  4I76 A;  3LSP A;  1U5T B;  4U7B A;  1LE8 A;  3FBI B;  5IP6 A;  4GCV A;  5BOX A;  1ZR4 A;  3OIO A;  4ZZL A;  3BWG A;  3GLX A;  5DV5 A;  3ISP A;  4FT8 A;  1R5H A;  4QWQ A;  2OUM A;  3RSN A;  3A01 B;  4DBR A;  4BDY A;  3BG6 A;  3HOU J;  3HTS B;  4XMY A;  2XRO A;  2M4G A;  1SD6 A;  2K02 A;  1AOY A;  1K78 A;  2NNY A;  2PMZ N;  3F0C A;  4PFP A;  2GLO A;  3FMQ A;  2P4W A;  3T8T A;  5DD8 A;  3G4S I;  1WGX A;  3KEY A;  1Z9C A;  2EJR A;  3ASN H;  5F64 A;  4FE7 A;  4G6D A;  4A0Y A;  2BW3 A;  1FBS A;  3CCR I;  4E7H A;  1L3L A;  5FRM A;  2F48 A;  3K2A A;  2OZ6 A;  3I4N J;  4M6X A;  1X2N A;  4J00 A;  1YIJ I;  1ETQ A;  3CCL I;  3RIR A;  3HJE A;  4LB5 A;  1AKH A;  4G12 A;  4IEJ A;  4XM3 A;  4KJZ A;  1RR7 A;  2LYC A;  3BTI A;  1XCV A;  2EZL A;  4DZP A;  2K7L A;  4C3H J;  1D5V A;  1TL8 A;  2RN7 A;  2FNA A;  2DPD A;  1N78 A;  5F1J A;  3CTA A;  3BQY A;  3CO6 C;  3MCZ A;  2ZME C;  4HQE A;  2RC4 A;  1NG6 A;  1HLV A;  2CSO A;  3S3N A;  2E2I J;  4KFC A;  4XLE A;  4IJA A;  3WOD F;  4FE4 A;  1OKR A;  5K5O A;  2VOD A;  4N9I A;  2ZB9 A;  5LFA A;  3BG5 A;  1W5C C;  2QBY A;  4PJN A;  4U87 A;  1X4P A;  2OZU A;  2ZSH B;  3R6S A;  1LFP A;  4OWR B;  1Y39 A;  1OFC X;  3KX2 A;  3TDU C;  1PYV A;  4ABZ A;  1OPC A;  4XLN F;  3REO A;  1H9T A;  3BY6 A;  2DT6 A;  2ZME B;  2JWT A;  3FXR A;  4RB1 A;  3SFZ A;  4A5M A;  3DF8 A;  5HVQ C;  5K5Q A;  4ENM A;  4ZDP A;  2JA8 J;  4E70 A;  3Q5F A;  2CWE A;  5E79 C;  1SVM A;  3FHN A;  1ZRF A;  2KL4 A;  3IL2 A;  4NQW A;  3CMY A;  5D4R A;  1XSV A;  5J4Y A;  3MKW B;  2GXG A;  2E5Z A;  4LLN A;  1N77 A;  2O5R A;  2W48 A;  2FJ1 A;  1KQ0 A;  5B5E C;  5D5W B;  3LFK A;  1CQT A;  3DTK A;  1TWG J;  1R58 A;  1I39 A;  2FSW A;  5DEQ A;  5EF6 A;  3S3O A;  1SMY F;  3MKZ A;  3OR2 C;  2VBW A;  1MBJ A;  3JRC A;  2WB1 N;  1EA3 A;  4ZJZ A;  5KNL A;  1R6R A;  2EIN H;  5E17 F;  2I8D A;  1B1B A;  2DDB A;  1WSU A;  3TGN A;  2DN0 A;  2CW7 A;  4P5O A;  3CCU I;  1J0R A;  3ZPL A;  5FFZ A;  2BY0 A;  5L3F A;  4E7Z A;  3KP4 A;  1VQL I;  1ITY A;  2DJN A;  3P9I A;  4RS8 A;  1N25 A;  1RZ4 A;  3A03 A;  3RPU A;  3RZD J;  3OYL A;  1X1B A;  2IGO A;  2LR8 A;  1QHG A;  3OS1 A;  2UV1 A;  3S14 J;  2LY9 A;  3D5R C;  4Q47 A;  4HV6 A;  1B8I A;  1Y0N A;  2K9M A;  1X3W B;  2WC2 A;  5ERI A;  1A5J A;  3TL4 X;  3OSG A;  2M4K A;  3QPL A;  4XOT A;  4CH7 A;  4BE0 A;  3KCC A;  2O9L A;  3H3U A;  2D45 A;  4BUP A;  1R1T A;  1AU7 A;  1MH4 A;  1Y8Q B;  5J8F A;  2H27 A;  4DBQ A;  2KIQ A;  1P6R A;  3KP6 A;  3UKG A;  3KLN A;  5JLX A;  4NB5 A;  4IQJ A;  3ZQH A;  3OYC A;  3HTU A;  2QQ8 A;  5ED4 A;  5M5X J;  3I4P A;  1OYI A;  3C18 A;  1ZLJ A;  2CS3 A;  5B1B H;  4HF1 A;  3V42 A;  2QVO A;  2NYX A;  1F9N A;  1XC5 A;  3O6B B;  3I5U A;  4M9Z A;  1YIT I;  2XB0 X;  4CIC A;  3GTP J;  3S1M J;  4BQA A;  2J5P A;  3BJO A;  1H0M A;  2PLY A;  3QYE A;  1LNW A;  5F08 A;  1UFM A;  3F23 A;  4EGY A;  3HOV J;  1SAN A;  5GAG J;  1HDD C;  3HOY J;  2HVQ A;  1FYM A;  4CGZ A;  2QSF X;  2WY7 Q;  3FXL A;  4XLP F;  4C2U A;  2R7Z J;  2ZXW H;  4FQG A;  1QO0 D;  3VOD A;  4MTE A;  3MAJ A;  1GVD A;  3X2Q H;  2Y9Y A;  3K9T A;  1RIO H;  2R5Z B;  3AG3 H;  2IT0 A;  3G71 I;  1YRN B;  4FHT A;  3QU6 A;  1VQ5 I;  3H9J A;  3WGG A;  3BCA A;  3PO2 J;  2OA4 A;  1X3U A;  3S32 A;  5IY5 H;  3OOU A;  3KZZ A;  4CYC A;  4P9F A;  1FP2 A;  2HTS A;  2XAU A;  5HS7 A;  1B4A A;  1O4X A;  1K83 J;  2ZNY A;  3TMO A;  4ZYH A;  1VQM I;  2A6T A;  2VQL A;  2QEX I;  3JCU C;  5HNH A;  3RYR A;  4EM1 A;  4UVB A;  2LFB A;  4EAT A;  4C30 A;  1V54 H;  4LD5 A;  4IF4 A;  2NS7 A;  2HXI A;  1JKO C;  5IYD J;  1IN5 A;  4HYE A;  2K4B A;  4ESJ A;  2Y75 A;  4J19 A;  5E3O A;  3OS2 A;  1FZP B;  1DU6 A;  3TP0 A;  5CVR A;  4B8X A;  1V5G A;  5C4J J;  1T56 A;  2MG4 A;  2QGU A;  2M7B A;  3HOW J;  2ZNZ A;  1FBQ A;  2X6X A;  3PNT A;  2E2J J;  2IW5 A;  3RKX A;  1YTY A;  4L9N A;  4HNV A;  3EQL F;  5A2Q K;  2BHY A;  4M72 A;  5CJ9 A;  1Z21 A;  4KUM A;  4LIV A;  5H6R A;  3OYA A;  1GHC A;  2TCT A;  2STT A;  1XCB A;  4XRS G;  2R7V A;  3CCM I;  4IRH A;  4XOR A;  3S93 A;  2OU2 A;  1J7K A;  5EZG A;  4BEH B;  2A5Y B;  2QQB A;  3JSP A;  5LHI A;  1I5Z A;  3A1Y A;  3KP2 A;  3CME I;  5AIP A;  3P7N A;  4I6Z A;  2COB A;  3G73 A;  4HNT A;  3GZ5 A;  1IUY A;  4CCL A;  4V2G A;  4B3X A;  1ONV A;  3JTG A;  1WPK A;  3GXO A;  1Y0U A;  4LIU A;  1SEU A;  2UXN A;  1ETY A;  3FXM A;  2VJ5 A;  2EPF A;  4F52 A;  2BY1 A;  1B72 A;  1V3F A;  3J7Y J;  2VB6 A;  3OYM A;  1RR8 C;  2LY1 A;  3VEP A;  2MH2 A;  4EJU A;  1UST A;  1MIJ A;  1I3Q J;  2ADU A;  3HGG A;  3HSF A;  4G8X A;  4P55 A;  1SFK A;  1ZGJ A;  3LSI A;  1KQ9 A;  2Z5U A;  1HW2 A;  2Z99 A;  1TWA J;  4PDK A;  3ABU A;  4W1U A;  3ZN0 A;  5IP9 J;  1E3O C;  1WJF A;  1SFU A;  4YFN F;  1I27 A;  3L09 A;  2FA5 A;  4MQ9 F;  4PJJ A;  2STW A;  4H4K C;  4C2M J;  1FOK A;  1NHA A;  3WGI A;  1X1D A;  2FUG 2;  1BOB A;  3F6O A;  5CPR B;  2FF4 A;  2BVL A;  1MBE A;  3COA C;  1XSX A;  3R0A A;  5BPI A;  1D0X A;  3WU0 A;  2DA7 A;  4UV9 A;  1BI3 A;  3FHZ A;  3O8H A;  2P5L C;  5ILU A;  2EFO A;  3RPQ A;  2PEX A;  1H8A C;  4N4N B;  3KPH A;  2XPW A;  2DAO A;  4RB0 A;  2NVQ J;  1LJ9 A;  2M7A A;  4XON A;  3HOZ J;  3GTG J;  1Y1W J;  3VYU B;  1GLN A;  2EIM H;  2DT5 A;  4S05 A;  3M7G A;  2X6O A;  3K4J A;  1KU3 A;  4W97 A;  1GV2 A;  2IAI A;  3JRB A;  3IH2 A;  1K79 A;  3CUQ C;  3K69 A;  4D5C A;  2M5W A;  3ZMS A;  2RVC A;  3RTR A;  1VQK I;  3KZY A;  2NVX J;  2Z9O A;  4L18 B;  3E6B A;  1FLI A;  2TRT A;  2YSR A;  1JKR C;  2CJJ A;  1ZRC A;  2ZKZ A;  2MBF A;  2RNG A;  4BHP A;  1OR7 A;  1D0Z A;  3QWL A;  4PZJ A;  1NG7 A;  1LDJ A;  2K27 A;  2X48 A;  4PSW A;  3HUG A;  5K7F A;  1K4S A;  1J75 A;  5F0H A;  1E0E A;  1XX5 A;  3KEQ A;  3DU5 A;  2P6S A;  2M8G X;  3MZY A;  4AID A;  1ETK A;  4ZC3 A;  4I0A A;  1UMQ A;  2IA1 A;  2OBP A;  1VQN I;  3L2Q A;  3HOX J;  3T8R A;  3J81 Z;  1SVL A;  1TW3 A;  1O3Q A;  5J4V A;  1WRJ A;  3IUO A;  5HLH A;  2FX0 A;  2G7H A;  1MMS A;  5IT9 Z;  4DNC A;  4KNY A;  4Y17 A;  4CHU A;  4HF2 A;  2UUZ A;  2WAF A;  1V4R A;  4D0P A;  1UZC A;  1NK2 P;  2K9Q A;  4PGH A;  4B44 A;  2IS4 A;  4NHJ A;  3AL0 C;  2IJL A;  4OIR F;  4HSR A;  1AWC A;  3GF2 A;  3DBH B;  3HRU A;  2F6C A;  5DDG A;  1MMG A;  3FBN B;  4NUB A;  4IX7 A;  3H35 A;  3DQV C;  2CQ7 A;  2E19 A;  4CZZ A;  1L0O C;  1K61 A;  4UUV A;  4LOC A;  1TWF J;  2NS0 A;  3CJN A;  1MSE C;  5HDN A;  3SDG A;  3H1C A;  1IRF A;  3A4C A;  1UEL B;  3H9Q A;  4LGW A;  1Q1H A;  2HYF A;  3AG2 H;  1VTN C;  2MAB A;  3T0Y A;  1UAA A;  2PJR B;  1APL C;  1XGO A;  1HKQ A;  2FXA A;  3SEZ A;  1P9Q C;  2DOA A;  1X1P A;  1SC7 A;  2D5V A;  2H1K A;  3HBL A;  2JJ7 A;  2HQA A;  3LQR A;  3IWZ A;  3TO6 A;  2IVM A;  5J1U A;  4OAY A;  3MEX A;  2ELK A;  2KIU A;  3FXQ A;  4EJT A;  3K70 D;  1W5T A;  5EEG A;  5ICC A;  1GVJ A;  1I1G A;  2J5O A;  1S7A A;  2MGQ A;  3FK7 A;  1TLH B;  4NC6 A;  1I50 J;  1WQ2 A;  3CUO A;  2IGK A;  3KYC B;  3N05 A;  4PFO A;  4UV8 A;  4BYY A;  3KE2 A;  5IPA A;  3OS0 A;  1RUO A;  3F3X A;  4N0B A;  1OYW A;  1OIS A;  4EGZ A;  2VOO A;  2Y30 A;  3WTZ A;  2YR2 A;  1IRX A;  2A3S A;  3DV8 A;  3VPR A;  4B1R A;  5FO5 A;  5LGT A;  4HBL A;  2DMN A;  5HS9 A;  3PO3 J;  1IZ1 A;  1Y56 A;  3GTQ J;  3SDB A;  2FEZ A;  3J7A Y;  1I1S A;  2I5U A;  3SQN A;  3WHC A;  1X19 A;  3BTJ A;  3S1N J;  2F5D A;  2GOX B;  1F43 A;  2Z3Y A;  2CMP A;  5LEK A;  3LMM A;  2OAZ A;  4NBQ A;  2JSC A;  2Z33 A;  4AYB A;  3J80 K;  2CQX A;  4ENN A;  5FLX K;  2GIV A;  1JI8 A;  1T38 A;  2ESN A;  2LSO A;  5FKN A;  4B47 A;  1IN6 A;  1MD0 A;  4P96 A;  2E35 A;  4IHX A;  2TDX A;  4HX8 A;  2NVU B;  2L7M P;  2ACJ A;  4PK4 A;  1O57 A;  2HZT A;  4O6J A;  1TW2 A;  2L54 A;  4NNJ A;  2KZG A;  2FD5 A;  3RKY A;  3ZGK A;  3H0G J;  4CSW A;  4N4O B;  5HOO A;  2WV0 A;  4PCQ A;  1TTY A;  4DYR A;  4HDV A;  5K1Y A;  2BVM A;  4CCK A;  4LMY A;  3FM5 A;  2CO5 A;  2Q1Z B;  2VKH A;  4F92 B;  1HW5 A;  1YW9 A;  1IN4 A;  2FBK A;  1ZEL A;  2EB7 A;  3CP2 A;  1Z67 A;  3CD6 I;  4U0W A;  4ESF A;  2RQQ A;  5EGO B;  1ZG1 A;  1XMA A;  3BTC A;  5L3C A;  2XKO A;  2IS6 A;  3BR6 A;  2D2W A;  2O7O A;  4PJL A;  4J01 A;  3FXJ A;  3S2W A;  1OQY A;  4QPQ A;  3LOC A;  5DM6 F;  2JRT A;  4L5E A;  1RES A;  2LDU A;  3ZQQ A;  4CXF A;  3GWZ A;  3Q9V A;  5AON A;  2YU3 A;  3HYI A;  4UXN A;  5K7Z A;  3GFI A;  2DO7 A;  3PUF A;  2OQR A;  4M73 A;  2R0Q C;  3ESW B;  3R0J A;  5BPD A;  4CUG A;  1FIP A;  3W6K B;  2QA4 I;  2R7W A;  2L9R A;  3OMY A;  1WCM J;  2W4S A;  3OYG A;  4X0G A;  2R7F A;  1XSD A;  2OTL I;  1T08 B;  4MQV A;  2VE8 A;  3RPU D;  5E3L A;  4C3I J;  4UUS B;  1W36 C;  2QKL B;  3HB9 A;  4LG0 A;  3IWF A;  4MTD A;  3HKZ A;  1T0F A;  4E4H A;  2ZXJ A;  3IV5 A;  5F04 A;  3TKY A;  1A35 A;  3AG4 H;  3PL8 A;  5ICG A;  1VQO I;  4II2 A;  2E7X A;  5DTD A;  2CYY A;  1LE8 B;  3CJQ B;  1ZAR A;  3F72 A;  4KIG A;  2Z16 A;  1ETO A;  4LFU A;  4XSZ F;  2FOK A;  3ZQL A;  2FBI A;  1OJL A;  2HGC A;  3BQZ A;  3PSF A;  4M9S A;  4XLH A;  3WG9 A;  1WI9 A;  3OYE A;  2LOO A;  1ENH A;  4RA2 A;  2WAQ A;  2ID3 A;  2VOP A;  2G9W A;  2HPM A;  3GFM A;  3CC2 I;  5BNG A;  3CCQ I;  1CF7 B;  2BV6 A;  2V9K A;  2V1U A;  3H5N A;  1P7J A;  2LKP A;  1F36 A;  3TP3 A;  3RZO J;  1MSF C;  2DA5 A;  2ME6 A;  2VKV A;  2W7N A;  3K4N A;  1SMT A;  2KKO A;  3LSJ A;  4CA0 A;  3HZJ A;  2Q2E A;  2COM A;  2Q0O A;  1S8N A;  4C3J J;  4QLC U;  1YI2 I;  2HOA A;  3ZQF A;  5GAH J;  4I01 A;  2QQ9 A;  3DXJ F;  3DCF A;  3E0J B;  1S9H A;  1MGT A;  2O03 A;  1SD4 A;  1ZG5 A;  1JUM A;  2JVG A;  3CP8 A;  1AKH B;  1Z6T A;  2HDC A;  1ETV A;  3U2R A;  2IA2 A;  1VQ8 I;  3FWE A;  2LLK A;  4L9J A;  2K9S A;  4U88 A;  3C7J A;  3BPV A;  5EG0 B;  2NRA C;  4AC0 A;  3K4C A;  5GAD J;  3PQK A;  3SJM A;  3K1M A;  4YEJ A;  3GO5 A;  2DFI A;  2Y31 A;  3GTM J;  2BGC A;  3Q0U A;  1DP7 P;  4YII A;  4A2U A;  2P5K A;  5CVV A;  3N4M A;  5HDK A;  2VBY A;  3EYI A; 
#chains in the Genus database with same CATH homology
 3OYJ A;  4CCO A;  4DBQ A;  1BR2 A;  1OLT A;  2OV7 A;  4IQJ A;  2X6W A;  3OYC A;  3SYT A;  3CES A;  5TGT A;  4BQO A;  4RLF A;  5LD2 C;  2L9N A;  3DWL E;  3ZCO A;  1YX3 A;  2CS3 A;  2R7X A;  4II3 A;  3V42 A;  3ZXS A;  2V6E A;  2E60 A;  2PJR A;  1D1B A;  2CV1 A;  4XKC A;  3M1C A;  3NWS A;  3QYE A;  3DPT A;  4KIS A;  4E6K G;  4NQW B;  3LSH A;  4RMN A;  2IS1 A;  2HVQ A;  4BXF A;  1Z3X A;  2WY7 Q;  4C2U A;  2IS2 A;  3LSK A;  3RQ4 A;  1WFX A;  2OC6 A;  3IAM 2;  1Z7L A;  3C2G A;  3VSK A;  3VYT B;  3CMM A;  3IAS 2;  3K4B A;  4Y33 A;  2KQR A;  3VDX A;  2VIX A;  3H9J A;  3BCA A;  3QOD A;  4E7K A;  3S32 A;  3OOU A;  1V5F A;  4NC8 A;  2XAU A;  4XLF A;  2W82 A;  3TMO A;  3OR1 C;  2A6T A;  2MFZ A;  2VQL A;  5HNH A;  2JUG A;  4C30 A;  4EAT A;  2R7O A;  3UR3 C;  2A5W A;  2Z2S B;  4GRI A;  3S8P A;  2F5V A;  3OS2 A;  1WJC A;  2MYS A;  2PMZ A;  3K70 C;  1V5G A;  3K10 A;  2M7B A;  2X6X A;  3PNT A;  4HRI A;  4RM2 A;  3L2W A;  3PNY A;  3EUK L;  1Z21 A;  4BE1 A;  4HNU A;  4LIV A;  3OYA A;  1N75 A;  2R7V A;  2V7F A;  4BJ5 C;  1K6Y A;  4XOR A;  3OYF A;  3LL7 A;  4D1Q A;  3S93 A;  2X51 A;  4BEH B;  3LSM A;  2XF7 A;  2WAE A;  3C2H A;  2JSP A;  2R7U A;  3A1Y A;  4F55 A;  1TZL A;  1J09 A;  4HNT A;  4CCL A;  4B3X A;  2ZXI A;  3VYS B;  1W36 D;  3L2V A;  1QU3 A;  2HNH A;  3DPU A;  2X6Y A;  4LIU A;  2BW3 B;  3BCB A;  2VJ5 A;  3NWT A;  4F52 A;  2VB6 A;  2CH0 A;  3OYM A;  2LY1 A;  4ZDL A;  4YEL A;  3OWT A;  1MMA A;  2VLA A;  1X4O A;  4LG3 A;  2JA2 A;  4QPO A;  1SFK A;  2M0M A;  3W2V A;  1Y6I A;  1FMV A;  3LSI A;  1TT0 A;  1X1C A;  3H9G A;  3MD2 A;  4NC7 A;  3E1S A;  2CUJ A;  3MKY B;  1WJF A;  2E5N A;  4B43 A;  3CF2 A;  4PJJ A;  4ZTF A;  4H4K C;  1FMW A;  4CCJ A;  3PJR A;  1LKX A;  3CJR B;  1X1D A;  2FUG 2;  1BOB A;  5CPR B;  2V1N A;  2BVL A;  4DGW B;  1D0X A;  1DP3 A;  4BDZ A;  1DGW Y;  3OIQ A;  1WJB A;  2R7R A;  2WY8 Q;  4N4N B;  3ZR8 X;  1D0Y A;  5JHF A;  2M7A A;  3QYB A;  4XON A;  3S3M A;  4AVZ A;  4BJ6 C;  4CCM A;  5CQG A;  3VYU B;  4CZC A;  1GLN A;  3BG7 A;  2M3A A;  3K4J A;  3H5A A;  3LFU A;  2VXZ A;  4BJT A;  2RRE A;  2HVR A;  3EUA A;  4XKW A;  2ZXH A;  4XKV A;  3RTR A;  4AU7 A;  4XKB A;  1BR4 A;  3MMY B;  3K6G A;  1G59 A;  2VQH A;  3HPH A;  3SEQ A;  3RCO A;  3PSI A;  2RNG A;  4XLA A;  1D0Z A;  2VXD A;  3PUB A;  1NG7 A;  4RLQ A;  2DJI A;  4PSW A;  2XF5 A;  1E0E A;  5FRO A;  3DU5 A;  1U0J A;  2Q2E B;  2AQE A;  3OIP A;  5KHD A;  2V4J C;  4ZC3 A;  3HOT A;  4XR6 A;  2CW8 A;  3D5S C;  1YE9 A;  3DEE A;  3M8J A;  3L2Q A;  3OYK A;  2HZD A;  1PJR A;  3OL3 A;  4XL9 A;  2VPL A;  3DTI A;  3KYL A;  3IUO A;  1WJ5 A;  2KLO A;  3I3L A;  4XLC A;  3OYI A;  1MND A;  2KHM A;  2R7S A;  2LH9 A;  2K9L A;  2KRC A;  2UUZ A;  2WAF A;  2BOL A;  2WAD A;  4P1W A;  2QKM B;  4PJM A;  2IS4 A;  4B44 A;  3D5L A;  3AL0 C;  1WJE A;  3QYF A;  2MC4 A;  4HSR A;  3K4K A;  2F4I A;  2W00 A;  4PSX A;  4HG2 A;  2LBF B;  2HPI A;  2F6C A;  2VJJ A;  2VJI A;  3OL4 A;  4BGD A;  1MMG A;  3FBN B;  4NUB A;  4IX7 A;  2X1C A;  3H35 A;  3DQV C;  3GBG A;  2ZSI B;  4ZYA A;  4CCN A;  2K5C A;  2ZFU A;  2VKD A;  1WJA A;  3CZ6 A;  4Y4R A;  1LDK B;  2AQF A;  4IKF A;  3G2B A;  3VSL A;  3HOS A;  1G8X A;  2L5Q A;  2CUZ A;  3A4C A;  2V26 A;  1UEL B;  3H9Q A;  1SAU A;  1OR7 C;  2GOM A;  3EUH C;  1MW7 A;  3U21 A;  2MAB A;  2KZV A;  1UAA A;  2PJR B;  3HC7 A;  3K4L A;  3TBI A;  3SEZ A;  1V5E A;  1DQU A;  1P9Q C;  2VQG A;  2DOA A;  2KPM A;  3SZG A;  2HQA A;  3HL2 A;  4OAY A;  2X85 A;  4XOP A;  2CFO A;  2R7T A;  4R79 A;  3OYD A;  3K70 D;  2R7Q A;  2WBM A;  2X1E A;  3AFH A;  3VWB A;  4BQQ A;  2VJ4 A;  4ITV A;  3N05 A;  2IGK A;  3HUG B;  4PFO A;  3OS0 A;  2DCE A;  3VYR B;  3HPG A;  4F93 B;  3OYB A;  2R4G A;  1VZ0 A;  2E1M C;  2VL8 A;  4DOZ A;  4JOM A;  1IRX A;  1HA8 A;  4OAZ A;  3W2W A;  3K4M A;  3BLY A;  3UNG C;  3I9V 2;  4B48 A;  4XN3 A;  1Y56 A;  3DPL C;  5CKT A;  3SDB A;  3QOE A;  3J7A Y;  2HDW A;  4F3Q A;  1X19 A;  4FET A;  2X1D A;  4DIQ A;  2GOX B;  2LRE A;  5FRN A;  2CMP A;  2LG4 A;  2IGN A;  3LMM A;  4KIT B;  2E1M B;  4AYB A;  4BL0 B;  4E7I A;  2Y0S A;  3PFY A;  2VAS A;  2XC7 A;  1JI8 A;  4E7J A;  3F9K A;  4E7L A;  1X1A A;  2P0W A;  4B47 A;  2DT7 B;  3A2K A;  4XQF A;  2UWM A;  4ZDO A;  2HU9 A;  3DKX A;  3FDY A;  4U7B A;  1ERD A;  3FBI B;  4BAC A;  1MNE A;  4PK4 A;  2L2O A;  4BE2 A;  4NNJ A;  3ZGK A;  2WB1 A;  4CSW A;  4N4O B;  5HOO A;  5CQE A;  3W2A A;  1BR1 A;  4G6T B;  2OUM A;  2BVM A;  4DJA A;  3RSN A;  4DBR A;  4YRV A;  4BDY A;  2DXI A;  3BG6 A;  4CCK A;  4XMY A;  4IQ4 A;  4BEH A;  1QHH D;  2XDV A;  2M4G A;  1LVK A;  2Q1Z B;  3W3C A;  2CV0 A;  2VKH A;  4RM3 A;  2WA0 A;  4F92 B;  1ZEL A;  4PFP A;  3CP2 A;  2KMU A;  2RQQ A;  3KEY A;  2IS6 A;  4PJL A;  4J01 A;  2BW3 A;  4QPQ A;  4E7H A;  5FRM A;  4IZZ A;  4J00 A;  2LY2 A;  3ZQQ A;  3LSG A;  4HEA 2;  3ZRG A;  3OY9 A;  3AKZ A;  4XM3 A;  3IP4 B;  4KJZ A;  2Z1D A;  2LYC A;  4MLO A;  4BS9 A;  4D9J A;  4F91 B;  3H5R A;  4CUG A;  2CV2 A;  2R7W A;  1N78 A;  3ONQ A;  3OMY A;  4HST A;  2W4S A;  1NG6 A;  3BC8 A;  1T95 A;  2VQC A;  4X0G A;  3OYG A;  3S3N A;  5HNF A;  3OYN A;  4XLE A;  3RPU D;  2W1O A;  1DGR M;  4JQF A;  4LIT A;  4E7S A;  1W36 C;  2QKL B;  1MMD A;  3L2R A;  2NOJ B;  3EPZ A;  5LFA A;  3HKZ A;  1Z3Y A;  4E4H A;  4BQN A;  4PJN A;  4U87 A;  1X4P A;  3DTE A;  2ZSH B;  3HG9 A;  5KCM A;  1LFP A;  4OWR B;  3PL8 A;  4HPQ A;  3AL0 B;  3KX2 A;  1YX5 A;  4II2 A;  1PYV A;  1UG0 A;  3CJQ B;  2Z16 A;  2DT6 A;  4XLH A;  3PSF A;  4Y3O A;  3DU6 A;  5HVQ C;  4ZDP A;  2LOO A;  3OYE A;  3FHN A;  2KL4 A;  3L2U A;  2WAQ A;  1D1C A;  2MD0 A;  2IGM A;  2LRD A;  2HPM A;  2K3P A;  3MKW B;  2V9K A;  2E5Z A;  4BU2 A;  3H5N A;  1N77 A;  2O5R A;  2IXS A;  1D1A A;  2ELJ A;  3H0D A;  3DKY A;  2W7N A;  3DTK A;  3K4N A;  4XNF A;  4PUS A;  2L9S A;  2KP6 A;  1MMN A;  4CA0 A;  3S3O A;  4KT6 A;  2LC2 A;  3MKZ A;  3OR2 C;  3OYH A;  1WJD A;  4XN0 A;  1EA3 A;  4ZJZ A;  2KDO A;  5KNL A;  1R6R A;  4ZTJ A;  4C2T A;  3E0J B;  4ANJ A;  1S9H A;  2I8D A;  2JVG A;  2HVS A;  2CW7 A;  3CP8 A;  3DLA A;  4P5O A;  1T0F C;  4E7Z A;  5HLT A;  3OYL A;  2KRH A;  1X1B A;  2IGO A;  3OS1 A;  1QHG A;  2UV1 A;  3D5R C;  2K9M A;  2L7K A;  2XF6 A;  3K4C A;  1AA7 A;  4YEJ A;  3TL4 X;  1KON A;  3PNV A;  2M4K A;  3HXL A;  4XOT A;  2LBF A;  2JVH A;  4CH7 A;  4FAS D;  4BE0 A;  4BUP A;  4C9Y A;  3FKJ A;  2XSJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...