3EPZA

Structure of the replication foci-targeting sequence of human dna cytosine methyltransferase dnmt1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
250
structure length
227
Chain Sequence
GPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIPGGVNGKNLGPINEWWITGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDQPIFLTPCMRDLIKLAGVTLGQRRAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA (cytosine-5)-methyltransferase 1
publication title The replication focus targeting sequence (RFTS) domain is a DNA-competitive inhibitor of Dnmt1.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 227
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12047 DNMT1-RFD Cytosine specific DNA methyltransferase replication foci domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2230 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3epzA02
3EPZA
chains in the Genus database with same CATH superfamily
2PMZN 4IOCF 2EIKH 1HW5A 2M3AA 2XAGA 3OR2C 4M9ZA 2DMUA 4MTEA 3J7YJ 1ERDA 4CYDA 3CUOA 1USTA 4IQ4A 4ESBA 3DQVC 1L3LA 3KP2A 2YUSA 4U88A 3K4KA 5H6RA 4OU0A 3VODA 4YG2F 3DLLF 2D2WA 2X1EA 5B1BH 2NVXJ 3L2VA 3PQKA 1BL0A 4OAYA 2R7TA 4W97A 3K9TA 3K2ZA 4CYCA 2AO9A 4B1RA 3OYDA 2VN2A 4I0AA 5J8FA 2DFEA 2YX7A 4B8XA 2QEXI 2HEOA 3GFLA 1B59A 3HTUA 2M8EA 2QBYA 1NTCA 5J1UA 1LVKA 5EZHA 2X1DA 4CCLA 1YRNA 3CCSI 5FLXZ 1TW3A 2K4JA 2EZIA 4BUPA 2VONA 4EJTA 1S3JA 1P4WA 2RVCA 3ZQFA 1U9OA 3ZXSA 2IS1A 3WG9A 3DTEA 2R7ZJ 1DPRA 2LR8A 2JWTA 3CP8A 3GTKJ 3DCFA 3BG5A 3OMYA 4CCMA 1YYVA 2PFBA 2PMZA 5FKKA 3VOEA 1K61A 2FMYA 2IEKA 3CCUI 4IXAA 1V55H 2KHMA 3DEEA 3MN2A 3GX4X 5FB2A 1CGPA 4ZTJA 3BPXA 4JBAA 2WAFA 4Y15A 2O03A 3ZMDA 2LOOA 3WTVC 1DPUA 1D1AA 3U9GA 4ESJA 3MVPA 3FK6A 4EATA 2OQRA 3CUQC 1B9MA 3I59A 1OFCX 3DBRB 2VJ5A 4XSZF 3T8RA 4L0YB 4BJTA 4BBSJ 1N25A 1OYWA 3TBIA 2M4GA 1ZAOA 3F72A 2DN0A 3LSKA 3K7AJ 5FJ8J 2AXLA 2NS8A 2XSDC 1YW8A 5HOOA 3RKYA 2EV6A 1QZZA 3OOUA 2ZJQF 3QAHA 2BYVE 3BC8A 4BL0B 2L54A 4BXFA 4L9TA 4LITA 1MMSA 3CDLA 1KQ0A 5D6EA 3GTMJ 4IRHA 1X1CA 4DJAA 4S05A 1QRYA 2LTPA 3ZMVA 2ZBKA 2L7ZA 3BR6A 2XAQA 5GP9A 3O2PE 3RDIA 1YJNI 4BXXJ 2K9SA 1FTZA 3QWLA 2PEXA 5CKTA 1TLHB 3L2QA 3PNTA 2Y69H 3S2DJ 4AM3A 2EPFA 2KIMA 4CUGA 1V5FA 1I6HJ 1WI3A 3CP2A 3LOCA 5EGOB 2CSOA 4EJOA 1BR2A 3PM1A 1J5YA 4NHJA 2XB0X 3JRDA 4RGUA 4HNTA 2P7VB 2R92J 2IP2A 1OJLA 2LC2A 2Y9ZA 1F43A 2LH9A 1MBEA 4LB6B 5DEQA 4ETSA 1X4PA 2K86A 3CJRB 5D5WB 3HOZJ 1HSJA 4BGDA 4A12A 1FMVA 2L2OA 1Z67A 3OWTA 5D4RA 2VB6A 2KP6A 5EG0B 1Y0UA 1KYWA 1WH7A 1JKOC 4RGXA 3AG4H 1TWAJ 5CQEA 3OYJA 2K5CA 5M5WJ 5LRSA 1BR4A 3HRUA 4KN7X 2JUGA 2KKOA 2IPQX 3RKQA 2XVCA 2V9KA 2VJJA 3IRQA 3QOPA 1QVUA 1XX5A 3O8GA 3BPVA 2P5LC 3EQLF 1UHSA 2QUFA 1U8BA 2JVGA 2X1CA 5E1XA 2Q8KA 1HLVA 3MKLA 2CH0A 2DK5A 1TC3C 3W6VA 5F1RA 2DO7A 1RIOH 1IRXA 2E36A 2K9MA 3K1NA 2H1KA 2XASA 4YEJA 2DQRA 3LQRA 3I5UA 1TP4A 2HQRA 5KAIC 5BPIA 2ZMEC 3E7LA 1XTAA 4NQWA 1ETYA 1VQPI 2XGCA 3P9KA 2ECBA 2JN6A 3KP3A 3QU6A 3BG7A 4E6KG 2A05A 2WADA 4O3MA 3KPHA 2H8RA 3GXOA 2QZ8A 1SFXA 3RKXA 2QM3A 2RQQA 3MCZA 4HOBA 2ID6A 4IEJA 4MQVA 1Y39A 4XK4A 1G2HA 3U2RA 2G0EA 1J2XA 2I10A 4Y7NJ 2M5WA 5LEKA 1JHFA 1YQAA 2EQRA 4Y3OA 3H3VK 3GBGA 1V5EA 1BI2A 4EJUA 3FXUA 2BHYA 3PIPF 4HF2A 2K85A 4XLEA 2V9PA 4C30A 3BTCA 2HWVA 1ZGWA 2JMWA 3CMMA 3CMYA 1Z7LA 3KE2A 4Q47A 1E3OC 2L01A 1UG2A 1YX3A 2MLGA 2OAZA 1H0MA 3P7NA 1SFEA 4RA2A 4BEHA 3MMYB 3BDDA 4C2MJ 4G9YA 3WTTC 1FY7A 3ERMA 4G6TB 4XRSA 2PN6A 1MSFC 1U8RA 1D0XA 4CSWA 2QKLB 1ZGJA 2XB5A 1S7AA 2O6GE 3CQZJ 1HA8A 2HZTA 1E0EA 4TV7A 1VQ9I 3S2WA 2DA1A 4HX4A 1ETQA 2X6YA 2AXTC 5KVRA 2R7QA 1RUNA 2HYFA 5IPAA 3PNYA 4BACA 1KU7A 1HKQA 4PSWA 1IC8A 4I09A 1S29A 1FWZA 4RS8A 2HOSA 2R7WA 3JTHA 4RAYA 3Q5FA 3MQ0A 1IAWA 4QTRA 2VKEA 1SMTA 1HCRA 4BE2A 2H94A 2XGXA 1QA6A 5M5XJ 1CQTA 3H0GJ 2X9DA 1WRJA 4GO1A 2KDOA 2Z16A 4MFDA 5GTHC 2BY1A 2GIZA 3ZMTA 3JW4A 1MNMC 2BVLA 1D0YA 3S1NJ 1ETOA 3OYFA 2BOLA 5HLGA 2PJRB 3CCVI 1E2XA 1D1CA 4D1QA 1WJBA 1SVMA 4YRVA 3M7GA 1YE9A 3C3WA 2LREA 5IYBJ 3LSHA 4F93B 3CO7C 2EINH 4KYWA 3PSIA 3I54A 2VJ4A 4B3AA 3EDPA 3TO9A 1PVEA 5IOYA 2E5NA 3TW6A 1JT0A 4IHWA 4AIJA 2LK2A 3QPLA 1A36A 3I4NJ 3CD6I 3ULQB 2HQNA 3DU5A 3OYEA 2G7HA 2W57A 4HRIA 2RAEA 4UUSA 2R7SA 2FXAA 4KIFA 5HNFA 4FTHA 4DNCA 4C2UA 2E2IJ 2MG4A 4AYBN 4WXDA 3S8PA 2VXDA 1X58A 3SXYA 2MD5A 3S1QJ 1PJRA 4M6YA 4MLOA 4ZDPA 2O8XA 4PZJA 2CUJA 2JSCA 4HBLA 3I56I 3AAFA 3BCBA 2JA8J 1LFPA 1BI1A 2YSRA 1U5TC 1MMAA 2HDWA 4XR6A 5ICFA 3KP6A 1OLTA 2FX0A 3JRGA 5JLWA 3ZQLA 4ABZA 1IUFA 5TISC 4JX4A 3AL0B 1K4TA 4LFUA 2KISA 1FC3A 2DU9A 1SFOJ 5M3FJ 3K4LA 1ZYRF 2ELJA 3TGNA 3TO7A 1UZCA 5FFXA 2PI0A 4D7NA 1S72I 1O3RA 4A3BJ 3JREA 2H6BA 5DCFA 5FKLA 3I55I 5IOZA 2NNYA 3HSFA 1NK3P 2M8GX 4LMYA 1X2MA 3OL4A 1FX7A 2JPBA 1KQ8A 2H6CA 1ZN2A 3FHZA 3CJNA 3J80Z 2FBIA 3RPQA 3LAPA 5EEAA 2XF7A 2FMLA 3OYLA 2EFWA 3M1CA 3PFYA 1TWCJ 1FMWA 2CW8A 1J59A 1JE8A 4DYQA 2XC7A 1Z21A 2W82A 1F4KA 3HB9A 1D1BA 5TJJA 3G3ZA 1XN7A 4AYBA 2V1XA 1HBXG 5D8KB 2VQHA 4GXOA 4BBRJ 2DK8A 2G7UA 2VT2A 4MO7A 3WGHA 4KNYA 3E6DA 2ZSIB 3S93A 1U78A 2CMPA 1X1AA 2K9QA 2R3SA 1R4NB 3H3ZA 1MSEC 1ACIA 1L0OC 3B6AA 1MGTA 1WJCA 2L3DA 3FMRA 1WFXA 2EWNA 4LJZF 4EGZA 1DU6A 3E1SA 4FHTA 2QBYB 2A69F 4OIOF 4P9FA 2ECCA 1WVRA 2OZUA 1R4MB 2VKDA 4YELA 1W0UA 3T1BA 1WHUA 2W84A 1GV2A 1I3AA 2DFIA 4X1EA 1IXSB 5J4YA 3GTOJ 1Y0NA 2ZXHA 2VPLA 3HSEA 2E1MB 1QO0D 4M9SA 3ROUA 4A3LJ 4K2EA 1SANA 1R5GA 3BR2A 1USSA 2OV7A 5L3BA 3W3CA 1AOYA 4A3EJ 2VUMJ 1X1BA 4A0XA 1STZA 4DIQA 4E7SA 2F5FA 1AKHB 2HDDA 1J0RA 1RETA 1FBQA 3K1PA 1JKQC 4CCJA 5K7ZA 1DU0A 3L2RA 1ODDA 2V4JC 1EF4A 3E6CC 4XSXF 3HHGA 3C7JA 1ZARA 3L7WA 2YU9J 2CQ7A 2P8TA 2DMTA 3H5NA 2D5VA 2MBFA 5BMZA 1TT0A 2DTZA 3BG9A 3DPUA 4OWRB 1SFKA 3GMEA 3NWSA 3IRRA 1A6IA 1QVTA 4NB5A 4N4NB 4B09A 1YW9A 3ZP5A 1R1UA 2NAZA 4RB3C 3AL0C 1FTTA 5F04A 3I59B 3BOQA 4ZJZA 1BC8C 1OCZH 4WCGA 2E2JJ 4LOCA 2FU4A 3ABKH 1S7EA 5E79C 1R58A 5ED4A 5FKNA 4PGHA 4G94A 1XSVA 3OYBA 2CO5A 2EIJH 2X0LA 5E8IA 1BBYA 1MH3A 2ADUA 2QSHX 3GF2A 4L5JA 4F55A 3LSIA 1T98A 3C1DA 4UY8I 2L9RA 5HDNA 2YPRA 1EV7A 1QZYA 3WTYC 1QU3A 3ZPLA 2XHKA 3ZMSA 2MD0A 1XGMA 3RPUA 2JA5J 4F3QA 4EM2A 1OCPA 3KP5A 2WY7Q 3OSGA 3FK7A 4E70A 1T0FA 2DTRA 2EZHA 3HRTA 4HQEA 5L3GA 2R5YA 2JQ7A 2GA1A 3JAMZ 4RM2A 3F8FA 1UFMA 1YJ9I 3KETA 1IO2A 4U0WA 3SDBA 2FBHA 2DLLA 5CJ9A 1EH7A 2WY8Q 3A0HC 2GXAA 2ZKZA 2PMUA 3K4JA 1O3QA 2YR2A 4XKWA 1ZR4A 5E1ZB 5LGNA 2LKPA 1X2NA 4EV0A 1DP7P 1RR8C 1SEUA 2ZFUA 1MBJA 3FKIJ 1RRJA 3BP8A 1X1DA 1G6NA 3ZQGA 3M8FA 4DQ2A 1XG1A 5H2FC 3RPUD 1WJ5A 3E3VA 2QLZA 1JGSA 2VKVA 3SZPA 4H0EA 1K6YA 3QP6A 3HJEA 2JUCA 2LSOA 2IT0A 2WA0A 2BY2A 4MFEA 2NVTJ 5ILVA 1WJEA 4M9XA 1JJ6C 2VODA 2GA2A 1MIJA 2E1MC 4KFCA 1I5ZA 3EPZA 3MAJA 3JRCA 3DPTA 2PJRA 3DTIA 4FISA 5H20A 2J5OA 2XPUA 2BHZA 3HBLA 4AIDA 4IF4A 5GAHJ 4HW0A 2KMUA 2RGVA 1XDUA 2CFOA 1Z9CA 3ZQHA 5JFRA 1P92A 1T2KA 3BT9A 2MC3A 2VL8A 4HDUA 3TDZC 2UV1A 3LSTA 3S32A 2GM4A 3IUOA 1FSHA 1SD7A 1RR7A 2B9SA 1BW6A 5ICEA 3S1RJ 2ZNZA 3R60A 3EUAA 3R0AA 2M0CA 4J00A 4OIQF 5L3CA 1N77A 1BOAA 5C44J 3LMMA 5CVUA 1IN7A 1TNSA 2LKSA 4RB1A 1P4XA 3TQNA 4PFOA 2OF7A 4OIRF 1MD0A 4CGZA 3JSOA 2GWRA 2CWEA 3PIOF 1OQYA 3GFIA 1GUUA 2BE5F 2QQAA 1WI9A 3TOBA 3LSJA 4E7HA 3KYLA 3I3LA 1ZRCA 4IRIA 1EA3A 3BG3A 3BTJA 4EM0B 2KT0A 3H9QA 5IY5H 5E3MA 1Z77A 4V19K 2NOGA 5HS8A 4NDLA 2EFQA 4II2A 3H36A 5F0HA 1KZHA 2K4BA 5DD4A 4M3GA 3HZJA 3KYDB 2DMNA 5L3EA 5LFAA 2V6EA 2K3PA 1BOBA 2OU2A 4I02A 5KCMA 3HSRA 1HF0A 4M6XA 3PSFA 1YW7A 4XIDA 4YIIA 3GTJJ 4V2GA 2F5CA 2G9WA 2QENA 1P6RA 2HTSA 3FMSA 2DMPA 4UNOA 1FBSA 3VYRB 2D45A 1TQIA 2MYSA 2WB1N 3W2VA 3PJRA 2O8KA 3K6GA 3R6SA 1A04A 2NS0A 2OPTA 2LKXA 5FGMA 2KL4A 2J5PA 3H0DA 2JSPA 2JTVA 4PJMA 3JCUC 3KEYA 1XMKA 2Q2EA 1G8XA 3BWGA 1CF7A 1Z05A 3WGGA 1NHAA 1KONA 1RZ4A 3UNGC 1MKMA 3NEUA 4UVBA 3WE3A 5EEHA 4IRGA 1ZG5A 3J80K 3ERED 1E3PA 2QVOA 2BGCA 3RTRA 2MGQA 1K7AA 1SD6A 2NYXA 4BAYA 5J47A 1PP7U 4IHVA 2Y48A 3DFGA 2NVYJ 4L5EA 2M30A 5IP9J 1JKRC 4BU2A 3HTSB 1QGPA 1BIAA 1I39A 3DF8A 2DXIA 4RAZA 3WTWC 3LQQA 1YITI 3NWTA 6PAXA 4IX7A 1IXCA 3Q0UA 1VFCA 2VOPA 5FLMJ 5KNLA 3GLXA 1BC7C 1MNDA 2KDZA 3CC4I 5H6QA 1AKHA 2DBBA 3BJOA 1OCRH 3VSKA 3W2AA 2MLKA 5DUIA 3AKZA 2WB1A 2P5VA 2ZCWA 2OBPA 5C4XJ 3FXKA 4C3HJ 4FX0A 4C9YA 4A6EA 5JHUA 3HOTA 3Q0VA 1ON1A 2HPIA 2VBZA 3AG1H 4HA8A 4XLNF 2MABA 2IGNA 1G4DA 1IN8A 2JPCA 1ETVA 1MBFA 5AONA 3F21A 2JK3A 2GZWA 3K4NA 1IRGA 2HU9A 5E18F 3I4MJ 1IN4A 2O7OA 4HYEA 4P96A 4XORA 1FIPA 2NOJB 2EZLA 4IHSA 3RJPA 4UUSB 3OYNA 1NG7A 5CVIA 2HS5A 2IS2A 1T6SA 2A6EF 5FROA 1F9NA 3FKJA 2KLOA 2V6CA 3CCYA 2FSWA 4AIKA 4RAGA 2Z2SB 1LE8A 4AU7A 3TEDA 5FRMA 4U87A 1HDDC 3F6VA 2FRHA 2VQCA 5M5YJ 1WJDA 4KIBA 3FM3A 2PQ8A 2GLOA 1XC5A 3K4MA 2DMQA 3QODA 1W4MA 2M45A 2FD5A 2W00A 3OYKA 1GXQA 2CUZA 4GRIA 4DBQA 3HM5A 4ENMA 2VQGA 1R00A 4HZFA 3HYIA 4XMYA 3BZCA 1W5TA 4JK1X 2IS4A 4E7JA 2GXGA 4KIGA 3EETA 1S8NA 5K5RA 1BR1A 1YX5A 3ZQCA 4KMUX 3CDHA 2HFHA 4CZZA 1V5GA 5F27A 2GIVA 3HKZN 3R0JA 3O6BB 2EJRA 4HAMA 5LHIA 4QIWN 4IQJA 4CA0A 3GZ6A 2R4GA 2E2HJ 3JAMK 3V8JA 4UB6C 1NH3A 1EJ9A 3MZYA 3K70C 5D5XB 2A68F 1MZBA 4N9IA 1O3SA 3ZQ7A 2XV4S 1U0JA 1YO5C 4RBOA 1IRFA 2IA2A 3DBHB 1MJAA 1D8KA 2IGMA 4ZZLA 2RV8A 1FLIA 1ZQ3P 4HLYA 4WXHA 2IGKA 3ECOA 1P4AA 1OCCH 4IO9F 3V42A 1WJFA 2HQAA 3F6OA 3QQAA 3OS0A 4E7KA 2JA6J 1W5SA 3LNQA 1V3FA 2ISZA 1I1GA 1OCOH 4ENKA 1BW5A 3I4PA 2WBMA 1UMQA 2L7MP 3FF5A 3N05A 3TW7A 1IZ1A 2OTLI 4P9UA 4L18B 1ON2A 4MGRA 3H1CA 1GV5A 2LBFA 5L3DA 3WTXC 2OTJI 5BS6A 5E3LA 3ZMZA 4HLXA 2PMHA 1YG2A 3H92A 3U21A 2F4MB 4LGWA 1LPQA 2EA4A 4BDYA 1IDZA 2M2EA 1FIAA 5TGTA 1XSXA 1OYIA 4M73A 3HKZA 4UV9A 3KEOA 2EH3A 4EM1A 3MD2A 1Z7UA 3L2WA 1IN6A 1ETXA 1KA8A 1MNEA 5AIPA 2KPMA 1YIJI 1OR7A 3ZMUA 1A5JA 4XOPA 4LG0B 3QOEA 2EFNA 3ABTA 5B1AH 3FMQA 2FJ1A 3I58A 2L0KA 4RGRA 3A0BC 2XROA 1PDNC 2Q0OA 5DM6F 4XRFA 3WU2C 2IS6A 2W7NA 3CCRI 3M3YJ 2LY9A 5C4JJ 1T39A 3OR1C 5E3OA 4U0YA 3HGGA 3CCEI 2A6HF 1B8IB 2HI3A 5ERIA 1KQ9A 2AHQA 5BNGA 2DOEA 1MMDA 2QQ9A 1FJLA 1K83J 2E1OA 1ZRDA 2P5KA 3GFJA 3OIPA 1DQUA 4XICA 5D6FA 2WV0A 4HF1A 1EH6A 1W5CC 3FXLA 4KUMA 2Y0MA 5K7FA 1JUMA 5LBQA 3DP7A 1K6OA 5CVRA 2VE8A 3G2BA 4HPQA 1ZGAA 3COAC 1IJWC 1K79A 1TTYA 2XDVA 2R5YB 4E7ZA 3KZIC 1JTXA 4XQFA 2GBYA 2CV2A 3FXRA 4FE7A 1RI7A 5K5OA 1XS9A 4NBQA 1H8AC 2NVUB 2IA0A 1R36A 4HV5A 4XNFA 4D5CA 1YHQI 3J7AO 1FOWA 5DV5A 2VJIA 1PUEE 2X4HA 3D1NI 4HSRA 1OYYA 3VFZA 4CCOA 2E34A 2LFBA 4GCVA 2R7RA 4M3EA 2ZC2A 3N97A 5D5UB 4U0VA 4YFNF 2OC6A 4PJLA 3PUFA 3OYHA 3LA3A 3GLLA 2K40A 1MMGA 3SFIA 5J40A 1Q1VA 2XAFA 1R22A 2HOAA 2COMA 4XONA 4KITB 5LGUA 4NUBA 3NRVA 1ZLJA 3RYPA 4XOTA 4MTDA 1U3EM 4W1UA 3K70D 3IAS2 2M9HA 4BHPA 1FBUA 3B6CA 5F1JA 2CFXA 3KFWX 3NAUA 1IW7F 3D0SA 4KJZA 4IHXA 2O9LA 5GAEJ 1RUOA 2E35A 2HXOA 1Y8RB 4BKXA 1IF1A 2RKHA 1O4XA 2TRTA 2NVQJ 1WKMA 1O57A 5CLSA 4RLQA 2W85A 4ESFA 5D4SA 5JLXA 2CUFA 3KZYA 3LA7A 1Y1VJ 4S04A 4G7ZF 1RNLA 2HVSA 1ZHFA 1YFHA 1KU2A 1MBHA 3FISA 4JX5A 2MFZA 5CQGA 2F5VA 3JRHA 3V8LA 2M1BA 5J6XA 2KZGA 3A01B 3W2WA 2VOOA 1SVOA 3SYTA 1SAXA 2OZ6A 1OKRA 2IVMA 2R0QC 3IP4B 5FD5A 4PJJA 3PO2J 1HC8A 2K27A 2V26A 3TOAA 1D5VA 3WODF 4A5MA 5EJCA 1ORKA 3CDIA 4FT8A 4G8XA 4LB5A 3WTUC 1T0FC 2M7AA 1G3WA 2DFFA 4XBFA 3MZ8A 5K1YA 5BQTA 2Y31A 2V1DA 3LL7A 1WSUA 2VQLA 2HPMA 2F2EA 3GYHX 1W36D 3BJAA 4BJ6C 1RKWA 2K02A 1I50J 1Z0XA 3IAM2 4OMZA 4AD9A 1OCTC 4MEXF 1WCMJ 2NRAC 2OD5A 3GTLJ 5IYCJ 4R8HA 1F36A 1DUXC 3H9JA 1TNTA 1WZ2A 1EH8A 3E5XA 3ZOBA 1RPWA 1JJ8C 2K9LA 4I2OA 2XKPA 4XLCA 1C0WA 4XM3A 1FP2A 2Q1ZB 4IZZA 4A3IJ 4XLAA 2CU7A 4I98B 5GAGJ 3J7AY 5IT9Z 2Q2EB 4P55A 1H88C 1R1TA 1CF7B 1FPQA 1BI0A 4CZCA 1WJAA 3PFIA 1FZPB 1G3SA 3S16J 1JUPA 4LG3A 4PGGA 3JSPA 1P7JA 4HNUA 4BE1A 1MBGA 3Q0WA 1I3QJ 3S15J 3GUDA 3I0TA 2TDXA 2QQBA 3HOSA 5IT3A 3P9CA 2QGUA 3QP5A 1VQ6I 2HZDA 4WX9A 1QHHD 2DDAA 3MZHA 5IP7J 2HDCA 1W7PB 2HYGD 2CQQA 5DYMA 2CV0A 2DQLA 2V1NA 3WE2A 4KICA 4FETA 2XAJA 3VYUB 2H1LA 4LIVA 3BZ6A 2R7FA 2VLAA 4BY7J 1XGSA 5IYDJ 2Y2ZA 2Z99A 1N75A 4KT6A 1R7JA 4JQFA 4A0ZA 1M1EB 2GOMA 3RQ4A 4DYRA 4B47A 3LFUA 3OIOA 2GOXB 1YTYA 2BY3A 5LLQA 4HX7A 3LFKA 4BQOA 3CO6C 4LG0A 5HS7A 1YI2I 2VC1A 1R5ID 3K10A 1QQIA 2A3SA 4HNVA 4UV8A 1VQOI 3K1MA 4WF2A 4ANJA 5FKMA 3VYSB 2EIMH 1R71A 4F92B 4J19A 1YS7A 1MDMB 2UXXA 3V7CA 2XKOA 2DPUA 5GADJ 2LG4A 3CCMI 2I8DA 1B8IA 3HOUJ 4IJAA 1TWFJ 1WGXA 1Q1HA 2ZXWH 2KRFA 2R7VA 1KGSA 1K78A 3ZN0A 3CMAI 4C3IJ 3DLAA 4II3A 3GW2A 4LD5A 3G73A 1LE8B 1FOYA 3A2KA 1WPKA 2KIFA 4F91B 4WWCA 2UXNA 2VXZA 4IVNA 4RGSA 4J01A 4DW6A 3IV5A 2R93J 3EUHA 1BJZA 3BCAA 5IP6A 3ZQQA 3DEUA 2ZNYA 2DA7A 2F48A 2Z3YA 3EYYA 2PLYA 1UJ8A 4E7LA 3IKVA 4PDKA 2JRMA 2CQNA 3SJMA 1AHDP 3CC2I 2HVRA 4XN3A 4EQQA 4ON0A 3L2CA 4CICA 1GHCA 4WXCA 2HYJA 4ZYHA 1XSDA 1WQ2A 4FE4A 4OAZA 1QHGA 3HOVJ 3BJ6A 1BI3A 1GVJA 4PFPA 5B3SH 3BLYA 2L9NA 1D8JA 2L9SA 2M87A 2HVQA 1BA5A 1FT9A 1HXDA 4HX8A 2QWWA 2XRNA 1W0TA 5EYRA 4FCYA 2FOKA 4MNUA 3GO5A 4RAFA 4BY1J 3G1LA 4RB0A 1BN5A 3CESA 1N78A 1Z1DA 1A6QA 2KQRA 2VBYA 1FYLA 2DT7B 1SVLA 2EV5A 2OJED 4JP0A 3AG2H 2NS7A 3QYBA 2L7KA 2OA4A 2ACJA 4I7HA 2CQKA 1A35A 1OMIA 3IC7A 2E71A 2W25A 2FOWA 3DV8A 3RIRA 2XAHA 3DKYA 1XGNA 2DOFA 2W48A 1HSTA 5J1YA 3HOYJ 3OYCA 1IRZA 1B72A 1YOVB 4OINF 3F3XA 1VQKI 2LBFB 1Y56A 3HC7A 4I76A 5E1WA 4BXUA 2DT6A 2DFHA 1IXRC 2O61A 4A69C 1VNDA 2Z1DA 2DOAA 1AU7A 2R5ZA 2V7FA 4KN4X 4HDVA 1MW7A 3G4SI 2Z5UA 1MJBA 3KIOA 3KLNA 3Q9SA 4JX6A 4QWQA 1D0ZA 2MH2A 3A01A 4G7OF 5FLVA 2F5DA 3SEZA 4S0HB 1X19A 2CJJA 2GXBA 5HODA 2CS3A 4XLFA 1TWHJ 3S14J 3K69A 1YJWI 2DYSH 1J75A 4L9VA 2R7XA 1D3YA 4AC0A 2FUG2 2QYOA 1SFUA 5DTDA 1ULYA 4YIRX 2BXZA 5K5QA 2IW5A 3K2AA 3OV8A 1ENHA 4DGWB 2RDPA 4N4OB 2O5RA 4B44A 3F0CA 3Q3SA 2PX9A 2LF7A 3M9AA 2X85A 4BH9A 3B02A 3VDXA 1VQ5I 2DT5A 2TCTA 4A2UA 3WGIA 2JZYA 2A61A 2HOEA 3FBNB 3CZ6A 4HQMA 3IL2A 1VQ4I 2ME0A 2Y0SN 3AFHA 1TQPA 4QSHA 3R61A 3ZQIA 3C2BA 3OL3A 3I9V2 3FZVA 3QYEA 2B7EA 1TT5B 2DDBA 3GEZA 3UR3C 1LDJA 1P9QC 4XN0A 4DYCA 3OS1A 2EV0A 3ZCOA 4CXFA 3L9FA 4I0BA 5HNHA 5C3EJ 4CHUA 4QPOA 1MBKA 1KU9A 3K4CA 5K7HA 1GT0C 3OYAA 2Y30A 5DCMA 4DOZA 2X6OA 4XRMA 2DJIA 2XF6A 1H9GA 4PJ0C 5IT9K 1D5YA 1P7IA 4DZPA 3VSLA 1U6GA 3H35A 1W7PA 2EK5A 2K9NA 5FFZA 5DS9A 4Z2YA 3BR3A 5L3FA 2FF4A 4ZYDA 2P6SA 1XMAA 2QKMB 3R4KA 4UHTA 4AUXA 1T38A 1SC7A 3LSRA 2R7OA 2CG4A 1U9NA 2KZVA 2Y0SA 2E60A 2WWYA 1ZTRA 2Y9YA 3BZKA 3C18A 2D1VA 2VBWA 3CCQI 5TRDA 2ISYA 5JI6A 2DA5A 3NARA 3FDYA 4HF0A 2M0MA 3OYMA 4Y52J 1ETKA 3OS2A 1OR7C 2ME6A 2JJ7A 2STWA 3JRFA 1W7PD 4XKCA 4IHTA 1MDMA 4G12A 1EKEA 3GCMA 1ZR2A 1JT6A 4HV6A 3K0LA 2IGOA 2BW3A 1S7OA 2V1UA 1DGRM 3FX3A 3NQOA 3MKZA 3SFZA 3CC7I 4A0YA 3ZR8X 3V7SA 1QPIA 2ZXJA 1POGA 2A5WA 2ELKA 1JXSA 1IUYA 3MKWB 3A1YA 4KA4A 5BPDA 3KCCA 1R9TJ 1NK2P 1X1PA 2EA2A 4V2FA 4IHYA 3LSPA 4FASD 2M34A 4KDPA 1MJ9A 1UB9A 4L9JA 4OIPF 2L5QA 1FEXA 2LLKA 4ZYGA 3ABUA 1LFUP 4MEYF 1DP3A 1I6XA 3X2QH 2ZMEB 2OCEA 2JA2A 3P5JA 3A02A 2X48A 3T0YA 1HW1A 3WG7H 1J7KA 1XMXA 4BHBA 4E7IA 1SD5A 3F8NA 4M3BA 2LF8A 2NXNB 1ZREA 4Y33A 3S1MJ 1KU3A 4UUTA 1B6AA 4L9NA 3TP0A 3U1DA 3I64A 3E5UA 1FOXA 4F7ZA 3IKTA 2HTJA 2OQGA 2IJLA 3BTLA 3OYGA 1G59A 2ZB9A 2W1OA 4I01A 1Z3YA 3A4CA 3H5AA 3HG9A 1I1SA 3PNVA 1YS6A 3IHUA 5FO5A 1UELB 4U7BA 2L02A 3HIFA 4PK4A 4B48A 4HG2A 5FKOA 3KLOA 3A03A 4YFKF 3CF2A 2HGCA 1RKTA 2KIUA 4L5IA 4P5OA 4MHGA 1T56A 2YX4A 3LA2A 2KJBA 5A2QZ 4EGYA 1R6RA 2GQQA 3E5QA 4M3DA 2QQ8A 2DODA 2ZJ2A 2XPWA 1UCRA 1ZG3A 3MKYB 1PUFB 3CCJI 2DPDA 2EB7A 4AVZA 3ABLH 5HLTA 3JRAA 3VWBA 1LEAA 2KRHA 4PCQA 3OOPA 4ZYAA 1X3ZB 4BS9A 3AG3H 1HKTA 2CYYA 3L1PA 4R79A 1T95A 3HUGA 1QNTA 2HXIA 4N9HA 3QRFF 3HEFA 5KK1A 4JYKA 4G6DA 3CJTB 3D5SC 2KJCA 3FWEA 4HEA2 3ZRGA 4A3DJ 3LAJA 2MSYA 2F6CA 2BY0A 2MH9A 3HHHA 1LEBA 3LSGA 2FA5A 2LVSA 3T8TA 1XGOA 2FE3A 4E4HA 3H5RA 1YLFA 2K3FA 4QLCU 2WV1A 2HKXA 2JVHA 2LP0A 2WC2A 2A07F 3JRBA 1W1WE 3E6BA 2W24A 3L2UA 2PBIA 4AVPA 2L4MA 1W36C 3FXOA 4PSXA 3VPRA 3K4BA 1R1VA 2M4KA 2N8GA 2IAIA 5ILUA 4QPQA 4LK0F 4LLLA 2F5EA 4O5VA 1ZKGA 1FYMA 4KT5C 3F8MA 3FXJA 4Z6YA 1ZK8A 2RREA 3BR0A 4B4CA 3M1EA 3VYTB 5E17F 4Y17A 1LVAA 3OIQA 4G7HF 4CO8A 2VC0A 3KEQA 3CMEI 3S2HJ 3WU0A 4NC6A 1Y1WJ 5EDNA 3KYCB 4UVAA 3HDDA 3HPHA 5KAFC 2E1CA 1K78B 1AWCA 4UUVA 4OMYA 4L0ZB 3GWZA 1FP1D 2MA3A 3SQNA 2O3FA 1APLC 3TP3A 3CUQA 2YS9A 3EUKL 5LHGA 3M07A 2DA6A 4ZC3A 3IWZA 1BJAA 1FYKA 3CTAA 5GTIC 3E97A 3F8CA 1F5TA 1R49A 4BHCA 4BQNA 2OCCH 1OPCA 3HXLA 1UAAA 5HS9A 5EF6A 4RB2C 3JR9A 2BVMA 3F8BA 4UB8C 5CPRB 1S5LC 4A3MJ 1U5TB 1Z6TA 3FHNA 2V79A 2CV1A 2FQ3A 3ABMH 3IH3A 4LK1F 5F64A 1Z91A 2FEZA 2VKHA 2Z9OA 2CW7A 2OUMA 3PUBA 4BJ5C 1B1BA 1TBXA 5ICCA 2QSFX 1Y6IA 3BY6A 5D8LB 3RCOA 4FX4A 2EFOA 3OY9A 2JA7J 3FM5A 1HKSA 2WAQN 3RI4A 5LRRA 2ZO4A 4DBRA 1VTNC 1R23A 2R7UA 3DKWA 1R5HA 2DAOA 2B0LA 5E20A 1X3UA 3TKYA 3G1OA 3QPSA 1JTYA 1TWGJ 1LDDA 2UUZA 4B43A 1K4SA 2ELHA 4PJNA 1JKPC 1TL8A 1LUJB 1PYVA 2HNHA 1H9TA 5DD8A 4C2TA 2DA2A 3D5LA 1DGWY 4LLGF 3ASNH 2D1HA 3BTIA 3TL4X 4IL6C 2IXSA 5LGTA 4R1HA 2HKOA 1IGNA 1JI8A 4XL9A 5F0FA 2X6XA 2I5UA 1MMNA 4A3JJ 2ICWG 2XGDA 5JR3A 3P9IA 3DU6A 3O3KA 5JVTA 2VASA 2FNPA 3ZN1A 5E8GA 4ITVA 3MFKA 3GTQJ 1IDYA 2RC4A 3WHCA 2KFDA 4XKVA 4KMFA 1B72B 4IPAA 4C3JJ 2AQFA 1V4RA 3TO6A 1IV6A 2COBA 2CRGA 2VIXA 1XCBA 5FRNA 4FQGA 2VE9A 3KX2A 4WK8F 3GTGJ 2WAQA 4EJVA 1LJ9A 1BM9A 5LEJA 2R5ZB 3WTSC 1VQ8I 4D5FA 5FLXK 1HQCA 1IG7A 2HOTA 3JTGA 2GAUA 3RYRA 1GLNA 1F1ZA 1Z6RA 3BR1A 4H4KC 5J1RA 3DBLB 3GZ5A 2VBXA 4GGGA 3VEPA 9ANTA 2L4AA 3DKXA 2ZMEA 3S3MA 4Q5SF 2P4WA 3HRSA 5CVJA 2LDUA 2IBDA 2FBKA 2F4IA 3ML6A 5F0CA 2P81A 3ZGKA 4ASNA 4XRSG 4CH7A 3EUHC 4XKBA 1UHWA 2DCEA 2ZFWA 3CLQA 3V7RA 3KP7A 1JHHA 3HOXJ 4A3GJ 2H09A 5KHDA 1JGGA 1E17A 5AIQA 5HLHA 4IKFA 2DA3A 4JOMA 1GDTA 2LMDA 1I27A 4I6ZA 1SMYF 3PL8A 3FXQA 3V4GA 1SD4A 1J09A 1O3TA 1LB2A 4LIUA 2IRFG 1HW2A 4HSTA 3G71I 2BV6A 3LSMA 3J81Z 1ZH5A 3TMOA 3W6KB 1PP8F 4CDGA 1XB4A 4UXNA 5BOXA 2VPRA 3G6EI 4D7MA 2R7DA 2UZKA 1X4OA 2Z33A 1H89C 3U1KA 1HOMA 2QCOA 4P1WA 2Y75A 3LWFA 4ZH4F 3DPLC 1E3HA 5EGOA 2LY1A 4ZYEA 1SAUA 5ILSA 1T08B 5GPAA 2QA4I 3RZDJ 4M74A 2FNAA 3B73A 1RC9A 3E0JB 2VI6A 1FNNA 5HDGA 2V9VA 4RMNA 4Y4RA 2CQXA 2A6TA 2X6WA 3HOWJ 1YIOA 1REPC 2E7XA 2DJNA 5J3LA 1PUFA 2BXYA 1B4AA 2ETHA 4XLHA 5E3NA 5CYVA 2XSJC 5J4VA 3SZTA 3CLOA 4RM3A 5DCMB 5M3MJ 2P7CB 3S3OA 3DTKA 2EFPA 5EG0A 1U2WA 2AQEA 3DXJF 3SHFA 4UVCA 5A2QK 1A31A 4GDFA 3H3UA 1VQ7I 2PJPA 3SZGA 4ZTFA 5B5EC 4ENNA 4AWXB 1LKXA 2RN7A 2W4SA 4BYYA 5HVQC 4CYCB 3GVAA 3S17J 1J9IA 2YU3A 1XDSA 2LRDA 5DDGA 2C6YA 2O0YA 1BIBA 4GYGA 1VQNI 1LFBA 4NNJA 1O7LA 3FIWA 4EJWA 1YRNB 3TDUC 1KYZA 1T8IA 3L00A 4YIFA 4IOAF 2LNBA 1RESA 3DEWA 3GZNB 4M6VA 4ENJA 3BROA 3I71A 4BE0A 4MQ9F 4XLPF 4CCNA 4M72A 2H27A 2EILH 3HPGA 2BW3B 3Q9VA 2JRTA 2PG4A 2F4OB 2HR3A 1ZELA 2AS5F 4D9JA 2QSGX 2L9VA 2X51A 3N4MA 1XCVA 5HDKA 1OISA 1X3WB 4LLNA 2MC4A 4Q48A 3GTPJ 5JVGF 3BQZA 2ESNA 4RLFA 1LQ1A 4DZJA 2CW0F 5F6FA 5GPCA 3FXMA 2L7FP 5ICGA 4I99C 2WTEA 3G1MA 3F23A 3T5XA 2EBIA 4ZDOA 3IWFA 4B3XA 3O8HA 2CUEA 5EZGA 2STTA 1VQMI 1ONVA 3QPHA 4OOIA 4AIHA 4A93J 1U5TA 3L09A 2CGPA 3HRMA 3UKGA 2E5ZA 3KZZA 3SEQA 1V54H 2XPVA 2EZKA 4EVIA 1VZ0A 1G3YA 3ECHA 3BR5A 3DWLE 2XUBA 5LD2C 4BDZA 3W6JB 2BZTA 1QPMA 3OYIA 3FBIB 1VI0A 1ZG1A 2E7WA 3IH4A 2XIGA 2MW8A 5J8CA 4GYIA 5JHFA 1VF9A 1TZLA 1S6LA 1GVDA 4PUSA 1O7FA 3BQYA 3ISPA 3IH2A 1ITYA 1WWXA 2DI3A 3CCLI 1G3TA 3SDGA 4Q4ZF 1XPXA 1XD7A 2VT3A 3I53A 2ZXIA 3V8KA 4A3KJ 1LDKB 2FQ4A 1LNWA 1ZRFA 3PO3J 2E19A 3WHBA 3VB2A 2DA4A 4ZDLA 2ZSHB 2E1NA 2LYCA 2B63J 1ETWA 1T33A 3ELKA 5DM7F 3C2GA 3HUGB 2ESHA 2XAUA 1B9NA 4NC8A 3CF5F 1VQLI 3WU1B 4BQQA 4M3FA 2NNNA 2P0WA 4RDUA 2HQ5A 3D5RC 4YFXF 2XRLA 3RZOJ 1AA7A 3ESWB 4A3FJ 1UHMA 1Y8QB 2DW4A 3HGYA 2QF7A 4F52A 2ZJRF 2RQPA 1QZEA 2XF5A 1DDNA 4A3CJ 3REOA 4BQAA 5CVVA 2IA1A 3QPTA 3CJQB 3MEXA 4G6QA 4U7DA 3EYIA 4M71A 1MH4A 3M8EA 2ZJPF 2H8WA 4A5NA 4EMSA 3M8JA 4A6DA 1UG0A 2ID3A 4NQWB 1ZLKA 1QBJA 3JRIA 2M7BA 3KP4A 4D0PA 3F22A 2KRCA 3QU3A 3ASOH 3BG6A 4X6AJ 1WH5A 5EEGA 4X0GA 2UWMA 1GXPA 2A5YB 2KIQA 4CCKA 3H9GA 4GFBA 4Y13A 3CUQB 2RNGA 2LD5A 3M4OJ 3RSNA 5LHHA 3C2HA 5DUKA 3GFMA 3F9KA 3RQIA 4BNCA 1HDPA 2WAEA 2BEOA 3PQJA 1S9HA 3MWMA 4MIMA 4NC7A 3OSFA 2BBYA 4ZZDA 1TQMA 1TW2A 2DYRH 4O6JA 3J7ZI 4KISA 5HLIA 2RNJA 2JT1A 3S3NA 3E6MA 1IV8A 5D5VB 3WTZA 1FOKA 3RKWA 2LY2A 5B66C 4BEHB 1IN5A 3J81K 1Z3XA 5F08A 3ONQA 2XGEA 2K7LA 3QYFA 1FSEA 5FD6A 1JUSA 4N0BA 3HL2A 1P2FA 2P6TA 4EEFG 1NG6A
chains in the Genus database with same CATH topology
1QU3A 3D5SC 2M3AA 4HEA2 3OR2C 3ZRGA 2MD0A 2HVSA 1ERDA 4F3QA 2F6CA 4IQ4A 2WY7Q 3DQVC 2MFZA 5CQGA 3K4KA 3LSGA 2F5VA 2X1EA 3L2VA 4RM2A 3W2WA 4OAYA 3SYTA 2R7TA 4E4HA 3SDBA 3H5RA 3OYDA 3IP4B 4PJJA 2JVHA 2WY8Q 3K4JA 2V26A 4XKWA 3L2UA 1W36C 4PSXA 1LVKA 3K4BA 2M4KA 2ZFUA 2X1DA 1T0FC 4QPQA 2M7AA 4CCLA 1X1DA 3LL7A 2VQLA 2HPMA 2RREA 4BUPA 3RPUD 1WJ5A 3VYTB 1W36D 4BJ6C 3OIQA 3IAM2 1K6YA 2WA0A 3HPHA 3ZXSA 2IS1A 3H9JA 3DTEA 1WJEA 3CP8A 2E1MC 2K9LA 3EUKL 4XLCA 3EPZA 4XM3A 4IZZA 2Q1ZB 4ZC3A 3OMYA 4CCMA 4XLAA 3DPTA 2PJRA 3J7AY 2PMZA 2Q2EB 3DTIA 4BQNA 2KHMA 3DEEA 4CZCA 1WJAA 3HXLA 4ZTJA 1UAAA 2KMUA 2WAFA 4LG3A 2LOOA 4HNUA 2BVMA 2CFOA 4BE1A 1D1AA 5CPRB 4EATA 2VL8A 3FHNA 2CV1A 2VJ5A 2UV1A 2VKHA 3S32A 4BJTA 2CW7A 2OUMA 3IUOA 3PUBA 3TBIA 2M4GA 4BJ5C 3HOSA 1Y6IA 3LSKA 3EUAA 2HZDA 3RCOA 1QHHD 3OY9A 4J00A 5HOOA 1N77A 3OOUA 4DBRA 3LMMA 2R7UA 3BC8A 4BL0B 4BXFA 2V1NA 4LITA 2CV0A 4FETA 3VYUB 1X1CA 4DJAA 4PFOA 4LIVA 2UUZA 4B43A 2VLAA 1N75A 4KT6A 4JQFA 4PJNA 2GOMA 3RQ4A 2HNHA 1PYVA 3LFUA 4B47A 2GOXB 4E7HA 4C2TA 5CKTA 3D5LA 3KYLA 3I3LA 1DGWY 3L2QA 3PNTA 4BQOA 1EA3A 3H9QA 3K10A 4CUGA 1V5FA 3CP2A 4II2A 3TL4X 4ANJA 1BR2A 2IXSA 1JI8A 3VYSB 4XL9A 2X6XA 4F92B 1MMNA 4HNTA 5LFAA 2V6EA 2K3PA 3DU6A 2VASA 1BOBA 2LC2A 5KCMA 2LG4A 4ITVA 2I8DA 2LH9A 3PSFA 4XKVA 1X4PA 2AQFA 3CJRB 2R7VA 3VYRB 3PJRA 3W2VA 2MYSA 4BGDA 1FMVA 2L2OA 3OWTA 2VIXA 2VB6A 2KP6A 3K6GA 3DLAA 4II3A 5FRNA 3KX2A 5CQEA 3OYJA 2KL4A 2WAQA 3H0DA 2JSPA 2K5CA 3A2KA 4PJMA 1BR4A 4F91B 3KEYA 2JUGA 2VXZA 1G8XA 4J01A 2V9KA 2VJJA 1KONA 1GLNA 3UNGC 3BCAA 4H4KC 2JVGA 2X1CA 3ZQQA 2CH0A 3S3MA 3DKXA 4E7LA 3RTRA 2F4IA 2HVRA 4XN3A 1IRXA 2K9MA 3ZGKA 4YEJA 4OAZA 4CH7A 1QHGA 3EUHC 4XKBA 2DCEA 4PFPA 4BU2A 5KHDA 3BLYA 2L9NA 2L9SA 2DXIA 4IKFA 2HVQA 4JOMA 3NWTA 3PL8A 4IX7A 3BG7A 4E6KG 5KNLA 1J09A 2WADA 4LIUA 1MNDA 4HSTA 3LSMA 3TMOA 3VSKA 2RQQA 3W2AA 3AKZA 2WB1A 3CESA 1N78A 1X4OA 2KQRA 2DT7B 4P1WA 4C9YA 3QYBA 3HOTA 3DPLC 2LY1A 2HPIA 2L7KA 4Y3OA 1SAUA 2MABA 3GBGA 1V5EA 2IGNA 4XLEA 4C30A 3E0JB 3K4NA 4RMNA 2HU9A 4Y4RA 2A6TA 2X6WA 3CMMA 3DKYA 1Z7LA 4XLHA 4XORA 3OYCA 2NOJB 1YX3A 2XSJC 3OYNA 1NG7A 1Y56A 3HC7A 4RM3A 2LBFB 4BEHA 2IS2A 3MMYB 2DT6A 5FROA 3S3OA 3DTKA 3FKJA 2KLOA 2AQEA 4G6TB 2Z2SB 2Z1DA 2DOAA 1D0XA 4AU7A 5FRMA 4CSWA 2QKLB 4U87A 2V7FA 1HA8A 1E0EA 3SZGA 2VQCA 1WJDA 4ZTFA 1MW7A 2X6YA 1LKXA 2R7QA 2W4SA 5HVQC 3K4MA 3PNYA 3QODA 4BACA 1D0ZA 2LRDA 4PSWA 2W00A 3SEZA 4GRIA 2CUZA 4DBQA 3OYKA 1X19A 4NNJA 2VQGA 2CS3A 4XLFA 2R7WA 4XMYA 2IS4A 2R7XA 4E7JA 2FUG2 4BE2A 1BR1A 1YX5A 4DGWB 1V5GA 4N4OB 2O5RA 4BE0A 4B44A 4CCNA 4IQJA 3HPGA 4CA0A 2BW3B 2KDOA 2R4GA 2X85A 2Z16A 1ZELA 3VDXA 4D9JA 2X51A 3K70C 2BVLA 1D0YA 2MC4A 3FBNB 3CZ6A 4RLFA 1U0JA 3OYFA 2BOLA 2PJRB 3AFHA 1D1CA 4D1QA 2IGMA 1WJBA 3OL3A 4YRVA 1YE9A 2IGKA 2LREA 3I9V2 3LSHA 4F93B 3QYEA 3PSIA 4ZDOA 4B3XA 3V42A 2VJ4A 1WJFA 2HQAA 3OS0A 4E7KA 2E5NA 3UR3C 1P9QC 4XN0A 3OS1A 3ZCOA 5HNHA 2WBMA 4QPOA 3DU5A 3N05A 3OYEA 3K4CA 4HRIA 2E5ZA 2R7SA 3SEQA 3OYAA 5HNFA 2LBFA 4C2UA 4DOZA 3S8PA 2VXDA 2DJIA 3U21A 2XF6A 1PJRA 1VZ0A 4MLOA 4ZDPA 4BDYA 2CUJA 3DWLE 3VSLA 5LD2C 3H35A 3BCBA 5TGTA 1LFPA 4XR6A 4BDZA 1MMAA 2HDWA 3HKZA 1OLTA 3MD2A 3L2WA 1MNEA 3FBIB 3OYIA 2QKMB 2KPMA 3AL0B 4XOPA 3QOEA 3K4LA 2R7OA 2ELJA 5JHFA 1TZLA 2KZVA 2Y0SA 2E60A 4PUSA 2IS6A 2W7NA 3FDYA 2M0MA 3OR1C 3OYMA 3OS2A 1OR7C 3OL4A 2ZXIA 4XKCA 1LDKB 1MMDA 2XF7A 2IGOA 3OYLA 2BW3A 3M1CA 1DGRM 3PFYA 1FMWA 2CW8A 3MKZA 4ZDLA 3ZR8X 2XC7A 1Z21A 2ZSHB 2LYCA 3OIPA 1DQUA 2W82A 2A5WA 3C2GA 3HUGB 2XAUA 4NC8A 1D1BA 3A1YA 3MKWB 4BQQA 4AYBA 2P0WA 2VQHA 3D5RC 4FASD 1AA7A 2L5QA 4HPQA 3G2BA 2ZSIB 3S93A 2CMPA 1X1AA 2XDVA 1DP3A 4F52A 4E7ZA 4XQFA 2JA2A 2XF5A 2CV2A 1WJCA 4E7IA 1WFXA 3E1SA 3CJQB 4XNFA 4Y33A 4YELA 2VKDA 2VJIA 3M8JA 4HSRA 2ZXHA 2VPLA 1UG0A 4CCOA 2E1MB 4NQWB 2R7RA 1G59A 2M7BA 3OYGA 2OV7A 3W3CA 2W1OA 1Z3YA 2KRCA 3A4CA 1X1BA 3H5AA 4DIQA 3HG9A 4E7SA 3BG6A 3PNVA 1UELB 2OC6A 4PJLA 4X0GA 2UWMA 4U7BA 3OYHA 4CCJA 1MMGA 3L2RA 4PK4A 4CCKA 3H9GA 4HG2A 4B48A 2V4JC 2RNGA 3CF2A 3RSNA 4P5OA 4XONA 4KITB 3C2HA 3H5NA 3F9KA 4NUBA 1TT0A 2WAEA 1R6RA 1S9HA 3DPUA 4OWRB 1SFKA 3NWSA 4NC7A 4XOTA 3K70D 3IAS2 4N4NB 3AL0C 3MKYB 4KISA 4KJZA 4AVZA 4ZJZA 3S3NA 5HLTA 3VWBA 2KRHA 2LY2A 4BEHB 4ZYAA 1Z3XA 4BS9A 3ONQA 3QYFA 3OYBA 4R79A 1T95A 4RLQA 3HL2A 4F55A 3LSIA 1NG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPZ A; 
#chains in the Genus database with same CATH topology
 2PMZ N;  4IOC F;  2EIK H;  1HW5 A;  2M3A A;  2XAG A;  3OR2 C;  4M9Z A;  2DMU A;  4MTE A;  3J7Y J;  1ERD A;  4CYD A;  3CUO A;  1UST A;  4IQ4 A;  4ESB A;  3DQV C;  1L3L A;  3KP2 A;  2YUS A;  4U88 A;  3K4K A;  5H6R A;  4OU0 A;  3VOD A;  4YG2 F;  3DLL F;  2D2W A;  2X1E A;  5B1B H;  2NVX J;  3L2V A;  3PQK A;  1BL0 A;  4OAY A;  2R7T A;  4W97 A;  3K9T A;  3K2Z A;  4CYC A;  2AO9 A;  4B1R A;  3OYD A;  2VN2 A;  4I0A A;  5J8F A;  2DFE A;  2YX7 A;  4B8X A;  2QEX I;  2HEO A;  3GFL A;  1B59 A;  3HTU A;  2M8E A;  2QBY A;  1NTC A;  5J1U A;  1LVK A;  5EZH A;  2X1D A;  4CCL A;  1YRN A;  3CCS I;  5FLX Z;  1TW3 A;  2K4J A;  2EZI A;  4BUP A;  2VON A;  4EJT A;  1S3J A;  1P4W A;  2RVC A;  3ZQF A;  1U9O A;  3ZXS A;  2IS1 A;  3WG9 A;  3DTE A;  2R7Z J;  1DPR A;  2LR8 A;  2JWT A;  3CP8 A;  3GTK J;  3DCF A;  3BG5 A;  3OMY A;  4CCM A;  1YYV A;  2PFB A;  2PMZ A;  5FKK A;  3VOE A;  1K61 A;  2FMY A;  2IEK A;  3CCU I;  4IXA A;  1V55 H;  2KHM A;  3DEE A;  3MN2 A;  3GX4 X;  5FB2 A;  1CGP A;  4ZTJ A;  3BPX A;  4JBA A;  2WAF A;  4Y15 A;  2O03 A;  3ZMD A;  2LOO A;  3WTV C;  1DPU A;  1D1A A;  3U9G A;  4ESJ A;  3MVP A;  3FK6 A;  4EAT A;  2OQR A;  3CUQ C;  1B9M A;  3I59 A;  1OFC X;  3DBR B;  2VJ5 A;  4XSZ F;  3T8R A;  4L0Y B;  4BJT A;  4BBS J;  1N25 A;  1OYW A;  3TBI A;  2M4G A;  1ZAO A;  3F72 A;  2DN0 A;  3LSK A;  3K7A J;  5FJ8 J;  2AXL A;  2NS8 A;  2XSD C;  1YW8 A;  5HOO A;  3RKY A;  2EV6 A;  1QZZ A;  3OOU A;  2ZJQ F;  3QAH A;  2BYV E;  3BC8 A;  4BL0 B;  2L54 A;  4BXF A;  4L9T A;  4LIT A;  1MMS A;  3CDL A;  1KQ0 A;  5D6E A;  3GTM J;  4IRH A;  1X1C A;  4DJA A;  4S05 A;  1QRY A;  2LTP A;  3ZMV A;  2ZBK A;  2L7Z A;  3BR6 A;  2XAQ A;  5GP9 A;  3O2P E;  3RDI A;  1YJN I;  4BXX J;  2K9S A;  1FTZ A;  3QWL A;  2PEX A;  5CKT A;  1TLH B;  3L2Q A;  3PNT A;  2Y69 H;  3S2D J;  4AM3 A;  2EPF A;  2KIM A;  4CUG A;  1V5F A;  1I6H J;  1WI3 A;  3CP2 A;  3LOC A;  5EGO B;  2CSO A;  4EJO A;  1BR2 A;  3PM1 A;  1J5Y A;  4NHJ A;  2XB0 X;  3JRD A;  4RGU A;  4HNT A;  2P7V B;  2R92 J;  2IP2 A;  1OJL A;  2LC2 A;  2Y9Z A;  1F43 A;  2LH9 A;  1MBE A;  4LB6 B;  5DEQ A;  4ETS A;  1X4P A;  2K86 A;  3CJR B;  5D5W B;  3HOZ J;  1HSJ A;  4BGD A;  4A12 A;  1FMV A;  2L2O A;  1Z67 A;  3OWT A;  5D4R A;  2VB6 A;  2KP6 A;  5EG0 B;  1Y0U A;  1KYW A;  1WH7 A;  1JKO C;  4RGX A;  3AG4 H;  1TWA J;  5CQE A;  3OYJ A;  2K5C A;  5M5W J;  5LRS A;  1BR4 A;  3HRU A;  4KN7 X;  2JUG A;  2KKO A;  2IPQ X;  3RKQ A;  2XVC A;  2V9K A;  2VJJ A;  3IRQ A;  3QOP A;  1QVU A;  1XX5 A;  3O8G A;  3BPV A;  2P5L C;  3EQL F;  1UHS A;  2QUF A;  1U8B A;  2JVG A;  2X1C A;  5E1X A;  2Q8K A;  1HLV A;  3MKL A;  2CH0 A;  2DK5 A;  1TC3 C;  3W6V A;  5F1R A;  2DO7 A;  1RIO H;  1IRX A;  2E36 A;  2K9M A;  3K1N A;  2H1K A;  2XAS A;  4YEJ A;  2DQR A;  3LQR A;  3I5U A;  1TP4 A;  2HQR A;  5KAI C;  5BPI A;  2ZME C;  3E7L A;  1XTA A;  4NQW A;  1ETY A;  1VQP I;  2XGC A;  3P9K A;  2ECB A;  2JN6 A;  3KP3 A;  3QU6 A;  3BG7 A;  4E6K G;  2A05 A;  2WAD A;  4O3M A;  3KPH A;  2H8R A;  3GXO A;  2QZ8 A;  1SFX A;  3RKX A;  2QM3 A;  2RQQ A;  3MCZ A;  4HOB A;  2ID6 A;  4IEJ A;  4MQV A;  1Y39 A;  4XK4 A;  1G2H A;  3U2R A;  2G0E A;  1J2X A;  2I10 A;  4Y7N J;  2M5W A;  5LEK A;  1JHF A;  1YQA A;  2EQR A;  4Y3O A;  3H3V K;  3GBG A;  1V5E A;  1BI2 A;  4EJU A;  3FXU A;  2BHY A;  3PIP F;  4HF2 A;  2K85 A;  4XLE A;  2V9P A;  4C30 A;  3BTC A;  2HWV A;  1ZGW A;  2JMW A;  3CMM A;  3CMY A;  1Z7L A;  3KE2 A;  4Q47 A;  1E3O C;  2L01 A;  1UG2 A;  1YX3 A;  2MLG A;  2OAZ A;  1H0M A;  3P7N A;  1SFE A;  4RA2 A;  4BEH A;  3MMY B;  3BDD A;  4C2M J;  4G9Y A;  3WTT C;  1FY7 A;  3ERM A;  4G6T B;  4XRS A;  2PN6 A;  1MSF C;  1U8R A;  1D0X A;  4CSW A;  2QKL B;  1ZGJ A;  2XB5 A;  1S7A A;  2O6G E;  3CQZ J;  1HA8 A;  2HZT A;  1E0E A;  4TV7 A;  1VQ9 I;  3S2W A;  2DA1 A;  4HX4 A;  1ETQ A;  2X6Y A;  2AXT C;  5KVR A;  2R7Q A;  1RUN A;  2HYF A;  5IPA A;  3PNY A;  4BAC A;  1KU7 A;  1HKQ A;  4PSW A;  1IC8 A;  4I09 A;  1S29 A;  1FWZ A;  4RS8 A;  2HOS A;  2R7W A;  3JTH A;  4RAY A;  3Q5F A;  3MQ0 A;  1IAW A;  4QTR A;  2VKE A;  1SMT A;  1HCR A;  4BE2 A;  2H94 A;  2XGX A;  1QA6 A;  5M5X J;  1CQT A;  3H0G J;  2X9D A;  1WRJ A;  4GO1 A;  2KDO A;  2Z16 A;  4MFD A;  5GTH C;  2BY1 A;  2GIZ A;  3ZMT A;  3JW4 A;  1MNM C;  2BVL A;  1D0Y A;  3S1N J;  1ETO A;  3OYF A;  2BOL A;  5HLG A;  2PJR B;  3CCV I;  1E2X A;  1D1C A;  4D1Q A;  1WJB A;  1SVM A;  4YRV A;  3M7G A;  1YE9 A;  3C3W A;  2LRE A;  5IYB J;  3LSH A;  4F93 B;  3CO7 C;  2EIN H;  4KYW A;  3PSI A;  3I54 A;  2VJ4 A;  4B3A A;  3EDP A;  3TO9 A;  1PVE A;  5IOY A;  2E5N A;  3TW6 A;  1JT0 A;  4IHW A;  4AIJ A;  2LK2 A;  3QPL A;  1A36 A;  3I4N J;  3CD6 I;  3ULQ B;  2HQN A;  3DU5 A;  3OYE A;  2G7H A;  2W57 A;  4HRI A;  2RAE A;  4UUS A;  2R7S A;  2FXA A;  4KIF A;  5HNF A;  4FTH A;  4DNC A;  4C2U A;  2E2I J;  2MG4 A;  4AYB N;  4WXD A;  3S8P A;  2VXD A;  1X58 A;  3SXY A;  2MD5 A;  3S1Q J;  1PJR A;  4M6Y A;  4MLO A;  4ZDP A;  2O8X A;  4PZJ A;  2CUJ A;  2JSC A;  4HBL A;  3I56 I;  3AAF A;  3BCB A;  2JA8 J;  1LFP A;  1BI1 A;  2YSR A;  1U5T C;  1MMA A;  2HDW A;  4XR6 A;  5ICF A;  3KP6 A;  1OLT A;  2FX0 A;  3JRG A;  5JLW A;  3ZQL A;  4ABZ A;  1IUF A;  5TIS C;  4JX4 A;  3AL0 B;  1K4T A;  4LFU A;  2KIS A;  1FC3 A;  2DU9 A;  1SFO J;  5M3F J;  3K4L A;  1ZYR F;  2ELJ A;  3TGN A;  3TO7 A;  1UZC A;  5FFX A;  2PI0 A;  4D7N A;  1S72 I;  1O3R A;  4A3B J;  3JRE A;  2H6B A;  5DCF A;  5FKL A;  3I55 I;  5IOZ A;  2NNY A;  3HSF A;  1NK3 P;  2M8G X;  4LMY A;  1X2M A;  3OL4 A;  1FX7 A;  2JPB A;  1KQ8 A;  2H6C A;  1ZN2 A;  3FHZ A;  3CJN A;  3J80 Z;  2FBI A;  3RPQ A;  3LAP A;  5EEA A;  2XF7 A;  2FML A;  3OYL A;  2EFW A;  3M1C A;  3PFY A;  1TWC J;  1FMW A;  2CW8 A;  1J59 A;  1JE8 A;  4DYQ A;  2XC7 A;  1Z21 A;  2W82 A;  1F4K A;  3HB9 A;  1D1B A;  5TJJ A;  3G3Z A;  1XN7 A;  4AYB A;  2V1X A;  1HBX G;  5D8K B;  2VQH A;  4GXO A;  4BBR J;  2DK8 A;  2G7U A;  2VT2 A;  4MO7 A;  3WGH A;  4KNY A;  3E6D A;  2ZSI B;  3S93 A;  1U78 A;  2CMP A;  1X1A A;  2K9Q A;  2R3S A;  1R4N B;  3H3Z A;  1MSE C;  1ACI A;  1L0O C;  3B6A A;  1MGT A;  1WJC A;  2L3D A;  3FMR A;  1WFX A;  2EWN A;  4LJZ F;  4EGZ A;  1DU6 A;  3E1S A;  4FHT A;  2QBY B;  2A69 F;  4OIO F;  4P9F A;  2ECC A;  1WVR A;  2OZU A;  1R4M B;  2VKD A;  4YEL A;  1W0U A;  3T1B A;  1WHU A;  2W84 A;  1GV2 A;  1I3A A;  2DFI A;  4X1E A;  1IXS B;  5J4Y A;  3GTO J;  1Y0N A;  2ZXH A;  2VPL A;  3HSE A;  2E1M B;  1QO0 D;  4M9S A;  3ROU A;  4A3L J;  4K2E A;  1SAN A;  1R5G A;  3BR2 A;  1USS A;  2OV7 A;  5L3B A;  3W3C A;  1AOY A;  4A3E J;  2VUM J;  1X1B A;  4A0X A;  1STZ A;  4DIQ A;  4E7S A;  2F5F A;  1AKH B;  2HDD A;  1J0R A;  1RET A;  1FBQ A;  3K1P A;  1JKQ C;  4CCJ A;  5K7Z A;  1DU0 A;  3L2R A;  1ODD A;  2V4J C;  1EF4 A;  3E6C C;  4XSX F;  3HHG A;  3C7J A;  1ZAR A;  3L7W A;  2YU9 J;  2CQ7 A;  2P8T A;  2DMT A;  3H5N A;  2D5V A;  2MBF A;  5BMZ A;  1TT0 A;  2DTZ A;  3BG9 A;  3DPU A;  4OWR B;  1SFK A;  3GME A;  3NWS A;  3IRR A;  1A6I A;  1QVT A;  4NB5 A;  4N4N B;  4B09 A;  1YW9 A;  3ZP5 A;  1R1U A;  2NAZ A;  4RB3 C;  3AL0 C;  1FTT A;  5F04 A;  3I59 B;  3BOQ A;  4ZJZ A;  1BC8 C;  1OCZ H;  4WCG A;  2E2J J;  4LOC A;  2FU4 A;  3ABK H;  1S7E A;  5E79 C;  1R58 A;  5ED4 A;  5FKN A;  4PGH A;  4G94 A;  1XSV A;  3OYB A;  2CO5 A;  2EIJ H;  2X0L A;  5E8I A;  1BBY A;  1MH3 A;  2ADU A;  2QSH X;  3GF2 A;  4L5J A;  4F55 A;  3LSI A;  1T98 A;  3C1D A;  4UY8 I;  2L9R A;  5HDN A;  2YPR A;  1EV7 A;  1QZY A;  3WTY C;  1QU3 A;  3ZPL A;  2XHK A;  3ZMS A;  2MD0 A;  1XGM A;  3RPU A;  2JA5 J;  4F3Q A;  4EM2 A;  1OCP A;  3KP5 A;  2WY7 Q;  3OSG A;  3FK7 A;  4E70 A;  1T0F A;  2DTR A;  2EZH A;  3HRT A;  4HQE A;  5L3G A;  2R5Y A;  2JQ7 A;  2GA1 A;  3JAM Z;  4RM2 A;  3F8F A;  1UFM A;  1YJ9 I;  3KET A;  1IO2 A;  4U0W A;  3SDB A;  2FBH A;  2DLL A;  5CJ9 A;  1EH7 A;  2WY8 Q;  3A0H C;  2GXA A;  2ZKZ A;  2PMU A;  3K4J A;  1O3Q A;  2YR2 A;  4XKW A;  1ZR4 A;  5E1Z B;  5LGN A;  2LKP A;  1X2N A;  4EV0 A;  1DP7 P;  1RR8 C;  1SEU A;  2ZFU A;  1MBJ A;  3FKI J;  1RRJ A;  3BP8 A;  1X1D A;  1G6N A;  3ZQG A;  3M8F A;  4DQ2 A;  1XG1 A;  5H2F C;  3RPU D;  1WJ5 A;  3E3V A;  2QLZ A;  1JGS A;  2VKV A;  3SZP A;  4H0E A;  1K6Y A;  3QP6 A;  3HJE A;  2JUC A;  2LSO A;  2IT0 A;  2WA0 A;  2BY2 A;  4MFE A;  2NVT J;  5ILV A;  1WJE A;  4M9X A;  1JJ6 C;  2VOD A;  2GA2 A;  1MIJ A;  2E1M C;  4KFC A;  1I5Z A;  3EPZ A;  3MAJ A;  3JRC A;  3DPT A;  2PJR A;  3DTI A;  4FIS A;  5H20 A;  2J5O A;  2XPU A;  2BHZ A;  3HBL A;  4AID A;  4IF4 A;  5GAH J;  4HW0 A;  2KMU A;  2RGV A;  1XDU A;  2CFO A;  1Z9C A;  3ZQH A;  5JFR A;  1P92 A;  1T2K A;  3BT9 A;  2MC3 A;  2VL8 A;  4HDU A;  3TDZ C;  2UV1 A;  3LST A;  3S32 A;  2GM4 A;  3IUO A;  1FSH A;  1SD7 A;  1RR7 A;  2B9S A;  1BW6 A;  5ICE A;  3S1R J;  2ZNZ A;  3R60 A;  3EUA A;  3R0A A;  2M0C A;  4J00 A;  4OIQ F;  5L3C A;  1N77 A;  1BOA A;  5C44 J;  3LMM A;  5CVU A;  1IN7 A;  1TNS A;  2LKS A;  4RB1 A;  1P4X A;  3TQN A;  4PFO A;  2OF7 A;  4OIR F;  1MD0 A;  4CGZ A;  3JSO A;  2GWR A;  2CWE A;  3PIO F;  1OQY A;  3GFI A;  1GUU A;  2BE5 F;  2QQA A;  1WI9 A;  3TOB A;  3LSJ A;  4E7H A;  3KYL A;  3I3L A;  1ZRC A;  4IRI A;  1EA3 A;  3BG3 A;  3BTJ A;  4EM0 B;  2KT0 A;  3H9Q A;  5IY5 H;  5E3M A;  1Z77 A;  4V19 K;  2NOG A;  5HS8 A;  4NDL A;  2EFQ A;  4II2 A;  3H36 A;  5F0H A;  1KZH A;  2K4B A;  5DD4 A;  4M3G A;  3HZJ A;  3KYD B;  2DMN A;  5L3E A;  5LFA A;  2V6E A;  2K3P A;  1BOB A;  2OU2 A;  4I02 A;  5KCM A;  3HSR A;  1HF0 A;  4M6X A;  3PSF A;  1YW7 A;  4XID A;  4YII A;  3GTJ J;  4V2G A;  2F5C A;  2G9W A;  2QEN A;  1P6R A;  2HTS A;  3FMS A;  2DMP A;  4UNO A;  1FBS A;  3VYR B;  2D45 A;  1TQI A;  2MYS A;  2WB1 N;  3W2V A;  3PJR A;  2O8K A;  3K6G A;  3R6S A;  1A04 A;  2NS0 A;  2OPT A;  2LKX A;  5FGM A;  2KL4 A;  2J5P A;  3H0D A;  2JSP A;  2JTV A;  4PJM A;  3JCU C;  3KEY A;  1XMK A;  2Q2E A;  1G8X A;  3BWG A;  1CF7 A;  1Z05 A;  3WGG A;  1NHA A;  1KON A;  1RZ4 A;  3UNG C;  1MKM A;  3NEU A;  4UVB A;  3WE3 A;  5EEH A;  4IRG A;  1ZG5 A;  3J80 K;  3ERE D;  1E3P A;  2QVO A;  2BGC A;  3RTR A;  2MGQ A;  1K7A A;  1SD6 A;  2NYX A;  4BAY A;  5J47 A;  1PP7 U;  4IHV A;  2Y48 A;  3DFG A;  2NVY J;  4L5E A;  2M30 A;  5IP9 J;  1JKR C;  4BU2 A;  3HTS B;  1QGP A;  1BIA A;  1I39 A;  3DF8 A;  2DXI A;  4RAZ A;  3WTW C;  3LQQ A;  1YIT I;  3NWT A;  6PAX A;  4IX7 A;  1IXC A;  3Q0U A;  1VFC A;  2VOP A;  5FLM J;  5KNL A;  3GLX A;  1BC7 C;  1MND A;  2KDZ A;  3CC4 I;  5H6Q A;  1AKH A;  2DBB A;  3BJO A;  1OCR H;  3VSK A;  3W2A A;  2MLK A;  5DUI A;  3AKZ A;  2WB1 A;  2P5V A;  2ZCW A;  2OBP A;  5C4X J;  3FXK A;  4C3H J;  4FX0 A;  4C9Y A;  4A6E A;  5JHU A;  3HOT A;  3Q0V A;  1ON1 A;  2HPI A;  2VBZ A;  3AG1 H;  4HA8 A;  4XLN F;  2MAB A;  2IGN A;  1G4D A;  1IN8 A;  2JPC A;  1ETV A;  1MBF A;  5AON A;  3F21 A;  2JK3 A;  2GZW A;  3K4N A;  1IRG A;  2HU9 A;  5E18 F;  3I4M J;  1IN4 A;  2O7O A;  4HYE A;  4P96 A;  4XOR A;  1FIP A;  2NOJ B;  2EZL A;  4IHS A;  3RJP A;  4UUS B;  3OYN A;  1NG7 A;  5CVI A;  2HS5 A;  2IS2 A;  1T6S A;  2A6E F;  5FRO A;  1F9N A;  3FKJ A;  2KLO A;  2V6C A;  3CCY A;  2FSW A;  4AIK A;  4RAG A;  2Z2S B;  1LE8 A;  4AU7 A;  3TED A;  5FRM A;  4U87 A;  1HDD C;  3F6V A;  2FRH A;  2VQC A;  5M5Y J;  1WJD A;  4KIB A;  3FM3 A;  2PQ8 A;  2GLO A;  1XC5 A;  3K4M A;  2DMQ A;  3QOD A;  1W4M A;  2M45 A;  2FD5 A;  2W00 A;  3OYK A;  1GXQ A;  2CUZ A;  4GRI A;  4DBQ A;  3HM5 A;  4ENM A;  2VQG A;  1R00 A;  4HZF A;  3HYI A;  4XMY A;  3BZC A;  1W5T A;  4JK1 X;  2IS4 A;  4E7J A;  2GXG A;  4KIG A;  3EET A;  1S8N A;  5K5R A;  1BR1 A;  1YX5 A;  3ZQC A;  4KMU X;  3CDH A;  2HFH A;  4CZZ A;  1V5G A;  5F27 A;  2GIV A;  3HKZ N;  3R0J A;  3O6B B;  2EJR A;  4HAM A;  5LHI A;  4QIW N;  4IQJ A;  4CA0 A;  3GZ6 A;  2R4G A;  2E2H J;  3JAM K;  3V8J A;  4UB6 C;  1NH3 A;  1EJ9 A;  3MZY A;  3K70 C;  5D5X B;  2A68 F;  1MZB A;  4N9I A;  1O3S A;  3ZQ7 A;  2XV4 S;  1U0J A;  1YO5 C;  4RBO A;  1IRF A;  2IA2 A;  3DBH B;  1MJA A;  1D8K A;  2IGM A;  4ZZL A;  2RV8 A;  1FLI A;  1ZQ3 P;  4HLY A;  4WXH A;  2IGK A;  3ECO A;  1P4A A;  1OCC H;  4IO9 F;  3V42 A;  1WJF A;  2HQA A;  3F6O A;  3QQA A;  3OS0 A;  4E7K A;  2JA6 J;  1W5S A;  3LNQ A;  1V3F A;  2ISZ A;  1I1G A;  1OCO H;  4ENK A;  1BW5 A;  3I4P A;  2WBM A;  1UMQ A;  2L7M P;  3FF5 A;  3N05 A;  3TW7 A;  1IZ1 A;  2OTL I;  4P9U A;  4L18 B;  1ON2 A;  4MGR A;  3H1C A;  1GV5 A;  2LBF A;  5L3D A;  3WTX C;  2OTJ I;  5BS6 A;  5E3L A;  3ZMZ A;  4HLX A;  2PMH A;  1YG2 A;  3H92 A;  3U21 A;  2F4M B;  4LGW A;  1LPQ A;  2EA4 A;  4BDY A;  1IDZ A;  2M2E A;  1FIA A;  5TGT A;  1XSX A;  1OYI A;  4M73 A;  3HKZ A;  4UV9 A;  3KEO A;  2EH3 A;  4EM1 A;  3MD2 A;  1Z7U A;  3L2W A;  1IN6 A;  1ETX A;  1KA8 A;  1MNE A;  5AIP A;  2KPM A;  1YIJ I;  1OR7 A;  3ZMU A;  1A5J A;  4XOP A;  4LG0 B;  3QOE A;  2EFN A;  3ABT A;  5B1A H;  3FMQ A;  2FJ1 A;  3I58 A;  2L0K A;  4RGR A;  3A0B C;  2XRO A;  1PDN C;  2Q0O A;  5DM6 F;  4XRF A;  3WU2 C;  2IS6 A;  2W7N A;  3CCR I;  3M3Y J;  2LY9 A;  5C4J J;  1T39 A;  3OR1 C;  5E3O A;  4U0Y A;  3HGG A;  3CCE I;  2A6H F;  1B8I B;  2HI3 A;  5ERI A;  1KQ9 A;  2AHQ A;  5BNG A;  2DOE A;  1MMD A;  2QQ9 A;  1FJL A;  1K83 J;  2E1O A;  1ZRD A;  2P5K A;  3GFJ A;  3OIP A;  1DQU A;  4XIC A;  5D6F A;  2WV0 A;  4HF1 A;  1EH6 A;  1W5C C;  3FXL A;  4KUM A;  2Y0M A;  5K7F A;  1JUM A;  5LBQ A;  3DP7 A;  1K6O A;  5CVR A;  2VE8 A;  3G2B A;  4HPQ A;  1ZGA A;  3COA C;  1IJW C;  1K79 A;  1TTY A;  2XDV A;  2R5Y B;  4E7Z A;  3KZI C;  1JTX A;  4XQF A;  2GBY A;  2CV2 A;  3FXR A;  4FE7 A;  1RI7 A;  5K5O A;  1XS9 A;  4NBQ A;  1H8A C;  2NVU B;  2IA0 A;  1R36 A;  4HV5 A;  4XNF A;  4D5C A;  1YHQ I;  3J7A O;  1FOW A;  5DV5 A;  2VJI A;  1PUE E;  2X4H A;  3D1N I;  4HSR A;  1OYY A;  3VFZ A;  4CCO A;  2E34 A;  2LFB A;  4GCV A;  2R7R A;  4M3E A;  2ZC2 A;  3N97 A;  5D5U B;  4U0V A;  4YFN F;  2OC6 A;  4PJL A;  3PUF A;  3OYH A;  3LA3 A;  3GLL A;  2K40 A;  1MMG A;  3SFI A;  5J40 A;  1Q1V A;  2XAF A;  1R22 A;  2HOA A;  2COM A;  4XON A;  4KIT B;  5LGU A;  4NUB A;  3NRV A;  1ZLJ A;  3RYP A;  4XOT A;  4MTD A;  1U3E M;  4W1U A;  3K70 D;  3IAS 2;  2M9H A;  4BHP A;  1FBU A;  3B6C A;  5F1J A;  2CFX A;  3KFW X;  3NAU A;  1IW7 F;  3D0S A;  4KJZ A;  4IHX A;  2O9L A;  5GAE J;  1RUO A;  2E35 A;  2HXO A;  1Y8R B;  4BKX A;  1IF1 A;  2RKH A;  1O4X A;  2TRT A;  2NVQ J;  1WKM A;  1O57 A;  5CLS A;  4RLQ A;  2W85 A;  4ESF A;  5D4S A;  5JLX A;  2CUF A;  3KZY A;  3LA7 A;  1Y1V J;  4S04 A;  4G7Z F;  1RNL A;  2HVS A;  1ZHF A;  1YFH A;  1KU2 A;  1MBH A;  3FIS A;  4JX5 A;  2MFZ A;  5CQG A;  2F5V A;  3JRH A;  3V8L A;  2M1B A;  5J6X A;  2KZG A;  3A01 B;  3W2W A;  2VOO A;  1SVO A;  3SYT A;  1SAX A;  2OZ6 A;  1OKR A;  2IVM A;  2R0Q C;  3IP4 B;  5FD5 A;  4PJJ A;  3PO2 J;  1HC8 A;  2K27 A;  2V26 A;  3TOA A;  1D5V A;  3WOD F;  4A5M A;  5EJC A;  1ORK A;  3CDI A;  4FT8 A;  4G8X A;  4LB5 A;  3WTU C;  1T0F C;  2M7A A;  1G3W A;  2DFF A;  4XBF A;  3MZ8 A;  5K1Y A;  5BQT A;  2Y31 A;  2V1D A;  3LL7 A;  1WSU A;  2VQL A;  2HPM A;  2F2E A;  3GYH X;  1W36 D;  3BJA A;  4BJ6 C;  1RKW A;  2K02 A;  1I50 J;  1Z0X A;  3IAM 2;  4OMZ A;  4AD9 A;  1OCT C;  4MEX F;  1WCM J;  2NRA C;  2OD5 A;  3GTL J;  5IYC J;  4R8H A;  1F36 A;  1DUX C;  3H9J A;  1TNT A;  1WZ2 A;  1EH8 A;  3E5X A;  3ZOB A;  1RPW A;  1JJ8 C;  2K9L A;  4I2O A;  2XKP A;  4XLC A;  1C0W A;  4XM3 A;  1FP2 A;  2Q1Z B;  4IZZ A;  4A3I J;  4XLA A;  2CU7 A;  4I98 B;  5GAG J;  3J7A Y;  5IT9 Z;  2Q2E B;  4P55 A;  1H88 C;  1R1T A;  1CF7 B;  1FPQ A;  1BI0 A;  4CZC A;  1WJA A;  3PFI A;  1FZP B;  1G3S A;  3S16 J;  1JUP A;  4LG3 A;  4PGG A;  3JSP A;  1P7J A;  4HNU A;  4BE1 A;  1MBG A;  3Q0W A;  1I3Q J;  3S15 J;  3GUD A;  3I0T A;  2TDX A;  2QQB A;  3HOS A;  5IT3 A;  3P9C A;  2QGU A;  3QP5 A;  1VQ6 I;  2HZD A;  4WX9 A;  1QHH D;  2DDA A;  3MZH A;  5IP7 J;  2HDC A;  1W7P B;  2HYG D;  2CQQ A;  5DYM A;  2CV0 A;  2DQL A;  2V1N A;  3WE2 A;  4KIC A;  4FET A;  2XAJ A;  3VYU B;  2H1L A;  4LIV A;  3BZ6 A;  2R7F A;  2VLA A;  4BY7 J;  1XGS A;  5IYD J;  2Y2Z A;  2Z99 A;  1N75 A;  4KT6 A;  1R7J A;  4JQF A;  4A0Z A;  1M1E B;  2GOM A;  3RQ4 A;  4DYR A;  4B47 A;  3LFU A;  3OIO A;  2GOX B;  1YTY A;  2BY3 A;  5LLQ A;  4HX7 A;  3LFK A;  4BQO A;  3CO6 C;  4LG0 A;  5HS7 A;  1YI2 I;  2VC1 A;  1R5I D;  3K10 A;  1QQI A;  2A3S A;  4HNV A;  4UV8 A;  1VQO I;  3K1M A;  4WF2 A;  4ANJ A;  5FKM A;  3VYS B;  2EIM H;  1R71 A;  4F92 B;  4J19 A;  1YS7 A;  1MDM B;  2UXX A;  3V7C A;  2XKO A;  2DPU A;  5GAD J;  2LG4 A;  3CCM I;  2I8D A;  1B8I A;  3HOU J;  4IJA A;  1TWF J;  1WGX A;  1Q1H A;  2ZXW H;  2KRF A;  2R7V A;  1KGS A;  1K78 A;  3ZN0 A;  3CMA I;  4C3I J;  3DLA A;  4II3 A;  3GW2 A;  4LD5 A;  3G73 A;  1LE8 B;  1FOY A;  3A2K A;  1WPK A;  2KIF A;  4F91 B;  4WWC A;  2UXN A;  2VXZ A;  4IVN A;  4RGS A;  4J01 A;  4DW6 A;  3IV5 A;  2R93 J;  3EUH A;  1BJZ A;  3BCA A;  5IP6 A;  3ZQQ A;  3DEU A;  2ZNY A;  2DA7 A;  2F48 A;  2Z3Y A;  3EYY A;  2PLY A;  1UJ8 A;  4E7L A;  3IKV A;  4PDK A;  2JRM A;  2CQN A;  3SJM A;  1AHD P;  3CC2 I;  2HVR A;  4XN3 A;  4EQQ A;  4ON0 A;  3L2C A;  4CIC A;  1GHC A;  4WXC A;  2HYJ A;  4ZYH A;  1XSD A;  1WQ2 A;  4FE4 A;  4OAZ A;  1QHG A;  3HOV J;  3BJ6 A;  1BI3 A;  1GVJ A;  4PFP A;  5B3S H;  3BLY A;  2L9N A;  1D8J A;  2L9S A;  2M87 A;  2HVQ A;  1BA5 A;  1FT9 A;  1HXD A;  4HX8 A;  2QWW A;  2XRN A;  1W0T A;  5EYR A;  4FCY A;  2FOK A;  4MNU A;  3GO5 A;  4RAF A;  4BY1 J;  3G1L A;  4RB0 A;  1BN5 A;  3CES A;  1N78 A;  1Z1D A;  1A6Q A;  2KQR A;  2VBY A;  1FYL A;  2DT7 B;  1SVL A;  2EV5 A;  2OJE D;  4JP0 A;  3AG2 H;  2NS7 A;  3QYB A;  2L7K A;  2OA4 A;  2ACJ A;  4I7H A;  2CQK A;  1A35 A;  1OMI A;  3IC7 A;  2E71 A;  2W25 A;  2FOW A;  3DV8 A;  3RIR A;  2XAH A;  3DKY A;  1XGN A;  2DOF A;  2W48 A;  1HST A;  5J1Y A;  3HOY J;  3OYC A;  1IRZ A;  1B72 A;  1YOV B;  4OIN F;  3F3X A;  1VQK I;  2LBF B;  1Y56 A;  3HC7 A;  4I76 A;  5E1W A;  4BXU A;  2DT6 A;  2DFH A;  1IXR C;  2O61 A;  4A69 C;  1VND A;  2Z1D A;  2DOA A;  1AU7 A;  2R5Z A;  2V7F A;  4KN4 X;  4HDV A;  1MW7 A;  3G4S I;  2Z5U A;  1MJB A;  3KIO A;  3KLN A;  3Q9S A;  4JX6 A;  4QWQ A;  1D0Z A;  2MH2 A;  3A01 A;  4G7O F;  5FLV A;  2F5D A;  3SEZ A;  4S0H B;  1X19 A;  2CJJ A;  2GXB A;  5HOD A;  2CS3 A;  4XLF A;  1TWH J;  3S14 J;  3K69 A;  1YJW I;  2DYS H;  1J75 A;  4L9V A;  2R7X A;  1D3Y A;  4AC0 A;  2FUG 2;  2QYO A;  1SFU A;  5DTD A;  1ULY A;  4YIR X;  2BXZ A;  5K5Q A;  2IW5 A;  3K2A A;  3OV8 A;  1ENH A;  4DGW B;  2RDP A;  4N4O B;  2O5R A;  4B44 A;  3F0C A;  3Q3S A;  2PX9 A;  2LF7 A;  3M9A A;  2X85 A;  4BH9 A;  3B02 A;  3VDX A;  1VQ5 I;  2DT5 A;  2TCT A;  4A2U A;  3WGI A;  2JZY A;  2A61 A;  2HOE A;  3FBN B;  3CZ6 A;  4HQM A;  3IL2 A;  1VQ4 I;  2ME0 A;  2Y0S N;  3AFH A;  1TQP A;  4QSH A;  3R61 A;  3ZQI A;  3C2B A;  3OL3 A;  3I9V 2;  3FZV A;  3QYE A;  2B7E A;  1TT5 B;  2DDB A;  3GEZ A;  3UR3 C;  1LDJ A;  1P9Q C;  4XN0 A;  4DYC A;  3OS1 A;  2EV0 A;  3ZCO A;  4CXF A;  3L9F A;  4I0B A;  5HNH A;  5C3E J;  4CHU A;  4QPO A;  1MBK A;  1KU9 A;  3K4C A;  5K7H A;  1GT0 C;  3OYA A;  2Y30 A;  5DCM A;  4DOZ A;  2X6O A;  4XRM A;  2DJI A;  2XF6 A;  1H9G A;  4PJ0 C;  5IT9 K;  1D5Y A;  1P7I A;  4DZP A;  3VSL A;  1U6G A;  3H35 A;  1W7P A;  2EK5 A;  2K9N A;  5FFZ A;  5DS9 A;  4Z2Y A;  3BR3 A;  5L3F A;  2FF4 A;  4ZYD A;  2P6S A;  1XMA A;  2QKM B;  3R4K A;  4UHT A;  4AUX A;  1T38 A;  1SC7 A;  3LSR A;  2R7O A;  2CG4 A;  1U9N A;  2KZV A;  2Y0S A;  2E60 A;  2WWY A;  1ZTR A;  2Y9Y A;  3BZK A;  3C18 A;  2D1V A;  2VBW A;  3CCQ I;  5TRD A;  2ISY A;  5JI6 A;  2DA5 A;  3NAR A;  3FDY A;  4HF0 A;  2M0M A;  3OYM A;  4Y52 J;  1ETK A;  3OS2 A;  1OR7 C;  2ME6 A;  2JJ7 A;  2STW A;  3JRF A;  1W7P D;  4XKC A;  4IHT A;  1MDM A;  4G12 A;  1EKE A;  3GCM A;  1ZR2 A;  1JT6 A;  4HV6 A;  3K0L A;  2IGO A;  2BW3 A;  1S7O A;  2V1U A;  1DGR M;  3FX3 A;  3NQO A;  3MKZ A;  3SFZ A;  3CC7 I;  4A0Y A;  3ZR8 X;  3V7S A;  1QPI A;  2ZXJ A;  1POG A;  2A5W A;  2ELK A;  1JXS A;  1IUY A;  3MKW B;  3A1Y A;  4KA4 A;  5BPD A;  3KCC A;  1R9T J;  1NK2 P;  1X1P A;  2EA2 A;  4V2F A;  4IHY A;  3LSP A;  4FAS D;  2M34 A;  4KDP A;  1MJ9 A;  1UB9 A;  4L9J A;  4OIP F;  2L5Q A;  1FEX A;  2LLK A;  4ZYG A;  3ABU A;  1LFU P;  4MEY F;  1DP3 A;  1I6X A;  3X2Q H;  2ZME B;  2OCE A;  2JA2 A;  3P5J A;  3A02 A;  2X48 A;  3T0Y A;  1HW1 A;  3WG7 H;  1J7K A;  1XMX A;  4BHB A;  4E7I A;  1SD5 A;  3F8N A;  4M3B A;  2LF8 A;  2NXN B;  1ZRE A;  4Y33 A;  3S1M J;  1KU3 A;  4UUT A;  1B6A A;  4L9N A;  3TP0 A;  3U1D A;  3I64 A;  3E5U A;  1FOX A;  4F7Z A;  3IKT A;  2HTJ A;  2OQG A;  2IJL A;  3BTL A;  3OYG A;  1G59 A;  2ZB9 A;  2W1O A;  4I01 A;  1Z3Y A;  3A4C A;  3H5A A;  3HG9 A;  1I1S A;  3PNV A;  1YS6 A;  3IHU A;  5FO5 A;  1UEL B;  4U7B A;  2L02 A;  3HIF A;  4PK4 A;  4B48 A;  4HG2 A;  5FKO A;  3KLO A;  3A03 A;  4YFK F;  3CF2 A;  2HGC A;  1RKT A;  2KIU A;  4L5I A;  4P5O A;  4MHG A;  1T56 A;  2YX4 A;  3LA2 A;  2KJB A;  5A2Q Z;  4EGY A;  1R6R A;  2GQQ A;  3E5Q A;  4M3D A;  2QQ8 A;  2DOD A;  2ZJ2 A;  2XPW A;  1UCR A;  1ZG3 A;  3MKY B;  1PUF B;  3CCJ I;  2DPD A;  2EB7 A;  4AVZ A;  3ABL H;  5HLT A;  3JRA A;  3VWB A;  1LEA A;  2KRH A;  4PCQ A;  3OOP A;  4ZYA A;  1X3Z B;  4BS9 A;  3AG3 H;  1HKT A;  2CYY A;  3L1P A;  4R79 A;  1T95 A;  3HUG A;  1QNT A;  2HXI A;  4N9H A;  3QRF F;  3HEF A;  5KK1 A;  4JYK A;  4G6D A;  3CJT B;  3D5S C;  2KJC A;  3FWE A;  4HEA 2;  3ZRG A;  4A3D J;  3LAJ A;  2MSY A;  2F6C A;  2BY0 A;  2MH9 A;  3HHH A;  1LEB A;  3LSG A;  2FA5 A;  2LVS A;  3T8T A;  1XGO A;  2FE3 A;  4E4H A;  3H5R A;  1YLF A;  2K3F A;  4QLC U;  2WV1 A;  2HKX A;  2JVH A;  2LP0 A;  2WC2 A;  2A07 F;  3JRB A;  1W1W E;  3E6B A;  2W24 A;  3L2U A;  2PBI A;  4AVP A;  2L4M A;  1W36 C;  3FXO A;  4PSX A;  3VPR A;  3K4B A;  1R1V A;  2M4K A;  2N8G A;  2IAI A;  5ILU A;  4QPQ A;  4LK0 F;  4LLL A;  2F5E A;  4O5V A;  1ZKG A;  1FYM A;  4KT5 C;  3F8M A;  3FXJ A;  4Z6Y A;  1ZK8 A;  2RRE A;  3BR0 A;  4B4C A;  3M1E A;  3VYT B;  5E17 F;  4Y17 A;  1LVA A;  3OIQ A;  4G7H F;  4CO8 A;  2VC0 A;  3KEQ A;  3CME I;  3S2H J;  3WU0 A;  4NC6 A;  1Y1W J;  5EDN A;  3KYC B;  4UVA A;  3HDD A;  3HPH A;  5KAF C;  2E1C A;  1K78 B;  1AWC A;  4UUV A;  4OMY A;  4L0Z B;  3GWZ A;  1FP1 D;  2MA3 A;  3SQN A;  2O3F A;  1APL C;  3TP3 A;  3CUQ A;  2YS9 A;  3EUK L;  5LHG A;  3M07 A;  2DA6 A;  4ZC3 A;  3IWZ A;  1BJA A;  1FYK A;  3CTA A;  5GTI C;  3E97 A;  3F8C A;  1F5T A;  1R49 A;  4BHC A;  4BQN A;  2OCC H;  1OPC A;  3HXL A;  1UAA A;  5HS9 A;  5EF6 A;  4RB2 C;  3JR9 A;  2BVM A;  3F8B A;  4UB8 C;  5CPR B;  1S5L C;  4A3M J;  1U5T B;  1Z6T A;  3FHN A;  2V79 A;  2CV1 A;  2FQ3 A;  3ABM H;  3IH3 A;  4LK1 F;  5F64 A;  1Z91 A;  2FEZ A;  2VKH A;  2Z9O A;  2CW7 A;  2OUM A;  3PUB A;  4BJ5 C;  1B1B A;  1TBX A;  5ICC A;  2QSF X;  1Y6I A;  3BY6 A;  5D8L B;  3RCO A;  4FX4 A;  2EFO A;  3OY9 A;  2JA7 J;  3FM5 A;  1HKS A;  2WAQ N;  3RI4 A;  5LRR A;  2ZO4 A;  4DBR A;  1VTN C;  1R23 A;  2R7U A;  3DKW A;  1R5H A;  2DAO A;  2B0L A;  5E20 A;  1X3U A;  3TKY A;  3G1O A;  3QPS A;  1JTY A;  1TWG J;  1LDD A;  2UUZ A;  4B43 A;  1K4S A;  2ELH A;  4PJN A;  1JKP C;  1TL8 A;  1LUJ B;  1PYV A;  2HNH A;  1H9T A;  5DD8 A;  4C2T A;  2DA2 A;  3D5L A;  1DGW Y;  4LLG F;  3ASN H;  2D1H A;  3BTI A;  3TL4 X;  4IL6 C;  2IXS A;  5LGT A;  4R1H A;  2HKO A;  1IGN A;  1JI8 A;  4XL9 A;  5F0F A;  2X6X A;  2I5U A;  1MMN A;  4A3J J;  2ICW G;  2XGD A;  5JR3 A;  3P9I A;  3DU6 A;  3O3K A;  5JVT A;  2VAS A;  2FNP A;  3ZN1 A;  5E8G A;  4ITV A;  3MFK A;  3GTQ J;  1IDY A;  2RC4 A;  3WHC A;  2KFD A;  4XKV A;  4KMF A;  1B72 B;  4IPA A;  4C3J J;  2AQF A;  1V4R A;  3TO6 A;  1IV6 A;  2COB A;  2CRG A;  2VIX A;  1XCB A;  5FRN A;  4FQG A;  2VE9 A;  3KX2 A;  4WK8 F;  3GTG J;  2WAQ A;  4EJV A;  1LJ9 A;  1BM9 A;  5LEJ A;  2R5Z B;  3WTS C;  1VQ8 I;  4D5F A;  5FLX K;  1HQC A;  1IG7 A;  2HOT A;  3JTG A;  2GAU A;  3RYR A;  1GLN A;  1F1Z A;  1Z6R A;  3BR1 A;  4H4K C;  5J1R A;  3DBL B;  3GZ5 A;  2VBX A;  4GGG A;  3VEP A;  9ANT A;  2L4A A;  3DKX A;  2ZME A;  3S3M A;  4Q5S F;  2P4W A;  3HRS A;  5CVJ A;  2LDU A;  2IBD A;  2FBK A;  2F4I A;  3ML6 A;  5F0C A;  2P81 A;  3ZGK A;  4ASN A;  4XRS G;  4CH7 A;  3EUH C;  4XKB A;  1UHW A;  2DCE A;  2ZFW A;  3CLQ A;  3V7R A;  3KP7 A;  1JHH A;  3HOX J;  4A3G J;  2H09 A;  5KHD A;  1JGG A;  1E17 A;  5AIQ A;  5HLH A;  4IKF A;  2DA3 A;  4JOM A;  1GDT A;  2LMD A;  1I27 A;  4I6Z A;  1SMY F;  3PL8 A;  3FXQ A;  3V4G A;  1SD4 A;  1J09 A;  1O3T A;  1LB2 A;  4LIU A;  2IRF G;  1HW2 A;  4HST A;  3G71 I;  2BV6 A;  3LSM A;  3J81 Z;  1ZH5 A;  3TMO A;  3W6K B;  1PP8 F;  4CDG A;  1XB4 A;  4UXN A;  5BOX A;  2VPR A;  3G6E I;  4D7M A;  2R7D A;  2UZK A;  1X4O A;  2Z33 A;  1H89 C;  3U1K A;  1HOM A;  2QCO A;  4P1W A;  2Y75 A;  3LWF A;  4ZH4 F;  3DPL C;  1E3H A;  5EGO A;  2LY1 A;  4ZYE A;  1SAU A;  5ILS A;  1T08 B;  5GPA A;  2QA4 I;  3RZD J;  4M74 A;  2FNA A;  3B73 A;  1RC9 A;  3E0J B;  2VI6 A;  1FNN A;  5HDG A;  2V9V A;  4RMN A;  4Y4R A;  2CQX A;  2A6T A;  2X6W A;  3HOW J;  1YIO A;  1REP C;  2E7X A;  2DJN A;  5J3L A;  1PUF A;  2BXY A;  1B4A A;  2ETH A;  4XLH A;  5E3N A;  5CYV A;  2XSJ C;  5J4V A;  3SZT A;  3CLO A;  4RM3 A;  5DCM B;  5M3M J;  2P7C B;  3S3O A;  3DTK A;  2EFP A;  5EG0 A;  1U2W A;  2AQE A;  3DXJ F;  3SHF A;  4UVC A;  5A2Q K;  1A31 A;  4GDF A;  3H3U A;  1VQ7 I;  2PJP A;  3SZG A;  4ZTF A;  5B5E C;  4ENN A;  4AWX B;  1LKX A;  2RN7 A;  2W4S A;  4BYY A;  5HVQ C;  4CYC B;  3GVA A;  3S17 J;  1J9I A;  2YU3 A;  1XDS A;  2LRD A;  5DDG A;  2C6Y A;  2O0Y A;  1BIB A;  4GYG A;  1VQN I;  1LFB A;  4NNJ A;  1O7L A;  3FIW A;  4EJW A;  1YRN B;  3TDU C;  1KYZ A;  1T8I A;  3L00 A;  4YIF A;  4IOA F;  2LNB A;  1RES A;  3DEW A;  3GZN B;  4M6V A;  4ENJ A;  3BRO A;  3I71 A;  4BE0 A;  4MQ9 F;  4XLP F;  4CCN A;  4M72 A;  2H27 A;  2EIL H;  3HPG A;  2BW3 B;  3Q9V A;  2JRT A;  2PG4 A;  2F4O B;  2HR3 A;  1ZEL A;  2AS5 F;  4D9J A;  2QSG X;  2L9V A;  2X51 A;  3N4M A;  1XCV A;  5HDK A;  1OIS A;  1X3W B;  4LLN A;  2MC4 A;  4Q48 A;  3GTP J;  5JVG F;  3BQZ A;  2ESN A;  4RLF A;  1LQ1 A;  4DZJ A;  2CW0 F;  5F6F A;  5GPC A;  3FXM A;  2L7F P;  5ICG A;  4I99 C;  2WTE A;  3G1M A;  3F23 A;  3T5X A;  2EBI A;  4ZDO A;  3IWF A;  4B3X A;  3O8H A;  2CUE A;  5EZG A;  2STT A;  1VQM I;  1ONV A;  3QPH A;  4OOI A;  4AIH A;  4A93 J;  1U5T A;  3L09 A;  2CGP A;  3HRM A;  3UKG A;  2E5Z A;  3KZZ A;  3SEQ A;  1V54 H;  2XPV A;  2EZK A;  4EVI A;  1VZ0 A;  1G3Y A;  3ECH A;  3BR5 A;  3DWL E;  2XUB A;  5LD2 C;  4BDZ A;  3W6J B;  2BZT A;  1QPM A;  3OYI A;  3FBI B;  1VI0 A;  1ZG1 A;  2E7W A;  3IH4 A;  2XIG A;  2MW8 A;  5J8C A;  4GYI A;  5JHF A;  1VF9 A;  1TZL A;  1S6L A;  1GVD A;  4PUS A;  1O7F A;  3BQY A;  3ISP A;  3IH2 A;  1ITY A;  1WWX A;  2DI3 A;  3CCL I;  1G3T A;  3SDG A;  4Q4Z F;  1XPX A;  1XD7 A;  2VT3 A;  3I53 A;  2ZXI A;  3V8K A;  4A3K J;  1LDK B;  2FQ4 A;  1LNW A;  1ZRF A;  3PO3 J;  2E19 A;  3WHB A;  3VB2 A;  2DA4 A;  4ZDL A;  2ZSH B;  2E1N A;  2LYC A;  2B63 J;  1ETW A;  1T33 A;  3ELK A;  5DM7 F;  3C2G A;  3HUG B;  2ESH A;  2XAU A;  1B9N A;  4NC8 A;  3CF5 F;  1VQL I;  3WU1 B;  4BQQ A;  4M3F A;  2NNN A;  2P0W A;  4RDU A;  2HQ5 A;  3D5R C;  4YFX F;  2XRL A;  3RZO J;  1AA7 A;  3ESW B;  4A3F J;  1UHM A;  1Y8Q B;  2DW4 A;  3HGY A;  2QF7 A;  4F52 A;  2ZJR F;  2RQP A;  1QZE A;  2XF5 A;  1DDN A;  4A3C J;  3REO A;  4BQA A;  5CVV A;  2IA1 A;  3QPT A;  3CJQ B;  3MEX A;  4G6Q A;  4U7D A;  3EYI A;  4M71 A;  1MH4 A;  3M8E A;  2ZJP F;  2H8W A;  4A5N A;  4EMS A;  3M8J A;  4A6D A;  1UG0 A;  2ID3 A;  4NQW B;  1ZLK A;  1QBJ A;  3JRI A;  2M7B A;  3KP4 A;  4D0P A;  3F22 A;  2KRC A;  3QU3 A;  3ASO H;  3BG6 A;  4X6A J;  1WH5 A;  5EEG A;  4X0G A;  2UWM A;  1GXP A;  2A5Y B;  2KIQ A;  4CCK A;  3H9G A;  4GFB A;  4Y13 A;  3CUQ B;  2RNG A;  2LD5 A;  3M4O J;  3RSN A;  5LHH A;  3C2H A;  5DUK A;  3GFM A;  3F9K A;  3RQI A;  4BNC A;  1HDP A;  2WAE A;  2BEO A;  3PQJ A;  1S9H A;  3MWM A;  4MIM A;  4NC7 A;  3OSF A;  2BBY A;  4ZZD A;  1TQM A;  1TW2 A;  2DYR H;  4O6J A;  3J7Z I;  4KIS A;  5HLI A;  2RNJ A;  2JT1 A;  3S3N A;  3E6M A;  1IV8 A;  5D5V B;  3WTZ A;  1FOK A;  3RKW A;  2LY2 A;  5B66 C;  4BEH B;  1IN5 A;  3J81 K;  1Z3X A;  5F08 A;  3ONQ A;  2XGE A;  2K7L A;  3QYF A;  1FSE A;  5FD6 A;  1JUS A;  4N0B A;  3HL2 A;  1P2F A;  2P6T A;  4EEF G;  1NG6 A; 
#chains in the Genus database with same CATH homology
 1QU3 A;  3D5S C;  2M3A A;  4HEA 2;  3OR2 C;  3ZRG A;  2MD0 A;  2HVS A;  1ERD A;  4F3Q A;  2F6C A;  4IQ4 A;  2WY7 Q;  3DQV C;  2MFZ A;  5CQG A;  3K4K A;  3LSG A;  2F5V A;  2X1E A;  3L2V A;  4RM2 A;  3W2W A;  4OAY A;  3SYT A;  2R7T A;  4E4H A;  3SDB A;  3H5R A;  3OYD A;  3IP4 B;  4PJJ A;  2JVH A;  2WY8 Q;  3K4J A;  2V26 A;  4XKW A;  3L2U A;  1W36 C;  4PSX A;  1LVK A;  3K4B A;  2M4K A;  2ZFU A;  2X1D A;  1T0F C;  4QPQ A;  2M7A A;  4CCL A;  1X1D A;  3LL7 A;  2VQL A;  2HPM A;  2RRE A;  4BUP A;  3RPU D;  1WJ5 A;  3VYT B;  1W36 D;  4BJ6 C;  3OIQ A;  3IAM 2;  1K6Y A;  2WA0 A;  3HPH A;  3ZXS A;  2IS1 A;  3H9J A;  3DTE A;  1WJE A;  3CP8 A;  2E1M C;  2K9L A;  3EUK L;  4XLC A;  3EPZ A;  4XM3 A;  4IZZ A;  2Q1Z B;  4ZC3 A;  3OMY A;  4CCM A;  4XLA A;  3DPT A;  2PJR A;  3J7A Y;  2PMZ A;  2Q2E B;  3DTI A;  4BQN A;  2KHM A;  3DEE A;  4CZC A;  1WJA A;  3HXL A;  4ZTJ A;  1UAA A;  2KMU A;  2WAF A;  4LG3 A;  2LOO A;  4HNU A;  2BVM A;  2CFO A;  4BE1 A;  1D1A A;  5CPR B;  4EAT A;  2VL8 A;  3FHN A;  2CV1 A;  2VJ5 A;  2UV1 A;  2VKH A;  3S32 A;  4BJT A;  2CW7 A;  2OUM A;  3IUO A;  3PUB A;  3TBI A;  2M4G A;  4BJ5 C;  3HOS A;  1Y6I A;  3LSK A;  3EUA A;  2HZD A;  3RCO A;  1QHH D;  3OY9 A;  4J00 A;  5HOO A;  1N77 A;  3OOU A;  4DBR A;  3LMM A;  2R7U A;  3BC8 A;  4BL0 B;  4BXF A;  2V1N A;  4LIT A;  2CV0 A;  4FET A;  3VYU B;  1X1C A;  4DJA A;  4PFO A;  4LIV A;  2UUZ A;  4B43 A;  2VLA A;  1N75 A;  4KT6 A;  4JQF A;  4PJN A;  2GOM A;  3RQ4 A;  2HNH A;  1PYV A;  3LFU A;  4B47 A;  2GOX B;  4E7H A;  4C2T A;  5CKT A;  3D5L A;  3KYL A;  3I3L A;  1DGW Y;  3L2Q A;  3PNT A;  4BQO A;  1EA3 A;  3H9Q A;  3K10 A;  4CUG A;  1V5F A;  3CP2 A;  4II2 A;  3TL4 X;  4ANJ A;  1BR2 A;  2IXS A;  1JI8 A;  3VYS B;  4XL9 A;  2X6X A;  4F92 B;  1MMN A;  4HNT A;  5LFA A;  2V6E A;  2K3P A;  3DU6 A;  2VAS A;  1BOB A;  2LC2 A;  5KCM A;  2LG4 A;  4ITV A;  2I8D A;  2LH9 A;  3PSF A;  4XKV A;  1X4P A;  2AQF A;  3CJR B;  2R7V A;  3VYR B;  3PJR A;  3W2V A;  2MYS A;  4BGD A;  1FMV A;  2L2O A;  3OWT A;  2VIX A;  2VB6 A;  2KP6 A;  3K6G A;  3DLA A;  4II3 A;  5FRN A;  3KX2 A;  5CQE A;  3OYJ A;  2KL4 A;  2WAQ A;  3H0D A;  2JSP A;  2K5C A;  3A2K A;  4PJM A;  1BR4 A;  4F91 B;  3KEY A;  2JUG A;  2VXZ A;  1G8X A;  4J01 A;  2V9K A;  2VJJ A;  1KON A;  1GLN A;  3UNG C;  3BCA A;  4H4K C;  2JVG A;  2X1C A;  3ZQQ A;  2CH0 A;  3S3M A;  3DKX A;  4E7L A;  3RTR A;  2F4I A;  2HVR A;  4XN3 A;  1IRX A;  2K9M A;  3ZGK A;  4YEJ A;  4OAZ A;  4CH7 A;  1QHG A;  3EUH C;  4XKB A;  2DCE A;  4PFP A;  4BU2 A;  5KHD A;  3BLY A;  2L9N A;  2L9S A;  2DXI A;  4IKF A;  2HVQ A;  4JOM A;  3NWT A;  3PL8 A;  4IX7 A;  3BG7 A;  4E6K G;  5KNL A;  1J09 A;  2WAD A;  4LIU A;  1MND A;  4HST A;  3LSM A;  3TMO A;  3VSK A;  2RQQ A;  3W2A A;  3AKZ A;  2WB1 A;  3CES A;  1N78 A;  1X4O A;  2KQR A;  2DT7 B;  4P1W A;  4C9Y A;  3QYB A;  3HOT A;  3DPL C;  2LY1 A;  2HPI A;  2L7K A;  4Y3O A;  1SAU A;  2MAB A;  3GBG A;  1V5E A;  2IGN A;  4XLE A;  4C30 A;  3E0J B;  3K4N A;  4RMN A;  2HU9 A;  4Y4R A;  2A6T A;  2X6W A;  3CMM A;  3DKY A;  1Z7L A;  4XLH A;  4XOR A;  3OYC A;  2NOJ B;  1YX3 A;  2XSJ C;  3OYN A;  1NG7 A;  1Y56 A;  3HC7 A;  4RM3 A;  2LBF B;  4BEH A;  2IS2 A;  3MMY B;  2DT6 A;  5FRO A;  3S3O A;  3DTK A;  3FKJ A;  2KLO A;  2AQE A;  4G6T B;  2Z2S B;  2Z1D A;  2DOA A;  1D0X A;  4AU7 A;  5FRM A;  4CSW A;  2QKL B;  4U87 A;  2V7F A;  1HA8 A;  1E0E A;  3SZG A;  2VQC A;  1WJD A;  4ZTF A;  1MW7 A;  2X6Y A;  1LKX A;  2R7Q A;  2W4S A;  5HVQ C;  3K4M A;  3PNY A;  3QOD A;  4BAC A;  1D0Z A;  2LRD A;  4PSW A;  2W00 A;  3SEZ A;  4GRI A;  2CUZ A;  4DBQ A;  3OYK A;  1X19 A;  4NNJ A;  2VQG A;  2CS3 A;  4XLF A;  2R7W A;  4XMY A;  2IS4 A;  2R7X A;  4E7J A;  2FUG 2;  4BE2 A;  1BR1 A;  1YX5 A;  4DGW B;  1V5G A;  4N4O B;  2O5R A;  4BE0 A;  4B44 A;  4CCN A;  4IQJ A;  3HPG A;  4CA0 A;  2BW3 B;  2KDO A;  2R4G A;  2X85 A;  2Z16 A;  1ZEL A;  3VDX A;  4D9J A;  2X51 A;  3K70 C;  2BVL A;  1D0Y A;  2MC4 A;  3FBN B;  3CZ6 A;  4RLF A;  1U0J A;  3OYF A;  2BOL A;  2PJR B;  3AFH A;  1D1C A;  4D1Q A;  2IGM A;  1WJB A;  3OL3 A;  4YRV A;  1YE9 A;  2IGK A;  2LRE A;  3I9V 2;  3LSH A;  4F93 B;  3QYE A;  3PSI A;  4ZDO A;  4B3X A;  3V42 A;  2VJ4 A;  1WJF A;  2HQA A;  3OS0 A;  4E7K A;  2E5N A;  3UR3 C;  1P9Q C;  4XN0 A;  3OS1 A;  3ZCO A;  5HNH A;  2WBM A;  4QPO A;  3DU5 A;  3N05 A;  3OYE A;  3K4C A;  4HRI A;  2E5Z A;  2R7S A;  3SEQ A;  3OYA A;  5HNF A;  2LBF A;  4C2U A;  4DOZ A;  3S8P A;  2VXD A;  2DJI A;  3U21 A;  2XF6 A;  1PJR A;  1VZ0 A;  4MLO A;  4ZDP A;  4BDY A;  2CUJ A;  3DWL E;  3VSL A;  5LD2 C;  3H35 A;  3BCB A;  5TGT A;  1LFP A;  4XR6 A;  4BDZ A;  1MMA A;  2HDW A;  3HKZ A;  1OLT A;  3MD2 A;  3L2W A;  1MNE A;  3FBI B;  3OYI A;  2QKM B;  2KPM A;  3AL0 B;  4XOP A;  3QOE A;  3K4L A;  2R7O A;  2ELJ A;  5JHF A;  1TZL A;  2KZV A;  2Y0S A;  2E60 A;  4PUS A;  2IS6 A;  2W7N A;  3FDY A;  2M0M A;  3OR1 C;  3OYM A;  3OS2 A;  1OR7 C;  3OL4 A;  2ZXI A;  4XKC A;  1LDK B;  1MMD A;  2XF7 A;  2IGO A;  3OYL A;  2BW3 A;  3M1C A;  1DGR M;  3PFY A;  1FMW A;  2CW8 A;  3MKZ A;  4ZDL A;  3ZR8 X;  2XC7 A;  1Z21 A;  2ZSH B;  2LYC A;  3OIP A;  1DQU A;  2W82 A;  2A5W A;  3C2G A;  3HUG B;  2XAU A;  4NC8 A;  1D1B A;  3A1Y A;  3MKW B;  4BQQ A;  4AYB A;  2P0W A;  2VQH A;  3D5R C;  4FAS D;  1AA7 A;  2L5Q A;  4HPQ A;  3G2B A;  2ZSI B;  3S93 A;  2CMP A;  1X1A A;  2XDV A;  1DP3 A;  4F52 A;  4E7Z A;  4XQF A;  2JA2 A;  2XF5 A;  2CV2 A;  1WJC A;  4E7I A;  1WFX A;  3E1S A;  3CJQ B;  4XNF A;  4Y33 A;  4YEL A;  2VKD A;  2VJI A;  3M8J A;  4HSR A;  2ZXH A;  2VPL A;  1UG0 A;  4CCO A;  2E1M B;  4NQW B;  2R7R A;  1G59 A;  2M7B A;  3OYG A;  2OV7 A;  3W3C A;  2W1O A;  1Z3Y A;  2KRC A;  3A4C A;  1X1B A;  3H5A A;  4DIQ A;  3HG9 A;  4E7S A;  3BG6 A;  3PNV A;  1UEL B;  2OC6 A;  4PJL A;  4X0G A;  2UWM A;  4U7B A;  3OYH A;  4CCJ A;  1MMG A;  3L2R A;  4PK4 A;  4CCK A;  3H9G A;  4HG2 A;  4B48 A;  2V4J C;  2RNG A;  3CF2 A;  3RSN A;  4P5O A;  4XON A;  4KIT B;  3C2H A;  3H5N A;  3F9K A;  4NUB A;  1TT0 A;  2WAE A;  1R6R A;  1S9H A;  3DPU A;  4OWR B;  1SFK A;  3NWS A;  4NC7 A;  4XOT A;  3K70 D;  3IAS 2;  4N4N B;  3AL0 C;  3MKY B;  4KIS A;  4KJZ A;  4AVZ A;  4ZJZ A;  3S3N A;  5HLT A;  3VWB A;  2KRH A;  2LY2 A;  4BEH B;  4ZYA A;  1Z3X A;  4BS9 A;  3ONQ A;  3QYF A;  3OYB A;  4R79 A;  1T95 A;  4RLQ A;  3HL2 A;  4F55 A;  3LSI A;  1NG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...