3EPZA

Structure of the replication foci-targeting sequence of human dna cytosine methyltransferase dnmt1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
250
structure length
227
Chain Sequence
GPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIPGGVNGKNLGPINEWWITGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDQPIFLTPCMRDLIKLAGVTLGQRRAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (cytosine-5)-methyltransferase 1
publication title The replication focus targeting sequence (RFTS) domain is a DNA-competitive inhibitor of Dnmt1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 227
sequence length 250
chains with identical sequence B
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12047 DNMT1-RFD Cytosine specific DNA methyltransferase replication foci domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2230 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3epzA02
3EPZA
chains in the Genus database with same CATH superfamily
3TDUC 2MD0A 4BQNA 2NAZA 1U0JA 2QCOA 1WCMJ 2V1NA 1YJ9I 3D5LA 5FROA 4Q48A 4ASNA 5M5WJ 1LFPA 2VOPA 5DUIA 5IOZA 1IC8A 4YIIA 2M7AA 4A93J 2O6GE 3HL2A 1XDSA 3ZGKA 3WGGA 4QPOA 4ZZLA 1RUNA 4C2MJ 4BE1A 1TQMA 5FFZA 2VKDA 2O9LA 4XN0A 1V54H 1V5GA 3KPHA 2R7ZJ 2E34A 2ZXHA 3H3ZA 4RGXA 2KRCA 2L7MP 3V8JA 4P55A 3O8HA 2CQKA 3KEOA 3QRFF 1J59A 5IP9J 4U87A 1MNEA 5DS9A 5ERIA 1WZ2A 4A3MJ 4XIDA 5AONA 3H1CA 3L09A 1VFCA 3EETA 1MSFC 2EIMH 1OR7A 2F2EA 2X9DA 1SANA 3I59B 4MQ9F 2CWEA 3PUBA 1V5FA 2X6OA 1GUUA 2P6SA 5GAHJ 3KLOA 4YFNF 1IN6A 4E7LA 3HC7A 4HG2A 1L3LA 3GZ6A 3W3CA 2YUSA 3BTCA 1G3WA 4QPQA 1AWCA 3BTIA 2XGXA 5ICGA 2DA7A 2IGKA 2LSOA 2PG4A 1XN7A 3E6CC 1JJ6C 4G9YA 2L7ZA 3OYKA 4ANJA 2LFBA 2VXDA 3CJNA 2UZKA 3CD6I 2RQQA 4UVCA 3JR9A 3N97A 2HR3A 4HDUA 2OC6A 3OIQA 4ZYDA 1QHGA 2LY9A 2A61A 3FK7A 1ETQA 4EQQA 1R71A 2DFFA 2LKXA 3TO6A 3DCFA 3SYTA 4DW6A 2F6CA 2M9HA 3QU3A 2H6CA 1GT0C 1MGTA 1SAXA 1BC8C 1QZYA 2TDXA 2ZNYA 3BCBA 1W36D 1SMYF 1R5ID 2NNYA 1ETWA 1YW8A 1N78A 5HLIA 2H8WA 3DLLF 2P5LC 3U2RA 2HYFA 2HGCA 2A07F 4A3KJ 1M1EB 2V1XA 5K5QA 3S3MA 3BTLA 2E1MB 4IO9F 5GAEJ 3G2BA 4UV8A 5TJJA 2W84A 3FXOA 5L3DA 2LRDA 1ETXA 1QPIA 1ETYA 3AG4H 1MW7A 3AG1H 3EUHA 4RMNA 5DCFA 2V79A 2L7KA 1WPKA 3OYGA 3KZYA 5EEHA 2WAEA 1YOVB 1STZA 3R0AA 3MZHA 2FOWA 2FA5A 2MD5A 1J09A 3CDLA 4FX0A 1EJ9A 1WJFA 1ZTRA 3RCOA 4WXHA 2JA2A 3I0TA 3FXMA 2H6BA 3AL0C 1MKMA 5EYRA 3CC2I 1TL8A 4V2GA 1Y0UA 3SJMA 1BN5A 2EV5A 1VQ4I 3IAS2 2A68F 1H88C 2PN6A 4EGZA 1GXQA 3QWLA 2RDPA 4OIRF 4KA4A 1I1GA 2HQNA 1PDNC 4EM2A 3HOYJ 5HS8A 3G4SI 1OCOH 2D2WA 1OJLA 5B1AH 1KONA 2XDVA 3BR6A 1DPRA 4O5VA 5E8IA 2CSOA 3DPUA 4HA8A 5F08A 3VEPA 4ZTFA 2R7QA 1XSVA 2VB6A 4XL9A 2ZJPF 3KP2A 3G71I 4GYIA 3NWTA 2NVUB 2EA2A 1UZCA 1BW6A 2PLYA 3ZMDA 3BWGA 2QBYA 3PQKA 4BQAA 3TBIA 3BCAA 1HF0A 2H1KA 2OA4A 1JGGA 3QPSA 3A4CA 5IPAA 3S3OA 3I9V2 4FQGA 2FRHA 2V1UA 5K5OA 2E2JJ 4CXFA 5EF6A 3HOSA 5BPDA 2ESHA 2FNPA 2X6WA 3B73A 2DOEA 3FXJA 1QPMA 1X3WB 1Y39A 1BIBA 3O2PE 3ZRGA 1I3QJ 2HOAA 2GIZA 3JREA 4Z6YA 3KEQA 1U5TA 1GLNA 4Y13A 1SMTA 4DYCA 5LGUA 4F3QA 1R23A 2DU9A 5EG0B 3CCRI 1BOBA 1P4WA 1YX5A 4Y17A 1FTTA 3WE2A 2E2HJ 3F8CA 4P1WA 4A5NA 5ILSA 1WRJA 2BEOA 1B9NA 2F5EA 3GFMA 9ANTA 2M0CA 3F8NA 3I3LA 3GTOJ 1TQIA 5J1RA 5CLSA 5L3CA 5B66C 1HLVA 5JLWA 1VQ6I 4CA0A 4J19A 3U21A 5DEQA 3LNQA 3H35A 1VQ7I 1W5CC 2JWTA 3DU5A 3DXJF 4B47A 3CCMI 2HPIA 1Y8RB 1USTA 3W2VA 2JUCA 5CQGA 4I99C 2O0YA 3HHHA 3WTVC 4RGSA 1XGNA 5KNLA 4C2TA 2EQRA 4BQOA 1JXSA 1SVMA 1EKEA 2Q2EA 5EJCA 3W6KB 2GM4A 4HRIA 3F8FA 4U0VA 3H0DA 1VQ5I 2IGMA 4NC7A 2I8DA 1YIOA 4D0PA 5HNFA 2Y0SA 2CMPA 2LBFA 5DTDA 1T95A 2BW3A 2OCCH 4G94A 2IJLA 3O8GA 1XMAA 2PJPA 4EATA 3L9FA 1K61A 5J47A 1SD5A 4OIPF 4CCLA 2VJIA 3BT9A 4FHTA 1EH7A 4XLEA 3K1MA 3K4LA 1KQ0A 1XGOA 3GBGA 4LB6B 4G6DA 3A03A 3WG9A 4G8XA 3B6AA 4HPQA 3OSGA 1FY7A 2XGEA 1IRXA 4XM3A 1VQLI 3FMRA 3GLLA 3F8BA 3PFYA 1P92A 2PI0A 3ECOA 4XRFA 1E3HA 1YS7A 1BIAA 3B02A 3BG5A 5KHDA 3ZMTA 3KYCB 2VQGA 2KIFA 4BHPA 1YS6A 3LSRA 1P2FA 5GP9A 3HOTA 1DGWY 2MC3A 3WU0A 3V42A 4KN7X 1X2MA 1P4AA 2XPUA 5AIPA 2EZIA 2L2OA 2BY2A 4CCKA 4D7NA 1JKPC 1GXPA 4S0HB 4GDFA 2VJ4A 2PX9A 3ERMA 2VOOA 5E1WA 3OYFA 2JK3A 2HYJA 5FB2A 4BGDA 1ZN2A 1F4KA 5FRNA 1QRYA 3L2CA 2F48A 3TEDA 1XB4A 4GCVA 5E1XA 2E7XA 4CH7A 2QM3A 5DDGA 1LFUP 2JA7J 4M73A 3SFIA 1VQNI 4LJZF 3ERED 2RN7A 4IQJA 3R4KA 4IHSA 2JZYA 4JX5A 1D1CA 1ZGAA 5E79C 3TGNA 4V19K 2VBYA 1FEXA 3VSKA 3LA3A 3WHBA 1A35A 2FX0A 3FZVA 3ZQIA 1T2KA 2KMUA 2A5YB 5GAGJ 1H9TA 3K69A 1FLIA 3KX2A 3L7WA 2CUJA 3WTSC 2HQ5A 1U9OA 1BM9A 3C3WA 4PJ0C 5J1YA 4LG3A 4PK4A 3H9QA 4ON0A 1N75A 3FM3A 2LY1A 1R4MB 4C3HJ 3L2VA 2E71A 3DTIA 3I56I 1RR8C 4ESJA 5LFAA 2E7WA 3MWMA 1D8JA 1AOYA 2M2EA 2D45A 1P7IA 3AG2H 4II2A 2EH3A 3T8TA 4GYGA 3RKWA 1TW3A 4G7OF 1WVRA 2P7VB 5F1RA 1B8IA 4HV5A 4A2UA 4BJTA 3TKYA 4PDKA 3BDDA 3A1YA 3E7LA 2CQ7A 2HZTA 2UXNA 4HX4A 1AKHA 2VPRA 2MG4A 1MBEA 4BAYA 1ETVA 2RV8A 4BYYA 4A5MA 3ZQLA 3ABKH 2VKEA 3NEUA 1OPCA 1T33A 3MEXA 4HYEA 1FOYA 5E1ZB 5J40A 1MIJA 2OZUA 1XS9A 4HDVA 1MNDA 2A5WA 2OAZA 2HKOA 3H3UA 2ID6A 3K4NA 2OD5A 3FXQA 5CQEA 2DT5A 2YR2A 1MMNA 4WXDA 4LD5A 2QBYB 3M1EA 2H8RA 4BHCA 3M8JA 5DM6F 3ULQB 3T1BA 4MIMA 2C6YA 1ZLJA 3FMQA 1WKMA 5M3FJ 1ZHFA 4BKXA 4U7BA 4E7IA 4IEJA 1JUSA 3LWFA 1KU3A 4XMYA 2MYSA 1R4NB 4HW0A 3QAHA 1I6XA 2RKHA 4AIHA 2DJNA 4UVBA 2A05A 3J80K 4J00A 1MSEC 1U5TB 2EJRA 1X2NA 4I01A 1D0ZA 5BMZA 2MABA 4M9XA 4ZYGA 3MFKA 2L9RA 4XR6A 2DMTA 2G0EA 2L4AA 2XF6A 4HZFA 2Z99A 3S2DJ 2TCTA 3OYIA 4XONA 2DMNA 3QODA 2FUG2 1UAAA 4O6JA 4M74A 3GFLA 2JQ7A 2ZNZA 3TP0A 2I10A 1ZG1A 3F0CA 2DYRH 2V1DA 2B9SA 2HOTA 4PJLA 4IXAA 3WODF 5JR3A 2HVQA 2QGUA 4UNOA 1TW2A 3CZ6A 1QNTA 1V5EA 3K4KA 4CGZA 1BW5A 1U6GA 3KZZA 2OUMA 2P8TA 3P9IA 3BG6A 5J8CA 2OQRA 3HSEA 2BXZA 3VYRB 1T8IA 5D8LB 4BU2A 3W2AA 2R7FA 2F4MB 3EQLF 3WU2C 2E36A 3Q0WA 2Q2EB 2K9LA 4AVPA 3D1NI 2LNBA 5KCMA 3ZMUA 3RKQA 2DPDA 3BZKA 2FMLA 2IPQX 4DIQA 1WJEA 3E5XA 2LBFB 2ZKZA 4RS8A 2BW3B 2NS8A 1APLC 2ETHA 2DI3A 2ZXIA 5FO5A 4BHBA 3H92A 4FE4A 5E18F 5GPAA 3EPZA 3IHUA 1LVAA 3EUKL 3BR3A 2AS5F 4B1RA 3CESA 1W7PA 2DA2A 3CJRB 1QVTA 3KP6A 3EYYA 2D1HA 4QTRA 4OAYA 4OOIA 4I98B 2WBMA 5K7ZA 1TTYA 1HW5A 1XGMA 3H36A 4HLXA 2V7FA 4EMSA 2JSCA 5HODA 4IPAA 2AO9A 2GIVA 2Z9OA 3VPRA 1UB9A 2M5WA 4ZTJA 3FBNB 3D0SA 2KZGA 2CQNA 2IP2A 1ONVA 2K7LA 2J5PA 4Y33A 4S05A 1U8BA 2V6CA 5J4YA 3DF8A 4Q5SF 1A6IA 4NBQA 3ISPA 2WY7Q 5DV5A 4N0BA 2E1NA 4YFKF 3F23A 1W0TA 1BI3A 1IUFA 1I3AA 1A31A 3E5UA 1W7PD 1RRJA 1BJZA 2DA1A 3GTGJ 1H8AC 2EZHA 2K9MA 3IKVA 3PM1A 2M7BA 3HTSB 1Z7UA 2DJIA 4U0WA 1XMXA 3QOEA 1RKTA 3LSPA 3DWLE 3KP3A 1KGSA 4W97A 4ETSA 3NARA 4F55A 3M07A 3CJQB 1ACIA 3KP4A 3GLXA 2NOGA 4AYBN 1DP7P 3Q3SA 3VSLA 3DKXA 2VONA 2OV7A 3Q9VA 1ETOA 1ZLKA 2DA5A 1G59A 2STWA 2X1CA 4HLYA 4IJAA 3A0HC 1SFEA 1XSDA 3J7AO 2W7NA 2BY1A 2OTJI 3FK6A 4RM3A 4C2UA 3CF2A 3TOAA 1YRNA 2Y48A 2HDWA 2N8GA 5TRDA 1YHQI 4WCGA 1XMKA 1JHHA 4QSHA 2D1VA 3K0LA 4UHTA 4A0YA 4HNVA 4MTDA 1NTCA 4ENNA 1FYLA 3LFUA 2DQRA 2HPMA 1U3EM 4I6ZA 5EEGA 1B4AA 4QWQA 1MMGA 3AG3H 1USSA 2VL8A 3KP5A 1Y1WJ 3CP2A 1X3UA 4NQWA 4B3AA 3WTTC 1J9IA 1B8IB 4RAGA 1S5LC 1JI8A 3BP8A 3LFKA 4OMZA 5FJ8J 3Q0UA 1W0UA 2RNJA 5LBQA 4YRVA 4A3DJ 2IAIA 2LYCA 2YS9A 5LEJA 3HPHA 5J4VA 1AKHB 2LF8A 3PSIA 1MJBA 3HGYA 5AIQA 2ZJ2A 1S8NA 2ZSHB 5CJ9A 1D1AA 2ELKA 2RAEA 3K4JA 5B1BH 3H5RA 3IUOA 1HDDC 1WJ5A 3ZMVA 4L5EA 4EV0A 3I58A 2WB1N 2MLKA 2L4MA 1IO2A 1D0XA 1MJ9A 4XKWA 1OYYA 3BLYA 2WAFA 4Q47A 3LSKA 2HQRA 2L0KA 4XOPA 5M3MJ 1TT5B 2R3SA 2RC4A 5KVRA 5K7FA 3K10A 2DMQA 4ZDLA 4KICA 3HOVJ 1JE8A 1X19A 1OKRA 2K4JA 1SAUA 3GTPJ 3DBHB 2IS4A 3E6DA 3S14J 4UUTA 2M4KA 1FWZA 2RQPA 4CSWA 1DDNA 3GTQJ 4L9TA 1ULYA 4HAMA 4PSWA 3CDHA 3DPTA 1EH8A 4XLHA 4IZZA 2P5VA 4CO8A 3VB2A 3K9TA 4OIOF 4UUVA 2I5UA 1UHSA 3V7CA 1D5YA 1XC5A 3CCQI 2ACJA 1KQ8A 5HDNA 2F5CA 4YEJA 1YJNI 1SVLA 3QOPA 3S16J 1BR2A 3EDPA 1WH5A 1XCVA 1TWFJ 2W48A 3VOEA 1JKRC 2KL4A 4G6QA 2CGPA 2LF7A 4FISA 3COAC 2Z1DA 3OIOA 1NH3A 2L9NA 2PMUA 2K9QA 3CLOA 4BE2A 2WWYA 4HOBA 2ISYA 3ZR8X 3K4MA 4HSTA 3FHNA 5LD2C 1FIAA 3WE3A 3G73A 3MKZA 3K7AJ 2A6TA 5FLXK 5JHUA 1FP1D 3SEZA 3CCSI 5LRSA 5FFXA 2VBWA 2JPCA 2W25A 4NUBA 3FWEA 3GVAA 3U1KA 2XPVA 4ABZA 3J7AY 1ODDA 3VYUB 1ZG5A 5FKNA 2EIKH 1ORKA 3ZQQA 1T08B 2ECBA 1O57A 2MH2A 2PEXA 2FSWA 2V26A 4ENJA 3MKLA 2XAJA 4P9UA 2XUBA 1FJLA 1Q1HA 1W7PB 3ZMZA 5CYVA 3BR1A 1FX7A 3JRBA 3DTKA 2QQBA 5HLGA 2XAQA 1TWGJ 4MFDA 1FYMA 2ZMEC 2BHYA 2MW8A 2GLOA 1SC7A 3K70C 2CV1A 1BJAA 2ZO4A 4Y4RA 3ZN1A 2QLZA 2DN0A 4MFEA 3D5SC 2AXLA 2HXIA 4ENKA 1EV7A 4MHGA 3HRSA 3OSFA 1BL0A 3HRTA 3DTEA 1NK3P 1PP7U 2EV0A 4O3MA 4EJTA 1H89C 3IH2A 2PFBA 4OWRB 3H3VK 4HF0A 1GHCA 1QHHD 4XSXF 1U2WA 5ILUA 3A01A 4CZCA 2X51A 4KIBA 1TWHJ 5LHIA 2F5VA 2NNNA 3OL3A 5DD4A 1B72A 4XK4A 4XNFA 1YO5C 4MQVA 1DP3A 2WTEA 2FJ1A 5E17F 2ELJA 1FBUA 1IF1A 3KYDB 1O3SA 3R6SA 4YG2F 1A5JA 1BR4A 3MN2A 5CVJA 3QPTA 5DM7F 2KRHA 2V9VA 3JRGA 4IHYA 3W6VA 1ENHA 5ICEA 1N25A 2RREA 3HKZN 1QQIA 2FQ4A 2E2IJ 3IL2A 1ZRFA 2LR8A 3REOA 2QKMB 2ZBKA 4IX7A 3QQAA 2R7XA 2XVCA 4ITVA 4ZYHA 2Z3YA 2XSJC 2L3DA 1O3RA 2KIQA 4XKVA 5GTIC 2H27A 1HOMA 4JK1X 4YELA 3F21A 5E20A 2K40A 5BS6A 3CO6C 2JT1A 5JVTA 4DZPA 3ZQ7A 3FM5A 1UCRA 1UG0A 2GZWA 5HNHA 1YRNB 2NYXA 3C2GA 3RQ4A 4E4HA 1K78A 1VQMI 2KDZA 3BROA 2QQ8A 2XROA 3LAPA 2NVTJ 1I50J 4JBAA 3MAJA 3UNGC 1GV2A 2HI3A 2MSYA 5F0FA 1X1AA 5BPIA 5D4RA 4FETA 1IDZA 5LRRA 5LHHA 4B09A 2VJ5A 4CCNA 2DQLA 1UFMA 4NQWB 2WADA 5F0HA 1IN8A 2CH0A 4RAZA 1ZYRF 2BVLA 2W57A 1G6NA 2ZSIB 3RYRA 4BDZA 3L2RA 1FZPB 1FOWA 2AQEA 4R1HA 2QVOA 4TV7A 4EJWA 2YPRA 2XKPA 3KCCA 3L00A 2W82A 1ZR2A 2ZXJA 4LLLA 1Y8QB 3CTAA 5IYCJ 1RESA 4KMUX 3H9JA 4A3FJ 2NRAC 4R79A 1Y0NA 2H09A 2LC2A 4A0XA 5E3OA 3A0BC 2CG4A 5L3EA 4EM1A 1BC7C 3BJAA 4BUPA 3E5QA 2H1LA 1W5SA 2GA2A 5E3NA 1TNSA 3C7JA 3O6BB 3TL4X 1ZG3A 2V6EA 4BY7J 3ECHA 1OCCH 2BOLA 3AL0B 3BQZA 3GWZA 4UV9A 3IRQA 2NOJB 2WV1A 2KPMA 2DA3A 1IRGA 2HXOA 3GYHX 5D5VB 2K4BA 1HXDA 3FXRA 2GBYA 4LG0A 2ID3A 4A3BJ 5LHGA 1A04A 1J75A 1LKXA 4NHJA 1I39A 1R9TJ 4F52A 2WY8Q 2OTLI 5FLMJ 2JVHA 3BR2A 2X6YA 1E2XA 1Z3XA 4LOCA 3QP6A 2DMPA 3X2QH 2HTJA 4BH9A 4M72A 1IN5A 1KA8A 2BV6A 1HDPA 1VNDA 3BTJA 3BC8A 2OJED 3KE2A 2OF7A 2KKOA 2KDOA 3RZOJ 4IRGA 4Z2YA 2HDCA 2R7RA 4BJ6C 3OV8A 3Q9SA 3SZGA 1FPQA 2EFNA 3F6VA 4B44A 2LK2A 1LPQA 2XAHA 1RUOA 2IA2A 1FBSA 3WTZA 3BOQA 3GO5A 3DP7A 2VODA 2OCEA 3K2AA 2Z16A 1OYIA 2KQRA 1CGPA 3GTMJ 3RQIA 3GTKJ 3ZQHA 1TNTA 2X1EA 2JUGA 2LVSA 2L5QA 1T98A 3W6JB 4IL6C 3GEZA 3CMYA 3WU1B 2LKSA 4IOCF 4F7ZA 1A36A 1OMIA 4XKBA 2FNAA 4KT5C 4H4KC 4LFUA 2W1OA 5HS9A 4LGWA 1LNWA 4A6DA 3HG9A 2RGVA 5GTHC 5C4JJ 5JVGF 3G1OA 3LSIA 3MKYB 2R7WA 3CUQC 3PSFA 1V4RA 4XOTA 1IZ1A 2JN6A 3FHZA 1IGNA 1QU3A 1ZREA 4M3BA 4A3IJ 2WAQN 3PO3J 4DOZA 1IRFA 2P81A 1E3PA 3G3ZA 1I1SA 4Y7NJ 2Y9YA 4I0BA 3MVPA 1KU2A 1HQCA 3BG9A 3CP8A 4XLCA 3HUGA 3GTJJ 2Z5UA 2DBBA 1WWXA 5ICCA 4RLFA 3HOXJ 5J6XA 2AHQA 3GMEA 1FBQA 2FBKA 2IW5A 3ZN0A 4HNUA 3R60A 1MBKA 2DA6A 5CKTA 2DAOA 2M1BA 4ZC3A 1EF4A 2VC0A 4RB1A 2PMZA 3K2ZA 3A01B 2M4GA 4I0AA 4AU7A 3SFZA 1B72B 2DFHA 4I76A 4I2OA 2GWRA 3RKYA 3NAUA 2XRLA 5F6FA 1RZ4A 1MJAA 3JCUC 2QSFX 4ZDOA 1XD7A 2EK5A 5FKOA 2DDAA 3HM5A 5EZGA 1T56A 2XGCA 5F04A 2DOAA 4IVNA 4UB8C 2M87A 5C4XJ 2YX4A 2HYGD 1G3SA 2LDUA 1FIPA 1YYVA 3FX3A 2Z2SB 1POGA 2L7FP 3K4CA 1IG7A 3S2HJ 1ZGWA 1HW1A 4E7SA 3FBIB 4B8XA 2MBFA 5FLVA 2DA4A 4G6TB 3ASOH 5L3GA 1IJWC 2VE8A 2HZDA 4OMYA 3D5RC 3DKWA 3HRMA 1IAWA 3HGGA 4KN4X 3QU6A 3J7ZI 3JSPA 3ABTA 3IWZA 5K1YA 1IV8A 2X85A 4NC6A 3LSMA 4EJOA 3BZ6A 4XSZF 2R5ZA 3ZQCA 4LMYA 4ZJZA 4ZYEA 2MC4A 3J7YJ 1VQPI 4OINF 3MKWB 1K78B 2ZFWA 1K4SA 4L0YB 1RI7A 4I02A 2VKVA 1VI0A 4LLGF 1I6HJ 4CCMA 3RPQA 3L1PA 3I4PA 1ZH5A 1QZZA 4XLPF 5L3FA 4GO1A 3I4MJ 3ABLH 5K5RA 2GOXB 2ECCA 2L9SA 3HB9A 1X1DA 4KYWA 2EBIA 2X4HA 3HRUA 4IOAF 1RNLA 2OQGA 3ZXSA 1PJRA 2CUEA 1IW7F 1LJ9A 4RM2A 1RIOH 1ZAOA 2K86A 3I54A 1YI2I 5KAIC 3T0YA 4ZYAA 3TOBA 1ZARA 1LFBA 4FX4A 4QLCU 5D6EA 1T38A 3OYJA 2JA6J 3CF5F 2O3FA 2LP0A 4AC0A 3PJRA 3S15J 1BI0A 4X1EA 2HVRA 1FC3A 5HDKA 2XAUA 1Z91A 2COBA 4XRSG 1S3JA 4RB3C 3WGIA 4L9VA 2VASA 2Q0OA 5D5XB 4RB2C 4E7HA 4BE0A 2HU9A 2VUMJ 2KJBA 2CFOA 4RBOA 4IQ4A 4M3DA 2M30A 3OWTA 4EEFG 1BOAA 2KISA 4WWCA 3JRAA 2DW4A 3C1DA 4RA2A 1S7EA 4PUSA 1AA7A 2X1DA 3KLNA 4AM3A 2HDDA 2GOMA 2G7HA 1P4XA 2DXIA 1MDMA 4RB0A 3BG7A 3CCLI 1Z6TA 2DCEA 3HEFA 3R61A 3ESWB 2UUZA 2E19A 5C44J 1HA8A 5IP6A 5CVRA 5IY5H 2LKPA 2IGOA 2FU4A 2QQ9A 3HOWJ 3LQQA 1QA6A 1TT0A 1N77A 1RKWA 2DLLA 2CJJA 5J1UA 1J7KA 1OQYA 2NS7A 3CQZJ 1VQKI 1ETKA 2R7OA 3KZIC 5HOOA 4IHWA 2E35A 4XRSA 1FP2A 1VQ9I 4IHXA 3PFIA 3FDYA 4M3EA 4ESBA 2M0MA 4H0EA 3OS0A 4HBLA 2NS0A 2ZJQF 1XG1A 3EUAA 3F72A 4BXUA 2X0LA 1FSEA 4ZH4F 3FIWA 3RJPA 1FNNA 2XGDA 3AFHA 1MMSA 4IRIA 2QWWA 4JQFA 4HQMA 4MO7A 5ILVA 4HQEA 5IT9K 3DPLC 2O5RA 1Z77A 1E0EA 3LSJA 4AD9A 1XSXA 3GX4X 1T0FC 3PNVA 3FXKA 4A3LJ 2RVCA 2LG4A 4U0YA 2K5CA 5FKMA 2VLAA 1SVOA 1Y56A 2GXGA 5LLQA 2MFZA 2ZB9A 1UHMA 1K79A 3DFGA 1R7JA 2XB0X 4MLOA 1VQOI 1R36A 1YLFA 2YU9J 3O3KA 2BGCA 3F8MA 3HHGA 1TC3C 4YIRX 1NG6A 3L2UA 1S7OA 4LIVA 1IXSB 4KFCA 1Z6RA 1J0RA 3JSOA 3ELKA 1JJ8C 3HUGB 3WG7H 3S1QJ 2KIMA 4RDUA 4E7JA 2Y9ZA 3R0JA 1SD7A 4HSRA 4XN3A 2FOKA 5IT3A 3I64A 1O3TA 5KAFC 1U8RA 5EDNA 1I5ZA 3SZTA 2EFQA 3I53A 2CS3A 2CQXA 1MH4A 2BXYA 4HX8A 5TISC 3F22A 5EGOA 2Y2ZA 2XV4S 1R00A 2EIJH 1J2XA 2P5KA 3S3NA 1K6OA 2O03A 1ZRDA 4RAYA 4DBRA 1VQ8I 1QBJA 1ZGJA 1SFXA 1FYKA 3GF2A 4LITA 5HS7A 4MEXF 3RSNA 2VKHA 2LREA 5LGTA 3LSHA 2GAUA 1ZELA 2LY2A 3RYPA 4PFPA 3H9GA 2NXNB 5DYMA 3G1MA 3M8EA 2R5YA 1R49A 1T6SA 3MMYB 2ZMEA 4CCOA 3NRVA 4OAZA 4KNYA 3P9CA 3IP4B 4LB5A 4EM0B 1CQTA 1VZ0A 4RGRA 5K7HA 3HOUJ 1ON2A 1OCZH 4DBQA 3OYEA 2DYSH 4M9ZA 2DK8A 3HJEA 1VTNC 4KIFA 2R7VA 1WJBA 4GRIA 2CW7A 2BE5F 1VF9A 3S17J 3J80Z 3MCZA 1SEUA 3SZPA 5B5EC 2YX7A 1OCPA 3RIRA 3TO7A 2QKLB 1D5VA 1MNMC 4UVAA 2DT6A 1QZEA 3BJOA 5JLXA 3PUFA 4A3JJ 2MLGA 2P6TA 3HSRA 2IGNA 3KFWX 2NVQJ 4BXFA 3T8RA 3CCEI 2G9WA 3M3YJ 2CUZA 1BR1A 2R5ZB 5GADJ 2XF5A 1H0MA 1REPC 3DEEA 2BY0A 2KT0A 5D4SA 4DZJA 2ISZA 1MH3A 1W1WE 1D0YA 2K27A 1LDDA 1O4XA 2GXAA 1JGSA 1TZLA 1QO0D 3PNYA 2VBZA 1TWAJ 3CDIA 3BPVA 3K70D 1O3QA 3M8FA 3P9KA 2FXAA 5IYBJ 3JRCA 4IF4A 1MMAA 4XLFA 1FSHA 1S6LA 4L0ZB 4E7KA 2DK5A 4IKFA 3K1PA 3LAJA 3SHFA 1JKOC 2E1MC 2FBIA 4OU0A 2JRTA 1BA5A 2R7DA 3SEQA 5JI6A 2FQ3A 4BXXJ 1JHFA 4P5OA 3OY9A 1XGSA 5FRMA 4A69C 2JSPA 4YIFA 3GZNB 2EFPA 1TBXA 3A02A 3OS2A 3C2BA 3HOZJ 2OBPA 4BNCA 1C0WA 3H5NA 1P9QC 4I09A 4ESFA 2CV0A 1LVKA 2L01A 5LEKA 5H6RA 5JHFA 3DU6A 2JMWA 2Y69H 4N9HA 5EEAA 1EA3A 2GQQA 4XORA 5M5XJ 1UJ8A 1XCBA 2VQHA 4XRMA 5ICFA 1O7FA 1WFXA 4G12A 3S8PA 2A3SA 2ZFUA 3JAMK 4IHVA 4M71A 3QPLA 5M5YJ 3PO2J 2QF7A 4AIKA 2XF7A 4Y15A 3L2WA 1MDMB 1YX3A 2VQLA 1QVUA 3IWFA 4ZZDA 2A6HF 1PUFA 3FMSA 1Z67A 4C3JJ 4CYDA 4D5FA 1D8KA 2E1CA 5IT9Z 4E7ZA 3HTUA 3GCMA 2VT3A 3WGHA 2ZCWA 3OYLA 1G3TA 4WK8F 2DTRA 2Y0SN 3OYNA 4N9IA 2R0QC 1JKQC 4A3GJ 4G7HF 2XHKA 2QQAA 3TW7A 5IP7J 4HV6A 1R5GA 2R7TA 4KDPA 2CU7A 2XB5A 1OLTA 3KP7A 5E3MA 3JRFA 2HQAA 2K9NA 1JUMA 3WTUC 2NVYJ 2DFEA 1ZRCA 1OCRH 1X1PA 3ASNH 2V9PA 3E6BA 3I5UA 3ZPLA 4AYBA 3OMYA 1F5TA 3CMEI 2KP6A 4F93B 2IS1A 2ICWG 2JPBA 3H5AA 3QYEA 1JT6A 3GTLJ 2EWNA 1YQAA 2MA3A 2DT7B 3HPGA 4LIUA 2L02A 1ON1A 3OYDA 4K2EA 1UELB 2XAGA 2PMHA 2JVGA 3ZMSA 1Z05A 3K4BA 3LSGA 4NC8A 1HKTA 3IAM2 2IBDA 2FD5A 3OYBA 1RETA 1HKQA 3LSTA 3M9AA 3P5JA 3OYAA 2R93J 1Y1VJ 5F1JA 4B4CA 1DUXC 4GFBA 5E8GA 2IS2A 3M1CA 4MNUA 4DGWB 1F43A 2CW8A 4BBRJ 2F5DA 3OR1C 2LMDA 1MBHA 3F9KA 1FTZA 5HDGA 1YITI 3EYIA 4DJAA 3F6OA 1OISA 4A0ZA 1UG2A 4PGGA 5EGOB 2EFWA 4EJVA 3NWSA 1YW9A 4UB6C 2QEXI 1LE8A 3RPUA 3DBRB 2WB1A 2YSRA 3QPHA 3TO9A 2F5FA 1B59A 2O7OA 2PQ8A 2QENA 4LK0F 2EZKA 1S72I 3CUQA 4OIQF 4WXCA 3TMOA 2PMZN 1OR7C 3N05A 3CC4I 2CQQA 4A6EA 3ABMH 2HEOA 2R5YB 3DEUA 5CVUA 3C18A 4IHTA 4L18B 2RNGA 2OU2A 2P7CB 1V55H 1WHUA 2ZMEB 3ZQGA 3IC7A 4F92B 1W36C 3T5XA 1T39A 5C3EJ 2BVMA 4JP0A 1JT0A 1FOKA 2CRGA 2D5VA 3RTRA 3S1RJ 3JW4A 1WI3A 2ZC2A 3K6GA 2Q1ZB 3FXLA 2DOFA 3FKJA 2DMUA 1MZBA 2ADUA 4NNJA 2ZJRF 3IH3A 3WTXC 3P7NA 1SFUA 3QYFA 4KITB 1Z0XA 3OYHA 5FD5A 2IXSA 2EB7A 1R1VA 3CCUI 2B0LA 4FE7A 1H9GA 2QUFA 5F27A 4KMFA 4AUXA 1DPUA 3LL7A 3RPUD 1KYZA 2R92J 5FKLA 1R22A 1S29A 4CYCA 3S1MJ 1YW7A 2UWMA 3NQOA 3S32A 3VYTB 1NK2P 4RGUA 2ELHA 4QIWN 4YFXF 2PJRA 4NB5A 2J5OA 3BR0A 2BY3A 3UR3C 1HC8A 5IYDJ 4AVZA 1ZK8A 2LOOA 3BJ6A 1P7JA 4BEHA 2DPUA 3MZ8A 2JJ7A 1SD6A 2JA8J 1G2HA 3OOUA 3VODA 1YTYA 1R5HA 1FMWA 2M45A 4L9NA 1IDYA 4DNCA 3KIOA 3CJTB 4A3CJ 1HW2A 1D1BA 2V9KA 2O8KA 1X4OA 4PFOA 5H6QA 5HLTA 3WTWC 3GFIA 5D6FA 2FBHA 4Y3OA 5FLXZ 3RZDJ 1SFKA 4B48A 3VFZA 4N4OB 3JAMZ 2G7UA 3OR2C 1SD4A 3RDIA 2BZTA 3OS1A 4ENMA 1KQ9A 1GVJA 2ESNA 3HYIA 3IRRA 3EUHC 4WF2A 4GXOA 1I27A 4I7HA 3I71A 1Q1VA 4N4NB 1S9HA 1TQPA 4HF2A 3DKYA 2CO5A 3ML6A 3S2WA 1XDUA 2HKXA 1GV5A 1QGPA 3CMMA 1X58A 1YJWI 5HLHA 1OYWA 1P6RA 4X6AJ 2K3FA 3U9GA 4F91B 4HEA2 2W00A 1OCTC 4UUSA 4PGHA 5KK1A 4U7DA 3IH4A 3LQRA 4FCYA 4E6KG 4XBFA 4FASD 1W5TA 4WX9A 4BY1J 2VN2A 2IEKA 2E1OA 3K1NA 4B43A 4LLNA 6PAXA 2EZLA 2VE9A 2EPFA 3Q5FA 1BBYA 2KFDA 3HXLA 2OPTA 1PUFB 1K4TA 2R7UA 3UKGA 3Q0VA 1RC9A 3DLAA 3MQ0A 3CO7C 1XTAA 5D5UB 3VWBA 4B3XA 4A3EJ 2X48A 1YE9A 3HBLA 3E1SA 4E70A 2Y75A 4EVIA 4II3A 5J8FA 3QYBA 3IKTA 3BPXA 2F4OB 2VIXA 3M7GA 2IA1A 3KETA 3HKZA 1SFOJ 2QSGX 5F0CA 3J81Z 2P4WA 4PSXA 3BQYA 1TWCJ 3V4GA 2WA0A 1B1BA 3ZQFA 2CYYA 2XKOA 4W1UA 1Z7LA 1IRZA 1JTXA 1R6RA 1AHDP 2EFOA 2QZ8A 3HDDA 3GW2A 1U5TC 3E97A 2ME6A 4LK1F 4BDYA 2IT0A 3CC7I 3SQNA 1BI1A 1UMQA 2GXBA 5F64A 4KISA 4M3GA 4KJZA 3HSFA 4U88A 5J3LA 5DCMA 2FF4A 3CUOA 4C9YA 5TGTA 4XKCA 3SDGA 3E0JB 3FISA 3PQJA 1X1BA 2DFIA 2HOEA 4RAFA 4DYRA 4CUGA 3SXYA 2OZ6A 1Z9CA 3JRDA 1TP4A 1LQ1A 4FT8A 1LB2A 4PJMA 1OFCX 2W4SA 3RKXA 4MGRA 1NG7A 2EV6A 4P96A 3TP3A 3BZCA 4RLQA 3OYCA 4X0GA 1UHWA 1XPXA 3V8KA 4PCQA 1BI2A 1B6AA 1F1ZA 2H94A 1CF7A 4GGGA 4BS9A 3F3XA 2XRNA 1KZHA 2NVXJ 1TLHB 2MH9A 2BYVE 4L5IA 4ZDPA 2FEZA 2IVMA 1T0FA 2W24A 5CVVA 3DQVC 4MTEA 3VDXA 3IV5A 3S1NJ 1X4PA 5L3BA 1J5YA 3DBLB 1KU9A 2PBIA 2A69F 4D7MA 1LE8B 1E17A 2HFHA 3PL8A 2Y31A 2K02A 3V7SA 4G7ZF 1K83J 1RR7A 4EGYA 1ERDA 2DDBA 5E3LA 2E60A 3H0GJ 2IS6A 3CUQB 2FE3A 1MBJA 2TRTA 2HS5A 2KJCA 3QP5A 1L0OC 3CCYA 5A2QK 2K9SA 4C30A 5JFRA 2XASA 3BG3A 5B3SH 2VJJA 2LH9A 2CUFA 2XAFA 4XLAA 2JA5J 1AU7A 2VC1A 1G8XA 3GZ5A 4HF1A 3ZOBA 1XX5A 1PVEA 1R58A 2GA1A 2KRFA 3CMAI 1KYWA 2CW0F 2K85A 2O8XA 1ZR4A 3J81K 4M3FA 1KU7A 1DU6A 1U9NA 3LA7A 3TW6A 3OL4A 2EILH 3LMMA 1F9NA 1LUJB 1MMDA 1YG2A 3OYMA 3RI4A 2E5ZA 4NDLA 2LD5A 2KIUA 3CLQA 2UXXA 2R7SA 2Y30A 4EJUA 4CYCB 1JUPA 2QA4I 4S04A 2JRMA 3FXUA 3GXOA 2M8EA 2ME0A 1GVDA 2PJRB 2LTPA 3ZP5A 2DTZA 4XLNF 1R1UA 4XICA 5CVIA 4AIJA 2P0WA 2E5NA 3I59A 1JTYA 3JTGA 5D5WB 2F4IA 3FKIJ 1HSTA 4M9SA 4M6XA 3C2HA 4BEHB 3JRHA 1K7AA 4LG0B 3PNTA 3PIPF 1G4DA 1LEBA 3M4OJ 1LEAA 1W4MA 5DD8A 1DQUA 3V7RA 3LOCA 1WJAA 4XQFA 3GUDA 1D3YA 2M34A 3E3VA 2V4JC 1HBXG 4AIDA 3LA2A 3GFJA 1RPWA 3DV8A 1Z3YA 1MBGA 1WI9A 5H2FC 3AKZA 4AWXB 1B9MA 3TQNA 4CICA 3TDZC 2B7EA 2ZXWH 1GDTA 2M8GX 1HSJA 2LLKA 2M3AA 4Y52J 2COMA 1LDJA 2BHZA 2B63J 2WAQA 2UV1A 2WC2A 4JX6A 2HNHA 5H20A 2K3PA 1HCRA 1IN7A 4BL0B 4DQ2A 1HKSA 4Q4ZF 4BBSJ 2O61A 2IA0A 4L9JA 1Y6IA 3FF5A 5BNGA 2KLOA 4UUSB 2AXTC 2MGQA 5HVQC 4M6VA 5EZHA 5ED4A 3JRIA 2W85A 2EA4A 4UXNA 2XC7A 3L2QA 3HIFA 2CFXA 4C3IJ 2VBXA 3E6MA 3A2KA 5LGNA 4BACA 2IRFG 1IXRC 2KHMA 1WQ2A 2FMYA 4R8HA 5FKKA 1X3ZB 1E3OC 1R1TA 4D5CA 1FMVA 5GPCA 2STTA 4P9FA 4KT6A 1YFHA 3DEWA 1FOXA 3V8LA 3ZCOA 1O7LA 3KYLA 2QSHX 4BJ5C 3OOPA 1Z1DA 2Y0MA 3G1LA 1ZKGA 2DO7A 4J01A 2HWVA 3BY6A 4M6YA 3ROUA 2KZVA 3W2WA 4A12A 1PP8F 1ITYA 4PJNA 3S93A 2X6XA 2AQFA 2EINH 2CV2A 2A6EF 3WTYC 3MD2A 3PIOF 3CCVI 2VPLA 1A6QA 1WJCA 1K6YA 4JX4A 1WSUA 3N4MA 4CDGA 4CCJA 3WHCA 4D1QA 4UY8I 3OIPA 4HX7A 2YU3A 1U78A 5IOYA 3I55I 5CPRB 4MEYF 1F36A 5DCMB 1IN4A 1WJDA 2JTVA 2HOSA 3ONQA 4JOMA 4CZZA 1PUEE 2R4GA 4KIGA 2L54A 1PYVA 3CCJI 4HNTA 2VT2A 1LDKB 1YIJI 4JYKA 3I4NJ 2XSDC 5BOXA 2L9VA 3G6EI 3ABUA 5DUKA 2BBYA 2WV0A 4PJJA 4V2FA 4CHUA 2XIGA 3B6CA 3HZJA 3U1DA 1WGXA 4IRHA 1MBFA 1IV6A 5A2QZ 3BR5A 1G3YA 1V3FA 4PZJA 2Q8KA 1DU0A 5FGMA 4D9JA 2HVSA 1EH6A 2Z33A 3AAFA 2HTSA 2QYOA 2VXZA 3JTHA 3VYSB 1CF7B 1X1CA 2XPWA 3KEYA 3MZYA 1NHAA 5EG0A 1S7AA 1DGRM 2DODA 4BQQA 5BQTA 4L5JA 2VI6A 1MD0A 1IXCA 4FTHA 4KUMA 4DYQA 5FD6A 1WH7A 1IUYA 1ZQ3P 5D8KB 1Z21A 1FT9A 3SDBA 2VQCA
chains in the Genus database with same CATH topology
4BU2A 3LSIA 2IS2A 2MD0A 3M1CA 4DGWB 4BQNA 3PSFA 3MKYB 2CW8A 4XOTA 2R7WA 1U0JA 2V1NA 3F9KA 3OR1C 2Q2EB 2K9LA 3D5LA 5KCMA 1QU3A 4DJAA 5FROA 4DIQA 4DOZA 1LFPA 1WJEA 2LBFB 2BW3B 3NWSA 2M7AA 2ZXIA 2WB1A 3HL2A 3ZGKA 3EPZA 3CP8A 4QPOA 4XLCA 3EUKL 4BE1A 4RLFA 3CESA 2VKDA 3TMOA 1OR7C 3CJRB 3N05A 4HNUA 4XN0A 1V5GA 4ZC3A 5CKTA 2ZXHA 2KRCA 2RNGA 2PMZA 4F92B 1W36C 2M4GA 4OAYA 2BVMA 4AU7A 3RTRA 4U87A 2WBMA 1MNEA 3K6GA 2Q1ZB 2V7FA 3FKJA 4NNJA 4ZDOA 3QYFA 4ZTJA 4KITB 3FBNB 3OYHA 2IXSA 3PUBA 2DOAA 1V5FA 4Y33A 3LL7A 4E7LA 3HC7A 4HG2A 3RPUD 3W3CA 2Z2SB 3K4CA 4QPQA 2WY7Q 4E7SA 2UWMA 3FBIB 3S32A 3VYTB 4G6TB 2PJRA 2IGKA 3UR3C 4AVZA 2K9MA 3OYKA 2LOOA 2M7BA 2HZDA 4ANJA 3D5RC 2VXDA 4BEHA 3OOUA 2RQQA 2DJIA 1FMWA 3QOEA 2OC6A 3OIQA 1QHGA 2X85A 3LSMA 3DWLE 4F55A 4ZJZA 1D1BA 2MC4A 2V9KA 1X4OA 4PFOA 5HLTA 3CJQB 3SYTA 3MKWB 2F6CA 4Y3OA 1SFKA 4B48A 4N4OB 3VSLA 3DKXA 4CCMA 2OV7A 3OR2C 1G59A 2X1CA 3BCBA 1W36D 3OS1A 2W7NA 1N78A 3EUHC 2GOXB 4RM3A 4C2UA 3CF2A 2L9SA 1X1DA 2HDWA 4N4NB 1S9HA 3ZXSA 1PJRA 4RM2A 3DKYA 3S3MA 4ZYAA 3CMMA 2E1MB 3G2BA 3LFUA 2HPMA 3OYJA 4F91B 4HEA2 2W00A 2LRDA 3PJRA 4E6KG 2HVRA 1MW7A 4FASD 1MMGA 2XAUA 4RMNA 2VL8A 3CP2A 2L7KA 2VASA 4B43A 4E7HA 3OYGA 1JI8A 4BE0A 2HU9A 2WAEA 2CFOA 4YRVA 3HXLA 1J09A 2LYCA 4IQ4A 3HPHA 2R7UA 1WJFA 3PSIA 3RCOA 3OWTA 2JA2A 2ZSHB 3DLAA 3AL0C 1D1AA 3K4JA 3H5RA 3IUOA 3VWBA 4B3XA 4PUSA 1AA7A 1WJ5A 1YE9A 2X1DA 3E1SA 4II3A 3IAS2 2GOMA 3QYBA 2VIXA 2DXIA 1D0XA 3BG7A 2DCEA 4XKWA 3BLYA 2WAFA 3HKZA 2UUZA 1HA8A 3LSKA 4XOPA 4PSXA 2IGOA 2WA0A 3K10A 1KONA 4ZDLA 2XDVA 1X19A 1TT0A 1Z7LA 3DPUA 1N77A 1R6RA 1SAUA 4ZTFA 2R7QA 2VB6A 4XL9A 2IS4A 3NWTA 2M4KA 2R7OA 5HOOA 4CSWA 3TBIA 3BCAA 3FDYA 2M0MA 4BDYA 3OS0A 4PSWA 3A4CA 3DPTA 4XLHA 3S3OA 4IZZA 3EUAA 3I9V2 4KISA 3HOSA 2X6WA 3AFHA 4KJZA 4JQFA 4C9YA 4YEJA 3ZRGA 5TGTA 3DPLC 2O5RA 4XKCA 3E0JB 1BR2A 1GLNA 1X1BA 4CUGA 4F3QA 1E0EA 2KL4A 1T0FC 1BOBA 3PNVA 2Z1DA 4PJMA 1YX5A 2LG4A 2W4SA 2L9NA 2K5CA 1NG7A 4P1WA 4BE2A 2VLAA 4RLQA 3OYCA 1Y56A 3ZR8X 3K4MA 2MFZA 4HSTA 4X0GA 3FHNA 3I3LA 5LD2C 4MLOA 3MKZA 2A6TA 3SEZA 4CA0A 3U21A 4BS9A 3H35A 4ZDPA 4NUBA 3DQVC 1NG6A 3L2UA 3DU5A 3VDXA 4B47A 1X4PA 4LIVA 2HPIA 3J7AY 3VYUB 3W2VA 3PL8A 5CQGA 3ZQQA 3HUGB 1ERDA 4E7JA 2V26A 5KNLA 4C2TA 2E60A 4HSRA 4XN3A 4BQOA 2IS6A 3DTKA 4HRIA 3H0DA 2IGMA 2CS3A 4NC7A 2I8DA 4C30A 5HNFA 2Y0SA 2CMPA 2LBFA 3K70C 3S3NA 1T95A 2BW3A 2VJJA 2CV1A 2LH9A 4Y4RA 4DBRA 4XLAA 3D5SC 4EATA 4LITA 1G8XA 3RSNA 2VKHA 2VJIA 2LREA 4CCLA 3LSHA 4XLEA 3K4LA 1ZELA 2LY2A 3DTEA 3GBGA 4PFPA 3H9GA 4OWRB 1QHHD 3MMYB 4HPQA 4CCOA 3OL4A 4CZCA 2X51A 1IRXA 3LMMA 4OAZA 4XM3A 1MMDA 2F5VA 3OL3A 3IP4B 3PFYA 3OYMA 1VZ0A 2E5ZA 4XNFA 2R7SA 4DBQA 1DP3A 3OYEA 2R7VA 2ELJA 1WJBA 4GRIA 1BR4A 2CW7A 5KHDA 2PJRB 2VQGA 2KRHA 2QKLB 2DT6A 2P0WA 2E5NA 2F4IA 4BEHB 3C2HA 3HOTA 1DGWY 3PNTA 2RREA 3V42A 2IGNA 4BXFA 4CCKA 1DQUA 2L2OA 1WJAA 4XQFA 2CUZA 1BR1A 2QKMB 2XF5A 4IX7A 2VJ4A 2R7XA 3DEEA 4ITVA 2V4JC 3OYFA 5FRNA 4BGDA 1D0YA 2XSJC 1Z3YA 4XKVA 1TZLA 4CH7A 3AKZA 3PNYA 3K70D 4YELA 4IQJA 1UG0A 5HNHA 1MMAA 2M3AA 4XLFA 3C2GA 3RQ4A 2WAQA 2UV1A 4E4HA 4E7KA 2HNHA 4IKFA 1D1CA 2K3PA 4BL0B 2E1MC 3VSKA 1Y6IA 3SEQA 3UNGC 1X1AA 2KMUA 2KLOA 4P5OA 3OY9A 4FETA 5FRMA 2JSPA 2VJ5A 3KX2A 4CCNA 5HVQC 2CUJA 4NQWB 3OS2A 2WADA 2CH0A 3H5NA 1P9QC 2XC7A 3L2QA 2BVLA 2ZSIB 4LG3A 2CV0A 1LVKA 4PK4A 3H9QA 4BDZA 3L2RA 1N75A 2AQEA 2LY1A 3A2KA 5JHFA 3L2VA 3DU6A 3DTIA 4BACA 1EA3A 4XORA 5LFAA 2KHMA 2W82A 2VQHA 1WFXA 3S8PA 4II2A 2ZFUA 1FMVA 3H9JA 4R79A 2LC2A 2XF7A 4KT6A 3L2WA 4BJTA 1YX3A 3A1YA 2VQLA 3ZCOA 4BUPA 3TL4X 3KYLA 4BJ5C 2V6EA 2BOLA 3AL0B 4E7ZA 2NOJB 2KPMA 3OYLA 4J01A 3OYNA 2KZVA 3W2WA 1MNDA 2A5WA 4PJNA 1LKXA 3K4NA 3S93A 2X6XA 2AQFA 5CQEA 2CV2A 1MMNA 2R7TA 3MD2A 3M8JA 1OLTA 2VPLA 4F52A 2HQAA 1WJCA 1K6YA 2WY8Q 4CCJA 2JVHA 2X6YA 4D1QA 1Z3XA 3OIPA 4U7BA 4E7IA 4XMYA 2MYSA 5CPRB 4AYBA 1WJDA 3OMYA 3BC8A 3ONQA 4JOMA 2KP6A 4J00A 2R4GA 2KDOA 4F93B 1PYVA 2IS1A 2R7RA 4BJ6C 4HNTA 1D0ZA 3SZGA 1LDKB 2MABA 4B44A 3H5AA 3QYEA 4XR6A 2XF6A 4PJJA 3OYIA 4XONA 3QODA 2FUG2 1UAAA 2Z16A 2DT7B 3HPGA 4LIUA 3OYDA 1UELB 2KQRA 4D9JA 2HVSA 2VXZA 2JVGA 3VYSB 1X1CA 3KEYA 4PJLA 2X1EA 2JUGA 3K4BA 2L5QA 3LSGA 4NC8A 3IAM2 1DGRM 2HVQA 4BQQA 3OYBA 3CZ6A 1V5EA 3K4KA 4XKBA 4H4KC 3OYAA 2OUMA 2W1OA 3BG6A 3HG9A 1Z21A 3VYRB 3SDBA 2VQCA 3W2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPZ A; 
#chains in the Genus database with same CATH topology
 3TDU C;  2MD0 A;  4BQN A;  2NAZ A;  1U0J A;  2QCO A;  1WCM J;  2V1N A;  1YJ9 I;  3D5L A;  5FRO A;  4Q48 A;  4ASN A;  5M5W J;  1LFP A;  2VOP A;  5DUI A;  5IOZ A;  1IC8 A;  4YII A;  2M7A A;  4A93 J;  2O6G E;  3HL2 A;  1XDS A;  3ZGK A;  3WGG A;  4QPO A;  4ZZL A;  1RUN A;  4C2M J;  4BE1 A;  1TQM A;  5FFZ A;  2VKD A;  2O9L A;  4XN0 A;  1V54 H;  1V5G A;  3KPH A;  2R7Z J;  2E34 A;  2ZXH A;  3H3Z A;  4RGX A;  2KRC A;  2L7M P;  3V8J A;  4P55 A;  3O8H A;  2CQK A;  3KEO A;  3QRF F;  1J59 A;  5IP9 J;  4U87 A;  1MNE A;  5DS9 A;  5ERI A;  1WZ2 A;  4A3M J;  4XID A;  5AON A;  3H1C A;  3L09 A;  1VFC A;  3EET A;  1MSF C;  2EIM H;  1OR7 A;  2F2E A;  2X9D A;  1SAN A;  3I59 B;  4MQ9 F;  2CWE A;  3PUB A;  1V5F A;  2X6O A;  1GUU A;  2P6S A;  5GAH J;  3KLO A;  4YFN F;  1IN6 A;  4E7L A;  3HC7 A;  4HG2 A;  1L3L A;  3GZ6 A;  3W3C A;  2YUS A;  3BTC A;  1G3W A;  4QPQ A;  1AWC A;  3BTI A;  2XGX A;  5ICG A;  2DA7 A;  2IGK A;  2LSO A;  2PG4 A;  1XN7 A;  3E6C C;  1JJ6 C;  4G9Y A;  2L7Z A;  3OYK A;  4ANJ A;  2LFB A;  2VXD A;  3CJN A;  2UZK A;  3CD6 I;  2RQQ A;  4UVC A;  3JR9 A;  3N97 A;  2HR3 A;  4HDU A;  2OC6 A;  3OIQ A;  4ZYD A;  1QHG A;  2LY9 A;  2A61 A;  3FK7 A;  1ETQ A;  4EQQ A;  1R71 A;  2DFF A;  2LKX A;  3TO6 A;  3DCF A;  3SYT A;  4DW6 A;  2F6C A;  2M9H A;  3QU3 A;  2H6C A;  1GT0 C;  1MGT A;  1SAX A;  1BC8 C;  1QZY A;  2TDX A;  2ZNY A;  3BCB A;  1W36 D;  1SMY F;  1R5I D;  2NNY A;  1ETW A;  1YW8 A;  1N78 A;  5HLI A;  2H8W A;  3DLL F;  2P5L C;  3U2R A;  2HYF A;  2HGC A;  2A07 F;  4A3K J;  1M1E B;  2V1X A;  5K5Q A;  3S3M A;  3BTL A;  2E1M B;  4IO9 F;  5GAE J;  3G2B A;  4UV8 A;  5TJJ A;  2W84 A;  3FXO A;  5L3D A;  2LRD A;  1ETX A;  1QPI A;  1ETY A;  3AG4 H;  1MW7 A;  3AG1 H;  3EUH A;  4RMN A;  5DCF A;  2V79 A;  2L7K A;  1WPK A;  3OYG A;  3KZY A;  5EEH A;  2WAE A;  1YOV B;  1STZ A;  3R0A A;  3MZH A;  2FOW A;  2FA5 A;  2MD5 A;  1J09 A;  3CDL A;  4FX0 A;  1EJ9 A;  1WJF A;  1ZTR A;  3RCO A;  4WXH A;  2JA2 A;  3I0T A;  3FXM A;  2H6B A;  3AL0 C;  1MKM A;  5EYR A;  3CC2 I;  1TL8 A;  4V2G A;  1Y0U A;  3SJM A;  1BN5 A;  2EV5 A;  1VQ4 I;  3IAS 2;  2A68 F;  1H88 C;  2PN6 A;  4EGZ A;  1GXQ A;  3QWL A;  2RDP A;  4OIR F;  4KA4 A;  1I1G A;  2HQN A;  1PDN C;  4EM2 A;  3HOY J;  5HS8 A;  3G4S I;  1OCO H;  2D2W A;  1OJL A;  5B1A H;  1KON A;  2XDV A;  3BR6 A;  1DPR A;  4O5V A;  5E8I A;  2CSO A;  3DPU A;  4HA8 A;  5F08 A;  3VEP A;  4ZTF A;  2R7Q A;  1XSV A;  2VB6 A;  4XL9 A;  2ZJP F;  3KP2 A;  3G71 I;  4GYI A;  3NWT A;  2NVU B;  2EA2 A;  1UZC A;  1BW6 A;  2PLY A;  3ZMD A;  3BWG A;  2QBY A;  3PQK A;  4BQA A;  3TBI A;  3BCA A;  1HF0 A;  2H1K A;  2OA4 A;  1JGG A;  3QPS A;  3A4C A;  5IPA A;  3S3O A;  3I9V 2;  4FQG A;  2FRH A;  2V1U A;  5K5O A;  2E2J J;  4CXF A;  5EF6 A;  3HOS A;  5BPD A;  2ESH A;  2FNP A;  2X6W A;  3B73 A;  2DOE A;  3FXJ A;  1QPM A;  1X3W B;  1Y39 A;  1BIB A;  3O2P E;  3ZRG A;  1I3Q J;  2HOA A;  2GIZ A;  3JRE A;  4Z6Y A;  3KEQ A;  1U5T A;  1GLN A;  4Y13 A;  1SMT A;  4DYC A;  5LGU A;  4F3Q A;  1R23 A;  2DU9 A;  5EG0 B;  3CCR I;  1BOB A;  1P4W A;  1YX5 A;  4Y17 A;  1FTT A;  3WE2 A;  2E2H J;  3F8C A;  4P1W A;  4A5N A;  5ILS A;  1WRJ A;  2BEO A;  1B9N A;  2F5E A;  3GFM A;  9ANT A;  2M0C A;  3F8N A;  3I3L A;  3GTO J;  1TQI A;  5J1R A;  5CLS A;  5L3C A;  5B66 C;  1HLV A;  5JLW A;  1VQ6 I;  4CA0 A;  4J19 A;  3U21 A;  5DEQ A;  3LNQ A;  3H35 A;  1VQ7 I;  1W5C C;  2JWT A;  3DU5 A;  3DXJ F;  4B47 A;  3CCM I;  2HPI A;  1Y8R B;  1UST A;  3W2V A;  2JUC A;  5CQG A;  4I99 C;  2O0Y A;  3HHH A;  3WTV C;  4RGS A;  1XGN A;  5KNL A;  4C2T A;  2EQR A;  4BQO A;  1JXS A;  1SVM A;  1EKE A;  2Q2E A;  5EJC A;  3W6K B;  2GM4 A;  4HRI A;  3F8F A;  4U0V A;  3H0D A;  1VQ5 I;  2IGM A;  4NC7 A;  2I8D A;  1YIO A;  4D0P A;  5HNF A;  2Y0S A;  2CMP A;  2LBF A;  5DTD A;  1T95 A;  2BW3 A;  2OCC H;  4G94 A;  2IJL A;  3O8G A;  1XMA A;  2PJP A;  4EAT A;  3L9F A;  1K61 A;  5J47 A;  1SD5 A;  4OIP F;  4CCL A;  2VJI A;  3BT9 A;  4FHT A;  1EH7 A;  4XLE A;  3K1M A;  3K4L A;  1KQ0 A;  1XGO A;  3GBG A;  4LB6 B;  4G6D A;  3A03 A;  3WG9 A;  4G8X A;  3B6A A;  4HPQ A;  3OSG A;  1FY7 A;  2XGE A;  1IRX A;  4XM3 A;  1VQL I;  3FMR A;  3GLL A;  3F8B A;  3PFY A;  1P92 A;  2PI0 A;  3ECO A;  4XRF A;  1E3H A;  1YS7 A;  1BIA A;  3B02 A;  3BG5 A;  5KHD A;  3ZMT A;  3KYC B;  2VQG A;  2KIF A;  4BHP A;  1YS6 A;  3LSR A;  1P2F A;  5GP9 A;  3HOT A;  1DGW Y;  2MC3 A;  3WU0 A;  3V42 A;  4KN7 X;  1X2M A;  1P4A A;  2XPU A;  5AIP A;  2EZI A;  2L2O A;  2BY2 A;  4CCK A;  4D7N A;  1JKP C;  1GXP A;  4S0H B;  4GDF A;  2VJ4 A;  2PX9 A;  3ERM A;  2VOO A;  5E1W A;  3OYF A;  2JK3 A;  2HYJ A;  5FB2 A;  4BGD A;  1ZN2 A;  1F4K A;  5FRN A;  1QRY A;  3L2C A;  2F48 A;  3TED A;  1XB4 A;  4GCV A;  5E1X A;  2E7X A;  4CH7 A;  2QM3 A;  5DDG A;  1LFU P;  2JA7 J;  4M73 A;  3SFI A;  1VQN I;  4LJZ F;  3ERE D;  2RN7 A;  4IQJ A;  3R4K A;  4IHS A;  2JZY A;  4JX5 A;  1D1C A;  1ZGA A;  5E79 C;  3TGN A;  4V19 K;  2VBY A;  1FEX A;  3VSK A;  3LA3 A;  3WHB A;  1A35 A;  2FX0 A;  3FZV A;  3ZQI A;  1T2K A;  2KMU A;  2A5Y B;  5GAG J;  1H9T A;  3K69 A;  1FLI A;  3KX2 A;  3L7W A;  2CUJ A;  3WTS C;  2HQ5 A;  1U9O A;  1BM9 A;  3C3W A;  4PJ0 C;  5J1Y A;  4LG3 A;  4PK4 A;  3H9Q A;  4ON0 A;  1N75 A;  3FM3 A;  2LY1 A;  1R4M B;  4C3H J;  3L2V A;  2E71 A;  3DTI A;  3I56 I;  1RR8 C;  4ESJ A;  5LFA A;  2E7W A;  3MWM A;  1D8J A;  1AOY A;  2M2E A;  2D45 A;  1P7I A;  3AG2 H;  4II2 A;  2EH3 A;  3T8T A;  4GYG A;  3RKW A;  1TW3 A;  4G7O F;  1WVR A;  2P7V B;  5F1R A;  1B8I A;  4HV5 A;  4A2U A;  4BJT A;  3TKY A;  4PDK A;  3BDD A;  3A1Y A;  3E7L A;  2CQ7 A;  2HZT A;  2UXN A;  4HX4 A;  1AKH A;  2VPR A;  2MG4 A;  1MBE A;  4BAY A;  1ETV A;  2RV8 A;  4BYY A;  4A5M A;  3ZQL A;  3ABK H;  2VKE A;  3NEU A;  1OPC A;  1T33 A;  3MEX A;  4HYE A;  1FOY A;  5E1Z B;  5J40 A;  1MIJ A;  2OZU A;  1XS9 A;  4HDV A;  1MND A;  2A5W A;  2OAZ A;  2HKO A;  3H3U A;  2ID6 A;  3K4N A;  2OD5 A;  3FXQ A;  5CQE A;  2DT5 A;  2YR2 A;  1MMN A;  4WXD A;  4LD5 A;  2QBY B;  3M1E A;  2H8R A;  4BHC A;  3M8J A;  5DM6 F;  3ULQ B;  3T1B A;  4MIM A;  2C6Y A;  1ZLJ A;  3FMQ A;  1WKM A;  5M3F J;  1ZHF A;  4BKX A;  4U7B A;  4E7I A;  4IEJ A;  1JUS A;  3LWF A;  1KU3 A;  4XMY A;  2MYS A;  1R4N B;  4HW0 A;  3QAH A;  1I6X A;  2RKH A;  4AIH A;  2DJN A;  4UVB A;  2A05 A;  3J80 K;  4J00 A;  1MSE C;  1U5T B;  2EJR A;  1X2N A;  4I01 A;  1D0Z A;  5BMZ A;  2MAB A;  4M9X A;  4ZYG A;  3MFK A;  2L9R A;  4XR6 A;  2DMT A;  2G0E A;  2L4A A;  2XF6 A;  4HZF A;  2Z99 A;  3S2D J;  2TCT A;  3OYI A;  4XON A;  2DMN A;  3QOD A;  2FUG 2;  1UAA A;  4O6J A;  4M74 A;  3GFL A;  2JQ7 A;  2ZNZ A;  3TP0 A;  2I10 A;  1ZG1 A;  3F0C A;  2DYR H;  2V1D A;  2B9S A;  2HOT A;  4PJL A;  4IXA A;  3WOD F;  5JR3 A;  2HVQ A;  2QGU A;  4UNO A;  1TW2 A;  3CZ6 A;  1QNT A;  1V5E A;  3K4K A;  4CGZ A;  1BW5 A;  1U6G A;  3KZZ A;  2OUM A;  2P8T A;  3P9I A;  3BG6 A;  5J8C A;  2OQR A;  3HSE A;  2BXZ A;  3VYR B;  1T8I A;  5D8L B;  4BU2 A;  3W2A A;  2R7F A;  2F4M B;  3EQL F;  3WU2 C;  2E36 A;  3Q0W A;  2Q2E B;  2K9L A;  4AVP A;  3D1N I;  2LNB A;  5KCM A;  3ZMU A;  3RKQ A;  2DPD A;  3BZK A;  2FML A;  2IPQ X;  4DIQ A;  1WJE A;  3E5X A;  2LBF B;  2ZKZ A;  4RS8 A;  2BW3 B;  2NS8 A;  1APL C;  2ETH A;  2DI3 A;  2ZXI A;  5FO5 A;  4BHB A;  3H92 A;  4FE4 A;  5E18 F;  5GPA A;  3EPZ A;  3IHU A;  1LVA A;  3EUK L;  3BR3 A;  2AS5 F;  4B1R A;  3CES A;  1W7P A;  2DA2 A;  3CJR B;  1QVT A;  3KP6 A;  3EYY A;  2D1H A;  4QTR A;  4OAY A;  4OOI A;  4I98 B;  2WBM A;  5K7Z A;  1TTY A;  1HW5 A;  1XGM A;  3H36 A;  4HLX A;  2V7F A;  4EMS A;  2JSC A;  5HOD A;  4IPA A;  2AO9 A;  2GIV A;  2Z9O A;  3VPR A;  1UB9 A;  2M5W A;  4ZTJ A;  3FBN B;  3D0S A;  2KZG A;  2CQN A;  2IP2 A;  1ONV A;  2K7L A;  2J5P A;  4Y33 A;  4S05 A;  1U8B A;  2V6C A;  5J4Y A;  3DF8 A;  4Q5S F;  1A6I A;  4NBQ A;  3ISP A;  2WY7 Q;  5DV5 A;  4N0B A;  2E1N A;  4YFK F;  3F23 A;  1W0T A;  1BI3 A;  1IUF A;  1I3A A;  1A31 A;  3E5U A;  1W7P D;  1RRJ A;  1BJZ A;  2DA1 A;  3GTG J;  1H8A C;  2EZH A;  2K9M A;  3IKV A;  3PM1 A;  2M7B A;  3HTS B;  1Z7U A;  2DJI A;  4U0W A;  1XMX A;  3QOE A;  1RKT A;  3LSP A;  3DWL E;  3KP3 A;  1KGS A;  4W97 A;  4ETS A;  3NAR A;  4F55 A;  3M07 A;  3CJQ B;  1ACI A;  3KP4 A;  3GLX A;  2NOG A;  4AYB N;  1DP7 P;  3Q3S A;  3VSL A;  3DKX A;  2VON A;  2OV7 A;  3Q9V A;  1ETO A;  1ZLK A;  2DA5 A;  1G59 A;  2STW A;  2X1C A;  4HLY A;  4IJA A;  3A0H C;  1SFE A;  1XSD A;  3J7A O;  2W7N A;  2BY1 A;  2OTJ I;  3FK6 A;  4RM3 A;  4C2U A;  3CF2 A;  3TOA A;  1YRN A;  2Y48 A;  2HDW A;  2N8G A;  5TRD A;  1YHQ I;  4WCG A;  1XMK A;  1JHH A;  4QSH A;  2D1V A;  3K0L A;  4UHT A;  4A0Y A;  4HNV A;  4MTD A;  1NTC A;  4ENN A;  1FYL A;  3LFU A;  2DQR A;  2HPM A;  1U3E M;  4I6Z A;  5EEG A;  1B4A A;  4QWQ A;  1MMG A;  3AG3 H;  1USS A;  2VL8 A;  3KP5 A;  1Y1W J;  3CP2 A;  1X3U A;  4NQW A;  4B3A A;  3WTT C;  1J9I A;  1B8I B;  4RAG A;  1S5L C;  1JI8 A;  3BP8 A;  3LFK A;  4OMZ A;  5FJ8 J;  3Q0U A;  1W0U A;  2RNJ A;  5LBQ A;  4YRV A;  4A3D J;  2IAI A;  2LYC A;  2YS9 A;  5LEJ A;  3HPH A;  5J4V A;  1AKH B;  2LF8 A;  3PSI A;  1MJB A;  3HGY A;  5AIQ A;  2ZJ2 A;  1S8N A;  2ZSH B;  5CJ9 A;  1D1A A;  2ELK A;  2RAE A;  3K4J A;  5B1B H;  3H5R A;  3IUO A;  1HDD C;  1WJ5 A;  3ZMV A;  4L5E A;  4EV0 A;  3I58 A;  2WB1 N;  2MLK A;  2L4M A;  1IO2 A;  1D0X A;  1MJ9 A;  4XKW A;  1OYY A;  3BLY A;  2WAF A;  4Q47 A;  3LSK A;  2HQR A;  2L0K A;  4XOP A;  5M3M J;  1TT5 B;  2R3S A;  2RC4 A;  5KVR A;  5K7F A;  3K10 A;  2DMQ A;  4ZDL A;  4KIC A;  3HOV J;  1JE8 A;  1X19 A;  1OKR A;  2K4J A;  1SAU A;  3GTP J;  3DBH B;  2IS4 A;  3E6D A;  3S14 J;  4UUT A;  2M4K A;  1FWZ A;  2RQP A;  4CSW A;  1DDN A;  3GTQ J;  4L9T A;  1ULY A;  4HAM A;  4PSW A;  3CDH A;  3DPT A;  1EH8 A;  4XLH A;  4IZZ A;  2P5V A;  4CO8 A;  3VB2 A;  3K9T A;  4OIO F;  4UUV A;  2I5U A;  1UHS A;  3V7C A;  1D5Y A;  1XC5 A;  3CCQ I;  2ACJ A;  1KQ8 A;  5HDN A;  2F5C A;  4YEJ A;  1YJN I;  1SVL A;  3QOP A;  3S16 J;  1BR2 A;  3EDP A;  1WH5 A;  1XCV A;  1TWF J;  2W48 A;  3VOE A;  1JKR C;  2KL4 A;  4G6Q A;  2CGP A;  2LF7 A;  4FIS A;  3COA C;  2Z1D A;  3OIO A;  1NH3 A;  2L9N A;  2PMU A;  2K9Q A;  3CLO A;  4BE2 A;  2WWY A;  4HOB A;  2ISY A;  3ZR8 X;  3K4M A;  4HST A;  3FHN A;  5LD2 C;  1FIA A;  3WE3 A;  3G73 A;  3MKZ A;  3K7A J;  2A6T A;  5FLX K;  5JHU A;  1FP1 D;  3SEZ A;  3CCS I;  5LRS A;  5FFX A;  2VBW A;  2JPC A;  2W25 A;  4NUB A;  3FWE A;  3GVA A;  3U1K A;  2XPV A;  4ABZ A;  3J7A Y;  1ODD A;  3VYU B;  1ZG5 A;  5FKN A;  2EIK H;  1ORK A;  3ZQQ A;  1T08 B;  2ECB A;  1O57 A;  2MH2 A;  2PEX A;  2FSW A;  2V26 A;  4ENJ A;  3MKL A;  2XAJ A;  4P9U A;  2XUB A;  1FJL A;  1Q1H A;  1W7P B;  3ZMZ A;  5CYV A;  3BR1 A;  1FX7 A;  3JRB A;  3DTK A;  2QQB A;  5HLG A;  2XAQ A;  1TWG J;  4MFD A;  1FYM A;  2ZME C;  2BHY A;  2MW8 A;  2GLO A;  1SC7 A;  3K70 C;  2CV1 A;  1BJA A;  2ZO4 A;  4Y4R A;  3ZN1 A;  2QLZ A;  2DN0 A;  4MFE A;  3D5S C;  2AXL A;  2HXI A;  4ENK A;  1EV7 A;  4MHG A;  3HRS A;  3OSF A;  1BL0 A;  3HRT A;  3DTE A;  1NK3 P;  1PP7 U;  2EV0 A;  4O3M A;  4EJT A;  1H89 C;  3IH2 A;  2PFB A;  4OWR B;  3H3V K;  4HF0 A;  1GHC A;  1QHH D;  4XSX F;  1U2W A;  5ILU A;  3A01 A;  4CZC A;  2X51 A;  4KIB A;  1TWH J;  5LHI A;  2F5V A;  2NNN A;  3OL3 A;  5DD4 A;  1B72 A;  4XK4 A;  4XNF A;  1YO5 C;  4MQV A;  1DP3 A;  2WTE A;  2FJ1 A;  5E17 F;  2ELJ A;  1FBU A;  1IF1 A;  3KYD B;  1O3S A;  3R6S A;  4YG2 F;  1A5J A;  1BR4 A;  3MN2 A;  5CVJ A;  3QPT A;  5DM7 F;  2KRH A;  2V9V A;  3JRG A;  4IHY A;  3W6V A;  1ENH A;  5ICE A;  1N25 A;  2RRE A;  3HKZ N;  1QQI A;  2FQ4 A;  2E2I J;  3IL2 A;  1ZRF A;  2LR8 A;  3REO A;  2QKM B;  2ZBK A;  4IX7 A;  3QQA A;  2R7X A;  2XVC A;  4ITV A;  4ZYH A;  2Z3Y A;  2XSJ C;  2L3D A;  1O3R A;  2KIQ A;  4XKV A;  5GTI C;  2H27 A;  1HOM A;  4JK1 X;  4YEL A;  3F21 A;  5E20 A;  2K40 A;  5BS6 A;  3CO6 C;  2JT1 A;  5JVT A;  4DZP A;  3ZQ7 A;  3FM5 A;  1UCR A;  1UG0 A;  2GZW A;  5HNH A;  1YRN B;  2NYX A;  3C2G A;  3RQ4 A;  4E4H A;  1K78 A;  1VQM I;  2KDZ A;  3BRO A;  2QQ8 A;  2XRO A;  3LAP A;  2NVT J;  1I50 J;  4JBA A;  3MAJ A;  3UNG C;  1GV2 A;  2HI3 A;  2MSY A;  5F0F A;  1X1A A;  5BPI A;  5D4R A;  4FET A;  1IDZ A;  5LRR A;  5LHH A;  4B09 A;  2VJ5 A;  4CCN A;  2DQL A;  1UFM A;  4NQW B;  2WAD A;  5F0H A;  1IN8 A;  2CH0 A;  4RAZ A;  1ZYR F;  2BVL A;  2W57 A;  1G6N A;  2ZSI B;  3RYR A;  4BDZ A;  3L2R A;  1FZP B;  1FOW A;  2AQE A;  4R1H A;  2QVO A;  4TV7 A;  4EJW A;  2YPR A;  2XKP A;  3KCC A;  3L00 A;  2W82 A;  1ZR2 A;  2ZXJ A;  4LLL A;  1Y8Q B;  3CTA A;  5IYC J;  1RES A;  4KMU X;  3H9J A;  4A3F J;  2NRA C;  4R79 A;  1Y0N A;  2H09 A;  2LC2 A;  4A0X A;  5E3O A;  3A0B C;  2CG4 A;  5L3E A;  4EM1 A;  1BC7 C;  3BJA A;  4BUP A;  3E5Q A;  2H1L A;  1W5S A;  2GA2 A;  5E3N A;  1TNS A;  3C7J A;  3O6B B;  3TL4 X;  1ZG3 A;  2V6E A;  4BY7 J;  3ECH A;  1OCC H;  2BOL A;  3AL0 B;  3BQZ A;  3GWZ A;  4UV9 A;  3IRQ A;  2NOJ B;  2WV1 A;  2KPM A;  2DA3 A;  1IRG A;  2HXO A;  3GYH X;  5D5V B;  2K4B A;  1HXD A;  3FXR A;  2GBY A;  4LG0 A;  2ID3 A;  4A3B J;  5LHG A;  1A04 A;  1J75 A;  1LKX A;  4NHJ A;  1I39 A;  1R9T J;  4F52 A;  2WY8 Q;  2OTL I;  5FLM J;  2JVH A;  3BR2 A;  2X6Y A;  1E2X A;  1Z3X A;  4LOC A;  3QP6 A;  2DMP A;  3X2Q H;  2HTJ A;  4BH9 A;  4M72 A;  1IN5 A;  1KA8 A;  2BV6 A;  1HDP A;  1VND A;  3BTJ A;  3BC8 A;  2OJE D;  3KE2 A;  2OF7 A;  2KKO A;  2KDO A;  3RZO J;  4IRG A;  4Z2Y A;  2HDC A;  2R7R A;  4BJ6 C;  3OV8 A;  3Q9S A;  3SZG A;  1FPQ A;  2EFN A;  3F6V A;  4B44 A;  2LK2 A;  1LPQ A;  2XAH A;  1RUO A;  2IA2 A;  1FBS A;  3WTZ A;  3BOQ A;  3GO5 A;  3DP7 A;  2VOD A;  2OCE A;  3K2A A;  2Z16 A;  1OYI A;  2KQR A;  1CGP A;  3GTM J;  3RQI A;  3GTK J;  3ZQH A;  1TNT A;  2X1E A;  2JUG A;  2LVS A;  2L5Q A;  1T98 A;  3W6J B;  4IL6 C;  3GEZ A;  3CMY A;  3WU1 B;  2LKS A;  4IOC F;  4F7Z A;  1A36 A;  1OMI A;  4XKB A;  2FNA A;  4KT5 C;  4H4K C;  4LFU A;  2W1O A;  5HS9 A;  4LGW A;  1LNW A;  4A6D A;  3HG9 A;  2RGV A;  5GTH C;  5C4J J;  5JVG F;  3G1O A;  3LSI A;  3MKY B;  2R7W A;  3CUQ C;  3PSF A;  1V4R A;  4XOT A;  1IZ1 A;  2JN6 A;  3FHZ A;  1IGN A;  1QU3 A;  1ZRE A;  4M3B A;  4A3I J;  2WAQ N;  3PO3 J;  4DOZ A;  1IRF A;  2P81 A;  1E3P A;  3G3Z A;  1I1S A;  4Y7N J;  2Y9Y A;  4I0B A;  3MVP A;  1KU2 A;  1HQC A;  3BG9 A;  3CP8 A;  4XLC A;  3HUG A;  3GTJ J;  2Z5U A;  2DBB A;  1WWX A;  5ICC A;  4RLF A;  3HOX J;  5J6X A;  2AHQ A;  3GME A;  1FBQ A;  2FBK A;  2IW5 A;  3ZN0 A;  4HNU A;  3R60 A;  1MBK A;  2DA6 A;  5CKT A;  2DAO A;  2M1B A;  4ZC3 A;  1EF4 A;  2VC0 A;  4RB1 A;  2PMZ A;  3K2Z A;  3A01 B;  2M4G A;  4I0A A;  4AU7 A;  3SFZ A;  1B72 B;  2DFH A;  4I76 A;  4I2O A;  2GWR A;  3RKY A;  3NAU A;  2XRL A;  5F6F A;  1RZ4 A;  1MJA A;  3JCU C;  2QSF X;  4ZDO A;  1XD7 A;  2EK5 A;  5FKO A;  2DDA A;  3HM5 A;  5EZG A;  1T56 A;  2XGC A;  5F04 A;  2DOA A;  4IVN A;  4UB8 C;  2M87 A;  5C4X J;  2YX4 A;  2HYG D;  1G3S A;  2LDU A;  1FIP A;  1YYV A;  3FX3 A;  2Z2S B;  1POG A;  2L7F P;  3K4C A;  1IG7 A;  3S2H J;  1ZGW A;  1HW1 A;  4E7S A;  3FBI B;  4B8X A;  2MBF A;  5FLV A;  2DA4 A;  4G6T B;  3ASO H;  5L3G A;  1IJW C;  2VE8 A;  2HZD A;  4OMY A;  3D5R C;  3DKW A;  3HRM A;  1IAW A;  3HGG A;  4KN4 X;  3QU6 A;  3J7Z I;  3JSP A;  3ABT A;  3IWZ A;  5K1Y A;  1IV8 A;  2X85 A;  4NC6 A;  3LSM A;  4EJO A;  3BZ6 A;  4XSZ F;  2R5Z A;  3ZQC A;  4LMY A;  4ZJZ A;  4ZYE A;  2MC4 A;  3J7Y J;  1VQP I;  4OIN F;  3MKW B;  1K78 B;  2ZFW A;  1K4S A;  4L0Y B;  1RI7 A;  4I02 A;  2VKV A;  1VI0 A;  4LLG F;  1I6H J;  4CCM A;  3RPQ A;  3L1P A;  3I4P A;  1ZH5 A;  1QZZ A;  4XLP F;  5L3F A;  4GO1 A;  3I4M J;  3ABL H;  5K5R A;  2GOX B;  2ECC A;  2L9S A;  3HB9 A;  1X1D A;  4KYW A;  2EBI A;  2X4H A;  3HRU A;  4IOA F;  1RNL A;  2OQG A;  3ZXS A;  1PJR A;  2CUE A;  1IW7 F;  1LJ9 A;  4RM2 A;  1RIO H;  1ZAO A;  2K86 A;  3I54 A;  1YI2 I;  5KAI C;  3T0Y A;  4ZYA A;  3TOB A;  1ZAR A;  1LFB A;  4FX4 A;  4QLC U;  5D6E A;  1T38 A;  3OYJ A;  2JA6 J;  3CF5 F;  2O3F A;  2LP0 A;  4AC0 A;  3PJR A;  3S15 J;  1BI0 A;  4X1E A;  2HVR A;  1FC3 A;  5HDK A;  2XAU A;  1Z91 A;  2COB A;  4XRS G;  1S3J A;  4RB3 C;  3WGI A;  4L9V A;  2VAS A;  2Q0O A;  5D5X B;  4RB2 C;  4E7H A;  4BE0 A;  2HU9 A;  2VUM J;  2KJB A;  2CFO A;  4RBO A;  4IQ4 A;  4M3D A;  2M30 A;  3OWT A;  4EEF G;  1BOA A;  2KIS A;  4WWC A;  3JRA A;  2DW4 A;  3C1D A;  4RA2 A;  1S7E A;  4PUS A;  1AA7 A;  2X1D A;  3KLN A;  4AM3 A;  2HDD A;  2GOM A;  2G7H A;  1P4X A;  2DXI A;  1MDM A;  4RB0 A;  3BG7 A;  3CCL I;  1Z6T A;  2DCE A;  3HEF A;  3R61 A;  3ESW B;  2UUZ A;  2E19 A;  5C44 J;  1HA8 A;  5IP6 A;  5CVR A;  5IY5 H;  2LKP A;  2IGO A;  2FU4 A;  2QQ9 A;  3HOW J;  3LQQ A;  1QA6 A;  1TT0 A;  1N77 A;  1RKW A;  2DLL A;  2CJJ A;  5J1U A;  1J7K A;  1OQY A;  2NS7 A;  3CQZ J;  1VQK I;  1ETK A;  2R7O A;  3KZI C;  5HOO A;  4IHW A;  2E35 A;  4XRS A;  1FP2 A;  1VQ9 I;  4IHX A;  3PFI A;  3FDY A;  4M3E A;  4ESB A;  2M0M A;  4H0E A;  3OS0 A;  4HBL A;  2NS0 A;  2ZJQ F;  1XG1 A;  3EUA A;  3F72 A;  4BXU A;  2X0L A;  1FSE A;  4ZH4 F;  3FIW A;  3RJP A;  1FNN A;  2XGD A;  3AFH A;  1MMS A;  4IRI A;  2QWW A;  4JQF A;  4HQM A;  4MO7 A;  5ILV A;  4HQE A;  5IT9 K;  3DPL C;  2O5R A;  1Z77 A;  1E0E A;  3LSJ A;  4AD9 A;  1XSX A;  3GX4 X;  1T0F C;  3PNV A;  3FXK A;  4A3L J;  2RVC A;  2LG4 A;  4U0Y A;  2K5C A;  5FKM A;  2VLA A;  1SVO A;  1Y56 A;  2GXG A;  5LLQ A;  2MFZ A;  2ZB9 A;  1UHM A;  1K79 A;  3DFG A;  1R7J A;  2XB0 X;  4MLO A;  1VQO I;  1R36 A;  1YLF A;  2YU9 J;  3O3K A;  2BGC A;  3F8M A;  3HHG A;  1TC3 C;  4YIR X;  1NG6 A;  3L2U A;  1S7O A;  4LIV A;  1IXS B;  4KFC A;  1Z6R A;  1J0R A;  3JSO A;  3ELK A;  1JJ8 C;  3HUG B;  3WG7 H;  3S1Q J;  2KIM A;  4RDU A;  4E7J A;  2Y9Z A;  3R0J A;  1SD7 A;  4HSR A;  4XN3 A;  2FOK A;  5IT3 A;  3I64 A;  1O3T A;  5KAF C;  1U8R A;  5EDN A;  1I5Z A;  3SZT A;  2EFQ A;  3I53 A;  2CS3 A;  2CQX A;  1MH4 A;  2BXY A;  4HX8 A;  5TIS C;  3F22 A;  5EGO A;  2Y2Z A;  2XV4 S;  1R00 A;  2EIJ H;  1J2X A;  2P5K A;  3S3N A;  1K6O A;  2O03 A;  1ZRD A;  4RAY A;  4DBR A;  1VQ8 I;  1QBJ A;  1ZGJ A;  1SFX A;  1FYK A;  3GF2 A;  4LIT A;  5HS7 A;  4MEX F;  3RSN A;  2VKH A;  2LRE A;  5LGT A;  3LSH A;  2GAU A;  1ZEL A;  2LY2 A;  3RYP A;  4PFP A;  3H9G A;  2NXN B;  5DYM A;  3G1M A;  3M8E A;  2R5Y A;  1R49 A;  1T6S A;  3MMY B;  2ZME A;  4CCO A;  3NRV A;  4OAZ A;  4KNY A;  3P9C A;  3IP4 B;  4LB5 A;  4EM0 B;  1CQT A;  1VZ0 A;  4RGR A;  5K7H A;  3HOU J;  1ON2 A;  1OCZ H;  4DBQ A;  3OYE A;  2DYS H;  4M9Z A;  2DK8 A;  3HJE A;  1VTN C;  4KIF A;  2R7V A;  1WJB A;  4GRI A;  2CW7 A;  2BE5 F;  1VF9 A;  3S17 J;  3J80 Z;  3MCZ A;  1SEU A;  3SZP A;  5B5E C;  2YX7 A;  1OCP A;  3RIR A;  3TO7 A;  2QKL B;  1D5V A;  1MNM C;  4UVA A;  2DT6 A;  1QZE A;  3BJO A;  5JLX A;  3PUF A;  4A3J J;  2MLG A;  2P6T A;  3HSR A;  2IGN A;  3KFW X;  2NVQ J;  4BXF A;  3T8R A;  3CCE I;  2G9W A;  3M3Y J;  2CUZ A;  1BR1 A;  2R5Z B;  5GAD J;  2XF5 A;  1H0M A;  1REP C;  3DEE A;  2BY0 A;  2KT0 A;  5D4S A;  4DZJ A;  2ISZ A;  1MH3 A;  1W1W E;  1D0Y A;  2K27 A;  1LDD A;  1O4X A;  2GXA A;  1JGS A;  1TZL A;  1QO0 D;  3PNY A;  2VBZ A;  1TWA J;  3CDI A;  3BPV A;  3K70 D;  1O3Q A;  3M8F A;  3P9K A;  2FXA A;  5IYB J;  3JRC A;  4IF4 A;  1MMA A;  4XLF A;  1FSH A;  1S6L A;  4L0Z B;  4E7K A;  2DK5 A;  4IKF A;  3K1P A;  3LAJ A;  3SHF A;  1JKO C;  2E1M C;  2FBI A;  4OU0 A;  2JRT A;  1BA5 A;  2R7D A;  3SEQ A;  5JI6 A;  2FQ3 A;  4BXX J;  1JHF A;  4P5O A;  3OY9 A;  1XGS A;  5FRM A;  4A69 C;  2JSP A;  4YIF A;  3GZN B;  2EFP A;  1TBX A;  3A02 A;  3OS2 A;  3C2B A;  3HOZ J;  2OBP A;  4BNC A;  1C0W A;  3H5N A;  1P9Q C;  4I09 A;  4ESF A;  2CV0 A;  1LVK A;  2L01 A;  5LEK A;  5H6R A;  5JHF A;  3DU6 A;  2JMW A;  2Y69 H;  4N9H A;  5EEA A;  1EA3 A;  2GQQ A;  4XOR A;  5M5X J;  1UJ8 A;  1XCB A;  2VQH A;  4XRM A;  5ICF A;  1O7F A;  1WFX A;  4G12 A;  3S8P A;  2A3S A;  2ZFU A;  3JAM K;  4IHV A;  4M71 A;  3QPL A;  5M5Y J;  3PO2 J;  2QF7 A;  4AIK A;  2XF7 A;  4Y15 A;  3L2W A;  1MDM B;  1YX3 A;  2VQL A;  1QVU A;  3IWF A;  4ZZD A;  2A6H F;  1PUF A;  3FMS A;  1Z67 A;  4C3J J;  4CYD A;  4D5F A;  1D8K A;  2E1C A;  5IT9 Z;  4E7Z A;  3HTU A;  3GCM A;  2VT3 A;  3WGH A;  2ZCW A;  3OYL A;  1G3T A;  4WK8 F;  2DTR A;  2Y0S N;  3OYN A;  4N9I A;  2R0Q C;  1JKQ C;  4A3G J;  4G7H F;  2XHK A;  2QQA A;  3TW7 A;  5IP7 J;  4HV6 A;  1R5G A;  2R7T A;  4KDP A;  2CU7 A;  2XB5 A;  1OLT A;  3KP7 A;  5E3M A;  3JRF A;  2HQA A;  2K9N A;  1JUM A;  3WTU C;  2NVY J;  2DFE A;  1ZRC A;  1OCR H;  1X1P A;  3ASN H;  2V9P A;  3E6B A;  3I5U A;  3ZPL A;  4AYB A;  3OMY A;  1F5T A;  3CME I;  2KP6 A;  4F93 B;  2IS1 A;  2ICW G;  2JPB A;  3H5A A;  3QYE A;  1JT6 A;  3GTL J;  2EWN A;  1YQA A;  2MA3 A;  2DT7 B;  3HPG A;  4LIU A;  2L02 A;  1ON1 A;  3OYD A;  4K2E A;  1UEL B;  2XAG A;  2PMH A;  2JVG A;  3ZMS A;  1Z05 A;  3K4B A;  3LSG A;  4NC8 A;  1HKT A;  3IAM 2;  2IBD A;  2FD5 A;  3OYB A;  1RET A;  1HKQ A;  3LST A;  3M9A A;  3P5J A;  3OYA A;  2R93 J;  1Y1V J;  5F1J A;  4B4C A;  1DUX C;  4GFB A;  5E8G A;  2IS2 A;  3M1C A;  4MNU A;  4DGW B;  1F43 A;  2CW8 A;  4BBR J;  2F5D A;  3OR1 C;  2LMD A;  1MBH A;  3F9K A;  1FTZ A;  5HDG A;  1YIT I;  3EYI A;  4DJA A;  3F6O A;  1OIS A;  4A0Z A;  1UG2 A;  4PGG A;  5EGO B;  2EFW A;  4EJV A;  3NWS A;  1YW9 A;  4UB6 C;  2QEX I;  1LE8 A;  3RPU A;  3DBR B;  2WB1 A;  2YSR A;  3QPH A;  3TO9 A;  2F5F A;  1B59 A;  2O7O A;  2PQ8 A;  2QEN A;  4LK0 F;  2EZK A;  1S72 I;  3CUQ A;  4OIQ F;  4WXC A;  3TMO A;  2PMZ N;  1OR7 C;  3N05 A;  3CC4 I;  2CQQ A;  4A6E A;  3ABM H;  2HEO A;  2R5Y B;  3DEU A;  5CVU A;  3C18 A;  4IHT A;  4L18 B;  2RNG A;  2OU2 A;  2P7C B;  1V55 H;  1WHU A;  2ZME B;  3ZQG A;  3IC7 A;  4F92 B;  1W36 C;  3T5X A;  1T39 A;  5C3E J;  2BVM A;  4JP0 A;  1JT0 A;  1FOK A;  2CRG A;  2D5V A;  3RTR A;  3S1R J;  3JW4 A;  1WI3 A;  2ZC2 A;  3K6G A;  2Q1Z B;  3FXL A;  2DOF A;  3FKJ A;  2DMU A;  1MZB A;  2ADU A;  4NNJ A;  2ZJR F;  3IH3 A;  3WTX C;  3P7N A;  1SFU A;  3QYF A;  4KIT B;  1Z0X A;  3OYH A;  5FD5 A;  2IXS A;  2EB7 A;  1R1V A;  3CCU I;  2B0L A;  4FE7 A;  1H9G A;  2QUF A;  5F27 A;  4KMF A;  4AUX A;  1DPU A;  3LL7 A;  3RPU D;  1KYZ A;  2R92 J;  5FKL A;  1R22 A;  1S29 A;  4CYC A;  3S1M J;  1YW7 A;  2UWM A;  3NQO A;  3S32 A;  3VYT B;  1NK2 P;  4RGU A;  2ELH A;  4QIW N;  4YFX F;  2PJR A;  4NB5 A;  2J5O A;  3BR0 A;  2BY3 A;  3UR3 C;  1HC8 A;  5IYD J;  4AVZ A;  1ZK8 A;  2LOO A;  3BJ6 A;  1P7J A;  4BEH A;  2DPU A;  3MZ8 A;  2JJ7 A;  1SD6 A;  2JA8 J;  1G2H A;  3OOU A;  3VOD A;  1YTY A;  1R5H A;  1FMW A;  2M45 A;  4L9N A;  1IDY A;  4DNC A;  3KIO A;  3CJT B;  4A3C J;  1HW2 A;  1D1B A;  2V9K A;  2O8K A;  1X4O A;  4PFO A;  5H6Q A;  5HLT A;  3WTW C;  3GFI A;  5D6F A;  2FBH A;  4Y3O A;  5FLX Z;  3RZD J;  1SFK A;  4B48 A;  3VFZ A;  4N4O B;  3JAM Z;  2G7U A;  3OR2 C;  1SD4 A;  3RDI A;  2BZT A;  3OS1 A;  4ENM A;  1KQ9 A;  1GVJ A;  2ESN A;  3HYI A;  3IRR A;  3EUH C;  4WF2 A;  4GXO A;  1I27 A;  4I7H A;  3I71 A;  1Q1V A;  4N4N B;  1S9H A;  1TQP A;  4HF2 A;  3DKY A;  2CO5 A;  3ML6 A;  3S2W A;  1XDU A;  2HKX A;  1GV5 A;  1QGP A;  3CMM A;  1X58 A;  1YJW I;  5HLH A;  1OYW A;  1P6R A;  4X6A J;  2K3F A;  3U9G A;  4F91 B;  4HEA 2;  2W00 A;  1OCT C;  4UUS A;  4PGH A;  5KK1 A;  4U7D A;  3IH4 A;  3LQR A;  4FCY A;  4E6K G;  4XBF A;  4FAS D;  1W5T A;  4WX9 A;  4BY1 J;  2VN2 A;  2IEK A;  2E1O A;  3K1N A;  4B43 A;  4LLN A;  6PAX A;  2EZL A;  2VE9 A;  2EPF A;  3Q5F A;  1BBY A;  2KFD A;  3HXL A;  2OPT A;  1PUF B;  1K4T A;  2R7U A;  3UKG A;  3Q0V A;  1RC9 A;  3DLA A;  3MQ0 A;  3CO7 C;  1XTA A;  5D5U B;  3VWB A;  4B3X A;  4A3E J;  2X48 A;  1YE9 A;  3HBL A;  3E1S A;  4E70 A;  2Y75 A;  4EVI A;  4II3 A;  5J8F A;  3QYB A;  3IKT A;  3BPX A;  2F4O B;  2VIX A;  3M7G A;  2IA1 A;  3KET A;  3HKZ A;  1SFO J;  2QSG X;  5F0C A;  3J81 Z;  2P4W A;  4PSX A;  3BQY A;  1TWC J;  3V4G A;  2WA0 A;  1B1B A;  3ZQF A;  2CYY A;  2XKO A;  4W1U A;  1Z7L A;  1IRZ A;  1JTX A;  1R6R A;  1AHD P;  2EFO A;  2QZ8 A;  3HDD A;  3GW2 A;  1U5T C;  3E97 A;  2ME6 A;  4LK1 F;  4BDY A;  2IT0 A;  3CC7 I;  3SQN A;  1BI1 A;  1UMQ A;  2GXB A;  5F64 A;  4KIS A;  4M3G A;  4KJZ A;  3HSF A;  4U88 A;  5J3L A;  5DCM A;  2FF4 A;  3CUO A;  4C9Y A;  5TGT A;  4XKC A;  3SDG A;  3E0J B;  3FIS A;  3PQJ A;  1X1B A;  2DFI A;  2HOE A;  4RAF A;  4DYR A;  4CUG A;  3SXY A;  2OZ6 A;  1Z9C A;  3JRD A;  1TP4 A;  1LQ1 A;  4FT8 A;  1LB2 A;  4PJM A;  1OFC X;  2W4S A;  3RKX A;  4MGR A;  1NG7 A;  2EV6 A;  4P96 A;  3TP3 A;  3BZC A;  4RLQ A;  3OYC A;  4X0G A;  1UHW A;  1XPX A;  3V8K A;  4PCQ A;  1BI2 A;  1B6A A;  1F1Z A;  2H94 A;  1CF7 A;  4GGG A;  4BS9 A;  3F3X A;  2XRN A;  1KZH A;  2NVX J;  1TLH B;  2MH9 A;  2BYV E;  4L5I A;  4ZDP A;  2FEZ A;  2IVM A;  1T0F A;  2W24 A;  5CVV A;  3DQV C;  4MTE A;  3VDX A;  3IV5 A;  3S1N J;  1X4P A;  5L3B A;  1J5Y A;  3DBL B;  1KU9 A;  2PBI A;  2A69 F;  4D7M A;  1LE8 B;  1E17 A;  2HFH A;  3PL8 A;  2Y31 A;  2K02 A;  3V7S A;  4G7Z F;  1K83 J;  1RR7 A;  4EGY A;  1ERD A;  2DDB A;  5E3L A;  2E60 A;  3H0G J;  2IS6 A;  3CUQ B;  2FE3 A;  1MBJ A;  2TRT A;  2HS5 A;  2KJC A;  3QP5 A;  1L0O C;  3CCY A;  5A2Q K;  2K9S A;  4C30 A;  5JFR A;  2XAS A;  3BG3 A;  5B3S H;  2VJJ A;  2LH9 A;  2CUF A;  2XAF A;  4XLA A;  2JA5 J;  1AU7 A;  2VC1 A;  1G8X A;  3GZ5 A;  4HF1 A;  3ZOB A;  1XX5 A;  1PVE A;  1R58 A;  2GA1 A;  2KRF A;  3CMA I;  1KYW A;  2CW0 F;  2K85 A;  2O8X A;  1ZR4 A;  3J81 K;  4M3F A;  1KU7 A;  1DU6 A;  1U9N A;  3LA7 A;  3TW6 A;  3OL4 A;  2EIL H;  3LMM A;  1F9N A;  1LUJ B;  1MMD A;  1YG2 A;  3OYM A;  3RI4 A;  2E5Z A;  4NDL A;  2LD5 A;  2KIU A;  3CLQ A;  2UXX A;  2R7S A;  2Y30 A;  4EJU A;  4CYC B;  1JUP A;  2QA4 I;  4S04 A;  2JRM A;  3FXU A;  3GXO A;  2M8E A;  2ME0 A;  1GVD A;  2PJR B;  2LTP A;  3ZP5 A;  2DTZ A;  4XLN F;  1R1U A;  4XIC A;  5CVI A;  4AIJ A;  2P0W A;  2E5N A;  3I59 A;  1JTY A;  3JTG A;  5D5W B;  2F4I A;  3FKI J;  1HST A;  4M9S A;  4M6X A;  3C2H A;  4BEH B;  3JRH A;  1K7A A;  4LG0 B;  3PNT A;  3PIP F;  1G4D A;  1LEB A;  3M4O J;  1LEA A;  1W4M A;  5DD8 A;  1DQU A;  3V7R A;  3LOC A;  1WJA A;  4XQF A;  3GUD A;  1D3Y A;  2M34 A;  3E3V A;  2V4J C;  1HBX G;  4AID A;  3LA2 A;  3GFJ A;  1RPW A;  3DV8 A;  1Z3Y A;  1MBG A;  1WI9 A;  5H2F C;  3AKZ A;  4AWX B;  1B9M A;  3TQN A;  4CIC A;  3TDZ C;  2B7E A;  2ZXW H;  1GDT A;  2M8G X;  1HSJ A;  2LLK A;  2M3A A;  4Y52 J;  2COM A;  1LDJ A;  2BHZ A;  2B63 J;  2WAQ A;  2UV1 A;  2WC2 A;  4JX6 A;  2HNH A;  5H20 A;  2K3P A;  1HCR A;  1IN7 A;  4BL0 B;  4DQ2 A;  1HKS A;  4Q4Z F;  4BBS J;  2O61 A;  2IA0 A;  4L9J A;  1Y6I A;  3FF5 A;  5BNG A;  2KLO A;  4UUS B;  2AXT C;  2MGQ A;  5HVQ C;  4M6V A;  5EZH A;  5ED4 A;  3JRI A;  2W85 A;  2EA4 A;  4UXN A;  2XC7 A;  3L2Q A;  3HIF A;  2CFX A;  4C3I J;  2VBX A;  3E6M A;  3A2K A;  5LGN A;  4BAC A;  2IRF G;  1IXR C;  2KHM A;  1WQ2 A;  2FMY A;  4R8H A;  5FKK A;  1X3Z B;  1E3O C;  1R1T A;  4D5C A;  1FMV A;  5GPC A;  2STT A;  4P9F A;  4KT6 A;  1YFH A;  3DEW A;  1FOX A;  3V8L A;  3ZCO A;  1O7L A;  3KYL A;  2QSH X;  4BJ5 C;  3OOP A;  1Z1D A;  2Y0M A;  3G1L A;  1ZKG A;  2DO7 A;  4J01 A;  2HWV A;  3BY6 A;  4M6Y A;  3ROU A;  2KZV A;  3W2W A;  4A12 A;  1PP8 F;  1ITY A;  4PJN A;  3S93 A;  2X6X A;  2AQF A;  2EIN H;  2CV2 A;  2A6E F;  3WTY C;  3MD2 A;  3PIO F;  3CCV I;  2VPL A;  1A6Q A;  1WJC A;  1K6Y A;  4JX4 A;  1WSU A;  3N4M A;  4CDG A;  4CCJ A;  3WHC A;  4D1Q A;  4UY8 I;  3OIP A;  4HX7 A;  2YU3 A;  1U78 A;  5IOY A;  3I55 I;  5CPR B;  4MEY F;  1F36 A;  5DCM B;  1IN4 A;  1WJD A;  2JTV A;  2HOS A;  3ONQ A;  4JOM A;  4CZZ A;  1PUE E;  2R4G A;  4KIG A;  2L54 A;  1PYV A;  3CCJ I;  4HNT A;  2VT2 A;  1LDK B;  1YIJ I;  4JYK A;  3I4N J;  2XSD C;  5BOX A;  2L9V A;  3G6E I;  3ABU A;  5DUK A;  2BBY A;  2WV0 A;  4PJJ A;  4V2F A;  4CHU A;  2XIG A;  3B6C A;  3HZJ A;  3U1D A;  1WGX A;  4IRH A;  1MBF A;  1IV6 A;  5A2Q Z;  3BR5 A;  1G3Y A;  1V3F A;  4PZJ A;  2Q8K A;  1DU0 A;  5FGM A;  4D9J A;  2HVS A;  1EH6 A;  2Z33 A;  3AAF A;  2HTS A;  2QYO A;  2VXZ A;  3JTH A;  3VYS B;  1CF7 B;  1X1C A;  2XPW A;  3KEY A;  3MZY A;  1NHA A;  5EG0 A;  1S7A A;  1DGR M;  2DOD A;  4BQQ A;  5BQT A;  4L5J A;  2VI6 A;  1MD0 A;  1IXC A;  4FTH A;  4KUM A;  4DYQ A;  5FD6 A;  1WH7 A;  1IUY A;  1ZQ3 P;  5D8K B;  1Z21 A;  1FT9 A;  3SDB A;  2VQC A; 
#chains in the Genus database with same CATH homology
 4BU2 A;  3LSI A;  2IS2 A;  2MD0 A;  3M1C A;  4DGW B;  4BQN A;  3PSF A;  3MKY B;  2CW8 A;  4XOT A;  2R7W A;  1U0J A;  2V1N A;  3F9K A;  3OR1 C;  2Q2E B;  2K9L A;  3D5L A;  5KCM A;  1QU3 A;  4DJA A;  5FRO A;  4DIQ A;  4DOZ A;  1LFP A;  1WJE A;  2LBF B;  2BW3 B;  3NWS A;  2M7A A;  2ZXI A;  2WB1 A;  3HL2 A;  3ZGK A;  3EPZ A;  3CP8 A;  4QPO A;  4XLC A;  3EUK L;  4BE1 A;  4RLF A;  3CES A;  2VKD A;  3TMO A;  1OR7 C;  3CJR B;  3N05 A;  4HNU A;  4XN0 A;  1V5G A;  4ZC3 A;  5CKT A;  2ZXH A;  2KRC A;  2RNG A;  2PMZ A;  4F92 B;  1W36 C;  2M4G A;  4OAY A;  2BVM A;  4AU7 A;  3RTR A;  4U87 A;  2WBM A;  1MNE A;  3K6G A;  2Q1Z B;  2V7F A;  3FKJ A;  4NNJ A;  4ZDO A;  3QYF A;  4ZTJ A;  4KIT B;  3FBN B;  3OYH A;  2IXS A;  3PUB A;  2DOA A;  1V5F A;  4Y33 A;  3LL7 A;  4E7L A;  3HC7 A;  4HG2 A;  3RPU D;  3W3C A;  2Z2S B;  3K4C A;  4QPQ A;  2WY7 Q;  4E7S A;  2UWM A;  3FBI B;  3S32 A;  3VYT B;  4G6T B;  2PJR A;  2IGK A;  3UR3 C;  4AVZ A;  2K9M A;  3OYK A;  2LOO A;  2M7B A;  2HZD A;  4ANJ A;  3D5R C;  2VXD A;  4BEH A;  3OOU A;  2RQQ A;  2DJI A;  1FMW A;  3QOE A;  2OC6 A;  3OIQ A;  1QHG A;  2X85 A;  3LSM A;  3DWL E;  4F55 A;  4ZJZ A;  1D1B A;  2MC4 A;  2V9K A;  1X4O A;  4PFO A;  5HLT A;  3CJQ B;  3SYT A;  3MKW B;  2F6C A;  4Y3O A;  1SFK A;  4B48 A;  4N4O B;  3VSL A;  3DKX A;  4CCM A;  2OV7 A;  3OR2 C;  1G59 A;  2X1C A;  3BCB A;  1W36 D;  3OS1 A;  2W7N A;  1N78 A;  3EUH C;  2GOX B;  4RM3 A;  4C2U A;  3CF2 A;  2L9S A;  1X1D A;  2HDW A;  4N4N B;  1S9H A;  3ZXS A;  1PJR A;  4RM2 A;  3DKY A;  3S3M A;  4ZYA A;  3CMM A;  2E1M B;  3G2B A;  3LFU A;  2HPM A;  3OYJ A;  4F91 B;  4HEA 2;  2W00 A;  2LRD A;  3PJR A;  4E6K G;  2HVR A;  1MW7 A;  4FAS D;  1MMG A;  2XAU A;  4RMN A;  2VL8 A;  3CP2 A;  2L7K A;  2VAS A;  4B43 A;  4E7H A;  3OYG A;  1JI8 A;  4BE0 A;  2HU9 A;  2WAE A;  2CFO A;  4YRV A;  3HXL A;  1J09 A;  2LYC A;  4IQ4 A;  3HPH A;  2R7U A;  1WJF A;  3PSI A;  3RCO A;  3OWT A;  2JA2 A;  2ZSH B;  3DLA A;  3AL0 C;  1D1A A;  3K4J A;  3H5R A;  3IUO A;  3VWB A;  4B3X A;  4PUS A;  1AA7 A;  1WJ5 A;  1YE9 A;  2X1D A;  3E1S A;  4II3 A;  3IAS 2;  2GOM A;  3QYB A;  2VIX A;  2DXI A;  1D0X A;  3BG7 A;  2DCE A;  4XKW A;  3BLY A;  2WAF A;  3HKZ A;  2UUZ A;  1HA8 A;  3LSK A;  4XOP A;  4PSX A;  2IGO A;  2WA0 A;  3K10 A;  1KON A;  4ZDL A;  2XDV A;  1X19 A;  1TT0 A;  1Z7L A;  3DPU A;  1N77 A;  1R6R A;  1SAU A;  4ZTF A;  2R7Q A;  2VB6 A;  4XL9 A;  2IS4 A;  3NWT A;  2M4K A;  2R7O A;  5HOO A;  4CSW A;  3TBI A;  3BCA A;  3FDY A;  2M0M A;  4BDY A;  3OS0 A;  4PSW A;  3A4C A;  3DPT A;  4XLH A;  3S3O A;  4IZZ A;  3EUA A;  3I9V 2;  4KIS A;  3HOS A;  2X6W A;  3AFH A;  4KJZ A;  4JQF A;  4C9Y A;  4YEJ A;  3ZRG A;  5TGT A;  3DPL C;  2O5R A;  4XKC A;  3E0J B;  1BR2 A;  1GLN A;  1X1B A;  4CUG A;  4F3Q A;  1E0E A;  2KL4 A;  1T0F C;  1BOB A;  3PNV A;  2Z1D A;  4PJM A;  1YX5 A;  2LG4 A;  2W4S A;  2L9N A;  2K5C A;  1NG7 A;  4P1W A;  4BE2 A;  2VLA A;  4RLQ A;  3OYC A;  1Y56 A;  3ZR8 X;  3K4M A;  2MFZ A;  4HST A;  4X0G A;  3FHN A;  3I3L A;  5LD2 C;  4MLO A;  3MKZ A;  2A6T A;  3SEZ A;  4CA0 A;  3U21 A;  4BS9 A;  3H35 A;  4ZDP A;  4NUB A;  3DQV C;  1NG6 A;  3L2U A;  3DU5 A;  3VDX A;  4B47 A;  1X4P A;  4LIV A;  2HPI A;  3J7A Y;  3VYU B;  3W2V A;  3PL8 A;  5CQG A;  3ZQQ A;  3HUG B;  1ERD A;  4E7J A;  2V26 A;  5KNL A;  4C2T A;  2E60 A;  4HSR A;  4XN3 A;  4BQO A;  2IS6 A;  3DTK A;  4HRI A;  3H0D A;  2IGM A;  2CS3 A;  4NC7 A;  2I8D A;  4C30 A;  5HNF A;  2Y0S A;  2CMP A;  2LBF A;  3K70 C;  3S3N A;  1T95 A;  2BW3 A;  2VJJ A;  2CV1 A;  2LH9 A;  4Y4R A;  4DBR A;  4XLA A;  3D5S C;  4EAT A;  4LIT A;  1G8X A;  3RSN A;  2VKH A;  2VJI A;  2LRE A;  4CCL A;  3LSH A;  4XLE A;  3K4L A;  1ZEL A;  2LY2 A;  3DTE A;  3GBG A;  4PFP A;  3H9G A;  4OWR B;  1QHH D;  3MMY B;  4HPQ A;  4CCO A;  3OL4 A;  4CZC A;  2X51 A;  1IRX A;  3LMM A;  4OAZ A;  4XM3 A;  1MMD A;  2F5V A;  3OL3 A;  3IP4 B;  3PFY A;  3OYM A;  1VZ0 A;  2E5Z A;  4XNF A;  2R7S A;  4DBQ A;  1DP3 A;  3OYE A;  2R7V A;  2ELJ A;  1WJB A;  4GRI A;  1BR4 A;  2CW7 A;  5KHD A;  2PJR B;  2VQG A;  2KRH A;  2QKL B;  2DT6 A;  2P0W A;  2E5N A;  2F4I A;  4BEH B;  3C2H A;  3HOT A;  1DGW Y;  3PNT A;  2RRE A;  3V42 A;  2IGN A;  4BXF A;  4CCK A;  1DQU A;  2L2O A;  1WJA A;  4XQF A;  2CUZ A;  1BR1 A;  2QKM B;  2XF5 A;  4IX7 A;  2VJ4 A;  2R7X A;  3DEE A;  4ITV A;  2V4J C;  3OYF A;  5FRN A;  4BGD A;  1D0Y A;  2XSJ C;  1Z3Y A;  4XKV A;  1TZL A;  4CH7 A;  3AKZ A;  3PNY A;  3K70 D;  4YEL A;  4IQJ A;  1UG0 A;  5HNH A;  1MMA A;  2M3A A;  4XLF A;  3C2G A;  3RQ4 A;  2WAQ A;  2UV1 A;  4E4H A;  4E7K A;  2HNH A;  4IKF A;  1D1C A;  2K3P A;  4BL0 B;  2E1M C;  3VSK A;  1Y6I A;  3SEQ A;  3UNG C;  1X1A A;  2KMU A;  2KLO A;  4P5O A;  3OY9 A;  4FET A;  5FRM A;  2JSP A;  2VJ5 A;  3KX2 A;  4CCN A;  5HVQ C;  2CUJ A;  4NQW B;  3OS2 A;  2WAD A;  2CH0 A;  3H5N A;  1P9Q C;  2XC7 A;  3L2Q A;  2BVL A;  2ZSI B;  4LG3 A;  2CV0 A;  1LVK A;  4PK4 A;  3H9Q A;  4BDZ A;  3L2R A;  1N75 A;  2AQE A;  2LY1 A;  3A2K A;  5JHF A;  3L2V A;  3DU6 A;  3DTI A;  4BAC A;  1EA3 A;  4XOR A;  5LFA A;  2KHM A;  2W82 A;  2VQH A;  1WFX A;  3S8P A;  4II2 A;  2ZFU A;  1FMV A;  3H9J A;  4R79 A;  2LC2 A;  2XF7 A;  4KT6 A;  3L2W A;  4BJT A;  1YX3 A;  3A1Y A;  2VQL A;  3ZCO A;  4BUP A;  3TL4 X;  3KYL A;  4BJ5 C;  2V6E A;  2BOL A;  3AL0 B;  4E7Z A;  2NOJ B;  2KPM A;  3OYL A;  4J01 A;  3OYN A;  2KZV A;  3W2W A;  1MND A;  2A5W A;  4PJN A;  1LKX A;  3K4N A;  3S93 A;  2X6X A;  2AQF A;  5CQE A;  2CV2 A;  1MMN A;  2R7T A;  3MD2 A;  3M8J A;  1OLT A;  2VPL A;  4F52 A;  2HQA A;  1WJC A;  1K6Y A;  2WY8 Q;  4CCJ A;  2JVH A;  2X6Y A;  4D1Q A;  1Z3X A;  3OIP A;  4U7B A;  4E7I A;  4XMY A;  2MYS A;  5CPR B;  4AYB A;  1WJD A;  3OMY A;  3BC8 A;  3ONQ A;  4JOM A;  2KP6 A;  4J00 A;  2R4G A;  2KDO A;  4F93 B;  1PYV A;  2IS1 A;  2R7R A;  4BJ6 C;  4HNT A;  1D0Z A;  3SZG A;  1LDK B;  2MAB A;  4B44 A;  3H5A A;  3QYE A;  4XR6 A;  2XF6 A;  4PJJ A;  3OYI A;  4XON A;  3QOD A;  2FUG 2;  1UAA A;  2Z16 A;  2DT7 B;  3HPG A;  4LIU A;  3OYD A;  1UEL B;  2KQR A;  4D9J A;  2HVS A;  2VXZ A;  2JVG A;  3VYS B;  1X1C A;  3KEY A;  4PJL A;  2X1E A;  2JUG A;  3K4B A;  2L5Q A;  3LSG A;  4NC8 A;  3IAM 2;  1DGR M;  2HVQ A;  4BQQ A;  3OYB A;  3CZ6 A;  1V5E A;  3K4K A;  4XKB A;  4H4K C;  3OYA A;  2OUM A;  2W1O A;  3BG6 A;  3HG9 A;  1Z21 A;  3VYR B;  3SDB A;  2VQC A;  3W2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...