1YG2A

Structure of the vibrio cholerae virulence activator apha
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
169
Chain Sequence
SLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELNKMGEQGLVTCVLEVYSITQAGRSALGEWFDQPTAHPTVRDEFSAKLMACSVQSAEPYRLQLAELVEESRKLVAHYQEIEAAYYANPAVLDKQQRLERLTLRRNLLVRQAWIQWADEVLAELNAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gene activator AphA
publication title Crystal structure of the virulence gene activator AphA from Vibrio cholerae reveals it is a novel member of the winged helix transcription factor superfamily
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
total genus 64
structure length 169
sequence length 178
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
A PF10400 Vir_act_alpha_C Virulence activator alpha C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yg2A01
1H9TA 1LB2A 3ZMZA 2GXBA 1J7KA 1C0WA 3GUDA 1ZGAA 3SZPA 4XBFA 3L09A 2RQPA 2A5YB 5LHHA 3CUQA 1USTA 3FMRA 3I4PA 2YSRA 1ZAOA 4BAYA 2O0YA 4N0BA 4KIFA 1MGTA 1XGMA 2TDXA 2A3SA 4WXHA 4IHTA 4YFXF 1GXPA 2ZXJA 1I5ZA 1F9NA 3V8KA 1FT9A 4OIQF 2FBIA 1BC8C 3E97A 1MJAA 2ZMEA 1ULYA 4LJZF 2YX7A 1P4XA 1Y0UA 2ESNA 2QUFA 3LFKA 2HDCA 1FY7A 5JHUA 3FX3A 3JSPA 4L0ZB 4FHTA 1ODDA 2EB7A 2E7WA 2M5WA 2PBIA 3LAJA 1ZYRF 4BHCA 1Z6RA 5KK1A 2F5CA 3FZVA 2NNYA 2OD5A 2EJRA 3LWFA 4Q4ZF 2MBFA 3EUHA 1GHCA 2CFXA 2CYYA 2XHKA 3COAC 3WGHA 1ZG5A 1FP2A 1ZN2A 2M45A 4B09A 1S8NA 1HW1A 4B8XA 3Q9SA 3FXRA 3KZZA 1IUYA 2ZO4A 2F2EA 5A2QZ 4RGUA 5L3CA 4EJWA 1ZRCA 3L00A 1DPUA 4ESFA 1O57A 5L3DA 4RB3C 3ZMSA 2L01A 3DP7A 3HOSA 2W25A 3U9GA 1T6SA 1D8JA 3CO6C 4A12A 3E3VA 4JBAA 2Y75A 4IF4A 4LFUA 2QQAA 3IC7A 1JHFA 5D5UB 2YPRA 1DUXC 1L0OC 3GVAA 3DQVC 5AONA 4IXAA 1TQIA 3T1BA 1R00A 1FLIA 2H09A 5CVRA 1OR7A 1W7PB 1YO5C 1BIBA 4HLXA 1KQ9A 4OIPF 3CUOA 2VT2A 1FWZA 4ASNA 3F3XA 4CZZA 4R1HA 3LSTA 1XSVA 4WXCA 3WTZA 5LGUA 4MEYF 2FF4A 2GA2A 4AVPA 3ROUA 5H20A 5HVQC 2LF8A 2Z9OA 3WTYC 1BM9A 4EVIA 5DYMA 3KP5A 2STTA 1IXSB 2EFQA 3BJAA 1LDKB 4G8XA 1KU9A 4HV6A 2E1NA 1FNNA 1O7FA 1B59A 1AWCA 2DBBA 2Z5UA 1CF7B 1JHHA 5AIQA 1K6OA 1HKTA 4Y17A 1OYWA 4M6XA 2ZNYA 3OV8A 4XLNF 3ML6A 2RC4A 1X3UA 1Z91A 5CJ9A 1TW3A 5HLGA 4KN7X 5ERIA 3HSFA 2EK5A 4AIHA 4IJAA 2XAJA 1FSHA 3EETA 3ISPA 1A04A 4KDPA 1B1BA 3RDIA 3GF2A 2L54A 4BHPA 3CUQB 2P4WA 1SFXA 2ETHA 1XDSA 2K4JA 4BQAA 4LK1F 1J0RA 3IHUA 4ZYGA 3REOA 2KIFA 1J59A 2ESHA 4I01A 2HGCA 4N9HA 2CW0F 3QRFF 4DNCA 2FE3A 1R5GA 2VE8A 2HTSA 4HQMA 1XDUA 4IHSA 4M9XA 4HF1A 3IWFA 2ZMEB 1S7AA 3NRVA 2DI3A 1FBUA 2IRFG 3T8TA 2O8XA 2IT0A 2UWMA 1YTYA 2HTJA 1XB4A 4KICA 2EFWA 1TNSA 3TOBA 1GVJA 2R3SA 3WTVC 1MKMA 2NRAC 2RKHA 2EFPA 5FFXA 1EH8A 1R23A 2QBYA 2A07F 4EQQA 4U0VA 4HBLA 1XGSA 2W57A 3I59A 2F5FA 1MZBA 2HYGD 3KCCA 4HOBA 4HV5A 3QPTA 4EMSA 2MLKA 4U0WA 5ICEA 4H0EA 1BI0A 4P9FA 2D1VA 3NEUA 2P6SA 2NAZA 2OAZA 3F21A 2PEXA 2E7XA 1O3SA 2QENA 1KU3A 1LEBA 4M74A 3SFZA 2PN6A 4A6DA 2LDUA 4U7DA 3T0YA 1ON2A 2LF7A 3EYIA 3JAMK 3HHHA 1YS7A 2W24A 3CUQC 2CGPA 3WTUC 4UVCA 1I6XA 3KP3A 1ON1A 4YIIA 2A6EF 2XAQA 1BIAA 1FYLA 1OKRA 3OOPA 3J80K 5FLXK 5D4RA 2IJLA 4RGRA 3CDHA 3RPQA 1WSUA 4WX9A 1ZRDA 3W6KB 1KU7A 1T38A 2FU4A 2YU3A 3VODA 4O3MA 2M8EA 5DDGA 2XASA 1FBSA 4BHBA 2XROA 5BOXA 5HOOA 3LA7A 1RZ4A 4G7OF 4K2EA 2P6TA 1W7PA 1UCRA 3ZMTA 4MTDA 2RV8A 2XAGA 5ICGA 4HX4A 4GYIA 1K7AA 4MEXF 1MJBA 1FP1D 3BP8A 2VOOA 5E8IA 3CTAA 4QWQA 5JR3A 1HBXG 2UXXA 5DCFA 5D8LB 1RUOA 1F5TA 5DV5A 2XIGA 2Z3YA 4LLLA 3RJPA 4PZJA 5DCMA 2DQRA 3H3ZA 3ZP5A 4I7HA 3V4GA 3HOTA 1LNWA 3RKWA 1ZREA 5BQTA 2RDPA 1BI1A 2XKOA 3JSOA 1BOAA 1S7OA 2UXNA 1Q1HA 1LDDA 5E1WA 1CF7A 2EFOA 3RIRA 2DU9A 4F7ZA 1XGNA 1YW8A 5BMZA 4E70A 4KA4A 1FBQA 2FBHA 4EJOA 4G6QA 1H9GA 1U5TC 2QVOA 1ZH5A 5CVVA 3FHZA 1HKQA 3JAMZ 4ZYHA 5CYVA 1UB9A 3C7JA 4RB2C 3WTWC 2CO5A 1KQ8A 2OQRA 2VBZA 2R7DA 3GEZA 3WTTC 2P5VA 5F6FA 1BI2A 5DEQA 4R8HA 1T39A 3RPUA 2P7VB 4GXOA 3LQQA 1ZG1A 3KP7A 5HDGA 1FYMA 3F8FA 5ICCA 3E6DA 1U6GA 3IRQA 5F1RA 1B9NA 2VN2A 4I98B 3E6MA 1I1SA 3D0SA 2VBXA 3IRRA 1YW9A 4ENKA 1D5VA 3GFMA 2G9WA 5HS8A 1QPMA 1W7PD 5E18F 2A6HF 3EQLF 2VBWA 2F5DA 2HKXA 2QBYB 4AIJA 2IW5A 3GFJA 4XSXF 1E2XA 1XMKA 3I59B 3I53A 1B4AA 2ADUA 2VE9A 5L3FA 2XAHA 1HQCA 1DPRA 4M72A 3VB2A 2BE5F 3WU0A 3HHGA 2XGXA 4EV0A 2JZYA 2L02A 4ETSA 2IA0A 5LGNA 4WXDA 4FT8A 2WTEA 3IKTA 2E1CA 3V7SA 2DPUA 3G73A 1IZ1A 3H3UA 1PP7U 4IRGA 2G7HA 1KGSA 3FXQA 2FSWA 3MWMA 2BV6A 4NHJA 4KMFA 1SMYF 4JQFA 2WV0A 1U8RA 4Z2YA 3BROA 4ENJA 2P5LC 1S6LA 3BJOA 4KMUX 4LK0F 1XCBA 2JSCA 2XKPA 1Z7UA 4L0YB 4GYGA 1R22A 2ZKZA 2A61A 2HEOA 5E1XA 1FC3A 2BYVE 3GWZA 1IN5A 3WG9A 1ZLJA 2H27A 4OINF 3ULQB 3QP6A 3JTGA 4S04A 1KU2A 2J5PA 4LMYA 1YW7A 1DP7P 3L7WA 1YG2A 2FNPA 3I0TA 2V79A 2KIUA 3MZYA 2PMUA 5FFZA 4N9IA 3FF5A 1SD4A 4UNOA 4ENNA 2EV5A 1EH6A 2Y0MA 1XGOA 2V6CA 4MQVA 3WE3A 3P9CA 1BBYA 4EM0B 1E17A 5ED4A 3P9KA 4P5OA 1TBXA 1XSXA 1VTNC 4EGYA 2Z33A 3D5LA 2FNAA 1O3TA 5CLSA 3E6BA 3VOEA 3HTSB 2DPDA 3R0AA 2FQ3A 3MEXA 4KT5C 1YFHA 3HYIA 3KLOA 3B73A 1FPQA 2V9VA 2P7CB 3WTXC 4U7BA 3KETA 2DK5A 4Q48A 2EFNA 4I0BA 3V8JA 5E17F 5DCMB 4KFCA 3PQKA 2A68F 2MA3A 3LQRA 2YX4A 1UHWA 2MH2A 4GCVA 2FOKA 2EA4A 3QPHA 1S3JA 3BPXA 1QGPA 3BJ6A 3HSEA 3GFLA 2K27A 5L3EA 5HLHA 4ENMA 3WGIA 3GX4X 3LA3A 1PUEE 2V1UA 1GXQA 4UVBA 5E1ZB 3U1DA 1DDNA 1RNLA 1XN7A 3F6OA 1R58A 1IRGA 3HUGA 4Y15A 5LEKA 4I09A 2P5KA 1HW2A 3ZMVA 4KNYA 2MD5A 3E6CC 4BYYA 5E8GA 4D0PA 5K5QA 2HKOA 2M87A 2CG4A 2DO7A 2MH9A 4DQ2A 2EV0A 5ILVA 5H6QA 2HZTA 4CGZA 2ISYA 3R61A 2GXGA 3KP2A 3F23A 3KP6A 2CSOA 1KYZA 1P6RA 4YIFA 1QNTA 1AOYA 3KLNA 1Z05A 1FSEA 4OMYA 1SD6A 2JTVA 1T0FA 2IA2A 3FM3A 4L9JA 1IXRC 1SD7A 4HQEA 2K02A 4A0ZA 3TO9A 3HSRA 1R1UA 4RGSA 4PGGA 5DD4A 1REPC 3ELKA 2Q2EA 4P55A 5DUKA 4MQ9F 1USSA 4I2OA 2VONA 5K5RA 4G9YA 4HDVA 2PQ8A 1OPCA 4Q47A 3DXJF 3WU1B 3N97A 1J75A 2LSOA 4HA8A 1FOKA 2D1HA 5FB2A 2B0LA 3N4MA 3O2PE 4WCGA 2VXZA 5HDKA 1P4AA 1ONVA 4EJUA 4ESJA 1YYVA 4L9TA 3ZMUA 3RKXA 3K9TA 3I5UA 4KIGA 3U2RA 1QBJA 4L5JA 1IN4A 1LDJA 4A5NA 3M1EA 4L9NA 3ZQ7A 3F6VA 4G94A 2RN7A 4ZZLA 2JPCA 2BGCA 3F8MA 3L2CA 2M30A 3QU6A 2ZJ2A 4HZFA 3RI4A 5LGTA 5E20A 2FBKA 3V7RA 3W6JB 3IWZA 3MQ0A 3PQJA 3HRMA 5J8CA 4L5IA 1TQPA 3K69A 3ABUA 3DKWA 1IAWA 1OYIA 4LD5A 4UVAA 4ZH4F 4NB5A 1SFEA 3FMSA 4PGHA 3ECHA 3GXOA 3JW4A 1UFMA 5DD8A 3SHFA 4HAMA 4MHGA 2ISZA 1ZRFA 2XAFA 4LG0A 3M8FA 1BJAA 4RS8A 2ACJA 3P7NA 3VFZA 3L9FA 3BZ6A 1R1TA 2XVCA 1SD5A 1KYWA 4IRHA 2YR2A 5LLQA 1G6NA 2G7UA 3KP4A 1QZYA 1YLFA 4CHUA 2QZ8A 4HX8A 2L4MA 4L9VA 2FEZA 1MD0A 1SAXA 1G3YA 1IF1A 5KVRA 2K4BA 3WE2A 5EEHA 4XSZF 3PFIA 1Z6TA 2ZFWA 2EV6A 4AWXB 5EEGA 3KFWX 4MGRA 5LHGA 4IPAA 4PDKA 3TDUC 2IVMA 3K0LA 4M73A 2LNBA 4O6JA 4R79A 4XRFA 2V1DA 1WI9A 4IRIA 2J5OA 4WWCA 1YIOA 3H92A 3T8RA 3ZN1A 2NNNA 2O6GE 2PI0A 2PG4A 4M9SA 1J5YA 3DFGA 3J80Z 1J2XA 1QZZA 3E5UA 3S2WA 5FLXZ 3RYPA 1G3WA 4EJTA 4HYEA 2P8TA 3P9IA 3BOQA 1STZA 3HRSA 2KJBA 4HW0A 4WF2A 1SFUA 3R6SA 1ZARA 2GWRA 3SZTA 5FO5A 2O03A 3GO5A 1ZHFA 3K1PA 3ECOA 3DPLC 3MAJA 2JT1A 4CDGA 1D8KA 4RB1A 2GAUA 2OA4A 5K1YA 3V7CA 1K78A 2OQGA 4NQWA 1ZG3A 5LRSA 4BH9A 2M1BA 5H6RA 2EWNA 4L18B 3J81K 4IVNA 3TQNA 1TLHB 1XD7A 2X4HA 3MZHA 3RKYA 1MDMA 3C1DA 1BI3A 4EJVA 4ON0A 5TRDA 1WRJA 5ICFA 4CO8A 3T5XA 5K5OA 3EYYA 3K1NA 1TNTA 4A6EA 2RNJA 3C18A 4HLYA 2HQNA 4GGGA 2KIMA 4MNUA 2GQQA 5AIPA 1W5SA 2Q8KA 2W85A 2IPQX 4KIBA 1LQ1A 5ILUA 5HS7A 3G3ZA 2VBYA 3CLOA 4RAYA 3DPTA 2BEOA 4OU0A 1TTYA 1UHMA 3MCZA 6PAXA 3ZPLA 1J9IA 1LJ9A 1QQIA 4CICA 2H94A 1PP8F 1L3LA 1EH7A 4BXUA 1F4KA 2OBPA 1H0MA 3V8LA 2QM3A 2L4AA 2Z99A 1CGPA 3EDPA 2DW4A 4RAZA 2AXLA 3IL2A 2BBYA 3KEQA 2AS5F 4EM2A 1P92A 5JVTA 1U5TA 5CVIA 2FA5A 1R36A 1WKMA 1KQ0A 3ZN0A 3KZYA 1G3SA 4BNCA 2PMHA 5HS9A 2GZWA 2XUBA 5IT3A 1O3RA 5LBQA 1P4WA 1RI7A 1WQ2A 1IN8A 1O7LA 1BN5A 2HS5A 3IKVA 2PLYA 5CVJA 3F72A 3I64A 1RIOH 5IT9K 1V4RA 3KE2A 2ELHA 2ZNZA 3F8CA 1LVAA 4LG0B 2KRFA 2PFBA 4YG2F 3R60A 1FZPB 5FD6A 1SMTA 5L3GA 3GZ6A 3TKYA 5F64A 1P2FA 2HOEA 4EM1A 1U2WA 4A2UA 2RVCA 1I27A 2DFIA 5D8KB 3FWEA 2H6BA 4M6YA 2W84A 4JK1X 2FMYA 4M9ZA 2HR3A 3HIFA 3TO7A 4ESBA 3K1MA 4P9UA 2JRTA 2HQRA 2QWWA 3J81Z 2HYFA 1HXDA 1QO0D 3WGGA 3ABTA 1XSDA 2FXAA 4A0YA 1XMAA 1EV7A 5D6EA 2O61A 3I54A 3BPVA 1Z1DA 2JPBA 4WK8F 4S05A 4FX0A 1I1GA 2DLLA 3FM5A 3DV8A 3M8EA 3WTSC 1XCVA 1IN7A 2CWEA 3HRUA 4OIRF 3DEUA 1O3QA 2XRNA 4LLNA 4G6DA 2D2WA 4U0YA 4KN4X 3LAPA 2PJPA 4P96A 1B9MA 2KJCA 1R5HA 1HW5A 1R1VA 3CO7C 2FRHA 3B02A 4ZYDA 5D5WB 3TO6A 2NYXA 1JGSA 2NS0A 2OU2A 1W5TA 2CQKA 1HSJA 4QLCU 1RUNA 3C3WA 3BY6A 1MJ9A 2DAOA 1JE8A 1IRFA 1YS6A 2L3DA 1B6AA 2K7LA 4FX4A 4M71A 2OZ6A 5FD5A 3K2ZA 1S29A 3QAHA 1G3TA 2F5EA 3NQOA 3RYRA 1U3EM 5HDNA 3GLXA 4A5MA 1K78B 3M7GA 4OMZA 4AIKA 4ZYEA 5LEJA 3E5QA 1MDMB 3O6BB 4AD9A 2STWA 1NHAA 2LKPA 4UHTA 2ZCWA 2OZUA 5IT9Z 1OYYA 2IA1A 3FXUA 4LB6B 2VOPA 1V3FA 4XLPF 4OIOF 1HKSA 2VC0A 2Q0OA 4HF0A 1YQAA 5LRRA 3HTUA 1IXCA 3J7AO 3ERED 4YFNF 4LLGF 3DF8A 3MFKA 5CVUA 1OMIA 4HX7A 4G7HF 2QLZA 2DTRA 4PCQA 4UV9A 1JXSA 3Q5FA 4CYDA 1Z9CA 2A69F 1BC7C 2VC1A 3TOAA 5L3BA 2WWYA 1FX7A 5D5XB 1HSTA 2QYOA 1LEAA 4ZZDA 2X0LA 3F22A 1R7JA 5ILSA 5FGMA 3KEOA 4Y13A 2DT5A 2IP2A 3TGNA 1KA8A 2MC3A 2RGVA 3F8NA 2KKOA 4CXFA 4UXNA 2DK8A 4G7ZF 3GYHX 4O5VA 3AAFA 5J8FA 4TV7A 2VODA 2GIVA 2DQLA 3QOPA 1W4MA 1U5TB 5J6XA 5BPIA 3BDDA 3RTRA 2QQBA 3GW2A 4UUVA 4RB0A 3ZMDA 2WC2A 3HRTA 5LHIA 2COMA 4YFKF 1IN6A 3O3KA 4I02A 1T98A 3E5XA 2Y48A 1ZLKA 1G4DA 2V1XA 3JTHA 3GFIA 1ZGJA 5D4SA 3R0JA 2K86A 5D5VB 3I58A 4MTEA 4EGZA 4GO1A 1TW2A 1U78A 4A0XA 4RGXA 2GA1A 3M9AA 5BS6A 3QP5A 1WWXA 2HFHA 2ZBKA 2XV4S 2HWVA 3SXYA 4KUMA 1IW7F 2R7FA 1TQMA 2UZKA 2H6CA 2VT3A 4U88A 3SQNA 2O3FA 5JFRA 5HLIA 2FMLA 4UV8A 3CJNA 4HF2A 1K79A 2C6YA 1FYKA 1T2KA 5A2QK 4Q5SF 3LA2A 2D45A 5TJJA 3Q9VA 5DUIA 4HDUA 1D3YA 4KYWA 1F1ZA 4OOIA 3TDZC 5D6FA 1PDNC 5BPDA 3R4KA 2EA2A 3WODF 3I71A 2QQ9A 4I0AA 3FMQA 4LB5A 3BWGA 4LGWA 3F8BA 5JI6A 3QU3A 3VEPA 2MLGA 3GZ5A
chains in the Genus database with same CATH superfamily
1H9TA 3G1MA 3CCSI 3ZMZA 1LB2A 2GXBA 3S3NA 5F27A 4F52A 1J7KA 1C0WA 3GUDA 1LUJB 1ZGAA 3SZPA 4XBFA 3L09A 3BQZA 2RQPA 3DTKA 2R7QA 1CQTA 2A5YB 3CCYA 5KAIC 5LHHA 3CUQA 3G2BA 4HSTA 1USTA 3FMRA 3IH4A 3I4PA 2YSRA 1ZAOA 2H8RA 3HDDA 4XLHA 1Q1VA 2O0YA 4N0BA 4BAYA 2E1MB 3PNTA 4KIFA 1MGTA 5E3OA 1XGMA 2TDXA 2A3SA 4WXHA 4IHTA 4YFXF 3OY9A 3K70C 1GXPA 2ZXJA 1I5ZA 3LFUA 4CCLA 2GM4A 2V1NA 1TWFJ 5M5XJ 2VJIA 1F9NA 4PSXA 1FT9A 4QPQA 3V8KA 3W2VA 4OIQF 2EINH 2FBIA 1BC8C 3HKZA 3CMEI 3E97A 4CCMA 1OCOH 1IV8A 1MJAA 5J4VA 2ZMEA 4J19A 1ULYA 4LJZF 2YX7A 4DBQA 1P4XA 1Y0UA 2BVLA 2ESNA 2QUFA 3LFKA 2NVTJ 2DFHA 3OYEA 2CS3A 3S1NJ 1K61A 2HI3A 2HDCA 5KAFC 4JOMA 1FY7A 5JHUA 3FX3A 3ABLH 3JSPA 3KEYA 1T8IA 2B7EA 3S16J 4NC7A 4L0ZB 4FHTA 1E0EA 3CCEI 2JA6J 1ODDA 2DMUA 4CYCA 2EB7A 3LSKA 2E7WA 2M5WA 1R49A 4C3IJ 2PBIA 3LAJA 1ZYRF 5JLXA 3VYSB 4DZPA 4BHCA 4IHXA 1Z6RA 5KK1A 2F5CA 3FZVA 3K6GA 1MBEA 2NNYA 2NVQJ 2OD5A 2EJRA 3AG4H 3LWFA 2MBFA 3EUHA 4Q4ZF 1GHCA 5M5WJ 4LOCA 1NH3A 4D7NA 2CFXA 2V7FA 4XLCA 2CYYA 2ZJRF 4A3CJ 2XHKA 5C3EJ 3COAC 3WGHA 1ZG5A 1FP2A 3C2GA 4FETA 1ZN2A 2M45A 2WA0A 5KHDA 2R5ZB 4B09A 1S8NA 2W1OA 1HW1A 4B8XA 1OCCH 2XGEA 4V2FA 3Q9SA 3FXRA 3KZZA 1IUYA 2RREA 2ZO4A 3VYRB 2F2EA 3CMAI 5A2QZ 4RGUA 5L3CA 1MH3A 2HPMA 4EJWA 2E36A 1ZRCA 2KMUA 3L00A 2HU9A 1QZEA 4ESFA 1DPUA 1O57A 2NVXJ 2FUG2 4X1EA 5L3DA 3DLLF 4RB3C 3BG5A 1S5LC 1PUFB 4D7MA 3ZMSA 1HLVA 3QYEA 2M4GA 2L01A 2NVYJ 3DP7A 5CKTA 3OYGA 3HOSA 5IYDJ 2W25A 3U1KA 3H5NA 1RKTA 3U9GA 2KL4A 3Q0VA 2LD5A 1T6SA 1D8JA 1BOBA 3CO6C 4A12A 3AG1H 5FKNA 1WH5A 3E3VA 4E7ZA 1TT0A 4A69C 4RBOA 4JBAA 2Y75A 2BHZA 4IF4A 2QQAA 4LFUA 4MFEA 1N78A 2JVHA 1T0FC 2E1MC 2X51A 2L0KA 3JRDA 2Y0SN 3IC7A 1JHFA 5D5UB 5F0FA 1SVMA 2YPRA 1E3OC 2LLKA 1DUXC 3W6VA 1L0OC 1SVLA 3BR3A 3LSMA 3QPSA 3GVAA 3DQVC 5AONA 3CMMA 1MBJA 4BQOA 2R5YB 1Z3YA 4IXAA 4C2TA 1DP3A 4HPQA 1TQIA 1MMNA 3T1BA 1UJ8A 1B8IB 5B5EC 5M3FJ 1R00A 1FLIA 1IV6A 3I56I 2H09A 4J01A 3CF2A 5CVRA 1OR7A 3TP0A 4LITA 3HOVJ 1TP4A 1HA8A 1W7PB 1YO5C 2CQ7A 2PMZN 1JKQC 1BIBA 4HLXA 2CRGA 1KQ9A 3DLAA 4YIRX 3VSLA 3ZGKA 4OIPF 1RPWA 3CUOA 4UY8I 2VT2A 1FWZA 4ASNA 3B6CA 2GOMA 2NOJB 3F3XA 1LPQA 4DBRA 2E60A 4CZZA 4R1HA 3LSTA 1XSVA 4WXCA 3WTZA 5LGUA 3ERMA 4JYKA 4MEYF 2Y69H 2Q1ZB 2FF4A 1VQ5I 2R92J 2GA2A 4AVPA 1BW5A 3ROUA 5H20A 1VQKI 2NS7A 1DQUA 2X85A 5HVQC 2LF8A 3N05A 2E2JJ 2Z9OA 3WTYC 2DN0A 1BM9A 4EVIA 1WGXA 5DYMA 5EJCA 3KP5A 2H1KA 2STTA 4CA0A 2DMTA 1IXSB 3V42A 1TZLA 2EFQA 2XB5A 1PJRA 2JK3A 1T56A 3K4LA 3BJAA 1LDKB 4G8XA 1KU9A 3OYBA 5J40A 3UNGC 2KDZA 4HV6A 3WG7H 3LSRA 1S9HA 2E1NA 3CJRB 1FNNA 4CCNA 1ZELA 1O7FA 4BGDA 2R7XA 1B72A 1B59A 1AWCA 2DBBA 5E3MA 2Z5UA 4CH7A 1CF7B 1JHHA 3BR6A 4XLAA 1WJ5A 5AIQA 1K6OA 2LBFB 1ENHA 4A3GJ 1HKTA 3OS0A 4Y17A 3S8PA 5KNLA 1NK3P 3GLLA 2WAQN 1OYWA 1BR4A 2M4KA 3AKZA 4M6XA 3CZ6A 4BL0B 2ZNYA 2ZSIB 3OV8A 1EKEA 4QIWN 1MBKA 3ML6A 2VKVA 4XLNF 2RC4A 3OYNA 2X6OA 2F5VA 1VZ0A 3L1PA 1X3UA 1Z91A 5CJ9A 3ZQQA 4NBQA 2L7ZA 3OS1A 1TW3A 1IRZA 5HLGA 3J7YJ 4KN7X 1GLNA 2K9QA 5ERIA 2EIKH 4DYQA 2E2IJ 4IO9F 3HSFA 2EK5A 4AIHA 3FDYA 4IJAA 2XAJA 1FSHA 3VSKA 3EETA 4GFBA 3ISPA 3IH3A 1A04A 4KDPA 1B1BA 1YJNI 2CUZA 3RDIA 1ETVA 2L54A 3GF2A 4BHPA 5EEAA 3CUQB 2P4WA 2CFOA 1A6QA 1SFXA 1D1CA 2ETHA 3CJQB 2EZHA 2TRTA 1XDSA 2LREA 4PJLA 2HXOA 2K4JA 4XM3A 1D1AA 4NUBA 4BQAA 4LK1F 1J0RA 3IHUA 4XK4A 1XTAA 4XLFA 4ZYGA 3MVPA 3REOA 5FRMA 1FIPA 2KIFA 5EDNA 1J59A 3OOUA 3HL2A 2ESHA 4I01A 1MIJA 2HGCA 4N9HA 2CW0F 5F04A 3RCOA 2EPFA 4DNCA 2FE3A 3QRFF 1R5GA 2VE8A 2DXIA 2ECCA 2FQ4A 1APLC 2HTSA 3IUOA 4HQMA 4AVZA 1XDUA 3K4NA 4IHSA 4M9XA 4W97A 1QVUA 4HF1A 3IWFA 1X19A 2ZMEB 2WAEA 2IGMA 2E19A 3GZNB 1S7AA 2XPUA 1X58A 3I3LA 2PJRB 5C44J 3NRVA 3LNQA 2XSJC 3HXLA 2CUJA 2DI3A 1FBUA 2IRFG 3K4BA 1TWAJ 3T8TA 2O8XA 2IT0A 2UWMA 1YTYA 2HTJA 4BE2A 2ME6A 1X4PA 2LK2A 1XB4A 4KICA 2YU9J 1Y1VJ 2EFWA 1TNSA 3TOBA 2ELJA 1GVJA 2R3SA 2M0MA 3MKYB 4NNJA 5M5YJ 1BR1A 3WTVC 3OS2A 4X0GA 1MKMA 4DGWB 2CJJA 2NRAC 4A3KJ 3ZQFA 2RKHA 5EYRA 2EFPA 1V5EA 4ZC3A 3S3MA 5FFXA 1EH8A 1R23A 3CQZJ 4XICA 3FKIJ 5M3MJ 3VWBA 2QBYA 3GMEA 2A07F 4EQQA 1E3PA 3S1RJ 4U0VA 4A3IJ 4HBLA 1XGSA 4F93B 2W57A 3I59A 4PUSA 2F5FA 1MZBA 2HYGD 3KCCA 4HOBA 1GT0C 4HV5A 2DFEA 3QPTA 1MBFA 1VF9A 4EMSA 3BT9A 2MLKA 4U0WA 3H36A 5ICEA 4H0EA 1BI0A 1OQYA 2ZFUA 4P9FA 3IAM2 1O4XA 1R71A 2D1VA 3OYAA 3NEUA 2P6SA 1QA6A 1FOXA 3DU6A 2NAZA 2XF5A 2Y30A 2IGKA 2BHYA 2OAZA 2MG4A 3F21A 2PEXA 2E7XA 1O3SA 2QENA 1KU3A 5IOZA 5C4JJ 1LEBA 4M74A 3SFZA 2PN6A 4A6DA 1WJAA 1FTTA 3BR1A 1K6YA 3HB9A 2LDUA 4F91B 2IGNA 1HDPA 3E0JB 4U7DA 2VKEA 3T0YA 1H89C 3S15J 1ON2A 2LF7A 3EYIA 3JAMK 2HVSA 2DA7A 4M3DA 4QPOA 3H1CA 1JI8A 2JJ7A 1F36A 3HHHA 1YS7A 2W24A 2OJED 3CUQC 2CGPA 3WTUC 5FKKA 4UVCA 1I6XA 3I9V2 2TCTA 2L5QA 3KP3A 4E7HA 1ON1A 3DTEA 1W5CC 2X6YA 2LVSA 4YIIA 2IS4A 2A6EF 3OYCA 2XAQA 1BIAA 1FYLA 1OKRA 3OOPA 3J80K 4MIMA 4E7LA 3MMYB 5FLXK 2FJ1A 5D4RA 2H1LA 2IJLA 4IKFA 3K10A 4DYCA 4RGRA 2VLAA 3CDHA 3RPQA 4AYBN 2DTZA 1SANA 1WSUA 4WX9A 1ZRDA 3W6KB 1KU7A 2KRHA 2XPWA 1T38A 1SVOA 3H9GA 3QOEA 2FU4A 2YU3A 5GAGJ 4Y4RA 4BBSJ 4LG3A 3VODA 4XORA 2L7FP 4O3MA 3QYFA 2M8EA 2VKHA 2XASA 5DDGA 3S14J 1FBSA 2IBDA 4BHBA 2XROA 3BZKA 3LSJA 5IPAA 3JRAA 3IH2A 5BOXA 5HOOA 4I76A 3DBRB 3C2HA 4UB8C 3LA7A 1RZ4A 4G7OF 4K2EA 5FKMA 1WVRA 3PJRA 2LH9A 2P6TA 1W7PA 2XAUA 1UCRA 3UKGA 3ZMTA 1WPKA 5GPAA 1ZKGA 2RV8A 4MTDA 2XAGA 4IX7A 5ICGA 4HX4A 3GZ5A 5FKLA 4GYIA 4BDYA 1K7AA 2NVUB 4MEXF 1MJBA 1FP1D 2LG4A 4B48A 4RM2A 4D9JA 3EUHC 5JLWA 2XF6A 3FIWA 3BP8A 2VOOA 5E8IA 3PNYA 4FE4A 3CTAA 3ZRGA 2AQFA 4QWQA 5JR3A 2HOTA 1Z7LA 2R7UA 2K5CA 2O8KA 1HBXG 2CUEA 1Y39A 3G6EI 3OIOA 2UXXA 2O7OA 5DCFA 1SFOJ 5D8LB 1RUOA 1JUMA 4RLFA 4BXXJ 4PJNA 1U9NA 2MGQA 2Z1DA 1F5TA 2WBMA 4IOCF 5DV5A 2LR8A 2XIGA 2Z3YA 4S0HB 4LLLA 1MMDA 2IAIA 1B72B 3RJPA 3HOZJ 4PZJA 4PK4A 3MN2A 1JT6A 1V54H 2X9DA 5GTHC 2R7RA 4XR6A 1S7EA 2I8DA 5DCMA 2DQRA 3H3ZA 3V4GA 4I7HA 3PIOF 3ZP5A 3HOTA 1LNWA 5J3LA 2DOFA 1X2NA 3RKWA 1ZREA 5BQTA 2RDPA 1BI1A 2XKOA 3JSOA 3FBIB 1BOAA 1S7OA 2UXNA 1YIJI 1Q1HA 5K7ZA 4OWRB 2MC4A 1FMWA 1LDDA 3BG7A 3GCMA 4V19K 1TC3C 1D5YA 5E1WA 1X2MA 2EZLA 4U87A 1CF7A 2EFOA 3RIRA 1FOWA 4AUXA 3QPLA 2DU9A 4F7ZA 1YI2I 1XGNA 1YW8A 5BMZA 2OPTA 4E70A 1JKOC 4KA4A 3HUGB 1FBQA 2RQQA 2FBHA 4YEJA 4ZTFA 2GIZA 2HZDA 4EJOA 4G6QA 1GVDA 1H9GA 1U5TC 2QVOA 1BL0A 3PO3J 1WH7A 1EF4A 2BY1A 1ZH5A 5CVVA 3IP4B 1MSFC 2UUZA 3FHZA 1HKQA 3JAMZ 4ZYHA 1BJZA 2AXTC 1QHGA 5CYVA 1UB9A 3C7JA 2MW8A 4RB2C 2E1OA 2CO5A 3WTWC 3MKWB 3SDGA 3RQ4A 1AKHA 1KQ8A 1E3HA 2ZC2A 4BE0A 2OQRA 2VBZA 2R7DA 2DA4A 3GEZA 3WTTC 2P5VA 5F6FA 1BI2A 1W0TA 5DEQA 4ZYAA 4R8HA 3C2BA 3RPUA 1T39A 2LY1A 2P7VB 1FOYA 4GXOA 2I10A 2DMQA 3LQQA 1ZG1A 3KP7A 5HDGA 1FYMA 2XRLA 4N4NB 3F8FA 1NG6A 1Y8RB 1U6GA 2DOEA 2QKMB 3E6DA 2H8WA 5ICCA 4BXFA 3HM5A 2L9RA 3IRQA 1N75A 5F1RA 1B9NA 2VN2A 3H0DA 4BUPA 3HPHA 4I98B 1X1PA 4CUGA 1ERDA 3E6MA 1I1SA 4E6KG 3D0SA 3H5RA 2DJIA 3ZCOA 1G59A 2VBXA 3IRRA 2V26A 1BA5A 1YW9A 2OTJI 3ZR8X 2R7SA 2Y9YA 4ENKA 1D5VA 3GFMA 3SYTA 2F6CA 2PJRA 2G9WA 4I6ZA 5HS8A 1QPMA 4RAFA 1W7PD 3KZIC 2X1CA 5E18F 2EIJH 2A6HF 3EQLF 2VBWA 2F5DA 2HKXA 2QBYB 2Q2EB 1M1EB 1K4SA 4AIJA 1QU3A 2IW5A 1Y56A 3GFJA 2XPVA 4XSXF 1E2XA 1XMKA 2XSDC 1JT0A 3I59B 5K7FA 3I53A 1AU7A 1D0XA 1B4AA 5TGTA 1VQPI 3CDLA 2ADUA 2M2EA 2VE9A 1WJEA 3FXOA 3O8HA 5L3FA 2DDAA 4B43A 2XAHA 1HQCA 3S93A 2F48A 5FLVA 3OIPA 1W36D 2HNHA 1DPRA 2VQCA 4M72A 1I39A 3VB2A 2BE5F 2F4OB 3WU0A 3HHGA 2XGXA 4EV0A 1T08B 2JZYA 3OYIA 3GTOJ 4C9YA 2L02A 4ETSA 2IA0A 5LGNA 4WXDA 3CMYA 3SJMA 4FT8A 2WTEA 2QSHX 2VPRA 5HLTA 3IKTA 3BG3A 2W48A 2E1CA 3V7SA 5DM6F 2KZVA 2QKLB 5E79C 2K9MA 2DPUA 4IEJA 3G73A 1IZ1A 1HF0A 3H3UA 4E7KA 2LRDA 4IRGA 1PP7U 2V9KA 2G7HA 1KGSA 3FXQA 1G2HA 4CSWA 1ZQ3P 3TL4X 2FSWA 3MWMA 2BV6A 4NHJA 2IEKA 4KMFA 1SMYF 4UB6C 4JQFA 2GXAA 2WV0A 2DA6A 1U8RA 2YUSA 1YJWI 4Z2YA 3BROA 4ENJA 3ZOBA 2LY2A 1S6LA 1X3WB 3BJOA 4KMUX 4LK0F 2P5LC 2CV2A 1K83J 2ELKA 1VQ8I 1XCBA 2JSCA 2X48A 2XKPA 1Z7UA 4L0YB 2KFDA 4GYGA 2VI6A 2FD5A 3BTIA 1R22A 2ZKZA 2A61A 2HEOA 5E1XA 3KPHA 1FC3A 2BYVE 3PO2J 3P5JA 3CD6I 2D5VA 3DKYA 3GWZA 2K9LA 2W4SA 3HPGA 4RA2A 1IO2A 4C3HJ 3S2HJ 4M3GA 1IN5A 3WG9A 4CCJA 1ZLJA 4M3FA 4OINF 3ULQB 2H27A 5E3NA 4BY1J 3QP6A 3JTGA 4S04A 1KU2A 1DGRM 2J5PA 1Y1WJ 2L7MP 4LMYA 3J7AY 1I3AA 1YW7A 2HVRA 3DCFA 3BCBA 3L7WA 1DP7P 4RDUA 3PNVA 2CQNA 1YG2A 3HOXJ 2FNPA 3I0TA 4KITB 2V79A 2KIUA 3MZYA 5GAHJ 2PMUA 5FFZA 4N9IA 3FF5A 4NC8A 2XDVA 1SD4A 2NXNB 4CCOA 4ENNA 2EV5A 4UNOA 3A02A 4LIUA 2VPLA 1EH6A 2Y0MA 4UUSA 4B4CA 3J7ZI 2IXSA 3MZ8A 1XGOA 2V6CA 4MQVA 3WE3A 1U0JA 3P9CA 1BBYA 4ZDLA 4EM0B 1E17A 3VYUB 5ED4A 1JUPA 3P9KA 4P5OA 1TBXA 1XSXA 5J4YA 1VTNC 4EGYA 2P0WA 2VJJA 2Z33A 3D5LA 2FNAA 3FBNB 1O3TA 5CLSA 3E6BA 3VOEA 3HTSB 2K85A 3W2WA 2DPDA 3R0AA 2OF7A 2FQ3A 4DYRA 3MEXA 1ETYA 2MABA 4KT5C 1YFHA 1YX5A 3S1MJ 3HYIA 2AQEA 3KLOA 3JRIA 1LE8A 3NWTA 3M8JA 2JA5J 3B73A 3G71I 1FPQA 2DCEA 3CESA 2EQRA 2ZSHB 1I6HJ 2V9VA 4GRIA 3WTXC 2P7CB 4U7BA 1HDDC 3KETA 2DK5A 2JMWA 4Q48A 2EFNA 2X1EA 4I0BA 3V8JA 5E17F 2I5UA 5DCMB 3JRFA 4KFCA 3PQKA 2A68F 2MA3A 3LQRA 2VQHA 3OYDA 1VQ9I 2YX4A 1UHWA 1LFPA 2LYCA 2MH2A 4MFDA 4GCVA 2FOKA 1H88C 2KPMA 2VB6A 2EA4A 3HZJA 3S2DJ 4G6TB 1EA3A 4XMYA 3QPHA 1S3JA 4E4HA 3DWLE 3BPXA 4BJ6C 5CPRB 2W82A 1QGPA 5C4XJ 1KONA 3BJ6A 2M3AA 5B3SH 3H0GJ 2CMPA 2R7TA 3HSEA 2B9SA 5GAEJ 2R0QC 3SEZA 3GFLA 2K27A 5L3EA 4MO7A 5HLHA 1YITI 1ETOA 4A3MJ 1VQLI 1ORKA 3Q0WA 2ZB9A 4ENMA 3WGIA 3GX4X 3JRBA 3LA3A 3CCLI 2CW7A 1PUEE 2V1UA 2DYSH 1GXQA 2DT6A 2LFBA 4UVBA 1WHUA 5E1ZB 3U1DA 1VQ4I 1ETQA 2PMZA 4A3FJ 1DDNA 2QSGX 1RNLA 1XN7A 3F6OA 1R58A 4BQNA 1IRGA 2VJ4A 1X1AA 3HUGA 1FMVA 4Y15A 1UAAA 5LEKA 5GTIC 4I09A 2P5KA 4AU7A 2DJNA 1HW2A 3ZMVA 4KNYA 3LL7A 2MD5A 3E6CC 1Z0XA 4BYYA 5IYBJ 1AKHB 5E8GA 3CCVI 2A5WA 4D0PA 5K5QA 2M9HA 2HKOA 4BACA 1I3QJ 2M87A 2CG4A 2DO7A 3A01A 4RAGA 3KYDB 3BTLA 2MH9A 3BG9A 3QYBA 3MD2A 2EV0A 4DQ2A 5ILVA 5F1JA 1ZR2A 3A0HC 5H6QA 2HZTA 4NDLA 2LOOA 2OTLI 4M3BA 3K4KA 5IP7J 1U8BA 1WFXA 4ANJA 4CGZA 4X6AJ 2N8GA 3Q0UA 3SZGA 2ISYA 1V5GA 3HBLA 4PSWA 2PX9A 2OCEA 3EUKL 1AHDP 4A3JJ 3AL0B 3R61A 5J1RA 1VI0A 2GXGA 3KP2A 3GTQJ 3F23A 1W36C 2L9VA 3KP6A 1SAUA 2CSOA 1KYZA 1P6RA 4YIFA 1YRNA 1QNTA 4NC6A 1DU0A 1AOYA 3KLNA 1YJ9I 5EGOA 1Z05A 2WB1A 1FSEA 3FK7A 3KYCB 4OMYA 1SD6A 4XRMA 2JVGA 2JTVA 1T0FA 1VNDA 4JP0A 5EZHA 2IA2A 3FM3A 4L9JA 1SD7A 1IXRC 4HQEA 2HOSA 2K02A 1OFCX 4A0ZA 2RNGA 3TO9A 3HSRA 3QWLA 3M07A 1R1UA 5GADJ 4RGSA 4PGGA 5DD4A 1REPC 3ELKA 4BEHA 4A93J 1TT5B 1MBGA 2Q2EA 4JX5A 2K3PA 4P55A 2CQXA 5DUKA 3L2UA 2JSPA 4MQ9F 1DGWY 1USSA 2ID6A 5CQEA 4I2OA 4DOZA 4CZCA 2VONA 2EIMH 3K4JA 5K5RA 4G9YA 4HDVA 3JRHA 2QGUA 2M34A 2PQ8A 1OPCA 1XMXA 2EILH 3HG9A 4HEA2 3ZQLA 2JWTA 4Q47A 3DXJF 3NARA 3WU1B 3N97A 1J75A 1Z3XA 2LSOA 3FXLA 4HA8A 3JREA 1IGNA 1FOKA 3CDIA 2D1HA 5FB2A 2KHMA 2B0LA 3N4MA 3LSGA 3O2PE 3LMMA 4WCGA 2VXZA 3K4CA 5IY5H 5HDKA 3GTPJ 1LVKA 3H35A 1P4AA 1UHSA 1ONVA 2DA1A 4EJUA 4ESJA 1YYVA 2ECBA 2DYRH 2HYJA 4D5CA 4L9TA 3ZMUA 3BZCA 3HOWJ 4C2MJ 3RKXA 1D0YA 3K9TA 2BY0A 5DM7F 4C2UA 3I5UA 2FOWA 1R9TJ 3A4CA 4KIGA 3O8GA 3U2RA 2B63J 2E71A 2HQ5A 1QBJA 3M1CA 4L5JA 1IN4A 1LDJA 4A5NA 3H9QA 3M1EA 1NG7A 2L7KA 4L9NA 1EJ9A 4F55A 2EH3A 3QODA 4HNTA 3ZQ7A 1S72I 5BNGA 3F6VA 4G94A 2RN7A 4ZZLA 2G0EA 2JPCA 4BBRJ 3D5SC 2BGCA 3F8MA 3L2CA 5H2FC 2M30A 1MNMC 3QU6A 4DW6A 3CC4I 3AL0C 2ZJ2A 4HZFA 1PVEA 2VUMJ 3RI4A 5LGTA 1F43A 5J47A 1A5JA 4F92B 3M3YJ 2ZMEC 5E20A 3JCUC 1UG0A 4B1RA 3CC2I 2FBKA 3V7RA 4UUSB 1HC8A 3W6JB 1OISA 3OR2C 3IWZA 1UG2A 3MQ0A 1JJ6C 1MNEA 3PQJA 4P1WA 3HRMA 5J8CA 3RZDJ 3IAS2 4L5IA 1IC8A 5GPCA 1TQPA 4BDZA 4YELA 4I99C 2V4JC 1Y6IA 2DT7B 3K69A 2L9NA 3ABUA 3DKWA 2JUGA 1IAWA 1OYIA 3PL8A 1I50J 3DTIA 4LD5A 4UVAA 4HNVA 1WJBA 2W7NA 3BTJA 4NB5A 4ZH4F 4FQGA 4DZJA 5F0HA 1SFEA 3FMSA 1LE8B 1WJFA 2CW8A 1FIAA 4PGHA 3KIOA 3I55I 2AHQA 2M7AA 3ECHA 3GXOA 2KQRA 3E7LA 4PJMA 3JW4A 4XN3A 1LFUP 1UFMA 1XG1A 5DD8A 3OWTA 1WCMJ 3SHFA 2DA5A 4HAMA 4MHGA 2ISZA 1ZRFA 2XAFA 3M4OJ 2HDWA 3DKXA 4LG0A 4ZJZA 3M8FA 1BJAA 2AO9A 4RS8A 3CC7I 2HQAA 1BW6A 2ACJA 3P7NA 4V2GA 4XQFA 4E7JA 3VFZA 1VFCA 3LOCA 3TW7A 1OCPA 2CQQA 1YE9A 3L9FA 4BKXA 3BZ6A 1R1TA 2XVCA 5LFAA 2Z16A 1SD5A 3BTCA 2DMNA 1V5FA 1KYWA 4IRHA 2YR2A 3AG2H 4AYBA 5LLQA 3WHBA 2EZIA 2Y31A 4BJ5C 4PFOA 1G6NA 3MKZA 1OLTA 4B47A 2G7UA 3KP4A 4GDFA 1W1WE 1N25A 3OSFA 1QZYA 1QHHD 1ETWA 2DFFA 2QQ8A 2LY9A 3CCMI 2MSYA 1P9QC 1YLFA 4CHUA 2KISA 3HKZN 5CQGA 2QZ8A 4HX8A 2COBA 2L4MA 1FEXA 1FTZA 4L9VA 3CF5F 2FEZA 3HOYJ 1MD0A 1SAXA 1G3YA 5GP9A 3JR9A 1IF1A 3OYHA 5KVRA 3FXKA 2K4BA 2WV1A 3WE2A 2ZJPF 3I4NJ 2Y2ZA 5EEHA 4Z6YA 2ICWG 4XSZF 5B66C 3PFIA 4C3JJ 5FLMJ 3A01B 2DDBA 1Z6TA 1OR7C 2ZFWA 2EV6A 4AWXB 5EEGA 3CJTB 4DJAA 3KFWX 4MGRA 5LHGA 4IPAA 2IS2A 3E1SA 4PDKA 3TDUC 2IVMA 4XIDA 1SFKA 3K0LA 3K7AJ 4M73A 1XC5A 1TWHJ 2LNBA 2IGOA 4O6JA 4XRFA 4R79A 2V1DA 1WI9A 4IRIA 2J5OA 4WWCA 1YIOA 3H92A 3T8RA 3ZN1A 2NNNA 1JKPC 2O6GE 2PI0A 2PG4A 4M9SA 1Z77A 1J5YA 3GTGJ 1NTCA 2X6WA 3DFGA 3GBGA 3J80Z 3G4SI 1J2XA 1QZZA 3E5UA 3S2WA 3ASNH 3U21A 5FLXZ 1G3WA 3RYPA 1YRNB 4EJTA 4HYEA 2P8TA 1XX5A 2JA2A 4PJJA 3P9IA 3BOQA 1STZA 3HRSA 4L5EA 4YRVA 5EGOB 4PJ0C 5FJ8J 2KJBA 4J00A 2BW3B 4HW0A 4WF2A 4XOPA 5EZGA 1SFUA 3R6SA 1ZARA 4F3QA 4XN0A 1U9OA 2VASA 4HNUA 1YOVB 2DMPA 2GWRA 1ETKA 1JTYA 3SZTA 5FO5A 2IS6A 2O03A 1MNDA 3GO5A 1ZHFA 3K1PA 3ECOA 3FHNA 3DPLC 3MAJA 1V55H 2F4MB 1PYVA 2JT1A 4CDGA 4BEHB 2EBIA 1D8KA 3ESWB 5JHFA 4RB1A 3CP2A 3CP8A 2GAUA 2OA4A 5K1YA 1Y0NA 3V7CA 1RR8C 2VQLA 1K78A 2OQGA 4NQWA 1ZG3A 3GTLJ 2R93J 3AG3H 5LRSA 1IG7A 5K7HA 4BH9A 2M1BA 5H6RA 2EWNA 2V9PA 4L18B 5EG0A 3J81K 2OCCH 2F4IA 3A0BC 4IVNA 3TQNA 1TLHB 2BZTA 1XD7A 2X4HA 3DEWA 3DU5A 3RKYA 2HXIA 1JTXA 1BI3A 3C1DA 3IV5A 3MZHA 4EJVA 1MDMA 4ON0A 5TRDA 1WRJA 5ICFA 4BY7J 3OR1C 4CO8A 3T5XA 2ZJQF 5K5OA 3EYYA 3Q3SA 2VJ5A 1MMGA 2R7ZJ 3K1NA 1IJWC 1TNTA 4A6EA 2R7WA 2RNJA 3C18A 4HLYA 2BVMA 2HQNA 1D1BA 2MYSA 2CV1A 4GGGA 1GV5A 2ZXHA 2KIMA 4MNUA 2QA4I 2GQQA 2O9LA 3GTJJ 5AIPA 1ZGWA 1TWCJ 2JA8J 1W5SA 2Q8KA 2W85A 2IPQX 5J1UA 1R6RA 4KIBA 3CCUI 2KLOA 1RRJA 2K3FA 5B1AH 2MFZA 3TW6A 4E7SA 4BS9A 1LQ1A 4RM3A 1G8XA 3PFYA 5ILUA 1GV2A 3CCRI 5HS7A 4HSRA 4KISA 3G3ZA 2VBYA 3CLOA 5KCMA 3S17J 2KT0A 4RAYA 3DPTA 1AA7A 2BEOA 4OU0A 1SEUA 1TTYA 4RLQA 1UHMA 3MCZA 4EATA 5J1YA 1IUFA 6PAXA 2WY7Q 3ZPLA 2HDDA 4A3BJ 1J9IA 3BLYA 2QEXI 5DS9A 1LJ9A 3S3OA 3PUFA 2QF7A 1QQIA 3VDXA 2BXZA 2X6XA 4CICA 2H94A 1PP8F 1L3LA 1EH7A 3LSPA 3F0CA 4BXUA 3ZQGA 2OBPA 1F4KA 4BE1A 1H0MA 3V8LA 2XGCA 2QM3A 4OAZA 2L4AA 3UR3C 3ZQCA 2Z99A 1CGPA 3VYTB 3DEEA 4LIVA 1IRXA 2K40A 2OUMA 3EDPA 2DW4A 1R4NB 3MKLA 4RAZA 9ANTA 2AXLA 5F0CA 1A6IA 3RPUD 3IL2A 2BBYA 3KEQA 4N4OB 2AS5F 4EM2A 1P92A 3PSIA 4IHYA 2P81A 5JVTA 1U5TA 2R7OA 4CCKA 5CVIA 5B1BH 2XC7A 3FXJA 2FA5A 1R36A 1WKMA 1KQ0A 3ZN0A 3KZYA 1G3SA 2BOLA 4BNCA 2BXYA 2PMHA 5HS9A 2GZWA 2XUBA 5IT3A 1XS9A 1N77A 1O3RA 5LBQA 3FK6A 3OYJA 1MH4A 1P4WA 4OAYA 1VQMI 1RI7A 1VQOI 1WQ2A 4XLEA 1O7LA 1IN8A 4RMNA 1BN5A 2HS5A 3IKVA 2PLYA 3ABKH 5CVJA 3F72A 3I64A 1RIOH 5IT9K 1V4RA 3KE2A 2ELHA 2ZNZA 3F8CA 3ONQA 1LVAA 4LG0B 3HOUJ 5JVGF 4IHWA 1WJCA 5IYCJ 2KRFA 1WJDA 1YHQI 2PFBA 4YG2F 1TL8A 3R60A 1QRYA 4ITVA 4XRSA 1FZPB 3ZQHA 5FD6A 1SMTA 5L3GA 3GZ6A 3TKYA 1X3ZB 4A3LJ 2GBYA 2JA7J 5F64A 1P2FA 2HOEA 3BCAA 1U2WA 4A2UA 2RVCA 1I27A 3FISA 4EM1A 3TP3A 2DFIA 4IQJA 1NK2P 5D8KB 2GOXB 3FWEA 2H6BA 4M6YA 4FASD 3L2RA 2W84A 4JK1X 1IDZA 2FMYA 4M9ZA 2E5NA 2HR3A 1JJ8C 1QPIA 3HIFA 3TO7A 2Y0SA 2Y9ZA 4ESBA 2MD0A 3K1MA 4P9UA 2JRTA 2HQRA 2QWWA 1A36A 4B44A 4KT6A 2O5RA 2KIQA 3J81Z 1R5ID 4ZDPA 3ZXSA 1UELB 4II2A 5HNHA 2HYFA 4HRIA 1HXDA 4XONA 1QO0D 4XKCA 2QSFX 3WGGA 3ABTA 2VXDA 3G1OA 1XSDA 3BR5A 2FXAA 1K4TA 3LSHA 4A0YA 1XMAA 1EV7A 5D6EA 2O61A 3I54A 4XKBA 3BPVA 1T95A 1Z1DA 2JPBA 4WK8F 4S05A 3OYLA 2L2OA 4FX0A 1BR2A 1I1GA 2WB1N 3WHCA 4ZTJA 2DLLA 3FM5A 3DV8A 3M8EA 2FX0A 1X1CA 3D5RC 1FJLA 4XKVA 1RETA 3WTSC 3HGGA 1XCVA 1IN7A 2CWEA 3HRUA 3HJEA 3L2QA 4HG2A 4OIRF 4EEFG 2LC2A 1OCRH 3DEUA 1O3QA 4H4KC 3WU2C 2XRNA 4LLNA 4G6DA 2D2WA 4U0YA 4KN4X 3TMOA 3EPZA 1Z67A 3BQYA 3BR0A 3A1YA 3LAPA 1GDTA 4P96A 2PJPA 1B9MA 2KJCA 1R5HA 1HW5A 5LD2C 2KRCA 1R1VA 3RQIA 3CO7C 2WY8Q 2K9SA 4C30A 2FRHA 3B02A 2X1DA 4ZYDA 5D5WB 2IS1A 1ETXA 3TO6A 2NYXA 3S32A 1JGSA 2NS0A 2OU2A 3VPRA 1W5TA 2CQKA 1VQNI 1HSJA 1ITYA 4QLCU 5EF6A 3C3WA 1RUNA 3BY6A 1MJ9A 2DAOA 1JE8A 1IRFA 1YS6A 2L3DA 1MBHA 3RKQA 1B6AA 2K7LA 4QTRA 2CV0A 1X1BA 3L2VA 1DU6A 3GTKJ 4M6VA 4FX4A 2CH0A 4M71A 5IP6A 4DIQA 3CCQI 5F08A 1YX3A 2CU7A 3AFHA 1Y8QB 2UV1A 2OZ6A 3KYLA 5FD5A 3EUAA 1VQ6I 2A05A 2BW3A 4FISA 3K2ZA 2DA2A 1S29A 3QAHA 1G3TA 2JQ7A 2F5EA 3F9KA 3NQOA 3RYRA 4FCYA 2WAQA 1U3EM 5IP9J 5HDNA 4BU2A 4IHVA 2KDOA 3BC8A 3GLXA 3SFIA 4A5MA 1K78B 4NQWB 1QVTA 3I4MJ 1P7IA 3M7GA 2WAFA 4OMZA 4AIKA 1RC9A 4ZYEA 5EG0B 3JRCA 5LEJA 3TEDA 3E5QA 4FE7A 1MDMB 3O6BB 2YS9A 4AD9A 4II3A 1NHAA 2A6TA 2STWA 2LKPA 4UHTA 2ZCWA 5IT9Z 1OYYA 2IA1A 4CYCB 3FXUA 4Y7NJ 4D1QA 4LB6B 2VOPA 5FROA 1V3FA 4XLPF 3G1LA 1ACIA 2DOAA 4OIOF 1LKXA 3K2AA 1HKSA 4XL9A 1ZK8A 1RKWA 1LFBA 2VC0A 3QQAA 3HC7A 2Q0OA 3CLQA 4HF0A 3OYMA 1YQAA 3FKJA 4IL6C 3K70D 3PUBA 2CUFA 1ZTRA 2E35A 5LRRA 2BY3A 4PFPA 2XF7A 3HTUA 2HPIA 1IXCA 2EZKA 3J7AO 4XRSG 3ERED 5HNFA 3NWSA 4YFNF 3OSGA 4LLGF 4AIDA 3DPUA 4B3AA 3DF8A 4IZZA 3MFKA 5CVUA 1OMIA 2ME0A 4HX7A 4G7HF 2NS8A 1ZR4A 2QLZA 2DTRA 2BY2A 3RZOJ 3OL3A 4PCQA 4UV9A 1JXSA 3Q5FA 4CYDA 1Z9CA 4KJZA 2A69F 2XB0X 3LSIA 3RSNA 1WZ2A 4W1UA 4FTHA 1MSEC 2JN6A 3OMYA 1BC7C 3A2KA 2VC1A 4AM3A 3PM1A 3OIQA 3W3CA 3TOAA 3ASOH 5L3BA 2R5ZA 2WWYA 3DBLB 1WI3A 2DODA 1FX7A 5D5XB 1HSTA 2QYOA 5HODA 1LEAA 1RESA 4ZZDA 2X0LA 2LTPA 4AC0A 4D5FA 3F22A 1R7JA 5ILSA 3W2AA 5FGMA 2R4GA 3KEOA 4Y13A 2DT5A 2IP2A 3TGNA 4UUTA 4XKWA 1KA8A 3ABMH 1PUFA 1W0UA 3D1NI 2MC3A 2RGVA 2JUCA 3F8NA 2KKOA 2L9SA 3PSFA 2LP0A 4CXFA 4UXNA 2DK8A 4G7ZF 3GYHX 1RR7A 1UZCA 2JRMA 4O5VA 3AAFA 2KZGA 3PIPF 1MW7A 5J8FA 4TV7A 1X1DA 2VODA 2GIVA 1VQ7I 2DQLA 3QOPA 1W4MA 1U5TB 2OC6A 5J6XA 5FKOA 3GTMJ 1OJLA 5BPIA 3BDDA 3RTRA 2KP6A 1SC7A 2QQBA 3GW2A 4UUVA 4RB0A 3ZMDA 3S1QJ 2LKSA 2WC2A 3HRTA 4YFKF 2COMA 2ID3A 5LHIA 1IN6A 1JGGA 3O3KA 2LMDA 4I02A 4A3DJ 1T98A 2K9NA 2R5YA 1IDYA 3E5XA 1J09A 3DBHB 2Y48A 1ZLKA 4XNFA 1G4DA 3OYFA 2LKXA 1B8IA 3BR2A 2V1XA 2Z2SB 2XGDA 3JTHA 3GFIA 1ZGJA 5D4SA 1T33A 3R0JA 2K86A 5D5VB 3I58A 4MTEA 4G12A 2VIXA 4EGZA 4GO1A 1TW2A 1U78A 4A0XA 3H3VK 1P7JA 4RGXA 2GA1A 3M9AA 3JRGA 5BS6A 4BJTA 3SDBA 5E3LA 1UMQA 3QP5A 2DA3A 1POGA 3X2QH 4ZDOA 1WWXA 2HFHA 1A35A 2HVQA 1D0ZA 2E2HJ 3L2WA 1TWGJ 2ZBKA 4A3EJ 2XV4S 1R4MB 2WADA 2HWVA 3SXYA 2NOGA 4KUMA 1IW7F 2R7FA 1HOMA 3BG6A 1TQMA 4MLOA 2H6CA 2UZKA 4Y3OA 3B6AA 4B3XA 2VT3A 5FRNA 4U88A 3HGYA 5TISC 3ZQIA 2OV7A 4XOTA 2O3FA 4M3EA 3SQNA 3NAUA 5JFRA 2RAEA 4JX6A 1H8AC 5HLIA 1JKRC 4JX4A 2FMLA 1Z21A 4UV8A 2E5ZA 2E34A 2GLOA 3CJNA 4Y52J 4HF2A 2M8GX 3SEQA 1K79A 4IQ4A 1FYKA 1T2KA 2C6YA 2V6EA 3HEFA 5A2QK 5DTDA 1MMSA 2VL8A 4Q5SF 3LA2A 2D45A 5TJJA 3H9JA 1XPXA 3Q9VA 5DUIA 3FXMA 4HDUA 1JUSA 1HCRA 4BQQA 3K4MA 1D3YA 2VKDA 4KYWA 1OCTC 2M7BA 4ABZA 1F1ZA 2HOAA 2ZXIA 3H5AA 4OOIA 1A31A 3TDZC 1MMAA 5D6FA 1PDNC 4IOAF 4QSHA 3OYKA 1KZHA 2M0CA 5BPDA 4E7IA 3R4KA 2LBFA 2EA2A 3WODF 3A03A 2W00A 3I71A 3OL4A 2QQ9A 4I0AA 1X4OA 3FMQA 4LB5A 1OCZH 3BWGA 3TBIA 4LGWA 1GUUA 2ZXWH 3KX2A 2VQGA 2QCOA 4Y33A 5IOYA 3F8BA 5JI6A 3QU3A 3CCJI 2R7VA 3VEPA 2MLGA 2OZUA
chains in the Genus database with same CATH topology
1H9TA 1LB2A 3ZMZA 2GXBA 1J7KA 1C0WA 3GUDA 1ZGAA 3SZPA 4XBFA 3L09A 2RQPA 2A5YB 5LHHA 3CUQA 1USTA 3FMRA 3I4PA 2YSRA 1ZAOA 4BAYA 2O0YA 4N0BA 4KIFA 1MGTA 1XGMA 2TDXA 2A3SA 4WXHA 4IHTA 4YFXF 1GXPA 2ZXJA 1I5ZA 1F9NA 3V8KA 1FT9A 4OIQF 2FBIA 1BC8C 3E97A 1MJAA 2ZMEA 1ULYA 4LJZF 2YX7A 1P4XA 1Y0UA 2ESNA 2QUFA 3LFKA 2HDCA 1FY7A 5JHUA 3FX3A 3JSPA 4L0ZB 4FHTA 1ODDA 2EB7A 2E7WA 2M5WA 2PBIA 3LAJA 1ZYRF 4BHCA 1Z6RA 5KK1A 2F5CA 3FZVA 2NNYA 2OD5A 2EJRA 3LWFA 4Q4ZF 2MBFA 3EUHA 1GHCA 2CFXA 2CYYA 2XHKA 3COAC 3WGHA 1ZG5A 1FP2A 1ZN2A 2M45A 4B09A 1S8NA 1HW1A 4B8XA 3Q9SA 3FXRA 3KZZA 1IUYA 2ZO4A 2F2EA 5A2QZ 4RGUA 5L3CA 4EJWA 1ZRCA 3L00A 1DPUA 4ESFA 1O57A 5L3DA 4RB3C 3ZMSA 2L01A 3DP7A 3HOSA 2W25A 3U9GA 1T6SA 1D8JA 3CO6C 4A12A 3E3VA 4JBAA 2Y75A 4IF4A 4LFUA 2QQAA 3IC7A 1JHFA 5D5UB 2YPRA 1DUXC 1L0OC 3GVAA 3DQVC 5AONA 4IXAA 1TQIA 3T1BA 1R00A 1FLIA 2H09A 5CVRA 1OR7A 1W7PB 1YO5C 1BIBA 4HLXA 1KQ9A 4OIPF 3CUOA 2VT2A 1FWZA 4ASNA 3F3XA 4CZZA 4R1HA 3LSTA 1XSVA 4WXCA 3WTZA 5LGUA 4MEYF 2FF4A 2GA2A 4AVPA 3ROUA 5H20A 5HVQC 2LF8A 2Z9OA 3WTYC 1BM9A 4EVIA 5DYMA 3KP5A 2STTA 1IXSB 2EFQA 3BJAA 1LDKB 4G8XA 1KU9A 4HV6A 2E1NA 1FNNA 1O7FA 1B59A 1AWCA 2DBBA 2Z5UA 1CF7B 1JHHA 5AIQA 1K6OA 1HKTA 4Y17A 1OYWA 4M6XA 2ZNYA 3OV8A 4XLNF 3ML6A 2RC4A 1X3UA 1Z91A 5CJ9A 1TW3A 5HLGA 4KN7X 5ERIA 3HSFA 2EK5A 4AIHA 4IJAA 2XAJA 1FSHA 3EETA 3ISPA 1A04A 4KDPA 1B1BA 3RDIA 3GF2A 2L54A 4BHPA 3CUQB 2P4WA 1SFXA 2ETHA 1XDSA 2K4JA 4BQAA 4LK1F 1J0RA 3IHUA 4ZYGA 3REOA 2KIFA 1J59A 2ESHA 4I01A 2HGCA 4N9HA 2CW0F 3QRFF 4DNCA 2FE3A 1R5GA 2VE8A 2HTSA 4HQMA 1XDUA 4IHSA 4M9XA 4HF1A 3IWFA 2ZMEB 1S7AA 3NRVA 2DI3A 1FBUA 2IRFG 3T8TA 2O8XA 2IT0A 2UWMA 1YTYA 2HTJA 1XB4A 4KICA 2EFWA 1TNSA 3TOBA 1GVJA 2R3SA 3WTVC 1MKMA 2NRAC 2RKHA 2EFPA 5FFXA 1EH8A 1R23A 2QBYA 2A07F 4EQQA 4U0VA 4HBLA 1XGSA 2W57A 3I59A 2F5FA 1MZBA 2HYGD 3KCCA 4HOBA 4HV5A 3QPTA 4EMSA 2MLKA 4U0WA 5ICEA 4H0EA 1BI0A 4P9FA 2D1VA 3NEUA 2P6SA 2NAZA 2OAZA 3F21A 2PEXA 2E7XA 1O3SA 2QENA 1KU3A 1LEBA 4M74A 3SFZA 2PN6A 4A6DA 2LDUA 4U7DA 3T0YA 1ON2A 2LF7A 3EYIA 3JAMK 3HHHA 1YS7A 2W24A 3CUQC 2CGPA 3WTUC 4UVCA 1I6XA 3KP3A 1ON1A 4YIIA 2A6EF 2XAQA 1BIAA 1FYLA 1OKRA 3OOPA 3J80K 5FLXK 5D4RA 2IJLA 4RGRA 3CDHA 3RPQA 1WSUA 4WX9A 1ZRDA 3W6KB 1KU7A 1T38A 2FU4A 2YU3A 3VODA 4O3MA 2M8EA 5DDGA 2XASA 1FBSA 4BHBA 2XROA 5BOXA 5HOOA 3LA7A 1RZ4A 4G7OF 4K2EA 2P6TA 1W7PA 1UCRA 3ZMTA 4MTDA 2RV8A 2XAGA 5ICGA 4HX4A 4GYIA 1K7AA 4MEXF 1MJBA 1FP1D 3BP8A 2VOOA 5E8IA 3CTAA 4QWQA 5JR3A 1HBXG 2UXXA 5DCFA 5D8LB 1RUOA 1F5TA 5DV5A 2XIGA 2Z3YA 4LLLA 3RJPA 4PZJA 5DCMA 2DQRA 3H3ZA 3ZP5A 4I7HA 3V4GA 3HOTA 1LNWA 3RKWA 1ZREA 5BQTA 2RDPA 1BI1A 2XKOA 3JSOA 1BOAA 1S7OA 2UXNA 1Q1HA 1LDDA 5E1WA 1CF7A 2EFOA 3RIRA 2DU9A 4F7ZA 1XGNA 1YW8A 5BMZA 4E70A 4KA4A 1FBQA 2FBHA 4EJOA 4G6QA 1H9GA 1U5TC 2QVOA 1ZH5A 5CVVA 3FHZA 1HKQA 3JAMZ 4ZYHA 5CYVA 1UB9A 3C7JA 4RB2C 3WTWC 2CO5A 1KQ8A 2OQRA 2VBZA 2R7DA 3GEZA 3WTTC 2P5VA 5F6FA 1BI2A 5DEQA 4R8HA 1T39A 3RPUA 2P7VB 4GXOA 3LQQA 1ZG1A 3KP7A 5HDGA 1FYMA 3F8FA 5ICCA 3E6DA 1U6GA 3IRQA 5F1RA 1B9NA 2VN2A 4I98B 3E6MA 1I1SA 3D0SA 2VBXA 3IRRA 1YW9A 4ENKA 1D5VA 3GFMA 2G9WA 5HS8A 1QPMA 1W7PD 5E18F 2A6HF 3EQLF 2VBWA 2F5DA 2HKXA 2QBYB 4AIJA 2IW5A 3GFJA 4XSXF 1E2XA 1XMKA 3I59B 3I53A 1B4AA 2ADUA 2VE9A 5L3FA 2XAHA 1HQCA 1DPRA 4M72A 3VB2A 2BE5F 3WU0A 3HHGA 2XGXA 4EV0A 2JZYA 2L02A 4ETSA 2IA0A 5LGNA 4WXDA 4FT8A 2WTEA 3IKTA 2E1CA 3V7SA 2DPUA 3G73A 1IZ1A 3H3UA 1PP7U 4IRGA 2G7HA 1KGSA 3FXQA 2FSWA 3MWMA 2BV6A 4NHJA 4KMFA 1SMYF 4JQFA 2WV0A 1U8RA 4Z2YA 3BROA 4ENJA 2P5LC 1S6LA 3BJOA 4KMUX 4LK0F 1XCBA 2JSCA 2XKPA 1Z7UA 4L0YB 4GYGA 1R22A 2ZKZA 2A61A 2HEOA 5E1XA 1FC3A 2BYVE 3GWZA 1IN5A 3WG9A 1ZLJA 2H27A 4OINF 3ULQB 3QP6A 3JTGA 4S04A 1KU2A 2J5PA 4LMYA 1YW7A 1DP7P 3L7WA 1YG2A 2FNPA 3I0TA 2V79A 2KIUA 3MZYA 2PMUA 5FFZA 4N9IA 3FF5A 1SD4A 4UNOA 4ENNA 2EV5A 1EH6A 2Y0MA 1XGOA 2V6CA 4MQVA 3WE3A 3P9CA 1BBYA 4EM0B 1E17A 5ED4A 3P9KA 4P5OA 1TBXA 1XSXA 1VTNC 4EGYA 2Z33A 3D5LA 2FNAA 1O3TA 5CLSA 3E6BA 3VOEA 3HTSB 2DPDA 3R0AA 2FQ3A 3MEXA 4KT5C 1YFHA 3HYIA 3KLOA 3B73A 1FPQA 2V9VA 2P7CB 3WTXC 4U7BA 3KETA 2DK5A 4Q48A 2EFNA 4I0BA 3V8JA 5E17F 5DCMB 4KFCA 3PQKA 2A68F 2MA3A 3LQRA 2YX4A 1UHWA 2MH2A 4GCVA 2FOKA 2EA4A 3QPHA 1S3JA 3BPXA 1QGPA 3BJ6A 3HSEA 3GFLA 2K27A 5L3EA 5HLHA 4ENMA 3WGIA 3GX4X 3LA3A 1PUEE 2V1UA 1GXQA 4UVBA 5E1ZB 3U1DA 1DDNA 1RNLA 1XN7A 3F6OA 1R58A 1IRGA 3HUGA 4Y15A 5LEKA 4I09A 2P5KA 1HW2A 3ZMVA 4KNYA 2MD5A 3E6CC 4BYYA 5E8GA 4D0PA 5K5QA 2HKOA 2M87A 2CG4A 2DO7A 2MH9A 4DQ2A 2EV0A 5ILVA 5H6QA 2HZTA 4CGZA 2ISYA 3R61A 2GXGA 3KP2A 3F23A 3KP6A 2CSOA 1KYZA 1P6RA 4YIFA 1QNTA 1AOYA 3KLNA 1Z05A 1FSEA 4OMYA 1SD6A 2JTVA 1T0FA 2IA2A 3FM3A 4L9JA 1IXRC 1SD7A 4HQEA 2K02A 4A0ZA 3TO9A 3HSRA 1R1UA 4RGSA 4PGGA 5DD4A 1REPC 3ELKA 2Q2EA 4P55A 5DUKA 4MQ9F 1USSA 4I2OA 2VONA 5K5RA 4G9YA 4HDVA 2PQ8A 1OPCA 4Q47A 3DXJF 3WU1B 3N97A 1J75A 2LSOA 4HA8A 1FOKA 2D1HA 5FB2A 2B0LA 3N4MA 3O2PE 4WCGA 2VXZA 5HDKA 1P4AA 1ONVA 4EJUA 4ESJA 1YYVA 4L9TA 3ZMUA 3RKXA 3K9TA 3I5UA 4KIGA 3U2RA 1QBJA 4L5JA 1IN4A 1LDJA 4A5NA 3M1EA 4L9NA 3ZQ7A 3F6VA 4G94A 2RN7A 4ZZLA 2JPCA 2BGCA 3F8MA 3L2CA 2M30A 3QU6A 2ZJ2A 4HZFA 3RI4A 5LGTA 5E20A 2FBKA 3V7RA 3W6JB 3IWZA 3MQ0A 3PQJA 3HRMA 5J8CA 4L5IA 1TQPA 3K69A 3ABUA 3DKWA 1IAWA 1OYIA 4LD5A 4UVAA 4ZH4F 4NB5A 1SFEA 3FMSA 4PGHA 3ECHA 3GXOA 3JW4A 1UFMA 5DD8A 3SHFA 4HAMA 4MHGA 2ISZA 1ZRFA 2XAFA 4LG0A 3M8FA 1BJAA 4RS8A 2ACJA 3P7NA 3VFZA 3L9FA 3BZ6A 1R1TA 2XVCA 1SD5A 1KYWA 4IRHA 2YR2A 5LLQA 1G6NA 2G7UA 3KP4A 1QZYA 1YLFA 4CHUA 2QZ8A 4HX8A 2L4MA 4L9VA 2FEZA 1MD0A 1SAXA 1G3YA 1IF1A 5KVRA 2K4BA 3WE2A 5EEHA 4XSZF 3PFIA 1Z6TA 2ZFWA 2EV6A 4AWXB 5EEGA 3KFWX 4MGRA 5LHGA 4IPAA 4PDKA 3TDUC 2IVMA 3K0LA 4M73A 2LNBA 4O6JA 4R79A 4XRFA 2V1DA 1WI9A 4IRIA 2J5OA 4WWCA 1YIOA 3H92A 3T8RA 3ZN1A 2NNNA 2O6GE 2PI0A 2PG4A 4M9SA 1J5YA 3DFGA 3J80Z 1J2XA 1QZZA 3E5UA 3S2WA 5FLXZ 3RYPA 1G3WA 4EJTA 4HYEA 2P8TA 3P9IA 3BOQA 1STZA 3HRSA 2KJBA 4HW0A 4WF2A 1SFUA 3R6SA 1ZARA 2GWRA 3SZTA 5FO5A 2O03A 3GO5A 1ZHFA 3K1PA 3ECOA 3DPLC 3MAJA 2JT1A 4CDGA 1D8KA 4RB1A 2GAUA 2OA4A 5K1YA 3V7CA 1K78A 2OQGA 4NQWA 1ZG3A 5LRSA 4BH9A 2M1BA 5H6RA 2EWNA 4L18B 3J81K 4IVNA 3TQNA 1TLHB 1XD7A 2X4HA 3MZHA 3RKYA 1MDMA 3C1DA 1BI3A 4EJVA 4ON0A 5TRDA 1WRJA 5ICFA 4CO8A 3T5XA 5K5OA 3EYYA 3K1NA 1TNTA 4A6EA 2RNJA 3C18A 4HLYA 2HQNA 4GGGA 2KIMA 4MNUA 2GQQA 5AIPA 1W5SA 2Q8KA 2W85A 2IPQX 4KIBA 1LQ1A 5ILUA 5HS7A 3G3ZA 2VBYA 3CLOA 4RAYA 3DPTA 2BEOA 4OU0A 1TTYA 1UHMA 3MCZA 6PAXA 3ZPLA 1J9IA 1LJ9A 1QQIA 4CICA 2H94A 1PP8F 1L3LA 1EH7A 4BXUA 1F4KA 2OBPA 1H0MA 3V8LA 2QM3A 2L4AA 2Z99A 1CGPA 3EDPA 2DW4A 4RAZA 2AXLA 3IL2A 2BBYA 3KEQA 2AS5F 4EM2A 1P92A 5JVTA 1U5TA 5CVIA 2FA5A 1R36A 1WKMA 1KQ0A 3ZN0A 3KZYA 1G3SA 4BNCA 2PMHA 5HS9A 2GZWA 2XUBA 5IT3A 1O3RA 5LBQA 1P4WA 1RI7A 1WQ2A 1IN8A 1O7LA 1BN5A 2HS5A 3IKVA 2PLYA 5CVJA 3F72A 3I64A 1RIOH 5IT9K 1V4RA 3KE2A 2ELHA 2ZNZA 3F8CA 1LVAA 4LG0B 2KRFA 2PFBA 4YG2F 3R60A 1FZPB 5FD6A 1SMTA 5L3GA 3GZ6A 3TKYA 5F64A 1P2FA 2HOEA 4EM1A 1U2WA 4A2UA 2RVCA 1I27A 2DFIA 5D8KB 3FWEA 2H6BA 4M6YA 2W84A 4JK1X 2FMYA 4M9ZA 2HR3A 3HIFA 3TO7A 4ESBA 3K1MA 4P9UA 2JRTA 2HQRA 2QWWA 3J81Z 2HYFA 1HXDA 1QO0D 3WGGA 3ABTA 1XSDA 2FXAA 4A0YA 1XMAA 1EV7A 5D6EA 2O61A 3I54A 3BPVA 1Z1DA 2JPBA 4WK8F 4S05A 4FX0A 1I1GA 2DLLA 3FM5A 3DV8A 3M8EA 3WTSC 1XCVA 1IN7A 2CWEA 3HRUA 4OIRF 3DEUA 1O3QA 2XRNA 4LLNA 4G6DA 2D2WA 4U0YA 4KN4X 3LAPA 2PJPA 4P96A 1B9MA 2KJCA 1R5HA 1HW5A 1R1VA 3CO7C 2FRHA 3B02A 4ZYDA 5D5WB 3TO6A 2NYXA 1JGSA 2NS0A 2OU2A 1W5TA 2CQKA 1HSJA 4QLCU 1RUNA 3C3WA 3BY6A 1MJ9A 2DAOA 1JE8A 1IRFA 1YS6A 2L3DA 1B6AA 2K7LA 4FX4A 4M71A 2OZ6A 5FD5A 3K2ZA 1S29A 3QAHA 1G3TA 2F5EA 3NQOA 3RYRA 1U3EM 5HDNA 3GLXA 4A5MA 1K78B 3M7GA 4OMZA 4AIKA 4ZYEA 5LEJA 3E5QA 1MDMB 3O6BB 4AD9A 2STWA 1NHAA 2LKPA 4UHTA 2ZCWA 2OZUA 5IT9Z 1OYYA 2IA1A 3FXUA 4LB6B 2VOPA 1V3FA 4XLPF 4OIOF 1HKSA 2VC0A 2Q0OA 4HF0A 1YQAA 5LRRA 3HTUA 1IXCA 3J7AO 3ERED 4YFNF 4LLGF 3DF8A 3MFKA 5CVUA 1OMIA 4HX7A 4G7HF 2QLZA 2DTRA 4PCQA 4UV9A 1JXSA 3Q5FA 4CYDA 1Z9CA 2A69F 1BC7C 2VC1A 3TOAA 5L3BA 2WWYA 1FX7A 5D5XB 1HSTA 2QYOA 1LEAA 4ZZDA 2X0LA 3F22A 1R7JA 5ILSA 5FGMA 3KEOA 4Y13A 2DT5A 2IP2A 3TGNA 1KA8A 2MC3A 2RGVA 3F8NA 2KKOA 4CXFA 4UXNA 2DK8A 4G7ZF 3GYHX 4O5VA 3AAFA 5J8FA 4TV7A 2VODA 2GIVA 2DQLA 3QOPA 1W4MA 1U5TB 5J6XA 5BPIA 3BDDA 3RTRA 2QQBA 3GW2A 4UUVA 4RB0A 3ZMDA 2WC2A 3HRTA 5LHIA 2COMA 4YFKF 1IN6A 3O3KA 4I02A 1T98A 3E5XA 2Y48A 1ZLKA 1G4DA 2V1XA 3JTHA 3GFIA 1ZGJA 5D4SA 3R0JA 2K86A 5D5VB 3I58A 4MTEA 4EGZA 4GO1A 1TW2A 1U78A 4A0XA 4RGXA 2GA1A 3M9AA 5BS6A 3QP5A 1WWXA 2HFHA 2ZBKA 2XV4S 2HWVA 3SXYA 4KUMA 1IW7F 2R7FA 1TQMA 2UZKA 2H6CA 2VT3A 4U88A 3SQNA 2O3FA 5JFRA 5HLIA 2FMLA 4UV8A 3CJNA 4HF2A 1K79A 2C6YA 1FYKA 1T2KA 5A2QK 4Q5SF 3LA2A 2D45A 5TJJA 3Q9VA 5DUIA 4HDUA 1D3YA 4KYWA 1F1ZA 4OOIA 3TDZC 5D6FA 1PDNC 5BPDA 3R4KA 2EA2A 3WODF 3I71A 2QQ9A 4I0AA 3FMQA 4LB5A 3BWGA 4LGWA 3F8BA 5JI6A 3QU3A 3VEPA 2MLGA 3GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9T A;  1LB2 A;  3ZMZ A;  2GXB A;  1J7K A;  1C0W A;  3GUD A;  1ZGA A;  3SZP A;  4XBF A;  3L09 A;  2RQP A;  2A5Y B;  5LHH A;  3CUQ A;  1UST A;  3FMR A;  3I4P A;  2YSR A;  1ZAO A;  4BAY A;  2O0Y A;  4N0B A;  4KIF A;  1MGT A;  1XGM A;  2TDX A;  2A3S A;  4WXH A;  4IHT A;  4YFX F;  1GXP A;  2ZXJ A;  1I5Z A;  1F9N A;  3V8K A;  1FT9 A;  4OIQ F;  2FBI A;  1BC8 C;  3E97 A;  1MJA A;  2ZME A;  1ULY A;  4LJZ F;  2YX7 A;  1P4X A;  1Y0U A;  2ESN A;  2QUF A;  3LFK A;  2HDC A;  1FY7 A;  5JHU A;  3FX3 A;  3JSP A;  4L0Z B;  4FHT A;  1ODD A;  2EB7 A;  2E7W A;  2M5W A;  2PBI A;  3LAJ A;  1ZYR F;  4BHC A;  1Z6R A;  5KK1 A;  2F5C A;  3FZV A;  2NNY A;  2OD5 A;  2EJR A;  3LWF A;  4Q4Z F;  2MBF A;  3EUH A;  1GHC A;  2CFX A;  2CYY A;  2XHK A;  3COA C;  3WGH A;  1ZG5 A;  1FP2 A;  1ZN2 A;  2M45 A;  4B09 A;  1S8N A;  1HW1 A;  4B8X A;  3Q9S A;  3FXR A;  3KZZ A;  1IUY A;  2ZO4 A;  2F2E A;  5A2Q Z;  4RGU A;  5L3C A;  4EJW A;  1ZRC A;  3L00 A;  1DPU A;  4ESF A;  1O57 A;  5L3D A;  4RB3 C;  3ZMS A;  2L01 A;  3DP7 A;  3HOS A;  2W25 A;  3U9G A;  1T6S A;  1D8J A;  3CO6 C;  4A12 A;  3E3V A;  4JBA A;  2Y75 A;  4IF4 A;  4LFU A;  2QQA A;  3IC7 A;  1JHF A;  5D5U B;  2YPR A;  1DUX C;  1L0O C;  3GVA A;  3DQV C;  5AON A;  4IXA A;  1TQI A;  3T1B A;  1R00 A;  1FLI A;  2H09 A;  5CVR A;  1OR7 A;  1W7P B;  1YO5 C;  1BIB A;  4HLX A;  1KQ9 A;  4OIP F;  3CUO A;  2VT2 A;  1FWZ A;  4ASN A;  3F3X A;  4CZZ A;  4R1H A;  3LST A;  1XSV A;  4WXC A;  3WTZ A;  5LGU A;  4MEY F;  2FF4 A;  2GA2 A;  4AVP A;  3ROU A;  5H20 A;  5HVQ C;  2LF8 A;  2Z9O A;  3WTY C;  1BM9 A;  4EVI A;  5DYM A;  3KP5 A;  2STT A;  1IXS B;  2EFQ A;  3BJA A;  1LDK B;  4G8X A;  1KU9 A;  4HV6 A;  2E1N A;  1FNN A;  1O7F A;  1B59 A;  1AWC A;  2DBB A;  2Z5U A;  1CF7 B;  1JHH A;  5AIQ A;  1K6O A;  1HKT A;  4Y17 A;  1OYW A;  4M6X A;  2ZNY A;  3OV8 A;  4XLN F;  3ML6 A;  2RC4 A;  1X3U A;  1Z91 A;  5CJ9 A;  1TW3 A;  5HLG A;  4KN7 X;  5ERI A;  3HSF A;  2EK5 A;  4AIH A;  4IJA A;  2XAJ A;  1FSH A;  3EET A;  3ISP A;  1A04 A;  4KDP A;  1B1B A;  3RDI A;  3GF2 A;  2L54 A;  4BHP A;  3CUQ B;  2P4W A;  1SFX A;  2ETH A;  1XDS A;  2K4J A;  4BQA A;  4LK1 F;  1J0R A;  3IHU A;  4ZYG A;  3REO A;  2KIF A;  1J59 A;  2ESH A;  4I01 A;  2HGC A;  4N9H A;  2CW0 F;  3QRF F;  4DNC A;  2FE3 A;  1R5G A;  2VE8 A;  2HTS A;  4HQM A;  1XDU A;  4IHS A;  4M9X A;  4HF1 A;  3IWF A;  2ZME B;  1S7A A;  3NRV A;  2DI3 A;  1FBU A;  2IRF G;  3T8T A;  2O8X A;  2IT0 A;  2UWM A;  1YTY A;  2HTJ A;  1XB4 A;  4KIC A;  2EFW A;  1TNS A;  3TOB A;  1GVJ A;  2R3S A;  3WTV C;  1MKM A;  2NRA C;  2RKH A;  2EFP A;  5FFX A;  1EH8 A;  1R23 A;  2QBY A;  2A07 F;  4EQQ A;  4U0V A;  4HBL A;  1XGS A;  2W57 A;  3I59 A;  2F5F A;  1MZB A;  2HYG D;  3KCC A;  4HOB A;  4HV5 A;  3QPT A;  4EMS A;  2MLK A;  4U0W A;  5ICE A;  4H0E A;  1BI0 A;  4P9F A;  2D1V A;  3NEU A;  2P6S A;  2NAZ A;  2OAZ A;  3F21 A;  2PEX A;  2E7X A;  1O3S A;  2QEN A;  1KU3 A;  1LEB A;  4M74 A;  3SFZ A;  2PN6 A;  4A6D A;  2LDU A;  4U7D A;  3T0Y A;  1ON2 A;  2LF7 A;  3EYI A;  3JAM K;  3HHH A;  1YS7 A;  2W24 A;  3CUQ C;  2CGP A;  3WTU C;  4UVC A;  1I6X A;  3KP3 A;  1ON1 A;  4YII A;  2A6E F;  2XAQ A;  1BIA A;  1FYL A;  1OKR A;  3OOP A;  3J80 K;  5FLX K;  5D4R A;  2IJL A;  4RGR A;  3CDH A;  3RPQ A;  1WSU A;  4WX9 A;  1ZRD A;  3W6K B;  1KU7 A;  1T38 A;  2FU4 A;  2YU3 A;  3VOD A;  4O3M A;  2M8E A;  5DDG A;  2XAS A;  1FBS A;  4BHB A;  2XRO A;  5BOX A;  5HOO A;  3LA7 A;  1RZ4 A;  4G7O F;  4K2E A;  2P6T A;  1W7P A;  1UCR A;  3ZMT A;  4MTD A;  2RV8 A;  2XAG A;  5ICG A;  4HX4 A;  4GYI A;  1K7A A;  4MEX F;  1MJB A;  1FP1 D;  3BP8 A;  2VOO A;  5E8I A;  3CTA A;  4QWQ A;  5JR3 A;  1HBX G;  2UXX A;  5DCF A;  5D8L B;  1RUO A;  1F5T A;  5DV5 A;  2XIG A;  2Z3Y A;  4LLL A;  3RJP A;  4PZJ A;  5DCM A;  2DQR A;  3H3Z A;  3ZP5 A;  4I7H A;  3V4G A;  3HOT A;  1LNW A;  3RKW A;  1ZRE A;  5BQT A;  2RDP A;  1BI1 A;  2XKO A;  3JSO A;  1BOA A;  1S7O A;  2UXN A;  1Q1H A;  1LDD A;  5E1W A;  1CF7 A;  2EFO A;  3RIR A;  2DU9 A;  4F7Z A;  1XGN A;  1YW8 A;  5BMZ A;  4E70 A;  4KA4 A;  1FBQ A;  2FBH A;  4EJO A;  4G6Q A;  1H9G A;  1U5T C;  2QVO A;  1ZH5 A;  5CVV A;  3FHZ A;  1HKQ A;  3JAM Z;  4ZYH A;  5CYV A;  1UB9 A;  3C7J A;  4RB2 C;  3WTW C;  2CO5 A;  1KQ8 A;  2OQR A;  2VBZ A;  2R7D A;  3GEZ A;  3WTT C;  2P5V A;  5F6F A;  1BI2 A;  5DEQ A;  4R8H A;  1T39 A;  3RPU A;  2P7V B;  4GXO A;  3LQQ A;  1ZG1 A;  3KP7 A;  5HDG A;  1FYM A;  3F8F A;  5ICC A;  3E6D A;  1U6G A;  3IRQ A;  5F1R A;  1B9N A;  2VN2 A;  4I98 B;  3E6M A;  1I1S A;  3D0S A;  2VBX A;  3IRR A;  1YW9 A;  4ENK A;  1D5V A;  3GFM A;  2G9W A;  5HS8 A;  1QPM A;  1W7P D;  5E18 F;  2A6H F;  3EQL F;  2VBW A;  2F5D A;  2HKX A;  2QBY B;  4AIJ A;  2IW5 A;  3GFJ A;  4XSX F;  1E2X A;  1XMK A;  3I59 B;  3I53 A;  1B4A A;  2ADU A;  2VE9 A;  5L3F A;  2XAH A;  1HQC A;  1DPR A;  4M72 A;  3VB2 A;  2BE5 F;  3WU0 A;  3HHG A;  2XGX A;  4EV0 A;  2JZY A;  2L02 A;  4ETS A;  2IA0 A;  5LGN A;  4WXD A;  4FT8 A;  2WTE A;  3IKT A;  2E1C A;  3V7S A;  2DPU A;  3G73 A;  1IZ1 A;  3H3U A;  1PP7 U;  4IRG A;  2G7H A;  1KGS A;  3FXQ A;  2FSW A;  3MWM A;  2BV6 A;  4NHJ A;  4KMF A;  1SMY F;  4JQF A;  2WV0 A;  1U8R A;  4Z2Y A;  3BRO A;  4ENJ A;  2P5L C;  1S6L A;  3BJO A;  4KMU X;  4LK0 F;  1XCB A;  2JSC A;  2XKP A;  1Z7U A;  4L0Y B;  4GYG A;  1R22 A;  2ZKZ A;  2A61 A;  2HEO A;  5E1X A;  1FC3 A;  2BYV E;  3GWZ A;  1IN5 A;  3WG9 A;  1ZLJ A;  2H27 A;  4OIN F;  3ULQ B;  3QP6 A;  3JTG A;  4S04 A;  1KU2 A;  2J5P A;  4LMY A;  1YW7 A;  1DP7 P;  3L7W A;  1YG2 A;  2FNP A;  3I0T A;  2V79 A;  2KIU A;  3MZY A;  2PMU A;  5FFZ A;  4N9I A;  3FF5 A;  1SD4 A;  4UNO A;  4ENN A;  2EV5 A;  1EH6 A;  2Y0M A;  1XGO A;  2V6C A;  4MQV A;  3WE3 A;  3P9C A;  1BBY A;  4EM0 B;  1E17 A;  5ED4 A;  3P9K A;  4P5O A;  1TBX A;  1XSX A;  1VTN C;  4EGY A;  2Z33 A;  3D5L A;  2FNA A;  1O3T A;  5CLS A;  3E6B A;  3VOE A;  3HTS B;  2DPD A;  3R0A A;  2FQ3 A;  3MEX A;  4KT5 C;  1YFH A;  3HYI A;  3KLO A;  3B73 A;  1FPQ A;  2V9V A;  2P7C B;  3WTX C;  4U7B A;  3KET A;  2DK5 A;  4Q48 A;  2EFN A;  4I0B A;  3V8J A;  5E17 F;  5DCM B;  4KFC A;  3PQK A;  2A68 F;  2MA3 A;  3LQR A;  2YX4 A;  1UHW A;  2MH2 A;  4GCV A;  2FOK A;  2EA4 A;  3QPH A;  1S3J A;  3BPX A;  1QGP A;  3BJ6 A;  3HSE A;  3GFL A;  2K27 A;  5L3E A;  5HLH A;  4ENM A;  3WGI A;  3GX4 X;  3LA3 A;  1PUE E;  2V1U A;  1GXQ A;  4UVB A;  5E1Z B;  3U1D A;  1DDN A;  1RNL A;  1XN7 A;  3F6O A;  1R58 A;  1IRG A;  3HUG A;  4Y15 A;  5LEK A;  4I09 A;  2P5K A;  1HW2 A;  3ZMV A;  4KNY A;  2MD5 A;  3E6C C;  4BYY A;  5E8G A;  4D0P A;  5K5Q A;  2HKO A;  2M87 A;  2CG4 A;  2DO7 A;  2MH9 A;  4DQ2 A;  2EV0 A;  5ILV A;  5H6Q A;  2HZT A;  4CGZ A;  2ISY A;  3R61 A;  2GXG A;  3KP2 A;  3F23 A;  3KP6 A;  2CSO A;  1KYZ A;  1P6R A;  4YIF A;  1QNT A;  1AOY A;  3KLN A;  1Z05 A;  1FSE A;  4OMY A;  1SD6 A;  2JTV A;  1T0F A;  2IA2 A;  3FM3 A;  4L9J A;  1IXR C;  1SD7 A;  4HQE A;  2K02 A;  4A0Z A;  3TO9 A;  3HSR A;  1R1U A;  4RGS A;  4PGG A;  5DD4 A;  1REP C;  3ELK A;  2Q2E A;  4P55 A;  5DUK A;  4MQ9 F;  1USS A;  4I2O A;  2VON A;  5K5R A;  4G9Y A;  4HDV A;  2PQ8 A;  1OPC A;  4Q47 A;  3DXJ F;  3WU1 B;  3N97 A;  1J75 A;  2LSO A;  4HA8 A;  1FOK A;  2D1H A;  5FB2 A;  2B0L A;  3N4M A;  3O2P E;  4WCG A;  2VXZ A;  5HDK A;  1P4A A;  1ONV A;  4EJU A;  4ESJ A;  1YYV A;  4L9T A;  3ZMU A;  3RKX A;  3K9T A;  3I5U A;  4KIG A;  3U2R A;  1QBJ A;  4L5J A;  1IN4 A;  1LDJ A;  4A5N A;  3M1E A;  4L9N A;  3ZQ7 A;  3F6V A;  4G94 A;  2RN7 A;  4ZZL A;  2JPC A;  2BGC A;  3F8M A;  3L2C A;  2M30 A;  3QU6 A;  2ZJ2 A;  4HZF A;  3RI4 A;  5LGT A;  5E20 A;  2FBK A;  3V7R A;  3W6J B;  3IWZ A;  3MQ0 A;  3PQJ A;  3HRM A;  5J8C A;  4L5I A;  1TQP A;  3K69 A;  3ABU A;  3DKW A;  1IAW A;  1OYI A;  4LD5 A;  4UVA A;  4ZH4 F;  4NB5 A;  1SFE A;  3FMS A;  4PGH A;  3ECH A;  3GXO A;  3JW4 A;  1UFM A;  5DD8 A;  3SHF A;  4HAM A;  4MHG A;  2ISZ A;  1ZRF A;  2XAF A;  4LG0 A;  3M8F A;  1BJA A;  4RS8 A;  2ACJ A;  3P7N A;  3VFZ A;  3L9F A;  3BZ6 A;  1R1T A;  2XVC A;  1SD5 A;  1KYW A;  4IRH A;  2YR2 A;  5LLQ A;  1G6N A;  2G7U A;  3KP4 A;  1QZY A;  1YLF A;  4CHU A;  2QZ8 A;  4HX8 A;  2L4M A;  4L9V A;  2FEZ A;  1MD0 A;  1SAX A;  1G3Y A;  1IF1 A;  5KVR A;  2K4B A;  3WE2 A;  5EEH A;  4XSZ F;  3PFI A;  1Z6T A;  2ZFW A;  2EV6 A;  4AWX B;  5EEG A;  3KFW X;  4MGR A;  5LHG A;  4IPA A;  4PDK A;  3TDU C;  2IVM A;  3K0L A;  4M73 A;  2LNB A;  4O6J A;  4R79 A;  4XRF A;  2V1D A;  1WI9 A;  4IRI A;  2J5O A;  4WWC A;  1YIO A;  3H92 A;  3T8R A;  3ZN1 A;  2NNN A;  2O6G E;  2PI0 A;  2PG4 A;  4M9S A;  1J5Y A;  3DFG A;  3J80 Z;  1J2X A;  1QZZ A;  3E5U A;  3S2W A;  5FLX Z;  3RYP A;  1G3W A;  4EJT A;  4HYE A;  2P8T A;  3P9I A;  3BOQ A;  1STZ A;  3HRS A;  2KJB A;  4HW0 A;  4WF2 A;  1SFU A;  3R6S A;  1ZAR A;  2GWR A;  3SZT A;  5FO5 A;  2O03 A;  3GO5 A;  1ZHF A;  3K1P A;  3ECO A;  3DPL C;  3MAJ A;  2JT1 A;  4CDG A;  1D8K A;  4RB1 A;  2GAU A;  2OA4 A;  5K1Y A;  3V7C A;  1K78 A;  2OQG A;  4NQW A;  1ZG3 A;  5LRS A;  4BH9 A;  2M1B A;  5H6R A;  2EWN A;  4L18 B;  3J81 K;  4IVN A;  3TQN A;  1TLH B;  1XD7 A;  2X4H A;  3MZH A;  3RKY A;  1MDM A;  3C1D A;  1BI3 A;  4EJV A;  4ON0 A;  5TRD A;  1WRJ A;  5ICF A;  4CO8 A;  3T5X A;  5K5O A;  3EYY A;  3K1N A;  1TNT A;  4A6E A;  2RNJ A;  3C18 A;  4HLY A;  2HQN A;  4GGG A;  2KIM A;  4MNU A;  2GQQ A;  5AIP A;  1W5S A;  2Q8K A;  2W85 A;  2IPQ X;  4KIB A;  1LQ1 A;  5ILU A;  5HS7 A;  3G3Z A;  2VBY A;  3CLO A;  4RAY A;  3DPT A;  2BEO A;  4OU0 A;  1TTY A;  1UHM A;  3MCZ A;  6PAX A;  3ZPL A;  1J9I A;  1LJ9 A;  1QQI A;  4CIC A;  2H94 A;  1PP8 F;  1L3L A;  1EH7 A;  4BXU A;  1F4K A;  2OBP A;  1H0M A;  3V8L A;  2QM3 A;  2L4A A;  2Z99 A;  1CGP A;  3EDP A;  2DW4 A;  4RAZ A;  2AXL A;  3IL2 A;  2BBY A;  3KEQ A;  2AS5 F;  4EM2 A;  1P92 A;  5JVT A;  1U5T A;  5CVI A;  2FA5 A;  1R36 A;  1WKM A;  1KQ0 A;  3ZN0 A;  3KZY A;  1G3S A;  4BNC A;  2PMH A;  5HS9 A;  2GZW A;  2XUB A;  5IT3 A;  1O3R A;  5LBQ A;  1P4W A;  1RI7 A;  1WQ2 A;  1IN8 A;  1O7L A;  1BN5 A;  2HS5 A;  3IKV A;  2PLY A;  5CVJ A;  3F72 A;  3I64 A;  1RIO H;  5IT9 K;  1V4R A;  3KE2 A;  2ELH A;  2ZNZ A;  3F8C A;  1LVA A;  4LG0 B;  2KRF A;  2PFB A;  4YG2 F;  3R60 A;  1FZP B;  5FD6 A;  1SMT A;  5L3G A;  3GZ6 A;  3TKY A;  5F64 A;  1P2F A;  2HOE A;  4EM1 A;  1U2W A;  4A2U A;  2RVC A;  1I27 A;  2DFI A;  5D8K B;  3FWE A;  2H6B A;  4M6Y A;  2W84 A;  4JK1 X;  2FMY A;  4M9Z A;  2HR3 A;  3HIF A;  3TO7 A;  4ESB A;  3K1M A;  4P9U A;  2JRT A;  2HQR A;  2QWW A;  3J81 Z;  2HYF A;  1HXD A;  1QO0 D;  3WGG A;  3ABT A;  1XSD A;  2FXA A;  4A0Y A;  1XMA A;  1EV7 A;  5D6E A;  2O61 A;  3I54 A;  3BPV A;  1Z1D A;  2JPB A;  4WK8 F;  4S05 A;  4FX0 A;  1I1G A;  2DLL A;  3FM5 A;  3DV8 A;  3M8E A;  3WTS C;  1XCV A;  1IN7 A;  2CWE A;  3HRU A;  4OIR F;  3DEU A;  1O3Q A;  2XRN A;  4LLN A;  4G6D A;  2D2W A;  4U0Y A;  4KN4 X;  3LAP A;  2PJP A;  4P96 A;  1B9M A;  2KJC A;  1R5H A;  1HW5 A;  1R1V A;  3CO7 C;  2FRH A;  3B02 A;  4ZYD A;  5D5W B;  3TO6 A;  2NYX A;  1JGS A;  2NS0 A;  2OU2 A;  1W5T A;  2CQK A;  1HSJ A;  4QLC U;  1RUN A;  3C3W A;  3BY6 A;  1MJ9 A;  2DAO A;  1JE8 A;  1IRF A;  1YS6 A;  2L3D A;  1B6A A;  2K7L A;  4FX4 A;  4M71 A;  2OZ6 A;  5FD5 A;  3K2Z A;  1S29 A;  3QAH A;  1G3T A;  2F5E A;  3NQO A;  3RYR A;  1U3E M;  5HDN A;  3GLX A;  4A5M A;  1K78 B;  3M7G A;  4OMZ A;  4AIK A;  4ZYE A;  5LEJ A;  3E5Q A;  1MDM B;  3O6B B;  4AD9 A;  2STW A;  1NHA A;  2LKP A;  4UHT A;  2ZCW A;  2OZU A;  5IT9 Z;  1OYY A;  2IA1 A;  3FXU A;  4LB6 B;  2VOP A;  1V3F A;  4XLP F;  4OIO F;  1HKS A;  2VC0 A;  2Q0O A;  4HF0 A;  1YQA A;  5LRR A;  3HTU A;  1IXC A;  3J7A O;  3ERE D;  4YFN F;  4LLG F;  3DF8 A;  3MFK A;  5CVU A;  1OMI A;  4HX7 A;  4G7H F;  2QLZ A;  2DTR A;  4PCQ A;  4UV9 A;  1JXS A;  3Q5F A;  4CYD A;  1Z9C A;  2A69 F;  1BC7 C;  2VC1 A;  3TOA A;  5L3B A;  2WWY A;  1FX7 A;  5D5X B;  1HST A;  2QYO A;  1LEA A;  4ZZD A;  2X0L A;  3F22 A;  1R7J A;  5ILS A;  5FGM A;  3KEO A;  4Y13 A;  2DT5 A;  2IP2 A;  3TGN A;  1KA8 A;  2MC3 A;  2RGV A;  3F8N A;  2KKO A;  4CXF A;  4UXN A;  2DK8 A;  4G7Z F;  3GYH X;  4O5V A;  3AAF A;  5J8F A;  4TV7 A;  2VOD A;  2GIV A;  2DQL A;  3QOP A;  1W4M A;  1U5T B;  5J6X A;  5BPI A;  3BDD A;  3RTR A;  2QQB A;  3GW2 A;  4UUV A;  4RB0 A;  3ZMD A;  2WC2 A;  3HRT A;  5LHI A;  2COM A;  4YFK F;  1IN6 A;  3O3K A;  4I02 A;  1T98 A;  3E5X A;  2Y48 A;  1ZLK A;  1G4D A;  2V1X A;  3JTH A;  3GFI A;  1ZGJ A;  5D4S A;  3R0J A;  2K86 A;  5D5V B;  3I58 A;  4MTE A;  4EGZ A;  4GO1 A;  1TW2 A;  1U78 A;  4A0X A;  4RGX A;  2GA1 A;  3M9A A;  5BS6 A;  3QP5 A;  1WWX A;  2HFH A;  2ZBK A;  2XV4 S;  2HWV A;  3SXY A;  4KUM A;  1IW7 F;  2R7F A;  1TQM A;  2UZK A;  2H6C A;  2VT3 A;  4U88 A;  3SQN A;  2O3F A;  5JFR A;  5HLI A;  2FML A;  4UV8 A;  3CJN A;  4HF2 A;  1K79 A;  2C6Y A;  1FYK A;  1T2K A;  5A2Q K;  4Q5S F;  3LA2 A;  2D45 A;  5TJJ A;  3Q9V A;  5DUI A;  4HDU A;  1D3Y A;  4KYW A;  1F1Z A;  4OOI A;  3TDZ C;  5D6F A;  1PDN C;  5BPD A;  3R4K A;  2EA2 A;  3WOD F;  3I71 A;  2QQ9 A;  4I0A A;  3FMQ A;  4LB5 A;  3BWG A;  4LGW A;  3F8B A;  5JI6 A;  3QU3 A;  3VEP A;  2MLG A;  3GZ5 A; 
#chains in the Genus database with same CATH topology
 1H9T A;  3G1M A;  3CCS I;  3ZMZ A;  1LB2 A;  2GXB A;  3S3N A;  5F27 A;  4F52 A;  1J7K A;  1C0W A;  3GUD A;  1LUJ B;  1ZGA A;  3SZP A;  4XBF A;  3L09 A;  3BQZ A;  2RQP A;  3DTK A;  2R7Q A;  1CQT A;  2A5Y B;  3CCY A;  5KAI C;  5LHH A;  3CUQ A;  3G2B A;  4HST A;  1UST A;  3FMR A;  3IH4 A;  3I4P A;  2YSR A;  1ZAO A;  2H8R A;  3HDD A;  4XLH A;  1Q1V A;  2O0Y A;  4N0B A;  4BAY A;  2E1M B;  3PNT A;  4KIF A;  1MGT A;  5E3O A;  1XGM A;  2TDX A;  2A3S A;  4WXH A;  4IHT A;  4YFX F;  3OY9 A;  3K70 C;  1GXP A;  2ZXJ A;  1I5Z A;  3LFU A;  4CCL A;  2GM4 A;  2V1N A;  1TWF J;  5M5X J;  2VJI A;  1F9N A;  4PSX A;  1FT9 A;  4QPQ A;  3V8K A;  3W2V A;  4OIQ F;  2EIN H;  2FBI A;  1BC8 C;  3HKZ A;  3CME I;  3E97 A;  4CCM A;  1OCO H;  1IV8 A;  1MJA A;  5J4V A;  2ZME A;  4J19 A;  1ULY A;  4LJZ F;  2YX7 A;  4DBQ A;  1P4X A;  1Y0U A;  2BVL A;  2ESN A;  2QUF A;  3LFK A;  2NVT J;  2DFH A;  3OYE A;  2CS3 A;  3S1N J;  1K61 A;  2HI3 A;  2HDC A;  5KAF C;  4JOM A;  1FY7 A;  5JHU A;  3FX3 A;  3ABL H;  3JSP A;  3KEY A;  1T8I A;  2B7E A;  3S16 J;  4NC7 A;  4L0Z B;  4FHT A;  1E0E A;  3CCE I;  2JA6 J;  1ODD A;  2DMU A;  4CYC A;  2EB7 A;  3LSK A;  2E7W A;  2M5W A;  1R49 A;  4C3I J;  2PBI A;  3LAJ A;  1ZYR F;  5JLX A;  3VYS B;  4DZP A;  4BHC A;  4IHX A;  1Z6R A;  5KK1 A;  2F5C A;  3FZV A;  3K6G A;  1MBE A;  2NNY A;  2NVQ J;  2OD5 A;  2EJR A;  3AG4 H;  3LWF A;  2MBF A;  3EUH A;  4Q4Z F;  1GHC A;  5M5W J;  4LOC A;  1NH3 A;  4D7N A;  2CFX A;  2V7F A;  4XLC A;  2CYY A;  2ZJR F;  4A3C J;  2XHK A;  5C3E J;  3COA C;  3WGH A;  1ZG5 A;  1FP2 A;  3C2G A;  4FET A;  1ZN2 A;  2M45 A;  2WA0 A;  5KHD A;  2R5Z B;  4B09 A;  1S8N A;  2W1O A;  1HW1 A;  4B8X A;  1OCC H;  2XGE A;  4V2F A;  3Q9S A;  3FXR A;  3KZZ A;  1IUY A;  2RRE A;  2ZO4 A;  3VYR B;  2F2E A;  3CMA I;  5A2Q Z;  4RGU A;  5L3C A;  1MH3 A;  2HPM A;  4EJW A;  2E36 A;  1ZRC A;  2KMU A;  3L00 A;  2HU9 A;  1QZE A;  4ESF A;  1DPU A;  1O57 A;  2NVX J;  2FUG 2;  4X1E A;  5L3D A;  3DLL F;  4RB3 C;  3BG5 A;  1S5L C;  1PUF B;  4D7M A;  3ZMS A;  1HLV A;  3QYE A;  2M4G A;  2L01 A;  2NVY J;  3DP7 A;  5CKT A;  3OYG A;  3HOS A;  5IYD J;  2W25 A;  3U1K A;  3H5N A;  1RKT A;  3U9G A;  2KL4 A;  3Q0V A;  2LD5 A;  1T6S A;  1D8J A;  1BOB A;  3CO6 C;  4A12 A;  3AG1 H;  5FKN A;  1WH5 A;  3E3V A;  4E7Z A;  1TT0 A;  4A69 C;  4RBO A;  4JBA A;  2Y75 A;  2BHZ A;  4IF4 A;  2QQA A;  4LFU A;  4MFE A;  1N78 A;  2JVH A;  1T0F C;  2E1M C;  2X51 A;  2L0K A;  3JRD A;  2Y0S N;  3IC7 A;  1JHF A;  5D5U B;  5F0F A;  1SVM A;  2YPR A;  1E3O C;  2LLK A;  1DUX C;  3W6V A;  1L0O C;  1SVL A;  3BR3 A;  3LSM A;  3QPS A;  3GVA A;  3DQV C;  5AON A;  3CMM A;  1MBJ A;  4BQO A;  2R5Y B;  1Z3Y A;  4IXA A;  4C2T A;  1DP3 A;  4HPQ A;  1TQI A;  1MMN A;  3T1B A;  1UJ8 A;  1B8I B;  5B5E C;  5M3F J;  1R00 A;  1FLI A;  1IV6 A;  3I56 I;  2H09 A;  4J01 A;  3CF2 A;  5CVR A;  1OR7 A;  3TP0 A;  4LIT A;  3HOV J;  1TP4 A;  1HA8 A;  1W7P B;  1YO5 C;  2CQ7 A;  2PMZ N;  1JKQ C;  1BIB A;  4HLX A;  2CRG A;  1KQ9 A;  3DLA A;  4YIR X;  3VSL A;  3ZGK A;  4OIP F;  1RPW A;  3CUO A;  4UY8 I;  2VT2 A;  1FWZ A;  4ASN A;  3B6C A;  2GOM A;  2NOJ B;  3F3X A;  1LPQ A;  4DBR A;  2E60 A;  4CZZ A;  4R1H A;  3LST A;  1XSV A;  4WXC A;  3WTZ A;  5LGU A;  3ERM A;  4JYK A;  4MEY F;  2Y69 H;  2Q1Z B;  2FF4 A;  1VQ5 I;  2R92 J;  2GA2 A;  4AVP A;  1BW5 A;  3ROU A;  5H20 A;  1VQK I;  2NS7 A;  1DQU A;  2X85 A;  5HVQ C;  2LF8 A;  3N05 A;  2E2J J;  2Z9O A;  3WTY C;  2DN0 A;  1BM9 A;  4EVI A;  1WGX A;  5DYM A;  5EJC A;  3KP5 A;  2H1K A;  2STT A;  4CA0 A;  2DMT A;  1IXS B;  3V42 A;  1TZL A;  2EFQ A;  2XB5 A;  1PJR A;  2JK3 A;  1T56 A;  3K4L A;  3BJA A;  1LDK B;  4G8X A;  1KU9 A;  3OYB A;  5J40 A;  3UNG C;  2KDZ A;  4HV6 A;  3WG7 H;  3LSR A;  1S9H A;  2E1N A;  3CJR B;  1FNN A;  4CCN A;  1ZEL A;  1O7F A;  4BGD A;  2R7X A;  1B72 A;  1B59 A;  1AWC A;  2DBB A;  5E3M A;  2Z5U A;  4CH7 A;  1CF7 B;  1JHH A;  3BR6 A;  4XLA A;  1WJ5 A;  5AIQ A;  1K6O A;  2LBF B;  1ENH A;  4A3G J;  1HKT A;  3OS0 A;  4Y17 A;  3S8P A;  5KNL A;  1NK3 P;  3GLL A;  2WAQ N;  1OYW A;  1BR4 A;  2M4K A;  3AKZ A;  4M6X A;  3CZ6 A;  4BL0 B;  2ZNY A;  2ZSI B;  3OV8 A;  1EKE A;  4QIW N;  1MBK A;  3ML6 A;  2VKV A;  4XLN F;  2RC4 A;  3OYN A;  2X6O A;  2F5V A;  1VZ0 A;  3L1P A;  1X3U A;  1Z91 A;  5CJ9 A;  3ZQQ A;  4NBQ A;  2L7Z A;  3OS1 A;  1TW3 A;  1IRZ A;  5HLG A;  3J7Y J;  4KN7 X;  1GLN A;  2K9Q A;  5ERI A;  2EIK H;  4DYQ A;  2E2I J;  4IO9 F;  3HSF A;  2EK5 A;  4AIH A;  3FDY A;  4IJA A;  2XAJ A;  1FSH A;  3VSK A;  3EET A;  4GFB A;  3ISP A;  3IH3 A;  1A04 A;  4KDP A;  1B1B A;  1YJN I;  2CUZ A;  3RDI A;  1ETV A;  2L54 A;  3GF2 A;  4BHP A;  5EEA A;  3CUQ B;  2P4W A;  2CFO A;  1A6Q A;  1SFX A;  1D1C A;  2ETH A;  3CJQ B;  2EZH A;  2TRT A;  1XDS A;  2LRE A;  4PJL A;  2HXO A;  2K4J A;  4XM3 A;  1D1A A;  4NUB A;  4BQA A;  4LK1 F;  1J0R A;  3IHU A;  4XK4 A;  1XTA A;  4XLF A;  4ZYG A;  3MVP A;  3REO A;  5FRM A;  1FIP A;  2KIF A;  5EDN A;  1J59 A;  3OOU A;  3HL2 A;  2ESH A;  4I01 A;  1MIJ A;  2HGC A;  4N9H A;  2CW0 F;  5F04 A;  3RCO A;  2EPF A;  4DNC A;  2FE3 A;  3QRF F;  1R5G A;  2VE8 A;  2DXI A;  2ECC A;  2FQ4 A;  1APL C;  2HTS A;  3IUO A;  4HQM A;  4AVZ A;  1XDU A;  3K4N A;  4IHS A;  4M9X A;  4W97 A;  1QVU A;  4HF1 A;  3IWF A;  1X19 A;  2ZME B;  2WAE A;  2IGM A;  2E19 A;  3GZN B;  1S7A A;  2XPU A;  1X58 A;  3I3L A;  2PJR B;  5C44 J;  3NRV A;  3LNQ A;  2XSJ C;  3HXL A;  2CUJ A;  2DI3 A;  1FBU A;  2IRF G;  3K4B A;  1TWA J;  3T8T A;  2O8X A;  2IT0 A;  2UWM A;  1YTY A;  2HTJ A;  4BE2 A;  2ME6 A;  1X4P A;  2LK2 A;  1XB4 A;  4KIC A;  2YU9 J;  1Y1V J;  2EFW A;  1TNS A;  3TOB A;  2ELJ A;  1GVJ A;  2R3S A;  2M0M A;  3MKY B;  4NNJ A;  5M5Y J;  1BR1 A;  3WTV C;  3OS2 A;  4X0G A;  1MKM A;  4DGW B;  2CJJ A;  2NRA C;  4A3K J;  3ZQF A;  2RKH A;  5EYR A;  2EFP A;  1V5E A;  4ZC3 A;  3S3M A;  5FFX A;  1EH8 A;  1R23 A;  3CQZ J;  4XIC A;  3FKI J;  5M3M J;  3VWB A;  2QBY A;  3GME A;  2A07 F;  4EQQ A;  1E3P A;  3S1R J;  4U0V A;  4A3I J;  4HBL A;  1XGS A;  4F93 B;  2W57 A;  3I59 A;  4PUS A;  2F5F A;  1MZB A;  2HYG D;  3KCC A;  4HOB A;  1GT0 C;  4HV5 A;  2DFE A;  3QPT A;  1MBF A;  1VF9 A;  4EMS A;  3BT9 A;  2MLK A;  4U0W A;  3H36 A;  5ICE A;  4H0E A;  1BI0 A;  1OQY A;  2ZFU A;  4P9F A;  3IAM 2;  1O4X A;  1R71 A;  2D1V A;  3OYA A;  3NEU A;  2P6S A;  1QA6 A;  1FOX A;  3DU6 A;  2NAZ A;  2XF5 A;  2Y30 A;  2IGK A;  2BHY A;  2OAZ A;  2MG4 A;  3F21 A;  2PEX A;  2E7X A;  1O3S A;  2QEN A;  1KU3 A;  5IOZ A;  5C4J J;  1LEB A;  4M74 A;  3SFZ A;  2PN6 A;  4A6D A;  1WJA A;  1FTT A;  3BR1 A;  1K6Y A;  3HB9 A;  2LDU A;  4F91 B;  2IGN A;  1HDP A;  3E0J B;  4U7D A;  2VKE A;  3T0Y A;  1H89 C;  3S15 J;  1ON2 A;  2LF7 A;  3EYI A;  3JAM K;  2HVS A;  2DA7 A;  4M3D A;  4QPO A;  3H1C A;  1JI8 A;  2JJ7 A;  1F36 A;  3HHH A;  1YS7 A;  2W24 A;  2OJE D;  3CUQ C;  2CGP A;  3WTU C;  5FKK A;  4UVC A;  1I6X A;  3I9V 2;  2TCT A;  2L5Q A;  3KP3 A;  4E7H A;  1ON1 A;  3DTE A;  1W5C C;  2X6Y A;  2LVS A;  4YII A;  2IS4 A;  2A6E F;  3OYC A;  2XAQ A;  1BIA A;  1FYL A;  1OKR A;  3OOP A;  3J80 K;  4MIM A;  4E7L A;  3MMY B;  5FLX K;  2FJ1 A;  5D4R A;  2H1L A;  2IJL A;  4IKF A;  3K10 A;  4DYC A;  4RGR A;  2VLA A;  3CDH A;  3RPQ A;  4AYB N;  2DTZ A;  1SAN A;  1WSU A;  4WX9 A;  1ZRD A;  3W6K B;  1KU7 A;  2KRH A;  2XPW A;  1T38 A;  1SVO A;  3H9G A;  3QOE A;  2FU4 A;  2YU3 A;  5GAG J;  4Y4R A;  4BBS J;  4LG3 A;  3VOD A;  4XOR A;  2L7F P;  4O3M A;  3QYF A;  2M8E A;  2VKH A;  2XAS A;  5DDG A;  3S14 J;  1FBS A;  2IBD A;  4BHB A;  2XRO A;  3BZK A;  3LSJ A;  5IPA A;  3JRA A;  3IH2 A;  5BOX A;  5HOO A;  4I76 A;  3DBR B;  3C2H A;  4UB8 C;  3LA7 A;  1RZ4 A;  4G7O F;  4K2E A;  5FKM A;  1WVR A;  3PJR A;  2LH9 A;  2P6T A;  1W7P A;  2XAU A;  1UCR A;  3UKG A;  3ZMT A;  1WPK A;  5GPA A;  1ZKG A;  2RV8 A;  4MTD A;  2XAG A;  4IX7 A;  5ICG A;  4HX4 A;  3GZ5 A;  5FKL A;  4GYI A;  4BDY A;  1K7A A;  2NVU B;  4MEX F;  1MJB A;  1FP1 D;  2LG4 A;  4B48 A;  4RM2 A;  4D9J A;  3EUH C;  5JLW A;  2XF6 A;  3FIW A;  3BP8 A;  2VOO A;  5E8I A;  3PNY A;  4FE4 A;  3CTA A;  3ZRG A;  2AQF A;  4QWQ A;  5JR3 A;  2HOT A;  1Z7L A;  2R7U A;  2K5C A;  2O8K A;  1HBX G;  2CUE A;  1Y39 A;  3G6E I;  3OIO A;  2UXX A;  2O7O A;  5DCF A;  1SFO J;  5D8L B;  1RUO A;  1JUM A;  4RLF A;  4BXX J;  4PJN A;  1U9N A;  2MGQ A;  2Z1D A;  1F5T A;  2WBM A;  4IOC F;  5DV5 A;  2LR8 A;  2XIG A;  2Z3Y A;  4S0H B;  4LLL A;  1MMD A;  2IAI A;  1B72 B;  3RJP A;  3HOZ J;  4PZJ A;  4PK4 A;  3MN2 A;  1JT6 A;  1V54 H;  2X9D A;  5GTH C;  2R7R A;  4XR6 A;  1S7E A;  2I8D A;  5DCM A;  2DQR A;  3H3Z A;  3V4G A;  4I7H A;  3PIO F;  3ZP5 A;  3HOT A;  1LNW A;  5J3L A;  2DOF A;  1X2N A;  3RKW A;  1ZRE A;  5BQT A;  2RDP A;  1BI1 A;  2XKO A;  3JSO A;  3FBI B;  1BOA A;  1S7O A;  2UXN A;  1YIJ I;  1Q1H A;  5K7Z A;  4OWR B;  2MC4 A;  1FMW A;  1LDD A;  3BG7 A;  3GCM A;  4V19 K;  1TC3 C;  1D5Y A;  5E1W A;  1X2M A;  2EZL A;  4U87 A;  1CF7 A;  2EFO A;  3RIR A;  1FOW A;  4AUX A;  3QPL A;  2DU9 A;  4F7Z A;  1YI2 I;  1XGN A;  1YW8 A;  5BMZ A;  2OPT A;  4E70 A;  1JKO C;  4KA4 A;  3HUG B;  1FBQ A;  2RQQ A;  2FBH A;  4YEJ A;  4ZTF A;  2GIZ A;  2HZD A;  4EJO A;  4G6Q A;  1GVD A;  1H9G A;  1U5T C;  2QVO A;  1BL0 A;  3PO3 J;  1WH7 A;  1EF4 A;  2BY1 A;  1ZH5 A;  5CVV A;  3IP4 B;  1MSF C;  2UUZ A;  3FHZ A;  1HKQ A;  3JAM Z;  4ZYH A;  1BJZ A;  2AXT C;  1QHG A;  5CYV A;  1UB9 A;  3C7J A;  2MW8 A;  4RB2 C;  2E1O A;  2CO5 A;  3WTW C;  3MKW B;  3SDG A;  3RQ4 A;  1AKH A;  1KQ8 A;  1E3H A;  2ZC2 A;  4BE0 A;  2OQR A;  2VBZ A;  2R7D A;  2DA4 A;  3GEZ A;  3WTT C;  2P5V A;  5F6F A;  1BI2 A;  1W0T A;  5DEQ A;  4ZYA A;  4R8H A;  3C2B A;  3RPU A;  1T39 A;  2LY1 A;  2P7V B;  1FOY A;  4GXO A;  2I10 A;  2DMQ A;  3LQQ A;  1ZG1 A;  3KP7 A;  5HDG A;  1FYM A;  2XRL A;  4N4N B;  3F8F A;  1NG6 A;  1Y8R B;  1U6G A;  2DOE A;  2QKM B;  3E6D A;  2H8W A;  5ICC A;  4BXF A;  3HM5 A;  2L9R A;  3IRQ A;  1N75 A;  5F1R A;  1B9N A;  2VN2 A;  3H0D A;  4BUP A;  3HPH A;  4I98 B;  1X1P A;  4CUG A;  1ERD A;  3E6M A;  1I1S A;  4E6K G;  3D0S A;  3H5R A;  2DJI A;  3ZCO A;  1G59 A;  2VBX A;  3IRR A;  2V26 A;  1BA5 A;  1YW9 A;  2OTJ I;  3ZR8 X;  2R7S A;  2Y9Y A;  4ENK A;  1D5V A;  3GFM A;  3SYT A;  2F6C A;  2PJR A;  2G9W A;  4I6Z A;  5HS8 A;  1QPM A;  4RAF A;  1W7P D;  3KZI C;  2X1C A;  5E18 F;  2EIJ H;  2A6H F;  3EQL F;  2VBW A;  2F5D A;  2HKX A;  2QBY B;  2Q2E B;  1M1E B;  1K4S A;  4AIJ A;  1QU3 A;  2IW5 A;  1Y56 A;  3GFJ A;  2XPV A;  4XSX F;  1E2X A;  1XMK A;  2XSD C;  1JT0 A;  3I59 B;  5K7F A;  3I53 A;  1AU7 A;  1D0X A;  1B4A A;  5TGT A;  1VQP I;  3CDL A;  2ADU A;  2M2E A;  2VE9 A;  1WJE A;  3FXO A;  3O8H A;  5L3F A;  2DDA A;  4B43 A;  2XAH A;  1HQC A;  3S93 A;  2F48 A;  5FLV A;  3OIP A;  1W36 D;  2HNH A;  1DPR A;  2VQC A;  4M72 A;  1I39 A;  3VB2 A;  2BE5 F;  2F4O B;  3WU0 A;  3HHG A;  2XGX A;  4EV0 A;  1T08 B;  2JZY A;  3OYI A;  3GTO J;  4C9Y A;  2L02 A;  4ETS A;  2IA0 A;  5LGN A;  4WXD A;  3CMY A;  3SJM A;  4FT8 A;  2WTE A;  2QSH X;  2VPR A;  5HLT A;  3IKT A;  3BG3 A;  2W48 A;  2E1C A;  3V7S A;  5DM6 F;  2KZV A;  2QKL B;  5E79 C;  2K9M A;  2DPU A;  4IEJ A;  3G73 A;  1IZ1 A;  1HF0 A;  3H3U A;  4E7K A;  2LRD A;  4IRG A;  1PP7 U;  2V9K A;  2G7H A;  1KGS A;  3FXQ A;  1G2H A;  4CSW A;  1ZQ3 P;  3TL4 X;  2FSW A;  3MWM A;  2BV6 A;  4NHJ A;  2IEK A;  4KMF A;  1SMY F;  4UB6 C;  4JQF A;  2GXA A;  2WV0 A;  2DA6 A;  1U8R A;  2YUS A;  1YJW I;  4Z2Y A;  3BRO A;  4ENJ A;  3ZOB A;  2LY2 A;  1S6L A;  1X3W B;  3BJO A;  4KMU X;  4LK0 F;  2P5L C;  2CV2 A;  1K83 J;  2ELK A;  1VQ8 I;  1XCB A;  2JSC A;  2X48 A;  2XKP A;  1Z7U A;  4L0Y B;  2KFD A;  4GYG A;  2VI6 A;  2FD5 A;  3BTI A;  1R22 A;  2ZKZ A;  2A61 A;  2HEO A;  5E1X A;  3KPH A;  1FC3 A;  2BYV E;  3PO2 J;  3P5J A;  3CD6 I;  2D5V A;  3DKY A;  3GWZ A;  2K9L A;  2W4S A;  3HPG A;  4RA2 A;  1IO2 A;  4C3H J;  3S2H J;  4M3G A;  1IN5 A;  3WG9 A;  4CCJ A;  1ZLJ A;  4M3F A;  4OIN F;  3ULQ B;  2H27 A;  5E3N A;  4BY1 J;  3QP6 A;  3JTG A;  4S04 A;  1KU2 A;  1DGR M;  2J5P A;  1Y1W J;  2L7M P;  4LMY A;  3J7A Y;  1I3A A;  1YW7 A;  2HVR A;  3DCF A;  3BCB A;  3L7W A;  1DP7 P;  4RDU A;  3PNV A;  2CQN A;  1YG2 A;  3HOX J;  2FNP A;  3I0T A;  4KIT B;  2V79 A;  2KIU A;  3MZY A;  5GAH J;  2PMU A;  5FFZ A;  4N9I A;  3FF5 A;  4NC8 A;  2XDV A;  1SD4 A;  2NXN B;  4CCO A;  4ENN A;  2EV5 A;  4UNO A;  3A02 A;  4LIU A;  2VPL A;  1EH6 A;  2Y0M A;  4UUS A;  4B4C A;  3J7Z I;  2IXS A;  3MZ8 A;  1XGO A;  2V6C A;  4MQV A;  3WE3 A;  1U0J A;  3P9C A;  1BBY A;  4ZDL A;  4EM0 B;  1E17 A;  3VYU B;  5ED4 A;  1JUP A;  3P9K A;  4P5O A;  1TBX A;  1XSX A;  5J4Y A;  1VTN C;  4EGY A;  2P0W A;  2VJJ A;  2Z33 A;  3D5L A;  2FNA A;  3FBN B;  1O3T A;  5CLS A;  3E6B A;  3VOE A;  3HTS B;  2K85 A;  3W2W A;  2DPD A;  3R0A A;  2OF7 A;  2FQ3 A;  4DYR A;  3MEX A;  1ETY A;  2MAB A;  4KT5 C;  1YFH A;  1YX5 A;  3S1M J;  3HYI A;  2AQE A;  3KLO A;  3JRI A;  1LE8 A;  3NWT A;  3M8J A;  2JA5 J;  3B73 A;  3G71 I;  1FPQ A;  2DCE A;  3CES A;  2EQR A;  2ZSH B;  1I6H J;  2V9V A;  4GRI A;  3WTX C;  2P7C B;  4U7B A;  1HDD C;  3KET A;  2DK5 A;  2JMW A;  4Q48 A;  2EFN A;  2X1E A;  4I0B A;  3V8J A;  5E17 F;  2I5U A;  5DCM B;  3JRF A;  4KFC A;  3PQK A;  2A68 F;  2MA3 A;  3LQR A;  2VQH A;  3OYD A;  1VQ9 I;  2YX4 A;  1UHW A;  1LFP A;  2LYC A;  2MH2 A;  4MFD A;  4GCV A;  2FOK A;  1H88 C;  2KPM A;  2VB6 A;  2EA4 A;  3HZJ A;  3S2D J;  4G6T B;  1EA3 A;  4XMY A;  3QPH A;  1S3J A;  4E4H A;  3DWL E;  3BPX A;  4BJ6 C;  5CPR B;  2W82 A;  1QGP A;  5C4X J;  1KON A;  3BJ6 A;  2M3A A;  5B3S H;  3H0G J;  2CMP A;  2R7T A;  3HSE A;  2B9S A;  5GAE J;  2R0Q C;  3SEZ A;  3GFL A;  2K27 A;  5L3E A;  4MO7 A;  5HLH A;  1YIT I;  1ETO A;  4A3M J;  1VQL I;  1ORK A;  3Q0W A;  2ZB9 A;  4ENM A;  3WGI A;  3GX4 X;  3JRB A;  3LA3 A;  3CCL I;  2CW7 A;  1PUE E;  2V1U A;  2DYS H;  1GXQ A;  2DT6 A;  2LFB A;  4UVB A;  1WHU A;  5E1Z B;  3U1D A;  1VQ4 I;  1ETQ A;  2PMZ A;  4A3F J;  1DDN A;  2QSG X;  1RNL A;  1XN7 A;  3F6O A;  1R58 A;  4BQN A;  1IRG A;  2VJ4 A;  1X1A A;  3HUG A;  1FMV A;  4Y15 A;  1UAA A;  5LEK A;  5GTI C;  4I09 A;  2P5K A;  4AU7 A;  2DJN A;  1HW2 A;  3ZMV A;  4KNY A;  3LL7 A;  2MD5 A;  3E6C C;  1Z0X A;  4BYY A;  5IYB J;  1AKH B;  5E8G A;  3CCV I;  2A5W A;  4D0P A;  5K5Q A;  2M9H A;  2HKO A;  4BAC A;  1I3Q J;  2M87 A;  2CG4 A;  2DO7 A;  3A01 A;  4RAG A;  3KYD B;  3BTL A;  2MH9 A;  3BG9 A;  3QYB A;  3MD2 A;  2EV0 A;  4DQ2 A;  5ILV A;  5F1J A;  1ZR2 A;  3A0H C;  5H6Q A;  2HZT A;  4NDL A;  2LOO A;  2OTL I;  4M3B A;  3K4K A;  5IP7 J;  1U8B A;  1WFX A;  4ANJ A;  4CGZ A;  4X6A J;  2N8G A;  3Q0U A;  3SZG A;  2ISY A;  1V5G A;  3HBL A;  4PSW A;  2PX9 A;  2OCE A;  3EUK L;  1AHD P;  4A3J J;  3AL0 B;  3R61 A;  5J1R A;  1VI0 A;  2GXG A;  3KP2 A;  3GTQ J;  3F23 A;  1W36 C;  2L9V A;  3KP6 A;  1SAU A;  2CSO A;  1KYZ A;  1P6R A;  4YIF A;  1YRN A;  1QNT A;  4NC6 A;  1DU0 A;  1AOY A;  3KLN A;  1YJ9 I;  5EGO A;  1Z05 A;  2WB1 A;  1FSE A;  3FK7 A;  3KYC B;  4OMY A;  1SD6 A;  4XRM A;  2JVG A;  2JTV A;  1T0F A;  1VND A;  4JP0 A;  5EZH A;  2IA2 A;  3FM3 A;  4L9J A;  1SD7 A;  1IXR C;  4HQE A;  2HOS A;  2K02 A;  1OFC X;  4A0Z A;  2RNG A;  3TO9 A;  3HSR A;  3QWL A;  3M07 A;  1R1U A;  5GAD J;  4RGS A;  4PGG A;  5DD4 A;  1REP C;  3ELK A;  4BEH A;  4A93 J;  1TT5 B;  1MBG A;  2Q2E A;  4JX5 A;  2K3P A;  4P55 A;  2CQX A;  5DUK A;  3L2U A;  2JSP A;  4MQ9 F;  1DGW Y;  1USS A;  2ID6 A;  5CQE A;  4I2O A;  4DOZ A;  4CZC A;  2VON A;  2EIM H;  3K4J A;  5K5R A;  4G9Y A;  4HDV A;  3JRH A;  2QGU A;  2M34 A;  2PQ8 A;  1OPC A;  1XMX A;  2EIL H;  3HG9 A;  4HEA 2;  3ZQL A;  2JWT A;  4Q47 A;  3DXJ F;  3NAR A;  3WU1 B;  3N97 A;  1J75 A;  1Z3X A;  2LSO A;  3FXL A;  4HA8 A;  3JRE A;  1IGN A;  1FOK A;  3CDI A;  2D1H A;  5FB2 A;  2KHM A;  2B0L A;  3N4M A;  3LSG A;  3O2P E;  3LMM A;  4WCG A;  2VXZ A;  3K4C A;  5IY5 H;  5HDK A;  3GTP J;  1LVK A;  3H35 A;  1P4A A;  1UHS A;  1ONV A;  2DA1 A;  4EJU A;  4ESJ A;  1YYV A;  2ECB A;  2DYR H;  2HYJ A;  4D5C A;  4L9T A;  3ZMU A;  3BZC A;  3HOW J;  4C2M J;  3RKX A;  1D0Y A;  3K9T A;  2BY0 A;  5DM7 F;  4C2U A;  3I5U A;  2FOW A;  1R9T J;  3A4C A;  4KIG A;  3O8G A;  3U2R A;  2B63 J;  2E71 A;  2HQ5 A;  1QBJ A;  3M1C A;  4L5J A;  1IN4 A;  1LDJ A;  4A5N A;  3H9Q A;  3M1E A;  1NG7 A;  2L7K A;  4L9N A;  1EJ9 A;  4F55 A;  2EH3 A;  3QOD A;  4HNT A;  3ZQ7 A;  1S72 I;  5BNG A;  3F6V A;  4G94 A;  2RN7 A;  4ZZL A;  2G0E A;  2JPC A;  4BBR J;  3D5S C;  2BGC A;  3F8M A;  3L2C A;  5H2F C;  2M30 A;  1MNM C;  3QU6 A;  4DW6 A;  3CC4 I;  3AL0 C;  2ZJ2 A;  4HZF A;  1PVE A;  2VUM J;  3RI4 A;  5LGT A;  1F43 A;  5J47 A;  1A5J A;  4F92 B;  3M3Y J;  2ZME C;  5E20 A;  3JCU C;  1UG0 A;  4B1R A;  3CC2 I;  2FBK A;  3V7R A;  4UUS B;  1HC8 A;  3W6J B;  1OIS A;  3OR2 C;  3IWZ A;  1UG2 A;  3MQ0 A;  1JJ6 C;  1MNE A;  3PQJ A;  4P1W A;  3HRM A;  5J8C A;  3RZD J;  3IAS 2;  4L5I A;  1IC8 A;  5GPC A;  1TQP A;  4BDZ A;  4YEL A;  4I99 C;  2V4J C;  1Y6I A;  2DT7 B;  3K69 A;  2L9N A;  3ABU A;  3DKW A;  2JUG A;  1IAW A;  1OYI A;  3PL8 A;  1I50 J;  3DTI A;  4LD5 A;  4UVA A;  4HNV A;  1WJB A;  2W7N A;  3BTJ A;  4NB5 A;  4ZH4 F;  4FQG A;  4DZJ A;  5F0H A;  1SFE A;  3FMS A;  1LE8 B;  1WJF A;  2CW8 A;  1FIA A;  4PGH A;  3KIO A;  3I55 I;  2AHQ A;  2M7A A;  3ECH A;  3GXO A;  2KQR A;  3E7L A;  4PJM A;  3JW4 A;  4XN3 A;  1LFU P;  1UFM A;  1XG1 A;  5DD8 A;  3OWT A;  1WCM J;  3SHF A;  2DA5 A;  4HAM A;  4MHG A;  2ISZ A;  1ZRF A;  2XAF A;  3M4O J;  2HDW A;  3DKX A;  4LG0 A;  4ZJZ A;  3M8F A;  1BJA A;  2AO9 A;  4RS8 A;  3CC7 I;  2HQA A;  1BW6 A;  2ACJ A;  3P7N A;  4V2G A;  4XQF A;  4E7J A;  3VFZ A;  1VFC A;  3LOC A;  3TW7 A;  1OCP A;  2CQQ A;  1YE9 A;  3L9F A;  4BKX A;  3BZ6 A;  1R1T A;  2XVC A;  5LFA A;  2Z16 A;  1SD5 A;  3BTC A;  2DMN A;  1V5F A;  1KYW A;  4IRH A;  2YR2 A;  3AG2 H;  4AYB A;  5LLQ A;  3WHB A;  2EZI A;  2Y31 A;  4BJ5 C;  4PFO A;  1G6N A;  3MKZ A;  1OLT A;  4B47 A;  2G7U A;  3KP4 A;  4GDF A;  1W1W E;  1N25 A;  3OSF A;  1QZY A;  1QHH D;  1ETW A;  2DFF A;  2QQ8 A;  2LY9 A;  3CCM I;  2MSY A;  1P9Q C;  1YLF A;  4CHU A;  2KIS A;  3HKZ N;  5CQG A;  2QZ8 A;  4HX8 A;  2COB A;  2L4M A;  1FEX A;  1FTZ A;  4L9V A;  3CF5 F;  2FEZ A;  3HOY J;  1MD0 A;  1SAX A;  1G3Y A;  5GP9 A;  3JR9 A;  1IF1 A;  3OYH A;  5KVR A;  3FXK A;  2K4B A;  2WV1 A;  3WE2 A;  2ZJP F;  3I4N J;  2Y2Z A;  5EEH A;  4Z6Y A;  2ICW G;  4XSZ F;  5B66 C;  3PFI A;  4C3J J;  5FLM J;  3A01 B;  2DDB A;  1Z6T A;  1OR7 C;  2ZFW A;  2EV6 A;  4AWX B;  5EEG A;  3CJT B;  4DJA A;  3KFW X;  4MGR A;  5LHG A;  4IPA A;  2IS2 A;  3E1S A;  4PDK A;  3TDU C;  2IVM A;  4XID A;  1SFK A;  3K0L A;  3K7A J;  4M73 A;  1XC5 A;  1TWH J;  2LNB A;  2IGO A;  4O6J A;  4XRF A;  4R79 A;  2V1D A;  1WI9 A;  4IRI A;  2J5O A;  4WWC A;  1YIO A;  3H92 A;  3T8R A;  3ZN1 A;  2NNN A;  1JKP C;  2O6G E;  2PI0 A;  2PG4 A;  4M9S A;  1Z77 A;  1J5Y A;  3GTG J;  1NTC A;  2X6W A;  3DFG A;  3GBG A;  3J80 Z;  3G4S I;  1J2X A;  1QZZ A;  3E5U A;  3S2W A;  3ASN H;  3U21 A;  5FLX Z;  1G3W A;  3RYP A;  1YRN B;  4EJT A;  4HYE A;  2P8T A;  1XX5 A;  2JA2 A;  4PJJ A;  3P9I A;  3BOQ A;  1STZ A;  3HRS A;  4L5E A;  4YRV A;  5EGO B;  4PJ0 C;  5FJ8 J;  2KJB A;  4J00 A;  2BW3 B;  4HW0 A;  4WF2 A;  4XOP A;  5EZG A;  1SFU A;  3R6S A;  1ZAR A;  4F3Q A;  4XN0 A;  1U9O A;  2VAS A;  4HNU A;  1YOV B;  2DMP A;  2GWR A;  1ETK A;  1JTY A;  3SZT A;  5FO5 A;  2IS6 A;  2O03 A;  1MND A;  3GO5 A;  1ZHF A;  3K1P A;  3ECO A;  3FHN A;  3DPL C;  3MAJ A;  1V55 H;  2F4M B;  1PYV A;  2JT1 A;  4CDG A;  4BEH B;  2EBI A;  1D8K A;  3ESW B;  5JHF A;  4RB1 A;  3CP2 A;  3CP8 A;  2GAU A;  2OA4 A;  5K1Y A;  1Y0N A;  3V7C A;  1RR8 C;  2VQL A;  1K78 A;  2OQG A;  4NQW A;  1ZG3 A;  3GTL J;  2R93 J;  3AG3 H;  5LRS A;  1IG7 A;  5K7H A;  4BH9 A;  2M1B A;  5H6R A;  2EWN A;  2V9P A;  4L18 B;  5EG0 A;  3J81 K;  2OCC H;  2F4I A;  3A0B C;  4IVN A;  3TQN A;  1TLH B;  2BZT A;  1XD7 A;  2X4H A;  3DEW A;  3DU5 A;  3RKY A;  2HXI A;  1JTX A;  1BI3 A;  3C1D A;  3IV5 A;  3MZH A;  4EJV A;  1MDM A;  4ON0 A;  5TRD A;  1WRJ A;  5ICF A;  4BY7 J;  3OR1 C;  4CO8 A;  3T5X A;  2ZJQ F;  5K5O A;  3EYY A;  3Q3S A;  2VJ5 A;  1MMG A;  2R7Z J;  3K1N A;  1IJW C;  1TNT A;  4A6E A;  2R7W A;  2RNJ A;  3C18 A;  4HLY A;  2BVM A;  2HQN A;  1D1B A;  2MYS A;  2CV1 A;  4GGG A;  1GV5 A;  2ZXH A;  2KIM A;  4MNU A;  2QA4 I;  2GQQ A;  2O9L A;  3GTJ J;  5AIP A;  1ZGW A;  1TWC J;  2JA8 J;  1W5S A;  2Q8K A;  2W85 A;  2IPQ X;  5J1U A;  1R6R A;  4KIB A;  3CCU I;  2KLO A;  1RRJ A;  2K3F A;  5B1A H;  2MFZ A;  3TW6 A;  4E7S A;  4BS9 A;  1LQ1 A;  4RM3 A;  1G8X A;  3PFY A;  5ILU A;  1GV2 A;  3CCR I;  5HS7 A;  4HSR A;  4KIS A;  3G3Z A;  2VBY A;  3CLO A;  5KCM A;  3S17 J;  2KT0 A;  4RAY A;  3DPT A;  1AA7 A;  2BEO A;  4OU0 A;  1SEU A;  1TTY A;  4RLQ A;  1UHM A;  3MCZ A;  4EAT A;  5J1Y A;  1IUF A;  6PAX A;  2WY7 Q;  3ZPL A;  2HDD A;  4A3B J;  1J9I A;  3BLY A;  2QEX I;  5DS9 A;  1LJ9 A;  3S3O A;  3PUF A;  2QF7 A;  1QQI A;  3VDX A;  2BXZ A;  2X6X A;  4CIC A;  2H94 A;  1PP8 F;  1L3L A;  1EH7 A;  3LSP A;  3F0C A;  4BXU A;  3ZQG A;  2OBP A;  1F4K A;  4BE1 A;  1H0M A;  3V8L A;  2XGC A;  2QM3 A;  4OAZ A;  2L4A A;  3UR3 C;  3ZQC A;  2Z99 A;  1CGP A;  3VYT B;  3DEE A;  4LIV A;  1IRX A;  2K40 A;  2OUM A;  3EDP A;  2DW4 A;  1R4N B;  3MKL A;  4RAZ A;  9ANT A;  2AXL A;  5F0C A;  1A6I A;  3RPU D;  3IL2 A;  2BBY A;  3KEQ A;  4N4O B;  2AS5 F;  4EM2 A;  1P92 A;  3PSI A;  4IHY A;  2P81 A;  5JVT A;  1U5T A;  2R7O A;  4CCK A;  5CVI A;  5B1B H;  2XC7 A;  3FXJ A;  2FA5 A;  1R36 A;  1WKM A;  1KQ0 A;  3ZN0 A;  3KZY A;  1G3S A;  2BOL A;  4BNC A;  2BXY A;  2PMH A;  5HS9 A;  2GZW A;  2XUB A;  5IT3 A;  1XS9 A;  1N77 A;  1O3R A;  5LBQ A;  3FK6 A;  3OYJ A;  1MH4 A;  1P4W A;  4OAY A;  1VQM I;  1RI7 A;  1VQO I;  1WQ2 A;  4XLE A;  1O7L A;  1IN8 A;  4RMN A;  1BN5 A;  2HS5 A;  3IKV A;  2PLY A;  3ABK H;  5CVJ A;  3F72 A;  3I64 A;  1RIO H;  5IT9 K;  1V4R A;  3KE2 A;  2ELH A;  2ZNZ A;  3F8C A;  3ONQ A;  1LVA A;  4LG0 B;  3HOU J;  5JVG F;  4IHW A;  1WJC A;  5IYC J;  2KRF A;  1WJD A;  1YHQ I;  2PFB A;  4YG2 F;  1TL8 A;  3R60 A;  1QRY A;  4ITV A;  4XRS A;  1FZP B;  3ZQH A;  5FD6 A;  1SMT A;  5L3G A;  3GZ6 A;  3TKY A;  1X3Z B;  4A3L J;  2GBY A;  2JA7 J;  5F64 A;  1P2F A;  2HOE A;  3BCA A;  1U2W A;  4A2U A;  2RVC A;  1I27 A;  3FIS A;  4EM1 A;  3TP3 A;  2DFI A;  4IQJ A;  1NK2 P;  5D8K B;  2GOX B;  3FWE A;  2H6B A;  4M6Y A;  4FAS D;  3L2R A;  2W84 A;  4JK1 X;  1IDZ A;  2FMY A;  4M9Z A;  2E5N A;  2HR3 A;  1JJ8 C;  1QPI A;  3HIF A;  3TO7 A;  2Y0S A;  2Y9Z A;  4ESB A;  2MD0 A;  3K1M A;  4P9U A;  2JRT A;  2HQR A;  2QWW A;  1A36 A;  4B44 A;  4KT6 A;  2O5R A;  2KIQ A;  3J81 Z;  1R5I D;  4ZDP A;  3ZXS A;  1UEL B;  4II2 A;  5HNH A;  2HYF A;  4HRI A;  1HXD A;  4XON A;  1QO0 D;  4XKC A;  2QSF X;  3WGG A;  3ABT A;  2VXD A;  3G1O A;  1XSD A;  3BR5 A;  2FXA A;  1K4T A;  3LSH A;  4A0Y A;  1XMA A;  1EV7 A;  5D6E A;  2O61 A;  3I54 A;  4XKB A;  3BPV A;  1T95 A;  1Z1D A;  2JPB A;  4WK8 F;  4S05 A;  3OYL A;  2L2O A;  4FX0 A;  1BR2 A;  1I1G A;  2WB1 N;  3WHC A;  4ZTJ A;  2DLL A;  3FM5 A;  3DV8 A;  3M8E A;  2FX0 A;  1X1C A;  3D5R C;  1FJL A;  4XKV A;  1RET A;  3WTS C;  3HGG A;  1XCV A;  1IN7 A;  2CWE A;  3HRU A;  3HJE A;  3L2Q A;  4HG2 A;  4OIR F;  4EEF G;  2LC2 A;  1OCR H;  3DEU A;  1O3Q A;  4H4K C;  3WU2 C;  2XRN A;  4LLN A;  4G6D A;  2D2W A;  4U0Y A;  4KN4 X;  3TMO A;  3EPZ A;  1Z67 A;  3BQY A;  3BR0 A;  3A1Y A;  3LAP A;  1GDT A;  4P96 A;  2PJP A;  1B9M A;  2KJC A;  1R5H A;  1HW5 A;  5LD2 C;  2KRC A;  1R1V A;  3RQI A;  3CO7 C;  2WY8 Q;  2K9S A;  4C30 A;  2FRH A;  3B02 A;  2X1D A;  4ZYD A;  5D5W B;  2IS1 A;  1ETX A;  3TO6 A;  2NYX A;  3S32 A;  1JGS A;  2NS0 A;  2OU2 A;  3VPR A;  1W5T A;  2CQK A;  1VQN I;  1HSJ A;  1ITY A;  4QLC U;  5EF6 A;  3C3W A;  1RUN A;  3BY6 A;  1MJ9 A;  2DAO A;  1JE8 A;  1IRF A;  1YS6 A;  2L3D A;  1MBH A;  3RKQ A;  1B6A A;  2K7L A;  4QTR A;  2CV0 A;  1X1B A;  3L2V A;  1DU6 A;  3GTK J;  4M6V A;  4FX4 A;  2CH0 A;  4M71 A;  5IP6 A;  4DIQ A;  3CCQ I;  5F08 A;  1YX3 A;  2CU7 A;  3AFH A;  1Y8Q B;  2UV1 A;  2OZ6 A;  3KYL A;  5FD5 A;  3EUA A;  1VQ6 I;  2A05 A;  2BW3 A;  4FIS A;  3K2Z A;  2DA2 A;  1S29 A;  3QAH A;  1G3T A;  2JQ7 A;  2F5E A;  3F9K A;  3NQO A;  3RYR A;  4FCY A;  2WAQ A;  1U3E M;  5IP9 J;  5HDN A;  4BU2 A;  4IHV A;  2KDO A;  3BC8 A;  3GLX A;  3SFI A;  4A5M A;  1K78 B;  4NQW B;  1QVT A;  3I4M J;  1P7I A;  3M7G A;  2WAF A;  4OMZ A;  4AIK A;  1RC9 A;  4ZYE A;  5EG0 B;  3JRC A;  5LEJ A;  3TED A;  3E5Q A;  4FE7 A;  1MDM B;  3O6B B;  2YS9 A;  4AD9 A;  4II3 A;  1NHA A;  2A6T A;  2STW A;  2LKP A;  4UHT A;  2ZCW A;  5IT9 Z;  1OYY A;  2IA1 A;  4CYC B;  3FXU A;  4Y7N J;  4D1Q A;  4LB6 B;  2VOP A;  5FRO A;  1V3F A;  4XLP F;  3G1L A;  1ACI A;  2DOA A;  4OIO F;  1LKX A;  3K2A A;  1HKS A;  4XL9 A;  1ZK8 A;  1RKW A;  1LFB A;  2VC0 A;  3QQA A;  3HC7 A;  2Q0O A;  3CLQ A;  4HF0 A;  3OYM A;  1YQA A;  3FKJ A;  4IL6 C;  3K70 D;  3PUB A;  2CUF A;  1ZTR A;  2E35 A;  5LRR A;  2BY3 A;  4PFP A;  2XF7 A;  3HTU A;  2HPI A;  1IXC A;  2EZK A;  3J7A O;  4XRS G;  3ERE D;  5HNF A;  3NWS A;  4YFN F;  3OSG A;  4LLG F;  4AID A;  3DPU A;  4B3A A;  3DF8 A;  4IZZ A;  3MFK A;  5CVU A;  1OMI A;  2ME0 A;  4HX7 A;  4G7H F;  2NS8 A;  1ZR4 A;  2QLZ A;  2DTR A;  2BY2 A;  3RZO J;  3OL3 A;  4PCQ A;  4UV9 A;  1JXS A;  3Q5F A;  4CYD A;  1Z9C A;  4KJZ A;  2A69 F;  2XB0 X;  3LSI A;  3RSN A;  1WZ2 A;  4W1U A;  4FTH A;  1MSE C;  2JN6 A;  3OMY A;  1BC7 C;  3A2K A;  2VC1 A;  4AM3 A;  3PM1 A;  3OIQ A;  3W3C A;  3TOA A;  3ASO H;  5L3B A;  2R5Z A;  2WWY A;  3DBL B;  1WI3 A;  2DOD A;  1FX7 A;  5D5X B;  1HST A;  2QYO A;  5HOD A;  1LEA A;  1RES A;  4ZZD A;  2X0L A;  2LTP A;  4AC0 A;  4D5F A;  3F22 A;  1R7J A;  5ILS A;  3W2A A;  5FGM A;  2R4G A;  3KEO A;  4Y13 A;  2DT5 A;  2IP2 A;  3TGN A;  4UUT A;  4XKW A;  1KA8 A;  3ABM H;  1PUF A;  1W0U A;  3D1N I;  2MC3 A;  2RGV A;  2JUC A;  3F8N A;  2KKO A;  2L9S A;  3PSF A;  2LP0 A;  4CXF A;  4UXN A;  2DK8 A;  4G7Z F;  3GYH X;  1RR7 A;  1UZC A;  2JRM A;  4O5V A;  3AAF A;  2KZG A;  3PIP F;  1MW7 A;  5J8F A;  4TV7 A;  1X1D A;  2VOD A;  2GIV A;  1VQ7 I;  2DQL A;  3QOP A;  1W4M A;  1U5T B;  2OC6 A;  5J6X A;  5FKO A;  3GTM J;  1OJL A;  5BPI A;  3BDD A;  3RTR A;  2KP6 A;  1SC7 A;  2QQB A;  3GW2 A;  4UUV A;  4RB0 A;  3ZMD A;  3S1Q J;  2LKS A;  2WC2 A;  3HRT A;  4YFK F;  2COM A;  2ID3 A;  5LHI A;  1IN6 A;  1JGG A;  3O3K A;  2LMD A;  4I02 A;  4A3D J;  1T98 A;  2K9N A;  2R5Y A;  1IDY A;  3E5X A;  1J09 A;  3DBH B;  2Y48 A;  1ZLK A;  4XNF A;  1G4D A;  3OYF A;  2LKX A;  1B8I A;  3BR2 A;  2V1X A;  2Z2S B;  2XGD A;  3JTH A;  3GFI A;  1ZGJ A;  5D4S A;  1T33 A;  3R0J A;  2K86 A;  5D5V B;  3I58 A;  4MTE A;  4G12 A;  2VIX A;  4EGZ A;  4GO1 A;  1TW2 A;  1U78 A;  4A0X A;  3H3V K;  1P7J A;  4RGX A;  2GA1 A;  3M9A A;  3JRG A;  5BS6 A;  4BJT A;  3SDB A;  5E3L A;  1UMQ A;  3QP5 A;  2DA3 A;  1POG A;  3X2Q H;  4ZDO A;  1WWX A;  2HFH A;  1A35 A;  2HVQ A;  1D0Z A;  2E2H J;  3L2W A;  1TWG J;  2ZBK A;  4A3E J;  2XV4 S;  1R4M B;  2WAD A;  2HWV A;  3SXY A;  2NOG A;  4KUM A;  1IW7 F;  2R7F A;  1HOM A;  3BG6 A;  1TQM A;  4MLO A;  2H6C A;  2UZK A;  4Y3O A;  3B6A A;  4B3X A;  2VT3 A;  5FRN A;  4U88 A;  3HGY A;  5TIS C;  3ZQI A;  2OV7 A;  4XOT A;  2O3F A;  4M3E A;  3SQN A;  3NAU A;  5JFR A;  2RAE A;  4JX6 A;  1H8A C;  5HLI A;  1JKR C;  4JX4 A;  2FML A;  1Z21 A;  4UV8 A;  2E5Z A;  2E34 A;  2GLO A;  3CJN A;  4Y52 J;  4HF2 A;  2M8G X;  3SEQ A;  1K79 A;  4IQ4 A;  1FYK A;  1T2K A;  2C6Y A;  2V6E A;  3HEF A;  5A2Q K;  5DTD A;  1MMS A;  2VL8 A;  4Q5S F;  3LA2 A;  2D45 A;  5TJJ A;  3H9J A;  1XPX A;  3Q9V A;  5DUI A;  3FXM A;  4HDU A;  1JUS A;  1HCR A;  4BQQ A;  3K4M A;  1D3Y A;  2VKD A;  4KYW A;  1OCT C;  2M7B A;  4ABZ A;  1F1Z A;  2HOA A;  2ZXI A;  3H5A A;  4OOI A;  1A31 A;  3TDZ C;  1MMA A;  5D6F A;  1PDN C;  4IOA F;  4QSH A;  3OYK A;  1KZH A;  2M0C A;  5BPD A;  4E7I A;  3R4K A;  2LBF A;  2EA2 A;  3WOD F;  3A03 A;  2W00 A;  3I71 A;  3OL4 A;  2QQ9 A;  4I0A A;  1X4O A;  3FMQ A;  4LB5 A;  1OCZ H;  3BWG A;  3TBI A;  4LGW A;  1GUU A;  2ZXW H;  3KX2 A;  2VQG A;  2QCO A;  4Y33 A;  5IOY A;  3F8B A;  5JI6 A;  3QU3 A;  3CCJ I;  2R7V A;  3VEP A;  2MLG A;  2OZU A; 
#chains in the Genus database with same CATH homology
 1H9T A;  1LB2 A;  3ZMZ A;  2GXB A;  1J7K A;  1C0W A;  3GUD A;  1ZGA A;  3SZP A;  4XBF A;  3L09 A;  2RQP A;  2A5Y B;  5LHH A;  3CUQ A;  1UST A;  3FMR A;  3I4P A;  2YSR A;  1ZAO A;  4BAY A;  2O0Y A;  4N0B A;  4KIF A;  1MGT A;  1XGM A;  2TDX A;  2A3S A;  4WXH A;  4IHT A;  4YFX F;  1GXP A;  2ZXJ A;  1I5Z A;  1F9N A;  3V8K A;  1FT9 A;  4OIQ F;  2FBI A;  1BC8 C;  3E97 A;  1MJA A;  2ZME A;  1ULY A;  4LJZ F;  2YX7 A;  1P4X A;  1Y0U A;  2ESN A;  2QUF A;  3LFK A;  2HDC A;  1FY7 A;  5JHU A;  3FX3 A;  3JSP A;  4L0Z B;  4FHT A;  1ODD A;  2EB7 A;  2E7W A;  2M5W A;  2PBI A;  3LAJ A;  1ZYR F;  4BHC A;  1Z6R A;  5KK1 A;  2F5C A;  3FZV A;  2NNY A;  2OD5 A;  2EJR A;  3LWF A;  4Q4Z F;  2MBF A;  3EUH A;  1GHC A;  2CFX A;  2CYY A;  2XHK A;  3COA C;  3WGH A;  1ZG5 A;  1FP2 A;  1ZN2 A;  2M45 A;  4B09 A;  1S8N A;  1HW1 A;  4B8X A;  3Q9S A;  3FXR A;  3KZZ A;  1IUY A;  2ZO4 A;  2F2E A;  5A2Q Z;  4RGU A;  5L3C A;  4EJW A;  1ZRC A;  3L00 A;  1DPU A;  4ESF A;  1O57 A;  5L3D A;  4RB3 C;  3ZMS A;  2L01 A;  3DP7 A;  3HOS A;  2W25 A;  3U9G A;  1T6S A;  1D8J A;  3CO6 C;  4A12 A;  3E3V A;  4JBA A;  2Y75 A;  4IF4 A;  4LFU A;  2QQA A;  3IC7 A;  1JHF A;  5D5U B;  2YPR A;  1DUX C;  1L0O C;  3GVA A;  3DQV C;  5AON A;  4IXA A;  1TQI A;  3T1B A;  1R00 A;  1FLI A;  2H09 A;  5CVR A;  1OR7 A;  1W7P B;  1YO5 C;  1BIB A;  4HLX A;  1KQ9 A;  4OIP F;  3CUO A;  2VT2 A;  1FWZ A;  4ASN A;  3F3X A;  4CZZ A;  4R1H A;  3LST A;  1XSV A;  4WXC A;  3WTZ A;  5LGU A;  4MEY F;  2FF4 A;  2GA2 A;  4AVP A;  3ROU A;  5H20 A;  5HVQ C;  2LF8 A;  2Z9O A;  3WTY C;  1BM9 A;  4EVI A;  5DYM A;  3KP5 A;  2STT A;  1IXS B;  2EFQ A;  3BJA A;  1LDK B;  4G8X A;  1KU9 A;  4HV6 A;  2E1N A;  1FNN A;  1O7F A;  1B59 A;  1AWC A;  2DBB A;  2Z5U A;  1CF7 B;  1JHH A;  5AIQ A;  1K6O A;  1HKT A;  4Y17 A;  1OYW A;  4M6X A;  2ZNY A;  3OV8 A;  4XLN F;  3ML6 A;  2RC4 A;  1X3U A;  1Z91 A;  5CJ9 A;  1TW3 A;  5HLG A;  4KN7 X;  5ERI A;  3HSF A;  2EK5 A;  4AIH A;  4IJA A;  2XAJ A;  1FSH A;  3EET A;  3ISP A;  1A04 A;  4KDP A;  1B1B A;  3RDI A;  3GF2 A;  2L54 A;  4BHP A;  3CUQ B;  2P4W A;  1SFX A;  2ETH A;  1XDS A;  2K4J A;  4BQA A;  4LK1 F;  1J0R A;  3IHU A;  4ZYG A;  3REO A;  2KIF A;  1J59 A;  2ESH A;  4I01 A;  2HGC A;  4N9H A;  2CW0 F;  3QRF F;  4DNC A;  2FE3 A;  1R5G A;  2VE8 A;  2HTS A;  4HQM A;  1XDU A;  4IHS A;  4M9X A;  4HF1 A;  3IWF A;  2ZME B;  1S7A A;  3NRV A;  2DI3 A;  1FBU A;  2IRF G;  3T8T A;  2O8X A;  2IT0 A;  2UWM A;  1YTY A;  2HTJ A;  1XB4 A;  4KIC A;  2EFW A;  1TNS A;  3TOB A;  1GVJ A;  2R3S A;  3WTV C;  1MKM A;  2NRA C;  2RKH A;  2EFP A;  5FFX A;  1EH8 A;  1R23 A;  2QBY A;  2A07 F;  4EQQ A;  4U0V A;  4HBL A;  1XGS A;  2W57 A;  3I59 A;  2F5F A;  1MZB A;  2HYG D;  3KCC A;  4HOB A;  4HV5 A;  3QPT A;  4EMS A;  2MLK A;  4U0W A;  5ICE A;  4H0E A;  1BI0 A;  4P9F A;  2D1V A;  3NEU A;  2P6S A;  2NAZ A;  2OAZ A;  3F21 A;  2PEX A;  2E7X A;  1O3S A;  2QEN A;  1KU3 A;  1LEB A;  4M74 A;  3SFZ A;  2PN6 A;  4A6D A;  2LDU A;  4U7D A;  3T0Y A;  1ON2 A;  2LF7 A;  3EYI A;  3JAM K;  3HHH A;  1YS7 A;  2W24 A;  3CUQ C;  2CGP A;  3WTU C;  4UVC A;  1I6X A;  3KP3 A;  1ON1 A;  4YII A;  2A6E F;  2XAQ A;  1BIA A;  1FYL A;  1OKR A;  3OOP A;  3J80 K;  5FLX K;  5D4R A;  2IJL A;  4RGR A;  3CDH A;  3RPQ A;  1WSU A;  4WX9 A;  1ZRD A;  3W6K B;  1KU7 A;  1T38 A;  2FU4 A;  2YU3 A;  3VOD A;  4O3M A;  2M8E A;  5DDG A;  2XAS A;  1FBS A;  4BHB A;  2XRO A;  5BOX A;  5HOO A;  3LA7 A;  1RZ4 A;  4G7O F;  4K2E A;  2P6T A;  1W7P A;  1UCR A;  3ZMT A;  4MTD A;  2RV8 A;  2XAG A;  5ICG A;  4HX4 A;  4GYI A;  1K7A A;  4MEX F;  1MJB A;  1FP1 D;  3BP8 A;  2VOO A;  5E8I A;  3CTA A;  4QWQ A;  5JR3 A;  1HBX G;  2UXX A;  5DCF A;  5D8L B;  1RUO A;  1F5T A;  5DV5 A;  2XIG A;  2Z3Y A;  4LLL A;  3RJP A;  4PZJ A;  5DCM A;  2DQR A;  3H3Z A;  3ZP5 A;  4I7H A;  3V4G A;  3HOT A;  1LNW A;  3RKW A;  1ZRE A;  5BQT A;  2RDP A;  1BI1 A;  2XKO A;  3JSO A;  1BOA A;  1S7O A;  2UXN A;  1Q1H A;  1LDD A;  5E1W A;  1CF7 A;  2EFO A;  3RIR A;  2DU9 A;  4F7Z A;  1XGN A;  1YW8 A;  5BMZ A;  4E70 A;  4KA4 A;  1FBQ A;  2FBH A;  4EJO A;  4G6Q A;  1H9G A;  1U5T C;  2QVO A;  1ZH5 A;  5CVV A;  3FHZ A;  1HKQ A;  3JAM Z;  4ZYH A;  5CYV A;  1UB9 A;  3C7J A;  4RB2 C;  3WTW C;  2CO5 A;  1KQ8 A;  2OQR A;  2VBZ A;  2R7D A;  3GEZ A;  3WTT C;  2P5V A;  5F6F A;  1BI2 A;  5DEQ A;  4R8H A;  1T39 A;  3RPU A;  2P7V B;  4GXO A;  3LQQ A;  1ZG1 A;  3KP7 A;  5HDG A;  1FYM A;  3F8F A;  5ICC A;  3E6D A;  1U6G A;  3IRQ A;  5F1R A;  1B9N A;  2VN2 A;  4I98 B;  3E6M A;  1I1S A;  3D0S A;  2VBX A;  3IRR A;  1YW9 A;  4ENK A;  1D5V A;  3GFM A;  2G9W A;  5HS8 A;  1QPM A;  1W7P D;  5E18 F;  2A6H F;  3EQL F;  2VBW A;  2F5D A;  2HKX A;  2QBY B;  4AIJ A;  2IW5 A;  3GFJ A;  4XSX F;  1E2X A;  1XMK A;  3I59 B;  3I53 A;  1B4A A;  2ADU A;  2VE9 A;  5L3F A;  2XAH A;  1HQC A;  1DPR A;  4M72 A;  3VB2 A;  2BE5 F;  3WU0 A;  3HHG A;  2XGX A;  4EV0 A;  2JZY A;  2L02 A;  4ETS A;  2IA0 A;  5LGN A;  4WXD A;  4FT8 A;  2WTE A;  3IKT A;  2E1C A;  3V7S A;  2DPU A;  3G73 A;  1IZ1 A;  3H3U A;  1PP7 U;  4IRG A;  2G7H A;  1KGS A;  3FXQ A;  2FSW A;  3MWM A;  2BV6 A;  4NHJ A;  4KMF A;  1SMY F;  4JQF A;  2WV0 A;  1U8R A;  4Z2Y A;  3BRO A;  4ENJ A;  2P5L C;  1S6L A;  3BJO A;  4KMU X;  4LK0 F;  1XCB A;  2JSC A;  2XKP A;  1Z7U A;  4L0Y B;  4GYG A;  1R22 A;  2ZKZ A;  2A61 A;  2HEO A;  5E1X A;  1FC3 A;  2BYV E;  3GWZ A;  1IN5 A;  3WG9 A;  1ZLJ A;  2H27 A;  4OIN F;  3ULQ B;  3QP6 A;  3JTG A;  4S04 A;  1KU2 A;  2J5P A;  4LMY A;  1YW7 A;  1DP7 P;  3L7W A;  1YG2 A;  2FNP A;  3I0T A;  2V79 A;  2KIU A;  3MZY A;  2PMU A;  5FFZ A;  4N9I A;  3FF5 A;  1SD4 A;  4UNO A;  4ENN A;  2EV5 A;  1EH6 A;  2Y0M A;  1XGO A;  2V6C A;  4MQV A;  3WE3 A;  3P9C A;  1BBY A;  4EM0 B;  1E17 A;  5ED4 A;  3P9K A;  4P5O A;  1TBX A;  1XSX A;  1VTN C;  4EGY A;  2Z33 A;  3D5L A;  2FNA A;  1O3T A;  5CLS A;  3E6B A;  3VOE A;  3HTS B;  2DPD A;  3R0A A;  2FQ3 A;  3MEX A;  4KT5 C;  1YFH A;  3HYI A;  3KLO A;  3B73 A;  1FPQ A;  2V9V A;  2P7C B;  3WTX C;  4U7B A;  3KET A;  2DK5 A;  4Q48 A;  2EFN A;  4I0B A;  3V8J A;  5E17 F;  5DCM B;  4KFC A;  3PQK A;  2A68 F;  2MA3 A;  3LQR A;  2YX4 A;  1UHW A;  2MH2 A;  4GCV A;  2FOK A;  2EA4 A;  3QPH A;  1S3J A;  3BPX A;  1QGP A;  3BJ6 A;  3HSE A;  3GFL A;  2K27 A;  5L3E A;  5HLH A;  4ENM A;  3WGI A;  3GX4 X;  3LA3 A;  1PUE E;  2V1U A;  1GXQ A;  4UVB A;  5E1Z B;  3U1D A;  1DDN A;  1RNL A;  1XN7 A;  3F6O A;  1R58 A;  1IRG A;  3HUG A;  4Y15 A;  5LEK A;  4I09 A;  2P5K A;  1HW2 A;  3ZMV A;  4KNY A;  2MD5 A;  3E6C C;  4BYY A;  5E8G A;  4D0P A;  5K5Q A;  2HKO A;  2M87 A;  2CG4 A;  2DO7 A;  2MH9 A;  4DQ2 A;  2EV0 A;  5ILV A;  5H6Q A;  2HZT A;  4CGZ A;  2ISY A;  3R61 A;  2GXG A;  3KP2 A;  3F23 A;  3KP6 A;  2CSO A;  1KYZ A;  1P6R A;  4YIF A;  1QNT A;  1AOY A;  3KLN A;  1Z05 A;  1FSE A;  4OMY A;  1SD6 A;  2JTV A;  1T0F A;  2IA2 A;  3FM3 A;  4L9J A;  1IXR C;  1SD7 A;  4HQE A;  2K02 A;  4A0Z A;  3TO9 A;  3HSR A;  1R1U A;  4RGS A;  4PGG A;  5DD4 A;  1REP C;  3ELK A;  2Q2E A;  4P55 A;  5DUK A;  4MQ9 F;  1USS A;  4I2O A;  2VON A;  5K5R A;  4G9Y A;  4HDV A;  2PQ8 A;  1OPC A;  4Q47 A;  3DXJ F;  3WU1 B;  3N97 A;  1J75 A;  2LSO A;  4HA8 A;  1FOK A;  2D1H A;  5FB2 A;  2B0L A;  3N4M A;  3O2P E;  4WCG A;  2VXZ A;  5HDK A;  1P4A A;  1ONV A;  4EJU A;  4ESJ A;  1YYV A;  4L9T A;  3ZMU A;  3RKX A;  3K9T A;  3I5U A;  4KIG A;  3U2R A;  1QBJ A;  4L5J A;  1IN4 A;  1LDJ A;  4A5N A;  3M1E A;  4L9N A;  3ZQ7 A;  3F6V A;  4G94 A;  2RN7 A;  4ZZL A;  2JPC A;  2BGC A;  3F8M A;  3L2C A;  2M30 A;  3QU6 A;  2ZJ2 A;  4HZF A;  3RI4 A;  5LGT A;  5E20 A;  2FBK A;  3V7R A;  3W6J B;  3IWZ A;  3MQ0 A;  3PQJ A;  3HRM A;  5J8C A;  4L5I A;  1TQP A;  3K69 A;  3ABU A;  3DKW A;  1IAW A;  1OYI A;  4LD5 A;  4UVA A;  4ZH4 F;  4NB5 A;  1SFE A;  3FMS A;  4PGH A;  3ECH A;  3GXO A;  3JW4 A;  1UFM A;  5DD8 A;  3SHF A;  4HAM A;  4MHG A;  2ISZ A;  1ZRF A;  2XAF A;  4LG0 A;  3M8F A;  1BJA A;  4RS8 A;  2ACJ A;  3P7N A;  3VFZ A;  3L9F A;  3BZ6 A;  1R1T A;  2XVC A;  1SD5 A;  1KYW A;  4IRH A;  2YR2 A;  5LLQ A;  1G6N A;  2G7U A;  3KP4 A;  1QZY A;  1YLF A;  4CHU A;  2QZ8 A;  4HX8 A;  2L4M A;  4L9V A;  2FEZ A;  1MD0 A;  1SAX A;  1G3Y A;  1IF1 A;  5KVR A;  2K4B A;  3WE2 A;  5EEH A;  4XSZ F;  3PFI A;  1Z6T A;  2ZFW A;  2EV6 A;  4AWX B;  5EEG A;  3KFW X;  4MGR A;  5LHG A;  4IPA A;  4PDK A;  3TDU C;  2IVM A;  3K0L A;  4M73 A;  2LNB A;  4O6J A;  4R79 A;  4XRF A;  2V1D A;  1WI9 A;  4IRI A;  2J5O A;  4WWC A;  1YIO A;  3H92 A;  3T8R A;  3ZN1 A;  2NNN A;  2O6G E;  2PI0 A;  2PG4 A;  4M9S A;  1J5Y A;  3DFG A;  3J80 Z;  1J2X A;  1QZZ A;  3E5U A;  3S2W A;  5FLX Z;  3RYP A;  1G3W A;  4EJT A;  4HYE A;  2P8T A;  3P9I A;  3BOQ A;  1STZ A;  3HRS A;  2KJB A;  4HW0 A;  4WF2 A;  1SFU A;  3R6S A;  1ZAR A;  2GWR A;  3SZT A;  5FO5 A;  2O03 A;  3GO5 A;  1ZHF A;  3K1P A;  3ECO A;  3DPL C;  3MAJ A;  2JT1 A;  4CDG A;  1D8K A;  4RB1 A;  2GAU A;  2OA4 A;  5K1Y A;  3V7C A;  1K78 A;  2OQG A;  4NQW A;  1ZG3 A;  5LRS A;  4BH9 A;  2M1B A;  5H6R A;  2EWN A;  4L18 B;  3J81 K;  4IVN A;  3TQN A;  1TLH B;  1XD7 A;  2X4H A;  3MZH A;  3RKY A;  1MDM A;  3C1D A;  1BI3 A;  4EJV A;  4ON0 A;  5TRD A;  1WRJ A;  5ICF A;  4CO8 A;  3T5X A;  5K5O A;  3EYY A;  3K1N A;  1TNT A;  4A6E A;  2RNJ A;  3C18 A;  4HLY A;  2HQN A;  4GGG A;  2KIM A;  4MNU A;  2GQQ A;  5AIP A;  1W5S A;  2Q8K A;  2W85 A;  2IPQ X;  4KIB A;  1LQ1 A;  5ILU A;  5HS7 A;  3G3Z A;  2VBY A;  3CLO A;  4RAY A;  3DPT A;  2BEO A;  4OU0 A;  1TTY A;  1UHM A;  3MCZ A;  6PAX A;  3ZPL A;  1J9I A;  1LJ9 A;  1QQI A;  4CIC A;  2H94 A;  1PP8 F;  1L3L A;  1EH7 A;  4BXU A;  1F4K A;  2OBP A;  1H0M A;  3V8L A;  2QM3 A;  2L4A A;  2Z99 A;  1CGP A;  3EDP A;  2DW4 A;  4RAZ A;  2AXL A;  3IL2 A;  2BBY A;  3KEQ A;  2AS5 F;  4EM2 A;  1P92 A;  5JVT A;  1U5T A;  5CVI A;  2FA5 A;  1R36 A;  1WKM A;  1KQ0 A;  3ZN0 A;  3KZY A;  1G3S A;  4BNC A;  2PMH A;  5HS9 A;  2GZW A;  2XUB A;  5IT3 A;  1O3R A;  5LBQ A;  1P4W A;  1RI7 A;  1WQ2 A;  1IN8 A;  1O7L A;  1BN5 A;  2HS5 A;  3IKV A;  2PLY A;  5CVJ A;  3F72 A;  3I64 A;  1RIO H;  5IT9 K;  1V4R A;  3KE2 A;  2ELH A;  2ZNZ A;  3F8C A;  1LVA A;  4LG0 B;  2KRF A;  2PFB A;  4YG2 F;  3R60 A;  1FZP B;  5FD6 A;  1SMT A;  5L3G A;  3GZ6 A;  3TKY A;  5F64 A;  1P2F A;  2HOE A;  4EM1 A;  1U2W A;  4A2U A;  2RVC A;  1I27 A;  2DFI A;  5D8K B;  3FWE A;  2H6B A;  4M6Y A;  2W84 A;  4JK1 X;  2FMY A;  4M9Z A;  2HR3 A;  3HIF A;  3TO7 A;  4ESB A;  3K1M A;  4P9U A;  2JRT A;  2HQR A;  2QWW A;  3J81 Z;  2HYF A;  1HXD A;  1QO0 D;  3WGG A;  3ABT A;  1XSD A;  2FXA A;  4A0Y A;  1XMA A;  1EV7 A;  5D6E A;  2O61 A;  3I54 A;  3BPV A;  1Z1D A;  2JPB A;  4WK8 F;  4S05 A;  4FX0 A;  1I1G A;  2DLL A;  3FM5 A;  3DV8 A;  3M8E A;  3WTS C;  1XCV A;  1IN7 A;  2CWE A;  3HRU A;  4OIR F;  3DEU A;  1O3Q A;  2XRN A;  4LLN A;  4G6D A;  2D2W A;  4U0Y A;  4KN4 X;  3LAP A;  2PJP A;  4P96 A;  1B9M A;  2KJC A;  1R5H A;  1HW5 A;  1R1V A;  3CO7 C;  2FRH A;  3B02 A;  4ZYD A;  5D5W B;  3TO6 A;  2NYX A;  1JGS A;  2NS0 A;  2OU2 A;  1W5T A;  2CQK A;  1HSJ A;  4QLC U;  1RUN A;  3C3W A;  3BY6 A;  1MJ9 A;  2DAO A;  1JE8 A;  1IRF A;  1YS6 A;  2L3D A;  1B6A A;  2K7L A;  4FX4 A;  4M71 A;  2OZ6 A;  5FD5 A;  3K2Z A;  1S29 A;  3QAH A;  1G3T A;  2F5E A;  3NQO A;  3RYR A;  1U3E M;  5HDN A;  3GLX A;  4A5M A;  1K78 B;  3M7G A;  4OMZ A;  4AIK A;  4ZYE A;  5LEJ A;  3E5Q A;  1MDM B;  3O6B B;  4AD9 A;  2STW A;  1NHA A;  2LKP A;  4UHT A;  2ZCW A;  2OZU A;  5IT9 Z;  1OYY A;  2IA1 A;  3FXU A;  4LB6 B;  2VOP A;  1V3F A;  4XLP F;  4OIO F;  1HKS A;  2VC0 A;  2Q0O A;  4HF0 A;  1YQA A;  5LRR A;  3HTU A;  1IXC A;  3J7A O;  3ERE D;  4YFN F;  4LLG F;  3DF8 A;  3MFK A;  5CVU A;  1OMI A;  4HX7 A;  4G7H F;  2QLZ A;  2DTR A;  4PCQ A;  4UV9 A;  1JXS A;  3Q5F A;  4CYD A;  1Z9C A;  2A69 F;  1BC7 C;  2VC1 A;  3TOA A;  5L3B A;  2WWY A;  1FX7 A;  5D5X B;  1HST A;  2QYO A;  1LEA A;  4ZZD A;  2X0L A;  3F22 A;  1R7J A;  5ILS A;  5FGM A;  3KEO A;  4Y13 A;  2DT5 A;  2IP2 A;  3TGN A;  1KA8 A;  2MC3 A;  2RGV A;  3F8N A;  2KKO A;  4CXF A;  4UXN A;  2DK8 A;  4G7Z F;  3GYH X;  4O5V A;  3AAF A;  5J8F A;  4TV7 A;  2VOD A;  2GIV A;  2DQL A;  3QOP A;  1W4M A;  1U5T B;  5J6X A;  5BPI A;  3BDD A;  3RTR A;  2QQB A;  3GW2 A;  4UUV A;  4RB0 A;  3ZMD A;  2WC2 A;  3HRT A;  5LHI A;  2COM A;  4YFK F;  1IN6 A;  3O3K A;  4I02 A;  1T98 A;  3E5X A;  2Y48 A;  1ZLK A;  1G4D A;  2V1X A;  3JTH A;  3GFI A;  1ZGJ A;  5D4S A;  3R0J A;  2K86 A;  5D5V B;  3I58 A;  4MTE A;  4EGZ A;  4GO1 A;  1TW2 A;  1U78 A;  4A0X A;  4RGX A;  2GA1 A;  3M9A A;  5BS6 A;  3QP5 A;  1WWX A;  2HFH A;  2ZBK A;  2XV4 S;  2HWV A;  3SXY A;  4KUM A;  1IW7 F;  2R7F A;  1TQM A;  2UZK A;  2H6C A;  2VT3 A;  4U88 A;  3SQN A;  2O3F A;  5JFR A;  5HLI A;  2FML A;  4UV8 A;  3CJN A;  4HF2 A;  1K79 A;  2C6Y A;  1FYK A;  1T2K A;  5A2Q K;  4Q5S F;  3LA2 A;  2D45 A;  5TJJ A;  3Q9V A;  5DUI A;  4HDU A;  1D3Y A;  4KYW A;  1F1Z A;  4OOI A;  3TDZ C;  5D6F A;  1PDN C;  5BPD A;  3R4K A;  2EA2 A;  3WOD F;  3I71 A;  2QQ9 A;  4I0A A;  3FMQ A;  4LB5 A;  3BWG A;  4LGW A;  3F8B A;  5JI6 A;  3QU3 A;  3VEP A;  2MLG A;  3GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...