1YG2A

Structure of the vibrio cholerae virulence activator apha
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
169
Chain Sequence
SLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELNKMGEQGLVTCVLEVYSITQAGRSALGEWFDQPTAHPTVRDEFSAKLMACSVQSAEPYRLQLAELVEESRKLVAHYQEIEAAYYANPAVLDKQQRLERLTLRRNLLVRQAWIQWADEVLAELNAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the virulence gene activator AphA from Vibrio cholerae reveals it is a novel member of the winged helix transcription factor superfamily
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transcription
molecule keywords gene activator AphA
total genus 64
structure length 169
sequence length 178
ec nomenclature
pdb deposition date 2005-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
A PF10400 Vir_act_alpha_C Virulence activator alpha C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yg2A01
4XBFA 2HDCA 4M9XA 5LHHA 2YU3A 1QNTA 2K86A 2H27A 1T98A 1P6RA 1B9NA 1O3SA 3E5QA 2JTVA 4A2UA 3MWMA 3T0YA 3ZMDA 3WU1B 3I0TA 3D5LA 2DBBA 4WX9A 2XAFA 1R36A 5JI6A 4PGHA 3N4MA 2P8TA 2FNPA 4IRGA 4LFUA 1K78B 4KN7X 3DFGA 1O7LA 1NHAA 2QLZA 2HR3A 4Q4ZF 3ABUA 2X4HA 4N0BA 3DEUA 4OIQF 5LRRA 3H3UA 2QBYA 3MZYA 4CHUA 4YG2F 3KP4A 4BQAA 3FMQA 4HX8A 1XGNA 2MC3A 1XSXA 1P2FA 5IT3A 4P9FA 2YX7A 1W5SA 3I4PA 4EM2A 2DO7A 2EB7A 1QZYA 5H6QA 1KQ0A 2NRAC 3V8KA 2YR2A 2CG4A 4ESFA 3JTGA 4UUVA 4N9HA 2CYYA 3I59A 2RV8A 5IT9K 1D5VA 1IAWA 6PAXA 4LD5A 3ECOA 1ONVA 1FBUA 2OBPA 1QO0D 1RI7A 3U2RA 1UCRA 2Y0MA 4U88A 4HV5A 2H94A 4FX0A 1MJBA 4EGZA 4PGGA 3MFKA 2XVCA 5L3GA 1TW2A 5HDGA 1OPCA 2UWMA 4RGXA 2IVMA 5F6FA 3QP5A 5IT9Z 3PFIA 2CO5A 3GFIA 3Q5FA 3F8BA 3LA2A 2BYVE 1Q1HA 5D8LB 2RQPA 4KNYA 2XV4S 2BEOA 2CGPA 1U5TC 3CDHA 1HQCA 2RDPA 3DPTA 3P9KA 5BPDA 2QENA 3GZ6A 1KQ8A 2FSWA 3BPXA 3F23A 4MEYF 1MJAA 2M8EA 4UNOA 3LA3A 1J7KA 5ICEA 3LAPA 3T8RA 1SD4A 3AAFA 1YFHA 5CVVA 3FX3A 3TKYA 4M74A 2DQLA 1I27A 4BNCA 4KIBA 2D45A 5DUKA 5D5VB 3WGHA 1EH6A 3IKVA 1CF7A 2ELHA 4EJUA 2FBIA 2V1DA 4TV7A 4M9ZA 3TO6A 3JW4A 2MD5A 2YSRA 4I09A 3NEUA 5LGUA 4RS8A 2DPUA 3VFZA 1SMTA 2QZ8A 4G6QA 3C7JA 1OMIA 1JXSA 5CJ9A 4Y15A 4GGGA 5ED4A 3W6KB 2NNNA 1XSDA 1R22A 2EA4A 3ZMVA 2WTEA 3IRRA 2DT5A 2V1XA 3MZHA 4KYWA 2IJLA 4ENNA 3JTHA 2FOKA 4E70A 1B1BA 3REOA 1ZH5A 1K78A 2EV6A 2JSCA 4KIGA 3ZMTA 2PMUA 4UVBA 2EV0A 2X0LA 3F8CA 4KUMA 4ESBA 1KQ9A 4DQ2A 5D4SA 1R00A 2HEOA 2MH2A 3Q9SA 2HS5A 1XSVA 4LK0F 5AIPA 3KCCA 2M1BA 2MLGA 2C6YA 2UXXA 4LGWA 3F8MA 1YLFA 5LRSA 1DPUA 3V8JA 4WXHA 4OIRF 2NAZA 4I7HA 3V7RA 1IN8A 3M7GA 2EJRA 4RB3C 1FBQA 2IA1A 1J59A 3G3ZA 1BI0A 3O6BB 1RUNA 3I53A 3KP6A 3R6SA 3K0LA 1FLIA 3QAHA 3WE3A 2XAGA 1XD7A 2RGVA 2PG4A 4ZYEA 3EDPA 4U0WA 1CF7B 4IXAA 1KU3A 5BPIA 4RGUA 2ETHA 4L9NA 2CW0F 2RVCA 2XAQA 2KJCA 5TJJA 2FQ3A 3J7AO 1SD6A 4WCGA 4CYDA 4RAYA 1SD5A 2VBZA 1HKSA 4JBAA 3BP8A 2GIVA 3F3XA 3BWGA 1OYIA 3HIFA 3GUDA 3FM5A 4ZYHA 4KIFA 1D3YA 1ON1A 2L54A 1EH8A 3KP5A 1JHFA 4FX4A 1O3RA 3U1DA 3ZN1A 2J5OA 1IRFA 3GFJA 2OD5A 3K9TA 2BV6A 1L0OC 2PQ8A 1R5HA 3I54A 3E6MA 1DDNA 5CVJA 2L4AA 2M87A 4CXFA 1Z1DA 2ESNA 5LHGA 4IPAA 2P6SA 2IP2A 3BJAA 5HDKA 1ZREA 2RN7A 1QBJA 2HWVA 5E20A 3E6BA 2EWNA 4HLXA 4Q48A 4U0VA 2D1VA 4EJWA 4MEXF 4U7DA 4I2OA 4AWXB 1KU2A 3GYHX 4IF4A 3HRSA 4NHJA 3IHUA 2QQBA 1UHMA 2BE5F 3GO5A 2XKOA 4M72A 1YQAA 2JPCA 4OU0A 2UXNA 5H20A 1YS7A 2RNJA 1T38A 3J81K 2EA2A 3G73A 2EFPA 4ZYGA 4UV9A 3EUHA 4OIOF 2XAHA 1Z6TA 1K79A 2VT3A 5E1XA 2TDXA 1UB9A 3EQLF 3DQVC 4N9IA 4KFCA 2O6GE 3GW2A 3IL2A 4D0PA 4HF0A 5DD8A 2EFQA 3WODF 1D8KA 3CO7C 4AIJA 1ZG5A 4QWQA 3CUQB 4A0YA 1U8RA 1SFXA 1ZARA 1S8NA 3T8TA 1XMKA 1ZG1A 4BYYA 4R79A 5F64A 3WE2A 1LEBA 1IXCA 3RKXA 3R0JA 1S7AA 2OAZA 2Z3YA 4HF2A 3MAJA 3B73A 3M9AA 1IRGA 1PDNC 2XUBA 2IT0A 1P92A 2IRFG 4HYEA 2E7WA 1DUXC 5E8GA 1BIAA 4LJZF 5DV5A 4A6EA 3C18A 3QPHA 2ESHA 2Z99A 2EFNA 3RJPA 2XASA 2QYOA 4MTEA 4OOIA 3WTVC 3T5XA 2DW4A 5L3BA 1WQ2A 1W7PA 2L01A 3FXUA 4EMSA 2G9WA 3I71A 2LKPA 1S3JA 1I6XA 1YO5C 1T2KA 1DP7P 1O7FA 3HYIA 2A07F 3W6JB 4FT8A 4AVPA 3HOSA 2ZNYA 4GCVA 2HYGD 3M8FA 3ELKA 4LMYA 2FBKA 3N97A 1O3QA 1Z05A 3GFMA 2GZWA 4IRHA 3TQNA 5HS9A 5AIQA 1FSEA 3BJOA 1ZGAA 1LVAA 1XMAA 1QQIA 1XCBA 4KT5C 1XCVA 3WTYC 1REPC 2P5KA 1U5TB 2ZXJA 4S04A 5ILSA 3T1BA 2JZYA 2W24A 4A0ZA 3COAC 5LGNA 1HW1A 2FMLA 4DNCA 2ZBKA 5ERIA 1TNTA 2E1CA 3P7NA 3QOPA 2Y75A 5LBQA 2Q0OA 1HW2A 2J5PA 1CGPA 1ZG3A 3I59B 4G9YA 4MQ9F 2DAOA 4B09A 1Z6RA 2Z33A 3FF5A 2VBXA 4Q5SF 2OZUA 3GFLA 1WWXA 4BHPA 1W7PD 4MQVA 2EV5A 4G8XA 3CUQA 1STZA 4HDUA 1BC8C 1O57A 4KICA 1ZAOA 1HSTA 1LJ9A 3FMSA 3LAJA 1IF1A 1R23A 1R5GA 5D4RA 5ICFA 1O3TA 4GXOA 5D5UB 2QBYB 2V9VA 4XSXF 3TGNA 3HSEA 5CLSA 3E6DA 1LDKB 5HLGA 4ETSA 1HKTA 2M30A 3F6OA 2PFBA 3BZ6A 3C3WA 2VBYA 3GLXA 3IWZA 4UVCA 4HDVA 1XB4A 3BDDA 4G7HF 2WC2A 1I5ZA 2L4MA 5ICCA 4L0ZB 2IW5A 4I0AA 1RZ4A 2HGCA 2LNBA 3L9FA 1ZHFA 3PQKA 4GYGA 4MTDA 3LFKA 3BOQA 4L9VA 2Z5UA 3ZQ7A 3HRTA 2UZKA 3S2WA 4CICA 3RI4A 1KYZA 4ZZLA 1YTYA 5L3CA 2EFWA 2M5WA 3QU3A 2LF7A 2M45A 1OYWA 3KP7A 1P4AA 1XN7A 4LG0A 3IWFA 5EEHA 1FOKA 1IXRC 2H6BA 5D8KB 2GA1A 3OOPA 5J8CA 4M9SA 1ZRDA 3K69A 2IA0A 1IXSB 1TNSA 3I58A 3ISPA 3WGGA 5HOOA 3K1NA 3HHGA 1T39A 2A6HF 1JE8A 1TQIA 1LEAA 1TW3A 2HKXA 4HQEA 1AWCA 4L5IA 5FFZA 1W7PB 3EYYA 4I02A 3LA7A 4WF2A 1B59A 5D6EA 4RAZA 5CVIA 1LDDA 3JSPA 1HKQA 3VODA 3JAMZ 2MLKA 2K27A 5LLQA 4CO8A 2RKHA 4M6XA 5HDNA 2O61A 1HSJA 3CUQC 2VXZA 2YPRA 1ULYA 3ZMSA 1F1ZA 2K4BA 1HXDA 5TRDA 1R7JA 2KKOA 4HZFA 2NYXA 5L3EA 2PMHA 4ESJA 5FO5A 4ZZDA 1KGSA 4LG0B 1EV7A 4XSZF 2CQKA 1BN5A 4M71A 4BHCA 3J81Z 1BI1A 3O3KA 3CLOA 4P5OA 1FY7A 3U9GA 2VOPA 1YS6A 1BOAA 3K1MA 3WG9A 2F2EA 1ZLKA 5AONA 1H9TA 3R4KA 5DCMA 4RB0A 4G94A 1MD0A 2FU4A 1IN7A 2ZO4A 1D8JA 2K7LA 3CTAA 4U7BA 3FWEA 3FZVA 4RGSA 2FA5A 3E5XA 2B0LA 4I01A 1G3SA 3QP6A 2XKPA 1TBXA 4XLPF 4ZH4F 5DCMB 1FNNA 5DUIA 2BBYA 4EVIA 4LK1F 1WI9A 2XGXA 4ENKA 1XGMA 4MHGA 4YFXF 1HW5A 3QPTA 4BHBA 3J80K 2QM3A 3B02A 4I0BA 1WRJA 1MDMB 5FLXK 3E97A 1K6OA 2FE3A 3F72A 4R8HA 2PN6A 4M73A 2HTSA 4QLCU 3HRMA 3OV8A 2KRFA 2FRHA 3CJNA 4HOBA 3LWFA 3KEOA 4HLYA 5HLHA 2NNYA 1OKRA 1XDSA 3LQQA 5FD6A 3KETA 5L3FA 1JHHA 1ZGJA 4YIFA 4EM1A 3BPVA 2HQNA 1E17A 4K2EA 3VOEA 2K4JA 2FMYA 3RTRA 2A69F 1BM9A 1T0FA 1GHCA 4HW0A 5JR3A 2ZMEB 5DYMA 2NS0A 3L2CA 1FX7A 2A5YB 3GVAA 4KA4A 5KK1A 5CVRA 2AS5F 4P55A 4A5MA 1FYKA 1B4AA 2DU9A 1ZYRF 2PI0A 1MDMA 1G3YA 4OINF 2D1HA 3FM3A 5D5XB 1Z7UA 3LQRA 1I1GA 5LEKA 3HSFA 3WTZA 3KLOA 1PP8F 3Q9VA 2AXLA 4M6YA 4P96A 2KIUA 4ENMA 1BBYA 3D0SA 4UXNA 3DXJF 2A6EF 2IPQX 1FYMA 3LSTA 1FYLA 5F1RA 2CWEA 5HVQC 2VE9A 4IRIA 3K1PA 3E5UA 1Y0UA 4NQWA 3F21A 2XAJA 3DKWA 2ZKZA 2F5EA 1IW7F 5HS8A 1ODDA 3GZ5A 1H0MA 1XGSA 5K1YA 2FBHA 3FHZA 3TO9A 1UFMA 1R58A 5BOXA 1IN4A 5EEGA 3KP3A 3BY6A 4YFNF 4S05A 2ZNZA 3WTTC 4G7OF 4OMYA 1IN6A 1BC7C 2A3SA 5LGTA 1UHWA 2OA4A 3PQJA 2DK5A 1J5YA 2Q8KA 2A61A 3SQNA 3KP2A 3F22A 2GA2A 4WK8F 4Z2YA 3HUGA 3FXRA 4UVAA 1U3EM 3K2ZA 5FGMA 3DPLC 2LSOA 4HV6A 3ZPLA 1S7OA 2G7HA 2GXBA 4L5JA 5LHIA 3WTWC 1Z91A 3TO7A 1K7AA 2QUFA 3KLNA 4KMUX 1EH7A 4CGZA 3QRFF 4L9JA 1YW8A 4ZYDA 2H6CA 2HKOA 1SFUA 2OQRA 2O03A 2HFHA 3TOBA 3I5UA 4OMZA 2P6TA 1IN5A 1GXQA 1FZPB 5BS6A 2R7FA 4WXCA 4Y17A 4EQQA 3QU6A 2ZFWA 2OU2A 1MKMA 4G6DA 4EV0A 1B9MA 1BIBA 2STWA 3FMRA 2W57A 5A2QK 4U0YA 5KVRA 4WXDA 4MNUA 4XLNF 3WTSC 3BROA 1TLHB 3RKYA 5FD5A 2IA2A 2YX4A 3SXYA 4ASNA 2P5LC 4HX7A 1F5TA 2HOEA 2VBWA 3P9CA 2VE8A 2DLLA 4A12A 2GAUA 2LF8A 4GYIA 1S29A 5E1WA 3SZPA 5D5WB 1IZ1A 1G3TA 3RDIA 4IHSA 1F4KA 2ISYA 2P4WA 2HQRA 3ERED 2DQRA 2VC1A 2WWYA 1G3WA 2F5FA 3ML6A 1S6LA 4EJOA 1U6GA 1A04A 3GF2A 3RPQA 1B6AA 2HZTA 4F7ZA 1QPMA 2L02A 3KEQA 3SZTA 4HA8A 2V79A 1Z9CA 1JGSA 2O0YA 3VB2A 2VN2A 1HBXG 1FP1D 4G7ZF 1KYWA 1J9IA 4EJTA 1FWZA 4L9TA 2Q2EA 4O3MA 1VTNC 4A5NA 4KN4X 1KA8A 3DV8A 1YW9A 3H92A 3R0AA 2ISZA 2ZJ2A 5LEJA 3EETA 5ILVA 4HX4A 3SFZA 1TQMA 1V4RA 2VC0A 1L3LA 1GVJA 1ZRCA 5K5OA 2VODA 1YW7A 1LDJA 1RIOH 1PUEE 3GXOA 4B8XA 4JK1X 2XIGA 4ENJA 1QZZA 4BH9A 5E8IA 4LLGF 4HBLA 5A2QZ 4HAMA 1SFEA 1X3UA 4UHTA 2STTA 2QWWA 1ZLJA 5DCFA 2FNAA 4XRFA 5D6FA 2FXAA 4WWCA 1OYYA 2P7CB 3VEPA 2HYFA 2P7VB 5K5QA 3F8NA 2Y48A 1LB2A 2DK8A 1XGOA 5E1ZB 4Y13A 1KU7A 1TTYA 2BGCA 2V6CA 2PLYA 3EYIA 2O3FA 2HTJA 3R60A 1YYVA 2G7UA 1F9NA 4A6DA 4RB1A 4L18B 3E6CC 4KMFA 3NRVA 5DEQA 1C0WA 4P9UA 4UV8A 4OIPF 3V7SA 3BJ6A 3O2PE 5J6XA 1DPRA 1MJ9A 4EJVA 2PEXA 4Q47A 1FC3A 1XDUA 1FP2A 2XHKA 2W85A 2DPDA 1IUYA 4MGRA 1J75A 5JFRA 4O6JA 3ECHA 2LDUA 4O5VA 3E3VA 3WTXC 1USSA 1ON2A 3MEXA 1U5TA 3WU0A 1G4DA 2VONA 2MBFA 2OZ6A 2VT2A 3DP7A 4AD9A 1RUOA 1P4WA 3GEZA 5FFXA 3V4GA 1J0RA 2VOOA 1G6NA 3HOTA 5JVTA 4IVNA 1BI3A 3WTUC 3M1EA 4BXUA 3MQ0A 1KU9A 1MZBA 3NQOA 4NB5A 2PBIA 4IHTA 1TQPA 3L09A 1MGTA 2DFIA 4IJAA 1FSHA 2RC4A 3L00A 3CUOA 2CFXA 1T6SA 2EK5A 1BJAA 1WKMA 2F5DA 3ZN0A 2XRNA 4LLNA 3V7CA 2WV0A 3TDZC 1PP7U 5BMZA 4YFKF 1R1VA 1SD7A 5HLIA 1ZRFA 2ADUA 4L0YB 4H0EA 1GXPA 5FLXZ 4CZZA 3HSRA 2Z9OA 1E2XA 4FHTA 3IC7A 4YIIA 3IRQA 3RKWA 1H9GA 3KFWX 1RNLA 3P9IA 2FEZA 2ZCWA 4JQFA 1YIOA 2JT1A 1U78A 2K02A 1USTA 2DTRA 2QQ9A 2R7DA 3TOAA 1FPQA 1YG2A 3GWZA 1R1TA 2KIMA 4PCQA 2CSOA 3ZP5A 1P4XA 4PDKA 3TDUC 3RIRA 3ZMZA 1WSUA 2COMA 3IKTA 3V8LA 4A0XA 2EFOA 2MH9A 5DD4A 3F6VA 2GWRA 2W25A 3M8EA 2A68F 1OR7A 3CO6C 2QVOA 1FBSA 1V3FA 1J2XA 2P5VA 1W5TA 2FF4A 4EM0B 2MA3A 1R1UA 3ULQB 2ZMEA 2KIFA 2JPBA 4RGRA 5FB2A 4HF1A 1ZN2A 1LQ1A 5E17F 2W84A 3HTUA 2D2WA 2GQQA 5HS7A 2OQGA 3C1DA 3GX4X 3KZZA 4RB2C 4ON0A 4BAYA 5BQTA 3ROUA 2PJPA 3SHFA 2R3SA 2E7XA 2DI3A 4CDGA 5DDGA 5J8FA 1QGPA 4HQMA 4I98B 2L3DA 1SMYF 5H6RA 3F8FA 2O8XA 2JRTA 3FXQA 1I1SA 3WGIA 1W4MA 1SAXA 2GXGA 3RPUA 2KJBA 4LB5A 3KZYA 2H09A 4GO1A 2QQAA 3HRUA 5ICGA 5JHUA 1AOYA 2F5CA 4AIKA 5L3DA 1U2WA 3KE2A 5CYVA 2E1NA 3J80Z 3RYRA 5K5RA 5E18F 2V1UA 3ZMUA 4LB6B 3JSOA 3L7WA 2ACJA 1LNWA 5CVUA 3MCZA 3HTSB 4EGYA 1FT9A 3DF8A 1BI2A 3I64A 3H3ZA 3HHHA 4AIHA 4PZJA 3RYPA 3JAMK 4LLLA 4R1HA 4KDPA 5ILUA 2XROA 3R61A 3ABTA
chains in the Genus database with same CATH superfamily
2R7ZJ 4XBFA 2XSJC 2EIJH 2DMTA 2BW3B 2HDCA 4M9XA 3ZGKA 5LHHA 2UV1A 2K3FA 2L7MP 2YU3A 1XS9A 2LREA 5KHDA 1QNTA 3LNQA 2HI3A 2K86A 3AFHA 2AXTC 1PUFA 2H27A 2ECBA 1T98A 1P6RA 2VXDA 1TL8A 1PYVA 3OIOA 1B9NA 1H8AC 4II3A 5FKNA 1O3SA 2JQ7A 3E5QA 4D7MA 2JTVA 4A2UA 3KYCB 3MWMA 3T0YA 3ZMDA 2VKHA 3IUOA 3I0TA 3WU1B 3D5LA 2DBBA 4FASD 4A3KJ 1YJ9I 1Y56A 4WX9A 2XAFA 3IH4A 3EUHC 1K4TA 1R36A 5JI6A 1QZEA 1IDZA 3JRIA 2R93J 3BCAA 4I76A 4PGHA 3N4MA 3D5RC 2P8TA 2FNPA 2CUFA 4IRGA 4CCLA 2K5CA 4DYQA 4LFUA 1K78B 3ZQGA 4F93B 4KN7X 1DGWY 1SVLA 3DFGA 5C44J 1O7LA 1NHAA 2QLZA 1YI2I 2JA5J 1TZLA 2HR3A 1SC7A 2M4KA 4Q4ZF 3ABUA 2X4HA 4N0BA 2KISA 3DEUA 4OIQF 4GFBA 1OJLA 1TWCJ 5LRRA 3OSFA 3H3UA 2QBYA 3MZYA 2ZC2A 4CHUA 2LY9A 4XNFA 3KP4A 4I99C 4UB6C 4YG2F 3FMQA 4BQAA 3CQZJ 4HX8A 4NC7A 2NXNB 1XGNA 1RKWA 2MC3A 3OS0A 1XSXA 1P2FA 5IT3A 1JTYA 4P9FA 2YX7A 1W5SA 3I4PA 3PUFA 4EM2A 2DO7A 2EB7A 4RLQA 1Z0XA 1QZYA 5H6QA 3G1OA 1K61A 4XKBA 5IOZA 1D1CA 1KQ0A 2GOXB 5CQEA 1VQKI 2NRAC 3V8KA 2CH0A 2YR2A 2CG4A 5J3LA 1W1WE 4ESFA 2NOGA 2RQQA 1WFXA 1IGNA 3OR2C 1WJ5A 3JTGA 3HOWJ 5J40A 3E0JB 4UUVA 4N9HA 1G8XA 2CYYA 3LSPA 3I59A 2RV8A 5IT9K 4IQJA 1D5VA 1IAWA 6PAXA 4LD5A 3D5SC 5EF6A 4IQ4A 3W2AA 3ECOA 3RSNA 1ONVA 4M3GA 1FBUA 3ZRGA 4ZDOA 1AKHB 1YIJI 3PSIA 2OBPA 1QO0D 1RI7A 1Y8QB 2F6CA 3U2RA 2ME0A 1UCRA 1X19A 2Y0MA 4HV5A 4U88A 3OYNA 3W6VA 4E7JA 2H94A 4FX0A 1MJBA 4EGZA 5E3NA 4PGGA 3MFKA 1VQMI 1YHQI 2HZDA 4MFDA 2XVCA 4F91B 5L3GA 3DKYA 1TW2A 5HDGA 5TGTA 2JWTA 2CQXA 1OPCA 3GTKJ 2EIMH 2UWMA 5J1RA 4C2MJ 2E2JJ 2ME6A 4PK4A 1TWHJ 3JR9A 1WZ2A 2V9KA 1ZK8A 3FKIJ 4RGXA 2CUZA 1WGXA 3DEEA 2IVMA 5F6FA 3QP5A 3OWTA 4B3AA 5IT9Z 2DT6A 4FE4A 3PFIA 1BR4A 2CO5A 3GFIA 3Q5FA 3F8BA 1VZ0A 3LA2A 2DA5A 2BYVE 1Q1HA 1X1DA 3CC4I 4P1WA 3S15J 5D8LB 4LITA 3DTIA 4JYKA 2COBA 2RQPA 2UUZA 3CLQA 1D1BA 1I3QJ 4KNYA 1ETYA 2XV4S 2BEOA 2CGPA 4Z6YA 1EF4A 1U5TC 2ZXIA 3K70C 2VJIA 3CDHA 3RKQA 1HQCA 4DW6A 3FBIB 2RDPA 2JA8J 3DPTA 3P9KA 5BPDA 2LKXA 2QENA 3HOVJ 3GZ6A 3GTQJ 2FSWA 1KQ8A 1DQUA 3BZKA 3BPXA 2CV2A 3F23A 4MEYF 1MJAA 2M8EA 4UNOA 3LA3A 1J7KA 5ICEA 3PM1A 3LAPA 3T8RA 4ZDLA 1GUUA 3EPZA 3FISA 1SD4A 5GP9A 1UG2A 3AAFA 1DP3A 2L9RA 2LR8A 1YFHA 4ZC3A 5CVVA 3FX3A 3TKYA 2HQAA 2ICWG 3I4MJ 4N4OB 3KYDB 4M74A 2VQGA 4LIUA 2CMPA 3M3YJ 2DQLA 1I27A 4A3IJ 2CJJA 4XQFA 1AHDP 2D5VA 4KIBA 4BNCA 2D45A 1VQ6I 1D0YA 5DUKA 5D5VB 1MH4A 3ABLH 4YELA 5DTDA 3WGHA 1EH6A 3B6AA 3IKVA 5LFAA 2AO9A 1CF7A 2O9LA 2ELHA 2V7FA 2IGOA 4EJUA 2FBIA 2V1DA 4TV7A 4M9ZA 1OCZH 3TO6A 3MKZA 3OL4A 3K2AA 2MC4A 3AL0C 3JW4A 2MD5A 2AHQA 4Y7NJ 2YSRA 1FMVA 3NEUA 4I09A 4F52A 5LGUA 4RS8A 3OYGA 2DPUA 3VFZA 2JA6J 2LVSA 1SMTA 3DBHB 2QZ8A 4G6QA 3C7JA 1LFBA 1HCRA 1A36A 2BZTA 1NG6A 1G59A 1OMIA 3IAM2 3LSIA 1JXSA 5CJ9A 5M5WJ 4Y15A 4GGGA 4LIVA 5ED4A 5FRNA 3W6KB 2X6WA 2FOWA 2NNNA 1XSDA 1R22A 2EA4A 3BG6A 3ZMVA 2WTEA 4B48A 4HPQA 1ETQA 3NWSA 1JKRC 3IRRA 3H0GJ 2DT5A 3BCBA 5B3SH 3BZCA 2V1XA 1HF0A 2VASA 2XPUA 1Q1VA 4B44A 2H1LA 3BR2A 3MZHA 1VQ5I 4KYWA 3S1QJ 3K4CA 2R4GA 2IJLA 4ENNA 3QYBA 1XTAA 1CQTA 2KL4A 4E7IA 1WJEA 3MKWB 3JTHA 2VJ4A 2FOKA 1SEUA 3BQZA 5J1UA 4E70A 2OUMA 4PJLA 1B1BA 3REOA 1ZH5A 3HXLA 1K78A 2EV6A 2DODA 1NK3P 2X1EA 2JSCA 3JRBA 4KIGA 3ZMTA 4C2TA 3Q0VA 2PMUA 4UVBA 3BLYA 2LKSA 1JJ8C 2EV0A 2X0LA 3F8CA 4BQQA 4KUMA 4ESBA 3UKGA 1KQ9A 4DQ2A 5D4SA 4RDUA 3DU5A 1Y8RB 1R00A 2HEOA 5M3MJ 1MMGA 2MH2A 3Q9SA 4HNUA 4M6VA 4YRVA 2DCEA 2HS5A 1XSVA 4YIRX 4LK0F 5AIPA 3KCCA 1S9HA 2M1BA 2H8WA 1FJLA 2NVYJ 2MLGA 1FTTA 1A35A 3S1MJ 1P7IA 2UXXA 3PNVA 2C6YA 2VQLA 2DMQA 2JVGA 3S14J 2BW3A 3S8PA 3CP8A 4XKWA 4XIDA 4LGWA 4PJNA 4BEHB 2O5RA 1YLFA 3F8MA 5LRSA 4BQOA 1JGGA 1DPUA 3I4NJ 2XPVA 2A6TA 3V8JA 2R7VA 4WXHA 5EGOB 4JX6A 4OIRF 1FIAA 3JRDA 3LOCA 2NAZA 2DT7B 4I7HA 3V7RA 1HC8A 3L2VA 3LSGA 1IN8A 4W97A 3FXMA 3CJQB 3M7GA 2M34A 1W36C 2L7KA 2X6OA 2EJRA 2QCOA 5GTIC 2W82A 1N25A 4BBSJ 1IO2A 4RB3C 4XLAA 1FBQA 4FISA 5CPRB 1R9TJ 1I50J 2IA1A 4AYBA 3S3NA 3BR6A 3H35A 2IXSA 1J59A 4A3GJ 5M3FJ 3G3ZA 1R6RA 3OYIA 1BI0A 3O6BB 3HL2A 1RUNA 3I53A 3KP6A 3R6SA 3K0LA 1FLIA 3QAHA 3WE3A 2LH9A 2XAGA 1TWFJ 1W0TA 2KP6A 1XD7A 2RGVA 1QA6A 2PG4A 4ZYEA 1MSFC 1QU3A 4AUXA 4BACA 3EDPA 3OIPA 3L2WA 2JSPA 4U0WA 1CF7B 4IXAA 1KU3A 5BPIA 3C2BA 4IEJA 4RGUA 2ETHA 3H5AA 2KT0A 4L9NA 3VSKA 2Y69H 2CW0F 2RVCA 2XAQA 1ACIA 3DPUA 1GV5A 2KJCA 5TJJA 2FQ3A 3SEZA 1OLTA 3J7AO 1SD6A 1X3WB 4WCGA 5DM6F 2KLOA 4CYDA 2DTZA 4RAYA 1VQLI 1P7JA 3E1SA 1SD5A 2VBZA 1HKSA 4JBAA 3S3OA 3BP8A 2GIVA 4IO9F 3F3XA 2CS3A 2EH3A 3BWGA 1OYIA 2LYCA 3DTEA 3HIFA 2QGUA 1BOBA 3GUDA 3FM5A 1OCPA 4ZYHA 4KIFA 3TP3A 1D3YA 2ZFUA 5EGOA 2DXIA 3ERMA 2LC2A 1ON1A 3VWBA 3S16J 1R5ID 2L54A 1EH8A 4MLOA 2X6YA 3KP5A 2R7QA 4M3DA 4BEHA 1JHFA 4D1QA 4XOTA 4FX4A 1O3RA 3U1DA 3VYTB 2J5OA 3ZN1A 1IRFA 3GFJA 2OD5A 1S7EA 3K9TA 2BV6A 2XB5A 3HPGA 1L0OC 4UB8C 2PQ8A 1R5HA 3I54A 2E35A 3E6MA 1Z3YA 1DDNA 2R5YA 1R49A 5CVJA 2L4AA 2M87A 4CXFA 2ZJPF 1Z1DA 1E3OC 2ESNA 1K83J 5IP6A 5LHGA 4IPAA 2P6SA 2WB1A 2VPLA 2IP2A 3BJAA 2M4GA 5HDKA 1ZREA 4U87A 3WU2C 1JTXA 1EJ9A 3F0CA 2W7NA 4AVZA 3FIWA 2BHYA 2RN7A 1QBJA 2X9DA 3CCYA 4HSTA 2HWVA 4E7HA 5E20A 1NTCA 1AKHA 5FKLA 3E6BA 2EWNA 2R7SA 4HLXA 4Q48A 1UMQA 4U0VA 2L9VA 2KZVA 4XLFA 2XF6A 1T56A 4UY8I 3OYFA 2LLKA 2D1VA 1VQ7I 2IEKA 3CCRI 4EJWA 5LD2C 1SVOA 2F5VA 3BR1A 4C3HJ 2R7RA 1U8BA 4MEXF 5BNGA 4U7DA 4I2OA 4XORA 4AWXB 1KU2A 3GYHX 3JRAA 4IF4A 3HRSA 4NHJA 3IHUA 2QQBA 1YITI 1UHMA 2E2HJ 4PJJA 2BE5F 3VSLA 2CV1A 3ABKH 3SJMA 3GO5A 4PSWA 1A31A 2XKOA 1FOYA 2DFEA 4XN3A 3OMYA 2HVRA 1MBGA 1XX5A 4M72A 3A03A 1YQAA 2JPCA 4BXFA 4ZTJA 2EILH 1OR7C 2UXNA 4OU0A 5H20A 1YS7A 4C9YA 2RNJA 1T38A 3OY9A 2WAFA 1ZR4A 2GBYA 3J81K 2EA2A 5FLMJ 2IS6A 2L7ZA 3G73A 2EFPA 4ZYGA 4UV9A 3EUHA 4OIOF 3FXJA 2O8KA 2XAHA 1Z6TA 2K3PA 3BG3A 1K79A 1MMAA 1QHGA 3JRFA 2VT3A 5E1XA 3VYRB 3A4CA 2F4IA 2HXIA 1UB9A 2AQFA 2TDXA 3EQLF 3Q3SA 5K7ZA 3DQVC 4N9IA 1G2HA 4BQNA 4KFCA 2KFDA 2O6GE 1W36D 4XKVA 5GAGJ 2DOAA 3GW2A 3JRGA 3OIQA 3SDGA 3IL2A 3CMYA 3S93A 2B63J 2RREA 4D0PA 1UAAA 3O8HA 4HF0A 2MYSA 5DD8A 2EFQA 3G4SI 3WODF 1D8KA 3CO7C 2VB6A 4V2FA 4AIJA 1ZG5A 4QWQA 1FTZA 2X48A 3CUQB 4A0YA 1U8RA 1SFXA 1MIJA 1ZARA 5M5YJ 1S8NA 3T8TA 1XMKA 2VPRA 1ZG1A 4BYYA 4XR6A 2TRTA 4R79A 2M0CA 4DIQA 2BY2A 4ABZA 1MBFA 5F64A 2E5NA 3WE2A 1HDDC 1LEBA 1IXCA 3RKXA 3R0JA 3EUAA 1S7AA 2OAZA 2Z3YA 1YX5A 4HF2A 4A3FJ 3WHCA 3MAJA 2M0MA 1Z7LA 3B73A 3M9AA 1I3AA 1X58A 1PDNC 1IRGA 2XUBA 2X6XA 2PMZN 1MSEC 3S1RJ 2IT0A 1P92A 3SDBA 2IRFG 5IP9J 1B72A 4HYEA 2E7WA 1DUXC 1XMXA 5E8GA 3WG7H 1BIAA 4LJZF 2DDBA 5DV5A 3C18A 3HGYA 3U1KA 4A6EA 3QPHA 2ESHA 3VYSB 4BUPA 4CCMA 2Z99A 1LPQA 3H9JA 2EFNA 3PO2J 3LL7A 1BJZA 3RJPA 2LK2A 2XASA 2QYOA 1WH5A 1IRXA 1JT6A 2V6EA 4N4NB 1X4OA 4MTEA 4OOIA 1R4NB 4XRSG 4ANJA 3WTVC 3T5XA 4X1EA 3A0BC 1N75A 2DW4A 2M2EA 5L3BA 1BR2A 1RKTA 2OCEA 4F55A 4DZJA 1D0ZA 4RAGA 1WQ2A 2EBIA 1PVEA 1W7PA 3IAS2 3CCEI 1IV8A 2L01A 4XN0A 1T08B 1LE8A 3FXUA 4EMSA 1TT0A 2G9WA 1ENHA 2LKPA 3I71A 1ORKA 1S3JA 1I6XA 1LFUP 3BR3A 3JRHA 1YO5C 3LSKA 2CV0A 2VJJA 3C2GA 1T2KA 1O7FA 3HYIA 1DP7P 2R7XA 4XONA 4XM3A 2A07F 3W6JB 4GRIA 4FT8A 3S1NJ 4RA2A 2IGMA 1JKPC 4AVPA 2L9NA 2HU9A 2VQCA 4QIWN 3HOSA 3DBLB 3OS1A 1OCCH 1WCMJ 2ZNYA 4GCVA 2HYGD 3M8FA 3ELKA 1X2NA 2IS2A 4LMYA 1LE8B 2Y0SA 2FBKA 3N97A 4A3JJ 4C2UA 2E19A 4ZJZA 5IPAA 1O3QA 3S2DJ 1Z05A 3GFMA 2M9HA 4CCKA 3CP2A 2GZWA 4IRHA 2LRDA 3M1CA 3TQNA 3LFUA 5HS9A 5TISC 2DFHA 5AIQA 2ZMEC 1FSEA 4EATA 3BJOA 3KZIC 5F04A 2XDVA 4E7KA 1ZGAA 1LVAA 1JUPA 3DCFA 1XMAA 1QQIA 1XCBA 1SVMA 1XCVA 3HBLA 4KT5C 3WTYC 1REPC 3QQAA 1GT0C 2RAEA 2P5KA 4BU2A 5M5XJ 1U5TB 1RC9A 2ZXJA 2BY3A 1JKOC 2W00A 4S04A 1A5JA 1HOMA 5ILSA 3T1BA 4A93J 1F43A 1RESA 2JZYA 2W24A 3NAUA 4A0ZA 4BKXA 5LGNA 1HW1A 2FMLA 3COAC 2R0QC 4DNCA 2ZBKA 2VI6A 5ERIA 3G2BA 1ZQ3P 1TNTA 2BXYA 2E1CA 3X2QH 2M7BA 2E34A 3P7NA 2VKEA 4HG2A 3QOPA 3UNGC 2Y75A 5LBQA 2Q0OA 1HW2A 2J5PA 1CGPA 2HXOA 2HQ5A 1ZG3A 3I59B 4G9YA 4MQ9F 2DAOA 4B09A 1Z6RA 2Z33A 3G71I 1ETKA 3FF5A 2VBXA 4Q5SF 3W2WA 2OZUA 3GFLA 3HUGB 2XSDC 4DZPA 1WWXA 2DA6A 4BHPA 1W7PD 1BR1A 2LTPA 4MQVA 4XRMA 2QKLB 2L5QA 3BTIA 3DLAA 4AYBN 2EV5A 4G8XA 3IH3A 3D1NI 3CUQA 2HOAA 4RM3A 1STZA 4HDUA 4KITB 1B8IB 1O57A 5B66C 1BC8C 2IBDA 4KICA 1ZAOA 1HSTA 1LJ9A 2XF5A 3FMSA 3LAJA 1IF1A 3PFYA 1R23A 4CCOA 1R5GA 5D4RA 5ICFA 3ABMH 2FUG2 1X1CA 1O3TA 4GXOA 5D5UB 3CCVI 3HG9A 4M3FA 2QBYB 2V9VA 4XSXF 2OTLI 3TGNA 3HSEA 3G1MA 3L1PA 2ZXWH 5CLSA 3GTLJ 3E6DA 1LDKB 2HOTA 3LSJA 2MG4A 5HLGA 4ETSA 4J01A 1HKTA 1F36A 5KAIC 1D5YA 2M30A 3F6OA 2PFBA 3BZ6A 3C3WA 2DYSH 5J47A 2VBYA 1YJNI 2R7OA 3GLXA 2Y0SN 2KIQA 3IWZA 3RZOJ 1V5EA 1V5FA 4UVCA 4HDVA 1U9OA 1XB4A 2XAUA 2DYRH 3BDDA 3HKZN 4G7HF 4V2GA 2WC2A 1IRZA 1I5ZA 2L4MA 4HEA2 5ICCA 4L0ZB 1AA7A 2IW5A 4I0AA 1SFOJ 5C4XJ 2R5ZA 1X2MA 3CCQI 1ETWA 3QYEA 1RZ4A 4UUSA 2HGCA 2LP0A 2LNBA 1SFKA 3MD2A 4Y3OA 4MO7A 2MFZA 3B6CA 3L9FA 1ZHFA 3PQKA 4GYGA 4MTDA 1W0UA 1VQ9I 3LFKA 3BOQA 3TW6A 4M3BA 1JT0A 2WB1N 2Z5UA 4L9VA 3ZOBA 3ZQ7A 3HRTA 2UZKA 2MSYA 3ZQFA 3S2WA 4CICA 2QKMB 5J1YA 1KYZA 4ZZLA 3RI4A 1YTYA 5L3CA 2EFWA 2M5WA 3QU3A 2LF7A 2M45A 2HVQA 1OYWA 2R7TA 3KP7A 3SFIA 1HLVA 5GTHC 4S0HB 2E36A 1P4AA 1XN7A 1WI3A 4LG0A 3IWFA 4AU7A 4BXXJ 4I6ZA 5EEHA 1TC3C 1FOKA 1IXRC 2H6BA 3GZNB 5D8KB 2GA1A 3K4NA 3NWTA 2Y2ZA 5FROA 3OOPA 4B3XA 3PO3J 2KRHA 3PUBA 5J8CA 4A3DJ 4Y33A 4M9SA 1ZRDA 3A01B 2CQNA 4A3MJ 1T95A 3HKZA 3K69A 5IYCJ 2IA0A 1IXSB 1MMSA 5E79C 1TNSA 3M4OJ 3AG4H 3I58A 2DJIA 3ISPA 3WGGA 4DOZA 1HA8A 2MGQA 5HOOA 4CYCA 3K1NA 3HHGA 1T39A 1QVUA 2A6HF 5GPAA 1JE8A 1TQIA 1LEAA 1K6YA 1TW3A 2HKXA 3HC7A 4HQEA 5K7FA 1AWCA 1VF9A 2ZJQF 4L5IA 5FFZA 2XGCA 2DDAA 1W7PB 3EYYA 3HDDA 3U21A 2QF7A 3LA7A 4I02A 4WF2A 1B59A 5D6EA 5EZGA 4RAZA 5CVIA 3BR0A 4BE1A 1LDDA 4LOCA 2E71A 2H1KA 3J7ZI 3QYFA 2XF7A 3JSPA 4IHWA 3AG3H 2K9LA 3QPLA 1HKQA 4OAZA 2QSGX 3VODA 2RNGA 3JAMZ 3I3LA 2MLKA 1TP4A 2K27A 5LLQA 4CO8A 2V26A 2RKHA 4M6XA 5HDNA 2O61A 1HSJA 3CUQC 2VXZA 1NH3A 3ASNH 1JKQC 2YPRA 2VQHA 1ULYA 2ID3A 1F1ZA 4PJMA 3ZMSA 2K4BA 4G12A 1HXDA 5TRDA 1R7JA 2KKOA 3FK7A 2B9SA 4HZFA 3HB9A 2NYXA 1YOVB 5L3EA 2PMHA 4ESJA 3F9KA 5FO5A 2XC7A 4E6KG 1KGSA 4ZZDA 1K4SA 1IG7A 4LG0B 1EV7A 2QQ8A 4XSZF 9ANTA 2CQKA 1VQNI 3VPRA 3H5NA 2JA7J 4X0GA 2K9SA 1BN5A 3IP4B 4HSRA 4M71A 4BHCA 1H88C 3J81Z 3DKXA 1WJFA 1BI1A 5HODA 3O3KA 3CLOA 4P5OA 4IHYA 2WAQA 3TL4X 1FY7A 3U9GA 2VOPA 2CQQA 1YS6A 1BOAA 3K1MA 3WG9A 4MIMA 2F2EA 4BGDA 3JRCA 1QVTA 1ZLKA 4XLHA 3H3VK 5AONA 3QWLA 3PIOF 1Y1VJ 1H9TA 4BS9A 3R4KA 2FQ4A 5DCMA 2QSHX 4RB0A 4G94A 5GPCA 1MD0A 2FU4A 1IN7A 2ZO4A 2GXAA 4M3EA 1D8JA 2K7LA 1Z21A 3CTAA 2P0WA 4U7BA 2BY1A 1D1AA 3FWEA 3FZVA 2YU9J 4RGSA 2FA5A 3E5XA 2B0LA 4I01A 1G3SA 2FD5A 3CCLI 4FE7A 4II2A 3QP6A 1R71A 2P81A 2XKPA 3TBIA 3FDYA 3RQIA 1WVRA 2KRCA 2OC6A 3LSMA 1TBXA 4XLPF 3CCSI 4ZH4F 5DCMB 1FNNA 2WBMA 5H2FC 2DN0A 1MNMC 5DUIA 3K4LA 2BBYA 4EVIA 3S3MA 4LK1F 1WI9A 2XGXA 4ENKA 3HJEA 1XGMA 4MHGA 4YFXF 2Q2EB 3RCOA 3OYMA 1HW5A 3HPHA 3QPTA 4BHBA 3CCJI 5K7HA 3CMMA 3J80K 2QM3A 2VKVA 4NBQA 3CC2I 2WAQN 3B02A 4I0BA 3OYBA 1WRJA 4DJAA 3FKJA 1MBJA 2JK3A 1MDMB 5FLXK 3E97A 3K4KA 2W48A 2MD0A 3W3CA 1K6OA 4IOCF 2FE3A 3FXLA 2H8RA 1JI8A 3F72A 4Y4RA 4R8HA 2PN6A 2M8GX 4M73A 3BT9A 3NARA 5KAFC 2VUMJ 4NC8A 2HTSA 4QLCU 3HRMA 3OV8A 2KRFA 2BOLA 4PJ0C 4XMYA 1MW7A 2ELKA 5GADJ 3FBNB 2FRHA 3CJNA 4HOBA 4BDYA 3BQYA 4HRIA 1MMDA 3OYAA 2DOEA 3DEWA 3KEOA 3LWFA 4HLYA 1X3ZB 2LMDA 4XLEA 5HLHA 2NNYA 1OKRA 2L9SA 3KPHA 2E1MB 1XDSA 3LQQA 2XB0X 5FD6A 2I5UA 3W2VA 2M3AA 3KETA 1UELB 3OR1C 4ITVA 5J4VA 4BJ5C 5L3FA 1OCRH 4KT6A 2Y9ZA 1JHHA 1ZGJA 1VQ4I 2DMUA 4YIFA 1TWGJ 1BW5A 4EM1A 3L2RA 3BPVA 5EZHA 2HQNA 3KX2A 1GV2A 1E17A 4K2EA 5F08A 2DA2A 2X51A 3VOEA 4E7SA 1IV6A 4LG3A 2K4JA 2FMYA 3QPSA 3RTRA 2A69F 1V5GA 1BM9A 1T0FA 5EG0A 4V19K 1GVDA 3A02A 2IAIA 4HW0A 4KJZA 5JR3A 2ZMEB 3L2QA 3P5JA 4G6TB 1GHCA 3JREA 5DYMA 2NS0A 5J4YA 3L2CA 1FX7A 2A5YB 2VLAA 1SANA 2HOSA 3MN2A 3GVAA 4KA4A 3OYDA 1FMWA 5KK1A 5CVRA 1QPIA 4P55A 2AS5F 4A5MA 4FQGA 1B4AA 1FYKA 1U0JA 3I55I 3RZDJ 2EZIA 1X1PA 4A69C 1MNEA 2DU9A 5B5EC 2VKDA 1ZYRF 2PI0A 1MDMA 2ZXHA 3G1LA 4FCYA 1G3YA 4OINF 3BTLA 2YUSA 2MABA 1POGA 4CUGA 5E3MA 3BTJA 2D1HA 5HNHA 3FM3A 5D5XB 5FRMA 1LFPA 1Z7UA 3LQRA 4F92B 1I1GA 4D7NA 1ZKGA 2EZLA 5LEKA 2DA3A 1X1AA 1YJWI 3HSFA 3WTZA 3KLOA 1Y39A 1Z3XA 1PP8F 3Q9VA 1GLNA 2AXLA 4QPOA 5FJ8J 1ITYA 3K6GA 3HOUJ 4M6YA 4P96A 2KIUA 3FXOA 4DYRA 2R5ZB 3GTPJ 4ENMA 2OCCH 1BBYA 3D0SA 3ESWB 4UXNA 3S17J 2BHZA 1ETVA 3HGGA 3DXJF 1T0FC 2WV1A 2A6EF 2HPMA 2L0KA 1E0EA 2IPQX 1FYMA 5C4JJ 2PJRA 3LSTA 4JOMA 1KZHA 1FYLA 5F1RA 1BA5A 2CWEA 3BC8A 5HVQC 2VE9A 4IRIA 3K1PA 2HVSA 3E5UA 4W1UA 4CSWA 1Y0UA 4NQWA 3TP0A 2GLOA 2MW8A 3F21A 2XAJA 2X1CA 3DKWA 2ZKZA 1GDTA 3MZ8A 2F5EA 3IV5A 4ZDPA 2CFOA 1IW7F 2E5ZA 4JX4A 4AM3A 2JRMA 2LG4A 5HS8A 4BJTA 1LUJB 1YE9A 1HDPA 1ODDA 1FEXA 3RPUD 5JLXA 3GZ5A 1H0MA 1JUMA 1XGSA 5K1YA 2V4JC 3SYTA 2FBHA 4J19A 2CUJA 2W1OA 3MKLA 1IC8A 1WHUA 2AQEA 2KHMA 3MMYB 3FHZA 5CQGA 1UFMA 1R58A 3TO9A 1IN4A 3K4JA 5EEGA 5BOXA 3KP3A 1ZGWA 2YS9A 3BY6A 4YFNF 4S05A 3HEFA 3TEDA 2ZNZA 3WTTC 4G7OF 4OMYA 1IN6A 1BC7C 3GCMA 3OS2A 4B47A 1B8IA 2WY7Q 2A3SA 5LGTA 1UHWA 2A5WA 2OA4A 3PQJA 2DK5A 1D0XA 1RETA 4BBRJ 5GAHJ 4QPQA 1J5YA 2Q8KA 2A61A 3SQNA 3KP2A 3F22A 2GA2A 4WK8F 2R7WA 4Z2YA 3HUGA 3FXRA 4UVAA 3K2ZA 1U3EM 5FGMA 3DPLC 2NVXJ 2X85A 4B4CA 2LSOA 4OWRB 2EZHA 4HV6A 4IHXA 1YRNB 1P9QC 1OFCX 3ZPLA 1S7OA 2G7HA 4IOAF 2GXBA 2IS1A 4H4KC 3BR5A 4L5JA 5LHIA 3WTWC 1Z91A 3TO7A 1K7AA 3MVPA 2QUFA 3KLNA 2F48A 1I6HJ 3E7LA 4KMUX 1EH7A 2FJ1A 3GTMJ 4CH7A 2OF7A 4CGZA 3QRFF 3Q0UA 4L9JA 1YW8A 4ZYDA 2H6CA 2HKOA 2I10A 1SFUA 3MKYB 2OQRA 2PJRB 2EZKA 2O03A 3DBRB 3RQ4A 2HFHA 3TOBA 3I5UA 2GIZA 4OMZA 3C2HA 2P6TA 3H0DA 1IN5A 5E3LA 1WPKA 3CCUI 2QA4I 1GXQA 2OV7A 3A1YA 1FZPB 5BS6A 2PX9A 2R7FA 4WXCA 3K70D 4Y17A 5EJCA 1RRJA 2JVHA 4EQQA 3QU6A 2ZFWA 2XGEA 2L2OA 2OU2A 4MFEA 1MKMA 3CC7I 2K9MA 1XPXA 2VJ5A 2BVMA 2CW7A 2BXZA 2ZB9A 4G6DA 4EV0A 1B9MA 2JJ7A 4RAFA 1BIBA 5FLVA 3FMRA 2W57A 2DFFA 1WJDA 4XKCA 5JVGF 2STWA 5A2QK 2OTJI 3AG1H 1WJAA 2K9QA 5F1JA 4U0YA 5KVRA 4WXDA 2IS4A 4F3QA 4MNUA 4XLNF 3WTSC 3BROA 1LVKA 1ERDA 1TLHB 3RKYA 5FD5A 2IA2A 2YX4A 3SXYA 4ASNA 5IYBJ 2LD5A 2ZJRF 2P5LC 4HX7A 5EYRA 1Y1WJ 1F5TA 4XICA 1ZTRA 2GM4A 1UJ8A 2HOEA 2VBWA 2HPIA 3P9CA 2V9PA 2VE8A 2DLLA 1J09A 4A12A 2NOJB 2GAUA 2LF8A 4EEFG 2K85A 4GYIA 4BY7J 3BG7A 5KCMA 1S29A 1ETXA 4D9JA 5DS9A 1VQ8I 5E1WA 3SZPA 5D5WB 5F0HA 1IZ1A 3PNYA 3FK6A 1G3TA 3LSRA 3K4BA 3RDIA 3M07A 1IDYA 4D5CA 3N05A 2LBFB 3QOEA 2DA4A 4D5FA 4IHSA 3KEYA 4BDZA 1F4KA 2ISYA 2P4WA 1APLC 2HQRA 3ERED 2DQRA 2VC1A 2WWYA 3I56I 1G3WA 4C3JJ 1ZR2A 2F5FA 3H5RA 2G0EA 1QRYA 4NUBA 3ML6A 1S6LA 3H36A 4ZYAA 1U6GA 4EJOA 1A6QA 1A04A 1QHHD 3OYKA 1O4XA 4PFPA 1YX3A 3BTCA 2V1NA 5IYDJ 2E1MC 3GF2A 3RPQA 1B6AA 3BG5A 3ZXSA 2HZTA 2DA1A 1AU7A 4F7ZA 3SEQA 1RR8C 1QPMA 2L02A 3KEQA 3SZTA 4HA8A 5EEAA 2V79A 1IJWC 1Z9CA 1JGSA 2O0YA 3VB2A 2VN2A 2OJED 1HBXG 1FP1D 2JN6A 4G7ZF 1KYWA 4E7LA 4XK4A 1J9IA 4EJTA 4C30A 4AIDA 1FWZA 4L9TA 4RM2A 2Q2EA 4O3MA 1VTNC 4A5NA 4KN4X 2QSFX 1KA8A 3V42A 3DV8A 3CF2A 1YW9A 2LY2A 3H92A 3R0AA 4BJ6C 3CF5F 4RLFA 2E1OA 2ISZA 2ZJ2A 3O8GA 5LEJA 3EETA 5ILVA 4HX4A 2DMNA 2IGKA 5E3OA 5FKKA 3SFZA 1TQMA 1V4RA 3J7AY 3S2HJ 2VC0A 1L3LA 1GVJA 1ZRCA 5K5OA 2VODA 4XRSA 1VI0A 1LDJA 1YW7A 1RIOH 1PUEE 3GXOA 4B8XA 4JK1X 3ZCOA 2GOMA 2HDDA 2XIGA 4ENJA 3PNTA 3OYHA 5JHFA 1QZZA 1Z67A 3CMAI 1EKEA 4BH9A 5E8IA 4LLGF 1EA3A 4HBLA 5A2QZ 4HAMA 1SFEA 4A3CJ 1X3UA 4UHTA 4E7ZA 3PIPF 2STTA 2QWWA 2NS7A 3GTGJ 2WAEA 3CDLA 1ZLJA 5DCFA 3CD6I 2FNAA 4XRFA 5D6FA 1PUFB 2FXAA 4QSHA 4WWCA 1OYYA 2P7CB 4B43A 2LY1A 3VEPA 3VDXA 2HYFA 1UG0A 1DU0A 2Z1DA 2P7VB 5K5QA 2Z2SB 3F8NA 2Y48A 4BE0A 3OL3A 1LB2A 4C3IJ 1MMNA 2DK8A 1XGOA 5E1ZB 5F27A 4Y13A 4E4HA 2OPTA 1KU7A 1TTYA 2EPFA 2X1DA 2JA2A 3A0HC 4DYCA 2BGCA 2V6CA 2PLYA 5FKMA 4QTRA 4PFOA 3EYIA 2O3FA 4DBQA 2HTJA 3R60A 5HLTA 1YYVA 2G7UA 1F9NA 1X4PA 4A6DA 4RB1A 4PSXA 4L18B 2CU7A 2VL8A 1E3PA 3E6CC 3IH2A 4KMFA 3NRVA 5DEQA 1LKXA 1C0WA 1PJRA 2CRGA 4P9UA 4UV8A 2HDWA 4OIPF 3V7SA 3BJ6A 3H1CA 3ZQCA 2R7UA 3O2PE 2XPWA 1ETOA 3H9GA 5J6XA 1DPRA 1MJ9A 4EJVA 2PEXA 1T8IA 4Q47A 1FC3A 5F0FA 4J00A 1XDUA 2Y30A 1FP2A 3SZGA 2KZGA 4RBOA 2XHKA 4IHVA 2W85A 2LOOA 3CJRB 2DPDA 4A3LJ 1IUYA 4MGRA 4BY1J 1J75A 5JFRA 4O6JA 4BL0B 3ECHA 5GAEJ 2LDUA 1JUSA 3AG2H 4O5VA 3E3VA 3WTXC 1UZCA 1USSA 2KDZA 4NDLA 1ON2A 3MEXA 3HOYJ 4HNVA 1U5TA 1WJBA 3WU0A 3A2KA 3CZ6A 1G4DA 4CZCA 2LBFA 2B7EA 5IP7J 2VONA 2MBFA 2OZ6A 3ZQLA 2VT2A 1MH3A 1RPWA 3DP7A 3GTOJ 1Y0NA 4CYCB 4AD9A 1RUOA 1P4WA 3J7YJ 3GMEA 3CMEI 4A3EJ 1IUFA 3GEZA 2JUCA 4NQWB 5FFXA 3V4GA 1YRNA 1J0RA 1XG1A 2ZSHB 4NC6A 2BVLA 2VOOA 1MBHA 1G6NA 2KMUA 3HOTA 5JVTA 3K10A 4IVNA 3A01A 2A05A 1W5CC 2M7AA 4IL6C 3ZR8X 1BI3A 4IZZA 3FXKA 3TMOA 3WTUC 1VQOI 3M1EA 4BXUA 3MQ0A 2Z16A 2EIKH 1MNDA 4YEJA 5B1BH 1KU9A 1MZBA 3NQOA 3OYJA 4FTHA 4GDFA 2ELJA 4NB5A 4HNTA 1V55H 1N78A 3Q0WA 2PBIA 4RMNA 4IHTA 1TQPA 3L09A 5CKTA 1JJ6C 1MGTA 2DFIA 4IJAA 3PSFA 3PJRA 1FSHA 2NVUB 1RR7A 2RC4A 4XL9A 3L00A 3CUOA 3AL0B 2CFXA 1T6SA 1FIPA 2EK5A 1BJAA 3DLLF 2ECCA 1MBKA 1WKMA 4AC0A 1WJCA 2F5DA 4JP0A 3ZN0A 2XRNA 4LLNA 1DGRM 2NVTJ 2Y31A 2FX0A 3V7CA 2WV0A 3TDZC 1PP7U 5BMZA 5JLWA 2DA7A 2ID6A 4YFKF 1R1VA 1SD7A 2NVQJ 5HLIA 1ZRFA 2ADUA 4L0YB 4B1RA 5IY5H 3CESA 1BW6A 4H0EA 3HOZJ 1NK2P 1FOXA 1GXPA 4DBRA 5FLXZ 1M1EB 3OSGA 4CZZA 3HSRA 3HOXJ 1KONA 2Z9OA 1E2XA 2BY0A 3PL8A 1SAUA 3KYLA 5DM7F 4FHTA 3IC7A 4CCJA 1OQYA 2KDOA 2N8GA 1MBEA 4YIIA 3IRQA 1R4MB 5EG0B 2JUGA 3DU6A 3RKWA 1H9GA 4UUTA 3OOUA 3KFWX 1RNLA 3I9V2 3P9IA 2FEZA 2ZCWA 3EUKL 3L2UA 4JQFA 3BG9A 3CDIA 2R5YB 5B1AH 4FETA 2E2IJ 1YIOA 1NG7A 1TWAJ 2JT1A 3M8JA 1N77A 4A3BJ 1U78A 2K02A 4CA0A 3DWLE 1USTA 2DTRA 2HNHA 2QQ9A 2R7DA 3HZJA 3G6EI 3TOAA 3GWZA 1FPQA 1YG2A 1R1TA 2KIMA 4PCQA 3VYUB 2CSOA 2L7FP 2EQRA 5EDNA 1S5LC 5F0CA 3ZP5A 2CQ7A 1P4XA 2DMPA 2DJNA 2QEXI 4PDKA 4PUSA 2WADA 3OYLA 3TDUC 3RIRA 3ZMZA 3OYCA 1WSUA 2COMA 3IKTA 3FHNA 4XOPA 3V8LA 4A0XA 2EFOA 2MH9A 5DD4A 3GTJJ 3F6VA 2GWRA 1XC5A 2K40A 2W25A 3LSHA 3M8EA 2E60A 4NNJA 2A68F 1OR7A 3WHBA 3CO6C 2QVOA 1FBSA 1V3FA 3ASOH 1J2XA 5FKOA 4X6AJ 2P5VA 3UR3C 1W5TA 2FF4A 4EM0B 1T33A 2MA3A 3ZQHA 3TW7A 3ZQIA 1R1UA 4OAYA 3ULQB 2ZMEA 2KIFA 2JPBA 3S32A 3DTKA 1VFCA 4RGRA 5FB2A 4HF1A 1ZN2A 1X1BA 2XRLA 1WH7A 2R92J 3AKZA 4L5EA 2VIXA 1U9NA 1S72I 1LQ1A 2KPMA 5E17F 2JMWA 2W84A 3HM5A 3HTUA 2Y9YA 1VNDA 2D2WA 2GQQA 5IOYA 5HS7A 2KQRA 2OQGA 3C1DA 3GX4X 2LFBA 1FOWA 2ZSIB 3KZZA 1ZELA 4RB2C 4ON0A 4BAYA 1A6IA 5BQTA 3ROUA 2PJPA 1BL0A 3QODA 3SHFA 1OCTC 2CUEA 2R3SA 2E7XA 1H89C 2DI3A 4CDGA 3GBGA 5DDGA 5J8FA 1QGPA 3CJTB 2XGDA 4HQMA 4I98B 2EINH 2L3DA 1SMYF 5H6RA 3F8FA 2O8XA 2PMZA 2JRTA 3FXQA 1I1SA 2W4SA 3WGIA 2TCTA 1W4MA 1SAXA 2GXGA 2HYJA 2NS8A 3K4MA 3RPUA 2KJBA 1Z77A 4LB5A 3LMMA 5KNLA 3KZYA 4ZTFA 2IGNA 3H9QA 2H09A 4GO1A 2QQAA 1TT5B 1OCOH 3HRUA 1I39A 4Y52J 5ICGA 3KIOA 2WY8Q 3GLLA 4BE2A 5JHUA 3ZQQA 1AOYA 2F5CA 4AIKA 4XLCA 4CCNA 5L3DA 1U2WA 4UUSB 3KE2A 5CYVA 2K9NA 2E1NA 3JCUC 3J80Z 2WA0A 3RYRA 5C3EJ 4IX7A 2F4OB 3OYEA 5K5RA 2F4MB 4DGWB 5E18F 2V1UA 3ZMUA 4LB6B 3L7WA 3JSOA 2ACJA 4JX5A 1LNWA 1UHSA 5CVUA 3MCZA 5HNFA 2O7OA 3HTSB 4EGYA 4IKFA 1FT9A 3ONQA 3DF8A 1OISA 1BI2A 3I64A 3H3ZA 1VQPI 3K7AJ 4KISA 1Y6IA 2DOFA 1B72B 3HHHA 1E3HA 1V54H 2I8DA 2Q1ZB 3CCMI 4AIHA 4PZJA 3RYPA 3JAMK 4LLLA 4R1HA 4KDPA 5ILUA 2CW8A 2XROA 1DU6A 3R61A 3ABTA
chains in the Genus database with same CATH topology
4XBFA 2HDCA 4M9XA 5LHHA 2YU3A 1QNTA 2K86A 2H27A 1T98A 1P6RA 1B9NA 1O3SA 3E5QA 2JTVA 4A2UA 3MWMA 3T0YA 3ZMDA 3WU1B 3I0TA 3D5LA 2DBBA 4WX9A 2XAFA 1R36A 5JI6A 4PGHA 3N4MA 2P8TA 2FNPA 4IRGA 4LFUA 1K78B 4KN7X 3DFGA 1O7LA 1NHAA 2QLZA 2HR3A 4Q4ZF 3ABUA 2X4HA 4N0BA 3DEUA 4OIQF 5LRRA 3H3UA 2QBYA 3MZYA 4CHUA 4YG2F 3KP4A 4BQAA 3FMQA 4HX8A 1XGNA 2MC3A 1XSXA 1P2FA 5IT3A 4P9FA 2YX7A 1W5SA 3I4PA 4EM2A 2DO7A 2EB7A 1QZYA 5H6QA 1KQ0A 2NRAC 3V8KA 2YR2A 2CG4A 4ESFA 3JTGA 4UUVA 4N9HA 2CYYA 3I59A 2RV8A 5IT9K 1D5VA 1IAWA 6PAXA 4LD5A 3ECOA 1ONVA 1FBUA 2OBPA 1QO0D 1RI7A 3U2RA 1UCRA 2Y0MA 4U88A 4HV5A 2H94A 4FX0A 1MJBA 4EGZA 4PGGA 3MFKA 2XVCA 5L3GA 1TW2A 5HDGA 1OPCA 2UWMA 4RGXA 2IVMA 5F6FA 3QP5A 5IT9Z 3PFIA 2CO5A 3GFIA 3Q5FA 3F8BA 3LA2A 2BYVE 1Q1HA 5D8LB 2RQPA 4KNYA 2XV4S 2BEOA 2CGPA 1U5TC 3CDHA 1HQCA 2RDPA 3DPTA 3P9KA 5BPDA 2QENA 3GZ6A 1KQ8A 2FSWA 3BPXA 3F23A 4MEYF 1MJAA 2M8EA 4UNOA 3LA3A 1J7KA 5ICEA 3LAPA 3T8RA 1SD4A 3AAFA 1YFHA 5CVVA 3FX3A 3TKYA 4M74A 2DQLA 1I27A 4BNCA 4KIBA 2D45A 5DUKA 5D5VB 3WGHA 1EH6A 3IKVA 1CF7A 2ELHA 4EJUA 2FBIA 2V1DA 4TV7A 4M9ZA 3TO6A 3JW4A 2MD5A 2YSRA 4I09A 3NEUA 5LGUA 4RS8A 2DPUA 3VFZA 1SMTA 2QZ8A 4G6QA 3C7JA 1OMIA 1JXSA 5CJ9A 4Y15A 4GGGA 5ED4A 3W6KB 2NNNA 1XSDA 1R22A 2EA4A 3ZMVA 2WTEA 3IRRA 2DT5A 2V1XA 3MZHA 4KYWA 2IJLA 4ENNA 3JTHA 2FOKA 4E70A 1B1BA 3REOA 1ZH5A 1K78A 2EV6A 2JSCA 4KIGA 3ZMTA 2PMUA 4UVBA 2EV0A 2X0LA 3F8CA 4KUMA 4ESBA 1KQ9A 4DQ2A 5D4SA 1R00A 2HEOA 2MH2A 3Q9SA 2HS5A 1XSVA 4LK0F 5AIPA 3KCCA 2M1BA 2MLGA 2C6YA 2UXXA 4LGWA 3F8MA 1YLFA 5LRSA 1DPUA 3V8JA 4WXHA 4OIRF 2NAZA 4I7HA 3V7RA 1IN8A 3M7GA 2EJRA 4RB3C 1FBQA 2IA1A 1J59A 3G3ZA 1BI0A 3O6BB 1RUNA 3I53A 3KP6A 3R6SA 3K0LA 1FLIA 3QAHA 3WE3A 2XAGA 1XD7A 2RGVA 2PG4A 4ZYEA 3EDPA 4U0WA 1CF7B 4IXAA 1KU3A 5BPIA 4RGUA 2ETHA 4L9NA 2CW0F 2RVCA 2XAQA 2KJCA 5TJJA 2FQ3A 3J7AO 1SD6A 4WCGA 4CYDA 4RAYA 1SD5A 2VBZA 1HKSA 4JBAA 3BP8A 2GIVA 3F3XA 3BWGA 1OYIA 3HIFA 3GUDA 3FM5A 4ZYHA 4KIFA 1D3YA 1ON1A 2L54A 1EH8A 3KP5A 1JHFA 4FX4A 1O3RA 3U1DA 3ZN1A 2J5OA 1IRFA 3GFJA 2OD5A 3K9TA 2BV6A 1L0OC 2PQ8A 1R5HA 3I54A 3E6MA 1DDNA 5CVJA 2L4AA 2M87A 4CXFA 1Z1DA 2ESNA 5LHGA 4IPAA 2P6SA 2IP2A 3BJAA 5HDKA 1ZREA 2RN7A 1QBJA 2HWVA 5E20A 3E6BA 2EWNA 4HLXA 4Q48A 4U0VA 2D1VA 4EJWA 4MEXF 4U7DA 4I2OA 4AWXB 1KU2A 3GYHX 4IF4A 3HRSA 4NHJA 3IHUA 2QQBA 1UHMA 2BE5F 3GO5A 2XKOA 4M72A 1YQAA 2JPCA 4OU0A 2UXNA 5H20A 1YS7A 2RNJA 1T38A 3J81K 2EA2A 3G73A 2EFPA 4ZYGA 4UV9A 3EUHA 4OIOF 2XAHA 1Z6TA 1K79A 2VT3A 5E1XA 2TDXA 1UB9A 3EQLF 3DQVC 4N9IA 4KFCA 2O6GE 3GW2A 3IL2A 4D0PA 4HF0A 5DD8A 2EFQA 3WODF 1D8KA 3CO7C 4AIJA 1ZG5A 4QWQA 3CUQB 4A0YA 1U8RA 1SFXA 1ZARA 1S8NA 3T8TA 1XMKA 1ZG1A 4BYYA 4R79A 5F64A 3WE2A 1LEBA 1IXCA 3RKXA 3R0JA 1S7AA 2OAZA 2Z3YA 4HF2A 3MAJA 3B73A 3M9AA 1IRGA 1PDNC 2XUBA 2IT0A 1P92A 2IRFG 4HYEA 2E7WA 1DUXC 5E8GA 1BIAA 4LJZF 5DV5A 4A6EA 3C18A 3QPHA 2ESHA 2Z99A 2EFNA 3RJPA 2XASA 2QYOA 4MTEA 4OOIA 3WTVC 3T5XA 2DW4A 5L3BA 1WQ2A 1W7PA 2L01A 3FXUA 4EMSA 2G9WA 3I71A 2LKPA 1S3JA 1I6XA 1YO5C 1T2KA 1DP7P 1O7FA 3HYIA 2A07F 3W6JB 4FT8A 4AVPA 3HOSA 2ZNYA 4GCVA 2HYGD 3M8FA 3ELKA 4LMYA 2FBKA 3N97A 1O3QA 1Z05A 3GFMA 2GZWA 4IRHA 3TQNA 5HS9A 5AIQA 1FSEA 3BJOA 1ZGAA 1LVAA 1XMAA 1QQIA 1XCBA 4KT5C 1XCVA 3WTYC 1REPC 2P5KA 1U5TB 2ZXJA 4S04A 5ILSA 3T1BA 2JZYA 2W24A 4A0ZA 3COAC 5LGNA 1HW1A 2FMLA 4DNCA 2ZBKA 5ERIA 1TNTA 2E1CA 3P7NA 3QOPA 2Y75A 5LBQA 2Q0OA 1HW2A 2J5PA 1CGPA 1ZG3A 3I59B 4G9YA 4MQ9F 2DAOA 4B09A 1Z6RA 2Z33A 3FF5A 2VBXA 4Q5SF 2OZUA 3GFLA 1WWXA 4BHPA 1W7PD 4MQVA 2EV5A 4G8XA 3CUQA 1STZA 4HDUA 1BC8C 1O57A 4KICA 1ZAOA 1HSTA 1LJ9A 3FMSA 3LAJA 1IF1A 1R23A 1R5GA 5D4RA 5ICFA 1O3TA 4GXOA 5D5UB 2QBYB 2V9VA 4XSXF 3TGNA 3HSEA 5CLSA 3E6DA 1LDKB 5HLGA 4ETSA 1HKTA 2M30A 3F6OA 2PFBA 3BZ6A 3C3WA 2VBYA 3GLXA 3IWZA 4UVCA 4HDVA 1XB4A 3BDDA 4G7HF 2WC2A 1I5ZA 2L4MA 5ICCA 4L0ZB 2IW5A 4I0AA 1RZ4A 2HGCA 2LNBA 3L9FA 1ZHFA 3PQKA 4GYGA 4MTDA 3LFKA 3BOQA 4L9VA 2Z5UA 3ZQ7A 3HRTA 2UZKA 3S2WA 4CICA 3RI4A 1KYZA 4ZZLA 1YTYA 5L3CA 2EFWA 2M5WA 3QU3A 2LF7A 2M45A 1OYWA 3KP7A 1P4AA 1XN7A 4LG0A 3IWFA 5EEHA 1FOKA 1IXRC 2H6BA 5D8KB 2GA1A 3OOPA 5J8CA 4M9SA 1ZRDA 3K69A 2IA0A 1IXSB 1TNSA 3I58A 3ISPA 3WGGA 5HOOA 3K1NA 3HHGA 1T39A 2A6HF 1JE8A 1TQIA 1LEAA 1TW3A 2HKXA 4HQEA 1AWCA 4L5IA 5FFZA 1W7PB 3EYYA 4I02A 3LA7A 4WF2A 1B59A 5D6EA 4RAZA 5CVIA 1LDDA 3JSPA 1HKQA 3VODA 3JAMZ 2MLKA 2K27A 5LLQA 4CO8A 2RKHA 4M6XA 5HDNA 2O61A 1HSJA 3CUQC 2VXZA 2YPRA 1ULYA 3ZMSA 1F1ZA 2K4BA 1HXDA 5TRDA 1R7JA 2KKOA 4HZFA 2NYXA 5L3EA 2PMHA 4ESJA 5FO5A 4ZZDA 1KGSA 4LG0B 1EV7A 4XSZF 2CQKA 1BN5A 4M71A 4BHCA 3J81Z 1BI1A 3O3KA 3CLOA 4P5OA 1FY7A 3U9GA 2VOPA 1YS6A 1BOAA 3K1MA 3WG9A 2F2EA 1ZLKA 5AONA 1H9TA 3R4KA 5DCMA 4RB0A 4G94A 1MD0A 2FU4A 1IN7A 2ZO4A 1D8JA 2K7LA 3CTAA 4U7BA 3FWEA 3FZVA 4RGSA 2FA5A 3E5XA 2B0LA 4I01A 1G3SA 3QP6A 2XKPA 1TBXA 4XLPF 4ZH4F 5DCMB 1FNNA 5DUIA 2BBYA 4EVIA 4LK1F 1WI9A 2XGXA 4ENKA 1XGMA 4MHGA 4YFXF 1HW5A 3QPTA 4BHBA 3J80K 2QM3A 3B02A 4I0BA 1WRJA 1MDMB 5FLXK 3E97A 1K6OA 2FE3A 3F72A 4R8HA 2PN6A 4M73A 2HTSA 4QLCU 3HRMA 3OV8A 2KRFA 2FRHA 3CJNA 4HOBA 3LWFA 3KEOA 4HLYA 5HLHA 2NNYA 1OKRA 1XDSA 3LQQA 5FD6A 3KETA 5L3FA 1JHHA 1ZGJA 4YIFA 4EM1A 3BPVA 2HQNA 1E17A 4K2EA 3VOEA 2K4JA 2FMYA 3RTRA 2A69F 1BM9A 1T0FA 1GHCA 4HW0A 5JR3A 2ZMEB 5DYMA 2NS0A 3L2CA 1FX7A 2A5YB 3GVAA 4KA4A 5KK1A 5CVRA 2AS5F 4P55A 4A5MA 1FYKA 1B4AA 2DU9A 1ZYRF 2PI0A 1MDMA 1G3YA 4OINF 2D1HA 3FM3A 5D5XB 1Z7UA 3LQRA 1I1GA 5LEKA 3HSFA 3WTZA 3KLOA 1PP8F 3Q9VA 2AXLA 4M6YA 4P96A 2KIUA 4ENMA 1BBYA 3D0SA 4UXNA 3DXJF 2A6EF 2IPQX 1FYMA 3LSTA 1FYLA 5F1RA 2CWEA 5HVQC 2VE9A 4IRIA 3K1PA 3E5UA 1Y0UA 4NQWA 3F21A 2XAJA 3DKWA 2ZKZA 2F5EA 1IW7F 5HS8A 1ODDA 3GZ5A 1H0MA 1XGSA 5K1YA 2FBHA 3FHZA 3TO9A 1UFMA 1R58A 5BOXA 1IN4A 5EEGA 3KP3A 3BY6A 4YFNF 4S05A 2ZNZA 3WTTC 4G7OF 4OMYA 1IN6A 1BC7C 2A3SA 5LGTA 1UHWA 2OA4A 3PQJA 2DK5A 1J5YA 2Q8KA 2A61A 3SQNA 3KP2A 3F22A 2GA2A 4WK8F 4Z2YA 3HUGA 3FXRA 4UVAA 1U3EM 3K2ZA 5FGMA 3DPLC 2LSOA 4HV6A 3ZPLA 1S7OA 2G7HA 2GXBA 4L5JA 5LHIA 3WTWC 1Z91A 3TO7A 1K7AA 2QUFA 3KLNA 4KMUX 1EH7A 4CGZA 3QRFF 4L9JA 1YW8A 4ZYDA 2H6CA 2HKOA 1SFUA 2OQRA 2O03A 2HFHA 3TOBA 3I5UA 4OMZA 2P6TA 1IN5A 1GXQA 1FZPB 5BS6A 2R7FA 4WXCA 4Y17A 4EQQA 3QU6A 2ZFWA 2OU2A 1MKMA 4G6DA 4EV0A 1B9MA 1BIBA 2STWA 3FMRA 2W57A 5A2QK 4U0YA 5KVRA 4WXDA 4MNUA 4XLNF 3WTSC 3BROA 1TLHB 3RKYA 5FD5A 2IA2A 2YX4A 3SXYA 4ASNA 2P5LC 4HX7A 1F5TA 2HOEA 2VBWA 3P9CA 2VE8A 2DLLA 4A12A 2GAUA 2LF8A 4GYIA 1S29A 5E1WA 3SZPA 5D5WB 1IZ1A 1G3TA 3RDIA 4IHSA 1F4KA 2ISYA 2P4WA 2HQRA 3ERED 2DQRA 2VC1A 2WWYA 1G3WA 2F5FA 3ML6A 1S6LA 4EJOA 1U6GA 1A04A 3GF2A 3RPQA 1B6AA 2HZTA 4F7ZA 1QPMA 2L02A 3KEQA 3SZTA 4HA8A 2V79A 1Z9CA 1JGSA 2O0YA 3VB2A 2VN2A 1HBXG 1FP1D 4G7ZF 1KYWA 1J9IA 4EJTA 1FWZA 4L9TA 2Q2EA 4O3MA 1VTNC 4A5NA 4KN4X 1KA8A 3DV8A 1YW9A 3H92A 3R0AA 2ISZA 2ZJ2A 5LEJA 3EETA 5ILVA 4HX4A 3SFZA 1TQMA 1V4RA 2VC0A 1L3LA 1GVJA 1ZRCA 5K5OA 2VODA 1YW7A 1LDJA 1RIOH 1PUEE 3GXOA 4B8XA 4JK1X 2XIGA 4ENJA 1QZZA 4BH9A 5E8IA 4LLGF 4HBLA 5A2QZ 4HAMA 1SFEA 1X3UA 4UHTA 2STTA 2QWWA 1ZLJA 5DCFA 2FNAA 4XRFA 5D6FA 2FXAA 4WWCA 1OYYA 2P7CB 3VEPA 2HYFA 2P7VB 5K5QA 3F8NA 2Y48A 1LB2A 2DK8A 1XGOA 5E1ZB 4Y13A 1KU7A 1TTYA 2BGCA 2V6CA 2PLYA 3EYIA 2O3FA 2HTJA 3R60A 1YYVA 2G7UA 1F9NA 4A6DA 4RB1A 4L18B 3E6CC 4KMFA 3NRVA 5DEQA 1C0WA 4P9UA 4UV8A 4OIPF 3V7SA 3BJ6A 3O2PE 5J6XA 1DPRA 1MJ9A 4EJVA 2PEXA 4Q47A 1FC3A 1XDUA 1FP2A 2XHKA 2W85A 2DPDA 1IUYA 4MGRA 1J75A 5JFRA 4O6JA 3ECHA 2LDUA 4O5VA 3E3VA 3WTXC 1USSA 1ON2A 3MEXA 1U5TA 3WU0A 1G4DA 2VONA 2MBFA 2OZ6A 2VT2A 3DP7A 4AD9A 1RUOA 1P4WA 3GEZA 5FFXA 3V4GA 1J0RA 2VOOA 1G6NA 3HOTA 5JVTA 4IVNA 1BI3A 3WTUC 3M1EA 4BXUA 3MQ0A 1KU9A 1MZBA 3NQOA 4NB5A 2PBIA 4IHTA 1TQPA 3L09A 1MGTA 2DFIA 4IJAA 1FSHA 2RC4A 3L00A 3CUOA 2CFXA 1T6SA 2EK5A 1BJAA 1WKMA 2F5DA 3ZN0A 2XRNA 4LLNA 3V7CA 2WV0A 3TDZC 1PP7U 5BMZA 4YFKF 1R1VA 1SD7A 5HLIA 1ZRFA 2ADUA 4L0YB 4H0EA 1GXPA 5FLXZ 4CZZA 3HSRA 2Z9OA 1E2XA 4FHTA 3IC7A 4YIIA 3IRQA 3RKWA 1H9GA 3KFWX 1RNLA 3P9IA 2FEZA 2ZCWA 4JQFA 1YIOA 2JT1A 1U78A 2K02A 1USTA 2DTRA 2QQ9A 2R7DA 3TOAA 1FPQA 1YG2A 3GWZA 1R1TA 2KIMA 4PCQA 2CSOA 3ZP5A 1P4XA 4PDKA 3TDUC 3RIRA 3ZMZA 1WSUA 2COMA 3IKTA 3V8LA 4A0XA 2EFOA 2MH9A 5DD4A 3F6VA 2GWRA 2W25A 3M8EA 2A68F 1OR7A 3CO6C 2QVOA 1FBSA 1V3FA 1J2XA 2P5VA 1W5TA 2FF4A 4EM0B 2MA3A 1R1UA 3ULQB 2ZMEA 2KIFA 2JPBA 4RGRA 5FB2A 4HF1A 1ZN2A 1LQ1A 5E17F 2W84A 3HTUA 2D2WA 2GQQA 5HS7A 2OQGA 3C1DA 3GX4X 3KZZA 4RB2C 4ON0A 4BAYA 5BQTA 3ROUA 2PJPA 3SHFA 2R3SA 2E7XA 2DI3A 4CDGA 5DDGA 5J8FA 1QGPA 4HQMA 4I98B 2L3DA 1SMYF 5H6RA 3F8FA 2O8XA 2JRTA 3FXQA 1I1SA 3WGIA 1W4MA 1SAXA 2GXGA 3RPUA 2KJBA 4LB5A 3KZYA 2H09A 4GO1A 2QQAA 3HRUA 5ICGA 5JHUA 1AOYA 2F5CA 4AIKA 5L3DA 1U2WA 3KE2A 5CYVA 2E1NA 3J80Z 3RYRA 5K5RA 5E18F 2V1UA 3ZMUA 4LB6B 3JSOA 3L7WA 2ACJA 1LNWA 5CVUA 3MCZA 3HTSB 4EGYA 1FT9A 3DF8A 1BI2A 3I64A 3H3ZA 3HHHA 4AIHA 4PZJA 3RYPA 3JAMK 4LLLA 4R1HA 4KDPA 5ILUA 2XROA 3R61A 3ABTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBF A;  2HDC A;  4M9X A;  5LHH A;  2YU3 A;  1QNT A;  2K86 A;  2H27 A;  1T98 A;  1P6R A;  1B9N A;  1O3S A;  3E5Q A;  2JTV A;  4A2U A;  3MWM A;  3T0Y A;  3ZMD A;  3WU1 B;  3I0T A;  3D5L A;  2DBB A;  4WX9 A;  2XAF A;  1R36 A;  5JI6 A;  4PGH A;  3N4M A;  2P8T A;  2FNP A;  4IRG A;  4LFU A;  1K78 B;  4KN7 X;  3DFG A;  1O7L A;  1NHA A;  2QLZ A;  2HR3 A;  4Q4Z F;  3ABU A;  2X4H A;  4N0B A;  3DEU A;  4OIQ F;  5LRR A;  3H3U A;  2QBY A;  3MZY A;  4CHU A;  4YG2 F;  3KP4 A;  4BQA A;  3FMQ A;  4HX8 A;  1XGN A;  2MC3 A;  1XSX A;  1P2F A;  5IT3 A;  4P9F A;  2YX7 A;  1W5S A;  3I4P A;  4EM2 A;  2DO7 A;  2EB7 A;  1QZY A;  5H6Q A;  1KQ0 A;  2NRA C;  3V8K A;  2YR2 A;  2CG4 A;  4ESF A;  3JTG A;  4UUV A;  4N9H A;  2CYY A;  3I59 A;  2RV8 A;  5IT9 K;  1D5V A;  1IAW A;  6PAX A;  4LD5 A;  3ECO A;  1ONV A;  1FBU A;  2OBP A;  1QO0 D;  1RI7 A;  3U2R A;  1UCR A;  2Y0M A;  4U88 A;  4HV5 A;  2H94 A;  4FX0 A;  1MJB A;  4EGZ A;  4PGG A;  3MFK A;  2XVC A;  5L3G A;  1TW2 A;  5HDG A;  1OPC A;  2UWM A;  4RGX A;  2IVM A;  5F6F A;  3QP5 A;  5IT9 Z;  3PFI A;  2CO5 A;  3GFI A;  3Q5F A;  3F8B A;  3LA2 A;  2BYV E;  1Q1H A;  5D8L B;  2RQP A;  4KNY A;  2XV4 S;  2BEO A;  2CGP A;  1U5T C;  3CDH A;  1HQC A;  2RDP A;  3DPT A;  3P9K A;  5BPD A;  2QEN A;  3GZ6 A;  1KQ8 A;  2FSW A;  3BPX A;  3F23 A;  4MEY F;  1MJA A;  2M8E A;  4UNO A;  3LA3 A;  1J7K A;  5ICE A;  3LAP A;  3T8R A;  1SD4 A;  3AAF A;  1YFH A;  5CVV A;  3FX3 A;  3TKY A;  4M74 A;  2DQL A;  1I27 A;  4BNC A;  4KIB A;  2D45 A;  5DUK A;  5D5V B;  3WGH A;  1EH6 A;  3IKV A;  1CF7 A;  2ELH A;  4EJU A;  2FBI A;  2V1D A;  4TV7 A;  4M9Z A;  3TO6 A;  3JW4 A;  2MD5 A;  2YSR A;  4I09 A;  3NEU A;  5LGU A;  4RS8 A;  2DPU A;  3VFZ A;  1SMT A;  2QZ8 A;  4G6Q A;  3C7J A;  1OMI A;  1JXS A;  5CJ9 A;  4Y15 A;  4GGG A;  5ED4 A;  3W6K B;  2NNN A;  1XSD A;  1R22 A;  2EA4 A;  3ZMV A;  2WTE A;  3IRR A;  2DT5 A;  2V1X A;  3MZH A;  4KYW A;  2IJL A;  4ENN A;  3JTH A;  2FOK A;  4E70 A;  1B1B A;  3REO A;  1ZH5 A;  1K78 A;  2EV6 A;  2JSC A;  4KIG A;  3ZMT A;  2PMU A;  4UVB A;  2EV0 A;  2X0L A;  3F8C A;  4KUM A;  4ESB A;  1KQ9 A;  4DQ2 A;  5D4S A;  1R00 A;  2HEO A;  2MH2 A;  3Q9S A;  2HS5 A;  1XSV A;  4LK0 F;  5AIP A;  3KCC A;  2M1B A;  2MLG A;  2C6Y A;  2UXX A;  4LGW A;  3F8M A;  1YLF A;  5LRS A;  1DPU A;  3V8J A;  4WXH A;  4OIR F;  2NAZ A;  4I7H A;  3V7R A;  1IN8 A;  3M7G A;  2EJR A;  4RB3 C;  1FBQ A;  2IA1 A;  1J59 A;  3G3Z A;  1BI0 A;  3O6B B;  1RUN A;  3I53 A;  3KP6 A;  3R6S A;  3K0L A;  1FLI A;  3QAH A;  3WE3 A;  2XAG A;  1XD7 A;  2RGV A;  2PG4 A;  4ZYE A;  3EDP A;  4U0W A;  1CF7 B;  4IXA A;  1KU3 A;  5BPI A;  4RGU A;  2ETH A;  4L9N A;  2CW0 F;  2RVC A;  2XAQ A;  2KJC A;  5TJJ A;  2FQ3 A;  3J7A O;  1SD6 A;  4WCG A;  4CYD A;  4RAY A;  1SD5 A;  2VBZ A;  1HKS A;  4JBA A;  3BP8 A;  2GIV A;  3F3X A;  3BWG A;  1OYI A;  3HIF A;  3GUD A;  3FM5 A;  4ZYH A;  4KIF A;  1D3Y A;  1ON1 A;  2L54 A;  1EH8 A;  3KP5 A;  1JHF A;  4FX4 A;  1O3R A;  3U1D A;  3ZN1 A;  2J5O A;  1IRF A;  3GFJ A;  2OD5 A;  3K9T A;  2BV6 A;  1L0O C;  2PQ8 A;  1R5H A;  3I54 A;  3E6M A;  1DDN A;  5CVJ A;  2L4A A;  2M87 A;  4CXF A;  1Z1D A;  2ESN A;  5LHG A;  4IPA A;  2P6S A;  2IP2 A;  3BJA A;  5HDK A;  1ZRE A;  2RN7 A;  1QBJ A;  2HWV A;  5E20 A;  3E6B A;  2EWN A;  4HLX A;  4Q48 A;  4U0V A;  2D1V A;  4EJW A;  4MEX F;  4U7D A;  4I2O A;  4AWX B;  1KU2 A;  3GYH X;  4IF4 A;  3HRS A;  4NHJ A;  3IHU A;  2QQB A;  1UHM A;  2BE5 F;  3GO5 A;  2XKO A;  4M72 A;  1YQA A;  2JPC A;  4OU0 A;  2UXN A;  5H20 A;  1YS7 A;  2RNJ A;  1T38 A;  3J81 K;  2EA2 A;  3G73 A;  2EFP A;  4ZYG A;  4UV9 A;  3EUH A;  4OIO F;  2XAH A;  1Z6T A;  1K79 A;  2VT3 A;  5E1X A;  2TDX A;  1UB9 A;  3EQL F;  3DQV C;  4N9I A;  4KFC A;  2O6G E;  3GW2 A;  3IL2 A;  4D0P A;  4HF0 A;  5DD8 A;  2EFQ A;  3WOD F;  1D8K A;  3CO7 C;  4AIJ A;  1ZG5 A;  4QWQ A;  3CUQ B;  4A0Y A;  1U8R A;  1SFX A;  1ZAR A;  1S8N A;  3T8T A;  1XMK A;  1ZG1 A;  4BYY A;  4R79 A;  5F64 A;  3WE2 A;  1LEB A;  1IXC A;  3RKX A;  3R0J A;  1S7A A;  2OAZ A;  2Z3Y A;  4HF2 A;  3MAJ A;  3B73 A;  3M9A A;  1IRG A;  1PDN C;  2XUB A;  2IT0 A;  1P92 A;  2IRF G;  4HYE A;  2E7W A;  1DUX C;  5E8G A;  1BIA A;  4LJZ F;  5DV5 A;  4A6E A;  3C18 A;  3QPH A;  2ESH A;  2Z99 A;  2EFN A;  3RJP A;  2XAS A;  2QYO A;  4MTE A;  4OOI A;  3WTV C;  3T5X A;  2DW4 A;  5L3B A;  1WQ2 A;  1W7P A;  2L01 A;  3FXU A;  4EMS A;  2G9W A;  3I71 A;  2LKP A;  1S3J A;  1I6X A;  1YO5 C;  1T2K A;  1DP7 P;  1O7F A;  3HYI A;  2A07 F;  3W6J B;  4FT8 A;  4AVP A;  3HOS A;  2ZNY A;  4GCV A;  2HYG D;  3M8F A;  3ELK A;  4LMY A;  2FBK A;  3N97 A;  1O3Q A;  1Z05 A;  3GFM A;  2GZW A;  4IRH A;  3TQN A;  5HS9 A;  5AIQ A;  1FSE A;  3BJO A;  1ZGA A;  1LVA A;  1XMA A;  1QQI A;  1XCB A;  4KT5 C;  1XCV A;  3WTY C;  1REP C;  2P5K A;  1U5T B;  2ZXJ A;  4S04 A;  5ILS A;  3T1B A;  2JZY A;  2W24 A;  4A0Z A;  3COA C;  5LGN A;  1HW1 A;  2FML A;  4DNC A;  2ZBK A;  5ERI A;  1TNT A;  2E1C A;  3P7N A;  3QOP A;  2Y75 A;  5LBQ A;  2Q0O A;  1HW2 A;  2J5P A;  1CGP A;  1ZG3 A;  3I59 B;  4G9Y A;  4MQ9 F;  2DAO A;  4B09 A;  1Z6R A;  2Z33 A;  3FF5 A;  2VBX A;  4Q5S F;  2OZU A;  3GFL A;  1WWX A;  4BHP A;  1W7P D;  4MQV A;  2EV5 A;  4G8X A;  3CUQ A;  1STZ A;  4HDU A;  1BC8 C;  1O57 A;  4KIC A;  1ZAO A;  1HST A;  1LJ9 A;  3FMS A;  3LAJ A;  1IF1 A;  1R23 A;  1R5G A;  5D4R A;  5ICF A;  1O3T A;  4GXO A;  5D5U B;  2QBY B;  2V9V A;  4XSX F;  3TGN A;  3HSE A;  5CLS A;  3E6D A;  1LDK B;  5HLG A;  4ETS A;  1HKT A;  2M30 A;  3F6O A;  2PFB A;  3BZ6 A;  3C3W A;  2VBY A;  3GLX A;  3IWZ A;  4UVC A;  4HDV A;  1XB4 A;  3BDD A;  4G7H F;  2WC2 A;  1I5Z A;  2L4M A;  5ICC A;  4L0Z B;  2IW5 A;  4I0A A;  1RZ4 A;  2HGC A;  2LNB A;  3L9F A;  1ZHF A;  3PQK A;  4GYG A;  4MTD A;  3LFK A;  3BOQ A;  4L9V A;  2Z5U A;  3ZQ7 A;  3HRT A;  2UZK A;  3S2W A;  4CIC A;  3RI4 A;  1KYZ A;  4ZZL A;  1YTY A;  5L3C A;  2EFW A;  2M5W A;  3QU3 A;  2LF7 A;  2M45 A;  1OYW A;  3KP7 A;  1P4A A;  1XN7 A;  4LG0 A;  3IWF A;  5EEH A;  1FOK A;  1IXR C;  2H6B A;  5D8K B;  2GA1 A;  3OOP A;  5J8C A;  4M9S A;  1ZRD A;  3K69 A;  2IA0 A;  1IXS B;  1TNS A;  3I58 A;  3ISP A;  3WGG A;  5HOO A;  3K1N A;  3HHG A;  1T39 A;  2A6H F;  1JE8 A;  1TQI A;  1LEA A;  1TW3 A;  2HKX A;  4HQE A;  1AWC A;  4L5I A;  5FFZ A;  1W7P B;  3EYY A;  4I02 A;  3LA7 A;  4WF2 A;  1B59 A;  5D6E A;  4RAZ A;  5CVI A;  1LDD A;  3JSP A;  1HKQ A;  3VOD A;  3JAM Z;  2MLK A;  2K27 A;  5LLQ A;  4CO8 A;  2RKH A;  4M6X A;  5HDN A;  2O61 A;  1HSJ A;  3CUQ C;  2VXZ A;  2YPR A;  1ULY A;  3ZMS A;  1F1Z A;  2K4B A;  1HXD A;  5TRD A;  1R7J A;  2KKO A;  4HZF A;  2NYX A;  5L3E A;  2PMH A;  4ESJ A;  5FO5 A;  4ZZD A;  1KGS A;  4LG0 B;  1EV7 A;  4XSZ F;  2CQK A;  1BN5 A;  4M71 A;  4BHC A;  3J81 Z;  1BI1 A;  3O3K A;  3CLO A;  4P5O A;  1FY7 A;  3U9G A;  2VOP A;  1YS6 A;  1BOA A;  3K1M A;  3WG9 A;  2F2E A;  1ZLK A;  5AON A;  1H9T A;  3R4K A;  5DCM A;  4RB0 A;  4G94 A;  1MD0 A;  2FU4 A;  1IN7 A;  2ZO4 A;  1D8J A;  2K7L A;  3CTA A;  4U7B A;  3FWE A;  3FZV A;  4RGS A;  2FA5 A;  3E5X A;  2B0L A;  4I01 A;  1G3S A;  3QP6 A;  2XKP A;  1TBX A;  4XLP F;  4ZH4 F;  5DCM B;  1FNN A;  5DUI A;  2BBY A;  4EVI A;  4LK1 F;  1WI9 A;  2XGX A;  4ENK A;  1XGM A;  4MHG A;  4YFX F;  1HW5 A;  3QPT A;  4BHB A;  3J80 K;  2QM3 A;  3B02 A;  4I0B A;  1WRJ A;  1MDM B;  5FLX K;  3E97 A;  1K6O A;  2FE3 A;  3F72 A;  4R8H A;  2PN6 A;  4M73 A;  2HTS A;  4QLC U;  3HRM A;  3OV8 A;  2KRF A;  2FRH A;  3CJN A;  4HOB A;  3LWF A;  3KEO A;  4HLY A;  5HLH A;  2NNY A;  1OKR A;  1XDS A;  3LQQ A;  5FD6 A;  3KET A;  5L3F A;  1JHH A;  1ZGJ A;  4YIF A;  4EM1 A;  3BPV A;  2HQN A;  1E17 A;  4K2E A;  3VOE A;  2K4J A;  2FMY A;  3RTR A;  2A69 F;  1BM9 A;  1T0F A;  1GHC A;  4HW0 A;  5JR3 A;  2ZME B;  5DYM A;  2NS0 A;  3L2C A;  1FX7 A;  2A5Y B;  3GVA A;  4KA4 A;  5KK1 A;  5CVR A;  2AS5 F;  4P55 A;  4A5M A;  1FYK A;  1B4A A;  2DU9 A;  1ZYR F;  2PI0 A;  1MDM A;  1G3Y A;  4OIN F;  2D1H A;  3FM3 A;  5D5X B;  1Z7U A;  3LQR A;  1I1G A;  5LEK A;  3HSF A;  3WTZ A;  3KLO A;  1PP8 F;  3Q9V A;  2AXL A;  4M6Y A;  4P96 A;  2KIU A;  4ENM A;  1BBY A;  3D0S A;  4UXN A;  3DXJ F;  2A6E F;  2IPQ X;  1FYM A;  3LST A;  1FYL A;  5F1R A;  2CWE A;  5HVQ C;  2VE9 A;  4IRI A;  3K1P A;  3E5U A;  1Y0U A;  4NQW A;  3F21 A;  2XAJ A;  3DKW A;  2ZKZ A;  2F5E A;  1IW7 F;  5HS8 A;  1ODD A;  3GZ5 A;  1H0M A;  1XGS A;  5K1Y A;  2FBH A;  3FHZ A;  3TO9 A;  1UFM A;  1R58 A;  5BOX A;  1IN4 A;  5EEG A;  3KP3 A;  3BY6 A;  4YFN F;  4S05 A;  2ZNZ A;  3WTT C;  4G7O F;  4OMY A;  1IN6 A;  1BC7 C;  2A3S A;  5LGT A;  1UHW A;  2OA4 A;  3PQJ A;  2DK5 A;  1J5Y A;  2Q8K A;  2A61 A;  3SQN A;  3KP2 A;  3F22 A;  2GA2 A;  4WK8 F;  4Z2Y A;  3HUG A;  3FXR A;  4UVA A;  1U3E M;  3K2Z A;  5FGM A;  3DPL C;  2LSO A;  4HV6 A;  3ZPL A;  1S7O A;  2G7H A;  2GXB A;  4L5J A;  5LHI A;  3WTW C;  1Z91 A;  3TO7 A;  1K7A A;  2QUF A;  3KLN A;  4KMU X;  1EH7 A;  4CGZ A;  3QRF F;  4L9J A;  1YW8 A;  4ZYD A;  2H6C A;  2HKO A;  1SFU A;  2OQR A;  2O03 A;  2HFH A;  3TOB A;  3I5U A;  4OMZ A;  2P6T A;  1IN5 A;  1GXQ A;  1FZP B;  5BS6 A;  2R7F A;  4WXC A;  4Y17 A;  4EQQ A;  3QU6 A;  2ZFW A;  2OU2 A;  1MKM A;  4G6D A;  4EV0 A;  1B9M A;  1BIB A;  2STW A;  3FMR A;  2W57 A;  5A2Q K;  4U0Y A;  5KVR A;  4WXD A;  4MNU A;  4XLN F;  3WTS C;  3BRO A;  1TLH B;  3RKY A;  5FD5 A;  2IA2 A;  2YX4 A;  3SXY A;  4ASN A;  2P5L C;  4HX7 A;  1F5T A;  2HOE A;  2VBW A;  3P9C A;  2VE8 A;  2DLL A;  4A12 A;  2GAU A;  2LF8 A;  4GYI A;  1S29 A;  5E1W A;  3SZP A;  5D5W B;  1IZ1 A;  1G3T A;  3RDI A;  4IHS A;  1F4K A;  2ISY A;  2P4W A;  2HQR A;  3ERE D;  2DQR A;  2VC1 A;  2WWY A;  1G3W A;  2F5F A;  3ML6 A;  1S6L A;  4EJO A;  1U6G A;  1A04 A;  3GF2 A;  3RPQ A;  1B6A A;  2HZT A;  4F7Z A;  1QPM A;  2L02 A;  3KEQ A;  3SZT A;  4HA8 A;  2V79 A;  1Z9C A;  1JGS A;  2O0Y A;  3VB2 A;  2VN2 A;  1HBX G;  1FP1 D;  4G7Z F;  1KYW A;  1J9I A;  4EJT A;  1FWZ A;  4L9T A;  2Q2E A;  4O3M A;  1VTN C;  4A5N A;  4KN4 X;  1KA8 A;  3DV8 A;  1YW9 A;  3H92 A;  3R0A A;  2ISZ A;  2ZJ2 A;  5LEJ A;  3EET A;  5ILV A;  4HX4 A;  3SFZ A;  1TQM A;  1V4R A;  2VC0 A;  1L3L A;  1GVJ A;  1ZRC A;  5K5O A;  2VOD A;  1YW7 A;  1LDJ A;  1RIO H;  1PUE E;  3GXO A;  4B8X A;  4JK1 X;  2XIG A;  4ENJ A;  1QZZ A;  4BH9 A;  5E8I A;  4LLG F;  4HBL A;  5A2Q Z;  4HAM A;  1SFE A;  1X3U A;  4UHT A;  2STT A;  2QWW A;  1ZLJ A;  5DCF A;  2FNA A;  4XRF A;  5D6F A;  2FXA A;  4WWC A;  1OYY A;  2P7C B;  3VEP A;  2HYF A;  2P7V B;  5K5Q A;  3F8N A;  2Y48 A;  1LB2 A;  2DK8 A;  1XGO A;  5E1Z B;  4Y13 A;  1KU7 A;  1TTY A;  2BGC A;  2V6C A;  2PLY A;  3EYI A;  2O3F A;  2HTJ A;  3R60 A;  1YYV A;  2G7U A;  1F9N A;  4A6D A;  4RB1 A;  4L18 B;  3E6C C;  4KMF A;  3NRV A;  5DEQ A;  1C0W A;  4P9U A;  4UV8 A;  4OIP F;  3V7S A;  3BJ6 A;  3O2P E;  5J6X A;  1DPR A;  1MJ9 A;  4EJV A;  2PEX A;  4Q47 A;  1FC3 A;  1XDU A;  1FP2 A;  2XHK A;  2W85 A;  2DPD A;  1IUY A;  4MGR A;  1J75 A;  5JFR A;  4O6J A;  3ECH A;  2LDU A;  4O5V A;  3E3V A;  3WTX C;  1USS A;  1ON2 A;  3MEX A;  1U5T A;  3WU0 A;  1G4D A;  2VON A;  2MBF A;  2OZ6 A;  2VT2 A;  3DP7 A;  4AD9 A;  1RUO A;  1P4W A;  3GEZ A;  5FFX A;  3V4G A;  1J0R A;  2VOO A;  1G6N A;  3HOT A;  5JVT A;  4IVN A;  1BI3 A;  3WTU C;  3M1E A;  4BXU A;  3MQ0 A;  1KU9 A;  1MZB A;  3NQO A;  4NB5 A;  2PBI A;  4IHT A;  1TQP A;  3L09 A;  1MGT A;  2DFI A;  4IJA A;  1FSH A;  2RC4 A;  3L00 A;  3CUO A;  2CFX A;  1T6S A;  2EK5 A;  1BJA A;  1WKM A;  2F5D A;  3ZN0 A;  2XRN A;  4LLN A;  3V7C A;  2WV0 A;  3TDZ C;  1PP7 U;  5BMZ A;  4YFK F;  1R1V A;  1SD7 A;  5HLI A;  1ZRF A;  2ADU A;  4L0Y B;  4H0E A;  1GXP A;  5FLX Z;  4CZZ A;  3HSR A;  2Z9O A;  1E2X A;  4FHT A;  3IC7 A;  4YII A;  3IRQ A;  3RKW A;  1H9G A;  3KFW X;  1RNL A;  3P9I A;  2FEZ A;  2ZCW A;  4JQF A;  1YIO A;  2JT1 A;  1U78 A;  2K02 A;  1UST A;  2DTR A;  2QQ9 A;  2R7D A;  3TOA A;  1FPQ A;  1YG2 A;  3GWZ A;  1R1T A;  2KIM A;  4PCQ A;  2CSO A;  3ZP5 A;  1P4X A;  4PDK A;  3TDU C;  3RIR A;  3ZMZ A;  1WSU A;  2COM A;  3IKT A;  3V8L A;  4A0X A;  2EFO A;  2MH9 A;  5DD4 A;  3F6V A;  2GWR A;  2W25 A;  3M8E A;  2A68 F;  1OR7 A;  3CO6 C;  2QVO A;  1FBS A;  1V3F A;  1J2X A;  2P5V A;  1W5T A;  2FF4 A;  4EM0 B;  2MA3 A;  1R1U A;  3ULQ B;  2ZME A;  2KIF A;  2JPB A;  4RGR A;  5FB2 A;  4HF1 A;  1ZN2 A;  1LQ1 A;  5E17 F;  2W84 A;  3HTU A;  2D2W A;  2GQQ A;  5HS7 A;  2OQG A;  3C1D A;  3GX4 X;  3KZZ A;  4RB2 C;  4ON0 A;  4BAY A;  5BQT A;  3ROU A;  2PJP A;  3SHF A;  2R3S A;  2E7X A;  2DI3 A;  4CDG A;  5DDG A;  5J8F A;  1QGP A;  4HQM A;  4I98 B;  2L3D A;  1SMY F;  5H6R A;  3F8F A;  2O8X A;  2JRT A;  3FXQ A;  1I1S A;  3WGI A;  1W4M A;  1SAX A;  2GXG A;  3RPU A;  2KJB A;  4LB5 A;  3KZY A;  2H09 A;  4GO1 A;  2QQA A;  3HRU A;  5ICG A;  5JHU A;  1AOY A;  2F5C A;  4AIK A;  5L3D A;  1U2W A;  3KE2 A;  5CYV A;  2E1N A;  3J80 Z;  3RYR A;  5K5R A;  5E18 F;  2V1U A;  3ZMU A;  4LB6 B;  3JSO A;  3L7W A;  2ACJ A;  1LNW A;  5CVU A;  3MCZ A;  3HTS B;  4EGY A;  1FT9 A;  3DF8 A;  1BI2 A;  3I64 A;  3H3Z A;  3HHH A;  4AIH A;  4PZJ A;  3RYP A;  3JAM K;  4LLL A;  4R1H A;  4KDP A;  5ILU A;  2XRO A;  3R61 A;  3ABT A; 
#chains in the Genus database with same CATH topology
 2R7Z J;  4XBF A;  2XSJ C;  2EIJ H;  2DMT A;  2BW3 B;  2HDC A;  4M9X A;  3ZGK A;  5LHH A;  2UV1 A;  2K3F A;  2L7M P;  2YU3 A;  1XS9 A;  2LRE A;  5KHD A;  1QNT A;  3LNQ A;  2HI3 A;  2K86 A;  3AFH A;  2AXT C;  1PUF A;  2H27 A;  2ECB A;  1T98 A;  1P6R A;  2VXD A;  1TL8 A;  1PYV A;  3OIO A;  1B9N A;  1H8A C;  4II3 A;  5FKN A;  1O3S A;  2JQ7 A;  3E5Q A;  4D7M A;  2JTV A;  4A2U A;  3KYC B;  3MWM A;  3T0Y A;  3ZMD A;  2VKH A;  3IUO A;  3I0T A;  3WU1 B;  3D5L A;  2DBB A;  4FAS D;  4A3K J;  1YJ9 I;  1Y56 A;  4WX9 A;  2XAF A;  3IH4 A;  3EUH C;  1K4T A;  1R36 A;  5JI6 A;  1QZE A;  1IDZ A;  3JRI A;  2R93 J;  3BCA A;  4I76 A;  4PGH A;  3N4M A;  3D5R C;  2P8T A;  2FNP A;  2CUF A;  4IRG A;  4CCL A;  2K5C A;  4DYQ A;  4LFU A;  1K78 B;  3ZQG A;  4F93 B;  4KN7 X;  1DGW Y;  1SVL A;  3DFG A;  5C44 J;  1O7L A;  1NHA A;  2QLZ A;  1YI2 I;  2JA5 J;  1TZL A;  2HR3 A;  1SC7 A;  2M4K A;  4Q4Z F;  3ABU A;  2X4H A;  4N0B A;  2KIS A;  3DEU A;  4OIQ F;  4GFB A;  1OJL A;  1TWC J;  5LRR A;  3OSF A;  3H3U A;  2QBY A;  3MZY A;  2ZC2 A;  4CHU A;  2LY9 A;  4XNF A;  3KP4 A;  4I99 C;  4UB6 C;  4YG2 F;  3FMQ A;  4BQA A;  3CQZ J;  4HX8 A;  4NC7 A;  2NXN B;  1XGN A;  1RKW A;  2MC3 A;  3OS0 A;  1XSX A;  1P2F A;  5IT3 A;  1JTY A;  4P9F A;  2YX7 A;  1W5S A;  3I4P A;  3PUF A;  4EM2 A;  2DO7 A;  2EB7 A;  4RLQ A;  1Z0X A;  1QZY A;  5H6Q A;  3G1O A;  1K61 A;  4XKB A;  5IOZ A;  1D1C A;  1KQ0 A;  2GOX B;  5CQE A;  1VQK I;  2NRA C;  3V8K A;  2CH0 A;  2YR2 A;  2CG4 A;  5J3L A;  1W1W E;  4ESF A;  2NOG A;  2RQQ A;  1WFX A;  1IGN A;  3OR2 C;  1WJ5 A;  3JTG A;  3HOW J;  5J40 A;  3E0J B;  4UUV A;  4N9H A;  1G8X A;  2CYY A;  3LSP A;  3I59 A;  2RV8 A;  5IT9 K;  4IQJ A;  1D5V A;  1IAW A;  6PAX A;  4LD5 A;  3D5S C;  5EF6 A;  4IQ4 A;  3W2A A;  3ECO A;  3RSN A;  1ONV A;  4M3G A;  1FBU A;  3ZRG A;  4ZDO A;  1AKH B;  1YIJ I;  3PSI A;  2OBP A;  1QO0 D;  1RI7 A;  1Y8Q B;  2F6C A;  3U2R A;  2ME0 A;  1UCR A;  1X19 A;  2Y0M A;  4HV5 A;  4U88 A;  3OYN A;  3W6V A;  4E7J A;  2H94 A;  4FX0 A;  1MJB A;  4EGZ A;  5E3N A;  4PGG A;  3MFK A;  1VQM I;  1YHQ I;  2HZD A;  4MFD A;  2XVC A;  4F91 B;  5L3G A;  3DKY A;  1TW2 A;  5HDG A;  5TGT A;  2JWT A;  2CQX A;  1OPC A;  3GTK J;  2EIM H;  2UWM A;  5J1R A;  4C2M J;  2E2J J;  2ME6 A;  4PK4 A;  1TWH J;  3JR9 A;  1WZ2 A;  2V9K A;  1ZK8 A;  3FKI J;  4RGX A;  2CUZ A;  1WGX A;  3DEE A;  2IVM A;  5F6F A;  3QP5 A;  3OWT A;  4B3A A;  5IT9 Z;  2DT6 A;  4FE4 A;  3PFI A;  1BR4 A;  2CO5 A;  3GFI A;  3Q5F A;  3F8B A;  1VZ0 A;  3LA2 A;  2DA5 A;  2BYV E;  1Q1H A;  1X1D A;  3CC4 I;  4P1W A;  3S15 J;  5D8L B;  4LIT A;  3DTI A;  4JYK A;  2COB A;  2RQP A;  2UUZ A;  3CLQ A;  1D1B A;  1I3Q J;  4KNY A;  1ETY A;  2XV4 S;  2BEO A;  2CGP A;  4Z6Y A;  1EF4 A;  1U5T C;  2ZXI A;  3K70 C;  2VJI A;  3CDH A;  3RKQ A;  1HQC A;  4DW6 A;  3FBI B;  2RDP A;  2JA8 J;  3DPT A;  3P9K A;  5BPD A;  2LKX A;  2QEN A;  3HOV J;  3GZ6 A;  3GTQ J;  2FSW A;  1KQ8 A;  1DQU A;  3BZK A;  3BPX A;  2CV2 A;  3F23 A;  4MEY F;  1MJA A;  2M8E A;  4UNO A;  3LA3 A;  1J7K A;  5ICE A;  3PM1 A;  3LAP A;  3T8R A;  4ZDL A;  1GUU A;  3EPZ A;  3FIS A;  1SD4 A;  5GP9 A;  1UG2 A;  3AAF A;  1DP3 A;  2L9R A;  2LR8 A;  1YFH A;  4ZC3 A;  5CVV A;  3FX3 A;  3TKY A;  2HQA A;  2ICW G;  3I4M J;  4N4O B;  3KYD B;  4M74 A;  2VQG A;  4LIU A;  2CMP A;  3M3Y J;  2DQL A;  1I27 A;  4A3I J;  2CJJ A;  4XQF A;  1AHD P;  2D5V A;  4KIB A;  4BNC A;  2D45 A;  1VQ6 I;  1D0Y A;  5DUK A;  5D5V B;  1MH4 A;  3ABL H;  4YEL A;  5DTD A;  3WGH A;  1EH6 A;  3B6A A;  3IKV A;  5LFA A;  2AO9 A;  1CF7 A;  2O9L A;  2ELH A;  2V7F A;  2IGO A;  4EJU A;  2FBI A;  2V1D A;  4TV7 A;  4M9Z A;  1OCZ H;  3TO6 A;  3MKZ A;  3OL4 A;  3K2A A;  2MC4 A;  3AL0 C;  3JW4 A;  2MD5 A;  2AHQ A;  4Y7N J;  2YSR A;  1FMV A;  3NEU A;  4I09 A;  4F52 A;  5LGU A;  4RS8 A;  3OYG A;  2DPU A;  3VFZ A;  2JA6 J;  2LVS A;  1SMT A;  3DBH B;  2QZ8 A;  4G6Q A;  3C7J A;  1LFB A;  1HCR A;  1A36 A;  2BZT A;  1NG6 A;  1G59 A;  1OMI A;  3IAM 2;  3LSI A;  1JXS A;  5CJ9 A;  5M5W J;  4Y15 A;  4GGG A;  4LIV A;  5ED4 A;  5FRN A;  3W6K B;  2X6W A;  2FOW A;  2NNN A;  1XSD A;  1R22 A;  2EA4 A;  3BG6 A;  3ZMV A;  2WTE A;  4B48 A;  4HPQ A;  1ETQ A;  3NWS A;  1JKR C;  3IRR A;  3H0G J;  2DT5 A;  3BCB A;  5B3S H;  3BZC A;  2V1X A;  1HF0 A;  2VAS A;  2XPU A;  1Q1V A;  4B44 A;  2H1L A;  3BR2 A;  3MZH A;  1VQ5 I;  4KYW A;  3S1Q J;  3K4C A;  2R4G A;  2IJL A;  4ENN A;  3QYB A;  1XTA A;  1CQT A;  2KL4 A;  4E7I A;  1WJE A;  3MKW B;  3JTH A;  2VJ4 A;  2FOK A;  1SEU A;  3BQZ A;  5J1U A;  4E70 A;  2OUM A;  4PJL A;  1B1B A;  3REO A;  1ZH5 A;  3HXL A;  1K78 A;  2EV6 A;  2DOD A;  1NK3 P;  2X1E A;  2JSC A;  3JRB A;  4KIG A;  3ZMT A;  4C2T A;  3Q0V A;  2PMU A;  4UVB A;  3BLY A;  2LKS A;  1JJ8 C;  2EV0 A;  2X0L A;  3F8C A;  4BQQ A;  4KUM A;  4ESB A;  3UKG A;  1KQ9 A;  4DQ2 A;  5D4S A;  4RDU A;  3DU5 A;  1Y8R B;  1R00 A;  2HEO A;  5M3M J;  1MMG A;  2MH2 A;  3Q9S A;  4HNU A;  4M6V A;  4YRV A;  2DCE A;  2HS5 A;  1XSV A;  4YIR X;  4LK0 F;  5AIP A;  3KCC A;  1S9H A;  2M1B A;  2H8W A;  1FJL A;  2NVY J;  2MLG A;  1FTT A;  1A35 A;  3S1M J;  1P7I A;  2UXX A;  3PNV A;  2C6Y A;  2VQL A;  2DMQ A;  2JVG A;  3S14 J;  2BW3 A;  3S8P A;  3CP8 A;  4XKW A;  4XID A;  4LGW A;  4PJN A;  4BEH B;  2O5R A;  1YLF A;  3F8M A;  5LRS A;  4BQO A;  1JGG A;  1DPU A;  3I4N J;  2XPV A;  2A6T A;  3V8J A;  2R7V A;  4WXH A;  5EGO B;  4JX6 A;  4OIR F;  1FIA A;  3JRD A;  3LOC A;  2NAZ A;  2DT7 B;  4I7H A;  3V7R A;  1HC8 A;  3L2V A;  3LSG A;  1IN8 A;  4W97 A;  3FXM A;  3CJQ B;  3M7G A;  2M34 A;  1W36 C;  2L7K A;  2X6O A;  2EJR A;  2QCO A;  5GTI C;  2W82 A;  1N25 A;  4BBS J;  1IO2 A;  4RB3 C;  4XLA A;  1FBQ A;  4FIS A;  5CPR B;  1R9T J;  1I50 J;  2IA1 A;  4AYB A;  3S3N A;  3BR6 A;  3H35 A;  2IXS A;  1J59 A;  4A3G J;  5M3F J;  3G3Z A;  1R6R A;  3OYI A;  1BI0 A;  3O6B B;  3HL2 A;  1RUN A;  3I53 A;  3KP6 A;  3R6S A;  3K0L A;  1FLI A;  3QAH A;  3WE3 A;  2LH9 A;  2XAG A;  1TWF J;  1W0T A;  2KP6 A;  1XD7 A;  2RGV A;  1QA6 A;  2PG4 A;  4ZYE A;  1MSF C;  1QU3 A;  4AUX A;  4BAC A;  3EDP A;  3OIP A;  3L2W A;  2JSP A;  4U0W A;  1CF7 B;  4IXA A;  1KU3 A;  5BPI A;  3C2B A;  4IEJ A;  4RGU A;  2ETH A;  3H5A A;  2KT0 A;  4L9N A;  3VSK A;  2Y69 H;  2CW0 F;  2RVC A;  2XAQ A;  1ACI A;  3DPU A;  1GV5 A;  2KJC A;  5TJJ A;  2FQ3 A;  3SEZ A;  1OLT A;  3J7A O;  1SD6 A;  1X3W B;  4WCG A;  5DM6 F;  2KLO A;  4CYD A;  2DTZ A;  4RAY A;  1VQL I;  1P7J A;  3E1S A;  1SD5 A;  2VBZ A;  1HKS A;  4JBA A;  3S3O A;  3BP8 A;  2GIV A;  4IO9 F;  3F3X A;  2CS3 A;  2EH3 A;  3BWG A;  1OYI A;  2LYC A;  3DTE A;  3HIF A;  2QGU A;  1BOB A;  3GUD A;  3FM5 A;  1OCP A;  4ZYH A;  4KIF A;  3TP3 A;  1D3Y A;  2ZFU A;  5EGO A;  2DXI A;  3ERM A;  2LC2 A;  1ON1 A;  3VWB A;  3S16 J;  1R5I D;  2L54 A;  1EH8 A;  4MLO A;  2X6Y A;  3KP5 A;  2R7Q A;  4M3D A;  4BEH A;  1JHF A;  4D1Q A;  4XOT A;  4FX4 A;  1O3R A;  3U1D A;  3VYT B;  2J5O A;  3ZN1 A;  1IRF A;  3GFJ A;  2OD5 A;  1S7E A;  3K9T A;  2BV6 A;  2XB5 A;  3HPG A;  1L0O C;  4UB8 C;  2PQ8 A;  1R5H A;  3I54 A;  2E35 A;  3E6M A;  1Z3Y A;  1DDN A;  2R5Y A;  1R49 A;  5CVJ A;  2L4A A;  2M87 A;  4CXF A;  2ZJP F;  1Z1D A;  1E3O C;  2ESN A;  1K83 J;  5IP6 A;  5LHG A;  4IPA A;  2P6S A;  2WB1 A;  2VPL A;  2IP2 A;  3BJA A;  2M4G A;  5HDK A;  1ZRE A;  4U87 A;  3WU2 C;  1JTX A;  1EJ9 A;  3F0C A;  2W7N A;  4AVZ A;  3FIW A;  2BHY A;  2RN7 A;  1QBJ A;  2X9D A;  3CCY A;  4HST A;  2HWV A;  4E7H A;  5E20 A;  1NTC A;  1AKH A;  5FKL A;  3E6B A;  2EWN A;  2R7S A;  4HLX A;  4Q48 A;  1UMQ A;  4U0V A;  2L9V A;  2KZV A;  4XLF A;  2XF6 A;  1T56 A;  4UY8 I;  3OYF A;  2LLK A;  2D1V A;  1VQ7 I;  2IEK A;  3CCR I;  4EJW A;  5LD2 C;  1SVO A;  2F5V A;  3BR1 A;  4C3H J;  2R7R A;  1U8B A;  4MEX F;  5BNG A;  4U7D A;  4I2O A;  4XOR A;  4AWX B;  1KU2 A;  3GYH X;  3JRA A;  4IF4 A;  3HRS A;  4NHJ A;  3IHU A;  2QQB A;  1YIT I;  1UHM A;  2E2H J;  4PJJ A;  2BE5 F;  3VSL A;  2CV1 A;  3ABK H;  3SJM A;  3GO5 A;  4PSW A;  1A31 A;  2XKO A;  1FOY A;  2DFE A;  4XN3 A;  3OMY A;  2HVR A;  1MBG A;  1XX5 A;  4M72 A;  3A03 A;  1YQA A;  2JPC A;  4BXF A;  4ZTJ A;  2EIL H;  1OR7 C;  2UXN A;  4OU0 A;  5H20 A;  1YS7 A;  4C9Y A;  2RNJ A;  1T38 A;  3OY9 A;  2WAF A;  1ZR4 A;  2GBY A;  3J81 K;  2EA2 A;  5FLM J;  2IS6 A;  2L7Z A;  3G73 A;  2EFP A;  4ZYG A;  4UV9 A;  3EUH A;  4OIO F;  3FXJ A;  2O8K A;  2XAH A;  1Z6T A;  2K3P A;  3BG3 A;  1K79 A;  1MMA A;  1QHG A;  3JRF A;  2VT3 A;  5E1X A;  3VYR B;  3A4C A;  2F4I A;  2HXI A;  1UB9 A;  2AQF A;  2TDX A;  3EQL F;  3Q3S A;  5K7Z A;  3DQV C;  4N9I A;  1G2H A;  4BQN A;  4KFC A;  2KFD A;  2O6G E;  1W36 D;  4XKV A;  5GAG J;  2DOA A;  3GW2 A;  3JRG A;  3OIQ A;  3SDG A;  3IL2 A;  3CMY A;  3S93 A;  2B63 J;  2RRE A;  4D0P A;  1UAA A;  3O8H A;  4HF0 A;  2MYS A;  5DD8 A;  2EFQ A;  3G4S I;  3WOD F;  1D8K A;  3CO7 C;  2VB6 A;  4V2F A;  4AIJ A;  1ZG5 A;  4QWQ A;  1FTZ A;  2X48 A;  3CUQ B;  4A0Y A;  1U8R A;  1SFX A;  1MIJ A;  1ZAR A;  5M5Y J;  1S8N A;  3T8T A;  1XMK A;  2VPR A;  1ZG1 A;  4BYY A;  4XR6 A;  2TRT A;  4R79 A;  2M0C A;  4DIQ A;  2BY2 A;  4ABZ A;  1MBF A;  5F64 A;  2E5N A;  3WE2 A;  1HDD C;  1LEB A;  1IXC A;  3RKX A;  3R0J A;  3EUA A;  1S7A A;  2OAZ A;  2Z3Y A;  1YX5 A;  4HF2 A;  4A3F J;  3WHC A;  3MAJ A;  2M0M A;  1Z7L A;  3B73 A;  3M9A A;  1I3A A;  1X58 A;  1PDN C;  1IRG A;  2XUB A;  2X6X A;  2PMZ N;  1MSE C;  3S1R J;  2IT0 A;  1P92 A;  3SDB A;  2IRF G;  5IP9 J;  1B72 A;  4HYE A;  2E7W A;  1DUX C;  1XMX A;  5E8G A;  3WG7 H;  1BIA A;  4LJZ F;  2DDB A;  5DV5 A;  3C18 A;  3HGY A;  3U1K A;  4A6E A;  3QPH A;  2ESH A;  3VYS B;  4BUP A;  4CCM A;  2Z99 A;  1LPQ A;  3H9J A;  2EFN A;  3PO2 J;  3LL7 A;  1BJZ A;  3RJP A;  2LK2 A;  2XAS A;  2QYO A;  1WH5 A;  1IRX A;  1JT6 A;  2V6E A;  4N4N B;  1X4O A;  4MTE A;  4OOI A;  1R4N B;  4XRS G;  4ANJ A;  3WTV C;  3T5X A;  4X1E A;  3A0B C;  1N75 A;  2DW4 A;  2M2E A;  5L3B A;  1BR2 A;  1RKT A;  2OCE A;  4F55 A;  4DZJ A;  1D0Z A;  4RAG A;  1WQ2 A;  2EBI A;  1PVE A;  1W7P A;  3IAS 2;  3CCE I;  1IV8 A;  2L01 A;  4XN0 A;  1T08 B;  1LE8 A;  3FXU A;  4EMS A;  1TT0 A;  2G9W A;  1ENH A;  2LKP A;  3I71 A;  1ORK A;  1S3J A;  1I6X A;  1LFU P;  3BR3 A;  3JRH A;  1YO5 C;  3LSK A;  2CV0 A;  2VJJ A;  3C2G A;  1T2K A;  1O7F A;  3HYI A;  1DP7 P;  2R7X A;  4XON A;  4XM3 A;  2A07 F;  3W6J B;  4GRI A;  4FT8 A;  3S1N J;  4RA2 A;  2IGM A;  1JKP C;  4AVP A;  2L9N A;  2HU9 A;  2VQC A;  4QIW N;  3HOS A;  3DBL B;  3OS1 A;  1OCC H;  1WCM J;  2ZNY A;  4GCV A;  2HYG D;  3M8F A;  3ELK A;  1X2N A;  2IS2 A;  4LMY A;  1LE8 B;  2Y0S A;  2FBK A;  3N97 A;  4A3J J;  4C2U A;  2E19 A;  4ZJZ A;  5IPA A;  1O3Q A;  3S2D J;  1Z05 A;  3GFM A;  2M9H A;  4CCK A;  3CP2 A;  2GZW A;  4IRH A;  2LRD A;  3M1C A;  3TQN A;  3LFU A;  5HS9 A;  5TIS C;  2DFH A;  5AIQ A;  2ZME C;  1FSE A;  4EAT A;  3BJO A;  3KZI C;  5F04 A;  2XDV A;  4E7K A;  1ZGA A;  1LVA A;  1JUP A;  3DCF A;  1XMA A;  1QQI A;  1XCB A;  1SVM A;  1XCV A;  3HBL A;  4KT5 C;  3WTY C;  1REP C;  3QQA A;  1GT0 C;  2RAE A;  2P5K A;  4BU2 A;  5M5X J;  1U5T B;  1RC9 A;  2ZXJ A;  2BY3 A;  1JKO C;  2W00 A;  4S04 A;  1A5J A;  1HOM A;  5ILS A;  3T1B A;  4A93 J;  1F43 A;  1RES A;  2JZY A;  2W24 A;  3NAU A;  4A0Z A;  4BKX A;  5LGN A;  1HW1 A;  2FML A;  3COA C;  2R0Q C;  4DNC A;  2ZBK A;  2VI6 A;  5ERI A;  3G2B A;  1ZQ3 P;  1TNT A;  2BXY A;  2E1C A;  3X2Q H;  2M7B A;  2E34 A;  3P7N A;  2VKE A;  4HG2 A;  3QOP A;  3UNG C;  2Y75 A;  5LBQ A;  2Q0O A;  1HW2 A;  2J5P A;  1CGP A;  2HXO A;  2HQ5 A;  1ZG3 A;  3I59 B;  4G9Y A;  4MQ9 F;  2DAO A;  4B09 A;  1Z6R A;  2Z33 A;  3G71 I;  1ETK A;  3FF5 A;  2VBX A;  4Q5S F;  3W2W A;  2OZU A;  3GFL A;  3HUG B;  2XSD C;  4DZP A;  1WWX A;  2DA6 A;  4BHP A;  1W7P D;  1BR1 A;  2LTP A;  4MQV A;  4XRM A;  2QKL B;  2L5Q A;  3BTI A;  3DLA A;  4AYB N;  2EV5 A;  4G8X A;  3IH3 A;  3D1N I;  3CUQ A;  2HOA A;  4RM3 A;  1STZ A;  4HDU A;  4KIT B;  1B8I B;  1O57 A;  5B66 C;  1BC8 C;  2IBD A;  4KIC A;  1ZAO A;  1HST A;  1LJ9 A;  2XF5 A;  3FMS A;  3LAJ A;  1IF1 A;  3PFY A;  1R23 A;  4CCO A;  1R5G A;  5D4R A;  5ICF A;  3ABM H;  2FUG 2;  1X1C A;  1O3T A;  4GXO A;  5D5U B;  3CCV I;  3HG9 A;  4M3F A;  2QBY B;  2V9V A;  4XSX F;  2OTL I;  3TGN A;  3HSE A;  3G1M A;  3L1P A;  2ZXW H;  5CLS A;  3GTL J;  3E6D A;  1LDK B;  2HOT A;  3LSJ A;  2MG4 A;  5HLG A;  4ETS A;  4J01 A;  1HKT A;  1F36 A;  5KAI C;  1D5Y A;  2M30 A;  3F6O A;  2PFB A;  3BZ6 A;  3C3W A;  2DYS H;  5J47 A;  2VBY A;  1YJN I;  2R7O A;  3GLX A;  2Y0S N;  2KIQ A;  3IWZ A;  3RZO J;  1V5E A;  1V5F A;  4UVC A;  4HDV A;  1U9O A;  1XB4 A;  2XAU A;  2DYR H;  3BDD A;  3HKZ N;  4G7H F;  4V2G A;  2WC2 A;  1IRZ A;  1I5Z A;  2L4M A;  4HEA 2;  5ICC A;  4L0Z B;  1AA7 A;  2IW5 A;  4I0A A;  1SFO J;  5C4X J;  2R5Z A;  1X2M A;  3CCQ I;  1ETW A;  3QYE A;  1RZ4 A;  4UUS A;  2HGC A;  2LP0 A;  2LNB A;  1SFK A;  3MD2 A;  4Y3O A;  4MO7 A;  2MFZ A;  3B6C A;  3L9F A;  1ZHF A;  3PQK A;  4GYG A;  4MTD A;  1W0U A;  1VQ9 I;  3LFK A;  3BOQ A;  3TW6 A;  4M3B A;  1JT0 A;  2WB1 N;  2Z5U A;  4L9V A;  3ZOB A;  3ZQ7 A;  3HRT A;  2UZK A;  2MSY A;  3ZQF A;  3S2W A;  4CIC A;  2QKM B;  5J1Y A;  1KYZ A;  4ZZL A;  3RI4 A;  1YTY A;  5L3C A;  2EFW A;  2M5W A;  3QU3 A;  2LF7 A;  2M45 A;  2HVQ A;  1OYW A;  2R7T A;  3KP7 A;  3SFI A;  1HLV A;  5GTH C;  4S0H B;  2E36 A;  1P4A A;  1XN7 A;  1WI3 A;  4LG0 A;  3IWF A;  4AU7 A;  4BXX J;  4I6Z A;  5EEH A;  1TC3 C;  1FOK A;  1IXR C;  2H6B A;  3GZN B;  5D8K B;  2GA1 A;  3K4N A;  3NWT A;  2Y2Z A;  5FRO A;  3OOP A;  4B3X A;  3PO3 J;  2KRH A;  3PUB A;  5J8C A;  4A3D J;  4Y33 A;  4M9S A;  1ZRD A;  3A01 B;  2CQN A;  4A3M J;  1T95 A;  3HKZ A;  3K69 A;  5IYC J;  2IA0 A;  1IXS B;  1MMS A;  5E79 C;  1TNS A;  3M4O J;  3AG4 H;  3I58 A;  2DJI A;  3ISP A;  3WGG A;  4DOZ A;  1HA8 A;  2MGQ A;  5HOO A;  4CYC A;  3K1N A;  3HHG A;  1T39 A;  1QVU A;  2A6H F;  5GPA A;  1JE8 A;  1TQI A;  1LEA A;  1K6Y A;  1TW3 A;  2HKX A;  3HC7 A;  4HQE A;  5K7F A;  1AWC A;  1VF9 A;  2ZJQ F;  4L5I A;  5FFZ A;  2XGC A;  2DDA A;  1W7P B;  3EYY A;  3HDD A;  3U21 A;  2QF7 A;  3LA7 A;  4I02 A;  4WF2 A;  1B59 A;  5D6E A;  5EZG A;  4RAZ A;  5CVI A;  3BR0 A;  4BE1 A;  1LDD A;  4LOC A;  2E71 A;  2H1K A;  3J7Z I;  3QYF A;  2XF7 A;  3JSP A;  4IHW A;  3AG3 H;  2K9L A;  3QPL A;  1HKQ A;  4OAZ A;  2QSG X;  3VOD A;  2RNG A;  3JAM Z;  3I3L A;  2MLK A;  1TP4 A;  2K27 A;  5LLQ A;  4CO8 A;  2V26 A;  2RKH A;  4M6X A;  5HDN A;  2O61 A;  1HSJ A;  3CUQ C;  2VXZ A;  1NH3 A;  3ASN H;  1JKQ C;  2YPR A;  2VQH A;  1ULY A;  2ID3 A;  1F1Z A;  4PJM A;  3ZMS A;  2K4B A;  4G12 A;  1HXD A;  5TRD A;  1R7J A;  2KKO A;  3FK7 A;  2B9S A;  4HZF A;  3HB9 A;  2NYX A;  1YOV B;  5L3E A;  2PMH A;  4ESJ A;  3F9K A;  5FO5 A;  2XC7 A;  4E6K G;  1KGS A;  4ZZD A;  1K4S A;  1IG7 A;  4LG0 B;  1EV7 A;  2QQ8 A;  4XSZ F;  9ANT A;  2CQK A;  1VQN I;  3VPR A;  3H5N A;  2JA7 J;  4X0G A;  2K9S A;  1BN5 A;  3IP4 B;  4HSR A;  4M71 A;  4BHC A;  1H88 C;  3J81 Z;  3DKX A;  1WJF A;  1BI1 A;  5HOD A;  3O3K A;  3CLO A;  4P5O A;  4IHY A;  2WAQ A;  3TL4 X;  1FY7 A;  3U9G A;  2VOP A;  2CQQ A;  1YS6 A;  1BOA A;  3K1M A;  3WG9 A;  4MIM A;  2F2E A;  4BGD A;  3JRC A;  1QVT A;  1ZLK A;  4XLH A;  3H3V K;  5AON A;  3QWL A;  3PIO F;  1Y1V J;  1H9T A;  4BS9 A;  3R4K A;  2FQ4 A;  5DCM A;  2QSH X;  4RB0 A;  4G94 A;  5GPC A;  1MD0 A;  2FU4 A;  1IN7 A;  2ZO4 A;  2GXA A;  4M3E A;  1D8J A;  2K7L A;  1Z21 A;  3CTA A;  2P0W A;  4U7B A;  2BY1 A;  1D1A A;  3FWE A;  3FZV A;  2YU9 J;  4RGS A;  2FA5 A;  3E5X A;  2B0L A;  4I01 A;  1G3S A;  2FD5 A;  3CCL I;  4FE7 A;  4II2 A;  3QP6 A;  1R71 A;  2P81 A;  2XKP A;  3TBI A;  3FDY A;  3RQI A;  1WVR A;  2KRC A;  2OC6 A;  3LSM A;  1TBX A;  4XLP F;  3CCS I;  4ZH4 F;  5DCM B;  1FNN A;  2WBM A;  5H2F C;  2DN0 A;  1MNM C;  5DUI A;  3K4L A;  2BBY A;  4EVI A;  3S3M A;  4LK1 F;  1WI9 A;  2XGX A;  4ENK A;  3HJE A;  1XGM A;  4MHG A;  4YFX F;  2Q2E B;  3RCO A;  3OYM A;  1HW5 A;  3HPH A;  3QPT A;  4BHB A;  3CCJ I;  5K7H A;  3CMM A;  3J80 K;  2QM3 A;  2VKV A;  4NBQ A;  3CC2 I;  2WAQ N;  3B02 A;  4I0B A;  3OYB A;  1WRJ A;  4DJA A;  3FKJ A;  1MBJ A;  2JK3 A;  1MDM B;  5FLX K;  3E97 A;  3K4K A;  2W48 A;  2MD0 A;  3W3C A;  1K6O A;  4IOC F;  2FE3 A;  3FXL A;  2H8R A;  1JI8 A;  3F72 A;  4Y4R A;  4R8H A;  2PN6 A;  2M8G X;  4M73 A;  3BT9 A;  3NAR A;  5KAF C;  2VUM J;  4NC8 A;  2HTS A;  4QLC U;  3HRM A;  3OV8 A;  2KRF A;  2BOL A;  4PJ0 C;  4XMY A;  1MW7 A;  2ELK A;  5GAD J;  3FBN B;  2FRH A;  3CJN A;  4HOB A;  4BDY A;  3BQY A;  4HRI A;  1MMD A;  3OYA A;  2DOE A;  3DEW A;  3KEO A;  3LWF A;  4HLY A;  1X3Z B;  2LMD A;  4XLE A;  5HLH A;  2NNY A;  1OKR A;  2L9S A;  3KPH A;  2E1M B;  1XDS A;  3LQQ A;  2XB0 X;  5FD6 A;  2I5U A;  3W2V A;  2M3A A;  3KET A;  1UEL B;  3OR1 C;  4ITV A;  5J4V A;  4BJ5 C;  5L3F A;  1OCR H;  4KT6 A;  2Y9Z A;  1JHH A;  1ZGJ A;  1VQ4 I;  2DMU A;  4YIF A;  1TWG J;  1BW5 A;  4EM1 A;  3L2R A;  3BPV A;  5EZH A;  2HQN A;  3KX2 A;  1GV2 A;  1E17 A;  4K2E A;  5F08 A;  2DA2 A;  2X51 A;  3VOE A;  4E7S A;  1IV6 A;  4LG3 A;  2K4J A;  2FMY A;  3QPS A;  3RTR A;  2A69 F;  1V5G A;  1BM9 A;  1T0F A;  5EG0 A;  4V19 K;  1GVD A;  3A02 A;  2IAI A;  4HW0 A;  4KJZ A;  5JR3 A;  2ZME B;  3L2Q A;  3P5J A;  4G6T B;  1GHC A;  3JRE A;  5DYM A;  2NS0 A;  5J4Y A;  3L2C A;  1FX7 A;  2A5Y B;  2VLA A;  1SAN A;  2HOS A;  3MN2 A;  3GVA A;  4KA4 A;  3OYD A;  1FMW A;  5KK1 A;  5CVR A;  1QPI A;  4P55 A;  2AS5 F;  4A5M A;  4FQG A;  1B4A A;  1FYK A;  1U0J A;  3I55 I;  3RZD J;  2EZI A;  1X1P A;  4A69 C;  1MNE A;  2DU9 A;  5B5E C;  2VKD A;  1ZYR F;  2PI0 A;  1MDM A;  2ZXH A;  3G1L A;  4FCY A;  1G3Y A;  4OIN F;  3BTL A;  2YUS A;  2MAB A;  1POG A;  4CUG A;  5E3M A;  3BTJ A;  2D1H A;  5HNH A;  3FM3 A;  5D5X B;  5FRM A;  1LFP A;  1Z7U A;  3LQR A;  4F92 B;  1I1G A;  4D7N A;  1ZKG A;  2EZL A;  5LEK A;  2DA3 A;  1X1A A;  1YJW I;  3HSF A;  3WTZ A;  3KLO A;  1Y39 A;  1Z3X A;  1PP8 F;  3Q9V A;  1GLN A;  2AXL A;  4QPO A;  5FJ8 J;  1ITY A;  3K6G A;  3HOU J;  4M6Y A;  4P96 A;  2KIU A;  3FXO A;  4DYR A;  2R5Z B;  3GTP J;  4ENM A;  2OCC H;  1BBY A;  3D0S A;  3ESW B;  4UXN A;  3S17 J;  2BHZ A;  1ETV A;  3HGG A;  3DXJ F;  1T0F C;  2WV1 A;  2A6E F;  2HPM A;  2L0K A;  1E0E A;  2IPQ X;  1FYM A;  5C4J J;  2PJR A;  3LST A;  4JOM A;  1KZH A;  1FYL A;  5F1R A;  1BA5 A;  2CWE A;  3BC8 A;  5HVQ C;  2VE9 A;  4IRI A;  3K1P A;  2HVS A;  3E5U A;  4W1U A;  4CSW A;  1Y0U A;  4NQW A;  3TP0 A;  2GLO A;  2MW8 A;  3F21 A;  2XAJ A;  2X1C A;  3DKW A;  2ZKZ A;  1GDT A;  3MZ8 A;  2F5E A;  3IV5 A;  4ZDP A;  2CFO A;  1IW7 F;  2E5Z A;  4JX4 A;  4AM3 A;  2JRM A;  2LG4 A;  5HS8 A;  4BJT A;  1LUJ B;  1YE9 A;  1HDP A;  1ODD A;  1FEX A;  3RPU D;  5JLX A;  3GZ5 A;  1H0M A;  1JUM A;  1XGS A;  5K1Y A;  2V4J C;  3SYT A;  2FBH A;  4J19 A;  2CUJ A;  2W1O A;  3MKL A;  1IC8 A;  1WHU A;  2AQE A;  2KHM A;  3MMY B;  3FHZ A;  5CQG A;  1UFM A;  1R58 A;  3TO9 A;  1IN4 A;  3K4J A;  5EEG A;  5BOX A;  3KP3 A;  1ZGW A;  2YS9 A;  3BY6 A;  4YFN F;  4S05 A;  3HEF A;  3TED A;  2ZNZ A;  3WTT C;  4G7O F;  4OMY A;  1IN6 A;  1BC7 C;  3GCM A;  3OS2 A;  4B47 A;  1B8I A;  2WY7 Q;  2A3S A;  5LGT A;  1UHW A;  2A5W A;  2OA4 A;  3PQJ A;  2DK5 A;  1D0X A;  1RET A;  4BBR J;  5GAH J;  4QPQ A;  1J5Y A;  2Q8K A;  2A61 A;  3SQN A;  3KP2 A;  3F22 A;  2GA2 A;  4WK8 F;  2R7W A;  4Z2Y A;  3HUG A;  3FXR A;  4UVA A;  3K2Z A;  1U3E M;  5FGM A;  3DPL C;  2NVX J;  2X85 A;  4B4C A;  2LSO A;  4OWR B;  2EZH A;  4HV6 A;  4IHX A;  1YRN B;  1P9Q C;  1OFC X;  3ZPL A;  1S7O A;  2G7H A;  4IOA F;  2GXB A;  2IS1 A;  4H4K C;  3BR5 A;  4L5J A;  5LHI A;  3WTW C;  1Z91 A;  3TO7 A;  1K7A A;  3MVP A;  2QUF A;  3KLN A;  2F48 A;  1I6H J;  3E7L A;  4KMU X;  1EH7 A;  2FJ1 A;  3GTM J;  4CH7 A;  2OF7 A;  4CGZ A;  3QRF F;  3Q0U A;  4L9J A;  1YW8 A;  4ZYD A;  2H6C A;  2HKO A;  2I10 A;  1SFU A;  3MKY B;  2OQR A;  2PJR B;  2EZK A;  2O03 A;  3DBR B;  3RQ4 A;  2HFH A;  3TOB A;  3I5U A;  2GIZ A;  4OMZ A;  3C2H A;  2P6T A;  3H0D A;  1IN5 A;  5E3L A;  1WPK A;  3CCU I;  2QA4 I;  1GXQ A;  2OV7 A;  3A1Y A;  1FZP B;  5BS6 A;  2PX9 A;  2R7F A;  4WXC A;  3K70 D;  4Y17 A;  5EJC A;  1RRJ A;  2JVH A;  4EQQ A;  3QU6 A;  2ZFW A;  2XGE A;  2L2O A;  2OU2 A;  4MFE A;  1MKM A;  3CC7 I;  2K9M A;  1XPX A;  2VJ5 A;  2BVM A;  2CW7 A;  2BXZ A;  2ZB9 A;  4G6D A;  4EV0 A;  1B9M A;  2JJ7 A;  4RAF A;  1BIB A;  5FLV A;  3FMR A;  2W57 A;  2DFF A;  1WJD A;  4XKC A;  5JVG F;  2STW A;  5A2Q K;  2OTJ I;  3AG1 H;  1WJA A;  2K9Q A;  5F1J A;  4U0Y A;  5KVR A;  4WXD A;  2IS4 A;  4F3Q A;  4MNU A;  4XLN F;  3WTS C;  3BRO A;  1LVK A;  1ERD A;  1TLH B;  3RKY A;  5FD5 A;  2IA2 A;  2YX4 A;  3SXY A;  4ASN A;  5IYB J;  2LD5 A;  2ZJR F;  2P5L C;  4HX7 A;  5EYR A;  1Y1W J;  1F5T A;  4XIC A;  1ZTR A;  2GM4 A;  1UJ8 A;  2HOE A;  2VBW A;  2HPI A;  3P9C A;  2V9P A;  2VE8 A;  2DLL A;  1J09 A;  4A12 A;  2NOJ B;  2GAU A;  2LF8 A;  4EEF G;  2K85 A;  4GYI A;  4BY7 J;  3BG7 A;  5KCM A;  1S29 A;  1ETX A;  4D9J A;  5DS9 A;  1VQ8 I;  5E1W A;  3SZP A;  5D5W B;  5F0H A;  1IZ1 A;  3PNY A;  3FK6 A;  1G3T A;  3LSR A;  3K4B A;  3RDI A;  3M07 A;  1IDY A;  4D5C A;  3N05 A;  2LBF B;  3QOE A;  2DA4 A;  4D5F A;  4IHS A;  3KEY A;  4BDZ A;  1F4K A;  2ISY A;  2P4W A;  1APL C;  2HQR A;  3ERE D;  2DQR A;  2VC1 A;  2WWY A;  3I56 I;  1G3W A;  4C3J J;  1ZR2 A;  2F5F A;  3H5R A;  2G0E A;  1QRY A;  4NUB A;  3ML6 A;  1S6L A;  3H36 A;  4ZYA A;  1U6G A;  4EJO A;  1A6Q A;  1A04 A;  1QHH D;  3OYK A;  1O4X A;  4PFP A;  1YX3 A;  3BTC A;  2V1N A;  5IYD J;  2E1M C;  3GF2 A;  3RPQ A;  1B6A A;  3BG5 A;  3ZXS A;  2HZT A;  2DA1 A;  1AU7 A;  4F7Z A;  3SEQ A;  1RR8 C;  1QPM A;  2L02 A;  3KEQ A;  3SZT A;  4HA8 A;  5EEA A;  2V79 A;  1IJW C;  1Z9C A;  1JGS A;  2O0Y A;  3VB2 A;  2VN2 A;  2OJE D;  1HBX G;  1FP1 D;  2JN6 A;  4G7Z F;  1KYW A;  4E7L A;  4XK4 A;  1J9I A;  4EJT A;  4C30 A;  4AID A;  1FWZ A;  4L9T A;  4RM2 A;  2Q2E A;  4O3M A;  1VTN C;  4A5N A;  4KN4 X;  2QSF X;  1KA8 A;  3V42 A;  3DV8 A;  3CF2 A;  1YW9 A;  2LY2 A;  3H92 A;  3R0A A;  4BJ6 C;  3CF5 F;  4RLF A;  2E1O A;  2ISZ A;  2ZJ2 A;  3O8G A;  5LEJ A;  3EET A;  5ILV A;  4HX4 A;  2DMN A;  2IGK A;  5E3O A;  5FKK A;  3SFZ A;  1TQM A;  1V4R A;  3J7A Y;  3S2H J;  2VC0 A;  1L3L A;  1GVJ A;  1ZRC A;  5K5O A;  2VOD A;  4XRS A;  1VI0 A;  1LDJ A;  1YW7 A;  1RIO H;  1PUE E;  3GXO A;  4B8X A;  4JK1 X;  3ZCO A;  2GOM A;  2HDD A;  2XIG A;  4ENJ A;  3PNT A;  3OYH A;  5JHF A;  1QZZ A;  1Z67 A;  3CMA I;  1EKE A;  4BH9 A;  5E8I A;  4LLG F;  1EA3 A;  4HBL A;  5A2Q Z;  4HAM A;  1SFE A;  4A3C J;  1X3U A;  4UHT A;  4E7Z A;  3PIP F;  2STT A;  2QWW A;  2NS7 A;  3GTG J;  2WAE A;  3CDL A;  1ZLJ A;  5DCF A;  3CD6 I;  2FNA A;  4XRF A;  5D6F A;  1PUF B;  2FXA A;  4QSH A;  4WWC A;  1OYY A;  2P7C B;  4B43 A;  2LY1 A;  3VEP A;  3VDX A;  2HYF A;  1UG0 A;  1DU0 A;  2Z1D A;  2P7V B;  5K5Q A;  2Z2S B;  3F8N A;  2Y48 A;  4BE0 A;  3OL3 A;  1LB2 A;  4C3I J;  1MMN A;  2DK8 A;  1XGO A;  5E1Z B;  5F27 A;  4Y13 A;  4E4H A;  2OPT A;  1KU7 A;  1TTY A;  2EPF A;  2X1D A;  2JA2 A;  3A0H C;  4DYC A;  2BGC A;  2V6C A;  2PLY A;  5FKM A;  4QTR A;  4PFO A;  3EYI A;  2O3F A;  4DBQ A;  2HTJ A;  3R60 A;  5HLT A;  1YYV A;  2G7U A;  1F9N A;  1X4P A;  4A6D A;  4RB1 A;  4PSX A;  4L18 B;  2CU7 A;  2VL8 A;  1E3P A;  3E6C C;  3IH2 A;  4KMF A;  3NRV A;  5DEQ A;  1LKX A;  1C0W A;  1PJR A;  2CRG A;  4P9U A;  4UV8 A;  2HDW A;  4OIP F;  3V7S A;  3BJ6 A;  3H1C A;  3ZQC A;  2R7U A;  3O2P E;  2XPW A;  1ETO A;  3H9G A;  5J6X A;  1DPR A;  1MJ9 A;  4EJV A;  2PEX A;  1T8I A;  4Q47 A;  1FC3 A;  5F0F A;  4J00 A;  1XDU A;  2Y30 A;  1FP2 A;  3SZG A;  2KZG A;  4RBO A;  2XHK A;  4IHV A;  2W85 A;  2LOO A;  3CJR B;  2DPD A;  4A3L J;  1IUY A;  4MGR A;  4BY1 J;  1J75 A;  5JFR A;  4O6J A;  4BL0 B;  3ECH A;  5GAE J;  2LDU A;  1JUS A;  3AG2 H;  4O5V A;  3E3V A;  3WTX C;  1UZC A;  1USS A;  2KDZ A;  4NDL A;  1ON2 A;  3MEX A;  3HOY J;  4HNV A;  1U5T A;  1WJB A;  3WU0 A;  3A2K A;  3CZ6 A;  1G4D A;  4CZC A;  2LBF A;  2B7E A;  5IP7 J;  2VON A;  2MBF A;  2OZ6 A;  3ZQL A;  2VT2 A;  1MH3 A;  1RPW A;  3DP7 A;  3GTO J;  1Y0N A;  4CYC B;  4AD9 A;  1RUO A;  1P4W A;  3J7Y J;  3GME A;  3CME I;  4A3E J;  1IUF A;  3GEZ A;  2JUC A;  4NQW B;  5FFX A;  3V4G A;  1YRN A;  1J0R A;  1XG1 A;  2ZSH B;  4NC6 A;  2BVL A;  2VOO A;  1MBH A;  1G6N A;  2KMU A;  3HOT A;  5JVT A;  3K10 A;  4IVN A;  3A01 A;  2A05 A;  1W5C C;  2M7A A;  4IL6 C;  3ZR8 X;  1BI3 A;  4IZZ A;  3FXK A;  3TMO A;  3WTU C;  1VQO I;  3M1E A;  4BXU A;  3MQ0 A;  2Z16 A;  2EIK H;  1MND A;  4YEJ A;  5B1B H;  1KU9 A;  1MZB A;  3NQO A;  3OYJ A;  4FTH A;  4GDF A;  2ELJ A;  4NB5 A;  4HNT A;  1V55 H;  1N78 A;  3Q0W A;  2PBI A;  4RMN A;  4IHT A;  1TQP A;  3L09 A;  5CKT A;  1JJ6 C;  1MGT A;  2DFI A;  4IJA A;  3PSF A;  3PJR A;  1FSH A;  2NVU B;  1RR7 A;  2RC4 A;  4XL9 A;  3L00 A;  3CUO A;  3AL0 B;  2CFX A;  1T6S A;  1FIP A;  2EK5 A;  1BJA A;  3DLL F;  2ECC A;  1MBK A;  1WKM A;  4AC0 A;  1WJC A;  2F5D A;  4JP0 A;  3ZN0 A;  2XRN A;  4LLN A;  1DGR M;  2NVT J;  2Y31 A;  2FX0 A;  3V7C A;  2WV0 A;  3TDZ C;  1PP7 U;  5BMZ A;  5JLW A;  2DA7 A;  2ID6 A;  4YFK F;  1R1V A;  1SD7 A;  2NVQ J;  5HLI A;  1ZRF A;  2ADU A;  4L0Y B;  4B1R A;  5IY5 H;  3CES A;  1BW6 A;  4H0E A;  3HOZ J;  1NK2 P;  1FOX A;  1GXP A;  4DBR A;  5FLX Z;  1M1E B;  3OSG A;  4CZZ A;  3HSR A;  3HOX J;  1KON A;  2Z9O A;  1E2X A;  2BY0 A;  3PL8 A;  1SAU A;  3KYL A;  5DM7 F;  4FHT A;  3IC7 A;  4CCJ A;  1OQY A;  2KDO A;  2N8G A;  1MBE A;  4YII A;  3IRQ A;  1R4M B;  5EG0 B;  2JUG A;  3DU6 A;  3RKW A;  1H9G A;  4UUT A;  3OOU A;  3KFW X;  1RNL A;  3I9V 2;  3P9I A;  2FEZ A;  2ZCW A;  3EUK L;  3L2U A;  4JQF A;  3BG9 A;  3CDI A;  2R5Y B;  5B1A H;  4FET A;  2E2I J;  1YIO A;  1NG7 A;  1TWA J;  2JT1 A;  3M8J A;  1N77 A;  4A3B J;  1U78 A;  2K02 A;  4CA0 A;  3DWL E;  1UST A;  2DTR A;  2HNH A;  2QQ9 A;  2R7D A;  3HZJ A;  3G6E I;  3TOA A;  3GWZ A;  1FPQ A;  1YG2 A;  1R1T A;  2KIM A;  4PCQ A;  3VYU B;  2CSO A;  2L7F P;  2EQR A;  5EDN A;  1S5L C;  5F0C A;  3ZP5 A;  2CQ7 A;  1P4X A;  2DMP A;  2DJN A;  2QEX I;  4PDK A;  4PUS A;  2WAD A;  3OYL A;  3TDU C;  3RIR A;  3ZMZ A;  3OYC A;  1WSU A;  2COM A;  3IKT A;  3FHN A;  4XOP A;  3V8L A;  4A0X A;  2EFO A;  2MH9 A;  5DD4 A;  3GTJ J;  3F6V A;  2GWR A;  1XC5 A;  2K40 A;  2W25 A;  3LSH A;  3M8E A;  2E60 A;  4NNJ A;  2A68 F;  1OR7 A;  3WHB A;  3CO6 C;  2QVO A;  1FBS A;  1V3F A;  3ASO H;  1J2X A;  5FKO A;  4X6A J;  2P5V A;  3UR3 C;  1W5T A;  2FF4 A;  4EM0 B;  1T33 A;  2MA3 A;  3ZQH A;  3TW7 A;  3ZQI A;  1R1U A;  4OAY A;  3ULQ B;  2ZME A;  2KIF A;  2JPB A;  3S32 A;  3DTK A;  1VFC A;  4RGR A;  5FB2 A;  4HF1 A;  1ZN2 A;  1X1B A;  2XRL A;  1WH7 A;  2R92 J;  3AKZ A;  4L5E A;  2VIX A;  1U9N A;  1S72 I;  1LQ1 A;  2KPM A;  5E17 F;  2JMW A;  2W84 A;  3HM5 A;  3HTU A;  2Y9Y A;  1VND A;  2D2W A;  2GQQ A;  5IOY A;  5HS7 A;  2KQR A;  2OQG A;  3C1D A;  3GX4 X;  2LFB A;  1FOW A;  2ZSI B;  3KZZ A;  1ZEL A;  4RB2 C;  4ON0 A;  4BAY A;  1A6I A;  5BQT A;  3ROU A;  2PJP A;  1BL0 A;  3QOD A;  3SHF A;  1OCT C;  2CUE A;  2R3S A;  2E7X A;  1H89 C;  2DI3 A;  4CDG A;  3GBG A;  5DDG A;  5J8F A;  1QGP A;  3CJT B;  2XGD A;  4HQM A;  4I98 B;  2EIN H;  2L3D A;  1SMY F;  5H6R A;  3F8F A;  2O8X A;  2PMZ A;  2JRT A;  3FXQ A;  1I1S A;  2W4S A;  3WGI A;  2TCT A;  1W4M A;  1SAX A;  2GXG A;  2HYJ A;  2NS8 A;  3K4M A;  3RPU A;  2KJB A;  1Z77 A;  4LB5 A;  3LMM A;  5KNL A;  3KZY A;  4ZTF A;  2IGN A;  3H9Q A;  2H09 A;  4GO1 A;  2QQA A;  1TT5 B;  1OCO H;  3HRU A;  1I39 A;  4Y52 J;  5ICG A;  3KIO A;  2WY8 Q;  3GLL A;  4BE2 A;  5JHU A;  3ZQQ A;  1AOY A;  2F5C A;  4AIK A;  4XLC A;  4CCN A;  5L3D A;  1U2W A;  4UUS B;  3KE2 A;  5CYV A;  2K9N A;  2E1N A;  3JCU C;  3J80 Z;  2WA0 A;  3RYR A;  5C3E J;  4IX7 A;  2F4O B;  3OYE A;  5K5R A;  2F4M B;  4DGW B;  5E18 F;  2V1U A;  3ZMU A;  4LB6 B;  3L7W A;  3JSO A;  2ACJ A;  4JX5 A;  1LNW A;  1UHS A;  5CVU A;  3MCZ A;  5HNF A;  2O7O A;  3HTS B;  4EGY A;  4IKF A;  1FT9 A;  3ONQ A;  3DF8 A;  1OIS A;  1BI2 A;  3I64 A;  3H3Z A;  1VQP I;  3K7A J;  4KIS A;  1Y6I A;  2DOF A;  1B72 B;  3HHH A;  1E3H A;  1V54 H;  2I8D A;  2Q1Z B;  3CCM I;  4AIH A;  4PZJ A;  3RYP A;  3JAM K;  4LLL A;  4R1H A;  4KDP A;  5ILU A;  2CW8 A;  2XRO A;  1DU6 A;  3R61 A;  3ABT A; 
#chains in the Genus database with same CATH homology
 4XBF A;  2HDC A;  4M9X A;  5LHH A;  2YU3 A;  1QNT A;  2K86 A;  2H27 A;  1T98 A;  1P6R A;  1B9N A;  1O3S A;  3E5Q A;  2JTV A;  4A2U A;  3MWM A;  3T0Y A;  3ZMD A;  3WU1 B;  3I0T A;  3D5L A;  2DBB A;  4WX9 A;  2XAF A;  1R36 A;  5JI6 A;  4PGH A;  3N4M A;  2P8T A;  2FNP A;  4IRG A;  4LFU A;  1K78 B;  4KN7 X;  3DFG A;  1O7L A;  1NHA A;  2QLZ A;  2HR3 A;  4Q4Z F;  3ABU A;  2X4H A;  4N0B A;  3DEU A;  4OIQ F;  5LRR A;  3H3U A;  2QBY A;  3MZY A;  4CHU A;  4YG2 F;  3KP4 A;  4BQA A;  3FMQ A;  4HX8 A;  1XGN A;  2MC3 A;  1XSX A;  1P2F A;  5IT3 A;  4P9F A;  2YX7 A;  1W5S A;  3I4P A;  4EM2 A;  2DO7 A;  2EB7 A;  1QZY A;  5H6Q A;  1KQ0 A;  2NRA C;  3V8K A;  2YR2 A;  2CG4 A;  4ESF A;  3JTG A;  4UUV A;  4N9H A;  2CYY A;  3I59 A;  2RV8 A;  5IT9 K;  1D5V A;  1IAW A;  6PAX A;  4LD5 A;  3ECO A;  1ONV A;  1FBU A;  2OBP A;  1QO0 D;  1RI7 A;  3U2R A;  1UCR A;  2Y0M A;  4U88 A;  4HV5 A;  2H94 A;  4FX0 A;  1MJB A;  4EGZ A;  4PGG A;  3MFK A;  2XVC A;  5L3G A;  1TW2 A;  5HDG A;  1OPC A;  2UWM A;  4RGX A;  2IVM A;  5F6F A;  3QP5 A;  5IT9 Z;  3PFI A;  2CO5 A;  3GFI A;  3Q5F A;  3F8B A;  3LA2 A;  2BYV E;  1Q1H A;  5D8L B;  2RQP A;  4KNY A;  2XV4 S;  2BEO A;  2CGP A;  1U5T C;  3CDH A;  1HQC A;  2RDP A;  3DPT A;  3P9K A;  5BPD A;  2QEN A;  3GZ6 A;  1KQ8 A;  2FSW A;  3BPX A;  3F23 A;  4MEY F;  1MJA A;  2M8E A;  4UNO A;  3LA3 A;  1J7K A;  5ICE A;  3LAP A;  3T8R A;  1SD4 A;  3AAF A;  1YFH A;  5CVV A;  3FX3 A;  3TKY A;  4M74 A;  2DQL A;  1I27 A;  4BNC A;  4KIB A;  2D45 A;  5DUK A;  5D5V B;  3WGH A;  1EH6 A;  3IKV A;  1CF7 A;  2ELH A;  4EJU A;  2FBI A;  2V1D A;  4TV7 A;  4M9Z A;  3TO6 A;  3JW4 A;  2MD5 A;  2YSR A;  4I09 A;  3NEU A;  5LGU A;  4RS8 A;  2DPU A;  3VFZ A;  1SMT A;  2QZ8 A;  4G6Q A;  3C7J A;  1OMI A;  1JXS A;  5CJ9 A;  4Y15 A;  4GGG A;  5ED4 A;  3W6K B;  2NNN A;  1XSD A;  1R22 A;  2EA4 A;  3ZMV A;  2WTE A;  3IRR A;  2DT5 A;  2V1X A;  3MZH A;  4KYW A;  2IJL A;  4ENN A;  3JTH A;  2FOK A;  4E70 A;  1B1B A;  3REO A;  1ZH5 A;  1K78 A;  2EV6 A;  2JSC A;  4KIG A;  3ZMT A;  2PMU A;  4UVB A;  2EV0 A;  2X0L A;  3F8C A;  4KUM A;  4ESB A;  1KQ9 A;  4DQ2 A;  5D4S A;  1R00 A;  2HEO A;  2MH2 A;  3Q9S A;  2HS5 A;  1XSV A;  4LK0 F;  5AIP A;  3KCC A;  2M1B A;  2MLG A;  2C6Y A;  2UXX A;  4LGW A;  3F8M A;  1YLF A;  5LRS A;  1DPU A;  3V8J A;  4WXH A;  4OIR F;  2NAZ A;  4I7H A;  3V7R A;  1IN8 A;  3M7G A;  2EJR A;  4RB3 C;  1FBQ A;  2IA1 A;  1J59 A;  3G3Z A;  1BI0 A;  3O6B B;  1RUN A;  3I53 A;  3KP6 A;  3R6S A;  3K0L A;  1FLI A;  3QAH A;  3WE3 A;  2XAG A;  1XD7 A;  2RGV A;  2PG4 A;  4ZYE A;  3EDP A;  4U0W A;  1CF7 B;  4IXA A;  1KU3 A;  5BPI A;  4RGU A;  2ETH A;  4L9N A;  2CW0 F;  2RVC A;  2XAQ A;  2KJC A;  5TJJ A;  2FQ3 A;  3J7A O;  1SD6 A;  4WCG A;  4CYD A;  4RAY A;  1SD5 A;  2VBZ A;  1HKS A;  4JBA A;  3BP8 A;  2GIV A;  3F3X A;  3BWG A;  1OYI A;  3HIF A;  3GUD A;  3FM5 A;  4ZYH A;  4KIF A;  1D3Y A;  1ON1 A;  2L54 A;  1EH8 A;  3KP5 A;  1JHF A;  4FX4 A;  1O3R A;  3U1D A;  3ZN1 A;  2J5O A;  1IRF A;  3GFJ A;  2OD5 A;  3K9T A;  2BV6 A;  1L0O C;  2PQ8 A;  1R5H A;  3I54 A;  3E6M A;  1DDN A;  5CVJ A;  2L4A A;  2M87 A;  4CXF A;  1Z1D A;  2ESN A;  5LHG A;  4IPA A;  2P6S A;  2IP2 A;  3BJA A;  5HDK A;  1ZRE A;  2RN7 A;  1QBJ A;  2HWV A;  5E20 A;  3E6B A;  2EWN A;  4HLX A;  4Q48 A;  4U0V A;  2D1V A;  4EJW A;  4MEX F;  4U7D A;  4I2O A;  4AWX B;  1KU2 A;  3GYH X;  4IF4 A;  3HRS A;  4NHJ A;  3IHU A;  2QQB A;  1UHM A;  2BE5 F;  3GO5 A;  2XKO A;  4M72 A;  1YQA A;  2JPC A;  4OU0 A;  2UXN A;  5H20 A;  1YS7 A;  2RNJ A;  1T38 A;  3J81 K;  2EA2 A;  3G73 A;  2EFP A;  4ZYG A;  4UV9 A;  3EUH A;  4OIO F;  2XAH A;  1Z6T A;  1K79 A;  2VT3 A;  5E1X A;  2TDX A;  1UB9 A;  3EQL F;  3DQV C;  4N9I A;  4KFC A;  2O6G E;  3GW2 A;  3IL2 A;  4D0P A;  4HF0 A;  5DD8 A;  2EFQ A;  3WOD F;  1D8K A;  3CO7 C;  4AIJ A;  1ZG5 A;  4QWQ A;  3CUQ B;  4A0Y A;  1U8R A;  1SFX A;  1ZAR A;  1S8N A;  3T8T A;  1XMK A;  1ZG1 A;  4BYY A;  4R79 A;  5F64 A;  3WE2 A;  1LEB A;  1IXC A;  3RKX A;  3R0J A;  1S7A A;  2OAZ A;  2Z3Y A;  4HF2 A;  3MAJ A;  3B73 A;  3M9A A;  1IRG A;  1PDN C;  2XUB A;  2IT0 A;  1P92 A;  2IRF G;  4HYE A;  2E7W A;  1DUX C;  5E8G A;  1BIA A;  4LJZ F;  5DV5 A;  4A6E A;  3C18 A;  3QPH A;  2ESH A;  2Z99 A;  2EFN A;  3RJP A;  2XAS A;  2QYO A;  4MTE A;  4OOI A;  3WTV C;  3T5X A;  2DW4 A;  5L3B A;  1WQ2 A;  1W7P A;  2L01 A;  3FXU A;  4EMS A;  2G9W A;  3I71 A;  2LKP A;  1S3J A;  1I6X A;  1YO5 C;  1T2K A;  1DP7 P;  1O7F A;  3HYI A;  2A07 F;  3W6J B;  4FT8 A;  4AVP A;  3HOS A;  2ZNY A;  4GCV A;  2HYG D;  3M8F A;  3ELK A;  4LMY A;  2FBK A;  3N97 A;  1O3Q A;  1Z05 A;  3GFM A;  2GZW A;  4IRH A;  3TQN A;  5HS9 A;  5AIQ A;  1FSE A;  3BJO A;  1ZGA A;  1LVA A;  1XMA A;  1QQI A;  1XCB A;  4KT5 C;  1XCV A;  3WTY C;  1REP C;  2P5K A;  1U5T B;  2ZXJ A;  4S04 A;  5ILS A;  3T1B A;  2JZY A;  2W24 A;  4A0Z A;  3COA C;  5LGN A;  1HW1 A;  2FML A;  4DNC A;  2ZBK A;  5ERI A;  1TNT A;  2E1C A;  3P7N A;  3QOP A;  2Y75 A;  5LBQ A;  2Q0O A;  1HW2 A;  2J5P A;  1CGP A;  1ZG3 A;  3I59 B;  4G9Y A;  4MQ9 F;  2DAO A;  4B09 A;  1Z6R A;  2Z33 A;  3FF5 A;  2VBX A;  4Q5S F;  2OZU A;  3GFL A;  1WWX A;  4BHP A;  1W7P D;  4MQV A;  2EV5 A;  4G8X A;  3CUQ A;  1STZ A;  4HDU A;  1BC8 C;  1O57 A;  4KIC A;  1ZAO A;  1HST A;  1LJ9 A;  3FMS A;  3LAJ A;  1IF1 A;  1R23 A;  1R5G A;  5D4R A;  5ICF A;  1O3T A;  4GXO A;  5D5U B;  2QBY B;  2V9V A;  4XSX F;  3TGN A;  3HSE A;  5CLS A;  3E6D A;  1LDK B;  5HLG A;  4ETS A;  1HKT A;  2M30 A;  3F6O A;  2PFB A;  3BZ6 A;  3C3W A;  2VBY A;  3GLX A;  3IWZ A;  4UVC A;  4HDV A;  1XB4 A;  3BDD A;  4G7H F;  2WC2 A;  1I5Z A;  2L4M A;  5ICC A;  4L0Z B;  2IW5 A;  4I0A A;  1RZ4 A;  2HGC A;  2LNB A;  3L9F A;  1ZHF A;  3PQK A;  4GYG A;  4MTD A;  3LFK A;  3BOQ A;  4L9V A;  2Z5U A;  3ZQ7 A;  3HRT A;  2UZK A;  3S2W A;  4CIC A;  3RI4 A;  1KYZ A;  4ZZL A;  1YTY A;  5L3C A;  2EFW A;  2M5W A;  3QU3 A;  2LF7 A;  2M45 A;  1OYW A;  3KP7 A;  1P4A A;  1XN7 A;  4LG0 A;  3IWF A;  5EEH A;  1FOK A;  1IXR C;  2H6B A;  5D8K B;  2GA1 A;  3OOP A;  5J8C A;  4M9S A;  1ZRD A;  3K69 A;  2IA0 A;  1IXS B;  1TNS A;  3I58 A;  3ISP A;  3WGG A;  5HOO A;  3K1N A;  3HHG A;  1T39 A;  2A6H F;  1JE8 A;  1TQI A;  1LEA A;  1TW3 A;  2HKX A;  4HQE A;  1AWC A;  4L5I A;  5FFZ A;  1W7P B;  3EYY A;  4I02 A;  3LA7 A;  4WF2 A;  1B59 A;  5D6E A;  4RAZ A;  5CVI A;  1LDD A;  3JSP A;  1HKQ A;  3VOD A;  3JAM Z;  2MLK A;  2K27 A;  5LLQ A;  4CO8 A;  2RKH A;  4M6X A;  5HDN A;  2O61 A;  1HSJ A;  3CUQ C;  2VXZ A;  2YPR A;  1ULY A;  3ZMS A;  1F1Z A;  2K4B A;  1HXD A;  5TRD A;  1R7J A;  2KKO A;  4HZF A;  2NYX A;  5L3E A;  2PMH A;  4ESJ A;  5FO5 A;  4ZZD A;  1KGS A;  4LG0 B;  1EV7 A;  4XSZ F;  2CQK A;  1BN5 A;  4M71 A;  4BHC A;  3J81 Z;  1BI1 A;  3O3K A;  3CLO A;  4P5O A;  1FY7 A;  3U9G A;  2VOP A;  1YS6 A;  1BOA A;  3K1M A;  3WG9 A;  2F2E A;  1ZLK A;  5AON A;  1H9T A;  3R4K A;  5DCM A;  4RB0 A;  4G94 A;  1MD0 A;  2FU4 A;  1IN7 A;  2ZO4 A;  1D8J A;  2K7L A;  3CTA A;  4U7B A;  3FWE A;  3FZV A;  4RGS A;  2FA5 A;  3E5X A;  2B0L A;  4I01 A;  1G3S A;  3QP6 A;  2XKP A;  1TBX A;  4XLP F;  4ZH4 F;  5DCM B;  1FNN A;  5DUI A;  2BBY A;  4EVI A;  4LK1 F;  1WI9 A;  2XGX A;  4ENK A;  1XGM A;  4MHG A;  4YFX F;  1HW5 A;  3QPT A;  4BHB A;  3J80 K;  2QM3 A;  3B02 A;  4I0B A;  1WRJ A;  1MDM B;  5FLX K;  3E97 A;  1K6O A;  2FE3 A;  3F72 A;  4R8H A;  2PN6 A;  4M73 A;  2HTS A;  4QLC U;  3HRM A;  3OV8 A;  2KRF A;  2FRH A;  3CJN A;  4HOB A;  3LWF A;  3KEO A;  4HLY A;  5HLH A;  2NNY A;  1OKR A;  1XDS A;  3LQQ A;  5FD6 A;  3KET A;  5L3F A;  1JHH A;  1ZGJ A;  4YIF A;  4EM1 A;  3BPV A;  2HQN A;  1E17 A;  4K2E A;  3VOE A;  2K4J A;  2FMY A;  3RTR A;  2A69 F;  1BM9 A;  1T0F A;  1GHC A;  4HW0 A;  5JR3 A;  2ZME B;  5DYM A;  2NS0 A;  3L2C A;  1FX7 A;  2A5Y B;  3GVA A;  4KA4 A;  5KK1 A;  5CVR A;  2AS5 F;  4P55 A;  4A5M A;  1FYK A;  1B4A A;  2DU9 A;  1ZYR F;  2PI0 A;  1MDM A;  1G3Y A;  4OIN F;  2D1H A;  3FM3 A;  5D5X B;  1Z7U A;  3LQR A;  1I1G A;  5LEK A;  3HSF A;  3WTZ A;  3KLO A;  1PP8 F;  3Q9V A;  2AXL A;  4M6Y A;  4P96 A;  2KIU A;  4ENM A;  1BBY A;  3D0S A;  4UXN A;  3DXJ F;  2A6E F;  2IPQ X;  1FYM A;  3LST A;  1FYL A;  5F1R A;  2CWE A;  5HVQ C;  2VE9 A;  4IRI A;  3K1P A;  3E5U A;  1Y0U A;  4NQW A;  3F21 A;  2XAJ A;  3DKW A;  2ZKZ A;  2F5E A;  1IW7 F;  5HS8 A;  1ODD A;  3GZ5 A;  1H0M A;  1XGS A;  5K1Y A;  2FBH A;  3FHZ A;  3TO9 A;  1UFM A;  1R58 A;  5BOX A;  1IN4 A;  5EEG A;  3KP3 A;  3BY6 A;  4YFN F;  4S05 A;  2ZNZ A;  3WTT C;  4G7O F;  4OMY A;  1IN6 A;  1BC7 C;  2A3S A;  5LGT A;  1UHW A;  2OA4 A;  3PQJ A;  2DK5 A;  1J5Y A;  2Q8K A;  2A61 A;  3SQN A;  3KP2 A;  3F22 A;  2GA2 A;  4WK8 F;  4Z2Y A;  3HUG A;  3FXR A;  4UVA A;  1U3E M;  3K2Z A;  5FGM A;  3DPL C;  2LSO A;  4HV6 A;  3ZPL A;  1S7O A;  2G7H A;  2GXB A;  4L5J A;  5LHI A;  3WTW C;  1Z91 A;  3TO7 A;  1K7A A;  2QUF A;  3KLN A;  4KMU X;  1EH7 A;  4CGZ A;  3QRF F;  4L9J A;  1YW8 A;  4ZYD A;  2H6C A;  2HKO A;  1SFU A;  2OQR A;  2O03 A;  2HFH A;  3TOB A;  3I5U A;  4OMZ A;  2P6T A;  1IN5 A;  1GXQ A;  1FZP B;  5BS6 A;  2R7F A;  4WXC A;  4Y17 A;  4EQQ A;  3QU6 A;  2ZFW A;  2OU2 A;  1MKM A;  4G6D A;  4EV0 A;  1B9M A;  1BIB A;  2STW A;  3FMR A;  2W57 A;  5A2Q K;  4U0Y A;  5KVR A;  4WXD A;  4MNU A;  4XLN F;  3WTS C;  3BRO A;  1TLH B;  3RKY A;  5FD5 A;  2IA2 A;  2YX4 A;  3SXY A;  4ASN A;  2P5L C;  4HX7 A;  1F5T A;  2HOE A;  2VBW A;  3P9C A;  2VE8 A;  2DLL A;  4A12 A;  2GAU A;  2LF8 A;  4GYI A;  1S29 A;  5E1W A;  3SZP A;  5D5W B;  1IZ1 A;  1G3T A;  3RDI A;  4IHS A;  1F4K A;  2ISY A;  2P4W A;  2HQR A;  3ERE D;  2DQR A;  2VC1 A;  2WWY A;  1G3W A;  2F5F A;  3ML6 A;  1S6L A;  4EJO A;  1U6G A;  1A04 A;  3GF2 A;  3RPQ A;  1B6A A;  2HZT A;  4F7Z A;  1QPM A;  2L02 A;  3KEQ A;  3SZT A;  4HA8 A;  2V79 A;  1Z9C A;  1JGS A;  2O0Y A;  3VB2 A;  2VN2 A;  1HBX G;  1FP1 D;  4G7Z F;  1KYW A;  1J9I A;  4EJT A;  1FWZ A;  4L9T A;  2Q2E A;  4O3M A;  1VTN C;  4A5N A;  4KN4 X;  1KA8 A;  3DV8 A;  1YW9 A;  3H92 A;  3R0A A;  2ISZ A;  2ZJ2 A;  5LEJ A;  3EET A;  5ILV A;  4HX4 A;  3SFZ A;  1TQM A;  1V4R A;  2VC0 A;  1L3L A;  1GVJ A;  1ZRC A;  5K5O A;  2VOD A;  1YW7 A;  1LDJ A;  1RIO H;  1PUE E;  3GXO A;  4B8X A;  4JK1 X;  2XIG A;  4ENJ A;  1QZZ A;  4BH9 A;  5E8I A;  4LLG F;  4HBL A;  5A2Q Z;  4HAM A;  1SFE A;  1X3U A;  4UHT A;  2STT A;  2QWW A;  1ZLJ A;  5DCF A;  2FNA A;  4XRF A;  5D6F A;  2FXA A;  4WWC A;  1OYY A;  2P7C B;  3VEP A;  2HYF A;  2P7V B;  5K5Q A;  3F8N A;  2Y48 A;  1LB2 A;  2DK8 A;  1XGO A;  5E1Z B;  4Y13 A;  1KU7 A;  1TTY A;  2BGC A;  2V6C A;  2PLY A;  3EYI A;  2O3F A;  2HTJ A;  3R60 A;  1YYV A;  2G7U A;  1F9N A;  4A6D A;  4RB1 A;  4L18 B;  3E6C C;  4KMF A;  3NRV A;  5DEQ A;  1C0W A;  4P9U A;  4UV8 A;  4OIP F;  3V7S A;  3BJ6 A;  3O2P E;  5J6X A;  1DPR A;  1MJ9 A;  4EJV A;  2PEX A;  4Q47 A;  1FC3 A;  1XDU A;  1FP2 A;  2XHK A;  2W85 A;  2DPD A;  1IUY A;  4MGR A;  1J75 A;  5JFR A;  4O6J A;  3ECH A;  2LDU A;  4O5V A;  3E3V A;  3WTX C;  1USS A;  1ON2 A;  3MEX A;  1U5T A;  3WU0 A;  1G4D A;  2VON A;  2MBF A;  2OZ6 A;  2VT2 A;  3DP7 A;  4AD9 A;  1RUO A;  1P4W A;  3GEZ A;  5FFX A;  3V4G A;  1J0R A;  2VOO A;  1G6N A;  3HOT A;  5JVT A;  4IVN A;  1BI3 A;  3WTU C;  3M1E A;  4BXU A;  3MQ0 A;  1KU9 A;  1MZB A;  3NQO A;  4NB5 A;  2PBI A;  4IHT A;  1TQP A;  3L09 A;  1MGT A;  2DFI A;  4IJA A;  1FSH A;  2RC4 A;  3L00 A;  3CUO A;  2CFX A;  1T6S A;  2EK5 A;  1BJA A;  1WKM A;  2F5D A;  3ZN0 A;  2XRN A;  4LLN A;  3V7C A;  2WV0 A;  3TDZ C;  1PP7 U;  5BMZ A;  4YFK F;  1R1V A;  1SD7 A;  5HLI A;  1ZRF A;  2ADU A;  4L0Y B;  4H0E A;  1GXP A;  5FLX Z;  4CZZ A;  3HSR A;  2Z9O A;  1E2X A;  4FHT A;  3IC7 A;  4YII A;  3IRQ A;  3RKW A;  1H9G A;  3KFW X;  1RNL A;  3P9I A;  2FEZ A;  2ZCW A;  4JQF A;  1YIO A;  2JT1 A;  1U78 A;  2K02 A;  1UST A;  2DTR A;  2QQ9 A;  2R7D A;  3TOA A;  1FPQ A;  1YG2 A;  3GWZ A;  1R1T A;  2KIM A;  4PCQ A;  2CSO A;  3ZP5 A;  1P4X A;  4PDK A;  3TDU C;  3RIR A;  3ZMZ A;  1WSU A;  2COM A;  3IKT A;  3V8L A;  4A0X A;  2EFO A;  2MH9 A;  5DD4 A;  3F6V A;  2GWR A;  2W25 A;  3M8E A;  2A68 F;  1OR7 A;  3CO6 C;  2QVO A;  1FBS A;  1V3F A;  1J2X A;  2P5V A;  1W5T A;  2FF4 A;  4EM0 B;  2MA3 A;  1R1U A;  3ULQ B;  2ZME A;  2KIF A;  2JPB A;  4RGR A;  5FB2 A;  4HF1 A;  1ZN2 A;  1LQ1 A;  5E17 F;  2W84 A;  3HTU A;  2D2W A;  2GQQ A;  5HS7 A;  2OQG A;  3C1D A;  3GX4 X;  3KZZ A;  4RB2 C;  4ON0 A;  4BAY A;  5BQT A;  3ROU A;  2PJP A;  3SHF A;  2R3S A;  2E7X A;  2DI3 A;  4CDG A;  5DDG A;  5J8F A;  1QGP A;  4HQM A;  4I98 B;  2L3D A;  1SMY F;  5H6R A;  3F8F A;  2O8X A;  2JRT A;  3FXQ A;  1I1S A;  3WGI A;  1W4M A;  1SAX A;  2GXG A;  3RPU A;  2KJB A;  4LB5 A;  3KZY A;  2H09 A;  4GO1 A;  2QQA A;  3HRU A;  5ICG A;  5JHU A;  1AOY A;  2F5C A;  4AIK A;  5L3D A;  1U2W A;  3KE2 A;  5CYV A;  2E1N A;  3J80 Z;  3RYR A;  5K5R A;  5E18 F;  2V1U A;  3ZMU A;  4LB6 B;  3JSO A;  3L7W A;  2ACJ A;  1LNW A;  5CVU A;  3MCZ A;  3HTS B;  4EGY A;  1FT9 A;  3DF8 A;  1BI2 A;  3I64 A;  3H3Z A;  3HHH A;  4AIH A;  4PZJ A;  3RYP A;  3JAM K;  4LLL A;  4R1H A;  4KDP A;  5ILU A;  2XRO A;  3R61 A;  3ABT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...