1TWAJ

Rna polymerase ii complexed with atp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twaJ00
3DCFA 3QPLA 4XIDA 2ID3A 4I76A 4A3KJ 5FKNA 3TW7A 1TWFJ 1E3OC 2QF7A 3IH4A 4EEFG 1AHDP 1H89C 4BXXJ 1H88C 3GTLJ 1FIPA 1ZTRA 1AU7A 3BR1A 3HOXJ 3S15J 1JT0A 3S16J 4JP0A 4C2MJ 4RDUA 3BTJA 1RPWA 3SFIA 3RQIA 1MBJA 2ECBA 2DMTA 3Q0WA 2XPWA 1ZR2A 2P81A 1F36A 2L0KA 1ETVA 2OPTA 4A3EJ 4A3JJ 1ETXA 4XRMA 3VPRA 3DEWA 2AO9A 4JYKA 2KDZA 4FCYA 1VNDA 2M0CA 5E3OA 1WH7A 5C4JJ 4JX5A 4JX4A 5IOYA 4AUXA 1UMQA 1IUFA 1S7EA 2FX0A 1JTXA 4S0HB 4MFDA 1ETOA 2M34A 3BQYA 2DMQA 3BTLA 1K83J 1NK3P 3PO3J 3WHBA 2N8GA 1ETYA 2HOSA 3H0GJ 1FTTA 1JKQC 1RETA 2EZHA 2COBA 1IGNA 1JUSA 3S2DJ 3HB9A 3HM5A 5GPAA 2WV1A 2VKVA 2X48A 2ZB9A 1OJLA 1WCMJ 4A3BJ 1WGXA 2R93J 1TWCJ 3LOCA 3BTIA 2HXIA 2O7OA 5IOZA 4Y7NJ 3JRIA 5M3FJ 3ZQHA 5GPCA 5F0HA 1O4XA 4JX6A 5FJ8J 5J3LA 1ORKA 3LNQA 1F43A 1AKHB 1B8IA 1HLVA 3HOUJ 4CYCB 1APLC 2XRLA 3A03A 3HGGA 1BW5A 1NTCA 1GV5A 4D7MA 3HKZN 3S14J 1NK2P 2XB0X 4A3FJ 2HDDA 4FE7A 3C2BA 4BBSJ 4IHXA 1FEXA 2JWTA 2TCTA 2HXOA 5C3EJ 1IJWC 1JKOC 1MBEA 5J1RA 3HOZJ 1QRYA 2R5ZA 3QQAA 1JTYA 2DTZA 5J1YA 1W0UA 2XPUA 2L7FP 1XS9A 2IBDA 2LY9A 2DMUA 2CRGA 2EH3A 3E7LA 3PO2J 2H1KA 3FK6A 2JN6A 5K7FA 3JRHA 3HOVJ 1ETKA 3LSGA 1JJ8C 1MH3A 5IYCJ 4MIMA 1LE8A 1QVUA 3IH2A 1D5YA 2Y9ZA 2XGEA 3RZOJ 5F0CA 5M5YJ 9ANTA 5K7HA 4AYBN 3BR0A 1JT6A 1T33A 2R5YB 3I4NJ 3HOWJ 5IP7J 5F27A 4V2FA 2Y0SN 2YUSA 5E3LA 2JJ7A 2ME0A 4B3AA 1QPIA 1B72B 5EEAA 2W48A 2L9RA 1VFCA 1HF0A 2YU9J 3GTQJ 3HOYJ 4XRSG 3BTCA 2ECCA 5F1JA 2K9QA 3SDGA 4I6ZA 4C3JJ 3A01B 4MFEA 2EZIA 2E1OA 1QVTA 4DYQA 4XRSA 2CUEA 5IYBJ 2VPRA 3RKQA 1RKWA 3JRFA 3ZQGA 2Y2ZA 3BT9A 2TRTA 1GUUA 5EYRA 4A3CJ 5DTDA 2CQQA 2K9NA 4AC0A 2XB5A 4B1RA 2JA7J 2LK2A 1TWAJ 3K7AJ 4A3MJ 3BG5A 4UUSB 5F08A 2LKXA 2E2HJ 1OCTC 3JRAA 2LVSA 3BG3A 3ZQCA 1ZQ3P 3W6VA 1IDZA 3SJMA 3OSFA 4IHYA 3JRGA 4DYCA 1GDTA 5GP9A 1OFCX 2NS8A 3ZOBA 3HDDA 5E3MA 2ELKA 2K9SA 5EG0B 5F0FA 1IV6A 2XGCA 2X9DA 4FISA 4X1EA 3S1NJ 2DA2A 3BR2A 2CJJA 4FE4A 1BW6A 1XG1A 5HODA 3S1MJ 2K40A 1MNMC 4Y52J 1R9TJ 1X58A 2JK3A 5FKOA 2VKEA 4IEJA 3LSPA 1RKTA 2Y31A 1XC5A 4M6VA 1H8AC 3MVPA 3RZDJ 2GLOA 3MKLA 1MBFA 5DS9A 1Y1VJ 1FJLA 3MN2A 2D5VA 4M3FA 3H3VK 2NOGA 2WB1N 4IHWA 5FKMA 1AKHA 3FKIJ 4CYCA 4ABZA 1I3QJ 2DA1A 1OCPA 2DN0A 1TC3C 4MO7A 2Y9YA 2MGQA 3O8GA 1YRNB 1TWGJ 3I4MJ 4C3HJ 4BY1J 1U9OA 1G2HA 1UHSA 3HEFA 1FTZA 3CDLA 3JR9A 3UKGA 4QTRA 5FLVA 3BG9A 2FJ1A 1CQTA 4MLOA 2MSYA 5IYDJ 2M9HA 2CU7A 3BR6A 2R5YA 2XPVA 3TW6A 4G12A 2YS9A 5EDNA 5IP9J 4W97A 1WH5A 1JJ6C 2JMWA 3IH3A 1Z77A 1B72A 5C4XJ 2LFBA 1WPKA 1SFOJ 2DMPA 2FQ4A 2FD5A 1A5JA 3A01A 3L1PA 3S2HJ 1ZKGA 2HOTA 4IHVA 3Q3SA 2HOAA 3GTKJ 1A6IA 2E19A 3HBLA 4XK4A 2LLKA 2WAQN 1PUFB 2DA3A 2XSDC 2NS7A 4X6AJ 3JRCA 1BL0A 2NVXJ 5IP6A 1ENHA 2IAIA 4A93J 3FIWA 2O9LA 4UUSA 2JA6J 3GTMJ 3NAUA 1W0TA 1HDPA 4NDLA 5K7ZA 3GTPJ 5M5XJ 1MBHA 1JKRC 3M3YJ 2DA5A 1RR7A 1IG7A 2CQXA 3PM1A 2EQRA 2E2JJ 2JA8J 1VI0A 2EZLA 4A69C 4DZJA 1VF9A 3G1MA 3LSJA 4DYRA 3Q0VA 2L7ZA 2NVQJ 3HGYA 4BY7J 2X6OA 1ETQA 3A02A 3OSGA 4DW6A 3B6CA 2IEKA 2LR8A 1ITYA 1HCRA 2G0EA 2ID6A 4BBRJ 1U9NA 2GBYA 5JLWA 5EG0A 4A3GJ 1LFBA 1MSFC 5J1UA 2OF7A 3D1NI 3S1RJ 3FISA 3TP0A 4DZPA 1Y1WJ 1FIAA 1JGGA 2R92J 3GTGJ 5M3MJ 2DJNA 4V2GA 4D5CA 3CQZJ 2LP0A 1MH4A 3G1OA 1UG2A 2AHQA 3K2AA 1JUPA 5M5WJ 1GV2A 1ZK8A 5EZHA 2GM4A 1IRZA 1ZR4A 1RESA 2LTPA 1P7JA 3QPSA 5JLXA 4XICA 4RBOA 3M4OJ 2O8KA 5F04A 1GVDA 1HDDC 1I6HJ 5BNGA 3B6AA 3S1QJ 2ME6A 1YRNA 1LFUP 1WI3A 4QSHA 1JKPC 5EGOA 1IDYA 1X2NA 3JRDA 1TWHJ 2DA6A 3ZQLA 5EGOB 2DA4A 3GTJJ 2B63J 1ETWA 5FKKA 1EF4A 3NARA 1GT0C 4D5FA 1JUMA 3CMYA 1BJZA 3LSRA 2HI3A 2Y30A 4FTHA 4A3DJ 1MBKA 2MW8A 3BQZA 2XGDA 1X2MA 3G1LA 3Q0UA 4M3GA 4UUTA 1HOMA 5C44J 1I50J 4A3IJ 4HNVA 2EBIA 4LOCA 3CCYA 1Q1VA 5EF6A 2DA7A 1B8IB 5FLMJ 3BR5A 1P7IA 5FKLA 2NVTJ 2M8GX 4B4CA 1IC8A 3JRBA 4M3EA 3S17J 1MBGA 3ZQIA 4J19A 2R0QC 2QCOA 2R7ZJ 2H8RA 2L7MP 3FK7A 2M2EA 4M3BA 3TP3A 2R5ZB 4C3IJ 3GTOJ 4L5EA 2E2IJ 2KT0A 3OIOA 1SANA 3TEDA 4A3LJ 5EZGA 2EZKA 1U8BA 1ZGWA 4BKXA 1DU6A 2MG4A 1T56A 3ZQFA 2RAEA 2I10A 1K61A 1U78A 2NVYJ 4QIWN 1LE8B 3OOUA 3JREA 1MSEC 1PUFA 1DU0A 3WHCA 2HYJA 2LD5A 3BR3A 3F0CA 1POGA 3GBGA 4W1UA 2JA5J 2DMNA 2PMZN 1BA5A 2CUFA 5E3NA 2VUMJ 3IV5A 4GFBA 2HQ5A 1Z0XA 2VI6A 4M3DA 5IPAA 3O8HA 4D7NA
chains in the Genus database with same CATH superfamily
4HF1A 5H20A 1K6YA 5CJ9A 3DCFA 1QQIA 1YFHA 2A3SA 2CFXA 4XSZF 1K78B 3ULQB 3OYAA 3U9GA 3CC2I 1RR8C 2QF7A 4OMYA 2OTLI 1AHDP 4WXHA 4BXXJ 3RCOA 1BM9A 2V6EA 3V42A 1SVOA 3E6BA 1G3TA 1WI9A 3K2ZA 3Q9SA 1JT0A 4JBAA 1MDMA 4C2MJ 1IW7F 5D8KB 1RPWA 2K9MA 1LFPA 3CP8A 2LG4A 5BPDA 2DMTA 2XPWA 5GAHJ 3FMSA 3ZMSA 4G7OF 5F6FA 3VPRA 3DEWA 2DFHA 3I3LA 4NQWA 4RGUA 2EFQA 4Q4ZF 1RUOA 1V55H 3H35A 2CV2A 4M9XA 2R7VA 4HEA2 5JFRA 2HTSA 1UMQA 1S7EA 2EA4A 4F7ZA 1UELB 5E1XA 3VWBA 2QKLB 2W57A 2FMLA 3F22A 3B73A 2M34A 3BQYA 1V5FA 2DMQA 4Y33A 3GZ6A 4JQFA 2Z33A 3VB2A 1K83J 3ZRGA 1NK3P 2ESNA 2ZC2A 1RI7A 1J9IA 3WGHA 4XOPA 3Q5FA 2VE8A 2BXZA 2HOSA 2AQFA 5AIPA 1T2KA 3CCMI 1RETA 4RAFA 2COBA 4HX7A 5KNLA 5E8IA 1SFEA 5GPAA 1B9NA 2X48A 1I1SA 2VBZA 3KEQA 1WCMJ 1OLTA 2PX9A 3DKXA 4ZH4F 2DOFA 2JSPA 1R4NB 3ESWB 4IF4A 4A3BJ 1BN5A 2CQNA 3FZVA 1WZ2A 2O7OA 5IOZA 3B02A 1R5GA 4IOCF 4XR6A 5F0HA 2PJRA 1EKEA 2GA1A 2P6TA 2Y75A 2DO7A 3QPHA 1ORKA 1UAAA 2HYFA 1B8IA 2R7OA 2VXDA 1F1ZA 3WU1B 3PQKA 1YI2I 3PQJA 3HKZN 4XSXF 1D3YA 2BHYA 1OISA 4ZTFA 1NK2P 3QRFF 3HTUA 4NUBA 2P7CB 3CLOA 3VYTB 5DCFA 3JW4A 1ZGJA 2JWTA 2HXOA 3W2AA 2CG4A 2WTEA 5J1RA 3W2WA 3QQAA 4FHTA 4IOAF 1MJBA 3GFIA 1XN7A 2XPUA 5CVVA 1XS9A 1G3WA 1ZRFA 2LY9A 2CRGA 2H1KA 3FK6A 1QGPA 4FX0A 3FXMA 3S3MA 3LL7A 2PEXA 4FASD 2IJLA 1JJ8C 4MIMA 1QVUA 3IH2A 3WTTC 3KE2A 1K6OA 2XF6A 3LSIA 4YELA 1V54H 3OY9A 4AYBN 1XSXA 1ZGAA 3I4NJ 2GXAA 3HOTA 4IHTA 5IP7J 3C3WA 1Y6IA 2W85A 2FOKA 2ME0A 2DFFA 1LEBA 2KP6A 1B72B 1LEAA 5EEAA 4RA2A 3HOYJ 2Y0MA 1OCOH 5DCMA 3BLYA 2ECCA 4QLCU 3KETA 3OYBA 1YOVB 2E1OA 3C7JA 2CUEA 2VPRA 3JRFA 3GO5A 3KP6A 3A2KA 1YJNI 2IXSA 4XLAA 4CCNA 1FMWA 4A3CJ 4AD9A 1PUEE 2A05A 4S04A 3C1DA 2IRFG 2ZXIA 2BZTA 1U0JA 2JA7J 1YS7A 1UJ8A 2XKOA 5BMZA 1TWAJ 4BQQA 1OR7C 4OU0A 4BACA 3BG5A 1F5TA 1FMVA 2E60A 3AAFA 1ZRDA 2DDAA 1G6NA 1LDDA 3W3CA 2JPBA 5E20A 4GCVA 2EFOA 3HIFA 4PFOA 2H94A 3OSFA 4IHYA 1SD6A 4EMSA 3G2BA 1N75A 2DT6A 5GP9A 4ANJA 3KYDB 2M7BA 4C30A 3OYKA 4U7BA 3KFWX 5JI6A 5GTIC 2ZJ2A 1Z05A 3NQOA 3FM3A 2K85A 1Z3XA 5IT9K 3S3NA 1QHGA 1IV6A 4BDZA 3V8JA 2XGCA 2XAGA 4FISA 3BC8A 4BUPA 2DA2A 4L9NA 3PIPF 3GEZA 3GVAA 1HKSA 1OQYA 4NC8A 3WTZA 3GZ5A 1BW6A 1SFKA 1LDJA 2MC4A 4A0YA 4E7HA 4JOMA 2VT3A 4Y52J 1GXPA 1LQ1A 4HX8A 1SVLA 4LG3A 1ODDA 3ZMZA 2VASA 4HX4A 2WWYA 3OYDA 1R1UA 4M6VA 1XCBA 4G9YA 1DPRA 3CCJI 4O5VA 5J8CA 1MMDA 2DT5A 3MKLA 3QU3A 5DS9A 2L02A 2CV0A 5LGTA 3MN2A 4BS9A 4M3FA 4LMYA 1TQPA 2NOGA 3FKIJ 1Y0UA 2EFWA 3HHGA 3HSEA 2VJJA 3KP5A 3DBLB 1LB2A 2Y9YA 1S72I 2MGQA 3O8GA 1K4SA 2W1OA 3T8TA 3DKYA 2M5WA 3I4MJ 3GW2A 3RYPA 3RI4A 3T8RA 3I55I 2OTJI 5ICFA 4PCQA 3FF5A 3VSLA 3QU6A 1BI1A 1RUNA 2Q1ZB 1R4MB 3HEFA 1IN4A 3KP2A 1M1EB 1IN8A 3JR9A 4J00A 4QTRA 4XQFA 3DFGA 3I0TA 5FD6A 1FOYA 2VBWA 2XSJC 3EYIA 1CQTA 1T6SA 4AU7A 2M9HA 3ZGKA 3EYYA 2BEOA 2WA0A 3VYRB 3ZMDA 3K4CA 1A35A 1VQKI 2A6EF 3HUGB 3PJRA 1Z6TA 4KICA 4OAYA 2HQAA 3MD2A 3MZYA 1DQUA 4F91B 5IP9J 1F4KA 3TQNA 1T38A 2E7WA 3ERMA 4NC6A 1ZG3A 3L7WA 2YU3A 2LFBA 1WPKA 5C4XJ 1UCRA 2DMPA 2FD5A 1Z7UA 2FQ4A 3VYSB 2DT7B 3FMQA 3BJAA 3H3UA 2BY1A 2VQLA 2QSGX 1HSTA 2HOTA 3KZYA 4WXCA 4CZZA 2FOWA 4DQ2A 4CUGA 3M07A 4ZYEA 3FWEA 3GTKJ 2QWWA 1CGPA 3H0DA 2X6XA 2LLKA 1PJRA 2L3DA 2OBPA 2DA3A 2LBFB 2XSDC 1MMNA 5IP6A 1XDSA 1ENHA 1W7PD 4RAGA 3P9IA 2EB7A 1XB4A 4ESFA 3G6EI 4CHUA 1VZ0A 3JCUC 2ISZA 2Y69H 1L3LA 3NAUA 1JHHA 3HSFA 5K7ZA 5KCMA 4P9FA 3ZMUA 2VONA 3J7AO 1C0WA 1WKMA 2CQXA 2E2JJ 4A5MA 1HW1A 2ZFUA 5IT3A 4A69C 3IKTA 2P0WA 1ZHFA 4BQOA 4DYRA 4BXUA 1YX5A 1KU9A 4L9TA 2H1LA 1ZYRF 1HKTA 3OMYA 3DPLC 2BE5F 2X6OA 4BY7J 3FDYA 4Y13A 1I6XA 4MEYF 4CCKA 2DBBA 2KMUA 5CVRA 1U9NA 5IY5H 5EG0A 1MSFC 4UUVA 3SHFA 3FISA 2BHZA 5ILUA 1FIAA 3GFMA 4P1WA 5M3MJ 2DJNA 3G71I 4MQVA 2CH0A 2F2EA 2HFHA 3I4PA 1JXSA 3RTRA 2RNGA 4I02A 2IPQX 3GLLA 2HVRA 4ZTJA 1Y8RB 2P4WA 4UNOA 1KU7A 1IRZA 5CPRB 5ILVA 4F52A 2W25A 2K4BA 1W1WE 3H5AA 2B9SA 3WTXC 2XASA 4XONA 4II2A 4N4OB 2BOLA 2D45A 4GYIA 2ZFWA 5DD8A 4IZZA 5F04A 1GVDA 1HDDC 2QKMB 3O6BB 4KYWA 1TW2A 3W6KB 4D9JA 2ME6A 4E7SA 1YRNA 4BEHA 2PFBA 4F93B 3K0LA 1JKPC 4CA0A 1QO0D 1IDYA 1P4XA 3JRDA 2MABA 3TO7A 5CLSA 3GTJJ 4YFNF 2HU9A 2K5CA 2FU4A 3NARA 4D5FA 1S9HA 1R23A 2Q8KA 4ZYDA 4EJVA 4FTHA 3QAHA 4FX4A 1MBKA 3DEUA 3BQZA 1N77A 1X4PA 1X2MA 3G1LA 2FE3A 1I50J 3MZ8A 5E1ZB 4HNVA 1BJAA 1Z6RA 2OZ6A 1T39A 2DA7A 2BVMA 2M7AA 2ZNZA 2KIUA 2CYYA 2R7QA 1YX3A 5FLMJ 4F55A 3HJEA 3JAMK 3CP2A 2H09A 4LB5A 2FBIA 4M3EA 3OYGA 1S3JA 1UG0A 3D5RC 4EJWA 2OA4A 4LK1F 1TBXA 2R7ZJ 2CWEA 3CDHA 2L7MP 2M2EA 1T98A 3H9GA 2R5ZB 1ZG5A 4YIFA 4C3IJ 3TDZC 4L5EA 1TNSA 3D5LA 2E2IJ 4AIJA 1FX7A 1BBYA 1FT9A 2EILH 2EZKA 2QQBA 5DDGA 2MG4A 5CVUA 1D1AA 1I5ZA 1SVMA 2XKPA 3ZQFA 4DOZA 2RAEA 4UV9A 1K61A 2Q2EA 1UHMA 2VC0A 4OINF 1E3HA 2XC7A 5CKTA 4A2UA 4AYBA 3BR3A 4W1UA 2JA5J 1Y39A 2OC6A 3K1MA 5E3NA 2DAOA 3SDBA 2VUMJ 2HQ5A 5EJCA 1TQIA 2RQQA 1Q1HA 4G7ZF 1SD5A 1Z0XA 2I5UA 2VI6A 1DGRM 1BR1A 1OCCH 3C2HA 5IPAA 2R7DA 1FLIA 2KIMA 2PJPA 3U21A 4ENKA 4E4HA 2E34A 3DPUA 6PAXA 4I76A 2YSRA 3X2QH 2WAQA 5FKNA 1OCZH 1WJEA 1TWFJ 4XKBA 3KYLA 3RPUA 4CSWA 3IH4A 4EEFG 5ERIA 1TNTA 4Y17A 1H89C 2GIVA 3E1SA 3VODA 3GTLJ 4OOIA 1FIPA 3BZ6A 5B66C 1AU7A 4YFKF 3QODA 1BC8C 1VQOI 2W82A 3DWLE 4I99C 1HW2A 4UB6C 2FNAA 4MHGA 3RSNA 3EUKL 2BV6A 3K4KA 4I7HA 3RQIA 1MBJA 2ECBA 3Q0WA 1ZR2A 2P81A 2L0KA 2OPTA 4A3JJ 1XD7A 2JSCA 1ETXA 1WWXA 1EH7A 1USSA 3IL2A 2KDZA 4FCYA 2M0CA 5D5VB 2ELHA 4C2TA 1IN7A 1Y0NA 1WJAA 2B7EA 4WXDA 1WHUA 2CUZA 2EFNA 4AUXA 4HOBA 1IUFA 4ZYAA 1MKMA 2F5EA 4PJJA 4BYYA 1JTXA 4S0HB 1YS6A 4MFDA 3VSKA 3OYMA 1FSHA 3BTLA 3KEOA 4I0AA 2K02A 3CUQC 2O0YA 2CW7A 1HXDA 3M7GA 1ULYA 3FXOA 1FTTA 1JKQC 2EZHA 4IQ4A 1B4AA 4G6QA 3TKYA 1IUYA 3FBNB 3HM5A 5F1RA 2J5PA 4S05A 2VLAA 5FD5A 2YPRA 3K4NA 4HDUA 4RGXA 5GAGJ 3ABTA 2Z3YA 3JRIA 2Z16A 2LYCA 4XNFA 5A2QK 2RN7A 4HZFA 3OR1C 4JX6A 2CO5A 1MMSA 1BC7C 3OIQA 4U87A 1D1CA 1AKHB 1F43A 1XTAA 2F5VA 3L2WA 3CO7C 4CYCB 1YO5C 4EQQA 2CMPA 2WAFA 3A03A 2E1MB 1APLC 2ZXWH 1BW5A 1NTCA 2JTVA 3KIOA 2NAZA 4OAZA 4CCOA 3S14J 1HA8A 2XB0X 2CQKA 4FE7A 3J80K 3I64A 2R7SA 2BYVE 2A5YB 4XLFA 2TCTA 2KISA 2DXIA 4EJOA 1QZYA 3HOZJ 5LGNA 1TQMA 5DM6F 2CW8A 2DTZA 1D0YA 2L7FP 3IAS2 4HLXA 4KN7X 4AIDA 2VE9A 2M4KA 4KMUX 3G3ZA 3CO6C 4KA4A 1U5TB 2DMUA 3PO2J 3JRHA 2E5ZA 3HOVJ 1Z9CA 2K3FA 3FKJA 1MD0A 5IYCJ 3EUAA 3F3XA 3FXUA 2Y9ZA 2HZTA 3RZOJ 2R5YB 4XKCA 2CGPA 4D1QA 2HOEA 3I58A 2ESHA 4IVNA 2CFOA 3N97A 3SEQA 2JJ7A 3CCRI 2FBHA 2XRNA 2ZMEC 1VFCA 3GFJA 4XRSG 4BNCA 2EINH 5F1JA 4XL9A 2K9QA 4I6ZA 4NB5A 3A01B 4MFEA 1QVTA 2LOOA 4M73A 2ZSIB 4K2EA 1KZHA 2ZCWA 1K78A 3CLQA 3QPTA 4UB8C 1YJWI 3BT9A 3WTVC 2TRTA 4CXFA 1GUUA 3PUBA 1QPMA 1SMTA 2CQQA 5D5UB 2ADUA 2K27A 1XMAA 3EETA 3BY6A 2LK2A 4Y3OA 4A3MJ 2LRDA 4KIFA 4ENNA 4KN4X 3TBIA 3R0AA 4UUSB 4BE2A 2LKXA 3L2RA 2E2HJ 1XDUA 3JRAA 1ZARA 2YR2A 1LKXA 2LVSA 2P6SA 1HKQA 2IGMA 1KYZA 2K4JA 3VYUB 1SC7A 2ZNYA 5DYMA 3SJMA 2LNBA 3NWTA 2OD5A 4L0YB 1T0FC 1LUJB 4IKFA 1GDTA 5E8GA 1V5GA 2NS8A 2YX7A 4I01A 2V1DA 3QOEA 3M1CA 2VXZA 3HDDA 2XDVA 3DTIA 4CYDA 3PNTA 2VJ4A 2ZSHB 1AA7A 1KQ8A 4B8XA 2CJJA 3ZMTA 2VKHA 3ZCOA 5DV5A 1WQ2A 3OYNA 2NVUB 3A4CA 1WJ5A 1EJ9A 3LQRA 4LITA 5HODA 3S1MJ 2K40A 1GLNA 1I3AA 2K3PA 3PSFA 3COAC 1X58A 5FKOA 4U7DA 3LSHA 3LSPA 3TGNA 4OIPF 3AFHA 4EJUA 1OMIA 1UFMA 3MVPA 5DEQA 2E1CA 3ELKA 2MA3A 4DNCA 2CQ7A 2GLOA 1MBFA 3P7NA 4IO9F 1Y1VJ 3HC7A 3FM5A 3LSMA 4YIIA 3ML6A 4ABZA 1OCPA 1I39A 1TC3C 2G7UA 1QZEA 4LB6B 3BPVA 3OL4A 2O5RA 2HVQA 4HA8A 4KISA 3BG6A 1ZH5A 2QYOA 1LNWA 3BJOA 2IA2A 4C3HJ 5LGUA 4BY1J 1U9OA 4RGRA 1W7PB 2FXAA 1G2HA 1HQCA 5EEHA 1UHSA 5J6XA 1TTYA 3RJPA 5TJJA 2PMHA 3CDLA 4MGRA 4CGZA 2DOEA 2FJ1A 3W2VA 4MLOA 3HRUA 3DLAA 5IYDJ 1VQPI 3E5UA 3OS1A 4PJMA 1WVRA 2QENA 2LH9A 1D8KA 3PNVA 5ED4A 4E7KA 1LDKB 3CD6I 3GYHX 5HLHA 3CF5F 1H9GA 2DLLA 1HBXG 4W97A 2X6YA 4ESBA 4BDYA 2FEZA 2LKPA 1U6GA 1Z77A 1B72A 4Z2YA 4XRFA 1R49A 1A5JA 1U3EM 3ZR8X 1YG2A 3H3ZA 4Q48A 1JI8A 1JE8A 3FXLA 3UNGC 1BR2A 1G59A 1FBSA 2GXGA 2VQGA 3CCVI 3BOQA 4IHVA 1BOAA 2IGKA 2VIXA 1XCVA 4KMFA 2IP2A 1WRJA 1A6IA 3SEZA 3FHNA 5L3DA 4J01A 2Z1DA 2WAQN 3LSTA 3ABLH 2RDPA 2F48A 3EDPA 4X6AJ 2XV4S 2WADA 2Y0SA 2NVXJ 2STWA 5B5EC 1G8XA 2JA2A 1MW7A 1PYVA 1VQ8I 1YYVA 4KNYA 2M8EA 2JA6J 2XAUA 3MAJA 3GTMJ 4I98B 1W0TA 1G3YA 1MBHA 2DQRA 1STZA 2DA5A 4ZDPA 2JRMA 2LY1A 1K4TA 4RM2A 2JA8J 1GHCA 3BDDA 4DZJA 3IWZA 3G1MA 4G94A 2K9LA 1QU3A 3L2CA 3Q0VA 2DYRH 2JVGA 2NVQJ 3HGYA 4A0XA 1ETQA 2RNJA 3A02A 3B6CA 2V9KA 4AIHA 3RKXA 2WY7Q 1ITYA 2LKSA 1HCRA 5D4SA 4BJ5C 4PGGA 5LRRA 1R1TA 4M9SA 5J1UA 5HLIA 5LBQA 4CZCA 3KEYA 3UR3C 4HRIA 1Y1WJ 2R92J 1D0ZA 2EA2A 1ZN2A 2LP0A 1OYWA 1MH4A 3DTEA 3E6MA 4ASNA 2AHQA 2DJIA 2BBYA 1OYYA 4MQ9F 2W00A 3ZXSA 1FZPB 4L5IA 1GV2A 1KYWA 1ZK8A 5EZHA 4IRIA 1DUXC 2L01A 4BXFA 5LHGA 2R7TA 1ZR4A 3CMAI 2O61A 3LFKA 1P7JA 2QGUA 4P5OA 3WU0A 5JLXA 5LEKA 4EGYA 2MH2A 3AG2H 3M4OJ 1P4WA 3CUQB 4F92B 5BNGA 3B6AA 2IS4A 4XN0A 4N9IA 1OPCA 2J5OA 2P5KA 3H5RA 3CCLI 2DFEA 3ZQQA 2MLKA 1O57A 5EGOA 2RVCA 2L9NA 1KU2A 5EGOB 1ETWA 5FKKA 1G3SA 1P9QC 3FXKA 1VTNC 1GT0C 2BY2A 3V4GA 1JUMA 4UVAA 3LSRA 2I8DA 2R7FA 5KAFC 4IX7A 3FX3A 4KFCA 3T5XA 2Y30A 4LJZF 5B3SH 4ZDOA 2UZKA 2MW8A 1BI3A 3CDIA 2WB1A 3LQQA 3CTAA 4M3GA 4UUTA 2Q0OA 3MKZA 4KT6A 1LJ9A 4IL6C 3CCYA 1Q1VA 3TOAA 1J7KA 1T8IA 3G4SI 4N9HA 3VDXA 4B4CA 3HUGA 2XROA 3HL2A 4XKVA 3ZPLA 2OQRA 2VC1A 3ZQIA 2F4OB 2R0QC 1S7OA 3F8FA 1KONA 3CMMA 5KK1A 4PJNA 2QQAA 4PSWA 3TP3A 1MJ9A 4XLNF 2QA4I 3V7RA 3L2UA 5B1BH 1Z7LA 3GTOJ 2VPLA 2Z9OA 1FOKA 1SANA 1A36A 3TEDA 2K7LA 1U8BA 2BW3B 4BKXA 1E17A 2EIJH 1T56A 1BIBA 3JTGA 1U78A 4QIWN 1WJCA 2K86A 4A6DA 2AXLA 5ICCA 3OOUA 1LE8B 2L9SA 2M4GA 1SAXA 2LBFA 2HYJA 2DDBA 2X85A 3E5QA 1X1AA 2FBKA 3F0CA 1POGA 1BA5A 4CDGA 3KLOA 2MFZA 3BCBA 3DU6A 1S7AA 2ZMEB 4M3DA 3J81K 4HNTA 2WY8Q 3M8FA 5L3FA 1YLFA 3CESA 2LC2A 4ENJA 2HQNA 3QPLA 2ID3A 1PP8F 1MGTA 4A3KJ 3ABMH 1NHAA 3TW7A 2XVCA 3OOPA 4EGZA 2EV0A 3EUHA 3IWFA 3PL8A 2D1VA 4I09A 1H88C 4RLFA 1FC3A 4UY8I 3N4MA 5LD2C 3BR1A 2E1NA 3S15J 2KRHA 2XAHA 4RDUA 2F5FA 3BTJA 3F23A 3QP6A 4HPQA 4RLQA 1J09A 3EQLF 3QOPA 4RGSA 3C18A 1F36A 5B1AH 4XORA 3CC7I 4XRMA 4YRVA 1YIJI 1K7AA 4JYKA 2RQPA 5E3OA 3FBIB 1WH7A 4P55A 2W7NA 4WWCA 2MBFA 3D5SC 5C4JJ 2V1XA 4JX4A 5D6EA 5E79C 1KGSA 2VBYA 1V4RA 3F8NA 1J0RA 2FX0A 3E0JB 5HVQC 3R4KA 1ONVA 3HPGA 5FFXA 1O3QA 5FLXK 1FOXA 5H2FC 2P5LC 4KUMA 3BZKA 2A6HF 4KT5C 5L3BA 5LFAA 4I0BA 3EPZA 3D0SA 2N8GA 3WU2C 2HWVA 3S2DJ 4D0PA 4BL0B 3HTSB 1PVEA 4MTEA 3HB9A 2O3FA 1KA8A 5L3CA 4LK0F 1OJLA 2HKXA 2R93J 1TWCJ 3LOCA 5J40A 3S32A 3BTIA 2QUFA 4HQEA 2HXIA 4HF2A 3SZGA 2FA5A 4Y7NJ 3RQ4A 1QNTA 5M3FJ 5L3GA 1YW7A 4PSXA 1O4XA 2PBIA 4C9YA 5FJ8J 1Z67A 5CVJA 3LNQA 3AL0C 2KDOA 1ZG1A 1HLVA 1WFXA 2GIZA 4RB0A 3HOUJ 2L7KA 2NNYA 2PMUA 3QWLA 2RV8A 1GV5A 2VJ5A 3I71A 4D7MA 3RIRA 5GADJ 4OIOF 4BQNA 4A3FJ 1YW9A 1GXQA 3FXQA 2HDDA 2R7UA 3A1YA 4IHXA 1IRGA 1SFUA 2X1EA 5C3EJ 1IJWC 1JKOC 1A31A 1MBEA 1QRYA 3L09A 2R5ZA 3J7AY 4UVCA 1WSUA 5HNFA 1FPQA 1JTYA 2XF7A 3MCZA 3OYEA 5J1YA 1BI2A 1W0UA 2IBDA 4ZJZA 3ECHA 1VQLI 2A61A 2KJBA 3WG7H 3F8BA 3CUOA 3FXJA 1MH3A 1ON2A 3OYCA 2JT1A 1XGNA 1J75A 3WTSC 1X1CA 5F0CA 5M5YJ 1J5YA 4XM3A 5F64A 1T33A 4EM2A 1D1BA 3HOWJ 2NNNA 4G6TB 3ABKH 3MZHA 2Y0SN 3OL3A 1QPIA 5IT9Z 3BROA 3MWMA 1ZRCA 5KAIC 2W48A 1SFXA 2L9RA 3GTQJ 2YU9J 4M71A 2DOAA 3BTCA 2LREA 1IO2A 3I59B 4C3JJ 2NRAC 2IGOA 2PQ8A 2IVMA 2EZIA 1L0OC 4ITVA 4DYQA 2HKOA 3RYRA 3E6CC 3K6GA 2V9PA 1R5ID 3CC4I 3IP4B 5EYRA 5HNHA 4ETSA 5DTDA 2K9NA 1G4DA 1TL8A 1XGMA 4G6DA 4B1RA 4O3MA 2OQGA 4M9ZA 2X0LA 2KQRA 1OR7A 3ASOH 2GOXB 3P5JA 3K7AJ 4Z6YA 4ZZDA 2CS3A 2UUZA 1U8RA 1Z21A 2V9VA 2Z5UA 3R61A 2NS0A 2FRHA 1OCTC 2XGXA 4XLCA 3BG3A 1IDZA 2IA0A 1J2XA 4WCGA 2ZBKA 1XSDA 2GOMA 1MMGA 4RM3A 2ISYA 4DYCA 1OFCX 3H9QA 1R7JA 2M45A 1XGOA 2RKHA 3BP8A 5E3MA 2ELKA 2B0LA 1IRXA 4GO1A 1U2WA 3WGGA 1VQ9I 2X9DA 3FXRA 3DU5A 1B9MA 3S1NJ 2A6TA 1IN5A 5D5XB 1A04A 4GYGA 5FRMA 3IUOA 5K5OA 1R9TJ 2JK3A 3A0BC 2VKEA 4IEJA 2HVSA 2Y31A 4QWQA 1NH3A 3J7ZI 1ZREA 1XC5A 2IS2A 1P6RA 5JR3A 3RZDJ 1VQ6I 1AOYA 2D5VA 2HQRA 5EEGA 3SYTA 3H3VK 4IHWA 2WB1N 5HDKA 1AKHA 3KZZA 2X51A 1IXRC 4CYCA 2UXXA 3BZCA 2QBYA 2DA1A 1KQ0A 2DN0A 4G7HF 2QBYB 5K1YA 5TGTA 4EM1A 1REPC 3V8LA 1BI0A 3KP3A 3QP5A 3CCEI 4BHCA 5DUIA 1X3UA 3M8JA 3OS0A 1F9NA 3HRTA 1R22A 1GVJA 4BAYA 2L54A 3UKGA 4HW0A 4PK4A 1U5TA 5FLVA 1YQAA 2P7VB 5JVGF 1FBQA 3CZ6A 2MSYA 2VB6A 1FP2A 4O6JA 4JK1X 4WF2A 3FHZA 1X1BA 2IGNA 2CU7A 5FB2A 4XLHA 3MKYB 3BR6A 3TO9A 4BH9A 5LLQA 3R6SA 2R5YA 4X0GA 2A69F 2OAZA 2V1UA 1Y56A 3IC7A 1MZBA 3JTHA 2WV0A 4U88A 4G12A 4ZYGA 4WK8F 3DXJF 3L2VA 2YS9A 5EDNA 4IPAA 3NEUA 4C2UA 5LHHA 1WH5A 2JMWA 2LF7A 1SEUA 3LA7A 1X3ZB 3K4MA 3F8CA 4ON0A 3R60A 4LLGF 2BY3A 3A01A 5HS8A 3L1PA 3S2HJ 1ZKGA 2IT0A 2LMDA 3Q3SA 2KIQA 4RAZA 4G8XA 3BG7A 2G7HA 3F72A 3HBLA 2ICWG 1N78A 4B48A 4LG0B 5BOXA 2JPCA 3H36A 1PUFB 2X1DA 5CQEA 3K69A 3JRCA 4I2OA 1FBUA 1TT5B 1Z3YA 3FIWA 2Y48A 1T95A 4FT8A 3F21A 2JQ7A 4UUSA 2DK8A 4L18B 4RB3C 3F9KA 1HDPA 3GZNB 1W36D 5GTHC 5M5XJ 4HDVA 3M3YJ 4II3A 1T08B 1RR7A 4YG2F 1IG7A 3S2WA 2X1CA 3PM1A 4HYEA 2EZLA 4NNJA 3LSJA 1IN6A 2L7ZA 2M87A 5DD4A 2BVLA 4DJAA 4DW6A 3EUHC 3PIOF 2LR8A 3LAPA 2G0EA 3GFLA 1RZ4A 1HC8A 5JLWA 1YW8A 2O8XA 3D1NI 2OF7A 1H0MA 2FNPA 4BJ6C 4U0VA 1S29A 1R1VA 1MDMB 1B1BA 3JAMZ 5K5QA 1ON1A 2EV6A 2KIFA 4BHBA 4V2GA 1QZZA 3CQZJ 1EA3A 3AG1H 4L0ZB 3G1OA 1E2XA 1UG2A 2PLYA 4CICA 2VJIA 4NQWB 2QEXI 2DPUA 4HSTA 1RRJA 1R00A 2GM4A 5FROA 2C6YA 3VEPA 3LFUA 4IHSA 4MEXF 1X1DA 3QPSA 5CYVA 4HV5A 2VL8A 2L4MA 2VT2A 1PDNC 2F4IA 2DPDA 5JVTA 1EH6A 3QYFA 2O8KA 1I6HJ 1S5LC 2JRTA 1IV8A 2OV7A 3S1QJ 4B09A 1LFUP 1WI3A 4LIVA 3GXOA 1X2NA 3I54A 1OYIA 2DA6A 3HPHA 2B63J 4ZDLA 3E6DA 1EF4A 2IS1A 2YX4A 1ZELA 4L5JA 1W7PA 1BJZA 2XF5A 3MMYB 2HI3A 3RPUD 3RPQA 2D2WA 2IS6A 4UXNA 4A3DJ 5E18F 2DK5A 2XGDA 4L9JA 2EV5A 2PJRB 1D5VA 1HOMA 4RS8A 3V7SA 5C44J 3LA3A 1W36C 2EBIA 3AL0B 4LOCA 3KYCB 2EPFA 1SMYF 1B8IB 2M8GX 3CJQB 1PP7U 2H8WA 1IC8A 3HZJA 3OWTA 5KVRA 5LRSA 4PJLA 1MBGA 3R0JA 4J19A 3WE2A 2QCOA 2KHMA 1WJBA 1X19A 2H8RA 2FUG2 4IRGA 1RNLA 2KZVA 4M3BA 3TL4X 3BWGA 2WC2A 3ASNH 3O3KA 1P4AA 4OIQF 4ESJA 1HSJA 3GCMA 3OIOA 3DLLF 3DP7A 3WTYC 4A3LJ 5J8FA 1ZGWA 1IAWA 1IF1A 1DU6A 2GXBA 2VQCA 1R6RA 2HS5A 3S3OA 4EV0A 2I10A 3GWZA 2QM3A 3VOEA 2W24A 2BGCA 3JREA 2F5CA 1W5TA 1MSEC 2XHKA 3DF8A 4M72A 4MTDA 3WHCA 2FF4A 2UXNA 2HTJA 1E3PA 1N25A 3F6VA 4IQJA 1DP3A 2OCCH 2CUFA 1E0EA 3PNYA 4N0BA 3OYFA 1MJAA 5FO5A 2O6GE 1IXSB 3E5XA 3C2GA 1AWCA 4P9UA 1MNEA 2HR3A 3O8HA 2KFDA 3REOA 5DCMB 2RC4A 4D7NA 3KLNA 5AONA 1YTYA 1XSVA 4BE0A 2OU2A 4XIDA 2JZYA 2LSOA 1LVAA 4RMNA 2DFIA 2H6BA 3HYIA 3G73A 1FWZA 3OV8A 1E3OC 2E35A 2F6CA 2A07F 5LEJA 3F8MA 3JSPA 2AS5F 2R4GA 4QPQA 1ZTRA 3K9TA 3LSKA 4KITB 5A2QZ 2VOOA 1OCRH 3HOXJ 3S16J 2AQEA 3H5NA 5HDGA 2GQQA 4JP0A 3T1BA 4UHTA 4ZZLA 3LA2A 3O2PE 3SFIA 3ERED 3IKVA 4AWXB 4B44A 2GAUA 1ETVA 4A3EJ 5ICEA 4NHJA 2OUMA 4ZC3A 3J80Z 2AO9A 1VNDA 2V7FA 2DYSH 1VQMI 2CSOA 2CV1A 4JX5A 1TZLA 1XPXA 5IOYA 2QQ8A 1DPUA 2GA2A 4DBQA 4CCMA 1R36A 5H6RA 4EVIA 4R8HA 4LFUA 2EK5A 1ETOA 3CUQA 3ABUA 3K4BA 1TT0A 4FETA 3SQNA 3PO3J 4WX9A 2DODA 3WHBA 1W5CC 1ETYA 3DTKA 3H0GJ 1Y8QB 2KRCA 1VQ4I 3P9CA 4XBFA 1IGNA 1JUSA 1V5EA 3RKYA 2EIKH 2WV1A 4OMZA 4CCJA 1X3WB 2VKVA 2ZB9A 3F6OA 2P8TA 3U1KA 1WGXA 4ZYHA 5LHIA 3H9JA 2WBMA 3GX4X 1W5SA 2V79A 2UWMA 4Y4RA 3ZQHA 1D8JA 3NWSA 3KPHA 5GPCA 2PI0A 3L00A 3QYEA 2VODA 3ROUA 5J3LA 4LIUA 2GZWA 3V8KA 3P9KA 4PGHA 5ICGA 2ZJQF 2E1MC 5J47A 4DBRA 2XRLA 3HGGA 2V26A 3A0HC 2VN2A 1P92A 3HRMA 4LLLA 1VQ5I 3IRRA 4Q47A 3C2BA 4BBSJ 2HEOA 1FEXA 2MC3A 4GRIA 4CO8A 3DBHB 2QSHX 4QPOA 3HG9A 2EFPA 3SXYA 2W84A 2IA1A 1B59A 2MYSA 3ZMVA 3BJ6A 4Y15A 1DDNA 2BW3A 4KIGA 1U5TC 4LD5A 2EH3A 3E7LA 3TOBA 2HYGD 4Q5SF 3I9V2 3CCQI 2D1HA 2JN6A 4YFXF 5K7FA 3IRQA 3DEEA 1TW3A 1ETKA 2M1BA 1O7LA 3DBRB 3LSGA 4OWRB 4BU2A 5TISC 1LE8A 1CF7A 4PUSA 1V3FA 3S8PA 3U2RA 1D5YA 2XGEA 1R5HA 1CF7B 9ANTA 5K7HA 3BR0A 1JT6A 1ERDA 2R7RA 1O3RA 5FFZA 2ZJPF 3GUDA 2PG4A 2A68F 5F27A 3M8EA 4V2FA 2YUSA 3Q9VA 5E3LA 3OYJA 1JHFA 5BPIA 1XX5A 4B3AA 2R7XA 3ZQ7A 2ZMEA 3K10A 3ZN0A 4L9VA 1FNNA 2DQLA 4IJAA 3MFKA 1HF0A 1Z91A 3PFYA 1XMXA 2DTRA 3ZP5A 3SDGA 3CF2A 3U1DA 5HDNA 3DPTA 5FGMA 1FP1D 2HZDA 4DGWB 4XRSA 5IYBJ 3RKQA 1RKWA 3GMEA 3MKWB 3ZQGA 2Y2ZA 5FRNA 2DCEA 2RREA 2UV1A 4XOTA 4LGWA 4AC0A 2XB5A 5AIQA 2PMZA 5H6QA 4E7IA 2XAQA 2E71A 4BHPA 4NC7A 5L3EA 2F4MB 1K79A 2XAFA 3CJNA 5F08A 2W4SA 2TDXA 4R1HA 2STTA 4RAYA 4AM3A 1FYMA 4MNUA 3SFZA 3ZQCA 1ZQ3P 4A0ZA 4HG2A 3W6VA 2ZXHA 1T0FA 3JSOA 2E7XA 4EATA 3OS2A 3JRGA 1OKRA 1YHQI 3W6JB 2H27A 3RKWA 4A5NA 3KCCA 4E6KG 3ZOBA 3I56I 2AXTC 1IXCA 4GDFA 2K9SA 5EG0B 1EH8A 2L9VA 4H0EA 5F0FA 2DI3A 4M6XA 4LLNA 3J7YJ 4X1EA 3QYBA 3BR2A 2EIMH 1S6LA 3L2QA 4FE4A 4B47A 3GF2A 2ETHA 2NXNB 1DP7P 1XG1A 1B6AA 1MNMC 2OZUA 2LDUA 3LAJA 5HS7A 1QA6A 2KLOA 1RKTA 4CCLA 4BE1A 2Z2SB 1O3SA 1H8AC 3CCUI 1ZAOA 2DU9A 3IHUA 2F5DA 3OYLA 1NG6A 1USTA 1FJLA 3TO6A 2HNHA 1J59A 1S8NA 5ILSA 5FKMA 4F3QA 4KIBA 1I3QJ 1FOWA 4MO7A 1WJDA 2KPMA 2WAEA 3CCSI 2LY2A 3CJRB 1YRNB 2BY0A 1TWGJ 4BEHB 1JGSA 3K70D 1I1GA 4AVZA 1ACIA 3T0YA 1HW5A 2CW0F 1SD4A 2CUJA 2QQ9A 2ZKZA 5CQGA 3K4JA 4ENMA 3PFIA 4XN3A 4E7ZA 1FYKA 3I5UA 1FTZA 3HXLA 4HV6A 2V1NA 2V4JC 3BG9A 3E3VA 5HOOA 4XLPF 3BCAA 3WTUC 3CMEI 1O3TA 5GAEJ 2NYXA 3KP7A 3L9FA 1KU3A 3FMRA 3IAM2 3WE3A 3HKZA 3OR2C 3LWFA 4GXOA 4V19K 2E36A 2KKOA 3MQ0A 2L2OA 4TV7A 2XPVA 3TW6A 2EWNA 1WJFA 5D4RA 3HOSA 1XMKA 2V6CA 1R58A 1JJ6C 3IH3A 3SZTA 3M9AA 2MLGA 3HHHA 1SFOJ 4GGGA 1SD7A 3I59A 2KJCA 2XAJA 1BIAA 5D8LB 1P2FA 1IRFA 1IZ1A 4A12A 4U0YA 2KZGA 3H1CA 5JHUA 1MMAA 3BPXA 4YEJA 2Q2EB 1DGWY 3K4LA 2MH9A 4HBLA 2HOAA 5K5RA 3AKZA 2E19A 4XK4A 2L5QA 3K1NA 3S93A 2NS7A 5DM7F 2KRFA 1BR4A 3CJTB 1BL0A 3M1EA 3HRSA 4P96A 3TDUC 3KZIC 1Z1DA 4E7LA 2IAIA 4A93J 4BJTA 2H6CA 2MD5A 2O9LA 1LPQA 4E7JA 2X4HA 2G9WA 5JHFA 4UVBA 3KX2A 2BXYA 3GTPJ 4NDLA 3K1PA 1JKRC 2O03A 2HPIA 4M74A 2ZJRF 2R7WA 2EQRA 4PDKA 3K70C 1VI0A 3ISPA 1VF9A 3HSRA 1YE9A 4R79A 4CH7A 2XIGA 2E5NA 1SAUA 3OSGA 1QBJA 2ZO4A 3OYIA 2P5VA 2IEKA 4H4KC 2HDWA 2GWRA 2ID6A 4BBRJ 5E17F 5BS6A 2GBYA 4BQAA 4E70A 1YIOA 1LFBA 1TP4A 4A3GJ 3S1RJ 3PSIA 3TP0A 1TLHB 2FQ3A 4DZPA 1JGGA 3DKWA 4EM0B 4KDPA 2QZ8A 3GTGJ 2DW4A 3VFZA 1X4OA 3NRVA 2R3SA 4HQMA 4D5CA 3GLXA 5TRDA 2M3AA 2X6WA 1MIJA 3K2AA 4PFPA 5HLTA 4AVPA 2EJRA 1JUPA 4B3XA 5M5WJ 1EV7A 5BQTA 3WGIA 1UZCA 4AIKA 2PN6A 3H92A 3WG9A 1FSEA 2JUCA 4PZJA 4EJTA 1RESA 1I27A 2LTPA 2A5WA 1H9TA 4NBQA 4UV8A 1ZLJA 4XICA 4RBOA 4HAMA 3TMOA 4DIQA 1BOBA 2LF8A 2OCEA 1R71A 4QSHA 1O7FA 3DV8A 2QLZA 2JVHA 1TWHJ 1RC9A 3ZQLA 2DA4A 4KJZA 5HLGA 2Z99A 3CMYA 2HGCA 5HS9A 4A6EA 1W4MA 4HLYA 3ONQA 4M6YA 5D6FA 5E1WA 3J81Z 2NOJB 1YJ9I 3Q0UA 1NG7A 2VKDA 3SZPA 4RB1A 5DUKA 1VQNI 4A3IJ 2IW5A 3WTWC 2QVOA 4XLEA 1LVKA 3ECOA 3OIPA 5EF6A 3LMMA 3BR5A 3I53A 1RIOH 1P7IA 2M30A 5FKLA 2NVTJ 2KL4A 1UB9A 1A6QA 3JRBA 3S17J 2L4AA 5J4VA 4B43A 1MNDA 3MEXA 4HNUA 3OYHA 5CVIA 3FK7A 4XKWA 2FMYA 2M0MA 5KHDA 2VOPA 2RGVA 4HSRA 2FSWA 3KP4A 2KT0A 2HDCA 1QHHD 1KQ9A 5J4YA 2QSFX 4PJ0C 5EZGA 2VBXA 3WODF 2COMA 2HPMA 2VQHA 1ZLKA 4IRHA 2JUGA 2OJED 4OIRF 3AG4H 2NVYJ 4XMYA 2ACJA 2ELJA 4U0WA 4LG0A 2MD0A 4RB2C 4YIRX 3V7CA 1PUFA 1DU0A 1X1PA 1VQ7I 3PUFA 2LD5A 3RDIA 4IXAA 1XGSA 5D5WB 3GBGA 2DMNA 3DQVC 4FQGA 2PMZN 3ZN1A 3IV5A 4N4NB 4GFBA 1FY7A 3AG3H 5FLXZ 2ZXJA 1FYLA 1D0XA 3N05A 1UHWA 1YITI 3E97A 2XUBA 4HF0A 4BGDA
chains in the Genus database with same CATH topology
3DCFA 3QPLA 4XIDA 2ID3A 4I76A 4A3KJ 5FKNA 3TW7A 1TWFJ 1E3OC 2QF7A 3IH4A 4EEFG 1AHDP 1H89C 4BXXJ 1H88C 3GTLJ 1FIPA 1ZTRA 1AU7A 3BR1A 3HOXJ 3S15J 1JT0A 3S16J 4JP0A 4C2MJ 4RDUA 3BTJA 1RPWA 3SFIA 3RQIA 1MBJA 2ECBA 2DMTA 3Q0WA 2XPWA 1ZR2A 2P81A 1F36A 2L0KA 1ETVA 2OPTA 4A3EJ 4A3JJ 1ETXA 4XRMA 3VPRA 3DEWA 2AO9A 4JYKA 2KDZA 4FCYA 1VNDA 2M0CA 5E3OA 1WH7A 5C4JJ 4JX5A 4JX4A 5IOYA 4AUXA 1UMQA 1IUFA 1S7EA 2FX0A 1JTXA 4S0HB 4MFDA 1ETOA 2M34A 3BQYA 2DMQA 3BTLA 1K83J 1NK3P 3PO3J 3WHBA 2N8GA 1ETYA 2HOSA 3H0GJ 1FTTA 1JKQC 1RETA 2EZHA 2COBA 1IGNA 1JUSA 3S2DJ 3HB9A 3HM5A 5GPAA 2WV1A 2VKVA 2X48A 2ZB9A 1OJLA 1WCMJ 4A3BJ 1WGXA 2R93J 1TWCJ 3LOCA 3BTIA 2HXIA 2O7OA 5IOZA 4Y7NJ 3JRIA 5M3FJ 3ZQHA 5GPCA 5F0HA 1O4XA 4JX6A 5FJ8J 5J3LA 1ORKA 3LNQA 1F43A 1AKHB 1B8IA 1HLVA 3HOUJ 4CYCB 1APLC 2XRLA 3A03A 3HGGA 1BW5A 1NTCA 1GV5A 4D7MA 3HKZN 3S14J 1NK2P 2XB0X 4A3FJ 2HDDA 4FE7A 3C2BA 4BBSJ 4IHXA 1FEXA 2JWTA 2TCTA 2HXOA 5C3EJ 1IJWC 1JKOC 1MBEA 5J1RA 3HOZJ 1QRYA 2R5ZA 3QQAA 1JTYA 2DTZA 5J1YA 1W0UA 2XPUA 2L7FP 1XS9A 2IBDA 2LY9A 2DMUA 2CRGA 2EH3A 3E7LA 3PO2J 2H1KA 3FK6A 2JN6A 5K7FA 3JRHA 3HOVJ 1ETKA 3LSGA 1JJ8C 1MH3A 5IYCJ 4MIMA 1LE8A 1QVUA 3IH2A 1D5YA 2Y9ZA 2XGEA 3RZOJ 5F0CA 5M5YJ 9ANTA 5K7HA 4AYBN 3BR0A 1JT6A 1T33A 2R5YB 3I4NJ 3HOWJ 5IP7J 5F27A 4V2FA 2Y0SN 2YUSA 5E3LA 2JJ7A 2ME0A 4B3AA 1QPIA 1B72B 5EEAA 2W48A 2L9RA 1VFCA 1HF0A 2YU9J 3GTQJ 3HOYJ 4XRSG 3BTCA 2ECCA 5F1JA 2K9QA 3SDGA 4I6ZA 4C3JJ 3A01B 4MFEA 2EZIA 2E1OA 1QVTA 4DYQA 4XRSA 2CUEA 5IYBJ 2VPRA 3RKQA 1RKWA 3JRFA 3ZQGA 2Y2ZA 3BT9A 2TRTA 1GUUA 5EYRA 4A3CJ 5DTDA 2CQQA 2K9NA 4AC0A 2XB5A 4B1RA 2JA7J 2LK2A 1TWAJ 3K7AJ 4A3MJ 3BG5A 4UUSB 5F08A 2LKXA 2E2HJ 1OCTC 3JRAA 2LVSA 3BG3A 3ZQCA 1ZQ3P 3W6VA 1IDZA 3SJMA 3OSFA 4IHYA 3JRGA 4DYCA 1GDTA 5GP9A 1OFCX 2NS8A 3ZOBA 3HDDA 5E3MA 2ELKA 2K9SA 5EG0B 5F0FA 1IV6A 2XGCA 2X9DA 4FISA 4X1EA 3S1NJ 2DA2A 3BR2A 2CJJA 4FE4A 1BW6A 1XG1A 5HODA 3S1MJ 2K40A 1MNMC 4Y52J 1R9TJ 1X58A 2JK3A 5FKOA 2VKEA 4IEJA 3LSPA 1RKTA 2Y31A 1XC5A 4M6VA 1H8AC 3MVPA 3RZDJ 2GLOA 3MKLA 1MBFA 5DS9A 1Y1VJ 1FJLA 3MN2A 2D5VA 4M3FA 3H3VK 2NOGA 2WB1N 4IHWA 5FKMA 1AKHA 3FKIJ 4CYCA 4ABZA 1I3QJ 2DA1A 1OCPA 2DN0A 1TC3C 4MO7A 2Y9YA 2MGQA 3O8GA 1YRNB 1TWGJ 3I4MJ 4C3HJ 4BY1J 1U9OA 1G2HA 1UHSA 3HEFA 1FTZA 3CDLA 3JR9A 3UKGA 4QTRA 5FLVA 3BG9A 2FJ1A 1CQTA 4MLOA 2MSYA 5IYDJ 2M9HA 2CU7A 3BR6A 2R5YA 2XPVA 3TW6A 4G12A 2YS9A 5EDNA 5IP9J 4W97A 1WH5A 1JJ6C 2JMWA 3IH3A 1Z77A 1B72A 5C4XJ 2LFBA 1WPKA 1SFOJ 2DMPA 2FQ4A 2FD5A 1A5JA 3A01A 3L1PA 3S2HJ 1ZKGA 2HOTA 4IHVA 3Q3SA 2HOAA 3GTKJ 1A6IA 2E19A 3HBLA 4XK4A 2LLKA 2WAQN 1PUFB 2DA3A 2XSDC 2NS7A 4X6AJ 3JRCA 1BL0A 2NVXJ 5IP6A 1ENHA 2IAIA 4A93J 3FIWA 2O9LA 4UUSA 2JA6J 3GTMJ 3NAUA 1W0TA 1HDPA 4NDLA 5K7ZA 3GTPJ 5M5XJ 1MBHA 1JKRC 3M3YJ 2DA5A 1RR7A 1IG7A 2CQXA 3PM1A 2EQRA 2E2JJ 2JA8J 1VI0A 2EZLA 4A69C 4DZJA 1VF9A 3G1MA 3LSJA 4DYRA 3Q0VA 2L7ZA 2NVQJ 3HGYA 4BY7J 2X6OA 1ETQA 3A02A 3OSGA 4DW6A 3B6CA 2IEKA 2LR8A 1ITYA 1HCRA 2G0EA 2ID6A 4BBRJ 1U9NA 2GBYA 5JLWA 5EG0A 4A3GJ 1LFBA 1MSFC 5J1UA 2OF7A 3D1NI 3S1RJ 3FISA 3TP0A 4DZPA 1Y1WJ 1FIAA 1JGGA 2R92J 3GTGJ 5M3MJ 2DJNA 4V2GA 4D5CA 3CQZJ 2LP0A 1MH4A 3G1OA 1UG2A 2AHQA 3K2AA 1JUPA 5M5WJ 1GV2A 1ZK8A 5EZHA 2GM4A 1IRZA 1ZR4A 1RESA 2LTPA 1P7JA 3QPSA 5JLXA 4XICA 4RBOA 3M4OJ 2O8KA 5F04A 1GVDA 1HDDC 1I6HJ 5BNGA 3B6AA 3S1QJ 2ME6A 1YRNA 1LFUP 1WI3A 4QSHA 1JKPC 5EGOA 1IDYA 1X2NA 3JRDA 1TWHJ 2DA6A 3ZQLA 5EGOB 2DA4A 3GTJJ 2B63J 1ETWA 5FKKA 1EF4A 3NARA 1GT0C 4D5FA 1JUMA 3CMYA 1BJZA 3LSRA 2HI3A 2Y30A 4FTHA 4A3DJ 1MBKA 2MW8A 3BQZA 2XGDA 1X2MA 3G1LA 3Q0UA 4M3GA 4UUTA 1HOMA 5C44J 1I50J 4A3IJ 4HNVA 2EBIA 4LOCA 3CCYA 1Q1VA 5EF6A 2DA7A 1B8IB 5FLMJ 3BR5A 1P7IA 5FKLA 2NVTJ 2M8GX 4B4CA 1IC8A 3JRBA 4M3EA 3S17J 1MBGA 3ZQIA 4J19A 2R0QC 2QCOA 2R7ZJ 2H8RA 2L7MP 3FK7A 2M2EA 4M3BA 3TP3A 2R5ZB 4C3IJ 3GTOJ 4L5EA 2E2IJ 2KT0A 3OIOA 1SANA 3TEDA 4A3LJ 5EZGA 2EZKA 1U8BA 1ZGWA 4BKXA 1DU6A 2MG4A 1T56A 3ZQFA 2RAEA 2I10A 1K61A 1U78A 2NVYJ 4QIWN 1LE8B 3OOUA 3JREA 1MSEC 1PUFA 1DU0A 3WHCA 2HYJA 2LD5A 3BR3A 3F0CA 1POGA 3GBGA 4W1UA 2JA5J 2DMNA 2PMZN 1BA5A 2CUFA 5E3NA 2VUMJ 3IV5A 4GFBA 2HQ5A 1Z0XA 2VI6A 4M3DA 5IPAA 3O8HA 4D7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCF A;  3QPL A;  4XID A;  2ID3 A;  4I76 A;  4A3K J;  5FKN A;  3TW7 A;  1TWF J;  1E3O C;  2QF7 A;  3IH4 A;  4EEF G;  1AHD P;  1H89 C;  4BXX J;  1H88 C;  3GTL J;  1FIP A;  1ZTR A;  1AU7 A;  3BR1 A;  3HOX J;  3S15 J;  1JT0 A;  3S16 J;  4JP0 A;  4C2M J;  4RDU A;  3BTJ A;  1RPW A;  3SFI A;  3RQI A;  1MBJ A;  2ECB A;  2DMT A;  3Q0W A;  2XPW A;  1ZR2 A;  2P81 A;  1F36 A;  2L0K A;  1ETV A;  2OPT A;  4A3E J;  4A3J J;  1ETX A;  4XRM A;  3VPR A;  3DEW A;  2AO9 A;  4JYK A;  2KDZ A;  4FCY A;  1VND A;  2M0C A;  5E3O A;  1WH7 A;  5C4J J;  4JX5 A;  4JX4 A;  5IOY A;  4AUX A;  1UMQ A;  1IUF A;  1S7E A;  2FX0 A;  1JTX A;  4S0H B;  4MFD A;  1ETO A;  2M34 A;  3BQY A;  2DMQ A;  3BTL A;  1K83 J;  1NK3 P;  3PO3 J;  3WHB A;  2N8G A;  1ETY A;  2HOS A;  3H0G J;  1FTT A;  1JKQ C;  1RET A;  2EZH A;  2COB A;  1IGN A;  1JUS A;  3S2D J;  3HB9 A;  3HM5 A;  5GPA A;  2WV1 A;  2VKV A;  2X48 A;  2ZB9 A;  1OJL A;  1WCM J;  4A3B J;  1WGX A;  2R93 J;  1TWC J;  3LOC A;  3BTI A;  2HXI A;  2O7O A;  5IOZ A;  4Y7N J;  3JRI A;  5M3F J;  3ZQH A;  5GPC A;  5F0H A;  1O4X A;  4JX6 A;  5FJ8 J;  5J3L A;  1ORK A;  3LNQ A;  1F43 A;  1AKH B;  1B8I A;  1HLV A;  3HOU J;  4CYC B;  1APL C;  2XRL A;  3A03 A;  3HGG A;  1BW5 A;  1NTC A;  1GV5 A;  4D7M A;  3HKZ N;  3S14 J;  1NK2 P;  2XB0 X;  4A3F J;  2HDD A;  4FE7 A;  3C2B A;  4BBS J;  4IHX A;  1FEX A;  2JWT A;  2TCT A;  2HXO A;  5C3E J;  1IJW C;  1JKO C;  1MBE A;  5J1R A;  3HOZ J;  1QRY A;  2R5Z A;  3QQA A;  1JTY A;  2DTZ A;  5J1Y A;  1W0U A;  2XPU A;  2L7F P;  1XS9 A;  2IBD A;  2LY9 A;  2DMU A;  2CRG A;  2EH3 A;  3E7L A;  3PO2 J;  2H1K A;  3FK6 A;  2JN6 A;  5K7F A;  3JRH A;  3HOV J;  1ETK A;  3LSG A;  1JJ8 C;  1MH3 A;  5IYC J;  4MIM A;  1LE8 A;  1QVU A;  3IH2 A;  1D5Y A;  2Y9Z A;  2XGE A;  3RZO J;  5F0C A;  5M5Y J;  9ANT A;  5K7H A;  4AYB N;  3BR0 A;  1JT6 A;  1T33 A;  2R5Y B;  3I4N J;  3HOW J;  5IP7 J;  5F27 A;  4V2F A;  2Y0S N;  2YUS A;  5E3L A;  2JJ7 A;  2ME0 A;  4B3A A;  1QPI A;  1B72 B;  5EEA A;  2W48 A;  2L9R A;  1VFC A;  1HF0 A;  2YU9 J;  3GTQ J;  3HOY J;  4XRS G;  3BTC A;  2ECC A;  5F1J A;  2K9Q A;  3SDG A;  4I6Z A;  4C3J J;  3A01 B;  4MFE A;  2EZI A;  2E1O A;  1QVT A;  4DYQ A;  4XRS A;  2CUE A;  5IYB J;  2VPR A;  3RKQ A;  1RKW A;  3JRF A;  3ZQG A;  2Y2Z A;  3BT9 A;  2TRT A;  1GUU A;  5EYR A;  4A3C J;  5DTD A;  2CQQ A;  2K9N A;  4AC0 A;  2XB5 A;  4B1R A;  2JA7 J;  2LK2 A;  1TWA J;  3K7A J;  4A3M J;  3BG5 A;  4UUS B;  5F08 A;  2LKX A;  2E2H J;  1OCT C;  3JRA A;  2LVS A;  3BG3 A;  3ZQC A;  1ZQ3 P;  3W6V A;  1IDZ A;  3SJM A;  3OSF A;  4IHY A;  3JRG A;  4DYC A;  1GDT A;  5GP9 A;  1OFC X;  2NS8 A;  3ZOB A;  3HDD A;  5E3M A;  2ELK A;  2K9S A;  5EG0 B;  5F0F A;  1IV6 A;  2XGC A;  2X9D A;  4FIS A;  4X1E A;  3S1N J;  2DA2 A;  3BR2 A;  2CJJ A;  4FE4 A;  1BW6 A;  1XG1 A;  5HOD A;  3S1M J;  2K40 A;  1MNM C;  4Y52 J;  1R9T J;  1X58 A;  2JK3 A;  5FKO A;  2VKE A;  4IEJ A;  3LSP A;  1RKT A;  2Y31 A;  1XC5 A;  4M6V A;  1H8A C;  3MVP A;  3RZD J;  2GLO A;  3MKL A;  1MBF A;  5DS9 A;  1Y1V J;  1FJL A;  3MN2 A;  2D5V A;  4M3F A;  3H3V K;  2NOG A;  2WB1 N;  4IHW A;  5FKM A;  1AKH A;  3FKI J;  4CYC A;  4ABZ A;  1I3Q J;  2DA1 A;  1OCP A;  2DN0 A;  1TC3 C;  4MO7 A;  2Y9Y A;  2MGQ A;  3O8G A;  1YRN B;  1TWG J;  3I4M J;  4C3H J;  4BY1 J;  1U9O A;  1G2H A;  1UHS A;  3HEF A;  1FTZ A;  3CDL A;  3JR9 A;  3UKG A;  4QTR A;  5FLV A;  3BG9 A;  2FJ1 A;  1CQT A;  4MLO A;  2MSY A;  5IYD J;  2M9H A;  2CU7 A;  3BR6 A;  2R5Y A;  2XPV A;  3TW6 A;  4G12 A;  2YS9 A;  5EDN A;  5IP9 J;  4W97 A;  1WH5 A;  1JJ6 C;  2JMW A;  3IH3 A;  1Z77 A;  1B72 A;  5C4X J;  2LFB A;  1WPK A;  1SFO J;  2DMP A;  2FQ4 A;  2FD5 A;  1A5J A;  3A01 A;  3L1P A;  3S2H J;  1ZKG A;  2HOT A;  4IHV A;  3Q3S A;  2HOA A;  3GTK J;  1A6I A;  2E19 A;  3HBL A;  4XK4 A;  2LLK A;  2WAQ N;  1PUF B;  2DA3 A;  2XSD C;  2NS7 A;  4X6A J;  3JRC A;  1BL0 A;  2NVX J;  5IP6 A;  1ENH A;  2IAI A;  4A93 J;  3FIW A;  2O9L A;  4UUS A;  2JA6 J;  3GTM J;  3NAU A;  1W0T A;  1HDP A;  4NDL A;  5K7Z A;  3GTP J;  5M5X J;  1MBH A;  1JKR C;  3M3Y J;  2DA5 A;  1RR7 A;  1IG7 A;  2CQX A;  3PM1 A;  2EQR A;  2E2J J;  2JA8 J;  1VI0 A;  2EZL A;  4A69 C;  4DZJ A;  1VF9 A;  3G1M A;  3LSJ A;  4DYR A;  3Q0V A;  2L7Z A;  2NVQ J;  3HGY A;  4BY7 J;  2X6O A;  1ETQ A;  3A02 A;  3OSG A;  4DW6 A;  3B6C A;  2IEK A;  2LR8 A;  1ITY A;  1HCR A;  2G0E A;  2ID6 A;  4BBR J;  1U9N A;  2GBY A;  5JLW A;  5EG0 A;  4A3G J;  1LFB A;  1MSF C;  5J1U A;  2OF7 A;  3D1N I;  3S1R J;  3FIS A;  3TP0 A;  4DZP A;  1Y1W J;  1FIA A;  1JGG A;  2R92 J;  3GTG J;  5M3M J;  2DJN A;  4V2G A;  4D5C A;  3CQZ J;  2LP0 A;  1MH4 A;  3G1O A;  1UG2 A;  2AHQ A;  3K2A A;  1JUP A;  5M5W J;  1GV2 A;  1ZK8 A;  5EZH A;  2GM4 A;  1IRZ A;  1ZR4 A;  1RES A;  2LTP A;  1P7J A;  3QPS A;  5JLX A;  4XIC A;  4RBO A;  3M4O J;  2O8K A;  5F04 A;  1GVD A;  1HDD C;  1I6H J;  5BNG A;  3B6A A;  3S1Q J;  2ME6 A;  1YRN A;  1LFU P;  1WI3 A;  4QSH A;  1JKP C;  5EGO A;  1IDY A;  1X2N A;  3JRD A;  1TWH J;  2DA6 A;  3ZQL A;  5EGO B;  2DA4 A;  3GTJ J;  2B63 J;  1ETW A;  5FKK A;  1EF4 A;  3NAR A;  1GT0 C;  4D5F A;  1JUM A;  3CMY A;  1BJZ A;  3LSR A;  2HI3 A;  2Y30 A;  4FTH A;  4A3D J;  1MBK A;  2MW8 A;  3BQZ A;  2XGD A;  1X2M A;  3G1L A;  3Q0U A;  4M3G A;  4UUT A;  1HOM A;  5C44 J;  1I50 J;  4A3I J;  4HNV A;  2EBI A;  4LOC A;  3CCY A;  1Q1V A;  5EF6 A;  2DA7 A;  1B8I B;  5FLM J;  3BR5 A;  1P7I A;  5FKL A;  2NVT J;  2M8G X;  4B4C A;  1IC8 A;  3JRB A;  4M3E A;  3S17 J;  1MBG A;  3ZQI A;  4J19 A;  2R0Q C;  2QCO A;  2R7Z J;  2H8R A;  2L7M P;  3FK7 A;  2M2E A;  4M3B A;  3TP3 A;  2R5Z B;  4C3I J;  3GTO J;  4L5E A;  2E2I J;  2KT0 A;  3OIO A;  1SAN A;  3TED A;  4A3L J;  5EZG A;  2EZK A;  1U8B A;  1ZGW A;  4BKX A;  1DU6 A;  2MG4 A;  1T56 A;  3ZQF A;  2RAE A;  2I10 A;  1K61 A;  1U78 A;  2NVY J;  4QIW N;  1LE8 B;  3OOU A;  3JRE A;  1MSE C;  1PUF A;  1DU0 A;  3WHC A;  2HYJ A;  2LD5 A;  3BR3 A;  3F0C A;  1POG A;  3GBG A;  4W1U A;  2JA5 J;  2DMN A;  2PMZ N;  1BA5 A;  2CUF A;  5E3N A;  2VUM J;  3IV5 A;  4GFB A;  2HQ5 A;  1Z0X A;  2VI6 A;  4M3D A;  5IPA A;  3O8H A;  4D7N A; 
#chains in the Genus database with same CATH topology
 4HF1 A;  5H20 A;  1K6Y A;  5CJ9 A;  3DCF A;  1QQI A;  1YFH A;  2A3S A;  2CFX A;  4XSZ F;  1K78 B;  3ULQ B;  3OYA A;  3U9G A;  3CC2 I;  1RR8 C;  2QF7 A;  4OMY A;  2OTL I;  1AHD P;  4WXH A;  4BXX J;  3RCO A;  1BM9 A;  2V6E A;  3V42 A;  1SVO A;  3E6B A;  1G3T A;  1WI9 A;  3K2Z A;  3Q9S A;  1JT0 A;  4JBA A;  1MDM A;  4C2M J;  1IW7 F;  5D8K B;  1RPW A;  2K9M A;  1LFP A;  3CP8 A;  2LG4 A;  5BPD A;  2DMT A;  2XPW A;  5GAH J;  3FMS A;  3ZMS A;  4G7O F;  5F6F A;  3VPR A;  3DEW A;  2DFH A;  3I3L A;  4NQW A;  4RGU A;  2EFQ A;  4Q4Z F;  1RUO A;  1V55 H;  3H35 A;  2CV2 A;  4M9X A;  2R7V A;  4HEA 2;  5JFR A;  2HTS A;  1UMQ A;  1S7E A;  2EA4 A;  4F7Z A;  1UEL B;  5E1X A;  3VWB A;  2QKL B;  2W57 A;  2FML A;  3F22 A;  3B73 A;  2M34 A;  3BQY A;  1V5F A;  2DMQ A;  4Y33 A;  3GZ6 A;  4JQF A;  2Z33 A;  3VB2 A;  1K83 J;  3ZRG A;  1NK3 P;  2ESN A;  2ZC2 A;  1RI7 A;  1J9I A;  3WGH A;  4XOP A;  3Q5F A;  2VE8 A;  2BXZ A;  2HOS A;  2AQF A;  5AIP A;  1T2K A;  3CCM I;  1RET A;  4RAF A;  2COB A;  4HX7 A;  5KNL A;  5E8I A;  1SFE A;  5GPA A;  1B9N A;  2X48 A;  1I1S A;  2VBZ A;  3KEQ A;  1WCM J;  1OLT A;  2PX9 A;  3DKX A;  4ZH4 F;  2DOF A;  2JSP A;  1R4N B;  3ESW B;  4IF4 A;  4A3B J;  1BN5 A;  2CQN A;  3FZV A;  1WZ2 A;  2O7O A;  5IOZ A;  3B02 A;  1R5G A;  4IOC F;  4XR6 A;  5F0H A;  2PJR A;  1EKE A;  2GA1 A;  2P6T A;  2Y75 A;  2DO7 A;  3QPH A;  1ORK A;  1UAA A;  2HYF A;  1B8I A;  2R7O A;  2VXD A;  1F1Z A;  3WU1 B;  3PQK A;  1YI2 I;  3PQJ A;  3HKZ N;  4XSX F;  1D3Y A;  2BHY A;  1OIS A;  4ZTF A;  1NK2 P;  3QRF F;  3HTU A;  4NUB A;  2P7C B;  3CLO A;  3VYT B;  5DCF A;  3JW4 A;  1ZGJ A;  2JWT A;  2HXO A;  3W2A A;  2CG4 A;  2WTE A;  5J1R A;  3W2W A;  3QQA A;  4FHT A;  4IOA F;  1MJB A;  3GFI A;  1XN7 A;  2XPU A;  5CVV A;  1XS9 A;  1G3W A;  1ZRF A;  2LY9 A;  2CRG A;  2H1K A;  3FK6 A;  1QGP A;  4FX0 A;  3FXM A;  3S3M A;  3LL7 A;  2PEX A;  4FAS D;  2IJL A;  1JJ8 C;  4MIM A;  1QVU A;  3IH2 A;  3WTT C;  3KE2 A;  1K6O A;  2XF6 A;  3LSI A;  4YEL A;  1V54 H;  3OY9 A;  4AYB N;  1XSX A;  1ZGA A;  3I4N J;  2GXA A;  3HOT A;  4IHT A;  5IP7 J;  3C3W A;  1Y6I A;  2W85 A;  2FOK A;  2ME0 A;  2DFF A;  1LEB A;  2KP6 A;  1B72 B;  1LEA A;  5EEA A;  4RA2 A;  3HOY J;  2Y0M A;  1OCO H;  5DCM A;  3BLY A;  2ECC A;  4QLC U;  3KET A;  3OYB A;  1YOV B;  2E1O A;  3C7J A;  2CUE A;  2VPR A;  3JRF A;  3GO5 A;  3KP6 A;  3A2K A;  1YJN I;  2IXS A;  4XLA A;  4CCN A;  1FMW A;  4A3C J;  4AD9 A;  1PUE E;  2A05 A;  4S04 A;  3C1D A;  2IRF G;  2ZXI A;  2BZT A;  1U0J A;  2JA7 J;  1YS7 A;  1UJ8 A;  2XKO A;  5BMZ A;  1TWA J;  4BQQ A;  1OR7 C;  4OU0 A;  4BAC A;  3BG5 A;  1F5T A;  1FMV A;  2E60 A;  3AAF A;  1ZRD A;  2DDA A;  1G6N A;  1LDD A;  3W3C A;  2JPB A;  5E20 A;  4GCV A;  2EFO A;  3HIF A;  4PFO A;  2H94 A;  3OSF A;  4IHY A;  1SD6 A;  4EMS A;  3G2B A;  1N75 A;  2DT6 A;  5GP9 A;  4ANJ A;  3KYD B;  2M7B A;  4C30 A;  3OYK A;  4U7B A;  3KFW X;  5JI6 A;  5GTI C;  2ZJ2 A;  1Z05 A;  3NQO A;  3FM3 A;  2K85 A;  1Z3X A;  5IT9 K;  3S3N A;  1QHG A;  1IV6 A;  4BDZ A;  3V8J A;  2XGC A;  2XAG A;  4FIS A;  3BC8 A;  4BUP A;  2DA2 A;  4L9N A;  3PIP F;  3GEZ A;  3GVA A;  1HKS A;  1OQY A;  4NC8 A;  3WTZ A;  3GZ5 A;  1BW6 A;  1SFK A;  1LDJ A;  2MC4 A;  4A0Y A;  4E7H A;  4JOM A;  2VT3 A;  4Y52 J;  1GXP A;  1LQ1 A;  4HX8 A;  1SVL A;  4LG3 A;  1ODD A;  3ZMZ A;  2VAS A;  4HX4 A;  2WWY A;  3OYD A;  1R1U A;  4M6V A;  1XCB A;  4G9Y A;  1DPR A;  3CCJ I;  4O5V A;  5J8C A;  1MMD A;  2DT5 A;  3MKL A;  3QU3 A;  5DS9 A;  2L02 A;  2CV0 A;  5LGT A;  3MN2 A;  4BS9 A;  4M3F A;  4LMY A;  1TQP A;  2NOG A;  3FKI J;  1Y0U A;  2EFW A;  3HHG A;  3HSE A;  2VJJ A;  3KP5 A;  3DBL B;  1LB2 A;  2Y9Y A;  1S72 I;  2MGQ A;  3O8G A;  1K4S A;  2W1O A;  3T8T A;  3DKY A;  2M5W A;  3I4M J;  3GW2 A;  3RYP A;  3RI4 A;  3T8R A;  3I55 I;  2OTJ I;  5ICF A;  4PCQ A;  3FF5 A;  3VSL A;  3QU6 A;  1BI1 A;  1RUN A;  2Q1Z B;  1R4M B;  3HEF A;  1IN4 A;  3KP2 A;  1M1E B;  1IN8 A;  3JR9 A;  4J00 A;  4QTR A;  4XQF A;  3DFG A;  3I0T A;  5FD6 A;  1FOY A;  2VBW A;  2XSJ C;  3EYI A;  1CQT A;  1T6S A;  4AU7 A;  2M9H A;  3ZGK A;  3EYY A;  2BEO A;  2WA0 A;  3VYR B;  3ZMD A;  3K4C A;  1A35 A;  1VQK I;  2A6E F;  3HUG B;  3PJR A;  1Z6T A;  4KIC A;  4OAY A;  2HQA A;  3MD2 A;  3MZY A;  1DQU A;  4F91 B;  5IP9 J;  1F4K A;  3TQN A;  1T38 A;  2E7W A;  3ERM A;  4NC6 A;  1ZG3 A;  3L7W A;  2YU3 A;  2LFB A;  1WPK A;  5C4X J;  1UCR A;  2DMP A;  2FD5 A;  1Z7U A;  2FQ4 A;  3VYS B;  2DT7 B;  3FMQ A;  3BJA A;  3H3U A;  2BY1 A;  2VQL A;  2QSG X;  1HST A;  2HOT A;  3KZY A;  4WXC A;  4CZZ A;  2FOW A;  4DQ2 A;  4CUG A;  3M07 A;  4ZYE A;  3FWE A;  3GTK J;  2QWW A;  1CGP A;  3H0D A;  2X6X A;  2LLK A;  1PJR A;  2L3D A;  2OBP A;  2DA3 A;  2LBF B;  2XSD C;  1MMN A;  5IP6 A;  1XDS A;  1ENH A;  1W7P D;  4RAG A;  3P9I A;  2EB7 A;  1XB4 A;  4ESF A;  3G6E I;  4CHU A;  1VZ0 A;  3JCU C;  2ISZ A;  2Y69 H;  1L3L A;  3NAU A;  1JHH A;  3HSF A;  5K7Z A;  5KCM A;  4P9F A;  3ZMU A;  2VON A;  3J7A O;  1C0W A;  1WKM A;  2CQX A;  2E2J J;  4A5M A;  1HW1 A;  2ZFU A;  5IT3 A;  4A69 C;  3IKT A;  2P0W A;  1ZHF A;  4BQO A;  4DYR A;  4BXU A;  1YX5 A;  1KU9 A;  4L9T A;  2H1L A;  1ZYR F;  1HKT A;  3OMY A;  3DPL C;  2BE5 F;  2X6O A;  4BY7 J;  3FDY A;  4Y13 A;  1I6X A;  4MEY F;  4CCK A;  2DBB A;  2KMU A;  5CVR A;  1U9N A;  5IY5 H;  5EG0 A;  1MSF C;  4UUV A;  3SHF A;  3FIS A;  2BHZ A;  5ILU A;  1FIA A;  3GFM A;  4P1W A;  5M3M J;  2DJN A;  3G71 I;  4MQV A;  2CH0 A;  2F2E A;  2HFH A;  3I4P A;  1JXS A;  3RTR A;  2RNG A;  4I02 A;  2IPQ X;  3GLL A;  2HVR A;  4ZTJ A;  1Y8R B;  2P4W A;  4UNO A;  1KU7 A;  1IRZ A;  5CPR B;  5ILV A;  4F52 A;  2W25 A;  2K4B A;  1W1W E;  3H5A A;  2B9S A;  3WTX C;  2XAS A;  4XON A;  4II2 A;  4N4O B;  2BOL A;  2D45 A;  4GYI A;  2ZFW A;  5DD8 A;  4IZZ A;  5F04 A;  1GVD A;  1HDD C;  2QKM B;  3O6B B;  4KYW A;  1TW2 A;  3W6K B;  4D9J A;  2ME6 A;  4E7S A;  1YRN A;  4BEH A;  2PFB A;  4F93 B;  3K0L A;  1JKP C;  4CA0 A;  1QO0 D;  1IDY A;  1P4X A;  3JRD A;  2MAB A;  3TO7 A;  5CLS A;  3GTJ J;  4YFN F;  2HU9 A;  2K5C A;  2FU4 A;  3NAR A;  4D5F A;  1S9H A;  1R23 A;  2Q8K A;  4ZYD A;  4EJV A;  4FTH A;  3QAH A;  4FX4 A;  1MBK A;  3DEU A;  3BQZ A;  1N77 A;  1X4P A;  1X2M A;  3G1L A;  2FE3 A;  1I50 J;  3MZ8 A;  5E1Z B;  4HNV A;  1BJA A;  1Z6R A;  2OZ6 A;  1T39 A;  2DA7 A;  2BVM A;  2M7A A;  2ZNZ A;  2KIU A;  2CYY A;  2R7Q A;  1YX3 A;  5FLM J;  4F55 A;  3HJE A;  3JAM K;  3CP2 A;  2H09 A;  4LB5 A;  2FBI A;  4M3E A;  3OYG A;  1S3J A;  1UG0 A;  3D5R C;  4EJW A;  2OA4 A;  4LK1 F;  1TBX A;  2R7Z J;  2CWE A;  3CDH A;  2L7M P;  2M2E A;  1T98 A;  3H9G A;  2R5Z B;  1ZG5 A;  4YIF A;  4C3I J;  3TDZ C;  4L5E A;  1TNS A;  3D5L A;  2E2I J;  4AIJ A;  1FX7 A;  1BBY A;  1FT9 A;  2EIL H;  2EZK A;  2QQB A;  5DDG A;  2MG4 A;  5CVU A;  1D1A A;  1I5Z A;  1SVM A;  2XKP A;  3ZQF A;  4DOZ A;  2RAE A;  4UV9 A;  1K61 A;  2Q2E A;  1UHM A;  2VC0 A;  4OIN F;  1E3H A;  2XC7 A;  5CKT A;  4A2U A;  4AYB A;  3BR3 A;  4W1U A;  2JA5 J;  1Y39 A;  2OC6 A;  3K1M A;  5E3N A;  2DAO A;  3SDB A;  2VUM J;  2HQ5 A;  5EJC A;  1TQI A;  2RQQ A;  1Q1H A;  4G7Z F;  1SD5 A;  1Z0X A;  2I5U A;  2VI6 A;  1DGR M;  1BR1 A;  1OCC H;  3C2H A;  5IPA A;  2R7D A;  1FLI A;  2KIM A;  2PJP A;  3U21 A;  4ENK A;  4E4H A;  2E34 A;  3DPU A;  6PAX A;  4I76 A;  2YSR A;  3X2Q H;  2WAQ A;  5FKN A;  1OCZ H;  1WJE A;  1TWF J;  4XKB A;  3KYL A;  3RPU A;  4CSW A;  3IH4 A;  4EEF G;  5ERI A;  1TNT A;  4Y17 A;  1H89 C;  2GIV A;  3E1S A;  3VOD A;  3GTL J;  4OOI A;  1FIP A;  3BZ6 A;  5B66 C;  1AU7 A;  4YFK F;  3QOD A;  1BC8 C;  1VQO I;  2W82 A;  3DWL E;  4I99 C;  1HW2 A;  4UB6 C;  2FNA A;  4MHG A;  3RSN A;  3EUK L;  2BV6 A;  3K4K A;  4I7H A;  3RQI A;  1MBJ A;  2ECB A;  3Q0W A;  1ZR2 A;  2P81 A;  2L0K A;  2OPT A;  4A3J J;  1XD7 A;  2JSC A;  1ETX A;  1WWX A;  1EH7 A;  1USS A;  3IL2 A;  2KDZ A;  4FCY A;  2M0C A;  5D5V B;  2ELH A;  4C2T A;  1IN7 A;  1Y0N A;  1WJA A;  2B7E A;  4WXD A;  1WHU A;  2CUZ A;  2EFN A;  4AUX A;  4HOB A;  1IUF A;  4ZYA A;  1MKM A;  2F5E A;  4PJJ A;  4BYY A;  1JTX A;  4S0H B;  1YS6 A;  4MFD A;  3VSK A;  3OYM A;  1FSH A;  3BTL A;  3KEO A;  4I0A A;  2K02 A;  3CUQ C;  2O0Y A;  2CW7 A;  1HXD A;  3M7G A;  1ULY A;  3FXO A;  1FTT A;  1JKQ C;  2EZH A;  4IQ4 A;  1B4A A;  4G6Q A;  3TKY A;  1IUY A;  3FBN B;  3HM5 A;  5F1R A;  2J5P A;  4S05 A;  2VLA A;  5FD5 A;  2YPR A;  3K4N A;  4HDU A;  4RGX A;  5GAG J;  3ABT A;  2Z3Y A;  3JRI A;  2Z16 A;  2LYC A;  4XNF A;  5A2Q K;  2RN7 A;  4HZF A;  3OR1 C;  4JX6 A;  2CO5 A;  1MMS A;  1BC7 C;  3OIQ A;  4U87 A;  1D1C A;  1AKH B;  1F43 A;  1XTA A;  2F5V A;  3L2W A;  3CO7 C;  4CYC B;  1YO5 C;  4EQQ A;  2CMP A;  2WAF A;  3A03 A;  2E1M B;  1APL C;  2ZXW H;  1BW5 A;  1NTC A;  2JTV A;  3KIO A;  2NAZ A;  4OAZ A;  4CCO A;  3S14 J;  1HA8 A;  2XB0 X;  2CQK A;  4FE7 A;  3J80 K;  3I64 A;  2R7S A;  2BYV E;  2A5Y B;  4XLF A;  2TCT A;  2KIS A;  2DXI A;  4EJO A;  1QZY A;  3HOZ J;  5LGN A;  1TQM A;  5DM6 F;  2CW8 A;  2DTZ A;  1D0Y A;  2L7F P;  3IAS 2;  4HLX A;  4KN7 X;  4AID A;  2VE9 A;  2M4K A;  4KMU X;  3G3Z A;  3CO6 C;  4KA4 A;  1U5T B;  2DMU A;  3PO2 J;  3JRH A;  2E5Z A;  3HOV J;  1Z9C A;  2K3F A;  3FKJ A;  1MD0 A;  5IYC J;  3EUA A;  3F3X A;  3FXU A;  2Y9Z A;  2HZT A;  3RZO J;  2R5Y B;  4XKC A;  2CGP A;  4D1Q A;  2HOE A;  3I58 A;  2ESH A;  4IVN A;  2CFO A;  3N97 A;  3SEQ A;  2JJ7 A;  3CCR I;  2FBH A;  2XRN A;  2ZME C;  1VFC A;  3GFJ A;  4XRS G;  4BNC A;  2EIN H;  5F1J A;  4XL9 A;  2K9Q A;  4I6Z A;  4NB5 A;  3A01 B;  4MFE A;  1QVT A;  2LOO A;  4M73 A;  2ZSI B;  4K2E A;  1KZH A;  2ZCW A;  1K78 A;  3CLQ A;  3QPT A;  4UB8 C;  1YJW I;  3BT9 A;  3WTV C;  2TRT A;  4CXF A;  1GUU A;  3PUB A;  1QPM A;  1SMT A;  2CQQ A;  5D5U B;  2ADU A;  2K27 A;  1XMA A;  3EET A;  3BY6 A;  2LK2 A;  4Y3O A;  4A3M J;  2LRD A;  4KIF A;  4ENN A;  4KN4 X;  3TBI A;  3R0A A;  4UUS B;  4BE2 A;  2LKX A;  3L2R A;  2E2H J;  1XDU A;  3JRA A;  1ZAR A;  2YR2 A;  1LKX A;  2LVS A;  2P6S A;  1HKQ A;  2IGM A;  1KYZ A;  2K4J A;  3VYU B;  1SC7 A;  2ZNY A;  5DYM A;  3SJM A;  2LNB A;  3NWT A;  2OD5 A;  4L0Y B;  1T0F C;  1LUJ B;  4IKF A;  1GDT A;  5E8G A;  1V5G A;  2NS8 A;  2YX7 A;  4I01 A;  2V1D A;  3QOE A;  3M1C A;  2VXZ A;  3HDD A;  2XDV A;  3DTI A;  4CYD A;  3PNT A;  2VJ4 A;  2ZSH B;  1AA7 A;  1KQ8 A;  4B8X A;  2CJJ A;  3ZMT A;  2VKH A;  3ZCO A;  5DV5 A;  1WQ2 A;  3OYN A;  2NVU B;  3A4C A;  1WJ5 A;  1EJ9 A;  3LQR A;  4LIT A;  5HOD A;  3S1M J;  2K40 A;  1GLN A;  1I3A A;  2K3P A;  3PSF A;  3COA C;  1X58 A;  5FKO A;  4U7D A;  3LSH A;  3LSP A;  3TGN A;  4OIP F;  3AFH A;  4EJU A;  1OMI A;  1UFM A;  3MVP A;  5DEQ A;  2E1C A;  3ELK A;  2MA3 A;  4DNC A;  2CQ7 A;  2GLO A;  1MBF A;  3P7N A;  4IO9 F;  1Y1V J;  3HC7 A;  3FM5 A;  3LSM A;  4YII A;  3ML6 A;  4ABZ A;  1OCP A;  1I39 A;  1TC3 C;  2G7U A;  1QZE A;  4LB6 B;  3BPV A;  3OL4 A;  2O5R A;  2HVQ A;  4HA8 A;  4KIS A;  3BG6 A;  1ZH5 A;  2QYO A;  1LNW A;  3BJO A;  2IA2 A;  4C3H J;  5LGU A;  4BY1 J;  1U9O A;  4RGR A;  1W7P B;  2FXA A;  1G2H A;  1HQC A;  5EEH A;  1UHS A;  5J6X A;  1TTY A;  3RJP A;  5TJJ A;  2PMH A;  3CDL A;  4MGR A;  4CGZ A;  2DOE A;  2FJ1 A;  3W2V A;  4MLO A;  3HRU A;  3DLA A;  5IYD J;  1VQP I;  3E5U A;  3OS1 A;  4PJM A;  1WVR A;  2QEN A;  2LH9 A;  1D8K A;  3PNV A;  5ED4 A;  4E7K A;  1LDK B;  3CD6 I;  3GYH X;  5HLH A;  3CF5 F;  1H9G A;  2DLL A;  1HBX G;  4W97 A;  2X6Y A;  4ESB A;  4BDY A;  2FEZ A;  2LKP A;  1U6G A;  1Z77 A;  1B72 A;  4Z2Y A;  4XRF A;  1R49 A;  1A5J A;  1U3E M;  3ZR8 X;  1YG2 A;  3H3Z A;  4Q48 A;  1JI8 A;  1JE8 A;  3FXL A;  3UNG C;  1BR2 A;  1G59 A;  1FBS A;  2GXG A;  2VQG A;  3CCV I;  3BOQ A;  4IHV A;  1BOA A;  2IGK A;  2VIX A;  1XCV A;  4KMF A;  2IP2 A;  1WRJ A;  1A6I A;  3SEZ A;  3FHN A;  5L3D A;  4J01 A;  2Z1D A;  2WAQ N;  3LST A;  3ABL H;  2RDP A;  2F48 A;  3EDP A;  4X6A J;  2XV4 S;  2WAD A;  2Y0S A;  2NVX J;  2STW A;  5B5E C;  1G8X A;  2JA2 A;  1MW7 A;  1PYV A;  1VQ8 I;  1YYV A;  4KNY A;  2M8E A;  2JA6 J;  2XAU A;  3MAJ A;  3GTM J;  4I98 B;  1W0T A;  1G3Y A;  1MBH A;  2DQR A;  1STZ A;  2DA5 A;  4ZDP A;  2JRM A;  2LY1 A;  1K4T A;  4RM2 A;  2JA8 J;  1GHC A;  3BDD A;  4DZJ A;  3IWZ A;  3G1M A;  4G94 A;  2K9L A;  1QU3 A;  3L2C A;  3Q0V A;  2DYR H;  2JVG A;  2NVQ J;  3HGY A;  4A0X A;  1ETQ A;  2RNJ A;  3A02 A;  3B6C A;  2V9K A;  4AIH A;  3RKX A;  2WY7 Q;  1ITY A;  2LKS A;  1HCR A;  5D4S A;  4BJ5 C;  4PGG A;  5LRR A;  1R1T A;  4M9S A;  5J1U A;  5HLI A;  5LBQ A;  4CZC A;  3KEY A;  3UR3 C;  4HRI A;  1Y1W J;  2R92 J;  1D0Z A;  2EA2 A;  1ZN2 A;  2LP0 A;  1OYW A;  1MH4 A;  3DTE A;  3E6M A;  4ASN A;  2AHQ A;  2DJI A;  2BBY A;  1OYY A;  4MQ9 F;  2W00 A;  3ZXS A;  1FZP B;  4L5I A;  1GV2 A;  1KYW A;  1ZK8 A;  5EZH A;  4IRI A;  1DUX C;  2L01 A;  4BXF A;  5LHG A;  2R7T A;  1ZR4 A;  3CMA I;  2O61 A;  3LFK A;  1P7J A;  2QGU A;  4P5O A;  3WU0 A;  5JLX A;  5LEK A;  4EGY A;  2MH2 A;  3AG2 H;  3M4O J;  1P4W A;  3CUQ B;  4F92 B;  5BNG A;  3B6A A;  2IS4 A;  4XN0 A;  4N9I A;  1OPC A;  2J5O A;  2P5K A;  3H5R A;  3CCL I;  2DFE A;  3ZQQ A;  2MLK A;  1O57 A;  5EGO A;  2RVC A;  2L9N A;  1KU2 A;  5EGO B;  1ETW A;  5FKK A;  1G3S A;  1P9Q C;  3FXK A;  1VTN C;  1GT0 C;  2BY2 A;  3V4G A;  1JUM A;  4UVA A;  3LSR A;  2I8D A;  2R7F A;  5KAF C;  4IX7 A;  3FX3 A;  4KFC A;  3T5X A;  2Y30 A;  4LJZ F;  5B3S H;  4ZDO A;  2UZK A;  2MW8 A;  1BI3 A;  3CDI A;  2WB1 A;  3LQQ A;  3CTA A;  4M3G A;  4UUT A;  2Q0O A;  3MKZ A;  4KT6 A;  1LJ9 A;  4IL6 C;  3CCY A;  1Q1V A;  3TOA A;  1J7K A;  1T8I A;  3G4S I;  4N9H A;  3VDX A;  4B4C A;  3HUG A;  2XRO A;  3HL2 A;  4XKV A;  3ZPL A;  2OQR A;  2VC1 A;  3ZQI A;  2F4O B;  2R0Q C;  1S7O A;  3F8F A;  1KON A;  3CMM A;  5KK1 A;  4PJN A;  2QQA A;  4PSW A;  3TP3 A;  1MJ9 A;  4XLN F;  2QA4 I;  3V7R A;  3L2U A;  5B1B H;  1Z7L A;  3GTO J;  2VPL A;  2Z9O A;  1FOK A;  1SAN A;  1A36 A;  3TED A;  2K7L A;  1U8B A;  2BW3 B;  4BKX A;  1E17 A;  2EIJ H;  1T56 A;  1BIB A;  3JTG A;  1U78 A;  4QIW N;  1WJC A;  2K86 A;  4A6D A;  2AXL A;  5ICC A;  3OOU A;  1LE8 B;  2L9S A;  2M4G A;  1SAX A;  2LBF A;  2HYJ A;  2DDB A;  2X85 A;  3E5Q A;  1X1A A;  2FBK A;  3F0C A;  1POG A;  1BA5 A;  4CDG A;  3KLO A;  2MFZ A;  3BCB A;  3DU6 A;  1S7A A;  2ZME B;  4M3D A;  3J81 K;  4HNT A;  2WY8 Q;  3M8F A;  5L3F A;  1YLF A;  3CES A;  2LC2 A;  4ENJ A;  2HQN A;  3QPL A;  2ID3 A;  1PP8 F;  1MGT A;  4A3K J;  3ABM H;  1NHA A;  3TW7 A;  2XVC A;  3OOP A;  4EGZ A;  2EV0 A;  3EUH A;  3IWF A;  3PL8 A;  2D1V A;  4I09 A;  1H88 C;  4RLF A;  1FC3 A;  4UY8 I;  3N4M A;  5LD2 C;  3BR1 A;  2E1N A;  3S15 J;  2KRH A;  2XAH A;  4RDU A;  2F5F A;  3BTJ A;  3F23 A;  3QP6 A;  4HPQ A;  4RLQ A;  1J09 A;  3EQL F;  3QOP A;  4RGS A;  3C18 A;  1F36 A;  5B1A H;  4XOR A;  3CC7 I;  4XRM A;  4YRV A;  1YIJ I;  1K7A A;  4JYK A;  2RQP A;  5E3O A;  3FBI B;  1WH7 A;  4P55 A;  2W7N A;  4WWC A;  2MBF A;  3D5S C;  5C4J J;  2V1X A;  4JX4 A;  5D6E A;  5E79 C;  1KGS A;  2VBY A;  1V4R A;  3F8N A;  1J0R A;  2FX0 A;  3E0J B;  5HVQ C;  3R4K A;  1ONV A;  3HPG A;  5FFX A;  1O3Q A;  5FLX K;  1FOX A;  5H2F C;  2P5L C;  4KUM A;  3BZK A;  2A6H F;  4KT5 C;  5L3B A;  5LFA A;  4I0B A;  3EPZ A;  3D0S A;  2N8G A;  3WU2 C;  2HWV A;  3S2D J;  4D0P A;  4BL0 B;  3HTS B;  1PVE A;  4MTE A;  3HB9 A;  2O3F A;  1KA8 A;  5L3C A;  4LK0 F;  1OJL A;  2HKX A;  2R93 J;  1TWC J;  3LOC A;  5J40 A;  3S32 A;  3BTI A;  2QUF A;  4HQE A;  2HXI A;  4HF2 A;  3SZG A;  2FA5 A;  4Y7N J;  3RQ4 A;  1QNT A;  5M3F J;  5L3G A;  1YW7 A;  4PSX A;  1O4X A;  2PBI A;  4C9Y A;  5FJ8 J;  1Z67 A;  5CVJ A;  3LNQ A;  3AL0 C;  2KDO A;  1ZG1 A;  1HLV A;  1WFX A;  2GIZ A;  4RB0 A;  3HOU J;  2L7K A;  2NNY A;  2PMU A;  3QWL A;  2RV8 A;  1GV5 A;  2VJ5 A;  3I71 A;  4D7M A;  3RIR A;  5GAD J;  4OIO F;  4BQN A;  4A3F J;  1YW9 A;  1GXQ A;  3FXQ A;  2HDD A;  2R7U A;  3A1Y A;  4IHX A;  1IRG A;  1SFU A;  2X1E A;  5C3E J;  1IJW C;  1JKO C;  1A31 A;  1MBE A;  1QRY A;  3L09 A;  2R5Z A;  3J7A Y;  4UVC A;  1WSU A;  5HNF A;  1FPQ A;  1JTY A;  2XF7 A;  3MCZ A;  3OYE A;  5J1Y A;  1BI2 A;  1W0U A;  2IBD A;  4ZJZ A;  3ECH A;  1VQL I;  2A61 A;  2KJB A;  3WG7 H;  3F8B A;  3CUO A;  3FXJ A;  1MH3 A;  1ON2 A;  3OYC A;  2JT1 A;  1XGN A;  1J75 A;  3WTS C;  1X1C A;  5F0C A;  5M5Y J;  1J5Y A;  4XM3 A;  5F64 A;  1T33 A;  4EM2 A;  1D1B A;  3HOW J;  2NNN A;  4G6T B;  3ABK H;  3MZH A;  2Y0S N;  3OL3 A;  1QPI A;  5IT9 Z;  3BRO A;  3MWM A;  1ZRC A;  5KAI C;  2W48 A;  1SFX A;  2L9R A;  3GTQ J;  2YU9 J;  4M71 A;  2DOA A;  3BTC A;  2LRE A;  1IO2 A;  3I59 B;  4C3J J;  2NRA C;  2IGO A;  2PQ8 A;  2IVM A;  2EZI A;  1L0O C;  4ITV A;  4DYQ A;  2HKO A;  3RYR A;  3E6C C;  3K6G A;  2V9P A;  1R5I D;  3CC4 I;  3IP4 B;  5EYR A;  5HNH A;  4ETS A;  5DTD A;  2K9N A;  1G4D A;  1TL8 A;  1XGM A;  4G6D A;  4B1R A;  4O3M A;  2OQG A;  4M9Z A;  2X0L A;  2KQR A;  1OR7 A;  3ASO H;  2GOX B;  3P5J A;  3K7A J;  4Z6Y A;  4ZZD A;  2CS3 A;  2UUZ A;  1U8R A;  1Z21 A;  2V9V A;  2Z5U A;  3R61 A;  2NS0 A;  2FRH A;  1OCT C;  2XGX A;  4XLC A;  3BG3 A;  1IDZ A;  2IA0 A;  1J2X A;  4WCG A;  2ZBK A;  1XSD A;  2GOM A;  1MMG A;  4RM3 A;  2ISY A;  4DYC A;  1OFC X;  3H9Q A;  1R7J A;  2M45 A;  1XGO A;  2RKH A;  3BP8 A;  5E3M A;  2ELK A;  2B0L A;  1IRX A;  4GO1 A;  1U2W A;  3WGG A;  1VQ9 I;  2X9D A;  3FXR A;  3DU5 A;  1B9M A;  3S1N J;  2A6T A;  1IN5 A;  5D5X B;  1A04 A;  4GYG A;  5FRM A;  3IUO A;  5K5O A;  1R9T J;  2JK3 A;  3A0B C;  2VKE A;  4IEJ A;  2HVS A;  2Y31 A;  4QWQ A;  1NH3 A;  3J7Z I;  1ZRE A;  1XC5 A;  2IS2 A;  1P6R A;  5JR3 A;  3RZD J;  1VQ6 I;  1AOY A;  2D5V A;  2HQR A;  5EEG A;  3SYT A;  3H3V K;  4IHW A;  2WB1 N;  5HDK A;  1AKH A;  3KZZ A;  2X51 A;  1IXR C;  4CYC A;  2UXX A;  3BZC A;  2QBY A;  2DA1 A;  1KQ0 A;  2DN0 A;  4G7H F;  2QBY B;  5K1Y A;  5TGT A;  4EM1 A;  1REP C;  3V8L A;  1BI0 A;  3KP3 A;  3QP5 A;  3CCE I;  4BHC A;  5DUI A;  1X3U A;  3M8J A;  3OS0 A;  1F9N A;  3HRT A;  1R22 A;  1GVJ A;  4BAY A;  2L54 A;  3UKG A;  4HW0 A;  4PK4 A;  1U5T A;  5FLV A;  1YQA A;  2P7V B;  5JVG F;  1FBQ A;  3CZ6 A;  2MSY A;  2VB6 A;  1FP2 A;  4O6J A;  4JK1 X;  4WF2 A;  3FHZ A;  1X1B A;  2IGN A;  2CU7 A;  5FB2 A;  4XLH A;  3MKY B;  3BR6 A;  3TO9 A;  4BH9 A;  5LLQ A;  3R6S A;  2R5Y A;  4X0G A;  2A69 F;  2OAZ A;  2V1U A;  1Y56 A;  3IC7 A;  1MZB A;  3JTH A;  2WV0 A;  4U88 A;  4G12 A;  4ZYG A;  4WK8 F;  3DXJ F;  3L2V A;  2YS9 A;  5EDN A;  4IPA A;  3NEU A;  4C2U A;  5LHH A;  1WH5 A;  2JMW A;  2LF7 A;  1SEU A;  3LA7 A;  1X3Z B;  3K4M A;  3F8C A;  4ON0 A;  3R60 A;  4LLG F;  2BY3 A;  3A01 A;  5HS8 A;  3L1P A;  3S2H J;  1ZKG A;  2IT0 A;  2LMD A;  3Q3S A;  2KIQ A;  4RAZ A;  4G8X A;  3BG7 A;  2G7H A;  3F72 A;  3HBL A;  2ICW G;  1N78 A;  4B48 A;  4LG0 B;  5BOX A;  2JPC A;  3H36 A;  1PUF B;  2X1D A;  5CQE A;  3K69 A;  3JRC A;  4I2O A;  1FBU A;  1TT5 B;  1Z3Y A;  3FIW A;  2Y48 A;  1T95 A;  4FT8 A;  3F21 A;  2JQ7 A;  4UUS A;  2DK8 A;  4L18 B;  4RB3 C;  3F9K A;  1HDP A;  3GZN B;  1W36 D;  5GTH C;  5M5X J;  4HDV A;  3M3Y J;  4II3 A;  1T08 B;  1RR7 A;  4YG2 F;  1IG7 A;  3S2W A;  2X1C A;  3PM1 A;  4HYE A;  2EZL A;  4NNJ A;  3LSJ A;  1IN6 A;  2L7Z A;  2M87 A;  5DD4 A;  2BVL A;  4DJA A;  4DW6 A;  3EUH C;  3PIO F;  2LR8 A;  3LAP A;  2G0E A;  3GFL A;  1RZ4 A;  1HC8 A;  5JLW A;  1YW8 A;  2O8X A;  3D1N I;  2OF7 A;  1H0M A;  2FNP A;  4BJ6 C;  4U0V A;  1S29 A;  1R1V A;  1MDM B;  1B1B A;  3JAM Z;  5K5Q A;  1ON1 A;  2EV6 A;  2KIF A;  4BHB A;  4V2G A;  1QZZ A;  3CQZ J;  1EA3 A;  3AG1 H;  4L0Z B;  3G1O A;  1E2X A;  1UG2 A;  2PLY A;  4CIC A;  2VJI A;  4NQW B;  2QEX I;  2DPU A;  4HST A;  1RRJ A;  1R00 A;  2GM4 A;  5FRO A;  2C6Y A;  3VEP A;  3LFU A;  4IHS A;  4MEX F;  1X1D A;  3QPS A;  5CYV A;  4HV5 A;  2VL8 A;  2L4M A;  2VT2 A;  1PDN C;  2F4I A;  2DPD A;  5JVT A;  1EH6 A;  3QYF A;  2O8K A;  1I6H J;  1S5L C;  2JRT A;  1IV8 A;  2OV7 A;  3S1Q J;  4B09 A;  1LFU P;  1WI3 A;  4LIV A;  3GXO A;  1X2N A;  3I54 A;  1OYI A;  2DA6 A;  3HPH A;  2B63 J;  4ZDL A;  3E6D A;  1EF4 A;  2IS1 A;  2YX4 A;  1ZEL A;  4L5J A;  1W7P A;  1BJZ A;  2XF5 A;  3MMY B;  2HI3 A;  3RPU D;  3RPQ A;  2D2W A;  2IS6 A;  4UXN A;  4A3D J;  5E18 F;  2DK5 A;  2XGD A;  4L9J A;  2EV5 A;  2PJR B;  1D5V A;  1HOM A;  4RS8 A;  3V7S A;  5C44 J;  3LA3 A;  1W36 C;  2EBI A;  3AL0 B;  4LOC A;  3KYC B;  2EPF A;  1SMY F;  1B8I B;  2M8G X;  3CJQ B;  1PP7 U;  2H8W A;  1IC8 A;  3HZJ A;  3OWT A;  5KVR A;  5LRS A;  4PJL A;  1MBG A;  3R0J A;  4J19 A;  3WE2 A;  2QCO A;  2KHM A;  1WJB A;  1X19 A;  2H8R A;  2FUG 2;  4IRG A;  1RNL A;  2KZV A;  4M3B A;  3TL4 X;  3BWG A;  2WC2 A;  3ASN H;  3O3K A;  1P4A A;  4OIQ F;  4ESJ A;  1HSJ A;  3GCM A;  3OIO A;  3DLL F;  3DP7 A;  3WTY C;  4A3L J;  5J8F A;  1ZGW A;  1IAW A;  1IF1 A;  1DU6 A;  2GXB A;  2VQC A;  1R6R A;  2HS5 A;  3S3O A;  4EV0 A;  2I10 A;  3GWZ A;  2QM3 A;  3VOE A;  2W24 A;  2BGC A;  3JRE A;  2F5C A;  1W5T A;  1MSE C;  2XHK A;  3DF8 A;  4M72 A;  4MTD A;  3WHC A;  2FF4 A;  2UXN A;  2HTJ A;  1E3P A;  1N25 A;  3F6V A;  4IQJ A;  1DP3 A;  2OCC H;  2CUF A;  1E0E A;  3PNY A;  4N0B A;  3OYF A;  1MJA A;  5FO5 A;  2O6G E;  1IXS B;  3E5X A;  3C2G A;  1AWC A;  4P9U A;  1MNE A;  2HR3 A;  3O8H A;  2KFD A;  3REO A;  5DCM B;  2RC4 A;  4D7N A;  3KLN A;  5AON A;  1YTY A;  1XSV A;  4BE0 A;  2OU2 A;  4XID A;  2JZY A;  2LSO A;  1LVA A;  4RMN A;  2DFI A;  2H6B A;  3HYI A;  3G73 A;  1FWZ A;  3OV8 A;  1E3O C;  2E35 A;  2F6C A;  2A07 F;  5LEJ A;  3F8M A;  3JSP A;  2AS5 F;  2R4G A;  4QPQ A;  1ZTR A;  3K9T A;  3LSK A;  4KIT B;  5A2Q Z;  2VOO A;  1OCR H;  3HOX J;  3S16 J;  2AQE A;  3H5N A;  5HDG A;  2GQQ A;  4JP0 A;  3T1B A;  4UHT A;  4ZZL A;  3LA2 A;  3O2P E;  3SFI A;  3ERE D;  3IKV A;  4AWX B;  4B44 A;  2GAU A;  1ETV A;  4A3E J;  5ICE A;  4NHJ A;  2OUM A;  4ZC3 A;  3J80 Z;  2AO9 A;  1VND A;  2V7F A;  2DYS H;  1VQM I;  2CSO A;  2CV1 A;  4JX5 A;  1TZL A;  1XPX A;  5IOY A;  2QQ8 A;  1DPU A;  2GA2 A;  4DBQ A;  4CCM A;  1R36 A;  5H6R A;  4EVI A;  4R8H A;  4LFU A;  2EK5 A;  1ETO A;  3CUQ A;  3ABU A;  3K4B A;  1TT0 A;  4FET A;  3SQN A;  3PO3 J;  4WX9 A;  2DOD A;  3WHB A;  1W5C C;  1ETY A;  3DTK A;  3H0G J;  1Y8Q B;  2KRC A;  1VQ4 I;  3P9C A;  4XBF A;  1IGN A;  1JUS A;  1V5E A;  3RKY A;  2EIK H;  2WV1 A;  4OMZ A;  4CCJ A;  1X3W B;  2VKV A;  2ZB9 A;  3F6O A;  2P8T A;  3U1K A;  1WGX A;  4ZYH A;  5LHI A;  3H9J A;  2WBM A;  3GX4 X;  1W5S A;  2V79 A;  2UWM A;  4Y4R A;  3ZQH A;  1D8J A;  3NWS A;  3KPH A;  5GPC A;  2PI0 A;  3L00 A;  3QYE A;  2VOD A;  3ROU A;  5J3L A;  4LIU A;  2GZW A;  3V8K A;  3P9K A;  4PGH A;  5ICG A;  2ZJQ F;  2E1M C;  5J47 A;  4DBR A;  2XRL A;  3HGG A;  2V26 A;  3A0H C;  2VN2 A;  1P92 A;  3HRM A;  4LLL A;  1VQ5 I;  3IRR A;  4Q47 A;  3C2B A;  4BBS J;  2HEO A;  1FEX A;  2MC3 A;  4GRI A;  4CO8 A;  3DBH B;  2QSH X;  4QPO A;  3HG9 A;  2EFP A;  3SXY A;  2W84 A;  2IA1 A;  1B59 A;  2MYS A;  3ZMV A;  3BJ6 A;  4Y15 A;  1DDN A;  2BW3 A;  4KIG A;  1U5T C;  4LD5 A;  2EH3 A;  3E7L A;  3TOB A;  2HYG D;  4Q5S F;  3I9V 2;  3CCQ I;  2D1H A;  2JN6 A;  4YFX F;  5K7F A;  3IRQ A;  3DEE A;  1TW3 A;  1ETK A;  2M1B A;  1O7L A;  3DBR B;  3LSG A;  4OWR B;  4BU2 A;  5TIS C;  1LE8 A;  1CF7 A;  4PUS A;  1V3F A;  3S8P A;  3U2R A;  1D5Y A;  2XGE A;  1R5H A;  1CF7 B;  9ANT A;  5K7H A;  3BR0 A;  1JT6 A;  1ERD A;  2R7R A;  1O3R A;  5FFZ A;  2ZJP F;  3GUD A;  2PG4 A;  2A68 F;  5F27 A;  3M8E A;  4V2F A;  2YUS A;  3Q9V A;  5E3L A;  3OYJ A;  1JHF A;  5BPI A;  1XX5 A;  4B3A A;  2R7X A;  3ZQ7 A;  2ZME A;  3K10 A;  3ZN0 A;  4L9V A;  1FNN A;  2DQL A;  4IJA A;  3MFK A;  1HF0 A;  1Z91 A;  3PFY A;  1XMX A;  2DTR A;  3ZP5 A;  3SDG A;  3CF2 A;  3U1D A;  5HDN A;  3DPT A;  5FGM A;  1FP1 D;  2HZD A;  4DGW B;  4XRS A;  5IYB J;  3RKQ A;  1RKW A;  3GME A;  3MKW B;  3ZQG A;  2Y2Z A;  5FRN A;  2DCE A;  2RRE A;  2UV1 A;  4XOT A;  4LGW A;  4AC0 A;  2XB5 A;  5AIQ A;  2PMZ A;  5H6Q A;  4E7I A;  2XAQ A;  2E71 A;  4BHP A;  4NC7 A;  5L3E A;  2F4M B;  1K79 A;  2XAF A;  3CJN A;  5F08 A;  2W4S A;  2TDX A;  4R1H A;  2STT A;  4RAY A;  4AM3 A;  1FYM A;  4MNU A;  3SFZ A;  3ZQC A;  1ZQ3 P;  4A0Z A;  4HG2 A;  3W6V A;  2ZXH A;  1T0F A;  3JSO A;  2E7X A;  4EAT A;  3OS2 A;  3JRG A;  1OKR A;  1YHQ I;  3W6J B;  2H27 A;  3RKW A;  4A5N A;  3KCC A;  4E6K G;  3ZOB A;  3I56 I;  2AXT C;  1IXC A;  4GDF A;  2K9S A;  5EG0 B;  1EH8 A;  2L9V A;  4H0E A;  5F0F A;  2DI3 A;  4M6X A;  4LLN A;  3J7Y J;  4X1E A;  3QYB A;  3BR2 A;  2EIM H;  1S6L A;  3L2Q A;  4FE4 A;  4B47 A;  3GF2 A;  2ETH A;  2NXN B;  1DP7 P;  1XG1 A;  1B6A A;  1MNM C;  2OZU A;  2LDU A;  3LAJ A;  5HS7 A;  1QA6 A;  2KLO A;  1RKT A;  4CCL A;  4BE1 A;  2Z2S B;  1O3S A;  1H8A C;  3CCU I;  1ZAO A;  2DU9 A;  3IHU A;  2F5D A;  3OYL A;  1NG6 A;  1UST A;  1FJL A;  3TO6 A;  2HNH A;  1J59 A;  1S8N A;  5ILS A;  5FKM A;  4F3Q A;  4KIB A;  1I3Q J;  1FOW A;  4MO7 A;  1WJD A;  2KPM A;  2WAE A;  3CCS I;  2LY2 A;  3CJR B;  1YRN B;  2BY0 A;  1TWG J;  4BEH B;  1JGS A;  3K70 D;  1I1G A;  4AVZ A;  1ACI A;  3T0Y A;  1HW5 A;  2CW0 F;  1SD4 A;  2CUJ A;  2QQ9 A;  2ZKZ A;  5CQG A;  3K4J A;  4ENM A;  3PFI A;  4XN3 A;  4E7Z A;  1FYK A;  3I5U A;  1FTZ A;  3HXL A;  4HV6 A;  2V1N A;  2V4J C;  3BG9 A;  3E3V A;  5HOO A;  4XLP F;  3BCA A;  3WTU C;  3CME I;  1O3T A;  5GAE J;  2NYX A;  3KP7 A;  3L9F A;  1KU3 A;  3FMR A;  3IAM 2;  3WE3 A;  3HKZ A;  3OR2 C;  3LWF A;  4GXO A;  4V19 K;  2E36 A;  2KKO A;  3MQ0 A;  2L2O A;  4TV7 A;  2XPV A;  3TW6 A;  2EWN A;  1WJF A;  5D4R A;  3HOS A;  1XMK A;  2V6C A;  1R58 A;  1JJ6 C;  3IH3 A;  3SZT A;  3M9A A;  2MLG A;  3HHH A;  1SFO J;  4GGG A;  1SD7 A;  3I59 A;  2KJC A;  2XAJ A;  1BIA A;  5D8L B;  1P2F A;  1IRF A;  1IZ1 A;  4A12 A;  4U0Y A;  2KZG A;  3H1C A;  5JHU A;  1MMA A;  3BPX A;  4YEJ A;  2Q2E B;  1DGW Y;  3K4L A;  2MH9 A;  4HBL A;  2HOA A;  5K5R A;  3AKZ A;  2E19 A;  4XK4 A;  2L5Q A;  3K1N A;  3S93 A;  2NS7 A;  5DM7 F;  2KRF A;  1BR4 A;  3CJT B;  1BL0 A;  3M1E A;  3HRS A;  4P96 A;  3TDU C;  3KZI C;  1Z1D A;  4E7L A;  2IAI A;  4A93 J;  4BJT A;  2H6C A;  2MD5 A;  2O9L A;  1LPQ A;  4E7J A;  2X4H A;  2G9W A;  5JHF A;  4UVB A;  3KX2 A;  2BXY A;  3GTP J;  4NDL A;  3K1P A;  1JKR C;  2O03 A;  2HPI A;  4M74 A;  2ZJR F;  2R7W A;  2EQR A;  4PDK A;  3K70 C;  1VI0 A;  3ISP A;  1VF9 A;  3HSR A;  1YE9 A;  4R79 A;  4CH7 A;  2XIG A;  2E5N A;  1SAU A;  3OSG A;  1QBJ A;  2ZO4 A;  3OYI A;  2P5V A;  2IEK A;  4H4K C;  2HDW A;  2GWR A;  2ID6 A;  4BBR J;  5E17 F;  5BS6 A;  2GBY A;  4BQA A;  4E70 A;  1YIO A;  1LFB A;  1TP4 A;  4A3G J;  3S1R J;  3PSI A;  3TP0 A;  1TLH B;  2FQ3 A;  4DZP A;  1JGG A;  3DKW A;  4EM0 B;  4KDP A;  2QZ8 A;  3GTG J;  2DW4 A;  3VFZ A;  1X4O A;  3NRV A;  2R3S A;  4HQM A;  4D5C A;  3GLX A;  5TRD A;  2M3A A;  2X6W A;  1MIJ A;  3K2A A;  4PFP A;  5HLT A;  4AVP A;  2EJR A;  1JUP A;  4B3X A;  5M5W J;  1EV7 A;  5BQT A;  3WGI A;  1UZC A;  4AIK A;  2PN6 A;  3H92 A;  3WG9 A;  1FSE A;  2JUC A;  4PZJ A;  4EJT A;  1RES A;  1I27 A;  2LTP A;  2A5W A;  1H9T A;  4NBQ A;  4UV8 A;  1ZLJ A;  4XIC A;  4RBO A;  4HAM A;  3TMO A;  4DIQ A;  1BOB A;  2LF8 A;  2OCE A;  1R71 A;  4QSH A;  1O7F A;  3DV8 A;  2QLZ A;  2JVH A;  1TWH J;  1RC9 A;  3ZQL A;  2DA4 A;  4KJZ A;  5HLG A;  2Z99 A;  3CMY A;  2HGC A;  5HS9 A;  4A6E A;  1W4M A;  4HLY A;  3ONQ A;  4M6Y A;  5D6F A;  5E1W A;  3J81 Z;  2NOJ B;  1YJ9 I;  3Q0U A;  1NG7 A;  2VKD A;  3SZP A;  4RB1 A;  5DUK A;  1VQN I;  4A3I J;  2IW5 A;  3WTW C;  2QVO A;  4XLE A;  1LVK A;  3ECO A;  3OIP A;  5EF6 A;  3LMM A;  3BR5 A;  3I53 A;  1RIO H;  1P7I A;  2M30 A;  5FKL A;  2NVT J;  2KL4 A;  1UB9 A;  1A6Q A;  3JRB A;  3S17 J;  2L4A A;  5J4V A;  4B43 A;  1MND A;  3MEX A;  4HNU A;  3OYH A;  5CVI A;  3FK7 A;  4XKW A;  2FMY A;  2M0M A;  5KHD A;  2VOP A;  2RGV A;  4HSR A;  2FSW A;  3KP4 A;  2KT0 A;  2HDC A;  1QHH D;  1KQ9 A;  5J4Y A;  2QSF X;  4PJ0 C;  5EZG A;  2VBX A;  3WOD F;  2COM A;  2HPM A;  2VQH A;  1ZLK A;  4IRH A;  2JUG A;  2OJE D;  4OIR F;  3AG4 H;  2NVY J;  4XMY A;  2ACJ A;  2ELJ A;  4U0W A;  4LG0 A;  2MD0 A;  4RB2 C;  4YIR X;  3V7C A;  1PUF A;  1DU0 A;  1X1P A;  1VQ7 I;  3PUF A;  2LD5 A;  3RDI A;  4IXA A;  1XGS A;  5D5W B;  3GBG A;  2DMN A;  3DQV C;  4FQG A;  2PMZ N;  3ZN1 A;  3IV5 A;  4N4N B;  4GFB A;  1FY7 A;  3AG3 H;  5FLX Z;  2ZXJ A;  1FYL A;  1D0X A;  3N05 A;  1UHW A;  1YIT I;  3E97 A;  2XUB A;  4HF0 A;  4BGD A; 
#chains in the Genus database with same CATH homology
 3DCF A;  3QPL A;  4XID A;  2ID3 A;  4I76 A;  4A3K J;  5FKN A;  3TW7 A;  1TWF J;  1E3O C;  2QF7 A;  3IH4 A;  4EEF G;  1AHD P;  1H89 C;  4BXX J;  1H88 C;  3GTL J;  1FIP A;  1ZTR A;  1AU7 A;  3BR1 A;  3HOX J;  3S15 J;  1JT0 A;  3S16 J;  4JP0 A;  4C2M J;  4RDU A;  3BTJ A;  1RPW A;  3SFI A;  3RQI A;  1MBJ A;  2ECB A;  2DMT A;  3Q0W A;  2XPW A;  1ZR2 A;  2P81 A;  1F36 A;  2L0K A;  1ETV A;  2OPT A;  4A3E J;  4A3J J;  1ETX A;  4XRM A;  3VPR A;  3DEW A;  2AO9 A;  4JYK A;  2KDZ A;  4FCY A;  1VND A;  2M0C A;  5E3O A;  1WH7 A;  5C4J J;  4JX5 A;  4JX4 A;  5IOY A;  4AUX A;  1UMQ A;  1IUF A;  1S7E A;  2FX0 A;  1JTX A;  4S0H B;  4MFD A;  1ETO A;  2M34 A;  3BQY A;  2DMQ A;  3BTL A;  1K83 J;  1NK3 P;  3PO3 J;  3WHB A;  2N8G A;  1ETY A;  2HOS A;  3H0G J;  1FTT A;  1JKQ C;  1RET A;  2EZH A;  2COB A;  1IGN A;  1JUS A;  3S2D J;  3HB9 A;  3HM5 A;  5GPA A;  2WV1 A;  2VKV A;  2X48 A;  2ZB9 A;  1OJL A;  1WCM J;  4A3B J;  1WGX A;  2R93 J;  1TWC J;  3LOC A;  3BTI A;  2HXI A;  2O7O A;  5IOZ A;  4Y7N J;  3JRI A;  5M3F J;  3ZQH A;  5GPC A;  5F0H A;  1O4X A;  4JX6 A;  5FJ8 J;  5J3L A;  1ORK A;  3LNQ A;  1F43 A;  1AKH B;  1B8I A;  1HLV A;  3HOU J;  4CYC B;  1APL C;  2XRL A;  3A03 A;  3HGG A;  1BW5 A;  1NTC A;  1GV5 A;  4D7M A;  3HKZ N;  3S14 J;  1NK2 P;  2XB0 X;  4A3F J;  2HDD A;  4FE7 A;  3C2B A;  4BBS J;  4IHX A;  1FEX A;  2JWT A;  2TCT A;  2HXO A;  5C3E J;  1IJW C;  1JKO C;  1MBE A;  5J1R A;  3HOZ J;  1QRY A;  2R5Z A;  3QQA A;  1JTY A;  2DTZ A;  5J1Y A;  1W0U A;  2XPU A;  2L7F P;  1XS9 A;  2IBD A;  2LY9 A;  2DMU A;  2CRG A;  2EH3 A;  3E7L A;  3PO2 J;  2H1K A;  3FK6 A;  2JN6 A;  5K7F A;  3JRH A;  3HOV J;  1ETK A;  3LSG A;  1JJ8 C;  1MH3 A;  5IYC J;  4MIM A;  1LE8 A;  1QVU A;  3IH2 A;  1D5Y A;  2Y9Z A;  2XGE A;  3RZO J;  5F0C A;  5M5Y J;  9ANT A;  5K7H A;  4AYB N;  3BR0 A;  1JT6 A;  1T33 A;  2R5Y B;  3I4N J;  3HOW J;  5IP7 J;  5F27 A;  4V2F A;  2Y0S N;  2YUS A;  5E3L A;  2JJ7 A;  2ME0 A;  4B3A A;  1QPI A;  1B72 B;  5EEA A;  2W48 A;  2L9R A;  1VFC A;  1HF0 A;  2YU9 J;  3GTQ J;  3HOY J;  4XRS G;  3BTC A;  2ECC A;  5F1J A;  2K9Q A;  3SDG A;  4I6Z A;  4C3J J;  3A01 B;  4MFE A;  2EZI A;  2E1O A;  1QVT A;  4DYQ A;  4XRS A;  2CUE A;  5IYB J;  2VPR A;  3RKQ A;  1RKW A;  3JRF A;  3ZQG A;  2Y2Z A;  3BT9 A;  2TRT A;  1GUU A;  5EYR A;  4A3C J;  5DTD A;  2CQQ A;  2K9N A;  4AC0 A;  2XB5 A;  4B1R A;  2JA7 J;  2LK2 A;  1TWA J;  3K7A J;  4A3M J;  3BG5 A;  4UUS B;  5F08 A;  2LKX A;  2E2H J;  1OCT C;  3JRA A;  2LVS A;  3BG3 A;  3ZQC A;  1ZQ3 P;  3W6V A;  1IDZ A;  3SJM A;  3OSF A;  4IHY A;  3JRG A;  4DYC A;  1GDT A;  5GP9 A;  1OFC X;  2NS8 A;  3ZOB A;  3HDD A;  5E3M A;  2ELK A;  2K9S A;  5EG0 B;  5F0F A;  1IV6 A;  2XGC A;  2X9D A;  4FIS A;  4X1E A;  3S1N J;  2DA2 A;  3BR2 A;  2CJJ A;  4FE4 A;  1BW6 A;  1XG1 A;  5HOD A;  3S1M J;  2K40 A;  1MNM C;  4Y52 J;  1R9T J;  1X58 A;  2JK3 A;  5FKO A;  2VKE A;  4IEJ A;  3LSP A;  1RKT A;  2Y31 A;  1XC5 A;  4M6V A;  1H8A C;  3MVP A;  3RZD J;  2GLO A;  3MKL A;  1MBF A;  5DS9 A;  1Y1V J;  1FJL A;  3MN2 A;  2D5V A;  4M3F A;  3H3V K;  2NOG A;  2WB1 N;  4IHW A;  5FKM A;  1AKH A;  3FKI J;  4CYC A;  4ABZ A;  1I3Q J;  2DA1 A;  1OCP A;  2DN0 A;  1TC3 C;  4MO7 A;  2Y9Y A;  2MGQ A;  3O8G A;  1YRN B;  1TWG J;  3I4M J;  4C3H J;  4BY1 J;  1U9O A;  1G2H A;  1UHS A;  3HEF A;  1FTZ A;  3CDL A;  3JR9 A;  3UKG A;  4QTR A;  5FLV A;  3BG9 A;  2FJ1 A;  1CQT A;  4MLO A;  2MSY A;  5IYD J;  2M9H A;  2CU7 A;  3BR6 A;  2R5Y A;  2XPV A;  3TW6 A;  4G12 A;  2YS9 A;  5EDN A;  5IP9 J;  4W97 A;  1WH5 A;  1JJ6 C;  2JMW A;  3IH3 A;  1Z77 A;  1B72 A;  5C4X J;  2LFB A;  1WPK A;  1SFO J;  2DMP A;  2FQ4 A;  2FD5 A;  1A5J A;  3A01 A;  3L1P A;  3S2H J;  1ZKG A;  2HOT A;  4IHV A;  3Q3S A;  2HOA A;  3GTK J;  1A6I A;  2E19 A;  3HBL A;  4XK4 A;  2LLK A;  2WAQ N;  1PUF B;  2DA3 A;  2XSD C;  2NS7 A;  4X6A J;  3JRC A;  1BL0 A;  2NVX J;  5IP6 A;  1ENH A;  2IAI A;  4A93 J;  3FIW A;  2O9L A;  4UUS A;  2JA6 J;  3GTM J;  3NAU A;  1W0T A;  1HDP A;  4NDL A;  5K7Z A;  3GTP J;  5M5X J;  1MBH A;  1JKR C;  3M3Y J;  2DA5 A;  1RR7 A;  1IG7 A;  2CQX A;  3PM1 A;  2EQR A;  2E2J J;  2JA8 J;  1VI0 A;  2EZL A;  4A69 C;  4DZJ A;  1VF9 A;  3G1M A;  3LSJ A;  4DYR A;  3Q0V A;  2L7Z A;  2NVQ J;  3HGY A;  4BY7 J;  2X6O A;  1ETQ A;  3A02 A;  3OSG A;  4DW6 A;  3B6C A;  2IEK A;  2LR8 A;  1ITY A;  1HCR A;  2G0E A;  2ID6 A;  4BBR J;  1U9N A;  2GBY A;  5JLW A;  5EG0 A;  4A3G J;  1LFB A;  1MSF C;  5J1U A;  2OF7 A;  3D1N I;  3S1R J;  3FIS A;  3TP0 A;  4DZP A;  1Y1W J;  1FIA A;  1JGG A;  2R92 J;  3GTG J;  5M3M J;  2DJN A;  4V2G A;  4D5C A;  3CQZ J;  2LP0 A;  1MH4 A;  3G1O A;  1UG2 A;  2AHQ A;  3K2A A;  1JUP A;  5M5W J;  1GV2 A;  1ZK8 A;  5EZH A;  2GM4 A;  1IRZ A;  1ZR4 A;  1RES A;  2LTP A;  1P7J A;  3QPS A;  5JLX A;  4XIC A;  4RBO A;  3M4O J;  2O8K A;  5F04 A;  1GVD A;  1HDD C;  1I6H J;  5BNG A;  3B6A A;  3S1Q J;  2ME6 A;  1YRN A;  1LFU P;  1WI3 A;  4QSH A;  1JKP C;  5EGO A;  1IDY A;  1X2N A;  3JRD A;  1TWH J;  2DA6 A;  3ZQL A;  5EGO B;  2DA4 A;  3GTJ J;  2B63 J;  1ETW A;  5FKK A;  1EF4 A;  3NAR A;  1GT0 C;  4D5F A;  1JUM A;  3CMY A;  1BJZ A;  3LSR A;  2HI3 A;  2Y30 A;  4FTH A;  4A3D J;  1MBK A;  2MW8 A;  3BQZ A;  2XGD A;  1X2M A;  3G1L A;  3Q0U A;  4M3G A;  4UUT A;  1HOM A;  5C44 J;  1I50 J;  4A3I J;  4HNV A;  2EBI A;  4LOC A;  3CCY A;  1Q1V A;  5EF6 A;  2DA7 A;  1B8I B;  5FLM J;  3BR5 A;  1P7I A;  5FKL A;  2NVT J;  2M8G X;  4B4C A;  1IC8 A;  3JRB A;  4M3E A;  3S17 J;  1MBG A;  3ZQI A;  4J19 A;  2R0Q C;  2QCO A;  2R7Z J;  2H8R A;  2L7M P;  3FK7 A;  2M2E A;  4M3B A;  3TP3 A;  2R5Z B;  4C3I J;  3GTO J;  4L5E A;  2E2I J;  2KT0 A;  3OIO A;  1SAN A;  3TED A;  4A3L J;  5EZG A;  2EZK A;  1U8B A;  1ZGW A;  4BKX A;  1DU6 A;  2MG4 A;  1T56 A;  3ZQF A;  2RAE A;  2I10 A;  1K61 A;  1U78 A;  2NVY J;  4QIW N;  1LE8 B;  3OOU A;  3JRE A;  1MSE C;  1PUF A;  1DU0 A;  3WHC A;  2HYJ A;  2LD5 A;  3BR3 A;  3F0C A;  1POG A;  3GBG A;  4W1U A;  2JA5 J;  2DMN A;  2PMZ N;  1BA5 A;  2CUF A;  5E3N A;  2VUM J;  3IV5 A;  4GFB A;  2HQ5 A;  1Z0X A;  2VI6 A;  4M3D A;  5IPA A;  3O8H A;  4D7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...