1TWAJ

Rna polymerase ii complexed with atp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twaJ00
3TW6A 5FJ8J 2DMNA 2NS7A 2LKXA 1A5JA 2NOGA 4XICA 3HB9A 4A3LJ 2Y9ZA 1MBHA 4A3BJ 3HKZN 2LLKA 4FCYA 4RBOA 2XB0X 1JKRC 1LE8A 2DA4A 1JKPC 2HXOA 1ORKA 3ZQIA 2VI6A 3MKLA 3HOUJ 2Y9YA 3HOZJ 1WGXA 2LFBA 2Y31A 2LD5A 2DMQA 4QTRA 1H88C 1Y1WJ 5E3LA 1AKHA 1TC3C 2M9HA 3SJMA 5E3MA 3WHBA 3I4NJ 5EYRA 2CQQA 3BG5A 4M3BA 3ZQFA 5IP7J 3ZQGA 3BR6A 3JREA 1RKWA 2CU7A 2YU9J 2YUSA 2D5VA 1Q1VA 3HGGA 3GTJJ 3S1RJ 4BKXA 1GV5A 5FKNA 4A3FJ 2M34A 1JJ8C 1QPIA 3S16J 1ETKA 3BTLA 3BTJA 5EG0A 4B1RA 3A01A 2NVYJ 1IDYA 1UHSA 2DJNA 1S7EA 3SFIA 2DMPA 3LSPA 4UUSB 2LK2A 3GBGA 2H8RA 2O7OA 2E2JJ 5M3MJ 1BW6A 3BR5A 3BR2A 1UG2A 3GTPJ 1MH4A 2QF7A 2G0EA 1HLVA 3RQIA 3JRIA 3Q3SA 1RPWA 1X2MA 4MLOA 3SDGA 2WV1A 3FK7A 5E3NA 2LTPA 1HDDC 2DA1A 1Z77A 2ECBA 4D7NA 3NAUA 5M5YJ 2JJ7A 2AO9A 3FK6A 3K7AJ 3FISA 3FIWA 1SANA 2JWTA 3FKIJ 5BNGA 1FIPA 3G1OA 4CYCA 3RKQA 3S2DJ 3OIOA 2HOSA 2VPRA 5EDNA 4B4CA 3I4MJ 4IEJA 2EQRA 1X2NA 2KT0A 3K2AA 3MVPA 1RR7A 1LFUP 2K9SA 3JRHA 1HOMA 1X58A 1WCMJ 2XSDC 1HCRA 2R92J 1BA5A 2OPTA 5F04A 4FTHA 3M4OJ 4FISA 5HODA 2B63J 5K7ZA 2OF7A 1RESA 4A3MJ 1T33A 3IH2A 2CQXA 2K40A 4Y52J 3HDDA 1TWGJ 4A3GJ 2YS9A 2L9RA 3LNQA 1JT6A 2HI3A 3JRCA 3A02A 1R9TJ 1P7JA 1O4XA 4C3IJ 2ELKA 3TP3A 3S1NJ 4S0HB 4V2GA 1GDTA 3H0GJ 2X9DA 3G1MA 1JKQC 3BR1A 1GT0C 3HOXJ 2HDDA 4C3JJ 2HOTA 1WH5A 1ETVA 2DMUA 2EH3A 2VUMJ 3LSJA 4V2FA 2E1OA 1U9NA 2Y2ZA 2ME6A 1DU6A 5F08A 4DYCA 3H3VK 3OSGA 2HXIA 3G1LA 3BG9A 2LR8A 2VKVA 5GPCA 4GFBA 3S15J 2LP0A 2VKEA 1ZKGA 4FE4A 2PMZN 2M8GX 2NVXJ 2COBA 4DW6A 3GTOJ 1MBGA 1NK3P 2JA6J 1NK2P 4M3FA 1PUFB 1ETXA 2MGQA 2WB1N 1ETYA 3ZOBA 4A93J 5J3LA 1G2HA 2R5YA 2R5ZB 2ID3A 2JMWA 4XRSA 1B8IB 4C2MJ 3S1QJ 2FX0A 2DA7A 4A3CJ 4DYRA 4MO7A 3M3YJ 4Y7NJ 2Y30A 1XS9A 1JJ6C 4X6AJ 2W48A 5C3EJ 3TW7A 3MN2A 2MSYA 5C4JJ 1XC5A 5M5WJ 5J1UA 1JUPA 1HDPA 3GTQJ 1BL0A 5M3FJ 5EZHA 5IOZA 3F0CA 1IUFA 3BTCA 1APLC 4JP0A 2LVSA 3S14J 2X6OA 2R0QC 1VF9A 9ANTA 4I6ZA 2L7MP 2GBYA 1MBJA 5J1RA 2DMTA 2O9LA 1JTXA 4IHWA 1RKTA 3TP0A 1ETQA 1T56A 5F0HA 1WI3A 1H8AC 3B6AA 5IP9J 1I6HJ 5EZGA 3D1NI 1GUUA 3RZOJ 1SFOJ 1PUFA 3IH3A 3LSRA 1CQTA 1WH7A 4M6VA 2M2EA 2E2HJ 3HOYJ 1FIAA 1JGGA 1ETOA 1ZTRA 3ZQCA 2TRTA 4EEFG 5EEAA 2EZLA 3HEFA 3Q0WA 4M3DA 2ID6A 1OFCX 5FKOA 5C44J 1W0UA 1F36A 2L7FP 1JKOC 1JUSA 4UUTA 5IPAA 2CJJA 5GP9A 5IYDJ 1EF4A 4IHYA 4M3GA 3DCFA 4QSHA 1OCPA 2GLOA 2EBIA 5GPAA 4XRSG 1P7IA 4UUSA 4AYBN 1AHDP 1NTCA 1HF0A 2RAEA 5JLWA 2IAIA 2LY9A 4M3EA 4HNVA 2MW8A 4XRMA 3BG3A 2X48A 3GTKJ 3A03A 4DYQA 4L5EA 1IRZA 3JRAA 1MH3A 4A3JJ 3Q0VA 2DA6A 2XGEA 1RETA 2XB5A 1IJWC 3HM5A 1B72B 2E2IJ 1AKHB 4XIDA 2Y0SN 1OCTC 1BW5A 2R93J 3E7LA 3JRDA 4MFDA 1K83J 5FKKA 2AHQA 2FQ4A 2HQ5A 4G12A 4ABZA 2N8GA 3O8GA 3CDLA 3BTIA 4A3EJ 5EGOB 2CUEA 4A3IJ 3DEWA 1MSEC 4BY1J 3GTMJ 4J19A 3ZQHA 1D5YA 2I10A 3S17J 3CQZJ 1ENHA 3BT9A 3IV5A 4A3KJ 2K9QA 2HOAA 4FE7A 2R7ZJ 1F43A 3JRGA 2ZB9A 1DU0A 2CRGA 1YRNB 5FLMJ 3QQAA 3UKGA 4X1EA 1TWCJ 2P81A 4DZPA 1K61A 1IGNA 5J1YA 4W97A 4IHVA 3CMYA 5EF6A 1POGA 2FJ1A 1BJZA 2NVTJ 4AUXA 1B72A 1GVDA 3OOUA 3ZQLA 4C3HJ 5IYBJ 5M5XJ 1ZR4A 3LOCA 1W0TA 3BQZA 1IC8A 4CYCB 1QRYA 3CCYA 4D7MA 1IV6A 1JUMA 5FKMA 2E19A 2XPUA 4BBRJ 3W6VA 5EGOA 1Y1VJ 1TWAJ 1U78A 2H1KA 2K9NA 1QVUA 1MSFC 1ZK8A 2DTZA 1E3OC 5F1JA 4JX6A 4XK4A 3JR9A 3BR3A 4MIMA 1IDZA 3JRFA 2O8KA 2IEKA 2DA3A 3PM1A 4LOCA 2CUFA 2JA5J 1YRNA 2L0KA 1ITYA 2R5ZA 2TCTA 2GM4A 4DZJA 1B8IA 2WAQN 4I76A 4BXXJ 5IOYA 1U8BA 3BQYA 1A6IA 4QIWN 4RDUA 4JX5A 3QPLA 3HGYA 3PO3J 3NARA 3HOVJ 5IYCJ 2HYJA 5FKLA 1MBFA 3O8HA 1H89C 3L1PA 1UMQA 4JX4A 5F0CA 5K7FA 4BBSJ 3HBLA 1IG7A 3S2HJ 2XPWA 2JA8J 2NS8A 1TWHJ 5K7HA 2ME0A 1U9OA 3JRBA 1VFCA 5F0FA 1ZGWA 1I3QJ 1TWFJ 3HOWJ 1MBEA 2MG4A 1VI0A 5E3OA 5C4XJ 1GV2A 5FLVA 3LSGA 2XPVA 1LE8B 3C2BA 5F27A 5JLXA 1WPKA 1MNMC 1I50J 5IP6A 4D5FA 3Q0UA 4NDLA 3VPRA 4B3AA 4BY7J 2XGCA 3BR0A 3TEDA 1FTZA 4AC0A 2JK3A 1FTTA 2JN6A 2EZHA 1XG1A 1AU7A 4MFEA 2IBDA 4A69C 1LFBA 1JTYA 2R5YB 1OJLA 4D5CA 2NVQJ 1FEXA 2QCOA 1JT0A 3QPSA 2DA5A 5DTDA 2XRLA 3S1MJ 2ECCA 3OSFA 3IH4A 3RZDJ 1Z0XA 4W1UA 1MBKA 2FD5A 3PO2J 2L7ZA 2M0CA 4IHXA 1ETWA 5DS9A 1FJLA 3B6CA 2KDZA 2EZKA 2DA2A 3GTLJ 2DN0A 1VNDA 1ZR2A 4JYKA 3WHCA 3GTGJ 5EG0B 4A3DJ 3A01B 1ZQ3P 2EZIA 2XGDA 2JA7J 1QVTA
chains in the Genus database with same CATH superfamily
4G6DA 3TW6A 2DMNA 1IXSB 4N4OB 4E7JA 2AS5F 4ENJA 2V6EA 3FXLA 4XONA 1BC7C 4XNFA 1W4MA 5E8GA 2DT5A 4N9IA 2AXLA 2Y9ZA 3HC7A 1I39A 3CCEI 2DA4A 3QP5A 1JKPC 3ZQIA 4A6DA 2MFZA 4BHBA 2X1CA 1TQPA 3K69A 2M45A 2JTVA 3ULQB 5LBQA 1WGXA 3MCZA 1W36D 2Y31A 4XLHA 2LD5A 4QTRA 2FMYA 4M71A 1Y1WJ 1UZCA 2L9NA 3H35A 3PNTA 2MABA 3DV8A 3K4MA 4HX7A 4M3BA 2DFIA 1R36A 1G3YA 2D1VA 2F5DA 3ZRGA 2CU7A 3JREA 1WSUA 2D5VA 5EJCA 3S1RJ 1GV5A 1RIOH 3OIQA 2BE5F 1QPIA 4CDGA 2E35A 1J75A 1ETKA 2CFOA 4B1RA 2QSFX 1S7EA 2VBWA 1VQ4I 1BOBA 5L3BA 1FYMA 2H8RA 2EB7A 5M3MJ 1I1SA 2ISZA 4DBQA 2JA2A 1F1ZA 3SQNA 1S9HA 4FASD 4HX4A 1X19A 2ZMEC 2XAUA 2XRNA 3NQOA 4BE2A 1X3WB 2WV1A 4ENKA 2ICWG 3MMYB 2LTPA 4KN4X 4BJ5C 1WQ2A 1Z77A 5LFAA 2ECBA 2F6CA 2PX9A 2OZ6A 4JOMA 1T08B 2HTSA 2DDBA 4CA0A 4Q48A 3CCMI 2DPUA 2VE8A 4UV9A 4XMYA 1KQ0A 2L2OA 3H5NA 4ZZDA 4HOBA 1IN7A 2L5QA 5K1YA 1FIPA 2HDWA 2P5LC 4CYCA 3BDDA 4BE1A 3RKQA 2RQPA 1U6GA 3S2DJ 3OIOA 3PNYA 1NHAA 4HX8A 2VOPA 5EDNA 1H9GA 3L2QA 3BZCA 1PJRA 5CVUA 3K1MA 5B5EC 2EQRA 3T0YA 1LFUP 1Z7LA 2IGKA 1HOMA 1KA8A 2RNJA 1HCRA 2F4OB 3SZPA 4EJTA 3FXQA 2DLLA 3M8JA 1Y8RB 2ZCWA 1XTAA 1G4DA 1EH7A 4NQWB 1QHHD 3KEQA 3CC7I 4Y52J 1FOKA 1YIJI 3HDDA 4M6XA 1R49A 1TWGJ 3WTSC 1WKMA 3TGNA 3LNQA 3HRTA 2L9VA 2DO7A 3JRCA 3L2VA 4F55A 1R9TJ 1U8RA 1O4XA 3S3NA 4ENMA 4C3IJ 1YJ9I 3TP3A 4N9HA 5KNLA 1SAXA 2QSGX 3BZKA 3MD2A 1YS6A 1GDTA 3ASOH 3H0GJ 4NNJA 5CQGA 3G1MA 4B09A 5GAGJ 2K4BA 3HZJA 3COAC 3KYLA 2Z33A 5BPIA 1LEBA 1PYVA 3L9FA 2RQQA 1YI2I 3PIPF 4UB8C 1LVKA 2DU9A 4MQVA 5FRNA 2WV0A 5ED4A 3GLLA 4IJAA 4IQ4A 2VASA 1ODDA 2ACJA 3GMEA 3W6KB 3G1LA 4P55A 2WADA 4KT6A 1FWZA 4IVNA 5D5WB 1OISA 4FE4A 3TDUC 1TW2A 2PMZN 3LQQA 2M1BA 3GZ5A 3OYKA 4A12A 4G7ZF 1EH6A 3F9KA 4XR6A 5DEQA 2CV1A 3I58A 4M3FA 4BHPA 1PUFB 1YE9A 1LPQA 2QVOA 4ZDLA 2K85A 5LHGA 3I5UA 5LGUA 1G2HA 2OBPA 2EK5A 2R5YA 3P9KA 3P7NA 2R5ZB 1D0ZA 1T6SA 2CMPA 1SD6A 2DK5A 1Z7UA 3VYSB 3OV8A 1U5TB 1CGPA 4X6AJ 1D1AA 2ZNZA 3CCLI 1USSA 1HW2A 2VQCA 4UY8I 4ZZLA 4I02A 3TW7A 4WCGA 2JRTA 3LA2A 2MSYA 3S93A 4BDZA 5C4JJ 4ZYDA 1XC5A 4L5IA 4ZTFA 5J1UA 1JUPA 3GTQJ 5EZHA 1IUFA 1A6QA 2LVSA 1MDMB 3HKZA 2VB6A 3CUOA 2R0QC 1J09A 3DKWA 4I6ZA 4KYWA 3AG3H 4O3MA 2F5VA 2PMZA 2QWWA 3O3KA 4I0BA 4EV0A 5LHHA 1BJAA 3F6VA 1MBJA 3ABKH 3E3VA 4YIIA 4IHWA 2QQ9A 1RKTA 4LB6B 4XKCA 4ZC3A 3AG2H 5FROA 4ITVA 3PSIA 3FZVA 3RPUA 1WI3A 1R71A 3GO5A 1H8AC 5JHUA 5IT3A 1VQ7I 3JCUC 4QPQA 1MIJA 2P5VA 4FHTA 3W3CA 4HDUA 3D1NI 3OYCA 4Q4ZF 2GOMA 2R7DA 2W00A 4IF4A 3IH3A 3LSRA 1CQTA 3MZYA 3MQ0A 1YITI 3U1DA 4L5JA 3S8PA 3ZQCA 2G7HA 2WBMA 5DD4A 2F5EA 3J7AO 3DFGA 1GVJA 1F36A 1WVRA 3KP7A 1BOAA 4ZYGA 4HV5A 1EF4A 2O8XA 1W5TA 5HNFA 1IZ1A 3S3OA 2ZC2A 1P7IA 4QWQA 4UUSA 4BGDA 2GIVA 3RSNA 4L18B 3MKYB 2LC2A 5E1ZB 4HNVA 4XRMA 2CW0F 2E7XA 2ZBKA 1FSHA 4XLEA 4L5EA 4G7OF 1STZA 3Q0VA 4KDPA 2DA6A 3QAHA 2R3SA 4BUPA 1RETA 3VYUB 1ZRFA 2BGCA 3J81Z 5J8FA 4I7HA 2OAZA 5JR3A 1B72B 3BPVA 2YR2A 2E2IJ 2HYFA 2KISA 3ZGKA 3S32A 2UXNA 3PUFA 5D5UB 2ZJ2A 3V7SA 4DJAA 1W5SA 2GWRA 1OCTC 2J5PA 4MFDA 5FKKA 4HF1A 2FQ4A 2ZXHA 5D4SA 1ZH5A 4G12A 4ABZA 1WFXA 1XGMA 2P7VB 4E4HA 3O8GA 1G3SA 1OCOH 2DJIA 5EGOB 1P6RA 1B1BA 2LKSA 3MZ8A 4A3IJ 3FDYA 1BIAA 1VQNI 2BOLA 3SFZA 3GCMA 1GLNA 3FMRA 2JQ7A 1ACIA 2XAGA 2PBIA 2F2EA 5ILSA 2R7QA 2I10A 2E1NA 4HF2A 3J80Z 3CESA 3BT9A 5F1RA 3LAPA 3MZHA 3WTVC 3QYEA 2HOAA 4RGUA 4HNTA 4U0VA 3V4GA 1IUYA 2ZB9A 4I98B 2CO5A 4X1EA 1N75A 6PAXA 4IHTA 1K61A 4DZPA 1IGNA 3FBNB 5J1YA 2BHZA 3GLXA 4IHVA 2X6XA 3E97A 2JPCA 1X1DA 2IA2A 4RAFA 1FMVA 3HSFA 3OYBA 2W57A 1N77A 2XAFA 3ZQLA 1O7LA 2R7FA 3ZQ7A 3KFWX 2IS4A 2FNPA 1QO0D 5IYBJ 5M5XJ 1FY7A 1ZR4A 1QRYA 5LGTA 3EYYA 3M07A 4G94A 1A04A 2PI0A 2O61A 2XAHA 3LMMA 4IKFA 3MFKA 2F5FA 1D3YA 4XKBA 2HYGD 1E17A 1QVUA 2EFPA 3BP8A 2DW4A 2DK8A 2HPIA 4EJVA 3L2WA 1Y0NA 4IX7A 3DBRB 5HDKA 3MEXA 4JK1X 5E18F 3JR9A 5HLGA 1IDZA 5ICEA 2DA3A 4HNUA 3T8RA 4ANJA 1ITYA 1YRNA 1MNEA 4DZJA 3WTTC 2VXDA 4I76A 3LA7A 3ZMSA 3QODA 2V4JC 1I5ZA 3G2BA 3IP4B 3RYPA 1R00A 3MKWB 3AL0C 1AA7A 2GA1A 2M4GA 4XKVA 2ZKZA 4B47A 2KJCA 4IRGA 3RIRA 2YPRA 3NARA 2OTLI 3A2KA 3HUGB 1OYWA 2A3SA 5IYCJ 2K02A 1N78A 2HYJA 4Y15A 1MBFA 3O8HA 3GVAA 5F0CA 2H6BA 4BBSJ 1T95A 1IG7A 4XSZF 5FGMA 3OYNA 2XPWA 1TWHJ 3EDPA 1OCZH 3SDBA 4EQQA 1J9IA 4XQFA 4L9NA 1I3QJ 4S04A 2K86A 3HOTA 1MBEA 2BY3A 5FLVA 2XPVA 4UVCA 3C2BA 3OOPA 4GGGA 5JI6A 3GUDA 1G8XA 2I8DA 5IP6A 4D5FA 1PUEE 4A0XA 4UV8A 1YX5A 1U2WA 4H0EA 4QPOA 2W7NA 3J7AY 3H5AA 1ZLJA 4AC0A 1FTTA 5DDGA 1XG1A 2E34A 1LFBA 5DV5A 1FEXA 1Z05A 1XN7A 1TQIA 3OSFA 4E7LA 1ONVA 1Z0XA 2FD5A 1ZHFA 2L7ZA 2M0CA 3J7YJ 1ETWA 3RYRA 5DS9A 1LB2A 4IHXA 1FJLA 2DFFA 2EZKA 2DA2A 2V79A 2A61A 4LIVA 4NBQA 2DN0A 2JUCA 4CCKA 5DM7F 4RB1A 2CG4A 4JYKA 1ZR2A 2KIQA 3B02A 3CZ6A 2V26A 3PSFA 4CCLA 1EV7A 3FXUA 4LG3A 1YHQI 3H9QA 4ON0A 2QUFA 2NS7A 4BQOA 2HNHA 1A5JA 3FHNA 2FE3A 2L9SA 4NC8A 3HB9A 4XL9A 1IO2A 1HW1A 1MBHA 1X1CA 4L9TA 2XDVA 3N4MA 4OAYA 2CQKA 3QU3A 1BI1A 1V55H 3BJ6A 4RBOA 1ZG1A 1Q1HA 2HXOA 2LBFA 4GYIA 2Z2SB 4L0YB 3ZN1A 2Y9YA 3HOZJ 2HKOA 4OIOF 1X3UA 4D1QA 2HOEA 3JTHA 3F22A 4TV7A 1AKHA 3PUBA 1TC3C 4FX4A 1T2KA 5J8CA 4B44A 2QQ8A 1P4WA 2CQQA 2K3FA 3BG5A 3HPGA 3R0AA 3V7CA 2Z3YA 3BPXA 1T39A 1R5ID 2ZNYA 3BC8A 2YU9J 5HLHA 1Q1VA 1JHHA 1VQ5I 3GTJJ 3D0SA 5FKNA 4A3FJ 1LDJA 5FFZA 1UELB 1XCBA 3BTLA 1SD7A 1DQUA 5DCMA 4QLCU 4D9JA 3A01A 1K78B 1LJ9A 4PFOA 5DYMA 3SFIA 2DMPA 3K2ZA 3LSPA 2LK2A 3GBGA 2O7OA 1BW6A 3BR2A 4LG0B 3ZQQA 5ILVA 1KU9A 4KICA 2QF7A 1LEAA 3QP6A 4CUGA 4KIFA 3L7WA 4CYDA 1X2MA 3DKYA 5CVJA 2FOKA 2IXSA 4G6QA 3TL4X 3SDGA 1FLIA 5E8IA 2QGUA 1R22A 1HDDC 2DA1A 4BQQA 3K70C 2KIUA 2A05A 2EA2A 1G6NA 2VBZA 3DBLB 4LFUA 4DGWB 4D7NA 3S3MA 2DAOA 1OCCH 1R23A 3DTKA 2O0YA 3K7AJ 1ZRDA 3FIWA 3CCSI 1IV8A 1OCRH 1S3JA 2WY8Q 3VB2A 3VOEA 3G1OA 3EUHC 1YOVB 2LG4A 4HQEA 4N0BA 2HOSA 1EKEA 4KITB 5BS6A 3CC4I 2AQEA 2STWA 1V5GA 2KT0A 3K2AA 1Z91A 1VQKI 2LREA 2ISYA 2RVCA 1X58A 1WJ5A 3FKJA 1W5CC 4AD9A 3OS0A 4BDYA 3VEPA 5FD6A 2R92J 2FF4A 3CJQB 4M74A 5F04A 5BQTA 1MKMA 3J7ZI 2B63J 5HODA 4KISA 3QOPA 1T33A 2OA4A 5HVQC 2JVGA 4B3XA 5TRDA 1MJ9A 3HXLA 1H9TA 1TNSA 4RM3A 4OIQF 1B9NA 3HSEA 4DIQA 1P7JA 2LY2A 3ZCOA 2ELKA 2LY1A 3F72A 2CSOA 2O3FA 3I53A 2IP2A 2ELJA 2A6EF 3ZMTA 1B6AA 5KCMA 5AIQA 2UUZA 3EPZA 4UB6C 2A07F 1Z21A 1KQ8A 1TTYA 2YX4A 2E1MC 2ESNA 3EUAA 2E7WA 3V7RA 2MLGA 1T8IA 3DBHB 5F08A 3H3VK 1BBYA 5D8KB 3WGIA 2IPQX 3P9CA 1O57A 3BG9A 2LR8A 2IGMA 2QLZA 2VKEA 3U2RA 2H94A 2M8GX 2NVXJ 2R7RA 5CLSA 2YX7A 3HHHA 1NK3P 4U0YA 3I56I 2JA6J 2H8WA 2JT1A 1ETXA 1CF7B 2ZFUA 1XGOA 2DFHA 1TZLA 2WB1N 2AQFA 5L3CA 3HRUA 2EFQA 1DGRM 5J3LA 3CMAI 1K6OA 5LHIA 3T1BA 2KDOA 1B8IB 1YJWI 3BJAA 4Y7NJ 2Y30A 3EUHA 3KPHA 2MC3A 4IRHA 3VODA 3U21A 3WODF 4PSWA 2PEXA 3CDHA 3E6DA 5IOZA 1VQ9I 3SXYA 2XAQA 4PJNA 5CYVA 2WWYA 1DDNA 1RUNA 4KMFA 2RGVA 5GTHC 3WGGA 1BC8C 4NHJA 1MMSA 1SEUA 3GWZA 3TO9A 2OUMA 3E5QA 4NUBA 3DEUA 4BXUA 1K6YA 4BS9A 1ETQA 4IHSA 4PJMA 1A35A 1IW7F 2OCCH 3WTZA 5F0HA 3B6AA 4OIRF 5EZGA 3OY9A 1D1BA 3K0LA 3K1NA 2VN2A 3RZOJ 2VQLA 4GDFA 2Q2EB 1TLHB 1PUFA 3OYLA 2CS3A 1IXCA 2BVMA 3AFHA 3D5SC 4ESBA 2EFOA 4Y3OA 2E2HJ 3DEEA 1X1BA 1Z6RA 3RKWA 1HKTA 2W24A 3K4NA 2PJRA 1XDUA 2MBFA 1ZTRA 1KZHA 2TRTA 3ECHA 5TGTA 3KEOA 2CUZA 1HKQA 1MMDA 1MMGA 1HA8A 2EZLA 1XB4A 2ADUA 3DF8A 5K5RA 2XASA 1BI0A 4ZYHA 4RB3C 4YIFA 1FP1D 3D5LA 1USTA 4BH9A 1JUSA 2GXAA 5IYDJ 2EFWA 2E36A 3DCFA 1TT5B 4M3GA 3TOAA 1VQOI 2BEOA 2GLOA 1S7AA 3KYDB 4LLNA 2EBIA 1SVMA 5GPAA 4JBAA 4AU7A 4C30A 4NC7A 4AYBN 4MEXF 4YFXF 2RAEA 2IAIA 2LY9A 2MW8A 1SD4A 3R4KA 3O6BB 3ZXSA 3W6JB 2X48A 3QPHA 1O7FA 2HDCA 2A68F 2ESHA 1FNNA 3A03A 2MD5A 2K3PA 2XAJA 3JRAA 1DP7P 1L0OC 3I64A 4LMYA 1IAWA 1YTYA 1Y8QB 1LKXA 2DODA 5A2QK 1ERDA 5D5VB 2I5UA 2L3DA 2O5RA 3FF5A 4YELA 2R7UA 2Z16A 1ON1A 3ERMA 1QGPA 1BW5A 4UVAA 2R93J 4BE0A 3ASNH 3LSKA 4AIJA 3E7LA 3PFIA 1OLTA 1D5VA 1K83J 4RGRA 3ZMZA 3CP8A 1WI9A 1WJDA 2JSCA 5B1AH 3M8EA 4X0GA 2N8GA 4M6YA 1YIOA 3CDLA 2BHYA 1ZAOA 4AYBA 5IT9Z 2VJ5A 5K5OA 2H27A 3DEWA 1R7JA 4EATA 1MSEC 3E6CC 3GTMJ 1Z3YA 2K5CA 3WE2A 4BJ6C 2D1HA 3DU6A 1R5HA 5E79C 2ZXJA 4KNYA 3HYIA 1T38A 1ENHA 4A3KJ 4FE7A 2R7ZJ 1UHMA 2E5NA 3JRGA 2Z1DA 1YW8A 4EJUA 2QEXI 2COMA 1LDKB 5B3SH 1QHGA 5FLMJ 3QQAA 1X4OA 3H36A 3H9JA 3OYMA 2ZJRF 2GAUA 4GXOA 1VQMI 2KIMA 3CMYA 1RI7A 1UJ8A 2Y75A 5EF6A 5AIPA 2FJ1A 3PQJA 5J4VA 3RI4A 1BJZA 4PCQA 3HRMA 3G4SI 1SMYF 2R7WA 1B72A 2FNAA 1EH8A 2Y0MA 2EINH 3BJOA 1D0XA 2WAEA 1E0EA 3IAS2 3GFIA 3LOCA 1W0TA 3BQZA 4AIHA 1IC8A 2JVHA 4CYCB 1XMKA 5E1XA 4B48A 3CCYA 1IV6A 4BEHA 5FKMA 4HBLA 2L54A 2ZSHB 3LSIA 3H92A 4G7HF 3W6VA 2NS0A 1K7AA 5EGOA 3FM3A 4B43A 1Y1VJ 2HQRA 3FXKA 2MH9A 1S5LC 2FU4A 3DU5A 1W7PD 1E3OC 2DTZA 4HYEA 4F7ZA 3QPTA 2HPMA 1YG2A 3SYTA 4RM2A 5K5QA 4XK4A 3QYBA 3BR3A 1KQ9A 3BCAA 2V1NA 3JRFA 2IEKA 2XUBA 4CZZA 3DWLE 2O8KA 1MMAA 2CUFA 2JA5J 1WWXA 4M9XA 3JSPA 2TCTA 2GM4A 4HA8A 2OU2A 2DOFA 3L2CA 5AONA 2VJ4A 1WHUA 1A36A 4BXXJ 1X1PA 1U8BA 2QSHX 1HW5A 3BQYA 1WJAA 3HL2A 4RDUA 1TW3A 3K4CA 3HGYA 2W82A 1FBQA 3X2QH 3CC2I 4CGZA 4MNUA 4XKWA 2X6WA 1H89C 3KP2A 2E5ZA 4JX4A 4E7ZA 5K7FA 1Y39A 3S2HJ 1KU2A 3AG4H 2E60A 2NS8A 5K7HA 1TT0A 3F8MA 1VFCA 4XLCA 2C6YA 2MLKA 2M0MA 4M9SA 4ENNA 2DXIA 5KAIC 3R6SA 3HOWJ 2MG4A 2L7KA 1VI0A 5B1BH 3LL7A 1GV2A 1OQYA 3CMEI 2K9LA 2QQAA 1LE8B 5F27A 2ZMEB 4HQMA 4YEJA 2QA4I 4B8XA 1XSDA 1MZBA 4NDLA 3GF2A 3OYHA 5H20A 3TEDA 4U0WA 4RA2A 2V7FA 3ZMDA 2VODA 3R0JA 2QBYA 3K4BA 4K2EA 5J6XA 2HWVA 2R5YB 4BU2A 1JTYA 2VL8A 4MTDA 4PZJA 2NVQJ 2A5WA 1JT0A 5DTDA 1ZRCA 1HSTA 2Q8KA 4MTEA 2CW8A 3H3UA 4L0ZB 4ZYEA 3D5RC 3M8FA 2HFHA 3KP4A 4W1UA 1MBKA 2OQRA 3TBIA 3ML6A 3CDIA 3BWGA 2CFXA 3B6CA 2BV6A 3K70D 1IN6A 4CCJA 1AWCA 2M3AA 3I3LA 3CO6C 5GAHJ 2EIMH 2LNBA 3HUGA 3OL3A 5EG0B 4A3DJ 1ZQ3P 2NXNB 2XHKA 3IAM2 1ZARA 4CHUA 3S14J 4U87A 5E17F 1R58A 5L3DA 1S6LA 1KGSA 2LKXA 4O6JA 4Q47A 2K7LA 3IWZA 4ZDPA 4XOPA 4XICA 3GYHX 3F6OA 5HLIA 2K27A 3QOEA 3ZPLA 3E5XA 4A3BJ 3TO6A 3KETA 2LLKA 1Z1DA 2EPFA 4II3A 4FCYA 1MMNA 4BL0B 1ORKA 2OJED 3LAJA 4L9VA 1AOYA 3C1DA 4PJJA 2BXZA 2VI6A 3HOUJ 2KHMA 2EWNA 2IA1A 1QPMA 2WY7Q 2VT2A 4OIPF 1LDDA 1YW7A 2P6SA 2PMHA 4EM0B 3SZGA 5E3MA 1OMIA 1J0RA 5EYRA 3ZQFA 5IP7J 1YX3A 2IW5A 2VXZA 4WK8F 3OIPA 3C2GA 1RRJA 3GX4X 4LB5A 3IKTA 3KZYA 3HGGA 2BY1A 4MGRA 2EIJH 1XPXA 1JJ8C 5CKTA 5D4RA 3S16J 2ZFWA 2EV0A 3BTJA 2PFBA 2HTJA 3GFJA 4UHTA 1GHCA 1R6RA 3VSKA 1UHSA 1ZG5A 2VIXA 2KMUA 5F6FA 3WGHA 1JGSA 3CJRB 4YIRX 3T5XA 3CUQC 4F92B 4UUSB 2P0WA 2H09A 1MW7A 2X1EA 2E2JJ 2L4MA 4GO1A 2DT6A 4C2UA 3BOQA 1UG2A 3FXJA 1MH4A 1V3FA 1HLVA 1DPRA 1TQMA 3UR3C 2IT0A 3Q3SA 1N25A 3RCOA 2IS1A 4MLOA 1OPCA 4AIDA 2STTA 1IN4A 3BCBA 4I09A 4ESJA 2AXTC 1K4SA 3F8BA 2EFNA 3WTXC 2KZVA 3PFYA 2LF7A 4BHCA 1PDNC 1HQCA 1EA3A 3NAUA 5M5YJ 3AKZA 2HZTA 2JZYA 2AO9A 1SAUA 3FK6A 4UVBA 3CCJI 3JSOA 1K79A 3CD6I 5JVTA 5BNGA 1KONA 3OR1C 3BROA 4CZCA 2VPRA 3WG7H 1O3TA 2BW3B 3I4MJ 2GXGA 4IEJA 2R7OA 5KHDA 4XBFA 1B59A 3V8JA 2Z5UA 1VQ6I 2M4KA 3FM5A 3OYFA 2A6TA 4HPQA 2XSDC 3C7JA 1BA5A 4ESFA 4XRFA 2FSWA 3RQ4A 5HDNA 4FISA 1RUOA 5K7ZA 2HVQA 4AWXB 1RESA 4A3MJ 1VZ0A 3QRFF 3A0BC 2OTJI 3IH2A 2CQXA 2W85A 3JW4A 4LG0A 1M1EB 4PGGA 3HHGA 1MNDA 3FX3A 2PLYA 3CCUI 5LD2C 2YS9A 2L9RA 1FC3A 2IA0A 1SC7A 3ABMH 3A02A 1FYLA 4PK4A 2ZO4A 2ZJPF 1REPC 4OMZA 4HAMA 3CCVI 1F4KA 4BXFA 4S0HB 1YO5C 4OWRB 2P4WA 4V2GA 4Z2YA 2CV0A 4LJZF 2X9DA 1JKQC 4PUSA 1OKRA 3BR1A 1GT0C 5H2FC 3HOXJ 4C3JJ 2HOTA 1WH5A 4WXDA 3KP5A 2EH3A 2VUMJ 1BR1A 1MGTA 3CUQA 4BAYA 2E1OA 2RNGA 1U9NA 2ME6A 1DU6A 2R7TA 4DYCA 5J40A 4F3QA 2HXIA 4NC6A 2ZJQF 5CQEA 4GFBA 2JRMA 2X51A 2VKVA 4KFCA 3MKZA 1ZKGA 1LNWA 4H4KC 2COBA 4DW6A 1HKSA 3CLOA 1YW9A 3H0DA 3JAMZ 5LRSA 2ZXWH 2JUGA 1WJEA 3L2RA 2UZKA 1ULYA 2MGQA 1ETYA 4A93J 4AVZA 2VBYA 1Z3XA 3CTAA 2M30A 1F5TA 4XRSA 2VC0A 4C2MJ 2FX0A 2DA7A 4ZYAA 3T8TA 4MO7A 3M3YJ 3Q9SA 2V9PA 1JJ6C 3WU0A 5DM6F 3O2PE 3RPUD 3I55I 5C3EJ 3NRVA 1OR7C 4P9FA 1KU7A 3GZ6A 3MN2A 4EMSA 5HS7A 5CVVA 5M5WJ 3IRRA 1HDPA 3SEQA 1ON2A 5M3FJ 2FBHA 1DPUA 2XIGA 4O5VA 2X6OA 9ANTA 1KYWA 4II2A 3A0HC 2GBYA 4EJOA 5J1RA 2DMTA 2O03A 3ELKA 2IVMA 2O9LA 1JTXA 3OWTA 4JQFA 2KL4A 3MAJA 1R4NB 4G9YA 3TP0A 1IRXA 2GQQA 3DQVC 3GFMA 1Y56A 3GW2A 4HG2A 4FX0A 1ZLKA 3KCCA 1T56A 2FMLA 2NVUB 4EGYA 1I6HJ 1E3PA 1P9QC 1GUUA 3NEUA 3RKXA 2NYXA 3PL8A 4WF2A 3HSRA 1CF7A 2M2EA 2FRHA 4IPAA 3HOYJ 4ZH4F 4PGHA 3W2VA 2VKDA 4PDKA 1Z9CA 3DP7A 3MWMA 1FMWA 4RMNA 3BG6A 1QZZA 4EEFG 3M1EA 3F23A 5EEAA 3HG9A 4M9ZA 3A1YA 4KJZA 4A6EA 2V9KA 1OFCX 2LYCA 2VONA 1L3LA 3U1KA 1FP2A 2F4MB 2IGOA 2L7FP 3AG1H 4LGWA 1W0UA 1JKOC 4F91B 3FHZA 5KAFC 1RZ4A 5IPAA 2CJJA 2X0LA 5GP9A 1XSXA 2H1LA 4LK1F 3H3ZA 4XRSG 3WTUC 3WTYC 3KP3A 4KUMA 1AHDP 1NTCA 1HF0A 2BYVE 3N05A 3I59B 5JLWA 4M3EA 2D45A 4HSRA 2KJBA 4Y17A 3LSMA 1MH3A 1FBUA 3ZMVA 1OR7A 1JI8A 3HJEA 1IRFA 4KT5C 5FLXZ 2XB5A 1BI2A 3WG9A 3AL0B 1IJWC 2Q2EA 4EM2A 1QQIA 2XSJC 3KLOA 2HVRA 1MD0A 1AKHB 4XIDA 3FWEA 2Y48A 2VJIA 4GRIA 3KIOA 1U5TC 2Y0SN 1YS7A 2M5WA 3JRDA 1DP3A 2L01A 4ETSA 3BZ6A 2IS6A 2RDPA 2HS5A 2XF5A 4M72A 2XKPA 1W1WE 2DYRH 1E3HA 4A3EJ 2CUEA 1TL8A 5CJ9A 4BY1J 1D0YA 3K1PA 4J19A 3GFLA 5GTIC 1YJNI 2QZ8A 2DQRA 3IKVA 1D5YA 3S17J 3CQZJ 5FO5A 4NQWA 4C9YA 1DU0A 3FXMA 4P96A 2QYOA 2DFEA 4E7HA 1FPQA 2PG4A 3UKGA 3F8CA 5FD5A 1LVAA 2DYSH 2JPBA 2P81A 2M87A 1T0FA 2CH0A 2P5KA 2RREA 2Y0SA 2IRFG 4HDVA 4UUVA 3KZIC 1YLFA 1POGA 2V6CA 5L3FA 1TNTA 4AUXA 2CWEA 2R4GA 3FXRA 3G71I 1WJFA 3BG7A 4CCNA 1V5EA 1W7PB 1HXDA 2B9SA 2QENA 4DBRA 1QZYA 4WWCA 1S29A 2F5CA 3CO7C 4IRIA 3CCRI 4D7MA 2IGNA 2DOAA 3IL2A 5TJJA 2XPUA 4I2OA 1IN8A 2WB1A 3W2AA 1SFUA 5IT9K 1P4AA 3G6EI 1U78A 2KLOA 3F8NA 2H1KA 3E6MA 1UCRA 2FA5A 2K9NA 4HV6A 4MHGA 5F1JA 4JX6A 2V1XA 5TISC 4XM3A 4V19K 4MIMA 2XC7A 2P8TA 5H6RA 3PM1A 4R79A 3CMMA 3I4PA 4BACA 2R5ZA 3OYGA 3AAFA 1QU3A 1BIBA 2PQ8A 2WAQN 4HLYA 1VQ8I 1U5TA 4U88A 1ZGJA 2E1CA 2BY0A 4E7KA 2KPMA 3G3ZA 1ZN2A 4JX5A 4PFPA 5F64A 3QPLA 1IN5A 4YFKF 2XGXA 3PO3J 1PVEA 1S7OA 1XGSA 3HOVJ 2MH2A 3SZTA 4KIGA 2FQ3A 5BPDA 1MDMA 3ESWB 3CP2A 3PQKA 3DPTA 4A5MA 3HBLA 3B73A 4BQNA 2Z9OA 1UB9A 3EYIA 2JA8J 3WU1B 1R1VA 1U9OA 1TP4A 2ME0A 4F93B 2M7BA 1QZEA 3E1SA 1H0MA 5E3OA 1KYZA 4RLQA 3LSGA 3LWFA 5L3GA 4EVIA 5JLXA 1WPKA 4BJTA 1MNMC 3DPLC 1I50J 2WAQA 3OYEA 1Y0UA 2FEZA 3LFKA 3Q0UA 4XLNF 2CGPA 2L4AA 4B3AA 2XGCA 4ZDOA 1DUXC 3OYDA 2WAFA 1FTZA 2RKHA 3M7GA 2MC4A 2JN6A 3EETA 2EZHA 2CQ7A 3ERED 4MFEA 1I1GA 2RC4A 2IBDA 4A69C 2VOOA 2XVCA 1HC8A 1XDSA 4HSTA 5KK1A 2QCOA 3Q5FA 2XF7A 4OU0A 1S8NA 2XRLA 4CSWA 3S1MJ 1DGWY 2ECCA 3IH4A 3LFUA 4F52A 4XN3A 4G8XA 4C2TA 2KDZA 2V1DA 2LF8A 3GTLJ 2FBIA 1T98A 3K4JA 1KU3A 3P9IA 1VNDA 2QKMB 2P7CB 2NRAC 2HU9A 1SFKA 2XKOA 2DDAA 2KRHA 5JVGF 2XGDA 2JA7J 2UXXA 1QVTA 5FJ8J 3BLYA 2KQRA 2JSPA 4PSXA 3C18A 3SHFA 3IHUA 5LEJA 2NOGA 1G59A 1SVOA 4MQ9F 5GADJ 2NNYA 2OQGA 4A3LJ 1IRGA 3HKZN 2XB0X 1JKRC 1LE8A 2ZMEA 2W84A 3HTSB 3MKLA 2R7XA 4AIKA 4YG2F 3REOA 1QNTA 2F48A 4FT8A 2LFBA 3KX2A 1UG0A 2J5OA 2B7EA 3J81K 1RC9A 2DMQA 4XLAA 1H88C 4S05A 4IL6C 5E3LA 2Q0OA 2M9HA 3SJMA 3F8FA 1SMTA 4U7BA 3WHBA 2XF6A 2CQNA 4OMYA 3I4NJ 2PJRB 2W1OA 2Q1ZB 3BR6A 3C3WA 3ZQGA 3RJPA 4XOTA 1RKWA 2E1MB 2Z99A 4RGSA 1FOWA 2YUSA 5CVIA 2DTRA 4CO8A 2BZTA 5FRMA 4BKXA 2A69F 2M34A 3I71A 3R60A 2W25A 3GEZA 1V54H 5D6FA 5EG0A 4I99C 3DLLF 2HQAA 2NVYJ 1IDYA 2DJNA 4Y4RA 1YYVA 2X1DA 3J80K 1R1TA 2E71A 3BR5A 3SEZA 4RGXA 4RAYA 5J4YA 3GTPJ 2G0EA 1WJCA 3RQIA 2G7UA 3JRIA 1XSVA 1RPWA 2D2WA 2VT3A 3I54A 3FK7A 5E3NA 2DBBA 3S2WA 2HVSA 3CCQI 5A2QZ 2A6HF 2KZGA 3HIFA 4LLLA 4RB2C 2JJ7A 3N97A 3FISA 1SFEA 3ISPA 3C2HA 1LFPA 1SANA 2JWTA 3FKIJ 3FXOA 5ILUA 5LEKA 3U9GA 2BBYA 4EJWA 2L02A 2R7SA 4CCOA 2B0LA 5FFXA 3TMOA 4R1HA 1O3SA 4B4CA 2VJJA 3UNGC 1OYYA 2K9MA 1I6XA 3KP6A 1BI3A 1X2NA 1HSJA 1E2XA 3MVPA 1RR7A 2ELHA 2K9SA 3JRHA 1WCMJ 3M9AA 4A0YA 1W36C 2OPTA 3K10A 4FTHA 3M4OJ 3HPHA 3OYIA 2OF7A 3DLAA 3RKYA 4Y13A 4XLFA 3CJNA 2K40A 1WZ2A 2VKHA 2HZDA 4HEA2 5ICFA 5CVRA 1FOXA 4GYGA 4BNCA 4A3GJ 4G6TB 5EEHA 1JT6A 2HI3A 4CICA 3LQRA 1BN5A 1TBXA 5DD8A 1FBSA 3WU2C 1GXPA 3S1NJ 1X4PA 4U7DA 4GCVA 3M1CA 2EV5A 2BVLA 3KLNA 3IWFA 2A5YB 2HDDA 2YU3A 2RN7A 1YQAA 2W4SA 3E0JB 1ETVA 2DMUA 3IRQA 2DOEA 3LSJA 4V2FA 4XSXF 2Y2ZA 4BEHB 3R61A 2KFDA 4IZZA 1O3RA 3OSGA 3ZN0A 2BW3A 3ABLH 4HF0A 4E70A 2PJPA 2UWMA 2EJRA 5GPCA 3S15J 1D8KA 2IJLA 2LP0A 4ZTJA 4J01A 4PJLA 1HBXG 2VQHA 1K4TA 3GTOJ 2WTEA 1MBGA 4IXAA 1VQPI 1R1UA 2CYYA 3L00A 1P92A 5JHFA 4NB5A 5ICGA 3IC7A 2DT7B 2XROA 1NK2P 2M7AA 4EGZA 2F4IA 1G3WA 4MEYF 3ZOBA 2LOOA 5DCFA 3HRSA 2ID3A 2EIKH 2JMWA 4AM3A 3S1QJ 2QM3A 3GZNB 4A3CJ 4DYRA 1Y6IA 1SVLA 1XS9A 2LMDA 2K4JA 1FX7A 2W48A 4IQJA 4DOZA 5DUKA 4Q5SF 3A4CA 4L9JA 4ASNA 5D6EA 3OYJA 1J7KA 1BL0A 2Y69H 2MYSA 3F0CA 3BTCA 1JE8A 4JP0A 3EQLF 4XLPF 1APLC 1FOYA 2TDXA 1P2FA 1VF9A 3BY6A 2HR3A 2CV2A 3DTEA 2L7MP 3RTRA 5HS8A 1G3TA 4HLXA 2FXAA 1B9MA 1YFHA 3DTIA 2GIZA 2WA0A 5LRRA 4DQ2A 1I27A 3I0TA 1J2XA 3RPQA 3TOBA 4DNCA 2O6GE 5IP9J 1PP8F 2OCEA 2LDUA 2P6TA 1XCVA 4WXCA 4KA4A 3E5UA 3GXOA 4D0PA 2GA2A 2G9WA 4E7SA 3JAMK 1Z67A 1O3QA 1SFOJ 2KIFA 1WH7A 4M6VA 1X3ZB 2FUG2 1R5GA 3KEYA 1VQLI 1J5YA 2IS2A 2QBYB 3CF2A 2PMUA 1FIAA 1JGGA 1ETOA 3WTWC 1F9NA 2VC1A 5CPRB 3HEFA 3Q0WA 1S72I 4E7IA 4M3DA 2PN6A 1JHFA 2ID6A 5FKOA 3G73A 1XX5A 2KKOA 3FMQA 5C44J 2ETHA 3KE2A 1P4XA 3OS2A 2DQLA 5J47A 3VWBA 3ZR8X 4LITA 4UNOA 4UUTA 1ZGAA 2X85A 2XV4S 3PJRA 4HZFA 4IHYA 1U3EM 3TKYA 4QSHA 1OCPA 4XORA 2NAZA 3JTGA 1K78A 5HOOA 1SD5A 3LA3A 2GOXB 2H6CA 4R8HA 5JFRA 5L3EA 3DXJF 3H9GA 1UAAA 2DI3A 2V9VA 3BG3A 2OV7A 4FQGA 1UFMA 3GTKJ 4DYQA 3ZP5A 1IRZA 2M8EA 2WC2A 2CUJA 2QQBA 2NOJB 4FETA 4LIUA 4LLGF 1ZELA 5LGNA 4A3JJ 2VQGA 4P9UA 1MJBA 4YRVA 2V1UA 2XGEA 2KRFA 2KRCA 4WX9A 1I3AA 2MD0A 5D8LB 2RV8A 3HM5A 2HQNA 3OR2C 5KVRA 1NH3A 4A0ZA 3VYTB 2QKLB 4I0AA 5IY5H 3LSTA 2HGCA 3CLQA 3P5JA 2AHQA 2EV6A 1J59A 2HQ5A 3OS1A 4KIBA 2MA3A 3K4KA 3BTIA 3Q9VA 5HNHA 5E1WA 4CXFA 2BXYA 5DUIA 2ZSIB 1WRJA 3F3XA 3ZQHA 1D1CA 3VFZA 1JXSA 4HRIA 2YSRA 1A31A 3K6GA 4P1WA 1WJBA 1BR2A 3IV5A 2K9QA 1F43A 1BR4A 3WE3A 3L09A 4XN0A 4IOAF 2CRGA 2HEOA 3I59A 1YRNB 4RAGA 1C0WA 4ZJZA 1XD7A 3ECOA 1TWCJ 3OL4A 5ERIA 3H1CA 2ZXIA 4YFNF 3NWSA 4W97A 1XGNA 2X4HA 3DKXA 1B4AA 1FT9A 3ABTA 4Z6YA 3QU6A 3V8LA 3ABUA 2NVTJ 5FLXK 4E6KG 1FZPB 4KN7X 2OZUA 1GVDA 3OOUA 1VTNC 4C3HJ 1SFXA 3ONQA 4RLFA 4KMUX 3DPUA 3FMSA 2R7VA 1BM9A 1U0JA 3TQNA 3PIOF 4WXHA 4CCMA 1ZYRF 1JUMA 3FBIB 2CW7A 2E19A 1X1AA 1GXQA 4M73A 4BBRJ 2LH9A 2FOWA 3RDIA 3TDZC 1TWAJ 2OD5A 3EUKL 1LUJB 1IF1A 1MSFC 2VLAA 1ZK8A 3HOSA 1D8JA 1QA6A 3F21A 4A5NA 2GZWA 1XMAA 2LRDA 1NG7A 5BOXA 5D5XB 4LOCA 3ZMUA 2LKPA 2X6YA 2L0KA 3K9TA 4RB0A 5FB2A 1QBJA 4CH7A 1B8IA 5E20A 5BMZA 1T0FC 4RS8A 1FSEA 5IOYA 2HKXA 3CJTB 5EEGA 2LSOA 1A6IA 4QIWN 2DCEA 2BY2A 2KP6A 2GXBA 4Y33A 3HTUA 3I9V2 3V8KA 4PJ0C 4IOCF 2NNNA 1W7PA 1V5FA 4HW0A 5FKLA 1FYKA 3W2WA 3L1PA 1OYIA 1UMQA 3KZZA 4UXNA 5HLTA 2FBKA 3CF5F 3OMYA 5H6QA 3CUQB 3PNVA 4LD5A 3JRBA 4LK0F 5F0FA 3NWTA 1ZG3A 1ZGWA 4BQAA 1TWFJ 5HDGA 1XMXA 3KYCB 4AVPA 3IUOA 5C4XJ 3K4LA 5LLQA 1R4MB 1UHWA 5GAEJ 2EILH 1NG6A 2VBXA 3VSLA 2LBFB 3V42A 3H5RA 2VPLA 1IXRC 3ROUA 3VPRA 2DPDA 3QWLA 4BY7J 3BR0A 2OC6A 4OINF 4A2UA 2JK3A 3TO7A 1RR8C 4RAZA 4OAZA 1ZREA 1AU7A 4EM1A 4P5OA 1OJLA 3LSHA 4D5CA 4BYYA 1V4RA 4J00A 1MJAA 3QPSA 2DA5A 4I01A 1PP7U 3VYRB 3QYFA 1EJ9A 3RZDJ 2EA4A 4N4NB 1Z6TA 3PO2J 3L2UA 5HS9A 1LQ1A 3VDXA 2UV1A 4IO9F 3GTGJ 3WHCA 5DCMB 3E6BA 4OOIA 3A01B 2EZIA 1RNLA 5ICCA 3OYAA 2VE9A 5B66C
chains in the Genus database with same CATH topology
3TW6A 5FJ8J 2DMNA 2NS7A 2LKXA 1A5JA 2NOGA 4XICA 3HB9A 4A3LJ 2Y9ZA 1MBHA 4A3BJ 3HKZN 2LLKA 4FCYA 4RBOA 2XB0X 1JKRC 1LE8A 2DA4A 1JKPC 2HXOA 1ORKA 3ZQIA 2VI6A 3MKLA 3HOUJ 2Y9YA 3HOZJ 1WGXA 2LFBA 2Y31A 2LD5A 2DMQA 4QTRA 1H88C 1Y1WJ 5E3LA 1AKHA 1TC3C 2M9HA 3SJMA 5E3MA 3WHBA 3I4NJ 5EYRA 2CQQA 3BG5A 4M3BA 3ZQFA 5IP7J 3ZQGA 3BR6A 3JREA 1RKWA 2CU7A 2YU9J 2YUSA 2D5VA 1Q1VA 3HGGA 3GTJJ 3S1RJ 4BKXA 1GV5A 5FKNA 4A3FJ 2M34A 1JJ8C 1QPIA 3S16J 1ETKA 3BTLA 3BTJA 5EG0A 4B1RA 3A01A 2NVYJ 1IDYA 1UHSA 2DJNA 1S7EA 3SFIA 2DMPA 3LSPA 4UUSB 2LK2A 3GBGA 2H8RA 2O7OA 2E2JJ 5M3MJ 1BW6A 3BR5A 3BR2A 1UG2A 3GTPJ 1MH4A 2QF7A 2G0EA 1HLVA 3RQIA 3JRIA 3Q3SA 1RPWA 1X2MA 4MLOA 3SDGA 2WV1A 3FK7A 5E3NA 2LTPA 1HDDC 2DA1A 1Z77A 2ECBA 4D7NA 3NAUA 5M5YJ 2JJ7A 2AO9A 3FK6A 3K7AJ 3FISA 3FIWA 1SANA 2JWTA 3FKIJ 5BNGA 1FIPA 3G1OA 4CYCA 3RKQA 3S2DJ 3OIOA 2HOSA 2VPRA 5EDNA 4B4CA 3I4MJ 4IEJA 2EQRA 1X2NA 2KT0A 3K2AA 3MVPA 1RR7A 1LFUP 2K9SA 3JRHA 1HOMA 1X58A 1WCMJ 2XSDC 1HCRA 2R92J 1BA5A 2OPTA 5F04A 4FTHA 3M4OJ 4FISA 5HODA 2B63J 5K7ZA 2OF7A 1RESA 4A3MJ 1T33A 3IH2A 2CQXA 2K40A 4Y52J 3HDDA 1TWGJ 4A3GJ 2YS9A 2L9RA 3LNQA 1JT6A 2HI3A 3JRCA 3A02A 1R9TJ 1P7JA 1O4XA 4C3IJ 2ELKA 3TP3A 3S1NJ 4S0HB 4V2GA 1GDTA 3H0GJ 2X9DA 3G1MA 1JKQC 3BR1A 1GT0C 3HOXJ 2HDDA 4C3JJ 2HOTA 1WH5A 1ETVA 2DMUA 2EH3A 2VUMJ 3LSJA 4V2FA 2E1OA 1U9NA 2Y2ZA 2ME6A 1DU6A 5F08A 4DYCA 3H3VK 3OSGA 2HXIA 3G1LA 3BG9A 2LR8A 2VKVA 5GPCA 4GFBA 3S15J 2LP0A 2VKEA 1ZKGA 4FE4A 2PMZN 2M8GX 2NVXJ 2COBA 4DW6A 3GTOJ 1MBGA 1NK3P 2JA6J 1NK2P 4M3FA 1PUFB 1ETXA 2MGQA 2WB1N 1ETYA 3ZOBA 4A93J 5J3LA 1G2HA 2R5YA 2R5ZB 2ID3A 2JMWA 4XRSA 1B8IB 4C2MJ 3S1QJ 2FX0A 2DA7A 4A3CJ 4DYRA 4MO7A 3M3YJ 4Y7NJ 2Y30A 1XS9A 1JJ6C 4X6AJ 2W48A 5C3EJ 3TW7A 3MN2A 2MSYA 5C4JJ 1XC5A 5M5WJ 5J1UA 1JUPA 1HDPA 3GTQJ 1BL0A 5M3FJ 5EZHA 5IOZA 3F0CA 1IUFA 3BTCA 1APLC 4JP0A 2LVSA 3S14J 2X6OA 2R0QC 1VF9A 9ANTA 4I6ZA 2L7MP 2GBYA 1MBJA 5J1RA 2DMTA 2O9LA 1JTXA 4IHWA 1RKTA 3TP0A 1ETQA 1T56A 5F0HA 1WI3A 1H8AC 3B6AA 5IP9J 1I6HJ 5EZGA 3D1NI 1GUUA 3RZOJ 1SFOJ 1PUFA 3IH3A 3LSRA 1CQTA 1WH7A 4M6VA 2M2EA 2E2HJ 3HOYJ 1FIAA 1JGGA 1ETOA 1ZTRA 3ZQCA 2TRTA 4EEFG 5EEAA 2EZLA 3HEFA 3Q0WA 4M3DA 2ID6A 1OFCX 5FKOA 5C44J 1W0UA 1F36A 2L7FP 1JKOC 1JUSA 4UUTA 5IPAA 2CJJA 5GP9A 5IYDJ 1EF4A 4IHYA 4M3GA 3DCFA 4QSHA 1OCPA 2GLOA 2EBIA 5GPAA 4XRSG 1P7IA 4UUSA 4AYBN 1AHDP 1NTCA 1HF0A 2RAEA 5JLWA 2IAIA 2LY9A 4M3EA 4HNVA 2MW8A 4XRMA 3BG3A 2X48A 3GTKJ 3A03A 4DYQA 4L5EA 1IRZA 3JRAA 1MH3A 4A3JJ 3Q0VA 2DA6A 2XGEA 1RETA 2XB5A 1IJWC 3HM5A 1B72B 2E2IJ 1AKHB 4XIDA 2Y0SN 1OCTC 1BW5A 2R93J 3E7LA 3JRDA 4MFDA 1K83J 5FKKA 2AHQA 2FQ4A 2HQ5A 4G12A 4ABZA 2N8GA 3O8GA 3CDLA 3BTIA 4A3EJ 5EGOB 2CUEA 4A3IJ 3DEWA 1MSEC 4BY1J 3GTMJ 4J19A 3ZQHA 1D5YA 2I10A 3S17J 3CQZJ 1ENHA 3BT9A 3IV5A 4A3KJ 2K9QA 2HOAA 4FE7A 2R7ZJ 1F43A 3JRGA 2ZB9A 1DU0A 2CRGA 1YRNB 5FLMJ 3QQAA 3UKGA 4X1EA 1TWCJ 2P81A 4DZPA 1K61A 1IGNA 5J1YA 4W97A 4IHVA 3CMYA 5EF6A 1POGA 2FJ1A 1BJZA 2NVTJ 4AUXA 1B72A 1GVDA 3OOUA 3ZQLA 4C3HJ 5IYBJ 5M5XJ 1ZR4A 3LOCA 1W0TA 3BQZA 1IC8A 4CYCB 1QRYA 3CCYA 4D7MA 1IV6A 1JUMA 5FKMA 2E19A 2XPUA 4BBRJ 3W6VA 5EGOA 1Y1VJ 1TWAJ 1U78A 2H1KA 2K9NA 1QVUA 1MSFC 1ZK8A 2DTZA 1E3OC 5F1JA 4JX6A 4XK4A 3JR9A 3BR3A 4MIMA 1IDZA 3JRFA 2O8KA 2IEKA 2DA3A 3PM1A 4LOCA 2CUFA 2JA5J 1YRNA 2L0KA 1ITYA 2R5ZA 2TCTA 2GM4A 4DZJA 1B8IA 2WAQN 4I76A 4BXXJ 5IOYA 1U8BA 3BQYA 1A6IA 4QIWN 4RDUA 4JX5A 3QPLA 3HGYA 3PO3J 3NARA 3HOVJ 5IYCJ 2HYJA 5FKLA 1MBFA 3O8HA 1H89C 3L1PA 1UMQA 4JX4A 5F0CA 5K7FA 4BBSJ 3HBLA 1IG7A 3S2HJ 2XPWA 2JA8J 2NS8A 1TWHJ 5K7HA 2ME0A 1U9OA 3JRBA 1VFCA 5F0FA 1ZGWA 1I3QJ 1TWFJ 3HOWJ 1MBEA 2MG4A 1VI0A 5E3OA 5C4XJ 1GV2A 5FLVA 3LSGA 2XPVA 1LE8B 3C2BA 5F27A 5JLXA 1WPKA 1MNMC 1I50J 5IP6A 4D5FA 3Q0UA 4NDLA 3VPRA 4B3AA 4BY7J 2XGCA 3BR0A 3TEDA 1FTZA 4AC0A 2JK3A 1FTTA 2JN6A 2EZHA 1XG1A 1AU7A 4MFEA 2IBDA 4A69C 1LFBA 1JTYA 2R5YB 1OJLA 4D5CA 2NVQJ 1FEXA 2QCOA 1JT0A 3QPSA 2DA5A 5DTDA 2XRLA 3S1MJ 2ECCA 3OSFA 3IH4A 3RZDJ 1Z0XA 4W1UA 1MBKA 2FD5A 3PO2J 2L7ZA 2M0CA 4IHXA 1ETWA 5DS9A 1FJLA 3B6CA 2KDZA 2EZKA 2DA2A 3GTLJ 2DN0A 1VNDA 1ZR2A 4JYKA 3WHCA 3GTGJ 5EG0B 4A3DJ 3A01B 1ZQ3P 2EZIA 2XGDA 2JA7J 1QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW6 A;  5FJ8 J;  2DMN A;  2NS7 A;  2LKX A;  1A5J A;  2NOG A;  4XIC A;  3HB9 A;  4A3L J;  2Y9Z A;  1MBH A;  4A3B J;  3HKZ N;  2LLK A;  4FCY A;  4RBO A;  2XB0 X;  1JKR C;  1LE8 A;  2DA4 A;  1JKP C;  2HXO A;  1ORK A;  3ZQI A;  2VI6 A;  3MKL A;  3HOU J;  2Y9Y A;  3HOZ J;  1WGX A;  2LFB A;  2Y31 A;  2LD5 A;  2DMQ A;  4QTR A;  1H88 C;  1Y1W J;  5E3L A;  1AKH A;  1TC3 C;  2M9H A;  3SJM A;  5E3M A;  3WHB A;  3I4N J;  5EYR A;  2CQQ A;  3BG5 A;  4M3B A;  3ZQF A;  5IP7 J;  3ZQG A;  3BR6 A;  3JRE A;  1RKW A;  2CU7 A;  2YU9 J;  2YUS A;  2D5V A;  1Q1V A;  3HGG A;  3GTJ J;  3S1R J;  4BKX A;  1GV5 A;  5FKN A;  4A3F J;  2M34 A;  1JJ8 C;  1QPI A;  3S16 J;  1ETK A;  3BTL A;  3BTJ A;  5EG0 A;  4B1R A;  3A01 A;  2NVY J;  1IDY A;  1UHS A;  2DJN A;  1S7E A;  3SFI A;  2DMP A;  3LSP A;  4UUS B;  2LK2 A;  3GBG A;  2H8R A;  2O7O A;  2E2J J;  5M3M J;  1BW6 A;  3BR5 A;  3BR2 A;  1UG2 A;  3GTP J;  1MH4 A;  2QF7 A;  2G0E A;  1HLV A;  3RQI A;  3JRI A;  3Q3S A;  1RPW A;  1X2M A;  4MLO A;  3SDG A;  2WV1 A;  3FK7 A;  5E3N A;  2LTP A;  1HDD C;  2DA1 A;  1Z77 A;  2ECB A;  4D7N A;  3NAU A;  5M5Y J;  2JJ7 A;  2AO9 A;  3FK6 A;  3K7A J;  3FIS A;  3FIW A;  1SAN A;  2JWT A;  3FKI J;  5BNG A;  1FIP A;  3G1O A;  4CYC A;  3RKQ A;  3S2D J;  3OIO A;  2HOS A;  2VPR A;  5EDN A;  4B4C A;  3I4M J;  4IEJ A;  2EQR A;  1X2N A;  2KT0 A;  3K2A A;  3MVP A;  1RR7 A;  1LFU P;  2K9S A;  3JRH A;  1HOM A;  1X58 A;  1WCM J;  2XSD C;  1HCR A;  2R92 J;  1BA5 A;  2OPT A;  5F04 A;  4FTH A;  3M4O J;  4FIS A;  5HOD A;  2B63 J;  5K7Z A;  2OF7 A;  1RES A;  4A3M J;  1T33 A;  3IH2 A;  2CQX A;  2K40 A;  4Y52 J;  3HDD A;  1TWG J;  4A3G J;  2YS9 A;  2L9R A;  3LNQ A;  1JT6 A;  2HI3 A;  3JRC A;  3A02 A;  1R9T J;  1P7J A;  1O4X A;  4C3I J;  2ELK A;  3TP3 A;  3S1N J;  4S0H B;  4V2G A;  1GDT A;  3H0G J;  2X9D A;  3G1M A;  1JKQ C;  3BR1 A;  1GT0 C;  3HOX J;  2HDD A;  4C3J J;  2HOT A;  1WH5 A;  1ETV A;  2DMU A;  2EH3 A;  2VUM J;  3LSJ A;  4V2F A;  2E1O A;  1U9N A;  2Y2Z A;  2ME6 A;  1DU6 A;  5F08 A;  4DYC A;  3H3V K;  3OSG A;  2HXI A;  3G1L A;  3BG9 A;  2LR8 A;  2VKV A;  5GPC A;  4GFB A;  3S15 J;  2LP0 A;  2VKE A;  1ZKG A;  4FE4 A;  2PMZ N;  2M8G X;  2NVX J;  2COB A;  4DW6 A;  3GTO J;  1MBG A;  1NK3 P;  2JA6 J;  1NK2 P;  4M3F A;  1PUF B;  1ETX A;  2MGQ A;  2WB1 N;  1ETY A;  3ZOB A;  4A93 J;  5J3L A;  1G2H A;  2R5Y A;  2R5Z B;  2ID3 A;  2JMW A;  4XRS A;  1B8I B;  4C2M J;  3S1Q J;  2FX0 A;  2DA7 A;  4A3C J;  4DYR A;  4MO7 A;  3M3Y J;  4Y7N J;  2Y30 A;  1XS9 A;  1JJ6 C;  4X6A J;  2W48 A;  5C3E J;  3TW7 A;  3MN2 A;  2MSY A;  5C4J J;  1XC5 A;  5M5W J;  5J1U A;  1JUP A;  1HDP A;  3GTQ J;  1BL0 A;  5M3F J;  5EZH A;  5IOZ A;  3F0C A;  1IUF A;  3BTC A;  1APL C;  4JP0 A;  2LVS A;  3S14 J;  2X6O A;  2R0Q C;  1VF9 A;  9ANT A;  4I6Z A;  2L7M P;  2GBY A;  1MBJ A;  5J1R A;  2DMT A;  2O9L A;  1JTX A;  4IHW A;  1RKT A;  3TP0 A;  1ETQ A;  1T56 A;  5F0H A;  1WI3 A;  1H8A C;  3B6A A;  5IP9 J;  1I6H J;  5EZG A;  3D1N I;  1GUU A;  3RZO J;  1SFO J;  1PUF A;  3IH3 A;  3LSR A;  1CQT A;  1WH7 A;  4M6V A;  2M2E A;  2E2H J;  3HOY J;  1FIA A;  1JGG A;  1ETO A;  1ZTR A;  3ZQC A;  2TRT A;  4EEF G;  5EEA A;  2EZL A;  3HEF A;  3Q0W A;  4M3D A;  2ID6 A;  1OFC X;  5FKO A;  5C44 J;  1W0U A;  1F36 A;  2L7F P;  1JKO C;  1JUS A;  4UUT A;  5IPA A;  2CJJ A;  5GP9 A;  5IYD J;  1EF4 A;  4IHY A;  4M3G A;  3DCF A;  4QSH A;  1OCP A;  2GLO A;  2EBI A;  5GPA A;  4XRS G;  1P7I A;  4UUS A;  4AYB N;  1AHD P;  1NTC A;  1HF0 A;  2RAE A;  5JLW A;  2IAI A;  2LY9 A;  4M3E A;  4HNV A;  2MW8 A;  4XRM A;  3BG3 A;  2X48 A;  3GTK J;  3A03 A;  4DYQ A;  4L5E A;  1IRZ A;  3JRA A;  1MH3 A;  4A3J J;  3Q0V A;  2DA6 A;  2XGE A;  1RET A;  2XB5 A;  1IJW C;  3HM5 A;  1B72 B;  2E2I J;  1AKH B;  4XID A;  2Y0S N;  1OCT C;  1BW5 A;  2R93 J;  3E7L A;  3JRD A;  4MFD A;  1K83 J;  5FKK A;  2AHQ A;  2FQ4 A;  2HQ5 A;  4G12 A;  4ABZ A;  2N8G A;  3O8G A;  3CDL A;  3BTI A;  4A3E J;  5EGO B;  2CUE A;  4A3I J;  3DEW A;  1MSE C;  4BY1 J;  3GTM J;  4J19 A;  3ZQH A;  1D5Y A;  2I10 A;  3S17 J;  3CQZ J;  1ENH A;  3BT9 A;  3IV5 A;  4A3K J;  2K9Q A;  2HOA A;  4FE7 A;  2R7Z J;  1F43 A;  3JRG A;  2ZB9 A;  1DU0 A;  2CRG A;  1YRN B;  5FLM J;  3QQA A;  3UKG A;  4X1E A;  1TWC J;  2P81 A;  4DZP A;  1K61 A;  1IGN A;  5J1Y A;  4W97 A;  4IHV A;  3CMY A;  5EF6 A;  1POG A;  2FJ1 A;  1BJZ A;  2NVT J;  4AUX A;  1B72 A;  1GVD A;  3OOU A;  3ZQL A;  4C3H J;  5IYB J;  5M5X J;  1ZR4 A;  3LOC A;  1W0T A;  3BQZ A;  1IC8 A;  4CYC B;  1QRY A;  3CCY A;  4D7M A;  1IV6 A;  1JUM A;  5FKM A;  2E19 A;  2XPU A;  4BBR J;  3W6V A;  5EGO A;  1Y1V J;  1TWA J;  1U78 A;  2H1K A;  2K9N A;  1QVU A;  1MSF C;  1ZK8 A;  2DTZ A;  1E3O C;  5F1J A;  4JX6 A;  4XK4 A;  3JR9 A;  3BR3 A;  4MIM A;  1IDZ A;  3JRF A;  2O8K A;  2IEK A;  2DA3 A;  3PM1 A;  4LOC A;  2CUF A;  2JA5 J;  1YRN A;  2L0K A;  1ITY A;  2R5Z A;  2TCT A;  2GM4 A;  4DZJ A;  1B8I A;  2WAQ N;  4I76 A;  4BXX J;  5IOY A;  1U8B A;  3BQY A;  1A6I A;  4QIW N;  4RDU A;  4JX5 A;  3QPL A;  3HGY A;  3PO3 J;  3NAR A;  3HOV J;  5IYC J;  2HYJ A;  5FKL A;  1MBF A;  3O8H A;  1H89 C;  3L1P A;  1UMQ A;  4JX4 A;  5F0C A;  5K7F A;  4BBS J;  3HBL A;  1IG7 A;  3S2H J;  2XPW A;  2JA8 J;  2NS8 A;  1TWH J;  5K7H A;  2ME0 A;  1U9O A;  3JRB A;  1VFC A;  5F0F A;  1ZGW A;  1I3Q J;  1TWF J;  3HOW J;  1MBE A;  2MG4 A;  1VI0 A;  5E3O A;  5C4X J;  1GV2 A;  5FLV A;  3LSG A;  2XPV A;  1LE8 B;  3C2B A;  5F27 A;  5JLX A;  1WPK A;  1MNM C;  1I50 J;  5IP6 A;  4D5F A;  3Q0U A;  4NDL A;  3VPR A;  4B3A A;  4BY7 J;  2XGC A;  3BR0 A;  3TED A;  1FTZ A;  4AC0 A;  2JK3 A;  1FTT A;  2JN6 A;  2EZH A;  1XG1 A;  1AU7 A;  4MFE A;  2IBD A;  4A69 C;  1LFB A;  1JTY A;  2R5Y B;  1OJL A;  4D5C A;  2NVQ J;  1FEX A;  2QCO A;  1JT0 A;  3QPS A;  2DA5 A;  5DTD A;  2XRL A;  3S1M J;  2ECC A;  3OSF A;  3IH4 A;  3RZD J;  1Z0X A;  4W1U A;  1MBK A;  2FD5 A;  3PO2 J;  2L7Z A;  2M0C A;  4IHX A;  1ETW A;  5DS9 A;  1FJL A;  3B6C A;  2KDZ A;  2EZK A;  2DA2 A;  3GTL J;  2DN0 A;  1VND A;  1ZR2 A;  4JYK A;  3WHC A;  3GTG J;  5EG0 B;  4A3D J;  3A01 B;  1ZQ3 P;  2EZI A;  2XGD A;  2JA7 J;  1QVT A; 
#chains in the Genus database with same CATH topology
 4G6D A;  3TW6 A;  2DMN A;  1IXS B;  4N4O B;  4E7J A;  2AS5 F;  4ENJ A;  2V6E A;  3FXL A;  4XON A;  1BC7 C;  4XNF A;  1W4M A;  5E8G A;  2DT5 A;  4N9I A;  2AXL A;  2Y9Z A;  3HC7 A;  1I39 A;  3CCE I;  2DA4 A;  3QP5 A;  1JKP C;  3ZQI A;  4A6D A;  2MFZ A;  4BHB A;  2X1C A;  1TQP A;  3K69 A;  2M45 A;  2JTV A;  3ULQ B;  5LBQ A;  1WGX A;  3MCZ A;  1W36 D;  2Y31 A;  4XLH A;  2LD5 A;  4QTR A;  2FMY A;  4M71 A;  1Y1W J;  1UZC A;  2L9N A;  3H35 A;  3PNT A;  2MAB A;  3DV8 A;  3K4M A;  4HX7 A;  4M3B A;  2DFI A;  1R36 A;  1G3Y A;  2D1V A;  2F5D A;  3ZRG A;  2CU7 A;  3JRE A;  1WSU A;  2D5V A;  5EJC A;  3S1R J;  1GV5 A;  1RIO H;  3OIQ A;  2BE5 F;  1QPI A;  4CDG A;  2E35 A;  1J75 A;  1ETK A;  2CFO A;  4B1R A;  2QSF X;  1S7E A;  2VBW A;  1VQ4 I;  1BOB A;  5L3B A;  1FYM A;  2H8R A;  2EB7 A;  5M3M J;  1I1S A;  2ISZ A;  4DBQ A;  2JA2 A;  1F1Z A;  3SQN A;  1S9H A;  4FAS D;  4HX4 A;  1X19 A;  2ZME C;  2XAU A;  2XRN A;  3NQO A;  4BE2 A;  1X3W B;  2WV1 A;  4ENK A;  2ICW G;  3MMY B;  2LTP A;  4KN4 X;  4BJ5 C;  1WQ2 A;  1Z77 A;  5LFA A;  2ECB A;  2F6C A;  2PX9 A;  2OZ6 A;  4JOM A;  1T08 B;  2HTS A;  2DDB A;  4CA0 A;  4Q48 A;  3CCM I;  2DPU A;  2VE8 A;  4UV9 A;  4XMY A;  1KQ0 A;  2L2O A;  3H5N A;  4ZZD A;  4HOB A;  1IN7 A;  2L5Q A;  5K1Y A;  1FIP A;  2HDW A;  2P5L C;  4CYC A;  3BDD A;  4BE1 A;  3RKQ A;  2RQP A;  1U6G A;  3S2D J;  3OIO A;  3PNY A;  1NHA A;  4HX8 A;  2VOP A;  5EDN A;  1H9G A;  3L2Q A;  3BZC A;  1PJR A;  5CVU A;  3K1M A;  5B5E C;  2EQR A;  3T0Y A;  1LFU P;  1Z7L A;  2IGK A;  1HOM A;  1KA8 A;  2RNJ A;  1HCR A;  2F4O B;  3SZP A;  4EJT A;  3FXQ A;  2DLL A;  3M8J A;  1Y8R B;  2ZCW A;  1XTA A;  1G4D A;  1EH7 A;  4NQW B;  1QHH D;  3KEQ A;  3CC7 I;  4Y52 J;  1FOK A;  1YIJ I;  3HDD A;  4M6X A;  1R49 A;  1TWG J;  3WTS C;  1WKM A;  3TGN A;  3LNQ A;  3HRT A;  2L9V A;  2DO7 A;  3JRC A;  3L2V A;  4F55 A;  1R9T J;  1U8R A;  1O4X A;  3S3N A;  4ENM A;  4C3I J;  1YJ9 I;  3TP3 A;  4N9H A;  5KNL A;  1SAX A;  2QSG X;  3BZK A;  3MD2 A;  1YS6 A;  1GDT A;  3ASO H;  3H0G J;  4NNJ A;  5CQG A;  3G1M A;  4B09 A;  5GAG J;  2K4B A;  3HZJ A;  3COA C;  3KYL A;  2Z33 A;  5BPI A;  1LEB A;  1PYV A;  3L9F A;  2RQQ A;  1YI2 I;  3PIP F;  4UB8 C;  1LVK A;  2DU9 A;  4MQV A;  5FRN A;  2WV0 A;  5ED4 A;  3GLL A;  4IJA A;  4IQ4 A;  2VAS A;  1ODD A;  2ACJ A;  3GME A;  3W6K B;  3G1L A;  4P55 A;  2WAD A;  4KT6 A;  1FWZ A;  4IVN A;  5D5W B;  1OIS A;  4FE4 A;  3TDU C;  1TW2 A;  2PMZ N;  3LQQ A;  2M1B A;  3GZ5 A;  3OYK A;  4A12 A;  4G7Z F;  1EH6 A;  3F9K A;  4XR6 A;  5DEQ A;  2CV1 A;  3I58 A;  4M3F A;  4BHP A;  1PUF B;  1YE9 A;  1LPQ A;  2QVO A;  4ZDL A;  2K85 A;  5LHG A;  3I5U A;  5LGU A;  1G2H A;  2OBP A;  2EK5 A;  2R5Y A;  3P9K A;  3P7N A;  2R5Z B;  1D0Z A;  1T6S A;  2CMP A;  1SD6 A;  2DK5 A;  1Z7U A;  3VYS B;  3OV8 A;  1U5T B;  1CGP A;  4X6A J;  1D1A A;  2ZNZ A;  3CCL I;  1USS A;  1HW2 A;  2VQC A;  4UY8 I;  4ZZL A;  4I02 A;  3TW7 A;  4WCG A;  2JRT A;  3LA2 A;  2MSY A;  3S93 A;  4BDZ A;  5C4J J;  4ZYD A;  1XC5 A;  4L5I A;  4ZTF A;  5J1U A;  1JUP A;  3GTQ J;  5EZH A;  1IUF A;  1A6Q A;  2LVS A;  1MDM B;  3HKZ A;  2VB6 A;  3CUO A;  2R0Q C;  1J09 A;  3DKW A;  4I6Z A;  4KYW A;  3AG3 H;  4O3M A;  2F5V A;  2PMZ A;  2QWW A;  3O3K A;  4I0B A;  4EV0 A;  5LHH A;  1BJA A;  3F6V A;  1MBJ A;  3ABK H;  3E3V A;  4YII A;  4IHW A;  2QQ9 A;  1RKT A;  4LB6 B;  4XKC A;  4ZC3 A;  3AG2 H;  5FRO A;  4ITV A;  3PSI A;  3FZV A;  3RPU A;  1WI3 A;  1R71 A;  3GO5 A;  1H8A C;  5JHU A;  5IT3 A;  1VQ7 I;  3JCU C;  4QPQ A;  1MIJ A;  2P5V A;  4FHT A;  3W3C A;  4HDU A;  3D1N I;  3OYC A;  4Q4Z F;  2GOM A;  2R7D A;  2W00 A;  4IF4 A;  3IH3 A;  3LSR A;  1CQT A;  3MZY A;  3MQ0 A;  1YIT I;  3U1D A;  4L5J A;  3S8P A;  3ZQC A;  2G7H A;  2WBM A;  5DD4 A;  2F5E A;  3J7A O;  3DFG A;  1GVJ A;  1F36 A;  1WVR A;  3KP7 A;  1BOA A;  4ZYG A;  4HV5 A;  1EF4 A;  2O8X A;  1W5T A;  5HNF A;  1IZ1 A;  3S3O A;  2ZC2 A;  1P7I A;  4QWQ A;  4UUS A;  4BGD A;  2GIV A;  3RSN A;  4L18 B;  3MKY B;  2LC2 A;  5E1Z B;  4HNV A;  4XRM A;  2CW0 F;  2E7X A;  2ZBK A;  1FSH A;  4XLE A;  4L5E A;  4G7O F;  1STZ A;  3Q0V A;  4KDP A;  2DA6 A;  3QAH A;  2R3S A;  4BUP A;  1RET A;  3VYU B;  1ZRF A;  2BGC A;  3J81 Z;  5J8F A;  4I7H A;  2OAZ A;  5JR3 A;  1B72 B;  3BPV A;  2YR2 A;  2E2I J;  2HYF A;  2KIS A;  3ZGK A;  3S32 A;  2UXN A;  3PUF A;  5D5U B;  2ZJ2 A;  3V7S A;  4DJA A;  1W5S A;  2GWR A;  1OCT C;  2J5P A;  4MFD A;  5FKK A;  4HF1 A;  2FQ4 A;  2ZXH A;  5D4S A;  1ZH5 A;  4G12 A;  4ABZ A;  1WFX A;  1XGM A;  2P7V B;  4E4H A;  3O8G A;  1G3S A;  1OCO H;  2DJI A;  5EGO B;  1P6R A;  1B1B A;  2LKS A;  3MZ8 A;  4A3I J;  3FDY A;  1BIA A;  1VQN I;  2BOL A;  3SFZ A;  3GCM A;  1GLN A;  3FMR A;  2JQ7 A;  1ACI A;  2XAG A;  2PBI A;  2F2E A;  5ILS A;  2R7Q A;  2I10 A;  2E1N A;  4HF2 A;  3J80 Z;  3CES A;  3BT9 A;  5F1R A;  3LAP A;  3MZH A;  3WTV C;  3QYE A;  2HOA A;  4RGU A;  4HNT A;  4U0V A;  3V4G A;  1IUY A;  2ZB9 A;  4I98 B;  2CO5 A;  4X1E A;  1N75 A;  6PAX A;  4IHT A;  1K61 A;  4DZP A;  1IGN A;  3FBN B;  5J1Y A;  2BHZ A;  3GLX A;  4IHV A;  2X6X A;  3E97 A;  2JPC A;  1X1D A;  2IA2 A;  4RAF A;  1FMV A;  3HSF A;  3OYB A;  2W57 A;  1N77 A;  2XAF A;  3ZQL A;  1O7L A;  2R7F A;  3ZQ7 A;  3KFW X;  2IS4 A;  2FNP A;  1QO0 D;  5IYB J;  5M5X J;  1FY7 A;  1ZR4 A;  1QRY A;  5LGT A;  3EYY A;  3M07 A;  4G94 A;  1A04 A;  2PI0 A;  2O61 A;  2XAH A;  3LMM A;  4IKF A;  3MFK A;  2F5F A;  1D3Y A;  4XKB A;  2HYG D;  1E17 A;  1QVU A;  2EFP A;  3BP8 A;  2DW4 A;  2DK8 A;  2HPI A;  4EJV A;  3L2W A;  1Y0N A;  4IX7 A;  3DBR B;  5HDK A;  3MEX A;  4JK1 X;  5E18 F;  3JR9 A;  5HLG A;  1IDZ A;  5ICE A;  2DA3 A;  4HNU A;  3T8R A;  4ANJ A;  1ITY A;  1YRN A;  1MNE A;  4DZJ A;  3WTT C;  2VXD A;  4I76 A;  3LA7 A;  3ZMS A;  3QOD A;  2V4J C;  1I5Z A;  3G2B A;  3IP4 B;  3RYP A;  1R00 A;  3MKW B;  3AL0 C;  1AA7 A;  2GA1 A;  2M4G A;  4XKV A;  2ZKZ A;  4B47 A;  2KJC A;  4IRG A;  3RIR A;  2YPR A;  3NAR A;  2OTL I;  3A2K A;  3HUG B;  1OYW A;  2A3S A;  5IYC J;  2K02 A;  1N78 A;  2HYJ A;  4Y15 A;  1MBF A;  3O8H A;  3GVA A;  5F0C A;  2H6B A;  4BBS J;  1T95 A;  1IG7 A;  4XSZ F;  5FGM A;  3OYN A;  2XPW A;  1TWH J;  3EDP A;  1OCZ H;  3SDB A;  4EQQ A;  1J9I A;  4XQF A;  4L9N A;  1I3Q J;  4S04 A;  2K86 A;  3HOT A;  1MBE A;  2BY3 A;  5FLV A;  2XPV A;  4UVC A;  3C2B A;  3OOP A;  4GGG A;  5JI6 A;  3GUD A;  1G8X A;  2I8D A;  5IP6 A;  4D5F A;  1PUE E;  4A0X A;  4UV8 A;  1YX5 A;  1U2W A;  4H0E A;  4QPO A;  2W7N A;  3J7A Y;  3H5A A;  1ZLJ A;  4AC0 A;  1FTT A;  5DDG A;  1XG1 A;  2E34 A;  1LFB A;  5DV5 A;  1FEX A;  1Z05 A;  1XN7 A;  1TQI A;  3OSF A;  4E7L A;  1ONV A;  1Z0X A;  2FD5 A;  1ZHF A;  2L7Z A;  2M0C A;  3J7Y J;  1ETW A;  3RYR A;  5DS9 A;  1LB2 A;  4IHX A;  1FJL A;  2DFF A;  2EZK A;  2DA2 A;  2V79 A;  2A61 A;  4LIV A;  4NBQ A;  2DN0 A;  2JUC A;  4CCK A;  5DM7 F;  4RB1 A;  2CG4 A;  4JYK A;  1ZR2 A;  2KIQ A;  3B02 A;  3CZ6 A;  2V26 A;  3PSF A;  4CCL A;  1EV7 A;  3FXU A;  4LG3 A;  1YHQ I;  3H9Q A;  4ON0 A;  2QUF A;  2NS7 A;  4BQO A;  2HNH A;  1A5J A;  3FHN A;  2FE3 A;  2L9S A;  4NC8 A;  3HB9 A;  4XL9 A;  1IO2 A;  1HW1 A;  1MBH A;  1X1C A;  4L9T A;  2XDV A;  3N4M A;  4OAY A;  2CQK A;  3QU3 A;  1BI1 A;  1V55 H;  3BJ6 A;  4RBO A;  1ZG1 A;  1Q1H A;  2HXO A;  2LBF A;  4GYI A;  2Z2S B;  4L0Y B;  3ZN1 A;  2Y9Y A;  3HOZ J;  2HKO A;  4OIO F;  1X3U A;  4D1Q A;  2HOE A;  3JTH A;  3F22 A;  4TV7 A;  1AKH A;  3PUB A;  1TC3 C;  4FX4 A;  1T2K A;  5J8C A;  4B44 A;  2QQ8 A;  1P4W A;  2CQQ A;  2K3F A;  3BG5 A;  3HPG A;  3R0A A;  3V7C A;  2Z3Y A;  3BPX A;  1T39 A;  1R5I D;  2ZNY A;  3BC8 A;  2YU9 J;  5HLH A;  1Q1V A;  1JHH A;  1VQ5 I;  3GTJ J;  3D0S A;  5FKN A;  4A3F J;  1LDJ A;  5FFZ A;  1UEL B;  1XCB A;  3BTL A;  1SD7 A;  1DQU A;  5DCM A;  4QLC U;  4D9J A;  3A01 A;  1K78 B;  1LJ9 A;  4PFO A;  5DYM A;  3SFI A;  2DMP A;  3K2Z A;  3LSP A;  2LK2 A;  3GBG A;  2O7O A;  1BW6 A;  3BR2 A;  4LG0 B;  3ZQQ A;  5ILV A;  1KU9 A;  4KIC A;  2QF7 A;  1LEA A;  3QP6 A;  4CUG A;  4KIF A;  3L7W A;  4CYD A;  1X2M A;  3DKY A;  5CVJ A;  2FOK A;  2IXS A;  4G6Q A;  3TL4 X;  3SDG A;  1FLI A;  5E8I A;  2QGU A;  1R22 A;  1HDD C;  2DA1 A;  4BQQ A;  3K70 C;  2KIU A;  2A05 A;  2EA2 A;  1G6N A;  2VBZ A;  3DBL B;  4LFU A;  4DGW B;  4D7N A;  3S3M A;  2DAO A;  1OCC H;  1R23 A;  3DTK A;  2O0Y A;  3K7A J;  1ZRD A;  3FIW A;  3CCS I;  1IV8 A;  1OCR H;  1S3J A;  2WY8 Q;  3VB2 A;  3VOE A;  3G1O A;  3EUH C;  1YOV B;  2LG4 A;  4HQE A;  4N0B A;  2HOS A;  1EKE A;  4KIT B;  5BS6 A;  3CC4 I;  2AQE A;  2STW A;  1V5G A;  2KT0 A;  3K2A A;  1Z91 A;  1VQK I;  2LRE A;  2ISY A;  2RVC A;  1X58 A;  1WJ5 A;  3FKJ A;  1W5C C;  4AD9 A;  3OS0 A;  4BDY A;  3VEP A;  5FD6 A;  2R92 J;  2FF4 A;  3CJQ B;  4M74 A;  5F04 A;  5BQT A;  1MKM A;  3J7Z I;  2B63 J;  5HOD A;  4KIS A;  3QOP A;  1T33 A;  2OA4 A;  5HVQ C;  2JVG A;  4B3X A;  5TRD A;  1MJ9 A;  3HXL A;  1H9T A;  1TNS A;  4RM3 A;  4OIQ F;  1B9N A;  3HSE A;  4DIQ A;  1P7J A;  2LY2 A;  3ZCO A;  2ELK A;  2LY1 A;  3F72 A;  2CSO A;  2O3F A;  3I53 A;  2IP2 A;  2ELJ A;  2A6E F;  3ZMT A;  1B6A A;  5KCM A;  5AIQ A;  2UUZ A;  3EPZ A;  4UB6 C;  2A07 F;  1Z21 A;  1KQ8 A;  1TTY A;  2YX4 A;  2E1M C;  2ESN A;  3EUA A;  2E7W A;  3V7R A;  2MLG A;  1T8I A;  3DBH B;  5F08 A;  3H3V K;  1BBY A;  5D8K B;  3WGI A;  2IPQ X;  3P9C A;  1O57 A;  3BG9 A;  2LR8 A;  2IGM A;  2QLZ A;  2VKE A;  3U2R A;  2H94 A;  2M8G X;  2NVX J;  2R7R A;  5CLS A;  2YX7 A;  3HHH A;  1NK3 P;  4U0Y A;  3I56 I;  2JA6 J;  2H8W A;  2JT1 A;  1ETX A;  1CF7 B;  2ZFU A;  1XGO A;  2DFH A;  1TZL A;  2WB1 N;  2AQF A;  5L3C A;  3HRU A;  2EFQ A;  1DGR M;  5J3L A;  3CMA I;  1K6O A;  5LHI A;  3T1B A;  2KDO A;  1B8I B;  1YJW I;  3BJA A;  4Y7N J;  2Y30 A;  3EUH A;  3KPH A;  2MC3 A;  4IRH A;  3VOD A;  3U21 A;  3WOD F;  4PSW A;  2PEX A;  3CDH A;  3E6D A;  5IOZ A;  1VQ9 I;  3SXY A;  2XAQ A;  4PJN A;  5CYV A;  2WWY A;  1DDN A;  1RUN A;  4KMF A;  2RGV A;  5GTH C;  3WGG A;  1BC8 C;  4NHJ A;  1MMS A;  1SEU A;  3GWZ A;  3TO9 A;  2OUM A;  3E5Q A;  4NUB A;  3DEU A;  4BXU A;  1K6Y A;  4BS9 A;  1ETQ A;  4IHS A;  4PJM A;  1A35 A;  1IW7 F;  2OCC H;  3WTZ A;  5F0H A;  3B6A A;  4OIR F;  5EZG A;  3OY9 A;  1D1B A;  3K0L A;  3K1N A;  2VN2 A;  3RZO J;  2VQL A;  4GDF A;  2Q2E B;  1TLH B;  1PUF A;  3OYL A;  2CS3 A;  1IXC A;  2BVM A;  3AFH A;  3D5S C;  4ESB A;  2EFO A;  4Y3O A;  2E2H J;  3DEE A;  1X1B A;  1Z6R A;  3RKW A;  1HKT A;  2W24 A;  3K4N A;  2PJR A;  1XDU A;  2MBF A;  1ZTR A;  1KZH A;  2TRT A;  3ECH A;  5TGT A;  3KEO A;  2CUZ A;  1HKQ A;  1MMD A;  1MMG A;  1HA8 A;  2EZL A;  1XB4 A;  2ADU A;  3DF8 A;  5K5R A;  2XAS A;  1BI0 A;  4ZYH A;  4RB3 C;  4YIF A;  1FP1 D;  3D5L A;  1UST A;  4BH9 A;  1JUS A;  2GXA A;  5IYD J;  2EFW A;  2E36 A;  3DCF A;  1TT5 B;  4M3G A;  3TOA A;  1VQO I;  2BEO A;  2GLO A;  1S7A A;  3KYD B;  4LLN A;  2EBI A;  1SVM A;  5GPA A;  4JBA A;  4AU7 A;  4C30 A;  4NC7 A;  4AYB N;  4MEX F;  4YFX F;  2RAE A;  2IAI A;  2LY9 A;  2MW8 A;  1SD4 A;  3R4K A;  3O6B B;  3ZXS A;  3W6J B;  2X48 A;  3QPH A;  1O7F A;  2HDC A;  2A68 F;  2ESH A;  1FNN A;  3A03 A;  2MD5 A;  2K3P A;  2XAJ A;  3JRA A;  1DP7 P;  1L0O C;  3I64 A;  4LMY A;  1IAW A;  1YTY A;  1Y8Q B;  1LKX A;  2DOD A;  5A2Q K;  1ERD A;  5D5V B;  2I5U A;  2L3D A;  2O5R A;  3FF5 A;  4YEL A;  2R7U A;  2Z16 A;  1ON1 A;  3ERM A;  1QGP A;  1BW5 A;  4UVA A;  2R93 J;  4BE0 A;  3ASN H;  3LSK A;  4AIJ A;  3E7L A;  3PFI A;  1OLT A;  1D5V A;  1K83 J;  4RGR A;  3ZMZ A;  3CP8 A;  1WI9 A;  1WJD A;  2JSC A;  5B1A H;  3M8E A;  4X0G A;  2N8G A;  4M6Y A;  1YIO A;  3CDL A;  2BHY A;  1ZAO A;  4AYB A;  5IT9 Z;  2VJ5 A;  5K5O A;  2H27 A;  3DEW A;  1R7J A;  4EAT A;  1MSE C;  3E6C C;  3GTM J;  1Z3Y A;  2K5C A;  3WE2 A;  4BJ6 C;  2D1H A;  3DU6 A;  1R5H A;  5E79 C;  2ZXJ A;  4KNY A;  3HYI A;  1T38 A;  1ENH A;  4A3K J;  4FE7 A;  2R7Z J;  1UHM A;  2E5N A;  3JRG A;  2Z1D A;  1YW8 A;  4EJU A;  2QEX I;  2COM A;  1LDK B;  5B3S H;  1QHG A;  5FLM J;  3QQA A;  1X4O A;  3H36 A;  3H9J A;  3OYM A;  2ZJR F;  2GAU A;  4GXO A;  1VQM I;  2KIM A;  3CMY A;  1RI7 A;  1UJ8 A;  2Y75 A;  5EF6 A;  5AIP A;  2FJ1 A;  3PQJ A;  5J4V A;  3RI4 A;  1BJZ A;  4PCQ A;  3HRM A;  3G4S I;  1SMY F;  2R7W A;  1B72 A;  2FNA A;  1EH8 A;  2Y0M A;  2EIN H;  3BJO A;  1D0X A;  2WAE A;  1E0E A;  3IAS 2;  3GFI A;  3LOC A;  1W0T A;  3BQZ A;  4AIH A;  1IC8 A;  2JVH A;  4CYC B;  1XMK A;  5E1X A;  4B48 A;  3CCY A;  1IV6 A;  4BEH A;  5FKM A;  4HBL A;  2L54 A;  2ZSH B;  3LSI A;  3H92 A;  4G7H F;  3W6V A;  2NS0 A;  1K7A A;  5EGO A;  3FM3 A;  4B43 A;  1Y1V J;  2HQR A;  3FXK A;  2MH9 A;  1S5L C;  2FU4 A;  3DU5 A;  1W7P D;  1E3O C;  2DTZ A;  4HYE A;  4F7Z A;  3QPT A;  2HPM A;  1YG2 A;  3SYT A;  4RM2 A;  5K5Q A;  4XK4 A;  3QYB A;  3BR3 A;  1KQ9 A;  3BCA A;  2V1N A;  3JRF A;  2IEK A;  2XUB A;  4CZZ A;  3DWL E;  2O8K A;  1MMA A;  2CUF A;  2JA5 J;  1WWX A;  4M9X A;  3JSP A;  2TCT A;  2GM4 A;  4HA8 A;  2OU2 A;  2DOF A;  3L2C A;  5AON A;  2VJ4 A;  1WHU A;  1A36 A;  4BXX J;  1X1P A;  1U8B A;  2QSH X;  1HW5 A;  3BQY A;  1WJA A;  3HL2 A;  4RDU A;  1TW3 A;  3K4C A;  3HGY A;  2W82 A;  1FBQ A;  3X2Q H;  3CC2 I;  4CGZ A;  4MNU A;  4XKW A;  2X6W A;  1H89 C;  3KP2 A;  2E5Z A;  4JX4 A;  4E7Z A;  5K7F A;  1Y39 A;  3S2H J;  1KU2 A;  3AG4 H;  2E60 A;  2NS8 A;  5K7H A;  1TT0 A;  3F8M A;  1VFC A;  4XLC A;  2C6Y A;  2MLK A;  2M0M A;  4M9S A;  4ENN A;  2DXI A;  5KAI C;  3R6S A;  3HOW J;  2MG4 A;  2L7K A;  1VI0 A;  5B1B H;  3LL7 A;  1GV2 A;  1OQY A;  3CME I;  2K9L A;  2QQA A;  1LE8 B;  5F27 A;  2ZME B;  4HQM A;  4YEJ A;  2QA4 I;  4B8X A;  1XSD A;  1MZB A;  4NDL A;  3GF2 A;  3OYH A;  5H20 A;  3TED A;  4U0W A;  4RA2 A;  2V7F A;  3ZMD A;  2VOD A;  3R0J A;  2QBY A;  3K4B A;  4K2E A;  5J6X A;  2HWV A;  2R5Y B;  4BU2 A;  1JTY A;  2VL8 A;  4MTD A;  4PZJ A;  2NVQ J;  2A5W A;  1JT0 A;  5DTD A;  1ZRC A;  1HST A;  2Q8K A;  4MTE A;  2CW8 A;  3H3U A;  4L0Z B;  4ZYE A;  3D5R C;  3M8F A;  2HFH A;  3KP4 A;  4W1U A;  1MBK A;  2OQR A;  3TBI A;  3ML6 A;  3CDI A;  3BWG A;  2CFX A;  3B6C A;  2BV6 A;  3K70 D;  1IN6 A;  4CCJ A;  1AWC A;  2M3A A;  3I3L A;  3CO6 C;  5GAH J;  2EIM H;  2LNB A;  3HUG A;  3OL3 A;  5EG0 B;  4A3D J;  1ZQ3 P;  2NXN B;  2XHK A;  3IAM 2;  1ZAR A;  4CHU A;  3S14 J;  4U87 A;  5E17 F;  1R58 A;  5L3D A;  1S6L A;  1KGS A;  2LKX A;  4O6J A;  4Q47 A;  2K7L A;  3IWZ A;  4ZDP A;  4XOP A;  4XIC A;  3GYH X;  3F6O A;  5HLI A;  2K27 A;  3QOE A;  3ZPL A;  3E5X A;  4A3B J;  3TO6 A;  3KET A;  2LLK A;  1Z1D A;  2EPF A;  4II3 A;  4FCY A;  1MMN A;  4BL0 B;  1ORK A;  2OJE D;  3LAJ A;  4L9V A;  1AOY A;  3C1D A;  4PJJ A;  2BXZ A;  2VI6 A;  3HOU J;  2KHM A;  2EWN A;  2IA1 A;  1QPM A;  2WY7 Q;  2VT2 A;  4OIP F;  1LDD A;  1YW7 A;  2P6S A;  2PMH A;  4EM0 B;  3SZG A;  5E3M A;  1OMI A;  1J0R A;  5EYR A;  3ZQF A;  5IP7 J;  1YX3 A;  2IW5 A;  2VXZ A;  4WK8 F;  3OIP A;  3C2G A;  1RRJ A;  3GX4 X;  4LB5 A;  3IKT A;  3KZY A;  3HGG A;  2BY1 A;  4MGR A;  2EIJ H;  1XPX A;  1JJ8 C;  5CKT A;  5D4R A;  3S16 J;  2ZFW A;  2EV0 A;  3BTJ A;  2PFB A;  2HTJ A;  3GFJ A;  4UHT A;  1GHC A;  1R6R A;  3VSK A;  1UHS A;  1ZG5 A;  2VIX A;  2KMU A;  5F6F A;  3WGH A;  1JGS A;  3CJR B;  4YIR X;  3T5X A;  3CUQ C;  4F92 B;  4UUS B;  2P0W A;  2H09 A;  1MW7 A;  2X1E A;  2E2J J;  2L4M A;  4GO1 A;  2DT6 A;  4C2U A;  3BOQ A;  1UG2 A;  3FXJ A;  1MH4 A;  1V3F A;  1HLV A;  1DPR A;  1TQM A;  3UR3 C;  2IT0 A;  3Q3S A;  1N25 A;  3RCO A;  2IS1 A;  4MLO A;  1OPC A;  4AID A;  2STT A;  1IN4 A;  3BCB A;  4I09 A;  4ESJ A;  2AXT C;  1K4S A;  3F8B A;  2EFN A;  3WTX C;  2KZV A;  3PFY A;  2LF7 A;  4BHC A;  1PDN C;  1HQC A;  1EA3 A;  3NAU A;  5M5Y J;  3AKZ A;  2HZT A;  2JZY A;  2AO9 A;  1SAU A;  3FK6 A;  4UVB A;  3CCJ I;  3JSO A;  1K79 A;  3CD6 I;  5JVT A;  5BNG A;  1KON A;  3OR1 C;  3BRO A;  4CZC A;  2VPR A;  3WG7 H;  1O3T A;  2BW3 B;  3I4M J;  2GXG A;  4IEJ A;  2R7O A;  5KHD A;  4XBF A;  1B59 A;  3V8J A;  2Z5U A;  1VQ6 I;  2M4K A;  3FM5 A;  3OYF A;  2A6T A;  4HPQ A;  2XSD C;  3C7J A;  1BA5 A;  4ESF A;  4XRF A;  2FSW A;  3RQ4 A;  5HDN A;  4FIS A;  1RUO A;  5K7Z A;  2HVQ A;  4AWX B;  1RES A;  4A3M J;  1VZ0 A;  3QRF F;  3A0B C;  2OTJ I;  3IH2 A;  2CQX A;  2W85 A;  3JW4 A;  4LG0 A;  1M1E B;  4PGG A;  3HHG A;  1MND A;  3FX3 A;  2PLY A;  3CCU I;  5LD2 C;  2YS9 A;  2L9R A;  1FC3 A;  2IA0 A;  1SC7 A;  3ABM H;  3A02 A;  1FYL A;  4PK4 A;  2ZO4 A;  2ZJP F;  1REP C;  4OMZ A;  4HAM A;  3CCV I;  1F4K A;  4BXF A;  4S0H B;  1YO5 C;  4OWR B;  2P4W A;  4V2G A;  4Z2Y A;  2CV0 A;  4LJZ F;  2X9D A;  1JKQ C;  4PUS A;  1OKR A;  3BR1 A;  1GT0 C;  5H2F C;  3HOX J;  4C3J J;  2HOT A;  1WH5 A;  4WXD A;  3KP5 A;  2EH3 A;  2VUM J;  1BR1 A;  1MGT A;  3CUQ A;  4BAY A;  2E1O A;  2RNG A;  1U9N A;  2ME6 A;  1DU6 A;  2R7T A;  4DYC A;  5J40 A;  4F3Q A;  2HXI A;  4NC6 A;  2ZJQ F;  5CQE A;  4GFB A;  2JRM A;  2X51 A;  2VKV A;  4KFC A;  3MKZ A;  1ZKG A;  1LNW A;  4H4K C;  2COB A;  4DW6 A;  1HKS A;  3CLO A;  1YW9 A;  3H0D A;  3JAM Z;  5LRS A;  2ZXW H;  2JUG A;  1WJE A;  3L2R A;  2UZK A;  1ULY A;  2MGQ A;  1ETY A;  4A93 J;  4AVZ A;  2VBY A;  1Z3X A;  3CTA A;  2M30 A;  1F5T A;  4XRS A;  2VC0 A;  4C2M J;  2FX0 A;  2DA7 A;  4ZYA A;  3T8T A;  4MO7 A;  3M3Y J;  3Q9S A;  2V9P A;  1JJ6 C;  3WU0 A;  5DM6 F;  3O2P E;  3RPU D;  3I55 I;  5C3E J;  3NRV A;  1OR7 C;  4P9F A;  1KU7 A;  3GZ6 A;  3MN2 A;  4EMS A;  5HS7 A;  5CVV A;  5M5W J;  3IRR A;  1HDP A;  3SEQ A;  1ON2 A;  5M3F J;  2FBH A;  1DPU A;  2XIG A;  4O5V A;  2X6O A;  9ANT A;  1KYW A;  4II2 A;  3A0H C;  2GBY A;  4EJO A;  5J1R A;  2DMT A;  2O03 A;  3ELK A;  2IVM A;  2O9L A;  1JTX A;  3OWT A;  4JQF A;  2KL4 A;  3MAJ A;  1R4N B;  4G9Y A;  3TP0 A;  1IRX A;  2GQQ A;  3DQV C;  3GFM A;  1Y56 A;  3GW2 A;  4HG2 A;  4FX0 A;  1ZLK A;  3KCC A;  1T56 A;  2FML A;  2NVU B;  4EGY A;  1I6H J;  1E3P A;  1P9Q C;  1GUU A;  3NEU A;  3RKX A;  2NYX A;  3PL8 A;  4WF2 A;  3HSR A;  1CF7 A;  2M2E A;  2FRH A;  4IPA A;  3HOY J;  4ZH4 F;  4PGH A;  3W2V A;  2VKD A;  4PDK A;  1Z9C A;  3DP7 A;  3MWM A;  1FMW A;  4RMN A;  3BG6 A;  1QZZ A;  4EEF G;  3M1E A;  3F23 A;  5EEA A;  3HG9 A;  4M9Z A;  3A1Y A;  4KJZ A;  4A6E A;  2V9K A;  1OFC X;  2LYC A;  2VON A;  1L3L A;  3U1K A;  1FP2 A;  2F4M B;  2IGO A;  2L7F P;  3AG1 H;  4LGW A;  1W0U A;  1JKO C;  4F91 B;  3FHZ A;  5KAF C;  1RZ4 A;  5IPA A;  2CJJ A;  2X0L A;  5GP9 A;  1XSX A;  2H1L A;  4LK1 F;  3H3Z A;  4XRS G;  3WTU C;  3WTY C;  3KP3 A;  4KUM A;  1AHD P;  1NTC A;  1HF0 A;  2BYV E;  3N05 A;  3I59 B;  5JLW A;  4M3E A;  2D45 A;  4HSR A;  2KJB A;  4Y17 A;  3LSM A;  1MH3 A;  1FBU A;  3ZMV A;  1OR7 A;  1JI8 A;  3HJE A;  1IRF A;  4KT5 C;  5FLX Z;  2XB5 A;  1BI2 A;  3WG9 A;  3AL0 B;  1IJW C;  2Q2E A;  4EM2 A;  1QQI A;  2XSJ C;  3KLO A;  2HVR A;  1MD0 A;  1AKH B;  4XID A;  3FWE A;  2Y48 A;  2VJI A;  4GRI A;  3KIO A;  1U5T C;  2Y0S N;  1YS7 A;  2M5W A;  3JRD A;  1DP3 A;  2L01 A;  4ETS A;  3BZ6 A;  2IS6 A;  2RDP A;  2HS5 A;  2XF5 A;  4M72 A;  2XKP A;  1W1W E;  2DYR H;  1E3H A;  4A3E J;  2CUE A;  1TL8 A;  5CJ9 A;  4BY1 J;  1D0Y A;  3K1P A;  4J19 A;  3GFL A;  5GTI C;  1YJN I;  2QZ8 A;  2DQR A;  3IKV A;  1D5Y A;  3S17 J;  3CQZ J;  5FO5 A;  4NQW A;  4C9Y A;  1DU0 A;  3FXM A;  4P96 A;  2QYO A;  2DFE A;  4E7H A;  1FPQ A;  2PG4 A;  3UKG A;  3F8C A;  5FD5 A;  1LVA A;  2DYS H;  2JPB A;  2P81 A;  2M87 A;  1T0F A;  2CH0 A;  2P5K A;  2RRE A;  2Y0S A;  2IRF G;  4HDV A;  4UUV A;  3KZI C;  1YLF A;  1POG A;  2V6C A;  5L3F A;  1TNT A;  4AUX A;  2CWE A;  2R4G A;  3FXR A;  3G71 I;  1WJF A;  3BG7 A;  4CCN A;  1V5E A;  1W7P B;  1HXD A;  2B9S A;  2QEN A;  4DBR A;  1QZY A;  4WWC A;  1S29 A;  2F5C A;  3CO7 C;  4IRI A;  3CCR I;  4D7M A;  2IGN A;  2DOA A;  3IL2 A;  5TJJ A;  2XPU A;  4I2O A;  1IN8 A;  2WB1 A;  3W2A A;  1SFU A;  5IT9 K;  1P4A A;  3G6E I;  1U78 A;  2KLO A;  3F8N A;  2H1K A;  3E6M A;  1UCR A;  2FA5 A;  2K9N A;  4HV6 A;  4MHG A;  5F1J A;  4JX6 A;  2V1X A;  5TIS C;  4XM3 A;  4V19 K;  4MIM A;  2XC7 A;  2P8T A;  5H6R A;  3PM1 A;  4R79 A;  3CMM A;  3I4P A;  4BAC A;  2R5Z A;  3OYG A;  3AAF A;  1QU3 A;  1BIB A;  2PQ8 A;  2WAQ N;  4HLY A;  1VQ8 I;  1U5T A;  4U88 A;  1ZGJ A;  2E1C A;  2BY0 A;  4E7K A;  2KPM A;  3G3Z A;  1ZN2 A;  4JX5 A;  4PFP A;  5F64 A;  3QPL A;  1IN5 A;  4YFK F;  2XGX A;  3PO3 J;  1PVE A;  1S7O A;  1XGS A;  3HOV J;  2MH2 A;  3SZT A;  4KIG A;  2FQ3 A;  5BPD A;  1MDM A;  3ESW B;  3CP2 A;  3PQK A;  3DPT A;  4A5M A;  3HBL A;  3B73 A;  4BQN A;  2Z9O A;  1UB9 A;  3EYI A;  2JA8 J;  3WU1 B;  1R1V A;  1U9O A;  1TP4 A;  2ME0 A;  4F93 B;  2M7B A;  1QZE A;  3E1S A;  1H0M A;  5E3O A;  1KYZ A;  4RLQ A;  3LSG A;  3LWF A;  5L3G A;  4EVI A;  5JLX A;  1WPK A;  4BJT A;  1MNM C;  3DPL C;  1I50 J;  2WAQ A;  3OYE A;  1Y0U A;  2FEZ A;  3LFK A;  3Q0U A;  4XLN F;  2CGP A;  2L4A A;  4B3A A;  2XGC A;  4ZDO A;  1DUX C;  3OYD A;  2WAF A;  1FTZ A;  2RKH A;  3M7G A;  2MC4 A;  2JN6 A;  3EET A;  2EZH A;  2CQ7 A;  3ERE D;  4MFE A;  1I1G A;  2RC4 A;  2IBD A;  4A69 C;  2VOO A;  2XVC A;  1HC8 A;  1XDS A;  4HST A;  5KK1 A;  2QCO A;  3Q5F A;  2XF7 A;  4OU0 A;  1S8N A;  2XRL A;  4CSW A;  3S1M J;  1DGW Y;  2ECC A;  3IH4 A;  3LFU A;  4F52 A;  4XN3 A;  4G8X A;  4C2T A;  2KDZ A;  2V1D A;  2LF8 A;  3GTL J;  2FBI A;  1T98 A;  3K4J A;  1KU3 A;  3P9I A;  1VND A;  2QKM B;  2P7C B;  2NRA C;  2HU9 A;  1SFK A;  2XKO A;  2DDA A;  2KRH A;  5JVG F;  2XGD A;  2JA7 J;  2UXX A;  1QVT A;  5FJ8 J;  3BLY A;  2KQR A;  2JSP A;  4PSX A;  3C18 A;  3SHF A;  3IHU A;  5LEJ A;  2NOG A;  1G59 A;  1SVO A;  4MQ9 F;  5GAD J;  2NNY A;  2OQG A;  4A3L J;  1IRG A;  3HKZ N;  2XB0 X;  1JKR C;  1LE8 A;  2ZME A;  2W84 A;  3HTS B;  3MKL A;  2R7X A;  4AIK A;  4YG2 F;  3REO A;  1QNT A;  2F48 A;  4FT8 A;  2LFB A;  3KX2 A;  1UG0 A;  2J5O A;  2B7E A;  3J81 K;  1RC9 A;  2DMQ A;  4XLA A;  1H88 C;  4S05 A;  4IL6 C;  5E3L A;  2Q0O A;  2M9H A;  3SJM A;  3F8F A;  1SMT A;  4U7B A;  3WHB A;  2XF6 A;  2CQN A;  4OMY A;  3I4N J;  2PJR B;  2W1O A;  2Q1Z B;  3BR6 A;  3C3W A;  3ZQG A;  3RJP A;  4XOT A;  1RKW A;  2E1M B;  2Z99 A;  4RGS A;  1FOW A;  2YUS A;  5CVI A;  2DTR A;  4CO8 A;  2BZT A;  5FRM A;  4BKX A;  2A69 F;  2M34 A;  3I71 A;  3R60 A;  2W25 A;  3GEZ A;  1V54 H;  5D6F A;  5EG0 A;  4I99 C;  3DLL F;  2HQA A;  2NVY J;  1IDY A;  2DJN A;  4Y4R A;  1YYV A;  2X1D A;  3J80 K;  1R1T A;  2E71 A;  3BR5 A;  3SEZ A;  4RGX A;  4RAY A;  5J4Y A;  3GTP J;  2G0E A;  1WJC A;  3RQI A;  2G7U A;  3JRI A;  1XSV A;  1RPW A;  2D2W A;  2VT3 A;  3I54 A;  3FK7 A;  5E3N A;  2DBB A;  3S2W A;  2HVS A;  3CCQ I;  5A2Q Z;  2A6H F;  2KZG A;  3HIF A;  4LLL A;  4RB2 C;  2JJ7 A;  3N97 A;  3FIS A;  1SFE A;  3ISP A;  3C2H A;  1LFP A;  1SAN A;  2JWT A;  3FKI J;  3FXO A;  5ILU A;  5LEK A;  3U9G A;  2BBY A;  4EJW A;  2L02 A;  2R7S A;  4CCO A;  2B0L A;  5FFX A;  3TMO A;  4R1H A;  1O3S A;  4B4C A;  2VJJ A;  3UNG C;  1OYY A;  2K9M A;  1I6X A;  3KP6 A;  1BI3 A;  1X2N A;  1HSJ A;  1E2X A;  3MVP A;  1RR7 A;  2ELH A;  2K9S A;  3JRH A;  1WCM J;  3M9A A;  4A0Y A;  1W36 C;  2OPT A;  3K10 A;  4FTH A;  3M4O J;  3HPH A;  3OYI A;  2OF7 A;  3DLA A;  3RKY A;  4Y13 A;  4XLF A;  3CJN A;  2K40 A;  1WZ2 A;  2VKH A;  2HZD A;  4HEA 2;  5ICF A;  5CVR A;  1FOX A;  4GYG A;  4BNC A;  4A3G J;  4G6T B;  5EEH A;  1JT6 A;  2HI3 A;  4CIC A;  3LQR A;  1BN5 A;  1TBX A;  5DD8 A;  1FBS A;  3WU2 C;  1GXP A;  3S1N J;  1X4P A;  4U7D A;  4GCV A;  3M1C A;  2EV5 A;  2BVL A;  3KLN A;  3IWF A;  2A5Y B;  2HDD A;  2YU3 A;  2RN7 A;  1YQA A;  2W4S A;  3E0J B;  1ETV A;  2DMU A;  3IRQ A;  2DOE A;  3LSJ A;  4V2F A;  4XSX F;  2Y2Z A;  4BEH B;  3R61 A;  2KFD A;  4IZZ A;  1O3R A;  3OSG A;  3ZN0 A;  2BW3 A;  3ABL H;  4HF0 A;  4E70 A;  2PJP A;  2UWM A;  2EJR A;  5GPC A;  3S15 J;  1D8K A;  2IJL A;  2LP0 A;  4ZTJ A;  4J01 A;  4PJL A;  1HBX G;  2VQH A;  1K4T A;  3GTO J;  2WTE A;  1MBG A;  4IXA A;  1VQP I;  1R1U A;  2CYY A;  3L00 A;  1P92 A;  5JHF A;  4NB5 A;  5ICG A;  3IC7 A;  2DT7 B;  2XRO A;  1NK2 P;  2M7A A;  4EGZ A;  2F4I A;  1G3W A;  4MEY F;  3ZOB A;  2LOO A;  5DCF A;  3HRS A;  2ID3 A;  2EIK H;  2JMW A;  4AM3 A;  3S1Q J;  2QM3 A;  3GZN B;  4A3C J;  4DYR A;  1Y6I A;  1SVL A;  1XS9 A;  2LMD A;  2K4J A;  1FX7 A;  2W48 A;  4IQJ A;  4DOZ A;  5DUK A;  4Q5S F;  3A4C A;  4L9J A;  4ASN A;  5D6E A;  3OYJ A;  1J7K A;  1BL0 A;  2Y69 H;  2MYS A;  3F0C A;  3BTC A;  1JE8 A;  4JP0 A;  3EQL F;  4XLP F;  1APL C;  1FOY A;  2TDX A;  1P2F A;  1VF9 A;  3BY6 A;  2HR3 A;  2CV2 A;  3DTE A;  2L7M P;  3RTR A;  5HS8 A;  1G3T A;  4HLX A;  2FXA A;  1B9M A;  1YFH A;  3DTI A;  2GIZ A;  2WA0 A;  5LRR A;  4DQ2 A;  1I27 A;  3I0T A;  1J2X A;  3RPQ A;  3TOB A;  4DNC A;  2O6G E;  5IP9 J;  1PP8 F;  2OCE A;  2LDU A;  2P6T A;  1XCV A;  4WXC A;  4KA4 A;  3E5U A;  3GXO A;  4D0P A;  2GA2 A;  2G9W A;  4E7S A;  3JAM K;  1Z67 A;  1O3Q A;  1SFO J;  2KIF A;  1WH7 A;  4M6V A;  1X3Z B;  2FUG 2;  1R5G A;  3KEY A;  1VQL I;  1J5Y A;  2IS2 A;  2QBY B;  3CF2 A;  2PMU A;  1FIA A;  1JGG A;  1ETO A;  3WTW C;  1F9N A;  2VC1 A;  5CPR B;  3HEF A;  3Q0W A;  1S72 I;  4E7I A;  4M3D A;  2PN6 A;  1JHF A;  2ID6 A;  5FKO A;  3G73 A;  1XX5 A;  2KKO A;  3FMQ A;  5C44 J;  2ETH A;  3KE2 A;  1P4X A;  3OS2 A;  2DQL A;  5J47 A;  3VWB A;  3ZR8 X;  4LIT A;  4UNO A;  4UUT A;  1ZGA A;  2X85 A;  2XV4 S;  3PJR A;  4HZF A;  4IHY A;  1U3E M;  3TKY A;  4QSH A;  1OCP A;  4XOR A;  2NAZ A;  3JTG A;  1K78 A;  5HOO A;  1SD5 A;  3LA3 A;  2GOX B;  2H6C A;  4R8H A;  5JFR A;  5L3E A;  3DXJ F;  3H9G A;  1UAA A;  2DI3 A;  2V9V A;  3BG3 A;  2OV7 A;  4FQG A;  1UFM A;  3GTK J;  4DYQ A;  3ZP5 A;  1IRZ A;  2M8E A;  2WC2 A;  2CUJ A;  2QQB A;  2NOJ B;  4FET A;  4LIU A;  4LLG F;  1ZEL A;  5LGN A;  4A3J J;  2VQG A;  4P9U A;  1MJB A;  4YRV A;  2V1U A;  2XGE A;  2KRF A;  2KRC A;  4WX9 A;  1I3A A;  2MD0 A;  5D8L B;  2RV8 A;  3HM5 A;  2HQN A;  3OR2 C;  5KVR A;  1NH3 A;  4A0Z A;  3VYT B;  2QKL B;  4I0A A;  5IY5 H;  3LST A;  2HGC A;  3CLQ A;  3P5J A;  2AHQ A;  2EV6 A;  1J59 A;  2HQ5 A;  3OS1 A;  4KIB A;  2MA3 A;  3K4K A;  3BTI A;  3Q9V A;  5HNH A;  5E1W A;  4CXF A;  2BXY A;  5DUI A;  2ZSI B;  1WRJ A;  3F3X A;  3ZQH A;  1D1C A;  3VFZ A;  1JXS A;  4HRI A;  2YSR A;  1A31 A;  3K6G A;  4P1W A;  1WJB A;  1BR2 A;  3IV5 A;  2K9Q A;  1F43 A;  1BR4 A;  3WE3 A;  3L09 A;  4XN0 A;  4IOA F;  2CRG A;  2HEO A;  3I59 A;  1YRN B;  4RAG A;  1C0W A;  4ZJZ A;  1XD7 A;  3ECO A;  1TWC J;  3OL4 A;  5ERI A;  3H1C A;  2ZXI A;  4YFN F;  3NWS A;  4W97 A;  1XGN A;  2X4H A;  3DKX A;  1B4A A;  1FT9 A;  3ABT A;  4Z6Y A;  3QU6 A;  3V8L A;  3ABU A;  2NVT J;  5FLX K;  4E6K G;  1FZP B;  4KN7 X;  2OZU A;  1GVD A;  3OOU A;  1VTN C;  4C3H J;  1SFX A;  3ONQ A;  4RLF A;  4KMU X;  3DPU A;  3FMS A;  2R7V A;  1BM9 A;  1U0J A;  3TQN A;  3PIO F;  4WXH A;  4CCM A;  1ZYR F;  1JUM A;  3FBI B;  2CW7 A;  2E19 A;  1X1A A;  1GXQ A;  4M73 A;  4BBR J;  2LH9 A;  2FOW A;  3RDI A;  3TDZ C;  1TWA J;  2OD5 A;  3EUK L;  1LUJ B;  1IF1 A;  1MSF C;  2VLA A;  1ZK8 A;  3HOS A;  1D8J A;  1QA6 A;  3F21 A;  4A5N A;  2GZW A;  1XMA A;  2LRD A;  1NG7 A;  5BOX A;  5D5X B;  4LOC A;  3ZMU A;  2LKP A;  2X6Y A;  2L0K A;  3K9T A;  4RB0 A;  5FB2 A;  1QBJ A;  4CH7 A;  1B8I A;  5E20 A;  5BMZ A;  1T0F C;  4RS8 A;  1FSE A;  5IOY A;  2HKX A;  3CJT B;  5EEG A;  2LSO A;  1A6I A;  4QIW N;  2DCE A;  2BY2 A;  2KP6 A;  2GXB A;  4Y33 A;  3HTU A;  3I9V 2;  3V8K A;  4PJ0 C;  4IOC F;  2NNN A;  1W7P A;  1V5F A;  4HW0 A;  5FKL A;  1FYK A;  3W2W A;  3L1P A;  1OYI A;  1UMQ A;  3KZZ A;  4UXN A;  5HLT A;  2FBK A;  3CF5 F;  3OMY A;  5H6Q A;  3CUQ B;  3PNV A;  4LD5 A;  3JRB A;  4LK0 F;  5F0F A;  3NWT A;  1ZG3 A;  1ZGW A;  4BQA A;  1TWF J;  5HDG A;  1XMX A;  3KYC B;  4AVP A;  3IUO A;  5C4X J;  3K4L A;  5LLQ A;  1R4M B;  1UHW A;  5GAE J;  2EIL H;  1NG6 A;  2VBX A;  3VSL A;  2LBF B;  3V42 A;  3H5R A;  2VPL A;  1IXR C;  3ROU A;  3VPR A;  2DPD A;  3QWL A;  4BY7 J;  3BR0 A;  2OC6 A;  4OIN F;  4A2U A;  2JK3 A;  3TO7 A;  1RR8 C;  4RAZ A;  4OAZ A;  1ZRE A;  1AU7 A;  4EM1 A;  4P5O A;  1OJL A;  3LSH A;  4D5C A;  4BYY A;  1V4R A;  4J00 A;  1MJA A;  3QPS A;  2DA5 A;  4I01 A;  1PP7 U;  3VYR B;  3QYF A;  1EJ9 A;  3RZD J;  2EA4 A;  4N4N B;  1Z6T A;  3PO2 J;  3L2U A;  5HS9 A;  1LQ1 A;  3VDX A;  2UV1 A;  4IO9 F;  3GTG J;  3WHC A;  5DCM B;  3E6B A;  4OOI A;  3A01 B;  2EZI A;  1RNL A;  5ICC A;  3OYA A;  2VE9 A;  5B66 C; 
#chains in the Genus database with same CATH homology
 3TW6 A;  5FJ8 J;  2DMN A;  2NS7 A;  2LKX A;  1A5J A;  2NOG A;  4XIC A;  3HB9 A;  4A3L J;  2Y9Z A;  1MBH A;  4A3B J;  3HKZ N;  2LLK A;  4FCY A;  4RBO A;  2XB0 X;  1JKR C;  1LE8 A;  2DA4 A;  1JKP C;  2HXO A;  1ORK A;  3ZQI A;  2VI6 A;  3MKL A;  3HOU J;  2Y9Y A;  3HOZ J;  1WGX A;  2LFB A;  2Y31 A;  2LD5 A;  2DMQ A;  4QTR A;  1H88 C;  1Y1W J;  5E3L A;  1AKH A;  1TC3 C;  2M9H A;  3SJM A;  5E3M A;  3WHB A;  3I4N J;  5EYR A;  2CQQ A;  3BG5 A;  4M3B A;  3ZQF A;  5IP7 J;  3ZQG A;  3BR6 A;  3JRE A;  1RKW A;  2CU7 A;  2YU9 J;  2YUS A;  2D5V A;  1Q1V A;  3HGG A;  3GTJ J;  3S1R J;  4BKX A;  1GV5 A;  5FKN A;  4A3F J;  2M34 A;  1JJ8 C;  1QPI A;  3S16 J;  1ETK A;  3BTL A;  3BTJ A;  5EG0 A;  4B1R A;  3A01 A;  2NVY J;  1IDY A;  1UHS A;  2DJN A;  1S7E A;  3SFI A;  2DMP A;  3LSP A;  4UUS B;  2LK2 A;  3GBG A;  2H8R A;  2O7O A;  2E2J J;  5M3M J;  1BW6 A;  3BR5 A;  3BR2 A;  1UG2 A;  3GTP J;  1MH4 A;  2QF7 A;  2G0E A;  1HLV A;  3RQI A;  3JRI A;  3Q3S A;  1RPW A;  1X2M A;  4MLO A;  3SDG A;  2WV1 A;  3FK7 A;  5E3N A;  2LTP A;  1HDD C;  2DA1 A;  1Z77 A;  2ECB A;  4D7N A;  3NAU A;  5M5Y J;  2JJ7 A;  2AO9 A;  3FK6 A;  3K7A J;  3FIS A;  3FIW A;  1SAN A;  2JWT A;  3FKI J;  5BNG A;  1FIP A;  3G1O A;  4CYC A;  3RKQ A;  3S2D J;  3OIO A;  2HOS A;  2VPR A;  5EDN A;  4B4C A;  3I4M J;  4IEJ A;  2EQR A;  1X2N A;  2KT0 A;  3K2A A;  3MVP A;  1RR7 A;  1LFU P;  2K9S A;  3JRH A;  1HOM A;  1X58 A;  1WCM J;  2XSD C;  1HCR A;  2R92 J;  1BA5 A;  2OPT A;  5F04 A;  4FTH A;  3M4O J;  4FIS A;  5HOD A;  2B63 J;  5K7Z A;  2OF7 A;  1RES A;  4A3M J;  1T33 A;  3IH2 A;  2CQX A;  2K40 A;  4Y52 J;  3HDD A;  1TWG J;  4A3G J;  2YS9 A;  2L9R A;  3LNQ A;  1JT6 A;  2HI3 A;  3JRC A;  3A02 A;  1R9T J;  1P7J A;  1O4X A;  4C3I J;  2ELK A;  3TP3 A;  3S1N J;  4S0H B;  4V2G A;  1GDT A;  3H0G J;  2X9D A;  3G1M A;  1JKQ C;  3BR1 A;  1GT0 C;  3HOX J;  2HDD A;  4C3J J;  2HOT A;  1WH5 A;  1ETV A;  2DMU A;  2EH3 A;  2VUM J;  3LSJ A;  4V2F A;  2E1O A;  1U9N A;  2Y2Z A;  2ME6 A;  1DU6 A;  5F08 A;  4DYC A;  3H3V K;  3OSG A;  2HXI A;  3G1L A;  3BG9 A;  2LR8 A;  2VKV A;  5GPC A;  4GFB A;  3S15 J;  2LP0 A;  2VKE A;  1ZKG A;  4FE4 A;  2PMZ N;  2M8G X;  2NVX J;  2COB A;  4DW6 A;  3GTO J;  1MBG A;  1NK3 P;  2JA6 J;  1NK2 P;  4M3F A;  1PUF B;  1ETX A;  2MGQ A;  2WB1 N;  1ETY A;  3ZOB A;  4A93 J;  5J3L A;  1G2H A;  2R5Y A;  2R5Z B;  2ID3 A;  2JMW A;  4XRS A;  1B8I B;  4C2M J;  3S1Q J;  2FX0 A;  2DA7 A;  4A3C J;  4DYR A;  4MO7 A;  3M3Y J;  4Y7N J;  2Y30 A;  1XS9 A;  1JJ6 C;  4X6A J;  2W48 A;  5C3E J;  3TW7 A;  3MN2 A;  2MSY A;  5C4J J;  1XC5 A;  5M5W J;  5J1U A;  1JUP A;  1HDP A;  3GTQ J;  1BL0 A;  5M3F J;  5EZH A;  5IOZ A;  3F0C A;  1IUF A;  3BTC A;  1APL C;  4JP0 A;  2LVS A;  3S14 J;  2X6O A;  2R0Q C;  1VF9 A;  9ANT A;  4I6Z A;  2L7M P;  2GBY A;  1MBJ A;  5J1R A;  2DMT A;  2O9L A;  1JTX A;  4IHW A;  1RKT A;  3TP0 A;  1ETQ A;  1T56 A;  5F0H A;  1WI3 A;  1H8A C;  3B6A A;  5IP9 J;  1I6H J;  5EZG A;  3D1N I;  1GUU A;  3RZO J;  1SFO J;  1PUF A;  3IH3 A;  3LSR A;  1CQT A;  1WH7 A;  4M6V A;  2M2E A;  2E2H J;  3HOY J;  1FIA A;  1JGG A;  1ETO A;  1ZTR A;  3ZQC A;  2TRT A;  4EEF G;  5EEA A;  2EZL A;  3HEF A;  3Q0W A;  4M3D A;  2ID6 A;  1OFC X;  5FKO A;  5C44 J;  1W0U A;  1F36 A;  2L7F P;  1JKO C;  1JUS A;  4UUT A;  5IPA A;  2CJJ A;  5GP9 A;  5IYD J;  1EF4 A;  4IHY A;  4M3G A;  3DCF A;  4QSH A;  1OCP A;  2GLO A;  2EBI A;  5GPA A;  4XRS G;  1P7I A;  4UUS A;  4AYB N;  1AHD P;  1NTC A;  1HF0 A;  2RAE A;  5JLW A;  2IAI A;  2LY9 A;  4M3E A;  4HNV A;  2MW8 A;  4XRM A;  3BG3 A;  2X48 A;  3GTK J;  3A03 A;  4DYQ A;  4L5E A;  1IRZ A;  3JRA A;  1MH3 A;  4A3J J;  3Q0V A;  2DA6 A;  2XGE A;  1RET A;  2XB5 A;  1IJW C;  3HM5 A;  1B72 B;  2E2I J;  1AKH B;  4XID A;  2Y0S N;  1OCT C;  1BW5 A;  2R93 J;  3E7L A;  3JRD A;  4MFD A;  1K83 J;  5FKK A;  2AHQ A;  2FQ4 A;  2HQ5 A;  4G12 A;  4ABZ A;  2N8G A;  3O8G A;  3CDL A;  3BTI A;  4A3E J;  5EGO B;  2CUE A;  4A3I J;  3DEW A;  1MSE C;  4BY1 J;  3GTM J;  4J19 A;  3ZQH A;  1D5Y A;  2I10 A;  3S17 J;  3CQZ J;  1ENH A;  3BT9 A;  3IV5 A;  4A3K J;  2K9Q A;  2HOA A;  4FE7 A;  2R7Z J;  1F43 A;  3JRG A;  2ZB9 A;  1DU0 A;  2CRG A;  1YRN B;  5FLM J;  3QQA A;  3UKG A;  4X1E A;  1TWC J;  2P81 A;  4DZP A;  1K61 A;  1IGN A;  5J1Y A;  4W97 A;  4IHV A;  3CMY A;  5EF6 A;  1POG A;  2FJ1 A;  1BJZ A;  2NVT J;  4AUX A;  1B72 A;  1GVD A;  3OOU A;  3ZQL A;  4C3H J;  5IYB J;  5M5X J;  1ZR4 A;  3LOC A;  1W0T A;  3BQZ A;  1IC8 A;  4CYC B;  1QRY A;  3CCY A;  4D7M A;  1IV6 A;  1JUM A;  5FKM A;  2E19 A;  2XPU A;  4BBR J;  3W6V A;  5EGO A;  1Y1V J;  1TWA J;  1U78 A;  2H1K A;  2K9N A;  1QVU A;  1MSF C;  1ZK8 A;  2DTZ A;  1E3O C;  5F1J A;  4JX6 A;  4XK4 A;  3JR9 A;  3BR3 A;  4MIM A;  1IDZ A;  3JRF A;  2O8K A;  2IEK A;  2DA3 A;  3PM1 A;  4LOC A;  2CUF A;  2JA5 J;  1YRN A;  2L0K A;  1ITY A;  2R5Z A;  2TCT A;  2GM4 A;  4DZJ A;  1B8I A;  2WAQ N;  4I76 A;  4BXX J;  5IOY A;  1U8B A;  3BQY A;  1A6I A;  4QIW N;  4RDU A;  4JX5 A;  3QPL A;  3HGY A;  3PO3 J;  3NAR A;  3HOV J;  5IYC J;  2HYJ A;  5FKL A;  1MBF A;  3O8H A;  1H89 C;  3L1P A;  1UMQ A;  4JX4 A;  5F0C A;  5K7F A;  4BBS J;  3HBL A;  1IG7 A;  3S2H J;  2XPW A;  2JA8 J;  2NS8 A;  1TWH J;  5K7H A;  2ME0 A;  1U9O A;  3JRB A;  1VFC A;  5F0F A;  1ZGW A;  1I3Q J;  1TWF J;  3HOW J;  1MBE A;  2MG4 A;  1VI0 A;  5E3O A;  5C4X J;  1GV2 A;  5FLV A;  3LSG A;  2XPV A;  1LE8 B;  3C2B A;  5F27 A;  5JLX A;  1WPK A;  1MNM C;  1I50 J;  5IP6 A;  4D5F A;  3Q0U A;  4NDL A;  3VPR A;  4B3A A;  4BY7 J;  2XGC A;  3BR0 A;  3TED A;  1FTZ A;  4AC0 A;  2JK3 A;  1FTT A;  2JN6 A;  2EZH A;  1XG1 A;  1AU7 A;  4MFE A;  2IBD A;  4A69 C;  1LFB A;  1JTY A;  2R5Y B;  1OJL A;  4D5C A;  2NVQ J;  1FEX A;  2QCO A;  1JT0 A;  3QPS A;  2DA5 A;  5DTD A;  2XRL A;  3S1M J;  2ECC A;  3OSF A;  3IH4 A;  3RZD J;  1Z0X A;  4W1U A;  1MBK A;  2FD5 A;  3PO2 J;  2L7Z A;  2M0C A;  4IHX A;  1ETW A;  5DS9 A;  1FJL A;  3B6C A;  2KDZ A;  2EZK A;  2DA2 A;  3GTL J;  2DN0 A;  1VND A;  1ZR2 A;  4JYK A;  3WHC A;  3GTG J;  5EG0 B;  4A3D J;  3A01 B;  1ZQ3 P;  2EZI A;  2XGD A;  2JA7 J;  1QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...