1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
5HP1A 2DFHA 2P1JA 4O0IA 2VWJA 2KQ2A 4DFKA 1TK8A 4M42A 3QLHA 3ZT3A 1WN7A 2EX3A 1S1UA 4FJGA 4DSIA 1Q8IA 1VSFA 4CHQA 1N5YA 4TSXA 4OVLA 3SUPA 3KTQA 3UIQA 2YKNA 4H4MA 3WNHA 4FM2A 4CEAA 3G10A 2O4IA 4FLWA 2WOMA 3SI6A 2D0BA 1S1VA 2VWKA 1KCFA 3HP9A 3O3FA 2A1SA 4W5NA 1NK6A 1YT3A 1JKHA 4KRFA 3T3FA 3C6TA 3THVA 4FJKA 1SV5A 1RBTA 4J2BA 1MW7A 1C1BA 1HNIA 1REVA 1RT6A 3IS9A 4EP5A 1IH7A 4KFBA 4F2RA 1Z25A 1Y97A 5C42A 2OYQA 3OS0A 4DSLA 3SNNA 4B9UA 2B4JA 4OGCA 2G8HA 3AVJA 4C8MA 1RT1A 1SUQA 3DRRA 4CEDA 3WNFA 5J2NA 1IKYA 4BE2A 4F3TA 4DQPA 4KV8A 3DOKA 1LWCA 2X6NA 3V9WA 1TKTA 1U48A 3AO4A 4FK2A 5HRRA 3CM5A 1JLAA 1S5JA 2YNHA 2P5OA 2EHGA 1Q9YA 3RRGA 1LW0A 3VQQA 3RR8A 4MFBA 2AJQA 4KB1A 1VSIA 1X1PA 4IFYA 3SJJA 1KVAA 4Y1DA 1WJBA 1I39A 3ZCMA 3RMCA 1BIZA 3AA3A 4AHCA 3KLIA 1TL3A 2IAJA 4M3TA 2XY7A 4RW8A 3ZSOA 4HUGA 3KJVA 4BDZA 5CYQA 3ZSYA 2Y1IA 4CESA 3IRXA 2ATQA 3LWMA 4CGDA 3VA0A 3NHGA 3VQEA 4FJMA 1JLQA 2XY5A 4KI6A 1DLOA 2Z1IA 5KTQA 4RW9A 1QTMA 4O0JA 4KHQA 4C8OA 1UAXA 1EX4A 1J9AA 3V1QA 5C24A 3OYGA 1KONA 3P83D 4DSFA 3L2UA 3TAFA 5K14A 3LP0A 1NK7A 4DQIA 3QEIA 1JLEA 2XO7A 3BDPA 5HROA 1WAFA 4CFCA 3L3UA 4Z4GA 4OPKA 4BWJA 4EZ6A 4AILC 3SQ1A 3FFIA 2YNGA 4RG8A 3PX0A 1TL1A 3AVGA 3SUOA 1WSIA 2W42A 3PUFA 4DSKA 4CJSA 3OYBA 2G8KA 3PO5A 1VSMA 4FLTA 4E1NA 2Z1GA 3HYFA 1HMVA 3DLEA 1JLFA 5KGWA 1VSEA 4AHTA 3TAPA 4FJHA 4NCBA 4M3XA 4BWMA 1BQNA 1WAJA 4LSNA 3DYAA 3I0SA 4J2EA 2E4LA 1HJRA 4CFDA 4CJRA 2KZZA 2O4GA 3LAKA 5FDLA 3V1OA 4DU1A 4ELUA 4BDYA 1ASUA 3DOLA 2G8UA 4FW1A 3RMBA 2Z1HA 2G8WA 4YFUA 4C8KA 2RF2A 3HO1A 5CZ1A 4DG1A 4DFMA 3V81A 1VSHA 2PYJA 4JS5A 3ZSWA 4EP4A 1KLMA 1WLJA 3AVIA 4HHTA 2RKIA 4G1QA 2IOCA 3KK2A 3K2PA 3C94A 4Z4CA 1S9GA 1QSLA 3HSTB 1XHZA 3P5JA 1KRPA 2FBVA 3AVHA 3T19A 4KPYA 4I7FA 4CF8A 1T7PA 3TAMA 1RBUA 4GVMA 1CZBA 1WSGA 4RW4A 3AV9A 3L2QA 3JYTA 3NDKA 3SZ2A 4KB0A 4CEZA 3ALYA 3VQBA 3L8BA 2D0CA 1ZBLA 3M8PA 2XRIA 3LP1A 3O4QA 3HVTA 4JRPA 1CLQA 4KO0A 5HRSA 1WNSA 5E41A 1WSEA 3DRSA 3TAGA 3HJFA 3ZT2A 3SQ0A 4Z4HA 2XY6A 3IAYA 3SQ2A 1KLNA 3M8QA 3OS1A 4KAZA 1EP4A 3MXJA 3NF9A 3HVRA 2XY8A 3QEPA 5FRNA 3CYMA 3S3NA 2D0AA 3V9XA 1KSPA 3AA4A 1TKXA 5CY4A 4E1MA 2HHXA 2KFNA 1ZYQA 4FM1A 4ELVA 2HNDA 1LAWA 4NYFA 4O55A 3EYZA 1VSLA 1U45A 3NGZA 1TK5A 1RT2A 3PX4A 1DTQA 3CFRA 3NCIA 3TAEA 1RTJA 1RT4A 1YVUA 4F4KA 1ZBHA 5I42A 3E01A 4W5QA 4CE9A 3NH1A 3OYFA 2VG7A 4CF0A 4FJNA 4N41A 2QXFA 4NCAA 4OLBA 3KK1A 1TAQA 4CEOA 3VQ4A 3HPOA 2QK9A 3QIOA 3AVAA 4IBNA 4B08A 1RBRA 1GOCA 3RWUA 1HQUA 3H08A 4DU4A 3M8RA 3KD5E 4DS5A 1RT3A 4AHSA 1JL2A 4FLZA 3AVLA 1TK0A 4M41A 3K57A 4FJ9A 4IG3A 1BGXT 1RDDA 3S9HA 1MU2A 2YNFA 1KFDA 1KVCA 3MECA 3QEWA 2F8SA 4FK4A 1L3SA 1QE1A 4EZ9A 4KI4A 3NF7A 3QERA 3RMDA 4DLGA 3K5MA 1HNVA 4HTUA 3V4IA 2ZE2A 4I2PA 4PUOA 3OYAA 3OYDA 1L3TA 1VSDA 4M45A 1DTTA 2HHQA 1BI4B 1HQEA 3HT3A 3QNNA 4FJLA 3AO3A 4E19A 4HVJA 3F9KA 3CM6A 4IG0A 4DS4A 4CGJA 4B8CA 3K59A 2BE2A 3OYIA 4FXDA 4FYDA 5DK5A 4B3OA 1QHTA 3AVKA 3VQ9A 4OPJA 3VN5A 4FCYA 3OYMA 3QO9A 1U04A 3LP2A 4LY7A 2XHBA 3TWHA 2OZMA 1JLGA 3K58A 4LSLA 4CGIA 1XHXA 3VQ8A 5KGXA 3M8SA 3V6DA 4L8RB 3CG7A 3OS2A 5EU7A 2OPPA 4Q5VA 3VQ5A 1UOCA 2JLEA 5T7BA 3ZSZA 1FK9A 4Z4EA 3JSMA 1RNHA 2OPRA 1X9WA 4F3QA 1D9DA 4BE1A 4Z0UA 3PX6A 3RMAA 3OJUA 3AO5A 4CK1A 1CXUA 2G8IA 3ZT0A 5D3GA 4PY5A 4DTXA 1UA0A 1S1XA 2BANA 1SL1A 3OYEA 1I3AA 3F73A 2HHSA 4J2AA 4CJEA 1HRHA 3SYZA 3LALA 3TANA 5SWMA 5HLFA 1ZBFA 3NGYA 3LZJA 4FW2A 4QAGA 3K5NA 1RTDA 2QKBA 1ZBUA 4FJXA 4OKKA 4W5OA 2RPIA 4CF1A 3LDSA 1LWFA 4FLVA 4CGHA 4ICLA 1F21A 4AHRA 4Z4IA 4LH4A 4B9TA 3IG1A 4HUFA 1JLBA 4Y1CA 1GOAA 1IG9A 1JLCA 2HB5A 2IGIA 1TV6A 1RDCA 4HCBA 1JXBA 4N56A 1NJXA 2GV9A 4CHYA 2HNZA 5JS2A 1X9SA 1NKCA 1NK0A 1L5UA 3SCXA 3OYHA 1ITGA 4DSEA 2A1RA 4CIFA 1EETA 3AVMA 1BQMA 1LAVA 5I3UA 4CECA 4CJVA 1WJEA 3RTVA 4ZTFA 2X78A 3DLGA 4DLEA 3OYNA 2HHUA 1HYVA 1WJDA 4MQ3A 3LAMA 3TR8A 4AH9A 1XI1A 4I9LA 5FROA 2NUBA 2D5RA 4IKFA 1NOZA 3NH0A 3S3OA 4HCCA 1XWLA 1NK5A 4FJ5A 4AHVA 3ZSRA 2R7YA 4CK2A 1O1WA 2OPQA 3QIPA 4Z4FA 2RN2A 1RT5A 4CJFA 2FBTA 3HPHA 1TKZA 1RDAA 1RT7A 2FBYA 3KKRA 4OJRA 1VRTA 1E0EA 4ZHRA 3ZSQA 1G15A 1NK8A 4FZZA 2DTUA 4CF9A 1TGOA 4JS4A 4M3WA 4GMJB 4J2DA 1S9EA 4HUEA 2HMIA 4ZTJA 4KHSA 1CZ9A 1FKOA 2KW4A 5KRTA 3ULDA 1J54A 1EXQA 3SUNA 3HL8A 3AVNA 4B9VA 4CERA 3TABA 3CFPA 4KHNA 5J2QA 4O5BA 2OZSA 4N47A 1GOBA 2FC0A 2IC3A 3RR7A 4CGFA 3VA3A 2YHAA 4XIUA 4DQQA 2G8FA 1JL1A 1WSJA 2X6SA 3KLEA 1IO2A 4FZXC 1BI4A 4R5PA 1KVBA 1EKEA 1UA1A 3LP3A 1U4BA 3HP6A 3SPYA 3ASMA 2I5JA 3KIOA 3KLGA 3DRPA 5J2PA 2P5GA 4Q0BA 5DMRA 1TVRA 1QQCA 2PZSA 1D9FA 3NFAA 3L2VA 4BACA 3O3GA 1NK9A 3CQ8A 1T05A 3EY1A 1L3VA 4IDKA 3DLHA 4QCLA 5KI6A 1T03A 1WJAA 3RRHA 4O44A 1LFPA 4WE1A 4OGEA 4CJUA 2KFZA 1C0TA 3G0ZA 1YTAA 3D45A 3EZ5A 1X9MA 1SL2A 4CEBA 4B8AB 4OKJA 4DTPA 3OY9A 2OPSA 3KLFA 4FLUA 1RTIA 4RW7A 4AHUA 4CHPA 3QETA 2YKMA 3DM2A 3V9UA 2Y1JA 4M3UA 4KTWA 1WJFA 2WONA 4CEQA 4BE0A 3I0RA 1TAUA 2X74A 3V1RA 3AA5X 3C6UA 4PWDA 5JS1A 4FK0A 4W5TA 1NOYA 2QKKA 4N76A 1A5VA 1UWBA 2G8VA 1A5WA 4CJQA 4N5SA 1WSHA 1BISA 3LANA 4CF2A 1B9FA 3DLRA 1U47A 4CJWA 4M3RA 1RTHA 2YV0X 4CHOA 5KRSA 5J1EA 2E6LA 2VG5A 1NJYA 4KHWA 3VQDA 4E7HA 1B92A 1W9HA 4GW6A 3SV3A 3K5LA 4C8NA 3I8DA 4DU3A 2KZMA 1NJWA 4W5RA 3HXMA 1RBSA 3SQ4A 4KHUA 4E89A 1FKPA 4PA1A 1A5XA 1BIUA 5CYMA 1WSFA 4F8RA 1LWEA 4FJIA 3PO4A 4CJ3A 1BHLA 4UQGA 3WNGA 4NYNA 3DLBA 2LSNA 3MXMA 3P1GA 5HRPA 1BCOA 1NJZA 3D0PA 4KKOA 4KTQA 2BGGA 4NCGA 4CJ4A 1BL3A 3QESA 3QEXA 3OVNA 3NBPA 3V9SA 2HHWA 1RDBA 1KTQA 3KK3A 3LWLA 3ITHA 3WNEA 1T8EA 4DQSA 1J5OA 1QSSA 2IS3A 3ZT4A 3QEVA 4DFPA 1C0UA 1NK4A 1HYSA 4DTRA 3SV4A 3DMJA 4DTUA 3K5OA 4H8KA 4CIGA 4DTSA 4ID5A 3VQAA 4CEFA 4DQRA 2HVIA 2IDOA 3NF6A 3U3YA 4FJ7A 1HYZA 4CEEA 1VK0A 3BGRA 2E6MA 3B6PA 4CFBA 3SPZA 4CFAA 3C95A 4F3OA 1ASVA 4CJLA 3HK2A 1ASWA 4CHZA 3L2RA 3NE6A 4CJ5A 1K6YA 2ITGA 1RBVA 5SZTA 3ZSXA 3OYKA 1JXEA 3ZSVA 4DWIA 4B9NA 1RCHA 5HBMA 4E0DA 2PY5A 1LW2A 2P51A 2B5JA 3O4NA 3OYCA 4C8LA 1N6QA 2HHTA 1C1AA 4K8XA 4E3SA 1LV5A 4CGGA 1VSKA 3NGIA 1C0MA 4FJ8A 2FBXA 4I9QA 2YHBA 2ETJA 3KKSA 4KREA 3CFOA 3MEGA 4BDPA 1HPZA 1ZBIA 2GUIA 4DF4A 4IFVA 3SUQA 4M3ZA 4RW6A 1S6PA 4YNQA 3QINA 3AO2A 4CJPA 3L2WA 1R0AA 1TKDA 3PY8A 2KTQA 3QNOA 3VQCA 3V9ZA 4E7KA 1RILA 2F96A 1S1TA 4FLYA 1CXQA 2DFEA 2ZD1A 4DTMA 4KTZA 4FLXA 2ZQBA 4LD0A 3U6FA 2BDPA 3A2FA 2YNIA 1QSYA 4OLAA 4FVMA 3U3GA 4CJTA 3AA2A 3AVCA 3NH2A 4CK3A 1S6QA 3MXIA 5CZ2A 4JRQA 4ELTA 1C6VA 1FXXA 3ZT1A 4DMNA 1KFSA 2Z1JA 1IKXA 3HPGA 1BCMA 4E7LA 3HM9A 3OJSA 1D5AA 1SKSA 1Q9XA 2VG6A 1NKBA 4B9MA 3PV8A 3TARA 3KD1E 4F2SA 5FRMA 3DI6A 3DLKA 4E7JA 4FZYA 3S3MA 2HVHA 3O3HA 1C1CA 3MEDA 1W0HA 3LPUA 2F8TA 4CJKA 2HW3A 3OYJA 3MAQA 4DTJA 2B6AA 3VQPA 4FJJA 1XC9A 4FM0A 3TAQA 4PQUA 2OA8A 3AVBA 3L3VA 4DSJA 3NF8A 3TI0A 2Q3SA 4E7IA 1L3UA 4B9SA 5HRNA 3VQ7A 1VSJA 3AO1A 4ID1A 4I2QA 1D8YA 1SKWA 1IKWA 4M3YA 1S1WA 4DTOA 1NKEA 4O4GA 4CCHA 1SKRA 2PYLA 2DY4A 4OKEA 1SL0A 1J53A 3ISNC 3KLHA 3LZIA 3AVFA 3LPTA 4DFJA 1U49A 3NAEA 1IKVA 4JLHA 4CHNA 4H4OA 3OYLA 3MEEA 1Z26A 4LH5A 1VRUA 4QOZB 3T1AA 1B9DA 3VQ6A 4CIEA 1YTUA 4B9LA 2GBZA 2DFFA 4DTNA 1QS4A 2JGUA 4K8ZA 1WJCA 5C25A 4KHYA 5J2MA 2HHVA 3B6OA 2HNYA 4DF8A
chains in the Genus database with same CATH superfamily
3CJ1A 3BWGA 1S1UA 2O8XA 1QVGM 5ICGA 2RHKA 5E3LA 1BR2A 5LLQA 1NK6A 5JLXA 3TP3A 1YITI 3HUGB 1TYQB 2ADUA 4BVOA 2UXCK 2RREA 1S5JA 3ULQB 4B3MK 4KB1A 5ILSA 3SJJA 4LK1F 4DZJA 1J7KA 1TL3A 3KJVA 5FKLA 2QQ9A 4MHGA 4DV0K 1POGA 2XY5A 2FE3A 4BGAA 4KICA 1J9AA 4QS8A 3MN5A 2GZWA 3AL0C 3H5RA 4HA8A 4EZ6A 3PL8A 1MMAA 4LG0A 1TL1A 2NRHA 2WAFA 3PO5A 3K9TA 4AHTA 3K9KA 1HJRA 1SQKA 2D45A 3CJ9A 5HNFA 3C2GA 3AAPA 4MFEA 1XHZA 1KRPA 1X4OA 2K02A 5D4RA 1YXQA 5C15A 3SZGA 1BOBA 1YF5L 1WRJA 1MH4A 2DA4A 3TAGA 4HSTA 2XHKA 1QQNA 4PGGA 3N4MA 3ZX3A 2YU3A 4U0YA 3QDKA 1Z3YA 3CUQC 4NYFA 5J4YA 2BHZA 4LOCA 4M9SA 3NGZA 4B8XA 3DLLL 1DGRM 1R7JA 1HPMA 4FWPA 2QQAA 3LDLA 3HPOA 2LF7A 5JHUA 5FKMA 3CP8A 1IC8A 5CJ9A 3NAUA 4QS7A 1GLCG 3VGLA 1GHCA 4IHWA 4BXXJ 2G7UA 1I1GA 2EV5A 4LY7A 2UUAK 4JNEA 4GV9A 1X1DA 3WEEA 2P7CB 4BE1A 3PX6A 4MTDA 1CF7A 2JVGA 4RGRA 1A04A 3LSPA 4FETA 1TLHB 1O13A 3L2CA 2JA2A 2MH2A 2PAVA 4G12A 1RDCA 3IUOA 1FBQA 4WF2A 5MLCQ 4YOXA 4U87A 1Z7LA 3P7NA 4UB8C 2X78A 4DLEA 1WJDA 1XI1A 2M5WA 3S1MJ 2HWVA 3SAHA 1ZYRF 1N78A 3MAJA 2HQRA 1MH3A 3MQ0A 1YVNA 1U2VB 2Z1DA 4HQMA 1VRTA 1G15A 2NAZA 2KMUA 4KHQA 1LOTB 3AVNA 1ETXA 2FC0A 2EFNA 3RR7A 3SLCA 1Q86O 1E4FT 4FZXC 2WC9A 3LP3A 5AQRA 2XUBA 5B66C 2F48A 3A0IX 3NFAA 3DWLA 1XSXA 3CQ8A 5LRRA 4IDKA 1K4TA 1FIAA 2EIMH 4CJUA 2JZYA 4JQFA 3LWFA 3ZQQA 3T69A 5JS1A 1P4XA 4KH4A 3JW4A 1NGIA 1BN5A 3CCVI 3CMEI 2UV1A 3PNTA 5JFRA 3HXMA 1S22A 4IZZA 2IVPA 3PO4A 3BR6A 3E6BA 3VDXA 2VWBA 3LQQA 3QESA 3QEXA 3NBPA 3WNEA 1FOKA 3DMJA 4DTUA 4H8KA 2ZGYA 3S1QJ 1G99A 4HQEA 3GFJA 4CZKA 2E1MC 3B6PA 5EOYA 4XH1A 2PJPA 1WPKA 3UKRA 2PY5A 2P51A 1NK3P 4E3SA 2FBXA 2QENA 5BPNA 4TV7A 1UMQA 2JA8J 4EMSA 3LSGA 1R0AA 4Y7NJ 2NXNB 2AP1A 2F5EA 4KTZA 2BDPA 4BQLA 5A2QZ 2CH0A 3LDNA 1A6QA 1FXXA 2KKZA 3RPUD 2VUMJ 4HDVA 4CD1A 3DFGA 1K61A 1ZN2A 3V42A 3L0QA 5C10A 1W0HA 5M1NA 4CZCA 2HBLA 4AVZA 4EJWA 3VQPA 3TAQA 2P7VB 5LRSA 3EE8A 1SKWA 3G71N 3MEXA 1U0JA 4O4GA 2DY4A 4RAZA 1BA5A 3S17J 1U49A 3OYLA 3CCSI 3I4NJ 3S2WA 3GLLA 1B9DA 1VQ4I 2Q0RA 1JCEA 4JV5K 3F8CA 4BC4A 1ERDA 3QYBA 2P9NB 2DCEA 3DEWA 1OH6A 2C6YA 2VASA 2FMYA 4FJGA 2KIQA 4DSIA 4I01A 4CHQA 2GBYA 5K5OA 5K5RA 3WTWC 2WOMA 3B02A 3O9RA 4V19K 2M34A 4Y4RA 1OCCH 4Q47A 2V1DA 1R5GA 1S29A 3MKLA 4DSLA 4C8MA 1BA1A 1RT1A 4CEDA 4M74A 3I4PA 4FHTA 4BGDA 3IWZA 4I7HA 5E18F 4HEA2 1D5VA 4I6ZA 2FBHA 1LW0A 4KDPA 2XY7A 1NGGA 1B4AA 2Z1IA 4RTFD 2L54A 5F1JA 4BL0B 4JI7K 4B43A 3LP0A 4EHUA 2K4JA 1GXQA 2CQXA 3FFIA 2E71A 1KA8A 3PX0A 3D2EA 2UUZA 2LY2A 3AVGA 1RGIA 3RKQA 3HYFA 2E20A 1S7EA 3I0SA 2F5DA 4ZYDA 3LAKA 4IQJA 4QS9A 2VPRA 1R4MB 2QWQA 1S9GA 4P1WA 3V8LA 4I7FA 4CF8A 3F72A 4GVMA 2EINH 3VERA 3L2QA 3M8PA 1SMTA 3HOUJ 1NMDA 3SQ0A 3TSUA 4K41A 2ITMA 2FOKA 1Z91A 4XRSG 2MYSA 4PZJA 2XV4S 1W5SA 3CYMA 1DUXC 4B3AA 2NRAC 3E6DA 1FOWA 1RT2A 2NLXA 1U9NA 1QU3A 3N4QA 3ABUA 4AHSA 2FRHA 4FLZA 3AVLA 2JA5J 3I56I 4RM2A 1YLFA 5JLWA 3JAMO 1I94K 3IDHA 3IV5A 3DXJF 1B6AA 4EM1A 3HRTA 3C7NA 3OIPA 3K10A 4WK8F 1XHXA 4C2MJ 3DQVC 4MEXF 3O9UA 1UOCA 2JLEA 1QZ5A 5LHGA 4GDFA 3RMAA 3OJUA 2N8GA 4RLQA 3VEXA 2R7XA 2HHSA 5SWMA 3NGYA 2ASPA 4B1VA 1ETVA 4AQYK 2G0EA 4WFNL 1N32K 2OU2A 3K1NA 3IG1A 1IDYA 2E2HJ 2I8DA 2KP6A 1MDMB 4HOBA 4YY3K 1O4XA 1SFEA 3DTIA 2RQQA 4MDAA 4I98B 4PDKA 3Q0VA 5FLXO 4I9LA 5LGUA 4IKFA 5AQXA 3NH0A 2V26A 5HDGA 4HDUA 3G25A 1GUUA 1B1BA 2V6CA 2O8BA 4OJRA 2DTUA 4CF9A 4FVUA 2HQ5A 4HUEA 1J54A 5F0XA 1GOBA 3VA3A 3MX2A 3QYEA 5AQWA 1EKEA 2KZVA 4AF1A 3E66A 2VKVA 3O80A 5JMVA 1E3HA 2CFXA 1OISA 4QCLA 5J47A 1ZRFA 4AM6A 5AZJB 3EZ5A 5K5QA 1SEUA 1ZG1A 2M4KA 2UZKA 2YKMA 4KTWA 4EHTA 5HDNA 1N75A 4LFCK 5EVZA 1RTHA 2NRXA 2M0CA 2HXOA 3RVCA 3SZPA 5DYMA 1O57A 3ZLJA 4C3HJ 4ON0A 3CXCM 1RI7A 1QSSA 1J5OA 1U8BA 1T8EA 2IS3A 3WXMB 1R71A 2VQGA 2Q97A 1KZHA 5B1BH 2JPCA 2OJED 3F6OA 2HVIA 1MNDA 2B9SA 2P5KA 2IDOA 1HYZA 3J8AA 1H9GA 4CJ5A 1L3LA 2QXLA 2CQQA 3P4IA 4JI6K 3D0SA 4BC3A 1C0MA 2ETJA 4M3ZA 1I50J 1TKDA 1GT0C 3TQNA 1JJ6C 2ZQBA 2O03A 2RDPA 1Z0XA 3DJCA 3MXIA 2NRWA 1P9QC 3O4WA 4D7NA 3HM9A 2M45A 3P9IA 4L3QA 1VQMN 4IJNA 3CJ7A 3O08A 3MWMA 4DSJA 2DA3A 5BMZA 4LG0B 4PJJA 5L3DA 5FJ8J 3VQ7A 4I2QA 2AXTC 1IKWA 4C23A 3CC4N 1J53A 3R0AA 4CHNA 4FWLA 3MEEA 3K4MA 3LA7A 4MLHA 2DFFA 1FJLA 3CF2A 4JHDA 2DO7A 2Z3YA 5LEKA 2DT5A 3HJEA 1S7AA 3BTJA 4Q5SF 1OKRA 2QSGX 2YX6A 3E9LA 4NNJA 5JHFA 3ENHA 3BZCA 3CDLA 3OR1C 3U8XA 1QQMA 1ZREA 1MMSA 3OS0A 3T8TA 3ZGKA 4E6KG 2D0PA 2XSDC 1IW7F 4KV8A 3S1NJ 2DN0A 4A69C 2WA0A 3X2QH 1VSIA 3R6MA 1WJBA 5E3MA 3KK7A 4BAYA 3F8NA 1JKPC 5H6RA 2PG4A 1IGNA 5C12A 4CCOA 1XMQK 1JLEA 3BCAA 4A61A 2EK5A 2Y48A 4LB6B 4YOTA 3K70C 1BQNA 4QWQA 2JSPA 4JBAA 3TKYA 2M7AA 3ABMH 5LJVA 3RMBA 3HDDA 2Q31A 3FFKB 1GDTA 5FGMA 2ZXJA 3G6EI 2FBVA 3WEEB 2X6OA 4H03B 4BVPA 1CF7B 4FTHA 5HS9A 1ZBLA 1WNSA 4ABZA 1Q81O 2XY6A 3SQ2A 1B72A 5M5WJ 3ZX2A 3S1RJ 4GYIA 2K4BA 2HHHK 1KSPA 2R5ZA 5TRDA 2Z2SB 2H8WA 2XDVA 4CVNE 1A35A 1U9OA 1ZBHA 2XRLA 4DV5K 3REOA 3WG9A 5D8KB 3KP5A 4P96A 4DS5A 1JL2A 2F4VK 4WFBL 2DT6A 2O8KA 5ILVA 2CJJA 1WZ2A 1ON2A 2V79A 2F8SA 1UG2A 3OYAA 3U9ZA 1HQEA 3ZQGA 4Y13A 3RPQA 3VQ9A 2XPWA 4UXNA 2IT0A 1JLGA 2HSTA 1KYWA 4DQ2A 4R8HA 3CCJN 4Z4EA 1AU7A 2HMPA 2V7ZA 4L18B 3L1PA 2R7UA 1J2XA 3HG9A 5LY3A 5GADP 4BR4A 1GOAA 2EIJH 1KYZA 1IRGA 1BW5A 2DMUA 5F27A 1AKHA 1ITGA 4CIFA 4U7BA 3ZMDA 4BS9A 1NGJA 2R7SA 1EH7A 1S6LA 1MNMC 3KLOA 2OPQA 1VQLN 3UKRB 4M3WA 1TGOA 5BREA 4RM3A 2F4MB 2W41A 1VQ9N 2ETHA 4II3A 4CCLA 1TT0A 5GAEP 1KVBA 1F36A 3TPQA 3RQ4A 1U4BA 3SPYA 3DRPA 1JTYA 1D9FA 3IAM2 4G6QA 3FF5A 1QPMA 4PK4A 2P9LB 1NK2P 3IC7A 4HLXA 4F9OA 5E1ZB 3MZHA 1D1CA 4G9YA 3CC7N 3GOIA 2QWPA 4RW7A 3H45C 1UCRA 2ZFWA 4LIVA 2QKKA 2V7FA 4MNUA 4L9JA 2ZSIB 1VHXA 1XGSA 2BUPA 4AM7A 4DR7K 3E6CC 4O8UA 3RIRA 4W5RA 4RGUA 3L09A 3OMYA 2AHQA 3P1GA 3FZKA 4KMFA 1OPCA 3QOEA 2YJFA 2NRZA 1R59O 4DUZK 2CRGA 3WTSC 2E6MA 3EDPA 2XIGA 3C95A 3HK2A 1B59A 3SMPA 2HHTA 2FX0A 3F9MA 2GTDA 3HM5A 3UKGA 3V9ZA 4OIQF 2OF7A 4YEJA 1S1TA 1QZYA 1V55H 2R7WA 3MCAB 1C6VA 4CZZA 2Z1JA 3HPGA 2CW0F 1IUYA 4E7JA 2XAJA 3ZMZA 3B73A 2VQCA 2PFUA 4CZFA 2P6SA 2M1BA 3D2EB 2CUFA 3ZP5A 1N8RO 4S04A 3BF1A 1IKVA 3CQZJ 5E20A 4H5VA 1USSA 2MFZA 4C2UA 4AIJA 3DKYA 5KNLA 2EPFA 3OTOK 4GY2B 2VQHA 3EE9A 3C0BA 4I6MA 5D6FA 1N5YA 4FM2A 4ZDLA 5B1AH 1JUMA 2O4IA 1TNTA 5IYCJ 2ESNA 2JRTA 2VQLA 4BNCA 3WXIA 1VQNI 2ZFUA 1VQMI 3AVJA 3QPHA 5J2NA 2CUJA 2HYFA 1TKTA 2OTJI 3ZETA 3QAHA 2EFPA 1E3PA 4CCMA 2A5WA 4FOEA 1V5EA 3W0LA 1EX4A 4UV9A 4J19A 4DV3K 4K25A 4OPKA 1BI1A 4D5FA 2STWA 3CJAA 4CFDA 2O4GA 5ADXH 1QHAA 3C7NB 5M1QA 5CZ1A 4EP4A 3AY9A 2DMQA 3U9DA 2OQRA 2BXYA 3UR3C 1J75A 1JGSA 4KT5C 5JLFA 1VNDA 3AV9A 2W00A 4M6XA 2XRIA 3LP1A 4DKWA 3HVTA 3NVMA 1MJBA 2ME0A 4NHJA 3WT0A 1MA9B 1NMNA 2JN6A 1EP4A 3RQIA 3QOPA 1KU9A 4X66K 3FZHA 1KQ9A 4KT6A 4O55A 3VF6A 2E34A 3IUCA 1RTJA 5F0CA 1L0OC 4LJZF 5ICFA 4CE9A 3ECHA 2QM3A 1YAGA 4NCAA 3J7YJ 2FF3B 1Y56A 4CZIA 2P9KA 1G3WA 5AQUA 3K4BA 2O8BB 1K83J 1N25A 3QEWA 4EZ9A 3FR0A 1Y1VJ 3OIQA 1NGHA 4ESJA 4F91B 1VSDA 5C2DA 2E5ZA 2NRVA 3ESWB 1GLFO 2KRHA 2NVYJ 4NXMK 4D5CA 1W7AA 4ZH4F 2E5NA 1YJNN 4Z0UA 4BXUA 1I3AA 3F73A 1MKMA 3IKTA 4S05A 1RTDA 3LSHA 3Q9SA 2A3SA 1U5TA 3OBWA 5GAHP 4B9TA 1JLBA 1WOQA 3S2DJ 5M1PA 4XK4A 2JA7J 1NKCA 1BUPA 2KDOA 2VCPA 4V19S 2E60A 2H6CA 3I71A 4A3FJ 2OV7A 2PMHA 3CCJI 4IRGA 4JKAA 4A3EJ 1ZLJA 5BR8K 1LCUA 2PX9A 1BW6A 3MWPA 4BRKA 4KHPK 1IXSB 2DI3A 4BRMA 1Q18A 3I4MJ 3KLEA 4IXCA 4ISFA 5J2PA 1BC8C 1QQCA 1Y39A 3THXA 2XPVA 4JKCA 1T03A 4WE1A 3FZFA 4YDUA 2P5LC 2WFBA 1NM1A 3KLFA 1FYKA 4MIMA 4M6VA 4BBSJ 4PWDA 4IVNA 1MJAA 2QQBA 4CZHA 4PFPA 1B9FA 4UUSA 5AQQA 5J1EA 4RLFA 1W1WE 3GFMA 3ZQ7A 2GXAA 3NVKA 1SANA 1JKOC 1ZGJA 4OWRB 1Y0UA 4JHDB 1BHLA 1W36C 3A5NC 1IBKK 3MXMA 2BGGA 1W97L 4DQSA 5LD2C 4GYGA 4ITVA 3H36A 3PIPL 1I27A 4IQ4A 4HX7A 5LGTA 2PJRA 4HPQA 1P92A 4RB2C 1LEBA 1ZARA 2Y0SN 3ZSVA 3CC7I 4OPHA 1QNTA 4FJ8A 3KKSA 4KREA 4KYWA 5FPNA 1ZBIA 2WB1N 4DF4A 5FB2A 3QINA 4LF5K 2OA4A 3PY8A 3QNOA 3OOPA 2KHOA 3IP4B 3O1WA 3TTFA 3C1DA 4IRHA 4CK3A 2M8GX 3CIPA 4FZYA 3S3MA 4G6TB 1XC9A 3AVBA 4QLCU 1IV6A 1NGEA 3D5LA 3KYDB 3TSPA 4LH5A 4YHHK 3IL2A 5HLHA 5J2MA 2Y9ZA 2HNYA 2E2NA 3S41A 4B47A 3UKUA 3H1QA 2LY9A 3UIQA 3CCUI 3A02A 5AR0A 3V7RA 3QQAA 3IS9A 4EP5A 1B72B 1MSEC 2G8HA 3N97A 3QODA 1U48A 3SEZA 3WU0A 4HX8A 4CJ7A 3RR8A 1QRYA 3HL2A 5DD8A 1MNEA 3MCZA 5CE3A 4EAHD 4IDHA 5C24A 4DSFA 2F5FA 1NH3A 1RDUA 2CW8A 1VQON 1QZEA 2L4AA 2E1NA 3EUHC 2HYGD 2GWKA 1HKSA 3RKXA 1RUNA 4CJRA 1UELB 2G8WA 1HW1A 4C8KA 3PIPF 1E4GT 2F5CA 1X4PA 1G8XA 3CCMN 1MJ9A 1DT9A 2XB5A 2NRRA 5JVTA 1D0ZA 3AVHA 4BRGA 3A1YA 2JQ7A 1V54H 4CEZA 5DUKA 5DM7L 5EF6A 2EQRA 1KLNA 2NRTA 5EYRA 2DJIA 4WQ4A 4PKHA 3COAC 2KFNA 2EJRA 4JEPA 1XGOA 1ZBSA 3EYZA 2KLOA 1MZBA 4ZC3A 2PMUA 1AKHB 1CQTA 1RESA 2M87A 4N41A 3UNGC 3S8PA 4CEOA 1XQSC 5LFAA 2DPUA 2E35A 3H08A 2EA2A 1HQCA 3QB0A 4MQ9F 3K57A 2V7YA 4FJ9A 3IFRA 3QERA 2HFHA 3C2BA 2HHQA 3CM6A 3K59A 3QFPA 4PFOA 4EGYA 2HVRA 2JA6J 2X1CA 4LF9K 2X6YA 3V8JA 2GA1A 1H9TA 4F3QA 4KUMA 3I59A 2G8IA 3RCOA 2KPMA 1VQKN 1IG8A 1RETA 2MC3A 5AIQA 4D0PA 4Y33A 4OAYA 3RI4A 2AA4A 1TWFJ 1Z6RA 4L9TA 1YJWN 1IRFA 2VGMA 3O9TA 4HCBA 3G1LA 2MABA 5JS2A 3O6WA 3H46O 1FZPB 3K1MA 3TR8A 2O0YA 3OR2C 4YFXF 3CCRI 2M8EA 3M8EA 3QIPA 2WBNA 1MBKA 4XIDA 1EXQA 4B9VA 5J2QA 4FOIA 4DQQA 3KLGA 2PZSA 4BACA 4BR0A 1YYVA 1WJAA 4CBWA 3FXQA 4ENNA 3G0ZA 1TUUA 4CEBA 3FK7A 2A3ZA 5DM7F 3H1CA 2EZLA 2QKMB 5AQZA 2EWNA 4BC2A 2ACJA 1UWBA 3U1KA 3CETA 2R3SA 3KEOA 4L9VA 3ERED 1J5EK 2ZC2A 2L9NA 1FKPA 2PFBA 4UQGA 3CMAI 2X48A 3WU1B 5D5UB 4WFAL 3AG4H 4I6MB 1VQPI 3QEVA 5HOOA 3AGKA 4ID5A 1BIAA 3H5AA 3G73A 5M3FJ 2L2OA 4H0TB 3OYKA 2KJBA 4JYKA 1LW2A 2B5JA 2EZKA 1LV5A 2VC1A 3ZMTA 5BQTA 4XONA 2GWJA 3LMMA 1XDSA 2KT0A 3L2WA 5EDNA 3SDGA 2ICWG 4A57A 1X2MA 4N9IA 1PDNC 1BDGA 4DTMA 1ZHFA 1LFUP 1VQ5I 4FVMA 3NH2A 4HG2A 3HOZJ 1KU3A 5IT9O 4KJZA 1SKSA 1Q9XA 1NKBA 2HZTA 5AQLA 3O2PE 3LPUA 2L9VA 2IGKA 3HXLA 1ZR4A 2P8TA 3C65A 3SJMA 3QFUA 4BRPA 1VSJA 2W24A 4DTOA 3V4GA 1VQ7N 2PYLA 3ZMUA 3CCLN 2MC4A 1VRUA 2D1KA 2D2WA 2VI6A 4XLNF 4DTNA 2HS5A 2ZNYA 1SAUA 3MKZA 1G3TA 3WNHA 1QHHD 1U3EM 2QW9A 2HU9A 3T0YA 2JWLA 3THVA 1REVA 1Z25A 3GE1A 4BRAA 4F3TA 3IH2A 4DQPA 4BREA 1H8AC 3CM5A 4KBOA 3JAMK 4IFYA 1MBGA 3DXMA 3NHGA 5F0FA 2VJ5A 1UAXA 2P9KB 3VEZA 4WXCA 3L2UA 3VSLA 1WAFA 4Z4GA 4BWJA 1R9TJ 2YNGA 4UHTA 1WH7A 5CVJA 1HR0K 3CF5L 4NCBA 3R9PA 1WAJA 4LSNA 2YX7A 4J8FA 3EZWA 3BEXA 5EGOA 3K6GA 1WLJA 1S7OA 1ZG5A 1NGFA 4I2OA 5AJ3K 3HSTB 2PLYA 5HLIA 1JUPA 5DV5A 1RC9A 3ALYA 3FMQA 1FNNA 1U5TC 5CPRB 5FLXK 4XOTA 3J81O 1IBMK 2GAUA 1MDUB 4GFBA 5LMUK 3HVRA 1UB9A 2D0AA 3V9XA 3DTEA 2BHYA 1TK5A 5J6XA 1K79A 1J5YA 3E97A 2GIZA 2WY7Q 2CW7A 4ISEA 4BRQA 3SFIA 3M8RA 1T44A 3G2BA 5E26A 1J09A 1JT0A 2MLGA 1ZELA 2ZMEA 2HNHA 1ZH5A 1S72I 3U4LA 1YI2I 2EILH 3LAJA 2IS1A 3VN5A 3THXB 2OZMA 3K58A 1EWQA 4Q5VA 4W97A 5C3EJ 4CK1A 3ZT0A 2VGNA 3G1MA 2VKDA 1S1XA 2E2PA 3OYEA 3FMRA 4CJEA 1LE8A 4UUSB 1ZBUA 2ZM6K 1U2VA 1LWFA 4P55A 4UV8A 5AQVA 2DPNA 1W5CC 1JLCA 3WTYC 4HF2A 1OFCX 3M1CA 4CHYA 1L5UA 2IS2A 2E19A 4CJVA 3DLGA 3LAMA 3E3VA 2QA4N 2QEXN 3GTQJ 4HZFA 4BHCA 1LJ9A 1RRJA 1GLAG 5BRFA 2FU4A 2PJRB 2NOJB 1O1WA 2FBYA 1EWRA 4EGZA 1RT7A 2EV6A 4ZHRA 2OTLI 3LFUA 3CF5F 2K3PA 2L9RA 3EKUA 1PP7U 2P9SA 3FZVA 1QVTA 3M7GA 1B9MA 4H0XB 1ZGWA 1BI4A 5TISC 1QHGA 3DKXA 4JYAK 4E7ZA 1YOVB 4BQNA 4PGHA 5FD6A 2COMA 3THWA 2LYCA 3JSOA 2Q0UA 4H0PA 1OH5A 2IEKA 1YW7A 4X1EA 3CCQI 1YTAA 3D45A 3M3YJ 1YHQN 3FHNA 3AG2H 2OPSA 3QETA 5ED4A 3V9UA 1WJFA 2K9MA 2WONA 5AFUA 3HRUA 1IV0A 2BH1A 3ZMSA 2G8VA 3LANA 1J0RA 1XGNA 1NJYA 4RGXA 2VKEA 3SV3A 3P9KA 4D9JA 4KHUA 2ZF5O 4BEHA 2AO9A 5HRPA 3D0PA 4CJ4A 4FISA 4MO5A 3UKUB 1KTQA 3LWLA 4FWSA 4CHUA 1C0UA 1W5TA 3K5OA 2R4GA 2KHMA 4F93B 4ZZDA 2O9LA 1LKXA 4R79A 1SFXA 4CGZA 1LB2A 4I9QA 2YHBA 3MEGA 4BDPA 3QU3A 3HEFA 1DDNA 2YNIA 1IJJA 1S6QA 4XM3A 3QPLA 4PCQA 1K8KA 4F2SA 4B9MA 3CD6N 5FRMA 3CTAA 1C1CA 3E5QA 4CJKA 4YFNF 4H4KC 2LKPA 3MWTA 1ZLKA 1HXDA 2ZJQL 3KLHA 1WKMA 2LTPA 3LL3A 1BOTO 3WTTC 3BY5A 5BPMA 4O8KA 4JK9A 1NTCA 4KN4X 1GVDA 3VYSB 4C1NK 2GLOA 3KP4A 3E1YA 1F9NA 1ZXOA 3O1BA 1NBWA 2FSWA 1ACIA 2B0LA 1S1VA 4LF4K 4KRFA 1QA6A 2H09A 4F2RA 5BNGA 4G9ZA 2Q8KA 4XRFA 4DHYA 2NZTA 4GKKK 5HNHA 3K4NA 4IHYA 4FK2A 2YNHA 4YOVA 3CUOA 4ZYHA 3WUHA 3RMCA 3CCLI 4IOAL 4HUGA 2F4OB 3B6AA 2R92J 2Y30A 4UY8O 3DBRB 4GV6A 1Y0NA 2DA5A 1QTMA 4C8OA 4H0VB 3VF2A 1TNSA 4WQ5C 4RAYA 3QBXA 1E17A 3L3UA 2K85A 3ZMVA 3M1EA 4YIRX 4PL8A 1HDPA 5CHIA 2G8KA 1BR1A 3FZLA 3D6RA 2FSKA 4XLHA 4EFHA 2LC2A 5JI6A 1V4RA 4B1XB 4MO7A 2WAEA 2VL8A 2PYJA 1IXCA 2J5OA 4HHTA 2Z9OA 1T33A 1PVEA 2RGVA 5JLHA 3CZ6A 3I59B 5BPDA 2BV6A 4FWMA 3U9GA 1CZBA 2HKOA 3GVAA 4BHPA 4IHSA 3RSEA 4BQQA 4KO0A 3EL2A 2K3FA 5E41A 1MD0A 3W6VA 3OS1A 2AS5F 3NF9A 4JKGA 2CO5A 1XGMA 3I54A 1VF9A 4Y15A 4LC9B 4FM1A 3DBHB 4IXAA 3HRSA 1YRNA 2QWRA 4XKWA 3LSMA 3BROA 2GA2A 4UVBA 4M3BA 5AQNA 1LEAA 2YSRA 3DXKA 1XC3A 4V2FA 4FJNA 1NGCA 2LRDA 3QIOA 4CYDA 4DU4A 3R1XA 2FXAA 3CCYA 4M41A 4FX4A 2ZJQF 4AYBA 4XLEA 3C18A 3K5MA 1EH8A 2X1EA 2XRNA 1FPQA 5AQSA 4FJLA 3N05A 4B3OA 2QSHX 4FCYA 3CCEI 3S16J 1MBHA 1XMXA 2OPRA 1D9DA 3E9PA 2X9DA 1BA0A 1UA0A 4HBLA 1T6CA 1ZBFA 4H5WA 4ASNA 1P4AA 4CF1A 4ICLA 2GWRA 3VODA 4LH4A 4HUFA 1ETWA 3WXKA 4IOAF 4Y1CA 3HB9A 2CUEA 3GF2A 5GTHC 4H5NA 2JVHA 2E1CA 5GAGP 4C2TA 3VEOA 2BY3A 3ZXSA 4GXOA 4CECA 2LP0A 2WTUA 3H0GJ 1U2WA 3NMUA 1OR7A 3KP2A 2DDAA 1R58A 1NK5A 4ZYAA 5BN9A 2XC7A 4YFKF 1NK8A 4JX4A 3ZSQA 3TL4X 2CQ7A 2P81A 3LSKA 2LREA 2HMIA 3ZQCA 2KW4A 4CO8A 3HL8A 3K9JA 2IC3A 3P31A 4Z2YA 3KIOA 4ZYGA 2P5GA 3I58A 3HOSA 2P6TA 3IH4A 5J40A 3O8HA 2DA7A 3RRHA 5K1YA 5KPZA 1ZQ3P 4CZLA 4UUVA 4DR4K 3VEYA 1R1UA 1FYMA 1NOYA 3IHUA 3EN9A 1BISA 4JI8K 1NNEA 2D0OA 4XSXF 4OINF 4E7HA 4YIFA 1W9HA 1O3TA 2D5VA 4C8NA 4XICA 1A5XA 4I0BA 3Q0UA 1WSFA 4FJIA 4A2BA 1FMWA 3DLBA 1BCOA 4HX4A 3K7AJ 5D5WB 2OBPA 2DQLA 2IIRA 3QPSA 1VK0A 3HSEA 3JXUA 3HZJA 4F3OA 3C3WA 5DDGA 3S32A 2KFDA 3A03A 4DR6K 1RCHA 3VETA 1WGXA 1UHWA 4K8XA 2R0QC 4JKEA 3MKYB 3ASNH 2IGNA 4XLAA 4F7ZA 1KGSA 1PP8F 2W57A 3DXMB 3U3GA 4RB1A 5CZ2A 2L7ZA 5DUIA 2VG6A 2FQ4A 4PKIA 2F8TA 2P0WA 4WXDA 3F8BA 1SFOJ 4B3XA 4ID1A 2XROA 3R6SA 5IWAK 3ZEUA 1XS9A 3TO6A 4B3RK 4D1QA 2ZCWA 4CIEA 3VQ6A 2DA1A 2RAEA 3Q5FA 5EGOB 1LNWA 5B3SH 2DA2A 4L9NA 1S3XA 2V52B 3FXLA 1TK8A 3RZDJ 4TSXA 3ISPA 3KTQA 4MLOA 4CEAA 3T1YK 1T8IA 1JKHA 3CD6I 1ONVA 2GQQA 4A3IJ 3UE5A 4XSZF 3HKZA 1QZ6A 2STTA 3LM9A 1HC8A 3RRGA 4MFBA 1LPQA 2BVMA 4CZJA 2QWNA 1MMNA 2VODA 4NLBA 4A0ZA 2E7WA 4JKDA 4XLFA 2QF7A 3GMEA 2XAHA 3KEQA 3TAFA 3LDOA 3HZ6A 1X1AA 1G6NA 4CJSA 2ZMEB 3R0JA 4E1NA 4GO1A 1HMVA 4GVEA 4BWMA 5JVGL 3OL4A 1WSUA 1HF0A 4ILHA 3BQZA 3V1OA 3OA9A 1MBJA 4AC0A 4YFUA 2EFOA 1NLVA 4XEIA 3KK2A 2CV0A 3K2PA 3P5JA 2E7XA 2W82A 1RBUA 4OX9K 1PUFA 2D0CA 3MDQA 1LE8B 1GXPA 3J7AO 1AWCA 1XSDA 3ZT2A 2Y69H 2G9WA 1BO5O 3EYYA 2W1OA 1ZAOA 3S3NA 3HYIA 5IOYA 1FIPA 2Q1ZB 1VFCA 3G1OA 3CQYA 1GLLO 2LVSA 2A5YB 2QK9A 3D1NI 2IVOA 3RWUA 4RB3C 2MD0A 4CUGA 1FLIA 2EFQA 1TZLA 1JXSA 4EV0A 4W1UA 3MECA 2Q1NA 1QE1A 2P9SB 3Q7BA 1SAZA 4A3BJ 4M3FA 3OYDA 3HBLA 4M45A 1BI4B 2KIMA 2O8EA 4FXDA 2NVXJ 4IL6C 1FEXA 1J6ZA 1ULYA 4OPJA 3HGYA 3OYMA 1V5FA 1MSFC 2PBIA 3THWB 3CG7A 2IBDA 2Z33A 4O5VA 1NU0A 4K43A 5T7BA 1HUXA 1RNHA 3S93A 3LOCA 2QM1A 2ID3A 1DU6A 1Z77A 1V4TA 3LALA 3CO7C 4IHVA 4FW2A 4KN7X 3GBGA 1SD5A 2LFBA 4CGHA 4AHRA 1FT9A 2DOAA 5AIPA 4YOYA 3K4LA 1R49A 3FM5A 1NJXA 2HNZA 4BEHB 2PBDA 4QIWN 1EETA 2RN7A 3BPXA 1WJEA 2L4MA 4MQ3A 1HLUA 1OJLA 2D5RA 3S3OA 2P9LA 4E4HA 2K7LA 4CZGA 5JVGF 1FKOA 3ULDA 4KHNA 4XIUA 1WSJA 1HNZK 5B5EC 4Q0BA 2EIKH 3MMVA 3CC2N 4B1UB 5F04A 4HNTA 1SD6A 1R1VA 1K8KB 1HKBA 1K78A 4I0AA 2JTVA 3GBTA 4DTPA 1IDZA 1WQ2A 1SC7A 3DM2A 4H0OA 2DT7B 4CEQA 4BE0A 2FA5A 4LF7K 5EZHA 3I55N 4KHWA 2GM4A 3DU5A 3VQDA 2E2OA 2XF7A 3V7CA 2K9NA 4B3SK 1T0FC 4PA1A 2VN2A 1LWEA 4JI0K 3VGKA 1VQ8N 1NJZA 4KKOA 3OVNA 2HHWA 1Z67A 1T39A 3ZT4A 1BI0A 3E0JB 3VOEA 2O8DA 2CUZA 3O5BA 1RR8C 4LB5A 3HTSB 4GV3A 4ESFA 3WE2A 3JREA 4B9NA 5IP7J 3OYCA 4C8LA 1QBJA 3WGIA 2G7HA 2X6WA 2DMPA 3CFOA 4EIAA 2CYYA 4RW6A 1S6PA 2AQEA 3CUQA 2JRMA 1DQUA 4DB3A 1B9NA 3A2FA 1ETQA 4HF1A 1SVOA 3MKWB 4XKBA 1Y1WJ 2BW3A 1KFSA 4CCNA 1G4DA 2E2IJ 3OJSA 2XKOA 1H1VA 3DEEA 1WHUA 2DK8A 2UXXA 1EF4A 4FJJA 1QPIA 5L3GA 3KYCB 3TI0A 3M9AA 3F2KA 1X2NA 1NKEA 3MCPA 3GDQA 3GL1A 3ISNC 3QU6A 3AVFA 2TRTA 4UVCA 3NAEA 4A6EA 3GZ5A 4E1JA 3SK3A 3CPWM 2GBZA 1SFUA 5HP1A 3M8FA 2H27A 4CW7B 3GUDA 1WN7A 4M3DA 2HYJA 3SUPA 4FLWA 5LJWA 5LMNK 3RSEB 4Y52J 1ZR2A 3C6TA 4FJKA 3BZ6A 2D1VA 1IH7A 2OYQA 3JRGA 4NO7A 3E5UA 4JKGB 3WNFA 3MN6A 1LWCA 1D5YA 1Q9YA 1WVRA 3VQQA 1BU6O 1YG2A 3OBYA 1YRNB 4CZMA 1KVAA 4Y1DA 2KJCA 3LFKA 1HJOA 1V4SA 4CESA 3DXKB 5AQKA 2HKXA 4UNOA 2XGEA 2F9WA 3MMYB 1DLOA 3KP7A 5LHIA 4M9XA 1Y8QB 5FLXZ 5L3FA 3V1QA 4KNYA 3C7JA 3P83D 4ZJZA 3K69A 2E8AA 2ZWHA 2XO7A 2HI3A 1WH5A 3A2KA 3L7WA 1WSIA 2Z1GA 5GPCA 4FPBA 3VF4A 2DXIA 4ELUA 3OV8A 1TP4A 3MVPA 4AIHA 4AM3A 3F22A 4LFAK 2HPMA 1D0YA 1IJWC 3C94A 1YITN 2B63J 3SZ2A 3HKZN 5FD5A 3Q0WA 1ETKA 4JRPA 1YQAA 3HTVA 2CH6A 1WSEA 1W7PA 1HKTA 3M8QA 5GPAA 5HDKA 4ELVA 2VKHA 2VXDA 3S15J 3JRIA 4BY1J 1JT6A 4XKCA 3E01A 4MQVA 3OSGA 4BRFA 2JUGA 4OLBA 3AG3H 3WHBA 5CQGA 4X65K 4HSRA 2LNBA 2CQNA 3S9HA 1MU2A 4A5AA 2MLKA 2YU9J 3HOWJ 4FO0A 2MA3A 2ECBA 1S3JA 3OIOA 3LDPA 1XDUA 5AZIA 3EEQA 1RZ4A 2L7KA 3AO3A 2P5VA 4DS4A 3FDYA 1NHAA 3EUKL 1QHTA 2BZTA 2XHBA 3TWHA 2IS6A 1KXPA 3VQ8A 3OS2A 3TGNA 4ZDOA 2A41A 3VQ5A 1WI9A 1EH6A 2JK3A 3AO5A 3LA3A 3BUZB 3ML6A 2JWKA 1HKGA 4KA4A 4C1NI 4YOWA 3H3UA 4WX9A 2WV1A 4FLVA 4Z4IA 5F1RA 5L3CA 1TV6A 2J5PA 2K27A 5CLSA 3KLNA 4YG2F 4LLNA 4OAZA 3BT9A 5I9EB 2H3GX 2V6EA 1TWAJ 4Y3OA 1XWLA 3ZSRA 3ZR8X 5M5YJ 2RN2A 4UB6C 1O3SA 5IT9K 4FZZA 5E84A 4ZTJA 2HTSA 1ON1A 2HDDA 4RGSA 2OZSA 3RJPA 2D4WA 5CQEA 3LM2A 2X6SA 2VOOA 4M7YA 3L2VA 3W3CA 3KCCA 1L3VA 1EV7A 3DLHA 4E7SA 3CPEA 1BJZA 4BUPA 1DEJA 4OMZA 1YIOA 4AIDA 2VT2A 1X9MA 3K4KA 2BVLA 3ZPLA 4A2AA 2F7TA 4CYCA 2Y1JA 2K9SA 1TAUA 3H0DA 3BZKA 3J80O 3VYTB 2IGMA 3ZEUB 2E6LA 2VG5A 4A2UA 2JSCA 1XPXA 4PUSA 4F55A 4BU2A 4JX6A 4ETSA 1D1BA 2XAUA 3DEUA 3G71I 3TW7A 1BL3A 1YS6A 3SV4A 5D5XB 4DQRA 2KIUA 1IZ1A 5H1SQ 3BGRA 1JKRC 1RKWA 2IPQX 4CJLA 3L2RA 2ITGA 2OUMA 4Y0WA 5L3EA 5E1XA 1JXEA 4E0DA 1ATRA 4KIGA 3SXYA 2CV2A 1VSKA 3HBTA 1DPUA 2BXZA 3J7ZO 4OU0A 3AO2A 1HW2A 4G8XA 4FLYA 1VQ6N 4OLAA 4CJTA 3AVCA 4JRQA 3HSRA 3GFLA 3TU5A 1FC3A 5FPDA 3CCVN 3CMEN 3EYIA 3S2HJ 4IHTA 2KQRA 3AKZA 3MEDA 1HNWK 2HW3A 3MAQA 4JKHA 3QBWA 2P9PA 4B44A 4BRHA 4PQUA 2OA8A 1D8YA 1TWHJ 4EJTA 1HLVA 3H92A 1XG1A 3J81K 3JRAA 4RB0A 3DPTA 2CMPA 3L6QA 2VBWA 1X3MA 4DFKA 1IG7A 3HRMA 1GLNA 1X9JA 4J00A 2BGCA 4H4MA 3KE2A 2CG4A 1PUFB 3O3FA 2DMNA 2HOTA 3IKMA 5JR3A 1SUQA 3DRRA 1TQMA 1A5JA 3DOKA 1WJ5A 4BKXA 2WBMA 2V4JC 3QP6A 5KPRA 1REPC 2Y0MA 1DKGD 1W2BM 2Y1IA 1X1BA 4IFEA 1JLQA 1JJ2M 2WY8Q 4O0JA 3CCSN 3OYGA 3LSIA 2VONA 2A6EF 5HROA 1VQ4N 4CFCA 4RG8A 3P9CA 5M1OA 1GV5A 5F6FA 2MG4A 2FJ1A 1IRXA 4DV6K 4A59A 2LG4A 1R00A 2QWMA 2O8EB 2KZZA 1SZ2A 4A3CJ 2FXUA 3AVIA 4A62A 4A3MJ 3T19A 2VJ4A 4RW4A 1YIJN 4KB0A 3H3NO 3TTDA 3WTUC 4Z4HA 2M30A 2XGCA 3AFHA 3GWZA 3FISA 2HZDA 3I3LA 1IRZA 3PX4A 3CFRA 4Z94A 3LL7A 1OVQA 3CJQB 5EZGA 4A0XA 4DZPA 4XMYA 3QPTA 3KK1A 5TGTA 3AAQA 3HRGA 2DA6A 1RBRA 2GUPA 1NGAA 3TDUC 3SJHA 5AQGA 3B6CA 2IRFG 4GGGA 2KL4A 4PUOA 2ZE2A 4I2PA 3GZ6A 4EVIA 2E1ZA 4F92B 4JX5A 4HRIA 1BG3A 1QO0D 5GADJ 4U67L 4MLEA 1OLTA 1U04A 3S14J 3SAGA 4AIKA 1K78B 3T8RA 1RPWA 1T3VA 4U88A 3V8KA 4PL7A 3AL0B 2HQNA 4DYQA 1Z05A 4FWKA 4XN0A 3LZJA 2KZGA 4DJAA 9ANTA 3OW2M 3LDSA 1OYYA 3VTIA 1GLBG 2X4HA 3C6AA 3HSFA 3KEYA 4XLPF 2GV9A 2VJIA 3I56N 3BCBA 1B8IA 5GAEJ 2HHUA 1HX1A 3BR1A 2O8DB 4Z4FA 1OCPA 1R36A 2FBTA 2F9TA 2HDWA 4XRMA 4BR9A 2R7TA 1S9EA 3CJCA 2UXBK 3BC8A 1H88C 1PYVA 4EQQA 1P7JA 4CGFA 1IO2A 3CUQB 4DBQA 2QWLA 5DMRA 5K7ZA 4BQAA 1SS6A 2BW3B 5BR9A 2FF6A 5KI6A 2M7BA 3H1VX 1KU7A 3ID8A 3F5TA 2DODA 3BF3A 4LF8K 5KAIC 4CJWA 4M3RA 4KFCA 4JK7A 3SBGA 5KVRA 1RNLA 1R23A 4MEYF 3PO3J 4E89A 2HTJA 5H6QA 1T6DA 2BBYA 2Q2EB 4BJTA 3CC4I 3KK3A 3EETA 4DTRA 1XN7A 3FLCO 5AQTA 4GCVA 2A42A 3SPZA 3VPRA 2XAGA 1NGDA 1ASWA 1TBXA 2QKLB 1UFMA 3LAPA 3SEQA 1U8RA 2Z16A 2WUSA 4A0YA 4CGGA 1VI0A 2GUIA 3SUQA 3O8MA 1RILA 2JPBA 5AONA 1FBSA 5HLTA 4XH5A 3OL3A 2DDBA 1UHMA 1XUPO 2ZBKA 5E1WA 3PQJA 1Y8RB 3GTOJ 1OYIA 2LKXA 3VEVA 2R7ZJ 4OMYA 1L3UA 3AO1A 4LLGF 2X0LA 1S1WA 4OKEA 3LZIA 3VMFB 2O5RA 2BEOA 1UZCA 3GCMA 4K8ZA 4DF8A 2ECCA 3QLHA 3DLAA 3TW6A 4ESBA 1Q8IA 1VSFA 1D8KA 4C30A 3C2HA 3I5UA 4E70A 1VQ6I 3DKWA 2R93J 4CBUA 3EO3A 2A6HF 4MTEA 1C1BA 1HNIA 5E3NA 1W7PB 5AQPA 4A3GJ 2B4JA 4OGCA 3DLLF 2F4IA 5ELZA 4HYEA 1JLAA 1ODDA 1FP2A 4XKVA 4LK0F 2M9HA 3MFKA 5C2FA 1I39A 2IAJA 4RW8A 3IRXA 2DTZA 1YS7A 3SDBA 2ZJPL 4RMNA 4QSHA 4AUXA 5K14A 2E1MB 3KX2A 3BDPA 4BR2A 3HIFA 1P7IA 2KDZA 3SQ1A 3H3ZA 3PUFA 4FLTA 4MGRA 2UWMA 4FJHA 5KGWA 5AZIB 2OD5A 4HLYA 1BC7C 4CBXA 2X51A 4M72A 2E4LA 4HV6A 4BRCA 1EQYA 3LDQA 1ASUA 2LKSA 3DOLA 2G8UA 2CWEA 4BRDA 4KMUX 3CHWA 1G3SA 4DG1A 3IKVA 3D7EO 3ZSWA 2VB6A 4I02A 4YRVA 3SHFA 1Q7YO 2IOCA 1S9HA 2VBZA 1STZA 3VFZA 3NDKA 3VQBA 1QQOA 3O4QA 4II2A 1XX5A 3NEUA 5AFUH 4ZDPA 3IAYA 3O3KA 1BL0A 2XSJC 4LD5A 5FRNA 1JCGA 5FKKA 5J8FA 1SMYF 5D8LB 2NNNA 1LAWA 5A2QO 2Y31A 3TAEA 3NCIA 5E8IA 4H5RA 4NLCA 1MBEA 1TAQA 4IBNA 2ISYA 2NS0A 1TK0A 3SZTA 2YHXA 2DJNA 2BY2A 1YIJI 3RMDA 3EQLF 1WI3A 3G6EN 2JUCA 3HT3A 5ICCA 5J4VA 1APLC 1VQLI 3HOYJ 4BRLA 1P4WA 5E8GA 2DYSH 3AVKA 1Z1DA 3NWTA 3ZCOA 5GAHJ 1F4KA 1VQ9I 3H35A 2ME6A 3ZRGA 1Z3XA 2MBFA 1OCZH 3RSNA 3JSMA 3L9FA 1I5ZA 4CYCB 2TCTA 5J3LA 1HKQA 1BI2A 4AWXB 3IRRA 1FMVA 1S5LC 4IEEA 5HLFA 4ISGA 2Y75A 3THYA 4WCGA 2E88A 2H8RA 1JCFA 2KRFA 5D4SA 2GOXB 4RBOA 1KQ0A 5ERIA 2ZJPF 4XL9A 2FEZA 5KCMA 5I3UA 4ZTFA 3KZIC 1X3UA 3IRQA 2NNYA 1NOZA 2L9SA 4HCCA 4WXHA 2OZ6A 2HF3A 5EY4A 2NVQJ 3F8FA 5EEGA 2FD5A 3NWSA 4RDUA 2QQ8A 1MBFA 4IZ9A 1HSTA 4G7HF 4D7MA 3CFPA 3QICA 2H94A 2OC6A 4DBRA 4DV2K 3JRCA 5LEJA 5FFZA 5C4JJ 1NK9A 1DGWY 3M8JA 3IAS2 4EM2A 4BBRJ 4O44A 2ZJ2A 2FLOA 3GFIA 4OKJA 2ELKA 1P8ZA 2P9PB 4I99C 2BYVE 4DNCA 3MN2A 3TO9A 3IWFA 3V7SA 4N76A 1X3WB 4CF2A 3DLRA 1IF1A 2XGDA 5F64A 2YJEA 2UYTA 1SVMA 1KAXA 2DFIA 4M9ZA 4L5IA 1NJWA 3SQ4A 5CVUA 3CESA 4EJUA 4A12A 1I3QJ 4DGWB 1HYSA 4U7DA 4CEFA 3H3OB 2OZUA 3NF6A 4FJ7A 2RE2A 3TTCA 5LGNA 4CFBA 5IT3A 1OKJA 4DW6A 1ASVA 4GNIA 1RBVA 3ZSXA 3GTLJ 3ABTA 2XKPA 4IO9L 1WCMJ 1N6QA 3KHYA 1SD4A 3CDIA 1FYLA 2UXNA 3QYFA 4CJPA 1Y6IA 2F96A 2ZD1A 4LD0A 4N4NB 4DMNA 2HOSA 1IKXA 3G4SN 3WXLA 3TARA 2K40A 3KETA 3FXKA 3CMMA 3BTIA 2HPIA 4N4OB 1C0FA 2R7FA 3HHGA 3KZYA 4E7IA 3R4KA 1FBUA 3WTXC 4ENKA 2MSYA 4K0KK 1FOYA 2I10A 2PI0A 2PMZA 4B9LA 2OPTA 3ECOA 1J9IA 4A93J 4FX0A 5D6EA 4EEFG 2KQ2A 2QCOA 1ETYA 4B1WB 1ETOA 3CMYA 3GTJJ 3BG3A 3SI6A 5LL6Z 2I7NA 1K6OA 2UU9K 2R7OA 1YT3A 5JVHL 3RKYA 3T3FA 2HOEA 1YX5A 5F08A 5F2RA 5EEAA 5C42A 2ISZA 2V1XA 1IKYA 2HBJA 1HW5A 1DPRA 2TDXA 2X6NA 2EHGA 5EXWA 2AJQA 4PJNA 1HBXG 3KVGA 3SYTA 5BPIA 2BOLA 4CZEA 5DCFA 5E79C 2ATQA 2W48A 3VQEA 2UUCK 4FJMA 1BR4A 1J59A 4BHBA 2VBYA 1Y64A 1NK7A 4L5JA 4DQIA 3QEIA 2W40A 1S8NA 2QVOA 5CVIA 3L00A 4NBQA 3SUOA 1A31A 1VZ0A 2VE8A 3PJRA 1XMOK 2M2EA 4LG3A 4FW1A 2YHYA 3WODF 3KWIA 3V81A 3SBTA 1AHDP 1KLMA 4NUBA 1D4XA 1VQNN 4JK1X 5C44J 3WGGA 1WSGA 4IO9F 3L8BA 1TC3C 2OTJN 1W4MA 2YUSA 5HRSA 1ZTRA 1YJNI 2XF5A 3MXJA 2XY8A 4O5FA 4PSWA 2GOMA 1QVFM 4BY9C 1OMIA 2HNDA 3CJNA 4JKFA 1H0MA 2ELJA 4CXFA 1DTQA 1B8IB 1R1TA 3OYFA 1YJ9N 4A5MA 4OO1J 1RIOH 4A3DJ 1GOCA 1HQUA 4K2EA 1RT3A 3E7LA 1RDDA 5KQ8A 2KKOA 2IVNA 3JRBA 2Z99A 4DLGA 3V4IA 1OVYA 4JI1K 4P9FA 4DR5K 4FYDA 2Z5UA 5EJCA 4CGIA 4AD9A 1ZC6A 1QQIA 1FK9A 1X9WA 4K42A 5IT9Z 3VB2A 1DP7P 2DMTA 1RFQA 3SYZA 3TANA 1XSVA 3P39A 1XNQK 1F21A 4BC5A 1KU2A 3ONQA 4N56A 2Q36A 1X9SA 1NK0A 2E36A 1QZZA 3NQOA 4B1RA 1BQMA 1HYVA 5J1YA 5E3OA 3ROUA 5LHHA 4DIQA 1XMKA 1BI3A 1YO5C 3GO5A 4PJ0C 4ELTA 3SAFA 4DV1K 3VEPA 3I0TA 4KHSA 5KRTA 4CERA 1X3ZB 3ZN0A 1K8AO 2P9UA 2FMLA 1UA1A 4FASD 3H5NA 4PJMA 1ATSA 3F21A 4HWIA 1F5TA 1T05A 3E5XA 4MFDA 1LFPA 4OGEA 1SL2A 4B8AB 2HOAA 2O61A 5ILUA 5BPLA 3I0RA 2F6CA 3JRFA 2GX9A 3EUHA 4CHOA 3M4OJ 2OQGA 3O8GA 2LSOA 4GW6A 3W6JB 1FWZA 1X1CA 2K86A 4GKJK 2KZMA 3PQKA 2P9IA 5FPEA 2EBIA 2RQPA 2LSNA 3IMXA 4NCGA 4FWOA 4CIGA 2FQ3A 4M6YA 2NS8A 4CHZA 1K6YA 1C0WA 2OAZA 5HBMA 3HTUA 3J81Z 1NJIO 1PJRA 5JICA 2XVCA 2HEOA 2ZJRL 2VIXA 4ILJA 3ENBA 2CS3A 3VQCA 3TP0A 4I09A 1GVJA 2IP2A 3W2AA 5FLVA 1QSYA 2ID6A 3GTPJ 1AA7A 4E7LA 3A4CA 2LY1A 2IJLA 4RAFA 3RZOJ 2W84A 4FM0A 2L7MP 1ZK8A 2HVQA 4HNUA 4B9SA 1T56A 1SL0A 2VT3A 1MMDA 3TOBA 2Y0SA 1LUJB 2WC2A 1IN6A 3LSJA 1VQOI 4GRIA 3O6BB 2A07F 3GW2A 4IOCL 2WB1A 5K7FA 4FSVA 3B6OA 3LSTA 3ZN1A 2DFHA 2XB0X 2P1JA 4H5TA 1JUSA 4M71A 2M4GA 2DU9A 4OVLA 3G10A 2NVUB 3B8AX 3HP9A 3GLXA 1JE8A 3CCMI 5CVVA 4OIPF 2O8FA 3G4SI 2XF6A 1MW7A 1FP1D 2V51B 3DPUA 4HTLA 3A5MC 5CYVA 3MD2A 3WGHA 1OCRH 2LDUA 1Z21A 3AO4A 4FWQA 2RNGA 3PSIA 3ASOH 1MGTA 2UUBK 4AHCA 3OHRA 2PEXA 4CCJA 4YDUC 3CLQA 4CGDA 5DCMA 1O3RA 3E1SA 3K2ZA 3TEDA 3KFWX 2PMZN 4AILC 3VYRB 2LOOA 4IPAA 3WTZA 4B48A 1HKCA 3DLEA 1JLFA 2DPDA 2RC4A 4J2EA 2CGJA 4YORA 5FDLA 3CCUN 3HHHA 2EV0A 2Z1HA 1GLJO 2O6GE 2RF2A 1TQPA 4DFMA 3GXOA 5BRHA 4HAMA 1K7AA 4KPYA 3L4IA 4IOXA 3ULEA 3BG9A 1BIBA 1T7PA 1GV2A 3JYTA 1IN8A 2A61A 2E5LK 4BR7A 2QUFA 1U6ZA 4BYYA 1Z7UA 2ZJRF 4YOUA 2VQEK 2XASA 3THYB 2DW4A 2MH9A 1I6XA 4KAZA 1VQKI 4DOZA 2LF8A 5ICEA 1ZRCA 3K4CA 4UY8I 4CICA 1KD1O 1RT4A 3RYRA 1LDKB 2A05A 4W5QA 1FSHA 1NG7A 3HGGA 1YJWI 1IBLK 1YW8A 2ZSHB 4IG3A 1KFDA 3NF7A 4HTUA 4IOCF 1HA8A 4OIOF 2L3DA 3J80K 2XGXA 3J7YP 1SAXA 4LF6K 4LSLA 2VYPA 4A6DA 1LFBA 3V6DA 4L8RB 1W7PD 2GXGA 3G3ZA 2PN6A 4IF4A 1LVKA 2ZNZA 4A5NA 5HLGA 4RAGA 4X6AJ 3R60A 4C9YA 4DTXA 2J4RA 1YJ9I 2EH3A 3K0SA 4XBFA 3O9QA 5M3MJ 2H6BA 3U2RA 2RPIA 3R61A 3C6HA 2YR2A 2HB5A 1A6IA 4IJAA 3ID6A 4JKBA 2FOWA 1R22A 4NDLA 4BQOA 4DV4K 1BM9A 3DV8A 1NWKA 2NUBA 2W7NA 1XCVA 2JT1A 4FJ5A 1RT5A 1LQ1A 1TT5B 4JP0A 2EZIA 3TABA 4WCEL 4BRNA 1FSEA 4Y17A 4R5PA 3HP6A 3ASMA 2I5JA 1FOXA 4C3IJ 2IA0A 1YX3A 3HM8A 2WTEA 2LBFA 2QYOA 3H9JA 4FLUA 1GLDG 3LA2A 2D1HA 1A5WA 3VENA 3HOXJ 5KRSA 3RPUA 4WQ4C 4LITA 1VTNC 1B92A 4DU3A 3CCRN 1USTA 3RTRA 3BJAA 1X19A 4B1YB 4CJ3A 3WNGA 2V9KA 3VSKA 4MO4A 1VQ7I 4KTQA 4KH5A 1TW3A 5TKYA 3M6GA 2O7OA 3PNVA 3AARA 3ZQLA 2HBKA 1LDJA 3WHCA 4IX7A 4N0BA 4G7OF 5H2FC 5BOXA 3PO2J 1HPZA 3QRFF 4IFVA 4JAXA 4YNQA 3K0LA 4E7KA 1M90O 2DFEA 1P90A 3U6FA 1N36K 2DTRA 1XB4A 3HSCA 3ZT1A 5EG0A 3I9V2 1W0TA 3ATVA 2A6AA 1EO1A 3FXOA 2OANA 1IV8A 4M7XA 4XNFA 2IGOA 3CMAN 4DCHA 1KQ8A 3ERMA 3H3VK 3W3DA 5F1XA 1EA3A 1WBBA 4DFJA 5C4XJ 1VQPN 4H4OA 4KIFA 1A36A 1YTUA 3KZZA 1QS4A 2KISA 2HHVA 3CQXA 2LLKA 2DBBA 2VWJA 2R7VA 4M42A 3PIOL 3BP8A 1U6GA 3R8EA 3TDZC 1BBYA 2MGQA 3BQYA 1XNRK 3ELKA 3TOAA 3F6VA 1JJ8C 5J8CA 4HV5A 4XOPA 1VQ5N 1Y97A 1W0UA 3QMLA 1WUAA 6PAXA 1ZGAA 3V9WA 5HRRA 4LMYA 4B9QA 4DV7K 2W6LA 2KLAA 1X1PA 3ENOA 3SQNA 1TQIA 1BOAA 1T98A 3U21A 1BIZA 5HODA 4M3TA 3ZSOA 4BDZA 3ZSYA 2ZGZA 3J7AP 1ORKA 1D0XA 4HNVA 3T7ZA 1CGPA 1WFXA 3ZQIA 5CR4A 4BROA 3HOTA 1V3FA 2R5YA 1HCRA 3WTVC 3TAPA 5L3BA 4M3XA 1YE9A 3DYAA 4X62K 3A5OC 4DU1A 2VJJA 3T1BA 1YTYA 2NOGA 3DTKA 2X6XA 2NNWA 4UVAA 2KIFA 2IA2A 2IAIA 1YUWA 1BWFO 4JD2A 1QSLA 3KYLA 1XCBA 1DP3A 3F0CA 2HF4A 2CSOA 2FNPA 2IVMA 1CLQA 3FXRA 3DRSA 2FBKA 1P2FA 4A5BA 3Q9VA 2HR3A 3QEPA 3P38A 3FBIB 5CY4A 2EWSA 2RKHA 1ZYQA 1WB9A 4P9UA 5D5VB 2L02A 2QBYA 2VG7A 4ILGB 4CF0A 3W2WA 1YFHA 4B08A 1Z9CA 2IA1A 4OOIA 3CO6C 1KVCA 1XTAA 1TUYA 1OH7A 2OCEA 2QA4I 2R5ZB 2QEXI 1L3SA 1L3TA 4QPQA 1IUFA 3MX5A 2P9UB 3QNNA 4HVJA 3F9KA 3ATUA 4B8CA 2BE2A 5DK5A 3PIOF 2LR8A 1MMGA 3DPLC 1KAZA 3HC7A 1R6RA 1TL8A 4EJOA 2QWOA 5GAGJ 3ZQFA 1CXUA 3FX3A 5D3GA 4PY5A 1SL1A 4MDBA 3QP5A 1HRHA 1VAZA 3K5NA 5HVQC 2X1DA 4OKKA 1K4SA 4I76A 1YHQI 4NC8A 2L01A 2WAQA 2AXLA 2P9IB 4CCKA 3Q3SA 1I1SA 4ENJA 4DSEA 2A1RA 3OYNA 2JJ7A 1S72N 5M1KA 4CK2A 5KQDA 1YI2N 4CJFA 1D8JA 3HPHA 4CCHA 2ZXWH 4JI4K 4JS4A 3D5SC 5HS8A 4AVPA 1CZ9A 2FF4A 4O5BA 1HDDC 1N33K 5GP9A 1SFKA 4LFUA 2LMDA 3A01A 2EZHA 2L0KA 1TVRA 4G7ZF 5IP6A 2VE9A 3E9OA 4V2GA 5GINA 3HI0A 4HF0A 5DS9A 1T08B 3RKWA 5IOZA 3M3ZA 3K1PA 5IYBJ 3KPHA 4CHPA 1Q82O 2R7QA 4WQ5A 4FK0A 4DUYK 2WADA 1WSHA 3ABKH 3BPVA 1U47A 3BJOA 1UJ8A 4CA0A 3I8DA 2ZXHA 3BTCA 3JCUC 5HS7A 4G6DA 1RBSA 3ZX0A 4JOMA 4NYNA 2CV1A 2OTLN 3ZOBA 1RDBA 3D2FA 2E2JJ 3T5XA 3U3YA 2P4WA 2CGPA 2O8FB 3VWBA 2BTFA 3NE6A 4ZYEA 5SZTA 4DWIA 3EKSA 2ZMEC 1OYWA 3NGIA 3CCQN 3I8BA 4Q4ZF 2W6KA 4IEJA 1M1EB 1CXQA 1HSJA 4Z6YA 4WF9L 3K4JA 3BG6A 3GTGJ 5DCMB 1BCMA 2K5CA 3A8YA 3K70D 1FTTA 3D5RC 3FK6A 2AQFA 3OYJA 2B6AA 3T1HK 4LFBK 2CGLA 3FXMA 4ENMA 2EA4A 5HRNA 3JR9A 4ZZLA 4WWCA 4M3YA 3QWLA 5KPTA 2HBMA 3PNYA 4JLHA 2RVCA 1Z26A 2PQ8A 4QOZB 1JGGA 3T1AA 4IHXA 4JI3K 2ESHA 4C3JJ 1WJCA 3MN7A 5C25A 5LBQA 2O8CA 3WE3A 1FJGK 2CGKA 5FFXA 3BTLA 3ZT3A 2EX3A 5K7HA 5A2QK 2WWYA 4KIBA 2YKNA 3ULEB 4JK8A 4XORA 3CERA 4LIUA 1KCFA 1XD7A 2L5QA 3MK6A 1RBTA 3FXUA 5AQFA 1IAWA 3F3XA 4NQWA 2F2EA 3JRHA 4B9UA 2LK2A 2EFWA 4BE2A 3MN9A 5KHDA 1OCOH 2GIVA 4A3JJ 4XN3A 2FNAA 3AAFA 3ZCMA 3DWLE 3J7AY 5CYQA 3LWMA 3VA0A 5FO5A 5KTQA 3CJRB 2RNJA 3VEWA 3E6MA 1NG9A 3H9QA 4DQ8A 4U0VA 5CVRA 2W42A 2QTDA 1RDWX 3OYBA 3ZQHA 3A0HC 3VOVA 3ZETB 4OIRF 2GEMA 2VXZA 1VSEA 4OPAA 2O3FA 1HOMA 3WG7H 2DAOA 5AQYA 1FX7A 4XQFA 5M5XJ 4BDYA 4BGBA 4YIIA 3WXJA 1TWGJ 4DR2K 2DYRH 3HO1A 4X0GA 1IN5A 2CH5A 4IEIA 4JS5A 4CH7A 1EJ9A 4P5OA 4CDGA 2RKIA 4Z4CA 1IN4A 3TAMA 2YX4A 2W25A 4AYBN 4H0EA 2NYXA 4BG8A 3HJFA 4F52A 2NS7A 2A69F 3HUGA 1TYQA 3MZYA 3AA4A 2ZKZA 1TTYA 2A40A 1NG6A 1VSLA 3LSRA 4NC7A 3N4PA 4F4KA 3TBIA 3BOQA 5I42A 3VGMA 3NH1A 3CP2A 1OQYA 3DBLB 1KAYA 4O6JA 4CD3A 1SVLA 4LGWA 4L0ZB 3HOVJ 3I64A 2YCHA 1BGXT 4KI4A 1HNVA 2ZB9A 4E19A 1MIJA 1RKTA 3FWEA 4IG0A 1C0GA 4NXNK 2HQAA 5AQMA 1Z6TA 2UXDK 3M07A 2ASMA 5KGXA 5EU7A 2OPPA 1FW6A 3FGUA 2LBFB 1OH8A 3ZSZA 3ABLH 3FHZA 4RCHA 2ZXIA 2B7EA 3PUBA 4QAGA 2QKBA 1SD7A 4RS8A 3RYPA 3PM1A 4W5OA 3BR3A 3A0BC 5GTIC 4FWNA 3UB5A 3JRDA 2Q0OA 1O3QA 3W6KB 2IGIA 3BR0A 4EM0B 3PFYA 4B3TK 3SCXA 3OYHA 5TJJA 4BG9A 3AVMA 1LAVA 4BJ6C 2Y9YA 4ANJA 4M73A 3K2AA 4AH9A 4RWTA 5FROA 3Q7CA 5J1RA 1QVUA 4AHVA 3M1FA 3U1DA 1TKZA 2RV8A 5H20A 3KKRA 1U5TB 2HDCA 1E0EA 2E1OA 4EJVA 2QLZA 3BDDA 3CCEN 1GLEG 5DM6L 3SUNA 2QSFX 4N47A 4A3KJ 2DOEA 5ADXA 2YHAA 2G8FA 1QGPA 2VBXA 4G94A 2DOFA 3W2VA 4QPOA 3JAMZ 2QWWA 5M1FA 1JHHA 1Q1HA 4BH9A 2IXSA 3O3GA 3DCFA 5GIOA 5EG0B 4DR3K 2KFZA 1C0TA 2Q2EA 2V1UA 2V9PA 4QTRA 2XAFA 1LDDA 4BXFA 2CQKA 3OY9A 1RTIA 4HW0A 4XRSA 2X85A 4A3LJ 1D3YA 2X74A 3AA5X 3M5RA 2WAQN 2L7FP 1D1AA 4CJQA 2IS4A 2YI1A 2VOPA 2YV0X 2W85A 4KITB 3K5LA 4X64K 4F8RA 1E3MA 3I33A 5DEQA 3V9SA 5IY5H 5BS6A 1RR7A 1NK4A 1X58A 3ZYYX 2FBIA 4IO8A 4DTSA 3VQAA 4CEEA 5AQIA 3MZ8A 3BR2A 4CFAA 2CFOA 2EB7A 2HXIA 3PSFA 4XR6A 3DAWA 3GEZA 3JS6A 4AU7A 3NRVA 3O4NA 2YHWA 3CI5A 4PHTX 2JMWA 3FBNB 4BQZA 2KTQA 1WWXA 4FLXA 1RUOA 3FIWA 1NGBA 1LVAA 3SFZA 5BN8A 1ATNA 1D5AA 3PV8A 2MD5A 3DLKA 3O3HA 2YS9A 3CJBA 2OCCH 5FKNA 3L4QA 3CDHA 3BLYA 3F23A 5CKTA 1JTXA 1Q1VA 1OCTC 2R5YB 1SKRA 2VC0A 1ZKGA 3LPTA 4BY7J 3DP7A 4KISA 4RA2A 1CZAN 2R7DA 4NB4A 2A5XA 1TW2A 1E2XA 3KWGA 4O0IA 1JKQC 4BRIA 5KAFC 2XAQA 3H9GA 1OR7C 4JD2B 5J1UA 2M3AA 4M3EA 2LD5A 3KP3A 2D0BA 2VWKA 4W5NA 3FE1A 5DM6F 2A1SA 3J7ZI 4YELA 1SV5A 3VPZA 4J2BA 1RT6A 4KFBA 1I6HJ 3R3LA 3SNNA 5B8HA 4CSWA 2P5OA 1DU0A 3GX4X 3AA3A 3KLIA 1UAAA 2JWTA 3BY6A 1KQSM 2QBYB 4KI6A 1N34K 4RW9A 4FQGA 1KONA 1JI8A 4N9HA 4BR5A 5FLMJ 1T2KA 1T95A 4XLCA 3GG4A 1ITYA 4DSKA 3OOUA 3SMSA 2A68F 3GZNB 1VSMA 5IP9J 1T6SA 1PUEE 3WU2C 4NB5A 2IW5A 1FTZA 3FMSA 2KRCA 1VSHA 2P9NA 1ESVA 2BY0A 4G1QA 4IRIA 5EX5A 1IXRC 3NARA 4EATA 3EPZA 2ZO4A 3FXJA 2FUG2 3J80Z 2WV0A 1O7LA 3FKIJ 3OSFA 4B1ZA 2VQFK 1R5HA 5DD4A 1TKXA 4E1MA 2HHXA 2V9VA 3JSPA 3JTHA 2XPUA 5IYDJ 4IWVA 1T0FA 1UG0A 1U45A 3F8MA 4PKGA 3BG7A 1YVUA 3I53A 5F0HA 5GIPA 2E2QA 2QXFA 3VQ4A 5DTDA 3AVAA 3KD5E 2YPRA 4FE4A 2YNFA 3VYUB 1TWCJ 3TMOA 1ZRDA 4FK4A 3FZMA 4FE7A 1N77A 5AQOA 4O3MA 1DTTA 3A01B 1DGKN 2H1KA 4XH4A 3GTMJ 4CGJA 3OYIA 1G59A 3DU6A 3TO7A 3QO9A 3LP2A 3VESA 3CJTB 3M8SA 4J01A 4S0HB 2V1NA 4M63C 4FT8A 4L0YB 2Q2RA 4U0WA 1T38A 4FL9A 4PJLA 1XC5A 3CC2I 2BANA 2CU7A 3OWTA 4J2AA 2DLLA 1W36D 2DK5A 4FJXA 5EEHA 2R7RA 1YW9A 2K9LA 1IG9A 3WQTA 1JXBA 2H1LA 3I55I 1R4NB 2W4SA 2MW8A 3PLAA 2QGUA 3RTVA 1E3OC 3D2FB 3H6EA 3KP6A 2R7YA 1K73O 4H0YB 2Y2ZA 1VQ8I 3LQRA 1RDAA 3PFIA 2VLAA 4JI5K 2E1YA 4GMJB 4J2DA 3GTKJ 3DF8A 2GXBA 2M0MA 1AOYA 2DQRA 1WBDA 2HVSA 2QI2A 1JL1A 1MWKA 4LLLA 2FSJA 1M1KO 2BY1A 1X3NA 5AQJA 2FSNA 2I7PA 3VTHA 1V5GA 1XMAA 4DYCA 3EY1A 5FKOA 3RDIA 4Q48A 5C0YA 1H89C 3O9SA 2VPLA 4AHUA 4BJ5C 5IPAA 3A5LC 4M3UA 4JN4A 3V1RA 3C6UA 4L5EA 4W5TA 1A5VA 4FPAA 4N5SA 5KK1A 3BR5A 2QZ8A 4JI2K 1G2HA 1ILYA 5BRDA 4NC6A 1BIUA 5CYMA 1MDMA 2K9QA 1G3YA 2ASOA 5AQHA 2F5VA 2O8CB 1JHFA 1KC8O 4R1HA 3ITHA 2COBA 4DFPA 1F43A 1BJAA 4UUTA 3AGRA 3FKJA 3TSQA 2I5UA 2HGCA 4NQWB 3IH3A 1C1AA 5HL7L 1U78A 2A6TA 1HNXK 5FPMA 3CLOA 3WQUA 4PSXA 2LH9A 1MWMA 1ENHA 4WYBA 1K9MO 5TKWA 4B4CA 3AA2A 3KZBA 1R5ID 4FWRA 1ZG3A 3LNQA 3BJ6A 1UHSA 3KD1E 2BE5F 5AZJA 3DI6A 1F1ZA 2HVHA 5E17F 4DTJA 3EUAA 4M3GA 4DR1K 3FM3A 3GYHX 3JTGA 4B09A 3L3VA 3NF8A 4CI6A 3BG5A 2Q3SA 2ELHA 1FY7A 4DYRA 2GELA 1P6RA 2NVTJ 4KH6A 1O7FA 2JGUA 4KHYA 1IN7A 3AG1H
chains in the Genus database with same CATH topology
5HP1A 2DFHA 2P1JA 4B47A 1WN7A 1S1UA 2M4GA 4OVLA 3SUPA 3UIQA 3G10A 4FLWA 1BR2A 3HP9A 1NK6A 3C6TA 4FJKA 2XF6A 1MW7A 3IS9A 4EP5A 1IH7A 2OYQA 2G8HA 3DPUA 3WNFA 3HUGB 3MD2A 3QODA 1LWCA 1U48A 1Z21A 3AO4A 2RREA 3SEZA 1S5JA 1Q9YA 2RNGA 3VQQA 3RR8A 4KB1A