1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Integrase
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
3V9SA 3KLIA 1RTIA 4E0DA 3ZSQA 4DLEA 3O3HA 2R7YA 4OKKA 4IG0A 1ZBFA 2XY6A 3SUQA 3DLGA 4DU4A 4IBNA 2B6AA 1JLCA 4CJ4A 3ZT3A 4CGDA 3F73A 1U47A 4IFVA 3VQAA 3ZSOA 1L5UA 1JLEA 2PYLA 4B9VA 4JS5A 2OZSA 3PO4A 3TABA 1KFSA 4KI4A 4Z4FA 4FJJA 1A5VA 1KVBA 3IRXA 2IGIA 1SKSA 3AA2A 3TAEA 3VQ8A 1FKPA 1NK4A 1C0TA 4B08A 3HPOA 3L2WA 3ISNC 5FDLA 1KCFA 3ZT0A 3THVA 1HQUA 3CFRA 1QTMA 2NUBA 3V9WA 1LW0A 1BCOA 2OA8A 4DSFA 2FBYA 1RT3A 1D8YA 4E3SA 4CFAA 4DTPA 1N6QA 4DTNA 2P51A 1JLAA 4NCGA 4IKFA 4I2PA 3L2VA 1Q9YA 2Q3SA 4NCAA 3LP1A 3AVNA 3L2RA 1Y97A 1NK9A 5FRMA 3AV9A 3LP0A 3G10A 3DLRA 1SL1A 3OYGA 2XO7A 4DTOA 2BDPA 2Z1GA 4HTUA 1HYZA 2RF2A 2HW3A 3AO4A 4DSEA 4OGEA 4EP4A 4KRFA 3AO2A 3ULDA 4CESA 4NCBA 4N47A 4FLXA 2KZMA 3V9ZA 5J1EA 4M3YA 1IKYA 4OGCA 1IG9A 4DLGA 3LAKA 1W0HA 3S3MA 2HHQA 2GUIA 3QEPA 3S3NA 4IG3A 1R0AA 3HL8A 4MQ3A 4B9NA 2P1JA 3PV8A 4FW1A 2ZQBA 1HMVA 3VQPA 1KONA 3ZSYA 1L3SA 2DTUA 4YNQA 3KK1A 3VQEA 2F8TA 4ID1A 3QINA 4BACA 1D5AA 5SWMA 3AA4A 1EX4A 4LSNA 1BI4B 3V9XA 3QEVA 4DQPA 4KHQA 1X9SA 4OPKA 4B8CA 2HHXA 2WOMA 3KTQA 2HVHA 1S6QA 3OVNA 2QK9A 4KHSA 1DTTA 3L8BA 1X9MA 1BISA 4F2RA 4PQUA 2KFNA 4FLVA 1J53A 5KGWA 4FJ5A 3IS9A 3OYDA 1LFPA 1BIUA 4CK2A 3HT3A 4DU1A 3SUPA 3HJFA 1TKDA 4JS4A 3OS0A 3LWMA 3EY1A 1K6YA 2A1RA 3KKSA 2O4IA 2HVIA 1TKZA 1S1TA 4BWMA 4J2BA 4H4MA 4H8KA 1B9FA 3AO5A 3DLEA 3OS2A 2HNDA 3ASMA 4EZ9A 2OPQA 1KVCA 5J2MA 4QOZB 4R5PA 1WSJA 3V81A 1TKXA 3AO3A 4CJFA 1IKWA 4CJ3A 1CZBA 4DG1A 4Z4CA 2HB5A 5HRPA 1D9FA 3I0RA 2FC0A 3OJSA 4CJRA 1VSKA 3HM9A 3C6TA 4E7LA 2IAJA 3VA3A 3MEEA 1S9GA 4M3UA 1QE1A 4B3OA 4KKOA 3TI0A 3AVIA 2D5RA 4IFYA 3NGIA 4MFBA 5HP1A 1U48A 1SKRA 4I7FA 4Z0UA 3T3FA 1MU2A 4XIUA 3NDKA 4CHQA 4KFBA 3RMAA 3VQ7A 5T7BA 3OYLA 3BDPA 2HHSA 2AJQA 1D9DA 5CYQA 4CGJA 4M3RA 4BDPA 4HCBA 3JYTA 2BE2A 3PX4A 4K8XA 2VWKA 1VK0A 3DYAA 1RT6A 1S5JA 3MEGA 2G8IA 2KFZA 2Z1HA 3AA3A 1RCHA 4OKJA 3ZT1A 1T03A 2Z1JA 4FLUA 2GBZA 5CZ1A 1U04A 3SQ0A 3DMJA 1J9AA 1S1VA 3SJJA 4HCCA 3NCIA 3B6PA 1Q8IA 1UA0A 3K57A 4FXDA 2HNZA 4CHZA 1U49A 1KVAA 4W5NA 4CFDA 4O5BA 4Z4HA 3OYEA 3HP6A 1FXXA 1HYVA 4HHTA 1VSFA 4FM1A 1J5OA 3QEIA 4WE1A 4F4KA 3OYFA 2F96A 1J54A 2JLEA 3K2PA 1KTQA 4FCYA 3SUNA 1BHLA 4FM2A 3RRGA 3SV3A 3L2QA 2XY5A 5KGXA 4PY5A 4RG8A 3MXMA 4YFUA 1MW7A 2KZZA 4DMNA 1SKWA 4DSKA 2A1SA 3TAQA 2X6SA 4CEFA 3QO9A 3ZSVA 1LWEA 3VN5A 4O0IA 1KSPA 4KTZA 2E4LA 3C94A 4FJIA 1FK9A 2BANA 4C8NA 4B9TA 1L3UA 5DMRA 1NOYA 2DFEA 4CEOA 3PX0A 3HK2A 1ASVA 4I2QA 5E41A 2DY4A 5SZTA 2ZE2A 2ZD1A 1ZYQA 1NK8A 3VQDA 3ZSRA 4E7KA 1NK0A 5J2QA 2OYQA 3SCXA 4KTWA 1CLQA 4RW9A 3AA5X 2LSNA 4CF9A 3NH0A 1RDDA 3PX6A 4FK2A 4RW8A 4CJUA 2RPIA 1Z26A 3ZT4A 1UWBA 3T19A 1X1PA 3I0SA 1QS4A 3CM6A 4DFMA 1HPZA 4ELTA 1ZBIA 1A5WA 4GW6A 3NF9A 4Q0BA 3B6OA 4OLAA 2G8UA 1RTJA 2EHGA 2FBXA 4B9LA 1VRUA 1CXQA 1YTAA 4LSLA 3V4IA 3TWHA 4FJNA 4CF2A 4OLBA 1LAWA 3K58A 4C8KA 1GOCA 3MEDA 5HROA 4Z4EA 1TL1A 4Z4GA 3UIQA 4KHNA 3EYZA 4I9QA 1RT7A 2X74A 2FBVA 5HBMA 1NKBA 1WJEA 3QNOA 4OPJA 1EXQA 1WSFA 4CJSA 2G8VA 3JSMA 3AVJA 1ZBLA 1S1WA 3ZSXA 3O3FA 1RT2A 4FW2A 1EKEA 3ZSWA 4E1NA 4FLZA 4RW6A 4M45A 1VSEA 3NGZA 4CHNA 4CK3A 1TL3A 2YNHA 1JLBA 4CJQA 4CK1A 1HNIA 4O0JA 5KRTA 1X9WA 4Z4IA 3CQ8A 1JLFA 3DOKA 1C0MA 2W42A 1IO2A 3ZCMA 1TK8A 3RR8A 2XRIA 1TK5A 4OVLA 4G1QA 3AVMA 3O3GA 3OYIA 1I3AA 1TVRA 3NE6A 4DQQA 4KV8A 2D0AA 5HRNA 3TAFA 4DTJA 1NK7A 4KB0A 4AILC 1YVUA 1ITGA 2QKKA 4DFJA 4KI6A 4DTXA 2RKIA 4FYDA 2IOCA 2OPSA 3E01A 3TAPA 3DLKA 3LAMA 3F9KA 5I3UA 4DWIA 1CXUA 1KLNA 3HYFA 4KREA 4CJEA 2Y1IA 1RBTA 4CIEA 1LV5A 3DLHA 4CFCA 4B9UA 4DQRA 3NH2A 1RDCA 4BWJA 1WAFA 5D3GA 4DTSA 1BL3A 4FJGA 4DTRA 2PZSA 3OYAA 3D45A 4M3ZA 1QHTA 3LPUA 3LP3A 3NFAA 1XHXA 3LWLA 1WNSA 3SQ2A 3DRPA 4N41A 1RT4A 4CF0A 4CHYA 2P5OA 4FJMA 3LP2A 4E7IA 3SUOA 4Y1DA 4ID5A 4C8OA 4J2DA 2YHAA 4BE0A 3VQBA 3RMDA 1VSDA 3VQ9A 4CIGA 1QSSA 4DSLA 3CG7A 4E7HA 4N56A 3MXJA 3OYCA 3SYZA 2BGGA 4LH5A 3ZSZA 3I8DA 4DTUA 4DF8A 4FVMA 4CEQA 4BDYA 2HNYA 3KKRA 3V9UA 3LPTA 1I39A 2E6MA 4FJLA 3VQ5A 3D0PA 4JRPA 4DS5A 5FRNA 4KAZA 1RBSA 4TSXA 3NF7A 4EZ6A 3M8PA 3P1GA 2DFHA 2XY7A 4M3XA 3NF6A 5EU7A 4F2SA 1U45A 1BCMA 2IDOA 4Y1CA 3KJVA 4N5SA 4JRQA 4HUEA 4K8ZA 4CERA 2X78A 3QIPA 3SPZA 3DRRA 2YHBA 3AVKA 1VSHA 1RNHA 3WNEA 1JXEA 1NJZA 4FJ9A 4RW4A 3CFOA 3NAEA 1L3TA 3HXMA 1WLJA 4CEBA 5HRSA 3AVHA 1LW2A 4E7JA 1E0EA 1B92A 3SZ2A 4DS4A 3V6DA 2OZMA 4DSIA 5CYMA 4J2AA 1ZBHA 4AHUA 1WSHA 2G8FA 4B9MA 1RBVA 2B4JA 1Q9XA 4JLHA 3OYNA 3NH1A 4CECA 1RBRA 1RDBA 2OPPA 4KHYA 3M8SA 4CGFA 2XHBA 4CF8A 1L3VA 2Y1JA 3SQ4A 3LZIA 3DOLA 4CEEA 1KLMA 3O4NA 2HHWA 4W5TA 1SUQA 3WNHA 4CEAA 3HP9A 4CJVA 1A5XA 4QCLA 1RTHA 1QSLA 3A2FA 4AHRA 4ZTJA 1WSEA 3VQQA 1RT1A 3T1AA 1UA1A 2PY5A 3RMBA 1LAVA 1NOZA 2PYJA 3ZT2A 1ASWA 1JKHA 3KK3A 4FLTA 4FJKA 3TARA 4CJWA 4CF1A 1EETA 3L3UA 3LANA 3U6FA 1TGOA 1WJBA 2D0CA 4KPYA 5FROA 4CHPA 3K59A 1ASUA 3OJUA 2QKBA 3K5OA 1LWCA 4LY7A 3HVRA 3AVCA 1S1UA 1JLQA 1IH7A 2GV9A 3TAGA 3HO1A 1FKOA 3HSTB 1NJWA 1W9HA 4UQGA 4B9SA 4CFBA 4QAGA 4ELUA 3RR7A 5J2PA 4CJTA 4CCHA 1T7PA 1XI1A 2YNFA 1G15A 2QXFA 3OY9A 3DLBA 2DFFA 3M8RA 1VRTA 4BDZA 4O44A 3AVBA 2YKNA 5CY4A 3OYMA 3NHGA 4HVJA 3AVGA 4DU3A 1KFDA 3KD5E 3RTVA 1TAUA 2VG7A 3K5NA 2YV0X 4F3OA 3S3OA 2JGUA 3MXIA 3C95A 3IAYA 3ITHA 1F21A 3O4QA 2YNGA 3U3YA 3HPGA 2B5JA 4GVMA 1WJAA 1UOCA 5I42A 3VQ6A 1WJFA 1RDAA 4CEDA 4W5QA 1REVA 2E6LA 4FJHA 1BGXT 3RMCA 1WJDA 3V1RA 3SV4A 1VSMA 1NJXA 3KLFA 1NK6A 3KD1E 4FZXC 1T8EA 3L3VA 1XC9A 4PA1A 3AO1A 1YT3A 4DF4A 3HPHA 1TAQA 3V1OA 4KHWA 2X6NA 3RWUA 3QEWA 4CJ5A 3SNNA 5C24A 1XHZA 2IS3A 4LH4A 4CIFA 1XWLA 3VA0A 4KHUA 4BE2A 1IKXA 1Z25A 2HHVA 1WSGA 4HUFA 3PY8A 2P5GA 3MAQA 3MECA 1HNVA 4L8RB 3NF8A 3CFPA 4NYNA 2EX3A 4DQIA 1IKVA 1RBUA 1JL1A 2YNIA 4ZHRA 3EZ5A 3U3GA 1N5YA 2RN2A 4CGHA 3HVTA 1GOAA 2VG6A 5JS2A 1QQCA 4F8RA 3SQ1A 4M42A 4OJRA 2IC3A 1HQEA 1B9DA 5KTQA 4CGIA 3SPYA 1RTDA 3OYKA 1JXBA 4AHTA 3CYMA 3WNFA 3KLEA 4EP5A 4AHVA 5C25A 4CGGA 1U4BA 3DRSA 4E1MA 4DFKA 1HJRA 3BGRA 3P83D 1BIZA 3NGYA 4E19A 3QEXA 1WSIA 1O1WA 1VSLA 4CE9A 1NKCA 1C0UA 5C42A 4CJKA 4Q5VA 3L2UA 4KTQA 2FBTA 4FJ8A 4RW7A 1UAXA 1S6PA 4O4GA 4HUGA 3PUFA 4CJLA 1RT5A 1JLGA 3ALYA 4H4OA 4AHSA 2WONA 2G8HA 1C1AA 3KK2A 1LWFA 4FZYA 3DM2A 5HLFA 3TAMA 4ICLA 5KI6A 1C1CA 5KRSA 4FM0A 2KTQA 3AVLA 3LDSA 1DTQA 2KW4A 4PWDA 4CJPA 4IDKA 4FJXA 1WN7A 2ATQA 3G0ZA 4O55A 4GMJB 4E89A 3RRHA 4LD0A 3OYHA 4C8MA 2ETJA 3V1QA 4CEZA 3LALA 4M3TA 3IG1A 2O4GA 4KO0A 1VSJA 2VWJA 4BE1A 1BQNA 5K14A 3KIOA 3TR8A 1SL0A 4KB1A 1BQMA 3QLHA 4F3QA 3K5MA 4DTMA 3QERA 1S9EA 4FLWA 3QNNA 3AVFA 1SV5A 2YKMA 1CZ9A 1TKTA 3AVAA 3KLHA 1NK5A 3TANA 2G8WA 2HHUA 4W5OA 4ELVA 3SI6A 1T05A 2KQ2A 4FJ7A 1KRPA 1S1XA 3DI6A 1BI4A 1WAJA 3OS1A 5HRRA 3C6UA 3NBPA 4NYFA 3CM5A 3LZJA 4ZTFA 3VQCA 1SL2A 4C8LA 1C6VA 2HHTA 3K5LA 1RILA 2OPRA 3M8QA 4J2EA 1DLOA 1HRHA 4B8AB 1YTUA 3VQ4A 4M41A 4DSJA 1EP4A 1WJCA 4CHOA 4FK4A 3S9HA 2G8KA 3QIOA 4W5RA 4PUOA 1HYSA 4I9LA 1NJYA 4N76A 1ZBUA 4FZZA 3WNGA 4DQSA 2D0BA 5CZ2A 3P5JA 1VSIA 4OKEA 2HMIA 2Z1IA 1TV6A 3PO5A 1GOBA 4F3TA 2VG5A 1NKEA 2F8SA 3KLGA 3QESA 3QETA 3OYBA 3FFIA 4AHCA 5JS1A 4FLYA 5J2NA 2I5JA 1TK0A 4FK0A 1JL2A 5DK5A 3OYJA 4M3WA 2ITGA 2XY8A 3H08A 1QSYA 4AH9A 4DFPA 1C1BA
chains in the Genus database with same CATH superfamily
2L7ZA 3EUKL 2VYPA 4EMSA 4E0DA 3ZSQA 2A6EF 5EZGA 3NWSA 3O3HA 4IG0A 1Z0XA 2LY1A 1ZBFA 3SUQA 4BQAA 2DQLA 1NK3P 1S7AA 2HTJA 2K02A 2DPUA 3E1YA 3L4QA 4B1WB 4BROA 3GTOJ 2UXDK 3OIOA 3CTAA 1JHFA 4IFVA 3JSPA 3VQAA 4B9VA 3HGYA 1G4DA 4IHYA 1BO5O 2OZSA 5KHDA 3H0DA 2NRAC 2L4MA 1KFSA 4FJJA 2YCHA 4KI4A 3IRXA 1SKSA 2FBIA 2IGIA 2X0LA 4CBXA 3F6OA 2HHSA 2UV1A 3GTMJ 1N25A 4I76A 1ZRFA 1DP3A 2EJRA 1HSJA 1HQUA 1YE9A 4PKGA 1A5JA 4NC8A 4IRHA 3JRFA 3DV8A 2X48A 4S05A 2EWSA 1GVDA 4IHXA 4DSFA 2FF4A 1L3LA 4PUSA 4U88A 1D8YA 2XF5A 1FPQA 2W7NA 2KRFA 4UV9A 2P51A 2XAFA 4XRFA 3MN9A 3EE8A 1VQLN 2XHKA 3ZQFA 4CCLA 1T3VA 1S7EA 2HGCA 3CF5F 3EZWA 1QHHD 2E60A 4P5OA 4R1HA 3VDXA 4HF1A 1BIAA 5MLCQ 2CUEA 3CCVN 1Y8QB 3CJBA 1TWHJ 3FXLA 2WTUA 1SANA 4AC0A 3OYGA 3TGNA 2XO7A 4EV0A 2BDPA 2Z1GA 5KCMA 3WGHA 4CZLA 2NVUB 3VSLA 2RF2A 2HW3A 2HDDA 1KAXA 1M1EB 4EP4A 2OTJI 2P7VB 4HF2A 1ZGWA 4KRFA 3ULDA 4NCBA 2CH6A 2X74A 4N47A 2E5LK 1KU2A 5J1EA 1H88C 3S3MA 3M9AA 2F48A 2ZJQF 3BLYA 1TBXA 3S3NA 3A2KA 2Y48A 2P1JA 2F4IA 1IRXA 3T1YK 1A6QA 3E5QA 1B9MA 3ML6A 4AUXA 2O8BA 3ZGKA 1YQAA 1BI2A 2O7OA 3HSRA 4BR9A 4KT5C 2H1KA 2V4JC 3VWBA 4WQ5C 4AM6A 2FE3A 3A01A 2BXYA 1FBQA 3A5NC 4GNIA 4BY7J 1O7LA 1E3HA 1VAZA 3QEVA 4FJXA 2VT2A 3V9XA 5ICEA 4DQPA 3L4IA 4KIFA 4RAFA 5DUKA 1GLJO 3M07A 4B8CA 3IAS2 3GWZA 2WOMA 4KMUX 1X9SA 4PKIA 3J7AO 2NRHA 4FJ8A 1R5GA 2FSWA 3ASNH 4DV1K 3F23A 1DTTA 4GXOA 3L8BA 4F2RA 4JAXA 3MCAB 1TC3C 2OTJN 3GUDA 5E79C 4OWRB 2IA2A 5FB2A 1LFPA 1FOWA 1WH7A 2ADUA 5EZHA 1BIUA 3SUPA 1TKDA 1EV7A 3GL1A 4IJNA 2A1RA 4Z94A 3I4NJ 2QGUA 2LC2A 3BG5A 1RESA 4J2BA 2CQKA 4GCVA 4H8KA 4JKDA 2ZXWH 2XGXA 4BGBA 3OS2A 1MBHA 5F0HA 3A4CA 4MFEA 2NVYJ 3KZZA 4DYRA 5AFUA 1MH3A 2L9SA 3V81A 3I55I 3C6TA 2HKXA 3JAMO 2BZTA 1IKWA 1CZBA 4II2A 4DG1A 2W4SA 2GQQA 1W36C 3I0RA 4K41A 3OJSA 4CJRA 1VSKA 4XLNF 3AARA 3EL2A 3CCUN 1APLC 1P8ZA 3J7AY 4B3OA 2L02A 4DV0K 2CH5A 1LDKB 2YSRA 2DU9A 3QPHA 3ROUA 3T8TA 4WYBA 1U48A 4DR4K 4I7FA 2KLAA 3M1FA 4UV8A 3NDKA 2L4AA 4KFBA 3VQ7A 4XOPA 2A68F 5EJCA 1LNWA 3K4BA 1JUSA 3ENHA 2Z3YA 2QQBA 3F9MA 3MD2A 4M3RA 4BRMA 4CZJA 1D9DA 4HCBA 3I53A 1T08B 2CQ7A 1ORKA 3G25A 2R7OA 2YJEA 2BY2A 2JUGA 2WBMA 1MDMB 3WTXC 2LH9A 2K27A 2IBDA 2K9QA 5J6XA 1U04A 4EGZA 3FISA 1RKTA 4DBQA 2DJNA 3UE5A 1PUFA 5BNGA 5D8KB 1HBXG 2G7HA 2MFZA 3DEWA 4ZDLA 3SDGA 1O13A 2FRHA 2PBIA 3O6BB 4QPOA 4FXDA 3OL4A 3PQJA 3U2RA 5M1OA 3A1YA 3IP4B 4L0ZB 2O8FB 4EJTA 1V54H 2QKMB 3HOYJ 1HYVA 1J5OA 3EDPA 1UAAA 3DTIA 3OYFA 5JVHL 2O8CB 4ZYGA 1J54A 2Y0MA 2HOSA 3ISPA 1T33A 2JLEA 2CS3A 4LIVA 1BHLA 2FOKA 3K2PA 4H5TA 2W00A 2HBLA 4HSTA 4G9YA 4ENNA 3ULQB 1GVJA 5BPIA 2D0AA 3O8MA 5BPLA 2KT0A 4DR1K 2XY5A 4PY5A 1JE8A 3R6SA 5GAHJ 3VGLA 3DQVC 3MX5A 2A1SA 3TU5A 3WXLA 2XAHA 3RQ4A 2M8GX 5L3GA 4A57A 1D0ZA 4QS8A 1KSPA 4KTZA 2E4LA 4B3RK 5E3MA 1B6AA 1QZ6A 5CHIA 1GDTA 2RNJA 4B9TA 4FJIA 4E4HA 4FOIA 3AAFA 2JRTA 2DFEA 1K78B 3CI5A 4JI2K 2DK5A 4CEOA 3HK2A 3E6BA 2VIXA 2W84A 2WADA 1ZKGA 3F8NA 4PGGA 4RS8A 4ANJA 3KP6A 2MBFA 5JLWA 1VQ9I 2Z5UA 4J01A 5GAGP 1NK8A 2VODA 1SFKA 5J2QA 3QBXA 4PJLA 3SCXA 3FBIB 4P9UA 4RW9A 4N4NB 2I5UA 3R4KA 4P55A 1QPIA 4EJOA 3MKWB 4RW8A 3PX6A 4FK2A 3LL7A 4RM3A 2WAEA 5AQNA 2WC2A 1UWBA 4I09A 2F9TA 2B0LA 3I0SA 2LTPA 1QS4A 2JPBA 4Q0BA 1FOYA 1A5WA 3ZEUB 2VB6A 5C4JJ 1PUEE 4YOUA 1AHDP 1VRUA 1YTAA 2ITMA 4LLGF 3CCSI 1VQ4N 4FJNA 2WV0A 1SQKA 3W3DA 1QVUA 4CI6A 4PHTX 1VQ5N 4A3JJ 1OCCH 4NQWA 5LHGA 2DOEA 3K0LA 4A5NA 4IOAF 1LAWA 2STTA 4IRGA 3ZQQA 3HOSA 1OCZH 3K58A 1EF4A 3F8CA 4YIRX 4Z4EA 1WB9A 2L5QA 1X3UA 4BU2A 4NHJA 1RT7A 4IJAA 1REPC 5EEAA 1QHGA 1ON1A 1CZAN 2FBVA 1WJEA 2HVSA 3U1KA 2Q36A 2ESNA 2GA2A 3N97A 3QNOA 4V19S 3DCFA 4LF9K 3VPRA 2HF3A 2XGEA 3O9TA 2XF6A 1UELB 1ATSA 1KYWA 2O0YA 1RT2A 4JK9A 1MSFC 4E1NA 3GTJJ 4QWQA 1H1VA 2CGLA 4RW6A 2BVMA 4FLZA 3W6KB 1ILYA 3AKZA 2YX7A 4CHNA 2YNHA 1A36A 1JTYA 3O2PE 2NOGA 2E1NA 3F21A 1HNIA 1Q81O 1JLFA 4BQNA 4WXDA 4CZMA 2WV1A 1TK8A 1TK5A 1FNNA 1RI7A 4G1QA 4H5RA 3V7RA 2X6WA 3IL2A 1BC7C 1GUUA 1E3PA 4KV8A 2DBBA 2XRLA 3E5UA 4Y7NJ 1K78A 3AG2H 1XD7A 3KYDB 4EGYA 1LE8A 4MEXF 1UHSA 4JHDA 1L0OC 2VI6A 2QKKA 4KI6A 1WFXA 4DTXA 2DI3A 2A69F 3RYRA 2CRGA 2IOCA 4WFAL 4GV9A 2V26A 4BHPA 2XKPA 4E7SA 2CGPA 2OPSA 5I3UA 1YW7A 2LK2A 3MVPA 4A3GJ 3FXKA 5D6FA 1IC8A 2XPUA 1LV5A 1MNMC 4PFPA 3CJ9A 4B9UA 4DYQA 1FY7A 1ZGAA 3S1RJ 1J75A 4ZZDA 3GYHX 1OVQA 3NH2A 4CCJA 1K8KB 4FJGA 3F3XA 2XGCA 2ZMEA 1IBKK 3I55N 3NFAA 1K7AA 1WNSA 3ESWB 3SQ2A 1OCRH 3IDHA 2EV0A 2IJLA 3Q7BA 4AIJA 2HDCA 2P5OA 3LP2A 5D4SA 5EDNA 2HQ5A 4ID5A 4J2DA 3ABMH 1UFMA 4RGRA 3QDKA 1YX5A 4BE0A 3CCVI 3IMXA 3BQYA 1O3SA 1IJJA 4DSLA 4KBOA 4BUPA 2R7XA 2BGGA 4LH5A 2O6GE 3ZSZA 4DFMA 4LFCK 4BDYA 2M45A 3FXMA 4F55A 3F2KA 4CEQA 1JI8A 4WX9A 2LP0A 4HOBA 4PK4A 2ZM6K 4JRPA 1IBLK 2OV7A 5K5QA 2JWTA 3KWGA 3TBIA 5LMUK 4B47A 4EZ6A 3M8PA 5J1RA 2XY7A 2OCCH 3NF6A 5LJVA 1BCMA 1NGDA 5J8CA 5D5XB 1LVKA 3KJVA 4HUEA 4N5SA 3T0YA 4K8ZA 2OA4A 3QIPA 3SPZA 4UB8C 1G3SA 4F91B 2YHBA 1V5GA 1VQ8I 4M9ZA 4ZYHA 1SMYF 1XC5A 4H5NA 2KLOA 1IXCA 2E1ZA 4E7ZA 3WTYC 5LHHA 2LKSA 1QQIA 3E0JB 5ED4A 3CFOA 4CEBA 1HCRA 3HXMA 2IGNA 3Q9SA 2OZMA 2DA4A 4Z6YA 5KAFC 2CV2A 4KNYA 5F2RA 3SBTA 2DCEA 4AHUA 2G8FA 3K1MA 1IRGA 1Q9XA 2MGQA 5BR8K 4M9XA 4B9MA 4A0ZA 1R23A 3OYNA 3OV8A 1XMAA 2IP2A 1GXPA 1YIJI 2W48A 3WU0A 1D3YA 1O7FA 2IVPA 5FLMJ 4CF8A 4O5FA 3DKWA 2XROA 1ZG5A 9ANTA 2O5RA 1FYMA 4A3KJ 4CEAA 4CJVA 5M5XJ 3TO9A 1A5XA 2FF3B 2A3SA 5DM7L 4JI1K 3A2FA 1WSEA 4IFEA 3VQQA 2FMLA 3HUGB 3D1NI 1HLVA 1UA1A 2PY5A 2BW3B 4BG8A 1LFBA 2JA7J 2EBIA 1J5YA 1T38A 1EETA 4HYEA 4NB5A 3H3VK 3EKUA 3BDPA 5TRDA 2OQRA 1TGOA 3OTOK 3THWA 2ELKA 2D0CA 4CHPA 1R9TJ 4A6DA 4JKEA 1WBDA 3RI4A 3HVRA 1IXRC 2K3PA 2Z1DA 2GV9A 2NS8A 1MMNA 2OPTA 3K69A 5D6EA 3BG9A 1YUWA 3HSTB 3CLOA 4LG0A 3L09A 4UQGA 3R60A 4DR5K 3GDQA 5J2PA 3CDHA 2JJ7A 3CLQA 1BC8C 1XI1A 2EZKA 4ESFA 2JVGA 3HKZA 3OY9A 1T8IA 3LOCA 3ZQIA 2CG4A 1A35A 3AVBA 3W6VA 5CY4A 1Z91A 5C15A 1G3WA 4V19K 2AQFA 2P5KA 3IH3A 4BAYA 2XSDC 2JPCA 2VG7A 3DXKB 4BVPA 1NG9A 3K5NA 2YV0X 4HDUA 1YXQA 3MEEA 4MHGA 3ZCOA 2EFWA 3I33A 3IAYA 1NGCA 3A5LC 5EEHA 3HPGA 1P4AA 2Z33A 2B5JA 4GVMA 2NRWA 2GA1A 1WJAA 4EM0B 2VPLA 4XLHA 4MTDA 3SMSA 3VQ6A 1WJFA 4CEDA 4W5QA 4XEIA 2VWBA 3VETA 3LSHA 1FIAA 2NS0A 1P2FA 1BGXT 3V1RA 4HAMA 2OAZA 4G12A 1VSMA 1NK6A 4M6VA 2G0EA 4P9FA 2QBYA 3CC2I 3M4OJ 1S72I 3J81Z 2DA7A 3R0AA 1XC9A 3ASOH 3VGKA 2VKDA 2Y9ZA 5TGTA 2D4WA 3E7LA 3D0SA 3RWUA 3THWB 1UCRA 3QEWA 3EQLF 1XQSC 2W41A 3BJ6A 2F4MB 2IS3A 3HOTA 3WEEA 3C18A 5KAIC 5M1KA 4HUFA 2F4OB 1HNVA 2HI3A 2M9HA 3CFPA 1NHAA 4NC7A 5H20A 1IKVA 2ZXIA 1RBUA 3ATVA 1JGGA 4CVNE 4HQMA 2RN2A 4JNEA 4MGRA 2EPFA 3SZGA 4NXMK 1BA0A 1F43A 1GOAA 4FX0A 4EM1A 4M42A 2F8SA 2XVCA 2IC3A 4NO7A 2DDAA 4I99C 1OR7C 2GEMA 1BDGA 2HMPA 3SPYA 3WU2C 1AKHB 3N4MA 1GLFO 3CYMA 3OBWA 4AHTA 3KLEA 4EP5A 4AHVA 5M1PA 2W25A 1TW3A 1FP1D 2FOWA 4CGGA 5C12A 1UG0A 5HLTA 1B4AA 2W85A 3BGRA 3NAUA 3P83D 2L0KA 1DGKN 3NGYA 1POGA 4FX4A 4E19A 3RKYA 3PM1A 3BF3A 1ITYA 1Z77A 3R0JA 3J80Z 3E6DA 3K1NA 1R1VA 1YS7A 3MWMA 3MFKA 1NGEA 1Q1HA 1RR8C 4OU0A 2PBDA 4PKHA 2ASPA 1HKSA 3BG7A 1F36A 3I9V2 3CQZJ 2ZCWA 3PUFA 1TUUA 1UAXA 1BOTO 3LAPA 3F8MA 1RT5A 2V1XA 1CF7A 1J7KA 1PDNC 3GBGA 2WONA 1WRJA 1P7IA 3EEQA 1B1BA 4IWVA 3KK2A 5HLFA 5KRSA 2KTQA 3SDBA 3ZYYX 1OCPA 1QZ5A 3LDSA 1SFXA 2YI1A 5FKNA 1SFOJ 4G7OF 3QMLA 1KQSM 5F0CA 4B3MK 3G0ZA 2KP6A 4G6DA 2JWKA 3OYHA 4C8MA 2ETJA 3V1QA 1Z6RA 4CEZA 1TT5B 2CMPA 2O4GA 5LGUA 4KA4A 2Q0RA 4KO0A 5C10A 3KIOA 1BQMA 4DTMA 2NRVA 3THXB 2NYXA 3H36A 5AQVA 3QNNA 4ENMA 1XMXA 5DV5A 1HKGA 2YKMA 4L9VA 2P8TA 4N9HA 1BI0A 4BY1J 4W5OA 2TCTA 3B8AX 5BN8A 4ELVA 4P1WA 1T05A 4HNUA 5TJJA 1TUYA 2ZGYA 4JKHA 4IXAA 1KRPA 3S32A 1UG2A 5C2FA 4CSWA 4IEEA 2GIVA 3OS1A 4NYFA 1TYQB 4A3LJ 4C8LA 5J47A 2KIMA 3ZN1A 4LJZF 3M8QA 2R7DA 3FM3A 4J2EA 1DGRM 2M8EA 2X6OA 3SHFA 3V7SA 1HRHA 1YTUA 3J7YJ 4IZZA 3MN7A 4RDUA 5AQPA 4M41A 4DSJA 4ENKA 1AOYA 3CZ6A 4CHOA 1WJCA 3OIPA 3S9HA 4AQYK 4M73A 4PUOA 3CCEI 2P9IB 4I9LA 4IOCL 2ZGZA 3D7EO 3H9QA 5GTIC 2XKOA 4S04A 6PAXA 1W7PA 1R49A 3A0HC 3P5JA 2QF7A 1VSIA 2QWRA 4DIQA 2HMIA 4HX7A 5CVJA 2CWEA 1IN7A 2M1BA 3ZN0A 3WU1B 5EOYA 5AONA 4L0YB 4V2GA 2KJCA 3DLLL 4DQ8A 1YI2N 3M5RA 1NKEA 3LSMA 3OYBA 1BM9A 4A93J 2D0OA 2YX4A 2W6LA 1IV6A 3CHWA 4FK0A 2IW5A 3EYYA 3OYJA 3TR8A 3EO3A 2D45A 4JKBA 4C1NK 2HZTA 1P92A 4X65K 1W5SA 4M3BA 3QFPA 5ICCA 4KFCA 2GLOA 2LG4A 3BUZB 1MBGA 4BRGA 1RTIA 3BWGA 3L7WA 3MN6A 4DLEA 3RSEA 5E3OA 4LG0B 5M5YJ 4B8XA 2JZYA 1JLCA 4CJ4A 2ZSIB 1V5FA 2QWMA 3ZT3A 4CGDA 4A3CJ 3FF5A 1B8IB 3ZSOA 1JLEA 1SFEA 2Y0SA 3ZX2A 4BRLA 4DKWA 3J7ZO 4JS5A 5K1YA 2PYLA 2AP1A 4DR3K 1KVBA 1ZK8A 2QM1A 4G9ZA 2CQNA 2E7XA 5B1BH 2EA4A 3WQUA 4DB3A 1MBKA 3JRAA 4RAZA 3L2WA 2KISA 3QPSA 2VBYA 1TWCJ 1IN6A 3KHYA 3M8EA 1KCFA 5FDLA 3ZT0A 2YHWA 4EIAA 5CE3A 3CFRA 3HEFA 1J0RA 2JSCA 1HUXA 3MN5A 2NUBA 1XPXA 1BU6O 1S6LA 5CVIA 5L3BA 2IS1A 1BCOA 1LW0A 2OD5A 3ZMDA 1RT3A 2OA8A 3FHZA 4CFAA 2E8AA 2DA6A 3GG4A 4DV5K 4DTPA 1MZBA 3LAJA 2HPMA 3PL8A 4NCGA 4I2PA 1Q9YA 4KHUA 2UXNA 3I0TA 3LP1A 3OR2C 3L2RA 4JEPA 2BXZA 2ISYA 3LSIA 2M34A 5EEGA 4A2BA 1YFHA 4IRIA 2Z99A 3ZXSA 2WA0A 2B63J 4A3DJ 3AV9A 2ESHA 1NK9A 1M90O 3G10A 5F04A 3DLRA 4WQ4A 1OH8A 1XDUA 3BTCA 3RSNA 2VLAA 3FZHA 1SL1A 3FK6A 2HVHA 3FK7A 1HF0A 2D1HA 1HYZA 3BY5A 3VPZA 4XLCA 1NGHA 2BTFA 5ADXA 4OGEA 3WHBA 1Z6TA 2NVXJ 4DSEA 2A5XA 2RKHA 4LFAK 2YHXA 5KNLA 3AO2A 1HLUA 4X6AJ 2QEXI 3EYZA 1ZAOA 1NTCA 4N0BA 4DJAA 5F1RA 4D1QA 4CESA 1KAYA 2EA2A 3BZKA 1IKYA 4LGWA 1G99A 4OGCA 3UKUB 4DLGA 3LAKA 1IG9A 2FX0A 2VUMJ 3GXOA 1GHCA 2GTDA 2E34A 1I1SA 2GUIA 2DA3A 1K79A 2OANA 2LREA 4LB6B 3CJAA 5BREA 5M1NA 4M3WA 4WQ5A 2O8CA 3PV8A 1T0FC 2ZXHA 4M3GA 3G6EI 3VQPA 1KONA 1L3SA 5AQOA 4AIKA 1LOTB 2KQRA 2VJIA 3KK1A 1XSDA 3OL3A 5M5WJ 3RKQA 2E1YA 2QSGX 3N4QA 4PCQA 3NEUA 2AS5F 5ILSA 3LDOA 4KHQA 3AA4A 1XC3A 2R7FA 5A2QO 4ILJA 4HLXA 2P5VA 1VNDA 4C1NI 1MNDA 2QSHX 2WUSA 4DV3K 4DV6K 1P6RA 2WC9A 3KTQA 3OVNA 1ZBSA 4FPBA 4JD2B 2E36A 3K4JA 2ZO4A 4WXHA 1X9MA 5K5RA 2KFNA 5KPTA 3H46O 2HQRA 2KDZA 1J53A 4WF2A 1G2HA 3M1CA 4IL6C 5EVZA 1EH7A 3HT3A 3HJFA 3BR1A 1DU0A 4JS4A 1IJWC 3S15J 1W7PD 4II3A 3VEOA 1HQCA 4CZIA 1XG1A 2M2EA 4I6ZA 1NGIA 3KKSA 3VF4A 1K9MO 3U1DA 4BWMA 4H4MA 5FLVA 2HNDA 4JYAK 3ASMA 1TTYA 5LMNK 3R9PA 2CV0A 4LITA 4MQ9F 4C3IJ 4JK1X 5EGOA 1PP8F 1B59A 1ZREA 1YYVA 1G8XA 2EH3A 1KVCA 3A8YA 3CJRB 4CJFA 2QENA 4PGHA 4CJ3A 5HNHA 2HB5A 2E5NA 4NQWB 1ZG3A 2FC0A 1RC9A 2HOEA 2I7NA 3HM9A 5E26A 1IBMK 3G1OA 2DQRA 1UMQA 4JKAA 2H1LA 3CDIA 3FLCO 2E2JJ 3H45C 1MIJA 1S9HA 4WCGA 4FWKA 4H0YB 4KKOA 1X1DA 2FF6A 1J2XA 4Q4ZF 1X1AA 3CCMI 2D5RA 4IFYA 5HP1A 2PX9A 3E6MA 5M3MJ 2NVQJ 3DF8A 4Z0UA 1R59O 3I59B 3LFKA 4LLLA 5J4VA 1MU2A 3RMAA 1XGMA 5B3SH 4H0PA 3G71N 4BDPA 4CGJA 4B9SA 2AJQA 2F9WA 2M0CA 2CQQA 4NDLA 1KD1O 3VENA 4HPQA 2NNNA 3QOPA 1ENHA 3EUAA 3F0CA 2BE2A 5GIPA 3GE1A 2VWKA 3C7JA 2JQ7A 3CCLN 2VE8A 1VQPI 4WCEL 1X2MA 2FSNA 3WXKA 3PSFA 3DWLA 1YHQN 5FPMA 3H92A 2LR8A 2GBZA 1F4KA 2PMZN 4CBWA 4CICA 3DMJA 2QZ8A 3DLLF 1J9AA 1Y1VJ 2DTZA 4IEIA 2KIFA 4I7HA 5LBQA 3NCIA 1Q8IA 2PEXA 1MBFA 1YAGA 1VF9A 2R5YB 2WAQA 2M3AA 3JXUA 3C7NB 3QICA 4CFDA 1U49A 4I2OA 3TW6A 4Y15A 4MIMA 4XRSG 1FXXA 4HHTA 2O8BB 3TP0A 5M1QA 2F96A 1MMSA 4RCHA 3K1PA 2HKOA 2PQ8A 3PNYA 3BCAA 2ID3A 3LA3A 3JSOA 5BMZA 5IOZA 1Z9CA 2W6KA 4YHHK 3S1MJ 1RRJA 4YFUA 5AQIA 2KZZA 2NVTJ 1SKWA 4CHUA 4CUGA 1Z05A 2K5CA 1ETXA 3X2QH 4RB3C 2IEKA 3C65A 3QO9A 4JI0K 2HHXA 2HHVA 2X85A 2ZJPL 4BR7A 4OIPF 3LA7A 5IT9K 2MH9A 1JUPA 4RAGA 2BV6A 1L3UA 5DMRA 1NOYA 3JTHA 4D5CA 3O1BA 3PX0A 5E41A 2F5CA 3FKIJ 5SZTA 2ZD1A 5C4XJ 4DFPA 2J4RA 1EO1A 2LBFA 4M72A 3R1XA 3VSKA 4KTWA 1CLQA 2P9PB 4PFOA 5E17F 3AA5X 1XNQK 3MKLA 1RDDA 3DXJF 4CJUA 2RPIA 4JKGA 3FXQA 5IOYA 4AM3A 3GBTA 4DOZA 1QNTA 4GW6A 1BI1A 3FMRA 4GO1A 4ITVA 3I56N 2B7EA 3D2EB 2EHGA 2FMYA 1GLEG 3D2FB 3TTCA 2P9SB 4LSLA 2E88A 2P9UB 3K70D 4FWOA 3KETA 1GLBG 3TWHA 4GKJK 4M63C 1SAZA 4A5BA 1TQPA 3NAEA 4CH7A 4CF2A 4OLBA 3C2GA 4C8KA 1QZZA 5LRSA 3MEDA 3O9UA 3LMMA 3VF6A 5E8IA 3TP3A 4KHNA 2FXUA 4I9QA 4HA8A 3VEZA 3ZMUA 1XGSA 5KK1A 3RQIA 1BR2A 1MBEA 3KYLA 4RWTA 1EXQA 2RV8A 4CJSA 2ETHA 4QTRA 4OPJA 3JSMA 2E1CA 3AVJA 3HHHA 1S1WA 1ZBLA 4GV3A 5EGOB 3FXJA 1DPRA 3DPLC 4EVIA 4XKWA 1U5TA 3BJAA 3FXOA 4XICA 3KP5A 4BC2A 4CJ7A 5LGNA 4M45A 4X0GA 3H9GA 1VSEA 3SAHA 4N9IA 3NGZA 2UUBK 4CK3A 1TL3A 2EQRA 3GFLA 4RB2C 3S14J 5KRTA 1X9WA 4Z4IA 5L3EA 3M3YJ 1CF7B 3DOKA 2W42A 4OAYA 1VQ9N 3RR8A 4A3IJ 1Y64A 4OVLA 3O3GA 3AVMA 4KHPK 5FGMA 2XB5A 3OYIA 4QSHA 4JD2A 1NK7A 1N32K 4U0VA 3RCOA 4KH4A 2FXAA 1IZ1A 4J8FA 3TO7A 2ME0A 4B1VA 2E1MB 1ITGA 4FSVA 3C3WA 4DFJA 4XLAA 2RKIA 5J4YA 2JMWA 3TPQA 1W7AA 2JVHA 3AG1H 1LDDA 3VYUB 1QQNA 2YX6A 3HM5A 3DLKA 1NG7A 1ZARA 4EEFG 3JRGA 3ZEUA 3BPVA 3KZIC 1CXUA 1FIPA 4HG2A 1P7JA 1R5HA 5A2QZ 1YRNA 4CJEA 1YF5L 3LSPA 4CIEA 4IVNA 2E19A 1R58A 5K7ZA 1WI9A 1TP4A 5D3GA 3GO5A 5ILVA 1BL3A 3CUQB 3EN9A 4DTRA 2I10A 4EJUA 1QHTA 4WWCA 3LP3A 3LWLA 2YPRA 1MJAA 4BGAA 2BVLA 4CF0A 4KICA 5M3FJ 5JLHA 4DV2K 1FMVA 4BHCA 4E7IA 3PQKA 3QODA 3QYEA 2QWQA 1HSTA 4BVOA 4K0KK 4NLCA 2YS9A 1GLNA 2BHZA 2ZMEC 3V8LA 3FGUA 1LJ9A 1QSSA 3MZHA 4D5FA 4E7HA 1ZH5A 3OYCA 1D4XA 5H2FC 4DF8A 3KKRA 1UB9A 3KX2A 4KN4X 4RA2A 1QA6A 1I39A 2E6MA 1W5CC 3A5MC 3M6GA 3D0PA 4FJLA 2Y30A 1VQMI 1YI2I 1RUNA 2XSJC 3Q0UA 4YOYA 3VFZA 3ZMZA 1RBSA 3CJ7A 2HOAA 3M8JA 2DFHA 2OPQA 4YDUA 2VQLA 4EM2A 3T7ZA 1U45A 2IDOA 2KKOA 1ZTRA 4L5JA 1ZQ3P 4JRQA 4Y17A 1C0GA 3P9KA 2PAVA 4CERA 2QWPA 2L54A 1QPMA 2X78A 2P6TA 2NXNB 2CFOA 4JKFA 5AFUH 3UNGC 2EWNA 3R6MA 3R8EA 1WLJA 5HRSA 2CUZA 3H3UA 4E7JA 1B92A 4JX4A 5CYMA 4UNOA 1ZBHA 1D1AA 1USTA 3G1LA 3L2CA 3IC7A 5LEKA 4ISFA 2FBKA 4FPAA 2IGKA 2A40A 4OIRF 3KYCB 1VZ0A 2KRCA 2MYSA 1NJWA 4BS9A 3LSKA 3CERA 1HNWK 3KCCA 4CEEA 2PJPA 3L9FA 4W5TA 3WNHA 3HP9A 3FZMA 1NKCA 5JMVA 4HF0A 4JQFA 2VQGA 4A69C 4ZTJA 4IHVA 5AQRA 1ZGJA 3SXYA 4O5VA 5CQGA 1ZLKA 2CW7A 5TISC 1ASWA 1LAVA 1FTZA 1JKHA 1NOZA 4HTLA 3TSUA 4C9YA 2PMHA 4FLTA 3AY9A 1E4FT 1U2WA 3SLCA 2AQEA 3HHGA 2C6YA 3GZNB 2X6YA 2GZWA 3RVCA 3TKYA 4YRVA 4DR2K 2OZ6A 2HQAA 1ASUA 3KVGA 2QKBA 2BH1A 4LY7A 4WFBL 5DM6F 1IH7A 4OMYA 3HO1A 2DAOA 1YIJN 3MKZA 3MWTA 1AKHA 3C6HA 3QFUA 4BXXJ 4CDGA 4QAGA 3FMSA 3LQQA 3T1HK 4CCHA 4AD9A 2HTSA 4DBRA 1YITN 3VYSB 3DLBA 1XNRK 3I56I 4BR5A 3OYMA 3FWEA 1IN8A 4JI3K 3KD5E 3SFIA 4A6EA 1NGAA 2W57A 3G71I 1VQNN 2VE9A 2ME6A 4L18B 1OYYA 2PJRB 3F8FA 3OHRA 3MXIA 1T95A 2EB7A 1BJAA 1F21A 3FHNA 5JHUA 4J19A 4FWPA 4C30A 3U3YA 2GOMA 5D5UB 5F0XA 1UOCA 3WE2A 3FKJA 1ULYA 1REVA 4JP0A 1X3MA 1J6ZA 1WJDA 1QU3A 2OZUA 1X4PA 1WCMJ 1MD0A 3KEYA 5BR9A 3ZPLA 2KDOA 3KD1E 1EJ9A 2RQQA 1W97L 3H0GJ 4DF4A 3ZMTA 4Q5SF 3IH2A 3IKVA 1TAQA 3V1OA 4KHWA 4LLNA 3KZBA 4CJ5A 2M0MA 1IV0A 4LFBK 3CMYA 4XMYA 2QA4N 4KITB 2BY0A 5D4RA 4QPQA 1U8RA 4RB1A 4BE2A 1S29A 2MC4A 2WB1N 1XWLA 3VA0A 1XMOK 1P4WA 1V55H 2EFNA 1MJBA 4YFNF 4ENJA 2YU9J 2BUPA 3MECA 2RGVA 5AQYA 5HDKA 3CMAN 4NYNA 4ZYAA 1SD6A 2IPQX 2VJ5A 2XAGA 5K5OA 2O8XA 2NAZA 1NMDA 1VQ5I 2UYTA 2YNIA 3MK6A 2DT5A 1GV2A 4DYCA 2IIRA 2V1NA 3LM2A 2VG6A 1QQCA 3VF2A 5EXWA 4DHYA 2L9NA 3M7GA 3MMYB 4DQ2A 2W24A 1HQEA 4K8XA 4WK8F 5KTQA 1RTDA 1SVMA 4DR7K 1JXBA 1OYWA 2VOPA 4M3FA 2CU7A 2KKZA 4BC3A 4KISA 1OJLA 2DMNA 2XGDA 5F0FA 4L9JA 1MNEA 1HDDC 1QZYA 4CZCA 2PLYA 3QWLA 2UWMA 4E1MA 4DFKA 4D0PA 2M87A 2QQ8A 1Y39A 3IWZA 3MZ8A 1T2KA 2HHHK 1BIZA 1HKBA 1WSIA 4MDAA 3VA3A 2KZGA 2MA3A 3DU5A 2MLGA 4FHTA 3ABTA 4L9NA 1OCOH 5JFRA 1VSLA 2YHYA 4CZFA 3BTJA 4BRPA 3HRTA 4CJKA 4KTQA 1R1UA 2LY2A 1EWQA 4XNFA 4FYDA 3F72A 3GFJA 4H4OA 1R36A 2QWOA 3TTFA 4FZYA 2DMQA 3DM2A 4ZC3A 4FM0A 5CVVA 4ICLA 2VJJA 5KI6A 1K73O 2YR2A 3O8HA 4CD3A 1XDSA 2E1MC 1JKOC 4CA0A 1CGPA 4MLOA 1DTQA 2KW4A 4MLEA 3VODA 1BBYA 2H09A 4HX4A 4NLBA 2FQ4A 4CJPA 4E89A 2O8EB 4GMJB 2QBYB 5FJ8J 4M3TA 4FE4A 2AA4A 1B9NA 2VWJA 2JA5J 4BE1A 1C0FA 1SL0A 2KPMA 1RR7A 3L00A 3K70C 3CJCA 3E01A 4F3QA 3VESA 2LNBA 3JRHA 3JW4A 1ON2A 4F9OA 4GYIA 3K5MA 3AVFA 1SV5A 1TKTA 4XBFA 3I3LA 5F6FA 2HHUA 3FMQA 5DUIA 4XLEA 1OPCA 4HEA2 4IHSA 2HBJA 1DU6A 1IN5A 4YDUC 1LCUA 2ZNYA 5ICGA 4XLFA 3O3KA 3GLLA 2XUBA 4Z2YA 3ABLH 4AU7A 3C6UA 4L5EA 4ZTFA 1OQYA 3NBPA 3VQCA 1SL2A 5D8LB 1C6VA 2HHTA 4RM2A 3FR0A 2HZDA 1KLNA 4XONA 2DOFA 3VGMA 5AQKA 3CMAI 2V7ZA 5BPNA 1YOVB 1WVRA 2Q2EB 3CJ1A 5JR3A 2W40A 1KQ8A 4MO4A 5FLXO 1EA3A 1BW5A 2G8KA 3QIOA 4W5RA 1PYVA 3DEUA 2LOOA 2BE5F 3JRCA 2HXOA 4B1RA 4LF4K 4N76A 3RPQA 4BC4A 4OKEA 1X3NA 3HOXJ 2Z1IA 2NRRA 4UUSB 1JT0A 4F7ZA 2VG5A 4XN3A 3TOAA 5FPDA 3BR6A 4F3TA 2KMUA 2H27A 1TZLA 3FFIA 3WTWC 4HSRA 5J2NA 3E1SA 2XB0X 3HB9A 3OR1C 2I5JA 1G59A 3GTKJ 5AQSA 5KQDA 3I71A 3FE1A 1M1KO 1X19A 2ITGA 2A5WA 2XY8A 3H08A 1QSYA 4AH9A 4XOTA 3FIWA 3KEQA 4B44A 2EZHA 3VTIA 5HS9A 2IVNA 3V9SA 3I4PA 4YIIA 1R00A 3U9ZA 3KE2A 4XSXF 3SEZA 1KC8O 3DLGA 4DU4A 2IAIA 4IBNA 4OPHA 1BOAA 2DLLA 2EFOA 2M7AA 3CP2A 5JLXA 3V8JA 3ZOBA 3D5SC 2CV1A 3W2WA 1J59A 1O57A 3VB2A 4S0HB 3PSIA 3F73A 1L5UA 1PUFB 3TABA 5JLFA 5HODA 1RGIA 5M1FA 5AIPA 1A5VA 1NMNA 1RETA 2VC0A 3VQ8A 1FKPA 3TAEA 3L6QA 3HPOA 1VFCA 1FJLA 1TQMA 1J09A 1OISA 3BROA 3CJTB 3SJMA 1U78A 3VTHA 2WWYA 4GDFA 3THVA 5J8FA 3CPEA 4M3EA 1U2VA 1VTNC 5C44J 2PMUA 3EUHA 2VOOA 3FBNB 3HBTA 4UHTA 3O1WA 4E3SA 3MEXA 3E97A 3LDLA 2XF7A 3P9IA 2CJJA 2RVCA 5L3CA 1UHMA 3DEEA 3HYIA 1K4SA 5AIQA 1JLAA 1Q82O 1N6QA 2V79A 1T98A 2J5OA 4CYCA 4A0XA 5J1UA 5FKKA 2D2WA 2DMPA 4NCAA 4DV7K 3AVNA 4BYYA 1Y97A 5FD5A 5GP9A 1ESVA 5FRMA 4PJMA 2JWLA 2A6TA 1KU9A 1MKMA 4LK1F 3O8GA 3WTTC 1XSXA 3H5AA 2FJ1A 1SZ2A 4HTUA 3CCJI 3O80A 3AO4A 2HYGD 4K43A 1Z3XA 1OH5A 5BPMA 1IV8A 5DCFA 4CCOA 2P5LC 3RZDJ 4EFHA 3J81O 4GGGA 1E3MA 2KZMA 2V9KA 3F22A 1IG8A 2B9SA 1W0HA 4YELA 2HHQA 3QEPA 2M7BA 4IG3A 2GWRA 3HL8A 4MQ3A 1R0AA 4B9NA 1ZYRF 1X1CA 3UR3C 4LOCA 3RTRA 1LPQA 1SD5A 3ZSYA 3HRUA 1WHUA 4YNQA 1U9NA 3VQEA 2F8TA 2XIGA 3BZ6A 4ID1A 2ZJQL 2V7YA 3DPUA 3O9RA 3QINA 3HGGA 4CCNA 4BACA 1D5AA 5SWMA 1EX4A 3QP5A 1IG7A 2UXXA 1MA9B 3WXIA 4OPKA 1MMGA 3PNTA 4BEHB 3J80K 1VQ6N 2PMZA 5CQEA 1S6QA 2FBHA 1VQMN 2QK9A 4KHSA 2E2PA 2DJIA 3TEDA 4QLCU 4L3QA 4PQUA 2HPIA 4FLVA 1VQNI 1U8BA 2KL4A 1ETVA 4FJ5A 3WGGA 5GAHP 4IOCF 5AQXA 3BR2A 1G6NA 3BG3A 4H4KC 3OS0A 1DKGD 3LWMA 4KB1A 2V1DA 2VCPA 2L01A 2Y69H 3OMYA 5F08A 1QQOA 2O4IA 3DLAA 3G1MA 3OOPA 3TL4X 1S3JA 4G7HF 1BI3A 2FNPA 3VOEA 2V1UA 3AO5A 3H5NA 3F5TA 2E2NA 5DEQA 2OBPA 3K10A 4EZ9A 1RFQA 5H6RA 4JI5K 2QEXN 1W4MA 5BN9A 1TKXA 2P9LB 3C2HA 4X62K 1KQ0A 3K0SA 1D9FA 5H6QA 4W1UA 2KHOA 3BP8A 5AR0A 2X1CA 3GTGJ 4CZHA 2QCOA 4JBAA 3WTUC 2QQ9A 4XKCA 3KZYA 3ERMA 4E7LA 4CCKA 3BQZA 1S9GA 1KGSA 2IAJA 3D2FA 3KPHA 1HW1A 2LRDA 5CVUA 1SC7A 1V4RA 1G3YA 3O5BA 4IO9L 4CYCB 2OQGA 4N4OB 4UXNA 3H3ZA 3IAM2 4I0BA 1ACIA 1KXPA 1U9OA 5LFAA 1MWKA 3IH4A 3T3FA 4EJVA 5AQUA 2AXTC 4XIUA 2UXBK 1TK0A 2F6CA 2DPNA 1NG6A 2FD5A 2H6CA 3LDQA 3NVKA 5CYQA 3CCSN 5D5WB 2STWA 4ESJA 3HTVA 2HFHA 2J5PA 3BY6A 1RT6A 3S2DJ 3DYAA 3MEGA 2GWJA 2Z1HA 2NRXA 2G8IA 5IWAK 2KFZA 1QZEA 3QP6A 3ZR8X 3GFMA 2CQXA 4C2MJ 4OKJA 2Y9YA 2DODA 3ZT1A 2V51B 4AM7A 3CUQC 2Z1JA 2DOAA 3TOBA 4FLUA 4LD5A 4B1UB 1T03A 4MO7A 3VEPA 3SQ0A 4UUSA 1S8NA 5LD2C 4FQGA 5E1ZB 5IT3A 4HCCA 1UA0A 4A59A 1GLLO 4MNUA 3SYTA 3IRRA 3ID8A 3JYTA 3K57A 5HS8A 1QTMA 4BNCA 2EV5A 3QYFA 4CHZA 3CCMN 3DXKA 4W5NA 2L3DA 4O5BA 2ZMEB 1A6IA 2COMA 4Z4HA 3HP6A 2F5EA 2K9SA 2AHQA 1DT9A 3QEIA 4P96A 1SVLA 5C3EJ 2Q2EA 3VEVA 2F7TA 3SUNA 1NJIO 3CESA 4FM2A 1NWKA 2KIQA 3RRGA 3SV3A 1I6XA 3JR9A 3L2QA 4YFKF 5KGXA 4NNJA 4YOVA 1NNEA 2E71A 1UZCA 3CCLI 1HKQA 4XORA 2WAQN 3A03A 3ONQA 1QRYA 5AQZA 2FEZA 4OMZA 4UUTA 2X6SA 2G9WA 4CEFA 5ILUA 1LWEA 3VN5A 3CQXA 3ZSVA 4O0IA 3H1VX 1FK9A 2BANA 4C8NA 3BR5A 1Z7LA 4U7BA 2HYFA 2R5ZB 4BXUA 2FSJA 2QXLA 3VEWA 4PSWA 5EF6A 5LHIA 3M3ZA 4Y13A 3RDIA 2PJRA 2DY4A 1XGNA 4H0EA 1ZYQA 1TNSA 3RKXA 3VQDA 3ZSRA 1NK0A 3HSCA 2V9VA 1JJ2M 2OYQA 1FBUA 1AU7A 1RIOH 1DGWY 2E35A 2LSNA 4CF9A 3NH0A 4I01A 1NM1A 2DYSH 4MFDA 3M1EA 5E1WA 1YHQI 3G6EN 2L2OA 2VN2A 3CCQN 1FBSA 2OJED 1WWXA 3ZT4A 2IT0A 1X1PA 3CM6A 5CJ9A 4AVZA 1ZBIA 1X3WB 3FZKA 1YS6A 1HA8A 3B6OA 1J5EK 1RTJA 2FBXA 1ZHFA 5F27A 3V7CA 3FM5A 2K9LA 1KA8A 2R4GA 2VASA 4F93B 3P39A 3D5RC 2UU9K 3EUHC 2CYYA 3AAPA 4CXFA 5HROA 4RGUA 1MDMA 1Z1DA 3D6RA 4BRIA 1RUOA 4ZH4F 3K9JA 5HL7L 1NKBA 2DT7B 4LF8K 1WSFA 3HTSB 2G8VA 1V4SA 1IAWA 4BRDA 2QYOA 4DGWB 1EKEA 3IKTA 4K25A 4C3JJ 3S1QJ 3CD6N 2F5VA 1HPMA 3DPTA 3PFIA 1BWFO 4KH6A 3HRSA 2F5FA 2HSTA 2N8GA 1JLBA 1QHAA 1R6RA 1ZR4A 1O3RA 3IWFA 2WBNA 4O0JA 1R71A 4LB5A 1JCGA 3JS6A 2JSPA 3S2WA 1I50J 1JTXA 2R7RA 3Q5FA 1C0MA 3I8BA 1IO2A 3H6EA 2XRIA 2HOTA 1KYZA 2OCEA 5JVGF 2BGCA 4A5AA 1I3AA 1TVRA 5E3LA 3NE6A 3BT9A 4LMYA 3WTVC 4B09A 2GXAA 1VQ6I 1W0TA 1FSHA 1BJZA 5ERIA 1FP2A 2YU3A 1YJ9I 3TW7A 3TAFA 4B3TK 2P81A 5L3DA 1I5ZA 5IPAA 3FX3A 3ZMSA 1Y0NA 3THYA 3MDQA 1BL0A 3PIOL 3WTZA 2EZIA 3LSGA 3GEZA 3WG9A 2A61A 3LAMA 1ETKA 3BR0A 3RPUA 4CZEA 5KQ8A 2VONA 1NGGA 1N34K 1VQ7N 3HYFA 1ZELA 4MO5A 4OO1J 2Y1IA 1RBTA 3NMUA 4HRIA 4DQRA 4QS7A 2ZB9A 1WAFA 4O8KA 3K2AA 3DKYA 4JI6K 3OOUA 3QB0A 3E66A 4ZYEA 3CPWM 3QRFF 5I9EB 3LPUA 1G3TA 2JA6J 5TKWA 3N4PA 4ILGB 1QQMA 3H35A 4N41A 4FWSA 4CHYA 2VGMA 1B72B 4FJMA 4HNTA 4CZGA 1KZHA 4Y1DA 3E5XA 4C8OA 3THXA 2X4HA 3D5LA 3QAHA 1OMIA 3IV5A 3GVAA 1KU7A 1VQ4I 4KMFA 1VSDA 3VQBA 1RZ4A 4B43A 1BW6A 4XRMA 3MMVA 3MXJA 1OKRA 4N56A 3SYZA 3JCUC 3I8DA 2HS5A 3QYBA 1FX7A 2IGOA 1N33K 4FVMA 1ERDA 3H1CA 2QLZA 3LPTA 4JOMA 3VQ5A 5FRNA 4XH4A 2MABA 2EIJH 3OBYA 2Z2SB 2L7KA 4M3DA 3J7ZI 2ZJPF 3NF7A 4G8XA 4TSXA 3P1GA 3HZ6A 3THYB 1YX3A 1OFCX 3UKUA 3A02A 3U6FA 3GTQJ 3LDNA 2RHKA 1HW2A 2UXCK 2DK8A 4KIBA 3G3ZA 3DRRA 1Q7YO 1VSHA 3I4MJ 3VMFB 2D1KA 1FOXA 1ATRA 1OH6A 3PNVA 1L3TA 3KFWX 2O03A 4U7DA 4HX8A 1E0EA 1LW2A 3SZ2A 3FZLA 3E9PA 5AQMA 1WSHA 5CPRB 5K7HA 1K4TA 2ASMA 1VI0A 2B4JA 1EH6A 5AQLA 3NQOA 5J3LA 4M6XA 2NLXA 2DT6A 1RBRA 5FPNA 4CECA 3E3VA 3K4LA 3NARA 5LEJA 5EYRA 1OKJA 4CGFA 3M8SA 4KHYA 2WY8Q 1ZRCA 2VPRA 2XHBA 1L3VA 1PP7U 1D1BA 3LZIA 3DOLA 5TKYA 3SQ4A 2Q8KA 1EH8A 4O8UA 1WQ2A 2K85A 1SUQA 4DUZK 1T6SA 1ONVA 2CO5A 4QCLA 3OA9A 1RTHA 4CZZA 1GLCG 2AXLA 2PYJA 2GIZA 1XX5A 3RMBA 2L9VA 2PFUA 2VBXA 3BPXA 3WTSC 3K2ZA 3HOZJ 2Q2RA 3KK3A 4M9SA 4CF1A 4W97A 3H3NO 2W1OA 2Y0SN 3I54A 1WJBA 4E70A 1GLDG 3ECHA 2X1EA 5FROA 3MN2A 3K59A 4JV5K 5FKOA 2Q31A 3K5OA 1LWCA 5CVRA 5JVTA 4BRNA 3AVCA 1JLQA 3BR3A 3TAGA 2QTDA 1FKOA 1XN7A 2Y31A 1W9HA 4CD1A 4ELUA 1U0JA 4GY2B 5AQQA 4CJTA 5DS9A 3HG9A 2DTRA 2K86A 2YNFA 3KP7A 1G15A 2QXFA 5IP9J 2DFFA 2XAJA 1VRTA 4Y33A 2Y75A 5HLHA 3KWIA 4O44A 4BJ5C 4HVJA 4DU3A 1TAUA 4YOWA 4PL7A 3RTVA 1U3EM 1Y6IA 2NOJB 1FWZA 2IA0A 2RC4A 2OTLI 4IHWA 4BEHA 3VERA 2JGUA 3RPUD 1RDWX 4RMNA 3C95A 3R3LA 1YVNA 3J81K 4PJ0C 5E1XA 4I02A 4A5MA 5A2QK 1T39A 2FSKA 5IT9O 1LVAA 5DM6L 4BRCA 4ESBA 2ID6A 3WUHA 5I42A 4IQJA 2K9NA 5LRRA 2HXIA 1RDAA 3AGRA 4KH5A 2R7SA 4LF5K 2E6LA 3KK7A 3O9SA 3HKZN 3RMCA 3O9QA 5AQWA 1S72N 2K7LA 1H0MA 3Q3SA 1T8EA 1QO0D 3L3VA 5CYVA 4JYKA 5AQGA 3AO1A 1YT3A 4D7NA 3C0BA 3HPHA 2GXGA 4PDKA 1YLFA 2O8DB 2P9NB 2A05A 3E6CC 5J40A 5C24A 3BG6A 3GX4X 1XHZA 1DQUA 3JREA 4IF4A 3SBGA 4CIFA 1O3QA 1IKXA 1Z25A 2VGNA 1WSGA 5B5EC 3PY8A 2P5GA 3MAQA 4BY9C 4L8RB 3NF8A 3WXMB 4OOIA 5BQTA 2IS6A 3ZX3A 3PO2J 4DQIA 1N77A 1YJWN 1JL1A 4ZHRA 1IDYA 2VQFK 3ZQ7A 3B73A 4ZYDA 2P9KA 3U3GA 1QGPA 1PJRA 4B3XA 4A0YA 2R7UA 1K8AO 3EE9A 3CXCM 1ATNA 1JGSA 2FA5A 4CGIA 3OYKA 2QI2A 1WH5A 4LK0F 1D8KA 4ZDPA 3BDDA 4RGXA 3CCYA 3LSJA 2CUJA 1W0UA 5C0YA 2V6EA 2DMTA 4DW6A 3DRSA 5BRHA 4YOTA 1BR1A 4F92B 1I1GA 3KP4A 1HJRA 3A0BC 1E4GT 1USSA 4OPAA 4FVUA 4IXCA 1XGOA 2R3SA 1VQKI 3QEXA 2E2OA 3SMPA 4BRHA 1VQON 3T69A 5HDGA 4G6QA 2KHMA 3T1BA 1C0UA 5GAEP 5C42A 1QBJA 5IP6A 3L2UA 4Q5VA 3U9GA 4LF7K 2FBTA 1AA7A 2X9DA 1S6PA 4O4GA 1BA1A 3ERED 4HUGA 3SJHA 4CJLA 2G8HA 1JLGA 2K4JA 4AHSA 4G94A 5ADXH 4UY8O 3IUOA 2Y2ZA 3B6AA 1LWFA 2P9SA 1ETQA 3VOVA 4BREA 4PJNA 4U67L 1C1CA 5B66C 4F52A 1MH4A 1JJ6C 4Y4RA 1IW7F 2H3GX 4PWDA 2FNAA 2LSOA 5GAEJ 4O55A 1U47A 2G8UA 3ABKH 4BJTA 1H8AC 4IOXA 5AQJA 3RRHA 5JHFA 1AWCA 3LALA 3LSRA 1TLHB 2MD5A 3LSTA 2EFQA 3GMEA 4NC6A 4EATA 1VSJA 2XRNA 4H0OA 3OSGA 2H94A 4UVAA 3KLNA 2KZVA 2HQNA 3QERA 3KLOA 2I7PA 3CO7C 4M74A 3HOUJ 1S9EA 3SZTA 3CC2N 4M71A 1HC8A 4B3SK 1NK5A 1WBBA 3TANA 1P4XA 1SD4A 3HL2A 3WQTA 3K7AJ 3GTLJ 5AJ3K 1HR0K 2Z16A 4KN7X 2KQ2A 2GOXB 2R7WA 3PFYA 1MDUB 1S1XA 2IS4A 4XKBA 4EQQA 1BI4A 4BH9A 1WAJA 3S8PA 5HRRA 3CMMA 2ASOA 1ZN2A 1C1AA 3K5LA 3F6VA 3TDZC 3CJNA 1N78A 4YORA 4B8AB 1XCBA 1S22A 3VQ4A 2O8EA 1NGBA 3QPLA 1OYIA 2HWVA 1E17A 3W2VA 1SVOA 4FK4A 3BZCA 3K4NA 1EWRA 4EHUA 4YOXA 3BCBA 1IGNA 1HYSA 4MEYF 4B4CA 1U2VB 1ZBUA 2VC1A 3U9DA 4FZZA 3WNGA 4HZFA 4CCMA 2D0BA 4GVEA 2XPVA 5CZ2A 1LQ1A 2DA2A 2JK3A 2K40A 1H9TA 1BA5A 4AIDA 1VQLI 1TV6A 5ELZA 4KJZA 4XLPF 4BQOA 1LEAA 2M4GA 2ZSHB 5ICFA 2K3FA 5J1YA 3CCQI 1GOBA 3SAFA 3KLGA 4BR2A 3CUQA 2M5WA 4FLYA 3K4MA 4QIWN 1JL2A 4XK4A 2DA1A 1YITI 3B6CA 3HXLA 1C1BA 1N75A 2VJ4A 3GZ6A 3ENBA 3RJPA 1R7JA 1K61A 3KLIA 3ELKA 2R92J 2NNWA 1GXQA 4IO8A 3PIPF 2DYRH 3V42A 2D0PA 4FWLA 2COBA 3A5OC 4OKKA 4B1ZA 5FPEA 2XY6A 3DXMA 3UKRA 1O4XA 2B6AA 4ZZLA 2Q1ZB 3H3OB 1BR4A 2QM3A 3HBLA 2R7QA 2BOLA 5C2DA 3PO4A 4Z4FA 2KIUA 4IOAL 3VEXA 1Y56A 3Q0VA 3AA2A 1NK4A 1C0TA 2DO7A 4MTEA 4B08A 1H9GA 1IRZA 1HNZK 5CKTA 3ISNC 4XSZF 4KDPA 5LY3A 2EV6A 3V9WA 3MAJA 1FC3A 5KPRA 1XMQK 2FBYA 4EAHD 3PLAA 3DXMB 3UKRB 2A07F 4A2AA 2QW9A 2CSOA 2VBZA 3DBLB 4LFUA 1R4NB 4DTNA 1ZRDA 3RSEB 3TSQA 3VEYA 3GLXA 2R0QC 3L2VA 2ZJRF 4IKFA 3K6GA 2Q3SA 4K42A 1WI3A 2UUAK 2NRZA 5B1AH 3PIOF 2CFXA 4ISEA 4J00A 3LP0A 2LVSA 4C23A 2R5ZA 4DUYK 2ACJA 3W3CA 1A31A 3QPTA 4DTOA 1YJWI 1B72A 3SEQA 5BRDA 3GFIA 1XCVA 2XPWA 4ISGA 3TSPA 3ATUA 4BQZA 3DBRB 1S7OA 2LFBA 2HNHA 3HIFA 4RLFA 1VHXA 1FJGK 3P9CA 4L9TA 1WUAA 4FLXA 3V9ZA 4M3YA 3K4KA 3O08A 3T8RA 4YFXF 1T6CA 4B1XB 4UVBA 4BKXA 4U0WA 2LLKA 5FFZA 1RPWA 3ZP5A 4ILHA 3M8FA 5FKLA 2O8DA 1SMTA 3TO6A 4FW1A 4EHTA 2ZQBA 3CUOA 1HMVA 3MQ0A 2DTUA 1HX1A 2ZKZA 5DCMA 3FFKB 1UHWA 2E2QA 4FT8A 2R7YA 2VXDA 1TYQA 1FEXA 2UZKA 3G73A 5AQTA 1F1ZA 5FLXK 4LSNA 1BI4B 1ETYA 2KRHA 2F4VK 2OU2A 2F5DA 3PJRA 5LL6Z 2V6CA 3TAPA 1MMDA 2R93J 3ZETB 4PSXA 2P0WA 2RQPA 1CQTA 3IFRA 5F1XA 4JI8K 3G4SI 2QA4I 1BISA 2HVQA 5BOXA 3U21A 5JS1A 3H1QA 5IYCJ 3ZRGA 5KGWA 2P7CB 3OYDA 3IS9A 2GUPA 4CK2A 4DU1A 1JHHA 3LA2A 3O6WA 3EYIA 1TW2A 2KFDA 4CO8A 4XR6A 4XM3A 3EY1A 1K6YA 4M6YA 2RNGA 4NXNK 2HVIA 1TKZA 1S1TA 3QU3A 2LDUA 2VL8A 3HTUA 3HM8A 1B9FA 1TNTA 2LKXA 3A0IX 2QWLA 3DLEA 4X64K 3SQNA 4YG2F 5GPCA 5JVGL 4UB6C 1U6GA 2DDBA 3LQRA 2CW8A 5J2MA 4QOZB 4R5PA 1IN4A 4HNVA 2MD0A 4RGSA 5KVRA 1OVYA 1Z21A 1WSJA 1XS9A 1LKXA 2JRMA 3DKXA 3AO3A 4Z4CA 4MDBA 5HRPA 4RBOA 4EJWA 1HOMA 3CCRN 1MBJA 2BY3A 3DFGA 2Q97A 3ZT2A 2ICWG 5JI6A 2PN6A 1H89C 1TL8A 1QE1A 2IVMA 5CLSA 3I5UA 5CR4A 3Q0WA 4C3HJ 5GAGJ 3TI0A 3AVIA 1B8IA 2H8RA 2D5VA 4JI7K 2ZJRL 3NGIA 4C2UA 4MFBA 1SKRA 1X1BA 4ZJZA 3WXJA 3ZQHA 5GINA 2CUFA 1TWGJ 3LL3A 2G7UA 1F5TA 4KIGA 5EY4A 3SK3A 2LD5A 1JKQC 3OYLA 4BBRJ 4DZPA 1WOQA 4CHQA 3SZPA 3BEXA 1JKPC 5T7BA 2LKPA 2VKEA 4TV7A 3I58A 5DDGA 1NH3A 3CC7I 5FD6A 3P31A 1T56A 3OWTA 4XQFA 1MMAA 4H0VB 1R4MB 2TDXA 3PX4A 1R1TA 3HZJA 3KP2A 4Q48A 1VK0A 1S5JA 3HOWJ 3WE3A 5E84A 2LY9A 2DN0A 4I0AA 3AA3A 2PG4A 4MQVA 3S93A 4BBSJ 3FZFA 3AGKA 1VQPN 1RCHA 3NVMA 1FT9A 5CZ1A 4BR0A 2A41A 2EIKH 3ZQLA 3SJJA 1S1VA 2Z9OA 1VQOI 3JRIA 2E5ZA 2A42A 3B6PA 1WPKA 1KQ9A 1S5LC 2DA5A 2QWWA 1C0WA 4A3FJ 2CGKA 3IHUA 2IGMA 3EKSA 4AYBA 3CC4N 1VQKN 1W7PB 4UUVA 3AAQA 3ULEA 3CMEN 2AO9A 3ZQGA 2HNZA 2RDPA 1KVAA 3OYEA 4F4KA 4FM1A 1VSFA 2ZBKA 5E8GA 4WE1A 4LF6K 1FTTA 4CBUA 2GELA 3BOQA 3WG7H 4FCYA 2GAUA 1DDNA 1KTQA 4HDVA 1YRNB 2ZNZA 3ZLJA 1FMWA 1T44A 4NB4A 5LJWA 4UVCA 2VXZA 1NK2P 4RG8A 1LUJB 2X6XA 3MXMA 1MW7A 4O6JA 3TMOA 1T0FA 5HNFA 3DU6A 4K2EA 4DMNA 3GZ5A 2MLKA 3TAQA 4DSKA 3CF5L 3ECOA 1Z7UA 1YJNN 3Q9VA 4D9JA 1EQYA 2YJFA 3C94A 4OINF 3CCJN 3V8KA 1OH7A 5BS6A 1YW9A 2HU9A 4RLQA 3PO3J 3S16J 2NZTA 2IA1A 4FTHA 4OAZA 2UUZA 3AL0B 1ASVA 4I2QA 3JTGA 3IRQA 2ZE2A 3ZQCA 1HW5A 3O4WA 4E7KA 4BRKA 1V4TA 1YG2A 1HKCA 4H5VA 4FWNA 1V5EA 1Y1WJ 2A3ZA 1NBWA 3CJQB 5BRFA 2X1DA 1FSEA 4XKVA 4L5IA 4HLYA 2ELHA 1MWMA 2CGJA 3GOIA 5GADP 1Z26A 5F1JA 3V4GA 1ZG1A 3T19A 4HBLA 5DM7F 1HXDA 2I8DA 3I59A 3QU6A 3NRVA 2R5YA 1HPZA 3NF9A 4FO0A 4ELTA 4OLAA 3MKYB 4FWQA 5AZIB 4B9LA 2O8FA 1CXQA 4XRSA 2RAEA 1TWAJ 2XASA 3V4IA 3I64A 3OSFA 4KYWA 3GTPJ 4IZ9A 1D0YA 4NUBA 3CP8A 4O3MA 4X1EA 3S2HJ 1Z67A 1GOCA 1W5TA 4KUMA 1I6HJ 1TL1A 4WFNL 3UIQA 4Z4GA 1X9JA 2EZLA 4DZJA 1J9IA 2OUMA 2MSYA 4XIDA 4M7YA 4BL0B 1U5TC 4YEJA 2IXSA 3IUCA 2M4KA 4FISA 4G6TB 3ZSXA 3O3FA 4FW2A 4A3MJ 4BG9A 3HSEA 3ZSWA 4IX7A 4IHTA 2FU4A 1NU0A 3IKMA 4OX9K 5HLIA 1ZR2A 5D5VB 4JKGB 4I98B 1K6OA 4CK1A 3NWTA 3DWLE 4CJQA 3CQ8A 3HRMA 2D1VA 4BQQA 2W82A 1I27A 1QVTA 5JICA 4ON0A 3BTIA 3ZCMA 1D5YA 2E2IJ 3DP7A 2CH0A 5IYBJ 1BUPA 3DTKA 1SFUA 2CW0F 1X2NA 1UJ8A 2GX9A 3OW2M 4DQQA 5HRNA 1HNXK 4M3UA 4DTJA 3OIQA 4KB0A 1NGJA 3KEOA 2QQAA 4AILC 3D2EA 3TQNA 1SS6A 1YVUA 1A04A 5DD4A 2E20A 2WAFA 1ZXOA 5HVQC 5H1SQ 1S3XA 1K83J 3AG3H 2JA8J 2O61A 2P9IA 4CW7B 1WZ2A 3J80O 4GYGA 3F9KA 4DWIA 1Q1VA 5HBMA 4UY8I 3L1PA 4KREA 3AG4H 2P9PA 5GPAA 2XDVA 3P38A 4CFCA 3HC7A 4HW0A 3DLHA 1IUYA 4A61A 1RDCA 4BWJA 1YIOA 1HDPA 2LYCA 4DTSA 2GXBA 3QOEA 4JX6A 3OYAA 3D45A 3HOVJ 2PZSA 4M3ZA 3LNQA 3ENOA 1WSUA 1BG3A 3EETA 1XHXA 3QQAA 3DRPA 2NS7A 4XH5A 1RT4A 1W2BM 3MCZA 4HV6A 1VQ8N 3CD6I 4B9QA 3SUOA 2ZFWA 3LFUA 4LG3A 2VQEK 2V7FA 1GV5A 5AQFA 1JCFA 2LF7A 2EILH 2YHAA 3RMDA 2A6AA 3JAMK 3VQ9A 4CIGA 2FQ3A 2R7TA 3CG7A 1P9QC 1D0XA 2P9NA 1STZA 2HBMA 4DTUA 3WODF 5K7FA 2ELJA 2HNYA 3V9UA 1K8KA 5FO5A 1BIBA 3BC8A 4WQ4C 1QVFM 4DS5A 3BTLA 4KAZA 1Z3YA 2OF7A 4BGDA 3ZMVA 1MJ9A 1OLTA 5L3FA 2IRFG 2EFPA 2ZWHA 5EU7A 4M3XA 2VKVA 4F2SA 1ODDA 2K4BA 1PVEA 1FYLA 2RE2A 2HF4A 4Y1CA 4Y3OA 1NLVA 2FUG2 1BN5A 4B1YB 3HI0A 4BXFA 3COAC 4U0YA 3AVKA 1RNHA 3LM9A 2HYJA 3JRBA 1VQ7I 1JXEA 3WNEA 4AF1A 4RW4A 1NJZA 4FJ9A 2JN6A 4JN4A 1TQIA 2UUCK 4DR6K 2VKHA 3S41A 3AVHA 5AZJA 4DS4A 1X3ZB 4IEJA 4RB0A 3V6DA 4FE7A 4DSIA 4J2AA 2IVOA 5E3NA 2P9UA 1ETOA 1RBVA 1MSEC 2EIMH 4JLHA 4RAYA 3VYTB 1ZC6A 1W36D 3NH1A 4DV4K 2LMDA 1RDBA 1QVGM 1XMKA 4ABZA 1U6ZA 2OPPA 4HWIA 1HKTA 2E1OA 3PIPL 2L9RA 2XAUA 2XC7A 1DEJA 4PZJA 2Y1JA 4PJJA 1D8JA 1KLMA 3O4NA 1JXSA 1IRFA 2RREA 3H9JA 2GBYA 4ASNA 4A62A 2HHWA 3ZX0A 3GF2A 1KAZA 3MCPA 1O3TA 5AQHA 2BBYA 2O3FA 2ZF5O 4AYBN 1QSLA 1TWFJ 3RYPA 4AHRA 4FASD 3G4SN 1RT1A 3T1AA 2DXIA 2P9KB 3E9LA 3CF2A 1BOBA 1SEUA 1OR7A 1IUFA 4JKCA 1I94K 4FJKA 4WF9L 3TARA 4CJWA 3L3UA 3LANA 3CCRI 2GM4A 4MLHA 1TT0A 2NNYA 4HV5A 4AWXB 1HJOA 5AZIA 4YY3K 3FXRA 4GV6A 4Y0WA 2EK5A 4KPYA 2BEOA 3K4CA 2P9LA 3OJUA 1S1UA 2BYVE 4AVPA 1ZLJA 4R79A 4H0TB 1DP7P 1T6DA 2ZFUA 4XH1A 3TDUC 1W1WE 3P7NA 5DYMA 2BY1A 4C2TA 4CFBA 3RR7A 4IPAA 4E6KG 1RDUA 5HDNA 2F2EA 4ZDOA 3MX2A 1T7PA 2XV4S 3K9TA 2LBFB 4BC5A 4ETSA 2R7VA 3M8RA 4BDZA 1N36K 2TRTA 3NHGA 3DBHB 2YKNA 2Q1NA 3AVGA 3C7NA 3FDYA 1KFDA 3CCEN 4HQEA 3ULEB 4GKKK 5LGTA 4F3OA 4AIHA 3S3OA 1YO5C 1YJ9N 3ITHA 2E7WA 3O4QA 5DD8A 2YNGA 4RTFD 4B3AA 2QWNA 3JRDA 2DFIA 4PL8A 3UB5A 4DCHA 3W0LA 1JJ8C 2VT3A 4OIOF 2WFBA 1JT6A 3LWFA 4A3EJ 4H0XB 4M7XA 3CCUI 1D1CA 2PFBA 3AL0C 3CC7N 3FXUA 3CMEI 4FJHA 3A01B 4JI4K 3SV4A 1NJXA 3CC4I 3KLFA 4V2FA 2NRTA 4FZXC 4CZKA 1Y8RB 2A5YB 3R61A 1FYKA 1YW8A 2GWKA 4FWMA 1DUXC 4IDHA 4PA1A 4R8HA 1RNLA 2X6NA 1JUMA 2RN7A 1RKWA 5EG0B 2E2HJ 1Q18A 1JKRC 2FLOA 4NBQA 3DAWA 3SNNA 3J7AP 3AFHA 4LH4A 4Y52J 1YTYA 4A2UA 1MGTA 5IYDJ 2ZJ2A 4BRFA 2ISZA 2MG4A 5HS7A 3RIRA 2IS2A 1Q86O 2XAQA 1YJNI 2EX3A 5DTDA 3W6JB 4I6MB 3EZ5A 2V9PA 2BW3A 3F8BA 1IF1A 1N5YA 4CGHA 4OIQF 3CO6C 2P4WA 2WY7Q 3E9OA 3HVTA 3CDLA 4H5WA 3T5XA 4QS9A 4OJRA 5JS2A 3SQ1A 1B9DA 1XSVA 1X58A 3WNFA 4FWRA 3ABUA 2H8WA 2DW4A 1U5TB 3S1NJ 5C25A 2OC6A 3DJCA 4X66K 1U4BA 1SD7A 2JTVA 4BJ6C 1LDJA 3C6AA 2PI0A 5IT9Z 1DPUA 4DNCA 5AZJB 5F64A 3P4IA 3U8XA 3Q7CA 1LE8B 4B48A 4A12A 1FZPB 3HJEA 1E3OC 2QUFA 2HVRA 2BHYA 1O1WA 3WT0A 4CE9A 4FL9A 2HDWA 3EPZA 5FFXA 3FZVA 4XN0A 2X51A 1XUPO 5FLXZ 4RW7A 3B02A 2MW8A 3VYRB 1F9NA 3CIPA 2L7MP 2EINH 5EX5A 3ALYA 3MZYA 3RKWA 2ZXJA 3JAMZ 5EG0A 2A6HF 3KP3A 3HDDA 4A3BJ 1XB4A 2WTEA 1KU3A 5IY5H 1E2XA 1FOKA 1P90A 3TAMA 1IXSB 1SAXA 4E1JA 1WJ5A 3AVLA 3GW2A 1I3QJ 2HR3A 3RZOJ 2LF8A 2V52B 4JK8A 5B8HA 2HEOA 4IDKA 4F8RA 1N8RO 4G7ZF 1WN7A 2ATQA 3GCMA 4YIFA 4LD0A 2VBWA 5FKMA 3IG1A 2VQCA 2JUCA 2DMUA 2P6SA 1BQNA 5K14A 5GTHC 4GFBA 2R7ZJ 3S17J 3CQYA 3QLHA 3BJOA 1V3FA 3ZETA 3QBWA 2QVOA 4FLWA 1GLAG 4JK7A 1R5ID 4BRAA 4CYDA 2O9LA 1CZ9A 3AVAA 3KLHA 2G8WA 2HBKA 4I6MA 1D5VA 3HRGA 4BR4A 2MC3A 3WEEB 2ECCA 2WB1A 5BPDA 3SI6A 3J8AA 3BF1A 4GRIA 4FJ7A 4FOEA 1IDZA 3DI6A 3SAGA 2VQHA 5DCMB 2DPDA 2JA2A 4BQLA 4KT6A 4LIUA 1WGXA 4U87A 4XL9A 3L0QA 3LZJA 3CM5A 3UKGA 3J7YP 5HLGA 1RILA 2OPRA 1WKMA 3LDPA 3TTDA 3U4LA 1DLOA 1ETWA 4BHBA 3WGIA 3HSFA 4H03B 4Q47A 3DTEA 1FW6A 3PUBA 1Y0UA 2Q0OA 2QSFX 4IO9F 2QKLB 4D7MA 5IP7J 1EP4A 1OCTC 2OTLN 5E18F 2K9MA 1LB2A 2Q0UA 3CETA 5LLQA 4IQ4A 1LEBA 5KPZA 5GIOA 3WHCA 1NJYA 2O8KA 1LFUP 4CGZA 4DQSA 2YUSA 3H5RA 4BRQA 3G2BA 2H6BA 3SFZA 4JHDB 3W2AA 4FETA 1GT0C 5GADJ 3PO5A 2MH2A 1FLIA 3ID6A 1X4OA 3N05A 3QESA 3QETA 5E20A 4LC9B 3C1DA 1NGFA 4WXCA 1JCEA 1XTAA 3K9KA 4AHCA 2KJBA 3HUGA 3REOA 5HOOA 5DK5A 2L7FP 2ECBA 2JT1A 1SAUA 2M30A 4JX5A 2ZC2A 3C2BA 1R22A 3MWPA
chains in the Genus database with same CATH topology
3EUKL 4E0DA 3ZSQA 3O3HA 3NWSA 4IG0A 1ZBFA 2LY1A 3SUQA 4IFVA 3VQAA 2OZSA 4B9VA 5KHDA 3H0DA 1KFSA 4KI4A 4FJJA 3IRXA 1SKSA 2IGIA 2UV1A 1DP3A 1HQUA 1YE9A 4NC8A 4DSFA 1D8YA 4PUSA 2XF5A 2W7NA 2P51A 4CCLA 1QHHD 2E60A 4P5OA 3VDXA 3OYGA 2XO7A 2BDPA 2Z1GA <