1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Integrase
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
1NKBA 1WJCA 3IAYA 4KPYA 1BL3A 3UIQA 4E19A 4CIFA 1VSDA 1SL2A 1YTAA 1UWBA 4FJNA 3F73A 3OYNA 1L3TA 2BE2A 4CJTA 4N56A 1FKOA 3C95A 3MAQA 3OY9A 2HNDA 1VSEA 4W5RA 2KQ2A 2RPIA 4HUFA 3AVAA 1NK7A 2I5JA 4ID5A 2PYJA 4QCLA 3K5NA 5C24A 4JS4A 1BQMA 1RNHA 4DFKA 1TKXA 1D9DA 4E7IA 4JS5A 3ZT2A 3THVA 4FZXC 1WLJA 4CFCA 3DYAA 3AVIA 4W5QA 4E7LA 1T8EA 2IAJA 3AVKA 4DSKA 1NOZA 1QQCA 3MEDA 1ASVA 3NF8A 4CGFA 3TWHA 2G8WA 4FJKA 3OYFA 3AA4A 3AO2A 3OJUA 3D45A 3MECA 3LP3A 3DRSA 1X1PA 1JXBA 4M41A 4K8ZA 2JGUA 4KRFA 4ELUA 1ITGA 4UQGA 1RT5A 3U3GA 3NH0A 5HRRA 4FCYA 2FBTA 1B9DA 2YHAA 1C0MA 4CJUA 5SWMA 2ITGA 4CJSA 1KTQA 2FC0A 3MXMA 4HUEA 5HRPA 3LANA 4DFPA 3TAPA 3DLGA 5CZ1A 1BQNA 2XY8A 4Z0UA 4DMNA 3PO5A 3LWLA 2WOMA 5HRNA 4E89A 3OYIA 4CJ4A 4KI4A 1ASWA 4FJ9A 2PYLA 4Y1CA 1EP4A 3AVLA 1X9SA 4CF9A 1VRUA 4J2BA 3I0SA 4DU4A 3I0RA 2A1RA 1QE1A 3VQAA 4O0IA 2HHVA 1KSPA 1CXQA 4KO0A 3RTVA 1ZBFA 2VG7A 2HNYA 4CGDA 3KLFA 3LPTA 3JSMA 1KFSA 1XHZA 4PA1A 1HQEA 4KKOA 1KLNA 1RTIA 3MEGA 1Q9XA 4NYNA 3ITHA 4CESA 4CJQA 4B9VA 2EHGA 2HHXA 4AHRA 5FDLA 4PWDA 3HVTA 4WE1A 3C6TA 2RN2A 3VQ9A 3S3MA 1IO2A 3G10A 3LPUA 4LD0A 4AHTA 3KLGA 4ZTJA 1S1VA 3VQ7A 3AVBA 2HVHA 4KTWA 4N47A 1HYZA 1WAFA 4B3OA 2OYQA 2RKIA 4CEDA 1IKXA 4CEEA 4CJVA 4OKJA 3A2FA 1D8YA 3P5JA 4DTRA 4DFMA 3ZCMA 3OYGA 3DM2A 4FJGA 1DLOA 4YFUA 3V9WA 4F3OA 3DI6A 5JS2A 2X78A 4FLXA 1S6PA 1R0AA 2A1SA 4JLHA 1IKVA 3P1GA 1CZ9A 3M8RA 2G8IA 2KFNA 4M42A 1VSFA 5HBMA 1TAQA 3ZT3A 4CERA 4CJWA 3CFPA 4E7JA 3AVMA 3NH2A 1TK5A 1W0HA 1TK0A 5J2MA 3DRRA 3U3YA 1SKRA 1YVUA 4I2PA 4CJRA 4XIUA 1EXQA 4FLUA 1U47A 4FYDA 3OYJA 1D9FA 2P5OA 2HW3A 3L2VA 4J2EA 4EP4A 4DS4A 4OKEA 4CFDA 3T3FA 4DTOA 5J2QA 2YNIA 1BIUA 4CHPA 4M3YA 2XHBA 3RRHA 3M8PA 3DLHA 4HUGA 3DLRA 3HP6A 4E7KA 3HJFA 2DY4A 3VA3A 2QXFA 3HL8A 3SQ0A 3KKRA 2IC3A 4IG3A 1U4BA 4DSIA 4E3SA 4CJLA 3L2WA 2P51A 2XRIA 3OS0A 4DTPA 1Q9YA 1BI4B 4KHSA 3AVCA 1RTJA 4B9TA 1FKPA 4DSJA 3QNNA 4CEAA 1IH7A 1WN7A 2GUIA 3CYMA 2R7YA 2YNGA 4CGIA 1BGXT 2IGIA 2G8KA 1I3AA 3SZ2A 4RW6A 1KVBA 3L2UA 1UA1A 1SL1A 3C94A 4OGCA 4AHSA 3SUOA 3RR8A 5CYMA 1HQUA 3SUNA 3KD5E 4CHOA 1HMVA 4ICLA 4FJ8A 3WNGA 2E6MA 4FM0A 4C8NA 3SQ2A 4FJMA 1C6VA 1TL1A 3K2PA 4B8CA 3HSTB 4I9QA 4J2DA 3O3HA 4KTZA 3PO4A 4J2AA 1REVA 3AVNA 3VQDA 3HPGA 1S1XA 4AHCA 4CEOA 4OPJA 4CCHA 1L3SA 4KHQA 3PX0A 1ZYQA 3M8QA 1S9GA 4CK3A 1J53A 3S3OA 3AVGA 4CJFA 3L3VA 2XY6A 4B9SA 3LDSA 4BDYA 4H8KA 5HLFA 5T7BA 3K58A 1VSLA 4CJKA 4MQ3A 3LWMA 4DTXA 4KTQA 3AA3A 4Z4EA 2XO7A 3K5MA 3RR7A 1WSHA 5DK5A 2IOCA 4CECA 2ZD1A 4EZ9A 5CZ2A 3LALA 1G15A 1S1UA 3AA2A 3OS1A 2KZZA 3O4NA 3CM6A 1A5WA 4CJ5A 1N5YA 3OYLA 1Z26A 2Z1JA 4RW7A 3QESA 3PX4A 4M3XA 1BCMA 3DRPA 1TKTA 2O4GA 1JLGA 4OGEA 1VSKA 2QK9A 4HCCA 3TAEA 4W5NA 2OPRA 4AILC 1SUQA 1L3VA 4FK2A 4G1QA 1EKEA 2D0BA 3DLBA 4B9MA 3RWUA 1JLAA 4DLGA 3RMCA 2WONA 3ZSQA 3OYMA 3DLEA 4ID1A 2XY7A 3SPZA 4C8LA 4NCAA 1SKSA 1WJBA 2W42A 1RT6A 2VWJA 1RT1A 1QS4A 3OVNA 2DFHA 4JRPA 3KIOA 3QNOA 1QTMA 3V81A 4KHWA 4EP5A 3ZSXA 2XY5A 3OYCA 4I9LA 4FZYA 1X9MA 4KI6A 1TL3A 2YV0X 3ZSYA 4YNQA 1VRTA 3KLEA 2GBZA 4DTJA 3HT3A 3TAGA 1WSIA 1X9WA 1QSYA 1WSEA 1UAXA 1Y97A 4F2SA 4OLBA 3ALYA 5HROA 4B9LA 1JLQA 1L3UA 4FK0A 3OYHA 4GW6A 1VSHA 1HYSA 1ZBUA 3B6OA 3KK3A 1NK5A 1FK9A 2F96A 3AO4A 4CF2A 4BACA 1KONA 3QEVA 2E4LA 1U49A 1A5XA 1JLEA 4CGHA 1KRPA 4N5SA 3OYDA 2BDPA 5KTQA 4DSEA 1WJEA 5J2NA 4M45A 1S1WA 3CQ8A 1QSLA 1RDDA 3HYFA 4DQPA 4ELVA 3QEXA 2PY5A 3O3FA 1VSJA 1WSJA 2RF2A 3V1QA 1RBVA 2YKMA 3LAKA 1HYVA 1WSGA 3ZSVA 3IS9A 4W5TA 3NGZA 2FBYA 3LAMA 4DTMA 4DF4A 3BDPA 2YHBA 3V4IA 4FK4A 1CLQA 3LP0A 4Q5VA 1RTDA 3QEPA 2OPQA 2VG6A 3SQ4A 3SQ1A 4KREA 4O0JA 2GV9A 1RILA 5J1EA 3RRGA 3TABA 4KHUA 3BGRA 4RW4A 3MXIA 5FRNA 2D5RA 1RDAA 4CIEA 3QO9A 3VQEA 1HPZA 4CGGA 4FLYA 3V6DA 1RDCA 4DSLA 1XI1A 2X74A 1CZBA 1Q8IA 4M3UA 1C0TA 4BWJA 1HNVA 3VA0A 4CGJA 1U04A 4FLTA 3NF6A 4FJ7A 2X6SA 1KLMA 3B6PA 4O5BA 1RBSA 4M3RA 3IG1A 4CJ3A 1XHXA 4DWIA 5FRMA 5C42A 3TAQA 4O55A 1EETA 4DQSA 2OPPA 4B9UA 2OPSA 2ZQBA 3QEIA 4PQUA 2HHSA 5K14A 3L8BA 1BCOA 1SKWA 4FJ5A 4Z4GA 4IKFA 4CFBA 3DOLA 5HP1A 3TI0A 2ZE2A 4H4MA 1RT7A 3EY1A 3QERA 1NK4A 4M3WA 5KGWA 3OS2A 2P1JA 4B08A 1YTUA 3ASMA 4M3ZA 4CHQA 3S9HA 3HM9A 4Z4FA 3AO1A 3H08A 3DOKA 4FW2A 1N6QA 2D0CA 4DTUA 3I8DA 4DTSA 4F8RA 1XC9A 2ATQA 1QSSA 1NK8A 1ZBIA 1C1AA 1HNIA 4B8AB 3AV9A 2IS3A 1VSMA 3VN5A 1K6YA 4GMJB 3HPHA 1TK8A 5HRSA 3QIOA 1KCFA 4IG0A 4CEZA 2OZSA 1NOYA 4AHVA 3EYZA 4MFBA 5CYQA 1ASUA 1DTTA 2G8HA 4RG8A 1S9EA 1T7PA 1LAVA 3KK1A 1RBTA 1WNSA 4KB0A 4KHNA 3E01A 3CG7A 2KFZA 3TAFA 1DTQA 2EX3A 4FM1A 4Z4CA 1I39A 1S6QA 3V1RA 1IKYA 3NF9A 1J5OA 4FJHA 1LV5A 4DTNA 3ISNC 5I3UA 1S1TA 4CF1A 4CHZA 4RW8A 4L8RB 2DFFA 5DMRA 3TAMA 4C8MA 4N76A 1RT2A 3VQPA 2DTUA 1HJRA 2YNHA 3OJSA 3ZT4A 4CHNA 1TGOA 4QAGA 4AH9A 4KV8A 3L2RA 2KZMA 3NH1A 1L5UA 3QETA 2HVIA 4QOZB 1IKWA 1S5JA 4CEFA 2G8VA 2JLEA 4E1NA 1JLCA 3ZSZA 3KLIA 3FFIA 1TKZA 2HHWA 3AO5A 2B4JA 3VQ8A 3KJVA 4LSNA 3M8SA 4FJXA 3VQ4A 1C0UA 1NKEA 3O4QA 1TVRA 1C1BA 1JXEA 1JL2A 3HP9A 3K59A 3SNNA 2P5GA 1JKHA 4ZHRA 4DLEA 3V9UA 4LH5A 1WJFA 1WSFA 4IDKA 1T03A 4HHTA 4W5OA 4FJLA 2LSNA 1RT4A 4BWMA 4B9NA 4FJIA 4HCBA 3T19A 1WJDA 1LAWA 4FZZA 3SUPA 1EX4A 1JLBA 4EZ6A 4DFJA 4LY7A 1MU2A 3KKSA 3D0PA 3TANA 3G0ZA 1F21A 1O1WA 1VK0A 3NGIA 4F3QA 4F2RA 3LZIA 4CFAA 4FXDA 2FBXA 5JS1A 4Y1DA 4I2QA 4AHUA 5CY4A 3QINA 4CJPA 1UA0A 3VQ6A 2QKKA 2F8TA 4CF0A 2IDOA 3JYTA 4PY5A 2O4IA 3DMJA 5I42A 3SV3A 4GVMA 3RMAA 3PV8A 5C25A 1NJZA 1U48A 4OVLA 4ELTA 4CE9A 2HMIA 2BGGA 2OA8A 3ULDA 1LWCA 5E41A 3MEEA 4OPKA 3HXMA 4N41A 3L3UA 4OLAA 4NCGA 3V9ZA 3ZSWA 3SUQA 4IBNA 3WNFA 4O4GA 3QLHA 4DU3A 3NAEA 1NJYA 2Z1IA 4I7FA 4R5PA 2E6LA 2ETJA 3U6FA 3OYKA 3NCIA 3AA5X 4E1MA 4KB1A 2G8UA 3WNEA 4CEBA 4KAZA 4TSXA 2HHTA 1JLFA 4CF8A 3SV4A 1BIZA 1NKCA 1RBUA 3NF7A 4LSLA 4NYFA 1XWLA 4BDZA 4BE0A 2PZSA 4E0DA 1JL1A 4H4OA 3VQBA 3SJJA 4Q0BA 3T1AA 1WAJA 3QEWA 1UOCA 4CK2A 4DS5A 3TARA 3OYBA 4HTUA 4FM2A 1VSIA 1RDBA 3ZT1A 3VQ5A 1QHTA 3IRXA 4ZTFA 1NK9A 4DG1A 2VG5A 1GOBA 4LH4A 5SZTA 3RMBA 3QIPA 3KTQA 4PUOA 1TV6A 4O44A 1SL0A 3ZSOA 4KFBA 5D3GA 3HK2A 1GOCA 2X6NA 1KVCA 5KRSA 2NUBA 2OZMA 3V1OA 4FJJA 3AO3A 3K57A 1NK6A 3CFRA 2Z1HA 1KVAA 4CK1A 5KGXA 3CM5A 1LWFA 3OYAA 4FLZA 1J9AA 3AVJA 1E0EA 2Y1JA 4C8KA 4NCBA 2HB5A 1LW0A 3AVFA 4CIGA 3PX6A 4RW9A 1U45A 2KTQA 1SV5A 3RMDA 1C1CA 3TR8A 3HVRA 1NK0A 1TAUA 3HO1A 5KI6A 1BI4A 3K5LA 2QKBA 1HRHA 1NJXA 4BE1A 1RCHA 1CXUA 4HVJA 1YT3A 2AJQA 3NGYA 1FXXA 3KK2A 3S3NA 3DLKA 1ZBHA 1BISA 1BHLA 3ZT0A 1LFPA 3SYZA 2YNFA 1B92A 5J2PA 3KLHA 2YKNA 1LWEA 3WNHA 4F4KA 4Z4IA 1Z25A 4FVMA 2DFEA 2VWKA 2BANA 5EU7A 4Z4HA 1MW7A 3ZSRA 3HPOA 2Y1IA 1T05A 3KD1E 3NBPA 4BDPA 3C6UA 3OYEA 4JRQA 4K8XA 3L2QA 3EZ5A 1RTHA 4M3TA 4F3TA 4IFYA 1RBRA 3PUFA 3NDKA 4KHYA 1LW2A 1NJWA 1TKDA 1A5VA 2FBVA 1B9FA 1D5AA 2Z1GA 3LP2A 3P83D 5KRTA 2Q3SA 3NHGA 4OKKA 3NFAA 3V9XA 4DU1A 3CFOA 3NE6A 4FLVA 2HHUA 4E7HA 4DSFA 4DF8A 3LP1A 3AVHA 3LZJA 2G8FA 4C8OA 4FLWA 3SCXA 2KW4A 1GOAA 4IFVA 1RT3A 3MXJA 2HNZA 4DQRA 1KFDA 1ZBLA 4CHYA 1J54A 5FROA 3VQQA 3V9SA 2B6AA 3SPYA 2HHQA 1W9HA 4CEQA 2B5JA 3SI6A 1IG9A 2D0AA 3O3GA 4DQIA 3F9KA 4OJRA 2F8SA 4FW1A 4DQQA 3VQCA 4BE2A 3PY8A 4CJEA 3K5OA 1WJAA
chains in the Genus database with same CATH superfamily
3C2GA 1WB9A 3H92A 2LY2A 5CVUA 3MAQA 1BWFO 2E34A 2K7LA 4IJAA 2L4AA 1T8EA 4CZIA 3IHUA 1K4TA 3EDPA 4L9TA 2G8WA 3DRSA 3ULEB 4PGGA 1B9DA 2QZ8A 2ITGA 2FC0A 4DBRA 2TRTA 1LDJA 2XGCA 2CW7A 1QPMA 4CSWA 2E2PA 3JREA 2VQLA 3VQAA 1IN4A 2R93J 2IEKA 1Y39A 3S3MA 1ERDA 3JRBA 4CEDA 5FPNA 4GYGA 3V9WA 3HOTA 2HU9A 4FLXA 5HDGA 4UY8I 3P1GA 1K7AA 3CC4N 1BA0A 1SKRA 1YVUA 3H1VX 1EXQA 4BY9C 2YHYA 4DTOA 3MZ8A 4CHPA 3CCMN 3RRHA 1BIAA 2ZCWA 2QXFA 3HL8A 4OAZA 1Q9YA 1P92A 5J3LA 3AVCA 1K8KB 2R7YA 1IUYA 4PFOA 2OTJI 4RWTA 4CHUA 2M30A 3KD5E 4PHTX 3H1CA 4UVCA 3ZETA 4J2AA 3VQDA 3K4MA 4EJTA 4XH4A 5JVGF 3D2EA 5DM7F 1GT0C 3VEOA 4AVZA 1MH3A 2MFZA 4L5EA 3O6WA 3AA3A 5DK5A 2QCOA 2E5ZA 5AQZA 1N5YA 4PFPA 3JCUC 3GZ6A 5J1RA 1GV2A 4UUSB 3DXMB 5FFXA 2VASA 2E1NA 2NS8A 4KT5C 2VWJA 1FOXA 5E8GA 4B3RK 2IGNA 1ESVA 4CGZA 3W6VA 4DTJA 5E17F 3AFHA 3EUHA 2ZNYA 2E1ZA 3BUZB 1TYQA 5ADXH 1NG9A 1YX3A 1JUSA 2O8FA 1U3EM 4CBXA 4PKGA 2XGEA 2Q2EB 4M45A 5ICCA 3DLLL 4JP0A 5J47A 1IXRC 4ELVA 4S04A 1LEAA 3ZEUB 2DMUA 4AM6A 1RDCA 4RMNA 2Z1DA 5FPEA 4FLTA 4AM7A 3NWSA 3D2FA 4CJ3A 1X4OA 4A2UA 4XLPF 4C3IJ 5H6RA 4AIKA 3CJCA 4M3WA 4JI0K 2A05A 2A3SA 5HNFA 2XB0X 2ATQA 3HL2A 3I3LA 5A2QZ 1DTTA 4BR5A 3THXB 3SBTA 1Y8QB 2M4GA 2QWLA 4DTNA 2E7XA 4CHZA 4PL7A 3G71N 4N4OB 2GBYA 5AZJB 2FSNA 1H9TA 4AH9A 2P4WA 3QETA 2RQPA 3M8EA 3KLIA 3FFIA 5BN8A 1TUUA 2HKOA 1VQ6N 3VQ4A 4WFNL 3M5RA 1BU6O 3E6BA 5TKYA 1KQSM 5IWAK 4IQ4A 1BDGA 3D1NI 4E1JA 5JMVA 3F5TA 2X6WA 4CJPA 3VQ6A 2CW0F 3RMAA 1R23A 2P6TA 4OVLA 3HXMA 1FPQA 3EO3A 3SFZA 1R59O 2CMPA 4TSXA 1X3WB 4LSLA 1QGPA 1WAJA 1I6XA 1KQ0A 2ECCA 2A6HF 3O2PE 4BR2A 2OC6A 1E3HA 2CUEA 1TLHB 4WFBL 2L9VA 3RKYA 2WAEA 5C2DA 3A02A 4KH4A 3G1MA 3LSPA 2UXDK 3WTUC 4HDUA 3VEWA 5GPCA 3MZYA 1RGIA 4I98B 3HVRA 4XORA 2NRVA 1EF4A 3DXKB 3EUKL 2W40A 1ORKA 1QVTA 2VWKA 5EU7A 1HJOA 2GEMA 3ZRGA 1YJ9I 3O9SA 1RTHA 2W7NA 3MKZA 3NDKA 3HM5A 3FDYA 1EJ9A 3GW2A 3A1YA 1GLDG 3LZJA 2N8GA 4FLWA 1U2WA 3UR3C 2KDOA 3F9KA 3EE9A 3VEZA 3HBTA 1DKGD 3QO9A 3FXLA 2AQFA 3CMEI 5EJCA 5HS9A 2F9WA 1VSDA 2KZGA 4XR6A 2I7PA 1X2MA 3FK6A 1FBUA 1QQIA 1UG2A 5C24A 3O4WA 3CLOA 1R36A 2IJLA 1V4TA 2ZB9A 4C3HJ 3WTZA 4MO7A 3ATUA 4CCNA 1QQCA 1A6QA 3MEDA 3LSIA 2QQAA 1JXBA 4M41A 4K8ZA 4M9ZA 2YHAA 3OMYA 3D5LA 2L9NA 2IGMA 3DLGA 5CZ1A 4DMNA 2KP6A 5BPLA 4KI4A 3CP8A 2DOAA 1EP4A 1POGA 1T39A 1FIPA 2CUZA 4BEHA 2ZSHB 3AARA 3QICA 1QE1A 2RQQA 1M1KO 3KLFA 4N0BA 1KFSA 3MEGA 3VGMA 2BW3A 3SZGA 1YX5A 1I1GA 1BI2A 3GFIA 3OSFA 3GTKJ 1O57A 4G9ZA 2KFNA 5E3LA 2NVQJ 2WB1N 2K85A 4HW0A 1ZN2A 3P4IA 1W36C 3DLRA 4KHPK 3B6CA 3CYMA 4KBOA 4XLHA 1RUNA 1HLVA 3SZ2A 5ICEA 1G3WA 2R3SA 1HQUA 4DJAA 4WX9A 4CHOA 3FM5A 1TL1A 3K2PA 4OOIA 2F4MB 3BG3A 1W2BM 3FLCO 3K58A 4MQ3A 3QFPA 2XO7A 2F4OB 3GO5A 3TDZC 5CZ2A 3AA2A 2MABA 3E66A 3I71A 3VETA 3CQXA 2LOOA 2QW9A 1S3XA 2WONA 5ILSA 5JLHA 1IRXA 2A42A 2NVXJ 1T0FC 3FXJA 1QTMA 4A3GJ 1HNZK 3L4IA 3OYCA 4FZYA 3LL3A 4MTDA 1Y97A 4L9VA 5HROA 2E71A 1AU7A 1QRYA 3DEUA 1H1VA 4N5SA 5KTQA 4ISEA 2DA3A 2P9PA 2MD0A 3O3FA 1WSJA 1Q86O 1WSGA 1NGHA 3LAMA 1B72B 2IAIA 1VAZA 2MC4A 3WU1B 2GV9A 1N8RO 3JRFA 2XAGA 2VT2A 1HSJA 3JAMZ 5AQGA 4C1NK 3KP4A 3K1MA 4H03B 3HUGB 3AL0C 1Q1VA 2OPSA 2R5ZB 4C2UA 4LFBK 1U8BA 4M3ZA 4HPQA 3ZPLA 4MO5A 1C1AA 5F0FA 1K6YA 5GAHJ 4Y0WA 3KK1A 1MBKA 4FWPA 4Z4CA 2PFBA 2A5WA 1ONVA 3U2RA 5I3UA 4FE4A 4CF1A 2DFFA 4DHYA 2DOFA 4GO1A 2M34A 2L02A 2DJIA 4QAGA 4NUBA 5AQXA 4GRIA 2JLEA 3ZSZA 3BJ6A 4LIUA 4M71A 2ZWHA 3I58A 4I01A 4LJZF 2LSNA 3KEQA 4LB5A 4HCBA 1WJDA 1ZARA 2FXUA 2XF5A 2VBWA 2R7FA 2EWSA 3NVKA 5HLIA 2DT6A 4KN4X 4I2QA 2F8TA 1ZR4A 2RVCA 5F1XA 1FX7A 3CD6I 5AQRA 1Z91A 2ETHA 2ZGYA 5F0HA 4K25A 2NS7A 2VOPA 3GUDA 4IBNA 4O4GA 1IRGA 1WZ2A 4IOAF 1WOQA 2E6LA 2ETJA 2YHXA 3WNEA 3MWTA 5J8CA 4ZYEA 1GVDA 1DGWY 2I5UA 3VQ5A 3V8KA 2FU4A 1HW5A 4O44A 1Z3YA 4BXXJ 4IXAA 4L9NA 4BGDA 3F2KA 1NH3A 5KGXA 2AA4A 4FLZA 2Y1JA 3H0DA 1NHAA 2DPNA 2COMA 3OR1C 1XCBA 3NGYA 3DLKA 2YNFA 1F5TA 3KLHA 2Y1IA 1I3QJ 4RM3A 2W1OA 5CYVA 1QO0D 4BJ5C 5FLXZ 3CFOA 3VTHA 2DPDA 5DM7L 1S22A 1ZBLA 5HLHA 4CEQA 4ASNA 3SJMA 2DYRH 3PY8A 2NXNB 3JS6A 1YAGA 3IAYA 4BHCA 3HOYJ 4Q48A 4W5RA 4NHJA 1S7AA 2HBJA 3W2WA 4OPAA 2ZFUA 1RZ4A 3TWHA 4CGFA 1GUUA 1GV5A 2LC2A 4UQGA 3DPTA 3IP4B 4DV2K 1QU3A 3MXMA 9ANTA 4PKIA 3MZHA 1HDPA 1TT5B 4WQ4A 3KP2A 5ADXA 4HSRA 5HRNA 4GXOA 4FJ9A 4MQ9F 3Q5FA 4PJ0C 2K4JA 2HNHA 2HVSA 1EV7A 4RGUA 2ZSIB 1SD4A 2HNYA 4CESA 3NEUA 2QEXN 1MA9B 1XDSA 4I6MA 3AVBA 4IZ9A 2YPRA 4XRSG 5E3MA 2W6KA 3OA9A 1DLOA 1DDNA 1OVQA 4EGYA 2L5QA 3WODF 2VKEA 3SXYA 1VQ5I 4A5AA 5KQ8A 3DLHA 2E1MC 2W41A 1SQKA 4DSIA 1YOVB 1HNXK 4CJLA 2GTDA 2WAFA 2XRIA 3FZVA 3ZQ7A 3FF5A 1VQ9I 4AIHA 5IYDJ 4BGAA 3O08A 3GTMJ 1SL1A 3QOEA 4JNEA 4KYWA 1KXPA 1T6SA 2LYCA 1C6VA 4Y13A 3RSEA 5EX5A 2ZO4A 1ZGWA 3M8QA 4OO1J 3KHYA 2XY6A 4O3MA 1T44A 2DA7A 2ZD1A 3CJ7A 3OS1A 3D2EB 3SEQA 4CZKA 3OYLA 4RW7A 1JI8A 4M3EA 4M63C 1Q7YO 2HPIA 2Z99A 2QK9A 4LD5A 4HCCA 2W57A 1LE8A 3T69A 5FPMA 5IP7J 1J2XA 2HZDA 4C8LA 4QPOA 4ID1A 2H3GX 2CS3A 2VXZA 4ZYGA 2DFHA 2CFOA 3V81A 4I9LA 1LEBA 4Q47A 4UB6C 4JI4K 5IP9J 3TAGA 4F2SA 4KN7X 5F1JA 1OFCX 1Y64A 3AG1H 3B6OA 3VODA 2EINH 5M5WJ 2YHWA 3V7SA 1A5XA 4CBUA 1TYQB 3VB2A 1OH8A 2X1EA 3LAKA 4W5TA 3DTKA 1G3SA 2XC7A 3VYTB 5CLSA 1QQOA 2X9DA 1HPZA 2P5LC 1HNVA 2RN7A 2HQ5A 4D0PA 2W24A 2ELHA 2VJIA 4JEPA 2Z9OA 3BTLA 2XDVA 5C4JJ 3QRFF 4CFBA 3TO9A 3PM1A 4CZFA 3GTPJ 3D2FB 1ZAOA 2Y75A 4CZJA 4FW2A 4NB5A 1I50J 2CQKA 1WSUA 2IP2A 2IS2A 2IS3A 1U9OA 2DFIA 2HXOA 5A2QO 2KFDA 4BGBA 4OIOF 2EX3A 3ZX3A 4KDPA 1IKYA 4FJHA 3U1KA 5CVIA 5LD2C 1OCTC 1RT2A 3OJSA 1H88C 1XGNA 2NOJB 2XSJC 2WB1A 2HVIA 1K4SA 4H0OA 3O8GA 2GZWA 4RLFA 3K59A 3ZYYX 1TUYA 4OU0A 4FWOA 2DMQA 3REOA 2M7BA 4E7SA 2FD5A 5HS8A 4EVIA 3HOWJ 2M3AA 4MQVA 3OOPA 1GLLO 4QS9A 4N41A 3F22A 2IVOA 3GTGJ 5M3MJ 2Z1IA 3U9DA 4R5PA 1K8AO 3CCEN 4UV9A 1NKCA 1S8NA 1MNMC 3A0HC 2LKXA 4RS8A 2CYYA 3IFRA 5K7ZA 3QIPA 4PUOA 4BHPA 1SL0A 2X6NA 2W84A 5TJJA 4A5BA 2IXSA 3ABMH 1IJJA 2HF4A 1E0EA 1ZTRA 4LITA 4JKFA 5EZGA 3F8MA 2RNJA 3HRTA 4LG3A 4IDHA 1TWHJ 1RCHA 1T6DA 4O5FA 2YKNA 4K8XA 1LOTB 3EZ5A 1NJWA 2WV0A 4DU1A 4YDUC 4IFVA 4MO4A 4CHYA 2YX7A 1NG6A 1I1SA 5JLWA 4DQIA 3J81O 3RDIA 4FW1A 3GZNB 4A5MA 4XM3A 5ICFA 5EVZA 4KPYA 5D5UB 2GOMA 3F73A 5AQQA 2AQEA 2D2WA 1MBHA 4QSHA 1N77A 4X0GA 1OISA 1OPCA 1XUPO 3ZT2A 1KU9A 2LREA 3E1YA 4BRKA 2GELA 4BRNA 1TWCJ 1RRJA 4A57A 4FJKA 3LP3A 3CIPA 1RT5A 4GVEA 2JTVA 3COAC 1C0MA 1EA3A 1XSXA 4A3CJ 4HUEA 5GTHC 1U5TA 3BG6A 3VSKA 3ZN0A 1LVAA 3LWLA 2UXNA 2GWRA 2CU7A 3CCJI 4O0IA 2CV0A 2NYXA 2JT1A 3ITHA 2OAZA 1ODDA 4ZH4F 1DT9A 2O5RA 4Y33A 4EFHA 2QBYA 1WAFA 3HSFA 4DTRA 5H1SQ 2E1YA 2BW3B 4YFUA 5BRHA 1S6PA 1PJRA 4GV3A 1TK0A 4I2PA 4FYDA 3RZOJ 4KFCA 4CFDA 2RC4A 1JXSA 5F2RA 3KKRA 2KLOA 2P51A 4DTPA 5AR0A 1WN7A 1Z77A 4RW6A 4OGCA 3J7AY 2WA0A 3TSQA 2QF7A 3I54A 3KK7A 4XKWA 2FF3B 2A6EF 3HRUA 1Z9CA 2E2JJ 4IEIA 2CH6A 4CZEA 1J0RA 4KHQA 5BRDA 3S3OA 4KT6A 3RQIA 4IF4A 2XSDC 4IO8A 1Z1DA 2ESNA 2EIJH 3LA2A 3A0IX 4FQGA 3DP7A 2E20A 3A4CA 4HRIA 3QESA 1IRFA 1JLGA 3GZ5A 4GDFA 5AFUA 2DA5A 3RJPA 1IUFA 3SPZA 3QAHA 1VQKI 1SKSA 3I59A 5AQPA 4ON0A 4IOAL 4DGWB 2HYGD 2OF7A 3TGNA 1FK9A 2F96A 2X48A 1U49A 1KRPA 2BDPA 2QYOA 4FPAA 3ZN1A 2CGJA 4XOPA 4K2EA 5FD6A 3MN7A 5ED4A 3RKWA 1LDDA 2MW8A 3HBLA 4CGGA 2FXAA 1HDDC 3I33A 1VQ8I 5LLQA 3ZQHA 3ASNH 3IDHA 3DJCA 1VQNN 4DW6A 2RE2A 4O8KA 2K9QA 4L5IA 1XQSC 2VBXA 3CPWM 2HBKA 1IZ1A 1HR0K 1YTUA 1BI3A 4B3MK 2D0CA 1QHGA 4IHXA 1SVOA 3DLAA 4B8AB 3VN5A 3EL2A 4PSWA 2VUMJ 4IEEA 5HRSA 2Y30A 3CDHA 2O4IA 3C6HA 1Z3XA 2CWEA 2QM1A 4BVPA 1UHMA 4UVAA 4CHNA 2UUZA 3ENBA 2EQRA 3EKSA 3PL8A 5KAIC 2CUFA 3HM8A 2NRWA 4B9NA 1ZELA 3F72A 4LF9K 3J80K 3ZQFA 3GFJA 1VK0A 5TKWA 2W48A 1J5EK 3ZCOA 2IBDA 2JPCA 2IRFG 2DU9A 1KQ8A 3JYTA 2FX0A 3FE1A 3JXUA 1X58A 5AQUA 2KJBA 4CE9A 4ISGA 1Q18A 4W97A 1O3TA 5D6FA 2WC2A 3MAJA 4LLNA 1BIZA 3DEEA 3HJFA 4A3EJ 2KIUA 4G7ZF 1G99A 1GOBA 5JICA 2VKVA 1WCMJ 2FF4A 1FOKA 4HA8A 3M3ZA 2OANA 3K4CA 1KVAA 1JJ2M 3CM5A 5D4RA 3UE5A 3CCQN 4BG9A 1NK0A 4WF2A 5JLFA 1YJWI 2XPVA 3TL4X 2QKBA 1NJXA 4BE1A 4XRFA 5ILUA 1R49A 2VE8A 1NTCA 3TTFA 4D9JA 4XICA 3CCSI 4MNUA 3L2QA 1P4AA 2JUGA 3PUFA 3GOIA 1MKMA 1BJZA 2X6XA 5FLXO 2HHUA 2BXZA 5EEHA 3DWLA 2HHQA 3O3GA 4IRIA 3CI5A 2ZF5O 3LSJA 1BL3A 3WGGA 4E19A 2VJ4A 4FJNA 3BC8A 2BE2A 3ZXSA 2K27A 4XNFA 3AVAA 2AHQA 2YI1A 2F4IA 5EYRA 2PN6A 4II2A 1IBLK 1N25A 4BL0B 2R4GA 3SLCA 2BY0A 3S2WA 2JGUA 1IDYA 2F7TA 3T1HK 3TAPA 2XY8A 3G6EN 3QPLA 2J4RA 3BP8A 2EA4A 2OTLI 1SAUA 3LWFA 2OD5A 4KKOA 2PJRB 1VQPN 3WEEA 4A3IJ 4G9YA 4HEA2 4CCJA 1OCZH 3KLGA 4ESJA 4KTWA 3I8BA 2YUSA 5EZHA 4CEEA 2CH5A 1RIOH 2ZFWA 1TQMA 4YDUA 5GP9A 4BQQA 4BS9A 3Q7CA 3VF6A 1TK5A 4NQWA 5C4XJ 1W0HA 3DRRA 2NAZA 2ZC2A 1U47A 5B3SH 5FKLA 3OYJA 3LSGA 1Z67A 1AOYA 2JA7J 4K42A 4BQLA 4CI6A 3FZFA 2M0CA 3OS0A 3I55I 1RTJA 2PBDA 4IRHA 2YNGA 1I27A 1BN5A 4DV4K 1YW7A 1I3AA 4CVNE 2QGUA 3OR2C 3C94A 1S6LA 1OYIA 4HLYA 2DOEA 4FJ8A 3HRGA 2BBYA 4JK8A 2ZM6K 3J7ZO 4ZC3A 2VPRA 1RI7A 1BC7C 2D45A 3S8PA 1HC8A 3FGUA 5T7BA 3RSEB 3ZQGA 4KNYA 4KTQA 4L0ZB 1ULYA 3CJRB 4FOIA 3EYYA 4MLEA 1O3RA 2Q97A 5B5EC 5CVJA 2OCEA 4BQOA 1ZH5A 1W1WE 1EKEA 1Y6IA 3GLLA 2F4VK 3IAM2 3CMAN 1YW8A 3QODA 3CJ9A 1IN7A 5JI6A 5FB2A 2ZXJA 3QNOA 1LE8B 1VQON 4F55A 1X9MA 4KI6A 4E4HA 2F2EA 5FKMA 3MN6A 4CXFA 3TOBA 3GWZA 5FJ8J 3AGKA 4B09A 2O8BA 3L09A 1P6RA 4ESFA 2H09A 1NJIO 2LFBA 1P4XA 3R4KA 4BBRJ 1X4PA 1MBFA 3I4MJ 4Z4FA 4DF4A 5DEQA 4ITVA 2OUMA 1RTDA 1KYZA 2DPUA 3TDUC 1R1TA 1QQMA 5F1RA 2P5KA 1MDMA 1V54H 4EJUA 5C42A 3TAQA 5BREA 1FSEA 4X6AJ 4Z4GA 5AZIA 3EY1A 1ZGJA 2P1JA 3HHGA 2V6EA 4M3BA 3A8YA 4DTUA 2XAQA 2KRHA 1QZYA 1UMQA 2E1OA 4JI5K 1VSMA 2H6BA 1BG3A 5E1ZB 3K6GA 3DU5A 1ASUA 3HTSB 3HDDA 3WHCA 1DTQA 4CDGA 1TTYA 3NF9A 2YX6A 1S1TA 4L8RB 4RW8A 4UB8C 1HJRA 4DCHA 1GXPA 2WY7Q 1WI9A 2EZKA 4JX5A 4Y52J 1TKZA 4Y15A 3IKMA 2KT0A 2BTFA 2KRCA 3L7WA 3LL7A 1JL2A 6PAXA 3V9UA 2QWPA 2QWOA 1EX4A 3NVMA 3H45C 1F21A 1O1WA 1X1AA 4FXDA 3SFIA 3IWZA 2FBXA 2XPUA 1ZYRF 4EJVA 3VYUB 5I42A 1JKQC 1E3OC 1NJZA 3L0QA 2KKZA 5E41A 4A3BJ 4EATA 3H46O 3G4SI 3WNFA 2R7DA 1NGIA 4JI6K 2R5YA 3ZLJA 2ITMA 1W5TA 3I9V2 3K9KA 1S29A 2V4JC 2G8UA 3RZDJ 5FKOA 2M5WA 3FMQA 4DS5A 3ZQCA 2Q1ZB 2QWWA 2VG5A 4KFBA 1MSFC 1VHXA 3GDQA 3CF5L 4BROA 5LFAA 2QENA 1IGNA 3CP2A 3DKWA 1K8KA 3SYZA 1GLEG 1WH5A 2OZ6A 3HYIA 3KD1E 1IV8A 3R8EA 1FIAA 4LC9B 5CR4A 3NHGA 3V9XA 4DSFA 3LP1A 3G3ZA 2JZYA 1FOWA 1R58A 4DBQA 2YJEA 2B5JA 1ZC6A 3V4GA 1AHDP 4EM1A 1WJCA 1D0ZA 1RDUA 4U0WA 1K6OA 4Y3OA 1IN5A 4I0AA 3F21A 1ZGAA 2BZTA 2DMTA 1VSEA 3RSNA 2PYJA 2MG4A 3K5NA 3BTCA 2X1CA 4N9IA 4E7LA 5DD8A 3M1CA 3IUOA 3BR1A 3KYDB 3BOQA 4KRFA 4ELUA 1ITGA 3R9PA 5HRRA 3LDNA 4FCYA 2JSCA 4KICA 2R92J 1ON1A 1R5GA 3S1NJ 1AA7A 1XS9A 1QNTA 5CPRB 5AQSA 4DU4A 3I0RA 1O7LA 2P9LB 1U5TB 1N34K 1XHZA 3ENHA 4Y4RA 4WE1A 4IX7A 3VQ9A 1IO2A 3CCLI 1S1VA 1DGRM 3M6GA 2RKIA 3FZLA 3DBLB 1S9HA 4XEIA 1P7JA 2PEXA 3ZCMA 3OYGA 4FTHA 4M42A 1D1CA 1FJGK 3F8CA 2K9MA 4H0TB 3BR2A 4XIUA 5KQDA 1V3FA 4BC5A 5M3FJ 3CCUI 4FWNA 3SQ0A 4PDKA 2UUAK 2P9UB 1SMYF 4MHGA 1N75A 3BZ6A 4EEFG 4CGIA 1SC7A 3L2UA 2EFNA 1TL8A 2GAUA 2H6CA 1ZRDA 1WFXA 3JSPA 4DQ2A 1NGJA 4CCHA 5AZJA 3AVGA 4CJFA 2RHKA 3WTVC 3TO7A 4A69C 3IV5A 5M1OA 3O4NA 2O8KA 1Z26A 4M3XA 4H0YB 2GWJA 1TKTA 4G6QA 1L3VA 1OLTA 3GVAA 1RKTA 4NCAA 2V9PA 2F5FA 1MZBA 2GX9A 5GADP 1W7AA 3LAJA 2WAQN 1MJAA 3BQYA 2DK5A 1HUXA 4YIIA 3WE3A 3I59B 1IG8A 5KK1A 1VSHA 1BOAA 1WGXA 3HGGA 1HA8A 1KONA 2JWTA 2IVMA 1QSLA 4YIFA 4V19S 1J75A 3V1QA 1HYVA 3PLAA 1YIJN 2VG6A 3CC7I 4WQ5A 1PYVA 2HXIA 3BGRA 4RW4A 1YITI 3E6CC 2V79A 1WJ5A 3RPUD 4JKAA 2LK2A 1VQ5N 1U04A 2FNAA 1EWQA 5JLXA 4LFAK 1T56A 3THWA 1XMKA 2EFQA 4WXCA 2ZKZA 3H6EA 1S7EA 5M1PA 4PQUA 3CPEA 5J40A 3DBRB 5HP1A 3K70C 2HI3A 1VQ9N 1VQMI 4FISA 4PJJA 4DTSA 4MDAA 1XNRK 1QZ5A 1ZLKA 1D0XA 2JVHA 3ZQQA 4WWCA 3TSUA 3J80Z 1SAZA 4KB0A 2D1VA 3CCVN 1FP1D 1X2NA 3R61A 4FM1A 4LF5K 4JKGB 3K4LA 3D7EO 4GY2B 4LB6B 4Y7NJ 1S5JA 4QLCU 1BIBA 2P5GA 1N36K 3H36A 2BE5F 2L7MP 3BDDA 1YJNI 1FMVA 1TW3A 2IT0A 4EZ6A 2K3PA 1JKOC 2ID3A 2JK3A 3HXLA 3HJEA 2QKKA 1OR7A 4XKBA 4HLXA 4X66K 1YI2I 1TQIA 2BGGA 1D1AA 1MNEA 3DWLE 3N97A 5EXWA 3OBWA 2LR8A 3NQOA 1Z6RA 3D0SA 1USSA 3TTCA 1FC3A 5SZTA 2K4BA 4RGRA 3SZTA 4YFKF 1BI1A 3HK2A 2OCCH 1KVCA 4YOVA 1NK6A 3PNVA 4FO0A 2FLOA 2RREA 3GCMA 2Z16A 1YS7A 1ATRA 1WWXA 3RPQA 4M6VA 1BISA 3ZT0A 1B92A 2I10A 3K9JA 2BANA 4JRQA 2M7AA 5CHIA 1LW2A 1KC8O 1QZZA 1B9FA 1D5AA 1Z21A 4OKKA 2AO9A 2XAFA 3FXKA 4C8OA 2BV6A 5BQTA 3OV8A 1GOAA 3BG9A 2QA4N 4KA4A 4ZDPA 2D0AA 3ZMUA 2GUPA 3W0LA 1WJAA 1X3UA 1SFKA 1L3TA 4M3FA 3K4JA 2R7OA 2XKOA 4CA0A 4CD1A 5CKTA 1TKXA 3MEXA 4RBOA 3DYAA 3CMYA 3AVIA 4W5QA 2CQQA 1WHUA 1NOZA 1ASVA 4BQZA 1MD0A 1WPKA 2NRHA 4BR0A 1SFEA 2IA1A 1SD7A 4NB4A 4CICA 5FLVA 3WGIA 2LRDA 4QTRA 3BT9A 4XLNF 2XIGA 3CC2N 4CJ4A 1BR1A 2E2IJ 4Y1CA 3VEPA 3DKXA 3M4OJ 3FISA 4CGDA 4AHRA 5FDLA 1ZLJA 4QIWN 4PK4A 2VC1A 1U2VB 3A2FA 3P5JA 4B4CA 3WEEB 3DTEA 1V5GA 2X4HA 3CC4I 4P9FA 2MSYA 3NH2A 5J2MA 3H3ZA 2HDWA 3CDLA 4XOTA 2HW3A 1W0TA 2Q31A 3CCMI 4IJNA 4UUTA 4XN3A 2R5ZA 3WT0A 2L0KA 3QYBA 4HUGA 2HMPA 3VA3A 3VEVA 4FASD 3O8MA 4IOCF 3BY6A 4HNTA 3A5OC 5CYMA 3NWTA 1HMVA 3WXKA 4QPQA 5GAEP 2H1LA 1YF5L 3CO6C 1GLFO 3QDKA 3HOZJ 3H3VK 2QSGX 3MMYB 5F0XA 2ZJRF 4ZDOA 1VSLA 3D6RA 4JX4A 2QLZA 1G15A 1JUPA 1MBGA 3TQNA 4AILC 4A61A 2DA4A 3A0BC 1G59A 2D0BA 3LDPA 4HX7A 5F27A 1F43A 4DLGA 1BW5A 1DPRA 4CYDA 3OVNA 3KIOA 4EP5A 5BPIA 2VYPA 1E3MA 4YNQA 1VRTA 3KTQA 2VIXA 2QUFA 1HX1A 3CCJN 1SVMA 3AO4A 4AIJA 5LRRA 1JLEA 3OYDA 4BRLA 1S1WA 2PMZA 5IPAA 4C9YA 3IS9A 4ABZA 1N32K 2O8BB 3SZPA 4BJTA 4HF0A 3ZMVA 3ZX0A 1FWZA 3LMMA 1R71A 2TDXA 3GFLA 2IGOA 2FBKA 2NVUB 1TNTA 2PJPA 4RA2A 3THYB 2OU2A 2HHSA 1SKWA 1MJ9A 4NLCA 2KRFA 5BRFA 1MDMB 4DR3K 4KMFA 2BHZA 1U6GA 4FHTA 1NK8A 4YORA 2EFPA 4IZZA 1PUEE 2B7EA 4GMJB 4H5WA 4IG0A 2EWNA 4A62A 4I02A 5FLMJ 1HOMA 3GYHX 4BC2A 3G71I 2Q0RA 2XAHA 4BRFA 2LD5A 1RR7A 1FP2A 3TAMA 3E7LA 4YOWA 1L5UA 4G12A 1VQ6I 1XNQK 3ONQA 4JKBA 4FJXA 3O4QA 1TVRA 2F48A 4CJ7A 4MEXF 3O5BA 4BWMA 2Z2SB 3SHFA 1LAWA 5IT9K 1QPIA 5L3CA 4YY3K 3G0ZA 5DM6F 4CFAA 1UA0A 2JWKA 5CY4A 3FIWA 4PY5A 3JRAA 5DCMA 3BJAA 3DFGA 4NCGA 4FWMA 2CFXA 2P9KA 3Q0UA 3SAFA 1RESA 2GIZA 3FZHA 3EETA 4CZCA 1YIOA 4M72A 3C7NB 4M9XA 1K78B 3SV4A 3FBIB 3DBHB 4H4OA 3SJJA 2VCPA 3T1AA 2R5YB 4HTUA 3MN2A 1RDBA 2LG4A 5KNLA 4A6DA 2D0PA 3CCRN 3A5LC 2JA6J 2OJED 1VQ8N 3IAS2 2HB5A 1XGSA 1U45A 2NNYA 2WAQA 2CGPA 3QPSA 3FBNB 4OMYA 5IYBJ 2AXTC 1NM1A 5KVRA 4A3FJ 3RKXA 3C0BA 3ZMSA 2JJ7A 5E18F 3ZSRA 1T05A 2JRTA 1U78A 3VGKA 2ZNZA 3EN9A 3E9OA 3NFAA 3DPLC 1HKSA 2G8FA 1MMNA 3NMUA 3H9GA 1SS6A 1YHQN 2B6AA 5LHGA 3NARA 1J9IA 2UUCK 3SDGA 4A2BA 3MCZA 3QPTA 4BE2A 2ZXWH 3I64A 1XG1A 5BOXA 5HL7L 1MNDA 4DUZK 1WRJA 3HB9A 1BQMA 2H1KA 4Z2YA 3BG5A 3HZ6A 3EUAA 2JSPA 4EGZA 2BOLA 5J8FA 4FT8A 3MECA 2VT3A 1TZLA 3LANA 1REPC 1JHHA 3HIFA 3QOPA 3WQUA 3CETA 1XCVA 2A1RA 4J8FA 1ZBFA 2EILH 4XMYA 4A3DJ 2EHGA 2RN2A 4AHTA 4ZTJA 4N9HA 2EJRA 4E7ZA 2OYQA 5AONA 4M7YA 3L4QA 4DQ8A 2ISZA 2X0LA 1IKVA 3S16J 2BY2A 3BG7A 1BM9A 2P5OA 4FPBA 4YRVA 4XH5A 3WXLA 3E6MA 3CMMA 5BN9A 2XKPA 3R1XA 2VQEK 1GXQA 3W6JB 4DSJA 2R7SA 3DCFA 3CCSN 1ACIA 3ECHA 3SUOA 2GQQA 4UV8A 3QMLA 4ICLA 1BI0A 3WGHA 4C8NA 4II3A 3H3OB 4KTZA 4H5NA 2WWYA 1S9GA 1J53A 2ESHA 1R22A 5EOYA 4CJKA 3LA3A 3K5MA 4CECA 1FTTA 3HC7A 1A6IA 2NRZA 4BRDA 2FQ3A 2Z1JA 2KISA 4B1XB 1V5FA 1K83J 3O3KA 3ESWB 1HKTA 1FYLA 3MD2A 2ISYA 3ZSQA 3HGYA 1QS4A 4DV6K 3ZSYA 3CHWA 2DQRA 4P5OA 3AL0B 3WU2C 1X19A 3TW6A 3QEVA 2KJCA 4HF2A 3CQZJ 5GADJ 1OH6A 1RDDA 3RQ4A 2RF2A 5FD5A 5JVHL 3ELKA 1P7IA 4DTMA 3K1PA 4J00A 1QVUA 5F08A 4A0ZA 3SMPA 4O0JA 3KZIC 3GBTA 4I7HA 1RDAA 5LGUA 1JCFA 4BWJA 3TEDA 3IH3A 5B1AH 3VA0A 4CGJA 4CO8A 3PIPF 4H0VB 4O5BA 2CQNA 4DWIA 4WQ4C 3UB5A 4LG0A 1JGGA 4FWQA 5K14A 1BCOA 2GIVA 1PUFB 4HAMA 5KGWA 4GFBA 3THWB 4B08A 3S9HA 3H5NA 1ZBIA 3I8DA 2STWA 3WXMB 3TMOA 2AS5F 1Z7UA 3J80O 2KDZA 1QHAA 1NOYA 3EYZA 1S9EA 2JA5J 1J7KA 5JVTA 3K4KA 2JRMA 2KIFA 2W6LA 2UZKA 3M8JA 1S72I 2ZXHA 2CO5A 5HODA 2M9HA 3J81Z 1TGOA 2QXLA 2VQCA 3SDBA 1SEUA 4LSNA 1C0UA 2Z5UA 4BJ6C 5DS9A 2HTSA 4JK7A 3T19A 2Q36A 2CW8A 3OIPA 4BYYA 4F3QA 4CUGA 3TO6A 2DT7B 2X51A 3EQLF 5ELZA 4JK9A 1UHSA 3DMJA 3SV3A 4GVMA 2HOSA 4HTLA 3SUQA 3SK3A 4I7FA 1V4RA 3C2HA 4GYIA 4RB2C 4KB1A 1ON2A 4UY8O 3P9CA 3NF7A 1XWLA 4BXUA 5EF6A 4FM2A 1HXDA 1VSIA 4BG8A 2LBFA 1OH7A 1GOCA 4YHHK 4RCHA 3WQTA 3AO3A 1S7OA 1J9AA 3K2ZA 1NGDA 3AVJA 2HWVA 3RCOA 4NCBA 4IOCL 1PP7U 3QQAA 2BH1A 3T1YK 2DDAA 4QWQA 3K4NA 1T8IA 2MD5A 3JSOA 1NGEA 1R00A 4KIGA 3WNHA 4B1RA 4DNCA 2GOXB 4BDPA 5LEKA 3OYEA 4LF6K 1WVRA 2FBVA 1BR2A 3EYIA 1RNLA 4DF8A 4YOTA 2V51B 3SCXA 1RT3A 2HNZA 4WF9L 1HKGA 4ZYDA 4H5TA 4RM2A 2F8SA 4KUMA 4EIAA 4LF4K 3PO3J 4M73A 3BLYA 2O7OA 1MGTA 3M8FA 3KP3A 3VTIA 2EV5A 3KZYA 3ULQB 1H0MA 5A2QK 1OKRA 2RDPA 1VFCA 5SWMA 3VMFB 4BRHA 1NK3P 1NMNA 2VPLA 3AVLA 5CQGA 2H94A 4GKKK 3G4SN 3JRGA 4IHYA 1C0GA 2EZIA 5B1BH 2QEXI 1Q9XA 1HSTA 4PWDA 2PFUA 2HVHA 4WCEL 3VQ7A 2VQHA 3DLLF 3A03A 2DYSH 1X3MA 3FK7A 4OKJA 1D8YA 4YFXF 3HRSA 4DFMA 4BRQA 3DM2A 4FJGA 3S1RJ 2A1SA 4ENNA 1QA6A 4UXNA 4F52A 4A5NA 5HBMA 1MJBA 2FSWA 3ZT3A 4AIDA 1YS6A 3KX2A 4IHVA 4J2EA 1MIJA 2YNIA 2BY1A 3QBXA 3LNQA 1E4FT 2VI6A 3BTIA 4C23A 4XKCA 2GUIA 1SANA 5AQFA 2JPBA 2L01A 1X3NA 2A3ZA 1UA1A 4B8XA 4IO9F 3RR8A 4B1YB 2K9LA 2RNGA 3FKIJ 2FBHA 4ANJA 2L3DA 3BZKA 2ZMEA 2A61A 3QBWA 4S0HB 3MDQA 2O61A 3C18A 3L3VA 3VPZA 3E0JB 2XB5A 4F9OA 4WK8F 3H5RA 4MFDA 3LALA 1XTAA 3AG2H 3QYEA 4XLCA 5GAEJ 3PX4A 1XD7A 4FETA 1FBQA 3QFUA 3FXUA 4OGEA 2PBIA 1SUQA 4D7MA 4G1QA 3QU3A 5DM6L 1JLAA 4RAZA 2P9SA 2GXBA 2JN6A 5AFUH 1X9WA 3SMSA 1R5HA 3PUBA 2MC3A 4A3MJ 4JD2A 4EP4A 1FSHA 3ZSVA 2YS9A 1IF1A 4Q5VA 2ELJA 3U9ZA 3E5UA 5C10A 4CYCA 1YQAA 3NF6A 3CCUN 2O6GE 4M3RA 1QQNA 3IG1A 5FRMA 1KGSA 1U5TC 1EETA 2OPPA 4NC8A 2LLKA 1TP4A 1AWCA 4H4MA 2RGVA 1VQ4N 1B6AA 4CHQA 3CUQB 3H35A 1HNIA 1LB2A 4H5RA 5BPDA 3VENA 1KCFA 4AHVA 1LAVA 3GF2A 3CG7A 5JVGL 3S41A 2A40A 4A93J 3V1RA 1HQCA 1J5OA 2DA1A 4ESBA 4DOZA 2V9VA 2DTUA 2YNHA 2LF7A 2HKXA 3KE2A 4CEFA 3FR0A 3C1DA 1Y8RB 3IH4A 3L2CA 4EAHD 3E6DA 4V19K 4YOXA 2Y31A 3SNNA 1MMDA 4KIBA 3PFYA 1RT4A 3KP5A 1RETA 4PKHA 1W97L 3CXCM 2DXIA 3IMXA 5C0YA 3NGIA 4F2RA 2L7ZA 5JFRA 3QINA 4TV7A 2V1UA 2HMIA 2OA8A 2DODA 3GXOA 4CCLA 3QPHA 2PJRA 3QLHA 3NAEA 5DCMB 3AA5X 4HG2A 2OBPA 1G6NA 4BDZA 2M8EA 2O8EA 1JL1A 2P9KB 5C44J 3ZT1A 1ETVA 3OL4A 2NNWA 4DG1A 2UUBK 4GV6A 4C2TA 3O9QA 3VYSB 3ABKH 3ZSOA 5AQTA 1PVEA 1T98A 2L7FP 2VWBA 2WADA 4FJJA 3OYAA 2G0EA 5D4SA 1I5ZA 1GLAG 1KU3A 3MVPA 4K0KK 5EEGA 1HCRA 1H9GA 3W2AA 3C65A 5C2FA 3MKYB 1LWEA 4F4KA 2BY3A 4NC7A 1ATSA 2VN2A 1M90O 4IFYA 1RBRA 2VODA 2Q3SA 4NLBA 3HI0A 3JAMK 1KFDA 3VQQA 4KISA 1ATNA 3T5XA 4IL6C 2FOKA 1G8XA 5IOYA 3HSEA 3KPHA 2EZHA 5DYMA 4ID5A 2YJFA 2MBFA 5KPZA 4KJZA 4ILGB 4XIDA 4G7OF 1HKCA 5E1WA 2O9LA 2O03A 4CJUA 5J6XA 1IG7A 4CJSA 1XDUA 5HRPA 4DFPA 1P4WA 4Z0UA 1KAZA 2JVGA 1T08B 1W5CC 2Z33A 3OYIA 1ASWA 1R6RA 2W25A 3VF4A 4J2BA 2UV1A 4DR1K 1L0OC 1Z7LA 5EGOB 2HQRA 4XKVA 1R1VA 3LA7A 4XLEA 4CJVA 5MLCQ 3HRMA 3PO2J 1KAXA 2X78A 3CJNA 4IHSA 1CZ9A 2XGDA 3U3YA 5CVRA 4H0PA 4FLUA 3SYTA 3MKWB 4ISFA 3SAGA 3T3FA 3AAPA 4M3YA 3K0LA 2J5OA 3RVCA 3M8PA 1ITYA 1APLC 2IC3A 5E3NA 3E1SA 4KHSA 1WQ2A 5FKKA 1RR8C 4B1UB 3CF2A 2L9SA 1KVBA 4XSZF 2P5VA 5B8HA 3KZBA 1HKBA 2E35A 2E6MA 4B8CA 1BR4A 3IL2A 2FOWA 1TWFJ 1DGKN 2OV7A 2FJ1A 1REVA 3V8JA 4RB0A 1F4KA 2MLKA 5HLFA 1D8KA 5E3OA 3C3WA 1OJLA 3CTAA 4X64K 2H8WA 2RAEA 3DRPA 1KAYA 5FLXK 5LJVA 3RWUA 3OYMA 4WXDA 1ILYA 4U0VA 2CJJA 1RT1A 3ML6A 4KH6A 4KHWA 4MFEA 3ZSXA 4BU2A 2A6AA 2IA2A 4MTEA 1QSYA 4AQYK 1GDTA 1L3UA 3GLXA 1ZBSA 2UXBK 1NK5A 2EZLA 4Q5SF 2DTZA 2G7UA 3R3LA 2DT5A 3ERMA 2E19A 2PY5A 4U88A 1IV6A 4IHWA 3NGZA 4QS7A 1CLQA 3LP0A 3KWGA 3VSLA 3LM2A 3TW7A 5FRNA 4CIEA 4DSLA 3LDLA 1WBDA 3O8HA 4PSXA 1TNSA 1VQNI 2K86A 4JOMA 4O55A 4DQSA 4BY1J 4LFCK 4BRGA 3C6AA 5AQOA 1RT7A 2O8DB 3T0YA 3OS2A 2L54A 2P9NB 3GEZA 3HM9A 4WCGA 2HOAA 4LG0B 3H08A 3DOKA 4NDLA 4A3JJ 3AV9A 2O8CA 3QIOA 5TRDA 3HG9A 2G8HA 2W4SA 4RG8A 1OYWA 5FO5A 3E5QA 4JYKA 4CCOA 4CW7B 4F93B 3ISNC 2ZGZA 2O0YA 3K1NA 2HZTA 3LOCA 3ZT4A 1IXCA 1MSEC 4U0YA 1BOTO 4F7ZA 3FXOA 4QOZB 3AG4H 1DPUA 1YYVA 3JRIA 4I2OA 3PQJA 4DV0K 3HP9A 3B02A 4IEJA 3VESA 2WFBA 3W6KB 1A35A 4FZZA 1JLBA 3MQ0A 3D0PA 2G9WA 2JA8J 3LZIA 4AHUA 1FOYA 4Y17A 2EFWA 3RYRA 4DUYK 2P9LA 3AAFA 3VEYA 5EDNA 1NU0A 2WBNA 2QQ8A 3H0GJ 2IS1A 2M87A 1DU6A 4NYFA 4X1EA 1KU2A 1LFUP 4Q0BA 3U21A 1XB4A 2Z3YA 1JTXA 4CK2A 3OWTA 1D5VA 2FBIA 4LH4A 2GA1A 4V2GA 1TV6A 2LY9A 3HKZA 5D3GA 4HNVA 2FMYA 2W82A 2Y0SN 4H0EA 3WG7H 4DYQA 3V1OA 3LFUA 1P8ZA 5KPTA 3CCQI 3SBGA 1E17A 4CK1A 2LBFB 3I5UA 1XMQK 3RMDA 3TR8A 3HO1A 2P9UA 4JI2K 1HRHA 3RTRA 1DP7P 4IPAA 3ZMZA 3E9LA 1FXXA 4IO9L 2HR3A 1BHLA 4EJOA 1LJ9A 2DFEA 3A01B 3C6UA 3J7YP 2P9IB 3I56I 3LSHA 1P90A 1ETWA 2K5CA 4HX4A 4A3KJ 1IW7F 2KQRA 1J59A 3Q9VA 2V1XA 2ME6A 1JJ8C 4CJEA 1RUOA 5DUKA 2QWQA 1A04A 2ZJ2A 3V42A 3W2VA 3VERA 4XLAA 4CJTA 5TISC 3I53A 2KQ2A 5AQHA 2I5JA 4M3GA 1WKMA 2LMDA 1U6ZA 1D9DA 2F5EA 2WTEA 5EG0B 2IAJA 3NF8A 4ZDLA 3OJUA 1NGGA 2PAVA 5LY3A 4RB1A 3G6EI 5L3EA 2WOMA 2AP1A 4M9SA 1X9SA 1R7JA 4CF9A 1VRUA 3G25A 3KCCA 1UAAA 4KO0A 5E26A 2EH3A 3TSPA 1VQPI 4P1WA 1UELB 1H8AC 3NAUA 1OMIA 3LPUA 5K7FA 1MBEA 3H3NO 5E8IA 4N47A 4LGWA 2R0QC 3J7AO 1ETOA 4BRCA 1W36D 5HOOA 2HOTA 3OIQA 3GL1A 3CFPA 3CJAA 4I76A 4WFAL 4HNUA 4CJRA 4B43A 5GAGP 5I9EB 4DS4A 4OKEA 4IFEA 3VDXA 2NNNA 1UB9A 4E3SA 3KYLA 2UWMA 2D1KA 2V6CA 1FKPA 3JTGA 2NRXA 1IBMK 4BREA 2G8KA 2OTJN 2RKHA 2FMLA 1A36A 1OQYA 3SQ2A 4FJMA 4I9QA 4JKGA 2VKHA 3OIOA 4C30A 1IC8A 4BBSJ 3AY9A 2X6OA 5GIOA 1OH5A 1FLIA 2H8RA 3RYPA 1N78A 1NGAA 2VQGA 2QWNA 2ZMEB 4MLOA 3O9TA 3I4PA 1A5WA 4NXMK 1X3ZB 3W3CA 1FJLA 1K79A 1X1DA 3M1FA 4J01A 3TAEA 3R6MA 3FMRA 1JKPC 3CMAI 3WE2A 1C0WA 4C2MJ 2KIMA 2VBZA 1RT6A 1VQOI 3B8AX 2Y48A 4R8HA 1OCPA 3WTSC 5HNHA 1SD5A 3BWGA 4OLBA 1JLQA 2L7KA 2P9SB 4FK0A 3UKRA 1IN6A 3GBGA 1W5SA 1YRNB 3UKUA 1C0FA 4NNJA 3PQKA 2D5VA 2V1NA 4JD2B 3FMSA 2YHBA 1J6ZA 3SQ4A 4LF7K 5J1EA 2BVLA 3HOXJ 3GMEA 5IY5H 4FLYA 2VBYA 3V6DA 1W0UA 2NRRA 3VPRA 4FJ7A 2L2OA 1SFOJ 4BRMA 4F91B 2ZQBA 3CO7C 4CYCB 1LPQA 1K73O 3BPVA 4CD3A 5AIPA 5CVVA 5IT9O 3FHZA 5DCFA 3SQNA 4CH7A 4FX4A 3C2BA 5CQEA 4ENKA 3HPHA 1JUMA 1T2KA 2FE3A 2NVTJ 3IKTA 4HQEA 1VI0A 4OINF 2KFZA 1XC5A 1LV5A 1QHHD 2M45A 3OL3A 4CBWA 2JMWA 2DTRA 3KEYA 4JK1X 3MWPA 1OCCH 2H27A 3MX5A 3IRQA 1ZRFA 4LF8K 4L0YB 1ETQA 2IGKA 2HPMA 4DB3A 3BY5A 2CRGA 4XLFA 1E4GT 2LH9A 1ZHFA 3VYRB 3F8BA 1A31A 3TANA 1NMDA 3S1MJ 1Y1WJ 3CUOA 1W7PD 2YU3A 3L3UA 4W1UA 3E5XA 4DR5K 3ZSWA 5L3BA 3MK6A 4I6ZA 3TP3A 2MYSA 2BHYA 4E1MA 2A41A 1U2VA 4CEBA 2HHTA 1I6HJ 4BE0A 3TARA 1MMGA 3IC7A 2UXCK 1NK2P 2O8EB 5GINA 4KITB 4JBAA 1A5JA 4FSVA 5M1NA 3S17J 2DN0A 4GGGA 4BAYA 4R79A 2KTQA 4JKCA 3Q9SA 3T8RA 1TAUA 3RI4A 3WUHA 4PCQA 4H4KC 5FGMA 3TP0A 2Y69H 2A68F 1ZBHA 1LFPA 3ID6A 4Z4IA 3V7RA 1YJ9N 1BBYA 1TKDA 2Z1GA 3CERA 3NE6A 4FLVA 5LJWA 4WQ5C 1S72N 2IVPA 3DTIA 4L5JA 1LVKA 1PP8F 5L3DA 1SL2A 2HQAA 3CMEN 3R60A 4CZZA 2GWKA 1FKOA 1NK7A 2HNDA 4PUSA 4CZMA 2FQ4A 2NVYJ 1RNHA 2ICWG 4FZXC 4CFCA 2Y2ZA 1UJ8A 4AYBN 3AVKA 3S2HJ 3OYFA 1LQ1A 2ASOA 4RB3C 1STZA 4RAGA 5L3GA 1KTQA 5HLTA 3BR6A 1XSVA 4YOUA 2HDDA 3QWLA 1D3YA 1NWKA 2A5YB 2D0OA 2HHVA 2ADUA 2EV0A 3F23A 2VG7A 3ZOBA 3BR5A 4B3OA 2O3FA 5J4VA 2OZUA 3FX3A 1U0JA 3IWFA 3M8RA 4AC0A 3CESA 1TAQA 4CJWA 5LGNA 3THYA 3L2VA 3G2BA 3BR3A 2IA0A 1OR7C 2DO7A 3ZGKA 3PNYA 4E7KA 2DY4A 4CCMA 4G6TB 4GCVA 4P55A 1BI4B 1SMTA 2E5NA 4BRPA 3HHHA 3T7ZA 1GHCA 1LDKB 5C12A 4FM0A 3HSTB 3KP6A 3H9QA 3O3HA 3M07A 3PO4A 2Q2RA 4HOBA 1KZHA 3BCAA 5HDNA 1S1XA 3FZMA 1UFMA 1VQ7I 2YX4A 4B9SA 1R9TJ 4BDYA 4ZYHA 1B9NA 2Y0SA 4Z4EA 3F6VA 4DR2K 4JX6A 2EV6A 4OWRB 1XSDA 2HGCA 1Z6TA 3S1QJ 4DIQA 1OCOH 3DLBA 4EHTA 3RMCA 2PLYA 2KL4A 3N4QA 3OBYA 3Q0WA 1XC3A 3KLEA 4HV6A 5GIPA 2UXXA 3HSCA 2ZJPF 4GW6A 1T6CA 5F64A 1Y0UA 3C7NA 3B73A 1K78A 1WJEA 1RFQA 3Q7BA 3HYFA 4A3LJ 1ZXOA 5K5QA 4DYCA 1RBVA 1YIJI 2FBYA 3DKYA 3SQ1A 2O8XA 3KYCB 5AQNA 3MXIA 2D5RA 4X65K 4YELA 3HOUJ 2V26A 3BQZA 2X74A 2YU9J 2FEZA 4P96A 2X6SA 2HOEA 3B6PA 3ZMTA 3MX2A 2R7QA 4JKDA 4AU7A 3L8BA 4BVOA 2ZE2A 3KP7A 4RAFA 4PGHA 3ASMA 2GXAA 5LHHA 1NLVA 2V7ZA 1QSSA 1VTNC 3PIOF 2XHKA 3CCVI 2STTA 4CCKA 4MFBA 4D1QA 4KHNA 5C15A 2A07F 1I39A 2QQ9A 1S6QA 3ZETB 4FWLA 1IV0A 1MH4A 5ICGA 2O8CB 3GTOJ 2P8TA 3VQPA 3VEXA 1YTYA 2QSFX 4KV8A 1ETXA 2PMZN 1D0YA 4L9JA 1JLCA 2HHWA 3AO5A 3U4LA 1RKWA 1VQLI 4OIRF 4LH5A 4IDKA 2FF6A 2V7YA 1T03A 1HF0A 3P7NA 3TOAA 2F5CA 2WY8Q 1Y0NA 3HTVA 3CD6N 3ULDA 3AAQA 1X1CA 2PG4A 4JI3K 3U6FA 2O8FB 2XV4S 4KAZA 2PZSA 3VQBA 1WUAA 3QEWA 3IRRA 1F1ZA 4ZTFA 2NZTA 1V55H 4A2AA 4LIVA 4DZPA 3QP6A 2MH9A 4H5VA 1WH7A 2NUBA 3TPQA 2OZMA 3ZQIA 4BQAA 4C8KA 3DF8A 3PX6A 1LW0A 1VZ0A 1HLUA 2DMPA 1C1CA 4L3QA 2A69F 1XMAA 1F9NA 3LM9A 4XN0A 4M74A 4Z4HA 3UIQA 4KH5A 4F3TA 1T0FA 4BY7J 3P83D 1NBWA 4HZFA 2QA4I 2E2HJ 3VGLA 3K0SA 2Y9YA 3JRDA 3E97A 5FROA 1J54A 1W9HA 4LK0F 1HPMA 4OJRA 5E20A 4DQQA 3VQCA 3FHNA 3J7YJ 3K5OA 1QBJA 3P9IA 4CIFA 2E88A 3OYNA 4N56A 2GXGA 3HTUA 1UHWA 4HUFA 4R1HA 3CUQC 4L18B 3N05A 4HYEA 1HW2A 4JS5A 3ZMDA 4JHDA 3ROUA 1EH7A 1IRZA 4DSKA 2PQ8A 3PNTA 3AO2A 3AGRA 2WV1A 2MH2A 4BR9A 1FW6A 4X62K 4EV0A 3CC2I 3PO5A 3S2DJ 3ENOA 1SD6A 4ILHA 2Q1NA 1J5YA 4NXNK 1CXQA 3OTOK 2J5PA 4Q4ZF 3A5NC 1KLNA 4B47A 4ZJZA 2JWLA 3HVTA 3C6TA 3TTDA 1HYZA 2DA2A 1MMSA 4MIMA 1IKXA 3GX4X 3K7AJ 3WU0A 5JS2A 2ID6A 1O3QA 2G8IA 1VSFA 1XPXA 2CSOA 4CERA 1HNWK 3O1BA 2XRLA 3QP5A 2X6YA 2ZJQF 5J2QA 1PUFA 2QVOA 1G2HA 3TKYA 3PJRA 2LF8A 5KAFC 1LFBA 4IQJA 2VXDA 5GAGJ 1JT0A 1O3SA 3WNGA 2W00A 2R7ZJ 4J2DA 2X1DA 1CQTA 3HPGA 3BTJA 3LDQA 4MGRA 4JI1K 1L3SA 4RAYA 5ILVA 2QSHX 4B48A 1AKHA 4H8KA 4DTXA 1W7PA 5AQIA 2MLGA 2LNBA 1YE9A 1CF7A 4EMSA 4BQNA 5AIQA 4JKEA 4W5NA 3G1LA 2IS4A 2XY7A 5D5WB 4KIFA 2EK5A 2W42A 1JGSA 3MCAB 5CE3A 1HKQA 1EQYA 2XUBA 2YV0X 1QVGM 2GBZA 2XGXA 3HT3A 1UAXA 4B9LA 1TBXA 3OYHA 2HVQA 4CF2A 4G7HF 1S5LC 4BEHB 3CQYA 3CQ8A 3UKRB 5LGTA 2HDCA 3GFMA 1FNNA 4CZGA 3BDPA 3UKUB 2W85A 3VQEA 4AYBA 2F5DA 1XI1A 1Q8IA 4H0XB 1LNWA 1R1UA 5HVQC 3CF5F 4I09A 4JI8K 4FJ5A 3QERA 4LMYA 3T1BA 4IXCA 3AO1A 2I7NA 3M1EA 1TK8A 5B66C 3H3UA 2OA4A 2WC9A 1BO5O 5CYQA 2FRHA 3E01A 3DXJF 1ZREA 5BR9A 1T95A 2P7CB 2BEOA 4B1VA 4N76A 3A5MC 2DAOA 3J7ZI 4FL9A 3VOEA 4XSXF 3JTHA 2B4JA 3KWIA 3LQRA 3D5RC 1WJFA 4W5OA 2VGMA 5FKNA 3SUPA 3DPUA 4DFJA 4BNCA 5L3FA 1U9NA 4Y1DA 4MEYF 2R7UA 3P38A 2M1BA 4OPKA 3MN9A 2BVMA 1SFUA 3BJOA 3PSIA 5DTDA 5K5RA 3IH2A 2LKSA 2VGNA 2KHOA 2HTJA 2YCHA 4E0DA 2ZXIA 2P9PB 4HX8A 1UOCA 3EPZA 1KA8A 2MA3A 1DP3A 3JAMO 3CCRI 4U87A 1UZCA 1D1BA 2Z1HA 4AF1A 2BXYA 3AVFA 2Y9ZA 4C3JJ 2DCEA 3R0JA 1B1BA 1HBXG 4FVMA 3HPOA 3O6BB 4E6KG 1ZR2A 2V1DA 1TQPA 1A5VA 5KRTA 4FOEA 4D5FA 1KD1O 1YHQI 2ASMA 4OMZA 4DQRA 3WTTC 1BL0A 3RIRA 2BYVE 4M6YA 1RC9A 3CJBA 1HW1A 3E9PA 2FA5A 2VLAA 3C95A 2P6SA 4E7IA 1G3TA 3CLQA 3NH0A 1KU7A 3VWBA 2FBTA 1ETYA 5KHDA 1KYWA 2ZJPL 2NS0A 3IUCA 2HHHK 2IIRA 3ZR8X 4EM2A 2YR2A 5E1XA 4FX0A 4JN4A 1YXQA 3MCPA 1HQEA 1RTIA 1ZRCA 4NYNA 4B9VA 2HHXA 3PSFA 3F6OA 3S14J 3G10A 4LD0A 2P7VB 4RGXA 2CG4A 5J1YA 3UNGC 3LAPA 1EWRA 5F0CA 4F3OA 1R0AA 3WTWC 4DV5K 1ENHA 3LSTA 2VJJA 2JQ7A 3BPXA 4ZYAA 1H89C 4CZLA 4PJLA 5AQKA 1NGFA 1BIUA 2XHBA 1JTYA 3LQQA 3S93A 4OPHA 3R6SA 1J09A 3L2WA 3CUQA 2EA2A 1IN8A 3EE8A 3PIOL 1IH7A 1LKXA 4GV9A 2IGIA 3I56N 4RTFD 2JUCA 5J1UA 4ENMA 3AVNA 4CEOA 2HSTA 3PX0A 1ZYQA 2D1HA 1MWKA 4XONA 2I8DA 1ZK8A 4GKJK 1UG0A 4JKHA 3RR7A 3V7CA 2QTDA 4CJ5A 2YSRA 4WXHA 4FWSA 3WHBA 2VC0A 2NLXA 2E2OA 1ZQ3P 2WBMA 2VE9A 1IXSB 1V5EA 2OPRA 4BXFA 5TGTA 1GLBG 3CDIA 4BKXA 3EEQA 1OCRH 5D5XB 4A12A 1VQKN 3ZP5A 4IHTA 1XMOK 5K1YA 4PL8A 4BC4A 2E36A 1WSIA 1T33A 2K9SA 4OAYA 3ECOA 4A0XA 5HLGA 1HYSA 2LY1A 1ZBUA 3KK3A 1T3VA 2HBMA 4G6DA 4D5CA 4DSEA 5J2NA 1D4XA 2Q0UA 4DQPA 4BRIA 5BPMA 2HQNA 2YKMA 4B9MA 4I6MB 4FK4A 3A2KA 4EQQA 4YOYA 3BCBA 3B6AA 3HZJA 4U7BA 1DUXC 5AQYA 1RDWX 2OPQA 3N4MA 3ASOH 3BR0A 2VOOA 1IAWA 1CZBA 1X1BA 1C0TA 5M5YJ 4I99C 1RBSA 1XHXA 4BH9A 4O5VA 5BNGA 3F0CA 2E8AA 3DOLA 3TI0A 4M6XA 2ELKA 2VL8A 4I0BA 4A6EA 5CJ9A 1JCEA 3OW2M 1N6QA 4F8RA 1M1EB 4DYRA 2XAJA 5LMNK 4B9QA 3DEWA 4JI7K 4S05A 3WXIA 3LSMA 2LSOA 1KQ9A 2ACJA 3I4NJ 3ABTA 1YFHA 3GTJJ 1TT0A 4HDVA 1XX5A 5DMRA 4A0YA 3U9GA 3KLNA 3KEOA 2GM4A 2K9NA 4BR7A 3K9TA 3ERED 3EZWA 1P2FA 5AQMA 4JYAK 2E1CA 3KJVA 1NKEA 1C1BA 2B63J 2NOGA 1JKHA 4DLEA 5KCMA 3W3DA 1WSFA 4HHTA 2COBA 1DU0A 4LY7A 3HEFA 1MU2A 2DI3A 3QYFA 2DDBA 1OYYA 3CZ6A 3KETA 4LFUA 4CF0A 1B8IA 5FFZA 1YVNA 1OKJA 2HVRA 3PV8A 1B4AA 2DJNA 5EGOA 3MFKA 2ZMEC 1EO1A 4C1NI 3MEEA 4OLAA 3GTLJ 5J4YA 2G7HA 3V9ZA 3Q3SA 3RPUA 4NC6A 2FSJA 1NGBA 4DU3A 1NJYA 2HFHA 3O1WA 4IWVA 3OYKA 3H5AA 5BS6A 5H20A 5IP6A 3OYBA 2M8GX 1TWAJ 3L1PA 3IRXA 3BF3A 1MBJA 1WBBA 5EY4A 1JCGA 2ZJQL 1W4MA 1LWFA 4RW9A 5KI6A 1YJWN 1CXUA 4HVJA 1YT3A 1E2XA 3H9JA 2NRAC 1NNEA 1SFXA 5BPNA 1Z25A 3VOVA 3SAHA 4RLQA 1QZEA 4XRSA 5DV5A 5DD4A 3LP2A 4E7HA 4JQFA 5HS7A 5EEAA 3V9SA 2EB7A 1BW6A 3WTXC 1NKBA 1GLJO 4DZJA 1BJAA 3IKVA 4NBQA 4DR7K 2VJ5A 4UNOA 4EJWA 3U8XA 4HF1A 2RPIA 4YG2F 3ULEA 5IT3A 1FMWA 2K3FA 4JS4A 2KPMA 2R7VA 4DFKA 1WLJA 4G94A 2Q8KA 1MMAA 3QB0A 2F6CA 3AA4A 2EBIA 3BEXA 3D45A 2WTUA 3CJTB 3WTYC 4JHDB 5ERIA 1DEJA 4E89A 1F36A 2PYLA 2B0LA 2DK8A 3FKJA 2OQGA 2QKMB 5D8LB 3RTVA 2GA2A 3JSMA 1ZG3A 3LPTA 5AQVA 2PX9A 4PA1A 3SEZA 2OTLN 5K7HA 3WG9A 1NG7A 3OHRA 3F9MA 3JRCA 1CGPA 4FE7A 3MKLA 4IOXA 3GG4A 4JLHA 3ISPA 3UKGA 5C3EJ 4NO7A 2HYJA 4P9UA 2EIKH 1D9FA 3F3XA 2R7RA 2O8DA 5F6FA 1XN7A 2P9NA 3QNNA 3I55N 4XBFA 1JJ6C 1UCRA 3NRVA 2EPFA 4B3SK 3M7GA 3SUNA 1D5YA 1YLFA 5E84A 2FNPA 4AHCA 4OPJA 3L00A 3ATVA 4CK3A 3LDSA 3LWMA 2HEOA 2HBLA 4U7DA 1WSHA 3GTQJ 4AWXB 3ZX2A 3CM6A 1MWMA 4UUSA 3DXMA 1AKHB 1L3LA 1G3YA 1BCMA 1W7PB 2VQFK 1VSKA 1R5ID 4JAXA 2D4WA 4FK2A 1CF7B 5BR8K 3DLEA 1RPWA 3ABLH 3LSKA 4BHBA 2XY5A 4FWKA 3O80A 2E60A 1TL3A 4DKWA 2XAUA 2Q2EA 2UU9K 5LHIA 4BACA 1FYMA 4CGHA 1USTA 3WXJA 3F8FA 4B1ZA 3JW4A 2ASPA 5IYCJ 1I94K 4UVBA 3S15J 3ZEUA 1NGCA 1FYKA 1E3PA 3E3VA 2QBYB 4KREA 1B9MA 1RILA 3RRGA 4PZJA 4K43A 2XPWA 4M3UA 3RKQA 3K70D 2XF6A 1R4NB 1KLMA 1JHFA 3LDOA 4MDBA 3KZZA 1P9QC 3Q0VA 3JR9A 4Z94A 1YW9A 1ZG1A 4IKFA 2E2QA 3A01A 2QM3A 1VQ4I 2FUG2 3FXRA 2IW5A 5IOZA 4OIPF 2P9IA 4LK1F 2CUJA 3AKZA 1MDUB 2BUPA 2A6TA 3THXA 4YFNF 2QWRA 5JHFA 2CQXA 4LLGF 2OZSA 2XRNA 4CEZA 2Y0MA 3R0AA 1O4XA 1T7PA 1FTZA 3SJHA 1RBTA 1WNSA 2QKLB 4BC3A 3FXMA 3TAFA 1VQ7N 4YEJA 2ZJRL 2PI0A 4HWIA 4C8MA 4HQMA 2CGLA 5LBQA 3L2RA 2KZMA 2LKPA 1Z05A 4E1NA 4ETSA 3TU5A 3K4BA 5EG0A 2C6YA 1JXEA 4HSTA 2DA6A 4KMUX 2KLAA 1SZ2A 2QQBA 2K40A 2DW4A 5HDKA 3KKSA 1O13A 4A59A 2L9RA 3BROA 3JRHA 4XK4A 5JS1A 5FPDA 1BA1A 4PJNA 3L9FA 2LDUA 4XRMA 1U48A 5AQJA 1GVJA 5H2FC 4HBLA 1LWCA 2LVSA 3K10A 1ZG5A 1S3JA 5DDGA 1LUJB 2E1MB 3ID8A 1SVLA 2E7WA 5M1KA 1JLFA 2CQ7A 3F8NA 4CF8A 5M1FA 4PJMA 1NK9A 3V8LA 1EH6A 3RMBA 1EH8A 2XASA 3H1QA 4M3DA 5KRSA 1IBKK 4B44A 4DR6K 1IJWC 3CFRA 3U1DA 5D5VB 3DXKA 4CIGA 1SV5A 1ETKA 3K5LA 3J8AA 1QVFM 2AJQA 1T38A 3KK2A 1Q1HA 3M3YJ 2HF3A 1MW7A 3MWMA 4KHYA 1CZAN 3KLOA 5BMZA 3P39A 4K41A 1IG9A 3SI6A 4ZZLA 4XH1A 1SAXA 3GE1A 5M1QA 4J19A 4IVNA 4EM0B 1YTAA 3CCYA 1UWBA 5JHUA 5F04A 5GTIC 1G4DA 3OY9A 5AQWA 4QCLA 4DV1K 2Q0OA 3THVA 1VQLN 4D7NA 4Z6YA 1Y56A 4RDUA 1FY7A 2BGCA 1X1PA 2IPQX 2PMHA 2ZBKA 3HKZN 2F5VA 3HSRA 3U3GA 1D8JA 2KZVA 4HV5A 4MLHA 5H6QA 1XGOA 5M5XJ 1TW2A 1BQNA 1TWGJ 2DLLA 5LMUK 3J81K 2WUSA 3I0SA 5LL6Z 1FZPB 1O7FA 1KSPA 3K69A 1YRNA 4RGSA 4B3AA 4XQFA 4CJQA 4YIRX 2XROA 3G73A 1Q81O 4G8XA 3CCLN 4B1WB 2VB6A 3DI6A 4FVUA 2JA2A 1GLNA 3G1OA 5LRSA 4E7JA 2CH0A 3AVMA 3M9AA 3ZQLA 1BC8C 4BRAA 2R7XA 3EUHC 3X2QH 5JR3A 1GLCG 3HP6A 4IG3A 1U4BA 2F9TA 3D5SC 2P81A 1B59A 4B9TA 4CEAA 1BGXT 2DMNA 4AHSA 3N4PA 4B3TK 3T8TA 5IT9Z 4V2FA 4ZZDA 1VNDA 1XMXA 3BF1A 2B9SA 1Q82O 1JT6A 3CJQB 1DQUA 2XF7A 2IOCA 4EZ9A 2V7FA 1S1UA 2KZZA 5AJ3K 4M7XA 2KHMA 1Y1VJ 3PFIA 4ENJA 2O4GA 1K9MO 2VKDA 2K02A 3CJ1A 1OVYA 1YG2A 2LP0A 2ME0A 2L4MA 1WJBA 4B3XA 4JRPA 2IVNA 1BOBA 2OQRA 2DBBA 4F92B 1WSEA 5GPAA 3ALYA 4OIQF 5D6EA 3MMVA 2DQLA 2KKOA 4IRGA 2E4LA 1B72A 1VF9A 2M4KA 3KFWX 4E70A 5DUIA 1YO5C 2XVCA 3QEXA 1VSJA 3CCEI 2PMUA 3DV8A 3V4IA 3BZCA 4EHUA 3QEPA 2IS6A 3DQVC 3TABA 4KHUA 3CC7N 1Z0XA 3HUGA 3FXQA 2M2EA 2EIMH 3I0TA 1FBSA 1YITN 4U67L 2CGKA 4NQWB 5KPRA 2LTPA 4CZHA 4B9UA 3L6QA 4BUPA 3QEIA 5GAHP 2HYFA 2QI2A 4BR4A 2TCTA 1NK4A 3AG3H 1VQMN 2KIQA 3P9KA 1YUWA 4UHTA 1XC9A 2EFOA 1V4SA 2X85A 4O6JA 2R7WA 2P0WA 2UYTA 3O9UA 4AD9A 1K61A 2HS5A 3P31A 4N4NB 3OSGA 3NH1A 4DV3K 1FT9A 1XGMA 2GLOA 1IKWA 1TC3C 2G8VA 3VQ8A 1JKRC 3DAWA 3M8SA 2CV1A 3DU6A 3VFZA 3EKUA 5E79C 5LEJA 3QU6A 1WI3A 2M0MA 4ZHRA 4OX9K 4FJLA 1X9JA 4LLLA 2E2NA 4FJIA 3FZKA 2OPTA 3HOSA 1FEXA 2MGQA 1QZ6A 1YJNN 5AQLA 3ABUA 3LSRA 5K5OA 5D8KB 1PDNC 2QWMA 2IDOA 3C7JA 4DV7K 3HOVJ 5C25A 4ELTA 4DR4K 2ECBA 1YI2N 3VF2A 4FWRA 4O8UA 1B8IB 4ILJA 3NCIA 2FSKA 3FWEA 4XL9A 3OOUA 1RBUA 2V9KA 1N33K 1QHTA 3KVGA 4QS8A 3FM3A 3LFKA 4GNIA 1BA5A 2E5LK 1ZKGA 4JV5K 1BUPA 2RV8A 3MN5A 3K57A 3PIPL 1R4MB 2A5XA 4WYBA 1BI4A 1LCUA 3TBIA 2AXLA 3S3NA 3K2AA 2NRTA 5J2PA 3S32A 5AZIB 1JE8A 3NBPA 3O9RA 4M3TA 2V52B 4UUVA 4AUXA 4LOCA 2CV2A 3AVHA 3J7AP 2KW4A 3MXJA 4AM3A 2VONA 3SPYA 4AVPA 3FFKB 1U8RA 2R7TA 2KMUA 1IDZA
chains in the Genus database with same CATH topology
3C2GA 1BL3A 4E19A 4CIFA 2VJ4A 4FJNA 3OYNA 3BC8A 2BE2A 3ZXSA 4N56A 2LY2A 3BLYA 4XNFA 3MAQA 4HUFA 3AVAA 3N05A 2F4IA 4JS5A 4II2A 4BL0B 1T8EA 2R4GA 4DSKA 2G8WA 3PNTA 3AO2A 3DRSA 2JGUA 1B9DA 5SWMA 2ITGA 2FC0A 3TAPA 2XY8A 4DBRA 3PO5A 2VPLA 2CW7A 3AVLA