1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Integrase
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
4IFVA 5J2PA 1IO2A 4B9TA 2OA8A 4FYDA 1RDDA 4OPJA 3OYFA 4Z4FA 4RW4A 1NK4A 1B9FA 1G15A 3ZSXA 5I42A 4NCAA 3VQ8A 3ZSWA 4E7KA 3LZJA 2XY5A 3AVHA 5KGWA 3NGIA 4I2QA 1WSJA 3OY9A 3P1GA 4FLTA 3PY8A 3OYHA 1BQMA 4N41A 4DF8A 4OJRA 4DU4A 3S9HA 1JXBA 2KQ2A 3NH0A 1DTTA 2OPRA 4DTJA 2EX3A 3AVMA 4CF0A 3BGRA 4GW6A 1TV6A 2IOCA 4LSNA 4L8RB 4FLZA 1JLCA 1LW2A 3QERA 4LH4A 3OYBA 4I2PA 1SL2A 3RMDA 4HUEA 3OS1A 4CK3A 4ID1A 1L3TA 3HP9A 4BE1A 3HPOA 4Z4IA 1UAXA 4F8RA 1RBSA 3DLRA 5JS1A 3TARA 3QIPA 4KO0A 3KLEA 4O0IA 4RW6A 4KTQA 4J2AA 2FBXA 1ZBUA 3KK3A 1NK0A 1NK6A 4W5NA 4Q0BA 1Z26A 4KHWA 3PX6A 2IAJA 3QNOA 3V1QA 2OZMA 4FW2A 2D0BA 4B9NA 4N56A 2R7YA 3HK2A 3VQ4A 1CXQA 4DTSA 4W5RA 4FM0A 4K8ZA 1J9AA 2BGGA 4CEBA 4RG8A 5EU7A 1BCOA 3U3GA 4CEQA 1N6QA 2PYJA 3NCIA 4FLXA 1FKPA 2HB5A 5I3UA 4E0DA 3SPZA 5J1EA 1JLGA 3VQ9A 1RT1A 4CHOA 3PO5A 1RNHA 5E41A 4DTOA 4IBNA 4Z4HA 4CHYA 4AILC 2PYLA 3KLFA 1ZYQA 1Q9YA 5C24A 3TAMA 4E7JA 3TABA 3SZ2A 5CZ1A 1ASUA 2BANA 1S1TA 3AVGA 1S6QA 1VSHA 3PUFA 4B08A 4DFJA 3S3NA 1MU2A 4E7LA 4CJFA 2KZZA 1TKDA 3ITHA 3T1AA 3JYTA 1LAVA 3M8PA 4CJ4A 4FLYA 1VSFA 1GOAA 1S1UA 4W5QA 2QK9A 1CLQA 1SUQA 2GBZA 2XRIA 1D9DA 1ZBHA 2Z1GA 1QS4A 2YNFA 3LWMA 4EZ6A 4J2DA 1J54A 3L2RA 3SQ4A 1TKXA 3NDKA 3F73A 4BDYA 2PY5A 1TAUA 1IKVA 1T7PA 3MXMA 4ZTJA 4DLEA 3OYDA 2HMIA 3QEPA 1DLOA 4CEOA 4F3OA 3DRPA 4CHPA 3AVIA 3HVRA 1L5UA 4KHQA 4FJNA 4O44A 4IDKA 1EXQA 2FBTA 3LPTA 4M3UA 4M3YA 5CZ2A 4DU1A 1NJXA 2DFFA 5FRNA 5HRPA 2G8IA 2X6SA 4CGHA 4PY5A 1KFDA 3K58A 4N76A 2OYQA 2ZE2A 3C6TA 3LPUA 4KV8A 4UQGA 2HNYA 3K5NA 4KB0A 2HHSA 4RW8A 3VQBA 3HPHA 4FLWA 3RMCA 3ZT4A 4XIUA 2P51A 4OKEA 3DOLA 1BI4A 1S9EA 3P83D 4CCHA 1X9SA 1NJYA 5KI6A 4DG1A 3QESA 3QO9A 3KK2A 3RR7A 4KREA 1I3AA 4Z0UA 1KRPA 2IGIA 4DTRA 3C95A 1U48A 3AO5A 1I39A 3L2VA 1WAFA 4E89A 1U04A 4B8CA 3VA0A 3TR8A 4FJMA 1VRTA 3M8QA 3ALYA 4CHNA 4E7IA 2IS3A 2DFEA 3RMBA 2XY6A 3RTVA 3PO4A 3KD1E 1JL1A 5HROA 4DWIA 4OKKA 1D8YA 4FJ5A 2FC0A 4CJPA 4ID5A 1Y97A 1C0MA 3DLGA 3IG1A 1SL1A 1BHLA 1QTMA 4M42A 2HHVA 3V9UA 2QKKA 1N5YA 3SUNA 4CHQA 4OLBA 1XHXA 3LANA 1RBRA 3LAMA 3CYMA 4CFAA 4CJQA 4JRQA 1SKWA 2DFHA 4O5BA 3AVAA 1JLBA 2HVIA 1ASWA 2F8SA 4DSKA 3VQQA 4BDZA 4CF8A 4Z4CA 1QQCA 4DSFA 2JLEA 4CFDA 4FJ9A 2WONA 1RDCA 4NCGA 5FROA 3OS0A 2G8FA 1SKSA 3IRXA 3LALA 3C94A 1J5OA 3VQCA 3SJJA 1ZBIA 3CM5A 4CF1A 3OJSA 5DMRA 3V1RA 2QXFA 2YHBA 3O4QA 3K5MA 4DQRA 4EP4A 3VN5A 3AO3A 3ZCMA 3SYZA 4ICLA 4DQQA 1WJDA 1VSEA 4AHUA 4FJIA 4GVMA 4FJJA 3F9KA 4H4OA 3VQEA 3B6OA 2IC3A 1NOZA 3K2PA 4I9QA 3V4IA 3AVCA 5KGXA 4KHUA 4JRPA 1U4BA 3QEWA 4CF2A 1HNIA 1NJWA 1KLNA 4KHSA 5D3GA 3HO1A 3O3FA 1VSLA 3ZSRA 1RT4A 3AVJA 3OYCA 1SV5A 4FW1A 4DSLA 4AHCA 1HRHA 1ITGA 1GOBA 4CJVA 2VG5A 2YKNA 4DFMA 2JGUA 2A1SA 4TSXA 4CEFA 1X1PA 4PA1A 3WNGA 4AHVA 4CHZA 5HLFA 4CJUA 1RTHA 2P1JA 4MFBA 5CY4A 3OYKA 4F2SA 4HCBA 2KFNA 2WOMA 2YHAA 4F4KA 5C42A 1L3VA 4R5PA 3IAYA 2RF2A 1WJAA 4DQIA 2X78A 1VRUA 1QE1A 1RILA 3NE6A 1C1BA 2BE2A 2G8KA 1QSYA 2F8TA 3HJFA 2HHTA 4HUFA 2Z1JA 1NK5A 1JKHA 3KKSA 3AVNA 3NFAA 4KTZA 1UA0A 1KSPA 4B9VA 1JL2A 4Z4GA 2YKMA 3HVTA 3ZSVA 2O4IA 4OGCA 1JLFA 4CJ3A 1KLMA 4O4GA 1VSDA 4DFPA 3TI0A 4IFYA 1WJBA 1RBTA 2HW3A 1W0HA 4HTUA 3ZSYA 1L3UA 3AA3A 2OPPA 4M3XA 4KI6A 1B9DA 1KVBA 3DOKA 3SNNA 1YT3A 4E3SA 4DTNA 4C8OA 4E1NA 5FRMA 4PQUA 1T03A 4CEDA 4FJ8A 3SI6A 4J2BA 4FM1A 4QAGA 1JLEA 3NF9A 3NAEA 3NGYA 1E0EA 4C8KA 4ELTA 1J53A 4H4MA 2YNIA 3AVLA 4DTPA 3OYAA 4C8NA 1BIZA 4FLVA 1U47A 3KIOA 4JLHA 4BDPA 2NUBA 4FK4A 2HVHA 4KPYA 4N5SA 3KLIA 1WLJA 4IG0A 4E7HA 1WSFA 1RDAA 3LP1A 1C1AA 1NK9A 4DFKA 4BE2A 3NF8A 4CECA 4DSIA 1S9GA 1WJCA 3DRRA 3L3VA 3AO1A 1HPZA 3QLHA 1JXEA 3V6DA 1LWCA 5J2MA 3AO4A 1EETA 1TGOA 1SKRA 3BDPA 4AHSA 3S3MA 3K59A 2P5GA 1XI1A 4FVMA 3WNEA 4Q5VA 2QKBA 1BI4B 3IS9A 3V9SA 1S1WA 4M3ZA 3VA3A 3KLHA 2A1RA 4NCBA 1C0UA 1RT7A 3AVKA 3WNFA 1LFPA 1Q8IA 1A5XA 1RT5A 1WSIA 1C1CA 2OPQA 1TK8A 1NKCA 4FJHA 3DMJA 3AO2A 3QEIA 2RPIA 4CEAA 5JS2A 2Z1HA 5SWMA 1QSSA 4M3RA 3VQDA 4ELUA 3ASMA 4RW7A 4FXDA 3C6UA 4M41A 4HHTA 3SUOA 2RN2A 4CJKA 4M3TA 1RT3A 1BIUA 5HP1A 1C6VA 4CIGA 4W5TA 3HL8A 5KTQA 1UWBA 3T19A 3LP2A 1R0AA 1WAJA 2Z1IA 3ISNC 3HT3A 1L3SA 1FK9A 3QETA 1A5VA 4CEZA 1CXUA 1EX4A 4AHRA 1IG9A 2HHXA 3D0PA 1RCHA 2B5JA 2Q3SA 3L3UA 3L2QA 1NK7A 1QSLA 4B9SA 4DQSA 3V9ZA 5HRSA 1TKZA 3K5OA 3L2WA 3MEDA 2P5OA 3DLHA 3OYMA 3HM9A 4KTWA 1UA1A 4QOZB 4O55A 2HHUA 1IH7A 1KVCA 1HQEA 4CJTA 5CYMA 4LY7A 3VQAA 3PX0A 3KTQA 4LH5A 2BDPA 4CJSA 1KFSA 3RWUA 3DLKA 3NBPA 3O4NA 4ELVA 4H8KA 3SCXA 2KTQA 4Z4EA 3RR8A 2KFZA 4M3WA 3QNNA 3CFPA 2HNZA 1W9HA 4HUGA 3S3OA 2GUIA 2E4LA 4KKOA 3EYZA 4CK2A 3NGZA 3ULDA 3NHGA 3A2FA 4C8MA 2RKIA 4FLUA 4B9MA 4I9LA 3CM6A 4F3TA 1RTDA 4OPKA 3U6FA 1UOCA 5T7BA 1YTAA 4DF4A 1WJEA 3THVA 2B4JA 4DSJA 3SQ1A 3QEVA 4HVJA 1T8EA 3CFOA 3NH1A 1WN7A 3LZIA 3OYIA 3KK1A 4DTUA 2VWJA 4BE0A 3V81A 4KRFA 2G8HA 1BL3A 3DRSA 3I0SA 3LP0A 4EP5A 3OYNA 1RBVA 2VWKA 3PX4A 3I0RA 1O1WA 1XHZA 4QCLA 2Y1JA 2E6LA 4E1MA 1TVRA 1SL0A 3E01A 3D45A 3VQ6A 3AVFA 3SQ2A 5KRTA 2ZQBA 1YTUA 4DTMA 3OYLA 1KTQA 1NOYA 4FJXA 5J2QA 3UIQA 1RDBA 3DI6A 3SPYA 3T3FA 4J2EA 1X9WA 1XC9A 1EKEA 4CJRA 2EHGA 3TAPA 3SQ0A 3HSTB 3TANA 4B3OA 3MXIA 3TAFA 4FJ7A 1HYSA 3V1OA 2ITGA 1U45A 1JLQA 2LSNA 1ASVA 3LWLA 4KAZA 4FCYA 1BGXT 3NF7A 2HHWA 1FKOA 1HMVA 3KJVA 4BWJA 1HJRA 3VQ5A 2G8WA 3U3YA 2D5RA 4CIEA 2VG6A 1GOCA 1FXXA 3AA2A 3OYEA 3ZT0A 3TAGA 1WJFA 1VK0A 3H08A 3QIOA 4CFBA 2ETJA 4CGJA 3K57A 5J2NA 1B92A 3M8RA 2G8UA 1KONA 1TL1A 4K8XA 4C8LA 3HPGA 1VSKA 1WSEA 4IG3A 4CGFA 4CE9A 2GV9A 2VG7A 4CGGA 4E19A 3O3GA 4BACA 4DQPA 2FBVA 4FJGA 4CFCA 3MECA 4DSEA 1CZ9A 1TKTA 3RRHA 4FK0A 4Y1DA 4W5OA 1D5AA 2F96A 3ZT1A 4YNQA 2I5JA 3M8SA 3AV9A 1IKYA 4FJKA 4NYFA 1ZBFA 3ZT2A 5KRSA 4JS4A 3DYAA 4M45A 3CQ8A 1TK5A 3CFRA 1EP4A 4FZXC 3AA5X 1S1XA 4ZHRA 4CK1A 1CZBA 3SUQA 1S1VA 4EZ9A 1BCMA 3LAKA 1TL3A 3TAEA 5CYQA 4CJ5A 4DTXA 4Y1CA 2DY4A 3VQPA 1KVAA 4CF9A 1BQNA 4CEEA 1HQUA 2XY8A 4I7FA 2AJQA 2O4GA 1S5JA 4OGEA 2PZSA 2D0AA 2XO7A 2HNDA 3LP3A 4B8AB 1JLAA 4OLAA 2D0CA 1KCFA 1NJZA 2G8VA 4CJWA 1ZBLA 1RTJA 4OKJA 1MW7A 1K6YA 4AHTA 1TK0A 3MEGA 3DLBA 2DTUA 3OJUA 5FDLA 4FJLA 1VSJA 1RT2A 3EZ5A 2W42A 4PWDA 3KD5E 3O3HA 3SV4A 3TWHA 1REVA 4FZYA 4F3QA 1LW0A 1LWFA 1S6PA 3P5JA 4CESA 3NH2A 3SUPA 1NKEA 1RTIA 5K14A 2KW4A 2OZSA 1HNVA 3OS2A 3KLGA 1LV5A 3HYFA 3MEEA 3QINA 3ZSQA 3CG7A 2XHBA 3G10A 3V9XA 4DMNA 2B6AA 1YVUA 4JS5A 3VQ7A 2E6MA 3AA4A 3L2UA 1VSIA 3RMAA 4KB1A 4FZZA 4WE1A 3ZSOA 4CGIA 3MAQA 1IKWA 4KHNA 1HYZA 1Q9XA 2YNGA 5HRRA 4BWMA 1RT6A 1NK8A 3ZT3A 3I8DA 4B9UA 3OYGA 3WNHA 3LDSA 1VSMA 4LD0A 1T05A 4B9LA 3EY1A 3PV8A 1F21A 3G0ZA 4CGDA 4DS5A 3ZSZA 1XWLA 1HYVA 4AH9A 2KZMA 3TAQA 2X6NA 3K5LA 2ATQA 4DS4A 4HCCA 3FFIA 1X9MA 4KFBA 3JSMA 1LWEA 1WNSA 4YFUA 4G1QA 3RRGA 4LSLA 4N47A 3OVNA 3QEXA 4CJEA 4DLGA 4RW9A 2XY7A 4CJLA 1IKXA 3HP6A 1QHTA 4CIFA 2Y1IA 3MXJA 5SZTA 4ZTFA 1Z25A 3KKRA 1D9FA 1LAWA 3AVBA 3L8BA 3NF6A 2FBYA 3DM2A 5HRNA 3SV3A 4IKFA 5DK5A 4MQ3A 4CERA 5C25A 4FM2A 2HHQA 2YV0X 1RBUA 3HXMA 4F2RA 2IDOA 4DU3A 2X74A 4OVLA 4PUOA 1U49A 4KHYA 5HBMA 1WSHA 2YNHA 3OYJA 4NYNA 1C0TA 3V9WA 1WSGA 3B6PA 1TAQA 4O0JA 4FK2A 1DTQA 2OPSA 2ZD1A 1NKBA 4KI4A 1BISA 4GMJB 1A5WA 3DLEA
chains in the Genus database with same CATH superfamily
1IO2A 4CCOA 2WC2A 2R7FA 3KLOA 1RDDA 3U21A 4BG8A 3CCVI 4OPJA 1NK4A 3MEXA 3ZSXA 5K7FA 4WFNL 2CUFA 2P9UB 2R5YB 2OV7A 1FP1D 3ASNH 4KT5C 3A01B 4E7KA 1VQ9I 2Z9OA 1EQYA 3LZJA 3N4PA 3NVMA 3V7RA 2L9RA 4FISA 5CJ9A 3G71I 3JTGA 3OY9A 4I2QA 2ZGYA 4WCEL 3BQZA 3NGIA 3Q0VA 5LEJA 4FLTA 1WI9A 4A57A 4BR2A 2O8BB 5BS6A 1XNQK 3T1BA 2NNYA 2CV0A 1X3NA 1E3MA 3OBYA 4M72A 4DF8A 1R4MB 4OJRA 3CCSI 3HTSB 2KQ2A 2M30A 3NH0A 3A0HC 1EH8A 4V2FA 3E6MA 2K3FA 1NBWA 1SS6A 2NRHA 3H3OB 4MIMA 1KQ9A 3TEDA 3BGRA 2B9SA 3EN9A 4PL7A 5IYCJ 4HDVA 1BIAA 2GXBA 5AQUA 2RGVA 3ZMSA 5ERIA 4JI8K 4PL8A 2HOAA 4F93B 1ZREA 1LW2A 4I2PA 4BQZA 2UU9K 4DBQA 2P4WA 4IXAA 3OS1A 4IZZA 1LB2A 3C6AA 3HRTA 1ZLKA 3FXKA 4KT6A 3HP9A 4JHDA 3J7YP 2DMQA 3MKWB 3JRIA 1UAXA 3DLRA 3HPOA 4F8RA 4WXCA 2R7UA 3RPQA 4LF6K 4BRHA 1P4WA 5JR3A 1D4XA 3KLEA 3F6VA 1PDNC 3J7YJ 2QWPA 5BRDA 4J2AA 2FBXA 3KK3A 3OA9A 1TNTA 2RNGA 2F5EA 2XPUA 4CK3A 4Q0BA 2JA6J 4BH9A 3DXKB 1B1BA 2F4OB 3R60A 2VL8A 4FW2A 3DU6A 2NNNA 3VEOA 2JWKA 4DTSA 4W5RA 2O8DA 3MKZA 3O9TA 4MLEA 2E60A 4CEBA 1S6LA 1R1UA 2KLOA 4H5RA 4CEQA 2HHHK 3G2BA 1P6RA 1V3FA 4DZJA 1H89C 1A36A 1HJOA 1MMDA 4E0DA 1FKPA 4BUPA 5ILUA 3N4MA 1R7JA 2XHKA 4XRSA 1JLGA 1YJ9N 2IA0A 2DJIA 5E1XA 1K9MO 4EM2A 1I6HJ 3S8PA 2GZWA 5AJ3K 1Q86O 3KLFA 4QIWN 4WQ4A 4OLBA 1ZYQA 3K69A 5EGOB 3ZQLA 3FZLA 4KUMA 4I0BA 5CVIA 2AS5F 2BW3A 1XN7A 4A5MA 1DQUA 1S6QA 4B08A 4I99C 4A2AA 3O2PE 1MKMA 1PP7U 2HYFA 3HRUA 1T44A 1Y0UA 4Z2YA 2HOTA 4FLYA 1B9NA 2OZUA 1W4MA 2VPRA 5LHGA 1O3QA 1LAVA 1GOAA 3Q0WA 4A2BA 4CJ4A 3H6EA 2QK9A 1CLQA 3HBLA 5JI6A 2YNFA 1OCCH 3F0CA 1OH7A 3FM3A 3U1KA 2DXIA 3F73A 1MJAA 1K8AO 2PY5A 2R7OA 1BR1A 4EM1A 3ZCOA 2HOEA 4ZTJA 4V19K 4YOYA 2HMIA 1DLOA 2M4KA 2OZSA 2IS4A 2ACJA 3PO2J 3ENOA 3FK6A 4MEXF 2Q2EB 1Z7LA 4IHWA 4KHQA 2YJEA 2CW0F 3QRFF 4M3UA 1BR4A 3F23A 2CQNA 1NJXA 2DFFA 4B3XA 5FRNA 2G8IA 4I98B 4LFBK 2UXCK 2VB6A 5HS9A 1F9NA 4PY5A 4N76A 2VC0A 4KB0A 2A5XA 2VN2A 2GWKA 2CW8A 3E1SA 4FLWA 1Q7YO 1LUJB 3RCOA 4XIUA 3IKMA 1IN4A 1RTDA 2Y0SN 2FLOA 1FJLA 3J7ZO 4PSWA 1ZBSA 1N32K 2H1LA 3QO9A 4KBOA 1W36D 2M7AA 3KK2A 1P7JA 2A69F 4JI7K 4KREA 3O08A 4Z0UA 2ADUA 2IGIA 4DTRA 3G6EI 2QWWA 2I5UA 4IX7A 4LB6B 3IKTA 1I39A 3L2VA 5AZIB 2O0YA 3VA0A 5BQTA 3BTLA 2E2NA 2MLGA 3M8QA 2BTFA 3GTMJ 4CZEA 2K9LA 2YX4A 2DFEA 4CI6A 3CZ6A 3KD1E 4CD1A 3EO3A 3T5XA 1JL1A 3HOYJ 5HROA 4DWIA 2FC0A 4CJPA 3QAHA 1QTMA 2DJNA 4XOPA 3V9UA 1LDKB 1JT0A 4NXMK 1ITYA 1X1BA 4KFCA 4CHQA 3SUNA 2GM4A 1XHXA 2ZSIB 1RBRA 4GKJK 3SDBA 2MLKA 1SKWA 2DFHA 2Y75A 2A6AA 3PIPF 5IY5H 1NK3P 4FASD 1FOKA 1MDUB 2F8SA 5E18F 5J47A 5FD5A 1IDYA 4LG0A 4EJWA 4DSFA 1QQCA 4XOTA 5ICGA 4FWNA 1MIJA 1BA1A 2WONA 3U2RA 3I55I 2DA4A 3C7NB 4BC3A 4G7OF 2GWRA 3HUGA 5FROA 1RDCA 3FZHA 4IJNA 3IRXA 3LALA 3J80Z 3C94A 5AQTA 3EE9A 3CM5A 4CF1A 3LAPA 2XUBA 4H5WA 1J5EK 5DS9A 3DXJF 4I6ZA 3OMYA 3CUQA 1GLCG 2E88A 3GDQA 3G6EN 4B3SK 5EZGA 4EP4A 1HKBA 3ZCMA 3SYZA 4MFDA 2E1NA 4GVMA 3D5RC 4JN4A 4MDAA 2EINH 3B6OA 4RB2C 3AVCA 3DFGA 1U2WA 1EF4A 2Q8KA 2VIXA 3CIPA 3ZX2A 4CF2A 3KP3A 3HO1A 4O5VA 2EFWA 3HXLA 4Y13A 1ERDA 4M71A 2Z3YA 3WGIA 4CHUA 4FW1A 3GW2A 3I58A 4QWQA 4DSLA 1BJZA 2FOKA 2JMWA 2M45A 4RAFA 4AU7A 2WAQN 2VG5A 3BJOA 3OOPA 2ZMEC 2YKNA 3TDUC 4AHVA 1NLVA 1VQ5N 3HOZJ 5FPEA 5JVGL 2W40A 2FF6A 3C1DA 3CO7C 2P1JA 4JYKA 4JD2B 2X6OA 4S0HB 4A93J 2JA5J 4QS8A 5C42A 2C6YA 5J4YA 1L3VA 3TTCA 2M7BA 4CO8A 2R7TA 3H9QA 3SHFA 3CCJN 2X85A 3WEEB 4YIRX 1YJNI 4HF1A 1DPRA 1RILA 2XB0X 3GE1A 3N05A 1C1BA 2HHTA 1QSYA 5F0HA 2K7LA 1MNDA 3LSRA 2HZDA 4BJTA 3SMSA 1NK5A 2FX0A 2LMDA 3AG3H 1QRYA 4CCKA 2X51A 4IRGA 1HBXG 2YKMA 3HVTA 1DGRM 5KPZA 2L7ZA 2WTEA 5CE3A 4V19S 1YJWI 4BRGA 3TGNA 5AR0A 4PFPA 3D7EO 3HSCA 3F8FA 4CZLA 4IF4A 5JHUA 4IFYA 4K25A 1FBSA 2V1UA 4UNOA 2HW3A 3VEWA 4ILHA 3FISA 2JN6A 5HL7L 1YT3A 3P9CA 4QS7A 2H6CA 4E3SA 4XIDA 4Q5SF 4E1NA 4DR5K 4XM3A 1IG7A 1R23A 4AC0A 2QBYB 2JJ7A 3T8TA 3SI6A 6PAXA 1Z05A 4M6YA 3OIPA 4UXNA 1TQPA 1EWRA 1JLEA 2GX9A 4MQ9F 1E0EA 2VPLA 2EWSA 4H4MA 3NAEA 4ELTA 5D6FA 4ZZLA 4P5OA 2YNIA 4RGRA 4C8NA 2P6SA 3CMAI 1HDPA 4B1XB 1U78A 4M3BA 5LD2C 4JKCA 4CBUA 3G73A 1XC3A 2ESHA 2FOWA 4CCLA 4E7HA 4CZZA 1WSFA 1RDAA 5JVTA 2A6TA 4KITB 4BE2A 3ZEUA 2MYSA 4UVCA 1JJ6C 5HLIA 1WJCA 1KU9A 3CCUI 3NF8A 4DV0K 3S1MJ 1JXEA 1TGOA 3S3MA 1OJLA 5ICCA 5FB2A 5AQPA 4FVMA 3WNEA 5LL6Z 2BBYA 3KP5A 4CGZA 3IS9A 3WU1B 4E6KG 2KT0A 4O8UA 1YW8A 4DUYK 3RKYA 3EZWA 3AVKA 4DBRA 1RT7A 1ZARA 1E3PA 1WSIA 1RT5A 4PGGA 2L0KA 3W2AA 2M2EA 4BG9A 3CCQI 2RPIA 5JS2A 1OH5A 4JHDB 3GCMA 4M3RA 3CCSN 3WE3A 2QWRA 2XSDC 2WB1A 4XH5A 4GYGA 1IDZA 4FXDA 3C6UA 4M41A 4CJKA 3LOCA 3T1HK 2O4IA 1K6OA 1RT3A 4OMYA 2E2HJ 4BHCA 3CC7N 4U67L 4A0YA 4EJUA 1NGAA 1BBYA 3KP2A 2CV1A 2O8CB 4XRFA 1UWBA 1RIOH 1WAJA 5L3FA 4B1WB 1DUXC 4IHXA 3VFZA 2ZMEA 5FLXZ 1IGNA 1XCBA 3IAS2 1RUOA 2HDWA 4NQWA 1CXUA 2Q31A 3U9GA 4AHRA 2HVRA 3P31A 1LEAA 1OPCA 2Q3SA 3L3UA 2V79A 4EV0A 2KIFA 4DQSA 3V9ZA 1ETYA 5HRSA 3IAM2 3GTOJ 1QQNA 2LY2A 3M8EA 2VQCA 1H8AC 2KLAA 4CW7B 4XRMA 1IH7A 2HHUA 1DGWY 1OYWA 4I7HA 4CJTA 3LSMA 1X3ZB 4Z94A 1M1KO 1I27A 3ZEUB 1KZHA 4C9YA 1YIJI 4CJSA 2QM3A 4X1EA 4BRIA 2KTQA 2EQRA 4BNCA 3AAQA 4CZFA 4GV6A 5DD4A 5AQLA 2IS6A 1KU2A 3EYZA 4RCHA 4CK2A 3B73A 3AAPA 4IHTA 4C8MA 5FKKA 3T1YK 2EA4A 4F92B 1K78A 1TNSA 3ZQHA 4EVIA 5DV5A 4ZH4F 2W85A 3QU3A 1IRXA 3AKZA 5AQXA 3A5NC 4BL0B 4EM0B 3FMSA 3UB5A 5AQGA 3QEVA 1OYIA 2KJCA 3WU2C 1NMDA 4HVJA 1LV5A 3CO6C 3S1RJ 4OIRF 4DTUA 3LZIA 1W5SA 3KK1A 3G25A 5DYMA 2P0WA 3MX5A 3JRHA 4LF7K 2G8HA 4C3HJ 1RESA 2LD5A 3I0SA 3EQLF 3LP0A 1U0JA 1T8IA 1RBVA 2HBKA 2EFNA 2VWKA 4EP5A 2XAGA 2ZJPL 1ZKGA 1XHZA 1I5ZA 2VBZA 1F4KA 1TVRA 2GTDA 3CJBA 3R1XA 1SL0A 4UUSA 1NMNA 3VODA 1VQ8N 2ZQBA 3G1MA 4FJXA 3VOVA 4RMNA 5DCMB 3DXMB 5J2QA 1B9MA 3DEEA 1XC9A 1EKEA 2ESNA 1X9WA 3QYEA 2L7MP 4NNJA 5AQVA 2BVMA 3TAPA 4O6JA 1EH6A 2JUCA 2R5ZB 3HRMA 2IGNA 3FXLA 4XLPF 2Y9ZA 2FU4A 2ZC2A 1JLQA 2LSNA 2IPQX 1FTTA 5JLWA 4H5NA 1BGXT 4JNEA 2Q1ZB 1PVEA 5C3EJ 1FKOA 1HMVA 3KJVA 4BWJA 1WGXA 1PUEE 2ASPA 2JK3A 4XKVA 2JVHA 3IMXA 1KAXA 4DR4K 3LAJA 3E9LA 2D5RA 4CIEA 4CJ7A 1GOCA 3FXUA 1SFEA 4XLAA 2HNHA 2WAFA 1VK0A 4JK8A 1K83J 2R7DA 3TAGA 3VEPA 1B92A 4Y4RA 2G8UA 1KONA 2VBXA 5EEAA 2LOOA 4RAYA 1VSKA 3O1BA 2ZJQF 3PNTA 2D1VA 3QFUA 4IG3A 3QBXA 4CGFA 4IOAL 1ODDA 2FBVA 2Y69H 1CZ9A 4ZZDA 2BOLA 4XK4A 4MO5A 4FK0A 3B6AA 3Q7BA 2ISYA 3BC8A 1D5AA 2ZSHB 1ZR2A 2DMNA 2OZ6A 3ZT1A 1I94K 3LSHA 3RJPA 4AF1A 2HU9A 3SXYA 1ZBFA 1NU0A 2UUZA 2EV6A 2DQLA 3CJ1A 3HGGA 2IGKA 3TQNA 1ZN2A 2V1NA 3CFRA 2WADA 2HS5A 2R7SA 3JW4A 5JLHA 3SUQA 1EA3A 1FC3A 3CDHA 1B72B 2VBYA 5AQSA 2A42A 4EGZA 1Z0XA 4BYYA 3ESWB 1T95A 3IRRA 4IOAF 4UY8O 4KIBA 3BQYA 3LL7A 4Y1CA 4CCJA 3QPHA 4IO9L 2G7UA 1KVAA 4CF9A 1IN7A 1TC3C 3IKVA 3FWEA 3CMEN 2UXBK 1YF5L 1S5JA 3R6SA 2D0AA 4XSZF 3CUQB 3H92A 1IN5A 4WXHA 1V4RA 5D4SA 1XSDA 4B8AB 4PJNA 1ETOA 1KCFA 2RV8A 2D0CA 4CJWA 2G8VA 2CQKA 1UG0A 4M3FA 3AL0B 4OKJA 4R8HA 1TK0A 3G1OA 3D1NI 3P9KA 2A5WA 1T08B 2KQRA 1EV7A 4II3A 2OANA 2ZJRF 3OIOA 2KRCA 3OJUA 5FDLA 2VQGA 1VSJA 1RT2A 2W42A 3FGUA 3KZZA 5E3MA 3O3HA 4BRCA 4FZYA 4F3QA 1LW0A 4CESA 3BR0A 1AA7A 3A5LC 3QINA 4BRLA 3RSNA 3H3NO 4DB3A 3A2KA 1KQ0A 5HLGA 3CG7A 2R5ZA 3AFHA 5IPAA 2XHBA 4GVEA 1SAUA 1MD0A 2ZKZA 3HOWJ 2YI1A 2E6MA 3AA4A 3VQ7A 2H94A 1IN6A 2GOXB 1NGDA 4P96A 3I56I 3MAQA 4KHPK 1FLIA 2ISZA 3LM2A 4I02A 3K1PA 3O6WA 4UV9A 1HOMA 3FDYA 4BWMA 2JRTA 2LNBA 2P9IA 1S3JA 3WNHA 3LDSA 2BY0A 5EYRA 5FKNA 4B9LA 4IEEA 1BI2A 1F21A 1YG2A 5C15A 4CGDA 4DS5A 1ZRDA 2CS3A 1NGFA 4UUSB 3J80O 2BXZA 5FPNA 2LVSA 1XMOK 2O9LA 4I0AA 4D7MA 1WB9A 3N97A 1F5TA 2WY8Q 4XKCA 1QHGA 4RGXA 5CVJA 2ME6A 2KISA 3N4QA 3DPTA 1WPKA 2EIMH 3H35A 1JGSA 2I7PA 1OISA 2XY7A 4I76A 1FTZA 1R5ID 3D2FB 5TKYA 1GLJO 3CC7I 4LG3A 4B3RK 1IKXA 3QYFA 1AKHB 3IC7A 2KFDA 4D5FA 1JKPC 5AQKA 3GLXA 3UKRB 3CJAA 5E79C 2EZKA 4ZTFA 5KCMA 3X2QH 5SZTA 4LMYA 3TOAA 1PUFB 5CVVA 3OSFA 1TWCJ 2K86A 3WT0A 2M1BA 1RETA 1R58A 1T6SA 2H6BA 5AQHA 1OYYA 1NGHA 2P9LA 2QYOA 3MDQA 4MQ3A 4CERA 4FM2A 3BR6A 3HXMA 3A5MC 2LP0A 2P81A 1P8ZA 2B0LA 2X74A 3R3LA 1U49A 1JUPA 3S15J 5JICA 1OLTA 1C0TA 2BYVE 3EL2A 2DK8A 4FVUA 2OCEA 4AIDA 4AM3A 1WBBA 4BEHA 5BMZA 1VAZA 3SMPA 2ZD1A 5I9EB 2O8CA 3BG3A 4HV6A 1Y1WJ 1SD6A 1HYVA 3DLEA 3GOIA 3I56N 3NRVA 2ZXJA 2BH1A 1X1CA 3HM8A 1BOAA 1BI3A 1HKSA 5HNHA 1B9FA 3WXLA 3R4KA 3ZSWA 4CJQA 1ETKA 1KYZA 1BI1A 2DA7A 2E7WA 3I71A 1BIBA 5CQGA 1IAWA 5J2NA 2GIVA 1Z21A 3BT9A 4K2EA 4IRHA 2QSFX 4BXFA 5F27A 3O1WA 3DV8A 3ZMVA 3J80K 2EPFA 2D2WA 4A6EA 2NZTA 5IT3A 3JSOA 3FBNB 5K5QA 1N78A 5HDNA 2EX3A 2RVCA 3AVMA 5GADP 4YOWA 3P9IA 2OC6A 1NTCA 5F08A 2IS1A 1O3TA 1TV6A 1OQYA 2IOCA 3I4NJ 4FLZA 4L8RB 2HBMA 2P9NB 4JKFA 2ZJ2A 3L0QA 4ESBA 1W5CC 1TWHJ 3PFYA 3OYBA 5LRRA 1ZRCA 3MN7A 2LKSA 4HUEA 2K02A 2R3SA 5GTHC 3RMDA 5D5UB 4BE1A 2RE2A 1NNEA 1E2XA 2PMHA 4BRNA 2XF6A 1R1VA 3CLQA 1OR7C 3BY6A 4I01A 5JS1A 3KX2A 3QIPA 4KO0A 2B63J 3JS6A 3S41A 4AM7A 5EOYA 1NK0A 3KP4A 2KDOA 2ZJQL 3DJCA 3VGLA 3KLNA 3JRFA 5BR8K 4A6DA 3PX6A 1T33A 4KHWA 4WXDA 3CF2A 1W97L 2OZMA 1G3TA 1RZ4A 2LC2A 3L7WA 3OWTA 4FO0A 4N56A 1BG3A 3VQ4A 3EETA 1CXQA 2Y0MA 1NGGA 3VPZA 5BREA 4FM0A 4XNFA 3MK6A 5JMVA 3U3GA 1BCOA 2XAHA 1F1ZA 2PYJA 4LF9K 2P9LB 3SZTA 4E7ZA 3DCFA 3NCIA 5K5RA 2CU7A 4CD3A 4FLXA 5I3UA 2IP2A 4BS9A 1JHHA 1R5HA 4JYAK 2VGMA 1X19A 2EIKH 5J1EA 1MBGA 4JP0A 1RT1A 1FIPA 4JI4K 4CHOA 4ENJA 3TSUA 4OIPF 1JKOC 3HTUA 1HC8A 1S22A 2QWNA 4IBNA 5AQYA 4CHYA 4AILC 2PYLA 2M5WA 2CO5A 3EKSA 5M1PA 1Q9YA 3TABA 3GTQJ 3CC2N 1P9QC 2GAUA 4W1UA 5K7HA 5CZ1A 1S1TA 3GZ6A 1IZ1A 5BRFA 2F2EA 2XV4S 3FMRA 2HKXA 1TKDA 3ITHA 3M3ZA 3MZYA 4RAZA 1Z1DA 3PSFA 4UVBA 2FEZA 2PBIA 3FXOA 1T39A 3O5BA 4A62A 3HL2A 2AQFA 2E7XA 1D1AA 2RREA 1SUQA 4B1ZA 4WQ5C 4A3JJ 2Z1GA 4IOXA 3I55N 3LWMA 1D9DA 1CQTA 1J54A 4CSWA 3NDKA 2E8AA 3ZMDA 2R4GA 3MXMA 2CWEA 2L01A 2RN7A 1LCUA 3J7AO 4IJAA 3BY5A 3CJ7A 4CEOA 5D4RA 4F3OA 4A69C 1GXQA 3E9PA 5J40A 2D4WA 2W1OA 4XR6A 4DNCA 3R6MA 2A5YB 1G4DA 3LPTA 4MGRA 4IDKA 4O44A 3J7ZI 1HR0K 5C0YA 1HNXK 1GXPA 4D9JA 1Y8QB 4EQQA 4A3MJ 1U8RA 1LQ1A 2PMZA 1B59A 4BBSJ 5FLXK 2X6SA 1IBMK 4WWCA 2BW3B 4PJLA 4TV7A 5GPAA 4A3GJ 1KFDA 3K58A 3C6TA 4KV8A 2HNYA 3DLAA 3VTHA 4EIAA 1R71A 2E1CA 4RW8A 4I09A 1J59A 1G3YA 4F7ZA 3VQBA 3AG2H 1BI4A 1S9EA 3LMMA 1RRJA 4BC2A 4HPQA 1X9SA 1VQMN 4DG1A 2XPVA 3QESA 4Y3OA 5F1JA 1YHQN 1UHMA 2CFXA 2P9KA 4RBOA 4BRDA 1YUWA 1I3AA 3RR7A 3EE8A 3L6QA 4B9QA 3I3LA 2CUZA 4XMYA 4KMUX 3H3ZA 5GP9A 3CCYA 4F91B 3JRDA 4H0YB 4IXCA 5EVZA 1WAFA 4E89A 3GL1A 3OW2M 1NG9A 3BP8A 5LGNA 3VSLA 1RNLA 2GLOA 1RKWA 4BVPA 4NB5A 4CHNA 4FJMA 3ZN1A 1YE9A 1IRFA 4E7IA 4EJVA 5EGOA 3RMBA 1O3RA 5FD6A 3QPSA 5GINA 4FT8A 4XICA 5M1QA 2CFOA 4QPOA 3L4QA 1Y97A 4ID5A 2L7KA 1HNZK 1BHLA 1J09A 3LDOA 2HHVA 2QW9A 1QVUA 4XLFA 3CDLA 5E1ZB 4A3IJ 2VUMJ 4CZHA 1N5YA 1BN5A 2KHMA 1QA6A 5C4JJ 3CYMA 4H0VB 4JK9A 5FFXA 1BO5O 4YORA 3GUDA 3G4SN 3AVAA 1JLBA 2F4MB 4HX7A 2OCCH 4MTDA 1YYVA 4DJAA 3RVCA 2R7XA 3VERA 2AP1A 2UXXA 1RR7A 4BDZA 3PFIA 2MFZA 3WGHA 4CFDA 1G8XA 2YX7A 3BR5A 4FJ9A 5HODA 2FBIA 2LDUA 4C3JJ 4YFXF 2UZKA 1JJ2M 2DDAA 4HDUA 4PHTX 1BDGA 4PDKA 1ZBIA 4A0ZA 2D5VA 1G2HA 2QKLB 4C2MJ 4U0VA 4MDBA 2A05A 3M4OJ 2DOFA 2H09A 3DBLB 1IF1A 3VN5A 4FJIA 1XC5A 3LDNA 5B3SH 4AHUA 4FJJA 3VQEA 3HDDA 2IC3A 5BPMA 1NOZA 4AD9A 2K9QA 4L0YB 3BJ6A 3K2PA 3V4IA 2W82A 2EV5A 4A3BJ 3QEWA 4DGWB 2LG4A 2Z33A 4KHSA 1POGA 3O3FA 1VSLA 3QU6A 3JAMO 4L5JA 4B3TK 2VXDA 2QUFA 3FM5A 3ZMZA 1A04A 1YO5C 5TRDA 2V6EA 1HRHA 1SV5A 3ZMTA 5DM6F 1B4AA 3OSGA 1FNNA 3H3UA 4CEFA 1TP4A 5J4VA 5HLFA 3WNGA 1HSTA 4B47A 1S3XA 2L9SA 1JUMA 4CHZA 4CJUA 2F4VK 1RTHA 4BQQA 1IN8A 4F2SA 3IWFA 3DPUA 1VQ7I 2E2IJ 4EFHA 2YHAA 2P9UA 1BJAA 1P92A 2ZJRL 2RF2A 3E66A 4G12A 3IH3A 3W2VA 2V52B 1VRUA 3CCMI 2W00A 3NE6A 4XKWA 1E3HA 1H88C 2BE2A 3HJFA 2ITMA 4HRIA 3A03A 3WEEA 4BRFA 1KSPA 3NFAA 3AVNA 4KTZA 3OIQA 5DD8A 4B9VA 1U5TC 3ZYYX 4Z4GA 5IOYA 1BW5A 3ZSVA 3E0JB 5GAEP 3J81O 3THWA 1YRNA 1SFUA 1J75A 1TBXA 4BRQA 3PNYA 1R9TJ 3K70D 1KLMA 3K2ZA 3TI0A 2IA1A 3BZ6A 2ETHA 1WJBA 3RPUA 1RBTA 4XONA 3VGKA 5FLVA 3CQZJ 4IO8A 4D5CA 1LFBA 2P7CB 4KI6A 1BWFO 1KVBA 2YHXA 3BCBA 1ZGWA 3SNNA 1MH4A 3W6KB 1UG2A 4KMFA 1ZTRA 3LWFA 2ECCA 2GOMA 2E36A 4MNUA 4CEDA 3S32A 1V5FA 3MN2A 3P4IA 4FM1A 2JWLA 5LLQA 3BZCA 3NGYA 4C8KA 2RHKA 5KK1A 1ZR4A 4A2UA 5GADJ 2P7VB 5HLTA 1LPQA 1VQ5I 5ICEA 1C0FA 1KAYA 3I59A 5M1FA 1BIZA 1V54H 3PL8A 1S72N 2EV0A 2EZIA 2VQLA 4AVPA 4BDPA 3WGGA 3MCAB 4JQFA 4KPYA 4JI3K 2HVHA 2IEKA 1OH8A 1GVDA 2CGLA 1WHUA 1WOQA 1C1AA 1N25A 2P9PA 1HW2A 3DBHB 3FF5A 1NK9A 3WTZA 4WQ5A 1S7AA 3BR1A 3K4LA 2HSTA 1Q1VA 4DSIA 3H1QA 3V6DA 1EETA 2HEOA 3HZ6A 5GAGP 3K59A 4QPQA 2HF3A 1XI1A 2NVXJ 4LLNA 4MLHA 2V9VA 1J2XA 3I5UA 1GLFO 1S1WA 4KNYA 4ON0A 2QWMA 4XEIA 3PQKA 1VQPI 3FBIB 3AARA 3THWB 4O8KA 3WNFA 3HYIA 3MFKA 1TK8A 3V4GA 1R1TA 1TQIA 3W3CA 4C3IJ 2P6TA 3ZOBA 3CCEI 4JKEA 1YX5A 2GA1A 3AO2A 3ZQFA 3LL3A 1Z67A 3JAMZ 5AZJB 3RZDJ 3QEIA 1QSSA 5K7ZA 2DDBA 5FLXO 2HTJA 3RKXA 3HOTA 2DAOA 3MKYB 2YJFA 3SUOA 5IYDJ 2KMUA 3I0TA 2ID6A 1BR2A 3FXMA 5L3CA 2IVPA 5C2DA 2JZYA 1N8RO 3F3XA 3HI0A 4FWRA 1P4AA 1F36A 3ISNC 4KH5A 3HT3A 2DU9A 1BC8C 4EAHD 4CA0A 1A5VA 1K4SA 2KKZA 5FO5A 3P38A 2HHXA 2IJLA 4B3AA 1Q18A 4YIIA 1MDMA 3L2QA 4XSXF 3CPEA 1QSLA 4NQWB 3JRBA 3VDXA 3MEDA 4CYCB 3W2WA 1MJBA 2FA5A 3OYMA 4JV5K 4QOZB 4GV3A 1KVCA 1AWCA 4PKIA 1JKRC 5CYMA 1FBUA 4X62K 3CUQC 2EA2A 3J81Z 3SLCA 1JTYA 1TW3A 2G0EA 5F64A 2DLLA 4LH5A 2CH5A 2BDPA 4II2A 2CW7A 3FHNA 4H8KA 3OR2C 5IP7J 3CCJI 4M3WA 3C7JA 2KFZA 5M5YJ 5LHIA 2O8XA 1FSEA 4LITA 4U87A 1ZH5A 2L7FP 3ULDA 1WKMA 3A2FA 2DT7B 5LGTA 3H0DA 3ABKH 2VONA 4H4KC 4FLUA 2M4GA 2XGDA 1ETQA 2G9WA 3CM6A 1VQ9N 1ETVA 3JXUA 3VEXA 4OPKA 3U6FA 3K9KA 3I4PA 1YTAA 3THVA 5IT9K 3M1EA 4DSJA 3C7NA 1G3SA 4RGUA 2KRFA 3TMOA 4FX4A 3S16J 1UJ8A 4B1UB 4DV5K 2DA5A 2CMPA 3GZNB 3KCCA 4Z6YA 3VSKA 4AIKA 2O61A 2V7ZA 2R5YA 2VWJA 4BE0A 5LEKA 3E9OA 3HRSA 3HSFA 3HHHA 3DRSA 4IEIA 2XASA 1U9NA 3OYNA 2YX6A 3BG5A 4YOXA 1O1WA 1KQSM 3O9RA 4LIUA 2E6LA 4E1MA 3AVFA 1JT6A 5E1WA 3GVAA 5HOOA 3ZMUA 4DTMA 1YTUA 1KTQA 5E20A 3PM1A 1NOYA 3SPYA 2FXAA 2HQNA 3C3WA 3T3FA 2NOGA 3U9DA 4CJRA 3S17J 4JKDA 4B3OA 3TANA 3TOBA 1VI0A 3V1OA 2ITGA 2IRFG 1OCZH 2D1HA 4QTRA 1DU0A 1U45A 1D1CA 2EH3A 2K9MA 1D0YA 1ZC6A 2XKPA 2YSRA 1DPUA 2HHWA 1T56A 1SMTA 4LLGF 2EWNA 2XB5A 5J8FA 2HKOA 1K73O 1FP2A 3TPQA 2KIUA 4UB8C 2P9KB 3VQ5A 5EX5A 1L3LA 3NWTA 3D2FA 2W7NA 3WG7H 3WHBA 3P7NA 3T19A 4U7DA 1LJ9A 1TUUA 5GIOA 2O8BA 1WJFA 2QCOA 2ETJA 4IWVA 4K8XA 3VWBA 2GIZA 1UELB 3Q7CA 3QYBA 4L9JA 3M8RA 4C8LA 2OD5A 3HPGA 4YOVA 1OR7A 1RDWX 4CGGA 2H8WA 1WJ5A 4E19A 2V1DA 5GAEJ 4ITVA 3CLOA 1OMIA 5HDKA 2AHQA 2ELJA 3ZP5A 1YITI 4W5OA 3DLLF 4M63C 2I5JA 3FXJA 3M8SA 4FJKA 3TP0A 3TW7A 4NYFA 4JAXA 3Q0UA 5KRSA 4M45A 3CQ8A 3SAGA 2HOSA 4GFBA 1VQPN 3IUOA 2A6HF 4O3MA 4KA4A 2QQ8A 3KYLA 4ENKA 3HRGA 5GPCA 4LB5A 1W7PA 1YIJN 2JT1A 2COMA 4CUGA 3IL2A 2E19A 1N36K 3O8HA 5J3LA 1SVOA 3HEFA 5EDNA 3KZBA 1SANA 3TAEA 2LTPA 4DTXA 1HKCA 2DY4A 5BPLA 5L3DA 5C10A 1BQNA 4KISA 1IXSB 4H0PA 2UUAK 2AJQA 2DO7A 3RKWA 2O4GA 3VESA 1QGPA 5BR9A 2XO7A 1XMQK 1T3VA 1S72I 1U6GA 3F72A 4Y0WA 4RB0A 3IWZA 1CGPA 3DKXA 3CJ9A 4XQFA 4YDUC 5AQQA 5AQFA 1RTJA 1NM1A 3FK7A 4AYBA 5EG0B 1ZBLA 1VNDA 4L9TA 2DTUA 1WI3A 3HOXJ 3Q9SA 2GXGA 3CHWA 2KDZA 4AQYK 1RDUA 3GXOA 3HGYA 5B5EC 1HPMA 2UWMA 3P5JA 5C44J 1LWFA 3SUPA 1BM9A 1NKEA 2X6XA 2YPRA 2KW4A 4CH7A 4BHBA 3ERMA 3OS2A 3CF5F 4ISGA 3ULEA 5JVHL 3ZSQA 4HG2A 2GXAA 5CR4A 2AQEA 3L4IA 2AXTC 1ON1A 4I2OA 3BTJA 1YVUA 4JS5A 3RMAA 4KB1A 4FZZA 5CQEA 5M3FJ 4A59A 4WQ4C 2JWTA 1SC7A 4KHNA 2GUPA 3BG7A 2STWA 1HYZA 4JI2K 3GF2A 2ZJPF 2O3FA 5HRRA 1RT6A 1LFUP 3CJNA 2EIJH 1D0ZA 3I8DA 4B9UA 3OYGA 4WF9L 1T05A 2E1MC 3LSIA 4M74A 3MZ8A 1YVNA 1HSJA 3BEXA 2V1XA 4M9SA 1FYKA 4B43A 1XWLA 3ULEB 3ZSZA 1KAZA 3CPWM 3Q5FA 3TAQA 5IT9Z 4LK1F 2ATQA 4CGJA 3CTAA 3CD6I 3F8BA 4HCCA 4GCVA 4WFBL 2WUSA 1L0OC 4KFBA 3WTSC 3JSMA 2K9NA 1W0UA 4G1QA 1S7OA 3CJRB 4XBFA 3RRGA 4LSLA 4N47A 4HSTA 5KPTA 2RC4A 5LMNK 3ELKA 4K43A 4ASNA 1EWQA 3ML6A 1MMAA 3FKJA 3D2EB 3E5QA 4BROA 2QWOA 4DV4K 2QM1A 4JBAA 1MBEA 2M0MA 1QHTA 3H5AA 1APLC 4CIFA 3TW6A 3O6BB 1LKXA 2DYRH 2X48A 1Z25A 1C0WA 3KKRA 1X1DA 2P9IB 2K5CA 4FPBA 2DMPA 5KAIC 1LAWA 1D9FA 3BZKA 3NF6A 4EHUA 3S2HJ 3J7AY 3CP8A 3K1NA 5L3BA 5HRNA 3SV3A 1FOXA 4L3QA 1JHFA 2ASOA 5AIPA 2XGEA 5KAFC 1RBUA 4RLFA 4LLLA 4RB1A 2IDOA 4DU3A 1SD7A 3RYPA 1JXSA 4XLEA 2UUCK 2FSWA 3DTIA 3PQJA 4AIJA 5D8KB 1MWKA 3DKWA 1JUSA 2XDVA 4KJZA 4MO7A 3FZVA 3MN9A 1GHCA 3V9WA 3CUOA 2JA7J 1A35A 2OPSA 3H9JA 2MA3A 4KI4A 2O7OA 4BQNA 4GMJB 5IP6A 5ILVA 5J2PA 3OYFA 2G7HA 2NVQJ 4Z4FA 1XG1A 4RW4A 5I42A 4NCAA 3QWLA 1HKGA 2HPIA 1SEUA 3HSEA 2HZTA 4OINF 1MMGA 3HSRA 3AGKA 4HF0A 5K14A 2J5OA 3AVHA 1GV5A 4ENMA 1IG8A 2FBKA 4FQGA 1WSJA 2ZO4A 2NXNB 3BTIA 2V9PA 2VJJA 3I8BA 4U88A 3PY8A 4HYEA 2VKVA 3C2BA 5M3MJ 2FMLA 1QQMA 3PO3J 1GUUA 3M1FA 1DT9A 3S9HA 1LE8B 1AOYA 3ASOH 2QEXI 1DTTA 1JXBA 2XAUA 2OPRA 4DTJA 2KKOA 2A61A 1R59O 3C0BA 1Y1VJ 4BHPA 2NRAC 5J1RA 4LSNA 1X4PA 3RTRA 4EJTA 3H46O 3CCLN 4ZC3A 2VJ5A 2JA2A 2Z16A 5LFAA 2D1KA 1IRGA 3FHZA 3GFJA 4LH4A 2CGKA 1N75A 4YHHK 3BLYA 1SL2A 1XD7A 3AGRA 5LJWA 3RDIA 1VQMI 2LK2A 1FT9A 5LHHA 3KHYA 2EBIA 1WZ2A 1JCEA 1K8KA 4FWLA 4ILGB 2PLYA 4A61A 3THYA 4JI1K 3D6RA 3TARA 1ZG3A 4Q47A 4HNVA 4O0IA 4RW6A 4XLCA 3EUHA 2VOOA 3GLLA 2VQHA 4A3FJ 3LQRA 4M3DA 1ZBUA 4KTQA 1NK6A 3CDIA 4C2UA 1GLNA 4BR5A 2YHWA 4WYBA 3T69A 2OTJN 2IAJA 3DP7A 3NEUA 4Q48A 3V1QA 2YU3A 4AWXB 3FZKA 4IL6C 4B9NA 1G99A 3FZFA 2R7YA 3HK2A 5E26A 1T6CA 1J5YA 4OMZA 5HS8A 4K8ZA 3O80A 1J9AA 3CESA 2BGGA 4RG8A 2HYJA 4BBRJ 5EU7A 1Y56A 4BQAA 1FZPB 1TW2A 3LA7A 2HYGD 3BR3A 1NGCA 3GMEA 2HB5A 1IG9A 2JQ7A 1IJJA 3VQ9A 3C2GA 5KQ8A 3PO5A 2M8EA 4ZJZA 4DTOA 1FIAA 5E41A 3FZMA 1U3EM 4Z4HA 5B1BH 3OBWA 3CCEN 3F22A 1J9IA 3A0BC 1WQ2A 2NRRA 1D8KA 5C24A 4LFAK 2ZBKA 3K10A 3SZ2A 3RPUD 3VYTB 1V5EA 1ASUA 4ZYDA 4M7XA 2HBLA 3PUFA 4DFJA 3S3NA 4E7LA 4CJFA 2KZZA 5TGTA 1X1AA 3T8RA 1YAGA 2WAQA 3CC4N 2OF7A 3O8GA 4KH4A 4DV7K 5BPIA 3M8PA 4A3EJ 1VSFA 1S1UA 3G4SI 4H0XB 2FRHA 2GBZA 2GWJA 2QEXN 4FWMA 1ZBHA 4W97A 3IH4A 3ZQGA 2PN6A 4FE4A 4J2DA 2PX9A 3SQ4A 2TDXA 4BDYA 2O8FA 1T7PA 4GKKK 2KRHA 1IV8A 2QVOA 1Y8RB 3ONQA 3MD2A 4HOBA 4ESJA 2VXZA 3CMMA 3SQNA 1A6QA 3K4KA 3CCRI 3K2AA 2NS0A 2NRXA 2PI0A 1MWMA 1QZYA 3DRPA 4PKGA 3HVRA 1L5UA 1VQLN 4D1QA 4M3YA 4CBWA 1SD4A 2XPWA 2FBTA 3H36A 3WTWC 5CZ2A 4DU1A 2X1EA 2UXDK 1S29A 2Q0RA 4P55A 2O8KA 2GEMA 5C12A 2ZE2A 4UQGA 3K5NA 5AQOA 1BA0A 3SEZA 2Q2EA 1RR8C 2P51A 4DQ2A 4IFEA 4OKEA 4CCMA 3K4BA 3R8EA 3TSPA 4QSHA 3P83D 4BR4A 1CZAN 1NJYA 5F6FA 3KEOA 3HOSA 2E20A 3FFKB 1KU3A 3ZQ7A 4HV5A 2OTLI 2XAQA 3AO5A 3C95A 1U48A 1TT0A 1V55H 2M34A 1SFXA 2E2PA 3MVPA 1U04A 3WTYC 4IDHA 2DA1A 3TR8A 1QZ6A 1OH6A 1ETXA 2KZGA 1ACIA 2R7RA 4H0EA 3SJMA 1IC8A 3QICA 4DCHA 1MA9B 2IS3A 2XY6A 4G9ZA 3PO4A 3CCMN 2GQQA 4XL9A 2H8RA 4HQMA 3TKYA 4OKKA 4QS9A 4CZIA 1D8YA 4FJ5A 2VE8A 1S8NA 3QP6A 3IG1A 4RGSA 4M42A 1XMKA 4XN3A 3C65A 4DUZK 2NYXA 2ASMA 1KU7A 3IFRA 2I10A 1MBHA 1M1EB 1K78B 1Z77A 1K7AA 3LANA 3LAMA 4K42A 4O5BA 2HF4A 3M7GA 4B3MK 1BUPA 1TWAJ 4M9ZA 1NWKA 2COBA 3GFLA 4P1WA 3CQXA 3VQQA 4DSKA 2DFIA 2WBMA 4CF8A 4Z4CA 5F04A 2V7FA 3FMQA 3DWLE 1U9OA 1UZCA 3B02A 3CJQB 4BKXA 3CC2I 1I1SA 1OKJA 4OPAA 2DTRA 4DHYA 3L9FA 2VQFK 3OS0A 1AKHA 4BEHB 2G8FA 3U4LA 1SKSA 5B66C 5FPDA 1XGOA 3SJJA 1ORKA 3VF2A 4JI0K 4HF2A 4GYIA 3DKYA 5DMRA 2XGXA 5D5VB 1MDMB 3V1RA 4A3DJ 2QXFA 2MW8A 2YHBA 1NGEA 3K5MA 4DQRA 1U8BA 2R93J 4ZYAA 3AG1H 5K1YA 4ICLA 1VSEA 4DQQA 1L3TA 2VKEA 3D2EA 4H4OA 4N9IA 3I4MJ 3DLLL 2Y9YA 3VYRB 4WCGA 1ATSA 4JRPA 3SDGA 1V4SA 1U4BA 3FXQA 4L5IA 5D3GA 3W6JB 2O03A 1NJWA 2W41A 3ZSRA 3OYCA 1S9HA 2CG4A 3AVJA 4PQUA 4B8XA 1GOBA 1ZYRF 3LSGA 4AM6A 2BHYA 3WQUA 3ERED 3WTTC 3HOVJ 3S1NJ 1X1PA 4PA1A 4TSXA 3G71N 2D45A 1QU3A 5E3OA 4HTLA 2VKDA 4BRKA 3WTVC 3G3ZA 3OYKA 1O3SA 1K61A 1DEJA 3EUKL 4MFBA 2M8GX 5DM7L 2WOMA 1YI2I 5LJVA 1QO0D 1TLHB 4R5PA 3IAYA 1WJAA 4Q4ZF 5M1OA 4DQIA 4FPAA 2X6YA 2X78A 1E4GT 3B8AX 2ZXHA 4BAYA 3ZN0A 4G7ZF 1QE1A 3DWLA 2WAEA 3BOQA 1QVTA 1GDTA 2QQBA 2VJ4A 5LRSA 3MWPA 3HZJA 3MZHA 4GY2B 2PBDA 3VF6A 2PFUA 3K0LA 3NVKA 1LVKA 2L3DA 3F21A 3MQ0A 1YJ9I 1J6ZA 3KKSA 1FOWA 3E6BA 5L3EA 1QNTA 1USSA 2L4AA 4PZJA 3ZXSA 1JLFA 2EFQA 1TT5B 5ELZA 4BQLA 4DFPA 3D0SA 3SFZA 4IPAA 5KNLA 5E17F 2I7NA 3CF5L 1BL0A 1W0HA 2R7WA 3KVGA 4HTUA 3AA3A 3A0IX 3TU5A 3F8NA 2OPPA 1VQNI 1L3UA 3OHRA 3KFWX 2VLAA 5DDGA 3ROUA 2HXIA 1B9DA 3DOKA 4FL9A 3ZX3A 3E97A 1NG6A 1BW6A 1D5YA 4C8OA 4EJOA 5FRMA 2WC9A 2F9TA 1T03A 2FD5A 3PUBA 2PMUA 5JLXA 3EEQA 4K41A 3HC7A 2L9NA 4QAGA 2CYYA 1VFCA 3AVLA 4DTPA 2QA4N 2OQRA 3JRGA 3WXKA 2DOAA 1U47A 2UYTA 1GLAG 3EKUA 4N5SA 2QTDA 3KLIA 5AQMA 4ZDOA 2WY7Q 1WLJA 1YJWN 4JI5K 3WTUC 4IG0A 1XNRK 2IBDA 3THYB 4NO7A 4C1NK 3V8LA 3IDHA 3SJHA 4CECA 1ZRFA 1S9GA 1ZAOA 5HNFA 3DRRA 5FPMA 1HPZA 4U7BA 1LWCA 5J2MA 3AO4A 1PYVA 2IT0A 4HX4A 4DR3K 2P5GA 1XGNA 1HLVA 1W36C 1DGKN 3GTGJ 3K57A 4HZFA 3SYTA 2HFHA 3BROA 3O8MA 4MHGA 2KIMA 2NAZA 2A1RA 1MNMC 4NCBA 2V26A 3CCLI 3MEEA 2OUMA 1JTXA 1REPC 3VB2A 2BHZA 1A5XA 1Q8IA 5CHIA 1C1CA 4H5VA 3U8XA 4FJHA 3H9GA 3O3KA 4CEAA 4IHSA 2Z1HA 3VQDA 3A1YA 2TRTA 4RW7A 1VQ6N 2KZVA 4JKBA 1D0XA 3T7ZA 1N34K 1IXRC 2RN2A 2MD5A 1V5GA 2D0OA 4M3TA 1BIUA 3J8AA 3ABMH 4KN4X 1C6VA 2BY3A 2QQ9A 3C2HA 3S2WA 5F0FA 1VQ6I 3HL8A 4W5TA 5FKMA 5A2QO 2CQXA 1ZELA 2J4RA 5IOZA 1R0AA 1GLEG 4NUBA 4UUVA 5JHFA 1J0RA 2Z1IA 3VEYA 3QETA 1XMXA 2ZXIA 3KEQA 3BTCA 4ETSA 2QF7A 1FSHA 1EX4A 4YFKF 2ZGZA 3EYYA 4FE7A 3IP4B 2M9HA 4YEJA 2B5JA 4RTFD 1HW1A 1FYLA 1NK7A 4FWKA 1TKZA 3K5OA 3L2WA 3WXIA 2RKHA 2W84A 3E6CC 1A5JA 1NGIA 3GBTA 3HBTA 1YHQI 1MMSA 4BJ5C 2FSJA 2NRZA 4KTWA 2ELKA 4O55A 4BGBA 5CVRA 2BUPA 1OVYA 3SZPA 2WB1N 2E71A 1W0TA 1TZLA 2LREA 3M8FA 4Y17A 1KFSA 3RWUA 1WVRA 2JTVA 3NBPA 4ELVA 2A41A 4B1YB 4GXOA 1QVGM 1UCRA 3QNNA 3CFPA 1VQ8I 3S3OA 4A5NA 1Z3YA 4HNTA 1FX7A 3W6VA 1W9HA 2GUIA 2L4MA 3BF3A 1P90A 2H1KA 3V42A 3FKIJ 3DBRB 2RKIA 3MX2A 3UKUB 3NHGA 4B9MA 2R7ZJ 4I9LA 1Q82O 1U5TB 3BWGA 5EXWA 5C2FA 2V9KA 4F3TA 1R5GA 5T7BA 4OO1J 1X2NA 4RB3C 1OCTC 3ABTA 3SQ1A 4NDLA 4ISEA 4BQOA 2Q1NA 2R92J 2F5DA 3LQQA 4X0GA 4DOZA 1FPQA 5AQZA 1XB4A 3DXKA 2RNJA 2VWBA 4M3GA 3GX4X 2CQQA 2FF3B 2K4BA 4BU2A 2V51B 1VQNN 3V81A 5BPNA 2LFBA 4NC8A 5E3LA 2XROA 2KL4A 4C2TA 3VYSB 3PX4A 3I0RA 1ZG5A 3GYHX 1FWZA 5AIQA 4D7NA 1MGTA 3D45A 1OKRA 3E01A 4FSVA 4JI6K 3J81K 4DV6K 4JD2A 5KRTA 2TCTA 3SQ2A 2JPBA 4G9YA 3UIQA 4J2EA 5LY3A 3K4CA 4BY7J 2A3ZA 4DV3K 2E2QA 2PAVA 4MEYF 2EHGA 1N33K 1MNEA 3SQ0A 4XORA 4FJ7A 3TAFA 4PGHA 4QLCU 3MCPA 1ZQ3P 4KIFA 1BOTO 1ASVA 3LWLA 4KAZA 3I9V2 4FCYA 4M9XA 1UB9A 2L2OA 3NF7A 1OFCX 4DW6A 4B4CA 1KC8O 3IV5A 4LJZF 5E8GA 3D5LA 2E5LK 3GFMA 4HNUA 1HJRA 3RSEA 2EZHA 1UHWA 2BY2A 2X4HA 1TYQA 3THXB 3E3VA 1ZK8A 2IGMA 1LDJA 3D5SC 1WFXA 5D5XB 5J8CA 3OYEA 1JGGA 2L02A 5BPDA 1XGSA 1U6ZA 3QIOA 3MWTA 3UKUA 1UHSA 4R79A 3SFIA 3ID8A 2IGOA 4KICA 3IUCA 1TL1A 3CJCA 1WSUA 3PLAA 1IV6A 2UXNA 3BG6A 1WSEA 2DTZA 4CE9A 3NAUA 3KZIC 4BACA 2GV9A 4DQPA 1P4XA 2CJJA 3M07A 2CH0A 1WH5A 3GZ5A 1O4XA 4DSEA 3GTPJ 3RRHA 4Y1DA 3CCQN 5TJJA 4HAMA 3DTKA 2F96A 2XRNA 3CERA 4YNQA 5AONA 2VOPA 2LRDA 4BXUA 1MZBA 2L9VA 2ME0A 4ZYEA 2HTSA 3ZT2A 2BE5F 3QB0A 4JS4A 1TK5A 2NNWA 1NJIO 2K27A 4G94A 1QZZA 2Y30A 1EP4A 5EEGA 4KH6A 1XS9A 5J1YA 1S1XA 2VI6A 3K70C 4ZHRA 4CK1A 1R36A 4X6AJ 4BRAA 1B8IA 2WV1A 1CZBA 3L09A 3OR1C 2NRWA 2VBWA 4N4OB 5CPRB 3EYIA 3GG4A 2DA6A 3LAKA 2DMUA 4EZ9A 1X3MA 3O9SA 2ZM6K 3ZETA 1FBQA 4O5FA 4CEEA 2XY8A 4I7FA 2HVQA 2PZSA 4PK4A 2NRVA 1MBKA 5F0CA 2HNDA 3DLHA 5E8IA 2Z2SB 4M6XA 1YFHA 1JLAA 2F9WA 5EEHA 4YFNF 2IS2A 4AHTA 4B44A 3MEGA 4X66K 3DLBA 1KQ8A 1DP3A 4HQEA 1YS6A 2OAZA 1W5TA 3EZ5A 4BJ6C 3CD6N 5EG0A 3GTLJ 5EJCA 3IRQA 1JE8A 3SV4A 3VPRA 1S6PA 3QP5A 4BGAA 3K4JA 1XCVA 4LOCA 3S93A 3KLGA 2K9SA 2A3SA 2MC3A 3LDQA 2EFPA 2E1OA 4G6QA 2VODA 4C23A 2N8GA 3S14J 3V9XA 2B6AA 4NC7A 2HMPA 5AZIA 2BXYA 2Q0OA 3JAMK 2KIQA 4A0XA 4J01A 4LG0B 4WE1A 4H03B 3ZSOA 4CGIA 3VENA 4FX0A 1IBLK 1HCRA 1Q9XA 1XTAA 2W48A 2YNGA 3ISPA 1FOYA 4GDFA 5AZJA 3ZT3A 4I6MA 5ADXH 4YY3K 2DOEA 3SAHA 3ENHA 3CXCM 3M8JA 3ATVA 2OPTA 4IRIA 3EY1A 3V7SA 3PV8A 2LKXA 2Q2RA 2DT6A 4AH9A 3WTXC 3WXMB 3FXRA 2CGPA 1YJNN 1KGSA 5D8LB 2KZMA 4DS4A 3K4MA 5B1AH 3BCAA 5F0XA 2RQQA 1PJRA 1O7LA 1WNSA 5KPRA 2E35A 4JKHA 4NBQA 2HHSA 3BF1A 5KVRA 1YTYA 5M5XJ 2X1DA 3OVNA 4WFAL 1IXCA 2BEOA 1PUFA 3QEXA 3SBGA 1TQMA 1FY7A 3HHGA 5F1RA 2ZNYA 4DLGA 4RW9A 3TL4X 4CJLA 3ID6A 2HPMA 5F1XA 3BG9A 2MG4A 3JR9A 3NMUA 2BGCA 2IXSA 3HKZN 1TWFJ 4LFUA 4CXFA 3LDPA 3RSEB 3MMYB 5FJ8J 3HP6A 2O8EB 3PJRA 4XLHA 2Y1IA 1OCRH 2E1MB 3HB9A 4IQ4A 1MJ9A 5CYVA 1J7KA 2EFOA 3O9QA 3TBIA 5H6QA 2WFBA 3AVBA 3H0GJ 2FBYA 3CCUN 3E6DA 2ZB9A 1CF7B 1T0FA 5C25A 2A6EF 2HHQA 2ZFUA 1BOBA 2YV0X 1T38A 5IYBJ 4F2RA 1TTYA 2QI2A 4OVLA 4PUOA 1X9JA 2Q36A 4DR1K 4KHYA 1MBJA 2YNHA 2NVUB 3OYJA 4OAZA 3K6GA 4RA2A 2ZF5O 4NYNA 4CYCA 2MD0A 4LGWA 2JSPA 3HTVA 4I6MB 1TAQA 4O0JA 2CUEA 1DTQA 5DTDA 4H0TB 2K3PA 4ESFA 5H6RA 4HLYA 1A5WA 3H5NA 3QPLA 1KXPA 3A5OC 4IFVA 4FYDA 2AA4A 1ON2A 1RFQA 5E3NA 2VJIA 3JTHA 5KHDA 1G15A 4ZDLA 3MMVA 3VQ8A 4UVAA 1UMQA 2PG4A 2YUSA 3P39A 4XH1A 2BY1A 2XY5A 1XGMA 1SAXA 3CP2A 3F8CA 5KGWA 4DR6K 5GIPA 1Q81O 3P1GA 3PIOF 2P9NA 3CMEI 3RIRA 3OYHA 1BQMA 3WODF 1ZGJA 1LOTB 4N41A 3KK7A 4XLNF 4NB4A 4WX9A 4ZDPA 1DU6A 4DU4A 1XUPO 3ZR8X 2R7VA 4CF0A 4GW6A 2O8DB 1R6RA 2UV1A 4DV1K 1IUYA 5AQWA 2JRMA 3I33A 2NOJB 2FBHA 3KWIA 4DYRA 2ZXWH 3NARA 1RUNA 1JLCA 4MO4A 3QERA 3W0LA 1T0FC 4RS8A 2IVNA 2DA3A 1SVMA 2DT5A 3REOA 5D6EA 4DYQA 5L3GA 4BY1J 2F7TA 4ID1A 2STTA 1WCMJ 4OPHA 5IP9J 1MMNA 1RBSA 1ZXOA 2EZLA 3K4NA 2VKHA 5FKOA 1IRZA 2E34A 2DPUA 3WXJA 1K8KB 3BJAA 4L9VA 3BR2A 3FIWA 1BC7C 4HX8A 3CQYA 4W5NA 3QOEA 2DBBA 1Z26A 2FE3A 4KN7X 4OWRB 3QNOA 4NLCA 2P8TA 3U1DA 3OL3A 1HF0A 1GLDG 1Z6TA 2D0BA 4V2GA 2FSKA 5AQIA 1S5LC 3A4CA 1U2VA 1VQON 4A5BA 5HDGA 2GELA 1VHXA 4ANJA 1Y64A 4M7YA 1N6QA 3LFUA 1W7PB 1FEXA 3DEWA 2VE9A 9ANTA 4IHVA 4FHTA 3H1VX 3SPZA 3DPLC 2LBFB 1YQAA 2UUBK 1FMWA 2DK5A 1RNHA 3K7AJ 1HLUA 4JX5A 2ZMEB 4GGGA 2FJ1A 3F9MA 2X6WA 1YIOA 2DI3A 2CGJA 1G59A 4R1HA 1MSFC 4E7JA 3H3VK 1SMYF 5BN9A 3TAMA 4L9NA 2BANA 5LBQA 1XPXA 3AVGA 1BI0A 1TL8A 4A3LJ 1VSHA 3S2DJ 2P9PB 1FW6A 1MU2A 1YW9A 1N77A 2NRTA 2B7EA 4FWSA 1WRJA 3K9TA 1AU7A 2ZCWA 1R22A 1X2MA 1K4TA 1A31A 3T1AA 3C18A 3UE5A 3JYTA 4KKOA 4BRPA 4W5QA 5EZHA 4BR9A 2XRIA 1F43A 1QS4A 1D1BA 3OV8A 4EZ6A 1GVJA 4BREA 3VEZA 5H2FC 5DUIA 3L2RA 1SFKA 3K1MA 4XKBA 4IHYA 1TKXA 3PSIA 2DW4A 5A2QK 4UY8I 1IKVA 4C1NI 2V4JC 3OYDA 2QWQA 2LF7A 2HDCA 3I59B 3A8YA 4DLEA 3QEPA 3DEUA 3TDZC 3V8KA 5GAHJ 4CHPA 1VZ0A 3AVIA 2XIGA 4OIOF 2DA2A 4NLBA 4FJNA 1EXQA 2PQ8A 1ESVA 1IW7F 3DQVC 4DR7K 1D3YA 1WH7A 2CH6A 4CGHA 4C30A 4CYDA 3M9AA 2OYQA 4Y33A 3LPUA 1TWGJ 1WUAA 1SZ2A 4EEFG 2ICWG 3HPHA 2Q0UA 4S04A 4JKGB 3ABLH 1QQIA 2MBFA 3E5UA 3KYCB 1VQKI 4BXXJ 3DOLA 3ZT4A 1PP8F 5D5WB 4CBXA 3KTQA 1NGJA 3I64A 3LSTA 5KI6A 3KZYA 1IJWC 3TTFA 1Z91A 3GBGA 4B1VA 2VGNA 1EH7A 2DYSH 2P5KA 2KJBA 4J00A 1W7PD 1HQCA 1KRPA 2HBJA 4CCNA 2L5QA 1SAZA 3HM5A 4F55A 4ZYGA 4Y7NJ 2KHOA 4YDUA 4YOTA 1P7IA 4GV9A 4IVNA 4BR0A 4B8CA 3A02A 1YI2N 1Y39A 5LGUA 5TISC 3ZT0A 1VRTA 4OAYA 1H9GA 3LA2A 5ED4A 3ALYA 3TO6A 4LK0F 3RTVA 1UFMA 2RAEA 2E2JJ 4LF5K 1HW5A 5BN8A 3ZPLA 2P9SA 3CI5A 3O9UA 1SL1A 2LH9A 1C0MA 3DLGA 4PFOA 4BY9C 2W24A 4RAGA 4DIQA 2QKKA 1EO1A 3W3DA 3CJTB 2F5FA 1X4OA 4YG2F 3KETA 4RM3A 1GV2A 4LIVA 1RC9A 2XVCA 1O7FA 3UKGA 4CFAA 1ATNA 4JRQA 3CCRN 2HVIA 1ASWA 2JSCA 2W4SA 2WA0A 4YOUA 3ZQIA 1A6IA 3WE2A 4IO9F 4HW0A 4L5EA 3QPTA 2JLEA 3KE2A 3FE1A 2XF5A 4HWIA 4CZGA 2LR8A 1QPIA 4NCGA 2K85A 2XGCA 4KDPA 3LSKA 3HOUJ 3JSPA 3ULQB 2MC4A 3M6GA 3FR0A 4Y15A 3VQCA 5GAHP 2DN0A 3IHUA 1GT0C 1J5OA 1RGIA 2QGUA 1OVQA 4BVOA 3OJSA 4JKGA 3CC4I 4DV2K 3O4QA 2ID3A 4RWTA 3JRAA 4RM2A 2DQRA 1OCPA 2ZNZA 3AO3A 4JK1X 4EATA 4UHTA 3F2KA 4ILJA 1WJDA 1YW7A 3OL4A 3MWMA 4E70A 2R0QC 3F9KA 3KEYA 3WQTA 4YELA 1HKQA 2OA4A 3CMAN 4I9QA 3PX0A 4RLQA 5KGXA 4KHUA 1ZHFA 1Z6RA 4ISFA 2DMTA 1HNWK 2LKPA 3TO7A 3QOPA 1HNIA 1KLNA 5M1NA 5M5WJ 2NS7A 1JCFA 1RT4A 3H45C 4CZKA 1QVFM 3BDDA 4AHCA 1ITGA 4CJVA 1YOVB 3HIFA 4B48A 4DFMA 2JGUA 2A1SA 4PKHA 3KP6A 4E1JA 5AFUA 1I1GA 2CRGA 2FNPA 2P9SB 2PFBA 1U5TA 4G6TB 3SEQA 4EGYA 5H20A 4D0PA 2OA8A 2QA4I 5CY4A 3FLCO 2OQGA 2LY9A 4HCBA 4WK8F 1VQ4N 2KFNA 4F4KA 1VF9A 3JREA 2VT2A 2QBYA 4FWOA 1K79A 4NHJA 3SAFA 2WTUA 3MN6A 4DQ8A 1MBFA 2A07F 1QBJA 4J8FA 2P5LC 2E5NA 3F6OA 4M73A 2FSNA 2G8KA 3GO5A 4LFCK 2R7QA 2QWLA 4G6DA 2F8TA 2ZWHA 4N9HA 2VCPA 2Z1JA 3CETA 4HUFA 3BPXA 1T2KA 1X58A 1JKHA 4N4NB 5J6XA 1LE8A 4X64K 1UA0A 1LVAA 1JL2A 3AL0C 1O13A 3WUHA 1RPWA 4OGCA 1XSVA 1E3OC 2XAFA 3GEZA 1DP7P 3BPVA 4BGDA 2E1ZA 2WBNA 5EY4A 4CJ3A 4O4GA 1VSDA 4FWQA 2FXUA 3LDLA 2Y2ZA 4U0YA 3ZSYA 4XH4A 4AUXA 3MN5A 1VQLI 1HKTA 4M3XA 1QHAA 4BRMA 1LEBA 2IA2A 2I8DA 3RQIA 1FYMA 3K0SA 2EILH 3U9ZA 4DTNA 3R9PA 1KD1O 4G7HF 1ULYA 2BVLA 4HLXA 1B6AA 3Q3SA 4FJ8A 1RI7A 4EHTA 4J2BA 2JUGA 1VTNC 3RYRA 1BU6O 3S1QJ 3NF9A 4DYCA 1G3WA 4UB6C 4HA8A 2HDDA 1J53A 4S05A 2H27A 3VTIA 3OYAA 3LNQA 2GBYA 2NVYJ 4J19A 4FLVA 5DM6L 5GTIC 3KIOA 5FLMJ 4L0ZB 1YS7A 4JLHA 3H5RA 2NUBA 2W6LA 4FK4A 2IW5A 3KPHA 4GO1A 1ATRA 3EPZA 3ZQCA 1BA5A 1WWXA 2HQRA 4DZPA 4FTHA 3SBTA 3LP1A 1STZA 1Z7UA 2MSYA 3COAC 5HLHA 4DFKA 3L3VA 4FOEA 1XX5A 2K4JA 3AO1A 4IEJA 5ILSA 3QLHA 5E84A 2MGQA 3BDPA 1GLBG 1XQSC 5AQJA 1ZG1A 1SKRA 3RKQA 2XRLA 4AHSA 2YU9J 1E17A 1Y6IA 4ENNA 2QLZA 4Q5VA 3L2CA 2QKBA 1KA8A 2M87A 1BI4B 3V9SA 1HX1A 3E5XA 4M3ZA 1USTA 3KLHA 3VA3A 2BV6A 2HQAA 5JLFA 4AIHA 3J7AP 1C0UA 5GAGJ 5BNGA 4OIQF 1LFPA 1B8IB 4F9OA 1W1WE 2FQ4A 2E1YA 2OPQA 1NKCA 3DMJA 4DR2K 5A2QZ 3SK3A 5SWMA 4ELUA 2Q97A 3ASMA 2EB7A 2KPMA 4A3CJ 5J1UA 2JVGA 4JOMA 4HHTA 1X3WB 4N0BA 2Y0SA 4IOCF 5HP1A 5KQDA 4CIGA 2AO9A 5KTQA 2IIRA 1T98A 4ABZA 1DDNA 3LP2A 3ATUA 3M1CA 3QMLA 3I53A 1LNWA 1HDDC 4WF2A 1E4FT 5ICFA 1FK9A 1H1VA 2QXLA 2DPDA 5K5OA 4CEZA 5AFUH 5DUKA 3ZLJA 2Y31A 3D0PA 5CLSA 2HXOA 2FNAA 1RCHA 3VF4A 4MTEA 2QENA 3PIOL 4B9SA 2P5OA 2LSOA 3ZGKA 4B1RA 2IVOA 3F5TA 2BZTA 3HM9A 4OU0A 2VQEK 1UA1A 4HEA2 3VGMA 3HKZA 2Z1DA 3GWZA 2LYCA 2DCEA 1HQEA 2ELHA 1ZLJA 4LY7A 3VQAA 1ZGAA 4H0OA 2YHYA 1XMAA 2RDPA 3QQAA 3ECOA 3DLKA 2MH2A 4G8XA 3O4NA 5M1KA 1XSXA 3SCXA 4Z4EA 3RR8A 2NVTJ 2OTLN 5CKTA 4AVZA 1XDSA 2HNZA 5IT9O 4HUGA 1R4NB 4FWPA 2E4LA 5H1SQ 4KYWA 3NGZA 4B9TA 4UUTA 2CUJA 4PJ0C 3I54A 1UOCA 2F6CA 1WJEA 1YXQA 2B4JA 4DF4A 1TAUA 2O8EA 3NQOA 1TUYA 1NHAA 2EJRA 3R0JA 5DEQA 3DF8A 2HVSA 1T8EA 2E5ZA 3CFOA 3WU0A 2DPNA 2FF4A 3NH1A 1WN7A 4ZYHA 3B6CA 3R0AA 2X1CA 5FFZA 4EMSA 5JFRA 3OYIA 3LM9A 2FMYA 2QQAA 4JKAA 5MLCQ 4KRFA 1BL3A 2LLKA 3G1LA 2M0CA 3DTEA 1B72A 3ENBA 4Y52J 3L00A 4LF8K 4BC5A 1JJ8C 1ONVA 1R49A 2Y1JA 3CCVN 2V6CA 2WV0A 3DXMA 4PCQA 1Z3XA 3VQ6A 2M3AA 2OU2A 2Z5UA 3OYLA 1QPMA 3KP7A 3TO9A 1Z9CA 1RDBA 3DI6A 5FKLA 4YRVA 4BC4A 4YIFA 3EDPA 3RZOJ 3HSTB 1HYSA 3MXIA 3UR3C 2PJRA 3ZX0A 5IWAK 1QQOA 3TSQA 1VQKN 4K0KK 1YLFA 1QHHD 2QSGX 2VC1A 1C0GA 3QDKA 2VYPA 2HI3A 5F2RA 2XF7A 1IV0A 3KYDB 5HRPA 3GTJJ 1H0MA 2QKMB 5BOXA 3U3YA 2G8WA 2X9DA 1Q1HA 1VQ7N 1FMVA 4NC6A 1R00A 4DKWA 2VG6A 3AA2A 2WWYA 1FXXA 2LF8A 1NH3A 3ABUA 4CZJA 3H08A 3PIPL 1YITN 1L3SA 4A3KJ 5HS7A 2KP6A 4MQVA 3ZRGA 4F52A 1MH3A 1P2FA 3WHCA 5JVGF 1JCGA 2F48A 1G6NA 3MKLA 4CCHA 1D8JA 3O3GA 3EUAA 2VG7A 4CFCA 3MECA 1TKTA 1CF7A 1FJGK 4CZMA 1ETWA 4B09A 1SVLA 4OX9K 5HVQC 4LC9B 3VEVA 3DU5A 4OOIA 2PMZN 3AV9A 4IQJA 1IKYA 2A40A 2JA8J 2QZ8A 3BUZB 4XN0A 4AYBN 2W25A 3H1CA 2QSHX 3DYAA 3ECHA 3ZQQA 5BRHA 2OJED 4FZXC 3AA5X 3LFKA 3VOEA 2ZFWA 3QBWA 2O5RA 1RKTA 2YS9A 1S1VA 2HWVA 3QODA 1TYQB 3E7LA 1BCMA 3TP3A 3A01A 1ENHA 1TL3A 1O57A 5CYQA 4CJ5A 4X65K 2GA2A 4CVNE 1NK2P 3VQPA 4LD5A 4IZ9A 1HQUA 4M6VA 3IH2A 3SZGA 2X0LA 5AQNA 1T6DA 4GNIA 4E4HA 1XDUA 4RDUA 3RI4A 4OGEA 2YR2A 3C6HA 2RQPA 2XKOA 3LP3A 3UNGC 2HR3A 3Q9VA 3GFIA 1VQOI 1NJZA 4JEPA 4OLAA 3R61A 2J5PA 4BR7A 2FUG2 2F5CA 2YCHA 1K6YA 1MW7A 2XAJA 1IUFA 2CSOA 2Z99A 2O6GE 2E2OA 3E1YA 1HXDA 2AXLA 2MH9A 3KWGA 5FGMA 4FJLA 3CMYA 5CVUA 3O4WA 1QZEA 3KD5E 2CQ7A 4PWDA 1KYWA 3TWHA 1REVA 3NH2A 3THXA 4FJGA 2D0PA 2XSJC 2MABA 4FETA 3HG9A 1RTIA 1HNVA 1QZ5A 1U2VB 4CICA 1V4TA 1GLLO 2H3GX 3HYFA 2VASA 4A12A 3L1PA 3AAFA 3K9JA 3VYUB 3G10A 2DODA 4L18B 3MAJA 4DMNA 1IBKK 4KIGA 3L2UA 3VMFB 1VSIA 2NLXA 2IAIA 3LSJA 3ZETB 2FQ3A 1IKWA 1SD5A 2HGCA 2EK5A 2LBFA 4U0WA 2PEXA 1SQKA 3AG4H 4JX6A 1NK8A 3OOUA 1EJ9A 2F4IA 2OBPA 1NG7A 2F5VA 1VSMA 4LD0A 5DCMA 3T0YA 4CDGA 5DM7F 3G0ZA 5ADXA 2O8FB 2A68F 1AHDP 3HUGB 4QCLA 3JRCA 4CFBA 4GRIA 2P5VA 2L54A 1X3UA 2ECBA 2X6NA 4PUSA 4HSRA 3JCUC 4UV8A 4JX4A 3AY9A 3K5LA 1WBDA 3FFIA 1X9MA 1LDDA 4PSXA 2HQ5A 4M3EA 4IOCL 2XC7A 3DAWA 1LWEA 4YFUA 4CZCA 3PNVA 3F8MA 1HUXA 4P9UA 1VQ4I 3MCZA 2K40A 5C4XJ 2VT3A 2PJRB 1JI8A 2PJPA 4FOIA 4H5TA 5EF6A 1HA8A 3QFPA 2JPCA 4A5AA 4CJEA 5B8HA 1UAAA 5TKWA 3UKRA 3HJEA 2OTJI 1M90O 3GTKJ 2W6KA 4MLOA 1DKGD 3OTOK 1ILYA 1W7AA 4P9FA 1W2BM 5AQRA 3MXJA 4NXNK 1S7EA 1JKQC 2NS8A 4E7SA 4PJMA 4LF4K 3V7CA 2IVMA 1SFOJ 3L8BA 1NGBA 1YX3A 3FX3A 3DM2A 2LY1A 4PJJA 3V8JA 4IKFA 3TTDA 1I6XA 3WG9A 5DK5A 3NWSA 4XRSG 3LSPA 3M3YJ 3M5RA 4JK7A 1I3QJ 2Y48A 5DCFA 3RQ4A 5HBMA 1WSHA 4MFEA 3LA3A 5LMUK 1MSEC 4HBLA 2V7YA 1I50J 3EUHC 1OCOH 3RMCA 1WSGA 3B6PA 3VETA 2CV2A 4FK2A 1D5VA 4Z4IA 1YRNB 1NKBA 1Y0NA 1BISA 2W57A 1H9TA
chains in the Genus database with same CATH topology
4CCOA 1IO2A 2OA8A 4B9TA 1RDDA 4OPJA 3U21A 1NK4A 3ZSXA 2OV7A 4E7KA 3LZJA 3NGIA 4I2QA 3OY9A 4FLTA 2CV0A 4DF8A 4OJRA 2KQ2A 3NH0A 3BGRA 4F93B 1LW2A 4I2PA 4DBQA 3OS1A 4IZZA 4CK3A 1L3TA 3HP9A 4KT6A 3HPOA 4Z4IA 3MKWB 1UAXA 4F8RA 3DLRA 2R7UA 3KLEA 4J2AA <