1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Integrase
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
4ELUA 4KHNA 2PYJA 4BDYA 4F2RA 4DQPA 3K57A 5SWMA 3KKRA 5FROA 3OYEA 3TANA 1BQMA 3U3GA 3AO1A 2BANA 4GMJB 3OS2A 4DFMA 4CGIA 3OYBA 1WSEA 1BL3A 1XWLA 3HK2A 3DLKA 1FXXA 1EETA 3HPGA 1RBTA 4CHOA 2RF2A 4BE2A 4IKFA 1HNIA 2RKIA 4C8KA 1FK9A 4N76A 1WJEA 2YNIA 4HCBA 4M42A 3V1OA 4LSLA 3ZSQA 5T7BA 5JS1A 3CG7A 3ZSYA 4DTRA 1T7PA 3B6OA 2HHQA 1QSSA 2Q3SA 3C95A 2D0AA 3PX6A 1WJFA 4C8MA 2D0CA 1T8EA 4OGCA 2YNGA 4DQRA 2G8VA 4QOZB 3V1QA 2QXFA 5HROA 2G8FA 3TWHA 2DFHA 3D45A 4CFDA 4NCBA 3AVCA 1NOZA 4BE1A 4Z4CA 1WSIA 2GV9A 4KHYA 4KKOA 1NJZA 3PO5A 1HQUA 4N47A 3AVMA 4KV8A 2FBTA 2YKMA 3QIOA 4CJPA 1WJBA 3IS9A 5E41A 4W5OA 1UA0A 1U4BA 1NK5A 4C8LA 1VRTA 2KFNA 1RBVA 3RWUA 3QERA 2IC3A 1LAWA 3PX4A 1IKYA 3L2RA 1L5UA 4H8KA 3WNHA 4FJLA 5FDLA 1BCMA 3TR8A 4Z0UA 1E0EA 3IAYA 2KZZA 3QEWA 4FZYA 4KI6A 3WNEA 1RT6A 3LZIA 4CGJA 4JRPA 4F8RA 5J2MA 4JLHA 3NH2A 1RDCA 3LDSA 4CJ3A 1ZBLA 1TKZA 1FKPA 3KLHA 3OYHA 1WJDA 4KTZA 3VQ8A 3L2VA 3CFRA 1FKOA 4FLUA 1C6VA 3SZ2A 5J1EA 4CEFA 4DSJA 4AHCA 4FJXA 1EXQA 3PUFA 3MXIA 4DSLA 3TAFA 1D9FA 4B9NA 4OGEA 4AILC 3H08A 3JSMA 4FJGA 3NF8A 4CHYA 3O4QA 1TKXA 4FK0A 1BI4A 4CJUA 1WSFA 5HRPA 3LP0A 1NOYA 4J2AA 3O3GA 1HYVA 4HUFA 1NK8A 4DQIA 1TAUA 3DM2A 3U6FA 2JGUA 2BE2A 3ZSRA 1MW7A 1D5AA 4CEOA 4W5RA 4QCLA 3AVAA 3LPUA 3TAEA 3S9HA 4FXDA 4W5QA 4JRQA 3AVNA 4W5TA 5J2NA 2FBYA 1NKCA 2HMIA 4I9LA 5CZ2A 2KFZA 1RBUA 4CHZA 5DK5A 3HXMA 5KI6A 3MEDA 4KRFA 3VN5A 3OYGA 3DOKA 3V9ZA 1J54A 4DLGA 1IKXA 4M3WA 1XHXA 5KRSA 3MEEA 3VQPA 4O0IA 4E7JA 4F3OA 4KHSA 1NK9A 1IO2A 4CK2A 3SQ4A 4FVMA 4CJQA 1LW2A 4XIUA 1J53A 2D5RA 1BIUA 1RT2A 3M8PA 4RW7A 2KW4A 4FLVA 4RG8A 1QTMA 3HO1A 2G8WA 3ZSZA 1KLMA 3KLIA 3L2WA 4LH5A 4Y1DA 1XHZA 1MU2A 3OY9A 4KREA 3SQ0A 2FBXA 4QAGA 1TVRA 2Z1JA 4PA1A 1JL1A 3KK2A 3CFOA 1SKSA 4B9TA 3AV9A 1B9FA 1S1UA 3UIQA 1L3VA 3ISNC 2YNFA 4ID5A 3FFIA 4FW2A 4RW8A 1TK5A 2QKBA 2A1RA 2Z1IA 3V9UA 3TAMA 2EX3A 3NF9A 3K5OA 2X6NA 3SV4A 3QETA 4B9SA 1YT3A 3KLFA 1NK7A 1KLNA 5C24A 1RILA 1VSJA 4CFBA 1NKBA 2OA8A 3NH1A 2G8UA 3C6TA 4DTUA 3AVLA 4KO0A 5D3GA 3A2FA 1RT7A 2YHBA 3LP2A 3RMAA 1SKRA 3V4IA 1U04A 3VQBA 4CJ4A 3OYFA 1S1TA 2F8SA 3TI0A 1U47A 4M3TA 2XRIA 5HRRA 1LFPA 4H4MA 1K6YA 3DOLA 1JLGA 1DLOA 1JKHA 4DWIA 3QESA 1RT5A 1X9WA 4DU4A 4K8XA 1S6QA 1TKTA 3T1AA 3RRHA 4KPYA 4C8OA 4OVLA 4RW6A 3CM5A 2PY5A 2IAJA 1RT1A 4CGGA 3OS1A 4L8RB 1TKDA 1REVA 2LSNA 4CECA 1Y97A 5C25A 1CZBA 4DSFA 1JLCA 3QEXA 5HRNA 2PZSA 1Z26A 3PO4A 2B4JA 4CEDA 1ITGA 3VA0A 5HP1A 3DRRA 2P5OA 4I2PA 3P5JA 2ZQBA 3V1RA 4DTSA 4DF8A 3SI6A 1L3TA 3ZSVA 4CJFA 1LW0A 4OJRA 3SUOA 4CJTA 4BDPA 3SQ2A 1HPZA 3V9WA 1TV6A 3KLGA 2VWKA 4CJSA 1N5YA 3VQ4A 4DU1A 4Z4FA 2XY8A 3OS0A 4AHRA 3V9SA 1WJAA 3PY8A 1W9HA 5J2QA 3DLGA 5FRMA 4DTXA 1BGXT 4PWDA 3KD1E 4Q0BA 4CFAA 3S3MA 1LWCA 1CXUA 3ZSOA 1JLAA 3I0SA 4Z4HA 3NFAA 3F9KA 3P1GA 1D9DA 4FJ8A 2ETJA 3L3VA 4KAZA 2YHAA 4KHQA 1NJWA 1VSLA 4E19A 3HT3A 3JYTA 4E7KA 3OJUA 2JLEA 3G0ZA 1BQNA 2OPPA 3MECA 3O4NA 1F21A 4DFPA 4RW4A 4FLXA 1KCFA 4CE9A 3DLEA 3DMJA 2XY7A 3ALYA 3RMDA 3OJSA 2OPSA 3NBPA 1TL3A 4WE1A 1SL0A 3AO5A 2F8TA 2E6LA 4O4GA 3PX0A 4Y1CA 1IKVA 4BWJA 1QQCA 1WSJA 3AA4A 3SCXA 4FW1A 1KRPA 3KTQA 1RT4A 2D0BA 4EZ9A 5CYQA 4CK3A 5K14A 4E7HA 1X9MA 4KTQA 4FJ9A 1RT3A 1XC9A 2ZE2A 1JL2A 5CYMA 2PYLA 1Z25A 2XHBA 4IFYA 3RMBA 2R7YA 1GOAA 1VSDA 3O3FA 4DU3A 1ZBFA 1O1WA 2FC0A 4N41A 4OPJA 1L3SA 3V81A 3ZSWA 3AVKA 1EP4A 5CY4A 4OPKA 3ZCMA 4DSIA 1KVAA 3NE6A 4HCCA 2Y1JA 1IG9A 1R0AA 3HP9A 1I3AA 4CHQA 1NKEA 1ASUA 1LV5A 2RN2A 2HNDA 4DFKA 1VSIA 4DS4A 4CHPA 2WONA 2X78A 4IG0A 4PY5A 3NAEA 4LY7A 4ICLA 1HMVA 2P51A 4N56A 3EYZA 3SNNA 2KTQA 4NCGA 1B9DA 2HVHA 4KI4A 2HHTA 1KFSA 3HM9A 2I5JA 3C94A 3VQ5A 4N5SA 2E4LA 5KGWA 4B9MA 5J2PA 4ZHRA 1RTDA 3B6PA 5EU7A 2VG5A 1SL2A 3AA2A 4FJ7A 3K5LA 4FK4A 1HYSA 1RTIA 4FJ5A 4AHTA 1BCOA 1VSHA 4M3UA 1RNHA 1S9EA 3L3UA 4KHUA 1KONA 3CM6A 1RTHA 4CEAA 4HUGA 3T3FA 2NUBA 2VG6A 2X74A 5I3UA 1CZ9A 1KVCA 3ZSXA 4CERA 3L2QA 1YVUA 3RR7A 2GUIA 1SUQA 1SL1A 4K8ZA 4J2BA 4LH4A 1TGOA 4LSNA 3QNOA 3ZT0A 3AVHA 3RR8A 4DTMA 1WNSA 3WNFA 1C0TA 1S9GA 4KFBA 4Q5VA 5CZ1A 1JLBA 4E7IA 1EKEA 4CJ5A 1VSMA 3DLBA 3OYCA 2Y1IA 3OYMA 2EHGA 1C0MA 2P1JA 3SYZA 4B9UA 4CEZA 4CESA 3V6DA 1J5OA 3K5MA 1W0HA 4M3XA 3QEVA 4FK2A 1JLFA 4OKKA 4CEEA 1T03A 2YNHA 1KFDA 3MEGA 1WAJA 4BWMA 3HP6A 3RMCA 5I42A 2Z1HA 3HL8A 2BGGA 3IG1A 4W5NA 2QKKA 3K58A 1WJCA 4FLYA 3PV8A 4DF4A 1RDAA 4NCAA 4GVMA 4Z4EA 1UAXA 5KRTA 4MQ3A 1YTUA 1A5WA 3SV3A 4JS4A 3OYKA 1KSPA 2G8IA 3CYMA 1GOBA 5KTQA 1VSFA 2ITGA 1XI1A 1HQEA 3AVFA 2KQ2A 1U49A 1VK0A 1C1BA 4AHVA 4IG3A 4B3OA 3D0PA 3TABA 4IFVA 4DTJA 4M3YA 3NH0A 3LWMA 3SPZA 1WAFA 3AVJA 4GW6A 2HB5A 5DMRA 4LD0A 3DLRA 4F4KA 4YFUA 3EY1A 5C42A 4I2QA 2F96A 3AVGA 3OYDA 1Q8IA 3HSTB 3SJJA 1ZBUA 1QSYA 3VQ9A 4OLAA 3M8QA 1TK0A 4FZXC 4CIEA 4R5PA 3KKSA 3VQQA 1C1CA 3TARA 1ASWA 2DFEA 1I39A 1KVBA 1VRUA 1YTAA 4DTOA 4FJIA 2YV0X 4HVJA 4DS5A 1C1AA 3OVNA 4C8NA 4DLEA 3THVA 2OPQA 1WLJA 2B5JA 2YKNA 4CJKA 3NCIA 4FJJA 1B92A 1S5JA 4G1QA 1RCHA 2HNZA 3SUPA 4CF9A 5KGXA 4B9LA 2Z1GA 3IRXA 2DTUA 4BACA 1KTQA 1UA1A 3DRPA 3ASMA 3RRGA 4B08A 4FM0A 4CF2A 1N6QA 3EZ5A 3AVBA 3L8BA 2HVIA 1VSEA 3HVRA 3LAKA 3T19A 4E7LA 3P83D 3OYNA 1WSHA 4HTUA 3QEPA 2WOMA 1JXBA 3TAPA 4ELVA 3WNGA 4FM2A 4I9QA 3VA3A 1S6PA 2IGIA 3TAQA 3MXMA 1D8YA 4OKJA 4CIGA 3U3YA 1TL1A 4ELTA 1SV5A 3NDKA 4AHSA 4FJHA 4Z4IA 4I7FA 4CF1A 5JS2A 4CCHA 3SUNA 3KLEA 2HHWA 3SPYA 4ZTFA 1VSKA 1DTTA 4M45A 2OYQA 1A5XA 4Z4GA 3QEIA 3ITHA 2HW3A 1UWBA 4ZTJA 3CFPA 3KIOA 1WSGA 3VQEA 1CLQA 4EZ6A 4KB0A 4EP5A 4PUOA 2G8HA 3HPOA 3OYIA 1LAVA 3VQAA 3S3OA 4AH9A 4DG1A 1BI4B 1S1VA 4E1MA 4E3SA 1RDDA 4DTNA 4F3TA 2O4IA 1QSLA 3VQ6A 1A5VA 3HYFA 4PQUA 2HNYA 4CJRA 3AVIA 3NGZA 2VWJA 4BE0A 2BDPA 1DTQA 3TAGA 1BISA 4CIFA 3MXJA 3LALA 3M8SA 3BDPA 4OKEA 4FZZA 4ID1A 4KTWA 2QK9A 4AHUA 2RPIA 3VQ7A 1QHTA 4CJWA 3KD5E 4E89A 4CJEA 2G8KA 2HHVA 1ZBIA 1G15A 3AA5X 3DYAA 1TK8A 3DRSA 4CHNA 4M3RA 1X1PA 4BDZA 1NJXA 1WN7A 3VQDA 4CF8A 1ASVA 4FLWA 3NF7A 2P5GA 1ZBHA 3ULDA 4B9VA 4CGHA 1Q9XA 3VQCA 4DQSA 2B6AA 4O55A 4O5BA 4FJKA 5HBMA 4CJLA 4CEQA 4CGDA 1U48A 4DQQA 4NYFA 3QO9A 3ZT1A 4CFCA 4CK1A 2X6SA 4FLZA 3I8DA 4IBNA 2ATQA 1C0UA 3K5NA 3ZT4A 4O0JA 3ZT2A 4M3ZA 2HHXA 4F3QA 2HHUA 3MAQA 4DTPA 1HYZA 1SKWA 1Q9YA 4CGFA 4OLBA 4KHWA 1S1WA 1GOCA 1IH7A 2DFFA 3QNNA 3RTVA 5HRSA 4EP4A 3KJVA 4E1NA 3M8RA 1BHLA 4FM1A 1U45A 1NJYA 2E6MA 2IOCA 4UQGA 1NK4A 4HHTA 2O4GA 3NF6A 4DMNA 1LWFA 3LAMA 4FYDA 3E01A 3KK3A 1UOCA 1J9AA 2VG7A 4YNQA 1S1XA 3NHGA 3LP3A 2IS3A 5HLFA 3QLHA 5SZTA 4JS5A 4F2SA 1RDBA 4FJMA 4FJNA 4DSEA 2XY6A 3L2UA 3LPTA 1CXQA 1QE1A 1RBRA 2AJQA 2DY4A 2HHSA 1TAQA 2FBVA 4B8AB 3OYLA 4HUEA 1HNVA 4TSXA 3K59A 3DLHA 2ZD1A 3LWLA 2XO7A 4J2EA 4CF0A 3DI6A 3LZJA 3HVTA 3KK1A 2IDOA 1RBSA 5FRNA 3ZT3A 2OZSA 3S3NA 4B8CA 4CEBA 3HPHA 3CQ8A 1L3UA 3V9XA 3BGRA 3SUQA 4DFJA 1QS4A 3I0RA 3OYJA 2W42A 2XY5A 1JXEA 3SQ1A 3C6UA 3QIPA 4IDKA 4J2DA 3NGIA 3QINA 4M41A 4FCYA 4FLTA 4MFBA 1EX4A 3LP1A 1X9SA 1BIZA 3AO2A 1HRHA 3AO3A 2A1SA 3AA3A 3G10A 1JLEA 2OPRA 1NK0A 2KZMA 3O3HA 4O44A 4CJVA 1HJRA 3AO4A 3OYAA 4H4OA 4NYNA 1NK6A 2GBZA 3NGYA 3LANA 1T05A 3K2PA 4RW9A 2OZMA 4E0DA 4KB1A 3HJFA 1IKWA 1ZYQA 3F73A 1JLQA 1LWEA 4DSKA 1RTJA
chains in the Genus database with same CATH superfamily
2QQ9A 5CVRA 3GBTA 1JJ6C 2PYJA 3OBWA 4KHNA 1VQ5N 3FK6A 3GVAA 2LY9A 4UB8C 3KKRA 1GLBG 1TBXA 1T6SA 3CZ6A 4B8XA 5KHDA 1BQMA 2P9IB 5HOOA 2W6LA 5LLQA 1EF4A 3CC2N 4I76A 4DFMA 3G1LA 1T6CA 4CGIA 5DM6L 3DTIA 1VQ9I 1WSEA 1TWGJ 2X6XA 3DPTA 2BZTA 1HX1A 4YDUA 4J01A 2F4IA 3DP7A 3GTQJ 1RBTA 3HSEA 4FT8A 1Z6TA 4IKFA 2CUFA 2RREA 4J00A 4ZYEA 2WA0A 3QODA 2DA7A 4A3CJ 4GYGA 4I02A 3ZCOA 3JSOA 4BHBA 1FK9A 3OA9A 5MLCQ 4V19S 2DA4A 3BTIA 1AU7A 5FD6A 1VZ0A 4LSLA 3ZSQA 4BL0B 5T7BA 2IW5A 2YSRA 3CG7A 3B6OA 2AQEA 3J7AY 1G3YA 3C95A 5J4VA 3TSQA 3BPXA 3N4QA 2IGOA 4Q48A 1CZAN 2KL4A 3VYRB 4LF9K 3FMSA 5GPAA 1S7EA 4BRNA 2O5RA 1N36K 2DU9A 2D0OA 3AVCA 4BE1A 1HC8A 5GAEP 4KHYA 1YJWN 3F8CA 1NJZA 1P6RA 4DKWA 3PFIA 3F21A 1HQUA 3PO5A 1E2XA 3K4LA 4P5OA 3JTHA 2LBFA 2FBTA 4QPOA 2YKMA 1WJBA 4KV8A 2M0CA 3IS9A 2PLYA 1UA0A 1R58A 1NK5A 2LDUA 3I53A 3ZR8X 4A5MA 4ZDOA 2KFNA 1RBVA 2N8GA 2EIMH 3KEQA 4KT5C 5FKOA 2R5YA 2PG4A 2X1CA 4CZCA 1BA5A 2IC3A 1B9MA 4A2BA 2W41A 4FJLA 3WNHA 1Y8QB 5FDLA 1TQMA 3LSJA 3QBWA 2O8DB 1Z05A 4Z0UA 3IAYA 2ZJPL 2UXDK 3IAS2 2K85A 4HBLA 1AHDP 2H6BA 3MZYA 1RFQA 2HPIA 1QVTA 4IHYA 1YAGA 4JRPA 4F8RA 3NH2A 3CCEN 1RDCA 3D2EB 4NUBA 4CJ3A 2QLZA 1JHHA 4A0YA 2JK3A 3OYHA 3L2VA 4KTZA 5CE3A 4KDPA 4CEFA 3PUBA 2OANA 4B9NA 1S3JA 4JN4A 1SFKA 3QYFA 1D0YA 2MSYA 4C23A 1X19A 4PJMA 4PFOA 1T38A 4V19K 3CI5A 5JVHL 1F36A 1YE9A 1XGSA 5FGMA 2QEXN 1A6IA 2F7TA 4AWXB 4CJUA 1WSFA 5A2QO 5HRPA 3JCUC 3A2KA 1NK8A 1HYVA 1XX5A 2K3FA 3DWLE 3V4GA 5DM6F 1TAUA 4BJTA 5B1BH 3VOVA 2XKOA 4W5RA 2BE2A 3K1PA 4AVPA 3I33A 1I27A 1J75A 3AVAA 5CR4A 4XIDA 1XI1A 3S9HA 2E36A 3MX2A 3CO6C 1I6HJ 4PL7A 4W5TA 1WH5A 2NRRA 1R1VA 3BQZA 3HSCA 4MLHA 3KCCA 3ZX2A 1X4PA 4FHTA 2DODA 4F55A 3K4CA 3LWFA 2X1DA 5CPRB 2O8CA 3UE5A 1ZHFA 5KRSA 4F3OA 1IXCA 4OINF 2JQ7A 3HRGA 2QWPA 2NRAC 1APLC 3C3WA 1VQPN 4FLVA 1G6NA 1RT2A 1QTMA 1X3UA 4RG8A 3HO1A 4YFXF 1KLMA 3KLIA 4QS7A 2A61A 4HTLA 3GMEA 3TDZC 2FBXA 4QAGA 1TVRA 4PA1A 1WH7A 3VETA 3KK2A 1SKSA 1A6QA 4XKWA 2O8KA 1S1UA 3CMAN 4AUXA 4ID5A 1MNMC 3JTGA 4DV7K 2OCCH 1M1KO 5M1PA 3U9GA 3O8GA 4YELA 4BQQA 2EX3A 1WZ2A 4H0VB 4XLAA 1TLHB 4A3FJ 2X6NA 3JAMK 3OR2C 4I6ZA 1KLNA 2FBIA 5KCMA 2CS3A 2QQAA 5C24A 1RILA 1NK7A 4KIGA 2G8UA 4UY8O 4L5IA 4Y13A 5DUIA 2ZJQL 3IWZA 4HG2A 1RT7A 5F1JA 4DYQA 3AGKA 2ZXJA 3VQBA 3CC7N 1Y64A 1V5GA 4ZYAA 1S1TA 2PBDA 4XONA 4YFNF 3TI0A 3K9KA 1HLVA 1XPXA 3B6CA 1LOTB 4IHSA 4FWLA 2UXCK 4JBAA 4M3BA 1JLGA 3OWTA 3CDHA 2UV1A 1MSEC 1FTZA 4KHPK 4LJZF 1DU0A 2O9LA 4KPYA 4RW6A 2LKXA 4CGGA 2VOOA 2KIUA 4JP0A 3CXCM 4L8RB 4CECA 4WK8F 2L54A 4QIWN 2EIKH 1Y97A 3J81K 1CF7A 2UUCK 3AAFA 1Z26A 2FU4A 3CCLI 4DTUA 2A3SA 5E84A 1YJ9I 1ITGA 1FMWA 3AFHA 3DFGA 3EUHC 3DRRA 3HHGA 1P7JA 5EDNA 1B9NA 4CCKA 5JLWA 5EGOB 2NVTJ 1DPUA 5FKKA 1NG7A 3V1RA 4BC4A 1LW0A 2V7ZA 4OJRA 3I8DA 2MD5A 4BDPA 2L5QA 3BCBA 5D5WB 1HPZA 3VTIA 3SQ2A 5FKNA 1BM9A 4EM2A 3CMEN 2JMWA 2M45A 4YFKF 2VWKA 1JTXA 1ORKA 4ESFA 3OS0A 1S72I 1MMDA 1YIOA 4CCOA 1WUAA 1VQLN 3PY8A 1SAUA 2P9PA 5J2QA 4PWDA 4LMYA 1BGXT 3I3LA 5DCMB 4DR3K 3VWBA 1VQ4N 1FJGK 2HVQA 1K79A 3GL1A 4CA0A 2ZMEC 3P1GA 1D9DA 4FJ8A 2F5VA 4PFPA 4BRLA 2YHAA 2JSCA 2FF4A 2EA2A 2F5DA 1G3SA 2XF5A 4E7KA 4XM3A 2E2JJ 3R1XA 4HQEA 4C2TA 3MECA 2G7UA 1XC5A 2W84A 2IVMA 3O4NA 3MCZA 1KQ0A 1OPCA 3DCFA 3MQ0A 4RW4A 4JX5A 2QUFA 4FLXA 3FM3A 5AQVA 3DMJA 3E9LA 2DAOA 4CCLA 2F8TA 3BZCA 2QBYB 2CSOA 3S17J 4WXDA 1STZA 2CYYA 5J1UA 1IKVA 5FLXO 3RKQA 1WSJA 3A5MC 3RPUD 3AA4A 1KRPA 3KTQA 1RT4A 1O7LA 2D0BA 5CYQA 3HOZJ 4E7HA 4C1NI 4KTQA 3CUQC 2M87A 4FJ9A 5JFRA 1ATNA 3KVGA 3AL0B 3HI0A 3IL2A 2PYLA 3ID6A 3RMBA 1BI0A 4DU3A 2CQKA 2LF7A 1W36C 5IP9J 3DXKA 3H9QA 2HQAA 1QZ5A 4QS9A 5AQGA 2EINH 3V81A 4HLXA 4ILJA 3ZSWA 4AM7A 3TU5A 2GELA 3LL7A 3WUHA 4XNFA 2P9KB 4RBOA 3V8KA 2LH9A 1LV5A 3FZMA 1Z7UA 3CJNA 3VMFB 4DS4A 3AG2H 1QO0D 3QICA 3BR6A 5BPMA 2WONA 4DR5K 2X78A 3A03A 3ML6A 1NTCA 3DBRB 5LGUA 4JI2K 2BVMA 2E71A 2ICWG 2VKEA 4ICLA 4GV6A 3DWLA 3VSLA 3GCMA 2CQ7A 3ESWB 1JKQC 2P51A 4NO7A 4N56A 2ZMEA 3R61A 3EYZA 2DDAA 3A0HC 3BT9A 2HHTA 3REOA 1USTA 3WXJA 2I5JA 3C94A 3O9RA 1DU6A 3G25A 3SBTA 5KGWA 4B9MA 4IOCF 3AG3H 4ZHRA 3B6PA 1VQNI 4I01A 3SZPA 2KT0A 2W24A 1E3HA 4YY3K 3K5LA 4ZZLA 1RTIA 3O1BA 4FK4A 1HYSA 1BCOA 3ROUA 4WF2A 1D5VA 2F9WA 3W0LA 1S9EA 2YS9A 3MVPA 5I9EB 3L3UA 5M1OA 5C0YA 3NQOA 3CM6A 4HUGA 3JSPA 2NNWA 2NUBA 2VG6A 2XAQA 3E1SA 1QZZA 1NGCA 3ZSXA 5FD5A 4HDUA 4CUGA 5M5WJ 4GDFA 3GG4A 5GINA 4MGRA 2Q2EA 2W25A 4J2BA 3NMUA 4XKVA 1J7KA 5J8CA 2UUZA 5BS6A 3QNOA 1XTAA 2CGLA 3GTGJ 4DTMA 2F2EA 3ABLH 1GLJO 1FTTA 3SLCA 2M4KA 4Q5VA 1NGBA 5CZ1A 1LDJA 1EKEA 2QF7A 1JCFA 1UJ8A 2VQHA 2PMZA 2BGCA 4B1YB 1C0MA 2P1JA 5E17F 3R3LA 5GAHP 2CG4A 5DUKA 4CESA 1J5YA 2EA4A 2O8CB 3IUOA 2B0LA 3CD6I 4FK2A 2WC9A 2KJCA 3SK3A 5GAHJ 2DMNA 2IGNA 2O3FA 1ENHA 2J4RA 2YNHA 5CVVA 3CJBA 2WY8Q 3HL8A 3JAMO 3HP6A 1IAWA 2R92J 2DJIA 1OCTC 4BXFA 3DKXA 5E18F 1T56A 1VQ5I 5F0FA 5C4JJ 3C18A 1Q1HA 4GV3A 1KYZA 2R7OA 2ZXIA 3K6GA 2DDBA 1O3RA 2E20A 4BRPA 1JJ2M 5AQXA 1P4XA 3ABKH 4Q47A 2DOFA 3BZ6A 4FX4A 2A6HF 2DN0A 2JVHA 3SV3A 1RUOA 1HBXG 3BTCA 4B48A 3CC4I 5KTQA 2CQNA 4M6VA 1S72N 2ITGA 1Z9CA 2MLGA 3FZFA 2IJLA 4HX8A 2VPRA 3WG7H 3J81Z 1ZQ3P 5C10A 1U49A 4BEHA 3LDPA 4IG3A 2CWEA 2LK2A 4AU7A 3WGIA 4M3YA 3IKVA 5J40A 1PUFA 3WGHA 5IOZA 5EX5A 2HB5A 4LD0A 1RC9A 2E60A 3FXLA 3VEYA 4YFUA 5C42A 4BGBA 1QZYA 5AQOA 4IWVA 2F96A 1KA8A 2FLOA 1NBWA 1Q8IA 4PSXA 5D4RA 1ZBUA 1YW9A 5ICCA 3I56N 3H3ZA 1KC8O 4WQ4C 1TUYA 1ATRA 1OQYA 5D4SA 3SYTA 1C1CA 3I0TA 3A0BC 5CKTA 1V5FA 3CD6N 2XVCA 2DFEA 2W82A 1YTAA 4JKBA 2V1NA 1J6ZA 2YV0X 2YUSA 1XSDA 1C1AA 1X9JA 3RQ4A 4FOIA 1ILYA 3BQYA 4I0BA 4CZHA 3NCIA 4FJJA 4G1QA 1CF7B 2WB1N 1UB9A 3CETA 1U8BA 5KGXA 4BQLA 2Z1GA 3R60A 4R1HA 3IRXA 5EVZA 1UA1A 3O9UA 3RRGA 2L7FP 1MNEA 2PX9A 2XAFA 2V1UA 5BRFA 3NWTA 3C2HA 1O3QA 3KEOA 2IVOA 2Z33A 3AVBA 1BA0A 3HVRA 5F1XA 3VEXA 4B1UB 3OYNA 5KPZA 4B9QA 1YG2A 4JX6A 1JXBA 1UHSA 3H35A 2XAGA 3IH2A 2IGIA 3SEQA 3TAQA 2G7HA 1Z3XA 2HOSA 4OKJA 1D8YA 1SEUA 1WB9A 4KIBA 4H5WA 4L9JA 2VC1A 4Z4IA 4I7FA 4CF1A 5JS2A 2KZGA 4CCHA 3SUNA 3ENOA 5BREA 4EIAA 3UNGC 1DTTA 4FWPA 1X1AA 3MN9A 3IHUA 4XLPF 3DEWA 4Z6YA 1FLIA 5K7ZA 4KMUX 5CQEA 2HTJA 4Y33A 5C3EJ 3KIOA 4ZTJA 1WSGA 2Q97A 1CLQA 4YOXA 3SAGA 5DCFA 3GE1A 3MDQA 1HKSA 2IEKA 3VQAA 2A5YB 2FJ1A 3A5NC 3K0SA 2DT7B 4ZC3A 3J7AP 3RDIA 4E1MA 2O4IA 4DTNA 3WHCA 3S8PA 3DPLC 3NARA 2NOJB 4BGDA 5HVQC 4IHWA 1A5VA 1QSLA 3UB5A 2HNYA 4LFAK 4CJRA 3AVIA 3SBGA 3CJTB 1HKBA 4BR9A 2DBBA 2FSKA 3TAGA 2X4HA 1V55H 2A42A 3LALA 1ULYA 4MDBA 3TEDA 1SZ2A 3VQ7A 4ANJA 4F52A 4MNUA 2V26A 5D8LB 3CCMN 2AXTC 4KREA 2HYGD 1TWFJ 1A36A 4OU0A 1QHGA 3E6DA 3AA5X 3U4LA 2V4JC 1U3EM 3H3OB 1V4SA 3W6JB 3VOEA 3ZOBA 3FF5A 3NF7A 2A6AA 4XMYA 1YFHA 3CF5F 4JNEA 4LF4K 2OBPA 3SQNA 4EHTA 1W5TA 2KDZA 5E26A 1LE8B 1H89C 1SD7A 4F91B 1LDDA 3HYIA 4IBNA 3WTWC 4AYBA 2P5LC 2HNHA 1DKGD 3P9CA 3ULQB 3WU2C 1VFCA 2Q0RA 2D1VA 1P8ZA 1BG3A 4CYCA 3ZT2A 1SVOA 2XAHA 3CPEA 3FWEA 2ZXHA 2IA0A 2HHUA 5AQMA 1R4NB 3KZBA 4BROA 5ADXA 4DTPA 1Q9YA 3D2EA 4CGFA 2BHYA 2A5WA 2BYVE 2Z9OA 1GOCA 1S1WA 2FA5A 3VPZA 3QNNA 3QP5A 2JJ7A 3ZX3A 2NNNA 3M8RA 4BS9A 3HOUJ 3CCVI 2VN2A 4M3DA 4A2UA 4I6MA 3E01A 2PMZN 3TP0A 3OV8A 4FWMA 1MJ9A 1JUPA 3QFPA 3UKGA 1K8AO 3V7RA 4ESBA 3FHNA 4DR6K 2P9NB 1GV5A 3IDHA 1HKCA 1UG0A 1ZTRA 3JRBA 3L2UA 2HKOA 3HUGA 1CXQA 3MCAB 2AJQA 1UZCA 4LFCK 2DY4A 1P4WA 1TW3A 2Y30A 1HKGA 4YOUA 1GVDA 4B1WB 1HNVA 1JGSA 2VT3A 2ZD1A 1OCRH 5F0XA 1W36D 5DD8A 2VUMJ 3DI6A 2R7RA 3HVTA 3KK1A 4BJ5C 4FPBA 4D7MA 5FRNA 2ESHA 3A5OC 1YX5A 3THYA 4QPQA 3S3NA 3K10A 3HPHA 1KAYA 1VQ8I 2VE9A 3CC2I 3BGRA 4JI6K 4WXCA 1L3LA 1GVJA 4EM0B 2KQRA 2RVCA 3QIPA 2HBKA 1EJ9A 4J2DA 2W00A 4M7XA 4FCYA 3P31A 1W4MA 4BRCA 3E3VA 1BIZA 2VCPA 1U9NA 2RN2A 1FOKA 5LFAA 1SFEA 1T08B 2F5CA 1JLEA 3G6EI 3LMMA 2QM1A 1EH7A 2E5NA 2R7UA 4DB3A 1NK0A 1D1AA 2EFPA 2FX0A 5A2QK 4P1WA 3VERA 4NYNA 4PJ0C 1X1BA 1LB2A 2KMUA 2V1DA 2FMLA 3DLLF 3PO2J 3MMVA 1IKWA 4X62K 1ZBHA 1DPRA 1JLQA 3H3NO 4UVCA 4DSKA 1RTJA 4CCNA 1D8JA 4NBQA 4BDYA 1ZLKA 4LK1F 2GOXB 1IBLK 3ABTA 1YLFA 3OYEA 3TANA 2Y2ZA 3HOWJ 3QB0A 2BANA 3E97A 3H45C 2WFBA 3ID8A 4H4KC 2AHQA 1IW7F 1BL3A 1XWLA 1VF9A 3ECHA 2KZVA 1BC7C 4HOBA 2VQGA 3HRTA 3HPGA 1RUNA 3I55I 1F4KA 4OIQF 3FE1A 4JEPA 4PKHA 5AQNA 3BROA 3FM5A 1XNRK 2XGXA 2CV0A 2ZJRF 2MC3A 5L3FA 2UU9K 1WJEA 1PUEE 1BA1A 2YNIA 4JI3K 1K78B 3V1OA 3SZGA 4M42A 2QWMA 5JS1A 3TTCA 2XGEA 4JAXA 4JX4A 5E1WA 4BH9A 3WTYC 2D0AA 2W7NA 3GDQA 3P9KA 2W4SA 2D0CA 4C30A 2YNGA 3J80K 4FTHA 2QKLB 4QOZB 2VXDA 3SDBA 3V1QA 3IMXA 3DF8A 4G12A 1LCUA 4UNOA 1Y0NA 3D45A 1Q7YO 4NCBA 2VKDA 2GV9A 3W6KB 3O6BB 3QPHA 4C9YA 3VGMA 3U1DA 3WTXC 1YF5L 2KKZA 4N47A 5K5QA 2L3DA 4BY7J 4K41A 2GTDA 1ETYA 3QIOA 3S16J 4CCJA 2HZTA 4IZZA 1YO5C 1U4BA 1M90O 4C8LA 4K43A 1VRTA 2JWTA 2Y31A 2LR8A 4ZZDA 5J6XA 3LSTA 2HVRA 1I50J 3BF3A 5M1KA 2H3GX 3O1WA 4PKIA 3DXKB 3TR8A 1K78A 1BR4A 2OZUA 3T8TA 1E0EA 2X6YA 2DA1A 2RN7A 3SEZA 5HS8A 1JE8A 3B8AX 3IFRA 2E34A 1KAXA 4IEIA 4KI6A 3WHBA 1RT6A 3LZIA 3VF4A 1VQPI 3E9PA 4O6JA 5TRDA 5L3GA 1FKPA 2XY5A 4JI7K 2V6CA 1IF1A 3E6CC 3HZ6A 5TKYA 4BQNA 5M5XJ 4CZGA 4PY5A 1MBKA 3HBLA 3RIRA 4AHCA 4FJXA 4MLOA 1EXQA 3DLLL 4DSLA 2QK9A 2M7BA 2ECCA 3TAFA 4IEEA 4OGEA 4AM3A 3LDLA 5LD2C 2ECBA 1VNDA 4IHXA 3NF8A 3O4QA 1Z3YA 1PVEA 1ETWA 3HKZA 3K4JA 2G9WA 2ASMA 4DJAA 3LP0A 1NOYA 2HVSA 2X0LA 4OIRF 4CYDA 4HUFA 4DQIA 4RB3C 2D1HA 3DM2A 3U6FA 1KU9A 2HKXA 4PGGA 1MW7A 2JGUA 2H8RA 2FOWA 3H0DA 3LPUA 4BRHA 1BC8C 5A2QZ 4JRQA 4AQYK 5J2NA 4DYCA 3PFYA 1FIPA 3C7JA 3L00A 1W7PD 4FISA 1IN6A 2ME6A 3SFIA 1FOXA 5CZ2A 1RBUA 2IA2A 2LY1A 2OD5A 3HRMA 2F4MB 2KHMA 5C2FA 2WAQN 4HX7A 1ZG3A 3DV8A 4AC0A 1QRYA 3S15J 1ETKA 2EILH 1FOWA 5BOXA 3EUKL 4II3A 3VQPA 4O0IA 4XR6A 1IBMK 1JKPC 4CGZA 3PNTA 2HBJA 2E1OA 5IT3A 4CK2A 1NK9A 2KISA 2XPUA 1LW2A 1TNSA 1J53A 3M8PA 3F72A 4XIUA 4RW7A 1ZKGA 3QRFF 5ELZA 5EYRA 1KQSM 4EEFG 2YI1A 2X6WA 1LKXA 1XHZA 2DA6A 3OY9A 3CCQI 1MU2A 3HL2A 2JA7J 1W1WE 3MN7A 4JI4K 1R49A 1V3FA 2VJIA 5FB2A 1I1SA 4B9TA 3K0LA 2E1NA 3ATVA 4M3WA 1I3QJ 2FUG2 1S6LA 4M71A 3H5NA 1KZHA 1L3VA 2KFDA 3I54A 2Z1IA 2XRNA 2UXNA 3TAMA 1D3YA 1OJLA 2DYSH 2FNAA 2IA1A 3V9UA 1QPMA 3UKUB 2NYXA 3G1MA 3GFJA 3H1CA 3H0GJ 1YT3A 3SV4A 3QETA 1OCZH 1MBFA 3W2VA 1U8RA 2NLXA 4H0PA 4KN7X 4CFBA 2OA8A 3NH1A 1O3SA 1U0JA 3C6TA 4DUZK 4HAMA 3M4OJ 1QZ6A 1WGXA 4R79A 3CIPA 1QPIA 4BNCA 2YHBA 4RB1A 4MTDA 2ZM6K 1UELB 1Z77A 2JA5J 4LC9B 4Y3OA 3FGUA 5TKWA 4CJ4A 2DQLA 2W48A 3O8MA 2VI6A 1BO5O 4AIDA 1KQ8A 3LAJA 1KYWA 1E4FT 1NGJA 2XRIA 5HRRA 2P8TA 2E2QA 1DLOA 4CO8A 5F6FA 3K70D 3E5XA 5CYVA 5AIQA 1RT5A 1TKTA 2BY1A 3LDNA 1JCGA 4K42A 5AQWA 4DU4A 4C8OA 2RE2A 3CM5A 4MDAA 2IAJA 1RT1A 3EKSA 5EEHA 4NHJA 2UZKA 1AKHB 2VE8A 2M1BA 4PHTX 3UR3C 2VOPA 1QBJA 4RS8A 1JLCA 1VAZA 2NXNB 5K5OA 4NC8A 2IRFG 1U2VB 2RGVA 1VHXA 2EWSA 4D7NA 3QO9A 3QOPA 3PO4A 3Q0VA 3CCSN 1JT0A 3VA0A 3EUAA 5HP1A 4JYKA 1EQYA 3P5JA 4I2PA 2P5OA 4MEYF 2V52B 2GA1A 5IT9K 2ZQBA 1NMNA 3CC7I 1L3TA 1SAXA 4IJNA 3ZSVA 3KK7A 4JKDA 4U88A 2E1CA 4BHCA 3TO7A 4Z4FA 3EE8A 1FP2A 5FJ8J 3VQ4A 1WPKA 1YYVA 2CH6A 2BV6A 5GTHC 4AHRA 4Y52J 5D6EA 2F9TA 4HDVA 4KBOA 4XORA 3FKJA 4Q0BA 2XB0X 2KDOA 1RKWA 2HOTA 1MBJA 2HFHA 1CXUA 1LWCA 1NGFA 3ZSOA 2QWNA 4ZYDA 4Z4HA 3NFAA 3F9KA 3ELKA 4KJZA 2WWYA 5IWAK 2ETJA 4KHQA 1VSLA 3DBLB 3PNYA 3JYTA 5EEAA 3MN2A 2GXBA 5GADP 4HNTA 1QQNA 5B3SH 5ILVA 3S1QJ 3AY9A 3L6QA 5LJWA 1KCFA 1OVQA 3U9DA 4PL8A 3DLEA 2P81A 4LFUA 2E2NA 2A07F 3ALYA 3OJSA 2UUBK 2E7WA 1SL0A 1ON2A 5AZJB 2E6LA 1TQIA 4NB4A 4QLCU 4Y1CA 1UHMA 2O8XA 3FZLA 4LF7K 2BE5F 5AQIA 5BPLA 4E6KG 1FIAA 5K14A 1X9MA 4PZJA 1OCPA 3TO9A 1ETQA 1KU3A 1JUMA 1OYYA 3Q0WA 3M07A 1JL2A 2ZE2A 1GLEG 1U2WA 2XHBA 4MTEA 4BJ6C 4IFYA 1GOAA 3O3FA 1ZBFA 3KX2A 1MA9B 3BZKA 1O1WA 2VLAA 2HSTA 1L3SA 2O8DA 1Z0XA 3A02A 3FXUA 3TBIA 3KYLA 3AVKA 1YI2N 4OPKA 4ZJZA 3ZCMA 3NE6A 4CH7A 4HCCA 3Q3SA 4OO1J 4IDHA 1S5LC 1I3AA 2MFZA 4JI1K 2XROA 4JK9A 3CQ8A 4S04A 2LP0A 2OU2A 3F3XA 4BR4A 3VFZA 3IC7A 3DXMA 4CHPA 4GKKK 1MJAA 2P9UA 2DK5A 2O8BB 2D5VA 4A3LJ 4LY7A 1T3VA 1BU6O 1Y0UA 1E3OC 4FWSA 2Y0SA 2EZLA 3VODA 1UCRA 2KTQA 2HWVA 2KRCA 1QHHD 4NCGA 3D6RA 4XN0A 5E8GA 1B9DA 4G6TB 3ZSZA 4KI4A 3QMLA 2HVHA 1H8AC 5GIOA 1IRZA 3QYEA 3HM9A 4N5SA 2CFXA 4X64K 1NGHA 2Q1NA 2CU7A 1N8RO 5BQTA 2HMPA 1O4XA 3LQRA 1SANA 4FJ7A 1X3MA 4FJ5A 3SHFA 4AHTA 3HM8A 4IOXA 1U9OA 1NJIO 4UUSB 5L3CA 4FE4A 3ENHA 4CEAA 2WC2A 1F9NA 2X74A 3FK7A 1CZ9A 2L4MA 2LOOA 3ASNH 5B5EC 3L2QA 2D2WA 3PQJA 4E70A 4CERA 3TQNA 2KLOA 2GUIA 2P9IA 1EH8A 1SUQA 1LDKB 4EFHA 1SL1A 2NS8A 1MKMA 3AL0C 1MWKA 1GXPA 3ZMTA 2FF6A 1XC3A 4LH4A 4LSNA 1J09A 2JPBA 5JLXA 2V9VA 4XRSA 3P4IA 1SFXA 1X4OA 1S8NA 3K69A 4AILC 3L7WA 3RR8A 1DUXC 2BOLA 3IUCA 4KFBA 3CTAA 1YRNA 3IAM2 2OUMA 4E7IA 4KNYA 1JLBA 1GV2A 3R0JA 4CJ5A 1VSMA 1K61A 4YHHK 3DLBA 1XDUA 2H1KA 1VQ9N 2EHGA 4UV9A 1NGDA 4NQWA 2O8FA 2HU9A 4BRMA 4BR7A 2VASA 3H92A 4A3BJ 1W0HA 1VI0A 3HTVA 3RSEA 3V42A 1K8KA 3QEVA 4OKKA 1T03A 3HB9A 4KISA 4IVNA 2BY2A 1K4TA 1NK2P 1KFDA 3FBIB 3BEXA 2H09A 3FKIJ 3H9GA 4IXAA 3WE3A 3IG1A 1L3UA 4W5NA 2QKKA 1OCOH 1B59A 2HYJA 1ITYA 4ILGB 4JK7A 1WJCA 3O3KA 2VQCA 4FOEA 1O57A 2BEOA 2P9NA 5IP6A 2FSWA 1DT9A 1UAXA 1R9TJ 1FYMA 4Z4EA 4NC6A 1A5WA 3CUQA 4L18B 2X9DA 3W2AA 3CYMA 1E3PA 3RPQA 1RI7A 2JSPA 4HW0A 1IV6A 3D5RC 4LG0B 4Y4RA 1XMXA 5HLHA 4A12A 2KQ2A 4NQWB 3AVFA 5GAGJ 4G94A 4DHYA 4K0KK 2O8FB 1BI1A 5JICA 2I10A 5GIPA 1TNTA 2F6CA 2HGCA 4IFVA 3U1KA 4DTJA 4ITVA 2R4GA 3FIWA 1NMDA 3NH0A 2CQXA 3LSHA 3I9V2 3CCLN 1IN4A 4A57A 3CCQN 2FQ4A 3KP4A 2PJPA 3DLRA 5HDNA 1XMOK 1IZ1A 5FPNA 1FY7A 4BUPA 4TV7A 4I2QA 1MMSA 3OYDA 1HCRA 2NRVA 4XL9A 1ETXA 5HNHA 2F5FA 5DS9A 3HHHA 3R6SA 3VQ9A 4OLAA 2J5PA 4CIEA 4R5PA 1Z6RA 4U7BA 5M1QA 1W7PB 3G4SN 1D8KA 5FLMJ 3E9OA 4BY1J 3S93A 4FJIA 4BQAA 3CF5L 3ZQCA 2NRXA 2CUEA 1Z21A 3OVNA 5FFXA 1T98A 4FE7A 2BW3B 3LL3A 2MLKA 2B5JA 1WOQA 3L4QA 3BY6A 3JRDA 1B92A 2Z5UA 4EJVA 3SUPA 3KHYA 3F5TA 2ZGYA 3GZ5A 2ASOA 4B9LA 2QI2A 3ZT1A 1JKOC 4WFAL 1NG9A 1Y6IA 3TOBA 3BY5A 1HR0K 4Z94A 1B72B 3EZ5A 3CCRI 2C6YA 2HOAA 5GP9A 3P9IA 3HG9A 2LLKA 4BRGA 4E7LA 4DV2K 3E1YA 2H27A 3G71N 4A0ZA 1UFMA 1TQPA 1KGSA 1E17A 4I9QA 2L9VA 1HSTA 4CCMA 4OMYA 1S6PA 1T39A 4B3RK 3C2GA 2X51A 3KEYA 1MSFC 4RAYA 1HLUA 2VL8A 4AF1A 2QYOA 4KT6A 5F04A 4B1RA 3J7ZI 3BF1A 3RPUA 5AQFA 3W3CA 2VC0A 1FYKA 2L9RA 3SPYA 2XGDA 1VSKA 1SFOJ 3AKZA 1R00A 3DU5A 2OYQA 4BRKA 3DU6A 3EUHA 4AYBN 4Z4GA 1FSEA 2QENA 3S41A 2HW3A 5F27A 3WE2A 3GZNB 1WWXA 2KLAA 4U67L 1VQ8N 2JPCA 1RPWA 1NGEA 3WEEA 2HDCA 2EFWA 4EP5A 4PUOA 3GFIA 5EY4A 2G8HA 4O5FA 3A8YA 1LAVA 2WB1A 1PYVA 5HLIA 3N97A 3R6MA 3ZGKA 4G6QA 4PGHA 1S1VA 2JRMA 2OTLI 1RDDA 1LVKA 4CICA 1LNWA 1B6AA 3GTOJ 3VQ6A 3Q9VA 1P9QC 4PQUA 2R5YB 2B7EA 4X6AJ 3CJ7A 5F1RA 4PSWA 3I64A 1DTQA 2BDPA 2P9SA 4BGAA 3C2BA 4OKEA 4HSRA 3GX4X 1N77A 2GQQA 3CLQA 4CHUA 4WFNL 3KD5E 2HXIA 3TO6A 3QPLA 3DYAA 4DZPA 1FBSA 2M34A 4WCEL 2DJNA 4CHNA 4L9NA 4B44A 5ADXH 4L9VA 1RR8C 3BR0A 4D5CA 3K9TA 1NJXA 1HNZK 4M72A 5KK1A 2FE3A 2P5VA 3HUGB 3PSIA 4I0AA 3ULDA 2P5GA 2CV2A 2ISYA 3LA3A 3VQCA 2B6AA 3RKXA 4ENMA 3I55N 2YU9J 4M3EA 2HEOA 4CEQA 4DV6K 5GPCA 4BU2A 3MN6A 1WHUA 5J1YA 1OLTA 2KIFA 1BI2A 4P55A 3TW7A 2K9LA 1HW2A 2X6SA 3A5LC 2BHZA 3K4BA 3IH4A 4HZFA 4YIFA 1VQ4I 1MBGA 2UXXA 3J7AO 4H5NA 5KPTA 5KPRA 3C6AA 1W0TA 3K5NA 2YPRA 4O0JA 4M3ZA 2Y9ZA 2GWJA 2DCEA 4ON0A 4F3QA 1TT0A 4H0XB 4MIMA 2RKHA 5JHFA 3HOTA 2XB5A 4LF5K 2D4WA 4BG8A 3MKZA 2QBYA 1GLCG 3RTVA 3J80O 1U45A 1HNWK 1BHLA 3WXKA 2IOCA 5BN9A 4FYDA 1LPQA 3NF6A 5IP7J 3KK3A 2RAEA 5B66C 3GEZA 4RA2A 2W40A 3O9QA 1R5ID 3QU3A 3VDXA 4RB0A 2LNBA 2DA3A 3AAQA 4BVPA 3QLHA 2JRTA 1R5GA 2CUZA 2ZSHB 3HTUA 4HA8A 4EJWA 2OQRA 3IRQA 1RDBA 3IKMA 4CD3A 3K1MA 2XY6A 1YUWA 4FJNA 4XKCA 1R1UA 1GLDG 2TDXA 3EEQA 1U6ZA 3VEOA 1UG2A 4GY2B 3BDDA 9ANTA 3CESA 1TAQA 5EOYA 3DLHA 4OWRB 4CXFA 4TSXA 4HUEA 2HHSA 1YQAA 4BRAA 3NRVA 4BQZA 2QKMB 1YRNB 3BUZB 1YHQN 1IJWC 3RZOJ 2ZJQF 4JKGA 2IDOA 2CJJA 2O7OA 2M4GA 4JOMA 4RWTA 2QXLA 1QVGM 4DR7K 2M5WA 3I59B 3V9XA 4EVIA 2ESNA 3CUOA 2W1OA 2R3SA 3OYJA 1QS4A 2W42A 1JXEA 3C6UA 5F0HA 2OZ6A 3H1QA 3VF2A 1TT5B 2JUCA 1ETOA 2TCTA 3CDLA 4MFBA 4ZDLA 4NNJA 1DDNA 3FISA 1H88C 1OR7A 3AO3A 3PIPL 1OKRA 2R0QC 3OIPA 4CDGA 3Q7BA 2XRLA 5C15A 2GWRA 4O44A 2HTSA 1HJRA 1ZGJA 3OYAA 2F4VK 1WI9A 1NK6A 3NGYA 3HJFA 4RW9A 3E5UA 1MMGA 4PCQA 3MX5A 3EYIA 1ZYQA 4I99C 4BHPA 2RQPA 5LBQA 3BJ6A 2QW9A 3OIQA 3I4NJ 2KRFA 2V7YA 2W6KA 3J8AA 3M1FA 5SWMA 4O8UA 3FR0A 5C44J 4G9ZA 1YOVB 5ICFA 2L02A 4MQVA 3CQZJ 2IS2A 4BC3A 4XSXF 2BXZA 1DEJA 1OH8A 2NVQJ 1QNTA 4M6XA 1NGAA 2Q2RA 1IG7A 2EPFA 4OPHA 3DLKA 2HBMA 5HL7L 1R6RA 2WV0A 1A5JA 1Z7LA 1ZLJA 5DTDA 3T1HK 1OH7A 1NM1A 4BE2A 3OL4A 3WGGA 5ICEA 5EF6A 2HQ5A 3QYBA 2KHOA 2Q0UA 4RGRA 3TKYA 1B8IB 2CQQA 1D4XA 4H0YB 4X66K 3MWMA 3O2PE 3ZSYA 1WBDA 2R7VA 3OSGA 2P6SA 5AQZA 2Q3SA 5ED4A 4U0YA 2L7MP 2FQ3A 1T8EA 3EYYA 4RGXA 4BBSJ 4FWNA 4OGCA 4DQRA 2G8VA 5CHIA 3K70C 1G3WA 1X3NA 1ZYRF 4PKGA 1IN5A 2XIGA 4A3IJ 2HBLA 2G8FA 4CFDA 1IXRC 4B1XB 3GXOA 2XGCA 5BR9A 1WSIA 1T8IA 1XGMA 1JCEA 4MLEA 4KKOA 4FSVA 4C1NK 1SQKA 2Q8KA 5AZJA 1J0RA 2IVNA 2R7WA 2JWKA 4EAHD 1TUUA 2XAUA 4DYRA 5E41A 2ASPA 2PFUA 4ZDPA 4H0OA 4DV1K 2JZYA 3RWUA 4M3FA 4OIPF 3PX4A 1LAWA 1WI3A 3DTEA 1IKYA 1L5UA 2HR3A 4CBUA 5C2DA 2CRGA 1NH3A 5C4XJ 5AFUA 3ERED 1H0MA 1NGIA 1R71A 1PUFB 1IGNA 4Z2YA 3PSFA 3BPVA 2R7ZJ 4FZYA 5FLVA 3P38A 2GWKA 4CGJA 3O6WA 2FRHA 1E4GT 5J2MA 4P9UA 5EG0A 3LDSA 1PDNC 3ABUA 2E2PA 2IS1A 1TKZA 3BG6A 2R5ZA 3CFRA 3SZ2A 4HV6A 1YJ9N 1I94K 4ELUA 4M6YA 1NK3P 4I09A 4JK1X 2O6GE 2A3ZA 2ZWHA 4LB5A 3MXIA 2M7AA 3PJRA 3ZLJA 4B4CA 2DPUA 2LG4A 2E7XA 3LSRA 3HOVJ 3OW2M 2V9PA 3H08A 2PMUA 4EGZA 4CHYA 3JSMA 1IV0A 4LF6K 1N25A 4KN4X 5BRDA 3BR3A 1BI4A 1WRJA 2WAFA 4IOCL 1PP7U 2BVLA 2P4WA 3HBTA 4J2AA 3G3ZA 3FZVA 3K9JA 5ICGA 4G7OF 2QSGX 3ZSRA 3UKRA 4CEOA 1WQ2A 4FXDA 4RB2C 2IXSA 3IP4B 2IS6A 2PFBA 4XLHA 1WVRA 2FBYA 2F4OB 3UKUA 2YR2A 1QVFM 1FZPB 2KFZA 2NRHA 2CFOA 2R5ZB 4CHZA 3VSKA 4FO0A 3VEPA 5EG0B 3JRCA 3HOSA 4NXNK 5KI6A 1FBUA 3G2BA 2MA3A 4NC7A 4UXNA 5IY5H 3MEDA 3OYGA 1SVMA 4XICA 2VQFK 4WQ5C 1J54A 4DLGA 3V9ZA 3RI4A 2RNJA 4W97A 1TL8A 1IRGA 1XHXA 4ENNA 3O5BA 3TAPA 4KHSA 1ZREA 3THWA 3TSUA 3CC4N 3ZN1A 4LIVA 2D5RA 2MG4A 4UUTA 4OX9K 2G8WA 3NWSA 5EZHA 4DV3K 4Y1DA 3S32A 3KZIC 3R0AA 4K2EA 2LYCA 3C1DA 4LK0F 4PDKA 3R9PA 4BR2A 1JL1A 1OR7C 3CFOA 3UIQA 3ZQHA 4HLYA 1B9FA 3MKYB 4OAZA 3ISNC 3QQAA 2YNFA 3FFIA 4FW2A 4RW8A 3T7ZA 1TK5A 3ZX0A 4BAYA 2BBYA 4JYAK 1I6XA 2QGUA 5LHGA 5EGOA 3E5QA 4XLFA 3NF9A 2ZB9A 3K5OA 5LMUK 2EQRA 4NLBA 2E5LK 4A62A 4KICA 4V2FA 3J7YP 3KLFA 1NKBA 2JVGA 4EJUA 2H6CA 4ETSA 3BCAA 5GADJ 3FMRA 1MDMB 4XLEA 3AVLA 3L4IA 4BVOA 2ME0A 4Y15A 4YG2F 2E1ZA 5D3GA 2YX4A 5ILSA 4D5FA 3LP2A 4CZLA 4ENKA 4L3QA 3V4IA 2L2OA 1SS6A 1Q1VA 1MD0A 1U04A 1SKRA 5M3FJ 3GF2A 1FNNA 2IGKA 3OYFA 2F48A 2LREA 1OYIA 3QPSA 2O61A 2Q2EB 1K6YA 3DOLA 2PI0A 3EY1A 4LB6B 1R23A 4BBRJ 3J7YJ 3QESA 4DWIA 4I98B 4QWQA 3T1AA 2CGKA 3RRHA 5J3LA 1R7JA 2P7VB 3I4PA 1XN7A 4N9HA 4DNCA 3OS1A 4OVLA 5JI6A 1BR1A 1REVA 1TKDA 3F22A 2E2OA 3BR1A 2MC4A 2LSNA 5C25A 2XHKA 3T1BA 3ONQA 1KU7A 3DXJF 2ISZA 1QQMA 5HRNA 4W1UA 2QSHX 4CEDA 3O9SA 3H6EA 1NGGA 2BTFA 2QWOA 3QFUA 5FPEA 4IF4A 4E1JA 3OSFA 2E2HJ 3VEWA 4DF8A 4L5JA 1F5TA 1HF0A 4CJFA 4DQ8A 3IWFA 4AIHA 1YJNN 3HEFA 4M3GA 4FWOA 4CJTA 4J19A 3L1PA 1GDTA 2QEXI 3KLGA 1N5YA 3CCVN 1U5TB 3GBGA 1U5TA 5LHIA 1HKTA 1R4MB 2XY8A 2YHXA 2ZXWH 1GUUA 4RLQA 4I7HA 4FWQA 2NAZA 2MD0A 2EFQA 3FBNB 2DOEA 5H6RA 1W9HA 1M1EB 3DLGA 1EV7A 2EZHA 4DTXA 2PAVA 5AONA 5AQQA 3KD1E 1R5HA 3S3MA 1LFUP 4F9OA 2IP2A 2A05A 1JLAA 3CF2A 3ZQQA 2L9SA 1FP1D 4UV8A 2P6TA 1VQNN 1E3MA 4YDUC 1MMAA 3BTJA 2I7PA 3L3VA 4JKCA 1ZAOA 1Q82O 1SVLA 2M0MA 2AP1A 1FEXA 3HRUA 1HQCA 4RGSA 5K1YA 5FLXK 3GTPJ 1NWKA 1Z67A 1BQNA 2OPPA 3G0ZA 4JD2A 5L3DA 1F21A 4DFPA 4XRMA 1T95A 1LVAA 3DBHB 3FMQA 2BXYA 2Y0SN 3ZMZA 5E3MA 2D45A 2IT0A 3JS6A 3EZWA 5KQ8A 3RMDA 3GLXA 4WWCA 3S2DJ 2QZ8A 5D6FA 5H6QA 5HDKA 1TL3A 2RDPA 3FXQA 2QSFX 1FYLA 3AO5A 3PX0A 3MCPA 5DM7F 3TOAA 2L4AA 3SCXA 1LQ1A 4FW1A 4EZ9A 3L9FA 4CZMA 1RIOH 4CK3A 1KD1O 3TPQA 4H5TA 3BR5A 5IOYA 1RT3A 2ZF5O 3KWGA 4PJLA 1IBKK 4AIJA 1ON1A 3TGNA 1N75A 1VQ7I 4WF9L 4XK4A 2XSDC 1VSDA 2R7YA 2R7SA 2VBXA 4OPJA 3TL4X 1YIJN 1YITI 1G4DA 2LMDA 5CY4A 4JI8K 2Y1JA 1IG9A 1R0AA 2H8WA 1OYWA 4X1EA 1JXSA 4D1QA 1DGKN 5LMNK 4DR2K 1NKEA 1S7OA 1MH4A 2ZNYA 3BG3A 3EPZA 3HRSA 4GFBA 5E79C 4L0YB 1R1TA 1F43A 2HNDA 3CJRB 3E6BA 4JKGB 3P7NA 1HDDC 3L0QA 3SMPA 4DFKA 5LHHA 4KH4A 4N9IA 2OA4A 2XDVA 2LD5A 4I2OA 4B3XA 3NAEA 2Z16A 3LSPA 4S0HB 2GXAA 1VQ6I 2K40A 2ZFWA 2X85A 3JW4A 3A01B 1NHAA 4C3JJ 3M8EA 5L3EA 4IHTA 4XRSG 3TAEA 3ZQFA 1QQOA 4A3KJ 3BG7A 3VQ5A 1BIAA 5DEQA 4LLNA 1FX7A 5J2PA 3L09A 4ESJA 1RTDA 3H9JA 1WCMJ 3TP3A 1PP8F 1C0WA 1XMAA 3AA2A 1SL2A 1L0OC 1QGPA 3FDYA 1GLNA 4FPAA 3DEUA 3B73A 1CGPA 2V51B 4UHTA 2R7DA 5HS7A 1KVCA 1HPMA 1FWZA 1BWFO 5E8IA 2VYPA 2KRHA 4BY9C 5LGTA 2EK5A 1X2MA 2V6EA 1YVUA 2MABA 3CLOA 4RM3A 2DPNA 3KYCB 3K7AJ 4K8ZA 4L5EA 5EZGA 4DBRA 1TGOA 4DV5K 5AQPA 1RETA 1S3XA 3G71I 4RAGA 1GLAG 3D7EO 3TTFA 1C0FA 1S9GA 3LNQA 5HLTA 5GAGP 5AQKA 1IXSB 1X3WB 2FD5A 2BGGA 4RM2A 4LIUA 3WG9A 4HSTA 1Y1VJ 3AARA 2JA2A 2NOGA 4BC5A 1J5EK 3SYZA 2M30A 4JKEA 4CEZA 2Q0OA 2B63J 3WU0A 2DOAA 4KYWA 2XPWA 1J5OA 1VQ7N 3JREA 4JV5K 4M3XA 2Y0MA 3MKLA 3MZ8A 2Y9YA 4XRFA 3SZTA 3G73A 1JLFA 2E1MB 4CEEA 3VB2A 4GKJK 4B1VA 2K7LA 2ZKZA 1B1BA 1H9TA 5LL6Z 1VQKN 3K58A 2I5UA 3QDKA 4FLYA 1OISA 2EB7A 4DF4A 4RLFA 1RDAA 4AM6A 1T0FC 5GAEJ 4PK4A 2DW4A 3DEEA 3E66A 2P7CB 1ZRCA 4JS4A 2G8IA 3SJMA 1Q86O 3LAPA 1GOBA 2DPDA 4HEA2 3GFMA 3LFUA 1HQEA 2XKPA 4IFEA 2L01A 1VK0A 2NRWA 3OTOK 5FLXZ 1C1BA 4HWIA 3B02A 1DP3A 2K3PA 3D0PA 3TABA 3H3UA 3N4PA 1MWMA 3LWMA 3SPZA 2WV1A 3AVJA 4GW6A 2LY2A 5DMRA 4U87A 2LF8A 4B09A 5AZIB 1VQKI 2ID6A 1ETVA 1B8IA 2WAEA 1CQTA 4XLNF 3AVGA 1B4AA 3EN9A 1MDUB 3HSTB 3ASOH 3HDDA 3CCUN 1QSYA 1YTYA 3WTUC 1ACIA 5B1AH 2ITMA 4FZXC 3U9ZA 2CGPA 4DGWB 3KKSA 4A93J 1XG1A 1R22A 1MBHA 1Y56A 1Z91A 2PQ8A 4IQ4A 4A3MJ 2ACJA 2AS5F 1ASWA 3TARA 1TP4A 1I39A 1X58A 5GTIC 3A0IX 4HHTA 4KITB 2FXUA 2EBIA 2LSOA 2IS4A 4EHUA 4HVJA 2WUSA 1S7AA 2PMHA 3GTJJ 1IUYA 4DLEA 3THVA 5ERIA 1WLJA 1Y39A 2YKNA 4CJKA 5BNGA 2JWLA 4IRIA 1WBBA 4B3SK 1S5JA 3K1NA 2HNZA 3A1YA 4HF2A 5AQYA 2A5XA 3KLNA 2KP6A 2M2EA 4HF0A 4FWKA 2DTUA 1JTYA 2COBA 4BACA 4NDLA 3DRPA 3ABMH 4XLCA 3ASMA 2WADA 2VPLA 5I42A 4FM0A 1EWQA 4EV0A 4CF2A 5LJVA 4RCHA 2HDWA 4IJAA 4KH6A 5TJJA 4XH4A 4CVNE 3VTHA 3L8BA 1VSEA 2HVIA 1TWCJ 2DMQA 1BUPA 4BQOA 3LAKA 3SDGA 4M9SA 3P83D 3T19A 5BN8A 2WOMA 2KIQA 4HTUA 1GXQA 1N33K 2M8EA 5K5RA 2AQFA 3RKYA 1G99A 3I71A 1H1VA 1KAZA 3FXJA 1YX3A 1TL1A 4CIGA 3U3YA 3SJHA 3NDKA 1RKTA 3GW2A 2R7QA 1R59O 3ATUA 3KLEA 1RRJA 3KP2A 2P9KA 4H0TB 1TYQA 3QEIA 3QWLA 1XUPO 3THXB 3ITHA 3CQYA 3D2FB 1YXQA 1SMYF 2X48A 4ASNA 1BI3A 2ZJRL 5JVGL 2ZJPF 3FLCO 2IPQX 3F6OA 1VQOI 4P9FA 3CCMI 1QVUA 1EWRA 4UVBA 1K7AA 1D0ZA 4LOCA 1K8KB 1U5TC 2STTA 2O03A 3S3OA 3ZYYX 3O08A 3K4MA 5DDGA 1BI4B 4E3SA 3TTDA 3ENBA 4XOPA 1AKHA 3SAFA 1QU3A 3HYFA 5JLHA 3A4CA 4OOIA 3ZP5A 5FO5A 5M1NA 3NGZA 3C7NB 4BE0A 1I1GA 1BISA 3MXJA 5E3NA 4CIFA 1X3ZB 5HODA 1MJBA 2DI3A 2VBZA 1YS6A 3CP8A 4ID1A 4KTWA 4FZZA 1QHTA 3F23A 4CJWA 4X65K 5IPAA 1ZG1A 4E89A 2VIXA 1P90A 2G8KA 2HHVA 4KMFA 3P39A 2Z3YA 4ABZA 4Y7NJ 1YS7A 1G15A 2A41A 3MWTA 4CJ7A 1XSVA 4M3RA 4CSWA 5FKMA 4UUSA 4OPAA 1X1PA 2XAJA 4GRIA 3ZEUA 4ISFA 4FLWA 1ASVA 1S29A 4A5NA 1W0UA 2L0KA 3L2CA 4KRFA 1XGOA 4B9VA 1Q9XA 1UHWA 3S14J 3JRFA 5AFUH 4DQSA 4BRDA 4FJKA 2NZTA 4MO5A 4CJLA 2VGNA 3LA2A 1O7FA 3LOCA 3HGYA 5BPDA 2WTEA 4DQQA 4CK1A 3Q0UA 5TGTA 4IEJA 2FMYA 3RSNA 4BEHB 3N05A 3M6GA 4EQQA 5H2FC 3F6VA 1XDSA 2ATQA 2ZCWA 5IYBJ 2WAQA 4L9TA 5D5VB 3TSPA 1MIJA 3H5AA 1BIBA 5E3LA 4CYCB 3KP3A 2MBFA 2OV7A 2GOMA 1BOAA 3OOUA 2VONA 5CVJA 2HI3A 3BJAA 5DM7L 3MAQA 1MZBA 1HYZA 1SKWA 1FPQA 2HYFA 5LRRA 3QEXA 4KHWA 2A68F 4WCGA 2DFFA 3KP5A 3MAJA 4KUMA 1ODDA 1WSUA 3ZETA 2OJED 1S22A 4JKHA 4E1NA 3KJVA 4LD5A 1NJYA 1NNEA 1LEAA 2E6MA 2K9SA 2O4GA 3DKWA 1U78A 1LWFA 3LAMA 4DMNA 3VYSB 1MNDA 4CD1A 2PBIA 4N0BA 1NU0A 3D5LA 4JI5K 2CMPA 2VG7A 5AQHA 3VENA 2DT5A 4HF1A 4BRQA 3BTLA 2BY0A 4Y17A 3BWGA 5B8HA 4JS5A 4DR1K 4F2SA 1ONVA 2HDDA 1IV8A 2EZKA 5E3OA 1X9WA 3TDUC 1TTYA 2ZFUA 3GOIA 1OH6A 1FJLA 2A40A 3OYLA 2ZC2A 3W6VA 2FBVA 4B8AB 2UWMA 3NVKA 3SAHA 3LWLA 3TMOA 2XSJC 1G8XA 3M3YJ 2FF3B 2EFNA 2R7XA 1FT9A 3LZJA 2LKSA 1ZARA 3F8BA 3NVMA 4DQ2A 1O13A 1XB4A 4LGWA 4U0VA 1J9IA 3ZT3A 3PQKA 4B8CA 4CEBA 1X1CA 1P92A 1HW1A 2CW0F 5TISC 4EATA 3OOPA 4IQJA 3HOYJ 4ZH4F 5J47A 1G59A 4ISEA 2W57A 2RNGA 2BY3A 2MYSA 3I0RA 1K9MO 4F92B 4YOVA 3SQ1A 2MGQA 3HXLA 2HZDA 4IDKA 4A3DJ 3MEXA 3NGIA 1IC8A 3QINA 4M41A 4FLTA 1EX4A 3LP1A 1X9SA 3GWZA 3AO2A 3H3VK 3G10A 4AIKA 3QU6A 4NXMK 2DMPA 2OPRA 3EKUA 5KQDA 5FPDA 4Q5SF 4MEXF 2GBZA 2QWQA 3LANA 4CBXA 1T05A 2OZMA 4E0DA 5IT9Z 3BC8A 1OH5A 3R4KA 3GTLJ 3GUDA 3F73A 4KB1A 3ERMA 1LWEA 1WAJA 2H94A 2MW8A 3K2AA 4F2RA 4DQPA 3K57A 5FROA 4BG9A 4GO1A 3U3GA 3AO1A 3OS2A 4GMJB 1F1ZA 1JKRC 1D0XA 3OYBA 3QP6A 4XKBA 2EFOA 3HGGA 3RCOA 3WTTC 4JK8A 5JMVA 3HK2A 4E7ZA 1FXXA 2KKOA 2XUBA 4NLCA 1EETA 1UMQA 4CHOA 2RF2A 1IN8A 1DGWY 2VKVA 1GT0C 3EL2A 1HNIA 2RKIA 4C8KA 2R7FA 2QWRA 4N76A 4HCBA 3V8LA 5LGNA 3VGLA 2M8GX 4XQFA 1IRFA 1K4SA 3HJEA 1T7PA 2RV8A 4DTRA 4A2AA 3O80A 4RTFD 3PX6A 2K9NA 3WQUA 1QSSA 1WJFA 4C8MA 2GEMA 3GTKJ 1A35A 2IIRA 2P9LB 3LDOA 2Y69H 3VESA 1PJRA 3V8JA 5JLFA 2NVXJ 2QXFA 5HROA 2K4JA 3G4SI 5BRHA 2DFHA 1POGA 5LRSA 1RDUA 4A59A 4IO9F 1NOZA 3TWHA 3OIOA 4HX4A 4LG0A 2CV1A 4Z4CA 2B9SA 3W3DA 3AVMA 1RGIA 1HKQA 2DTRA 2LBFB 4CJPA 3K4NA 6PAXA 2CW8A 4W5OA 2WY7Q 1XGNA 2DQRA 2QA4N 2HF3A 2QM3A 1K73O 3QERA 3IV5A 3ZMSA 4JHDB 3KLOA 2JA6J 3L2RA 2P0WA 4UVAA 5D5XB 4H8KA 3JRHA 2QQ8A 3GO5A 3KYDB 3PM1A 1BCMA 4NB5A 3LM9A 2DK8A 3D0SA 3V7SA 3RZDJ 4Y0WA 2Y48A 2YJEA 4GGGA 1GLFO 2KZZA 3QEWA 1EH6A 3LSGA 1TWAJ 1BW6A 3WNEA 3T1YK 4B3TK 4BRIA 1N78A 4JLHA 1A31A 2CW7A 3ZQIA 1ZBLA 4NCAA 4DZJA 3OBYA 1W7AA 2XV4S 1SC7A 3KLHA 4FLUA 3OR1C 1WJDA 2NS0A 1ZGWA 2QWWA 3CMMA 1FKOA 2NRTA 1C6VA 2YCHA 3VQ8A 2ZNZA 5J1EA 4DSJA 4YOYA 3PUFA 3QBXA 1XCBA 1HOMA 3LSIA 3DKYA 4XOTA 5AQLA 1D9FA 3H36A 1BBYA 2VKHA 4FJGA 2HXOA 2NVYJ 2R7TA 1BW5A 1TKXA 1AA7A 1ZBSA 4FK0A 1HXDA 3LM2A 1HNXK 2YX7A 4GXOA 5DD4A 4ZYGA 2RHKA 3O3GA 3ZMUA 1IUFA 2K9QA 4CZEA 1YJWI 4QCLA 1D5AA 1QQIA 1ZBIA 4YOWA 2R93J 3GZ6A 3O8HA 3VYTB 1T33A 3M7GA 1BN5A 3NAUA 4C2MJ 3AVNA 3CQXA 4WQ5A 4W5QA 4JI0K 1NKCA 2OTLN 4HV5A 2HMIA 3NEUA 4I9LA 3PLAA 3A01A 4DOZA 2GX9A 2K02A 2YHWA 5DK5A 1HJOA 1U6GA 4RGUA 3BR2A 2LKPA 3HXMA 2CGJA 1NG6A 2PEXA 3KZYA 3O4WA 4WX9A 3VN5A 2GLOA 3JXUA 5DV5A 3DOKA 1T2KA 1IKXA 1IG8A 2AXLA 4E7JA 1RR7A 3MEEA 2X1EA 1IO2A 3SQ4A 2O8EA 4FVMA 4CJQA 3CCEI 1SFUA 3WEEB 3EDPA 4M9ZA 1JJ8C 4FASD 1USSA 2COMA 3S1MJ 5LEKA 1BIUA 3U21A 2KW4A 3MK6A 3VEZA 2XASA 3L2WA 4LH5A 5JVGF 1IJJA 2P9LA 1TWHJ 3RTRA 4WQ4A 3SQ0A 5BPIA 3Q7CA 3CJ9A 3R8EA 2KPMA 3X2QH 2Z1JA 1RDWX 3WTSC 1V54H 3PNVA 3T69A 1RZ4A 3AV9A 1ZR4A 1YW8A 4EMSA 3HSFA 2QA4I 4OIOF 3O9TA 1BJZA 5L3BA 2ZSIB 1QHAA 3U2RA 3ZMVA 2QKBA 2D1KA 5EJCA 4EJOA 1LE8A 2HOEA 5E1ZB 2K86A 2GXGA 1FMVA 1P2FA 3M1CA 2ZMEB 3QPTA 1I5ZA 4IRGA 4RMNA 3RJPA 3IRRA 1ZH5A 4B9SA 3ZETB 3CCRN 2EIJH 4QS8A 1VSJA 3I4MJ 1WFXA 2ELKA 5AQJA 2ELHA 2W85A 2LC2A 2VXZA 4FX0A 5D5UB 4C2UA 3N4MA 2L7ZA 2OPTA 3H5RA 4PJJA 4KO0A 1W7PA 1ZG5A 3A2FA 1WJ5A 2LVSA 3RMAA 4S05A 4MO7A 4G8XA 4LFBK 2F8SA 1VQMI 1U47A 1YIJI 2HHHK 4M3TA 1HUXA 4II2A 1LFPA 2JTVA 3F8NA 4H4MA 4OMZA 1XCVA 2IBDA 5CLSA 4B1ZA 5M5YJ 2Z99A 2CUJA 2VT2A 2EV0A 1JKHA 4JKAA 4JKFA 1S6QA 2L7KA 4BREA 2OCEA 3HKZN 3KE2A 3WTZA 1AOYA 1YHQI 2PY5A 1HSJA 2A6EF 4FWRA 5IT9O 3CCJI 2Q1ZB 1Q81O 4M74A 4DBQA 4A3GJ 3CO7C 2O0YA 1CZBA 1H9GA 3VGKA 4DSFA 2PZSA 4GV9A 4LLLA 2B4JA 4CZIA 1XNQK 3LDQA 3BG5A 5CVUA 4DTSA 3SI6A 1ZC6A 1DP7P 4KB0A 3PIOL 3J80Z 1VTNC 3ZQGA 3SUOA 3MEGA 2GBYA 3BG9A 1VQMN 2GIZA 3LQQA 2UYTA 1OKJA 1TV6A 3M5RA 3V9WA 4CJSA 1ZR2A 4DU1A 4CZJA 2PJRA 4BC2A 4MFDA 3MFKA 3V9SA 1WJAA 5I3UA 5FRMA 2GAUA 5AQUA 4M63C 4CFAA 3M9AA 3WT0A 2O8EB 4BR0A 4G6DA 4DIQA 4UY8I 1SMTA 3I0SA 4H5VA 3BLYA 4KA4A 1ERDA 3J81O 2IAIA 2XF7A 4KAZA 3VYUB 3E0JB 1NJWA 2UUAK 2HPMA 4U0WA 1LUJB 5F2RA 4E19A 5AIPA 3OJUA 1OVYA 2JLEA 3HT3A 1R36A 1JI8A 3THWB 1VQ6N 4IO8A 5D8KB 1W5SA 4D9JA 2GUPA 3B6AA 2NRZA 4CW7B 4CE9A 4G7ZF 2XY7A 3CDIA 1BJAA 4O5VA 2IVPA 2OPSA 3NBPA 1ESVA 4WE1A 4CZKA 4DUYK 3ZRGA 1TW2A 2PJRB 1X2NA 4EJTA 4HRIA 3Q5FA 4JHDA 4O4GA 4BWJA 3GFLA 2FOKA 3M1EA 4EGYA 4KIFA 1QQCA 3CJQB 3AG1H 3CCYA 3T0YA 5HNFA 4BXUA 5JVTA 3FHZA 3D1NI 1JHFA 1XMKA 1ATSA 4E7SA 2BH1A 4HYEA 1IDZA 3K4KA 5CYMA 1XC9A 3ZMDA 1Z25A 1T0FA 1ZK8A 3COAC 4BYYA 3RSEB 2HQNA 1J59A 2CH5A 2FC0A 3H46O 1FW6A 1A04A 4A5BA 4N41A 2TRTA 5J4YA 2Z2SB 4LITA 1MGTA 3S1RJ 2DXIA 1EP4A 2P9PB 4DV0K 1N32K 4DSIA 4FQGA 2PN6A 1KVAA 3ZN0A 4ENJA 1V4RA 3ZPLA 4WXHA 5FFZA 4H03B 1GLLO 3G1OA 5J1RA 1XS9A 3HP9A 4CHQA 4HPQA 1HDPA 1ASUA 1V4TA 3EETA 3ZEUB 2H1LA 4C3IJ 1VSIA 4XH1A 3KPHA 3JRAA 4IG0A 1SD6A 1FOYA 2CH0A 3RKWA 3I5UA 4YOTA 4DV4K 5E20A 2P9UB 4WYBA 2O8BA 3LA7A 5HLFA 4QTRA 2ELJA 1N34K 4V2GA 1HMVA 5IYDJ 1XQSC 4U7DA 2GM4A 3SNNA 3ZXSA 2DMUA 3AAPA 3G6EN 5AR0A 5BPNA 3ULEA 2Q36A 4YIRX 5F08A 4E4HA 3C7NA 4XEIA 1KFSA 4IZ9A 4C3HJ 1DQUA 3C6HA 4I6MB 2ETHA 2FXAA 5KAFC 2E4LA 5LEJA 2QWLA 5HS9A 4L0ZB 2NS7A 5EU7A 1ZGAA 2QVOA 2VB6A 1D1CA 1SD5A 4XSZF 5F0CA 2VG5A 3C0BA 1YJNI 3PL8A 3CCSI 3RVCA 3S2WA 3TW6A 3QAHA 1VSHA 4F93B 5H20A 2NNYA 4M3UA 3AG4H 1NLVA 1RNHA 3KWIA 3FXOA 4KHUA 3SMSA 1KONA 4IXCA 4R8HA 3HIFA 3K2ZA 1RTHA 1KXPA 3U8XA 4BR5A 2XC7A 1S9HA 2EV5A 2HS5A 4YIIA 3JAMZ 4F4KA 3THXA 5BMZA 3FXKA 3LSMA 3I8BA 3RR7A 2VJJA 1P4AA 1T44A 3DXMB 2QQBA 3CP2A 1UAAA 2Q31A 1ZELA 3ZT0A 3GYHX 3AVHA 4LF8K 4QSHA 1WNSA 3WNFA 1C0TA 1BR2A 1WKMA 5K7HA 3ULEB 1MH3A 2VJ4A 3I58A 3EE9A 2X6OA 2YJFA 1FBQA 2JN6A 3OYCA 3OYMA 2Y1IA 4B9UA 1SD4A 3V6DA 3EQLF 4A69C 2RC4A 1K6OA 3K5MA 2E19A 3SFZA 4A5AA 3HC7A 2JT1A 3C65A 4BWMA 3RMCA 4PJNA 3DLAA 4N4OB 2Z1HA 3MMYB 1YW7A 4MFEA 4AVZA 1LEBA 2I8DA 3IH3A 4B3AA 3IKTA 1RESA 5ILUA 1TC3C 3JR9A 3DAWA 3T3FA 3WXIA 3PV8A 2FSJA 4RAZA 2DO7A 4O3MA 2VJ5A 3V7CA 3CMYA 4GVMA 5EXWA 5KRTA 2YHYA 4X0GA 4G7HF 4MQ3A 1YTUA 1W5CC 2DYRH 1AWCA 1OFCX 4IPAA 3OYKA 4ISGA 5AQRA 1KSPA 4J2EA 4A61A 2UXBK 3FZHA 5M1FA 1VSFA 4YRVA 3THYB 2JUGA 4FVUA 1EO1A 1U2VA 4XBFA 2V9KA 4XN3A 2P5KA 1BDGA 3HOXJ 3CHWA 4AHVA 4B3OA 2I7NA 2V7FA 1WAFA 2DT6A 1QZEA 3FFKB 5C12A 5AZIA 1G2HA 4IOAL 1X1DA 4CZFA 3E6MA 5IYCJ 3I59A 3SJJA 4GYIA 5BR8K 1GHCA 2ZBKA 2BUPA 3M8QA 3GTMJ 3ISPA 1TK0A 2OTJI 4AD9A 4CBWA 3VQQA 1IN7A 4UB6C 1Z1DA 2D0PA 2YU3A 3CJ1A 4K8XA 3F9MA 3T5XA 1KVBA 4DTOA 2GA2A 1VRUA 2FNPA 1KQ9A 1BOBA 1D1BA 4BXXJ 2F5EA 1OMIA 2DLLA 2M3AA 2VBWA 2STWA 4C8NA 3VPRA 4DS5A 2OPQA 3AGRA 5JR3A 3OMYA 3OHRA 4GCVA 3KP7A 2DFIA 3CJAA 4K25A 1HW5A 1RCHA 2VBYA 4CF9A 3FZKA 2ID3A 4H5RA 2A69F 2E1MC 2LTPA 2MH9A 3PIPF 3ZQLA 4MQ9F 2XF6A 1KTQA 2E8AA 2HF4A 4B08A 4CZZA 4ZYHA 2WBNA 2DMTA 3CCUI 1G3TA 3VF6A 1N6QA 2FBKA 3M3ZA 2FEZA 4M7YA 2ZO4A 3JRIA 2EWNA 3HZJA 2IGMA 4HNVA 2HQRA 3ECOA 2VODA 4ILHA 2K9MA 1WSHA 4A3JJ 3UKRB 3QEPA 3BOQA 4KFCA 4ELVA 3WNGA 4FM2A 1V5EA 4XH5A 4DW6A 3VA3A 3KP6A 1IDYA 3MXMA 3ZQ7A 4H0EA 4DCHA 3WTVC 1SV5A 4ELTA 3WXLA 4AHSA 2VQEK 3RQIA 4FJHA 2E88A 4A6DA 3FXMA 3KETA 3HTSB 4B3MK 5JHUA 3DPUA 2OF7A 3CMAI 4ZTFA 1JT6A 3MN5A 5FPMA 4M45A 3QOEA 5HDGA 1A5XA 2E5ZA 3CMEI 3KZZA 4JD2B 3GLLA 5F64A 2DA2A 1UWBA 3CFPA 3MD2A 3VQEA 3FXRA 1T6DA 4EZ6A 4LG3A 5KVRA 2FBHA 2ADUA 2VQLA 3M8FA 4MHGA 4Q4ZF 1TZLA 3F8FA 4HNUA 5M3MJ 4IX7A 2EJRA 3OYIA 1ZRDA 3HPOA 5CVIA 1O3TA 1K83J 3HM5A 2JA8J 3F2KA 4MO4A 4AH9A 5AJ3K 4DG1A 5CQGA 3LFKA 2YX6A 1LJ9A 4O8KA 2J5OA 5AQTA 4F3TA 3KFWX 1HA8A 5KNLA 4N4NB 2NVUB 1ZRFA 2OAZA 1D5YA 2VWJA 2GZWA 3W2WA 5KAIC 5HLGA 3PIOF 1YI2I 2P9SB 1YVNA 4GNIA 3BP8A 4KH5A 5AQSA 3M8SA 2WTUA 3CCJN 3BDPA 4WFBL 4AHUA 2EZIA 2G0EA 2WBMA 2RPIA 4DR4K 4IRHA 2OTJN 2Z1DA 2DA5A 3PO3J 1MBEA 4CJEA 3S2HJ 2K5CA 4CI6A 3MZHA 1TK8A 4OAYA 5J8FA 3DRSA 3J7ZO 1VQON 3VEVA 1EA3A 1TYQB 4BDZA 4G9YA 5CJ9A 4F7ZA 1WN7A 3VQDA 4CF8A 3DJCA 3SXYA 4CGHA 1Q18A 1W2BM 4O55A 3I56I 4O5BA 5K7FA 3M8JA 5HBMA 3MKWB 4CGDA 3S1NJ 1U48A 2E35A 3EO3A 2FSNA 4NYFA 1REPC 4CFCA 2EH3A 3F0CA 3FX3A 4FLZA 4A0XA 4BRFA 1J2XA 2LFBA 3HSRA 1C0UA 2V1XA 3ZT4A 2HHXA 2HHQA 3LSKA 3F8MA 2A6TA 4IOAF 1Y8RB 4A3EJ 4JQFA 4OLBA 1LFBA 2OC6A 2RQQA 3DQVC 1IH7A 2V79A 1BOTO 5HRSA 4HQMA 4EP4A 3E7LA 5EEGA 5LY3A 4FM1A 1BL0A 4UQGA 1OCCH 1NK4A 1MDMA 2M9HA 3CJCA 4D0PA 1J9AA 1UOCA 2MH2A 3WU1B 1S1XA 2L9NA 2QTDA 4YNQA 3NHGA 4M73A 2DTZA 3LP3A 3DTKA 2IS3A 5SZTA 1SAZA 3RYPA 4IO9L 4IL6C 4GVEA 2ZGZA 4EM1A 4FJMA 3OL3A 4DSEA 1JGGA 2ZJ2A 3LPTA 2CO5A 5FKLA 1QE1A 3WXMB 1RBRA 2XPVA 2HHWA 4P96A 4B43A 4YORA 1IRXA 2OQGA 5DYMA 2XO7A 3K59A 1FC3A 4UUVA 1MMNA 4CF0A 1YITN 3WQTA 2VGMA 4IHVA 1ZXOA 1RBSA 4RAFA 2OZSA 4PUSA 1XSXA 3RYRA 2E1YA 4M9XA 2QCOA 1P7IA 1Y1WJ 3SUQA 4RDUA 1KU2A 4DFJA 4FETA 4B47A 2Y75A 4A6EA 1ZN2A 1DGRM 3D5SC 2KIMA 4LLGF 3WODF 1B72A 5DCMA 5H1SQ 2K27A 1FSHA 1RNLA 1HRHA 1JUSA 2KJBA 3Q9SA 2EV6A 2A1SA 3AA3A 3JRGA 3CERA 1W97L 1XD7A 2K4BA 3BJOA 4YEJA 1VQLI 2VWBA 2AO9A 3H1VX 3MWPA 3O3HA 2KZMA 3CPWM 4CJVA 5E1XA 3AO4A 3CUQB 3T8RA 4BKXA 4H4OA 2BW3A 3D2FA 3K2PA 4FL9A 1QA6A 2E2IJ 4J8FA 1XMQK 2AA4A 2GIVA 2LRDA 1C0GA 2A1RA
chains in the Genus database with same CATH topology
4KHNA 2PYJA 3KKRA 3CZ6A 5KHDA 1BQMA 5HOOA 4DFMA 4CGIA 3DTIA 1WSEA 3DPTA 2X6XA 4J01A 2F4IA 1RBTA 4IKFA 2RREA 4J00A 2WA0A 3QODA 1FK9A 3ZCOA 4LSLA 1VZ0A 3ZSQA 5T7BA 4BL0B 3CG7A 3B6OA 2AQEA 3J7AY 3C95A 2IGOA 2KL4A 3VYRB 2O5RA 3AVCA 4BE1A 4KHYA 1NJZA <