1K6YA

Crystal structure of a two-domain fragment of hiv-1 integrase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
192
Chain Sequence
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structure of a two-domain fragment of HIV-1 integrase: implications for domain organization in the intact protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 65
structure length 192
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1k6yA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1k6yA02
3K5OA 5E41A 3KD1E 3VQPA 3RMDA 3LZJA 2P1JA 2RPIA 4KHSA 4DWIA 4KV8A 4AHVA 3ZT4A 1ZBHA 4NYFA 4CFBA 1T7PA 1WSFA 2VG5A 1TV6A 1B9FA 3AVAA 3NAEA 1WSHA 4DSFA 4ELUA 4GVMA 5HRNA 4DQRA 2P5GA 4CF1A 1RDCA 1ZBUA 1VSIA 1KVAA 3K58A 1S5JA 3AVHA 2HHXA 3O3FA 4DTJA 4MQ3A 1CXQA 4FW1A 2D0CA 3L3UA 4FLWA 4FZZA 4B9UA 1EKEA 3NDKA 3I8DA 2DY4A 4OVLA 1NKCA 1K6YA 5KI6A 3SQ2A 2X6NA 4E7KA 2B6AA 1TL3A 1QQCA 3NGYA 4F3OA 4FLXA 1S6PA 1JLAA 3ISNC 5HRSA 3AA4A 4BE1A 1YVUA 1S1VA 1VSEA 4CHQA 3TAPA 4F3TA 4PUOA 1L3VA 2YNFA 1LV5A 3EZ5A 3UIQA 4R5PA 2YNHA 4CFCA 4XIUA 4DSKA 2Q3SA 4HUFA 1U04A 1NK4A 5FRNA 1KLMA 4FJ5A 4BDZA 4KO0A 4W5RA 3KK3A 1RDDA 3DLGA 4ELTA 2ZQBA 3AVNA 3KK1A 1RBUA 1WLJA 4AHCA 3AA5X 3PO4A 4KHYA 3DI6A 1QTMA 4FZXC 4L8RB 5HBMA 4M41A 3ZSWA 3LPUA 3SYZA 2BGGA 4HUEA 1RBTA 3HM9A 1J9AA 2E4LA 3PX6A 1KSPA 1VSMA 4KAZA 5D3GA 4CEFA 3HJFA 3DYAA 1KVCA 3AA3A 3K2PA 3AVLA 1HNVA 4KTQA 1T8EA 4OKEA 4O44A 3TAGA 3THVA 3OYIA 2O4IA 3ZSRA 1WSJA 3QINA 3OJUA 1HMVA 2KFNA 1JLEA 3RWUA 3CFPA 3AVIA 3A2FA 3CFOA 1YT3A 3QERA 4LSNA 3OYEA 4FM1A 4FLVA 2HW3A 4CJVA 5HRPA 3O4QA 3RR8A 5KGWA 4CEAA 4CJWA 5T7BA 4FLUA 1Z26A 3QEVA 4QAGA 1J53A 2YHBA 4KKOA 4CJTA 1QSLA 1RT4A 2B5JA 3OS1A 4ZTFA 2D0AA 4AHTA 3L8BA 1RBVA 1U48A 3ZSXA 4CIEA 4CF2A 3TWHA 4J2DA 1XHXA 3OYCA 2G8WA 1LWFA 2VG6A 2YNGA 4KHUA 4CJSA 5FRMA 4DS5A 4E7LA 3MXJA 3ZSZA 2HVIA 2JLEA 1Y97A 1LW0A 4NCAA 1LWCA 3MEDA 3LPTA 3U3YA 4LH5A 5I3UA 1YTAA 3AO2A 3KKRA 1SL0A 2E6MA 1UAXA 2IDOA 4Z4GA 4OPJA 3OYAA 3KKSA 4JLHA 3LP0A 3DLHA 3V1QA 5CZ1A 4ID1A 3P83D 4E7JA 4IFVA 4BE2A 3AO3A 4AH9A 1TKTA 3M8RA 1QE1A 4DQSA 1TK0A 4Q0BA 1WJAA 3EY1A 1NKBA 3NH1A 5HLFA 4FM2A 1LAWA 4IKFA 1ZBIA 4DSJA 4CGGA 1HYSA 1S9GA 4CHOA 2Z1IA 3MXMA 4EZ6A 1TL1A 3VQEA 4E0DA 1IKXA 4M3XA 3VA3A 1YTUA 4W5QA 4B9LA 1RT1A 2FBXA 1KFSA 4KPYA 4N41A 3AVKA 5J2NA 3PY8A 4DU1A 4Z4CA 3RRHA 4B08A 4RW7A 3OYKA 1SKWA 1HQUA 3RMBA 4CF8A 5J2MA 1W0HA 3ZSOA 2D5RA 4E7HA 4O55A 1RTDA 1RT3A 1WAJA 4H4OA 3NE6A 3OYGA 3V1OA 1WJEA 1RT6A 3WNHA 3TI0A 1SL1A 4CJUA 4JRPA 4KHWA 1HNIA 2E6LA 4M42A 1C1AA 4PA1A 2Y1JA 3ZT2A 3OYDA 3TR8A 3LWLA 4CE9A 1ITGA 3KLEA 1X9MA 3QNNA 4ZHRA 3L2RA 3C94A 1JL1A 4YFUA 2ITGA 2RN2A 3KLIA 3AA2A 4IG0A 2NUBA 1EXQA 4AHUA 3VQ8A 2OPRA 3NHGA 4FLYA 4W5NA 1IKYA 1TKXA 3O3GA 2OZSA 4IDKA 4CJ5A 1DTTA 1IKWA 3O4NA 5J1EA 3LWMA 4CJQA 1L3TA 4OKKA 1KLNA 1C0MA 1RBRA 1R0AA 1J54A 1LWEA 4DLEA 4F8RA 3AVMA 1UOCA 1S1WA 4CHPA 1NJZA 4KTWA 1KRPA 1I3AA 2FBTA 3NH0A 1VSKA 4CEZA 4CGIA 2XHBA 4QCLA 1KCFA 4NYNA 5CY4A 4CJKA 5I42A 4N56A 1Q9XA 4FJXA 1ZBLA 1D9DA 1G15A 2G8HA 2ZE2A 3QEXA 4OPKA 3K5NA 4CERA 4CEBA 4YNQA 3VQ9A 1CZ9A 1NK9A 3T1AA 4WE1A 4ELVA 4F3QA 1TGOA 3S3MA 2OZMA 4FJKA 3OJSA 4FJNA 1EX4A 1JKHA 1S1TA 3VN5A 2IC3A 1T03A 4CIGA 3V6DA 2PYJA 2W42A 1BGXT 1IG9A 2BE2A 1X9WA 1C1BA 1NJWA 3OYJA 4HUGA 3OYMA 4E1NA 3ULDA 3DLKA 3SPZA 3SV3A 2G8KA 5JS2A 2VWJA 4HTUA 3LALA 3AVFA 4E19A 3TANA 1BISA 1C0UA 1CZBA 3V9SA 1U49A 1QSYA 4I7FA 4B9SA 1BI4A 2KTQA 4CF0A 2BDPA 1B92A 3MEEA 4RW8A 4OLAA 3BGRA 1RCHA 2PYLA 4BWJA 4AILC 4DFMA 4CCHA 1CLQA 4CFAA 3TAEA 3SQ0A 4CJEA 4Y1CA 1ASUA 1VK0A 3DOKA 1VSHA 3H08A 3HVTA 1GOCA 4O0IA 4DTNA 4O0JA 1RTJA 3TAFA 1MU2A 1RTHA 4J2BA 1C0TA 2KW4A 3G0ZA 1A5VA 2DFFA 3SPYA 5C42A 4M3YA 3LAKA 4PY5A 3NGZA 4LY7A 3HK2A 5JS1A 1TKDA 3DLBA 4ICLA 3QLHA 3HPGA 4FJGA 1RILA 2YV0X 4DS4A 3AVGA 4FCYA 3SUOA 3AVBA 4FZYA 3QEIA 1BIUA 1JLFA 2QKBA 4HHTA 4DU4A 4NCGA 3NH2A 1A5XA 2G8FA 3B6PA 4FLZA 1O1WA 2OPQA 4FM0A 1ASVA 1ZBFA 3LP1A 5CYMA 3WNGA 1B9DA 3HVRA 4FJ7A 4CF9A 4DQIA 5CZ2A 3L2VA 4M3UA 5DMRA 3HPOA 4I2QA 2F8TA 1RNHA 4CJRA 4DFKA 4ZTJA 4C8OA 1SL2A 1KFDA 4ID5A 4UQGA 2OPPA 4QOZB 1DTQA 1FKPA 4HCBA 1NJXA 3T3FA 4C8KA 1IO2A 1BQMA 3HP9A 4E89A 1VSLA 2XRIA 3P1GA 3QNOA 3HPHA 4FW2A 5J2PA 1UWBA 2ETJA 3DMJA 1RDBA 3AVCA 4IG3A 3L2WA 3AVJA 3KIOA 2HNDA 4DLGA 3QESA 3S3OA 3V9XA 3WNFA 4JS4A 1N5YA 4KHQA 1F21A 2HHUA 1TK8A 1SKRA 4E7IA 4Z4IA 1XC9A 4RW6A 3G10A 2LSNA 3MEGA 1WSEA 3SUQA 1XHZA 1ZYQA 3C6UA 2XY8A 3ZCMA 1HPZA 3K59A 2R7YA 1NK5A 4KB0A 2AJQA 3T19A 3NCIA 3CM5A 3V4IA 1NK8A 2P5OA 3DLRA 4CECA 4CGFA 3L2QA 4E3SA 1JLQA 3VQ4A 3HL8A 1Q9YA 4HCCA 3KLGA 4H4MA 2QKKA 3TABA 2HMIA 4K8ZA 1L3UA 4LD0A 3ZT3A 4DTSA 2ZD1A 1BL3A 5K14A 1S1XA 4F4KA 3PO5A 1WSIA 2FC0A 4GW6A 3CM6A 4OLBA 3QETA 1RT2A 2EX3A 1C6VA 3RMAA 1EP4A 4G1QA 1GOBA 3LDSA 3SJJA 1VRTA 2D0BA 3C95A 4KTZA 5EU7A 4N47A 4B8AB 3SNNA 3LP2A 2OA8A 1NOZA 1X1PA 3I0RA 1XWLA 2G8IA 5SZTA 3SI6A 4KRFA 3ZSYA 4W5TA 2KQ2A 1QS4A 2RF2A 3SUNA 4FJLA 3RMCA 4CGDA 3V81A 1HJRA 3CG7A 2YKMA 3HSTB 3SCXA 1EETA 4DTXA 2Z1JA 2DFEA 3VA0A 2HHQA 1LFPA 2KFZA 2XO7A 3PUFA 4CGHA 2GV9A 3ITHA 2QXFA 5KTQA 3VQ7A 3CQ8A 4CHZA 2P51A 1U4BA 1KVBA 2G8UA 3K5LA 4DFJA 4DSLA 2Z1GA 4I9LA 3VQDA 4CJFA 4CFDA 1VSFA 1SKSA 4DMNA 3HT3A 1FK9A 4B9VA 3NGIA 4BWMA 4RW4A 2X78A 4CK2A 3TAQA 3OS0A 4OKJA 4CGJA 3TAMA 3SZ2A 2HNYA 3VQBA 4CJPA 3S9HA 4B9TA 3ZT0A 4CK3A 1HYZA 1S9EA 1RT5A 2YHAA 4CESA 4I2PA 1VRUA 5HRRA 2QK9A 4Z4EA 4CEOA 1D8YA 2B4JA 1T05A 4I9QA 3DRSA 3NF8A 1MW7A 2HHSA 4DTUA 2IGIA 2IAJA 4O4GA 4TSXA 3VQ6A 3VQQA 4DFPA 3AV9A 4FJHA 4KI6A 3IRXA 3OYFA 2YNIA 3AO4A 4DTMA 4M3WA 3D0PA 4KI4A 4CEQA 2HHVA 1GOAA 1LW2A 3OS2A 5HROA 3DRRA 4LH4A 4Y1DA 1JLGA 4K8XA 3OYLA 1UA1A 3KLFA 1RDAA 1TAQA 3KK2A 4KREA 3MAQA 3NF7A 1E0EA 1C1CA 2JGUA 3LZIA 3RR7A 2GUIA 3DM2A 3KTQA 4OGEA 2KZZA 2GBZA 2YKNA 1Q8IA 1BHLA 3D45A 3I0SA 3LAMA 1FXXA 1TKZA 4IFYA 4CIFA 1RTIA 5DK5A 1L5UA 3QIOA 2X74A 3C6TA 3V9UA 4OGCA 3RRGA 2FBVA 4FK2A 3PX0A 3F9KA 4DF8A 4DTRA 3QEPA 1TK5A 1SUQA 1NK0A 4EZ9A 4KHNA 3IG1A 5FROA 4M45A 3QEWA 3U3GA 3LANA 4AHRA 3V9WA 1NOYA 4MFBA 1A5WA 3NF9A 1CXUA 5KGXA 4J2EA 2HHTA 3V1RA 4FJMA 3HYFA 1RBSA 1REVA 1BCMA 3ALYA 4CJLA 1QSSA 1TVRA 5FDLA 1U47A 2I5JA 4FJIA 2RKIA 2WONA 1WJFA 4CK1A 2X6SA 3NBPA 3ZSQA 3VQAA 1BCOA 3SQ4A 1VSJA 4RG8A 4PQUA 1BI4B 1S6QA 4RW9A 3ASMA 3S3NA 4C8LA 2XY5A 4M3RA 1NJYA 2A1SA 4CJ3A 3M8QA 3O3HA 1X9SA 4FJ8A 1SV5A 2IS3A 4H8KA 1L3SA 2DTUA 4DSIA 3HP6A 4JS5A 4BDYA 3V9ZA 1RT7A 4JRQA 1IKVA 4DTOA 2WOMA 3K57A 1Z25A 1KTQA 4W5OA 4OJRA 4FJJA 3AO5A 4DF4A 1HRHA 2HNZA 1JLBA 2Z1HA 3LP3A 4C8MA 4CEEA 3BDPA 5C25A 4B9NA 1WN7A 2F96A 4EP4A 3KJVA 3WNEA 3OY9A 4NCBA 3L3VA 4N5SA 3ZSVA 1WJCA 3OYHA 1BIZA 1NKEA 3HO1A 1UA0A 4BACA 4DTPA 3MECA 3IS9A 4PWDA 3ZT1A 4FXDA 1WNSA 5KRTA 4FLTA 4BE0A 1U45A 1HYVA 5J2QA 4O5BA 4B9MA 3DLEA 4AHSA 1ASWA 4CHNA 4F2RA 5KRSA 4CEDA 4DG1A 1W9HA 1J5OA 3U6FA 4E1MA 3PV8A 2EHGA 5CYQA 5SWMA 2XY6A 2ATQA 2DFHA 1IH7A 1I39A 1S1UA 2VG7A 2OYQA 1DLOA 3QO9A 1NK6A 2BANA 3M8PA 4BDPA 2O4GA 4N76A 3E01A 1BQNA 1XI1A 2PZSA 1WJBA 1JL2A 1FKOA 3AO1A 3OVNA 2OPSA 3P5JA 4C8NA 3K5MA 3SQ1A 4DQPA 4FJ9A 3L2UA 4M3ZA 3VQCA 3FFIA 1D9FA 3TARA 4Z4HA 3KD5E 3JSMA 3RTVA 1JXEA 3B6OA 4J2AA 1TAUA 3KLHA 4DQQA 1NK7A 3OYNA 1D5AA 4B8CA 2XY7A 1KONA 4IBNA 3HXMA 4FYDA 4M3TA 2HVHA 4KB1A 3VQ5A 2FBYA 2HHWA 3QIPA 3JYTA 1HQEA 1JXBA 4GMJB 4LSLA 3F73A 2Y1IA 3IAYA 4CHYA 4FK4A 3PX4A 3NFAA 1WJDA 3MXIA 2PY5A 4Q5VA 4KFBA 1LAVA 3M8SA 3SUPA 5HP1A 2F8SA 4Z0UA 4F2SA 3CFRA 2G8VA 4Z4FA 3OYBA 2HB5A 2A1RA 4CJ4A 4B3OA 4EP5A 5C24A 2KZMA 4DSEA 4HVJA 4DU3A 3DOLA 1QHTA 3DRPA 2VWKA 1WSGA 1JLCA 3CYMA 3EYZA 1VSDA 1WAFA 4FK0A 3NF6A 4FVMA 3SV4A 2IOCA 1N6QA
chains in the Genus database with same CATH superfamily
4QS8A 2NNYA 4KHSA 3DAWA 5KVRA 3U21A 4UB8C 1J5EK 2KFDA 4ITVA 4B1YB 1S5JA 2FBHA 2W00A 5H20A 4UUSB 1LNWA 4JI0K 5BNGA 2RN7A 4PL7A 4XORA 1FJGK 1ETQA 3NQOA 4YG2F 2LMDA 2JJ7A 3AA5X 3ZLJA 4YDUA 2QCOA 1SZ2A 1KSPA 1YX5A 2ETHA 2DA1A 4BG8A 3THVA 4JKGB 4FX4A 4F91B 2O8XA 1IZ1A 2JWLA 4BC2A 3CF2A 4JKDA 4IO8A 2VC1A 1TLHB 1FY7A 3Q9SA 2A69F 4NLCA 1FW6A 1OKJA 1HLVA 1PUEE 1UZCA 4C2MJ 3A02A 2IDOA 3ID8A 4BQNA 4D7MA 4BE2A 3JTHA 3ABUA 1WB9A 3EY1A 1W36C 3J7ZO 1BJAA 1VQ9I 1TL1A 2QWLA 1YTUA 1EWRA 4O55A 3WEEA 5BRFA 1WAJA 2BY1A 3WNHA 2E19A 4YELA 2P6SA 5GADP 2KRCA 1IXRC 1ON1A 3ZGKA 3O3GA 2OZSA 3LWMA 1L3TA 2NZTA 3QAHA 2EA2A 3AGKA 5B1BH 2PX9A 3QPHA 3M8FA 1UELB 4CERA 1VQPN 3BY6A 4F3QA 2XSJC 1IG9A 2BE2A 3O2PE 2VWJA 4B9SA 4C3JJ 1UJ8A 5AQYA 4RW8A 4NXMK 4CYCA 1V55H 3G1MA 4CICA 4RS8A 4UXNA 3WU1B 4U67L 1RTHA 3CUQC 1T0FA 2R3SA 3VTIA 3IP4B 3MMYB 3HK2A 1RILA 5ADXH 1JLFA 4M3EA 1VQ5N 4FLZA 3EKUA 1Q82O 1KFDA 2DTZA 3GBTA 1NJXA 1JCFA 1FP2A 3FXUA 4IPAA 1VQOI 4HV5A 4FASD 4A3JJ 3FFKB 1BWFO 4RW6A 3C0BA 3C6UA 2H09A 2KRFA 3GL1A 4CBWA 2QKKA 1K7AA 1ZH5A 3AL0B 4E6KG 4F4KA 3F8BA 2PLYA 1C6VA 4A57A 4N47A 4Y4RA 3LP2A 1BW6A 1X1PA 2KFZA 3VEYA 1TC3C 4HSRA 3CC4N 2Z1JA 2W48A 1VQPI 3CQ8A 4DFJA 3KPHA 1P4XA 4NC8A 3K2AA 4CK2A 4GNIA 1P2FA 5FKKA 2E1YA 4A61A 4Q4ZF 4I9QA 2N8GA 1B6AA 1HUXA 3VQQA 2K4JA 2QQ8A 1ILYA 5GINA 4RGRA 4GKKK 4BR2A 2HYGD 3WTZA 1DGWY 4O5VA 2XF7A 1VQ5I 1Y64A 4CZEA 3D45A 3L0QA 1RTIA 3PQKA 3V9UA 2G7HA 4OIRF 1NGCA 1J5YA 3ROUA 4KHNA 2Y48A 1Z7LA 2IA1A 4NLBA 2FNAA 2HHTA 1RBSA 3OR2C 2V52B 2IW5A 3H3OB 4JD2A 5BN8A 4JI8K 1X9SA 3O3HA 1QQOA 3FLCO 2K85A 4OJRA 4AVPA 3LP3A 5GIPA 2PFUA 3IKVA 1BI0A 3U9DA 1HYVA 3RCOA 4ZC3A 4DG1A 4OIOF 4MLEA 2ATQA 4AU7A 3MK6A 1IH7A 3ZMZA 1O13A 1D4XA 3VQCA 4BRKA 4P9UA 3J81K 1NK7A 5BN9A 4FYDA 2HVHA 4A2BA 3KZYA 2BY3A 1HQEA 3VF6A 1V5GA 4RM3A 5CVIA 3NFAA 2A5WA 3SUPA 1YQAA 3OBYA 2G8VA 2P0WA 4B3OA 1T95A 4KHPK 1RESA 2EZKA 4ZYEA 3Q0WA 3H46O 1PP7U 2BW3A 2W57A 3A1YA 3FZFA 4HNUA 2P5GA 1VSIA 4WCEL 1R36A 4FWNA 2DK8A 1U2VB 5FGMA 3MX2A 4XLNF 2QW9A 1T08B 4LK1F 1FYLA 1L0OC 2DJNA 4FE7A 2PBIA 4B43A 1XMAA 4FZXC 1VSMA 3I56N 3K2PA 1DEJA 4O44A 3OJUA 1X1AA 4QIWN 5K7FA 3AVIA 1ETWA 4FM1A 1AWCA 4FLUA 1Z26A 3QEVA 2IVNA 1Z05A 2VJ5A 3K9TA 3P4IA 2XAJA 1MBKA 3Q3SA 3G71N 4DJAA 1KU7A 4Q5SF 1PUFA 3SZTA 2ELKA 4I6ZA 4C23A 4IFVA 1YAGA 1FMVA 1WJAA 3WU2C 1NKBA 5HLFA 2XKPA 4FM2A 2BXYA 4JK8A 1SFUA 1IKXA 4M3XA 1T3VA 3GTJJ 3KVGA 2IXSA 3OYKA 2QWWA 1RTDA 5GIOA 3M8JA 1Q7YO 4XLHA 1MDUB 3QYFA 5DYMA 2R5ZB 4ON0A 3I53A 3BPXA 4HF2A 4FLYA 5BPNA 4UUSA 3J7AP 1RIOH 5JLHA 4CJQA 4K41A 3MX5A 1VSKA 4M3BA 4RGSA 5CY4A 4NYNA 3ASNH 1BC8C 4HTLA 3GTKJ 2B9SA 1JXSA 4BRIA 4FJKA 3PM1A 2D1VA 2QBYB 1IRFA 3VFZA 1VNDA 3G1OA 2ZJPL 2ZMEB 3TANA 4C2UA 1M1KO 2KTQA 4JKGA 3R6SA 4BAYA 4ESBA 3GTOJ 2JRMA 3G71I 1RTJA 4O0JA 1TWAJ 1XDUA 4DHYA 2A07F 1XMQK 4M3YA 3LAKA 4LY7A 2F5FA 3P7NA 1R00A 1A6QA 5F2RA 2G8FA 4IZZA 2BE5F 2VUMJ 1Y1VJ 4M3UA 3VYUB 5J1YA 3BOQA 2V1DA 4FW2A 2ECBA 1RDBA 4OMZA 1ZG3A 2V9VA 4MQ9F 2VQEK 1XC9A 1KQ9A 5CHIA 4X0GA 2VJIA 4IO9F 2OZ6A 2FEZA 3V4IA 1NK8A 2F7TA 5JLXA 4BROA 5K14A 4NHJA 3DXMA 4IEJA 1EP4A 1NOZA 2W85A 2XB5A 1P8ZA 4W5TA 3GOIA 3V81A 4UY8I 2MW8A 2NRAC 1YW8A 3VQDA 2J5PA 1FK9A 4BWMA 4BGDA 4B9TA 3ZT0A 4CK3A 2YHAA 4QPOA 1JHHA 3I54A 1Z9CA 1VRUA 5HRRA 4GGGA 2ZCWA 3HOWJ 1MW7A 2OBPA 3GG4A 3FF5A 3OYFA 4W1UA 4Y1DA 2P6TA 4A0YA 4CIFA 1QZEA 3GDQA 3C3WA 5IT3A 5DK5A 3RRGA 4HBLA 1JKPC 1Y8QB 2JRTA 2P4WA 2RVCA 2ZGZA 2VBZA 3CJ7A 2XC7A 4A3EJ 1PVEA 4XONA 2OANA 3E3VA 3M1CA 1BI4B 2O8BB 5KPZA 2JVGA 2Q1ZB 3SEZA 4JKFA 3O8GA 4DNCA 5GP9A 4LIVA 2IS3A 5EOYA 4DF4A 1GV2A 4CEEA 3JRAA 3HZJA 2R7OA 1IXSB 4EP4A 1ETXA 1JT0A 2EIJH 3CF5F 3P39A 1Z21A 1K79A 4FXDA 1WNSA 1HOMA 1X3WB 1U45A 5J2QA 4AIJA 5HLTA 1C0GA 5HDKA 2XDVA 1ZR2A 4WFAL 4PUSA 3L2UA 4DV1K 4B8CA 1WBBA 5AQVA 5ILVA 4S05A 2Y1IA 4CHYA 3TOBA 2VOPA 2GXBA 2ZFUA 3NF6A 2IOCA 2STTA 1UG2A 1R5GA 2R7WA 1D0ZA 3DF8A 2VG5A 1SD4A 5TKYA 1VQ6N 5F1RA 1RDCA 3L6QA 1T0FC 1YF5L 2DYSH 3ID6A 3H5AA 5AQNA 5E3MA 4YFXF 4BE1A 3CI5A 4DSKA 4UY8O 5AZIB 1T98A 2L0KA 2V26A 4OOIA 5DTDA 3AG4H 3DYAA 2W82A 2JZYA 2W1OA 1G6NA 3EUHA 1KQSM 1U8BA 5GAGP 2VPLA 3VGMA 2CMPA 3CC2N 5M5YJ 5KGWA 4CJWA 6PAXA 2L9NA 1NM1A 4CF2A 3S8PA 2JA7J 1Z7UA 1FBSA 3HZ6A 3MZYA 2HF3A 4H0YB 1R9TJ 3K9KA 3KKRA 3E6CC 2E6MA 2DA5A 3OYAA 2O8CB 4FWRA 3HYIA 4EHUA 3AO3A 2JQ7A 3M8RA 1X2MA 2B63J 1N32K 4DSJA 3WXIA 1S9GA 4IHVA 4EZ6A 2FLOA 1SKWA 3DP7A 5AZJB 1G8XA 3J7AY 3CERA 1J0RA 4IEIA 1VQ6I 4BXXJ 1C0FA 2Y1JA 3LNQA 4XKCA 2ZSIB 3PIOF 2IGOA 4G94A 2NUBA 3O9RA 1IKWA 1XNQK 1R0AA 1FJLA 4BXFA 3EPZA 5EEGA 4GY2B 1ZBLA 1D9DA 2A5XA 1L3LA 2XGCA 4CZFA 1EX4A 4P1WA 2YS9A 3TP0A 3VMFB 1FPQA 3HBTA 4P5OA 4RMNA 1B92A 4JYAK 4M9XA 5LGNA 1XMOK 4OPHA 2ZJRF 2FA5A 4ZDOA 3G0ZA 2KISA 2Q8KA 5LL6Z 3TDUC 4ICLA 1MDMA 1WUAA 5M1KA 4FCYA 3TMOA 4NCGA 3HSRA 1ASVA 2HBMA 3MFKA 3KWIA 5D5VB 2XF5A 3WTVC 2LR8A 4JX5A 1QPIA 4KH4A 1BOTO 2COBA 4JK9A 3OMYA 4XMYA 3M4OJ 4NXNK 5L3BA 1FEXA 4CZGA 3THYB 2AO9A 3BWGA 4JI6K 1WQ2A 3KLGA 2FOKA 3FZMA 3TL4X 1BL3A 2JTVA 3M7GA 3OSFA 5E1WA 4HX8A 3ECHA 1VRTA 3AKZA 3LMMA 3PQJA 3D7EO 3CG7A 2L7FP 4A62A 2ASMA 1MMAA 4Y33A 5FO5A 4PJJA 1YOVB 1J6ZA 1JE8A 2Z1GA 4AUXA 3N4PA 3S1QJ 5F04A 5L3GA 4BR7A 4I2PA 2DDAA 3TTDA 4P9FA 2JMWA 5F0XA 1RGIA 2DXIA 2JUCA 3VQ6A 1OH8A 1MJAA 1IGNA 4M3FA 1LW2A 1F43A 1NGAA 4A12A 3DM2A 2F5EA 2DI3A 1G3WA 5E8IA 3E7LA 4DR3K 2FBVA 3RKWA 3WXLA 5IYDJ 1XQSC 2RGVA 1S3JA 3LANA 4AHRA 1HR0K 3RKXA 4MFBA 1Z1DA 4LB6B 3CIPA 3TTFA 1QZYA 1CGPA 2W6KA 4U0YA 4NBQA 2W24A 4D5CA 5KNLA 3DU6A 2Q97A 2DTUA 4BDYA 1EF4A 2NVTJ 3K57A 4C8MA 3T0YA 3WTYC 2O03A 1Q1HA 4N5SA 1UA0A 5KAIC 1YRNA 4PJNA 1IDZA 4O5BA 2GAUA 4Y52J 5KRSA 2Q2EB 2R93J 4DR1K 3HI0A 4M3ZA 4Z4HA 3VESA 1Z0XA 3QIPA 2XROA 2K3FA 1ZREA 3F8CA 1U8RA 1I6HJ 4U7BA 4C9YA 5BR9A 2HB5A 4XRFA 3GZ5A 1S72I 4BEHB 1LE8A 1ATRA 1NJIO 2YU9J 5F0CA 4KV8A 4AHVA 3RZDJ 4BBSJ 4EAHD 2QKMB 1F1ZA 3FK6A 3MEXA 2QQBA 5D8LB 1TYQB 5AQJA 1BA0A 1D1AA 1G3YA 2YNFA 1X2NA 4X66K 4ELTA 3TSPA 1A36A 2O8BA 5FD6A 2UXDK 4ZDPA 4PSWA 1W0TA 2O4IA 3QINA 3S41A 4I99C 4H5WA 5CQGA 4J8FA 1VFCA 5FKNA 1YT3A 1NK3P 5M1FA 1NHAA 1MBEA 1EJ9A 1E17A 5T7BA 3ZR8X 3E9OA 1F5TA 2VE9A 1GLBG 4CCMA 4J2DA 2A3ZA 1HC8A 2E20A 2STWA 3L9FA 3DLHA 3V1QA 2XRLA 2CU7A 4FE4A 4AIHA 2OTJI 2H1LA 1A31A 4X62K 3IWZA 2E1MC 1RUOA 3KK7A 1HYSA 1YVNA 1KFSA 4N41A 1HNWK 1JTXA 2ZWHA 1B8IB 5HS8A 2KLOA 3HM8A 1JCEA 2ISZA 2D2WA 1H0MA 3LDLA 1HXDA 2L9SA 4PA1A 2KP6A 4EVIA 2O6GE 2ITGA 2NRZA 2EV0A 2DOEA 1IKYA 1RDWX 2EJRA 2FBTA 1YITN 4CEZA 2KIMA 4CJKA 5AZIA 2HDCA 1K9MO 2YI1A 1YO5C 1KZHA 1S1TA 4N4OB 3T1HK 2PYJA 4JI3K 1XTAA 2G8KA 5JS2A 2CGLA 3V9SA 4OLAA 2CYYA 2X6YA 3QU6A 3PL8A 2A61A 2HGCA 1C0WA 2YSRA 1VSHA 1VQNN 1SS6A 1LB2A 3F22A 3JRBA 1AA7A 3THXB 5C42A 1D5YA 4KT6A 1EO1A 3AL0C 2UUBK 4FZYA 1PYVA 5AQOA 3WNGA 2GXAA 2ZB9A 1PP8F 2XF6A 4ETSA 2O8CA 4ID5A 5J8FA 4C8KA 1JUSA 1OH7A 3VF4A 3VYSB 3GTLJ 4DW6A 2VASA 2B0LA 3PJRA 2D1HA 3QU3A 3AGRA 5DCMA 5AZJA 3NCIA 3H3ZA 5BS6A 3WE3A 4H4MA 1H1VA 1ETOA 4K8ZA 3NMUA 4LF7K 4RAGA 4AYBN 1ETKA 4G1QA 2D0BA 2W41A 1YITI 2EB7A 3I0RA 1XWLA 1MGTA 3E9LA 3HSTB 1EETA 2HHQA 2DFEA 4GV3A 2E2IJ 2D0PA 2KIQA 3VQ7A 3PUBA 2FXUA 1OCCH 3DTIA 3W2WA 3MMVA 3EE9A 3O9TA 2HOSA 2H6CA 1HYZA 1VQNI 4JNEA 2IAJA 4YOYA 2YNIA 2QUFA 4CBXA 5CVVA 2IEKA 4MHGA 1VQ8I 1TAQA 3MN6A 1IRZA 3JAMO 4EM2A 4BRQA 4G7OF 1R6RA 1NGJA 3MAJA 2OF7A 2GIZA 4DTRA 1Y0NA 4FOEA 1OPCA 4IOAL 3NF9A 4Y17A 2HYFA 3HYFA 2XV4S 1REVA 1BCMA 2L7MP 2VN2A 5BPIA 4PKGA 4XL9A 3VQAA 3SQ4A 5AQZA 4IHSA 4FISA 1NJYA 5LFAA 1IKVA 1K8KB 3WU0A 3JRGA 2WY7Q 3K0SA 1LDKB 3NWTA 3THYA 4JKEA 2VI6A 3D2FA 3ABTA 1YHQN 4CHNA 4AHSA 2DFHA 3DPTA 1Z3YA 2OYQA 4ENNA 3E5QA 2ISYA 2KRHA 3QDKA 3CJTB 1B9MA 3HXMA 2FD5A 4W97A 4LSLA 3R1XA 4ISFA 1CZAN 1F4KA 3OYBA 4DSEA 3BUZB 1JLCA 3SZPA 5IT9K 2DYRH 2EFOA 1YTYA 2L7ZA 2NRWA 1SFXA 3PO2J 4OMYA 1YXQA 2PBDA 3ZN1A 2CQKA 4CF1A 1ZBUA 1K4TA 1MA9B 4FW1A 2ZNZA 2VOOA 4BC5A 4LLGF 2PMZA 4R79A 3R0AA 4HOBA 1KAXA 5KPTA 5CJ9A 3L00A 1U04A 1T44A 1HKGA 4MO5A 4FOIA 4J19A 1YJNN 2OPTA 2FUG2 4HUEA 4LFBK 5HLIA 2Z99A 5DM7F 2OZUA 3OYIA 4IWVA 1RKTA 3GFIA 1SAXA 1YHQI 2HPMA 3S93A 3CFPA 4FLVA 4XH1A 4CEAA 4LLNA 1J53A 4KKOA 1RT4A 1K78B 2HEOA 1LWFA 3ELKA 4AQYK 1E3MA 4CSWA 1WZ2A 4CA0A 3J8AA 1RC9A 1IUYA 3I59A 2VBWA 4OPJA 5AQRA 5CZ1A 2F2EA 2A5YB 4KFCA 1O3RA 2XPUA 4M63C 4O5FA 2EV6A 3WTSC 3RJPA 4CHOA 2Z1IA 1V3FA 1QQMA 2W40A 4B9LA 2FBKA 1FBUA 1RKWA 3FKIJ 4E7HA 3K1PA 5K1YA 3KE2A 3DPUA 1ZC6A 4HYEA 2P7CB 2MH9A 2QM1A 2PJRB 2ZMEC 2R5YA 4JOMA 4MFDA 3HHGA 3RKYA 4K0KK 2E2HJ 1GLDG 4Z2YA 1W1WE 3HXLA 3J80Z 1DT9A 2RN2A 1XN7A 2R7UA 1QVFM 2LNBA 4HRIA 4KICA 2DK5A 5EZHA 1DTTA 1KLNA 5J1EA 1UHMA 1YJNI 3G4SN 2QF7A 3K7AJ 5FLXO 2HQRA 2G8HA 2JPCA 3FK7A 3ZETB 2HNHA 4GXOA 4QS9A 4KT5C 1C1BA 2XUBA 3OYMA 3A4CA 1IN5A 5TKWA 4LMYA 2KL4A 1WH7A 4CCLA 3SQ0A 2CH5A 4NDLA 4G8XA 5EX5A 3M1FA 4N9IA 4A3BJ 4DTNA 3F8FA 3FMSA 2KW4A 2DT7B 2CW8A 4CO8A 2F6CA 1AKHA 4CZJA 1MMSA 2Y31A 1Z77A 2R7XA 3ZQCA 3CETA 2IGNA 4I2QA 5DMRA 1YJ9N 3IH3A 1NU0A 1QZ5A 4JX6A 3FZKA 1Z6RA 4PJMA 3D5LA 5H1SQ 1P4WA 3HP9A 3HRUA 1SD5A 3D2EB 4BVPA 5KK1A 1TK8A 1HKCA 3EUKL 1B8IA 5IP6A 1XC3A 4HCCA 5JFRA 1VHXA 4FT8A 1CF7B 5LLQA 3SAGA 1U9OA 1S1XA 2AQEA 4IZ9A 4OLBA 5KHDA 3SJJA 1MJ9A 3A03A 3VENA 2HDDA 3H5NA 2FSWA 5EG0A 1LFPA 2QXFA 2HI3A 3U1KA 4DSLA 4WQ4A 2EFWA 4I9LA 1YX3A 2OQRA 3Q9VA 3HJEA 4LLLA 4MNUA 4DZJA 2RV8A 3AG2H 4A3FJ 2X78A 4CGJA 5JMVA 4TSXA 1QA6A 3AO4A 1MBFA 3KZZA 3PSFA 4C2TA 1RDAA 2FU4A 2F9TA 2AXTC 2JA6J 3KTQA 1XSXA 4JK7A 5C15A 1P90A 5K7HA 2NVUB 1YJ9I 3FISA 1TK5A 4PJLA 4UV9A 5TISC 5FDLA 3IAS2 3I64A 4CK1A 4RW9A 3O9SA 1T6CA 1W5TA 1SV5A 5D6EA 3HP6A 1HW1A 1EH8A 3M3ZA 1G3TA 4WWCA 2LREA 3H36A 1KU2A 2UWMA 2DBBA 2F96A 3KJVA 1UMQA 2E2QA 4BE0A 5C4JJ 1TWCJ 3HHHA 1W5CC 5J4VA 3CCRN 2JSCA 4YY3K 3QOEA 3R6MA 5ICFA 3SQ1A 1S22A 2F5VA 4NO7A 3HRSA 2DT6A 1UHWA 3HGGA 1HF0A 2NRHA 3BT9A 4KB1A 5LHHA 1I5ZA 3DKWA 3IKMA 1RI7A 5L3FA 2HQ5A 4EP5A 5A2QZ 4HVJA 2E1OA 1F36A 3ZX2A 3CYMA 2Z3YA 2E1NA 2WAQN 1WAFA 3ZMUA 1WFXA 3VQPA 1NK2P 2QYOA 3ZT4A 4NYFA 1BI3A 1SEUA 2QZ8A 5AQPA 4GVMA 3BJOA 1T6SA 2EA4A 3DWLE 4E1JA 4B9UA 3NDKA 2KPMA 3I4PA 1ZHFA 4MLOA 1BG3A 1S6PA 5EZGA 2HFHA 4CJ7A 1YVUA 4F3TA 1LV5A 2YNHA 2FRHA 4DKWA 5D8KB 1WLJA 1BN5A 4YOTA 2X48A 3SYZA 2K02A 2Y0MA 3PX6A 4H4KC 3SAFA 5IP7J 3I3LA 2M0MA 2V1NA 2OU2A 3LOCA 1K8KA 4LSNA 4HF0A 3CCRI 2YHBA 1NGEA 1RBVA 3GF2A 4GV6A 2G8WA 1DKGD 5AJ3K 2FQ4A 4F9OA 4NQWB 4IRHA 4FX0A 3KYDB 2IJLA 3KP7A 4PK4A 4RDUA 1LAWA 1ZG5A 4XEIA 5KPRA 3S17J 2O61A 2NRRA 3E97A 1SFKA 5FKOA 3Q5FA 3WG9A 2OQGA 3F8NA 3RPUA 2IT0A 3OYGA 1RT6A 4JQFA 3TSQA 1B72B 1E3PA 5L3EA 2WV0A 3ECOA 3QNNA 2KQRA 3QP6A 3M07A 3OIQA 1XS9A 1EXQA 1FNNA 2OPRA 2VKEA 1R71A 4LFAK 2V7FA 5F27A 2Q31A 3ISPA 1KRPA 2DA2A 4H5RA 1Q9XA 2Q0RA 2NLXA 2FXAA 3LDPA 3TP3A 2IC3A 3EKSA 4HUGA 2RQQA 3LALA 2G0EA 4E19A 1SMYF 4FSVA 2PYLA 4AILC 2H3GX 2QM3A 2DJIA 1SD7A 4CJEA 1OQYA 2NOGA 3E66A 5JLFA 1MU2A 1ZAOA 2CQNA 1K78A 1O4XA 4QTRA 2EIKH 2BV6A 3QFPA 2GA2A 4IO9L 2OAZA 2YX4A 5LEJA 1OR7A 3CQYA 2HVQA 1ZLKA 4HWIA 2LYCA 2P9SA 4PKIA 3L7WA 2Z2SB 4V2GA 4KYWA 2ETJA 4XM3A 3AVCA 3QESA 4KHQA 2CQQA 4E7IA 4Z4IA 4FHTA 2LSNA 3GX4X 3L2QA 3GTPJ 1T39A 4PDKA 3C2BA 3TABA 1VAZA 1L3UA 1RT2A 1NNEA 2BGCA 4E4HA 1N34K 2FBIA 4A3DJ 1FP1D 3ZSYA 4FJLA 2CH0A 3VGKA 4CGHA 1ZXOA 2XGEA 3FXKA 4YOWA 2E5LK 1TW3A 4XRSG 1LCUA 2XAGA 4Z4EA 4BQQA 4DFPA 2X4HA 2OA4A 1K6OA 3JTGA 2M9HA 5LHGA 2GOMA 1JLGA 4IHTA 4K8XA 2E71A 3H45C 3KK2A 2QQ9A 4HA8A 1YW7A 2YKNA 4KH6A 2LC2A 1ATSA 3C6TA 1IV0A 1JHFA 4IFEA 3ZQFA 3CF5L 1USSA 3QEWA 3AAQA 5KGXA 2CH6A 3ALYA 3VDXA 1OYWA 3T7ZA 3BR5A 1QHHD 1BCOA 2DFIA 2D1KA 3H5RA 3MQ0A 4F7ZA 2XY5A 4CYCB 3M8QA 3KHYA 4FJ8A 4AC0A 1SMTA 4UVCA 1R1TA 3H9JA 5LHIA 3D2EA 2UUZA 3BDPA 2KZVA 2AA4A 1R5ID 4KA4A 5CE3A 1MNMC 4MTEA 1ASWA 2FF6A 3JREA 1TUUA 3UKRA 3OVNA 2P9LB 4B09A 1JXEA 3QFUA 1I27A 3F72A 3WGHA 4RAZA 3WXKA 1PDNC 2X0LA 3CFRA 2VONA 4YORA 3KP4A 3VOEA 2R7DA 2A6HF 1VSDA 2WB1A 4FVMA 2D4WA 3WODF 3S15J 3J7AO 5ADXA 1SQKA 1O3SA 1TV6A 3NAEA 2XAUA 4L5JA 3H6EA 2UXNA 2O3FA 1QVUA 3L3UA 1FTZA 1FLIA 4GYGA 4HX7A 4OVLA 2P9NA 2ZJQL 1I6XA 2NRXA 1TL3A 2XASA 4CI6A 4JEPA 3UIQA 4XIUA 2Q3SA 1JTYA 5FRNA 1RBUA 4WQ5A 5HBMA 3LPUA 5D3GA 1OCRH 3TO9A 1FOXA 4U0VA 2MYSA 5CVUA 1WSJA 4FPBA 3A2FA 3QERA 4GFBA 3F0CA 2XHKA 4CJTA 3V4GA 3OS1A 4G7ZF 3NVKA 5CVRA 4CJSA 2X1EA 2HVIA 4PSXA 1Y97A 1LWCA 5I3UA 4JD2B 3QPSA 3WT0A 4CCNA 1ZGWA 4GDFA 4RA2A 4E7JA 4FWKA 1BO5O 1ULYA 2NRVA 3PIOL 2DO7A 1DU6A 1YG2A 3CCVI 4E0DA 2VT2A 3N4QA 3H3NO 2MLGA 5M1NA 3UKGA 4Z4CA 2YX6A 1G59A 1SVMA 1VQ4I 3BTCA 3RMBA 5B66C 4EJTA 4UVAA 5AONA 2P9PA 5HLGA 3ZT2A 3IV5A 2DTRA 2X6OA 1LEBA 2I7NA 4ZHRA 2PQ8A 3E5XA 2E5ZA 4HAMA 3ZXSA 4ASNA 4CJ5A 3IKTA 4OKKA 4BYYA 5GAEP 2ZJRL 3FXQA 1MSFC 1S1WA 5FFXA 3QICA 3BY5A 3NH0A 2RDPA 3K4NA 2OZMA 1LDJA 3VODA 2EFQA 3DKYA 2BW3B 4XSXF 4BS9A 3S14J 1IBKK 3LSRA 3JSOA 1OKRA 3D5RC 4DV7K 4KISA 5C10A 3TAFA 5E3LA 2W84A 5D5UB 1C0TA 2DFFA 4Y7NJ 4I76A 4TV7A 3HPGA 2W7NA 2M87A 3AVBA 2P9KB 3A2KA 4IX7A 5LMNK 1VQKI 3B6PA 3HVRA 3UE5A 4BJTA 3CCSI 3RZOJ 4DQIA 2F8TA 4CJRA 3L09A 4B3MK 3JR9A 4LGWA 4PKHA 2WAFA 1UWBA 2BOLA 4JI5K 3AVJA 2HBLA 4MQVA 1N5YA 1R5HA 4EV0A 1HLUA 1F21A 1SKRA 3CMEI 1P92A 1IRXA 4IJAA 3SFIA 3MDQA 1IC8A 2NXNB 1HPZA 3BQYA 5BR8K 3VQ4A 2AS5F 2X9DA 2HBKA 1XPXA 2KHOA 3R0JA 3CCUN 3MVPA 3K4JA 2YX7A 3R4KA 3LDSA 2LF7A 3C95A 1GLAG 3JS6A 2Z9OA 2OA8A 3FKJA 2RF2A 5M5XJ 1IV8A 1T38A 5IYCJ 3ITHA 1GUUA 4FWSA 2CSOA 3KZIC 4RW4A 1I50J 4FETA 3PIPF 5JVGF 3S9HA 2WBNA 4LF8K 4E70A 5GADJ 1MMNA 2HHSA 4ISEA 2EZIA 1KAZA 3FHNA 5BPLA 4A3KJ 2ACJA 3HTSB 2IAIA 5AIPA 2BVMA 3O1BA 3FBIB 1ZLJA 4O8KA 1TKZA 2E8AA 5LRSA 2LF8A 4OAYA 4FK2A 1R4MB 1HDPA 4V2FA 1VZ0A 3F3XA 1CXUA 4FJMA 4CJLA 1EWQA 4B1WB 3ZSQA 5CYVA 3G25A 2H27A 2Q0OA 5GAHP 2ZBKA 4KN7X 4M3RA 4H0PA 4DR5K 3CZ6A 2CGPA 1QHGA 3CCUI 3LAPA 4BU2A 1WCMJ 3FR0A 1B4AA 2GQQA 2KKZA 2VL8A 1W9HA 3S2HJ 3U6FA 1JGGA 2EHGA 5CYQA 3CUQB 2XY6A 2P5KA 3C7NB 4BDPA 3K4KA 1FKOA 2CFOA 3TARA 3B6OA 3GCMA 1TAUA 2VQFK 2XY7A 4M9ZA 3DFGA 4M3TA 4B8XA 2Y9ZA 4JI4K 2BHZA 4E7ZA 2B7EA 5ELZA 2I8DA 2RC4A 3BR1A 5F6FA 2P5VA 3F21A 3DXMB 2WY8Q 4HZFA 2UU9K 4DWIA 2ZXHA 2HKOA 4IXAA 1T7PA 2X6XA 3BROA 1B9FA 4M9SA 1X3UA 5IOYA 3O08A 4MQ3A 4OO1J 3FMRA 2UXBK 2HZTA 3KLNA 4BHPA 4E7KA 4BC3A 2B6AA 1WHUA 2H1KA 1LVAA 2BYVE 4D9JA 2HOAA 1OR7C 2PAVA 3F23A 2IS1A 1KLMA 3GW2A 3AVNA 3PO4A 4BC4A 3HKZN 2QVOA 4DV0K 1U5TC 1Z67A 3AVLA 2ELJA 4JV5K 5EVZA 2JA8J 1UFMA 3OL3A 1NG9A 1HSJA 1V5EA 2M0CA 1HW2A 4LF5K 4ZYHA 4I0AA 1X3MA 3L8BA 5M1PA 2K86A 4LJZF 2DU9A 2WA0A 3EO3A 3BC8A 4ENJA 3VB2A 3AO2A 4AM7A 5BREA 2P9LA 1WBDA 4I6MA 1JGSA 4DQSA 2XAFA 1TK0A 1B9NA 3VQEA 4AD9A 3WXMB 1LJ9A 3MZHA 3O5BA 3AVKA 5J2NA 2VQCA 2QWRA 3U8XA 1QGPA 3HUGB 3SEQA 4XOTA 3ZQHA 1TQPA 1XMXA 4L9NA 2M45A 1HNIA 2QA4N 4IHYA 4BY1J 1BC7C 9ANTA 2EK5A 3CCLN 4UV8A 3C94A 3KLIA 4UHTA 2DAOA 4AHUA 3MCZA 4I7HA 4DV6K 3PNTA 4D1QA 3IRRA 3BDDA 2DN0A 3RVCA 3VERA 3EYIA 1J9IA 4WFBL 2VYPA 4N56A 2ZE2A 5J40A 4ELVA 1HKSA 4JKCA 3N4MA 1V4RA 1HKQA 4CYDA 1MNEA 1BGXT 1OYYA 3ULDA 4YIIA 4CVNE 3VGLA 4BRNA 5ICCA 2BXZA 4H0EA 2WC9A 2QKLB 3S16J 3D0SA 4WXHA 4XH5A 4J2BA 1XGNA 3CDLA 5LD2C 2A6TA 2DA3A 1IBMK 1B9DA 4MDBA 3L2VA 1VSLA 2XRIA 3P1GA 4DV2K 3LL3A 3L2WA 1XG1A 3S3OA 4N9HA 5DD8A 2A3SA 3G2BA 3SMSA 2VGNA 2ICWG 4J01A 2DPUA 3CC4I 1KQ8A 4M72A 2Q0UA 1LEAA 3DLRA 1R4NB 5F64A 3WTWC 3M8EA 3LFUA 5LEKA 3QETA 4CHUA 2HZDA 5DUIA 1ESVA 1IG7A 4MTDA 4JI2K 3BZ6A 2X51A 3VSKA 4LFCK 1HJRA 2VT3A 3SCXA 4M3GA 5LBQA 2OTLN 1D1BA 2KIFA 1BIBA 4V19K 1RR7A 3CPEA 1JUMA 3TAQA 4MEYF 3ZMDA 3IUCA 2GWKA 3EE8A 1D8YA 1T05A 4CZZA 4RB0A 3B02A 4A2AA 2YJFA 4KI4A 4CEQA 3PFIA 3RKQA 2YCHA 2JGUA 4BRAA 1OJLA 1EH7A 1KXPA 2VIXA 2X74A 3LM2A 3TTCA 3U3GA 4BRMA 2P9KA 2I5JA 2R7SA 3S3NA 3VOVA 4YOXA 1MZBA 3C2HA 5FPEA 1YIJN 4FJJA 2M1BA 4H5VA 3WTXC 2M7AA 3UNGC 2DMNA 2BH1A 3CJNA 4RB3C 4DTPA 1MDMB 2R92J 3L4QA 4XRMA 3CHWA 1S3XA 3PV8A 1OH6A 2VG7A 2O4GA 2EWNA 4JHDA 2X1CA 1BI1A 3SXYA 5ICEA 3JSMA 4I0BA 5ERIA 4DQQA 2ESHA 2HWVA 5JI6A 4BH9A 4GMJB 4BQZA 3HB9A 1VQ7N 2M2EA 3A5OC 2F8SA 4Z0UA 4B48A 4CJ4A 5AQMA 3OV8A 2VWKA 4FK0A 4JN4A 5FKMA 1J7KA 3K5OA 5E41A 4G9ZA 1WSFA 4DR6K 2CUZA 4CGZA 2LSOA 4DSFA 3PNVA 5DM7L 3ZQLA 3BR3A 5C44J 5M5WJ 3G1LA 2Y30A 2D0OA 4MGRA 3I56I 1KD1O 5HRSA 3AA4A 2NRTA 2V6CA 2NOJB 4PUOA 1L3VA 1QU3A 4B4CA 2V9PA 4KIFA 2F5DA 2XAHA 5EGOB 1S7OA 1ZELA 1XD7A 1YIJI 5HS9A 3DI6A 3NAUA 4LD5A 2BGGA 1FBQA 1P7JA 4U7DA 3SDBA 2LOOA 1T8EA 4UVBA 1ETVA 1E3OC 2DCEA 3LQQA 3CFOA 5HNFA 3GBGA 1AOYA 3LSPA 3BLYA 4AHTA 1OYIA 2CRGA 4KIGA 1XHXA 4RGUA 4DS5A 3LDQA 1BR4A 3CUQA 2CW7A 3C7NA 4NCAA 2Q2RA 4LH5A 1X19A 3JRFA 3TW6A 4Y0WA 4PGHA 4Z4GA 2GIVA 3KKSA 1VQ7I 2GWRA 2X85A 3C7JA 1OCTC 4YOUA 1IN8A 2R7FA 4RCHA 3S2DJ 3SFZA 3I4MJ 1YRNB 2OJED 2MLKA 4B08A 4IXCA 2D5RA 2DQLA 2VJ4A 2VKDA 2LKXA 2K9SA 2IGMA 5ICGA 1IDYA 2Y0SN 2M34A 4BVOA 1NG6A 3TR8A 3KLEA 3V8KA 1TQMA 3VQ8A 5BOXA 4IDKA 5AQFA 4OU0A 3VYTB 1UCRA 1Z3XA 2DT5A 4YDUC 3THWA 1LE8B 3LDOA 3S3MA 4OWRB 3VN5A 3SMPA 3BF1A 1QSYA 4CF0A 3W6KB 4BXUA 1BR2A 1IRGA 2L3DA 3CJ9A 2VXZA 3TAEA 1NH3A 3CCMN 3GEZA 4G6DA 3S32A 2Y9YA 2BEOA 3KFWX 1A5VA 2QI2A 2HVSA 1RRJA 3QLHA 1J09A 5LRRA 2YV0X 5D4RA 3G73A 3NH2A 2MSYA 1M90O 3DLLF 2R7VA 3MWPA 5D5WB 1ZYRF 3KZBA 1TWHJ 5EYRA 1FKPA 3F2KA 2VQHA 4HCBA 3H1QA 3A5NC 4S04A 3V9XA 3WNFA 4JS4A 3BR6A 1ETYA 1WSEA 4B47A 2HOTA 3QPTA 2XY8A 3JXUA 1FWZA 3HUGA 3KWGA 1OMIA 3TPQA 4YFNF 3HL8A 1Q9YA 2QQAA 3HM5A 3O4WA 2IS2A 1WSIA 2FC0A 4MLHA 4B8AB 3SI6A 3SUNA 2HSTA 4FTHA 4EQQA 1T8IA 4GV9A 3K6GA 3BZCA 3PUFA 3VPZA 1W7PB 2P51A 3AARA 3GMEA 4X65K 4CJPA 1V4TA 3HGYA 3CCMI 3HRTA 3MCPA 2L9VA 2DA4A 1P7IA 3RPQA 4XICA 4H0XB 3SDGA 4M3WA 2HHVA 5B5EC 1JCGA 1GOAA 2KKOA 2O8EA 4KREA 2E60A 3GWZA 3LZIA 2H6BA 1H9TA 3F9KA 2LP0A 1MNDA 3S1NJ 3MKYB 5M3FJ 5F1JA 5IT9O 4R1HA 3O80A 1JT6A 3IDHA 2A05A 4RG8A 1ZRCA 2A6EF 2ZGYA 2ZJQF 3SK3A 4Z6YA 1Z25A 1ZG1A 3EN9A 1JLBA 4G7HF 1WN7A 5DCFA 3ABMH 1NKEA 1EV7A 4LK0F 1U9NA 4HX4A 3MECA 1K73O 3CCJN 1K83J 3DLEA 2F4VK 2CUJA 4QWQA 3WHCA 3RSNA 4BREA 1NK6A 2KIUA 4DSIA 1NBWA 4EIAA 2E2PA 4K25A 1W97L 3FMQA 1XC5A 1UAAA 1P9QC 3DBLB 3VQ5A 2FBYA 2HHWA 5DCMB 3PX4A 5CLSA 2PY5A 3OR1C 4O8UA 5HDNA 5FLXZ 3U1DA 4C3IJ 2DA7A 3TO7A 3L2CA 3PX0A 2NS8A 5K7ZA 4DYRA 1ZBHA 4CZMA 5JHUA 1WSHA 2MGQA 1SAZA 4WX9A 2HHXA 3J80O 1XGMA 1SD6A 2VQGA 1WGXA 2LY2A 4YFKF 2LKSA 4ILHA 3GZ6A 4N4NB 2ZQBA 3CC2I 3KK1A 1NGHA 5J6XA 1QZ6A 4M41A 2GWJA 1J9AA 4BY7J 4CEFA 4HQMA 5DS9A 1FC3A 2DMPA 3ML6A 3TGNA 3CCJI 3U4LA 4A6DA 1WJ5A 5HOOA 3H3VK 2ELHA 4CIEA 3CCYA 1R49A 2ADUA 2NVQJ 1D3YA 4I01A 1SL0A 2NS7A 3ATVA 3TSUA 1H89C 3K4BA 1POGA 3J7YP 1HCRA 4AH9A 2F4OB 2GXGA 4KMUX 1MBGA 3NH1A 1ZBIA 3BPVA 3JRIA 2QWMA 1X4PA 4IL6C 1SC7A 3D2FB 1RT1A 4RW7A 5J2MA 4BRHA 1W0HA 4XN3A 3TO6A 4A59A 3W3DA 2E7WA 3V1OA 2HTJA 3TI0A 3F6OA 3OSGA 4M42A 1BM9A 3OYDA 2WV1A 5H2FC 4FWQA 4ILGB 4BKXA 1HJOA 2R0QC 1HPMA 1Y1WJ 1U2WA 4JKBA 3M5RA 3BR2A 3ULEB 4CHPA 2CW0F 2XGXA 3QEXA 5EGOA 4YNQA 4WE1A 4FJNA 2LH9A 3V6DA 3FBNB 2GZWA 2LD5A 4HTUA 3SYTA 3CO7C 1U49A 5BMZA 2BDPA 2EFPA 4XIDA 3R8EA 3WUHA 4DFMA 4CFAA 1GOCA 2KDZA 2XPVA 1Y56A 1XDSA 3RQ4A 1A5JA 3HTVA 3CLQA 4HHTA 3KCCA 4II3A 1ZBFA 2M8EA 1ITYA 5CZ2A 1RNHA 3DLAA 5AQSA 3SJMA 5FLMJ 1XSDA 4U87A 1WH5A 2DOFA 3E5UA 3T3FA 1KU9A 3HPHA 3KIOA 3UB5A 2LG4A 3U9ZA 2BY2A 3DTEA 4DQ8A 3G10A 1ZYQA 4CUGA 3A0IX 3PSIA 3K59A 3CM5A 3B8AX 4M3DA 2P5OA 4RWTA 3I59B 1VQON 2EZLA 1YS6A 3NVMA 1DGKN 3KETA 2QWQA 3DPLC 3CJ1A 3FIWA 4KIBA 1WVRA 2E1MB 4DMNA 4B9VA 2R5YB 4LF9K 4PZJA 1S9EA 5A2QO 2QK9A 3DRSA 2CO5A 3AG3H 4M7XA 3T8RA 2J5OA 2M3AA 3KEQA 1LVKA 5HROA 2X1DA 1IN7A 2K9QA 3BTJA 3GTMJ 2GBZA 3ESWB 1FXXA 4ZYGA 1HX1A 4OGCA 3MZ8A 4DF8A 3ZX3A 3CJBA 1V5FA 1QSSA 2PEXA 1NGDA 1XGSA 2Z1DA 3ZEUA 3C65A 2WONA 1WJFA 2L2OA 1LFUP 3FZHA 4CCJA 2HS5A 3DTKA 1KQ0A 4LG3A 2JK3A 1NLVA 4EM1A 4DTOA 4B9NA 3VEXA 2W6LA 3WNEA 3V8JA 3ZPLA 3LL7A 1XSVA 1AKHB 2P81A 4D7NA 3LFKA 4B1UB 2QEXN 3GFMA 4HG2A 4CEDA 2CV0A 3RSEB 4HQEA 2DQRA 1I39A 2P9IB 4ESJA 4N76A 3CDHA 1A6IA 3P5JA 3BG3A 3QYBA 5CPRB 1T33A 4FQGA 4MIMA 4B3AA 4BR5A 3MN2A 1W7PA 3IAYA 4BNCA 3MXIA 2L7KA 4BJ5C 3M8SA 3ENHA 5E3OA 1ZRFA 1QHTA 1X9JA 1A35A 4J00A 3C6AA 3IAM2 2VC0A 4KNYA 2E2OA 3SV4A 2IIRA 1N6QA 1SAUA 4ZYAA 2VPRA 4DGWB 2WAEA 1V54H 5EG0B 5HRNA 4CCKA 1VQLN 1W4MA 3K58A 1R1UA 4DTJA 5M3MJ 1YYVA 3FWEA 2D0CA 4IEEA 1XB4A 4I02A 3KP6A 3QMLA 4B9QA 2KLAA 1VSEA 5B3SH 4W5RA 1RDDA 1ACIA 5AQQA 3JCUC 3AFHA 1RBTA 3GVAA 3CPWM 3G3ZA 2QEXI 3CCQN 3K4CA 4DUYK 3RWUA 5C2FA 1W7PD 3SLCA 4CJVA 2Z5UA 3DKXA 4ENKA 3A01A 5E26A 2R4GA 5EEAA 4ZYDA 4JI7K 4X64K 3ZSZA 3EETA 3OBWA 2YHXA 4XOPA 1OFCX 3ABLH 5TJJA 1O57A 3IC7A 3HL2A 2QGUA 2GLOA 1NGGA 1OH5A 3ZRGA 3EEQA 3ATUA 3RRHA 1H8AC 2ZXIA 1NGFA 3ZSOA 4V19S 2CJJA 1VQLI 1OISA 1WRJA 2WFBA 2H8WA 1GLNA 5CVJA 2IBDA 1TNTA 4R8HA 1ITGA 3J81Z 3O3KA 3L2RA 5AFUA 5AQLA 5I9EB 3OTOK 4W5NA 2MD0A 4A5BA 3RYRA 3BTIA 1NWKA 2AHQA 3WTUC 2F4MB 1I3AA 3QRFF 4OIQF 3ZX0A 2JPBA 3ERMA 2YJEA 1DPUA 3HSCA 3OIPA 1Z6TA 2HR3A 3CCQI 5C0YA 3NARA 2RREA 1HSTA 1T03A 1S6LA 3EUHC 4DIQA 2RE2A 4E1NA 2AXLA 1JUPA 2VLAA 3AVFA 3C6HA 1K4SA 4LG0A 1C0UA 4I7FA 1OVQA 2O5RA 2ID3A 4DBRA 1G3SA 2X6WA 2K4BA 2COMA 3V7SA 4KMFA 3MN7A 4Y1CA 1ASUA 3H08A 3HVTA 4H5TA 4AIKA 3CJRB 5DDGA 1JJ8C 3DQVC 1HBXG 2EZHA 5LY3A 2HBJA 2E7XA 1GV5A 1I3QJ 1O1WA 2CG4A 5AQIA 5EY4A 1JJ6C 3B6CA 4CF9A 4ZTJA 3H1VX 2OPPA 4C30A 3GO5A 1IO2A 1BQMA 4CZLA 3WTTC 4IG3A 4DR4K 2LY1A 4AYBA 2GTDA 3SUQA 2I5UA 3CLOA 4IOCL 1NK5A 3PIPL 5JVGL 4LF6K 2M30A 4DTSA 3PO5A 2HVRA 4GW6A 3CM6A 2NYXA 3RMAA 1ZGJA 4GCVA 1GOBA 4KTZA 1GVJA 3B73A 4EJOA 3SNNA 3WXJA 5SZTA 5E84A 4CGDA 3IH4A 2YKMA 3SJHA 2GV9A 3ULEA 4DCHA 2G8UA 3F8MA 1U4BA 2FX0A 2ME6A 2E2NA 1VSFA 4D0PA 3RTRA 2JWTA 1E4FT 2ZO4A 1RT5A 1N33K 4CEOA 3NF8A 2IGIA 1I1SA 4BGAA 4FJHA 3E6MA 4DTMA 3GUDA 3OS2A 4JKHA 3QYEA 4JP0A 3MAQA 3NF7A 5EDNA 2OUMA 2A6AA 5E17F 3I0SA 3VF2A 4I2OA 3LSJA 2BVLA 2DOAA 3FM3A 1NK0A 3IG1A 1BDGA 4HPQA 1NMNA 1A5WA 2FF3B 5FKLA 3U2RA 3T69A 1RDUA 4FJIA 2M7BA 2YUSA 2LFBA 4P55A 2HQAA 4DZPA 4H8KA 1TP4A 3W2AA 2LVSA 2KDOA 4F92B 1HRHA 2HNZA 1BR1A 2YHWA 4LOCA 3BG7A 5C25A 4IHWA 3BZKA 2NVXJ 2UUAK 4IF4A 3DJCA 4IQ4A 3P9KA 3SBGA 2IVOA 4HSTA 4M6XA 3S1MJ 1T6DA 1J5OA 4A5NA 5SWMA 2K5CA 1I1GA 2FOWA 4O3MA 2P9SB 1JL2A 3HOSA 4AF1A 2UXXA 2MBFA 1MD0A 1P4AA 2QSGX 3J80K 2HKXA 3F73A 2XIGA 3P38A 3ZOBA 4B1ZA 4F2SA 1TL8A 2L9RA 1GXQA 5LGTA 2Q1NA 5E3NA 1GT0C 2PMHA 1ZRDA 3KD1E 3GZNB 1QHAA 2Q36A 4ELUA 2BBYA 3I9V2 4H0OA 2VBYA 4ZJZA 1EKEA 1JKOC 1K6YA 2BUPA 4AVZA 3TEDA 4AWXB 1QQCA 3FDYA 1JLAA 1YLFA 5HLHA 4A6EA 4CHQA 3TAPA 3QQAA 3FXOA 4DQ2A 3QPLA 3DLGA 3KP3A 2QTDA 3H0DA 4YHHK 3DEEA 3ZSWA 1MKMA 1MMDA 2E4LA 4KAZA 2A40A 1VQMN 4A3LJ 4LC9B 4EFHA 4XSZF 1JLEA 3Q0VA 4F55A 3KYCB 1VTNC 3VEPA 4B44A 3O4QA 3BF3A 4CZKA 1G2HA 1OCPA 4JAXA 1G99A 3RSEA 3LSKA 3MXJA 2WTEA 4DYCA 1STZA 2P9IA 4WFNL 3R3LA 3LPTA 4ESFA 1ATNA 1ZGAA 3GLXA 3P83D 5D5XB 3MKLA 3ZN0A 1TKTA 4IKFA 1O7FA 3DEWA 3MXMA 3WE2A 3ABKH 1HQUA 2J4RA 3KEOA 2VODA 4IQJA 3HRGA 2P9UB 2OCEA 3UKRB 4HEA2 4WCGA 4KHWA 3LM9A 2NNWA 3G4SI 3LWLA 4BY9C 2QWNA 4YFUA 2HU9A 2MD5A 2CV1A 1TKXA 2E5NA 2V9KA 4QCLA 2Z33A 1KCFA 4ZZLA 1VQMI 1SANA 4X1EA 2XSDC 5AQKA 1JKHA 1YUWA 3GTGJ 4CIGA 1W5SA 2W42A 3FXMA 4DUZK 3HBLA 3SV3A 3S2WA 3CUOA 4EHTA 4N0BA 3BGRA 5IPAA 1RCHA 4YRVA 1H9GA 2P9NB 1XNRK 1LFBA 2Y69H 4O0IA 4CW7B 2RAEA 5J8CA 5C3EJ 5JS1A 2FSJA 2FSNA 2P8TA 2YHYA 4GRIA 1TQIA 2A42A 1A5XA 3OA9A 3KYLA 4JKAA 3P9IA 3LP1A 1F9NA 5CYMA 1M1EB 2ECCA 4CD1A 4B1RA 1SL2A 3MKWB 4UQGA 1LPQA 5J2PA 3DMJA 4O6JA 5EXWA 3VEWA 4X6AJ 1U78A 1X1CA 5AR0A 3VTHA 2VKVA 4DYQA 2EQRA 5FPMA 3OOPA 1JLQA 2HMIA 5A2QK 2H8RA 3WQTA 3ZQGA 2L54A 3QP5A 1TBXA 4PFOA 3AAPA 4HDVA 2KQ2A 2WBMA 3O8MA 4A3GJ 2TDXA 1YIOA 1ZK8A 3CMYA 3BP8A 1ZKGA 1U2VA 3SAHA 4XR6A 4CJFA 4CZIA 3K4MA 1SKSA 3D5SC 1HA8A 2ID6A 2HPIA 4DR2K 4JBAA 2HNYA 3VQBA 4BR0A 4L9TA 2P9PB 1YW9A 4QS7A 4B3SK 4DTUA 1N75A 3AV9A 2GA1A 3DRRA 3IHUA 4JYKA 1C1CA 4OGEA 3CJQB 4IFYA 5KCMA 1NGBA 2VWBA 1FX7A 1TUYA 2O8DB 4I98B 1QQNA 2LRDA 3QWLA 2NVYJ 4EZ9A 2QWOA 4L0ZB 5E1XA 1TT0A 4OX9K 3K4LA 3VETA 4I09A 1S6QA 4C8LA 3R60A 1N77A 3ENOA 4OIPF 2LDUA 1L3SA 2KZGA 4EATA 4JS5A 3PNYA 2WOMA 3UR3C 3X2QH 1KTQA 3AO5A 3TOAA 4GYIA 5J3LA 4KUMA 3OY9A 2D45A 1BIZA 3AG1H 4KJZA 3K70D 4OPAA 2IS6A 3ZT1A 1YJWN 2JA5J 2DW4A 3VEZA 3LQRA 4F2RA 4B9MA 1ON2A 2PFBA 2XRNA 2HQNA 2JT1A 3LSHA 4GVEA 1XI1A 1BQNA 3IL2A 1WJBA 1YS7A 3AO1A 1Y6IA 1D9FA 1FOYA 3NWSA 1WPKA 1IJWC 3KLHA 4XRSA 2WAQA 3ZP5A 2R5ZA 1KONA 4A3IJ 4B3RK 4K43A 4L3QA 1JXBA 5AQXA 1HNXK 5DM6F 1DU0A 2K9MA 5DD4A 4U88A 1FIPA 3LSMA 3HSEA 1O3TA 3E0JB 4FWPA 2MABA 4H5NA 4HLYA 2QBYA 4WYBA 2HHHK 3HRMA 4Y13A 2ZMEA 4XLEA 5AQUA 3AVHA 4BQLA 1CXQA 3V42A 1S72N 4FLWA 4FZZA 2M4GA 1NKCA 2KJBA 3ZMSA 1GVDA 1ORKA 3EZ5A 4R5PA 4CFCA 4M6YA 4CBUA 1Y0UA 5HVQC 3UKUB 2PI0A 4DV4K 3I5UA 1BW5A 1EA3A 1K61A 4XH4A 3HM9A 5MLCQ 1KVCA 4BL0B 2EWSA 1YJWI 3M1EA 3BCAA 1USTA 1H88C 3VEVA 3GE1A 4ANJA 4IHXA 1DP3A 1SVLA 3RPUD 1QSLA 3CMAN 4ZTFA 1N78A 3BEXA 1ZN2A 3ZSXA 1U48A 3TWHA 1RPWA 3OYCA 2VG6A 4BQOA 4E7LA 1HDDC 1IBLK 1LW0A 3MEDA 4FWMA 5DEQA 1SVOA 4WF9L 3TQNA 4BG9A 4ID1A 3H35A 4XKWA 4Q0BA 3BJAA 2F4IA 3O8HA 3GYHX 2K3PA 4CGGA 3VA3A 3C1DA 2FBXA 4KPYA 3CC7N 4DU1A 1IUFA 3M9AA 3OOUA 3O9UA 1FMWA 3H1CA 3HOXJ 2JSPA 2OTJN 1D8JA 2ASPA 3ASOH 1FZPB 1C1AA 3CJCA 5HDGA 2XPWA 3HSFA 1JL1A 3M6GA 5HS7A 4A5AA 3CP8A 1P6RA 1HNZK 3E6DA 4DLEA 3AVMA 4KTWA 1ENHA 4CGIA 2XHBA 4G12A 5I42A 4FJXA 4CEBA 2WTUA 2K9NA 1TGOA 3OW2M 2R7TA 3DLLL 1KYWA 1NJWA 4JI1K 4II2A 2HTSA 4FPAA 3DLKA 5HNHA 1BI4A 4BJ6C 3BG6A 4P96A 3CMAI 4ZDLA 5LJVA 1LDDA 4BWJA 4MFEA 2FJ1A 1VK0A 1B1BA 2VXDA 3SPYA 4FL9A 3V7RA 2KHMA 4PY5A 4LB5A 4FJGA 3EUAA 4BR4A 3SUOA 4DU4A 3MCAB 3HPOA 1KA8A 1REPC 5F1XA 4QOZB 1DTQA 3CC7I 1R59O 4E89A 1X1DA 5GTIC 4FO0A 4DLGA 3QODA 3MEGA 1TTYA 3ZCMA 4A93J 2QLZA 4D5FA 1NMDA 1RUNA 2P9UA 4L5EA 3GXOA 4L0YB 1FTTA 4NC6A 1E4GT 3ULQB 2ZD1A 4I6MB 2CGKA 2FE3A 4BR9A 4HDUA 1N8RO 3RMCA 3H92A 4K2EA 4DTXA 1S9HA 4XK4A 4C1NI 3ENBA 2V7ZA 3RQIA 1T56A 4CFDA 2FSKA 2M8GX 2V6EA 5IWAK 3LA2A 3I8BA 2W25A 4YIRX 2M5WA 1JI8A 3C2GA 1O3QA 2K40A 1UG0A 4KI6A 3IRXA 3DXKB 3D0PA 1IV6A 4LH4A 4L5IA 1B59A 3CQZJ 3JRCA 4FWLA 1FSHA 5GAEJ 1RFQA 2GUIA 1SFEA 2LBFB 5AIQA 1BHLA 1GLJO 4FVUA 3OL4A 3QEPA 2O8FB 3R9PA 3V9WA 1NOYA 1E2XA 3LSGA 2D5VA 1VQ8N 4M6VA 2IGKA 3NBPA 4IDHA 3ASMA 3MWMA 5FD5A 2ITMA 2A1SA 4CJ3A 4HNVA 4A69C 4DV5K 3HC7A 3V9ZA 1RT7A 1X3ZB 3TBIA 1QPMA 1GDTA 3L3VA 1XGOA 3CXCM 3IS9A 1MBHA 5C4XJ 1U3EM 2L02A 4EJWA 2DPNA 1KGSA 4E1MA 2L4AA 2CWEA 2BANA 3CO6C 2TRTA 3FE1A 1XUPO 3QB0A 3K5MA 4FJ9A 3K69A 1HQCA 3KD5E 1XCVA 1FSEA 2NAZA 1RR8C 4WQ4C 1D8KA 1U6ZA 3OYNA 1ODDA 5B8HA 4FWOA 2E34A 2IPQX 4KBOA 1JJ2M 3DBRB 4KFBA 1MH3A 4EGZA 4M74A 1LAVA 1QVTA 2A1RA 5C24A 2ZXWH 2L5QA 2WC2A 4BHCA 3TDZC 5JICA 2I10A 2IA2A 2QSFX 2XB0X 1BA5A 2RPIA 2JA2A 2HXIA 2IP2A 1KVAA 3EQLF 1DUXC 3TU5A 3BTLA 2M4KA 2LK2A 2OV7A 3IMXA 3LWFA 3H3UA 3ISNC 2O8DA 1U6GA 4PL8A 3K1NA 3W6VA 4B3TK 3MKZA 5J1RA 2UZKA 1BOAA 4FJ5A 4BDZA 4KO0A 3KK3A 1Q1VA 1RZ4A 1Y8RB 2DA6A 2PMZN 4OKEA 1XCBA 5M1QA 5E8GA 1ONVA 3ZSRA 1D5VA 1ZTRA 3OYEA 1U0JA 2VBXA 5HRPA 2VB6A 3H9GA 4IRIA 3ZMTA 4QAGA 5C2DA 1BL0A 2E1ZA 5D6FA 1G4DA 2QWPA 4XNFA 3W0LA 4XN0A 4QPQA 5GAHJ 3VEOA 2VE8A 3Q7CA 2GEMA 4HF1A 2E2JJ 3MN9A 4JK1X 1FYKA 2RNGA 1S29A 3A5LC 3K70C 1J2XA 3HOVJ 3NE6A 4ZH4F 4CJUA 4JHDB 3AY9A 4XBFA 2LY9A 2P5LC 4KDPA 4EJVA 2V79A 4AM6A 4CE9A 3FGUA 1NG7A 3VYRB 1X9MA 2V1XA 3FM5A 2ZKZA 5HL7L 3FX3A 3DEUA 5FFZA 2ZFWA 4IOCF 2EV5A 1RBRA 5AQHA 4F8RA 3KP5A 1NJZA 1QQIA 1KYZA 5IT9Z 4OPKA 5K5QA 1WKMA 3VQ9A 1CZ9A 3DBHB 2A68F 5J4YA 3UKUA 5LMUK 4XKBA 3SPZA 2K7LA 1MH4A 2JVHA 2R7QA 4BRPA 1BISA 3F9MA 4M7YA 1MWMA 1CLQA 1Q86O 2OD5A 1D0YA 2WADA 3LDNA 1X1BA 5BQTA 4PGGA 4L9JA 1NK9A 2Z16A 2EH3A 2PJPA 2ZJPF 2Q2EA 4DFKA 4CXFA 5JLWA 4GKJK 1D0XA 2UYTA 5DUKA 3QNOA 4E7SA 3CD6N 4MO7A 2DPDA 2HNDA 3MD2A 1YI2N 2ME0A 1U5TB 3DCFA 1LOTB 3ZQ7A 1W7AA 4KB0A 2AJQA 1EQYA 4DB3A 4E3SA 4BEHA 1T2KA 3BCBA 3EL2A 4RB2C 1IW7F 2K9LA 3F5TA 4RLFA 4CZCA 1W2BM 2LTPA 4BGBA 1OCZH 4A3MJ 5JR3A 4WXDA 2XO7A 3CDIA 2E36A 3BJ6A 3C18A 1FOKA 3K5LA 3TKYA 2BTFA 2O8KA 2GOXB 1TYQA 2AQFA 4RM2A 3JW4A 4RAFA 1AU7A 4NB4A 4BUPA 1WI9A 3F6VA 3FXJA 1VI0A 1GLEG 3HDDA 1QBJA 4XKVA 1R22A 1HKTA 3OYLA 3KLFA 5L3DA 4UNOA 1R1VA 2G9WA 1RETA 3QIOA 4HLXA 4F93B 2EPFA 4EM0B 3THWB 3IRQA 1SUQA 3JRHA 5FROA 4M45A 1NGIA 4HW0A 3N97A 1VF9A 1U47A 3CD6I 2RKIA 2X6SA 2EILH 5H6RA 1Y39A 5IYBJ 5LGUA 1YI2I 5FPNA 1VSJA 5FB2A 4KN4X 4PQUA 2DLLA 3SZGA 3T8TA 1W0UA 4BBRJ 4DOZA 1MSEC 5KQ8A 4HV6A 3M3YJ 4JRQA 1V4SA 2DMTA 2ZM6K 1OVYA 2Z1HA 4NCBA 3ZSVA 2ZNYA 3HO1A 5H6QA 3L4IA 2F9WA 4FLTA 5ILUA 2ZXJA 5KQDA 1X3NA 1Z91A 1Q81O 2W4SA 2VJJA 1N36K 4DQPA 3Q7BA 3FFIA 3I0TA 3RTVA 3CTAA 4L18B 2FMLA 1J59A 1D5AA 1R7JA 4K42A 2PN6A 3I33A 4FK4A 1XMKA 1WJDA 4EGYA 1MJBA 5E1ZB 3HIFA 1BUPA 2CGJA 4BRCA 3RMDA 3LZJA 2P1JA 3SQNA 2BY0A 1QO0D 3DXKA 5IP9J 4CFBA 2CQXA 4DQRA 2ZSHB 3O3FA 2DODA 2LBFA 2XVCA 3KEYA 3HKZA 2IS4A 2RHKA 5K5RA 3I8DA 1ERDA 5KI6A 3SQ2A 3E1SA 3A0BC 4RTFD 3G6EN 2O8FA 3N05A 1S1VA 3THXA 4C3HJ 1A04A 2RKHA 1QZZA 1ZR4A 1NTCA 1TNSA 5J1UA 4KHYA 4L8RB 4F52A 3B6AA 5AFUH 4MEXF 2RQPA 2DDBA 3LA3A 2O8EB 3T5XA 5F0HA 1GHCA 1HNVA 4KTQA 3FXRA 1FOWA 1BI2A 4DV3K 2QXLA 3HTUA 2KFNA 3O9QA 4A0XA 3I71A 5E20A 2HW3A 4RGXA 4G9YA 3LSIA 5JHFA 3WGIA 3VPRA 2R7ZJ 2EIMH 3W3CA 2HXOA 5FRMA 2KJCA 2GM4A 2E35A 2JLEA 3FZVA 2FF4A 3U3YA 1YTAA 3TW7A 1UAXA 2XGDA 2ZF5O 4GO1A 1TZLA 2QENA 2IVPA 2QA4I 2ZC2A 3CCLI 3P9CA 5FPDA 3PY8A 4CH7A 4EEFG 4CF8A 3JSPA 2O7OA 3ONQA 3FZLA 3PLAA 4H4OA 5JVHL 1OCOH 3O6WA 5GPAA 3REOA 1SL1A 2HDWA 2E6LA 4IOXA 1X4OA 2NNNA 3G6EI 2F48A 3WGGA 5FJ8J 2EINH 2FNPA 4IG0A 2XAQA 3NHGA 4UB6C 4M71A 1ZARA 1LWEA 2FMYA 4CDGA 2VCPA 4WQ5C 1XX5A 1Q18A 3K5NA 3KX2A 3K10A 2CUEA 3V8LA 3T1AA 3QOPA 3OJSA 4L9VA 4A2UA 1R23A 5D4SA 3MEEA 3VWBA 1MBJA 1I94K 4CCHA 3NEUA 4A5MA 3DOKA 2A41A 2WUSA 2KT0A 3DLBA 3BQZA 3QEIA 2QKBA 3JRDA 2QSHX 2DMQA 4FJ7A 4S0HB 2GUPA 3LA7A 2RNJA 2E88A 4C8OA 3IUOA 2VGMA 4MDAA 1GLCG 4H03B 4YOVA 3FXLA 5IOZA 2GBYA 1IF1A 2Y75A 1HKBA 5J47A 2JN6A 1XHZA 2R7YA 2ASOA 3T19A 3I55N 4CECA 3E6BA 2HF4A 4CGFA 2L4MA 1KC8O 4G6TB 2OTLI 3DV8A 4LD0A 3GLLA 2IA0A 3I4NJ 5FLVA 5CR4A 4ISGA 5EU7A 2CUFA 4KRFA 1QS4A 2PMUA 4KITB 5CKTA 3VA0A 5HODA 5BPDA 4Y3OA 5F08A 4CHZA 2HMPA 4ABZA 1K8AO 3A5MC 4Z94A 4OAZA 3OS0A 3TAMA 3SZ2A 1DP7P 4CESA 4BRLA 1WWXA 3L1PA 3OHRA 4UUVA 3RIRA 4O4GA 1EH6A 5TGTA 3P31A 3CJAA 2BZTA 3K0LA 2GX9A 2E1CA 1GLLO 1DGRM 1N25A 1E0EA 3RR7A 3V7CA 1L5UA 2MG4A 2GELA 3E9PA 4PCQA 3SHFA 2AP1A 4H0TB 4J2EA 3V1RA 4M73A 3T1YK 4RAYA 2OCCH 5C12A 3GTQJ 4A3CJ 2LKPA 2OC6A 3I55I 1W36D 4W5OA 4BHBA 3SBTA 4UUTA 3E1YA 1U5TA 1WJCA 3OYHA 3IWFA 4BACA 1IG8A 2CQ7A 1LQ1A 1IN4A 2R7RA 4LFUA 1GLFO 1S1UA 3EYYA 1DLOA 2PJRA 5E79C 4A0ZA 2CS3A 2OPSA 4C8NA 2L01A 4B3XA 2MC3A 4J2AA 4QLCU 2MFZA 4G6QA 3CP2A 4IBNA 5IY5H 4YEJA 4U0WA 3JAMK 1JKQC 3JYTA 3W2VA 4Q5VA 2HOEA 5AQWA 2JUGA 2KZMA 1QRYA 1DQUA 3DOLA 3WEEB 5BRDA 4XLFA 4CZHA 1TT5B 3DRPA 4C1NK 1IN6A 3A8YA 2MH2A 2TCTA 3ZETA 3HEFA 4EJUA 1WI3A 5JVTA 5B1AH 3JAMZ 3AVAA 5DV5A 2YR2A 3U9GA 3J81O 1TWGJ 1S7AA 5L3CA 3CESA 2V7YA 2P7VB 3CCEN 5GPCA 3MN5A 3PFYA 2DY4A 2WB1N 3DU5A 2X6NA 2JWKA 2V51B 3NGYA 4F3OA 4FLXA 4MO4A 3ERED 3O1WA 4HUFA 1NK4A 1GXPA 4AHCA 1BIAA 1QTMA 1IAWA 1YE9A 4BRDA 4RB1A 3W6JB 3HJFA 3AA3A 3AAFA 3TAGA 5K5OA 1HMVA 2PG4A 1QNTA 1BA1A 3RI4A 3ZYYX 1BOBA 2MA3A 3RYPA 3RR8A 3ZQQA 2B5JA 1LUJB 2D0AA 3Q0UA 3ZEUB 1AHDP 2YNGA 4KHUA 4NB5A 4XLAA 5ED4A 1APLC 2FQ3A 2LLKA 1CF7A 1S5LC 5GAGJ 4PHTX 3HOTA 1IXCA 4JLHA 3LP0A 4ILJA 4RLQA 4WK8F 1FYMA 3FHZA 1QE1A 3ZQIA 2Y0SA 5BRHA 4W5QA 2MC4A 2ZJ2A 5EF6A 3A0HC 4Y15A 1RT3A 4LIUA 5M1OA 1WJEA 3MWTA 1KAYA 3OWTA 4ZZDA 3CCEI 4JRPA 3CCVN 4AM3A 3HOZJ 1TW2A 5TRDA 4CD3A 3O6BB 4BQAA 1R58A 3D6RA 2H94A 1VQ4N 3AA2A 2Y2ZA 2UXCK 3COAC 3HOUJ 2YPRA 3K9JA 3H0GJ 3O4NA 1C0MA 5F0FA 1J54A 1UOCA 4LF4K 4IVNA 1G15A 5GTHC 1X9WA 3OYJA 1E3HA 2VQLA 4JX4A 1CZBA 2BHYA 4CCOA 5AQTA 4OINF 2C6YA 4B1XB 2K27A 1OLTA 4NC7A 4ENMA 1LKXA 1UHSA 2HYJA 4B1VA 5E18F 2EFNA 2XKOA 1HW5A 1KU3A 3NGZA 1TKDA 3LSTA 4QSHA 4DR7K 4DS4A 3AVGA 5LJWA 1BIUA 3LAJA 4FM0A 2OPQA 1BJZA 3R61A 2YU3A 3OIOA 1MMGA 3ZMVA 1DDNA 2O0YA 3D1NI 2KMUA 1JKRC 1VQKN 4NUBA 1X58A 2HHUA 3A01B 3CCSN 4Q47A 1UB9A 3IFRA 3EZWA 4LITA 4WXCA 2WWYA 2I7PA 2O9LA 5FLXK 4HNTA 3J7YJ 3ZT3A 3CMMA 2EX3A 3CMEN 3K1MA 2G8IA 4WF2A 1BU6O 5KTQA 1MWKA 1KVBA 2IRFG 2V4JC 1IJJA 5AQGA 2EBIA 3BG9A 4Q48A 4AIDA 3HT3A 3NGIA 4OKJA 3K2ZA 2B4JA 1ZBSA 1DPRA 3QBXA 4NNJA 3ZCOA 1CQTA 1QVGM 3H9QA 1S8NA 3T1BA 1UA1A 1FIAA 1WSUA 1YFHA 3BG5A 2KZZA 1Q8IA 3CQXA 3LAMA 1TWFJ 4YIFA 1D1CA 5EJCA 1SFOJ 1O7LA 3NRVA 4BRGA 3S1RJ 1WOQA 1TVRA 3IH2A 3J7ZI 4DBQA 4LG0B 2CV2A 3RDIA 3I58A 3KP2A 4BRFA 1RNLA 4NQWA 2F5CA 4PJ0C 2G7UA 4IRGA 4RBOA 3EDPA 1MIJA 1S7EA 3BR0A 3DXJF 2ESNA 3KLOA 2CFXA 3HG9A 5BPMA 5ILSA 3GFLA 4PWDA 5DM6L 3GFJA 4IOAF 5KRTA 4XQFA 3PO3J 2V1UA 3DWLA 3WG7H 4H0VB 1J75A 3QO9A 3WQUA 3M8PA 1B72A 2DMUA 3E01A 1PUFB 4IJNA 2PZSA 2UV1A 3WHBA 3VSLA 4XLPF 1BBYA 1PJRA 4KH5A 2NS0A 4PFPA 5KAFC 5CQEA 1FT9A 3HOYJ 4XLCA 3QBWA 5HP1A 2VKHA 2IVMA 5EEHA 4Z4FA 2UUCK 4DU3A 4EMSA 1ZQ3P 1VQ9N 1WSGA 3EYZA
chains in the Genus database with same CATH topology
3K5OA 5E41A 4KHSA 1WSFA 2CUZA 3U21A 4XLEA 4DSFA 3PNVA 4ITVA 4CF1A 1ZBUA 1S5JA 3AVHA 1CXQA 3V42A 4FW1A 2W00A 4FLWA 4FZZA 2M4GA 1NKCA 4R79A 2PMZA 3AA4A 5HRSA 4XORA 2NOJB 4PUOA 1L3VA 1QU3A 3EZ5A 4R5PA 4CFCA 1U04A 1ZELA 5HVQC 3AA5X 1EA3A 3DI6A 2BGGA