1GV5A

Crystal structure of c-myb r2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
molecule tags Transcription
molecule keywords MYB PROTO-ONCOGENE PROTEIN
total genus 16
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv5A00
3HGYA 2E2JJ 3HM5A 5M3MJ 4UUTA 2Y0SN 4Y52J 5J1YA 2EZHA 1QVUA 4UUSB 4XK4A 3ZQCA 1MBJA 2ZB9A 5M5XJ 4FE7A 3DEWA 4GFBA 4RDUA 2M0CA 1T33A 5IP9J 2R0QC 1HCRA 2K9SA 2B63J 1Z0XA 1HF0A 3JRAA 5EEAA 5F08A 3CMYA 4MFEA 2W48A 2COBA 3WHCA 3JREA 2CQXA 3G1LA 5C3EJ 4X1EA 1AHDP 5IOYA 1IGNA 1TWAJ 4AYBN 3RKQA 1B72A 2EZLA 3ZQGA 4C3HJ 4A3EJ 1U9NA 4M3GA 3PM1A 4B3AA 2JJ7A 4A3IJ 1AU7A 3C2BA 3OOUA 2IAIA 4C2MJ 2EZIA 1UG2A 5E3MA 5DTDA 4W1UA 1ZK8A 3JRDA 2FJ1A 2DA4A 1LFUP 4M3DA 2H1KA 1BW5A 2L7MP 2R5YB 4D7NA 5IP7J 5K7HA 5EF6A 3SJMA 9ANTA 1WCMJ 5E3LA 2DMNA 1H8AC 1AKHB 3A02A 2L0KA 1JTXA 5EGOB 1GUUA 2M2EA 1WI3A 1MNMC 5FKKA 4XRSG 1BJZA 2VUMJ 2DMQA 4G12A 1ETQA 4L5EA 2OF7A 2DA7A 1B8IA 1JUSA 3ZQHA 5GPCA 2CRGA 3JR9A 4C3JJ 1X2MA 2LLKA 1ETXA 1O4XA 2LR8A 3HDDA 1I3QJ 1LE8A 2XGEA 4X6AJ 2EQRA 2JMWA 4A3FJ 4A69C 1U9OA 3Q3SA 2M8GX 1ETKA 3FK7A 1JUPA 3CDLA 4JYKA 5FKLA 1K83J 1U78A 3O8HA 1H88C 3LSPA 2ME6A 3BTLA 3LSJA 3S1NJ 3BQYA 1POGA 3H0GJ 4I76A 2XGCA 5C44J 1QPIA 1CQTA 1TC3C 2DA2A 2CJJA 4RBOA 2GBYA 5EYRA 2LTPA 3S1MJ 5C4JJ 1T56A 4V2FA 5EZHA 4QTRA 1MBFA 4A93J 2L9RA 3MN2A 2NOGA 3JRCA 3K2AA 2K40A 1JJ6C 2O9LA 4NDLA 3G1OA 3IV5A 4BBRJ 1F36A 2EBIA 5J1RA 2LY9A 3HOVJ 4BY1J 4FE4A 4IHXA 2IBDA 1GDTA 2KT0A 5FLVA 2M34A 5F04A 3UKGA 1P7JA 1IUFA 4DZPA 3S2HJ 3HB9A 3GTPJ 1Y1WJ 3Q0VA 1IG7A 1P7IA 1DU6A 2LD5A 2E19A 5FJ8J 2HXOA 3FK6A 1PUFB 4MIMA 2XRLA 3HKZN 4QIWN 1MBEA 2YUSA 4MO7A 2ECCA 1ENHA 5EG0A 4A3JJ 3RZDJ 3K7AJ 2JA5J 5BNGA 3M3YJ 5J1UA 5FKNA 2VKVA 1X2NA 3BT9A 3JRIA 1YRNA 2EZKA 2ID6A 2R7ZJ 2JA6J 1I6HJ 1B8IB 3HOWJ 2GM4A 4FISA 1ZQ3P 4A3GJ 1ZTRA 4DZJA 4MFDA 1IV6A 3I4MJ 3HGGA 4FTHA 3H3VK 5F0HA 1RPWA 2RAEA 1BW6A 2AHQA 2TRTA 2HXIA 3SFIA 1ITYA 2R5ZB 3ZOBA 5EDNA 1JKOC 3B6AA 4BXXJ 2R92J 2XB5A 3HEFA 1E3OC 3FIWA 1RETA 2HOSA 1QVTA 1U8BA 4A3LJ 2NVXJ 3QPSA 3TW6A 3NARA 4I6ZA 4CYCA 5M3FJ 4DYCA 2KDZA 2WV1A 2DN0A 2Y30A 3IH4A 3A01A 5JLWA 2LK2A 4MLOA 1NK3P 2Y2ZA 3M4OJ 2E2IJ 2WB1N 1TWGJ 3OSFA 3CQZJ 3JRBA 2HI3A 3BTIA 3B6CA 1I50J 4UUSA 1WH5A 4A3MJ 5GPAA 1WPKA 4AC0A 3S17J 1G2HA 3CCYA 1UHSA 2HYJA 2NVTJ 2M9HA 3A03A 4JX5A 4S0HB 5F1JA 1RR7A 2X9DA 1APLC 1XS9A 5F0FA 1GV5A 5IYBJ 1XC5A 4A3BJ 1MH3A 2AO9A 2Y9ZA 3TP3A 3GTGJ 2CUFA 3Q0WA 4BKXA 1JKPC 2H8RA 3MVPA 2DA3A 3NAUA 3WHBA 1B72B 3JRGA 1JKQC 2MG4A 3IH2A 4A3CJ 3OSGA 3TEDA 3GTMJ 2DTZA 1HDPA 3LNQA 3GTLJ 1FJLA 1OCTC 5J3LA 5IOZA 4AUXA 1VFCA 1QRYA 2DA6A 2MSYA 3HOZJ 5M5WJ 5FLMJ 2R5YA 5E3NA 2HOTA 3RQIA 4BBSJ 2Y31A 2XPUA 1NK2P 1YRNB 2DMTA 5K7FA 1OFCX 2NVYJ 2VPRA 2Y9YA 3TP0A 1HOMA 1BA5A 1AKHA 2FQ4A 3HBLA 4M6VA 4JP0A 1ZKGA 5E3OA 3TW7A 1MSEC 3L1PA 2JN6A 1BL0A 2VI6A 1ETWA 1MBGA 1TWFJ 2WAQN 3LSRA 2D5VA 1JTYA 1SANA 1VF9A 2VKEA 5EZGA 1X58A 5IYCJ 3BG5A 4D5FA 2L7FP 4XRMA 2CU7A 5IYDJ 4M3BA 4EEFG 2E1OA 3PO2J 2ID3A 2XGDA 2X6OA 3BR3A 4M3FA 3HOYJ 4ABZA 2X48A 5JLXA 2R93J 3S2DJ 2JA8J 2K9QA 2JK3A 3D1NI 3S14J 4M3EA 2P81A 4IHVA 1Q1VA 1MBHA 1GT0C 2XPVA 1IRZA 1S7EA 3BR1A 1ORKA 1HLVA 4IHWA 3HOXJ 1WGXA 3PO3J 4LOCA 5IPAA 2YU9J 1W0TA 3SDGA 3GTQJ 3BQZA 2HDDA 1JGGA 1Y1VJ 5HODA 1DU0A 4B1RA 4B4CA 5M5YJ 3IH3A 1W0UA 3BTJA 3W6VA 2O8KA 3GTOJ 4D7MA 1FEXA 3BG9A 1TWCJ 5C4XJ 4IEJA 4FCYA 2ELKA 1H89C 2HQ5A 1GVDA 2LKXA 1RESA 4DYQA 1JJ8C 2HOAA 3JRHA 3MKLA 3ZQLA 4XRSA 1ETYA 1MBKA 1A6IA 2QF7A 3GTKJ 1ZR4A 1GV2A 5DS9A 2CQQA 3BG3A 3OIOA 2CUEA 4D5CA 2DMPA 4A3DJ 2DA5A 2EH3A 3S16J 1IJWC 2PMZN 4JX6A 3Q0UA 1MH4A 1FIPA 1R9TJ 1WH7A 5F27A 3S15J 2LP0A 2DA1A 1K61A 1Z77A 2E2HJ 2I10A 1IDZA 1A5JA 1TWHJ 3BR2A 3HOUJ 1JUMA 1JT6A 4XICA 3I4NJ 1MSFC 5K7ZA 3BR0A 2LFBA 2IEKA 1ETVA 1OCPA 5FKOA 2ECBA 4Y7NJ 2O7OA 3LOCA 2NS7A 1ZGWA 4C3IJ 4DYRA 2XB0X 2XPWA 5GP9A 2NVQJ 1NTCA 2FX0A 1VNDA 1FTZA 1PUFA 4HNVA 1FTTA 3S1QJ 1F43A 2K9NA 3DCFA 5EG0B 3BR6A 1LFBA 2R5ZA 1EF4A 3FKIJ 4V2GA 2JA7J 4BY7J 3RZOJ 1RKWA 2YS9A 1ZR2A 1FIAA 3VPRA 3GBGA 1IC8A 2OPTA 3FISA 5FKMA 5EGOA 2N8GA 1JKRC 3QQAA 2GLOA 2QCOA 4JX4A 4CYCB 3JRFA 2LVSA 2FD5A 3BTCA 2L7ZA 2ME0A 3LSGA 3A01B 1XG1A 2G0EA 2DJNA 3BR5A 1RKTA 3F0CA 3ZQIA 1ETOA 1VI0A 3G1MA 5IP6A 4XIDA 3S1RJ 2NS8A 1LE8B 1UMQA 1HDDC 2TCTA 4W97A 2MGQA 3QPLA 1OJLA 1D5YA 4J19A 4QSHA 4IHYA 1SFOJ 5F0CA 2DMUA 4A3KJ 2JWTA 2MW8A 2XSDC 1IDYA 3GTJJ 4DW6A 1JT0A 3E7LA 3O8GA 3ZQFA
chains in the Genus database with same CATH superfamily
3HGYA 1V4RA 3MKZA 3B73A 1TNSA 3DKYA 4UUTA 2M4GA 3ZGKA 1IO2A 3Q9SA 5J1YA 4MEYF 2IS4A 4B43A 1DP7P 1WJBA 1S7OA 3DKWA 1QVUA 2VBZA 4UUSB 3FXOA 3LFUA 3ZXSA 2WY7Q 2GIVA 2FOWA 4HQMA 2ACJA 4FE7A 3F8CA 1BR2A 3R6SA 3V7SA 5IP9J 1HCRA 3HPGA 2FMLA 1BJAA 2H6CA 5EEAA 3I59B 3CMYA 4MFEA 1VQLI 5LHIA 1OYIA 3G1LA 3KYCB 1YOVB 1DQUA 2EPFA 2QQ9A 4P9FA 1VQ4I 1JXSA 1TWAJ 2K85A 4AYBN 5D5VB 3KP7A 2K86A 4A3EJ 3GXOA 3PM1A 1XGMA 4DOZA 1BIBA 1UJ8A 2JPBA 5GAGJ 3L00A 3C2BA 3V7RA 3C3WA 5FB2A 1AU7A 1VQOI 1LNWA 1W4MA 4U88A 1ZK8A 5BS6A 2FJ1A 4IKFA 4HA8A 3M7GA 1I27A 2JVGA 4ENKA 1LFUP 2L4MA 1A31A 2DOAA 2LF7A 5EF6A 4RB1A 4LB5A 2NNNA 2MYSA 2ZKZA 3GYHX 1Z6TA 1FOWA 2OU2A 3P9KA 1REPC 2L0KA 2KIMA 3I4PA 2MBFA 1K79A 1D0YA 3HUGA 2HWVA 3X2QH 2OAZA 1YHQI 1RI7A 4XRFA 1N25A 1QQIA 3PNYA 2MLGA 3S8PA 2HVRA 3R0AA 2R7FA 2Q8KA 1D1AA 4PGHA 5GPCA 2QKLB 1W7PB 3OS1A 4NNJA 1Z67A 3KLOA 1OR7A 2WADA 1I3QJ 2FE3A 2GIZA 4NC8A 2XGXA 1D1CA 3F9KA 1AOYA 3GLLA 3QPTA 2M8GX 3I0TA 1FLIA 4KFCA 4BACA 1F1ZA 4IQJA 2D2WA 4BU2A 1ETKA 1I1GA 2B7EA 1Z9CA 2NVUB 1Z6RA 1ZGJA 2EWNA 5HS8A 1S29A 3OS2A 5DD8A 1JUPA 1WRJA 2RVCA 3O3KA 5FKLA 2UZKA 1K83J 1G4DA 5DM6F 3LSTA 1MD0A 3OMYA 5FROA 2BXYA 3LSPA 2IRFG 2VOOA 5FRNA 4F93B 3CCVI 2XGCA 1S7AA 2OTJI 3JTHA 1W5TA 1T95A 3ABUA 1MDMA 4YELA 3L2CA 3J7ZI 2CJJA 3CUQB 3I5UA 1EH8A 2PX9A 4RBOA 3K4JA 5C4JJ 2PG4A 2BOLA 2LYCA 1X4OA 2JSCA 2L9RA 3M1CA 3SQNA 1BN5A 3MKWB 4BUPA 1S72I 2O9LA 1KGSA 4NDLA 2GAUA 2M30A 3IV5A 3E97A 3ECHA 3FKJA 4BDYA 1F36A 3PUBA 5JHFA 3F8BA 1TQIA 4FE4A 3GUDA 5HLHA 2M7BA 2PMZA 4IHXA 1KA8A 4OIOF 1ZG1A 1R1TA 1ZN2A 2ELHA 2VN2A 4L5JA 5F04A 3LSIA 2XAUA 4ITVA 5HS9A 2QKMB 3EUAA 3FM3A 3U1KA 4OMYA 2COMA 3RPQA 3TQNA 1UG0A 3OV8A 1G3TA 2P4WA 4R1HA 2JTVA 2DT5A 3CLOA 1P7IA 2D1HA 1EJ9A 2LD5A 2ZFWA 4XONA 3HIFA 2F4OB 1FOYA 5AONA 5FJ8J 2R7VA 2HXOA 2XRLA 4MIMA 2QQBA 2Z5UA 1MBEA 2YUSA 3OYHA 4Y17A 5EG0A 4IHTA 3ESWB 3RZDJ 3F22A 3M3YJ 2ESNA 2VBXA 4UVBA 3CC4I 3M9AA 1YW7A 1Z91A 3ABMH 5L3BA 1P4XA 1I6HJ 3SZTA 3VSKA 2ADUA 4BQNA 4YIFA 2GM4A 5E8IA 5H6RA 4A3GJ 4UNOA 4E70A 3U1DA 4MFDA 1W36D 2PMUA 2HZTA 1R23A 5LGNA 5ILUA 4KISA 1I39A 4UXNA 4QPOA 1BW6A 3KPHA 4BJTA 5JR3A 4J00A 4KMFA 4PJNA 5IY5H 4HYEA 3RKXA 2JUGA 1MGTA 1XD7A 2IPQX 2W7NA 1KQ9A 2F6CA 2QEXI 3B6AA 1DGRM 1Y8RB 4GRIA 1I5ZA 2RQQA 3HEFA 1E3OC 2CSOA 5L3GA 1RETA 2HOSA 4U7BA 1YO5C 2YX4A 3CLQA 2EB7A 1ZRDA 4QWQA 2DLLA 4I6ZA 2VE8A 2FBKA 3F6VA 2WV1A 2OV7A 5JLWA 3KEOA 2Y2ZA 3RPUD 3VYUB 3SYTA 3M4OJ 2YPRA 1H9TA 1R1UA 3M8FA 3BC8A 2LKPA 3DBRB 1DPUA 2R7QA 3I64A 3E5XA 4RM2A 2P5KA 4NC6A 4P55A 4AC0A 2XAQA 1G2HA 4U87A 2NVTJ 2Z33A 3ABTA 3A03A 3RDIA 3FXUA 5F1JA 4IL6C 1APLC 1XS9A 5F0FA 1GV5A 5IYBJ 4I2OA 2M7AA 1MH3A 2OD5A 4XOTA 3E1SA 2QYOA 2VKDA 2DO7A 1K4TA 3Q0WA 1SAXA 1OCOH 1OCCH 3JCUC 2DA3A 2FBIA 1B72B 3JRGA 1JKQC 3RPUA 4FHTA 3RSNA 2R7SA 1NG7A 3IH2A 4M6XA 3QYEA 1YTYA 4ZTJA 4IRHA 3FBIB 2O61A 3I58A 1QA6A 3CD6I 5DYMA 1XMXA 2DBBA 2GOXB 1HDPA 3LNQA 2IS2A 4A5NA 2OQRA 4GXOA 1OCTC 1SMYF 1WHUA 5IOZA 4AUXA 1VFCA 2BGCA 1C0WA 5M5WJ 3NWTA 2HOTA 5FFZA 1YRNB 2DMTA 2K7LA 1SAUA 1OFCX 5DV5A 1UB9A 4LMYA 2V6CA 4CSWA 1HOMA 3CJNA 3HBLA 2E60A 2ISZA 3FWEA 3KX2A 1KU7A 4XQFA 2HPIA 1RUOA 2RV8A 3DTKA 1H9GA 2MLKA 1BL0A 1P4AA 2QA4I 3W2VA 5ILVA 1XGSA 2WAQN 2W85A 1JTYA 3K0LA 2VKEA 1ZLKA 1X58A 3NRVA 3BJ6A 3BG5A 1I6XA 2HFHA 4XRMA 5LRSA 2X4HA 2QQ8A 3HSRA 4EEFG 4FQGA 2E1OA 5GTHC 4XBFA 2ID3A 1PP7U 2XGDA 3E6DA 3PO2J 3ABKH 4BAYA 3PIOF 3DTEA 4CCJA 1HW2A 4BH9A 2F5DA 4RMNA 4GGGA 1XSVA 4IVNA 5JLXA 4DGWB 1W5CC 4G94A 2ZCWA 3D1NI 1BR4A 2DOFA 1YX3A 1IXSB 3PFYA 2LC2A 3MEXA 2EIMH 1J5YA 1MBHA 1RNLA 2ZBKA 4HG2A 1S7EA 2A3SA 3BR1A 5CLSA 1PJRA 1ORKA 3EDPA 5LGTA 3JAMZ 1VZ0A 3ECOA 4IO9F 2HTSA 2WBMA 5B66C 4MNUA 3PO3J 4LOCA 4OINF 1KU2A 2GA1A 1QBJA 2Y69H 4HEA2 5E20A 3TO9A 1JGGA 5GAHJ 3M8JA 2IXSA 3K4NA 5L3FA 1Y1VJ 3ZQ7A 2F4MB 2ZXWH 1Z7UA 4B1RA 4E7KA 3W2WA 2QBYB 3E5UA 5M5YJ 3ZRGA 2WV0A 2NAZA 3BTJA 1LKXA 2BY0A 2XAHA 5C4XJ 4IEJA 2DDAA 2LOOA 4QPQA 1CF7B 4YIRX 1HA8A 4B3XA 4LLGF 3PUFA 2LKXA 4DYQA 3WTXC 1JJ8C 3D0SA 3JRHA 1ETYA 3KETA 3RI4A 1HW5A 3F3XA 1MBKA 3VOEA 4OMZA 4XOPA 3TDUC 3GTKJ 4LK0F 4K2EA 3U9GA 1O3QA 3BG3A 4HLYA 2DT7B 2DMPA 1SEUA 3S16J 4IX7A 2J5PA 1J59A 2DQRA 3U21A 1EV7A 2CV2A 1MH4A 2IVMA 4CCLA 3S15J 2LP0A 4AIHA 4ON0A 2FA5A 2I10A 2OZ6A 2P7CB 3BR2A 1T0FC 1JUMA 2XF6A 3HC7A 1IAWA 3LA3A 2VE9A 1FPQA 3H9GA 3LOCA 3H5NA 1YIOA 5HDGA 3MFKA 4DYRA 1ZHFA 4I98B 5LEJA 1KONA 1NTCA 4Q4ZF 2FX0A 4CUGA 1ZGAA 3VSLA 4PCQA 1IV8A 2W1OA 1YW9A 1E0EA 1LFBA 5FFXA 1SMTA 3FKIJ 2LY1A 4I7HA 1LUJB 2Q1ZB 1RKWA 3H36A 4KT6A 4BQOA 4BE0A 4YIIA 2L54A 3GBGA 3AG1H 3L2QA 3GO5A 2GLOA 4CYCB 1X3WB 2KL4A 2W4SA 1KYZA 2BE5F 2CFOA 3BTCA 4P1WA 1ZG5A 1YJWI 2E34A 1XG1A 2HTJA 2G0EA 3T0YA 3BR5A 1RKTA 1FYKA 1ETOA 2W00A 3S1RJ 1P9QC 3FDYA 1FMWA 3SHFA 3DLAA 4FETA 4D9JA 1KU9A 3FXJA 5BPDA 3WGHA 3TOAA 1AA7A 1OPCA 5LLQA 4IHYA 2R3SA 5F0CA 3HZJA 1IDYA 2V4JC 3HOSA 4LJZF 3R0JA 1YLFA 5ICGA 2V9VA 4DW6A 3FMQA 4CZCA 1T39A 2KFDA 4EJWA 3H5AA 5CVJA 2L9VA 2VQHA 2Y0SN 4A5MA 2CUJA 4Y52J 1XCBA 4AIJA 2VQGA 1KQ8A 3L2VA 3QWLA 2DTRA 2V7FA 1LJ9A 1G8XA 4II3A 3IP4B 1MJ9A 1JGSA 2X85A 5J6XA 5K5RA 2VIXA 3EYIA 2A5WA 2L3DA 2O3FA 2K9SA 4M72A 3K4LA 3TDZC 5TGTA 3JRAA 2W48A 1JHFA 3WHCA 2QUFA 2JRMA 2V1XA 1LPQA 2CQXA 3S93A 1D8KA 2NYXA 3FZVA 4EMSA 2FXAA 1MJAA 5IOYA 1ULYA 2I8DA 1D0ZA 5F64A 5JVTA 4C3HJ 1U9NA 3OYMA 3P9CA 4ANJA 3P7NA 3LSHA 3WG7H 4A3IJ 2X1CA 2Y48A 2IAIA 1SD7A 1UG2A 2L7KA 4W1UA 4XLEA 3EQLF 4BEHB 3ZN1A 3COAC 4M3DA 2H1KA 2A6TA 2P8TA 6PAXA 1P4WA 4IXAA 5IP7J 3SJMA 3V7CA 9ANTA 1WCMJ 4BE2A 4YFKF 2V1DA 2K02A 2XKOA 1H8AC 1XGOA 3AG3H 1WI3A 4LIUA 5FKKA 4XRSG 3IRQA 2VUMJ 2MD0A 2WAQA 4XLPF 2YX7A 5J8FA 1ETQA 3K1MA 3QOPA 3OL4A 1FP2A 1EA3A 3S3NA 1B8IA 3OYNA 4C3JJ 1X2MA 2LLKA 4EJVA 3KYDB 3EUHA 1O4XA 2LR8A 3WTWC 4OOIA 1YITI 1O3SA 5KK1A 1TT0A 5B3SH 2EFOA 2VJ4A 2F2EA 4RAGA 1TW2A 2AXLA 4LG0A 3HRSA 4P96A 4WXHA 4YFXF 3FM5A 2X6YA 2PN6A 4XN3A 1PDNC 3GZ5A 1KQ0A 2CW8A 3ASOH 5D5XB 1L3LA 3T1BA 1BOBA 1H88C 4A6DA 1P2FA 1Q1HA 3LSJA 4F52A 3BQYA 1A6QA 1IXCA 2FOKA 4I76A 1R7JA 2DQLA 5C44J 3REOA 1QPIA 2BW3B 1CQTA 2PFBA 2G7HA 3HHGA 5EYRA 2VXDA 1T56A 4QTRA 4A93J 3MQ0A 3CCQI 4UY8I 2NOGA 3K2AA 2K40A 5LHHA 3KP4A 2KJCA 4RAZA 1UHWA 3HRUA 4BBRJ 1ON2A 1WZ2A 2ICWG 1SD4A 2IGKA 5FD5A 4DQ2A 1RRJA 1FWZA 5J1RA 1EKEA 2JSPA 3RJPA 2IBDA 1VQ6I 1GDTA 1UZCA 3S32A 3OYDA 1ZAOA 1K7AA 4HLXA 5TRDA 1YE9A 2V1NA 3GTPJ 1YFHA 3LQRA 1Y1WJ 3TO7A 3I53A 3H35A 3OYLA 3Q0VA 1V55H 1IG7A 1BR1A 2CYYA 4HPQA 4BXUA 1DU6A 1XB4A 4F91B 2B0LA 2IS6A 1T2KA 1DDNA 1XMKA 3CCMI 1W5SA 3GMEA 1O7FA 5HLIA 3H0DA 5J4VA 2VB6A 1ENHA 2STTA 4HOBA 1N78A 3I56I 1FMVA 2H94A 2JA5J 5BNGA 5J1UA 1S5LC 5FKNA 4EJOA 3E0JB 3MWMA 2ID6A 3VWBA 3MCZA 4P9UA 2JA6J 1BI3A 1JHHA 2E35A 4DZJA 3BWGA 1IV6A 4EGYA 2E7WA 1UCRA 3DBLB 1D8JA 3A0HC 5CJ9A 2XRNA 3CCUI 3I4MJ 4XORA 4FTHA 2LREA 4F7ZA 1UFMA 2ZNZA 3CJQB 2AHQA 2TRTA 3DPLC 1D3YA 3SFIA 4HX8A 2R5ZB 2ZSIB 5D8KB 5D4RA 1QO0D 1JKOC 1IRGA 4GO1A 3PL8A 4E7HA 2VPLA 1S8NA 2M87A 4I99C 4LLLA 2HVSA 2NVXJ 3QPSA 3Q9VA 1T08B 3TW6A 3NARA 3WTUC 4CYCA 1MMAA 2BZTA 3SEQA 3TO6A 4B44A 2DFHA 4PDKA 2KDZA 2DN0A 2GXGA 1NK3P 2UV1A 1FX7A 3WODF 1VQNI 4HF2A 5HLTA 3FX3A 3KFWX 5CVVA 2FNAA 4UUSA 2DPDA 2DCEA 1WH5A 4L9NA 2PMHA 1V54H 3K10A 4B47A 5GPAA 4B48A 3GWZA 5LD2C 4AU7A 1UHSA 2M9HA 4IRGA 1TQMA 3ZMUA 3DP7A 3QU3A 4WWCA 1X1AA 1U5TC 3QPHA 4L9TA 4PK4A 2AO9A 2GWRA 3TP3A 4AYBA 3GTGJ 1GVJA 2CUFA 4HNUA 2R7OA 3J7AO 2E1CA 2H8RA 3M8EA 3NAUA 2JVHA 3BG7A 2MG4A 1XTAA 4M9SA 3GTMJ 4M6YA 3CUQC 1OLTA 4HV5A 4WXDA 4BHBA 3GTLJ 3RTRA 4AD9A 2VC1A 1LQ1A 4L0YB 3DV8A 4CCMA 1R71A 2H1LA 4UHTA 5FLMJ 1X1DA 4QLCU 1YG2A 4BBSJ 2EV5A 1PVEA 2FQ3A 2XPUA 3OYJA 3RIRA 3LFKA 4KUMA 2NVYJ 5AIQA 1XSXA 2E36A 3F72A 4M6VA 4U0VA 4KA4A 4FX0A 3HUGB 2F48A 4KMUX 1MSEC 4IF4A 4RB0A 4BEHA 1FY7A 3CCLI 2CUZA 2Q2EB 3LSRA 4E7JA 5EZGA 1OR7C 2XAGA 4IQ4A 4CGZA 4IZZA 3MAJA 2ZJQF 1ON1A 2CG4A 2VL8A 5GTIC 2DAOA 2FSWA 3J80Z 4NB5A 2X6OA 3ZQQA 4YFNF 3AL0B 3BR3A 4EATA 3HOYJ 3WTYC 4LK1F 4ABZA 2QWWA 3EPZA 3EETA 2JA8J 2K9QA 2D1VA 3CDHA 3ERED 1TL8A 1VQ8I 3GLXA 3OYIA 3ISPA 2E5NA 4A0YA 5LFAA 1R5ID 2ZXHA 4BHCA 5B5EC 1UAAA 2EJRA 5IT9K 5FGMA 3DWLE 3HOXJ 3J7YJ 3C18A 2BV6A 3SDGA 5LHGA 2GXAA 3BQZA 4ZYDA 3IKVA 3ERMA 2DPUA 5D5WB 1LVAA 3CUOA 1USTA 2DK5A 2TDXA 4RB3C 3W6VA 1FSEA 4RGXA 3BJAA 5D5UB 3BG9A 1TWCJ 4CCNA 1V5GA 4FCYA 1H89C 1Y56A 2KIFA 1TBXA 2JUCA 3I9V2 2X51A 3ZQLA 1V3FA 3TOBA 1J75A 5F1RA 4HZFA 1MNDA 1VQ9I 3KIOA 1ZR4A 2BEOA 4HBLA 1K6YA 1GV2A 5CVRA 4E4HA 3CESA 1YQAA 3OIOA 5E1ZB 4D5CA 2IS1A 4A3DJ 3WTTC 2PLYA 1WJDA 2P5VA 2QM3A 3E3VA 4A0XA 1JE8A 3H5RA 2A07F 1IW7F 4CHUA 1FIPA 3BPVA 1K61A 1IDZA 2K3FA 2E7XA 2VBYA 1WSUA 5DUIA 3CF5F 3GFMA 1U5TB 3HOUJ 1JT6A 5K7ZA 1BI2A 3BR0A 3IWFA 2ETHA 4I01A 2IEKA 3AL0C 1OCPA 4OIRF 1Z21A 4Y7NJ 3OY9A 2P6TA 3FXKA 4CCKA 3JSOA 4RGRA 3WU2C 3LAJA 4KDPA 2XPWA 4CA0A 1MIJA 2HQNA 3QODA 4R79A 4S05A 1YJNI 1FTZA 3T8RA 3SEZA 3ROUA 4HNVA 2RREA 2DFFA 3DPTA 1F43A 2LRDA 1UHMA 5HOOA 3B02A 5L3CA 1NHAA 2LY2A 4BGDA 3EUHC 4V2GA 2D45A 2JQ7A 2BHZA 3OYEA 3HKZA 3RZOJ 1ZR2A 2L4AA 1FIAA 3MD2A 3KLNA 2K4BA 1S9HA 5FKMA 2CFXA 2MC3A 4EGZA 3WE2A 4PJLA 3QQAA 4OIPF 2QCOA 2R7WA 4KITB 5J8CA 2LVSA 2FD5A 2DW4A 3H1CA 4PGGA 4WCGA 3VB2A 1KZHA 3LSGA 2HPMA 2R7UA 4G6DA 1B59A 3ZQIA 4XIDA 3FXQA 1W7PA 3MZHA 2QSHX 5JI6A 1K78B 1FNNA 1LE8B 1GXPA 1UMQA 1HW1A 4PSWA 3WU0A 1MW7A 1E17A 4N9IA 2PBIA 3QPLA 1D5YA 4ESJA 1SFOJ 3A2KA 2JWTA 2MW8A 3ML6A 1Z7LA 3GTJJ 5B1AH 3O8GA 3OIPA 3ABLH 2FRHA 1FBSA 3H3ZA 3BZ6A 3HM5A 4Z2YA 2V1UA 3D5RC 5HDKA 2UXXA 1QPMA 3QP5A 2RDPA 2PJPA 5J4YA 3ZQCA 4FASD 1FOKA 5CVIA 1RR8C 4KN7X 3FHZA 3DEWA 1OYYA 4Z6YA 3VYSB 2M0CA 2ZC2A 4JK1X 1T33A 5J40A 2B63J 1WJCA 2KDOA 1N75A 4JOMA 1HF0A 3PQJA 1U6GA 5F08A 1BI1A 2RNGA 3ZR8X 3JREA 2X0LA 3A4CA 2VJJA 4RLFA 4A6EA 4X1EA 1FZPB 1R49A 4LITA 1DUXC 3T8TA 1IGNA 2MD5A 3RKQA 3TL4X 3ZQGA 4G7OF 1STZA 1X3UA 3F8FA 4B3AA 1LEAA 5LBQA 4D1QA 4LG3A 2M0MA 3OOUA 4C2MJ 2EZIA 2P7VB 3PQKA 1ZH5A 3JRDA 3MMYB 2AQEA 4FT8A 1PUEE 4EM1A 4OAYA 2LKSA 3J81K 2Z2SB 1R1VA 1BW5A 2L7MP 4XN0A 5K7HA 5KHDA 3HL2A 3BLYA 2XV4S 1Y8QB 3C2GA 5E3LA 4C2TA 2DMNA 4N4OB 4CCOA 2XROA 1AKHB 4KT5C 5KNLA 1SFKA 2KRHA 2L01A 1BJZA 4G12A 3J81Z 4L5EA 2OF7A 3C2HA 3K1PA 2DA7A 1R00A 3GFLA 1GLNA 4RS8A 2W57A 3SZPA 2CRGA 2RQPA 2QSFX 3LA2A 1ETXA 1Z05A 1IN7A 1B1BA 3HDDA 1LE8A 4XM3A 4ENMA 4UB8C 5BPIA 1MMSA 3CC2I 3KE2A 1R6RA 1U9OA 1U8RA 3CF2A 3NWSA 5JVGF 3Q3SA 2F4IA 2NRAC 1TTYA 1LDJA 2M8EA 3FBNB 3R61A 3ZP5A 2JA2A 2R7TA 1RC9A 3FK7A 3HYIA 3M1EA 4Y33A 1MKMA 1JI8A 2GOMA 1HQCA 1XPXA 4CDGA 4JYKA 2F5FA 3G2BA 5BQTA 1O7LA 2OA4A 2HQRA 3GCMA 3F23A 3S3OA 2ME6A 1XGNA 3PNTA 1POGA 3H0GJ 1XX5A 2VT3A 3CMAI 1TC3C 5FLXZ 4BDZA 2DYSH 1M1EB 1HC8A 2LTPA 4V2FA 2ESHA 1MBFA 5KVRA 4ENNA 2XSJC 2GXBA 1OCZH 1Y0NA 2BVLA 4I0BA 2BHYA 2O0YA 2L9NA 2A68F 1OCRH 2KLOA 1K4SA 4L18B 1YW8A 1MMDA 2P0WA 3KP5A 2K27A 2EBIA 2EA2A 3HOVJ 1ZELA 4E7LA 2WAFA 1XSDA 2O03A 2DT6A 3F21A 2M4KA 3ZMTA 3PIPF 2FUG2 1E3HA 1Z3YA 2WB1A 1T0FA 5FLVA 5H6QA 2M34A 2BY1A 3A0BC 2Z16A 4ENJA 3UKGA 1P7JA 1IUFA 4DZPA 3S2HJ 3HB9A 5L3EA 5CQGA 1XDUA 1R5HA 3VODA 4LIVA 3O6BB 3QOEA 3VYRB 4DBRA 4G7HF 3MZ8A 3CMEI 3LMMA 3OR2C 1VQMI 2E19A 4RLQA 2OQGA 3LQQA 1OQYA 2VBWA 2O5RA 1BIAA 1SD6A 4QIWN 1A04A 4IRIA 4B09A 1YIJI 4A3JJ 3K7AJ 2O8XA 4V19K 4ZYHA 2VKVA 1X2NA 4Y13A 3JRIA 1YRNA 1PYVA 2K9MA 2XC7A 3AG4H 1BBYA 2KISA 3HXLA 1ZQ3P 2EFWA 1ZTRA 2EFNA 3H3VK 1U2WA 3JAMK 1ZYRF 1RPWA 2ZMEC 2HR3A 2RAEA 3T5XA 5F0HA 1O3RA 2HNHA 1V5EA 2HXIA 3DPUA 3L7WA 4KN4X 4M71A 1ITYA 4AIKA 4MHGA 2EV0A 3SZGA 3K4KA 4BQQA 4BXXJ 2VJ5A 3GW2A 1G3SA 5DUKA 4F3QA 1LDDA 3I3LA 3FMSA 4BE1A 2LBFB 1QVTA 2ZJPF 4OIQF 4AIDA 3W6KB 3Q5FA 2VQLA 4TV7A 5LRRA 4UV8A 5M3FJ 2P6SA 3K70D 5K5QA 2LK2A 2LNBA 1MDMB 4MLOA 2CGPA 5AIPA 1J9IA 2HYGD 5JFRA 2MABA 3EYYA 2E2IJ 3OSFA 2YSRA 3CQZJ 4IPAA 2CW7A 3BTIA 2EFQA 2KZVA 3B6CA 1I50J 2IGOA 4NUBA 2STWA 3MKYB 4A3MJ 2OJED 2X6XA 4L0ZB 1QGPA 1T98A 1WPKA 3S17J 3G6EI 3CCYA 2HYJA 4HSTA 2Q0OA 4AVPA 4JX5A 4JBAA 1RR7A 2X9DA 1TQPA 3C7JA 4BL0B 3QYFA 2KQRA 3AG2H 4E7SA 4A3BJ 2VXZA 2Y9ZA 1YJ9I 1HSJA 3L9FA 4CXFA 2VOPA 2NNYA 2QSGX 2H8WA 3CJTB 4MEXF 2KKOA 3RYPA 3WHBA 1LB2A 2V9KA 5J47A 4A3CJ 4E7IA 3OSGA 1TW3A 3TEDA 2IA0A 2R7RA 2DTZA 3K70C 4EM0B 2Y0MA 2BXZA 1FBUA 4RGUA 1ZRFA 3E5QA 4F92B 2RC4A 2NOJB 2MSYA 3HOZJ 2R5YA 5E3NA 2ZMEB 3RQIA 2Y31A 3BJOA 2R4GA 2F5VA 3ULQB 1U0JA 4RAFA 3KP2A 2VPRA 3ZMDA 2Y9YA 2V9PA 3TP0A 3U2RA 3IL2A 1BA5A 3LAPA 1IZ1A 4JP0A 2C6YA 1SVLA 3AAFA 5E17F 2E5ZA 3K2ZA 4ZH4F 4PZJA 2DOEA 4IHSA 2VI6A 1TWFJ 4Y15A 2UUZA 4S04A 2XF7A 4L5IA 1YYVA 2A6EF 3OOPA 5L3DA 3TGNA 1ZLJA 3CZ6A 2HU9A 2L7FP 4D5FA 3G4SI 1NH3A 4A0ZA 1LVKA 2ZJ2A 1IN5A 1X1CA 2VKHA 2LBFA 4LG0B 3OYCA 3OIQA 2R93J 4PJJA 3JW4A 3WU1B 2JK3A 3S14J 3QAHA 5CQEA 2KRCA 5D4SA 1Q1VA 2XPVA 3DBHB 5E1XA 1IRZA 5D6EA 1U3EM 3DQVC 1Y39A 1TP4A 2ZXIA 1O57A 2B9SA 3L09A 1J0RA 3AFHA 4XKVA 2OCCH 1IUYA 1R22A 1WGXA 4LGWA 5LGUA 2Z9OA 4EVIA 2HS5A 2HDWA 2M5WA 5ILSA 4XLCA 3J80K 1L0OC 3QU6A 2BW3A 3BZKA 5E1WA 3I54A 5IPAA 2YU3A 3ZN0A 3O2PE 1RIOH 3QYBA 4XKBA 1FYMA 4MQ9F 4DNCA 4B4CA 2EK5A 3WTSC 2WWYA 5B1BH 1D0XA 4D0PA 1R4MB 4PSXA 1ODDA 4LB6B 4GCVA 3WTZA 3R4KA 3FF5A 4X0GA 1BI0A 2GA2A 4IJAA 3GX4X 1NG6A 2ELKA 1GVDA 1TT5B 1MZBA 2ZNYA 5HS7A 3CCJI 4JQFA 1SVMA 2MH9A 2HOAA 1DP3A 1B9NA 1W7PD 2O6GE 1RUNA 2UWMA 4GYIA 3SFZA 3NQOA 3TKYA 1GXQA 2XDVA 2XASA 2CQQA 5DS9A 1IN6A 1YI2I 3CO6C 2DA5A 3BG6A 1IJWC 3H92A 1KU3A 1Y6IA 4XSZF 1XDSA 3N05A 3Q0UA 3K4BA 2ZMEA 4O6JA 2CWEA 4EJTA 1R9TJ 5BOXA 4BNCA 3NEUA 2AXTC 4XLNF 3L2UA 1ERDA 4C30A 1TZLA 1FP1D 4WF2A 1A5JA 2CQNA 2WY8Q 1TNTA 2HDCA 3HSFA 4NC7A 3OR1C 3I4NJ 2VQCA 3BPXA 1MSFC 4I0AA 2ELJA 3DEUA 4BJ5C 1HKSA 3HRMA 4HNTA 1ETVA 4E6KG 1USSA 5CKTA 4RA2A 2EINH 4IOCF 2XB0X 2XVCA 2RGVA 3ZMVA 3DKXA 3GFJA 5GP9A 4MTDA 2NVQJ 3PNVA 3DTIA 3IC7A 2Y75A 1G3YA 1FTTA 3HPHA 3LL7A 5EG0B 3AKZA 3GZ6A 2R5ZA 5A2QK 1EF4A 2QZ8A 5DCFA 2WTEA 4BY7J 2YS9A 3IAS2 4ZC3A 1WFXA 4ZDLA 5EGOA 3I71A 1T38A 2IJLA 2N8GA 1QZEA 4BJ6C 5DCMA 1QZYA 5K5OA 2NXNB 3JRFA 2P5LC 1SD5A 3ASNH 3A01B 2CV1A 3N4MA 3R60A 3F0CA 1VI0A 2PI0A 1G6NA 2NS8A 3CP8A 3GF2A 4I09A 3ZPLA 4MTEA 2MA3A 2QBYA 2E1NA 2OBPA 3P9IA 1QZZA 1IN8A 4A3KJ 2H27A 2XSDC 1MMNA 1CF7A 3OWTA 2Z1DA 1X3ZB 3J7AY 2KMUA 2M1BA 3BP8A 4HSRA 3CCSI 1R4NB 4KNYA 2E2JJ 1WKMA 5M3MJ 2HQAA 4XLAA 5FLXK 3K4MA 3KEQA 3K6GA 1Z1DA 5EEHA 3VEPA 1G3WA 2EZHA 1EH6A 2A5YB 4ZJZA 4XK4A 3E6CC 1MBJA 2ZB9A 5M5XJ 2MC4A 4N9HA 2K5CA 2BVMA 3M07A 4UVAA 1AWCA 1E2XA 4NQWB 4AVZA 5GADJ 2DJIA 4GFBA 5HVQC 4RDUA 2R0QC 4BXFA 1Z0XA 1W1WE 2CMPA 2W25A 2HKOA 2COBA 3TBIA 2FMYA 5C3EJ 3CO7C 1FC3A 2X1DA 4FX4A 3WE3A 1AHDP 1SFXA 1KYWA 4DIQA 1B72A 1X1BA 2EZLA 4G9YA 2DK8A 4AM3A 4G6QA 1ONVA 4M3GA 2I5UA 3KYLA 3CDIA 1HXDA 2JJ7A 2GQQA 5E3MA 3CCRI 5DTDA 2K3PA 2DA4A 2KIQA 2PJRA 2V6EA 1IRFA 2VODA 2CH0A 2KZGA 1VQ5I 3PFIA 5D8LB 2R5YB 4D7NA 1R36A 3RQ4A 2VJIA 5CVUA 3QP6A 3IKTA 3ONQA 2DI3A 3A02A 1LDKB 1JTXA 5EGOB 1GUUA 1WJ5A 1CGPA 5ERIA 2M2EA 4ZYAA 1MNMC 2CS3A 4YRVA 3KCCA 3RYRA 5DCMB 2DMQA 4ESBA 4LD5A 3SXYA 4BQAA 1JUSA 3ZQHA 3JR9A 1SFUA 2CV0A 2UXNA 3OYAA 3G71I 2FBHA 2E71A 4KJZA 2XGEA 1S3JA 2DODA 5E79C 3HTSB 2L9SA 4X6AJ 2EQRA 2JMWA 1IN4A 4KIBA 3UNGC 4A3FJ 4A69C 3HJEA 1FOXA 1VQPI 2WAEA 4G7ZF 3F6OA 1HKTA 4ZZDA 1RZ4A 5ICFA 4OU0A 4O3MA 4KIGA 3CDLA 2EIJH 3IUOA 2OCEA 5CYVA 1A36A 3LWFA 1A35A 4Y4RA 3O8HA 1U78A 2IA2A 2X6WA 3GVAA 3BTLA 3S1NJ 3BCBA 4EV0A 2QGUA 2RNJA 2BY3A 4P5OA 4BYYA 5HNHA 2DA2A 1J7KA 4XKWA 2GBYA 1IXRC 3S1MJ 5EZHA 1K6OA 4NQWA 5H2FC 2CW0F 2W24A 2HYFA 3MN2A 2XF5A 1X4PA 2E1MB 2FEZA 3KZYA 4U0WA 5IT3A 4CO8A 3JRCA 2EIKH 2A69F 2RKHA 2QENA 4HF0A 4HQEA 1OMIA 1JJ6C 2F5EA 1YS6A 2YR2A 3G1OA 2IP2A 4M9ZA 5HNFA 3G73A 1E3PA 2DFIA 2LY9A 1XMAA 5ICEA 4BY1J 3JTGA 3OL3A 3HSEA 3K9TA 1IRXA 1ACIA 5EJCA 1QHGA 2KT0A 4U7DA 5FD6A 4CH7A 1U5TA 1P6RA 2CQKA 1HBXG 4A12A 3LSMA 3OYGA 2LG4A 3CTAA 2ZXJA 4KYWA 1V5FA 5K1YA 4HX7A 1BC8C 1SFEA 5BMZA 1BM9A 1I1SA 3GZNB 4II2A 2EA4A 4ASNA 2ZO4A 3FK6A 5E18F 1PUFB 3HKZN 1VTNC 4MO7A 2K9LA 2ECCA 4N4NB 2JRTA 4I02A 3GEZA 3H3UA 1ZREA 3WG9A 2KHMA 2AQFA 1J2XA 1MJBA 4LFUA 3BT9A 3S3MA 1O3TA 2EZKA 4N0BA 1W36C 3L2RA 2R7ZJ 3E6BA 3OYKA 4EM2A 3LSKA 3HTUA 1B8IB 3HOWJ 4XMYA 4FISA 4H0EA 1F4KA 1IF1A 3HG9A 2QVOA 2W84A 3V4GA 3HGGA 4H4KC 2LF8A 3GFIA 4Q5SF 5IT9Z 2HVQA 1HKQA 2XKPA 4G8XA 1ZRCA 2KP6A 3RCOA 1B9MA 3ZOBA 4PFOA 5DD4A 5EDNA 2HKXA 1ZARA 4HX4A 4XLFA 3OS0A 2L2OA 2X1EA 3WTVC 2R92J 2XB5A 4ZYGA 2LMDA 3FHNA 3FIWA 2BY2A 1XCVA 2OZUA 2DU9A 3TMOA 1U8BA 3V8LA 4A3LJ 2XAFA 4RAYA 4EQQA 2M3AA 4J01A 1B6AA 4CYDA 4F55A 2E1MC 1DGWY 4E7ZA 4M73A 2MFZA 4GDFA 2IGNA 4DYCA 4RB2C 3CC7I 5DDGA 2Y30A 3IH4A 3A01A 1G59A 3UR3C 2H6BA 1QU3A 3HHHA 2WB1N 1TWGJ 4PJ0C 3KP6A 5HDNA 2W82A 3JRBA 2HI3A 2XHKA 3VDXA 5FO5A 1B4AA 3LA7A 1R5GA 4HAMA 5H20A 1SC7A 1WI9A 3C1DA 1FYLA 2KRFA 3VYTB 5FRMA 4R8HA 5KAFC 1LFPA 4O5VA 2L5QA 2XIGA 2QQAA 2R7DA 4CZZA 3KP3A 4S0HB 3DEEA 4BHPA 4DJAA 1SVOA 3FXRA 3I59A 2G9WA 4M9XA 4NBQA 1XC5A 4HF1A 2VC0A 3DU5A 4ZDPA 3KZZA 1ZG3A 2BYVE 3VFZA 3W3CA 4ESFA 1N77A 4PUSA 3WGGA 4BKXA 4GYGA 4B8XA 1JKPC 4EJUA 4DBQA 3MVPA 1DPRA 3K1NA 4MQVA 2ZFUA 3BCAA 5KCMA 1WVRA 3ZMZA 2CQ7A 3DFGA 5DEQA 2OUMA 5E8GA 2GZWA 1OISA 4HV6A 1FJLA 3HOTA 5J3LA 3PSIA 2EV6A 2ZSHB 1QRYA 3L2WA 2DA6A 3HRTA 4RGSA 3CMMA 1MMGA 5D6FA 3CCEI 1NK2P 5K7FA 1P92A 3ZCOA 3SDBA 5ED4A 4Y3OA 5TISC 4A2UA 2R7XA 1AKHA 2FQ4A 2IGMA 1ZKGA 5E3OA 1FSHA 1MNEA 3TW7A 1WJEA 4ZZLA 3IRRA 1D1BA 3V8KA 4CICA 3L1PA 2JN6A 3RKYA 1Z3XA 3QRFF 1ETWA 1MBGA 2PJRB 2D5VA 2FU4A 1SANA 1VF9A 5LEKA 5IYCJ 2J5OA 1D5VA 3A1YA 4MGRA 2A05A 2CU7A 2KIUA 5IYDJ 2LH9A 2XUBA 4M3BA 3D5SC 3H9QA 4Q47A 2Z99A 3BDDA 3BROA 4M3FA 4C9YA 2X48A 2AS5F 3S2DJ 2XAJA 2JPCA 3V8JA 4XR6A 2OC6A 4M3EA 3W2AA 3K69A 1J09A 2P81A 2LSOA 1H0MA 4IHVA 1PP8F 3DXJF 1GT0C 3BOQA 1F5TA 4UUVA 2Z3YA 1YS7A 2WC2A 2ISYA 3PSFA 4L9VA 2DYRH 4L9JA 4HW0A 1HLVA 4IHWA 3WGIA 5HLGA 2K4JA 4NHJA 4RM3A 4AWXB 2HZDA 3P5JA 2YU9J 1W0TA 1VQKI 3CUQA 4HDUA 3GTQJ 2HDDA 4U0YA 3G3ZA 1X19A 2HGCA 3JSPA 5HODA 1K78A 1DU0A 2A61A 3K4CA 4XKCA 2OTLI 3IH3A 1W0UA 5ICCA 1QNTA 1VQ7I 2HEOA 2O8KA 3GTOJ 2CO5A 4D7MA 1FEXA 4UV9A 1T8IA 2HQ5A 4Q48A 1BOAA 1RESA 1WJFA 3CJRB 3KZIC 3DU6A 1OKRA 3MKLA 2H09A 4XRSA 1UELB 4UB6C 1A6IA 2QF7A 4ETSA 5F6FA 2PQ8A 2FNPA 4YG2F 4HDVA 2CUEA 1T6SA 2EH3A 2IW5A 5TJJA 1FT9A 3N97A 3PJRA 1LEBA 2PMZN 4JX6A 3F8MA 4C2UA 3IWZA 3DLLF 4WK8F 3I55I 1R58A 3MZYA 1WH7A 5F27A 3CP2A 3IHUA 3W6JB 2DA1A 2IT0A 1Z77A 2FF4A 2F5CA 2E2HJ 1TWHJ 3FXLA 3BZCA 4XICA 2M45A 2VLAA 1HSTA 4PJMA 1QHHD 2LFBA 1I3AA 2PEXA 4ZDOA 5FKOA 2Q2EA 2ECBA 2BBYA 2O7OA 2NS7A 5EEGA 1ZGWA 2MH2A 2HOEA 2RN7A 3ELKA 4C3IJ 1S6LA 3H9JA 3OYFA 1BC7C 4HRIA 2G7UA 4XSXF 1XN7A 2LDUA 1VNDA 4UVCA 4XL9A 1FBQA 4KICA 1PUFA 3FMRA 3S1QJ 2JT1A 3IAM2 2K9NA 3DCFA 3BR6A 2WA0A 2NS0A 1WQ2A 1F9NA 2JA7J 5GAEJ 3OYBA 1TLHB 2ZJRF 3F8NA 2VONA 4BS9A 3D5LA 3VPRA 1IC8A 2OPTA 3FISA 4LLNA 4ZYEA 4ZTFA 5JHUA 1GHCA 3RKWA 4WX9A 2KJBA 1JKRC 1Y0UA 4JX4A 3DF8A 5CPRB 2L7ZA 1WJAA 2ME0A 1YX5A 4OWRB 3S2WA 2DXIA 2V79A 2DJNA 2KPMA 4WXCA 2L02A 4PFPA 3E6MA 3EUKL 4M74A 3G1MA 1WWXA 2DDBA 4XNFA 5IP6A 5A2QZ 2VASA 1OYWA 4G6TB 3FXMA 4YEJA 1EH7A 4KIFA 3ZMSA 1HDDC 2TCTA 4W97A 2MGQA 3KEYA 1OJLA 2IA1A 1X1PA 2QLZA 2VT2A 4QSHA 4J19A 2DMUA 4XLHA 3V42A 3BY6A 5DM7F 2EILH 5KAIC 4IOAF 2V26A 2DFEA 2JZYA 1JT0A 3E7LA 3ZQFA 4OAZA 2A6HF 2Y0SA 2EFPA
chains in the Genus database with same CATH topology
3HGYA 2E2JJ 3HM5A 5M3MJ 4UUTA 2Y0SN 4Y52J 5J1YA 2EZHA 1QVUA 4UUSB 4XK4A 3ZQCA 1MBJA 2ZB9A 5M5XJ 4FE7A 3DEWA 4GFBA 4RDUA 2M0CA 1T33A 5IP9J 2R0QC 1HCRA 2K9SA 2B63J 1Z0XA 1HF0A 3JRAA 5EEAA 5F08A 3CMYA 4MFEA 2W48A 2COBA 3WHCA 3JREA 2CQXA 3G1LA 5C3EJ 4X1EA 1AHDP 5IOYA 1IGNA 1TWAJ 4AYBN 3RKQA 1B72A 2EZLA 3ZQGA 4C3HJ 4A3EJ 1U9NA 4M3GA 3PM1A 4B3AA 2JJ7A 4A3IJ 1AU7A 3C2BA 3OOUA 2IAIA 4C2MJ 2EZIA 1UG2A 5E3MA 5DTDA 4W1UA 1ZK8A 3JRDA 2FJ1A 2DA4A 1LFUP 4M3DA 2H1KA 1BW5A 2L7MP 2R5YB 4D7NA 5IP7J 5K7HA 5EF6A 3SJMA 9ANTA 1WCMJ 5E3LA 2DMNA 1H8AC 1AKHB 3A02A 2L0KA 1JTXA 5EGOB 1GUUA 2M2EA 1WI3A 1MNMC 5FKKA 4XRSG 1BJZA 2VUMJ 2DMQA 4G12A 1ETQA 4L5EA 2OF7A 2DA7A 1B8IA 1JUSA 3ZQHA 5GPCA 2CRGA 3JR9A 4C3JJ 1X2MA 2LLKA 1ETXA 1O4XA 2LR8A 3HDDA 1I3QJ 1LE8A 2XGEA 4X6AJ 2EQRA 2JMWA 4A3FJ 4A69C 1U9OA 3Q3SA 2M8GX 1ETKA 3FK7A 1JUPA 3CDLA 4JYKA 5FKLA 1K83J 1U78A 3O8HA 1H88C 3LSPA 2ME6A 3BTLA 3LSJA 3S1NJ 3BQYA 1POGA 3H0GJ 4I76A 2XGCA 5C44J 1QPIA 1CQTA 1TC3C 2DA2A 2CJJA 4RBOA 2GBYA 5EYRA 2LTPA 3S1MJ 5C4JJ 1T56A 4V2FA 5EZHA 4QTRA 1MBFA 4A93J 2L9RA 3MN2A 2NOGA 3JRCA 3K2AA 2K40A 1JJ6C 2O9LA 4NDLA 3G1OA 3IV5A 4BBRJ 1F36A 2EBIA 5J1RA 2LY9A 3HOVJ 4BY1J 4FE4A 4IHXA 2IBDA 1GDTA 2KT0A 5FLVA 2M34A 5F04A 3UKGA 1P7JA 1IUFA 4DZPA 3S2HJ 3HB9A 3GTPJ 1Y1WJ 3Q0VA 1IG7A 1P7IA 1DU6A 2LD5A 2E19A 5FJ8J 2HXOA 3FK6A 1PUFB 4MIMA 2XRLA 3HKZN 4QIWN 1MBEA 2YUSA 4MO7A 2ECCA 1ENHA 5EG0A 4A3JJ 3RZDJ 3K7AJ 2JA5J 5BNGA 3M3YJ 5J1UA 5FKNA 2VKVA 1X2NA 3BT9A 3JRIA 1YRNA 2EZKA 2ID6A 2R7ZJ 2JA6J 1I6HJ 1B8IB 3HOWJ 2GM4A 4FISA 1ZQ3P 4A3GJ 1ZTRA 4DZJA 4MFDA 1IV6A 3I4MJ 3HGGA 4FTHA 3H3VK 5F0HA 1RPWA 2RAEA 1BW6A 2AHQA 2TRTA 2HXIA 3SFIA 1ITYA 2R5ZB 3ZOBA 5EDNA 1JKOC 3B6AA 4BXXJ 2R92J 2XB5A 3HEFA 1E3OC 3FIWA 1RETA 2HOSA 1QVTA 1U8BA 4A3LJ 2NVXJ 3QPSA 3TW6A 3NARA 4I6ZA 4CYCA 5M3FJ 4DYCA 2KDZA 2WV1A 2DN0A 2Y30A 3IH4A 3A01A 5JLWA 2LK2A 4MLOA 1NK3P 2Y2ZA 3M4OJ 2E2IJ 2WB1N 1TWGJ 3OSFA 3CQZJ 3JRBA 2HI3A 3BTIA 3B6CA 1I50J 4UUSA 1WH5A 4A3MJ 5GPAA 1WPKA 4AC0A 3S17J 1G2HA 3CCYA 1UHSA 2HYJA 2NVTJ 2M9HA 3A03A 4JX5A 4S0HB 5F1JA 1RR7A 2X9DA 1APLC 1XS9A 5F0FA 1GV5A 5IYBJ 1XC5A 4A3BJ 1MH3A 2AO9A 2Y9ZA 3TP3A 3GTGJ 2CUFA 3Q0WA 4BKXA 1JKPC 2H8RA 3MVPA 2DA3A 3NAUA 3WHBA 1B72B 3JRGA 1JKQC 2MG4A 3IH2A 4A3CJ 3OSGA 3TEDA 3GTMJ 2DTZA 1HDPA 3LNQA 3GTLJ 1FJLA 1OCTC 5J3LA 5IOZA 4AUXA 1VFCA 1QRYA 2DA6A 2MSYA 3HOZJ 5M5WJ 5FLMJ 2R5YA 5E3NA 2HOTA 3RQIA 4BBSJ 2Y31A 2XPUA 1NK2P 1YRNB 2DMTA 5K7FA 1OFCX 2NVYJ 2VPRA 2Y9YA 3TP0A 1HOMA 1BA5A 1AKHA 2FQ4A 3HBLA 4M6VA 4JP0A 1ZKGA 5E3OA 3TW7A 1MSEC 3L1PA 2JN6A 1BL0A 2VI6A 1ETWA 1MBGA 1TWFJ 2WAQN 3LSRA 2D5VA 1JTYA 1SANA 1VF9A 2VKEA 5EZGA 1X58A 5IYCJ 3BG5A 4D5FA 2L7FP 4XRMA 2CU7A 5IYDJ 4M3BA 4EEFG 2E1OA 3PO2J 2ID3A 2XGDA 2X6OA 3BR3A 4M3FA 3HOYJ 4ABZA 2X48A 5JLXA 2R93J 3S2DJ 2JA8J 2K9QA 2JK3A 3D1NI 3S14J 4M3EA 2P81A 4IHVA 1Q1VA 1MBHA 1GT0C 2XPVA 1IRZA 1S7EA 3BR1A 1ORKA 1HLVA 4IHWA 3HOXJ 1WGXA 3PO3J 4LOCA 5IPAA 2YU9J 1W0TA 3SDGA 3GTQJ 3BQZA 2HDDA 1JGGA 1Y1VJ 5HODA 1DU0A 4B1RA 4B4CA 5M5YJ 3IH3A 1W0UA 3BTJA 3W6VA 2O8KA 3GTOJ 4D7MA 1FEXA 3BG9A 1TWCJ 5C4XJ 4IEJA 4FCYA 2ELKA 1H89C 2HQ5A 1GVDA 2LKXA 1RESA 4DYQA 1JJ8C 2HOAA 3JRHA 3MKLA 3ZQLA 4XRSA 1ETYA 1MBKA 1A6IA 2QF7A 3GTKJ 1ZR4A 1GV2A 5DS9A 2CQQA 3BG3A 3OIOA 2CUEA 4D5CA 2DMPA 4A3DJ 2DA5A 2EH3A 3S16J 1IJWC 2PMZN 4JX6A 3Q0UA 1MH4A 1FIPA 1R9TJ 1WH7A 5F27A 3S15J 2LP0A 2DA1A 1K61A 1Z77A 2E2HJ 2I10A 1IDZA 1A5JA 1TWHJ 3BR2A 3HOUJ 1JUMA 1JT6A 4XICA 3I4NJ 1MSFC 5K7ZA 3BR0A 2LFBA 2IEKA 1ETVA 1OCPA 5FKOA 2ECBA 4Y7NJ 2O7OA 3LOCA 2NS7A 1ZGWA 4C3IJ 4DYRA 2XB0X 2XPWA 5GP9A 2NVQJ 1NTCA 2FX0A 1VNDA 1FTZA 1PUFA 4HNVA 1FTTA 3S1QJ 1F43A 2K9NA 3DCFA 5EG0B 3BR6A 1LFBA 2R5ZA 1EF4A 3FKIJ 4V2GA 2JA7J 4BY7J 3RZOJ 1RKWA 2YS9A 1ZR2A 1FIAA 3VPRA 3GBGA 1IC8A 2OPTA 3FISA 5FKMA 5EGOA 2N8GA 1JKRC 3QQAA 2GLOA 2QCOA 4JX4A 4CYCB 3JRFA 2LVSA 2FD5A 3BTCA 2L7ZA 2ME0A 3LSGA 3A01B 1XG1A 2G0EA 2DJNA 3BR5A 1RKTA 3F0CA 3ZQIA 1ETOA 1VI0A 3G1MA 5IP6A 4XIDA 3S1RJ 2NS8A 1LE8B 1UMQA 1HDDC 2TCTA 4W97A 2MGQA 3QPLA 1OJLA 1D5YA 4J19A 4QSHA 4IHYA 1SFOJ 5F0CA 2DMUA 4A3KJ 2JWTA 2MW8A 2XSDC 1IDYA 3GTJJ 4DW6A 1JT0A 3E7LA 3O8GA 3ZQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGY A;  2E2J J;  3HM5 A;  5M3M J;  4UUT A;  2Y0S N;  4Y52 J;  5J1Y A;  2EZH A;  1QVU A;  4UUS B;  4XK4 A;  3ZQC A;  1MBJ A;  2ZB9 A;  5M5X J;  4FE7 A;  3DEW A;  4GFB A;  4RDU A;  2M0C A;  1T33 A;  5IP9 J;  2R0Q C;  1HCR A;  2K9S A;  2B63 J;  1Z0X A;  1HF0 A;  3JRA A;  5EEA A;  5F08 A;  3CMY A;  4MFE A;  2W48 A;  2COB A;  3WHC A;  3JRE A;  2CQX A;  3G1L A;  5C3E J;  4X1E A;  1AHD P;  5IOY A;  1IGN A;  1TWA J;  4AYB N;  3RKQ A;  1B72 A;  2EZL A;  3ZQG A;  4C3H J;  4A3E J;  1U9N A;  4M3G A;  3PM1 A;  4B3A A;  2JJ7 A;  4A3I J;  1AU7 A;  3C2B A;  3OOU A;  2IAI A;  4C2M J;  2EZI A;  1UG2 A;  5E3M A;  5DTD A;  4W1U A;  1ZK8 A;  3JRD A;  2FJ1 A;  2DA4 A;  1LFU P;  4M3D A;  2H1K A;  1BW5 A;  2L7M P;  2R5Y B;  4D7N A;  5IP7 J;  5K7H A;  5EF6 A;  3SJM A;  9ANT A;  1WCM J;  5E3L A;  2DMN A;  1H8A C;  1AKH B;  3A02 A;  2L0K A;  1JTX A;  5EGO B;  1GUU A;  2M2E A;  1WI3 A;  1MNM C;  5FKK A;  4XRS G;  1BJZ A;  2VUM J;  2DMQ A;  4G12 A;  1ETQ A;  4L5E A;  2OF7 A;  2DA7 A;  1B8I A;  1JUS A;  3ZQH A;  5GPC A;  2CRG A;  3JR9 A;  4C3J J;  1X2M A;  2LLK A;  1ETX A;  1O4X A;  2LR8 A;  3HDD A;  1I3Q J;  1LE8 A;  2XGE A;  4X6A J;  2EQR A;  2JMW A;  4A3F J;  4A69 C;  1U9O A;  3Q3S A;  2M8G X;  1ETK A;  3FK7 A;  1JUP A;  3CDL A;  4JYK A;  5FKL A;  1K83 J;  1U78 A;  3O8H A;  1H88 C;  3LSP A;  2ME6 A;  3BTL A;  3LSJ A;  3S1N J;  3BQY A;  1POG A;  3H0G J;  4I76 A;  2XGC A;  5C44 J;  1QPI A;  1CQT A;  1TC3 C;  2DA2 A;  2CJJ A;  4RBO A;  2GBY A;  5EYR A;  2LTP A;  3S1M J;  5C4J J;  1T56 A;  4V2F A;  5EZH A;  4QTR A;  1MBF A;  4A93 J;  2L9R A;  3MN2 A;  2NOG A;  3JRC A;  3K2A A;  2K40 A;  1JJ6 C;  2O9L A;  4NDL A;  3G1O A;  3IV5 A;  4BBR J;  1F36 A;  2EBI A;  5J1R A;  2LY9 A;  3HOV J;  4BY1 J;  4FE4 A;  4IHX A;  2IBD A;  1GDT A;  2KT0 A;  5FLV A;  2M34 A;  5F04 A;  3UKG A;  1P7J A;  1IUF A;  4DZP A;  3S2H J;  3HB9 A;  3GTP J;  1Y1W J;  3Q0V A;  1IG7 A;  1P7I A;  1DU6 A;  2LD5 A;  2E19 A;  5FJ8 J;  2HXO A;  3FK6 A;  1PUF B;  4MIM A;  2XRL A;  3HKZ N;  4QIW N;  1MBE A;  2YUS A;  4MO7 A;  2ECC A;  1ENH A;  5EG0 A;  4A3J J;  3RZD J;  3K7A J;  2JA5 J;  5BNG A;  3M3Y J;  5J1U A;  5FKN A;  2VKV A;  1X2N A;  3BT9 A;  3JRI A;  1YRN A;  2EZK A;  2ID6 A;  2R7Z J;  2JA6 J;  1I6H J;  1B8I B;  3HOW J;  2GM4 A;  4FIS A;  1ZQ3 P;  4A3G J;  1ZTR A;  4DZJ A;  4MFD A;  1IV6 A;  3I4M J;  3HGG A;  4FTH A;  3H3V K;  5F0H A;  1RPW A;  2RAE A;  1BW6 A;  2AHQ A;  2TRT A;  2HXI A;  3SFI A;  1ITY A;  2R5Z B;  3ZOB A;  5EDN A;  1JKO C;  3B6A A;  4BXX J;  2R92 J;  2XB5 A;  3HEF A;  1E3O C;  3FIW A;  1RET A;  2HOS A;  1QVT A;  1U8B A;  4A3L J;  2NVX J;  3QPS A;  3TW6 A;  3NAR A;  4I6Z A;  4CYC A;  5M3F J;  4DYC A;  2KDZ A;  2WV1 A;  2DN0 A;  2Y30 A;  3IH4 A;  3A01 A;  5JLW A;  2LK2 A;  4MLO A;  1NK3 P;  2Y2Z A;  3M4O J;  2E2I J;  2WB1 N;  1TWG J;  3OSF A;  3CQZ J;  3JRB A;  2HI3 A;  3BTI A;  3B6C A;  1I50 J;  4UUS A;  1WH5 A;  4A3M J;  5GPA A;  1WPK A;  4AC0 A;  3S17 J;  1G2H A;  3CCY A;  1UHS A;  2HYJ A;  2NVT J;  2M9H A;  3A03 A;  4JX5 A;  4S0H B;  5F1J A;  1RR7 A;  2X9D A;  1APL C;  1XS9 A;  5F0F A;  1GV5 A;  5IYB J;  1XC5 A;  4A3B J;  1MH3 A;  2AO9 A;  2Y9Z A;  3TP3 A;  3GTG J;  2CUF A;  3Q0W A;  4BKX A;  1JKP C;  2H8R A;  3MVP A;  2DA3 A;  3NAU A;  3WHB A;  1B72 B;  3JRG A;  1JKQ C;  2MG4 A;  3IH2 A;  4A3C J;  3OSG A;  3TED A;  3GTM J;  2DTZ A;  1HDP A;  3LNQ A;  3GTL J;  1FJL A;  1OCT C;  5J3L A;  5IOZ A;  4AUX A;  1VFC A;  1QRY A;  2DA6 A;  2MSY A;  3HOZ J;  5M5W J;  5FLM J;  2R5Y A;  5E3N A;  2HOT A;  3RQI A;  4BBS J;  2Y31 A;  2XPU A;  1NK2 P;  1YRN B;  2DMT A;  5K7F A;  1OFC X;  2NVY J;  2VPR A;  2Y9Y A;  3TP0 A;  1HOM A;  1BA5 A;  1AKH A;  2FQ4 A;  3HBL A;  4M6V A;  4JP0 A;  1ZKG A;  5E3O A;  3TW7 A;  1MSE C;  3L1P A;  2JN6 A;  1BL0 A;  2VI6 A;  1ETW A;  1MBG A;  1TWF J;  2WAQ N;  3LSR A;  2D5V A;  1JTY A;  1SAN A;  1VF9 A;  2VKE A;  5EZG A;  1X58 A;  5IYC J;  3BG5 A;  4D5F A;  2L7F P;  4XRM A;  2CU7 A;  5IYD J;  4M3B A;  4EEF G;  2E1O A;  3PO2 J;  2ID3 A;  2XGD A;  2X6O A;  3BR3 A;  4M3F A;  3HOY J;  4ABZ A;  2X48 A;  5JLX A;  2R93 J;  3S2D J;  2JA8 J;  2K9Q A;  2JK3 A;  3D1N I;  3S14 J;  4M3E A;  2P81 A;  4IHV A;  1Q1V A;  1MBH A;  1GT0 C;  2XPV A;  1IRZ A;  1S7E A;  3BR1 A;  1ORK A;  1HLV A;  4IHW A;  3HOX J;  1WGX A;  3PO3 J;  4LOC A;  5IPA A;  2YU9 J;  1W0T A;  3SDG A;  3GTQ J;  3BQZ A;  2HDD A;  1JGG A;  1Y1V J;  5HOD A;  1DU0 A;  4B1R A;  4B4C A;  5M5Y J;  3IH3 A;  1W0U A;  3BTJ A;  3W6V A;  2O8K A;  3GTO J;  4D7M A;  1FEX A;  3BG9 A;  1TWC J;  5C4X J;  4IEJ A;  4FCY A;  2ELK A;  1H89 C;  2HQ5 A;  1GVD A;  2LKX A;  1RES A;  4DYQ A;  1JJ8 C;  2HOA A;  3JRH A;  3MKL A;  3ZQL A;  4XRS A;  1ETY A;  1MBK A;  1A6I A;  2QF7 A;  3GTK J;  1ZR4 A;  1GV2 A;  5DS9 A;  2CQQ A;  3BG3 A;  3OIO A;  2CUE A;  4D5C A;  2DMP A;  4A3D J;  2DA5 A;  2EH3 A;  3S16 J;  1IJW C;  2PMZ N;  4JX6 A;  3Q0U A;  1MH4 A;  1FIP A;  1R9T J;  1WH7 A;  5F27 A;  3S15 J;  2LP0 A;  2DA1 A;  1K61 A;  1Z77 A;  2E2H J;  2I10 A;  1IDZ A;  1A5J A;  1TWH J;  3BR2 A;  3HOU J;  1JUM A;  1JT6 A;  4XIC A;  3I4N J;  1MSF C;  5K7Z A;  3BR0 A;  2LFB A;  2IEK A;  1ETV A;  1OCP A;  5FKO A;  2ECB A;  4Y7N J;  2O7O A;  3LOC A;  2NS7 A;  1ZGW A;  4C3I J;  4DYR A;  2XB0 X;  2XPW A;  5GP9 A;  2NVQ J;  1NTC A;  2FX0 A;  1VND A;  1FTZ A;  1PUF A;  4HNV A;  1FTT A;  3S1Q J;  1F43 A;  2K9N A;  3DCF A;  5EG0 B;  3BR6 A;  1LFB A;  2R5Z A;  1EF4 A;  3FKI J;  4V2G A;  2JA7 J;  4BY7 J;  3RZO J;  1RKW A;  2YS9 A;  1ZR2 A;  1FIA A;  3VPR A;  3GBG A;  1IC8 A;  2OPT A;  3FIS A;  5FKM A;  5EGO A;  2N8G A;  1JKR C;  3QQA A;  2GLO A;  2QCO A;  4JX4 A;  4CYC B;  3JRF A;  2LVS A;  2FD5 A;  3BTC A;  2L7Z A;  2ME0 A;  3LSG A;  3A01 B;  1XG1 A;  2G0E A;  2DJN A;  3BR5 A;  1RKT A;  3F0C A;  3ZQI A;  1ETO A;  1VI0 A;  3G1M A;  5IP6 A;  4XID A;  3S1R J;  2NS8 A;  1LE8 B;  1UMQ A;  1HDD C;  2TCT A;  4W97 A;  2MGQ A;  3QPL A;  1OJL A;  1D5Y A;  4J19 A;  4QSH A;  4IHY A;  1SFO J;  5F0C A;  2DMU A;  4A3K J;  2JWT A;  2MW8 A;  2XSD C;  1IDY A;  3GTJ J;  4DW6 A;  1JT0 A;  3E7L A;  3O8G A;  3ZQF A; 
#chains in the Genus database with same CATH topology
 3HGY A;  1V4R A;  3MKZ A;  3B73 A;  1TNS A;  3DKY A;  4UUT A;  2M4G A;  3ZGK A;  1IO2 A;  3Q9S A;  5J1Y A;  4MEY F;  2IS4 A;  4B43 A;  1DP7 P;  1WJB A;  1S7O A;  3DKW A;  1QVU A;  2VBZ A;  4UUS B;  3FXO A;  3LFU A;  3ZXS A;  2WY7 Q;  2GIV A;  2FOW A;  4HQM A;  2ACJ A;  4FE7 A;  3F8C A;  1BR2 A;  3R6S A;  3V7S A;  5IP9 J;  1HCR A;  3HPG A;  2FML A;  1BJA A;  2H6C A;  5EEA A;  3I59 B;  3CMY A;  4MFE A;  1VQL I;  5LHI A;  1OYI A;  3G1L A;  3KYC B;  1YOV B;  1DQU A;  2EPF A;  2QQ9 A;  4P9F A;  1VQ4 I;  1JXS A;  1TWA J;  2K85 A;  4AYB N;  5D5V B;  3KP7 A;  2K86 A;  4A3E J;  3GXO A;  3PM1 A;  1XGM A;  4DOZ A;  1BIB A;  1UJ8 A;  2JPB A;  5GAG J;  3L00 A;  3C2B A;  3V7R A;  3C3W A;  5FB2 A;  1AU7 A;  1VQO I;  1LNW A;  1W4M A;  4U88 A;  1ZK8 A;  5BS6 A;  2FJ1 A;  4IKF A;  4HA8 A;  3M7G A;  1I27 A;  2JVG A;  4ENK A;  1LFU P;  2L4M A;  1A31 A;  2DOA A;  2LF7 A;  5EF6 A;  4RB1 A;  4LB5 A;  2NNN A;  2MYS A;  2ZKZ A;  3GYH X;  1Z6T A;  1FOW A;  2OU2 A;  3P9K A;  1REP C;  2L0K A;  2KIM A;  3I4P A;  2MBF A;  1K79 A;  1D0Y A;  3HUG A;  2HWV A;  3X2Q H;  2OAZ A;  1YHQ I;  1RI7 A;  4XRF A;  1N25 A;  1QQI A;  3PNY A;  2MLG A;  3S8P A;  2HVR A;  3R0A A;  2R7F A;  2Q8K A;  1D1A A;  4PGH A;  5GPC A;  2QKL B;  1W7P B;  3OS1 A;  4NNJ A;  1Z67 A;  3KLO A;  1OR7 A;  2WAD A;  1I3Q J;  2FE3 A;  2GIZ A;  4NC8 A;  2XGX A;  1D1C A;  3F9K A;  1AOY A;  3GLL A;  3QPT A;  2M8G X;  3I0T A;  1FLI A;  4KFC A;  4BAC A;  1F1Z A;  4IQJ A;  2D2W A;  4BU2 A;  1ETK A;  1I1G A;  2B7E A;  1Z9C A;  2NVU B;  1Z6R A;  1ZGJ A;  2EWN A;  5HS8 A;  1S29 A;  3OS2 A;  5DD8 A;  1JUP A;  1WRJ A;  2RVC A;  3O3K A;  5FKL A;  2UZK A;  1K83 J;  1G4D A;  5DM6 F;  3LST A;  1MD0 A;  3OMY A;  5FRO A;  2BXY A;  3LSP A;  2IRF G;  2VOO A;  5FRN A;  4F93 B;  3CCV I;  2XGC A;  1S7A A;  2OTJ I;  3JTH A;  1W5T A;  1T95 A;  3ABU A;  1MDM A;  4YEL A;  3L2C A;  3J7Z I;  2CJJ A;  3CUQ B;  3I5U A;  1EH8 A;  2PX9 A;  4RBO A;  3K4J A;  5C4J J;  2PG4 A;  2BOL A;  2LYC A;  1X4O A;  2JSC A;  2L9R A;  3M1C A;  3SQN A;  1BN5 A;  3MKW B;  4BUP A;  1S72 I;  2O9L A;  1KGS A;  4NDL A;  2GAU A;  2M30 A;  3IV5 A;  3E97 A;  3ECH A;  3FKJ A;  4BDY A;  1F36 A;  3PUB A;  5JHF A;  3F8B A;  1TQI A;  4FE4 A;  3GUD A;  5HLH A;  2M7B A;  2PMZ A;  4IHX A;  1KA8 A;  4OIO F;  1ZG1 A;  1R1T A;  1ZN2 A;  2ELH A;  2VN2 A;  4L5J A;  5F04 A;  3LSI A;  2XAU A;  4ITV A;  5HS9 A;  2QKM B;  3EUA A;  3FM3 A;  3U1K A;  4OMY A;  2COM A;  3RPQ A;  3TQN A;  1UG0 A;  3OV8 A;  1G3T A;  2P4W A;  4R1H A;  2JTV A;  2DT5 A;  3CLO A;  1P7I A;  2D1H A;  1EJ9 A;  2LD5 A;  2ZFW A;  4XON A;  3HIF A;  2F4O B;  1FOY A;  5AON A;  5FJ8 J;  2R7V A;  2HXO A;  2XRL A;  4MIM A;  2QQB A;  2Z5U A;  1MBE A;  2YUS A;  3OYH A;  4Y17 A;  5EG0 A;  4IHT A;  3ESW B;  3RZD J;  3F22 A;  3M3Y J;  2ESN A;  2VBX A;  4UVB A;  3CC4 I;  3M9A A;  1YW7 A;  1Z91 A;  3ABM H;  5L3B A;  1P4X A;  1I6H J;  3SZT A;  3VSK A;  2ADU A;  4BQN A;  4YIF A;  2GM4 A;  5E8I A;  5H6R A;  4A3G J;  4UNO A;  4E70 A;  3U1D A;  4MFD A;  1W36 D;  2PMU A;  2HZT A;  1R23 A;  5LGN A;  5ILU A;  4KIS A;  1I39 A;  4UXN A;  4QPO A;  1BW6 A;  3KPH A;  4BJT A;  5JR3 A;  4J00 A;  4KMF A;  4PJN A;  5IY5 H;  4HYE A;  3RKX A;  2JUG A;  1MGT A;  1XD7 A;  2IPQ X;  2W7N A;  1KQ9 A;  2F6C A;  2QEX I;  3B6A A;  1DGR M;  1Y8R B;  4GRI A;  1I5Z A;  2RQQ A;  3HEF A;  1E3O C;  2CSO A;  5L3G A;  1RET A;  2HOS A;  4U7B A;  1YO5 C;  2YX4 A;  3CLQ A;  2EB7 A;  1ZRD A;  4QWQ A;  2DLL A;  4I6Z A;  2VE8 A;  2FBK A;  3F6V A;  2WV1 A;  2OV7 A;  5JLW A;  3KEO A;  2Y2Z A;  3RPU D;  3VYU B;  3SYT A;  3M4O J;  2YPR A;  1H9T A;  1R1U A;  3M8F A;  3BC8 A;  2LKP A;  3DBR B;  1DPU A;  2R7Q A;  3I64 A;  3E5X A;  4RM2 A;  2P5K A;  4NC6 A;  4P55 A;  4AC0 A;  2XAQ A;  1G2H A;  4U87 A;  2NVT J;  2Z33 A;  3ABT A;  3A03 A;  3RDI A;  3FXU A;  5F1J A;  4IL6 C;  1APL C;  1XS9 A;  5F0F A;  1GV5 A;  5IYB J;  4I2O A;  2M7A A;  1MH3 A;  2OD5 A;  4XOT A;  3E1S A;  2QYO A;  2VKD A;  2DO7 A;  1K4T A;  3Q0W A;  1SAX A;  1OCO H;  1OCC H;  3JCU C;  2DA3 A;  2FBI A;  1B72 B;  3JRG A;  1JKQ C;  3RPU A;  4FHT A;  3RSN A;  2R7S A;  1NG7 A;  3IH2 A;  4M6X A;  3QYE A;  1YTY A;  4ZTJ A;  4IRH A;  3FBI B;  2O61 A;  3I58 A;  1QA6 A;  3CD6 I;  5DYM A;  1XMX A;  2DBB A;  2GOX B;  1HDP A;  3LNQ A;  2IS2 A;  4A5N A;  2OQR A;  4GXO A;  1OCT C;  1SMY F;  1WHU A;  5IOZ A;  4AUX A;  1VFC A;  2BGC A;  1C0W A;  5M5W J;  3NWT A;  2HOT A;  5FFZ A;  1YRN B;  2DMT A;  2K7L A;  1SAU A;  1OFC X;  5DV5 A;  1UB9 A;  4LMY A;  2V6C A;  4CSW A;  1HOM A;  3CJN A;  3HBL A;  2E60 A;  2ISZ A;  3FWE A;  3KX2 A;  1KU7 A;  4XQF A;  2HPI A;  1RUO A;  2RV8 A;  3DTK A;  1H9G A;  2MLK A;  1BL0 A;  1P4A A;  2QA4 I;  3W2V A;  5ILV A;  1XGS A;  2WAQ N;  2W85 A;  1JTY A;  3K0L A;  2VKE A;  1ZLK A;  1X58 A;  3NRV A;  3BJ6 A;  3BG5 A;  1I6X A;  2HFH A;  4XRM A;  5LRS A;  2X4H A;  2QQ8 A;  3HSR A;  4EEF G;  4FQG A;  2E1O A;  5GTH C;  4XBF A;  2ID3 A;  1PP7 U;  2XGD A;  3E6D A;  3PO2 J;  3ABK H;  4BAY A;  3PIO F;  3DTE A;  4CCJ A;  1HW2 A;  4BH9 A;  2F5D A;  4RMN A;  4GGG A;  1XSV A;  4IVN A;  5JLX A;  4DGW B;  1W5C C;  4G94 A;  2ZCW A;  3D1N I;  1BR4 A;  2DOF A;  1YX3 A;  1IXS B;  3PFY A;  2LC2 A;  3MEX A;  2EIM H;  1J5Y A;  1MBH A;  1RNL A;  2ZBK A;  4HG2 A;  1S7E A;  2A3S A;  3BR1 A;  5CLS A;  1PJR A;  1ORK A;  3EDP A;  5LGT A;  3JAM Z;  1VZ0 A;  3ECO A;  4IO9 F;  2HTS A;  2WBM A;  5B66 C;  4MNU A;  3PO3 J;  4LOC A;  4OIN F;  1KU2 A;  2GA1 A;  1QBJ A;  2Y69 H;  4HEA 2;  5E20 A;  3TO9 A;  1JGG A;  5GAH J;  3M8J A;  2IXS A;  3K4N A;  5L3F A;  1Y1V J;  3ZQ7 A;  2F4M B;  2ZXW H;  1Z7U A;  4B1R A;  4E7K A;  3W2W A;  2QBY B;  3E5U A;  5M5Y J;  3ZRG A;  2WV0 A;  2NAZ A;  3BTJ A;  1LKX A;  2BY0 A;  2XAH A;  5C4X J;  4IEJ A;  2DDA A;  2LOO A;  4QPQ A;  1CF7 B;  4YIR X;  1HA8 A;  4B3X A;  4LLG F;  3PUF A;  2LKX A;  4DYQ A;  3WTX C;  1JJ8 C;  3D0S A;  3JRH A;  1ETY A;  3KET A;  3RI4 A;  1HW5 A;  3F3X A;  1MBK A;  3VOE A;  4OMZ A;  4XOP A;  3TDU C;  3GTK J;  4LK0 F;  4K2E A;  3U9G A;  1O3Q A;  3BG3 A;  4HLY A;  2DT7 B;  2DMP A;  1SEU A;  3S16 J;  4IX7 A;  2J5P A;  1J59 A;  2DQR A;  3U21 A;  1EV7 A;  2CV2 A;  1MH4 A;  2IVM A;  4CCL A;  3S15 J;  2LP0 A;  4AIH A;  4ON0 A;  2FA5 A;  2I10 A;  2OZ6 A;  2P7C B;  3BR2 A;  1T0F C;  1JUM A;  2XF6 A;  3HC7 A;  1IAW A;  3LA3 A;  2VE9 A;  1FPQ A;  3H9G A;  3LOC A;  3H5N A;  1YIO A;  5HDG A;  3MFK A;  4DYR A;  1ZHF A;  4I98 B;  5LEJ A;  1KON A;  1NTC A;  4Q4Z F;  2FX0 A;  4CUG A;  1ZGA A;  3VSL A;  4PCQ A;  1IV8 A;  2W1O A;  1YW9 A;  1E0E A;  1LFB A;  5FFX A;  1SMT A;  3FKI J;  2LY1 A;  4I7H A;  1LUJ B;  2Q1Z B;  1RKW A;  3H36 A;  4KT6 A;  4BQO A;  4BE0 A;  4YII A;  2L54 A;  3GBG A;  3AG1 H;  3L2Q A;  3GO5 A;  2GLO A;  4CYC B;  1X3W B;  2KL4 A;  2W4S A;  1KYZ A;  2BE5 F;  2CFO A;  3BTC A;  4P1W A;  1ZG5 A;  1YJW I;  2E34 A;  1XG1 A;  2HTJ A;  2G0E A;  3T0Y A;  3BR5 A;  1RKT A;  1FYK A;  1ETO A;  2W00 A;  3S1R J;  1P9Q C;  3FDY A;  1FMW A;  3SHF A;  3DLA A;  4FET A;  4D9J A;  1KU9 A;  3FXJ A;  5BPD A;  3WGH A;  3TOA A;  1AA7 A;  1OPC A;  5LLQ A;  4IHY A;  2R3S A;  5F0C A;  3HZJ A;  1IDY A;  2V4J C;  3HOS A;  4LJZ F;  3R0J A;  1YLF A;  5ICG A;  2V9V A;  4DW6 A;  3FMQ A;  4CZC A;  1T39 A;  2KFD A;  4EJW A;  3H5A A;  5CVJ A;  2L9V A;  2VQH A;  2Y0S N;  4A5M A;  2CUJ A;  4Y52 J;  1XCB A;  4AIJ A;  2VQG A;  1KQ8 A;  3L2V A;  3QWL A;  2DTR A;  2V7F A;  1LJ9 A;  1G8X A;  4II3 A;  3IP4 B;  1MJ9 A;  1JGS A;  2X85 A;  5J6X A;  5K5R A;  2VIX A;  3EYI A;  2A5W A;  2L3D A;  2O3F A;  2K9S A;  4M72 A;  3K4L A;  3TDZ C;  5TGT A;  3JRA A;  2W48 A;  1JHF A;  3WHC A;  2QUF A;  2JRM A;  2V1X A;  1LPQ A;  2CQX A;  3S93 A;  1D8K A;  2NYX A;  3FZV A;  4EMS A;  2FXA A;  1MJA A;  5IOY A;  1ULY A;  2I8D A;  1D0Z A;  5F64 A;  5JVT A;  4C3H J;  1U9N A;  3OYM A;  3P9C A;  4ANJ A;  3P7N A;  3LSH A;  3WG7 H;  4A3I J;  2X1C A;  2Y48 A;  2IAI A;  1SD7 A;  1UG2 A;  2L7K A;  4W1U A;  4XLE A;  3EQL F;  4BEH B;  3ZN1 A;  3COA C;  4M3D A;  2H1K A;  2A6T A;  2P8T A;  6PAX A;  1P4W A;  4IXA A;  5IP7 J;  3SJM A;  3V7C A;  9ANT A;  1WCM J;  4BE2 A;  4YFK F;  2V1D A;  2K02 A;  2XKO A;  1H8A C;  1XGO A;  3AG3 H;  1WI3 A;  4LIU A;  5FKK A;  4XRS G;  3IRQ A;  2VUM J;  2MD0 A;  2WAQ A;  4XLP F;  2YX7 A;  5J8F A;  1ETQ A;  3K1M A;  3QOP A;  3OL4 A;  1FP2 A;  1EA3 A;  3S3N A;  1B8I A;  3OYN A;  4C3J J;  1X2M A;  2LLK A;  4EJV A;  3KYD B;  3EUH A;  1O4X A;  2LR8 A;  3WTW C;  4OOI A;  1YIT I;  1O3S A;  5KK1 A;  1TT0 A;  5B3S H;  2EFO A;  2VJ4 A;  2F2E A;  4RAG A;  1TW2 A;  2AXL A;  4LG0 A;  3HRS A;  4P96 A;  4WXH A;  4YFX F;  3FM5 A;  2X6Y A;  2PN6 A;  4XN3 A;  1PDN C;  3GZ5 A;  1KQ0 A;  2CW8 A;  3ASO H;  5D5X B;  1L3L A;  3T1B A;  1BOB A;  1H88 C;  4A6D A;  1P2F A;  1Q1H A;  3LSJ A;  4F52 A;  3BQY A;  1A6Q A;  1IXC A;  2FOK A;  4I76 A;  1R7J A;  2DQL A;  5C44 J;  3REO A;  1QPI A;  2BW3 B;  1CQT A;  2PFB A;  2G7H A;  3HHG A;  5EYR A;  2VXD A;  1T56 A;  4QTR A;  4A93 J;  3MQ0 A;  3CCQ I;  4UY8 I;  2NOG A;  3K2A A;  2K40 A;  5LHH A;  3KP4 A;  2KJC A;  4RAZ A;  1UHW A;  3HRU A;  4BBR J;  1ON2 A;  1WZ2 A;  2ICW G;  1SD4 A;  2IGK A;  5FD5 A;  4DQ2 A;  1RRJ A;  1FWZ A;  5J1R A;  1EKE A;  2JSP A;  3RJP A;  2IBD A;  1VQ6 I;  1GDT A;  1UZC A;  3S32 A;  3OYD A;  1ZAO A;  1K7A A;  4HLX A;  5TRD A;  1YE9 A;  2V1N A;  3GTP J;  1YFH A;  3LQR A;  1Y1W J;  3TO7 A;  3I53 A;  3H35 A;  3OYL A;  3Q0V A;  1V55 H;  1IG7 A;  1BR1 A;  2CYY A;  4HPQ A;  4BXU A;  1DU6 A;  1XB4 A;  4F91 B;  2B0L A;  2IS6 A;  1T2K A;  1DDN A;  1XMK A;  3CCM I;  1W5S A;  3GME A;  1O7F A;  5HLI A;  3H0D A;  5J4V A;  2VB6 A;  1ENH A;  2STT A;  4HOB A;  1N78 A;  3I56 I;  1FMV A;  2H94 A;  2JA5 J;  5BNG A;  5J1U A;  1S5L C;  5FKN A;  4EJO A;  3E0J B;  3MWM A;  2ID6 A;  3VWB A;  3MCZ A;  4P9U A;  2JA6 J;  1BI3 A;  1JHH A;  2E35 A;  4DZJ A;  3BWG A;  1IV6 A;  4EGY A;  2E7W A;  1UCR A;  3DBL B;  1D8J A;  3A0H C;  5CJ9 A;  2XRN A;  3CCU I;  3I4M J;  4XOR A;  4FTH A;  2LRE A;  4F7Z A;  1UFM A;  2ZNZ A;  3CJQ B;  2AHQ A;  2TRT A;  3DPL C;  1D3Y A;  3SFI A;  4HX8 A;  2R5Z B;  2ZSI B;  5D8K B;  5D4R A;  1QO0 D;  1JKO C;  1IRG A;  4GO1 A;  3PL8 A;  4E7H A;  2VPL A;  1S8N A;  2M87 A;  4I99 C;  4LLL A;  2HVS A;  2NVX J;  3QPS A;  3Q9V A;  1T08 B;  3TW6 A;  3NAR A;  3WTU C;  4CYC A;  1MMA A;  2BZT A;  3SEQ A;  3TO6 A;  4B44 A;  2DFH A;  4PDK A;  2KDZ A;  2DN0 A;  2GXG A;  1NK3 P;  2UV1 A;  1FX7 A;  3WOD F;  1VQN I;  4HF2 A;  5HLT A;  3FX3 A;  3KFW X;  5CVV A;  2FNA A;  4UUS A;  2DPD A;  2DCE A;  1WH5 A;  4L9N A;  2PMH A;  1V54 H;  3K10 A;  4B47 A;  5GPA A;  4B48 A;  3GWZ A;  5LD2 C;  4AU7 A;  1UHS A;  2M9H A;  4IRG A;  1TQM A;  3ZMU A;  3DP7 A;  3QU3 A;  4WWC A;  1X1A A;  1U5T C;  3QPH A;  4L9T A;  4PK4 A;  2AO9 A;  2GWR A;  3TP3 A;  4AYB A;  3GTG J;  1GVJ A;  2CUF A;  4HNU A;  2R7O A;  3J7A O;  2E1C A;  2H8R A;  3M8E A;  3NAU A;  2JVH A;  3BG7 A;  2MG4 A;  1XTA A;  4M9S A;  3GTM J;  4M6Y A;  3CUQ C;  1OLT A;  4HV5 A;  4WXD A;  4BHB A;  3GTL J;  3RTR A;  4AD9 A;  2VC1 A;  1LQ1 A;  4L0Y B;  3DV8 A;  4CCM A;  1R71 A;  2H1L A;  4UHT A;  5FLM J;  1X1D A;  4QLC U;  1YG2 A;  4BBS J;  2EV5 A;  1PVE A;  2FQ3 A;  2XPU A;  3OYJ A;  3RIR A;  3LFK A;  4KUM A;  2NVY J;  5AIQ A;  1XSX A;  2E36 A;  3F72 A;  4M6V A;  4U0V A;  4KA4 A;  4FX0 A;  3HUG B;  2F48 A;  4KMU X;  1MSE C;  4IF4 A;  4RB0 A;  4BEH A;  1FY7 A;  3CCL I;  2CUZ A;  2Q2E B;  3LSR A;  4E7J A;  5EZG A;  1OR7 C;  2XAG A;  4IQ4 A;  4CGZ A;  4IZZ A;  3MAJ A;  2ZJQ F;  1ON1 A;  2CG4 A;  2VL8 A;  5GTI C;  2DAO A;  2FSW A;  3J80 Z;  4NB5 A;  2X6O A;  3ZQQ A;  4YFN F;  3AL0 B;  3BR3 A;  4EAT A;  3HOY J;  3WTY C;  4LK1 F;  4ABZ A;  2QWW A;  3EPZ A;  3EET A;  2JA8 J;  2K9Q A;  2D1V A;  3CDH A;  3ERE D;  1TL8 A;  1VQ8 I;  3GLX A;  3OYI A;  3ISP A;  2E5N A;  4A0Y A;  5LFA A;  1R5I D;  2ZXH A;  4BHC A;  5B5E C;  1UAA A;  2EJR A;  5IT9 K;  5FGM A;  3DWL E;  3HOX J;  3J7Y J;  3C18 A;  2BV6 A;  3SDG A;  5LHG A;  2GXA A;  3BQZ A;  4ZYD A;  3IKV A;  3ERM A;  2DPU A;  5D5W B;  1LVA A;  3CUO A;  1UST A;  2DK5 A;  2TDX A;  4RB3 C;  3W6V A;  1FSE A;  4RGX A;  3BJA A;  5D5U B;  3BG9 A;  1TWC J;  4CCN A;  1V5G A;  4FCY A;  1H89 C;  1Y56 A;  2KIF A;  1TBX A;  2JUC A;  3I9V 2;  2X51 A;  3ZQL A;  1V3F A;  3TOB A;  1J75 A;  5F1R A;  4HZF A;  1MND A;  1VQ9 I;  3KIO A;  1ZR4 A;  2BEO A;  4HBL A;  1K6Y A;  1GV2 A;  5CVR A;  4E4H A;  3CES A;  1YQA A;  3OIO A;  5E1Z B;  4D5C A;  2IS1 A;  4A3D J;  3WTT C;  2PLY A;  1WJD A;  2P5V A;  2QM3 A;  3E3V A;  4A0X A;  1JE8 A;  3H5R A;  2A07 F;  1IW7 F;  4CHU A;  1FIP A;  3BPV A;  1K61 A;  1IDZ A;  2K3F A;  2E7X A;  2VBY A;  1WSU A;  5DUI A;  3CF5 F;  3GFM A;  1U5T B;  3HOU J;  1JT6 A;  5K7Z A;  1BI2 A;  3BR0 A;  3IWF A;  2ETH A;  4I01 A;  2IEK A;  3AL0 C;  1OCP A;  4OIR F;  1Z21 A;  4Y7N J;  3OY9 A;  2P6T A;  3FXK A;  4CCK A;  3JSO A;  4RGR A;  3WU2 C;  3LAJ A;  4KDP A;  2XPW A;  4CA0 A;  1MIJ A;  2HQN A;  3QOD A;  4R79 A;  4S05 A;  1YJN I;  1FTZ A;  3T8R A;  3SEZ A;  3ROU A;  4HNV A;  2RRE A;  2DFF A;  3DPT A;  1F43 A;  2LRD A;  1UHM A;  5HOO A;  3B02 A;  5L3C A;  1NHA A;  2LY2 A;  4BGD A;  3EUH C;  4V2G A;  2D45 A;  2JQ7 A;  2BHZ A;  3OYE A;  3HKZ A;  3RZO J;  1ZR2 A;  2L4A A;  1FIA A;  3MD2 A;  3KLN A;  2K4B A;  1S9H A;  5FKM A;  2CFX A;  2MC3 A;  4EGZ A;  3WE2 A;  4PJL A;  3QQA A;  4OIP F;  2QCO A;  2R7W A;  4KIT B;  5J8C A;  2LVS A;  2FD5 A;  2DW4 A;  3H1C A;  4PGG A;  4WCG A;  3VB2 A;  1KZH A;  3LSG A;  2HPM A;  2R7U A;  4G6D A;  1B59 A;  3ZQI A;  4XID A;  3FXQ A;  1W7P A;  3MZH A;  2QSH X;  5JI6 A;  1K78 B;  1FNN A;  1LE8 B;  1GXP A;  1UMQ A;  1HW1 A;  4PSW A;  3WU0 A;  1MW7 A;  1E17 A;  4N9I A;  2PBI A;  3QPL A;  1D5Y A;  4ESJ A;  1SFO J;  3A2K A;  2JWT A;  2MW8 A;  3ML6 A;  1Z7L A;  3GTJ J;  5B1A H;  3O8G A;  3OIP A;  3ABL H;  2FRH A;  1FBS A;  3H3Z A;  3BZ6 A;  3HM5 A;  4Z2Y A;  2V1U A;  3D5R C;  5HDK A;  2UXX A;  1QPM A;  3QP5 A;  2RDP A;  2PJP A;  5J4Y A;  3ZQC A;  4FAS D;  1FOK A;  5CVI A;  1RR8 C;  4KN7 X;  3FHZ A;  3DEW A;  1OYY A;  4Z6Y A;  3VYS B;  2M0C A;  2ZC2 A;  4JK1 X;  1T33 A;  5J40 A;  2B63 J;  1WJC A;  2KDO A;  1N75 A;  4JOM A;  1HF0 A;  3PQJ A;  1U6G A;  5F08 A;  1BI1 A;  2RNG A;  3ZR8 X;  3JRE A;  2X0L A;  3A4C A;  2VJJ A;  4RLF A;  4A6E A;  4X1E A;  1FZP B;  1R49 A;  4LIT A;  1DUX C;  3T8T A;  1IGN A;  2MD5 A;  3RKQ A;  3TL4 X;  3ZQG A;  4G7O F;  1STZ A;  1X3U A;  3F8F A;  4B3A A;  1LEA A;  5LBQ A;  4D1Q A;  4LG3 A;  2M0M A;  3OOU A;  4C2M J;  2EZI A;  2P7V B;  3PQK A;  1ZH5 A;  3JRD A;  3MMY B;  2AQE A;  4FT8 A;  1PUE E;  4EM1 A;  4OAY A;  2LKS A;  3J81 K;  2Z2S B;  1R1V A;  1BW5 A;  2L7M P;  4XN0 A;  5K7H A;  5KHD A;  3HL2 A;  3BLY A;  2XV4 S;  1Y8Q B;  3C2G A;  5E3L A;  4C2T A;  2DMN A;  4N4O B;  4CCO A;  2XRO A;  1AKH B;  4KT5 C;  5KNL A;  1SFK A;  2KRH A;  2L01 A;  1BJZ A;  4G12 A;  3J81 Z;  4L5E A;  2OF7 A;  3C2H A;  3K1P A;  2DA7 A;  1R00 A;  3GFL A;  1GLN A;  4RS8 A;  2W57 A;  3SZP A;  2CRG A;  2RQP A;  2QSF X;  3LA2 A;  1ETX A;  1Z05 A;  1IN7 A;  1B1B A;  3HDD A;  1LE8 A;  4XM3 A;  4ENM A;  4UB8 C;  5BPI A;  1MMS A;  3CC2 I;  3KE2 A;  1R6R A;  1U9O A;  1U8R A;  3CF2 A;  3NWS A;  5JVG F;  3Q3S A;  2F4I A;  2NRA C;  1TTY A;  1LDJ A;  2M8E A;  3FBN B;  3R61 A;  3ZP5 A;  2JA2 A;  2R7T A;  1RC9 A;  3FK7 A;  3HYI A;  3M1E A;  4Y33 A;  1MKM A;  1JI8 A;  2GOM A;  1HQC A;  1XPX A;  4CDG A;  4JYK A;  2F5F A;  3G2B A;  5BQT A;  1O7L A;  2OA4 A;  2HQR A;  3GCM A;  3F23 A;  3S3O A;  2ME6 A;  1XGN A;  3PNT A;  1POG A;  3H0G J;  1XX5 A;  2VT3 A;  3CMA I;  1TC3 C;  5FLX Z;  4BDZ A;  2DYS H;  1M1E B;  1HC8 A;  2LTP A;  4V2F A;  2ESH A;  1MBF A;  5KVR A;  4ENN A;  2XSJ C;  2GXB A;  1OCZ H;  1Y0N A;  2BVL A;  4I0B A;  2BHY A;  2O0Y A;  2L9N A;  2A68 F;  1OCR H;  2KLO A;  1K4S A;  4L18 B;  1YW8 A;  1MMD A;  2P0W A;  3KP5 A;  2K27 A;  2EBI A;  2EA2 A;  3HOV J;  1ZEL A;  4E7L A;  2WAF A;  1XSD A;  2O03 A;  2DT6 A;  3F21 A;  2M4K A;  3ZMT A;  3PIP F;  2FUG 2;  1E3H A;  1Z3Y A;  2WB1 A;  1T0F A;  5FLV A;  5H6Q A;  2M34 A;  2BY1 A;  3A0B C;  2Z16 A;  4ENJ A;  3UKG A;  1P7J A;  1IUF A;  4DZP A;  3S2H J;  3HB9 A;  5L3E A;  5CQG A;  1XDU A;  1R5H A;  3VOD A;  4LIV A;  3O6B B;  3QOE A;  3VYR B;  4DBR A;  4G7H F;  3MZ8 A;  3CME I;  3LMM A;  3OR2 C;  1VQM I;  2E19 A;  4RLQ A;  2OQG A;  3LQQ A;  1OQY A;  2VBW A;  2O5R A;  1BIA A;  1SD6 A;  4QIW N;  1A04 A;  4IRI A;  4B09 A;  1YIJ I;  4A3J J;  3K7A J;  2O8X A;  4V19 K;  4ZYH A;  2VKV A;  1X2N A;  4Y13 A;  3JRI A;  1YRN A;  1PYV A;  2K9M A;  2XC7 A;  3AG4 H;  1BBY A;  2KIS A;  3HXL A;  1ZQ3 P;  2EFW A;  1ZTR A;  2EFN A;  3H3V K;  1U2W A;  3JAM K;  1ZYR F;  1RPW A;  2ZME C;  2HR3 A;  2RAE A;  3T5X A;  5F0H A;  1O3R A;  2HNH A;  1V5E A;  2HXI A;  3DPU A;  3L7W A;  4KN4 X;  4M71 A;  1ITY A;  4AIK A;  4MHG A;  2EV0 A;  3SZG A;  3K4K A;  4BQQ A;  4BXX J;  2VJ5 A;  3GW2 A;  1G3S A;  5DUK A;  4F3Q A;  1LDD A;  3I3L A;  3FMS A;  4BE1 A;  2LBF B;  1QVT A;  2ZJP F;  4OIQ F;  4AID A;  3W6K B;  3Q5F A;  2VQL A;  4TV7 A;  5LRR A;  4UV8 A;  5M3F J;  2P6S A;  3K70 D;  5K5Q A;  2LK2 A;  2LNB A;  1MDM B;  4MLO A;  2CGP A;  5AIP A;  1J9I A;  2HYG D;  5JFR A;  2MAB A;  3EYY A;  2E2I J;  3OSF A;  2YSR A;  3CQZ J;  4IPA A;  2CW7 A;  3BTI A;  2EFQ A;  2KZV A;  3B6C A;  1I50 J;  2IGO A;  4NUB A;  2STW A;  3MKY B;  4A3M J;  2OJE D;  2X6X A;  4L0Z B;  1QGP A;  1T98 A;  1WPK A;  3S17 J;  3G6E I;  3CCY A;  2HYJ A;  4HST A;  2Q0O A;  4AVP A;  4JX5 A;  4JBA A;  1RR7 A;  2X9D A;  1TQP A;  3C7J A;  4BL0 B;  3QYF A;  2KQR A;  3AG2 H;  4E7S A;  4A3B J;  2VXZ A;  2Y9Z A;  1YJ9 I;  1HSJ A;  3L9F A;  4CXF A;  2VOP A;  2NNY A;  2QSG X;  2H8W A;  3CJT B;  4MEX F;  2KKO A;  3RYP A;  3WHB A;  1LB2 A;  2V9K A;  5J47 A;  4A3C J;  4E7I A;  3OSG A;  1TW3 A;  3TED A;  2IA0 A;  2R7R A;  2DTZ A;  3K70 C;  4EM0 B;  2Y0M A;  2BXZ A;  1FBU A;  4RGU A;  1ZRF A;  3E5Q A;  4F92 B;  2RC4 A;  2NOJ B;  2MSY A;  3HOZ J;  2R5Y A;  5E3N A;  2ZME B;  3RQI A;  2Y31 A;  3BJO A;  2R4G A;  2F5V A;  3ULQ B;  1U0J A;  4RAF A;  3KP2 A;  2VPR A;  3ZMD A;  2Y9Y A;  2V9P A;  3TP0 A;  3U2R A;  3IL2 A;  1BA5 A;  3LAP A;  1IZ1 A;  4JP0 A;  2C6Y A;  1SVL A;  3AAF A;  5E17 F;  2E5Z A;  3K2Z A;  4ZH4 F;  4PZJ A;  2DOE A;  4IHS A;  2VI6 A;  1TWF J;  4Y15 A;  2UUZ A;  4S04 A;  2XF7 A;  4L5I A;  1YYV A;  2A6E F;  3OOP A;  5L3D A;  3TGN A;  1ZLJ A;  3CZ6 A;  2HU9 A;  2L7F P;  4D5F A;  3G4S I;  1NH3 A;  4A0Z A;  1LVK A;  2ZJ2 A;  1IN5 A;  1X1C A;  2VKH A;  2LBF A;  4LG0 B;  3OYC A;  3OIQ A;  2R93 J;  4PJJ A;  3JW4 A;  3WU1 B;  2JK3 A;  3S14 J;  3QAH A;  5CQE A;  2KRC A;  5D4S A;  1Q1V A;  2XPV A;  3DBH B;  5E1X A;  1IRZ A;  5D6E A;  1U3E M;  3DQV C;  1Y39 A;  1TP4 A;  2ZXI A;  1O57 A;  2B9S A;  3L09 A;  1J0R A;  3AFH A;  4XKV A;  2OCC H;  1IUY A;  1R22 A;  1WGX A;  4LGW A;  5LGU A;  2Z9O A;  4EVI A;  2HS5 A;  2HDW A;  2M5W A;  5ILS A;  4XLC A;  3J80 K;  1L0O C;  3QU6 A;  2BW3 A;  3BZK A;  5E1W A;  3I54 A;  5IPA A;  2YU3 A;  3ZN0 A;  3O2P E;  1RIO H;  3QYB A;  4XKB A;  1FYM A;  4MQ9 F;  4DNC A;  4B4C A;  2EK5 A;  3WTS C;  2WWY A;  5B1B H;  1D0X A;  4D0P A;  1R4M B;  4PSX A;  1ODD A;  4LB6 B;  4GCV A;  3WTZ A;  3R4K A;  3FF5 A;  4X0G A;  1BI0 A;  2GA2 A;  4IJA A;  3GX4 X;  1NG6 A;  2ELK A;  1GVD A;  1TT5 B;  1MZB A;  2ZNY A;  5HS7 A;  3CCJ I;  4JQF A;  1SVM A;  2MH9 A;  2HOA A;  1DP3 A;  1B9N A;  1W7P D;  2O6G E;  1RUN A;  2UWM A;  4GYI A;  3SFZ A;  3NQO A;  3TKY A;  1GXQ A;  2XDV A;  2XAS A;  2CQQ A;  5DS9 A;  1IN6 A;  1YI2 I;  3CO6 C;  2DA5 A;  3BG6 A;  1IJW C;  3H92 A;  1KU3 A;  1Y6I A;  4XSZ F;  1XDS A;  3N05 A;  3Q0U A;  3K4B A;  2ZME A;  4O6J A;  2CWE A;  4EJT A;  1R9T J;  5BOX A;  4BNC A;  3NEU A;  2AXT C;  4XLN F;  3L2U A;  1ERD A;  4C30 A;  1TZL A;  1FP1 D;  4WF2 A;  1A5J A;  2CQN A;  2WY8 Q;  1TNT A;  2HDC A;  3HSF A;  4NC7 A;  3OR1 C;  3I4N J;  2VQC A;  3BPX A;  1MSF C;  4I0A A;  2ELJ A;  3DEU A;  4BJ5 C;  1HKS A;  3HRM A;  4HNT A;  1ETV A;  4E6K G;  1USS A;  5CKT A;  4RA2 A;  2EIN H;  4IOC F;  2XB0 X;  2XVC A;  2RGV A;  3ZMV A;  3DKX A;  3GFJ A;  5GP9 A;  4MTD A;  2NVQ J;  3PNV A;  3DTI A;  3IC7 A;  2Y75 A;  1G3Y A;  1FTT A;  3HPH A;  3LL7 A;  5EG0 B;  3AKZ A;  3GZ6 A;  2R5Z A;  5A2Q K;  1EF4 A;  2QZ8 A;  5DCF A;  2WTE A;  4BY7 J;  2YS9 A;  3IAS 2;  4ZC3 A;  1WFX A;  4ZDL A;  5EGO A;  3I71 A;  1T38 A;  2IJL A;  2N8G A;  1QZE A;  4BJ6 C;  5DCM A;  1QZY A;  5K5O A;  2NXN B;  3JRF A;  2P5L C;  1SD5 A;  3ASN H;  3A01 B;  2CV1 A;  3N4M A;  3R60 A;  3F0C A;  1VI0 A;  2PI0 A;  1G6N A;  2NS8 A;  3CP8 A;  3GF2 A;  4I09 A;  3ZPL A;  4MTE A;  2MA3 A;  2QBY A;  2E1N A;  2OBP A;  3P9I A;  1QZZ A;  1IN8 A;  4A3K J;  2H27 A;  2XSD C;  1MMN A;  1CF7 A;  3OWT A;  2Z1D A;  1X3Z B;  3J7A Y;  2KMU A;  2M1B A;  3BP8 A;  4HSR A;  3CCS I;  1R4N B;  4KNY A;  2E2J J;  1WKM A;  5M3M J;  2HQA A;  4XLA A;  5FLX K;  3K4M A;  3KEQ A;  3K6G A;  1Z1D A;  5EEH A;  3VEP A;  1G3W A;  2EZH A;  1EH6 A;  2A5Y B;  4ZJZ A;  4XK4 A;  3E6C C;  1MBJ A;  2ZB9 A;  5M5X J;  2MC4 A;  4N9H A;  2K5C A;  2BVM A;  3M07 A;  4UVA A;  1AWC A;  1E2X A;  4NQW B;  4AVZ A;  5GAD J;  2DJI A;  4GFB A;  5HVQ C;  4RDU A;  2R0Q C;  4BXF A;  1Z0X A;  1W1W E;  2CMP A;  2W25 A;  2HKO A;  2COB A;  3TBI A;  2FMY A;  5C3E J;  3CO7 C;  1FC3 A;  2X1D A;  4FX4 A;  3WE3 A;  1AHD P;  1SFX A;  1KYW A;  4DIQ A;  1B72 A;  1X1B A;  2EZL A;  4G9Y A;  2DK8 A;  4AM3 A;  4G6Q A;  1ONV A;  4M3G A;  2I5U A;  3KYL A;  3CDI A;  1HXD A;  2JJ7 A;  2GQQ A;  5E3M A;  3CCR I;  5DTD A;  2K3P A;  2DA4 A;  2KIQ A;  2PJR A;  2V6E A;  1IRF A;  2VOD A;  2CH0 A;  2KZG A;  1VQ5 I;  3PFI A;  5D8L B;  2R5Y B;  4D7N A;  1R36 A;  3RQ4 A;  2VJI A;  5CVU A;  3QP6 A;  3IKT A;  3ONQ A;  2DI3 A;  3A02 A;  1LDK B;  1JTX A;  5EGO B;  1GUU A;  1WJ5 A;  1CGP A;  5ERI A;  2M2E A;  4ZYA A;  1MNM C;  2CS3 A;  4YRV A;  3KCC A;  3RYR A;  5DCM B;  2DMQ A;  4ESB A;  4LD5 A;  3SXY A;  4BQA A;  1JUS A;  3ZQH A;  3JR9 A;  1SFU A;  2CV0 A;  2UXN A;  3OYA A;  3G71 I;  2FBH A;  2E71 A;  4KJZ A;  2XGE A;  1S3J A;  2DOD A;  5E79 C;  3HTS B;  2L9S A;  4X6A J;  2EQR A;  2JMW A;  1IN4 A;  4KIB A;  3UNG C;  4A3F J;  4A69 C;  3HJE A;  1FOX A;  1VQP I;  2WAE A;  4G7Z F;  3F6O A;  1HKT A;  4ZZD A;  1RZ4 A;  5ICF A;  4OU0 A;  4O3M A;  4KIG A;  3CDL A;  2EIJ H;  3IUO A;  2OCE A;  5CYV A;  1A36 A;  3LWF A;  1A35 A;  4Y4R A;  3O8H A;  1U78 A;  2IA2 A;  2X6W A;  3GVA A;  3BTL A;  3S1N J;  3BCB A;  4EV0 A;  2QGU A;  2RNJ A;  2BY3 A;  4P5O A;  4BYY A;  5HNH A;  2DA2 A;  1J7K A;  4XKW A;  2GBY A;  1IXR C;  3S1M J;  5EZH A;  1K6O A;  4NQW A;  5H2F C;  2CW0 F;  2W24 A;  2HYF A;  3MN2 A;  2XF5 A;  1X4P A;  2E1M B;  2FEZ A;  3KZY A;  4U0W A;  5IT3 A;  4CO8 A;  3JRC A;  2EIK H;  2A69 F;  2RKH A;  2QEN A;  4HF0 A;  4HQE A;  1OMI A;  1JJ6 C;  2F5E A;  1YS6 A;  2YR2 A;  3G1O A;  2IP2 A;  4M9Z A;  5HNF A;  3G73 A;  1E3P A;  2DFI A;  2LY9 A;  1XMA A;  5ICE A;  4BY1 J;  3JTG A;  3OL3 A;  3HSE A;  3K9T A;  1IRX A;  1ACI A;  5EJC A;  1QHG A;  2KT0 A;  4U7D A;  5FD6 A;  4CH7 A;  1U5T A;  1P6R A;  2CQK A;  1HBX G;  4A12 A;  3LSM A;  3OYG A;  2LG4 A;  3CTA A;  2ZXJ A;  4KYW A;  1V5F A;  5K1Y A;  4HX7 A;  1BC8 C;  1SFE A;  5BMZ A;  1BM9 A;  1I1S A;  3GZN B;  4II2 A;  2EA4 A;  4ASN A;  2ZO4 A;  3FK6 A;  5E18 F;  1PUF B;  3HKZ N;  1VTN C;  4MO7 A;  2K9L A;  2ECC A;  4N4N B;  2JRT A;  4I02 A;  3GEZ A;  3H3U A;  1ZRE A;  3WG9 A;  2KHM A;  2AQF A;  1J2X A;  1MJB A;  4LFU A;  3BT9 A;  3S3M A;  1O3T A;  2EZK A;  4N0B A;  1W36 C;  3L2R A;  2R7Z J;  3E6B A;  3OYK A;  4EM2 A;  3LSK A;  3HTU A;  1B8I B;  3HOW J;  4XMY A;  4FIS A;  4H0E A;  1F4K A;  1IF1 A;  3HG9 A;  2QVO A;  2W84 A;  3V4G A;  3HGG A;  4H4K C;  2LF8 A;  3GFI A;  4Q5S F;  5IT9 Z;  2HVQ A;  1HKQ A;  2XKP A;  4G8X A;  1ZRC A;  2KP6 A;  3RCO A;  1B9M A;  3ZOB A;  4PFO A;  5DD4 A;  5EDN A;  2HKX A;  1ZAR A;  4HX4 A;  4XLF A;  3OS0 A;  2L2O A;  2X1E A;  3WTV C;  2R92 J;  2XB5 A;  4ZYG A;  2LMD A;  3FHN A;  3FIW A;  2BY2 A;  1XCV A;  2OZU A;  2DU9 A;  3TMO A;  1U8B A;  3V8L A;  4A3L J;  2XAF A;  4RAY A;  4EQQ A;  2M3A A;  4J01 A;  1B6A A;  4CYD A;  4F55 A;  2E1M C;  1DGW Y;  4E7Z A;  4M73 A;  2MFZ A;  4GDF A;  2IGN A;  4DYC A;  4RB2 C;  3CC7 I;  5DDG A;  2Y30 A;  3IH4 A;  3A01 A;  1G59 A;  3UR3 C;  2H6B A;  1QU3 A;  3HHH A;  2WB1 N;  1TWG J;  4PJ0 C;  3KP6 A;  5HDN A;  2W82 A;  3JRB A;  2HI3 A;  2XHK A;  3VDX A;  5FO5 A;  1B4A A;  3LA7 A;  1R5G A;  4HAM A;  5H20 A;  1SC7 A;  1WI9 A;  3C1D A;  1FYL A;  2KRF A;  3VYT B;  5FRM A;  4R8H A;  5KAF C;  1LFP A;  4O5V A;  2L5Q A;  2XIG A;  2QQA A;  2R7D A;  4CZZ A;  3KP3 A;  4S0H B;  3DEE A;  4BHP A;  4DJA A;  1SVO A;  3FXR A;  3I59 A;  2G9W A;  4M9X A;  4NBQ A;  1XC5 A;  4HF1 A;  2VC0 A;  3DU5 A;  4ZDP A;  3KZZ A;  1ZG3 A;  2BYV E;  3VFZ A;  3W3C A;  4ESF A;  1N77 A;  4PUS A;  3WGG A;  4BKX A;  4GYG A;  4B8X A;  1JKP C;  4EJU A;  4DBQ A;  3MVP A;  1DPR A;  3K1N A;  4MQV A;  2ZFU A;  3BCA A;  5KCM A;  1WVR A;  3ZMZ A;  2CQ7 A;  3DFG A;  5DEQ A;  2OUM A;  5E8G A;  2GZW A;  1OIS A;  4HV6 A;  1FJL A;  3HOT A;  5J3L A;  3PSI A;  2EV6 A;  2ZSH B;  1QRY A;  3L2W A;  2DA6 A;  3HRT A;  4RGS A;  3CMM A;  1MMG A;  5D6F A;  3CCE I;  1NK2 P;  5K7F A;  1P92 A;  3ZCO A;  3SDB A;  5ED4 A;  4Y3O A;  5TIS C;  4A2U A;  2R7X A;  1AKH A;  2FQ4 A;  2IGM A;  1ZKG A;  5E3O A;  1FSH A;  1MNE A;  3TW7 A;  1WJE A;  4ZZL A;  3IRR A;  1D1B A;  3V8K A;  4CIC A;  3L1P A;  2JN6 A;  3RKY A;  1Z3X A;  3QRF F;  1ETW A;  1MBG A;  2PJR B;  2D5V A;  2FU4 A;  1SAN A;  1VF9 A;  5LEK A;  5IYC J;  2J5O A;  1D5V A;  3A1Y A;  4MGR A;  2A05 A;  2CU7 A;  2KIU A;  5IYD J;  2LH9 A;  2XUB A;  4M3B A;  3D5S C;  3H9Q A;  4Q47 A;  2Z99 A;  3BDD A;  3BRO A;  4M3F A;  4C9Y A;  2X48 A;  2AS5 F;  3S2D J;  2XAJ A;  2JPC A;  3V8J A;  4XR6 A;  2OC6 A;  4M3E A;  3W2A A;  3K69 A;  1J09 A;  2P81 A;  2LSO A;  1H0M A;  4IHV A;  1PP8 F;  3DXJ F;  1GT0 C;  3BOQ A;  1F5T A;  4UUV A;  2Z3Y A;  1YS7 A;  2WC2 A;  2ISY A;  3PSF A;  4L9V A;  2DYR H;  4L9J A;  4HW0 A;  1HLV A;  4IHW A;  3WGI A;  5HLG A;  2K4J A;  4NHJ A;  4RM3 A;  4AWX B;  2HZD A;  3P5J A;  2YU9 J;  1W0T A;  1VQK I;  3CUQ A;  4HDU A;  3GTQ J;  2HDD A;  4U0Y A;  3G3Z A;  1X19 A;  2HGC A;  3JSP A;  5HOD A;  1K78 A;  1DU0 A;  2A61 A;  3K4C A;  4XKC A;  2OTL I;  3IH3 A;  1W0U A;  5ICC A;  1QNT A;  1VQ7 I;  2HEO A;  2O8K A;  3GTO J;  2CO5 A;  4D7M A;  1FEX A;  4UV9 A;  1T8I A;  2HQ5 A;  4Q48 A;  1BOA A;  1RES A;  1WJF A;  3CJR B;  3KZI C;  3DU6 A;  1OKR A;  3MKL A;  2H09 A;  4XRS A;  1UEL B;  4UB6 C;  1A6I A;  2QF7 A;  4ETS A;  5F6F A;  2PQ8 A;  2FNP A;  4YG2 F;  4HDV A;  2CUE A;  1T6S A;  2EH3 A;  2IW5 A;  5TJJ A;  1FT9 A;  3N97 A;  3PJR A;  1LEB A;  2PMZ N;  4JX6 A;  3F8M A;  4C2U A;  3IWZ A;  3DLL F;  4WK8 F;  3I55 I;  1R58 A;  3MZY A;  1WH7 A;  5F27 A;  3CP2 A;  3IHU A;  3W6J B;  2DA1 A;  2IT0 A;  1Z77 A;  2FF4 A;  2F5C A;  2E2H J;  1TWH J;  3FXL A;  3BZC A;  4XIC A;  2M45 A;  2VLA A;  1HST A;  4PJM A;  1QHH D;  2LFB A;  1I3A A;  2PEX A;  4ZDO A;  5FKO A;  2Q2E A;  2ECB A;  2BBY A;  2O7O A;  2NS7 A;  5EEG A;  1ZGW A;  2MH2 A;  2HOE A;  2RN7 A;  3ELK A;  4C3I J;  1S6L A;  3H9J A;  3OYF A;  1BC7 C;  4HRI A;  2G7U A;  4XSX F;  1XN7 A;  2LDU A;  1VND A;  4UVC A;  4XL9 A;  1FBQ A;  4KIC A;  1PUF A;  3FMR A;  3S1Q J;  2JT1 A;  3IAM 2;  2K9N A;  3DCF A;  3BR6 A;  2WA0 A;  2NS0 A;  1WQ2 A;  1F9N A;  2JA7 J;  5GAE J;  3OYB A;  1TLH B;  2ZJR F;  3F8N A;  2VON A;  4BS9 A;  3D5L A;  3VPR A;  1IC8 A;  2OPT A;  3FIS A;  4LLN A;  4ZYE A;  4ZTF A;  5JHU A;  1GHC A;  3RKW A;  4WX9 A;  2KJB A;  1JKR C;  1Y0U A;  4JX4 A;  3DF8 A;  5CPR B;  2L7Z A;  1WJA A;  2ME0 A;  1YX5 A;  4OWR B;  3S2W A;  2DXI A;  2V79 A;  2DJN A;  2KPM A;  4WXC A;  2L02 A;  4PFP A;  3E6M A;  3EUK L;  4M74 A;  3G1M A;  1WWX A;  2DDB A;  4XNF A;  5IP6 A;  5A2Q Z;  2VAS A;  1OYW A;  4G6T B;  3FXM A;  4YEJ A;  1EH7 A;  4KIF A;  3ZMS A;  1HDD C;  2TCT A;  4W97 A;  2MGQ A;  3KEY A;  1OJL A;  2IA1 A;  1X1P A;  2QLZ A;  2VT2 A;  4QSH A;  4J19 A;  2DMU A;  4XLH A;  3V42 A;  3BY6 A;  5DM7 F;  2EIL H;  5KAI C;  4IOA F;  2V26 A;  2DFE A;  2JZY A;  1JT0 A;  3E7L A;  3ZQF A;  4OAZ A;  2A6H F;  2Y0S A;  2EFP A; 
#chains in the Genus database with same CATH homology
 3HGY A;  2E2J J;  3HM5 A;  5M3M J;  4UUT A;  2Y0S N;  4Y52 J;  5J1Y A;  2EZH A;  1QVU A;  4UUS B;  4XK4 A;  3ZQC A;  1MBJ A;  2ZB9 A;  5M5X J;  4FE7 A;  3DEW A;  4GFB A;  4RDU A;  2M0C A;  1T33 A;  5IP9 J;  2R0Q C;  1HCR A;  2K9S A;  2B63 J;  1Z0X A;  1HF0 A;  3JRA A;  5EEA A;  5F08 A;  3CMY A;  4MFE A;  2W48 A;  2COB A;  3WHC A;  3JRE A;  2CQX A;  3G1L A;  5C3E J;  4X1E A;  1AHD P;  5IOY A;  1IGN A;  1TWA J;  4AYB N;  3RKQ A;  1B72 A;  2EZL A;  3ZQG A;  4C3H J;  4A3E J;  1U9N A;  4M3G A;  3PM1 A;  4B3A A;  2JJ7 A;  4A3I J;  1AU7 A;  3C2B A;  3OOU A;  2IAI A;  4C2M J;  2EZI A;  1UG2 A;  5E3M A;  5DTD A;  4W1U A;  1ZK8 A;  3JRD A;  2FJ1 A;  2DA4 A;  1LFU P;  4M3D A;  2H1K A;  1BW5 A;  2L7M P;  2R5Y B;  4D7N A;  5IP7 J;  5K7H A;  5EF6 A;  3SJM A;  9ANT A;  1WCM J;  5E3L A;  2DMN A;  1H8A C;  1AKH B;  3A02 A;  2L0K A;  1JTX A;  5EGO B;  1GUU A;  2M2E A;  1WI3 A;  1MNM C;  5FKK A;  4XRS G;  1BJZ A;  2VUM J;  2DMQ A;  4G12 A;  1ETQ A;  4L5E A;  2OF7 A;  2DA7 A;  1B8I A;  1JUS A;  3ZQH A;  5GPC A;  2CRG A;  3JR9 A;  4C3J J;  1X2M A;  2LLK A;  1ETX A;  1O4X A;  2LR8 A;  3HDD A;  1I3Q J;  1LE8 A;  2XGE A;  4X6A J;  2EQR A;  2JMW A;  4A3F J;  4A69 C;  1U9O A;  3Q3S A;  2M8G X;  1ETK A;  3FK7 A;  1JUP A;  3CDL A;  4JYK A;  5FKL A;  1K83 J;  1U78 A;  3O8H A;  1H88 C;  3LSP A;  2ME6 A;  3BTL A;  3LSJ A;  3S1N J;  3BQY A;  1POG A;  3H0G J;  4I76 A;  2XGC A;  5C44 J;  1QPI A;  1CQT A;  1TC3 C;  2DA2 A;  2CJJ A;  4RBO A;  2GBY A;  5EYR A;  2LTP A;  3S1M J;  5C4J J;  1T56 A;  4V2F A;  5EZH A;  4QTR A;  1MBF A;  4A93 J;  2L9R A;  3MN2 A;  2NOG A;  3JRC A;  3K2A A;  2K40 A;  1JJ6 C;  2O9L A;  4NDL A;  3G1O A;  3IV5 A;  4BBR J;  1F36 A;  2EBI A;  5J1R A;  2LY9 A;  3HOV J;  4BY1 J;  4FE4 A;  4IHX A;  2IBD A;  1GDT A;  2KT0 A;  5FLV A;  2M34 A;  5F04 A;  3UKG A;  1P7J A;  1IUF A;  4DZP A;  3S2H J;  3HB9 A;  3GTP J;  1Y1W J;  3Q0V A;  1IG7 A;  1P7I A;  1DU6 A;  2LD5 A;  2E19 A;  5FJ8 J;  2HXO A;  3FK6 A;  1PUF B;  4MIM A;  2XRL A;  3HKZ N;  4QIW N;  1MBE A;  2YUS A;  4MO7 A;  2ECC A;  1ENH A;  5EG0 A;  4A3J J;  3RZD J;  3K7A J;  2JA5 J;  5BNG A;  3M3Y J;  5J1U A;  5FKN A;  2VKV A;  1X2N A;  3BT9 A;  3JRI A;  1YRN A;  2EZK A;  2ID6 A;  2R7Z J;  2JA6 J;  1I6H J;  1B8I B;  3HOW J;  2GM4 A;  4FIS A;  1ZQ3 P;  4A3G J;  1ZTR A;  4DZJ A;  4MFD A;  1IV6 A;  3I4M J;  3HGG A;  4FTH A;  3H3V K;  5F0H A;  1RPW A;  2RAE A;  1BW6 A;  2AHQ A;  2TRT A;  2HXI A;  3SFI A;  1ITY A;  2R5Z B;  3ZOB A;  5EDN A;  1JKO C;  3B6A A;  4BXX J;  2R92 J;  2XB5 A;  3HEF A;  1E3O C;  3FIW A;  1RET A;  2HOS A;  1QVT A;  1U8B A;  4A3L J;  2NVX J;  3QPS A;  3TW6 A;  3NAR A;  4I6Z A;  4CYC A;  5M3F J;  4DYC A;  2KDZ A;  2WV1 A;  2DN0 A;  2Y30 A;  3IH4 A;  3A01 A;  5JLW A;  2LK2 A;  4MLO A;  1NK3 P;  2Y2Z A;  3M4O J;  2E2I J;  2WB1 N;  1TWG J;  3OSF A;  3CQZ J;  3JRB A;  2HI3 A;  3BTI A;  3B6C A;  1I50 J;  4UUS A;  1WH5 A;  4A3M J;  5GPA A;  1WPK A;  4AC0 A;  3S17 J;  1G2H A;  3CCY A;  1UHS A;  2HYJ A;  2NVT J;  2M9H A;  3A03 A;  4JX5 A;  4S0H B;  5F1J A;  1RR7 A;  2X9D A;  1APL C;  1XS9 A;  5F0F A;  1GV5 A;  5IYB J;  1XC5 A;  4A3B J;  1MH3 A;  2AO9 A;  2Y9Z A;  3TP3 A;  3GTG J;  2CUF A;  3Q0W A;  4BKX A;  1JKP C;  2H8R A;  3MVP A;  2DA3 A;  3NAU A;  3WHB A;  1B72 B;  3JRG A;  1JKQ C;  2MG4 A;  3IH2 A;  4A3C J;  3OSG A;  3TED A;  3GTM J;  2DTZ A;  1HDP A;  3LNQ A;  3GTL J;  1FJL A;  1OCT C;  5J3L A;  5IOZ A;  4AUX A;  1VFC A;  1QRY A;  2DA6 A;  2MSY A;  3HOZ J;  5M5W J;  5FLM J;  2R5Y A;  5E3N A;  2HOT A;  3RQI A;  4BBS J;  2Y31 A;  2XPU A;  1NK2 P;  1YRN B;  2DMT A;  5K7F A;  1OFC X;  2NVY J;  2VPR A;  2Y9Y A;  3TP0 A;  1HOM A;  1BA5 A;  1AKH A;  2FQ4 A;  3HBL A;  4M6V A;  4JP0 A;  1ZKG A;  5E3O A;  3TW7 A;  1MSE C;  3L1P A;  2JN6 A;  1BL0 A;  2VI6 A;  1ETW A;  1MBG A;  1TWF J;  2WAQ N;  3LSR A;  2D5V A;  1JTY A;  1SAN A;  1VF9 A;  2VKE A;  5EZG A;  1X58 A;  5IYC J;  3BG5 A;  4D5F A;  2L7F P;  4XRM A;  2CU7 A;  5IYD J;  4M3B A;  4EEF G;  2E1O A;  3PO2 J;  2ID3 A;  2XGD A;  2X6O A;  3BR3 A;  4M3F A;  3HOY J;  4ABZ A;  2X48 A;  5JLX A;  2R93 J;  3S2D J;  2JA8 J;  2K9Q A;  2JK3 A;  3D1N I;  3S14 J;  4M3E A;  2P81 A;  4IHV A;  1Q1V A;  1MBH A;  1GT0 C;  2XPV A;  1IRZ A;  1S7E A;  3BR1 A;  1ORK A;  1HLV A;  4IHW A;  3HOX J;  1WGX A;  3PO3 J;  4LOC A;  5IPA A;  2YU9 J;  1W0T A;  3SDG A;  3GTQ J;  3BQZ A;  2HDD A;  1JGG A;  1Y1V J;  5HOD A;  1DU0 A;  4B1R A;  4B4C A;  5M5Y J;  3IH3 A;  1W0U A;  3BTJ A;  3W6V A;  2O8K A;  3GTO J;  4D7M A;  1FEX A;  3BG9 A;  1TWC J;  5C4X J;  4IEJ A;  4FCY A;  2ELK A;  1H89 C;  2HQ5 A;  1GVD A;  2LKX A;  1RES A;  4DYQ A;  1JJ8 C;  2HOA A;  3JRH A;  3MKL A;  3ZQL A;  4XRS A;  1ETY A;  1MBK A;  1A6I A;  2QF7 A;  3GTK J;  1ZR4 A;  1GV2 A;  5DS9 A;  2CQQ A;  3BG3 A;  3OIO A;  2CUE A;  4D5C A;  2DMP A;  4A3D J;  2DA5 A;  2EH3 A;  3S16 J;  1IJW C;  2PMZ N;  4JX6 A;  3Q0U A;  1MH4 A;  1FIP A;  1R9T J;  1WH7 A;  5F27 A;  3S15 J;  2LP0 A;  2DA1 A;  1K61 A;  1Z77 A;  2E2H J;  2I10 A;  1IDZ A;  1A5J A;  1TWH J;  3BR2 A;  3HOU J;  1JUM A;  1JT6 A;  4XIC A;  3I4N J;  1MSF C;  5K7Z A;  3BR0 A;  2LFB A;  2IEK A;  1ETV A;  1OCP A;  5FKO A;  2ECB A;  4Y7N J;  2O7O A;  3LOC A;  2NS7 A;  1ZGW A;  4C3I J;  4DYR A;  2XB0 X;  2XPW A;  5GP9 A;  2NVQ J;  1NTC A;  2FX0 A;  1VND A;  1FTZ A;  1PUF A;  4HNV A;  1FTT A;  3S1Q J;  1F43 A;  2K9N A;  3DCF A;  5EG0 B;  3BR6 A;  1LFB A;  2R5Z A;  1EF4 A;  3FKI J;  4V2G A;  2JA7 J;  4BY7 J;  3RZO J;  1RKW A;  2YS9 A;  1ZR2 A;  1FIA A;  3VPR A;  3GBG A;  1IC8 A;  2OPT A;  3FIS A;  5FKM A;  5EGO A;  2N8G A;  1JKR C;  3QQA A;  2GLO A;  2QCO A;  4JX4 A;  4CYC B;  3JRF A;  2LVS A;  2FD5 A;  3BTC A;  2L7Z A;  2ME0 A;  3LSG A;  3A01 B;  1XG1 A;  2G0E A;  2DJN A;  3BR5 A;  1RKT A;  3F0C A;  3ZQI A;  1ETO A;  1VI0 A;  3G1M A;  5IP6 A;  4XID A;  3S1R J;  2NS8 A;  1LE8 B;  1UMQ A;  1HDD C;  2TCT A;  4W97 A;  2MGQ A;  3QPL A;  1OJL A;  1D5Y A;  4J19 A;  4QSH A;  4IHY A;  1SFO J;  5F0C A;  2DMU A;  4A3K J;  2JWT A;  2MW8 A;  2XSD C;  1IDY A;  3GTJ J;  4DW6 A;  1JT0 A;  3E7L A;  3O8G A;  3ZQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...