1GV5A

Crystal structure of c-myb r2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
b'LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
molecule tags Transcription
total genus 16
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv5A00
1X2MA 1OCTC 1B72B 3TP0A 1MBEA 3TP3A 4W1UA 1Y1WJ 4M3FA 5GPCA 4X1EA 2GLOA 5FKLA 1NTCA 4UUSA 2MSYA 1AU7A 1TWGJ 3LSPA 1U8BA 2XGEA 1B8IB 1IC8A 2D5VA 2XB0X 1DU6A 4BKXA 1QRYA 5F0CA 2E2IJ 2KDZA 1JUPA 4MFEA 5JLWA 1LE8B 1GT0C 3TW7A 4IHVA 1W0TA 1UG2A 3FIWA 2JK3A 3JRFA 3GTJJ 2DA2A 3Q0VA 1XG1A 5C44J 2X48A 2LVSA 3I4MJ 4MO7A 5FKOA 4BBRJ 2M8GX 5IYDJ 3HOXJ 4RBOA 3GTPJ 1RKWA 1FTZA 3CQZJ 2EQRA 3JRCA 2CQXA 2ME6A 1JKPC 3HOWJ 2QF7A 2Y9YA 2EH3A 3G1MA 2R5YB 2JA8J 2DMUA 1IDZA 2DA1A 4JX5A 4C3IJ 4M3GA 3GTOJ 4BXXJ 4G12A 2TCTA 2I10A 1ENHA 2COBA 4UUSB 1ZTRA 2DA3A 2NOGA 2XGCA 5IOYA 1FJLA 3ZQIA 3M3YJ 1ETWA 2WV1A 3ZOBA 4D7NA 4BBSJ 1OCPA 3HOUJ 4FISA 1E3OC 3K2AA 1HLVA 2LD5A 5FKKA 5EZGA 4IHWA 5FKNA 2HDDA 1JT6A 4XICA 1FEXA 2M2EA 4IHYA 2GBYA 3FISA 1JTXA 2IBDA 5E3OA 1IDYA 1IJWC 1U9NA 4B1RA 2P81A 4A3DJ 1MBGA 1WPKA 2CUEA 1TWFJ 4A3MJ 2RAEA 3MN2A 2DJNA 3DEWA 1RETA 2MW8A 1CQTA 1X2NA 3PM1A 2HOAA 2VPRA 3OOUA 4C3JJ 3BR3A 5F1JA 2AO9A 5M3FJ 2L7ZA 2LY9A 1BJZA 2H8RA 2YS9A 1QPIA 1G2HA 2ECBA 2WAQN 4RDUA 3RZDJ 1IV6A 1FIPA 1IGNA 5FLVA 2XPWA 1A5JA 3CDLA 2XSDC 2JMWA 2XPUA 4QSHA 3C2BA 3A01A 4Y52J 1VF9A 1W0UA 1NK2P 2HYJA 3BG9A 3H0GJ 2XPVA 1P7IA 4Y7NJ 1YRNA 4D7MA 3GTMJ 4I76A 3OSGA 1QVTA 1ORKA 1BL0A 3IH3A 4LOCA 1K61A 2XRLA 3GTQJ 3GTLJ 3JRDA 2EBIA 3RQIA 3RZOJ 3QQAA 5FJ8J 5BNGA 4A3EJ 4M6VA 1MNMC 4HNVA 1TWCJ 1ETOA 3BG3A 2E19A 2R5ZA 1BA5A 1MH4A 4D5CA 2G0EA 3IV5A 2R5YA 1H8AC 2JA5J 2R7ZJ 1ETKA 3ZQGA 3SJMA 5GPAA 4XRSG 3BR5A 3WHBA 1JKOC 1POGA 2NVQJ 1ETVA 2R93J 5F08A 2YU9J 3S2HJ 3A01B 1GDTA 3S16J 2O8KA 2K9SA 2M9HA 3HM5A 1OJLA 1MSEC 4AC0A 2VKVA 4L5EA 2CQQA 5F04A 2DMQA 5IP9J 3JRHA 2HOSA 2NVTJ 3S15J 1YRNB 3S1NJ 4A93J 3HOVJ 4V2GA 4DW6A 4QTRA 1Z77A 3M4OJ 4B4CA 3LSGA 3LSJA 2PMZN 4EEFG 2R0QC 5IP6A 3TEDA 4A3FJ 3W6VA 3TW6A 2O7OA 5JLXA 4BY7J 1TWAJ 2R5ZB 3HGYA 3BR1A 3BTLA 4A3CJ 4M3DA 3QPLA 9ANTA 2NS7A 2DA6A 5J3LA 1K83J 1ETXA 2CUFA 1H88C 3BG5A 2EZLA 5K7HA 3BT9A 1UMQA 2DN0A 4IHXA 1RKTA 4B3AA 1MBHA 3H3VK 2IAIA 1H89C 4XK4A 1Z0XA 3JRBA 3S17J 4IEJA 4XIDA 3DCFA 2M34A 3VPRA 3NARA 2EZKA 4DZJA 2NVXJ 1APLC 4XRSA 3FK7A 5F0FA 2N8GA 4W97A 2HXOA 2VI6A 2KT0A 1I50J 1JGGA 3LSRA 4J19A 4A3KJ 5EEAA 1T33A 5J1RA 2HOTA 3I4NJ 2Y30A 1MBFA 1JUMA 1QVUA 2LK2A 1P7JA 1AKHA 1IUFA 4BY1J 1IRZA 2WB1N 3IH4A 3BQZA 2DMTA 1U78A 1ZR4A 4A3GJ 2YUSA 2W48A 3K7AJ 5IYCJ 2DMPA 2HQ5A 5DTDA 2L7MP 1JUSA 1JJ6C 1Y1VJ 1T56A 2TRTA 4C3HJ 1HDPA 3O8GA 1ITYA 3JRGA 2LTPA 5EF6A 5J1UA 4AYBN 1GV5A 3IH2A 1GV2A 3BR2A 2O9LA 2NS8A 4FE4A 3BTCA 4DYQA 4FTHA 2FX0A 2MG4A 2OF7A 4C2MJ 3S1QJ 5IPAA 3GTGJ 3JREA 2EZHA 1SANA 2DA4A 2HXIA 2GM4A 2HI3A 4CYCA 3B6AA 3BR6A 2DA7A 4A3JJ 3PO2J 1TC3C 5E3NA 1AKHB 2L9RA 2ELKA 2ID6A 2E2HJ 2VKEA 4JX4A 2B63J 5EG0B 4JP0A 2MGQA 2ZB9A 4JX6A 1NK3P 1UHSA 1FTTA 3HOYJ 1PUFB 3MVPA 3S1RJ 3BR0A 1MBKA 2ECCA 4QIWN 3Q0UA 1TWHJ 1ZKGA 3D1NI 1ETYA 1R9TJ 1JJ8C 3ZQFA 1F36A 1VI0A 1LFUP 2XB5A 2NVYJ 5F27A 5E3LA 5M5YJ 1JKQC 5M5WJ 1RESA 4UUTA 4D5FA 1Q1VA 2JWTA 4XRMA 2EZIA 3GBGA 1S7EA 3HGGA 4CYCB 3B6CA 3Q0WA 4A3BJ 1EF4A 4A69C 3LNQA 1O4XA 1U9OA 2FJ1A 3A03A 4S0HB 2E1OA 1JKRC 1HF0A 2JJ7A 5K7ZA 2LP0A 3WHCA 1WGXA 2QCOA 2X6OA 3QPSA 5IP7J 4FCYA 3L1PA 1JT0A 1AHDP 3OIOA 1F43A 1D5YA 3HOZJ 5M5XJ 1WI3A 4FE7A 2R92J 1ZR2A 3JRIA 2ID3A 3UKGA 3FKIJ 2L7FP 2CJJA 5IOZA 5C4JJ 3MKLA 1XS9A 2LKXA 5IYBJ 5EZHA 2K9NA 3FK6A 2CRGA 3CMYA 3HB9A 5GP9A 2CU7A 2JA6J 1HDDC 1MBJA 3NAUA 5F0HA 2IEKA 4X6AJ 3BTIA 5HODA 1XC5A 4ABZA 1LFBA 4A3IJ 3HBLA 1JTYA 1GUUA 4M3EA 2K9QA 3LOCA 1FIAA 3PO3J 5EYRA 1OFCX 2E2JJ 2VUMJ 2XGDA 3ZQLA 3HDDA 1ZGWA 3O8HA 3ZQHA 1HCRA 2OPTA 1DU0A 1WH5A 4M3BA 1SFOJ 5EDNA 3BQYA 2LR8A 5K7FA 4DZPA 5EG0A 4GFBA 3E7LA 1BW6A 4DYRA 1HOMA 1IG7A 1PUFA 2Y9ZA 3HEFA 3BTJA 5EGOA 5FKMA 3GTKJ 5DS9A 4MLOA 2JN6A 3S14J 3ZQCA 1VFCA 1VNDA 2Y2ZA 5M3MJ 2Y0SN 2FQ4A 1BW5A 5C4XJ 3SFIA 1RPWA 4I6ZA 3OSFA 2K40A 3HKZN 2L0KA 3S1MJ 2AHQA 4DYCA 1B72A 5E3MA 3F0CA 2Y31A 2DTZA 5C3EJ 5J1YA 3SDGA 4A3LJ 3S2DJ 4NDLA 1X58A 2JA7J 1ZK8A 1I6HJ 4MFDA 3JR9A 1MSFC 1GVDA 1ETQA 1MH3A 3RKQA 1I3QJ 2M0CA 1ZQ3P 1WCMJ 1A6IA 4JYKA 2DMNA 2LLKA 3Q3SA 3A02A 1B8IA 3G1LA 2ME0A 5FLMJ 2FD5A 5EGOB 3G1OA 3CCYA 4AUXA 1LE8A 2H1KA 4MIMA 1RR7A 4V2FA 2LFBA 2DA5A 2X9DA 3JRAA 1WH7A
chains in the Genus database with same CATH superfamily
1SD7A 3T8TA 4EQQA 1OCTC 1B72B 1MBEA 3DKWA 3CJRB 4W1UA 1RUOA 1XB4A 2P8TA 3HC7A 4XKBA 2EIJH 2VJJA 4ETSA 4AVZA 1BBYA 1NTCA 2C6YA 1AU7A 1TWGJ 4LK1F 3LSPA 2LH9A 3WU2C 2QSGX 5TJJA 3OYNA 1B8IB 1T08B 3GVAA 1QRYA 2E2IJ 2KDZA 2BW3A 3SZPA 3IKTA 1LE8B 3PFIA 3FBIB 1BR4A 4BL0B 3JRFA 3FIWA 2HKXA 4K2EA 3C1DA 2BXZA 3ZR8X 2X48A 1LNWA 2EIMH 3R6SA 2QSFX 4MO7A 3CCSI 1Z67A 1XX5A 2V6EA 1F4KA 3HOXJ 4RBOA 3KX2A 3CO6C 2EQRA 4D1QA 2IT0A 3I64A 2CQXA 4OOIA 4IQ4A 4G94A 4IRHA 3V8LA 2KP6A 2QF7A 3ERMA 3J7ZI 1Z7LA 3G1MA 2JA8J 1ULYA 1IDZA 2A68F 4EV0A 4O6JA 3GTOJ 2QQ8A 5FROA 4G12A 3FDYA 3OS2A 2COBA 3VB2A 2V4JC 5KAFC 2KL4A 2DA3A 2ZSIB 2E7XA 3F8FA 4KFCA 3W2VA 4HQEA 2X1DA 3U1DA 4E70A 4BBSJ 1OCPA 1NHAA 4FISA 1D0XA 1GXQA 3HUGB 1E3OC 2GA2A 4E7SA 4ZC3A 3CJTB 5FKKA 4IHWA 5FKNA 4ZH4F 1EJ9A 1JT6A 3QRFF 2M2EA 4DOZA 5ICEA 2PBIA 4EJWA 2IBDA 1IDYA 1U9NA 1SVLA 4Y15A 2RQPA 1WPKA 4A3DJ 4UXNA 1RRJA 1TWFJ 4B47A 4A3MJ 1ZRCA 2OC6A 4PJ0C 4PSWA 2DJNA 1RETA 5CQEA 1KU2A 1D1BA 2VT2A 2KRFA 1X2NA 3PM1A 4C3JJ 4HG2A 3KLNA 3LSIA 2K3PA 2FE3A 3EUHC 3M07A 2AO9A 2XVCA 3VYSB 5M3FJ 1V3FA 1XMXA 2LY9A 2VXDA 5LFAA 1JI8A 1BJZA 1LEAA 3ML6A 3HTSB 2CH0A 2V79A 2CQNA 2FRHA 2VBZA 4LIUA 2VXZA 3RZDJ 2VBYA 4WWCA 1XSVA 2ZMEB 3BZKA 3CUQB 5D6EA 2IGKA 3KE2A 3FXLA 3JCUC 2W25A 3CP8A 1ZELA 3CDLA 2B9SA 1MMAA 3A01A 2IS1A 1Y0NA 2NVUB 2XV4S 4II2A 3I4PA 2HVSA 2XPVA 4Y7NJ 2DQLA 3WG9A 1YRNA 2P7CB 1D8KA 3VDXA 1QVTA 3J7YJ 1HW5A 2HTJA 3M9AA 3SYTA 2VE9A 4LOCA 2BY2A 2XRLA 2UZKA 2V1NA 2X6WA 1R49A 4CZZA 4ENJA 2GIVA 2PLYA 4WXHA 4A6DA 3PFYA 3QQAA 2LY2A 2FNAA 4HNVA 1J9IA 1DGWY 3BG3A 2FBHA 2QQAA 1BA5A 2ZJ2A 4D5CA 1E17A 2R7TA 5J40A 1ETKA 3ZQGA 4XRSG 3BWGA 3GZNB 2YPRA 2H09A 3GW2A 3I5UA 4XKVA 2NVQJ 5F08A 1YITI 2R7FA 2IA0A 1OPCA 4ANJA 3G71I 3G2BA 4UB6C 4RGUA 2DMQA 2NYXA 2CFXA 4P5OA 4PUSA 3EUKL 3G4SI 2DK8A 3HOVJ 1KYZA 3OYEA 5ICFA 3WTUC 2DXIA 1MGTA 4RAGA 1S3JA 1V54H 2GXAA 3LSGA 5BOXA 2R0QC 1G4DA 2EK5A 4A3FJ 5BPIA 2K4JA 3K4MA 2IRFG 3W6VA 1BI3A 1W7PA 2QENA 3GZ5A 3HPGA 1I5ZA 2O7OA 4NB5A 4ESFA 3L2VA 5BQTA 3HPHA 1OCOH 1WKMA 3BTLA 4HNTA 3QPLA 4RM2A 1M1EB 2KFDA 1LB2A 5HS8A 1X4OA 4CYDA 2NS7A 2FBIA 1E3HA 1ETXA 2CUFA 1H88C 2Y75A 1VQKI 3BG5A 1WJFA 4C30A 1K78B 1RKTA 2DPDA 5HVQC 1MBHA 4S05A 3CESA 1D5VA 2HFHA 4IXAA 2MD5A 5GAEJ 2F5VA 1YX3A 2ZNZA 3CZ6A 1H89C 2ZJRF 4I7HA 1J2XA 1HC8A 3JRBA 3GLXA 4IEJA 3F8MA 3DCFA 2ZFUA 5CVRA 3MAJA 2FF4A 3FMQA 3KFWX 3QYFA 2EZKA 3ESWB 3VPRA 4DZJA 2A3SA 4NC7A 1R1TA 5F0FA 2XF5A 3SQNA 5CVJA 4XLNF 4XRSA 1S9HA 5TRDA 4XLEA 4KDPA 1XGMA 3O6BB 3IAS2 4P96A 1JGGA 2XAGA 5HS7A 1OCCH 5H2FC 2HDWA 4BH9A 4A5NA 4KJZA 4BXUA 5J1RA 2IS6A 1QO0D 3I4NJ 1MBFA 3J81Z 4LJZF 4OIPF 1HKQA 3E5QA 1FBUA 2WY8Q 4HV5A 3H9GA 3IH4A 3OYHA 2JT1A 3J80K 5LRSA 4JQFA 1WZ2A 4ASNA 1JJ6C 3OYFA 2X1CA 3G6EI 4CZCA 1X1BA 2L5QA 5LHIA 1T56A 3AL0C 4IOAF 3O8GA 1ITYA 5IT3A 3BLYA 2IJLA 1XMAA 3HZJA 4KICA 1GV2A 5ILVA 2FX0A 2MG4A 2I5UA 5HNHA 1Z3XA 3Q5FA 1TW2A 2GM4A 1N77A 2BY3A 1FNNA 3S8PA 5HLTA 4FX4A 2L02A 4A3JJ 3LSKA 2ISYA 3PO2J 1YS7A 2CYYA 4KN7X 1G59A 2A61A 2ELKA 4Y17A 3CCLI 5GADJ 2B63J 2K85A 5EG0B 2DYRH 4DIQA 2ZB9A 4UVAA 4JX6A 1FTTA 4HSTA 4BAYA 4MQ9F 3I56I 2D2WA 4NUBA 5AIPA 3UNGC 3S1RJ 4XNFA 2GXGA 5L3CA 2V7FA 2E35A 3D1NI 3C7JA 2WB1A 4BXFA 1PYVA 5LEJA 3D5SC 1ERDA 1LFUP 3VYUB 2PX9A 4M72A 2J5OA 2ZMEC 3CUQC 2VBWA 4Q5SF 1SD5A 1JE8A 1MNDA 2JWTA 5FD5A 5CQGA 4MEYF 4Y13A 3GBGA 4CYCB 3B02A 3R60A 1Q1HA 5HLIA 2RKHA 3HSRA 3Q0WA 4A3BJ 4Y4RA 5E18F 4AYBA 1R7JA 1X1DA 1MJ9A 2E1MB 2FJ1A 1VQLI 3LA3A 2E1OA 2CW0F 2JJ7A 3BY6A 3I59B 2L7KA 1WGXA 3QOEA 3E3VA 2IA2A 3WHCA 5IP7J 4NQWB 1A36A 3OIPA 1AHDP 3OIOA 4R1HA 1F43A 4D0PA 2R7DA 2HOEA 2BXYA 4F55A 1HQCA 1R5HA 2D1HA 3JRIA 2ID3A 5ILSA 4B48A 3OYAA 1O3QA 2CJJA 2COMA 3QOPA 2LKXA 5LGTA 3OR1C 3GYHX 4L5IA 1S7OA 2K9NA 2VIXA 1YHQI 2P6SA 3LSMA 1UFMA 2F4IA 2BOLA 5HDGA 1HDDC 1MBJA 3GF2A 4XOPA 3PQJA 3BTIA 1K6YA 3K2ZA 5HODA 3ELKA 3OYLA 4A3IJ 5FRMA 4HRIA 1VQ5I 4IJAA 1G6NA 2CW7A 3LOCA 2FA5A 3PO3J 2HQRA 1MW7A 2ZKZA 2E2JJ 4HAMA 1ZGJA 2VUMJ 2VL8A 3ZQLA 3HDDA 5FO5A 2MD0A 3WTVC 4GXOA 2QM3A 2E7WA 2M4GA 1BM9A 3KCCA 2OPTA 1MMNA 1WH5A 2JA2A 2VASA 2R7QA 1SFOJ 2ZXWH 4PJJA 2LC2A 1U5TB 4BYYA 1VZ0A 2K9LA 2Z33A 2X6XA 3IWFA 3L2CA 2MLKA 1YIJI 1PUFA 4ENNA 1H0MA 3GTKJ 1MJAA 2AXLA 5H6QA 5DS9A 3DXJF 2JN6A 1FSEA 1IXCA 1ZLJA 5M3MJ 1BW5A 1XCVA 3SFIA 4BGDA 1USTA 1GXPA 1KYWA 2XF6A 3CMMA 1UCRA 1T39A 1DPUA 2K40A 5HDKA 2L0KA 3GFLA 5E79C 2R7VA 2AHQA 1B72A 2E5NA 2PMUA 2IS4A 4CDGA 2DTZA 4XMYA 5C3EJ 1P4AA 1O7LA 1XGSA 4KITB 4NDLA 4OMZA 5L3FA 3KP4A 3T0YA 3D5LA 1XCBA 1YLFA 4MNUA 2JA7J 2STWA 4AM3A 4MFDA 2VJ5A 5FB2A 1PVEA 1OCRH 2MBFA 1Z6RA 2DMNA 2UWMA 3CMEI 1KU7A 1B8IA 4HLXA 4NHJA 1GVJA 2ME0A 1D0YA 5DUIA 3I53A 3HYIA 5EGOB 5K5QA 4PJNA 1LE8A 1BOAA 3D0SA 4JK1X 4XLFA 1RR7A 4B43A 3K70C 1BI2A 1U2WA 1BR1A 3E5UA 1XPXA 1UZCA 2VB6A 3Q9VA 1FZPB 3WTSC 2ICWG 1IF1A 1SVOA 2P6TA 4U0WA 4ENKA 3L00A 1DGRM 4LLNA 5A2QK 1Y1WJ 4KUMA 1FBSA 4M3FA 4UVCA 2GOXB 1G3WA 2WA0A 3RIRA 4X1EA 4HZFA 2GLOA 2GZWA 3MKWB 1QBJA 5D5XB 3K9TA 1EV7A 4LK0F 1G8XA 3BJOA 3PL8A 3K70D 2Q1ZB 3IHUA 2D5VA 2XB0X 1S7AA 3HUGA 4BKXA 1HBXG 1T98A 1GT0C 3TW7A 1IN7A 2IPQX 3DWLE 4IHVA 1W0TA 4BJTA 1JHHA 3GTJJ 2DA2A 3Q0VA 5C44J 1V4RA 2EWNA 1J5YA 1BJAA 2DDAA 3H92A 2M8GX 3CDHA 4ZYEA 1V5EA 2CFOA 2IS2A 1YW8A 1CF7A 3CJQB 1FTZA 3HOWJ 2LF7A 2DMUA 4Q48A 1EH6A 1U8RA 2HPMA 4C3IJ 4FQGA 2R7RA 1TLHB 3RKWA 3RI4A 1ENHA 1E0EA 3W3CA 2NOGA 2PMHA 3ZQIA 3OOPA 3M3YJ 2WV1A 3ZOBA 4D7NA 2VQCA 2ZMEA 3CUQA 2RVCA 3WE3A 4AVPA 1HLVA 1K79A 2W84A 1IW7F 2HDDA 2CSOA 4XICA 4ZYDA 2R7WA 3EYYA 1WSUA 1YW9A 3DLLF 3FISA 2MH9A 2M3AA 2E5ZA 1ZREA 4AU7A 3IUOA 4B1RA 2P81A 3CTAA 4ESJA 1MBGA 1ZHFA 3E0JB 5L3DA 3TOBA 3LSTA 2L9NA 3KZYA 3VYRB 2WAEA 2KZGA 4YIRX 1X19A 2DCEA 2MW8A 3ABUA 1NG6A 2VPRA 2A5WA 2Z2SB 4AIDA 2XAFA 4XOTA 3CLOA 3ZMUA 2JRMA 2L7ZA 5KAIC 3KYDB 4OU0A 2Q2EB 2RV8A 3HRTA 3WTTC 2RQQA 5DD4A 4BQOA 4M6YA 3DTKA 3BCBA 4E7JA 1BC8C 2WY7Q 2YS9A 4B09A 1ACIA 2XAJA 2YU3A 4PFOA 4XRFA 4E7LA 2WAQN 2DT6A 1WVRA 2V1XA 4C2UA 1FIPA 3H35A 3DEUA 2KRCA 1A5JA 2DOEA 1S8NA 2JMWA 4QSHA 3T1BA 4Y52J 2JPCA 1VF9A 5GTIC 1NK2P 2X85A 4C9YA 3BG9A 5J6XA 3GXOA 3C18A 2DK5A 1P7IA 3ASNH 2K3FA 3ZMDA 4D7MA 4E6KG 3A4CA 4I76A 3GTMJ 4L0YB 1T0FA 3TO9A 1Z3YA 3IH3A 1KONA 2X51A 1K61A 4WXCA 2CGPA 1U5TC 3RZOJ 1A31A 3U1KA 5JHUA 5JHFA 3OYBA 3KLOA 1TWCJ 4IRGA 1U0JA 3N97A 4DBRA 2JTVA 2EPFA 1D8JA 3HIFA 3QU3A 2ELHA 4Y3OA 2WBMA 4BUPA 2HPIA 2R5YA 1H8AC 1O3SA 2CUJA 3PSFA 1WQ2A 3WHBA 2IVMA 4U7BA 3MZ8A 1POGA 3WODF 5B5EC 3NWSA 2GXBA 2R93J 2EFQA 2DFEA 2E34A 1TW3A 2M45A 1K78A 2FU4A 2W24A 4KIGA 1GDTA 4LLLA 3S16J 2O8KA 4GGGA 1OJLA 2HNHA 4UHTA 3WGHA 5F04A 4AC0A 5IP9J 2HOSA 4UB8C 5CKTA 3RYPA 3H5AA 4A93J 1R36A 4FASD 3EYIA 3JTHA 3KPHA 3M4OJ 1HSJA 3LSJA 2PMZN 3TEDA 4HF1A 4M9SA 5IP6A 4BNCA 2VC1A 3OYMA 2LDUA 2M7AA 2D1VA 2HZDA 2WC2A 4EM2A 3TW6A 1UELB 3OS0A 4PCQA 1MDMB 2O6GE 2M8EA 4I01A 2R5ZB 2LY1A 3E6DA 3BR1A 1K4SA 3K0LA 1O3TA 1MKMA 4L5JA 1VQNI 1TZLA 1X3ZB 3CCVI 2VQHA 2DA6A 5J3LA 1K83J 4CCNA 3OYCA 1FC3A 4HYEA 2EZLA 1ZN2A 4M6XA 5K7HA 3S3OA 1UMQA 1UB9A 3TOAA 4B3AA 1SAXA 3AL0B 2R7XA 1QU3A 1S5LC 1DP7P 2EILH 4X0GA 2CUZA 4NC8A 1U3EM 4CCKA 1ZG5A 2IAIA 1WFXA 2L54A 1Z0XA 2PN6A 5ED4A 4UV9A 2XAUA 3KP6A 3IRQA 3S17J 3K6GA 1XN7A 4ITVA 4BE0A 2QGUA 4RGXA 1APLC 1FBQA 2Z5UA 3FK7A 4CCLA 1D1CA 2VI6A 3FWEA 1I50J 3RCOA 4J19A 4HOBA 1RC9A 4DBQA 5LLQA 4U87A 2HOTA 3FKJA 3DEEA 1KQ8A 1OYYA 2DYSH 1JUMA 1QVUA 1IUFA 2EV5A 1SMTA 1BI1A 3OR2C 3WTXC 2QA4I 1U78A 3JAMK 1PP8F 4A3GJ 2YUSA 3K7AJ 5IYCJ 4AWXB 4HDVA 1HXDA 2OCCH 4I02A 3KETA 1B59A 4U0VA 3VWBA 4XLPF 4EGYA 1YG2A 2LKPA 2QKLB 2BEOA 2X1EA 4C3HJ 1HDPA 2XASA 4JOMA 3W6KB 3ECHA 2LTPA 3FXRA 1GV5A 5FRNA 4ESBA 2W4SA 3WTZA 2FMYA 4G8XA 1K7AA 1LDDA 4DYQA 2HU9A 4C2MJ 3SZTA 2WWYA 2GWRA 2HYGD 4XORA 3GTGJ 3WTWC 1V5GA 1FLIA 2HXIA 4CYCA 3FXOA 1Y6IA 2EV0A 1UHMA 2H6BA 3L09A 3J7AO 3C2HA 1YJWI 4F92B 1S29A 1XGNA 5LGNA 2XHKA 4MEXF 3I59A 2ID6A 2PQ8A 2E2HJ 2DQRA 4R79A 1YJNI 1I1GA 4BDZA 2NXNB 2DFFA 1UHSA 1X1CA 2ZJQF 4KN4X 5LEKA 5AONA 2ECCA 1R1UA 2KJCA 4QIWN 1TWHJ 1ZKGA 3LFKA 1W5SA 4IZZA 3W2WA 2XKPA 4UY8I 1DP3A 1P92A 3E6MA 5E3LA 4HBLA 3EPZA 1JKQC 1X3UA 4H0EA 2P5LC 1RESA 3IC7A 4UUTA 2L9SA 1E3PA 1XD7A 1ZRFA 1FOYA 4I98B 2P0WA 4XRMA 4LMYA 3KEYA 1IXRC 4CICA 1EF4A 1Z91A 2OV7A 1WJAA 4HQMA 3P7NA 1UAAA 3RQ4A 2HZTA 5HDNA 3A03A 3K1PA 4LD5A 3A1YA 2KHMA 3DPUA 3FM5A 5E8GA 2L9VA 1JKRC 3R4KA 3DBRB 4XSZF 5GAHJ 1MMSA 2DT7B 3I3LA 1SMYF 3DF8A 3L2UA 3HRUA 5H6RA 1JT0A 4YIFA 3KP2A 2EA2A 1D5YA 1JGSA 1PUEE 3IL2A 1KQ9A 3T5XA 1WI3A 4FE7A 2R92J 5CVUA 2VPLA 2ZBKA 2XUBA 3UKGA 2OQRA 3FKIJ 5IOZA 3EDPA 2A05A 1XS9A 2OJED 2H8WA 2A69F 5IYBJ 2Z16A 2H27A 4ZTFA 3BJ6A 1V5FA 2CRGA 5HLHA 3CMYA 1J09A 4YG2F 2CMPA 3NRVA 2MC3A 4G6DA 4LB6B 3GEZA 4XLAA 4XL9A 2IEKA 3V8KA 4P55A 5B66C 3J80Z 2MFZA 2O3FA 4ABZA 4YRVA 3HBLA 2L2OA 2OQGA 4M3EA 1FIAA 1MJBA 5EYRA 3OY9A 4IRIA 1VQ9I 3KP3A 3GMEA 1QPMA 3RKYA 2IGMA 3O8HA 4ZZLA 3LAPA 4F7ZA 3M1EA 3GCMA 2HGCA 5HNFA 4M3BA 3WTYC 4C2TA 4WF2A 3BQYA 3SEZA 3L2QA 3SEQA 3F8CA 1XTAA 4GFBA 5AIQA 3L9FA 1BW6A 4DYRA 4AIKA 2UV1A 1IG7A 1N75A 2PG4A 2R4GA 2Y9ZA 3HEFA 1SC7A 5EGOA 4L9VA 2JRTA 1WJCA 5BMZA 3ZQQA 3MKZA 2FQ4A 2WAFA 1G3SA 2HDCA 5C4XJ 4I09A 2MABA 4KNYA 3AG1H 3OSFA 3N05A 1UHWA 1X3WB 5E3MA 4EM0B 3F0CA 2Y31A 4RGRA 1IXSB 3ROUA 4A2UA 4EJVA 1RNLA 3SDGA 3KP7A 4QPQA 4BE2A 5LHHA 3AKZA 3FMSA 2E1NA 2F48A 3QWLA 4KMUX 4CO8A 2DOFA 1ETQA 1GVDA 2KPMA 3DKYA 3RKQA 1MSFC 2VOOA 1I3QJ 2LNBA 2M0CA 2NRAC 3R0AA 4JYKA 4NBQA 4RLFA 2LLKA 3A02A 4IPAA 2OA4A 2IP2A 3U9GA 3J81K 5CYVA 2VT3A 3DBHB 4KMFA 4AUXA 4XLCA 3QP5A 3CD6I 3VSLA 3RJPA 5HLGA 2CQKA 3MFKA 2M7BA 6PAXA 1FSHA 3EUHA 3OYIA 1OYIA 2DA5A 5KCMA 2CV0A 1FEXA 4IO9F 2ZFWA 5FGMA 3COAC 2E60A 3TP3A 3JW4A 4BDYA 2B7EA 5J8FA 4HLYA 5J47A 5LBQA 5GPCA 1VQ6I 1QZZA 3RTRA 2G7UA 2ZXIA 2XKOA 3GFJA 1XDSA 3CCQI 3L7WA 3NWTA 2MSYA 2NS0A 3HRSA 3I55I 1U8BA 2H6CA 3F8NA 3GZ6A 2RDPA 3FF5A 4YELA 1T6SA 1IC8A 4FETA 2W57A 1SAUA 1Z7UA 2Z1DA 2BE5F 4CXFA 4MFEA 5JLWA 4RAZA 2E71A 1UG2A 3M8JA 4NNJA 2MH2A 3CCMI 3CO7C 1XG1A 3FMRA 2LVSA 3I4MJ 2AQFA 3LFUA 5FKOA 3CP2A 4BBRJ 5IYDJ 3GTPJ 1RKWA 3CQZJ 1W4MA 3JRCA 3FHNA 3PUFA 3HG9A 2ME6A 3KZZA 2EH3A 5TISC 1J75A 1BOBA 3ASOH 3KEQA 3L2WA 4JX5A 5K1YA 3OYJA 3TQNA 4BXXJ 1RR8C 2Q2EA 2TCTA 4UUSB 1FYMA 1ZTRA 2HTSA 4L9JA 1FJLA 1N25A 2KRHA 1ETWA 3C3WA 2Z9OA 3KZIC 2ZXHA 2K27A 3HOUJ 4F52A 2LRDA 4RMNA 3K2AA 3H1CA 3CMAI 4F93B 1V55H 2M4KA 1H9GA 2K9MA 4IHYA 1IRFA 2GBYA 3KYCB 1JTXA 3M8EA 1IJWC 3AG2H 3V7RA 3OYKA 1HSTA 2CUEA 3FXQA 1SFUA 5DM7F 3DTEA 1W7PB 3MN2A 2DI3A 2BY0A 1L3LA 1WRJA 3V8JA 4E7KA 1CQTA 3A2KA 2V1DA 2HOAA 3BR3A 2VOPA 2R3SA 3DBLB 2LYCA 1YI2I 2IW5A 5LD2C 3K4CA 4GYIA 2H8RA 4IOCF 1LQ1A 2W00A 1FY7A 1G2HA 2ECBA 3MWMA 4PJMA 4DNCA 2STTA 2BGCA 2W85A 4XLHA 4UNOA 2QQBA 2PI0A 1R4NB 1Z05A 1YJ9I 4IKFA 2L4AA 1Y56A 1ZAOA 2DPUA 3WE2A 2XSDC 3C2BA 4E4HA 1W0UA 4EJUA 5A2QZ 5KHDA 1Y8QB 4B44A 2ZO4A 3H9QA 2NNYA 3M1CA 4NC6A 3H0GJ 1WI9A 1R00A 2R7SA 3PNVA 3DTIA 4IHTA 3K1MA 3LAJA 4KT6A 2QBYB 5L3EA 4HF2A 2A07F 3GTQJ 3GTLJ 2FBKA 2VKHA 4XM3A 3RQIA 4B8XA 3BG7A 3LWFA 1HW1A 2BY1A 3H3UA 2Y0MA 1EH7A 2J5PA 3H9JA 1P2FA 2MLGA 3QYEA 5DUKA 5BNGA 4OINF 4GRIA 4BEHB 4DJAA 3JTGA 2K02A 3W2AA 4EJTA 1QA6A 1ETOA 2LMDA 4E7ZA 2YX7A 4YIIA 1MDMA 3K69A 4EM1A 1MIJA 4RAYA 3F22A 2R5ZA 1ZG3A 3GWZA 2G0EA 3MCZA 3IV5A 2Y0SA 4WX9A 4E7IA 2JA5J 2R7ZJ 2X0LA 4PZJA 1FOWA 3SJMA 2WTEA 5BS6A 1T38A 4RA2A 5D5VB 1TL8A 4F3QA 1JKOC 3HKZA 5FLXK 2V9PA 1ETVA 2YU9J 5IT9K 2P5KA 4HX4A 1ZLKA 3M7GA 3K1NA 2K9SA 3HM5A 1ON1A 3HRMA 1TT5B 1MSEC 2GIZA 3JRHA 2CQQA 2NVTJ 2OBPA 3WG7H 3S1NJ 4RM3A 5E8IA 2BVMA 5J4VA 2CO5A 3BJAA 4Z2YA 3IAM2 5JR3A 4V2GA 4DW6A 3H5NA 5E20A 4QTRA 3E6BA 4B4CA 1YFHA 3DP7A 2RNJA 3BDDA 4EEFG 3TO7A 2YX4A 4PSXA 5DCMB 3TKYA 1Z6TA 3TDUC 1S72I 3R0JA 3TBIA 5JLXA 2HKOA 2V9VA 3E97A 1QQIA 3O2PE 1TWAJ 3PNYA 1OYWA 4BY7J 2HVRA 3F72A 1KU9A 3F21A 3HSEA 4M3DA 4J01A 4A3CJ 3C2GA 3LSHA 2VBXA 5FFZA 1R6RA 3CC4I 4M73A 3OV8A 2X6YA 3S93A 1W1WE 1WWXA 3ECOA 3KEOA 4LG3A 4A0XA 3BT9A 1ODDA 4XSXF 4MHGA 3S3NA 2VKDA 3H3VK 5DDGA 3QPHA 4IHSA 3CCRI 3WU1B 2FMLA 4G6TB 3BP8A 1XGOA 4XIDA 2JSCA 4UV8A 2ISZA 4L9NA 3NEUA 5DEQA 4CCMA 2VONA 3LQRA 2N8GA 2V1UA 3KIOA 3DU6A 4W97A 4G7HF 1QZEA 2KT0A 4P9FA 4RS8A 3BOQA 2IXSA 3TO6A 2QUFA 4A3KJ 2JQ7A 1TNSA 1HKSA 2O03A 4XN0A 2FXAA 3HHHA 1OR7C 2PMZA 2LSOA 2RGVA 5FD6A 3IP4B 2KDOA 1LUJB 4BY1J 1IRZA 3LA2A 3BQZA 3HSFA 1YO5C 1SD4A 1ZR4A 2W48A 3OMYA 3CCUI 3HJEA 1WJDA 4UUVA 4YFNF 1JUSA 3CLQA 3SDBA 2BYVE 2K4BA 5K5OA 3HTUA 5CLSA 3ZN1A 5ICCA 2KIFA 2JSPA 1WJBA 1BC7C 3ZXSA 2TRTA 5DCFA 3N4MA 1FOKA 5E1XA 1J0RA 5EF6A 4XBFA 5J1UA 4BQQA 3IH2A 3BR2A 1IV8A 4FE4A 2M87A 2KJBA 5HS9A 4ZDLA 4E7HA 3S1QJ 5DV5A 3LL7A 3JREA 2V26A 3CUOA 2DA4A 2FSWA 1VQ4I 4U88A 1G3TA 3RDIA 2QZ8A 2EFNA 3GFIA 3HOTA 3BR6A 3KP5A 4CA0A 1IO2A 4LLGF 1YIOA 3RKXA 3PIPF 1KGSA 4BS9A 1FYLA 1TC3C 2ESHA 2IA1A 2KQRA 5GTHC 4Y33A 1AKHB 3VYTB 1PDNC 3FX3A 2CW8A 4G7OF 2VKEA 4JX4A 1HW2A 3DV8A 3OIQA 4JP0A 2LF8A 2MGQA 4ZDPA 5JI6A 3I9V2 4N9IA 1LVKA 1NK3P 1ONVA 3HOYJ 1MNEA 2ACJA 1PUFB 3MVPA 3BR0A 2GAUA 3FM3A 3MZYA 3HHGA 3TL4X 4PJLA 1YQAA 3VEPA 1ETYA 3RYRA 1F9NA 4J00A 4G6QA 3ZQFA 4RLQA 1F36A 3AG3H 5F27A 3ABMH 4CSWA 2DAOA 1B9MA 3GFMA 1W7PD 2A6EF 4FHTA 5M5WJ 4RB0A 4HDUA 4IF4A 1Q1VA 2AQEA 3PIOF 4PDKA 2VJIA 2LKSA 2NNNA 4FX0A 4IX7A 4BACA 4ZYHA 3ZRGA 4WK8F 4A69C 1ZG1A 2H1LA 1O4XA 1U9OA 3RPQA 2DBBA 2EFOA 1O3RA 3BROA 3BC8A 2EFPA 2XDVA 5D8KB 5K7ZA 1A6QA 2LP0A 3QPSA 2QCOA 2Q8KA 1YE9A 2F5EA 3GLLA 4M71A 1KU3A 1TT0A 1Z1DA 2F2EA 4FCYA 2HEOA 4HNUA 3L1PA 3MQ0A 2ESNA 3CF2A 3LQQA 3HOZJ 2FEZA 3W6JB 5JFRA 3H36A 3RPUD 5M5XJ 5FFXA 3TGNA 1TBXA 2IGNA 2ZJPF 3CCEI 3OS1A 3LA7A 1DQUA 2QKMB 3MKLA 2HQNA 1QZYA 3FXMA 1D0ZA 3ABTA 4N4OB 1LFPA 2RC4A 4XKWA 1A04A 3BG6A 3EUAA 5KNLA 2XRNA 5GP9A 4BE1A 2CU7A 5JVTA 2FUG2 2JA6J 3NAUA 1USSA 5F0HA 5BPDA 5J8CA 3FXKA 4BQNA 3JAMZ 4X6AJ 3A0HC 3QODA 3MKYB 1LFBA 5LGUA 2DU9A 2HVQA 3ULQB 1GUUA 1B4AA 2EINH 2JUGA 2Z3YA 2XAHA 5D4SA 1OFCX 3GO5A 5CJ9A 3ISPA 2PJRB 4Q47A 4II3A 5D6FA 4LIVA 2XGDA 4XQFA 1ZGWA 1D1AA 1RUNA 3I71A 3GX4X 1HCRA 1REPC 1FYKA 1I1SA 4I99C 3JSOA 1OKRA 1LDKB 3F6OA 3AAFA 4WCGA 2LR8A 4DZPA 5EG0A 4LG0B 2VC0A 1N78A 3E7LA 4IVNA 3PNTA 1HOMA 2K86A 3BTJA 3ZCOA 4P9UA 2YSRA 4MGRA 1CF7B 4MLOA 2GQQA 2LG4A 3ZQCA 4ZTJA 1R22A 1VNDA 1YS6A 2Z99A 1RPWA 3K4NA 1J59A 3SFZA 4DYCA 2K7LA 1BR2A 5EJCA 3F8BA 2M5WA 5J1YA 2QSHX 2XC7A 2Y48A 3PUBA 1LDJA 3PSIA 1HA8A 2JVGA 1X58A 2W82A 2A6HF 2UXXA 3JR9A 1EA3A 2HQAA 3H3ZA 4OWRB 1IN8A 2M1BA 1W5TA 3VFZA 3PJRA 3K4JA 3I58A 3P9IA 1X1AA 4NQWA 4OIRF 3Q3SA 4A5MA 2A5YB 1RZ4A 5FLMJ 1R4MB 2FD5A 2IGOA 3F6VA 1P9QC 1NG7A 3S3MA 2BBYA 2CS3A 3WGGA 2P7VB 4MIMA 3DKXA 5ILUA 4A12A 1AA7A 4V2FA 1WHUA 2LFBA 1OR7A 2FOWA 3ZMZA 4CUGA 1FMVA 4BHPA 1A35A 1P4XA 1X2MA 3FXUA 3TP0A 2OTJI 1ZH5A 2QYOA 4QWQA 1O7FA 1LVAA 2EIKH 3F3XA 2BVLA 2LBFB 5FKLA 5J4YA 4UUSA 2GOMA 1Z21A 2ADUA 1R71A 5F64A 4OMYA 5CVIA 2XGEA 4BQAA 1DU6A 2RNGA 4PFPA 3WU0A 5F0CA 1RIOH 1JUPA 1R58A 1QHHD 2FNPA 2NOJB 3V4GA 3SHFA 5D5WB 3P9CA 4RB3C 2DOAA 4GCVA 1YX5A 2JK3A 3BZCA 1U5TA 3I0TA 2L3DA 4D9JA 1D3YA 2CV1A 3MEXA 2O8XA 1T95A 1YW7A 3FHZA 4HF0A 3HOSA 4L9TA 1JKPC 4EGZA 1BI0A 2Y9YA 2KIUA 2R5YB 2QLZA 3R61A 4A6EA 4HPQA 2DA1A 1IN6A 2DLLA 4M3GA 3F9KA 4I0AA 2KMUA 2I10A 2P4WA 1LPQA 3QAHA 1B6AA 2XGCA 5IOYA 2UUZA 1VQ8I 3FXJA 4HW0A 4N9HA 4RB1A 3ZMTA 2XIGA 2CG4A 2ZC2A 1KA8A 3RPUA 2LD5A 2DO7A 4QLCU 5EZGA 2BW3B 4IQJA 2KIQA 1WJEA 4ON0A 4N4NB 4JBAA 1SVMA 3MD2A 1X1PA 4EATA 2DJIA 5E3OA 4CGZA 1XMKA 2OZ6A 2QWWA 2ZNYA 4WXDA 4CH7A 3MMYB 2G7HA 3QPTA 3H0DA 2RAEA 2Y69H 3JSPA 2OD5A 2ETHA 2Q0OA 4LB5A 4YFKF 4BJ6C 1OISA 2HWVA 3DEWA 3B73A 5LRRA 2DTRA 2F5CA 1IN5A 5D5UB 4MQVA 4B3XA 3OOUA 5F1JA 3BPXA 2QBYA 2ZCWA 1GLNA 2RN7A 3GUDA 5E17F 4UVBA 4EMSA 4PK4A 1BIAA 1DPRA 4G7ZF 4BEHA 4DQ2A 3DQVC 3EQLF 5LHGA 3H5RA 1LJ9A 2M0MA 1OQYA 2LREA 4GYGA 1QPIA 3OL3A 4RAFA 3CC7I 4RDUA 3L2RA 1H9TA 3O3KA 1IV6A 1IGNA 3DFGA 2XPWA 5FLVA 3F23A 4AIJA 3E5XA 1AOYA 2XPUA 2GA1A 1BIBA 4FT8A 3SZGA 1NH3A 1MMGA 4V19K 4MTDA 2HYJA 4XR6A 2G9WA 3IRRA 2F5DA 2XROA 4OIOF 1B9NA 1SD6A 1IN4A 2I8DA 3RSNA 1ZRDA 1SFEA 3OSGA 3S2WA 3X2QH 1ORKA 1BL0A 1YOVB 2RREA 1C0WA 1F1ZA 2FQ3A 4H4KC 1JHFA 3A0BC 3JRDA 2EBIA 5E1WA 1OCZH 4GDFA 2DDBA 2KISA 2KZVA 5FJ8J 4A3EJ 3ZMVA 5DCMA 3P9KA 4M6VA 1MNMC 1KZHA 2BHZA 3U2RA 2EFWA 4A0YA 1UJ8A 2DW4A 2E19A 5GAGJ 3G3ZA 3DPTA 4LFUA 1FP1D 1MH4A 2A6TA 1FOXA 1WJ5A 4EVIA 4F91B 5GPAA 2R7OA 3BR5A 1VTNC 2KIMA 1R1VA 1ZARA 2QEXI 2R7UA 3U21A 4CHUA 3S2HJ 3A01B 1CGPA 3VOEA 5IY5H 1PJRA 4MTEA 5ERIA 3ZGKA 2PJPA 2M9HA 3TDZC 2VKVA 4L5EA 5DD8A 3ERED 2O5RA 3S15J 5DM6F 1YRNB 3HL2A 2DODA 2JUCA 1O57A 5EEHA 4ZZDA 2O61A 3ZPLA 1TTYA 2VQLA 4KIBA 5B3SH 1Z77A 4O5VA 5HOOA 3DPLC 2OU2A 1QGPA 4L0ZB 2XF7A 4R8HA 3UR3C 1FPQA 4M9XA 2EJRA 3HGYA 4GO1A 3SXYA 2VJ4A 3NQOA 9ANTA 2V6CA 1GHCA 1TQIA 1IAWA 4IL6C 2XAQA 1U6GA 3E1SA 5F6FA 2MC4A 2PEXA 2K5CA 3CF5F 4IHXA 2DN0A 5L3BA 1JXSA 2H94A 4KIFA 4XK4A 4OAZA 4EJOA 5TGTA 1R5GA 1IUYA 3TMOA 2B0LA 2M34A 3NARA 4A0ZA 2JZYA 3CDIA 1BN5A 3K4LA 2NVXJ 1TP4A 1VQPI 3ABKH 1Y39A 2HXOA 3BCAA 3I54A 1T0FC 2O0YA 3DLAA 3LSRA 4BHBA 3FZVA 5EEAA 2HS5A 1T33A 1KQ0A 3K4KA 1YYVA 2ZSHB 2YR2A 3OWTA 3ZMSA 2Y30A 1IRXA 2LK2A 5B1BH 3ZN0A 1P7JA 2DT5A 1AKHA 3BZ6A 2WB1N 4BHCA 5EEGA 2DMTA 2JPBA 2MA3A 1FX7A 3QP6A 3EETA 3PQKA 2VODA 2DMPA 3DU5A 2VN2A 3Q9SA 2HQ5A 4HX8A 5DTDA 1K4TA 2L7MP 1XSXA 3OYDA 1T2KA 3E6CC 1Y1VJ 1Y8RB 1ZYRF 2F4MB 4KYWA 2EV6A 3JRGA 1XSDA 2FOKA 4L18B 4AYBN 1X4PA 4M9ZA 2O9LA 5ICGA 2NS8A 3BTCA 2BHYA 3REOA 4FTHA 1FMWA 5FLXZ 1MMDA 2OF7A 2VE8A 3IWZA 2D45A 4ZDOA 5IPAA 1QHGA 4S04A 4XKCA 5IT9Z 1EH8A 3V7SA 2EZHA 1SANA 5H20A 4KA4A 1SEUA 2HI3A 2UXNA 2W1OA 3B6AA 2CV2A 4HV6A 2DA7A 1E2XA 3VODA 2KKOA 5CVVA 5E3NA 3LMMA 2HR3A 2L9RA 4KISA 2KLOA 5E1ZB 2PFBA 2WADA 2L4MA 3BPVA 4CCOA 1MZBA 2DFIA 2F6CA 2TDXA 4ZYAA 4O3MA 1MBKA 3ABLH 3Q0UA 3S32A 1ZGAA 1I6XA 1OMIA 1W36C 2F5FA 3J7AY 1I27A 3CCJI 1R9TJ 1JJ8C 1TQMA 1L0OC 1VI0A 1EKEA 2WAQA 2XB5A 2P5VA 2NVYJ 5M5YJ 2OAZA 4U7DA 1I3AA 1J7KA 2ZXJA 4D5FA 5JVGF 1QNTA 4G9YA 1K6OA 2EZIA 1VQOI 3CC2I 1S7EA 3HGGA 3B6CA 1P4WA 3ZP5A 1Z9CA 2NAZA 1OLTA 3LNQA 3VSKA 4RB2C 3T8RA 2BZTA 1IRGA 5F1RA 1FT9A 4S0HB 4PGGA 1HF0A 4KT5C 1W36D 2X6OA 5DYMA 1MD0A 2PJRA 2OCEA 1LKXA 1RI7A 4CCJA 1PP7U 3V42A 4ENMA 1T8IA 4P1WA 5B1AH 1ZR2A 1I39A 1VQMI 1LEBA 1ON2A 2L7FP 4ZJZA 5C4JJ 4LG0A 2WV0A 2VQGA 3D5RC 4PGHA 3OL4A 4N0BA 5EZHA 3FK6A 4OAYA 1DUXC 5D4RA 3HB9A 5KK1A 1AWCA 4HX7A 3ZQ7A 2XGXA 3FBNB 3IKVA 1FWZA 2QQ9A 2BV6A 3KYLA 1XC5A 2QVOA 3V7CA 1P6RA 1JTYA 1Y0UA 1UG0A 2K9QA 4OIQF 4RGSA 2AXTC 3ONQA 1W5CC 2V9KA 2L01A 4I0BA 4U0YA 2E1MC 3ZQHA 4XONA 1DU0A 3QU6A 2OUMA 3K4BA 5L3GA 5EDNA 5K7FA 4DGWB 2VLAA 1G3YA 4HEA2 4YFXF 2M30A 5FKMA 3S14J 1VFCA 3AG4H 1S6LA 1IZ1A 2F4OB 1F5TA 2Y2ZA 2Y0SN 3OYGA 2DFHA 3MZHA 3G73A 2OTLI 2CWEA 4I6ZA 4QPOA 5K5RA 4Q4ZF 2E1CA 3HKZN 1FP2A 1YTYA 2AS5F 4I2OA 3S1MJ 1SFKA 2E36A 4BU2A 1SFXA 1B1BA 3QYBA 2EB7A 5CPRB 4ZYGA 4A3LJ 3S2DJ 1STZA 5KVRA 3P5JA 1ZK8A 1I6HJ 4AIHA 2EA4A 3K10A 1DDNA 2LBFA 2MYSA 1MH3A 1VQ7I 3HXLA 2W7NA 2CQ7A 1ZQ3P 4M74A 2HYFA 3CJNA 4HSRA 1WCMJ 1A6IA 1R5ID 4BJ5C 4XN3A 2ELJA 1TNTA 3G1LA 1XDUA 3AFHA 4HA8A 4LGWA 4LITA 3G1OA 2LOOA 3CCYA 3M8FA 2H1KA 1TQPA 2OZUA 2XSJC 4AD9A 4Z6YA 5D8LB 1HKTA 2X4HA 2X9DA 2JVHA 1R23A 3WGIA 3JRAA 1WH7A 4TV7A 4YEJA
chains in the Genus database with same CATH topology
1X2MA 1OCTC 1B72B 3TP0A 1MBEA 3TP3A 4W1UA 1Y1WJ 4M3FA 5GPCA 4X1EA 2GLOA 5FKLA 1NTCA 4UUSA 2MSYA 1AU7A 1TWGJ 3LSPA 1U8BA 2XGEA 1B8IB 1IC8A 2D5VA 2XB0X 1DU6A 4BKXA 1QRYA 5F0CA 2E2IJ 2KDZA 1JUPA 4MFEA 5JLWA 1LE8B 1GT0C 3TW7A 4IHVA 1W0TA 1UG2A 3FIWA 2JK3A 3JRFA 3GTJJ 2DA2A 3Q0VA 1XG1A 5C44J 2X48A 2LVSA 3I4MJ 4MO7A 5FKOA 4BBRJ 2M8GX 5IYDJ 3HOXJ 4RBOA 3GTPJ 1RKWA 1FTZA 3CQZJ 2EQRA 3JRCA 2CQXA 2ME6A 1JKPC 3HOWJ 2QF7A 2Y9YA 2EH3A 3G1MA 2R5YB 2JA8J 2DMUA 1IDZA 2DA1A 4JX5A 4C3IJ 4M3GA 3GTOJ 4BXXJ 4G12A 2TCTA 2I10A 1ENHA 2COBA 4UUSB 1ZTRA 2DA3A 2NOGA 2XGCA 5IOYA 1FJLA 3ZQIA 3M3YJ 1ETWA 2WV1A 3ZOBA 4D7NA 4BBSJ 1OCPA 3HOUJ 4FISA 1E3OC 3K2AA 1HLVA 2LD5A 5FKKA 5EZGA 4IHWA 5FKNA 2HDDA 1JT6A 4XICA 1FEXA 2M2EA 4IHYA 2GBYA 3FISA 1JTXA 2IBDA 5E3OA 1IDYA 1IJWC 1U9NA 4B1RA 2P81A 4A3DJ 1MBGA 1WPKA 2CUEA 1TWFJ 4A3MJ 2RAEA 3MN2A 2DJNA 3DEWA 1RETA 2MW8A 1CQTA 1X2NA 3PM1A 2HOAA 2VPRA 3OOUA 4C3JJ 3BR3A 5F1JA 2AO9A 5M3FJ 2L7ZA 2LY9A 1BJZA 2H8RA 2YS9A 1QPIA 1G2HA 2ECBA 2WAQN 4RDUA 3RZDJ 1IV6A 1FIPA 1IGNA 5FLVA 2XPWA 1A5JA 3CDLA 2XSDC 2JMWA 2XPUA 4QSHA 3C2BA 3A01A 4Y52J 1VF9A 1W0UA 1NK2P 2HYJA 3BG9A 3H0GJ 2XPVA 1P7IA 4Y7NJ 1YRNA 4D7MA 3GTMJ 4I76A 3OSGA 1QVTA 1ORKA 1BL0A 3IH3A 4LOCA 1K61A 2XRLA 3GTQJ 3GTLJ 3JRDA 2EBIA 3RQIA 3RZOJ 3QQAA 5FJ8J 5BNGA 4A3EJ 4M6VA 1MNMC 4HNVA 1TWCJ 1ETOA 3BG3A 2E19A 2R5ZA 1BA5A 1MH4A 4D5CA 2G0EA 3IV5A 2R5YA 1H8AC 2JA5J 2R7ZJ 1ETKA 3ZQGA 3SJMA 5GPAA 4XRSG 3BR5A 3WHBA 1JKOC 1POGA 2NVQJ 1ETVA 2R93J 5F08A 2YU9J 3S2HJ 3A01B 1GDTA 3S16J 2O8KA 2K9SA 2M9HA 3HM5A 1OJLA 1MSEC 4AC0A 2VKVA 4L5EA 2CQQA 5F04A 2DMQA 5IP9J 3JRHA 2HOSA 2NVTJ 3S15J 1YRNB 3S1NJ 4A93J 3HOVJ 4V2GA 4DW6A 4QTRA 1Z77A 3M4OJ 4B4CA 3LSGA 3LSJA 2PMZN 4EEFG 2R0QC 5IP6A 3TEDA 4A3FJ 3W6VA 3TW6A 2O7OA 5JLXA 4BY7J 1TWAJ 2R5ZB 3HGYA 3BR1A 3BTLA 4A3CJ 4M3DA 3QPLA 9ANTA 2NS7A 2DA6A 5J3LA 1K83J 1ETXA 2CUFA 1H88C 3BG5A 2EZLA 5K7HA 3BT9A 1UMQA 2DN0A 4IHXA 1RKTA 4B3AA 1MBHA 3H3VK 2IAIA 1H89C 4XK4A 1Z0XA 3JRBA 3S17J 4IEJA 4XIDA 3DCFA 2M34A 3VPRA 3NARA 2EZKA 4DZJA 2NVXJ 1APLC 4XRSA 3FK7A 5F0FA 2N8GA 4W97A 2HXOA 2VI6A 2KT0A 1I50J 1JGGA 3LSRA 4J19A 4A3KJ 5EEAA 1T33A 5J1RA 2HOTA 3I4NJ 2Y30A 1MBFA 1JUMA 1QVUA 2LK2A 1P7JA 1AKHA 1IUFA 4BY1J 1IRZA 2WB1N 3IH4A 3BQZA 2DMTA 1U78A 1ZR4A 4A3GJ 2YUSA 2W48A 3K7AJ 5IYCJ 2DMPA 2HQ5A 5DTDA 2L7MP 1JUSA 1JJ6C 1Y1VJ 1T56A 2TRTA 4C3HJ 1HDPA 3O8GA 1ITYA 3JRGA 2LTPA 5EF6A 5J1UA 4AYBN 1GV5A 3IH2A 1GV2A 3BR2A 2O9LA 2NS8A 4FE4A 3BTCA 4DYQA 4FTHA 2FX0A 2MG4A 2OF7A 4C2MJ 3S1QJ 5IPAA 3GTGJ 3JREA 2EZHA 1SANA 2DA4A 2HXIA 2GM4A 2HI3A 4CYCA 3B6AA 3BR6A 2DA7A 4A3JJ 3PO2J 1TC3C 5E3NA 1AKHB 2L9RA 2ELKA 2ID6A 2E2HJ 2VKEA 4JX4A 2B63J 5EG0B 4JP0A 2MGQA 2ZB9A 4JX6A 1NK3P 1UHSA 1FTTA 3HOYJ 1PUFB 3MVPA 3S1RJ 3BR0A 1MBKA 2ECCA 4QIWN 3Q0UA 1TWHJ 1ZKGA 3D1NI 1ETYA 1R9TJ 1JJ8C 3ZQFA 1F36A 1VI0A 1LFUP 2XB5A 2NVYJ 5F27A 5E3LA 5M5YJ 1JKQC 5M5WJ 1RESA 4UUTA 4D5FA 1Q1VA 2JWTA 4XRMA 2EZIA 3GBGA 1S7EA 3HGGA 4CYCB 3B6CA 3Q0WA 4A3BJ 1EF4A 4A69C 3LNQA 1O4XA 1U9OA 2FJ1A 3A03A 4S0HB 2E1OA 1JKRC 1HF0A 2JJ7A 5K7ZA 2LP0A 3WHCA 1WGXA 2QCOA 2X6OA 3QPSA 5IP7J 4FCYA 3L1PA 1JT0A 1AHDP 3OIOA 1F43A 1D5YA 3HOZJ 5M5XJ 1WI3A 4FE7A 2R92J 1ZR2A 3JRIA 2ID3A 3UKGA 3FKIJ 2L7FP 2CJJA 5IOZA 5C4JJ 3MKLA 1XS9A 2LKXA 5IYBJ 5EZHA 2K9NA 3FK6A 2CRGA 3CMYA 3HB9A 5GP9A 2CU7A 2JA6J 1HDDC 1MBJA 3NAUA 5F0HA 2IEKA 4X6AJ 3BTIA 5HODA 1XC5A 4ABZA 1LFBA 4A3IJ 3HBLA 1JTYA 1GUUA 4M3EA 2K9QA 3LOCA 1FIAA 3PO3J 5EYRA 1OFCX 2E2JJ 2VUMJ 2XGDA 3ZQLA 3HDDA 1ZGWA 3O8HA 3ZQHA 1HCRA 2OPTA 1DU0A 1WH5A 4M3BA 1SFOJ 5EDNA 3BQYA 2LR8A 5K7FA 4DZPA 5EG0A 4GFBA 3E7LA 1BW6A 4DYRA 1HOMA 1IG7A 1PUFA 2Y9ZA 3HEFA 3BTJA 5EGOA 5FKMA 3GTKJ 5DS9A 4MLOA 2JN6A 3S14J 3ZQCA 1VFCA 1VNDA 2Y2ZA 5M3MJ 2Y0SN 2FQ4A 1BW5A 5C4XJ 3SFIA 1RPWA 4I6ZA 3OSFA 2K40A 3HKZN 2L0KA 3S1MJ 2AHQA 4DYCA 1B72A 5E3MA 3F0CA 2Y31A 2DTZA 5C3EJ 5J1YA 3SDGA 4A3LJ 3S2DJ 4NDLA 1X58A 2JA7J 1ZK8A 1I6HJ 4MFDA 3JR9A 1MSFC 1GVDA 1ETQA 1MH3A 3RKQA 1I3QJ 2M0CA 1ZQ3P 1WCMJ 1A6IA 4JYKA 2DMNA 2LLKA 3Q3SA 3A02A 1B8IA 3G1LA 2ME0A 5FLMJ 2FD5A 5EGOB 3G1OA 3CCYA 4AUXA 1LE8A 2H1KA 4MIMA 1RR7A 4V2FA 2LFBA 2DA5A 2X9DA 3JRAA 1WH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2M A;  1OCT C;  1B72 B;  3TP0 A;  1MBE A;  3TP3 A;  4W1U A;  1Y1W J;  4M3F A;  5GPC A;  4X1E A;  2GLO A;  5FKL A;  1NTC A;  4UUS A;  2MSY A;  1AU7 A;  1TWG J;  3LSP A;  1U8B A;  2XGE A;  1B8I B;  1IC8 A;  2D5V A;  2XB0 X;  1DU6 A;  4BKX A;  1QRY A;  5F0C A;  2E2I J;  2KDZ A;  1JUP A;  4MFE A;  5JLW A;  1LE8 B;  1GT0 C;  3TW7 A;  4IHV A;  1W0T A;  1UG2 A;  3FIW A;  2JK3 A;  3JRF A;  3GTJ J;  2DA2 A;  3Q0V A;  1XG1 A;  5C44 J;  2X48 A;  2LVS A;  3I4M J;  4MO7 A;  5FKO A;  4BBR J;  2M8G X;  5IYD J;  3HOX J;  4RBO A;  3GTP J;  1RKW A;  1FTZ A;  3CQZ J;  2EQR A;  3JRC A;  2CQX A;  2ME6 A;  1JKP C;  3HOW J;  2QF7 A;  2Y9Y A;  2EH3 A;  3G1M A;  2R5Y B;  2JA8 J;  2DMU A;  1IDZ A;  2DA1 A;  4JX5 A;  4C3I J;  4M3G A;  3GTO J;  4BXX J;  4G12 A;  2TCT A;  2I10 A;  1ENH A;  2COB A;  4UUS B;  1ZTR A;  2DA3 A;  2NOG A;  2XGC A;  5IOY A;  1FJL A;  3ZQI A;  3M3Y J;  1ETW A;  2WV1 A;  3ZOB A;  4D7N A;  4BBS J;  1OCP A;  3HOU J;  4FIS A;  1E3O C;  3K2A A;  1HLV A;  2LD5 A;  5FKK A;  5EZG A;  4IHW A;  5FKN A;  2HDD A;  1JT6 A;  4XIC A;  1FEX A;  2M2E A;  4IHY A;  2GBY A;  3FIS A;  1JTX A;  2IBD A;  5E3O A;  1IDY A;  1IJW C;  1U9N A;  4B1R A;  2P81 A;  4A3D J;  1MBG A;  1WPK A;  2CUE A;  1TWF J;  4A3M J;  2RAE A;  3MN2 A;  2DJN A;  3DEW A;  1RET A;  2MW8 A;  1CQT A;  1X2N A;  3PM1 A;  2HOA A;  2VPR A;  3OOU A;  4C3J J;  3BR3 A;  5F1J A;  2AO9 A;  5M3F J;  2L7Z A;  2LY9 A;  1BJZ A;  2H8R A;  2YS9 A;  1QPI A;  1G2H A;  2ECB A;  2WAQ N;  4RDU A;  3RZD J;  1IV6 A;  1FIP A;  1IGN A;  5FLV A;  2XPW A;  1A5J A;  3CDL A;  2XSD C;  2JMW A;  2XPU A;  4QSH A;  3C2B A;  3A01 A;  4Y52 J;  1VF9 A;  1W0U A;  1NK2 P;  2HYJ A;  3BG9 A;  3H0G J;  2XPV A;  1P7I A;  4Y7N J;  1YRN A;  4D7M A;  3GTM J;  4I76 A;  3OSG A;  1QVT A;  1ORK A;  1BL0 A;  3IH3 A;  4LOC A;  1K61 A;  2XRL A;  3GTQ J;  3GTL J;  3JRD A;  2EBI A;  3RQI A;  3RZO J;  3QQA A;  5FJ8 J;  5BNG A;  4A3E J;  4M6V A;  1MNM C;  4HNV A;  1TWC J;  1ETO A;  3BG3 A;  2E19 A;  2R5Z A;  1BA5 A;  1MH4 A;  4D5C A;  2G0E A;  3IV5 A;  2R5Y A;  1H8A C;  2JA5 J;  2R7Z J;  1ETK A;  3ZQG A;  3SJM A;  5GPA A;  4XRS G;  3BR5 A;  3WHB A;  1JKO C;  1POG A;  2NVQ J;  1ETV A;  2R93 J;  5F08 A;  2YU9 J;  3S2H J;  3A01 B;  1GDT A;  3S16 J;  2O8K A;  2K9S A;  2M9H A;  3HM5 A;  1OJL A;  1MSE C;  4AC0 A;  2VKV A;  4L5E A;  2CQQ A;  5F04 A;  2DMQ A;  5IP9 J;  3JRH A;  2HOS A;  2NVT J;  3S15 J;  1YRN B;  3S1N J;  4A93 J;  3HOV J;  4V2G A;  4DW6 A;  4QTR A;  1Z77 A;  3M4O J;  4B4C A;  3LSG A;  3LSJ A;  2PMZ N;  4EEF G;  2R0Q C;  5IP6 A;  3TED A;  4A3F J;  3W6V A;  3TW6 A;  2O7O A;  5JLX A;  4BY7 J;  1TWA J;  2R5Z B;  3HGY A;  3BR1 A;  3BTL A;  4A3C J;  4M3D A;  3QPL A;  9ANT A;  2NS7 A;  2DA6 A;  5J3L A;  1K83 J;  1ETX A;  2CUF A;  1H88 C;  3BG5 A;  2EZL A;  5K7H A;  3BT9 A;  1UMQ A;  2DN0 A;  4IHX A;  1RKT A;  4B3A A;  1MBH A;  3H3V K;  2IAI A;  1H89 C;  4XK4 A;  1Z0X A;  3JRB A;  3S17 J;  4IEJ A;  4XID A;  3DCF A;  2M34 A;  3VPR A;  3NAR A;  2EZK A;  4DZJ A;  2NVX J;  1APL C;  4XRS A;  3FK7 A;  5F0F A;  2N8G A;  4W97 A;  2HXO A;  2VI6 A;  2KT0 A;  1I50 J;  1JGG A;  3LSR A;  4J19 A;  4A3K J;  5EEA A;  1T33 A;  5J1R A;  2HOT A;  3I4N J;  2Y30 A;  1MBF A;  1JUM A;  1QVU A;  2LK2 A;  1P7J A;  1AKH A;  1IUF A;  4BY1 J;  1IRZ A;  2WB1 N;  3IH4 A;  3BQZ A;  2DMT A;  1U78 A;  1ZR4 A;  4A3G J;  2YUS A;  2W48 A;  3K7A J;  5IYC J;  2DMP A;  2HQ5 A;  5DTD A;  2L7M P;  1JUS A;  1JJ6 C;  1Y1V J;  1T56 A;  2TRT A;  4C3H J;  1HDP A;  3O8G A;  1ITY A;  3JRG A;  2LTP A;  5EF6 A;  5J1U A;  4AYB N;  1GV5 A;  3IH2 A;  1GV2 A;  3BR2 A;  2O9L A;  2NS8 A;  4FE4 A;  3BTC A;  4DYQ A;  4FTH A;  2FX0 A;  2MG4 A;  2OF7 A;  4C2M J;  3S1Q J;  5IPA A;  3GTG J;  3JRE A;  2EZH A;  1SAN A;  2DA4 A;  2HXI A;  2GM4 A;  2HI3 A;  4CYC A;  3B6A A;  3BR6 A;  2DA7 A;  4A3J J;  3PO2 J;  1TC3 C;  5E3N A;  1AKH B;  2L9R A;  2ELK A;  2ID6 A;  2E2H J;  2VKE A;  4JX4 A;  2B63 J;  5EG0 B;  4JP0 A;  2MGQ A;  2ZB9 A;  4JX6 A;  1NK3 P;  1UHS A;  1FTT A;  3HOY J;  1PUF B;  3MVP A;  3S1R J;  3BR0 A;  1MBK A;  2ECC A;  4QIW N;  3Q0U A;  1TWH J;  1ZKG A;  3D1N I;  1ETY A;  1R9T J;  1JJ8 C;  3ZQF A;  1F36 A;  1VI0 A;  1LFU P;  2XB5 A;  2NVY J;  5F27 A;  5E3L A;  5M5Y J;  1JKQ C;  5M5W J;  1RES A;  4UUT A;  4D5F A;  1Q1V A;  2JWT A;  4XRM A;  2EZI A;  3GBG A;  1S7E A;  3HGG A;  4CYC B;  3B6C A;  3Q0W A;  4A3B J;  1EF4 A;  4A69 C;  3LNQ A;  1O4X A;  1U9O A;  2FJ1 A;  3A03 A;  4S0H B;  2E1O A;  1JKR C;  1HF0 A;  2JJ7 A;  5K7Z A;  2LP0 A;  3WHC A;  1WGX A;  2QCO A;  2X6O A;  3QPS A;  5IP7 J;  4FCY A;  3L1P A;  1JT0 A;  1AHD P;  3OIO A;  1F43 A;  1D5Y A;  3HOZ J;  5M5X J;  1WI3 A;  4FE7 A;  2R92 J;  1ZR2 A;  3JRI A;  2ID3 A;  3UKG A;  3FKI J;  2L7F P;  2CJJ A;  5IOZ A;  5C4J J;  3MKL A;  1XS9 A;  2LKX A;  5IYB J;  5EZH A;  2K9N A;  3FK6 A;  2CRG A;  3CMY A;  3HB9 A;  5GP9 A;  2CU7 A;  2JA6 J;  1HDD C;  1MBJ A;  3NAU A;  5F0H A;  2IEK A;  4X6A J;  3BTI A;  5HOD A;  1XC5 A;  4ABZ A;  1LFB A;  4A3I J;  3HBL A;  1JTY A;  1GUU A;  4M3E A;  2K9Q A;  3LOC A;  1FIA A;  3PO3 J;  5EYR A;  1OFC X;  2E2J J;  2VUM J;  2XGD A;  3ZQL A;  3HDD A;  1ZGW A;  3O8H A;  3ZQH A;  1HCR A;  2OPT A;  1DU0 A;  1WH5 A;  4M3B A;  1SFO J;  5EDN A;  3BQY A;  2LR8 A;  5K7F A;  4DZP A;  5EG0 A;  4GFB A;  3E7L A;  1BW6 A;  4DYR A;  1HOM A;  1IG7 A;  1PUF A;  2Y9Z A;  3HEF A;  3BTJ A;  5EGO A;  5FKM A;  3GTK J;  5DS9 A;  4MLO A;  2JN6 A;  3S14 J;  3ZQC A;  1VFC A;  1VND A;  2Y2Z A;  5M3M J;  2Y0S N;  2FQ4 A;  1BW5 A;  5C4X J;  3SFI A;  1RPW A;  4I6Z A;  3OSF A;  2K40 A;  3HKZ N;  2L0K A;  3S1M J;  2AHQ A;  4DYC A;  1B72 A;  5E3M A;  3F0C A;  2Y31 A;  2DTZ A;  5C3E J;  5J1Y A;  3SDG A;  4A3L J;  3S2D J;  4NDL A;  1X58 A;  2JA7 J;  1ZK8 A;  1I6H J;  4MFD A;  3JR9 A;  1MSF C;  1GVD A;  1ETQ A;  1MH3 A;  3RKQ A;  1I3Q J;  2M0C A;  1ZQ3 P;  1WCM J;  1A6I A;  4JYK A;  2DMN A;  2LLK A;  3Q3S A;  3A02 A;  1B8I A;  3G1L A;  2ME0 A;  5FLM J;  2FD5 A;  5EGO B;  3G1O A;  3CCY A;  4AUX A;  1LE8 A;  2H1K A;  4MIM A;  1RR7 A;  4V2F A;  2LFB A;  2DA5 A;  2X9D A;  3JRA A;  1WH7 A; 
#chains in the Genus database with same CATH topology
 1SD7 A;  3T8T A;  4EQQ A;  1OCT C;  1B72 B;  1MBE A;  3DKW A;  3CJR B;  4W1U A;  1RUO A;  1XB4 A;  2P8T A;  3HC7 A;  4XKB A;  2EIJ H;  2VJJ A;  4ETS A;  4AVZ A;  1BBY A;  1NTC A;  2C6Y A;  1AU7 A;  1TWG J;  4LK1 F;  3LSP A;  2LH9 A;  3WU2 C;  2QSG X;  5TJJ A;  3OYN A;  1B8I B;  1T08 B;  3GVA A;  1QRY A;  2E2I J;  2KDZ A;  2BW3 A;  3SZP A;  3IKT A;  1LE8 B;  3PFI A;  3FBI B;  1BR4 A;  4BL0 B;  3JRF A;  3FIW A;  2HKX A;  4K2E A;  3C1D A;  2BXZ A;  3ZR8 X;  2X48 A;  1LNW A;  2EIM H;  3R6S A;  2QSF X;  4MO7 A;  3CCS I;  1Z67 A;  1XX5 A;  2V6E A;  1F4K A;  3HOX J;  4RBO A;  3KX2 A;  3CO6 C;  2EQR A;  4D1Q A;  2IT0 A;  3I64 A;  2CQX A;  4OOI A;  4IQ4 A;  4G94 A;  4IRH A;  3V8L A;  2KP6 A;  2QF7 A;  3ERM A;  3J7Z I;  1Z7L A;  3G1M A;  2JA8 J;  1ULY A;  1IDZ A;  2A68 F;  4EV0 A;  4O6J A;  3GTO J;  2QQ8 A;  5FRO A;  4G12 A;  3FDY A;  3OS2 A;  2COB A;  3VB2 A;  2V4J C;  5KAF C;  2KL4 A;  2DA3 A;  2ZSI B;  2E7X A;  3F8F A;  4KFC A;  3W2V A;  4HQE A;  2X1D A;  3U1D A;  4E70 A;  4BBS J;  1OCP A;  1NHA A;  4FIS A;  1D0X A;  1GXQ A;  3HUG B;  1E3O C;  2GA2 A;  4E7S A;  4ZC3 A;  3CJT B;  5FKK A;  4IHW A;  5FKN A;  4ZH4 F;  1EJ9 A;  1JT6 A;  3QRF F;  2M2E A;  4DOZ A;  5ICE A;  2PBI A;  4EJW A;  2IBD A;  1IDY A;  1U9N A;  1SVL A;  4Y15 A;  2RQP A;  1WPK A;  4A3D J;  4UXN A;  1RRJ A;  1TWF J;  4B47 A;  4A3M J;  1ZRC A;  2OC6 A;  4PJ0 C;  4PSW A;  2DJN A;  1RET A;  5CQE A;  1KU2 A;  1D1B A;  2VT2 A;  2KRF A;  1X2N A;  3PM1 A;  4C3J J;  4HG2 A;  3KLN A;  3LSI A;  2K3P A;  2FE3 A;  3EUH C;  3M07 A;  2AO9 A;  2XVC A;  3VYS B;  5M3F J;  1V3F A;  1XMX A;  2LY9 A;  2VXD A;  5LFA A;  1JI8 A;  1BJZ A;  1LEA A;  3ML6 A;  3HTS B;  2CH0 A;  2V79 A;  2CQN A;  2FRH A;  2VBZ A;  4LIU A;  2VXZ A;  3RZD J;  2VBY A;  4WWC A;  1XSV A;  2ZME B;  3BZK A;  3CUQ B;  5D6E A;  2IGK A;  3KE2 A;  3FXL A;  3JCU C;  2W25 A;  3CP8 A;  1ZEL A;  3CDL A;  2B9S A;  1MMA A;  3A01 A;  2IS1 A;  1Y0N A;  2NVU B;  2XV4 S;  4II2 A;  3I4P A;  2HVS A;  2XPV A;  4Y7N J;  2DQL A;  3WG9 A;  1YRN A;  2P7C B;  1D8K A;  3VDX A;  1QVT A;  3J7Y J;  1HW5 A;  2HTJ A;  3M9A A;  3SYT A;  2VE9 A;  4LOC A;  2BY2 A;  2XRL A;  2UZK A;  2V1N A;  2X6W A;  1R49 A;  4CZZ A;  4ENJ A;  2GIV A;  2PLY A;  4WXH A;  4A6D A;  3PFY A;  3QQA A;  2LY2 A;  2FNA A;  4HNV A;  1J9I A;  1DGW Y;  3BG3 A;  2FBH A;  2QQA A;  1BA5 A;  2ZJ2 A;  4D5C A;  1E17 A;  2R7T A;  5J40 A;  1ETK A;  3ZQG A;  4XRS G;  3BWG A;  3GZN B;  2YPR A;  2H09 A;  3GW2 A;  3I5U A;  4XKV A;  2NVQ J;  5F08 A;  1YIT I;  2R7F A;  2IA0 A;  1OPC A;  4ANJ A;  3G71 I;  3G2B A;  4UB6 C;  4RGU A;  2DMQ A;  2NYX A;  2CFX A;  4P5O A;  4PUS A;  3EUK L;  3G4S I;  2DK8 A;  3HOV J;  1KYZ A;  3OYE A;  5ICF A;  3WTU C;  2DXI A;  1MGT A;  4RAG A;  1S3J A;  1V54 H;  2GXA A;  3LSG A;  5BOX A;  2R0Q C;  1G4D A;  2EK5 A;  4A3F J;  5BPI A;  2K4J A;  3K4M A;  2IRF G;  3W6V A;  1BI3 A;  1W7P A;  2QEN A;  3GZ5 A;  3HPG A;  1I5Z A;  2O7O A;  4NB5 A;  4ESF A;  3L2V A;  5BQT A;  3HPH A;  1OCO H;  1WKM A;  3BTL A;  4HNT A;  3QPL A;  4RM2 A;  1M1E B;  2KFD A;  1LB2 A;  5HS8 A;  1X4O A;  4CYD A;  2NS7 A;  2FBI A;  1E3H A;  1ETX A;  2CUF A;  1H88 C;  2Y75 A;  1VQK I;  3BG5 A;  1WJF A;  4C30 A;  1K78 B;  1RKT A;  2DPD A;  5HVQ C;  1MBH A;  4S05 A;  3CES A;  1D5V A;  2HFH A;  4IXA A;  2MD5 A;  5GAE J;  2F5V A;  1YX3 A;  2ZNZ A;  3CZ6 A;  1H89 C;  2ZJR F;  4I7H A;  1J2X A;  1HC8 A;  3JRB A;  3GLX A;  4IEJ A;  3F8M A;  3DCF A;  2ZFU A;  5CVR A;  3MAJ A;  2FF4 A;  3FMQ A;  3KFW X;  3QYF A;  2EZK A;  3ESW B;  3VPR A;  4DZJ A;  2A3S A;  4NC7 A;  1R1T A;  5F0F A;  2XF5 A;  3SQN A;  5CVJ A;  4XLN F;  4XRS A;  1S9H A;  5TRD A;  4XLE A;  4KDP A;  1XGM A;  3O6B B;  3IAS 2;  4P96 A;  1JGG A;  2XAG A;  5HS7 A;  1OCC H;  5H2F C;  2HDW A;  4BH9 A;  4A5N A;  4KJZ A;  4BXU A;  5J1R A;  2IS6 A;  1QO0 D;  3I4N J;  1MBF A;  3J81 Z;  4LJZ F;  4OIP F;  1HKQ A;  3E5Q A;  1FBU A;  2WY8 Q;  4HV5 A;  3H9G A;  3IH4 A;  3OYH A;  2JT1 A;  3J80 K;  5LRS A;  4JQF A;  1WZ2 A;  4ASN A;  1JJ6 C;  3OYF A;  2X1C A;  3G6E I;  4CZC A;  1X1B A;  2L5Q A;  5LHI A;  1T56 A;  3AL0 C;  4IOA F;  3O8G A;  1ITY A;  5IT3 A;  3BLY A;  2IJL A;  1XMA A;  3HZJ A;  4KIC A;  1GV2 A;  5ILV A;  2FX0 A;  2MG4 A;  2I5U A;  5HNH A;  1Z3X A;  3Q5F A;  1TW2 A;  2GM4 A;  1N77 A;  2BY3 A;  1FNN A;  3S8P A;  5HLT A;  4FX4 A;  2L02 A;  4A3J J;  3LSK A;  2ISY A;  3PO2 J;  1YS7 A;  2CYY A;  4KN7 X;  1G59 A;  2A61 A;  2ELK A;  4Y17 A;  3CCL I;  5GAD J;  2B63 J;  2K85 A;  5EG0 B;  2DYR H;  4DIQ A;  2ZB9 A;  4UVA A;  4JX6 A;  1FTT A;  4HST A;  4BAY A;  4MQ9 F;  3I56 I;  2D2W A;  4NUB A;  5AIP A;  3UNG C;  3S1R J;  4XNF A;  2GXG A;  5L3C A;  2V7F A;  2E35 A;  3D1N I;  3C7J A;  2WB1 A;  4BXF A;  1PYV A;  5LEJ A;  3D5S C;  1ERD A;  1LFU P;  3VYU B;  2PX9 A;  4M72 A;  2J5O A;  2ZME C;  3CUQ C;  2VBW A;  4Q5S F;  1SD5 A;  1JE8 A;  1MND A;  2JWT A;  5FD5 A;  5CQG A;  4MEY F;  4Y13 A;  3GBG A;  4CYC B;  3B02 A;  3R60 A;  1Q1H A;  5HLI A;  2RKH A;  3HSR A;  3Q0W A;  4A3B J;  4Y4R A;  5E18 F;  4AYB A;  1R7J A;  1X1D A;  1MJ9 A;  2E1M B;  2FJ1 A;  1VQL I;  3LA3 A;  2E1O A;  2CW0 F;  2JJ7 A;  3BY6 A;  3I59 B;  2L7K A;  1WGX A;  3QOE A;  3E3V A;  2IA2 A;  3WHC A;  5IP7 J;  4NQW B;  1A36 A;  3OIP A;  1AHD P;  3OIO A;  4R1H A;  1F43 A;  4D0P A;  2R7D A;  2HOE A;  2BXY A;  4F55 A;  1HQC A;  1R5H A;  2D1H A;  3JRI A;  2ID3 A;  5ILS A;  4B48 A;  3OYA A;  1O3Q A;  2CJJ A;  2COM A;  3QOP A;  2LKX A;  5LGT A;  3OR1 C;  3GYH X;  4L5I A;  1S7O A;  2K9N A;  2VIX A;  1YHQ I;  2P6S A;  3LSM A;  1UFM A;  2F4I A;  2BOL A;  5HDG A;  1HDD C;  1MBJ A;  3GF2 A;  4XOP A;  3PQJ A;  3BTI A;  1K6Y A;  3K2Z A;  5HOD A;  3ELK A;  3OYL A;  4A3I J;  5FRM A;  4HRI A;  1VQ5 I;  4IJA A;  1G6N A;  2CW7 A;  3LOC A;  2FA5 A;  3PO3 J;  2HQR A;  1MW7 A;  2ZKZ A;  2E2J J;  4HAM A;  1ZGJ A;  2VUM J;  2VL8 A;  3ZQL A;  3HDD A;  5FO5 A;  2MD0 A;  3WTV C;  4GXO A;  2QM3 A;  2E7W A;  2M4G A;  1BM9 A;  3KCC A;  2OPT A;  1MMN A;  1WH5 A;  2JA2 A;  2VAS A;  2R7Q A;  1SFO J;  2ZXW H;  4PJJ A;  2LC2 A;  1U5T B;  4BYY A;  1VZ0 A;  2K9L A;  2Z33 A;  2X6X A;  3IWF A;  3L2C A;  2MLK A;  1YIJ I;  1PUF A;  4ENN A;  1H0M A;  3GTK J;  1MJA A;  2AXL A;  5H6Q A;  5DS9 A;  3DXJ F;  2JN6 A;  1FSE A;  1IXC A;  1ZLJ A;  5M3M J;  1BW5 A;  1XCV A;  3SFI A;  4BGD A;  1UST A;  1GXP A;  1KYW A;  2XF6 A;  3CMM A;  1UCR A;  1T39 A;  1DPU A;  2K40 A;  5HDK A;  2L0K A;  3GFL A;  5E79 C;  2R7V A;  2AHQ A;  1B72 A;  2E5N A;  2PMU A;  2IS4 A;  4CDG A;  2DTZ A;  4XMY A;  5C3E J;  1P4A A;  1O7L A;  1XGS A;  4KIT B;  4NDL A;  4OMZ A;  5L3F A;  3KP4 A;  3T0Y A;  3D5L A;  1XCB A;  1YLF A;  4MNU A;  2JA7 J;  2STW A;  4AM3 A;  4MFD A;  2VJ5 A;  5FB2 A;  1PVE A;  1OCR H;  2MBF A;  1Z6R A;  2DMN A;  2UWM A;  3CME I;  1KU7 A;  1B8I A;  4HLX A;  4NHJ A;  1GVJ A;  2ME0 A;  1D0Y A;  5DUI A;  3I53 A;  3HYI A;  5EGO B;  5K5Q A;  4PJN A;  1LE8 A;  1BOA A;  3D0S A;  4JK1 X;  4XLF A;  1RR7 A;  4B43 A;  3K70 C;  1BI2 A;  1U2W A;  1BR1 A;  3E5U A;  1XPX A;  1UZC A;  2VB6 A;  3Q9V A;  1FZP B;  3WTS C;  2ICW G;  1IF1 A;  1SVO A;  2P6T A;  4U0W A;  4ENK A;  3L00 A;  1DGR M;  4LLN A;  5A2Q K;  1Y1W J;  4KUM A;  1FBS A;  4M3F A;  4UVC A;  2GOX B;  1G3W A;  2WA0 A;  3RIR A;  4X1E A;  4HZF A;  2GLO A;  2GZW A;  3MKW B;  1QBJ A;  5D5X B;  3K9T A;  1EV7 A;  4LK0 F;  1G8X A;  3BJO A;  3PL8 A;  3K70 D;  2Q1Z B;  3IHU A;  2D5V A;  2XB0 X;  1S7A A;  3HUG A;  4BKX A;  1HBX G;  1T98 A;  1GT0 C;  3TW7 A;  1IN7 A;  2IPQ X;  3DWL E;  4IHV A;  1W0T A;  4BJT A;  1JHH A;  3GTJ J;  2DA2 A;  3Q0V A;  5C44 J;  1V4R A;  2EWN A;  1J5Y A;  1BJA A;  2DDA A;  3H92 A;  2M8G X;  3CDH A;  4ZYE A;  1V5E A;  2CFO A;  2IS2 A;  1YW8 A;  1CF7 A;  3CJQ B;  1FTZ A;  3HOW J;  2LF7 A;  2DMU A;  4Q48 A;  1EH6 A;  1U8R A;  2HPM A;  4C3I J;  4FQG A;  2R7R A;  1TLH B;  3RKW A;  3RI4 A;  1ENH A;  1E0E A;  3W3C A;  2NOG A;  2PMH A;  3ZQI A;  3OOP A;  3M3Y J;  2WV1 A;  3ZOB A;  4D7N A;  2VQC A;  2ZME A;  3CUQ A;  2RVC A;  3WE3 A;  4AVP A;  1HLV A;  1K79 A;  2W84 A;  1IW7 F;  2HDD A;  2CSO A;  4XIC A;  4ZYD A;  2R7W A;  3EYY A;  1WSU A;  1YW9 A;  3DLL F;  3FIS A;  2MH9 A;  2M3A A;  2E5Z A;  1ZRE A;  4AU7 A;  3IUO A;  4B1R A;  2P81 A;  3CTA A;  4ESJ A;  1MBG A;  1ZHF A;  3E0J B;  5L3D A;  3TOB A;  3LST A;  2L9N A;  3KZY A;  3VYR B;  2WAE A;  2KZG A;  4YIR X;  1X19 A;  2DCE A;  2MW8 A;  3ABU A;  1NG6 A;  2VPR A;  2A5W A;  2Z2S B;  4AID A;  2XAF A;  4XOT A;  3CLO A;  3ZMU A;  2JRM A;  2L7Z A;  5KAI C;  3KYD B;  4OU0 A;  2Q2E B;  2RV8 A;  3HRT A;  3WTT C;  2RQQ A;  5DD4 A;  4BQO A;  4M6Y A;  3DTK A;  3BCB A;  4E7J A;  1BC8 C;  2WY7 Q;  2YS9 A;  4B09 A;  1ACI A;  2XAJ A;  2YU3 A;  4PFO A;  4XRF A;  4E7L A;  2WAQ N;  2DT6 A;  1WVR A;  2V1X A;  4C2U A;  1FIP A;  3H35 A;  3DEU A;  2KRC A;  1A5J A;  2DOE A;  1S8N A;  2JMW A;  4QSH A;  3T1B A;  4Y52 J;  2JPC A;  1VF9 A;  5GTI C;  1NK2 P;  2X85 A;  4C9Y A;  3BG9 A;  5J6X A;  3GXO A;  3C18 A;  2DK5 A;  1P7I A;  3ASN H;  2K3F A;  3ZMD A;  4D7M A;  4E6K G;  3A4C A;  4I76 A;  3GTM J;  4L0Y B;  1T0F A;  3TO9 A;  1Z3Y A;  3IH3 A;  1KON A;  2X51 A;  1K61 A;  4WXC A;  2CGP A;  1U5T C;  3RZO J;  1A31 A;  3U1K A;  5JHU A;  5JHF A;  3OYB A;  3KLO A;  1TWC J;  4IRG A;  1U0J A;  3N97 A;  4DBR A;  2JTV A;  2EPF A;  1D8J A;  3HIF A;  3QU3 A;  2ELH A;  4Y3O A;  2WBM A;  4BUP A;  2HPI A;  2R5Y A;  1H8A C;  1O3S A;  2CUJ A;  3PSF A;  1WQ2 A;  3WHB A;  2IVM A;  4U7B A;  3MZ8 A;  1POG A;  3WOD F;  5B5E C;  3NWS A;  2GXB A;  2R93 J;  2EFQ A;  2DFE A;  2E34 A;  1TW3 A;  2M45 A;  1K78 A;  2FU4 A;  2W24 A;  4KIG A;  1GDT A;  4LLL A;  3S16 J;  2O8K A;  4GGG A;  1OJL A;  2HNH A;  4UHT A;  3WGH A;  5F04 A;  4AC0 A;  5IP9 J;  2HOS A;  4UB8 C;  5CKT A;  3RYP A;  3H5A A;  4A93 J;  1R36 A;  4FAS D;  3EYI A;  3JTH A;  3KPH A;  3M4O J;  1HSJ A;  3LSJ A;  2PMZ N;  3TED A;  4HF1 A;  4M9S A;  5IP6 A;  4BNC A;  2VC1 A;  3OYM A;  2LDU A;  2M7A A;  2D1V A;  2HZD A;  2WC2 A;  4EM2 A;  3TW6 A;  1UEL B;  3OS0 A;  4PCQ A;  1MDM B;  2O6G E;  2M8E A;  4I01 A;  2R5Z B;  2LY1 A;  3E6D A;  3BR1 A;  1K4S A;  3K0L A;  1O3T A;  1MKM A;  4L5J A;  1VQN I;  1TZL A;  1X3Z B;  3CCV I;  2VQH A;  2DA6 A;  5J3L A;  1K83 J;  4CCN A;  3OYC A;  1FC3 A;  4HYE A;  2EZL A;  1ZN2 A;  4M6X A;  5K7H A;  3S3O A;  1UMQ A;  1UB9 A;  3TOA A;  4B3A A;  1SAX A;  3AL0 B;  2R7X A;  1QU3 A;  1S5L C;  1DP7 P;  2EIL H;  4X0G A;  2CUZ A;  4NC8 A;  1U3E M;  4CCK A;  1ZG5 A;  2IAI A;  1WFX A;  2L54 A;  1Z0X A;  2PN6 A;  5ED4 A;  4UV9 A;  2XAU A;  3KP6 A;  3IRQ A;  3S17 J;  3K6G A;  1XN7 A;  4ITV A;  4BE0 A;  2QGU A;  4RGX A;  1APL C;  1FBQ A;  2Z5U A;  3FK7 A;  4CCL A;  1D1C A;  2VI6 A;  3FWE A;  1I50 J;  3RCO A;  4J19 A;  4HOB A;  1RC9 A;  4DBQ A;  5LLQ A;  4U87 A;  2HOT A;  3FKJ A;  3DEE A;  1KQ8 A;  1OYY A;  2DYS H;  1JUM A;  1QVU A;  1IUF A;  2EV5 A;  1SMT A;  1BI1 A;  3OR2 C;  3WTX C;  2QA4 I;  1U78 A;  3JAM K;  1PP8 F;  4A3G J;  2YUS A;  3K7A J;  5IYC J;  4AWX B;  4HDV A;  1HXD A;  2OCC H;  4I02 A;  3KET A;  1B59 A;  4U0V A;  3VWB A;  4XLP F;  4EGY A;  1YG2 A;  2LKP A;  2QKL B;  2BEO A;  2X1E A;  4C3H J;  1HDP A;  2XAS A;  4JOM A;  3W6K B;  3ECH A;  2LTP A;  3FXR A;  1GV5 A;  5FRN A;  4ESB A;  2W4S A;  3WTZ A;  2FMY A;  4G8X A;  1K7A A;  1LDD A;  4DYQ A;  2HU9 A;  4C2M J;  3SZT A;  2WWY A;  2GWR A;  2HYG D;  4XOR A;  3GTG J;  3WTW C;  1V5G A;  1FLI A;  2HXI A;  4CYC A;  3FXO A;  1Y6I A;  2EV0 A;  1UHM A;  2H6B A;  3L09 A;  3J7A O;  3C2H A;  1YJW I;  4F92 B;  1S29 A;  1XGN A;  5LGN A;  2XHK A;  4MEX F;  3I59 A;  2ID6 A;  2PQ8 A;  2E2H J;  2DQR A;  4R79 A;  1YJN I;  1I1G A;  4BDZ A;  2NXN B;  2DFF A;  1UHS A;  1X1C A;  2ZJQ F;  4KN4 X;  5LEK A;  5AON A;  2ECC A;  1R1U A;  2KJC A;  4QIW N;  1TWH J;  1ZKG A;  3LFK A;  1W5S A;  4IZZ A;  3W2W A;  2XKP A;  4UY8 I;  1DP3 A;  1P92 A;  3E6M A;  5E3L A;  4HBL A;  3EPZ A;  1JKQ C;  1X3U A;  4H0E A;  2P5L C;  1RES A;  3IC7 A;  4UUT A;  2L9S A;  1E3P A;  1XD7 A;  1ZRF A;  1FOY A;  4I98 B;  2P0W A;  4XRM A;  4LMY A;  3KEY A;  1IXR C;  4CIC A;  1EF4 A;  1Z91 A;  2OV7 A;  1WJA A;  4HQM A;  3P7N A;  1UAA A;  3RQ4 A;  2HZT A;  5HDN A;  3A03 A;  3K1P A;  4LD5 A;  3A1Y A;  2KHM A;  3DPU A;  3FM5 A;  5E8G A;  2L9V A;  1JKR C;  3R4K A;  3DBR B;  4XSZ F;  5GAH J;  1MMS A;  2DT7 B;  3I3L A;  1SMY F;  3DF8 A;  3L2U A;  3HRU A;  5H6R A;  1JT0 A;  4YIF A;  3KP2 A;  2EA2 A;  1D5Y A;  1JGS A;  1PUE E;  3IL2 A;  1KQ9 A;  3T5X A;  1WI3 A;  4FE7 A;  2R92 J;  5CVU A;  2VPL A;  2ZBK A;  2XUB A;  3UKG A;  2OQR A;  3FKI J;  5IOZ A;  3EDP A;  2A05 A;  1XS9 A;  2OJE D;  2H8W A;  2A69 F;  5IYB J;  2Z16 A;  2H27 A;  4ZTF A;  3BJ6 A;  1V5F A;  2CRG A;  5HLH A;  3CMY A;  1J09 A;  4YG2 F;  2CMP A;  3NRV A;  2MC3 A;  4G6D A;  4LB6 B;  3GEZ A;  4XLA A;  4XL9 A;  2IEK A;  3V8K A;  4P55 A;  5B66 C;  3J80 Z;  2MFZ A;  2O3F A;  4ABZ A;  4YRV A;  3HBL A;  2L2O A;  2OQG A;  4M3E A;  1FIA A;  1MJB A;  5EYR A;  3OY9 A;  4IRI A;  1VQ9 I;  3KP3 A;  3GME A;  1QPM A;  3RKY A;  2IGM A;  3O8H A;  4ZZL A;  3LAP A;  4F7Z A;  3M1E A;  3GCM A;  2HGC A;  5HNF A;  4M3B A;  3WTY C;  4C2T A;  4WF2 A;  3BQY A;  3SEZ A;  3L2Q A;  3SEQ A;  3F8C A;  1XTA A;  4GFB A;  5AIQ A;  3L9F A;  1BW6 A;  4DYR A;  4AIK A;  2UV1 A;  1IG7 A;  1N75 A;  2PG4 A;  2R4G A;  2Y9Z A;  3HEF A;  1SC7 A;  5EGO A;  4L9V A;  2JRT A;  1WJC A;  5BMZ A;  3ZQQ A;  3MKZ A;  2FQ4 A;  2WAF A;  1G3S A;  2HDC A;  5C4X J;  4I09 A;  2MAB A;  4KNY A;  3AG1 H;  3OSF A;  3N05 A;  1UHW A;  1X3W B;  5E3M A;  4EM0 B;  3F0C A;  2Y31 A;  4RGR A;  1IXS B;  3ROU A;  4A2U A;  4EJV A;  1RNL A;  3SDG A;  3KP7 A;  4QPQ A;  4BE2 A;  5LHH A;  3AKZ A;  3FMS A;  2E1N A;  2F48 A;  3QWL A;  4KMU X;  4CO8 A;  2DOF A;  1ETQ A;  1GVD A;  2KPM A;  3DKY A;  3RKQ A;  1MSF C;  2VOO A;  1I3Q J;  2LNB A;  2M0C A;  2NRA C;  3R0A A;  4JYK A;  4NBQ A;  4RLF A;  2LLK A;  3A02 A;  4IPA A;  2OA4 A;  2IP2 A;  3U9G A;  3J81 K;  5CYV A;  2VT3 A;  3DBH B;  4KMF A;  4AUX A;  4XLC A;  3QP5 A;  3CD6 I;  3VSL A;  3RJP A;  5HLG A;  2CQK A;  3MFK A;  2M7B A;  6PAX A;  1FSH A;  3EUH A;  3OYI A;  1OYI A;  2DA5 A;  5KCM A;  2CV0 A;  1FEX A;  4IO9 F;  2ZFW A;  5FGM A;  3COA C;  2E60 A;  3TP3 A;  3JW4 A;  4BDY A;  2B7E A;  5J8F A;  4HLY A;  5J47 A;  5LBQ A;  5GPC A;  1VQ6 I;  1QZZ A;  3RTR A;  2G7U A;  2ZXI A;  2XKO A;  3GFJ A;  1XDS A;  3CCQ I;  3L7W A;  3NWT A;  2MSY A;  2NS0 A;  3HRS A;  3I55 I;  1U8B A;  2H6C A;  3F8N A;  3GZ6 A;  2RDP A;  3FF5 A;  4YEL A;  1T6S A;  1IC8 A;  4FET A;  2W57 A;  1SAU A;  1Z7U A;  2Z1D A;  2BE5 F;  4CXF A;  4MFE A;  5JLW A;  4RAZ A;  2E71 A;  1UG2 A;  3M8J A;  4NNJ A;  2MH2 A;  3CCM I;  3CO7 C;  1XG1 A;  3FMR A;  2LVS A;  3I4M J;  2AQF A;  3LFU A;  5FKO A;  3CP2 A;  4BBR J;  5IYD J;  3GTP J;  1RKW A;  3CQZ J;  1W4M A;  3JRC A;  3FHN A;  3PUF A;  3HG9 A;  2ME6 A;  3KZZ A;  2EH3 A;  5TIS C;  1J75 A;  1BOB A;  3ASO H;  3KEQ A;  3L2W A;  4JX5 A;  5K1Y A;  3OYJ A;  3TQN A;  4BXX J;  1RR8 C;  2Q2E A;  2TCT A;  4UUS B;  1FYM A;  1ZTR A;  2HTS A;  4L9J A;  1FJL A;  1N25 A;  2KRH A;  1ETW A;  3C3W A;  2Z9O A;  3KZI C;  2ZXH A;  2K27 A;  3HOU J;  4F52 A;  2LRD A;  4RMN A;  3K2A A;  3H1C A;  3CMA I;  4F93 B;  1V55 H;  2M4K A;  1H9G A;  2K9M A;  4IHY A;  1IRF A;  2GBY A;  3KYC B;  1JTX A;  3M8E A;  1IJW C;  3AG2 H;  3V7R A;  3OYK A;  1HST A;  2CUE A;  3FXQ A;  1SFU A;  5DM7 F;  3DTE A;  1W7P B;  3MN2 A;  2DI3 A;  2BY0 A;  1L3L A;  1WRJ A;  3V8J A;  4E7K A;  1CQT A;  3A2K A;  2V1D A;  2HOA A;  3BR3 A;  2VOP A;  2R3S A;  3DBL B;  2LYC A;  1YI2 I;  2IW5 A;  5LD2 C;  3K4C A;  4GYI A;  2H8R A;  4IOC F;  1LQ1 A;  2W00 A;  1FY7 A;  1G2H A;  2ECB A;  3MWM A;  4PJM A;  4DNC A;  2STT A;  2BGC A;  2W85 A;  4XLH A;  4UNO A;  2QQB A;  2PI0 A;  1R4N B;  1Z05 A;  1YJ9 I;  4IKF A;  2L4A A;  1Y56 A;  1ZAO A;  2DPU A;  3WE2 A;  2XSD C;  3C2B A;  4E4H A;  1W0U A;  4EJU A;  5A2Q Z;  5KHD A;  1Y8Q B;  4B44 A;  2ZO4 A;  3H9Q A;  2NNY A;  3M1C A;  4NC6 A;  3H0G J;  1WI9 A;  1R00 A;  2R7S A;  3PNV A;  3DTI A;  4IHT A;  3K1M A;  3LAJ A;  4KT6 A;  2QBY B;  5L3E A;  4HF2 A;  2A07 F;  3GTQ J;  3GTL J;  2FBK A;  2VKH A;  4XM3 A;  3RQI A;  4B8X A;  3BG7 A;  3LWF A;  1HW1 A;  2BY1 A;  3H3U A;  2Y0M A;  1EH7 A;  2J5P A;  3H9J A;  1P2F A;  2MLG A;  3QYE A;  5DUK A;  5BNG A;  4OIN F;  4GRI A;  4BEH B;  4DJA A;  3JTG A;  2K02 A;  3W2A A;  4EJT A;  1QA6 A;  1ETO A;  2LMD A;  4E7Z A;  2YX7 A;  4YII A;  1MDM A;  3K69 A;  4EM1 A;  1MIJ A;  4RAY A;  3F22 A;  2R5Z A;  1ZG3 A;  3GWZ A;  2G0E A;  3MCZ A;  3IV5 A;  2Y0S A;  4WX9 A;  4E7I A;  2JA5 J;  2R7Z J;  2X0L A;  4PZJ A;  1FOW A;  3SJM A;  2WTE A;  5BS6 A;  1T38 A;  4RA2 A;  5D5V B;  1TL8 A;  4F3Q A;  1JKO C;  3HKZ A;  5FLX K;  2V9P A;  1ETV A;  2YU9 J;  5IT9 K;  2P5K A;  4HX4 A;  1ZLK A;  3M7G A;  3K1N A;  2K9S A;  3HM5 A;  1ON1 A;  3HRM A;  1TT5 B;  1MSE C;  2GIZ A;  3JRH A;  2CQQ A;  2NVT J;  2OBP A;  3WG7 H;  3S1N J;  4RM3 A;  5E8I A;  2BVM A;  5J4V A;  2CO5 A;  3BJA A;  4Z2Y A;  3IAM 2;  5JR3 A;  4V2G A;  4DW6 A;  3H5N A;  5E20 A;  4QTR A;  3E6B A;  4B4C A;  1YFH A;  3DP7 A;  2RNJ A;  3BDD A;  4EEF G;  3TO7 A;  2YX4 A;  4PSX A;  5DCM B;  3TKY A;  1Z6T A;  3TDU C;  1S72 I;  3R0J A;  3TBI A;  5JLX A;  2HKO A;  2V9V A;  3E97 A;  1QQI A;  3O2P E;  1TWA J;  3PNY A;  1OYW A;  4BY7 J;  2HVR A;  3F72 A;  1KU9 A;  3F21 A;  3HSE A;  4M3D A;  4J01 A;  4A3C J;  3C2G A;  3LSH A;  2VBX A;  5FFZ A;  1R6R A;  3CC4 I;  4M73 A;  3OV8 A;  2X6Y A;  3S93 A;  1W1W E;  1WWX A;  3ECO A;  3KEO A;  4LG3 A;  4A0X A;  3BT9 A;  1ODD A;  4XSX F;  4MHG A;  3S3N A;  2VKD A;  3H3V K;  5DDG A;  3QPH A;  4IHS A;  3CCR I;  3WU1 B;  2FML A;  4G6T B;  3BP8 A;  1XGO A;  4XID A;  2JSC A;  4UV8 A;  2ISZ A;  4L9N A;  3NEU A;  5DEQ A;  4CCM A;  2VON A;  3LQR A;  2N8G A;  2V1U A;  3KIO A;  3DU6 A;  4W97 A;  4G7H F;  1QZE A;  2KT0 A;  4P9F A;  4RS8 A;  3BOQ A;  2IXS A;  3TO6 A;  2QUF A;  4A3K J;  2JQ7 A;  1TNS A;  1HKS A;  2O03 A;  4XN0 A;  2FXA A;  3HHH A;  1OR7 C;  2PMZ A;  2LSO A;  2RGV A;  5FD6 A;  3IP4 B;  2KDO A;  1LUJ B;  4BY1 J;  1IRZ A;  3LA2 A;  3BQZ A;  3HSF A;  1YO5 C;  1SD4 A;  1ZR4 A;  2W48 A;  3OMY A;  3CCU I;  3HJE A;  1WJD A;  4UUV A;  4YFN F;  1JUS A;  3CLQ A;  3SDB A;  2BYV E;  2K4B A;  5K5O A;  3HTU A;  5CLS A;  3ZN1 A;  5ICC A;  2KIF A;  2JSP A;  1WJB A;  1BC7 C;  3ZXS A;  2TRT A;  5DCF A;  3N4M A;  1FOK A;  5E1X A;  1J0R A;  5EF6 A;  4XBF A;  5J1U A;  4BQQ A;  3IH2 A;  3BR2 A;  1IV8 A;  4FE4 A;  2M87 A;  2KJB A;  5HS9 A;  4ZDL A;  4E7H A;  3S1Q J;  5DV5 A;  3LL7 A;  3JRE A;  2V26 A;  3CUO A;  2DA4 A;  2FSW A;  1VQ4 I;  4U88 A;  1G3T A;  3RDI A;  2QZ8 A;  2EFN A;  3GFI A;  3HOT A;  3BR6 A;  3KP5 A;  4CA0 A;  1IO2 A;  4LLG F;  1YIO A;  3RKX A;  3PIP F;  1KGS A;  4BS9 A;  1FYL A;  1TC3 C;  2ESH A;  2IA1 A;  2KQR A;  5GTH C;  4Y33 A;  1AKH B;  3VYT B;  1PDN C;  3FX3 A;  2CW8 A;  4G7O F;  2VKE A;  4JX4 A;  1HW2 A;  3DV8 A;  3OIQ A;  4JP0 A;  2LF8 A;  2MGQ A;  4ZDP A;  5JI6 A;  3I9V 2;  4N9I A;  1LVK A;  1NK3 P;  1ONV A;  3HOY J;  1MNE A;  2ACJ A;  1PUF B;  3MVP A;  3BR0 A;  2GAU A;  3FM3 A;  3MZY A;  3HHG A;  3TL4 X;  4PJL A;  1YQA A;  3VEP A;  1ETY A;  3RYR A;  1F9N A;  4J00 A;  4G6Q A;  3ZQF A;  4RLQ A;  1F36 A;  3AG3 H;  5F27 A;  3ABM H;  4CSW A;  2DAO A;  1B9M A;  3GFM A;  1W7P D;  2A6E F;  4FHT A;  5M5W J;  4RB0 A;  4HDU A;  4IF4 A;  1Q1V A;  2AQE A;  3PIO F;  4PDK A;  2VJI A;  2LKS A;  2NNN A;  4FX0 A;  4IX7 A;  4BAC A;  4ZYH A;  3ZRG A;  4WK8 F;  4A69 C;  1ZG1 A;  2H1L A;  1O4X A;  1U9O A;  3RPQ A;  2DBB A;  2EFO A;  1O3R A;  3BRO A;  3BC8 A;  2EFP A;  2XDV A;  5D8K B;  5K7Z A;  1A6Q A;  2LP0 A;  3QPS A;  2QCO A;  2Q8K A;  1YE9 A;  2F5E A;  3GLL A;  4M71 A;  1KU3 A;  1TT0 A;  1Z1D A;  2F2E A;  4FCY A;  2HEO A;  4HNU A;  3L1P A;  3MQ0 A;  2ESN A;  3CF2 A;  3LQQ A;  3HOZ J;  2FEZ A;  3W6J B;  5JFR A;  3H36 A;  3RPU D;  5M5X J;  5FFX A;  3TGN A;  1TBX A;  2IGN A;  2ZJP F;  3CCE I;  3OS1 A;  3LA7 A;  1DQU A;  2QKM B;  3MKL A;  2HQN A;  1QZY A;  3FXM A;  1D0Z A;  3ABT A;  4N4O B;  1LFP A;  2RC4 A;  4XKW A;  1A04 A;  3BG6 A;  3EUA A;  5KNL A;  2XRN A;  5GP9 A;  4BE1 A;  2CU7 A;  5JVT A;  2FUG 2;  2JA6 J;  3NAU A;  1USS A;  5F0H A;  5BPD A;  5J8C A;  3FXK A;  4BQN A;  3JAM Z;  4X6A J;  3A0H C;  3QOD A;  3MKY B;  1LFB A;  5LGU A;  2DU9 A;  2HVQ A;  3ULQ B;  1GUU A;  1B4A A;  2EIN H;  2JUG A;  2Z3Y A;  2XAH A;  5D4S A;  1OFC X;  3GO5 A;  5CJ9 A;  3ISP A;  2PJR B;  4Q47 A;  4II3 A;  5D6F A;  4LIV A;  2XGD A;  4XQF A;  1ZGW A;  1D1A A;  1RUN A;  3I71 A;  3GX4 X;  1HCR A;  1REP C;  1FYK A;  1I1S A;  4I99 C;  3JSO A;  1OKR A;  1LDK B;  3F6O A;  3AAF A;  4WCG A;  2LR8 A;  4DZP A;  5EG0 A;  4LG0 B;  2VC0 A;  1N78 A;  3E7L A;  4IVN A;  3PNT A;  1HOM A;  2K86 A;  3BTJ A;  3ZCO A;  4P9U A;  2YSR A;  4MGR A;  1CF7 B;  4MLO A;  2GQQ A;  2LG4 A;  3ZQC A;  4ZTJ A;  1R22 A;  1VND A;  1YS6 A;  2Z99 A;  1RPW A;  3K4N A;  1J59 A;  3SFZ A;  4DYC A;  2K7L A;  1BR2 A;  5EJC A;  3F8B A;  2M5W A;  5J1Y A;  2QSH X;  2XC7 A;  2Y48 A;  3PUB A;  1LDJ A;  3PSI A;  1HA8 A;  2JVG A;  1X58 A;  2W82 A;  2A6H F;  2UXX A;  3JR9 A;  1EA3 A;  2HQA A;  3H3Z A;  4OWR B;  1IN8 A;  2M1B A;  1W5T A;  3VFZ A;  3PJR A;  3K4J A;  3I58 A;  3P9I A;  1X1A A;  4NQW A;  4OIR F;  3Q3S A;  4A5M A;  2A5Y B;  1RZ4 A;  5FLM J;  1R4M B;  2FD5 A;  2IGO A;  3F6V A;  1P9Q C;  1NG7 A;  3S3M A;  2BBY A;  2CS3 A;  3WGG A;  2P7V B;  4MIM A;  3DKX A;  5ILU A;  4A12 A;  1AA7 A;  4V2F A;  1WHU A;  2LFB A;  1OR7 A;  2FOW A;  3ZMZ A;  4CUG A;  1FMV A;  4BHP A;  1A35 A;  1P4X A;  1X2M A;  3FXU A;  3TP0 A;  2OTJ I;  1ZH5 A;  2QYO A;  4QWQ A;  1O7F A;  1LVA A;  2EIK H;  3F3X A;  2BVL A;  2LBF B;  5FKL A;  5J4Y A;  4UUS A;  2GOM A;  1Z21 A;  2ADU A;  1R71 A;  5F64 A;  4OMY A;  5CVI A;  2XGE A;  4BQA A;  1DU6 A;  2RNG A;  4PFP A;  3WU0 A;  5F0C A;  1RIO H;  1JUP A;  1R58 A;  1QHH D;  2FNP A;  2NOJ B;  3V4G A;  3SHF A;  5D5W B;  3P9C A;  4RB3 C;  2DOA A;  4GCV A;  1YX5 A;  2JK3 A;  3BZC A;  1U5T A;  3I0T A;  2L3D A;  4D9J A;  1D3Y A;  2CV1 A;  3MEX A;  2O8X A;  1T95 A;  1YW7 A;  3FHZ A;  4HF0 A;  3HOS A;  4L9T A;  1JKP C;  4EGZ A;  1BI0 A;  2Y9Y A;  2KIU A;  2R5Y B;  2QLZ A;  3R61 A;  4A6E A;  4HPQ A;  2DA1 A;  1IN6 A;  2DLL A;  4M3G A;  3F9K A;  4I0A A;  2KMU A;  2I10 A;  2P4W A;  1LPQ A;  3QAH A;  1B6A A;  2XGC A;  5IOY A;  2UUZ A;  1VQ8 I;  3FXJ A;  4HW0 A;  4N9H A;  4RB1 A;  3ZMT A;  2XIG A;  2CG4 A;  2ZC2 A;  1KA8 A;  3RPU A;  2LD5 A;  2DO7 A;  4QLC U;  5EZG A;  2BW3 B;  4IQJ A;  2KIQ A;  1WJE A;  4ON0 A;  4N4N B;  4JBA A;  1SVM A;  3MD2 A;  1X1P A;  4EAT A;  2DJI A;  5E3O A;  4CGZ A;  1XMK A;  2OZ6 A;  2QWW A;  2ZNY A;  4WXD A;  4CH7 A;  3MMY B;  2G7H A;  3QPT A;  3H0D A;  2RAE A;  2Y69 H;  3JSP A;  2OD5 A;  2ETH A;  2Q0O A;  4LB5 A;  4YFK F;  4BJ6 C;  1OIS A;  2HWV A;  3DEW A;  3B73 A;  5LRR A;  2DTR A;  2F5C A;  1IN5 A;  5D5U B;  4MQV A;  4B3X A;  3OOU A;  5F1J A;  3BPX A;  2QBY A;  2ZCW A;  1GLN A;  2RN7 A;  3GUD A;  5E17 F;  4UVB A;  4EMS A;  4PK4 A;  1BIA A;  1DPR A;  4G7Z F;  4BEH A;  4DQ2 A;  3DQV C;  3EQL F;  5LHG A;  3H5R A;  1LJ9 A;  2M0M A;  1OQY A;  2LRE A;  4GYG A;  1QPI A;  3OL3 A;  4RAF A;  3CC7 I;  4RDU A;  3L2R A;  1H9T A;  3O3K A;  1IV6 A;  1IGN A;  3DFG A;  2XPW A;  5FLV A;  3F23 A;  4AIJ A;  3E5X A;  1AOY A;  2XPU A;  2GA1 A;  1BIB A;  4FT8 A;  3SZG A;  1NH3 A;  1MMG A;  4V19 K;  4MTD A;  2HYJ A;  4XR6 A;  2G9W A;  3IRR A;  2F5D A;  2XRO A;  4OIO F;  1B9N A;  1SD6 A;  1IN4 A;  2I8D A;  3RSN A;  1ZRD A;  1SFE A;  3OSG A;  3S2W A;  3X2Q H;  1ORK A;  1BL0 A;  1YOV B;  2RRE A;  1C0W A;  1F1Z A;  2FQ3 A;  4H4K C;  1JHF A;  3A0B C;  3JRD A;  2EBI A;  5E1W A;  1OCZ H;  4GDF A;  2DDB A;  2KIS A;  2KZV A;  5FJ8 J;  4A3E J;  3ZMV A;  5DCM A;  3P9K A;  4M6V A;  1MNM C;  1KZH A;  2BHZ A;  3U2R A;  2EFW A;  4A0Y A;  1UJ8 A;  2DW4 A;  2E19 A;  5GAG J;  3G3Z A;  3DPT A;  4LFU A;  1FP1 D;  1MH4 A;  2A6T A;  1FOX A;  1WJ5 A;  4EVI A;  4F91 B;  5GPA A;  2R7O A;  3BR5 A;  1VTN C;  2KIM A;  1R1V A;  1ZAR A;  2QEX I;  2R7U A;  3U21 A;  4CHU A;  3S2H J;  3A01 B;  1CGP A;  3VOE A;  5IY5 H;  1PJR A;  4MTE A;  5ERI A;  3ZGK A;  2PJP A;  2M9H A;  3TDZ C;  2VKV A;  4L5E A;  5DD8 A;  3ERE D;  2O5R A;  3S15 J;  5DM6 F;  1YRN B;  3HL2 A;  2DOD A;  2JUC A;  1O57 A;  5EEH A;  4ZZD A;  2O61 A;  3ZPL A;  1TTY A;  2VQL A;  4KIB A;  5B3S H;  1Z77 A;  4O5V A;  5HOO A;  3DPL C;  2OU2 A;  1QGP A;  4L0Z B;  2XF7 A;  4R8H A;  3UR3 C;  1FPQ A;  4M9X A;  2EJR A;  3HGY A;  4GO1 A;  3SXY A;  2VJ4 A;  3NQO A;  9ANT A;  2V6C A;  1GHC A;  1TQI A;  1IAW A;  4IL6 C;  2XAQ A;  1U6G A;  3E1S A;  5F6F A;  2MC4 A;  2PEX A;  2K5C A;  3CF5 F;  4IHX A;  2DN0 A;  5L3B A;  1JXS A;  2H94 A;  4KIF A;  4XK4 A;  4OAZ A;  4EJO A;  5TGT A;  1R5G A;  1IUY A;  3TMO A;  2B0L A;  2M34 A;  3NAR A;  4A0Z A;  2JZY A;  3CDI A;  1BN5 A;  3K4L A;  2NVX J;  1TP4 A;  1VQP I;  3ABK H;  1Y39 A;  2HXO A;  3BCA A;  3I54 A;  1T0F C;  2O0Y A;  3DLA A;  3LSR A;  4BHB A;  3FZV A;  5EEA A;  2HS5 A;  1T33 A;  1KQ0 A;  3K4K A;  1YYV A;  2ZSH B;  2YR2 A;  3OWT A;  3ZMS A;  2Y30 A;  1IRX A;  2LK2 A;  5B1B H;  3ZN0 A;  1P7J A;  2DT5 A;  1AKH A;  3BZ6 A;  2WB1 N;  4BHC A;  5EEG A;  2DMT A;  2JPB A;  2MA3 A;  1FX7 A;  3QP6 A;  3EET A;  3PQK A;  2VOD A;  2DMP A;  3DU5 A;  2VN2 A;  3Q9S A;  2HQ5 A;  4HX8 A;  5DTD A;  1K4T A;  2L7M P;  1XSX A;  3OYD A;  1T2K A;  3E6C C;  1Y1V J;  1Y8R B;  1ZYR F;  2F4M B;  4KYW A;  2EV6 A;  3JRG A;  1XSD A;  2FOK A;  4L18 B;  4AYB N;  1X4P A;  4M9Z A;  2O9L A;  5ICG A;  2NS8 A;  3BTC A;  2BHY A;  3REO A;  4FTH A;  1FMW A;  5FLX Z;  1MMD A;  2OF7 A;  2VE8 A;  3IWZ A;  2D45 A;  4ZDO A;  5IPA A;  1QHG A;  4S04 A;  4XKC A;  5IT9 Z;  1EH8 A;  3V7S A;  2EZH A;  1SAN A;  5H20 A;  4KA4 A;  1SEU A;  2HI3 A;  2UXN A;  2W1O A;  3B6A A;  2CV2 A;  4HV6 A;  2DA7 A;  1E2X A;  3VOD A;  2KKO A;  5CVV A;  5E3N A;  3LMM A;  2HR3 A;  2L9R A;  4KIS A;  2KLO A;  5E1Z B;  2PFB A;  2WAD A;  2L4M A;  3BPV A;  4CCO A;  1MZB A;  2DFI A;  2F6C A;  2TDX A;  4ZYA A;  4O3M A;  1MBK A;  3ABL H;  3Q0U A;  3S32 A;  1ZGA A;  1I6X A;  1OMI A;  1W36 C;  2F5F A;  3J7A Y;  1I27 A;  3CCJ I;  1R9T J;  1JJ8 C;  1TQM A;  1L0O C;  1VI0 A;  1EKE A;  2WAQ A;  2XB5 A;  2P5V A;  2NVY J;  5M5Y J;  2OAZ A;  4U7D A;  1I3A A;  1J7K A;  2ZXJ A;  4D5F A;  5JVG F;  1QNT A;  4G9Y A;  1K6O A;  2EZI A;  1VQO I;  3CC2 I;  1S7E A;  3HGG A;  3B6C A;  1P4W A;  3ZP5 A;  1Z9C A;  2NAZ A;  1OLT A;  3LNQ A;  3VSK A;  4RB2 C;  3T8R A;  2BZT A;  1IRG A;  5F1R A;  1FT9 A;  4S0H B;  4PGG A;  1HF0 A;  4KT5 C;  1W36 D;  2X6O A;  5DYM A;  1MD0 A;  2PJR A;  2OCE A;  1LKX A;  1RI7 A;  4CCJ A;  1PP7 U;  3V42 A;  4ENM A;  1T8I A;  4P1W A;  5B1A H;  1ZR2 A;  1I39 A;  1VQM I;  1LEB A;  1ON2 A;  2L7F P;  4ZJZ A;  5C4J J;  4LG0 A;  2WV0 A;  2VQG A;  3D5R C;  4PGH A;  3OL4 A;  4N0B A;  5EZH A;  3FK6 A;  4OAY A;  1DUX C;  5D4R A;  3HB9 A;  5KK1 A;  1AWC A;  4HX7 A;  3ZQ7 A;  2XGX A;  3FBN B;  3IKV A;  1FWZ A;  2QQ9 A;  2BV6 A;  3KYL A;  1XC5 A;  2QVO A;  3V7C A;  1P6R A;  1JTY A;  1Y0U A;  1UG0 A;  2K9Q A;  4OIQ F;  4RGS A;  2AXT C;  3ONQ A;  1W5C C;  2V9K A;  2L01 A;  4I0B A;  4U0Y A;  2E1M C;  3ZQH A;  4XON A;  1DU0 A;  3QU6 A;  2OUM A;  3K4B A;  5L3G A;  5EDN A;  5K7F A;  4DGW B;  2VLA A;  1G3Y A;  4HEA 2;  4YFX F;  2M30 A;  5FKM A;  3S14 J;  1VFC A;  3AG4 H;  1S6L A;  1IZ1 A;  2F4O B;  1F5T A;  2Y2Z A;  2Y0S N;  3OYG A;  2DFH A;  3MZH A;  3G73 A;  2OTL I;  2CWE A;  4I6Z A;  4QPO A;  5K5R A;  4Q4Z F;  2E1C A;  3HKZ N;  1FP2 A;  1YTY A;  2AS5 F;  4I2O A;  3S1M J;  1SFK A;  2E36 A;  4BU2 A;  1SFX A;  1B1B A;  3QYB A;  2EB7 A;  5CPR B;  4ZYG A;  4A3L J;  3S2D J;  1STZ A;  5KVR A;  3P5J A;  1ZK8 A;  1I6H J;  4AIH A;  2EA4 A;  3K10 A;  1DDN A;  2LBF A;  2MYS A;  1MH3 A;  1VQ7 I;  3HXL A;  2W7N A;  2CQ7 A;  1ZQ3 P;  4M74 A;  2HYF A;  3CJN A;  4HSR A;  1WCM J;  1A6I A;  1R5I D;  4BJ5 C;  4XN3 A;  2ELJ A;  1TNT A;  3G1L A;  1XDU A;  3AFH A;  4HA8 A;  4LGW A;  4LIT A;  3G1O A;  2LOO A;  3CCY A;  3M8F A;  2H1K A;  1TQP A;  2OZU A;  2XSJ C;  4AD9 A;  4Z6Y A;  5D8L B;  1HKT A;  2X4H A;  2X9D A;  2JVH A;  1R23 A;  3WGI A;  3JRA A;  1WH7 A;  4TV7 A;  4YEJ A; 
#chains in the Genus database with same CATH homology
 1X2M A;  1OCT C;  1B72 B;  3TP0 A;  1MBE A;  3TP3 A;  4W1U A;  1Y1W J;  4M3F A;  5GPC A;  4X1E A;  2GLO A;  5FKL A;  1NTC A;  4UUS A;  2MSY A;  1AU7 A;  1TWG J;  3LSP A;  1U8B A;  2XGE A;  1B8I B;  1IC8 A;  2D5V A;  2XB0 X;  1DU6 A;  4BKX A;  1QRY A;  5F0C A;  2E2I J;  2KDZ A;  1JUP A;  4MFE A;  5JLW A;  1LE8 B;  1GT0 C;  3TW7 A;  4IHV A;  1W0T A;  1UG2 A;  3FIW A;  2JK3 A;  3JRF A;  3GTJ J;  2DA2 A;  3Q0V A;  1XG1 A;  5C44 J;  2X48 A;  2LVS A;  3I4M J;  4MO7 A;  5FKO A;  4BBR J;  2M8G X;  5IYD J;  3HOX J;  4RBO A;  3GTP J;  1RKW A;  1FTZ A;  3CQZ J;  2EQR A;  3JRC A;  2CQX A;  2ME6 A;  1JKP C;  3HOW J;  2QF7 A;  2Y9Y A;  2EH3 A;  3G1M A;  2R5Y B;  2JA8 J;  2DMU A;  1IDZ A;  2DA1 A;  4JX5 A;  4C3I J;  4M3G A;  3GTO J;  4BXX J;  4G12 A;  2TCT A;  2I10 A;  1ENH A;  2COB A;  4UUS B;  1ZTR A;  2DA3 A;  2NOG A;  2XGC A;  5IOY A;  1FJL A;  3ZQI A;  3M3Y J;  1ETW A;  2WV1 A;  3ZOB A;  4D7N A;  4BBS J;  1OCP A;  3HOU J;  4FIS A;  1E3O C;  3K2A A;  1HLV A;  2LD5 A;  5FKK A;  5EZG A;  4IHW A;  5FKN A;  2HDD A;  1JT6 A;  4XIC A;  1FEX A;  2M2E A;  4IHY A;  2GBY A;  3FIS A;  1JTX A;  2IBD A;  5E3O A;  1IDY A;  1IJW C;  1U9N A;  4B1R A;  2P81 A;  4A3D J;  1MBG A;  1WPK A;  2CUE A;  1TWF J;  4A3M J;  2RAE A;  3MN2 A;  2DJN A;  3DEW A;  1RET A;  2MW8 A;  1CQT A;  1X2N A;  3PM1 A;  2HOA A;  2VPR A;  3OOU A;  4C3J J;  3BR3 A;  5F1J A;  2AO9 A;  5M3F J;  2L7Z A;  2LY9 A;  1BJZ A;  2H8R A;  2YS9 A;  1QPI A;  1G2H A;  2ECB A;  2WAQ N;  4RDU A;  3RZD J;  1IV6 A;  1FIP A;  1IGN A;  5FLV A;  2XPW A;  1A5J A;  3CDL A;  2XSD C;  2JMW A;  2XPU A;  4QSH A;  3C2B A;  3A01 A;  4Y52 J;  1VF9 A;  1W0U A;  1NK2 P;  2HYJ A;  3BG9 A;  3H0G J;  2XPV A;  1P7I A;  4Y7N J;  1YRN A;  4D7M A;  3GTM J;  4I76 A;  3OSG A;  1QVT A;  1ORK A;  1BL0 A;  3IH3 A;  4LOC A;  1K61 A;  2XRL A;  3GTQ J;  3GTL J;  3JRD A;  2EBI A;  3RQI A;  3RZO J;  3QQA A;  5FJ8 J;  5BNG A;  4A3E J;  4M6V A;  1MNM C;  4HNV A;  1TWC J;  1ETO A;  3BG3 A;  2E19 A;  2R5Z A;  1BA5 A;  1MH4 A;  4D5C A;  2G0E A;  3IV5 A;  2R5Y A;  1H8A C;  2JA5 J;  2R7Z J;  1ETK A;  3ZQG A;  3SJM A;  5GPA A;  4XRS G;  3BR5 A;  3WHB A;  1JKO C;  1POG A;  2NVQ J;  1ETV A;  2R93 J;  5F08 A;  2YU9 J;  3S2H J;  3A01 B;  1GDT A;  3S16 J;  2O8K A;  2K9S A;  2M9H A;  3HM5 A;  1OJL A;  1MSE C;  4AC0 A;  2VKV A;  4L5E A;  2CQQ A;  5F04 A;  2DMQ A;  5IP9 J;  3JRH A;  2HOS A;  2NVT J;  3S15 J;  1YRN B;  3S1N J;  4A93 J;  3HOV J;  4V2G A;  4DW6 A;  4QTR A;  1Z77 A;  3M4O J;  4B4C A;  3LSG A;  3LSJ A;  2PMZ N;  4EEF G;  2R0Q C;  5IP6 A;  3TED A;  4A3F J;  3W6V A;  3TW6 A;  2O7O A;  5JLX A;  4BY7 J;  1TWA J;  2R5Z B;  3HGY A;  3BR1 A;  3BTL A;  4A3C J;  4M3D A;  3QPL A;  9ANT A;  2NS7 A;  2DA6 A;  5J3L A;  1K83 J;  1ETX A;  2CUF A;  1H88 C;  3BG5 A;  2EZL A;  5K7H A;  3BT9 A;  1UMQ A;  2DN0 A;  4IHX A;  1RKT A;  4B3A A;  1MBH A;  3H3V K;  2IAI A;  1H89 C;  4XK4 A;  1Z0X A;  3JRB A;  3S17 J;  4IEJ A;  4XID A;  3DCF A;  2M34 A;  3VPR A;  3NAR A;  2EZK A;  4DZJ A;  2NVX J;  1APL C;  4XRS A;  3FK7 A;  5F0F A;  2N8G A;  4W97 A;  2HXO A;  2VI6 A;  2KT0 A;  1I50 J;  1JGG A;  3LSR A;  4J19 A;  4A3K J;  5EEA A;  1T33 A;  5J1R A;  2HOT A;  3I4N J;  2Y30 A;  1MBF A;  1JUM A;  1QVU A;  2LK2 A;  1P7J A;  1AKH A;  1IUF A;  4BY1 J;  1IRZ A;  2WB1 N;  3IH4 A;  3BQZ A;  2DMT A;  1U78 A;  1ZR4 A;  4A3G J;  2YUS A;  2W48 A;  3K7A J;  5IYC J;  2DMP A;  2HQ5 A;  5DTD A;  2L7M P;  1JUS A;  1JJ6 C;  1Y1V J;  1T56 A;  2TRT A;  4C3H J;  1HDP A;  3O8G A;  1ITY A;  3JRG A;  2LTP A;  5EF6 A;  5J1U A;  4AYB N;  1GV5 A;  3IH2 A;  1GV2 A;  3BR2 A;  2O9L A;  2NS8 A;  4FE4 A;  3BTC A;  4DYQ A;  4FTH A;  2FX0 A;  2MG4 A;  2OF7 A;  4C2M J;  3S1Q J;  5IPA A;  3GTG J;  3JRE A;  2EZH A;  1SAN A;  2DA4 A;  2HXI A;  2GM4 A;  2HI3 A;  4CYC A;  3B6A A;  3BR6 A;  2DA7 A;  4A3J J;  3PO2 J;  1TC3 C;  5E3N A;  1AKH B;  2L9R A;  2ELK A;  2ID6 A;  2E2H J;  2VKE A;  4JX4 A;  2B63 J;  5EG0 B;  4JP0 A;  2MGQ A;  2ZB9 A;  4JX6 A;  1NK3 P;  1UHS A;  1FTT A;  3HOY J;  1PUF B;  3MVP A;  3S1R J;  3BR0 A;  1MBK A;  2ECC A;  4QIW N;  3Q0U A;  1TWH J;  1ZKG A;  3D1N I;  1ETY A;  1R9T J;  1JJ8 C;  3ZQF A;  1F36 A;  1VI0 A;  1LFU P;  2XB5 A;  2NVY J;  5F27 A;  5E3L A;  5M5Y J;  1JKQ C;  5M5W J;  1RES A;  4UUT A;  4D5F A;  1Q1V A;  2JWT A;  4XRM A;  2EZI A;  3GBG A;  1S7E A;  3HGG A;  4CYC B;  3B6C A;  3Q0W A;  4A3B J;  1EF4 A;  4A69 C;  3LNQ A;  1O4X A;  1U9O A;  2FJ1 A;  3A03 A;  4S0H B;  2E1O A;  1JKR C;  1HF0 A;  2JJ7 A;  5K7Z A;  2LP0 A;  3WHC A;  1WGX A;  2QCO A;  2X6O A;  3QPS A;  5IP7 J;  4FCY A;  3L1P A;  1JT0 A;  1AHD P;  3OIO A;  1F43 A;  1D5Y A;  3HOZ J;  5M5X J;  1WI3 A;  4FE7 A;  2R92 J;  1ZR2 A;  3JRI A;  2ID3 A;  3UKG A;  3FKI J;  2L7F P;  2CJJ A;  5IOZ A;  5C4J J;  3MKL A;  1XS9 A;  2LKX A;  5IYB J;  5EZH A;  2K9N A;  3FK6 A;  2CRG A;  3CMY A;  3HB9 A;  5GP9 A;  2CU7 A;  2JA6 J;  1HDD C;  1MBJ A;  3NAU A;  5F0H A;  2IEK A;  4X6A J;  3BTI A;  5HOD A;  1XC5 A;  4ABZ A;  1LFB A;  4A3I J;  3HBL A;  1JTY A;  1GUU A;  4M3E A;  2K9Q A;  3LOC A;  1FIA A;  3PO3 J;  5EYR A;  1OFC X;  2E2J J;  2VUM J;  2XGD A;  3ZQL A;  3HDD A;  1ZGW A;  3O8H A;  3ZQH A;  1HCR A;  2OPT A;  1DU0 A;  1WH5 A;  4M3B A;  1SFO J;  5EDN A;  3BQY A;  2LR8 A;  5K7F A;  4DZP A;  5EG0 A;  4GFB A;  3E7L A;  1BW6 A;  4DYR A;  1HOM A;  1IG7 A;  1PUF A;  2Y9Z A;  3HEF A;  3BTJ A;  5EGO A;  5FKM A;  3GTK J;  5DS9 A;  4MLO A;  2JN6 A;  3S14 J;  3ZQC A;  1VFC A;  1VND A;  2Y2Z A;  5M3M J;  2Y0S N;  2FQ4 A;  1BW5 A;  5C4X J;  3SFI A;  1RPW A;  4I6Z A;  3OSF A;  2K40 A;  3HKZ N;  2L0K A;  3S1M J;  2AHQ A;  4DYC A;  1B72 A;  5E3M A;  3F0C A;  2Y31 A;  2DTZ A;  5C3E J;  5J1Y A;  3SDG A;  4A3L J;  3S2D J;  4NDL A;  1X58 A;  2JA7 J;  1ZK8 A;  1I6H J;  4MFD A;  3JR9 A;  1MSF C;  1GVD A;  1ETQ A;  1MH3 A;  3RKQ A;  1I3Q J;  2M0C A;  1ZQ3 P;  1WCM J;  1A6I A;  4JYK A;  2DMN A;  2LLK A;  3Q3S A;  3A02 A;  1B8I A;  3G1L A;  2ME0 A;  5FLM J;  2FD5 A;  5EGO B;  3G1O A;  3CCY A;  4AUX A;  1LE8 A;  2H1K A;  4MIM A;  1RR7 A;  4V2F A;  2LFB A;  2DA5 A;  2X9D A;  3JRA A;  1WH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...