1GV5A

Crystal structure of c-myb r2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Crystal Structure of C-Myb DNA-Binding Domain: Specific Na+ Binding and Correlation with NMR Structure
rcsb
total genus 16
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1gv5A00
3RZOJ 3S1MJ 4A3IJ 3BQYA 4BY1J 4MFDA 4XRMA 2QF7A 1ENHA 4DYCA 5K7HA 3PO3J 5F1JA 1B8IB 2D5VA 1RPWA 2CJJA 1O4XA 1B72B 1JUMA 2H1KA 4C3HJ 2FD5A 4ABZA 5F0CA 3QPSA 1BW5A 3TP0A 1JJ8C 3IH3A 2CU7A 4XRSG 5IYBJ 4FISA 1JGGA 1A6IA 4IEJA 1Y1WJ 4CYCA 4A3FJ 3NARA 3HOXJ 2JMWA 4C3JJ 1TWHJ 2MW8A 3HEFA 2AHQA 2XB0X 1QVTA 3QPLA 1ZR4A 1XS9A 3GTJJ 1D5YA 1QVUA 3K7AJ 1S7EA 4BBRJ 3JRFA 2K9SA 3PO2J 2YUSA 1SFOJ 2HXIA 3C2BA 1ETQA 4DW6A 2R5YB 3FK6A 4D7NA 3JRAA 1GT0C 2CRGA 5J1UA 4BBSJ 2O9LA 2OPTA 1R9TJ 2E2HJ 3WHBA 4DYQA 1JTYA 2GLOA 1ETOA 4NDLA 3HOZJ 2DMUA 1TWAJ 2JA7J 3I4MJ 3S1NJ 3GBGA 1JJ6C 1JT6A 2R92J 2IAIA 4D5FA 5DTDA 3S15J 1P7JA 1YRNA 3UKGA 1WI3A 1WPKA 3BR0A 3ZQLA 3IH4A 2I10A 3JREA 1MH4A 4MIMA 3GTQJ 4XIDA 5M5YJ 3G1LA 2DMPA 5IP9J 4A3BJ 1RKWA 1VF9A 1JKOC 1IV6A 1DU0A 5HODA 3GTPJ 1ZKGA 3BR1A 2VPRA 4IHWA 4W97A 2ECBA 5C3EJ 2E2IJ 2L7ZA 2R5ZB 3BTCA 1AU7A 3ZQHA 5GPCA 1MH3A 2E1OA 5E3MA 2E19A 3RKQA 2TRTA 4L5EA 3FKIJ 5EG0A 1Q1VA 3OSGA 2K9QA 1MBFA 1JT0A 2EH3A 1XC5A 1SANA 1IGNA 1LE8A 4FE4A 3MKLA 4I76A 3JRCA 3GTKJ 1VNDA 5C44J 4AYBN 1NK2P 3M3YJ 3BT9A 3HOYJ 5IP6A 4Y52J 2LLKA 1PUFB 2L0KA 2ZB9A 4IHVA 2VKEA 2EZIA 5FKKA 5M5XJ 3JRBA 1OCPA 3ZQFA 1LFUP 3GTMJ 3SJMA 3A01A 1MNMC 2DMNA 1TC3C 4Y7NJ 4M3FA 5EYRA 1MBKA 3S1RJ 3JRIA 1HLVA 4UUSA 3BG9A 3HOWJ 2FQ4A 1ORKA 5FKMA 4MLOA 2LK2A 4DZJA 1RETA 4JYKA 3S2HJ 3W6VA 4M3DA 2XPUA 5EGOA 4JX4A 4IHXA 4RDUA 2XSDC 1HCRA 2JN6A 2ELKA 2DTZA 2HQ5A 3BTJA 4I6ZA 4UUTA 2XPWA 1WH5A 1OFCX 2NS8A 4JX5A 2XGDA 4AUXA 4DZPA 1BL0A 2GM4A 5E3OA 5M5WJ 2NVYJ 5F04A 4DYRA 2DN0A 2O7OA 5E3LA 2FJ1A 2H8RA 1ZR2A 1U9OA 1IDYA 1FEXA 3LSJA 2L7MP 3HGGA 3FIWA 3OIOA 1JKPC 1Y1VJ 2VI6A 4A3MJ 2IBDA 2DA5A 5EZHA 2R0QC 2MG4A 1LFBA 3VPRA 3A03A 1ETXA 1MSEC 5IYDJ 1RKTA 2ID3A 2KT0A 1WCMJ 2ME0A 1F36A 3H0GJ 2X9DA 4JP0A 2HOAA 4X1EA 3GTLJ 1IG7A 3HOVJ 2XGCA 1Z77A 1GV5A 2M2EA 1GUUA 5J1RA 2EBIA 2MGQA 5J3LA 4D5CA 2LD5A 2CUEA 2L9RA 3HM5A 4W1UA 1ZGWA 3S2DJ 1T33A 2O8KA 3O8GA 3PM1A 3Q0VA 2XRLA 2VUMJ 1MBGA 1OJLA 3I4NJ 5JLXA 1UHSA 2IEKA 5IOYA 1AKHA 4A3KJ 3DCFA 1P7IA 1WGXA 2ECCA 2Y9YA 3BTIA 1K83J 2CUFA 1FTZA 4CYCB 2HXOA 1UG2A 5C4JJ 4HNVA 3BR5A 2YU9J 2EQRA 4JX6A 3B6CA 4J19A 3BG3A 3F0CA 3RZDJ 1EF4A 2LTPA 4MFEA 5FLVA 2WB1N 4V2GA 4A3LJ 2VKVA 3BR3A 5J1YA 2YS9A 4LOCA 1BW6A 3IH2A 3JRHA 3WHCA 2Y9ZA 2LY9A 2ME6A 4A3JJ 2X6OA 2CQQA 1TWGJ 1Z0XA 3IV5A 2HOTA 1IJWC 1JUPA 1FIPA 3ZOBA 2JWTA 3NAUA 3LNQA 2MSYA 5E3NA 4XICA 1B8IA 2DA1A 2M34A 2R93J 4BXXJ 2Y30A 2DA2A 1B72A 5C4XJ 4BY7J 3HB9A 4IHYA 3Q0UA 5GPAA 1JKQC 3GTGJ 2Y2ZA 1YRNB 3LSGA 4B1RA 1F43A 2DMTA 4RBOA 3D1NI 2E2JJ 2DA6A 2LR8A 3LSPA 4D7MA 4B3AA 5K7FA 1IRZA 3A02A 3HOUJ 2QCOA 2WV1A 2HDDA 5EF6A 2HOSA 3H3VK 4XRSA 1QPIA 4M6VA 5JLWA 3ZQIA 1X2MA 1JKRC 2M9HA 3CMYA 3Q0WA 4GFBA 5EZGA 1MBHA 2XB5A 1APLC 4QIWN 2JK3A 3TW7A 4G12A 5K7ZA 1MBJA 1U9NA 5EG0B 1CQTA 1HDDC 2R5YA 1DU6A 1U78A 1GVDA 2DJNA 1X58A 2NOGA 2X48A 3G1MA 3TP3A 3ZQGA 1HF0A 1LE8B 1ITYA 2GBYA 1I6HJ 2DMQA 5IYCJ 1FIAA 1MSFC 1HDPA 5M3FJ 5F08A 2NS7A 2G0EA 3FISA 3E7LA 2DA4A 5FKLA 2JA5J 1T56A 2EZLA 2LP0A 4A93J 4FTHA 4A69C 2PMZN 2K40A 3A01B 1MBEA 1FJLA 1VI0A 4A3EJ 3S17J 4QSHA 1RESA 2NVQJ 3S14J 3ZQCA 3M4OJ 9ANTA 3O8HA 1ETWA 4UUSB 3GTOJ 2JA8J 2OF7A 3FK7A 2RAEA 5F0HA 1X2NA 2R5ZA 5F0FA 4S0HB 2HI3A 5EDNA 3DEWA 4C2MJ 3OSFA 1HOMA 1IUFA 4M3BA 5EGOB 1U8BA 3LSRA 4A3DJ 2LVSA 4FE7A 2DA7A 3G1OA 4X6AJ 1OCTC 4A3CJ 3OOUA 2LKXA 3MN2A 2Y31A 2Y0SN 2EZKA 1W0UA 2FX0A 5IPAA 2CQXA 3QQAA 1NTCA 3JRDA 4BKXA 1IDZA 4B4CA 1IC8A 1AHDP 3JR9A 1PUFA 2N8GA 5DS9A 1WH7A 5FKNA 5M3MJ 3TEDA 1NK3P 1JUSA 1TWFJ 3BG5A 2L7FP 2NVTJ 1W0TA 4XK4A 5BNGA 3BQZA 3RQIA 2WAQN 3HKZN 1GV2A 2P81A 4V2FA 4M3GA 1I50J 1E3OC 2JJ7A 1ETVA 1H88C 4QTRA 2B63J 1XG1A 3BTLA 1VFCA 3BR6A 4FCYA 2NVXJ 1POGA 3S16J 2XGEA 2KDZA 5IP7J 3TW6A 2ID6A 5IOZA 2TCTA 3CDLA 1UMQA 3BR2A 3LOCA 1JTXA 3CQZJ 2EZHA 2K9NA 2M8GX 1H89C 1RR7A 5EEAA 1K61A 4M3EA 1GDTA 1ETYA 5FJ8J 1AKHB 1G2HA 2DA3A 5F27A 2M0CA 3L1PA 4EEFG 1FTTA 3JRGA 1ZTRA 3SFIA 3S1QJ 2COBA 3HBLA 1ZQ3P 2HYJA 2R7ZJ 3HDDA 1TWCJ 3CCYA 3B6AA 4C3IJ 5FLMJ 2XPVA 5FKOA 3Q3SA 1I3QJ 5GP9A 3K2AA 3SDGA 1ZK8A 4MO7A 1QRYA 1BA5A 1H8AC 3MVPA 1A5JA 1ETKA 1BJZA 3HGYA 4A3GJ 2LFBA 2AO9A 2W48A 4AC0A 2JA6J
chains in the Genus database with same CATH superfamily
1TQMA 5KAIC 5FFZA 4JQFA 4I7HA 3BQYA 5D5XB 4A3IJ 2IS1A 2RQQA 4MFDA 1KU9A 3F9KA 3VWBA 1ENHA 3LAJA 1FP1D 4BUPA 5IT9K 1VQNI 4DQ2A 1C0WA 1MNDA 3OYEA 2P8TA 3Q5FA 1YO5C 4WK8F 1S29A 3KYLA 1A6QA 1R1TA 4XSXF 2Z33A 1RPWA 1DP7P 4CZCA 2F2EA 4PUSA 1S5LC 4F3QA 3BWGA 4CICA 2FA5A 3LSMA 2V1UA 1AWCA 2VJIA 4XRSG 3OYAA 1JGGA 2H09A 2HVSA 3JSOA 1T6SA 3K69A 4CYCA 4P55A 4R8HA 4OIRF 4EV0A 1TZLA 3NWSA 3GLLA 3DTIA 1TWHJ 5HDKA 3G73A 3HEFA 4LLNA 4CZZA 2AHQA 2BZTA 2XB0X 2DDAA 3TOAA 1Y39A 2CH0A 2OCCH 1S8NA 3A0HC 1BR4A 3KLNA 1ZARA 3K4NA 3GTJJ 1D5YA 2G7HA 3K7AJ 5J6XA 4BQAA 4XN0A 1W5TA 3JRFA 2K9SA 3F23A 3PO2J 2YUSA 2HYGD 2M7BA 3C2GA 1R1VA 2IGOA 2STTA 4KMFA 1QGPA 3OMYA 3E97A 3P5JA 4RA2A 2P5LC 3VYUB 3FK6A 1GT0C 2HQRA 1BI0A 2HTSA 4A0YA 3F21A 4BU2A 3L2CA 3LFKA 4BBSJ 3QP5A 3V7RA 2BYVE 2MD0A 3C3WA 2O9LA 1R5GA 4XKCA 3RYRA 3K1PA 3MD2A 4CCJA 2XIGA 4HPQA 3FXQA 2JVHA 2F5DA 2R7UA 5H6RA 2A5WA 1TT0A 2BY3A 4QPQA 2ZNZA 1FSEA 5DTDA 1IZ1A 2A6TA 3K4MA 4BE0A 3K4JA 5L3CA 3UKGA 1H9TA 1WI3A 1WPKA 2DQRA 3EPZA 4MQVA 2Q1ZB 1W7PB 1XTAA 2M45A 4XLFA 2HWVA 2LNBA 1D1BA 4WWCA 3ZXSA 2BV6A 4HYEA 5E18F 4RLQA 3G1LA 2DMPA 2UV1A 1FBSA 2WBMA 3V4GA 1DU0A 3M07A 1VQ7I 3GTPJ 1B1BA 1ZKGA 2ZFUA 2BY1A 2M1BA 2HVQA 4IHWA 2ECBA 2E2IJ 2L7ZA 3HSEA 3WTVC 3ZQHA 2XHKA 2YR2A 4ITVA 3M8EA 3RKQA 2R7RA 1FBUA 1UCRA 1G59A 2CQ7A 4DBQA 1J0RA 5HS9A 1FOYA 5K5QA 4LG3A 4XL9A 2EH3A 3OSGA 5K5RA 1JI8A 2ZFWA 3RTRA 3HOTA 3FKJA 1U6GA 4E7JA 3H1CA 1LE8A 4I76A 1XSDA 2O0YA 3FDYA 3AKZA 1X3ZB 2Q2EB 2KQRA 3L2UA 2EFWA 3D5RC 3M3YJ 4LB5A 3BT9A 4Y52J 4P9UA 4IHVA 2VKEA 5M5XJ 3DF8A 2IPQX 1W4MA 1OCPA 5HVQC 3ZQFA 4EJOA 1LFUP 1BI3A 4HG2A 1G3YA 2E1MB 4E7LA 4NC7A 4E70A 3GYHX 3S1RJ 3BPVA 3JRIA 1E0EA 5HNHA 2QQ8A 5DD4A 3CO7C 2QUFA 3JSPA 4IHSA 1U5TC 5CKTA 4MTEA 3QAHA 2XC7A 1OCOH 3R0AA 4DZJA 3FMRA 3IAS2 2HKXA 4IL6C 4M3DA 5BMZA 2KDOA 5EGOA 4JX4A 2L02A 1IRXA 3DTKA 2CQKA 2ZSHB 1HA8A 3LSHA 4RAFA 4DNCA 3DWLE 1LVAA 4XLNF 4I6ZA 2J5OA 4UUTA 1X3UA 3W3CA 4AIKA 4JX5A 4L9TA 2XGDA 2GM4A 1T8IA 5DCMB 2F6CA 1D1CA 1L0OC 1S72I 3LSJA 3WTTC 2DOAA 2L7MP 1JKPC 2DPUA 3FF5A 3WGHA 1J75A 3ECHA 1GVJA 4L9JA 4DJAA 1VQOI 3H0DA 1Y1VJ 3L9FA 2DA5A 1ZRCA 4XLEA 4NQWA 3H5NA 4M9SA 2R7SA 2IGNA 5HDGA 3FXMA 1RKTA 2DU9A 4YEJA 2HVRA 4AIHA 4YFKF 2FXAA 4N0BA 3KP2A 3T5XA 1GV5A 3BLYA 4B44A 1MGTA 2P7VB 2DXIA 2DW4A 3HM5A 3DFGA 1I39A 5JHUA 4Z6YA 1J59A 4RGSA 3PM1A 4NBQA 4NUBA 2X4HA 2LYCA 3GCMA 3IWZA 1MBGA 3MZHA 1RC9A 1OJLA 1WQ2A 3OR2C 5D4RA 4HV5A 1TW3A 1UHSA 5DEQA 1VQ5I 2IEKA 5J8CA 3C18A 1AKHA 4IKFA 4ZYDA 3QU3A 3N05A 1WGXA 1XGNA 4IJAA 1BC7C 1K83J 3OOPA 3BY6A 1PDNC 2A61A 3E6BA 3LQRA 5C4JJ 4HNVA 2EQRA 1LJ9A 3CJQB 3KZZA 4HDVA 4LG0A 1R58A 3F0CA 3J7AO 1MMDA 1EF4A 1HXDA 2QBYA 4MFEA 1MJBA 5FLVA 2WB1N 2Y0SA 4U88A 4HF2A 3ML6A 5CYVA 3WU1B 2QSHX 3F8MA 1U3EM 3V7SA 1VQ9I 4LOCA 2QKLB 2Y9ZA 2LY9A 5CVRA 1LB2A 4L0YB 2W00A 2TDXA 4UB8C 4XLCA 2OD5A 2L3DA 2ZMEA 1MZBA 2IVMA 3FZVA 3OV8A 1A36A 2CS3A 2EA2A 1SAXA 2ELJA 4RAYA 2RGVA 2WAQA 2DA2A 2YSRA 1IN6A 1BJAA 2DLLA 3Q0UA 1Z6RA 3K1MA 2LRDA 3LSGA 3CDIA 2DMTA 3R61A 1BR1A 1B6AA 4RBOA 1R49A 3D1NI 4PK4A 4NNJA 3LSPA 3CCJI 1P6RA 2EFPA 4D7MA 3I3LA 1P2FA 3KEYA 2I8DA 5HOOA 2F4IA 4CSWA 2WV1A 3W6KB 1WJAA 3T0YA 2HOSA 3H3VK 2L9NA 2CO5A 2Z16A 1FYMA 1QPMA 5LGUA 2VB6A 1RZ4A 3H5AA 2M9HA 5D8KB 1MBHA 1APLC 4G8XA 2FBKA 3CF5F 5K7ZA 1CQTA 1HDDC 1UAAA 4RAGA 2QENA 4ETSA 1GVDA 3G1MA 2QQBA 2KIQA 2GBYA 5D5UB 2DI3A 2DMQA 4ZDPA 2HFHA 5LFAA 5IYCJ 1FIAA 4WX9A 4KUMA 1U0JA 2GXGA 1KU2A 2CW8A 3GWZA 5CVIA 4KT6A 2EILH 1U8RA 1N77A 4L9NA 1N75A 2P4WA 4A93J 3S3MA 2PMZN 4KYWA 2HDWA 1X1CA 1SD6A 5HS8A 1MBEA 5CPRB 2A3SA 4BS9A 4A3EJ 4AVZA 2GIZA 2LY1A 4RAZA 2BHZA 3HSRA 4I99C 2CSOA 3P7NA 1I1GA 1UJ8A 3OS1A 2OF7A 4LB6B 2RAEA 5F0HA 1IN7A 4M6XA 2KIUA 5F0FA 1J09A 2ADUA 3OSFA 3LA3A 2ZNYA 4HNTA 2W4SA 1HOMA 2CFXA 4M3BA 5ERIA 4M9ZA 2JUCA 3DP7A 4HRIA 4X6AJ 3C2HA 1LEBA 3BCBA 2X6YA 3VFZA 4CH7A 1OPCA 3OS0A 4KDPA 2O5RA 1MKMA 3L2VA 1LEAA 1V5EA 3QQAA 3ZMZA 3CMMA 2DK8A 1EA3A 4HSTA 4BKXA 1R4MB 1B4AA 4B4CA 1IC8A 3GZNB 1STZA 3E6DA 3ISPA 3J81Z 2Q0OA 5FKNA 3OYCA 1Z21A 5M3MJ 4L18B 1WJFA 2H1LA 5B66C 2HTJA 2ZXJA 4BYYA 1W0TA 3EYIA 2ICWG 4RGRA 4BXUA 2H8WA 1YX5A 2Z5UA 4BE1A 3DBLB 4V2FA 1E3OC 6PAXA 4XORA 2OTLI 1H0MA 2R7VA 1ERDA 1OYYA 2HQAA 5KVRA 1H88C 1JHFA 2XF7A 1VFCA 3PJRA 3BR6A 4FCYA 2W57A 2X1CA 1POGA 2W84A 4S05A 3TW6A 3S3OA 4ZDLA 3V7CA 1UMQA 3LOCA 2IJLA 3OR1C 2E1NA 3CQZJ 3H5RA 1H89C 3COAC 3S2WA 4LD5A 3P9CA 3JAMZ 5D6FA 2ZSIB 2OZ6A 2ZMEC 5AIPA 2PI0A 4L5IA 3CO6C 2HS5A 4EEFG 4DIQA 4F55A 3SFIA 2ZJRF 3S1QJ 1Y0NA 2K3FA 2HYJA 2R7ZJ 3W2WA 1HW1A 5J8FA 3Q3SA 5DM6F 4ZJZA 5CVJA 4OAYA 2X1DA 2BXYA 1F9NA 3SDGA 3ZRGA 1ZLJA 1BBYA 1ZK8A 1BC8C 1Z3YA 3O2PE 2MH9A 1ETKA 4XONA 2HQNA 1E3HA 3CZ6A 4KJZA 1FOXA 2DQLA 3S1MJ 3K4LA 4UV8A 2GXAA 4BDYA 3CC4I 4HF1A 3LFUA 1KYWA 4CCLA 4E4HA 4XRMA 2QF7A 2I5UA 4EJTA 4B8XA 3CLQA 2CQNA 2NYXA 2HYFA 3HRTA 3KZIC 4KMUX 2JTVA 2HEOA 3DKWA 2BY0A 3BZ6A 5K7HA 3PO3J 1B8IB 1V3FA 2D5VA 3MQ0A 1TL8A 3AFHA 4KN4X 3ZR8X 2DOFA 1JUMA 4RM3A 4C3HJ 3AL0B 2M8EA 1XMKA 2FD5A 5ICGA 4H0EA 3QPSA 2PEXA 3TP0A 1VQMI 1BW5A 1R1UA 2CU7A 4FISA 4OOIA 2A69F 1J5YA 1D0ZA 2MD5A 4IEJA 1XGOA 3FXUA 3TGNA 4HQMA 3UR3C 2JMWA 1G3SA 3P9IA 2MW8A 1R23A 2LF7A 1FZPB 4B48A 3LWFA 3QPLA 3HC7A 2G7UA 2HPMA 2IP2A 1ZR4A 1XS9A 3PQJA 5D8LB 3I0TA 2XUBA 4YFXF 5DM7F 1S7EA 3DEUA 1TLHB 1RR8C 1E3PA 4HW0A 5AIQA 1A35A 1SFOJ 2O61A 2HXIA 3FXKA 3EUAA 3C2BA 4MQ9F 3OYFA 2P0WA 4N9HA 3DTEA 5IY5H 4D7NA 2GIVA 4CHUA 1OCCH 2LBFB 1RI7A 4Z2YA 1BI2A 2CRGA 4FT8A 1DUXC 2EFQA 2JZYA 3SDBA 3G2BA 4DYQA 1OKRA 2GLOA 1ETOA 2RC4A 3ABKH 4XSZF 3MKWB 1TWAJ 3I4MJ 3S1NJ 1USSA 5A2QK 4HQEA 2NNNA 1JT6A 2L54A 3G3ZA 1O3TA 2R92J 4Q48A 3HL2A 1LDDA 3ZP5A 3BG7A 4JOMA 3TMOA 1FT9A 1V55H 3I59B 3ZQLA 3BDDA 3JREA 4JBAA 4ZZLA 1ZG5A 3J81K 2IA0A 2MH2A 2OAZA 3PSIA 4MIMA 1K78A 3DV8A 2VE9A 1ON2A 5IP9J 4A3BJ 2EB7A 1HSTA 1RKWA 1VF9A 2VBXA 2JPBA 1IV6A 3KP5A 3ZMTA 5HODA 4G6QA 1PP7U 4CO8A 2MLGA 2R5ZB 4YIRX 3QWLA 4GGGA 4EM2A 1MH3A 5GPCA 2VLAA 2E1OA 4GO1A 2VONA 3ABLH 2TRTA 4L5EA 3TKYA 3FBNB 1O7FA 1QHGA 2JRTA 3GZ6A 4LK0F 2K9QA 1MBFA 1QZYA 1XC5A 1SANA 1FWZA 1R6RA 5HNFA 2KHMA 3CMEI 4FE4A 5ILUA 4E7ZA 3GTKJ 1VNDA 4EJWA 4LIUA 4AYBN 3RPUA 4Y3OA 1ODDA 3PNYA 2EFNA 1MD0A 3AAFA 4ZTFA 1IXSB 3SQNA 4WCGA 2EINH 4HNUA 1U5TA 4AWXB 2W82A 5IP6A 4IOCF 4QLCU 4CYDA 4LK1F 2ZB9A 2O03A 3JAMK 3CC7I 1REPC 4P5OA 3G4SI 3GTMJ 3RYPA 4IQJA 1IF1A 1IXCA 2XASA 5D6EA 4Y7NJ 4M3FA 2BGCA 2IXSA 2HDCA 2BE5F 1YJ9I 3E5UA 1RUNA 1MBKA 3J80Z 4Q47A 3OYIA 4HV6A 3VYTB 2BW3B 1UHMA 4L5JA 2L4MA 4I09A 5FKMA 4MLOA 3A0BC 4JYKA 2PFBA 3E6MA 2V6EA 5ED4A 1SMYF 4H4KC 5H2FC 2KPMA 1MMSA 3SYTA 1KU3A 2MA3A 2XSDC 2OJED 2F4OB 4XOTA 1TQIA 3CCEI 3KCCA 5JR3A 4I2OA 1G3TA 2HQ5A 3N97A 2X6XA 3GFJA 3LMMA 1FMVA 1T08B 3PNTA 5E17F 2QKMB 1LFPA 1X1PA 1OMIA 1VQLI 1MMNA 3ERMA 4A5MA 1EKEA 4XQFA 3ASNH 2NVYJ 3TOBA 2IS4A 5E3LA 1V5GA 5CVVA 1A04A 1ZR2A 4O6JA 5FROA 2Z2SB 3OIOA 3FIWA 1YJWI 2B0LA 2K4JA 5F6FA 3GUDA 3I9V2 5EZHA 2MG4A 4E7IA 1MSEC 1G6NA 2JVGA 2ID3A 2KT0A 2XDVA 5LEJA 2QEXI 2DCEA 3K1NA 2ME0A 2M7AA 2X9DA 4UUVA 2HOAA 2MC4A 2GOXB 3BG6A 3GTLJ 3L7WA 3HOVJ 3GW2A 2V9VA 3T1BA 3OYDA 1Z77A 1GHCA 2ETHA 4FX0A 1GUUA 2EBIA 2HR3A 1Q1HA 3IKVA 1KA8A 2CUEA 3OIPA 3I55I 2L9RA 3M1EA 1WHUA 3S2DJ 1T33A 2O8KA 5CLSA 1YG2A 1HSJA 2XRLA 3KP6A 5BQTA 2IS2A 2VXZA 4KITB 2PN6A 3VYRB 1OLTA 2VQLA 1P7IA 2DJIA 2CUFA 3ONQA 3SZGA 3QPHA 4Y17A 1UG2A 3WTSC 2JQ7A 1X4OA 2M5WA 2R7XA 2O3FA 2DPDA 4JX6A 4A6EA 3B6CA 5FD5A 1DPUA 1YFHA 3B73A 2LTPA 3K4KA 3PIOF 3DBRB 4V2GA 4PSWA 4A3LJ 1MJ9A 2OV7A 2PJRA 2Z99A 2K4BA 2A07F 1S7OA 3FWEA 3IH2A 4A3JJ 3KEOA 5ILVA 1IN8A 3GMEA 2ZBKA 2LREA 3K0LA 4Y4RA 1IJWC 1JUPA 3J7ZI 1KU7A 3ZOBA 1FOWA 1NH3A 3K4CA 2FUG2 2D1HA 3NAUA 3RKXA 2EV6A 1MJAA 2MSYA 4ENJA 3ZMDA 1WJEA 4I02A 1BI1A 1VQ6I 2DA1A 2M34A 4BAYA 4HBLA 2R93J 1J2XA 3HKZA 4BXXJ 4A12A 1Z05A 2DT7B 1FY7A 2P7CB 1TTYA 4BY7J 2ZJPF 3GTGJ 4HX4A 4UV9A 1YRNB 2IGKA 3AG1H 3WG9A 4IX7A 5E1ZB 5L3BA 2E2JJ 4FETA 3OS2A 2LR8A 1IXRC 3RKWA 1HW5A 2YU3A 2WC2A 2F5FA 3E3VA 3FM5A 4Q4ZF 2KJBA 3HOUJ 4OAZA 2A6HF 1Z3XA 5EF6A 3FXOA 2D45A 3AG2H 3HHGA 4M6VA 1E2XA 2OCEA 3M8FA 3ZQIA 3J80K 4U7DA 1X2MA 1Y8RB 1O3QA 4G6DA 3BZKA 4KIFA 1JKRC 2FBIA 5TGTA 3Q0WA 1YITI 3MKZA 2XB5A 2JK3A 3TW7A 4G12A 1MBJA 3LA2A 3MZYA 5EG0B 3GO5A 3VYSB 3BZCA 4XRFA 2E5NA 3IP4B 4EATA 2AXLA 2NOGA 4NC8A 3ZQGA 3SZPA 1U78A 4XN3A 5LHGA 1ITYA 3OL4A 1Y6IA 3CESA 2V9KA 4JK1X 5F08A 1AA7A 5DV5A 2GOMA 2EV0A 4LITA 2KMUA 2NS0A 2ZJQF 3ROUA 2K3PA 4B43A 3U2RA 3G71I 3E7LA 2PMHA 3WTYC 2VOPA 2ZXWH 1HKQA 2KIFA 2IW5A 1UG0A 5LHIA 3X2QH 1K7AA 1Y56A 2K40A 3A01B 1W7PA 1WVRA 3VB2A 2K5CA 1UZCA 1VI0A 4PZJA 4ESFA 3S17J 4QSHA 3A2KA 1CF7B 3ZQ7A 3I58A 3K9TA 2DK5A 3M4OJ 1DQUA 1SAUA 3O8HA 4UUSB 2MC3A 3PFYA 5E1WA 4D1QA 2VPLA 4WXCA 5CQEA 2CW0F 1I6XA 3DEWA 2HZTA 2V4JC 2VT3A 1UB9A 3ERED 4U0WA 2LVSA 3HSFA 1SFUA 2L01A 2OZUA 2PQ8A 4BJ5C 3OOUA 5HLGA 4KISA 1D8KA 3CUQB 3R6SA 5GTIC 1PYVA 2Y0SN 2GZWA 4BJTA 2RKHA 2R7OA 4XLHA 5IPAA 2Q2EA 1ZHFA 1LDJA 3ELKA 3IUOA 3F6OA 1HBXG 4E7HA 1B59A 4UXNA 3HIFA 2WAEA 2Y48A 4A2UA 3WTUC 1JUSA 4CCOA 4M73A 4KICA 4ZYGA 2ISYA 3NRVA 3QPTA 5BNGA 1MIJA 4IRGA 2DYRH 3BQZA 1MDMB 4WXHA 3RQIA 4YIFA 2WAQN 1TT5B 1GV2A 2XAGA 4FX4A 2P81A 2QSFX 2EJRA 3FM3A 2EIJH 2JJ7A 1X4PA 2WADA 4QTRA 4XKVA 3NQOA 1XG1A 3FXRA 2VBWA 1DP3A 2STWA 2MBFA 2K85A 2VN2A 2X51A 1LNWA 5FLXZ 3CTAA 4BE2A 3GX4X 2DFEA 2TCTA 5DD8A 1JTXA 5HS7A 4HZFA 2HZDA 3MWMA 3S93A 3L00A 2EK5A 1LVKA 3G6EI 4O5VA 4KIGA 5F27A 2M0CA 5DCMA 1Y8QB 3RIRA 2C6YA 3GF2A 2L9SA 4EMSA 3L2QA 1ZQ3P 3WE3A 4FASD 3HDDA 3B6AA 3BJAA 2V1NA 4C3IJ 3P9KA 1I3QJ 5GP9A 4AM3A 2FOWA 1YE9A 3K2AA 2VJ4A 3HOSA 3ZMVA 2KZGA 4P96A 2CMPA 2X85A 4PSXA 1OISA 1DPRA 1EH6A 3KX2A 1K6OA 1BA5A 3REOA 3ZMSA 3MVPA 3HGYA 2WTEA 3F8CA 4A3GJ 2V26A 2PMUA 1B9MA 2KJCA 2NNYA 3DPUA 4NC6A 2IA2A 1I3AA 1ZELA 3DKXA 3OYHA 2JSCA 1DGRM 2CWEA 1ONVA 2HGCA 4ZYHA 5F1JA 1K4TA 1I1SA 1IV8A 3KYCB 3HTUA 4OIPF 3V42A 2CJJA 1O4XA 1B72B 2H1KA 1X1DA 4A0XA 4ABZA 3CCRI 1FSHA 1IUYA 2D2WA 2FRHA 1Z91A 5IYBJ 3IL2A 4J00A 3U1DA 1YTYA 1A6IA 3C7JA 4HF0A 3RKYA 1FP2A 4A3FJ 1GLNA 3WTWC 3HOXJ 4C3JJ 4YG2F 1P9QC 3SHFA 1N78A 1QVTA 3IAM2 3HRSA 3QODA 2DDBA 4DGWB 3I53A 3MMYB 1QVUA 5ICFA 2W7NA 5D5VB 1Z67A 5CJ9A 5L3FA 2GAUA 4DW6A 5FRMA 2KRCA 2R5YB 2DO7A 3W2AA 4P9FA 5DYMA 3BJ6A 3ASOH 3NWTA 2GXBA 2OPTA 2LDUA 2E2HJ 3O3KA 1JTYA 2JA7J 2P6SA 2QWWA 1FYLA 2GWRA 3GBGA 4IQ4A 4UHTA 2P6TA 3FXLA 4D0PA 3HJEA 2UUZA 1QA6A 3S15J 4UNOA 2M3AA 2HNHA 1P7JA 2LKSA 2M4KA 4PGHA 2R7WA 2CGPA 3HUGB 2L7KA 5CQGA 3T8TA 4DOZA 1MH4A 5JHFA 4ZH4F 3BPXA 1ZREA 2QGUA 2NVUB 1EV7A 5TRDA 1JKOC 2V7FA 2NXNB 3JW4A 3TO9A 2ACJA 1F4KA 1EH8A 5B5EC 3CP2A 3K10A 3BR1A 5C3EJ 3V8JA 1ZG1A 4U87A 5BPDA 1SMTA 3A4CA 1J9IA 1VQPI 3BROA 1XGMA 5E3MA 3KETA 3IWFA 5LLQA 2E19A 2UZKA 2VBYA 2E1MC 4BHCA 3FKIJ 2DBBA 3VDXA 3QU6A 1JT0A 1U2WA 3DKYA 2HOEA 4EM0B 3LQQA 5LD2C 4MHGA 5FLXK 5C44J 4I0BA 4K2EA 1BOBA 1FLIA 2H94A 3A1YA 2R4GA 3HOYJ 4PJMA 4MNUA 4EJVA 3H3UA 3SEQA 1PUFB 3RI4A 1BIAA 2GA1A 2L0KA 4HAMA 3SXYA 2EZIA 3OL3A 1LDKB 1N25A 3K70C 2XAJA 1LPQA 1S3JA 1R5ID 2GA2A 3TO7A 2DMNA 3RPQA 5EYRA 1Z7LA 1K79A 1IN4A 2FBHA 2QM3A 4RB2C 2KFDA 1SD4A 4RM2A 4UB6C 4F93B 1SEUA 1VQKI 1HLVA 1I5ZA 3BG9A 1EJ9A 2PJPA 2FQ4A 2QQAA 4Y13A 3JCUC 1ORKA 4UVAA 2FU4A 2QLZA 1IAWA 3GFLA 3ZGKA 3W6VA 5ICEA 2PG4A 3HTSB 1UELB 2AQEA 2Y75A 4IHXA 3V8LA 4RDUA 1ZAOA 2JN6A 2ELKA 1Y0UA 4BHPA 2HPIA 4LLLA 2E7WA 2M30A 3DQVC 1E17A 1WJ5A 3HZJA 2QYOA 2Z1DA 4HDUA 2JUGA 1OFCX 2LMDA 5HLIA 5F1RA 4AUXA 4DZPA 5B3SH 2V6CA 3I56I 1BL0A 2JA2A 3F8BA 2VOOA 4DYRA 4FHTA 3CCQI 2DN0A 2O7OA 1FYKA 2FJ1A 2H8RA 4AIJA 1IDYA 5FFXA 2FQ3A 2WAFA 2A5YB 3VODA 2VI6A 1JXSA 4BEHB 4A3MJ 2IBDA 3CUQC 3GFMA 3Q9VA 1TP4A 1D0YA 2OC6A 3A03A 4MTDA 5D4SA 4AVPA 1WCMJ 1EH7A 3H9JA 5J47A 1BM9A 3WU2C 1IG7A 1ZH5A 4UY8I 4E7KA 1YIOA 2XGCA 2XAUA 3HG9A 3I4PA 1YW9A 3TDZC 3OYNA 4KT5C 5J3LA 4D5CA 2J5PA 5KNLA 3WGGA 5LGTA 4XR6A 3F72A 1ZGWA 2KKOA 1YJNI 3Q0VA 1OR7A 3F8FA 1T39A 4XKBA 3HYIA 2VUMJ 2DFFA 3CUOA 3ZQQA 2L9VA 3HHHA 3I4NJ 2EA4A 4LMYA 2FF4A 3D0SA 2DFHA 1KQ0A 4HX8A 5IOYA 1BOAA 2X6WA 2VC1A 4A3KJ 2Y9YA 1ON1A 2CG4A 3WGIA 2F5VA 3DLAA 4OWRB 4CYCB 3CD6I 2XAHA 4B09A 2HU9A 2VODA 1G8XA 1W5CC 3RZDJ 3OYJA 1BN5A 5FB2A 2RN7A 4QWQA 4PJ0C 3VSKA 2DT6A 1D8JA 1XX5A 4EJUA 1QU3A 5J1YA 3MKYB 3RSNA 2RREA 2XVCA 3JRHA 2CYYA 2KRHA 3WHCA 5E20A 3DPLC 4LIVA 4RB1A 4Q5SF 1XD7A 3OYBA 1DGWY 3MCZA 2CQQA 1Z0XA 1HW2A 2A6EF 2HOTA 4CDGA 3TO6A 2L5QA 2JWTA 2M87A 3J7YJ 5E3NA 1UHWA 3EUHA 1ZYRF 4XICA 2A68F 1B8IA 2H6CA 2XKOA 4MEYF 4RS8A 4MEXF 4CUGA 3FMQA 5C4XJ 4BQNA 3CF2A 4C2UA 5HLHA 5TJJA 3KIOA 2Y2ZA 3V8KA 3KE2A 1XMXA 1F43A 3DU6A 4PCQA 4M71A 2DA6A 2XRNA 4N4OB 4B3AA 3PFIA 1JHHA 5K7FA 3CC2I 3A02A 1T38A 1LUJB 1S9HA 4KN7X 3QOPA 2HDDA 5GAHJ 5BOXA 3I71A 1WRJA 3F6VA 2ESNA 2G9WA 2B7EA 1ZN2A 2ZKZA 2ISZA 3FMSA 2L4AA 2BOLA 2VXDA 2BHYA 3MFKA 4P1WA 4OMZA 1ACIA 2V9PA 4RGXA 2MYSA 2DJNA 2X48A 1X58A 3TP3A 3N4MA 3GVAA 2LBFA 3CP8A 1LE8B 1I6HJ 1XDUA 4FQGA 1KQ8A 2P5VA 2MABA 1TNTA 2FSWA 3M1CA 1A31A 2ZXHA 2K7LA 2EV5A 3GEZA 3AG3H 5K5OA 4RMNA 4RGUA 1W36C 2JA5J 1HKTA 2FMYA 4UVBA 2YX4A 1YLFA 4BL0B 2ZXIA 3IHUA 4FTHA 4A5NA 4A69C 1YQAA 2OQGA 1YOVB 3I59A 3RPUD 1VQ4I 4M9XA 4N9IA 4IO9F 3MEXA 1R22A 1Z6TA 2WV0A 3ZMUA 3ZQCA 1O57A 4I01A 1FNNA 2VQCA 4UVCA 2LC2A 3U9GA 4G94A 2JA8J 1WJCA 3U1KA 1R4NB 2ZC2A 2ZCWA 2R5ZA 1GXPA 2HI3A 4C2MJ 2W85A 1YYVA 3Q9SA 4R79A 5L3EA 5EGOB 2JPCA 2FE3A 3H35A 3LSRA 4A3DJ 2XF5A 4FE7A 5LGNA 3G1OA 3H36A 2E1CA 2M4GA 1OCTC 4A3CJ 3PL8A 4F92B 2XF6A 1X3WB 2KLOA 2PBIA 3DU5A 2OTJI 2LKXA 3MN2A 2Y31A 3CMAI 2EZKA 4I0AA 4LGWA 3OYGA 4HLXA 1LQ1A 5EEHA 3OIQA 5E8GA 3FXJA 1IDZA 2XSJC 2IT0A 1D3YA 3E0JB 2DODA 3JR9A 2N8GA 2W25A 3DXJF 1YI2I 1MMAA 4EM1A 5DS9A 3CCLI 3PSFA 1OR7C 4B3XA 3L2RA 3BOQA 3TEDA 1QZEA 4HSRA 2NVTJ 3DPTA 4XK4A 4NQWB 2VASA 4DBRA 2FOKA 2B9SA 1FMWA 2IS6A 3QYBA 2UXXA 3HKZN 1WZ2A 3VEPA 3CCVI 4IZZA 4M3GA 2V1XA 2XGXA 4HLYA 3ABTA 2IA1A 1ETVA 3W6JB 2RNJA 4IOAF 2BW3A 1OYWA 1H9GA 1SFEA 5GAGJ 2EIMH 4G7OF 1RNLA 5L3DA 2XGEA 4D9JA 2H27A 3WG7H 4AD9A 5HDNA 2VIXA 4M74A 5IP7J 5IT3A 3CDLA 3H3ZA 1XDSA 2DTRA 2ELHA 2EZHA 3EDPA 4ON0A 1RR7A 1M1EB 5EEAA 4M3EA 1GDTA 1AKHB 2IGMA 3UNGC 4HOBA 2CV0A 3R4KA 2R7FA 3L1PA 1FTTA 1KONA 3JRGA 1ZTRA 3QOEA 2A05A 3EUHC 2COBA 2P5KA 5J4VA 4LG0B 1XB4A 1TWCJ 5FLMJ 2XPVA 5FKOA 4IRHA 4CA0A 2CW7A 1V5FA 3AL0C 2QBYB 4ZYAA 3ABUA 1G4DA 4BGDA 2LKPA 1LKXA 1P4XA 3PNVA 4PJNA 5CVUA 5FD6A 1H8AC 4V19K 3KP3A 4C30A 2F5CA 2X1EA 2BEOA 2AO9A 2W48A 4AC0A 1F5TA 2JA6J 3RZOJ 4GYGA 2ZO4A 3I5UA 3EQLF 4BY1J 5J40A 1NHAA 2W1OA 4XOPA 5JVTA 2ZMEB 2VQGA 3L09A 2EFOA 4DYCA 4RB3C 1IW7F 3O6BB 4M6YA 3WU0A 2RVCA 3ZCOA 3CJNA 2R7TA 3M7GA 3BC8A 3CCSI 2KRFA 2YX7A 2JT1A 5F0CA 1JJ8C 3IH3A 2UWMA 4G7HF 1FOKA 2COMA 4G7ZF 2K9MA 2IRFG 1VZ0A 4M72A 4CCKA 4IRIA 1YIJI 1FPQA 1Y1WJ 4ZZDA 3VSLA 2FNAA 5KAFC 1RRJA 2EWNA 3NARA 2JRMA 3K2ZA 1R36A 3KP4A 3OYKA 4KNYA 2FNPA 3JTHA 5H20A 4N4NB 4F52A 4LJZF 3TQNA 1D5VA 1KQ9A 4ZC3A 1ZRDA 3C1DA 4BBRJ 4R1HA 3K6GA 1IRGA 3LSKA 3WTXC 4BNCA 1ETQA 1TNSA 2K02A 3SEZA 1QZZA 3JRAA 5JI6A 3FHZA 4ENKA 1SD5A 4QPOA 1YS6A 3EUKL 5J1UA 5TISC 2WWYA 1PVEA 4S04A 1W1WE 1WJDA 1R9TJ 3CJTB 2XV4S 3WHBA 2XROA 2VBZA 1T2KA 4NDLA 3K4BA 2DMUA 1JE8A 4XBFA 3HOZJ 5LRSA 3GLXA 5B1BH 1JJ6C 1QBJA 2KL4A 2IAIA 4D5FA 4ESBA 4BHBA 4ENMA 1MNEA 1T98A 3LSTA 1YRNA 4ENNA 3BP8A 4RLFA 5BS6A 3BR0A 3IH4A 4PJLA 3H9GA 2I10A 2L2OA 3H92A 2OQRA 3ZN0A 4CCNA 2E7XA 3GTQJ 4EQQA 5M5YJ 4XIDA 3I54A 3S3NA 2W24A 5K1YA 2ZJ2A 2XKPA 5LHHA 2LH9A 1QQIA 4X0GA 2VPRA 4OINF 3JTGA 4W97A 2Y0MA 3BTCA 3WE2A 3KZYA 1AU7A 1W7PD 3E6CC 2DT5A 2RDPA 4GCVA 2HKOA 5E8IA 2JSPA 5F64A 4C9YA 5ICCA 4E6KG 3GZ5A 5LRRA 1OYIA 5EG0A 2QSGX 1Q1VA 4U0YA 1YHQI 2OUMA 1JGSA 2O6GE 4YFNF 1ZGJA 1IGNA 3HPHA 3MKLA 1SVLA 3SZTA 5GAEJ 5DDGA 3JRCA 2DFIA 2AS5F 4OMYA 3J7AY 4PFOA 2WB1A 4KIBA 1ULYA 5FO5A 2FEZA 1NK2P 4CXFA 5L3GA 4PGGA 5EJCA 2LY2A 3BJOA 3FBIB 5JVGF 2LLKA 3LSIA 1SFXA 3LAPA 4ANJA 1TW2A 5FKKA 3T8RA 1X19A 3JRBA 2AXTC 4EGZA 3ZPLA 3KP7A 5FRNA 3QYFA 3SJMA 3A01A 1KGSA 1V4RA 3TBIA 1R71A 1MNMC 2GQQA 2EIKH 1TC3C 4XNFA 1CF7A 3IKTA 1F1ZA 3F3XA 1J7KA 1P92A 3FHNA 1XSVA 1Z1DA 4BQQA 4UUSA 3HOWJ 4Y15A 3TDUC 4GRIA 4OU0A 1VQ8I 3PQKA 1RUOA 2LK2A 2WY8Q 1RETA 3S2HJ 3GFIA 1T95A 2XPUA 2VC0A 5AONA 2PX9A 3IRQA 2Y69H 4XKWA 1HCRA 4O3MA 1O3SA 2WA0A 2DTZA 3BTJA 2BVMA 1PP8F 1XMAA 3CUQA 2R3SA 4II2A 4IPAA 1P4AA 4XM3A 1T0FA 2XPWA 1WH5A 4G9YA 1S7AA 2NS8A 2M0MA 1FBQA 1S6LA 4YRVA 2E5ZA 2VKDA 5E3OA 5M5WJ 4ZTJA 3KLOA 5F04A 3K70D 3CCUI 3U21A 1U9OA 1FEXA 1XN7A 2XAFA 4NHJA 3TL4X 3HGGA 4LFUA 1TQPA 5FGMA 2KISA 2VE8A 2R0QC 5GTHC 1LFBA 3VPRA 1MDMA 1ETXA 5IYDJ 3E5QA 4KA4A 4JP0A 1F36A 3H0GJ 3WTZA 4X1EA 2RNGA 2OBPA 3CCMI 1SFKA 2CFOA 3CDHA 1X1AA 1O7LA 2M2EA 3ZN1A 4L9VA 5J1RA 2MGQA 2LD5A 1WI9A 2PMZA 1OCRH 3RDIA 2E60A 1ZGAA 4HX7A 1IN5A 4W1UA 3PUBA 3ECOA 2K86A 2LG4A 3O8GA 2EPFA 4U7BA 1Z7UA 1MW7A 4BJ6C 3F22A 4LLGF 1RIOH 5JLXA 2E71A 2MFZA 4ZDOA 3OWTA 1XPXA 5A2QZ 1WJBA 3DCFA 2ECCA 3BTIA 3KFWX 1FTZA 2LSOA 2Z3YA 2CV2A 2HXOA 5DCFA 3OYLA 1WKMA 3BR5A 2DOEA 2YU9J 3KPHA 1KZHA 2UXNA 4J19A 3BG3A 4HEA2 4ZYEA 2VKHA 2LF8A 3EYYA 1MMGA 3KYDB 3OY9A 1WFXA 5BPIA 3H9QA 2VKVA 3KEQA 4XMYA 1R7JA 3BR3A 2YS9A 3RJPA 1NG7A 1BW6A 3ULQB 4KFCA 4C2TA 4RB0A 3S8PA 2ME6A 3CLOA 2QZ8A 1QHHD 4IF4A 2V1DA 2X6OA 5J4YA 1TWGJ 5KCMA 3IV5A 4PJJA 1FIPA 1HC8A 2K27A 2KIMA 1FC3A 3SFZA 4YIIA 2XAQA 3LNQA 2F5EA 2E35A 5LBQA 3DBHB 2NRAC 3M9AA 2Y30A 1B72A 1VTNC 2CUZA 3HB9A 4IHYA 1YW8A 5GPAA 1JKQC 1ZG3A 2BVLA 3RQ4A 4B1RA 4AIDA 2NAZA 1YS7A 3HXLA 4J01A 4B47A 1K78B 2X0LA 3DLLF 1IRZA 1L3LA 2QCOA 3E5XA 1AOYA 2E34A 3OYMA 4EGYA 4XRSA 1QO0D 1R00A 1QPIA 3HRMA 5JLWA 4YELA 2BBYA 2KP6A 3CMYA 4GFBA 5EZGA 3D5SC 4QIWN 1U9NA 5IT9Z 2FMLA 2R5YA 4OIOF 1K6YA 2NOJB 2KZVA 1DU6A 4CGZA 1HF0A 1SD7A 4PDKA 5JFRA 2VJJA 1SC7A 2MLKA 4TV7A 1YW7A 1MSFC 1HDPA 2OU2A 5M3FJ 2AQFA 4CCMA 4ESJA 3IC7A 3LA7A 4WXDA 3VOEA 1OCZH 2NS7A 1O3RA 1XSXA 1U5TB 1SVOA 2G0EA 2YPRA 1FX7A 3I64A 3FISA 3LL7A 2DA4A 5FKLA 1T56A 2RV8A 2EZLA 1XCBA 2LP0A 2H6BA 1TBXA 3GXOA 3MAJA 5HLTA 1KYZA 3E1SA 3HUGA 4XLPF 2Q8KA 1FJLA 2K9LA 4EVIA 1T0FC 1RESA 1PUEE 3S32A 2NVQJ 3D5LA 3S14J 9ANTA 1XCVA 1WWXA 1ETWA 3GTOJ 2F4MB 3MZ8A 3FK7A 3NEUA 1X2NA 5KHDA 3R0JA 4S0HB 2VQHA 5EDNA 1YX3A 3CJRB 2QVOA 4AU7A 1W5SA 1IUFA 5D5WB 5DUKA 5H6QA 3HPGA 1U8BA 2DA7A 4Y33A 1BR2A 1B9NA 2VJ5A 4E7SA 1SVMA 3PIPF 2RQPA 5E1XA 2WY7Q 4BXFA 1W0UA 4XLAA 1IRFA 2FX0A 4A6DA 2CQXA 1GXQA 1WSUA 2VL8A 4F91B 1NTCA 3JRDA 3W2VA 4II3A 2CV1A 1W36D 2PLYA 1R5HA 1AHDP 2DYSH 1PUFA 2F48A 1WH7A 2VT2A 4OIQF 1OQYA 1X1BA 3M8JA 1NK3P 1TWFJ 5ILSA 4I98B 3BG5A 1HKSA 1USTA 2L7FP 5GADJ 2DAOA 4HA8A 3L2WA 2E36A 3F8NA 1CGPA 4A0ZA 4U0VA 4IHTA 1HQCA 1I50J 1XGSA 1DDNA 4BDZA 1ZLKA 1D1AA 3R60A 3B02A 2B63J 3BTLA 4GXOA 5KK1A 1BIBA 4WF2A 3BCAA 3ABMH 4IXAA 2NVXJ 3S16J 3QP6A 2KDZA 2CUJA 2QA4I 1UFMA 2ID6A 5IOZA 4BQOA 4BACA 2BY2A 5E79C 5DUIA 1D0XA 3BR2A 2O8XA 4BH9A 5EEGA 2Z9OA 2K9NA 1V54H 2M8GX 2V79A 3QYEA 4F7ZA 5LEKA 3HRUA 1ZRFA 1K61A 4GDFA 4MGRA 1ETYA 5FJ8J 4L0ZB 2R7QA 1G2HA 2DA3A 4ASNA 4G6TB 2BXZA 4PFPA 1QNTA 1Z9CA 2R7DA 3AG4H 3DEEA 1K4SA 2OA4A 3HBLA 4IVNA 2ESHA 3CCYA 4GYIA 2D1VA 4NB5A 3WODF 1NG6A 5B1AH 3QRFF 1P4WA 4BEHA 3ESWB 3FX3A 1QRYA 4MO7A 4AYBA 1PJRA 3EETA 2PJRB 2LOOA 1I27A 3IRRA 1A5JA 2QQ9A 3PUFA 3RCOA 1BJZA 1G3WA 2LFBA 1IO2A
chains in the Genus database with same CATH topology
3RZOJ 3S1MJ 4A3IJ 3BQYA 4BY1J 4MFDA 4XRMA 2QF7A 1ENHA 4DYCA 5K7HA 3PO3J 5F1JA 1B8IB 2D5VA 1RPWA 2CJJA 1O4XA 1B72B 1JUMA 2H1KA 4C3HJ 2FD5A 4ABZA 5F0CA 3QPSA 1BW5A 3TP0A 1JJ8C 3IH3A 2CU7A 4XRSG 5IYBJ 4FISA 1JGGA 1A6IA 4IEJA 1Y1WJ 4CYCA 4A3FJ 3NARA 3HOXJ 2JMWA 4C3JJ 1TWHJ 2MW8A 3HEFA 2AHQA 2XB0X 1QVTA 3QPLA 1ZR4A 1XS9A 3GTJJ 1D5YA 1QVUA 3K7AJ 1S7EA 4BBRJ 3JRFA 2K9SA 3PO2J 2YUSA 1SFOJ 2HXIA 3C2BA 1ETQA 4DW6A 2R5YB 3FK6A 4D7NA 3JRAA 1GT0C 2CRGA 5J1UA 4BBSJ 2O9LA 2OPTA 1R9TJ 2E2HJ 3WHBA 4DYQA 1JTYA 2GLOA 1ETOA 4NDLA 3HOZJ 2DMUA 1TWAJ 2JA7J 3I4MJ 3S1NJ 3GBGA 1JJ6C 1JT6A 2R92J 2IAIA 4D5FA 5DTDA 3S15J 1P7JA 1YRNA 3UKGA 1WI3A 1WPKA 3BR0A 3ZQLA 3IH4A 2I10A 3JREA 1MH4A 4MIMA 3GTQJ 4XIDA 5M5YJ 3G1LA 2DMPA 5IP9J 4A3BJ 1RKWA 1VF9A 1JKOC 1IV6A 1DU0A 5HODA 3GTPJ 1ZKGA 3BR1A 2VPRA 4IHWA 4W97A 2ECBA 5C3EJ 2E2IJ 2L7ZA 2R5ZB 3BTCA 1AU7A 3ZQHA 5GPCA 1MH3A 2E1OA 5E3MA 2E19A 3RKQA 2TRTA 4L5EA 3FKIJ 5EG0A 1Q1VA 3OSGA 2K9QA 1MBFA 1JT0A 2EH3A 1XC5A 1SANA 1IGNA 1LE8A 4FE4A 3MKLA 4I76A 3JRCA 3GTKJ 1VNDA 5C44J 4AYBN 1NK2P 3M3YJ 3BT9A 3HOYJ 5IP6A 4Y52J 2LLKA 1PUFB 2L0KA 2ZB9A 4IHVA 2VKEA 2EZIA 5FKKA 5M5XJ 3JRBA 1OCPA 3ZQFA 1LFUP 3GTMJ 3SJMA 3A01A 1MNMC 2DMNA 1TC3C 4Y7NJ 4M3FA 5EYRA 1MBKA 3S1RJ 3JRIA 1HLVA 4UUSA 3BG9A 3HOWJ 2FQ4A 1ORKA 5FKMA 4MLOA 2LK2A 4DZJA 1RETA 4JYKA 3S2HJ 3W6VA 4M3DA 2XPUA 5EGOA 4JX4A 4IHXA 4RDUA 2XSDC 1HCRA 2JN6A 2ELKA 2DTZA 2HQ5A 3BTJA 4I6ZA 4UUTA 2XPWA 1WH5A 1OFCX 2NS8A 4JX5A 2XGDA 4AUXA 4DZPA 1BL0A 2GM4A 5E3OA 5M5WJ 2NVYJ 5F04A 4DYRA 2DN0A 2O7OA 5E3LA 2FJ1A 2H8RA 1ZR2A 1U9OA 1IDYA 1FEXA 3LSJA 2L7MP 3HGGA 3FIWA 3OIOA 1JKPC 1Y1VJ 2VI6A 4A3MJ 2IBDA 2DA5A 5EZHA 2R0QC 2MG4A 1LFBA 3VPRA 3A03A 1ETXA 1MSEC 5IYDJ 1RKTA 2ID3A 2KT0A 1WCMJ 2ME0A 1F36A 3H0GJ 2X9DA 4JP0A 2HOAA 4X1EA 3GTLJ 1IG7A 3HOVJ 2XGCA 1Z77A 1GV5A 2M2EA 1GUUA 5J1RA 2EBIA 2MGQA 5J3LA 4D5CA 2LD5A 2CUEA 2L9RA 3HM5A 4W1UA 1ZGWA 3S2DJ 1T33A 2O8KA 3O8GA 3PM1A 3Q0VA 2XRLA 2VUMJ 1MBGA 1OJLA 3I4NJ 5JLXA 1UHSA 2IEKA 5IOYA 1AKHA 4A3KJ 3DCFA 1P7IA 1WGXA 2ECCA 2Y9YA 3BTIA 1K83J 2CUFA 1FTZA 4CYCB 2HXOA 1UG2A 5C4JJ 4HNVA 3BR5A 2YU9J 2EQRA 4JX6A 3B6CA 4J19A 3BG3A 3F0CA 3RZDJ 1EF4A 2LTPA 4MFEA 5FLVA 2WB1N 4V2GA 4A3LJ 2VKVA 3BR3A 5J1YA 2YS9A 4LOCA 1BW6A 3IH2A 3JRHA 3WHCA 2Y9ZA 2LY9A 2ME6A 4A3JJ 2X6OA 2CQQA 1TWGJ 1Z0XA 3IV5A 2HOTA 1IJWC 1JUPA 1FIPA 3ZOBA 2JWTA 3NAUA 3LNQA 2MSYA 5E3NA 4XICA 1B8IA 2DA1A 2M34A 2R93J 4BXXJ 2Y30A 2DA2A 1B72A 5C4XJ 4BY7J 3HB9A 4IHYA 3Q0UA 5GPAA 1JKQC 3GTGJ 2Y2ZA 1YRNB 3LSGA 4B1RA 1F43A 2DMTA 4RBOA 3D1NI 2E2JJ 2DA6A 2LR8A 3LSPA 4D7MA 4B3AA 5K7FA 1IRZA 3A02A 3HOUJ 2QCOA 2WV1A 2HDDA 5EF6A 2HOSA 3H3VK 4XRSA 1QPIA 4M6VA 5JLWA 3ZQIA 1X2MA 1JKRC 2M9HA 3CMYA 3Q0WA 4GFBA 5EZGA 1MBHA 2XB5A 1APLC 4QIWN 2JK3A 3TW7A 4G12A 5K7ZA 1MBJA 1U9NA 5EG0B 1CQTA 1HDDC 2R5YA 1DU6A 1U78A 1GVDA 2DJNA 1X58A 2NOGA 2X48A 3G1MA 3TP3A 3ZQGA 1HF0A 1LE8B 1ITYA 2GBYA 1I6HJ 2DMQA 5IYCJ 1FIAA 1MSFC 1HDPA 5M3FJ 5F08A 2NS7A 2G0EA 3FISA 3E7LA 2DA4A 5FKLA 2JA5J 1T56A 2EZLA 2LP0A 4A93J 4FTHA 4A69C 2PMZN 2K40A 3A01B 1MBEA 1FJLA 1VI0A 4A3EJ 3S17J 4QSHA 1RESA 2NVQJ 3S14J 3ZQCA 3M4OJ 9ANTA 3O8HA 1ETWA 4UUSB 3GTOJ 2JA8J 2OF7A 3FK7A 2RAEA 5F0HA 1X2NA 2R5ZA 5F0FA 4S0HB 2HI3A 5EDNA 3DEWA 4C2MJ 3OSFA 1HOMA 1IUFA 4M3BA 5EGOB 1U8BA 3LSRA 4A3DJ 2LVSA 4FE7A 2DA7A 3G1OA 4X6AJ 1OCTC 4A3CJ 3OOUA 2LKXA 3MN2A 2Y31A 2Y0SN 2EZKA 1W0UA 2FX0A 5IPAA 2CQXA 3QQAA 1NTCA 3JRDA 4BKXA 1IDZA 4B4CA 1IC8A 1AHDP 3JR9A 1PUFA 2N8GA 5DS9A 1WH7A 5FKNA 5M3MJ 3TEDA 1NK3P 1JUSA 1TWFJ 3BG5A 2L7FP 2NVTJ 1W0TA 4XK4A 5BNGA 3BQZA 3RQIA 2WAQN 3HKZN 1GV2A 2P81A 4V2FA 4M3GA 1I50J 1E3OC 2JJ7A 1ETVA 1H88C 4QTRA 2B63J 1XG1A 3BTLA 1VFCA 3BR6A 4FCYA 2NVXJ 1POGA 3S16J 2XGEA 2KDZA 5IP7J 3TW6A 2ID6A 5IOZA 2TCTA 3CDLA 1UMQA 3BR2A 3LOCA 1JTXA 3CQZJ 2EZHA 2K9NA 2M8GX 1H89C 1RR7A 5EEAA 1K61A 4M3EA 1GDTA 1ETYA 5FJ8J 1AKHB 1G2HA 2DA3A 5F27A 2M0CA 3L1PA 4EEFG 1FTTA 3JRGA 1ZTRA 3SFIA 3S1QJ 2COBA 3HBLA 1ZQ3P 2HYJA 2R7ZJ 3HDDA 1TWCJ 3CCYA 3B6AA 4C3IJ 5FLMJ 2XPVA 5FKOA 3Q3SA 1I3QJ 5GP9A 3K2AA 3SDGA 1ZK8A 4MO7A 1QRYA 1BA5A 1H8AC 3MVPA 1A5JA 1ETKA 1BJZA 3HGYA 4A3GJ 2LFBA 2AO9A 2W48A 4AC0A 2JA6J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO J;  3S1M J;  4A3I J;  3BQY A;  4BY1 J;  4MFD A;  4XRM A;  2QF7 A;  1ENH A;  4DYC A;  5K7H A;  3PO3 J;  5F1J A;  1B8I B;  2D5V A;  1RPW A;  2CJJ A;  1O4X A;  1B72 B;  1JUM A;  2H1K A;  4C3H J;  2FD5 A;  4ABZ A;  5F0C A;  3QPS A;  1BW5 A;  3TP0 A;  1JJ8 C;  3IH3 A;  2CU7 A;  4XRS G;  5IYB J;  4FIS A;  1JGG A;  1A6I A;  4IEJ A;  1Y1W J;  4CYC A;  4A3F J;  3NAR A;  3HOX J;  2JMW A;  4C3J J;  1TWH J;  2MW8 A;  3HEF A;  2AHQ A;  2XB0 X;  1QVT A;  3QPL A;  1ZR4 A;  1XS9 A;  3GTJ J;  1D5Y A;  1QVU A;  3K7A J;  1S7E A;  4BBR J;  3JRF A;  2K9S A;  3PO2 J;  2YUS A;  1SFO J;  2HXI A;  3C2B A;  1ETQ A;  4DW6 A;  2R5Y B;  3FK6 A;  4D7N A;  3JRA A;  1GT0 C;  2CRG A;  5J1U A;  4BBS J;  2O9L A;  2OPT A;  1R9T J;  2E2H J;  3WHB A;  4DYQ A;  1JTY A;  2GLO A;  1ETO A;  4NDL A;  3HOZ J;  2DMU A;  1TWA J;  2JA7 J;  3I4M J;  3S1N J;  3GBG A;  1JJ6 C;  1JT6 A;  2R92 J;  2IAI A;  4D5F A;  5DTD A;  3S15 J;  1P7J A;  1YRN A;  3UKG A;  1WI3 A;  1WPK A;  3BR0 A;  3ZQL A;  3IH4 A;  2I10 A;  3JRE A;  1MH4 A;  4MIM A;  3GTQ J;  4XID A;  5M5Y J;  3G1L A;  2DMP A;  5IP9 J;  4A3B J;  1RKW A;  1VF9 A;  1JKO C;  1IV6 A;  1DU0 A;  5HOD A;  3GTP J;  1ZKG A;  3BR1 A;  2VPR A;  4IHW A;  4W97 A;  2ECB A;  5C3E J;  2E2I J;  2L7Z A;  2R5Z B;  3BTC A;  1AU7 A;  3ZQH A;  5GPC A;  1MH3 A;  2E1O A;  5E3M A;  2E19 A;  3RKQ A;  2TRT A;  4L5E A;  3FKI J;  5EG0 A;  1Q1V A;  3OSG A;  2K9Q A;  1MBF A;  1JT0 A;  2EH3 A;  1XC5 A;  1SAN A;  1IGN A;  1LE8 A;  4FE4 A;  3MKL A;  4I76 A;  3JRC A;  3GTK J;  1VND A;  5C44 J;  4AYB N;  1NK2 P;  3M3Y J;  3BT9 A;  3HOY J;  5IP6 A;  4Y52 J;  2LLK A;  1PUF B;  2L0K A;  2ZB9 A;  4IHV A;  2VKE A;  2EZI A;  5FKK A;  5M5X J;  3JRB A;  1OCP A;  3ZQF A;  1LFU P;  3GTM J;  3SJM A;  3A01 A;  1MNM C;  2DMN A;  1TC3 C;  4Y7N J;  4M3F A;  5EYR A;  1MBK A;  3S1R J;  3JRI A;  1HLV A;  4UUS A;  3BG9 A;  3HOW J;  2FQ4 A;  1ORK A;  5FKM A;  4MLO A;  2LK2 A;  4DZJ A;  1RET A;  4JYK A;  3S2H J;  3W6V A;  4M3D A;  2XPU A;  5EGO A;  4JX4 A;  4IHX A;  4RDU A;  2XSD C;  1HCR A;  2JN6 A;  2ELK A;  2DTZ A;  2HQ5 A;  3BTJ A;  4I6Z A;  4UUT A;  2XPW A;  1WH5 A;  1OFC X;  2NS8 A;  4JX5 A;  2XGD A;  4AUX A;  4DZP A;  1BL0 A;  2GM4 A;  5E3O A;  5M5W J;  2NVY J;  5F04 A;  4DYR A;  2DN0 A;  2O7O A;  5E3L A;  2FJ1 A;  2H8R A;  1ZR2 A;  1U9O A;  1IDY A;  1FEX A;  3LSJ A;  2L7M P;  3HGG A;  3FIW A;  3OIO A;  1JKP C;  1Y1V J;  2VI6 A;  4A3M J;  2IBD A;  2DA5 A;  5EZH A;  2R0Q C;  2MG4 A;  1LFB A;  3VPR A;  3A03 A;  1ETX A;  1MSE C;  5IYD J;  1RKT A;  2ID3 A;  2KT0 A;  1WCM J;  2ME0 A;  1F36 A;  3H0G J;  2X9D A;  4JP0 A;  2HOA A;  4X1E A;  3GTL J;  1IG7 A;  3HOV J;  2XGC A;  1Z77 A;  1GV5 A;  2M2E A;  1GUU A;  5J1R A;  2EBI A;  2MGQ A;  5J3L A;  4D5C A;  2LD5 A;  2CUE A;  2L9R A;  3HM5 A;  4W1U A;  1ZGW A;  3S2D J;  1T33 A;  2O8K A;  3O8G A;  3PM1 A;  3Q0V A;  2XRL A;  2VUM J;  1MBG A;  1OJL A;  3I4N J;  5JLX A;  1UHS A;  2IEK A;  5IOY A;  1AKH A;  4A3K J;  3DCF A;  1P7I A;  1WGX A;  2ECC A;  2Y9Y A;  3BTI A;  1K83 J;  2CUF A;  1FTZ A;  4CYC B;  2HXO A;  1UG2 A;  5C4J J;  4HNV A;  3BR5 A;  2YU9 J;  2EQR A;  4JX6 A;  3B6C A;  4J19 A;  3BG3 A;  3F0C A;  3RZD J;  1EF4 A;  2LTP A;  4MFE A;  5FLV A;  2WB1 N;  4V2G A;  4A3L J;  2VKV A;  3BR3 A;  5J1Y A;  2YS9 A;  4LOC A;  1BW6 A;  3IH2 A;  3JRH A;  3WHC A;  2Y9Z A;  2LY9 A;  2ME6 A;  4A3J J;  2X6O A;  2CQQ A;  1TWG J;  1Z0X A;  3IV5 A;  2HOT A;  1IJW C;  1JUP A;  1FIP A;  3ZOB A;  2JWT A;  3NAU A;  3LNQ A;  2MSY A;  5E3N A;  4XIC A;  1B8I A;  2DA1 A;  2M34 A;  2R93 J;  4BXX J;  2Y30 A;  2DA2 A;  1B72 A;  5C4X J;  4BY7 J;  3HB9 A;  4IHY A;  3Q0U A;  5GPA A;  1JKQ C;  3GTG J;  2Y2Z A;  1YRN B;  3LSG A;  4B1R A;  1F43 A;  2DMT A;  4RBO A;  3D1N I;  2E2J J;  2DA6 A;  2LR8 A;  3LSP A;  4D7M A;  4B3A A;  5K7F A;  1IRZ A;  3A02 A;  3HOU J;  2QCO A;  2WV1 A;  2HDD A;  5EF6 A;  2HOS A;  3H3V K;  4XRS A;  1QPI A;  4M6V A;  5JLW A;  3ZQI A;  1X2M A;  1JKR C;  2M9H A;  3CMY A;  3Q0W A;  4GFB A;  5EZG A;  1MBH A;  2XB5 A;  1APL C;  4QIW N;  2JK3 A;  3TW7 A;  4G12 A;  5K7Z A;  1MBJ A;  1U9N A;  5EG0 B;  1CQT A;  1HDD C;  2R5Y A;  1DU6 A;  1U78 A;  1GVD A;  2DJN A;  1X58 A;  2NOG A;  2X48 A;  3G1M A;  3TP3 A;  3ZQG A;  1HF0 A;  1LE8 B;  1ITY A;  2GBY A;  1I6H J;  2DMQ A;  5IYC J;  1FIA A;  1MSF C;  1HDP A;  5M3F J;  5F08 A;  2NS7 A;  2G0E A;  3FIS A;  3E7L A;  2DA4 A;  5FKL A;  2JA5 J;  1T56 A;  2EZL A;  2LP0 A;  4A93 J;  4FTH A;  4A69 C;  2PMZ N;  2K40 A;  3A01 B;  1MBE A;  1FJL A;  1VI0 A;  4A3E J;  3S17 J;  4QSH A;  1RES A;  2NVQ J;  3S14 J;  3ZQC A;  3M4O J;  9ANT A;  3O8H A;  1ETW A;  4UUS B;  3GTO J;  2JA8 J;  2OF7 A;  3FK7 A;  2RAE A;  5F0H A;  1X2N A;  2R5Z A;  5F0F A;  4S0H B;  2HI3 A;  5EDN A;  3DEW A;  4C2M J;  3OSF A;  1HOM A;  1IUF A;  4M3B A;  5EGO B;  1U8B A;  3LSR A;  4A3D J;  2LVS A;  4FE7 A;  2DA7 A;  3G1O A;  4X6A J;  1OCT C;  4A3C J;  3OOU A;  2LKX A;  3MN2 A;  2Y31 A;  2Y0S N;  2EZK A;  1W0U A;  2FX0 A;  5IPA A;  2CQX A;  3QQA A;  1NTC A;  3JRD A;  4BKX A;  1IDZ A;  4B4C A;  1IC8 A;  1AHD P;  3JR9 A;  1PUF A;  2N8G A;  5DS9 A;  1WH7 A;  5FKN A;  5M3M J;  3TED A;  1NK3 P;  1JUS A;  1TWF J;  3BG5 A;  2L7F P;  2NVT J;  1W0T A;  4XK4 A;  5BNG A;  3BQZ A;  3RQI A;  2WAQ N;  3HKZ N;  1GV2 A;  2P81 A;  4V2F A;  4M3G A;  1I50 J;  1E3O C;  2JJ7 A;  1ETV A;  1H88 C;  4QTR A;  2B63 J;  1XG1 A;  3BTL A;  1VFC A;  3BR6 A;  4FCY A;  2NVX J;  1POG A;  3S16 J;  2XGE A;  2KDZ A;  5IP7 J;  3TW6 A;  2ID6 A;  5IOZ A;  2TCT A;  3CDL A;  1UMQ A;  3BR2 A;  3LOC A;  1JTX A;  3CQZ J;  2EZH A;  2K9N A;  2M8G X;  1H89 C;  1RR7 A;  5EEA A;  1K61 A;  4M3E A;  1GDT A;  1ETY A;  5FJ8 J;  1AKH B;  1G2H A;  2DA3 A;  5F27 A;  2M0C A;  3L1P A;  4EEF G;  1FTT A;  3JRG A;  1ZTR A;  3SFI A;  3S1Q J;  2COB A;  3HBL A;  1ZQ3 P;  2HYJ A;  2R7Z J;  3HDD A;  1TWC J;  3CCY A;  3B6A A;  4C3I J;  5FLM J;  2XPV A;  5FKO A;  3Q3S A;  1I3Q J;  5GP9 A;  3K2A A;  3SDG A;  1ZK8 A;  4MO7 A;  1QRY A;  1BA5 A;  1H8A C;  3MVP A;  1A5J A;  1ETK A;  1BJZ A;  3HGY A;  4A3G J;  2LFB A;  2AO9 A;  2W48 A;  4AC0 A;  2JA6 J; 
#chains in the Genus database with same CATH topology
 1TQM A;  5KAI C;  5FFZ A;  4JQF A;  4I7H A;  3BQY A;  5D5X B;  4A3I J;  2IS1 A;  2RQQ A;  4MFD A;  1KU9 A;  3F9K A;  3VWB A;  1ENH A;  3LAJ A;  1FP1 D;  4BUP A;  5IT9 K;  1VQN I;  4DQ2 A;  1C0W A;  1MND A;  3OYE A;  2P8T A;  3Q5F A;  1YO5 C;  4WK8 F;  1S29 A;  3KYL A;  1A6Q A;  1R1T A;  4XSX F;  2Z33 A;  1RPW A;  1DP7 P;  4CZC A;  2F2E A;  4PUS A;  1S5L C;  4F3Q A;  3BWG A;  4CIC A;  2FA5 A;  3LSM A;  2V1U A;  1AWC A;  2VJI A;  4XRS G;  3OYA A;  1JGG A;  2H09 A;  2HVS A;  3JSO A;  1T6S A;  3K69 A;  4CYC A;  4P55 A;  4R8H A;  4OIR F;  4EV0 A;  1TZL A;  3NWS A;  3GLL A;  3DTI A;  1TWH J;  5HDK A;  3G73 A;  3HEF A;  4LLN A;  4CZZ A;  2AHQ A;  2BZT A;  2XB0 X;  2DDA A;  3TOA A;  1Y39 A;  2CH0 A;  2OCC H;  1S8N A;  3A0H C;  1BR4 A;  3KLN A;  1ZAR A;  3K4N A;  3GTJ J;  1D5Y A;  2G7H A;  3K7A J;  5J6X A;  4BQA A;  4XN0 A;  1W5T A;  3JRF A;  2K9S A;  3F23 A;  3PO2 J;  2YUS A;  2HYG D;  2M7B A;  3C2G A;  1R1V A;  2IGO A;  2STT A;  4KMF A;  1QGP A;  3OMY A;  3E97 A;  3P5J A;  4RA2 A;  2P5L C;  3VYU B;  3FK6 A;  1GT0 C;  2HQR A;  1BI0 A;  2HTS A;  4A0Y A;  3F21 A;  4BU2 A;  3L2C A;  3LFK A;  4BBS J;  3QP5 A;  3V7R A;  2BYV E;  2MD0 A;  3C3W A;  2O9L A;  1R5G A;  4XKC A;  3RYR A;  3K1P A;  3MD2 A;  4CCJ A;  2XIG A;  4HPQ A;  3FXQ A;  2JVH A;  2F5D A;  2R7U A;  5H6R A;  2A5W A;  1TT0 A;  2BY3 A;  4QPQ A;  2ZNZ A;  1FSE A;  5DTD A;  1IZ1 A;  2A6T A;  3K4M A;  4BE0 A;  3K4J A;  5L3C A;  3UKG A;  1H9T A;  1WI3 A;  1WPK A;  2DQR A;  3EPZ A;  4MQV A;  2Q1Z B;  1W7P B;  1XTA A;  2M45 A;  4XLF A;  2HWV A;  2LNB A;  1D1B A;  4WWC A;  3ZXS A;  2BV6 A;  4HYE A;  5E18 F;  4RLQ A;  3G1L A;  2DMP A;  2UV1 A;  1FBS A;  2WBM A;  3V4G A;  1DU0 A;  3M07 A;  1VQ7 I;  3GTP J;  1B1B A;  1ZKG A;  2ZFU A;  2BY1 A;  2M1B A;  2HVQ A;  4IHW A;  2ECB A;  2E2I J;  2L7Z A;  3HSE A;  3WTV C;  3ZQH A;  2XHK A;  2YR2 A;  4ITV A;  3M8E A;  3RKQ A;  2R7R A;  1FBU A;  1UCR A;  1G59 A;  2CQ7 A;  4DBQ A;  1J0R A;  5HS9 A;  1FOY A;  5K5Q A;  4LG3 A;  4XL9 A;  2EH3 A;  3OSG A;  5K5R A;  1JI8 A;  2ZFW A;  3RTR A;  3HOT A;  3FKJ A;  1U6G A;  4E7J A;  3H1C A;  1LE8 A;  4I76 A;  1XSD A;  2O0Y A;  3FDY A;  3AKZ A;  1X3Z B;  2Q2E B;  2KQR A;  3L2U A;  2EFW A;  3D5R C;  3M3Y J;  4LB5 A;  3BT9 A;  4Y52 J;  4P9U A;  4IHV A;  2VKE A;  5M5X J;  3DF8 A;  2IPQ X;  1W4M A;  1OCP A;  5HVQ C;  3ZQF A;  4EJO A;  1LFU P;  1BI3 A;  4HG2 A;  1G3Y A;  2E1M B;  4E7L A;  4NC7 A;  4E70 A;  3GYH X;  3S1R J;  3BPV A;  3JRI A;  1E0E A;  5HNH A;  2QQ8 A;  5DD4 A;  3CO7 C;  2QUF A;  3JSP A;  4IHS A;  1U5T C;  5CKT A;  4MTE A;  3QAH A;  2XC7 A;  1OCO H;  3R0A A;  4DZJ A;  3FMR A;  3IAS 2;  2HKX A;  4IL6 C;  4M3D A;  5BMZ A;  2KDO A;  5EGO A;  4JX4 A;  2L02 A;  1IRX A;  3DTK A;  2CQK A;  2ZSH B;  1HA8 A;  3LSH A;  4RAF A;  4DNC A;  3DWL E;  1LVA A;  4XLN F;  4I6Z A;  2J5O A;  4UUT A;  1X3U A;  3W3C A;  4AIK A;  4JX5 A;  4L9T A;  2XGD A;  2GM4 A;  1T8I A;  5DCM B;  2F6C A;  1D1C A;  1L0O C;  1S72 I;  3LSJ A;  3WTT C;  2DOA A;  2L7M P;  1JKP C;  2DPU A;  3FF5 A;  3WGH A;  1J75 A;  3ECH A;  1GVJ A;  4L9J A;  4DJA A;  1VQO I;  3H0D A;  1Y1V J;  3L9F A;  2DA5 A;  1ZRC A;  4XLE A;  4NQW A;  3H5N A;  4M9S A;  2R7S A;  2IGN A;  5HDG A;  3FXM A;  1RKT A;  2DU9 A;  4YEJ A;  2HVR A;  4AIH A;  4YFK F;  2FXA A;  4N0B A;  3KP2 A;  3T5X A;  1GV5 A;  3BLY A;  4B44 A;  1MGT A;  2P7V B;  2DXI A;  2DW4 A;  3HM5 A;  3DFG A;  1I39 A;  5JHU A;  4Z6Y A;  1J59 A;  4RGS A;  3PM1 A;  4NBQ A;  4NUB A;  2X4H A;  2LYC A;  3GCM A;  3IWZ A;  1MBG A;  3MZH A;  1RC9 A;  1OJL A;  1WQ2 A;  3OR2 C;  5D4R A;  4HV5 A;  1TW3 A;  1UHS A;  5DEQ A;  1VQ5 I;  2IEK A;  5J8C A;  3C18 A;  1AKH A;  4IKF A;  4ZYD A;  3QU3 A;  3N05 A;  1WGX A;  1XGN A;  4IJA A;  1BC7 C;  1K83 J;  3OOP A;  3BY6 A;  1PDN C;  2A61 A;  3E6B A;  3LQR A;  5C4J J;  4HNV A;  2EQR A;  1LJ9 A;  3CJQ B;  3KZZ A;  4HDV A;  4LG0 A;  1R58 A;  3F0C A;  3J7A O;  1MMD A;  1EF4 A;  1HXD A;  2QBY A;  4MFE A;  1MJB A;  5FLV A;  2WB1 N;  2Y0S A;  4U88 A;  4HF2 A;  3ML6 A;  5CYV A;  3WU1 B;  2QSH X;  3F8M A;  1U3E M;  3V7S A;  1VQ9 I;  4LOC A;  2QKL B;  2Y9Z A;  2LY9 A;  5CVR A;  1LB2 A;  4L0Y B;  2W00 A;  2TDX A;  4UB8 C;  4XLC A;  2OD5 A;  2L3D A;  2ZME A;  1MZB A;  2IVM A;  3FZV A;  3OV8 A;  1A36 A;  2CS3 A;  2EA2 A;  1SAX A;  2ELJ A;  4RAY A;  2RGV A;  2WAQ A;  2DA2 A;  2YSR A;  1IN6 A;  1BJA A;  2DLL A;  3Q0U A;  1Z6R A;  3K1M A;  2LRD A;  3LSG A;  3CDI A;  2DMT A;  3R61 A;  1BR1 A;  1B6A A;  4RBO A;  1R49 A;  3D1N I;  4PK4 A;  4NNJ A;  3LSP A;  3CCJ I;  1P6R A;  2EFP A;  4D7M A;  3I3L A;  1P2F A;  3KEY A;  2I8D A;  5HOO A;  2F4I A;  4CSW A;  2WV1 A;  3W6K B;  1WJA A;  3T0Y A;  2HOS A;  3H3V K;  2L9N A;  2CO5 A;  2Z16 A;  1FYM A;  1QPM A;  5LGU A;  2VB6 A;  1RZ4 A;  3H5A A;  2M9H A;  5D8K B;  1MBH A;  1APL C;  4G8X A;  2FBK A;  3CF5 F;  5K7Z A;  1CQT A;  1HDD C;  1UAA A;  4RAG A;  2QEN A;  4ETS A;  1GVD A;  3G1M A;  2QQB A;  2KIQ A;  2GBY A;  5D5U B;  2DI3 A;  2DMQ A;  4ZDP A;  2HFH A;  5LFA A;  5IYC J;  1FIA A;  4WX9 A;  4KUM A;  1U0J A;  2GXG A;  1KU2 A;  2CW8 A;  3GWZ A;  5CVI A;  4KT6 A;  2EIL H;  1U8R A;  1N77 A;  4L9N A;  1N75 A;  2P4W A;  4A93 J;  3S3M A;  2PMZ N;  4KYW A;  2HDW A;  1X1C A;  1SD6 A;  5HS8 A;  1MBE A;  5CPR B;  2A3S A;  4BS9 A;  4A3E J;  4AVZ A;  2GIZ A;  2LY1 A;  4RAZ A;  2BHZ A;  3HSR A;  4I99 C;  2CSO A;  3P7N A;  1I1G A;  1UJ8 A;  3OS1 A;  2OF7 A;  4LB6 B;  2RAE A;  5F0H A;  1IN7 A;  4M6X A;  2KIU A;  5F0F A;  1J09 A;  2ADU A;  3OSF A;  3LA3 A;  2ZNY A;  4HNT A;  2W4S A;  1HOM A;  2CFX A;  4M3B A;  5ERI A;  4M9Z A;  2JUC A;  3DP7 A;  4HRI A;  4X6A J;  3C2H A;  1LEB A;  3BCB A;  2X6Y A;  3VFZ A;  4CH7 A;  1OPC A;  3OS0 A;  4KDP A;  2O5R A;  1MKM A;  3L2V A;  1LEA A;  1V5E A;  3QQA A;  3ZMZ A;  3CMM A;  2DK8 A;  1EA3 A;  4HST A;  4BKX A;  1R4M B;  1B4A A;  4B4C A;  1IC8 A;  3GZN B;  1STZ A;  3E6D A;  3ISP A;  3J81 Z;  2Q0O A;  5FKN A;  3OYC A;  1Z21 A;  5M3M J;  4L18 B;  1WJF A;  2H1L A;  5B66 C;  2HTJ A;  2ZXJ A;  4BYY A;  1W0T A;  3EYI A;  2ICW G;  4RGR A;  4BXU A;  2H8W A;  1YX5 A;  2Z5U A;  4BE1 A;  3DBL B;  4V2F A;  1E3O C;  6PAX A;  4XOR A;  2OTL I;  1H0M A;  2R7V A;  1ERD A;  1OYY A;  2HQA A;  5KVR A;  1H88 C;  1JHF A;  2XF7 A;  1VFC A;  3PJR A;  3BR6 A;  4FCY A;  2W57 A;  2X1C A;  1POG A;  2W84 A;  4S05 A;  3TW6 A;  3S3O A;  4ZDL A;  3V7C A;  1UMQ A;  3LOC A;  2IJL A;  3OR1 C;  2E1N A;  3CQZ J;  3H5R A;  1H89 C;  3COA C;  3S2W A;  4LD5 A;  3P9C A;  3JAM Z;  5D6F A;  2ZSI B;  2OZ6 A;  2ZME C;  5AIP A;  2PI0 A;  4L5I A;  3CO6 C;  2HS5 A;  4EEF G;  4DIQ A;  4F55 A;  3SFI A;  2ZJR F;  3S1Q J;  1Y0N A;  2K3F A;  2HYJ A;  2R7Z J;  3W2W A;  1HW1 A;  5J8F A;  3Q3S A;  5DM6 F;  4ZJZ A;  5CVJ A;  4OAY A;  2X1D A;  2BXY A;  1F9N A;  3SDG A;  3ZRG A;  1ZLJ A;  1BBY A;  1ZK8 A;  1BC8 C;  1Z3Y A;  3O2P E;  2MH9 A;  1ETK A;  4XON A;  2HQN A;  1E3H A;  3CZ6 A;  4KJZ A;  1FOX A;  2DQL A;  3S1M J;  3K4L A;  4UV8 A;  2GXA A;  4BDY A;  3CC4 I;  4HF1 A;  3LFU A;  1KYW A;  4CCL A;  4E4H A;  4XRM A;  2QF7 A;  2I5U A;  4EJT A;  4B8X A;  3CLQ A;  2CQN A;  2NYX A;  2HYF A;  3HRT A;  3KZI C;  4KMU X;  2JTV A;  2HEO A;  3DKW A;  2BY0 A;  3BZ6 A;  5K7H A;  3PO3 J;  1B8I B;  1V3F A;  2D5V A;  3MQ0 A;  1TL8 A;  3AFH A;  4KN4 X;  3ZR8 X;  2DOF A;  1JUM A;  4RM3 A;  4C3H J;  3AL0 B;  2M8E A;  1XMK A;  2FD5 A;  5ICG A;  4H0E A;  3QPS A;  2PEX A;  3TP0 A;  1VQM I;  1BW5 A;  1R1U A;  2CU7 A;  4FIS A;  4OOI A;  2A69 F;  1J5Y A;  1D0Z A;  2MD5 A;  4IEJ A;  1XGO A;  3FXU A;  3TGN A;  4HQM A;  3UR3 C;  2JMW A;  1G3S A;  3P9I A;  2MW8 A;  1R23 A;  2LF7 A;  1FZP B;  4B48 A;  3LWF A;  3QPL A;  3HC7 A;  2G7U A;  2HPM A;  2IP2 A;  1ZR4 A;  1XS9 A;  3PQJ A;  5D8L B;  3I0T A;  2XUB A;  4YFX F;  5DM7 F;  1S7E A;  3DEU A;  1TLH B;  1RR8 C;  1E3P A;  4HW0 A;  5AIQ A;  1A35 A;  1SFO J;  2O61 A;  2HXI A;  3FXK A;  3EUA A;  3C2B A;  4MQ9 F;  3OYF A;  2P0W A;  4N9H A;  3DTE A;  5IY5 H;  4D7N A;  2GIV A;  4CHU A;  1OCC H;  2LBF B;  1RI7 A;  4Z2Y A;  1BI2 A;  2CRG A;  4FT8 A;  1DUX C;  2EFQ A;  2JZY A;  3SDB A;  3G2B A;  4DYQ A;  1OKR A;  2GLO A;  1ETO A;  2RC4 A;  3ABK H;  4XSZ F;  3MKW B;  1TWA J;  3I4M J;  3S1N J;  1USS A;  5A2Q K;  4HQE A;  2NNN A;  1JT6 A;  2L54 A;  3G3Z A;  1O3T A;  2R92 J;  4Q48 A;  3HL2 A;  1LDD A;  3ZP5 A;  3BG7 A;  4JOM A;  3TMO A;  1FT9 A;  1V55 H;  3I59 B;  3ZQL A;  3BDD A;  3JRE A;  4JBA A;  4ZZL A;  1ZG5 A;  3J81 K;  2IA0 A;  2MH2 A;  2OAZ A;  3PSI A;  4MIM A;  1K78 A;  3DV8 A;  2VE9 A;  1ON2 A;  5IP9 J;  4A3B J;  2EB7 A;  1HST A;  1RKW A;  1VF9 A;  2VBX A;  2JPB A;  1IV6 A;  3KP5 A;  3ZMT A;  5HOD A;  4G6Q A;  1PP7 U;  4CO8 A;  2MLG A;  2R5Z B;  4YIR X;  3QWL A;  4GGG A;  4EM2 A;  1MH3 A;  5GPC A;  2VLA A;  2E1O A;  4GO1 A;  2VON A;  3ABL H;  2TRT A;  4L5E A;  3TKY A;  3FBN B;  1O7F A;  1QHG A;  2JRT A;  3GZ6 A;  4LK0 F;  2K9Q A;  1MBF A;  1QZY A;  1XC5 A;  1SAN A;  1FWZ A;  1R6R A;  5HNF A;  2KHM A;  3CME I;  4FE4 A;  5ILU A;  4E7Z A;  3GTK J;  1VND A;  4EJW A;  4LIU A;  4AYB N;  3RPU A;  4Y3O A;  1ODD A;  3PNY A;  2EFN A;  1MD0 A;  3AAF A;  4ZTF A;  1IXS B;  3SQN A;  4WCG A;  2EIN H;  4HNU A;  1U5T A;  4AWX B;  2W82 A;  5IP6 A;  4IOC F;  4QLC U;  4CYD A;  4LK1 F;  2ZB9 A;  2O03 A;  3JAM K;  3CC7 I;  1REP C;  4P5O A;  3G4S I;  3GTM J;  3RYP A;  4IQJ A;  1IF1 A;  1IXC A;  2XAS A;  5D6E A;  4Y7N J;  4M3F A;  2BGC A;  2IXS A;  2HDC A;  2BE5 F;  1YJ9 I;  3E5U A;  1RUN A;  1MBK A;  3J80 Z;  4Q47 A;  3OYI A;  4HV6 A;  3VYT B;  2BW3 B;  1UHM A;  4L5J A;  2L4M A;  4I09 A;  5FKM A;  4MLO A;  3A0B C;  4JYK A;  2PFB A;  3E6M A;  2V6E A;  5ED4 A;  1SMY F;  4H4K C;  5H2F C;  2KPM A;  1MMS A;  3SYT A;  1KU3 A;  2MA3 A;  2XSD C;  2OJE D;  2F4O B;  4XOT A;  1TQI A;  3CCE I;  3KCC A;  5JR3 A;  4I2O A;  1G3T A;  2HQ5 A;  3N97 A;  2X6X A;  3GFJ A;  3LMM A;  1FMV A;  1T08 B;  3PNT A;  5E17 F;  2QKM B;  1LFP A;  1X1P A;  1OMI A;  1VQL I;  1MMN A;  3ERM A;  4A5M A;  1EKE A;  4XQF A;  3ASN H;  2NVY J;  3TOB A;  2IS4 A;  5E3L A;  1V5G A;  5CVV A;  1A04 A;  1ZR2 A;  4O6J A;  5FRO A;  2Z2S B;  3OIO A;  3FIW A;  1YJW I;  2B0L A;  2K4J A;  5F6F A;  3GUD A;  3I9V 2;  5EZH A;  2MG4 A;  4E7I A;  1MSE C;  1G6N A;  2JVG A;  2ID3 A;  2KT0 A;  2XDV A;  5LEJ A;  2QEX I;  2DCE A;  3K1N A;  2ME0 A;  2M7A A;  2X9D A;  4UUV A;  2HOA A;  2MC4 A;  2GOX B;  3BG6 A;  3GTL J;  3L7W A;  3HOV J;  3GW2 A;  2V9V A;  3T1B A;  3OYD A;  1Z77 A;  1GHC A;  2ETH A;  4FX0 A;  1GUU A;  2EBI A;  2HR3 A;  1Q1H A;  3IKV A;  1KA8 A;  2CUE A;  3OIP A;  3I55 I;  2L9R A;  3M1E A;  1WHU A;  3S2D J;  1T33 A;  2O8K A;  5CLS A;  1YG2 A;  1HSJ A;  2XRL A;  3KP6 A;  5BQT A;  2IS2 A;  2VXZ A;  4KIT B;  2PN6 A;  3VYR B;  1OLT A;  2VQL A;  1P7I A;  2DJI A;  2CUF A;  3ONQ A;  3SZG A;  3QPH A;  4Y17 A;  1UG2 A;  3WTS C;  2JQ7 A;  1X4O A;  2M5W A;  2R7X A;  2O3F A;  2DPD A;  4JX6 A;  4A6E A;  3B6C A;  5FD5 A;  1DPU A;  1YFH A;  3B73 A;  2LTP A;  3K4K A;  3PIO F;  3DBR B;  4V2G A;  4PSW A;  4A3L J;  1MJ9 A;  2OV7 A;  2PJR A;  2Z99 A;  2K4B A;  2A07 F;  1S7O A;  3FWE A;  3IH2 A;  4A3J J;  3KEO A;  5ILV A;  1IN8 A;  3GME A;  2ZBK A;  2LRE A;  3K0L A;  4Y4R A;  1IJW C;  1JUP A;  3J7Z I;  1KU7 A;  3ZOB A;  1FOW A;  1NH3 A;  3K4C A;  2FUG 2;  2D1H A;  3NAU A;  3RKX A;  2EV6 A;  1MJA A;  2MSY A;  4ENJ A;  3ZMD A;  1WJE A;  4I02 A;  1BI1 A;  1VQ6 I;  2DA1 A;  2M34 A;  4BAY A;  4HBL A;  2R93 J;  1J2X A;  3HKZ A;  4BXX J;  4A12 A;  1Z05 A;  2DT7 B;  1FY7 A;  2P7C B;  1TTY A;  4BY7 J;  2ZJP F;  3GTG J;  4HX4 A;  4UV9 A;  1YRN B;  2IGK A;  3AG1 H;  3WG9 A;  4IX7 A;  5E1Z B;  5L3B A;  2E2J J;  4FET A;  3OS2 A;  2LR8 A;  1IXR C;  3RKW A;  1HW5 A;  2YU3 A;  2WC2 A;  2F5F A;  3E3V A;  3FM5 A;  4Q4Z F;  2KJB A;  3HOU J;  4OAZ A;  2A6H F;  1Z3X A;  5EF6 A;  3FXO A;  2D45 A;  3AG2 H;  3HHG A;  4M6V A;  1E2X A;  2OCE A;  3M8F A;  3ZQI A;  3J80 K;  4U7D A;  1X2M A;  1Y8R B;  1O3Q A;  4G6D A;  3BZK A;  4KIF A;  1JKR C;  2FBI A;  5TGT A;  3Q0W A;  1YIT I;  3MKZ A;  2XB5 A;  2JK3 A;  3TW7 A;  4G12 A;  1MBJ A;  3LA2 A;  3MZY A;  5EG0 B;  3GO5 A;  3VYS B;  3BZC A;  4XRF A;  2E5N A;  3IP4 B;  4EAT A;  2AXL A;  2NOG A;  4NC8 A;  3ZQG A;  3SZP A;  1U78 A;  4XN3 A;  5LHG A;  1ITY A;  3OL4 A;  1Y6I A;  3CES A;  2V9K A;  4JK1 X;  5F08 A;  1AA7 A;  5DV5 A;  2GOM A;  2EV0 A;  4LIT A;  2KMU A;  2NS0 A;  2ZJQ F;  3ROU A;  2K3P A;  4B43 A;  3U2R A;  3G71 I;  3E7L A;  2PMH A;  3WTY C;  2VOP A;  2ZXW H;  1HKQ A;  2KIF A;  2IW5 A;  1UG0 A;  5LHI A;  3X2Q H;  1K7A A;  1Y56 A;  2K40 A;  3A01 B;  1W7P A;  1WVR A;  3VB2 A;  2K5C A;  1UZC A;  1VI0 A;  4PZJ A;  4ESF A;  3S17 J;  4QSH A;  3A2K A;  1CF7 B;  3ZQ7 A;  3I58 A;  3K9T A;  2DK5 A;  3M4O J;  1DQU A;  1SAU A;  3O8H A;  4UUS B;  2MC3 A;  3PFY A;  5E1W A;  4D1Q A;  2VPL A;  4WXC A;  5CQE A;  2CW0 F;  1I6X A;  3DEW A;  2HZT A;  2V4J C;  2VT3 A;  1UB9 A;  3ERE D;  4U0W A;  2LVS A;  3HSF A;  1SFU A;  2L01 A;  2OZU A;  2PQ8 A;  4BJ5 C;  3OOU A;  5HLG A;  4KIS A;  1D8K A;  3CUQ B;  3R6S A;  5GTI C;  1PYV A;  2Y0S N;  2GZW A;  4BJT A;  2RKH A;  2R7O A;  4XLH A;  5IPA A;  2Q2E A;  1ZHF A;  1LDJ A;  3ELK A;  3IUO A;  3F6O A;  1HBX G;  4E7H A;  1B59 A;  4UXN A;  3HIF A;  2WAE A;  2Y48 A;  4A2U A;  3WTU C;  1JUS A;  4CCO A;  4M73 A;  4KIC A;  4ZYG A;  2ISY A;  3NRV A;  3QPT A;  5BNG A;  1MIJ A;  4IRG A;  2DYR H;  3BQZ A;  1MDM B;  4WXH A;  3RQI A;  4YIF A;  2WAQ N;  1TT5 B;  1GV2 A;  2XAG A;  4FX4 A;  2P81 A;  2QSF X;  2EJR A;  3FM3 A;  2EIJ H;  2JJ7 A;  1X4P A;  2WAD A;  4QTR A;  4XKV A;  3NQO A;  1XG1 A;  3FXR A;  2VBW A;  1DP3 A;  2STW A;  2MBF A;  2K85 A;  2VN2 A;  2X51 A;  1LNW A;  5FLX Z;  3CTA A;  4BE2 A;  3GX4 X;  2DFE A;  2TCT A;  5DD8 A;  1JTX A;  5HS7 A;  4HZF A;  2HZD A;  3MWM A;  3S93 A;  3L00 A;  2EK5 A;  1LVK A;  3G6E I;  4O5V A;  4KIG A;  5F27 A;  2M0C A;  5DCM A;  1Y8Q B;  3RIR A;  2C6Y A;  3GF2 A;  2L9S A;  4EMS A;  3L2Q A;  1ZQ3 P;  3WE3 A;  4FAS D;  3HDD A;  3B6A A;  3BJA A;  2V1N A;  4C3I J;  3P9K A;  1I3Q J;  5GP9 A;  4AM3 A;  2FOW A;  1YE9 A;  3K2A A;  2VJ4 A;  3HOS A;  3ZMV A;  2KZG A;  4P96 A;  2CMP A;  2X85 A;  4PSX A;  1OIS A;  1DPR A;  1EH6 A;  3KX2 A;  1K6O A;  1BA5 A;  3REO A;  3ZMS A;  3MVP A;  3HGY A;  2WTE A;  3F8C A;  4A3G J;  2V26 A;  2PMU A;  1B9M A;  2KJC A;  2NNY A;  3DPU A;  4NC6 A;  2IA2 A;  1I3A A;  1ZEL A;  3DKX A;  3OYH A;  2JSC A;  1DGR M;  2CWE A;  1ONV A;  2HGC A;  4ZYH A;  5F1J A;  1K4T A;  1I1S A;  1IV8 A;  3KYC B;  3HTU A;  4OIP F;  3V42 A;  2CJJ A;  1O4X A;  1B72 B;  2H1K A;  1X1D A;  4A0X A;  4ABZ A;  3CCR I;  1FSH A;  1IUY A;  2D2W A;  2FRH A;  1Z91 A;  5IYB J;  3IL2 A;  4J00 A;  3U1D A;  1YTY A;  1A6I A;  3C7J A;  4HF0 A;  3RKY A;  1FP2 A;  4A3F J;  1GLN A;  3WTW C;  3HOX J;  4C3J J;  4YG2 F;  1P9Q C;  3SHF A;  1N78 A;  1QVT A;  3IAM 2;  3HRS A;  3QOD A;  2DDB A;  4DGW B;  3I53 A;  3MMY B;  1QVU A;  5ICF A;  2W7N A;  5D5V B;  1Z67 A;  5CJ9 A;  5L3F A;  2GAU A;  4DW6 A;  5FRM A;  2KRC A;  2R5Y B;  2DO7 A;  3W2A A;  4P9F A;  5DYM A;  3BJ6 A;  3ASO H;  3NWT A;  2GXB A;  2OPT A;  2LDU A;  2E2H J;  3O3K A;  1JTY A;  2JA7 J;  2P6S A;  2QWW A;  1FYL A;  2GWR A;  3GBG A;  4IQ4 A;  4UHT A;  2P6T A;  3FXL A;  4D0P A;  3HJE A;  2UUZ A;  1QA6 A;  3S15 J;  4UNO A;  2M3A A;  2HNH A;  1P7J A;  2LKS A;  2M4K A;  4PGH A;  2R7W A;  2CGP A;  3HUG B;  2L7K A;  5CQG A;  3T8T A;  4DOZ A;  1MH4 A;  5JHF A;  4ZH4 F;  3BPX A;  1ZRE A;  2QGU A;  2NVU B;  1EV7 A;  5TRD A;  1JKO C;  2V7F A;  2NXN B;  3JW4 A;  3TO9 A;  2ACJ A;  1F4K A;  1EH8 A;  5B5E C;  3CP2 A;  3K10 A;  3BR1 A;  5C3E J;  3V8J A;  1ZG1 A;  4U87 A;  5BPD A;  1SMT A;  3A4C A;  1J9I A;  1VQP I;  3BRO A;  1XGM A;  5E3M A;  3KET A;  3IWF A;  5LLQ A;  2E19 A;  2UZK A;  2VBY A;  2E1M C;  4BHC A;  3FKI J;  2DBB A;  3VDX A;  3QU6 A;  1JT0 A;  1U2W A;  3DKY A;  2HOE A;  4EM0 B;  3LQQ A;  5LD2 C;  4MHG A;  5FLX K;  5C44 J;  4I0B A;  4K2E A;  1BOB A;  1FLI A;  2H94 A;  3A1Y A;  2R4G A;  3HOY J;  4PJM A;  4MNU A;  4EJV A;  3H3U A;  3SEQ A;  1PUF B;  3RI4 A;  1BIA A;  2GA1 A;  2L0K A;  4HAM A;  3SXY A;  2EZI A;  3OL3 A;  1LDK B;  1N25 A;  3K70 C;  2XAJ A;  1LPQ A;  1S3J A;  1R5I D;  2GA2 A;  3TO7 A;  2DMN A;  3RPQ A;  5EYR A;  1Z7L A;  1K79 A;  1IN4 A;  2FBH A;  2QM3 A;  4RB2 C;  2KFD A;  1SD4 A;  4RM2 A;  4UB6 C;  4F93 B;  1SEU A;  1VQK I;  1HLV A;  1I5Z A;  3BG9 A;  1EJ9 A;  2PJP A;  2FQ4 A;  2QQA A;  4Y13 A;  3JCU C;  1ORK A;  4UVA A;  2FU4 A;  2QLZ A;  1IAW A;  3GFL A;  3ZGK A;  3W6V A;  5ICE A;  2PG4 A;  3HTS B;  1UEL B;  2AQE A;  2Y75 A;  4IHX A;  3V8L A;  4RDU A;  1ZAO A;  2JN6 A;  2ELK A;  1Y0U A;  4BHP A;  2HPI A;  4LLL A;  2E7W A;  2M30 A;  3DQV C;  1E17 A;  1WJ5 A;  3HZJ A;  2QYO A;  2Z1D A;  4HDU A;  2JUG A;  1OFC X;  2LMD A;  5HLI A;  5F1R A;  4AUX A;  4DZP A;  5B3S H;  2V6C A;  3I56 I;  1BL0 A;  2JA2 A;  3F8B A;  2VOO A;  4DYR A;  4FHT A;  3CCQ I;  2DN0 A;  2O7O A;  1FYK A;  2FJ1 A;  2H8R A;  4AIJ A;  1IDY A;  5FFX A;  2FQ3 A;  2WAF A;  2A5Y B;  3VOD A;  2VI6 A;  1JXS A;  4BEH B;  4A3M J;  2IBD A;  3CUQ C;  3GFM A;  3Q9V A;  1TP4 A;  1D0Y A;  2OC6 A;  3A03 A;  4MTD A;  5D4S A;  4AVP A;  1WCM J;  1EH7 A;  3H9J A;  5J47 A;  1BM9 A;  3WU2 C;  1IG7 A;  1ZH5 A;  4UY8 I;  4E7K A;  1YIO A;  2XGC A;  2XAU A;  3HG9 A;  3I4P A;  1YW9 A;  3TDZ C;  3OYN A;  4KT5 C;  5J3L A;  4D5C A;  2J5P A;  5KNL A;  3WGG A;  5LGT A;  4XR6 A;  3F72 A;  1ZGW A;  2KKO A;  1YJN I;  3Q0V A;  1OR7 A;  3F8F A;  1T39 A;  4XKB A;  3HYI A;  2VUM J;  2DFF A;  3CUO A;  3ZQQ A;  2L9V A;  3HHH A;  3I4N J;  2EA4 A;  4LMY A;  2FF4 A;  3D0S A;  2DFH A;  1KQ0 A;  4HX8 A;  5IOY A;  1BOA A;  2X6W A;  2VC1 A;  4A3K J;  2Y9Y A;  1ON1 A;  2CG4 A;  3WGI A;  2F5V A;  3DLA A;  4OWR B;  4CYC B;  3CD6 I;  2XAH A;  4B09 A;  2HU9 A;  2VOD A;  1G8X A;  1W5C C;  3RZD J;  3OYJ A;  1BN5 A;  5FB2 A;  2RN7 A;  4QWQ A;  4PJ0 C;  3VSK A;  2DT6 A;  1D8J A;  1XX5 A;  4EJU A;  1QU3 A;  5J1Y A;  3MKY B;  3RSN A;  2RRE A;  2XVC A;  3JRH A;  2CYY A;  2KRH A;  3WHC A;  5E20 A;  3DPL C;  4LIV A;  4RB1 A;  4Q5S F;  1XD7 A;  3OYB A;  1DGW Y;  3MCZ A;  2CQQ A;  1Z0X A;  1HW2 A;  2A6E F;  2HOT A;  4CDG A;  3TO6 A;  2L5Q A;  2JWT A;  2M87 A;  3J7Y J;  5E3N A;  1UHW A;  3EUH A;  1ZYR F;  4XIC A;  2A68 F;  1B8I A;  2H6C A;  2XKO A;  4MEY F;  4RS8 A;  4MEX F;  4CUG A;  3FMQ A;  5C4X J;  4BQN A;  3CF2 A;  4C2U A;  5HLH A;  5TJJ A;  3KIO A;  2Y2Z A;  3V8K A;  3KE2 A;  1XMX A;  1F43 A;  3DU6 A;  4PCQ A;  4M71 A;  2DA6 A;  2XRN A;  4N4O B;  4B3A A;  3PFI A;  1JHH A;  5K7F A;  3CC2 I;  3A02 A;  1T38 A;  1LUJ B;  1S9H A;  4KN7 X;  3QOP A;  2HDD A;  5GAH J;  5BOX A;  3I71 A;  1WRJ A;  3F6V A;  2ESN A;  2G9W A;  2B7E A;  1ZN2 A;  2ZKZ A;  2ISZ A;  3FMS A;  2L4A A;  2BOL A;  2VXD A;  2BHY A;  3MFK A;  4P1W A;  4OMZ A;  1ACI A;  2V9P A;  4RGX A;  2MYS A;  2DJN A;  2X48 A;  1X58 A;  3TP3 A;  3N4M A;  3GVA A;  2LBF A;  3CP8 A;  1LE8 B;  1I6H J;  1XDU A;  4FQG A;  1KQ8 A;  2P5V A;  2MAB A;  1TNT A;  2FSW A;  3M1C A;  1A31 A;  2ZXH A;  2K7L A;  2EV5 A;  3GEZ A;  3AG3 H;  5K5O A;  4RMN A;  4RGU A;  1W36 C;  2JA5 J;  1HKT A;  2FMY A;  4UVB A;  2YX4 A;  1YLF A;  4BL0 B;  2ZXI A;  3IHU A;  4FTH A;  4A5N A;  4A69 C;  1YQA A;  2OQG A;  1YOV B;  3I59 A;  3RPU D;  1VQ4 I;  4M9X A;  4N9I A;  4IO9 F;  3MEX A;  1R22 A;  1Z6T A;  2WV0 A;  3ZMU A;  3ZQC A;  1O57 A;  4I01 A;  1FNN A;  2VQC A;  4UVC A;  2LC2 A;  3U9G A;  4G94 A;  2JA8 J;  1WJC A;  3U1K A;  1R4N B;  2ZC2 A;  2ZCW A;  2R5Z A;  1GXP A;  2HI3 A;  4C2M J;  2W85 A;  1YYV A;  3Q9S A;  4R79 A;  5L3E A;  5EGO B;  2JPC A;  2FE3 A;  3H35 A;  3LSR A;  4A3D J;  2XF5 A;  4FE7 A;  5LGN A;  3G1O A;  3H36 A;  2E1C A;  2M4G A;  1OCT C;  4A3C J;  3PL8 A;  4F92 B;  2XF6 A;  1X3W B;  2KLO A;  2PBI A;  3DU5 A;  2OTJ I;  2LKX A;  3MN2 A;  2Y31 A;  3CMA I;  2EZK A;  4I0A A;  4LGW A;  3OYG A;  4HLX A;  1LQ1 A;  5EEH A;  3OIQ A;  5E8G A;  3FXJ A;  1IDZ A;  2XSJ C;  2IT0 A;  1D3Y A;  3E0J B;  2DOD A;  3JR9 A;  2N8G A;  2W25 A;  3DXJ F;  1YI2 I;  1MMA A;  4EM1 A;  5DS9 A;  3CCL I;  3PSF A;  1OR7 C;  4B3X A;  3L2R A;  3BOQ A;  3TED A;  1QZE A;  4HSR A;  2NVT J;  3DPT A;  4XK4 A;  4NQW B;  2VAS A;  4DBR A;  2FOK A;  2B9S A;  1FMW A;  2IS6 A;  3QYB A;  2UXX A;  3HKZ N;  1WZ2 A;  3VEP A;  3CCV I;  4IZZ A;  4M3G A;  2V1X A;  2XGX A;  4HLY A;  3ABT A;  2IA1 A;  1ETV A;  3W6J B;  2RNJ A;  4IOA F;  2BW3 A;  1OYW A;  1H9G A;  1SFE A;  5GAG J;  2EIM H;  4G7O F;  1RNL A;  5L3D A;  2XGE A;  4D9J A;  2H27 A;  3WG7 H;  4AD9 A;  5HDN A;  2VIX A;  4M74 A;  5IP7 J;  5IT3 A;  3CDL A;  3H3Z A;  1XDS A;  2DTR A;  2ELH A;  2EZH A;  3EDP A;  4ON0 A;  1RR7 A;  1M1E B;  5EEA A;  4M3E A;  1GDT A;  1AKH B;  2IGM A;  3UNG C;  4HOB A;  2CV0 A;  3R4K A;  2R7F A;  3L1P A;  1FTT A;  1KON A;  3JRG A;  1ZTR A;  3QOE A;  2A05 A;  3EUH C;  2COB A;  2P5K A;  5J4V A;  4LG0 B;  1XB4 A;  1TWC J;  5FLM J;  2XPV A;  5FKO A;  4IRH A;  4CA0 A;  2CW7 A;  1V5F A;  3AL0 C;  2QBY B;  4ZYA A;  3ABU A;  1G4D A;  4BGD A;  2LKP A;  1LKX A;  1P4X A;  3PNV A;  4PJN A;  5CVU A;  5FD6 A;  1H8A C;  4V19 K;  3KP3 A;  4C30 A;  2F5C A;  2X1E A;  2BEO A;  2AO9 A;  2W48 A;  4AC0 A;  1F5T A;  2JA6 J;  3RZO J;  4GYG A;  2ZO4 A;  3I5U A;  3EQL F;  4BY1 J;  5J40 A;  1NHA A;  2W1O A;  4XOP A;  5JVT A;  2ZME B;  2VQG A;  3L09 A;  2EFO A;  4DYC A;  4RB3 C;  1IW7 F;  3O6B B;  4M6Y A;  3WU0 A;  2RVC A;  3ZCO A;  3CJN A;  2R7T A;  3M7G A;  3BC8 A;  3CCS I;  2KRF A;  2YX7 A;  2JT1 A;  5F0C A;  1JJ8 C;  3IH3 A;  2UWM A;  4G7H F;  1FOK A;  2COM A;  4G7Z F;  2K9M A;  2IRF G;  1VZ0 A;  4M72 A;  4CCK A;  4IRI A;  1YIJ I;  1FPQ A;  1Y1W J;  4ZZD A;  3VSL A;  2FNA A;  5KAF C;  1RRJ A;  2EWN A;  3NAR A;  2JRM A;  3K2Z A;  1R36 A;  3KP4 A;  3OYK A;  4KNY A;  2FNP A;  3JTH A;  5H20 A;  4N4N B;  4F52 A;  4LJZ F;  3TQN A;  1D5V A;  1KQ9 A;  4ZC3 A;  1ZRD A;  3C1D A;  4BBR J;  4R1H A;  3K6G A;  1IRG A;  3LSK A;  3WTX C;  4BNC A;  1ETQ A;  1TNS A;  2K02 A;  3SEZ A;  1QZZ A;  3JRA A;  5JI6 A;  3FHZ A;  4ENK A;  1SD5 A;  4QPO A;  1YS6 A;  3EUK L;  5J1U A;  5TIS C;  2WWY A;  1PVE A;  4S04 A;  1W1W E;  1WJD A;  1R9T J;  3CJT B;  2XV4 S;  3WHB A;  2XRO A;  2VBZ A;  1T2K A;  4NDL A;  3K4B A;  2DMU A;  1JE8 A;  4XBF A;  3HOZ J;  5LRS A;  3GLX A;  5B1B H;  1JJ6 C;  1QBJ A;  2KL4 A;  2IAI A;  4D5F A;  4ESB A;  4BHB A;  4ENM A;  1MNE A;  1T98 A;  3LST A;  1YRN A;  4ENN A;  3BP8 A;  4RLF A;  5BS6 A;  3BR0 A;  3IH4 A;  4PJL A;  3H9G A;  2I10 A;  2L2O A;  3H92 A;  2OQR A;  3ZN0 A;  4CCN A;  2E7X A;  3GTQ J;  4EQQ A;  5M5Y J;  4XID A;  3I54 A;  3S3N A;  2W24 A;  5K1Y A;  2ZJ2 A;  2XKP A;  5LHH A;  2LH9 A;  1QQI A;  4X0G A;  2VPR A;  4OIN F;  3JTG A;  4W97 A;  2Y0M A;  3BTC A;  3WE2 A;  3KZY A;  1AU7 A;  1W7P D;  3E6C C;  2DT5 A;  2RDP A;  4GCV A;  2HKO A;  5E8I A;  2JSP A;  5F64 A;  4C9Y A;  5ICC A;  4E6K G;  3GZ5 A;  5LRR A;  1OYI A;  5EG0 A;  2QSG X;  1Q1V A;  4U0Y A;  1YHQ I;  2OUM A;  1JGS A;  2O6G E;  4YFN F;  1ZGJ A;  1IGN A;  3HPH A;  3MKL A;  1SVL A;  3SZT A;  5GAE J;  5DDG A;  3JRC A;  2DFI A;  2AS5 F;  4OMY A;  3J7A Y;  4PFO A;  2WB1 A;  4KIB A;  1ULY A;  5FO5 A;  2FEZ A;  1NK2 P;  4CXF A;  5L3G A;  4PGG A;  5EJC A;  2LY2 A;  3BJO A;  3FBI B;  5JVG F;  2LLK A;  3LSI A;  1SFX A;  3LAP A;  4ANJ A;  1TW2 A;  5FKK A;  3T8R A;  1X19 A;  3JRB A;  2AXT C;  4EGZ A;  3ZPL A;  3KP7 A;  5FRN A;  3QYF A;  3SJM A;  3A01 A;  1KGS A;  1V4R A;  3TBI A;  1R71 A;  1MNM C;  2GQQ A;  2EIK H;  1TC3 C;  4XNF A;  1CF7 A;  3IKT A;  1F1Z A;  3F3X A;  1J7K A;  1P92 A;  3FHN A;  1XSV A;  1Z1D A;  4BQQ A;  4UUS A;  3HOW J;  4Y15 A;  3TDU C;  4GRI A;  4OU0 A;  1VQ8 I;  3PQK A;  1RUO A;  2LK2 A;  2WY8 Q;  1RET A;  3S2H J;  3GFI A;  1T95 A;  2XPU A;  2VC0 A;  5AON A;  2PX9 A;  3IRQ A;  2Y69 H;  4XKW A;  1HCR A;  4O3M A;  1O3S A;  2WA0 A;  2DTZ A;  3BTJ A;  2BVM A;  1PP8 F;  1XMA A;  3CUQ A;  2R3S A;  4II2 A;  4IPA A;  1P4A A;  4XM3 A;  1T0F A;  2XPW A;  1WH5 A;  4G9Y A;  1S7A A;  2NS8 A;  2M0M A;  1FBQ A;  1S6L A;  4YRV A;  2E5Z A;  2VKD A;  5E3O A;  5M5W J;  4ZTJ A;  3KLO A;  5F04 A;  3K70 D;  3CCU I;  3U21 A;  1U9O A;  1FEX A;  1XN7 A;  2XAF A;  4NHJ A;  3TL4 X;  3HGG A;  4LFU A;  1TQP A;  5FGM A;  2KIS A;  2VE8 A;  2R0Q C;  5GTH C;  1LFB A;  3VPR A;  1MDM A;  1ETX A;  5IYD J;  3E5Q A;  4KA4 A;  4JP0 A;  1F36 A;  3H0G J;  3WTZ A;  4X1E A;  2RNG A;  2OBP A;  3CCM I;  1SFK A;  2CFO A;  3CDH A;  1X1A A;  1O7L A;  2M2E A;  3ZN1 A;  4L9V A;  5J1R A;  2MGQ A;  2LD5 A;  1WI9 A;  2PMZ A;  1OCR H;  3RDI A;  2E60 A;  1ZGA A;  4HX7 A;  1IN5 A;  4W1U A;  3PUB A;  3ECO A;  2K86 A;  2LG4 A;  3O8G A;  2EPF A;  4U7B A;  1Z7U A;  1MW7 A;  4BJ6 C;  3F22 A;  4LLG F;  1RIO H;  5JLX A;  2E71 A;  2MFZ A;  4ZDO A;  3OWT A;  1XPX A;  5A2Q Z;  1WJB A;  3DCF A;  2ECC A;  3BTI A;  3KFW X;  1FTZ A;  2LSO A;  2Z3Y A;  2CV2 A;  2HXO A;  5DCF A;  3OYL A;  1WKM A;  3BR5 A;  2DOE A;  2YU9 J;  3KPH A;  1KZH A;  2UXN A;  4J19 A;  3BG3 A;  4HEA 2;  4ZYE A;  2VKH A;  2LF8 A;  3EYY A;  1MMG A;  3KYD B;  3OY9 A;  1WFX A;  5BPI A;  3H9Q A;  2VKV A;  3KEQ A;  4XMY A;  1R7J A;  3BR3 A;  2YS9 A;  3RJP A;  1NG7 A;  1BW6 A;  3ULQ B;  4KFC A;  4C2T A;  4RB0 A;  3S8P A;  2ME6 A;  3CLO A;  2QZ8 A;  1QHH D;  4IF4 A;  2V1D A;  2X6O A;  5J4Y A;  1TWG J;  5KCM A;  3IV5 A;  4PJJ A;  1FIP A;  1HC8 A;  2K27 A;  2KIM A;  1FC3 A;  3SFZ A;  4YII A;  2XAQ A;  3LNQ A;  2F5E A;  2E35 A;  5LBQ A;  3DBH B;  2NRA C;  3M9A A;  2Y30 A;  1B72 A;  1VTN C;  2CUZ A;  3HB9 A;  4IHY A;  1YW8 A;  5GPA A;  1JKQ C;  1ZG3 A;  2BVL A;  3RQ4 A;  4B1R A;  4AID A;  2NAZ A;  1YS7 A;  3HXL A;  4J01 A;  4B47 A;  1K78 B;  2X0L A;  3DLL F;  1IRZ A;  1L3L A;  2QCO A;  3E5X A;  1AOY A;  2E34 A;  3OYM A;  4EGY A;  4XRS A;  1QO0 D;  1R00 A;  1QPI A;  3HRM A;  5JLW A;  4YEL A;  2BBY A;  2KP6 A;  3CMY A;  4GFB A;  5EZG A;  3D5S C;  4QIW N;  1U9N A;  5IT9 Z;  2FML A;  2R5Y A;  4OIO F;  1K6Y A;  2NOJ B;  2KZV A;  1DU6 A;  4CGZ A;  1HF0 A;  1SD7 A;  4PDK A;  5JFR A;  2VJJ A;  1SC7 A;  2MLK A;  4TV7 A;  1YW7 A;  1MSF C;  1HDP A;  2OU2 A;  5M3F J;  2AQF A;  4CCM A;  4ESJ A;  3IC7 A;  3LA7 A;  4WXD A;  3VOE A;  1OCZ H;  2NS7 A;  1O3R A;  1XSX A;  1U5T B;  1SVO A;  2G0E A;  2YPR A;  1FX7 A;  3I64 A;  3FIS A;  3LL7 A;  2DA4 A;  5FKL A;  1T56 A;  2RV8 A;  2EZL A;  1XCB A;  2LP0 A;  2H6B A;  1TBX A;  3GXO A;  3MAJ A;  5HLT A;  1KYZ A;  3E1S A;  3HUG A;  4XLP F;  2Q8K A;  1FJL A;  2K9L A;  4EVI A;  1T0F C;  1RES A;  1PUE E;  3S32 A;  2NVQ J;  3D5L A;  3S14 J;  9ANT A;  1XCV A;  1WWX A;  1ETW A;  3GTO J;  2F4M B;  3MZ8 A;  3FK7 A;  3NEU A;  1X2N A;  5KHD A;  3R0J A;  4S0H B;  2VQH A;  5EDN A;  1YX3 A;  3CJR B;  2QVO A;  4AU7 A;  1W5S A;  1IUF A;  5D5W B;  5DUK A;  5H6Q A;  3HPG A;  1U8B A;  2DA7 A;  4Y33 A;  1BR2 A;  1B9N A;  2VJ5 A;  4E7S A;  1SVM A;  3PIP F;  2RQP A;  5E1X A;  2WY7 Q;  4BXF A;  1W0U A;  4XLA A;  1IRF A;  2FX0 A;  4A6D A;  2CQX A;  1GXQ A;  1WSU A;  2VL8 A;  4F91 B;  1NTC A;  3JRD A;  3W2V A;  4II3 A;  2CV1 A;  1W36 D;  2PLY A;  1R5H A;  1AHD P;  2DYS H;  1PUF A;  2F48 A;  1WH7 A;  2VT2 A;  4OIQ F;  1OQY A;  1X1B A;  3M8J A;  1NK3 P;  1TWF J;  5ILS A;  4I98 B;  3BG5 A;  1HKS A;  1UST A;  2L7F P;  5GAD J;  2DAO A;  4HA8 A;  3L2W A;  2E36 A;  3F8N A;  1CGP A;  4A0Z A;  4U0V A;  4IHT A;  1HQC A;  1I50 J;  1XGS A;  1DDN A;  4BDZ A;  1ZLK A;  1D1A A;  3R60 A;  3B02 A;  2B63 J;  3BTL A;  4GXO A;  5KK1 A;  1BIB A;  4WF2 A;  3BCA A;  3ABM H;  4IXA A;  2NVX J;  3S16 J;  3QP6 A;  2KDZ A;  2CUJ A;  2QA4 I;  1UFM A;  2ID6 A;  5IOZ A;  4BQO A;  4BAC A;  2BY2 A;  5E79 C;  5DUI A;  1D0X A;  3BR2 A;  2O8X A;  4BH9 A;  5EEG A;  2Z9O A;  2K9N A;  1V54 H;  2M8G X;  2V79 A;  3QYE A;  4F7Z A;  5LEK A;  3HRU A;  1ZRF A;  1K61 A;  4GDF A;  4MGR A;  1ETY A;  5FJ8 J;  4L0Z B;  2R7Q A;  1G2H A;  2DA3 A;  4ASN A;  4G6T B;  2BXZ A;  4PFP A;  1QNT A;  1Z9C A;  2R7D A;  3AG4 H;  3DEE A;  1K4S A;  2OA4 A;  3HBL A;  4IVN A;  2ESH A;  3CCY A;  4GYI A;  2D1V A;  4NB5 A;  3WOD F;  1NG6 A;  5B1A H;  3QRF F;  1P4W A;  4BEH A;  3ESW B;  3FX3 A;  1QRY A;  4MO7 A;  4AYB A;  1PJR A;  3EET A;  2PJR B;  2LOO A;  1I27 A;  3IRR A;  1A5J A;  2QQ9 A;  3PUF A;  3RCO A;  1BJZ A;  1G3W A;  2LFB A;  1IO2 A; 
#chains in the Genus database with same CATH homology
 3RZO J;  3S1M J;  4A3I J;  3BQY A;  4BY1 J;  4MFD A;  4XRM A;  2QF7 A;  1ENH A;  4DYC A;  5K7H A;  3PO3 J;  5F1J A;  1B8I B;  2D5V A;  1RPW A;  2CJJ A;  1O4X A;  1B72 B;  1JUM A;  2H1K A;  4C3H J;  2FD5 A;  4ABZ A;  5F0C A;  3QPS A;  1BW5 A;  3TP0 A;  1JJ8 C;  3IH3 A;  2CU7 A;  4XRS G;  5IYB J;  4FIS A;  1JGG A;  1A6I A;  4IEJ A;  1Y1W J;  4CYC A;  4A3F J;  3NAR A;  3HOX J;  2JMW A;  4C3J J;  1TWH J;  2MW8 A;  3HEF A;  2AHQ A;  2XB0 X;  1QVT A;  3QPL A;  1ZR4 A;  1XS9 A;  3GTJ J;  1D5Y A;  1QVU A;  3K7A J;  1S7E A;  4BBR J;  3JRF A;  2K9S A;  3PO2 J;  2YUS A;  1SFO J;  2HXI A;  3C2B A;  1ETQ A;  4DW6 A;  2R5Y B;  3FK6 A;  4D7N A;  3JRA A;  1GT0 C;  2CRG A;  5J1U A;  4BBS J;  2O9L A;  2OPT A;  1R9T J;  2E2H J;  3WHB A;  4DYQ A;  1JTY A;  2GLO A;  1ETO A;  4NDL A;  3HOZ J;  2DMU A;  1TWA J;  2JA7 J;  3I4M J;  3S1N J;  3GBG A;  1JJ6 C;  1JT6 A;  2R92 J;  2IAI A;  4D5F A;  5DTD A;  3S15 J;  1P7J A;  1YRN A;  3UKG A;  1WI3 A;  1WPK A;  3BR0 A;  3ZQL A;  3IH4 A;  2I10 A;  3JRE A;  1MH4 A;  4MIM A;  3GTQ J;  4XID A;  5M5Y J;  3G1L A;  2DMP A;  5IP9 J;  4A3B J;  1RKW A;  1VF9 A;  1JKO C;  1IV6 A;  1DU0 A;  5HOD A;  3GTP J;  1ZKG A;  3BR1 A;  2VPR A;  4IHW A;  4W97 A;  2ECB A;  5C3E J;  2E2I J;  2L7Z A;  2R5Z B;  3BTC A;  1AU7 A;  3ZQH A;  5GPC A;  1MH3 A;  2E1O A;  5E3M A;  2E19 A;  3RKQ A;  2TRT A;  4L5E A;  3FKI J;  5EG0 A;  1Q1V A;  3OSG A;  2K9Q A;  1MBF A;  1JT0 A;  2EH3 A;  1XC5 A;  1SAN A;  1IGN A;  1LE8 A;  4FE4 A;  3MKL A;  4I76 A;  3JRC A;  3GTK J;  1VND A;  5C44 J;  4AYB N;  1NK2 P;  3M3Y J;  3BT9 A;  3HOY J;  5IP6 A;  4Y52 J;  2LLK A;  1PUF B;  2L0K A;  2ZB9 A;  4IHV A;  2VKE A;  2EZI A;  5FKK A;  5M5X J;  3JRB A;  1OCP A;  3ZQF A;  1LFU P;  3GTM J;  3SJM A;  3A01 A;  1MNM C;  2DMN A;  1TC3 C;  4Y7N J;  4M3F A;  5EYR A;  1MBK A;  3S1R J;  3JRI A;  1HLV A;  4UUS A;  3BG9 A;  3HOW J;  2FQ4 A;  1ORK A;  5FKM A;  4MLO A;  2LK2 A;  4DZJ A;  1RET A;  4JYK A;  3S2H J;  3W6V A;  4M3D A;  2XPU A;  5EGO A;  4JX4 A;  4IHX A;  4RDU A;  2XSD C;  1HCR A;  2JN6 A;  2ELK A;  2DTZ A;  2HQ5 A;  3BTJ A;  4I6Z A;  4UUT A;  2XPW A;  1WH5 A;  1OFC X;  2NS8 A;  4JX5 A;  2XGD A;  4AUX A;  4DZP A;  1BL0 A;  2GM4 A;  5E3O A;  5M5W J;  2NVY J;  5F04 A;  4DYR A;  2DN0 A;  2O7O A;  5E3L A;  2FJ1 A;  2H8R A;  1ZR2 A;  1U9O A;  1IDY A;  1FEX A;  3LSJ A;  2L7M P;  3HGG A;  3FIW A;  3OIO A;  1JKP C;  1Y1V J;  2VI6 A;  4A3M J;  2IBD A;  2DA5 A;  5EZH A;  2R0Q C;  2MG4 A;  1LFB A;  3VPR A;  3A03 A;  1ETX A;  1MSE C;  5IYD J;  1RKT A;  2ID3 A;  2KT0 A;  1WCM J;  2ME0 A;  1F36 A;  3H0G J;  2X9D A;  4JP0 A;  2HOA A;  4X1E A;  3GTL J;  1IG7 A;  3HOV J;  2XGC A;  1Z77 A;  1GV5 A;  2M2E A;  1GUU A;  5J1R A;  2EBI A;  2MGQ A;  5J3L A;  4D5C A;  2LD5 A;  2CUE A;  2L9R A;  3HM5 A;  4W1U A;  1ZGW A;  3S2D J;  1T33 A;  2O8K A;  3O8G A;  3PM1 A;  3Q0V A;  2XRL A;  2VUM J;  1MBG A;  1OJL A;  3I4N J;  5JLX A;  1UHS A;  2IEK A;  5IOY A;  1AKH A;  4A3K J;  3DCF A;  1P7I A;  1WGX A;  2ECC A;  2Y9Y A;  3BTI A;  1K83 J;  2CUF A;  1FTZ A;  4CYC B;  2HXO A;  1UG2 A;  5C4J J;  4HNV A;  3BR5 A;  2YU9 J;  2EQR A;  4JX6 A;  3B6C A;  4J19 A;  3BG3 A;  3F0C A;  3RZD J;  1EF4 A;  2LTP A;  4MFE A;  5FLV A;  2WB1 N;  4V2G A;  4A3L J;  2VKV A;  3BR3 A;  5J1Y A;  2YS9 A;  4LOC A;  1BW6 A;  3IH2 A;  3JRH A;  3WHC A;  2Y9Z A;  2LY9 A;  2ME6 A;  4A3J J;  2X6O A;  2CQQ A;  1TWG J;  1Z0X A;  3IV5 A;  2HOT A;  1IJW C;  1JUP A;  1FIP A;  3ZOB A;  2JWT A;  3NAU A;  3LNQ A;  2MSY A;  5E3N A;  4XIC A;  1B8I A;  2DA1 A;  2M34 A;  2R93 J;  4BXX J;  2Y30 A;  2DA2 A;  1B72 A;  5C4X J;  4BY7 J;  3HB9 A;  4IHY A;  3Q0U A;  5GPA A;  1JKQ C;  3GTG J;  2Y2Z A;  1YRN B;  3LSG A;  4B1R A;  1F43 A;  2DMT A;  4RBO A;  3D1N I;  2E2J J;  2DA6 A;  2LR8 A;  3LSP A;  4D7M A;  4B3A A;  5K7F A;  1IRZ A;  3A02 A;  3HOU J;  2QCO A;  2WV1 A;  2HDD A;  5EF6 A;  2HOS A;  3H3V K;  4XRS A;  1QPI A;  4M6V A;  5JLW A;  3ZQI A;  1X2M A;  1JKR C;  2M9H A;  3CMY A;  3Q0W A;  4GFB A;  5EZG A;  1MBH A;  2XB5 A;  1APL C;  4QIW N;  2JK3 A;  3TW7 A;  4G12 A;  5K7Z A;  1MBJ A;  1U9N A;  5EG0 B;  1CQT A;  1HDD C;  2R5Y A;  1DU6 A;  1U78 A;  1GVD A;  2DJN A;  1X58 A;  2NOG A;  2X48 A;  3G1M A;  3TP3 A;  3ZQG A;  1HF0 A;  1LE8 B;  1ITY A;  2GBY A;  1I6H J;  2DMQ A;  5IYC J;  1FIA A;  1MSF C;  1HDP A;  5M3F J;  5F08 A;  2NS7 A;  2G0E A;  3FIS A;  3E7L A;  2DA4 A;  5FKL A;  2JA5 J;  1T56 A;  2EZL A;  2LP0 A;  4A93 J;  4FTH A;  4A69 C;  2PMZ N;  2K40 A;  3A01 B;  1MBE A;  1FJL A;  1VI0 A;  4A3E J;  3S17 J;  4QSH A;  1RES A;  2NVQ J;  3S14 J;  3ZQC A;  3M4O J;  9ANT A;  3O8H A;  1ETW A;  4UUS B;  3GTO J;  2JA8 J;  2OF7 A;  3FK7 A;  2RAE A;  5F0H A;  1X2N A;  2R5Z A;  5F0F A;  4S0H B;  2HI3 A;  5EDN A;  3DEW A;  4C2M J;  3OSF A;  1HOM A;  1IUF A;  4M3B A;  5EGO B;  1U8B A;  3LSR A;  4A3D J;  2LVS A;  4FE7 A;  2DA7 A;  3G1O A;  4X6A J;  1OCT C;  4A3C J;  3OOU A;  2LKX A;  3MN2 A;  2Y31 A;  2Y0S N;  2EZK A;  1W0U A;  2FX0 A;  5IPA A;  2CQX A;  3QQA A;  1NTC A;  3JRD A;  4BKX A;  1IDZ A;  4B4C A;  1IC8 A;  1AHD P;  3JR9 A;  1PUF A;  2N8G A;  5DS9 A;  1WH7 A;  5FKN A;  5M3M J;  3TED A;  1NK3 P;  1JUS A;  1TWF J;  3BG5 A;  2L7F P;  2NVT J;  1W0T A;  4XK4 A;  5BNG A;  3BQZ A;  3RQI A;  2WAQ N;  3HKZ N;  1GV2 A;  2P81 A;  4V2F A;  4M3G A;  1I50 J;  1E3O C;  2JJ7 A;  1ETV A;  1H88 C;  4QTR A;  2B63 J;  1XG1 A;  3BTL A;  1VFC A;  3BR6 A;  4FCY A;  2NVX J;  1POG A;  3S16 J;  2XGE A;  2KDZ A;  5IP7 J;  3TW6 A;  2ID6 A;  5IOZ A;  2TCT A;  3CDL A;  1UMQ A;  3BR2 A;  3LOC A;  1JTX A;  3CQZ J;  2EZH A;  2K9N A;  2M8G X;  1H89 C;  1RR7 A;  5EEA A;  1K61 A;  4M3E A;  1GDT A;  1ETY A;  5FJ8 J;  1AKH B;  1G2H A;  2DA3 A;  5F27 A;  2M0C A;  3L1P A;  4EEF G;  1FTT A;  3JRG A;  1ZTR A;  3SFI A;  3S1Q J;  2COB A;  3HBL A;  1ZQ3 P;  2HYJ A;  2R7Z J;  3HDD A;  1TWC J;  3CCY A;  3B6A A;  4C3I J;  5FLM J;  2XPV A;  5FKO A;  3Q3S A;  1I3Q J;  5GP9 A;  3K2A A;  3SDG A;  1ZK8 A;  4MO7 A;  1QRY A;  1BA5 A;  1H8A C;  3MVP A;  1A5J A;  1ETK A;  1BJZ A;  3HGY A;  4A3G J;  2LFB A;  2AO9 A;  2W48 A;  4AC0 A;  2JA6 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...