3J81K

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81K00
1BJAA 5ICFA 2D2WA 3F6OA 2VOPA 4CICA 1YTYA 4F7ZA 4MTDA 4M9XA 4A12A 3GUDA 5DCFA 3F8NA 2ISYA 1UFMA 1V3FA 5CVIA 3F8CA 1GVJA 2Y75A 4WK8F 4L5JA 1R00A 3GYHX 1P4XA 1KGSA 3FM5A 4YIFA 3L09A 4LD5A 1O3SA 1R36A 2VC0A 4HF0A 4HQEA 1BI0A 3WG9A 3W6JB 4E70A 3VEPA 3F21A 3E6DA 1G3SA 4LMYA 1XD7A 4OINF 4OU0A 4CO8A 3M8FA 1XGSA 2CYYA 1D8JA 1IN7A 2YSRA 4I02A 4KUMA 2P5LC 2ZKZA 2J5OA 1TW3A 5HS8A 1XGOA 1MDMB 1OYYA 5H6RA 1QPMA 5BPIA 1IW7F 2RV8A 2E7XA 1R5HA 1SMTA 4EM2A 3ZMTA 4EJTA 3L7WA 1REPC 3IHUA 3I71A 4EM1A 4IRGA 4UV8A 3C18A 1ULYA 1R22A 3I54A 5DD8A 3FWEA 4LG0B 1Y0UA 4L0YB 3ELKA 5LRSA 2JSCA 2FMYA 2F2EA 4BQAA 4FHTA 3J81K 1XCVA 3GF2A 2OU2A 1AOYA 2PBIA 2QQ9A 1Z91A 1J75A 4AVPA 4ON0A 5HLHA 4G6QA 3ZN0A 1T2KA 2RQPA 2BE5F 1HKTA 2HS5A 3CDHA 3L00A 3LSTA 1BM9A 2DTRA 4M6XA 3CO7C 2O6GE 5L3FA 1ZAOA 4G8XA 1Z6RA 1XCBA 4HLXA 3WTYC 3F8BA 1T6SA 2XAFA 3ABUA 4B09A 2EV6A 1ODDA 2XV4S 1JHHA 1LNWA 3QOPA 4KNYA 2HTJA 4A5MA 2RVCA 1LB2A 3QRFF 1RI7A 1K78B 2M30A 4ZYGA 4B8XA 5ICCA 5BS6A 5DEQA 2IA1A 3R0JA 3ZQ7A 5LEKA 1KYWA 1FYLA 2TDXA 2QWWA 1ZRCA 2WC2A 3IRQA 2H09A 3QAHA 4L9VA 4KFCA 2VC1A 2XKPA 1P4AA 3FMSA 3W6KB 1W5TA 5FGMA 2XVCA 3RJPA 1W7PD 4ENJA 1I5ZA 3M9AA 2H27A 2Y0MA 2ETHA 1ZRFA 3CLOA 2DLLA 1G4DA 2RN7A 3I5UA 1PP8F 2XASA 5L3GA 2O0YA 5E1XA 5J6XA 4LJZF 3K9TA 1DDNA 3HHGA 1YG2A 4IRIA 4KICA 3N4MA 1OMIA 4HX4A 4NB5A 1FP2A 1O3TA 1YQAA 1DUXC 1HW5A 4ENKA 3TO9A 4Q5SF 2DK5A 5AIQA 1D8KA 1IXSB 2HKOA 4I2OA 1U5TA 4WXCA 1IN5A 4CZZA 2H6BA 1K6OA 1J9IA 1IF1A 4OIPF 4S04A 3P7NA 1G6NA 3RKYA 5FFZA 5L3CA 2D1HA 3BZ6A 4UVCA 4G9YA 1XB4A 1LDJA 3BOQA 4P96A 4DQ2A 1ON1A 3HOTA 4U88A 2A6HF 2C6YA 4K2EA 2K7LA 1R7JA 1U78A 1ZRDA 1R23A 5LLQA 3BPXA 4ENMA 1Z7UA 1TBXA 3M8EA 3FZVA 3FXRA 2QBYB 2IVMA 5LGNA 5TRDA 4GXOA 1ON2A 1FBUA 2L4MA 1MJBA 5CVUA 3H3UA 5K1YA 1RUNA 2STTA 5E18F 1TNSA 2L02A 2FNPA 5JHUA 4RAYA 1FP1D 4WWCA 2MLGA 3KLOA 4GYIA 1HQCA 5D5UB 1YLFA 1WI9A 3F22A 1E17A 5IT9K 4CHUA 3WTXC 2PFBA 3V8KA 3GX4X 3EETA 2CWEA 3D0SA 1YIOA 1FSEA 4LLNA 4Q4ZF 1A04A 3CUQA 2X0LA 3E3VA 1Q1HA 4RGRA 1XSDA 1DP7P 2JZYA 1LEBA 2R7FA 1R1TA 3CUQB 1EH8A 3N97A 2DO7A 3TDUC 5L3BA 2EWNA 3HTUA 4HW0A 3H3ZA 3IKVA 4EGYA 2QENA 2VN2A 2PEXA 1J7KA 2PN6A 5D5VB 5DD4A 3WE3A 4YIIA 2VODA 2XROA 1OPCA 1FBSA 2KJCA 3K1NA 3VB2A 4HYEA 3CO6C 3QU3A 3HSRA 1FZPB 5A2QK 2ZCWA 3RDIA 4UUVA 4XSXF 1I27A 1SD4A 3CUOA 1CGPA 5K5RA 3K2ZA 3HYIA 3REOA 2XAQA 5HLGA 3TO7A 2HR3A 3WU1B 3ROUA 1OKRA 1ZG3A 2ZMEB 3WE2A 4R1HA 3S2WA 3BWGA 2GXBA 1E2XA 1L0OC 4HV6A 2COMA 4OMZA 2A6EF 2PQ8A 4EJOA 3WTTC 3K0LA 2F5FA 2K86A 1TQIA 1EH7A 2F5EA 2Z3YA 4I0BA 3EYYA 2STWA 2EA4A 3E5XA 3KP3A 3NRVA 3GXOA 3OOPA 1XDSA 2E1NA 2HDCA 3QPTA 2EFWA 2P7CB 3MFKA 3ZPLA 4OOIA 3JAMZ 2K02A 4FT8A 2V1UA 4L18B 2KKOA 2GA1A 1UHWA 2KIFA 4HDVA 2HYGD 5HDKA 4NQWA 5EEGA 1H9TA 4UHTA 2ZXJA 4KN4X 2W85A 3M1EA 2E7WA 4WCGA 3LFKA 3KP2A 3EUHA 5CLSA 3KFWX 4N0BA 3T8TA 2O61A 1XN7A 2CQKA 1I1SA 3RIRA 4QLCU 4HA8A 1IAWA 3GVAA 2NNNA 5LHIA 2RNJA 2AXLA 3SHFA 1USTA 1BI3A 4KT5C 4GYGA 1U5TC 4BXUA 2VE9A 3J7AO 2EB7A 3QU6A 4LFUA 2MA3A 4U0WA 4CXFA 3ZMZA 2DW4A 5LHGA 4RGXA 2R3SA 3MWMA 1SD7A 3R4KA 2HQRA 3ZMSA 2GQQA 1FX7A 3LAPA 4OIQF 2MC3A 3VFZA 4HOBA 4A5NA 3GFLA 1PP7U 4O6JA 3V8LA 1IN6A 4RB2C 4MGRA 1X3UA 3KZZA 2RGVA 4KIBA 2GWRA 2JRTA 1USSA 2JT1A 1YW9A 1YFHA 5K5OA 3TOAA 1VTNC 1B59A 2O8XA 1WQ2A 3V7SA 3KEQA 5KK1A 5F6FA 5JFRA 5BPDA 1HSTA 2FBKA 4CYDA 1OYIA 3SFZA 5DDGA 1UHMA 1FLIA 3B73A 4UNOA 1FY7A 2WV0A 1EH6A 4WXHA 4EMSA 3VOEA 3KE2A 3ECHA 2RKHA 1P4WA 1V4RA 3RPUA 3LA3A 2ADUA 3E6MA 1W4MA 3MCZA 1JGSA 1R5GA 2W25A 4P9FA 1IXRC 1ZHFA 2HGCA 3E6CC 1XSXA 2NYXA 2P5VA 1BC8C 2OQGA 3PFIA 4Q47A 1SMYF 1O3RA 5LBQA 3F3XA 3FF5A 2LF8A 5LRRA 3NEUA 3K1MA 5FLXK 1G3WA 2P6SA 3T8RA 3U2RA 3CUQC 5HS7A 2HKXA 4M9ZA 2IA2A 3MQ0A 2Z33A 1SFXA 1F9NA 4LGWA 4NHJA 2R7DA 3COAC 2A3SA 3V4GA 2XUBA 3HRSA 5FD6A 3LA2A 2G7UA 3I64A 4KN7X 4L9NA 2GXGA 1QZZA 2DPUA 1U2WA 4LLGF 3HOSA 1ONVA 5CVRA 2VBZA 1W7PA 3F23A 1LEAA 2ZNZA 1ZREA 1IRFA 2EFQA 2LF7A 4GCVA 5ED4A 2NS0A 3FMRA 4XLNF 2JPCA 3IKTA 1T98A 2HWVA 4ESBA 5EEHA 3G73A 3GEZA 2EJRA 1F1ZA 3GZ6A 5D6EA 1TLHB 4U0YA 1JE8A 4HQMA 1S8NA 2FA5A 2F5DA 3HRTA 2ISZA 3HTSB 2UXXA 5LHHA 2CGPA 2Q2EA 4IRHA 2E1CA 1QZYA 1HBXG 2OD5A 2ZNYA 3E6BA 5K5QA 2L01A 4EV0A 1O57A 3KZYA 3BP8A 1BBYA 3ZMUA 5HVQC 3R61A 4I98B 2IW5A 2CW0F 2YR2A 4M72A 4BHPA 5JR3A 4G94A 4M73A 2EA2A 4HDUA 3ZP5A 2H94A 1FT9A 2LNBA 2Z9OA 1XMAA 1ZGAA 1S7AA 4O5VA 1RUOA 2GZWA 2QQAA 1S7OA 3P9KA 3F72A 3LQRA 1KU7A 4MEXF 1MD0A 4I09A 4HAMA 1KU3A 2VBWA 4BYYA 1T39A 4G7OF 1J0RA 2GIVA 1R58A 5AIPA 3WTUC 1R1UA 1U5TB 2ELHA 2A07F 1WRJA 1HW2A 4A6EA 3O3KA 3T5XA 3SXYA 4I01A 2JTVA 1P6RA 2XAHA 1KYZA 3V8JA 1I1GA 2EFPA 2EFNA 2HYFA 2P6TA 5BQTA 1Z6TA 1FC3A 2DBBA 2QZ8A 2FU4A 2VBXA 4HX7A 3JSOA 3I59A 4ESJA 2F5CA 3EDPA 1Z1DA 5DV5A 4AIJA 4CGZA 5D8LB 1B1BA 5H20A 2EK5A 1S3JA 2K27A 2XKOA 2LDUA 2V79A 4PGHA 3ERED 3J81Z 4PCQA 3TQNA 1PUEE 4U7BA 2RC4A 2PMHA 4MNUA 4L9JA 2LSOA 3MAJA 3WTWC 4TV7A 1SAXA 4OMYA 4IJAA 4LB5A 4KMUX 2W84A 3BJOA 4R79A 2PI0A 5FLXZ 1LJ9A 5J8CA 3K1PA 2V1XA 3KP4A 3GFIA 3OV8A 2DQLA 4AD9A 3TGNA 1CF7A 2KIMA 5DCMA 3LA7A 2XIGA 3F8FA 1MJAA 3DQVC 1KQ8A 2VE8A 4I7HA 5HDNA 2MLKA 1STZA 1OR7A 1QQIA 3KLNA 2P4WA 5FO5A 5H6QA 3R6SA 4G6DA 5DCMB 2A69F 1QNTA 1K79A 5BOXA 4HF1A 4O3MA 1I6XA 4KYWA 1TQMA 1KQ9A 1SFUA 2FOKA 3I53A 1J2XA 2CO5A 4A0XA 1RNLA 2W24A 4BHCA 3FX3A 3CTAA 2CSOA 1WSUA 1IZ1A 3L9FA 3O2PE 1IRGA 4Y15A 4HV5A 1Z05A 2M8EA 3J80K 4DNCA 4N9IA 2Q8KA 2O3FA 1ZH5A 2OA4A 1YS6A 1LDDA 2QUFA 2FQ3A 4Y13A 4HLYA 3WU0A 1KA8A 3DF8A 4M9SA 4GGGA 5D8KB 3I4PA 3Q5FA 4ZH4F 2GA2A 2VT2A 5ILVA 4JBAA 2MH9A 1ZLJA 3Q9SA 2FBHA 1XGMA 2V6CA 4KA4A 3QPHA 3HSEA 2UWMA 2Q0OA 4BAYA 2HOEA 2L54A 2D45A 2G9WA 2B0LA 4AWXB 4ZYDA 2D1VA 2FMLA 1O7LA 4EGZA 4OIOF 1EV7A 3GW2A 2ZFWA 2K4JA 5ILSA 1KU2A 1B4AA 5D4SA 2FNAA 5KVRA 5FB2A 3BDDA 3SZPA 3BROA 4A0YA 4U0VA 1IXCA 2BGCA 2IPQX 4R8HA 5HLIA 2IT0A 1HKSA 4CDGA 1F5TA 2GAUA 2FF4A 1XMKA 1B9MA 4M6YA 4XRFA 1XGNA 5D5XB 1BN5A 1SFEA 4RAZA 3R60A 4L5IA 1OYWA 2MBFA 2QLZA 2J5PA 2FE3A 4XSZF 2FSWA 5F1RA 2M87A 4M74A 3RKXA 2IRFG 2V1DA 4JK1X 5E8IA 1GXPA 2DFIA 1JHFA 1RIOH 4XLPF 4EQQA 2PJPA 4MEYF 4IHTA 2FXAA 1PDNC 2HTSA 4OIRF 3VODA 4UVAA 5LGUA 2H6CA 5HS9A 4JQFA 1FSHA 3E5QA 3LAJA 1FOKA 1TQPA 3P9CA 3GFJA 3D5LA 3DEUA 4G7HF 2UXNA 1RZ4A 4KIGA 3JTHA 3I58A 1MKMA 1MDMA 3RYRA 2M5WA 3K69A 4IF4A 5CVJA 5IT9Z 4P9UA 3U1DA 3GO5A 2JPBA 3JSPA 1LQ1A 4LK1F 2DT5A 2P7VB 3CJNA 2FRHA 4YG2F 3DP7A 4XBFA 4N9HA 2ZO4A 5CJ9A 2FEZA 4A2UA 1ZARA 4ZYHA 3WTVC 4LG0A 1HXDA 2P5KA 2XGXA 4ZZLA 1SD5A 6PAXA 1BIBA 1DPUA 4A6DA 5E20A 5F64A 3BY6A 4LLLA 1H9GA 1BI2A 1YW8A 1IN8A 2DAOA 1TW2A 3WGGA 4MTEA 3ECOA 1WWXA 1J5YA 3TOBA 3HRUA 1ZLKA 3PQKA 4FX0A 3WGHA 1ZG1A 2OQRA 1U8RA 2WWYA 3G3ZA 1C0WA 2OZ6A 2IP2A 5A2QZ 2RDPA 4EVIA 1J59A 4MQVA 5BMZA 1D3YA 3TDZC 2L4AA 3J80Z 1G3TA 2XAGA 2PLYA 3ZMVA 3C3WA 3JTGA 3TKYA 5E1ZB 3DPTA 3HIFA 3DXJF 3IL2A 1K78A 1DPRA 3MZYA 1IN4A 4BHBA 4UXNA 2ESNA 5JVTA 2WTEA 4AIKA 1UB9A 4MQ9F 2V9VA 1JXSA 1TNTA 4RGUA 1TTYA 3PQJA 3GLXA 3QP6A 2BBYA 2A68F 3DV8A 4UV9A 3EYIA 2VOOA 2VT3A 2CG4A 2EV0A 4ESFA 4RS8A 1XDUA 4MHGA 4RB0A 3AAFA 4WF2A 1B6AA 1YS7A 1W7PB 4RB1A 4ASNA 2DI3A 5DUIA 3NQOA 2HQNA 1P92A 3F6VA 3SQNA 4P55A 2Z5UA 4AIHA 3R0AA 1HKQA 1S6LA 1U3EM 2UZKA 5DUKA 3HHHA 2HFHA 2LKPA 2YPRA 3C1DA 4BNCA 3KCCA 2OBPA 4HF2A 3V7RA 3RKWA 2A61A 1NHAA 3C7JA 3GWZA 2M45A 2BYVE 1FPQA 2DK8A 4WXDA 4PDKA 2QQBA 1T0FA 4RB3C 4EJWA 1MZBA 4IHSA 2KIUA 1GXQA 2XRNA 4L0ZB 3WTSC 2PG4A 1ZG5A 3FXUA 1HW1A 3KP5A 2BV6A 2MH2A 1XSVA 2FBIA 3HUGA 3O6BB 4KDPA 4D0PA 1AWCA 2VXZA 2X4HA 3TO6A 5L3DA 2YU3A 4KIFA 4PZJA 1YW7A 1QGPA 3FMQA 4IPAA 3FHZA 1FYKA 3ABTA 3RTRA 2EFOA 3IWZA 2Y48A 4ETSA 3JAMK 2KJBA 2O03A 4YFKF 2DPDA 3M7GA 2XHKA 1UCRA 2IJLA 2ESHA 2QM3A 3RPQA 4EM0B 2YX7A 4RGSA 2ZBKA 2QBYA 2Z99A 5E8GA 4A0ZA 4ZZDA 5DYMA 3T0YA 1O3QA 3EQLF 3DFGA 2G7HA 3V7CA 1P2FA 2PMUA 3DPLC 3I59B 4IVNA 2HEOA 5FFXA 5ERIA 2QYOA 3KEOA 4U7DA 1T38A 4HZFA 3IC7A 2OAZA 5ICGA 2L3DA 3ZMDA 4BH9A 3P9IA 2AS5F 2M1BA 1FBQA 1YO5C 3BJ6A 3T1BA 5LGTA 1LVAA 2NNYA 3RYPA 2CFXA 4IXAA 4PGGA 1MJ9A 3WGIA 3HRMA 1ZN2A 3H92A 4Y17A 3ML6A 3F8MA 5LEJA 4Q48A 1D5VA 5E1WA 4ENNA 1QBJA 4HBLA 1LDKB 4YFNF 5E17F 1CF7B 1KU9A 4HX8A 1BIAA 2ZJ2A 3LWFA 2NRAC 3E97A 3GZ5A 5FD5A 2IA0A 4LB6B 4ZYEA 1BOAA 1WKMA 5JI6A 2DU9A 2KRFA 2OZUA 1Z9CA 1K7AA 1B9NA 2HZTA 5D6FA 1KQ0A 1ZYRF 5TJJA 2K4BA 5AONA 5HDGA 2ZMEA 3SZTA 1ZGJA 3ZN1A 3FXQA 3HSFA 4EJUA 4L9TA 3BPVA 1G3YA 2XAJA 3BJAA 3ISPA 3RI4A 3KETA 3FM3A 3LQQA 1BC7C 4LK0F 3JW4A 2P8TA 1QO0D 4P5OA 4I0AA 3GFMA 1W5SA 3KP7A 1H0MA 1MGTA 3KP6A 3QP5A 5D5WB 4H0EA 3WTZA 1O7FA 3IRRA 1FYMA 1L3LA 4G7ZF 1FWZA 2YX4A 2ACJA 1F4KA 4FX4A 5IT3A 4YFXF 1R1VA 3B02A 3L2CA 2NAZA 1GHCA 1BI1A 1SD6A 5ILUA 4M71A 1IUYA 5J8FA 4WX9A 2VONA 5CVVA 1HSJA 3MEXA 1YYVA 4S05A 4GO1A 4EJVA 3E5UA 3WODF 2MD5A 2VBYA 3U9GA 2DQRA 3MZHA 4UVBA 3DKWA 5HOOA 1FNNA 2EV5A 3Q9VA 4Z2YA 5D4RA 3ULQB 1U6GA 3I0TA 2A5YB 2W57A 1S29A 3IWFA 4QWQA 2QVOA 5ICEA 2BEOA 5L3EA 5CYVA 4KMFA
chains in the Genus database with same CATH superfamily
2R7WA 3K70D 4E7HA 2BW3A 2W48A 1BJAA 5ICFA 3VYTB 2D2WA 2M0CA 3F6OA 2VOPA 3HGGA 4CICA 1EJ9A 4JYKA 1YTYA 4F7ZA 3K4CA 1IJWC 4MTDA 4BUPA 4P1WA 4M9XA 4A12A 3GUDA 5DCFA 3F8NA 2ISYA 1UFMA 3MZ8A 2X51A 1V3FA 4A69C 3OYMA 1VQLI 3SDGA 5CVIA 3L2UA 3F8CA 1GVJA 2Y75A 4WK8F 3S3OA 4BBSJ 4L5JA 4OWRB 1R00A 3GYHX 2ZB9A 1P4XA 1KGSA 3FM5A 4YIFA 3L09A 4LD5A 3E7LA 1O3SA 2LR8A 1R36A 2VC0A 4HF0A 3JRAA 4HQEA 1BI0A 3K4JA 3W6JB 3FKIJ 3VEPA 3WG9A 4E70A 3F21A 1ITYA 3E6DA 3A4CA 1G3SA 4LMYA 3S2DJ 2XPUA 5DTDA 4BDYA 3E0JB 1XD7A 4LITA 2R5YA 4U87A 2NVQJ 4OINF 4OU0A 4CO8A 3M8FA 1Z0XA 1XGSA 2I5UA 2LFBA 4UUSB 2CYYA 1D8JA 1IN7A 2NVYJ 2X6XA 5TISC 2YSRA 3K4MA 4I02A 3ABLH 2M7AA 3HDDA 4KUMA 2P5LC 2L7MP 2ZKZA 2J5OA 2LBFA 1TW3A 3AG3H 1ZTRA 4MFDA 4Y52J 2F6CA 1VQ6I 5HS8A 5J1UA 1HDDC 1XGOA 2CUZA 1MDMB 1KZHA 3OS0A 3OYKA 1OYYA 2A6TA 4B47A 5H6RA 4CYCA 1QPMA 5BPIA 2K3PA 2M3AA 4BU2A 1IW7F 3MMYB 1V54H 2RV8A 2E7XA 1R5HA 1SMTA 4EM2A 1UHSA 3ZMTA 4EJTA 2DCEA 2EQRA 4N4NB 3L7WA 1REPC 4FQGA 3IHUA 1H89C 3I71A 4EM1A 4IRGA 4UV8A 2OCEA 3C18A 4GFBA 4BACA 1ULYA 1R22A 3I54A 3HB9A 5DD8A 4HSTA 1F43A 2K85A 4FE7A 2BY3A 3FWEA 4LG0B 1Y0UA 2OF7A 3ELKA 4L0YB 1GDTA 3Q0UA 5LRSA 2JSCA 3W3CA 4XLEA 5E3OA 2FMYA 2F2EA 4BQAA 4XONA 4FHTA 2K3FA 4E7KA 3J81K 1XCVA 3GF2A 2OU2A 1AOYA 4KJZA 2PBIA 3D5RC 2QQ9A 1Z91A 1Z67A 1QVTA 4AVPA 1J75A 4ON0A 2DMPA 2ZC2A 3I3LA 5HLHA 4G6QA 3ZN0A 4F92B 1T2KA 4OAYA 2WADA 2RQPA 1ENHA 3LOCA 2BE5F 1HKTA 2HS5A 3CDHA 2F48A 3L00A 1YRNA 3LSTA 1A5JA 4H4KC 1O4XA 1BM9A 3DKYA 2DTRA 2RNGA 4M6XA 2L9VA 1IC8A 1A6IA 3CO7C 2GOMA 2PMZA 2O6GE 2XRLA 1JT6A 3VYSB 4JX5A 4CCOA 3PSIA 5L3FA 1ZAOA 2KZVA 1A36A 4G8XA 2EZLA 3OR1C 3MKYB 2GXAA 2PJRB 1Z6RA 1XCBA 1VQ5I 1ACIA 4HLXA 2WY8Q 3WTYC 3F8BA 1T6SA 4BL0B 3H5AA 2XAFA 2QCOA 3ABUA 3RCOA 4B09A 1JKRC 2EV6A 2KHMA 3OIQA 3KYDB 1WJFA 1ODDA 2XV4S 2HOSA 1JHHA 1LNWA 3QOPA 4KNYA 2HTJA 4A5MA 2RVCA 1EA3A 1LB2A 2FOWA 3QRFF 1RI7A 1K78B 1CQTA 2M30A 3HOWJ 4ZYGA 4B8XA 5CPRB 5ICCA 2HOAA 5BS6A 5DEQA 1IRZA 2IA1A 3R0JA 3ZQ7A 5LEKA 1SFKA 1KYWA 1FYLA 2TDXA 2P0WA 2QWWA 2DFEA 2LREA 1ZRCA 1MMDA 2WC2A 3QOEA 3IRQA 2H09A 4D5FA 3QAHA 2XGCA 4L9VA 4KFCA 2VC1A 2XKPA 4DZJA 1P4AA 3VYUB 3FMSA 1YHQI 1A6QA 2R7VA 3W6KB 1W5TA 1E3OC 9ANTA 5FGMA 2GIZA 4BGDA 2XF5A 2XVCA 3RJPA 1W7PD 3FK6A 1I5ZA 1DGRM 4PFOA 4ENJA 3M9AA 1OQYA 2H27A 3KPHA 2G0EA 4PJNA 1SC7A 4J01A 2ZMEC 2Y0MA 4AVZA 4YRVA 4FETA 1B8IB 2LVSA 4RLFA 2ETHA 1ZRFA 3G71I 3CLOA 4XKVA 2E71A 2DLLA 1G4DA 2RN7A 3I5UA 1PP8F 2XASA 4MLOA 4JOMA 3BR1A 1F36A 3H9GA 5FKMA 3L2QA 5L3GA 2AO9A 3S2HJ 2O0YA 1FMVA 5E1XA 3K4LA 4N4OB 5J6XA 3I9V2 3DCFA 2RAEA 4LJZF 2Y0SA 3K9TA 1DDNA 3HHGA 2KL4A 1YG2A 3PSFA 3S32A 4BDZA 4IRIA 4KICA 3N4MA 1K83J 5E3NA 2R7RA 1OMIA 3DU6A 3SDBA 3A1YA 4HX4A 3D5SC 4NB5A 3OYEA 1FP2A 4XLCA 3J7ZI 3ZQHA 3CP2A 3HOYJ 1SFOJ 1O3TA 1E3HA 3H9QA 2E1MB 1FTZA 1WJ5A 1YQAA 3BTCA 2B7EA 2V4JC 1DUXC 3OIOA 3SJMA 5EZGA 2EIKH 1HW5A 4ENKA 3TO9A 2DYSH 3BR6A 2DK5A 2X48A 5J4VA 4Q5SF 4E7SA 4XOPA 5AIQA 3IAS2 1U9OA 2MABA 1D8KA 1IXSB 3S93A 2L5QA 2HKOA 4I2OA 1U5TA 1XTAA 4E6KG 4WXCA 1IN5A 4CZZA 2HPIA 2H6BA 1K6OA 1J9IA 4XR6A 1IF1A 2VI6A 4OIPF 3OMYA 1IUFA 4S04A 4XRMA 1S72I 1IRXA 1X3ZB 2CV0A 3P7NA 1G6NA 5DM7F 3RKYA 1UG0A 5FFZA 5L3CA 2R93J 1GT0C 2JWTA 3ESWB 3HUGB 2D1HA 3BZ6A 4UVCA 4G9YA 1XB4A 5J1RA 1LDJA 3BOQA 4P96A 5KCMA 5JHFA 4KT6A 1HF0A 4DQ2A 1ON1A 3EUKL 1N78A 3HOTA 2KP6A 4U88A 1X1AA 2YU9J 2A6HF 2K40A 5H2FC 2L7ZA 2C6YA 4K2EA 2E2JJ 3QODA 2K7LA 1R7JA 1N25A 1U78A 1YI2I 2Y9YA 1S9HA 3PJRA 2VL8A 4IL6C 4BJTA 5JLWA 2E5ZA 2R5ZB 2HVRA 4A93J 1ZRDA 2ZJQF 1R23A 4CZCA 3BPXA 5LLQA 4ENMA 1Z7UA 3LSPA 4ABZA 1TBXA 1JJ8C 3M8EA 4AU7A 2MYSA 3FZVA 3FXRA 3CMAI 2QBYB 3AG4H 2IVMA 5LGNA 5TRDA 4ZDLA 2CV1A 3B6CA 4GXOA 1ON2A 3S1NJ 2DOEA 3QPSA 1FBUA 2F4MB 4RBOA 1W5CC 2L4MA 5J3LA 1MJBA 3CESA 3HPHA 5CVUA 2L9SA 1OCRH 3H3UA 4CCNA 5K1YA 2Y9ZA 1RUNA 4M3DA 1D0ZA 2STTA 2NXNB 3KZIC 5E18F 1TNSA 3RQIA 2L02A 2FNPA 1JKOC 5JHUA 2E35A 3MKWB 2MGQA 4RAYA 1FP1D 4HEA2 2Y30A 2LK2A 3OSGA 2KQRA 2LMDA 2ZJRF 3DTKA 1NTCA 4WWCA 3AL0B 2MLGA 3KLOA 4GYIA 1HQCA 5D5UB 1Y6IA 1YLFA 3FXLA 1TT5B 1WI9A 3F22A 2AHQA 2L9NA 2NOJB 1E17A 4YELA 5IT9K 4CHUA 1HA8A 3CCYA 3WTXC 2PFBA 2LYCA 3V8KA 4ZTFA 3GX4X 3EETA 3UKGA 2X1DA 2DMUA 1AKHB 2CQ7A 2CWEA 3D0SA 1YIOA 1FSEA 4LLNA 4Q4ZF 1EF4A 2CV2A 1A04A 3CUQA 2X0LA 3ZQIA 2HNHA 3RZDJ 3I4NJ 3E3VA 1MBEA 2E36A 1Q1HA 3BG7A 4PSWA 2CUEA 4RGRA 3E1SA 1XSDA 1DP7P 3GTLJ 2JZYA 2YS9A 1BL0A 1LEBA 2R7FA 1I50J 1R1TA 3CUQB 4QSHA 3V42A 1EH8A 3N97A 2DO7A 2CFOA 5IYDJ 3TDUC 5L3BA 1HCRA 2EWNA 2NS7A 3HTUA 2KISA 4HW0A 3H3ZA 3IKVA 4EGYA 2QENA 2IGMA 2VN2A 1ETWA 2PEXA 1J7KA 1R4MB 2M9HA 2PN6A 5D5VB 5DD4A 3WE3A 4YIIA 2IAIA 1WPKA 2VODA 2XROA 2QKLB 4XMYA 1OPCA 1FBSA 2KJCA 3K1NA 1X19A 1MBKA 3VB2A 4HYEA 3CO6C 1RPWA 5K7ZA 3QU3A 3HSRA 1FZPB 5J4YA 5A2QK 2VJ5A 2ZCWA 3NARA 4RA2A 3RDIA 2K9MA 4A3CJ 4UUVA 3TEDA 2EPFA 4XSXF 4Z6YA 4NBQA 4ZDOA 1I27A 1SD4A 2XSJC 3CUOA 3S1RJ 2W4SA 1CGPA 5K5RA 3CCSI 3K2ZA 3HYIA 3REOA 3QYEA 2N8GA 2XAQA 3ZQCA 1NG7A 1I39A 2BZTA 4UUTA 5HLGA 3TO7A 1MMGA 2HR3A 3WU1B 2XGEA 2WAQN 1I3AA 3ROUA 1OKRA 1ZG3A 5FLMJ 2ZMEB 3WE2A 2IS6A 2JRMA 1JUMA 2Y2ZA 5EGOB 4R1HA 3S2WA 3BWGA 2WV1A 1T33A 1MMSA 3NWTA 5B1BH 2GXBA 2QKMB 3PNYA 1E2XA 1L0OC 4HV6A 2COMA 3BTLA 3KX2A 4OMZA 2DA5A 2A6EF 2DMTA 2PQ8A 3OYFA 4EJOA 3WTTC 3H3VK 3K0LA 3L2WA 2F5FA 3K4KA 2VIXA 2K86A 1TQIA 1EH7A 2F5EA 2Z3YA 1MNMC 4RMNA 4I0BA 4FASD 2HDWA 1QA6A 5F08A 2VKVA 2OV7A 4E4HA 3EYYA 2DMQA 2GM4A 1GVDA 2DJNA 1K6YA 4C3JJ 1K4SA 5FKLA 2STWA 3PNVA 2EA4A 3A0BC 4C2UA 2B63J 2M0MA 2M4KA 1JTXA 3E5XA 3KP3A 2WY7Q 3NRVA 3GXOA 3OOPA 1XDSA 4I6ZA 4XN0A 4A3FJ 3CCJI 2KDOA 3HG9A 4IKFA 2E1NA 2HDCA 3QPTA 1Y0NA 4FISA 2EFWA 2P7CB 2R7UA 3MFKA 2P81A 3ZPLA 4OOIA 3JAMZ 2EH3A 2ZXHA 2K02A 4FT8A 2V1UA 4L18B 4HNTA 2KKOA 2LKXA 2GA1A 1UHWA 2KIFA 3OYBA 3ZGKA 1E3PA 5GADJ 4HDVA 3BTJA 1Z7LA 2MC4A 2HYGD 5HDKA 1QRYA 4NQWA 5EEGA 1H9TA 1QPIA 4UHTA 2ZXJA 2W00A 4KN4X 2W85A 2LP0A 3M1EA 2E7WA 4WCGA 2IGOA 1Q1VA 3LFKA 3KP2A 1GLNA 3EUHA 3A01A 5CLSA 3KFWX 4N0BA 3T8TA 2O61A 1XC5A 2EZHA 3LMMA 1XN7A 1HLVA 2CQKA 1I1SA 3RIRA 4QLCU 2V7FA 4HA8A 1PJRA 3UR3C 4DZPA 1IAWA 2KIQA 3BCAA 5F04A 4E7JA 3GVAA 2NNNA 5LHIA 2RNJA 2AXLA 2E60A 2WAEA 3SHFA 1USTA 1BI3A 4KT5C 4GYGA 1U5TC 5HNFA 1LPQA 2VKEA 4BXUA 2VE9A 3J7AO 2BW3B 1UELB 2FX0A 2EB7A 3QU6A 4LFUA 2W1OA 2MA3A 1R4NB 4U0WA 4CXFA 2DMNA 2DFHA 2HI3A 2ICWG 3ZMZA 2DW4A 5LHGA 4RGXA 2R3SA 3MWMA 1SD7A 3R4KA 2HQRA 4ZTJA 1G2HA 1BR1A 2UUZA 3ZMSA 4AUXA 5FRMA 5EG0A 4G12A 2GQQA 2BVLA 1FX7A 3LAPA 2ECBA 4OIQF 2EIJH 1U0JA 2MC3A 2QSGX 4GDFA 3VFZA 4HOBA 4A5NA 3GFLA 1PP7U 4O6JA 3V8LA 3QWLA 4AIDA 1IN6A 4RB2C 2XF7A 1X3UA 4MGRA 3KZZA 1NK3P 2RGVA 4KIBA 2GWRA 2JRTA 2LKSA 1K61A 1JGGA 1ZR4A 2R5YB 1USSA 4RM3A 4E7LA 4A3IJ 2JT1A 1JI8A 1VI0A 1YW9A 4DBRA 5K5OA 1YFHA 1MNDA 2Z2SB 3TOAA 1VTNC 1B59A 4IQ4A 2O8XA 1WQ2A 3V7SA 2HXIA 3O8HA 3KEQA 1X3WB 5F6FA 5KK1A 1HC8A 3OR2C 3EUAA 5JFRA 2R7TA 3OS1A 4A3EJ 4AC0A 5BPDA 1HSTA 1S7EA 3CJRB 3K2AA 1TWGJ 1IDZA 2FBKA 4CYDA 1OYIA 2LBFB 1OFCX 3SFZA 3A03A 5DDGA 1UHMA 3DLAA 4XL9A 1SVOA 1FLIA 2E2IJ 3Q3SA 3B73A 4UNOA 3LSGA 3H36A 3ZQFA 1FY7A 2WV0A 3AL0C 1EH6A 2DDAA 4WXHA 4CYCB 4EMSA 3VOEA 3KE2A 2K9QA 3SFIA 4CCMA 2DOFA 3ECHA 2RKHA 1P4WA 3DBRB 2VASA 1V4RA 4D9JA 4DW6A 2DA1A 3RPUA 3PUBA 3ASOH 3FXKA 3TL4X 3LA3A 1BR2A 3BQYA 2ADUA 4MIMA 3E6MA 1W4MA 4UB6C 3MCZA 1JGSA 3PUFA 5FKNA 5GPCA 2CS3A 1X1PA 2LOOA 1R5GA 2W25A 1QU3A 2V1NA 4P9FA 1ETOA 1TP4A 1IXRC 1ZHFA 2HGCA 1VFCA 3G4SI 3E6CC 1XSXA 3OYCA 3WHCA 2NYXA 2ID6A 1YITI 4OAZA 2P5VA 4C2TA 1BC8C 3FXMA 2OQGA 3A2KA 3PFIA 4Q47A 1SMYF 2CW7A 4S0HB 1O3RA 2KT0A 4DJAA 3F3XA 5LBQA 2LY2A 3FF5A 2LF8A 5LRRA 3NEUA 3K1MA 5FLXK 2F4IA 1G3WA 2P6SA 1DU0A 3T8RA 3U2RA 2CH0A 4HPQA 1YRNB 3CUQC 3QQAA 1BW5A 2WBMA 5HS7A 4X0GA 2E5NA 2BY2A 2XAUA 5FRNA 4IZZA 2JA8J 2HKXA 4M9ZA 1Y1VJ 1Z77A 4JX6A 2IA2A 3MQ0A 4A3BJ 2Z33A 1SFXA 1F9NA 2WB1A 1MBHA 2A05A 3DKXA 4LGWA 4NHJA 4PJ0C 1G59A 2LC2A 2R7DA 1NG6A 2M34A 3COAC 2A3SA 3V4GA 4A3DJ 3CCMI 1WI3A 2XUBA 1Z3YA 3HRSA 4B3AA 5FD6A 3LA2A 3RKQA 2G7UA 3I64A 4KN7X 3QPLA 3PNTA 4L9NA 3BG9A 2GXGA 4X1EA 5EJCA 3CP8A 4D7NA 2JQ7A 1QZZA 2DPUA 3CCRI 3DWLE 5HLTA 1T08B 1U2WA 3OYIA 4LLGF 5FROA 3HOSA 1ONVA 1MSFC 5CVRA 2E1OA 2VBZA 2DYRH 1W7PA 3L1PA 3F23A 3BR0A 1LEAA 2ZNZA 3IH2A 2FUG2 1ZREA 1IRFA 2EFQA 1IG7A 2K9NA 3LSRA 2LF7A 1YJ9I 4GCVA 5ED4A 1G8XA 2NS0A 3FMRA 4XLNF 1VQNI 2JPCA 3OYHA 3IKTA 1T98A 2HWVA 2DFFA 3MKZA 1OISA 4ESBA 1QHHD 1IGNA 5EEHA 3G73A 1OCPA 1P7JA 3GEZA 2MFZA 2EJRA 1X1DA 2BHYA 4F91B 2DJIA 1F1ZA 3BG6A 3FKJA 2VQHA 3CZ6A 1RC9A 3GZ6A 3PFYA 5D6EA 1TLHB 4U0YA 4IOCF 4PUSA 1JE8A 3HEFA 4BXXJ 4HQMA 2CQXA 1S8NA 2FA5A 2LRDA 2F5DA 3HRTA 2ISZA 1MSEC 3HTSB 2UXXA 4A3GJ 1TWCJ 5LHHA 2CGPA 2V6EA 4PSXA 2L2OA 2X9DA 2Q2EA 2COBA 4IRHA 4CSWA 2E1CA 1QZYA 1HBXG 2OD5A 2ECCA 4FE4A 1LUJB 4XKWA 1NK2P 2ZNYA 3E6BA 1X1CA 4LIVA 4F93B 5K5QA 2L01A 1ETXA 4BEHA 1O57A 3HPGA 4EV0A 1YIJI 3KZYA 3CJQB 2RQQA 2EZIA 3CCQI 2QSHX 3BP8A 1BBYA 3ZMUA 5HVQC 3R61A 4XOTA 1X1BA 3BLYA 2MG4A 4I98B 5IOYA 2L0KA 3IH4A 2IW5A 3VSLA 3BG3A 3I56I 2CW0F 2YR2A 4M72A 4BHPA 5JR3A 4G94A 2BXYA 4M73A 2EA2A 4HDUA 3ZP5A 2H94A 1FT9A 2M8GX 2LNBA 5B3SH 2DA2A 1MBJA 2Z9OA 1MW7A 1XMAA 1ZGAA 1S7AA 4O5VA 3H35A 3DU5A 2JMWA 3TMOA 1RUOA 1YJWI 2E2HJ 2GZWA 3GMEA 2QQAA 2Q1ZB 1S7OA 3OL4A 3P9KA 1Y56A 2TRTA 3F72A 3LQRA 1KU7A 5GPAA 4MEXF 2DOAA 1MD0A 3H9JA 4I09A 1VQ8I 2XC7A 4HAMA 1KU3A 1PYVA 3A02A 2DA7A 4XM3A 4HSRA 5IP6A 5BNGA 5C4JJ 2VBWA 3HZJA 1WGXA 4BYYA 1T39A 4G7OF 1D1AA 1J0RA 2WAQA 1Y1WJ 2KRCA 2OPTA 2GIVA 3HC7A 1R58A 5AIPA 1R5ID 4NC8A 2EILH 1R1UA 3WTUC 1U5TB 1FMWA 2ELHA 2A07F 1SANA 1WRJA 2H1LA 3OYAA 4A3KJ 4HRIA 2ZFUA 1HW2A 1FOYA 3W2WA 3MVPA 2ZSIB 4A6EA 3O3KA 1ETVA 3IH3A 3T5XA 3SXYA 4I01A 2JTVA 4IOAF 1P6RA 3NWSA 2XAHA 1KYZA 3V8JA 1JUPA 1I1GA 2EFPA 2EFNA 3EUHC 2HYFA 2P6TA 5BQTA 1Z6TA 5F0FA 3CDLA 1FC3A 2DBBA 3LSJA 3DBLB 1SVLA 2QZ8A 3JRGA 2FU4A 2VBXA 3TW6A 3S1QJ 4HX7A 3JSOA 1VQMI 3I59A 3HL2A 5B1AH 1Z3XA 2HXOA 2YUSA 4ESJA 2F5CA 3CCEI 3KIOA 3EDPA 1D0YA 1Z1DA 5DV5A 3CCLI 5GAGJ 1T8IA 4C30A 3JRHA 2HPMA 2VKDA 3AKZA 4XKCA 4AIJA 1LFPA 3BZCA 2M2EA 4CGZA 5D8LB 4UB8C 1B1BA 1PUFA 5CKTA 3BG5A 5H20A 5HODA 4YIRX 2EK5A 5EYRA 4C3IJ 2XF6A 1S3JA 2K27A 4Y4RA 4HG2A 2X6WA 2XKOA 4CCKA 2LDUA 2V79A 4PGHA 2M4GA 3ERED 4ITVA 3J81Z 4ZC3A 4XICA 4PCQA 2R7QA 4HNUA 2BHZA 2R0QC 1MNEA 2LY9A 3O8GA 3TQNA 1PUEE 4U7BA 2RC4A 2PMHA 4NUBA 4XKBA 4M6VA 1VQ4I 1GV5A 3FBNB 4DYCA 3ONQA 4MFEA 4MNUA 4L9JA 3GTPJ 2LSOA 3KEYA 3MAJA 3OOUA 5GAHJ 3BR2A 4XRSA 3WTWC 4TV7A 4CCJA 1SAXA 4IJAA 4OMYA 4LB5A 3CD6I 3G1OA 4KMUX 1QHGA 1P7IA 4LOCA 1S5LC 2W84A 3BJOA 4R79A 1AA7A 2OTJI 3QYFA 2PI0A 5FLXZ 1LJ9A 5J8CA 1D5YA 1RR7A 3K1PA 2V1XA 4Y7NJ 2KZGA 4BY1J 1ERDA 2XPWA 2R7SA 3GLLA 3M07A 3VSKA 1RESA 3KP4A 1MIJA 2VJIA 5CQGA 2EBIA 3GFIA 3GBGA 3OV8A 1A35A 2DODA 2DQLA 1FIAA 4AD9A 3GTQJ 3VWBA 3BT9A 2X6YA 3TGNA 5EF6A 4V19K 1CF7A 2JVGA 4PFPA 4RM2A 2KIMA 2OTLI 5DCMA 3VPRA 1VQKI 4BBRJ 3LA7A 3CF5F 1JT0A 1OCTC 3W6VA 3JRIA 2XIGA 3F8FA 1MJAA 3FISA 3DQVC 1PVEA 1KQ8A 3A0HC 2VE8A 2GLOA 3ZR8X 4I7HA 2O8KA 5HDNA 5GP9A 1QVUA 4F52A 2MLKA 1STZA 1OR7A 2ME0A 3TW7A 2Y0SN 1YJNI 1QQIA 3KLNA 4ZYAA 2P4WA 1OCCH 3HGYA 5FO5A 1R9TJ 1RKTA 5H6QA 3R6SA 4G6DA 5DCMB 2A69F 1QNTA 1K79A 5BOXA 3I55I 4HF1A 1I6XA 2H8RA 4O3MA 1D1BA 4KYWA 2W82A 3LL7A 1TQMA 1KQ9A 1SFUA 2FOKA 2NVXJ 3I53A 1J2XA 2CO5A 4XLHA 4A0XA 1RNLA 2W24A 2OC6A 4BHCA 3FX3A 2VLAA 3CTAA 3ERMA 2CSOA 1WSUA 1IZ1A 3L9FA 3O2PE 3B6AA 1IRGA 4Y15A 4HV5A 1Z05A 1LKXA 3K6GA 2KDZA 1YE9A 2HOTA 2XB5A 2M8EA 3J80K 2VB6A 4DNCA 4N9IA 2Q8KA 2O3FA 3S17J 4XNFA 1ZH5A 2OA4A 1YS6A 1LDDA 1HDPA 2QUFA 3SZGA 2FQ3A 3VYRB 4Y13A 4HLYA 3WU0A 1KA8A 2QEXI 5J1YA 5B66C 1B72A 1R71A 4BQQA 3DF8A 4M9SA 1ETQA 1OJLA 1X4PA 2XGDA 3SYTA 4GGGA 3IAM2 1NH3A 4AM3A 2CU7A 3BR5A 5F27A 5D8KB 3ZQQA 3I4PA 3S8PA 4XQFA 3Q5FA 4ZH4F 1KONA 2GA2A 3IUOA 2VT2A 5IY5H 5ILVA 3QYBA 4JBAA 3BQZA 2VJ4A 5M3MJ 2MH9A 1ZLJA 1W1WE 3Q9SA 2FBHA 2DDBA 3G6EI 1XGMA 4BJ6C 1FJLA 1TC3C 2V6CA 4KA4A 3QPHA 3HSEA 1GV2A 2UWMA 2Q0OA 1SVMA 4PK4A 4AYBN 4BAYA 2HOEA 3CMYA 2L54A 3NAUA 3X2QH 2D45A 2G9WA 4BKXA 2DTZA 2B0LA 4AWXB 1I3QJ 4ZYDA 2DA6A 2VUMJ 1WZ2A 2D1VA 2HZDA 2FMLA 4MO7A 1O7LA 1ZGWA 3LSIA 2I10A 5E3LA 4EGZA 4FCYA 4IHYA 4OIOF 1EV7A 3GW2A 4A3JJ 2ZFWA 4ZJZA 4W1UA 2K4JA 3ZOBA 5ILSA 1JJ6C 1VQOI 1KU2A 2X85A 3LSMA 1MBFA 1B4AA 2WAFA 5D4SA 2FNAA 5KVRA 5FB2A 4F55A 3BDDA 3K4NA 3SZPA 1Y8QB 2BOLA 4BQNA 3MN2A 4LG3A 4NC7A 3U1KA 2D5VA 3GTKJ 3W2VA 3BROA 4DYRA 4A0YA 2V26A 3CLQA 4U0VA 5EDNA 4XN3A 1IXCA 2BGCA 2IPQX 4R8HA 2MD0A 5IPAA 1FOWA 5HLIA 2IT0A 1HKSA 2HVQA 4CDGA 3PM1A 1F5TA 4IQJA 2GAUA 1K4TA 2FF4A 2ELJA 1XMKA 1B9MA 4M6YA 3OYJA 4XRFA 1XGNA 1LVKA 3FK7A 5D5XB 4RAGA 1BN5A 1SFEA 3JCUC 4RAZA 3R60A 4L5IA 1BOBA 1OCZH 2KRHA 3C2HA 2ZSHB 1OYWA 2MBFA 2QLZA 2J5PA 1I6HJ 2FE3A 4XSZF 2FSWA 3HJEA 2M87A 5F1RA 2IS1A 4RLQA 4M74A 4D5CA 3RKXA 3BR3A 3GTOJ 4RDUA 1OCOH 2IRFG 2R4GA 2LY1A 2V1DA 4JK1X 5E8IA 1GXPA 2DFIA 1JHFA 3JR9A 1RIOH 4XLPF 3IP4B 4NQWB 4EQQA 2PJPA 3HKZN 4MEYF 1MH4A 3SEZA 4IHTA 1UMQA 3J7YJ 1YOVB 2LH9A 4B44A 3A01B 3M8JA 2FXAA 2KMUA 1W36C 2XSDC 1PDNC 1W0TA 5IYCJ 2HTSA 1R6RA 4OIRF 1SAUA 3VODA 4UVAA 5LGUA 1V5GA 1RETA 2H6CA 5HS9A 4UUSA 2QA4I 1ZQ3P 1WFXA 5E79C 4JQFA 3OY9A 1FSHA 2QQ8A 2DA3A 3J7AY 3E5QA 3JRCA 1VZ0A 3LAJA 1ETKA 1N77A 1FOKA 1TQPA 2K5CA 2OCCH 3P9CA 3JRBA 3GFJA 3D5LA 1V5EA 3DEUA 1WJCA 4CUGA 4G7HF 4QPOA 2UXNA 1RZ4A 4KIGA 4NC6A 3JTHA 3WG7H 1AU7A 3I58A 4IHVA 2F5VA 1Z21A 1MKMA 1MDMA 2JA7J 3GCMA 3RYRA 2M5WA 5EG0B 3K69A 4IF4A 5CVJA 1DGWY 5IT9Z 2ELKA 4DGWB 1LFBA 4P9UA 3S16J 3U1DA 5IP9J 3GO5A 1DP3A 2JPBA 4V2FA 3JSPA 2Z16A 2BVMA 1LQ1A 4LK1F 2DT5A 2P7VB 3CJNA 1X58A 2FRHA 3HXLA 4YG2F 5C3EJ 1TWAJ 1EKEA 3DP7A 4XBFA 3S3MA 4XORA 4N9HA 2ZO4A 2IBDA 5CJ9A 3MKLA 2FEZA 3C2GA 4A2UA 1ZARA 2DN0A 4ZYHA 3WTVC 4LG0A 1HXDA 2ZJPF 1N75A 3SEQA 5IOZA 2P5KA 1U9NA 1UZCA 2XGXA 4ZZLA 3EPZA 3MD2A 4V2GA 4ANJA 1SD5A 6PAXA 1BIBA 1DPUA 4BY7J 4A6DA 1WJEA 5E20A 5F64A 3BY6A 3PL8A 1WH7A 1H9GA 4LLLA 1BI2A 4LIUA 1YW8A 1IN8A 2DAOA 1D0XA 1TW2A 3WGGA 4MTEA 3ECOA 4G6TB 1WWXA 2F4OB 1J5YA 3TOBA 3HRUA 1POGA 1ZLKA 3PQKA 4FX0A 2JN6A 3WGHA 1ZG1A 2OQRA 3PO3J 1HOMA 2XB0X 3OYNA 1U8RA 2XDVA 4BS9A 2WWYA 5E3MA 3W2AA 3G3ZA 1C0WA 2OZ6A 3RPUD 3ZXSA 1TWFJ 3U21A 1VQ7I 2IP2A 1WJAA 2PJRA 5IP7J 2RDPA 5A2QZ 4EVIA 2W7NA 3HOVJ 4I76A 4QTRA 1J59A 4UY8I 1WJBA 4MQVA 2VXDA 1D3YA 5BMZA 3FXJA 3TDZC 2L4AA 3J80Z 1G3TA 1MMNA 2VQGA 2VJJA 2XAGA 4NNJA 3CCUI 2PLYA 3ZMVA 3C3WA 2V9KA 3JTGA 1FEXA 3TKYA 5E1ZB 3DPTA 3HIFA 3DXJF 3IL2A 1K78A 5B5EC 1DPRA 3MZYA 4PJJA 3JRDA 1IN4A 4D1QA 4BHBA 4UXNA 2ESNA 5JVTA 1X4OA 2WTEA 4AIKA 2HU9A 4D7MA 3DEWA 2CRGA 4BE2A 3BC8A 1T95A 1UB9A 4MQ9F 2V9VA 3D1NI 3JRFA 5IYBJ 1JXSA 5JLXA 1TNTA 4PJMA 4RGUA 3BTIA 4B4CA 1TTYA 3PQJA 3GLXA 3HOUJ 3QP6A 2BBYA 1OR7C 1IDYA 3DEEA 1DU6A 2X1EA 2A68F 3CDIA 3DV8A 1ZELA 4UV9A 3EYIA 2VOOA 2VT3A 2CG4A 1ZK8A 2EV0A 3KYCB 1V55H 4XLAA 3AG1H 1ZR2A 4ESFA 2AXTC 2BXZA 5M5YJ 4RS8A 1XDUA 4MHGA 1JTYA 2VPRA 2R92J 3S3NA 1B8IA 4RB0A 2VQLA 1OLTA 3AAFA 2OUMA 3K7AJ 3CF2A 4BJ5C 2Y31A 3PO2J 4WF2A 1B6AA 1YS7A 4Y33A 1W7PB 4RB1A 1YX3A 4ASNA 2DI3A 5DUIA 1W0UA 2L7KA 3NQOA 3GTMJ 2JA5J 2HQNA 3H5RA 1P92A 3RSNA 2FD5A 4W97A 3L2RA 3F6VA 2KLOA 2IGKA 3SQNA 1Y8RB 4P55A 2NVUB 5LD2C 2Z5UA 1YX5A 3R0AA 4AIHA 3AFHA 3HOXJ 1VNDA 3M4OJ 1V5FA 2DA4A 1HKQA 1S6LA 1BR4A 1U3EM 2UZKA 5EEAA 1FTTA 4M3EA 2L7FP 4B3XA 3FXOA 2HVSA 5DUKA 4IHWA 2EZKA 3S14J 3GTJJ 3HHHA 1TT0A 2HFHA 2LKPA 2YPRA 3C1DA 4BNCA 3KCCA 3OYGA 2OBPA 4HF2A 4A3LJ 4GRIA 3V7RA 3LFUA 2IS4A 3RKWA 2Q2EB 2A61A 3C7JA 1NHAA 3GWZA 4E7IA 2M45A 2BYVE 5DS9A 4B48A 2VKHA 1FPQA 2EIMH 4BEHB 1BW6A 2DK8A 4EATA 4WXDA 4PDKA 3FBIB 2QQBA 3TP0A 1TL8A 1T0FA 3WHBA 1JKPC 2AQFA 2BY1A 4RB3C 1DQUA 4EJWA 1MZBA 2CMPA 2DXIA 2H8WA 2H1KA 4IHSA 2HQAA 4B43A 2KIUA 1GXQA 2XRNA 4M3FA 4L0ZB 5EZHA 2ID3A 3WTSC 5M5XJ 4KISA 2PG4A 4C2MJ 1ZG5A 3FXUA 1HW1A 3KP5A 3CC4I 2BV6A 2MH2A 1XSVA 2FBIA 3HUGA 3O6BB 1Y39A 1AHDP 4KDPA 3L2VA 4JX4A 2CW8A 4QIWN 1JKQC 3GTGJ 3K10A 3ZQGA 4D0PA 2HYJA 1AWCA 2VXZA 2X4HA 3TO6A 3HBLA 5L3DA 2XPVA 2YU3A 4X6AJ 4KIFA 5CQEA 4PZJA 3K70C 1YW7A 1QGPA 3FMQA 4IPAA 4XK4A 3FHZA 1FYKA 1WVRA 3ABTA 1UAAA 4J00A 1W36D 4II2A 3RTRA 3Q0WA 2EFOA 3IWZA 2Y48A 4ETSA 3GZNB 2KJBA 2O03A 4YFKF 3JAMK 2DPDA 1RRJA 2JA6J 1XMXA 3I4MJ 3M7GA 2R5ZA 1LFUP 2XHKA 3PIPF 2FQ4A 1UCRA 2IJLA 2FJ1A 2ME6A 4AYBA 3ABMH 5KAIC 2ESHA 4YEJA 2Y69H 2QM3A 1ZKGA 3RPQA 2YX7A 4EM0B 4RGSA 2PMZN 1RR8C 2ZBKA 2IEKA 5DM6F 2QBYA 2Z99A 3CJTB 5E8GA 4A0ZA 4ZZDA 5DYMA 1U8BA 2QSFX 2O9LA 1IO2A 3ABKH 3T0YA 1BJZA 1O3QA 1GUUA 3WU2C 5KHDA 3EQLF 4I99C 2CJJA 3DFGA 3CMMA 2G7HA 1TWHJ 3V7CA 1P2FA 5FJ8J 1TZLA 3DTIA 3M1CA 2PMUA 3DTEA 3HM5A 3PIOF 3DPLC 3I59B 4CA0A 4EEFG 5J47A 4IVNA 2HEOA 2WB1N 2GBYA 4DBQA 2RREA 3ASNH 1QZEA 2R7OA 5FFXA 5ERIA 3UNGC 3M3YJ 5C4XJ 2QYOA 1JUSA 3H5NA 2IS2A 3KEOA 4U7DA 1T38A 2AQEA 4HZFA 2KFDA 2M7BA 3IC7A 2OAZA 1PUFB 1FOXA 5ICGA 1FIPA 2LLKA 3DLLF 2R7XA 2L3DA 3ZMDA 4BH9A 3OYLA 3P9IA 2AS5F 1AKHA 2BY0A 2M1BA 1FBQA 1YO5C 1X2MA 3BJ6A 3FHNA 3T1BA 4BE0A 5J40A 5KNLA 1LE8A 4QPQA 5LGTA 1LVAA 2QF7A 2NNYA 4IO9F 4RAFA 5FLVA 3OWTA 3RYPA 3AG2H 2CFXA 3H1CA 1E0EA 4IXAA 5M3FJ 3P5JA 4FTHA 1XS9A 2VPLA 4PGGA 5GAEJ 1APLC 4BQOA 1MJ9A 2JVHA 3HKZA 3WGIA 3DPUA 5HNHA 3HRMA 2K9SA 4E7ZA 4HNVA 1ZN2A 2IXSA 3H92A 4Y17A 1LE8B 2V9PA 2LG4A 2ZXIA 3H0DA 3ML6A 3OYDA 3TBIA 3N05A 2CQQA 3F8MA 3C2BA 2NVTJ 5F0HA 5LEJA 4Q48A 1D5VA 2JA2A 2TCTA 5E1WA 4ENNA 1QBJA 3RQ4A 1WH5A 2E34A 3FIWA 1LDKB 4HBLA 4Y3OA 5F0CA 1RKWA 4C9YA 3JREA 4YFNF 1VQPI 2OJED 2IGNA 5E17F 1T56A 1CF7B 1KU9A 4B1RA 4DIQA 4HX8A 4II3A 1WJDA 1BIAA 1ETYA 2ZJ2A 3FDYA 3LWFA 2NRAC 3E97A 2R7ZJ 1J09A 3CQZJ 3GZ5A 5FD5A 2I8DA 2IA0A 4LB6B 4XRSG 4ZYEA 1BOAA 1WKMA 4IX7A 2MSYA 5JI6A 2DU9A 2KRFA 2OZUA 1Z9CA 1D1CA 1K7AA 1BA5A 2GOXB 3S15J 4DYQA 3ZQLA 4IEJA 1B9NA 3HOZJ 2HZTA 3VDXA 4F3QA 5D6FA 3OL3A 2JSPA 3DBHB 5C44J 3CC7I 2QGUA 4XIDA 1KQ0A 1ORKA 1ZYRF 5TJJA 1SEUA 2K4BA 5AONA 3LSKA 5HDGA 2ZMEA 3SZTA 1ZGJA 3ZN1A 4NDLA 2Z1DA 3FXQA 3HSFA 4EJUA 4L9TA 3IV5A 5EGOA 3BPVA 1G3YA 2XAJA 3BJAA 3ISPA 3RI4A 1A31A 2ZXWH 3KETA 3CMEI 3FM3A 3LQQA 5K7FA 2UV1A 1BC7C 5TGTA 4LK0F 4CCLA 1R49A 3JW4A 2P8TA 2CUJA 2JUGA 1QO0D 3KYLA 2B9SA 2E19A 4P5OA 3S1MJ 4I0AA 3GFMA 3CCVI 1W5SA 3F0CA 3KP7A 1UJ8A 1XX5A 4M3GA 1H0MA 1MGTA 3KP6A 2LTPA 3QP5A 5D5WB 5JVGF 3ZCOA 2K9LA 4H0EA 5FKKA 4KITB 2A5WA 3CC2I 1B72B 4BE1A 1XPXA 2O5RA 3G2BA 3WTZA 3K4BA 2NOGA 3LNQA 2JUCA 1IV8A 1O7FA 3OIPA 3IRRA 4BXFA 3OSFA 1FYMA 1L3LA 4G7ZF 1FWZA 2YX4A 2ACJA 5FKOA 1F4KA 4FX4A 2NS8A 5IT3A 2LD5A 5K7HA 2KPMA 2O7OA 2X1CA 4YFXF 1P9QC 3ZRGA 1R1VA 3BZKA 4C3HJ 4DOZA 1IV6A 4A3MJ 3G1LA 3B02A 2L9RA 1VF9A 3L2CA 2NAZA 4JP0A 1GHCA 1BI1A 1SD6A 3Q0VA 5ILUA 3F9KA 4M71A 5LFAA 2DT7B 5KAFC 2CUFA 3G1MA 1IUYA 5J8FA 4WX9A 4IHXA 2VONA 1MMAA 5CVVA 2EINH 1H88C 1HSJA 3MEXA 5GTIC 1YYVA 4S05A 4GO1A 2DT6A 2PX9A 5M5WJ 4EJVA 3E5UA 3WODF 4L5EA 2MD5A 2VBYA 4ZDPA 3TP3A 3U9GA 2WA0A 2DQRA 1VQ9I 2VQCA 1WHUA 3MZHA 4UVBA 4XLFA 1H8AC 3DKWA 1UG2A 5HOOA 3BCBA 1FNNA 1MBGA 1WCMJ 2EV5A 2JJ7A 3Q9VA 2HDDA 3LSHA 2E1MC 1XG1A 4Z2YA 5F1JA 5D4RA 3RZOJ 3ULQB 1U6GA 3I0TA 4CH7A 5GTHC 2HQ5A 2A5YB 2W57A 1S29A 3IWFA 1X2NA 2CQNA 4QWQA 4M3BA 4J19A 1MH3A 1M1EB 2QVOA 5ICEA 3OS2A 2X6OA 2MW8A 3H0GJ 2JK3A 1T0FC 4PJLA 2BEOA 5L3EA 5CYVA 4KMFA
chains in the Genus database with same CATH topology
1BJAA 5ICFA 2D2WA 3F6OA 2VOPA 4CICA 1YTYA 4F7ZA 4MTDA 4M9XA 4A12A 3GUDA 5DCFA 3F8NA 2ISYA 1UFMA 1V3FA 5CVIA 3F8CA 1GVJA 2Y75A 4WK8F 4L5JA 1R00A 3GYHX 1P4XA 1KGSA 3FM5A 4YIFA 3L09A 4LD5A 1O3SA 1R36A 2VC0A 4HF0A 4HQEA 1BI0A 3WG9A 3W6JB 4E70A 3VEPA 3F21A 3E6DA 1G3SA 4LMYA 1XD7A 4OINF 4OU0A 4CO8A 3M8FA 1XGSA 2CYYA 1D8JA 1IN7A 2YSRA 4I02A 4KUMA 2P5LC 2ZKZA 2J5OA 1TW3A 5HS8A 1XGOA 1MDMB 1OYYA 5H6RA 1QPMA 5BPIA 1IW7F 2RV8A 2E7XA 1R5HA 1SMTA 4EM2A 3ZMTA 4EJTA 3L7WA 1REPC 3IHUA 3I71A 4EM1A 4IRGA 4UV8A 3C18A 1ULYA 1R22A 3I54A 5DD8A 3FWEA 4LG0B 1Y0UA 4L0YB 3ELKA 5LRSA 2JSCA 2FMYA 2F2EA 4BQAA 4FHTA 3J81K 1XCVA 3GF2A 2OU2A 1AOYA 2PBIA 2QQ9A 1Z91A 1J75A 4AVPA 4ON0A 5HLHA 4G6QA 3ZN0A 1T2KA 2RQPA 2BE5F 1HKTA 2HS5A 3CDHA 3L00A 3LSTA 1BM9A 2DTRA 4M6XA 3CO7C 2O6GE 5L3FA 1ZAOA 4G8XA 1Z6RA 1XCBA 4HLXA 3WTYC 3F8BA 1T6SA 2XAFA 3ABUA 4B09A 2EV6A 1ODDA 2XV4S 1JHHA 1LNWA 3QOPA 4KNYA 2HTJA 4A5MA 2RVCA 1LB2A 3QRFF 1RI7A 1K78B 2M30A 4ZYGA 4B8XA 5ICCA 5BS6A 5DEQA 2IA1A 3R0JA 3ZQ7A 5LEKA 1KYWA 1FYLA 2TDXA 2QWWA 1ZRCA 2WC2A 3IRQA 2H09A 3QAHA 4L9VA 4KFCA 2VC1A 2XKPA 1P4AA 3FMSA 3W6KB 1W5TA 5FGMA 2XVCA 3RJPA 1W7PD 4ENJA 1I5ZA 3M9AA 2H27A 2Y0MA 2ETHA 1ZRFA 3CLOA 2DLLA 1G4DA 2RN7A 3I5UA 1PP8F 2XASA 5L3GA 2O0YA 5E1XA 5J6XA 4LJZF 3K9TA 1DDNA 3HHGA 1YG2A 4IRIA 4KICA 3N4MA 1OMIA 4HX4A 4NB5A 1FP2A 1O3TA 1YQAA 1DUXC 1HW5A 4ENKA 3TO9A 4Q5SF 2DK5A 5AIQA 1D8KA 1IXSB 2HKOA 4I2OA 1U5TA 4WXCA 1IN5A 4CZZA 2H6BA 1K6OA 1J9IA 1IF1A 4OIPF 4S04A 3P7NA 1G6NA 3RKYA 5FFZA 5L3CA 2D1HA 3BZ6A 4UVCA 4G9YA 1XB4A 1LDJA 3BOQA 4P96A 4DQ2A 1ON1A 3HOTA 4U88A 2A6HF 2C6YA 4K2EA 2K7LA 1R7JA 1U78A 1ZRDA 1R23A 5LLQA 3BPXA 4ENMA 1Z7UA 1TBXA 3M8EA 3FZVA 3FXRA 2QBYB 2IVMA 5LGNA 5TRDA 4GXOA 1ON2A 1FBUA 2L4MA 1MJBA 5CVUA 3H3UA 5K1YA 1RUNA 2STTA 5E18F 1TNSA 2L02A 2FNPA 5JHUA 4RAYA 1FP1D 4WWCA 2MLGA 3KLOA 4GYIA 1HQCA 5D5UB 1YLFA 1WI9A 3F22A 1E17A 5IT9K 4CHUA 3WTXC 2PFBA 3V8KA 3GX4X 3EETA 2CWEA 3D0SA 1YIOA 1FSEA 4LLNA 4Q4ZF 1A04A 3CUQA 2X0LA 3E3VA 1Q1HA 4RGRA 1XSDA 1DP7P 2JZYA 1LEBA 2R7FA 1R1TA 3CUQB 1EH8A 3N97A 2DO7A 3TDUC 5L3BA 2EWNA 3HTUA 4HW0A 3H3ZA 3IKVA 4EGYA 2QENA 2VN2A 2PEXA 1J7KA 2PN6A 5D5VB 5DD4A 3WE3A 4YIIA 2VODA 2XROA 1OPCA 1FBSA 2KJCA 3K1NA 3VB2A 4HYEA 3CO6C 3QU3A 3HSRA 1FZPB 5A2QK 2ZCWA 3RDIA 4UUVA 4XSXF 1I27A 1SD4A 3CUOA 1CGPA 5K5RA 3K2ZA 3HYIA 3REOA 2XAQA 5HLGA 3TO7A 2HR3A 3WU1B 3ROUA 1OKRA 1ZG3A 2ZMEB 3WE2A 4R1HA 3S2WA 3BWGA 2GXBA 1E2XA 1L0OC 4HV6A 2COMA 4OMZA 2A6EF 2PQ8A 4EJOA 3WTTC 3K0LA 2F5FA 2K86A 1TQIA 1EH7A 2F5EA 2Z3YA 4I0BA 3EYYA 2STWA 2EA4A 3E5XA 3KP3A 3NRVA 3GXOA 3OOPA 1XDSA 2E1NA 2HDCA 3QPTA 2EFWA 2P7CB 3MFKA 3ZPLA 4OOIA 3JAMZ 2K02A 4FT8A 2V1UA 4L18B 2KKOA 2GA1A 1UHWA 2KIFA 4HDVA 2HYGD 5HDKA 4NQWA 5EEGA 1H9TA 4UHTA 2ZXJA 4KN4X 2W85A 3M1EA 2E7WA 4WCGA 3LFKA 3KP2A 3EUHA 5CLSA 3KFWX 4N0BA 3T8TA 2O61A 1XN7A 2CQKA 1I1SA 3RIRA 4QLCU 4HA8A 1IAWA 3GVAA 2NNNA 5LHIA 2RNJA 2AXLA 3SHFA 1USTA 1BI3A 4KT5C 4GYGA 1U5TC 4BXUA 2VE9A 3J7AO 2EB7A 3QU6A 4LFUA 2MA3A 4U0WA 4CXFA 3ZMZA 2DW4A 5LHGA 4RGXA 2R3SA 3MWMA 1SD7A 3R4KA 2HQRA 3ZMSA 2GQQA 1FX7A 3LAPA 4OIQF 2MC3A 3VFZA 4HOBA 4A5NA 3GFLA 1PP7U 4O6JA 3V8LA 1IN6A 4RB2C 4MGRA 1X3UA 3KZZA 2RGVA 4KIBA 2GWRA 2JRTA 1USSA 2JT1A 1YW9A 1YFHA 5K5OA 3TOAA 1VTNC 1B59A 2O8XA 1WQ2A 3V7SA 3KEQA 5KK1A 5F6FA 5JFRA 5BPDA 1HSTA 2FBKA 4CYDA 1OYIA 3SFZA 5DDGA 1UHMA 1FLIA 3B73A 4UNOA 1FY7A 2WV0A 1EH6A 4WXHA 4EMSA 3VOEA 3KE2A 3ECHA 2RKHA 1P4WA 1V4RA 3RPUA 3LA3A 2ADUA 3E6MA 1W4MA 3MCZA 1JGSA 1R5GA 2W25A 4P9FA 1IXRC 1ZHFA 2HGCA 3E6CC 1XSXA 2NYXA 2P5VA 1BC8C 2OQGA 3PFIA 4Q47A 1SMYF 1O3RA 5LBQA 3F3XA 3FF5A 2LF8A 5LRRA 3NEUA 3K1MA 5FLXK 1G3WA 2P6SA 3T8RA 3U2RA 3CUQC 5HS7A 2HKXA 4M9ZA 2IA2A 3MQ0A 2Z33A 1SFXA 1F9NA 4LGWA 4NHJA 2R7DA 3COAC 2A3SA 3V4GA 2XUBA 3HRSA 5FD6A 3LA2A 2G7UA 3I64A 4KN7X 4L9NA 2GXGA 1QZZA 2DPUA 1U2WA 4LLGF 3HOSA 1ONVA 5CVRA 2VBZA 1W7PA 3F23A 1LEAA 2ZNZA 1ZREA 1IRFA 2EFQA 2LF7A 4GCVA 5ED4A 2NS0A 3FMRA 4XLNF 2JPCA 3IKTA 1T98A 2HWVA 4ESBA 5EEHA 3G73A 3GEZA 2EJRA 1F1ZA 3GZ6A 5D6EA 1TLHB 4U0YA 1JE8A 4HQMA 1S8NA 2FA5A 2F5DA 3HRTA 2ISZA 3HTSB 2UXXA 5LHHA 2CGPA 2Q2EA 4IRHA 2E1CA 1QZYA 1HBXG 2OD5A 2ZNYA 3E6BA 5K5QA 2L01A 4EV0A 1O57A 3KZYA 3BP8A 1BBYA 3ZMUA 5HVQC 3R61A 4I98B 2IW5A 2CW0F 2YR2A 4M72A 4BHPA 5JR3A 4G94A 4M73A 2EA2A 4HDUA 3ZP5A 2H94A 1FT9A 2LNBA 2Z9OA 1XMAA 1ZGAA 1S7AA 4O5VA 1RUOA 2GZWA 2QQAA 1S7OA 3P9KA 3F72A 3LQRA 1KU7A 4MEXF 1MD0A 4I09A 4HAMA 1KU3A 2VBWA 4BYYA 1T39A 4G7OF 1J0RA 2GIVA 1R58A 5AIPA 3WTUC 1R1UA 1U5TB 2ELHA 2A07F 1WRJA 1HW2A 4A6EA 3O3KA 3T5XA 3SXYA 4I01A 2JTVA 1P6RA 2XAHA 1KYZA 3V8JA 1I1GA 2EFPA 2EFNA 2HYFA 2P6TA 5BQTA 1Z6TA 1FC3A 2DBBA 2QZ8A 2FU4A 2VBXA 4HX7A 3JSOA 3I59A 4ESJA 2F5CA 3EDPA 1Z1DA 5DV5A 4AIJA 4CGZA 5D8LB 1B1BA 5H20A 2EK5A 1S3JA 2K27A 2XKOA 2LDUA 2V79A 4PGHA 3ERED 3J81Z 4PCQA 3TQNA 1PUEE 4U7BA 2RC4A 2PMHA 4MNUA 4L9JA 2LSOA 3MAJA 3WTWC 4TV7A 1SAXA 4OMYA 4IJAA 4LB5A 4KMUX 2W84A 3BJOA 4R79A 2PI0A 5FLXZ 1LJ9A 5J8CA 3K1PA 2V1XA 3KP4A 3GFIA 3OV8A 2DQLA 4AD9A 3TGNA 1CF7A 2KIMA 5DCMA 3LA7A 2XIGA 3F8FA 1MJAA 3DQVC 1KQ8A 2VE8A 4I7HA 5HDNA 2MLKA 1STZA 1OR7A 1QQIA 3KLNA 2P4WA 5FO5A 5H6QA 3R6SA 4G6DA 5DCMB 2A69F 1QNTA 1K79A 5BOXA 4HF1A 4O3MA 1I6XA 4KYWA 1TQMA 1KQ9A 1SFUA 2FOKA 3I53A 1J2XA 2CO5A 4A0XA 1RNLA 2W24A 4BHCA 3FX3A 3CTAA 2CSOA 1WSUA 1IZ1A 3L9FA 3O2PE 1IRGA 4Y15A 4HV5A 1Z05A 2M8EA 3J80K 4DNCA 4N9IA 2Q8KA 2O3FA 1ZH5A 2OA4A 1YS6A 1LDDA 2QUFA 2FQ3A 4Y13A 4HLYA 3WU0A 1KA8A 3DF8A 4M9SA 4GGGA 5D8KB 3I4PA 3Q5FA 4ZH4F 2GA2A 2VT2A 5ILVA 4JBAA 2MH9A 1ZLJA 3Q9SA 2FBHA 1XGMA 2V6CA 4KA4A 3QPHA 3HSEA 2UWMA 2Q0OA 4BAYA 2HOEA 2L54A 2D45A 2G9WA 2B0LA 4AWXB 4ZYDA 2D1VA 2FMLA 1O7LA 4EGZA 4OIOF 1EV7A 3GW2A 2ZFWA 2K4JA 5ILSA 1KU2A 1B4AA 5D4SA 2FNAA 5KVRA 5FB2A 3BDDA 3SZPA 3BROA 4A0YA 4U0VA 1IXCA 2BGCA 2IPQX 4R8HA 5HLIA 2IT0A 1HKSA 4CDGA 1F5TA 2GAUA 2FF4A 1XMKA 1B9MA 4M6YA 4XRFA 1XGNA 5D5XB 1BN5A 1SFEA 4RAZA 3R60A 4L5IA 1OYWA 2MBFA 2QLZA 2J5PA 2FE3A 4XSZF 2FSWA 5F1RA 2M87A 4M74A 3RKXA 2IRFG 2V1DA 4JK1X 5E8IA 1GXPA 2DFIA 1JHFA 1RIOH 4XLPF 4EQQA 2PJPA 4MEYF 4IHTA 2FXAA 1PDNC 2HTSA 4OIRF 3VODA 4UVAA 5LGUA 2H6CA 5HS9A 4JQFA 1FSHA 3E5QA 3LAJA 1FOKA 1TQPA 3P9CA 3GFJA 3D5LA 3DEUA 4G7HF 2UXNA 1RZ4A 4KIGA 3JTHA 3I58A 1MKMA 1MDMA 3RYRA 2M5WA 3K69A 4IF4A 5CVJA 5IT9Z 4P9UA 3U1DA 3GO5A 2JPBA 3JSPA 1LQ1A 4LK1F 2DT5A 2P7VB 3CJNA 2FRHA 4YG2F 3DP7A 4XBFA 4N9HA 2ZO4A 5CJ9A 2FEZA 4A2UA 1ZARA 4ZYHA 3WTVC 4LG0A 1HXDA 2P5KA 2XGXA 4ZZLA 1SD5A 6PAXA 1BIBA 1DPUA 4A6DA 5E20A 5F64A 3BY6A 4LLLA 1H9GA 1BI2A 1YW8A 1IN8A 2DAOA 1TW2A 3WGGA 4MTEA 3ECOA 1WWXA 1J5YA 3TOBA 3HRUA 1ZLKA 3PQKA 4FX0A 3WGHA 1ZG1A 2OQRA 1U8RA 2WWYA 3G3ZA 1C0WA 2OZ6A 2IP2A 5A2QZ 2RDPA 4EVIA 1J59A 4MQVA 5BMZA 1D3YA 3TDZC 2L4AA 3J80Z 1G3TA 2XAGA 2PLYA 3ZMVA 3C3WA 3JTGA 3TKYA 5E1ZB 3DPTA 3HIFA 3DXJF 3IL2A 1K78A 1DPRA 3MZYA 1IN4A 4BHBA 4UXNA 2ESNA 5JVTA 2WTEA 4AIKA 1UB9A 4MQ9F 2V9VA 1JXSA 1TNTA 4RGUA 1TTYA 3PQJA 3GLXA 3QP6A 2BBYA 2A68F 3DV8A 4UV9A 3EYIA 2VOOA 2VT3A 2CG4A 2EV0A 4ESFA 4RS8A 1XDUA 4MHGA 4RB0A 3AAFA 4WF2A 1B6AA 1YS7A 1W7PB 4RB1A 4ASNA 2DI3A 5DUIA 3NQOA 2HQNA 1P92A 3F6VA 3SQNA 4P55A 2Z5UA 4AIHA 3R0AA 1HKQA 1S6LA 1U3EM 2UZKA 5DUKA 3HHHA 2HFHA 2LKPA 2YPRA 3C1DA 4BNCA 3KCCA 2OBPA 4HF2A 3V7RA 3RKWA 2A61A 1NHAA 3C7JA 3GWZA 2M45A 2BYVE 1FPQA 2DK8A 4WXDA 4PDKA 2QQBA 1T0FA 4RB3C 4EJWA 1MZBA 4IHSA 2KIUA 1GXQA 2XRNA 4L0ZB 3WTSC 2PG4A 1ZG5A 3FXUA 1HW1A 3KP5A 2BV6A 2MH2A 1XSVA 2FBIA 3HUGA 3O6BB 4KDPA 4D0PA 1AWCA 2VXZA 2X4HA 3TO6A 5L3DA 2YU3A 4KIFA 4PZJA 1YW7A 1QGPA 3FMQA 4IPAA 3FHZA 1FYKA 3ABTA 3RTRA 2EFOA 3IWZA 2Y48A 4ETSA 3JAMK 2KJBA 2O03A 4YFKF 2DPDA 3M7GA 2XHKA 1UCRA 2IJLA 2ESHA 2QM3A 3RPQA 4EM0B 2YX7A 4RGSA 2ZBKA 2QBYA 2Z99A 5E8GA 4A0ZA 4ZZDA 5DYMA 3T0YA 1O3QA 3EQLF 3DFGA 2G7HA 3V7CA 1P2FA 2PMUA 3DPLC 3I59B 4IVNA 2HEOA 5FFXA 5ERIA 2QYOA 3KEOA 4U7DA 1T38A 4HZFA 3IC7A 2OAZA 5ICGA 2L3DA 3ZMDA 4BH9A 3P9IA 2AS5F 2M1BA 1FBQA 1YO5C 3BJ6A 3T1BA 5LGTA 1LVAA 2NNYA 3RYPA 2CFXA 4IXAA 4PGGA 1MJ9A 3WGIA 3HRMA 1ZN2A 3H92A 4Y17A 3ML6A 3F8MA 5LEJA 4Q48A 1D5VA 5E1WA 4ENNA 1QBJA 4HBLA 1LDKB 4YFNF 5E17F 1CF7B 1KU9A 4HX8A 1BIAA 2ZJ2A 3LWFA 2NRAC 3E97A 3GZ5A 5FD5A 2IA0A 4LB6B 4ZYEA 1BOAA 1WKMA 5JI6A 2DU9A 2KRFA 2OZUA 1Z9CA 1K7AA 1B9NA 2HZTA 5D6FA 1KQ0A 1ZYRF 5TJJA 2K4BA 5AONA 5HDGA 2ZMEA 3SZTA 1ZGJA 3ZN1A 3FXQA 3HSFA 4EJUA 4L9TA 3BPVA 1G3YA 2XAJA 3BJAA 3ISPA 3RI4A 3KETA 3FM3A 3LQQA 1BC7C 4LK0F 3JW4A 2P8TA 1QO0D 4P5OA 4I0AA 3GFMA 1W5SA 3KP7A 1H0MA 1MGTA 3KP6A 3QP5A 5D5WB 4H0EA 3WTZA 1O7FA 3IRRA 1FYMA 1L3LA 4G7ZF 1FWZA 2YX4A 2ACJA 1F4KA 4FX4A 5IT3A 4YFXF 1R1VA 3B02A 3L2CA 2NAZA 1GHCA 1BI1A 1SD6A 5ILUA 4M71A 1IUYA 5J8FA 4WX9A 2VONA 5CVVA 1HSJA 3MEXA 1YYVA 4S05A 4GO1A 4EJVA 3E5UA 3WODF 2MD5A 2VBYA 3U9GA 2DQRA 3MZHA 4UVBA 3DKWA 5HOOA 1FNNA 2EV5A 3Q9VA 4Z2YA 5D4RA 3ULQB 1U6GA 3I0TA 2A5YB 2W57A 1S29A 3IWFA 4QWQA 2QVOA 5ICEA 2BEOA 5L3EA 5CYVA 4KMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJA A;  5ICF A;  2D2W A;  3F6O A;  2VOP A;  4CIC A;  1YTY A;  4F7Z A;  4MTD A;  4M9X A;  4A12 A;  3GUD A;  5DCF A;  3F8N A;  2ISY A;  1UFM A;  1V3F A;  5CVI A;  3F8C A;  1GVJ A;  2Y75 A;  4WK8 F;  4L5J A;  1R00 A;  3GYH X;  1P4X A;  1KGS A;  3FM5 A;  4YIF A;  3L09 A;  4LD5 A;  1O3S A;  1R36 A;  2VC0 A;  4HF0 A;  4HQE A;  1BI0 A;  3WG9 A;  3W6J B;  4E70 A;  3VEP A;  3F21 A;  3E6D A;  1G3S A;  4LMY A;  1XD7 A;  4OIN F;  4OU0 A;  4CO8 A;  3M8F A;  1XGS A;  2CYY A;  1D8J A;  1IN7 A;  2YSR A;  4I02 A;  4KUM A;  2P5L C;  2ZKZ A;  2J5O A;  1TW3 A;  5HS8 A;  1XGO A;  1MDM B;  1OYY A;  5H6R A;  1QPM A;  5BPI A;  1IW7 F;  2RV8 A;  2E7X A;  1R5H A;  1SMT A;  4EM2 A;  3ZMT A;  4EJT A;  3L7W A;  1REP C;  3IHU A;  3I71 A;  4EM1 A;  4IRG A;  4UV8 A;  3C18 A;  1ULY A;  1R22 A;  3I54 A;  5DD8 A;  3FWE A;  4LG0 B;  1Y0U A;  4L0Y B;  3ELK A;  5LRS A;  2JSC A;  2FMY A;  2F2E A;  4BQA A;  4FHT A;  3J81 K;  1XCV A;  3GF2 A;  2OU2 A;  1AOY A;  2PBI A;  2QQ9 A;  1Z91 A;  1J75 A;  4AVP A;  4ON0 A;  5HLH A;  4G6Q A;  3ZN0 A;  1T2K A;  2RQP A;  2BE5 F;  1HKT A;  2HS5 A;  3CDH A;  3L00 A;  3LST A;  1BM9 A;  2DTR A;  4M6X A;  3CO7 C;  2O6G E;  5L3F A;  1ZAO A;  4G8X A;  1Z6R A;  1XCB A;  4HLX A;  3WTY C;  3F8B A;  1T6S A;  2XAF A;  3ABU A;  4B09 A;  2EV6 A;  1ODD A;  2XV4 S;  1JHH A;  1LNW A;  3QOP A;  4KNY A;  2HTJ A;  4A5M A;  2RVC A;  1LB2 A;  3QRF F;  1RI7 A;  1K78 B;  2M30 A;  4ZYG A;  4B8X A;  5ICC A;  5BS6 A;  5DEQ A;  2IA1 A;  3R0J A;  3ZQ7 A;  5LEK A;  1KYW A;  1FYL A;  2TDX A;  2QWW A;  1ZRC A;  2WC2 A;  3IRQ A;  2H09 A;  3QAH A;  4L9V A;  4KFC A;  2VC1 A;  2XKP A;  1P4A A;  3FMS A;  3W6K B;  1W5T A;  5FGM A;  2XVC A;  3RJP A;  1W7P D;  4ENJ A;  1I5Z A;  3M9A A;  2H27 A;  2Y0M A;  2ETH A;  1ZRF A;  3CLO A;  2DLL A;  1G4D A;  2RN7 A;  3I5U A;  1PP8 F;  2XAS A;  5L3G A;  2O0Y A;  5E1X A;  5J6X A;  4LJZ F;  3K9T A;  1DDN A;  3HHG A;  1YG2 A;  4IRI A;  4KIC A;  3N4M A;  1OMI A;  4HX4 A;  4NB5 A;  1FP2 A;  1O3T A;  1YQA A;  1DUX C;  1HW5 A;  4ENK A;  3TO9 A;  4Q5S F;  2DK5 A;  5AIQ A;  1D8K A;  1IXS B;  2HKO A;  4I2O A;  1U5T A;  4WXC A;  1IN5 A;  4CZZ A;  2H6B A;  1K6O A;  1J9I A;  1IF1 A;  4OIP F;  4S04 A;  3P7N A;  1G6N A;  3RKY A;  5FFZ A;  5L3C A;  2D1H A;  3BZ6 A;  4UVC A;  4G9Y A;  1XB4 A;  1LDJ A;  3BOQ A;  4P96 A;  4DQ2 A;  1ON1 A;  3HOT A;  4U88 A;  2A6H F;  2C6Y A;  4K2E A;  2K7L A;  1R7J A;  1U78 A;  1ZRD A;  1R23 A;  5LLQ A;  3BPX A;  4ENM A;  1Z7U A;  1TBX A;  3M8E A;  3FZV A;  3FXR A;  2QBY B;  2IVM A;  5LGN A;  5TRD A;  4GXO A;  1ON2 A;  1FBU A;  2L4M A;  1MJB A;  5CVU A;  3H3U A;  5K1Y A;  1RUN A;  2STT A;  5E18 F;  1TNS A;  2L02 A;  2FNP A;  5JHU A;  4RAY A;  1FP1 D;  4WWC A;  2MLG A;  3KLO A;  4GYI A;  1HQC A;  5D5U B;  1YLF A;  1WI9 A;  3F22 A;  1E17 A;  5IT9 K;  4CHU A;  3WTX C;  2PFB A;  3V8K A;  3GX4 X;  3EET A;  2CWE A;  3D0S A;  1YIO A;  1FSE A;  4LLN A;  4Q4Z F;  1A04 A;  3CUQ A;  2X0L A;  3E3V A;  1Q1H A;  4RGR A;  1XSD A;  1DP7 P;  2JZY A;  1LEB A;  2R7F A;  1R1T A;  3CUQ B;  1EH8 A;  3N97 A;  2DO7 A;  3TDU C;  5L3B A;  2EWN A;  3HTU A;  4HW0 A;  3H3Z A;  3IKV A;  4EGY A;  2QEN A;  2VN2 A;  2PEX A;  1J7K A;  2PN6 A;  5D5V B;  5DD4 A;  3WE3 A;  4YII A;  2VOD A;  2XRO A;  1OPC A;  1FBS A;  2KJC A;  3K1N A;  3VB2 A;  4HYE A;  3CO6 C;  3QU3 A;  3HSR A;  1FZP B;  5A2Q K;  2ZCW A;  3RDI A;  4UUV A;  4XSX F;  1I27 A;  1SD4 A;  3CUO A;  1CGP A;  5K5R A;  3K2Z A;  3HYI A;  3REO A;  2XAQ A;  5HLG A;  3TO7 A;  2HR3 A;  3WU1 B;  3ROU A;  1OKR A;  1ZG3 A;  2ZME B;  3WE2 A;  4R1H A;  3S2W A;  3BWG A;  2GXB A;  1E2X A;  1L0O C;  4HV6 A;  2COM A;  4OMZ A;  2A6E F;  2PQ8 A;  4EJO A;  3WTT C;  3K0L A;  2F5F A;  2K86 A;  1TQI A;  1EH7 A;  2F5E A;  2Z3Y A;  4I0B A;  3EYY A;  2STW A;  2EA4 A;  3E5X A;  3KP3 A;  3NRV A;  3GXO A;  3OOP A;  1XDS A;  2E1N A;  2HDC A;  3QPT A;  2EFW A;  2P7C B;  3MFK A;  3ZPL A;  4OOI A;  3JAM Z;  2K02 A;  4FT8 A;  2V1U A;  4L18 B;  2KKO A;  2GA1 A;  1UHW A;  2KIF A;  4HDV A;  2HYG D;  5HDK A;  4NQW A;  5EEG A;  1H9T A;  4UHT A;  2ZXJ A;  4KN4 X;  2W85 A;  3M1E A;  2E7W A;  4WCG A;  3LFK A;  3KP2 A;  3EUH A;  5CLS A;  3KFW X;  4N0B A;  3T8T A;  2O61 A;  1XN7 A;  2CQK A;  1I1S A;  3RIR A;  4QLC U;  4HA8 A;  1IAW A;  3GVA A;  2NNN A;  5LHI A;  2RNJ A;  2AXL A;  3SHF A;  1UST A;  1BI3 A;  4KT5 C;  4GYG A;  1U5T C;  4BXU A;  2VE9 A;  3J7A O;  2EB7 A;  3QU6 A;  4LFU A;  2MA3 A;  4U0W A;  4CXF A;  3ZMZ A;  2DW4 A;  5LHG A;  4RGX A;  2R3S A;  3MWM A;  1SD7 A;  3R4K A;  2HQR A;  3ZMS A;  2GQQ A;  1FX7 A;  3LAP A;  4OIQ F;  2MC3 A;  3VFZ A;  4HOB A;  4A5N A;  3GFL A;  1PP7 U;  4O6J A;  3V8L A;  1IN6 A;  4RB2 C;  4MGR A;  1X3U A;  3KZZ A;  2RGV A;  4KIB A;  2GWR A;  2JRT A;  1USS A;  2JT1 A;  1YW9 A;  1YFH A;  5K5O A;  3TOA A;  1VTN C;  1B59 A;  2O8X A;  1WQ2 A;  3V7S A;  3KEQ A;  5KK1 A;  5F6F A;  5JFR A;  5BPD A;  1HST A;  2FBK A;  4CYD A;  1OYI A;  3SFZ A;  5DDG A;  1UHM A;  1FLI A;  3B73 A;  4UNO A;  1FY7 A;  2WV0 A;  1EH6 A;  4WXH A;  4EMS A;  3VOE A;  3KE2 A;  3ECH A;  2RKH A;  1P4W A;  1V4R A;  3RPU A;  3LA3 A;  2ADU A;  3E6M A;  1W4M A;  3MCZ A;  1JGS A;  1R5G A;  2W25 A;  4P9F A;  1IXR C;  1ZHF A;  2HGC A;  3E6C C;  1XSX A;  2NYX A;  2P5V A;  1BC8 C;  2OQG A;  3PFI A;  4Q47 A;  1SMY F;  1O3R A;  5LBQ A;  3F3X A;  3FF5 A;  2LF8 A;  5LRR A;  3NEU A;  3K1M A;  5FLX K;  1G3W A;  2P6S A;  3T8R A;  3U2R A;  3CUQ C;  5HS7 A;  2HKX A;  4M9Z A;  2IA2 A;  3MQ0 A;  2Z33 A;  1SFX A;  1F9N A;  4LGW A;  4NHJ A;  2R7D A;  3COA C;  2A3S A;  3V4G A;  2XUB A;  3HRS A;  5FD6 A;  3LA2 A;  2G7U A;  3I64 A;  4KN7 X;  4L9N A;  2GXG A;  1QZZ A;  2DPU A;  1U2W A;  4LLG F;  3HOS A;  1ONV A;  5CVR A;  2VBZ A;  1W7P A;  3F23 A;  1LEA A;  2ZNZ A;  1ZRE A;  1IRF A;  2EFQ A;  2LF7 A;  4GCV A;  5ED4 A;  2NS0 A;  3FMR A;  4XLN F;  2JPC A;  3IKT A;  1T98 A;  2HWV A;  4ESB A;  5EEH A;  3G73 A;  3GEZ A;  2EJR A;  1F1Z A;  3GZ6 A;  5D6E A;  1TLH B;  4U0Y A;  1JE8 A;  4HQM A;  1S8N A;  2FA5 A;  2F5D A;  3HRT A;  2ISZ A;  3HTS B;  2UXX A;  5LHH A;  2CGP A;  2Q2E A;  4IRH A;  2E1C A;  1QZY A;  1HBX G;  2OD5 A;  2ZNY A;  3E6B A;  5K5Q A;  2L01 A;  4EV0 A;  1O57 A;  3KZY A;  3BP8 A;  1BBY A;  3ZMU A;  5HVQ C;  3R61 A;  4I98 B;  2IW5 A;  2CW0 F;  2YR2 A;  4M72 A;  4BHP A;  5JR3 A;  4G94 A;  4M73 A;  2EA2 A;  4HDU A;  3ZP5 A;  2H94 A;  1FT9 A;  2LNB A;  2Z9O A;  1XMA A;  1ZGA A;  1S7A A;  4O5V A;  1RUO A;  2GZW A;  2QQA A;  1S7O A;  3P9K A;  3F72 A;  3LQR A;  1KU7 A;  4MEX F;  1MD0 A;  4I09 A;  4HAM A;  1KU3 A;  2VBW A;  4BYY A;  1T39 A;  4G7O F;  1J0R A;  2GIV A;  1R58 A;  5AIP A;  3WTU C;  1R1U A;  1U5T B;  2ELH A;  2A07 F;  1WRJ A;  1HW2 A;  4A6E A;  3O3K A;  3T5X A;  3SXY A;  4I01 A;  2JTV A;  1P6R A;  2XAH A;  1KYZ A;  3V8J A;  1I1G A;  2EFP A;  2EFN A;  2HYF A;  2P6T A;  5BQT A;  1Z6T A;  1FC3 A;  2DBB A;  2QZ8 A;  2FU4 A;  2VBX A;  4HX7 A;  3JSO A;  3I59 A;  4ESJ A;  2F5C A;  3EDP A;  1Z1D A;  5DV5 A;  4AIJ A;  4CGZ A;  5D8L B;  1B1B A;  5H20 A;  2EK5 A;  1S3J A;  2K27 A;  2XKO A;  2LDU A;  2V79 A;  4PGH A;  3ERE D;  3J81 Z;  4PCQ A;  3TQN A;  1PUE E;  4U7B A;  2RC4 A;  2PMH A;  4MNU A;  4L9J A;  2LSO A;  3MAJ A;  3WTW C;  4TV7 A;  1SAX A;  4OMY A;  4IJA A;  4LB5 A;  4KMU X;  2W84 A;  3BJO A;  4R79 A;  2PI0 A;  5FLX Z;  1LJ9 A;  5J8C A;  3K1P A;  2V1X A;  3KP4 A;  3GFI A;  3OV8 A;  2DQL A;  4AD9 A;  3TGN A;  1CF7 A;  2KIM A;  5DCM A;  3LA7 A;  2XIG A;  3F8F A;  1MJA A;  3DQV C;  1KQ8 A;  2VE8 A;  4I7H A;  5HDN A;  2MLK A;  1STZ A;  1OR7 A;  1QQI A;  3KLN A;  2P4W A;  5FO5 A;  5H6Q A;  3R6S A;  4G6D A;  5DCM B;  2A69 F;  1QNT A;  1K79 A;  5BOX A;  4HF1 A;  4O3M A;  1I6X A;  4KYW A;  1TQM A;  1KQ9 A;  1SFU A;  2FOK A;  3I53 A;  1J2X A;  2CO5 A;  4A0X A;  1RNL A;  2W24 A;  4BHC A;  3FX3 A;  3CTA A;  2CSO A;  1WSU A;  1IZ1 A;  3L9F A;  3O2P E;  1IRG A;  4Y15 A;  4HV5 A;  1Z05 A;  2M8E A;  3J80 K;  4DNC A;  4N9I A;  2Q8K A;  2O3F A;  1ZH5 A;  2OA4 A;  1YS6 A;  1LDD A;  2QUF A;  2FQ3 A;  4Y13 A;  4HLY A;  3WU0 A;  1KA8 A;  3DF8 A;  4M9S A;  4GGG A;  5D8K B;  3I4P A;  3Q5F A;  4ZH4 F;  2GA2 A;  2VT2 A;  5ILV A;  4JBA A;  2MH9 A;  1ZLJ A;  3Q9S A;  2FBH A;  1XGM A;  2V6C A;  4KA4 A;  3QPH A;  3HSE A;  2UWM A;  2Q0O A;  4BAY A;  2HOE A;  2L54 A;  2D45 A;  2G9W A;  2B0L A;  4AWX B;  4ZYD A;  2D1V A;  2FML A;  1O7L A;  4EGZ A;  4OIO F;  1EV7 A;  3GW2 A;  2ZFW A;  2K4J A;  5ILS A;  1KU2 A;  1B4A A;  5D4S A;  2FNA A;  5KVR A;  5FB2 A;  3BDD A;  3SZP A;  3BRO A;  4A0Y A;  4U0V A;  1IXC A;  2BGC A;  2IPQ X;  4R8H A;  5HLI A;  2IT0 A;  1HKS A;  4CDG A;  1F5T A;  2GAU A;  2FF4 A;  1XMK A;  1B9M A;  4M6Y A;  4XRF A;  1XGN A;  5D5X B;  1BN5 A;  1SFE A;  4RAZ A;  3R60 A;  4L5I A;  1OYW A;  2MBF A;  2QLZ A;  2J5P A;  2FE3 A;  4XSZ F;  2FSW A;  5F1R A;  2M87 A;  4M74 A;  3RKX A;  2IRF G;  2V1D A;  4JK1 X;  5E8I A;  1GXP A;  2DFI A;  1JHF A;  1RIO H;  4XLP F;  4EQQ A;  2PJP A;  4MEY F;  4IHT A;  2FXA A;  1PDN C;  2HTS A;  4OIR F;  3VOD A;  4UVA A;  5LGU A;  2H6C A;  5HS9 A;  4JQF A;  1FSH A;  3E5Q A;  3LAJ A;  1FOK A;  1TQP A;  3P9C A;  3GFJ A;  3D5L A;  3DEU A;  4G7H F;  2UXN A;  1RZ4 A;  4KIG A;  3JTH A;  3I58 A;  1MKM A;  1MDM A;  3RYR A;  2M5W A;  3K69 A;  4IF4 A;  5CVJ A;  5IT9 Z;  4P9U A;  3U1D A;  3GO5 A;  2JPB A;  3JSP A;  1LQ1 A;  4LK1 F;  2DT5 A;  2P7V B;  3CJN A;  2FRH A;  4YG2 F;  3DP7 A;  4XBF A;  4N9H A;  2ZO4 A;  5CJ9 A;  2FEZ A;  4A2U A;  1ZAR A;  4ZYH A;  3WTV C;  4LG0 A;  1HXD A;  2P5K A;  2XGX A;  4ZZL A;  1SD5 A;  6PAX A;  1BIB A;  1DPU A;  4A6D A;  5E20 A;  5F64 A;  3BY6 A;  4LLL A;  1H9G A;  1BI2 A;  1YW8 A;  1IN8 A;  2DAO A;  1TW2 A;  3WGG A;  4MTE A;  3ECO A;  1WWX A;  1J5Y A;  3TOB A;  3HRU A;  1ZLK A;  3PQK A;  4FX0 A;  3WGH A;  1ZG1 A;  2OQR A;  1U8R A;  2WWY A;  3G3Z A;  1C0W A;  2OZ6 A;  2IP2 A;  5A2Q Z;  2RDP A;  4EVI A;  1J59 A;  4MQV A;  5BMZ A;  1D3Y A;  3TDZ C;  2L4A A;  3J80 Z;  1G3T A;  2XAG A;  2PLY A;  3ZMV A;  3C3W A;  3JTG A;  3TKY A;  5E1Z B;  3DPT A;  3HIF A;  3DXJ F;  3IL2 A;  1K78 A;  1DPR A;  3MZY A;  1IN4 A;  4BHB A;  4UXN A;  2ESN A;  5JVT A;  2WTE A;  4AIK A;  1UB9 A;  4MQ9 F;  2V9V A;  1JXS A;  1TNT A;  4RGU A;  1TTY A;  3PQJ A;  3GLX A;  3QP6 A;  2BBY A;  2A68 F;  3DV8 A;  4UV9 A;  3EYI A;  2VOO A;  2VT3 A;  2CG4 A;  2EV0 A;  4ESF A;  4RS8 A;  1XDU A;  4MHG A;  4RB0 A;  3AAF A;  4WF2 A;  1B6A A;  1YS7 A;  1W7P B;  4RB1 A;  4ASN A;  2DI3 A;  5DUI A;  3NQO A;  2HQN A;  1P92 A;  3F6V A;  3SQN A;  4P55 A;  2Z5U A;  4AIH A;  3R0A A;  1HKQ A;  1S6L A;  1U3E M;  2UZK A;  5DUK A;  3HHH A;  2HFH A;  2LKP A;  2YPR A;  3C1D A;  4BNC A;  3KCC A;  2OBP A;  4HF2 A;  3V7R A;  3RKW A;  2A61 A;  1NHA A;  3C7J A;  3GWZ A;  2M45 A;  2BYV E;  1FPQ A;  2DK8 A;  4WXD A;  4PDK A;  2QQB A;  1T0F A;  4RB3 C;  4EJW A;  1MZB A;  4IHS A;  2KIU A;  1GXQ A;  2XRN A;  4L0Z B;  3WTS C;  2PG4 A;  1ZG5 A;  3FXU A;  1HW1 A;  3KP5 A;  2BV6 A;  2MH2 A;  1XSV A;  2FBI A;  3HUG A;  3O6B B;  4KDP A;  4D0P A;  1AWC A;  2VXZ A;  2X4H A;  3TO6 A;  5L3D A;  2YU3 A;  4KIF A;  4PZJ A;  1YW7 A;  1QGP A;  3FMQ A;  4IPA A;  3FHZ A;  1FYK A;  3ABT A;  3RTR A;  2EFO A;  3IWZ A;  2Y48 A;  4ETS A;  3JAM K;  2KJB A;  2O03 A;  4YFK F;  2DPD A;  3M7G A;  2XHK A;  1UCR A;  2IJL A;  2ESH A;  2QM3 A;  3RPQ A;  4EM0 B;  2YX7 A;  4RGS A;  2ZBK A;  2QBY A;  2Z99 A;  5E8G A;  4A0Z A;  4ZZD A;  5DYM A;  3T0Y A;  1O3Q A;  3EQL F;  3DFG A;  2G7H A;  3V7C A;  1P2F A;  2PMU A;  3DPL C;  3I59 B;  4IVN A;  2HEO A;  5FFX A;  5ERI A;  2QYO A;  3KEO A;  4U7D A;  1T38 A;  4HZF A;  3IC7 A;  2OAZ A;  5ICG A;  2L3D A;  3ZMD A;  4BH9 A;  3P9I A;  2AS5 F;  2M1B A;  1FBQ A;  1YO5 C;  3BJ6 A;  3T1B A;  5LGT A;  1LVA A;  2NNY A;  3RYP A;  2CFX A;  4IXA A;  4PGG A;  1MJ9 A;  3WGI A;  3HRM A;  1ZN2 A;  3H92 A;  4Y17 A;  3ML6 A;  3F8M A;  5LEJ A;  4Q48 A;  1D5V A;  5E1W A;  4ENN A;  1QBJ A;  4HBL A;  1LDK B;  4YFN F;  5E17 F;  1CF7 B;  1KU9 A;  4HX8 A;  1BIA A;  2ZJ2 A;  3LWF A;  2NRA C;  3E97 A;  3GZ5 A;  5FD5 A;  2IA0 A;  4LB6 B;  4ZYE A;  1BOA A;  1WKM A;  5JI6 A;  2DU9 A;  2KRF A;  2OZU A;  1Z9C A;  1K7A A;  1B9N A;  2HZT A;  5D6F A;  1KQ0 A;  1ZYR F;  5TJJ A;  2K4B A;  5AON A;  5HDG A;  2ZME A;  3SZT A;  1ZGJ A;  3ZN1 A;  3FXQ A;  3HSF A;  4EJU A;  4L9T A;  3BPV A;  1G3Y A;  2XAJ A;  3BJA A;  3ISP A;  3RI4 A;  3KET A;  3FM3 A;  3LQQ A;  1BC7 C;  4LK0 F;  3JW4 A;  2P8T A;  1QO0 D;  4P5O A;  4I0A A;  3GFM A;  1W5S A;  3KP7 A;  1H0M A;  1MGT A;  3KP6 A;  3QP5 A;  5D5W B;  4H0E A;  3WTZ A;  1O7F A;  3IRR A;  1FYM A;  1L3L A;  4G7Z F;  1FWZ A;  2YX4 A;  2ACJ A;  1F4K A;  4FX4 A;  5IT3 A;  4YFX F;  1R1V A;  3B02 A;  3L2C A;  2NAZ A;  1GHC A;  1BI1 A;  1SD6 A;  5ILU A;  4M71 A;  1IUY A;  5J8F A;  4WX9 A;  2VON A;  5CVV A;  1HSJ A;  3MEX A;  1YYV A;  4S05 A;  4GO1 A;  4EJV A;  3E5U A;  3WOD F;  2MD5 A;  2VBY A;  3U9G A;  2DQR A;  3MZH A;  4UVB A;  3DKW A;  5HOO A;  1FNN A;  2EV5 A;  3Q9V A;  4Z2Y A;  5D4R A;  3ULQ B;  1U6G A;  3I0T A;  2A5Y B;  2W57 A;  1S29 A;  3IWF A;  4QWQ A;  2QVO A;  5ICE A;  2BEO A;  5L3E A;  5CYV A;  4KMF A; 
#chains in the Genus database with same CATH topology
 2R7W A;  3K70 D;  4E7H A;  2BW3 A;  2W48 A;  1BJA A;  5ICF A;  3VYT B;  2D2W A;  2M0C A;  3F6O A;  2VOP A;  3HGG A;  4CIC A;  1EJ9 A;  4JYK A;  1YTY A;  4F7Z A;  3K4C A;  1IJW C;  4MTD A;  4BUP A;  4P1W A;  4M9X A;  4A12 A;  3GUD A;  5DCF A;  3F8N A;  2ISY A;  1UFM A;  3MZ8 A;  2X51 A;  1V3F A;  4A69 C;  3OYM A;  1VQL I;  3SDG A;  5CVI A;  3L2U A;  3F8C A;  1GVJ A;  2Y75 A;  4WK8 F;  3S3O A;  4BBS J;  4L5J A;  4OWR B;  1R00 A;  3GYH X;  2ZB9 A;  1P4X A;  1KGS A;  3FM5 A;  4YIF A;  3L09 A;  4LD5 A;  3E7L A;  1O3S A;  2LR8 A;  1R36 A;  2VC0 A;  4HF0 A;  3JRA A;  4HQE A;  1BI0 A;  3K4J A;  3W6J B;  3FKI J;  3VEP A;  3WG9 A;  4E70 A;  3F21 A;  1ITY A;  3E6D A;  3A4C A;  1G3S A;  4LMY A;  3S2D J;  2XPU A;  5DTD A;  4BDY A;  3E0J B;  1XD7 A;  4LIT A;  2R5Y A;  4U87 A;  2NVQ J;  4OIN F;  4OU0 A;  4CO8 A;  3M8F A;  1Z0X A;  1XGS A;  2I5U A;  2LFB A;  4UUS B;  2CYY A;  1D8J A;  1IN7 A;  2NVY J;  2X6X A;  5TIS C;  2YSR A;  3K4M A;  4I02 A;  3ABL H;  2M7A A;  3HDD A;  4KUM A;  2P5L C;  2L7M P;  2ZKZ A;  2J5O A;  2LBF A;  1TW3 A;  3AG3 H;  1ZTR A;  4MFD A;  4Y52 J;  2F6C A;  1VQ6 I;  5HS8 A;  5J1U A;  1HDD C;  1XGO A;  2CUZ A;  1MDM B;  1KZH A;  3OS0 A;  3OYK A;  1OYY A;  2A6T A;  4B47 A;  5H6R A;  4CYC A;  1QPM A;  5BPI A;  2K3P A;  2M3A A;  4BU2 A;  1IW7 F;  3MMY B;  1V54 H;  2RV8 A;  2E7X A;  1R5H A;  1SMT A;  4EM2 A;  1UHS A;  3ZMT A;  4EJT A;  2DCE A;  2EQR A;  4N4N B;  3L7W A;  1REP C;  4FQG A;  3IHU A;  1H89 C;  3I71 A;  4EM1 A;  4IRG A;  4UV8 A;  2OCE A;  3C18 A;  4GFB A;  4BAC A;  1ULY A;  1R22 A;  3I54 A;  3HB9 A;  5DD8 A;  4HST A;  1F43 A;  2K85 A;  4FE7 A;  2BY3 A;  3FWE A;  4LG0 B;  1Y0U A;  2OF7 A;  3ELK A;  4L0Y B;  1GDT A;  3Q0U A;  5LRS A;  2JSC A;  3W3C A;  4XLE A;  5E3O A;  2FMY A;  2F2E A;  4BQA A;  4XON A;  4FHT A;  2K3F A;  4E7K A;  3J81 K;  1XCV A;  3GF2 A;  2OU2 A;  1AOY A;  4KJZ A;  2PBI A;  3D5R C;  2QQ9 A;  1Z91 A;  1Z67 A;  1QVT A;  4AVP A;  1J75 A;  4ON0 A;  2DMP A;  2ZC2 A;  3I3L A;  5HLH A;  4G6Q A;  3ZN0 A;  4F92 B;  1T2K A;  4OAY A;  2WAD A;  2RQP A;  1ENH A;  3LOC A;  2BE5 F;  1HKT A;  2HS5 A;  3CDH A;  2F48 A;  3L00 A;  1YRN A;  3LST A;  1A5J A;  4H4K C;  1O4X A;  1BM9 A;  3DKY A;  2DTR A;  2RNG A;  4M6X A;  2L9V A;  1IC8 A;  1A6I A;  3CO7 C;  2GOM A;  2PMZ A;  2O6G E;  2XRL A;  1JT6 A;  3VYS B;  4JX5 A;  4CCO A;  3PSI A;  5L3F A;  1ZAO A;  2KZV A;  1A36 A;  4G8X A;  2EZL A;  3OR1 C;  3MKY B;  2GXA A;  2PJR B;  1Z6R A;  1XCB A;  1VQ5 I;  1ACI A;  4HLX A;  2WY8 Q;  3WTY C;  3F8B A;  1T6S A;  4BL0 B;  3H5A A;  2XAF A;  2QCO A;  3ABU A;  3RCO A;  4B09 A;  1JKR C;  2EV6 A;  2KHM A;  3OIQ A;  3KYD B;  1WJF A;  1ODD A;  2XV4 S;  2HOS A;  1JHH A;  1LNW A;  3QOP A;  4KNY A;  2HTJ A;  4A5M A;  2RVC A;  1EA3 A;  1LB2 A;  2FOW A;  3QRF F;  1RI7 A;  1K78 B;  1CQT A;  2M30 A;  3HOW J;  4ZYG A;  4B8X A;  5CPR B;  5ICC A;  2HOA A;  5BS6 A;  5DEQ A;  1IRZ A;  2IA1 A;  3R0J A;  3ZQ7 A;  5LEK A;  1SFK A;  1KYW A;  1FYL A;  2TDX A;  2P0W A;  2QWW A;  2DFE A;  2LRE A;  1ZRC A;  1MMD A;  2WC2 A;  3QOE A;  3IRQ A;  2H09 A;  4D5F A;  3QAH A;  2XGC A;  4L9V A;  4KFC A;  2VC1 A;  2XKP A;  4DZJ A;  1P4A A;  3VYU B;  3FMS A;  1YHQ I;  1A6Q A;  2R7V A;  3W6K B;  1W5T A;  1E3O C;  9ANT A;  5FGM A;  2GIZ A;  4BGD A;  2XF5 A;  2XVC A;  3RJP A;  1W7P D;  3FK6 A;  1I5Z A;  1DGR M;  4PFO A;  4ENJ A;  3M9A A;  1OQY A;  2H27 A;  3KPH A;  2G0E A;  4PJN A;  1SC7 A;  4J01 A;  2ZME C;  2Y0M A;  4AVZ A;  4YRV A;  4FET A;  1B8I B;  2LVS A;  4RLF A;  2ETH A;  1ZRF A;  3G71 I;  3CLO A;  4XKV A;  2E71 A;  2DLL A;  1G4D A;  2RN7 A;  3I5U A;  1PP8 F;  2XAS A;  4MLO A;  4JOM A;  3BR1 A;  1F36 A;  3H9G A;  5FKM A;  3L2Q A;  5L3G A;  2AO9 A;  3S2H J;  2O0Y A;  1FMV A;  5E1X A;  3K4L A;  4N4O B;  5J6X A;  3I9V 2;  3DCF A;  2RAE A;  4LJZ F;  2Y0S A;  3K9T A;  1DDN A;  3HHG A;  2KL4 A;  1YG2 A;  3PSF A;  3S32 A;  4BDZ A;  4IRI A;  4KIC A;  3N4M A;  1K83 J;  5E3N A;  2R7R A;  1OMI A;  3DU6 A;  3SDB A;  3A1Y A;  4HX4 A;  3D5S C;  4NB5 A;  3OYE A;  1FP2 A;  4XLC A;  3J7Z I;  3ZQH A;  3CP2 A;  3HOY J;  1SFO J;  1O3T A;  1E3H A;  3H9Q A;  2E1M B;  1FTZ A;  1WJ5 A;  1YQA A;  3BTC A;  2B7E A;  2V4J C;  1DUX C;  3OIO A;  3SJM A;  5EZG A;  2EIK H;  1HW5 A;  4ENK A;  3TO9 A;  2DYS H;  3BR6 A;  2DK5 A;  2X48 A;  5J4V A;  4Q5S F;  4E7S A;  4XOP A;  5AIQ A;  3IAS 2;  1U9O A;  2MAB A;  1D8K A;  1IXS B;  3S93 A;  2L5Q A;  2HKO A;  4I2O A;  1U5T A;  1XTA A;  4E6K G;  4WXC A;  1IN5 A;  4CZZ A;  2HPI A;  2H6B A;  1K6O A;  1J9I A;  4XR6 A;  1IF1 A;  2VI6 A;  4OIP F;  3OMY A;  1IUF A;  4S04 A;  4XRM A;  1S72 I;  1IRX A;  1X3Z B;  2CV0 A;  3P7N A;  1G6N A;  5DM7 F;  3RKY A;  1UG0 A;  5FFZ A;  5L3C A;  2R93 J;  1GT0 C;  2JWT A;  3ESW B;  3HUG B;  2D1H A;  3BZ6 A;  4UVC A;  4G9Y A;  1XB4 A;  5J1R A;  1LDJ A;  3BOQ A;  4P96 A;  5KCM A;  5JHF A;  4KT6 A;  1HF0 A;  4DQ2 A;  1ON1 A;  3EUK L;  1N78 A;  3HOT A;  2KP6 A;  4U88 A;  1X1A A;  2YU9 J;  2A6H F;  2K40 A;  5H2F C;  2L7Z A;  2C6Y A;  4K2E A;  2E2J J;  3QOD A;  2K7L A;  1R7J A;  1N25 A;  1U78 A;  1YI2 I;  2Y9Y A;  1S9H A;  3PJR A;  2VL8 A;  4IL6 C;  4BJT A;  5JLW A;  2E5Z A;  2R5Z B;  2HVR A;  4A93 J;  1ZRD A;  2ZJQ F;  1R23 A;  4CZC A;  3BPX A;  5LLQ A;  4ENM A;  1Z7U A;  3LSP A;  4ABZ A;  1TBX A;  1JJ8 C;  3M8E A;  4AU7 A;  2MYS A;  3FZV A;  3FXR A;  3CMA I;  2QBY B;  3AG4 H;  2IVM A;  5LGN A;  5TRD A;  4ZDL A;  2CV1 A;  3B6C A;  4GXO A;  1ON2 A;  3S1N J;  2DOE A;  3QPS A;  1FBU A;  2F4M B;  4RBO A;  1W5C C;  2L4M A;  5J3L A;  1MJB A;  3CES A;  3HPH A;  5CVU A;  2L9S A;  1OCR H;  3H3U A;  4CCN A;  5K1Y A;  2Y9Z A;  1RUN A;  4M3D A;  1D0Z A;  2STT A;  2NXN B;  3KZI C;  5E18 F;  1TNS A;  3RQI A;  2L02 A;  2FNP A;  1JKO C;  5JHU A;  2E35 A;  3MKW B;  2MGQ A;  4RAY A;  1FP1 D;  4HEA 2;  2Y30 A;  2LK2 A;  3OSG A;  2KQR A;  2LMD A;  2ZJR F;  3DTK A;  1NTC A;  4WWC A;  3AL0 B;  2MLG A;  3KLO A;  4GYI A;  1HQC A;  5D5U B;  1Y6I A;  1YLF A;  3FXL A;  1TT5 B;  1WI9 A;  3F22 A;  2AHQ A;  2L9N A;  2NOJ B;  1E17 A;  4YEL A;  5IT9 K;  4CHU A;  1HA8 A;  3CCY A;  3WTX C;  2PFB A;  2LYC A;  3V8K A;  4ZTF A;  3GX4 X;  3EET A;  3UKG A;  2X1D A;  2DMU A;  1AKH B;  2CQ7 A;  2CWE A;  3D0S A;  1YIO A;  1FSE A;  4LLN A;  4Q4Z F;  1EF4 A;  2CV2 A;  1A04 A;  3CUQ A;  2X0L A;  3ZQI A;  2HNH A;  3RZD J;  3I4N J;  3E3V A;  1MBE A;  2E36 A;  1Q1H A;  3BG7 A;  4PSW A;  2CUE A;  4RGR A;  3E1S A;  1XSD A;  1DP7 P;  3GTL J;  2JZY A;  2YS9 A;  1BL0 A;  1LEB A;  2R7F A;  1I50 J;  1R1T A;  3CUQ B;  4QSH A;  3V42 A;  1EH8 A;  3N97 A;  2DO7 A;  2CFO A;  5IYD J;  3TDU C;  5L3B A;  1HCR A;  2EWN A;  2NS7 A;  3HTU A;  2KIS A;  4HW0 A;  3H3Z A;  3IKV A;  4EGY A;  2QEN A;  2IGM A;  2VN2 A;  1ETW A;  2PEX A;  1J7K A;  1R4M B;  2M9H A;  2PN6 A;  5D5V B;  5DD4 A;  3WE3 A;  4YII A;  2IAI A;  1WPK A;  2VOD A;  2XRO A;  2QKL B;  4XMY A;  1OPC A;  1FBS A;  2KJC A;  3K1N A;  1X19 A;  1MBK A;  3VB2 A;  4HYE A;  3CO6 C;  1RPW A;  5K7Z A;  3QU3 A;  3HSR A;  1FZP B;  5J4Y A;  5A2Q K;  2VJ5 A;  2ZCW A;  3NAR A;  4RA2 A;  3RDI A;  2K9M A;  4A3C J;  4UUV A;  3TED A;  2EPF A;  4XSX F;  4Z6Y A;  4NBQ A;  4ZDO A;  1I27 A;  1SD4 A;  2XSJ C;  3CUO A;  3S1R J;  2W4S A;  1CGP A;  5K5R A;  3CCS I;  3K2Z A;  3HYI A;  3REO A;  3QYE A;  2N8G A;  2XAQ A;  3ZQC A;  1NG7 A;  1I39 A;  2BZT A;  4UUT A;  5HLG A;  3TO7 A;  1MMG A;  2HR3 A;  3WU1 B;  2XGE A;  2WAQ N;  1I3A A;  3ROU A;  1OKR A;  1ZG3 A;  5FLM J;  2ZME B;  3WE2 A;  2IS6 A;  2JRM A;  1JUM A;  2Y2Z A;  5EGO B;  4R1H A;  3S2W A;  3BWG A;  2WV1 A;  1T33 A;  1MMS A;  3NWT A;  5B1B H;  2GXB A;  2QKM B;  3PNY A;  1E2X A;  1L0O C;  4HV6 A;  2COM A;  3BTL A;  3KX2 A;  4OMZ A;  2DA5 A;  2A6E F;  2DMT A;  2PQ8 A;  3OYF A;  4EJO A;  3WTT C;  3H3V K;  3K0L A;  3L2W A;  2F5F A;  3K4K A;  2VIX A;  2K86 A;  1TQI A;  1EH7 A;  2F5E A;  2Z3Y A;  1MNM C;  4RMN A;  4I0B A;  4FAS D;  2HDW A;  1QA6 A;  5F08 A;  2VKV A;  2OV7 A;  4E4H A;  3EYY A;  2DMQ A;  2GM4 A;  1GVD A;  2DJN A;  1K6Y A;  4C3J J;  1K4S A;  5FKL A;  2STW A;  3PNV A;  2EA4 A;  3A0B C;  4C2U A;  2B63 J;  2M0M A;  2M4K A;  1JTX A;  3E5X A;  3KP3 A;  2WY7 Q;  3NRV A;  3GXO A;  3OOP A;  1XDS A;  4I6Z A;  4XN0 A;  4A3F J;  3CCJ I;  2KDO A;  3HG9 A;  4IKF A;  2E1N A;  2HDC A;  3QPT A;  1Y0N A;  4FIS A;  2EFW A;  2P7C B;  2R7U A;  3MFK A;  2P81 A;  3ZPL A;  4OOI A;  3JAM Z;  2EH3 A;  2ZXH A;  2K02 A;  4FT8 A;  2V1U A;  4L18 B;  4HNT A;  2KKO A;  2LKX A;  2GA1 A;  1UHW A;  2KIF A;  3OYB A;  3ZGK A;  1E3P A;  5GAD J;  4HDV A;  3BTJ A;  1Z7L A;  2MC4 A;  2HYG D;  5HDK A;  1QRY A;  4NQW A;  5EEG A;  1H9T A;  1QPI A;  4UHT A;  2ZXJ A;  2W00 A;  4KN4 X;  2W85 A;  2LP0 A;  3M1E A;  2E7W A;  4WCG A;  2IGO A;  1Q1V A;  3LFK A;  3KP2 A;  1GLN A;  3EUH A;  3A01 A;  5CLS A;  3KFW X;  4N0B A;  3T8T A;  2O61 A;  1XC5 A;  2EZH A;  3LMM A;  1XN7 A;  1HLV A;  2CQK A;  1I1S A;  3RIR A;  4QLC U;  2V7F A;  4HA8 A;  1PJR A;  3UR3 C;  4DZP A;  1IAW A;  2KIQ A;  3BCA A;  5F04 A;  4E7J A;  3GVA A;  2NNN A;  5LHI A;  2RNJ A;  2AXL A;  2E60 A;  2WAE A;  3SHF A;  1UST A;  1BI3 A;  4KT5 C;  4GYG A;  1U5T C;  5HNF A;  1LPQ A;  2VKE A;  4BXU A;  2VE9 A;  3J7A O;  2BW3 B;  1UEL B;  2FX0 A;  2EB7 A;  3QU6 A;  4LFU A;  2W1O A;  2MA3 A;  1R4N B;  4U0W A;  4CXF A;  2DMN A;  2DFH A;  2HI3 A;  2ICW G;  3ZMZ A;  2DW4 A;  5LHG A;  4RGX A;  2R3S A;  3MWM A;  1SD7 A;  3R4K A;  2HQR A;  4ZTJ A;  1G2H A;  1BR1 A;  2UUZ A;  3ZMS A;  4AUX A;  5FRM A;  5EG0 A;  4G12 A;  2GQQ A;  2BVL A;  1FX7 A;  3LAP A;  2ECB A;  4OIQ F;  2EIJ H;  1U0J A;  2MC3 A;  2QSG X;  4GDF A;  3VFZ A;  4HOB A;  4A5N A;  3GFL A;  1PP7 U;  4O6J A;  3V8L A;  3QWL A;  4AID A;  1IN6 A;  4RB2 C;  2XF7 A;  1X3U A;  4MGR A;  3KZZ A;  1NK3 P;  2RGV A;  4KIB A;  2GWR A;  2JRT A;  2LKS A;  1K61 A;  1JGG A;  1ZR4 A;  2R5Y B;  1USS A;  4RM3 A;  4E7L A;  4A3I J;  2JT1 A;  1JI8 A;  1VI0 A;  1YW9 A;  4DBR A;  5K5O A;  1YFH A;  1MND A;  2Z2S B;  3TOA A;  1VTN C;  1B59 A;  4IQ4 A;  2O8X A;  1WQ2 A;  3V7S A;  2HXI A;  3O8H A;  3KEQ A;  1X3W B;  5F6F A;  5KK1 A;  1HC8 A;  3OR2 C;  3EUA A;  5JFR A;  2R7T A;  3OS1 A;  4A3E J;  4AC0 A;  5BPD A;  1HST A;  1S7E A;  3CJR B;  3K2A A;  1TWG J;  1IDZ A;  2FBK A;  4CYD A;  1OYI A;  2LBF B;  1OFC X;  3SFZ A;  3A03 A;  5DDG A;  1UHM A;  3DLA A;  4XL9 A;  1SVO A;  1FLI A;  2E2I J;  3Q3S A;  3B73 A;  4UNO A;  3LSG A;  3H36 A;  3ZQF A;  1FY7 A;  2WV0 A;  3AL0 C;  1EH6 A;  2DDA A;  4WXH A;  4CYC B;  4EMS A;  3VOE A;  3KE2 A;  2K9Q A;  3SFI A;  4CCM A;  2DOF A;  3ECH A;  2RKH A;  1P4W A;  3DBR B;  2VAS A;  1V4R A;  4D9J A;  4DW6 A;  2DA1 A;  3RPU A;  3PUB A;  3ASO H;  3FXK A;  3TL4 X;  3LA3 A;  1BR2 A;  3BQY A;  2ADU A;  4MIM A;  3E6M A;  1W4M A;  4UB6 C;  3MCZ A;  1JGS A;  3PUF A;  5FKN A;  5GPC A;  2CS3 A;  1X1P A;  2LOO A;  1R5G A;  2W25 A;  1QU3 A;  2V1N A;  4P9F A;  1ETO A;  1TP4 A;  1IXR C;  1ZHF A;  2HGC A;  1VFC A;  3G4S I;  3E6C C;  1XSX A;  3OYC A;  3WHC A;  2NYX A;  2ID6 A;  1YIT I;  4OAZ A;  2P5V A;  4C2T A;  1BC8 C;  3FXM A;  2OQG A;  3A2K A;  3PFI A;  4Q47 A;  1SMY F;  2CW7 A;  4S0H B;  1O3R A;  2KT0 A;  4DJA A;  3F3X A;  5LBQ A;  2LY2 A;  3FF5 A;  2LF8 A;  5LRR A;  3NEU A;  3K1M A;  5FLX K;  2F4I A;  1G3W A;  2P6S A;  1DU0 A;  3T8R A;  3U2R A;  2CH0 A;  4HPQ A;  1YRN B;  3CUQ C;  3QQA A;  1BW5 A;  2WBM A;  5HS7 A;  4X0G A;  2E5N A;  2BY2 A;  2XAU A;  5FRN A;  4IZZ A;  2JA8 J;  2HKX A;  4M9Z A;  1Y1V J;  1Z77 A;  4JX6 A;  2IA2 A;  3MQ0 A;  4A3B J;  2Z33 A;  1SFX A;  1F9N A;  2WB1 A;  1MBH A;  2A05 A;  3DKX A;  4LGW A;  4NHJ A;  4PJ0 C;  1G59 A;  2LC2 A;  2R7D A;  1NG6 A;  2M34 A;  3COA C;  2A3S A;  3V4G A;  4A3D J;  3CCM I;  1WI3 A;  2XUB A;  1Z3Y A;  3HRS A;  4B3A A;  5FD6 A;  3LA2 A;  3RKQ A;  2G7U A;  3I64 A;  4KN7 X;  3QPL A;  3PNT A;  4L9N A;  3BG9 A;  2GXG A;  4X1E A;  5EJC A;  3CP8 A;  4D7N A;  2JQ7 A;  1QZZ A;  2DPU A;  3CCR I;  3DWL E;  5HLT A;  1T08 B;  1U2W A;  3OYI A;  4LLG F;  5FRO A;  3HOS A;  1ONV A;  1MSF C;  5CVR A;  2E1O A;  2VBZ A;  2DYR H;  1W7P A;  3L1P A;  3F23 A;  3BR0 A;  1LEA A;  2ZNZ A;  3IH2 A;  2FUG 2;  1ZRE A;  1IRF A;  2EFQ A;  1IG7 A;  2K9N A;  3LSR A;  2LF7 A;  1YJ9 I;  4GCV A;  5ED4 A;  1G8X A;  2NS0 A;  3FMR A;  4XLN F;  1VQN I;  2JPC A;  3OYH A;  3IKT A;  1T98 A;  2HWV A;  2DFF A;  3MKZ A;  1OIS A;  4ESB A;  1QHH D;  1IGN A;  5EEH A;  3G73 A;  1OCP A;  1P7J A;  3GEZ A;  2MFZ A;  2EJR A;  1X1D A;  2BHY A;  4F91 B;  2DJI A;  1F1Z A;  3BG6 A;  3FKJ A;  2VQH A;  3CZ6 A;  1RC9 A;  3GZ6 A;  3PFY A;  5D6E A;  1TLH B;  4U0Y A;  4IOC F;  4PUS A;  1JE8 A;  3HEF A;  4BXX J;  4HQM A;  2CQX A;  1S8N A;  2FA5 A;  2LRD A;  2F5D A;  3HRT A;  2ISZ A;  1MSE C;  3HTS B;  2UXX A;  4A3G J;  1TWC J;  5LHH A;  2CGP A;  2V6E A;  4PSX A;  2L2O A;  2X9D A;  2Q2E A;  2COB A;  4IRH A;  4CSW A;  2E1C A;  1QZY A;  1HBX G;  2OD5 A;  2ECC A;  4FE4 A;  1LUJ B;  4XKW A;  1NK2 P;  2ZNY A;  3E6B A;  1X1C A;  4LIV A;  4F93 B;  5K5Q A;  2L01 A;  1ETX A;  4BEH A;  1O57 A;  3HPG A;  4EV0 A;  1YIJ I;  3KZY A;  3CJQ B;  2RQQ A;  2EZI A;  3CCQ I;  2QSH X;  3BP8 A;  1BBY A;  3ZMU A;  5HVQ C;  3R61 A;  4XOT A;  1X1B A;  3BLY A;  2MG4 A;  4I98 B;  5IOY A;  2L0K A;  3IH4 A;  2IW5 A;  3VSL A;  3BG3 A;  3I56 I;  2CW0 F;  2YR2 A;  4M72 A;  4BHP A;  5JR3 A;  4G94 A;  2BXY A;  4M73 A;  2EA2 A;  4HDU A;  3ZP5 A;  2H94 A;  1FT9 A;  2M8G X;  2LNB A;  5B3S H;  2DA2 A;  1MBJ A;  2Z9O A;  1MW7 A;  1XMA A;  1ZGA A;  1S7A A;  4O5V A;  3H35 A;  3DU5 A;  2JMW A;  3TMO A;  1RUO A;  1YJW I;  2E2H J;  2GZW A;  3GME A;  2QQA A;  2Q1Z B;  1S7O A;  3OL4 A;  3P9K A;  1Y56 A;  2TRT A;  3F72 A;  3LQR A;  1KU7 A;  5GPA A;  4MEX F;  2DOA A;  1MD0 A;  3H9J A;  4I09 A;  1VQ8 I;  2XC7 A;  4HAM A;  1KU3 A;  1PYV A;  3A02 A;  2DA7 A;  4XM3 A;  4HSR A;  5IP6 A;  5BNG A;  5C4J J;  2VBW A;  3HZJ A;  1WGX A;  4BYY A;  1T39 A;  4G7O F;  1D1A A;  1J0R A;  2WAQ A;  1Y1W J;  2KRC A;  2OPT A;  2GIV A;  3HC7 A;  1R58 A;  5AIP A;  1R5I D;  4NC8 A;  2EIL H;  1R1U A;  3WTU C;  1U5T B;  1FMW A;  2ELH A;  2A07 F;  1SAN A;  1WRJ A;  2H1L A;  3OYA A;  4A3K J;  4HRI A;  2ZFU A;  1HW2 A;  1FOY A;  3W2W A;  3MVP A;  2ZSI B;  4A6E A;  3O3K A;  1ETV A;  3IH3 A;  3T5X A;  3SXY A;  4I01 A;  2JTV A;  4IOA F;  1P6R A;  3NWS A;  2XAH A;  1KYZ A;  3V8J A;  1JUP A;  1I1G A;  2EFP A;  2EFN A;  3EUH C;  2HYF A;  2P6T A;  5BQT A;  1Z6T A;  5F0F A;  3CDL A;  1FC3 A;  2DBB A;  3LSJ A;  3DBL B;  1SVL A;  2QZ8 A;  3JRG A;  2FU4 A;  2VBX A;  3TW6 A;  3S1Q J;  4HX7 A;  3JSO A;  1VQM I;  3I59 A;  3HL2 A;  5B1A H;  1Z3X A;  2HXO A;  2YUS A;  4ESJ A;  2F5C A;  3CCE I;  3KIO A;  3EDP A;  1D0Y A;  1Z1D A;  5DV5 A;  3CCL I;  5GAG J;  1T8I A;  4C30 A;  3JRH A;  2HPM A;  2VKD A;  3AKZ A;  4XKC A;  4AIJ A;  1LFP A;  3BZC A;  2M2E A;  4CGZ A;  5D8L B;  4UB8 C;  1B1B A;  1PUF A;  5CKT A;  3BG5 A;  5H20 A;  5HOD A;  4YIR X;  2EK5 A;  5EYR A;  4C3I J;  2XF6 A;  1S3J A;  2K27 A;  4Y4R A;  4HG2 A;  2X6W A;  2XKO A;  4CCK A;  2LDU A;  2V79 A;  4PGH A;  2M4G A;  3ERE D;  4ITV A;  3J81 Z;  4ZC3 A;  4XIC A;  4PCQ A;  2R7Q A;  4HNU A;  2BHZ A;  2R0Q C;  1MNE A;  2LY9 A;  3O8G A;  3TQN A;  1PUE E;  4U7B A;  2RC4 A;  2PMH A;  4NUB A;  4XKB A;  4M6V A;  1VQ4 I;  1GV5 A;  3FBN B;  4DYC A;  3ONQ A;  4MFE A;  4MNU A;  4L9J A;  3GTP J;  2LSO A;  3KEY A;  3MAJ A;  3OOU A;  5GAH J;  3BR2 A;  4XRS A;  3WTW C;  4TV7 A;  4CCJ A;  1SAX A;  4IJA A;  4OMY A;  4LB5 A;  3CD6 I;  3G1O A;  4KMU X;  1QHG A;  1P7I A;  4LOC A;  1S5L C;  2W84 A;  3BJO A;  4R79 A;  1AA7 A;  2OTJ I;  3QYF A;  2PI0 A;  5FLX Z;  1LJ9 A;  5J8C A;  1D5Y A;  1RR7 A;  3K1P A;  2V1X A;  4Y7N J;  2KZG A;  4BY1 J;  1ERD A;  2XPW A;  2R7S A;  3GLL A;  3M07 A;  3VSK A;  1RES A;  3KP4 A;  1MIJ A;  2VJI A;  5CQG A;  2EBI A;  3GFI A;  3GBG A;  3OV8 A;  1A35 A;  2DOD A;  2DQL A;  1FIA A;  4AD9 A;  3GTQ J;  3VWB A;  3BT9 A;  2X6Y A;  3TGN A;  5EF6 A;  4V19 K;  1CF7 A;  2JVG A;  4PFP A;  4RM2 A;  2KIM A;  2OTL I;  5DCM A;  3VPR A;  1VQK I;  4BBR J;  3LA7 A;  3CF5 F;  1JT0 A;  1OCT C;  3W6V A;  3JRI A;  2XIG A;  3F8F A;  1MJA A;  3FIS A;  3DQV C;  1PVE A;  1KQ8 A;  3A0H C;  2VE8 A;  2GLO A;  3ZR8 X;  4I7H A;  2O8K A;  5HDN A;  5GP9 A;  1QVU A;  4F52 A;  2MLK A;  1STZ A;  1OR7 A;  2ME0 A;  3TW7 A;  2Y0S N;  1YJN I;  1QQI A;  3KLN A;  4ZYA A;  2P4W A;  1OCC H;  3HGY A;  5FO5 A;  1R9T J;  1RKT A;  5H6Q A;  3R6S A;  4G6D A;  5DCM B;  2A69 F;  1QNT A;  1K79 A;  5BOX A;  3I55 I;  4HF1 A;  1I6X A;  2H8R A;  4O3M A;  1D1B A;  4KYW A;  2W82 A;  3LL7 A;  1TQM A;  1KQ9 A;  1SFU A;  2FOK A;  2NVX J;  3I53 A;  1J2X A;  2CO5 A;  4XLH A;  4A0X A;  1RNL A;  2W24 A;  2OC6 A;  4BHC A;  3FX3 A;  2VLA A;  3CTA A;  3ERM A;  2CSO A;  1WSU A;  1IZ1 A;  3L9F A;  3O2P E;  3B6A A;  1IRG A;  4Y15 A;  4HV5 A;  1Z05 A;  1LKX A;  3K6G A;  2KDZ A;  1YE9 A;  2HOT A;  2XB5 A;  2M8E A;  3J80 K;  2VB6 A;  4DNC A;  4N9I A;  2Q8K A;  2O3F A;  3S17 J;  4XNF A;  1ZH5 A;  2OA4 A;  1YS6 A;  1LDD A;  1HDP A;  2QUF A;  3SZG A;  2FQ3 A;  3VYR B;  4Y13 A;  4HLY A;  3WU0 A;  1KA8 A;  2QEX I;  5J1Y A;  5B66 C;  1B72 A;  1R71 A;  4BQQ A;  3DF8 A;  4M9S A;  1ETQ A;  1OJL A;  1X4P A;  2XGD A;  3SYT A;  4GGG A;  3IAM 2;  1NH3 A;  4AM3 A;  2CU7 A;  3BR5 A;  5F27 A;  5D8K B;  3ZQQ A;  3I4P A;  3S8P A;  4XQF A;  3Q5F A;  4ZH4 F;  1KON A;  2GA2 A;  3IUO A;  2VT2 A;  5IY5 H;  5ILV A;  3QYB A;  4JBA A;  3BQZ A;  2VJ4 A;  5M3M J;  2MH9 A;  1ZLJ A;  1W1W E;  3Q9S A;  2FBH A;  2DDB A;  3G6E I;  1XGM A;  4BJ6 C;  1FJL A;  1TC3 C;  2V6C A;  4KA4 A;  3QPH A;  3HSE A;  1GV2 A;  2UWM A;  2Q0O A;  1SVM A;  4PK4 A;  4AYB N;  4BAY A;  2HOE A;  3CMY A;  2L54 A;  3NAU A;  3X2Q H;  2D45 A;  2G9W A;  4BKX A;  2DTZ A;  2B0L A;  4AWX B;  1I3Q J;  4ZYD A;  2DA6 A;  2VUM J;  1WZ2 A;  2D1V A;  2HZD A;  2FML A;  4MO7 A;  1O7L A;  1ZGW A;  3LSI A;  2I10 A;  5E3L A;  4EGZ A;  4FCY A;  4IHY A;  4OIO F;  1EV7 A;  3GW2 A;  4A3J J;  2ZFW A;  4ZJZ A;  4W1U A;  2K4J A;  3ZOB A;  5ILS A;  1JJ6 C;  1VQO I;  1KU2 A;  2X85 A;  3LSM A;  1MBF A;  1B4A A;  2WAF A;  5D4S A;  2FNA A;  5KVR A;  5FB2 A;  4F55 A;  3BDD A;  3K4N A;  3SZP A;  1Y8Q B;  2BOL A;  4BQN A;  3MN2 A;  4LG3 A;  4NC7 A;  3U1K A;  2D5V A;  3GTK J;  3W2V A;  3BRO A;  4DYR A;  4A0Y A;  2V26 A;  3CLQ A;  4U0V A;  5EDN A;  4XN3 A;  1IXC A;  2BGC A;  2IPQ X;  4R8H A;  2MD0 A;  5IPA A;  1FOW A;  5HLI A;  2IT0 A;  1HKS A;  2HVQ A;  4CDG A;  3PM1 A;  1F5T A;  4IQJ A;  2GAU A;  1K4T A;  2FF4 A;  2ELJ A;  1XMK A;  1B9M A;  4M6Y A;  3OYJ A;  4XRF A;  1XGN A;  1LVK A;  3FK7 A;  5D5X B;  4RAG A;  1BN5 A;  1SFE A;  3JCU C;  4RAZ A;  3R60 A;  4L5I A;  1BOB A;  1OCZ H;  2KRH A;  3C2H A;  2ZSH B;  1OYW A;  2MBF A;  2QLZ A;  2J5P A;  1I6H J;  2FE3 A;  4XSZ F;  2FSW A;  3HJE A;  2M87 A;  5F1R A;  2IS1 A;  4RLQ A;  4M74 A;  4D5C A;  3RKX A;  3BR3 A;  3GTO J;  4RDU A;  1OCO H;  2IRF G;  2R4G A;  2LY1 A;  2V1D A;  4JK1 X;  5E8I A;  1GXP A;  2DFI A;  1JHF A;  3JR9 A;  1RIO H;  4XLP F;  3IP4 B;  4NQW B;  4EQQ A;  2PJP A;  3HKZ N;  4MEY F;  1MH4 A;  3SEZ A;  4IHT A;  1UMQ A;  3J7Y J;  1YOV B;  2LH9 A;  4B44 A;  3A01 B;  3M8J A;  2FXA A;  2KMU A;  1W36 C;  2XSD C;  1PDN C;  1W0T A;  5IYC J;  2HTS A;  1R6R A;  4OIR F;  1SAU A;  3VOD A;  4UVA A;  5LGU A;  1V5G A;  1RET A;  2H6C A;  5HS9 A;  4UUS A;  2QA4 I;  1ZQ3 P;  1WFX A;  5E79 C;  4JQF A;  3OY9 A;  1FSH A;  2QQ8 A;  2DA3 A;  3J7A Y;  3E5Q A;  3JRC A;  1VZ0 A;  3LAJ A;  1ETK A;  1N77 A;  1FOK A;  1TQP A;  2K5C A;  2OCC H;  3P9C A;  3JRB A;  3GFJ A;  3D5L A;  1V5E A;  3DEU A;  1WJC A;  4CUG A;  4G7H F;  4QPO A;  2UXN A;  1RZ4 A;  4KIG A;  4NC6 A;  3JTH A;  3WG7 H;  1AU7 A;  3I58 A;  4IHV A;  2F5V A;  1Z21 A;  1MKM A;  1MDM A;  2JA7 J;  3GCM A;  3RYR A;  2M5W A;  5EG0 B;  3K69 A;  4IF4 A;  5CVJ A;  1DGW Y;  5IT9 Z;  2ELK A;  4DGW B;  1LFB A;  4P9U A;  3S16 J;  3U1D A;  5IP9 J;  3GO5 A;  1DP3 A;  2JPB A;  4V2F A;  3JSP A;  2Z16 A;  2BVM A;  1LQ1 A;  4LK1 F;  2DT5 A;  2P7V B;  3CJN A;  1X58 A;  2FRH A;  3HXL A;  4YG2 F;  5C3E J;  1TWA J;  1EKE A;  3DP7 A;  4XBF A;  3S3M A;  4XOR A;  4N9H A;  2ZO4 A;  2IBD A;  5CJ9 A;  3MKL A;  2FEZ A;  3C2G A;  4A2U A;  1ZAR A;  2DN0 A;  4ZYH A;  3WTV C;  4LG0 A;  1HXD A;  2ZJP F;  1N75 A;  3SEQ A;  5IOZ A;  2P5K A;  1U9N A;  1UZC A;  2XGX A;  4ZZL A;  3EPZ A;  3MD2 A;  4V2G A;  4ANJ A;  1SD5 A;  6PAX A;  1BIB A;  1DPU A;  4BY7 J;  4A6D A;  1WJE A;  5E20 A;  5F64 A;  3BY6 A;  3PL8 A;  1WH7 A;  1H9G A;  4LLL A;  1BI2 A;  4LIU A;  1YW8 A;  1IN8 A;  2DAO A;  1D0X A;  1TW2 A;  3WGG A;  4MTE A;  3ECO A;  4G6T B;  1WWX A;  2F4O B;  1J5Y A;  3TOB A;  3HRU A;  1POG A;  1ZLK A;  3PQK A;  4FX0 A;  2JN6 A;  3WGH A;  1ZG1 A;  2OQR A;  3PO3 J;  1HOM A;  2XB0 X;  3OYN A;  1U8R A;  2XDV A;  4BS9 A;  2WWY A;  5E3M A;  3W2A A;  3G3Z A;  1C0W A;  2OZ6 A;  3RPU D;  3ZXS A;  1TWF J;  3U21 A;  1VQ7 I;  2IP2 A;  1WJA A;  2PJR A;  5IP7 J;  2RDP A;  5A2Q Z;  4EVI A;  2W7N A;  3HOV J;  4I76 A;  4QTR A;  1J59 A;  4UY8 I;  1WJB A;  4MQV A;  2VXD A;  1D3Y A;  5BMZ A;  3FXJ A;  3TDZ C;  2L4A A;  3J80 Z;  1G3T A;  1MMN A;  2VQG A;  2VJJ A;  2XAG A;  4NNJ A;  3CCU I;  2PLY A;  3ZMV A;  3C3W A;  2V9K A;  3JTG A;  1FEX A;  3TKY A;  5E1Z B;  3DPT A;  3HIF A;  3DXJ F;  3IL2 A;  1K78 A;  5B5E C;  1DPR A;  3MZY A;  4PJJ A;  3JRD A;  1IN4 A;  4D1Q A;  4BHB A;  4UXN A;  2ESN A;  5JVT A;  1X4O A;  2WTE A;  4AIK A;  2HU9 A;  4D7M A;  3DEW A;  2CRG A;  4BE2 A;  3BC8 A;  1T95 A;  1UB9 A;  4MQ9 F;  2V9V A;  3D1N I;  3JRF A;  5IYB J;  1JXS A;  5JLX A;  1TNT A;  4PJM A;  4RGU A;  3BTI A;  4B4C A;  1TTY A;  3PQJ A;  3GLX A;  3HOU J;  3QP6 A;  2BBY A;  1OR7 C;  1IDY A;  3DEE A;  1DU6 A;  2X1E A;  2A68 F;  3CDI A;  3DV8 A;  1ZEL A;  4UV9 A;  3EYI A;  2VOO A;  2VT3 A;  2CG4 A;  1ZK8 A;  2EV0 A;  3KYC B;  1V55 H;  4XLA A;  3AG1 H;  1ZR2 A;  4ESF A;  2AXT C;  2BXZ A;  5M5Y J;  4RS8 A;  1XDU A;  4MHG A;  1JTY A;  2VPR A;  2R92 J;  3S3N A;  1B8I A;  4RB0 A;  2VQL A;  1OLT A;  3AAF A;  2OUM A;  3K7A J;  3CF2 A;  4BJ5 C;  2Y31 A;  3PO2 J;  4WF2 A;  1B6A A;  1YS7 A;  4Y33 A;  1W7P B;  4RB1 A;  1YX3 A;  4ASN A;  2DI3 A;  5DUI A;  1W0U A;  2L7K A;  3NQO A;  3GTM J;  2JA5 J;  2HQN A;  3H5R A;  1P92 A;  3RSN A;  2FD5 A;  4W97 A;  3L2R A;  3F6V A;  2KLO A;  2IGK A;  3SQN A;  1Y8R B;  4P55 A;  2NVU B;  5LD2 C;  2Z5U A;  1YX5 A;  3R0A A;  4AIH A;  3AFH A;  3HOX J;  1VND A;  3M4O J;  1V5F A;  2DA4 A;  1HKQ A;  1S6L A;  1BR4 A;  1U3E M;  2UZK A;  5EEA A;  1FTT A;  4M3E A;  2L7F P;  4B3X A;  3FXO A;  2HVS A;  5DUK A;  4IHW A;  2EZK A;  3S14 J;  3GTJ J;  3HHH A;  1TT0 A;  2HFH A;  2LKP A;  2YPR A;  3C1D A;  4BNC A;  3KCC A;  3OYG A;  2OBP A;  4HF2 A;  4A3L J;  4GRI A;  3V7R A;  3LFU A;  2IS4 A;  3RKW A;  2Q2E B;  2A61 A;  3C7J A;  1NHA A;  3GWZ A;  4E7I A;  2M45 A;  2BYV E;  5DS9 A;  4B48 A;  2VKH A;  1FPQ A;  2EIM H;  4BEH B;  1BW6 A;  2DK8 A;  4EAT A;  4WXD A;  4PDK A;  3FBI B;  2QQB A;  3TP0 A;  1TL8 A;  1T0F A;  3WHB A;  1JKP C;  2AQF A;  2BY1 A;  4RB3 C;  1DQU A;  4EJW A;  1MZB A;  2CMP A;  2DXI A;  2H8W A;  2H1K A;  4IHS A;  2HQA A;  4B43 A;  2KIU A;  1GXQ A;  2XRN A;  4M3F A;  4L0Z B;  5EZH A;  2ID3 A;  3WTS C;  5M5X J;  4KIS A;  2PG4 A;  4C2M J;  1ZG5 A;  3FXU A;  1HW1 A;  3KP5 A;  3CC4 I;  2BV6 A;  2MH2 A;  1XSV A;  2FBI A;  3HUG A;  3O6B B;  1Y39 A;  1AHD P;  4KDP A;  3L2V A;  4JX4 A;  2CW8 A;  4QIW N;  1JKQ C;  3GTG J;  3K10 A;  3ZQG A;  4D0P A;  2HYJ A;  1AWC A;  2VXZ A;  2X4H A;  3TO6 A;  3HBL A;  5L3D A;  2XPV A;  2YU3 A;  4X6A J;  4KIF A;  5CQE A;  4PZJ A;  3K70 C;  1YW7 A;  1QGP A;  3FMQ A;  4IPA A;  4XK4 A;  3FHZ A;  1FYK A;  1WVR A;  3ABT A;  1UAA A;  4J00 A;  1W36 D;  4II2 A;  3RTR A;  3Q0W A;  2EFO A;  3IWZ A;  2Y48 A;  4ETS A;  3GZN B;  2KJB A;  2O03 A;  4YFK F;  3JAM K;  2DPD A;  1RRJ A;  2JA6 J;  1XMX A;  3I4M J;  3M7G A;  2R5Z A;  1LFU P;  2XHK A;  3PIP F;  2FQ4 A;  1UCR A;  2IJL A;  2FJ1 A;  2ME6 A;  4AYB A;  3ABM H;  5KAI C;  2ESH A;  4YEJ A;  2Y69 H;  2QM3 A;  1ZKG A;  3RPQ A;  2YX7 A;  4EM0 B;  4RGS A;  2PMZ N;  1RR8 C;  2ZBK A;  2IEK A;  5DM6 F;  2QBY A;  2Z99 A;  3CJT B;  5E8G A;  4A0Z A;  4ZZD A;  5DYM A;  1U8B A;  2QSF X;  2O9L A;  1IO2 A;  3ABK H;  3T0Y A;  1BJZ A;  1O3Q A;  1GUU A;  3WU2 C;  5KHD A;  3EQL F;  4I99 C;  2CJJ A;  3DFG A;  3CMM A;  2G7H A;  1TWH J;  3V7C A;  1P2F A;  5FJ8 J;  1TZL A;  3DTI A;  3M1C A;  2PMU A;  3DTE A;  3HM5 A;  3PIO F;  3DPL C;  3I59 B;  4CA0 A;  4EEF G;  5J47 A;  4IVN A;  2HEO A;  2WB1 N;  2GBY A;  4DBQ A;  2RRE A;  3ASN H;  1QZE A;  2R7O A;  5FFX A;  5ERI A;  3UNG C;  3M3Y J;  5C4X J;  2QYO A;  1JUS A;  3H5N A;  2IS2 A;  3KEO A;  4U7D A;  1T38 A;  2AQE A;  4HZF A;  2KFD A;  2M7B A;  3IC7 A;  2OAZ A;  1PUF B;  1FOX A;  5ICG A;  1FIP A;  2LLK A;  3DLL F;  2R7X A;  2L3D A;  3ZMD A;  4BH9 A;  3OYL A;  3P9I A;  2AS5 F;  1AKH A;  2BY0 A;  2M1B A;  1FBQ A;  1YO5 C;  1X2M A;  3BJ6 A;  3FHN A;  3T1B A;  4BE0 A;  5J40 A;  5KNL A;  1LE8 A;  4QPQ A;  5LGT A;  1LVA A;  2QF7 A;  2NNY A;  4IO9 F;  4RAF A;  5FLV A;  3OWT A;  3RYP A;  3AG2 H;  2CFX A;  3H1C A;  1E0E A;  4IXA A;  5M3F J;  3P5J A;  4FTH A;  1XS9 A;  2VPL A;  4PGG A;  5GAE J;  1APL C;  4BQO A;  1MJ9 A;  2JVH A;  3HKZ A;  3WGI A;  3DPU A;  5HNH A;  3HRM A;  2K9S A;  4E7Z A;  4HNV A;  1ZN2 A;  2IXS A;  3H92 A;  4Y17 A;  1LE8 B;  2V9P A;  2LG4 A;  2ZXI A;  3H0D A;  3ML6 A;  3OYD A;  3TBI A;  3N05 A;  2CQQ A;  3F8M A;  3C2B A;  2NVT J;  5F0H A;  5LEJ A;  4Q48 A;  1D5V A;  2JA2 A;  2TCT A;  5E1W A;  4ENN A;  1QBJ A;  3RQ4 A;  1WH5 A;  2E34 A;  3FIW A;  1LDK B;  4HBL A;  4Y3O A;  5F0C A;  1RKW A;  4C9Y A;  3JRE A;  4YFN F;  1VQP I;  2OJE D;  2IGN A;  5E17 F;  1T56 A;  1CF7 B;  1KU9 A;  4B1R A;  4DIQ A;  4HX8 A;  4II3 A;  1WJD A;  1BIA A;  1ETY A;  2ZJ2 A;  3FDY A;  3LWF A;  2NRA C;  3E97 A;  2R7Z J;  1J09 A;  3CQZ J;  3GZ5 A;  5FD5 A;  2I8D A;  2IA0 A;  4LB6 B;  4XRS G;  4ZYE A;  1BOA A;  1WKM A;  4IX7 A;  2MSY A;  5JI6 A;  2DU9 A;  2KRF A;  2OZU A;  1Z9C A;  1D1C A;  1K7A A;  1BA5 A;  2GOX B;  3S15 J;  4DYQ A;  3ZQL A;  4IEJ A;  1B9N A;  3HOZ J;  2HZT A;  3VDX A;  4F3Q A;  5D6F A;  3OL3 A;  2JSP A;  3DBH B;  5C44 J;  3CC7 I;  2QGU A;  4XID A;  1KQ0 A;  1ORK A;  1ZYR F;  5TJJ A;  1SEU A;  2K4B A;  5AON A;  3LSK A;  5HDG A;  2ZME A;  3SZT A;  1ZGJ A;  3ZN1 A;  4NDL A;  2Z1D A;  3FXQ A;  3HSF A;  4EJU A;  4L9T A;  3IV5 A;  5EGO A;  3BPV A;  1G3Y A;  2XAJ A;  3BJA A;  3ISP A;  3RI4 A;  1A31 A;  2ZXW H;  3KET A;  3CME I;  3FM3 A;  3LQQ A;  5K7F A;  2UV1 A;  1BC7 C;  5TGT A;  4LK0 F;  4CCL A;  1R49 A;  3JW4 A;  2P8T A;  2CUJ A;  2JUG A;  1QO0 D;  3KYL A;  2B9S A;  2E19 A;  4P5O A;  3S1M J;  4I0A A;  3GFM A;  3CCV I;  1W5S A;  3F0C A;  3KP7 A;  1UJ8 A;  1XX5 A;  4M3G A;  1H0M A;  1MGT A;  3KP6 A;  2LTP A;  3QP5 A;  5D5W B;  5JVG F;  3ZCO A;  2K9L A;  4H0E A;  5FKK A;  4KIT B;  2A5W A;  3CC2 I;  1B72 B;  4BE1 A;  1XPX A;  2O5R A;  3G2B A;  3WTZ A;  3K4B A;  2NOG A;  3LNQ A;  2JUC A;  1IV8 A;  1O7F A;  3OIP A;  3IRR A;  4BXF A;  3OSF A;  1FYM A;  1L3L A;  4G7Z F;  1FWZ A;  2YX4 A;  2ACJ A;  5FKO A;  1F4K A;  4FX4 A;  2NS8 A;  5IT3 A;  2LD5 A;  5K7H A;  2KPM A;  2O7O A;  2X1C A;  4YFX F;  1P9Q C;  3ZRG A;  1R1V A;  3BZK A;  4C3H J;  4DOZ A;  1IV6 A;  4A3M J;  3G1L A;  3B02 A;  2L9R A;  1VF9 A;  3L2C A;  2NAZ A;  4JP0 A;  1GHC A;  1BI1 A;  1SD6 A;  3Q0V A;  5ILU A;  3F9K A;  4M71 A;  5LFA A;  2DT7 B;  5KAF C;  2CUF A;  3G1M A;  1IUY A;  5J8F A;  4WX9 A;  4IHX A;  2VON A;  1MMA A;  5CVV A;  2EIN H;  1H88 C;  1HSJ A;  3MEX A;  5GTI C;  1YYV A;  4S05 A;  4GO1 A;  2DT6 A;  2PX9 A;  5M5W J;  4EJV A;  3E5U A;  3WOD F;  4L5E A;  2MD5 A;  2VBY A;  4ZDP A;  3TP3 A;  3U9G A;  2WA0 A;  2DQR A;  1VQ9 I;  2VQC A;  1WHU A;  3MZH A;  4UVB A;  4XLF A;  1H8A C;  3DKW A;  1UG2 A;  5HOO A;  3BCB A;  1FNN A;  1MBG A;  1WCM J;  2EV5 A;  2JJ7 A;  3Q9V A;  2HDD A;  3LSH A;  2E1M C;  1XG1 A;  4Z2Y A;  5F1J A;  5D4R A;  3RZO J;  3ULQ B;  1U6G A;  3I0T A;  4CH7 A;  5GTH C;  2HQ5 A;  2A5Y B;  2W57 A;  1S29 A;  3IWF A;  1X2N A;  2CQN A;  4QWQ A;  4M3B A;  4J19 A;  1MH3 A;  1M1E B;  2QVO A;  5ICE A;  3OS2 A;  2X6O A;  2MW8 A;  3H0G J;  2JK3 A;  1T0F C;  4PJL A;  2BEO A;  5L3E A;  5CYV A;  4KMF A; 
#chains in the Genus database with same CATH homology
 1BJA A;  5ICF A;  2D2W A;  3F6O A;  2VOP A;  4CIC A;  1YTY A;  4F7Z A;  4MTD A;  4M9X A;  4A12 A;  3GUD A;  5DCF A;  3F8N A;  2ISY A;  1UFM A;  1V3F A;  5CVI A;  3F8C A;  1GVJ A;  2Y75 A;  4WK8 F;  4L5J A;  1R00 A;  3GYH X;  1P4X A;  1KGS A;  3FM5 A;  4YIF A;  3L09 A;  4LD5 A;  1O3S A;  1R36 A;  2VC0 A;  4HF0 A;  4HQE A;  1BI0 A;  3WG9 A;  3W6J B;  4E70 A;  3VEP A;  3F21 A;  3E6D A;  1G3S A;  4LMY A;  1XD7 A;  4OIN F;  4OU0 A;  4CO8 A;  3M8F A;  1XGS A;  2CYY A;  1D8J A;  1IN7 A;  2YSR A;  4I02 A;  4KUM A;  2P5L C;  2ZKZ A;  2J5O A;  1TW3 A;  5HS8 A;  1XGO A;  1MDM B;  1OYY A;  5H6R A;  1QPM A;  5BPI A;  1IW7 F;  2RV8 A;  2E7X A;  1R5H A;  1SMT A;  4EM2 A;  3ZMT A;  4EJT A;  3L7W A;  1REP C;  3IHU A;  3I71 A;  4EM1 A;  4IRG A;  4UV8 A;  3C18 A;  1ULY A;  1R22 A;  3I54 A;  5DD8 A;  3FWE A;  4LG0 B;  1Y0U A;  4L0Y B;  3ELK A;  5LRS A;  2JSC A;  2FMY A;  2F2E A;  4BQA A;  4FHT A;  3J81 K;  1XCV A;  3GF2 A;  2OU2 A;  1AOY A;  2PBI A;  2QQ9 A;  1Z91 A;  1J75 A;  4AVP A;  4ON0 A;  5HLH A;  4G6Q A;  3ZN0 A;  1T2K A;  2RQP A;  2BE5 F;  1HKT A;  2HS5 A;  3CDH A;  3L00 A;  3LST A;  1BM9 A;  2DTR A;  4M6X A;  3CO7 C;  2O6G E;  5L3F A;  1ZAO A;  4G8X A;  1Z6R A;  1XCB A;  4HLX A;  3WTY C;  3F8B A;  1T6S A;  2XAF A;  3ABU A;  4B09 A;  2EV6 A;  1ODD A;  2XV4 S;  1JHH A;  1LNW A;  3QOP A;  4KNY A;  2HTJ A;  4A5M A;  2RVC A;  1LB2 A;  3QRF F;  1RI7 A;  1K78 B;  2M30 A;  4ZYG A;  4B8X A;  5ICC A;  5BS6 A;  5DEQ A;  2IA1 A;  3R0J A;  3ZQ7 A;  5LEK A;  1KYW A;  1FYL A;  2TDX A;  2QWW A;  1ZRC A;  2WC2 A;  3IRQ A;  2H09 A;  3QAH A;  4L9V A;  4KFC A;  2VC1 A;  2XKP A;  1P4A A;  3FMS A;  3W6K B;  1W5T A;  5FGM A;  2XVC A;  3RJP A;  1W7P D;  4ENJ A;  1I5Z A;  3M9A A;  2H27 A;  2Y0M A;  2ETH A;  1ZRF A;  3CLO A;  2DLL A;  1G4D A;  2RN7 A;  3I5U A;  1PP8 F;  2XAS A;  5L3G A;  2O0Y A;  5E1X A;  5J6X A;  4LJZ F;  3K9T A;  1DDN A;  3HHG A;  1YG2 A;  4IRI A;  4KIC A;  3N4M A;  1OMI A;  4HX4 A;  4NB5 A;  1FP2 A;  1O3T A;  1YQA A;  1DUX C;  1HW5 A;  4ENK A;  3TO9 A;  4Q5S F;  2DK5 A;  5AIQ A;  1D8K A;  1IXS B;  2HKO A;  4I2O A;  1U5T A;  4WXC A;  1IN5 A;  4CZZ A;  2H6B A;  1K6O A;  1J9I A;  1IF1 A;  4OIP F;  4S04 A;  3P7N A;  1G6N A;  3RKY A;  5FFZ A;  5L3C A;  2D1H A;  3BZ6 A;  4UVC A;  4G9Y A;  1XB4 A;  1LDJ A;  3BOQ A;  4P96 A;  4DQ2 A;  1ON1 A;  3HOT A;  4U88 A;  2A6H F;  2C6Y A;  4K2E A;  2K7L A;  1R7J A;  1U78 A;  1ZRD A;  1R23 A;  5LLQ A;  3BPX A;  4ENM A;  1Z7U A;  1TBX A;  3M8E A;  3FZV A;  3FXR A;  2QBY B;  2IVM A;  5LGN A;  5TRD A;  4GXO A;  1ON2 A;  1FBU A;  2L4M A;  1MJB A;  5CVU A;  3H3U A;  5K1Y A;  1RUN A;  2STT A;  5E18 F;  1TNS A;  2L02 A;  2FNP A;  5JHU A;  4RAY A;  1FP1 D;  4WWC A;  2MLG A;  3KLO A;  4GYI A;  1HQC A;  5D5U B;  1YLF A;  1WI9 A;  3F22 A;  1E17 A;  5IT9 K;  4CHU A;  3WTX C;  2PFB A;  3V8K A;  3GX4 X;  3EET A;  2CWE A;  3D0S A;  1YIO A;  1FSE A;  4LLN A;  4Q4Z F;  1A04 A;  3CUQ A;  2X0L A;  3E3V A;  1Q1H A;  4RGR A;  1XSD A;  1DP7 P;  2JZY A;  1LEB A;  2R7F A;  1R1T A;  3CUQ B;  1EH8 A;  3N97 A;  2DO7 A;  3TDU C;  5L3B A;  2EWN A;  3HTU A;  4HW0 A;  3H3Z A;  3IKV A;  4EGY A;  2QEN A;  2VN2 A;  2PEX A;  1J7K A;  2PN6 A;  5D5V B;  5DD4 A;  3WE3 A;  4YII A;  2VOD A;  2XRO A;  1OPC A;  1FBS A;  2KJC A;  3K1N A;  3VB2 A;  4HYE A;  3CO6 C;  3QU3 A;  3HSR A;  1FZP B;  5A2Q K;  2ZCW A;  3RDI A;  4UUV A;  4XSX F;  1I27 A;  1SD4 A;  3CUO A;  1CGP A;  5K5R A;  3K2Z A;  3HYI A;  3REO A;  2XAQ A;  5HLG A;  3TO7 A;  2HR3 A;  3WU1 B;  3ROU A;  1OKR A;  1ZG3 A;  2ZME B;  3WE2 A;  4R1H A;  3S2W A;  3BWG A;  2GXB A;  1E2X A;  1L0O C;  4HV6 A;  2COM A;  4OMZ A;  2A6E F;  2PQ8 A;  4EJO A;  3WTT C;  3K0L A;  2F5F A;  2K86 A;  1TQI A;  1EH7 A;  2F5E A;  2Z3Y A;  4I0B A;  3EYY A;  2STW A;  2EA4 A;  3E5X A;  3KP3 A;  3NRV A;  3GXO A;  3OOP A;  1XDS A;  2E1N A;  2HDC A;  3QPT A;  2EFW A;  2P7C B;  3MFK A;  3ZPL A;  4OOI A;  3JAM Z;  2K02 A;  4FT8 A;  2V1U A;  4L18 B;  2KKO A;  2GA1 A;  1UHW A;  2KIF A;  4HDV A;  2HYG D;  5HDK A;  4NQW A;  5EEG A;  1H9T A;  4UHT A;  2ZXJ A;  4KN4 X;  2W85 A;  3M1E A;  2E7W A;  4WCG A;  3LFK A;  3KP2 A;  3EUH A;  5CLS A;  3KFW X;  4N0B A;  3T8T A;  2O61 A;  1XN7 A;  2CQK A;  1I1S A;  3RIR A;  4QLC U;  4HA8 A;  1IAW A;  3GVA A;  2NNN A;  5LHI A;  2RNJ A;  2AXL A;  3SHF A;  1UST A;  1BI3 A;  4KT5 C;  4GYG A;  1U5T C;  4BXU A;  2VE9 A;  3J7A O;  2EB7 A;  3QU6 A;  4LFU A;  2MA3 A;  4U0W A;  4CXF A;  3ZMZ A;  2DW4 A;  5LHG A;  4RGX A;  2R3S A;  3MWM A;  1SD7 A;  3R4K A;  2HQR A;  3ZMS A;  2GQQ A;  1FX7 A;  3LAP A;  4OIQ F;  2MC3 A;  3VFZ A;  4HOB A;  4A5N A;  3GFL A;  1PP7 U;  4O6J A;  3V8L A;  1IN6 A;  4RB2 C;  4MGR A;  1X3U A;  3KZZ A;  2RGV A;  4KIB A;  2GWR A;  2JRT A;  1USS A;  2JT1 A;  1YW9 A;  1YFH A;  5K5O A;  3TOA A;  1VTN C;  1B59 A;  2O8X A;  1WQ2 A;  3V7S A;  3KEQ A;  5KK1 A;  5F6F A;  5JFR A;  5BPD A;  1HST A;  2FBK A;  4CYD A;  1OYI A;  3SFZ A;  5DDG A;  1UHM A;  1FLI A;  3B73 A;  4UNO A;  1FY7 A;  2WV0 A;  1EH6 A;  4WXH A;  4EMS A;  3VOE A;  3KE2 A;  3ECH A;  2RKH A;  1P4W A;  1V4R A;  3RPU A;  3LA3 A;  2ADU A;  3E6M A;  1W4M A;  3MCZ A;  1JGS A;  1R5G A;  2W25 A;  4P9F A;  1IXR C;  1ZHF A;  2HGC A;  3E6C C;  1XSX A;  2NYX A;  2P5V A;  1BC8 C;  2OQG A;  3PFI A;  4Q47 A;  1SMY F;  1O3R A;  5LBQ A;  3F3X A;  3FF5 A;  2LF8 A;  5LRR A;  3NEU A;  3K1M A;  5FLX K;  1G3W A;  2P6S A;  3T8R A;  3U2R A;  3CUQ C;  5HS7 A;  2HKX A;  4M9Z A;  2IA2 A;  3MQ0 A;  2Z33 A;  1SFX A;  1F9N A;  4LGW A;  4NHJ A;  2R7D A;  3COA C;  2A3S A;  3V4G A;  2XUB A;  3HRS A;  5FD6 A;  3LA2 A;  2G7U A;  3I64 A;  4KN7 X;  4L9N A;  2GXG A;  1QZZ A;  2DPU A;  1U2W A;  4LLG F;  3HOS A;  1ONV A;  5CVR A;  2VBZ A;  1W7P A;  3F23 A;  1LEA A;  2ZNZ A;  1ZRE A;  1IRF A;  2EFQ A;  2LF7 A;  4GCV A;  5ED4 A;  2NS0 A;  3FMR A;  4XLN F;  2JPC A;  3IKT A;  1T98 A;  2HWV A;  4ESB A;  5EEH A;  3G73 A;  3GEZ A;  2EJR A;  1F1Z A;  3GZ6 A;  5D6E A;  1TLH B;  4U0Y A;  1JE8 A;  4HQM A;  1S8N A;  2FA5 A;  2F5D A;  3HRT A;  2ISZ A;  3HTS B;  2UXX A;  5LHH A;  2CGP A;  2Q2E A;  4IRH A;  2E1C A;  1QZY A;  1HBX G;  2OD5 A;  2ZNY A;  3E6B A;  5K5Q A;  2L01 A;  4EV0 A;  1O57 A;  3KZY A;  3BP8 A;  1BBY A;  3ZMU A;  5HVQ C;  3R61 A;  4I98 B;  2IW5 A;  2CW0 F;  2YR2 A;  4M72 A;  4BHP A;  5JR3 A;  4G94 A;  4M73 A;  2EA2 A;  4HDU A;  3ZP5 A;  2H94 A;  1FT9 A;  2LNB A;  2Z9O A;  1XMA A;  1ZGA A;  1S7A A;  4O5V A;  1RUO A;  2GZW A;  2QQA A;  1S7O A;  3P9K A;  3F72 A;  3LQR A;  1KU7 A;  4MEX F;  1MD0 A;  4I09 A;  4HAM A;  1KU3 A;  2VBW A;  4BYY A;  1T39 A;  4G7O F;  1J0R A;  2GIV A;  1R58 A;  5AIP A;  3WTU C;  1R1U A;  1U5T B;  2ELH A;  2A07 F;  1WRJ A;  1HW2 A;  4A6E A;  3O3K A;  3T5X A;  3SXY A;  4I01 A;  2JTV A;  1P6R A;  2XAH A;  1KYZ A;  3V8J A;  1I1G A;  2EFP A;  2EFN A;  2HYF A;  2P6T A;  5BQT A;  1Z6T A;  1FC3 A;  2DBB A;  2QZ8 A;  2FU4 A;  2VBX A;  4HX7 A;  3JSO A;  3I59 A;  4ESJ A;  2F5C A;  3EDP A;  1Z1D A;  5DV5 A;  4AIJ A;  4CGZ A;  5D8L B;  1B1B A;  5H20 A;  2EK5 A;  1S3J A;  2K27 A;  2XKO A;  2LDU A;  2V79 A;  4PGH A;  3ERE D;  3J81 Z;  4PCQ A;  3TQN A;  1PUE E;  4U7B A;  2RC4 A;  2PMH A;  4MNU A;  4L9J A;  2LSO A;  3MAJ A;  3WTW C;  4TV7 A;  1SAX A;  4OMY A;  4IJA A;  4LB5 A;  4KMU X;  2W84 A;  3BJO A;  4R79 A;  2PI0 A;  5FLX Z;  1LJ9 A;  5J8C A;  3K1P A;  2V1X A;  3KP4 A;  3GFI A;  3OV8 A;  2DQL A;  4AD9 A;  3TGN A;  1CF7 A;  2KIM A;  5DCM A;  3LA7 A;  2XIG A;  3F8F A;  1MJA A;  3DQV C;  1KQ8 A;  2VE8 A;  4I7H A;  5HDN A;  2MLK A;  1STZ A;  1OR7 A;  1QQI A;  3KLN A;  2P4W A;  5FO5 A;  5H6Q A;  3R6S A;  4G6D A;  5DCM B;  2A69 F;  1QNT A;  1K79 A;  5BOX A;  4HF1 A;  4O3M A;  1I6X A;  4KYW A;  1TQM A;  1KQ9 A;  1SFU A;  2FOK A;  3I53 A;  1J2X A;  2CO5 A;  4A0X A;  1RNL A;  2W24 A;  4BHC A;  3FX3 A;  3CTA A;  2CSO A;  1WSU A;  1IZ1 A;  3L9F A;  3O2P E;  1IRG A;  4Y15 A;  4HV5 A;  1Z05 A;  2M8E A;  3J80 K;  4DNC A;  4N9I A;  2Q8K A;  2O3F A;  1ZH5 A;  2OA4 A;  1YS6 A;  1LDD A;  2QUF A;  2FQ3 A;  4Y13 A;  4HLY A;  3WU0 A;  1KA8 A;  3DF8 A;  4M9S A;  4GGG A;  5D8K B;  3I4P A;  3Q5F A;  4ZH4 F;  2GA2 A;  2VT2 A;  5ILV A;  4JBA A;  2MH9 A;  1ZLJ A;  3Q9S A;  2FBH A;  1XGM A;  2V6C A;  4KA4 A;  3QPH A;  3HSE A;  2UWM A;  2Q0O A;  4BAY A;  2HOE A;  2L54 A;  2D45 A;  2G9W A;  2B0L A;  4AWX B;  4ZYD A;  2D1V A;  2FML A;  1O7L A;  4EGZ A;  4OIO F;  1EV7 A;  3GW2 A;  2ZFW A;  2K4J A;  5ILS A;  1KU2 A;  1B4A A;  5D4S A;  2FNA A;  5KVR A;  5FB2 A;  3BDD A;  3SZP A;  3BRO A;  4A0Y A;  4U0V A;  1IXC A;  2BGC A;  2IPQ X;  4R8H A;  5HLI A;  2IT0 A;  1HKS A;  4CDG A;  1F5T A;  2GAU A;  2FF4 A;  1XMK A;  1B9M A;  4M6Y A;  4XRF A;  1XGN A;  5D5X B;  1BN5 A;  1SFE A;  4RAZ A;  3R60 A;  4L5I A;  1OYW A;  2MBF A;  2QLZ A;  2J5P A;  2FE3 A;  4XSZ F;  2FSW A;  5F1R A;  2M87 A;  4M74 A;  3RKX A;  2IRF G;  2V1D A;  4JK1 X;  5E8I A;  1GXP A;  2DFI A;  1JHF A;  1RIO H;  4XLP F;  4EQQ A;  2PJP A;  4MEY F;  4IHT A;  2FXA A;  1PDN C;  2HTS A;  4OIR F;  3VOD A;  4UVA A;  5LGU A;  2H6C A;  5HS9 A;  4JQF A;  1FSH A;  3E5Q A;  3LAJ A;  1FOK A;  1TQP A;  3P9C A;  3GFJ A;  3D5L A;  3DEU A;  4G7H F;  2UXN A;  1RZ4 A;  4KIG A;  3JTH A;  3I58 A;  1MKM A;  1MDM A;  3RYR A;  2M5W A;  3K69 A;  4IF4 A;  5CVJ A;  5IT9 Z;  4P9U A;  3U1D A;  3GO5 A;  2JPB A;  3JSP A;  1LQ1 A;  4LK1 F;  2DT5 A;  2P7V B;  3CJN A;  2FRH A;  4YG2 F;  3DP7 A;  4XBF A;  4N9H A;  2ZO4 A;  5CJ9 A;  2FEZ A;  4A2U A;  1ZAR A;  4ZYH A;  3WTV C;  4LG0 A;  1HXD A;  2P5K A;  2XGX A;  4ZZL A;  1SD5 A;  6PAX A;  1BIB A;  1DPU A;  4A6D A;  5E20 A;  5F64 A;  3BY6 A;  4LLL A;  1H9G A;  1BI2 A;  1YW8 A;  1IN8 A;  2DAO A;  1TW2 A;  3WGG A;  4MTE A;  3ECO A;  1WWX A;  1J5Y A;  3TOB A;  3HRU A;  1ZLK A;  3PQK A;  4FX0 A;  3WGH A;  1ZG1 A;  2OQR A;  1U8R A;  2WWY A;  3G3Z A;  1C0W A;  2OZ6 A;  2IP2 A;  5A2Q Z;  2RDP A;  4EVI A;  1J59 A;  4MQV A;  5BMZ A;  1D3Y A;  3TDZ C;  2L4A A;  3J80 Z;  1G3T A;  2XAG A;  2PLY A;  3ZMV A;  3C3W A;  3JTG A;  3TKY A;  5E1Z B;  3DPT A;  3HIF A;  3DXJ F;  3IL2 A;  1K78 A;  1DPR A;  3MZY A;  1IN4 A;  4BHB A;  4UXN A;  2ESN A;  5JVT A;  2WTE A;  4AIK A;  1UB9 A;  4MQ9 F;  2V9V A;  1JXS A;  1TNT A;  4RGU A;  1TTY A;  3PQJ A;  3GLX A;  3QP6 A;  2BBY A;  2A68 F;  3DV8 A;  4UV9 A;  3EYI A;  2VOO A;  2VT3 A;  2CG4 A;  2EV0 A;  4ESF A;  4RS8 A;  1XDU A;  4MHG A;  4RB0 A;  3AAF A;  4WF2 A;  1B6A A;  1YS7 A;  1W7P B;  4RB1 A;  4ASN A;  2DI3 A;  5DUI A;  3NQO A;  2HQN A;  1P92 A;  3F6V A;  3SQN A;  4P55 A;  2Z5U A;  4AIH A;  3R0A A;  1HKQ A;  1S6L A;  1U3E M;  2UZK A;  5DUK A;  3HHH A;  2HFH A;  2LKP A;  2YPR A;  3C1D A;  4BNC A;  3KCC A;  2OBP A;  4HF2 A;  3V7R A;  3RKW A;  2A61 A;  1NHA A;  3C7J A;  3GWZ A;  2M45 A;  2BYV E;  1FPQ A;  2DK8 A;  4WXD A;  4PDK A;  2QQB A;  1T0F A;  4RB3 C;  4EJW A;  1MZB A;  4IHS A;  2KIU A;  1GXQ A;  2XRN A;  4L0Z B;  3WTS C;  2PG4 A;  1ZG5 A;  3FXU A;  1HW1 A;  3KP5 A;  2BV6 A;  2MH2 A;  1XSV A;  2FBI A;  3HUG A;  3O6B B;  4KDP A;  4D0P A;  1AWC A;  2VXZ A;  2X4H A;  3TO6 A;  5L3D A;  2YU3 A;  4KIF A;  4PZJ A;  1YW7 A;  1QGP A;  3FMQ A;  4IPA A;  3FHZ A;  1FYK A;  3ABT A;  3RTR A;  2EFO A;  3IWZ A;  2Y48 A;  4ETS A;  3JAM K;  2KJB A;  2O03 A;  4YFK F;  2DPD A;  3M7G A;  2XHK A;  1UCR A;  2IJL A;  2ESH A;  2QM3 A;  3RPQ A;  4EM0 B;  2YX7 A;  4RGS A;  2ZBK A;  2QBY A;  2Z99 A;  5E8G A;  4A0Z A;  4ZZD A;  5DYM A;  3T0Y A;  1O3Q A;  3EQL F;  3DFG A;  2G7H A;  3V7C A;  1P2F A;  2PMU A;  3DPL C;  3I59 B;  4IVN A;  2HEO A;  5FFX A;  5ERI A;  2QYO A;  3KEO A;  4U7D A;  1T38 A;  4HZF A;  3IC7 A;  2OAZ A;  5ICG A;  2L3D A;  3ZMD A;  4BH9 A;  3P9I A;  2AS5 F;  2M1B A;  1FBQ A;  1YO5 C;  3BJ6 A;  3T1B A;  5LGT A;  1LVA A;  2NNY A;  3RYP A;  2CFX A;  4IXA A;  4PGG A;  1MJ9 A;  3WGI A;  3HRM A;  1ZN2 A;  3H92 A;  4Y17 A;  3ML6 A;  3F8M A;  5LEJ A;  4Q48 A;  1D5V A;  5E1W A;  4ENN A;  1QBJ A;  4HBL A;  1LDK B;  4YFN F;  5E17 F;  1CF7 B;  1KU9 A;  4HX8 A;  1BIA A;  2ZJ2 A;  3LWF A;  2NRA C;  3E97 A;  3GZ5 A;  5FD5 A;  2IA0 A;  4LB6 B;  4ZYE A;  1BOA A;  1WKM A;  5JI6 A;  2DU9 A;  2KRF A;  2OZU A;  1Z9C A;  1K7A A;  1B9N A;  2HZT A;  5D6F A;  1KQ0 A;  1ZYR F;  5TJJ A;  2K4B A;  5AON A;  5HDG A;  2ZME A;  3SZT A;  1ZGJ A;  3ZN1 A;  3FXQ A;  3HSF A;  4EJU A;  4L9T A;  3BPV A;  1G3Y A;  2XAJ A;  3BJA A;  3ISP A;  3RI4 A;  3KET A;  3FM3 A;  3LQQ A;  1BC7 C;  4LK0 F;  3JW4 A;  2P8T A;  1QO0 D;  4P5O A;  4I0A A;  3GFM A;  1W5S A;  3KP7 A;  1H0M A;  1MGT A;  3KP6 A;  3QP5 A;  5D5W B;  4H0E A;  3WTZ A;  1O7F A;  3IRR A;  1FYM A;  1L3L A;  4G7Z F;  1FWZ A;  2YX4 A;  2ACJ A;  1F4K A;  4FX4 A;  5IT3 A;  4YFX F;  1R1V A;  3B02 A;  3L2C A;  2NAZ A;  1GHC A;  1BI1 A;  1SD6 A;  5ILU A;  4M71 A;  1IUY A;  5J8F A;  4WX9 A;  2VON A;  5CVV A;  1HSJ A;  3MEX A;  1YYV A;  4S05 A;  4GO1 A;  4EJV A;  3E5U A;  3WOD F;  2MD5 A;  2VBY A;  3U9G A;  2DQR A;  3MZH A;  4UVB A;  3DKW A;  5HOO A;  1FNN A;  2EV5 A;  3Q9V A;  4Z2Y A;  5D4R A;  3ULQ B;  1U6G A;  3I0T A;  2A5Y B;  2W57 A;  1S29 A;  3IWF A;  4QWQ A;  2QVO A;  5ICE A;  2BEO A;  5L3E A;  5CYV A;  4KMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...