3J81K

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
b'MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81K00
1XCVA 3LA7A 1KU9A 4P96A 5IT9Z 4I0AA 4MEXF 1BC8C 3VEPA 1B9NA 3OV8A 2H6BA 2V9VA 4MHGA 3ZQ7A 5D5VB 1HXDA 2ZMEB 1R36A 2A3SA 3DF8A 4L9JA 4CO8A 3MFKA 1IN7A 2PI0A 2CFXA 3ZMUA 1ZH5A 4A6DA 4AIJA 1W4MA 3SXYA 3TGNA 3GZ6A 1BIAA 3CO6C 1Z91A 1TQMA 4P55A 4EJOA 4A5MA 1HKQA 3EQLF 1W7PA 1LQ1A 2K4BA 1KQ9A 4ZYGA 3ZMTA 5HS7A 1C0WA 2K86A 5HDGA 1YFHA 1XD7A 1IXCA 4IJAA 4EGZA 1O3TA 2FU4A 3K1NA 1V3FA 1X3UA 2DPDA 1WRJA 4XRFA 1WQ2A 5TJJA 4G6QA 3SZTA 3KP2A 4M73A 3BDDA 5LGNA 5BOXA 2D1HA 3QOPA 4G8XA 3F6VA 4HQEA 3GFJA 2H6CA 1JXSA 2XKOA 4IVNA 1G4DA 4RGRA 2JZYA 1J59A 1HSTA 3M8EA 1UB9A 5LGUA 3QAHA 4CXFA 1IRGA 4QLCU 2VONA 4KIGA 1LDDA 2P8TA 2AXLA 4HLXA 1EV7A 3VOEA 2IA1A 4FX4A 1S3JA 2VBWA 3KFWX 4G7ZF 4YIIA 2EFWA 1CF7B 3QPTA 2EB7A 1IW7F 4PCQA 1PDNC 1FBUA 3LAJA 1K6OA 1FOKA 3CTAA 1R58A 4BAYA 5E1XA 4Q47A 2M45A 5E20A 2ZMEA 4LK0F 2V6CA 2JSCA 4LLNA 3PFIA 1SMTA 1U5TB 1BI0A 3H92A 1W5TA 3ZN1A 1REPC 3E6BA 1ON2A 1G6NA 3HIFA 2VE8A 1BOAA 2BGCA 4OIRF 4LFUA 3WU0A 3LWFA 3T8RA 4ZYDA 1T6SA 3KLNA 1TNTA 1MKMA 1BJAA 2IA2A 2CO5A 4XLNF 2K7LA 2DI3A 5KK1A 1O3SA 2Q2EA 3K1MA 4KIBA 1WSUA 2FMLA 1KU2A 4AD9A 2KIFA 1KQ8A 5JFRA 2ZFWA 4PGGA 2XASA 4HF1A 1QPMA 1P6RA 2NYXA 4HF2A 2EFNA 1F1ZA 4L5IA 4IF4A 2M30A 4I01A 4UVCA 1FWZA 3DV8A 5LBQA 4N0BA 2MH2A 5D5WB 4ESJA 4HA8A 4P9UA 3GFLA 2ELHA 4UUVA 4A12A 4A0ZA 3E6CC 1CF7A 3FF5A 3WTYC 5DEQA 5L3BA 1QBJA 4FT8A 4N9HA 1YQAA 1AWCA 3RKWA 1T98A 3JTGA 1J75A 1MGTA 2XAGA 4HQMA 3DPLC 3R60A 1Z6RA 1XGSA 3F72A 3RYRA 2A5YB 4HBLA 2G7UA 3L00A 5D8KB 1B9MA 5K5RA 3E5QA 5DD8A 5ICCA 3W6KB 4LD5A 2EFPA 3KE2A 1LEBA 3RKXA 1BI3A 4S04A 4N9IA 2FBHA 2Z9OA 1S6LA 2RVCA 3QPHA 2FA5A 3COAC 1YIOA 2PN6A 2XAFA 1HBXG 2BBYA 3BP8A 2FNPA 5LRRA 4EM0B 4ZZDA 3NQOA 2CW0F 4WF2A 5E18F 3WTUC 1FNNA 1IRFA 2F2EA 1W5SA 2F5CA 3PQJA 2ZNZA 5H6RA 3D0SA 2XRNA 4L18B 3BJ6A 5FFXA 4EGYA 3ABTA 1B59A 4MNUA 4L0YB 4HV6A 1LVAA 3EYIA 1OYIA 2ETHA 1R23A 2J5PA 3F21A 1H9GA 2DLLA 1YS7A 1O57A 2OZ6A 4B09A 2ZNYA 4YG2F 3V7RA 4HYEA 4A6EA 2CYYA 3MAJA 1TNSA 5D4SA 1YW8A 3IRQA 3RDIA 5D6EA 3E97A 3NEUA 2EWNA 1Z6TA 3DPTA 3CUQB 2ZKZA 3VFZA 2O61A 6PAXA 2PFBA 2KIMA 1I5ZA 3N4MA 2ZJ2A 1SFUA 1MZBA 3DXJF 2ISYA 5AONA 1J7KA 2UZKA 2KRFA 4Y15A 4A0XA 2RDPA 4KT5C 5L3EA 4JK1X 2KJCA 2M5WA 5LEJA 3KEOA 1GHCA 3FMQA 5KVRA 5BS6A 1HW1A 5F64A 3Q9SA 3GYHX 3LQRA 3WTXC 2WWYA 4PGHA 2MH9A 2GA1A 4R79A 2DW4A 3IKVA 2ZBKA 3I64A 3WE3A 3KP5A 5EEGA 2V79A 3R61A 1I6XA 2OA4A 4I2OA 2F5FA 3FZVA 2LDUA 3HTSB 2MA3A 2GWRA 3ZN0A 2K4JA 4AIHA 3MEXA 4XLPF 2MLKA 2FQ3A 4L5JA 2MBFA 4HZFA 4AIKA 1USTA 1QZZA 1OYWA 3LFKA 2EV0A 1K79A 4FHTA 2E1NA 1E2XA 1DPUA 4OU0A 1DPRA 2A07F 1W7PB 5FLXK 5LRSA 1GVJA 4LMYA 1SMYF 3WE2A 4LJZF 5L3DA 3P9CA 4LK1F 3DFGA 4RAYA 5FO5A 1U6GA 3BPVA 2JPCA 4NQWA 3KP7A 2QQBA 2QZ8A 5ERIA 3ECOA 4UXNA 1DP7P 5LHGA 2IJLA 2LF7A 3LSTA 2Z99A 2DO7A 3R0JA 3CUOA 4KMUX 3R4KA 4OINF 2FXAA 4NHJA 4Q4ZF 1HKTA 2ACJA 3T8TA 1RNLA 4R1HA 2VN2A 3FXRA 4DNCA 3WTZA 3CJNA 5ILVA 2KJBA 4CHUA 2XHKA 2OZUA 4XSXF 2UWMA 2W84A 2ZO4A 3I0TA 3IKTA 1WKMA 2UXNA 2STWA 3H3ZA 3J80K 2DAOA 4KICA 3GLXA 4EJTA 1R5HA 3M1EA 2DBBA 3BWGA 3I54A 1I1GA 4R8HA 3FWEA 1BI1A 1F9NA 1SD6A 4HW0A 3JTHA 3GX4X 3ELKA 3BZ6A 3QRFF 4TV7A 3FM3A 4WK8F 2Y48A 5LGTA 1E17A 1S7AA 3SFZA 3TOBA 5J8FA 2R3SA 5D4RA 4GYGA 1XCBA 2HQNA 1TQIA 1ZGJA 3FXQA 1BN5A 5FLXZ 1MDMA 2FF4A 4HF0A 4GXOA 5L3CA 1UFMA 3LA2A 5D8LB 5J6XA 2CWEA 1L3LA 1A04A 1IF1A 3F8BA 4RB1A 3HHHA 2E7XA 1K78A 5E8GA 4LG0B 4KYWA 3T5XA 4XSZF 2XAQA 3RIRA 2VC0A 1YO5C 3E5UA 3JSPA 1FSHA 1SD5A 1G3WA 2PLYA 3K0LA 3KP4A 2VOPA 2EV5A 2L4AA 3KEQA 1ULYA 5A2QK 4K2EA 1ZLKA 3TQNA 2G7HA 3NRVA 3U1DA 4EJVA 3L7WA 1YG2A 1BM9A 2YSRA 2Z3YA 3SZPA 1K7AA 4UV8A 4MTEA 2G9WA 1FYMA 3J80Z 3IL2A 3WTSC 2VBZA 4GGGA 3SHFA 5JHUA 2NNYA 3TO7A 3IC7A 4WXCA 1SAXA 4IRGA 4CZZA 2Z5UA 1O3RA 2WV0A 1IN4A 5E1ZB 4AVPA 3KP6A 4A0YA 2CG4A 4ZZLA 4D0PA 1ONVA 4U0YA 1CGPA 2OBPA 1XSVA 3N97A 1PUEE 2MLGA 2EFQA 1J9IA 3BOQA 3P9IA 3KZYA 3HSRA 3V8LA 3K2ZA 1I1SA 3ZP5A 1W7PD 1LDJA 3FMRA 3JSOA 3L2CA 4UVAA 4LG0A 5D6FA 5LHHA 1OR7A 4E70A 2ESNA 1S29A 1MJBA 4U7BA 5E1WA 3KLOA 4ESBA 4Y13A 2NAZA 1ZLJA 4BHCA 1R5GA 1O7FA 1XN7A 2QM3A 3T0YA 1ZAOA 2YX7A 4NB5A 1D8KA 1OKRA 3CDHA 2FOKA 2P5KA 1ZRCA 5A2QZ 4KDPA 3TO9A 4HOBA 3ULQB 2D45A 1BBYA 4I09A 1H0MA 1KU7A 1IAWA 4LGWA 3RJPA 4EVIA 1XB4A 2A6EF 1IZ1A 2XGXA 1ZHFA 2VE9A 2XIGA 2R7DA 1ZN2A 1PP7U 3ROUA 4WCGA 1FP2A 2COMA 2QVOA 5BQTA 5DUKA 3G3ZA 4U0VA 1B6AA 3RI4A 1BC7C 2KIUA 3F6OA 3E6MA 3MQ0A 3TO6A 4KUMA 2GZWA 3WG9A 1FP1D 2QENA 4ASNA 4F7ZA 3HHGA 4G6DA 2AS5F 2Q0OA 4BH9A 2O03A 2HFHA 1D5VA 4ZH4F 3KCCA 4HV5A 2LF8A 4IXAA 2A68F 2IP2A 2W57A 4RAZA 4RB2C 1YLFA 2D1VA 1V4RA 3BROA 3C3WA 1TW3A 4A2UA 3L09A 2XVCA 3HRMA 3FHZA 4HDUA 2FBIA 2JTVA 1I27A 2HKOA 4S05A 1P92A 3PQKA 1OMIA 5H6QA 3ABUA 4LLGF 4M9XA 2P5LC 1XDUA 3WTTC 2XKPA 4UVBA 1QZYA 1D8JA 1XGOA 1UCRA 4CDGA 4Q48A 2FMYA 4EM1A 2HR3A 1HW5A 2IRFG 1HW2A 1ON1A 3P9KA 5F6FA 4OIOF 4PDKA 1FT9A 3I4PA 5J8CA 4BHBA 2HYGD 2OQGA 3P7NA 4U88A 4EV0A 2DTRA 1BIBA 5JR3A 1KU3A 3HRTA 3V8KA 3F23A 3VB2A 2QBYA 3IWFA 1BI2A 2VOOA 2P6TA 3EUHA 1Z9CA 4GCVA 2DK8A 2ISZA 4GYIA 4HLYA 5BPIA 2HOEA 3GWZA 5DD4A 2ZCWA 4MGRA 3EYYA 1HQCA 3ZPLA 2B0LA 2TDXA 2NS0A 2P7VB 4YFNF 1R22A 2PMUA 5FD6A 2BE5F 2HGCA 5HOOA 4U0WA 1U8RA 3TDZC 2JPBA 1LJ9A 4P5OA 1Z05A 4KA4A 2VBXA 4MTDA 4PZJA 2V1UA 1F4KA 2V1DA 5ILSA 2RGVA 2RC4A 3GVAA 1Z1DA 2OQRA 2K02A 4WXDA 3DEUA 3HUGA 3I59A 5AIQA 1LDKB 2HWVA 4O6JA 5D5UB 3QU6A 3ISPA 4EJWA 4BYYA 2V1XA 1Q1HA 5L3GA 2HTSA 3QP6A 5IT9K 4IRIA 5ICEA 3I53A 2QUFA 3E3VA 3WTWC 3JAMK 4IRHA 1TW2A 4OOIA 1AOYA 3ZMVA 3RKYA 5HLGA 2CQKA 1MDMB 3B73A 4BQAA 1TBXA 3EETA 3J81K 4OIQF 2ESHA 3EDPA 2FSWA 2HS5A 3H3UA 1JHFA 1RUOA 2X0LA 1K78B 4ON0A 2XAJA 5FD5A 2H09A 1TQPA 5HDKA 2E1CA 3C18A 2IT0A 1FBSA 2LKPA 4JQFA 3Q5FA 5IT3A 4L9VA 4ENMA 2PEXA 2HYFA 2O6GE 5CLSA 3AAFA 1UHMA 1GXQA 4I02A 1R1UA 2WC2A 4HX8A 2VBYA 5HS8A 4YIFA 3C1DA 4M6XA 4Z2YA 4I0BA 1U78A 2FEZA 2HEOA 2WTEA 2FRHA 2HTJA 4G94A 3BJAA 1YTYA 3HSFA 1ZG5A 1SD7A 2RN7A 4I7HA 2FNAA 2PMHA 1XDSA 3JW4A 4EMSA 5DCMA 1ZGAA 2L4MA 5F1RA 1ZG3A 2P4WA 2O0YA 5ILUA 3HOTA 1B1BA 3WGHA 3HSEA 2ZXJA 1EH6A 2BEOA 1F5TA 3WU1B 2F5DA 3VODA 2EJRA 5CVVA 3JAMZ 1SFXA 4MQVA 4GO1A 5FGMA 3KZZA 2BYVE 1JHHA 3J7AO 4M72A 4HDVA 3FMSA 4CGZA 5E8IA 1XGMA 3J81Z 2A61A 3DQVC 1RI7A 2RQPA 4I98B 1T2KA 1FYKA 5CVRA 2M8EA 2NRAC 3IRRA 4M9SA 3W6JB 4UV9A 2YX4A 3HTUA 4RGXA 2L01A 4OIPF 4L0ZB 3HRSA 4EQQA 4LB6B 1QNTA 1RIOH 2ADUA 1EH7A 3O3KA 1XGNA 2RV8A 1JE8A 2BV6A 2VC1A 1G3YA 4IPAA 2W25A 4M74A 5L3FA 3K1PA 5CVJA 1LB2A 1IN5A 2VT2A 2XROA 4YFKF 2P7CB 2F5EA 2P6SA 3M8FA 3BJOA 1B4AA 4M6YA 1FBQA 3F8FA 2UXXA 2GQQA 3GZ5A 4G9YA 2YR2A 1ODDA 3FXUA 2FBKA 1QGPA 4KFCA 2XAHA 5LHIA 1STZA 1U3EM 2IPQX 3V7CA 3TDUC 5BMZA 4CICA 3QP5A 2M87A 1IXSB 2GXGA 3S2WA 1KQ0A 4KN4X 4ETSA 3RYPA 3CO7C 1IN8A 1MD0A 1QQIA 1FPQA 5HLHA 5D5XB 2QLZA 1P2FA 3R6SA 3WODF 2PG4A 4BHPA 2CGPA 2HZTA 1WI9A 2DPUA 1D3YA 2W24A 3T1BA 1XSXA 3IWZA 5K5OA 1KGSA 1YW9A 3SQNA 3MCZA 1IXRC 1ZG1A 2Z33A 1O3QA 1RZ4A 5DYMA 1DUXC 3HRUA 4CYDA 1U2WA 2OD5A 1TTYA 4M71A 3V8JA 2YU3A 3V4GA 5ICFA 3OOPA 3ZMSA 2DQRA 3MZHA 2MC3A 1LEAA 5DDGA 3TOAA 2J5OA 4RS8A 4O3MA 1FSEA 3O2PE 4IHTA 3WTVC 2VODA 4M9ZA 1IUYA 2LSOA 1PP8F 4LB5A 1IN6A 3MZYA 4RGUA 5E17F 5FFZA 2A69F 2PJPA 2HKXA 4HX4A 2QBYB 4Q5SF 3DP7A 4ESFA 4UNOA 2X4HA 4H0EA 1HKSA 4BXUA 2OU2A 3K9TA 1FLIA 4ENNA 3G73A 3WGGA 1R7JA 2EA2A 1FYLA 3C7JA 2MD5A 1G3SA 1P4WA 4BNCA 4ENKA 4KN7X 3ML6A 4UHTA 4KIFA 1S8NA 4WXHA 1DDNA 4OMYA 1U5TC 3U9GA 4WX9A 3LAPA 1KYWA 3F8NA 1UHWA 1XSDA 1SD4A 1TLHB 4AWXB 3IHUA 2HQRA 4G7HF 1RUNA 1GXPA 2H27A 1U5TA 2HDCA 4QWQA 5K1YA 4Y17A 3REOA 2D2WA 3F22A 1P4XA 2XUBA 2H94A 3GFIA 5CVIA 4A5NA 2DQLA 5BPDA 1T0FA 2E7WA 1OYYA 5HLIA 4B8XA 1FZPB 3I59B 3V7SA 2VXZA 3FM5A 5AIPA 4L9NA 2DU9A 3HYIA 1SFEA 5DCFA 4P9FA 1S7OA 2EFOA 4KNYA 1G3TA 1XMKA 2DK5A 2IVMA 3R0AA 2QYOA 4EM2A 4JBAA 2Y75A 3HOSA 3BPXA 3GUDA 3F3XA 1ZRFA 5ED4A 2O8XA 3GFMA 1R1TA 1Z7UA 3GEZA 1KA8A 1J0RA 1P4AA 4YFXF 5DV5A 1ZRDA 1FC3A 2PBIA 1Y0UA 3D5LA 5HVQC 3GW2A 1ZREA 5FB2A 3GO5A 1JGSA 5CYVA 4RB3C 3KETA 4ENJA 3I5UA 2Y0MA 4U7DA 2EV6A 2C6YA 1MJAA 3Q9VA 3GXOA 3F8MA 3B02A 3I71A 4XBFA 2DFIA 4HX7A 3K69A 4G7OF 2QWWA 3RTRA 4IHSA 2O3FA 5H20A 1FX7A 2P5VA 1HSJA 5HDNA 2M1BA 2PQ8A 2JRTA 3F8CA 1VTNC 1NHAA 2RKHA 3WGIA 2R7FA 2GAUA 3I58A 3U2RA 3LA3A 4ZYHA 1ZYRF 3ECHA 1YS6A 3M7GA 2GXBA 2K27A 1T39A 3GF2A 1R00A 4KMFA 5DCMB 5LEKA 3FX3A 3KP3A 2A6HF 2RNJA 1FY7A 3E6DA 5JVTA 1OPCA 1USSA 3LQQA 5DUIA 4LLLA 3DKWA 1H9TA 5ICGA 2KKOA 2YPRA 3ZMZA 2STTA 5LLQA 3L9FA 2VT3A 2DT5A 2FE3A 1O7LA 2NNNA 1LNWA 2EA4A 2L02A 1XMAA 3E5XA 2QQ9A 3RPQA 4EJUA 4RB0A 1YW7A 4WWCA 5TRDA 1EH8A 2EK5A 5CJ9A 2W85A 5CVUA 3O6BB 1WWXA 3CLOA 3M9AA 4MQ9F 4L9TA 2LNBA 2CSOA 2QQAA 1KYZA 3MWMA 3CUQC 3RPUA 1MJ9A 2L54A 3CUQA 1J2XA 1L0OC 4FX0A 2IA0A 1YYVA 4ZYEA 4DQ2A 3ERED 2GA2A 2OAZA 4MEYF 2JT1A 4O5VA 2GIVA 5HS9A 3ZMDA 5K5QA 3QU3A 1ZARA 1QO0D 3TKYA 1T38A 5EEHA 5JI6A 4HAMA 3BY6A 1R1VA 2L3DA 2XV4S 2Q8KA 1J5YA 4RGSA 4OMZA 2IW5A
chains in the Genus database with same CATH superfamily
1XCVA 3LA7A 3CCMI 1UHSA 1KU9A 3FXKA 3LSIA 4P96A 5IT9Z 4I0AA 4FE7A 4MEXF 1BC8C 5FKLA 3VEPA 1B9NA 2BW3B 3OV8A 4U87A 2CV1A 3CMYA 2H6BA 4XLHA 2V9VA 2JN6A 4MHGA 3ZQ7A 5D5VB 3CP8A 3EUKL 2LREA 3KYCB 1HXDA 2H8WA 1R36A 2A3SA 2ZMEB 3DF8A 4L9JA 4CO8A 3MFKA 1IN7A 2PI0A 4HG2A 2CFXA 1WPKA 1P7IA 3ZMUA 3AKZA 1ZH5A 3I3LA 4A6DA 4AIJA 3QOEA 1W4MA 3SXYA 3TGNA 1QZEA 3GZ6A 1BIAA 3CO6C 4QTRA 1Z91A 3H0GJ 4CCJA 1TQMA 2QF7A 4M3FA 4P55A 4A5MA 4EJOA 2E71A 1HKQA 3BG5A 3M1CA 4JX6A 2CUJA 3EQLF 1W7PA 2CFOA 1LQ1A 2K4BA 1KQ9A 4ZYGA 3ZMTA 5HS7A 3S1QJ 4FASD 1C0WA 2K86A 2WA0A 4DOZA 1XX5A 5HDGA 4MFEA 3H5NA 1D5YA 2JUCA 2UV1A 1YFHA 2WAFA 5EGOB 1XD7A 1IXCA 4IJAA 4EGZA 1GVDA 2X1DA 1O3TA 1SFOJ 2FU4A 4JP0A 2AHQA 3K1NA 1V3FA 1X3UA 2DPDA 1WRJA 4CCNA 4BY1J 2ID6A 3PUBA 4XRFA 4AUXA 1WQ2A 2VPLA 5GTHC 5TJJA 3QODA 5F0CA 1WHUA 4G6QA 2QKLB 1LFBA 3JRDA 2KHMA 3SZTA 3KP2A 4M73A 3NARA 3BDDA 4XN0A 5LGNA 1R5ID 3NWTA 5BOXA 2D1HA 1VQ4I 3QOPA 4G8XA 3F6VA 4C3HJ 4HQEA 3GFJA 2H6CA 1JXSA 2LY2A 3AG1H 2XKOA 3CDLA 4IVNA 4C2TA 2K3FA 1G4DA 4RGRA 2JZYA 1J59A 3J7AY 1HSTA 3M8EA 1UB9A 4GFBA 2W00A 5LGUA 3QAHA 4CXFA 2F4MB 1IRGA 4QLCU 2I10A 1U8BA 3A01B 2VONA 4KIGA 2ELKA 1LDDA 2E34A 1QRYA 2EH3A 2P8TA 4BGDA 2AXLA 3VWBA 4HLXA 5KNLA 4YELA 3CCSI 1EV7A 1LKXA 3AG4H 3VOEA 1LFPA 2IA1A 1NG7A 4FX4A 4V19K 4YIRX 1S3JA 2FOWA 2IGKA 2X6XA 4P1WA 2L9VA 2VBWA 3KFWX 3BTCA 4G7ZF 4YIIA 2EFWA 1CF7B 2CUEA 3QPTA 2EB7A 2EBIA 1IW7F 2JMWA 4C9YA 3BTJA 4A3LJ 2MSYA 2WADA 4B43A 4PCQA 5J1RA 1PDNC 1FBUA 3K4LA 3LAJA 1K6OA 2JA7J 3MKLA 1FOKA 3CTAA 1R58A 5F04A 4OAYA 2LR8A 4BAYA 5E1XA 4Q47A 2M45A 5E20A 2ZMEA 3IP4B 2V6CA 4LK0F 2JSCA 3S16J 3HM5A 1IC8A 4LLNA 1T95A 1YRNB 3ASOH 3PFIA 3DU5A 1SMTA 2XB5A 1U5TB 2LY1A 4NC8A 1BI0A 3H92A 4BXXJ 1NK3P 1W5TA 2KZGA 4LIVA 3ZN1A 1REPC 3E6BA 1ON2A 4BQOA 1G6NA 4D5CA 3HIFA 1FOWA 1GV5A 1PUFB 3MKWB 2VE8A 1BOAA 5J40A 5J4YA 3CCEI 2BGCA 4OIRF 1DU0A 2MFZA 1TP4A 4LFUA 3WU0A 3LWFA 3CJRB 1QU3A 3T8RA 3GTPJ 3RQIA 4ZYDA 1T6SA 3KLNA 1TNTA 3ZR8X 4IO9F 1MKMA 1BJAA 2DYRH 2IA2A 2CO5A 2W48A 1WH7A 4XLNF 4GRIA 2K7LA 1QHHD 2DI3A 1MBHA 1X2MA 1D0XA 3PM1A 5KK1A 1O3SA 2IEKA 2Q2EA 4C2UA 2EIKH 3K1MA 3HGGA 4KIBA 2E2JJ 1ETKA 1K4TA 2XF7A 1WSUA 2MC4A 2FMLA 3K70C 1KU2A 4DW6A 1X1AA 5CPRB 3X2QH 2DJIA 3W2VA 1AKHA 1QHGA 4YEJA 5TISC 4AD9A 2KIFA 3GTQJ 2R4GA 2ZSHB 3DEWA 1KQ8A 2VXDA 5JFRA 3U1KA 3BR0A 3S15J 2ZFWA 2K9SA 4PGGA 5GADJ 2XASA 4HF1A 3F0CA 2L5QA 3BQYA 1QPMA 1P6RA 1RKTA 2NYXA 4HF2A 2EFNA 1F1ZA 4L5IA 4IF4A 1UZCA 2E60A 2M30A 4I01A 1KZHA 2KISA 2XF6A 3K6GA 2LKXA 4BQQA 3HOYJ 4UVCA 1FWZA 3DV8A 5HODA 5LBQA 3G1OA 4N0BA 1JGGA 2MH2A 2VQCA 5D5WB 3AG3H 1B8IA 5K7ZA 4ESJA 1ETXA 2WV1A 4HA8A 1ACIA 3LMMA 4P9UA 3GFLA 2ELHA 4UUVA 3IH4A 1POGA 3FKIJ 4A12A 5GTIC 1RETA 4A0ZA 3E6CC 3H5AA 1CF7A 4XMYA 3FF5A 2FX0A 1H89C 3WTYC 2RQQA 2R5ZB 5DEQA 1ENHA 5LD2C 4BU2A 1BR1A 2A05A 1V5GA 3A03A 5L3BA 1N75A 4G12A 3OS2A 3GTKJ 1QBJA 4FT8A 1JKPC 4N9HA 1YQAA 1AWCA 1YX5A 2LK2A 3RKWA 3FXOA 4D7NA 1T98A 3JTGA 1J75A 1MGTA 2TRTA 2BXZA 2XAGA 4HQMA 1N77A 2NS8A 3DPLC 3R60A 2QCOA 1Z6RA 1XGSA 3F72A 3RYRA 2A5YB 2GM4A 4HBLA 2G7UA 1RR7A 2DFEA 3CJTB 3PUFA 3CD6I 4PJMA 3AFHA 3KX2A 1G8XA 3L00A 5D8KB 1B9MA 5K5RA 4DJAA 3E5QA 5DD8A 5ICCA 2DT6A 1D0ZA 3W6KB 2DXIA 2JVGA 2Y69H 4LD5A 1IV6A 4KJZA 4E7LA 2EFPA 3KE2A 1LEBA 3JRHA 3RKXA 1BI3A 4S04A 4N9IA 2IGMA 2FBHA 2Z9OA 1S6LA 1MMNA 2RVCA 2KPMA 3I55I 3QPHA 2R92J 4IOAF 3SEZA 1ZQ3P 2DMNA 2FA5A 3QYFA 5M3MJ 3COAC 1BA5A 1YIOA 2PN6A 2XAFA 1HBXG 2BBYA 2WAEA 2XRLA 3BP8A 4A93J 2FNPA 5LRRA 2HQAA 2MG4A 4BKXA 4EM0B 3ONQA 4B1RA 4ZZDA 2L9SA 1Y6IA 2H1LA 3NQOA 2CW0F 4WF2A 2IS1A 5E18F 3DBLB 3ZRGA 3WTUC 4RA2A 4BS9A 4KISA 3B6CA 3S1NJ 1FNNA 2VL8A 1IRFA 2F2EA 1W5SA 2F5CA 2E1MC 3PQJA 2ZNZA 5H6RA 3D0SA 2XRNA 4L18B 3BJ6A 2EZIA 5FFXA 2DA4A 2HVQA 3WG7H 4EGYA 3ABTA 2VKVA 1B59A 2VIXA 4KT6A 5JLWA 2HPMA 4MNUA 4L0YB 2DA2A 3CCYA 4HV6A 2YS9A 1LVAA 5FRNA 3EUHC 1Y39A 1IUFA 2XAUA 3EYIA 1OYIA 2ETHA 4B4CA 4DGWB 1R23A 3AL0C 2J5PA 4B44A 1LE8A 3F21A 1H9GA 2DLLA 4PJLA 4JOMA 1YS7A 1O57A 2OZ6A 2LYCA 4B09A 4X6AJ 2ZNYA 4NQWB 1OCZH 4YG2F 5JVGF 3HOWJ 2ZXHA 3V7RA 4HYEA 4A6EA 2CYYA 3MAJA 4XNFA 1TNSA 5D4SA 3BG6A 1YW8A 3F9KA 3N05A 3IRQA 3RDIA 3KEYA 5D6EA 1IRXA 3E97A 3NWSA 3L2WA 4ZC3A 3G71I 3NEUA 1VNDA 2EWNA 1Z6TA 3DPTA 3SZGA 2R7UA 3CUQB 4XOPA 2ZKZA 3VFZA 2O61A 6PAXA 1JUSA 2PFBA 2KIMA 1I5ZA 3N4MA 1XS9A 2ZJ2A 1SFUA 4HEA2 2X48A 1VQ8I 1MZBA 1DGWY 3DTIA 3DXJF 2ISYA 3QPLA 5AONA 1J7KA 2UZKA 2D5VA 2KRFA 4Y15A 4A0XA 2RDPA 4ZDPA 4KT5C 5E79C 4RLFA 2DYSH 4HPQA 5L3EA 4V2GA 4FISA 4JK1X 2KJCA 2M5WA 2ZFUA 1VZ0A 5LEJA 2VKDA 3KEOA 1OCRH 2JRMA 1GHCA 3FMQA 2X1CA 5E3NA 5KVRA 5BS6A 2EQRA 4A3IJ 1FIPA 1HW1A 1VQLI 5F64A 2VPRA 3Q9SA 1JKOC 2V6EA 3GYHX 2QGUA 3LQRA 2K5CA 3WTXC 1JUMA 2WWYA 4PGHA 4CH7A 4MLOA 1JTYA 4A3DJ 2MH9A 2GA1A 3A02A 4R79A 2DW4A 3GZNB 3IKVA 2O9LA 2M9HA 2ZBKA 3I64A 3WE3A 3KP5A 2L7ZA 1LVKA 2K9LA 5EEGA 2V79A 3K10A 3R61A 1I6XA 2OA4A 2Y9YA 3OYEA 2QSFX 4J01A 4I2OA 4I99C 2F5FA 3FZVA 2LDUA 3HTSB 2CJJA 2MA3A 2GWRA 5M5XJ 4A3KJ 4BBSJ 3DTEA 4BQNA 2X1EA 3ZN0A 2JQ7A 3FBIB 2K4JA 4AIHA 3M3YJ 2JVHA 1QA6A 3MEXA 4XLPF 1Y1WJ 2MLKA 4L5EA 2FQ3A 4L5JA 3B6AA 2MBFA 4HZFA 4AIKA 3HJEA 3OYGA 1USTA 3Q0WA 1QZZA 1HDPA 2VJ4A 3CCLI 2HVRA 1OYWA 5EJCA 3LFKA 3JRIA 2EV0A 1K79A 4FHTA 3DU6A 3IAM2 4PJ0C 3JRCA 2E1NA 1E2XA 1DPUA 3G1MA 4OU0A 3OR1C 1DPRA 1RPWA 1W7PB 2P81A 2XB0X 2RAEA 2A07F 5FLXK 5LRSA 1OCOH 1GVJA 4LMYA 1SMYF 3OYFA 3WE2A 4LJZF 5L3DA 2BHZA 3P9CA 3KZIC 2CQ7A 4II3A 1VI0A 4LK1F 1W0UA 3DFGA 3H9JA 1DGRM 2V26A 1U6GA 4RAYA 5FO5A 3BPVA 2JPCA 3OYMA 4NQWA 3RZDJ 3W6VA 4NDLA 3KP7A 2QQBA 2QZ8A 5ERIA 2H1KA 3ECOA 2OTLI 5J47A 4Y52J 4UXNA 4M3BA 3FDYA 4BY7J 1DP7P 5LHGA 2IJLA 3VYUB 3WHBA 2CV2A 3ZQQA 2LF7A 1X1DA 3LSTA 3G1LA 4KITB 2Z99A 2I8DA 2V9KA 1X3WB 1GDTA 2DO7A 3R0JA 2XDVA 3CUOA 4KMUX 1K83J 3R4KA 4D5FA 5E3OA 4OINF 1HCRA 3LFUA 4UUSA 2FXAA 2DOEA 2NOJB 4NHJA 4Q4ZF 3TP3A 1HKTA 1JT0A 3J7YJ 2ACJA 3TMOA 3T8TA 1ZGWA 2LG4A 1NG6A 1RNLA 2E1OA 4R1HA 2VN2A 3FXRA 1X1CA 4DNCA 3WTZA 2NOGA 3CJNA 5ILVA 3A4CA 2DDAA 3ABLH 2KJBA 1LPQA 2XPWA 4CHUA 1GLNA 2XHKA 2OZUA 2RREA 3Q0UA 4IL6C 4XSXF 2W84A 2UWMA 2ZO4A 2L7FP 3GTGJ 3RCOA 3I0TA 3IKTA 2LP0A 3ASNH 1RKWA 1WKMA 2DA7A 2UXNA 3MN2A 2M2EA 2STWA 3H3ZA 2CS3A 1FTTA 4RM3A 3J80K 1QVTA 2DAOA 4KICA 3JRGA 4S0HB 1NK2P 1OISA 3GLXA 1PYVA 1AU7A 4EJTA 1R5HA 4CZCA 2WAQN 3M1EA 2DBBA 3BWGA 1XG1A 2CRGA 1R6RA 3I54A 1I1GA 4R8HA 3FWEA 1BI1A 1OCCH 1F9NA 1TWGJ 1SD6A 2EZLA 3OWTA 4HW0A 3JTHA 3GX4X 3ELKA 3BZ6A 3FXJA 3QRFF 1TL8A 1SAUA 5IOYA 3S17J 1WJEA 4TV7A 1YE9A 5CQEA 4IQ4A 5GAEJ 1MH4A 3FM3A 3K4KA 1JT6A 4WK8F 2Y48A 5LGTA 1E17A 1S7AA 3ZQGA 3SFZA 2VJ5A 3OYIA 2VB6A 3TOBA 5J8FA 5M5YJ 1RC9A 2R3SA 5D4RA 4GYGA 2L9RA 1XCBA 2FQ4A 3OYHA 2WAQA 2HQNA 1KONA 2CU7A 3LSGA 1TQIA 1ZGJA 3FXQA 2JA6J 2PMZN 3H3VK 5HNHA 1BN5A 3TBIA 2R7VA 4I76A 4HNVA 5FLXZ 4J00A 5DS9A 1MDMA 3GTLJ 2FF4A 4HF0A 4GXOA 3WHCA 5L3CA 1SANA 1UFMA 3LA2A 5D8LB 5J6XA 2CWEA 1W36C 5CKTA 1L3LA 1A04A 4F91B 2ZJQF 2OJED 3PIOF 1N78A 1IF1A 1DP3A 3CCUI 3UNGC 2CUZA 3F8BA 4RB1A 3HHHA 2ME0A 2E7XA 1K78A 3QQAA 4XR6A 1VQOI 5E8GA 3FK6A 4LG0B 4KYWA 2DOFA 3KPHA 4PSXA 4HSRA 1R4MB 4IHWA 3T5XA 5B5EC 4XSZF 1PJRA 2Q2EB 2XAQA 3I4NJ 2LD5A 3RIRA 2VC0A 4PJJA 2PMZA 1YO5C 1JJ6C 3RPUD 3E5UA 2KDOA 1AA7A 1AKHB 3JSPA 4D1QA 1VQ5I 1FSHA 3ABMH 1SD5A 1G3WA 2ID3A 1HF0A 3TP0A 5C4XJ 1OFCX 2BVLA 4XKCA 1H88C 1O4XA 2PLYA 3K0LA 3KP4A 2VOPA 2EV5A 5B66C 5FKKA 2L4AA 3K4CA 2GBYA 5F27A 3CF2A 5B1BH 4ANJA 3KEQA 1ULYA 5A2QK 4K2EA 1D1BA 1I3QJ 5C3EJ 1ZLKA 3TQNA 2G7HA 2OF7A 3NRVA 3S14J 4PFOA 3ERMA 5EZHA 1NTCA 3U1DA 4EJVA 3L7WA 2VJJA 1T56A 1YG2A 1BM9A 2TCTA 1B8IB 1DU6A 3A0BC 4G6TB 3FXLA 2F4IA 2YSRA 2Z3YA 3SZPA 1YJWI 1K7AA 3BZKA 4D9JA 3CMMA 2OC6A 4UV8A 4MTEA 2G9WA 1FYMA 3J80Z 1TC3C 1XC5A 3SDBA 3IL2A 3WTSC 3GLLA 3HDDA 2VBZA 3CDIA 3OMYA 1YJ9I 4GGGA 4UB8C 4AIDA 3SHFA 5JHUA 4E7KA 5JLXA 2BZTA 3E1SA 4FQGA 5F0FA 2F6CA 2NNYA 3TO7A 4M3GA 3IC7A 4WXCA 4HNTA 4RAGA 1ETWA 1MMAA 1SAXA 2Y0SN 4IRGA 3EUAA 2Z5UA 3TW6A 4CZZA 2EPFA 1O3RA 2WV0A 4NBQA 3S93A 1W0TA 4B47A 1JKRC 2Z16A 3CCQI 2VQHA 1IN4A 2HPIA 3M4OJ 5E1ZB 2IS4A 1FTZA 4AVPA 1IO2A 4XLEA 4NC7A 1VQMI 3K4BA 3KP6A 4IOCF 4A0YA 4BACA 2ZC2A 2CG4A 4ZZLA 1FEXA 1S5LC 2LBFA 4D0PA 1ONVA 4DBRA 4U0YA 1CGPA 2OBPA 1XSVA 3ZQIA 3N97A 1PUEE 2MLGA 2EFQA 5M5WJ 1J9IA 3BOQA 3P9IA 1BOBA 3KZYA 4JX5A 3HSRA 2HOTA 1A31A 2NVQJ 3V8LA 2VASA 1EKEA 3K2ZA 3ZGKA 1I1SA 4D7MA 3ZP5A 2Y0SA 1W7PD 4BUPA 3OYAA 1OR7C 1LDJA 3FMRA 4XORA 1FMWA 4HNUA 3JSOA 3CCRI 1H8AC 2XGCA 1A35A 3L2CA 4UVAA 4LG0A 3VPRA 3OS1A 3DLLF 3CLQA 1IRZA 5D6FA 5LHHA 4UUTA 1OR7A 4E70A 2ESNA 2KDZA 4IKFA 1S29A 1MJBA 4U7BA 5E1WA 1E3HA 4BJ5C 2KP6A 1RRJA 3KLOA 3OYBA 2K9QA 4ESBA 4Y13A 1RESA 2NAZA 2VKEA 1YX3A 1ZLJA 4A3BJ 4BHCA 5KAFC 1R5GA 4X0GA 1O7FA 3K7AJ 1XN7A 2QM3A 3DLAA 5GAGJ 2NVYJ 5HLTA 3T0YA 1ZAOA 1GT0C 2VQLA 4E4HA 4FE4A 4IHYA 2YX7A 4NB5A 3SDGA 1D8KA 1OKRA 3CDHA 2FOKA 2P5KA 3GCMA 1ZRCA 2E1MB 1JI8A 3CC4I 4Y7NJ 5A2QZ 4F93B 1JKQC 4KDPA 3TO9A 4HOBA 3ULQB 2R7RA 5C44J 2YU9J 2D45A 2OV7A 3OYDA 1BBYA 4I09A 4BE1A 1OJLA 2R7ZJ 1IGNA 1H0MA 1LE8B 3MD2A 1BR4A 3M07A 1FJLA 1KU7A 1IAWA 2K3PA 4LGWA 1MH3A 3RJPA 4XRSG 4EVIA 1QVUA 1YJNI 2DODA 2HYJA 1XB4A 1ZR2A 3AL0B 2AQEA 3CESA 2A6EF 1IZ1A 3QPSA 4HRIA 2XGXA 4CCMA 2PJRB 3OY9A 3S2DJ 3DCFA 3VDXA 1ZHFA 3ZQLA 2VE9A 2XIGA 4FCYA 2R7DA 1ZN2A 4MIMA 1PP7U 3J7ZI 2JK3A 2R7XA 2BY0A 1E3PA 1EA3A 2K85A 3ROUA 3IH2A 4WCGA 4BDYA 1FP2A 1ETYA 2COMA 2QVOA 4UB6C 5BQTA 4LITA 2JA8J 5DUKA 3G3ZA 4U0VA 1B6AA 4ZTJA 1WI3A 3RI4A 1BC7C 3ZCOA 1RR8C 2KIUA 3F6OA 3E6MA 3MQ0A 3TO6A 4KUMA 5IP6A 4A3JJ 2GZWA 3WG9A 1FP1D 2QENA 4OWRB 4A3EJ 1YI2I 4ASNA 4F7ZA 3HHGA 4G6DA 2AS5F 2Q0OA 4BH9A 2O03A 2BOLA 2HFHA 1D5VA 4ZH4F 3KCCA 2MGQA 4HV5A 5KHDA 2LF8A 4JYKA 3DPUA 4IXAA 2A68F 3KYLA 2WB1N 1APLC 2GIZA 1SVOA 1S72I 2IP2A 2W57A 4RAZA 5J1YA 4RB2C 1YLFA 2LY9A 2D1VA 1V4RA 3BROA 3C3WA 3UKGA 5IP7J 1TW3A 4A69C 4A2UA 2E5NA 3L09A 2XVCA 5F08A 3HRMA 3FHZA 1VF9A 4HDUA 4I6ZA 2FBIA 2JTVA 1I27A 2HKOA 2OTJI 4S05A 1VQ7I 3ZOBA 2BY3A 1Y1VJ 1TWHJ 3HUGB 4BXFA 2BY1A 5FKMA 2NXNB 1P92A 3PQKA 1OMIA 5H6QA 3ABUA 4LLGF 4M9XA 3S8PA 2HOAA 3TL4X 4ZDOA 2P5LC 2G0EA 1XDUA 3WTTC 2I5UA 2XKPA 4UVBA 1QZYA 3DWLE 3OOUA 2V1NA 3SFIA 4RDUA 1D8JA 2WBMA 1XGOA 1UCRA 2WB1A 2ECBA 3VYSB 1VFCA 4F3QA 4BEHB 4ZDLA 4CDGA 2HVSA 4Q48A 2FMYA 4EM1A 2HR3A 1HW5A 3BR3A 4LOCA 4XKWA 1D1AA 2IRFG 1HW2A 2M0CA 3S1MJ 1ON1A 3P9KA 1EF4A 3P5JA 1XPXA 5F6FA 4BDZA 4PDKA 1FT9A 3I4PA 5J8CA 4CYCB 4OIOF 1FIAA 4CSWA 3L2UA 3BR1A 4BHBA 2HYGD 3K70D 2OQGA 1IJWC 3GMEA 4A3MJ 3P7NA 5JHFA 3DKXA 4FETA 2KZVA 4U88A 4A3CJ 4EV0A 3VYTB 2DTRA 1BIBA 1BJZA 3BCAA 3QWLA 1G59A 5JR3A 1KU3A 2LRDA 3HRTA 3V8KA 3F23A 1I50J 1ZKGA 3VB2A 2DN0A 4F92B 4V2FA 2QBYA 3IWFA 1BI2A 3EPZA 2P6TA 4XICA 2VOOA 3EUHA 1MBGA 1Z9CA 4GCVA 1P9QC 5EG0B 4N4NB 2DK8A 2X85A 2ISZA 2E19A 4GYIA 1MBEA 3BCBA 4X1EA 4HLYA 2PJRA 1W1WE 2DMQA 5BPIA 2NVXJ 2HOEA 3GWZA 2R0QC 4CA0A 5DD4A 2NVUB 2ZCWA 4MGRA 3EYYA 1HQCA 3ZPLA 3OYCA 2DOAA 2K9NA 2B0LA 3H9QA 2TDXA 2NS0A 4UUSB 4MO7A 2P7VB 2BHYA 3PIPF 2EIJH 4YFNF 1R22A 2PMUA 1OCPA 5FD6A 2BE5F 2HGCA 5HOOA 4U0WA 3PNTA 3D5RC 2QSHX 1U8RA 3TDZC 2A5WA 1R4NB 2JPBA 2IBDA 2VLAA 1LJ9A 4JX4A 4P5OA 4C30A 3HBLA 2YUSA 1Z05A 4ZTFA 4KA4A 2VBXA 3L2QA 1YITI 3M8JA 4PZJA 4MTDA 1F4KA 1CQTA 2V1UA 3LL7A 3LSHA 2V1DA 5ILSA 1WCMJ 5GPCA 3I4MJ 3ABKH 2QEXI 1FOYA 2RGVA 2RC4A 3GVAA 1Z1DA 1MBJA 2CV0A 2E2HJ 4XQFA 5FLVA 2OQRA 2N8GA 2K02A 3LSPA 5GP9A 3BC8A 4WXDA 2XPVA 3DEUA 3GTMJ 3HUGA 2DMUA 1V5FA 2OCEA 1X4OA 4NNJA 2DMTA 2Q1ZB 3I59A 3NAUA 2O7OA 1LDKB 5AIQA 3HOZJ 2HWVA 4O6JA 5D5UB 5KCMA 3QU6A 2B63J 3ISPA 1Y0NA 2HU9A 4EJWA 1SEUA 3OIOA 4XL9A 4BYYA 2V1XA 2QKMB 1Q1HA 1SFKA 5L3GA 3HC7A 4XKVA 2HTSA 3OYNA 4BEHA 3K4MA 1MIJA 3QP6A 2LC2A 1NH3A 9ANTA 3OSFA 3V42A 4IRIA 4OAZA 5IT9K 1IDYA 3I53A 5ICEA 2QUFA 3E3VA 3WTWC 1V5EA 3OL4A 3RZOJ 1J09A 3JAMK 3W2AA 4IRHA 2OPTA 1TW2A 1K61A 2MW8A 1TWCJ 4OOIA 5EF6A 2KL4A 4CYCA 4DZJA 1AOYA 1R71A 3ZMVA 4AM3A 3BTIA 2ZXIA 2DDBA 3RKYA 5EZGA 3S32A 5HLGA 4PK4A 5DM6F 3VSKA 2CQKA 1XMXA 3HGYA 3B73A 1MDMB 4BQAA 1TBXA 1F43A 3CZ6A 3RQ4A 3EETA 3CCJI 3J81K 4OIQF 1X58A 1M1EB 1K6YA 2ESHA 3EDPA 1E3OC 5FKOA 2FSWA 2X6OA 2HS5A 3H3UA 2B9SA 5EG0A 1JHFA 3CCVI 2L2OA 4W97A 1RUOA 3D1NI 2X0LA 1K78B 1K4SA 4ON0A 2KFDA 3JREA 2XAJA 5FD5A 2H09A 3BTLA 2LOOA 1TQPA 5HDKA 3E0JB 2E1CA 3C18A 2IT0A 4RAFA 1FBSA 2LKPA 3GTJJ 4JQFA 3Q5FA 5CQGA 2E2IJ 4CUGA 2ZXWH 5IT3A 2R5YA 4E7IA 4L9VA 5GPAA 4ENMA 1JJ8C 2PEXA 2HYFA 2O6GE 5CLSA 2GXAA 3FK7A 3AAFA 4J19A 2KRCA 3A0HC 1UHMA 2KT0A 1XTAA 1VQ9I 1GXQA 2L0KA 5J4VA 4I02A 3K4JA 1X1BA 5EYRA 1R1UA 2WC2A 3JRFA 4HX8A 1Z67A 3JCUC 2VBYA 5E3MA 3BR5A 5HS8A 4YIFA 2UUZA 3C1DA 4EEFG 2Y2ZA 4M6XA 2XGDA 3HPGA 4XLAA 2Y31A 4Z2YA 2DTZA 4E7ZA 1Y8RB 4I0BA 4Z6YA 2X6WA 4BE2A 1U78A 1JUPA 4F52A 5FRMA 2LVSA 2FEZA 2HEOA 2WTEA 2FRHA 2HTJA 3CQZJ 1X2NA 2DA5A 4G94A 5B3SH 2M34A 3BJAA 4IQJA 1Z21A 1YTYA 4XIDA 3HSFA 2EIMH 1MSFC 1ZG5A 5LFAA 1SD7A 4BJ6C 2RN7A 4I7HA 2FNAA 5DM7F 2PMHA 4N4OB 3O8HA 1XDSA 3JW4A 4EMSA 3S3MA 5DCMA 4CCLA 2HI3A 3OIQA 1ZGAA 4DBQA 2M3AA 1B72A 2L4MA 2JUGA 5F1RA 1WJ5A 1ZG3A 1BW6A 2P4WA 2E36A 3Q0VA 2O0YA 5ILUA 2P0WA 3HOTA 3OSGA 3BR6A 1B1BA 3MMYB 3WGHA 3HSEA 2ZXJA 2R93J 1EH6A 2BEOA 3ZQCA 5IP9J 1F5TA 2F5DA 3WU1B 1TT5B 3VODA 2EJRA 3PFYA 2JA5J 5CVVA 3JAMZ 1SFXA 4MQVA 4GO1A 3I56I 3DBRB 5FGMA 1ZK8A 2LBFB 3KZZA 2BYVE 3CMEI 1Z77A 2K9MA 2DA3A 1JHHA 3FXMA 4E7JA 3J7AO 4XN3A 3U21A 4M72A 2HDDA 1ETOA 4B48A 1GV2A 3FMSA 4HDVA 4CGZA 5E8IA 1Q1VA 1XGMA 1A5JA 3J81Z 2A61A 3DQVC 1RI7A 2CQNA 5IYBJ 4ZYAA 2RQPA 4I98B 4AYBN 1T2KA 3MZ8A 2XPUA 5FJ8J 1FYKA 3BLYA 5CVRA 1VQKI 4XLFA 2M8EA 2DT7B 2NRAC 3IRRA 4M9SA 3LNQA 4CCOA 1UELB 4QPQA 3PNVA 1UG2A 3W6JB 2ZJRF 4UV9A 4M6VA 2YX4A 3HTUA 4RGXA 2V4JC 5H2FC 2L01A 3OYLA 4OIPF 4L0ZB 3HRSA 4EQQA 4LB6B 1QNTA 1RIOH 2FJ1A 3BG3A 1MW7A 3IAS2 2ADUA 2FUG2 1EH7A 1Z3XA 4YRVA 3O3KA 2WY7Q 4BJTA 3I9V2 1XGNA 2RV8A 1JE8A 2BV6A 2OCCH 2VC1A 1G3YA 2LFBA 3IUOA 4IPAA 2W25A 4AYBA 4M74A 5L3FA 3ZQFA 1TWAJ 3K1PA 5CVJA 5FROA 4DZPA 3PJRA 1LB2A 2E5ZA 1QPIA 1IN5A 1P7JA 2VT2A 2XROA 1Y8QB 2X9DA 4UY8I 4YFKF 1WJAA 2P7CB 2LLKA 1WFXA 3FBNB 2JA2A 2DA6A 2F5EA 2P6SA 3M8FA 1ETVA 2HOSA 1W5CC 3BJOA 3BR2A 1B4AA 4M6YA 1FBQA 4IZZA 3F8FA 1WJFA 3AG2H 2UXXA 2GQQA 2QQ8A 1U9NA 3GZ5A 5K7FA 2O5RA 4QPOA 2XF5A 5GAHJ 4G9YA 4XK4A 2YR2A 1ODDA 4XONA 3OL3A 3FXUA 2FBKA 4E7HA 1MBFA 1QGPA 3L2VA 4KFCA 3JRBA 2XAHA 5LHIA 1STZA 2ICWG 1U3EM 2IPQX 3V7CA 4RLQA 3TDUC 5BMZA 4CICA 1HC8A 3QP5A 2M87A 1IXSB 2GXGA 3S2WA 1KQ0A 4KN4X 4ETSA 3RYPA 3CO7C 1IN8A 3JR9A 2XSJC 3H1CA 2ZMEC 1UAAA 2H8RA 3A2KA 2BW3A 1R9TJ 1Z0XA 1MD0A 3TEDA 1QQIA 4B3XA 5K7HA 1FPQA 3E7LA 4LG3A 5HLHA 2MABA 5D5XB 2QLZA 1ZTRA 1P2FA 3R6SA 3WODF 2PG4A 3KYDB 4BHPA 1X4PA 2CGPA 2HZTA 1WI9A 2DPUA 1D3YA 4PSWA 2W24A 3QYBA 3T1BA 1XSXA 3IWZA 1SVMA 5K5OA 2HXIA 1KGSA 2DA1A 3SJMA 2ME6A 1MNMC 1YW9A 2NS7A 2CUFA 3SQNA 3MCZA 5EEAA 1IXRC 1ZG1A 4QIWN 2Z33A 5M3FJ 1O3QA 4XRSA 1RZ4A 1BW5A 5DYMA 1DUXC 1D1CA 3HRUA 2QSGX 4CYDA 1U2WA 4NUBA 2OD5A 3PO3J 1TTYA 1A6QA 2KQRA 2L7KA 4M71A 3V8JA 2KIQA 1A6IA 2YU3A 3V4GA 3LSRA 4HSTA 3ZQHA 5ICFA 3OOPA 2M8GX 4C3IJ 4IEJA 3ZMSA 3L1PA 5EGOA 2DQRA 3MZHA 4NC6A 4RBOA 2MC3A 3BG7A 1LEAA 5DDGA 2R7WA 1WVRA 1W36D 1UJ8A 3TOAA 1X19A 4PJNA 2J5OA 4M3DA 2MYSA 4RS8A 3DEEA 4O3MA 1FSEA 3O2PE 1I39A 4IHTA 1UMQA 3WTVC 3RKQA 2VODA 4M9ZA 1IUYA 3DTKA 2HQ5A 2LSOA 1PP8F 3W2WA 4XRMA 1R49A 4LB5A 5IOZA 1IN6A 3MZYA 2CQQA 3Q3SA 1VQ6I 2BVMA 3SEQA 4RGUA 5E17F 2FD5A 2X51A 5FFZA 2A69F 2PJPA 2HKXA 2W1OA 4HX4A 2QBYB 4DYQA 4Q5SF 4Y3OA 3CMAI 3DP7A 2Y9ZA 3GBGA 3BG9A 4ESFA 1AHDP 4F55A 3A01A 4UNOA 2X4HA 3LSKA 4H0EA 1HKSA 4BXUA 2OU2A 1BL0A 3C2GA 3FKJA 3K9TA 1FLIA 4ENNA 3G73A 3WGGA 1IV8A 3HOVJ 1R7JA 2DCEA 2EA2A 4ABZA 5IYDJ 1FYLA 3C7JA 2MD5A 1YIJI 1G3SA 1HDDC 1P4WA 2B7EA 4BNCA 4ENKA 4KN7X 3ML6A 4UHTA 5FKNA 4KIFA 3BT9A 1S8NA 2L9NA 4IHVA 1WZ2A 3FHNA 4WXHA 2M7AA 1DDNA 3PO2J 4H4KC 2AO9A 4DYRA 3H0DA 4OMYA 1U5TC 3U9GA 4WX9A 4XLCA 3LAPA 1KYWA 3F8NA 3OIPA 2CH0A 1UHWA 1XSDA 1FMVA 1OLTA 1OQYA 2EZHA 1SD4A 1TLHB 2HNHA 4AWXB 3IHUA 1X1PA 1YRNA 2X6YA 3VSLA 2HQRA 4G7HF 1RUNA 1GXPA 2H27A 1T0FC 1U5TA 2HDCA 4QWQA 5F0HA 1PVEA 5K1YA 2ECCA 1G2HA 5IY5H 1MMGA 2DJNA 4Y17A 2D2WA 3REOA 3F22A 1SVLA 1P4XA 5DTDA 2XUBA 1MMDA 3HEFA 2H94A 3GFIA 5CVIA 4A5NA 1ERDA 4XOTA 2ZJPF 2M7BA 2DQLA 2NVTJ 5BPDA 1T0FA 2E7WA 1OYYA 1V55H 1PUFA 5HLIA 4B8XA 1FZPB 3I59B 5TGTA 3V7SA 2CW8A 4E7SA 4XM3A 1X3ZB 2VXZA 3FM5A 1TWFJ 2ZSIB 5AIPA 4QSHA 3S1RJ 3GTOJ 4L9NA 1WJBA 2DU9A 3MKYB 3HYIA 1SFEA 1Z7LA 2EINH 4P9FA 5DCFA 1HLVA 1S7OA 2EFOA 4KNYA 1G3TA 1XMKA 4C2MJ 1BR2A 2DK5A 2EILH 2IVMA 4DYCA 3R0AA 5EDNA 2QYOA 2K40A 3S3OA 3JRAA 4EM2A 4JBAA 2Y75A 5C4JJ 5IPAA 3HOSA 3BPXA 3A1YA 1LUJB 3GUDA 3F3XA 2GOXB 1ZRFA 2VI6A 1ITYA 2GLOA 5ED4A 1WJDA 2O8XA 2Z2SB 3GFMA 1R1TA 3CJQB 1Z7UA 3C2HA 3GEZA 1KA8A 3HOXJ 2XGEA 1LFUP 4RMNA 1OCTC 5BNGA 1J0RA 1IG7A 1P4AA 4YFXF 2V7FA 5DV5A 2ZB9A 4E6KG 3HKZN 1ZRDA 2VKHA 1FC3A 3UR3C 2Y30A 2PX9A 4CCKA 2PBIA 1T33A 2XC7A 1Y0UA 2V9PA 2VJIA 3D5LA 5HVQC 4W1UA 3GW2A 1T8IA 2IGOA 3K4NA 5FB2A 1ZREA 3S2HJ 3GO5A 1JGSA 5CYVA 4RB3C 4II2A 3OR2C 3PSIA 3KETA 4ENJA 1S9HA 2HZDA 2Y0MA 3I5UA 4AVZA 4U7DA 2Z1DA 2EV6A 3MKZA 2C6YA 3QYEA 1MJAA 2E35A 3G4SI 3Q9VA 3GXOA 2R5YB 3F8MA 1FOXA 4Y33A 3B02A 3I71A 4XBFA 2DFIA 2R5ZA 4HX7A 4ZJZA 2JJ7A 3K69A 4G7OF 1WJCA 4FTHA 1SC7A 2QWWA 3RTRA 3LSJA 1YHQI 2O3FA 3O8GA 5H20A 4IHSA 3HKZA 2JSPA 3H36A 1FX7A 2M4GA 3HB9A 3RSNA 3VYRB 1D0YA 1MNDA 2P5VA 1HSJA 5HDNA 2QA4I 2EZKA 2R7OA 3FISA 2LKSA 2M1BA 4BL0B 2R7SA 3HXLA 2PQ8A 4BBRJ 1I6HJ 5F1JA 3OYKA 2JRTA 2W7NA 5FLMJ 3F8CA 4AC0A 1VTNC 3HL2A 2CW7A 1NHAA 3PL8A 2RKHA 3C2BA 3WGIA 2CMPA 2R7FA 1S7EA 4XKBA 2GAUA 4PFPA 3I58A 3SYTA 3FIWA 3HG9A 3U2RA 3LA3A 1ZR4A 4EATA 1VQNI 2VUMJ 4ZYHA 2IS2A 1ZYRF 3ECHA 3ESWB 1YS6A 3M7GA 3MVPA 2GXBA 3PSFA 2K27A 4BE0A 5J1UA 3TW7A 1T39A 3WU2C 3GF2A 4A3FJ 3OS0A 1R00A 4KMFA 5DCMB 5LEKA 2OUMA 4PUSA 1B72B 2BY2A 3FX3A 4M3EA 3KP3A 3HOUJ 2COBA 2A6HF 2RNJA 1GUUA 1FY7A 3E6DA 5JVTA 2W82A 1IDZA 2L7MP 2O8KA 1HA8A 1OPCA 3HZJA 2R7TA 1USSA 3BQZA 3LQQA 4B3AA 2IXSA 5DUIA 1ETQA 4LLLA 2IAIA 5KAIC 1V54H 5HNFA 5E3LA 3DKWA 3OYJA 3DBHB 1H9TA 3H9GA 2KLOA 5ICGA 3HPHA 2KKOA 2YPRA 3ZMZA 2STTA 2CQXA 5LLQA 2DFFA 3L9FA 2AXTC 1I3AA 2VT3A 2DT5A 2F5VA 2FE3A 4RM2A 1O7LA 2NNNA 1LNWA 2EA4A 2L02A 1XMAA 1MBKA 2BXYA 1T08B 1DQUA 3E5XA 2QQ9A 1MNEA 1Z3YA 3RPQA 2GOMA 4EJUA 1N25A 4RB0A 2KRHA 1YW7A 3H5RA 1TZLA 4WWCA 5TRDA 1WH5A 2A6TA 1EH8A 1A36A 2EK5A 5CJ9A 3KIOA 2W85A 5CVUA 3D5SC 1YOVB 3BZCA 3O6BB 1UG0A 1WWXA 3CLOA 3M9AA 4MQ9F 4L9TA 2M0MA 1U0JA 2W4SA 4MFDA 2LNBA 2JWTA 4LIUA 2CSOA 2QQAA 1KYZA 3W3CA 3LSMA 4ITVA 3CF5F 2MD0A 3MWMA 2LMDA 3CUQC 3RPUA 3ZXSA 1MJ9A 1HOMA 5J3LA 2KMUA 1WGXA 1F36A 4Y4RA 3DKYA 3PNYA 4DIQA 1U9OA 3CC2I 2L54A 3CUQA 1J2XA 2HDWA 1E0EA 1L0OC 4FX0A 2XSDC 2IA0A 4A3GJ 2IGNA 4IHXA 1MMSA 1YYVA 2F4OB 4IX7A 4ZYEA 4DQ2A 3ERED 2DMPA 1EJ9A 1JTXA 2GA2A 1Y56A 1TT0A 4GDFA 2OAZA 4AU7A 4MEYF 3IV5A 2JT1A 3G6EI 4O5VA 2AQFA 2GIVA 5HS9A 3G2BA 3ZMDA 5K5QA 3QU3A 3L2RA 2R7QA 3H35A 3IH3A 1ZARA 1VQPI 4C3JJ 1QO0D 2VQGA 3TKYA 5IYCJ 2HXOA 1T38A 3LOCA 5EEHA 3BY6A 4HAMA 5JI6A 1R1VA 3K2AA 1ORKA 2L3DA 2LTPA 2XV4S 2Q8KA 2RNGA 2F48A 1MSEC 1J5YA 4RGSA 3S3NA 1ZELA 2ELJA 4OMZA 2WY8Q 2DFHA 2IW5A 2LH9A 3CP2A 5B1AH 2M4KA 3CC7I 2IS6A
chains in the Genus database with same CATH topology
1XCVA 3LA7A 1KU9A 4P96A 5IT9Z 4I0AA 4MEXF 1BC8C 3VEPA 1B9NA 3OV8A 2H6BA 2V9VA 4MHGA 3ZQ7A 5D5VB 1HXDA 2ZMEB 1R36A 2A3SA 3DF8A 4L9JA 4CO8A 3MFKA 1IN7A 2PI0A 2CFXA 3ZMUA 1ZH5A 4A6DA 4AIJA 1W4MA 3SXYA 3TGNA 3GZ6A 1BIAA 3CO6C 1Z91A 1TQMA 4P55A 4EJOA 4A5MA 1HKQA 3EQLF 1W7PA 1LQ1A 2K4BA 1KQ9A 4ZYGA 3ZMTA 5HS7A 1C0WA 2K86A 5HDGA 1YFHA 1XD7A 1IXCA 4IJAA 4EGZA 1O3TA 2FU4A 3K1NA 1V3FA 1X3UA 2DPDA 1WRJA 4XRFA 1WQ2A 5TJJA 4G6QA 3SZTA 3KP2A 4M73A 3BDDA 5LGNA 5BOXA 2D1HA 3QOPA 4G8XA 3F6VA 4HQEA 3GFJA 2H6CA 1JXSA 2XKOA 4IVNA 1G4DA 4RGRA 2JZYA 1J59A 1HSTA 3M8EA 1UB9A 5LGUA 3QAHA 4CXFA 1IRGA 4QLCU 2VONA 4KIGA 1LDDA 2P8TA 2AXLA 4HLXA 1EV7A 3VOEA 2IA1A 4FX4A 1S3JA 2VBWA 3KFWX 4G7ZF 4YIIA 2EFWA 1CF7B 3QPTA 2EB7A 1IW7F 4PCQA 1PDNC 1FBUA 3LAJA 1K6OA 1FOKA 3CTAA 1R58A 4BAYA 5E1XA 4Q47A 2M45A 5E20A 2ZMEA 4LK0F 2V6CA 2JSCA 4LLNA 3PFIA 1SMTA 1U5TB 1BI0A 3H92A 1W5TA 3ZN1A 1REPC 3E6BA 1ON2A 1G6NA 3HIFA 2VE8A 1BOAA 2BGCA 4OIRF 4LFUA 3WU0A 3LWFA 3T8RA 4ZYDA 1T6SA 3KLNA 1TNTA 1MKMA 1BJAA 2IA2A 2CO5A 4XLNF 2K7LA 2DI3A 5KK1A 1O3SA 2Q2EA 3K1MA 4KIBA 1WSUA 2FMLA 1KU2A 4AD9A 2KIFA 1KQ8A 5JFRA 2ZFWA 4PGGA 2XASA 4HF1A 1QPMA 1P6RA 2NYXA 4HF2A 2EFNA 1F1ZA 4L5IA 4IF4A 2M30A 4I01A 4UVCA 1FWZA 3DV8A 5LBQA 4N0BA 2MH2A 5D5WB 4ESJA 4HA8A 4P9UA 3GFLA 2ELHA 4UUVA 4A12A 4A0ZA 3E6CC 1CF7A 3FF5A 3WTYC 5DEQA 5L3BA 1QBJA 4FT8A 4N9HA 1YQAA 1AWCA 3RKWA 1T98A 3JTGA 1J75A 1MGTA 2XAGA 4HQMA 3DPLC 3R60A 1Z6RA 1XGSA 3F72A 3RYRA 2A5YB 4HBLA 2G7UA 3L00A 5D8KB 1B9MA 5K5RA 3E5QA 5DD8A 5ICCA 3W6KB 4LD5A 2EFPA 3KE2A 1LEBA 3RKXA 1BI3A 4S04A 4N9IA 2FBHA 2Z9OA 1S6LA 2RVCA 3QPHA 2FA5A 3COAC 1YIOA 2PN6A 2XAFA 1HBXG 2BBYA 3BP8A 2FNPA 5LRRA 4EM0B 4ZZDA 3NQOA 2CW0F 4WF2A 5E18F 3WTUC 1FNNA 1IRFA 2F2EA 1W5SA 2F5CA 3PQJA 2ZNZA 5H6RA 3D0SA 2XRNA 4L18B 3BJ6A 5FFXA 4EGYA 3ABTA 1B59A 4MNUA 4L0YB 4HV6A 1LVAA 3EYIA 1OYIA 2ETHA 1R23A 2J5PA 3F21A 1H9GA 2DLLA 1YS7A 1O57A 2OZ6A 4B09A 2ZNYA 4YG2F 3V7RA 4HYEA 4A6EA 2CYYA 3MAJA 1TNSA 5D4SA 1YW8A 3IRQA 3RDIA 5D6EA 3E97A 3NEUA 2EWNA 1Z6TA 3DPTA 3CUQB 2ZKZA 3VFZA 2O61A 6PAXA 2PFBA 2KIMA 1I5ZA 3N4MA 2ZJ2A 1SFUA 1MZBA 3DXJF 2ISYA 5AONA 1J7KA 2UZKA 2KRFA 4Y15A 4A0XA 2RDPA 4KT5C 5L3EA 4JK1X 2KJCA 2M5WA 5LEJA 3KEOA 1GHCA 3FMQA 5KVRA 5BS6A 1HW1A 5F64A 3Q9SA 3GYHX 3LQRA 3WTXC 2WWYA 4PGHA 2MH9A 2GA1A 4R79A 2DW4A 3IKVA 2ZBKA 3I64A 3WE3A 3KP5A 5EEGA 2V79A 3R61A 1I6XA 2OA4A 4I2OA 2F5FA 3FZVA 2LDUA 3HTSB 2MA3A 2GWRA 3ZN0A 2K4JA 4AIHA 3MEXA 4XLPF 2MLKA 2FQ3A 4L5JA 2MBFA 4HZFA 4AIKA 1USTA 1QZZA 1OYWA 3LFKA 2EV0A 1K79A 4FHTA 2E1NA 1E2XA 1DPUA 4OU0A 1DPRA 2A07F 1W7PB 5FLXK 5LRSA 1GVJA 4LMYA 1SMYF 3WE2A 4LJZF 5L3DA 3P9CA 4LK1F 3DFGA 4RAYA 5FO5A 1U6GA 3BPVA 2JPCA 4NQWA 3KP7A 2QQBA 2QZ8A 5ERIA 3ECOA 4UXNA 1DP7P 5LHGA 2IJLA 2LF7A 3LSTA 2Z99A 2DO7A 3R0JA 3CUOA 4KMUX 3R4KA 4OINF 2FXAA 4NHJA 4Q4ZF 1HKTA 2ACJA 3T8TA 1RNLA 4R1HA 2VN2A 3FXRA 4DNCA 3WTZA 3CJNA 5ILVA 2KJBA 4CHUA 2XHKA 2OZUA 4XSXF 2UWMA 2W84A 2ZO4A 3I0TA 3IKTA 1WKMA 2UXNA 2STWA 3H3ZA 3J80K 2DAOA 4KICA 3GLXA 4EJTA 1R5HA 3M1EA 2DBBA 3BWGA 3I54A 1I1GA 4R8HA 3FWEA 1BI1A 1F9NA 1SD6A 4HW0A 3JTHA 3GX4X 3ELKA 3BZ6A 3QRFF 4TV7A 3FM3A 4WK8F 2Y48A 5LGTA 1E17A 1S7AA 3SFZA 3TOBA 5J8FA 2R3SA 5D4RA 4GYGA 1XCBA 2HQNA 1TQIA 1ZGJA 3FXQA 1BN5A 5FLXZ 1MDMA 2FF4A 4HF0A 4GXOA 5L3CA 1UFMA 3LA2A 5D8LB 5J6XA 2CWEA 1L3LA 1A04A 1IF1A 3F8BA 4RB1A 3HHHA 2E7XA 1K78A 5E8GA 4LG0B 4KYWA 3T5XA 4XSZF 2XAQA 3RIRA 2VC0A 1YO5C 3E5UA 3JSPA 1FSHA 1SD5A 1G3WA 2PLYA 3K0LA 3KP4A 2VOPA 2EV5A 2L4AA 3KEQA 1ULYA 5A2QK 4K2EA 1ZLKA 3TQNA 2G7HA 3NRVA 3U1DA 4EJVA 3L7WA 1YG2A 1BM9A 2YSRA 2Z3YA 3SZPA 1K7AA 4UV8A 4MTEA 2G9WA 1FYMA 3J80Z 3IL2A 3WTSC 2VBZA 4GGGA 3SHFA 5JHUA 2NNYA 3TO7A 3IC7A 4WXCA 1SAXA 4IRGA 4CZZA 2Z5UA 1O3RA 2WV0A 1IN4A 5E1ZB 4AVPA 3KP6A 4A0YA 2CG4A 4ZZLA 4D0PA 1ONVA 4U0YA 1CGPA 2OBPA 1XSVA 3N97A 1PUEE 2MLGA 2EFQA 1J9IA 3BOQA 3P9IA 3KZYA 3HSRA 3V8LA 3K2ZA 1I1SA 3ZP5A 1W7PD 1LDJA 3FMRA 3JSOA 3L2CA 4UVAA 4LG0A 5D6FA 5LHHA 1OR7A 4E70A 2ESNA 1S29A 1MJBA 4U7BA 5E1WA 3KLOA 4ESBA 4Y13A 2NAZA 1ZLJA 4BHCA 1R5GA 1O7FA 1XN7A 2QM3A 3T0YA 1ZAOA 2YX7A 4NB5A 1D8KA 1OKRA 3CDHA 2FOKA 2P5KA 1ZRCA 5A2QZ 4KDPA 3TO9A 4HOBA 3ULQB 2D45A 1BBYA 4I09A 1H0MA 1KU7A 1IAWA 4LGWA 3RJPA 4EVIA 1XB4A 2A6EF 1IZ1A 2XGXA 1ZHFA 2VE9A 2XIGA 2R7DA 1ZN2A 1PP7U 3ROUA 4WCGA 1FP2A 2COMA 2QVOA 5BQTA 5DUKA 3G3ZA 4U0VA 1B6AA 3RI4A 1BC7C 2KIUA 3F6OA 3E6MA 3MQ0A 3TO6A 4KUMA 2GZWA 3WG9A 1FP1D 2QENA 4ASNA 4F7ZA 3HHGA 4G6DA 2AS5F 2Q0OA 4BH9A 2O03A 2HFHA 1D5VA 4ZH4F 3KCCA 4HV5A 2LF8A 4IXAA 2A68F 2IP2A 2W57A 4RAZA 4RB2C 1YLFA 2D1VA 1V4RA 3BROA 3C3WA 1TW3A 4A2UA 3L09A 2XVCA 3HRMA 3FHZA 4HDUA 2FBIA 2JTVA 1I27A 2HKOA 4S05A 1P92A 3PQKA 1OMIA 5H6QA 3ABUA 4LLGF 4M9XA 2P5LC 1XDUA 3WTTC 2XKPA 4UVBA 1QZYA 1D8JA 1XGOA 1UCRA 4CDGA 4Q48A 2FMYA 4EM1A 2HR3A 1HW5A 2IRFG 1HW2A 1ON1A 3P9KA 5F6FA 4OIOF 4PDKA 1FT9A 3I4PA 5J8CA 4BHBA 2HYGD 2OQGA 3P7NA 4U88A 4EV0A 2DTRA 1BIBA 5JR3A 1KU3A 3HRTA 3V8KA 3F23A 3VB2A 2QBYA 3IWFA 1BI2A 2VOOA 2P6TA 3EUHA 1Z9CA 4GCVA 2DK8A 2ISZA 4GYIA 4HLYA 5BPIA 2HOEA 3GWZA 5DD4A 2ZCWA 4MGRA 3EYYA 1HQCA 3ZPLA 2B0LA 2TDXA 2NS0A 2P7VB 4YFNF 1R22A 2PMUA 5FD6A 2BE5F 2HGCA 5HOOA 4U0WA 1U8RA 3TDZC 2JPBA 1LJ9A 4P5OA 1Z05A 4KA4A 2VBXA 4MTDA 4PZJA 2V1UA 1F4KA 2V1DA 5ILSA 2RGVA 2RC4A 3GVAA 1Z1DA 2OQRA 2K02A 4WXDA 3DEUA 3HUGA 3I59A 5AIQA 1LDKB 2HWVA 4O6JA 5D5UB 3QU6A 3ISPA 4EJWA 4BYYA 2V1XA 1Q1HA 5L3GA 2HTSA 3QP6A 5IT9K 4IRIA 5ICEA 3I53A 2QUFA 3E3VA 3WTWC 3JAMK 4IRHA 1TW2A 4OOIA 1AOYA 3ZMVA 3RKYA 5HLGA 2CQKA 1MDMB 3B73A 4BQAA 1TBXA 3EETA 3J81K 4OIQF 2ESHA 3EDPA 2FSWA 2HS5A 3H3UA 1JHFA 1RUOA 2X0LA 1K78B 4ON0A 2XAJA 5FD5A 2H09A 1TQPA 5HDKA 2E1CA 3C18A 2IT0A 1FBSA 2LKPA 4JQFA 3Q5FA 5IT3A 4L9VA 4ENMA 2PEXA 2HYFA 2O6GE 5CLSA 3AAFA 1UHMA 1GXQA 4I02A 1R1UA 2WC2A 4HX8A 2VBYA 5HS8A 4YIFA 3C1DA 4M6XA 4Z2YA 4I0BA 1U78A 2FEZA 2HEOA 2WTEA 2FRHA 2HTJA 4G94A 3BJAA 1YTYA 3HSFA 1ZG5A 1SD7A 2RN7A 4I7HA 2FNAA 2PMHA 1XDSA 3JW4A 4EMSA 5DCMA 1ZGAA 2L4MA 5F1RA 1ZG3A 2P4WA 2O0YA 5ILUA 3HOTA 1B1BA 3WGHA 3HSEA 2ZXJA 1EH6A 2BEOA 1F5TA 3WU1B 2F5DA 3VODA 2EJRA 5CVVA 3JAMZ 1SFXA 4MQVA 4GO1A 5FGMA 3KZZA 2BYVE 1JHHA 3J7AO 4M72A 4HDVA 3FMSA 4CGZA 5E8IA 1XGMA 3J81Z 2A61A 3DQVC 1RI7A 2RQPA 4I98B 1T2KA 1FYKA 5CVRA 2M8EA 2NRAC 3IRRA 4M9SA 3W6JB 4UV9A 2YX4A 3HTUA 4RGXA 2L01A 4OIPF 4L0ZB 3HRSA 4EQQA 4LB6B 1QNTA 1RIOH 2ADUA 1EH7A 3O3KA 1XGNA 2RV8A 1JE8A 2BV6A 2VC1A 1G3YA 4IPAA 2W25A 4M74A 5L3FA 3K1PA 5CVJA 1LB2A 1IN5A 2VT2A 2XROA 4YFKF 2P7CB 2F5EA 2P6SA 3M8FA 3BJOA 1B4AA 4M6YA 1FBQA 3F8FA 2UXXA 2GQQA 3GZ5A 4G9YA 2YR2A 1ODDA 3FXUA 2FBKA 1QGPA 4KFCA 2XAHA 5LHIA 1STZA 1U3EM 2IPQX 3V7CA 3TDUC 5BMZA 4CICA 3QP5A 2M87A 1IXSB 2GXGA 3S2WA 1KQ0A 4KN4X 4ETSA 3RYPA 3CO7C 1IN8A 1MD0A 1QQIA 1FPQA 5HLHA 5D5XB 2QLZA 1P2FA 3R6SA 3WODF 2PG4A 4BHPA 2CGPA 2HZTA 1WI9A 2DPUA 1D3YA 2W24A 3T1BA 1XSXA 3IWZA 5K5OA 1KGSA 1YW9A 3SQNA 3MCZA 1IXRC 1ZG1A 2Z33A 1O3QA 1RZ4A 5DYMA 1DUXC 3HRUA 4CYDA 1U2WA 2OD5A 1TTYA 4M71A 3V8JA 2YU3A 3V4GA 5ICFA 3OOPA 3ZMSA 2DQRA 3MZHA 2MC3A 1LEAA 5DDGA 3TOAA 2J5OA 4RS8A 4O3MA 1FSEA 3O2PE 4IHTA 3WTVC 2VODA 4M9ZA 1IUYA 2LSOA 1PP8F 4LB5A 1IN6A 3MZYA 4RGUA 5E17F 5FFZA 2A69F 2PJPA 2HKXA 4HX4A 2QBYB 4Q5SF 3DP7A 4ESFA 4UNOA 2X4HA 4H0EA 1HKSA 4BXUA 2OU2A 3K9TA 1FLIA 4ENNA 3G73A 3WGGA 1R7JA 2EA2A 1FYLA 3C7JA 2MD5A 1G3SA 1P4WA 4BNCA 4ENKA 4KN7X 3ML6A 4UHTA 4KIFA 1S8NA 4WXHA 1DDNA 4OMYA 1U5TC 3U9GA 4WX9A 3LAPA 1KYWA 3F8NA 1UHWA 1XSDA 1SD4A 1TLHB 4AWXB 3IHUA 2HQRA 4G7HF 1RUNA 1GXPA 2H27A 1U5TA 2HDCA 4QWQA 5K1YA 4Y17A 3REOA 2D2WA 3F22A 1P4XA 2XUBA 2H94A 3GFIA 5CVIA 4A5NA 2DQLA 5BPDA 1T0FA 2E7WA 1OYYA 5HLIA 4B8XA 1FZPB 3I59B 3V7SA 2VXZA 3FM5A 5AIPA 4L9NA 2DU9A 3HYIA 1SFEA 5DCFA 4P9FA 1S7OA 2EFOA 4KNYA 1G3TA 1XMKA 2DK5A 2IVMA 3R0AA 2QYOA 4EM2A 4JBAA 2Y75A 3HOSA 3BPXA 3GUDA 3F3XA 1ZRFA 5ED4A 2O8XA 3GFMA 1R1TA 1Z7UA 3GEZA 1KA8A 1J0RA 1P4AA 4YFXF 5DV5A 1ZRDA 1FC3A 2PBIA 1Y0UA 3D5LA 5HVQC 3GW2A 1ZREA 5FB2A 3GO5A 1JGSA 5CYVA 4RB3C 3KETA 4ENJA 3I5UA 2Y0MA 4U7DA 2EV6A 2C6YA 1MJAA 3Q9VA 3GXOA 3F8MA 3B02A 3I71A 4XBFA 2DFIA 4HX7A 3K69A 4G7OF 2QWWA 3RTRA 4IHSA 2O3FA 5H20A 1FX7A 2P5VA 1HSJA 5HDNA 2M1BA 2PQ8A 2JRTA 3F8CA 1VTNC 1NHAA 2RKHA 3WGIA 2R7FA 2GAUA 3I58A 3U2RA 3LA3A 4ZYHA 1ZYRF 3ECHA 1YS6A 3M7GA 2GXBA 2K27A 1T39A 3GF2A 1R00A 4KMFA 5DCMB 5LEKA 3FX3A 3KP3A 2A6HF 2RNJA 1FY7A 3E6DA 5JVTA 1OPCA 1USSA 3LQQA 5DUIA 4LLLA 3DKWA 1H9TA 5ICGA 2KKOA 2YPRA 3ZMZA 2STTA 5LLQA 3L9FA 2VT3A 2DT5A 2FE3A 1O7LA 2NNNA 1LNWA 2EA4A 2L02A 1XMAA 3E5XA 2QQ9A 3RPQA 4EJUA 4RB0A 1YW7A 4WWCA 5TRDA 1EH8A 2EK5A 5CJ9A 2W85A 5CVUA 3O6BB 1WWXA 3CLOA 3M9AA 4MQ9F 4L9TA 2LNBA 2CSOA 2QQAA 1KYZA 3MWMA 3CUQC 3RPUA 1MJ9A 2L54A 3CUQA 1J2XA 1L0OC 4FX0A 2IA0A 1YYVA 4ZYEA 4DQ2A 3ERED 2GA2A 2OAZA 4MEYF 2JT1A 4O5VA 2GIVA 5HS9A 3ZMDA 5K5QA 3QU3A 1ZARA 1QO0D 3TKYA 1T38A 5EEHA 5JI6A 4HAMA 3BY6A 1R1VA 2L3DA 2XV4S 2Q8KA 1J5YA 4RGSA 4OMZA 2IW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCV A;  3LA7 A;  1KU9 A;  4P96 A;  5IT9 Z;  4I0A A;  4MEX F;  1BC8 C;  3VEP A;  1B9N A;  3OV8 A;  2H6B A;  2V9V A;  4MHG A;  3ZQ7 A;  5D5V B;  1HXD A;  2ZME B;  1R36 A;  2A3S A;  3DF8 A;  4L9J A;  4CO8 A;  3MFK A;  1IN7 A;  2PI0 A;  2CFX A;  3ZMU A;  1ZH5 A;  4A6D A;  4AIJ A;  1W4M A;  3SXY A;  3TGN A;  3GZ6 A;  1BIA A;  3CO6 C;  1Z91 A;  1TQM A;  4P55 A;  4EJO A;  4A5M A;  1HKQ A;  3EQL F;  1W7P A;  1LQ1 A;  2K4B A;  1KQ9 A;  4ZYG A;  3ZMT A;  5HS7 A;  1C0W A;  2K86 A;  5HDG A;  1YFH A;  1XD7 A;  1IXC A;  4IJA A;  4EGZ A;  1O3T A;  2FU4 A;  3K1N A;  1V3F A;  1X3U A;  2DPD A;  1WRJ A;  4XRF A;  1WQ2 A;  5TJJ A;  4G6Q A;  3SZT A;  3KP2 A;  4M73 A;  3BDD A;  5LGN A;  5BOX A;  2D1H A;  3QOP A;  4G8X A;  3F6V A;  4HQE A;  3GFJ A;  2H6C A;  1JXS A;  2XKO A;  4IVN A;  1G4D A;  4RGR A;  2JZY A;  1J59 A;  1HST A;  3M8E A;  1UB9 A;  5LGU A;  3QAH A;  4CXF A;  1IRG A;  4QLC U;  2VON A;  4KIG A;  1LDD A;  2P8T A;  2AXL A;  4HLX A;  1EV7 A;  3VOE A;  2IA1 A;  4FX4 A;  1S3J A;  2VBW A;  3KFW X;  4G7Z F;  4YII A;  2EFW A;  1CF7 B;  3QPT A;  2EB7 A;  1IW7 F;  4PCQ A;  1PDN C;  1FBU A;  3LAJ A;  1K6O A;  1FOK A;  3CTA A;  1R58 A;  4BAY A;  5E1X A;  4Q47 A;  2M45 A;  5E20 A;  2ZME A;  4LK0 F;  2V6C A;  2JSC A;  4LLN A;  3PFI A;  1SMT A;  1U5T B;  1BI0 A;  3H92 A;  1W5T A;  3ZN1 A;  1REP C;  3E6B A;  1ON2 A;  1G6N A;  3HIF A;  2VE8 A;  1BOA A;  2BGC A;  4OIR F;  4LFU A;  3WU0 A;  3LWF A;  3T8R A;  4ZYD A;  1T6S A;  3KLN A;  1TNT A;  1MKM A;  1BJA A;  2IA2 A;  2CO5 A;  4XLN F;  2K7L A;  2DI3 A;  5KK1 A;  1O3S A;  2Q2E A;  3K1M A;  4KIB A;  1WSU A;  2FML A;  1KU2 A;  4AD9 A;  2KIF A;  1KQ8 A;  5JFR A;  2ZFW A;  4PGG A;  2XAS A;  4HF1 A;  1QPM A;  1P6R A;  2NYX A;  4HF2 A;  2EFN A;  1F1Z A;  4L5I A;  4IF4 A;  2M30 A;  4I01 A;  4UVC A;  1FWZ A;  3DV8 A;  5LBQ A;  4N0B A;  2MH2 A;  5D5W B;  4ESJ A;  4HA8 A;  4P9U A;  3GFL A;  2ELH A;  4UUV A;  4A12 A;  4A0Z A;  3E6C C;  1CF7 A;  3FF5 A;  3WTY C;  5DEQ A;  5L3B A;  1QBJ A;  4FT8 A;  4N9H A;  1YQA A;  1AWC A;  3RKW A;  1T98 A;  3JTG A;  1J75 A;  1MGT A;  2XAG A;  4HQM A;  3DPL C;  3R60 A;  1Z6R A;  1XGS A;  3F72 A;  3RYR A;  2A5Y B;  4HBL A;  2G7U A;  3L00 A;  5D8K B;  1B9M A;  5K5R A;  3E5Q A;  5DD8 A;  5ICC A;  3W6K B;  4LD5 A;  2EFP A;  3KE2 A;  1LEB A;  3RKX A;  1BI3 A;  4S04 A;  4N9I A;  2FBH A;  2Z9O A;  1S6L A;  2RVC A;  3QPH A;  2FA5 A;  3COA C;  1YIO A;  2PN6 A;  2XAF A;  1HBX G;  2BBY A;  3BP8 A;  2FNP A;  5LRR A;  4EM0 B;  4ZZD A;  3NQO A;  2CW0 F;  4WF2 A;  5E18 F;  3WTU C;  1FNN A;  1IRF A;  2F2E A;  1W5S A;  2F5C A;  3PQJ A;  2ZNZ A;  5H6R A;  3D0S A;  2XRN A;  4L18 B;  3BJ6 A;  5FFX A;  4EGY A;  3ABT A;  1B59 A;  4MNU A;  4L0Y B;  4HV6 A;  1LVA A;  3EYI A;  1OYI A;  2ETH A;  1R23 A;  2J5P A;  3F21 A;  1H9G A;  2DLL A;  1YS7 A;  1O57 A;  2OZ6 A;  4B09 A;  2ZNY A;  4YG2 F;  3V7R A;  4HYE A;  4A6E A;  2CYY A;  3MAJ A;  1TNS A;  5D4S A;  1YW8 A;  3IRQ A;  3RDI A;  5D6E A;  3E97 A;  3NEU A;  2EWN A;  1Z6T A;  3DPT A;  3CUQ B;  2ZKZ A;  3VFZ A;  2O61 A;  6PAX A;  2PFB A;  2KIM A;  1I5Z A;  3N4M A;  2ZJ2 A;  1SFU A;  1MZB A;  3DXJ F;  2ISY A;  5AON A;  1J7K A;  2UZK A;  2KRF A;  4Y15 A;  4A0X A;  2RDP A;  4KT5 C;  5L3E A;  4JK1 X;  2KJC A;  2M5W A;  5LEJ A;  3KEO A;  1GHC A;  3FMQ A;  5KVR A;  5BS6 A;  1HW1 A;  5F64 A;  3Q9S A;  3GYH X;  3LQR A;  3WTX C;  2WWY A;  4PGH A;  2MH9 A;  2GA1 A;  4R79 A;  2DW4 A;  3IKV A;  2ZBK A;  3I64 A;  3WE3 A;  3KP5 A;  5EEG A;  2V79 A;  3R61 A;  1I6X A;  2OA4 A;  4I2O A;  2F5F A;  3FZV A;  2LDU A;  3HTS B;  2MA3 A;  2GWR A;  3ZN0 A;  2K4J A;  4AIH A;  3MEX A;  4XLP F;  2MLK A;  2FQ3 A;  4L5J A;  2MBF A;  4HZF A;  4AIK A;  1UST A;  1QZZ A;  1OYW A;  3LFK A;  2EV0 A;  1K79 A;  4FHT A;  2E1N A;  1E2X A;  1DPU A;  4OU0 A;  1DPR A;  2A07 F;  1W7P B;  5FLX K;  5LRS A;  1GVJ A;  4LMY A;  1SMY F;  3WE2 A;  4LJZ F;  5L3D A;  3P9C A;  4LK1 F;  3DFG A;  4RAY A;  5FO5 A;  1U6G A;  3BPV A;  2JPC A;  4NQW A;  3KP7 A;  2QQB A;  2QZ8 A;  5ERI A;  3ECO A;  4UXN A;  1DP7 P;  5LHG A;  2IJL A;  2LF7 A;  3LST A;  2Z99 A;  2DO7 A;  3R0J A;  3CUO A;  4KMU X;  3R4K A;  4OIN F;  2FXA A;  4NHJ A;  4Q4Z F;  1HKT A;  2ACJ A;  3T8T A;  1RNL A;  4R1H A;  2VN2 A;  3FXR A;  4DNC A;  3WTZ A;  3CJN A;  5ILV A;  2KJB A;  4CHU A;  2XHK A;  2OZU A;  4XSX F;  2UWM A;  2W84 A;  2ZO4 A;  3I0T A;  3IKT A;  1WKM A;  2UXN A;  2STW A;  3H3Z A;  3J80 K;  2DAO A;  4KIC A;  3GLX A;  4EJT A;  1R5H A;  3M1E A;  2DBB A;  3BWG A;  3I54 A;  1I1G A;  4R8H A;  3FWE A;  1BI1 A;  1F9N A;  1SD6 A;  4HW0 A;  3JTH A;  3GX4 X;  3ELK A;  3BZ6 A;  3QRF F;  4TV7 A;  3FM3 A;  4WK8 F;  2Y48 A;  5LGT A;  1E17 A;  1S7A A;  3SFZ A;  3TOB A;  5J8F A;  2R3S A;  5D4R A;  4GYG A;  1XCB A;  2HQN A;  1TQI A;  1ZGJ A;  3FXQ A;  1BN5 A;  5FLX Z;  1MDM A;  2FF4 A;  4HF0 A;  4GXO A;  5L3C A;  1UFM A;  3LA2 A;  5D8L B;  5J6X A;  2CWE A;  1L3L A;  1A04 A;  1IF1 A;  3F8B A;  4RB1 A;  3HHH A;  2E7X A;  1K78 A;  5E8G A;  4LG0 B;  4KYW A;  3T5X A;  4XSZ F;  2XAQ A;  3RIR A;  2VC0 A;  1YO5 C;  3E5U A;  3JSP A;  1FSH A;  1SD5 A;  1G3W A;  2PLY A;  3K0L A;  3KP4 A;  2VOP A;  2EV5 A;  2L4A A;  3KEQ A;  1ULY A;  5A2Q K;  4K2E A;  1ZLK A;  3TQN A;  2G7H A;  3NRV A;  3U1D A;  4EJV A;  3L7W A;  1YG2 A;  1BM9 A;  2YSR A;  2Z3Y A;  3SZP A;  1K7A A;  4UV8 A;  4MTE A;  2G9W A;  1FYM A;  3J80 Z;  3IL2 A;  3WTS C;  2VBZ A;  4GGG A;  3SHF A;  5JHU A;  2NNY A;  3TO7 A;  3IC7 A;  4WXC A;  1SAX A;  4IRG A;  4CZZ A;  2Z5U A;  1O3R A;  2WV0 A;  1IN4 A;  5E1Z B;  4AVP A;  3KP6 A;  4A0Y A;  2CG4 A;  4ZZL A;  4D0P A;  1ONV A;  4U0Y A;  1CGP A;  2OBP A;  1XSV A;  3N97 A;  1PUE E;  2MLG A;  2EFQ A;  1J9I A;  3BOQ A;  3P9I A;  3KZY A;  3HSR A;  3V8L A;  3K2Z A;  1I1S A;  3ZP5 A;  1W7P D;  1LDJ A;  3FMR A;  3JSO A;  3L2C A;  4UVA A;  4LG0 A;  5D6F A;  5LHH A;  1OR7 A;  4E70 A;  2ESN A;  1S29 A;  1MJB A;  4U7B A;  5E1W A;  3KLO A;  4ESB A;  4Y13 A;  2NAZ A;  1ZLJ A;  4BHC A;  1R5G A;  1O7F A;  1XN7 A;  2QM3 A;  3T0Y A;  1ZAO A;  2YX7 A;  4NB5 A;  1D8K A;  1OKR A;  3CDH A;  2FOK A;  2P5K A;  1ZRC A;  5A2Q Z;  4KDP A;  3TO9 A;  4HOB A;  3ULQ B;  2D45 A;  1BBY A;  4I09 A;  1H0M A;  1KU7 A;  1IAW A;  4LGW A;  3RJP A;  4EVI A;  1XB4 A;  2A6E F;  1IZ1 A;  2XGX A;  1ZHF A;  2VE9 A;  2XIG A;  2R7D A;  1ZN2 A;  1PP7 U;  3ROU A;  4WCG A;  1FP2 A;  2COM A;  2QVO A;  5BQT A;  5DUK A;  3G3Z A;  4U0V A;  1B6A A;  3RI4 A;  1BC7 C;  2KIU A;  3F6O A;  3E6M A;  3MQ0 A;  3TO6 A;  4KUM A;  2GZW A;  3WG9 A;  1FP1 D;  2QEN A;  4ASN A;  4F7Z A;  3HHG A;  4G6D A;  2AS5 F;  2Q0O A;  4BH9 A;  2O03 A;  2HFH A;  1D5V A;  4ZH4 F;  3KCC A;  4HV5 A;  2LF8 A;  4IXA A;  2A68 F;  2IP2 A;  2W57 A;  4RAZ A;  4RB2 C;  1YLF A;  2D1V A;  1V4R A;  3BRO A;  3C3W A;  1TW3 A;  4A2U A;  3L09 A;  2XVC A;  3HRM A;  3FHZ A;  4HDU A;  2FBI A;  2JTV A;  1I27 A;  2HKO A;  4S05 A;  1P92 A;  3PQK A;  1OMI A;  5H6Q A;  3ABU A;  4LLG F;  4M9X A;  2P5L C;  1XDU A;  3WTT C;  2XKP A;  4UVB A;  1QZY A;  1D8J A;  1XGO A;  1UCR A;  4CDG A;  4Q48 A;  2FMY A;  4EM1 A;  2HR3 A;  1HW5 A;  2IRF G;  1HW2 A;  1ON1 A;  3P9K A;  5F6F A;  4OIO F;  4PDK A;  1FT9 A;  3I4P A;  5J8C A;  4BHB A;  2HYG D;  2OQG A;  3P7N A;  4U88 A;  4EV0 A;  2DTR A;  1BIB A;  5JR3 A;  1KU3 A;  3HRT A;  3V8K A;  3F23 A;  3VB2 A;  2QBY A;  3IWF A;  1BI2 A;  2VOO A;  2P6T A;  3EUH A;  1Z9C A;  4GCV A;  2DK8 A;  2ISZ A;  4GYI A;  4HLY A;  5BPI A;  2HOE A;  3GWZ A;  5DD4 A;  2ZCW A;  4MGR A;  3EYY A;  1HQC A;  3ZPL A;  2B0L A;  2TDX A;  2NS0 A;  2P7V B;  4YFN F;  1R22 A;  2PMU A;  5FD6 A;  2BE5 F;  2HGC A;  5HOO A;  4U0W A;  1U8R A;  3TDZ C;  2JPB A;  1LJ9 A;  4P5O A;  1Z05 A;  4KA4 A;  2VBX A;  4MTD A;  4PZJ A;  2V1U A;  1F4K A;  2V1D A;  5ILS A;  2RGV A;  2RC4 A;  3GVA A;  1Z1D A;  2OQR A;  2K02 A;  4WXD A;  3DEU A;  3HUG A;  3I59 A;  5AIQ A;  1LDK B;  2HWV A;  4O6J A;  5D5U B;  3QU6 A;  3ISP A;  4EJW A;  4BYY A;  2V1X A;  1Q1H A;  5L3G A;  2HTS A;  3QP6 A;  5IT9 K;  4IRI A;  5ICE A;  3I53 A;  2QUF A;  3E3V A;  3WTW C;  3JAM K;  4IRH A;  1TW2 A;  4OOI A;  1AOY A;  3ZMV A;  3RKY A;  5HLG A;  2CQK A;  1MDM B;  3B73 A;  4BQA A;  1TBX A;  3EET A;  3J81 K;  4OIQ F;  2ESH A;  3EDP A;  2FSW A;  2HS5 A;  3H3U A;  1JHF A;  1RUO A;  2X0L A;  1K78 B;  4ON0 A;  2XAJ A;  5FD5 A;  2H09 A;  1TQP A;  5HDK A;  2E1C A;  3C18 A;  2IT0 A;  1FBS A;  2LKP A;  4JQF A;  3Q5F A;  5IT3 A;  4L9V A;  4ENM A;  2PEX A;  2HYF A;  2O6G E;  5CLS A;  3AAF A;  1UHM A;  1GXQ A;  4I02 A;  1R1U A;  2WC2 A;  4HX8 A;  2VBY A;  5HS8 A;  4YIF A;  3C1D A;  4M6X A;  4Z2Y A;  4I0B A;  1U78 A;  2FEZ A;  2HEO A;  2WTE A;  2FRH A;  2HTJ A;  4G94 A;  3BJA A;  1YTY A;  3HSF A;  1ZG5 A;  1SD7 A;  2RN7 A;  4I7H A;  2FNA A;  2PMH A;  1XDS A;  3JW4 A;  4EMS A;  5DCM A;  1ZGA A;  2L4M A;  5F1R A;  1ZG3 A;  2P4W A;  2O0Y A;  5ILU A;  3HOT A;  1B1B A;  3WGH A;  3HSE A;  2ZXJ A;  1EH6 A;  2BEO A;  1F5T A;  3WU1 B;  2F5D A;  3VOD A;  2EJR A;  5CVV A;  3JAM Z;  1SFX A;  4MQV A;  4GO1 A;  5FGM A;  3KZZ A;  2BYV E;  1JHH A;  3J7A O;  4M72 A;  4HDV A;  3FMS A;  4CGZ A;  5E8I A;  1XGM A;  3J81 Z;  2A61 A;  3DQV C;  1RI7 A;  2RQP A;  4I98 B;  1T2K A;  1FYK A;  5CVR A;  2M8E A;  2NRA C;  3IRR A;  4M9S A;  3W6J B;  4UV9 A;  2YX4 A;  3HTU A;  4RGX A;  2L01 A;  4OIP F;  4L0Z B;  3HRS A;  4EQQ A;  4LB6 B;  1QNT A;  1RIO H;  2ADU A;  1EH7 A;  3O3K A;  1XGN A;  2RV8 A;  1JE8 A;  2BV6 A;  2VC1 A;  1G3Y A;  4IPA A;  2W25 A;  4M74 A;  5L3F A;  3K1P A;  5CVJ A;  1LB2 A;  1IN5 A;  2VT2 A;  2XRO A;  4YFK F;  2P7C B;  2F5E A;  2P6S A;  3M8F A;  3BJO A;  1B4A A;  4M6Y A;  1FBQ A;  3F8F A;  2UXX A;  2GQQ A;  3GZ5 A;  4G9Y A;  2YR2 A;  1ODD A;  3FXU A;  2FBK A;  1QGP A;  4KFC A;  2XAH A;  5LHI A;  1STZ A;  1U3E M;  2IPQ X;  3V7C A;  3TDU C;  5BMZ A;  4CIC A;  3QP5 A;  2M87 A;  1IXS B;  2GXG A;  3S2W A;  1KQ0 A;  4KN4 X;  4ETS A;  3RYP A;  3CO7 C;  1IN8 A;  1MD0 A;  1QQI A;  1FPQ A;  5HLH A;  5D5X B;  2QLZ A;  1P2F A;  3R6S A;  3WOD F;  2PG4 A;  4BHP A;  2CGP A;  2HZT A;  1WI9 A;  2DPU A;  1D3Y A;  2W24 A;  3T1B A;  1XSX A;  3IWZ A;  5K5O A;  1KGS A;  1YW9 A;  3SQN A;  3MCZ A;  1IXR C;  1ZG1 A;  2Z33 A;  1O3Q A;  1RZ4 A;  5DYM A;  1DUX C;  3HRU A;  4CYD A;  1U2W A;  2OD5 A;  1TTY A;  4M71 A;  3V8J A;  2YU3 A;  3V4G A;  5ICF A;  3OOP A;  3ZMS A;  2DQR A;  3MZH A;  2MC3 A;  1LEA A;  5DDG A;  3TOA A;  2J5O A;  4RS8 A;  4O3M A;  1FSE A;  3O2P E;  4IHT A;  3WTV C;  2VOD A;  4M9Z A;  1IUY A;  2LSO A;  1PP8 F;  4LB5 A;  1IN6 A;  3MZY A;  4RGU A;  5E17 F;  5FFZ A;  2A69 F;  2PJP A;  2HKX A;  4HX4 A;  2QBY B;  4Q5S F;  3DP7 A;  4ESF A;  4UNO A;  2X4H A;  4H0E A;  1HKS A;  4BXU A;  2OU2 A;  3K9T A;  1FLI A;  4ENN A;  3G73 A;  3WGG A;  1R7J A;  2EA2 A;  1FYL A;  3C7J A;  2MD5 A;  1G3S A;  1P4W A;  4BNC A;  4ENK A;  4KN7 X;  3ML6 A;  4UHT A;  4KIF A;  1S8N A;  4WXH A;  1DDN A;  4OMY A;  1U5T C;  3U9G A;  4WX9 A;  3LAP A;  1KYW A;  3F8N A;  1UHW A;  1XSD A;  1SD4 A;  1TLH B;  4AWX B;  3IHU A;  2HQR A;  4G7H F;  1RUN A;  1GXP A;  2H27 A;  1U5T A;  2HDC A;  4QWQ A;  5K1Y A;  4Y17 A;  3REO A;  2D2W A;  3F22 A;  1P4X A;  2XUB A;  2H94 A;  3GFI A;  5CVI A;  4A5N A;  2DQL A;  5BPD A;  1T0F A;  2E7W A;  1OYY A;  5HLI A;  4B8X A;  1FZP B;  3I59 B;  3V7S A;  2VXZ A;  3FM5 A;  5AIP A;  4L9N A;  2DU9 A;  3HYI A;  1SFE A;  5DCF A;  4P9F A;  1S7O A;  2EFO A;  4KNY A;  1G3T A;  1XMK A;  2DK5 A;  2IVM A;  3R0A A;  2QYO A;  4EM2 A;  4JBA A;  2Y75 A;  3HOS A;  3BPX A;  3GUD A;  3F3X A;  1ZRF A;  5ED4 A;  2O8X A;  3GFM A;  1R1T A;  1Z7U A;  3GEZ A;  1KA8 A;  1J0R A;  1P4A A;  4YFX F;  5DV5 A;  1ZRD A;  1FC3 A;  2PBI A;  1Y0U A;  3D5L A;  5HVQ C;  3GW2 A;  1ZRE A;  5FB2 A;  3GO5 A;  1JGS A;  5CYV A;  4RB3 C;  3KET A;  4ENJ A;  3I5U A;  2Y0M A;  4U7D A;  2EV6 A;  2C6Y A;  1MJA A;  3Q9V A;  3GXO A;  3F8M A;  3B02 A;  3I71 A;  4XBF A;  2DFI A;  4HX7 A;  3K69 A;  4G7O F;  2QWW A;  3RTR A;  4IHS A;  2O3F A;  5H20 A;  1FX7 A;  2P5V A;  1HSJ A;  5HDN A;  2M1B A;  2PQ8 A;  2JRT A;  3F8C A;  1VTN C;  1NHA A;  2RKH A;  3WGI A;  2R7F A;  2GAU A;  3I58 A;  3U2R A;  3LA3 A;  4ZYH A;  1ZYR F;  3ECH A;  1YS6 A;  3M7G A;  2GXB A;  2K27 A;  1T39 A;  3GF2 A;  1R00 A;  4KMF A;  5DCM B;  5LEK A;  3FX3 A;  3KP3 A;  2A6H F;  2RNJ A;  1FY7 A;  3E6D A;  5JVT A;  1OPC A;  1USS A;  3LQQ A;  5DUI A;  4LLL A;  3DKW A;  1H9T A;  5ICG A;  2KKO A;  2YPR A;  3ZMZ A;  2STT A;  5LLQ A;  3L9F A;  2VT3 A;  2DT5 A;  2FE3 A;  1O7L A;  2NNN A;  1LNW A;  2EA4 A;  2L02 A;  1XMA A;  3E5X A;  2QQ9 A;  3RPQ A;  4EJU A;  4RB0 A;  1YW7 A;  4WWC A;  5TRD A;  1EH8 A;  2EK5 A;  5CJ9 A;  2W85 A;  5CVU A;  3O6B B;  1WWX A;  3CLO A;  3M9A A;  4MQ9 F;  4L9T A;  2LNB A;  2CSO A;  2QQA A;  1KYZ A;  3MWM A;  3CUQ C;  3RPU A;  1MJ9 A;  2L54 A;  3CUQ A;  1J2X A;  1L0O C;  4FX0 A;  2IA0 A;  1YYV A;  4ZYE A;  4DQ2 A;  3ERE D;  2GA2 A;  2OAZ A;  4MEY F;  2JT1 A;  4O5V A;  2GIV A;  5HS9 A;  3ZMD A;  5K5Q A;  3QU3 A;  1ZAR A;  1QO0 D;  3TKY A;  1T38 A;  5EEH A;  5JI6 A;  4HAM A;  3BY6 A;  1R1V A;  2L3D A;  2XV4 S;  2Q8K A;  1J5Y A;  4RGS A;  4OMZ A;  2IW5 A; 
#chains in the Genus database with same CATH topology
 1XCV A;  3LA7 A;  3CCM I;  1UHS A;  1KU9 A;  3FXK A;  3LSI A;  4P96 A;  5IT9 Z;  4I0A A;  4FE7 A;  4MEX F;  1BC8 C;  5FKL A;  3VEP A;  1B9N A;  2BW3 B;  3OV8 A;  4U87 A;  2CV1 A;  3CMY A;  2H6B A;  4XLH A;  2V9V A;  2JN6 A;  4MHG A;  3ZQ7 A;  5D5V B;  3CP8 A;  3EUK L;  2LRE A;  3KYC B;  1HXD A;  2H8W A;  1R36 A;  2A3S A;  2ZME B;  3DF8 A;  4L9J A;  4CO8 A;  3MFK A;  1IN7 A;  2PI0 A;  4HG2 A;  2CFX A;  1WPK A;  1P7I A;  3ZMU A;  3AKZ A;  1ZH5 A;  3I3L A;  4A6D A;  4AIJ A;  3QOE A;  1W4M A;  3SXY A;  3TGN A;  1QZE A;  3GZ6 A;  1BIA A;  3CO6 C;  4QTR A;  1Z91 A;  3H0G J;  4CCJ A;  1TQM A;  2QF7 A;  4M3F A;  4P55 A;  4A5M A;  4EJO A;  2E71 A;  1HKQ A;  3BG5 A;  3M1C A;  4JX6 A;  2CUJ A;  3EQL F;  1W7P A;  2CFO A;  1LQ1 A;  2K4B A;  1KQ9 A;  4ZYG A;  3ZMT A;  5HS7 A;  3S1Q J;  4FAS D;  1C0W A;  2K86 A;  2WA0 A;  4DOZ A;  1XX5 A;  5HDG A;  4MFE A;  3H5N A;  1D5Y A;  2JUC A;  2UV1 A;  1YFH A;  2WAF A;  5EGO B;  1XD7 A;  1IXC A;  4IJA A;  4EGZ A;  1GVD A;  2X1D A;  1O3T A;  1SFO J;  2FU4 A;  4JP0 A;  2AHQ A;  3K1N A;  1V3F A;  1X3U A;  2DPD A;  1WRJ A;  4CCN A;  4BY1 J;  2ID6 A;  3PUB A;  4XRF A;  4AUX A;  1WQ2 A;  2VPL A;  5GTH C;  5TJJ A;  3QOD A;  5F0C A;  1WHU A;  4G6Q A;  2QKL B;  1LFB A;  3JRD A;  2KHM A;  3SZT A;  3KP2 A;  4M73 A;  3NAR A;  3BDD A;  4XN0 A;  5LGN A;  1R5I D;  3NWT A;  5BOX A;  2D1H A;  1VQ4 I;  3QOP A;  4G8X A;  3F6V A;  4C3H J;  4HQE A;  3GFJ A;  2H6C A;  1JXS A;  2LY2 A;  3AG1 H;  2XKO A;  3CDL A;  4IVN A;  4C2T A;  2K3F A;  1G4D A;  4RGR A;  2JZY A;  1J59 A;  3J7A Y;  1HST A;  3M8E A;  1UB9 A;  4GFB A;  2W00 A;  5LGU A;  3QAH A;  4CXF A;  2F4M B;  1IRG A;  4QLC U;  2I10 A;  1U8B A;  3A01 B;  2VON A;  4KIG A;  2ELK A;  1LDD A;  2E34 A;  1QRY A;  2EH3 A;  2P8T A;  4BGD A;  2AXL A;  3VWB A;  4HLX A;  5KNL A;  4YEL A;  3CCS I;  1EV7 A;  1LKX A;  3AG4 H;  3VOE A;  1LFP A;  2IA1 A;  1NG7 A;  4FX4 A;  4V19 K;  4YIR X;  1S3J A;  2FOW A;  2IGK A;  2X6X A;  4P1W A;  2L9V A;  2VBW A;  3KFW X;  3BTC A;  4G7Z F;  4YII A;  2EFW A;  1CF7 B;  2CUE A;  3QPT A;  2EB7 A;  2EBI A;  1IW7 F;  2JMW A;  4C9Y A;  3BTJ A;  4A3L J;  2MSY A;  2WAD A;  4B43 A;  4PCQ A;  5J1R A;  1PDN C;  1FBU A;  3K4L A;  3LAJ A;  1K6O A;  2JA7 J;  3MKL A;  1FOK A;  3CTA A;  1R58 A;  5F04 A;  4OAY A;  2LR8 A;  4BAY A;  5E1X A;  4Q47 A;  2M45 A;  5E20 A;  2ZME A;  3IP4 B;  2V6C A;  4LK0 F;  2JSC A;  3S16 J;  3HM5 A;  1IC8 A;  4LLN A;  1T95 A;  1YRN B;  3ASO H;  3PFI A;  3DU5 A;  1SMT A;  2XB5 A;  1U5T B;  2LY1 A;  4NC8 A;  1BI0 A;  3H92 A;  4BXX J;  1NK3 P;  1W5T A;  2KZG A;  4LIV A;  3ZN1 A;  1REP C;  3E6B A;  1ON2 A;  4BQO A;  1G6N A;  4D5C A;  3HIF A;  1FOW A;  1GV5 A;  1PUF B;  3MKW B;  2VE8 A;  1BOA A;  5J40 A;  5J4Y A;  3CCE I;  2BGC A;  4OIR F;  1DU0 A;  2MFZ A;  1TP4 A;  4LFU A;  3WU0 A;  3LWF A;  3CJR B;  1QU3 A;  3T8R A;  3GTP J;  3RQI A;  4ZYD A;  1T6S A;  3KLN A;  1TNT A;  3ZR8 X;  4IO9 F;  1MKM A;  1BJA A;  2DYR H;  2IA2 A;  2CO5 A;  2W48 A;  1WH7 A;  4XLN F;  4GRI A;  2K7L A;  1QHH D;  2DI3 A;  1MBH A;  1X2M A;  1D0X A;  3PM1 A;  5KK1 A;  1O3S A;  2IEK A;  2Q2E A;  4C2U A;  2EIK H;  3K1M A;  3HGG A;  4KIB A;  2E2J J;  1ETK A;  1K4T A;  2XF7 A;  1WSU A;  2MC4 A;  2FML A;  3K70 C;  1KU2 A;  4DW6 A;  1X1A A;  5CPR B;  3X2Q H;  2DJI A;  3W2V A;  1AKH A;  1QHG A;  4YEJ A;  5TIS C;  4AD9 A;  2KIF A;  3GTQ J;  2R4G A;  2ZSH B;  3DEW A;  1KQ8 A;  2VXD A;  5JFR A;  3U1K A;  3BR0 A;  3S15 J;  2ZFW A;  2K9S A;  4PGG A;  5GAD J;  2XAS A;  4HF1 A;  3F0C A;  2L5Q A;  3BQY A;  1QPM A;  1P6R A;  1RKT A;  2NYX A;  4HF2 A;  2EFN A;  1F1Z A;  4L5I A;  4IF4 A;  1UZC A;  2E60 A;  2M30 A;  4I01 A;  1KZH A;  2KIS A;  2XF6 A;  3K6G A;  2LKX A;  4BQQ A;  3HOY J;  4UVC A;  1FWZ A;  3DV8 A;  5HOD A;  5LBQ A;  3G1O A;  4N0B A;  1JGG A;  2MH2 A;  2VQC A;  5D5W B;  3AG3 H;  1B8I A;  5K7Z A;  4ESJ A;  1ETX A;  2WV1 A;  4HA8 A;  1ACI A;  3LMM A;  4P9U A;  3GFL A;  2ELH A;  4UUV A;  3IH4 A;  1POG A;  3FKI J;  4A12 A;  5GTI C;  1RET A;  4A0Z A;  3E6C C;  3H5A A;  1CF7 A;  4XMY A;  3FF5 A;  2FX0 A;  1H89 C;  3WTY C;  2RQQ A;  2R5Z B;  5DEQ A;  1ENH A;  5LD2 C;  4BU2 A;  1BR1 A;  2A05 A;  1V5G A;  3A03 A;  5L3B A;  1N75 A;  4G12 A;  3OS2 A;  3GTK J;  1QBJ A;  4FT8 A;  1JKP C;  4N9H A;  1YQA A;  1AWC A;  1YX5 A;  2LK2 A;  3RKW A;  3FXO A;  4D7N A;  1T98 A;  3JTG A;  1J75 A;  1MGT A;  2TRT A;  2BXZ A;  2XAG A;  4HQM A;  1N77 A;  2NS8 A;  3DPL C;  3R60 A;  2QCO A;  1Z6R A;  1XGS A;  3F72 A;  3RYR A;  2A5Y B;  2GM4 A;  4HBL A;  2G7U A;  1RR7 A;  2DFE A;  3CJT B;  3PUF A;  3CD6 I;  4PJM A;  3AFH A;  3KX2 A;  1G8X A;  3L00 A;  5D8K B;  1B9M A;  5K5R A;  4DJA A;  3E5Q A;  5DD8 A;  5ICC A;  2DT6 A;  1D0Z A;  3W6K B;  2DXI A;  2JVG A;  2Y69 H;  4LD5 A;  1IV6 A;  4KJZ A;  4E7L A;  2EFP A;  3KE2 A;  1LEB A;  3JRH A;  3RKX A;  1BI3 A;  4S04 A;  4N9I A;  2IGM A;  2FBH A;  2Z9O A;  1S6L A;  1MMN A;  2RVC A;  2KPM A;  3I55 I;  3QPH A;  2R92 J;  4IOA F;  3SEZ A;  1ZQ3 P;  2DMN A;  2FA5 A;  3QYF A;  5M3M J;  3COA C;  1BA5 A;  1YIO A;  2PN6 A;  2XAF A;  1HBX G;  2BBY A;  2WAE A;  2XRL A;  3BP8 A;  4A93 J;  2FNP A;  5LRR A;  2HQA A;  2MG4 A;  4BKX A;  4EM0 B;  3ONQ A;  4B1R A;  4ZZD A;  2L9S A;  1Y6I A;  2H1L A;  3NQO A;  2CW0 F;  4WF2 A;  2IS1 A;  5E18 F;  3DBL B;  3ZRG A;  3WTU C;  4RA2 A;  4BS9 A;  4KIS A;  3B6C A;  3S1N J;  1FNN A;  2VL8 A;  1IRF A;  2F2E A;  1W5S A;  2F5C A;  2E1M C;  3PQJ A;  2ZNZ A;  5H6R A;  3D0S A;  2XRN A;  4L18 B;  3BJ6 A;  2EZI A;  5FFX A;  2DA4 A;  2HVQ A;  3WG7 H;  4EGY A;  3ABT A;  2VKV A;  1B59 A;  2VIX A;  4KT6 A;  5JLW A;  2HPM A;  4MNU A;  4L0Y B;  2DA2 A;  3CCY A;  4HV6 A;  2YS9 A;  1LVA A;  5FRN A;  3EUH C;  1Y39 A;  1IUF A;  2XAU A;  3EYI A;  1OYI A;  2ETH A;  4B4C A;  4DGW B;  1R23 A;  3AL0 C;  2J5P A;  4B44 A;  1LE8 A;  3F21 A;  1H9G A;  2DLL A;  4PJL A;  4JOM A;  1YS7 A;  1O57 A;  2OZ6 A;  2LYC A;  4B09 A;  4X6A J;  2ZNY A;  4NQW B;  1OCZ H;  4YG2 F;  5JVG F;  3HOW J;  2ZXH A;  3V7R A;  4HYE A;  4A6E A;  2CYY A;  3MAJ A;  4XNF A;  1TNS A;  5D4S A;  3BG6 A;  1YW8 A;  3F9K A;  3N05 A;  3IRQ A;  3RDI A;  3KEY A;  5D6E A;  1IRX A;  3E97 A;  3NWS A;  3L2W A;  4ZC3 A;  3G71 I;  3NEU A;  1VND A;  2EWN A;  1Z6T A;  3DPT A;  3SZG A;  2R7U A;  3CUQ B;  4XOP A;  2ZKZ A;  3VFZ A;  2O61 A;  6PAX A;  1JUS A;  2PFB A;  2KIM A;  1I5Z A;  3N4M A;  1XS9 A;  2ZJ2 A;  1SFU A;  4HEA 2;  2X48 A;  1VQ8 I;  1MZB A;  1DGW Y;  3DTI A;  3DXJ F;  2ISY A;  3QPL A;  5AON A;  1J7K A;  2UZK A;  2D5V A;  2KRF A;  4Y15 A;  4A0X A;  2RDP A;  4ZDP A;  4KT5 C;  5E79 C;  4RLF A;  2DYS H;  4HPQ A;  5L3E A;  4V2G A;  4FIS A;  4JK1 X;  2KJC A;  2M5W A;  2ZFU A;  1VZ0 A;  5LEJ A;  2VKD A;  3KEO A;  1OCR H;  2JRM A;  1GHC A;  3FMQ A;  2X1C A;  5E3N A;  5KVR A;  5BS6 A;  2EQR A;  4A3I J;  1FIP A;  1HW1 A;  1VQL I;  5F64 A;  2VPR A;  3Q9S A;  1JKO C;  2V6E A;  3GYH X;  2QGU A;  3LQR A;  2K5C A;  3WTX C;  1JUM A;  2WWY A;  4PGH A;  4CH7 A;  4MLO A;  1JTY A;  4A3D J;  2MH9 A;  2GA1 A;  3A02 A;  4R79 A;  2DW4 A;  3GZN B;  3IKV A;  2O9L A;  2M9H A;  2ZBK A;  3I64 A;  3WE3 A;  3KP5 A;  2L7Z A;  1LVK A;  2K9L A;  5EEG A;  2V79 A;  3K10 A;  3R61 A;  1I6X A;  2OA4 A;  2Y9Y A;  3OYE A;  2QSF X;  4J01 A;  4I2O A;  4I99 C;  2F5F A;  3FZV A;  2LDU A;  3HTS B;  2CJJ A;  2MA3 A;  2GWR A;  5M5X J;  4A3K J;  4BBS J;  3DTE A;  4BQN A;  2X1E A;  3ZN0 A;  2JQ7 A;  3FBI B;  2K4J A;  4AIH A;  3M3Y J;  2JVH A;  1QA6 A;  3MEX A;  4XLP F;  1Y1W J;  2MLK A;  4L5E A;  2FQ3 A;  4L5J A;  3B6A A;  2MBF A;  4HZF A;  4AIK A;  3HJE A;  3OYG A;  1UST A;  3Q0W A;  1QZZ A;  1HDP A;  2VJ4 A;  3CCL I;  2HVR A;  1OYW A;  5EJC A;  3LFK A;  3JRI A;  2EV0 A;  1K79 A;  4FHT A;  3DU6 A;  3IAM 2;  4PJ0 C;  3JRC A;  2E1N A;  1E2X A;  1DPU A;  3G1M A;  4OU0 A;  3OR1 C;  1DPR A;  1RPW A;  1W7P B;  2P81 A;  2XB0 X;  2RAE A;  2A07 F;  5FLX K;  5LRS A;  1OCO H;  1GVJ A;  4LMY A;  1SMY F;  3OYF A;  3WE2 A;  4LJZ F;  5L3D A;  2BHZ A;  3P9C A;  3KZI C;  2CQ7 A;  4II3 A;  1VI0 A;  4LK1 F;  1W0U A;  3DFG A;  3H9J A;  1DGR M;  2V26 A;  1U6G A;  4RAY A;  5FO5 A;  3BPV A;  2JPC A;  3OYM A;  4NQW A;  3RZD J;  3W6V A;  4NDL A;  3KP7 A;  2QQB A;  2QZ8 A;  5ERI A;  2H1K A;  3ECO A;  2OTL I;  5J47 A;  4Y52 J;  4UXN A;  4M3B A;  3FDY A;  4BY7 J;  1DP7 P;  5LHG A;  2IJL A;  3VYU B;  3WHB A;  2CV2 A;  3ZQQ A;  2LF7 A;  1X1D A;  3LST A;  3G1L A;  4KIT B;  2Z99 A;  2I8D A;  2V9K A;  1X3W B;  1GDT A;  2DO7 A;  3R0J A;  2XDV A;  3CUO A;  4KMU X;  1K83 J;  3R4K A;  4D5F A;  5E3O A;  4OIN F;  1HCR A;  3LFU A;  4UUS A;  2FXA A;  2DOE A;  2NOJ B;  4NHJ A;  4Q4Z F;  3TP3 A;  1HKT A;  1JT0 A;  3J7Y J;  2ACJ A;  3TMO A;  3T8T A;  1ZGW A;  2LG4 A;  1NG6 A;  1RNL A;  2E1O A;  4R1H A;  2VN2 A;  3FXR A;  1X1C A;  4DNC A;  3WTZ A;  2NOG A;  3CJN A;  5ILV A;  3A4C A;  2DDA A;  3ABL H;  2KJB A;  1LPQ A;  2XPW A;  4CHU A;  1GLN A;  2XHK A;  2OZU A;  2RRE A;  3Q0U A;  4IL6 C;  4XSX F;  2W84 A;  2UWM A;  2ZO4 A;  2L7F P;  3GTG J;  3RCO A;  3I0T A;  3IKT A;  2LP0 A;  3ASN H;  1RKW A;  1WKM A;  2DA7 A;  2UXN A;  3MN2 A;  2M2E A;  2STW A;  3H3Z A;  2CS3 A;  1FTT A;  4RM3 A;  3J80 K;  1QVT A;  2DAO A;  4KIC A;  3JRG A;  4S0H B;  1NK2 P;  1OIS A;  3GLX A;  1PYV A;  1AU7 A;  4EJT A;  1R5H A;  4CZC A;  2WAQ N;  3M1E A;  2DBB A;  3BWG A;  1XG1 A;  2CRG A;  1R6R A;  3I54 A;  1I1G A;  4R8H A;  3FWE A;  1BI1 A;  1OCC H;  1F9N A;  1TWG J;  1SD6 A;  2EZL A;  3OWT A;  4HW0 A;  3JTH A;  3GX4 X;  3ELK A;  3BZ6 A;  3FXJ A;  3QRF F;  1TL8 A;  1SAU A;  5IOY A;  3S17 J;  1WJE A;  4TV7 A;  1YE9 A;  5CQE A;  4IQ4 A;  5GAE J;  1MH4 A;  3FM3 A;  3K4K A;  1JT6 A;  4WK8 F;  2Y48 A;  5LGT A;  1E17 A;  1S7A A;  3ZQG A;  3SFZ A;  2VJ5 A;  3OYI A;  2VB6 A;  3TOB A;  5J8F A;  5M5Y J;  1RC9 A;  2R3S A;  5D4R A;  4GYG A;  2L9R A;  1XCB A;  2FQ4 A;  3OYH A;  2WAQ A;  2HQN A;  1KON A;  2CU7 A;  3LSG A;  1TQI A;  1ZGJ A;  3FXQ A;  2JA6 J;  2PMZ N;  3H3V K;  5HNH A;  1BN5 A;  3TBI A;  2R7V A;  4I76 A;  4HNV A;  5FLX Z;  4J00 A;  5DS9 A;  1MDM A;  3GTL J;  2FF4 A;  4HF0 A;  4GXO A;  3WHC A;  5L3C A;  1SAN A;  1UFM A;  3LA2 A;  5D8L B;  5J6X A;  2CWE A;  1W36 C;  5CKT A;  1L3L A;  1A04 A;  4F91 B;  2ZJQ F;  2OJE D;  3PIO F;  1N78 A;  1IF1 A;  1DP3 A;  3CCU I;  3UNG C;  2CUZ A;  3F8B A;  4RB1 A;  3HHH A;  2ME0 A;  2E7X A;  1K78 A;  3QQA A;  4XR6 A;  1VQO I;  5E8G A;  3FK6 A;  4LG0 B;  4KYW A;  2DOF A;  3KPH A;  4PSX A;  4HSR A;  1R4M B;  4IHW A;  3T5X A;  5B5E C;  4XSZ F;  1PJR A;  2Q2E B;  2XAQ A;  3I4N J;  2LD5 A;  3RIR A;  2VC0 A;  4PJJ A;  2PMZ A;  1YO5 C;  1JJ6 C;  3RPU D;  3E5U A;  2KDO A;  1AA7 A;  1AKH B;  3JSP A;  4D1Q A;  1VQ5 I;  1FSH A;  3ABM H;  1SD5 A;  1G3W A;  2ID3 A;  1HF0 A;  3TP0 A;  5C4X J;  1OFC X;  2BVL A;  4XKC A;  1H88 C;  1O4X A;  2PLY A;  3K0L A;  3KP4 A;  2VOP A;  2EV5 A;  5B66 C;  5FKK A;  2L4A A;  3K4C A;  2GBY A;  5F27 A;  3CF2 A;  5B1B H;  4ANJ A;  3KEQ A;  1ULY A;  5A2Q K;  4K2E A;  1D1B A;  1I3Q J;  5C3E J;  1ZLK A;  3TQN A;  2G7H A;  2OF7 A;  3NRV A;  3S14 J;  4PFO A;  3ERM A;  5EZH A;  1NTC A;  3U1D A;  4EJV A;  3L7W A;  2VJJ A;  1T56 A;  1YG2 A;  1BM9 A;  2TCT A;  1B8I B;  1DU6 A;  3A0B C;  4G6T B;  3FXL A;  2F4I A;  2YSR A;  2Z3Y A;  3SZP A;  1YJW I;  1K7A A;  3BZK A;  4D9J A;  3CMM A;  2OC6 A;  4UV8 A;  4MTE A;  2G9W A;  1FYM A;  3J80 Z;  1TC3 C;  1XC5 A;  3SDB A;  3IL2 A;  3WTS C;  3GLL A;  3HDD A;  2VBZ A;  3CDI A;  3OMY A;  1YJ9 I;  4GGG A;  4UB8 C;  4AID A;  3SHF A;  5JHU A;  4E7K A;  5JLX A;  2BZT A;  3E1S A;  4FQG A;  5F0F A;  2F6C A;  2NNY A;  3TO7 A;  4M3G A;  3IC7 A;  4WXC A;  4HNT A;  4RAG A;  1ETW A;  1MMA A;  1SAX A;  2Y0S N;  4IRG A;  3EUA A;  2Z5U A;  3TW6 A;  4CZZ A;  2EPF A;  1O3R A;  2WV0 A;  4NBQ A;  3S93 A;  1W0T A;  4B47 A;  1JKR C;  2Z16 A;  3CCQ I;  2VQH A;  1IN4 A;  2HPI A;  3M4O J;  5E1Z B;  2IS4 A;  1FTZ A;  4AVP A;  1IO2 A;  4XLE A;  4NC7 A;  1VQM I;  3K4B A;  3KP6 A;  4IOC F;  4A0Y A;  4BAC A;  2ZC2 A;  2CG4 A;  4ZZL A;  1FEX A;  1S5L C;  2LBF A;  4D0P A;  1ONV A;  4DBR A;  4U0Y A;  1CGP A;  2OBP A;  1XSV A;  3ZQI A;  3N97 A;  1PUE E;  2MLG A;  2EFQ A;  5M5W J;  1J9I A;  3BOQ A;  3P9I A;  1BOB A;  3KZY A;  4JX5 A;  3HSR A;  2HOT A;  1A31 A;  2NVQ J;  3V8L A;  2VAS A;  1EKE A;  3K2Z A;  3ZGK A;  1I1S A;  4D7M A;  3ZP5 A;  2Y0S A;  1W7P D;  4BUP A;  3OYA A;  1OR7 C;  1LDJ A;  3FMR A;  4XOR A;  1FMW A;  4HNU A;  3JSO A;  3CCR I;  1H8A C;  2XGC A;  1A35 A;  3L2C A;  4UVA A;  4LG0 A;  3VPR A;  3OS1 A;  3DLL F;  3CLQ A;  1IRZ A;  5D6F A;  5LHH A;  4UUT A;  1OR7 A;  4E70 A;  2ESN A;  2KDZ A;  4IKF A;  1S29 A;  1MJB A;  4U7B A;  5E1W A;  1E3H A;  4BJ5 C;  2KP6 A;  1RRJ A;  3KLO A;  3OYB A;  2K9Q A;  4ESB A;  4Y13 A;  1RES A;  2NAZ A;  2VKE A;  1YX3 A;  1ZLJ A;  4A3B J;  4BHC A;  5KAF C;  1R5G A;  4X0G A;  1O7F A;  3K7A J;  1XN7 A;  2QM3 A;  3DLA A;  5GAG J;  2NVY J;  5HLT A;  3T0Y A;  1ZAO A;  1GT0 C;  2VQL A;  4E4H A;  4FE4 A;  4IHY A;  2YX7 A;  4NB5 A;  3SDG A;  1D8K A;  1OKR A;  3CDH A;  2FOK A;  2P5K A;  3GCM A;  1ZRC A;  2E1M B;  1JI8 A;  3CC4 I;  4Y7N J;  5A2Q Z;  4F93 B;  1JKQ C;  4KDP A;  3TO9 A;  4HOB A;  3ULQ B;  2R7R A;  5C44 J;  2YU9 J;  2D45 A;  2OV7 A;  3OYD A;  1BBY A;  4I09 A;  4BE1 A;  1OJL A;  2R7Z J;  1IGN A;  1H0M A;  1LE8 B;  3MD2 A;  1BR4 A;  3M07 A;  1FJL A;  1KU7 A;  1IAW A;  2K3P A;  4LGW A;  1MH3 A;  3RJP A;  4XRS G;  4EVI A;  1QVU A;  1YJN I;  2DOD A;  2HYJ A;  1XB4 A;  1ZR2 A;  3AL0 B;  2AQE A;  3CES A;  2A6E F;  1IZ1 A;  3QPS A;  4HRI A;  2XGX A;  4CCM A;  2PJR B;  3OY9 A;  3S2D J;  3DCF A;  3VDX A;  1ZHF A;  3ZQL A;  2VE9 A;  2XIG A;  4FCY A;  2R7D A;  1ZN2 A;  4MIM A;  1PP7 U;  3J7Z I;  2JK3 A;  2R7X A;  2BY0 A;  1E3P A;  1EA3 A;  2K85 A;  3ROU A;  3IH2 A;  4WCG A;  4BDY A;  1FP2 A;  1ETY A;  2COM A;  2QVO A;  4UB6 C;  5BQT A;  4LIT A;  2JA8 J;  5DUK A;  3G3Z A;  4U0V A;  1B6A A;  4ZTJ A;  1WI3 A;  3RI4 A;  1BC7 C;  3ZCO A;  1RR8 C;  2KIU A;  3F6O A;  3E6M A;  3MQ0 A;  3TO6 A;  4KUM A;  5IP6 A;  4A3J J;  2GZW A;  3WG9 A;  1FP1 D;  2QEN A;  4OWR B;  4A3E J;  1YI2 I;  4ASN A;  4F7Z A;  3HHG A;  4G6D A;  2AS5 F;  2Q0O A;  4BH9 A;  2O03 A;  2BOL A;  2HFH A;  1D5V A;  4ZH4 F;  3KCC A;  2MGQ A;  4HV5 A;  5KHD A;  2LF8 A;  4JYK A;  3DPU A;  4IXA A;  2A68 F;  3KYL A;  2WB1 N;  1APL C;  2GIZ A;  1SVO A;  1S72 I;  2IP2 A;  2W57 A;  4RAZ A;  5J1Y A;  4RB2 C;  1YLF A;  2LY9 A;  2D1V A;  1V4R A;  3BRO A;  3C3W A;  3UKG A;  5IP7 J;  1TW3 A;  4A69 C;  4A2U A;  2E5N A;  3L09 A;  2XVC A;  5F08 A;  3HRM A;  3FHZ A;  1VF9 A;  4HDU A;  4I6Z A;  2FBI A;  2JTV A;  1I27 A;  2HKO A;  2OTJ I;  4S05 A;  1VQ7 I;  3ZOB A;  2BY3 A;  1Y1V J;  1TWH J;  3HUG B;  4BXF A;  2BY1 A;  5FKM A;  2NXN B;  1P92 A;  3PQK A;  1OMI A;  5H6Q A;  3ABU A;  4LLG F;  4M9X A;  3S8P A;  2HOA A;  3TL4 X;  4ZDO A;  2P5L C;  2G0E A;  1XDU A;  3WTT C;  2I5U A;  2XKP A;  4UVB A;  1QZY A;  3DWL E;  3OOU A;  2V1N A;  3SFI A;  4RDU A;  1D8J A;  2WBM A;  1XGO A;  1UCR A;  2WB1 A;  2ECB A;  3VYS B;  1VFC A;  4F3Q A;  4BEH B;  4ZDL A;  4CDG A;  2HVS A;  4Q48 A;  2FMY A;  4EM1 A;  2HR3 A;  1HW5 A;  3BR3 A;  4LOC A;  4XKW A;  1D1A A;  2IRF G;  1HW2 A;  2M0C A;  3S1M J;  1ON1 A;  3P9K A;  1EF4 A;  3P5J A;  1XPX A;  5F6F A;  4BDZ A;  4PDK A;  1FT9 A;  3I4P A;  5J8C A;  4CYC B;  4OIO F;  1FIA A;  4CSW A;  3L2U A;  3BR1 A;  4BHB A;  2HYG D;  3K70 D;  2OQG A;  1IJW C;  3GME A;  4A3M J;  3P7N A;  5JHF A;  3DKX A;  4FET A;  2KZV A;  4U88 A;  4A3C J;  4EV0 A;  3VYT B;  2DTR A;  1BIB A;  1BJZ A;  3BCA A;  3QWL A;  1G59 A;  5JR3 A;  1KU3 A;  2LRD A;  3HRT A;  3V8K A;  3F23 A;  1I50 J;  1ZKG A;  3VB2 A;  2DN0 A;  4F92 B;  4V2F A;  2QBY A;  3IWF A;  1BI2 A;  3EPZ A;  2P6T A;  4XIC A;  2VOO A;  3EUH A;  1MBG A;  1Z9C A;  4GCV A;  1P9Q C;  5EG0 B;  4N4N B;  2DK8 A;  2X85 A;  2ISZ A;  2E19 A;  4GYI A;  1MBE A;  3BCB A;  4X1E A;  4HLY A;  2PJR A;  1W1W E;  2DMQ A;  5BPI A;  2NVX J;  2HOE A;  3GWZ A;  2R0Q C;  4CA0 A;  5DD4 A;  2NVU B;  2ZCW A;  4MGR A;  3EYY A;  1HQC A;  3ZPL A;  3OYC A;  2DOA A;  2K9N A;  2B0L A;  3H9Q A;  2TDX A;  2NS0 A;  4UUS B;  4MO7 A;  2P7V B;  2BHY A;  3PIP F;  2EIJ H;  4YFN F;  1R22 A;  2PMU A;  1OCP A;  5FD6 A;  2BE5 F;  2HGC A;  5HOO A;  4U0W A;  3PNT A;  3D5R C;  2QSH X;  1U8R A;  3TDZ C;  2A5W A;  1R4N B;  2JPB A;  2IBD A;  2VLA A;  1LJ9 A;  4JX4 A;  4P5O A;  4C30 A;  3HBL A;  2YUS A;  1Z05 A;  4ZTF A;  4KA4 A;  2VBX A;  3L2Q A;  1YIT I;  3M8J A;  4PZJ A;  4MTD A;  1F4K A;  1CQT A;  2V1U A;  3LL7 A;  3LSH A;  2V1D A;  5ILS A;  1WCM J;  5GPC A;  3I4M J;  3ABK H;  2QEX I;  1FOY A;  2RGV A;  2RC4 A;  3GVA A;  1Z1D A;  1MBJ A;  2CV0 A;  2E2H J;  4XQF A;  5FLV A;  2OQR A;  2N8G A;  2K02 A;  3LSP A;  5GP9 A;  3BC8 A;  4WXD A;  2XPV A;  3DEU A;  3GTM J;  3HUG A;  2DMU A;  1V5F A;  2OCE A;  1X4O A;  4NNJ A;  2DMT A;  2Q1Z B;  3I59 A;  3NAU A;  2O7O A;  1LDK B;  5AIQ A;  3HOZ J;  2HWV A;  4O6J A;  5D5U B;  5KCM A;  3QU6 A;  2B63 J;  3ISP A;  1Y0N A;  2HU9 A;  4EJW A;  1SEU A;  3OIO A;  4XL9 A;  4BYY A;  2V1X A;  2QKM B;  1Q1H A;  1SFK A;  5L3G A;  3HC7 A;  4XKV A;  2HTS A;  3OYN A;  4BEH A;  3K4M A;  1MIJ A;  3QP6 A;  2LC2 A;  1NH3 A;  9ANT A;  3OSF A;  3V42 A;  4IRI A;  4OAZ A;  5IT9 K;  1IDY A;  3I53 A;  5ICE A;  2QUF A;  3E3V A;  3WTW C;  1V5E A;  3OL4 A;  3RZO J;  1J09 A;  3JAM K;  3W2A A;  4IRH A;  2OPT A;  1TW2 A;  1K61 A;  2MW8 A;  1TWC J;  4OOI A;  5EF6 A;  2KL4 A;  4CYC A;  4DZJ A;  1AOY A;  1R71 A;  3ZMV A;  4AM3 A;  3BTI A;  2ZXI A;  2DDB A;  3RKY A;  5EZG A;  3S32 A;  5HLG A;  4PK4 A;  5DM6 F;  3VSK A;  2CQK A;  1XMX A;  3HGY A;  3B73 A;  1MDM B;  4BQA A;  1TBX A;  1F43 A;  3CZ6 A;  3RQ4 A;  3EET A;  3CCJ I;  3J81 K;  4OIQ F;  1X58 A;  1M1E B;  1K6Y A;  2ESH A;  3EDP A;  1E3O C;  5FKO A;  2FSW A;  2X6O A;  2HS5 A;  3H3U A;  2B9S A;  5EG0 A;  1JHF A;  3CCV I;  2L2O A;  4W97 A;  1RUO A;  3D1N I;  2X0L A;  1K78 B;  1K4S A;  4ON0 A;  2KFD A;  3JRE A;  2XAJ A;  5FD5 A;  2H09 A;  3BTL A;  2LOO A;  1TQP A;  5HDK A;  3E0J B;  2E1C A;  3C18 A;  2IT0 A;  4RAF A;  1FBS A;  2LKP A;  3GTJ J;  4JQF A;  3Q5F A;  5CQG A;  2E2I J;  4CUG A;  2ZXW H;  5IT3 A;  2R5Y A;  4E7I A;  4L9V A;  5GPA A;  4ENM A;  1JJ8 C;  2PEX A;  2HYF A;  2O6G E;  5CLS A;  2GXA A;  3FK7 A;  3AAF A;  4J19 A;  2KRC A;  3A0H C;  1UHM A;  2KT0 A;  1XTA A;  1VQ9 I;  1GXQ A;  2L0K A;  5J4V A;  4I02 A;  3K4J A;  1X1B A;  5EYR A;  1R1U A;  2WC2 A;  3JRF A;  4HX8 A;  1Z67 A;  3JCU C;  2VBY A;  5E3M A;  3BR5 A;  5HS8 A;  4YIF A;  2UUZ A;  3C1D A;  4EEF G;  2Y2Z A;  4M6X A;  2XGD A;  3HPG A;  4XLA A;  2Y31 A;  4Z2Y A;  2DTZ A;  4E7Z A;  1Y8R B;  4I0B A;  4Z6Y A;  2X6W A;  4BE2 A;  1U78 A;  1JUP A;  4F52 A;  5FRM A;  2LVS A;  2FEZ A;  2HEO A;  2WTE A;  2FRH A;  2HTJ A;  3CQZ J;  1X2N A;  2DA5 A;  4G94 A;  5B3S H;  2M34 A;  3BJA A;  4IQJ A;  1Z21 A;  1YTY A;  4XID A;  3HSF A;  2EIM H;  1MSF C;  1ZG5 A;  5LFA A;  1SD7 A;  4BJ6 C;  2RN7 A;  4I7H A;  2FNA A;  5DM7 F;  2PMH A;  4N4O B;  3O8H A;  1XDS A;  3JW4 A;  4EMS A;  3S3M A;  5DCM A;  4CCL A;  2HI3 A;  3OIQ A;  1ZGA A;  4DBQ A;  2M3A A;  1B72 A;  2L4M A;  2JUG A;  5F1R A;  1WJ5 A;  1ZG3 A;  1BW6 A;  2P4W A;  2E36 A;  3Q0V A;  2O0Y A;  5ILU A;  2P0W A;  3HOT A;  3OSG A;  3BR6 A;  1B1B A;  3MMY B;  3WGH A;  3HSE A;  2ZXJ A;  2R93 J;  1EH6 A;  2BEO A;  3ZQC A;  5IP9 J;  1F5T A;  2F5D A;  3WU1 B;  1TT5 B;  3VOD A;  2EJR A;  3PFY A;  2JA5 J;  5CVV A;  3JAM Z;  1SFX A;  4MQV A;  4GO1 A;  3I56 I;  3DBR B;  5FGM A;  1ZK8 A;  2LBF B;  3KZZ A;  2BYV E;  3CME I;  1Z77 A;  2K9M A;  2DA3 A;  1JHH A;  3FXM A;  4E7J A;  3J7A O;  4XN3 A;  3U21 A;  4M72 A;  2HDD A;  1ETO A;  4B48 A;  1GV2 A;  3FMS A;  4HDV A;  4CGZ A;  5E8I A;  1Q1V A;  1XGM A;  1A5J A;  3J81 Z;  2A61 A;  3DQV C;  1RI7 A;  2CQN A;  5IYB J;  4ZYA A;  2RQP A;  4I98 B;  4AYB N;  1T2K A;  3MZ8 A;  2XPU A;  5FJ8 J;  1FYK A;  3BLY A;  5CVR A;  1VQK I;  4XLF A;  2M8E A;  2DT7 B;  2NRA C;  3IRR A;  4M9S A;  3LNQ A;  4CCO A;  1UEL B;  4QPQ A;  3PNV A;  1UG2 A;  3W6J B;  2ZJR F;  4UV9 A;  4M6V A;  2YX4 A;  3HTU A;  4RGX A;  2V4J C;  5H2F C;  2L01 A;  3OYL A;  4OIP F;  4L0Z B;  3HRS A;  4EQQ A;  4LB6 B;  1QNT A;  1RIO H;  2FJ1 A;  3BG3 A;  1MW7 A;  3IAS 2;  2ADU A;  2FUG 2;  1EH7 A;  1Z3X A;  4YRV A;  3O3K A;  2WY7 Q;  4BJT A;  3I9V 2;  1XGN A;  2RV8 A;  1JE8 A;  2BV6 A;  2OCC H;  2VC1 A;  1G3Y A;  2LFB A;  3IUO A;  4IPA A;  2W25 A;  4AYB A;  4M74 A;  5L3F A;  3ZQF A;  1TWA J;  3K1P A;  5CVJ A;  5FRO A;  4DZP A;  3PJR A;  1LB2 A;  2E5Z A;  1QPI A;  1IN5 A;  1P7J A;  2VT2 A;  2XRO A;  1Y8Q B;  2X9D A;  4UY8 I;  4YFK F;  1WJA A;  2P7C B;  2LLK A;  1WFX A;  3FBN B;  2JA2 A;  2DA6 A;  2F5E A;  2P6S A;  3M8F A;  1ETV A;  2HOS A;  1W5C C;  3BJO A;  3BR2 A;  1B4A A;  4M6Y A;  1FBQ A;  4IZZ A;  3F8F A;  1WJF A;  3AG2 H;  2UXX A;  2GQQ A;  2QQ8 A;  1U9N A;  3GZ5 A;  5K7F A;  2O5R A;  4QPO A;  2XF5 A;  5GAH J;  4G9Y A;  4XK4 A;  2YR2 A;  1ODD A;  4XON A;  3OL3 A;  3FXU A;  2FBK A;  4E7H A;  1MBF A;  1QGP A;  3L2V A;  4KFC A;  3JRB A;  2XAH A;  5LHI A;  1STZ A;  2ICW G;  1U3E M;  2IPQ X;  3V7C A;  4RLQ A;  3TDU C;  5BMZ A;  4CIC A;  1HC8 A;  3QP5 A;  2M87 A;  1IXS B;  2GXG A;  3S2W A;  1KQ0 A;  4KN4 X;  4ETS A;  3RYP A;  3CO7 C;  1IN8 A;  3JR9 A;  2XSJ C;  3H1C A;  2ZME C;  1UAA A;  2H8R A;  3A2K A;  2BW3 A;  1R9T J;  1Z0X A;  1MD0 A;  3TED A;  1QQI A;  4B3X A;  5K7H A;  1FPQ A;  3E7L A;  4LG3 A;  5HLH A;  2MAB A;  5D5X B;  2QLZ A;  1ZTR A;  1P2F A;  3R6S A;  3WOD F;  2PG4 A;  3KYD B;  4BHP A;  1X4P A;  2CGP A;  2HZT A;  1WI9 A;  2DPU A;  1D3Y A;  4PSW A;  2W24 A;  3QYB A;  3T1B A;  1XSX A;  3IWZ A;  1SVM A;  5K5O A;  2HXI A;  1KGS A;  2DA1 A;  3SJM A;  2ME6 A;  1MNM C;  1YW9 A;  2NS7 A;  2CUF A;  3SQN A;  3MCZ A;  5EEA A;  1IXR C;  1ZG1 A;  4QIW N;  2Z33 A;  5M3F J;  1O3Q A;  4XRS A;  1RZ4 A;  1BW5 A;  5DYM A;  1DUX C;  1D1C A;  3HRU A;  2QSG X;  4CYD A;  1U2W A;  4NUB A;  2OD5 A;  3PO3 J;  1TTY A;  1A6Q A;  2KQR A;  2L7K A;  4M71 A;  3V8J A;  2KIQ A;  1A6I A;  2YU3 A;  3V4G A;  3LSR A;  4HST A;  3ZQH A;  5ICF A;  3OOP A;  2M8G X;  4C3I J;  4IEJ A;  3ZMS A;  3L1P A;  5EGO A;  2DQR A;  3MZH A;  4NC6 A;  4RBO A;  2MC3 A;  3BG7 A;  1LEA A;  5DDG A;  2R7W A;  1WVR A;  1W36 D;  1UJ8 A;  3TOA A;  1X19 A;  4PJN A;  2J5O A;  4M3D A;  2MYS A;  4RS8 A;  3DEE A;  4O3M A;  1FSE A;  3O2P E;  1I39 A;  4IHT A;  1UMQ A;  3WTV C;  3RKQ A;  2VOD A;  4M9Z A;  1IUY A;  3DTK A;  2HQ5 A;  2LSO A;  1PP8 F;  3W2W A;  4XRM A;  1R49 A;  4LB5 A;  5IOZ A;  1IN6 A;  3MZY A;  2CQQ A;  3Q3S A;  1VQ6 I;  2BVM A;  3SEQ A;  4RGU A;  5E17 F;  2FD5 A;  2X51 A;  5FFZ A;  2A69 F;  2PJP A;  2HKX A;  2W1O A;  4HX4 A;  2QBY B;  4DYQ A;  4Q5S F;  4Y3O A;  3CMA I;  3DP7 A;  2Y9Z A;  3GBG A;  3BG9 A;  4ESF A;  1AHD P;  4F55 A;  3A01 A;  4UNO A;  2X4H A;  3LSK A;  4H0E A;  1HKS A;  4BXU A;  2OU2 A;  1BL0 A;  3C2G A;  3FKJ A;  3K9T A;  1FLI A;  4ENN A;  3G73 A;  3WGG A;  1IV8 A;  3HOV J;  1R7J A;  2DCE A;  2EA2 A;  4ABZ A;  5IYD J;  1FYL A;  3C7J A;  2MD5 A;  1YIJ I;  1G3S A;  1HDD C;  1P4W A;  2B7E A;  4BNC A;  4ENK A;  4KN7 X;  3ML6 A;  4UHT A;  5FKN A;  4KIF A;  3BT9 A;  1S8N A;  2L9N A;  4IHV A;  1WZ2 A;  3FHN A;  4WXH A;  2M7A A;  1DDN A;  3PO2 J;  4H4K C;  2AO9 A;  4DYR A;  3H0D A;  4OMY A;  1U5T C;  3U9G A;  4WX9 A;  4XLC A;  3LAP A;  1KYW A;  3F8N A;  3OIP A;  2CH0 A;  1UHW A;  1XSD A;  1FMV A;  1OLT A;  1OQY A;  2EZH A;  1SD4 A;  1TLH B;  2HNH A;  4AWX B;  3IHU A;  1X1P A;  1YRN A;  2X6Y A;  3VSL A;  2HQR A;  4G7H F;  1RUN A;  1GXP A;  2H27 A;  1T0F C;  1U5T A;  2HDC A;  4QWQ A;  5F0H A;  1PVE A;  5K1Y A;  2ECC A;  1G2H A;  5IY5 H;  1MMG A;  2DJN A;  4Y17 A;  2D2W A;  3REO A;  3F22 A;  1SVL A;  1P4X A;  5DTD A;  2XUB A;  1MMD A;  3HEF A;  2H94 A;  3GFI A;  5CVI A;  4A5N A;  1ERD A;  4XOT A;  2ZJP F;  2M7B A;  2DQL A;  2NVT J;  5BPD A;  1T0F A;  2E7W A;  1OYY A;  1V55 H;  1PUF A;  5HLI A;  4B8X A;  1FZP B;  3I59 B;  5TGT A;  3V7S A;  2CW8 A;  4E7S A;  4XM3 A;  1X3Z B;  2VXZ A;  3FM5 A;  1TWF J;  2ZSI B;  5AIP A;  4QSH A;  3S1R J;  3GTO J;  4L9N A;  1WJB A;  2DU9 A;  3MKY B;  3HYI A;  1SFE A;  1Z7L A;  2EIN H;  4P9F A;  5DCF A;  1HLV A;  1S7O A;  2EFO A;  4KNY A;  1G3T A;  1XMK A;  4C2M J;  1BR2 A;  2DK5 A;  2EIL H;  2IVM A;  4DYC A;  3R0A A;  5EDN A;  2QYO A;  2K40 A;  3S3O A;  3JRA A;  4EM2 A;  4JBA A;  2Y75 A;  5C4J J;  5IPA A;  3HOS A;  3BPX A;  3A1Y A;  1LUJ B;  3GUD A;  3F3X A;  2GOX B;  1ZRF A;  2VI6 A;  1ITY A;  2GLO A;  5ED4 A;  1WJD A;  2O8X A;  2Z2S B;  3GFM A;  1R1T A;  3CJQ B;  1Z7U A;  3C2H A;  3GEZ A;  1KA8 A;  3HOX J;  2XGE A;  1LFU P;  4RMN A;  1OCT C;  5BNG A;  1J0R A;  1IG7 A;  1P4A A;  4YFX F;  2V7F A;  5DV5 A;  2ZB9 A;  4E6K G;  3HKZ N;  1ZRD A;  2VKH A;  1FC3 A;  3UR3 C;  2Y30 A;  2PX9 A;  4CCK A;  2PBI A;  1T33 A;  2XC7 A;  1Y0U A;  2V9P A;  2VJI A;  3D5L A;  5HVQ C;  4W1U A;  3GW2 A;  1T8I A;  2IGO A;  3K4N A;  5FB2 A;  1ZRE A;  3S2H J;  3GO5 A;  1JGS A;  5CYV A;  4RB3 C;  4II2 A;  3OR2 C;  3PSI A;  3KET A;  4ENJ A;  1S9H A;  2HZD A;  2Y0M A;  3I5U A;  4AVZ A;  4U7D A;  2Z1D A;  2EV6 A;  3MKZ A;  2C6Y A;  3QYE A;  1MJA A;  2E35 A;  3G4S I;  3Q9V A;  3GXO A;  2R5Y B;  3F8M A;  1FOX A;  4Y33 A;  3B02 A;  3I71 A;  4XBF A;  2DFI A;  2R5Z A;  4HX7 A;  4ZJZ A;  2JJ7 A;  3K69 A;  4G7O F;  1WJC A;  4FTH A;  1SC7 A;  2QWW A;  3RTR A;  3LSJ A;  1YHQ I;  2O3F A;  3O8G A;  5H20 A;  4IHS A;  3HKZ A;  2JSP A;  3H36 A;  1FX7 A;  2M4G A;  3HB9 A;  3RSN A;  3VYR B;  1D0Y A;  1MND A;  2P5V A;  1HSJ A;  5HDN A;  2QA4 I;  2EZK A;  2R7O A;  3FIS A;  2LKS A;  2M1B A;  4BL0 B;  2R7S A;  3HXL A;  2PQ8 A;  4BBR J;  1I6H J;  5F1J A;  3OYK A;  2JRT A;  2W7N A;  5FLM J;  3F8C A;  4AC0 A;  1VTN C;  3HL2 A;  2CW7 A;  1NHA A;  3PL8 A;  2RKH A;  3C2B A;  3WGI A;  2CMP A;  2R7F A;  1S7E A;  4XKB A;  2GAU A;  4PFP A;  3I58 A;  3SYT A;  3FIW A;  3HG9 A;  3U2R A;  3LA3 A;  1ZR4 A;  4EAT A;  1VQN I;  2VUM J;  4ZYH A;  2IS2 A;  1ZYR F;  3ECH A;  3ESW B;  1YS6 A;  3M7G A;  3MVP A;  2GXB A;  3PSF A;  2K27 A;  4BE0 A;  5J1U A;  3TW7 A;  1T39 A;  3WU2 C;  3GF2 A;  4A3F J;  3OS0 A;  1R00 A;  4KMF A;  5DCM B;  5LEK A;  2OUM A;  4PUS A;  1B72 B;  2BY2 A;  3FX3 A;  4M3E A;  3KP3 A;  3HOU J;  2COB A;  2A6H F;  2RNJ A;  1GUU A;  1FY7 A;  3E6D A;  5JVT A;  2W82 A;  1IDZ A;  2L7M P;  2O8K A;  1HA8 A;  1OPC A;  3HZJ A;  2R7T A;  1USS A;  3BQZ A;  3LQQ A;  4B3A A;  2IXS A;  5DUI A;  1ETQ A;  4LLL A;  2IAI A;  5KAI C;  1V54 H;  5HNF A;  5E3L A;  3DKW A;  3OYJ A;  3DBH B;  1H9T A;  3H9G A;  2KLO A;  5ICG A;  3HPH A;  2KKO A;  2YPR A;  3ZMZ A;  2STT A;  2CQX A;  5LLQ A;  2DFF A;  3L9F A;  2AXT C;  1I3A A;  2VT3 A;  2DT5 A;  2F5V A;  2FE3 A;  4RM2 A;  1O7L A;  2NNN A;  1LNW A;  2EA4 A;  2L02 A;  1XMA A;  1MBK A;  2BXY A;  1T08 B;  1DQU A;  3E5X A;  2QQ9 A;  1MNE A;  1Z3Y A;  3RPQ A;  2GOM A;  4EJU A;  1N25 A;  4RB0 A;  2KRH A;  1YW7 A;  3H5R A;  1TZL A;  4WWC A;  5TRD A;  1WH5 A;  2A6T A;  1EH8 A;  1A36 A;  2EK5 A;  5CJ9 A;  3KIO A;  2W85 A;  5CVU A;  3D5S C;  1YOV B;  3BZC A;  3O6B B;  1UG0 A;  1WWX A;  3CLO A;  3M9A A;  4MQ9 F;  4L9T A;  2M0M A;  1U0J A;  2W4S A;  4MFD A;  2LNB A;  2JWT A;  4LIU A;  2CSO A;  2QQA A;  1KYZ A;  3W3C A;  3LSM A;  4ITV A;  3CF5 F;  2MD0 A;  3MWM A;  2LMD A;  3CUQ C;  3RPU A;  3ZXS A;  1MJ9 A;  1HOM A;  5J3L A;  2KMU A;  1WGX A;  1F36 A;  4Y4R A;  3DKY A;  3PNY A;  4DIQ A;  1U9O A;  3CC2 I;  2L54 A;  3CUQ A;  1J2X A;  2HDW A;  1E0E A;  1L0O C;  4FX0 A;  2XSD C;  2IA0 A;  4A3G J;  2IGN A;  4IHX A;  1MMS A;  1YYV A;  2F4O B;  4IX7 A;  4ZYE A;  4DQ2 A;  3ERE D;  2DMP A;  1EJ9 A;  1JTX A;  2GA2 A;  1Y56 A;  1TT0 A;  4GDF A;  2OAZ A;  4AU7 A;  4MEY F;  3IV5 A;  2JT1 A;  3G6E I;  4O5V A;  2AQF A;  2GIV A;  5HS9 A;  3G2B A;  3ZMD A;  5K5Q A;  3QU3 A;  3L2R A;  2R7Q A;  3H35 A;  3IH3 A;  1ZAR A;  1VQP I;  4C3J J;  1QO0 D;  2VQG A;  3TKY A;  5IYC J;  2HXO A;  1T38 A;  3LOC A;  5EEH A;  3BY6 A;  4HAM A;  5JI6 A;  1R1V A;  3K2A A;  1ORK A;  2L3D A;  2LTP A;  2XV4 S;  2Q8K A;  2RNG A;  2F48 A;  1MSE C;  1J5Y A;  4RGS A;  3S3N A;  1ZEL A;  2ELJ A;  4OMZ A;  2WY8 Q;  2DFH A;  2IW5 A;  2LH9 A;  3CP2 A;  5B1A H;  2M4K A;  3CC7 I;  2IS6 A; 
#chains in the Genus database with same CATH homology
 1XCV A;  3LA7 A;  1KU9 A;  4P96 A;  5IT9 Z;  4I0A A;  4MEX F;  1BC8 C;  3VEP A;  1B9N A;  3OV8 A;  2H6B A;  2V9V A;  4MHG A;  3ZQ7 A;  5D5V B;  1HXD A;  2ZME B;  1R36 A;  2A3S A;  3DF8 A;  4L9J A;  4CO8 A;  3MFK A;  1IN7 A;  2PI0 A;  2CFX A;  3ZMU A;  1ZH5 A;  4A6D A;  4AIJ A;  1W4M A;  3SXY A;  3TGN A;  3GZ6 A;  1BIA A;  3CO6 C;  1Z91 A;  1TQM A;  4P55 A;  4EJO A;  4A5M A;  1HKQ A;  3EQL F;  1W7P A;  1LQ1 A;  2K4B A;  1KQ9 A;  4ZYG A;  3ZMT A;  5HS7 A;  1C0W A;  2K86 A;  5HDG A;  1YFH A;  1XD7 A;  1IXC A;  4IJA A;  4EGZ A;  1O3T A;  2FU4 A;  3K1N A;  1V3F A;  1X3U A;  2DPD A;  1WRJ A;  4XRF A;  1WQ2 A;  5TJJ A;  4G6Q A;  3SZT A;  3KP2 A;  4M73 A;  3BDD A;  5LGN A;  5BOX A;  2D1H A;  3QOP A;  4G8X A;  3F6V A;  4HQE A;  3GFJ A;  2H6C A;  1JXS A;  2XKO A;  4IVN A;  1G4D A;  4RGR A;  2JZY A;  1J59 A;  1HST A;  3M8E A;  1UB9 A;  5LGU A;  3QAH A;  4CXF A;  1IRG A;  4QLC U;  2VON A;  4KIG A;  1LDD A;  2P8T A;  2AXL A;  4HLX A;  1EV7 A;  3VOE A;  2IA1 A;  4FX4 A;  1S3J A;  2VBW A;  3KFW X;  4G7Z F;  4YII A;  2EFW A;  1CF7 B;  3QPT A;  2EB7 A;  1IW7 F;  4PCQ A;  1PDN C;  1FBU A;  3LAJ A;  1K6O A;  1FOK A;  3CTA A;  1R58 A;  4BAY A;  5E1X A;  4Q47 A;  2M45 A;  5E20 A;  2ZME A;  4LK0 F;  2V6C A;  2JSC A;  4LLN A;  3PFI A;  1SMT A;  1U5T B;  1BI0 A;  3H92 A;  1W5T A;  3ZN1 A;  1REP C;  3E6B A;  1ON2 A;  1G6N A;  3HIF A;  2VE8 A;  1BOA A;  2BGC A;  4OIR F;  4LFU A;  3WU0 A;  3LWF A;  3T8R A;  4ZYD A;  1T6S A;  3KLN A;  1TNT A;  1MKM A;  1BJA A;  2IA2 A;  2CO5 A;  4XLN F;  2K7L A;  2DI3 A;  5KK1 A;  1O3S A;  2Q2E A;  3K1M A;  4KIB A;  1WSU A;  2FML A;  1KU2 A;  4AD9 A;  2KIF A;  1KQ8 A;  5JFR A;  2ZFW A;  4PGG A;  2XAS A;  4HF1 A;  1QPM A;  1P6R A;  2NYX A;  4HF2 A;  2EFN A;  1F1Z A;  4L5I A;  4IF4 A;  2M30 A;  4I01 A;  4UVC A;  1FWZ A;  3DV8 A;  5LBQ A;  4N0B A;  2MH2 A;  5D5W B;  4ESJ A;  4HA8 A;  4P9U A;  3GFL A;  2ELH A;  4UUV A;  4A12 A;  4A0Z A;  3E6C C;  1CF7 A;  3FF5 A;  3WTY C;  5DEQ A;  5L3B A;  1QBJ A;  4FT8 A;  4N9H A;  1YQA A;  1AWC A;  3RKW A;  1T98 A;  3JTG A;  1J75 A;  1MGT A;  2XAG A;  4HQM A;  3DPL C;  3R60 A;  1Z6R A;  1XGS A;  3F72 A;  3RYR A;  2A5Y B;  4HBL A;  2G7U A;  3L00 A;  5D8K B;  1B9M A;  5K5R A;  3E5Q A;  5DD8 A;  5ICC A;  3W6K B;  4LD5 A;  2EFP A;  3KE2 A;  1LEB A;  3RKX A;  1BI3 A;  4S04 A;  4N9I A;  2FBH A;  2Z9O A;  1S6L A;  2RVC A;  3QPH A;  2FA5 A;  3COA C;  1YIO A;  2PN6 A;  2XAF A;  1HBX G;  2BBY A;  3BP8 A;  2FNP A;  5LRR A;  4EM0 B;  4ZZD A;  3NQO A;  2CW0 F;  4WF2 A;  5E18 F;  3WTU C;  1FNN A;  1IRF A;  2F2E A;  1W5S A;  2F5C A;  3PQJ A;  2ZNZ A;  5H6R A;  3D0S A;  2XRN A;  4L18 B;  3BJ6 A;  5FFX A;  4EGY A;  3ABT A;  1B59 A;  4MNU A;  4L0Y B;  4HV6 A;  1LVA A;  3EYI A;  1OYI A;  2ETH A;  1R23 A;  2J5P A;  3F21 A;  1H9G A;  2DLL A;  1YS7 A;  1O57 A;  2OZ6 A;  4B09 A;  2ZNY A;  4YG2 F;  3V7R A;  4HYE A;  4A6E A;  2CYY A;  3MAJ A;  1TNS A;  5D4S A;  1YW8 A;  3IRQ A;  3RDI A;  5D6E A;  3E97 A;  3NEU A;  2EWN A;  1Z6T A;  3DPT A;  3CUQ B;  2ZKZ A;  3VFZ A;  2O61 A;  6PAX A;  2PFB A;  2KIM A;  1I5Z A;  3N4M A;  2ZJ2 A;  1SFU A;  1MZB A;  3DXJ F;  2ISY A;  5AON A;  1J7K A;  2UZK A;  2KRF A;  4Y15 A;  4A0X A;  2RDP A;  4KT5 C;  5L3E A;  4JK1 X;  2KJC A;  2M5W A;  5LEJ A;  3KEO A;  1GHC A;  3FMQ A;  5KVR A;  5BS6 A;  1HW1 A;  5F64 A;  3Q9S A;  3GYH X;  3LQR A;  3WTX C;  2WWY A;  4PGH A;  2MH9 A;  2GA1 A;  4R79 A;  2DW4 A;  3IKV A;  2ZBK A;  3I64 A;  3WE3 A;  3KP5 A;  5EEG A;  2V79 A;  3R61 A;  1I6X A;  2OA4 A;  4I2O A;  2F5F A;  3FZV A;  2LDU A;  3HTS B;  2MA3 A;  2GWR A;  3ZN0 A;  2K4J A;  4AIH A;  3MEX A;  4XLP F;  2MLK A;  2FQ3 A;  4L5J A;  2MBF A;  4HZF A;  4AIK A;  1UST A;  1QZZ A;  1OYW A;  3LFK A;  2EV0 A;  1K79 A;  4FHT A;  2E1N A;  1E2X A;  1DPU A;  4OU0 A;  1DPR A;  2A07 F;  1W7P B;  5FLX K;  5LRS A;  1GVJ A;  4LMY A;  1SMY F;  3WE2 A;  4LJZ F;  5L3D A;  3P9C A;  4LK1 F;  3DFG A;  4RAY A;  5FO5 A;  1U6G A;  3BPV A;  2JPC A;  4NQW A;  3KP7 A;  2QQB A;  2QZ8 A;  5ERI A;  3ECO A;  4UXN A;  1DP7 P;  5LHG A;  2IJL A;  2LF7 A;  3LST A;  2Z99 A;  2DO7 A;  3R0J A;  3CUO A;  4KMU X;  3R4K A;  4OIN F;  2FXA A;  4NHJ A;  4Q4Z F;  1HKT A;  2ACJ A;  3T8T A;  1RNL A;  4R1H A;  2VN2 A;  3FXR A;  4DNC A;  3WTZ A;  3CJN A;  5ILV A;  2KJB A;  4CHU A;  2XHK A;  2OZU A;  4XSX F;  2UWM A;  2W84 A;  2ZO4 A;  3I0T A;  3IKT A;  1WKM A;  2UXN A;  2STW A;  3H3Z A;  3J80 K;  2DAO A;  4KIC A;  3GLX A;  4EJT A;  1R5H A;  3M1E A;  2DBB A;  3BWG A;  3I54 A;  1I1G A;  4R8H A;  3FWE A;  1BI1 A;  1F9N A;  1SD6 A;  4HW0 A;  3JTH A;  3GX4 X;  3ELK A;  3BZ6 A;  3QRF F;  4TV7 A;  3FM3 A;  4WK8 F;  2Y48 A;  5LGT A;  1E17 A;  1S7A A;  3SFZ A;  3TOB A;  5J8F A;  2R3S A;  5D4R A;  4GYG A;  1XCB A;  2HQN A;  1TQI A;  1ZGJ A;  3FXQ A;  1BN5 A;  5FLX Z;  1MDM A;  2FF4 A;  4HF0 A;  4GXO A;  5L3C A;  1UFM A;  3LA2 A;  5D8L B;  5J6X A;  2CWE A;  1L3L A;  1A04 A;  1IF1 A;  3F8B A;  4RB1 A;  3HHH A;  2E7X A;  1K78 A;  5E8G A;  4LG0 B;  4KYW A;  3T5X A;  4XSZ F;  2XAQ A;  3RIR A;  2VC0 A;  1YO5 C;  3E5U A;  3JSP A;  1FSH A;  1SD5 A;  1G3W A;  2PLY A;  3K0L A;  3KP4 A;  2VOP A;  2EV5 A;  2L4A A;  3KEQ A;  1ULY A;  5A2Q K;  4K2E A;  1ZLK A;  3TQN A;  2G7H A;  3NRV A;  3U1D A;  4EJV A;  3L7W A;  1YG2 A;  1BM9 A;  2YSR A;  2Z3Y A;  3SZP A;  1K7A A;  4UV8 A;  4MTE A;  2G9W A;  1FYM A;  3J80 Z;  3IL2 A;  3WTS C;  2VBZ A;  4GGG A;  3SHF A;  5JHU A;  2NNY A;  3TO7 A;  3IC7 A;  4WXC A;  1SAX A;  4IRG A;  4CZZ A;  2Z5U A;  1O3R A;  2WV0 A;  1IN4 A;  5E1Z B;  4AVP A;  3KP6 A;  4A0Y A;  2CG4 A;  4ZZL A;  4D0P A;  1ONV A;  4U0Y A;  1CGP A;  2OBP A;  1XSV A;  3N97 A;  1PUE E;  2MLG A;  2EFQ A;  1J9I A;  3BOQ A;  3P9I A;  3KZY A;  3HSR A;  3V8L A;  3K2Z A;  1I1S A;  3ZP5 A;  1W7P D;  1LDJ A;  3FMR A;  3JSO A;  3L2C A;  4UVA A;  4LG0 A;  5D6F A;  5LHH A;  1OR7 A;  4E70 A;  2ESN A;  1S29 A;  1MJB A;  4U7B A;  5E1W A;  3KLO A;  4ESB A;  4Y13 A;  2NAZ A;  1ZLJ A;  4BHC A;  1R5G A;  1O7F A;  1XN7 A;  2QM3 A;  3T0Y A;  1ZAO A;  2YX7 A;  4NB5 A;  1D8K A;  1OKR A;  3CDH A;  2FOK A;  2P5K A;  1ZRC A;  5A2Q Z;  4KDP A;  3TO9 A;  4HOB A;  3ULQ B;  2D45 A;  1BBY A;  4I09 A;  1H0M A;  1KU7 A;  1IAW A;  4LGW A;  3RJP A;  4EVI A;  1XB4 A;  2A6E F;  1IZ1 A;  2XGX A;  1ZHF A;  2VE9 A;  2XIG A;  2R7D A;  1ZN2 A;  1PP7 U;  3ROU A;  4WCG A;  1FP2 A;  2COM A;  2QVO A;  5BQT A;  5DUK A;  3G3Z A;  4U0V A;  1B6A A;  3RI4 A;  1BC7 C;  2KIU A;  3F6O A;  3E6M A;  3MQ0 A;  3TO6 A;  4KUM A;  2GZW A;  3WG9 A;  1FP1 D;  2QEN A;  4ASN A;  4F7Z A;  3HHG A;  4G6D A;  2AS5 F;  2Q0O A;  4BH9 A;  2O03 A;  2HFH A;  1D5V A;  4ZH4 F;  3KCC A;  4HV5 A;  2LF8 A;  4IXA A;  2A68 F;  2IP2 A;  2W57 A;  4RAZ A;  4RB2 C;  1YLF A;  2D1V A;  1V4R A;  3BRO A;  3C3W A;  1TW3 A;  4A2U A;  3L09 A;  2XVC A;  3HRM A;  3FHZ A;  4HDU A;  2FBI A;  2JTV A;  1I27 A;  2HKO A;  4S05 A;  1P92 A;  3PQK A;  1OMI A;  5H6Q A;  3ABU A;  4LLG F;  4M9X A;  2P5L C;  1XDU A;  3WTT C;  2XKP A;  4UVB A;  1QZY A;  1D8J A;  1XGO A;  1UCR A;  4CDG A;  4Q48 A;  2FMY A;  4EM1 A;  2HR3 A;  1HW5 A;  2IRF G;  1HW2 A;  1ON1 A;  3P9K A;  5F6F A;  4OIO F;  4PDK A;  1FT9 A;  3I4P A;  5J8C A;  4BHB A;  2HYG D;  2OQG A;  3P7N A;  4U88 A;  4EV0 A;  2DTR A;  1BIB A;  5JR3 A;  1KU3 A;  3HRT A;  3V8K A;  3F23 A;  3VB2 A;  2QBY A;  3IWF A;  1BI2 A;  2VOO A;  2P6T A;  3EUH A;  1Z9C A;  4GCV A;  2DK8 A;  2ISZ A;  4GYI A;  4HLY A;  5BPI A;  2HOE A;  3GWZ A;  5DD4 A;  2ZCW A;  4MGR A;  3EYY A;  1HQC A;  3ZPL A;  2B0L A;  2TDX A;  2NS0 A;  2P7V B;  4YFN F;  1R22 A;  2PMU A;  5FD6 A;  2BE5 F;  2HGC A;  5HOO A;  4U0W A;  1U8R A;  3TDZ C;  2JPB A;  1LJ9 A;  4P5O A;  1Z05 A;  4KA4 A;  2VBX A;  4MTD A;  4PZJ A;  2V1U A;  1F4K A;  2V1D A;  5ILS A;  2RGV A;  2RC4 A;  3GVA A;  1Z1D A;  2OQR A;  2K02 A;  4WXD A;  3DEU A;  3HUG A;  3I59 A;  5AIQ A;  1LDK B;  2HWV A;  4O6J A;  5D5U B;  3QU6 A;  3ISP A;  4EJW A;  4BYY A;  2V1X A;  1Q1H A;  5L3G A;  2HTS A;  3QP6 A;  5IT9 K;  4IRI A;  5ICE A;  3I53 A;  2QUF A;  3E3V A;  3WTW C;  3JAM K;  4IRH A;  1TW2 A;  4OOI A;  1AOY A;  3ZMV A;  3RKY A;  5HLG A;  2CQK A;  1MDM B;  3B73 A;  4BQA A;  1TBX A;  3EET A;  3J81 K;  4OIQ F;  2ESH A;  3EDP A;  2FSW A;  2HS5 A;  3H3U A;  1JHF A;  1RUO A;  2X0L A;  1K78 B;  4ON0 A;  2XAJ A;  5FD5 A;  2H09 A;  1TQP A;  5HDK A;  2E1C A;  3C18 A;  2IT0 A;  1FBS A;  2LKP A;  4JQF A;  3Q5F A;  5IT3 A;  4L9V A;  4ENM A;  2PEX A;  2HYF A;  2O6G E;  5CLS A;  3AAF A;  1UHM A;  1GXQ A;  4I02 A;  1R1U A;  2WC2 A;  4HX8 A;  2VBY A;  5HS8 A;  4YIF A;  3C1D A;  4M6X A;  4Z2Y A;  4I0B A;  1U78 A;  2FEZ A;  2HEO A;  2WTE A;  2FRH A;  2HTJ A;  4G94 A;  3BJA A;  1YTY A;  3HSF A;  1ZG5 A;  1SD7 A;  2RN7 A;  4I7H A;  2FNA A;  2PMH A;  1XDS A;  3JW4 A;  4EMS A;  5DCM A;  1ZGA A;  2L4M A;  5F1R A;  1ZG3 A;  2P4W A;  2O0Y A;  5ILU A;  3HOT A;  1B1B A;  3WGH A;  3HSE A;  2ZXJ A;  1EH6 A;  2BEO A;  1F5T A;  3WU1 B;  2F5D A;  3VOD A;  2EJR A;  5CVV A;  3JAM Z;  1SFX A;  4MQV A;  4GO1 A;  5FGM A;  3KZZ A;  2BYV E;  1JHH A;  3J7A O;  4M72 A;  4HDV A;  3FMS A;  4CGZ A;  5E8I A;  1XGM A;  3J81 Z;  2A61 A;  3DQV C;  1RI7 A;  2RQP A;  4I98 B;  1T2K A;  1FYK A;  5CVR A;  2M8E A;  2NRA C;  3IRR A;  4M9S A;  3W6J B;  4UV9 A;  2YX4 A;  3HTU A;  4RGX A;  2L01 A;  4OIP F;  4L0Z B;  3HRS A;  4EQQ A;  4LB6 B;  1QNT A;  1RIO H;  2ADU A;  1EH7 A;  3O3K A;  1XGN A;  2RV8 A;  1JE8 A;  2BV6 A;  2VC1 A;  1G3Y A;  4IPA A;  2W25 A;  4M74 A;  5L3F A;  3K1P A;  5CVJ A;  1LB2 A;  1IN5 A;  2VT2 A;  2XRO A;  4YFK F;  2P7C B;  2F5E A;  2P6S A;  3M8F A;  3BJO A;  1B4A A;  4M6Y A;  1FBQ A;  3F8F A;  2UXX A;  2GQQ A;  3GZ5 A;  4G9Y A;  2YR2 A;  1ODD A;  3FXU A;  2FBK A;  1QGP A;  4KFC A;  2XAH A;  5LHI A;  1STZ A;  1U3E M;  2IPQ X;  3V7C A;  3TDU C;  5BMZ A;  4CIC A;  3QP5 A;  2M87 A;  1IXS B;  2GXG A;  3S2W A;  1KQ0 A;  4KN4 X;  4ETS A;  3RYP A;  3CO7 C;  1IN8 A;  1MD0 A;  1QQI A;  1FPQ A;  5HLH A;  5D5X B;  2QLZ A;  1P2F A;  3R6S A;  3WOD F;  2PG4 A;  4BHP A;  2CGP A;  2HZT A;  1WI9 A;  2DPU A;  1D3Y A;  2W24 A;  3T1B A;  1XSX A;  3IWZ A;  5K5O A;  1KGS A;  1YW9 A;  3SQN A;  3MCZ A;  1IXR C;  1ZG1 A;  2Z33 A;  1O3Q A;  1RZ4 A;  5DYM A;  1DUX C;  3HRU A;  4CYD A;  1U2W A;  2OD5 A;  1TTY A;  4M71 A;  3V8J A;  2YU3 A;  3V4G A;  5ICF A;  3OOP A;  3ZMS A;  2DQR A;  3MZH A;  2MC3 A;  1LEA A;  5DDG A;  3TOA A;  2J5O A;  4RS8 A;  4O3M A;  1FSE A;  3O2P E;  4IHT A;  3WTV C;  2VOD A;  4M9Z A;  1IUY A;  2LSO A;  1PP8 F;  4LB5 A;  1IN6 A;  3MZY A;  4RGU A;  5E17 F;  5FFZ A;  2A69 F;  2PJP A;  2HKX A;  4HX4 A;  2QBY B;  4Q5S F;  3DP7 A;  4ESF A;  4UNO A;  2X4H A;  4H0E A;  1HKS A;  4BXU A;  2OU2 A;  3K9T A;  1FLI A;  4ENN A;  3G73 A;  3WGG A;  1R7J A;  2EA2 A;  1FYL A;  3C7J A;  2MD5 A;  1G3S A;  1P4W A;  4BNC A;  4ENK A;  4KN7 X;  3ML6 A;  4UHT A;  4KIF A;  1S8N A;  4WXH A;  1DDN A;  4OMY A;  1U5T C;  3U9G A;  4WX9 A;  3LAP A;  1KYW A;  3F8N A;  1UHW A;  1XSD A;  1SD4 A;  1TLH B;  4AWX B;  3IHU A;  2HQR A;  4G7H F;  1RUN A;  1GXP A;  2H27 A;  1U5T A;  2HDC A;  4QWQ A;  5K1Y A;  4Y17 A;  3REO A;  2D2W A;  3F22 A;  1P4X A;  2XUB A;  2H94 A;  3GFI A;  5CVI A;  4A5N A;  2DQL A;  5BPD A;  1T0F A;  2E7W A;  1OYY A;  5HLI A;  4B8X A;  1FZP B;  3I59 B;  3V7S A;  2VXZ A;  3FM5 A;  5AIP A;  4L9N A;  2DU9 A;  3HYI A;  1SFE A;  5DCF A;  4P9F A;  1S7O A;  2EFO A;  4KNY A;  1G3T A;  1XMK A;  2DK5 A;  2IVM A;  3R0A A;  2QYO A;  4EM2 A;  4JBA A;  2Y75 A;  3HOS A;  3BPX A;  3GUD A;  3F3X A;  1ZRF A;  5ED4 A;  2O8X A;  3GFM A;  1R1T A;  1Z7U A;  3GEZ A;  1KA8 A;  1J0R A;  1P4A A;  4YFX F;  5DV5 A;  1ZRD A;  1FC3 A;  2PBI A;  1Y0U A;  3D5L A;  5HVQ C;  3GW2 A;  1ZRE A;  5FB2 A;  3GO5 A;  1JGS A;  5CYV A;  4RB3 C;  3KET A;  4ENJ A;  3I5U A;  2Y0M A;  4U7D A;  2EV6 A;  2C6Y A;  1MJA A;  3Q9V A;  3GXO A;  3F8M A;  3B02 A;  3I71 A;  4XBF A;  2DFI A;  4HX7 A;  3K69 A;  4G7O F;  2QWW A;  3RTR A;  4IHS A;  2O3F A;  5H20 A;  1FX7 A;  2P5V A;  1HSJ A;  5HDN A;  2M1B A;  2PQ8 A;  2JRT A;  3F8C A;  1VTN C;  1NHA A;  2RKH A;  3WGI A;  2R7F A;  2GAU A;  3I58 A;  3U2R A;  3LA3 A;  4ZYH A;  1ZYR F;  3ECH A;  1YS6 A;  3M7G A;  2GXB A;  2K27 A;  1T39 A;  3GF2 A;  1R00 A;  4KMF A;  5DCM B;  5LEK A;  3FX3 A;  3KP3 A;  2A6H F;  2RNJ A;  1FY7 A;  3E6D A;  5JVT A;  1OPC A;  1USS A;  3LQQ A;  5DUI A;  4LLL A;  3DKW A;  1H9T A;  5ICG A;  2KKO A;  2YPR A;  3ZMZ A;  2STT A;  5LLQ A;  3L9F A;  2VT3 A;  2DT5 A;  2FE3 A;  1O7L A;  2NNN A;  1LNW A;  2EA4 A;  2L02 A;  1XMA A;  3E5X A;  2QQ9 A;  3RPQ A;  4EJU A;  4RB0 A;  1YW7 A;  4WWC A;  5TRD A;  1EH8 A;  2EK5 A;  5CJ9 A;  2W85 A;  5CVU A;  3O6B B;  1WWX A;  3CLO A;  3M9A A;  4MQ9 F;  4L9T A;  2LNB A;  2CSO A;  2QQA A;  1KYZ A;  3MWM A;  3CUQ C;  3RPU A;  1MJ9 A;  2L54 A;  3CUQ A;  1J2X A;  1L0O C;  4FX0 A;  2IA0 A;  1YYV A;  4ZYE A;  4DQ2 A;  3ERE D;  2GA2 A;  2OAZ A;  4MEY F;  2JT1 A;  4O5V A;  2GIV A;  5HS9 A;  3ZMD A;  5K5Q A;  3QU3 A;  1ZAR A;  1QO0 D;  3TKY A;  1T38 A;  5EEH A;  5JI6 A;  4HAM A;  3BY6 A;  1R1V A;  2L3D A;  2XV4 S;  2Q8K A;  1J5Y A;  4RGS A;  4OMZ A;  2IW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...