3J81K

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81K00
4U0VA 1FYLA 4MTDA 3D5LA 4M9SA 1QZZA 4UUVA 3J81Z 1QZYA 5JVTA 3NEUA 3CTAA 3FMQA 1RIOH 3KETA 4WK8F 4L18B 3JSPA 4MGRA 2FMLA 3D0SA 1YS7A 2L4MA 2GQQA 3LAPA 1YIOA 5JFRA 1ZN2A 3P7NA 2EV0A 2QVOA 5E1XA 2Z33A 2PI0A 3F8FA 4LB5A 2CFXA 4RAYA 3T1BA 3KLNA 4NB5A 1MJBA 1U2WA 3JW4A 2JZYA 5D6EA 3E3VA 1R23A 5FLXZ 1J9IA 2H6CA 4MQVA 2YPRA 1YW9A 1LEBA 2HKOA 3BPVA 3JTHA 4EJTA 1UCRA 4FT8A 3B73A 3MAJA 3IRRA 1B6AA 2G7UA 1B59A 2CYYA 1FZPB 2EFOA 1KU3A 4RGUA 4Q4ZF 1YYVA 1QNTA 3WTYC 4HX7A 2QQBA 3ECOA 2F2EA 2ZXJA 2JSCA 5D5VB 2Z9OA 1P2FA 3KE2A 3BP8A 2MH2A 5DCFA 2HS5A 2COMA 3V8LA 1IN6A 4BYYA 1XGSA 3R61A 2WC2A 4WCGA 2EV5A 1BIBA 3HRUA 4Q5SF 4DQ2A 3KFWX 3I4PA 2P7VB 1WI9A 2V1XA 4CDGA 2KJCA 3PFIA 2JPCA 2F5CA 3GW2A 1S3JA 4KFCA 4RGXA 2VT3A 3LAJA 1P4XA 1W7PD 5F1RA 3I54A 1XGOA 3V7CA 5ICEA 2L02A 1UHMA 3V7RA 2P7CB 3K0LA 1H9TA 4RB3C 3S2WA 2XV4S 5ILSA 2YU3A 4ESJA 2D45A 1ONVA 4ASNA 5DCMB 1KU2A 3RKWA 4HYEA 3J80K 2IA1A 1G3SA 4I09A 2QYOA 2WTEA 5K5OA 3KP3A 1U5TC 4KICA 1OKRA 4U7BA 5HS7A 4MQ9F 1B4AA 3IKTA 4ESFA 3HRSA 4XLNF 3TGNA 2JPBA 1BJAA 3H3UA 4FHTA 4ZH4F 1WQ2A 2RVCA 2EFWA 3CO7C 5BPIA 2M5WA 1D5VA 4M72A 3N4MA 2CSOA 2BGCA 4FX4A 2QQ9A 5J8FA 5HDNA 1G3TA 2W84A 4A2UA 5K5RA 2X0LA 5BOXA 4L9NA 2XGXA 3WU0A 2XAHA 5D5XB 3BWGA 2VBXA 5BQTA 4IF4A 2A69F 2W25A 1DUXC 4AIHA 3COAC 2VT2A 4YIIA 1SMYF 4OOIA 2RNJA 1XSVA 2QBYA 1IXRC 4HAMA 2OZ6A 5ED4A 4PDKA 3F23A 3O2PE 4KA4A 5EEGA 3WGGA 4IRGA 4BQAA 1R22A 3ZMDA 1XGNA 3WTZA 1O3TA 1Z9CA 5E1ZB 3R0JA 3KP6A 2P5VA 2HGCA 2IJLA 3ZN1A 2L54A 3DV8A 4KUMA 3U2RA 3EYIA 3BJAA 2L01A 4EGZA 3BJ6A 3KP7A 5IT3A 1ZRCA 5CVVA 1U3EM 4ZZDA 4ENNA 5LEKA 1W7PB 1GVJA 4K2EA 5HLHA 3TOAA 1G6NA 1ZG5A 1Q1HA 2FQ3A 2XHKA 4B09A 2ZNZA 3F6VA 4KMUX 2NRAC 4G94A 1TNTA 1CF7B 4OU0A 2F5FA 1QO0D 1P6RA 4UV9A 3K1MA 1OYIA 5CYVA 1T39A 1Z6RA 4CYDA 1FBSA 2OD5A 2E1CA 4HV6A 3LWFA 1XCVA 4LLNA 1XMAA 2CQKA 5JI6A 1SFUA 2OQGA 1LJ9A 2A3SA 4UHTA 4EJWA 4Z2YA 4EJOA 4ZZLA 4L9TA 1CF7A 1FP1D 1USSA 3V4GA 2HFHA 4DNCA 3FZVA 4XRFA 3FM5A 4KIGA 3QU3A 1GXQA 5HLIA 2ETHA 1ODDA 4LJZF 5FFZA 3T0YA 2VC0A 4I01A 4WXHA 3E6CC 5FLXK 2MBFA 1HQCA 1UHWA 5KVRA 2PMHA 4MEYF 2EFNA 3QRFF 1WRJA 1TW2A 4EVIA 4HBLA 4ENMA 2O61A 4JK1X 1I1SA 3CUQC 2K4BA 1T38A 1XMKA 4LGWA 3HSFA 1KQ0A 4HA8A 2HTJA 5IT9K 3O6BB 5DD8A 5LLQA 2QUFA 4S04A 2RV8A 4TV7A 1TLHB 3B02A 1JE8A 4IJAA 1FBUA 4HDVA 3BJOA 4IXAA 1LNWA 1ZHFA 1LDDA 1J0RA 4G6QA 1Z6TA 1MJAA 4QWQA 2PBIA 2MA3A 4NHJA 2PN6A 1MDMA 1Y0UA 4MTEA 1W5SA 2K7LA 4G8XA 2NYXA 1BIAA 1R5GA 2JTVA 2YX7A 1D3YA 1O57A 4AD9A 2ZMEB 2G7HA 4R79A 1PP7U 2HYFA 3LA2A 2LF7A 3NQOA 3HRMA 2V79A 4EJVA 1QGPA 4PCQA 2P5LC 3R0AA 3HHHA 4IRIA 5HS8A 1ZYRF 1YG2A 1USTA 1V3FA 1I6XA 1YQAA 4N0BA 3K69A 2VBYA 1HKTA 4MEXF 1FY7A 2QLZA 3V7SA 1CGPA 3REOA 4I02A 4EGYA 2UZKA 2R7DA 4N9HA 5CJ9A 5L3EA 2R7FA 3FMRA 3F8MA 2IW5A 2GXGA 1ZRFA 4LMYA 2JRTA 4XLPF 3KZYA 1F1ZA 3ULQB 1S29A 1MGTA 3T5XA 3GUDA 1IXCA 2E1NA 4HQMA 1FYMA 2XIGA 1O3RA 1ZREA 3ROUA 2P4WA 1F5TA 1G4DA 2MH9A 5HOOA 4I98B 1HBXG 2NNNA 3WTTC 1GHCA 5HVQC 4HDUA 1LB2A 2BE5F 3FXRA 2GWRA 1KYWA 1ZRDA 5AIQA 2DK5A 5L3CA 4RB2C 1RZ4A 4AVPA 4Y13A 2M87A 4KYWA 4KN4X 3QPTA 5BPDA 2OAZA 3QP5A 3QAHA 3LQQA 5DDGA 4M9XA 1YLFA 1GXPA 1XSDA 5KK1A 1JXSA 4G9YA 4KDPA 1LEAA 2GAUA 1BOAA 4RGSA 5D4SA 3TO6A 4JQFA 3C7JA 4ENJA 3QP6A 3I59A 4HLYA 3GEZA 4LB6B 1FPQA 2Q2EA 3DEUA 4XSXF 3WE2A 1PDNC 1BN5A 4GYGA 1KU9A 2VODA 1ZLJA 5LGNA 3CUQA 2HKXA 1BI2A 4YFNF 5ERIA 3RJPA 1KA8A 3R60A 5FGMA 3AAFA 2D1VA 1K6OA 5F64A 4GXOA 5L3DA 3EETA 4Q48A 1W7PA 4Q47A 2IPQX 4I0BA 1R5HA 5E1WA 1IN4A 1U5TA 1EH8A 3WTVC 2VBWA 4A0ZA 2W24A 5D8LB 3GWZA 1BBYA 1TQIA 4CICA 2DTRA 4AWXB 5ICGA 2AXLA 1L3LA 2ISZA 4G7HF 1J7KA 2K02A 1TTYA 1XDUA 4Y15A 4ENKA 1SD5A 2V9VA 1HW1A 1DPUA 2M1BA 2GA2A 3E6MA 2VC1A 2EFPA 2DFIA 4EV0A 3KZZA 2L3DA 1JHHA 1FLIA 2XUBA 3JSOA 2FBIA 3SQNA 2OQRA 2OU2A 1EV7A 4A0XA 3C18A 3BPXA 4N9IA 2FEZA 5AONA 4BHCA 3TOBA 3I58A 5DEQA 1B9MA 5JHUA 1I27A 3RYPA 4R8HA 1FYKA 2A61A 1SD7A 1RUOA 1BM9A 4LLLA 4M9ZA 1SD6A 1TW3A 3WGIA 3ABTA 2VBZA 1TQMA 3FXUA 4S05A 4M6XA 3E5UA 3KLOA 3ZPLA 5DYMA 1ZH5A 2KIMA 2RDPA 2EFQA 1OYWA 4YG2F 4UNOA 2PJPA 4L9VA 1ZG3A 3BDDA 1B9NA 1IRFA 2HQRA 3DKWA 5E18F 2JT1A 3VFZA 2XAFA 3I0TA 2FXAA 3OOPA 3P9KA 4UVCA 3EUHA 3HTUA 3SZTA 4L9JA 3ELKA 1IN5A 4HW0A 1R1TA 1R36A 1I5ZA 3M8EA 3MQ0A 4U7DA 4UV8A 2DPUA 1XSXA 4LG0B 4HX8A 2ZBKA 2KIFA 1E17A 1FC3A 3L9FA 4IVNA 4U0WA 3R4KA 3RIRA 3FMSA 4G7OF 3RPUA 1HSJA 2HOEA 1STZA 4WX9A 2R3SA 3BOQA 4OIQF 3TDUC 3LFKA 1IAWA 3VOEA 4A0YA 3GX4X 2CG4A 4ZYDA 3HUGA 1XN7A 1Z91A 2KRFA 4M74A 3I64A 4PGGA 2GZWA 1KGSA 2ZJ2A 4EJUA 1EH7A 3Q5FA 2TDXA 2E7XA 3J80Z 3R6SA 5H20A 5FO5A 4KNYA 4F7ZA 2FU4A 3Q9SA 3WG9A 5E17F 5J6XA 2STTA 3GZ6A 2XAQA 1T2KA 5LGUA 3HIFA 2VONA 5CVJA 5LBQA 1J59A 2ACJA 2IRFG 2DI3A 2W85A 2FBHA 1FSHA 3PQKA 1BC8C 1IW7F 1ZARA 2GA1A 4IPAA 3P9CA 1YW7A 2O6GE 4M6YA 4KN7X 3OV8A 3ECHA 4WF2A 2QENA 3F8BA 4OMYA 5E8IA 2QM3A 4OINF 3DF8A 2HQNA 3SZPA 3F22A 1RNLA 1E2XA 2A6EF 1YW8A 2CW0F 4KMFA 4R1HA 3VODA 1XD7A 3MFKA 1HKSA 2KJBA 5LRSA 1QBJA 4RGRA 1R00A 5HS9A 3F72A 2QZ8A 2NAZA 3K2ZA 5L3FA 3IC7A 3TQNA 4A6EA 4IRHA 2DK8A 1WKMA 2BV6A 1FBQA 3DP7A 1O3QA 4P55A 3DQVC 1D8KA 2LDUA 2MC3A 1Z7UA 2KIUA 2VE9A 2EJRA 1XDSA 3H3ZA 1FSEA 2YX4A 4LG0A 3ZMZA 1QPMA 4YIFA 1F4KA 1U5TB 2DBBA 3ZMTA 1ZAOA 4RS8A 3HSEA 3M8FA 3BZ6A 1Z1DA 2IA2A 4U0YA 1REPC 2G9WA 2MLKA 3MWMA 3Q9VA 2STWA 1SMTA 1A04A 3E6DA 2ESHA 2A07F 2HZTA 1YFHA 2ZMEA 1DDNA 3RKYA 2VN2A 3M1EA 5CVIA 2RQPA 3K1PA 4ZYEA 5FD6A 2EK5A 2P8TA 4CGZA 2HR3A 1LVAA 3MZYA 2LNBA 4RB1A 2DW4A 3V8KA 2LKPA 4ETSA 3GYHX 2NS0A 1VTNC 3DXJF 2FSWA 4AIKA 2QQAA 1ON1A 4L5IA 5BMZA 3H92A 5ILVA 3ZQ7A 2EA4A 2RN7A 1IUYA 3SHFA 3HHGA 1WSUA 2O03A 3GVAA 2WWYA 2P6TA 2O0YA 3ZMSA 1YS6A 3F3XA 4I0AA 1R7JA 4I7HA 1F9NA 1S7AA 3WTXC 4O5VA 4RB0A 2GIVA 3W6KB 4MNUA 5LHGA 4HX4A 4HLXA 2A5YB 2O8XA 5CVRA 4IHSA 1OPCA 2V6CA 4L0YB 6PAXA 2EB7A 4L5JA 3TDZC 4BXUA 4LD5A 3FM3A 4EM0B 2FF4A 2PEXA 1PUEE 2ZNYA 2Z3YA 1LDJA 1PP8F 2EV6A 1K78A 2F5EA 1P4WA 1BI0A 1Z05A 1XGMA 1R1VA 4LK1F 4M73A 3QU6A 2XKOA 3HYIA 3C1DA 3SFZA 1O7LA 2Y75A 4OIPF 4UVAA 2PQ8A 3KP2A 3I53A 3GFJA 4PZJA 4B8XA 3C3WA 3I59B 1X3UA 3O3KA 3JTGA 2C6YA 5A2QZ 5TJJA 4P9FA 4LFUA 4AIJA 3WU1B 5CVUA 1ZGJA 1WWXA 1OMIA 2DAOA 3IL2A 2J5OA 1G3WA 5IT9Z 3HOTA 3J81K 3LQRA 2ZKZA 2VOPA 3WODF 4BHBA 3F8NA 2IT0A 2ESNA 2M8EA 2XVCA 2DQRA 3K9TA 2V1DA 2HEOA 1ON2A 4GYIA 3WTWC 2IA0A 1UFMA 4E70A 4WWCA 3MCZA 5A2QK 3ZP5A 1U8RA 1AOYA 1QQIA 4FX0A 4WXCA 2H09A 5J8CA 5DUIA 2WV0A 3E6BA 1OYYA 1T0FA 3U1DA 1B1BA 3T8RA 2KKOA 2QWWA 4BHPA 1ZLKA 4KIBA 3J7AO 2YSRA 4P96A 2D2WA 2PLYA 2EA2A 2ELHA 3LA3A 2LSOA 1K79A 2VXZA 1C0WA 2FNPA 3T8TA 3FHZA 4OIRF 4O6JA 4YFKF 4CXFA 3RYRA 3WE3A 5FFXA 3QOPA 2NNYA 2RGVA 2Z5UA 5TRDA 3DPTA 4I2OA 1L0OC 1W5TA 4P9UA 1W4MA 1KU7A 3JAMZ 2XAGA 1BI3A 2DT5A 4CHUA 2M45A 4A6DA 2EWNA 2FMYA 4XBFA 5DV5A 1LQ1A 2H6BA 1KQ8A 3GXOA 3RKXA 4IHTA 5D5UB 1TQPA 4WXDA 1FT9A 3TO9A 3L7WA 2MD5A 2ZFWA 3TKYA 2H27A 1FP2A 3F6OA 4G6DA 1S7OA 2V1UA 2M30A 1ULYA 1FWZA 1K7AA 5CLSA 4GO1A 3E97A 3ZMUA 2YR2A 1YO5C 3IWZA 2HYGD 5D8KB 3LA7A 2UWMA 1HKQA 3QPHA 1HW2A 5LRRA 1U78A 1O3SA 5F6FA 3WGHA 1MD0A 2VE8A 1ZG1A 5HLGA 3PQJA 3BROA 3KCCA 1HSTA 4GGGA 2HWVA 1J5YA 3GFIA 4HQEA 1IN7A 2F5DA 2ZO4A 1H9GA 3BY6A 2Z99A 1MZBA 5JR3A 1S6LA 3SXYA 3NRVA 4KIFA 2HDCA 3TO7A 2O3FA 1T98A 3E5XA 3W6JB 4ZYGA 2OA4A 5D6FA 2XKPA 5K1YA 2Q8KA 1T6SA 2Y0MA 3HOSA 1J75A 4JBAA 1MJ9A 1IN8A 3VEPA 5D4RA 2DU9A 3IKVA 4H0EA 1SFXA 5AIPA 2LF8A 3WTSC 3ZN0A 2B0LA 5FB2A 4G7ZF 2K27A 2BEOA 3CJNA 2CGPA 1S8NA 2HTSA 1DPRA 2MLGA 3FF5A 5DD4A 2XRNA 3IRQA 2OZUA 4BAYA 1R1UA 2UXXA 3GZ5A 4KT5C 3F21A 3GFLA 4EM1A 4EMSA 5LGTA 3HSRA 2IP2A 1J2XA 4D0PA 3K1NA 2X4HA 1JGSA 5L3GA 1BC7C 3G3ZA 1P92A 5FD5A 2BYVE 3M9AA 1RUNA 4ZYHA 1MDMB 1FX7A 4BH9A 2XROA 5LHIA 1U6GA 3ML6A 4UVBA 5ILUA 4M71A 3HRTA 3ERED 1ZGAA 1XB4A 2ISYA 4CZZA 1G3YA 1IF1A 3WTUC 2PFBA 1IXSB 3ABUA 2ZCWA 5E20A 4EM2A 3G73A 4GCVA 3VB2A 3HTSB 2ADUA 1KYZA 3N97A 3GFMA 4P5OA 3LSTA 3KEQA 1I1GA 1XCBA 1V4RA 4LK0F 1JHFA 1FNNA 3EYYA 1IZ1A 3EDPA 2DLLA 2DPDA 2K86A 3MZHA 3KP5A 2A6HF 1KQ9A 2QBYB 2FE3A 1EH6A 4BNCA 3CLOA 5H6RA 1RI7A 2A68F 1DP7P 3KEOA 4RAZA 4Y17A 2P5KA 3I5UA 2DQLA 4YFXF 3ZMVA 4O3MA 4MHGA 1SFEA 3FX3A 4HV5A 4U88A 3RTRA 5EEHA 1AWCA 5DCMA 1O7FA 2W57A 1HW5A 4NQWA 5HDKA 1FOKA 2K4JA 3KP4A 4HF0A 2L4AA 2FA5A 2BBYA 2Q0OA 1UB9A 2FRHA 1OR7A 5DUKA 4CO8A 3FWEA 3V8JA 2PMUA 1TBXA 4LLGF 2H94A 3P9IA 2E7WA 5ICFA 4A12A 5LEJA 2J5PA 4UXNA 3CUOA 1K78B 5L3BA 2GXBA 1HXDA 1H0MA 2P6SA 1R58A 3RDIA 4EQQA 2IVMA 4A5MA 3I71A 1IRGA 1SAXA 3CO6C 3DFGA 2RKHA 1SD4A 3E5QA 3U9GA 2FBKA 2D1HA 2OBPA 4OMZA 3RPQA 3L00A 5K5QA 4OIOF 3JAMK 3CUQB 4L0ZB 3EQLF 2FNAA 2XASA 5D5WB 2UXNA 1YTYA 2XAJA 3CDHA 5LHHA 2FOKA 3RI4A 4A5NA 3IWFA 3ISPA 4ESBA 3FXQA 3L09A 3MEXA 4PGHA 1LDKB 2AS5F 3L2CA 1MKMA 2CWEA 5ICCA 5H6QA 3DPLC 4HF2A 3GO5A 2VOOA 5BS6A 2CO5A 4ON0A 4HOBA 2RC4A 2Y48A 4QLCU 1TNSA 3M7GA 3GLXA 3GF2A 5E8GA 1NHAA 1P4AA 2PG4A 3IHUA 4HF1A 5HDGA 2DO7A 1D8JA 4XSZF 3F8CA 1BI1A 4HZFA
chains in the Genus database with same CATH superfamily
4PJNA 4BDZA 1YITI 1Z3YA 4U0VA 1FYLA 2EBIA 2BY2A 4PJ0C 4DZJA 4MTDA 2ZXIA 3D5LA 2DA2A 1T0FC 4M9SA 1QZZA 1R4MB 4UUVA 3J81Z 4XNFA 1QZYA 1EF4A 2VQLA 5JVTA 3WHCA 3NEUA 3CTAA 3IAM2 3FMQA 2JVHA 1RIOH 2Y69H 4FASD 3HL2A 3KETA 4WK8F 4L18B 1S72I 5FKMA 3JSPA 4MGRA 1IDYA 2DFHA 2FMLA 3D0SA 1YS7A 2L4MA 2GQQA 3LAPA 3AL0B 1YIOA 2O5RA 2VQGA 4ZC3A 5JFRA 5J1YA 1DU6A 3MMYB 1ZN2A 1X3WB 3P7NA 2EV0A 4NDLA 2QVOA 5E1XA 3S16J 2Z33A 2PI0A 1FOXA 3F8FA 4LB5A 4HNUA 4A3BJ 2CFXA 2RQQA 4RAYA 3T1BA 1JUMA 3KLNA 4NB5A 1A6IA 3JRAA 1MJBA 1U2WA 3JW4A 2JZYA 2OJED 2LOOA 3O8HA 2CQ7A 5D6EA 2Y0SA 1R23A 3E3VA 1XG1A 5FLXZ 3H3VK 5EF6A 5DS9A 1J9IA 3OYDA 5E3NA 2H6CA 3FKJA 4MQVA 2YPRA 1YW9A 1EKEA 1LEBA 1B72A 2OTJI 1TT5B 2HKOA 5F27A 4II2A 3BPVA 4ZYAA 3JTHA 5DM6F 4EJTA 1UCRA 3OL3A 1X1DA 2KFDA 2UUZA 3B73A 4FT8A 3MAJA 3BG9A 3IRRA 4PSXA 5B5EC 1B6AA 2G7UA 3JRGA 3AKZA 1B59A 3RQIA 1YIJI 3FXLA 1QPIA 2CYYA 5LD2C 3HOXJ 2EFOA 1FZPB 1KU3A 4RGUA 2NVXJ 3OYJA 1MH4A 4Q4ZF 1YYVA 1QNTA 3WTYC 3CCSI 4HX7A 4QIWN 4F91B 2WA0A 3GZNB 2X1CA 2DA3A 3K70C 2QQBA 3ECOA 1IG7A 3WG7H 2F2EA 2ZXJA 1FJLA 2JSCA 2LG4A 5D5VB 3FKIJ 3DLLF 3LSPA 2Z9OA 1P2FA 3KE2A 3DWLE 2YU9J 3BP8A 2MH2A 3WU2C 3DTEA 1MMDA 2P81A 5DCFA 2HS5A 2COMA 3V8LA 2HYJA 1IN6A 3HG9A 3I9V2 4BYYA 1XGSA 3R61A 2F48A 2WC2A 4WCGA 2EV5A 3PM1A 1BIBA 1GUUA 3HRUA 4BE0A 5LFAA 4Q5SF 2ZB9A 4DQ2A 3KFWX 3I4PA 3ZQHA 1N25A 1ETKA 2LY2A 4Y33A 3BZKA 2P7VB 4XM3A 2L9RA 3HUGB 1WI9A 3MVPA 2R7ZJ 4KJZA 3Q3SA 1WJEA 2V1XA 4CDGA 3H0DA 2KJCA 1TL8A 3PFIA 2JPCA 1VZ0A 2F5CA 3GW2A 1S3JA 4KFCA 2K9LA 2M4KA 4RGXA 2ZJQF 1VQ7I 4HRIA 1PYVA 3VYRB 2LKSA 3QYEA 2K5CA 2VT3A 5FROA 3MKYB 2HDWA 3LAJA 1P4XA 4S0HB 1W7PD 2CH0A 3Q0UA 2X85A 5F1RA 2W7NA 3I54A 1XGOA 3V7CA 2F5VA 3WHBA 1FOYA 5ICEA 1I3AA 2L02A 2OTLI 4IEJA 1NG6A 3GLLA 1UHMA 4E7ZA 3V7RA 2P7CB 3VSKA 4HNTA 3OYBA 3FXMA 1VQ6I 2P0WA 3K0LA 1FEXA 1H9TA 3H5RA 4LIUA 4RB3C 5F08A 2QF7A 3S2WA 2XV4S 5ILSA 2DA5A 2YU3A 4XN3A 4ESJA 2QSFX 3CP2A 3D5RC 2D45A 1VFCA 4BGDA 1ONVA 2DA6A 1W0TA 4DW6A 4ASNA 5DCMB 1KU2A 3RKWA 4I99C 4XRSG 2LBFA 4BU2A 3S2HJ 2PX9A 3LSMA 5CKTA 4HYEA 5J1UA 3J80K 4BKXA 2IA1A 3OYGA 1G3SA 2EPFA 3AL0C 4I09A 2QYOA 2WTEA 5K5OA 3RCOA 3KP3A 1GVDA 2M0MA 4RMNA 4A3LJ 4E7LA 1DU0A 1U5TC 2IXSA 3H0GJ 4KICA 2W1OA 1OKRA 2EIMH 4NBQA 4AVZA 2EZLA 1MNMC 2ZJPF 4GFBA 4LITA 4U7BA 2BY0A 4V19K 3HPGA 5HS7A 4MQ9F 4JYKA 1B4AA 3BLYA 5F04A 3IKTA 3I55I 1TT0A 2H8WA 4ESFA 2DFEA 3HRSA 4IL6C 3VWBA 3A2KA 3KPHA 1R4NB 4XLNF 3H36A 3JRBA 5GAHJ 2XPWA 3TGNA 1NK3P 2JPBA 1BJAA 3H3UA 2ZXWH 4FHTA 4F55A 3G2BA 4UUSB 2VL8A 3G6EI 3TP3A 4IHXA 5M5WJ 4ZH4F 4CSWA 3CCYA 1WQ2A 3ONQA 2RVCA 3DLAA 2HZDA 4XLFA 2EFWA 1Z77A 5GPCA 3CO7C 4HG2A 5BPIA 2M5WA 2X6XA 1V55H 4L5EA 1D5VA 1T08B 2KZVA 3LSRA 4RAFA 4M72A 3N4MA 2CSOA 2XGCA 2BGCA 1I39A 4FX4A 3HOWJ 3BTCA 2QQ9A 2DA7A 1N77A 4XLEA 1JKOC 5J8FA 5HDNA 1G3TA 5EEAA 2W84A 2MW8A 4A2UA 2X0LA 5K5RA 5BOXA 3CD6I 4L9NA 2XGXA 2HQ5A 3WU0A 2XAHA 5D5XB 1K4SA 2WADA 3BWGA 4A3JJ 1GV5A 3S15J 1I3QJ 2KP6A 2VBXA 1NTCA 5BQTA 4IF4A 2X1DA 2A69F 3S17J 1XTAA 2W25A 1DUXC 4AIHA 3ZQIA 3K2AA 4IHYA 3COAC 2VPRA 2VT2A 3PUFA 2IGOA 1Z7LA 4YIIA 1SMYF 4OOIA 4YIRX 2RNJA 3BTIA 2F4MB 3BG7A 1XSVA 3AFHA 2CMPA 3G4SI 4M3EA 2IGNA 2MABA 1G8XA 3K4CA 2DYRH 2QBYA 1IXRC 4HAMA 5KHDA 4FETA 2OZ6A 1IGNA 5ED4A 3OYAA 3Q0VA 4PDKA 2EH3A 3F23A 3O2PE 3S1MJ 3H35A 2JMWA 1QHGA 3SDBA 1VQ8I 2XC7A 4G12A 4KA4A 5EEGA 3WGGA 3HDDA 4IRGA 1ZGWA 1R22A 4BE1A 4BQAA 3ZMDA 1XGNA 3W2AA 2EZIA 1FTTA 4DGWB 2ME0A 3WTZA 1O3TA 4B43A 1ETVA 2K3FA 3CJQB 2CQQA 4XRMA 2O7OA 4RLFA 1Z9CA 3HZJA 5EDNA 1ZQ3P 5E1ZB 3R0JA 3KP6A 2P5VA 2HGCA 2IJLA 3ZN1A 3DV8A 2L54A 4KUMA 3B6AA 3IP4B 4A3KJ 1RR8C 1R49A 3U2RA 1ETOA 2FD5A 1H89C 2CW8A 1MBEA 3EYIA 3BJAA 2BW3A 2L01A 4EGZA 2LKXA 3BJ6A 3KP7A 1U8BA 5IYDJ 5IT3A 3OMYA 3QPSA 1ZRCA 5CVVA 2BHYA 1U3EM 4IHVA 4ZZDA 3FXJA 4ENNA 2E2IJ 4DYCA 5LEKA 2CUJA 1W7PB 1GVJA 4K2EA 5IYCJ 5HLHA 3TOAA 3GTQJ 3HOUJ 1G6NA 1ZG5A 1Q1HA 2FQ3A 2OCCH 2XHKA 4B09A 2XSDC 2ZNZA 3F6VA 4KMUX 3CESA 3A4CA 2NRAC 4J19A 4G94A 1TNTA 1CF7B 4OU0A 2F5FA 1QO0D 1P6RA 4UV9A 2HDDA 3K1MA 1OYIA 5CYVA 5B66C 1T39A 1Z6RA 5EZGA 4CYDA 1FBSA 1S9HA 2OD5A 2E1CA 2LFBA 4HV6A 3LWFA 2DMUA 1XCVA 1LFUP 4LLNA 1T95A 1XMAA 4RA2A 2CQKA 3CDIA 5JI6A 2NOGA 3ZCOA 1SFUA 2OQGA 2O9LA 1LJ9A 2A3SA 2V7FA 4UHTA 4XONA 2BXYA 1FOWA 1JKQC 4C2MJ 3S14J 3PSFA 4BXFA 3IV5A 4EJWA 3H1CA 4Z2YA 4MFEA 5E3LA 5CQGA 4EJOA 4X6AJ 4ZZLA 3A01B 4L9TA 3BCBA 4XQFA 2E35A 1CF7A 5TISC 3CCEI 3C2GA 4BY1J 1FP1D 3LNQA 1USSA 2I5UA 2KDOA 4UY8I 3JCUC 4PSWA 3V4GA 2HFHA 4DNCA 3FZVA 4XRFA 3DEEA 2FUG2 1MW7A 1Y39A 3FM5A 4KIGA 4XKWA 3QU3A 1GXQA 5F0HA 2CUFA 2R0QC 3OYMA 5HLIA 2ETHA 3I4MJ 4CCLA 1ODDA 1P9QC 4JX4A 4LJZF 5FFZA 3MKLA 3T0YA 2VC0A 1G2HA 4I01A 1JTYA 3OL4A 4WXHA 3GTGJ 3E6CC 1EA3A 5FLXK 1D1CA 3K6GA 2MBFA 2WAQA 1HQCA 1UHWA 4M3GA 5KVRA 1BR1A 1YJNI 2VQCA 2ZC2A 2LMDA 2PMHA 4HPQA 4MEYF 3DBLB 2VPLA 2VI6A 2EFNA 4C30A 3QRFF 3H5AA 1WRJA 1TW2A 1F36A 2R7UA 4EVIA 4HBLA 5FKNA 4ENMA 2O61A 1QVTA 2JA2A 4JK1X 1I1SA 4JP0A 3CUQC 5IOYA 2K4BA 1T38A 2M7BA 4QSHA 1XMKA 4BL0B 1DGRM 1IV6A 4LGWA 3HSFA 2KRCA 1SAUA 2K9NA 4W1UA 1KQ0A 4HA8A 2HTJA 5IT9K 3O6BB 5DD8A 1K61A 5LLQA 2QUFA 4D9JA 4BBRJ 2XB0X 4S04A 4CCOA 2RV8A 2R5YB 3L2QA 4TV7A 1RKWA 1TLHB 1BW6A 3B02A 1JE8A 4IJAA 5J1RA 1FBUA 3CCVI 4HDVA 3BJOA 1E0EA 3HPHA 4IXAA 4Y52J 2DTZA 1LNWA 2WBMA 1ZHFA 1D0ZA 1LDDA 1J0RA 4G6QA 1Z6TA 1MJAA 2PJRB 1XPXA 4QWQA 4A3GJ 2PBIA 4OWRB 3W3CA 5FLMJ 3RZDJ 1E3HA 1MSEC 2MA3A 4NHJA 1QRYA 2PN6A 3LSHA 1MDMA 1Y0UA 3FDYA 3KIOA 4MTEA 4LIVA 1W5SA 2Y9ZA 3KYLA 4XKBA 1HA8A 2ZSHB 2GOMA 2K7LA 4G8XA 2NYXA 1BIAA 1X1PA 1R5GA 2NVUB 2B9SA 4ZJZA 2JTVA 2QKLB 2YX7A 1D3YA 4V2GA 1O57A 3M07A 3CF5F 4AD9A 2ZMEB 2G7HA 2M2EA 2HVSA 4R79A 1PP7U 2DA4A 2HYFA 4B47A 2QSHX 1YX5A 2Y0SN 4BQNA 3LA2A 5EG0B 2LF7A 3NQOA 3HRMA 1K4TA 2V79A 3DKYA 4EJVA 2DOEA 1QGPA 2X6WA 2OF7A 4CYCA 2F4OB 4JX5A 4PCQA 2P5LC 2R5YA 3R0AA 4XR6A 3HHHA 4IRIA 5HS8A 1ZYRF 2DYSH 3OSFA 3RQ4A 1O4XA 1YG2A 4F92B 1USTA 2JUGA 3SJMA 1V3FA 1I6XA 3QYFA 1YRNB 4DIQA 1YQAA 4N0BA 3K69A 2VBYA 3OSGA 4C3HJ 1HKTA 2R4GA 3RSNA 5E3OA 4MEXF 3S2DJ 1FY7A 2AHQA 2QLZA 3OR1C 3V7SA 2IEKA 4B44A 1CGPA 3REOA 3BR5A 4I02A 4EGYA 2UZKA 4J01A 1D1BA 2BW3B 2R7DA 1VQMI 4UUSA 1W5CC 1JKRC 4N9HA 5CJ9A 1PUFA 5CQEA 5L3EA 2R7FA 2LK2A 4LOCA 3FMRA 3F8MA 1Y1VJ 2GXGA 2IW5A 4BDYA 3AG1H 1ZRFA 4LMYA 2JRTA 4XLPF 2K85A 3KZYA 1F1ZA 3ULQB 3OYEA 1S29A 1MGTA 3JRHA 3ZRGA 3T5XA 3GUDA 1ETXA 3DEWA 2LVSA 1IXCA 2E1NA 4HQMA 5EZHA 1FYMA 2XIGA 1O3RA 2HXIA 2VJIA 3AG3H 3ZR8X 1ZREA 1I6HJ 1BW5A 3ROUA 1FIPA 1WHUA 2F6CA 2P4WA 1P7JA 2F4IA 4A3FJ 1FIAA 1E3OC 3HGGA 1F5TA 1G4DA 2R92J 2MH9A 5HOOA 4I98B 1HBXG 1T33A 2NNNA 4NC6A 3WTTC 3M1CA 5C4XJ 1MIJA 1GHCA 2WAFA 1MBJA 3KYDB 5HVQC 4HDUA 1LB2A 5K7ZA 2BOLA 3TL4X 3VPRA 2JSPA 3FXOA 4FTHA 2BE5F 3FXRA 2E1OA 4HNVA 1BL0A 1W1WE 2GWRA 1KYWA 2HOSA 2VJ4A 1ZRDA 5JVGF 2K9SA 1HC8A 5AIQA 2DK5A 5L3CA 4CH7A 3E7LA 4RB2C 1RZ4A 4AVPA 2NS7A 4Y13A 2M87A 3S3NA 4KYWA 4KN4X 3QPTA 5BPDA 2OAZA 2V4JC 1ZR4A 3QP5A 3NWSA 4XIDA 3QAHA 3LQQA 2ZJRF 5DDGA 4M9XA 2ZMEC 1YLFA 1GXPA 4DJAA 2TCTA 4E7IA 1XSDA 5DM7F 2OPTA 2MYSA 5KK1A 4B48A 3BT9A 1JXSA 4G9YA 2KISA 4KDPA 1LEAA 2GAUA 1BOAA 4RGSA 3PJRA 1QU3A 5D4SA 4BEHB 4W97A 3DU5A 3TO6A 4JQFA 5IP6A 4FE7A 3C7JA 4ENJA 1UHSA 4BBSJ 3QP6A 1LVKA 3I59A 4A3MJ 3P5JA 4HLYA 3GEZA 4F93B 4LB6B 1FPQA 2DT6A 4A3CJ 2Q2EA 3DEUA 2VJJA 3HKZA 2PMZA 1BOBA 4XSXF 3WE2A 1PDNC 1BN5A 4GYGA 1KU9A 2VODA 1ZLJA 2TRTA 3CUQA 5LGNA 2R7WA 1WI3A 2HKXA 3E1SA 1BI2A 2M9HA 2AQFA 2VKEA 1T8IA 2X51A 4PK4A 1H88C 3HXLA 2K40A 4YFNF 5ERIA 3RJPA 4AYBN 1KA8A 2VJ5A 3CCJI 3R60A 5FGMA 1A6QA 1WJFA 3S1RJ 1VQKI 3AAFA 1LFPA 1MNDA 2D1VA 1RPWA 1K6OA 2CV1A 5F64A 4GXOA 5L3DA 2H1KA 3EETA 4Q48A 1W7PA 3TW7A 4Q47A 2DOAA 2IPQX 4OAYA 4I0BA 1S5LC 3BQYA 4CCMA 1R5HA 2LYCA 3FBNB 5E1WA 1IN4A 1U5TA 1R71A 3W2WA 1EH8A 3WTVC 2VBWA 1B72B 1RETA 4A0ZA 2W24A 1ZR2A 2LH9A 5D8LB 3GWZA 1BBYA 3L1PA 2VKVA 1TQIA 4CICA 1PJRA 3ZQLA 4ZDPA 2DTRA 3IH2A 4M3DA 2IS2A 5C3EJ 4AWXB 2H1LA 1TWFJ 4UUTA 1NG7A 5ICGA 1SFKA 1U9OA 2AXLA 1L3LA 1BR2A 2ISZA 4G7HF 2COBA 1JJ6C 3IH3A 2FX0A 5IYBJ 1J7KA 2E2JJ 2K02A 2DDBA 2UV1A 1QVUA 1TWHJ 1TTYA 1XDUA 1G59A 2R7TA 4Y15A 3L2WA 2KZGA 3F9KA 1MMGA 4MO7A 1DP3A 2DN0A 2E2HJ 4ENKA 1SD5A 1B8IA 2V9VA 1F43A 3PIPF 1HW1A 1DPUA 4NC7A 3ZQQA 3ASOH 1IV8A 3FXKA 5FJ8J 2ID6A 2M1BA 5KAFC 3BG3A 2GA2A 1LE8B 3E6MA 2Y30A 2VC1A 1SVMA 2Q2EB 2JA5J 2EFPA 2DFIA 2M8GX 4EV0A 3KZZA 3OYIA 1NK2P 2L3DA 1MH3A 3H9JA 1JHHA 1FLIA 1YJWI 5J3LA 1YE9A 2I10A 2KPMA 2XUBA 3JSOA 2FBIA 2YS9A 1AA7A 2WAEA 3SQNA 2OQRA 4ZTFA 4LG3A 1D5YA 3N05A 2OU2A 1EV7A 3C18A 3OR2C 4A0XA 3BPXA 5BNGA 3JRIA 2DODA 2FEZA 4N9IA 5AONA 4BXXJ 1UG0A 4BHCA 3TOBA 1ETQA 2DMQA 3I58A 2BVLA 2NXNB 5DEQA 1B9MA 3CJRB 5JHUA 5GP9A 1I27A 3BR2A 4R8HA 3RYPA 1FYKA 3HOZJ 1ZKGA 2A61A 1SD7A 1RUOA 1BM9A 4LLLA 2JJ7A 2E34A 3U21A 2A6TA 4M9ZA 2O8KA 3JRDA 3J7AY 2R7OA 2Z2SB 2CFOA 2MD0A 4Y4RA 1K83J 3QOEA 3PNTA 3PO2J 2OCEA 1MBFA 5IP7J 2HOTA 1SD6A 1TW3A 3WGIA 4A93J 3ABTA 2L0KA 1BJZA 1POGA 2VBZA 2VUMJ 2NVQJ 1V54H 1TQMA 3FXUA 4S05A 4M6XA 3E5UA 4D5CA 2IAIA 3KLOA 4J00A 3LMMA 4DBQA 5JLWA 3ZPLA 5DYMA 1ZH5A 2KIMA 2RDPA 2EFQA 1OYWA 2Z1DA 4YG2F 4UNOA 1X1BA 2PJPA 5J4VA 1OJLA 1WFXA 1ZG3A 4L9VA 3BDDA 1B9NA 2GBYA 1IRFA 4ZDOA 2HQRA 3DKWA 2DJIA 5E18F 2JT1A 5TGTA 4IX7A 3VFZA 2XAFA 1A35A 3I0TA 2FXAA 3OOPA 4RDUA 3P9KA 2R5ZB 2CW7A 4UVCA 1YJ9I 3EUHA 1DGWY 3HTUA 3SZTA 4HSTA 3HBLA 4L9JA 3ELKA 2ZSIB 5JHFA 1IN5A 4HW0A 1JT6A 1R1TA 1R36A 1I5ZA 3M8EA 3MQ0A 4U7DA 5C44J 4UV8A 3OYNA 2E36A 2DPUA 5FRNA 1XSXA 4LG0B 4HX8A 2ZBKA 1HLVA 5J40A 3SDGA 2KIFA 1E17A 4M3BA 1FC3A 3L9FA 4IVNA 4AYBA 4U0WA 1AU7A 5FRMA 5J47A 4BUPA 2XAUA 3K10A 3CP8A 1X58A 3CLQA 3R4KA 3FMSA 3RIRA 4E6KG 3NWTA 4NQWB 4G7OF 5E3MA 2ID3A 1S7EA 2AO9A 3VDXA 3RPUA 1HSJA 2HOEA 3CC4I 1STZA 4WX9A 2R3SA 4BS9A 1VQLI 3BOQA 4OIQF 3TDUC 3G1OA 3LFKA 1IAWA 5GTHC 3S32A 3VOEA 4A0YA 2VXDA 3GX4X 4IKFA 1SEUA 3FIWA 2CG4A 4ZYDA 3HUGA 1XN7A 1ACIA 1Z91A 2NS8A 2KRFA 2ZXHA 4M74A 3I64A 3DTIA 3BR3A 4MIMA 4PGGA 4AM3A 2GZWA 3RPUD 3UR3C 4QTRA 3HOYJ 1V5FA 1KGSA 2HOAA 2ZJ2A 1XX5A 4EJUA 3ZXSA 1EH7A 3Q5FA 2TDXA 2E7XA 1Y0NA 4BE2A 1YRNA 3AG4H 1GT0C 3J80Z 2JWTA 3R6SA 2V9KA 2ZFUA 5H20A 5FO5A 4KNYA 1QHHD 4RLQA 1WJDA 4F7ZA 4C2TA 2FU4A 3Q9SA 5FKKA 3WG9A 3PL8A 3G71I 5E17F 2R7SA 2GM4A 5J6XA 4ITVA 4IZZA 2STTA 1ERDA 3GZ6A 2XAQA 1T2KA 3BR0A 2ICWG 5LGUA 3HIFA 2VONA 2X48A 1LPQA 5CVJA 3J7ZI 5LBQA 3GBGA 3TW6A 1J59A 1KZHA 1IUFA 2ACJA 1Y1WJ 2IRFG 2DI3A 2IGMA 2W85A 2LP0A 2WY8Q 3KZIC 2FBHA 1FSHA 3PQKA 4E4HA 1BC8C 3BG6A 1IW7F 3ABKH 1ZARA 2GA1A 4IPAA 3P9CA 1YW7A 1X1CA 2EILH 1ETYA 3PNVA 4X1EA 2O6GE 1PVEA 4M6YA 4KN7X 3OV8A 3ECHA 2KQRA 5M3MJ 2KL4A 2QENA 3A02A 3F8BA 4WF2A 5E8IA 2QA4I 4OMYA 2QM3A 3DCFA 2WY7Q 1VI0A 4OINF 3EUHC 3DF8A 2HVQA 2HQNA 3A03A 2MGQA 3K4KA 1MSFC 3SZPA 3F22A 3SFIA 1RNLA 1X19A 3BCAA 4CYCB 2DMNA 4BJTA 4DOZA 3VYSB 4AUXA 2EZHA 3BZCA 4M6VA 2HPMA 1E2XA 2A6EF 1YW8A 1AHDP 1VQPI 3H5NA 3CMMA 1IJWC 2WB1A 2CW0F 4KMFA 4R1HA 1P7IA 3VODA 1XD7A 2XPUA 2E1MC 3HB9A 3L2RA 3MFKA 1HKSA 2KJBA 5LRSA 1QBJA 4RGRA 5CPRB 2B63J 1R00A 5HS9A 2RAEA 2IS4A 3F72A 2QGUA 2QZ8A 2HI3A 1VQ5I 2NAZA 2LD5A 1SVLA 3K2ZA 5L3FA 3IC7A 1WH5A 3HOVJ 3TQNA 1VQ9I 1Z0XA 1JT0A 2A05A 4A6EA 4GRIA 4IRHA 2DK8A 4AIDA 2VB6A 1WKMA 2BV6A 4B1RA 1WJBA 1VQOI 1FBQA 3DP7A 1TC3C 3BG5A 3K7AJ 1UZCA 1O3QA 2L2OA 3MZ8A 2E1MB 4P55A 3GTKJ 3DQVC 1D8KA 2LDUA 2MC3A 3K4MA 4CCJA 3S93A 3W6VA 1Z7UA 2KIUA 2VE9A 4B3XA 3DBRB 2M34A 4ABZA 2EJRA 2LY1A 4ANJA 1XDSA 3H3ZA 1FSEA 2YX4A 4LG0A 3ZMZA 4YEJA 1QPMA 2W4SA 3FK6A 1R6RA 4FQGA 3I4NJ 4YIFA 1F4KA 1OCZH 1U5TB 2DBBA 3MD2A 3TMOA 2YUSA 4G6TB 1JI8A 4DYQA 5JLXA 2KDZA 3ZMTA 4EEFG 5EGOA 3MKZA 1ZAOA 4KITB 4XLHA 4RS8A 3HSEA 3GTPJ 1TWAJ 3M8FA 3BZ6A 2LBFB 2L9NA 1Z1DA 5F0FA 5K7FA 3ABMH 1WGXA 1OCPA 1ZTRA 2IA2A 2W48A 4U0YA 2XF5A 1REPC 2G9WA 2MLKA 2VKDA 2XPVA 2X1EA 1XMXA 1IRXA 3MWMA 3Q9VA 3OWTA 2CQNA 2LY9A 5B1BH 5GAGJ 1B8IB 5KAIC 3ABLH 2LRDA 4HEA2 2E19A 2STWA 1SMTA 1A04A 2QKMB 4AC0A 2FQ4A 3LL7A 2E71A 3E6DA 2ESHA 4BACA 2A07F 1UAAA 2HZTA 2BHZA 2R93J 1YFHA 2ZMEA 1DDNA 3RKYA 2VN2A 3CCQI 3JRFA 2R7RA 4CZCA 1LFBA 3M1EA 5CVIA 2RQPA 2CJJA 2V1NA 3K1PA 3ERMA 1X3ZB 4ZYEA 5FD6A 2EK5A 2P8TA 1ORKA 3A0HC 4CGZA 2HR3A 3QODA 1LVAA 3MZYA 2LNBA 4RB1A 4NC8A 2PJRA 2KRHA 2DW4A 2NOJB 1IRZA 2CQXA 4U87A 3V8KA 2X6YA 2LKPA 1I50J 4ETSA 3GYHX 2NS0A 1VTNC 3DXJF 2FSWA 3HJEA 3BQZA 3K4NA 2R7VA 4AIKA 2QSGX 2QQAA 4JOMA 3M4OJ 3PSIA 5F0CA 1ON1A 1WVRA 4L5IA 1UG2A 5BMZA 3H92A 4F3QA 5ILVA 5E79C 5KCMA 3ZQ7A 3EUKL 2EA4A 2RN7A 4GDFA 1IUYA 2GIZA 2L5QA 4MFDA 3SHFA 3HHGA 1WSUA 2W82A 2O03A 1Z67A 3GVAA 3K4LA 2WWYA 2P6TA 1APLC 2DT7B 2O0YA 5GPAA 3ZMSA 1WPKA 1YS6A 3F3XA 2BY3A 2IS1A 4I0AA 1R7JA 4I7HA 4D7NA 1RESA 2H8RA 3Q0WA 2R5ZA 3CCUI 2CV2A 1F9NA 1S7AA 3GMEA 3WTXC 4O5VA 2MG4A 4RB0A 2GIVA 3W6KB 4MNUA 5LHGA 2DOFA 2FOWA 2L7MP 4HX4A 4HLXA 2A5YB 1QZEA 2Y31A 2O8XA 5CVRA 1LUJB 3RKQA 4IHSA 2BY1A 1OPCA 2V6CA 4HSRA 2CUEA 2VASA 2ECCA 3VYUB 1YHQI 4H4KC 4RAGA 4L0YB 3PO3J 2HXOA 2PMZN 2HU9A 1HDDC 6PAXA 2EB7A 1R5ID 4L5JA 3ASNH 3TDZC 3LSJA 4BXUA 4LD5A 3FM3A 4EM0B 2FF4A 2PEXA 4XN0A 3C2BA 2IBDA 4PUSA 1PUEE 1J09A 5FLVA 2EIJH 1Q1VA 2ZNYA 2Z3YA 5DTDA 3K4BA 1LDJA 2JA6J 1PP8F 2EV6A 3E0JB 2DJNA 2HPIA 1K78A 2Y9YA 2OUMA 3GCMA 5IOZA 5KNLA 1Z21A 2F5EA 2V6EA 3K70D 2JA8J 1P4WA 1BI0A 1Z05A 1SC7A 1XGMA 1R1VA 4D5FA 4LK1F 3A1YA 2EIKH 3ZOBA 4M73A 5IPAA 5HLTA 3QU6A 2XKOA 2K9MA 4QPQA 3HYIA 4EATA 3ZQGA 3C1DA 3SFZA 1O7LA 2LC2A 2Y75A 4OIPF 4UVAA 2Q1ZB 3CCMI 1VQ4I 2V9PA 2PQ8A 3NARA 1ETWA 3KP2A 3I53A 3GFJA 5HNHA 4PZJA 1ZK8A 1WJ5A 3HM5A 4B8XA 3C3WA 3CJTB 1X3UA 3I59B 1OQYA 3O3KA 3JTGA 4QPOA 4JX6A 5F1JA 3CC7I 4YRVA 4M3FA 3QPLA 2IS6A 2C6YA 3V42A 5A2QZ 5TJJA 3EUAA 2ME6A 4P9FA 3TEDA 4LFUA 1EJ9A 4AIJA 3WU1B 3JREA 4I6ZA 3O8GA 5CVUA 1ZGJA 2KT0A 1WJAA 1WWXA 1OMIA 2CS3A 3JRCA 4N4OB 2DAOA 3GTMJ 5C4JJ 3OYCA 3VYTB 3IL2A 2J5OA 4RM2A 1G3WA 5IT9Z 4IQ4A 4E7SA 3HOTA 3J81K 3HGYA 4XOPA 2K9QA 3LQRA 2ECBA 2ZKZA 2HQAA 2MFZA 3HC7A 3WODF 2VOPA 4BHBA 3F8NA 1JKPC 5EYRA 2IT0A 3U1KA 1R9TJ 2G0EA 3FHNA 2ESNA 2M8EA 2XVCA 2DQRA 3K9TA 4RBOA 2V1DA 2HEOA 1ON2A 4GYIA 3WTWC 2IA0A 1UFMA 4E70A 4IO9F 1ZELA 3MCZA 5A2QK 4WWCA 3PIOF 3ZP5A 1U8RA 1AOYA 3IUOA 3KX2A 1QQIA 2EINH 4FX0A 2H09A 4OAZA 4WXCA 5J8CA 2WV0A 2ELKA 3E6BA 5DUIA 1OYYA 1T0FA 2VIXA 1B1BA 3S8PA 4PFOA 3T8RA 3U1DA 4D1QA 2E60A 5IY5H 2KKOA 2M3AA 2QWWA 1WH7A 3A0BC 4BHPA 3GTJJ 1ZLKA 4KIBA 3J7AO 4XOTA 2YSRA 1HOMA 3OOUA 4P96A 2JQ7A 2D2WA 3OIPA 2EA2A 3OIOA 2PLYA 1OISA 2ELHA 2DMPA 1OCTC 3LA3A 3M3YJ 1OCCH 2LSOA 1K79A 2VXZA 1C0WA 2FNPA 3T8TA 2BXZA 3LFUA 3FHZA 4OIRF 2HNHA 4O6JA 4YFKF 2CUZA 2E5NA 4CXFA 3RYRA 3WE3A 2OC6A 5FFXA 1RRJA 3IAS2 3QOPA 1MMNA 2NNYA 2RGVA 2Z5UA 4CCNA 1X4PA 3OIQA 5TRDA 3DPTA 4CUGA 4X0GA 3CDLA 4I2OA 1L0OC 1W5TA 4P9UA 1W4MA 3UNGC 2DXIA 1XC5A 2W00A 3H9GA 3NAUA 4C9YA 1KU7A 3S3OA 3JAMZ 2XAGA 1BI3A 4ZDLA 3FISA 2DT5A 5K7HA 4CHUA 2M45A 4A6DA 2EWNA 2FMYA 4XBFA 5DV5A 1LQ1A 2H6BA 1W36C 3GXOA 3RKXA 4IHTA 5D5UB 1KQ8A 1HCRA 1TQPA 4WXDA 1FT9A 3TO9A 3L7WA 1UJ8A 2WV1A 1MBKA 3G1MA 2MD5A 2ZFWA 3TKYA 1W36D 2H27A 4C3JJ 1FP2A 3F6OA 4G6DA 1S7OA 3VSLA 3BR6A 2V1UA 2CRGA 2M30A 2L7FP 3EPZA 1ULYA 1FWZA 2VKHA 3PUBA 3H9QA 1K7AA 1LKXA 3AG2H 2OV7A 5CLSA 3GTLJ 4GO1A 3E97A 3ZMUA 2YR2A 1YO5C 1AKHA 3F0CA 4B3AA 3IWZA 2HYGD 5D8KB 3LA7A 4IOCF 1A31A 2UWMA 1HKQA 1BA5A 3QPHA 1HW2A 3DKXA 4A3IJ 2IGKA 2XRLA 4II3A 5LRRA 1U78A 1O3SA 4PJMA 2RNGA 2FJ1A 5F6FA 1MD0A 3WGHA 4BQOA 4Y7NJ 2VE8A 2CV0A 1ZG1A 4PJLA 5HLGA 2L7KA 1PUFB 3PQJA 3BROA 3KCCA 5HNFA 3KEYA 4A69C 1ITYA 1HSTA 4GGGA 2HWVA 1J5YA 3GFIA 4HQEA 9ANTA 1IN7A 2F5DA 3S1NJ 2ZO4A 1TZLA 1H9GA 1RR7A 3BY6A 3ZQFA 2Z99A 2GLOA 1OCRH 1MZBA 5JR3A 1S6LA 3SXYA 3NRVA 4KIFA 2HDCA 3TO7A 4DBRA 2O3FA 4XICA 1T98A 3E5XA 3W6JB 4ZYGA 2OA4A 4RM3A 5D6FA 3CF2A 2XKPA 2E5ZA 5B1AH 5K1YA 1IC8A 4DZPA 4XK4A 2Q8KA 1T6SA 2VLAA 2KMUA 2Y0MA 1OFCX 2XF6A 3HOSA 1J75A 4JBAA 3LSGA 4UB8C 1MJ9A 1IN8A 2ELJA 3VEPA 5D4RA 1MMAA 2DU9A 3IKVA 4H0EA 4E7HA 1UELB 1SFXA 5AIPA 2LF8A 3WTSC 5FKLA 3ZN0A 3D5SC 4NNJA 2B0LA 1WJCA 5FB2A 2DMTA 4G7ZF 5GAEJ 2K27A 2BEOA 3CJNA 3UKGA 2CGPA 3OS2A 1S8NA 1RC9A 2HTSA 3FK7A 1JGGA 2JN6A 1DPRA 1MBHA 2MLGA 3FF5A 1YOVB 2M7AA 3FBIB 1DQUA 1WCMJ 5DD4A 1TWGJ 2XRNA 2M0CA 3PFYA 3IRQA 1ENHA 1X1AA 2BZTA 2OZUA 4BAYA 1R1UA 4PFPA 4BY7J 3CCLI 2UXXA 1T56A 2D5VA 5FKOA 1U0JA 3GZ5A 4KT5C 3F21A 4XKCA 3J7YJ 3GFLA 3OYKA 4EM1A 4E7JA 5H2FC 4EMSA 1TP4A 2NVTJ 2KLOA 1D0YA 5LGTA 2X9DA 2XSJC 3HSRA 2IP2A 1J2XA 4D0PA 3DU6A 3OS0A 4PJJA 3K1NA 4BJ5C 3DBHB 2X4HA 1JGSA 4FISA 1X2MA 4XMYA 5L3GA 3PNYA 2V26A 1BC7C 3G3ZA 1P92A 4BEHA 5FD5A 3W2VA 3A01A 2KIQA 1OR7C 2BYVE 2M4GA 3M9AA 1OCOH 2R7QA 1RUNA 4ZYHA 1MDMB 1FX7A 1WZ2A 1HF0A 4BH9A 2XROA 3SZGA 5LHIA 3OYHA 1U6GA 3ML6A 1QA6A 4UVBA 5ILUA 1W0UA 1LE8A 4M71A 3HRTA 3ERED 1ZGAA 1XB4A 5EGOB 3CQZJ 1IO2A 4KT6A 4XLAA 2ISYA 4CZZA 4IOAF 1G3YA 1Y8QB 1X4OA 1IF1A 2DCEA 3WTUC 3QQAA 4KISA 1JUSA 1BR4A 2PFBA 1IXSB 2L9VA 3ABUA 2JK3A 2ZCWA 5E20A 5GADJ 3S3MA 4EM2A 3TP0A 3DPUA 2JUCA 3G73A 4BQQA 4GCVA 3IH4A 5B3SH 4C2UA 3KYCB 3VB2A 3HTSB 2ADUA 1KYZA 4FE4A 3MKWB 1YI2I 3N97A 4UB6C 2MC4A 3G1LA 3QYBA 2WB1N 2XF7A 3GFMA 4P5OA 1V5EA 4CCKA 3LSTA 3OY9A 3KEQA 1I1GA 1XCBA 1K6YA 1V4RA 4LK0F 2GXAA 3C2HA 1JHFA 1FNNA 2I8DA 4N4NB 5GTIC 2VQHA 3EYYA 2XGEA 4XLCA 1IZ1A 4V2FA 3EDPA 2DLLA 4D7MA 2DPDA 4AU7A 2K86A 3MZHA 3KP5A 2A6HF 4Z6YA 2Z16A 3CCRI 1KQ9A 2QBYB 2FE3A 3L2UA 3OS1A 1EH6A 4BNCA 3CLOA 1JTXA 2DDAA 4XRSA 1A36A 2B7EA 1AKHB 1CQTA 5H6RA 1RI7A 1Y6IA 2A68F 2X6OA 1DP7P 3KEOA 4RAZA 1SANA 2K3PA 4Y17A 2P5KA 3I5UA 2DQLA 4YFXF 2JA7J 2JVGA 5IP9J 3ZMVA 4O3MA 4MHGA 1D1AA 1SFEA 3FX3A 3QWLA 4HV5A 3D1NI 3HKZN 4U88A 3RTRA 4I76A 5EEHA 1AWCA 5DCMA 1O7FA 3I3LA 2AQEA 2W57A 1HW5A 4NQWA 2QCOA 5HDKA 2LTPA 3GTOJ 5J4YA 1FOKA 2NVYJ 1X2NA 2BVMA 2K4JA 3KP4A 4HF0A 3HEFA 3BTLA 2L4AA 1N78A 3CMEI 1D0XA 3CC2I 3MN2A 3RZOJ 2DFFA 2FA5A 2BBYA 2Y2ZA 1JJ8C 2Q0OA 2LLKA 1SFOJ 1UB9A 2EQRA 3BR1A 2FRHA 3BTJA 1OR7A 5DUKA 2EZKA 4CO8A 3I56I 3FWEA 3V8JA 2MSYA 3SYTA 2PMUA 1TBXA 3JR9A 2AXTC 4LLGF 3M8JA 2H94A 3P9IA 2E7WA 3SEQA 5ICFA 3CZ6A 4A12A 5LEJA 2J5PA 2XGDA 4UXNA 2A5WA 3CUOA 4C3IJ 1K78B 3X2QH 5L3BA 2KHMA 2GXBA 1HXDA 5EG0A 4ZTJA 1H0MA 2P6SA 2DA1A 3CMAI 2WAQN 1R58A 3RDIA 1FTZA 4EQQA 2IVMA 1HDPA 4A5MA 1RKTA 3I71A 1IRGA 1SAXA 3CO6C 1GDTA 3DFGA 2RKHA 2QEXI 1SD4A 1GLNA 3E5QA 4DYRA 3U9GA 4Y3OA 1MBGA 2FBKA 1Y8RB 2D1HA 1V5GA 2OBPA 4OMZA 4A3EJ 3RPQA 3L00A 3OYFA 1FMWA 5K5QA 4OIOF 4P1WA 3JAMK 3S1QJ 3CUQB 4L0ZB 2XB5A 5EJCA 3EQLF 2FNAA 2XASA 2CU7A 4B4CA 4IQJA 1FMVA 5D5WB 4A3DJ 3SEZA 1JUPA 2UXNA 5M5XJ 1YTYA 3DTKA 2XAJA 3CDHA 5LHHA 4NUBA 2FOKA 3RI4A 4XORA 2RREA 4A5NA 3IWFA 5HODA 4FCYA 3ISPA 4ESBA 2N8GA 3FXQA 4MLOA 1OLTA 1NH3A 3L09A 3MEXA 3L2VA 4IHWA 3K4JA 1SVOA 1XS9A 1UMQA 4PGHA 1LDKB 1U9NA 1H8AC 2AS5F 4CA0A 3L2CA 1MKMA 1MMSA 2XDVA 2CWEA 5ICCA 3LSKA 5H6QA 3DPLC 4HF2A 3GO5A 1VQNI 2R7XA 2VOOA 1VNDA 2L9SA 5BS6A 1M1EB 2LREA 2CO5A 2L7ZA 2JRMA 4ON0A 1IDZA 4HOBA 1GV2A 2RC4A 3TBIA 2Y48A 4E7KA 4QLCU 1TNSA 3M7GA 3LSIA 5M5YJ 4BJ6C 3ESWB 3B6CA 3GLXA 3GF2A 5E8GA 1TWCJ 1NHAA 1P4AA 1YX3A 2PG4A 3IHUA 3ZQCA 3CMYA 1MNEA 5M3FJ 2HVRA 4HF1A 4YELA 1VF9A 3BC8A 4F52A 2QQ8A 5HDGA 2DO7A 1Y56A 2GOXB 3ZGKA 1D8JA 1N75A 3LOCA 4XSZF 3OYLA 4XL9A 1E3PA 3F8CA 1KONA 4XKVA 1BI1A 1Z3XA 4HZFA 2LR8A 1A5JA
chains in the Genus database with same CATH topology
4U0VA 1FYLA 4MTDA 3D5LA 4M9SA 1QZZA 4UUVA 3J81Z 1QZYA 5JVTA 3NEUA 3CTAA 3FMQA 1RIOH 3KETA 4WK8F 4L18B 3JSPA 4MGRA 2FMLA 3D0SA 1YS7A 2L4MA 2GQQA 3LAPA 1YIOA 5JFRA 1ZN2A 3P7NA 2EV0A 2QVOA 5E1XA 2Z33A 2PI0A 3F8FA 4LB5A 2CFXA 4RAYA 3T1BA 3KLNA 4NB5A 1MJBA 1U2WA 3JW4A 2JZYA 5D6EA 3E3VA 1R23A 5FLXZ 1J9IA 2H6CA 4MQVA 2YPRA 1YW9A 1LEBA 2HKOA 3BPVA 3JTHA 4EJTA 1UCRA 4FT8A 3B73A 3MAJA 3IRRA 1B6AA 2G7UA 1B59A 2CYYA 1FZPB 2EFOA 1KU3A 4RGUA 4Q4ZF 1YYVA 1QNTA 3WTYC 4HX7A 2QQBA 3ECOA 2F2EA 2ZXJA 2JSCA 5D5VB 2Z9OA 1P2FA 3KE2A 3BP8A 2MH2A 5DCFA 2HS5A 2COMA 3V8LA 1IN6A 4BYYA 1XGSA 3R61A 2WC2A 4WCGA 2EV5A 1BIBA 3HRUA 4Q5SF 4DQ2A 3KFWX 3I4PA 2P7VB 1WI9A 2V1XA 4CDGA 2KJCA 3PFIA 2JPCA 2F5CA 3GW2A 1S3JA 4KFCA 4RGXA 2VT3A 3LAJA 1P4XA 1W7PD 5F1RA 3I54A 1XGOA 3V7CA 5ICEA 2L02A 1UHMA 3V7RA 2P7CB 3K0LA 1H9TA 4RB3C 3S2WA 2XV4S 5ILSA 2YU3A 4ESJA 2D45A 1ONVA 4ASNA 5DCMB 1KU2A 3RKWA 4HYEA 3J80K 2IA1A 1G3SA 4I09A 2QYOA 2WTEA 5K5OA 3KP3A 1U5TC 4KICA 1OKRA 4U7BA 5HS7A 4MQ9F 1B4AA 3IKTA 4ESFA 3HRSA 4XLNF 3TGNA 2JPBA 1BJAA 3H3UA 4FHTA 4ZH4F 1WQ2A 2RVCA 2EFWA 3CO7C 5BPIA 2M5WA 1D5VA 4M72A 3N4MA 2CSOA 2BGCA 4FX4A 2QQ9A 5J8FA 5HDNA 1G3TA 2W84A 4A2UA 5K5RA 2X0LA 5BOXA 4L9NA 2XGXA 3WU0A 2XAHA 5D5XB 3BWGA 2VBXA 5BQTA 4IF4A 2A69F 2W25A 1DUXC 4AIHA 3COAC 2VT2A 4YIIA 1SMYF 4OOIA 2RNJA 1XSVA 2QBYA 1IXRC 4HAMA 2OZ6A 5ED4A 4PDKA 3F23A 3O2PE 4KA4A 5EEGA 3WGGA 4IRGA 4BQAA 1R22A 3ZMDA 1XGNA 3WTZA 1O3TA 1Z9CA 5E1ZB 3R0JA 3KP6A 2P5VA 2HGCA 2IJLA 3ZN1A 2L54A 3DV8A 4KUMA 3U2RA 3EYIA 3BJAA 2L01A 4EGZA 3BJ6A 3KP7A 5IT3A 1ZRCA 5CVVA 1U3EM 4ZZDA 4ENNA 5LEKA 1W7PB 1GVJA 4K2EA 5HLHA 3TOAA 1G6NA 1ZG5A 1Q1HA 2FQ3A 2XHKA 4B09A 2ZNZA 3F6VA 4KMUX 2NRAC 4G94A 1TNTA 1CF7B 4OU0A 2F5FA 1QO0D 1P6RA 4UV9A 3K1MA 1OYIA 5CYVA 1T39A 1Z6RA 4CYDA 1FBSA 2OD5A 2E1CA 4HV6A 3LWFA 1XCVA 4LLNA 1XMAA 2CQKA 5JI6A 1SFUA 2OQGA 1LJ9A 2A3SA 4UHTA 4EJWA 4Z2YA 4EJOA 4ZZLA 4L9TA 1CF7A 1FP1D 1USSA 3V4GA 2HFHA 4DNCA 3FZVA 4XRFA 3FM5A 4KIGA 3QU3A 1GXQA 5HLIA 2ETHA 1ODDA 4LJZF 5FFZA 3T0YA 2VC0A 4I01A 4WXHA 3E6CC 5FLXK 2MBFA 1HQCA 1UHWA 5KVRA 2PMHA 4MEYF 2EFNA 3QRFF 1WRJA 1TW2A 4EVIA 4HBLA 4ENMA 2O61A 4JK1X 1I1SA 3CUQC 2K4BA 1T38A 1XMKA 4LGWA 3HSFA 1KQ0A 4HA8A 2HTJA 5IT9K 3O6BB 5DD8A 5LLQA 2QUFA 4S04A 2RV8A 4TV7A 1TLHB 3B02A 1JE8A 4IJAA 1FBUA 4HDVA 3BJOA 4IXAA 1LNWA 1ZHFA 1LDDA 1J0RA 4G6QA 1Z6TA 1MJAA 4QWQA 2PBIA 2MA3A 4NHJA 2PN6A 1MDMA 1Y0UA 4MTEA 1W5SA 2K7LA 4G8XA 2NYXA 1BIAA 1R5GA 2JTVA 2YX7A 1D3YA 1O57A 4AD9A 2ZMEB 2G7HA 4R79A 1PP7U 2HYFA 3LA2A 2LF7A 3NQOA 3HRMA 2V79A 4EJVA 1QGPA 4PCQA 2P5LC 3R0AA 3HHHA 4IRIA 5HS8A 1ZYRF 1YG2A 1USTA 1V3FA 1I6XA 1YQAA 4N0BA 3K69A 2VBYA 1HKTA 4MEXF 1FY7A 2QLZA 3V7SA 1CGPA 3REOA 4I02A 4EGYA 2UZKA 2R7DA 4N9HA 5CJ9A 5L3EA 2R7FA 3FMRA 3F8MA 2IW5A 2GXGA 1ZRFA 4LMYA 2JRTA 4XLPF 3KZYA 1F1ZA 3ULQB 1S29A 1MGTA 3T5XA 3GUDA 1IXCA 2E1NA 4HQMA 1FYMA 2XIGA 1O3RA 1ZREA 3ROUA 2P4WA 1F5TA 1G4DA 2MH9A 5HOOA 4I98B 1HBXG 2NNNA 3WTTC 1GHCA 5HVQC 4HDUA 1LB2A 2BE5F 3FXRA 2GWRA 1KYWA 1ZRDA 5AIQA 2DK5A 5L3CA 4RB2C 1RZ4A 4AVPA 4Y13A 2M87A 4KYWA 4KN4X 3QPTA 5BPDA 2OAZA 3QP5A 3QAHA 3LQQA 5DDGA 4M9XA 1YLFA 1GXPA 1XSDA 5KK1A 1JXSA 4G9YA 4KDPA 1LEAA 2GAUA 1BOAA 4RGSA 5D4SA 3TO6A 4JQFA 3C7JA 4ENJA 3QP6A 3I59A 4HLYA 3GEZA 4LB6B 1FPQA 2Q2EA 3DEUA 4XSXF 3WE2A 1PDNC 1BN5A 4GYGA 1KU9A 2VODA 1ZLJA 5LGNA 3CUQA 2HKXA 1BI2A 4YFNF 5ERIA 3RJPA 1KA8A 3R60A 5FGMA 3AAFA 2D1VA 1K6OA 5F64A 4GXOA 5L3DA 3EETA 4Q48A 1W7PA 4Q47A 2IPQX 4I0BA 1R5HA 5E1WA 1IN4A 1U5TA 1EH8A 3WTVC 2VBWA 4A0ZA 2W24A 5D8LB 3GWZA 1BBYA 1TQIA 4CICA 2DTRA 4AWXB 5ICGA 2AXLA 1L3LA 2ISZA 4G7HF 1J7KA 2K02A 1TTYA 1XDUA 4Y15A 4ENKA 1SD5A 2V9VA 1HW1A 1DPUA 2M1BA 2GA2A 3E6MA 2VC1A 2EFPA 2DFIA 4EV0A 3KZZA 2L3DA 1JHHA 1FLIA 2XUBA 3JSOA 2FBIA 3SQNA 2OQRA 2OU2A 1EV7A 4A0XA 3C18A 3BPXA 4N9IA 2FEZA 5AONA 4BHCA 3TOBA 3I58A 5DEQA 1B9MA 5JHUA 1I27A 3RYPA 4R8HA 1FYKA 2A61A 1SD7A 1RUOA 1BM9A 4LLLA 4M9ZA 1SD6A 1TW3A 3WGIA 3ABTA 2VBZA 1TQMA 3FXUA 4S05A 4M6XA 3E5UA 3KLOA 3ZPLA 5DYMA 1ZH5A 2KIMA 2RDPA 2EFQA 1OYWA 4YG2F 4UNOA 2PJPA 4L9VA 1ZG3A 3BDDA 1B9NA 1IRFA 2HQRA 3DKWA 5E18F 2JT1A 3VFZA 2XAFA 3I0TA 2FXAA 3OOPA 3P9KA 4UVCA 3EUHA 3HTUA 3SZTA 4L9JA 3ELKA 1IN5A 4HW0A 1R1TA 1R36A 1I5ZA 3M8EA 3MQ0A 4U7DA 4UV8A 2DPUA 1XSXA 4LG0B 4HX8A 2ZBKA 2KIFA 1E17A 1FC3A 3L9FA 4IVNA 4U0WA 3R4KA 3RIRA 3FMSA 4G7OF 3RPUA 1HSJA 2HOEA 1STZA 4WX9A 2R3SA 3BOQA 4OIQF 3TDUC 3LFKA 1IAWA 3VOEA 4A0YA 3GX4X 2CG4A 4ZYDA 3HUGA 1XN7A 1Z91A 2KRFA 4M74A 3I64A 4PGGA 2GZWA 1KGSA 2ZJ2A 4EJUA 1EH7A 3Q5FA 2TDXA 2E7XA 3J80Z 3R6SA 5H20A 5FO5A 4KNYA 4F7ZA 2FU4A 3Q9SA 3WG9A 5E17F 5J6XA 2STTA 3GZ6A 2XAQA 1T2KA 5LGUA 3HIFA 2VONA 5CVJA 5LBQA 1J59A 2ACJA 2IRFG 2DI3A 2W85A 2FBHA 1FSHA 3PQKA 1BC8C 1IW7F 1ZARA 2GA1A 4IPAA 3P9CA 1YW7A 2O6GE 4M6YA 4KN7X 3OV8A 3ECHA 4WF2A 2QENA 3F8BA 4OMYA 5E8IA 2QM3A 4OINF 3DF8A 2HQNA 3SZPA 3F22A 1RNLA 1E2XA 2A6EF 1YW8A 2CW0F 4KMFA 4R1HA 3VODA 1XD7A 3MFKA 1HKSA 2KJBA 5LRSA 1QBJA 4RGRA 1R00A 5HS9A 3F72A 2QZ8A 2NAZA 3K2ZA 5L3FA 3IC7A 3TQNA 4A6EA 4IRHA 2DK8A 1WKMA 2BV6A 1FBQA 3DP7A 1O3QA 4P55A 3DQVC 1D8KA 2LDUA 2MC3A 1Z7UA 2KIUA 2VE9A 2EJRA 1XDSA 3H3ZA 1FSEA 2YX4A 4LG0A 3ZMZA 1QPMA 4YIFA 1F4KA 1U5TB 2DBBA 3ZMTA 1ZAOA 4RS8A 3HSEA 3M8FA 3BZ6A 1Z1DA 2IA2A 4U0YA 1REPC 2G9WA 2MLKA 3MWMA 3Q9VA 2STWA 1SMTA 1A04A 3E6DA 2ESHA 2A07F 2HZTA 1YFHA 2ZMEA 1DDNA 3RKYA 2VN2A 3M1EA 5CVIA 2RQPA 3K1PA 4ZYEA 5FD6A 2EK5A 2P8TA 4CGZA 2HR3A 1LVAA 3MZYA 2LNBA 4RB1A 2DW4A 3V8KA 2LKPA 4ETSA 3GYHX 2NS0A 1VTNC 3DXJF 2FSWA 4AIKA 2QQAA 1ON1A 4L5IA 5BMZA 3H92A 5ILVA 3ZQ7A 2EA4A 2RN7A 1IUYA 3SHFA 3HHGA 1WSUA 2O03A 3GVAA 2WWYA 2P6TA 2O0YA 3ZMSA 1YS6A 3F3XA 4I0AA 1R7JA 4I7HA 1F9NA 1S7AA 3WTXC 4O5VA 4RB0A 2GIVA 3W6KB 4MNUA 5LHGA 4HX4A 4HLXA 2A5YB 2O8XA 5CVRA 4IHSA 1OPCA 2V6CA 4L0YB 6PAXA 2EB7A 4L5JA 3TDZC 4BXUA 4LD5A 3FM3A 4EM0B 2FF4A 2PEXA 1PUEE 2ZNYA 2Z3YA 1LDJA 1PP8F 2EV6A 1K78A 2F5EA 1P4WA 1BI0A 1Z05A 1XGMA 1R1VA 4LK1F 4M73A 3QU6A 2XKOA 3HYIA 3C1DA 3SFZA 1O7LA 2Y75A 4OIPF 4UVAA 2PQ8A 3KP2A 3I53A 3GFJA 4PZJA 4B8XA 3C3WA 3I59B 1X3UA 3O3KA 3JTGA 2C6YA 5A2QZ 5TJJA 4P9FA 4LFUA 4AIJA 3WU1B 5CVUA 1ZGJA 1WWXA 1OMIA 2DAOA 3IL2A 2J5OA 1G3WA 5IT9Z 3HOTA 3J81K 3LQRA 2ZKZA 2VOPA 3WODF 4BHBA 3F8NA 2IT0A 2ESNA 2M8EA 2XVCA 2DQRA 3K9TA 2V1DA 2HEOA 1ON2A 4GYIA 3WTWC 2IA0A 1UFMA 4E70A 4WWCA 3MCZA 5A2QK 3ZP5A 1U8RA 1AOYA 1QQIA 4FX0A 4WXCA 2H09A 5J8CA 5DUIA 2WV0A 3E6BA 1OYYA 1T0FA 3U1DA 1B1BA 3T8RA 2KKOA 2QWWA 4BHPA 1ZLKA 4KIBA 3J7AO 2YSRA 4P96A 2D2WA 2PLYA 2EA2A 2ELHA 3LA3A 2LSOA 1K79A 2VXZA 1C0WA 2FNPA 3T8TA 3FHZA 4OIRF 4O6JA 4YFKF 4CXFA 3RYRA 3WE3A 5FFXA 3QOPA 2NNYA 2RGVA 2Z5UA 5TRDA 3DPTA 4I2OA 1L0OC 1W5TA 4P9UA 1W4MA 1KU7A 3JAMZ 2XAGA 1BI3A 2DT5A 4CHUA 2M45A 4A6DA 2EWNA 2FMYA 4XBFA 5DV5A 1LQ1A 2H6BA 1KQ8A 3GXOA 3RKXA 4IHTA 5D5UB 1TQPA 4WXDA 1FT9A 3TO9A 3L7WA 2MD5A 2ZFWA 3TKYA 2H27A 1FP2A 3F6OA 4G6DA 1S7OA 2V1UA 2M30A 1ULYA 1FWZA 1K7AA 5CLSA 4GO1A 3E97A 3ZMUA 2YR2A 1YO5C 3IWZA 2HYGD 5D8KB 3LA7A 2UWMA 1HKQA 3QPHA 1HW2A 5LRRA 1U78A 1O3SA 5F6FA 3WGHA 1MD0A 2VE8A 1ZG1A 5HLGA 3PQJA 3BROA 3KCCA 1HSTA 4GGGA 2HWVA 1J5YA 3GFIA 4HQEA 1IN7A 2F5DA 2ZO4A 1H9GA 3BY6A 2Z99A 1MZBA 5JR3A 1S6LA 3SXYA 3NRVA 4KIFA 2HDCA 3TO7A 2O3FA 1T98A 3E5XA 3W6JB 4ZYGA 2OA4A 5D6FA 2XKPA 5K1YA 2Q8KA 1T6SA 2Y0MA 3HOSA 1J75A 4JBAA 1MJ9A 1IN8A 3VEPA 5D4RA 2DU9A 3IKVA 4H0EA 1SFXA 5AIPA 2LF8A 3WTSC 3ZN0A 2B0LA 5FB2A 4G7ZF 2K27A 2BEOA 3CJNA 2CGPA 1S8NA 2HTSA 1DPRA 2MLGA 3FF5A 5DD4A 2XRNA 3IRQA 2OZUA 4BAYA 1R1UA 2UXXA 3GZ5A 4KT5C 3F21A 3GFLA 4EM1A 4EMSA 5LGTA 3HSRA 2IP2A 1J2XA 4D0PA 3K1NA 2X4HA 1JGSA 5L3GA 1BC7C 3G3ZA 1P92A 5FD5A 2BYVE 3M9AA 1RUNA 4ZYHA 1MDMB 1FX7A 4BH9A 2XROA 5LHIA 1U6GA 3ML6A 4UVBA 5ILUA 4M71A 3HRTA 3ERED 1ZGAA 1XB4A 2ISYA 4CZZA 1G3YA 1IF1A 3WTUC 2PFBA 1IXSB 3ABUA 2ZCWA 5E20A 4EM2A 3G73A 4GCVA 3VB2A 3HTSB 2ADUA 1KYZA 3N97A 3GFMA 4P5OA 3LSTA 3KEQA 1I1GA 1XCBA 1V4RA 4LK0F 1JHFA 1FNNA 3EYYA 1IZ1A 3EDPA 2DLLA 2DPDA 2K86A 3MZHA 3KP5A 2A6HF 1KQ9A 2QBYB 2FE3A 1EH6A 4BNCA 3CLOA 5H6RA 1RI7A 2A68F 1DP7P 3KEOA 4RAZA 4Y17A 2P5KA 3I5UA 2DQLA 4YFXF 3ZMVA 4O3MA 4MHGA 1SFEA 3FX3A 4HV5A 4U88A 3RTRA 5EEHA 1AWCA 5DCMA 1O7FA 2W57A 1HW5A 4NQWA 5HDKA 1FOKA 2K4JA 3KP4A 4HF0A 2L4AA 2FA5A 2BBYA 2Q0OA 1UB9A 2FRHA 1OR7A 5DUKA 4CO8A 3FWEA 3V8JA 2PMUA 1TBXA 4LLGF 2H94A 3P9IA 2E7WA 5ICFA 4A12A 5LEJA 2J5PA 4UXNA 3CUOA 1K78B 5L3BA 2GXBA 1HXDA 1H0MA 2P6SA 1R58A 3RDIA 4EQQA 2IVMA 4A5MA 3I71A 1IRGA 1SAXA 3CO6C 3DFGA 2RKHA 1SD4A 3E5QA 3U9GA 2FBKA 2D1HA 2OBPA 4OMZA 3RPQA 3L00A 5K5QA 4OIOF 3JAMK 3CUQB 4L0ZB 3EQLF 2FNAA 2XASA 5D5WB 2UXNA 1YTYA 2XAJA 3CDHA 5LHHA 2FOKA 3RI4A 4A5NA 3IWFA 3ISPA 4ESBA 3FXQA 3L09A 3MEXA 4PGHA 1LDKB 2AS5F 3L2CA 1MKMA 2CWEA 5ICCA 5H6QA 3DPLC 4HF2A 3GO5A 2VOOA 5BS6A 2CO5A 4ON0A 4HOBA 2RC4A 2Y48A 4QLCU 1TNSA 3M7GA 3GLXA 3GF2A 5E8GA 1NHAA 1P4AA 2PG4A 3IHUA 4HF1A 5HDGA 2DO7A 1D8JA 4XSZF 3F8CA 1BI1A 4HZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0V A;  1FYL A;  4MTD A;  3D5L A;  4M9S A;  1QZZ A;  4UUV A;  3J81 Z;  1QZY A;  5JVT A;  3NEU A;  3CTA A;  3FMQ A;  1RIO H;  3KET A;  4WK8 F;  4L18 B;  3JSP A;  4MGR A;  2FML A;  3D0S A;  1YS7 A;  2L4M A;  2GQQ A;  3LAP A;  1YIO A;  5JFR A;  1ZN2 A;  3P7N A;  2EV0 A;  2QVO A;  5E1X A;  2Z33 A;  2PI0 A;  3F8F A;  4LB5 A;  2CFX A;  4RAY A;  3T1B A;  3KLN A;  4NB5 A;  1MJB A;  1U2W A;  3JW4 A;  2JZY A;  5D6E A;  3E3V A;  1R23 A;  5FLX Z;  1J9I A;  2H6C A;  4MQV A;  2YPR A;  1YW9 A;  1LEB A;  2HKO A;  3BPV A;  3JTH A;  4EJT A;  1UCR A;  4FT8 A;  3B73 A;  3MAJ A;  3IRR A;  1B6A A;  2G7U A;  1B59 A;  2CYY A;  1FZP B;  2EFO A;  1KU3 A;  4RGU A;  4Q4Z F;  1YYV A;  1QNT A;  3WTY C;  4HX7 A;  2QQB A;  3ECO A;  2F2E A;  2ZXJ A;  2JSC A;  5D5V B;  2Z9O A;  1P2F A;  3KE2 A;  3BP8 A;  2MH2 A;  5DCF A;  2HS5 A;  2COM A;  3V8L A;  1IN6 A;  4BYY A;  1XGS A;  3R61 A;  2WC2 A;  4WCG A;  2EV5 A;  1BIB A;  3HRU A;  4Q5S F;  4DQ2 A;  3KFW X;  3I4P A;  2P7V B;  1WI9 A;  2V1X A;  4CDG A;  2KJC A;  3PFI A;  2JPC A;  2F5C A;  3GW2 A;  1S3J A;  4KFC A;  4RGX A;  2VT3 A;  3LAJ A;  1P4X A;  1W7P D;  5F1R A;  3I54 A;  1XGO A;  3V7C A;  5ICE A;  2L02 A;  1UHM A;  3V7R A;  2P7C B;  3K0L A;  1H9T A;  4RB3 C;  3S2W A;  2XV4 S;  5ILS A;  2YU3 A;  4ESJ A;  2D45 A;  1ONV A;  4ASN A;  5DCM B;  1KU2 A;  3RKW A;  4HYE A;  3J80 K;  2IA1 A;  1G3S A;  4I09 A;  2QYO A;  2WTE A;  5K5O A;  3KP3 A;  1U5T C;  4KIC A;  1OKR A;  4U7B A;  5HS7 A;  4MQ9 F;  1B4A A;  3IKT A;  4ESF A;  3HRS A;  4XLN F;  3TGN A;  2JPB A;  1BJA A;  3H3U A;  4FHT A;  4ZH4 F;  1WQ2 A;  2RVC A;  2EFW A;  3CO7 C;  5BPI A;  2M5W A;  1D5V A;  4M72 A;  3N4M A;  2CSO A;  2BGC A;  4FX4 A;  2QQ9 A;  5J8F A;  5HDN A;  1G3T A;  2W84 A;  4A2U A;  5K5R A;  2X0L A;  5BOX A;  4L9N A;  2XGX A;  3WU0 A;  2XAH A;  5D5X B;  3BWG A;  2VBX A;  5BQT A;  4IF4 A;  2A69 F;  2W25 A;  1DUX C;  4AIH A;  3COA C;  2VT2 A;  4YII A;  1SMY F;  4OOI A;  2RNJ A;  1XSV A;  2QBY A;  1IXR C;  4HAM A;  2OZ6 A;  5ED4 A;  4PDK A;  3F23 A;  3O2P E;  4KA4 A;  5EEG A;  3WGG A;  4IRG A;  4BQA A;  1R22 A;  3ZMD A;  1XGN A;  3WTZ A;  1O3T A;  1Z9C A;  5E1Z B;  3R0J A;  3KP6 A;  2P5V A;  2HGC A;  2IJL A;  3ZN1 A;  2L54 A;  3DV8 A;  4KUM A;  3U2R A;  3EYI A;  3BJA A;  2L01 A;  4EGZ A;  3BJ6 A;  3KP7 A;  5IT3 A;  1ZRC A;  5CVV A;  1U3E M;  4ZZD A;  4ENN A;  5LEK A;  1W7P B;  1GVJ A;  4K2E A;  5HLH A;  3TOA A;  1G6N A;  1ZG5 A;  1Q1H A;  2FQ3 A;  2XHK A;  4B09 A;  2ZNZ A;  3F6V A;  4KMU X;  2NRA C;  4G94 A;  1TNT A;  1CF7 B;  4OU0 A;  2F5F A;  1QO0 D;  1P6R A;  4UV9 A;  3K1M A;  1OYI A;  5CYV A;  1T39 A;  1Z6R A;  4CYD A;  1FBS A;  2OD5 A;  2E1C A;  4HV6 A;  3LWF A;  1XCV A;  4LLN A;  1XMA A;  2CQK A;  5JI6 A;  1SFU A;  2OQG A;  1LJ9 A;  2A3S A;  4UHT A;  4EJW A;  4Z2Y A;  4EJO A;  4ZZL A;  4L9T A;  1CF7 A;  1FP1 D;  1USS A;  3V4G A;  2HFH A;  4DNC A;  3FZV A;  4XRF A;  3FM5 A;  4KIG A;  3QU3 A;  1GXQ A;  5HLI A;  2ETH A;  1ODD A;  4LJZ F;  5FFZ A;  3T0Y A;  2VC0 A;  4I01 A;  4WXH A;  3E6C C;  5FLX K;  2MBF A;  1HQC A;  1UHW A;  5KVR A;  2PMH A;  4MEY F;  2EFN A;  3QRF F;  1WRJ A;  1TW2 A;  4EVI A;  4HBL A;  4ENM A;  2O61 A;  4JK1 X;  1I1S A;  3CUQ C;  2K4B A;  1T38 A;  1XMK A;  4LGW A;  3HSF A;  1KQ0 A;  4HA8 A;  2HTJ A;  5IT9 K;  3O6B B;  5DD8 A;  5LLQ A;  2QUF A;  4S04 A;  2RV8 A;  4TV7 A;  1TLH B;  3B02 A;  1JE8 A;  4IJA A;  1FBU A;  4HDV A;  3BJO A;  4IXA A;  1LNW A;  1ZHF A;  1LDD A;  1J0R A;  4G6Q A;  1Z6T A;  1MJA A;  4QWQ A;  2PBI A;  2MA3 A;  4NHJ A;  2PN6 A;  1MDM A;  1Y0U A;  4MTE A;  1W5S A;  2K7L A;  4G8X A;  2NYX A;  1BIA A;  1R5G A;  2JTV A;  2YX7 A;  1D3Y A;  1O57 A;  4AD9 A;  2ZME B;  2G7H A;  4R79 A;  1PP7 U;  2HYF A;  3LA2 A;  2LF7 A;  3NQO A;  3HRM A;  2V79 A;  4EJV A;  1QGP A;  4PCQ A;  2P5L C;  3R0A A;  3HHH A;  4IRI A;  5HS8 A;  1ZYR F;  1YG2 A;  1UST A;  1V3F A;  1I6X A;  1YQA A;  4N0B A;  3K69 A;  2VBY A;  1HKT A;  4MEX F;  1FY7 A;  2QLZ A;  3V7S A;  1CGP A;  3REO A;  4I02 A;  4EGY A;  2UZK A;  2R7D A;  4N9H A;  5CJ9 A;  5L3E A;  2R7F A;  3FMR A;  3F8M A;  2IW5 A;  2GXG A;  1ZRF A;  4LMY A;  2JRT A;  4XLP F;  3KZY A;  1F1Z A;  3ULQ B;  1S29 A;  1MGT A;  3T5X A;  3GUD A;  1IXC A;  2E1N A;  4HQM A;  1FYM A;  2XIG A;  1O3R A;  1ZRE A;  3ROU A;  2P4W A;  1F5T A;  1G4D A;  2MH9 A;  5HOO A;  4I98 B;  1HBX G;  2NNN A;  3WTT C;  1GHC A;  5HVQ C;  4HDU A;  1LB2 A;  2BE5 F;  3FXR A;  2GWR A;  1KYW A;  1ZRD A;  5AIQ A;  2DK5 A;  5L3C A;  4RB2 C;  1RZ4 A;  4AVP A;  4Y13 A;  2M87 A;  4KYW A;  4KN4 X;  3QPT A;  5BPD A;  2OAZ A;  3QP5 A;  3QAH A;  3LQQ A;  5DDG A;  4M9X A;  1YLF A;  1GXP A;  1XSD A;  5KK1 A;  1JXS A;  4G9Y A;  4KDP A;  1LEA A;  2GAU A;  1BOA A;  4RGS A;  5D4S A;  3TO6 A;  4JQF A;  3C7J A;  4ENJ A;  3QP6 A;  3I59 A;  4HLY A;  3GEZ A;  4LB6 B;  1FPQ A;  2Q2E A;  3DEU A;  4XSX F;  3WE2 A;  1PDN C;  1BN5 A;  4GYG A;  1KU9 A;  2VOD A;  1ZLJ A;  5LGN A;  3CUQ A;  2HKX A;  1BI2 A;  4YFN F;  5ERI A;  3RJP A;  1KA8 A;  3R60 A;  5FGM A;  3AAF A;  2D1V A;  1K6O A;  5F64 A;  4GXO A;  5L3D A;  3EET A;  4Q48 A;  1W7P A;  4Q47 A;  2IPQ X;  4I0B A;  1R5H A;  5E1W A;  1IN4 A;  1U5T A;  1EH8 A;  3WTV C;  2VBW A;  4A0Z A;  2W24 A;  5D8L B;  3GWZ A;  1BBY A;  1TQI A;  4CIC A;  2DTR A;  4AWX B;  5ICG A;  2AXL A;  1L3L A;  2ISZ A;  4G7H F;  1J7K A;  2K02 A;  1TTY A;  1XDU A;  4Y15 A;  4ENK A;  1SD5 A;  2V9V A;  1HW1 A;  1DPU A;  2M1B A;  2GA2 A;  3E6M A;  2VC1 A;  2EFP A;  2DFI A;  4EV0 A;  3KZZ A;  2L3D A;  1JHH A;  1FLI A;  2XUB A;  3JSO A;  2FBI A;  3SQN A;  2OQR A;  2OU2 A;  1EV7 A;  4A0X A;  3C18 A;  3BPX A;  4N9I A;  2FEZ A;  5AON A;  4BHC A;  3TOB A;  3I58 A;  5DEQ A;  1B9M A;  5JHU A;  1I27 A;  3RYP A;  4R8H A;  1FYK A;  2A61 A;  1SD7 A;  1RUO A;  1BM9 A;  4LLL A;  4M9Z A;  1SD6 A;  1TW3 A;  3WGI A;  3ABT A;  2VBZ A;  1TQM A;  3FXU A;  4S05 A;  4M6X A;  3E5U A;  3KLO A;  3ZPL A;  5DYM A;  1ZH5 A;  2KIM A;  2RDP A;  2EFQ A;  1OYW A;  4YG2 F;  4UNO A;  2PJP A;  4L9V A;  1ZG3 A;  3BDD A;  1B9N A;  1IRF A;  2HQR A;  3DKW A;  5E18 F;  2JT1 A;  3VFZ A;  2XAF A;  3I0T A;  2FXA A;  3OOP A;  3P9K A;  4UVC A;  3EUH A;  3HTU A;  3SZT A;  4L9J A;  3ELK A;  1IN5 A;  4HW0 A;  1R1T A;  1R36 A;  1I5Z A;  3M8E A;  3MQ0 A;  4U7D A;  4UV8 A;  2DPU A;  1XSX A;  4LG0 B;  4HX8 A;  2ZBK A;  2KIF A;  1E17 A;  1FC3 A;  3L9F A;  4IVN A;  4U0W A;  3R4K A;  3RIR A;  3FMS A;  4G7O F;  3RPU A;  1HSJ A;  2HOE A;  1STZ A;  4WX9 A;  2R3S A;  3BOQ A;  4OIQ F;  3TDU C;  3LFK A;  1IAW A;  3VOE A;  4A0Y A;  3GX4 X;  2CG4 A;  4ZYD A;  3HUG A;  1XN7 A;  1Z91 A;  2KRF A;  4M74 A;  3I64 A;  4PGG A;  2GZW A;  1KGS A;  2ZJ2 A;  4EJU A;  1EH7 A;  3Q5F A;  2TDX A;  2E7X A;  3J80 Z;  3R6S A;  5H20 A;  5FO5 A;  4KNY A;  4F7Z A;  2FU4 A;  3Q9S A;  3WG9 A;  5E17 F;  5J6X A;  2STT A;  3GZ6 A;  2XAQ A;  1T2K A;  5LGU A;  3HIF A;  2VON A;  5CVJ A;  5LBQ A;  1J59 A;  2ACJ A;  2IRF G;  2DI3 A;  2W85 A;  2FBH A;  1FSH A;  3PQK A;  1BC8 C;  1IW7 F;  1ZAR A;  2GA1 A;  4IPA A;  3P9C A;  1YW7 A;  2O6G E;  4M6Y A;  4KN7 X;  3OV8 A;  3ECH A;  4WF2 A;  2QEN A;  3F8B A;  4OMY A;  5E8I A;  2QM3 A;  4OIN F;  3DF8 A;  2HQN A;  3SZP A;  3F22 A;  1RNL A;  1E2X A;  2A6E F;  1YW8 A;  2CW0 F;  4KMF A;  4R1H A;  3VOD A;  1XD7 A;  3MFK A;  1HKS A;  2KJB A;  5LRS A;  1QBJ A;  4RGR A;  1R00 A;  5HS9 A;  3F72 A;  2QZ8 A;  2NAZ A;  3K2Z A;  5L3F A;  3IC7 A;  3TQN A;  4A6E A;  4IRH A;  2DK8 A;  1WKM A;  2BV6 A;  1FBQ A;  3DP7 A;  1O3Q A;  4P55 A;  3DQV C;  1D8K A;  2LDU A;  2MC3 A;  1Z7U A;  2KIU A;  2VE9 A;  2EJR A;  1XDS A;  3H3Z A;  1FSE A;  2YX4 A;  4LG0 A;  3ZMZ A;  1QPM A;  4YIF A;  1F4K A;  1U5T B;  2DBB A;  3ZMT A;  1ZAO A;  4RS8 A;  3HSE A;  3M8F A;  3BZ6 A;  1Z1D A;  2IA2 A;  4U0Y A;  1REP C;  2G9W A;  2MLK A;  3MWM A;  3Q9V A;  2STW A;  1SMT A;  1A04 A;  3E6D A;  2ESH A;  2A07 F;  2HZT A;  1YFH A;  2ZME A;  1DDN A;  3RKY A;  2VN2 A;  3M1E A;  5CVI A;  2RQP A;  3K1P A;  4ZYE A;  5FD6 A;  2EK5 A;  2P8T A;  4CGZ A;  2HR3 A;  1LVA A;  3MZY A;  2LNB A;  4RB1 A;  2DW4 A;  3V8K A;  2LKP A;  4ETS A;  3GYH X;  2NS0 A;  1VTN C;  3DXJ F;  2FSW A;  4AIK A;  2QQA A;  1ON1 A;  4L5I A;  5BMZ A;  3H92 A;  5ILV A;  3ZQ7 A;  2EA4 A;  2RN7 A;  1IUY A;  3SHF A;  3HHG A;  1WSU A;  2O03 A;  3GVA A;  2WWY A;  2P6T A;  2O0Y A;  3ZMS A;  1YS6 A;  3F3X A;  4I0A A;  1R7J A;  4I7H A;  1F9N A;  1S7A A;  3WTX C;  4O5V A;  4RB0 A;  2GIV A;  3W6K B;  4MNU A;  5LHG A;  4HX4 A;  4HLX A;  2A5Y B;  2O8X A;  5CVR A;  4IHS A;  1OPC A;  2V6C A;  4L0Y B;  6PAX A;  2EB7 A;  4L5J A;  3TDZ C;  4BXU A;  4LD5 A;  3FM3 A;  4EM0 B;  2FF4 A;  2PEX A;  1PUE E;  2ZNY A;  2Z3Y A;  1LDJ A;  1PP8 F;  2EV6 A;  1K78 A;  2F5E A;  1P4W A;  1BI0 A;  1Z05 A;  1XGM A;  1R1V A;  4LK1 F;  4M73 A;  3QU6 A;  2XKO A;  3HYI A;  3C1D A;  3SFZ A;  1O7L A;  2Y75 A;  4OIP F;  4UVA A;  2PQ8 A;  3KP2 A;  3I53 A;  3GFJ A;  4PZJ A;  4B8X A;  3C3W A;  3I59 B;  1X3U A;  3O3K A;  3JTG A;  2C6Y A;  5A2Q Z;  5TJJ A;  4P9F A;  4LFU A;  4AIJ A;  3WU1 B;  5CVU A;  1ZGJ A;  1WWX A;  1OMI A;  2DAO A;  3IL2 A;  2J5O A;  1G3W A;  5IT9 Z;  3HOT A;  3J81 K;  3LQR A;  2ZKZ A;  2VOP A;  3WOD F;  4BHB A;  3F8N A;  2IT0 A;  2ESN A;  2M8E A;  2XVC A;  2DQR A;  3K9T A;  2V1D A;  2HEO A;  1ON2 A;  4GYI A;  3WTW C;  2IA0 A;  1UFM A;  4E70 A;  4WWC A;  3MCZ A;  5A2Q K;  3ZP5 A;  1U8R A;  1AOY A;  1QQI A;  4FX0 A;  4WXC A;  2H09 A;  5J8C A;  5DUI A;  2WV0 A;  3E6B A;  1OYY A;  1T0F A;  3U1D A;  1B1B A;  3T8R A;  2KKO A;  2QWW A;  4BHP A;  1ZLK A;  4KIB A;  3J7A O;  2YSR A;  4P96 A;  2D2W A;  2PLY A;  2EA2 A;  2ELH A;  3LA3 A;  2LSO A;  1K79 A;  2VXZ A;  1C0W A;  2FNP A;  3T8T A;  3FHZ A;  4OIR F;  4O6J A;  4YFK F;  4CXF A;  3RYR A;  3WE3 A;  5FFX A;  3QOP A;  2NNY A;  2RGV A;  2Z5U A;  5TRD A;  3DPT A;  4I2O A;  1L0O C;  1W5T A;  4P9U A;  1W4M A;  1KU7 A;  3JAM Z;  2XAG A;  1BI3 A;  2DT5 A;  4CHU A;  2M45 A;  4A6D A;  2EWN A;  2FMY A;  4XBF A;  5DV5 A;  1LQ1 A;  2H6B A;  1KQ8 A;  3GXO A;  3RKX A;  4IHT A;  5D5U B;  1TQP A;  4WXD A;  1FT9 A;  3TO9 A;  3L7W A;  2MD5 A;  2ZFW A;  3TKY A;  2H27 A;  1FP2 A;  3F6O A;  4G6D A;  1S7O A;  2V1U A;  2M30 A;  1ULY A;  1FWZ A;  1K7A A;  5CLS A;  4GO1 A;  3E97 A;  3ZMU A;  2YR2 A;  1YO5 C;  3IWZ A;  2HYG D;  5D8K B;  3LA7 A;  2UWM A;  1HKQ A;  3QPH A;  1HW2 A;  5LRR A;  1U78 A;  1O3S A;  5F6F A;  3WGH A;  1MD0 A;  2VE8 A;  1ZG1 A;  5HLG A;  3PQJ A;  3BRO A;  3KCC A;  1HST A;  4GGG A;  2HWV A;  1J5Y A;  3GFI A;  4HQE A;  1IN7 A;  2F5D A;  2ZO4 A;  1H9G A;  3BY6 A;  2Z99 A;  1MZB A;  5JR3 A;  1S6L A;  3SXY A;  3NRV A;  4KIF A;  2HDC A;  3TO7 A;  2O3F A;  1T98 A;  3E5X A;  3W6J B;  4ZYG A;  2OA4 A;  5D6F A;  2XKP A;  5K1Y A;  2Q8K A;  1T6S A;  2Y0M A;  3HOS A;  1J75 A;  4JBA A;  1MJ9 A;  1IN8 A;  3VEP A;  5D4R A;  2DU9 A;  3IKV A;  4H0E A;  1SFX A;  5AIP A;  2LF8 A;  3WTS C;  3ZN0 A;  2B0L A;  5FB2 A;  4G7Z F;  2K27 A;  2BEO A;  3CJN A;  2CGP A;  1S8N A;  2HTS A;  1DPR A;  2MLG A;  3FF5 A;  5DD4 A;  2XRN A;  3IRQ A;  2OZU A;  4BAY A;  1R1U A;  2UXX A;  3GZ5 A;  4KT5 C;  3F21 A;  3GFL A;  4EM1 A;  4EMS A;  5LGT A;  3HSR A;  2IP2 A;  1J2X A;  4D0P A;  3K1N A;  2X4H A;  1JGS A;  5L3G A;  1BC7 C;  3G3Z A;  1P92 A;  5FD5 A;  2BYV E;  3M9A A;  1RUN A;  4ZYH A;  1MDM B;  1FX7 A;  4BH9 A;  2XRO A;  5LHI A;  1U6G A;  3ML6 A;  4UVB A;  5ILU A;  4M71 A;  3HRT A;  3ERE D;  1ZGA A;  1XB4 A;  2ISY A;  4CZZ A;  1G3Y A;  1IF1 A;  3WTU C;  2PFB A;  1IXS B;  3ABU A;  2ZCW A;  5E20 A;  4EM2 A;  3G73 A;  4GCV A;  3VB2 A;  3HTS B;  2ADU A;  1KYZ A;  3N97 A;  3GFM A;  4P5O A;  3LST A;  3KEQ A;  1I1G A;  1XCB A;  1V4R A;  4LK0 F;  1JHF A;  1FNN A;  3EYY A;  1IZ1 A;  3EDP A;  2DLL A;  2DPD A;  2K86 A;  3MZH A;  3KP5 A;  2A6H F;  1KQ9 A;  2QBY B;  2FE3 A;  1EH6 A;  4BNC A;  3CLO A;  5H6R A;  1RI7 A;  2A68 F;  1DP7 P;  3KEO A;  4RAZ A;  4Y17 A;  2P5K A;  3I5U A;  2DQL A;  4YFX F;  3ZMV A;  4O3M A;  4MHG A;  1SFE A;  3FX3 A;  4HV5 A;  4U88 A;  3RTR A;  5EEH A;  1AWC A;  5DCM A;  1O7F A;  2W57 A;  1HW5 A;  4NQW A;  5HDK A;  1FOK A;  2K4J A;  3KP4 A;  4HF0 A;  2L4A A;  2FA5 A;  2BBY A;  2Q0O A;  1UB9 A;  2FRH A;  1OR7 A;  5DUK A;  4CO8 A;  3FWE A;  3V8J A;  2PMU A;  1TBX A;  4LLG F;  2H94 A;  3P9I A;  2E7W A;  5ICF A;  4A12 A;  5LEJ A;  2J5P A;  4UXN A;  3CUO A;  1K78 B;  5L3B A;  2GXB A;  1HXD A;  1H0M A;  2P6S A;  1R58 A;  3RDI A;  4EQQ A;  2IVM A;  4A5M A;  3I71 A;  1IRG A;  1SAX A;  3CO6 C;  3DFG A;  2RKH A;  1SD4 A;  3E5Q A;  3U9G A;  2FBK A;  2D1H A;  2OBP A;  4OMZ A;  3RPQ A;  3L00 A;  5K5Q A;  4OIO F;  3JAM K;  3CUQ B;  4L0Z B;  3EQL F;  2FNA A;  2XAS A;  5D5W B;  2UXN A;  1YTY A;  2XAJ A;  3CDH A;  5LHH A;  2FOK A;  3RI4 A;  4A5N A;  3IWF A;  3ISP A;  4ESB A;  3FXQ A;  3L09 A;  3MEX A;  4PGH A;  1LDK B;  2AS5 F;  3L2C A;  1MKM A;  2CWE A;  5ICC A;  5H6Q A;  3DPL C;  4HF2 A;  3GO5 A;  2VOO A;  5BS6 A;  2CO5 A;  4ON0 A;  4HOB A;  2RC4 A;  2Y48 A;  4QLC U;  1TNS A;  3M7G A;  3GLX A;  3GF2 A;  5E8G A;  1NHA A;  1P4A A;  2PG4 A;  3IHU A;  4HF1 A;  5HDG A;  2DO7 A;  1D8J A;  4XSZ F;  3F8C A;  1BI1 A;  4HZF A; 
#chains in the Genus database with same CATH topology
 4PJN A;  4BDZ A;  1YIT I;  1Z3Y A;  4U0V A;  1FYL A;  2EBI A;  2BY2 A;  4PJ0 C;  4DZJ A;  4MTD A;  2ZXI A;  3D5L A;  2DA2 A;  1T0F C;  4M9S A;  1QZZ A;  1R4M B;  4UUV A;  3J81 Z;  4XNF A;  1QZY A;  1EF4 A;  2VQL A;  5JVT A;  3WHC A;  3NEU A;  3CTA A;  3IAM 2;  3FMQ A;  2JVH A;  1RIO H;  2Y69 H;  4FAS D;  3HL2 A;  3KET A;  4WK8 F;  4L18 B;  1S72 I;  5FKM A;  3JSP A;  4MGR A;  1IDY A;  2DFH A;  2FML A;  3D0S A;  1YS7 A;  2L4M A;  2GQQ A;  3LAP A;  3AL0 B;  1YIO A;  2O5R A;  2VQG A;  4ZC3 A;  5JFR A;  5J1Y A;  1DU6 A;  3MMY B;  1ZN2 A;  1X3W B;  3P7N A;  2EV0 A;  4NDL A;  2QVO A;  5E1X A;  3S16 J;  2Z33 A;  2PI0 A;  1FOX A;  3F8F A;  4LB5 A;  4HNU A;  4A3B J;  2CFX A;  2RQQ A;  4RAY A;  3T1B A;  1JUM A;  3KLN A;  4NB5 A;  1A6I A;  3JRA A;  1MJB A;  1U2W A;  3JW4 A;  2JZY A;  2OJE D;  2LOO A;  3O8H A;  2CQ7 A;  5D6E A;  2Y0S A;  1R23 A;  3E3V A;  1XG1 A;  5FLX Z;  3H3V K;  5EF6 A;  5DS9 A;  1J9I A;  3OYD A;  5E3N A;  2H6C A;  3FKJ A;  4MQV A;  2YPR A;  1YW9 A;  1EKE A;  1LEB A;  1B72 A;  2OTJ I;  1TT5 B;  2HKO A;  5F27 A;  4II2 A;  3BPV A;  4ZYA A;  3JTH A;  5DM6 F;  4EJT A;  1UCR A;  3OL3 A;  1X1D A;  2KFD A;  2UUZ A;  3B73 A;  4FT8 A;  3MAJ A;  3BG9 A;  3IRR A;  4PSX A;  5B5E C;  1B6A A;  2G7U A;  3JRG A;  3AKZ A;  1B59 A;  3RQI A;  1YIJ I;  3FXL A;  1QPI A;  2CYY A;  5LD2 C;  3HOX J;  2EFO A;  1FZP B;  1KU3 A;  4RGU A;  2NVX J;  3OYJ A;  1MH4 A;  4Q4Z F;  1YYV A;  1QNT A;  3WTY C;  3CCS I;  4HX7 A;  4QIW N;  4F91 B;  2WA0 A;  3GZN B;  2X1C A;  2DA3 A;  3K70 C;  2QQB A;  3ECO A;  1IG7 A;  3WG7 H;  2F2E A;  2ZXJ A;  1FJL A;  2JSC A;  2LG4 A;  5D5V B;  3FKI J;  3DLL F;  3LSP A;  2Z9O A;  1P2F A;  3KE2 A;  3DWL E;  2YU9 J;  3BP8 A;  2MH2 A;  3WU2 C;  3DTE A;  1MMD A;  2P81 A;  5DCF A;  2HS5 A;  2COM A;  3V8L A;  2HYJ A;  1IN6 A;  3HG9 A;  3I9V 2;  4BYY A;  1XGS A;  3R61 A;  2F48 A;  2WC2 A;  4WCG A;  2EV5 A;  3PM1 A;  1BIB A;  1GUU A;  3HRU A;  4BE0 A;  5LFA A;  4Q5S F;  2ZB9 A;  4DQ2 A;  3KFW X;  3I4P A;  3ZQH A;  1N25 A;  1ETK A;  2LY2 A;  4Y33 A;  3BZK A;  2P7V B;  4XM3 A;  2L9R A;  3HUG B;  1WI9 A;  3MVP A;  2R7Z J;  4KJZ A;  3Q3S A;  1WJE A;  2V1X A;  4CDG A;  3H0D A;  2KJC A;  1TL8 A;  3PFI A;  2JPC A;  1VZ0 A;  2F5C A;  3GW2 A;  1S3J A;  4KFC A;  2K9L A;  2M4K A;  4RGX A;  2ZJQ F;  1VQ7 I;  4HRI A;  1PYV A;  3VYR B;  2LKS A;  3QYE A;  2K5C A;  2VT3 A;  5FRO A;  3MKY B;  2HDW A;  3LAJ A;  1P4X A;  4S0H B;  1W7P D;  2CH0 A;  3Q0U A;  2X85 A;  5F1R A;  2W7N A;  3I54 A;  1XGO A;  3V7C A;  2F5V A;  3WHB A;  1FOY A;  5ICE A;  1I3A A;  2L02 A;  2OTL I;  4IEJ A;  1NG6 A;  3GLL A;  1UHM A;  4E7Z A;  3V7R A;  2P7C B;  3VSK A;  4HNT A;  3OYB A;  3FXM A;  1VQ6 I;  2P0W A;  3K0L A;  1FEX A;  1H9T A;  3H5R A;  4LIU A;  4RB3 C;  5F08 A;  2QF7 A;  3S2W A;  2XV4 S;  5ILS A;  2DA5 A;  2YU3 A;  4XN3 A;  4ESJ A;  2QSF X;  3CP2 A;  3D5R C;  2D45 A;  1VFC A;  4BGD A;  1ONV A;  2DA6 A;  1W0T A;  4DW6 A;  4ASN A;  5DCM B;  1KU2 A;  3RKW A;  4I99 C;  4XRS G;  2LBF A;  4BU2 A;  3S2H J;  2PX9 A;  3LSM A;  5CKT A;  4HYE A;  5J1U A;  3J80 K;  4BKX A;  2IA1 A;  3OYG A;  1G3S A;  2EPF A;  3AL0 C;  4I09 A;  2QYO A;  2WTE A;  5K5O A;  3RCO A;  3KP3 A;  1GVD A;  2M0M A;  4RMN A;  4A3L J;  4E7L A;  1DU0 A;  1U5T C;  2IXS A;  3H0G J;  4KIC A;  2W1O A;  1OKR A;  2EIM H;  4NBQ A;  4AVZ A;  2EZL A;  1MNM C;  2ZJP F;  4GFB A;  4LIT A;  4U7B A;  2BY0 A;  4V19 K;  3HPG A;  5HS7 A;  4MQ9 F;  4JYK A;  1B4A A;  3BLY A;  5F04 A;  3IKT A;  3I55 I;  1TT0 A;  2H8W A;  4ESF A;  2DFE A;  3HRS A;  4IL6 C;  3VWB A;  3A2K A;  3KPH A;  1R4N B;  4XLN F;  3H36 A;  3JRB A;  5GAH J;  2XPW A;  3TGN A;  1NK3 P;  2JPB A;  1BJA A;  3H3U A;  2ZXW H;  4FHT A;  4F55 A;  3G2B A;  4UUS B;  2VL8 A;  3G6E I;  3TP3 A;  4IHX A;  5M5W J;  4ZH4 F;  4CSW A;  3CCY A;  1WQ2 A;  3ONQ A;  2RVC A;  3DLA A;  2HZD A;  4XLF A;  2EFW A;  1Z77 A;  5GPC A;  3CO7 C;  4HG2 A;  5BPI A;  2M5W A;  2X6X A;  1V55 H;  4L5E A;  1D5V A;  1T08 B;  2KZV A;  3LSR A;  4RAF A;  4M72 A;  3N4M A;  2CSO A;  2XGC A;  2BGC A;  1I39 A;  4FX4 A;  3HOW J;  3BTC A;  2QQ9 A;  2DA7 A;  1N77 A;  4XLE A;  1JKO C;  5J8F A;  5HDN A;  1G3T A;  5EEA A;  2W84 A;  2MW8 A;  4A2U A;  2X0L A;  5K5R A;  5BOX A;  3CD6 I;  4L9N A;  2XGX A;  2HQ5 A;  3WU0 A;  2XAH A;  5D5X B;  1K4S A;  2WAD A;  3BWG A;  4A3J J;  1GV5 A;  3S15 J;  1I3Q J;  2KP6 A;  2VBX A;  1NTC A;  5BQT A;  4IF4 A;  2X1D A;  2A69 F;  3S17 J;  1XTA A;  2W25 A;  1DUX C;  4AIH A;  3ZQI A;  3K2A A;  4IHY A;  3COA C;  2VPR A;  2VT2 A;  3PUF A;  2IGO A;  1Z7L A;  4YII A;  1SMY F;  4OOI A;  4YIR X;  2RNJ A;  3BTI A;  2F4M B;  3BG7 A;  1XSV A;  3AFH A;  2CMP A;  3G4S I;  4M3E A;  2IGN A;  2MAB A;  1G8X A;  3K4C A;  2DYR H;  2QBY A;  1IXR C;  4HAM A;  5KHD A;  4FET A;  2OZ6 A;  1IGN A;  5ED4 A;  3OYA A;  3Q0V A;  4PDK A;  2EH3 A;  3F23 A;  3O2P E;  3S1M J;  3H35 A;  2JMW A;  1QHG A;  3SDB A;  1VQ8 I;  2XC7 A;  4G12 A;  4KA4 A;  5EEG A;  3WGG A;  3HDD A;  4IRG A;  1ZGW A;  1R22 A;  4BE1 A;  4BQA A;  3ZMD A;  1XGN A;  3W2A A;  2EZI A;  1FTT A;  4DGW B;  2ME0 A;  3WTZ A;  1O3T A;  4B43 A;  1ETV A;  2K3F A;  3CJQ B;  2CQQ A;  4XRM A;  2O7O A;  4RLF A;  1Z9C A;  3HZJ A;  5EDN A;  1ZQ3 P;  5E1Z B;  3R0J A;  3KP6 A;  2P5V A;  2HGC A;  2IJL A;  3ZN1 A;  3DV8 A;  2L54 A;  4KUM A;  3B6A A;  3IP4 B;  4A3K J;  1RR8 C;  1R49 A;  3U2R A;  1ETO A;  2FD5 A;  1H89 C;  2CW8 A;  1MBE A;  3EYI A;  3BJA A;  2BW3 A;  2L01 A;  4EGZ A;  2LKX A;  3BJ6 A;  3KP7 A;  1U8B A;  5IYD J;  5IT3 A;  3OMY A;  3QPS A;  1ZRC A;  5CVV A;  2BHY A;  1U3E M;  4IHV A;  4ZZD A;  3FXJ A;  4ENN A;  2E2I J;  4DYC A;  5LEK A;  2CUJ A;  1W7P B;  1GVJ A;  4K2E A;  5IYC J;  5HLH A;  3TOA A;  3GTQ J;  3HOU J;  1G6N A;  1ZG5 A;  1Q1H A;  2FQ3 A;  2OCC H;  2XHK A;  4B09 A;  2XSD C;  2ZNZ A;  3F6V A;  4KMU X;  3CES A;  3A4C A;  2NRA C;  4J19 A;  4G94 A;  1TNT A;  1CF7 B;  4OU0 A;  2F5F A;  1QO0 D;  1P6R A;  4UV9 A;  2HDD A;  3K1M A;  1OYI A;  5CYV A;  5B66 C;  1T39 A;  1Z6R A;  5EZG A;  4CYD A;  1FBS A;  1S9H A;  2OD5 A;  2E1C A;  2LFB A;  4HV6 A;  3LWF A;  2DMU A;  1XCV A;  1LFU P;  4LLN A;  1T95 A;  1XMA A;  4RA2 A;  2CQK A;  3CDI A;  5JI6 A;  2NOG A;  3ZCO A;  1SFU A;  2OQG A;  2O9L A;  1LJ9 A;  2A3S A;  2V7F A;  4UHT A;  4XON A;  2BXY A;  1FOW A;  1JKQ C;  4C2M J;  3S14 J;  3PSF A;  4BXF A;  3IV5 A;  4EJW A;  3H1C A;  4Z2Y A;  4MFE A;  5E3L A;  5CQG A;  4EJO A;  4X6A J;  4ZZL A;  3A01 B;  4L9T A;  3BCB A;  4XQF A;  2E35 A;  1CF7 A;  5TIS C;  3CCE I;  3C2G A;  4BY1 J;  1FP1 D;  3LNQ A;  1USS A;  2I5U A;  2KDO A;  4UY8 I;  3JCU C;  4PSW A;  3V4G A;  2HFH A;  4DNC A;  3FZV A;  4XRF A;  3DEE A;  2FUG 2;  1MW7 A;  1Y39 A;  3FM5 A;  4KIG A;  4XKW A;  3QU3 A;  1GXQ A;  5F0H A;  2CUF A;  2R0Q C;  3OYM A;  5HLI A;  2ETH A;  3I4M J;  4CCL A;  1ODD A;  1P9Q C;  4JX4 A;  4LJZ F;  5FFZ A;  3MKL A;  3T0Y A;  2VC0 A;  1G2H A;  4I01 A;  1JTY A;  3OL4 A;  4WXH A;  3GTG J;  3E6C C;  1EA3 A;  5FLX K;  1D1C A;  3K6G A;  2MBF A;  2WAQ A;  1HQC A;  1UHW A;  4M3G A;  5KVR A;  1BR1 A;  1YJN I;  2VQC A;  2ZC2 A;  2LMD A;  2PMH A;  4HPQ A;  4MEY F;  3DBL B;  2VPL A;  2VI6 A;  2EFN A;  4C30 A;  3QRF F;  3H5A A;  1WRJ A;  1TW2 A;  1F36 A;  2R7U A;  4EVI A;  4HBL A;  5FKN A;  4ENM A;  2O61 A;  1QVT A;  2JA2 A;  4JK1 X;  1I1S A;  4JP0 A;  3CUQ C;  5IOY A;  2K4B A;  1T38 A;  2M7B A;  4QSH A;  1XMK A;  4BL0 B;  1DGR M;  1IV6 A;  4LGW A;  3HSF A;  2KRC A;  1SAU A;  2K9N A;  4W1U A;  1KQ0 A;  4HA8 A;  2HTJ A;  5IT9 K;  3O6B B;  5DD8 A;  1K61 A;  5LLQ A;  2QUF A;  4D9J A;  4BBR J;  2XB0 X;  4S04 A;  4CCO A;  2RV8 A;  2R5Y B;  3L2Q A;  4TV7 A;  1RKW A;  1TLH B;  1BW6 A;  3B02 A;  1JE8 A;  4IJA A;  5J1R A;  1FBU A;  3CCV I;  4HDV A;  3BJO A;  1E0E A;  3HPH A;  4IXA A;  4Y52 J;  2DTZ A;  1LNW A;  2WBM A;  1ZHF A;  1D0Z A;  1LDD A;  1J0R A;  4G6Q A;  1Z6T A;  1MJA A;  2PJR B;  1XPX A;  4QWQ A;  4A3G J;  2PBI A;  4OWR B;  3W3C A;  5FLM J;  3RZD J;  1E3H A;  1MSE C;  2MA3 A;  4NHJ A;  1QRY A;  2PN6 A;  3LSH A;  1MDM A;  1Y0U A;  3FDY A;  3KIO A;  4MTE A;  4LIV A;  1W5S A;  2Y9Z A;  3KYL A;  4XKB A;  1HA8 A;  2ZSH B;  2GOM A;  2K7L A;  4G8X A;  2NYX A;  1BIA A;  1X1P A;  1R5G A;  2NVU B;  2B9S A;  4ZJZ A;  2JTV A;  2QKL B;  2YX7 A;  1D3Y A;  4V2G A;  1O57 A;  3M07 A;  3CF5 F;  4AD9 A;  2ZME B;  2G7H A;  2M2E A;  2HVS A;  4R79 A;  1PP7 U;  2DA4 A;  2HYF A;  4B47 A;  2QSH X;  1YX5 A;  2Y0S N;  4BQN A;  3LA2 A;  5EG0 B;  2LF7 A;  3NQO A;  3HRM A;  1K4T A;  2V79 A;  3DKY A;  4EJV A;  2DOE A;  1QGP A;  2X6W A;  2OF7 A;  4CYC A;  2F4O B;  4JX5 A;  4PCQ A;  2P5L C;  2R5Y A;  3R0A A;  4XR6 A;  3HHH A;  4IRI A;  5HS8 A;  1ZYR F;  2DYS H;  3OSF A;  3RQ4 A;  1O4X A;  1YG2 A;  4F92 B;  1UST A;  2JUG A;  3SJM A;  1V3F A;  1I6X A;  3QYF A;  1YRN B;  4DIQ A;  1YQA A;  4N0B A;  3K69 A;  2VBY A;  3OSG A;  4C3H J;  1HKT A;  2R4G A;  3RSN A;  5E3O A;  4MEX F;  3S2D J;  1FY7 A;  2AHQ A;  2QLZ A;  3OR1 C;  3V7S A;  2IEK A;  4B44 A;  1CGP A;  3REO A;  3BR5 A;  4I02 A;  4EGY A;  2UZK A;  4J01 A;  1D1B A;  2BW3 B;  2R7D A;  1VQM I;  4UUS A;  1W5C C;  1JKR C;  4N9H A;  5CJ9 A;  1PUF A;  5CQE A;  5L3E A;  2R7F A;  2LK2 A;  4LOC A;  3FMR A;  3F8M A;  1Y1V J;  2GXG A;  2IW5 A;  4BDY A;  3AG1 H;  1ZRF A;  4LMY A;  2JRT A;  4XLP F;  2K85 A;  3KZY A;  1F1Z A;  3ULQ B;  3OYE A;  1S29 A;  1MGT A;  3JRH A;  3ZRG A;  3T5X A;  3GUD A;  1ETX A;  3DEW A;  2LVS A;  1IXC A;  2E1N A;  4HQM A;  5EZH A;  1FYM A;  2XIG A;  1O3R A;  2HXI A;  2VJI A;  3AG3 H;  3ZR8 X;  1ZRE A;  1I6H J;  1BW5 A;  3ROU A;  1FIP A;  1WHU A;  2F6C A;  2P4W A;  1P7J A;  2F4I A;  4A3F J;  1FIA A;  1E3O C;  3HGG A;  1F5T A;  1G4D A;  2R92 J;  2MH9 A;  5HOO A;  4I98 B;  1HBX G;  1T33 A;  2NNN A;  4NC6 A;  3WTT C;  3M1C A;  5C4X J;  1MIJ A;  1GHC A;  2WAF A;  1MBJ A;  3KYD B;  5HVQ C;  4HDU A;  1LB2 A;  5K7Z A;  2BOL A;  3TL4 X;  3VPR A;  2JSP A;  3FXO A;  4FTH A;  2BE5 F;  3FXR A;  2E1O A;  4HNV A;  1BL0 A;  1W1W E;  2GWR A;  1KYW A;  2HOS A;  2VJ4 A;  1ZRD A;  5JVG F;  2K9S A;  1HC8 A;  5AIQ A;  2DK5 A;  5L3C A;  4CH7 A;  3E7L A;  4RB2 C;  1RZ4 A;  4AVP A;  2NS7 A;  4Y13 A;  2M87 A;  3S3N A;  4KYW A;  4KN4 X;  3QPT A;  5BPD A;  2OAZ A;  2V4J C;  1ZR4 A;  3QP5 A;  3NWS A;  4XID A;  3QAH A;  3LQQ A;  2ZJR F;  5DDG A;  4M9X A;  2ZME C;  1YLF A;  1GXP A;  4DJA A;  2TCT A;  4E7I A;  1XSD A;  5DM7 F;  2OPT A;  2MYS A;  5KK1 A;  4B48 A;  3BT9 A;  1JXS A;  4G9Y A;  2KIS A;  4KDP A;  1LEA A;  2GAU A;  1BOA A;  4RGS A;  3PJR A;  1QU3 A;  5D4S A;  4BEH B;  4W97 A;  3DU5 A;  3TO6 A;  4JQF A;  5IP6 A;  4FE7 A;  3C7J A;  4ENJ A;  1UHS A;  4BBS J;  3QP6 A;  1LVK A;  3I59 A;  4A3M J;  3P5J A;  4HLY A;  3GEZ A;  4F93 B;  4LB6 B;  1FPQ A;  2DT6 A;  4A3C J;  2Q2E A;  3DEU A;  2VJJ A;  3HKZ A;  2PMZ A;  1BOB A;  4XSX F;  3WE2 A;  1PDN C;  1BN5 A;  4GYG A;  1KU9 A;  2VOD A;  1ZLJ A;  2TRT A;  3CUQ A;  5LGN A;  2R7W A;  1WI3 A;  2HKX A;  3E1S A;  1BI2 A;  2M9H A;  2AQF A;  2VKE A;  1T8I A;  2X51 A;  4PK4 A;  1H88 C;  3HXL A;  2K40 A;  4YFN F;  5ERI A;  3RJP A;  4AYB N;  1KA8 A;  2VJ5 A;  3CCJ I;  3R60 A;  5FGM A;  1A6Q A;  1WJF A;  3S1R J;  1VQK I;  3AAF A;  1LFP A;  1MND A;  2D1V A;  1RPW A;  1K6O A;  2CV1 A;  5F64 A;  4GXO A;  5L3D A;  2H1K A;  3EET A;  4Q48 A;  1W7P A;  3TW7 A;  4Q47 A;  2DOA A;  2IPQ X;  4OAY A;  4I0B A;  1S5L C;  3BQY A;  4CCM A;  1R5H A;  2LYC A;  3FBN B;  5E1W A;  1IN4 A;  1U5T A;  1R71 A;  3W2W A;  1EH8 A;  3WTV C;  2VBW A;  1B72 B;  1RET A;  4A0Z A;  2W24 A;  1ZR2 A;  2LH9 A;  5D8L B;  3GWZ A;  1BBY A;  3L1P A;  2VKV A;  1TQI A;  4CIC A;  1PJR A;  3ZQL A;  4ZDP A;  2DTR A;  3IH2 A;  4M3D A;  2IS2 A;  5C3E J;  4AWX B;  2H1L A;  1TWF J;  4UUT A;  1NG7 A;  5ICG A;  1SFK A;  1U9O A;  2AXL A;  1L3L A;  1BR2 A;  2ISZ A;  4G7H F;  2COB A;  1JJ6 C;  3IH3 A;  2FX0 A;  5IYB J;  1J7K A;  2E2J J;  2K02 A;  2DDB A;  2UV1 A;  1QVU A;  1TWH J;  1TTY A;  1XDU A;  1G59 A;  2R7T A;  4Y15 A;  3L2W A;  2KZG A;  3F9K A;  1MMG A;  4MO7 A;  1DP3 A;  2DN0 A;  2E2H J;  4ENK A;  1SD5 A;  1B8I A;  2V9V A;  1F43 A;  3PIP F;  1HW1 A;  1DPU A;  4NC7 A;  3ZQQ A;  3ASO H;  1IV8 A;  3FXK A;  5FJ8 J;  2ID6 A;  2M1B A;  5KAF C;  3BG3 A;  2GA2 A;  1LE8 B;  3E6M A;  2Y30 A;  2VC1 A;  1SVM A;  2Q2E B;  2JA5 J;  2EFP A;  2DFI A;  2M8G X;  4EV0 A;  3KZZ A;  3OYI A;  1NK2 P;  2L3D A;  1MH3 A;  3H9J A;  1JHH A;  1FLI A;  1YJW I;  5J3L A;  1YE9 A;  2I10 A;  2KPM A;  2XUB A;  3JSO A;  2FBI A;  2YS9 A;  1AA7 A;  2WAE A;  3SQN A;  2OQR A;  4ZTF A;  4LG3 A;  1D5Y A;  3N05 A;  2OU2 A;  1EV7 A;  3C18 A;  3OR2 C;  4A0X A;  3BPX A;  5BNG A;  3JRI A;  2DOD A;  2FEZ A;  4N9I A;  5AON A;  4BXX J;  1UG0 A;  4BHC A;  3TOB A;  1ETQ A;  2DMQ A;  3I58 A;  2BVL A;  2NXN B;  5DEQ A;  1B9M A;  3CJR B;  5JHU A;  5GP9 A;  1I27 A;  3BR2 A;  4R8H A;  3RYP A;  1FYK A;  3HOZ J;  1ZKG A;  2A61 A;  1SD7 A;  1RUO A;  1BM9 A;  4LLL A;  2JJ7 A;  2E34 A;  3U21 A;  2A6T A;  4M9Z A;  2O8K A;  3JRD A;  3J7A Y;  2R7O A;  2Z2S B;  2CFO A;  2MD0 A;  4Y4R A;  1K83 J;  3QOE A;  3PNT A;  3PO2 J;  2OCE A;  1MBF A;  5IP7 J;  2HOT A;  1SD6 A;  1TW3 A;  3WGI A;  4A93 J;  3ABT A;  2L0K A;  1BJZ A;  1POG A;  2VBZ A;  2VUM J;  2NVQ J;  1V54 H;  1TQM A;  3FXU A;  4S05 A;  4M6X A;  3E5U A;  4D5C A;  2IAI A;  3KLO A;  4J00 A;  3LMM A;  4DBQ A;  5JLW A;  3ZPL A;  5DYM A;  1ZH5 A;  2KIM A;  2RDP A;  2EFQ A;  1OYW A;  2Z1D A;  4YG2 F;  4UNO A;  1X1B A;  2PJP A;  5J4V A;  1OJL A;  1WFX A;  1ZG3 A;  4L9V A;  3BDD A;  1B9N A;  2GBY A;  1IRF A;  4ZDO A;  2HQR A;  3DKW A;  2DJI A;  5E18 F;  2JT1 A;  5TGT A;  4IX7 A;  3VFZ A;  2XAF A;  1A35 A;  3I0T A;  2FXA A;  3OOP A;  4RDU A;  3P9K A;  2R5Z B;  2CW7 A;  4UVC A;  1YJ9 I;  3EUH A;  1DGW Y;  3HTU A;  3SZT A;  4HST A;  3HBL A;  4L9J A;  3ELK A;  2ZSI B;  5JHF A;  1IN5 A;  4HW0 A;  1JT6 A;  1R1T A;  1R36 A;  1I5Z A;  3M8E A;  3MQ0 A;  4U7D A;  5C44 J;  4UV8 A;  3OYN A;  2E36 A;  2DPU A;  5FRN A;  1XSX A;  4LG0 B;  4HX8 A;  2ZBK A;  1HLV A;  5J40 A;  3SDG A;  2KIF A;  1E17 A;  4M3B A;  1FC3 A;  3L9F A;  4IVN A;  4AYB A;  4U0W A;  1AU7 A;  5FRM A;  5J47 A;  4BUP A;  2XAU A;  3K10 A;  3CP8 A;  1X58 A;  3CLQ A;  3R4K A;  3FMS A;  3RIR A;  4E6K G;  3NWT A;  4NQW B;  4G7O F;  5E3M A;  2ID3 A;  1S7E A;  2AO9 A;  3VDX A;  3RPU A;  1HSJ A;  2HOE A;  3CC4 I;  1STZ A;  4WX9 A;  2R3S A;  4BS9 A;  1VQL I;  3BOQ A;  4OIQ F;  3TDU C;  3G1O A;  3LFK A;  1IAW A;  5GTH C;  3S32 A;  3VOE A;  4A0Y A;  2VXD A;  3GX4 X;  4IKF A;  1SEU A;  3FIW A;  2CG4 A;  4ZYD A;  3HUG A;  1XN7 A;  1ACI A;  1Z91 A;  2NS8 A;  2KRF A;  2ZXH A;  4M74 A;  3I64 A;  3DTI A;  3BR3 A;  4MIM A;  4PGG A;  4AM3 A;  2GZW A;  3RPU D;  3UR3 C;  4QTR A;  3HOY J;  1V5F A;  1KGS A;  2HOA A;  2ZJ2 A;  1XX5 A;  4EJU A;  3ZXS A;  1EH7 A;  3Q5F A;  2TDX A;  2E7X A;  1Y0N A;  4BE2 A;  1YRN A;  3AG4 H;  1GT0 C;  3J80 Z;  2JWT A;  3R6S A;  2V9K A;  2ZFU A;  5H20 A;  5FO5 A;  4KNY A;  1QHH D;  4RLQ A;  1WJD A;  4F7Z A;  4C2T A;  2FU4 A;  3Q9S A;  5FKK A;  3WG9 A;  3PL8 A;  3G71 I;  5E17 F;  2R7S A;  2GM4 A;  5J6X A;  4ITV A;  4IZZ A;  2STT A;  1ERD A;  3GZ6 A;  2XAQ A;  1T2K A;  3BR0 A;  2ICW G;  5LGU A;  3HIF A;  2VON A;  2X48 A;  1LPQ A;  5CVJ A;  3J7Z I;  5LBQ A;  3GBG A;  3TW6 A;  1J59 A;  1KZH A;  1IUF A;  2ACJ A;  1Y1W J;  2IRF G;  2DI3 A;  2IGM A;  2W85 A;  2LP0 A;  2WY8 Q;  3KZI C;  2FBH A;  1FSH A;  3PQK A;  4E4H A;  1BC8 C;  3BG6 A;  1IW7 F;  3ABK H;  1ZAR A;  2GA1 A;  4IPA A;  3P9C A;  1YW7 A;  1X1C A;  2EIL H;  1ETY A;  3PNV A;  4X1E A;  2O6G E;  1PVE A;  4M6Y A;  4KN7 X;  3OV8 A;  3ECH A;  2KQR A;  5M3M J;  2KL4 A;  2QEN A;  3A02 A;  3F8B A;  4WF2 A;  5E8I A;  2QA4 I;  4OMY A;  2QM3 A;  3DCF A;  2WY7 Q;  1VI0 A;  4OIN F;  3EUH C;  3DF8 A;  2HVQ A;  2HQN A;  3A03 A;  2MGQ A;  3K4K A;  1MSF C;  3SZP A;  3F22 A;  3SFI A;  1RNL A;  1X19 A;  3BCA A;  4CYC B;  2DMN A;  4BJT A;  4DOZ A;  3VYS B;  4AUX A;  2EZH A;  3BZC A;  4M6V A;  2HPM A;  1E2X A;  2A6E F;  1YW8 A;  1AHD P;  1VQP I;  3H5N A;  3CMM A;  1IJW C;  2WB1 A;  2CW0 F;  4KMF A;  4R1H A;  1P7I A;  3VOD A;  1XD7 A;  2XPU A;  2E1M C;  3HB9 A;  3L2R A;  3MFK A;  1HKS A;  2KJB A;  5LRS A;  1QBJ A;  4RGR A;  5CPR B;  2B63 J;  1R00 A;  5HS9 A;  2RAE A;  2IS4 A;  3F72 A;  2QGU A;  2QZ8 A;  2HI3 A;  1VQ5 I;  2NAZ A;  2LD5 A;  1SVL A;  3K2Z A;  5L3F A;  3IC7 A;  1WH5 A;  3HOV J;  3TQN A;  1VQ9 I;  1Z0X A;  1JT0 A;  2A05 A;  4A6E A;  4GRI A;  4IRH A;  2DK8 A;  4AID A;  2VB6 A;  1WKM A;  2BV6 A;  4B1R A;  1WJB A;  1VQO I;  1FBQ A;  3DP7 A;  1TC3 C;  3BG5 A;  3K7A J;  1UZC A;  1O3Q A;  2L2O A;  3MZ8 A;  2E1M B;  4P55 A;  3GTK J;  3DQV C;  1D8K A;  2LDU A;  2MC3 A;  3K4M A;  4CCJ A;  3S93 A;  3W6V A;  1Z7U A;  2KIU A;  2VE9 A;  4B3X A;  3DBR B;  2M34 A;  4ABZ A;  2EJR A;  2LY1 A;  4ANJ A;  1XDS A;  3H3Z A;  1FSE A;  2YX4 A;  4LG0 A;  3ZMZ A;  4YEJ A;  1QPM A;  2W4S A;  3FK6 A;  1R6R A;  4FQG A;  3I4N J;  4YIF A;  1F4K A;  1OCZ H;  1U5T B;  2DBB A;  3MD2 A;  3TMO A;  2YUS A;  4G6T B;  1JI8 A;  4DYQ A;  5JLX A;  2KDZ A;  3ZMT A;  4EEF G;  5EGO A;  3MKZ A;  1ZAO A;  4KIT B;  4XLH A;  4RS8 A;  3HSE A;  3GTP J;  1TWA J;  3M8F A;  3BZ6 A;  2LBF B;  2L9N A;  1Z1D A;  5F0F A;  5K7F A;  3ABM H;  1WGX A;  1OCP A;  1ZTR A;  2IA2 A;  2W48 A;  4U0Y A;  2XF5 A;  1REP C;  2G9W A;  2MLK A;  2VKD A;  2XPV A;  2X1E A;  1XMX A;  1IRX A;  3MWM A;  3Q9V A;  3OWT A;  2CQN A;  2LY9 A;  5B1B H;  5GAG J;  1B8I B;  5KAI C;  3ABL H;  2LRD A;  4HEA 2;  2E19 A;  2STW A;  1SMT A;  1A04 A;  2QKM B;  4AC0 A;  2FQ4 A;  3LL7 A;  2E71 A;  3E6D A;  2ESH A;  4BAC A;  2A07 F;  1UAA A;  2HZT A;  2BHZ A;  2R93 J;  1YFH A;  2ZME A;  1DDN A;  3RKY A;  2VN2 A;  3CCQ I;  3JRF A;  2R7R A;  4CZC A;  1LFB A;  3M1E A;  5CVI A;  2RQP A;  2CJJ A;  2V1N A;  3K1P A;  3ERM A;  1X3Z B;  4ZYE A;  5FD6 A;  2EK5 A;  2P8T A;  1ORK A;  3A0H C;  4CGZ A;  2HR3 A;  3QOD A;  1LVA A;  3MZY A;  2LNB A;  4RB1 A;  4NC8 A;  2PJR A;  2KRH A;  2DW4 A;  2NOJ B;  1IRZ A;  2CQX A;  4U87 A;  3V8K A;  2X6Y A;  2LKP A;  1I50 J;  4ETS A;  3GYH X;  2NS0 A;  1VTN C;  3DXJ F;  2FSW A;  3HJE A;  3BQZ A;  3K4N A;  2R7V A;  4AIK A;  2QSG X;  2QQA A;  4JOM A;  3M4O J;  3PSI A;  5F0C A;  1ON1 A;  1WVR A;  4L5I A;  1UG2 A;  5BMZ A;  3H92 A;  4F3Q A;  5ILV A;  5E79 C;  5KCM A;  3ZQ7 A;  3EUK L;  2EA4 A;  2RN7 A;  4GDF A;  1IUY A;  2GIZ A;  2L5Q A;  4MFD A;  3SHF A;  3HHG A;  1WSU A;  2W82 A;  2O03 A;  1Z67 A;  3GVA A;  3K4L A;  2WWY A;  2P6T A;  1APL C;  2DT7 B;  2O0Y A;  5GPA A;  3ZMS A;  1WPK A;  1YS6 A;  3F3X A;  2BY3 A;  2IS1 A;  4I0A A;  1R7J A;  4I7H A;  4D7N A;  1RES A;  2H8R A;  3Q0W A;  2R5Z A;  3CCU I;  2CV2 A;  1F9N A;  1S7A A;  3GME A;  3WTX C;  4O5V A;  2MG4 A;  4RB0 A;  2GIV A;  3W6K B;  4MNU A;  5LHG A;  2DOF A;  2FOW A;  2L7M P;  4HX4 A;  4HLX A;  2A5Y B;  1QZE A;  2Y31 A;  2O8X A;  5CVR A;  1LUJ B;  3RKQ A;  4IHS A;  2BY1 A;  1OPC A;  2V6C A;  4HSR A;  2CUE A;  2VAS A;  2ECC A;  3VYU B;  1YHQ I;  4H4K C;  4RAG A;  4L0Y B;  3PO3 J;  2HXO A;  2PMZ N;  2HU9 A;  1HDD C;  6PAX A;  2EB7 A;  1R5I D;  4L5J A;  3ASN H;  3TDZ C;  3LSJ A;  4BXU A;  4LD5 A;  3FM3 A;  4EM0 B;  2FF4 A;  2PEX A;  4XN0 A;  3C2B A;  2IBD A;  4PUS A;  1PUE E;  1J09 A;  5FLV A;  2EIJ H;  1Q1V A;  2ZNY A;  2Z3Y A;  5DTD A;  3K4B A;  1LDJ A;  2JA6 J;  1PP8 F;  2EV6 A;  3E0J B;  2DJN A;  2HPI A;  1K78 A;  2Y9Y A;  2OUM A;  3GCM A;  5IOZ A;  5KNL A;  1Z21 A;  2F5E A;  2V6E A;  3K70 D;  2JA8 J;  1P4W A;  1BI0 A;  1Z05 A;  1SC7 A;  1XGM A;  1R1V A;  4D5F A;  4LK1 F;  3A1Y A;  2EIK H;  3ZOB A;  4M73 A;  5IPA A;  5HLT A;  3QU6 A;  2XKO A;  2K9M A;  4QPQ A;  3HYI A;  4EAT A;  3ZQG A;  3C1D A;  3SFZ A;  1O7L A;  2LC2 A;  2Y75 A;  4OIP F;  4UVA A;  2Q1Z B;  3CCM I;  1VQ4 I;  2V9P A;  2PQ8 A;  3NAR A;  1ETW A;  3KP2 A;  3I53 A;  3GFJ A;  5HNH A;  4PZJ A;  1ZK8 A;  1WJ5 A;  3HM5 A;  4B8X A;  3C3W A;  3CJT B;  1X3U A;  3I59 B;  1OQY A;  3O3K A;  3JTG A;  4QPO A;  4JX6 A;  5F1J A;  3CC7 I;  4YRV A;  4M3F A;  3QPL A;  2IS6 A;  2C6Y A;  3V42 A;  5A2Q Z;  5TJJ A;  3EUA A;  2ME6 A;  4P9F A;  3TED A;  4LFU A;  1EJ9 A;  4AIJ A;  3WU1 B;  3JRE A;  4I6Z A;  3O8G A;  5CVU A;  1ZGJ A;  2KT0 A;  1WJA A;  1WWX A;  1OMI A;  2CS3 A;  3JRC A;  4N4O B;  2DAO A;  3GTM J;  5C4J J;  3OYC A;  3VYT B;  3IL2 A;  2J5O A;  4RM2 A;  1G3W A;  5IT9 Z;  4IQ4 A;  4E7S A;  3HOT A;  3J81 K;  3HGY A;  4XOP A;  2K9Q A;  3LQR A;  2ECB A;  2ZKZ A;  2HQA A;  2MFZ A;  3HC7 A;  3WOD F;  2VOP A;  4BHB A;  3F8N A;  1JKP C;  5EYR A;  2IT0 A;  3U1K A;  1R9T J;  2G0E A;  3FHN A;  2ESN A;  2M8E A;  2XVC A;  2DQR A;  3K9T A;  4RBO A;  2V1D A;  2HEO A;  1ON2 A;  4GYI A;  3WTW C;  2IA0 A;  1UFM A;  4E70 A;  4IO9 F;  1ZEL A;  3MCZ A;  5A2Q K;  4WWC A;  3PIO F;  3ZP5 A;  1U8R A;  1AOY A;  3IUO A;  3KX2 A;  1QQI A;  2EIN H;  4FX0 A;  2H09 A;  4OAZ A;  4WXC A;  5J8C A;  2WV0 A;  2ELK A;  3E6B A;  5DUI A;  1OYY A;  1T0F A;  2VIX A;  1B1B A;  3S8P A;  4PFO A;  3T8R A;  3U1D A;  4D1Q A;  2E60 A;  5IY5 H;  2KKO A;  2M3A A;  2QWW A;  1WH7 A;  3A0B C;  4BHP A;  3GTJ J;  1ZLK A;  4KIB A;  3J7A O;  4XOT A;  2YSR A;  1HOM A;  3OOU A;  4P96 A;  2JQ7 A;  2D2W A;  3OIP A;  2EA2 A;  3OIO A;  2PLY A;  1OIS A;  2ELH A;  2DMP A;  1OCT C;  3LA3 A;  3M3Y J;  1OCC H;  2LSO A;  1K79 A;  2VXZ A;  1C0W A;  2FNP A;  3T8T A;  2BXZ A;  3LFU A;  3FHZ A;  4OIR F;  2HNH A;  4O6J A;  4YFK F;  2CUZ A;  2E5N A;  4CXF A;  3RYR A;  3WE3 A;  2OC6 A;  5FFX A;  1RRJ A;  3IAS 2;  3QOP A;  1MMN A;  2NNY A;  2RGV A;  2Z5U A;  4CCN A;  1X4P A;  3OIQ A;  5TRD A;  3DPT A;  4CUG A;  4X0G A;  3CDL A;  4I2O A;  1L0O C;  1W5T A;  4P9U A;  1W4M A;  3UNG C;  2DXI A;  1XC5 A;  2W00 A;  3H9G A;  3NAU A;  4C9Y A;  1KU7 A;  3S3O A;  3JAM Z;  2XAG A;  1BI3 A;  4ZDL A;  3FIS A;  2DT5 A;  5K7H A;  4CHU A;  2M45 A;  4A6D A;  2EWN A;  2FMY A;  4XBF A;  5DV5 A;  1LQ1 A;  2H6B A;  1W36 C;  3GXO A;  3RKX A;  4IHT A;  5D5U B;  1KQ8 A;  1HCR A;  1TQP A;  4WXD A;  1FT9 A;  3TO9 A;  3L7W A;  1UJ8 A;  2WV1 A;  1MBK A;  3G1M A;  2MD5 A;  2ZFW A;  3TKY A;  1W36 D;  2H27 A;  4C3J J;  1FP2 A;  3F6O A;  4G6D A;  1S7O A;  3VSL A;  3BR6 A;  2V1U A;  2CRG A;  2M30 A;  2L7F P;  3EPZ A;  1ULY A;  1FWZ A;  2VKH A;  3PUB A;  3H9Q A;  1K7A A;  1LKX A;  3AG2 H;  2OV7 A;  5CLS A;  3GTL J;  4GO1 A;  3E97 A;  3ZMU A;  2YR2 A;  1YO5 C;  1AKH A;  3F0C A;  4B3A A;  3IWZ A;  2HYG D;  5D8K B;  3LA7 A;  4IOC F;  1A31 A;  2UWM A;  1HKQ A;  1BA5 A;  3QPH A;  1HW2 A;  3DKX A;  4A3I J;  2IGK A;  2XRL A;  4II3 A;  5LRR A;  1U78 A;  1O3S A;  4PJM A;  2RNG A;  2FJ1 A;  5F6F A;  1MD0 A;  3WGH A;  4BQO A;  4Y7N J;  2VE8 A;  2CV0 A;  1ZG1 A;  4PJL A;  5HLG A;  2L7K A;  1PUF B;  3PQJ A;  3BRO A;  3KCC A;  5HNF A;  3KEY A;  4A69 C;  1ITY A;  1HST A;  4GGG A;  2HWV A;  1J5Y A;  3GFI A;  4HQE A;  9ANT A;  1IN7 A;  2F5D A;  3S1N J;  2ZO4 A;  1TZL A;  1H9G A;  1RR7 A;  3BY6 A;  3ZQF A;  2Z99 A;  2GLO A;  1OCR H;  1MZB A;  5JR3 A;  1S6L A;  3SXY A;  3NRV A;  4KIF A;  2HDC A;  3TO7 A;  4DBR A;  2O3F A;  4XIC A;  1T98 A;  3E5X A;  3W6J B;  4ZYG A;  2OA4 A;  4RM3 A;  5D6F A;  3CF2 A;  2XKP A;  2E5Z A;  5B1A H;  5K1Y A;  1IC8 A;  4DZP A;  4XK4 A;  2Q8K A;  1T6S A;  2VLA A;  2KMU A;  2Y0M A;  1OFC X;  2XF6 A;  3HOS A;  1J75 A;  4JBA A;  3LSG A;  4UB8 C;  1MJ9 A;  1IN8 A;  2ELJ A;  3VEP A;  5D4R A;  1MMA A;  2DU9 A;  3IKV A;  4H0E A;  4E7H A;  1UEL B;  1SFX A;  5AIP A;  2LF8 A;  3WTS C;  5FKL A;  3ZN0 A;  3D5S C;  4NNJ A;  2B0L A;  1WJC A;  5FB2 A;  2DMT A;  4G7Z F;  5GAE J;  2K27 A;  2BEO A;  3CJN A;  3UKG A;  2CGP A;  3OS2 A;  1S8N A;  1RC9 A;  2HTS A;  3FK7 A;  1JGG A;  2JN6 A;  1DPR A;  1MBH A;  2MLG A;  3FF5 A;  1YOV B;  2M7A A;  3FBI B;  1DQU A;  1WCM J;  5DD4 A;  1TWG J;  2XRN A;  2M0C A;  3PFY A;  3IRQ A;  1ENH A;  1X1A A;  2BZT A;  2OZU A;  4BAY A;  1R1U A;  4PFP A;  4BY7 J;  3CCL I;  2UXX A;  1T56 A;  2D5V A;  5FKO A;  1U0J A;  3GZ5 A;  4KT5 C;  3F21 A;  4XKC A;  3J7Y J;  3GFL A;  3OYK A;  4EM1 A;  4E7J A;  5H2F C;  4EMS A;  1TP4 A;  2NVT J;  2KLO A;  1D0Y A;  5LGT A;  2X9D A;  2XSJ C;  3HSR A;  2IP2 A;  1J2X A;  4D0P A;  3DU6 A;  3OS0 A;  4PJJ A;  3K1N A;  4BJ5 C;  3DBH B;  2X4H A;  1JGS A;  4FIS A;  1X2M A;  4XMY A;  5L3G A;  3PNY A;  2V26 A;  1BC7 C;  3G3Z A;  1P92 A;  4BEH A;  5FD5 A;  3W2V A;  3A01 A;  2KIQ A;  1OR7 C;  2BYV E;  2M4G A;  3M9A A;  1OCO H;  2R7Q A;  1RUN A;  4ZYH A;  1MDM B;  1FX7 A;  1WZ2 A;  1HF0 A;  4BH9 A;  2XRO A;  3SZG A;  5LHI A;  3OYH A;  1U6G A;  3ML6 A;  1QA6 A;  4UVB A;  5ILU A;  1W0U A;  1LE8 A;  4M71 A;  3HRT A;  3ERE D;  1ZGA A;  1XB4 A;  5EGO B;  3CQZ J;  1IO2 A;  4KT6 A;  4XLA A;  2ISY A;  4CZZ A;  4IOA F;  1G3Y A;  1Y8Q B;  1X4O A;  1IF1 A;  2DCE A;  3WTU C;  3QQA A;  4KIS A;  1JUS A;  1BR4 A;  2PFB A;  1IXS B;  2L9V A;  3ABU A;  2JK3 A;  2ZCW A;  5E20 A;  5GAD J;  3S3M A;  4EM2 A;  3TP0 A;  3DPU A;  2JUC A;  3G73 A;  4BQQ A;  4GCV A;  3IH4 A;  5B3S H;  4C2U A;  3KYC B;  3VB2 A;  3HTS B;  2ADU A;  1KYZ A;  4FE4 A;  3MKW B;  1YI2 I;  3N97 A;  4UB6 C;  2MC4 A;  3G1L A;  3QYB A;  2WB1 N;  2XF7 A;  3GFM A;  4P5O A;  1V5E A;  4CCK A;  3LST A;  3OY9 A;  3KEQ A;  1I1G A;  1XCB A;  1K6Y A;  1V4R A;  4LK0 F;  2GXA A;  3C2H A;  1JHF A;  1FNN A;  2I8D A;  4N4N B;  5GTI C;  2VQH A;  3EYY A;  2XGE A;  4XLC A;  1IZ1 A;  4V2F A;  3EDP A;  2DLL A;  4D7M A;  2DPD A;  4AU7 A;  2K86 A;  3MZH A;  3KP5 A;  2A6H F;  4Z6Y A;  2Z16 A;  3CCR I;  1KQ9 A;  2QBY B;  2FE3 A;  3L2U A;  3OS1 A;  1EH6 A;  4BNC A;  3CLO A;  1JTX A;  2DDA A;  4XRS A;  1A36 A;  2B7E A;  1AKH B;  1CQT A;  5H6R A;  1RI7 A;  1Y6I A;  2A68 F;  2X6O A;  1DP7 P;  3KEO A;  4RAZ A;  1SAN A;  2K3P A;  4Y17 A;  2P5K A;  3I5U A;  2DQL A;  4YFX F;  2JA7 J;  2JVG A;  5IP9 J;  3ZMV A;  4O3M A;  4MHG A;  1D1A A;  1SFE A;  3FX3 A;  3QWL A;  4HV5 A;  3D1N I;  3HKZ N;  4U88 A;  3RTR A;  4I76 A;  5EEH A;  1AWC A;  5DCM A;  1O7F A;  3I3L A;  2AQE A;  2W57 A;  1HW5 A;  4NQW A;  2QCO A;  5HDK A;  2LTP A;  3GTO J;  5J4Y A;  1FOK A;  2NVY J;  1X2N A;  2BVM A;  2K4J A;  3KP4 A;  4HF0 A;  3HEF A;  3BTL A;  2L4A A;  1N78 A;  3CME I;  1D0X A;  3CC2 I;  3MN2 A;  3RZO J;  2DFF A;  2FA5 A;  2BBY A;  2Y2Z A;  1JJ8 C;  2Q0O A;  2LLK A;  1SFO J;  1UB9 A;  2EQR A;  3BR1 A;  2FRH A;  3BTJ A;  1OR7 A;  5DUK A;  2EZK A;  4CO8 A;  3I56 I;  3FWE A;  3V8J A;  2MSY A;  3SYT A;  2PMU A;  1TBX A;  3JR9 A;  2AXT C;  4LLG F;  3M8J A;  2H94 A;  3P9I A;  2E7W A;  3SEQ A;  5ICF A;  3CZ6 A;  4A12 A;  5LEJ A;  2J5P A;  2XGD A;  4UXN A;  2A5W A;  3CUO A;  4C3I J;  1K78 B;  3X2Q H;  5L3B A;  2KHM A;  2GXB A;  1HXD A;  5EG0 A;  4ZTJ A;  1H0M A;  2P6S A;  2DA1 A;  3CMA I;  2WAQ N;  1R58 A;  3RDI A;  1FTZ A;  4EQQ A;  2IVM A;  1HDP A;  4A5M A;  1RKT A;  3I71 A;  1IRG A;  1SAX A;  3CO6 C;  1GDT A;  3DFG A;  2RKH A;  2QEX I;  1SD4 A;  1GLN A;  3E5Q A;  4DYR A;  3U9G A;  4Y3O A;  1MBG A;  2FBK A;  1Y8R B;  2D1H A;  1V5G A;  2OBP A;  4OMZ A;  4A3E J;  3RPQ A;  3L00 A;  3OYF A;  1FMW A;  5K5Q A;  4OIO F;  4P1W A;  3JAM K;  3S1Q J;  3CUQ B;  4L0Z B;  2XB5 A;  5EJC A;  3EQL F;  2FNA A;  2XAS A;  2CU7 A;  4B4C A;  4IQJ A;  1FMV A;  5D5W B;  4A3D J;  3SEZ A;  1JUP A;  2UXN A;  5M5X J;  1YTY A;  3DTK A;  2XAJ A;  3CDH A;  5LHH A;  4NUB A;  2FOK A;  3RI4 A;  4XOR A;  2RRE A;  4A5N A;  3IWF A;  5HOD A;  4FCY A;  3ISP A;  4ESB A;  2N8G A;  3FXQ A;  4MLO A;  1OLT A;  1NH3 A;  3L09 A;  3MEX A;  3L2V A;  4IHW A;  3K4J A;  1SVO A;  1XS9 A;  1UMQ A;  4PGH A;  1LDK B;  1U9N A;  1H8A C;  2AS5 F;  4CA0 A;  3L2C A;  1MKM A;  1MMS A;  2XDV A;  2CWE A;  5ICC A;  3LSK A;  5H6Q A;  3DPL C;  4HF2 A;  3GO5 A;  1VQN I;  2R7X A;  2VOO A;  1VND A;  2L9S A;  5BS6 A;  1M1E B;  2LRE A;  2CO5 A;  2L7Z A;  2JRM A;  4ON0 A;  1IDZ A;  4HOB A;  1GV2 A;  2RC4 A;  3TBI A;  2Y48 A;  4E7K A;  4QLC U;  1TNS A;  3M7G A;  3LSI A;  5M5Y J;  4BJ6 C;  3ESW B;  3B6C A;  3GLX A;  3GF2 A;  5E8G A;  1TWC J;  1NHA A;  1P4A A;  1YX3 A;  2PG4 A;  3IHU A;  3ZQC A;  3CMY A;  1MNE A;  5M3F J;  2HVR A;  4HF1 A;  4YEL A;  1VF9 A;  3BC8 A;  4F52 A;  2QQ8 A;  5HDG A;  2DO7 A;  1Y56 A;  2GOX B;  3ZGK A;  1D8J A;  1N75 A;  3LOC A;  4XSZ F;  3OYL A;  4XL9 A;  1E3P A;  3F8C A;  1KON A;  4XKV A;  1BI1 A;  1Z3X A;  4HZF A;  2LR8 A;  1A5J A; 
#chains in the Genus database with same CATH homology
 4U0V A;  1FYL A;  4MTD A;  3D5L A;  4M9S A;  1QZZ A;  4UUV A;  3J81 Z;  1QZY A;  5JVT A;  3NEU A;  3CTA A;  3FMQ A;  1RIO H;  3KET A;  4WK8 F;  4L18 B;  3JSP A;  4MGR A;  2FML A;  3D0S A;  1YS7 A;  2L4M A;  2GQQ A;  3LAP A;  1YIO A;  5JFR A;  1ZN2 A;  3P7N A;  2EV0 A;  2QVO A;  5E1X A;  2Z33 A;  2PI0 A;  3F8F A;  4LB5 A;  2CFX A;  4RAY A;  3T1B A;  3KLN A;  4NB5 A;  1MJB A;  1U2W A;  3JW4 A;  2JZY A;  5D6E A;  3E3V A;  1R23 A;  5FLX Z;  1J9I A;  2H6C A;  4MQV A;  2YPR A;  1YW9 A;  1LEB A;  2HKO A;  3BPV A;  3JTH A;  4EJT A;  1UCR A;  4FT8 A;  3B73 A;  3MAJ A;  3IRR A;  1B6A A;  2G7U A;  1B59 A;  2CYY A;  1FZP B;  2EFO A;  1KU3 A;  4RGU A;  4Q4Z F;  1YYV A;  1QNT A;  3WTY C;  4HX7 A;  2QQB A;  3ECO A;  2F2E A;  2ZXJ A;  2JSC A;  5D5V B;  2Z9O A;  1P2F A;  3KE2 A;  3BP8 A;  2MH2 A;  5DCF A;  2HS5 A;  2COM A;  3V8L A;  1IN6 A;  4BYY A;  1XGS A;  3R61 A;  2WC2 A;  4WCG A;  2EV5 A;  1BIB A;  3HRU A;  4Q5S F;  4DQ2 A;  3KFW X;  3I4P A;  2P7V B;  1WI9 A;  2V1X A;  4CDG A;  2KJC A;  3PFI A;  2JPC A;  2F5C A;  3GW2 A;  1S3J A;  4KFC A;  4RGX A;  2VT3 A;  3LAJ A;  1P4X A;  1W7P D;  5F1R A;  3I54 A;  1XGO A;  3V7C A;  5ICE A;  2L02 A;  1UHM A;  3V7R A;  2P7C B;  3K0L A;  1H9T A;  4RB3 C;  3S2W A;  2XV4 S;  5ILS A;  2YU3 A;  4ESJ A;  2D45 A;  1ONV A;  4ASN A;  5DCM B;  1KU2 A;  3RKW A;  4HYE A;  3J80 K;  2IA1 A;  1G3S A;  4I09 A;  2QYO A;  2WTE A;  5K5O A;  3KP3 A;  1U5T C;  4KIC A;  1OKR A;  4U7B A;  5HS7 A;  4MQ9 F;  1B4A A;  3IKT A;  4ESF A;  3HRS A;  4XLN F;  3TGN A;  2JPB A;  1BJA A;  3H3U A;  4FHT A;  4ZH4 F;  1WQ2 A;  2RVC A;  2EFW A;  3CO7 C;  5BPI A;  2M5W A;  1D5V A;  4M72 A;  3N4M A;  2CSO A;  2BGC A;  4FX4 A;  2QQ9 A;  5J8F A;  5HDN A;  1G3T A;  2W84 A;  4A2U A;  5K5R A;  2X0L A;  5BOX A;  4L9N A;  2XGX A;  3WU0 A;  2XAH A;  5D5X B;  3BWG A;  2VBX A;  5BQT A;  4IF4 A;  2A69 F;  2W25 A;  1DUX C;  4AIH A;  3COA C;  2VT2 A;  4YII A;  1SMY F;  4OOI A;  2RNJ A;  1XSV A;  2QBY A;  1IXR C;  4HAM A;  2OZ6 A;  5ED4 A;  4PDK A;  3F23 A;  3O2P E;  4KA4 A;  5EEG A;  3WGG A;  4IRG A;  4BQA A;  1R22 A;  3ZMD A;  1XGN A;  3WTZ A;  1O3T A;  1Z9C A;  5E1Z B;  3R0J A;  3KP6 A;  2P5V A;  2HGC A;  2IJL A;  3ZN1 A;  2L54 A;  3DV8 A;  4KUM A;  3U2R A;  3EYI A;  3BJA A;  2L01 A;  4EGZ A;  3BJ6 A;  3KP7 A;  5IT3 A;  1ZRC A;  5CVV A;  1U3E M;  4ZZD A;  4ENN A;  5LEK A;  1W7P B;  1GVJ A;  4K2E A;  5HLH A;  3TOA A;  1G6N A;  1ZG5 A;  1Q1H A;  2FQ3 A;  2XHK A;  4B09 A;  2ZNZ A;  3F6V A;  4KMU X;  2NRA C;  4G94 A;  1TNT A;  1CF7 B;  4OU0 A;  2F5F A;  1QO0 D;  1P6R A;  4UV9 A;  3K1M A;  1OYI A;  5CYV A;  1T39 A;  1Z6R A;  4CYD A;  1FBS A;  2OD5 A;  2E1C A;  4HV6 A;  3LWF A;  1XCV A;  4LLN A;  1XMA A;  2CQK A;  5JI6 A;  1SFU A;  2OQG A;  1LJ9 A;  2A3S A;  4UHT A;  4EJW A;  4Z2Y A;  4EJO A;  4ZZL A;  4L9T A;  1CF7 A;  1FP1 D;  1USS A;  3V4G A;  2HFH A;  4DNC A;  3FZV A;  4XRF A;  3FM5 A;  4KIG A;  3QU3 A;  1GXQ A;  5HLI A;  2ETH A;  1ODD A;  4LJZ F;  5FFZ A;  3T0Y A;  2VC0 A;  4I01 A;  4WXH A;  3E6C C;  5FLX K;  2MBF A;  1HQC A;  1UHW A;  5KVR A;  2PMH A;  4MEY F;  2EFN A;  3QRF F;  1WRJ A;  1TW2 A;  4EVI A;  4HBL A;  4ENM A;  2O61 A;  4JK1 X;  1I1S A;  3CUQ C;  2K4B A;  1T38 A;  1XMK A;  4LGW A;  3HSF A;  1KQ0 A;  4HA8 A;  2HTJ A;  5IT9 K;  3O6B B;  5DD8 A;  5LLQ A;  2QUF A;  4S04 A;  2RV8 A;  4TV7 A;  1TLH B;  3B02 A;  1JE8 A;  4IJA A;  1FBU A;  4HDV A;  3BJO A;  4IXA A;  1LNW A;  1ZHF A;  1LDD A;  1J0R A;  4G6Q A;  1Z6T A;  1MJA A;  4QWQ A;  2PBI A;  2MA3 A;  4NHJ A;  2PN6 A;  1MDM A;  1Y0U A;  4MTE A;  1W5S A;  2K7L A;  4G8X A;  2NYX A;  1BIA A;  1R5G A;  2JTV A;  2YX7 A;  1D3Y A;  1O57 A;  4AD9 A;  2ZME B;  2G7H A;  4R79 A;  1PP7 U;  2HYF A;  3LA2 A;  2LF7 A;  3NQO A;  3HRM A;  2V79 A;  4EJV A;  1QGP A;  4PCQ A;  2P5L C;  3R0A A;  3HHH A;  4IRI A;  5HS8 A;  1ZYR F;  1YG2 A;  1UST A;  1V3F A;  1I6X A;  1YQA A;  4N0B A;  3K69 A;  2VBY A;  1HKT A;  4MEX F;  1FY7 A;  2QLZ A;  3V7S A;  1CGP A;  3REO A;  4I02 A;  4EGY A;  2UZK A;  2R7D A;  4N9H A;  5CJ9 A;  5L3E A;  2R7F A;  3FMR A;  3F8M A;  2IW5 A;  2GXG A;  1ZRF A;  4LMY A;  2JRT A;  4XLP F;  3KZY A;  1F1Z A;  3ULQ B;  1S29 A;  1MGT A;  3T5X A;  3GUD A;  1IXC A;  2E1N A;  4HQM A;  1FYM A;  2XIG A;  1O3R A;  1ZRE A;  3ROU A;  2P4W A;  1F5T A;  1G4D A;  2MH9 A;  5HOO A;  4I98 B;  1HBX G;  2NNN A;  3WTT C;  1GHC A;  5HVQ C;  4HDU A;  1LB2 A;  2BE5 F;  3FXR A;  2GWR A;  1KYW A;  1ZRD A;  5AIQ A;  2DK5 A;  5L3C A;  4RB2 C;  1RZ4 A;  4AVP A;  4Y13 A;  2M87 A;  4KYW A;  4KN4 X;  3QPT A;  5BPD A;  2OAZ A;  3QP5 A;  3QAH A;  3LQQ A;  5DDG A;  4M9X A;  1YLF A;  1GXP A;  1XSD A;  5KK1 A;  1JXS A;  4G9Y A;  4KDP A;  1LEA A;  2GAU A;  1BOA A;  4RGS A;  5D4S A;  3TO6 A;  4JQF A;  3C7J A;  4ENJ A;  3QP6 A;  3I59 A;  4HLY A;  3GEZ A;  4LB6 B;  1FPQ A;  2Q2E A;  3DEU A;  4XSX F;  3WE2 A;  1PDN C;  1BN5 A;  4GYG A;  1KU9 A;  2VOD A;  1ZLJ A;  5LGN A;  3CUQ A;  2HKX A;  1BI2 A;  4YFN F;  5ERI A;  3RJP A;  1KA8 A;  3R60 A;  5FGM A;  3AAF A;  2D1V A;  1K6O A;  5F64 A;  4GXO A;  5L3D A;  3EET A;  4Q48 A;  1W7P A;  4Q47 A;  2IPQ X;  4I0B A;  1R5H A;  5E1W A;  1IN4 A;  1U5T A;  1EH8 A;  3WTV C;  2VBW A;  4A0Z A;  2W24 A;  5D8L B;  3GWZ A;  1BBY A;  1TQI A;  4CIC A;  2DTR A;  4AWX B;  5ICG A;  2AXL A;  1L3L A;  2ISZ A;  4G7H F;  1J7K A;  2K02 A;  1TTY A;  1XDU A;  4Y15 A;  4ENK A;  1SD5 A;  2V9V A;  1HW1 A;  1DPU A;  2M1B A;  2GA2 A;  3E6M A;  2VC1 A;  2EFP A;  2DFI A;  4EV0 A;  3KZZ A;  2L3D A;  1JHH A;  1FLI A;  2XUB A;  3JSO A;  2FBI A;  3SQN A;  2OQR A;  2OU2 A;  1EV7 A;  4A0X A;  3C18 A;  3BPX A;  4N9I A;  2FEZ A;  5AON A;  4BHC A;  3TOB A;  3I58 A;  5DEQ A;  1B9M A;  5JHU A;  1I27 A;  3RYP A;  4R8H A;  1FYK A;  2A61 A;  1SD7 A;  1RUO A;  1BM9 A;  4LLL A;  4M9Z A;  1SD6 A;  1TW3 A;  3WGI A;  3ABT A;  2VBZ A;  1TQM A;  3FXU A;  4S05 A;  4M6X A;  3E5U A;  3KLO A;  3ZPL A;  5DYM A;  1ZH5 A;  2KIM A;  2RDP A;  2EFQ A;  1OYW A;  4YG2 F;  4UNO A;  2PJP A;  4L9V A;  1ZG3 A;  3BDD A;  1B9N A;  1IRF A;  2HQR A;  3DKW A;  5E18 F;  2JT1 A;  3VFZ A;  2XAF A;  3I0T A;  2FXA A;  3OOP A;  3P9K A;  4UVC A;  3EUH A;  3HTU A;  3SZT A;  4L9J A;  3ELK A;  1IN5 A;  4HW0 A;  1R1T A;  1R36 A;  1I5Z A;  3M8E A;  3MQ0 A;  4U7D A;  4UV8 A;  2DPU A;  1XSX A;  4LG0 B;  4HX8 A;  2ZBK A;  2KIF A;  1E17 A;  1FC3 A;  3L9F A;  4IVN A;  4U0W A;  3R4K A;  3RIR A;  3FMS A;  4G7O F;  3RPU A;  1HSJ A;  2HOE A;  1STZ A;  4WX9 A;  2R3S A;  3BOQ A;  4OIQ F;  3TDU C;  3LFK A;  1IAW A;  3VOE A;  4A0Y A;  3GX4 X;  2CG4 A;  4ZYD A;  3HUG A;  1XN7 A;  1Z91 A;  2KRF A;  4M74 A;  3I64 A;  4PGG A;  2GZW A;  1KGS A;  2ZJ2 A;  4EJU A;  1EH7 A;  3Q5F A;  2TDX A;  2E7X A;  3J80 Z;  3R6S A;  5H20 A;  5FO5 A;  4KNY A;  4F7Z A;  2FU4 A;  3Q9S A;  3WG9 A;  5E17 F;  5J6X A;  2STT A;  3GZ6 A;  2XAQ A;  1T2K A;  5LGU A;  3HIF A;  2VON A;  5CVJ A;  5LBQ A;  1J59 A;  2ACJ A;  2IRF G;  2DI3 A;  2W85 A;  2FBH A;  1FSH A;  3PQK A;  1BC8 C;  1IW7 F;  1ZAR A;  2GA1 A;  4IPA A;  3P9C A;  1YW7 A;  2O6G E;  4M6Y A;  4KN7 X;  3OV8 A;  3ECH A;  4WF2 A;  2QEN A;  3F8B A;  4OMY A;  5E8I A;  2QM3 A;  4OIN F;  3DF8 A;  2HQN A;  3SZP A;  3F22 A;  1RNL A;  1E2X A;  2A6E F;  1YW8 A;  2CW0 F;  4KMF A;  4R1H A;  3VOD A;  1XD7 A;  3MFK A;  1HKS A;  2KJB A;  5LRS A;  1QBJ A;  4RGR A;  1R00 A;  5HS9 A;  3F72 A;  2QZ8 A;  2NAZ A;  3K2Z A;  5L3F A;  3IC7 A;  3TQN A;  4A6E A;  4IRH A;  2DK8 A;  1WKM A;  2BV6 A;  1FBQ A;  3DP7 A;  1O3Q A;  4P55 A;  3DQV C;  1D8K A;  2LDU A;  2MC3 A;  1Z7U A;  2KIU A;  2VE9 A;  2EJR A;  1XDS A;  3H3Z A;  1FSE A;  2YX4 A;  4LG0 A;  3ZMZ A;  1QPM A;  4YIF A;  1F4K A;  1U5T B;  2DBB A;  3ZMT A;  1ZAO A;  4RS8 A;  3HSE A;  3M8F A;  3BZ6 A;  1Z1D A;  2IA2 A;  4U0Y A;  1REP C;  2G9W A;  2MLK A;  3MWM A;  3Q9V A;  2STW A;  1SMT A;  1A04 A;  3E6D A;  2ESH A;  2A07 F;  2HZT A;  1YFH A;  2ZME A;  1DDN A;  3RKY A;  2VN2 A;  3M1E A;  5CVI A;  2RQP A;  3K1P A;  4ZYE A;  5FD6 A;  2EK5 A;  2P8T A;  4CGZ A;  2HR3 A;  1LVA A;  3MZY A;  2LNB A;  4RB1 A;  2DW4 A;  3V8K A;  2LKP A;  4ETS A;  3GYH X;  2NS0 A;  1VTN C;  3DXJ F;  2FSW A;  4AIK A;  2QQA A;  1ON1 A;  4L5I A;  5BMZ A;  3H92 A;  5ILV A;  3ZQ7 A;  2EA4 A;  2RN7 A;  1IUY A;  3SHF A;  3HHG A;  1WSU A;  2O03 A;  3GVA A;  2WWY A;  2P6T A;  2O0Y A;  3ZMS A;  1YS6 A;  3F3X A;  4I0A A;  1R7J A;  4I7H A;  1F9N A;  1S7A A;  3WTX C;  4O5V A;  4RB0 A;  2GIV A;  3W6K B;  4MNU A;  5LHG A;  4HX4 A;  4HLX A;  2A5Y B;  2O8X A;  5CVR A;  4IHS A;  1OPC A;  2V6C A;  4L0Y B;  6PAX A;  2EB7 A;  4L5J A;  3TDZ C;  4BXU A;  4LD5 A;  3FM3 A;  4EM0 B;  2FF4 A;  2PEX A;  1PUE E;  2ZNY A;  2Z3Y A;  1LDJ A;  1PP8 F;  2EV6 A;  1K78 A;  2F5E A;  1P4W A;  1BI0 A;  1Z05 A;  1XGM A;  1R1V A;  4LK1 F;  4M73 A;  3QU6 A;  2XKO A;  3HYI A;  3C1D A;  3SFZ A;  1O7L A;  2Y75 A;  4OIP F;  4UVA A;  2PQ8 A;  3KP2 A;  3I53 A;  3GFJ A;  4PZJ A;  4B8X A;  3C3W A;  3I59 B;  1X3U A;  3O3K A;  3JTG A;  2C6Y A;  5A2Q Z;  5TJJ A;  4P9F A;  4LFU A;  4AIJ A;  3WU1 B;  5CVU A;  1ZGJ A;  1WWX A;  1OMI A;  2DAO A;  3IL2 A;  2J5O A;  1G3W A;  5IT9 Z;  3HOT A;  3J81 K;  3LQR A;  2ZKZ A;  2VOP A;  3WOD F;  4BHB A;  3F8N A;  2IT0 A;  2ESN A;  2M8E A;  2XVC A;  2DQR A;  3K9T A;  2V1D A;  2HEO A;  1ON2 A;  4GYI A;  3WTW C;  2IA0 A;  1UFM A;  4E70 A;  4WWC A;  3MCZ A;  5A2Q K;  3ZP5 A;  1U8R A;  1AOY A;  1QQI A;  4FX0 A;  4WXC A;  2H09 A;  5J8C A;  5DUI A;  2WV0 A;  3E6B A;  1OYY A;  1T0F A;  3U1D A;  1B1B A;  3T8R A;  2KKO A;  2QWW A;  4BHP A;  1ZLK A;  4KIB A;  3J7A O;  2YSR A;  4P96 A;  2D2W A;  2PLY A;  2EA2 A;  2ELH A;  3LA3 A;  2LSO A;  1K79 A;  2VXZ A;  1C0W A;  2FNP A;  3T8T A;  3FHZ A;  4OIR F;  4O6J A;  4YFK F;  4CXF A;  3RYR A;  3WE3 A;  5FFX A;  3QOP A;  2NNY A;  2RGV A;  2Z5U A;  5TRD A;  3DPT A;  4I2O A;  1L0O C;  1W5T A;  4P9U A;  1W4M A;  1KU7 A;  3JAM Z;  2XAG A;  1BI3 A;  2DT5 A;  4CHU A;  2M45 A;  4A6D A;  2EWN A;  2FMY A;  4XBF A;  5DV5 A;  1LQ1 A;  2H6B A;  1KQ8 A;  3GXO A;  3RKX A;  4IHT A;  5D5U B;  1TQP A;  4WXD A;  1FT9 A;  3TO9 A;  3L7W A;  2MD5 A;  2ZFW A;  3TKY A;  2H27 A;  1FP2 A;  3F6O A;  4G6D A;  1S7O A;  2V1U A;  2M30 A;  1ULY A;  1FWZ A;  1K7A A;  5CLS A;  4GO1 A;  3E97 A;  3ZMU A;  2YR2 A;  1YO5 C;  3IWZ A;  2HYG D;  5D8K B;  3LA7 A;  2UWM A;  1HKQ A;  3QPH A;  1HW2 A;  5LRR A;  1U78 A;  1O3S A;  5F6F A;  3WGH A;  1MD0 A;  2VE8 A;  1ZG1 A;  5HLG A;  3PQJ A;  3BRO A;  3KCC A;  1HST A;  4GGG A;  2HWV A;  1J5Y A;  3GFI A;  4HQE A;  1IN7 A;  2F5D A;  2ZO4 A;  1H9G A;  3BY6 A;  2Z99 A;  1MZB A;  5JR3 A;  1S6L A;  3SXY A;  3NRV A;  4KIF A;  2HDC A;  3TO7 A;  2O3F A;  1T98 A;  3E5X A;  3W6J B;  4ZYG A;  2OA4 A;  5D6F A;  2XKP A;  5K1Y A;  2Q8K A;  1T6S A;  2Y0M A;  3HOS A;  1J75 A;  4JBA A;  1MJ9 A;  1IN8 A;  3VEP A;  5D4R A;  2DU9 A;  3IKV A;  4H0E A;  1SFX A;  5AIP A;  2LF8 A;  3WTS C;  3ZN0 A;  2B0L A;  5FB2 A;  4G7Z F;  2K27 A;  2BEO A;  3CJN A;  2CGP A;  1S8N A;  2HTS A;  1DPR A;  2MLG A;  3FF5 A;  5DD4 A;  2XRN A;  3IRQ A;  2OZU A;  4BAY A;  1R1U A;  2UXX A;  3GZ5 A;  4KT5 C;  3F21 A;  3GFL A;  4EM1 A;  4EMS A;  5LGT A;  3HSR A;  2IP2 A;  1J2X A;  4D0P A;  3K1N A;  2X4H A;  1JGS A;  5L3G A;  1BC7 C;  3G3Z A;  1P92 A;  5FD5 A;  2BYV E;  3M9A A;  1RUN A;  4ZYH A;  1MDM B;  1FX7 A;  4BH9 A;  2XRO A;  5LHI A;  1U6G A;  3ML6 A;  4UVB A;  5ILU A;  4M71 A;  3HRT A;  3ERE D;  1ZGA A;  1XB4 A;  2ISY A;  4CZZ A;  1G3Y A;  1IF1 A;  3WTU C;  2PFB A;  1IXS B;  3ABU A;  2ZCW A;  5E20 A;  4EM2 A;  3G73 A;  4GCV A;  3VB2 A;  3HTS B;  2ADU A;  1KYZ A;  3N97 A;  3GFM A;  4P5O A;  3LST A;  3KEQ A;  1I1G A;  1XCB A;  1V4R A;  4LK0 F;  1JHF A;  1FNN A;  3EYY A;  1IZ1 A;  3EDP A;  2DLL A;  2DPD A;  2K86 A;  3MZH A;  3KP5 A;  2A6H F;  1KQ9 A;  2QBY B;  2FE3 A;  1EH6 A;  4BNC A;  3CLO A;  5H6R A;  1RI7 A;  2A68 F;  1DP7 P;  3KEO A;  4RAZ A;  4Y17 A;  2P5K A;  3I5U A;  2DQL A;  4YFX F;  3ZMV A;  4O3M A;  4MHG A;  1SFE A;  3FX3 A;  4HV5 A;  4U88 A;  3RTR A;  5EEH A;  1AWC A;  5DCM A;  1O7F A;  2W57 A;  1HW5 A;  4NQW A;  5HDK A;  1FOK A;  2K4J A;  3KP4 A;  4HF0 A;  2L4A A;  2FA5 A;  2BBY A;  2Q0O A;  1UB9 A;  2FRH A;  1OR7 A;  5DUK A;  4CO8 A;  3FWE A;  3V8J A;  2PMU A;  1TBX A;  4LLG F;  2H94 A;  3P9I A;  2E7W A;  5ICF A;  4A12 A;  5LEJ A;  2J5P A;  4UXN A;  3CUO A;  1K78 B;  5L3B A;  2GXB A;  1HXD A;  1H0M A;  2P6S A;  1R58 A;  3RDI A;  4EQQ A;  2IVM A;  4A5M A;  3I71 A;  1IRG A;  1SAX A;  3CO6 C;  3DFG A;  2RKH A;  1SD4 A;  3E5Q A;  3U9G A;  2FBK A;  2D1H A;  2OBP A;  4OMZ A;  3RPQ A;  3L00 A;  5K5Q A;  4OIO F;  3JAM K;  3CUQ B;  4L0Z B;  3EQL F;  2FNA A;  2XAS A;  5D5W B;  2UXN A;  1YTY A;  2XAJ A;  3CDH A;  5LHH A;  2FOK A;  3RI4 A;  4A5N A;  3IWF A;  3ISP A;  4ESB A;  3FXQ A;  3L09 A;  3MEX A;  4PGH A;  1LDK B;  2AS5 F;  3L2C A;  1MKM A;  2CWE A;  5ICC A;  5H6Q A;  3DPL C;  4HF2 A;  3GO5 A;  2VOO A;  5BS6 A;  2CO5 A;  4ON0 A;  4HOB A;  2RC4 A;  2Y48 A;  4QLC U;  1TNS A;  3M7G A;  3GLX A;  3GF2 A;  5E8G A;  1NHA A;  1P4A A;  2PG4 A;  3IHU A;  4HF1 A;  5HDG A;  2DO7 A;  1D8J A;  4XSZ F;  3F8C A;  1BI1 A;  4HZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...