3J81K

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81K00
5E8IA 1R58A 1XGOA 3WTXC 4P9UA 1IW7F 2F5DA 5HLGA 4QWQA 2HEOA 1HBXG 2ESNA 2K27A 3FX3A 2V6CA 2QBYA 2J5PA 1LDDA 1XGNA 1R00A 1UHWA 2MA3A 2QBYB 2JPCA 2E7XA 1TNTA 2A07F 3WG9A 5J8CA 3P9CA 3R61A 4L9NA 4ZH4F 3Q9VA 2DI3A 5L3DA 3TO9A 3ZMTA 1FP1D 3WODF 5L3CA 2FRHA 4KUMA 2AS5F 4AIJA 4ZZLA 2HQNA 5HDNA 2XHKA 5K5RA 4UVCA 2XGXA 4LJZF 2DLLA 4IJAA 1TTYA 3IRRA 2KIFA 5ICCA 2V1UA 4IHSA 4YFKF 2QQ9A 3WGGA 2JRTA 4Q5SF 4NQWA 4EV0A 1MD0A 3CLOA 2DK5A 3K1NA 2XVCA 3QP6A 3ISPA 2K86A 5D8KB 4M71A 4U7BA 3EDPA 3KP2A 3K2ZA 4HDUA 5FGMA 5F1RA 1YG2A 2G7HA 3U2RA 3C7JA 1BI1A 3SZTA 2Y0MA 3ZN0A 4KMFA 4GYGA 3IKVA 3I0TA 4G7HF 1I27A 4A0XA 3MQ0A 3V7CA 2P6TA 1YW9A 1T98A 4L5IA 2KRFA 2Y75A 2ZXJA 2EFOA 4Z2YA 1T6SA 1ZRFA 3E6MA 2PI0A 3D5LA 1AOYA 2A68F 2DPDA 2GQQA 4Q47A 5A2QZ 1R22A 3Q9SA 2ZNZA 1FX7A 2MLKA 1KU9A 2FBIA 2X4HA 4Y15A 5D5VB 2JPBA 1R1UA 2KJBA 4WX9A 1BI2A 1WQ2A 4KDPA 1P2FA 4EJOA 1DUXC 3I5UA 4ZYHA 3TQNA 2LNBA 2VC0A 4M74A 5LHHA 3H92A 3BPXA 3KETA 1S7OA 3E5UA 3MAJA 3COAC 5AIQA 1LEAA 2D1HA 2DAOA 1D8KA 3GZ6A 4RB2C 1F4KA 3J81K 2FE3A 2Z99A 4YG2F 3DF8A 5FB2A 1WRJA 3BDDA 2L4MA 3RPQA 3BPVA 5HLIA 5LEKA 4KICA 5E1WA 1U78A 2IW5A 2O8XA 4L9TA 1IXRC 3BWGA 3ZMZA 2OU2A 4Y17A 5AIPA 3VOEA 3CUOA 2W84A 2QUFA 3GFMA 5JFRA 1B1BA 4M9ZA 1I1GA 2HKXA 1J75A 4UUVA 4XLPF 3QPTA 1E17A 4KT5C 5BPDA 3FM5A 1CF7A 4KFCA 2FXAA 1ZYRF 2RVCA 4P9FA 5LGNA 4N9HA 4KNYA 3OV8A 4XRFA 2HR3A 4EM1A 1JXSA 3FM3A 1ZAOA 4OOIA 3IKTA 4I98B 3I59B 5J6XA 3L9FA 1BIAA 3EUHA 2IRFG 4WXDA 1XDSA 2QLZA 4G7ZF 3J7AO 1EH7A 4EGYA 2FF4A 2F2EA 2Z3YA 2IT0A 3BP8A 1G3SA 1FPQA 4KIFA 5LRRA 3SHFA 4F7ZA 4M73A 1QPMA 5D5UB 5DCMB 3NEUA 1PUEE 3F8NA 3ZMUA 4R8HA 4P55A 1KQ8A 2W25A 2E1NA 2PFBA 3KLNA 5D5XB 1UFMA 2ZO4A 2V1XA 3FHZA 2EFQA 1PP8F 1YS7A 1HKTA 2P6SA 4HF2A 3K0LA 4OIOF 4G9YA 2ACJA 1G6NA 3VB2A 2FU4A 4RGXA 2ZMEA 1FZPB 4MQ9F 1U8RA 2RGVA 1JE8A 2UXNA 3FWEA 4LMYA 4RS8A 4I09A 5DYMA 4CO8A 2ZMEB 2XV4S 4AIHA 3MCZA 1QGPA 3CTAA 2BBYA 2IVMA 4LK1F 1OYYA 1YW8A 4ENMA 5L3FA 2O03A 4Q48A 2CYYA 4I7HA 2L54A 4LB5A 2RKHA 2P5VA 3F72A 1SMYF 3ERED 5CVUA 4HAMA 5LGUA 1IF1A 4MTDA 3RJPA 2BE5F 1BOAA 1ZG5A 1IN5A 2H6BA 3BROA 2DFIA 2DQRA 1JHFA 2M87A 4UVAA 4OIRF 2MH9A 2P8TA 5L3BA 4M72A 4M6YA 3WTWC 2FBHA 1XMKA 1Y0UA 3L00A 3ZPLA 1K79A 4MHGA 3WTSC 4BHBA 1TW3A 4LLNA 2GWRA 1RI7A 1KYWA 3HRUA 2D2WA 5KK1A 1TQIA 1UCRA 1Z6TA 5FO5A 3E3VA 3R6SA 1A04A 3T5XA 3KP4A 2QQAA 3ELKA 4LK0F 2ADUA 2P5KA 3HRTA 3HRMA 2FBKA 5FD6A 2ISZA 3RPUA 4ON0A 2COMA 2VC1A 1J2XA 3T1BA 2JTVA 1T39A 1SD4A 3V8JA 4JBAA 2CSOA 3BY6A 1GXQA 2H27A 1W4MA 1NHAA 1G4DA 4KIGA 4BHCA 4E70A 4LG0A 1I6XA 2Z33A 3SZPA 3IRQA 2M30A 2CO5A 3GFLA 1ZGJA 3D0SA 4LG0B 2UWMA 1MJAA 3L7WA 5KVRA 2W24A 3TO7A 1BI3A 3QRFF 4AD9A 3ML6A 2HTJA 2HYGD 4LLLA 2XRNA 1ON1A 4HOBA 2UZKA 3IWZA 4GCVA 1V4RA 3L09A 2X0LA 1R5GA 3ZP5A 2YU3A 3JTGA 5HDGA 4L5JA 1Z91A 2XAJA 2YX7A 3HIFA 3IC7A 4RB3C 5ILVA 1OMIA 4P5OA 5DUIA 2H94A 4UNOA 4HX4A 3G73A 3M7GA 1ZH5A 4WF2A 5CVJA 1LVAA 2MLGA 1F9NA 4MTEA 2CWEA 1UB9A 4EJVA 2OZ6A 2PMUA 1T2KA 2VE8A 4YFXF 1O7FA 5ICEA 3TGNA 4CDGA 1RUNA 1EH8A 1ZLKA 1FT9A 4XBFA 4BAYA 4ESFA 1XSDA 1IN4A 4OU0A 4U7DA 1LQ1A 2O0YA 5A2QK 2GA2A 3BJAA 4Q4ZF 2C6YA 3KCCA 3RTRA 2EB7A 4A0ZA 2EA2A 3IL2A 4A12A 1T0FA 1PDNC 4WXCA 2IA0A 1MJBA 5TRDA 2DU9A 2H6CA 3R0AA 3KP6A 1LDKB 2LKPA 2O6GE 1SMTA 3ZN1A 1IN6A 3SXYA 3LA2A 1XGSA 2XIGA 2TDXA 1FBUA 3I54A 3IWFA 2B0LA 4EM0B 2HYFA 3EETA 1O7LA 5D4RA 4HA8A 1HQCA 3ULQB 4HLYA 3LAPA 4BXUA 2XAGA 3LWFA 1KA8A 3U1DA 2XKPA 4HBLA 4JK1X 3SQNA 1STZA 4ESBA 1SD6A 4OIPF 4HX8A 2D1VA 1ZRCA 1O3QA 1XB4A 1H9TA 1KGSA 3K9TA 3WGHA 3V4GA 2DPUA 2OA4A 2O61A 1W7PA 2PBIA 5JI6A 3QU6A 3BOQA 3BJOA 1EV7A 3PFIA 1CGPA 2BGCA 1OYWA 1XMAA 5ICFA 1U5TC 2A61A 3T8RA 4LD5A 3HTSB 4OINF 2EV6A 3WTVC 4NHJA 3KZYA 3FMQA 1BC7C 5CVRA 4FX0A 2ETHA 1G3YA 5IT9Z 3N97A 2HS5A 3IHUA 3JTHA 1W5SA 1FSEA 1O3SA 2NYXA 5DD4A 3ECOA 1K78A 3F6OA 4G7OF 4RAYA 1SFUA 5BQTA 4GO1A 2GA1A 4D0PA 2YSRA 4TV7A 3E6CC 2P4WA 2MD5A 4GGGA 1H0MA 3C3WA 1YIOA 5BOXA 1TLHB 2VOPA 2PN6A 2FA5A 4A6DA 2IJLA 4UV8A 2F5CA 3M8FA 1QQIA 3CUQC 1QBJA 2FQ3A 1OYIA 3DV8A 1ZLJA 2EV5A 4XLNF 3V7SA 1FLIA 3TDZC 5CVVA 1SFEA 1MDMA 1S8NA 2JT1A 2Q8KA 3S2WA 1Z9CA 5CLSA 4WXHA 1EH6A 1USSA 3E6BA 1DPRA 1Z7UA 2JSCA 4A6EA 2BV6A 4HF1A 1XSVA 2IA1A 2A3SA 1W5TA 2OAZA 4ENKA 1XN7A 2FMYA 1BIBA 2EFPA 1R1TA 3B73A 3K1MA 1FYKA 2QM3A 3HRSA 2CQKA 1K6OA 1MGTA 5DUKA 1LEBA 3DKWA 4PZJA 1C0WA 3RIRA 1E2XA 5K1YA 3OOPA 5CYVA 2P7VB 3HHHA 4MQVA 1Z6RA 2WWYA 1HSTA 3CO7C 4UXNA 1HW2A 5FFXA 4PCQA 1CF7B 1OR7A 2IP2A 3EQLF 5BMZA 2XAHA 1U6GA 2DT5A 3QP5A 2D45A 3CJNA 3B02A 2HTSA 2LDUA 3F23A 3PQJA 3Q5FA 1U5TA 3HOTA 1BBYA 4EJTA 3GYHX 2L3DA 4KA4A 5FLXK 1D5VA 1U5TB 2WV0A 2VE9A 2ZFWA 2OBPA 3KP3A 4RB0A 3RYRA 5LBQA 1KQ0A 5HDKA 2CG4A 1W7PD 2XKOA 4CYDA 2HZTA 4IPAA 1FC3A 5E1XA 4LB6B 5TJJA 4AIKA 1G3TA 2VT2A 3CO6C 3TOAA 3DPLC 3DQVC 3MFKA 4N9IA 3JAMZ 3TO6A 1ONVA 2CGPA 3CUQA 2DW4A 1LJ9A 4GYIA 1R23A 5FFZA 2PMHA 5DDGA 2A6HF 5JHUA 2PQ8A 3FMSA 1O57A 3CUQB 3LSTA 1MJ9A 2DO7A 3WE3A 3J80Z 2H09A 2PJPA 1IRFA 1YLFA 3GZ5A 1R7JA 3ZMSA 3MZYA 4BYYA 1USTA 2GAUA 2A6EF 4LFUA 5DD8A 4XSZF 5JR3A 1P6RA 2RQPA 5LGTA 5E20A 3W6KB 1P4XA 4UV9A 2M8EA 3TDUC 3LQRA 1KU3A 1I5ZA 4CICA 1BI0A 4O5VA 3GXOA 5L3EA 4S04A 3E97A 2OQGA 4RGSA 1B59A 2HFHA 1XCVA 3WU0A 6PAXA 4IRHA 4EMSA 1L0OC 1KU7A 5D6FA 3C1DA 2P5LC 4EVIA 1ZHFA 3V8KA 5LLQA 4YIIA 1R36A 3EYYA 1HW5A 2K7LA 3T0YA 1T38A 4BNCA 4AVPA 4U88A 5D5WB 2IPQX 4HQMA 3HHGA 1FWZA 4ZZDA 1J59A 1YFHA 3DPTA 4MGRA 2Q2EA 1F5TA 3TKYA 1S3JA 3QU3A 1B6AA 3L2CA 2BEOA 1TNSA 1FYLA 5E17F 2K4JA 2XROA 4I02A 2LF7A 1ZREA 1FP2A 5HS7A 1RIOH 3MWMA 4L0YB 5DCFA 2XUBA 5CJ9A 1D3YA 3W6JB 3HSEA 2HKOA 3RI4A 2EFNA 2Y48A 4KN4X 1YS6A 4KYWA 4RAZA 4UHTA 4LGWA 1AWCA 5E1ZB 5H6QA 3WU1B 1ODDA 1JGSA 1FOKA 4L0ZB 4ZYGA 5D6EA 4DNCA 5E18F 2NRAC 1GVJA 1WKMA 2EA4A 2G9WA 4R79A 4HV5A 4ZYDA 1ZARA 2E1CA 4RGRA 5FD5A 3I58A 1RZ4A 5ED4A 3GFIA 5HOOA 2DTRA 4A5NA 5EEGA 4ESJA 3ZQ7A 4WK8F 1D8JA 4O6JA 1WWXA 3F6VA 5J8FA 4S05A 4EJWA 1FSHA 2ZBKA 1DP7P 3LA3A 1HKSA 3JW4A 2WTEA 3F8BA 1HKQA 3R0JA 1J0RA 3ZMVA 2QENA 4B8XA 3K1PA 3PQKA 3FZVA 4MEYF 3V8LA 2RNJA 1G3WA 2Z5UA 4ENNA 1ZG3A 2YX4A 3KFWX 1TQPA 3RDIA 5D4SA 5LRSA 3H3ZA 2V1DA 2HOEA 4AWXB 2W85A 4CZZA 2FMLA 1IN8A 2LF8A 2V79A 4I2OA 1FY7A 1H9GA 5ILSA 3M1EA 4L18B 4L9VA 4OIQF 3GW2A 1TQMA 1YQAA 2GIVA 2IA2A 1J5YA 5AONA 2EFWA 3NQOA 3K69A 2A5YB 1MKMA 1B4AA 4YFNF 2QWWA 3GF2A 3WTYC 4IRGA 1U2WA 2OZUA 2STWA 4WCGA 4G8XA 2VODA 1QZYA 2QZ8A 4OMYA 2GZWA 3HYIA 3V7RA 3GX4X 2FOKA 3C18A 2PG4A 2LSOA 4PGHA 5ICGA 3AAFA 1IXSB 4U0WA 5LHGA 3ECHA 2JZYA 1W7PB 2ESHA 1Z1DA 1OPCA 3LAJA 2VBWA 1IN7A 4FT8A 4L9JA 1S29A 2KKOA 2Q0OA 2KIMA 1HW1A 1I1SA 1FBSA 1R5HA 1XGMA 4MNUA 3FMRA 2RN7A 1O3RA 3F8FA 3GLXA 4G6DA 2O3FA 1XDUA 1BJAA 1SAXA 5HS9A 1ZRDA 2R7FA 4LLGF 2R3SA 3T8TA 5EEHA 4Y13A 4O3MA 1J9IA 4U0YA 1K78B 2L02A 3ABTA 3REOA 4GXOA 4EJUA 1TW2A 5LEJA 2ZNYA 4QLCU 3LFKA 4HZFA 3O6BB 3WE2A 2UXXA 1XD7A 2VBYA 1BN5A 3KP7A 4A0YA 1VTNC 3JSOA 3I64A 1RNLA 3LQQA 2KIUA 1REPC 2QQBA 3GWZA 4KMUX 1DDNA 2RC4A 5L3GA 5K5OA 3JAMK 3I53A 1S6LA 1R1VA 3QAHA 1MDMB 1U3EM 2G7UA 3WGIA 3ROUA 2GXGA 1P92A 5ERIA 2PLYA 2MC3A 3ZMDA 2FEZA 1Q1HA 2BYVE 3J80K 4EGZA 4BH9A 5K5QA 2Z9OA 4FX4A 2HQRA 4RGUA 2XASA 5BS6A 2L01A 2M45A 2FSWA 1DPUA 3RYPA 2XAFA 1WI9A 4CHUA 2K4BA 4HV6A 4CGZA 2CW0F 3F3XA 3KEQA 3HSFA 1FYMA 2FNPA 2P7CB 3DXJF 2CFXA 1HXDA 3R60A 3KE2A 1J7KA 3GVAA 5HS8A 4I0AA 5IT3A 1LNWA 1P4AA 1BM9A 3P9KA 1S7AA 3F8MA 4OMZA 3E5XA 3U9GA 3MEXA 4HDVA 2ZCWA 4IHTA 4ZYEA 2R7DA 2XAQA 1QZZA 4EQQA 5HLHA 1HSJA 3I59A 2WC2A 3G3ZA 1KQ9A 3WTZA 1IRGA 4M9XA 2OQRA 5ILUA 2HDCA 5H20A 4A5MA 3FXRA 4U0VA 5HVQC 1OKRA 2VT3A 2RV8A 3O2PE 4ASNA 2DBBA 3WTUC 3R4KA 2ELHA 1YO5C 3HOSA 3BZ6A 3RKWA 4YIFA 4R1HA 5DCMA 2STTA 4MEXF 1YYVA 3O3KA 2YR2A 2EK5A 4HF0A 2W57A 4H0EA 4EM2A 2KJCA 3KEOA 2ZKZA 3DP7A 3RKYA 5DEQA 1IAWA 4IVNA 3GUDA 2A69F 1LDJA 1K7AA 1P4WA 3FF5A 3FXQA 4DQ2A 1O3TA 1QO0D 3GEZA 4PDKA 2ISYA 4G94A 2J5OA 1L3LA 3J81Z 4HYEA 1V3FA 2EWNA 3E5QA 2M5WA 1SD5A 4JQFA 3RKXA 3TOBA 1IUYA 5F6FA 4ETSA 5H6RA 2VONA 4M9SA 2NS0A 1KYZA 3KZZA 2DK8A 3M9AA 5D8LB 2ZJ2A 4BQAA 3P7NA 2E7WA 1B9MA 3GO5A 4IXAA 2VN2A 4BHPA 1BC8C 2HGCA 4XSXF 2GXBA 2EV0A 1SFXA 3GFJA 2FNAA 2EJRA 5BPIA 1GHCA 4PGGA 4M6XA 1YW7A 2AXLA 5DV5A 3I4PA 1Z05A 4N0BA 1XSXA 3KP5A 2VBXA 4K2EA 5LHIA 3BJ6A 1SD7A 2MH2A 1LB2A 2PEXA 4P96A 3EYIA 3SFZA 4ENJA 1RUOA 3F22A 5FLXZ 2NNYA 3DEUA 4IRIA 3HUGA 1KU2A 1ON2A 5JVTA 1QNTA 3CDHA 2QYOA 1ZGAA 3M8EA 3NRVA 2RDPA 3KLOA 1IXCA 4RB1A 3MZHA 3FXUA 4IF4A 1TBXA 3F21A 1F1ZA 2OD5A 1MZBA 1FBQA 2F5FA 2NNNA 4UVBA 1WSUA 4KN7X 1GXPA 4NB5A 2DQLA 4A2UA 4G6QA 5CVIA 2VBZA 4HLXA 3LA7A 4KIBA 4HW0A 4HX7A 3VODA 1UHMA 3ABUA 1XCBA 2F5EA 5F64A 4WWCA 2HWVA 4I0BA 3HTUA 1ULYA 2L4AA 2NAZA 3DFGA 2V9VA 3JSPA 1ZN2A 4I01A 3VEPA 1B9NA 3WTTC 1JHHA 1FNNA 1IZ1A 4HQEA 3E6DA 2YPRA 1PP7U 3QOPA 3VFZA 2MBFA 3QPHA 3F8CA 5IT9K 1X3UA 3H3UA 4B09A 2M1BA 3HSRA 3I71A 4CXFA 3P9IA 2VXZA 1ZG1A 3N4MA 4FHTA 5E8GA 1YTYA 2K02A 2VOOA 2QVOA
chains in the Genus database with same CATH superfamily
4CYCA 3FK6A 5E8IA 3I55I 1IDYA 1R58A 3VSKA 1XGOA 2M9HA 3BZKA 2GIZA 4KITB 3WTXC 1QHGA 4P9UA 1YX5A 1IW7F 2F5DA 2IAIA 5HLGA 4QWQA 4CYCB 2R5YA 2HEOA 1HBXG 4A3GJ 2ESNA 2K27A 3FX3A 2V6CA 5EJCA 2QBYA 3HOZJ 4D7NA 2J5PA 1LDDA 1XGNA 3CMEI 1R00A 2FX0A 1RKWA 2R5YB 1UHWA 2BW3A 2NVQJ 2MA3A 2NS8A 2BZTA 2QBYB 1OCOH 2JPCA 3K7AJ 4HPQA 2EIMH 2W00A 2E7XA 2LMDA 3QQAA 1F43A 3MKLA 1TNTA 2DJNA 2OJED 3WG9A 2A07F 2BW3B 3HXLA 1NH3A 1UELB 5FRMA 5J8CA 3P9CA 2EZIA 3R61A 3I56I 2OTJI 4L9NA 4C3HJ 4IOCF 1JUPA 2L7MP 4ZH4F 3Q9VA 1I50J 3H5NA 2DI3A 5L3DA 3TO9A 1IO2A 3ZMTA 1FP1D 3WODF 3SYTA 5L3CA 2FRHA 1BL0A 4KUMA 3DBRB 2O8KA 2XPVA 4BL0B 5IP9J 4RBOA 2AS5F 3BG6A 3CCEI 4AIJA 1S7EA 4ZZLA 2HQNA 5HDNA 2XHKA 5K5RA 4UVCA 2XGXA 4LJZF 2DLLA 4IJAA 1TTYA 3Q0WA 3IRRA 1D8JA 5EGOA 2KIFA 5ICCA 2V1UA 3OR2C 1Z77A 3H5AA 4IHSA 4YFKF 2HOAA 1VQ9I 2QQ9A 3DEEA 3WGGA 2B63J 2JRTA 1HF0A 4Q5SF 4NQWA 4PFPA 3DKYA 2M0CA 1RKTA 3PSIA 3WG7H 1H8AC 2L9NA 4M3EA 4EV0A 1MD0A 3CLOA 2DK5A 3K1NA 2XVCA 3QP6A 4BJ5C 3ISPA 2K86A 5D8KB 5K7HA 1SAUA 4FETA 4NQWB 4M71A 4U7BA 3EDPA 3KP2A 3K2ZA 2XSDC 1Z67A 4HDUA 2JA5J 3H36A 5FGMA 2ZJRF 5E3NA 5F1RA 1YG2A 2Z16A 5B1BH 2G7HA 3PIPF 3E0JB 1AKHB 4RAGA 1GV5A 3U2RA 3Q3SA 3RPUD 2XGEA 3C7JA 3M8JA 3ZRGA 1BI1A 2LFBA 3SZTA 2CQXA 2WA0A 1UMQA 2Y0MA 1YI2I 2DT6A 3ZN0A 4KMFA 4GYGA 3IKVA 2R7UA 3EUHC 4DGWB 2W82A 3I0TA 4PSXA 3HKZN 3SJMA 4DOZA 4G7HF 1JGGA 3HBLA 1WI3A 1I27A 4MIMA 4A0XA 3MQ0A 5C44J 3RZOJ 3V7CA 2P6TA 3F9KA 1YW9A 1T98A 4L5IA 3CCLI 1IJWC 1HCRA 4MFEA 2KRFA 2Y75A 2XDVA 2IGNA 2JVGA 2ZXJA 2EFOA 4Z2YA 4IL6C 2K5CA 1T6SA 2QA4I 3K4BA 2Y9ZA 1VQOI 5F08A 2YUSA 1YIJI 1VQ4I 1ZRFA 2DA4A 2DOEA 3E6MA 4IO9F 2PI0A 3D5LA 1AOYA 2A68F 3Q0UA 2DPDA 2EZHA 2GQQA 4Q47A 5A2QZ 1R22A 2KISA 3Q9SA 4Y3OA 2ZNZA 1FX7A 2COBA 2MLKA 4BXFA 1WJ5A 4XKBA 1ACIA 1KU9A 1SVOA 2FBIA 2EBIA 2X4HA 1QRYA 4Y15A 2R7QA 1MH3A 4F55A 5D5VB 5CQEA 1BA5A 2JPBA 3VWBA 1R1UA 2G0EA 3ZQIA 2KJBA 3KIOA 3OYAA 2L9SA 4UUSB 2DYSH 3BG7A 4DYCA 4WX9A 4N4OB 3ZCOA 1FOXA 1BI2A 1QPIA 1WQ2A 4E4HA 1R4NB 4KDPA 1P2FA 4EJOA 1X4PA 1DUXC 3I5UA 4ZYHA 1QA6A 1Z21A 3ZOBA 3TQNA 2LNBA 4CSWA 2CH0A 3QYEA 1B8IA 4FE4A 3I9V2 2VC0A 4M74A 1TT5B 4BY1J 2OC6A 3LSGA 3HZJA 2HVQA 5LHHA 2KDZA 3H92A 3BPXA 3KETA 4BACA 1S7OA 2HQAA 1B8IB 4HNVA 3E5UA 3MAJA 3DU6A 2DDBA 3LL7A 4BBSJ 3QYBA 2BOLA 4I99C 1MMAA 3COAC 5AIQA 3Q0VA 4IHYA 1LEAA 2D1HA 2EPFA 5F04A 1MSFC 2DAOA 1D8KA 3GZ6A 4RB2C 3BG3A 1F4KA 3J81K 1NG7A 2FE3A 2Z99A 4YG2F 4D9JA 3A0BC 3DF8A 5H2FC 1WRJA 3BDDA 5FB2A 3C2GA 2R7OA 5J4YA 2WB1N 4UB6C 3DLLF 2P0WA 1OFCX 2L4MA 3RPQA 3K4CA 3DKXA 3BPVA 3VYUB 5DM6F 2MD0A 5HLIA 5LEKA 1X3ZB 2X1CA 3BTIA 3CJRB 2QF7A 2TCTA 4KICA 5E1WA 1U78A 2IW5A 1Q1VA 2O8XA 4L9TA 2LYCA 1IXRC 4A3JJ 4OAYA 3BWGA 3ZMZA 2OU2A 5IOYA 4Y17A 5AIPA 3VOEA 1FIPA 3CUOA 2W84A 2QUFA 3GFMA 4DIQA 1VFCA 4XK4A 5JFRA 4BUPA 1UJ8A 3S3OA 1IC8A 1PJRA 1B1BA 3HOVJ 2OUMA 4M9ZA 1I1GA 3MN2A 2HKXA 3LSHA 1J75A 2LY1A 4UUVA 3QPTA 4XLPF 2LR8A 1E17A 4KT5C 2E2JJ 3RKQA 5BPDA 2CV0A 3FM5A 5JLWA 1CF7A 4KFCA 1XG1A 2FXAA 1ZYRF 2RVCA 3H1CA 2XPWA 2LLKA 5TGTA 4P9FA 2HOSA 5LGNA 4CA0A 4N9HA 1WFXA 2OPTA 1Y1WJ 4KNYA 1XS9A 1EA3A 2X48A 3OV8A 5M3MJ 4XRFA 2HR3A 2EH3A 1TP4A 3QODA 3LSRA 4EM1A 1YHQI 1JXSA 3FM3A 1ZAOA 2KZVA 4OOIA 1FJLA 3OWTA 3IKTA 4I98B 3GTKJ 2JN6A 3I59B 5J6XA 3G2BA 3L9FA 2Y2ZA 1BIAA 3L2WA 3EUHA 3W3CA 5J1RA 2IRFG 4WXDA 1XDSA 4B4CA 4GFBA 2BY1A 2DFEA 3TW6A 2QLZA 4FTHA 4G7ZF 2R7SA 3J7AO 1EH7A 4EGYA 2FF4A 2F2EA 2Y30A 2Z3YA 4A3IJ 1X1CA 4MFDA 3H3VK 2IT0A 2JWTA 5FKNA 3G4SI 3S93A 3BP8A 1JUMA 1G3SA 4PJ0C 1FPQA 5FKLA 1QVUA 4KIFA 1I3AA 5LRRA 3SHFA 4F7ZA 4M73A 4KJZA 1QPMA 5D5UB 5DCMB 3NEUA 4AYBN 1PUEE 2ICWG 4ZYAA 1FEXA 3F8NA 3ZMUA 4R8HA 1Y8RB 4P55A 3FDYA 3HB9A 1KQ8A 2W25A 2E1NA 2QQ8A 2PFBA 3KLNA 5D5XB 2ZO4A 1UFMA 2K9SA 2V1XA 3FHZA 2DTZA 1BJZA 1S72I 2VXDA 2EFQA 1PP8F 3H9QA 1YS7A 5FJ8J 2DCEA 4U87A 4ZDOA 3VDXA 1HKTA 2P6SA 3IH4A 3H0GJ 2LP0A 3CQZJ 3K0LA 4M6VA 4HF2A 4OIOF 2JQ7A 4G9YA 2ACJA 1G6NA 1XTAA 2FU4A 3VB2A 1D0YA 4RGXA 3A1YA 2ZMEA 3SZGA 2NVTJ 2JUCA 3KPHA 4CCLA 1FZPB 1K83J 4BJ6C 4MQ9F 1U8RA 2RGVA 1JE8A 2UXNA 3FISA 4AUXA 3FWEA 4Y52J 4LMYA 3ZQGA 3GTMJ 1O4XA 4RS8A 3OSFA 1E3PA 3S14J 1VNDA 4I09A 5DYMA 4CO8A 1N75A 2AQFA 2ZMEB 3CCRI 3NWSA 2XV4S 1VQNI 4XRMA 3MZ8A 4AIHA 1H89C 5GTIC 3MCZA 3CTAA 1QGPA 1LVKA 2BBYA 3ABKH 5IYCJ 3KYCB 2IVMA 4LK1F 1OYYA 1YW8A 4ENMA 2PMZA 2KQRA 3K6GA 1JKQC 5L3FA 2KFDA 1IDZA 2XPUA 2O03A 4Q48A 2CYYA 4I7HA 3ZR8X 2L54A 4JX4A 4LB5A 3S1QJ 4GDFA 2RKHA 1R49A 2K9MA 3GTJJ 4IHXA 3S17J 2P5VA 4CUGA 3BR6A 3CLQA 3F72A 4BKXA 1G2HA 2MSYA 1SMYF 5CVUA 4PJNA 4ZC3A 3ERED 4HAMA 5LGUA 1IF1A 4MTDA 3GCMA 5EF6A 3RJPA 3OL3A 2BE5F 4DBQA 2HDDA 1K6YA 1BOAA 1FOYA 1ZG5A 3HPGA 1IN5A 2H6BA 3BROA 2DFIA 4XL9A 2DQRA 3BR2A 3VYSB 1JHFA 3ASNH 2M87A 3BTLA 4UVAA 1W0TA 1JTXA 1YOVB 4OIRF 2MH9A 2P8TA 5L3BA 4M72A 4M6YA 1DGRM 3WTWC 2FBHA 1XMKA 3LFUA 1Y0UA 1UHSA 3L00A 4W97A 3GBGA 4JP0A 3ZPLA 1K79A 2CU7A 2CUEA 2FD5A 1T0FC 4MHGA 3WTSC 4BHBA 1OCCH 1I39A 1TW3A 2JA7J 4N4NB 4LLNA 2GWRA 3CCUI 1RI7A 5GPCA 4XIDA 1KYWA 3HRUA 2F4MB 2D2WA 5KK1A 1TQIA 1UCRA 1Z6TA 5FO5A 1R4MB 2H1LA 4G12A 2CW8A 2NS7A 1NTCA 4LOCA 3E3VA 1IV8A 3R6SA 2VPLA 1FIAA 1A04A 1LPQA 1GLNA 2VQLA 3T5XA 3GTPJ 2XRLA 3KP4A 2QQAA 3ELKA 4LK0F 2ADUA 2P5KA 3HRTA 4HNTA 4DYRA 4IOAF 3HRMA 2FBKA 5FD6A 3A03A 1WGXA 4PJLA 2WADA 3RPUA 2ISZA 4ON0A 2COMA 4PJJA 5IY5H 2VC1A 3BCAA 4Y4RA 1J2XA 2VIXA 3T1BA 1E3HA 4XOTA 1ERDA 2DFFA 3OYKA 2JTVA 4BQNA 1T39A 3HOUJ 5LD2C 4V2GA 1SD4A 3SDBA 3V8JA 1A5JA 1FTTA 4QPQA 3O8HA 4JBAA 2CSOA 3BY6A 1GXQA 2H27A 1W4MA 1NHAA 1G4DA 4KIGA 4BHCA 3NARA 4E70A 4LG0A 1I6XA 3OYLA 3CF5F 2Z33A 3SZPA 3IRQA 3OS1A 1X19A 1HA8A 2M30A 4AU7A 2A5WA 2CO5A 3GFLA 1ZGJA 2VJ4A 2L0KA 3D0SA 4LG0B 2UWMA 1T08B 5HLTA 1MJAA 3L7WA 2VJIA 5KVRA 2W24A 3TO7A 4X0GA 1BI3A 3QRFF 4AD9A 4RA2A 4YRVA 5C3EJ 3ML6A 3CCQI 2HTJA 2HYGD 3CCYA 4LLLA 2XRNA 1ON1A 1OQYA 4QTRA 4HOBA 2UZKA 3IWZA 4GCVA 2XSJC 1YJNI 1JT0A 1V4RA 3L09A 3A2KA 1LUJB 4NC8A 2Z2SB 2X0LA 1R5GA 3ZP5A 2YU3A 3PFYA 1YRNA 3LOCA 3IAM2 2BVMA 3JTGA 2MYSA 5HDGA 4L5JA 1Z91A 2XAJA 2YX7A 3HIFA 1OLTA 3K4JA 2OF7A 3HOYJ 3IC7A 1YRNB 4RB3C 2X6XA 3ONQA 2BY0A 1OMIA 4NBQA 5ILVA 1R71A 3S1MJ 5K7FA 4P5OA 5DUIA 3AG2H 2H94A 4NC6A 1WH5A 4UNOA 4HX4A 4B43A 3G73A 1P7JA 2DYRH 3M7GA 4D5FA 1VQ5I 1ZH5A 4WF2A 4A69C 4GRIA 2VLAA 1Z7LA 3W2AA 5CVJA 1LVAA 2MLGA 1F9NA 3AG1H 2VKHA 4MTEA 2CWEA 2NVUB 4C9YA 1YE9A 3JREA 1UB9A 4EJVA 1SFOJ 1W36D 2OZ6A 2PMUA 1T2KA 2IS2A 3VSLA 2VE8A 4YFXF 3CC7I 1O7FA 5ICEA 3TGNA 4CDGA 1RUNA 4B47A 1G8XA 5GP9A 2CUZA 2FQ4A 2X6WA 2KDOA 2E2IJ 1VQ8I 3IV5A 1EH8A 2JSPA 1FT9A 1ZLKA 4C2MJ 1JUSA 1GV2A 4XBFA 1Y39A 4BAYA 2ELJA 4ESFA 1IN4A 4OU0A 4U7DA 1XSDA 1LQ1A 2O0YA 3OYGA 5F1JA 2GM4A 1MBFA 4DW6A 3PO3J 3CC2I 2JUGA 4XM3A 4E7ZA 4X1EA 5A2QK 2GA2A 4FQGA 3OMYA 1OJLA 3BJAA 4Q4ZF 3JRHA 1AHDP 1NK2P 4E7KA 3CZ6A 2C6YA 4Z6YA 2DA7A 3KCCA 3FXOA 3RTRA 3H35A 2EB7A 1U0JA 4A0ZA 3ZQQA 2QEXI 1VF9A 2EA2A 2CUJA 2CV2A 2L7KA 3IL2A 4A12A 1T0FA 1PDNC 2Z1DA 4WXCA 2IA0A 1MJBA 2NOGA 3MKWB 2M0MA 5TRDA 2DU9A 2LY2A 3SEZA 1LE8A 3FIWA 2H6CA 2XB5A 2F48A 3R0AA 2ZJQF 3KP6A 1LDKB 2LKPA 4MO7A 2O6GE 3JR9A 4I6ZA 1SMTA 3ZN1A 1IN6A 3SXYA 1LE8B 5JVGF 3LA2A 1XGSA 3H9GA 2XIGA 2TDXA 4PUSA 2R7RA 1FBUA 3DTIA 3LMMA 3CJTB 4F92B 2Y0SN 3I54A 3IWFA 2B0LA 4EM0B 2HYFA 4BXXJ 2RREA 2ID3A 3EETA 1Y1VJ 3PNTA 2M4KA 1W1WE 3BLYA 3LSIA 1O7LA 2QGUA 4E7SA 5D4RA 4HA8A 1HQCA 2JA8J 3ULQB 3G1OA 2GOMA 4HLYA 3LAPA 4BXUA 2OV7A 2BXYA 2XAGA 5EGOB 2VKDA 4B44A 1BR1A 2VUMJ 4KT6A 3LWFA 4NUBA 1KA8A 1QU3A 3U1DA 2XKPA 1LKXA 4DZJA 4IHVA 3H0DA 4HBLA 4JK1X 1K4TA 4RMNA 3SQNA 1STZA 1UAAA 4ESBA 1SD6A 4OIPF 4HX8A 2H1KA 2HQ5A 2D1VA 3TP3A 1ZRCA 2X1EA 2IGMA 1O3QA 1XB4A 3MMYB 1H9TA 5KAIC 3A01A 3DTEA 1KGSA 3K9TA 4AM3A 2H8RA 4FISA 2NVXJ 2QKMB 3WGHA 3V4GA 5EDNA 2DPUA 2OA4A 1OR7C 1NG6A 3UR3C 2O61A 2KL4A 1W7PA 2PBIA 5JI6A 3M07A 1BW6A 3QU6A 3BOQA 3BJOA 3W2VA 1EV7A 3ZQHA 3PFIA 1CGPA 4CCNA 2BGCA 1OYWA 3RQIA 1K4SA 3CESA 1XMAA 5ICFA 4IZZA 1U5TC 2DA5A 2A61A 3N05A 3CCJI 1T56A 3T8RA 2I10A 2HI3A 3B6AA 4LD5A 3HTSB 4OINF 4BDZA 2VB6A 2EV6A 3WTVC 4NHJA 3WHCA 5JLXA 3KZYA 3FMQA 3DBLB 1BC7C 5CVRA 4FX0A 2ETHA 3ABMH 5GTHC 1G3YA 5IT9Z 3N97A 1GT0C 4C2UA 2EILH 2HS5A 2VQHA 4OWRB 3IHUA 3MKYB 3JTHA 1W5SA 1FSEA 1O3SA 2IS6A 1VI0A 2NYXA 2W7NA 5DD4A 3ECOA 3KZIC 1K78A 3F6OA 1OCZH 4G7OF 3OYNA 4XLEA 4M3FA 4RAYA 5FROA 1SFUA 1TWFJ 5EEAA 5IYBJ 4XQFA 4DYQA 2NOJB 5BQTA 3ESWB 2VJJA 4GO1A 2GA1A 2LG4A 4D0PA 2YSRA 4TV7A 2EZLA 3E6CC 1W36C 2P4WA 2MD5A 4GGGA 3CD6I 1H0MA 3C3WA 1YIOA 4RLFA 4XICA 3CMAI 3EUKL 5BOXA 1TLHB 2VOPA 2PN6A 3BZCA 2FA5A 1N77A 4A6DA 2R7VA 1TWGJ 2IJLA 3OYCA 1PYVA 4UV8A 2F5CA 3PJRA 3M8FA 2FOWA 1M1EB 1QQIA 1MMSA 3FBIB 3CUQC 5DM7F 5TISC 3QYFA 3E1SA 1QBJA 2GXAA 2ZMEC 4BJTA 1J09A 2FQ3A 1OYIA 2IGKA 5FLMJ 1V54H 3DV8A 1ZLJA 1B72A 2EV5A 2IXSA 4XLNF 3V7SA 2P81A 1LFUP 1FLIA 3TDZC 5CVVA 1R9TJ 3BG9A 3HM5A 1MMDA 1B72B 2PMZN 1SFEA 1MDMA 1S8NA 2JT1A 2Q8KA 3S2WA 1Z9CA 3S16J 1D1AA 5CLSA 3S1RJ 2DA6A 3K10A 2LREA 1RR8C 1RRJA 5GPAA 4WXHA 4C30A 4I76A 1EH6A 1USSA 3E6BA 3OS0A 1DPRA 1Z7UA 2JSCA 2HPIA 3L2RA 4A6EA 2EINH 1RC9A 1ZR4A 2JRMA 2BV6A 4HF1A 1XSVA 2IA1A 3DTKA 1I3QJ 2A3SA 5KNLA 2OTLI 3GTLJ 4F91B 1W5TA 2ZSIB 2OAZA 4ENKA 1XN7A 2FMYA 1A31A 1BIBA 2EFPA 1R1TA 3B73A 3K4LA 3K1MA 4H4KC 3OYEA 1FYKA 3S2HJ 2E1OA 2QM3A 3HRSA 4ITVA 2CQKA 1K6OA 1MGTA 5DUKA 1LEBA 1BR4A 1YITI 3BCBA 3L2UA 1FOWA 3DKWA 3HDDA 1OCPA 4PZJA 5J4VA 1C0WA 3RIRA 2R7TA 2AHQA 1E2XA 1G59A 3BQYA 5K1YA 3OOPA 5CYVA 2AO9A 2P7VB 3HHHA 4MQVA 1Z6RA 3TL4X 4XKCA 3PO2J 3CC4I 2WWYA 1HSTA 2WV1A 3TW7A 3CO7C 3OYDA 4UXNA 5J1UA 1HW2A 4XOPA 5FFXA 1WJBA 5J3LA 4PCQA 1CF7B 1OR7A 2IP2A 4P1WA 4XN3A 3FKIJ 1X1PA 4CCKA 2F5VA 1S9HA 3EQLF 5BMZA 2FUG2 2XAHA 3ZGKA 3IP4B 1U6GA 4XRSA 2DT5A 1K61A 3S15J 1JKRC 3QP5A 2D45A 2R0QC 1DU6A 1AU7A 1DQUA 3CJNA 1MNDA 2HTSA 2LDUA 2X6YA 3B02A 2HPMA 3F23A 3PQJA 1EJ9A 4BDYA 3Q5FA 1U5TA 5F0CA 2KLOA 3HOTA 1BBYA 3CCSI 4EJTA 2Q1ZB 3GYHX 2MG4A 2L3DA 1W5CC 4KA4A 5FLXK 1V5EA 2KRCA 1D5VA 2M34A 3I3LA 1U5TB 1CQTA 3IH3A 2WV0A 2JK3A 2VE9A 1Z3YA 1WPKA 2OBPA 2XB0X 2ZFWA 3KP3A 4AIDA 3DWLE 3OS2A 4RB0A 2DODA 3ZQFA 5IP6A 3RYRA 5LBQA 2VL8A 1KQ0A 5HDKA 2L5QA 3HOWJ 2CG4A 1W7PD 2W1OA 2XKOA 4RDUA 1ZTRA 4CYDA 4E6KG 2HZTA 4IPAA 3C2BA 3V42A 1FC3A 1X1DA 2VJ5A 3W2WA 5K7ZA 2ME0A 5E1XA 4LB6B 5TJJA 4E7IA 4AIKA 1EF4A 1G3TA 4HG2A 1TWAJ 1RPWA 2VT2A 3D5RC 2E1MC 2H8WA 2KMUA 5E79C 3BG5A 5E3MA 3L1PA 3CO6C 3TBIA 3TOAA 2R7XA 2GOXB 1OCTC 1Y8QB 4QIWN 2O7OA 3DPLC 3GZNB 3DQVC 3LSPA 1Z3XA 3MFKA 1KZHA 4N9IA 3JAMZ 2CRGA 5E3OA 3TO6A 1ONVA 2CGPA 3CUQA 2DW4A 1LJ9A 3FXKA 4GYIA 2BY2A 1R23A 1ETOA 5FFZA 2PMHA 3HC7A 3HG9A 5DDGA 2A6HF 2Y9YA 5JHUA 2K40A 1DGWY 2PQ8A 1O57A 3FMSA 5C4JJ 1PVEA 1HDDC 2LTPA 3CUQB 3LSTA 1MJ9A 2Y31A 3LSKA 2JMWA 2DO7A 3WE3A 3J80Z 2H09A 5C4XJ 3S3MA 2PJPA 3VPRA 1IRFA 1YLFA 2K3FA 2R4GA 2RQQA 3GZ5A 1N78A 4IEJA 2X1DA 3CJQB 4V19K 1R7JA 3ZMSA 3MZYA 4BYYA 1Y6IA 1USTA 5F0FA 4XNFA 2BHYA 3TP0A 2HZDA 2GAUA 2A6EF 4XONA 1MBEA 2XF6A 4LFUA 5DD8A 4F93B 2TRTA 4XSZF 4ZJZA 2MABA 5JR3A 1P6RA 2RQPA 3BR1A 3GMEA 3S2DJ 5LGTA 5EZHA 2FJ1A 1TC3C 1ZQ3P 5E20A 2E60A 1D5YA 2L7FP 4CCOA 3W6KB 1P4XA 3JRBA 3AG4H 5JHFA 4UV9A 2M8EA 2BY3A 4PJMA 3TDUC 3LQRA 1KU3A 2BXZA 1I5ZA 3BTCA 3EUAA 3ERMA 4IHWA 2E2HJ 2QKLB 4CICA 1BI0A 4A3MJ 2EIJH 4O5VA 3GXOA 2DMPA 2WB1A 1MIJA 3BC8A 2RNGA 3PM1A 3E97A 2OQGA 5L3EA 4S04A 4RGSA 1B59A 3G71I 2HFHA 1U9OA 1XCVA 3WU0A 3S32A 6PAXA 4IRHA 5E3LA 3VYTB 3ABLH 4EMSA 1L0OC 1KU7A 2OCCH 5D6FA 2DFHA 5DS9A 2R93J 3C1DA 2P5LC 4B3XA 3O8GA 2MGQA 3I4NJ 2XGCA 5B66C 4EVIA 5B5EC 1ZHFA 3V8KA 3PNYA 5LLQA 4BEHA 4YIIA 1QVTA 1YJWI 1R36A 2NVYJ 2VQGA 1VQPI 3EYYA 1HW5A 2K7LA 2CW7A 3T0YA 1T38A 3AG3H 4MLOA 4BNCA 3G6EI 4AVPA 2CUFA 4U88A 2DMTA 5D5WB 1POGA 2IPQX 3GTOJ 5F0HA 2LVSA 4HQMA 3QPLA 4JX5A 3HHGA 1SVLA 3OOUA 1X4OA 2Y69H 3CP8A 1FWZA 4ZZDA 3UKGA 1J59A 4IKFA 5BNGA 1MMNA 3BT9A 1IRXA 1YFHA 2WAQA 3DPTA 1WJAA 3HOXJ 4MGRA 2Q2EA 2V9KA 1F5TA 3TKYA 1S3JA 3QU3A 1B6AA 3L2CA 2E34A 4YELA 1HDPA 2BEOA 4A3LJ 1MSEC 1TNSA 2M2EA 2K3PA 1FYLA 3K70D 2Q2EB 2KZGA 2LC2A 5E17F 4II3A 2K4JA 2V9PA 2XROA 4I02A 2LF7A 4XLFA 4FE7A 1ZREA 1FP2A 4DZPA 5HS7A 1RIOH 2X6OA 1KONA 1VZ0A 1SEUA 3MWMA 3OYJA 5DCFA 4L0YB 2XUBA 5CJ9A 1D3YA 3W6JB 3HSEA 1D0XA 1P7IA 2X9DA 2HXIA 3OL4A 3AFHA 1ETKA 1RESA 2HKOA 3RI4A 5IPAA 2EFNA 2Y48A 4NNJA 4KN4X 1YS6A 2F6CA 4KYWA 2V4JC 3AKZA 1MMGA 3ZQCA 5DTDA 4A3BJ 3M1CA 1T33A 4RAZA 3FXJA 4LGWA 4UHTA 2E1MB 2CMPA 1AWCA 5E1ZB 1S5LC 5H6QA 2V7FA 3CF2A 3WU1B 4F3QA 4XKWA 1ODDA 1JGSA 1T95A 1FOKA 4L0ZB 4KISA 1RR7A 4ZYGA 1VQLI 2DOFA 5D6EA 4DNCA 5FKOA 5E18F 2NRAC 1GVJA 4X6AJ 1WKMA 2EA4A 1VQKI 4DJAA 2G9WA 4R79A 4HV5A 4ZYDA 4F52A 2LD5A 1ZARA 1Y56A 1MBKA 2E1CA 3CMYA 4RGRA 2KIQA 5FD5A 3I58A 1RZ4A 2AXTC 5ED4A 3PSFA 5HOOA 3GFIA 2DTRA 4W1UA 4A5NA 4DBRA 5EEGA 4B1RA 4ESJA 3ZQ7A 4IQ4A 4WK8F 4QSHA 4O6JA 3SDGA 1WWXA 3F6VA 5J8FA 4S05A 2QSGX 3FKJA 3JRFA 1UG0A 4EJWA 1FSHA 2ZBKA 1V55H 3CDLA 1DP7P 3LA3A 3LSJA 5CPRB 4LIVA 1HKSA 3JW4A 2WTEA 3RZDJ 1WVRA 3A4CA 1V5GA 3F8BA 1HKQA 2V1NA 3R0JA 1J0RA 2LBFA 3ZMVA 3JRDA 4M3GA 1UG2A 2QENA 3J7ZI 4BY7J 3OSGA 1Y0NA 2E5NA 2HU9A 4B8XA 3K1PA 3PQKA 3OYMA 3C2HA 3FZVA 4MEYF 3V8LA 3CCVI 2RNJA 3WU2C 1G3WA 2LBFB 1IUFA 2VI6A 2Z5UA 2ME6A 1ZG3A 4ENNA 2YS9A 2YX4A 4Y7NJ 3KFWX 1TQPA 1X58A 3RDIA 3L2VA 4D5CA 5D4SA 1U9NA 5LRSA 3H3ZA 3H9JA 5HODA 2V1DA 2HOEA 4AWXB 2W85A 4CZZA 2FMLA 1IN8A 2LF8A 1ZR2A 2V79A 4I2OA 1FY7A 4HRIA 2ZFUA 3RQ4A 3KYLA 1VQ7I 1H9GA 2DXIA 2DA3A 5ILSA 2N8GA 3M1EA 4L18B 2M7AA 1FMVA 4L9VA 4Y33A 4OIQF 4UUTA 3GW2A 1HC8A 1A6IA 2DA2A 2EQRA 1TQMA 1YQAA 2GIVA 3GTGJ 1I6HJ 1GVDA 3HEFA 2IA2A 5J47A 1J5YA 2XAUA 5AONA 2EFWA 2YU9J 5LFAA 3NQOA 3S3NA 3K69A 2DMUA 2A5YB 1MKMA 2M7BA 5KAFC 1TZLA 1LFBA 1TWCJ 5B1AH 5IOZA 3J7YJ 1B4AA 4YFNF 2QWWA 3GF2A 3WTYC 2EIKH 5FRNA 4NDLA 4AVZA 4IRGA 1WZ2A 5IP7J 1U2WA 2OZUA 2DA1A 2STWA 4WCGA 4G8XA 1E3OC 4ANJA 4C3IJ 2PJRA 2VODA 3OIOA 2I5UA 1QZYA 4UB8C 1BW5A 3BR3A 3HJEA 2KRHA 2W4SA 1WJEA 2QZ8A 3K70C 4OMYA 2PJRB 1JT6A 2GZWA 1X2MA 3HYIA 2KPMA 3V7RA 3GX4X 2FOKA 2ECBA 3C18A 2PG4A 3A01B 4BE0A 2LSOA 4PGHA 5ICGA 1X1AA 3AAFA 4XMYA 1IXSB 4U0WA 5LHGA 1AKHA 3ECHA 2WAEA 4OAZA 2JZYA 1W7PB 2ZXWH 2ESHA 4ABZA 1Z1DA 2D5VA 1OPCA 2DT7B 4XORA 4BE1A 3VYRB 3LAJA 1MH4A 2OCEA 3K2AA 2VBWA 3MKZA 2X51A 3KEYA 1IN7A 2ZXHA 4FT8A 4L9JA 3ASOH 1S29A 2A05A 2O5RA 2KKOA 2Q0OA 4ZTFA 2VPRA 2KIMA 1HW1A 2WY7Q 5F27A 1I1SA 3OYIA 2NXNB 1FBSA 1R5HA 1XGMA 3LNQA 4XLHA 4MNUA 1ENHA 3FMRA 4ZDLA 1WCMJ 3EPZA 3ZQLA 4ZDPA 2W48A 4ZTJA 2RN7A 3W6VA 1O3RA 3FHNA 3F8FA 3GLXA 4CCJA 3IH2A 4G6DA 1JTYA 2MW8A 2B9SA 2O3FA 1XDUA 1BJAA 1SAXA 5HS9A 1MBGA 2IS4A 2KT0A 1SC7A 1ZRDA 2R7FA 2JVHA 3PNVA 2R3SA 4LLGF 3T8TA 5EEHA 3NAUA 4V2FA 4Y13A 3OYFA 4O3MA 3UNGC 5GAGJ 2RAEA 3CP2A 3TMOA 4U0YA 1K78B 1J9IA 2XGDA 4CZCA 4PK4A 2L02A 3ABTA 2A6TA 1XPXA 3REOA 4GXOA 2QCOA 4EJUA 5M5YJ 1TW2A 3S1NJ 1X1BA 5LEJA 2ZNYA 4QLCU 3FXLA 3LFKA 4HZFA 2VASA 3H5RA 1ETQA 3O6BB 3WE2A 2K9QA 2UXXA 4UUSA 4LITA 1XD7A 2VBYA 4IX7A 1BN5A 3KP7A 4A0YA 1WJDA 3HPHA 1SANA 1WJCA 2L7ZA 4HEA2 3JRIA 2BVLA 2B7EA 2CS3A 2DJIA 2VQCA 2R7WA 2E19A 1VTNC 4B3AA 3JSOA 3I64A 1RNLA 3X2QH 3LQQA 4RAFA 2KIUA 1ITYA 1REPC 5GADJ 2QQBA 3GWZA 4KMUX 1DDNA 1IGNA 2RC4A 1WH7A 5L3GA 5K5OA 2HDWA 3JAMK 3I53A 4IQJA 1S6LA 1R1VA 1OCRH 3QAHA 2M8GX 1MDMB 1A35A 5M5WJ 1XC5A 1U3EM 2G7UA 3WGIA 3ROUA 2HXOA 2GXGA 1P92A 1BR2A 5KCMA 3I4MJ 5ERIA 2CV1A 2PLYA 3DEWA 2K9NA 2MC3A 3ZMDA 2AQEA 2FEZA 3FK7A 2DDAA 1ZKGA 1Q1HA 2BYVE 2KHMA 3J80K 5KHDA 1MNEA 4BH9A 4EGZA 5K5QA 2XF5A 2Z9OA 4FX4A 2HQRA 4RGUA 2DOAA 2IBDA 2GBYA 2XASA 5BS6A 2CFOA 3G1MA 2L01A 3RCOA 1AA7A 5EZGA 2M45A 2FSWA 1DPUA 3RYPA 2XAFA 2WY8Q 3OIPA 1E0EA 1WI9A 4CHUA 2K4BA 2E71A 1SFKA 4RLQA 4HV6A 1A6QA 3JCUC 2L2OA 3QPSA 2Y0SA 4CGZA 2CW0F 3F3XA 3KEQA 3HSFA 1FYMA 5CQGA 4HSTA 2FNPA 2P7CB 3DXJF 3U1KA 4A3KJ 3JRAA 2CFXA 1HXDA 3R60A 3AL0C 1WHUA 3KE2A 2O9LA 1J7KA 3GVAA 5HS8A 4A3FJ 3ZXSA 4I0AA 5IT3A 3MVPA 1LNWA 2KP6A 1P4AA 3D1NI 3KX2A 1BM9A 3P9KA 1S7AA 4XLCA 3U21A 3F8MA 4OMZA 9ANTA 3E5XA 3U9GA 1ZK8A 3MEXA 4HDVA 2ZCWA 2HYJA 4IHTA 4ZYEA 2R7DA 2XAQA 4HSRA 3HGYA 1QZZA 1P9QC 4E7HA 4EQQA 5HLHA 1HSJA 1H88C 3FBNB 2L9VA 1VQ6I 3I59A 2WC2A 3G3ZA 1FTZA 2QSHX 1KQ9A 2WAQN 3PUFA 5CKTA 3WTZA 1IRGA 4FCYA 4M9XA 2OQRA 2HVRA 3CMMA 5ILUA 2HDCA 1QHHD 1U8BA 5H20A 4A5MA 3FXRA 4U0VA 4D7MA 4J00A 5HVQC 1OKRA 2VT3A 2RV8A 3O2PE 1SVMA 4ASNA 5M5XJ 2DBBA 4L5EA 3BQZA 3WTUC 4E7JA 3R4KA 3WHBA 5M3FJ 3L2QA 2IS1A 2MC4A 2ELHA 1YX3A 3CDIA 3HKZA 4QPOA 1YO5C 4JOMA 3HOSA 3BZ6A 4XLAA 3RKWA 4YIFA 1ZGWA 4BBRJ 2ZJPF 4R1HA 3A0HC 1QZEA 1APLC 4CCMA 1MBJA 5DCMA 3JRCA 2STTA 3SEQA 3NWTA 1W0UA 4MEXF 1YYVA 2DN0A 2LY9A 4M3DA 3O3KA 1UZCA 2YR2A 2EK5A 1A36A 2DMNA 4HF0A 2W57A 5HNFA 4H0EA 4EM2A 2KJCA 3OYBA 3KEOA 3K4MA 2ZKZA 1JKOC 3DP7A 3RKYA 5DEQA 1IAWA 4IVNA 4S0HB 3F0CA 3GUDA 2A69F 1LDJA 1K7AA 1P4WA 3FF5A 1TT0A 2ZB9A 3MD2A 3FXQA 1JJ8C 2ZSHB 1ORKA 2L9RA 4DQ2A 1O3TA 1QO0D 2E35A 3GEZA 4PDKA 3RSNA 2ISYA 4G94A 4AC0A 2J5OA 4UY8I 4CH7A 2VKEA 3IAS2 2R92J 1L3LA 3J81Z 4BQOA 4HYEA 4XR6A 1V3FA 2EWNA 3E5QA 2M5WA 1SD5A 1JKPC 2K85A 4JQFA 3DCFA 3RKXA 3K4KA 2PX9A 3PIOF 3TOBA 1PUFA 1IUYA 3FXMA 5F6FA 3GTQJ 4ETSA 5H6RA 2VONA 1FMWA 2IGOA 4M9SA 4J19A 2NS0A 2UUZA 1ZELA 1KYZA 4NC7A 3KZZA 5EG0A 1D1CA 2DK8A 4XN0A 1PUFB 3M9AA 5D8LB 2WBMA 2ZJ2A 2QSFX 4BQAA 3OR1C 1JI8A 3P7NA 2E7WA 2MFZA 5EG0B 5EYRA 1B9MA 3OIQA 1V5FA 3HGGA 1T8IA 1YJ9I 2V6EA 3GO5A 4IXAA 5J1YA 2VN2A 4PFOA 4BHPA 1BC8C 2HGCA 4XSXF 4J01A 2GXBA 2EV0A 1MW7A 3GLLA 3M4OJ 3K4NA 2F4IA 4BE2A 4HNUA 3IUOA 1SFXA 1EKEA 3GFJA 2FNAA 2EJRA 5BPIA 2ID6A 3BTJA 1GHCA 4PGGA 2ZC2A 2JA6J 4FASD 4M6XA 1LFPA 1YW7A 2AXLA 1ETYA 2LRDA 2WAFA 3E7LA 5DV5A 1NK3P 4A93J 2R5ZA 3I4PA 1F36A 1Z05A 4A3EJ 4N0BA 2BHZA 1DP3A 4RM3A 1XSXA 3KP5A 3D5SC 3CCMI 2VBXA 4EATA 4JYKA 5GAEJ 1GUUA 3PL8A 1TL8A 2CJJA 2R5ZB 3AL0B 3B6CA 4K2EA 4C3JJ 5LHIA 4XRSG 1RETA 5B3SH 2HNHA 1SD7A 3BJ6A 2MH2A 1LB2A 2PEXA 4P96A 3EYIA 4BEHB 3SFZA 1X3WB 4YIRX 4ENJA 1RUOA 3F22A 5FKMA 1VQMI 4BQQA 5FLXZ 3G1LA 2NNYA 4C2TA 2CQNA 5HNHA 2UV1A 4D1QA 3BR5A 3DEUA 2GLOA 4JX6A 3P5JA 2IEKA 2DMQA 4IRIA 1TWHJ 3HUGA 4A3CJ 2M4GA 1OISA 2XF7A 3A02A 1MNMC 1KU2A 1ON2A 1IG7A 4A3DJ 5JVTA 1D0ZA 1QNTA 3CDHA 2QYOA 1ZGAA 2LK2A 3M8EA 1MBHA 2M3AA 3NRVA 2RDPA 3KLOA 2EZKA 1IXCA 4RB1A 3HUGB 2XC7A 3FXUA 3MZHA 2ECCA 3QWLA 4IF4A 3OY9A 5IYDJ 2R7ZJ 1TBXA 3F21A 1ETXA 3KYDB 1F1ZA 2I8DA 2OD5A 2V26A 3DU5A 3SFIA 2E36A 1MZBA 1FBQA 2F5FA 2LKSA 2NNNA 4UVBA 5FKKA 1WSUA 4KN7X 3J7AY 2X85A 1GXPA 4LG3A 4NB5A 2DQLA 1ETVA 4A2UA 4G6QA 5CVIA 4XKVA 3DLAA 2VBZA 4HLXA 3LA7A 4KIBA 4LIUA 2HOTA 4BU2A 2ELKA 4HW0A 1R6RA 4HX7A 4BGDA 3VODA 3DPUA 4AYBA 2HVSA 1UHMA 3ABUA 1XCBA 2K9LA 3JRGA 2F5EA 2E5ZA 5GAHJ 5F64A 2JA2A 4WWCA 2HWVA 4YEJA 4I0BA 2LKXA 1HLVA 3HTUA 3TEDA 1ULYA 1N25A 2L4AA 2CQ7A 2NAZA 1BOBA 1R5ID 1X2NA 3DFGA 2V9VA 1JJ6C 4B48A 3JSPA 1ZN2A 4I01A 2LH9A 2ZXIA 3VEPA 1B9NA 4BS9A 1ETWA 1IRZA 3PUBA 3WTTC 4EEFG 1JHHA 1FNNA 4II2A 4E7LA 1IZ1A 3DBHB 4HQEA 5J40A 1GDTA 3M3YJ 3E6DA 1XMXA 3BR0A 4RM2A 2YPRA 1PP7U 3QOEA 1WJFA 1DU0A 2F4OB 3QOPA 4M3BA 3VFZA 4PSWA 2MBFA 3QPHA 3F8CA 1Z0XA 3OYHA 1IV6A 5IT9K 2JJ7A 1X3UA 3H3UA 2LOOA 4B09A 2M1BA 3HSRA 3I71A 3S8PA 4CXFA 3LSMA 3P9IA 3HL2A 2VXZA 1ZG1A 3N4MA 1XX5A 2CQQA 4FHTA 5E8GA 5FLVA 1YTYA 1D1BA 2K02A 2VOOA 4G6TB 2QVOA 1HOMA 2VKVA
chains in the Genus database with same CATH topology
5E8IA 1R58A 1XGOA 3WTXC 4P9UA 1IW7F 2F5DA 5HLGA 4QWQA 2HEOA 1HBXG 2ESNA 2K27A 3FX3A 2V6CA 2QBYA 2J5PA 1LDDA 1XGNA 1R00A 1UHWA 2MA3A 2QBYB 2JPCA 2E7XA 1TNTA 2A07F 3WG9A 5J8CA 3P9CA 3R61A 4L9NA 4ZH4F 3Q9VA 2DI3A 5L3DA 3TO9A 3ZMTA 1FP1D 3WODF 5L3CA 2FRHA 4KUMA 2AS5F 4AIJA 4ZZLA 2HQNA 5HDNA 2XHKA 5K5RA 4UVCA 2XGXA 4LJZF 2DLLA 4IJAA 1TTYA 3IRRA 2KIFA 5ICCA 2V1UA 4IHSA 4YFKF 2QQ9A 3WGGA 2JRTA 4Q5SF 4NQWA 4EV0A 1MD0A 3CLOA 2DK5A 3K1NA 2XVCA 3QP6A 3ISPA 2K86A 5D8KB 4M71A 4U7BA 3EDPA 3KP2A 3K2ZA 4HDUA 5FGMA 5F1RA 1YG2A 2G7HA 3U2RA 3C7JA 1BI1A 3SZTA 2Y0MA 3ZN0A 4KMFA 4GYGA 3IKVA 3I0TA 4G7HF 1I27A 4A0XA 3MQ0A 3V7CA 2P6TA 1YW9A 1T98A 4L5IA 2KRFA 2Y75A 2ZXJA 2EFOA 4Z2YA 1T6SA 1ZRFA 3E6MA 2PI0A 3D5LA 1AOYA 2A68F 2DPDA 2GQQA 4Q47A 5A2QZ 1R22A 3Q9SA 2ZNZA 1FX7A 2MLKA 1KU9A 2FBIA 2X4HA 4Y15A 5D5VB 2JPBA 1R1UA 2KJBA 4WX9A 1BI2A 1WQ2A 4KDPA 1P2FA 4EJOA 1DUXC 3I5UA 4ZYHA 3TQNA 2LNBA 2VC0A 4M74A 5LHHA 3H92A 3BPXA 3KETA 1S7OA 3E5UA 3MAJA 3COAC 5AIQA 1LEAA 2D1HA 2DAOA 1D8KA 3GZ6A 4RB2C 1F4KA 3J81K 2FE3A 2Z99A 4YG2F 3DF8A 5FB2A 1WRJA 3BDDA 2L4MA 3RPQA 3BPVA 5HLIA 5LEKA 4KICA 5E1WA 1U78A 2IW5A 2O8XA 4L9TA 1IXRC 3BWGA 3ZMZA 2OU2A 4Y17A 5AIPA 3VOEA 3CUOA 2W84A 2QUFA 3GFMA 5JFRA 1B1BA 4M9ZA 1I1GA 2HKXA 1J75A 4UUVA 4XLPF 3QPTA 1E17A 4KT5C 5BPDA 3FM5A 1CF7A 4KFCA 2FXAA 1ZYRF 2RVCA 4P9FA 5LGNA 4N9HA 4KNYA 3OV8A 4XRFA 2HR3A 4EM1A 1JXSA 3FM3A 1ZAOA 4OOIA 3IKTA 4I98B 3I59B 5J6XA 3L9FA 1BIAA 3EUHA 2IRFG 4WXDA 1XDSA 2QLZA 4G7ZF 3J7AO 1EH7A 4EGYA 2FF4A 2F2EA 2Z3YA 2IT0A 3BP8A 1G3SA 1FPQA 4KIFA 5LRRA 3SHFA 4F7ZA 4M73A 1QPMA 5D5UB 5DCMB 3NEUA 1PUEE 3F8NA 3ZMUA 4R8HA 4P55A 1KQ8A 2W25A 2E1NA 2PFBA 3KLNA 5D5XB 1UFMA 2ZO4A 2V1XA 3FHZA 2EFQA 1PP8F 1YS7A 1HKTA 2P6SA 4HF2A 3K0LA 4OIOF 4G9YA 2ACJA 1G6NA 3VB2A 2FU4A 4RGXA 2ZMEA 1FZPB 4MQ9F 1U8RA 2RGVA 1JE8A 2UXNA 3FWEA 4LMYA 4RS8A 4I09A 5DYMA 4CO8A 2ZMEB 2XV4S 4AIHA 3MCZA 1QGPA 3CTAA 2BBYA 2IVMA 4LK1F 1OYYA 1YW8A 4ENMA 5L3FA 2O03A 4Q48A 2CYYA 4I7HA 2L54A 4LB5A 2RKHA 2P5VA 3F72A 1SMYF 3ERED 5CVUA 4HAMA 5LGUA 1IF1A 4MTDA 3RJPA 2BE5F 1BOAA 1ZG5A 1IN5A 2H6BA 3BROA 2DFIA 2DQRA 1JHFA 2M87A 4UVAA 4OIRF 2MH9A 2P8TA 5L3BA 4M72A 4M6YA 3WTWC 2FBHA 1XMKA 1Y0UA 3L00A 3ZPLA 1K79A 4MHGA 3WTSC 4BHBA 1TW3A 4LLNA 2GWRA 1RI7A 1KYWA 3HRUA 2D2WA 5KK1A 1TQIA 1UCRA 1Z6TA 5FO5A 3E3VA 3R6SA 1A04A 3T5XA 3KP4A 2QQAA 3ELKA 4LK0F 2ADUA 2P5KA 3HRTA 3HRMA 2FBKA 5FD6A 2ISZA 3RPUA 4ON0A 2COMA 2VC1A 1J2XA 3T1BA 2JTVA 1T39A 1SD4A 3V8JA 4JBAA 2CSOA 3BY6A 1GXQA 2H27A 1W4MA 1NHAA 1G4DA 4KIGA 4BHCA 4E70A 4LG0A 1I6XA 2Z33A 3SZPA 3IRQA 2M30A 2CO5A 3GFLA 1ZGJA 3D0SA 4LG0B 2UWMA 1MJAA 3L7WA 5KVRA 2W24A 3TO7A 1BI3A 3QRFF 4AD9A 3ML6A 2HTJA 2HYGD 4LLLA 2XRNA 1ON1A 4HOBA 2UZKA 3IWZA 4GCVA 1V4RA 3L09A 2X0LA 1R5GA 3ZP5A 2YU3A 3JTGA 5HDGA 4L5JA 1Z91A 2XAJA 2YX7A 3HIFA 3IC7A 4RB3C 5ILVA 1OMIA 4P5OA 5DUIA 2H94A 4UNOA 4HX4A 3G73A 3M7GA 1ZH5A 4WF2A 5CVJA 1LVAA 2MLGA 1F9NA 4MTEA 2CWEA 1UB9A 4EJVA 2OZ6A 2PMUA 1T2KA 2VE8A 4YFXF 1O7FA 5ICEA 3TGNA 4CDGA 1RUNA 1EH8A 1ZLKA 1FT9A 4XBFA 4BAYA 4ESFA 1XSDA 1IN4A 4OU0A 4U7DA 1LQ1A 2O0YA 5A2QK 2GA2A 3BJAA 4Q4ZF 2C6YA 3KCCA 3RTRA 2EB7A 4A0ZA 2EA2A 3IL2A 4A12A 1T0FA 1PDNC 4WXCA 2IA0A 1MJBA 5TRDA 2DU9A 2H6CA 3R0AA 3KP6A 1LDKB 2LKPA 2O6GE 1SMTA 3ZN1A 1IN6A 3SXYA 3LA2A 1XGSA 2XIGA 2TDXA 1FBUA 3I54A 3IWFA 2B0LA 4EM0B 2HYFA 3EETA 1O7LA 5D4RA 4HA8A 1HQCA 3ULQB 4HLYA 3LAPA 4BXUA 2XAGA 3LWFA 1KA8A 3U1DA 2XKPA 4HBLA 4JK1X 3SQNA 1STZA 4ESBA 1SD6A 4OIPF 4HX8A 2D1VA 1ZRCA 1O3QA 1XB4A 1H9TA 1KGSA 3K9TA 3WGHA 3V4GA 2DPUA 2OA4A 2O61A 1W7PA 2PBIA 5JI6A 3QU6A 3BOQA 3BJOA 1EV7A 3PFIA 1CGPA 2BGCA 1OYWA 1XMAA 5ICFA 1U5TC 2A61A 3T8RA 4LD5A 3HTSB 4OINF 2EV6A 3WTVC 4NHJA 3KZYA 3FMQA 1BC7C 5CVRA 4FX0A 2ETHA 1G3YA 5IT9Z 3N97A 2HS5A 3IHUA 3JTHA 1W5SA 1FSEA 1O3SA 2NYXA 5DD4A 3ECOA 1K78A 3F6OA 4G7OF 4RAYA 1SFUA 5BQTA 4GO1A 2GA1A 4D0PA 2YSRA 4TV7A 3E6CC 2P4WA 2MD5A 4GGGA 1H0MA 3C3WA 1YIOA 5BOXA 1TLHB 2VOPA 2PN6A 2FA5A 4A6DA 2IJLA 4UV8A 2F5CA 3M8FA 1QQIA 3CUQC 1QBJA 2FQ3A 1OYIA 3DV8A 1ZLJA 2EV5A 4XLNF 3V7SA 1FLIA 3TDZC 5CVVA 1SFEA 1MDMA 1S8NA 2JT1A 2Q8KA 3S2WA 1Z9CA 5CLSA 4WXHA 1EH6A 1USSA 3E6BA 1DPRA 1Z7UA 2JSCA 4A6EA 2BV6A 4HF1A 1XSVA 2IA1A 2A3SA 1W5TA 2OAZA 4ENKA 1XN7A 2FMYA 1BIBA 2EFPA 1R1TA 3B73A 3K1MA 1FYKA 2QM3A 3HRSA 2CQKA 1K6OA 1MGTA 5DUKA 1LEBA 3DKWA 4PZJA 1C0WA 3RIRA 1E2XA 5K1YA 3OOPA 5CYVA 2P7VB 3HHHA 4MQVA 1Z6RA 2WWYA 1HSTA 3CO7C 4UXNA 1HW2A 5FFXA 4PCQA 1CF7B 1OR7A 2IP2A 3EQLF 5BMZA 2XAHA 1U6GA 2DT5A 3QP5A 2D45A 3CJNA 3B02A 2HTSA 2LDUA 3F23A 3PQJA 3Q5FA 1U5TA 3HOTA 1BBYA 4EJTA 3GYHX 2L3DA 4KA4A 5FLXK 1D5VA 1U5TB 2WV0A 2VE9A 2ZFWA 2OBPA 3KP3A 4RB0A 3RYRA 5LBQA 1KQ0A 5HDKA 2CG4A 1W7PD 2XKOA 4CYDA 2HZTA 4IPAA 1FC3A 5E1XA 4LB6B 5TJJA 4AIKA 1G3TA 2VT2A 3CO6C 3TOAA 3DPLC 3DQVC 3MFKA 4N9IA 3JAMZ 3TO6A 1ONVA 2CGPA 3CUQA 2DW4A 1LJ9A 4GYIA 1R23A 5FFZA 2PMHA 5DDGA 2A6HF 5JHUA 2PQ8A 3FMSA 1O57A 3CUQB 3LSTA 1MJ9A 2DO7A 3WE3A 3J80Z 2H09A 2PJPA 1IRFA 1YLFA 3GZ5A 1R7JA 3ZMSA 3MZYA 4BYYA 1USTA 2GAUA 2A6EF 4LFUA 5DD8A 4XSZF 5JR3A 1P6RA 2RQPA 5LGTA 5E20A 3W6KB 1P4XA 4UV9A 2M8EA 3TDUC 3LQRA 1KU3A 1I5ZA 4CICA 1BI0A 4O5VA 3GXOA 5L3EA 4S04A 3E97A 2OQGA 4RGSA 1B59A 2HFHA 1XCVA 3WU0A 6PAXA 4IRHA 4EMSA 1L0OC 1KU7A 5D6FA 3C1DA 2P5LC 4EVIA 1ZHFA 3V8KA 5LLQA 4YIIA 1R36A 3EYYA 1HW5A 2K7LA 3T0YA 1T38A 4BNCA 4AVPA 4U88A 5D5WB 2IPQX 4HQMA 3HHGA 1FWZA 4ZZDA 1J59A 1YFHA 3DPTA 4MGRA 2Q2EA 1F5TA 3TKYA 1S3JA 3QU3A 1B6AA 3L2CA 2BEOA 1TNSA 1FYLA 5E17F 2K4JA 2XROA 4I02A 2LF7A 1ZREA 1FP2A 5HS7A 1RIOH 3MWMA 4L0YB 5DCFA 2XUBA 5CJ9A 1D3YA 3W6JB 3HSEA 2HKOA 3RI4A 2EFNA 2Y48A 4KN4X 1YS6A 4KYWA 4RAZA 4UHTA 4LGWA 1AWCA 5E1ZB 5H6QA 3WU1B 1ODDA 1JGSA 1FOKA 4L0ZB 4ZYGA 5D6EA 4DNCA 5E18F 2NRAC 1GVJA 1WKMA 2EA4A 2G9WA 4R79A 4HV5A 4ZYDA 1ZARA 2E1CA 4RGRA 5FD5A 3I58A 1RZ4A 5ED4A 3GFIA 5HOOA 2DTRA 4A5NA 5EEGA 4ESJA 3ZQ7A 4WK8F 1D8JA 4O6JA 1WWXA 3F6VA 5J8FA 4S05A 4EJWA 1FSHA 2ZBKA 1DP7P 3LA3A 1HKSA 3JW4A 2WTEA 3F8BA 1HKQA 3R0JA 1J0RA 3ZMVA 2QENA 4B8XA 3K1PA 3PQKA 3FZVA 4MEYF 3V8LA 2RNJA 1G3WA 2Z5UA 4ENNA 1ZG3A 2YX4A 3KFWX 1TQPA 3RDIA 5D4SA 5LRSA 3H3ZA 2V1DA 2HOEA 4AWXB 2W85A 4CZZA 2FMLA 1IN8A 2LF8A 2V79A 4I2OA 1FY7A 1H9GA 5ILSA 3M1EA 4L18B 4L9VA 4OIQF 3GW2A 1TQMA 1YQAA 2GIVA 2IA2A 1J5YA 5AONA 2EFWA 3NQOA 3K69A 2A5YB 1MKMA 1B4AA 4YFNF 2QWWA 3GF2A 3WTYC 4IRGA 1U2WA 2OZUA 2STWA 4WCGA 4G8XA 2VODA 1QZYA 2QZ8A 4OMYA 2GZWA 3HYIA 3V7RA 3GX4X 2FOKA 3C18A 2PG4A 2LSOA 4PGHA 5ICGA 3AAFA 1IXSB 4U0WA 5LHGA 3ECHA 2JZYA 1W7PB 2ESHA 1Z1DA 1OPCA 3LAJA 2VBWA 1IN7A 4FT8A 4L9JA 1S29A 2KKOA 2Q0OA 2KIMA 1HW1A 1I1SA 1FBSA 1R5HA 1XGMA 4MNUA 3FMRA 2RN7A 1O3RA 3F8FA 3GLXA 4G6DA 2O3FA 1XDUA 1BJAA 1SAXA 5HS9A 1ZRDA 2R7FA 4LLGF 2R3SA 3T8TA 5EEHA 4Y13A 4O3MA 1J9IA 4U0YA 1K78B 2L02A 3ABTA 3REOA 4GXOA 4EJUA 1TW2A 5LEJA 2ZNYA 4QLCU 3LFKA 4HZFA 3O6BB 3WE2A 2UXXA 1XD7A 2VBYA 1BN5A 3KP7A 4A0YA 1VTNC 3JSOA 3I64A 1RNLA 3LQQA 2KIUA 1REPC 2QQBA 3GWZA 4KMUX 1DDNA 2RC4A 5L3GA 5K5OA 3JAMK 3I53A 1S6LA 1R1VA 3QAHA 1MDMB 1U3EM 2G7UA 3WGIA 3ROUA 2GXGA 1P92A 5ERIA 2PLYA 2MC3A 3ZMDA 2FEZA 1Q1HA 2BYVE 3J80K 4EGZA 4BH9A 5K5QA 2Z9OA 4FX4A 2HQRA 4RGUA 2XASA 5BS6A 2L01A 2M45A 2FSWA 1DPUA 3RYPA 2XAFA 1WI9A 4CHUA 2K4BA 4HV6A 4CGZA 2CW0F 3F3XA 3KEQA 3HSFA 1FYMA 2FNPA 2P7CB 3DXJF 2CFXA 1HXDA 3R60A 3KE2A 1J7KA 3GVAA 5HS8A 4I0AA 5IT3A 1LNWA 1P4AA 1BM9A 3P9KA 1S7AA 3F8MA 4OMZA 3E5XA 3U9GA 3MEXA 4HDVA 2ZCWA 4IHTA 4ZYEA 2R7DA 2XAQA 1QZZA 4EQQA 5HLHA 1HSJA 3I59A 2WC2A 3G3ZA 1KQ9A 3WTZA 1IRGA 4M9XA 2OQRA 5ILUA 2HDCA 5H20A 4A5MA 3FXRA 4U0VA 5HVQC 1OKRA 2VT3A 2RV8A 3O2PE 4ASNA 2DBBA 3WTUC 3R4KA 2ELHA 1YO5C 3HOSA 3BZ6A 3RKWA 4YIFA 4R1HA 5DCMA 2STTA 4MEXF 1YYVA 3O3KA 2YR2A 2EK5A 4HF0A 2W57A 4H0EA 4EM2A 2KJCA 3KEOA 2ZKZA 3DP7A 3RKYA 5DEQA 1IAWA 4IVNA 3GUDA 2A69F 1LDJA 1K7AA 1P4WA 3FF5A 3FXQA 4DQ2A 1O3TA 1QO0D 3GEZA 4PDKA 2ISYA 4G94A 2J5OA 1L3LA 3J81Z 4HYEA 1V3FA 2EWNA 3E5QA 2M5WA 1SD5A 4JQFA 3RKXA 3TOBA 1IUYA 5F6FA 4ETSA 5H6RA 2VONA 4M9SA 2NS0A 1KYZA 3KZZA 2DK8A 3M9AA 5D8LB 2ZJ2A 4BQAA 3P7NA 2E7WA 1B9MA 3GO5A 4IXAA 2VN2A 4BHPA 1BC8C 2HGCA 4XSXF 2GXBA 2EV0A 1SFXA 3GFJA 2FNAA 2EJRA 5BPIA 1GHCA 4PGGA 4M6XA 1YW7A 2AXLA 5DV5A 3I4PA 1Z05A 4N0BA 1XSXA 3KP5A 2VBXA 4K2EA 5LHIA 3BJ6A 1SD7A 2MH2A 1LB2A 2PEXA 4P96A 3EYIA 3SFZA 4ENJA 1RUOA 3F22A 5FLXZ 2NNYA 3DEUA 4IRIA 3HUGA 1KU2A 1ON2A 5JVTA 1QNTA 3CDHA 2QYOA 1ZGAA 3M8EA 3NRVA 2RDPA 3KLOA 1IXCA 4RB1A 3MZHA 3FXUA 4IF4A 1TBXA 3F21A 1F1ZA 2OD5A 1MZBA 1FBQA 2F5FA 2NNNA 4UVBA 1WSUA 4KN7X 1GXPA 4NB5A 2DQLA 4A2UA 4G6QA 5CVIA 2VBZA 4HLXA 3LA7A 4KIBA 4HW0A 4HX7A 3VODA 1UHMA 3ABUA 1XCBA 2F5EA 5F64A 4WWCA 2HWVA 4I0BA 3HTUA 1ULYA 2L4AA 2NAZA 3DFGA 2V9VA 3JSPA 1ZN2A 4I01A 3VEPA 1B9NA 3WTTC 1JHHA 1FNNA 1IZ1A 4HQEA 3E6DA 2YPRA 1PP7U 3QOPA 3VFZA 2MBFA 3QPHA 3F8CA 5IT9K 1X3UA 3H3UA 4B09A 2M1BA 3HSRA 3I71A 4CXFA 3P9IA 2VXZA 1ZG1A 3N4MA 4FHTA 5E8GA 1YTYA 2K02A 2VOOA 2QVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E8I A;  1R58 A;  1XGO A;  3WTX C;  4P9U A;  1IW7 F;  2F5D A;  5HLG A;  4QWQ A;  2HEO A;  1HBX G;  2ESN A;  2K27 A;  3FX3 A;  2V6C A;  2QBY A;  2J5P A;  1LDD A;  1XGN A;  1R00 A;  1UHW A;  2MA3 A;  2QBY B;  2JPC A;  2E7X A;  1TNT A;  2A07 F;  3WG9 A;  5J8C A;  3P9C A;  3R61 A;  4L9N A;  4ZH4 F;  3Q9V A;  2DI3 A;  5L3D A;  3TO9 A;  3ZMT A;  1FP1 D;  3WOD F;  5L3C A;  2FRH A;  4KUM A;  2AS5 F;  4AIJ A;  4ZZL A;  2HQN A;  5HDN A;  2XHK A;  5K5R A;  4UVC A;  2XGX A;  4LJZ F;  2DLL A;  4IJA A;  1TTY A;  3IRR A;  2KIF A;  5ICC A;  2V1U A;  4IHS A;  4YFK F;  2QQ9 A;  3WGG A;  2JRT A;  4Q5S F;  4NQW A;  4EV0 A;  1MD0 A;  3CLO A;  2DK5 A;  3K1N A;  2XVC A;  3QP6 A;  3ISP A;  2K86 A;  5D8K B;  4M71 A;  4U7B A;  3EDP A;  3KP2 A;  3K2Z A;  4HDU A;  5FGM A;  5F1R A;  1YG2 A;  2G7H A;  3U2R A;  3C7J A;  1BI1 A;  3SZT A;  2Y0M A;  3ZN0 A;  4KMF A;  4GYG A;  3IKV A;  3I0T A;  4G7H F;  1I27 A;  4A0X A;  3MQ0 A;  3V7C A;  2P6T A;  1YW9 A;  1T98 A;  4L5I A;  2KRF A;  2Y75 A;  2ZXJ A;  2EFO A;  4Z2Y A;  1T6S A;  1ZRF A;  3E6M A;  2PI0 A;  3D5L A;  1AOY A;  2A68 F;  2DPD A;  2GQQ A;  4Q47 A;  5A2Q Z;  1R22 A;  3Q9S A;  2ZNZ A;  1FX7 A;  2MLK A;  1KU9 A;  2FBI A;  2X4H A;  4Y15 A;  5D5V B;  2JPB A;  1R1U A;  2KJB A;  4WX9 A;  1BI2 A;  1WQ2 A;  4KDP A;  1P2F A;  4EJO A;  1DUX C;  3I5U A;  4ZYH A;  3TQN A;  2LNB A;  2VC0 A;  4M74 A;  5LHH A;  3H92 A;  3BPX A;  3KET A;  1S7O A;  3E5U A;  3MAJ A;  3COA C;  5AIQ A;  1LEA A;  2D1H A;  2DAO A;  1D8K A;  3GZ6 A;  4RB2 C;  1F4K A;  3J81 K;  2FE3 A;  2Z99 A;  4YG2 F;  3DF8 A;  5FB2 A;  1WRJ A;  3BDD A;  2L4M A;  3RPQ A;  3BPV A;  5HLI A;  5LEK A;  4KIC A;  5E1W A;  1U78 A;  2IW5 A;  2O8X A;  4L9T A;  1IXR C;  3BWG A;  3ZMZ A;  2OU2 A;  4Y17 A;  5AIP A;  3VOE A;  3CUO A;  2W84 A;  2QUF A;  3GFM A;  5JFR A;  1B1B A;  4M9Z A;  1I1G A;  2HKX A;  1J75 A;  4UUV A;  4XLP F;  3QPT A;  1E17 A;  4KT5 C;  5BPD A;  3FM5 A;  1CF7 A;  4KFC A;  2FXA A;  1ZYR F;  2RVC A;  4P9F A;  5LGN A;  4N9H A;  4KNY A;  3OV8 A;  4XRF A;  2HR3 A;  4EM1 A;  1JXS A;  3FM3 A;  1ZAO A;  4OOI A;  3IKT A;  4I98 B;  3I59 B;  5J6X A;  3L9F A;  1BIA A;  3EUH A;  2IRF G;  4WXD A;  1XDS A;  2QLZ A;  4G7Z F;  3J7A O;  1EH7 A;  4EGY A;  2FF4 A;  2F2E A;  2Z3Y A;  2IT0 A;  3BP8 A;  1G3S A;  1FPQ A;  4KIF A;  5LRR A;  3SHF A;  4F7Z A;  4M73 A;  1QPM A;  5D5U B;  5DCM B;  3NEU A;  1PUE E;  3F8N A;  3ZMU A;  4R8H A;  4P55 A;  1KQ8 A;  2W25 A;  2E1N A;  2PFB A;  3KLN A;  5D5X B;  1UFM A;  2ZO4 A;  2V1X A;  3FHZ A;  2EFQ A;  1PP8 F;  1YS7 A;  1HKT A;  2P6S A;  4HF2 A;  3K0L A;  4OIO F;  4G9Y A;  2ACJ A;  1G6N A;  3VB2 A;  2FU4 A;  4RGX A;  2ZME A;  1FZP B;  4MQ9 F;  1U8R A;  2RGV A;  1JE8 A;  2UXN A;  3FWE A;  4LMY A;  4RS8 A;  4I09 A;  5DYM A;  4CO8 A;  2ZME B;  2XV4 S;  4AIH A;  3MCZ A;  1QGP A;  3CTA A;  2BBY A;  2IVM A;  4LK1 F;  1OYY A;  1YW8 A;  4ENM A;  5L3F A;  2O03 A;  4Q48 A;  2CYY A;  4I7H A;  2L54 A;  4LB5 A;  2RKH A;  2P5V A;  3F72 A;  1SMY F;  3ERE D;  5CVU A;  4HAM A;  5LGU A;  1IF1 A;  4MTD A;  3RJP A;  2BE5 F;  1BOA A;  1ZG5 A;  1IN5 A;  2H6B A;  3BRO A;  2DFI A;  2DQR A;  1JHF A;  2M87 A;  4UVA A;  4OIR F;  2MH9 A;  2P8T A;  5L3B A;  4M72 A;  4M6Y A;  3WTW C;  2FBH A;  1XMK A;  1Y0U A;  3L00 A;  3ZPL A;  1K79 A;  4MHG A;  3WTS C;  4BHB A;  1TW3 A;  4LLN A;  2GWR A;  1RI7 A;  1KYW A;  3HRU A;  2D2W A;  5KK1 A;  1TQI A;  1UCR A;  1Z6T A;  5FO5 A;  3E3V A;  3R6S A;  1A04 A;  3T5X A;  3KP4 A;  2QQA A;  3ELK A;  4LK0 F;  2ADU A;  2P5K A;  3HRT A;  3HRM A;  2FBK A;  5FD6 A;  2ISZ A;  3RPU A;  4ON0 A;  2COM A;  2VC1 A;  1J2X A;  3T1B A;  2JTV A;  1T39 A;  1SD4 A;  3V8J A;  4JBA A;  2CSO A;  3BY6 A;  1GXQ A;  2H27 A;  1W4M A;  1NHA A;  1G4D A;  4KIG A;  4BHC A;  4E70 A;  4LG0 A;  1I6X A;  2Z33 A;  3SZP A;  3IRQ A;  2M30 A;  2CO5 A;  3GFL A;  1ZGJ A;  3D0S A;  4LG0 B;  2UWM A;  1MJA A;  3L7W A;  5KVR A;  2W24 A;  3TO7 A;  1BI3 A;  3QRF F;  4AD9 A;  3ML6 A;  2HTJ A;  2HYG D;  4LLL A;  2XRN A;  1ON1 A;  4HOB A;  2UZK A;  3IWZ A;  4GCV A;  1V4R A;  3L09 A;  2X0L A;  1R5G A;  3ZP5 A;  2YU3 A;  3JTG A;  5HDG A;  4L5J A;  1Z91 A;  2XAJ A;  2YX7 A;  3HIF A;  3IC7 A;  4RB3 C;  5ILV A;  1OMI A;  4P5O A;  5DUI A;  2H94 A;  4UNO A;  4HX4 A;  3G73 A;  3M7G A;  1ZH5 A;  4WF2 A;  5CVJ A;  1LVA A;  2MLG A;  1F9N A;  4MTE A;  2CWE A;  1UB9 A;  4EJV A;  2OZ6 A;  2PMU A;  1T2K A;  2VE8 A;  4YFX F;  1O7F A;  5ICE A;  3TGN A;  4CDG A;  1RUN A;  1EH8 A;  1ZLK A;  1FT9 A;  4XBF A;  4BAY A;  4ESF A;  1XSD A;  1IN4 A;  4OU0 A;  4U7D A;  1LQ1 A;  2O0Y A;  5A2Q K;  2GA2 A;  3BJA A;  4Q4Z F;  2C6Y A;  3KCC A;  3RTR A;  2EB7 A;  4A0Z A;  2EA2 A;  3IL2 A;  4A12 A;  1T0F A;  1PDN C;  4WXC A;  2IA0 A;  1MJB A;  5TRD A;  2DU9 A;  2H6C A;  3R0A A;  3KP6 A;  1LDK B;  2LKP A;  2O6G E;  1SMT A;  3ZN1 A;  1IN6 A;  3SXY A;  3LA2 A;  1XGS A;  2XIG A;  2TDX A;  1FBU A;  3I54 A;  3IWF A;  2B0L A;  4EM0 B;  2HYF A;  3EET A;  1O7L A;  5D4R A;  4HA8 A;  1HQC A;  3ULQ B;  4HLY A;  3LAP A;  4BXU A;  2XAG A;  3LWF A;  1KA8 A;  3U1D A;  2XKP A;  4HBL A;  4JK1 X;  3SQN A;  1STZ A;  4ESB A;  1SD6 A;  4OIP F;  4HX8 A;  2D1V A;  1ZRC A;  1O3Q A;  1XB4 A;  1H9T A;  1KGS A;  3K9T A;  3WGH A;  3V4G A;  2DPU A;  2OA4 A;  2O61 A;  1W7P A;  2PBI A;  5JI6 A;  3QU6 A;  3BOQ A;  3BJO A;  1EV7 A;  3PFI A;  1CGP A;  2BGC A;  1OYW A;  1XMA A;  5ICF A;  1U5T C;  2A61 A;  3T8R A;  4LD5 A;  3HTS B;  4OIN F;  2EV6 A;  3WTV C;  4NHJ A;  3KZY A;  3FMQ A;  1BC7 C;  5CVR A;  4FX0 A;  2ETH A;  1G3Y A;  5IT9 Z;  3N97 A;  2HS5 A;  3IHU A;  3JTH A;  1W5S A;  1FSE A;  1O3S A;  2NYX A;  5DD4 A;  3ECO A;  1K78 A;  3F6O A;  4G7O F;  4RAY A;  1SFU A;  5BQT A;  4GO1 A;  2GA1 A;  4D0P A;  2YSR A;  4TV7 A;  3E6C C;  2P4W A;  2MD5 A;  4GGG A;  1H0M A;  3C3W A;  1YIO A;  5BOX A;  1TLH B;  2VOP A;  2PN6 A;  2FA5 A;  4A6D A;  2IJL A;  4UV8 A;  2F5C A;  3M8F A;  1QQI A;  3CUQ C;  1QBJ A;  2FQ3 A;  1OYI A;  3DV8 A;  1ZLJ A;  2EV5 A;  4XLN F;  3V7S A;  1FLI A;  3TDZ C;  5CVV A;  1SFE A;  1MDM A;  1S8N A;  2JT1 A;  2Q8K A;  3S2W A;  1Z9C A;  5CLS A;  4WXH A;  1EH6 A;  1USS A;  3E6B A;  1DPR A;  1Z7U A;  2JSC A;  4A6E A;  2BV6 A;  4HF1 A;  1XSV A;  2IA1 A;  2A3S A;  1W5T A;  2OAZ A;  4ENK A;  1XN7 A;  2FMY A;  1BIB A;  2EFP A;  1R1T A;  3B73 A;  3K1M A;  1FYK A;  2QM3 A;  3HRS A;  2CQK A;  1K6O A;  1MGT A;  5DUK A;  1LEB A;  3DKW A;  4PZJ A;  1C0W A;  3RIR A;  1E2X A;  5K1Y A;  3OOP A;  5CYV A;  2P7V B;  3HHH A;  4MQV A;  1Z6R A;  2WWY A;  1HST A;  3CO7 C;  4UXN A;  1HW2 A;  5FFX A;  4PCQ A;  1CF7 B;  1OR7 A;  2IP2 A;  3EQL F;  5BMZ A;  2XAH A;  1U6G A;  2DT5 A;  3QP5 A;  2D45 A;  3CJN A;  3B02 A;  2HTS A;  2LDU A;  3F23 A;  3PQJ A;  3Q5F A;  1U5T A;  3HOT A;  1BBY A;  4EJT A;  3GYH X;  2L3D A;  4KA4 A;  5FLX K;  1D5V A;  1U5T B;  2WV0 A;  2VE9 A;  2ZFW A;  2OBP A;  3KP3 A;  4RB0 A;  3RYR A;  5LBQ A;  1KQ0 A;  5HDK A;  2CG4 A;  1W7P D;  2XKO A;  4CYD A;  2HZT A;  4IPA A;  1FC3 A;  5E1X A;  4LB6 B;  5TJJ A;  4AIK A;  1G3T A;  2VT2 A;  3CO6 C;  3TOA A;  3DPL C;  3DQV C;  3MFK A;  4N9I A;  3JAM Z;  3TO6 A;  1ONV A;  2CGP A;  3CUQ A;  2DW4 A;  1LJ9 A;  4GYI A;  1R23 A;  5FFZ A;  2PMH A;  5DDG A;  2A6H F;  5JHU A;  2PQ8 A;  3FMS A;  1O57 A;  3CUQ B;  3LST A;  1MJ9 A;  2DO7 A;  3WE3 A;  3J80 Z;  2H09 A;  2PJP A;  1IRF A;  1YLF A;  3GZ5 A;  1R7J A;  3ZMS A;  3MZY A;  4BYY A;  1UST A;  2GAU A;  2A6E F;  4LFU A;  5DD8 A;  4XSZ F;  5JR3 A;  1P6R A;  2RQP A;  5LGT A;  5E20 A;  3W6K B;  1P4X A;  4UV9 A;  2M8E A;  3TDU C;  3LQR A;  1KU3 A;  1I5Z A;  4CIC A;  1BI0 A;  4O5V A;  3GXO A;  5L3E A;  4S04 A;  3E97 A;  2OQG A;  4RGS A;  1B59 A;  2HFH A;  1XCV A;  3WU0 A;  6PAX A;  4IRH A;  4EMS A;  1L0O C;  1KU7 A;  5D6F A;  3C1D A;  2P5L C;  4EVI A;  1ZHF A;  3V8K A;  5LLQ A;  4YII A;  1R36 A;  3EYY A;  1HW5 A;  2K7L A;  3T0Y A;  1T38 A;  4BNC A;  4AVP A;  4U88 A;  5D5W B;  2IPQ X;  4HQM A;  3HHG A;  1FWZ A;  4ZZD A;  1J59 A;  1YFH A;  3DPT A;  4MGR A;  2Q2E A;  1F5T A;  3TKY A;  1S3J A;  3QU3 A;  1B6A A;  3L2C A;  2BEO A;  1TNS A;  1FYL A;  5E17 F;  2K4J A;  2XRO A;  4I02 A;  2LF7 A;  1ZRE A;  1FP2 A;  5HS7 A;  1RIO H;  3MWM A;  4L0Y B;  5DCF A;  2XUB A;  5CJ9 A;  1D3Y A;  3W6J B;  3HSE A;  2HKO A;  3RI4 A;  2EFN A;  2Y48 A;  4KN4 X;  1YS6 A;  4KYW A;  4RAZ A;  4UHT A;  4LGW A;  1AWC A;  5E1Z B;  5H6Q A;  3WU1 B;  1ODD A;  1JGS A;  1FOK A;  4L0Z B;  4ZYG A;  5D6E A;  4DNC A;  5E18 F;  2NRA C;  1GVJ A;  1WKM A;  2EA4 A;  2G9W A;  4R79 A;  4HV5 A;  4ZYD A;  1ZAR A;  2E1C A;  4RGR A;  5FD5 A;  3I58 A;  1RZ4 A;  5ED4 A;  3GFI A;  5HOO A;  2DTR A;  4A5N A;  5EEG A;  4ESJ A;  3ZQ7 A;  4WK8 F;  1D8J A;  4O6J A;  1WWX A;  3F6V A;  5J8F A;  4S05 A;  4EJW A;  1FSH A;  2ZBK A;  1DP7 P;  3LA3 A;  1HKS A;  3JW4 A;  2WTE A;  3F8B A;  1HKQ A;  3R0J A;  1J0R A;  3ZMV A;  2QEN A;  4B8X A;  3K1P A;  3PQK A;  3FZV A;  4MEY F;  3V8L A;  2RNJ A;  1G3W A;  2Z5U A;  4ENN A;  1ZG3 A;  2YX4 A;  3KFW X;  1TQP A;  3RDI A;  5D4S A;  5LRS A;  3H3Z A;  2V1D A;  2HOE A;  4AWX B;  2W85 A;  4CZZ A;  2FML A;  1IN8 A;  2LF8 A;  2V79 A;  4I2O A;  1FY7 A;  1H9G A;  5ILS A;  3M1E A;  4L18 B;  4L9V A;  4OIQ F;  3GW2 A;  1TQM A;  1YQA A;  2GIV A;  2IA2 A;  1J5Y A;  5AON A;  2EFW A;  3NQO A;  3K69 A;  2A5Y B;  1MKM A;  1B4A A;  4YFN F;  2QWW A;  3GF2 A;  3WTY C;  4IRG A;  1U2W A;  2OZU A;  2STW A;  4WCG A;  4G8X A;  2VOD A;  1QZY A;  2QZ8 A;  4OMY A;  2GZW A;  3HYI A;  3V7R A;  3GX4 X;  2FOK A;  3C18 A;  2PG4 A;  2LSO A;  4PGH A;  5ICG A;  3AAF A;  1IXS B;  4U0W A;  5LHG A;  3ECH A;  2JZY A;  1W7P B;  2ESH A;  1Z1D A;  1OPC A;  3LAJ A;  2VBW A;  1IN7 A;  4FT8 A;  4L9J A;  1S29 A;  2KKO A;  2Q0O A;  2KIM A;  1HW1 A;  1I1S A;  1FBS A;  1R5H A;  1XGM A;  4MNU A;  3FMR A;  2RN7 A;  1O3R A;  3F8F A;  3GLX A;  4G6D A;  2O3F A;  1XDU A;  1BJA A;  1SAX A;  5HS9 A;  1ZRD A;  2R7F A;  4LLG F;  2R3S A;  3T8T A;  5EEH A;  4Y13 A;  4O3M A;  1J9I A;  4U0Y A;  1K78 B;  2L02 A;  3ABT A;  3REO A;  4GXO A;  4EJU A;  1TW2 A;  5LEJ A;  2ZNY A;  4QLC U;  3LFK A;  4HZF A;  3O6B B;  3WE2 A;  2UXX A;  1XD7 A;  2VBY A;  1BN5 A;  3KP7 A;  4A0Y A;  1VTN C;  3JSO A;  3I64 A;  1RNL A;  3LQQ A;  2KIU A;  1REP C;  2QQB A;  3GWZ A;  4KMU X;  1DDN A;  2RC4 A;  5L3G A;  5K5O A;  3JAM K;  3I53 A;  1S6L A;  1R1V A;  3QAH A;  1MDM B;  1U3E M;  2G7U A;  3WGI A;  3ROU A;  2GXG A;  1P92 A;  5ERI A;  2PLY A;  2MC3 A;  3ZMD A;  2FEZ A;  1Q1H A;  2BYV E;  3J80 K;  4EGZ A;  4BH9 A;  5K5Q A;  2Z9O A;  4FX4 A;  2HQR A;  4RGU A;  2XAS A;  5BS6 A;  2L01 A;  2M45 A;  2FSW A;  1DPU A;  3RYP A;  2XAF A;  1WI9 A;  4CHU A;  2K4B A;  4HV6 A;  4CGZ A;  2CW0 F;  3F3X A;  3KEQ A;  3HSF A;  1FYM A;  2FNP A;  2P7C B;  3DXJ F;  2CFX A;  1HXD A;  3R60 A;  3KE2 A;  1J7K A;  3GVA A;  5HS8 A;  4I0A A;  5IT3 A;  1LNW A;  1P4A A;  1BM9 A;  3P9K A;  1S7A A;  3F8M A;  4OMZ A;  3E5X A;  3U9G A;  3MEX A;  4HDV A;  2ZCW A;  4IHT A;  4ZYE A;  2R7D A;  2XAQ A;  1QZZ A;  4EQQ A;  5HLH A;  1HSJ A;  3I59 A;  2WC2 A;  3G3Z A;  1KQ9 A;  3WTZ A;  1IRG A;  4M9X A;  2OQR A;  5ILU A;  2HDC A;  5H20 A;  4A5M A;  3FXR A;  4U0V A;  5HVQ C;  1OKR A;  2VT3 A;  2RV8 A;  3O2P E;  4ASN A;  2DBB A;  3WTU C;  3R4K A;  2ELH A;  1YO5 C;  3HOS A;  3BZ6 A;  3RKW A;  4YIF A;  4R1H A;  5DCM A;  2STT A;  4MEX F;  1YYV A;  3O3K A;  2YR2 A;  2EK5 A;  4HF0 A;  2W57 A;  4H0E A;  4EM2 A;  2KJC A;  3KEO A;  2ZKZ A;  3DP7 A;  3RKY A;  5DEQ A;  1IAW A;  4IVN A;  3GUD A;  2A69 F;  1LDJ A;  1K7A A;  1P4W A;  3FF5 A;  3FXQ A;  4DQ2 A;  1O3T A;  1QO0 D;  3GEZ A;  4PDK A;  2ISY A;  4G94 A;  2J5O A;  1L3L A;  3J81 Z;  4HYE A;  1V3F A;  2EWN A;  3E5Q A;  2M5W A;  1SD5 A;  4JQF A;  3RKX A;  3TOB A;  1IUY A;  5F6F A;  4ETS A;  5H6R A;  2VON A;  4M9S A;  2NS0 A;  1KYZ A;  3KZZ A;  2DK8 A;  3M9A A;  5D8L B;  2ZJ2 A;  4BQA A;  3P7N A;  2E7W A;  1B9M A;  3GO5 A;  4IXA A;  2VN2 A;  4BHP A;  1BC8 C;  2HGC A;  4XSX F;  2GXB A;  2EV0 A;  1SFX A;  3GFJ A;  2FNA A;  2EJR A;  5BPI A;  1GHC A;  4PGG A;  4M6X A;  1YW7 A;  2AXL A;  5DV5 A;  3I4P A;  1Z05 A;  4N0B A;  1XSX A;  3KP5 A;  2VBX A;  4K2E A;  5LHI A;  3BJ6 A;  1SD7 A;  2MH2 A;  1LB2 A;  2PEX A;  4P96 A;  3EYI A;  3SFZ A;  4ENJ A;  1RUO A;  3F22 A;  5FLX Z;  2NNY A;  3DEU A;  4IRI A;  3HUG A;  1KU2 A;  1ON2 A;  5JVT A;  1QNT A;  3CDH A;  2QYO A;  1ZGA A;  3M8E A;  3NRV A;  2RDP A;  3KLO A;  1IXC A;  4RB1 A;  3MZH A;  3FXU A;  4IF4 A;  1TBX A;  3F21 A;  1F1Z A;  2OD5 A;  1MZB A;  1FBQ A;  2F5F A;  2NNN A;  4UVB A;  1WSU A;  4KN7 X;  1GXP A;  4NB5 A;  2DQL A;  4A2U A;  4G6Q A;  5CVI A;  2VBZ A;  4HLX A;  3LA7 A;  4KIB A;  4HW0 A;  4HX7 A;  3VOD A;  1UHM A;  3ABU A;  1XCB A;  2F5E A;  5F64 A;  4WWC A;  2HWV A;  4I0B A;  3HTU A;  1ULY A;  2L4A A;  2NAZ A;  3DFG A;  2V9V A;  3JSP A;  1ZN2 A;  4I01 A;  3VEP A;  1B9N A;  3WTT C;  1JHH A;  1FNN A;  1IZ1 A;  4HQE A;  3E6D A;  2YPR A;  1PP7 U;  3QOP A;  3VFZ A;  2MBF A;  3QPH A;  3F8C A;  5IT9 K;  1X3U A;  3H3U A;  4B09 A;  2M1B A;  3HSR A;  3I71 A;  4CXF A;  3P9I A;  2VXZ A;  1ZG1 A;  3N4M A;  4FHT A;  5E8G A;  1YTY A;  2K02 A;  2VOO A;  2QVO A; 
#chains in the Genus database with same CATH topology
 4CYC A;  3FK6 A;  5E8I A;  3I55 I;  1IDY A;  1R58 A;  3VSK A;  1XGO A;  2M9H A;  3BZK A;  2GIZ A;  4KIT B;  3WTX C;  1QHG A;  4P9U A;  1YX5 A;  1IW7 F;  2F5D A;  2IAI A;  5HLG A;  4QWQ A;  4CYC B;  2R5Y A;  2HEO A;  1HBX G;  4A3G J;  2ESN A;  2K27 A;  3FX3 A;  2V6C A;  5EJC A;  2QBY A;  3HOZ J;  4D7N A;  2J5P A;  1LDD A;  1XGN A;  3CME I;  1R00 A;  2FX0 A;  1RKW A;  2R5Y B;  1UHW A;  2BW3 A;  2NVQ J;  2MA3 A;  2NS8 A;  2BZT A;  2QBY B;  1OCO H;  2JPC A;  3K7A J;  4HPQ A;  2EIM H;  2W00 A;  2E7X A;  2LMD A;  3QQA A;  1F43 A;  3MKL A;  1TNT A;  2DJN A;  2OJE D;  3WG9 A;  2A07 F;  2BW3 B;  3HXL A;  1NH3 A;  1UEL B;  5FRM A;  5J8C A;  3P9C A;  2EZI A;  3R61 A;  3I56 I;  2OTJ I;  4L9N A;  4C3H J;  4IOC F;  1JUP A;  2L7M P;  4ZH4 F;  3Q9V A;  1I50 J;  3H5N A;  2DI3 A;  5L3D A;  3TO9 A;  1IO2 A;  3ZMT A;  1FP1 D;  3WOD F;  3SYT A;  5L3C A;  2FRH A;  1BL0 A;  4KUM A;  3DBR B;  2O8K A;  2XPV A;  4BL0 B;  5IP9 J;  4RBO A;  2AS5 F;  3BG6 A;  3CCE I;  4AIJ A;  1S7E A;  4ZZL A;  2HQN A;  5HDN A;  2XHK A;  5K5R A;  4UVC A;  2XGX A;  4LJZ F;  2DLL A;  4IJA A;  1TTY A;  3Q0W A;  3IRR A;  1D8J A;  5EGO A;  2KIF A;  5ICC A;  2V1U A;  3OR2 C;  1Z77 A;  3H5A A;  4IHS A;  4YFK F;  2HOA A;  1VQ9 I;  2QQ9 A;  3DEE A;  3WGG A;  2B63 J;  2JRT A;  1HF0 A;  4Q5S F;  4NQW A;  4PFP A;  3DKY A;  2M0C A;  1RKT A;  3PSI A;  3WG7 H;  1H8A C;  2L9N A;  4M3E A;  4EV0 A;  1MD0 A;  3CLO A;  2DK5 A;  3K1N A;  2XVC A;  3QP6 A;  4BJ5 C;  3ISP A;  2K86 A;  5D8K B;  5K7H A;  1SAU A;  4FET A;  4NQW B;  4M71 A;  4U7B A;  3EDP A;  3KP2 A;  3K2Z A;  2XSD C;  1Z67 A;  4HDU A;  2JA5 J;  3H36 A;  5FGM A;  2ZJR F;  5E3N A;  5F1R A;  1YG2 A;  2Z16 A;  5B1B H;  2G7H A;  3PIP F;  3E0J B;  1AKH B;  4RAG A;  1GV5 A;  3U2R A;  3Q3S A;  3RPU D;  2XGE A;  3C7J A;  3M8J A;  3ZRG A;  1BI1 A;  2LFB A;  3SZT A;  2CQX A;  2WA0 A;  1UMQ A;  2Y0M A;  1YI2 I;  2DT6 A;  3ZN0 A;  4KMF A;  4GYG A;  3IKV A;  2R7U A;  3EUH C;  4DGW B;  2W82 A;  3I0T A;  4PSX A;  3HKZ N;  3SJM A;  4DOZ A;  4G7H F;  1JGG A;  3HBL A;  1WI3 A;  1I27 A;  4MIM A;  4A0X A;  3MQ0 A;  5C44 J;  3RZO J;  3V7C A;  2P6T A;  3F9K A;  1YW9 A;  1T98 A;  4L5I A;  3CCL I;  1IJW C;  1HCR A;  4MFE A;  2KRF A;  2Y75 A;  2XDV A;  2IGN A;  2JVG A;  2ZXJ A;  2EFO A;  4Z2Y A;  4IL6 C;  2K5C A;  1T6S A;  2QA4 I;  3K4B A;  2Y9Z A;  1VQO I;  5F08 A;  2YUS A;  1YIJ I;  1VQ4 I;  1ZRF A;  2DA4 A;  2DOE A;  3E6M A;  4IO9 F;  2PI0 A;  3D5L A;  1AOY A;  2A68 F;  3Q0U A;  2DPD A;  2EZH A;  2GQQ A;  4Q47 A;  5A2Q Z;  1R22 A;  2KIS A;  3Q9S A;  4Y3O A;  2ZNZ A;  1FX7 A;  2COB A;  2MLK A;  4BXF A;  1WJ5 A;  4XKB A;  1ACI A;  1KU9 A;  1SVO A;  2FBI A;  2EBI A;  2X4H A;  1QRY A;  4Y15 A;  2R7Q A;  1MH3 A;  4F55 A;  5D5V B;  5CQE A;  1BA5 A;  2JPB A;  3VWB A;  1R1U A;  2G0E A;  3ZQI A;  2KJB A;  3KIO A;  3OYA A;  2L9S A;  4UUS B;  2DYS H;  3BG7 A;  4DYC A;  4WX9 A;  4N4O B;  3ZCO A;  1FOX A;  1BI2 A;  1QPI A;  1WQ2 A;  4E4H A;  1R4N B;  4KDP A;  1P2F A;  4EJO A;  1X4P A;  1DUX C;  3I5U A;  4ZYH A;  1QA6 A;  1Z21 A;  3ZOB A;  3TQN A;  2LNB A;  4CSW A;  2CH0 A;  3QYE A;  1B8I A;  4FE4 A;  3I9V 2;  2VC0 A;  4M74 A;  1TT5 B;  4BY1 J;  2OC6 A;  3LSG A;  3HZJ A;  2HVQ A;  5LHH A;  2KDZ A;  3H92 A;  3BPX A;  3KET A;  4BAC A;  1S7O A;  2HQA A;  1B8I B;  4HNV A;  3E5U A;  3MAJ A;  3DU6 A;  2DDB A;  3LL7 A;  4BBS J;  3QYB A;  2BOL A;  4I99 C;  1MMA A;  3COA C;  5AIQ A;  3Q0V A;  4IHY A;  1LEA A;  2D1H A;  2EPF A;  5F04 A;  1MSF C;  2DAO A;  1D8K A;  3GZ6 A;  4RB2 C;  3BG3 A;  1F4K A;  3J81 K;  1NG7 A;  2FE3 A;  2Z99 A;  4YG2 F;  4D9J A;  3A0B C;  3DF8 A;  5H2F C;  1WRJ A;  3BDD A;  5FB2 A;  3C2G A;  2R7O A;  5J4Y A;  2WB1 N;  4UB6 C;  3DLL F;  2P0W A;  1OFC X;  2L4M A;  3RPQ A;  3K4C A;  3DKX A;  3BPV A;  3VYU B;  5DM6 F;  2MD0 A;  5HLI A;  5LEK A;  1X3Z B;  2X1C A;  3BTI A;  3CJR B;  2QF7 A;  2TCT A;  4KIC A;  5E1W A;  1U78 A;  2IW5 A;  1Q1V A;  2O8X A;  4L9T A;  2LYC A;  1IXR C;  4A3J J;  4OAY A;  3BWG A;  3ZMZ A;  2OU2 A;  5IOY A;  4Y17 A;  5AIP A;  3VOE A;  1FIP A;  3CUO A;  2W84 A;  2QUF A;  3GFM A;  4DIQ A;  1VFC A;  4XK4 A;  5JFR A;  4BUP A;  1UJ8 A;  3S3O A;  1IC8 A;  1PJR A;  1B1B A;  3HOV J;  2OUM A;  4M9Z A;  1I1G A;  3MN2 A;  2HKX A;  3LSH A;  1J75 A;  2LY1 A;  4UUV A;  3QPT A;  4XLP F;  2LR8 A;  1E17 A;  4KT5 C;  2E2J J;  3RKQ A;  5BPD A;  2CV0 A;  3FM5 A;  5JLW A;  1CF7 A;  4KFC A;  1XG1 A;  2FXA A;  1ZYR F;  2RVC A;  3H1C A;  2XPW A;  2LLK A;  5TGT A;  4P9F A;  2HOS A;  5LGN A;  4CA0 A;  4N9H A;  1WFX A;  2OPT A;  1Y1W J;  4KNY A;  1XS9 A;  1EA3 A;  2X48 A;  3OV8 A;  5M3M J;  4XRF A;  2HR3 A;  2EH3 A;  1TP4 A;  3QOD A;  3LSR A;  4EM1 A;  1YHQ I;  1JXS A;  3FM3 A;  1ZAO A;  2KZV A;  4OOI A;  1FJL A;  3OWT A;  3IKT A;  4I98 B;  3GTK J;  2JN6 A;  3I59 B;  5J6X A;  3G2B A;  3L9F A;  2Y2Z A;  1BIA A;  3L2W A;  3EUH A;  3W3C A;  5J1R A;  2IRF G;  4WXD A;  1XDS A;  4B4C A;  4GFB A;  2BY1 A;  2DFE A;  3TW6 A;  2QLZ A;  4FTH A;  4G7Z F;  2R7S A;  3J7A O;  1EH7 A;  4EGY A;  2FF4 A;  2F2E A;  2Y30 A;  2Z3Y A;  4A3I J;  1X1C A;  4MFD A;  3H3V K;  2IT0 A;  2JWT A;  5FKN A;  3G4S I;  3S93 A;  3BP8 A;  1JUM A;  1G3S A;  4PJ0 C;  1FPQ A;  5FKL A;  1QVU A;  4KIF A;  1I3A A;  5LRR A;  3SHF A;  4F7Z A;  4M73 A;  4KJZ A;  1QPM A;  5D5U B;  5DCM B;  3NEU A;  4AYB N;  1PUE E;  2ICW G;  4ZYA A;  1FEX A;  3F8N A;  3ZMU A;  4R8H A;  1Y8R B;  4P55 A;  3FDY A;  3HB9 A;  1KQ8 A;  2W25 A;  2E1N A;  2QQ8 A;  2PFB A;  3KLN A;  5D5X B;  2ZO4 A;  1UFM A;  2K9S A;  2V1X A;  3FHZ A;  2DTZ A;  1BJZ A;  1S72 I;  2VXD A;  2EFQ A;  1PP8 F;  3H9Q A;  1YS7 A;  5FJ8 J;  2DCE A;  4U87 A;  4ZDO A;  3VDX A;  1HKT A;  2P6S A;  3IH4 A;  3H0G J;  2LP0 A;  3CQZ J;  3K0L A;  4M6V A;  4HF2 A;  4OIO F;  2JQ7 A;  4G9Y A;  2ACJ A;  1G6N A;  1XTA A;  2FU4 A;  3VB2 A;  1D0Y A;  4RGX A;  3A1Y A;  2ZME A;  3SZG A;  2NVT J;  2JUC A;  3KPH A;  4CCL A;  1FZP B;  1K83 J;  4BJ6 C;  4MQ9 F;  1U8R A;  2RGV A;  1JE8 A;  2UXN A;  3FIS A;  4AUX A;  3FWE A;  4Y52 J;  4LMY A;  3ZQG A;  3GTM J;  1O4X A;  4RS8 A;  3OSF A;  1E3P A;  3S14 J;  1VND A;  4I09 A;  5DYM A;  4CO8 A;  1N75 A;  2AQF A;  2ZME B;  3CCR I;  3NWS A;  2XV4 S;  1VQN I;  4XRM A;  3MZ8 A;  4AIH A;  1H89 C;  5GTI C;  3MCZ A;  3CTA A;  1QGP A;  1LVK A;  2BBY A;  3ABK H;  5IYC J;  3KYC B;  2IVM A;  4LK1 F;  1OYY A;  1YW8 A;  4ENM A;  2PMZ A;  2KQR A;  3K6G A;  1JKQ C;  5L3F A;  2KFD A;  1IDZ A;  2XPU A;  2O03 A;  4Q48 A;  2CYY A;  4I7H A;  3ZR8 X;  2L54 A;  4JX4 A;  4LB5 A;  3S1Q J;  4GDF A;  2RKH A;  1R49 A;  2K9M A;  3GTJ J;  4IHX A;  3S17 J;  2P5V A;  4CUG A;  3BR6 A;  3CLQ A;  3F72 A;  4BKX A;  1G2H A;  2MSY A;  1SMY F;  5CVU A;  4PJN A;  4ZC3 A;  3ERE D;  4HAM A;  5LGU A;  1IF1 A;  4MTD A;  3GCM A;  5EF6 A;  3RJP A;  3OL3 A;  2BE5 F;  4DBQ A;  2HDD A;  1K6Y A;  1BOA A;  1FOY A;  1ZG5 A;  3HPG A;  1IN5 A;  2H6B A;  3BRO A;  2DFI A;  4XL9 A;  2DQR A;  3BR2 A;  3VYS B;  1JHF A;  3ASN H;  2M87 A;  3BTL A;  4UVA A;  1W0T A;  1JTX A;  1YOV B;  4OIR F;  2MH9 A;  2P8T A;  5L3B A;  4M72 A;  4M6Y A;  1DGR M;  3WTW C;  2FBH A;  1XMK A;  3LFU A;  1Y0U A;  1UHS A;  3L00 A;  4W97 A;  3GBG A;  4JP0 A;  3ZPL A;  1K79 A;  2CU7 A;  2CUE A;  2FD5 A;  1T0F C;  4MHG A;  3WTS C;  4BHB A;  1OCC H;  1I39 A;  1TW3 A;  2JA7 J;  4N4N B;  4LLN A;  2GWR A;  3CCU I;  1RI7 A;  5GPC A;  4XID A;  1KYW A;  3HRU A;  2F4M B;  2D2W A;  5KK1 A;  1TQI A;  1UCR A;  1Z6T A;  5FO5 A;  1R4M B;  2H1L A;  4G12 A;  2CW8 A;  2NS7 A;  1NTC A;  4LOC A;  3E3V A;  1IV8 A;  3R6S A;  2VPL A;  1FIA A;  1A04 A;  1LPQ A;  1GLN A;  2VQL A;  3T5X A;  3GTP J;  2XRL A;  3KP4 A;  2QQA A;  3ELK A;  4LK0 F;  2ADU A;  2P5K A;  3HRT A;  4HNT A;  4DYR A;  4IOA F;  3HRM A;  2FBK A;  5FD6 A;  3A03 A;  1WGX A;  4PJL A;  2WAD A;  3RPU A;  2ISZ A;  4ON0 A;  2COM A;  4PJJ A;  5IY5 H;  2VC1 A;  3BCA A;  4Y4R A;  1J2X A;  2VIX A;  3T1B A;  1E3H A;  4XOT A;  1ERD A;  2DFF A;  3OYK A;  2JTV A;  4BQN A;  1T39 A;  3HOU J;  5LD2 C;  4V2G A;  1SD4 A;  3SDB A;  3V8J A;  1A5J A;  1FTT A;  4QPQ A;  3O8H A;  4JBA A;  2CSO A;  3BY6 A;  1GXQ A;  2H27 A;  1W4M A;  1NHA A;  1G4D A;  4KIG A;  4BHC A;  3NAR A;  4E70 A;  4LG0 A;  1I6X A;  3OYL A;  3CF5 F;  2Z33 A;  3SZP A;  3IRQ A;  3OS1 A;  1X19 A;  1HA8 A;  2M30 A;  4AU7 A;  2A5W A;  2CO5 A;  3GFL A;  1ZGJ A;  2VJ4 A;  2L0K A;  3D0S A;  4LG0 B;  2UWM A;  1T08 B;  5HLT A;  1MJA A;  3L7W A;  2VJI A;  5KVR A;  2W24 A;  3TO7 A;  4X0G A;  1BI3 A;  3QRF F;  4AD9 A;  4RA2 A;  4YRV A;  5C3E J;  3ML6 A;  3CCQ I;  2HTJ A;  2HYG D;  3CCY A;  4LLL A;  2XRN A;  1ON1 A;  1OQY A;  4QTR A;  4HOB A;  2UZK A;  3IWZ A;  4GCV A;  2XSJ C;  1YJN I;  1JT0 A;  1V4R A;  3L09 A;  3A2K A;  1LUJ B;  4NC8 A;  2Z2S B;  2X0L A;  1R5G A;  3ZP5 A;  2YU3 A;  3PFY A;  1YRN A;  3LOC A;  3IAM 2;  2BVM A;  3JTG A;  2MYS A;  5HDG A;  4L5J A;  1Z91 A;  2XAJ A;  2YX7 A;  3HIF A;  1OLT A;  3K4J A;  2OF7 A;  3HOY J;  3IC7 A;  1YRN B;  4RB3 C;  2X6X A;  3ONQ A;  2BY0 A;  1OMI A;  4NBQ A;  5ILV A;  1R71 A;  3S1M J;  5K7F A;  4P5O A;  5DUI A;  3AG2 H;  2H94 A;  4NC6 A;  1WH5 A;  4UNO A;  4HX4 A;  4B43 A;  3G73 A;  1P7J A;  2DYR H;  3M7G A;  4D5F A;  1VQ5 I;  1ZH5 A;  4WF2 A;  4A69 C;  4GRI A;  2VLA A;  1Z7L A;  3W2A A;  5CVJ A;  1LVA A;  2MLG A;  1F9N A;  3AG1 H;  2VKH A;  4MTE A;  2CWE A;  2NVU B;  4C9Y A;  1YE9 A;  3JRE A;  1UB9 A;  4EJV A;  1SFO J;  1W36 D;  2OZ6 A;  2PMU A;  1T2K A;  2IS2 A;  3VSL A;  2VE8 A;  4YFX F;  3CC7 I;  1O7F A;  5ICE A;  3TGN A;  4CDG A;  1RUN A;  4B47 A;  1G8X A;  5GP9 A;  2CUZ A;  2FQ4 A;  2X6W A;  2KDO A;  2E2I J;  1VQ8 I;  3IV5 A;  1EH8 A;  2JSP A;  1FT9 A;  1ZLK A;  4C2M J;  1JUS A;  1GV2 A;  4XBF A;  1Y39 A;  4BAY A;  2ELJ A;  4ESF A;  1IN4 A;  4OU0 A;  4U7D A;  1XSD A;  1LQ1 A;  2O0Y A;  3OYG A;  5F1J A;  2GM4 A;  1MBF A;  4DW6 A;  3PO3 J;  3CC2 I;  2JUG A;  4XM3 A;  4E7Z A;  4X1E A;  5A2Q K;  2GA2 A;  4FQG A;  3OMY A;  1OJL A;  3BJA A;  4Q4Z F;  3JRH A;  1AHD P;  1NK2 P;  4E7K A;  3CZ6 A;  2C6Y A;  4Z6Y A;  2DA7 A;  3KCC A;  3FXO A;  3RTR A;  3H35 A;  2EB7 A;  1U0J A;  4A0Z A;  3ZQQ A;  2QEX I;  1VF9 A;  2EA2 A;  2CUJ A;  2CV2 A;  2L7K A;  3IL2 A;  4A12 A;  1T0F A;  1PDN C;  2Z1D A;  4WXC A;  2IA0 A;  1MJB A;  2NOG A;  3MKW B;  2M0M A;  5TRD A;  2DU9 A;  2LY2 A;  3SEZ A;  1LE8 A;  3FIW A;  2H6C A;  2XB5 A;  2F48 A;  3R0A A;  2ZJQ F;  3KP6 A;  1LDK B;  2LKP A;  4MO7 A;  2O6G E;  3JR9 A;  4I6Z A;  1SMT A;  3ZN1 A;  1IN6 A;  3SXY A;  1LE8 B;  5JVG F;  3LA2 A;  1XGS A;  3H9G A;  2XIG A;  2TDX A;  4PUS A;  2R7R A;  1FBU A;  3DTI A;  3LMM A;  3CJT B;  4F92 B;  2Y0S N;  3I54 A;  3IWF A;  2B0L A;  4EM0 B;  2HYF A;  4BXX J;  2RRE A;  2ID3 A;  3EET A;  1Y1V J;  3PNT A;  2M4K A;  1W1W E;  3BLY A;  3LSI A;  1O7L A;  2QGU A;  4E7S A;  5D4R A;  4HA8 A;  1HQC A;  2JA8 J;  3ULQ B;  3G1O A;  2GOM A;  4HLY A;  3LAP A;  4BXU A;  2OV7 A;  2BXY A;  2XAG A;  5EGO B;  2VKD A;  4B44 A;  1BR1 A;  2VUM J;  4KT6 A;  3LWF A;  4NUB A;  1KA8 A;  1QU3 A;  3U1D A;  2XKP A;  1LKX A;  4DZJ A;  4IHV A;  3H0D A;  4HBL A;  4JK1 X;  1K4T A;  4RMN A;  3SQN A;  1STZ A;  1UAA A;  4ESB A;  1SD6 A;  4OIP F;  4HX8 A;  2H1K A;  2HQ5 A;  2D1V A;  3TP3 A;  1ZRC A;  2X1E A;  2IGM A;  1O3Q A;  1XB4 A;  3MMY B;  1H9T A;  5KAI C;  3A01 A;  3DTE A;  1KGS A;  3K9T A;  4AM3 A;  2H8R A;  4FIS A;  2NVX J;  2QKM B;  3WGH A;  3V4G A;  5EDN A;  2DPU A;  2OA4 A;  1OR7 C;  1NG6 A;  3UR3 C;  2O61 A;  2KL4 A;  1W7P A;  2PBI A;  5JI6 A;  3M07 A;  1BW6 A;  3QU6 A;  3BOQ A;  3BJO A;  3W2V A;  1EV7 A;  3ZQH A;  3PFI A;  1CGP A;  4CCN A;  2BGC A;  1OYW A;  3RQI A;  1K4S A;  3CES A;  1XMA A;  5ICF A;  4IZZ A;  1U5T C;  2DA5 A;  2A61 A;  3N05 A;  3CCJ I;  1T56 A;  3T8R A;  2I10 A;  2HI3 A;  3B6A A;  4LD5 A;  3HTS B;  4OIN F;  4BDZ A;  2VB6 A;  2EV6 A;  3WTV C;  4NHJ A;  3WHC A;  5JLX A;  3KZY A;  3FMQ A;  3DBL B;  1BC7 C;  5CVR A;  4FX0 A;  2ETH A;  3ABM H;  5GTH C;  1G3Y A;  5IT9 Z;  3N97 A;  1GT0 C;  4C2U A;  2EIL H;  2HS5 A;  2VQH A;  4OWR B;  3IHU A;  3MKY B;  3JTH A;  1W5S A;  1FSE A;  1O3S A;  2IS6 A;  1VI0 A;  2NYX A;  2W7N A;  5DD4 A;  3ECO A;  3KZI C;  1K78 A;  3F6O A;  1OCZ H;  4G7O F;  3OYN A;  4XLE A;  4M3F A;  4RAY A;  5FRO A;  1SFU A;  1TWF J;  5EEA A;  5IYB J;  4XQF A;  4DYQ A;  2NOJ B;  5BQT A;  3ESW B;  2VJJ A;  4GO1 A;  2GA1 A;  2LG4 A;  4D0P A;  2YSR A;  4TV7 A;  2EZL A;  3E6C C;  1W36 C;  2P4W A;  2MD5 A;  4GGG A;  3CD6 I;  1H0M A;  3C3W A;  1YIO A;  4RLF A;  4XIC A;  3CMA I;  3EUK L;  5BOX A;  1TLH B;  2VOP A;  2PN6 A;  3BZC A;  2FA5 A;  1N77 A;  4A6D A;  2R7V A;  1TWG J;  2IJL A;  3OYC A;  1PYV A;  4UV8 A;  2F5C A;  3PJR A;  3M8F A;  2FOW A;  1M1E B;  1QQI A;  1MMS A;  3FBI B;  3CUQ C;  5DM7 F;  5TIS C;  3QYF A;  3E1S A;  1QBJ A;  2GXA A;  2ZME C;  4BJT A;  1J09 A;  2FQ3 A;  1OYI A;  2IGK A;  5FLM J;  1V54 H;  3DV8 A;  1ZLJ A;  1B72 A;  2EV5 A;  2IXS A;  4XLN F;  3V7S A;  2P81 A;  1LFU P;  1FLI A;  3TDZ C;  5CVV A;  1R9T J;  3BG9 A;  3HM5 A;  1MMD A;  1B72 B;  2PMZ N;  1SFE A;  1MDM A;  1S8N A;  2JT1 A;  2Q8K A;  3S2W A;  1Z9C A;  3S16 J;  1D1A A;  5CLS A;  3S1R J;  2DA6 A;  3K10 A;  2LRE A;  1RR8 C;  1RRJ A;  5GPA A;  4WXH A;  4C30 A;  4I76 A;  1EH6 A;  1USS A;  3E6B A;  3OS0 A;  1DPR A;  1Z7U A;  2JSC A;  2HPI A;  3L2R A;  4A6E A;  2EIN H;  1RC9 A;  1ZR4 A;  2JRM A;  2BV6 A;  4HF1 A;  1XSV A;  2IA1 A;  3DTK A;  1I3Q J;  2A3S A;  5KNL A;  2OTL I;  3GTL J;  4F91 B;  1W5T A;  2ZSI B;  2OAZ A;  4ENK A;  1XN7 A;  2FMY A;  1A31 A;  1BIB A;  2EFP A;  1R1T A;  3B73 A;  3K4L A;  3K1M A;  4H4K C;  3OYE A;  1FYK A;  3S2H J;  2E1O A;  2QM3 A;  3HRS A;  4ITV A;  2CQK A;  1K6O A;  1MGT A;  5DUK A;  1LEB A;  1BR4 A;  1YIT I;  3BCB A;  3L2U A;  1FOW A;  3DKW A;  3HDD A;  1OCP A;  4PZJ A;  5J4V A;  1C0W A;  3RIR A;  2R7T A;  2AHQ A;  1E2X A;  1G59 A;  3BQY A;  5K1Y A;  3OOP A;  5CYV A;  2AO9 A;  2P7V B;  3HHH A;  4MQV A;  1Z6R A;  3TL4 X;  4XKC A;  3PO2 J;  3CC4 I;  2WWY A;  1HST A;  2WV1 A;  3TW7 A;  3CO7 C;  3OYD A;  4UXN A;  5J1U A;  1HW2 A;  4XOP A;  5FFX A;  1WJB A;  5J3L A;  4PCQ A;  1CF7 B;  1OR7 A;  2IP2 A;  4P1W A;  4XN3 A;  3FKI J;  1X1P A;  4CCK A;  2F5V A;  1S9H A;  3EQL F;  5BMZ A;  2FUG 2;  2XAH A;  3ZGK A;  3IP4 B;  1U6G A;  4XRS A;  2DT5 A;  1K61 A;  3S15 J;  1JKR C;  3QP5 A;  2D45 A;  2R0Q C;  1DU6 A;  1AU7 A;  1DQU A;  3CJN A;  1MND A;  2HTS A;  2LDU A;  2X6Y A;  3B02 A;  2HPM A;  3F23 A;  3PQJ A;  1EJ9 A;  4BDY A;  3Q5F A;  1U5T A;  5F0C A;  2KLO A;  3HOT A;  1BBY A;  3CCS I;  4EJT A;  2Q1Z B;  3GYH X;  2MG4 A;  2L3D A;  1W5C C;  4KA4 A;  5FLX K;  1V5E A;  2KRC A;  1D5V A;  2M34 A;  3I3L A;  1U5T B;  1CQT A;  3IH3 A;  2WV0 A;  2JK3 A;  2VE9 A;  1Z3Y A;  1WPK A;  2OBP A;  2XB0 X;  2ZFW A;  3KP3 A;  4AID A;  3DWL E;  3OS2 A;  4RB0 A;  2DOD A;  3ZQF A;  5IP6 A;  3RYR A;  5LBQ A;  2VL8 A;  1KQ0 A;  5HDK A;  2L5Q A;  3HOW J;  2CG4 A;  1W7P D;  2W1O A;  2XKO A;  4RDU A;  1ZTR A;  4CYD A;  4E6K G;  2HZT A;  4IPA A;  3C2B A;  3V42 A;  1FC3 A;  1X1D A;  2VJ5 A;  3W2W A;  5K7Z A;  2ME0 A;  5E1X A;  4LB6 B;  5TJJ A;  4E7I A;  4AIK A;  1EF4 A;  1G3T A;  4HG2 A;  1TWA J;  1RPW A;  2VT2 A;  3D5R C;  2E1M C;  2H8W A;  2KMU A;  5E79 C;  3BG5 A;  5E3M A;  3L1P A;  3CO6 C;  3TBI A;  3TOA A;  2R7X A;  2GOX B;  1OCT C;  1Y8Q B;  4QIW N;  2O7O A;  3DPL C;  3GZN B;  3DQV C;  3LSP A;  1Z3X A;  3MFK A;  1KZH A;  4N9I A;  3JAM Z;  2CRG A;  5E3O A;  3TO6 A;  1ONV A;  2CGP A;  3CUQ A;  2DW4 A;  1LJ9 A;  3FXK A;  4GYI A;  2BY2 A;  1R23 A;  1ETO A;  5FFZ A;  2PMH A;  3HC7 A;  3HG9 A;  5DDG A;  2A6H F;  2Y9Y A;  5JHU A;  2K40 A;  1DGW Y;  2PQ8 A;  1O57 A;  3FMS A;  5C4J J;  1PVE A;  1HDD C;  2LTP A;  3CUQ B;  3LST A;  1MJ9 A;  2Y31 A;  3LSK A;  2JMW A;  2DO7 A;  3WE3 A;  3J80 Z;  2H09 A;  5C4X J;  3S3M A;  2PJP A;  3VPR A;  1IRF A;  1YLF A;  2K3F A;  2R4G A;  2RQQ A;  3GZ5 A;  1N78 A;  4IEJ A;  2X1D A;  3CJQ B;  4V19 K;  1R7J A;  3ZMS A;  3MZY A;  4BYY A;  1Y6I A;  1UST A;  5F0F A;  4XNF A;  2BHY A;  3TP0 A;  2HZD A;  2GAU A;  2A6E F;  4XON A;  1MBE A;  2XF6 A;  4LFU A;  5DD8 A;  4F93 B;  2TRT A;  4XSZ F;  4ZJZ A;  2MAB A;  5JR3 A;  1P6R A;  2RQP A;  3BR1 A;  3GME A;  3S2D J;  5LGT A;  5EZH A;  2FJ1 A;  1TC3 C;  1ZQ3 P;  5E20 A;  2E60 A;  1D5Y A;  2L7F P;  4CCO A;  3W6K B;  1P4X A;  3JRB A;  3AG4 H;  5JHF A;  4UV9 A;  2M8E A;  2BY3 A;  4PJM A;  3TDU C;  3LQR A;  1KU3 A;  2BXZ A;  1I5Z A;  3BTC A;  3EUA A;  3ERM A;  4IHW A;  2E2H J;  2QKL B;  4CIC A;  1BI0 A;  4A3M J;  2EIJ H;  4O5V A;  3GXO A;  2DMP A;  2WB1 A;  1MIJ A;  3BC8 A;  2RNG A;  3PM1 A;  3E97 A;  2OQG A;  5L3E A;  4S04 A;  4RGS A;  1B59 A;  3G71 I;  2HFH A;  1U9O A;  1XCV A;  3WU0 A;  3S32 A;  6PAX A;  4IRH A;  5E3L A;  3VYT B;  3ABL H;  4EMS A;  1L0O C;  1KU7 A;  2OCC H;  5D6F A;  2DFH A;  5DS9 A;  2R93 J;  3C1D A;  2P5L C;  4B3X A;  3O8G A;  2MGQ A;  3I4N J;  2XGC A;  5B66 C;  4EVI A;  5B5E C;  1ZHF A;  3V8K A;  3PNY A;  5LLQ A;  4BEH A;  4YII A;  1QVT A;  1YJW I;  1R36 A;  2NVY J;  2VQG A;  1VQP I;  3EYY A;  1HW5 A;  2K7L A;  2CW7 A;  3T0Y A;  1T38 A;  3AG3 H;  4MLO A;  4BNC A;  3G6E I;  4AVP A;  2CUF A;  4U88 A;  2DMT A;  5D5W B;  1POG A;  2IPQ X;  3GTO J;  5F0H A;  2LVS A;  4HQM A;  3QPL A;  4JX5 A;  3HHG A;  1SVL A;  3OOU A;  1X4O A;  2Y69 H;  3CP8 A;  1FWZ A;  4ZZD A;  3UKG A;  1J59 A;  4IKF A;  5BNG A;  1MMN A;  3BT9 A;  1IRX A;  1YFH A;  2WAQ A;  3DPT A;  1WJA A;  3HOX J;  4MGR A;  2Q2E A;  2V9K A;  1F5T A;  3TKY A;  1S3J A;  3QU3 A;  1B6A A;  3L2C A;  2E34 A;  4YEL A;  1HDP A;  2BEO A;  4A3L J;  1MSE C;  1TNS A;  2M2E A;  2K3P A;  1FYL A;  3K70 D;  2Q2E B;  2KZG A;  2LC2 A;  5E17 F;  4II3 A;  2K4J A;  2V9P A;  2XRO A;  4I02 A;  2LF7 A;  4XLF A;  4FE7 A;  1ZRE A;  1FP2 A;  4DZP A;  5HS7 A;  1RIO H;  2X6O A;  1KON A;  1VZ0 A;  1SEU A;  3MWM A;  3OYJ A;  5DCF A;  4L0Y B;  2XUB A;  5CJ9 A;  1D3Y A;  3W6J B;  3HSE A;  1D0X A;  1P7I A;  2X9D A;  2HXI A;  3OL4 A;  3AFH A;  1ETK A;  1RES A;  2HKO A;  3RI4 A;  5IPA A;  2EFN A;  2Y48 A;  4NNJ A;  4KN4 X;  1YS6 A;  2F6C A;  4KYW A;  2V4J C;  3AKZ A;  1MMG A;  3ZQC A;  5DTD A;  4A3B J;  3M1C A;  1T33 A;  4RAZ A;  3FXJ A;  4LGW A;  4UHT A;  2E1M B;  2CMP A;  1AWC A;  5E1Z B;  1S5L C;  5H6Q A;  2V7F A;  3CF2 A;  3WU1 B;  4F3Q A;  4XKW A;  1ODD A;  1JGS A;  1T95 A;  1FOK A;  4L0Z B;  4KIS A;  1RR7 A;  4ZYG A;  1VQL I;  2DOF A;  5D6E A;  4DNC A;  5FKO A;  5E18 F;  2NRA C;  1GVJ A;  4X6A J;  1WKM A;  2EA4 A;  1VQK I;  4DJA A;  2G9W A;  4R79 A;  4HV5 A;  4ZYD A;  4F52 A;  2LD5 A;  1ZAR A;  1Y56 A;  1MBK A;  2E1C A;  3CMY A;  4RGR A;  2KIQ A;  5FD5 A;  3I58 A;  1RZ4 A;  2AXT C;  5ED4 A;  3PSF A;  5HOO A;  3GFI A;  2DTR A;  4W1U A;  4A5N A;  4DBR A;  5EEG A;  4B1R A;  4ESJ A;  3ZQ7 A;  4IQ4 A;  4WK8 F;  4QSH A;  4O6J A;  3SDG A;  1WWX A;  3F6V A;  5J8F A;  4S05 A;  2QSG X;  3FKJ A;  3JRF A;  1UG0 A;  4EJW A;  1FSH A;  2ZBK A;  1V55 H;  3CDL A;  1DP7 P;  3LA3 A;  3LSJ A;  5CPR B;  4LIV A;  1HKS A;  3JW4 A;  2WTE A;  3RZD J;  1WVR A;  3A4C A;  1V5G A;  3F8B A;  1HKQ A;  2V1N A;  3R0J A;  1J0R A;  2LBF A;  3ZMV A;  3JRD A;  4M3G A;  1UG2 A;  2QEN A;  3J7Z I;  4BY7 J;  3OSG A;  1Y0N A;  2E5N A;  2HU9 A;  4B8X A;  3K1P A;  3PQK A;  3OYM A;  3C2H A;  3FZV A;  4MEY F;  3V8L A;  3CCV I;  2RNJ A;  3WU2 C;  1G3W A;  2LBF B;  1IUF A;  2VI6 A;  2Z5U A;  2ME6 A;  1ZG3 A;  4ENN A;  2YS9 A;  2YX4 A;  4Y7N J;  3KFW X;  1TQP A;  1X58 A;  3RDI A;  3L2V A;  4D5C A;  5D4S A;  1U9N A;  5LRS A;  3H3Z A;  3H9J A;  5HOD A;  2V1D A;  2HOE A;  4AWX B;  2W85 A;  4CZZ A;  2FML A;  1IN8 A;  2LF8 A;  1ZR2 A;  2V79 A;  4I2O A;  1FY7 A;  4HRI A;  2ZFU A;  3RQ4 A;  3KYL A;  1VQ7 I;  1H9G A;  2DXI A;  2DA3 A;  5ILS A;  2N8G A;  3M1E A;  4L18 B;  2M7A A;  1FMV A;  4L9V A;  4Y33 A;  4OIQ F;  4UUT A;  3GW2 A;  1HC8 A;  1A6I A;  2DA2 A;  2EQR A;  1TQM A;  1YQA A;  2GIV A;  3GTG J;  1I6H J;  1GVD A;  3HEF A;  2IA2 A;  5J47 A;  1J5Y A;  2XAU A;  5AON A;  2EFW A;  2YU9 J;  5LFA A;  3NQO A;  3S3N A;  3K69 A;  2DMU A;  2A5Y B;  1MKM A;  2M7B A;  5KAF C;  1TZL A;  1LFB A;  1TWC J;  5B1A H;  5IOZ A;  3J7Y J;  1B4A A;  4YFN F;  2QWW A;  3GF2 A;  3WTY C;  2EIK H;  5FRN A;  4NDL A;  4AVZ A;  4IRG A;  1WZ2 A;  5IP7 J;  1U2W A;  2OZU A;  2DA1 A;  2STW A;  4WCG A;  4G8X A;  1E3O C;  4ANJ A;  4C3I J;  2PJR A;  2VOD A;  3OIO A;  2I5U A;  1QZY A;  4UB8 C;  1BW5 A;  3BR3 A;  3HJE A;  2KRH A;  2W4S A;  1WJE A;  2QZ8 A;  3K70 C;  4OMY A;  2PJR B;  1JT6 A;  2GZW A;  1X2M A;  3HYI A;  2KPM A;  3V7R A;  3GX4 X;  2FOK A;  2ECB A;  3C18 A;  2PG4 A;  3A01 B;  4BE0 A;  2LSO A;  4PGH A;  5ICG A;  1X1A A;  3AAF A;  4XMY A;  1IXS B;  4U0W A;  5LHG A;  1AKH A;  3ECH A;  2WAE A;  4OAZ A;  2JZY A;  1W7P B;  2ZXW H;  2ESH A;  4ABZ A;  1Z1D A;  2D5V A;  1OPC A;  2DT7 B;  4XOR A;  4BE1 A;  3VYR B;  3LAJ A;  1MH4 A;  2OCE A;  3K2A A;  2VBW A;  3MKZ A;  2X51 A;  3KEY A;  1IN7 A;  2ZXH A;  4FT8 A;  4L9J A;  3ASO H;  1S29 A;  2A05 A;  2O5R A;  2KKO A;  2Q0O A;  4ZTF A;  2VPR A;  2KIM A;  1HW1 A;  2WY7 Q;  5F27 A;  1I1S A;  3OYI A;  2NXN B;  1FBS A;  1R5H A;  1XGM A;  3LNQ A;  4XLH A;  4MNU A;  1ENH A;  3FMR A;  4ZDL A;  1WCM J;  3EPZ A;  3ZQL A;  4ZDP A;  2W48 A;  4ZTJ A;  2RN7 A;  3W6V A;  1O3R A;  3FHN A;  3F8F A;  3GLX A;  4CCJ A;  3IH2 A;  4G6D A;  1JTY A;  2MW8 A;  2B9S A;  2O3F A;  1XDU A;  1BJA A;  1SAX A;  5HS9 A;  1MBG A;  2IS4 A;  2KT0 A;  1SC7 A;  1ZRD A;  2R7F A;  2JVH A;  3PNV A;  2R3S A;  4LLG F;  3T8T A;  5EEH A;  3NAU A;  4V2F A;  4Y13 A;  3OYF A;  4O3M A;  3UNG C;  5GAG J;  2RAE A;  3CP2 A;  3TMO A;  4U0Y A;  1K78 B;  1J9I A;  2XGD A;  4CZC A;  4PK4 A;  2L02 A;  3ABT A;  2A6T A;  1XPX A;  3REO A;  4GXO A;  2QCO A;  4EJU A;  5M5Y J;  1TW2 A;  3S1N J;  1X1B A;  5LEJ A;  2ZNY A;  4QLC U;  3FXL A;  3LFK A;  4HZF A;  2VAS A;  3H5R A;  1ETQ A;  3O6B B;  3WE2 A;  2K9Q A;  2UXX A;  4UUS A;  4LIT A;  1XD7 A;  2VBY A;  4IX7 A;  1BN5 A;  3KP7 A;  4A0Y A;  1WJD A;  3HPH A;  1SAN A;  1WJC A;  2L7Z A;  4HEA 2;  3JRI A;  2BVL A;  2B7E A;  2CS3 A;  2DJI A;  2VQC A;  2R7W A;  2E19 A;  1VTN C;  4B3A A;  3JSO A;  3I64 A;  1RNL A;  3X2Q H;  3LQQ A;  4RAF A;  2KIU A;  1ITY A;  1REP C;  5GAD J;  2QQB A;  3GWZ A;  4KMU X;  1DDN A;  1IGN A;  2RC4 A;  1WH7 A;  5L3G A;  5K5O A;  2HDW A;  3JAM K;  3I53 A;  4IQJ A;  1S6L A;  1R1V A;  1OCR H;  3QAH A;  2M8G X;  1MDM B;  1A35 A;  5M5W J;  1XC5 A;  1U3E M;  2G7U A;  3WGI A;  3ROU A;  2HXO A;  2GXG A;  1P92 A;  1BR2 A;  5KCM A;  3I4M J;  5ERI A;  2CV1 A;  2PLY A;  3DEW A;  2K9N A;  2MC3 A;  3ZMD A;  2AQE A;  2FEZ A;  3FK7 A;  2DDA A;  1ZKG A;  1Q1H A;  2BYV E;  2KHM A;  3J80 K;  5KHD A;  1MNE A;  4BH9 A;  4EGZ A;  5K5Q A;  2XF5 A;  2Z9O A;  4FX4 A;  2HQR A;  4RGU A;  2DOA A;  2IBD A;  2GBY A;  2XAS A;  5BS6 A;  2CFO A;  3G1M A;  2L01 A;  3RCO A;  1AA7 A;  5EZG A;  2M45 A;  2FSW A;  1DPU A;  3RYP A;  2XAF A;  2WY8 Q;  3OIP A;  1E0E A;  1WI9 A;  4CHU A;  2K4B A;  2E71 A;  1SFK A;  4RLQ A;  4HV6 A;  1A6Q A;  3JCU C;  2L2O A;  3QPS A;  2Y0S A;  4CGZ A;  2CW0 F;  3F3X A;  3KEQ A;  3HSF A;  1FYM A;  5CQG A;  4HST A;  2FNP A;  2P7C B;  3DXJ F;  3U1K A;  4A3K J;  3JRA A;  2CFX A;  1HXD A;  3R60 A;  3AL0 C;  1WHU A;  3KE2 A;  2O9L A;  1J7K A;  3GVA A;  5HS8 A;  4A3F J;  3ZXS A;  4I0A A;  5IT3 A;  3MVP A;  1LNW A;  2KP6 A;  1P4A A;  3D1N I;  3KX2 A;  1BM9 A;  3P9K A;  1S7A A;  4XLC A;  3U21 A;  3F8M A;  4OMZ A;  9ANT A;  3E5X A;  3U9G A;  1ZK8 A;  3MEX A;  4HDV A;  2ZCW A;  2HYJ A;  4IHT A;  4ZYE A;  2R7D A;  2XAQ A;  4HSR A;  3HGY A;  1QZZ A;  1P9Q C;  4E7H A;  4EQQ A;  5HLH A;  1HSJ A;  1H88 C;  3FBN B;  2L9V A;  1VQ6 I;  3I59 A;  2WC2 A;  3G3Z A;  1FTZ A;  2QSH X;  1KQ9 A;  2WAQ N;  3PUF A;  5CKT A;  3WTZ A;  1IRG A;  4FCY A;  4M9X A;  2OQR A;  2HVR A;  3CMM A;  5ILU A;  2HDC A;  1QHH D;  1U8B A;  5H20 A;  4A5M A;  3FXR A;  4U0V A;  4D7M A;  4J00 A;  5HVQ C;  1OKR A;  2VT3 A;  2RV8 A;  3O2P E;  1SVM A;  4ASN A;  5M5X J;  2DBB A;  4L5E A;  3BQZ A;  3WTU C;  4E7J A;  3R4K A;  3WHB A;  5M3F J;  3L2Q A;  2IS1 A;  2MC4 A;  2ELH A;  1YX3 A;  3CDI A;  3HKZ A;  4QPO A;  1YO5 C;  4JOM A;  3HOS A;  3BZ6 A;  4XLA A;  3RKW A;  4YIF A;  1ZGW A;  4BBR J;  2ZJP F;  4R1H A;  3A0H C;  1QZE A;  1APL C;  4CCM A;  1MBJ A;  5DCM A;  3JRC A;  2STT A;  3SEQ A;  3NWT A;  1W0U A;  4MEX F;  1YYV A;  2DN0 A;  2LY9 A;  4M3D A;  3O3K A;  1UZC A;  2YR2 A;  2EK5 A;  1A36 A;  2DMN A;  4HF0 A;  2W57 A;  5HNF A;  4H0E A;  4EM2 A;  2KJC A;  3OYB A;  3KEO A;  3K4M A;  2ZKZ A;  1JKO C;  3DP7 A;  3RKY A;  5DEQ A;  1IAW A;  4IVN A;  4S0H B;  3F0C A;  3GUD A;  2A69 F;  1LDJ A;  1K7A A;  1P4W A;  3FF5 A;  1TT0 A;  2ZB9 A;  3MD2 A;  3FXQ A;  1JJ8 C;  2ZSH B;  1ORK A;  2L9R A;  4DQ2 A;  1O3T A;  1QO0 D;  2E35 A;  3GEZ A;  4PDK A;  3RSN A;  2ISY A;  4G94 A;  4AC0 A;  2J5O A;  4UY8 I;  4CH7 A;  2VKE A;  3IAS 2;  2R92 J;  1L3L A;  3J81 Z;  4BQO A;  4HYE A;  4XR6 A;  1V3F A;  2EWN A;  3E5Q A;  2M5W A;  1SD5 A;  1JKP C;  2K85 A;  4JQF A;  3DCF A;  3RKX A;  3K4K A;  2PX9 A;  3PIO F;  3TOB A;  1PUF A;  1IUY A;  3FXM A;  5F6F A;  3GTQ J;  4ETS A;  5H6R A;  2VON A;  1FMW A;  2IGO A;  4M9S A;  4J19 A;  2NS0 A;  2UUZ A;  1ZEL A;  1KYZ A;  4NC7 A;  3KZZ A;  5EG0 A;  1D1C A;  2DK8 A;  4XN0 A;  1PUF B;  3M9A A;  5D8L B;  2WBM A;  2ZJ2 A;  2QSF X;  4BQA A;  3OR1 C;  1JI8 A;  3P7N A;  2E7W A;  2MFZ A;  5EG0 B;  5EYR A;  1B9M A;  3OIQ A;  1V5F A;  3HGG A;  1T8I A;  1YJ9 I;  2V6E A;  3GO5 A;  4IXA A;  5J1Y A;  2VN2 A;  4PFO A;  4BHP A;  1BC8 C;  2HGC A;  4XSX F;  4J01 A;  2GXB A;  2EV0 A;  1MW7 A;  3GLL A;  3M4O J;  3K4N A;  2F4I A;  4BE2 A;  4HNU A;  3IUO A;  1SFX A;  1EKE A;  3GFJ A;  2FNA A;  2EJR A;  5BPI A;  2ID6 A;  3BTJ A;  1GHC A;  4PGG A;  2ZC2 A;  2JA6 J;  4FAS D;  4M6X A;  1LFP A;  1YW7 A;  2AXL A;  1ETY A;  2LRD A;  2WAF A;  3E7L A;  5DV5 A;  1NK3 P;  4A93 J;  2R5Z A;  3I4P A;  1F36 A;  1Z05 A;  4A3E J;  4N0B A;  2BHZ A;  1DP3 A;  4RM3 A;  1XSX A;  3KP5 A;  3D5S C;  3CCM I;  2VBX A;  4EAT A;  4JYK A;  5GAE J;  1GUU A;  3PL8 A;  1TL8 A;  2CJJ A;  2R5Z B;  3AL0 B;  3B6C A;  4K2E A;  4C3J J;  5LHI A;  4XRS G;  1RET A;  5B3S H;  2HNH A;  1SD7 A;  3BJ6 A;  2MH2 A;  1LB2 A;  2PEX A;  4P96 A;  3EYI A;  4BEH B;  3SFZ A;  1X3W B;  4YIR X;  4ENJ A;  1RUO A;  3F22 A;  5FKM A;  1VQM I;  4BQQ A;  5FLX Z;  3G1L A;  2NNY A;  4C2T A;  2CQN A;  5HNH A;  2UV1 A;  4D1Q A;  3BR5 A;  3DEU A;  2GLO A;  4JX6 A;  3P5J A;  2IEK A;  2DMQ A;  4IRI A;  1TWH J;  3HUG A;  4A3C J;  2M4G A;  1OIS A;  2XF7 A;  3A02 A;  1MNM C;  1KU2 A;  1ON2 A;  1IG7 A;  4A3D J;  5JVT A;  1D0Z A;  1QNT A;  3CDH A;  2QYO A;  1ZGA A;  2LK2 A;  3M8E A;  1MBH A;  2M3A A;  3NRV A;  2RDP A;  3KLO A;  2EZK A;  1IXC A;  4RB1 A;  3HUG B;  2XC7 A;  3FXU A;  3MZH A;  2ECC A;  3QWL A;  4IF4 A;  3OY9 A;  5IYD J;  2R7Z J;  1TBX A;  3F21 A;  1ETX A;  3KYD B;  1F1Z A;  2I8D A;  2OD5 A;  2V26 A;  3DU5 A;  3SFI A;  2E36 A;  1MZB A;  1FBQ A;  2F5F A;  2LKS A;  2NNN A;  4UVB A;  5FKK A;  1WSU A;  4KN7 X;  3J7A Y;  2X85 A;  1GXP A;  4LG3 A;  4NB5 A;  2DQL A;  1ETV A;  4A2U A;  4G6Q A;  5CVI A;  4XKV A;  3DLA A;  2VBZ A;  4HLX A;  3LA7 A;  4KIB A;  4LIU A;  2HOT A;  4BU2 A;  2ELK A;  4HW0 A;  1R6R A;  4HX7 A;  4BGD A;  3VOD A;  3DPU A;  4AYB A;  2HVS A;  1UHM A;  3ABU A;  1XCB A;  2K9L A;  3JRG A;  2F5E A;  2E5Z A;  5GAH J;  5F64 A;  2JA2 A;  4WWC A;  2HWV A;  4YEJ A;  4I0B A;  2LKX A;  1HLV A;  3HTU A;  3TED A;  1ULY A;  1N25 A;  2L4A A;  2CQ7 A;  2NAZ A;  1BOB A;  1R5I D;  1X2N A;  3DFG A;  2V9V A;  1JJ6 C;  4B48 A;  3JSP A;  1ZN2 A;  4I01 A;  2LH9 A;  2ZXI A;  3VEP A;  1B9N A;  4BS9 A;  1ETW A;  1IRZ A;  3PUB A;  3WTT C;  4EEF G;  1JHH A;  1FNN A;  4II2 A;  4E7L A;  1IZ1 A;  3DBH B;  4HQE A;  5J40 A;  1GDT A;  3M3Y J;  3E6D A;  1XMX A;  3BR0 A;  4RM2 A;  2YPR A;  1PP7 U;  3QOE A;  1WJF A;  1DU0 A;  2F4O B;  3QOP A;  4M3B A;  3VFZ A;  4PSW A;  2MBF A;  3QPH A;  3F8C A;  1Z0X A;  3OYH A;  1IV6 A;  5IT9 K;  2JJ7 A;  1X3U A;  3H3U A;  2LOO A;  4B09 A;  2M1B A;  3HSR A;  3I71 A;  3S8P A;  4CXF A;  3LSM A;  3P9I A;  3HL2 A;  2VXZ A;  1ZG1 A;  3N4M A;  1XX5 A;  2CQQ A;  4FHT A;  5E8G A;  5FLV A;  1YTY A;  1D1B A;  2K02 A;  2VOO A;  4G6T B;  2QVO A;  1HOM A;  2VKV A; 
#chains in the Genus database with same CATH homology
 5E8I A;  1R58 A;  1XGO A;  3WTX C;  4P9U A;  1IW7 F;  2F5D A;  5HLG A;  4QWQ A;  2HEO A;  1HBX G;  2ESN A;  2K27 A;  3FX3 A;  2V6C A;  2QBY A;  2J5P A;  1LDD A;  1XGN A;  1R00 A;  1UHW A;  2MA3 A;  2QBY B;  2JPC A;  2E7X A;  1TNT A;  2A07 F;  3WG9 A;  5J8C A;  3P9C A;  3R61 A;  4L9N A;  4ZH4 F;  3Q9V A;  2DI3 A;  5L3D A;  3TO9 A;  3ZMT A;  1FP1 D;  3WOD F;  5L3C A;  2FRH A;  4KUM A;  2AS5 F;  4AIJ A;  4ZZL A;  2HQN A;  5HDN A;  2XHK A;  5K5R A;  4UVC A;  2XGX A;  4LJZ F;  2DLL A;  4IJA A;  1TTY A;  3IRR A;  2KIF A;  5ICC A;  2V1U A;  4IHS A;  4YFK F;  2QQ9 A;  3WGG A;  2JRT A;  4Q5S F;  4NQW A;  4EV0 A;  1MD0 A;  3CLO A;  2DK5 A;  3K1N A;  2XVC A;  3QP6 A;  3ISP A;  2K86 A;  5D8K B;  4M71 A;  4U7B A;  3EDP A;  3KP2 A;  3K2Z A;  4HDU A;  5FGM A;  5F1R A;  1YG2 A;  2G7H A;  3U2R A;  3C7J A;  1BI1 A;  3SZT A;  2Y0M A;  3ZN0 A;  4KMF A;  4GYG A;  3IKV A;  3I0T A;  4G7H F;  1I27 A;  4A0X A;  3MQ0 A;  3V7C A;  2P6T A;  1YW9 A;  1T98 A;  4L5I A;  2KRF A;  2Y75 A;  2ZXJ A;  2EFO A;  4Z2Y A;  1T6S A;  1ZRF A;  3E6M A;  2PI0 A;  3D5L A;  1AOY A;  2A68 F;  2DPD A;  2GQQ A;  4Q47 A;  5A2Q Z;  1R22 A;  3Q9S A;  2ZNZ A;  1FX7 A;  2MLK A;  1KU9 A;  2FBI A;  2X4H A;  4Y15 A;  5D5V B;  2JPB A;  1R1U A;  2KJB A;  4WX9 A;  1BI2 A;  1WQ2 A;  4KDP A;  1P2F A;  4EJO A;  1DUX C;  3I5U A;  4ZYH A;  3TQN A;  2LNB A;  2VC0 A;  4M74 A;  5LHH A;  3H92 A;  3BPX A;  3KET A;  1S7O A;  3E5U A;  3MAJ A;  3COA C;  5AIQ A;  1LEA A;  2D1H A;  2DAO A;  1D8K A;  3GZ6 A;  4RB2 C;  1F4K A;  3J81 K;  2FE3 A;  2Z99 A;  4YG2 F;  3DF8 A;  5FB2 A;  1WRJ A;  3BDD A;  2L4M A;  3RPQ A;  3BPV A;  5HLI A;  5LEK A;  4KIC A;  5E1W A;  1U78 A;  2IW5 A;  2O8X A;  4L9T A;  1IXR C;  3BWG A;  3ZMZ A;  2OU2 A;  4Y17 A;  5AIP A;  3VOE A;  3CUO A;  2W84 A;  2QUF A;  3GFM A;  5JFR A;  1B1B A;  4M9Z A;  1I1G A;  2HKX A;  1J75 A;  4UUV A;  4XLP F;  3QPT A;  1E17 A;  4KT5 C;  5BPD A;  3FM5 A;  1CF7 A;  4KFC A;  2FXA A;  1ZYR F;  2RVC A;  4P9F A;  5LGN A;  4N9H A;  4KNY A;  3OV8 A;  4XRF A;  2HR3 A;  4EM1 A;  1JXS A;  3FM3 A;  1ZAO A;  4OOI A;  3IKT A;  4I98 B;  3I59 B;  5J6X A;  3L9F A;  1BIA A;  3EUH A;  2IRF G;  4WXD A;  1XDS A;  2QLZ A;  4G7Z F;  3J7A O;  1EH7 A;  4EGY A;  2FF4 A;  2F2E A;  2Z3Y A;  2IT0 A;  3BP8 A;  1G3S A;  1FPQ A;  4KIF A;  5LRR A;  3SHF A;  4F7Z A;  4M73 A;  1QPM A;  5D5U B;  5DCM B;  3NEU A;  1PUE E;  3F8N A;  3ZMU A;  4R8H A;  4P55 A;  1KQ8 A;  2W25 A;  2E1N A;  2PFB A;  3KLN A;  5D5X B;  1UFM A;  2ZO4 A;  2V1X A;  3FHZ A;  2EFQ A;  1PP8 F;  1YS7 A;  1HKT A;  2P6S A;  4HF2 A;  3K0L A;  4OIO F;  4G9Y A;  2ACJ A;  1G6N A;  3VB2 A;  2FU4 A;  4RGX A;  2ZME A;  1FZP B;  4MQ9 F;  1U8R A;  2RGV A;  1JE8 A;  2UXN A;  3FWE A;  4LMY A;  4RS8 A;  4I09 A;  5DYM A;  4CO8 A;  2ZME B;  2XV4 S;  4AIH A;  3MCZ A;  1QGP A;  3CTA A;  2BBY A;  2IVM A;  4LK1 F;  1OYY A;  1YW8 A;  4ENM A;  5L3F A;  2O03 A;  4Q48 A;  2CYY A;  4I7H A;  2L54 A;  4LB5 A;  2RKH A;  2P5V A;  3F72 A;  1SMY F;  3ERE D;  5CVU A;  4HAM A;  5LGU A;  1IF1 A;  4MTD A;  3RJP A;  2BE5 F;  1BOA A;  1ZG5 A;  1IN5 A;  2H6B A;  3BRO A;  2DFI A;  2DQR A;  1JHF A;  2M87 A;  4UVA A;  4OIR F;  2MH9 A;  2P8T A;  5L3B A;  4M72 A;  4M6Y A;  3WTW C;  2FBH A;  1XMK A;  1Y0U A;  3L00 A;  3ZPL A;  1K79 A;  4MHG A;  3WTS C;  4BHB A;  1TW3 A;  4LLN A;  2GWR A;  1RI7 A;  1KYW A;  3HRU A;  2D2W A;  5KK1 A;  1TQI A;  1UCR A;  1Z6T A;  5FO5 A;  3E3V A;  3R6S A;  1A04 A;  3T5X A;  3KP4 A;  2QQA A;  3ELK A;  4LK0 F;  2ADU A;  2P5K A;  3HRT A;  3HRM A;  2FBK A;  5FD6 A;  2ISZ A;  3RPU A;  4ON0 A;  2COM A;  2VC1 A;  1J2X A;  3T1B A;  2JTV A;  1T39 A;  1SD4 A;  3V8J A;  4JBA A;  2CSO A;  3BY6 A;  1GXQ A;  2H27 A;  1W4M A;  1NHA A;  1G4D A;  4KIG A;  4BHC A;  4E70 A;  4LG0 A;  1I6X A;  2Z33 A;  3SZP A;  3IRQ A;  2M30 A;  2CO5 A;  3GFL A;  1ZGJ A;  3D0S A;  4LG0 B;  2UWM A;  1MJA A;  3L7W A;  5KVR A;  2W24 A;  3TO7 A;  1BI3 A;  3QRF F;  4AD9 A;  3ML6 A;  2HTJ A;  2HYG D;  4LLL A;  2XRN A;  1ON1 A;  4HOB A;  2UZK A;  3IWZ A;  4GCV A;  1V4R A;  3L09 A;  2X0L A;  1R5G A;  3ZP5 A;  2YU3 A;  3JTG A;  5HDG A;  4L5J A;  1Z91 A;  2XAJ A;  2YX7 A;  3HIF A;  3IC7 A;  4RB3 C;  5ILV A;  1OMI A;  4P5O A;  5DUI A;  2H94 A;  4UNO A;  4HX4 A;  3G73 A;  3M7G A;  1ZH5 A;  4WF2 A;  5CVJ A;  1LVA A;  2MLG A;  1F9N A;  4MTE A;  2CWE A;  1UB9 A;  4EJV A;  2OZ6 A;  2PMU A;  1T2K A;  2VE8 A;  4YFX F;  1O7F A;  5ICE A;  3TGN A;  4CDG A;  1RUN A;  1EH8 A;  1ZLK A;  1FT9 A;  4XBF A;  4BAY A;  4ESF A;  1XSD A;  1IN4 A;  4OU0 A;  4U7D A;  1LQ1 A;  2O0Y A;  5A2Q K;  2GA2 A;  3BJA A;  4Q4Z F;  2C6Y A;  3KCC A;  3RTR A;  2EB7 A;  4A0Z A;  2EA2 A;  3IL2 A;  4A12 A;  1T0F A;  1PDN C;  4WXC A;  2IA0 A;  1MJB A;  5TRD A;  2DU9 A;  2H6C A;  3R0A A;  3KP6 A;  1LDK B;  2LKP A;  2O6G E;  1SMT A;  3ZN1 A;  1IN6 A;  3SXY A;  3LA2 A;  1XGS A;  2XIG A;  2TDX A;  1FBU A;  3I54 A;  3IWF A;  2B0L A;  4EM0 B;  2HYF A;  3EET A;  1O7L A;  5D4R A;  4HA8 A;  1HQC A;  3ULQ B;  4HLY A;  3LAP A;  4BXU A;  2XAG A;  3LWF A;  1KA8 A;  3U1D A;  2XKP A;  4HBL A;  4JK1 X;  3SQN A;  1STZ A;  4ESB A;  1SD6 A;  4OIP F;  4HX8 A;  2D1V A;  1ZRC A;  1O3Q A;  1XB4 A;  1H9T A;  1KGS A;  3K9T A;  3WGH A;  3V4G A;  2DPU A;  2OA4 A;  2O61 A;  1W7P A;  2PBI A;  5JI6 A;  3QU6 A;  3BOQ A;  3BJO A;  1EV7 A;  3PFI A;  1CGP A;  2BGC A;  1OYW A;  1XMA A;  5ICF A;  1U5T C;  2A61 A;  3T8R A;  4LD5 A;  3HTS B;  4OIN F;  2EV6 A;  3WTV C;  4NHJ A;  3KZY A;  3FMQ A;  1BC7 C;  5CVR A;  4FX0 A;  2ETH A;  1G3Y A;  5IT9 Z;  3N97 A;  2HS5 A;  3IHU A;  3JTH A;  1W5S A;  1FSE A;  1O3S A;  2NYX A;  5DD4 A;  3ECO A;  1K78 A;  3F6O A;  4G7O F;  4RAY A;  1SFU A;  5BQT A;  4GO1 A;  2GA1 A;  4D0P A;  2YSR A;  4TV7 A;  3E6C C;  2P4W A;  2MD5 A;  4GGG A;  1H0M A;  3C3W A;  1YIO A;  5BOX A;  1TLH B;  2VOP A;  2PN6 A;  2FA5 A;  4A6D A;  2IJL A;  4UV8 A;  2F5C A;  3M8F A;  1QQI A;  3CUQ C;  1QBJ A;  2FQ3 A;  1OYI A;  3DV8 A;  1ZLJ A;  2EV5 A;  4XLN F;  3V7S A;  1FLI A;  3TDZ C;  5CVV A;  1SFE A;  1MDM A;  1S8N A;  2JT1 A;  2Q8K A;  3S2W A;  1Z9C A;  5CLS A;  4WXH A;  1EH6 A;  1USS A;  3E6B A;  1DPR A;  1Z7U A;  2JSC A;  4A6E A;  2BV6 A;  4HF1 A;  1XSV A;  2IA1 A;  2A3S A;  1W5T A;  2OAZ A;  4ENK A;  1XN7 A;  2FMY A;  1BIB A;  2EFP A;  1R1T A;  3B73 A;  3K1M A;  1FYK A;  2QM3 A;  3HRS A;  2CQK A;  1K6O A;  1MGT A;  5DUK A;  1LEB A;  3DKW A;  4PZJ A;  1C0W A;  3RIR A;  1E2X A;  5K1Y A;  3OOP A;  5CYV A;  2P7V B;  3HHH A;  4MQV A;  1Z6R A;  2WWY A;  1HST A;  3CO7 C;  4UXN A;  1HW2 A;  5FFX A;  4PCQ A;  1CF7 B;  1OR7 A;  2IP2 A;  3EQL F;  5BMZ A;  2XAH A;  1U6G A;  2DT5 A;  3QP5 A;  2D45 A;  3CJN A;  3B02 A;  2HTS A;  2LDU A;  3F23 A;  3PQJ A;  3Q5F A;  1U5T A;  3HOT A;  1BBY A;  4EJT A;  3GYH X;  2L3D A;  4KA4 A;  5FLX K;  1D5V A;  1U5T B;  2WV0 A;  2VE9 A;  2ZFW A;  2OBP A;  3KP3 A;  4RB0 A;  3RYR A;  5LBQ A;  1KQ0 A;  5HDK A;  2CG4 A;  1W7P D;  2XKO A;  4CYD A;  2HZT A;  4IPA A;  1FC3 A;  5E1X A;  4LB6 B;  5TJJ A;  4AIK A;  1G3T A;  2VT2 A;  3CO6 C;  3TOA A;  3DPL C;  3DQV C;  3MFK A;  4N9I A;  3JAM Z;  3TO6 A;  1ONV A;  2CGP A;  3CUQ A;  2DW4 A;  1LJ9 A;  4GYI A;  1R23 A;  5FFZ A;  2PMH A;  5DDG A;  2A6H F;  5JHU A;  2PQ8 A;  3FMS A;  1O57 A;  3CUQ B;  3LST A;  1MJ9 A;  2DO7 A;  3WE3 A;  3J80 Z;  2H09 A;  2PJP A;  1IRF A;  1YLF A;  3GZ5 A;  1R7J A;  3ZMS A;  3MZY A;  4BYY A;  1UST A;  2GAU A;  2A6E F;  4LFU A;  5DD8 A;  4XSZ F;  5JR3 A;  1P6R A;  2RQP A;  5LGT A;  5E20 A;  3W6K B;  1P4X A;  4UV9 A;  2M8E A;  3TDU C;  3LQR A;  1KU3 A;  1I5Z A;  4CIC A;  1BI0 A;  4O5V A;  3GXO A;  5L3E A;  4S04 A;  3E97 A;  2OQG A;  4RGS A;  1B59 A;  2HFH A;  1XCV A;  3WU0 A;  6PAX A;  4IRH A;  4EMS A;  1L0O C;  1KU7 A;  5D6F A;  3C1D A;  2P5L C;  4EVI A;  1ZHF A;  3V8K A;  5LLQ A;  4YII A;  1R36 A;  3EYY A;  1HW5 A;  2K7L A;  3T0Y A;  1T38 A;  4BNC A;  4AVP A;  4U88 A;  5D5W B;  2IPQ X;  4HQM A;  3HHG A;  1FWZ A;  4ZZD A;  1J59 A;  1YFH A;  3DPT A;  4MGR A;  2Q2E A;  1F5T A;  3TKY A;  1S3J A;  3QU3 A;  1B6A A;  3L2C A;  2BEO A;  1TNS A;  1FYL A;  5E17 F;  2K4J A;  2XRO A;  4I02 A;  2LF7 A;  1ZRE A;  1FP2 A;  5HS7 A;  1RIO H;  3MWM A;  4L0Y B;  5DCF A;  2XUB A;  5CJ9 A;  1D3Y A;  3W6J B;  3HSE A;  2HKO A;  3RI4 A;  2EFN A;  2Y48 A;  4KN4 X;  1YS6 A;  4KYW A;  4RAZ A;  4UHT A;  4LGW A;  1AWC A;  5E1Z B;  5H6Q A;  3WU1 B;  1ODD A;  1JGS A;  1FOK A;  4L0Z B;  4ZYG A;  5D6E A;  4DNC A;  5E18 F;  2NRA C;  1GVJ A;  1WKM A;  2EA4 A;  2G9W A;  4R79 A;  4HV5 A;  4ZYD A;  1ZAR A;  2E1C A;  4RGR A;  5FD5 A;  3I58 A;  1RZ4 A;  5ED4 A;  3GFI A;  5HOO A;  2DTR A;  4A5N A;  5EEG A;  4ESJ A;  3ZQ7 A;  4WK8 F;  1D8J A;  4O6J A;  1WWX A;  3F6V A;  5J8F A;  4S05 A;  4EJW A;  1FSH A;  2ZBK A;  1DP7 P;  3LA3 A;  1HKS A;  3JW4 A;  2WTE A;  3F8B A;  1HKQ A;  3R0J A;  1J0R A;  3ZMV A;  2QEN A;  4B8X A;  3K1P A;  3PQK A;  3FZV A;  4MEY F;  3V8L A;  2RNJ A;  1G3W A;  2Z5U A;  4ENN A;  1ZG3 A;  2YX4 A;  3KFW X;  1TQP A;  3RDI A;  5D4S A;  5LRS A;  3H3Z A;  2V1D A;  2HOE A;  4AWX B;  2W85 A;  4CZZ A;  2FML A;  1IN8 A;  2LF8 A;  2V79 A;  4I2O A;  1FY7 A;  1H9G A;  5ILS A;  3M1E A;  4L18 B;  4L9V A;  4OIQ F;  3GW2 A;  1TQM A;  1YQA A;  2GIV A;  2IA2 A;  1J5Y A;  5AON A;  2EFW A;  3NQO A;  3K69 A;  2A5Y B;  1MKM A;  1B4A A;  4YFN F;  2QWW A;  3GF2 A;  3WTY C;  4IRG A;  1U2W A;  2OZU A;  2STW A;  4WCG A;  4G8X A;  2VOD A;  1QZY A;  2QZ8 A;  4OMY A;  2GZW A;  3HYI A;  3V7R A;  3GX4 X;  2FOK A;  3C18 A;  2PG4 A;  2LSO A;  4PGH A;  5ICG A;  3AAF A;  1IXS B;  4U0W A;  5LHG A;  3ECH A;  2JZY A;  1W7P B;  2ESH A;  1Z1D A;  1OPC A;  3LAJ A;  2VBW A;  1IN7 A;  4FT8 A;  4L9J A;  1S29 A;  2KKO A;  2Q0O A;  2KIM A;  1HW1 A;  1I1S A;  1FBS A;  1R5H A;  1XGM A;  4MNU A;  3FMR A;  2RN7 A;  1O3R A;  3F8F A;  3GLX A;  4G6D A;  2O3F A;  1XDU A;  1BJA A;  1SAX A;  5HS9 A;  1ZRD A;  2R7F A;  4LLG F;  2R3S A;  3T8T A;  5EEH A;  4Y13 A;  4O3M A;  1J9I A;  4U0Y A;  1K78 B;  2L02 A;  3ABT A;  3REO A;  4GXO A;  4EJU A;  1TW2 A;  5LEJ A;  2ZNY A;  4QLC U;  3LFK A;  4HZF A;  3O6B B;  3WE2 A;  2UXX A;  1XD7 A;  2VBY A;  1BN5 A;  3KP7 A;  4A0Y A;  1VTN C;  3JSO A;  3I64 A;  1RNL A;  3LQQ A;  2KIU A;  1REP C;  2QQB A;  3GWZ A;  4KMU X;  1DDN A;  2RC4 A;  5L3G A;  5K5O A;  3JAM K;  3I53 A;  1S6L A;  1R1V A;  3QAH A;  1MDM B;  1U3E M;  2G7U A;  3WGI A;  3ROU A;  2GXG A;  1P92 A;  5ERI A;  2PLY A;  2MC3 A;  3ZMD A;  2FEZ A;  1Q1H A;  2BYV E;  3J80 K;  4EGZ A;  4BH9 A;  5K5Q A;  2Z9O A;  4FX4 A;  2HQR A;  4RGU A;  2XAS A;  5BS6 A;  2L01 A;  2M45 A;  2FSW A;  1DPU A;  3RYP A;  2XAF A;  1WI9 A;  4CHU A;  2K4B A;  4HV6 A;  4CGZ A;  2CW0 F;  3F3X A;  3KEQ A;  3HSF A;  1FYM A;  2FNP A;  2P7C B;  3DXJ F;  2CFX A;  1HXD A;  3R60 A;  3KE2 A;  1J7K A;  3GVA A;  5HS8 A;  4I0A A;  5IT3 A;  1LNW A;  1P4A A;  1BM9 A;  3P9K A;  1S7A A;  3F8M A;  4OMZ A;  3E5X A;  3U9G A;  3MEX A;  4HDV A;  2ZCW A;  4IHT A;  4ZYE A;  2R7D A;  2XAQ A;  1QZZ A;  4EQQ A;  5HLH A;  1HSJ A;  3I59 A;  2WC2 A;  3G3Z A;  1KQ9 A;  3WTZ A;  1IRG A;  4M9X A;  2OQR A;  5ILU A;  2HDC A;  5H20 A;  4A5M A;  3FXR A;  4U0V A;  5HVQ C;  1OKR A;  2VT3 A;  2RV8 A;  3O2P E;  4ASN A;  2DBB A;  3WTU C;  3R4K A;  2ELH A;  1YO5 C;  3HOS A;  3BZ6 A;  3RKW A;  4YIF A;  4R1H A;  5DCM A;  2STT A;  4MEX F;  1YYV A;  3O3K A;  2YR2 A;  2EK5 A;  4HF0 A;  2W57 A;  4H0E A;  4EM2 A;  2KJC A;  3KEO A;  2ZKZ A;  3DP7 A;  3RKY A;  5DEQ A;  1IAW A;  4IVN A;  3GUD A;  2A69 F;  1LDJ A;  1K7A A;  1P4W A;  3FF5 A;  3FXQ A;  4DQ2 A;  1O3T A;  1QO0 D;  3GEZ A;  4PDK A;  2ISY A;  4G94 A;  2J5O A;  1L3L A;  3J81 Z;  4HYE A;  1V3F A;  2EWN A;  3E5Q A;  2M5W A;  1SD5 A;  4JQF A;  3RKX A;  3TOB A;  1IUY A;  5F6F A;  4ETS A;  5H6R A;  2VON A;  4M9S A;  2NS0 A;  1KYZ A;  3KZZ A;  2DK8 A;  3M9A A;  5D8L B;  2ZJ2 A;  4BQA A;  3P7N A;  2E7W A;  1B9M A;  3GO5 A;  4IXA A;  2VN2 A;  4BHP A;  1BC8 C;  2HGC A;  4XSX F;  2GXB A;  2EV0 A;  1SFX A;  3GFJ A;  2FNA A;  2EJR A;  5BPI A;  1GHC A;  4PGG A;  4M6X A;  1YW7 A;  2AXL A;  5DV5 A;  3I4P A;  1Z05 A;  4N0B A;  1XSX A;  3KP5 A;  2VBX A;  4K2E A;  5LHI A;  3BJ6 A;  1SD7 A;  2MH2 A;  1LB2 A;  2PEX A;  4P96 A;  3EYI A;  3SFZ A;  4ENJ A;  1RUO A;  3F22 A;  5FLX Z;  2NNY A;  3DEU A;  4IRI A;  3HUG A;  1KU2 A;  1ON2 A;  5JVT A;  1QNT A;  3CDH A;  2QYO A;  1ZGA A;  3M8E A;  3NRV A;  2RDP A;  3KLO A;  1IXC A;  4RB1 A;  3MZH A;  3FXU A;  4IF4 A;  1TBX A;  3F21 A;  1F1Z A;  2OD5 A;  1MZB A;  1FBQ A;  2F5F A;  2NNN A;  4UVB A;  1WSU A;  4KN7 X;  1GXP A;  4NB5 A;  2DQL A;  4A2U A;  4G6Q A;  5CVI A;  2VBZ A;  4HLX A;  3LA7 A;  4KIB A;  4HW0 A;  4HX7 A;  3VOD A;  1UHM A;  3ABU A;  1XCB A;  2F5E A;  5F64 A;  4WWC A;  2HWV A;  4I0B A;  3HTU A;  1ULY A;  2L4A A;  2NAZ A;  3DFG A;  2V9V A;  3JSP A;  1ZN2 A;  4I01 A;  3VEP A;  1B9N A;  3WTT C;  1JHH A;  1FNN A;  1IZ1 A;  4HQE A;  3E6D A;  2YPR A;  1PP7 U;  3QOP A;  3VFZ A;  2MBF A;  3QPH A;  3F8C A;  5IT9 K;  1X3U A;  3H3U A;  4B09 A;  2M1B A;  3HSR A;  3I71 A;  4CXF A;  3P9I A;  2VXZ A;  1ZG1 A;  3N4M A;  4FHT A;  5E8G A;  1YTY A;  2K02 A;  2VOO A;  2QVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...