3J81K

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFSWQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF03501 S10_plectin Plectin/S10 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3j81K00
4JK1X 2HTSA 5DUIA 2K4BA 2HS5A 5LGUA 1SMYF 4P9FA 4BH9A 1B9MA 3U1DA 3JAMK 4MNUA 3C3WA 2XAQA 2GA1A 1DUXC 3TKYA 1QO0D 5FFXA 4O6JA 6PAXA 4LK0F 5DCMA 2L54A 5HLHA 2WTEA 4UUVA 1XSVA 3ZMSA 2RN7A 2D1VA 5A2QZ 3AAFA 2Z33A 5DEQA 4NHJA 3TDZC 4IJAA 1P4XA 3R0AA 5BMZA 5IT9K 3WU1B 1I5ZA 4KIBA 5LHGA 1LB2A 2P7CB 2DI3A 3CUQA 5ILSA 3HSRA 3P7NA 1EH6A 4I09A 5E18F 4AVPA 1FP1D 1W5TA 4HLXA 4PGHA 5FB2A 4RB0A 2DTRA 2BEOA 4Y17A 5D8KB 3BROA 2ZBKA 4EJTA 4B8XA 1ZAOA 5DCMB 2RNJA 1R1UA 3M8FA 3FX3A 3DP7A 1IAWA 2H09A 3L09A 1PUEE 3IL2A 3HHGA 4EV0A 4MQVA 3IHUA 1W7PD 4R8HA 4O3MA 4HF1A 4IRHA 1OYWA 3EETA 2PMUA 4A12A 2XAJA 2A6HF 1W4MA 5E17F 1YW9A 3GWZA 4AD9A 3F23A 4ZYHA 4A6EA 3E6CC 5A2QK 2XGXA 5CLSA 1DPUA 3MWMA 3QP5A 3COAC 4ZYEA 2AS5F 5F64A 3KP7A 1R5GA 1PP8F 3LA3A 3HYIA 4KYWA 3BDDA 1K7AA 1NHAA 3W6JB 5KK1A 3G3ZA 1XSDA 1G4DA 3N4MA 2M30A 1RI7A 2GA2A 3CO6C 1SAXA 3WTUC 3ISPA 1F5TA 3JSPA 1W5SA 4RGXA 2DFIA 1IRGA 3WE3A 3G73A 4ESBA 3EQLF 3LAJA 2Z5UA 1JGSA 1B9NA 4Z2YA 3EYIA 4AWXB 1V4RA 4LLNA 1Z7UA 2VT2A 4HAMA 5L3BA 5BOXA 1ZYRF 3TO7A 1FYKA 3HRTA 5L3GA 2VE8A 2EFPA 2M87A 3T8RA 3WODF 2R7DA 2QENA 2LF7A 1HXDA 4I0BA 1O57A 1MKMA 4I7HA 2MBFA 1T0FA 3CLOA 1ZH5A 4FX4A 3T1BA 3F22A 2P5LC 4M71A 3RI4A 2TDXA 3F8NA 4WCGA 3REOA 3F8BA 4EVIA 5K5OA 2WWYA 1P4AA 2NNYA 4FX0A 3ZMDA 3B02A 4CICA 2MC3A 3QU3A 1U8RA 4XLPF 3WTSC 2RGVA 1TBXA 2DK8A 2J5OA 4EJVA 3R61A 1S29A 2FEZA 2XRNA 2KIUA 4UVBA 2DPUA 2Y48A 2D1HA 1R00A 3HSFA 3T5XA 5BPIA 3MZHA 2DK5A 2RDPA 1MZBA 2CFXA 2GXBA 1F4KA 2W24A 3W6KB 3DEUA 5ILVA 4KA4A 3H3UA 3RYRA 1UHMA 1O3SA 2XHKA 3FM3A 2E1NA 1ZGAA 3MZYA 4S05A 4ENNA 2QLZA 3VOEA 2H27A 5LEKA 1S3JA 2MH2A 5D5WB 1TNSA 4ASNA 4E70A 1K79A 4HOBA 4A6DA 1FWZA 1R36A 1D8JA 3TOAA 5LHHA 4XLNF 4GXOA 2W57A 1ZREA 1FC3A 5BPDA 5L3FA 1TQPA 1XDUA 4KNYA 4HA8A 1TW3A 1J2XA 3DPTA 1QPMA 3MEXA 1KQ9A 5J8CA 2CG4A 5LBQA 3KETA 1Z05A 4M9SA 2YPRA 3V7CA 4G6QA 4BAYA 2DU9A 2D45A 5AIPA 3ZMVA 1K6OA 1SFEA 2VC1A 5ICCA 3I53A 2VBXA 1ZRFA 5D4SA 1ZLKA 1FPQA 1FOKA 5HS9A 1J5YA 2IT0A 5H20A 2F5CA 3KFWX 3LA2A 3SZTA 3WTWC 3TO6A 2VT3A 3BJOA 3KEOA 3BWGA 1WWXA 1ZRCA 2Q2EA 2QVOA 2WC2A 3OOPA 4EGYA 2GXGA 2OZ6A 1G3WA 1U5TA 2VBZA 1I6XA 4RGSA 4IXAA 2XKOA 4RB3C 3L9FA 2UXNA 5H6QA 1YS7A 5CVIA 3LFKA 2NS0A 5HVQC 2YSRA 2F2EA 4U88A 3ZN0A 3CTAA 3TQNA 3FXQA 1XMKA 3VB2A 3F21A 1JE8A 1SMTA 3V4GA 2STTA 5HDKA 2O3FA 4UHTA 1YLFA 4HX8A 2Y0MA 2ZO4A 1J59A 2KRFA 5HS8A 2FRHA 4HW0A 1XGNA 2ZNZA 4IRIA 4YIIA 3BJAA 3KE2A 3U2RA 2K02A 3DXJF 1G3TA 2UXXA 1U5TB 2O6GE 2NAZA 3R6SA 5L3EA 2BV6A 2FMYA 3QPHA 1YTYA 1AWCA 3GO5A 4MEYF 1FP2A 4LMYA 2VXZA 3MQ0A 3ZQ7A 4KIGA 1HW2A 1ODDA 3GFLA 1Y0UA 1T6SA 3LA7A 2PJPA 5BS6A 2E1CA 1BI0A 2FU4A 4LLLA 2IW5A 4KIFA 4U7BA 3SHFA 3TOBA 4OIRF 3QPTA 4PDKA 3CO7C 4OOIA 3F8FA 2DT5A 1WI9A 4I0AA 4ZH4F 3E5QA 1C0WA 1SFUA 5CVRA 3H3ZA 1B1BA 5FO5A 3I64A 1SD5A 3FM5A 2ZMEA 1BJAA 3HHHA 4B09A 4HF2A 2MD5A 5ED4A 2QYOA 3WGGA 5E1ZB 3MFKA 1I1GA 2BE5F 1LEAA 1S7AA 1FSEA 4ETSA 4IF4A 4KUMA 5HS7A 4WXHA 3F8MA 1IN5A 3FWEA 3M8EA 3RYPA 4ZYGA 2YX4A 4HZFA 4M9XA 4L9TA 2F5FA 2V1XA 1KYZA 1JHFA 4KDPA 1YG2A 1QNTA 3WTTC 2LNBA 3GZ5A 2M8EA 1QGPA 2JPBA 2OAZA 2M1BA 4L9VA 5FD6A 2ZMEB 4LFUA 2P4WA 3I71A 3L00A 3P9IA 4OIQF 4QLCU 1XD7A 4M74A 1FSHA 2FF4A 2QZ8A 4BQAA 3SZPA 3IKTA 2EFOA 1ULYA 3WTVC 2ZJ2A 1I1SA 2PEXA 3I5UA 1BIAA 1MJAA 1FBSA 2VN2A 1LDKB 1LNWA 3GUDA 1F1ZA 1KU7A 4LB5A 1YS6A 2QM3A 3RPQA 2ADUA 5IT3A 5CJ9A 1XDSA 1RUOA 1USTA 3K1PA 5E1XA 2VONA 1BC7C 3CUQB 1TQMA 4ENKA 2C6YA 3N97A 1MJBA 1MDMA 1EH8A 2DQRA 1U6GA 4ESFA 1LVAA 5K1YA 3J80Z 1IXRC 5ERIA 3GLXA 3KP4A 4UXNA 1LEBA 4IPAA 3ZP5A 2YU3A 2BBYA 5CYVA 2O61A 3RDIA 1H0MA 5D6EA 3F6OA 4XRFA 5DD4A 2KIFA 2XV4S 4M73A 1P2FA 1KU2A 2QWWA 5BQTA 4BHPA 1FT9A 3FMSA 4IRGA 3FMRA 3LSTA 4G7OF 1CGPA 4OMZA 1QQIA 3GZ6A 2G9WA 2OD5A 3SQNA 3IRRA 3K2ZA 3V7RA 4OIOF 1IN8A 1HKSA 2IVMA 4K2EA 1E2XA 3J81Z 4MEXF 2HWVA 2DBBA 3HRMA 4PZJA 2DQLA 4I01A 1KA8A 1XN7A 5E20A 3GX4X 4U0WA 5JHUA 3L2CA 1IN4A 2V9VA 1FNNA 1YYVA 1D5VA 4N9HA 2ELHA 2H6BA 2P6TA 3GW2A 2BYVE 2NRAC 2L02A 1EH7A 3EDPA 4CYDA 4G6DA 3I0TA 3QU6A 1TQIA 3M1EA 2EV6A 4HX7A 4QWQA 2L3DA 3HIFA 1SD6A 3J80K 2HKXA 2L4AA 1F9NA 4N9IA 4YFXF 4RGUA 5DD8A 2OA4A 4BXUA 2KJBA 5JFRA 2STWA 1D8KA 2A07F 4M6XA 4EM0B 1TTYA 3WTXC 4AIJA 5FD5A 3K1MA 1IXSB 5F6FA 1J9IA 4L9NA 2LSOA 1ZARA 1BC8C 4PGGA 2FE3A 4HLYA 3SXYA 1Z1DA 3GFJA 1BI3A 2HGCA 2FBKA 4L9JA 5AIQA 2J5PA 3RKXA 2G7HA 2MH9A 3J81K 3DPLC 4KN4X 2E7WA 5D5XB 5FLXZ 1IF1A 2A6EF 4S04A 3RPUA 1HW1A 2G7UA 2UWMA 3C18A 2XAFA 4I98B 4A5NA 2Z3YA 1UCRA 3GXOA 3O6BB 4KMUX 2COMA 4M9ZA 5AONA 4EMSA 5LGTA 4XBFA 2P6SA 3Q9SA 5ICGA 1BM9A 1AOYA 5F1RA 1LQ1A 3M9AA 2FA5A 2EV0A 3FXRA 3KP6A 5E8IA 1R22A 3KZYA 3WGHA 5H6RA 4WK8F 2EB7A 2HYFA 5K5RA 2DO7A 4Y15A 5CVJA 1HKTA 1Z6TA 1WRJA 2FQ3A 4RAYA 3T0YA 1KU9A 5DCFA 3FXUA 1T39A 1O3RA 3CDHA 1ZG3A 3HUGA 4FT8A 2OQGA 2W84A 2HDCA 2DAOA 2BGCA 5ICEA 2R7FA 4BHBA 4M72A 3V8JA 3D0SA 1O7FA 3JSOA 2QQAA 4LJZF 3ABUA 5FLXK 3WU0A 3VFZA 1OMIA 4CHUA 1BN5A 1ZHFA 1ZGJA 4RS8A 3JTHA 3F8CA 1HBXG 3I59A 5CVUA 1YW7A 2O8XA 4Q47A 1KQ0A 3ZMZA 1G3SA 1MJ9A 4OMYA 1YO5C 1IN7A 1P92A 5D5UB 1LDDA 4YIFA 3E6DA 4HV6A 2HKOA 4MHGA 4UVAA 1XMAA 1KGSA 1IRFA 5ICFA 2Z9OA 2VC0A 5L3CA 2M5WA 4MQ9F 5LHIA 3RJPA 2ZNYA 3FF5A 2IPQX 1H9TA 4I2OA 3E5XA 2XAGA 2JPCA 3QOPA 4ENMA 2FOKA 5HLIA 3ECHA 4KICA 4UV8A 2GIVA 2ISZA 3QRFF 2EK5A 3I59B 1YFHA 3HRUA 4H0EA 2EA2A 1XB4A 4CGZA 1IW7F 1G3YA 3MAJA 4HQMA 4R79A 2W25A 2JRTA 3K0LA 2LKPA 1Z91A 2PG4A 1GXPA 1RZ4A 5FFZA 2PN6A 4EM1A 1B6AA 2FMLA 4ZZLA 1S7OA 2XAHA 2FBIA 3KEQA 1G6NA 1FBUA 3JW4A 5D8LB 2EWNA 3C7JA 2HZTA 3PQJA 4A0YA 5EEGA 3F3XA 4NQWA 3RKYA 3F6VA 1J75A 1B4AA 2KKOA 3NEUA 1U2WA 2IA2A 4WWCA 3RTRA 5HLGA 2ETHA 1FX7A 2AXLA 4KN7X 1BI1A 1FY7A 5D5VB 4L0YB 2Q8KA 2RC4A 1ZN2A 1D3YA 3O3KA 1T98A 3ABTA 2K27A 2V79A 3DV8A 4CZZA 1O3TA 1LJ9A 2RV8A 3K1NA 1WSUA 1XGOA 3F72A 2NNNA 1QZYA 3V8LA 1DPRA 1KQ8A 3KZZA 1R23A 3IWFA 3BJ6A 2PLYA 1WQ2A 2ZXJA 4RB1A 2GQQA 2OU2A 3DF8A 2OZUA 2O03A 4EM2A 3E3VA 2CSOA 2EFNA 1WKMA 2VBWA 1O3QA 4G7ZF 3HSEA 2CQKA 1W7PA 4CDGA 3J7AO 4P55A 5LLQA 3ZMUA 1ZRDA 4YFNF 4U0YA 4LLGF 1ZLJA 3EUHA 3WGIA 3WTYC 2PQ8A 2EFQA 1RNLA 1X3UA 3CUQC 4CXFA 1L0OC 2P5KA 3H92A 1HSJA 3BZ6A 2IA1A 2QQBA 5DUKA 3TO9A 3BY6A 1MGTA 2MLGA 1PDNC 3I4PA 1IXCA 2PFBA 1JHHA 4UVCA 5L3DA 3IWZA 1XGSA 3ULQB 5LRSA 2K86A 1OPCA 3LWFA 1REPC 5HDGA 4F7ZA 2V1UA 4R1HA 4YFKF 1W7PB 4L18B 2O0YA 1DP7P 3BPVA 1S8NA 3OV8A 2Z99A 4G94A 5EEHA 4GO1A 4PCQA 1USSA 4UNOA 1FYMA 4MGRA 2RQPA 1XCVA 4EJWA 4U7DA 3ELKA 4Q5SF 2P7VB 4GYGA 4WX9A 2NYXA 3RKWA 5J6XA 1R1TA 1XSXA 3GVAA 3KCCA 2XASA 1JXSA 4O5VA 1XGMA 2PBIA 3I58A 4CO8A 2ZCWA 5D6FA 3HTUA 4BYYA 2A69F 2DW4A 2X4HA 2A5YB 1EV7A 5E1WA 5LGNA 2V6CA 4UV9A 4I02A 2ESNA 2XVCA 3ZN1A 4LB6B 2JZYA 2HR3A 5HDNA 2DLLA 2UZKA 3Q5FA 4IVNA 2CYYA 1HSTA 4DQ2A 1BBYA 2GWRA 4HV5A 2LF8A 2WV0A 3WTZA 4P9UA 3RIRA 4IHTA 4EQQA 4DNCA 2FBHA 2GAUA 2HFHA 4HF0A 2W85A 1Q1HA 2EFWA 2HQNA 1V3FA 3VODA 1P4WA 2VE9A 2QQ9A 4MTEA 3DFGA 3R0JA 1Z9CA 2FXAA 1MDMB 4GGGA 2XUBA 2M45A 2HOEA 4FHTA 1OR7A 2QBYA 1UB9A 5DDGA 1ZG1A 2EJRA 3ZPLA 2P8TA 5TRDA 3ECOA 4ON0A 5ILUA 5LEJA 1Z6RA 1SD4A 3D5LA 4HDUA 3M7GA 1L3LA 1BIBA 3KP2A 4TV7A 5CVVA 4EJUA 1ZG5A 2F5DA 2ISYA 1R1VA 3PFIA 2CGPA 1MD0A 3ML6A 3HTSB 4GYIA 3O2PE 3E6MA 1RUNA 2KIMA 2IRFG 5DV5A 2QBYB 2F5EA 1R5HA 2V1DA 3ERED 2D2WA 3HOSA 1SFXA 4XSXF 3GFIA 1TNTA 5J8FA 3KP3A 4A0ZA 4KFCA 4LG0A 4BNCA 3HOTA 4ZYDA 1IN6A 2QUFA 4JBAA 4ZZDA 4L0ZB 1BI2A 2OQRA 4A2UA 1ON1A 2K7LA 2VOOA 2L4MA 2LDUA 4JQFA 5K5QA 1U3EM 1TLHB 3IRQA 2CWEA 3QAHA 3C1DA 1BOAA 2JT1A 4OINF 3MCZA 3WG9A 1J7KA 3FZVA 4YG2F 3P9CA 5JR3A 3K69A 5FGMA 4A5MA 4G9YA 4EGZA 2A68F 4P96A 3DKWA 1YW8A 1J0RA 3V8KA 4EJOA 4LG0B 1UHWA 1GVJA 4Q48A 3KLOA 2Q0OA 2PI0A 1QZZA 4BHCA 3TDUC 3LQRA 2H6CA 2IJLA 2HQRA 2P5VA 1R58A 4A0XA 2EA4A 2E7XA 3R60A 1GXQA 4ENJA 3FHZA 1SD7A 2HTJA 2IP2A 3NRVA 4L5JA 4RB2C 3HRSA 4G7HF 4MTDA 4Q4ZF 1TW2A 2CW0F 1A04A 3GF2A 4Y13A 1KYWA 3QP6A 2MLKA 2B0LA 3L7WA 2CO5A 2VOPA 3IKVA 2KJCA 3B73A 2R3SA 4WXCA 4ESJA 3GFMA 3LQQA 3BP8A 1E17A 2DPDA 5TJJA 1STZA 2VODA 2FNAA 3ZMTA 1U5TC 3KP5A 2XROA 2OBPA 4IHSA 3DQVC 3I54A 1I27A 2GZWA 3VEPA 2ACJA 4LGWA 4M6YA 1IUYA 2IA0A 1HQCA 3R4KA 4HQEA 4OIPF 2HYGD 3U9GA 2A3SA 4D0PA 4HYEA 4WXDA 3BPXA 1P6RA 5DYMA 4AIKA 1OKRA 1T38A 1IZ1A 3ROUA 1FBQA 1O7LA 2ESHA 4XSZF 1OYIA 4LK1F 5KVRA 1HW5A 2A61A 1FZPB 1CF7A 3TGNA 4N0BA 3JTGA 3IC7A 3WE2A 2JSCA 1XCBA 2ZFWA 2K4JA 4WF2A 1S6LA 3Q9VA 2Y75A 1DDNA 4KT5C 4AIHA 3V7SA 4RGRA 2L01A 5LRRA 2HEOA 4OU0A 3E97A 2YR2A 5HOOA 2PMHA 1ONVA 3JAMZ 3P9KA 5E8GA 2VBYA 4P5OA 1K78A 2RKHA 3SFZA 2X0LA 2FNPA 4HBLA 1H9GA 4GCVA 3E5UA 3BOQA 2XKPA 1GHCA 5JVTA 4LD5A 1B59A 5IT9Z 1CF7B 2MA3A 1FLIA 3T8TA 1R7JA 2ZKZA 2XIGA 3FMQA 4HX4A 5JI6A 1KU3A 5D4RA 1HKQA 4G8XA 1YQAA 4NB5A 4KMFA 4U0VA 1T2KA 3K9TA 4RAZA 3EYYA 3PQKA 1OYYA 3KLNA 3E6BA 1QBJA 1LDJA 2EV5A 1U78A 3NQOA 2JTVA 2RVCA 1K78B 4HDVA 2YX7A 3CUOA 1VTNC 3CJNA 2FSWA 1FYLA 1ON2A 3GYHX 1YIOA 1PP7U 1RIOH 2H94A 3LAPA 3S2WA 3GEZA 4L5IA 1UFMA
chains in the Genus database with same CATH superfamily
4CCMA 4JK1X 2HTSA 1X1CA 2ME6A 2K4BA 5DUIA 2HS5A 4HRIA 5LGUA 1SMYF 4P9FA 2BHYA 3QYFA 4BH9A 4HNVA 1B9MA 3U1DA 3AG2H 3JAMK 4MNUA 3IP4B 3C3WA 1BL0A 2R7UA 3BTIA 3OYCA 2XAQA 2GA1A 3S3NA 2DOFA 3TKYA 1DUXC 1QO0D 5FFXA 3S3OA 4O6JA 6PAXA 1A35A 3S1MJ 3AKZA 2VJIA 4LK0F 4NNJA 5DCMA 2L54A 5HLHA 2E2JJ 2LY2A 2M4KA 4PSWA 1WVRA 2WTEA 4I6ZA 2LP0A 1XSVA 3ZMSA 1A36A 2RN7A 2D1VA 4DW6A 5IP6A 5A2QZ 5DEQA 3AAFA 2Z33A 4NHJA 5KCMA 3TDZC 4B43A 4IJAA 1P4XA 3R0AA 5BMZA 1FOYA 5F08A 4QIWN 5IT9K 3CCYA 3WU1B 1I5ZA 4KIBA 5J3LA 1A5JA 1JI8A 2VIXA 5LHGA 2GLOA 4X0GA 1LB2A 2E71A 2P7CB 2DI3A 3CUQA 5ILSA 3HSRA 3P7NA 4OWRB 4RBOA 1EH6A 4I09A 5E18F 2NVXJ 2EINH 1Q1VA 3ZR8X 4AU7A 4AVPA 3JRAA 3PSFA 1FP1D 1W5TA 2W7NA 1IRXA 2I10A 4HLXA 1U9OA 4PGHA 1I6HJ 3OYBA 1N75A 3VYSB 5FB2A 2CQQA 1LUJB 4RB0A 1LFPA 2DTRA 4B48A 4KT6A 1MBEA 2BEOA 1JTYA 3RKQA 2LR8A 1FEXA 4XM3A 2K3PA 4Y17A 5D8KB 3BROA 2ZBKA 4Y4RA 4EJTA 4B8XA 1HA8A 1ZAOA 1QZEA 1ITYA 1ERDA 2V9KA 2WAQN 5DCMB 2DA6A 2RNJA 1R1UA 2IBDA 3M8FA 3FX3A 3DP7A 3TL4X 3H9GA 1IAWA 3VYTB 2WADA 1YJWI 1E3OC 2H09A 3F9KA 2V6EA 3L09A 2L7KA 1PUEE 4PSXA 1UAAA 3IL2A 3HHGA 1IG7A 4EV0A 4MQVA 3IHUA 2ZJRF 4C3JJ 2VUMJ 2DA2A 1W7PD 4R8HA 4O3MA 2BVMA 4HF1A 2DMTA 4FISA 4RMNA 4IRHA 1V54H 1OYWA 1WJBA 2DA1A 3EETA 4BE1A 3ZQCA 2PMUA 3G6EI 3K4BA 4A12A 4D1QA 2XAJA 1F43A 2A6HF 3MD2A 3VYUB 1TC3C 4QTRA 1W4MA 3PO2J 5E17F 5C44J 1FMWA 1YW9A 1WI3A 3GWZA 4GRIA 4AD9A 4RA2A 3F23A 4ZYHA 3ABKH 4A6EA 3E6CC 4ZDPA 2XGXA 3OR2C 5A2QK 3CMEI 5IYBJ 4RM3A 2PJRA 5CLSA 3G2BA 2ZJPF 1DPUA 5B1BH 5EF6A 1QHHD 3MWMA 2DT6A 4B44A 1Z21A 2ZSIB 2MC4A 2QQ8A 3QP5A 3J7ZI 4HNUA 2HXIA 4II2A 4XMYA 1QU3A 4F91B 3COAC 3MN2A 4UUSA 3AG3H 5K7FA 4ZYEA 2AS5F 5F64A 1UELB 1ZK8A 3KP7A 1R5GA 2QA4I 1WJFA 4M3EA 1B72A 1PP8F 1BW6A 3SEZA 3IAM2 1W5CC 1FTZA 3LA3A 3HYIA 1I39A 1ETXA 3FXOA 4KYWA 3BDDA 1K7AA 1NHAA 3W6JB 5KK1A 2DA5A 2BW3A 3G3ZA 3S16J 2BHZA 1JKPC 1T95A 4Y3OA 3RSNA 2JWTA 1XSDA 3GTGJ 4DBRA 3C2BA 3H35A 1G4DA 3N4MA 1O4XA 1JKOC 2M30A 2JUGA 2E5NA 2EILH 5LFAA 1RI7A 2GA2A 3CO6C 1SAXA 3WTUC 3ISPA 1F5TA 3CP2A 4RLFA 4PK4A 3JSPA 1W5SA 3W6VA 2DJNA 2KZGA 2Y2ZA 4RGXA 2DFIA 1IRGA 2PJRB 1MMAA 1HDDC 3WE3A 3OYNA 3G73A 2DDBA 4ESBA 4ZJZA 3EQLF 3LAJA 2Z5UA 3PIPF 2HNHA 1JGSA 1B9NA 4Z2YA 3EYIA 4AWXB 2JA8J 1V4RA 4UUSB 3OOUA 4LLNA 1FOXA 3HZJA 2CUFA 3HOXJ 1Z7UA 1B72B 4EATA 1MMSA 1K4SA 2XPUA 3PNYA 5H2FC 2CW8A 2VT2A 4HAMA 1PUFA 2V4JC 4CCNA 3JRDA 5L3BA 5BOXA 1ZYRF 4KITB 2GOXB 3TO7A 3IH2A 1FYKA 3HRTA 1Z0XA 2LD5A 3OL4A 1OCRH 2BW3B 5L3GA 2VE8A 5E3NA 3TW6A 2EFPA 2M87A 2QKMB 3T8RA 3WODF 4A3MJ 4RDUA 2R7DA 3OL3A 3PIOF 2QENA 3NAUA 2LF7A 3FXMA 1HXDA 4I0BA 3MKWB 1JKQC 3MKYB 3BTCA 2LYCA 2JQ7A 2DYRH 4DBQA 1O57A 3OS1A 2KISA 1MKMA 2CUZA 2KHMA 2B9SA 2QF7A 1LPQA 4I7HA 2QSHX 4XIDA 2MBFA 1T0FA 2ZXHA 3I9V2 3CLOA 1ZH5A 4FX4A 3T1BA 3F22A 2IS2A 2P5LC 4M71A 3RI4A 2TDXA 3F8NA 3PM1A 4WCGA 4B4CA 3REOA 2JA7J 3F8BA 4EVIA 4UUTA 5K5OA 1ETKA 2WWYA 1P4AA 2NNYA 4FX0A 3ZMDA 5FROA 3B02A 2NVQJ 1WGXA 4CICA 2MC3A 2LKSA 2K3FA 3QU3A 1U8RA 3CCMI 5J1UA 3HDDA 1PUFB 4XLPF 3S3MA 4BY7J 3WTSC 2RGVA 1TBXA 1S72I 2DK8A 4OAYA 1UHSA 4Y7NJ 1ENHA 2QGUA 3G1MA 1OISA 2J5OA 5FRNA 4EJVA 3R61A 1S29A 3S1QJ 2FEZA 2XRNA 2KIUA 4UVBA 2DPUA 3E7LA 2Y48A 2D1HA 2OCCH 1R00A 3DEWA 3HSFA 2WBMA 3T5XA 3ZGKA 3W2AA 5BPIA 1ETQA 2FJ1A 1RC9A 3MZHA 3H1CA 2DK5A 2RDPA 4NBQA 5GP9A 4BL0B 1MZBA 2CFXA 1PVEA 5EEAA 2GXBA 1F4KA 2W24A 1MBKA 3A4CA 1MBFA 3K10A 3W6KB 3BG6A 2LY1A 5LD2C 3DEUA 5ILVA 3FISA 1WCMJ 4KA4A 3KEYA 3H3UA 2EH3A 3RYRA 1N78A 1UHMA 1XMXA 1O3SA 2XHKA 2CV1A 3FM3A 2E1NA 4S0HB 1ZGAA 3MZYA 4S05A 4ENNA 2QLZA 3VOEA 2XAUA 2H27A 5LEKA 1S3JA 1RKTA 4BEHA 2MH2A 5D5WB 1TNSA 4ASNA 3Q0VA 2CS3A 4E70A 1MBGA 4HOBA 4A6DA 1K79A 1SAUA 1FWZA 1R36A 3JRBA 1D8JA 2HQ5A 5E3MA 3TOAA 3DPUA 2Y31A 2ZB9A 5LHHA 4IOCF 4XLNF 4GXOA 4D5FA 5IP7J 2E1MC 4FTHA 2W57A 1ZREA 1FC3A 5BPDA 5L3FA 1TQPA 1XDUA 4KNYA 1X3WB 4HA8A 2HXOA 1TW3A 1J2XA 3E0JB 3H5AA 4IEJA 3DPTA 1QPMA 3MEXA 3CCJI 1KQ9A 4XQFA 5IY5H 5J8CA 2CG4A 2CUEA 2E60A 3FKIJ 2W82A 3IAS2 3OYMA 3BR3A 1U0JA 3KZIC 4E4HA 2HDWA 3W2WA 5LBQA 3KETA 2OTLI 1Z05A 4M9SA 2YPRA 2YU9J 1G2HA 5EZGA 3V7CA 1X4OA 1D1AA 1P7IA 4G6QA 3RQ4A 4BAYA 3CC2I 2DU9A 2D45A 2R7QA 4CSWA 2IXSA 5AIPA 3ZMVA 5CPRB 1K6OA 1SFEA 2VC1A 5ICCA 3I53A 3KYDB 5JLXA 2M9HA 3GTQJ 2VBXA 1ZRFA 4AYBA 5D4SA 1ZLKA 1FPQA 1S5LC 1X1AA 1FOKA 5HS9A 1J5YA 1IUFA 2XGEA 1RRJA 2IT0A 5H20A 2XPWA 2F5CA 3KFWX 3F0CA 4BQOA 4BEHB 3H9QA 1ZKGA 1JJ6C 3HOUJ 3LA2A 3SZTA 3WTWC 3TO6A 2VT3A 3BJOA 3B6AA 1R4MB 1YI2I 4IHYA 3KEOA 2XF7A 2KT0A 2L7ZA 1WWXA 2L9RA 2VJJA 3BWGA 4E6KG 1ZRCA 2R4GA 2OPTA 2Q2EA 2QVOA 2WC2A 3OOPA 4EGYA 4XR6A 2R92J 2GXGA 2OZ6A 2V7FA 1G3WA 1U5TA 2VBZA 1I6XA 2KZVA 4IXAA 4RGSA 5B1AH 4V19K 1VZ0A 1HLVA 2XKOA 5HLTA 4RB3C 3L9FA 2KDZA 2AQEA 2UXNA 3G1OA 5H6QA 1YS7A 3MVPA 5CVIA 1N25A 4IHVA 3M4OJ 3LFKA 3SJMA 5IOYA 2QEXI 2NS0A 4CCLA 5HVQC 1FIPA 4D9JA 2YSRA 3ZQHA 1YE9A 2F2EA 2MSYA 1HC8A 3QYBA 4U88A 3ZN0A 1MIJA 3CTAA 3TQNA 3FXQA 1XMKA 1SFKA 3VB2A 3F21A 1JE8A 1SMTA 3V4GA 2STTA 2DA7A 4ABZA 4CCKA 4UY8I 3FHNA 2ZFUA 1TWHJ 4HSTA 1WZ2A 2W00A 5HDKA 2O3FA 4M3GA 3OYDA 4P1WA 4UHTA 3AG1H 1YLFA 4HX8A 3OYGA 2Y0MA 1ETWA 2ZO4A 4XKCA 1J59A 2KRFA 5HS8A 3BR5A 1U9NA 2FRHA 4HW0A 3M3YJ 3OSFA 1XGNA 2ZNZA 2X6XA 4IRIA 4YIIA 5IYCJ 3BZKA 3BJAA 3KE2A 2M2EA 2Z1DA 4A3IJ 3U2RA 5EJCA 2CFOA 1QA6A 2K02A 3OY9A 2Q2EB 4PFPA 3DXJF 1G3TA 3FBNB 2UXXA 3LNQA 1U5TB 3O8GA 1MNDA 2NAZA 2O6GE 3R6SA 5L3EA 5GPAA 2BV6A 2FMYA 3QPHA 1YTYA 1AWCA 3GO5A 4MEYF 1FP2A 3AL0B 1WJ5A 3MMYB 4LMYA 2VXZA 5DM6F 3MQ0A 3ZQ7A 4KIGA 1HW2A 2K9NA 1ODDA 3GFLA 1Y0UA 1T6SA 1GUUA 2K9LA 1H8AC 3LA7A 3K4MA 5BS6A 2PJPA 1TWGJ 3DCFA 3M1CA 1BI0A 3LSIA 2FU4A 4LLLA 2IW5A 1BJZA 4KIFA 5B66C 4IX7A 4U7BA 1JTXA 3SHFA 2HU9A 5J1YA 2LFBA 3TOBA 3EUAA 4OIRF 4E7HA 3ERMA 3QPTA 1ZQ3P 2Y0SN 4PDKA 1W1WE 3CO7C 1X1PA 1Y8RB 3OYAA 3BQZA 3ASOH 4OOIA 3F8FA 1OCZH 2DT5A 1WI9A 4I0AA 4ZH4F 3E5QA 4HNTA 3OS2A 1DQUA 2IS4A 2LREA 1XC5A 2R5ZA 5CVRA 1SFUA 3H3ZA 1B1BA 5FKOA 5FO5A 1C0WA 1R5ID 2OF7A 1AU7A 3I64A 3U1KA 4DZPA 1SD5A 3FM5A 1EF4A 2ZMEA 2LH9A 1BJAA 1VQMI 3HHHA 1A6QA 4B09A 4HF2A 2MD5A 1ZGWA 1OFCX 3HM5A 5ED4A 2QYOA 3WGGA 5E1ZB 5B5EC 3MFKA 3GBGA 1I1GA 3BR2A 1A31A 2VB6A 2BE5F 1LEAA 2L2OA 1S7AA 1FSEA 2R7XA 2JUCA 4XL9A 4ETSA 2LBFA 1P7JA 4IF4A 4KUMA 9ANTA 3GTOJ 5BNGA 1TWAJ 2JSPA 5HS7A 2IAIA 2K85A 4WXHA 5GAGJ 1R49A 3F8MA 2EPFA 1IN5A 2E5ZA 3FWEA 3M8EA 2COBA 3RYPA 4ZYGA 2YX4A 4HZFA 5EDNA 1VQ9I 4XORA 4M9XA 4L9TA 1DGRM 2F5FA 2M8GX 2V1XA 4RAFA 1IRZA 3CJRB 1G59A 4LITA 1WPKA 3WHBA 1KYZA 1JHFA 4KDPA 2X1DA 1VQ6I 2EZHA 1YG2A 1QNTA 4UB6C 3WTTC 2FUG2 5HNFA 5C3EJ 2R5ZB 2LNBA 3GZ5A 3LSJA 2M8EA 1QGPA 2JPBA 2OAZA 3TMOA 1NH3A 2M1BA 4L9VA 1UZCA 5FD6A 3D1NI 2ZMEB 5CQEA 4QSHA 4LFUA 2P4WA 3I71A 4FETA 4C3IJ 3OYJA 3L00A 3VSLA 4XRMA 2BZTA 3P9IA 1K61A 3DKYA 4OIQF 4U87A 2XF5A 4QLCU 1B8IA 1XD7A 3O8HA 4DIQA 2MW8A 2Q1ZB 4M74A 3WU2C 1FSHA 2FF4A 2DYSH 2QZ8A 1HOMA 1IJWC 2HYJA 2LY9A 4BQAA 4DZJA 3SZPA 3IKTA 1V5FA 2EFOA 2NOGA 1ULYA 3GTPJ 1S7EA 3WTVC 2ZJ2A 2ID6A 1I1SA 4C2TA 2PEXA 2AHQA 2GBYA 3I5UA 1BIAA 3MKLA 2ZJQF 1XX5A 1WJAA 1MJAA 1FBSA 3BG9A 2VN2A 3CDLA 1TWCJ 1LDKB 1LNWA 3GUDA 1MSEC 1F1ZA 1KU7A 1LKXA 4LB5A 4ZYAA 1YS6A 4DYCA 2QM3A 3RPQA 2ADUA 4ZDLA 3LSRA 5IT3A 1Y39A 3OYKA 1POGA 3CCRI 3MKZA 1PJRA 2DMPA 3HG9A 5CJ9A 1XDSA 1QRYA 3FK6A 1RUOA 1JJ8C 1USTA 4X1EA 4PJLA 3K1PA 1YJ9I 1YJNI 5E1XA 3EPZA 2VONA 1V5GA 1BC7C 3CUQB 1TQMA 4ENKA 2C6YA 3N97A 1MJBA 1MDMA 1EH8A 2DQRA 1LFBA 2HOAA 5FKLA 3E1SA 1U6GA 1VNDA 4ESFA 1LVAA 5K1YA 3J80Z 1IXRC 2DXIA 2R7SA 5ERIA 2TCTA 3GLXA 3RZOJ 3KP4A 4UXNA 1LEBA 4IPAA 3HJEA 3BT9A 2OUMA 3ZP5A 4M3FA 2YU3A 4AUXA 2BBYA 5FRMA 3FXJA 4EEFG 5CYVA 2O61A 1YHQI 4FCYA 3RDIA 1X58A 1OR7C 4LIUA 2X85A 3G4SI 1H0MA 2ZXWH 3F6OA 4ITVA 4XRFA 5D6EA 5M3FJ 2I8DA 5IP9J 5DD4A 1OCOH 4XN0A 2KIFA 2XV4S 4M73A 1P2FA 1KU2A 2QWWA 5BQTA 5F0HA 4BHPA 1FT9A 3FMSA 4IRGA 2DA4A 4PJMA 2Z2SB 5EG0A 3TP0A 3H0DA 3FMRA 2K5CA 3LSTA 4G7OF 4AYBN 1CGPA 4OMZA 4F3QA 1QQIA 3GZ6A 2G9WA 4J01A 2OD5A 3LMMA 1W36D 3SQNA 3BCAA 3IRRA 3K2ZA 3V7RA 1E3HA 4V2GA 2MGQA 2KRCA 2JRMA 4OIOF 2YS9A 2QKLB 3JREA 1VQ5I 1IN8A 1HKSA 2IVMA 4K2EA 4JX6A 4XLAA 1E2XA 3J81Z 4MEXF 1QPIA 2HWVA 4YIRX 2DBBA 3HRMA 3HOWJ 1MW7A 3BLYA 2F4MB 4PZJA 2DQLA 4UB8C 4I01A 4JX4A 1KA8A 2CV2A 1XN7A 3GTLJ 5E20A 3GX4X 4B1RA 4U0WA 3GTMJ 2E34A 4CCJA 2VLAA 5JHUA 2ELJA 2LKXA 3L2CA 4IHWA 1IN4A 1MMDA 3AFHA 2V9VA 1FNNA 1YYVA 2OJED 3B6CA 1VQ8I 3K2AA 1D5VA 2XDVA 4N9HA 1DGWY 2ELHA 2H6BA 2XRLA 3LSPA 1SEUA 2P6TA 2DOAA 3GW2A 3G71I 2BYVE 2Y0SA 1Y1WJ 2NRAC 1ORKA 1Z3YA 3Q0WA 2L02A 3S32A 1EH7A 2GOMA 1D0ZA 3EDPA 1X3ZB 4G6DA 4CYDA 2QSGX 3I0TA 2X51A 3QU6A 1T56A 2CJJA 2R0QC 1TQIA 3M1EA 5FJ8J 2NOJB 2EV6A 4HX7A 4QWQA 2DMNA 2L3DA 3HIFA 2OC6A 1SD6A 5K7HA 2HKXA 3J80K 4A3BJ 2X1EA 2KFDA 2L4AA 1F9NA 4N9IA 3DBLB 5CKTA 2JK3A 3V42A 2MABA 1IC8A 4YFXF 3OIOA 3FBIB 4RGUA 4XKBA 1OCPA 1X2NA 3FDYA 5DD8A 1IO2A 4KJZA 2R7VA 3PUFA 2OA4A 4BXUA 2KJBA 5JFRA 2STWA 2IGKA 1D8KA 4C30A 2A07F 2W48A 4M6XA 2H1KA 3CD6I 4A3GJ 4QPQA 2H8RA 1TT0A 4EM0B 1TTYA 4CCOA 3WTXC 4AIJA 1X19A 2X1CA 3I56I 4HEA2 5FD5A 2X6WA 3K1MA 1IXSB 5F6FA 1ACIA 1J9IA 4L9NA 4IL6C 2LSOA 1ZARA 1BC8C 4PGGA 2FE3A 4HLYA 1LE8A 2DOEA 3SXYA 3OSGA 1Z1DA 3GFJA 1BI3A 2HGCA 1D1CA 2FBKA 4L9JA 5AIQA 3BTLA 2J5PA 1TWFJ 3RKXA 1ETYA 2G7HA 2MH9A 4PFOA 3DPLC 3J81K 4KN4X 2E7WA 2VL8A 5D5XB 3MZ8A 3KYLA 1NG6A 3GTKJ 5FLXZ 4AC0A 2EIKH 3SDGA 1IF1A 3KYCB 2A6EF 2ME0A 1VFCA 4S04A 3BC8A 3RPUA 2XPVA 1HW1A 2G7UA 2UWMA 4Y52J 3C18A 1BR2A 3IH4A 3LSGA 5FLVA 2CQNA 2JVGA 2XAFA 4I98B 4A5NA 5B3SH 2WY8Q 2BY2A 2Z3YA 3OYEA 1UCRA 2VQGA 3GXOA 3O6BB 4KMUX 1T8IA 2COMA 2CW7A 4M9ZA 3H5RA 4KISA 5AONA 4EMSA 5LGTA 4XBFA 3L1PA 2P6SA 2EBIA 3Q9SA 4N4OB 2KL4A 1JUSA 5ICGA 4E7IA 1BM9A 1E0EA 4I99C 4XICA 1LE8B 2B7EA 1AOYA 5F1RA 1LQ1A 3M9AA 2FA5A 3M8JA 1UG2A 1SVLA 2KMUA 4BDZA 2EV0A 2R5YA 4BS9A 3FXRA 3KP6A 5E8IA 1APLC 1R22A 3KZYA 4CUGA 4D7MA 4BU2A 3WGHA 5H6RA 2GXAA 3RZDJ 4WK8F 1CQTA 2EB7A 2FX0A 3QQAA 2HYFA 3LL7A 4MIMA 5K5RA 5HODA 3SYTA 3JCUC 2HPMA 2FQ4A 1GVDA 2XF6A 2DO7A 4Z6YA 4Y15A 5CVJA 1HKTA 2M7BA 3DWLE 1Z6TA 1WRJA 2FQ3A 4RAYA 3T0YA 1KU9A 5DCFA 3I4MJ 3CZ6A 3FXUA 1T39A 1O3RA 3JRCA 3LSKA 4A3CJ 3CDHA 4C9YA 1ZG3A 3HUGA 5M5XJ 2IS6A 3Q0UA 2XB5A 1A6IA 4FT8A 2OQGA 2W84A 2HDCA 2DAOA 2BGCA 2DODA 5ICEA 2R7FA 3OYHA 4BHBA 4M72A 2HOTA 2DFHA 2DN0A 1V55H 1QVUA 3PNVA 3ZQGA 3V8JA 2BXYA 3G1LA 3D0SA 1O7FA 1FOWA 3JSOA 2DMQA 2QQAA 3BTJA 4LJZF 4M3BA 3ABUA 2D5VA 1GLNA 5FLXK 5M5YJ 2QCOA 4MFDA 3HOYJ 1K83J 3WU0A 3VFZA 1OMIA 5M5WJ 2R5YB 4CHUA 3HPGA 1BN5A 1ZHFA 1ZGJA 2Y9ZA 4RS8A 3JTHA 3F8CA 1HBXG 4GDFA 1Y56A 3I59A 2F5VA 5CVUA 2KLOA 1YW7A 4NC7A 4CA0A 1VQOI 3HL2A 1Z67A 2O8XA 4Q47A 1KQ0A 3ZMZA 1G3SA 2VKVA 3S14J 3X2QH 3A1YA 1MJ9A 2ID3A 4YELA 2MG4A 3AL0C 4OMYA 1BW5A 4IQJA 1YO5C 1IN7A 1P92A 3PJRA 5D5UB 1LDDA 4J19A 4YIFA 5FLMJ 3E6DA 2VXDA 5EZHA 4QPOA 4HV6A 3S2HJ 2HKOA 3HUGB 5J1RA 4MHGA 4UVAA 1XMAA 1KGSA 3FKJA 1AA7A 1IRFA 5ICFA 2Z9OA 2W4SA 1NK3P 4N4NB 1EKEA 2VC0A 4BJTA 4BJ6C 5L3CA 3S1RJ 2M5WA 4ZDOA 4MQ9F 5LHIA 2O5RA 3RJPA 2ZNYA 3FF5A 2EZLA 2IPQX 1JT6A 2E1CA 3GLLA 1WJCA 4XOPA 3UNGC 1H9TA 2HDDA 4I2OA 3E5XA 2XAGA 4MFEA 2JPCA 2XSDC 3QOPA 4BKXA 1YITI 4ENMA 4YRVA 2FOKA 3L2RA 5HLIA 5JVGF 3TEDA 3ECHA 4KICA 5JHFA 1BA5A 3HXLA 3GTJJ 4UV8A 2GIVA 3KX2A 2G0EA 2ISZA 3QRFF 4AM3A 2EK5A 3I59B 1YFHA 3HRUA 4H0EA 2OV7A 3K6GA 3BR1A 2EA2A 3D5RC 3HC7A 1XB4A 2V26A 2Y69H 1IW7F 3WHCA 4XK4A 1G3YA 3MAJA 4HQMA 4CGZA 3CDIA 4R79A 2W1OA 2W25A 1LFUP 2JRTA 3K0LA 2LKPA 1Z91A 2HZDA 2PG4A 3DKXA 1RZ4A 1GXPA 5FFZA 1OCTC 1HDPA 2PN6A 4IO9F 4EM1A 1B6AA 2FMLA 4ZZLA 5GPCA 2EZKA 1S7OA 3K4KA 2XAHA 2FBIA 3KEQA 2CQXA 1G6NA 1FBUA 1VQPI 2VQLA 3JW4A 4A3KJ 5D8LB 2L7MP 2EWNA 3C7JA 4OAZA 2HZTA 3PQJA 4IOAF 3BG3A 4A0YA 5EEGA 3F3XA 4NQWA 3RKYA 3F6VA 1J75A 3CC4I 1B4AA 1SC7A 2KKOA 1WH7A 2KPMA 3NEUA 1U2WA 2K9MA 2IA2A 2WB1A 2CUJA 2JA2A 4WWCA 3RTRA 5HLGA 2M0CA 2ETHA 1T08B 2NXNB 3I4NJ 1FX7A 2AXLA 3OIPA 3OIQA 4KN7X 4NUBA 3NWSA 1BI1A 1FY7A 2IGMA 5D5VB 4L0YB 2Q8KA 2RC4A 1ZN2A 3JRIA 1D3YA 2GIZA 3O3KA 1MSFC 1T98A 4XLEA 1FJLA 2VKHA 3ABTA 2R7WA 2K27A 2V79A 3N05A 2DDAA 2A5WA 4I76A 3DV8A 2VJ5A 4CZZA 1PYVA 1GT0C 2AQFA 3DBRB 1O3TA 2BY0A 3AG4H 3I3LA 1LJ9A 2RV8A 3K1NA 1WSUA 3BR0A 1XGOA 3C2HA 2NNNA 1QZYA 3CJQB 3F72A 1H88C 1VQLI 4XONA 2YUSA 3V8LA 4BACA 1DPRA 2EZIA 1KQ8A 3KZZA 1R23A 4XNFA 3IWFA 1D0XA 3BJ6A 2VI6A 1WQ2A 2PLYA 2ZXJA 4RB1A 3K7AJ 4C2UA 3A01A 5F04A 3CF2A 4V2FA 2GQQA 2OU2A 2Z16A 3DF8A 2RNGA 2OZUA 1XS9A 2HOSA 2O03A 2BY1A 1JUPA 3LSMA 3P5JA 3BZCA 4EM2A 3ASNH 4IQ4A 3E3VA 2CSOA 2EFNA 1WKMA 2LMDA 2VBWA 2NS7A 2O9LA 1I50J 1O3QA 2M0MA 2X6OA 3HSEA 4G7ZF 1K4TA 3DTEA 2CQKA 1W7PA 4CDGA 4BQNA 3J7AO 4P55A 5LLQA 3ZMUA 4E7KA 2RAEA 4E7SA 5E3LA 1ZRDA 1W36C 3SDBA 4BUPA 1D0YA 2BVLA 3KIOA 3DU5A 4YFNF 4U0YA 4LLGF 1ZLJA 3EUHA 4FE4A 3WGIA 3CF5F 3DLAA 4DOZA 2PQ8A 5J4VA 3WTYC 2EFQA 1RNLA 3EUKL 1X3UA 2A05A 5GAHJ 2KQRA 4NC6A 3CUQC 3JR9A 4CXFA 1L0OC 2P5KA 2IEKA 3H92A 1HSJA 2ICWG 3BZ6A 2IA1A 2QQBA 5DUKA 1RR8C 4RAGA 3ZOBA 3TO9A 3H36A 3BY6A 1MGTA 2MLGA 2R93J 3HOVJ 2DJIA 3BCBA 1YRNA 2WAFA 1OQYA 1PDNC 5J40A 3A03A 3I4PA 1MBHA 1IXCA 2PFBA 1F36A 1JHHA 4UVCA 5L3DA 2XGCA 2E19A 4XLFA 3HPHA 3FXLA 3IWZA 3A01B 2Y30A 1XGSA 3ULQB 4LG3A 5LRSA 2VKEA 2K86A 1OPCA 4A69C 3LWFA 1REPC 5HDGA 5HNHA 2UV1A 2QSFX 4FASD 4F7ZA 4E7JA 2V1UA 4AIDA 4R1HA 4YFKF 2R7RA 3JRHA 1VI0A 1W7PB 1G8XA 4ZTJA 4L18B 2O0YA 1DP7P 4CYCA 3FK7A 3BPVA 2CMPA 1S8NA 3OV8A 1HF0A 1X1BA 2LBFB 2ECBA 2Z99A 4G94A 1RR7A 5EEHA 4GO1A 4PCQA 1TT5B 4BE2A 1USSA 4UNOA 1FYMA 4MGRA 4JYKA 2DFFA 3QYEA 3CQZJ 1BOBA 2OTJI 2RQPA 2X6YA 3ONQA 1XCVA 3ZXSA 4EJWA 4U7DA 3H0GJ 2CH0A 1MH3A 4DGWB 3ELKA 4Q5SF 2P7VB 4GYGA 5IYDJ 4WX9A 2NYXA 3RKWA 5J6XA 1R1TA 1XSXA 3HEFA 3GVAA 4B47A 1ETVA 3KCCA 1YRNB 2XASA 5E79C 1JXSA 3QPLA 4O5VA 1XGMA 2PBIA 4ZC3A 3I58A 1S9HA 3IUOA 1W0TA 4CO8A 2ZCWA 1AHDP 3ABLH 3DBHB 2OCEA 5D6FA 1LVKA 4CZCA 3W2VA 4BE0A 3CLQA 2VPLA 1GV2A 3HTUA 3QOEA 2A69F 2KP6A 1EA3A 4BYYA 2DW4A 2X4HA 3JRFA 1ZR4A 2A5YB 1EV7A 1FMVA 2NVUB 3S15J 5E1WA 5LGNA 1TL8A 4LIVA 2V6CA 4UV9A 5TGTA 4I02A 2PX9A 1B8IB 3PL8A 3TBIA 4X6AJ 1YIJI 2XB0X 1VF9A 1X2MA 3TW7A 3HB9A 1WJEA 2ESNA 2XVCA 4CYCB 3ZN1A 4LB6B 1XPXA 2WAEA 2JZYA 1IGNA 3K70D 4C2MJ 2HR3A 5HDNA 2NVYJ 1QHGA 2F4IA 2DLLA 2UZKA 3Q5FA 4IVNA 2CYYA 1HSTA 3CCLI 5TISC 1KZHA 1SANA 1MNEA 4DQ2A 2K9QA 1BBYA 4ZTFA 2GWRA 3LOCA 4HV5A 2LF8A 2WV0A 3WTZA 4P9UA 3RIRA 1IV8A 2LG4A 4IHTA 5DTDA 4EQQA 2VQCA 4DNCA 4B3XA 3H5NA 2XGDA 2FBHA 2LTPA 3VDXA 2LOOA 2GAUA 2HFHA 4HF0A 2HQAA 2W85A 1Q1HA 2EFWA 2HQNA 1V3FA 1P9QC 3LFUA 3VODA 1P4WA 4HG2A 4BXFA 2VE9A 2LRDA 2QQ9A 4MTEA 3J7YJ 2E2IJ 3DFGA 3R0JA 5J4YA 1Z9CA 2FXAA 1MDMB 1UMQA 1JUMA 1VQ4I 4B3AA 2BOLA 4GGGA 2XUBA 2M45A 1JT0A 2HOEA 1UJ8A 4FHTA 1YX5A 3DTKA 1OR7A 4BY1J 2QBYA 1UB9A 5DDGA 5CQGA 2NVTJ 2VJ4A 1ZG1A 2EJRA 3ZPLA 2P8TA 5GAEJ 5TRDA 3PSIA 2JVHA 2I5UA 3S17J 2A6TA 3ECOA 1BR4A 2N8GA 3JRGA 1Y6IA 1NG7A 3A02A 4UUVA 5F27A 4ON0A 2F4OB 5ILUA 1GDTA 2L5QA 5M3MJ 5LEJA 1Z6RA 1SD4A 2HVQA 2O8KA 2O7OA 3D5LA 1IV6A 3UR3C 4HDUA 1VQNI 3CCUI 1D1BA 1FIAA 1SVMA 3HKZN 3HBLA 3SZGA 5EG0B 2DCEA 3M7GA 4NC8A 1L3LA 1BIBA 3KP2A 2KRHA 4TV7A 3HGYA 5CVVA 2CRGA 5DS9A 4EJUA 3VYRB 2R7TA 1WHUA 1T0FC 3QPSA 5K7ZA 4Y33A 4XN3A 1ZG5A 2F5DA 1JKRC 2ISYA 3NARA 1OCCH 1R1VA 1MBJA 3VSKA 3H3VK 3A0HC 3PFIA 4W97A 2LC2A 2CGPA 1Y8QB 1VQ7I 1MH4A 1SVOA 3D5SC 1MD0A 5KHDA 5DM7F 1VQKI 3ML6A 3HTSB 4IZZA 3ABMH 4GYIA 3O2PE 3E6MA 1RUNA 2KIMA 2IRFG 5DV5A 3J7AY 2QBYB 2F5EA 2BXZA 1R5HA 2V1DA 3ERED 2DA3A 2D2WA 2XC7A 1W0UA 1KONA 1I3QJ 3HOSA 4DYRA 1RESA 1SFXA 4XSXF 3GFIA 3RCOA 3C2GA 1TNTA 5J8FA 3PNTA 4ANJA 3KP3A 4XRSA 3GMEA 2IGOA 4A0ZA 1M1EB 2WB1N 4KFCA 2ZSHB 2DMUA 3A0BC 4LG0A 4BNCA 3A2KA 1QVTA 3HOTA 4ZYDA 1IN6A 5J47A 2QUFA 1TP4A 4JBAA 2L9VA 4ZZDA 4F92B 4L0ZB 3FXKA 1BI2A 1IDYA 2OQRA 4A2UA 1NTCA 3K4LA 4II3A 1X1DA 1ON1A 4E7ZA 2K7LA 2VOOA 2L4MA 2LDUA 4JQFA 5K5QA 1U3EM 3OWTA 1TLHB 3IRQA 2CWEA 3QODA 3QAHA 3C1DA 4XLHA 3VPRA 1BOAA 2JT1A 4OINF 3MCZA 5JLWA 1UG0A 1H89C 3WG9A 1J7KA 4RM2A 3CC7I 1TZLA 3FZVA 4M6VA 4YG2F 1MMNA 3P9CA 5JR3A 3CMAI 3KPHA 4XKVA 4DYQA 3K69A 4F55A 5FGMA 4A5MA 4D5CA 4G9YA 2PMZN 1DP3A 4EGZA 4PJJA 4BXXJ 1U8BA 2K40A 2A68F 1Z77A 3CESA 4L5EA 4P96A 2CU7A 2EQRA 1AKHA 4G6TB 4FQGA 2EIMH 2DFEA 1Y0NA 1RKWA 3DKWA 2RREA 3OYIA 3U21A 2DTZA 1ETOA 3PUBA 1YW8A 4BBSJ 1E3PA 1J0RA 3K4CA 3V8KA 3LSHA 4EJOA 4LG0B 2HVSA 3L2UA 4IHXA 1UHWA 1GVJA 2VPRA 4Q48A 4GFBA 2BY3A 3KLOA 1RPWA 2TRTA 3GZNB 2Q0OA 2PI0A 1QZZA 2VKDA 4BHCA 4NDLA 3TDUC 3HOZJ 3LQRA 1OJLA 2F48A 2H6CA 2IJLA 2WAQA 2WY7Q 2XSJC 2HQRA 3ZQLA 2P5VA 1R58A 2L0KA 4A0XA 2EA4A 2E7XA 3ZRGA 3R60A 4H4KC 5EGOA 1GXQA 4ENJA 3DU6A 2E35A 3FHZA 2E36A 1SD7A 2HTJA 3BQYA 2IP2A 1JGGA 3NRVA 4L5JA 4RB2C 4M3DA 3DLLF 3HRSA 3TP3A 4G7HF 5EYRA 3UKGA 4MTDA 4Q4ZF 3IH3A 1TW2A 2CW0F 1A04A 1EJ9A 5FKKA 2X9DA 4JOMA 5GADJ 3GF2A 3RQIA 5FKNA 3S2DJ 4Y13A 1KYWA 4YEJA 1Z7LA 3CP8A 3QP6A 4BJ5C 3S1NJ 1J09A 4A3DJ 2IS1A 2MLKA 4XOTA 1AKHB 2IGNA 4BQQA 2B0LA 3L7WA 3OS0A 2CO5A 2VOPA 3IKVA 2KJCA 1WFXA 3B73A 3SFIA 3K4JA 2R3SA 5F0CA 2E2HJ 2JA6J 4G12A 4WXCA 4ESJA 3GFMA 1R4NB 3LQQA 3BP8A 1MNMC 1ZELA 2H8WA 1E17A 2DPDA 2WV1A 5E3OA 5TJJA 1STZA 2VODA 2FNAA 3ZMTA 1U5TC 3OYFA 3OR1C 3KP5A 2XROA 3HGGA 1FTTA 4BDYA 2OBPA 2L9SA 4IHSA 3DQVC 2M3AA 3I54A 1I27A 2GZWA 3GCMA 3FIWA 3PO3J 3VEPA 5EGOB 5F1JA 3RPUD 2ACJA 2ECCA 1V5EA 4LGWA 2WA0A 3CMMA 4M6YA 1IUYA 2IA0A 1HQCA 3R4KA 3NWTA 4HQEA 4HPQA 2M7AA 3L2QA 4OIPF 1YX3A 2HYGD 3U9GA 1R6RA 2EIJH 2A3SA 1MMGA 2LLKA 2VASA 4BBRJ 3BG7A 2E1OA 2DT7B 4D0PA 3BG5A 2KIQA 4BGDA 1SFOJ 5GTIC 4AVZA 4HYEA 4WXDA 1XTAA 3BPXA 1P6RA 1N77A 1IDZA 5DYMA 2JMWA 4AIKA 1OKRA 2HI3A 2LK2A 3ESWB 4HSRA 1T38A 1IZ1A 2Y9YA 3ROUA 3OMYA 1FBQA 3S93A 2ELKA 2UUZA 1O7LA 3DEEA 2B63J 2ESHA 4XSZF 3HKZA 1R9TJ 1OYIA 2JJ7A 5GTHC 4LK1F 5KVRA 1HW5A 2A61A 2H1LA 4MO7A 3CCQI 4A93J 4XLCA 4A3EJ 1FZPB 1WH5A 1CF7A 2VQHA 3TGNA 4N0BA 3JTGA 3IC7A 3WE2A 2E1MB 2JA5J 2JSCA 1DU6A 3L2WA 1XCBA 2ZFWA 2RQQA 2K4JA 4WF2A 1S6LA 2K9SA 4XKWA 2ZXIA 4XRSG 2AO9A 3OYLA 4CH7A 3QWLA 1I3AA 2M34A 3Q9VA 4A3JJ 1HCRA 1X4PA 2Y75A 2V1NA 1DDNA 4KT5C 4AIHA 3M07A 3BR6A 5IPAA 1GV5A 3V7SA 4RGRA 1D5YA 2L01A 3DTIA 5F0FA 5LRRA 2HEOA 5IOZA 4OU0A 1R71A 3E97A 2YR2A 3ZQIA 5HOOA 2PMHA 4PJ0C 3H9JA 1NK2P 1ONVA 5C4JJ 3JAMZ 3P9KA 5E8GA 1RETA 3SEQA 2VBYA 3VWBA 4J00A 2X48A 4P5OA 2FOWA 1K78A 4JX5A 2RKHA 2NS8A 3SFZA 2X0LA 2FNPA 4HBLA 1H9GA 4GCVA 3E5UA 3BOQA 2HPIA 3Q3SA 4F52A 2XKPA 4RLQA 1GHCA 3CCEI 2F6CA 2CV0A 5JVTA 2P0WA 2HVRA 4LD5A 1ZR2A 2MYSA 1B59A 2CQ7A 5KAIC 1WJDA 2ZMEC 2JN6A 3K4NA 5IT9Z 1CF7B 3I55I 5KAFC 1DU0A 1K6YA 2MA3A 2LVSA 1XG1A 1FLIA 2FD5A 3WG7H 3T8TA 1R7JA 2ZKZA 2XIGA 3FMQA 4HX4A 1OLTA 5JI6A 1KU3A 2M4GA 2L9NA 5D4RA 3K70C 1HKQA 1Z3XA 4FE7A 2KDOA 3S8PA 4G8XA 5C4XJ 4IKFA 4PJNA 1YQAA 1ZTRA 4NB5A 3CCSI 4KMFA 3EUHC 4U0VA 4A3FJ 2MFZA 1T2KA 1BR1A 3K9TA 4RAZA 5KNLA 3CMYA 3ZQFA 3EYYA 4F93B 2AXTC 3PQKA 1OYYA 1T33A 2PMZA 4DJAA 3CJTB 4JP0A 4LOCA 4C3HJ 3L2VA 3KLNA 3E6BA 1QBJA 4MLOA 1LDJA 2EV5A 2R7OA 4PUSA 4W1UA 4NQWB 3W3CA 3PFYA 2R7ZJ 4A3LJ 3CCVI 1U78A 3NQOA 2JTVA 2RVCA 1K78B 4HDVA 2YX7A 3CUOA 5FKMA 1YOVB 3IV5A 3CJNA 4E7LA 2P81A 1VTNC 2V9PA 2MD0A 2FSWA 1FYLA 1ON2A 2GM4A 3GYHX 1YIOA 4D7NA 1Y1VJ 3ZQQA 1PP7U 2L7FP 1RIOH 2ZC2A 2H94A 3LAPA 3ZCOA 3S2WA 3GEZA 4L5IA 1UFMA
chains in the Genus database with same CATH topology
4JK1X 2HTSA 5DUIA 2K4BA 2HS5A 5LGUA 1SMYF 4P9FA 4BH9A 1B9MA 3U1DA 3JAMK 4MNUA 3C3WA 2XAQA 2GA1A 1DUXC 3TKYA 1QO0D 5FFXA 4O6JA 6PAXA 4LK0F 5DCMA 2L54A 5HLHA 2WTEA 4UUVA 1XSVA 3ZMSA 2RN7A 2D1VA 5A2QZ 3AAFA 2Z33A 5DEQA 4NHJA 3TDZC 4IJAA 1P4XA 3R0AA 5BMZA 5IT9K 3WU1B 1I5ZA 4KIBA 5LHGA 1LB2A 2P7CB 2DI3A 3CUQA 5ILSA 3HSRA 3P7NA 1EH6A 4I09A 5E18F 4AVPA 1FP1D 1W5TA 4HLXA 4PGHA 5FB2A 4RB0A 2DTRA 2BEOA 4Y17A 5D8KB 3BROA 2ZBKA 4EJTA 4B8XA 1ZAOA 5DCMB 2RNJA 1R1UA 3M8FA 3FX3A 3DP7A 1IAWA 2H09A 3L09A 1PUEE 3IL2A 3HHGA 4EV0A 4MQVA 3IHUA 1W7PD 4R8HA 4O3MA 4HF1A 4IRHA 1OYWA 3EETA 2PMUA 4A12A 2XAJA 2A6HF 1W4MA 5E17F 1YW9A 3GWZA 4AD9A 3F23A 4ZYHA 4A6EA 3E6CC 5A2QK 2XGXA 5CLSA 1DPUA 3MWMA 3QP5A 3COAC 4ZYEA 2AS5F 5F64A 3KP7A 1R5GA 1PP8F 3LA3A 3HYIA 4KYWA 3BDDA 1K7AA 1NHAA 3W6JB 5KK1A 3G3ZA 1XSDA 1G4DA 3N4MA 2M30A 1RI7A 2GA2A 3CO6C 1SAXA 3WTUC 3ISPA 1F5TA 3JSPA 1W5SA 4RGXA 2DFIA 1IRGA 3WE3A 3G73A 4ESBA 3EQLF 3LAJA 2Z5UA 1JGSA 1B9NA 4Z2YA 3EYIA 4AWXB 1V4RA 4LLNA 1Z7UA 2VT2A 4HAMA 5L3BA 5BOXA 1ZYRF 3TO7A 1FYKA 3HRTA 5L3GA 2VE8A 2EFPA 2M87A 3T8RA 3WODF 2R7DA 2QENA 2LF7A 1HXDA 4I0BA 1O57A 1MKMA 4I7HA 2MBFA 1T0FA 3CLOA 1ZH5A 4FX4A 3T1BA 3F22A 2P5LC 4M71A 3RI4A 2TDXA 3F8NA 4WCGA 3REOA 3F8BA 4EVIA 5K5OA 2WWYA 1P4AA 2NNYA 4FX0A 3ZMDA 3B02A 4CICA 2MC3A 3QU3A 1U8RA 4XLPF 3WTSC 2RGVA 1TBXA 2DK8A 2J5OA 4EJVA 3R61A 1S29A 2FEZA 2XRNA 2KIUA 4UVBA 2DPUA 2Y48A 2D1HA 1R00A 3HSFA 3T5XA 5BPIA 3MZHA 2DK5A 2RDPA 1MZBA 2CFXA 2GXBA 1F4KA 2W24A 3W6KB 3DEUA 5ILVA 4KA4A 3H3UA 3RYRA 1UHMA 1O3SA 2XHKA 3FM3A 2E1NA 1ZGAA 3MZYA 4S05A 4ENNA 2QLZA 3VOEA 2H27A 5LEKA 1S3JA 2MH2A 5D5WB 1TNSA 4ASNA 4E70A 1K79A 4HOBA 4A6DA 1FWZA 1R36A 1D8JA 3TOAA 5LHHA 4XLNF 4GXOA 2W57A 1ZREA 1FC3A 5BPDA 5L3FA 1TQPA 1XDUA 4KNYA 4HA8A 1TW3A 1J2XA 3DPTA 1QPMA 3MEXA 1KQ9A 5J8CA 2CG4A 5LBQA 3KETA 1Z05A 4M9SA 2YPRA 3V7CA 4G6QA 4BAYA 2DU9A 2D45A 5AIPA 3ZMVA 1K6OA 1SFEA 2VC1A 5ICCA 3I53A 2VBXA 1ZRFA 5D4SA 1ZLKA 1FPQA 1FOKA 5HS9A 1J5YA 2IT0A 5H20A 2F5CA 3KFWX 3LA2A 3SZTA 3WTWC 3TO6A 2VT3A 3BJOA 3KEOA 3BWGA 1WWXA 1ZRCA 2Q2EA 2QVOA 2WC2A 3OOPA 4EGYA 2GXGA 2OZ6A 1G3WA 1U5TA 2VBZA 1I6XA 4RGSA 4IXAA 2XKOA 4RB3C 3L9FA 2UXNA 5H6QA 1YS7A 5CVIA 3LFKA 2NS0A 5HVQC 2YSRA 2F2EA 4U88A 3ZN0A 3CTAA 3TQNA 3FXQA 1XMKA 3VB2A 3F21A 1JE8A 1SMTA 3V4GA 2STTA 5HDKA 2O3FA 4UHTA 1YLFA 4HX8A 2Y0MA 2ZO4A 1J59A 2KRFA 5HS8A 2FRHA 4HW0A 1XGNA 2ZNZA 4IRIA 4YIIA 3BJAA 3KE2A 3U2RA 2K02A 3DXJF 1G3TA 2UXXA 1U5TB 2O6GE 2NAZA 3R6SA 5L3EA 2BV6A 2FMYA 3QPHA 1YTYA 1AWCA 3GO5A 4MEYF 1FP2A 4LMYA 2VXZA 3MQ0A 3ZQ7A 4KIGA 1HW2A 1ODDA 3GFLA 1Y0UA 1T6SA 3LA7A 2PJPA 5BS6A 2E1CA 1BI0A 2FU4A 4LLLA 2IW5A 4KIFA 4U7BA 3SHFA 3TOBA 4OIRF 3QPTA 4PDKA 3CO7C 4OOIA 3F8FA 2DT5A 1WI9A 4I0AA 4ZH4F 3E5QA 1C0WA 1SFUA 5CVRA 3H3ZA 1B1BA 5FO5A 3I64A 1SD5A 3FM5A 2ZMEA 1BJAA 3HHHA 4B09A 4HF2A 2MD5A 5ED4A 2QYOA 3WGGA 5E1ZB 3MFKA 1I1GA 2BE5F 1LEAA 1S7AA 1FSEA 4ETSA 4IF4A 4KUMA 5HS7A 4WXHA 3F8MA 1IN5A 3FWEA 3M8EA 3RYPA 4ZYGA 2YX4A 4HZFA 4M9XA 4L9TA 2F5FA 2V1XA 1KYZA 1JHFA 4KDPA 1YG2A 1QNTA 3WTTC 2LNBA 3GZ5A 2M8EA 1QGPA 2JPBA 2OAZA 2M1BA 4L9VA 5FD6A 2ZMEB 4LFUA 2P4WA 3I71A 3L00A 3P9IA 4OIQF 4QLCU 1XD7A 4M74A 1FSHA 2FF4A 2QZ8A 4BQAA 3SZPA 3IKTA 2EFOA 1ULYA 3WTVC 2ZJ2A 1I1SA 2PEXA 3I5UA 1BIAA 1MJAA 1FBSA 2VN2A 1LDKB 1LNWA 3GUDA 1F1ZA 1KU7A 4LB5A 1YS6A 2QM3A 3RPQA 2ADUA 5IT3A 5CJ9A 1XDSA 1RUOA 1USTA 3K1PA 5E1XA 2VONA 1BC7C 3CUQB 1TQMA 4ENKA 2C6YA 3N97A 1MJBA 1MDMA 1EH8A 2DQRA 1U6GA 4ESFA 1LVAA 5K1YA 3J80Z 1IXRC 5ERIA 3GLXA 3KP4A 4UXNA 1LEBA 4IPAA 3ZP5A 2YU3A 2BBYA 5CYVA 2O61A 3RDIA 1H0MA 5D6EA 3F6OA 4XRFA 5DD4A 2KIFA 2XV4S 4M73A 1P2FA 1KU2A 2QWWA 5BQTA 4BHPA 1FT9A 3FMSA 4IRGA 3FMRA 3LSTA 4G7OF 1CGPA 4OMZA 1QQIA 3GZ6A 2G9WA 2OD5A 3SQNA 3IRRA 3K2ZA 3V7RA 4OIOF 1IN8A 1HKSA 2IVMA 4K2EA 1E2XA 3J81Z 4MEXF 2HWVA 2DBBA 3HRMA 4PZJA 2DQLA 4I01A 1KA8A 1XN7A 5E20A 3GX4X 4U0WA 5JHUA 3L2CA 1IN4A 2V9VA 1FNNA 1YYVA 1D5VA 4N9HA 2ELHA 2H6BA 2P6TA 3GW2A 2BYVE 2NRAC 2L02A 1EH7A 3EDPA 4CYDA 4G6DA 3I0TA 3QU6A 1TQIA 3M1EA 2EV6A 4HX7A 4QWQA 2L3DA 3HIFA 1SD6A 3J80K 2HKXA 2L4AA 1F9NA 4N9IA 4YFXF 4RGUA 5DD8A 2OA4A 4BXUA 2KJBA 5JFRA 2STWA 1D8KA 2A07F 4M6XA 4EM0B 1TTYA 3WTXC 4AIJA 5FD5A 3K1MA 1IXSB 5F6FA 1J9IA 4L9NA 2LSOA 1ZARA 1BC8C 4PGGA 2FE3A 4HLYA 3SXYA 1Z1DA 3GFJA 1BI3A 2HGCA 2FBKA 4L9JA 5AIQA 2J5PA 3RKXA 2G7HA 2MH9A 3J81K 3DPLC 4KN4X 2E7WA 5D5XB 5FLXZ 1IF1A 2A6EF 4S04A 3RPUA 1HW1A 2G7UA 2UWMA 3C18A 2XAFA 4I98B 4A5NA 2Z3YA 1UCRA 3GXOA 3O6BB 4KMUX 2COMA 4M9ZA 5AONA 4EMSA 5LGTA 4XBFA 2P6SA 3Q9SA 5ICGA 1BM9A 1AOYA 5F1RA 1LQ1A 3M9AA 2FA5A 2EV0A 3FXRA 3KP6A 5E8IA 1R22A 3KZYA 3WGHA 5H6RA 4WK8F 2EB7A 2HYFA 5K5RA 2DO7A 4Y15A 5CVJA 1HKTA 1Z6TA 1WRJA 2FQ3A 4RAYA 3T0YA 1KU9A 5DCFA 3FXUA 1T39A 1O3RA 3CDHA 1ZG3A 3HUGA 4FT8A 2OQGA 2W84A 2HDCA 2DAOA 2BGCA 5ICEA 2R7FA 4BHBA 4M72A 3V8JA 3D0SA 1O7FA 3JSOA 2QQAA 4LJZF 3ABUA 5FLXK 3WU0A 3VFZA 1OMIA 4CHUA 1BN5A 1ZHFA 1ZGJA 4RS8A 3JTHA 3F8CA 1HBXG 3I59A 5CVUA 1YW7A 2O8XA 4Q47A 1KQ0A 3ZMZA 1G3SA 1MJ9A 4OMYA 1YO5C 1IN7A 1P92A 5D5UB 1LDDA 4YIFA 3E6DA 4HV6A 2HKOA 4MHGA 4UVAA 1XMAA 1KGSA 1IRFA 5ICFA 2Z9OA 2VC0A 5L3CA 2M5WA 4MQ9F 5LHIA 3RJPA 2ZNYA 3FF5A 2IPQX 1H9TA 4I2OA 3E5XA 2XAGA 2JPCA 3QOPA 4ENMA 2FOKA 5HLIA 3ECHA 4KICA 4UV8A 2GIVA 2ISZA 3QRFF 2EK5A 3I59B 1YFHA 3HRUA 4H0EA 2EA2A 1XB4A 4CGZA 1IW7F 1G3YA 3MAJA 4HQMA 4R79A 2W25A 2JRTA 3K0LA 2LKPA 1Z91A 2PG4A 1GXPA 1RZ4A 5FFZA 2PN6A 4EM1A 1B6AA 2FMLA 4ZZLA 1S7OA 2XAHA 2FBIA 3KEQA 1G6NA 1FBUA 3JW4A 5D8LB 2EWNA 3C7JA 2HZTA 3PQJA 4A0YA 5EEGA 3F3XA 4NQWA 3RKYA 3F6VA 1J75A 1B4AA 2KKOA 3NEUA 1U2WA 2IA2A 4WWCA 3RTRA 5HLGA 2ETHA 1FX7A 2AXLA 4KN7X 1BI1A 1FY7A 5D5VB 4L0YB 2Q8KA 2RC4A 1ZN2A 1D3YA 3O3KA 1T98A 3ABTA 2K27A 2V79A 3DV8A 4CZZA 1O3TA 1LJ9A 2RV8A 3K1NA 1WSUA 1XGOA 3F72A 2NNNA 1QZYA 3V8LA 1DPRA 1KQ8A 3KZZA 1R23A 3IWFA 3BJ6A 2PLYA 1WQ2A 2ZXJA 4RB1A 2GQQA 2OU2A 3DF8A 2OZUA 2O03A 4EM2A 3E3VA 2CSOA 2EFNA 1WKMA 2VBWA 1O3QA 4G7ZF 3HSEA 2CQKA 1W7PA 4CDGA 3J7AO 4P55A 5LLQA 3ZMUA 1ZRDA 4YFNF 4U0YA 4LLGF 1ZLJA 3EUHA 3WGIA 3WTYC 2PQ8A 2EFQA 1RNLA 1X3UA 3CUQC 4CXFA 1L0OC 2P5KA 3H92A 1HSJA 3BZ6A 2IA1A 2QQBA 5DUKA 3TO9A 3BY6A 1MGTA 2MLGA 1PDNC 3I4PA 1IXCA 2PFBA 1JHHA 4UVCA 5L3DA 3IWZA 1XGSA 3ULQB 5LRSA 2K86A 1OPCA 3LWFA 1REPC 5HDGA 4F7ZA 2V1UA 4R1HA 4YFKF 1W7PB 4L18B 2O0YA 1DP7P 3BPVA 1S8NA 3OV8A 2Z99A 4G94A 5EEHA 4GO1A 4PCQA 1USSA 4UNOA 1FYMA 4MGRA 2RQPA 1XCVA 4EJWA 4U7DA 3ELKA 4Q5SF 2P7VB 4GYGA 4WX9A 2NYXA 3RKWA 5J6XA 1R1TA 1XSXA 3GVAA 3KCCA 2XASA 1JXSA 4O5VA 1XGMA 2PBIA 3I58A 4CO8A 2ZCWA 5D6FA 3HTUA 4BYYA 2A69F 2DW4A 2X4HA 2A5YB 1EV7A 5E1WA 5LGNA 2V6CA 4UV9A 4I02A 2ESNA 2XVCA 3ZN1A 4LB6B 2JZYA 2HR3A 5HDNA 2DLLA 2UZKA 3Q5FA 4IVNA 2CYYA 1HSTA 4DQ2A 1BBYA 2GWRA 4HV5A 2LF8A 2WV0A 3WTZA 4P9UA 3RIRA 4IHTA 4EQQA 4DNCA 2FBHA 2GAUA 2HFHA 4HF0A 2W85A 1Q1HA 2EFWA 2HQNA 1V3FA 3VODA 1P4WA 2VE9A 2QQ9A 4MTEA 3DFGA 3R0JA 1Z9CA 2FXAA 1MDMB 4GGGA 2XUBA 2M45A 2HOEA 4FHTA 1OR7A 2QBYA 1UB9A 5DDGA 1ZG1A 2EJRA 3ZPLA 2P8TA 5TRDA 3ECOA 4ON0A 5ILUA 5LEJA 1Z6RA 1SD4A 3D5LA 4HDUA 3M7GA 1L3LA 1BIBA 3KP2A 4TV7A 5CVVA 4EJUA 1ZG5A 2F5DA 2ISYA 1R1VA 3PFIA 2CGPA 1MD0A 3ML6A 3HTSB 4GYIA 3O2PE 3E6MA 1RUNA 2KIMA 2IRFG 5DV5A 2QBYB 2F5EA 1R5HA 2V1DA 3ERED 2D2WA 3HOSA 1SFXA 4XSXF 3GFIA 1TNTA 5J8FA 3KP3A 4A0ZA 4KFCA 4LG0A 4BNCA 3HOTA 4ZYDA 1IN6A 2QUFA 4JBAA 4ZZDA 4L0ZB 1BI2A 2OQRA 4A2UA 1ON1A 2K7LA 2VOOA 2L4MA 2LDUA 4JQFA 5K5QA 1U3EM 1TLHB 3IRQA 2CWEA 3QAHA 3C1DA 1BOAA 2JT1A 4OINF 3MCZA 3WG9A 1J7KA 3FZVA 4YG2F 3P9CA 5JR3A 3K69A 5FGMA 4A5MA 4G9YA 4EGZA 2A68F 4P96A 3DKWA 1YW8A 1J0RA 3V8KA 4EJOA 4LG0B 1UHWA 1GVJA 4Q48A 3KLOA 2Q0OA 2PI0A 1QZZA 4BHCA 3TDUC 3LQRA 2H6CA 2IJLA 2HQRA 2P5VA 1R58A 4A0XA 2EA4A 2E7XA 3R60A 1GXQA 4ENJA 3FHZA 1SD7A 2HTJA 2IP2A 3NRVA 4L5JA 4RB2C 3HRSA 4G7HF 4MTDA 4Q4ZF 1TW2A 2CW0F 1A04A 3GF2A 4Y13A 1KYWA 3QP6A 2MLKA 2B0LA 3L7WA 2CO5A 2VOPA 3IKVA 2KJCA 3B73A 2R3SA 4WXCA 4ESJA 3GFMA 3LQQA 3BP8A 1E17A 2DPDA 5TJJA 1STZA 2VODA 2FNAA 3ZMTA 1U5TC 3KP5A 2XROA 2OBPA 4IHSA 3DQVC 3I54A 1I27A 2GZWA 3VEPA 2ACJA 4LGWA 4M6YA 1IUYA 2IA0A 1HQCA 3R4KA 4HQEA 4OIPF 2HYGD 3U9GA 2A3SA 4D0PA 4HYEA 4WXDA 3BPXA 1P6RA 5DYMA 4AIKA 1OKRA 1T38A 1IZ1A 3ROUA 1FBQA 1O7LA 2ESHA 4XSZF 1OYIA 4LK1F 5KVRA 1HW5A 2A61A 1FZPB 1CF7A 3TGNA 4N0BA 3JTGA 3IC7A 3WE2A 2JSCA 1XCBA 2ZFWA 2K4JA 4WF2A 1S6LA 3Q9VA 2Y75A 1DDNA 4KT5C 4AIHA 3V7SA 4RGRA 2L01A 5LRRA 2HEOA 4OU0A 3E97A 2YR2A 5HOOA 2PMHA 1ONVA 3JAMZ 3P9KA 5E8GA 2VBYA 4P5OA 1K78A 2RKHA 3SFZA 2X0LA 2FNPA 4HBLA 1H9GA 4GCVA 3E5UA 3BOQA 2XKPA 1GHCA 5JVTA 4LD5A 1B59A 5IT9Z 1CF7B 2MA3A 1FLIA 3T8TA 1R7JA 2ZKZA 2XIGA 3FMQA 4HX4A 5JI6A 1KU3A 5D4RA 1HKQA 4G8XA 1YQAA 4NB5A 4KMFA 4U0VA 1T2KA 3K9TA 4RAZA 3EYYA 3PQKA 1OYYA 3KLNA 3E6BA 1QBJA 1LDJA 2EV5A 1U78A 3NQOA 2JTVA 2RVCA 1K78B 4HDVA 2YX7A 3CUOA 1VTNC 3CJNA 2FSWA 1FYLA 1ON2A 3GYHX 1YIOA 1PP7U 1RIOH 2H94A 3LAPA 3S2WA 3GEZA 4L5IA 1UFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 X;  2HTS A;  5DUI A;  2K4B A;  2HS5 A;  5LGU A;  1SMY F;  4P9F A;  4BH9 A;  1B9M A;  3U1D A;  3JAM K;  4MNU A;  3C3W A;  2XAQ A;  2GA1 A;  1DUX C;  3TKY A;  1QO0 D;  5FFX A;  4O6J A;  6PAX A;  4LK0 F;  5DCM A;  2L54 A;  5HLH A;  2WTE A;  4UUV A;  1XSV A;  3ZMS A;  2RN7 A;  2D1V A;  5A2Q Z;  3AAF A;  2Z33 A;  5DEQ A;  4NHJ A;  3TDZ C;  4IJA A;  1P4X A;  3R0A A;  5BMZ A;  5IT9 K;  3WU1 B;  1I5Z A;  4KIB A;  5LHG A;  1LB2 A;  2P7C B;  2DI3 A;  3CUQ A;  5ILS A;  3HSR A;  3P7N A;  1EH6 A;  4I09 A;  5E18 F;  4AVP A;  1FP1 D;  1W5T A;  4HLX A;  4PGH A;  5FB2 A;  4RB0 A;  2DTR A;  2BEO A;  4Y17 A;  5D8K B;  3BRO A;  2ZBK A;  4EJT A;  4B8X A;  1ZAO A;  5DCM B;  2RNJ A;  1R1U A;  3M8F A;  3FX3 A;  3DP7 A;  1IAW A;  2H09 A;  3L09 A;  1PUE E;  3IL2 A;  3HHG A;  4EV0 A;  4MQV A;  3IHU A;  1W7P D;  4R8H A;  4O3M A;  4HF1 A;  4IRH A;  1OYW A;  3EET A;  2PMU A;  4A12 A;  2XAJ A;  2A6H F;  1W4M A;  5E17 F;  1YW9 A;  3GWZ A;  4AD9 A;  3F23 A;  4ZYH A;  4A6E A;  3E6C C;  5A2Q K;  2XGX A;  5CLS A;  1DPU A;  3MWM A;  3QP5 A;  3COA C;  4ZYE A;  2AS5 F;  5F64 A;  3KP7 A;  1R5G A;  1PP8 F;  3LA3 A;  3HYI A;  4KYW A;  3BDD A;  1K7A A;  1NHA A;  3W6J B;  5KK1 A;  3G3Z A;  1XSD A;  1G4D A;  3N4M A;  2M30 A;  1RI7 A;  2GA2 A;  3CO6 C;  1SAX A;  3WTU C;  3ISP A;  1F5T A;  3JSP A;  1W5S A;  4RGX A;  2DFI A;  1IRG A;  3WE3 A;  3G73 A;  4ESB A;  3EQL F;  3LAJ A;  2Z5U A;  1JGS A;  1B9N A;  4Z2Y A;  3EYI A;  4AWX B;  1V4R A;  4LLN A;  1Z7U A;  2VT2 A;  4HAM A;  5L3B A;  5BOX A;  1ZYR F;  3TO7 A;  1FYK A;  3HRT A;  5L3G A;  2VE8 A;  2EFP A;  2M87 A;  3T8R A;  3WOD F;  2R7D A;  2QEN A;  2LF7 A;  1HXD A;  4I0B A;  1O57 A;  1MKM A;  4I7H A;  2MBF A;  1T0F A;  3CLO A;  1ZH5 A;  4FX4 A;  3T1B A;  3F22 A;  2P5L C;  4M71 A;  3RI4 A;  2TDX A;  3F8N A;  4WCG A;  3REO A;  3F8B A;  4EVI A;  5K5O A;  2WWY A;  1P4A A;  2NNY A;  4FX0 A;  3ZMD A;  3B02 A;  4CIC A;  2MC3 A;  3QU3 A;  1U8R A;  4XLP F;  3WTS C;  2RGV A;  1TBX A;  2DK8 A;  2J5O A;  4EJV A;  3R61 A;  1S29 A;  2FEZ A;  2XRN A;  2KIU A;  4UVB A;  2DPU A;  2Y48 A;  2D1H A;  1R00 A;  3HSF A;  3T5X A;  5BPI A;  3MZH A;  2DK5 A;  2RDP A;  1MZB A;  2CFX A;  2GXB A;  1F4K A;  2W24 A;  3W6K B;  3DEU A;  5ILV A;  4KA4 A;  3H3U A;  3RYR A;  1UHM A;  1O3S A;  2XHK A;  3FM3 A;  2E1N A;  1ZGA A;  3MZY A;  4S05 A;  4ENN A;  2QLZ A;  3VOE A;  2H27 A;  5LEK A;  1S3J A;  2MH2 A;  5D5W B;  1TNS A;  4ASN A;  4E70 A;  1K79 A;  4HOB A;  4A6D A;  1FWZ A;  1R36 A;  1D8J A;  3TOA A;  5LHH A;  4XLN F;  4GXO A;  2W57 A;  1ZRE A;  1FC3 A;  5BPD A;  5L3F A;  1TQP A;  1XDU A;  4KNY A;  4HA8 A;  1TW3 A;  1J2X A;  3DPT A;  1QPM A;  3MEX A;  1KQ9 A;  5J8C A;  2CG4 A;  5LBQ A;  3KET A;  1Z05 A;  4M9S A;  2YPR A;  3V7C A;  4G6Q A;  4BAY A;  2DU9 A;  2D45 A;  5AIP A;  3ZMV A;  1K6O A;  1SFE A;  2VC1 A;  5ICC A;  3I53 A;  2VBX A;  1ZRF A;  5D4S A;  1ZLK A;  1FPQ A;  1FOK A;  5HS9 A;  1J5Y A;  2IT0 A;  5H20 A;  2F5C A;  3KFW X;  3LA2 A;  3SZT A;  3WTW C;  3TO6 A;  2VT3 A;  3BJO A;  3KEO A;  3BWG A;  1WWX A;  1ZRC A;  2Q2E A;  2QVO A;  2WC2 A;  3OOP A;  4EGY A;  2GXG A;  2OZ6 A;  1G3W A;  1U5T A;  2VBZ A;  1I6X A;  4RGS A;  4IXA A;  2XKO A;  4RB3 C;  3L9F A;  2UXN A;  5H6Q A;  1YS7 A;  5CVI A;  3LFK A;  2NS0 A;  5HVQ C;  2YSR A;  2F2E A;  4U88 A;  3ZN0 A;  3CTA A;  3TQN A;  3FXQ A;  1XMK A;  3VB2 A;  3F21 A;  1JE8 A;  1SMT A;  3V4G A;  2STT A;  5HDK A;  2O3F A;  4UHT A;  1YLF A;  4HX8 A;  2Y0M A;  2ZO4 A;  1J59 A;  2KRF A;  5HS8 A;  2FRH A;  4HW0 A;  1XGN A;  2ZNZ A;  4IRI A;  4YII A;  3BJA A;  3KE2 A;  3U2R A;  2K02 A;  3DXJ F;  1G3T A;  2UXX A;  1U5T B;  2O6G E;  2NAZ A;  3R6S A;  5L3E A;  2BV6 A;  2FMY A;  3QPH A;  1YTY A;  1AWC A;  3GO5 A;  4MEY F;  1FP2 A;  4LMY A;  2VXZ A;  3MQ0 A;  3ZQ7 A;  4KIG A;  1HW2 A;  1ODD A;  3GFL A;  1Y0U A;  1T6S A;  3LA7 A;  2PJP A;  5BS6 A;  2E1C A;  1BI0 A;  2FU4 A;  4LLL A;  2IW5 A;  4KIF A;  4U7B A;  3SHF A;  3TOB A;  4OIR F;  3QPT A;  4PDK A;  3CO7 C;  4OOI A;  3F8F A;  2DT5 A;  1WI9 A;  4I0A A;  4ZH4 F;  3E5Q A;  1C0W A;  1SFU A;  5CVR A;  3H3Z A;  1B1B A;  5FO5 A;  3I64 A;  1SD5 A;  3FM5 A;  2ZME A;  1BJA A;  3HHH A;  4B09 A;  4HF2 A;  2MD5 A;  5ED4 A;  2QYO A;  3WGG A;  5E1Z B;  3MFK A;  1I1G A;  2BE5 F;  1LEA A;  1S7A A;  1FSE A;  4ETS A;  4IF4 A;  4KUM A;  5HS7 A;  4WXH A;  3F8M A;  1IN5 A;  3FWE A;  3M8E A;  3RYP A;  4ZYG A;  2YX4 A;  4HZF A;  4M9X A;  4L9T A;  2F5F A;  2V1X A;  1KYZ A;  1JHF A;  4KDP A;  1YG2 A;  1QNT A;  3WTT C;  2LNB A;  3GZ5 A;  2M8E A;  1QGP A;  2JPB A;  2OAZ A;  2M1B A;  4L9V A;  5FD6 A;  2ZME B;  4LFU A;  2P4W A;  3I71 A;  3L00 A;  3P9I A;  4OIQ F;  4QLC U;  1XD7 A;  4M74 A;  1FSH A;  2FF4 A;  2QZ8 A;  4BQA A;  3SZP A;  3IKT A;  2EFO A;  1ULY A;  3WTV C;  2ZJ2 A;  1I1S A;  2PEX A;  3I5U A;  1BIA A;  1MJA A;  1FBS A;  2VN2 A;  1LDK B;  1LNW A;  3GUD A;  1F1Z A;  1KU7 A;  4LB5 A;  1YS6 A;  2QM3 A;  3RPQ A;  2ADU A;  5IT3 A;  5CJ9 A;  1XDS A;  1RUO A;  1UST A;  3K1P A;  5E1X A;  2VON A;  1BC7 C;  3CUQ B;  1TQM A;  4ENK A;  2C6Y A;  3N97 A;  1MJB A;  1MDM A;  1EH8 A;  2DQR A;  1U6G A;  4ESF A;  1LVA A;  5K1Y A;  3J80 Z;  1IXR C;  5ERI A;  3GLX A;  3KP4 A;  4UXN A;  1LEB A;  4IPA A;  3ZP5 A;  2YU3 A;  2BBY A;  5CYV A;  2O61 A;  3RDI A;  1H0M A;  5D6E A;  3F6O A;  4XRF A;  5DD4 A;  2KIF A;  2XV4 S;  4M73 A;  1P2F A;  1KU2 A;  2QWW A;  5BQT A;  4BHP A;  1FT9 A;  3FMS A;  4IRG A;  3FMR A;  3LST A;  4G7O F;  1CGP A;  4OMZ A;  1QQI A;  3GZ6 A;  2G9W A;  2OD5 A;  3SQN A;  3IRR A;  3K2Z A;  3V7R A;  4OIO F;  1IN8 A;  1HKS A;  2IVM A;  4K2E A;  1E2X A;  3J81 Z;  4MEX F;  2HWV A;  2DBB A;  3HRM A;  4PZJ A;  2DQL A;  4I01 A;  1KA8 A;  1XN7 A;  5E20 A;  3GX4 X;  4U0W A;  5JHU A;  3L2C A;  1IN4 A;  2V9V A;  1FNN A;  1YYV A;  1D5V A;  4N9H A;  2ELH A;  2H6B A;  2P6T A;  3GW2 A;  2BYV E;  2NRA C;  2L02 A;  1EH7 A;  3EDP A;  4CYD A;  4G6D A;  3I0T A;  3QU6 A;  1TQI A;  3M1E A;  2EV6 A;  4HX7 A;  4QWQ A;  2L3D A;  3HIF A;  1SD6 A;  3J80 K;  2HKX A;  2L4A A;  1F9N A;  4N9I A;  4YFX F;  4RGU A;  5DD8 A;  2OA4 A;  4BXU A;  2KJB A;  5JFR A;  2STW A;  1D8K A;  2A07 F;  4M6X A;  4EM0 B;  1TTY A;  3WTX C;  4AIJ A;  5FD5 A;  3K1M A;  1IXS B;  5F6F A;  1J9I A;  4L9N A;  2LSO A;  1ZAR A;  1BC8 C;  4PGG A;  2FE3 A;  4HLY A;  3SXY A;  1Z1D A;  3GFJ A;  1BI3 A;  2HGC A;  2FBK A;  4L9J A;  5AIQ A;  2J5P A;  3RKX A;  2G7H A;  2MH9 A;  3J81 K;  3DPL C;  4KN4 X;  2E7W A;  5D5X B;  5FLX Z;  1IF1 A;  2A6E F;  4S04 A;  3RPU A;  1HW1 A;  2G7U A;  2UWM A;  3C18 A;  2XAF A;  4I98 B;  4A5N A;  2Z3Y A;  1UCR A;  3GXO A;  3O6B B;  4KMU X;  2COM A;  4M9Z A;  5AON A;  4EMS A;  5LGT A;  4XBF A;  2P6S A;  3Q9S A;  5ICG A;  1BM9 A;  1AOY A;  5F1R A;  1LQ1 A;  3M9A A;  2FA5 A;  2EV0 A;  3FXR A;  3KP6 A;  5E8I A;  1R22 A;  3KZY A;  3WGH A;  5H6R A;  4WK8 F;  2EB7 A;  2HYF A;  5K5R A;  2DO7 A;  4Y15 A;  5CVJ A;  1HKT A;  1Z6T A;  1WRJ A;  2FQ3 A;  4RAY A;  3T0Y A;  1KU9 A;  5DCF A;  3FXU A;  1T39 A;  1O3R A;  3CDH A;  1ZG3 A;  3HUG A;  4FT8 A;  2OQG A;  2W84 A;  2HDC A;  2DAO A;  2BGC A;  5ICE A;  2R7F A;  4BHB A;  4M72 A;  3V8J A;  3D0S A;  1O7F A;  3JSO A;  2QQA A;  4LJZ F;  3ABU A;  5FLX K;  3WU0 A;  3VFZ A;  1OMI A;  4CHU A;  1BN5 A;  1ZHF A;  1ZGJ A;  4RS8 A;  3JTH A;  3F8C A;  1HBX G;  3I59 A;  5CVU A;  1YW7 A;  2O8X A;  4Q47 A;  1KQ0 A;  3ZMZ A;  1G3S A;  1MJ9 A;  4OMY A;  1YO5 C;  1IN7 A;  1P92 A;  5D5U B;  1LDD A;  4YIF A;  3E6D A;  4HV6 A;  2HKO A;  4MHG A;  4UVA A;  1XMA A;  1KGS A;  1IRF A;  5ICF A;  2Z9O A;  2VC0 A;  5L3C A;  2M5W A;  4MQ9 F;  5LHI A;  3RJP A;  2ZNY A;  3FF5 A;  2IPQ X;  1H9T A;  4I2O A;  3E5X A;  2XAG A;  2JPC A;  3QOP A;  4ENM A;  2FOK A;  5HLI A;  3ECH A;  4KIC A;  4UV8 A;  2GIV A;  2ISZ A;  3QRF F;  2EK5 A;  3I59 B;  1YFH A;  3HRU A;  4H0E A;  2EA2 A;  1XB4 A;  4CGZ A;  1IW7 F;  1G3Y A;  3MAJ A;  4HQM A;  4R79 A;  2W25 A;  2JRT A;  3K0L A;  2LKP A;  1Z91 A;  2PG4 A;  1GXP A;  1RZ4 A;  5FFZ A;  2PN6 A;  4EM1 A;  1B6A A;  2FML A;  4ZZL A;  1S7O A;  2XAH A;  2FBI A;  3KEQ A;  1G6N A;  1FBU A;  3JW4 A;  5D8L B;  2EWN A;  3C7J A;  2HZT A;  3PQJ A;  4A0Y A;  5EEG A;  3F3X A;  4NQW A;  3RKY A;  3F6V A;  1J75 A;  1B4A A;  2KKO A;  3NEU A;  1U2W A;  2IA2 A;  4WWC A;  3RTR A;  5HLG A;  2ETH A;  1FX7 A;  2AXL A;  4KN7 X;  1BI1 A;  1FY7 A;  5D5V B;  4L0Y B;  2Q8K A;  2RC4 A;  1ZN2 A;  1D3Y A;  3O3K A;  1T98 A;  3ABT A;  2K27 A;  2V79 A;  3DV8 A;  4CZZ A;  1O3T A;  1LJ9 A;  2RV8 A;  3K1N A;  1WSU A;  1XGO A;  3F72 A;  2NNN A;  1QZY A;  3V8L A;  1DPR A;  1KQ8 A;  3KZZ A;  1R23 A;  3IWF A;  3BJ6 A;  2PLY A;  1WQ2 A;  2ZXJ A;  4RB1 A;  2GQQ A;  2OU2 A;  3DF8 A;  2OZU A;  2O03 A;  4EM2 A;  3E3V A;  2CSO A;  2EFN A;  1WKM A;  2VBW A;  1O3Q A;  4G7Z F;  3HSE A;  2CQK A;  1W7P A;  4CDG A;  3J7A O;  4P55 A;  5LLQ A;  3ZMU A;  1ZRD A;  4YFN F;  4U0Y A;  4LLG F;  1ZLJ A;  3EUH A;  3WGI A;  3WTY C;  2PQ8 A;  2EFQ A;  1RNL A;  1X3U A;  3CUQ C;  4CXF A;  1L0O C;  2P5K A;  3H92 A;  1HSJ A;  3BZ6 A;  2IA1 A;  2QQB A;  5DUK A;  3TO9 A;  3BY6 A;  1MGT A;  2MLG A;  1PDN C;  3I4P A;  1IXC A;  2PFB A;  1JHH A;  4UVC A;  5L3D A;  3IWZ A;  1XGS A;  3ULQ B;  5LRS A;  2K86 A;  1OPC A;  3LWF A;  1REP C;  5HDG A;  4F7Z A;  2V1U A;  4R1H A;  4YFK F;  1W7P B;  4L18 B;  2O0Y A;  1DP7 P;  3BPV A;  1S8N A;  3OV8 A;  2Z99 A;  4G94 A;  5EEH A;  4GO1 A;  4PCQ A;  1USS A;  4UNO A;  1FYM A;  4MGR A;  2RQP A;  1XCV A;  4EJW A;  4U7D A;  3ELK A;  4Q5S F;  2P7V B;  4GYG A;  4WX9 A;  2NYX A;  3RKW A;  5J6X A;  1R1T A;  1XSX A;  3GVA A;  3KCC A;  2XAS A;  1JXS A;  4O5V A;  1XGM A;  2PBI A;  3I58 A;  4CO8 A;  2ZCW A;  5D6F A;  3HTU A;  4BYY A;  2A69 F;  2DW4 A;  2X4H A;  2A5Y B;  1EV7 A;  5E1W A;  5LGN A;  2V6C A;  4UV9 A;  4I02 A;  2ESN A;  2XVC A;  3ZN1 A;  4LB6 B;  2JZY A;  2HR3 A;  5HDN A;  2DLL A;  2UZK A;  3Q5F A;  4IVN A;  2CYY A;  1HST A;  4DQ2 A;  1BBY A;  2GWR A;  4HV5 A;  2LF8 A;  2WV0 A;  3WTZ A;  4P9U A;  3RIR A;  4IHT A;  4EQQ A;  4DNC A;  2FBH A;  2GAU A;  2HFH A;  4HF0 A;  2W85 A;  1Q1H A;  2EFW A;  2HQN A;  1V3F A;  3VOD A;  1P4W A;  2VE9 A;  2QQ9 A;  4MTE A;  3DFG A;  3R0J A;  1Z9C A;  2FXA A;  1MDM B;  4GGG A;  2XUB A;  2M45 A;  2HOE A;  4FHT A;  1OR7 A;  2QBY A;  1UB9 A;  5DDG A;  1ZG1 A;  2EJR A;  3ZPL A;  2P8T A;  5TRD A;  3ECO A;  4ON0 A;  5ILU A;  5LEJ A;  1Z6R A;  1SD4 A;  3D5L A;  4HDU A;  3M7G A;  1L3L A;  1BIB A;  3KP2 A;  4TV7 A;  5CVV A;  4EJU A;  1ZG5 A;  2F5D A;  2ISY A;  1R1V A;  3PFI A;  2CGP A;  1MD0 A;  3ML6 A;  3HTS B;  4GYI A;  3O2P E;  3E6M A;  1RUN A;  2KIM A;  2IRF G;  5DV5 A;  2QBY B;  2F5E A;  1R5H A;  2V1D A;  3ERE D;  2D2W A;  3HOS A;  1SFX A;  4XSX F;  3GFI A;  1TNT A;  5J8F A;  3KP3 A;  4A0Z A;  4KFC A;  4LG0 A;  4BNC A;  3HOT A;  4ZYD A;  1IN6 A;  2QUF A;  4JBA A;  4ZZD A;  4L0Z B;  1BI2 A;  2OQR A;  4A2U A;  1ON1 A;  2K7L A;  2VOO A;  2L4M A;  2LDU A;  4JQF A;  5K5Q A;  1U3E M;  1TLH B;  3IRQ A;  2CWE A;  3QAH A;  3C1D A;  1BOA A;  2JT1 A;  4OIN F;  3MCZ A;  3WG9 A;  1J7K A;  3FZV A;  4YG2 F;  3P9C A;  5JR3 A;  3K69 A;  5FGM A;  4A5M A;  4G9Y A;  4EGZ A;  2A68 F;  4P96 A;  3DKW A;  1YW8 A;  1J0R A;  3V8K A;  4EJO A;  4LG0 B;  1UHW A;  1GVJ A;  4Q48 A;  3KLO A;  2Q0O A;  2PI0 A;  1QZZ A;  4BHC A;  3TDU C;  3LQR A;  2H6C A;  2IJL A;  2HQR A;  2P5V A;  1R58 A;  4A0X A;  2EA4 A;  2E7X A;  3R60 A;  1GXQ A;  4ENJ A;  3FHZ A;  1SD7 A;  2HTJ A;  2IP2 A;  3NRV A;  4L5J A;  4RB2 C;  3HRS A;  4G7H F;  4MTD A;  4Q4Z F;  1TW2 A;  2CW0 F;  1A04 A;  3GF2 A;  4Y13 A;  1KYW A;  3QP6 A;  2MLK A;  2B0L A;  3L7W A;  2CO5 A;  2VOP A;  3IKV A;  2KJC A;  3B73 A;  2R3S A;  4WXC A;  4ESJ A;  3GFM A;  3LQQ A;  3BP8 A;  1E17 A;  2DPD A;  5TJJ A;  1STZ A;  2VOD A;  2FNA A;  3ZMT A;  1U5T C;  3KP5 A;  2XRO A;  2OBP A;  4IHS A;  3DQV C;  3I54 A;  1I27 A;  2GZW A;  3VEP A;  2ACJ A;  4LGW A;  4M6Y A;  1IUY A;  2IA0 A;  1HQC A;  3R4K A;  4HQE A;  4OIP F;  2HYG D;  3U9G A;  2A3S A;  4D0P A;  4HYE A;  4WXD A;  3BPX A;  1P6R A;  5DYM A;  4AIK A;  1OKR A;  1T38 A;  1IZ1 A;  3ROU A;  1FBQ A;  1O7L A;  2ESH A;  4XSZ F;  1OYI A;  4LK1 F;  5KVR A;  1HW5 A;  2A61 A;  1FZP B;  1CF7 A;  3TGN A;  4N0B A;  3JTG A;  3IC7 A;  3WE2 A;  2JSC A;  1XCB A;  2ZFW A;  2K4J A;  4WF2 A;  1S6L A;  3Q9V A;  2Y75 A;  1DDN A;  4KT5 C;  4AIH A;  3V7S A;  4RGR A;  2L01 A;  5LRR A;  2HEO A;  4OU0 A;  3E97 A;  2YR2 A;  5HOO A;  2PMH A;  1ONV A;  3JAM Z;  3P9K A;  5E8G A;  2VBY A;  4P5O A;  1K78 A;  2RKH A;  3SFZ A;  2X0L A;  2FNP A;  4HBL A;  1H9G A;  4GCV A;  3E5U A;  3BOQ A;  2XKP A;  1GHC A;  5JVT A;  4LD5 A;  1B59 A;  5IT9 Z;  1CF7 B;  2MA3 A;  1FLI A;  3T8T A;  1R7J A;  2ZKZ A;  2XIG A;  3FMQ A;  4HX4 A;  5JI6 A;  1KU3 A;  5D4R A;  1HKQ A;  4G8X A;  1YQA A;  4NB5 A;  4KMF A;  4U0V A;  1T2K A;  3K9T A;  4RAZ A;  3EYY A;  3PQK A;  1OYY A;  3KLN A;  3E6B A;  1QBJ A;  1LDJ A;  2EV5 A;  1U78 A;  3NQO A;  2JTV A;  2RVC A;  1K78 B;  4HDV A;  2YX7 A;  3CUO A;  1VTN C;  3CJN A;  2FSW A;  1FYL A;  1ON2 A;  3GYH X;  1YIO A;  1PP7 U;  1RIO H;  2H94 A;  3LAP A;  3S2W A;  3GEZ A;  4L5I A;  1UFM A; 
#chains in the Genus database with same CATH topology
 4CCM A;  4JK1 X;  2HTS A;  1X1C A;  2ME6 A;  2K4B A;  5DUI A;  2HS5 A;  4HRI A;  5LGU A;  1SMY F;  4P9F A;  2BHY A;  3QYF A;  4BH9 A;  4HNV A;  1B9M A;  3U1D A;  3AG2 H;  3JAM K;  4MNU A;  3IP4 B;  3C3W A;  1BL0 A;  2R7U A;  3BTI A;  3OYC A;  2XAQ A;  2GA1 A;  3S3N A;  2DOF A;  3TKY A;  1DUX C;  1QO0 D;  5FFX A;  3S3O A;  4O6J A;  6PAX A;  1A35 A;  3S1M J;  3AKZ A;  2VJI A;  4LK0 F;  4NNJ A;  5DCM A;  2L54 A;  5HLH A;  2E2J J;  2LY2 A;  2M4K A;  4PSW A;  1WVR A;  2WTE A;  4I6Z A;  2LP0 A;  1XSV A;  3ZMS A;  1A36 A;  2RN7 A;  2D1V A;  4DW6 A;  5IP6 A;  5A2Q Z;  5DEQ A;  3AAF A;  2Z33 A;  4NHJ A;  5KCM A;  3TDZ C;  4B43 A;  4IJA A;  1P4X A;  3R0A A;  5BMZ A;  1FOY A;  5F08 A;  4QIW N;  5IT9 K;  3CCY A;  3WU1 B;  1I5Z A;  4KIB A;  5J3L A;  1A5J A;  1JI8 A;  2VIX A;  5LHG A;  2GLO A;  4X0G A;  1LB2 A;  2E71 A;  2P7C B;  2DI3 A;  3CUQ A;  5ILS A;  3HSR A;  3P7N A;  4OWR B;  4RBO A;  1EH6 A;  4I09 A;  5E18 F;  2NVX J;  2EIN H;  1Q1V A;  3ZR8 X;  4AU7 A;  4AVP A;  3JRA A;  3PSF A;  1FP1 D;  1W5T A;  2W7N A;  1IRX A;  2I10 A;  4HLX A;  1U9O A;  4PGH A;  1I6H J;  3OYB A;  1N75 A;  3VYS B;  5FB2 A;  2CQQ A;  1LUJ B;  4RB0 A;  1LFP A;  2DTR A;  4B48 A;  4KT6 A;  1MBE A;  2BEO A;  1JTY A;  3RKQ A;  2LR8 A;  1FEX A;  4XM3 A;  2K3P A;  4Y17 A;  5D8K B;  3BRO A;  2ZBK A;  4Y4R A;  4EJT A;  4B8X A;  1HA8 A;  1ZAO A;  1QZE A;  1ITY A;  1ERD A;  2V9K A;  2WAQ N;  5DCM B;  2DA6 A;  2RNJ A;  1R1U A;  2IBD A;  3M8F A;  3FX3 A;  3DP7 A;  3TL4 X;  3H9G A;  1IAW A;  3VYT B;  2WAD A;  1YJW I;  1E3O C;  2H09 A;  3F9K A;  2V6E A;  3L09 A;  2L7K A;  1PUE E;  4PSX A;  1UAA A;  3IL2 A;  3HHG A;  1IG7 A;  4EV0 A;  4MQV A;  3IHU A;  2ZJR F;  4C3J J;  2VUM J;  2DA2 A;  1W7P D;  4R8H A;  4O3M A;  2BVM A;  4HF1 A;  2DMT A;  4FIS A;  4RMN A;  4IRH A;  1V54 H;  1OYW A;  1WJB A;  2DA1 A;  3EET A;  4BE1 A;  3ZQC A;  2PMU A;  3G6E I;  3K4B A;  4A12 A;  4D1Q A;  2XAJ A;  1F43 A;  2A6H F;  3MD2 A;  3VYU B;  1TC3 C;  4QTR A;  1W4M A;  3PO2 J;  5E17 F;  5C44 J;  1FMW A;  1YW9 A;  1WI3 A;  3GWZ A;  4GRI A;  4AD9 A;  4RA2 A;  3F23 A;  4ZYH A;  3ABK H;  4A6E A;  3E6C C;  4ZDP A;  2XGX A;  3OR2 C;  5A2Q K;  3CME I;  5IYB J;  4RM3 A;  2PJR A;  5CLS A;  3G2B A;  2ZJP F;  1DPU A;  5B1B H;  5EF6 A;  1QHH D;  3MWM A;  2DT6 A;  4B44 A;  1Z21 A;  2ZSI B;  2MC4 A;  2QQ8 A;  3QP5 A;  3J7Z I;  4HNU A;  2HXI A;  4II2 A;  4XMY A;  1QU3 A;  4F91 B;  3COA C;  3MN2 A;  4UUS A;  3AG3 H;  5K7F A;  4ZYE A;  2AS5 F;  5F64 A;  1UEL B;  1ZK8 A;  3KP7 A;  1R5G A;  2QA4 I;  1WJF A;  4M3E A;  1B72 A;  1PP8 F;  1BW6 A;  3SEZ A;  3IAM 2;  1W5C C;  1FTZ A;  3LA3 A;  3HYI A;  1I39 A;  1ETX A;  3FXO A;  4KYW A;  3BDD A;  1K7A A;  1NHA A;  3W6J B;  5KK1 A;  2DA5 A;  2BW3 A;  3G3Z A;  3S16 J;  2BHZ A;  1JKP C;  1T95 A;  4Y3O A;  3RSN A;  2JWT A;  1XSD A;  3GTG J;  4DBR A;  3C2B A;  3H35 A;  1G4D A;  3N4M A;  1O4X A;  1JKO C;  2M30 A;  2JUG A;  2E5N A;  2EIL H;  5LFA A;  1RI7 A;  2GA2 A;  3CO6 C;  1SAX A;  3WTU C;  3ISP A;  1F5T A;  3CP2 A;  4RLF A;  4PK4 A;  3JSP A;  1W5S A;  3W6V A;  2DJN A;  2KZG A;  2Y2Z A;  4RGX A;  2DFI A;  1IRG A;  2PJR B;  1MMA A;  1HDD C;  3WE3 A;  3OYN A;  3G73 A;  2DDB A;  4ESB A;  4ZJZ A;  3EQL F;  3LAJ A;  2Z5U A;  3PIP F;  2HNH A;  1JGS A;  1B9N A;  4Z2Y A;  3EYI A;  4AWX B;  2JA8 J;  1V4R A;  4UUS B;  3OOU A;  4LLN A;  1FOX A;  3HZJ A;  2CUF A;  3HOX J;  1Z7U A;  1B72 B;  4EAT A;  1MMS A;  1K4S A;  2XPU A;  3PNY A;  5H2F C;  2CW8 A;  2VT2 A;  4HAM A;  1PUF A;  2V4J C;  4CCN A;  3JRD A;  5L3B A;  5BOX A;  1ZYR F;  4KIT B;  2GOX B;  3TO7 A;  3IH2 A;  1FYK A;  3HRT A;  1Z0X A;  2LD5 A;  3OL4 A;  1OCR H;  2BW3 B;  5L3G A;  2VE8 A;  5E3N A;  3TW6 A;  2EFP A;  2M87 A;  2QKM B;  3T8R A;  3WOD F;  4A3M J;  4RDU A;  2R7D A;  3OL3 A;  3PIO F;  2QEN A;  3NAU A;  2LF7 A;  3FXM A;  1HXD A;  4I0B A;  3MKW B;  1JKQ C;  3MKY B;  3BTC A;  2LYC A;  2JQ7 A;  2DYR H;  4DBQ A;  1O57 A;  3OS1 A;  2KIS A;  1MKM A;  2CUZ A;  2KHM A;  2B9S A;  2QF7 A;  1LPQ A;  4I7H A;  2QSH X;  4XID A;  2MBF A;  1T0F A;  2ZXH A;  3I9V 2;  3CLO A;  1ZH5 A;  4FX4 A;  3T1B A;  3F22 A;  2IS2 A;  2P5L C;  4M71 A;  3RI4 A;  2TDX A;  3F8N A;  3PM1 A;  4WCG A;  4B4C A;  3REO A;  2JA7 J;  3F8B A;  4EVI A;  4UUT A;  5K5O A;  1ETK A;  2WWY A;  1P4A A;  2NNY A;  4FX0 A;  3ZMD A;  5FRO A;  3B02 A;  2NVQ J;  1WGX A;  4CIC A;  2MC3 A;  2LKS A;  2K3F A;  3QU3 A;  1U8R A;  3CCM I;  5J1U A;  3HDD A;  1PUF B;  4XLP F;  3S3M A;  4BY7 J;  3WTS C;  2RGV A;  1TBX A;  1S72 I;  2DK8 A;  4OAY A;  1UHS A;  4Y7N J;  1ENH A;  2QGU A;  3G1M A;  1OIS A;  2J5O A;  5FRN A;  4EJV A;  3R61 A;  1S29 A;  3S1Q J;  2FEZ A;  2XRN A;  2KIU A;  4UVB A;  2DPU A;  3E7L A;  2Y48 A;  2D1H A;  2OCC H;  1R00 A;  3DEW A;  3HSF A;  2WBM A;  3T5X A;  3ZGK A;  3W2A A;  5BPI A;  1ETQ A;  2FJ1 A;  1RC9 A;  3MZH A;  3H1C A;  2DK5 A;  2RDP A;  4NBQ A;  5GP9 A;  4BL0 B;  1MZB A;  2CFX A;  1PVE A;  5EEA A;  2GXB A;  1F4K A;  2W24 A;  1MBK A;  3A4C A;  1MBF A;  3K10 A;  3W6K B;  3BG6 A;  2LY1 A;  5LD2 C;  3DEU A;  5ILV A;  3FIS A;  1WCM J;  4KA4 A;  3KEY A;  3H3U A;  2EH3 A;  3RYR A;  1N78 A;  1UHM A;  1XMX A;  1O3S A;  2XHK A;  2CV1 A;  3FM3 A;  2E1N A;  4S0H B;  1ZGA A;  3MZY A;  4S05 A;  4ENN A;  2QLZ A;  3VOE A;  2XAU A;  2H27 A;  5LEK A;  1S3J A;  1RKT A;  4BEH A;  2MH2 A;  5D5W B;  1TNS A;  4ASN A;  3Q0V A;  2CS3 A;  4E70 A;  1MBG A;  4HOB A;  4A6D A;  1K79 A;  1SAU A;  1FWZ A;  1R36 A;  3JRB A;  1D8J A;  2HQ5 A;  5E3M A;  3TOA A;  3DPU A;  2Y31 A;  2ZB9 A;  5LHH A;  4IOC F;  4XLN F;  4GXO A;  4D5F A;  5IP7 J;  2E1M C;  4FTH A;  2W57 A;  1ZRE A;  1FC3 A;  5BPD A;  5L3F A;  1TQP A;  1XDU A;  4KNY A;  1X3W B;  4HA8 A;  2HXO A;  1TW3 A;  1J2X A;  3E0J B;  3H5A A;  4IEJ A;  3DPT A;  1QPM A;  3MEX A;  3CCJ I;  1KQ9 A;  4XQF A;  5IY5 H;  5J8C A;  2CG4 A;  2CUE A;  2E60 A;  3FKI J;  2W82 A;  3IAS 2;  3OYM A;  3BR3 A;  1U0J A;  3KZI C;  4E4H A;  2HDW A;  3W2W A;  5LBQ A;  3KET A;  2OTL I;  1Z05 A;  4M9S A;  2YPR A;  2YU9 J;  1G2H A;  5EZG A;  3V7C A;  1X4O A;  1D1A A;  1P7I A;  4G6Q A;  3RQ4 A;  4BAY A;  3CC2 I;  2DU9 A;  2D45 A;  2R7Q A;  4CSW A;  2IXS A;  5AIP A;  3ZMV A;  5CPR B;  1K6O A;  1SFE A;  2VC1 A;  5ICC A;  3I53 A;  3KYD B;  5JLX A;  2M9H A;  3GTQ J;  2VBX A;  1ZRF A;  4AYB A;  5D4S A;  1ZLK A;  1FPQ A;  1S5L C;  1X1A A;  1FOK A;  5HS9 A;  1J5Y A;  1IUF A;  2XGE A;  1RRJ A;  2IT0 A;  5H20 A;  2XPW A;  2F5C A;  3KFW X;  3F0C A;  4BQO A;  4BEH B;  3H9Q A;  1ZKG A;  1JJ6 C;  3HOU J;  3LA2 A;  3SZT A;  3WTW C;  3TO6 A;  2VT3 A;  3BJO A;  3B6A A;  1R4M B;  1YI2 I;  4IHY A;  3KEO A;  2XF7 A;  2KT0 A;  2L7Z A;  1WWX A;  2L9R A;  2VJJ A;  3BWG A;  4E6K G;  1ZRC A;  2R4G A;  2OPT A;  2Q2E A;  2QVO A;  2WC2 A;  3OOP A;  4EGY A;  4XR6 A;  2R92 J;  2GXG A;  2OZ6 A;  2V7F A;  1G3W A;  1U5T A;  2VBZ A;  1I6X A;  2KZV A;  4IXA A;  4RGS A;  5B1A H;  4V19 K;  1VZ0 A;  1HLV A;  2XKO A;  5HLT A;  4RB3 C;  3L9F A;  2KDZ A;  2AQE A;  2UXN A;  3G1O A;  5H6Q A;  1YS7 A;  3MVP A;  5CVI A;  1N25 A;  4IHV A;  3M4O J;  3LFK A;  3SJM A;  5IOY A;  2QEX I;  2NS0 A;  4CCL A;  5HVQ C;  1FIP A;  4D9J A;  2YSR A;  3ZQH A;  1YE9 A;  2F2E A;  2MSY A;  1HC8 A;  3QYB A;  4U88 A;  3ZN0 A;  1MIJ A;  3CTA A;  3TQN A;  3FXQ A;  1XMK A;  1SFK A;  3VB2 A;  3F21 A;  1JE8 A;  1SMT A;  3V4G A;  2STT A;  2DA7 A;  4ABZ A;  4CCK A;  4UY8 I;  3FHN A;  2ZFU A;  1TWH J;  4HST A;  1WZ2 A;  2W00 A;  5HDK A;  2O3F A;  4M3G A;  3OYD A;  4P1W A;  4UHT A;  3AG1 H;  1YLF A;  4HX8 A;  3OYG A;  2Y0M A;  1ETW A;  2ZO4 A;  4XKC A;  1J59 A;  2KRF A;  5HS8 A;  3BR5 A;  1U9N A;  2FRH A;  4HW0 A;  3M3Y J;  3OSF A;  1XGN A;  2ZNZ A;  2X6X A;  4IRI A;  4YII A;  5IYC J;  3BZK A;  3BJA A;  3KE2 A;  2M2E A;  2Z1D A;  4A3I J;  3U2R A;  5EJC A;  2CFO A;  1QA6 A;  2K02 A;  3OY9 A;  2Q2E B;  4PFP A;  3DXJ F;  1G3T A;  3FBN B;  2UXX A;  3LNQ A;  1U5T B;  3O8G A;  1MND A;  2NAZ A;  2O6G E;  3R6S A;  5L3E A;  5GPA A;  2BV6 A;  2FMY A;  3QPH A;  1YTY A;  1AWC A;  3GO5 A;  4MEY F;  1FP2 A;  3AL0 B;  1WJ5 A;  3MMY B;  4LMY A;  2VXZ A;  5DM6 F;  3MQ0 A;  3ZQ7 A;  4KIG A;  1HW2 A;  2K9N A;  1ODD A;  3GFL A;  1Y0U A;  1T6S A;  1GUU A;  2K9L A;  1H8A C;  3LA7 A;  3K4M A;  5BS6 A;  2PJP A;  1TWG J;  3DCF A;  3M1C A;  1BI0 A;  3LSI A;  2FU4 A;  4LLL A;  2IW5 A;  1BJZ A;  4KIF A;  5B66 C;  4IX7 A;  4U7B A;  1JTX A;  3SHF A;  2HU9 A;  5J1Y A;  2LFB A;  3TOB A;  3EUA A;  4OIR F;  4E7H A;  3ERM A;  3QPT A;  1ZQ3 P;  2Y0S N;  4PDK A;  1W1W E;  3CO7 C;  1X1P A;  1Y8R B;  3OYA A;  3BQZ A;  3ASO H;  4OOI A;  3F8F A;  1OCZ H;  2DT5 A;  1WI9 A;  4I0A A;  4ZH4 F;  3E5Q A;  4HNT A;  3OS2 A;  1DQU A;  2IS4 A;  2LRE A;  1XC5 A;  2R5Z A;  5CVR A;  1SFU A;  3H3Z A;  1B1B A;  5FKO A;  5FO5 A;  1C0W A;  1R5I D;  2OF7 A;  1AU7 A;  3I64 A;  3U1K A;  4DZP A;  1SD5 A;  3FM5 A;  1EF4 A;  2ZME A;  2LH9 A;  1BJA A;  1VQM I;  3HHH A;  1A6Q A;  4B09 A;  4HF2 A;  2MD5 A;  1ZGW A;  1OFC X;  3HM5 A;  5ED4 A;  2QYO A;  3WGG A;  5E1Z B;  5B5E C;  3MFK A;  3GBG A;  1I1G A;  3BR2 A;  1A31 A;  2VB6 A;  2BE5 F;  1LEA A;  2L2O A;  1S7A A;  1FSE A;  2R7X A;  2JUC A;  4XL9 A;  4ETS A;  2LBF A;  1P7J A;  4IF4 A;  4KUM A;  9ANT A;  3GTO J;  5BNG A;  1TWA J;  2JSP A;  5HS7 A;  2IAI A;  2K85 A;  4WXH A;  5GAG J;  1R49 A;  3F8M A;  2EPF A;  1IN5 A;  2E5Z A;  3FWE A;  3M8E A;  2COB A;  3RYP A;  4ZYG A;  2YX4 A;  4HZF A;  5EDN A;  1VQ9 I;  4XOR A;  4M9X A;  4L9T A;  1DGR M;  2F5F A;  2M8G X;  2V1X A;  4RAF A;  1IRZ A;  3CJR B;  1G59 A;  4LIT A;  1WPK A;  3WHB A;  1KYZ A;  1JHF A;  4KDP A;  2X1D A;  1VQ6 I;  2EZH A;  1YG2 A;  1QNT A;  4UB6 C;  3WTT C;  2FUG 2;  5HNF A;  5C3E J;  2R5Z B;  2LNB A;  3GZ5 A;  3LSJ A;  2M8E A;  1QGP A;  2JPB A;  2OAZ A;  3TMO A;  1NH3 A;  2M1B A;  4L9V A;  1UZC A;  5FD6 A;  3D1N I;  2ZME B;  5CQE A;  4QSH A;  4LFU A;  2P4W A;  3I71 A;  4FET A;  4C3I J;  3OYJ A;  3L00 A;  3VSL A;  4XRM A;  2BZT A;  3P9I A;  1K61 A;  3DKY A;  4OIQ F;  4U87 A;  2XF5 A;  4QLC U;  1B8I A;  1XD7 A;  3O8H A;  4DIQ A;  2MW8 A;  2Q1Z B;  4M74 A;  3WU2 C;  1FSH A;  2FF4 A;  2DYS H;  2QZ8 A;  1HOM A;  1IJW C;  2HYJ A;  2LY9 A;  4BQA A;  4DZJ A;  3SZP A;  3IKT A;  1V5F A;  2EFO A;  2NOG A;  1ULY A;  3GTP J;  1S7E A;  3WTV C;  2ZJ2 A;  2ID6 A;  1I1S A;  4C2T A;  2PEX A;  2AHQ A;  2GBY A;  3I5U A;  1BIA A;  3MKL A;  2ZJQ F;  1XX5 A;  1WJA A;  1MJA A;  1FBS A;  3BG9 A;  2VN2 A;  3CDL A;  1TWC J;  1LDK B;  1LNW A;  3GUD A;  1MSE C;  1F1Z A;  1KU7 A;  1LKX A;  4LB5 A;  4ZYA A;  1YS6 A;  4DYC A;  2QM3 A;  3RPQ A;  2ADU A;  4ZDL A;  3LSR A;  5IT3 A;  1Y39 A;  3OYK A;  1POG A;  3CCR I;  3MKZ A;  1PJR A;  2DMP A;  3HG9 A;  5CJ9 A;  1XDS A;  1QRY A;  3FK6 A;  1RUO A;  1JJ8 C;  1UST A;  4X1E A;  4PJL A;  3K1P A;  1YJ9 I;  1YJN I;  5E1X A;  3EPZ A;  2VON A;  1V5G A;  1BC7 C;  3CUQ B;  1TQM A;  4ENK A;  2C6Y A;  3N97 A;  1MJB A;  1MDM A;  1EH8 A;  2DQR A;  1LFB A;  2HOA A;  5FKL A;  3E1S A;  1U6G A;  1VND A;  4ESF A;  1LVA A;  5K1Y A;  3J80 Z;  1IXR C;  2DXI A;  2R7S A;  5ERI A;  2TCT A;  3GLX A;  3RZO J;  3KP4 A;  4UXN A;  1LEB A;  4IPA A;  3HJE A;  3BT9 A;  2OUM A;  3ZP5 A;  4M3F A;  2YU3 A;  4AUX A;  2BBY A;  5FRM A;  3FXJ A;  4EEF G;  5CYV A;  2O61 A;  1YHQ I;  4FCY A;  3RDI A;  1X58 A;  1OR7 C;  4LIU A;  2X85 A;  3G4S I;  1H0M A;  2ZXW H;  3F6O A;  4ITV A;  4XRF A;  5D6E A;  5M3F J;  2I8D A;  5IP9 J;  5DD4 A;  1OCO H;  4XN0 A;  2KIF A;  2XV4 S;  4M73 A;  1P2F A;  1KU2 A;  2QWW A;  5BQT A;  5F0H A;  4BHP A;  1FT9 A;  3FMS A;  4IRG A;  2DA4 A;  4PJM A;  2Z2S B;  5EG0 A;  3TP0 A;  3H0D A;  3FMR A;  2K5C A;  3LST A;  4G7O F;  4AYB N;  1CGP A;  4OMZ A;  4F3Q A;  1QQI A;  3GZ6 A;  2G9W A;  4J01 A;  2OD5 A;  3LMM A;  1W36 D;  3SQN A;  3BCA A;  3IRR A;  3K2Z A;  3V7R A;  1E3H A;  4V2G A;  2MGQ A;  2KRC A;  2JRM A;  4OIO F;  2YS9 A;  2QKL B;  3JRE A;  1VQ5 I;  1IN8 A;  1HKS A;  2IVM A;  4K2E A;  4JX6 A;  4XLA A;  1E2X A;  3J81 Z;  4MEX F;  1QPI A;  2HWV A;  4YIR X;  2DBB A;  3HRM A;  3HOW J;  1MW7 A;  3BLY A;  2F4M B;  4PZJ A;  2DQL A;  4UB8 C;  4I01 A;  4JX4 A;  1KA8 A;  2CV2 A;  1XN7 A;  3GTL J;  5E20 A;  3GX4 X;  4B1R A;  4U0W A;  3GTM J;  2E34 A;  4CCJ A;  2VLA A;  5JHU A;  2ELJ A;  2LKX A;  3L2C A;  4IHW A;  1IN4 A;  1MMD A;  3AFH A;  2V9V A;  1FNN A;  1YYV A;  2OJE D;  3B6C A;  1VQ8 I;  3K2A A;  1D5V A;  2XDV A;  4N9H A;  1DGW Y;  2ELH A;  2H6B A;  2XRL A;  3LSP A;  1SEU A;  2P6T A;  2DOA A;  3GW2 A;  3G71 I;  2BYV E;  2Y0S A;  1Y1W J;  2NRA C;  1ORK A;  1Z3Y A;  3Q0W A;  2L02 A;  3S32 A;  1EH7 A;  2GOM A;  1D0Z A;  3EDP A;  1X3Z B;  4G6D A;  4CYD A;  2QSG X;  3I0T A;  2X51 A;  3QU6 A;  1T56 A;  2CJJ A;  2R0Q C;  1TQI A;  3M1E A;  5FJ8 J;  2NOJ B;  2EV6 A;  4HX7 A;  4QWQ A;  2DMN A;  2L3D A;  3HIF A;  2OC6 A;  1SD6 A;  5K7H A;  2HKX A;  3J80 K;  4A3B J;  2X1E A;  2KFD A;  2L4A A;  1F9N A;  4N9I A;  3DBL B;  5CKT A;  2JK3 A;  3V42 A;  2MAB A;  1IC8 A;  4YFX F;  3OIO A;  3FBI B;  4RGU A;  4XKB A;  1OCP A;  1X2N A;  3FDY A;  5DD8 A;  1IO2 A;  4KJZ A;  2R7V A;  3PUF A;  2OA4 A;  4BXU A;  2KJB A;  5JFR A;  2STW A;  2IGK A;  1D8K A;  4C30 A;  2A07 F;  2W48 A;  4M6X A;  2H1K A;  3CD6 I;  4A3G J;  4QPQ A;  2H8R A;  1TT0 A;  4EM0 B;  1TTY A;  4CCO A;  3WTX C;  4AIJ A;  1X19 A;  2X1C A;  3I56 I;  4HEA 2;  5FD5 A;  2X6W A;  3K1M A;  1IXS B;  5F6F A;  1ACI A;  1J9I A;  4L9N A;  4IL6 C;  2LSO A;  1ZAR A;  1BC8 C;  4PGG A;  2FE3 A;  4HLY A;  1LE8 A;  2DOE A;  3SXY A;  3OSG A;  1Z1D A;  3GFJ A;  1BI3 A;  2HGC A;  1D1C A;  2FBK A;  4L9J A;  5AIQ A;  3BTL A;  2J5P A;  1TWF J;  3RKX A;  1ETY A;  2G7H A;  2MH9 A;  4PFO A;  3DPL C;  3J81 K;  4KN4 X;  2E7W A;  2VL8 A;  5D5X B;  3MZ8 A;  3KYL A;  1NG6 A;  3GTK J;  5FLX Z;  4AC0 A;  2EIK H;  3SDG A;  1IF1 A;  3KYC B;  2A6E F;  2ME0 A;  1VFC A;  4S04 A;  3BC8 A;  3RPU A;  2XPV A;  1HW1 A;  2G7U A;  2UWM A;  4Y52 J;  3C18 A;  1BR2 A;  3IH4 A;  3LSG A;  5FLV A;  2CQN A;  2JVG A;  2XAF A;  4I98 B;  4A5N A;  5B3S H;  2WY8 Q;  2BY2 A;  2Z3Y A;  3OYE A;  1UCR A;  2VQG A;  3GXO A;  3O6B B;  4KMU X;  1T8I A;  2COM A;  2CW7 A;  4M9Z A;  3H5R A;  4KIS A;  5AON A;  4EMS A;  5LGT A;  4XBF A;  3L1P A;  2P6S A;  2EBI A;  3Q9S A;  4N4O B;  2KL4 A;  1JUS A;  5ICG A;  4E7I A;  1BM9 A;  1E0E A;  4I99 C;  4XIC A;  1LE8 B;  2B7E A;  1AOY A;  5F1R A;  1LQ1 A;  3M9A A;  2FA5 A;  3M8J A;  1UG2 A;  1SVL A;  2KMU A;  4BDZ A;  2EV0 A;  2R5Y A;  4BS9 A;  3FXR A;  3KP6 A;  5E8I A;  1APL C;  1R22 A;  3KZY A;  4CUG A;  4D7M A;  4BU2 A;  3WGH A;  5H6R A;  2GXA A;  3RZD J;  4WK8 F;  1CQT A;  2EB7 A;  2FX0 A;  3QQA A;  2HYF A;  3LL7 A;  4MIM A;  5K5R A;  5HOD A;  3SYT A;  3JCU C;  2HPM A;  2FQ4 A;  1GVD A;  2XF6 A;  2DO7 A;  4Z6Y A;  4Y15 A;  5CVJ A;  1HKT A;  2M7B A;  3DWL E;  1Z6T A;  1WRJ A;  2FQ3 A;  4RAY A;  3T0Y A;  1KU9 A;  5DCF A;  3I4M J;  3CZ6 A;  3FXU A;  1T39 A;  1O3R A;  3JRC A;  3LSK A;  4A3C J;  3CDH A;  4C9Y A;  1ZG3 A;  3HUG A;  5M5X J;  2IS6 A;  3Q0U A;  2XB5 A;  1A6I A;  4FT8 A;  2OQG A;  2W84 A;  2HDC A;  2DAO A;  2BGC A;  2DOD A;  5ICE A;  2R7F A;  3OYH A;  4BHB A;  4M72 A;  2HOT A;  2DFH A;  2DN0 A;  1V55 H;  1QVU A;  3PNV A;  3ZQG A;  3V8J A;  2BXY A;  3G1L A;  3D0S A;  1O7F A;  1FOW A;  3JSO A;  2DMQ A;  2QQA A;  3BTJ A;  4LJZ F;  4M3B A;  3ABU A;  2D5V A;  1GLN A;  5FLX K;  5M5Y J;  2QCO A;  4MFD A;  3HOY J;  1K83 J;  3WU0 A;  3VFZ A;  1OMI A;  5M5W J;  2R5Y B;  4CHU A;  3HPG A;  1BN5 A;  1ZHF A;  1ZGJ A;  2Y9Z A;  4RS8 A;  3JTH A;  3F8C A;  1HBX G;  4GDF A;  1Y56 A;  3I59 A;  2F5V A;  5CVU A;  2KLO A;  1YW7 A;  4NC7 A;  4CA0 A;  1VQO I;  3HL2 A;  1Z67 A;  2O8X A;  4Q47 A;  1KQ0 A;  3ZMZ A;  1G3S A;  2VKV A;  3S14 J;  3X2Q H;  3A1Y A;  1MJ9 A;  2ID3 A;  4YEL A;  2MG4 A;  3AL0 C;  4OMY A;  1BW5 A;  4IQJ A;  1YO5 C;  1IN7 A;  1P92 A;  3PJR A;  5D5U B;  1LDD A;  4J19 A;  4YIF A;  5FLM J;  3E6D A;  2VXD A;  5EZH A;  4QPO A;  4HV6 A;  3S2H J;  2HKO A;  3HUG B;  5J1R A;  4MHG A;  4UVA A;  1XMA A;  1KGS A;  3FKJ A;  1AA7 A;  1IRF A;  5ICF A;  2Z9O A;  2W4S A;  1NK3 P;  4N4N B;  1EKE A;  2VC0 A;  4BJT A;  4BJ6 C;  5L3C A;  3S1R J;  2M5W A;  4ZDO A;  4MQ9 F;  5LHI A;  2O5R A;  3RJP A;  2ZNY A;  3FF5 A;  2EZL A;  2IPQ X;  1JT6 A;  2E1C A;  3GLL A;  1WJC A;  4XOP A;  3UNG C;  1H9T A;  2HDD A;  4I2O A;  3E5X A;  2XAG A;  4MFE A;  2JPC A;  2XSD C;  3QOP A;  4BKX A;  1YIT I;  4ENM A;  4YRV A;  2FOK A;  3L2R A;  5HLI A;  5JVG F;  3TED A;  3ECH A;  4KIC A;  5JHF A;  1BA5 A;  3HXL A;  3GTJ J;  4UV8 A;  2GIV A;  3KX2 A;  2G0E A;  2ISZ A;  3QRF F;  4AM3 A;  2EK5 A;  3I59 B;  1YFH A;  3HRU A;  4H0E A;  2OV7 A;  3K6G A;  3BR1 A;  2EA2 A;  3D5R C;  3HC7 A;  1XB4 A;  2V26 A;  2Y69 H;  1IW7 F;  3WHC A;  4XK4 A;  1G3Y A;  3MAJ A;  4HQM A;  4CGZ A;  3CDI A;  4R79 A;  2W1O A;  2W25 A;  1LFU P;  2JRT A;  3K0L A;  2LKP A;  1Z91 A;  2HZD A;  2PG4 A;  3DKX A;  1RZ4 A;  1GXP A;  5FFZ A;  1OCT C;  1HDP A;  2PN6 A;  4IO9 F;  4EM1 A;  1B6A A;  2FML A;  4ZZL A;  5GPC A;  2EZK A;  1S7O A;  3K4K A;  2XAH A;  2FBI A;  3KEQ A;  2CQX A;  1G6N A;  1FBU A;  1VQP I;  2VQL A;  3JW4 A;  4A3K J;  5D8L B;  2L7M P;  2EWN A;  3C7J A;  4OAZ A;  2HZT A;  3PQJ A;  4IOA F;  3BG3 A;  4A0Y A;  5EEG A;  3F3X A;  4NQW A;  3RKY A;  3F6V A;  1J75 A;  3CC4 I;  1B4A A;  1SC7 A;  2KKO A;  1WH7 A;  2KPM A;  3NEU A;  1U2W A;  2K9M A;  2IA2 A;  2WB1 A;  2CUJ A;  2JA2 A;  4WWC A;  3RTR A;  5HLG A;  2M0C A;  2ETH A;  1T08 B;  2NXN B;  3I4N J;  1FX7 A;  2AXL A;  3OIP A;  3OIQ A;  4KN7 X;  4NUB A;  3NWS A;  1BI1 A;  1FY7 A;  2IGM A;  5D5V B;  4L0Y B;  2Q8K A;  2RC4 A;  1ZN2 A;  3JRI A;  1D3Y A;  2GIZ A;  3O3K A;  1MSF C;  1T98 A;  4XLE A;  1FJL A;  2VKH A;  3ABT A;  2R7W A;  2K27 A;  2V79 A;  3N05 A;  2DDA A;  2A5W A;  4I76 A;  3DV8 A;  2VJ5 A;  4CZZ A;  1PYV A;  1GT0 C;  2AQF A;  3DBR B;  1O3T A;  2BY0 A;  3AG4 H;  3I3L A;  1LJ9 A;  2RV8 A;  3K1N A;  1WSU A;  3BR0 A;  1XGO A;  3C2H A;  2NNN A;  1QZY A;  3CJQ B;  3F72 A;  1H88 C;  1VQL I;  4XON A;  2YUS A;  3V8L A;  4BAC A;  1DPR A;  2EZI A;  1KQ8 A;  3KZZ A;  1R23 A;  4XNF A;  3IWF A;  1D0X A;  3BJ6 A;  2VI6 A;  1WQ2 A;  2PLY A;  2ZXJ A;  4RB1 A;  3K7A J;  4C2U A;  3A01 A;  5F04 A;  3CF2 A;  4V2F A;  2GQQ A;  2OU2 A;  2Z16 A;  3DF8 A;  2RNG A;  2OZU A;  1XS9 A;  2HOS A;  2O03 A;  2BY1 A;  1JUP A;  3LSM A;  3P5J A;  3BZC A;  4EM2 A;  3ASN H;  4IQ4 A;  3E3V A;  2CSO A;  2EFN A;  1WKM A;  2LMD A;  2VBW A;  2NS7 A;  2O9L A;  1I50 J;  1O3Q A;  2M0M A;  2X6O A;  3HSE A;  4G7Z F;  1K4T A;  3DTE A;  2CQK A;  1W7P A;  4CDG A;  4BQN A;  3J7A O;  4P55 A;  5LLQ A;  3ZMU A;  4E7K A;  2RAE A;  4E7S A;  5E3L A;  1ZRD A;  1W36 C;  3SDB A;  4BUP A;  1D0Y A;  2BVL A;  3KIO A;  3DU5 A;  4YFN F;  4U0Y A;  4LLG F;  1ZLJ A;  3EUH A;  4FE4 A;  3WGI A;  3CF5 F;  3DLA A;  4DOZ A;  2PQ8 A;  5J4V A;  3WTY C;  2EFQ A;  1RNL A;  3EUK L;  1X3U A;  2A05 A;  5GAH J;  2KQR A;  4NC6 A;  3CUQ C;  3JR9 A;  4CXF A;  1L0O C;  2P5K A;  2IEK A;  3H92 A;  1HSJ A;  2ICW G;  3BZ6 A;  2IA1 A;  2QQB A;  5DUK A;  1RR8 C;  4RAG A;  3ZOB A;  3TO9 A;  3H36 A;  3BY6 A;  1MGT A;  2MLG A;  2R93 J;  3HOV J;  2DJI A;  3BCB A;  1YRN A;  2WAF A;  1OQY A;  1PDN C;  5J40 A;  3A03 A;  3I4P A;  1MBH A;  1IXC A;  2PFB A;  1F36 A;  1JHH A;  4UVC A;  5L3D A;  2XGC A;  2E19 A;  4XLF A;  3HPH A;  3FXL A;  3IWZ A;  3A01 B;  2Y30 A;  1XGS A;  3ULQ B;  4LG3 A;  5LRS A;  2VKE A;  2K86 A;  1OPC A;  4A69 C;  3LWF A;  1REP C;  5HDG A;  5HNH A;  2UV1 A;  2QSF X;  4FAS D;  4F7Z A;  4E7J A;  2V1U A;  4AID A;  4R1H A;  4YFK F;  2R7R A;  3JRH A;  1VI0 A;  1W7P B;  1G8X A;  4ZTJ A;  4L18 B;  2O0Y A;  1DP7 P;  4CYC A;  3FK7 A;  3BPV A;  2CMP A;  1S8N A;  3OV8 A;  1HF0 A;  1X1B A;  2LBF B;  2ECB A;  2Z99 A;  4G94 A;  1RR7 A;  5EEH A;  4GO1 A;  4PCQ A;  1TT5 B;  4BE2 A;  1USS A;  4UNO A;  1FYM A;  4MGR A;  4JYK A;  2DFF A;  3QYE A;  3CQZ J;  1BOB A;  2OTJ I;  2RQP A;  2X6Y A;  3ONQ A;  1XCV A;  3ZXS A;  4EJW A;  4U7D A;  3H0G J;  2CH0 A;  1MH3 A;  4DGW B;  3ELK A;  4Q5S F;  2P7V B;  4GYG A;  5IYD J;  4WX9 A;  2NYX A;  3RKW A;  5J6X A;  1R1T A;  1XSX A;  3HEF A;  3GVA A;  4B47 A;  1ETV A;  3KCC A;  1YRN B;  2XAS A;  5E79 C;  1JXS A;  3QPL A;  4O5V A;  1XGM A;  2PBI A;  4ZC3 A;  3I58 A;  1S9H A;  3IUO A;  1W0T A;  4CO8 A;  2ZCW A;  1AHD P;  3ABL H;  3DBH B;  2OCE A;  5D6F A;  1LVK A;  4CZC A;  3W2V A;  4BE0 A;  3CLQ A;  2VPL A;  1GV2 A;  3HTU A;  3QOE A;  2A69 F;  2KP6 A;  1EA3 A;  4BYY A;  2DW4 A;  2X4H A;  3JRF A;  1ZR4 A;  2A5Y B;  1EV7 A;  1FMV A;  2NVU B;  3S15 J;  5E1W A;  5LGN A;  1TL8 A;  4LIV A;  2V6C A;  4UV9 A;  5TGT A;  4I02 A;  2PX9 A;  1B8I B;  3PL8 A;  3TBI A;  4X6A J;  1YIJ I;  2XB0 X;  1VF9 A;  1X2M A;  3TW7 A;  3HB9 A;  1WJE A;  2ESN A;  2XVC A;  4CYC B;  3ZN1 A;  4LB6 B;  1XPX A;  2WAE A;  2JZY A;  1IGN A;  3K70 D;  4C2M J;  2HR3 A;  5HDN A;  2NVY J;  1QHG A;  2F4I A;  2DLL A;  2UZK A;  3Q5F A;  4IVN A;  2CYY A;  1HST A;  3CCL I;  5TIS C;  1KZH A;  1SAN A;  1MNE A;  4DQ2 A;  2K9Q A;  1BBY A;  4ZTF A;  2GWR A;  3LOC A;  4HV5 A;  2LF8 A;  2WV0 A;  3WTZ A;  4P9U A;  3RIR A;  1IV8 A;  2LG4 A;  4IHT A;  5DTD A;  4EQQ A;  2VQC A;  4DNC A;  4B3X A;  3H5N A;  2XGD A;  2FBH A;  2LTP A;  3VDX A;  2LOO A;  2GAU A;  2HFH A;  4HF0 A;  2HQA A;  2W85 A;  1Q1H A;  2EFW A;  2HQN A;  1V3F A;  1P9Q C;  3LFU A;  3VOD A;  1P4W A;  4HG2 A;  4BXF A;  2VE9 A;  2LRD A;  2QQ9 A;  4MTE A;  3J7Y J;  2E2I J;  3DFG A;  3R0J A;  5J4Y A;  1Z9C A;  2FXA A;  1MDM B;  1UMQ A;  1JUM A;  1VQ4 I;  4B3A A;  2BOL A;  4GGG A;  2XUB A;  2M45 A;  1JT0 A;  2HOE A;  1UJ8 A;  4FHT A;  1YX5 A;  3DTK A;  1OR7 A;  4BY1 J;  2QBY A;  1UB9 A;  5DDG A;  5CQG A;  2NVT J;  2VJ4 A;  1ZG1 A;  2EJR A;  3ZPL A;  2P8T A;  5GAE J;  5TRD A;  3PSI A;  2JVH A;  2I5U A;  3S17 J;  2A6T A;  3ECO A;  1BR4 A;  2N8G A;  3JRG A;  1Y6I A;  1NG7 A;  3A02 A;  4UUV A;  5F27 A;  4ON0 A;  2F4O B;  5ILU A;  1GDT A;  2L5Q A;  5M3M J;  5LEJ A;  1Z6R A;  1SD4 A;  2HVQ A;  2O8K A;  2O7O A;  3D5L A;  1IV6 A;  3UR3 C;  4HDU A;  1VQN I;  3CCU I;  1D1B A;  1FIA A;  1SVM A;  3HKZ N;  3HBL A;  3SZG A;  5EG0 B;  2DCE A;  3M7G A;  4NC8 A;  1L3L A;  1BIB A;  3KP2 A;  2KRH A;  4TV7 A;  3HGY A;  5CVV A;  2CRG A;  5DS9 A;  4EJU A;  3VYR B;  2R7T A;  1WHU A;  1T0F C;  3QPS A;  5K7Z A;  4Y33 A;  4XN3 A;  1ZG5 A;  2F5D A;  1JKR C;  2ISY A;  3NAR A;  1OCC H;  1R1V A;  1MBJ A;  3VSK A;  3H3V K;  3A0H C;  3PFI A;  4W97 A;  2LC2 A;  2CGP A;  1Y8Q B;  1VQ7 I;  1MH4 A;  1SVO A;  3D5S C;  1MD0 A;  5KHD A;  5DM7 F;  1VQK I;  3ML6 A;  3HTS B;  4IZZ A;  3ABM H;  4GYI A;  3O2P E;  3E6M A;  1RUN A;  2KIM A;  2IRF G;  5DV5 A;  3J7A Y;  2QBY B;  2F5E A;  2BXZ A;  1R5H A;  2V1D A;  3ERE D;  2DA3 A;  2D2W A;  2XC7 A;  1W0U A;  1KON A;  1I3Q J;  3HOS A;  4DYR A;  1RES A;  1SFX A;  4XSX F;  3GFI A;  3RCO A;  3C2G A;  1TNT A;  5J8F A;  3PNT A;  4ANJ A;  3KP3 A;  4XRS A;  3GME A;  2IGO A;  4A0Z A;  1M1E B;  2WB1 N;  4KFC A;  2ZSH B;  2DMU A;  3A0B C;  4LG0 A;  4BNC A;  3A2K A;  1QVT A;  3HOT A;  4ZYD A;  1IN6 A;  5J47 A;  2QUF A;  1TP4 A;  4JBA A;  2L9V A;  4ZZD A;  4F92 B;  4L0Z B;  3FXK A;  1BI2 A;  1IDY A;  2OQR A;  4A2U A;  1NTC A;  3K4L A;  4II3 A;  1X1D A;  1ON1 A;  4E7Z A;  2K7L A;  2VOO A;  2L4M A;  2LDU A;  4JQF A;  5K5Q A;  1U3E M;  3OWT A;  1TLH B;  3IRQ A;  2CWE A;  3QOD A;  3QAH A;  3C1D A;  4XLH A;  3VPR A;  1BOA A;  2JT1 A;  4OIN F;  3MCZ A;  5JLW A;  1UG0 A;  1H89 C;  3WG9 A;  1J7K A;  4RM2 A;  3CC7 I;  1TZL A;  3FZV A;  4M6V A;  4YG2 F;  1MMN A;  3P9C A;  5JR3 A;  3CMA I;  3KPH A;  4XKV A;  4DYQ A;  3K69 A;  4F55 A;  5FGM A;  4A5M A;  4D5C A;  4G9Y A;  2PMZ N;  1DP3 A;  4EGZ A;  4PJJ A;  4BXX J;  1U8B A;  2K40 A;  2A68 F;  1Z77 A;  3CES A;  4L5E A;  4P96 A;  2CU7 A;  2EQR A;  1AKH A;  4G6T B;  4FQG A;  2EIM H;  2DFE A;  1Y0N A;  1RKW A;  3DKW A;  2RRE A;  3OYI A;  3U21 A;  2DTZ A;  1ETO A;  3PUB A;  1YW8 A;  4BBS J;  1E3P A;  1J0R A;  3K4C A;  3V8K A;  3LSH A;  4EJO A;  4LG0 B;  2HVS A;  3L2U A;  4IHX A;  1UHW A;  1GVJ A;  2VPR A;  4Q48 A;  4GFB A;  2BY3 A;  3KLO A;  1RPW A;  2TRT A;  3GZN B;  2Q0O A;  2PI0 A;  1QZZ A;  2VKD A;  4BHC A;  4NDL A;  3TDU C;  3HOZ J;  3LQR A;  1OJL A;  2F48 A;  2H6C A;  2IJL A;  2WAQ A;  2WY7 Q;  2XSJ C;  2HQR A;  3ZQL A;  2P5V A;  1R58 A;  2L0K A;  4A0X A;  2EA4 A;  2E7X A;  3ZRG A;  3R60 A;  4H4K C;  5EGO A;  1GXQ A;  4ENJ A;  3DU6 A;  2E35 A;  3FHZ A;  2E36 A;  1SD7 A;  2HTJ A;  3BQY A;  2IP2 A;  1JGG A;  3NRV A;  4L5J A;  4RB2 C;  4M3D A;  3DLL F;  3HRS A;  3TP3 A;  4G7H F;  5EYR A;  3UKG A;  4MTD A;  4Q4Z F;  3IH3 A;  1TW2 A;  2CW0 F;  1A04 A;  1EJ9 A;  5FKK A;  2X9D A;  4JOM A;  5GAD J;  3GF2 A;  3RQI A;  5FKN A;  3S2D J;  4Y13 A;  1KYW A;  4YEJ A;  1Z7L A;  3CP8 A;  3QP6 A;  4BJ5 C;  3S1N J;  1J09 A;  4A3D J;  2IS1 A;  2MLK A;  4XOT A;  1AKH B;  2IGN A;  4BQQ A;  2B0L A;  3L7W A;  3OS0 A;  2CO5 A;  2VOP A;  3IKV A;  2KJC A;  1WFX A;  3B73 A;  3SFI A;  3K4J A;  2R3S A;  5F0C A;  2E2H J;  2JA6 J;  4G12 A;  4WXC A;  4ESJ A;  3GFM A;  1R4N B;  3LQQ A;  3BP8 A;  1MNM C;  1ZEL A;  2H8W A;  1E17 A;  2DPD A;  2WV1 A;  5E3O A;  5TJJ A;  1STZ A;  2VOD A;  2FNA A;  3ZMT A;  1U5T C;  3OYF A;  3OR1 C;  3KP5 A;  2XRO A;  3HGG A;  1FTT A;  4BDY A;  2OBP A;  2L9S A;  4IHS A;  3DQV C;  2M3A A;  3I54 A;  1I27 A;  2GZW A;  3GCM A;  3FIW A;  3PO3 J;  3VEP A;  5EGO B;  5F1J A;  3RPU D;  2ACJ A;  2ECC A;  1V5E A;  4LGW A;  2WA0 A;  3CMM A;  4M6Y A;  1IUY A;  2IA0 A;  1HQC A;  3R4K A;  3NWT A;  4HQE A;  4HPQ A;  2M7A A;  3L2Q A;  4OIP F;  1YX3 A;  2HYG D;  3U9G A;  1R6R A;  2EIJ H;  2A3S A;  1MMG A;  2LLK A;  2VAS A;  4BBR J;  3BG7 A;  2E1O A;  2DT7 B;  4D0P A;  3BG5 A;  2KIQ A;  4BGD A;  1SFO J;  5GTI C;  4AVZ A;  4HYE A;  4WXD A;  1XTA A;  3BPX A;  1P6R A;  1N77 A;  1IDZ A;  5DYM A;  2JMW A;  4AIK A;  1OKR A;  2HI3 A;  2LK2 A;  3ESW B;  4HSR A;  1T38 A;  1IZ1 A;  2Y9Y A;  3ROU A;  3OMY A;  1FBQ A;  3S93 A;  2ELK A;  2UUZ A;  1O7L A;  3DEE A;  2B63 J;  2ESH A;  4XSZ F;  3HKZ A;  1R9T J;  1OYI A;  2JJ7 A;  5GTH C;  4LK1 F;  5KVR A;  1HW5 A;  2A61 A;  2H1L A;  4MO7 A;  3CCQ I;  4A93 J;  4XLC A;  4A3E J;  1FZP B;  1WH5 A;  1CF7 A;  2VQH A;  3TGN A;  4N0B A;  3JTG A;  3IC7 A;  3WE2 A;  2E1M B;  2JA5 J;  2JSC A;  1DU6 A;  3L2W A;  1XCB A;  2ZFW A;  2RQQ A;  2K4J A;  4WF2 A;  1S6L A;  2K9S A;  4XKW A;  2ZXI A;  4XRS G;  2AO9 A;  3OYL A;  4CH7 A;  3QWL A;  1I3A A;  2M34 A;  3Q9V A;  4A3J J;  1HCR A;  1X4P A;  2Y75 A;  2V1N A;  1DDN A;  4KT5 C;  4AIH A;  3M07 A;  3BR6 A;  5IPA A;  1GV5 A;  3V7S A;  4RGR A;  1D5Y A;  2L01 A;  3DTI A;  5F0F A;  5LRR A;  2HEO A;  5IOZ A;  4OU0 A;  1R71 A;  3E97 A;  2YR2 A;  3ZQI A;  5HOO A;  2PMH A;  4PJ0 C;  3H9J A;  1NK2 P;  1ONV A;  5C4J J;  3JAM Z;  3P9K A;  5E8G A;  1RET A;  3SEQ A;  2VBY A;  3VWB A;  4J00 A;  2X48 A;  4P5O A;  2FOW A;  1K78 A;  4JX5 A;  2RKH A;  2NS8 A;  3SFZ A;  2X0L A;  2FNP A;  4HBL A;  1H9G A;  4GCV A;  3E5U A;  3BOQ A;  2HPI A;  3Q3S A;  4F52 A;  2XKP A;  4RLQ A;  1GHC A;  3CCE I;  2F6C A;  2CV0 A;  5JVT A;  2P0W A;  2HVR A;  4LD5 A;  1ZR2 A;  2MYS A;  1B59 A;  2CQ7 A;  5KAI C;  1WJD A;  2ZME C;  2JN6 A;  3K4N A;  5IT9 Z;  1CF7 B;  3I55 I;  5KAF C;  1DU0 A;  1K6Y A;  2MA3 A;  2LVS A;  1XG1 A;  1FLI A;  2FD5 A;  3WG7 H;  3T8T A;  1R7J A;  2ZKZ A;  2XIG A;  3FMQ A;  4HX4 A;  1OLT A;  5JI6 A;  1KU3 A;  2M4G A;  2L9N A;  5D4R A;  3K70 C;  1HKQ A;  1Z3X A;  4FE7 A;  2KDO A;  3S8P A;  4G8X A;  5C4X J;  4IKF A;  4PJN A;  1YQA A;  1ZTR A;  4NB5 A;  3CCS I;  4KMF A;  3EUH C;  4U0V A;  4A3F J;  2MFZ A;  1T2K A;  1BR1 A;  3K9T A;  4RAZ A;  5KNL A;  3CMY A;  3ZQF A;  3EYY A;  4F93 B;  2AXT C;  3PQK A;  1OYY A;  1T33 A;  2PMZ A;  4DJA A;  3CJT B;  4JP0 A;  4LOC A;  4C3H J;  3L2V A;  3KLN A;  3E6B A;  1QBJ A;  4MLO A;  1LDJ A;  2EV5 A;  2R7O A;  4PUS A;  4W1U A;  4NQW B;  3W3C A;  3PFY A;  2R7Z J;  4A3L J;  3CCV I;  1U78 A;  3NQO A;  2JTV A;  2RVC A;  1K78 B;  4HDV A;  2YX7 A;  3CUO A;  5FKM A;  1YOV B;  3IV5 A;  3CJN A;  4E7L A;  2P81 A;  1VTN C;  2V9P A;  2MD0 A;  2FSW A;  1FYL A;  1ON2 A;  2GM4 A;  3GYH X;  1YIO A;  4D7N A;  1Y1V J;  3ZQQ A;  1PP7 U;  2L7F P;  1RIO H;  2ZC2 A;  2H94 A;  3LAP A;  3ZCO A;  3S2W A;  3GEZ A;  4L5I A;  1UFM A; 
#chains in the Genus database with same CATH homology
 4JK1 X;  2HTS A;  5DUI A;  2K4B A;  2HS5 A;  5LGU A;  1SMY F;  4P9F A;  4BH9 A;  1B9M A;  3U1D A;  3JAM K;  4MNU A;  3C3W A;  2XAQ A;  2GA1 A;  1DUX C;  3TKY A;  1QO0 D;  5FFX A;  4O6J A;  6PAX A;  4LK0 F;  5DCM A;  2L54 A;  5HLH A;  2WTE A;  4UUV A;  1XSV A;  3ZMS A;  2RN7 A;  2D1V A;  5A2Q Z;  3AAF A;  2Z33 A;  5DEQ A;  4NHJ A;  3TDZ C;  4IJA A;  1P4X A;  3R0A A;  5BMZ A;  5IT9 K;  3WU1 B;  1I5Z A;  4KIB A;  5LHG A;  1LB2 A;  2P7C B;  2DI3 A;  3CUQ A;  5ILS A;  3HSR A;  3P7N A;  1EH6 A;  4I09 A;  5E18 F;  4AVP A;  1FP1 D;  1W5T A;  4HLX A;  4PGH A;  5FB2 A;  4RB0 A;  2DTR A;  2BEO A;  4Y17 A;  5D8K B;  3BRO A;  2ZBK A;  4EJT A;  4B8X A;  1ZAO A;  5DCM B;  2RNJ A;  1R1U A;  3M8F A;  3FX3 A;  3DP7 A;  1IAW A;  2H09 A;  3L09 A;  1PUE E;  3IL2 A;  3HHG A;  4EV0 A;  4MQV A;  3IHU A;  1W7P D;  4R8H A;  4O3M A;  4HF1 A;  4IRH A;  1OYW A;  3EET A;  2PMU A;  4A12 A;  2XAJ A;  2A6H F;  1W4M A;  5E17 F;  1YW9 A;  3GWZ A;  4AD9 A;  3F23 A;  4ZYH A;  4A6E A;  3E6C C;  5A2Q K;  2XGX A;  5CLS A;  1DPU A;  3MWM A;  3QP5 A;  3COA C;  4ZYE A;  2AS5 F;  5F64 A;  3KP7 A;  1R5G A;  1PP8 F;  3LA3 A;  3HYI A;  4KYW A;  3BDD A;  1K7A A;  1NHA A;  3W6J B;  5KK1 A;  3G3Z A;  1XSD A;  1G4D A;  3N4M A;  2M30 A;  1RI7 A;  2GA2 A;  3CO6 C;  1SAX A;  3WTU C;  3ISP A;  1F5T A;  3JSP A;  1W5S A;  4RGX A;  2DFI A;  1IRG A;  3WE3 A;  3G73 A;  4ESB A;  3EQL F;  3LAJ A;  2Z5U A;  1JGS A;  1B9N A;  4Z2Y A;  3EYI A;  4AWX B;  1V4R A;  4LLN A;  1Z7U A;  2VT2 A;  4HAM A;  5L3B A;  5BOX A;  1ZYR F;  3TO7 A;  1FYK A;  3HRT A;  5L3G A;  2VE8 A;  2EFP A;  2M87 A;  3T8R A;  3WOD F;  2R7D A;  2QEN A;  2LF7 A;  1HXD A;  4I0B A;  1O57 A;  1MKM A;  4I7H A;  2MBF A;  1T0F A;  3CLO A;  1ZH5 A;  4FX4 A;  3T1B A;  3F22 A;  2P5L C;  4M71 A;  3RI4 A;  2TDX A;  3F8N A;  4WCG A;  3REO A;  3F8B A;  4EVI A;  5K5O A;  2WWY A;  1P4A A;  2NNY A;  4FX0 A;  3ZMD A;  3B02 A;  4CIC A;  2MC3 A;  3QU3 A;  1U8R A;  4XLP F;  3WTS C;  2RGV A;  1TBX A;  2DK8 A;  2J5O A;  4EJV A;  3R61 A;  1S29 A;  2FEZ A;  2XRN A;  2KIU A;  4UVB A;  2DPU A;  2Y48 A;  2D1H A;  1R00 A;  3HSF A;  3T5X A;  5BPI A;  3MZH A;  2DK5 A;  2RDP A;  1MZB A;  2CFX A;  2GXB A;  1F4K A;  2W24 A;  3W6K B;  3DEU A;  5ILV A;  4KA4 A;  3H3U A;  3RYR A;  1UHM A;  1O3S A;  2XHK A;  3FM3 A;  2E1N A;  1ZGA A;  3MZY A;  4S05 A;  4ENN A;  2QLZ A;  3VOE A;  2H27 A;  5LEK A;  1S3J A;  2MH2 A;  5D5W B;  1TNS A;  4ASN A;  4E70 A;  1K79 A;  4HOB A;  4A6D A;  1FWZ A;  1R36 A;  1D8J A;  3TOA A;  5LHH A;  4XLN F;  4GXO A;  2W57 A;  1ZRE A;  1FC3 A;  5BPD A;  5L3F A;  1TQP A;  1XDU A;  4KNY A;  4HA8 A;  1TW3 A;  1J2X A;  3DPT A;  1QPM A;  3MEX A;  1KQ9 A;  5J8C A;  2CG4 A;  5LBQ A;  3KET A;  1Z05 A;  4M9S A;  2YPR A;  3V7C A;  4G6Q A;  4BAY A;  2DU9 A;  2D45 A;  5AIP A;  3ZMV A;  1K6O A;  1SFE A;  2VC1 A;  5ICC A;  3I53 A;  2VBX A;  1ZRF A;  5D4S A;  1ZLK A;  1FPQ A;  1FOK A;  5HS9 A;  1J5Y A;  2IT0 A;  5H20 A;  2F5C A;  3KFW X;  3LA2 A;  3SZT A;  3WTW C;  3TO6 A;  2VT3 A;  3BJO A;  3KEO A;  3BWG A;  1WWX A;  1ZRC A;  2Q2E A;  2QVO A;  2WC2 A;  3OOP A;  4EGY A;  2GXG A;  2OZ6 A;  1G3W A;  1U5T A;  2VBZ A;  1I6X A;  4RGS A;  4IXA A;  2XKO A;  4RB3 C;  3L9F A;  2UXN A;  5H6Q A;  1YS7 A;  5CVI A;  3LFK A;  2NS0 A;  5HVQ C;  2YSR A;  2F2E A;  4U88 A;  3ZN0 A;  3CTA A;  3TQN A;  3FXQ A;  1XMK A;  3VB2 A;  3F21 A;  1JE8 A;  1SMT A;  3V4G A;  2STT A;  5HDK A;  2O3F A;  4UHT A;  1YLF A;  4HX8 A;  2Y0M A;  2ZO4 A;  1J59 A;  2KRF A;  5HS8 A;  2FRH A;  4HW0 A;  1XGN A;  2ZNZ A;  4IRI A;  4YII A;  3BJA A;  3KE2 A;  3U2R A;  2K02 A;  3DXJ F;  1G3T A;  2UXX A;  1U5T B;  2O6G E;  2NAZ A;  3R6S A;  5L3E A;  2BV6 A;  2FMY A;  3QPH A;  1YTY A;  1AWC A;  3GO5 A;  4MEY F;  1FP2 A;  4LMY A;  2VXZ A;  3MQ0 A;  3ZQ7 A;  4KIG A;  1HW2 A;  1ODD A;  3GFL A;  1Y0U A;  1T6S A;  3LA7 A;  2PJP A;  5BS6 A;  2E1C A;  1BI0 A;  2FU4 A;  4LLL A;  2IW5 A;  4KIF A;  4U7B A;  3SHF A;  3TOB A;  4OIR F;  3QPT A;  4PDK A;  3CO7 C;  4OOI A;  3F8F A;  2DT5 A;  1WI9 A;  4I0A A;  4ZH4 F;  3E5Q A;  1C0W A;  1SFU A;  5CVR A;  3H3Z A;  1B1B A;  5FO5 A;  3I64 A;  1SD5 A;  3FM5 A;  2ZME A;  1BJA A;  3HHH A;  4B09 A;  4HF2 A;  2MD5 A;  5ED4 A;  2QYO A;  3WGG A;  5E1Z B;  3MFK A;  1I1G A;  2BE5 F;  1LEA A;  1S7A A;  1FSE A;  4ETS A;  4IF4 A;  4KUM A;  5HS7 A;  4WXH A;  3F8M A;  1IN5 A;  3FWE A;  3M8E A;  3RYP A;  4ZYG A;  2YX4 A;  4HZF A;  4M9X A;  4L9T A;  2F5F A;  2V1X A;  1KYZ A;  1JHF A;  4KDP A;  1YG2 A;  1QNT A;  3WTT C;  2LNB A;  3GZ5 A;  2M8E A;  1QGP A;  2JPB A;  2OAZ A;  2M1B A;  4L9V A;  5FD6 A;  2ZME B;  4LFU A;  2P4W A;  3I71 A;  3L00 A;  3P9I A;  4OIQ F;  4QLC U;  1XD7 A;  4M74 A;  1FSH A;  2FF4 A;  2QZ8 A;  4BQA A;  3SZP A;  3IKT A;  2EFO A;  1ULY A;  3WTV C;  2ZJ2 A;  1I1S A;  2PEX A;  3I5U A;  1BIA A;  1MJA A;  1FBS A;  2VN2 A;  1LDK B;  1LNW A;  3GUD A;  1F1Z A;  1KU7 A;  4LB5 A;  1YS6 A;  2QM3 A;  3RPQ A;  2ADU A;  5IT3 A;  5CJ9 A;  1XDS A;  1RUO A;  1UST A;  3K1P A;  5E1X A;  2VON A;  1BC7 C;  3CUQ B;  1TQM A;  4ENK A;  2C6Y A;  3N97 A;  1MJB A;  1MDM A;  1EH8 A;  2DQR A;  1U6G A;  4ESF A;  1LVA A;  5K1Y A;  3J80 Z;  1IXR C;  5ERI A;  3GLX A;  3KP4 A;  4UXN A;  1LEB A;  4IPA A;  3ZP5 A;  2YU3 A;  2BBY A;  5CYV A;  2O61 A;  3RDI A;  1H0M A;  5D6E A;  3F6O A;  4XRF A;  5DD4 A;  2KIF A;  2XV4 S;  4M73 A;  1P2F A;  1KU2 A;  2QWW A;  5BQT A;  4BHP A;  1FT9 A;  3FMS A;  4IRG A;  3FMR A;  3LST A;  4G7O F;  1CGP A;  4OMZ A;  1QQI A;  3GZ6 A;  2G9W A;  2OD5 A;  3SQN A;  3IRR A;  3K2Z A;  3V7R A;  4OIO F;  1IN8 A;  1HKS A;  2IVM A;  4K2E A;  1E2X A;  3J81 Z;  4MEX F;  2HWV A;  2DBB A;  3HRM A;  4PZJ A;  2DQL A;  4I01 A;  1KA8 A;  1XN7 A;  5E20 A;  3GX4 X;  4U0W A;  5JHU A;  3L2C A;  1IN4 A;  2V9V A;  1FNN A;  1YYV A;  1D5V A;  4N9H A;  2ELH A;  2H6B A;  2P6T A;  3GW2 A;  2BYV E;  2NRA C;  2L02 A;  1EH7 A;  3EDP A;  4CYD A;  4G6D A;  3I0T A;  3QU6 A;  1TQI A;  3M1E A;  2EV6 A;  4HX7 A;  4QWQ A;  2L3D A;  3HIF A;  1SD6 A;  3J80 K;  2HKX A;  2L4A A;  1F9N A;  4N9I A;  4YFX F;  4RGU A;  5DD8 A;  2OA4 A;  4BXU A;  2KJB A;  5JFR A;  2STW A;  1D8K A;  2A07 F;  4M6X A;  4EM0 B;  1TTY A;  3WTX C;  4AIJ A;  5FD5 A;  3K1M A;  1IXS B;  5F6F A;  1J9I A;  4L9N A;  2LSO A;  1ZAR A;  1BC8 C;  4PGG A;  2FE3 A;  4HLY A;  3SXY A;  1Z1D A;  3GFJ A;  1BI3 A;  2HGC A;  2FBK A;  4L9J A;  5AIQ A;  2J5P A;  3RKX A;  2G7H A;  2MH9 A;  3J81 K;  3DPL C;  4KN4 X;  2E7W A;  5D5X B;  5FLX Z;  1IF1 A;  2A6E F;  4S04 A;  3RPU A;  1HW1 A;  2G7U A;  2UWM A;  3C18 A;  2XAF A;  4I98 B;  4A5N A;  2Z3Y A;  1UCR A;  3GXO A;  3O6B B;  4KMU X;  2COM A;  4M9Z A;  5AON A;  4EMS A;  5LGT A;  4XBF A;  2P6S A;  3Q9S A;  5ICG A;  1BM9 A;  1AOY A;  5F1R A;  1LQ1 A;  3M9A A;  2FA5 A;  2EV0 A;  3FXR A;  3KP6 A;  5E8I A;  1R22 A;  3KZY A;  3WGH A;  5H6R A;  4WK8 F;  2EB7 A;  2HYF A;  5K5R A;  2DO7 A;  4Y15 A;  5CVJ A;  1HKT A;  1Z6T A;  1WRJ A;  2FQ3 A;  4RAY A;  3T0Y A;  1KU9 A;  5DCF A;  3FXU A;  1T39 A;  1O3R A;  3CDH A;  1ZG3 A;  3HUG A;  4FT8 A;  2OQG A;  2W84 A;  2HDC A;  2DAO A;  2BGC A;  5ICE A;  2R7F A;  4BHB A;  4M72 A;  3V8J A;  3D0S A;  1O7F A;  3JSO A;  2QQA A;  4LJZ F;  3ABU A;  5FLX K;  3WU0 A;  3VFZ A;  1OMI A;  4CHU A;  1BN5 A;  1ZHF A;  1ZGJ A;  4RS8 A;  3JTH A;  3F8C A;  1HBX G;  3I59 A;  5CVU A;  1YW7 A;  2O8X A;  4Q47 A;  1KQ0 A;  3ZMZ A;  1G3S A;  1MJ9 A;  4OMY A;  1YO5 C;  1IN7 A;  1P92 A;  5D5U B;  1LDD A;  4YIF A;  3E6D A;  4HV6 A;  2HKO A;  4MHG A;  4UVA A;  1XMA A;  1KGS A;  1IRF A;  5ICF A;  2Z9O A;  2VC0 A;  5L3C A;  2M5W A;  4MQ9 F;  5LHI A;  3RJP A;  2ZNY A;  3FF5 A;  2IPQ X;  1H9T A;  4I2O A;  3E5X A;  2XAG A;  2JPC A;  3QOP A;  4ENM A;  2FOK A;  5HLI A;  3ECH A;  4KIC A;  4UV8 A;  2GIV A;  2ISZ A;  3QRF F;  2EK5 A;  3I59 B;  1YFH A;  3HRU A;  4H0E A;  2EA2 A;  1XB4 A;  4CGZ A;  1IW7 F;  1G3Y A;  3MAJ A;  4HQM A;  4R79 A;  2W25 A;  2JRT A;  3K0L A;  2LKP A;  1Z91 A;  2PG4 A;  1GXP A;  1RZ4 A;  5FFZ A;  2PN6 A;  4EM1 A;  1B6A A;  2FML A;  4ZZL A;  1S7O A;  2XAH A;  2FBI A;  3KEQ A;  1G6N A;  1FBU A;  3JW4 A;  5D8L B;  2EWN A;  3C7J A;  2HZT A;  3PQJ A;  4A0Y A;  5EEG A;  3F3X A;  4NQW A;  3RKY A;  3F6V A;  1J75 A;  1B4A A;  2KKO A;  3NEU A;  1U2W A;  2IA2 A;  4WWC A;  3RTR A;  5HLG A;  2ETH A;  1FX7 A;  2AXL A;  4KN7 X;  1BI1 A;  1FY7 A;  5D5V B;  4L0Y B;  2Q8K A;  2RC4 A;  1ZN2 A;  1D3Y A;  3O3K A;  1T98 A;  3ABT A;  2K27 A;  2V79 A;  3DV8 A;  4CZZ A;  1O3T A;  1LJ9 A;  2RV8 A;  3K1N A;  1WSU A;  1XGO A;  3F72 A;  2NNN A;  1QZY A;  3V8L A;  1DPR A;  1KQ8 A;  3KZZ A;  1R23 A;  3IWF A;  3BJ6 A;  2PLY A;  1WQ2 A;  2ZXJ A;  4RB1 A;  2GQQ A;  2OU2 A;  3DF8 A;  2OZU A;  2O03 A;  4EM2 A;  3E3V A;  2CSO A;  2EFN A;  1WKM A;  2VBW A;  1O3Q A;  4G7Z F;  3HSE A;  2CQK A;  1W7P A;  4CDG A;  3J7A O;  4P55 A;  5LLQ A;  3ZMU A;  1ZRD A;  4YFN F;  4U0Y A;  4LLG F;  1ZLJ A;  3EUH A;  3WGI A;  3WTY C;  2PQ8 A;  2EFQ A;  1RNL A;  1X3U A;  3CUQ C;  4CXF A;  1L0O C;  2P5K A;  3H92 A;  1HSJ A;  3BZ6 A;  2IA1 A;  2QQB A;  5DUK A;  3TO9 A;  3BY6 A;  1MGT A;  2MLG A;  1PDN C;  3I4P A;  1IXC A;  2PFB A;  1JHH A;  4UVC A;  5L3D A;  3IWZ A;  1XGS A;  3ULQ B;  5LRS A;  2K86 A;  1OPC A;  3LWF A;  1REP C;  5HDG A;  4F7Z A;  2V1U A;  4R1H A;  4YFK F;  1W7P B;  4L18 B;  2O0Y A;  1DP7 P;  3BPV A;  1S8N A;  3OV8 A;  2Z99 A;  4G94 A;  5EEH A;  4GO1 A;  4PCQ A;  1USS A;  4UNO A;  1FYM A;  4MGR A;  2RQP A;  1XCV A;  4EJW A;  4U7D A;  3ELK A;  4Q5S F;  2P7V B;  4GYG A;  4WX9 A;  2NYX A;  3RKW A;  5J6X A;  1R1T A;  1XSX A;  3GVA A;  3KCC A;  2XAS A;  1JXS A;  4O5V A;  1XGM A;  2PBI A;  3I58 A;  4CO8 A;  2ZCW A;  5D6F A;  3HTU A;  4BYY A;  2A69 F;  2DW4 A;  2X4H A;  2A5Y B;  1EV7 A;  5E1W A;  5LGN A;  2V6C A;  4UV9 A;  4I02 A;  2ESN A;  2XVC A;  3ZN1 A;  4LB6 B;  2JZY A;  2HR3 A;  5HDN A;  2DLL A;  2UZK A;  3Q5F A;  4IVN A;  2CYY A;  1HST A;  4DQ2 A;  1BBY A;  2GWR A;  4HV5 A;  2LF8 A;  2WV0 A;  3WTZ A;  4P9U A;  3RIR A;  4IHT A;  4EQQ A;  4DNC A;  2FBH A;  2GAU A;  2HFH A;  4HF0 A;  2W85 A;  1Q1H A;  2EFW A;  2HQN A;  1V3F A;  3VOD A;  1P4W A;  2VE9 A;  2QQ9 A;  4MTE A;  3DFG A;  3R0J A;  1Z9C A;  2FXA A;  1MDM B;  4GGG A;  2XUB A;  2M45 A;  2HOE A;  4FHT A;  1OR7 A;  2QBY A;  1UB9 A;  5DDG A;  1ZG1 A;  2EJR A;  3ZPL A;  2P8T A;  5TRD A;  3ECO A;  4ON0 A;  5ILU A;  5LEJ A;  1Z6R A;  1SD4 A;  3D5L A;  4HDU A;  3M7G A;  1L3L A;  1BIB A;  3KP2 A;  4TV7 A;  5CVV A;  4EJU A;  1ZG5 A;  2F5D A;  2ISY A;  1R1V A;  3PFI A;  2CGP A;  1MD0 A;  3ML6 A;  3HTS B;  4GYI A;  3O2P E;  3E6M A;  1RUN A;  2KIM A;  2IRF G;  5DV5 A;  2QBY B;  2F5E A;  1R5H A;  2V1D A;  3ERE D;  2D2W A;  3HOS A;  1SFX A;  4XSX F;  3GFI A;  1TNT A;  5J8F A;  3KP3 A;  4A0Z A;  4KFC A;  4LG0 A;  4BNC A;  3HOT A;  4ZYD A;  1IN6 A;  2QUF A;  4JBA A;  4ZZD A;  4L0Z B;  1BI2 A;  2OQR A;  4A2U A;  1ON1 A;  2K7L A;  2VOO A;  2L4M A;  2LDU A;  4JQF A;  5K5Q A;  1U3E M;  1TLH B;  3IRQ A;  2CWE A;  3QAH A;  3C1D A;  1BOA A;  2JT1 A;  4OIN F;  3MCZ A;  3WG9 A;  1J7K A;  3FZV A;  4YG2 F;  3P9C A;  5JR3 A;  3K69 A;  5FGM A;  4A5M A;  4G9Y A;  4EGZ A;  2A68 F;  4P96 A;  3DKW A;  1YW8 A;  1J0R A;  3V8K A;  4EJO A;  4LG0 B;  1UHW A;  1GVJ A;  4Q48 A;  3KLO A;  2Q0O A;  2PI0 A;  1QZZ A;  4BHC A;  3TDU C;  3LQR A;  2H6C A;  2IJL A;  2HQR A;  2P5V A;  1R58 A;  4A0X A;  2EA4 A;  2E7X A;  3R60 A;  1GXQ A;  4ENJ A;  3FHZ A;  1SD7 A;  2HTJ A;  2IP2 A;  3NRV A;  4L5J A;  4RB2 C;  3HRS A;  4G7H F;  4MTD A;  4Q4Z F;  1TW2 A;  2CW0 F;  1A04 A;  3GF2 A;  4Y13 A;  1KYW A;  3QP6 A;  2MLK A;  2B0L A;  3L7W A;  2CO5 A;  2VOP A;  3IKV A;  2KJC A;  3B73 A;  2R3S A;  4WXC A;  4ESJ A;  3GFM A;  3LQQ A;  3BP8 A;  1E17 A;  2DPD A;  5TJJ A;  1STZ A;  2VOD A;  2FNA A;  3ZMT A;  1U5T C;  3KP5 A;  2XRO A;  2OBP A;  4IHS A;  3DQV C;  3I54 A;  1I27 A;  2GZW A;  3VEP A;  2ACJ A;  4LGW A;  4M6Y A;  1IUY A;  2IA0 A;  1HQC A;  3R4K A;  4HQE A;  4OIP F;  2HYG D;  3U9G A;  2A3S A;  4D0P A;  4HYE A;  4WXD A;  3BPX A;  1P6R A;  5DYM A;  4AIK A;  1OKR A;  1T38 A;  1IZ1 A;  3ROU A;  1FBQ A;  1O7L A;  2ESH A;  4XSZ F;  1OYI A;  4LK1 F;  5KVR A;  1HW5 A;  2A61 A;  1FZP B;  1CF7 A;  3TGN A;  4N0B A;  3JTG A;  3IC7 A;  3WE2 A;  2JSC A;  1XCB A;  2ZFW A;  2K4J A;  4WF2 A;  1S6L A;  3Q9V A;  2Y75 A;  1DDN A;  4KT5 C;  4AIH A;  3V7S A;  4RGR A;  2L01 A;  5LRR A;  2HEO A;  4OU0 A;  3E97 A;  2YR2 A;  5HOO A;  2PMH A;  1ONV A;  3JAM Z;  3P9K A;  5E8G A;  2VBY A;  4P5O A;  1K78 A;  2RKH A;  3SFZ A;  2X0L A;  2FNP A;  4HBL A;  1H9G A;  4GCV A;  3E5U A;  3BOQ A;  2XKP A;  1GHC A;  5JVT A;  4LD5 A;  1B59 A;  5IT9 Z;  1CF7 B;  2MA3 A;  1FLI A;  3T8T A;  1R7J A;  2ZKZ A;  2XIG A;  3FMQ A;  4HX4 A;  5JI6 A;  1KU3 A;  5D4R A;  1HKQ A;  4G8X A;  1YQA A;  4NB5 A;  4KMF A;  4U0V A;  1T2K A;  3K9T A;  4RAZ A;  3EYY A;  3PQK A;  1OYY A;  3KLN A;  3E6B A;  1QBJ A;  1LDJ A;  2EV5 A;  1U78 A;  3NQO A;  2JTV A;  2RVC A;  1K78 B;  4HDV A;  2YX7 A;  3CUO A;  1VTN C;  3CJN A;  2FSW A;  1FYL A;  1ON2 A;  3GYH X;  1YIO A;  1PP7 U;  1RIO H;  2H94 A;  3LAP A;  3S2W A;  3GEZ A;  4L5I A;  1UFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...