2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
b'MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
3AA3A 3SQ1A 1DLOA 1LAWA 1S5JA 1YTAA 3HJFA 3NBPA 3CFRA 1NK5A 4J2AA 2FBXA 4KI6A 3QIPA 4KI4A 1A5WA 5EU7A 3OS2A 4DFJA 1B9DA 1Z25A 4CEAA 2BE2A 4H8KA 3V9UA 4DTUA 1U48A 3KLIA 4LH5A 4K8XA 5KGXA 4CCHA 2KFZA 3FFIA 1NOZA 1NJZA 2XY6A 3ZT2A 4B8AB 2WONA 2G8IA 1HQEA 4AHVA 1VSEA 4E7IA 3G0ZA 3LP1A 4DQQA 1F21A 3RMAA 2YHAA 2HW3A 4DLGA 1FK9A 3AVNA 1IKVA 4BDPA 4DSJA 2B5JA 1SKRA 3SYZA 4Z4FA 1QQCA 3MEDA 3M8PA 4W5TA 3EYZA 5E41A 3WNGA 3K59A 4FJ8A 4NCGA 3QEVA 1RT7A 3ZCMA 4CK2A 1SKWA 3KKRA 1QSLA 1T8EA 4W5NA 3O3HA 2IDOA 1NK8A 1VSKA 4RW6A 4E89A 1C1BA 4FJJA 1C6VA 3EY1A 3VA0A 4KAZA 4M3TA 2GV9A 3VQ7A 1RBRA 2HNDA 2VWJA 3NCIA 4CIFA 2WOMA 4DWIA 1TAQA 4RW9A 2Z1HA 3TARA 3F73A 3QO9A 3RR8A 2E6LA 5J1EA 4M42A 4JS5A 2KQ2A 3MXIA 3KKSA 1KLNA 4CGDA 2A1SA 4NCAA 4J2BA 1FXXA 1L5UA 4FYDA 3KLHA 3AVKA 4B9TA 4Q0BA 3U3GA 4F3OA 3AVFA 4M3UA 2B4JA 3OJSA 1KTQA 4FW1A 3K57A 4FZXC 3K5MA 2HVHA 2XHBA 3PUFA 3TI0A 2ETJA 2DFHA 3OYEA 3ZSZA 5J2QA 4FJKA 2OPSA 3DYAA 3OYKA 4F2RA 1LWCA 1DTQA 3MEEA 1EKEA 1REVA 4CHQA 3L2VA 4C8OA 3DOKA 4K8ZA 3NHGA 5DK5A 1J9AA 1D9DA 4FJ5A 3SZ2A 3OYCA 1IO2A 4CFCA 2LSNA 1NKEA 4KB0A 4CJWA 2RF2A 4HHTA 2P5GA 3AVAA 4HCBA 4KHNA 3LP3A 4LY7A 3HXMA 2YV0X 2W42A 4DSIA 1TKZA 3S9HA 4OKJA 4DTXA 2P1JA 2NUBA 1JKHA 1X9MA 1NJYA 4CFAA 1VSIA 3CYMA 3OS1A 4B3OA 4CEQA 3TAGA 4CJFA 1RT4A 2XO7A 1HMVA 4CEFA 1TK5A 1C0UA 1SV5A 1XHXA 3NF8A 2OPRA 3D45A 4JLHA 2Z1IA 4LD0A 4FJMA 3C6UA 3AVJA 3M8RA 4OLBA 4AH9A 4B9VA 4JRQA 4ELVA 1K6YA 1WNSA 1B92A 4CGFA 3ZT1A 1QHTA 4FJXA 1HRHA 3T3FA 4DTSA 3SJJA 1RTDA 3ALYA 3V81A 1JLAA 4Z4IA 1TGOA 1BQMA 1RBVA 4DU4A 2D0CA 4DSEA 1XC9A 4O5BA 4FLVA 4FJGA 4Z4EA 3KTQA 4Y1CA 1W0HA 4GVMA 3RMCA 3V9ZA 4M41A 5J2MA 1S1WA 3VQEA 1ZYQA 4QCLA 3V9SA 3L2QA 3AA2A 3C95A 1DTTA 1LW2A 4WE1A 4Z4HA 4ID1A 3TAEA 1S9EA 1KSPA 1G15A 4DTRA 4ELTA 1X9SA 4FLTA 3LANA 4OLAA 1HNIA 5C25A 1KVCA 2PY5A 1FKOA 4KHQA 1B9FA 1HYSA 1TV6A 3KLGA 1SUQA 3LP0A 3TWHA 3RRHA 2JLEA 4KHYA 3VA3A 2ZE2A 4JS4A 1U47A 1NKCA 1S1UA 4DFPA 4ZHRA 4FJHA 2KZZA 1NOYA 3ZSQA 3THVA 3RRGA 1JL1A 2E6MA 2HB5A 4DFKA 4CHYA 4H4MA 4E7HA 4LH4A 4BACA 4PY5A 4KREA 1WSJA 4FK2A 3SQ2A 2KZMA 1UA0A 2A1RA 3K5OA 5HLFA 3TAFA 3CM6A 4XIUA 1T03A 4F3TA 4Y1DA 3JSMA 5HRSA 2G8VA 4W5RA 3MAQA 1T7PA 1XHZA 1KLMA 1TK8A 2HHWA 1S6PA 4I2PA 3OY9A 3V1QA 1D8YA 4FJLA 1Q9XA 2RPIA 4FW2A 4KFBA 3CFPA 4F4KA 3TANA 4TSXA 3LPUA 4PWDA 3B6OA 3WNHA 4B9NA 3ZT3A 2YNHA 2YKNA 3CQ8A 4O4GA 5DMRA 4I7FA 5D3GA 1NJWA 3AA5X 3HVRA 1UAXA 4GMJB 1VRTA 3P1GA 4MQ3A 5KI6A 1BI4A 4OPKA 1S9GA 3VQ9A 2BDPA 3S3OA 4L8RB 3HPHA 2Q3SA 4ICLA 3NH1A 2HHQA 1EXQA 3LAMA 1BIUA 1VK0A 1D5AA 5KGWA 4C8MA 4CF1A 3CFOA 3NH2A 3NDKA 3OYNA 1RTJA 3K58A 4CIEA 3TAPA 3HSTB 4FJIA 4FXDA 2AJQA 1C1AA 4I2QA 2RKIA 4JRPA 3IRXA 2DTUA 3SQ4A 3TR8A 2R7YA 1LAVA 4DQRA 5HP1A 1QSYA 4CJKA 1CZBA 2XY7A 4H4OA 3DRPA 4E7KA 3DM2A 3DRRA 4BDYA 2P5OA 4MFBA 1BISA 2PYLA 4FZYA 1KVBA 1WAFA 4HUEA 5CY4A 1X1PA 4DTNA 2ZD1A 1TL3A 4CEBA 2HNYA 4DFMA 3V4IA 1ITGA 3ISNC 4CGGA 3OYIA 4M3XA 4DMNA 1SL0A 2G8HA 4NYFA 1CXUA 1S1VA 4OKEA 4CHPA 3LPTA 3EZ5A 1NK9A 2RN2A 4HUFA 1NK6A 3AVMA 1RT2A 2QK9A 1UWBA 1ASWA 2YKMA 3L3UA 4DQIA 4M3ZA 1KFSA 4O55A 1BI4B 2FBYA 4E1MA 3K5LA 4NCBA 4CJ5A 4CK3A 4CEOA 4FM2A 2D5RA 3AV9A 1TK0A 3RWUA 2D0BA 3WNEA 3LZIA 5C42A 3SPYA 4RW4A 3MECA 4KTQA 4CESA 4CF0A 1VSMA 4CJTA 2D0AA 1L3TA 1JLCA 4CGHA 4HUGA 1TAUA 4J2EA 3ZSVA 1GOCA 2Y1JA 1T05A 2O4GA 5SZTA 3NGIA 4KHSA 1LWEA 5JS1A 3CG7A 1Z26A 1SKSA 4QOZB 3TAMA 2JGUA 4Z4GA 3LZJA 5J2NA 1NK7A 3QLHA 2KW4A 4DF8A 1UOCA 3NAEA 3V1OA 4ZTJA 3VQAA 2HHVA 4CHZA 4CGIA 4IDKA 2HMIA 4CF8A 4J2DA 3LWLA 4BWMA 3QINA 4I9LA 4Q5VA 1VSDA 3SUQA 3P5JA 4KV8A 4CJ3A 1ASUA 2IOCA 3L2UA 1MU2A 4Z4CA 2F8SA 4HCCA 1R0AA 2HNZA 3C94A 2VG6A 4CK1A 3L2WA 1BL3A 3NF7A 4RG8A 2GUIA 4BE1A 4CJLA 1EP4A 1Q9YA 1D9FA 4O0IA 3VN5A 1RILA 1HQUA 3H08A 3HP9A 4DTJA 4ELUA 2I5JA 3OYMA 5JS2A 2FBTA 1KVAA 4DSFA 3MXJA 4C8NA 4CF2A 1WAJA 1YTUA 4N47A 4KPYA 1RBSA 4IFYA 3MXMA 1XWLA 1C0TA 4M45A 3QESA 2E4LA 2YNGA 3AVBA 2G8WA 3PO4A 1O1WA 3HYFA 3PX0A 1S1TA 4N5SA 4DU3A 3VQ8A 3AVLA 3V9XA 3O3FA 1RT3A 3SUNA 1BCOA 5C24A 3AVCA 1KCFA 4KB1A 3HVTA 4YNQA 3OJUA 3ZT4A 1UA1A 1YVUA 4C8LA 4RW7A 1BHLA 4DTOA 1TKXA 3OYLA 3KLFA 1VSFA 3OYAA 3L8BA 2G8KA 3SV4A 1U49A 2F96A 2G8UA 1IKWA 4DQSA 3OVNA 2QXFA 4FM1A 1JXBA 3ZSYA 1QS4A 3CM5A 3PV8A 1TVRA 3KIOA 4YFUA 3QNOA 2IAJA 4AILC 3PO5A 4R5PA 2EX3A 3IS9A 3VQDA 4KHUA 4DF4A 3BDPA 3RMDA 3VQBA 3OYJA 1WSFA 1RT6A 3PX4A 1L3VA 4F8RA 5J2PA 4B9LA 1HJRA 3IG1A 4AHSA 4NYNA 4E7JA 3G10A 1BQNA 1RBUA 3ZT0A 3NGZA 3O4NA 3DLRA 3HM9A 4LSLA 4I9QA 3DLKA 2DFFA 1C1CA 3L2RA 4HTUA 5FRNA 1U04A 3DI6A 4DTMA 3HPOA 4IKFA 5CYMA 2Y1IA 3V6DA 3QNNA 1WN7A 3RR7A 4CJEA 2OYQA 4M3WA 2GBZA 1JXEA 2VG5A 4KTZA 1HPZA 5FDLA 4CJUA 2HHTA 2X78A 3DMJA 3P83D 1GOBA 3AO2A 4RW8A 4FLUA 1N5YA 4EP5A 1LV5A 1A5XA 4DSKA 4N76A 1RBTA 1IH7A 3KK2A 4IBNA 4ZTFA 2OA8A 1JLFA 2Z1JA 4FLXA 5I3UA 1TKTA 2Z1GA 1HNVA 1ZBUA 4AHCA 3V9WA 2HHXA 3O4QA 3RTVA 3VQQA 2KTQA 4PQUA 3ZSXA 5KRTA 4G1QA 3U3YA 3AVGA 3LP2A 1EX4A 4FLWA 4W5QA 1LW0A 4IFVA 1J5OA 3B6PA 3SCXA 2X6SA 4F2SA 3S3NA 1JLGA 3BGRA 3QEWA 2HHUA 3QEPA 3IAYA 1TKDA 3SUPA 3HK2A 1LWFA 3V1RA 5K14A 3SI6A 4B9UA 3OYGA 2X74A 5KRSA 4DSLA 2BGGA 4DLEA 3AO5A 2QKKA 1L3UA 1Y97A 4CFBA 3AO3A 2OPQA 3K2PA 3DLHA 4UQGA 3LDSA 4OPJA 3WNFA 3T1AA 4BE2A 4KRFA 4HVJA 3SNNA 3A2FA 1KRPA 3PY8A 4FK0A 4CHOA 1HYVA 1RTHA 1ZBFA 2FC0A 4AHUA 4FLYA 4FZZA 3SPZA 1QTMA 1X9WA 4CHNA 2X6NA 2KFNA 2VG7A 4E1NA 3SQ0A 4EP4A 4W5OA 3DLBA 3LWMA 3NE6A 1WSIA 1HYZA 2PYJA 5HRNA 4CE9A 1N6QA 4FK4A 1CXQA 4E3SA 4CECA 1S6QA 3MEGA 3DOLA 1IKXA 3AVHA 3RMBA 3VQCA 4E0DA 2XRIA 1ZBLA 4EZ9A 3QETA 3DLGA 1RDCA 2YHBA 3PX6A 4KHWA 4OKKA 4B8CA 1QSSA 1C0MA 1IG9A 1J54A 4CEEA 2DFEA 4CGJA 1NKBA 3UIQA 3KJVA 3HP6A 3U6FA 3SUOA 3O3GA 1WSGA 2OPPA 3F9KA 4O44A 4ID5A 4BWJA 3AVIA 1BIZA 1FKPA 3L3VA 2FBVA 4IG0A 3NH0A 3OS0A 4KKOA 4OGCA 3ASMA 1KFDA 4IG3A 4BE0A 1I39A 2OZSA 2ITGA 1WSEA 1RT5A 3AO4A 2HVIA 3D0PA 4CJSA 1JLQA 1RCHA 1WLJA 1YT3A 3HPGA 3TABA 2XY8A 4CIGA 1JL2A 4B9SA 2YNFA 1WSHA 3I0SA 4FJ7A 1RNHA 3DRSA 3OYHA 5CZ2A 4PA1A 2PZSA 3DLEA 4DU1A 4LSNA 3LALA 1S1XA 2VWKA 1W9HA 2EHGA 3T19A 4CERA 4FVMA 3HT3A 4FJ9A 1GOAA 3KK1A 4B9MA 4PUOA 1SL2A 1U45A 1VRUA 3VQ4A 4CJPA 4CEZA 1JLEA 1NJXA 4CJ4A 5CZ1A 3E01A 4KO0A 4E7LA 1VSHA 3I8DA 3TAQA 3KLEA 4N41A 4EZ6A 3NF6A 2YNIA 4DS4A 1NK4A 1L3SA 1ZBHA 3ULDA 3OYBA 3NFAA 2IC3A 1RDAA 3JYTA 1RT1A 1ASVA 4OGEA 2IGIA 4GW6A 4CJVA 3LAKA 1I3AA 5KTQA 2OZMA 1QE1A 2O4IA 1CLQA 4CJRA 3AO1A 3VQPA 3KK3A 3QERA 3QEIA 1XI1A 3OYFA 4CFDA 4CJQA 4B08A 3SV3A 4AHTA 4DQPA 5T7BA 1NK0A 2ATQA 4E19A 2HHSA 1RDBA 2DY4A 3M8QA 3K5NA 4DTPA 3KD5E 1U4BA 3KD1E 1RDDA 4CF9A 4FJNA 5I42A 5FROA 3HL8A 3C6TA 1CZ9A 2ZQBA 2P51A 2XY5A 5FRMA 4DS5A 1VSLA 4FCYA 4N56A 1BGXT 3QEXA 3I0RA 2IS3A 1TL1A 4DG1A 4M3YA 3OYDA 2QKBA 3ZSOA 1JLBA 4Z0UA 5SWMA 5HBMA 2B6AA 1Q8IA 4AHRA 1IKYA 3M8SA 4KTWA 3ZSRA 2G8FA 1ZBIA 4QAGA 3NF9A 1A5VA 5CYQA 1SL1A 3AA4A 3QIOA 4OJRA 3S3MA 5HROA 3VQ5A 4CEDA 2BANA 3NGYA 2F8TA 4M3RA 4FM0A 1EETA 1J53A 1VSJA 1BCMA 4O0JA 5HRRA 3ITHA 3VQ6A 3ZSWA 4BDZA 4FLZA 4OVLA 4C8KA 1RTIA 5HRPA 3HO1A
chains in the Genus database with same CATH superfamily
1YTAA 1QQIA 1I27A 1XMAA 4DTUA 2V79A 2VQGA 3RMAA 4DLGA 4CD3A 3CCLN 3MEDA 2QW9A 1J09A 3EUAA 5AQYA 3K70D 3I8BA 4DBQA 3C7NA 4WFAL 3RR8A 5J1EA 2ZSHB 2ZCWA 5H1SQ 2L01A 1FSEA 4Q0BA 4RGRA 1XG1A 2EQRA 3D5SC 3VOEA 3MEEA 3U1KA 3O3KA 5DK5A 1FP1D 3T7ZA 4CJWA 4KH6A 3Q0WA 2HNHA 2NZTA 3RZOJ 3LP3A 3ZMTA 4RA2A 2YV0X 2DI3A 2R4GA 3ISPA 1JKHA 1NJYA 4GV9A 1MBJA 2Y48A 2NVUB 4CCNA 2K86A 3AG4H 2IGNA 2UV1A 1SD5A 2Z9OA 2OPRA 1DEJA 2O03A 2VASA 4JAXA 3JAMO 1L0OC 2LF7A 3CJ7A 3ZMVA 4B9VA 4ENKA 2M3AA 4E1JA 1HBXG 1QHTA 5AQWA 1QRYA 1KXPA 4DTSA 3ALYA 3KTQA 1B9NA 5AFUH 3KYCB 3TOBA 4A5BA 1S1WA 3F8FA 3CMAN 3C95A 2QENA 2PX9A 2GOXB 1B9FA 2E2NA 2VQHA 1P4XA 2JLEA 3VA3A 4DYQA 4PGHA 4JS4A 3KLNA 1DKGD 4HTLA 3Q7CA 3EUKL 1ZN2A 1T8IA 4E7HA 1TUUA 2ZJQL 5K5QA 5D8LB 3BG3A 3HSFA 3DP7A 3HRSA 3I9V2 2VB6A 4DGWB 2ME0A 3HVRA 1D0XA 2DMUA 4XQFA 2DPUA 1MBGA 2HQAA 3DBLB 3BTIA 2OJED 1RTJA 4CIEA 3HSTB 3IRXA 3GL1A 5EG0A 2R7YA 3ATUA 1R4NB 2KT0A 2BV6A 4MFBA 1SAUA 3K4LA 2DOFA 2QKMB 3V4IA 2HNYA 2E2JJ 4FWNA 3S1MJ 3BTJA 1Y1WJ 4DQIA 1HLVA 3A03A 5HLGA 2XHKA 1VQLI 1G8XA 2FSKA 2EIJH 1FIAA 4MO4A 2QSFX 5CQGA 2JA7J 2M45A 4I76A 4BL0B 3THYA 3PIOF 5J2NA 3SQNA 4XM3A 5LJWA 4CHZA 4IDKA 3FK7A 2R92J 3GEZA 4GYGA 1NM1A 1V3FA 2X6YA 2J5PA 3VWBA 4FWLA 1BA0A 2AP1A 3G1LA 4XSXF 1VQKI 4QS7A 3PO4A 4NXMK 4DNCA 1JT6A 3V9XA 1YJWN 1RT3A 3LSTA 2EA2A 1UA1A 1NGGA 1ZGWA 3OYLA 1HXDA 3KLFA 2G8KA 4LF6K 1YHQN 1FNNA 3PLAA 2XRLA 5J2PA 2VBZA 1H1VA 3LAPA 2MFZA 1FOYA 1U04A 4NHJA 2YU3A 3F5TA 2ZC2A 3O1BA 4BU2A 2KRCA 2IA1A 2UU9K 2ITMA 4H0OA 2CGJA 4A69C 2JZYA 3FZVA 4DYRA 3HTVA 1PDNC 1W1WE 4LB6B 1U8RA 3HK2A 2Y31A 2K5CA 5HVQC 2E2QA 1HW5A 2L9VA 3E6DA 3QBXA 1BW6A 4UNOA 3SQ0A 4M6XA 5JLHA 1IC8A 1GLCG 3GLXA 1YRNB 2P5GA 3AFHA 3BR1A 1BIZA 2GBYA 2ZM6K 5HNFA 3ULEA 4L5EA 5H6RA 3AO4A 3D0PA 3H5AA 4NUBA 1JL2A 1TWFJ 4YFNF 2HWVA 3DLEA 1S1XA 4BRNA 2D2WA 4DYCA 2MLGA 1F36A 3HOSA 4O5VA 5CJ9A 3NF6A 5KCMA 3ATVA 4H0YB 4LMYA 1ASVA 5M1PA 2OV7A 3DEWA 2RREA 3CUQA 1USSA 1NK0A 1JHFA 1HW2A 4FJNA 3ZQ7A 1RR8C 3F3XA 3DWLE 1O13A 3GFLA 5HNHA 3WXIA 2VC0A 2K7LA 2V51B 1U2VA 4M3RA 5FKNA 1RTIA 5HRPA 4P9UA 1NK5A 1KYZA 4BJTA 5EY4A 1A5WA 4FYDA 1C0GA 3V9UA 4DKWA 3LA3A 4XL9A 5F0XA 3LP1A 1FJGK 4DR5K 4EMSA 2HOAA 2A69F 2JVHA 1MA9B 2CMPA 4M3TA 3VQ7A 1ZAOA 1JI8A 2QWOA 1E17A 2KQ2A 3KKSA 3AVKA 3CP8A 1VHXA 2UXNA 4DIQA 4FW1A 4BXFA 2CQ7A 3CCMI 1DTQA 5AQJA 2RHKA 3DTKA 3SFIA 4B3RK 2R7DA 3HDDA 2PQ8A 2LSNA 1U0JA 5F1RA 4DTXA 2NUBA 4C30A 1BR2A 3OR2C 1SEUA 3MX5A 3TAGA 1FOWA 3D1NI 1XHXA 3ZX0A 4M7XA 4JLHA 3HGYA 4ELVA 2QF7A 4IO9F 3E5XA 1Z05A 2MSYA 4BC2A 1STZA 2D0CA 3VTIA 4Y15A 1W0UA 3K6GA 3L09A 3V9ZA 4LLNA 5J2MA 3KWIA 1N33K 5F0HA 1B1BA 1S9EA 3WTXC 1X9SA 1KVCA 1FKOA 4BRIA 3FM5A 1ODDA 1BDGA 4KHYA 2HTJA 4BACA 2YHWA 1I6XA 2KZMA 1UA0A 3J7AP 4Y1DA 1ZHFA 3OY9A 3IL2A 2EBIA 4KFBA 3DKXA 2CGPA 3B6OA 2YKNA 1LB2A 4I09A 1BI4A 3OOPA 4L8RB 4A3DJ 1VK0A 4CF1A 4G8XA 4KIFA 4I6MB 1MJ9A 4I2QA 4A6EA 4HDVA 3H35A 4CJKA 3CD6I 2XY7A 3J81K 1IJJA 3S8PA 3DRRA 4NBQA 2BXYA 3UKRB 5K7HA 2LH9A 1KVBA 3WEEB 3D2FB 5K7ZA 2DAOA 4U67L 1SL0A 4ESBA 4RGXA 4OPAA 4FM2A 4XRSA 2D5RA 1TK0A 2E1NA 2QWQA 4RW4A 5F2RA 4CJTA 3E5UA 4AWXB 2KJCA 4KT6A 4DQ8A 1N8RO 2KJBA 1J2XA 4RGUA 2E36A 2PJRA 2HMIA 4ZYDA 1P6RA 4I9LA 3QYBA 1OH7A 3BG5A 3GMEA 4AD9A 2GUIA 4CJLA 1EP4A 4HWIA 4AYBN 4C8NA 2QWPA 5IPAA 3K69A 3AVLA 3WE3A 1K8AO 1AOYA 2H27A 2Q0RA 3HVTA 2DMPA 1G3SA 1JXBA 1QS4A 3IS9A 4XN0A 4AVPA 3LSIA 2F9TA 1KQ9A 1FP2A 4I7HA 1EWQA 4NYNA 3WEEA 1RBUA 2DFFA 2K9LA 1FYLA 3C2HA 1IRFA 1TYQA 2ZNZA 2XAJA 4XONA 4B48A 4IHYA 4M3EA 2D45A 3K4JA 1KAZA 2OA8A 4Q48A 1XSXA 2KTQA 4C3JJ 3I55I 4IFVA 3SUPA 2OUMA 3V1RA 1TQPA 3KWGA 1LFUP 4YOWA 1SAZA 2BGGA 3CMMA 3IKVA 1Y97A 2R5YB 3AO3A 2QWMA 3LDSA 4OPJA 3O4WA 4AHUA 1ZRCA 3P7NA 4XEIA 2F4MB 3H5RA 1IUFA 1Y56A 3LFKA 3OWTA 4EZ9A 3B73A 2Q31A 3TO6A 1IG9A 2O8CB 3IC7A 3UB5A 3F9KA 1SANA 3RTRA 2NOJB 1JTYA 2LRDA 4JN4A 3H3VK 3EQLF 4CIGA 1RNHA 5AZIB 3CQYA 1VQ6I 3U1DA 3A0IX 2OCEA 2H1KA 3GTPJ 3KK1A 4B9MA 1VRUA 2FXAA 2MH9A 5LD2C 3I8DA 2KDZA 3ULDA 1XC5A 2VXZA 3FBIB 5KTQA 4ANJA 4HF2A 3JCUC 1O3RA 4ZC3A 1C0FA 1JT0A 3CP2A 3S41A 5DV5A 4ENJA 3K5NA 3MN7A 2FQ4A 4B1XB 3GE1A 3O2PE 1H89C 4LG0B 2ZNYA 4N56A 4TV7A 3EPZA 4BRFA 2E7XA 4OX9K 3IKMA 2K3FA 4PFOA 1Q81O 3M8JA 4IVNA 4C8KA 4S04A 3R0AA 2F4OB 2EWSA 3VERA 2JSCA 3ERED 3K9JA 2JWLA 2Z33A 4I02A 4B8AB 3ONQA 4BROA 3PFYA 3BP8A 3E9PA 2QYOA 3WNGA 1SKWA 3HXLA 4BJ5C 1T8EA 3CCJI 4GFBA 4WFBL 4NXNK 4Y3OA 2GV9A 2CUZA 2VWJA 4HEA2 4CIFA 2WOMA 2CW8A 1SFEA 1TP4A 2N8GA 5E84A 2VKVA 5FKOA 4ZYEA 1S7EA 4IOAF 1Z1DA 1E3PA 2R7RA 3VSLA 2HVQA 3Q0UA 4CVNE 1YI2N 2GEMA 3HXMA 2HSTA 1LDDA 2MABA 1SFKA 2Y2ZA 4CEQA 3I59A 2WBNA 3VGMA 2EINH 1YE9A 1WJ5A 1MH4A 1V4TA 2BY1A 1IF1A 3I3LA 5IT9Z 1B72B 5DTDA 4N9IA 4MQ9F 4F92B 4C2TA 3V81A 4B44A 3ABMH 3BC8A 4WXCA 5EEAA 1ZGJA 2CUEA 2PFBA 2XAGA 5LL6Z 1G59A 2ZXJA 4DTRA 4ELTA 5C25A 3JRGA 3LDOA 3TPQA 3KLGA 4BC3A 3C6HA 5KAIC 1N32K 3UR3C 3F2KA 3GCMA 3BZKA 4F3TA 1WBBA 3RCOA 5ILVA 2IGKA 1APLC 3TANA 2UUCK 1YITI 5KI6A 1R49A 2DCEA 4FASD 3A8YA 3FZMA 2E5NA 1X1BA 3OYNA 3TAPA 3QICA 1S72I 1HPMA 2FF3B 1BG3A 5AZJA 4XRMA 2BY0A 4A3EJ 3CJAA 4CYCB 2JJ7A 3DF8A 4DFMA 3CC2N 4CGGA 3ZOBA 4DMNA 5BN8A 3I53A 1QU3A 2VKEA 3IH3A 4CK3A 3ZR8X 1QHHD 5L3GA 4UY8O 4CESA 1WQ2A 4CGHA 4HUGA 2XKPA 1VQOI 2O8FB 3CLOA 3E3VA 2R5ZB 4ZTJA 4BG8A 3P5JA 4FX0A 4CJ3A 2QEXI 4NLBA 2HNZA 4OMZA 2VG6A 4HX7A 1AKHA 3I4MJ 2P5VA 2P4WA 4YG2F 3HRGA 1K73O 4A62A 1ITYA 2W1OA 2CGKA 4KPYA 1G3YA 3MXMA 2L02A 2KIFA 2E4LA 1B6AA 2JK3A 1K79A 1S9HA 3HYFA 3FMRA 2X85A 5DCMB 3ZETA 4IQ4A 2LLKA 3C2BA 3DQVC 3CCSN 1IKWA 3OL4A 1W2BM 1VQ8N 2OCCH 4U7DA 2LREA 3G4SI 2W48A 5JVHL 2IAJA 3DPUA 3KETA 1SVOA 2P9LB 4E7JA 5M5YJ 3ZT0A 3VGLA 5AONA 4IO9L 5E8GA 5KPRA 4MEYF 3P83D 1GOBA 4JKDA 1N5YA 3OSFA 1IGNA 2I8DA 3ZCOA 3C2GA 2ZBKA 3CDIA 4PQUA 2Z5UA 4XRFA 1H9TA 1IRZA 2ZGYA 2A6EF 1NHAA 3S16J 3BGRA 4BR7A 2IXSA 2HZDA 2P6SA 4DLEA 4UQGA 2VPLA 3SFZA 3FXJA 4CHOA 3DFGA 1X9WA 3V7CA 1SFXA 1CXQA 4E3SA 3MEGA 2P9IB 3AKZA 2LYCA 2RKHA 1SD7A 1QSSA 3E1YA 2XAHA 1UAAA 1TW3A 2R7XA 5FPEA 1WSEA 2R7WA 2X0LA 3HPGA 2XB5A 1WSHA 2JA2A 4LSNA 1IDZA 3E0JB 5E8IA 2EH3A 4A3CJ 4PKGA 2P9LA 1O7FA 1U45A 1OCCH 3OTOK 5AJ3K 2H8WA 3ZXSA 3CCEN 2ASPA 3R61A 3MKZA 1WJFA 2FU4A 1FYKA 4O6JA 2O3FA 1QE1A 4CJRA 4GGGA 1ETKA 5T7BA 5KHDA 1RDBA 2CUFA 3C6TA 2Y0SN 2XY5A 3JRBA 4BH9A 3TEDA 1MDMA 1Q1VA 3FIWA 2ZF5O 3S3MA 1N77A 2YX4A 2CG4A 2MD5A 5HRRA 3P9CA 3VQ6A 1HKCA 2GTDA 3CFRA 4J2AA 3GXOA 3QIPA 2OD5A 2P9IA 1NJZA 4KYWA 2PAVA 2P9PA 1F21A 1FK9A 4BDPA 2PMZA 1JKQC 1Z7UA 3BJAA 1Z6RA 3OIPA 1V4RA 3EY1A 1K9MO 3D2EB 3HUGA 2LP0A 4FWMA 3K2ZA 1IAWA 3QO9A 1K8KB 5FKKA 1XDUA 4NQWB 3U3GA 3COAC 3A2KA 2COMA 4C9YA 5J2QA 2QBYA 3ASOH 1J9AA 4BHPA 4FSVA 3CUQC 3SZ2A 3DLLF 1VQ7I 4A5NA 4FT8A 3S9HA 4JX4A 5AQMA 4OO1J 2VBXA 1SV5A 1U5TB 1KD1O 3D45A 2UXXA 3R6SA 1EV7A 5F0FA 1RUOA 1FEXA 1X3MA 3RVCA 1VF9A 4Z4IA 4DU4A 5ICFA 4FWRA 3RMCA 5IT9K 3TAEA 2IP2A 5KNLA 2DA2A 2O61A 1LPQA 4S0HB 4LF8K 2V1XA 5GAHP 4QPQA 3SQ2A 2IA0A 3K5OA 5HLFA 3CM6A 4NQWA 2OQRA 3SDBA 2VJJA 4XBFA 1H8AC 4PWDA 2CV2A 3SAHA 2L9SA 1ERDA 3VYRB 4O4GA 4XLNF 2W41A 2L4AA 1TQIA 1OFCX 2HHQA 3F6OA 4C8MA 4DFJA 4PUSA 3CFOA 2V26A 2L2OA 4CCJA 4H0EA 1X4OA 4FJIA 4JRPA 3GOIA 4E7KA 3O1WA 3HI0A 3PNTA 3GWZA 3E1SA 5CY4A 4FOEA 1ITGA 3WTVC 1U5TA 1X2NA 3K4CA 1UWBA 1O3TA 2A6AA 3VGKA 4E1MA 2ZJ2A 5HDKA 4MO7A 3WQUA 5LMUK 1K78A 3FM3A 4XR6A 3KYDB 3NGIA 1LWEA 4QOZB 4OOIA 4Z4GA 2HHVA 4CGIA 4BRCA 2KHOA 3DWLA 3SUQA 4EM2A 3LL3A 4M73A 4FQGA 2V4JC 3L2WA 3W3CA 2Q1NA 5GPAA 1RILA 3H5NA 3MXJA 1YTUA 4BGBA 4IOAL 4O5FA 2M4GA 1AHDP 2F5VA 4MIMA 3RPUA 5C4JJ 2ELHA 3QOPA 5C15A 4C8LA 2Y30A 4YDUA 2LSOA 4WXHA 1U49A 2G8UA 2W82A 2UXBK 2NS8A 3RSEB 2O7OA 1L3VA 2R7TA 4B1VA 3TTDA 4OWRB 5AQFA 1UELB 2QM3A 3L7WA 4FLUA 2AHQA 4QSHA 4FLXA 1T6SA 3HIFA 4G6QA 4X1EA 2EFQA 4AHCA 4CUGA 4O8UA 1WI3A 3U3YA 4RTFD 1ZTRA 3VYTB 1ILYA 1VQNN 5K14A 4M6YA 4JK8A 2OPQA 2E71A 4U0YA 4HVJA 5F1XA 2FC0A 2Z2SB 4CHUA 4E1NA 4KT5C 3DXJF 2XRIA 1LVKA 4BY7J 1VQLN 1J54A 2QUFA 1NKBA 3KJVA 3S93A 1D0YA 1YS7A 3TDZC 2EPFA 4BUPA 1OCTC 5FPDA 1JLQA 5BNGA 2YNFA 3RSEA 3I56N 1PJRA 5DM6F 1GLAG 2QXLA 5FLXZ 3IWZA 2CGLA 3CCQI 3D0SA 4EZ6A 2V1UA 5D5UB 3O9TA 3OHRA 3M3ZA 4B1RA 1B8IA 1RDAA 1IG8A 2KZGA 2O4IA 3AO1A 3KK3A 3QERA 3OYFA 4WQ4A 4CJQA 4AHTA 4FO0A 1D1AA 2XF7A 1QZ5A 1FX7A 2ZQBA 4U0WA 2IS3A 2VXDA 3ZSOA 4G6TB 2DMQA 4AHRA 3VB2A 3AA4A 3K1MA 5E79C 2VUMJ 2KP6A 1J53A 3ITHA 3ABKH 4OVLA 3HO1A 1UG0A 1T98A 4V2FA 2YU9J 2H09A 2FBXA 4V19S 2VKDA 4H5WA 2BE2A 4DV5K 3MQ0A 3SLCA 3LDNA 3ZN1A 2W7NA 2JRMA 3FXKA 4OIOF 2OTJN 1I5ZA 1RFQA 3EYZA 2EZHA 4AUXA 4NCGA 2O5RA 2JWTA 2HDDA 2CQQA 4GY2B 3K4NA 1VQPI 1HA8A 3J7AY 3S1NJ 4RW9A 2Z1HA 4A12A 1BI1A 3KLHA 5KPZA 4IXCA 1NNEA 3OJSA 2CH6A 4IDHA 3MKYB 1AWCA 3TP0A 3F23A 1XD7A 1ZR4A 2X9DA 1YXQA 1Q7YO 4CFCA 1Y39A 4E7ZA 1Z7LA 4OKJA 3WXMB 3P4IA 3CYMA 4R8HA 1RPWA 2HEOA 3R3LA 1ETYA 1ONVA 1BW5A 4XKVA 1R7JA 2VPRA 3FXQA 3AG3H 3JR9A 3SHFA 3LDQA 4PJ0C 1W0HA 2QLZA 1TW2A 3RIRA 2HF3A 5FO5A 2IGOA 1F43A 4HV5A 1HYSA 4CD1A 2YUSA 3THVA 2W84A 2GM4A 1T03A 5J47A 2LY9A 3V7RA 3MFKA 2VYPA 2LDUA 3UKUA 1ZRDA 4PJNA 1D1BA 1BIUA 1D5AA 4Y4RA 4B1UB 4ISFA 2DTUA 3ZGKA 4DZPA 1BO5O 1V4SA 5KQDA 4RWTA 4M3XA 1R4MB 4AM7A 3EZ5A 5LFAA 3Q5FA 4RB2C 2YKMA 5ICEA 1VI0A 1SVLA 3ZP5A 4ISEA 1Y1VJ 2D0AA 2STTA 4EM1A 2P5LC 3THXA 2KIMA 2XAQA 1Z21A 2VODA 3U4LA 3BJOA 3RYRA 1G3TA 1MNDA 2F8SA 4M63C 4F93B 1X3UA 1HQUA 2NVYJ 1F5TA 2IS1A 5CKTA 2G8WA 3ELKA 3QYEA 2XB0X 3QYFA 4EFHA 3O3FA 2WFBA 3B02A 4KB1A 4YNQA 3ZT4A 2E60A 4JKGA 3UKGA 2XGDA 4F52A 1TVRA 4EV0A 1J9IA 4M3BA 1XMOK 5KK1A 1IN4A 3DLKA 5FLMJ 5DDGA 4M3WA 4NC8A 3LSPA 2NAZA 2VG5A 3DMJA 3FK6A 3T1YK 1SS6A 1NH3A 2L7MP 1JLFA 5FKLA 2Z1GA 1BC7C 4DV6K 3O4QA 2FNAA 2AQEA 3TSPA 5DUIA 2X6SA 4DR1K 2K3PA 2HHUA 4Y13A 2L9RA 1LKXA 2Y75A 3QP5A 1T08B 5E1XA 1O3SA 3NMUA 3M9AA 4CCOA 5TGTA 1GDTA 3SPZA 1MBFA 1XX5A 2VG7A 1BWFO 5BREA 2QA4N 1LOTB 1TWCJ 4YRVA 1REPC 2PMUA 2WAQN 1HSJA 3J7ZO 1VQ4I 4J8FA 3M6GA 4BR9A 4MDBA 2ITGA 5F0CA 4DW6A 1WLJA 1YT3A 4DR2K 3FMQA 3B8AX 5K5RA 3T19A 3HSRA 4FISA 3DXKA 1NJXA 4QIWN 3KLEA 2P9SA 2IC3A 4UUSB 1VQ9I 5TRDA 4IHXA 3CLQA 5FLXK 2FXUA 5KAFC 1R71A 2K9NA 3SZTA 4MLHA 1S8NA 3GTGJ 4GNIA 5JLFA 1OKRA 5AIQA 4FCYA 4H0TB 1TL1A 3ZSRA 5C12A 2BANA 3KE2A 1N36K 3M5RA 1BCMA 2CW0F 4BDZA 2NRAC 4BC4A 1OCOH 2DT5A 1WJEA 4Q5SF 4RB1A 4FJXA 2HTSA 2KFZA 1QO0D 1YJNN 3FFIA 4ENNA 2WONA 1HQEA 3JAMZ 3M8FA 5J1YA 1HKQA 1QQCA 1WH7A 4RLQA 4OU0A 2QWLA 5AQTA 4D7NA 3KKRA 1TNSA 4W5NA 4JI7K 3I55N 4IHWA 1RBRA 2HNDA 1IV0A 4BBRJ 2PEXA 2A1SA 1FXXA 1L5UA 3WUHA 4B4CA 4F3OA 4MFEA 2E34A 2GWJA 2GXBA 2E5LK 4RAFA 1X1DA 1D0ZA 2K4JA 4YHHK 3DOKA 2R93J 3ZX3A 1XS9A 4IRIA 3LL7A 1TZLA 4H4KC 2RF2A 2OA4A 3VTHA 1T44A 1X9MA 3G6EN 3BJ6A 2V9VA 4JHDA 1PP8F 3CXCM 1VQ5N 2A5WA 2FD5A 4B9QA 4AIDA 3EZWA 3ZQGA 2DYRH 3AVJA 4G12A 2Q0UA 1AU7A 1WNSA 2W24A 3BEXA 4FJGA 1LE8A 1D4XA 2H94A 3ZMZA 3TW6A 3MMVA 1KSPA 1TWHJ 5M5XJ 3RRHA 3LP0A 1P7IA 4HG2A 1WSUA 4EAHD 4ZHRA 3HRMA 1JL1A 1Z6TA 2LVSA 3BPVA 3BWGA 1D8KA 1LFBA 5AQUA 4BEHB 1Q9XA 2XDVA 4WCGA 2FOKA 4DR7K 5DMRA 3HHHA 5IP6A 4B1YB 1YTYA 2AA4A 2W25A 1FLIA 1S9GA 2BDPA 4AYBA 3N97A 2XGEA 3NDKA 3CC7I 2D4WA 2RKIA 1XB4A 3BR5A 3MN5A 2MG4A 2A61A 1MBHA 2CRGA 3HL2A 2XROA 4IEIA 2PYLA 4FL9A 5IOZA 4AIJA 1NGJA 1S1VA 4OKEA 1CF7A 3CCUN 1ASWA 3L3UA 1T6CA 4NCBA 1TT0A 2XSDC 2O8BB 3AV9A 3RWUA 4H5VA 3MECA 1S5LC 3V42A 2DA1A 2FMYA 4DBRA 1DPRA 2AS5F 1SMTA 3TAMA 2HHHK 3TDUC 2BH1A 4UV9A 2DQLA 4CZGA 5FD6A 1D9FA 4MO5A 1K6OA 2ZXHA 1FTTA 4ELUA 1DP3A 1YJ9I 4BEHA 3T8TA 4M45A 3DEEA 4YORA 2UUZA 1TKXA 2M87A 5GPCA 3KZBA 3OVNA 3TMOA 3PO5A 2DTZA 5DM7F 1OKJA 1WSFA 3GFIA 5FKMA 4U88A 5H2FC 3FMSA 3L2RA 5CVRA 1BOAA 1ULYA 4GV6A 3F8CA 2O8BA 2PBDA 3EKSA 5LBQA 2M0CA 1RBTA 5LY3A 2ZGZA 1YITN 1CGPA 3H45C 4PSWA 5L3EA 2WV1A 4L5IA 3ZSXA 5E3NA 1QQMA 2DBBA 3Q0VA 3SCXA 2Y9YA 3TKYA 2M8EA 4L0ZB 2K27A 3W2WA 3SI6A 3VSKA 4E70A 3J80K 2RAEA 1KC8O 3M1CA 1E3MA 1GXPA 5KQ8A 2M4KA 3WGIA 3CCVN 1R00A 3DLBA 1WSIA 2PYJA 5LLQA 3DOLA 4PL7A 4OPHA 1ZBLA 3BQYA 2YHBA 4B8CA 5EOYA 1ETVA 4BWJA 3L3VA 2FBVA 4YDUC 2BW3B 1R5ID 4A2BA 1R59O 3CJRB 2NRVA 2ADUA 1QA6A 4K25A 2EHGA 4CERA 3VDXA 2R7OA 1KQ0A 5BRHA 3WGGA 2IW5A 2BVMA 2IVMA 4CJ4A 4KO0A 3LSMA 3TO9A 2A05A 4G94A 5CVJA 2WAFA 2O8EA 1YLFA 2VQLA 4DTPA 4FPAA 5CHIA 3RSNA 2CJJA 4HX8A 4I0AA 4EJWA 3QEXA 4AM6A 3HHGA 4N9HA 1Q18A 3NF9A 3A01B 2RQQA 5CVIA 1POGA 5HDNA 3QP6A 4FLZA 4CCLA 4EGZA 2E8AA 3CCLI 5EU7A 1KRPA 1Z25A 3U9ZA 4CEAA 5A2QZ 3KLIA 1R22A 3K0LA 2HW3A 1IKVA 3FKIJ 1XMXA 2P5KA 1UMQA 4W5TA 3QEVA 3H1QA 2Z3YA 1YX3A 3T1HK 2JT1A 3JAMK 3VMFB 3JTHA 3M1EA 4FJJA 2ZJRL 4JBAA 4LF7K 3OR1C 5LEKA 2D5VA 2P9NB 4HZFA 4CGDA 4NCAA 4BREA 4IOCF 3O8MA 3HGGA 4LFBK 3K57A 5BRFA 4ZH4F 3GZNB 3MK6A 4FVUA 3OYEA 1Y0UA 4HA8A 4FJKA 5KVRA 1ZG3A 2CV0A 2ECBA 4LC9B 3I0TA 4BXXJ 4XH1A 1OPCA 4I98B 3I4PA 4KHNA 3TTCA 2W42A 1TKZA 1J5YA 5FPNA 2NNNA 3ZMUA 2GAUA 1LQ1A 2UUAK 3CPWM 2VC1A 2NXNB 1NBWA 3WG9A 2Z1IA 1MWKA 5GAGP 2DOEA 4U87A 3ASNH 4UY8I 4M3GA 1GUUA 3QMLA 3CMAI 3ZT1A 4LD5A 2W85A 3GX4X 2MBFA 1JCGA 3T3FA 1BQMA 1XC9A 1X3WB 3ID8A 3O9QA 2OPTA 4CXFA 1A36A 5ADXH 1XNQK 1JKOC 3CCRN 1TQMA 4BQLA 4BRPA 4WE1A 3EKUA 4OLAA 2IT0A 1SUQA 3EE8A 3SYTA 3CF2A 3JSPA 2XSJC 1QHAA 2EZIA 4H4MA 2G7HA 4FWPA 1P9QC 4G7ZF 2V9KA 4R79A 3V1QA 4FW2A 3CFPA 4F4KA 4TSXA 3AAFA 2LTPA 2WY8Q 3A02A 5F04A 4BXUA 2V7YA 3S3OA 2DO7A 4BGDA 2O0YA 3SAFA 1KU2A 2YHYA 3G25A 1Q1HA 3DM2A 4HF0A 5AQOA 2FQ3A 1RGIA 4OIRF 3E97A 4PKHA 4UB6C 5AQNA 2PMHA 4M3ZA 1KFSA 2X51A 1ATRA 4PJJA 4BAYA 1NGBA 1ETQA 5B5EC 2R7VA 3CI5A 2HYFA 3LZJA 1UOCA 3GYHX 4AQYK 3TL4X 4BRKA 1R0AA 2KIQA 4GV3A 2XGXA 2H3GX 4KJZA 1WAJA 2J5OA 3C7JA 5LRSA 1T95A 2ESHA 4ILJA 3PSFA 4A0YA 1BCOA 3VENA 2HMPA 3AVCA 1YIOA 1PUFA 4X65K 4BR0A 5C44J 3K0SA 4F55A 5D8KB 5AQSA 2QCOA 4XNFA 1P90A 4IL6C 3EN9A 4A6DA 3VQDA 1JKRC 4D5FA 4CYDA 4JKCA 5CLSA 1FMWA 1SQKA 1K4TA 3DI6A 4GKKK 5B1BH 3LQQA 4NLCA 1WJCA 1DQUA 4KTZA 4YOYA 1HPZA 2X78A 2ZSIB 3ID6A 4N76A 4JKBA 2V9PA 2JA6J 3KK2A 3EETA 1HNVA 4KITB 4PCQA 4JI1K 2JUCA 1NGAA 4IWVA 3QEWA 1OH8A 4KHPK 1TLHB 5KRSA 3PSIA 3BR0A 2IS4A 3MZYA 1IN7A 2Y0SA 2WB1N 3SDGA 3A2FA 3SNNA 1UHMA 1RTHA 3ZQIA 3LWMA 3U21A 4FK4A 2WA0A 4YFKF 1BA5A 4CW7B 3QETA 1RESA 4KUMA 3O3GA 4IZZA 3ZEUB 1FSHA 4MEXF 1D5VA 2QQ9A 3FXUA 4KKOA 4OGCA 5DD4A 1Y0NA 2OZSA 4XK4A 4WWCA 3HEFA 1RCHA 3TABA 2P9KB 3MCPA 3I0SA 4MGRA 2PZSA 5EZGA 3PIPF 4JI0K 2K9QA 3OMYA 2HYGD 2VQEK 2OAZA 2P7VB 3LQRA 3VQ4A 2HDWA 3IAS2 4E7LA 2I5UA 1LJ9A 3EO3A 1HNWK 4BHCA 5FLVA 3VQPA 4CFDA 4B08A 4CZFA 4ZYHA 5I42A 2P51A 1X4PA 4BRQA 1IXCA 4M3YA 3R4KA 3I4NJ 4Z0UA 1JE8A 5CYQA 2L7FP 4ON0A 1WOQA 3CDLA 2DA6A 2EFOA 1MMSA 1S5JA 3KEYA 5J1UA 2NS7A 4Y7NJ 1U48A 3O5BA 5LHHA 2DJIA 1SVMA 4E7IA 3RKQA 1QQNA 3SMPA 4ISGA 3ZX2A 3L6QA 1NWKA 3LAJA 2DW4A 3A0HC 3CC4N 3A1YA 2L7ZA 1BIAA 1E4GT 2K85A 1A35A 5C3EJ 3NVMA 5JVTA 4XLAA 2GWRA 5D4RA 3NCIA 4HW0A 3LDLA 3F73A 3F72A 3CQXA 3MXIA 1KLNA 3FF5A 2M9HA 4YELA 2XUBA 4YY3K 2E2IJ 1JJ2M 3CHWA 2ETJA 2R7SA 2DFHA 3LA2A 3JRCA 1Q86O 4K8ZA 3GTOJ 4FOIA 1TWGJ 3WTWC 1QZ6A 1IZ1A 3F8MA 4JYAK 1JCEA 1KQSM 2KIUA 1I50J 2YR2A 1W0TA 2M1BA 3V4GA 3GTJJ 3FXRA 4ZYAA 2ETHA 2IVNA 2L54A 3OOUA 4JRQA 3L4IA 4PDKA 1Z3YA 3IV5A 1KU7A 1BUPA 4Y1CA 4ZJZA 2EIMH 4M41A 1HNXK 4G6DA 4QPOA 3AAPA 3J7YP 2LKXA 2WUSA 5TISC 1HNIA 2E2HJ 2HXOA 2XKOA 2ZE2A 3CF5F 1BIBA 1UZCA 3TBIA 3JSMA 1A31A 5AIPA 5HLIA 4LIUA 3DXMB 3WNHA 1OR7C 3CQ8A 4GMJB 1VRTA 4OPKA 5E1WA 4ICLA 4KA4A 1LNWA 3MX2A 2E1OA 2R7UA 3EDPA 1LEAA 1S3JA 2HFHA 3S2WA 1X1PA 1E3OC 2ELJA 4FWKA 5BOXA 4HUFA 4X64K 4Y33A 4M9ZA 3SPYA 3O9RA 2ZMEC 1UB9A 2IVPA 5BR9A 4I01A 1TTYA 3CG7A 2DN0A 5BR8K 3DV8A 1ZKGA 3HOXJ 3K1PA 1ASUA 3CZ6A 3VEWA 1NGDA 1E3HA 2H6BA 3VYUB 2IOCA 3LOCA 3H1VX 4MDAA 1MSFC 3C94A 4WCEL 1FC3A 4RG8A 4E7SA 3O6WA 3GFMA 3KP5A 4IOCL 4AM3A 3E6CC 1RNLA 2KZVA 4DV2K 4DSFA 1HJOA 3EUHC 5JI6A 4JI6K 5CQEA 3HG9A 2ZWHA 1ZARA 3PX0A 3SUNA 3SJHA 1T38A 5B3SH 1T0FC 4HOBA 2VJIA 3MDQA 3O6BB 2XF6A 3H0GJ 2CQXA 4WX9A 3L8BA 3SV4A 4DQSA 1ON1A 2BYVE 3LSJA 3RMDA 1J0RA 3K9TA 2LY1A 3IG1A 5J1RA 2ZMEB 3R60A 1IN8A 1RIOH 4HTUA 1B4AA 1RC9A 4XICA 4DTMA 3HM8A 2FUG2 2GBZA 3ERMA 4CJUA 4N4OB 4G7OF 1P4AA 4IBNA 2L3DA 2B63J 1W97L 2NVXJ 3IUOA 2Q97A 5KRTA 3TP3A 4FLWA 5DUKA 3B6PA 1YRNA 4LF5K 1SMYF 1W7PD 5BPNA 2X74A 2HI3A 2QKKA 2J4RA 1JGGA 3V7SA 3DLHA 4N0BA 2DFIA 2CV1A 2XVCA 2UZKA 1FMVA 2NNYA 2X6NA 4B8XA 2AXLA 3EE9A 3LSRA 1T56A 2OZUA 3MZHA 4GYIA 3WU2C 3MAJA 2VE8A 3PX6A 1R36A 1EH6A 3G71I 4CEEA 2DFEA 4LGWA 3SUOA 4XLPF 2DPNA 1FKPA 2NVTJ 4JK9A 1T6DA 4UVAA 4BRLA 4BRGA 1SFUA 5FGMA 4PA1A 4I2OA 3QB0A 3AG1H 4BYYA 2VOPA 1W9HA 1U78A 3GTKJ 5LGNA 4LIVA 4ILGB 4A3GJ 5A2QO 3RPQA 1NK4A 3GW2A 4M71A 3JS6A 3W2AA 2E1MC 4XH4A 3SV3A 1T39A 3OBYA 3CMEN 3DKYA 3GVAA 5FRMA 4DS5A 5JMVA 3P39A 4UVCA 1EETA 3HOTA 3SQ1A 3HJFA 4KI4A 4HPQA 3OS2A 3WTSC 3PM1A 5KGXA 3FFKB 2R0QC 1I1GA 3KCCA 3U8XA 4F3QA 4DSJA 3AVNA 5E41A 1K7AA 1GV2A 2H8RA 3VF4A 1QSLA 4MTDA 3K1NA 4Z94A 2RDPA 3VA0A 1MNEA 2HZTA 4X62K 5D4SA 4XORA 3VESA 2E1MB 2K02A 2KRFA 1KTQA 3QPLA 1OMIA 3NAUA 1YI2I 1EKEA 3G73A 2F5CA 4FJ5A 2F5EA 1DUXC 3VEPA 2OBPA 3N05A 4IOXA 2ZJQF 5HLHA 2GA1A 3HBLA 2ECCA 4YOTA 2MH2A 3IDHA 4GO1A 2KKZA 3IHUA 5JHUA 1K6YA 1IV8A 1WFXA 2HXIA 2V7ZA 1PVEA 3T0YA 1JLAA 1XCVA 1J5EK 4BVOA 1ZYQA 4QCLA 5HS9A 3GLLA 4EIAA 4FLTA 2YX6A 5C2FA 3I5UA 4CZEA 1DP7P 4I6MA 2F4VK 2CW7A 2ZFWA 4FJHA 3RRGA 2E6MA 3C18A 2W4SA 2K40A 3NWSA 2DPDA 4FK2A 3HM5A 5J40A 3UKRA 3TO7A 3RYPA 4BGAA 3D2FA 1D8YA 2GX9A 3RQ4A 4CO8A 4KN4X 4G9ZA 3T5XA 2LR8A 3ECOA 3DCFA 1FIPA 3AA5X 1UAXA 4GKJK 4J19A 3NH1A 3A4CA 1ZH5A 5KGWA 3E7LA 3CC2I 4BY9C 1RETA 3GUDA 3R6MA 2GUPA 4HUEA 5JVGF 5C2DA 2VIXA 4NYFA 1CXUA 3Q7BA 3C3WA 1A5JA 1NK9A 2HQRA 2Z16A 3R1XA 3LZIA 1VSMA 3QPSA 2FE3A 1MMNA 4V19K 1SKSA 4BVPA 3W3DA 2JGUA 4QLCU 1GLFO 2GELA 2E88A 4C3IJ 4II3A 4Z4CA 3ZQLA 4HCCA 3AAQA 4ASNA 4WK8F 4A3LJ 4F9OA 9ANTA 1V54H 1JUMA 4L9NA 4DTJA 3N4MA 1JUPA 1X2MA 3ROUA 1OQYA 2P6TA 1D1CA 1FWZA 3J7ZI 2F5FA 1IW7F 3N4PA 4HX4A 3CCSI 2O8DB 4N5SA 1XMKA 4BRAA 3FDYA 1VQ8I 3SJMA 5L3DA 1KCFA 2ISYA 5BN9A 3A0BC 1LDJA 3H3NO 3REOA 3PIOL 2VQCA 4HSTA 2C6YA 2WAQA 1WHUA 2FBIA 1HF0A 2W6KA 2FSNA 3PV8A 3W6JB 3GTQJ 1MWMA 1RT6A 3S1QJ 4XKWA 1S29A 3DLRA 2R5YA 4LSLA 1ATNA 5CYMA 4MQVA 1ZG1A 3AO2A 2YX7A 2Z1JA 1TKTA 3OL3A 3GG4A 2O8KA 3U9DA 3GFJA 3IKTA 2QQBA 1IBMK 2O8CA 1W5CC 2QTDA 2CQNA 3CC7N 1JLGA 1XC3A 4DOZA 3CF5L 3K2PA 3WNFA 2BY2A 5AZIA 3R8EA 4EP4A 1YAGA 4NB5A 5J8FA 3GO5A 1S6QA 2BHZA 2CU7A 2JQ7A 3RMBA 3DLGA 3WT0A 1YQAA 2Q36A 3HKZN 2WTEA 3UE5A 3C6AA 4IXAA 3VYSB 3AVIA 5CPRB 2NRRA 2EZKA 2JVGA 1I39A 2XY8A 3K4BA 1OVYA 1XQSC 5FB2A 1HQCA 4LG0A 3CCEI 4LOCA 4DU1A 1YX5A 4JX5A 3LM2A 2B9SA 3ZQCA 4YOUA 2RN7A 1GVJA 4CEZA 2UWMA 5CZ1A 4QS8A 2GIZA 3E6MA 1ZREA 4IO8A 3H36A 2DXIA 3ZQFA 4CGZA 3BDDA 5LRRA 2ATQA 2HOTA 2DA5A 1O4XA 4DG1A 1GLEG 3RPUD 1O3QA 1Q8IA 2G8FA 2XPWA 5HROA 1IUYA 3K10A 5TKYA 2F8TA 4FM0A 4EHTA 5EEHA 1UHSA 1JGSA 1ZLJA 1DLOA 1RUNA 2LBFB 5GAGJ 5B8HA 2ME6A 4LH5A 1NOZA 3RKXA 4A5AA 1MDUB 2EV5A 4JNEA 4AHVA 3G0ZA 4BBSJ 4JP0A 3SYZA 4Z4FA 3M8PA 3K4KA 1WGXA 4M9XA 3FHZA 1ETOA 2IDOA 2NLXA 4RW6A 3O9UA 4E4HA 4KAZA 5E1ZB 4DWIA 4HAMA 4H03B 4I6ZA 2LC2A 4HDUA 3WTZA 1QPMA 1LUJB 3K5MA 2XHBA 4HNVA 3DYAA 4CHQA 2M30A 1B72A 3OYCA 4II2A 5E3LA 2IJLA 1R9TJ 3WXKA 4CSWA 3C7NB 3JREA 4RB3C 2P1JA 4CFAA 3OS1A 2VOOA 2OANA 1I6HJ 3FGUA 4ZDOA 1EWRA 1HMVA 3H3ZA 1ZGAA 5LHGA 2ZXIA 4LITA 5BS6A 4DSEA 4FLVA 3HYIA 2ID6A 4WF9L 2VBWA 5HL7L 3GTLJ 1D8JA 2FSJA 3KVGA 1TV6A 3TWHA 4LF9K 1S1UA 2HB5A 4DFKA 4LH4A 4BR2A 5M1OA 3LMMA 3HBTA 1MH3A 2PJPA 4JEPA 4JQFA 4CYCA 3LWFA 2DYSH 4HRIA 3MCAB 1S7OA 2P0WA 2NYXA 2IRFG 2WTUA 4BKXA 4DUYK 4YFXF 1NJWA 5E18F 1XTAA 4MQ3A 2O8XA 2A3ZA 1H9GA 3G1MA 4FXDA 3BTCA 3DEUA 2O8FA 1ESVA 1CZBA 1ZK8A 4Q47A 2R5ZA 4BDYA 2P5OA 3KPHA 1MMDA 3K4MA 2XAFA 2Q1ZB 2QQ8A 4OIPF 5D5WB 2KQRA 4CZMA 4IRGA 2D0PA 2VE9A 3KX2A 3CJTB 4BC5A 5I9EB 4H5RA 1L3TA 1FJLA 3ZSVA 2O4GA 2A5XA 5SZTA 4KHSA 5EG0B 1Z26A 3OIOA 1NK7A 4DF8A 5DCMA 5BQTA 2V52B 4BWMA 1GHCA 1LVAA 2MGQA 3NQOA 2X6OA 2VGNA 2F2EA 1Q9YA 2LD5A 5C10A 3QPTA 4FX4A 1A6IA 3THYB 1BM9A 4PL8A 1ON2A 1S1TA 3BR6A 5C24A 1U9OA 3K2AA 1BBYA 4RCHA 1IXSB 2F96A 2QXFA 1HC8A 4KIGA 3CM5A 5AQIA 2RVCA 4AILC 1RRJA 1KONA 3VQBA 4L9VA 4B9LA 4AHSA 4M74A 4EJOA 3J81Z 4RW8A 3BTLA 5HS7A 3BPXA 3MMYB 4MLOA 1CZAN 1VQNI 1XGOA 5E3OA 1U2WA 3FHNA 3VQQA 5GTHC 5BPMA 3ESWB 3FLCO 3JXUA 2DT7B 2M2EA 1L3UA 4BRMA 1U9NA 5M1QA 2COBA 5CVUA 2BOLA 2XRNA 1HYVA 3SEQA 4CHNA 3GZ6A 1GVDA 2VN2A 4CJ7A 2WC2A 3AVHA 2KHMA 3QU6A 2HKOA 3P38A 1Z9CA 3U6FA 1OJLA 4IHTA 4O44A 2WC9A 3ZQHA 1JCFA 2HS5A 3I56I 1IDYA 4HLXA 3ASMA 2VGMA 1HKTA 4PK4A 3OYHA 1I3QJ 2JTVA 5JVGL 1YIJN 3WTYC 5ILUA 2OF7A 3VEZA 1QVGM 3G3ZA 4CJPA 1VSHA 4N41A 1QVUA 4J01A 4ZYGA 4OGEA 2IGIA 4FTHA 3CETA 3ULEB 4E19A 2TRTA 3M8QA 3CIPA 1RDDA 2CQKA 1T33A 3FXOA 4UUTA 2P9UB 3D7EO 3IRRA 2B7EA 1A5VA 3E66A 3BQZA 3D2EA 4A3IJ 2TDXA 3ZSWA 1M90O 2OTJI 3AA3A 1K8KA 4YOVA 4H8KA 1T3VA 3CUQB 1KQ8A 1Y8QB 4XIDA 2OTLN 2G8IA 4XKBA 2LFBA 4AC0A 3OW2M 2NOGA 3S17J 3BG9A 1HDDC 3ZCMA 4HF1A 2YJEA 4BQZA 5AQLA 3O3HA 4B3SK 3J7YJ 1LFPA 3WODF 1U2VB 2RQPA 1TAQA 1MW7A 4H0PA 4RBOA 5FJ8J 1BC8C 4B9TA 2WWYA 1L3LA 2RNJA 1WJAA 2HVHA 2UYTA 1DU0A 5GTIC 1LWCA 3AL0C 4NB4A 3I33A 2QM1A 5AQKA 2FLOA 2W6LA 1F1ZA 1W5TA 4EQQA 4H5TA 4G7HF 2PG4A 2O9LA 1XGNA 2QQAA 2P9UA 3CERA 4CJFA 1RT4A 2XO7A 2G0EA 3NF8A 4BY1J 4FJMA 4OLBA 4GCVA 3LSKA 1IV6A 3WTTC 4DV3K 5JHFA 1B92A 2BUPA 1HX1A 3SJJA 2E1CA 4O5BA 2DJNA 2YCHA 2O6GE 4D1QA 1EA3A 5ELZA 3AA2A 1LW2A 4CBWA 1G15A 2HDCA 3VF6A 3BCBA 4DFPA 3M7GA 1D3YA 4PGGA 3AY9A 3AL0B 2ASOA 1FOKA 2G8VA 3I71A 1KLMA 1TK8A 4FJLA 5M5WJ 5GADP 4QWQA 5ADXA 3BR3A 4RB0A 3IMXA 2X1EA 4NO7A 2AJQA 2F9WA 1GV5A 2MD0A 4H4OA 3ULQB 3DRPA 1DU6A 5FPMA 1QHGA 1TL3A 4CEBA 1V55H 3L2CA 4YIFA 3KFWX 1TT5B 1Y6IA 3FWEA 1BI4B 2FBYA 4CJ5A 5IYCJ 3WNEA 4C3HJ 4KTQA 3MD2A 1W4MA 4LFAK 3J8AA 3ABLH 5JS1A 1Z91A 1NG6A 3QLHA 1G99A 4KMFA 4AU7A 5K7FA 3QINA 1RR7A 4CZJA 1MU2A 3C0BA 4OAYA 4PZJA 3WTUC 3MWPA 3VN5A 2FBTA 1A04A 2CYYA 2WB1A 2LNBA 1RBSA 1TNTA 1WVRA 4DU3A 1W36C 2PJRB 2RE2A 1FBSA 2XPVA 2XAUA 4AVZA 2Y9ZA 1VQKN 3P9KA 3OYAA 3ZSYA 2EX3A 3PX4A 5EEGA 2YS9A 1BQNA 2ACJA 2VKHA 4HSRA 2CSOA 1W5SA 2EK5A 5FDLA 1FY7A 2A6TA 1GXQA 1A5XA 2KPMA 2QWWA 3O8GA 5I3UA 4NC6A 5K1YA 2GWKA 2HHXA 3LNQA 5EDNA 5F1JA 2ISZA 4BG9A 3AVGA 1EX4A 3IH4A 1LW0A 3JRAA 2W00A 4FE4A 4LLGF 3QEPA 2LMDA 1OYYA 3OYGA 2IIRA 1FBUA 3CMYA 3CJQB 1U6ZA 2QA4I 1Z3XA 5EJCA 1R1TA 1ZBFA 1N34K 5B66C 1TYQB 1MZBA 2DDBA 3Q3SA 4EJVA 4HBLA 4CECA 3I58A 1HKSA 5IYDJ 1USTA 3HP6A 1V5EA 5JICA 4G9YA 3IRQA 3S15J 1K83J 5CZ2A 2FOWA 4P5OA 1E0EA 2E19A 4MFDA 1GOAA 2HU9A 2XPUA 4ETSA 1SL2A 2X6WA 1JLEA 1J59A 3E01A 3CPEA 2YNIA 4DS4A 1U3EM 3ENBA 2OZMA 1CLQA 1I3AA 4DR3K 3DPLC 1WBDA 1UHWA 1YG2A 3T8RA 3FZKA 1HDPA 3KD5E 4PJLA 1V5FA 5BRDA 4KNYA 1MJAA 5HLTA 1JJ8C 4KIBA 4CCKA 2L4MA 3BG6A 2IVOA 3VETA 2B6AA 4QAGA 3QIOA 4OJRA 3WXLA 5HOOA 1YJNI 2PI0A 1SD4A 3FBNB 1NJIO 4L18B 1B9DA 1WZ2A 3T69A 3ZMDA 1TUYA 2EJRA 3D6RA 5AFUA 3K59A 4FJ8A 5AQPA 5CYVA 2NRWA 3QDKA 1Z67A 4FHTA 4IFEA 1C1BA 4LF4K 2HQ5A 1C6VA 2KL4A 4WYBA 1KYWA 2PFUA 4WQ5A 3BF1A 5CR4A 2RC4A 5BPDA 2E6LA 1SAXA 4KDPA 3P9IA 1X3ZB 4C8OA 3MN9A 4DHYA 3G6EI 3ZPLA 3IUCA 1IO2A 1NGCA 1VQ5I 3G71N 2M34A 4Q4ZF 2HGCA 3CCMN 1K4SA 4BS9A 4I0BA 4PJMA 5EVZA 2OZ6A 3R9PA 1TWAJ 1ZLKA 4L9JA 3C6UA 2XC7A 1R5GA 4MLEA 2ESNA 2M7BA 1RKTA 4NC7A 2IEKA 1HKGA 4CGFA 5BPLA 2QSHX 4FETA 4P96A 3DBRB 3THWB 3S32A 2Z99A 1FZPB 5LEJA 4ID1A 2Q2EB 3I59B 3DLLL 4LG3A 1XGSA 4AIHA 2KZZA 2LF8A 4K0KK 1LEBA 3AARA 4KREA 1LDKB 2A3SA 5HRSA 5ICCA 4D7MA 3MAQA 2IAIA 1KA8A 1Z0XA 2RPIA 4DR4K 3ZT3A 3QBWA 5D3GA 4U7BA 3BY6A 2QI2A 1P2FA 2BE5F 2DA4A 2Q3SA 3F6VA 4WFNL 3LAMA 2GOMA 2Q0OA 1VQMI 3RZDJ 2MC4A 3MKLA 1C1AA 2E20A 4GDFA 1FYMA 1LAVA 5HP1A 2KKOA 3CCUI 4DTNA 1X1CA 3OYIA 3CD6N 3RQIA 4CHPA 3NWTA 1NK6A 2QK9A 1W7PB 1BA1A 5EXWA 5C42A 2KMUA 5IT3A 5EF6A 1FPQA 3AGRA 2QGUA 4ITVA 3THWA 5AZJB 2IGMA 4B3AA 2KW4A 2Q2EA 3VQAA 1EH8A 2FMLA 4K41A 1QZZA 4CF8A 4K42A 4IHVA 2CS3A 4CK1A 1BL3A 2GXGA 1RDUA 3G1OA 5J3LA 5HS8A 3J81O 3OYMA 5JS2A 5KPTA 1YOVB 4CF2A 1MKMA 3PJRA 4BQAA 4F7ZA 3VQ8A 3BUZB 3RKYA 4A3KJ 1MMAA 3HRUA 1VSFA 1OCZH 1MBEA 1KAYA 3W6VA 1D5YA 2CO5A 1AKHB 3OIQA 4R5PA 4XLFA 4DF4A 3OYJA 4F8RA 3G10A 3O4NA 3P31A 4IKFA 1W7PA 4IX7A 3ZETB 1X58A 4A0ZA 3F8NA 3RTVA 3LSGA 1HCRA 1HW1A 5K5OA 2DT6A 4F2SA 3S3NA 4W1UA 3IAYA 4C23A 1TKDA 3NEUA 1LWFA 3WHCA 3CCVI 4WF2A 2A07F 3OV8A 2HBLA 1S7AA 4CFBA 2X1CA 4KRFA 2ZXWH 3BZ6A 2WAEA 5JFRA 2LKSA 4NDLA 5F6FA 3SZPA 4HNUA 2E2OA 3VEVA 3DBHB 3QFPA 3H9GA 3MEXA 3V8LA 4CGJA 1YFHA 4UUSA 4Z2YA 3LDPA 2ZFUA 1M1EB 2EV0A 5AR0A 2DTRA 4A3JJ 4B9SA 4M3DA 5LMNK 5AQXA 3W2VA 2VWKA 4XLCA 4FVMA 3DU6A 4CZCA 5E17F 2E35A 1VQ6N 1WI9A 2ICWG 3OYBA 3NFAA 4BR5A 5D5VB 4UXNA 2HHSA 5FROA 3AG2H 2EWNA 3E6BA 4V2GA 1FW6A 1E4FT 3I0RA 5SWMA 3M8SA 3RDIA 1NMNA 4E6KG 2LG4A 2WADA 2HBKA 5DM6L 3NBPA 5GAEP 4MTEA 4B3MK 1U4BA 5ED4A 2HYJA 3PO2J 4K8XA 4RLFA 2QWRA 4PFPA 2FNPA 1XNRK 4JV5K 1NU0A 4DQQA 2ZKZA 2B5JA 4FE7A 4CK2A 5EX5A 1MDMB 3D5LA 1NK8A 5M1KA 1HNZK 2A68F 4IQJA 3SXYA 1VFCA 2NRZA 4EATA 4KFCA 5FFXA 4IJNA 3TU5A 3CCJN 2EB7A 4J2BA 2B4JA 2P9PB 3PUFA 5BMZA 3TI0A 1QQOA 1ZR2A 3OYKA 2OPSA 3BOQA 4BQNA 3JSOA 1D9DA 4KB0A 4XOTA 1K61A 3AVAA 5DYMA 4HCBA 3HUGB 2JMWA 2JUGA 4B3OA 4EVIA 2A41A 4JI4K 3NRVA 2G7UA 1S3XA 1S22A 1C0UA 3PO3J 4CBUA 5J4VA 4DB3A 2QBYB 3I54A 1EO1A 3CCRI 3WQTA 1RTDA 1IXRC 4XSZF 4Z4EA 3FKJA 1N75A 4JKHA 5CVVA 3SK3A 3LANA 4KHQA 3VFZA 3BZCA 4PKIA 1U47A 1NKCA 1NOYA 2XGCA 1QVTA 3PQJA 5F08A 1UG2A 4RS8A 4W5RA 2IPQX 1U5TC 3BY5A 3ZQQA 4A0XA 3DAWA 4ENMA 3PNVA 2QWNA 3FXLA 3HSEA 2M7AA 2Z1DA 4M7YA 3K58A 4KBOA 2CFOA 2XIGA 2B0LA 3KZZA 1Z77A 1CQTA 5E26A 1R1VA 1PP7U 1X3NA 4XLHA 5E3MA 4UHTA 1S72N 1G3WA 4DJAA 2DMTA 3AVMA 5HODA 3S2DJ 1DGRM 3LSHA 4O55A 4XRSG 3Q9SA 4B09A 1QZYA 1XCBA 3L00A 1MIJA 5DCFA 4UV8A 3V1OA 4Q5VA 3WGHA 2F48A 1N78A 1VQON 4A2AA 4CICA 2UXDK 3NF7A 1ATSA 2FJ1A 4O0IA 4DUZK 3KP6A 2I7NA 2GA2A 2QEXN 3E9OA 1OYWA 3TQNA 1KVAA 2DK5A 1K78B 2E5ZA 4EHUA 4R1HA 4YIIA 1J75A 3QESA 2YNGA 1XDSA 4OAZA 1IRXA 3MN6A 3VF2A 2X1DA 1NG7A 1YVUA 4CZKA 5C0YA 5ERIA 1W7AA 2I7PA 3HKZA 1OLTA 4FM1A 1WPKA 4YFUA 3KIOA 3QNOA 2MC3A 2W40A 3TSQA 4I9QA 2KDOA 3HM9A 3G4SN 1IBLK 2H6CA 1XN7A 3DPTA 1WN7A 2GQQA 1WKMA 2EILH 1ETWA 2V1NA 4LB5A 2YJFA 4K2EA 2CWEA 5IYBJ 1SD6A 4G1QA 4EEFG 1BI0A 3MZ8A 1J5OA 3M8EA 1MBKA 5M3FJ 2BW3A 1QZEA 4Y52J 3PY8A 4FK0A 3HRTA 4FZZA 1FT9A 1QTMA 3V8KA 4B1ZA 2KFNA 1KGSA 5GAHJ 4W5OA 3OA9A 4B1WB 2BY3A 2BTFA 1YS6A 3VQCA 2CH0A 1RDCA 3W0LA 1YW8A 1WSGA 4LFUA 2FEZA 3OS0A 4WQ4C 1EJ9A 1YYVA 4B43A 4UUVA 1BJAA 1XUPO 1BR4A 4QTRA 2V6CA 3A01A 3KP2A 4A2UA 3FISA 2E1ZA 1ZXOA 3K70C 1ZBHA 4JI2K 1WH5A 4GW6A 2F7TA 1IJWC 2VQFK 1BR1A 1T2KA 4RM2A 4A3MJ 1ZRFA 2STWA 4CF9A 3TSUA 3VPRA 1OCRH 2DU9A 1VSLA 3OYDA 2QKBA 3CESA 1B9MA 1R23A 1SL1A 4JK1X 4O0JA 1VSJA 4HLYA 1LAWA 1B8IB 1FTZA 2P9NA 1SZ2A 4KI6A 4EGYA 4N4NB 4CCHA 1OISA 3CC4I 2XY6A 3H46O 2QZ8A 4BHBA 2VCPA 3RKWA 3BCAA 1HSTA 4ZZLA 3PNYA 1U6GA 1R5HA 2HOSA 2QSGX 1P8ZA 2GZWA 4B3XA 4LK0F 2LY2A 2D1KA 4Y0WA 1WUAA 3CQZJ 1J7KA 3AVFA 3ZSZA 2CFXA 1REVA 3KLOA 2IS6A 5GADJ 2HBJA 2OC6A 2JA5J 4HHTA 1O57A 3M4OJ 1XSVA 1X19A 3HOYJ 3DKWA 1VQ7N 4H0XB 4KH5A 4CEFA 1TC3C 1ZELA 2K9MA 1ZG5A 5DS9A 1BJZA 2JA8J 3MVPA 5H20A 1JTXA 4AH9A 1DT9A 3G2BA 3K7AJ 4ESFA 1YJWI 1IN6A 1TGOA 4PHTX 2EV6A 4O8KA 4GVMA 3QPHA 4BRDA 3K9KA 1JJ6C 5LHIA 4Z4HA 3HB9A 3A5NC 2HKXA 1YHQI 2D1HA 2PY5A 1GLLO 2DA3A 2GIVA 2HQNA 1HR0K 4WQ5C 4RAYA 3CCYA 4HQMA 1FOXA 5AQRA 3FZHA 1IN5A 1P4WA 2A1RA 1X9JA 3TW7A 4U0VA 1VTNC 3AGKA 4I2PA 2V7FA 1R1UA 2HR3A 1F9NA 5AQZA 4I7FA 2UUBK 1B59A 3P1GA 2X6XA 3IWFA 4C1NI 4UB8C 3QWLA 2EZLA 2W57A 2KLAA 5B1AH 5EGOB 3I64A 4F91B 3VEYA 5IT9O 2VJ4A 1HOMA 1MSEC 3BLYA 3WU1B 2ZD1A 1HLUA 3ISNC 1G4DA 3A5LC 4YIRX 2LK2A 4RM3A 3V8JA 1RT2A 5D6FA 4A3BJ 3UKUB 3K5LA 1O7LA 3PUBA 3TOAA 4GRIA 5DEQA 4ZZDA 2D0BA 4QS9A 1AA7A 1BI3A 4J2EA 1T05A 4M9SA 1DDNA 5M1FA 4ESJA 4JOMA 3HOZJ 1U8BA 3N4QA 1EQYA 4J2DA 3QU3A 1JXSA 2JWKA 4KV8A 1Y8RB 2A5YB 2QVOA 3S14J 3QODA 5EYRA 1OH6A 2I5JA 2CH5A 1A6QA 3THXB 1RZ4A 2OQGA 2RV8A 4WXDA 3WG7H 2FRHA 1BU6O 4KISA 2BBYA 3OJUA 2JSPA 1OCPA 4DTOA 1J6ZA 5EGOA 3GBTA 1VNDA 1P7JA 5C4XJ 4CZLA 2D0OA 2BZTA 4XH5A 4KHUA 2LKPA 2OU2A 3GF2A 3ZN0A 2Y1IA 1X1AA 4CJEA 2OYQA 1H0MA 2MW8A 1NGHA 3M3YJ 1BOBA 3HOWJ 1VAZA 3ABUA 2A42A 4HNTA 5FD5A 1MNMC 4JKGB 3J7AO 2FBKA 3V9WA 3KZYA 1PUEE 5LGUA 2Q8KA 2WV0A 3HTUA 2XF5A 1IRGA 1SC7A 3ZEUA 4W97A 5A2QK 5F64A 1NLVA 4DV0K 3L9FA 1W36D 4BE2A 2R7ZJ 5HDGA 3Q9VA 2P9KA 4FLYA 3DLAA 2EIKH 4BNCA 2PLYA 5DM7L 4CH7A 3S2HJ 3T1BA 3NE6A 2M8GX 1KU3A 4C2UA 4Z6YA 1C0MA 3UIQA 4ID5A 4IG0A 3IAM2 3OSGA 3E9LA 3OBWA 1KFDA 4K43A 2FA5A 3QFUA 1RT5A 4CJSA 2R7QA 3ML6A 2WY7Q 3DRSA 1XMQK 3LALA 2NNWA 2VT2A 3X2QH 4GVEA 1NGIA 3M07A 1YUWA 4FJ9A 4X6AJ 3DJCA 2A6HF 3TAQA 4D9JA 3CO6C 4Y17A 5CE3A 1JKPC 2MLKA 4CCMA 3CMEI 3F22A 1RDWX 4LJZF 3BF3A 3CCQN 3KD1E 2ZJRF 1CZ9A 3B6CA 4DZJA 1Y64A 2LOOA 1BGXT 3PFIA 1SFOJ 3KK7A 5JLXA 1ZBIA 3SBTA 4KTWA 3DXKB 4EJTA 2HF4A 2VWBA 4CEDA 3MKWB 2EA4A 4M72A 4A3FJ 2P9SB 5IY5H 3H6EA 5IWAK 3CJBA 2XASA 4L0YB 1V5GA 3D5RC 4UVBA 1WWXA 4P55A 4YEJA 4CA0A 1VSEA 2P7CB 3J80Z 2YHAA 4CI6A 3QQAA 3FR0A 1SKRA 4IEEA 2KFDA 1H88C 3CO7C 2Q2RA 4B47A 4E89A 1UFMA 1G6NA 1G2HA 3IH2A 4RGSA 1BI2A 2UXCK 2JPBA 2E7WA 2HBMA 3TARA 4JS5A 3H9JA 1VQPN 2FF6A 3VEXA 1KU9A 4FZXC 4OIQF 1OVQA 2ZJPF 4NNJA 3H92A 4M3UA 4F2RA 5J8CA 3NHGA 2L7KA 2BGCA 4YOXA 2NRTA 3MWTA 5D6EA 4DQ2A 5D5XB 4KMUX 3ECHA 4ZDLA 2BVLA 2L0KA 4JYKA 3WHBA 2E2PA 3LA7A 3PL8A 5JR3A 3H0DA 2HVSA 2HPIA 2ELKA 2VL8A 2ZO4A 2EFNA 5AQVA 1IG7A 3WE2A 5AQGA 4JX6A 2VLAA 1HRHA 4A5MA 4JKAA 2JN6A 3HOUJ 1ZYRF 1ACIA 4X0GA 2IA2A 1R58A 3DXMA 3V9SA 3L2QA 1DTTA 2P8TA 4JHDB 5LJVA 4D0PA 1ENHA 3RI4A 4BR4A 4CHYA 2AXTC 1RI7A 1WSJA 3SZGA 2NVQJ 3EYIA 3MN2A 4BJ6C 1T7PA 3EEQA 3UNGC 4H0VB 1OYIA 1LE8B 1WJDA 3HZ6A 3LPUA 4M6VA 4B9NA 1ZC6A 1NK3P 2V1DA 5IP9J 3VQ9A 4I99C 3NVKA 3JRFA 3HPHA 4C2MJ 2BHYA 4IJAA 3ZLJA 2ID3A 4JKFA 4DQRA 1QSYA 1E2XA 3FZLA 1BL0A 2Y69H 2I10A 4XMYA 1BISA 1JHHA 1LCUA 1WCMJ 2XV4S 5L3FA 3LPTA 3KHYA 3F9MA 5TKWA 3JRIA 2K4BA 1OR7A 2NS0A 4CEOA 3NARA 4IF4A 1UCRA 4CF0A 1TBXA 1QVFM 1TAUA 3VOVA 1GOCA 4FPBA 1KZHA 3KP7A 2KISA 3NAEA 3DTEA 3JRDA 1XGMA 1HKBA 3LWLA 1QNTA 1VSDA 4A61A 3QOEA 1HUXA 1NGEA 2GLOA 4OINF 1YF5L 4L3QA 1CF7B 3KYLA 3H3OB 2VT3A 2QKLB 4DR6K 2DQRA 5MLCQ 3H08A 2V6EA 1YVNA 4N47A 3MCZA 5EZHA 2ZMEA 1XWLA 1C0TA 1UJ8A 3AVBA 4O3MA 5J6XA 2Y0MA 2M0MA 1VZ0A 4RW7A 4OMYA 2YPRA 4JK7A 2AO9A 4KN7X 3FZFA 2HPMA 3BDPA 1MJBA 2IS2A 4LLLA 4FWQA 3FE1A 3BT9A 3F21A 3NGZA 3SMSA 1FBQA 3EUHA 1EH7A 3HPOA 4S05A 3V6DA 1ORKA 1YO5C 1JXEA 2EFWA 2HHTA 5L3BA 1NG9A 3KEOA 4EP5A 1LV5A 3L4QA 3ZMSA 2MA3A 1I94K 1T0FA 2F5DA 1P92A 2NRXA 4PSXA 2VJ5A 4CZZA 3B6AA 1VQMN 2PBIA 4B9UA 1BOTO 4DSLA 3LFUA 4H5NA 3T1AA 2R3SA 4XLEA 4JKEA 1F4KA 1IBKK 4ZDPA 1BN5A 2GXAA 2DDAA 4RDUA 1HYZA 1PYVA 5HRNA 1N6QA 4HQEA 3ENHA 5GAEJ 2E1YA 4E0DA 3JW4A 5GINA 4FWSA 4KHWA 2IBDA 3MWMA 2OPPA 3NH0A 4MNUA 1DGWY 4AIKA 4IG3A 4BE0A 2HVIA 2L5QA 4ABZA 2L9NA 3ZRGA 4FJ7A 1GLDG 1VQ4N 5IP7J 1XSDA 3HT3A 2DODA 3JRHA 4PUOA 1QBJA 1MMGA 4EM0B 2MYSA 1L3SA 2RNGA 3JYTA 4IPAA 3LAKA 2CUJA 3QEIA 4DQPA 3SAGA 3CJNA 3IP4B 3VPZA 2G9WA 3HL8A 1VQ9N 2K9SA 1NTCA 5HBMA 3W6KB 5L3CA 3TGNA 5AQQA 1DPUA 3PIPL 4MHGA 1GT0C 1WB9A 5BPIA 2O8EB 3ZT2A 1R6RA 6PAXA 1NGFA 2F4IA 2F6CA 2AQFA 1RT7A 4IHSA 5ICGA 1VSKA 1GLJO 5FLXO 2KLOA 3WXJA 2D1VA 3HZJA 4XOPA 1ETXA 4DV4K 4M42A 2DA7A 2HOEA 3CDHA 3LM9A 3R0JA 2YSRA 4GXOA 5ILSA 4HV6A 3HJEA 3TTFA 1NMDA 4LFCK 3L2VA 1QGPA 1YW9A 3C1DA 3SBGA 4CBXA 1NKEA 4JI3K 4LY7A 4DSIA 1ZBSA 1VSIA 3VEOA 2JRTA 4EJUA 5E20A 5M1NA 5H6QA 4IZ9A 4B3TK 4A93J 1TK5A 1GLBG 1OH5A 4LD0A 3M8RA 2PMZN 3GBGA 4P9FA 3WU0A 3VODA 1RBVA 2X4HA 3BR2A 4P1WA 3KP4A 5GP9A 3VQEA 3CTAA 3DTIA 4BQQA 2A40A 3A5OC 3C65A 3A5MC 1RKWA 3ZSQA 4L9TA 3L1PA 4PY5A 2P81A 3TAFA 4XIUA 5FFZA 3HTSB 3F0CA 3CJCA 1XHZA 2HHWA 1S6PA 3H9QA 3PQKA 4AF1A 2YNHA 1WJBA 4JI8K 3GTMJ 5AQHA 4KICA 1EXQA 5GIOA 2DLLA 3ENOA 3NH2A 1Q82O 2VBYA 4X66K 3SQ4A 4IEJA 3TR8A 3EL2A 4DV1K 3F8BA 4FZYA 1WAFA 4FWOA 2G8HA 2RN2A 2BXZA 1TL8A 3SEZA 4D5CA 4KH4A 4C1NK 1JLCA 2Y1JA 3CUOA 4RAZA 2TCTA 2O8DA 4IRHA 1S6LA 4BRHA 3L2UA 3HOVJ 4RAGA 3BROA 2NRHA 3M1FA 4BE1A 3O9SA 2DMNA 3HP9A 3O8HA 1QPIA 4XKCA 3S1RJ 3GZ5A 2ZJPL 2DOAA 4IFYA 4DCHA 1O1WA 3H1CA 1EF4A 2DK8A 1YJ9N 3U9GA 2HVRA 3RJPA 1BHLA 2BEOA 3O08A 4J00A 1MGTA 2VONA 3BG7A 3HSCA 1C0WA 2ASMA 4ILHA 3JTGA 1HJRA 5JLWA 4RMNA 1C1CA 5FRNA 4A57A 3RR7A 3QNNA 3CJ9A 4XN3A 2VI6A 3ABTA 5TJJA 1KAXA 4DSKA 1PUFB 1IH7A 4ZTFA 5LGTA 5F27A 5M3MJ 1ZBUA 1YW7A 2WBMA 2FF4A 3LP2A 4W5QA 4BQOA 1WRJA 4JD2B 3GDQA 1MD0A 2RGVA 3AO5A 4LK1F 5IOYA 3E5QA 3IFRA 3KP3A 4CDGA 1ZQ3P 5GIPA 1N25A 4CE9A 2M5WA 5DD8A 1IKXA 4CZIA 2FX0A 1DGKN 4OKKA 3FXMA 1NK2P 1JUSA 2JPCA 4A59A 3H3UA 1YIJI 2KRHA 4L5JA 3L0QA 1XPXA 3U2RA 3FX3A 2FBHA 3DU5A 2X48A 3QRFF 2PN6A 4M3FA 2R7FA 2EFPA 3KZIC 3ZYYX 3J80O 2H1LA 2YI1A 4HYEA 1M1KO 1GLNA 2ZB9A 2FSWA 1RT1A 4CJVA 2LBFA 4CZHA 1XI1A 4DV7K 3QAHA 2DY4A 2YHXA 3EYYA 4JI5K 3KEQA 1JLBA 4JD2A 1IKYA 3O80A 3CJ1A 3VQ5A 3NGYA 5J4YA 1I1SA 2OTLI 3HC7A
chains in the Genus database with same CATH topology
3AA3A 3SQ1A 1DLOA 1LAWA 1S5JA 1YTAA 3HJFA 3NBPA 3CFRA 1NK5A 4J2AA 2FBXA 4KI6A 3QIPA 4KI4A 1A5WA 5EU7A 3OS2A 4DFJA 1B9DA 1Z25A 4CEAA 2BE2A 4H8KA 3V9UA 4DTUA 1U48A 3KLIA 4LH5A 4K8XA 5KGXA 4CCHA 2KFZA 3FFIA 1NOZA 1NJZA 2XY6A 3ZT2A 4B8AB 2WONA 2G8IA 1HQEA 4AHVA 1VSEA 4E7IA 3G0ZA 3LP1A 4DQQA 1F21A 3RMAA 2YHAA 2HW3A 4DLGA 1FK9A 3AVNA 1IKVA 4BDPA