2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
3O3GA 3NGYA 5C24A 3V9UA 2VWJA 4B9NA 1TV6A 1LW0A 1NJXA 1S9GA 2HHUA 1S1TA 4DSLA 1JL1A 4J2EA 4AHSA 4HUFA 4FK4A 1VSFA 4BWMA 4FJMA 1VSMA 3QIOA 4DTOA 2KFZA 2R7YA 3RRGA 4Z4GA 1L3SA 4RW4A 3U3GA 4BE2A 3PV8A 4I9QA 4CEZA 5SZTA 3CM6A 1NK9A 1ITGA 1GOBA 4Z4HA 1C1CA 2OZSA 3IRXA 3VQ6A 3ULDA 3OS1A 1Q9XA 1W9HA 4M41A 5HBMA 3OYGA 3MEGA 3CQ8A 2XHBA 3AVKA 3RRHA 4AILC 5JS1A 3L2UA 3L2WA 3K59A 1BHLA 2B6AA 3QEXA 4DQQA 3SQ1A 4E0DA 1RCHA 4CJQA 3EYZA 2DTUA 1T03A 5JS2A 4OKKA 3OYDA 1YTAA 4RW8A 1UWBA 2YHBA 1XHZA 4K8XA 2ETJA 3DRPA 1D9DA 1K6YA 1JLQA 1ASVA 3DLKA 1U04A 4CK3A 5KTQA 1WAFA 2FC0A 1RNHA 3M8SA 3QEPA 4M3ZA 2Z1JA 2KFNA 3PUFA 3VQ9A 3SV4A 4CK1A 4DSKA 4DF4A 3KLIA 2Z1GA 4OKEA 3DLEA 3QESA 3HT3A 3JSMA 4BDYA 2OZMA 2YNIA 4KTQA 4H4OA 1S5JA 4NCBA 3V6DA 1SL1A 4LH4A 1ZBFA 1HRHA 4JLHA 4RW7A 4CHNA 3V4IA 2QKKA 1HQEA 4E1NA 4DTJA 4M3WA 3JYTA 4F3TA 3CFPA 1EKEA 1RBTA 5KRTA 3O4QA 3ISNC 2OPQA 1C6VA 3AVMA 1TGOA 1F21A 4ELTA 4FJHA 1RT1A 4B9VA 1U48A 3ZT4A 3I0SA 4B08A 3ZSRA 1RDAA 5KRSA 3SQ2A 1RTHA 2WONA 1TL3A 1LWCA 4M3RA 3NH0A 4E7HA 1BGXT 4EP5A 4Y1DA 4R5PA 2KTQA 4Z4FA 1IKYA 1KVBA 3AVHA 3ZSWA 4CHQA 3ZT0A 4CF9A 3QO9A 3LP2A 4CE9A 4FJNA 1Z26A 2HHVA 1WSIA 4OGCA 4LSLA 3THVA 1BCMA 4CHOA 2JGUA 4YNQA 1HJRA 2OPSA 4KFBA 3HYFA 3VQ4A 4DU3A 3QERA 4W5QA 3TAGA 3T3FA 4DWIA 4FM1A 4FLXA 2RKIA 3RR7A 2Z1HA 3AO4A 1KSPA 4IKFA 1WN7A 3DM2A 4KPYA 1KRPA 3K2PA 3VQQA 4DQRA 1NOZA 1VSEA 2YNFA 1Q9YA 2XY8A 3HL8A 4IFVA 3LWMA 4HHTA 3QEVA 4PWDA 1JXEA 4CJ5A 3SZ2A 3KLEA 1S1VA 3C6UA 3IG1A 3V1QA 3VQAA 4BE1A 4ELVA 4F3OA 2HW3A 3I0RA 3EY1A 3CG7A 3ZSXA 2F8TA 1NKEA 1NK0A 1X9SA 3S3MA 3AV9A 1RT5A 3HVRA 3U3YA 4CIGA 4CEBA 1JLAA 4EP4A 1DLOA 4KHYA 4LD0A 3VQ5A 4DMNA 2VG5A 1D5AA 4CHZA 4CGIA 4CJWA 3PO5A 1WLJA 1RBUA 4PQUA 4B9LA 3B6PA 1T05A 3A2FA 1L5UA 4FJLA 3K5NA 3RMAA 4M3TA 1QS4A 3SCXA 3M8QA 3DMJA 2DFEA 3CFRA 3DOLA 5I42A 2PYJA 4CCHA 1JXBA 3C94A 2YHAA 1XC9A 4W5NA 2YV0X 3HXMA 1HYSA 1BISA 3ZT2A 3KTQA 2P1JA 2X74A 3CYMA 1U45A 2BANA 4Z4IA 2HHXA 4IFYA 3ZSOA 3T1AA 3OYEA 3SI6A 3NBPA 1SKSA 1WSJA 1VSLA 1RT2A 4DFMA 4DG1A 2E6MA 3C95A 3LPUA 5D3GA 4O0JA 1NJWA 3NF6A 3WNHA 2G8FA 3MECA 3ZCMA 3K57A 3U6FA 4FJ5A 2G8HA 2BGGA 4FJ9A 4FJ7A 3SYZA 4HUGA 1O1WA 4E7KA 4DTMA 5SWMA 3AVFA 1EP4A 3PX6A 4FYDA 4DU1A 3OYKA 4IG3A 2XY5A 3OS2A 1CXQA 1WNSA 4RG8A 3OYCA 4BDZA 2BDPA 2IS3A 4KV8A 1ASUA 3V1RA 3OYLA 3TR8A 5HLFA 1B9FA 4F8RA 2F96A 2HNYA 4QOZB 4N41A 1J53A 4GW6A 4CEQA 5FRMA 1JLBA 3HK2A 3KIOA 5CYMA 4PUOA 1IKVA 1J54A 4BWJA 4JRQA 4C8MA 2IOCA 1L3TA 4MQ3A 5HRRA 3TAQA 1VSKA 3LANA 4FM2A 3QEIA 4UQGA 4KI4A 3VQ8A 2XO7A 5E41A 3SV3A 2EHGA 1RBRA 3KK2A 4CESA 1EX4A 3ZSVA 4KHWA 2HHSA 4W5TA 3MXMA 2HMIA 3NGIA 3SUQA 4O4GA 1S9EA 5J2PA 1UA1A 3CFOA 1NK8A 3RMCA 4NCAA 3NH1A 2HHQA 2G8VA 4ZHRA 1UOCA 3TAFA 1QSLA 3KKSA 2D0CA 2AJQA 3OYJA 1D9FA 3RWUA 4AH9A 4ZTFA 2O4IA 4CGGA 4DFKA 3AO1A 4CF8A 4CECA 3L2RA 4B9SA 4CIEA 4WE1A 2HHTA 1YVUA 1WSGA 2E4LA 1WSFA 3V9XA 3LZIA 3TABA 3PX4A 1G15A 1S6QA 4CK2A 3EZ5A 2ZD1A 2HNZA 2HVHA 4FLZA 2IDOA 4OKJA 1TKXA 3VQPA 3VA0A 1WSHA 3PY8A 1ZBHA 3SUOA 4DQIA 4AHUA 3OYBA 3M8PA 3VQCA 1TL1A 4O44A 1XHXA 4FXDA 1HNIA 1UA0A 3V9ZA 2G8KA 2P5OA 3OYIA 4OPJA 4XIUA 3BGRA 3OS0A 4FJGA 3B6OA 4BACA 3DRRA 4FW2A 3QIPA 4M45A 3ZSYA 4M3UA 4Y1CA 3SPYA 4CEEA 1RDCA 4C8NA 1LV5A 5HP1A 2KZZA 3OY9A 3MEDA 1TKDA 4G1QA 2RPIA 1VSHA 5CY4A 4CJLA 5C42A 4B8AB 4DLEA 1NK5A 1DTQA 1YT3A 2GBZA 5K14A 4OPKA 5FROA 1S1WA 4ID1A 5KGWA 3DLRA 4CJEA 3L8BA 1JLFA 4I2QA 3NFAA 4CGDA 1X9WA 2ATQA 4FK2A 1UAXA 1W0HA 2VG7A 1GOAA 4NCGA 2HVIA 1HYVA 1KVAA 1VSIA 5KGXA 1XI1A 4CJ3A 1U49A 3VQDA 1VSDA 3WNEA 1TK5A 4DS4A 2WOMA 5HRSA 4FM0A 2OA8A 4KHQA 1LW2A 4RW6A 3QEWA 3TARA 1NJZA 4N5SA 4C8KA 4FW1A 4CEFA 1FXXA 4E3SA 1FKOA 1HYZA 3CM5A 4KB1A 1FKPA 3DYAA 4DFJA 3TI0A 1BI4A 1NJYA 3WNGA 4E1MA 3K58A 3IS9A 5DK5A 4H8KA 3HM9A 1S6PA 4DTRA 1EETA 4FLTA 4DSFA 5J2NA 1SL0A 4KREA 4CEAA 2IGIA 3SQ4A 3PX0A 1RTJA 1QSSA 4Z4CA 3VQBA 4AHRA 3MXIA 1BIZA 1A5WA 2HB5A 2X6NA 4O0IA 2VG6A 1I3AA 1TAQA 2JLEA 3H08A 4GMJB 1KFDA 1TVRA 4CERA 4CF1A 1HNVA 4CFAA 1SKWA 5DMRA 3OYMA 3TAPA 4E7LA 5HRPA 4BDPA 4FJIA 1ZBLA 2KW4A 3E01A 3OJSA 1YTUA 1ASWA 3OYFA 4B9MA 2Y1JA 4CF0A 1ZBIA 2DFHA 2A1SA 4KI6A 1TK0A 2Y1IA 3VN5A 3LDSA 1WSEA 4FZYA 4Q5VA 1RTDA 4CF2A 3V9WA 1TKZA 3AA3A 3KK3A 1TAUA 5CZ1A 1CZ9A 4CJSA 1VSJA 3TANA 2P5GA 2YNGA 4NYNA 3HO1A 3AO5A 4CJUA 1T7PA 1LAVA 4DQPA 4K8ZA 5I3UA 4FZXC 3ZT1A 3HP6A 3DLHA 4N47A 1RBSA 1BCOA 4J2DA 3L2QA 2OPPA 5FRNA 1NK6A 1VRTA 4DQSA 1C0TA 4M3XA 3KJVA 1HPZA 3LP1A 2Q3SA 3VA3A 1Y97A 4W5RA 1NKCA 1B9DA 3SUPA 3AO3A 1NKBA 1RT7A 4DTPA 1RBVA 2F8SA 3RR8A 1X9MA 4ICLA 4F2RA 4CJKA 4ELUA 4CJPA 1Z25A 2Z1IA 1J9AA 4AHVA 3F9KA 4DF8A 2PYLA 4B3OA 4KTWA 3K5MA 3LP0A 4YFUA 3NE6A 3S3OA 3KLHA 1N5YA 1A5XA 1REVA 4CEDA 3KD5E 4CFDA 1C0MA 1RDBA 1XWLA 3ASMA 3FFIA 5C25A 3OJUA 3SUNA 3OYHA 1SUQA 1IKWA 4DFPA 3NF7A 2XY6A 2FBTA 1L3UA 2QK9A 1RT3A 1BQMA 4W5OA 3KLFA 4FLYA 4OLBA 4CJFA 2D0AA 2HHWA 1QHTA 2X78A 3AO2A 4OGEA 3F73A 3DI6A 4Z0UA 5HROA 4CGFA 1D8YA 1RT4A 3KKRA 3OVNA 3P83D 4IG0A 4LSNA 4I2PA 1NK7A 4LH5A 4M42A 4L8RB 2YKMA 4CJTA 3LAKA 3QNNA 2B4JA 3G0ZA 5CZ2A 4HUEA 3AVGA 1RILA 1RDDA 4FLWA 1JL2A 1ZBUA 1B92A 1C1BA 3ZSZA 1IH7A 3ZT3A 2A1RA 4KAZA 2I5JA 3HP9A 2D0BA 4DTXA 4OLAA 3SNNA 3KLGA 1BQNA 4KO0A 2G8UA 1Q8IA 1HQUA 3QINA 3DLBA 1S1UA 1GOCA 4AHCA 3L3UA 1IKXA 4BE0A 1IO2A 1CXUA 2IC3A 3HPHA 4TSXA 2W42A 3KD1E 4J2BA 2G8IA 2ZQBA 2G8WA 1ZYQA 4CJRA 4J2AA 1S1XA 5CYQA 2PZSA 2IAJA 4KHUA 1LWEA 1NOYA 4FZZA 1CLQA 3RTVA 4FLVA 3L2VA 1JKHA 1JLCA 1FK9A 1RT6A 2OPRA 3AVLA 3NGZA 2XRIA 4N56A 1A5VA 3L3VA 3V1OA 4N76A 1QE1A 4IBNA 1LAWA 4B8CA 4CFCA 5T7BA 3LP3A 4KKOA 3KK1A 1T8EA 3O3FA 1BI4B 3S3NA 1SKRA 5J1EA 4OVLA 4QCLA 2QXFA 1L3VA 3M8RA 3SQ0A 4FJXA 3LWLA 3AVBA 3SPZA 3P5JA 2LSNA 3RMBA 4DSJA 5KI6A 3LZJA 4O5BA 4DTNA 3RMDA 4FLUA 4Q0BA 3OYNA 3AA5X 2X6SA 3C6TA 4DS5A 3MXJA 5EU7A 1SV5A 3HVTA 4I9LA 4CHYA 4DTSA 1X1PA 4C8OA 3I8DA 4Z4EA 3QNOA 4FK0A 3AVNA 4NYFA 3O4NA 1KLMA 3ZSQA 4F4KA 1TK8A 3UIQA 3BDPA 1U47A 3WNFA 1BIUA 2NUBA 4H4MA 4I7FA 4CJ4A 4FVMA 3G10A 1WAJA 4C8LA 4HTUA 1J5OA 3HSTB 4B9UA 1EXQA 4JRPA 4FCYA 3PO4A 2EX3A 4B9TA 3DRSA 1N6QA 3D45A 1I39A 4CFBA 1KCFA 4PY5A 2KZMA 1BL3A 2YNHA 2E6LA 1MU2A 2O4GA 1SL2A 4E7IA 4DTUA 4F2SA 4MFBA 2QKBA 1KLNA 4CEOA 2ZE2A 1C0UA 3NF9A 3OYAA 1VRUA 2FBYA 4CGJA 4HCBA 2RN2A 2DY4A 2RF2A 1KTQA 2GUIA 5FDLA 3SJJA 3VQ7A 3LPTA 4E89A 2GV9A 4LY7A 4QAGA 4CHPA 3K5LA 4E7JA 1R0AA 3TAMA 4FJ8A 4E19A 4RW9A 1QQCA 4GVMA 3TAEA 1IG9A 4HCCA 3NHGA 2VWKA 1U4BA 2D5RA 2FBVA 3NCIA 3K5OA 2FBXA 4JS5A 3AVIA 1QSYA 3DOKA 2B5JA 4O55A 3O3HA 3QETA 2HNDA 1DTTA 1JLGA 5J2MA 4M3YA 3D0PA 4DSEA 3P1GA 4CGHA 4KHSA 3AA2A 3ALYA 3S9HA 4EZ6A 3V81A 2DFFA 3AA4A 3AVAA 3AVJA 3NH2A 3LALA 2XY7A 4KTZA 3IAYA 3NDKA 1LWFA 3ITHA 4ID5A 1VK0A 1RTIA 4HVJA 4JS4A 3AVCA 3NF8A 1JLEA 3NAEA 2BE2A 3VQEA 4FJJA 3DLGA 1KVCA 2ITGA 3T19A 3HPGA 2KQ2A 1HMVA 3V9SA 2YKNA 4PA1A 4CIFA 2PY5A 3TWHA 2OYQA 4KRFA 1TKTA 5J2QA 3QLHA 4ZTJA 1KFSA 3HJFA 4OJRA 4KB0A 5HRNA 4EZ9A 4KHNA 4FJKA 1NK4A 2P51A 3MEEA 3LAMA 4DSIA 4CJVA 3HPOA 4DLGA 1CZBA 3MAQA 4DU4A 4IDKA 4AHTA 1QTMA 1C1AA
chains in the Genus database with same CATH superfamily
1EH8A 2YX7A 4DR1K 4DR4K 4FK4A 2K4BA 4NC6A 2BTFA 3TO6A 3CXCM 4I9QA 3U21A 2WAQA 2P6TA 4DQ2A 3RRHA 2XVCA 1IRGA 3IV5A 4I76A 2QZ8A 4A0YA 2NAZA 2FF3B 3M8SA 3PUFA 4BRPA 3F72A 4DF4A 3DTIA 4C1NK 2OZMA 4IHVA 3HL2A 5K5OA 2UUZA 3O4QA 2YUSA 1XQSC 2DODA 2K5CA 3HTVA 3HZJA 4FO0A 4RBOA 4E7SA 4RGSA 3O9QA 4A5BA 1HJRA 4KFBA 1Z3XA 3R0JA 2ZJRL 3FX3A 4H0PA 1K7AA 1BG3A 2ZJ2A 2HW3A 3EY1A 4OPAA 3GDQA 4LD0A 1XS9A 1D5AA 1U5TB 2R7VA 1XGOA 4FWSA 5HDKA 1BI2A 3S15J 3KTQA 2P1JA 3PIPL 4NBQA 2K4JA 1SVLA 4O0JA 3D5SC 5LJVA 5E1XA 5F1XA 3SYZA 3F0CA 4WYBA 3Q0WA 3VOEA 1XMXA 2A05A 2VPLA 9ANTA 4BDZA 2HPMA 1LFPA 1HDDC 3K70D 1ASUA 1HX1A 4O8KA 1IKVA 2LC2A 3GW2A 3TAQA 3I0TA 1GLNA 2OU2A 2HHSA 2O3FA 1O7LA 2UWMA 1QSLA 3BTIA 2F6CA 4XMYA 3D2EA 3ZEUA 3FGUA 1EF4A 4RGUA 2E36A 1V5FA 1O13A 5AQNA 4DW6A 2E4LA 1HLUA 1S6QA 3VF4A 2Y31A 4RS8A 1SZ2A 1ZBHA 2E1MC 1ZH5A 5IYDJ 4FJGA 2DA2A 4M45A 1BBYA 1XC3A 1VQ4N 2FU4A 3O9TA 3HOYJ 1LDDA 2Z16A 5LGUA 1XCBA 1VSDA 3TEDA 3O3KA 4JX6A 4CEFA 4HSTA 1HPMA 3JRIA 3GBGA 3WNGA 1BU6O 5FKOA 2XGCA 3SQ4A 2NXNB 4IOXA 1RTJA 4UUSB 4NB5A 3ROUA 3LA7A 4OOIA 1SKWA 4E7LA 4BDPA 1GVJA 2P8TA 3BJ6A 2DFHA 1TK0A 3MMYB 2JJ7A 3BF3A 4AC0A 4G6DA 2NNWA 2NNNA 3FXOA 1HKQA 4N9IA 3AL0C 2OPPA 1UELB 2ZSHB 5TRDA 3KJVA 3HOZJ 1RC9A 3HOVJ 4H5NA 5BOXA 2XRLA 1YJ9I 3L0QA 3IH2A 3GCMA 1X1DA 4JNEA 4AM7A 3MMVA 1SMTA 4OLBA 2E20A 1D8YA 4B9MA 1P4XA 4G9ZA 4PFPA 3AVGA 4MFEA 2UUBK 4Y13A 3FM3A 2I5JA 4UHTA 3VTHA 1Q8IA 4M6YA 1ERDA 5JHUA 3CERA 4KHUA 3AVLA 4JKDA 1IXCA 2MLKA 2NVQJ 3JXUA 3SAGA 3KK1A 3LQRA 3WHCA 3S3NA 5KI6A 1BO5O 4QPOA 2P9PB 2X6SA 3GL1A 3MXJA 5TKWA 3HVTA 1S6LA 2VBWA 3SJMA 4FVMA 4HTUA 3WGGA 2WWYA 1M1KO 4J19A 3VSKA 3ZGKA 4E7IA 2V52B 4FE4A 3GG4A 5J8FA 1R0AA 3Q9SA 4A3JJ 3KWGA 4ETSA 2R5ZB 2VWKA 3AVIA 3GEZA 5JI6A 4KDPA 2ZMEA 2GWJA 4CGHA 1Z6RA 5B1BH 3I4PA 1HW2A 2IVOA 2XY7A 3HGGA 1VQ5I 5BR8K 1VK0A 5DM6L 2DN0A 3JTHA 4EEFG 4IVNA 2IA1A 2ITGA 2F5EA 4WXCA 4H5TA 1U8RA 2ELHA 4CSWA 2GBYA 4DLGA 4ZYEA 4IDKA 2IAIA 3O3GA 2IS4A 1S9GA 2ISYA 1JL1A 3AGRA 3KP4A 1S7OA 3CPWM 1XSVA 1HW5A 4Z4HA 2KDOA 3O8HA 3I9V2 2V4JC 3QEXA 2M7BA 3QP5A 4M71A 4HW0A 2LBFA 3OYDA 3K6GA 4RW8A 2VYPA 3OWTA 2ETJA 3CESA 3LQQA 4PJNA 3DLKA 2YX4A 3U8XA 5FB2A 2KIUA 4I01A 2LY9A 4BC4A 4DSKA 5J4VA 5K5RA 3I54A 4A57A 1HRHA 3HTUA 2QWPA 3ISNC 4FJHA 2QYOA 1RTHA 3M3YJ 3J80Z 3TW6A 2XC7A 4G9YA 4XRSA 2KHMA 1G59A 4M9XA 3RR7A 3LFKA 2IPQX 4CYCB 3CQYA 2E2JJ 3TBIA 3KLEA 4C23A 5GTHC 2KJCA 4JI5K 4C3JJ 4PDKA 2QA4N 4HNVA 3LM9A 1NK0A 3S3MA 4CIGA 2W4SA 1JLAA 4EHUA 4IZZA 3BQYA 1WLJA 5DEQA 1BUPA 3EUHC 3BQZA 3FE1A 2KFDA 2DFEA 4I6ZA 4DR2K 4MLHA 1MDMA 3T1AA 1STZA 3IWZA 2XF6A 1NGCA 2JUCA 2JA6J 4RWTA 1O3QA 3S17J 3BY5A 2F96A 2W24A 2FXUA 5FRMA 4GW6A 1FOWA 1U6ZA 4IOCF 2IOCA 2YSRA 3MWPA 3ZQHA 4KHWA 2CH5A 1J6ZA 1IDYA 5CYVA 5EZGA 3U9ZA 1R7JA 2VXZA 3RMCA 4BQQA 2D5VA 3HOUJ 3RWUA 2W48A 4AH9A 1HXDA 4MO5A 4B4CA 5K7ZA 3TQNA 3PLAA 4K25A 3TABA 4Q47A 3GLXA 3W2VA 3I4MJ 3VA0A 4H0YB 3SUOA 3OYBA 1YIOA 3A5MC 1YRNA 2G8KA 2P5OA 4V19S 5LBQA 1PUFA 1FT9A 5CE3A 3IUCA 4AYBN 3BG5A 3GFMA 2BEOA 2V7YA 3G1LA 4HYEA 2DQRA 4KA4A 2M45A 4FPAA 4M3DA 2P9LB 2E5ZA 3F8BA 3EDPA 1SVMA 4UV9A 2OA8A 2MABA 4C8KA 1T2KA 1TWHJ 3I53A 1NK7A 4PKHA 1XNRK 3FXUA 5D5XB 2VG6A 1TVRA 3BJAA 4EGYA 1V4SA 2KP6A 4MQ9F 3VB2A 2FA5A 3ASOH 2VQLA 4EJUA 4Q5VA 4CF2A 1MD0A 1W4MA 1TAUA 1D3YA 1OCCH 3M8FA 1LVAA 5M1OA 4BRQA 2NZTA 5I3UA 1FEXA 4IRGA 2KKOA 1TT5B 1B9DA 3I59B 2F2EA 3DEEA 2Z1IA 4WF9L 4E7ZA 1ETYA 2W40A 2QK9A 4IL6C 3OIQA 3GTGJ 4LK0F 4U0VA 2A5WA 5E1WA 3P9IA 2IW5A 4X62K 2F5FA 1BQNA 3E9LA 3WTSC 1Z91A 4BR9A 2G8IA 3ZETB 3CLOA 1GLCG 2M34A 3P31A 4FLVA 3JR9A 5AQTA 1A5VA 2PFBA 2LFBA 2VBYA 4F55A 3ZN1A 5J1EA 1XCVA 4FJXA 1P6RA 4V2FA 3RMDA 2M0CA 4NDLA 4EGZA 3ZYYX 4BJ6C 2HDDA 1UHMA 2QWRA 4KMUX 3HSTB 1VF9A 4PFOA 5JFRA 2EX3A 3BCAA 4BRLA 2IVNA 4HCBA 3GTOJ 1VQ7N 4FJ8A 2KKZA 2IA0A 1BM9A 3ESWB 2FBVA 3C18A 3QBXA 3CF5F 3D0PA 3EL2A 3P1GA 2VOPA 2X51A 3ERMA 3NH2A 1DU6A 4KTZA 3ITHA 1NGEA 2ZJPF 3RKXA 4JS4A 3IFRA 1K8AO 1IAWA 1LKXA 3KHYA 3GTMJ 1AKHB 4B09A 5HRNA 2YCHA 3CJTB 1QZZA 2COBA 4DV1K 2EWNA 1BI1A 5EG0B 2LLKA 3L1PA 3GVAA 4AHSA 2UZKA 4FJMA 3RRGA 1S8NA 4RW4A 1WJFA 3BG6A 1RFQA 2XIGA 2MG4A 2Z2SB 2BBYA 4IO8A 3HUGB 3VOVA 1R1TA 3ZMVA 2XHBA 2B6AA 2MA3A 1Z9CA 3CC2I 1KAYA 3IMXA 4EQQA 3GOIA 3VQ9A 4MEYF 2IXSA 4YELA 3CJQB 1GLEG 1WI9A 2D0OA 3LSGA 5TKYA 4DTJA 1XD7A 4H5VA 2OPQA 3M1CA 4ELTA 1ETVA 3J81O 3L4IA 3ZT4A 3H3UA 4KH4A 2DO7A 2HOSA 2RNGA 2OUMA 2K85A 4FJNA 2LYCA 3W3DA 3TPQA 4ENNA 1K8KB 1Y8RB 4BRAA 2M7AA 4XORA 2F9TA 2X4HA 3HSRA 4BEHB 2VC1A 3CUQB 2V1UA 1DLOA 3VYSB 4DMNA 2L9SA 4KIGA 1T05A 5AQIA 2O0YA 1ZAOA 3D2FA 2QA4I 3R9PA 2HQRA 4W5NA 3WTTC 5J1YA 2H09A 1TWFJ 1M1EB 3TGNA 2BGGA 2QWQA 5ILUA 4RB3C 1T44A 4U88A 4XN3A 1UFMA 4DU1A 3OYKA 3VODA 2R5YB 1IG8A 4N41A 4JK8A 1DUXC 1J54A 1BDGA 1LQ1A 4YOVA 4MEXF 1VQLN 4CESA 1EX4A 4W5TA 1RIOH 1BA0A 2DI3A 2HDWA 2G8VA 2IGOA 3KKSA 3THWB 2HXOA 4DB3A 3UB5A 4CGGA 5BR9A 3LZIA 3HSCA 3TL4X 5JVGF 2IDOA 4UB6C 3ULEA 1LB2A 3CCRN 4I6MA 3HRTA 1P90A 2L7ZA 4OPJA 4XIUA 4GVEA 1KA8A 3FZKA 1X2NA 5GIOA 2E34A 1JXSA 4M3UA 2QW9A 2MFZA 1USSA 2Q2EB 1BC7C 3TKYA 1TKDA 4B8AB 1YT3A 2E88A 4CJEA 3HOWJ 2HVIA 1YQAA 1QRYA 3DKXA 3WNEA 2QKMB 1AOYA 5HRSA 2WB1A 3QEWA 4RW6A 4E3SA 5CHIA 3WXKA 1SL0A 1K79A 3MXIA 3CJNA 3MZYA 4CF1A 5FD5A 4RTFD 3I4NJ 3CTAA 3A4CA 4A3LJ 1RTDA 1CZ9A 3KZZA 4P9UA 2HGCA 5HLHA 1IN5A 4DV3K 3E1YA 3ONQA 2JWLA 5AZIA 3DLHA 5FLXZ 1LEBA 2M4GA 2F8SA 2ID6A 4ELUA 1Z25A 4AHVA 2VQCA 2YPRA 1O3SA 3HBLA 2BXZA 4CI6A 2HI3A 1RT3A 4JOMA 2GAUA 2JRMA 4AWXB 3WXJA 2MYSA 4KAZA 1MIJA 4B3RK 3FHNA 3KD1E 2V1XA 1ZYQA 1X3MA 1CLQA 4FZZA 4IOAF 4EVIA 2YHWA 2OPRA 2NRRA 1USTA 4AQYK 1KYWA 3MWMA 2LH9A 3K70C 1LAWA 3LP3A 1RDWX 3KCCA 1SAXA 4QCLA 1TW2A 1J59A 5KAFC 2QXFA 2FNPA 2LSNA 4YORA 3WG9A 3K10A 2COMA 1XMOK 4K41A 3BDPA 1YF5L 4CZHA 4HBLA 2NUBA 1P92A 1MDMB 3VEPA 1C0GA 3I56N 4JRPA 3PO4A 4RB0A 4LJZF 4MTDA 5AQOA 4PY5A 1BL3A 2E6LA 3QOPA 2O4GA 1U0JA 4MFBA 3T0YA 2H8RA 2RF2A 1WOQA 3QPHA 2GV9A 4IHYA 4GVMA 2P9IA 4BRGA 4J00A 3EUHA 2B5JA 2VKDA 4HA8A 1NHAA 3V81A 4YDUC 2BVLA 2HF3A 4CICA 1N75A 4IFEA 3MEXA 3CJBA 3AVCA 3SJHA 3TOBA 1KVCA 3LMMA 4YY3K 3EO3A 3IKMA 1KD1O 4IJAA 1Q18A 2STTA 2DMNA 4KB0A 3RJPA 2F5CA 1NK4A 4L18B 1J5YA 2VQEK 1H89C 1BI3A 2K40A 5F2RA 1SS6A 1N32K 3UKRB 1FBUA 2DA4A 5AONA 2MLGA 4WWCA 4BE2A 2A40A 2HS5A 1NK9A 2X6YA 3BLYA 5F64A 1MA9B 2KIMA 1E17A 1YITN 3WQTA 4UB8C 4E0DA 1IN6A 4IZ9A 4JV5K 3C6AA 2RQQA 3B6AA 1R71A 3LL7A 5B8HA 1K6YA 2FSJA 5KTQA 3L6QA 2NRTA 4M3FA 2R7UA 3ZLJA 3H6EA 3HT3A 3EYIA 2XRNA 3ABMH 2FSNA 3JYTA 3KEYA 2V6EA 1UG0A 4XLEA 3ZSRA 2ZWHA 2VC0A 3O6BB 4Z4FA 2DJIA 2CFXA 3FZFA 4E1JA 1REPC 4DU3A 3HYFA 4FLXA 3LSJA 1KSPA 4AVPA 2OBPA 4PKGA 1KONA 2EIMH 3HIFA 4MNUA 1FSHA 3F8FA 3A2KA 4JYAK 1MWMA 4EP4A 3H0GJ 3UKUB 4CHZA 5LGTA 3ZX0A 5D8LB 3WEEA 3DV8A 4A61A 2TRTA 1JXBA 3HXMA 1BC8C 1GLAG 1SKSA 3ZMUA 4PSXA 1K4TA 5CQGA 4A0XA 2DTZA 4L9TA 1NJWA 4FJ7A 5HLGA 1EP4A 3VYRB 4PGHA 3OS2A 4RG8A 3AAFA 3KK7A 4JKBA 3V1RA 5HDGA 2CWEA 1IUYA 4CEQA 3HK2A 3PL8A 2BHZA 5KAIC 1FC3A 5J40A 2DA7A 3FFKB 4G7HF 3DLLL 4S0HB 4H0XB 4JKCA 4NCAA 2HHQA 5C12A 1L3LA 1VQLI 2V7FA 3ABUA 3BR6A 2ISZA 3CCQI 4B9SA 4CIEA 2LREA 3DU6A 1G15A 3CQZJ 1X2MA 3SQNA 2KMUA 3VQCA 1W2BM 1HC8A 3A5NC 1X3WB 5F0FA 2ZC2A 4XOPA 3E5QA 3VERA 2VGMA 3D1NI 1S5LC 3CF5L 2V7ZA 3CCRI 1KQSM 1B9NA 4DR5K 1JKOC 3JTGA 3TP3A 4WQ5C 1VSHA 3A0IX 2ZJPL 5KGWA 3ZQGA 5DUKA 4IQJA 1HYVA 5HS8A 1KQ9A 5C10A 1FKOA 4KB1A 3E9OA 4E1MA 5J2NA 4BU2A 2IGIA 1POGA 3E1SA 3HKZN 2FQ3A 3CCVI 4BQAA 2JLEA 5LLQA 1KFDA 4KJZA 5E3NA 3FKJA 5EY4A 3LDNA 5FKKA 2R7ZJ 3E01A 3H36A 4BBRJ 1JHFA 4RAYA 2ITMA 1P7JA 3RQIA 1JE8A 2FOWA 2Y0SN 3G4SN 1YX3A 2HQNA 2X1EA 4I09A 1ZKGA 1T7PA 4N47A 1MNMC 3VA3A 2H3GX 1MJAA 2IJLA 2P9SA 5TJJA 1ZQ3P 3P9KA 1QPMA 2MC4A 1OFCX 3S3OA 1Q1VA 3H3VK 3V8KA 1L3UA 4FLYA 4Z0UA 2WAEA 1WQ2A 1R00A 4DUZK 3CCJN 3G0ZA 1OH8A 2BY2A 2A1RA 3WTWC 4IHSA 3QYFA 4LG0B 4BE0A 2W42A 4TSXA 3KPHA 3KWIA 2ZNZA 4DZPA 3DEUA 2PZSA 2IAJA 3BG3A 3QPTA 2AXTC 1RT6A 3AAPA 3AAQA 1GLJO 1NG9A 4DV2K 4V2GA 1GT0C 4R8HA 1LCUA 4DUYK 2BW3A 1X1PA 3VGLA 4LFBK 2QGUA 2QBYA 4I7FA 2OQGA 2O5RA 1Y8QB 3NEUA 1MU2A 5FFZA 2RN2A 1X3ZB 3IDHA 1W7AA 3LPTA 4B43A 5LMNK 4RW9A 2BHYA 4EM1A 4M72A 1QSYA 3DOKA 2EFOA 3V8LA 2HNDA 2ZJQF 3MKZA 1EV7A 1V5GA 1WH7A 3K4LA 3LALA 1BIAA 3NDKA 3MCPA 4OMYA 3NARA 4GXOA 1ZHFA 2TCTA 2X1CA 2VODA 1JKRC 3DXKA 4PA1A 4KRFA 1H0MA 1LE8A 2P81A 4CJVA 3MZ8A 1CZBA 5IT9O 5AQJA 2E2NA 3DFGA 2BYVE 3BR5A 3V9UA 3HI0A 2DDAA 5ED4A 2MBFA 2KFZA 1WCMJ 2EFWA 5EDNA 2V9KA 2V9PA 3FR0A 3HC7A 4CXFA 3L7WA 3OYGA 4AILC 2ECBA 1WVRA 5LHIA 5ELZA 4RM3A 2XB5A 5JS2A 4K8XA 5H6QA 1G8XA 2A68F 2KIQA 1YITI 3SV4A 4UXNA 1S5JA 3DLAA 1MWKA 3KLOA 1FBSA 1ZBFA 3NWTA 4NXNK 5FPEA 4Y1DA 3J7AO 1KVBA 4CCJA 1SANA 2HHVA 4LSLA 4YNQA 4W5QA 4FM1A 4ON0A 1RUOA 3C6UA 3FXLA 3LOCA 4CZIA 1MKMA 3CG7A 5DV5A 2DYSH 3VYUB 1IG7A 5F6FA 1IRXA 3B6PA 3BT9A 4ESBA 3OTOK 4M3TA 1HYSA 3ZP5A 1FW6A 3H46O 4IRIA 4JI6K 2E6MA 1YVNA 4EAHD 3MDQA 4IHTA 3H92A 4P5OA 4BVPA 4IG3A 3BY6A 2X0LA 2IS3A 4B3SK 5DCFA 1QZ6A 1B9FA 4IOAL 4YEJA 5LHHA 1XUPO 3O08A 3CCUN 3QPSA 4C8MA 3LANA 3QB0A 1A5JA 2V1DA 2MD5A 2EHGA 3K4MA 2E1NA 3NH1A 1X1BA 1NGDA 3HXLA 3OYJA 4GV6A 2E1YA 1RKWA 2RAEA 3H0DA 4H4KC 4X66K 5B5EC 1HKGA 2I5UA 5EF6A 3P39A 4GYGA 3HM8A 5IPAA 3PY8A 4FXDA 1MZBA 2HKOA 2K86A 1UA0A 2R7QA 2YX6A 5AQYA 2H6BA 4BACA 2EZKA 3ZSYA 3IP4B 4ILJA 1OYWA 2XB0X 1DTQA 2P9IB 1KZHA 5GAGP 4EMSA 4NXMK 2VIXA 4G7ZF 4CZLA 2WAQN 4NB4A 1BIZA 2VKHA 3PO2J 5EX5A 2OCCH 4E70A 3AG4H 4Y15A 3ZQIA 4MO4A 3OJSA 3IKTA 2Y1JA 4BRKA 1ON2A 1JKQC 3QICA 4YDUA 3BTCA 1YO5C 2PJRA 4RM2A 2BUPA 5BPLA 3G6EN 4FVUA 3QRFF 4J2DA 3HOTA 3G4SI 4FHTA 5LL6Z 1HPZA 2DU9A 1UHSA 3CC7N 1RBVA 5M3FJ 4DF8A 1RI7A 4K2EA 4CFDA 2A69F 4J01A 1LVKA 1YW8A 1SUQA 3KEOA 3R3LA 1ZG3A 2MH2A 4W5OA 2HHWA 5ICFA 3F73A 4WK8F 2LRDA 1BA5A 5AQPA 1LDJA 1U2VA 3K0SA 5EGOB 2VJ4A 3RYRA 2O8BA 4U67L 4BGDA 2R93J 1BOAA 2NRZA 1CXUA 3CCJI 2P5LC 4WFAL 4GYIA 3VEVA 2G8WA 1NOYA 1AU7A 3L2VA 5E20A 4XLNF 1HNXK 2VASA 4CZZA 3ZRGA 5E8IA 3L4QA 2AA4A 5C2FA 3SQ0A 3K4KA 5B3SH 4Q0BA 3IKVA 3I3LA 1PYVA 5JHFA 2V9VA 4BR4A 3A01B 4QS8A 2CQKA 4CJ4A 2XGXA 4ZYAA 1N6QA 2CFOA 3OBWA 4AIJA 3FK7A 4LIVA 5EEGA 4CJ7A 4WQ4C 3I33A 2P0WA 2RGVA 1YYVA 4GV9A 3IHUA 3ATVA 2O7OA 1B1BA 5KQ8A 4LB6B 4QIWN 4KHSA 2X6WA 2DFFA 3WTZA 2WV1A 5H2FC 4HX8A 5B66C 1S3XA 3UKGA 1IRZA 3LL3A 2XPUA 2BE2A 1HMVA 3RI4A 1ZLKA 4B1WB 3CJ9A 4FJKA 3HOXJ 1T6DA 3WTYC 1XMAA 2JVGA 5LEJA 4YFXF 1S1TA 4PL8A 2B63J 4HV5A 2JTVA 3N97A 1WPKA 2R7YA 2Z1DA 3PM1A 2Z33A 1N8RO 1RPWA 1IGNA 3LSIA 1I6XA 4R79A 4HDUA 3EUAA 3OS1A 5EEHA 1W9HA 1KQ0A 2L4MA 2HWVA 5GPAA 4OIRF 1XTAA 1GHCA 2D4WA 3DBLB 2FUG2 1NMNA 2QF7A 2YNIA 4JLHA 1HQEA 1EKEA 5IYBJ 1A6IA 2CUJA 3LSKA 1F21A 4BGBA 4LFCK 3I0SA 3A02A 1NG7A 4WQ5A 4IHWA 5C2DA 2DPUA 4CF9A 1JTXA 3LP2A 3THVA 2RKIA 1HF0A 2Z1HA 3RVCA 4LFAK 1NOZA 2VJIA 1R36A 3SZ2A 2KLOA 4BRDA 2H1LA 1HBXG 2R7WA 2R7SA 2ZB9A 1KGSA 5I42A 2RHKA 4PJ0C 4XRMA 2WA0A 4IFYA 3PQKA 3KE2A 2G9WA 4DG1A 5D3GA 1Y1WJ 1S7EA 5GAHP 5C4JJ 2M30A 3P9CA 1Z21A 4ANJA 4KV8A 4IWVA 4F92B 2HOEA 4PUOA 3VGMA 3S1NJ 5J1UA 1L3TA 4OIOF 2XGEA 5ADXH 4ILGB 2L54A 3H1VX 4M63C 2EZLA 3GLLA 2M4KA 2HBMA 3AG3H 4D7MA 1O7FA 3BZCA 3FKIJ 2QWNA 3M1FA 3N4MA 2E35A 1T0FC 3UNGC 3MX2A 2IEKA 5E84A 5KPTA 4DBQA 4YG2F 3M8PA 3MN5A 4XNFA 4WCEL 1R23A 2ZJQL 3MEDA 4CJLA 2R7TA 1FLIA 4Y3OA 3FMQA 2NS7A 3L8BA 4CGDA 4NCGA 2VG7A 1W7PA 4PJLA 3Q0UA 1WSUA 3VQDA 2OQRA 4A5MA 1V4RA 2QTDA 1IXSB 4G8XA 1IJJA 2PAVA 3CM5A 2JA5J 2P5KA 1I5ZA 3O9SA 1LEAA 2VLAA 3VWBA 3HRGA 3ENHA 4KREA 4OIPF 2OANA 3PX0A 3D6RA 4AHRA 2BY0A 2A6EF 3ABKH 3DCFA 4HNTA 4A2BA 4UVCA 3H3ZA 2DMQA 4JI1K 1HW1A 3LDSA 5CR4A 4A62A 3CLQA 4IF4A 2CH6A 5GP9A 2Q31A 1VSJA 2DMPA 2YNGA 2HOAA 1WJBA 1RKTA 4LLLA 5DM7F 4FZXC 2IVMA 1BCOA 3L2QA 3G71N 4XICA 2PN6A 1RT7A 5A2QO 1D0YA 4A3BJ 1FOYA 2DT6A 3LP0A 2EZHA 5KCMA 2BY3A 2P9NA 3CC7I 3DWLE 4LLGF 1QVTA 3MQ0A 3CCMN 3QDKA 4IG0A 3R8EA 3VSLA 3RQ4A 5CZ2A 2E1CA 1RDDA 1SD4A 3BTJA 3I58A 4PKIA 2VKEA 2MGQA 2JA2A 1Z6TA 5AFUA 2GOXB 2NOJB 4JYKA 4CFCA 5KNLA 1SKRA 3CJRB 4OVLA 1ZN2A 1L3VA 3SPZA 3P5JA 4DV0K 2OF7A 4MIMA 4Z4EA 4HF2A 2E2HJ 5HS7A 1BR2A 3CMMA 2O8CA 1J7KA 5CKTA 1D1BA 2K9SA 3CPEA 3DRSA 4DTUA 1JTYA 2QWMA 1J2XA 4E7JA 3TU5A 3J81K 3NCIA 1O3TA 3O8GA 4BR5A 4BJ5C 4JHDB 5H6RA 1GLBG 2HBLA 1R4NB 2VJJA 1ZRDA 3ALYA 3DTEA 1QQIA 4FWKA 2KZGA 2A61A 3OSGA 3GF2A 1JLEA 2OTJN 1YI2N 4OAYA 2FF6A 3THYA 2PY5A 2OYQA 2K3FA 1ATSA 4PHTX 4AD9A 3LAMA 4B9NA 4X1EA 2HHUA 4BC5A 4L0YB 1MH4A 2M9HA 3BR0A 1QVFM 2JQ7A 2NRVA 3FZLA 1L3SA 4CEZA 2HVQA 1ITGA 1GOBA 2QSGX 3JSOA 1R58A 1T95A 3G1OA 5DYMA 4D5CA 2WADA 1OH6A 1RCHA 3MVPA 4DV5K 4CJQA 2FOKA 2HR3A 5F1JA 1NGAA 1T08B 1XDUA 4IXCA 3SFZA 3QESA 4IDHA 2RN7A 2ZXIA 1BIBA 1K83J 5E3MA 4LH4A 1A36A 3PSIA 1I27A 5KRTA 4K43A 4ENKA 1C6VA 3M5RA 1U48A 2HVRA 4B08A 1RDAA 1LWCA 3AVHA 3FZHA 4CHQA 3QO9A 4CE9A 4RCHA 4OGCA 3FXKA 3TAGA 4DWIA 3LDQA 1GLLO 1Q7YO 2WFBA 1MW7A 1VSEA 2R7RA 1JXEA 4LF5K 1NTCA 4GV3A 3AFHA 3ATUA 2ESNA 1A31A 4NHJA 1MBKA 2Q97A 3SEQA 1Y39A 2JVHA 2L02A 5IT3A 4RMNA 2DPDA 3S8PA 4NC8A 2EWSA 3C94A 2DJNA 3F22A 4O6JA 3SAHA 2HHXA 1FYMA 3F21A 4OIQF 3SI6A 3U1KA 3C95A 2CO5A 3MECA 3JW4A 2VT3A 4E7KA 2OPTA 1U5TC 5F0CA 4FYDA 3DF8A 2XY5A 1CXQA 2QI2A 1SVOA 2HQ5A 2V51B 3ZCOA 1TUUA 3EE8A 1YJ9N 1RNLA 2O8BB 3F23A 5CYMA 3LSHA 2UU9K 2ELJA 4MQ3A 1B8IB 1IN7A 3QU6A 5IOZA 5BRFA 2BH1A 4L9JA 4PL7A 4M6VA 1A04A 3WXLA 2EFQA 2O8DA 1UOCA 1U3EM 3LM2A 5BRDA 2KDZA 2LY2A 1PUEE 2ZXJA 3SBTA 3DAWA 4B44A 5DDGA 2GLOA 2DCEA 1LPQA 3VENA 1MBJA 4RAGA 1YJWN 1FTTA 3SPYA 1YFHA 1QGPA 2IIRA 2KZZA 4KIBA 2GIZA 2DTRA 2LF7A 3B73A 3W2WA 3WHBA 4OPKA 1ITYA 5ICGA 1JLFA 3NFAA 4FK2A 1UAXA 1TQPA 4CJ3A 1TK5A 1S3JA 4XLCA 1BJZA 3W2AA 2ZGZA 1FKPA 4DFJA 1KU7A 4A69C 2JMWA 1QSSA 4Z4CA 3UR3C 2X6NA 4O0IA 4KN4X 3MFKA 2QQ8A 2WTUA 3O9RA 2EBIA 3AA3A 3KK3A 5CZ1A 1SD7A 3GYHX 1H8AC 1NK2P 3HZ6A 4WX9A 4FSVA 2WAFA 1NKBA 3CCSN 3THXA 3WTUC 2NVUB 3G71I 2DA1A 3OMYA 4CZCA 5C25A 3OYHA 1Z77A 5M1QA 2D0AA 3SZGA 4AF1A 1Q86O 4JX4A 3HJEA 5HODA 3QNNA 3HG9A 2VOOA 1E3HA 3MX5A 3PO3J 3E5XA 3CCMI 1HQUA 3U4LA 4AHCA 1X1CA 1WJAA 2EFPA 4FOEA 4OO1J 3VEXA 4I0BA 2EA4A 2KPMA 5JLXA 1RUNA 5AQHA 5T7BA 3O3FA 5IOYA 1K78A 1TWAJ 3WTXC 2M2EA 1ZLJA 4RB2C 3C6TA 4DS5A 4G6TB 3N4PA 4IHXA 3KP3A 2AQFA 2RNJA 3RDIA 4DYQA 3EZWA 2P5VA 2IS6A 3G10A 4Y7NJ 1NGHA 5AZJA 2E5LK 2HU9A 1DGWY 2H94A 3GZNB 4CFBA 1KCFA 1SL2A 1C0UA 3SYTA 3W6KB 2EB7A 3SJJA 4JKGA 1NGBA 2FJ1A 4JD2A 2WV0A 2VKVA 4HX4A 3QETA 1JLGA 1ETKA 3AA2A 4F7ZA 2PBIA 2NRXA 3C7NA 3O5BA 5DUIA 2OA4A 3M3ZA 3HPGA 4L0ZB 2QQ9A 1TKTA 1NGJA 3QLHA 4IEIA 3JRCA 2BZTA 4QLCU 5KPRA 4NQWB 2OTJI 1X58A 5KVRA 2FSWA 1YI2I 1C1AA 1N25A 3TDUC 3JCUC 4PGGA 1F43A 4DCHA 5JVTA 5C3EJ 3OA9A 2WB1N 3QIOA 1MBHA 2GXBA 5DCMA 3CM6A 4M41A 3MEGA 3P38A 4XH4A 1T0FA 3SQ1A 2CS3A 4Y52J 1KU3A 3EYZA 3I55I 4A2UA 1W7PB 4CK3A 1U04A 2FC0A 2CV1A 4CK1A 5GAGJ 3OHRA 2O8FA 3V6DA 4HX7A 1RBTA 3R1XA 2CQQA 3WU0A 3AVMA 2P9KA 4I99C 1U6GA 1BGXT 3TSUA 2J5PA 4EP5A 1IKYA 2HYFA 2JN6A 5DM7L 1VNDA 3GX4X 5EYRA 2Y9YA 4YFNF 4KPYA 1N36K 3K9TA 3QEVA 3IG1A 3EYYA 2Q1NA 3ZSXA 5BS6A 1IBLK 4CEBA 1NK3P 4EM2A 3VQ5A 2VG5A 2O8EB 4CJWA 4L5IA 4WCGA 5D5UB 2DYRH 4Z6YA 1S7AA 3HHGA 1MJBA 1WJDA 3M9AA 4DNCA 5TGTA 4A0ZA 1RT2A 1I50J 1DGKN 3JS6A 4FWNA 2EJRA 1OR7C 3QPLA 2QQAA 4ZDPA 2IBDA 5LHGA 4YHHK 3BP8A 1N78A 2V26A 3E9PA 5K7FA 3QEIA 4KI4A 4I02A 3RSEB 4P9FA 4G94A 4A3DJ 1UA1A 1TWCJ 3BZKA 2LG4A 3HRMA 1APLC 2FBHA 4CECA 4DGWB 3ZMZA 2AHQA 4HQMA 1ESVA 1T3VA 3HB9A 4FLZA 3GE1A 1TKXA 1TTYA 2O8CB 2DT7B 1U78A 4JK1X 3FISA 4B1UB 3CHWA 2GBZA 1YJWI 2P9UB 2TDXA 1KQ8A 5IYCJ 2EV6A 2CGJA 3PNYA 2Y9ZA 4N5SA 3AY9A 1BI4A 1FX7A 4RLFA 4DSFA 5IY5H 1XNQK 1FY7A 1Z05A 1JUMA 2HB5A 4CFAA 4I7HA 4XKBA 2DA3A 2W85A 1ZBLA 3H1QA 3B02A 1B72B 4HLYA 4HTLA 2FD5A 4DOZA 2DPNA 3KETA 3H3NO 4FZYA 1ZBSA 3K69A 1UB9A 2O8KA 4NYNA 4CJUA 2F4VK 2OV7A 2XV4S 1T98A 4ZJZA 2NYXA 5IP6A 2Q0OA 4DTPA 3RTRA 3M4OJ 4ICLA 2IVPA 4CH7A 2VONA 2PYLA 1WZ2A 4KTWA 3KLHA 1A5XA 4A5NA 3SFIA 5AIPA 4DFPA 4ZDLA 3CCSI 3IAM2 3R61A 1ETWA 5K5QA 2Q0RA 1Y64A 1C0FA 3L00A 1VQ8I 2YKMA 1PP7U 3E0JB 4HUEA 3KP6A 4EHTA 3CC2N 1B92A 3S41A 4DV4K 3SNNA 3KLGA 3QINA 1DP3A 1CF7B 5GIPA 5IT9K 1BOBA 4BQNA 3GFJA 2ZQBA 4L5JA 2L9RA 1JJ8C 1FK9A 3BTLA 2XRIA 3E6DA 3JREA 4XH1A 1QO0D 2FLOA 3IH3A 1GDTA 1G99A 1E4FT 3LZJA 1GUUA 2Y0MA 4H0OA 2IGNA 2VBXA 2E60A 1BIUA 2CQXA 3J80O 1EXQA 1Z1DA 2KZMA 1KLNA 3KZYA 3DPTA 5GAHJ 4N9HA 1E0EA 4KHPK 2J5OA 2D5RA 4JS5A 4FPBA 1OPCA 1WBDA 2L2OA 1D0ZA 2FQ4A 1W5CC 5AQMA 4HVJA 1QZ5A 3DPLC 3VQEA 5L3EA 2YKNA 2HDCA 1U5TA 4ZTJA 2IP2A 4EZ9A 4KHNA 4MGRA 2P51A 4DSIA 3BPVA 5EXWA 4Q48A 4A3CJ 3NGYA 2VWJA 3FXRA 1I3QJ 4J2EA 4AM6A 3TSPA 4IO9F 1H1VA 2DAOA 3MKWB 3JAMZ 4L9NA 2JWTA 3JRGA 1P7IA 3AVKA 1LUJB 1U9OA 1K61A 5BPIA 3IH4A 4JAXA 4HF1A 2NRAC 1UWBA 4JKAA 3C2GA 4WF2A 5M3MJ 2HZDA 1OVYA 4BDYA 2DMUA 4CBXA 3CFPA 4CZFA 3EEQA 4MO7A 1SMYF 1N33K 2HXIA 4E7HA 2RKHA 3ZT0A 1WB9A 1WSIA 1RRJA 1BI0A 1LNWA 5JLWA 3T3FA 3AO4A 4IKFA 2IGMA 3MN7A 1Q9YA 4IFVA 4ELVA 3CMYA 1NKEA 3QBWA 3QYEA 2UUAK 2CUFA 3HVRA 3SEZA 1HOMA 4CGIA 3PO5A 2YI1A 1PVEA 2DBBA 1XC5A 1XGSA 3K1MA 3JRHA 4LF7K 3THXB 4JQFA 3RYPA 2YV0X 1JGSA 4X65K 3S1RJ 2F4IA 4UUSA 3BR1A 3CUQC 3ZCMA 2FXAA 4HF0A 5JR3A 3RZDJ 4BGAA 4ZZDA 3ZMTA 4QOZB 3CMAN 5LMUK 3CF2A 3VEZA 4BQOA 2BE5F 1IJWC 2MW8A 3SV3A 2NVXJ 3ZSVA 3ZOBA 3C7JA 3SUQA 3H45C 2JPBA 2NRWA 1T6CA 3K0LA 2D0CA 2ASMA 3IC7A 3K4CA 4WE1A 1B9MA 5LD2C 4S04A 2VWBA 1WSFA 4O8UA 5ICCA 3PX4A 3LSRA 2OD5A 3DEWA 3VQPA 2ZF5O 2EPFA 1S9HA 3E97A 1RESA 5AQFA 2N8GA 3OS0A 1WKMA 1RDCA 4BHCA 3OY9A 3EKUA 3BG7A 2I7PA 1NBWA 1QHGA 1QZEA 2PMUA 1KVAA 4GKJK 2DOEA 1YE9A 1K4SA 2XAUA 3V7SA 3FLCO 1P8ZA 3K1NA 4KN7X 4BKXA 1WHUA 2P9PA 2H1KA 3CC4N 3KZIC 1UHWA 3D7EO 2LOOA 2LNBA 4XKWA 2E1ZA 4A6DA 1M90O 4XLHA 3WE3A 4KI6A 3A0HC 2MD0A 1SAZA 1VI0A 3EQLF 4FETA 5DCMB 4BRMA 2OC6A 1JJ6C 4F93B 3DP7A 4XRFA 5D4SA 2R5ZA 2W6LA 3JRFA 4QS9A 4UY8O 1NK6A 1OCRH 4IRHA 3D2EB 1NKCA 3ZEUB 3SUPA 1XG1A 1X9MA 1J9AA 2LP0A 2PJPA 1WFXA 1G4DA 4YFUA 3I64A 3FMSA 2XPWA 1C0MA 1UMQA 5BRHA 2M1BA 1QHTA 3TTCA 3OVNA 5DM6F 2B4JA 3KP7A 4U87A 1RILA 4A59A 3QOEA 2W1OA 4XOTA 4UUTA 4XRSG 4KO0A 2VQFK 2G0EA 3K4BA 3S14J 1IO2A 1XDSA 3HPHA 3K9KA 1V55H 5CYQA 1BJAA 4LK1F 1VZ0A 3RTVA 1WJEA 1JLCA 3HRSA 2K02A 3L3VA 4F52A 2CUZA 3AG1H 4IBNA 5AQZA 3LDPA 3BR2A 3SHFA 2EK5A 2XSDC 3M8RA 4BR0A 1EWQA 3FXMA 3LFUA 4A3FJ 1Z67A 4DSJA 5BPDA 3AA5X 1QA6A 4DR6K 5TISC 4FK0A 3LSTA 3UIQA 2KQRA 4FWOA 2Q2RA 3O8MA 4CCMA 4HSRA 3D45A 2A41A 3O6WA 3H9QA 2GUIA 5JICA 3OOPA 4KNYA 4OMZA 2FMLA 2HHHK 1U4BA 1P4WA 1SEUA 3NAUA 4CW7B 1BL0A 1LFBA 3S9HA 4ESJA 3AVJA 1U9NA 3J7ZO 4ID5A 2W84A 1OR7A 1KFSA 5CQEA 5JMVA 1RR8C 2WY7Q 2GM4A 1Z3YA 1FZPB 1G3SA 1VSFA 1VSMA 1TUYA 1HSJA 2QM1A 5DD8A 4V19K 4M3EA 2VJ5A 4GNIA 3CCQN 3L09A 2W6KA 4HG2A 1TYQA 3I5UA 3SAFA 3JRAA 2O61A 5AQSA 2PMHA 4PUSA 4U0YA 2EQRA 1WAFA 1XMKA 5FGMA 3DBHB 1Y6IA 2PG4A 2DQLA 5LRSA 5CJ9A 2W82A 4B9VA 1O57A 4FOIA 1R9TJ 3TO9A 1IV0A 3QFUA 2X1DA 2OPSA 4KICA 3VQ4A 2ZMEB 3KYDB 3RCOA 2YNFA 3JAMK 2XY8A 3N4QA 1ZGAA 5GPCA 3CCVN 5BMZA 1S1VA 4F3OA 5GAEP 2P6SA 5L3BA 1NNEA 5B1AH 3I0RA 2W25A 1I1SA 1ZC6A 1X9SA 2CGLA 3CJ7A 1KU2A 3S16J 2P9LA 1SQKA 3AG2H 4CCHA 3ZQCA 3MCZA 3VFZA 3ZT2A 2E1OA 5MLCQ 1U45A 1FP2A 4LD5A 3ZSOA 5AR0A 2Q36A 1YOVB 4LITA 3U6FA 4DTMA 4GCVA 4FQGA 2L9NA 1VQ6N 2HNYA 3BUZB 3GWZA 1J53A 2EV0A 1QQNA 3CP8A 4IPAA 1HKBA 2A5YB 4BWJA 2D1VA 4Y4RA 5FLXO 4QWQA 5H1SQ 2DK5A 1HA8A 3VQ8A 2LBFB 2XO7A 3WG7H 4BRIA 3QYBA 3CMAI 1TLHB 2KJBA 3AKZA 1PDNC 3CFOA 1NK8A 4YIFA 3A5LC 4FWLA 4CZKA 3IRRA 4AVZA 4IQ4A 2QLZA 3I59A 4FE7A 2LKPA 2UXNA 3S2WA 2HHTA 1V54H 3CCYA 3CETA 5E3OA 5A2QK 2Z5UA 4OKJA 1WSHA 1FOKA 2DLLA 4O44A 5E8GA 4HV6A 1DPUA 3GUDA 3CO6C 2YHYA 4ESFA 4C8NA 3TTFA 5HP1A 2GZWA 1XX5A 4C9YA 4IJNA 1ZRCA 2WC9A 3D5LA 3MCAB 3DXMA 3FXQA 4ILHA 5AJ3K 4LB5A 4I2QA 3BWGA 3ZETA 1VSIA 1XI1A 1U49A 2XASA 4FM0A 1LW2A 1NJZA 3C0BA 4E4HA 3G1MA 1EETA 2DA6A 3TW7A 1SFUA 3VF6A 1BN5A 4IOCL 1BA1A 4NNJA 1HNVA 5DMRA 2ZKZA 3M8EA 5HRPA 4IO9L 1XN7A 1DU0A 5LEKA 1GVDA 3LSPA 3NQOA 2ZO4A 1R5ID 1OYYA 1WSEA 3CC4I 4XKCA 1FJLA 3V9WA 1ZR4A 2BGCA 4CJSA 3HO1A 1D8KA 4KUMA 2XUBA 4DQPA 1ORKA 4M3XA 3LP1A 3PJRA 1GLDG 3V42A 1YHQN 3VDXA 3F8CA 1REVA 4CEDA 3HDDA 1RDBA 1OCZH 1IW7F 2YU9J 5HLTA 3FBNB 1IKWA 2FBTA 3ISPA 3ZQ7A 1AKHA 2F5DA 1EO1A 1YRNB 3DI6A 3HTSB 4CGFA 4B9UA 1RT4A 4I2PA 1PUFB 3W6VA 3OL4A 4FLWA 1JL2A 1ZBUA 5EG0A 3FF5A 2IS1A 3RPUD 2P4WA 3J7YJ 4J2BA 1LWEA 3HUGA 1JKHA 5LGNA 4B1YB 2IGKA 2EINH 3FWEA 5EU7A 5AQVA 3FZVA 2VPRA 3AVNA 2WTEA 5M5YJ 3O4NA 4UY8I 4H4MA 1DP7P 1J5OA 5HS9A 1R5HA 2OAZA 5LFAA 4B9TA 4GO1A 2QUFA 2QKBA 1VRUA 4E89A 4QAGA 4CHPA 1T8IA 3TAEA 3RZOJ 1K8KA 2XAQA 1DTTA 3ZN0A 1T38A 4JN4A 4EZ6A 4BEHA 3CCLI 4LF9K 5F0XA 2CW0F 3QU3A 3EKSA 3CUQA 2R92J 4FJJA 4MDBA 3KZBA 4CO8A 3T19A 2J4RA 1BWFO 5J2QA 4OJRA 1R59O 5AQKA 2PX9A 1HKSA 4A3GJ 3G73A 4KITB 4HUFA 2NLXA 3U9GA 3AARA 4LF8K 4LMYA 3U3GA 1D0XA 1B4AA 2R5YA 2JSPA 5HBMA 3CQ8A 2A5XA 2KRCA 2XHKA 4DR3K 3EE9A 5BPMA 1T56A 4BL0B 4KISA 1KU9A 4XM3A 2F48A 4OKKA 1D9DA 4EJWA 1SFOJ 1JLQA 4XR6A 1OCOH 1ATRA 4NCBA 1C0WA 4H4OA 1SL1A 3THWA 2G7UA 3ML6A 4BXXJ 2QWLA 4JX5A 5KRSA 3J7ZI 4BYYA 3NH0A 2ZM6K 2KTQA 1T6SA 2A07F 2XAGA 4B3TK 5DS9A 2JGUA 2CV2A 4BRFA 2LF8A 3VQQA 4HHTA 5M5XJ 2Q2EA 5KK1A 3QFPA 4FX4A 4IXAA 3VEOA 1OKJA 2FRHA 2BXYA 1RDUA 4O3MA 1RBUA 4FJLA 2JT1A 3M8QA 3ZR8X 3CFRA 2PYJA 1XC9A 4GGGA 5F04A 4XLPF 2HMPA 3CJ1A 3MN2A 1ONVA 3O4WA 2G8FA 4W1UA 1OQYA 3K57A 4FJ9A 2HQAA 3AVFA 1W36D 1WNSA 3TR8A 4CCNA 2YU3A 2B0LA 2ETHA 5HRRA 4JKHA 4MHGA 1VSKA 4FM2A 1VQ6I 3MXMA 2V79A 5J2PA 1ZGJA 2UUCK 1UG2A 3MD2A 2E1MB 2D1KA 4ZTFA 2OCEA 3U1DA 1YVUA 2VT2A 4CK2A 1IV6A 2W57A 2D45A 1JUPA 3KP5A 3WUHA 1YTYA 2K9LA 3VEWA 1ON1A 3OYIA 4DBRA 1H9GA 4BS9A 1S22A 4Z94A 3RKWA 4JK7A 4BY9C 2RPIA 2E71A 3NRVA 2HFHA 3H1CA 2ESHA 4JKEA 4EATA 1FNNA 2F4OB 3K2ZA 2A42A 4DS4A 3QQAA 3V4GA 4J8FA 3D2FB 4KHQA 4DIQA 4YIIA 1RR7A 2KIFA 4CEAA 3S32A 1SFXA 4YOUA 5HVQC 3H08A 4GMJB 1XGNA 4Y33A 3TDZC 4QS7A 4FJIA 3F5TA 1SAUA 2Y2ZA 3AL0B 1YTUA 4BNCA 3CJAA 2QKLB 1WRJA 4H0TB 4XSXF 4FX0A 2HSTA 2XROA 5ERIA 3AO5A 4G6QA 3BPXA 3DKWA 2NRHA 2MH9A 3D0SA 1F4KA 1TYQB 5JVGL 1SC7A 5E17F 4U7DA 1V5EA 5EOYA 3FIWA 4B48A 3F8NA 2LR8A 1YW9A 4Q5SF 1W7PD 1FMVA 1VQPN 1VQMN 2M5WA 1MNEA 3ASMA 4RA2A 3M7GA 1YHQI 2XY6A 3ULEB 3ERED 3U9DA 3D5RC 4I6MB 1BQMA 2PMZA 2MSYA 5KHDA 4B1VA 2DXIA 3LAKA 5F27A 3OR2C 1IBKK 2JK3A 1X9JA 3KP2A 2KRFA 4XLFA 4OLAA 3UKRA 3T69A 4L3QA 2G8UA 4RDUA 4AIKA 1GOCA 2CH0A 1IKXA 2IC3A 2O6GE 2W7NA 4M3BA 1S1XA 1FYKA 4LG3A 1LJ9A 1FYLA 3V1OA 1KAZA 2XSJC 2P7CB 3E5UA 1TBXA 1VQON 4BRCA 3DBRB 1RGIA 1VQ4I 3BCBA 2XKOA 5IP9J 3QNOA 3H9JA 1ZGWA 4NYFA 3W0LA 1KLMA 2M8EA 3IUOA 2OZUA 2YNHA 3ECOA 1YXQA 3NF9A 2VE9A 2UXCK 4HQEA 3PSFA 2OZ6A 1AA7A 5AZIB 2K9MA 3K5OA 2FBXA 4FL9A 1I1GA 5J2MA 2E19A 1WJCA 1X19A 4DQ8A 1NLVA 3AA4A 3BF1A 3OR1C 4B1ZA 2EA2A 2DMTA 1W0UA 3NAEA 4HDVA 4B47A 2GWKA 2KQ2A 1ZELA 4D7NA 3UKUA 3V9SA 5E18F 4AIDA 4D1QA 5I9EB 2Z3YA 3F6OA 2L4AA 1J0RA 3HYIA 3MN6A 4KT6A 2EZIA 2L7MP 1UAAA 4HOBA 4AHTA 1YS7A 1A6QA 2XAJA 4MTEA 5AQLA 2BV6A 4JKFA 1E3PA 4Z4GA 3ZMDA 4B3AA 2ZSIB 1MMDA 5SZTA 1RZ4A 4YFKF 1C1CA 3ULDA 3FMRA 2C6YA 2WC2A 3DXMB 3CI5A 3GTPJ 4X0GA 2YHBA 3OV8A 5FKNA 5D5VB 1RNHA 3NWSA 2Z1JA 2KFNA 2GEMA 4M9SA 4G7OF 2Z1GA 2STWA 2LSOA 3DLEA 4KTQA 4EIAA 3DLLF 3CDLA 1X3UA 4BG8A 3VGKA 3LDOA 1OCTC 5L3CA 1ODDA 1DKGD 2EIKH 1V3FA 4BVOA 1Y56A 2E2PA 1VQKN 3IRQA 2Q0UA 3GMEA 1WN7A 3DU5A 2Y75A 1E4GT 3HL8A 4FWMA 3NVKA 5CVJA 3CZ6A 3FM5A 2H8WA 1NGGA 3A5OC 1MMAA 4BRNA 1QHHD 1X4PA 3B6CA 2XKPA 4A2AA 5BN9A 1X4OA 4PQUA 2WBNA 2WUSA 3SCXA 1GLFO 3DOLA 2RREA 2YHAA 1MMSA 3BJOA 3LPUA 3RKYA 1TQMA 2NS0A 2ZGYA 3H9GA 3PX6A 3ABTA 1Y0UA 4TV7A 3OYCA 4XK4A 3CD6N 1GV2A 1GXPA 4RB1A 5C0YA 5E41A 1RBRA 1DT9A 3KK2A 3F3XA 3WXIA 3QAHA 1S9EA 4ZHRA 2AJQA 2VQHA 1D9FA 2O4IA 1V4TA 3AO1A 4AU7A 3L2RA 4LF6K 1ATNA 3EZ5A 2JA7J 2NS8A 2HZTA 1NJIO 1XHXA 3FZMA 3J81Z 1O4XA 1WGXA 5J4YA 4CHUA 1JHHA 3DRRA 3QIPA 1G2HA 2NNYA 2VL8A 5M1NA 4O5VA 4G1QA 4LG0A 5CY4A 2LVSA 2V1NA 2L01A 4CZJA 4NLCA 3WEEB 5J8CA 2F4MB 1NJXA 3TI0A 1NJYA 5DK5A 4H8KA 3W3CA 4A12A 5E3LA 3ZQFA 1TAQA 1EH7A 4FWQA 3TAPA 2VI6A 3OYFA 3F6VA 1S72N 1ZBIA 2Y1IA 3MZHA 2ADUA 2ECCA 1TKZA 1D1AA 3J80K 2WY8Q 2LY1A 1IV8A 2R7FA 4K8ZA 1CQTA 2PFUA 5FRNA 3Q7CA 4JP0A 2UXDK 1VRTA 4H0EA 5E26A 2GQQA 2VB6A 4H0VB 1Y97A 3NMUA 2R7XA 3ENOA 3GTLJ 2X6XA 1KYZA 2VGNA 3G25A 2DK8A 1XWLA 3ENBA 5D8KB 3SUNA 5L3FA 5FKLA 3AO2A 4XONA 1VQPI 1VQMI 1BR4A 2IRFG 3KVGA 2VCPA 4DYCA 1U8BA 1IH7A 1FTZA 3CMEN 1IN4A 1MH3A 3CDIA 4XN0A 3WGHA 1HDPA 2ASPA 5JVHL 2FSKA 4BRHA 1AWCA 5GTIC 1JI8A 3MKLA 4BY7J 4EJOA 4WXDA 1DPRA 1GV5A 3E3VA 5GAEJ 4ABZA 3QODA 4DTSA 1OH7A 3A0BC 3C65A 4F4KA 1TK8A 2CYYA 2ACJA 1VQOI 1IF1A 4WFBL 3OW2M 4FCYA 1I39A 1TWGJ 4F2SA 4EM0B 3PFYA 3K5LA 1BW6A 2BOLA 3BDDA 4XLAA 4E19A 4HEA2 1R6RA 4DSEA 2P9SB 1ACIA 5M1KA 3E6BA 5AQXA 1UCRA 2QEXN 2HTJA 2CSOA 4F3QA 2R4GA 5IP7J 2GELA 5L3GA 1CZAN 1T33A 3L9FA 3MAQA 4DU4A 4N0BA 2E2QA 2CMPA 3OIPA 1OISA 3OBYA 3PV8A 2HYJA 3ZQLA 2L3DA 2XGDA 3L2WA 3K1PA 4LC9B 2O9LA 2CRGA 4GKKK 2PLYA 2FE3A 2BW3B 3TP0A 3CUOA 2QBYB 4CHNA 4DR7K 4M73A 1Y1VJ 1TGOA 3R0AA 2WBMA 3WU2C 1MNDA 2X9DA 4DV7K 1Z7LA 1MGTA 2CV0A 5HDNA 2Q1ZB 2A3SA 3SBGA 1FP1D 3VESA 2L0KA 2R7OA 3VQAA 4IEJA 3J7AP 5CVVA 1VQKI 3U3YA 4JEPA 4KHYA 1R1VA 5AFUH 3DXKB 4B9LA 3A2FA 3C2BA 3K5NA 3RMAA 1VQ7I 1LE8B 5FD6A 3V8JA 3DMJA 4I0AA 1BISA 5GADP 2EFNA 3CYMA 3OYEA 4CCLA 2FBIA 4FJ5A 3JRDA 3MK6A 1O1WA 3GTJJ 1HUXA 2ASOA 3OYLA 4F8RA 3WQUA 1JLBA 4JI7K 3ID8A 1I6HJ 2CG4A 4CA0A 3CD6I 3T5XA 5HNHA 2CU7A 2F5VA 2H27A 3TAFA 2L9VA 2HKXA 3HSFA 1LOTB 4DV6K 4CD1A 1Y0NA 4CF8A 5JLFA 3V9XA 3TO7A 2HVHA 2VUMJ 1HNIA 3ID6A 2ZXWH 3BGRA 2UXXA 2K27A 1JGGA 5EGOA 2CW7A 4Y1CA 1ULYA 4CEEA 1YAGA 1W5TA 4FASD 4C3IJ 2QWWA 4U7BA 1S1WA 1YG2A 2ATQA 3ECHA 4JI2K 1GOAA 3MKYB 1G3WA 2CW8A 5KGXA 2HNHA 2WOMA 3TARA 2LKXA 4EFHA 3FHZA 5EEAA 3Q3SA 1RETA 3PIOF 1QQMA 1J9IA 4BUPA 3U2RA 3KYCB 2KW4A 3A01A 2IT0A 1JT0A 1HJOA 4CF0A 2LD5A 2A1SA 3SZTA 3BROA 2P5GA 1S72I 3T8TA 4HNUA 4CZMA 3ZT1A 1RBSA 2E8AA 4DQSA 4BC2A 1F1ZA 3S1QJ 2EIJH 2A6AA 1Z0XA 4I98B 4MDAA 4F2RA 1VQNN 3HM5A 3IAS2 1D1CA 1G3YA 1NU0A 3EN9A 4P55A 1DEJA 1Q82O 3KKRA 3P83D 2E2IJ 4L8RB 2W41A 3I55N 1ENHA 1YLFA 5DTDA 2D0BA 1P2FA 4C2UA 4B9QA 1ZXOA 3SK3A 5L3DA 4NO7A 5J3LA 2CQNA 4M7YA 3SMPA 1A35A 5D6EA 3N05A 2D2WA 1JT6A 3CMEI 2DT5A 2Y69H 4N56A 4BY1J 1W36C 4B3XA 2E2OA 2AXLA 2KL4A 2QENA 3RMBA 1R4MB 2HF4A 4YIRX 1W5SA 4C8OA 3I8DA 1WUAA 3F9MA 2QSFX 3GXOA 5FO5A 3VPZA 4M6XA 1T39A 4C8LA 3ZXSA 5KQDA 3FK6A 4C30A 2OTLN 1EA3A 3MWTA 3OYAA 2FBYA 2PJRB 4CGJA 1ETOA 3WXMB 3VQ7A 4BJTA 4HCCA 1IG9A 2YJFA 1QVGM 2ID3A 2VN2A 3O3HA 1XSXA 3T1BA 5F0HA 1NWKA 4M3YA 3SDGA 1FPQA 4H03B 1XSDA 4KMFA 1BR1A 4MLOA 5FPDA 2LMDA 2VXDA 4H5RA 4AYBA 5EZHA 3L2CA 1CGPA 2QEXI 1U2VB 3E66A 3HPOA 5AQRA 3GZ5A 3OL3A 5FJ8J 5C24A 4KT5C 5D4RA 4DSLA 2ME6A 1R22A 4FWPA 1ZRFA 2EH3A 2M0MA 2QM3A 1X3NA 2ZFUA 3G3ZA 3TSQA 3EETA 4N4NB 1QVUA 4CCOA 2DOAA 4GY2B 4GFBA 1ZYRF 2LDUA 2M8GX 3K59A 1BHLA 3T1YK 3GFIA 2HBJA 1YTAA 1XHZA 3W6JB 4CUGA 1ASVA 4N4OB 4M3ZA 5FLXK 3FDYA 2RC4A 2RE2A 4A3IJ 3SMSA 4RW7A 4E1NA 2RV8A 1YUWA 3CIPA 4F3TA 1FJGK 3SQ2A 2ELKA 4M3RA 4OAZA 4YRVA 1QPIA 4BAYA 1Z26A 1BCMA 4CHOA 4BR2A 1KRPA 3OSFA 4PWDA 4CJ5A 2I7NA 3V1QA 2B7EA 2K7LA 3BC8A 4P1WA 1FIAA 3I56I 1TNSA 4X64K 3AV9A 1ILYA 4WQ4A 3TOAA 3ZQQA 3DXJF 2FEZA 2V6CA 5J1RA 1N77A 1EQYA 3ZMSA 2X74A 4Z4IA 2GWRA 5C4XJ 3NBPA 1XB4A 2AQEA 1VSLA 4DFMA 5BNGA 3ASNH 3DKYA 1ZG5A 3NF6A 3WNHA 2AO9A 2G8HA 4HUGA 5SWMA 5IT9Z 4CZEA 5DD4A 5HLFA 2JPCA 4JI4K 1WWXA 1Z7UA 5M5WJ 1H9TA 1E3MA 4DYRA 4CVNE 1NGIA 3LAPA 3E7LA 1HKTA 2HVSA 4KH6A 1VQ8N 3H35A 3O9UA 2XAFA 4C2MJ 1YJNN 4DFKA 4LIUA 4YOWA 2ZD1A 4KFCA 2D1HA 5M1PA 3DQVC 4AHUA 1TL1A 2E5NA 4QSHA 3V9ZA 3SLCA 2XPVA 4LFUA 3B6OA 4FW2A 2ZXHA 4PZJA 1LV5A 1VTNC 3R4KA 3LA3A 2Q8KA 3KFWX 4AM3A 4OX9K 3DLRA 1TW3A 1W0HA 1FOXA 3SDBA 2JZYA 2L7KA 3A1YA 1YW7A 3GZ6A 4DTRA 4FLTA 1KAXA 4PSWA 1K6OA 4C1NI 1SFEA 1I3AA 1IZ1A 5EVZA 4RAZA 2D0PA 4JBAA 1KXPA 1HCRA 3VN5A 3JRBA 5M1FA 3DWLA 4HAMA 2FX0A 4X6AJ 1LAVA 2PI0A 1R5GA 1C0TA 4RGRA 4JHDA 4H5WA 4W5RA 1XMQK 2DW4A 3S1MJ 2ZNYA 4CJKA 3K5MA 3PUBA 3KD5E 1MDUB 1LFUP 1MSEC 2LKSA 1VQNI 3KLFA 4CJFA 3K4NA 4OGEA 1TZLA 4LSNA 1WI3A 4LH5A 5AQGA 4K0KK 1C1BA 3ZSZA 3CDHA 1W0TA 2GXAA 3IWFA 3ABLH 1OYIA 5CVUA 5AQUA 1S1UA 3L3UA 3CP2A 1D5VA 4BREA 1XGMA 4JK9A 3G2BA 4P96A 4BXFA 3S2HJ 3EUKL 3NGZA 5LJWA 5HLIA 1NH3A 1OVQA 4BQLA 4B8CA 4KKOA 1T8EA 4MLEA 4XEIA 3KX2A 5BREA 3AVBA 3H5NA 4CZGA 4HLXA 2ICWG 4FLUA 3OYNA 2ZCWA 2UV1A 4U0WA 1SV5A 4BC3A 3GO5A 5C15A 3J7YP 2RVCA 2X48A 1U47A 1WAJA 2KT0A 4ENJA 1Q81O 4ZH4F 2L7FP 1EH6A 2DDBA 4B8XA 3K7AJ 4MFDA 5FDLA 5LRRA 1P4AA 3TAMA 4B1RA 5ILVA 1QQCA 3RPUA 3O1BA 2OTLI 3T8RA 3C6HA 3I8BA 5C44J 5GINA 1ETQA 1TT0A 2Y48A 4L5EA 4A3EJ 5ICEA 3RSNA 1RTIA 3M8JA 2JRTA 4LLNA 3NF8A 2P9NB 3S2DJ 1AHDP 5FFXA 1R1UA 3DTKA 4UVBA 4M9ZA 1KC8O 3EPZA 4BHPA 1UZCA 1H88C 3HJFA 4AUXA 3K2AA 1YIJN 4MQVA 1QTMA 1B59A 4RLQA 4WXHA 2M87A 5HL7L 1SD5A 1FBQA 3F2KA 2CUEA 2OZSA 3KYLA 3IRXA 3VQ6A 4HRIA 1Q9XA 3V7CA 1MSFC 4PJMA 5JS1A 3C2HA 5F08A 3LDLA 4FWRA 1B8IA 1O3RA 2VBZA 3DRPA 3PIOL 3WODF 1FSEA 3VETA 3WU1B 3COAC 4OKEA 3BZ6A 4BHBA 4FTHA 3GBTA 2QKKA 4M7XA 3V4IA 4R1HA 4M3WA 3P4IA 2RDPA 1W97L 1WH5A 1RT1A 1TL3A 3FXJA 2GA2A 4YOXA 3HRUA 1ZR2A 3DM2A 3MN9A 1HNWK 4DQRA 3R6MA 4ISFA 2K9QA 2Y30A 2PBDA 2HBKA 1QHAA 4DZJA 1J5EK 4UUVA 4XH5A 4UNOA 4CBWA 3BOQA 3RPQA 1VHXA 3THYB 3QWLA 4D5FA 1GXQA 3O80A 1L5UA 1QS4A 3NVMA 2E7WA 3Q5FA 4XKVA 3I71A 4I2OA 1WSJA 4HPQA 2JWKA 1E3OC 2M3AA 1VAZA 3A8YA 1OMIA 2BDPA 2YS9A 3KIOA 3GTKJ 4A5AA 4ZZLA 1VQ9N 4ASNA 4UQGA 4CD3A 3LWFA 5FPNA 2OJED 3NGIA 4D9JA 1D5YA 3IL2A 4CBUA 3M6GA 1HQCA 4RAFA 1NG6A 4ZYDA 5J6XA 3TTDA 5D5WB 3CCEN 4ZYHA 3REOA 5J47A 3HEFA 1WSGA 1WBBA 2HNZA 3KLNA 4II3A 5KPZA 3T1HK 1YJNI 2QQBA 2FF4A 4CCKA 1G6NA 1Q1HA 1HNZK 5ILSA 4ZC3A 3VYTB 2KHOA 5K14A 5FROA 4ID1A 4AIHA 3FBIB 1X9WA 1ETXA 5F1RA 3O1WA 4NUBA 6PAXA 3TMOA 2GTDA 2ZBKA 2DOFA 1DQUA 4QPQA 5EJCA 4FW1A 5HOOA 1HYZA 4UV8A 1ZREA 4HWIA 2P7VB 2YR2A 4CERA 2YJEA 1HR0K 2NVYJ 2KISA 4II2A 2LK2A 1NM1A 2A6HF 1MMNA 2JSCA 3VMFB 3ZX2A 2RQPA 2NVTJ 2QXLA 4XL9A 1QNTA 4OWRB 3WGIA 5HNFA 1F9NA 2HEOA 3MAJA 3KEQA 2O8DB 2ZJRF 2YHXA 5BPNA 4BXUA 4ITVA 3F9KA 4B3OA 3NE6A 1N5YA 5E79C 1MJ9A 3FFIA 3ELKA 3CCUI 1X1AA 3OJUA 3NF7A 2JA8J 3VEYA 5H20A 4KBOA 5HROA 4NQWA 5E1ZB 4CJTA 4BH9A 2CQ7A 3Q9VA 4M74A 3PIPF 1TNTA 3JAMO 2O8XA 3HSEA 5AQWA 1J09A 4J2AA 4BQZA 2H6CA 4DJAA 2IS2A 3PNTA 4N76A 5CVIA 3HGYA 1JKPC 4UVAA 4G12A 4OU0A 3CQXA 1MBFA 4O5BA 4DTNA 4YOTA 3RIRA 2GXGA 4WFNL 3BR3A 1L0OC 3ZSQA 1JJ2M 1N34K 4B3MK 4LOCA 5GADJ 5ADXA 3ZPLA 2ZE2A 2I8DA 3WT0A 2DY4A 3LNQA 4JI0K 4C2TA 1JCFA 4PK4A 5CLSA 2A6TA 4FT8A 5D6FA 1WJ5A 1XPXA 4NC7A 1IUFA 4IX7A 2FBKA 3AVAA 4M3GA 1F5TA 3IAYA 3H5AA 1LWFA 4RGXA 1P9QC 3SXYA 2IA2A 5A2QZ 3BG9A 2O8EA 2KLAA 3PNVA 4Q4ZF 3G6EI 5K7HA 1PJRA 1TV6A 1LW0A 4BWMA 4DTOA 1U2WA 1NMDA 4BR7A 1YIJI 1TC3C 4ISEA 4O5FA 4HZFA 3VPRA 2R0QC 3HKZA 4OINF 3L2UA 3HBTA 4OPHA 1TP4A 4DQQA 5BQTA 1ZG1A 1QBJA 1IRFA 4A93J 4ENMA 2XF5A 2DTUA 1K78B 1T03A 3K9JA 1S29A 3RSEA 1IXRC 1QU3A 2ZFWA 2GIVA 2K9NA 2W00A 3QEPA 4GDFA 3DJCA 3KLIA 3JSMA 2Y0SA 1F36A 2HPIA 3CO7C 1HKCA 2KZVA 4Y17A 2CGPA 3QMLA 2CGKA 3H3OB 1OH5A 5AZJB 2CJJA 3M1EA 2B9SA 2WONA 5K1YA 4R5PA 4XBFA 3ZSWA 4JKGB 3BEXA 2UXBK 3QERA 4JD2B 1ZARA 2GX9A 3K2PA 5FPMA 4K42A 3LWMA 3OIOA 4JI8K 2I10A 2HYGD 2PMZN 4BE1A 4Z2YA 4XSZF 3C7NB 3Q0VA 1QZYA 2F8TA 3J7AY 1RT5A 3T7ZA 1J75A 2P9UA 1G3TA 2ZMEC 5BN8A 1OLTA 2BANA 3JSPA 1LDKB 3ULQB 3X2QH 2HTSA 2O03A 4XQFA 1MMGA 2Z99A 3LSMA 3UE5A 3HOSA 1B72A 4Y0WA 3GTQJ 4JRQA 2MC3A 2KRHA 2G7HA 2K3PA 2XAHA 4A3MJ 5AQQA 2HMIA 4O4GA 3PFIA 4ZDOA 3B8AX 3LAJA 3R6SA 1VQ9I 1IBMK 2O8FB 3A03A 2QCOA 4YOYA 1JCGA 3SZPA 3S93A 3C1DA 2P9KB 4F91B 4ZYGA 4W97A 2LTPA 3CCEI 4S05A 2BY1A 4DQIA 5FLMJ 3H5RA 3OOUA 3HHHA 5C42A 2XDVA 4DLEA 1NK5A 3V7RA 1CF7A 1QQOA 2BVMA 2EILH 3VF2A 1EJ9A 2QWOA 1I94K 2F9WA 1TQIA 1PP8F 4DKWA 1FXXA 3DYAA 3PQJA 3K58A 3IS9A 3HM9A 1S6PA 2X85A 5FKMA 1ZTRA 3VQBA 3WE2A 4ISGA 1K73O 1A5WA 3WTVC 1NGFA 2R3SA 3OYMA 4QTRA 5JLHA 1B6AA 3P7NA 1ASWA 3M07A 3CCLN 1K9MO 1JUSA 3E6MA 1TL8A 1ZK8A 4CYCA 3RKQA 4CDGA 2F7TA 3K4JA 3TANA 2JUGA 1D4XA 1FIPA 3E6CC 2X6OA 4NLBA 1DDNA 3HP6A 1IN8A 3J8AA 4C3HJ 4FISA 3QP6A 2Q3SA 3AO3A 1R49A 3RR8A 4CJPA 2FMYA 3Q7BA 4PJJA 1OCPA 4L9VA 1MBEA 4DHYA 4A6EA 2X78A 4M42A 1OKRA 3LA2A 5FLVA 3ZT3A 1E2XA 4GRIA 2VQGA 4LGWA 3HP9A 3O2PE 4DTXA 2E7XA 4EV0A 3DLBA 4EJVA 2XF7A 2AP1A 2R7DA 4CJRA 2GA1A 4A3KJ 1UJ8A 4EJTA 4CGZA 1SD6A 5LY3A 1QE1A 4E6KG 1FWZA 3VTIA 4KIFA 1BI4B 1YS6A 3LWLA 1SFKA 2AS5F 5AIQA 4I9LA 4CHYA 1D8JA 2ME0A 3R60A 2GOMA 1HSTA 3CJCA 4PCQA 3WNFA 2PEXA 2EV5A 5CVRA 2QSHX 2VE8A 4CEOA 1YX5A 4LF4K 1HLVA 2GUPA 1KTQA 5CPRB 3ZX3A 4LY7A 2HOTA 2L5QA 2PQ8A 3GFLA 3C3WA 1VQ5N 3NHGA 4XIDA 2FNAA 4O55A 4BG9A 1FMWA 4BROA 3F8MA 4CYDA 4D0PA 1BW5A 4BBSJ 4JI3K 4IEEA 5IWAK 3DPUA 1BOTO 3DLGA 1IC8A 2Z9OA 1OJLA 3AGKA 2DFIA 4CIFA 2NOGA 3TWHA 4F9OA 2UYTA 4KH5A 1DGRM 1IDZA 2DA5A 2A3ZA 2QVOA 3MEEA 4B1XB 1EWRA 4KYWA 1JCEA 1W1WE 1VFCA 1MBGA
chains in the Genus database with same CATH topology
3O3GA 3NGYA 5C24A 3V9UA 2VWJA 4B9NA 1TV6A 1LW0A 1NJXA 1S9GA 2HHUA 1S1TA 4DSLA 1JL1A 4J2EA 4AHSA 4HUFA 4FK4A 1VSFA 4BWMA 4FJMA 1VSMA 3QIOA 4DTOA 2KFZA 2R7YA 3RRGA 4Z4GA 1L3SA 4RW4A 3U3GA 4BE2A 3PV8A 4I9QA 4CEZA 5SZTA 3CM6A 1NK9A 1ITGA 1GOBA 4Z4HA 1C1CA 2OZSA 3IRXA 3VQ6A 3ULDA 3OS1A 1Q9XA 1W9HA 4M41A 5HBMA 3OYGA 3MEGA 3CQ8A 2XHBA 3AVKA 3RRHA