2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
5C25A 4N76A 1TKXA 4DTRA 2VWJA 4W5TA 2Y1JA 2B4JA 3HSTB 4FK4A 2HHXA 4FJNA 1SV5A 4CGFA 4PUOA 4E19A 4PY5A 1I3AA 1WSFA 4ICLA 3PX0A 3TARA 2O4GA 2OPPA 2OPQA 2JLEA 1RBTA 3MEDA 4DTPA 2HNYA 1KLNA 2G8HA 1BQMA 3HVTA 3ZT0A 5C42A 3D0PA 4CJUA 4DQPA 5J2MA 3V81A 5CYQA 5CZ2A 3OJSA 4OJRA 2HHVA 2A1RA 4CESA 4CIEA 4O0IA 3HK2A 1YTUA 1QE1A 3QINA 1IH7A 3OYEA 4F3TA 3U3YA 1HNVA 4DSJA 3VQ7A 5J2QA 1YVUA 3OY9A 4E7IA 3FFIA 2DFFA 3DLKA 4KKOA 4CIFA 1C1CA 4HTUA 3RMBA 2HHTA 4DTNA 4YFUA 1L3VA 1IKYA 2X6SA 3AVFA 4GMJB 1J9AA 2FBYA 5CY4A 2BANA 4DSIA 1L3SA 1VRUA 4RW4A 1EKEA 3MEGA 1U04A 1S9EA 3KK2A 3L2WA 4ID5A 2KQ2A 4NCGA 2ZQBA 1TKDA 3SNNA 4O4GA 3LWLA 1BISA 2HHUA 5HRRA 1NJYA 3SCXA 2QXFA 4RW7A 3ZSYA 3DRSA 1NJWA 4J2BA 1JLEA 3V1QA 1KTQA 4DWIA 4N47A 1RTJA 4E89A 3OYJA 4M3YA 1JXBA 3ASMA 4OPJA 2P5GA 3SQ4A 1S1XA 3QEVA 1WSJA 4IFYA 4CJ4A 1ASVA 4FVMA 4TSXA 3V1OA 4FLUA 3V9XA 3NGYA 4IKFA 1KVBA 3SI6A 1C0TA 1RT1A 1SL1A 3MXIA 3DLEA 2IGIA 1WLJA 3TAFA 1VSDA 1NJZA 4FJXA 5FRNA 3DLGA 3DI6A 3QO9A 3PV8A 3CYMA 1JLQA 4Y1CA 3LZIA 1RDAA 4KHQA 4DLEA 2OZSA 4CJ3A 3KLFA 4DS4A 3RR7A 4CF0A 1RBRA 3T19A 4CJSA 3DOKA 3QNOA 4E1MA 4B9MA 3KD5E 3O3GA 2XY6A 1CZ9A 4LD0A 2YHAA 1EXQA 4FJMA 1GOAA 3AV9A 3EZ5A 3ZSQA 3SQ0A 4OLAA 2FBVA 3S3MA 3U6FA 2YKNA 1NOYA 4C8OA 2WOMA 3VQDA 1JLFA 4KTQA 3SQ2A 1NK9A 3AA2A 1WSIA 1LAVA 3DM2A 4HVJA 4KV8A 1WAJA 2HHWA 5HRSA 3M8PA 1A5VA 2BGGA 3VQQA 3EYZA 3O4QA 3VQPA 4ELUA 4Z4EA 5KGXA 3ZSOA 4M45A 4LH5A 3T1AA 2PY5A 2ETJA 3NF9A 3AA5X 1VSMA 3SZ2A 2XHBA 3C6UA 1RT5A 3OYDA 3L2UA 4OPKA 2F96A 1CZBA 3OJUA 5J2PA 1D9FA 1BQNA 3AO5A 4I9QA 4FJ7A 3O3FA 1U45A 3MAQA 4DFKA 1EETA 1G15A 4R5PA 1T7PA 3PY8A 1VSFA 2VG6A 3LP0A 1WSEA 2Z1JA 4PA1A 3ZSWA 3RR8A 1DTTA 4MFBA 4CERA 1HPZA 5J1EA 1L3UA 3DLBA 1KVAA 4B8CA 2P1JA 2PYJA 3LALA 4CEOA 3SUNA 3MEEA 1QHTA 1TKZA 4KPYA 3OVNA 3WNHA 3LPUA 4O5BA 4CJPA 1RDDA 3AVJA 4CGIA 2FBXA 4W5OA 3TAEA 1JLBA 1L5UA 1LAWA 1RBUA 3OYMA 3PX6A 2QKKA 4CGHA 4DSFA 4B9SA 3AVAA 3SPZA 3THVA 3H08A 1RILA 4CJWA 1UWBA 4KI6A 4M3UA 4F4KA 1BHLA 1KVCA 4BDPA 2LSNA 3KLIA 4LSNA 5DK5A 3ZSVA 5HRPA 1X9WA 4AHSA 2YHBA 4OKEA 4DFMA 3SYZA 3KLGA 5I3UA 3TANA 4HCBA 3HO1A 3VQ5A 4W5RA 1X1PA 2B5JA 4G1QA 2FBTA 2RN2A 1TVRA 4OGCA 4B9TA 4DTUA 4HUGA 1TL1A 3I8DA 1JKHA 4OKKA 3QNNA 3HYFA 3TABA 3V9SA 2X6NA 1B9FA 4DTMA 4KREA 4RW6A 3SUPA 4WE1A 1WSHA 4DU3A 1KLMA 4PWDA 3HL8A 1FK9A 4FJHA 1ZBLA 3ZCMA 4E7HA 2G8UA 3JSMA 3G0ZA 3L2VA 2D5RA 1HNIA 1ZBUA 4FZYA 3LP1A 1IKWA 3AVGA 3P5JA 4RG8A 4O55A 3EY1A 2DTUA 2YKMA 3NF8A 4JLHA 3P1GA 4CJVA 3VQ4A 3SV3A 1QSSA 2OA8A 1Q8IA 1U49A 4CCHA 2XY7A 1LW2A 3QIOA 4K8ZA 1VRTA 3VQCA 3OYGA 3HVRA 3PX4A 3SQ1A 1W0HA 4H4OA 4KAZA 1XHXA 3LP3A 4DG1A 2WONA 4DMNA 4M3XA 2G8IA 4LH4A 4B08A 4QOZB 1J5OA 2ITGA 3VA0A 1YT3A 1HQUA 2BE2A 3RMCA 4RW8A 2XY8A 1WAFA 1SKWA 4JRPA 4CFBA 3L3UA 4KB1A 2IC3A 4BDZA 4YNQA 2BDPA 1JLGA 3LP2A 4M3TA 3TR8A 4JS4A 3ITHA 3UIQA 4FLTA 1IG9A 1KCFA 3PUFA 2GUIA 1RCHA 2RKIA 4CJQA 3V1RA 4FCYA 3RTVA 1TK8A 4L8RB 2HNDA 4CEBA 1QSLA 3B6OA 3QIPA 4FLVA 1U4BA 4Z4FA 4CJEA 1J53A 4FW1A 5KRSA 3V9ZA 3V4IA 4F2RA 4NCAA 3HJFA 3K58A 3QEPA 2IOCA 4CHZA 1LW0A 3DYAA 4GW6A 4GVMA 4OLBA 3DLHA 2VWKA 3NFAA 5HP1A 4AHCA 4AHRA 4N56A 2P5OA 4KI4A 1CXQA 1HRHA 3AO2A 4CEZA 2XO7A 2D0BA 3SUOA 1NK7A 4DFJA 2G8FA 2G8WA 5JS1A 3AO3A 1RBSA 1NK6A 2GBZA 3AVMA 2B6AA 3AVCA 4O0JA 3NH1A 2RF2A 4QCLA 3LWMA 5FRMA 4MQ3A 2YNGA 1GOBA 5HRNA 3HT3A 1NOZA 3ISNC 1IKVA 4EP5A 3NHGA 4E7JA 4O44A 4Q0BA 4CEFA 3M8SA 1NKEA 4DTXA 4FM0A 1TGOA 4W5NA 3M8RA 1NKBA 3KD1E 4KHYA 2GV9A 1RT7A 3TAPA 4DTSA 2HVHA 1WN7A 5FROA 4FLWA 3SJJA 3HPGA 1J54A 2YNFA 4DSLA 2IS3A 1BI4B 3C6TA 3TAQA 3NDKA 1YTAA 2HVIA 2RPIA 3VQ8A 4DSEA 3ZT3A 4IFVA 3HP6A 4F2SA 4ID1A 4N41A 3I0RA 4DSKA 1LWFA 4E1NA 1BIZA 3DLRA 4FLZA 3K5NA 3I0SA 4KB0A 3HPOA 1O1WA 4Q5VA 3QEWA 3OYFA 4EP4A 3NE6A 4M3WA 4M41A 3DRPA 5SZTA 4DTOA 2VG7A 1XC9A 4C8LA 4FJ5A 4Z4CA 2EX3A 1FXXA 2X74A 1RDBA 1JL2A 4BE2A 3WNFA 4PQUA 1X9SA 2HW3A 4FZXC 4I2QA 3AA4A 3LZJA 1TK0A 1S1VA 3OYBA 1RBVA 4C8MA 4BE0A 4KHUA 1TAUA 2F8SA 4FLXA 1B92A 4Y1DA 3KJVA 3ZT2A 2W42A 3C95A 1DLOA 1VSIA 3SUQA 3RMAA 4N5SA 1XI1A 3VQAA 1ASUA 4J2EA 3RRGA 2HHQA 1UA1A 1VSJA 4NYFA 4FM2A 2QK9A 1S5JA 1VSLA 3HPHA 1WSGA 3LDSA 1BL3A 2R7YA 4CHNA 4FJ8A 1C1AA 5D3GA 5J2NA 4HCCA 4CF9A 3OYKA 1DTQA 3CFOA 3DOLA 1NK8A 1VSEA 3C94A 1RTDA 1RNHA 3ZSZA 2QKBA 4W5QA 4M42A 2KTQA 1QTMA 1Q9YA 3P83D 2HHSA 4CFAA 3IG1A 1S6QA 4CJFA 3KKSA 4OKJA 4E7KA 1NKCA 3RWUA 4LY7A 3OYAA 1B9DA 3ZSXA 4CE9A 3HXMA 1ASWA 1VK0A 1ITGA 4CGDA 1EX4A 4KHSA 3L3VA 2VG5A 4RW9A 2ZD1A 4Z4IA 2KFNA 3PO5A 3OYCA 5FDLA 4I9LA 4B8AB 4KHWA 1HQEA 1A5WA 4Z4HA 2YV0X 1VSHA 4XIUA 2XRIA 4JRQA 1D9DA 4EZ6A 3D45A 1LWCA 4F3OA 4Z4GA 2IDOA 1TK5A 1S9GA 4DF4A 1S1UA 3TI0A 2Z1IA 4OVLA 4CJLA 2FC0A 4CJRA 3V9UA 3O4NA 2D0CA 1X9MA 2PZSA 3ZSRA 4CHQA 3TAMA 3F9KA 1MU2A 1RDCA 1Z26A 3VQ9A 3E01A 4FLYA 4BACA 3QEXA 3V9WA 3K2PA 3MXJA 4CEQA 4J2DA 4FK2A 1SL0A 3RMDA 3LAMA 3K57A 3K59A 1QQCA 2Y1IA 1JLAA 4CHYA 4FYDA 1RTIA 4OGEA 2EHGA 3VA3A 5K14A 4FK0A 3MECA 2KZMA 1ZBIA 4AHUA 2E4LA 2NUBA 4ZHRA 4BE1A 1U47A 1T03A 2HB5A 4NCBA 1HYVA 3WNEA 4IG3A 4FZZA 1C1BA 2Z1HA 3F73A 3RRHA 4E3SA 1R0AA 2ATQA 4FJKA 4BWJA 4DQRA 5JS2A 4UQGA 1SKSA 3VN5A 2OYQA 2DFEA 4B9NA 4CGGA 3AVLA 4CJTA 3AVIA 3OYHA 1QSYA 4FW2A 3AVNA 1UA0A 3AO4A 3LAKA 4ZTFA 4B9VA 4E0DA 1NK0A 1BCMA 1UOCA 3CQ8A 4IG0A 2OPSA 3SV4A 1JXEA 4FJGA 4KHNA 3NF6A 3QESA 1ZYQA 5HLFA 5CZ1A 1Z25A 5KTQA 3KK1A 3NF7A 4BDYA 1K6YA 1NK4A 3OYNA 4DFPA 4I7FA 4KFBA 4ZTJA 4LSLA 5HROA 1EP4A 2PYLA 3CG7A 1QS4A 4KO0A 4CFCA 5E41A 3OYLA 1L3TA 2Z1GA 4CEDA 3NGZA 4CK1A 3L8BA 3OS1A 1KRPA 3AVHA 3NBPA 5C24A 3KTQA 4KRFA 4AHTA 1S1TA 3BDPA 2YNHA 1XWLA 1RT4A 3KLEA 3PO4A 4K8XA 4DF8A 1BIUA 4EZ9A 4AH9A 4DU1A 1SUQA 3NH0A 3KK3A 4CF1A 1W9HA 3ULDA 3LPTA 3VQ6A 3QLHA 2G8VA 4CEAA 1BCOA 4CK3A 1XHZA 1IO2A 2D0AA 1T8EA 1NJXA 5EU7A 4B9UA 3DMJA 4NYNA 3K5LA 3WNGA 3K5OA 4IDKA 1C0MA 4B9LA 4ELVA 1C6VA 4AHVA 4CK2A 1HJRA 1WNSA 1FKPA 1RT2A 1S1WA 4M3ZA 1NK5A 4FJIA 3A2FA 1REVA 3SPYA 1CLQA 2JGUA 3AA3A 4CF2A 3DRRA 4DLGA 1Q9XA 1KFSA 3HM9A 1D8YA 5KRTA 3BGRA 3K5MA 3QEIA 3AVBA 3NCIA 1BGXT 2IAJA 3IAYA 3CM5A 3NGIA 4HUFA 3O3HA 3S3OA 4E7LA 1I39A 2F8TA 1RT3A 4DQSA 4FM1A 4HHTA 1SKRA 3TWHA 4DU4A 4CGJA 2ZE2A 1IKXA 4FJLA 4DS5A 4BWMA 3QERA 4ELTA 3G10A 3IRXA 4B3OA 2KZZA 4CJKA 3JYTA 1TV6A 5T7BA 4H8KA 3V6DA 4CJ5A 1GOCA 3CFPA 1ZBHA 2O4IA 1A5XA 4CECA 4FJJA 4CF8A 4CEEA 4KTZA 1D5AA 5KI6A 2YNIA 1TKTA 2AJQA 4CHOA 3LANA 4DTJA 1F21A 1Y97A 4H4MA 2HMIA 4Z0UA 3T3FA 1JLCA 2HNZA 1N5YA 4KTWA 3VQEA 1RTHA 1RT6A 3AO1A 1KFDA 4QAGA 3NAEA 1JL1A 1TAQA 3IS9A 4M3RA 3MXMA 1LWEA 1TL3A 3QETA 1SL2A 3TAGA 1U48A 4DQQA 3KLHA 4JS5A 2G8KA 4DQIA 5KGWA 4CIGA 3B6PA 5HBMA 4HUEA 1CXUA 3ZT4A 1KSPA 3VQBA 3CFRA 1LV5A 4J2AA 3S9HA 2DY4A 2A1SA 3M8QA 4I2PA 2Q3SA 3NH2A 1ZBFA 1C0UA 3OS2A 3ZT1A 1FKOA 3KIOA 5SWMA 2E6LA 2P51A 4IBNA 2X78A 3ALYA 3OS0A 4AILC 3OYIA 2XY5A 2I5JA 4C8KA 4C8NA 1N6QA 3U3GA 3KKRA 2KFZA 4CHPA 5I42A 3L2RA 2E6MA 1VSKA 1UAXA 3HP9A 4F8RA 2KW4A 2OPRA 1HMVA 4CFDA 1S6PA 1HYSA 2DFHA 1T05A 3S3NA 3L2QA 1HYZA 3AVKA 5CYMA 2OZMA 1BI4A 3CM6A 4FJ9A 5DMRA 4FXDA
chains in the Genus database with same CATH superfamily
1S29A 2HFHA 4QS8A 2F7TA 5AR0A 2VWJA 1E2XA 2B4JA 3ENHA 1SV5A 4H0OA 2VXDA 4A3BJ 4NBQA 4L3QA 4DQ8A 4E19A 4ICLA 2XC7A 5HL7L 1YJNN 2QWQA 3FXLA 2JLEA 3MEDA 4CD3A 3HHGA 3O8GA 1KLNA 2G8HA 2CW0F 1BQMA 5E8GA 2VQFK 1R1UA 3ISPA 3EPZA 3ABKH 3ZT0A 4CJUA 5C42A 3OJSA 5CZ2A 3C6AA 4OJRA 2VC1A 4DNCA 4ZYGA 4UUSA 3I4MJ 1G99A 2JVHA 3T1BA 4UUSB 1NGBA 3M5RA 3QINA 3VEVA 1O3QA 4LF4K 3SDBA 3ZN0A 1XUPO 5F0FA 1OCTC 1HCRA 3VQ7A 4DSJA 1MJBA 3FFIA 4CIFA 5HNHA 2HHTA 2IS1A 5LHIA 2Q2EA 1L3VA 1QHHD 2RDPA 4GMJB 3EUKL 1RR8C 4LF9K 1PDNC 3P7NA 1HKSA 2GWKA 1Z1DA 1XGMA 1EP4A 4QIWN 4A5AA 4RW4A 5F1XA 1EWQA 3CC2I 2NRXA 4L5JA 4YRVA 4L9TA 3PFYA 1KU2A 2QWOA 2E8AA 5GPCA 3C2GA 1IGNA 3ECOA 4R8HA 2ZQBA 3ELKA 4GXOA 1FYLA 4JKBA 2HZTA 3F8CA 2QXFA 4RW7A 1WJFA 3DRSA 4F91B 3LOCA 2FXAA 4XLHA 2FSNA 2ZJQL 4IL6C 4DWIA 3H46O 2P81A 1VQMI 1JXBA 4J19A 3ASMA 5AFUH 3QEVA 3AARA 1WSJA 2X1CA 1TQIA 4I2OA 1C0FA 1ASVA 1KU9A 3WTSC 4FVMA 4FLUA 3IRRA 3H6EA 3V9XA 4WXCA 3D2EA 3LAJA 4JHDB 1H88C 3COAC 2CH0A 2QVOA 1AHDP 1SL1A 4MNUA 4M7YA 2HHHK 3CP8A 2CV0A 2K86A 4CZJA 3QO9A 1NGGA 4A61A 3CCMI 1JLQA 3CYMA 4BC4A 1IXRC 2OZSA 1D0ZA 5IT9Z 3PIPL 2R0QC 4UVAA 1UJ8A 1T33A 2LBFA 3LAPA 2LREA 1DU0A 2D0PA 4E1MA 1POGA 3HVRA 5BNGA 3VPRA 4B9MA 1HNXK 1PUFB 1QHAA 2YHAA 2NRRA 3K4MA 1EXQA 4XKVA 1GOAA 2LR8A 2XGXA 2FSWA 1U9OA 2QQ8A 4ESJA 3MKWB 5K7ZA 2R7WA 2ELJA 1E4GT 2VGMA 3GBTA 3K7AJ 3HOYJ 1G2HA 2YKNA 4JKCA 2WOMA 1A5JA 3EUHC 4KTQA 2K4JA 5C2DA 5KAIC 4C3IJ 1LAVA 3DM2A 4H5TA 1WAJA 4HVJA 3FK7A 3OR1C 4HAMA 1T98A 4O3MA 5HRSA 3ZMDA 3WE2A 1HPMA 3VQQA 4M74A 3QICA 5JLFA 2NVUB 5KGXA 1BI0A 2MFZA 4XLPF 1HJOA 2Y30A 1LFUP 3FWEA 3HZJA 1S8NA 1T95A 2O03A 3HRUA 4PSXA 3KP3A 5B1AH 3E66A 4DZPA 1KC8O 1WH5A 2PN6A 1BOAA 2XHBA 5FKMA 1OH8A 2YHYA 4PGHA 1HA8A 3C6UA 3OYDA 1U5TB 2F96A 2ELHA 2ADUA 2X6XA 3AO5A 5BRHA 3WQUA 3OJUA 1U45A 2E1MB 3HOZJ 3FM5A 3GTOJ 3D0SA 2E1NA 3QOEA 2DK5A 2PG4A 3HJEA 4RAFA 2VG6A 2FNPA 1G4DA 4PA1A 1OH7A 1VQ9N 4CZFA 4DR4K 1SFOJ 1Z9CA 1K78B 4KNYA 4IHVA 1LDJA 1KQ8A 2KIQA 1HPZA 1EH6A 4BJ6C 2D5VA 3X2QH 4HX7A 5AQZA 2A5YB 5D5UB 2LNBA 3DLAA 2ESNA 2LYCA 1YJWN 1Q7YO 4C3HJ 1QQOA 1V4TA 3SUNA 3J8AA 1TKZA 3ZQIA 1HQCA 3E9PA 1GLBG 1FEXA 4NUBA 3EO3A 1Z0XA 3S2HJ 4CJPA 3SLCA 2FBXA 2A07F 1UB9A 2P9SA 2Z3YA 2R5ZB 1LAWA 5GAHP 3T8RA 3OYMA 3V81A 3SHFA 3HOSA 3CF5F 4DSFA 4B9SA 3SPZA 3THVA 3H08A 1ZR2A 1RILA 4ITVA 4PKIA 3I58A 3WT0A 5MLCQ 4KI6A 3R4KA 3CJQB 3R1XA 3THXA 5AQVA 4M3UA 2JPBA 2O8BB 1A04A 4HTLA 2ZM6K 4F4KA 2LSNA 5JR3A 3GTGJ 2FEZA 4AHSA 2YHBA 5DD8A 3U9DA 2GWRA 5C3EJ 3KP2A 2KZVA 4W5RA 1IRFA 1X1PA 4G1QA 5AQXA 4OGCA 5A2QK 4AU7A 2H1KA 3BJAA 1B9NA 3PNYA 4XRFA 1JKHA 4YDUC 4HUGA 4AVPA 2ISZA 3TABA 5BOXA 1BA5A 2LC2A 2BHYA 3V9SA 2DTRA 2R7SA 2OCEA 4X64K 3BP8A 3QBXA 2OJED 3G4SN 4M3BA 5LJWA 4IQ4A 3O80A 4L5EA 3CTAA 1VAZA 4B9QA 3RZDJ 3HL8A 3MK6A 2FF3B 1JTXA 2X1EA 3ZCMA 3BZ6A 2LKPA 2L7KA 4XL9A 3BOQA 1UG2A 2IAIA 5M5YJ 3WTVC 3G0ZA 2X51A 3H3ZA 4PJMA 3O6WA 3HL2A 4IOAL 3P5JA 5GAGJ 3CCVI 2IIRA 3ZOBA 4B1UB 1QSSA 3TBIA 1BOBA 3FM3A 2O8EB 4TV7A 1TP4A 1Y0UA 1JKOC 2Y69H 3O9SA 1JKPC 3OYGA 1DGRM 3E7LA 2NAZA 3FXKA 4RS8A 1VRTA 4MDAA 3E0JB 4PKHA 3TTFA 2K9LA 3QPHA 5EEAA 1XHXA 4YELA 3G1MA 1I6XA 3R6MA 5TKYA 2DMNA 1P2FA 2NXNB 3KX2A 3WE3A 1X1CA 2BBYA 2M8GX 4LG3A 4AUXA 4B3MK 2E19A 2HYGD 2V79A 1YG2A 1MNMC 2P9KA 4RW8A 4KB1A 2IC3A 4U87A 5ILUA 4H0YB 5AQHA 2KMUA 3TR8A 2MD5A 1G6NA 4YFNF 4MLEA 2ESHA 3IHUA 5M3MJ 1FZPB 2ZNZA 1SAXA 4A59A 4NXNK 5EEHA 2EFQA 3MX2A 1P4AA 5D5VB 3ERED 4BVOA 2Q97A 1OH5A 1I27A 5D4RA 4FLVA 1KQSM 4CJEA 2BXZA 2QWMA 5KPRA 4F2RA 3HJFA 4L18B 2OAZA 5FB2A 3I55N 3QEPA 2IOCA 3T1YK 3E1YA 1LW0A 4DV1K 1U78A 4BJ5C 2QWWA 3QYBA 5AQJA 3MCZA 4LF7K 3F8MA 2VWKA 1SFXA 3ZQLA 3BQZA 4ENNA 4OMYA 3VERA 3BT9A 2EFWA 3EL2A 2ASMA 1CXQA 4JK9A 2OQRA 4IEEA 4G8XA 5KVRA 2XO7A 3SUOA 1NK7A 1NHAA 2G8FA 4JK7A 3BC8A 3I53A 2VONA 3AVCA 3NH1A 2PMZN 3GFJA 2LDUA 2M4KA 3M6GA 3ULEA 3DBHB 4JI2K 4MQ3A 5ADXH 3GZNB 1WGXA 4B3AA 3ISNC 4EP5A 4Y7NJ 4HNUA 3K1NA 3E5QA 3KFWX 4Q0BA 3A2KA 4A3MJ 5E3OA 1NKEA 3S1RJ 1O3RA 4FWKA 2I10A 1XNQK 4MGRA 4A3KJ 5BREA 3HTSB 4QS7A 4CVNE 5E8IA 1FY7A 3WHCA 3HRMA 3M8RA 4W5NA 1RT7A 3BCAA 3QBWA 1FOXA 4BROA 3TAPA 3M1CA 1WN7A 1MJAA 1VQNI 3R0JA 3N97A 3H9GA 1KYWA 3OOPA 1HX1A 1BI4B 3QRFF 1H9GA 2HQRA 3GTKJ 1BA1A 1X3MA 2IGMA 4EJOA 1YTAA 3H92A 4U0YA 1J9IA 2DOAA 1IRGA 4DQPA 5AFUA 2GEMA 2P9LA 4N41A 5TISC 4HV6A 3K0SA 3O3KA 3I0SA 2QQBA 4FWNA 3HPOA 1O1WA 4CD1A 2IRFG 4DHYA 4LFAK 2MLKA 1Y39A 2HVRA 4PUSA 1UHSA 5D8KB 3J7AY 2V52B 3HRGA 3W3DA 4FASD 4YOTA 3DRPA 3QB0A 2EV0A 3FBNB 4JYKA 4AF1A 2EBIA 3K2AA 3RPUA 4E7ZA 4BE2A 1RDBA 3IUOA 2GX9A 5IP7J 4KA4A 2UZKA 2DDAA 4IZ9A 1OFCX 3LZJA 1TK0A 3FXMA 1S1VA 5BR9A 1LFBA 1LUJB 1YI2I 4RMNA 4FLXA 4PDKA 2C6YA 1X4OA 3JAMO 5K5QA 1JCFA 3DEUA 2R93J 3M4OJ 3C95A 2W42A 4GKKK 4S05A 3RMAA 3I3LA 4NC6A 2JPCA 2P9SB 5GIOA 1G59A 2KT0A 1W5SA 3RRGA 1UA1A 2EFPA 1C0WA 1VSJA 4NYFA 1S5JA 3HPHA 3SMPA 3VEOA 2QK9A 2BY1A 2VYPA 3LDSA 2K7LA 3K4LA 4CHNA 1XPXA 3LSPA 1C1AA 2PJRA 4HCCA 3KYLA 1UFMA 1F36A 2CQQA 3EQLF 3ZX2A 3E1SA 3K70D 3CFOA 4MFDA 1VSEA 4BRFA 1MBKA 2QKBA 1MNEA 3MEXA 4WF9L 4DUYK 4ZDLA 5HLTA 1MMNA 3IKMA 4IO8A 3BTJA 3LM9A 2KRFA 4CFAA 1X3ZB 3BR3A 3IG1A 4PL7A 4CJFA 1R1VA 4OKJA 4E7KA 5ICFA 4B1ZA 3RWUA 3ZLJA 2HS5A 3HZ6A 4A3DJ 4JBAA 5E26A 3ONQA 1B9DA 3ZSXA 3K70C 3HXMA 3N05A 3TW6A 4CGDA 1EX4A 1FBQA 4LIVA 2L02A 3ZMVA 1X4PA 2ZD1A 1WPKA 4BRMA 5HLGA 4BR7A 1A6QA 2FOKA 2QZ8A 2W57A 4UY8O 3OYCA 2W82A 2BTFA 3JXUA 1BI3A 3VWBA 1A5WA 2XRIA 4F3OA 2Q1ZB 4NHJA 3IV5A 5AQIA 2GOMA 1D1CA 4BJTA 2P6TA 2JRTA 6PAXA 1NGIA 3I8BA 3J7ZI 4GKJK 3P38A 2IXSA 3W6JB 4WXDA 2KJCA 2AQFA 2BEOA 2P6SA 3A4CA 1VQKI 3V9UA 1EH7A 4UV8A 5IOYA 4C2MJ 4BQOA 3UKRA 3ZEUA 4JX6A 1XGSA 4MO7A 5CE3A 4CHQA 3QP5A 4F92B 2GBYA 3E01A 3QEXA 2XKOA 4Q48A 4IHSA 4CYCA 3ERMA 4WXHA 4CEQA 5GIPA 2CFXA 1GLLO 4PCQA 3RMDA 4I0AA 4BRKA 4FISA 3KEOA 5CVUA 1JKRC 4CHYA 2EHGA 5K14A 3H45C 3MECA 4DV0K 3SZGA 1ZGAA 4NCBA 3AFHA 4XN0A 2HB5A 3WNEA 4IG3A 3CPEA 5AZIA 3MAJA 5BN9A 4CZIA 3F73A 3E5XA 2PJRB 3RRHA 1GLCG 4FJKA 3V8JA 4KYWA 1ETYA 4LMYA 1SKSA 3LDQA 2XSJC 4HQMA 3C1DA 5JLHA 2YSRA 4CGGA 3EUAA 1QQMA 1Z3XA 2CO5A 3AVLA 4CJTA 4JI7K 3OYHA 2CUZA 4FW2A 4XLAA 3EKSA 4ZTFA 2CQKA 4HF0A 4IG0A 1IW7F 3WEEB 4FJGA 3L1PA 4A5BA 5LJVA 4OAZA 1RUOA 5FFZA 4IO9F 1MWMA 2K02A 2HBLA 5HLFA 3OIPA 4HX8A 1Z25A 3SK3A 2NRAC 2L01A 2MD0A 2YUSA 3VF2A 4BDYA 3KEQA 2A61A 4DFPA 3KP6A 5CVIA 2FSJA 3EYYA 4LSLA 5HROA 2PYLA 4UUVA 3LSKA 1QS4A 1XC3A 1S7OA 1R23A 3GE1A 4PJJA 1L3TA 4K43A 4A6DA 4CK1A 2QCOA 1B4AA 1T56A 3PSIA 3J81Z 3D2FA 3VF6A 4JD2B 3KLEA 1RT4A 3H1QA 4C30A 4JKGA 4BNCA 1QPIA 4K8XA 2W00A 2EQRA 1JKQC 2A6TA 3GZ6A 3I56N 4ETSA 4DU1A 5DCMA 3HGGA 1VTNC 3ECHA 1RKWA 4NB5A 1WI3A 3VB2A 1LNWA 1KA8A 2IA1A 1Y56A 4HF2A 3M3YJ 1X58A 3IP4B 2Z33A 3FMSA 4QPQA 2A5XA 4ILHA 3TSUA 2D0AA 4M9SA 3K9TA 3DU5A 2KFDA 3CCJI 1PP7U 3UB5A 2HEOA 1E4FT 4ON0A 5EGOB 3CCRI 3DMJA 3W6KB 1U6ZA 4CI6A 5BRFA 3C3WA 3FMRA 5E3LA 3FZFA 5F1RA 1TYQA 4CK2A 5EJCA 1HJRA 1WNSA 2XF6A 1HDDC 1OCRH 4PGGA 4A3IJ 4R1HA 1RT2A 3BEXA 3FKIJ 5FLMJ 4ISFA 1MD0A 5KCMA 2JGUA 3AA3A 4Y17A 4F55A 4CGZA 4M63C 3TMOA 1Q9XA 2L4AA 4XLCA 2YJEA 4S0HB 1BWFO 1QVGM 4YOVA 1W4MA 2QQ9A 3BG9A 3DXKB 5BR8K 3DPLC 3NCIA 1Q1VA 4A0YA 2BXYA 3IAYA 3CM5A 1ZK8A 3CM6A 2JWTA 3CQZJ 2VB6A 1RT3A 4DQSA 4EGYA 3CDIA 4FM1A 2BVLA 4IHYA 4BHCA 1KQ0A 2R7TA 2ZF5O 3TP0A 2NRWA 5LFAA 2PX9A 2GXGA 3QERA 4ELTA 1D5YA 3WU1B 4OIOF 3AGKA 1VQ6I 3JYTA 2Y0MA 4B3OA 5T7BA 3V6DA 2XVCA 3GWZA 3ZRGA 4CJ5A 2O4IA 2P9LB 5F0HA 4H5RA 1QVFM 1TWAJ 1LVKA 3PIOF 2E1ZA 2NNYA 2F4VK 4BRNA 3HOVJ 1TWFJ 4IX7A 2D1VA 1CGPA 2KHMA 3T8TA 1T6DA 3Q9SA 3WXLA 3F22A 2NS0A 4Z0UA 3T3FA 4A5MA 3CJTB 3O2PE 2WBMA 4O0IA 5HDGA 2QBYB 2HNZA 3A01B 1RZ4A 1RT6A 1HSTA 3WGHA 3UE5A 4AWXB 1VQ5N 2XF5A 4QAGA 2IA2A 1S3XA 2VOPA 3C18A 1BR4A 1TAQA 2GM4A 4DGWB 3A5NC 4WQ4A 4M3RA 3DPUA 5EDNA 2XAGA 4GV9A 3TAGA 1SEUA 2R7XA 1L0OC 3ABTA 5EEGA 2W25A 5H6QA 4ZZDA 5EF6A 5KGWA 5J40A 1S7AA 1CXUA 3ZT4A 1LV5A 1DP3A 3RYPA 5EYRA 1IBLK 2Q3SA 2HQ5A 3Q3SA 1U6GA 4XSZF 3TOAA 3G71N 5ED4A 4CBXA 1FW6A 1FKOA 1XTAA 2EJRA 2V7FA 4JP0A 3OYIA 4XBFA 2I5JA 2CSOA 3BROA 4DKWA 1LB2A 1NGAA 5I42A 5IOZA 1WBBA 5E18F 3L2RA 4A3EJ 4RBOA 1UAXA 2E6MA 3HP9A 1NNEA 3HB9A 3CLOA 1KD1O 2M5WA 4ANJA 4CZHA 3TQNA 2OPRA 2XKPA 2A68F 1ZR4A 3R8EA 3VETA 4CFDA 4GNIA 3K4JA 2LY1A 2KRHA 3S3NA 2AO9A 4KFCA 2CGKA 4M7XA 5CYMA 1ZG5A 2O3FA 4RCHA 2BVMA 4UVCA 1CF7A 4A3CJ 2W48A 4LG0A 4B1YB 2DT6A 2V51B 2F4OB 2G0EA 1QVTA 4CGFA 4PUOA 1I3AA 5AQFA 3HKZN 4CXFA 1G3WA 3PX0A 3TARA 4LIUA 1RBTA 1P90A 3EN9A 1D1AA 1TW3A 3HOTA 2EWSA 3HVTA 5M1QA 3U9ZA 3CUQC 2A1RA 1ZG3A 4HOBA 3VEPA 1QE1A 2P9NB 3OYEA 4AVZA 5D6FA 4CESA 4OIRF 3E6MA 3IWZA 2KQRA 3KZIC 1YVUA 3OY9A 1FYKA 4E7IA 1W5CC 2DFFA 2O0YA 3DLKA 4KIBA 1T2KA 3ZQ7A 1OCZH 1YFHA 1A35A 1NGFA 2ID3A 2ETHA 3RMBA 1UELB 2V26A 4MFEA 3AVFA 1HNZK 2NVTJ 5E79C 5CY4A 4BHBA 4DR6K 4DSIA 4E70A 2VGNA 1TBXA 4EJVA 2WUSA 3HXLA 2AXLA 1U04A 2JUGA 3K1MA 1KQ9A 2Y75A 3K1PA 2KDZA 4ID5A 4H0XB 1YOVB 2LY2A 3LQQA 2FQ4A 1FWZA 2YJFA 4YG2F 3LWLA 1VQLN 2HHUA 3SCXA 1ETKA 3IC7A 4KMUX 5HS8A 5DV5A 3S14J 3GG4A 4OU0A 1MMDA 1KTQA 3PL8A 2DYSH 3BJ6A 3O4WA 3DQVC 3FISA 3QYFA 4K2EA 1KYZA 2DMUA 4G7ZF 3VYRB 3VENA 3L09A 1S1XA 4IFYA 3SQ4A 4JAXA 3FDYA 5LL6Z 3V1OA 1YUWA 1FBUA 1C0TA 4WYBA 2W7NA 2IW5A 2R7FA 4B4CA 1T39A 4BR5A 3MXIA 4G12A 1HF0A 5F08A 1F4KA 1IRZA 2KIUA 1VSDA 1XGNA 1OCPA 2Z16A 3DLGA 3AAFA 1X1BA 1O13A 2LD5A 3WEEA 3LZIA 3SQNA 1ZBSA 2FBIA 2G9WA 2XAUA 5EGOA 1LEAA 1R4NB 4CF0A 4WFBL 3DOKA 5L3GA 2YU3A 2DTZA 2PBIA 3O3GA 3KD5E 4GV6A 3GBGA 2P5VA 3DLLL 1ZELA 4EM0B 4LD0A 4WF2A 1D1BA 4CYDA 2E35A 3WTUC 4FJMA 3AV9A 4B3RK 3ZSQA 3SQ0A 4WQ5C 1B72B 1CZAN 2XAHA 1LOTB 1TC3C 2Q36A 3CZ6A 2X6OA 1J7KA 1Y6IA 3CCLI 2VPRA 3FZVA 3S3MA 1B72A 4FO0A 4IOXA 5M1PA 2M34A 3IH4A 4FOEA 3U6FA 3VQDA 2M0CA 3SQ2A 2P9PB 1WSIA 4Y3OA 4CCJA 3DU6A 4XLFA 2BY0A 1A5VA 2HKXA 3M8PA 2BGGA 5LHGA 4AM3A 5AQLA 2WAQN 5EG0A 4BYYA 2F5VA 2EV5A 1DEJA 3KETA 4LH5A 5TGTA 1FT9A 2JN6A 2ZJ2A 1W36C 2Q2RA 2PY5A 3DXMA 1RKTA 4RM2A 3HOXJ 5J1UA 3PUBA 2HF3A 2COBA 2Z5UA 4XONA 3AA5X 3VYUB 1VSMA 3RYRA 1R36A 2WA0A 4YDUA 3L2UA 5J2PA 4OPKA 1RI7A 2PFBA 4FJ7A 3HBLA 1BQNA 4O8KA 1PP8F 3O3FA 4KIGA 1VQ6N 3BTLA 1JUPA 1AWCA 1Y1WJ 2NVQJ 1G15A 3PY8A 1HC8A 1VSFA 1OCCH 3LP0A 1WSEA 4IRGA 5L3BA 4E1JA 1S3JA 2RN7A 1LEBA 5HS9A 1IV0A 1WKMA 1ODDA 4CERA 5AQRA 4I99C 4JI8K 2VOOA 3D5LA 5LHHA 2MW8A 1L3UA 4XKBA 3OSGA 1VQ9I 2A42A 4B8CA 2BW3B 3D1NI 3VEZA 1D4XA 3LALA 1REPC 3CO6C 4YEJA 3MEEA 4DV4K 1LCUA 2FE3A 1HSJA 1GVDA 3LPUA 1ERDA 2MABA 3S15J 4NDLA 1RDDA 1HUXA 1FJGK 4JX5A 4ZYHA 3IDHA 5DYMA 4W5OA 3TAEA 2V6CA 2FNAA 4XOPA 2RGVA 5J1YA 4X62K 1RBUA 4ZH4F 4OPAA 2P9UB 2EINH 4MTEA 4BRCA 4CGHA 2R7DA 3V8KA 4CJWA 3OTOK 1UWBA 4DR5K 4A2UA 3CIPA 3O1BA 4UV9A 4Y15A 4II2A 1GXQA 4A93J 3V7RA 1K73O 4HDVA 1NBWA 4X65K 4BDPA 1Y8RB 4RGUA 4ZYDA 1X9WA 3ZSVA 3D2EB 2IVMA 2H27A 4JHDA 2QENA 4OKEA 2E34A 4DFMA 3SYZA 5I3UA 3VGMA 3TANA 4HCBA 3VQ5A 2K85A 2M8EA 2XPWA 5B66C 2FBTA 4B9TA 2L2OA 4E4HA 1YAGA 2EA2A 2L7MP 4NO7A 3H5RA 3C2HA 3PM1A 5IYBJ 4RB3C 2QWNA 2H3GX 2X6NA 4U88A 2I7NA 2COMA 4G6QA 3GW2A 4NC7A 1O3SA 1YRNB 2VIXA 1B9FA 2VCPA 2MSYA 3E9OA 4KREA 3SUPA 4WE1A 2Q31A 1WSHA 2M3AA 4PWDA 3ABUA 3BPXA 1IUFA 4W97A 5EVZA 4FJHA 1MGTA 5JVHL 2DA5A 4V2FA 4E7HA 4C2UA 1X19A 3L2VA 1XX5A 4M71A 1L3LA 1VQPN 2E7XA 2KISA 3ZR8X 5HLIA 1GLEG 1ZBUA 3C6HA 2NS8A 4OAYA 3MKLA 2DTUA 3FZLA 1AOYA 4CZCA 4JLHA 3BCBA 3O9RA 1JCEA 1Q8IA 4CCHA 3ZXSA 2ZJPL 2ZXHA 1ETQA 2EILH 1FC3A 5HDKA 3QIOA 1YHQN 3PX4A 5IT9O 4EM2A 2G7HA 1Q1HA 3R61A 4KAZA 4DG1A 4IF4A 3U1DA 2G8IA 1NTCA 1B6AA 3IL2A 3PO2J 2O5RA 2LSOA 4LH4A 3VEYA 3VA0A 1HQUA 2BE2A 2YX6A 4HWIA 4I0BA 4ZC3A 4YIFA 5KQ8A 3RMCA 1BJZA 1KU7A 1IF1A 1PYVA 3GF2A 3V8LA 4JRPA 2L9RA 1H89C 4O8UA 3FBIB 2R5YB 1PUEE 2HKOA 2E2NA 1LE8B 3LP2A 4O5VA 4IJNA 3VSKA 3F5TA 4UNOA 1ETWA 4FLTA 1KCFA 5AQKA 4L8RB 1P92A 4FCYA 2ZNYA 4A62A 4FSVA 3NWTA 4CEBA 1VQLI 2E2PA 2A6AA 3GDQA 5KPTA 3QIPA 2HOSA 3T69A 3TTCA 3VGLA 1XDUA 4JV5K 1J53A 3Q7BA 2VT3A 3V9ZA 4NCAA 2HU9A 3H35A 3RKQA 2DMQA 5J8CA 2Q2EB 3CF2A 3FX3A 3MZ8A 3RIRA 1ON1A 3DYAA 4GW6A 2FD5A 1BA0A 2UUAK 1VHXA 3DAWA 1HDPA 2B63J 4UUTA 2IEKA 3L6QA 4N4OB 5HP1A 3DLHA 4N56A 2P5OA 1GV5A 1NM1A 4CCLA 1YRNA 3AO2A 2D0BA 1SVLA 3Q0VA 3I9V2 2G8WA 3CUQB 1G3TA 3AO3A 2B6AA 1MH4A 1TLHB 2PMHA 2JT1A 1QQNA 3SBGA 2YPRA 4GFBA 2P8TA 2YNGA 1GT0C 5HRNA 4GY2B 4UY8I 2CGJA 3HT3A 3DEEA 4LOCA 4RLQA 2ITMA 4BQAA 2Y9ZA 3MN6A 1E17A 4EMSA 5EXWA 1QTMA 1XMQK 4YFXF 4RDUA 1QZEA 5D6EA 2E2QA 1DKGD 4YORA 2IVOA 4N9HA 3OIOA 3T0YA 3LWFA 1GV2A 2EWNA 2M87A 2WY8Q 5GADJ 2AS5F 1K8KA 1TNTA 2B0LA 4FLWA 3SJJA 1JTYA 2ZBKA 4CCOA 1J54A 1T08B 2JA2A 2LVSA 4B1RA 4DSLA 4Y52J 2MC3A 2R7OA 1O57A 2HVIA 2VJ4A 3WTWC 3EE8A 2RPIA 4BY7J 3VQ8A 1ZLJA 5FLXZ 4IOAF 3ZT3A 3D0PA 5AONA 4HF1A 4ID1A 4DSEA 3FXRA 1VZ0A 2JK3A 3CESA 2RV8A 3E3VA 4D0PA 3WU0A 1OJLA 2HQAA 4D5FA 2ZJQF 1LPQA 1U5TA 4HNTA 1BIZA 1H1VA 4E1NA 1ENHA 2DJNA 2FOWA 5LGUA 3PJRA 3OYFA 3PNTA 4FM0A 4HG2A 4EP4A 3QEWA 4A2AA 3NE6A 4M3WA 4NQWA 4XR6A 5KAFC 1SD5A 4CCMA 4M41A 4DTOA 2VG7A 2CJJA 4A3LJ 3J80O 2X9DA 5DM6F 4Z4CA 2ZMEA 4A3JJ 2X1DA 3WODF 1U2VB 4IDHA 3CC7N 2ZCWA 5JFRA 1HNWK 2J5OA 4FZYA 1RBVA 2MYSA 3F3XA 3QP6A 4BE0A 5E84A 1TAUA 5H1SQ 4XRSG 3I5UA 1KAYA 3B73A 3FXJA 4M72A 4MIMA 5J47A 3KJVA 1XMXA 2IVPA 4Z2YA 3MN5A 4EATA 3WTYC 1SAUA 3CUQA 4D9JA 4N5SA 1YX3A 1GHCA 5AQSA 4D1QA 4HX4A 3G2BA 2XGCA 5ICEA 2MGQA 4FM2A 3WXJA 2E7WA 2VBWA 4RB2C 1OPCA 1BL3A 2R7YA 1VQPI 5D3GA 5C4JJ 3PQKA 4QLCU 3LDOA 3TO7A 3OYKA 4ISGA 4K25A 4PJLA 2VQLA 3CP2A 1SQKA 1NK8A 3C94A 3NWSA 4EGZA 2NNNA 4MEXF 3TSQA 2Z99A 3SXYA 5H2FC 1YHQI 1VQ4I 4DV3K 2BV6A 2QEXN 5EX5A 2HHSA 3P83D 4LLGF 1S6QA 4XORA 4BHPA 3U8XA 1IG8A 1QU3A 3I71A 4N9IA 5B1BH 1ZG1A 1OKJA 1FIAA 4JKDA 1QRYA 2HI3A 4HEA2 2EIJH 3OYAA 1MIJA 4LY7A 3FIWA 4CE9A 2P0WA 2YR2A 3WTZA 5LBQA 3GFLA 1YTYA 1TYQB 5M1NA 4ZZLA 4C8OA 4KHSA 2VG5A 5M1KA 4JI3K 4Y0WA 2M30A 2HHVA 5FFXA 2E71A 4H0PA 3PO5A 1ZLKA 5C0YA 2AP1A 2VLAA 4B8AB 1T8IA 1JHFA 1MBJA 2Q0UA 2X48A 2XRNA 1HQEA 5LGNA 4XIUA 2YV0X 1VSHA 4UB8C 2W84A 5JI6A 4EZ6A 1LWCA 1ATSA 2VBXA 1R7JA 2IDOA 4O5FA 4IXCA 4Z4GA 1S1UA 3L4IA 4WQ4C 3N4QA 1FOWA 2DA7A 3K2ZA 1YXQA 1BI2A 2FC0A 4L0ZB 4DCHA 4HPQA 4J8FA 2VBYA 2V1NA 1RDCA 5JICA 3CCLN 3LNQA 2IGKA 2CQXA 4P96A 2FBHA 4W1UA 3VSLA 3P31A 2D2WA 2CRGA 4FK2A 4J2DA 2QTDA 4LF8K 5CQGA 1IDYA 3EETA 4HZFA 4QSHA 4BKXA 1QQCA 2E1YA 2Y1IA 4FYDA 2OTLI 2CGPA 1B9MA 2P9KB 1V3FA 3DBRB 2QWPA 4FK0A 4ISEA 1JUMA 2KZMA 1Z21A 2AA4A 2NUBA 2VJ5A 4BE1A 3WHBA 4Y4RA 1C1BA 1STZA 3VEXA 4DBQA 2MLGA 3HOUJ 2R7RA 1I50J 1J59A 1O7LA 5EZGA 1U8BA 4AC0A 4I6MB 5JS2A 2DA6A 1T8EA 2OYQA 1IG7A 3W3CA 3THWA 1SD7A 4BXUA 3TW7A 1O4XA 4MQVA 3ASNH 3TEDA 2Q0OA 3AVNA 1E0EA 3AO4A 3K9JA 2WTUA 3LAKA 1VI0A 1MMAA 2OV7A 3RI4A 4EHUA 1TWCJ 2IJLA 1BCMA 1NK0A 2JVGA 1WJEA 1DT9A 5C44J 1W0TA 2P4WA 1WJAA 4B09A 1MBFA 3LSJA 1V5FA 1OR7A 4S04A 1GLFO 3NF7A 4G9ZA 1H9TA 4I7FA 4KFBA 3KP7A 5KK1A 1ORKA 3PIPF 2CQNA 2X6WA 4OMZA 4MTDA 1YO5C 1LQ1A 1IXCA 2E36A 3S1QJ 1NLVA 3OYLA 1YVNA 4CEDA 4CFCA 1HLUA 2R7UA 3OS1A 3H9QA 5C24A 3GLLA 1Z6TA 4KT6A 4OIQF 1S1TA 3E6DA 2RKHA 3F72A 3CQYA 2M2EA 1A31A 5CHIA 3ABMH 4DR2K 2VE9A 1BIUA 3MN2A 2YHXA 2O8DA 3ZMTA 1DPUA 1GLAG 3H9JA 2NS7A 3O9TA 4CF1A 3ZQQA 2ZMEC 1W9HA 3BQYA 3S41A 2CH6A 2HZDA 1BCOA 2UU9K 5AQOA 2OBPA 3CCUI 1WJBA 2XHKA 4J01A 3WNGA 3K5LA 5F04A 3K5OA 1W7AA 1D3YA 3IRQA 2QXLA 4ELVA 4JI0K 2VT2A 1C6VA 4XNFA 3G71I 5E3MA 3DKWA 4XSXF 2WB1A 2OA4A 3HUGB 2BY2A 1J6ZA 2ELKA 2K3PA 2RQPA 4H5NA 5DDGA 4XH5A 2W85A 1VQ8I 3CCEI 1F5TA 4CF2A 3J7ZO 3CDLA 1KFSA 2EZKA 3HIFA 3HM9A 5KRTA 3BGRA 3O6BB 3FR0A 1U3EM 2GQQA 3AL0C 3QEIA 4JX4A 2WC9A 1XMOK 3CQXA 2IAJA 3OMYA 3NGIA 4HUFA 3O3HA 4HA8A 4E7LA 5F1JA 2M9HA 1WCMJ 2RREA 2WAEA 3OL4A 4HNVA 3M1EA 1UHMA 3WU2C 3R9PA 2VI6A 3MKZA 1S72I 4CGJA 2ZE2A 4DU4A 1OR7C 4GGGA 4DS5A 3VESA 4ZDOA 3IRXA 1E3MA 4CICA 1MSFC 2R7QA 3KPHA 2OQGA 5GAGP 4CJKA 1ZYRF 2KZZA 5CQEA 4G6TB 5JHFA 2FXUA 3CFPA 1XSDA 1QO0D 1E3HA 2JMWA 2JSPA 4I09A 2IBDA 2K5CA 4CJ7A 4RGSA 3JRBA 1IUYA 1F21A 1I1GA 1UHWA 5ERIA 2GXBA 4H4MA 2HMIA 1Z3YA 1OKRA 4JD2A 1BC8C 2EIKH 3ZP5A 3R0AA 4KTWA 4AM6A 3JRAA 2L9VA 3VQEA 1ZARA 4AIHA 5HODA 4BQNA 1JE8A 1KFDA 2YX4A 3NAEA 5DCMB 4B1XB 2E5ZA 5HOOA 3C7NB 3MXMA 1SFUA 3C7NA 5BRDA 3QETA 3CJ7A 3DJCA 2M7BA 4FWLA 5AQTA 2DO7A 3IH3A 4WFNL 1LFPA 3RSNA 2E2JJ 3MCAB 4JS5A 1VQ4N 3DPTA 2XPUA 3I54A 2BYVE 4BQQA 3G1OA 2UWMA 1YS7A 2HDWA 1TL8A 1BU6O 3B6PA 2K9NA 3VOVA 4CIGA 4F9OA 1KAZA 3BR6A 2LBFB 4U67L 4HUEA 1KSPA 4J2AA 4I2PA 5AQMA 2ECCA 2FQ3A 2LFBA 4LB5A 3HUGA 4BRHA 3DLLF 4D7MA 2GAUA 1BR2A 1TT0A 2CW8A 3W2VA 2E6LA 2P51A 3FZKA 3OOUA 3ZMUA 4XH4A 5AQNA 1SMTA 4GDFA 3F8BA 3U3GA 3KKRA 4CHPA 1VSKA 2Y0SA 2VODA 4HQEA 2XAQA 4PZJA 3S1MJ 1S6PA 4BRPA 1T05A 1IV6A 1JUSA 2K27A 3FE1A 4BL0B 1BI4A 3HI0A 5DMRA 3RSEB 3LM2A 4N76A 1CF7B 1W36D 2E2OA 4DTRA 5FD5A 5AJ3K 4FPAA 4FJ9A 5GP9A 3FZMA 3HSTB 4KH6A 1S7EA 4HV5A 1BJAA 4FJNA 2HHXA 3KWIA 3J81O 5ICGA 3HSFA 1YIJN 4PY5A 4LLNA 4AIJA 4RGRA 2F5FA 2Y31A 2OPPA 2OPQA 4JI1K 4DTPA 2HVSA 2H8RA 3VPZA 1TT5B 3FHZA 4C2TA 5CVJA 2V6EA 3PIOL 5CYQA 4NQWB 2I5UA 4LD5A 2BHZA 4N0BA 4CIEA 1FP1D 1IH7A 4F3TA 3RPUD 3N4MA 4QTRA 3U3YA 5DD4A 2NRVA 4FWQA 4G7HF 5TJJA 1NGEA 4KKOA 4PK4A 1C1CA 2NZTA 3V4GA 2UYTA 3B8AX 4YFUA 1V54H 4YY3K 5IWAK 3PSFA 2X6SA 1F9NA 1J9AA 3WG9A 2FBYA 1NMNA 2Q8KA 2O9LA 4FJIA 4RAGA 1I3QJ 2E2IJ 1L3SA 5B5EC 1FNNA 2BZTA 2V9PA 4IRIA 1VRUA 4BRGA 3CC7I 1HKBA 2XGDA 3LA7A 2LF8A 2R5ZA 2FUG2 1S9EA 3KK2A 2W6LA 3EEQA 1OYWA 2IS6A 3JCUC 3VOEA 3QYEA 2R5YA 1BISA 4WCEL 3SNNA 1LE8A 1NJYA 4H03B 2O8FA 1I1SA 3ZSYA 1ZH5A 3S16J 4BQLA 1YITN 1XQSC 1X3WB 3V1QA 1NJWA 1BM9A 1R22A 2AXTC 4J2BA 1RTJA 4BRLA 3OYJA 3DF8A 2P5GA 3UKUB 2DQRA 1O7FA 3LA2A 4ENJA 1XNRK 4TSXA 3KEYA 1EH8A 1MJ9A 2Z1DA 1KVBA 3J80K 3H36A 1FPQA 3GVAA 4CA0A 3MDQA 4XH1A 4BC2A 5IY5H 4RB0A 3CJCA 5GAHJ 1KU3A 4WWCA 3G4SI 3PO3J 2IGIA 3RSEA 3TAFA 5FRNA 2K9QA 3DI6A 1S72N 2NOGA 5BQTA 3PV8A 3SEZA 2DA1A 1RDAA 4KHQA 4OWRB 4DLEA 4PJNA 4CJ3A 3KLFA 4DS4A 3MFKA 1RPWA 1RBRA 3T19A 3LSIA 2FU4A 5IYCJ 4E89A 2ZJRL 3QNOA 2XY6A 1P9QC 3BG7A 2UUBK 4Y33A 2KDOA 1KXPA 3BZCA 4OLBA 5ELZA 3EZ5A 4M3EA 4OLAA 5LD2C 4Y13A 2CGLA 2FJ1A 1TUYA 4UVBA 3MKYB 1NOYA 1QZZA 4LFUA 3JAMZ 3H3VK 2DMTA 3W2AA 3JSPA 1JLFA 4P9UA 2J4RA 4M3FA 4LLLA 3AA2A 2LP0A 4KV8A 1WHUA 2HHWA 2KZGA 3M8FA 4RM3A 4HBLA 3AGRA 4MQ9F 3D6RA 3O4QA 3EYZA 3VQPA 4ELUA 4Z4EA 2XSDC 3ZSOA 2F5DA 4M45A 1F1ZA 3JRIA 2YI1A 2ETJA 3O9UA 3FKJA 4BRIA 2ZXWH 5GTIC 2E2HJ 2XUBA 3GL1A 1B59A 4EVIA 1MDMB 4OX9K 3ZMZA 2BY3A 1CZBA 2WWYA 1D9FA 4I9QA 3W2WA 3SQ1A 2X4HA 3MAQA 1MMSA 1HW5A 2VE8A 1S9HA 3L00A 4R5PA 1FMWA 2EPFA 2XV4S 5DM7L 3VTHA 2Z1JA 3SFZA 3ZMSA 2GOXB 3ZSWA 3FGUA 2VJIA 5M5WJ 1DTTA 2I7PA 2D4WA 4MFBA 2H09A 4A3GJ 1FOYA 1JT6A 1USTA 2ZMEB 4CCKA 2LOOA 1H8AC 3DXKA 5J1EA 1WH7A 2DA4A 1IBMK 2XGEA 4HDUA 1KVAA 2P1JA 4H0EA 2PYJA 1FP2A 1OMIA 2HXOA 3I59A 3G73A 2E1CA 3IMXA 1QHTA 2O8CA 1A6IA 1JT0A 4FPBA 3OVNA 3WNHA 4KPYA 3CUOA 1N77A 4O5BA 4BREA 2IGOA 2JUCA 2QWLA 3AVJA 5JVGL 4CGIA 1I6HJ 2A5WA 1ZGJA 2LTPA 2N8GA 3P9CA 3WGIA 1JLBA 1L5UA 1Z6RA 3UR3C 2G8KA 1N36K 5D5XB 3KE2A 3PX6A 3ZQHA 1U0JA 5L3CA 1JI8A 4JKFA 3PQJA 3AVAA 3BTCA 3AG3H 3W6VA 3AL0B 2WAFA 1SD4A 2DBBA 2EH3A 1F43A 1NWKA 2O8KA 3CCYA 3TGNA 1BHLA 1ZAOA 3KLIA 3E97A 5HRPA 4KHPK 1D0XA 4M73A 1BIBA 1HW2A 2DDBA 2F5CA 3GTPJ 3FXOA 3HO1A 2PBDA 4BGDA 2B5JA 3WG7H 1FBSA 4V19K 1TVRA 5C15A 4BGBA 1TL1A 3I8DA 5IT9K 5LRRA 3ATUA 1N8RO 4DR1K 2DMPA 4E7SA 2P5KA 3LL7A 4CZZA 3ZN1A 2PAVA 5JVGF 3A0IX 3O5BA 2ISYA 1Y64A 4RW6A 2B7EA 2DT7B 2OF7A 2V1DA 5IPAA 5M5XJ 3GTLJ 4DU3A 3R3LA 3K10A 2FBKA 1FK9A 3LDLA 3KVGA 4JK8A 2G8UA 1E3PA 2ECBA 3JSMA 3KYDB 1ZRFA 1ZGWA 3L7WA 3LSGA 2D5RA 2HF4A 1IDZA 5DCFA 3LP1A 1VQMN 2KRCA 4RG8A 2PQ8A 2W4SA 2QM1A 2P9IB 5ILVA 3Q7CA 2JA7J 3HKZA 4O55A 3P1GA 3SV3A 3VQ4A 3TP3A 2OA8A 4JOMA 4JKHA 2VKVA 1LW2A 3SAHA 3O8HA 3MZHA 3VQCA 2OCCH 3KP4A 3CMMA 1SZ2A 5JHUA 1W0HA 2BGCA 3KHYA 2LG4A 2F48A 3E5UA 4HSRA 3CD6N 1YJWI 1DP7P 4C9YA 2WONA 1BDGA 3BR0A 3K9KA 4DMNA 4LG0B 1YT3A 1K8AO 2ASPA 1IN5A 1X2MA 1LDDA 3IWFA 1NMDA 4DOZA 1WAFA 4CCNA 1SKWA 3L3UA 4CZLA 2HTJA 3IKTA 4YNQA 1Y0NA 4M3TA 2UXBK 3ML6A 1NGDA 4K41A 4JS4A 1GUUA 3QU3A 3ITHA 3UIQA 1RCHA 4CJQA 1R5GA 3F9MA 1EF4A 1K78A 3B6OA 4U7BA 3C65A 1U4BA 1SFKA 3ROUA 4M9XA 2ICWG 3A1YA 1K4SA 2R3SA 2DA3A 4JQFA 5F27A 1QA6A 3NVMA 4FW1A 3WUHA 4CZGA 3V4IA 2EFOA 4LF5K 5FGMA 1BW6A 1WJ5A 1IZ1A 2R7VA 1YQAA 3MD2A 4CHZA 4QPOA 3S1NJ 4GVMA 3EUHA 1UMQA 1NG9A 2GIZA 3BZKA 5LRSA 2Q1NA 5AZJB 4AHCA 3PFIA 1XCVA 4H4KC 3VDXA 4AHRA 4KI4A 2RE2A 4K0KK 2P5LC 4XK4A 3DBLB 2CU7A 3CPWM 3GCMA 4DFJA 1ZC6A 2DK8A 3U21A 1GLNA 1T6SA 2KIMA 4YIRX 2GBZA 4YOYA 2P9UA 4QCLA 2RF2A 4FWPA 5LY3A 4RWTA 3FLCO 5E20A 3LWMA 1YW7A 2YX7A 3CCUN 2QSGX 4DUZK 2O8FB 1NOZA 3S17J 4E7JA 3NHGA 4O44A 2M1BA 4ENMA 3MN7A 4CEFA 3M8SA 4ESFA 2O8BA 4XRSA 2DU9A 4B1WB 2IP2A 1WRJA 3G6EN 2HQNA 2EA4A 2GV9A 2KHOA 1V5GA 3ID6A 1I94K 2HVHA 3CCEN 4M6XA 2XF7A 4FWRA 2YNFA 2QA4I 3CMEN 4BAYA 1RDWX 3TAQA 2VQEK 3DEWA 4ENKA 1YW9A 3TDZC 4NLBA 4JEPA 2GUPA 4BC3A 3DTIA 3NRVA 4BG9A 4BBRJ 4CBWA 1LWFA 3CC4I 3DLRA 3G25A 3FK6A 3C2BA 3MWPA 1D0YA 4V2GA 1ACIA 5AZIB 4IEJA 5BMZA 5FLXK 1YIOA 1QNTA 4PJ0C 4MDBA 1DGWY 5SZTA 1FSHA 3HM8A 4LC9B 3BDDA 1S5LC 4C8LA 4FJ5A 2EX3A 1Q18A 4IPAA 2D1KA 2QI2A 4FE7A 2X74A 2CFOA 3WNFA 4PQUA 1J09A 1ESVA 1MSEC 3AA4A 2OANA 1MZBA 1IN7A 4AYBN 1HXDA 2ME0A 4C8MA 4KHUA 3QPSA 4G94A 1Q86O 3I0TA 3J7YJ 3O1WA 2KP6A 2F8SA 1B92A 3VFZA 3QFPA 4ESBA 2ZGYA 4Y1DA 1R1TA 1DLOA 2WC2A 3QDKA 4XMYA 4BR4A 5GAEP 3ID8A 2CUFA 5BPMA 1N34K 2BUPA 3MMYB 3GX4X 2ME6A 5H20A 3RCOA 3VQAA 4B3TK 4J2EA 2HXIA 1FSEA 4R79A 5KHDA 3OHRA 3VMFB 4BR2A 4DB3A 4RTFD 3JRFA 3HDDA 1WSGA 3S8PA 2VPLA 3M1FA 1RFQA 4IHWA 1Q81O 1V55H 1FTTA 2MG4A 2UUCK 3MWTA 4CF9A 1FX7A 4P9FA 3KCCA 4BH9A 4XM3A 3DOLA 2DA2A 4KHYA 5M3FJ 1SFEA 2OZ6A 2KTQA 4W5QA 1V4RA 3K4CA 3SYTA 2L4MA 2A05A 5E1XA 3GEZA 2W24A 4ABZA 4ZYAA 2GWJA 4MO5A 4PHTX 4EIAA 1Q9YA 4K42A 5DUKA 2NRTA 4NNJA 4LF6K 3ASOH 3I59B 2O8CB 3P9KA 4F7ZA 2JA8J 3KKSA 1X1AA 1U5TC 3I55I 4MHGA 2O6GE 3U1KA 2QEXI 4DV7K 2M0MA 2MH9A 5E3NA 5AQUA 1BN5A 3GYHX 2EZHA 1ASWA 1IAWA 3G3ZA 1ITGA 2EZLA 1VK0A 3L3VA 3ENBA 4GYIA 5CVVA 1JJ8C 1OYIA 3QQAA 4YFKF 5IT3A 2JQ7A 2BH1A 3JREA 2QM3A 3RTRA 1AKHB 5FDLA 4KHWA 1YS6A 4L9VA 1ZRDA 2VJJA 3CJ1A 4FWOA 4HSTA 1OVQA 3HBTA 1N75A 3CMAN 3CCSN 4JRQA 1R49A 1D9DA 4U7DA 2DXIA 4XKWA 2HOAA 3ZETB 2O8EA 2HOEA 5F6FA 3S2WA 4DIQA 1S9GA 4DF4A 3TI0A 4N4NB 2DPUA 1MH3A 4M9ZA 4OVLA 4CJLA 3M9AA 4YOWA 3O4NA 2D0CA 1X9MA 2MC4A 3ZSRA 3TAMA 3F9KA 1Z26A 3HEFA 2GTDA 3CHWA 4HLXA 4BACA 3LSTA 1W2BM 1K83J 2EK5A 4BC5A 3CD6I 2GXAA 1VQNN 2RNGA 3CMYA 2A6EF 2OPTA 3LAMA 3K57A 3K59A 3SDGA 2RAEA 3JTHA 1RTIA 4OGEA 2Y9YA 3VA3A 3ATVA 4FOIA 1Z05A 2OUMA 1KZHA 1K7AA 2HVQA 3WQTA 4AHUA 3A0BC 4JI6K 4ILGB 1HYVA 4P55A 2XB0X 5FD6A 5BN8A 2VXZA 2ATQA 2IS2A 3RVCA 4KITB 2A40A 1JXSA 4BWJA 1FJLA 4DQRA 4JI5K 1SD6A 2OZUA 1IN4A 2FSKA 1Z67A 1T0FC 3IAM2 2DFEA 2CV1A 5J8FA 4XN3A 2K4BA 5J3LA 3RZOJ 3W0LA 1QSYA 3SFIA 5C10A 3HSEA 3T5XA 1VQ8N 4HYEA 4E0DA 1NG7A 2QF7A 4EJWA 4FWMA 3BR5A 1UOCA 1EQYA 3O8MA 2OPSA 4JYAK 3DP7A 2YU9J 1ZYQA 2F4MB 3MMVA 5DM7F 5KTQA 1HOMA 1MBHA 5LMUK 2WV0A 4YOXA 1NK4A 3QWLA 4OOIA 4CSWA 1ATNA 3VF4A 3WXMB 3HSCA 2A3ZA 3CG7A 1OYYA 4BRAA 5J4VA 4KO0A 1SVOA 5E41A 3L8BA 1KRPA 4KRFA 2UXXA 3JRCA 3IKVA 1YITI 4AHTA 2YNHA 3Q5FA 2DJIA 1OQYA 4QS9A 1WI9A 4DF8A 3A0HC 1UZCA 1Y8QB 2KKZA 4EZ9A 1UG0A 1W5TA 1SUQA 2E5LK 5JLWA 2QGUA 4PL8A 1J5EK 1M90O 3DCFA 2OD5A 3BR1A 2EB7A 3H1CA 1BIAA 4DQ2A 3LMMA 4CHUA 2JRMA 4NLCA 3LFKA 3M8EA 1IO2A 1YE9A 1EWRA 4MEYF 2KLAA 4Z94A 3DXJF 4B9UA 3MVPA 1TNSA 1N78A 1ETVA 1C0MA 3IH2A 4B9LA 1BI1A 1LJ9A 5LGTA 2Z2SB 2FX0A 3NAUA 2F9TA 2CUJA 2ZFUA 3CJNA 4KH4A 4M3ZA 4C1NK 3A2FA 3MWMA 5FKKA 2NNWA 1XGOA 3J7AO 1HR0K 1CLQA 2XAJA 3HSRA 5F0CA 3OWTA 2KIFA 4ZDPA 5K5RA 3OSFA 3BG5A 3DRRA 3FXQA 2HMPA 4JKAA 2AHQA 4EAHD 1D8YA 1RESA 3K5MA 5K7FA 3WTTC 4RA2A 1BGXT 2JWKA 2X0LA 3J7YP 2F8TA 1SKRA 3O9QA 1HKTA 4HHTA 3BY5A 1IXSB 3TWHA 4JKEA 3FMQA 4CYCB 3R60A 5DEQA 1VQKN 4B47A 1W7PB 3H0DA 5GAEJ 1EJ9A 4KDPA 1IKXA 4BWMA 3G10A 4BGAA 4FJLA 3JR9A 2L7ZA 5KPZA 2A6HF 2H1LA 2HGCA 5AQWA 4JI4K 1ZBHA 1WBDA 1GOCA 2LY9A 2CYYA 2GA1A 4RB1A 1W0UA 4EQQA 4BXXJ 4CECA 5BPLA 5KQDA 3AAPA 4CEEA 4CF8A 2DPDA 4KTZA 1GLDG 5B8HA 5KI6A 5JVTA 2ZXIA 4DTJA 4LFBK 1Y97A 4I6MA 5I9EB 2UUZA 3RKYA 4IQJA 1JLCA 3V7CA 4C23A 1H0MA 3MQ0A 1N5YA 4MO4A 2PMUA 2DLLA 3FF5A 1R9TJ 1IC8A 1QBJA 3GO5A 3A5LC 3P39A 1MW7A 5FLVA 2P7CB 2O8DB 3IS9A 1MKMA 1LWEA 1APLC 4WX9A 1NU0A 1SL2A 2GLOA 4DQQA 2W40A 4A2BA 4DQIA 1JCGA 5AQPA 1BL0A 2V7YA 3OR2C 2LRDA 5HBMA 4YHHK 3VQBA 2XDVA 3M3ZA 3S9HA 3F8FA 1KGSA 3VGKA 3NH2A 2XASA 3J81K 1ZBFA 3OS2A 1C0UA 5SWMA 2XIGA 2UXNA 1T0FA 2CS3A 1QHGA 2G7UA 1PUFA 1T3VA 1IN6A 1FYMA 2IT0A 3HTUA 3ALYA 4IBNA 3CCRN 4AILC 3K4KA 4C8KA 3PLAA 1JGGA 2KFZA 4Q4ZF 3DWLA 2H94A 1RNLA 2QQAA 1N25A 4JKGB 1FIPA 3AAQA 2KW4A 3SZTA 3LQRA 3SJMA 1RUNA 1K8KB 1HMVA 3A5OC 2MA3A 3A8YA 1P8ZA 5C2FA 2VBZA 1HYSA 4NB4A 4I7HA 3KLOA 1K79A 2O61A 1HYZA 2OZMA 2FMLA 1QZ6A 3CETA 4O4GA 5CLSA 4FXDA 4I98B 3I56I 5C25A 1YX5A 1TKXA 1EA3A 5D8LB 4W5TA 2E20A 4JK1X 4XOTA 3EKUA 3BJOA 3D5RC 4XKCA 4LFCK 2LK2A 3G6EI 1FMVA 4FK4A 4V19S 3HM5A 2LKXA 4EJTA 1WSFA 2O4GA 1R5ID 4XRMA 2L9NA 2HSTA 3L0QA 2HNYA 5GADP 1TQMA 3WGGA 5JMVA 1J5YA 2V9KA 5CPRB 3EZWA 1XD7A 4H5WA 5J2MA 1TZLA 2L54A 3M07A 3GFIA 3HK2A 3RDIA 1YTUA 4DW6A 1AU7A 4DJAA 4P5OA 4XIDA 2Y2ZA 2R92J 3H0GJ 3B6AA 1HNVA 2K3FA 5J2QA 2QSHX 4KUMA 2V9VA 3ZQCA 2QWRA 3HYIA 3JTGA 4HTUA 1WB9A 4DTNA 1ZN2A 1SMYF 3LSMA 1IKYA 3DFGA 4MLOA 3S2DJ 1PVEA 2DCEA 3LDPA 2UV1A 3AKZA 1ON2A 4KISA 2BANA 1T44A 4Q47A 4IOCF 1T38A 1IRXA 3HOWJ 4BG8A 2HBJA 1EKEA 3L2WA 2W41A 3MEGA 4ASNA 1RDUA 2KQ2A 2KJBA 4NCGA 4CZEA 1TKDA 2M4GA 4OO1J 2UXDK 3RKWA 3AG2H 4CZMA 1JJ6C 2V4JC 5HRRA 3SAGA 4M3DA 2RHKA 3L2CA 2NLXA 5JLXA 2TDXA 2A3SA 3DWLE 1JLEA 4B3SK 1UCRA 2CUEA 5K7HA 3ZQGA 1B8IA 4N47A 4M3YA 4OPJA 2ASOA 2UXCK 2QBYA 5FLXO 4IZZA 3A01A 4I6ZA 4CJ4A 3IFRA 4FL9A 3OIQA 2HYFA 4IKFA 2DQLA 1KAXA 3NGYA 4ILJA 4AYBA 3CF5L 3THWB 3SI6A 3TOBA 1RT1A 3JRGA 2FF4A 3DLEA 4IFEA 1QQIA 3VYSB 2XROA 1M1EB 1WLJA 1NJZA 4FJXA 3FXUA 2JSCA 4X66K 1MBEA 2GELA 1O3TA 4DYQA 3QPLA 1QVUA 5IP9J 1D8JA 2PEXA 4Y1CA 2NOJB 5DUIA 3CJ9A 3RR7A 3ENOA 3C7JA 4CJSA 4IXAA 3OA9A 2YCHA 2QA4N 2J5PA 4G9YA 1YW8A 5KNLA 1ZRCA 4EEFG 1CZ9A 2V1UA 5HDNA 4FVUA 4NC8A 1BUPA 5CKTA 3TDUC 4EHTA 2I8DA 3B02A 5AIPA 2FBVA 4GYGA 4I01A 3U4LA 4BVPA 4GCVA 1G3YA 4AIDA 2VKEA 3Q9VA 1NK9A 1JGSA 4EM1A 2QYOA 1VQ5I 3HRTA 2V1XA 2W6KA 1BOTO 5E1WA 5BPDA 9ANTA 1R6RA 3ZGKA 4A6EA 4BRDA 4DR7K 3UKRB 2K40A 3TTDA 3JW4A 1KONA 3CMAI 3CCSI 3T1AA 1X9JA 2QSFX 4U0VA 3JSOA 2B9SA 1HKCA 3NF9A 3VEWA 3SAFA 2PLYA 3THYB 1GDTA 5GTHC 3SZ2A 1VQON 2IVNA 1YJ9I 5EOYA 1RT5A 1BR1A 1R71A 3FZHA 3O08A 1EO1A 4BR0A 4Q5SF 4L9NA 1SAZA 5FPMA 1CQTA 1EETA 2PJPA 1X3NA 1R00A 4IWVA 4DFKA 4OIPF 1T7PA 3NVKA 5ILSA 2ZFWA 5CYVA 3MX5A 2HTSA 3RR8A 3KWGA 1BC7C 2VUMJ 3E9LA 4GVEA 5M1FA 2WAQA 2ZO4A 4PFOA 1LDKB 5EZHA 1Q82O 3DLBA 3K0LA 3E6CC 1G3SA 3ZX0A 3I0RA 4CEOA 5L3DA 2VKDA 1XSVA 3MZYA 2NRZA 3OW2M 4KBOA 4UB6C 4C3JJ 3VODA 3BF1A 1K61A 3F0CA 2WADA 3NQOA 1SANA 2RNJA 3CERA 3MN9A 4OPHA 3K4BA 2VQCA 1WZ2A 1Z7UA 1W7PD 5GPAA 4B1VA 2QKKA 5CVRA 4OINF 5H6RA 2ZJRF 5AQGA 1SVMA 1D5VA 4D5CA 1Y1VJ 3K4NA 5C12A 1P6RA 2OC6A 3LA3A 2TRTA 3DKYA 2L9SA 1QZ5A 4RAYA 5DM6L 3LFUA 4L5IA 1KVCA 4CBUA 1DPRA 4LSNA 5DK5A 5KRSA 2VQGA 1ILYA 2FA5A 2HBKA 1E3OC 2TCTA 3QODA 3MCPA 1B1BA 3SMSA 3KLGA 1VQ7N 2FF6A 4BY9C 1DUXC 2RN2A 1J5OA 4RLFA 4DTUA 4DYRA 1HW1A 4OKKA 4BBSJ 2HPMA 3QNNA 3HYFA 2JJ7A 5E1ZB 4CH7A 3SEQA 4FT8A 1DU6A 4DTMA 1K9MO 4O6JA 3GMEA 1QZYA 3REOA 3P4IA 1KLMA 4KICA 3EYIA 1P4WA 1U8RA 2E88A 2XPVA 1ZBLA 4KT5C 4JNEA 3BG3A 3CCQI 4KN4X 2IS4A 3GTJJ 4DV5K 3QOPA 1HNIA 4C1NI 5FPDA 1WJDA 1IKWA 3KZYA 3AVGA 1X1DA 3EY1A 3HRSA 4DV6K 2YKMA 1T6CA 3NF8A 4CJVA 1IN8A 1NG6A 4EFHA 3ZETA 1U49A 4KMFA 2XY7A 3H5NA 2ACJA 1MDUB 4K8ZA 2Y48A 3HGYA 4A12A 2DODA 1X3UA 3A02A 4RAZA 5E17F 4H4OA 5CR4A 1YYVA 3LP3A 4DZJA 3T7ZA 4DYCA 4M3XA 1W7PA 3ZQFA 2OTJN 4FTHA 5AQQA 4B08A 4QOZB 2ITGA 2OU2A 4I02A 2STTA 3DXMB 4EJUA 1A36A 1G8XA 2Q0RA 2XY8A 3M8JA 1YJNI 2E60A 2HR3A 2IGNA 1WWXA 4CFBA 3WXIA 5GINA 2RVCA 4BDZA 3F6OA 4FE4A 1JLGA 3Q0UA 2YHWA 2BDPA 2FRHA 2QUFA 5BS6A 4FQGA 2A41A 1TUUA 1IG9A 2RKIA 2MH2A 3PUFA 1BO5O 2GUIA 3RTVA 3V1RA 2NVYJ 1TK8A 2HNDA 1QSLA 2PMZA 1P4XA 4Z4FA 3F6VA 4B48A 2DT5A 3GXOA 1OVYA 4WQ5A 3ESWB 1T03A 2HDCA 3K58A 2A69F 1K6OA 2ZSIB 1HLVA 3ULQB 1C0GA 2XB5A 1WOQA 4M6VA 2R4GA 1RC9A 3JRHA 3FFKB 3NFAA 5ADXA 3UNGC 2MBFA 1GXPA 4AM7A 1TQPA 4P1WA 4HRIA 1WFXA 1HRHA 1NK3P 4CEZA 5CJ9A 1TTYA 5JS1A 1ONVA 1RBSA 1NK6A 5LEJA 1MNDA 2DOEA 2FMYA 2R7ZJ 2QW9A 3GTMJ 3AVMA 4O0JA 4BRQA 5FRMA 2V7ZA 1AKHA 1GOBA 5LMNK 3CJRB 1JJ2M 3QFUA 1ZTRA 1IKVA 3LSHA 3CMEI 2CWEA 1B8IB 1FLIA 1LKXA 3M7GA 4PFPA 3TO6A 4DTXA 5LLQA 1R5HA 2F4IA 4KN7X 5AIQA 4NXMK 2HOTA 1TGOA 3SBTA 1ZXOA 4AIKA 4WFAL 4IHTA 2X6YA 3OBWA 1NKBA 1IBKK 4DTSA 5K1YA 3KD1E 3RQIA 4BEHA 1XSXA 3HPGA 5FKLA 2D1HA 5D4SA 2AQEA 4D7NA 1V4SA 1W97L 2FLOA 2IS3A 3C6TA 3JS6A 4PKGA 3CCMN 5FPNA 3NDKA 1XMKA 4XEIA 1IJWC 2XRLA 2XY5A 4AD9A 2WTEA 4BS9A 2LLKA 4U0WA 5DS9A 5TRDA 3L4QA 3PNVA 4IFVA 3TU5A 3HP6A 4F2SA 3H5AA 4DSKA 2WV1A 4MLHA 4FLZA 4G6DA 2NVXJ 3K5NA 3VYTB 4KB0A 5J4YA 4IVNA 1K4TA 2P7VB 2K9MA 2L7FP 1AA7A 4FHTA 4RGXA 1VQOI 3AY9A 4Q5VA 2DYRH 5ICCA 3T1HK 3S32A 1ITYA 2P9IA 1BG3A 4H0TB 1YI2N 1XC9A 3CC4N 1Z91A 2BOLA 5B3SH 1FXXA 3CC2N 2WY7Q 2VL8A 1JL2A 3QMLA 2ZC2A 1X9SA 2HW3A 3C0BA 4FZXC 4I2QA 2BW3A 2ID6A 3OYBA 3BF3A 5AZJA 4BU2A 1ETOA 3IAS2 3BTIA 1DDNA 3ZT2A 1QGPA 2BE5F 3U9GA 1USSA 1VSIA 1WSUA 4II3A 3V7SA 3THYA 3SUQA 1NGCA 1NGHA 1XG1A 2ZSHB 3RPQA 1ASUA 2DN0A 1XI1A 1NJIO 2HHQA 2STWA 2KL4A 2VWBA 1VSLA 4IEIA 2H8WA 3LDNA 1J0RA 5M1OA 3B6CA 1ZQ3P 4G7OF 3KK7A 3U2RA 4FJ8A 2GIVA 5J2NA 4H5VA 5FKOA 3RQ4A 3TL4X 3D2FB 3EE9A 5HS7A 3Q0WA 5L3FA 1DTQA 4IOCL 3ZX3A 1RTDA 1W1WE 3N4PA 2WFBA 1GVJA 1RNHA 3ZSZA 4M42A 4FETA 1ULYA 3CDHA 2CW7A 2CG4A 2LF7A 3BG6A 3K69A 2YS9A 3QAHA 5DTDA 4BEHB 4XLNF 1WJCA 2PI0A 2JA6J 1N32K 1WVRA 3BPVA 2OTJI 1NKCA 1XCBA 2JTVA 2X85A 4LITA 5J6XA 1XMAA 3BLYA 3TO9A 4BXFA 4CO8A 2QKLB 1PJRA 4RW9A 4X6AJ 3KYCB 4M6YA 2PFUA 2HYJA 4Z4IA 3CI5A 3I33A 2RQQA 5BPIA 2KFNA 1P7IA 4IJAA 5IP6A 4I9LA 2EFNA 3IUCA 4Z4HA 3HTVA 4X0GA 5FPEA 1ZHFA 3D45A 2CV2A 2NRHA 4H0VB 2HWVA 4GO1A 3SJHA 4CZKA 4DV2K 1TK5A 1VFCA 3F23A 2Z1IA 3F21A 4CJRA 1R4MB 4DR3K 2PZSA 1XC5A 3K6GA 3VTIA 3ZPLA 1VNDA 2GZWA 5D5WB 4JN4A 1MU2A 1RGIA 1Z77A 5EG0B 3F2KA 3VQ9A 2L0KA 4FLYA 3V9WA 3K2PA 1RRJA 2KLOA 2Y0SN 2HBMA 3BUZB 3MXJA 1VF9A 2GA2A 1QPMA 3DTKA 1X2NA 4CDGA 3WTXC 1RR7A 3CXCM 1SL0A 1M1KO 1JLAA 1ZREA 3CO7C 1S22A 3CCVN 2H6BA 2K9SA 1OH6A 5HVQC 3H3OB 1ZBIA 1U47A 2E4LA 5F0XA 1MMGA 3BWGA 3AG1H 3GLXA 4QWQA 3SZPA 4Z6YA 4ZHRA 4GRIA 2VC0A 1V5EA 2EIMH 2Z1HA 1XHZA 1NH3A 4E3SA 2IPQX 2VASA 4BQZA 4F93B 1TWHJ 1BBYA 2CMPA 2HDDA 1R0AA 1ETXA 3ZYYX 4UQGA 1U2VA 4BY1J 3VN5A 4AQYK 4B9NA 4BUPA 3RJPA 1UAAA 3AVIA 2ZXJA 1UA0A 3D5SC 1R58A 2M7AA 2LKSA 1DQUA 4B9VA 4A69C 1N33K 1XB4A 2ZKZA 3OL3A 3OV8A 3KLNA 3CQ8A 1XS9A 4UXNA 3SV4A 1JXEA 5BPNA 4KH5A 4KHNA 5J1RA 2JWLA 3NF6A 1YF5L 5LEKA 3QESA 2M45A 1RETA 5CZ1A 5F64A 5EY4A 3UKGA 1NK2P 2DW4A 3WXKA 1WQ2A 1XDSA 4XICA 3KK1A 4EV0A 1K6YA 3OYNA 1JHHA 3TKYA 4ZTJA 5AQYA 5K5OA 3F8NA 2EV6A 2Z1GA 2ZGZA 3NGZA 2E1MC 3AVHA 1P7JA 3NBPA 4HW0A 1J2XA 3KTQA 1HKQA 3GZ5A 3J7AP 3BDPA 5FO5A 1XWLA 2LH9A 2WBNA 3EDPA 5L3EA 3PO4A 1RIOH 3H1VX 3G1LA 3CCJN 2EZIA 3HC7A 1YJ9N 4A3FJ 2JA5J 4AH9A 4I76A 5HLHA 4A57A 1IJJA 3CLQA 4F52A 1MA9B 3NH0A 3KK3A 2JZYA 3ULDA 3LPTA 3VQ6A 3QLHA 5HNFA 2DPNA 3KZBA 4CEAA 4CK3A 1NJXA 1IV8A 2G8VA 3AG4H 4LGWA 4IHXA 3CJBA 5EU7A 1GLJO 1OLTA 4NYNA 4PSWA 4CW7B 4XLEA 5C4XJ 1OISA 1ZKGA 4YIIA 4A0ZA 5A2QZ 3H3NO 2ZB9A 4IDKA 3S93A 4AHVA 4FWSA 1NGJA 3V42A 1FKPA 4ZJZA 1S1WA 1D8KA 3I64A 3P9IA 3GOIA 3FHNA 2KPMA 3A03A 4FX0A 4XQFA 3A5MC 1NK5A 1TWGJ 1REVA 2D45A 1SS6A 3SPYA 2IA0A 4LB6B 2HNHA 2CH5A 4DLGA 4B8XA 4KIFA 2OTLN 2E5NA 4FX4A 3HHHA 2F5EA 4GV3A 2P9PA 2F9WA 3AVBA 2W1OA 3DTEA 1TW2A 1U9NA 4UHTA 1Z7LA 2DI3A 1HKGA 3S3OA 1J75A 3I4NJ 1OCOH 1I39A 2VN2A 3NARA 2Y1JA 1YIJI 3CJAA 3ZEUB 4B43A 5FJ8J 2E1OA 3LSRA 3TPQA 2D0OA 5IYDJ 2DOFA 4HLYA 4A0XA 3BY6A 4DBRA 2F2EA 3BR2A 2WB1N 1MWKA 1TV6A 4E6KG 4H8KA 2LMDA 3TSPA 4L9JA 1MDMA 1A5XA 1EV7A 4X1EA 4FJJA 1FTZA 3ZCOA 4LK0F 1ATRA 1D5AA 2AJQA 2YNIA 1TKTA 4CHOA 3LANA 2DFIA 3GTQJ 2O7OA 1XN7A 2L3DA 4IRHA 3RKXA 4A5NA 1BW5A 2P9NA 3UKUA 2HPIA 3NMUA 1YLFA 1RTHA 3E6BA 3QPTA 3KZZA 3AO1A 2DAOA 3D7EO 1FOKA 3DV8A 1JL1A 2O8XA 4B3XA 2ZJPF 4J00A 1TL3A 4LJZF 1HBXG 3JRDA 2ZWHA 4WCGA 1MBGA 3HG9A 1U48A 3J80Z 3KLHA 3DKXA 2VKHA 3LL3A 3L9FA 4M3GA 2KKOA 4YOUA 1VQ7I 4F3QA 5F2RA 5TKWA 4IO9L 1I5ZA 1WUAA 1LVAA 4ZYEA 3CFRA 2DY4A 5FKNA 2H6CA 2A1SA 4LK1F 3M8QA 1U2WA 1S6LA 2RC4A 2QLZA 3ZT1A 3KIOA 3GUDA 3OS0A 2X78A 3CCQN 3THXB 4C8NA 1N6QA 2XAFA 2F6CA 3QU6A 5A2QO 1DGKN 2NYXA 2Z9OA 4CUGA 4BR9A 3OBYA 2VQHA 4L0YB 4F8RA 2L5QA 4KJZA 2QKMB 3NEUA 2CQ7A 4B44A 1R59O 1SC7A 3I4PA 3R6SA 3H3UA 3JAMK 4WK8F 3KP5A 2DFHA 4FZZA 3L2QA 3AVKA 3GFMA 3ABLH 5FROA 3ULEB
chains in the Genus database with same CATH topology
5C25A 4N76A 1TKXA 4DTRA 2VWJA 4W5TA 2Y1JA 2B4JA 3HSTB 4FK4A 2HHXA 4FJNA 1SV5A 4CGFA 4PUOA 4E19A 4PY5A 1I3AA 1WSFA 4ICLA 3PX0A 3TARA 2O4GA 2OPPA 2OPQA 2JLEA 1RBTA 3MEDA 4DTPA 2HNYA 1KLNA 2G8HA 1BQMA 3HVTA 3ZT0A 5C42A 3D0PA 4CJUA 4DQPA 5J2MA 3V81A 5CYQA 5CZ2A 3OJSA 4OJRA 2HHVA 2A1RA 4CESA 4CIEA 4O0IA 3HK2A 1YTUA 1QE1A 3QINA 1IH7A 3OYEA 4F3TA 3U3Y