2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
1Q8IA 3VQQA 4DU3A 2HW3A 2DFEA 3AO4A 2WONA 3EY1A 3EYZA 1FXXA 2P51A 2X74A 5KI6A 4CF1A 1SKRA 1HQUA 4Q0BA 1Q9XA 4E89A 2P5GA 4B9LA 4KI6A 3SQ2A 3NH1A 1RBVA 4DSIA 4FJ8A 4LSLA 4O0JA 4FJKA 1LV5A 1JLEA 1A5WA 3ZT2A 1X9SA 3RTVA 3LP0A 1XWLA 3AVHA 4OKJA 3NF9A 1KLMA 3U3YA 3T19A 3P5JA 4OPJA 3KLEA 2FBVA 3OYGA 3RMBA 3OYFA 4AHUA 4N47A 3OS0A 3TAPA 4I9QA 3PV8A 4DQIA 4O5BA 4HCCA 4LY7A 1ITGA 1CZBA 2VG7A 2G8FA 1U4BA 4DSKA 2ATQA 1TL3A 4YNQA 1JLQA 3O3HA 2G8HA 4IG3A 1HJRA 4LSNA 4PA1A 4EP5A 3CFOA 1WSFA 3QEPA 1NJZA 2A1RA 4CHPA 3VQ7A 3NDKA 3PY8A 3RWUA 4N41A 4CJFA 4O0IA 4FJ9A 4KRFA 3LWMA 1T03A 4CCHA 1K6YA 3HO1A 4DU1A 3AVBA 4GW6A 2PZSA 4FM2A 4F8RA 4FJ7A 2X6NA 1HYSA 3SYZA 1EXQA 2WOMA 3L2VA 1ASVA 2IDOA 4M3UA 5KGXA 5J2QA 4BDYA 3VQ5A 5FDLA 1QHTA 4ELUA 4E1NA 3QEWA 4PWDA 1N6QA 1ZBFA 3ZSRA 4PY5A 4OLAA 4MQ3A 4W5RA 2XHBA 4F2RA 1C6VA 3U6FA 4DU4A 3KIOA 3L2RA 4K8ZA 3DMJA 2P1JA 4ID5A 1BL3A 5HLFA 2D0CA 4H4OA 1KFSA 4W5NA 2ZD1A 4B9SA 3AVJA 1S9EA 4HUGA 4DTMA 1L3UA 4JRQA 1QSLA 5KRTA 4CJPA 3F9KA 1D5AA 5HRPA 3DRRA 3H08A 4FLTA 3NFAA 4J2EA 1SL2A 4Z4GA 4O44A 3PX0A 4B3OA 3AA3A 3KK2A 4RW6A 4L8RB 3ULDA 3OYJA 4BWMA 3SJJA 1KVBA 4DQSA 1C1AA 2BANA 4GVMA 3IG1A 3F73A 3HPOA 4C8OA 2VG5A 4F4KA 2GBZA 4KB0A 1BCOA 1VRTA 4C8MA 3VQBA 3LDSA 4N56A 1NOYA 3M8SA 1VSDA 3RMAA 2PYLA 2DY4A 4DFMA 1WLJA 3SQ4A 2F96A 1LWEA 3P1GA 4CJQA 4FJHA 1N5YA 3LPTA 3ZSVA 1RDBA 3HP9A 4IFVA 1R0AA 4KI4A 1WSEA 1L3SA 2OZSA 1JXBA 1GOAA 3AO1A 2R7YA 3OYHA 4J2AA 1Z26A 3VQEA 3IS9A 1JLCA 4Y1DA 2KW4A 5JS2A 1VK0A 2D5RA 3AVMA 1KTQA 2B6AA 3AA5X 5C24A 2PY5A 4KPYA 3NGIA 1J9AA 3ZT4A 3AA4A 3LP2A 1UWBA 1NKCA 3L3VA 3QEVA 3VQ8A 5I42A 3M8PA 3O3FA 1WAJA 2QK9A 4DTPA 4KHNA 1SL1A 1S5JA 3M8RA 3MEDA 3RMDA 1KRPA 3KD1E 3LP3A 4M42A 1ZBUA 4RG8A 1WN7A 4QOZB 2YV0X 3TAEA 3SPZA 2KFNA 2OPQA 4I9LA 4N76A 3A2FA 3KD5E 4C8LA 1SL0A 3K58A 4E7LA 2F8SA 1IKWA 3DLBA 3K5OA 3OY9A 4JRPA 4KB1A 4OVLA 1NK5A 1S1XA 2VG6A 3WNFA 2YNGA 5HBMA 4CJTA 4CHNA 4ELVA 2P5OA 1BQMA 3LANA 4FJXA 4FLZA 4DG1A 4CF2A 5C25A 3AVGA 3AVLA 4G1QA 2XY5A 3LZIA 4KO0A 4UQGA 4CK1A 5HP1A 1GOBA 4AHTA 3AVAA 4CF0A 1EP4A 3KLGA 3UIQA 2ZE2A 5FRMA 4CHZA 5SZTA 4M3XA 3NF6A 4RW9A 1ASUA 1B92A 1QS4A 3KLIA 2HB5A 4AHCA 3NE6A 4AHVA 4CJ5A 1YTUA 3ZSWA 1RT3A 1ZBIA 3IRXA 1O1WA 2GUIA 4KTZA 1JLFA 1LWFA 2JGUA 1WSJA 1NJYA 4CF9A 4B9TA 4E1MA 1TKTA 1BHLA 2LSNA 3V9SA 3O3GA 3OYLA 3QERA 3NH2A 1U49A 1KLNA 4K8XA 3PUFA 4M3RA 4CEAA 1LW0A 3AO5A 1RDAA 4DF4A 1C0MA 4GMJB 2FBTA 4CJKA 1C0UA 4E7JA 1NK7A 2D0BA 3OYDA 1XC9A 3B6OA 2HHTA 3OYAA 1U45A 1NOZA 2HVHA 3SUOA 2B4JA 1RT4A 4CGDA 2KQ2A 1BISA 3CQ8A 4HTUA 3CYMA 1DLOA 1JLAA 3WNEA 2RF2A 4B9UA 3V9WA 4ELTA 4NCAA 2W42A 3MEGA 1RBRA 4FJIA 1S6PA 2HNDA 2IS3A 4DMNA 3OYIA 3B6PA 1BI4B 4CGGA 4CJUA 3AVNA 1FKPA 4DFJA 1QE1A 1SV5A 4CGIA 4FM1A 1TK8A 1S1VA 4E7IA 3V6DA 4B9NA 2X6SA 3JYTA 2IOCA 2IAJA 3ALYA 3OS1A 4DTOA 1RTIA 4B8CA 2RKIA 4FLUA 3ZSXA 2HMIA 1IG9A 1FKOA 5HROA 2IC3A 1SUQA 4F3TA 3K5LA 3SV4A 3QO9A 4ZTFA 3V1QA 3L8BA 2X78A 2I5JA 1W0HA 4FLYA 3DLGA 1ZYQA 1VSIA 4BWJA 4FZXC 2O4IA 4FCYA 4M3ZA 4TSXA 3QINA 2KTQA 1T8EA 3AA2A 4CJRA 5CYMA 3NH0A 1NKBA 4QAGA 3SQ0A 5FRNA 3ZT3A 5HRRA 4XIUA 1U04A 1S9GA 1NK4A 4M3TA 4DTJA 4AHRA 1L3VA 3K2PA 1ZBHA 3SNNA 4J2DA 4PUOA 4DFPA 2OA8A 2E4LA 1RDDA 3OVNA 3PO4A 1RT5A 4KTWA 4DSLA 2HHWA 4PQUA 1WAFA 3I0SA 4CEQA 3MXMA 4FYDA 2Z1GA 3D45A 4KREA 3HVRA 4AILC 1GOCA 1VSJA 3C94A 4CJWA 4DFKA 4JLHA 5CY4A 3TAMA 4CJSA 4YFUA 4Q5VA 3V1OA 4DQRA 4KAZA 2YNHA 1I3AA 1T7PA 3AVIA 3QNOA 1KSPA 4FJJA 2EX3A 4NCGA 4M3YA 3KKRA 5C42A 4N5SA 3SUQA 5JS1A 4KKOA 2Q3SA 3DM2A 1RT2A 3NGZA 3OYCA 2KZMA 1B9FA 1HPZA 1IKXA 4CIEA 4DTSA 3NF8A 4CIGA 2YHBA 1VSFA 1HQEA 3ITHA 4CERA 3DLRA 1KCFA 1TKXA 4KHUA 4FXDA 2YKNA 2B5JA 4I2QA 3D0PA 5J2MA 4JS4A 4BDZA 4DSEA 3S3MA 4CFBA 2HHXA 2BDPA 3V9XA 2G8VA 3MAQA 4NYFA 4R5PA 4HVJA 2XY7A 3ZT1A 1IKVA 3LZJA 3S3OA 4B9VA 4H8KA 1C1CA 3MXJA 3T3FA 2HHUA 2E6LA 4Z0UA 3ZSQA 4AH9A 1WNSA 2Y1JA 1UA0A 1EX4A 4FJ5A 3AVKA 3RRGA 1DTQA 1Y97A 2HNYA 3OYEA 1NK6A 1A5VA 2EHGA 4FW2A 1EETA 3BGRA 5SWMA 1X1PA 1NJXA 3DLKA 3LAKA 5T7BA 3PO5A 1SKWA 3CM6A 3DRSA 4OKEA 4Z4HA 5KGWA 4KHSA 1TK0A 1TAQA 4CJ4A 3WNHA 5HRSA 1W9HA 3MEEA 5J1EA 3L2WA 3DOKA 4FK0A 4BACA 4FK4A 4HCBA 3HXMA 4F2SA 3K5MA 2QKKA 3C95A 3NGYA 3PX4A 4CFDA 3P83D 4B9MA 3QIOA 1BIZA 3QEXA 1L5UA 1D8YA 4EZ9A 4M45A 2YKMA 3TR8A 1C1BA 2FBYA 1XI1A 1ASWA 4FLXA 1RBSA 3HSTB 1NK0A 1QSYA 4W5TA 3V1RA 3ZSOA 4FJLA 4NYNA 2YHAA 3L2UA 1HMVA 2HNZA 2DTUA 4LH5A 1WSHA 4CF8A 3VQ4A 4H4MA 4CECA 3CFRA 4B08A 5DK5A 5CZ1A 2QXFA 4CEFA 4BE0A 3AV9A 5CZ2A 4HUFA 1T05A 2E6MA 2G8KA 2NUBA 3HPHA 4IKFA 4ICLA 3I0RA 4DTNA 3SUPA 4BE1A 3C6UA 1QSSA 1HNVA 3K5NA 1UOCA 3AO3A 1JLBA 4CEOA 4FM0A 3M8QA 2VWJA 1VSHA 3MECA 2RPIA 1NKEA 3QNNA 2G8IA 1REVA 4WE1A 4DS4A 1CLQA 5E41A 2FBXA 1A5XA 4CEDA 1VSKA 4CIFA 4KHQA 1Z25A 1XHZA 2OPRA 1CXQA 2BGGA 3DLHA 1RT1A 4IFYA 4O55A 1S1WA 1L3TA 1QTMA 3RR7A 1HNIA 4Y1CA 4AHSA 3DYAA 4MFBA 4CGJA 3I8DA 5J2NA 3RMCA 2XO7A 3S9HA 4OLBA 1C0TA 3DLEA 4KTQA 3L3UA 4IBNA 5DMRA 1IH7A 4Z4EA 1TAUA 2AJQA 3G0ZA 1RCHA 3T1AA 2OYQA 1TVRA 1YT3A 2DFFA 4CESA 4QCLA 1KVAA 3AVCA 4DTRA 1DTTA 3ZSZA 1RILA 3NHGA 3IAYA 3VQCA 1I39A 4I2PA 4RW8A 2JLEA 2Y1IA 3SV3A 4FLWA 1S6QA 2YNFA 3VQ6A 3RR8A 3VA0A 3K57A 3ISNC 4E0DA 4Z4CA 3PX6A 4Z4FA 1IO2A 1LW2A 3HVTA 4DLEA 3ZCMA 1S1TA 2BE2A 1RTDA 2YNIA 4KHWA 4BDPA 4E7HA 1JL2A 2A1SA 3OJSA 4OPKA 1MU2A 5HRNA 4FJMA 3AO2A 3V9UA 3NAEA 4DTUA 3TARA 1SKSA 4OKKA 4LD0A 3NF7A 2OZMA 4CJ3A 3VQ9A 4IDKA 5KRSA 3VA3A 2XY8A 3HL8A 4NCBA 4CJVA 1S1UA 3V81A 3LWLA 3BDPA 4C8KA 1JL1A 1NK9A 3CM5A 5J2PA 3OJUA 4JS5A 3G10A 3OYMA 3TAQA 4EP4A 4CE9A 1WSIA 1RBTA 4CFAA 4CHOA 1TKZA 4J2BA 4E7KA 1B9DA 4Z4IA 3KJVA 1NK8A 3V4IA 1J5OA 1X9WA 1J53A 4FVMA 4CGHA 4FZYA 5I3UA 3KK1A 3QEIA 5KTQA 3L2QA 2Z1JA 1TL1A 3VQPA 1Q9YA 4LH4A 1RT7A 2VWKA 3LALA 3WNGA 4CEBA 4CEZA 4DS5A 4CGFA 4DF8A 3SPYA 1U48A 1D9DA 1LAVA 2QKBA 2O4GA 4CEEA 4OGCA 1JKHA 3O4QA 3RRHA 3TAGA 1U47A 1TK5A 3SZ2A 3ZSYA 4DWIA 2Z1HA 3KLHA 4FW1A 4FZZA 1J54A 1RTHA 2PYJA 4F3OA 3TWHA 3VQAA 1G15A 1BGXT 1VSMA 3AVFA 1BIUA 4DQQA 2OPSA 3NBPA 3QLHA 3TABA 4CJEA 5FROA 4M41A 1BQNA 3HJFA 2KFZA 3DOLA 2RN2A 3SCXA 3FFIA 4W5QA 2Z1IA 3VN5A 1X9MA 3HP6A 2OPPA 2FC0A 1VSEA 3HYFA 1NJWA 3OYNA 3OYBA 3S3NA 2ZQBA 1RT6A 2F8TA 2G8UA 3HK2A 4OGEA 4DSJA 4HHTA 3SI6A 4KHYA 3KK3A 4RW4A 3HPGA 3QESA 3ZT0A 3O4NA 3V9ZA 1YTAA 4C8NA 4KFBA 1CZ9A 3TI0A 3LP1A 3KKSA 4FJGA 2HHQA 3SUNA 1IKYA 1JXEA 1EKEA 3KLFA 3SQ1A 1KVCA 1TKDA 1CXUA 1UAXA 4ZHRA 3K59A 1RBUA 1YVUA 1HRHA 3THVA 4FJNA 3QIPA 4I7FA 1VRUA 1HYZA 2KZZA 1WSGA 2ETJA 4OJRA 4ZTJA 1ZBLA 1D9FA 4BE2A 2XY6A 5D3GA 4CFCA 1RNHA 5EU7A 5CYQA 1RDCA 4CHQA 3JSMA 1TGOA 4FLVA 1F21A 4W5OA 4DTXA 1JLGA 3KTQA 5K14A 3LPUA 1HYVA 3LAMA 3U3GA 4IG0A 4DQPA 4M3WA 3QETA 1FK9A 3HM9A 4DSFA 1LAWA 2ITGA 3C6TA 2G8WA 4CJLA 1XHXA 3CG7A 2GV9A 4CK3A 4HUEA 3HT3A 3E01A 3TAFA 3ASMA 4ID1A 3TANA 1RTJA 3VQDA 4E19A 4RW7A 1TV6A 4O4GA 3OYKA 2HHSA 3OS2A 3NCIA 1VSLA 1LWCA 2D0AA 1UA1A 4B8AB 2HVIA 4FK2A 4E3SA 2HHVA 1BCMA 3EZ5A 4CK2A 3DRPA 3CFPA 1QQCA 2XRIA 4CHYA 4KV8A 4DLGA 1KFDA 3MXIA 2DFHA 4EZ6A 2IGIA 1BI4A 3DI6A
chains in the Genus database with same CATH superfamily
2HW3A 2DFEA 2VKEA 2YR2A 2P51A 2RKHA 3RSEA 1G3TA 1MW7A 4JHDA 3U3YA 4RB2C 3T19A 3OS0A 3O8MA 5EGOA 4BR7A 4I98B 4DSKA 4YNQA 1ITYA 2FSWA 2GEMA 1WSFA 1A5JA 2HOSA 3LSHA 1T03A 3IKMA 4JV5K 3K9TA 2X6NA 1WJ5A 5LGTA 2LP0A 2RNJA 3G6EI 4BDYA 1LJ9A 4IZZA 1VQ9I 3IC7A 1N6QA 1H89C 4K8ZA 4H0YB 3HOXJ 5IPAA 2E2QA 3CQZJ 4JP0A 3DRRA 4J2EA 1LDDA 1Y39A 1SL2A 5BNGA 4O44A 1YJWI 2VOOA 5EG0A 1LEBA 4C3IJ 2X6OA 5LY3A 3LPTA 3K4LA 4E4HA 2IA2A 3AA5X 1UWBA 3HRTA 1T56A 3RVCA 1OYYA 5ICFA 1TWCJ 3JRCA 4XLEA 2EIKH 2PX9A 4DR1K 1NGCA 4JRPA 1MBGA 4IWVA 4S05A 2HTJA 5AQOA 1OCRH 3HKZN 3H1VX 5LHGA 2R7XA 1QQMA 2NRXA 3LL7A 1WVRA 2V7FA 4CF0A 3KETA 2MC4A 3NF6A 1QS4A 2UZKA 3P9IA 3H5AA 5LJWA 3QFPA 5L3FA 3SZPA 4K8XA 4GV9A 1XNQK 1WCMJ 4YG2F 2O8BB 3OYAA 1NOZA 3K4MA 4ELTA 4H5WA 3N05A 3V9WA 5M5YJ 1TUUA 4DFJA 1QQIA 4AQYK 3V6DA 1O3QA 4PUSA 2DJIA 3OS1A 4B8CA 3JCUC 1BI2A 2HMIA 1FKOA 4OPAA 3Q9VA 4F3TA 3K5LA 1DGWY 3IHUA 1O7FA 1SD7A 1QPMA 3PQKA 2CV2A 3DBHB 3KEYA 1L3VA 2HDWA 2P9LB 2HHWA 3GBTA 4IRHA 2LKXA 1D0YA 2X9DA 3ERMA 3W0LA 4DWIA 4CJWA 4DFKA 5FPDA 1WGXA 2KQRA 3HSCA 3QNOA 5FKOA 2C6YA 4M3YA 1OCTC 3DM2A 1U6GA 4HWIA 3MAQA 4B9VA 4HVJA 1P2FA 3VOEA 4H8KA 4EQQA 2UXBK 3ZSQA 1BN5A 1NNEA 1M1KO 2P9UA 3BGRA 3I5UA 4MTDA 4MNUA 4A5NA 5ADXA 3MD2A 3SAFA 4EZ9A 1ASWA 3LSRA 4FLXA 4W5TA 3BJAA 3O2PE 5FGMA 1IUFA 2O8EA 1MMNA 5CZ2A 3F2KA 2R7FA 2NVXJ 3LFKA 1HLVA 2P9KA 1RNLA 4JN4A 5AQPA 1REVA 4IPAA 1A36A 4HW0A 3F8MA 2CO5A 3W2WA 3DYAA 4KT6A 3W2AA 4BGBA 2VI6A 2DA4A 1K78A 5FLXZ 2CUZA 1U2VB 1WH7A 3VB2A 3C1DA 4DLEA 4CYCB 3ZCMA 3HB9A 3E3VA 2K7LA 1HW2A 2NOJB 2ZBKA 2LY2A 2XC7A 3TOBA 4J19A 2ADUA 3OYMA 3BEXA 1PJRA 4EP4A 3TAQA 4OIOF 1B9DA 4E7SA 3D2EA 1NHAA 3B73A 5GAGP 2GLOA 1BM9A 1RT7A 3LALA 4CEBA 3AG2H 4O3MA 2R4GA 4BY9C 1HJOA 3KLHA 4OIPF 3TWHA 4DB3A 3TABA 4IX7A 2LY9A 2KFZA 4XLNF 2H27A 3HP6A 4DQ2A 4ZYAA 2JA2A 4RAYA 3GTMJ 3BPVA 2ZQBA 2G8UA 1XB4A 4PJNA 4YOXA 3LP1A 2O8KA 2QWNA 5DEQA 3CCMN 3A02A 4UY8I 2AA4A 1RBUA 5HS8A 4HNUA 4IHSA 4KHPK 3W6KB 1VQKI 5JVHL 2IGKA 3OL4A 1FK9A 1LAWA 4CK3A 3K1MA 3R60A 4DR5K 3OYKA 2CUEA 2E7WA 3F6VA 4FX4A 3SQ2A 1W7PB 1U8BA 5LBQA 2P9IA 2L7FP 3I59B 5GAGJ 1MD0A 4XKWA 5GAEP 4KI6A 2IS2A 3TP0A 3AVHA 1KAXA 4OKJA 4D5FA 1O7LA 3KP7A 1S72N 2DCEA 1U9NA 2M2EA 4M6YA 2F8TA 4N41A 4FJ9A 4O0IA 3AVBA 4XH4A 1YRNB 4RCHA 2CFXA 3G6EN 2QWPA 4B1ZA 2H6CA 1D0XA 2O8DB 1ZGAA 1A31A 4WF9L 3OV8A 4XN0A 2MSYA 3KIOA 2HOAA 1DKGD 4W5NA 4A5AA 2YU3A 2ID6A 1WRJA 1T6DA 1KLNA 4G12A 2W25A 4CJQA 2BY2A 1D1CA 2VKVA 2FXUA 3CCRI 1OISA 1MMDA 3BF3A 1YX3A 4NUBA 4QOZB 3TAEA 3SPZA 5C0YA 1NK2P 4LG0B 2OPQA 4N76A 3KD5E 2JZYA 3K58A 5GAEJ 3I56N 4GYIA 2MD5A 3J7ZO 1D5YA 2NS0A 3A0IX 3SAGA 5DCFA 2EZKA 1A35A 1QZYA 3M1FA 4OAZA 5SZTA 3DKXA 1PVEA 4I6MA 4ILGB 2CGKA 5KVRA 2GUIA 2XRNA 2WA0A 2WWYA 1WSJA 1TKTA 2ZJPF 2LSNA 3HZ6A 4FWQA 1HPMA 2D0BA 1KYWA 1BISA 2AXTC 4LF6K 2JJ7A 4HDVA 3GCMA 2JA7J 5FB2A 3QU3A 4FT8A 1HR0K 4X66K 3N97A 1N32K 4NXMK 2IAJA 4X62K 1BBYA 4ZTFA 3P7NA 5IWAK 4ILJA 3K1PA 1YE9A 5A2QK 3SHFA 1B72A 4XIUA 2CW8A 1U04A 2KZVA 4B4CA 4AHRA 2NVQJ 4DYCA 2D0PA 3KYDB 3QRFF 5JVGL 3TAMA 2GM4A 1HKQA 2AXLA 1OMIA 1I3AA 1MDMA 3KKRA 3V4GA 5JS1A 1RT2A 1FMWA 1B9FA 2YHBA 3ULEA 4UHTA 1KCFA 4JS4A 4CVNE 5F08A 4PFPA 1WJEA 1W5CC 2HVQA 1EJ9A 3LZJA 2GQQA 1DTQA 5AONA 1FP2A 4I6ZA 4ZDOA 3PO5A 1SKWA 3HEFA 2QWLA 4DR4K 2XAFA 3TL4X 2IIRA 4EM1A 2DK8A 5FD5A 4KJZA 1OH8A 1XI1A 1VAZA 3V1RA 2D5VA 1KU3A 5J8FA 1WSHA 2UUAK 5CZ1A 3AV9A 4HUFA 1HW5A 1FMVA 4DTNA 1OCCH 3FGUA 4YOYA 2KLOA 1KXPA 2OA4A 4A3MJ 3ZMZA 3WTWC 4WFAL 4PJLA 4KTQA 4IBNA 5DMRA 2HBJA 1KQ8A 3WQUA 2VN2A 1DTTA 1ZH5A 1X1DA 2JLEA 3SV3A 4BY1J 4DHYA 4G6TB 5CYVA 2FSJA 2YNFA 1TQPA 1BOBA 5TGTA 3OJSA 4BRGA 1WH5A 2D2WA 1G6NA 3V81A 2EPFA 2VQFK 4C8KA 1K4TA 1T2KA 1OYIA 4XEIA 4XH5A 5I3UA 2VC0A 3PNYA 5LHHA 4DS5A 4CEEA 3TTFA 3TAGA 2Z1HA 5TJJA 3V7SA 2IPQX 3E6BA 3WQTA 2MGQA 4CJEA 4CJ7A 2WAQA 3FM3A 4MDAA 2TRTA 3QPLA 3KYLA 3TSUA 3BZ6A 3DWLA 4HHTA 3UR3C 4KFBA 4HEA2 3AY9A 3G3ZA 4BRMA 1IKYA 3KLFA 3SQ1A 2N8GA 1KVCA 5EOYA 1VRUA 4Q47A 2P9NB 2HQRA 3BLYA 4FWRA 3DTIA 1RNHA 3JSMA 3CQXA 5H1SQ 1YITI 3WGGA 1LUJB 2JUGA 4ON0A 1IN6A 3O9RA 2DTRA 3MN7A 3CG7A 4LLNA 2GV9A 3J8AA 2EV5A 4WFNL 1AKHA 4DZJA 2O8FA 1LFBA 2L9VA 4DLGA 5J40A 1GLFO 4NO7A 2YX6A 1PUFB 1FXXA 2P5GA 1HKGA 4R1HA 3NH1A 3BDDA 1JJ6C 3NF9A 3KLEA 4V2GA 3GX4X 1TNTA 4M71A 3I4MJ 3OA9A 2O7OA 1JLQA 3M5RA 3QEPA 1NJZA 3B6AA 4CHPA 3D2FA 2YX7A 3LWMA 1JCFA 3CCJN 3O08A 2HSTA 1X3WB 4W5RA 5E18F 4DU4A 4BNCA 3DMJA 1BL3A 2XF7A 3JTHA 1BU6O 1S9EA 1G3WA 4B3OA 3AA3A 2DO7A 3MWMA 4BR0A 1HDPA 4C8OA 2F96A 3M9AA 1U5TB 1USTA 4DV3K 2ISYA 2VPLA 5KK1A 3GFJA 1H9TA 3M8RA 3JREA 3IH3A 3DXJF 5AQHA 2WV0A 2XGEA 1EA3A 3C18A 1LEAA 5F2RA 1YW8A 3M7GA 4NC8A 2P5LC 4KO0A 1B8IB 5D4SA 1EP4A 3HOVJ 2ZE2A 2JPBA 4YIRX 2MFZA 4PKGA 1SZ2A 4WQ4C 2E19A 1U49A 1Y0UA 1J5EK 3M8EA 2ASMA 2HXIA 4YOVA 1KAYA 5J3LA 4DGWB 2NYXA 4B9UA 2E35A 5AQGA 3T1BA 2IOCA 4KT5C 2VE8A 4EVIA 2DK5A 3QO9A 2EIMH 3WTVC 2AS5F 2RDPA 4B1YB 2MLGA 5J47A 3UNGC 4E70A 2GXGA 1R59O 3RKXA 4CXFA 4DKWA 2I8DA 1TYQA 4KAZA 4MO5A 2EFOA 1XSXA 3TW6A 4LFCK 3K4KA 2PI0A 5EG0B 1RIOH 1VQ4N 4CCJA 2RC4A 2BZTA 2YKNA 4WQ5C 4DSEA 4H0XB 3V9XA 1IKVA 2OUMA 3WGIA 3H3VK 2Y30A 1Y97A 2L9RA 1A5VA 4JKGB 5SWMA 3QAHA 5KGWA 4QPOA 1W1WE 1SAXA 1BIZA 3ERED 2QVOA 2IJLA 2K02A 1R36A 1HBXG 1NMNA 3EETA 4G6DA 4LH5A 3QYBA 1LOTB 1I1GA 3QPHA 2GTDA 3CCUN 3O80A 3K5NA 3GO5A 3TU5A 4H5RA 3QNNA 2ID3A 4DS4A 2HKXA 2YS9A 4B3TK 1HNIA 4OLBA 3L2CA 3BY5A 1SMYF 1GUUA 2DFFA 3ZQGA 2BXZA 4K0KK 3IAYA 4IO9L 1DGRM 1G4DA 1Z6TA 2QSHX 3PX6A 4Z4FA 2YNIA 3CPEA 4PKHA 3FBNB 5KCMA 1OKRA 2X6WA 4CD3A 1GV5A 4L0ZB 5EY4A 1NK9A 2WUSA 4CE9A 5E3LA 3S1QJ 4Z4IA 3KJVA 4BYYA 1T44A 2LC2A 3QEIA 2XROA 1HYSA 3R0JA 2R92J 3TW7A 2DA6A 1NK3P 4BR4A 4FW1A 4FZZA 5FPMA 2LKPA 1RTHA 5GP9A 3S15J 1GLLO 1ETQA 4HRIA 2A68F 5BRFA 3GL1A 1YO5C 1SFEA 4PJJA 3HYFA 3OYBA 3WTXC 1DEJA 3A5MC 1PYVA 2Q31A 4CO8A 3WE3A 2O8CB 4OMYA 1HKTA 1JXEA 2P9UB 1MNEA 3SDGA 2ZMEC 1H8AC 3RDIA 2HKOA 1NGIA 1IV8A 4EIAA 3HXLA 3JRHA 5BOXA 1RKWA 3HM5A 4XBFA 3ASMA 1HQCA 3IKTA 1IN5A 3J7ZI 2CH6A 2QKMB 4IL6C 4JKDA 4CF1A 3SEZA 3S93A 1R7JA 3ZEUA 3F0CA 4DR3K 3CIPA 4IVNA 3WXIA 2AQFA 2HBLA 4DQIA 2KIQA 3FKIJ 1ILYA 3QP6A 1U4BA 4XORA 3R3LA 4PA1A 3CFOA 4XICA 4KRFA 4LF7K 4DU1A 5JLXA 2PZSA 3HSFA 2WOMA 1IRZA 2R5YB 1ZBFA 2E5LK 1K4SA 4CHUA 3CXCM 4B9SA 2IEKA 4S04A 3CO6C 1SC7A 5LGNA 2UXXA 3KK2A 2DODA 2G9WA 4JKFA 4EHUA 3M8SA 2M8GX 3ZSVA 4KI4A 1BA1A 3C6AA 5BRHA 1GHCA 3L0QA 2QM1A 1SVOA 2D5RA 5C24A 2B6AA 1BW5A 2B63J 4BXFA 1IC8A 3O1WA 3RMDA 1J6ZA 4M42A 2XIGA 1J59A 5JR3A 4JK8A 1DP7P 1SS6A 1YTYA 1IKWA 2RVCA 2FBHA 2CV0A 4QLCU 2YNGA 4PDKA 2IGMA 4FLZA 3DPTA 1N78A 2FX0A 5HOOA 2QEXN 1V5GA 2D0OA 1YTUA 3IRXA 1TWHJ 3ML6A 1LWFA 4B9TA 1ZGJA 4CEAA 1LW0A 1G99A 1FT9A 3GZ6A 1C0MA 1H0MA 3PM1A 3OYDA 1XC9A 3CQ8A 4M9SA 3PIPL 2LYCA 5IT9K 5MLCQ 3BF1A 2NAZA 5LMNK 3MEXA 5ICGA 4CGGA 3HRMA 1QE1A 1TK8A 4CCMA 4E7IA 3JYTA 1XGOA 4PSXA 1B9NA 4JX5A 3E6DA 1IG9A 2VWBA 2X78A 4TSXA 4RA2A 1R1VA 4NHJA 3TDUC 3OVNA 4MEYF 3P31A 3BUZB 2Z33A 2V4JC 4D5CA 3RQIA 3DPLC 2VBWA 5HLIA 4CZIA 3DTKA 3FMSA 2OCCH 2F4VK 2VQHA 2ME6A 2Q3SA 4Q4ZF 3JTGA 1HQEA 4UVCA 4JI2K 4NQWA 4BGAA 1GLDG 3K2ZA 1N36K 1JTXA 5LLQA 4R5PA 1YJNI 1YAGA 5D8LB 2RQPA 3H5RA 4XSXF 3OYEA 2D1VA 2M7AA 2YHXA 3H45C 3L1PA 5T7BA 3W2VA 2R7WA 1S8NA 4B9MA 5M3MJ 1QSYA 4MFDA 2LLKA 3JRAA 3CCVN 3TTCA 4ICLA 1E4FT 1WWXA 4CZCA 1UOCA 1JLBA 1XCBA 1RETA 1XPXA 1EH6A 1GLNA 4I09A 1IZ1A 1S7OA 4B43A 4CZEA 2JPCA 1QTMA 1OCOH 4MFBA 6PAXA 4XLCA 1RCHA 3D5LA 1JHFA 3CERA 3DJCA 3ABMH 3VA0A 2I7NA 4E0DA 1T3VA 3IP4B 4KHWA 4JI8K 1VQLI 3SYTA 1P8ZA 2HVSA 3E6CC 3AARA 3NF7A 1R58A 1U5TC 4IDKA 3LWLA 1QA6A 3RCOA 3CPWM 1B72B 4J2BA 5AR0A 4CZGA 5IYDJ 4PSWA 2O3FA 4QWQA 5EVZA 3ZQLA 4KYWA 4W1UA 5E1XA 4F3OA 4BQAA 5CLSA 4HLXA 2LY1A 1FPQA 1MDMB 2MH9A 2PJPA 5C4JJ 2F4MB 3DOLA 3UB5A 3VN5A 2HZDA 4H4KC 3ULEB 4BR2A 2M7BA 3JRDA 4L9TA 3ZQCA 5LHIA 3WG7H 4BR5A 2ZB9A 4F93B 1D8JA 4G7HF 2V9VA 4OJRA 3GE1A 3M1CA 1YHQN 3ID8A 1IDZA 1FBUA 4DYRA 3MKWB 3U3GA 3FM5A 4N9IA 4WK8F 4DCHA 3FZVA 1XGSA 1RTJA 4O8UA 4HG2A 3F8BA 3CCQI 1VSLA 2HXOA 2GOXB 3CFPA 3JSOA 3VTIA 1QQCA 2UWMA 2DFHA 4EZ6A 1T05A 1W4MA 2IA0A 2MABA 4AVPA 4DSIA 1BA5A 2R7SA 3ZT2A 3RI4A 2MG4A 3IRQA 3K7AJ 4I7HA 5HS9A 1TL3A 2PJRA 3K1NA 3CCEI 4E1NA 4PWDA 3CO7C 2QKLB 4BHBA 4AIKA 1IF1A 4FPBA 3J80O 4CZLA 2XHBA 4CA0A 4X65K 2L9NA 3CCSI 5HRPA 4FLTA 3MZ8A 3OYJA 3CCYA 4BEHB 4JX6A 2VBZA 3DFGA 3LDSA 3G73A 2Q2EA 3KPHA 2HOEA 4IFVA 1L3SA 3MMYB 5BMZA 1BC7C 4YORA 1VK0A 2A69F 1JCGA 3ZT4A 3QOEA 1WAJA 1SL1A 3BT9A 1BWFO 1GXQA 3KP4A 1LDJA 4DW6A 3PO2J 4E7LA 2EBIA 3VMFB 3EPZA 3PFIA 4Y7NJ 2K3FA 3LSIA 3ATVA 5JHUA 2ZSHB 1WQ2A 3AVAA 1QHHD 2WTEA 4B3AA 2E36A 1OJLA 1Z1DA 4L5IA 1VQ7I 1F1ZA 5AFUH 1X1AA 2F6CA 2M9HA 3W3CA 4B9QA 1ZG1A 4AWXB 2HYFA 3SUOA 2YI1A 2KQ2A 2VJIA 1JLAA 4NB5A 3DCFA 3GG4A 4GXOA 1HF0A 2QQBA 2H1KA 1SVLA 1WBBA 3LDLA 1DGKN 1NKBA 3MN9A 4ITVA 1XMQK 5HRRA 2X51A 2E2NA 1TP4A 3K2PA 1ZBHA 3HC7A 1QZEA 1W0UA 3G1MA 2HTSA 4K42A 4FYDA 3N4PA 4M3WA 3IWZA 2WTUA 1YI2N 3VF6A 2CS3A 2QA4I 4WXCA 1KSPA 1V54H 1R5ID 3OYCA 4E7ZA 2IA1A 4CERA 2B5JA 4I2QA 2BDPA 4F92B 2G8VA 4XLAA 4U0YA 3FZFA 3ZMVA 5E26A 4Z0UA 4BC5A 3K10A 1X1PA 1BIBA 3CM6A 5J1EA 2ZKZA 2XAQA 4U87A 3NGYA 2FF4A 2YCHA 4A3DJ 1X9JA 2DOFA 2DTUA 3L7WA 3DXKA 1FBSA 1BG3A 2E6MA 3HPHA 3SUPA 3H46O 3BR0A 3MCZA 4IOAF 4YFNF 1IGNA 1OPCA 2NXNB 2KRHA 2G8IA 1JT0A 4JEPA 4FE4A 3MKLA 4IFYA 3RR7A 4CZFA 4LF5K 3IUOA 5AQVA 3BY6A 4YHHK 5LJVA 3Q7BA 2E1OA 1XUPO 3RSNA 2W48A 3ZETA 3ZMTA 5L3BA 1UG2A 4XLFA 5LMUK 4M9XA 1U78A 1IO2A 2KHOA 5J8CA 2A1SA 4FISA 4DUYK 2E7XA 1FYKA 3VA3A 4NCBA 3BDPA 5BPLA 2Y31A 2P9LA 1F5TA 1I1SA 2HWVA 1E3MA 1TKZA 5BS6A 2KHMA 2UXCK 1J53A 2KPMA 2GBYA 3KK1A 3BR2A 3M3ZA 3KP3A 1Q9YA 4BJ6C 4WXHA 4CGFA 1U48A 2VQLA 1TYQB 3RRHA 1D1AA 1VSMA 5K7FA 4M41A 2HI3A 3TP3A 1ACIA 1S29A 2G0EA 4J8FA 1MKMA 1LPQA 4A5MA 3G4SI 1ETYA 4KHYA 3DAWA 3BP8A 3V9ZA 2M45A 4JKEA 5GINA 3GF2A 2HHQA 5GAHJ 3MN6A 4A0XA 1Y0NA 1TQMA 4LFUA 4YELA 1HRHA 5M1KA 4J00A 3HSRA 4LIUA 5EU7A 3PO3J 4DV6K 2ISZA 1HYVA 1IV0A 1YIOA 1XC3A 3ULQB 3LSPA 2L9SA 3CCQN 1R1TA 2JRTA 3EZ5A 4ESBA 1ETKA 2XRIA 3KZIC 3A01B 5D5UB 1XC5A 4DU3A 3EY1A 1MBFA 4JI0K 2E60A 4LSLA 2NNWA 3RTVA 1ODDA 1U2VA 2QGUA 4I9QA 4CBWA 2Y0MA 4WQ4A 1KU7A 1ENHA 4CYCA 3ZYYX 3DEWA 5AQMA 4FWLA 3KZZA 1RKTA 3VPRA 2ZFUA 1JI8A 3QDKA 2A3SA 1U6ZA 1X1CA 3DQVC 2J5PA 2IS4A 3SYZA 4M3UA 1KONA 1WUAA 4GYGA 3LM9A 2DDBA 3E97A 4CICA 2VL8A 4HUGA 4M63C 3CCSN 1XDUA 1IBMK 3GTOJ 1C1AA 2JA8J 4H5VA 3JXUA 4N56A 2DY4A 3HHGA 1SD4A 1RDBA 1R0AA 1J7KA 5FKNA 3KP5A 1J9AA 3UKRB 4XK4A 2CGJA 2BV6A 1SEUA 1QHAA 3LP3A 3BR5A 5JLFA 3THYB 4KISA 2HNHA 3K5OA 1XGMA 1QU3A 2W57A 5B3SH 4BRLA 2W6LA 4CZKA 3A1YA 4IQ4A 1MBKA 3FBIB 5AQZA 3UIQA 3NAUA 5C12A 3GOIA 3CJ7A 4YOTA 1ZBIA 3WTZA 3FXQA 4HBLA 3MWTA 1BI3A 3V9SA 3OYLA 4IOCL 3K4JA 1IN8A 3PIOF 4PGHA 1NK7A 1W7PA 2UUCK 3D7EO 3THXB 1UZCA 2V6CA 3I59A 1YXQA 3B6PA 2ECCA 3E1SA 5K1YA 1QHGA 2O03A 2X6SA 1Q81O 3ZEUB 3LWFA 2IC3A 1I5ZA 1QGPA 1W0HA 1D5VA 2BHZA 3HGYA 2HYJA 1IAWA 2ZJRF 1S9HA 3ZT3A 4JKAA 1N33K 3FXLA 1IUYA 2O8DA 1V4TA 1FOYA 3SQNA 1RT5A 2NRZA 4BR9A 3CD6I 3DEEA 1IG8A 4KREA 5CY4A 4YFUA 5IT3A 1Z9CA 4I2OA 2PMZA 3VERA 3CZ6A 3DV8A 1T98A 1WSUA 5AQIA 3ITHA 1FTTA 2LDUA 2BUPA 4HQEA 4UUTA 3PNVA 4FJ5A 4C1NI 3F72A 1BOAA 1Z77A 3K70D 5EX5A 4BQQA 2BXYA 2EA4A 2K40A 4BBSJ 4LG0A 3VGMA 3WNHA 2QKKA 3BCBA 4JBAA 3V7CA 1AU7A 2FBYA 3ZSOA 4XOTA 1K7AA 4XKBA 1HMVA 2STWA 1QZ5A 2QTDA 3OBYA 3G1OA 1IDYA 5BN9A 5D4RA 3C6UA 4F3QA 3DU5A 3M8QA 3E1YA 2XRLA 2GWRA 2GWKA 4GDFA 2ZMEA 1I6HJ 3Q5FA 3FK7A 2CQNA 2HDCA 3VGLA 2W7NA 3H5NA 2IT0A 2DPNA 5A2QZ 3BR6A 3C0BA 2V26A 4M3FA 2P81A 4ZC3A 3VQCA 1SD5A 4RW8A 4FWKA 3VQ6A 3H0GJ 3HVTA 2HPMA 3CHWA 1C0FA 1UG0A 2XUBA 2XY8A 3EN9A 2XDVA 3TOAA 3ABKH 2A5XA 2KDOA 3WTSC 5FJ8J 3HG9A 1DT9A 4BVOA 1OVQA 4LH4A 4HYEA 2VWKA 2JTVA 1B9MA 1UHMA 3THWB 2VJ5A 4MO7A 3H9GA 1GVJA 1YJ9N 1Z67A 2Y75A 1N34K 2F4IA 2WAEA 1JKQC 3G4SN 1UMQA 3T7ZA 4NQWB 5B1BH 3WE2A 3QESA 3NWTA 3ZT0A 4C8NA 4XM3A 1CZ9A 2E1CA 3CMEI 1ON2A 1N25A 1QRYA 2STTA 3I64A 3IMXA 3GZ5A 5J4YA 4DIQA 1RRJA 3IAS2 2OU2A 2Q2RA 2QWOA 3Q3SA 3F8NA 5L3GA 3DWLE 1QBJA 3A5OC 3OS2A 1GLAG 2H3GX 1F9NA 3GLLA 1H9GA 4K41A 3FISA 4YIIA 1DP3A 3VEVA 1VQNN 5KHDA 2ESHA 1HQUA 3M07A 3NWSA 4FJKA 4L5JA 2MH2A 2H8RA 3FF5A 4OPJA 2FBVA 4BGDA 4XH1A 3DKYA 4DBQA 2OPTA 4O5BA 2D45A 4FE7A 3S14J 1IXSB 3MQ0A 2QBYB 4XRSA 4M74A 2ZJQF 1TBXA 5JLHA 1ZAOA 3CJAA 2IDOA 2LREA 2BTFA 3O9UA 5DM7L 1SFXA 1HW1A 3WHBA 1FSEA 2Z3YA 3H08A 4QPQA 3NFAA 4Z6YA 2FOWA 3BCAA 4B3XA 4HAMA 4CZJA 2CV1A 2NVTJ 3LDQA 1S6LA 5AQWA 3MN2A 2R7TA 1DQUA 1EV7A 1U0JA 3TEDA 1RC9A 1APLC 3IS9A 1U9OA 4NC7A 5E3OA 1NKCA 5I42A 3HI0A 2P0WA 3A03A 3KX2A 2FSKA 4KHNA 3TO9A 2PQ8A 3I53A 2V7YA 2F7TA 4L5EA 1J0RA 4C8LA 3H92A 3GTKJ 4ILHA 4EJTA 3C6HA 4A3GJ 2P9NA 1MNMC 4ELVA 5AQTA 1BQMA 4BROA 3ZMSA 2W85A 5C25A 3H35A 2YHYA 2DA3A 2ZJ2A 1VQPN 3ZQ7A 5AQQA 5AQXA 3R8EA 2YU9J 3KP2A 3M8FA 3ZQQA 1Z05A 1B92A 1BJAA 4BQZA 4BUPA 3AGRA 1KA8A 2M87A 1BW6A 3VF4A 4KTZA 4KICA 1LNWA 3QERA 4H5TA 2E1MB 3H0DA 1NGAA 2V9KA 1R1UA 2QKBA 4O5VA 3DTEA 3ELKA 1PUFA 1XNRK 1TW2A 4XRFA 3S32A 4XIDA 4JK9A 3EDPA 3OYIA 2IS3A 1SV5A 2CUFA 3LA2A 1S22A 1S1VA 5E1ZB 4IOXA 5H6QA 4FLUA 4IHXA 4Z94A 2I5JA 4B3MK 1RR7A 3NH0A 4Q48A 1TZLA 1RGIA 4JK7A 5FLVA 5IYBJ 1AA7A 1RDDA 3L6QA 1WPKA 2K9LA 1POGA 3IKVA 1XS9A 3K4NA 3WGHA 3VF2A 2V9PA 3NQOA 3C94A 4JLHA 2YNHA 1VQ8N 1ZK8A 4N5SA 4B44A 3BZKA 4BHPA 2P5VA 3ASOH 3B6CA 4BRKA 4ZJZA 1U5TA 3C2GA 3S8PA 1C1CA 2Q2EB 3T1YK 2BGCA 3AG1H 1ZRFA 1GDTA 3WTUC 1FYLA 1TAQA 2W24A 1W9HA 4HNVA 1TT5B 2EFNA 4O8KA 1W7AA 3GUDA 3CCMI 3QQAA 1Y56A 3HSTB 1Z7LA 3VQ4A 4BC4A 2D1HA 1G3SA 2QXFA 4V19K 2G8KA 3EUKL 2R3SA 4IKFA 3O5BA 4CEOA 3MECA 3GEZA 4WE1A 1CLQA 5E41A 2FBXA 2BGGA 3R61A 3WXJA 1ZG5A 3OOUA 2KKZA 3DXMA 3L3UA 2FBKA 4FASD 4AD9A 4L9VA 4CYDA 3K0SA 3OR2C 1HDDC 5JFRA 4FOIA 4UUVA 3K57A 4XKVA 1S72I 4BDPA 4I76A 1JL2A 3IAM2 4P9FA 3AO2A 3TARA 5C2DA 3VQ9A 1HUXA 4M6XA 4QS9A 2GOMA 1UB9A 5F0CA 4H03B 1Y1WJ 1FZPB 3D6RA 1F43A 3C2HA 2LFBA 3WU0A 2DPDA 1K8AO 1BIUA 3CUOA 3WU1B 5ILVA 1JE8A 2OPPA 2QSGX 4BS9A 5HDGA 2UUBK 3GTQJ 2H94A 1DPRA 5AJ3K 2XF5A 2K3PA 4XLPF 3I4NJ 4JKGA 2M34A 1PDNC 2LRDA 1G59A 3CMEN 1VQMN 2GUPA 2FE3A 2H1LA 3BTLA 3RKQA 2VBYA 2XY6A 2PFBA 3I56I 1RDUA 5AQRA 3DBLB 1HKBA 4BG9A 4RGXA 3E01A 3PLAA 2F5FA 3DXKB 4RW7A 5AQLA 1BUPA 5JVTA 9ANTA 4FK2A 1ZHFA 1MMAA 5E3NA 4DV2K 5BPIA 2BVLA 3ZQHA 2KZGA 3U9ZA 4B8XA 3DI6A 1Q8IA 3AO4A 3CC2N 2DA7A 3BOQA 1SKRA 5AQFA 1KU2A 1V5FA 4I0AA 1X9SA 1A5WA 4BY7J 1I6XA 3QPSA 5J1UA 1J75A 3ZETB 5DCMB 2W4SA 4LY7A 4FPAA 3WXLA 3EKSA 1UHWA 2MC3A 3ZGKA 2G8HA 2PFUA 1FX7A 3BROA 2JUCA 1R5HA 2VGMA 4FM2A 2DQLA 1V4SA 3FZLA 4KBOA 2DA1A 5BPNA 4BAYA 5J2QA 2CYYA 3QEWA 4JI6K 2D0CA 1N8RO 1QSLA 2ZO4A 1T38A 4Z4GA 3HOSA 4L9JA 4DQSA 3F73A 4KB0A 1XTAA 1BCOA 2LKSA 5K7ZA 1IXCA 3ECHA 3DP7A 1N5YA 4EM0B 2R7YA 4J2AA 1LE8B 3VYUB 2JWKA 2M1BA 2IP2A 2A61A 4CBXA 2O8CA 4GV6A 3MEDA 4MO4A 1TTYA 2FQ3A 3JAMO 2ASPA 3FFKB 3RPUA 4ENKA 2VG6A 3H6EA 4FJXA 1IN7A 1Q1HA 3WHCA 2WC2A 3AVLA 1GOBA 1K61A 3COAC 3FXJA 4AHVA 4IF4A 4BQLA 1P4AA 1OCZH 4M3XA 2RE2A 3FK6A 5JLWA 1RDAA 4LIVA 5DDGA 2FLOA 3M3YJ 2HNDA 3IV5A 3ATUA 2I5UA 4B9NA 3E9PA 3HTSB 1E3OC 4B1VA 5HROA 2IVNA 4KITB 2VXDA 4BWJA 1OH5A 2P8TA 4KIBA 1EF4A 3U9DA 2R5YA 4DFPA 1J9IA 3WTTC 4PQUA 3I0SA 3HOYJ 2K5CA 4QS7A 4YIFA 2HQAA 3AG3H 5B5EC 3ONQA 3O1BA 2R7RA 2NS7A 4HX7A 2EX3A 3H3OB 5C42A 4L9NA 4ESFA 2PAVA 3ZX2A 3I54A 4ZYEA 2R7VA 3S3MA 4BDZA 4CFBA 3LSTA 3KEQA 1S7EA 1T8IA 1MDUB 3EZWA 1YS6A 1WI9A 4II2A 1EX4A 5DM6L 1VQ5N 1KQ9A 4F7ZA 4CJ4A 3CMYA 3OSFA 3DOKA 1RFQA 1TLHB 4LJZF 1IW7F 4CFDA 3O6BB 2NRTA 5CVIA 1E4GT 2XB0X 4FHTA 4CF8A 5LEKA 2K27A 4CEFA 2NUBA 5IT9Z 4CCOA 5HVQC 3IDHA 1XSVA 4FOEA 4FM0A 1BR4A 1ZXOA 4JI4K 3V8JA 4ISFA 4AVZA 4PHTX 5LGUA 4CIFA 1B59A 5E20A 1RT1A 1S1WA 4UUSA 4AHSA 3RMCA 2L7MP 2L02A 4WX9A 3LAJA 4J01A 5KPRA 1TAUA 2Z1DA 1IH7A 3LA7A 2GAUA 1TVRA 1KVAA 4RLFA 4QTRA 1TWFJ 2CFOA 3NHGA 4A59A 5H2FC 1FYMA 4ENMA 1S1TA 3FZHA 1MNDA 3AAQA 3Q0WA 4OPKA 4ETSA 5I9EB 2E34A 4CJ3A 5KRSA 2A41A 1X4PA 2A6TA 1JL1A 5J2PA 2NVUB 2CU7A 1MMGA 3CCJI 2AQEA 1S3XA 4FVMA 2Z1JA 3RIRA 3A0BC 3WNGA 4C1NK 2O4GA 2E1ZA 5C2FA 2EJRA 1OVYA 2E5NA 3NBPA 2OZUA 3HOWJ 3QLHA 4A6DA 1HOMA 2FC0A 1VSEA 2NLXA 5AIPA 3L00A 4K43A 4OGEA 3KK3A 3O6WA 1K73O 4FJGA 2H6BA 1YW9A 2HMPA 2E1MC 1CXUA 1E2XA 5TKWA 3W6VA 1WSGA 4MQVA 2NOGA 2J4RA 2XHKA 2YX4A 3V8KA 1JJ8C 2BY1A 2EFWA 1Z21A 4EFHA 3NVKA 3CJ9A 5F1RA 2D0AA 2HVIA 1EWQA 3LSGA 1BI4A 3V42A 1LB2A 2DQRA 2WONA 2ZMEB 2L4AA 4ZYHA 3QU6A 2XGXA 3KP6A 3JRFA 2DOEA 1W36D 2ZJPL 5ILSA 3PV8A 3QODA 1N75A 2VG7A 3GFIA 4LSNA 2R5ZB 5CQGA 4GGGA 3BTJA 5FKMA 2CWEA 4KA4A 3ZQIA 5FDLA 2P7CB 4M72A 3ZP5A 5F64A 2P1JA 4XSZF 4JRQA 4RGRA 2VODA 4RW6A 2KIMA 4BJ5C 2JMWA 4X1EA 1ETXA 2WAQN 2VG5A 3QBWA 3R0AA 4P96A 1WLJA 2HDDA 2CUJA 3HP9A 3CLQA 5EF6A 4ISEA 2L54A 1VQ4I 4FWMA 4A61A 5IOYA 3F5TA 3KWGA 3U21A 2FEZA 3VYRB 3QEVA 1R9TJ 4RAZA 3DLLL 1UAAA 2XF6A 2Y2ZA 4UB6C 4CSWA 4CCNA 4MLOA 2Q36A 5AQUA 4A3BJ 3VFZA 1DPUA 4OIQF 4DV4K 4LC9B 4OINF 2V6EA 2PG4A 2A5WA 2JSPA 4GNIA 4RAFA 3S17J 3WXKA 3J7AP 4M3GA 4HF1A 4JD2A 1XQSC 3CCUI 4CF9A 4HNTA 3ABTA 4K25A 3REOA 2XAHA 3MKYB 2QWMA 2EH3A 4X0GA 3VESA 1X2MA 1OFCX 3DF8A 5L3EA 2NRAC 2LMDA 4BVPA 2X4HA 2JT1A 1Q1VA 2DA5A 4JI3K 1GVDA 4CZZA 3S2HJ 1QVGM 4OOIA 2WY8Q 2F4OB 3O9TA 1Z7UA 2HBMA 1T8EA 2XAGA 4QAGA 3SEQA 2LG4A 1KYZA 3G2BA 5FLMJ 3FXUA 4DTJA 5FLXO 4PUOA 3LSKA 3SK3A 4DJAA 4GCVA 4IZ9A 2LTPA 1GOCA 2DFIA 2ELKA 4Q5VA 3SBTA 3FIWA 3AVIA 2QWRA 4NCGA 3VEZA 4UY8O 4BEHA 3FR0A 3EYIA 1WJAA 4N0BA 4JKCA 4CIGA 2CQKA 3DLRA 2P6SA 4FXDA 3HUGA 3S16J 4RS8A 3MXJA 2WB1A 3RRGA 5DTDA 4U0WA 3ABLH 1JUPA 1OCPA 3KLOA 1USSA 1TK0A 4CCLA 1KAZA 2P7VB 4PKIA 1NG7A 1UELB 2BE5F 3KZYA 4FWSA 3KK7A 1FJGK 4M45A 1YLFA 1C1BA 2IGNA 2FMLA 2HNZA 4LF8K 4PL7A 5DK5A 2K85A 2E2JJ 1HKCA 2BHYA 2VT3A 2CMPA 1NKEA 2O0YA 1NM1A 3VEXA 4KMUX 2EWNA 2W6KA 1VNDA 2GA1A 1CXQA 2XO7A 3PFYA 3HZJA 1SAUA 5DM7F 2A42A 4BL0B 1HNZK 2KRCA 5HODA 4MEXF 4I2PA 1X19A 5M1FA 4MTEA 4WCGA 4X6AJ 2MBFA 1Z3XA 5C15A 3ID6A 1W97L 4IEJA 2RNGA 1SKSA 3CDIA 2XASA 2FNPA 4LK0F 1MJ9A 2ZWHA 3I55N 3LDOA 1WSIA 4LLLA 3V4IA 3BPXA 4CGHA 4PJ0C 3L2QA 3M8JA 3H9QA 3VQPA 1VZ0A 1O3SA 2VGNA 4HX8A 4CEZA 4HF0A 3O4QA 4CW7B 3JAMZ 2G7HA 2PYJA 5K5QA 3VQAA 1G15A 2V79A 3AVFA 2XPWA 4LFAK 5FROA 4U67L 4HPQA 3HJFA 1H1VA 3CJTB 1X9MA 4JKBA 2Q97A 1NWKA 3MKZA 3A2KA 3DKWA 3EUHC 3VETA 3TSPA 1P92A 1LVAA 2A6HF 1TKDA 1UAXA 4FWPA 4C2MJ 1YVUA 3FZKA 3OIOA 1D9FA 1JUSA 5KPZA 2XKOA 4FO0A 2CW7A 3VPZA 4LOCA 2CJJA 2EV6A 4MLHA 4Y4RA 1ZLJA 4DSFA 5DUIA 3BR3A 2O61A 5K5OA 1XX5A 2QEXI 3TANA 3LDNA 3VQDA 4C9YA 3NCIA 2MLKA 2VIXA 4E3SA 1KU9A 4HV6A 3TO6A 3RZDJ 4B9LA 1RBVA 2X48A 1Z3YA 1ZC6A 4MDBA 4O0JA 1LV5A 1BI0A 1ONVA 5AZIB 3DXMB 3ZCOA 3SZTA 4AHUA 4XRSG 2DMNA 1JCEA 4HSTA 2COBA 1XMKA 2L01A 4CCHA 4GW6A 1EXQA 2DT6A 1LVKA 1T6SA 4ELUA 3C2BA 4PY5A 4OLAA 4MQ3A 1R22A 2PN6A 3L2RA 2NRWA 4LB6B 1KFSA 3AVJA 3CCLN 2DA2A 4M7XA 3ULDA 4BWMA 3SLCA 4EV0A 3BJ6A 1R4NB 2CQQA 2OZSA 1JXBA 4BJTA 3PUBA 4Y1DA 4XRMA 1TQIA 3CC7N 5DD8A 4HSRA 5H20A 1S5JA 4IDHA 2FRHA 1JTYA 5BQTA 3MMVA 1MBHA 5F0XA 1ZRCA 1NK5A 1QPIA 5CQEA 4M3EA 4RBOA 3WNFA 3HGGA 4DG1A 2OTLN 1ATNA 3T69A 2XY5A 1WHUA 4U7DA 5HNFA 1TWGJ 2DT5A 2F2EA 3K2AA 3CCVI 4WXDA 3Q0UA 1F4KA 3G71I 1RT3A 5GPAA 1O1WA 3H9JA 2XV4S 2ZSIB 2BY3A 1JLFA 3JSPA 3NH2A 2WC9A 2DN0A 3A01A 1JGSA 2B4JA 4CGDA 1EH8A 1K9MO 4B1WB 1P7JA 1NH3A 4LF9K 4FM1A 2QWWA 4BRQA 2V1NA 2PMHA 3V1QA 3L8BA 1VSIA 2W84A 4M3ZA 3QINA 2DAOA 2XGDA 2X1DA 2ZGZA 4G9YA 2Z5UA 1S9GA 1NK4A 2M0CA 2HFHA 4BQNA 2QCOA 1O13A 3U4LA 3D45A 3KLNA 2K9SA 4GKKK 4CJSA 4CH7A 2P9SB 4DQRA 4IQJA 3ESWB 4DYQA 5GTHC 3O3KA 1FEXA 1FLIA 1MSFC 5BR9A 3D0PA 2LOOA 1FJLA 1FIAA 2HHUA 3UKRA 2HNYA 1D0ZA 4JI7K 2LD5A 4Y17A 1WJFA 5GADP 3DRSA 3EL2A 3THYA 2O5RA 4FK0A 3WU2C 2ACJA 1FOWA 3BZCA 1IN4A 4FJLA 3LSMA 4WYBA 3L2UA 2HEOA 5BRDA 2OQGA 3GTJJ 1YHQI 3IL2A 4BE1A 2OV7A 5GTIC 2BH1A 2OF7A 2Y0SA 3SFIA 4XNFA 2ZNZA 2VOPA 4I99C 2VASA 4FWOA 1XHZA 2OPRA 3ZOBA 3THXA 2CH0A 2O9LA 4CDGA 3H1QA 3NEUA 3ROUA 2NS8A 1JUMA 3AVCA 4BBRJ 2D4WA 4JI5K 5K5RA 2X1EA 2BE2A 4OKKA 2NZTA 1IBKK 4YFKF 4EJVA 2IRFG 4CZMA 4N9HA 5GADJ 4ASNA 4CHOA 4YOWA 3CF5L 1VQON 2QI2A 1QVTA 1BL0A 4EMSA 5EJCA 3EEQA 2KRFA 4DF8A 3WG9A 5AZJB 3TSQA 2ME0A 1U47A 4YDUA 2EZLA 3ZSYA 4EM2A 3BG9A 3AGKA 3T1HK 2D1KA 3IH4A 4FQGA 2ICWG 4NNJA 2F5EA 4W5QA 2Z1IA 4M3BA 3QPTA 5HLHA 4N4NB 3PJRA 4RM2A 2K86A 3Q9SA 3TDZC 4FVUA 1RT6A 3SMSA 2CQXA 1FW6A 2XAUA 3L9FA 2AO9A 1K79A 2LVSA 2GZWA 2QZ8A 2XSDC 4KIGA 1IRGA 4HX4A 2LBFA 2VKDA 4BE2A 3H3UA 4BQOA 1RDCA 5KAIC 1F21A 4W5OA 3MK6A 2EWSA 1ZBSA 4HTLA 5IP7J 4IG0A 1O4XA 4FSVA 3HKZA 1K6OA 3ENOA 1XHXA 3SAHA 2KT0A 2TCTA 1LWCA 4H0TB 1UA1A 2G7UA 4CK2A 5IP6A 5BREA 2DMUA 2WY7Q 1ZN2A 4ENNA 5KI6A 4EJUA 4FJ8A 2QENA 4UUSB 1JLEA 3LP0A 2VQGA 2WBNA 3DBRB 4G6QA 1R4MB 2W40A 1Y8RB 4HCCA 1HXDA 5CPRB 4OAYA 4MQ9F 4A0YA 4IG3A 1LKXA 2QF7A 1HJRA 1P7IA 4CJFA 2RREA 3M1EA 3CQYA 1SAZA 1ASVA 3GMEA 1K8KA 4KIFA 2H8WA 5DM6F 2ZD1A 3N4QA 4DTMA 3QICA 3F9KA 1D5AA 3CESA 3THWA 3C65A 1KVBA 3ECOA 3HPOA 3ASNH 1YI2I 2EILH 2X1CA 3CJBA 1ZTRA 4FJHA 2AHQA 4BC3A 3QWLA 4KPYA 2DXIA 2WFBA 3ZLJA 2HOTA 4NBQA 3O3FA 3MX2A 2J5OA 1KRPA 3T5XA 3MX5A 3VEYA 2YV0X 1Q18A 2HF4A 4EEFG 1ON1A 3NMUA 3E9OA 2CQ7A 1LFPA 4KB1A 1S1XA 3WEEB 1ZREA 2ZFWA 5HBMA 3QMLA 1GXPA 2ELJA 1FNNA 4IJAA 5D6FA 4NLBA 1GLBG 3KLGA 2VQCA 4YOUA 3FXOA 2V51B 3G71N 3L4IA 3DPUA 2RN7A 3GXOA 1X58A 2JGUA 3O3GA 4ABZA 2JVHA 1I94K 4JKHA 4H0VB 3OW2M 2QLZA 3BG3A 2P9PA 3D5RC 2WADA 3CYMA 4BHCA 1FY7A 4K2EA 1S6PA 1SFUA 1BI4B 3B8AX 1FKPA 1DU0A 4A0ZA 2R7OA 4RLQA 2DMPA 1SD6A 2TDXA 1V3FA 3M4OJ 1JHHA 3ZQFA 5AFUA 2E8AA 5CVRA 2QBYA 2ZM6K 3NVMA 5E3MA 3ENHA 2QW9A 1VQ9N 3D5SC 4M3TA 4B3SK 3T0YA 5M1QA 3SNNA 5HLTA 2I7PA 1WJBA 1YJWN 2Z1GA 1VSJA 1B1BA 5ADXH 2VYPA 4C3HJ 1NJIO 2KIFA 4RB3C 4CIEA 4OO1J 4E1JA 1MGTA 4KHUA 1REPC 2HHXA 3ZX0A 3U1KA 1X1BA 4M6VA 2CGPA 3QB0A 1J09A 2GIVA 1NK6A 3HRSA 3F6OA 4FW2A 2VC1A 2LSOA 4WFBL 3BWGA 3BG5A 1YG2A 4Z4HA 4D7NA 2HQNA 3L2WA 2F5CA 3MEEA 4FK4A 1TUYA 3K5MA 4Y52J 3HIFA 2ZCWA 1ZELA 5F1XA 3FMQA 2ZXIA 1CGPA 2BOLA 2HZTA 1QSSA 3CJNA 4L3QA 2ITMA 2XGCA 1OH6A 4LMYA 1VSHA 4JQFA 4CEDA 2NRHA 4JD2B 4CZHA 3DLHA 3X2QH 3FDYA 1XD7A 3T1AA 4LLGF 2GIZA 2Y48A 2UV1A 3OWTA 4DTRA 2DJNA 1R00A 4HLYA 4HZFA 1NGBA 4EGYA 3RYPA 2F5DA 1S6QA 3AFHA 1WBDA 5CJ9A 1RTDA 5F0FA 5D5VB 5JVGF 4IRGA 3GFLA 4NB4A 1KZHA 1NK8A 1X9WA 2BBYA 1X4OA 4C30A 2JWLA 1JJ2M 3DLLF 2BW3A 3KZBA 3MCAB 4ZDLA 2OCEA 3J7AO 3EE8A 1CZAN 2HU9A 4A3CJ 4G7OF 2PBIA 1NJWA 1XMAA 3HUGB 3OYNA 1F36A 2FXAA 1NGEA 3VOVA 2E5ZA 4XQFA 3CJCA 2IVPA 2AP1A 2OBPA 4AUXA 4ZHRA 4G9ZA 1QZ6A 1QVUA 1QQNA 3BQZA 4D1QA 4M3DA 3IH2A 5F1JA 3F9MA 2ZC2A 5JHFA 5D3GA 3O8GA 4DTXA 1YX5A 1JLGA 3KTQA 1Y8QB 3T8RA 3LPUA 5IYCJ 2LH9A 3K9KA 4XOPA 4UNOA 1DU6A 1FIPA 1YOVB 1TV6A 4NXNK 5IP9J 2HHVA 1LCUA 2V1UA 4V2FA 3ZPLA 1WFXA 2FF3B 4BC2A 5E84A 1Q9XA 5BR8K 1V4RA 5FD6A 3K0LA 2YUSA 1FTZA 1SVMA 2JVGA 2K4BA 1KLMA 4N47A 4G7ZF 3J81O 3A5NC 1JGGA 5KAFC 5HLGA 4IRIA 3F23A 1G2HA 3PY8A 1OLTA 3HO1A 1K6YA 3H36A 4BG8A 2MW8A 1WKMA 1QHTA 4P5OA 3S1MJ 1Q7YO 1ETWA 4ID5A 5TKYA 1Y1VJ 4H0PA 3U2RA 4KFCA 4CJPA 4B1RA 4II3A 3PSFA 1KQ0A 3R1XA 2DPUA 4XL9A 1P6RA 3I0TA 2M4KA 3BG6A 3VQBA 5L3DA 3SQ4A 1LWEA 1SFKA 2CG4A 4XONA 5M5XJ 3VQEA 3LSJA 2ZNYA 5C4XJ 2F48A 3LNQA 1WJCA 3JAMK 3ISPA 1NGHA 3AKZA 1SL0A 4V19S 2K9NA 3C7NB 3OY9A 1VQKN 1TW3A 4DV0K 3JW4A 1OR7C 4QSHA 3AVGA 3CTAA 2E20A 4G1QA 2HS5A 2Y9YA 3OTOK 1WI3A 3ZSWA 4JYAK 1T39A 4M3RA 1W7PD 2ZXJA 4DF4A 3BQYA 4Z2YA 4CJKA 3AO5A 2M5WA 2HHTA 4LF4K 1X3ZB 3H1CA 3AAFA 4AM6A 1RBRA 4FJIA 4XMYA 2R7ZJ 5GAHP 1HNWK 1NLVA 1SQKA 3UKGA 4IOAL 5DCMA 1I3QJ 4C2UA 4FLYA 2O4IA 2K9MA 3D1NI 2DMTA 3BJOA 3KE2A 2R7QA 4LGWA 3SQ0A 5E1WA 4YFXF 5C44J 5LRSA 2IBDA 4CEQA 1PP8F 5EZHA 2LR8A 1NOYA 3FXRA 3RPQA 1T7PA 1QZZA 1A6QA 3EO3A 1Q82O 3E5QA 1MSEC 1IKXA 3CDLA 3VWBA 3P39A 4R79A 3CCRN 4LK1F 1YJ9I 5EYRA 4NYFA 5FPEA 1LE8A 1K83J 3S2DJ 4AH9A 1UA0A 1UJ8A 2F5VA 3PQJA 2FNAA 1B6AA 4AIHA 4OKEA 4KHSA 4IEEA 3E5XA 1S7AA 1ZKGA 1L5UA 3E66A 3E6MA 1I27A 3GVAA 2YHAA 5LFAA 2MD0A 3RTRA 2CH5A 4B08A 3SBGA 3EUHA 4WCEL 3CUQA 1IXRC 1VF9A 5M1OA 1I50J 3SFZA 3K69A 4LB5A 1GV2A 2Q1NA 1A5XA 4QIWN 4CD1A 4PK4A 1OH7A 3MVPA 4BRHA 1JKOC 3EUAA 5HL7L 3WT0A 3RSEB 1VQNI 1SFOJ 1NG9A 4JHDB 4LITA 1I39A 4FLWA 5EGOB 4IXAA 4IHYA 2VJJA 3MN5A 4M7YA 3RKWA 3NAEA 2X6YA 2DI3A 5ERIA 3CM5A 3TMOA 3S1RJ 2VLAA 4IXCA 2VPRA 4BRNA 3V7RA 4UV9A 3ZMDA 2PMZN 4PZJA 4A69C 1HA8A 5F04A 1T95A 1TL1A 3ZX3A 2GXAA 5L3CA 3VTHA 4DR6K 3TQNA 1JKHA 1XMOK 1TK5A 3SZ2A 2PLYA 1E17A 5KPTA 4F52A 1NG6A 3GTGJ 4IO8A 1GLJO 2DBBA 5CVJA 3GTPJ 3LL3A 5LRRA 1HCRA 1P90A 1D1BA 4DSJA 3SI6A 3HPGA 5JI6A 3SUNA 3W6JB 1NMDA 4KH4A 3QIPA 2FOKA 2KZZA 1BC8C 2BVMA 1VI0A 3JRBA 1UHSA 4CHQA 4KUMA 2A07F 3BC8A 4DQPA 3QETA 3E5UA 1AWCA 2G8WA 1VQPI 5H6RA 3TAFA 2JSCA 4O4GA 3ZN0A 2HHSA 4IO9F 1KD1O 1ZARA 4EJOA 3OIQA 4LD5A 3HYIA 4A2BA 4CHYA 1KFDA 3MXIA 2IGIA 4JNEA 1ORKA 1X3MA 3UKUA 4CCKA 3RMBA 3TAPA 2QQAA 3PIOL 1T0FC 3AAPA 2F9WA 3CC4I 2GX9A 3FXKA 2A1RA 2CSOA 2Z99A 3MCPA 5KGXA 2KKOA 1FSHA 1S3JA 2KIUA 2H09A 1MH3A 2Q0OA 1UFMA 1IG7A 2V7ZA 4Q5SF 1XMXA 2E71A 1L3UA 4BRDA 5EDNA 2ZJRL 5B1AH 4GVMA 4ZYDA 2IVMA 4NLCA 4A6EA 4CI6A 1VQ8I 4BKXA 3AG4H 3ZMUA 4Y33A 1ZRDA 3SJMA 3ZRGA 1DUXC 4EATA 1Z26A 5JS2A 2PY5A 1KQSM 3LP2A 3VQ8A 3M8PA 2OJED 4E6KG 3MFKA 2HVRA 4DTPA 4OX9K 1ZBUA 4RG8A 4BXXJ 2KFNA 1GLEG 3CP8A 5M1PA 4HV5A 1YITN 2P5OA 2Z16A 1ATRA 2A6AA 2LBFB 4RGUA 5HP1A 2E1YA 2O8EB 1MBJA 1W5SA 4Y15A 3LAPA 2GA2A 4RW9A 1V55H 5AQKA 3NE6A 1MH4A 4RGSA 2R7DA 3HTVA 1NJYA 2DLLA 2P9KB 2VUMJ 4ZDPA 3TKYA 2FBTA 5E8GA 1U45A 3GZNB 1RT4A 3E0JB 4DNCA 2RF2A 2M8EA 5CR4A 4DMNA 3LMMA 3CDHA 2ETHA 3CF5F 1K78B 3GLXA 2EV0A 2MA3A 3J80Z 2RKIA 5DS9A 1O57A 2R7UA 4FZXC 4B1XB 1QVFM 1PUEE 2R5ZA 5FKKA 5AIQA 3AA2A 2NNNA 4GFBA 5FLXK 3A8YA 2QQ9A 5FFXA 2E1NA 4ZH4F 2YPRA 1K8KB 2HF3A 3D2EB 3HVRA 4AIJA 2L5QA 2VQEK 2O6GE 2DYRH 4KDPA 4A3JJ 4FX0A 3CP2A 3FE1A 3UE5A 1OQYA 1TKXA 2L3DA 4RB1A 1A6IA 2COMA 4F9OA 3L09A 3E9LA 3ZT1A 2E2PA 4NC6A 4A3EJ 1EETA 3I4PA 1ATSA 1NGDA 5HRSA 3NARA 3HXMA 2RHKA 3P83D 3QEXA 1D8YA 3TBIA 1VQMI 1IJWC 1YW7A 1RBSA 1NK0A 4RAGA 3AL0B 3SDBA 3DU6A 1XG1A 3PIPF 2L7ZA 2FBIA 4JX4A 5F0HA 3S2WA 1HNVA 4JYKA 1RPWA 1FWZA 3PSIA 3GW2A 1MBEA 3N4MA 1HSTA 3J81Z 4N4OB 1J2XA 3ENBA 2IVOA 1CF7A 3RJPA 3K4CA 4MIMA 4O55A 3P38A 2E2OA 4Y0WA 3S9HA 2P9IB 1C0TA 3DLEA 3G1LA 2P9PB 4EGZA 3CC2I 2V52B 3ZSZA 1RILA 2NVYJ 2W00A 3H3ZA 3I33A 1LW2A 5LL6Z 3VDXA 2YJEA 5CVUA 5GPCA 3V9UA 1FOXA 2P4WA 4F55A 1E3HA 4CJVA 3VYTB 1TWAJ 5D6EA 4CFAA 4Y3OA 1E3PA 3EE9A 3ZR8X 4PGGA 3S41A 2DDAA 4UVBA 1J5OA 1X3NA 5HNHA 4FZYA 2L2OA 3K70C 1D9DA 1RZ4A 1LAVA 4DOZA 2ZJQL 4RB0A 3HOTA 1BGXT 4DR2K 2OPSA 3SCXA 1RDWX 4FWNA 1W0TA 5CE3A 2IXSA 3KWIA 3K9JA 4KNYA 3VEWA 4RW4A 2EQRA 3H3NO 4TV7A 4AYBN 1WZ2A 3TI0A 3CJQB 3NRVA 1EKEA 2OZ6A 3K59A 2QQ8A 3VODA 4FJNA 3RZOJ 1D3YA 2ETJA 3MAJA 3CF2A 2RGVA 1ZBLA 2EFPA 5CYQA 2L0KA 1TGOA 5J1YA 4F91B 3LAMA 1EWRA 2LF8A 3D0SA 4I6MB 4ID1A 5CKTA 4E19A 3MZYA 2E2IJ 3DRPA 2Y9ZA 2P6TA 4G8XA 2DMQA 1KC8O 3VQQA 3EYZA 4ENJA 4C2TA 3P5JA 1YS7A 3JS6A 3ZN1A 3OYFA 2BY0A 1X2NA 2VONA 5E79C 3BTIA 2G8FA 1RUNA 2ATQA 4IEIA 3CC4N 1NBWA 2XAJA 4EP5A 3TTDA 4ESJA 4ZYGA 3VQ7A 3NDKA 3RWUA 4B1UB 3RYRA 1GLCG 4BRCA 3R9PA 1LFUP 5HS7A 1BDGA 3VYSB 1Y6IA 4F2RA 1C6VA 4DUZK 3WTYC 1BI1A 5KRTA 2OTJI 3O9QA 4L8RB 2EFQA 3R6SA 4ISGA 4F4KA 2GBZA 3KHYA 2BW3B 2FSNA 2PYLA 4DFMA 2P5KA 3J7AY 3IRRA 4BRFA 3P1GA 4MGRA 4DV5K 5C10A 4O6JA 3OYHA 2ZF5O 2KW4A 3AA4A 3L3VA 2FQ4A 4XR6A 3KD1E 2ZGYA 5FO5A 1XN7A 1VQ5I 3RPUD 3QFUA 3W3DA 4EHTA 2F8SA 2PMUA 5DUKA 4OVLA 2R0QC 3S1NJ 1CQTA 4CHNA 5BPMA 1L0OC 4UQGA 2HR3A 4AHTA 1ZG3A 4CHZA 2EZIA 4RMNA 4OPHA 4AHCA 3HTUA 5J1RA 3OIPA 3JR9A 4U88A 2EINH 2DT7B 2VT2A 4E1MA 2YHWA 4M73A 4PFOA 5TRDA 4E7JA 3B6OA 1R23A 3K6GA 4CJUA 2KP6A 5AZIA 3AVNA 3F8CA 2NNYA 2RQQA 2Q1ZB 4OIRF 1TC3C 2BYVE 3ALYA 4O5FA 4DTOA 1RTIA 3SV4A 1ZYQA 1ULYA 4A3KJ 3F3XA 1ZR2A 4CBUA 4NDLA 2FD5A 4DZPA 1BR1A 3MDQA 3O4WA 5A2QO 2EIJH 3C3WA 1O3RA 2E4LA 2UYTA 4UXNA 3MXMA 2V1DA 2JA6J 1MWKA 4RTFD 2KFDA 2UUZA 1EH7A 4KN7X 1XGNA 1EQYA 2KZMA 1HPZA 3NF8A 4YRVA 1YYVA 4MLEA 3LQQA 4IJNA 4KMFA 1IJJA 3AVKA 4YEJA 2VKHA 3LAKA 3SJHA 3LDPA 2IW5A 4F2SA 4MHGA 4LG3A 3PX4A 2DU9A 2M30A 5KNLA 3VEOA 2VCPA 4UB8C 2NRRA 2QM3A 5JMVA 1M1EB 3I0RA 1HX1A 5EZGA 5M1NA 2ESNA 3VEPA 2HQ5A 1IRFA 4A2UA 2Y69H 4ZZLA 1AKHB 3O8HA 4CUGA 1VSKA 4W97A 3J7YP 3B02A 2O8FB 4Y1CA 1R5GA 2ASOA 4BRPA 4CGJA 5GIOA 2OAZA 3HBTA 3Q7CA 2AJQA 3G0ZA 1KGSA 4P9UA 1YT3A 5ELZA 4CESA 2KDZA 1WJDA 4P1WA 1BOTO 3RR8A 3LA3A 2YJFA 4JAXA 4E7HA 4DTUA 4YDUC 3D2FB 4LD0A 2RAEA 2O8XA 1QNTA 3M6GA 5J6XA 3OJUA 4JS5A 3G10A 4E7KA 5M3FJ 3O9SA 5EEHA 3U8XA 3QP5A 2P9SA 1HNXK 2QWQA 1ESVA 3SPYA 1IBLK 1P4XA 2A6EF 1YJNN 2L7KA 5F27A 3QYFA 3FFIA 4M9ZA 2CW0F 3CMMA 3R4KA 3J7YJ 5EXWA 3ABUA 3KKSA 1QO0D 3I71A 1YIJI 1HLUA 1ETOA 3DEUA 5E8IA 2L4MA 2HPIA 2JWTA 3A4CA 1NU0A 2HGCA 5HDNA 1ERDA 2R93J 3HM9A 2ITGA 1Z6RA 4HUEA 3KYCB 3CUQB 2OANA 2O8BA 2B0LA 4B8AB 5DD4A 4I02A 1XSDA 3GWZA 1XDSA 4ANJA 1U8RA 1OR7A 2X74A 4Q0BA 4E89A 2ELHA 5EEAA 1XWLA 4OWRB 1P4WA 3CI5A 3P4IA 4D0PA 3OYGA 3FX3A 2KJBA 3CETA 5ICCA 1VQLN 4OU0A 3VSKA 4L0YB 2OQRA 4HQMA 1ITGA 4P55A 1CZBA 3K4BA 4H0OA 2VXZA 3O3HA 1U3EM 4DQ8A 1NGGA 4F8RA 4FJ7A 3L2VA 3U9GA 2FF6A 3ZSRA 3U6FA 5HLFA 4H4OA 4AIDA 3P9CA 1G8XA 3FXMA 3HRUA 2OTJN 5AZJA 3PX0A 2X0LA 4AC0A 3SJJA 1YUWA 4FTHA 1VRTA 4C8MA 1NTCA 1VSDA 4L18B 3RMAA 3EKUA 2WBMA 4HF2A 2GELA 4JI1K 1S5LC 3AL0C 1AHDP 1WSEA 2E2HJ 3AO1A 1WB9A 1W5TA 1B4AA 1KTQA 2ZXHA 3NGIA 1E0EA 3KFWX 1FP1D 3KCCA 3TGNA 4I9LA 2A3ZA 3HL2A 4AM7A 4GVEA 3HBLA 2VJ4A 4OMZA 3C7JA 3FWEA 3FMRA 5D5XB 2RV8A 5FRMA 2VBXA 2KLAA 4CJ5A 2EB7A 5DYMA 4BXUA 5HDKA 2FJ1A 5FKLA 4BH9A 1VTNC 3R6MA 1V5EA 1Q86O 2HVHA 2B9SA 4HTUA 1DLOA 4NCAA 4JK1X 3GDQA 2BEOA 1TT0A 2Q0RA 3UKUB 1T33A 2UU9K 4B09A 4GKJK 3ZSXA 4GY2B 5AQNA 4I0BA 1SUQA 2W82A 3BG7A 2HBKA 3DLGA 1SANA 3MZHA 2KTQA 4KN4X 4CJRA 3CCEN 1MA9B 5FRNA 1YQAA 3F8FA 4J2DA 2OA8A 3PO4A 4KTWA 1WAFA 4U7BA 1TNSA 3I55I 5FPNA 2DYSH 3G25A 2FA5A 2NRVA 4IHVA 2JK3A 1LDKB 3V8LA 4DTSA 1VHXA 4B3RK 3HJEA 1P9QC 3CMAI 4DV7K 2XY7A 2EK5A 1RI7A 1JKRC 2E6LA 1WNSA 2Y1JA 1MJBA 2EHGA 1R49A 3VGKA 3JRIA 1NJXA 3DLKA 4YY3K 2A5YB 4R8HA 4HCBA 4WQ5A 3WEEA 3QIOA 4XKCA 1NGFA 3A0HC 1UCRA 4IOCF 2M3AA 1XCVA 2VB6A 5JICA 4NYNA 1MZBA 2ZXWH 1OKJA 3CFRA 1VQ7N 1ETVA 4BE0A 4AM3A 3KEOA 1HC8A 3SMPA 5D5WB 1STZA 4A93J 1VQ6I 4H5NA 2X6XA 3IFRA 4KHQA 3QBXA 5BPDA 1L3TA 1R71A 5J2NA 2KISA 4Z4EA 3PNTA 4QCLA 2LNBA 2HYGD 2Y1IA 4FL9A 3WUHA 5KQ8A 4Z4CA 3FZMA 1O3TA 5KQDA 1YVNA 1YRNA 2F9TA 3OBWA 4RWTA 3SZGA 5HRNA 4A57A 4FJMA 2Z2SB 3I58A 5M5WJ 1S1UA 2GWJA 4CGZA 1RBTA 5FFZA 1T08B 1BIAA 4D9JA 2QA4N 3Q0VA 5KTQA 3GFMA 3J80K 5EEGA 3IUCA 1T0FA 4U0VA 3FHZA 3CCLI 1FC3A 1JKPC 3CJ1A 4DQQA 5GIPA 2WB1N 1ZGWA 1M90O 3MWPA 3HRGA 4BREA 4WF2A 4UV8A 5B66C 4A3IJ 1YFHA 2OD5A 1FOKA 2PBDA 4A62A 2WAFA 3HK2A 4B48A 1YTAA 1YIJN 3CC7I 3THVA 5AQSA 4I7FA 2Z9OA 1HYZA 4ZTJA 1C0GA 4CFCA 1W2BM 1EO1A 3LFUA 2QUFA 2I10A 2M4GA 2OTLI 3C6TA 3RQ4A 4DR7K 2IS6A 4IFEA 2IAIA 5IY5H 2Q0UA 1ZYRF 2LK2A 1CF7B 1YF5L 4RDUA 3HM8A 2K4JA 2DTZA 1R6RA 4MFEA 2QXLA 1J5YA 4D7MA 1IRXA 3J81K 2A40A 5D8KB 2LF7A 2EA2A 3FHNA 1SMTA 2ECBA 4B47A 3HSEA 3VQ5A 3I8BA 3ZXSA 4X64K 5B8HA 2JA5J 4DBRA 5ED4A 3BTCA 2BANA 3IG1A 1X3UA 2M0MA 3CJRB 1FBQA 4EAHD 1GOAA 2HHHK 1ZR4A 4XLHA 1JLCA 1QQOA 3AVMA 4KH5A 2X85A 1N77A 2QK9A 3OL3A 1WN7A 2DOAA 3A5LC 4A3FJ 1JXSA 3A2FA 3DLBA 4DV1K 1ZQ3P 1BA0A 2UXNA 4CJTA 4AU7A 3LANA 3QYEA 4CF2A 4H0EA 5AQYA 3LZIA 4CK1A 2EZHA 4PJMA 4KH6A 5BN8A 2YSRA 3FKJA 1BO5O 1ASUA 3KLIA 2HB5A 3OMYA 4JOMA 4A2AA 1W36C 2QYOA 1BHLA 4AF1A 1MIJA 2VE9A 3PUFA 1C0WA 3IWFA 3PL8A 4GMJB 1C0UA 3LM2A 4HDUA 3WNEA 2JQ7A 3E7LA 3CLOA 5IT9O 2W42A 3MEGA 1RUOA 3DLAA 4S0HB 2JN6A 4CGIA 3LQRA 2UXDK 2IGOA 2FMYA 3GTLJ 2B7EA 1D4XA 4C23A 4LFBK 5J4VA 4FCYA 5CYMA 2FUG2 3OOPA 1PP7U 3HDDA 3HOZJ 1BR2A 1VFCA 3KVGA 4DSLA 3HOUJ 2XPUA 4BRIA 1RR8C 5TISC 3OSGA 3GYHX 4AILC 1MWMA 3V1OA 1VQOI 4FJJA 3SUQA 1U2WA 5AQJA 1NGJA 4KKOA 3NGZA 2V1XA 1VSFA 5J2MA 5DV5A 1MJAA 3CMAN 1Z91A 1IV6A 4GV3A 3S3OA 3T3FA 5ILUA 1HKSA 4GRIA 4HOBA 1MMSA 1DDNA 1H88C 2JRMA 5C3EJ 3CUQC 4A12A 3I3LA 1JT6A 4BACA 3C7NA 3OHRA 2XSJC 3C95A 2YKMA 3TR8A 2PEXA 5F6FA 2K9QA 3GBGA 3VENA 2XPVA 3P9KA 2A05A 1G3YA 4H4MA 4ZZDA 4CECA 4UVAA 5CHIA 2KL4A 5LD2C 3AO3A 1VQ6N 2VWJA 4HA8A 2RPIA 1LQ1A 3JRGA 2KJCA 1L3LA 2CRGA 1A04A 3WXMB 4A3LJ 1Z25A 3I8DA 2W41A 3I9V2 3SXYA 1AOYA 2OYQA 1ZLKA 3BR1A 2OC6A 4XN3A 4RM3A 3HHHA 4A5BA 4Y13A 3ISNC 2XB5A 5ICEA 5CVVA 1BJZA 1MU2A 4PCQA 2OZMA 4FETA 3HL8A 2PJRB 3CD6N 4IHWA 2W1OA 1HSJA 3QOPA 3TPQA 3EQLF 2Q8KA 3U1DA 1Z0XA 2XVCA 2FU4A 1GT0C 2IS1A 4EJWA 1T6CA 4PL8A 4OGCA 2MYSA 4G94A 4BU2A 1J54A 3EYYA 5K7HA 3RKYA 1BQNA 2RN2A 2KMUA 4I01A 3F22A 2E88A 3S3NA 2GXBA 5E17F 3O4NA 4BRAA 3FLCO 5LEJA 3TO7A 4AYBA 1TL8A 4WWCA 4IHTA 1OYWA 2QSFX 3F21A 1B8IA 4FLVA 2Y0SN 4QS8A 5K14A 1D8KA 3OR1C 1Y64A 3L4QA 4CJLA 3HT3A 4GO1A 2WV1A 2CGLA 3LOCA 3WODF 3VSLA 1BCMA 5IOZA 4KV8A 2XKPA 3T8TA 4C3JJ 1WOQA 2DW4A 1RESA
chains in the Genus database with same CATH topology
1Q8IA 3VQQA 4DU3A 2HW3A 2DFEA 3AO4A 2WONA 3EY1A 3EYZA 1FXXA 2P51A 2X74A 5KI6A 4CF1A 1SKRA 1HQUA 4Q0BA 1Q9XA 4E89A 2P5GA 4B9LA 4KI6A 3SQ2A 3NH1A 1RBVA 4DSIA 4FJ8A 4LSLA 4O0JA 4FJKA 1LV5A 1JLEA 1A5WA 3ZT2A 1X9SA 3RTVA 3LP0A 1XWLA 3AVHA 4OKJA 3NF9A 1KLMA 3U3YA 3T19A 3P5JA 4OPJA 3KLEA 2FBVA 3OYGA 3RMBA 3OYFA 4AHUA 4N47A 3OS0A 3TAPA 4I9QA 3PV8A