2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Ribonuclease HII
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
3AO5A 4EZ9A 2XY5A 1KTQA 4GW6A 4M41A 4FZXC 1JLQA 4DSEA 3HVTA 3WNFA 3ZT2A 3AVNA 2IDOA 4CJKA 3F73A 4E7JA 3ZT0A 4DTNA 3TAFA 1KRPA 3CM6A 4KI6A 1C1CA 3NH2A 3V81A 1VSJA 4KB1A 1RTJA 4M3RA 4CHNA 4XIUA 4MFBA 3DOKA 1A5VA 4DSIA 4KI4A 4OLAA 1X9SA 1ZBIA 3QNNA 1SKWA 4Q5VA 1J9AA 3TAPA 3NF9A 3SJJA 4PY5A 1SL0A 1KLMA 1KVAA 1W9HA 4DWIA 4KTZA 5FDLA 3OYAA 3VQAA 4DFMA 4CHOA 4N56A 4M3TA 5C24A 1VSIA 4LH4A 2EHGA 1QS4A 5KGWA 4R5PA 4CHZA 4E3SA 2HHXA 4H8KA 1HRHA 4E1NA 1Z26A 1T7PA 1HYVA 2DFFA 1XI1A 4DTJA 4E7HA 3U3YA 2RPIA 2QXFA 4DLGA 3AVJA 4FYDA 4O0IA 4FLXA 4EP4A 3RMBA 4LY7A 4CJUA 1CLQA 4F8RA 4E7KA 4CJQA 1QE1A 4HTUA 1NJWA 2LSNA 2IAJA 2Z1HA 2G8VA 4DSJA 3QEPA 4AHVA 1EXQA 3MECA 3QINA 3VN5A 3M8RA 3U3GA 4CEZA 4AHUA 3L2VA 4CCHA 2HHWA 1NKBA 4LH5A 3HPHA 3L2RA 4IKFA 4BWJA 3ASMA 4ICLA 1L3UA 5K14A 2PY5A 3RTVA 4CHPA 1X9WA 1ZYQA 1YT3A 3G0ZA 3ALYA 2YNIA 3DI6A 1RT4A 1S9GA 1ASUA 1WN7A 3C6UA 2GV9A 3NH0A 3SI6A 1WLJA 2XY7A 3VQ8A 3T3FA 1TKDA 3ZSOA 1UA1A 2X74A 4JRQA 3V9XA 3VQBA 2G8WA 5FROA 1NOYA 1KVBA 1TVRA 5HBMA 4PWDA 2YKMA 1J5OA 2P51A 4K8ZA 4G1QA 3WNHA 4ELUA 3WNEA 4KO0A 2B5JA 4FZZA 3NFAA 2VG7A 4CIEA 3ZSZA 1IKVA 4AH9A 3VQ5A 1VSKA 3ZT1A 4CJVA 2HNDA 4DG1A 1T05A 1TK8A 4HVJA 4EZ6A 4CGDA 3TANA 3LAMA 4KHSA 4RW7A 3LANA 4CK3A 2YKNA 3KD1E 4FK2A 3HO1A 4DS5A 3OYGA 3K58A 1RBRA 1C1AA 3EYZA 4DQSA 5I42A 3HJFA 1K6YA 1BCOA 3BDPA 4B8CA 4KAZA 3KTQA 4CGHA 5C25A 1RT7A 4B9VA 2IS3A 3OS0A 4HUFA 3ZSRA 3V9SA 4MQ3A 4YNQA 4CFDA 2A1RA 2P5OA 3JSMA 3ZSWA 3AVLA 4N41A 5FRMA 2QK9A 1WAJA 1QTMA 2DTUA 3RR8A 2R7YA 2XY6A 1G15A 1UAXA 3HVRA 1QSLA 4OPJA 2PYLA 3DLBA 1X9MA 4I9QA 5SWMA 2WONA 4DF8A 2JLEA 3KKRA 1BI4B 1C6VA 3E01A 3LZIA 1ITGA 3QIPA 3SUOA 3SQ1A 2E4LA 3PO5A 3DRRA 4KV8A 5CZ2A 1GOCA 3KLFA 4FJHA 4KHNA 1GOBA 2D0BA 3QEWA 3QEXA 3KKSA 5KI6A 4CEFA 1IO2A 2E6LA 2IOCA 4CFAA 3NDKA 1LWEA 4HHTA 4Q0BA 3NHGA 2ATQA 3NE6A 3B6OA 3K2PA 4FCYA 3M8PA 3CFPA 2DY4A 1DLOA 1RDAA 4I7FA 3L2UA 3QLHA 4BE0A 1CXQA 2O4IA 3OYCA 3AVCA 1RT5A 4RG8A 4C8NA 4FLTA 5CYQA 4OLBA 1U48A 4Z4IA 5HP1A 3AVHA 4ZTJA 3CQ8A 1UOCA 4KKOA 4Z4HA 1VRTA 1YTUA 2HB5A 3SQ4A 4CEBA 3OJSA 2HVHA 3ZSVA 2KFZA 4W5NA 1ZBLA 1ASVA 4Z0UA 3RMAA 3AVIA 4CFCA 3RRHA 4AILC 4FM0A 4M3WA 2PZSA 4KTQA 3JYTA 3TARA 1U45A 1RDDA 3C95A 3L3UA 1TV6A 3LAKA 3UIQA 1L3SA 3P5JA 1JLAA 1JXBA 3K5OA 3AA3A 4H4MA 4JLHA 3VQ4A 1S9EA 5I3UA 4HCCA 4FM2A 1EKEA 3MEGA 4RW9A 4Z4EA 2F8TA 3AVMA 4RW6A 1SV5A 3NCIA 4PQUA 1LW2A 3LP2A 4FJ7A 4Z4FA 1RNHA 2OPRA 3NBPA 5HROA 1KCFA 4DTRA 4OKKA 3V1OA 4DFJA 3EZ5A 2B4JA 4C8LA 1NK9A 2HHSA 4F2RA 2NUBA 2F96A 4C8KA 4FJNA 2X6SA 1RBVA 3BGRA 1RBSA 1LWFA 1S1VA 3DRPA 4FLUA 2XHBA 1VRUA 4DTOA 1LV5A 3ZSYA 3IAYA 4KB0A 1Y97A 1RCHA 2HHVA 2DFHA 3HYFA 4CJ5A 4CEQA 3HT3A 1NJYA 4F3TA 2I5JA 3PUFA 1JLCA 3AA2A 4RW8A 4DU3A 1I39A 4CECA 4O0JA 5HRRA 4DFPA 1NJZA 1RTDA 4DSLA 1LW0A 3V9ZA 2RKIA 4E1MA 1NKEA 1TKTA 2P5GA 4NCGA 1R0AA 1JLBA 1SL2A 1D5AA 5T7BA 5CZ1A 2OZSA 1S1UA 2FBTA 4NYFA 3QERA 1RTHA 1VSEA 4DQRA 3G10A 2PYJA 1TAQA 2YNGA 4DLEA 4CIFA 4PUOA 4LD0A 1TGOA 4CJEA 1T8EA 2YNFA 3PY8A 1J54A 5JS2A 1I3AA 1WSEA 1BIZA 4LSNA 1VSLA 4OKJA 3WNGA 4NYNA 3SV4A 4KREA 2HHUA 1S5JA 2E6MA 3TWHA 3K59A 3A2FA 2YHBA 1SUQA 4CF1A 3ZSQA 4CGGA 3I8DA 2VG5A 3OJUA 4CF8A 4KRFA 4ELVA 4QAGA 4F3OA 1SL1A 1HYZA 3CG7A 3S3MA 4DTMA 1SKSA 2FBYA 2XY8A 1NK8A 4FJIA 2HHQA 1WSIA 4FJ9A 1HYSA 3M8QA 1S1XA 4B9TA 3KK1A 4DF4A 2G8FA 5KRTA 4ELTA 3M8SA 2KTQA 4CJ3A 1FK9A 4DU4A 5J2NA 2RN2A 5C42A 4CJWA 1Z25A 4CHQA 3AA5X 2BE2A 1BL3A 3KJVA 4QOZB 1N6QA 1TL3A 4CFBA 1NOZA 4CHYA 1DTQA 3AVBA 3O4QA 4B08A 3V9UA 3DLHA 4RW4A 4O4GA 3SYZA 4KTWA 4B9LA 2KZZA 1HJRA 4FJKA 4AHTA 2HHTA 3MXIA 3TAGA 1QHTA 1REVA 1TKXA 3NF8A 4B9NA 4CJ4A 3SQ2A 2KZMA 4I2PA 1XHZA 5E41A 2KW4A 4M45A 2OPSA 3AVGA 2FBXA 3V1QA 3K5NA 2VWJA 3OVNA 1JL2A 4IBNA 1GOAA 3VQCA 4E19A 2P1JA 4BE1A 3KLGA 1QSYA 1RBUA 4FW2A 4QCLA 1A5XA 3CYMA 4UQGA 2XO7A 4PA1A 1KFDA 4CGJA 1L3TA 1QQCA 1C0TA 1KLNA 2A1SA 1VSHA 3KLEA 3HK2A 3IG1A 1JLFA 1B92A 3NF7A 1F21A 2D0CA 3O4NA 3OYFA 3K5LA 3K57A 4AHSA 1BIUA 4M3YA 5KRSA 5DMRA 3SZ2A 1VK0A 3AVKA 2Z1IA 3LPUA 1U47A 5HRNA 4C8OA 5D3GA 2FC0A 2ETJA 3EY1A 3VA0A 1Q9XA 1EP4A 1JL1A 4EP5A 3NGYA 1J53A 1UWBA 3LP1A 1ASWA 1S6PA 3ZT3A 3KK3A 3TABA 1HQEA 1HNIA 1KFSA 3LWMA 1JKHA 4IG0A 4ZHRA 4KHUA 4GVMA 4GMJB 4CESA 4FLWA 4AHCA 3VQ9A 5CY4A 3VQDA 4N5SA 1NK0A 4F2SA 1JXEA 3OYEA 4DSFA 3SCXA 4FLVA 3KIOA 1CZ9A 3MEDA 3VQ6A 1MU2A 1EETA 3C6TA 2Q3SA 4OPKA 1D9DA 3VQEA 4CJRA 3VA3A 4B3OA 3QO9A 3DLEA 4ZTFA 4H4OA 4FJJA 4DQPA 2OZMA 3QNOA 2X78A 4J2AA 4E7LA 1O1WA 5J2QA 3V9WA 3DRSA 3SV3A 2EX3A 4DQQA 4J2EA 3B6PA 4KHQA 1BISA 3HL8A 2JGUA 2BANA 3PV8A 1NK7A 3TAQA 4DS4A 3KK2A 2BGGA 3LZJA 3SUQA 4M3ZA 3SPYA 1T03A 3OS2A 3DYAA 3OYLA 4DTPA 5J1EA 2B6AA 3RWUA 3ZSXA 1YVUA 2GUIA 3O3HA 3SQ0A 1JLEA 5KGXA 1L3VA 3QETA 1RT6A 4B8AB 1ZBHA 1RT1A 2YV0X 1FKOA 4CEOA 4CK2A 4CIGA 2G8HA 4DTSA 3TAEA 3OYJA 2VWKA 3L8BA 1VSFA 2F8SA 4E89A 4O44A 5EU7A 2D0AA 3P83D 4CF0A 3THVA 3AA4A 4KPYA 4CEDA 4I9LA 3H08A 3OYIA 3IS9A 4OGCA 4BDZA 1HPZA 1RDCA 1NK6A 1C0MA 3VQ7A 3AVAA 1KVCA 2ZE2A 2HW3A 4L8RB 1Q9YA 4ID5A 3CFOA 1ZBUA 1JLGA 2KQ2A 1IG9A 4B9UA 2OYQA 1CXUA 1EX4A 5SZTA 2X6NA 1VSDA 4HUGA 1S6QA 1NK5A 4CE9A 2OA8A 4FK0A 3NGZA 1RT2A 1U49A 4I2QA 1BQNA 4CEAA 5KTQA 1TK0A 4IFVA 3DM2A 4O55A 3L3VA 1TK5A 4DU1A 3OY9A 4IDKA 4M3XA 3I0RA 5HRPA 2XRIA 3DLGA 4FM1A 3NGIA 3CFRA 4K8XA 3MXJA 3RMDA 3PX4A 3ULDA 4CK1A 3QIOA 2HNZA 3OYDA 1BQMA 2BDPA 3OYNA 4FLZA 2ITGA 4IFYA 4FLYA 3V4IA 4OGEA 1RTIA 3U6FA 3VQQA 3AV9A 3V6DA 5FRNA 5CYMA 3D45A 1U04A 3TR8A 4DMNA 3S9HA 3OYHA 4FJMA 3KLIA 1HNVA 3AO4A 1ZBFA 1IKYA 1FXXA 3S3NA 1LWCA 4Z4CA 1RT3A 4CERA 4IG3A 3HP6A 3HM9A 3VQPA 3L2WA 3SPZA 3OYMA 3DOLA 3FFIA 4LSLA 3SNNA 4Y1DA 4BACA 2ZD1A 3PO4A 4N76A 5J2MA 3PX0A 3RMCA 2KFNA 1WSJA 1UA0A 4FJLA 1WSGA 1XHXA 3PX6A 1NK4A 1SKRA 4CGIA 4ID1A 3K5MA 1WAFA 4C8MA 3T1AA 4W5QA 1DTTA 2G8KA 1C1BA 1A5WA 2QKKA 4CJTA 2RF2A 4YFUA 2VG6A 4OKEA 3TAMA 3AO3A 4Z4GA 4BDYA 3SUPA 1KSPA 3OYKA 3T19A 1S1TA 3P1GA 4FJXA 1FKPA 3V1RA 4W5OA 4NCAA 1NJXA 4CEEA 3OS1A 4CGFA 1WNSA 4HCBA 4N47A 4CJFA 3RRGA 3ZCMA 1Q8IA 3IRXA 4CF9A 2O4GA 1QSSA 1B9DA 2Z1JA 5HLFA 1N5YA 3MXMA 3AVFA 3HPOA 3HSTB 2WOMA 3NH1A 4F4KA 4DTXA 4KHYA 2YHAA 3LP0A 2Y1JA 3ISNC 1CZBA 2ZQBA 2Y1IA 4KHWA 3C94A 4AHRA 1BGXT 2IGIA 4Y1CA 4JS4A 5JS1A 4FVMA 1LAVA 3HPGA 3CM5A 4OJRA 1TAUA 3HXMA 5J2PA 3MEEA 4CJSA 4E0DA 3QESA 2FBVA 1BHLA 3NF6A 4JRPA 2YNHA 1WSFA 1RBTA 3D0PA 3QEIA 4FZYA 3MAQA 3LPTA 1S1WA 2OPPA 3O3GA 3RR7A 4BWMA 3LALA 4M42A 3DLKA 2HNYA 4FJ5A 5HRSA 1RDBA 1VSMA 4TSXA 2W42A 1C0UA 4M3UA 1IH7A 1BI4A 3NAEA 4BDPA 1IKWA 3KD5E 4J2BA 3I0SA 2IC3A 3LP3A 3F9KA 1U4BA 1IKXA 4BE2A 3QEVA 2AJQA 3LWLA 1D9FA 2QKBA 2Z1GA 4CJPA 2G8UA 1XWLA 4B9MA 1HMVA 2HVIA 3DMJA 3DLRA 1YTAA 4CF2A 3LDSA 1WSHA 1L5UA 1B9FA 4FW1A 3ITHA 4DFKA 3OYBA 3O3FA 4WE1A 3SUNA 4DQIA 4DSKA 1BCMA 1LAWA 4FJGA 2DFEA 2HMIA 4E7IA 3AO1A 4JS5A 1TL1A 2GBZA 1D8YA 4J2DA 2OPQA 1TKZA 4OVLA 1NKCA 5DK5A 1W0HA 4NCBA 1RILA 1X1PA 4KFBA 4HUEA 4DTUA 4O5BA 3L2QA 4FK4A 4FXDA 3HP9A 4W5TA 2G8IA 1XC9A 1HQUA 3TI0A 4FJ8A 3KLHA 4CJLA 4B9SA 3AO2A 3S3OA 2D5RA 4W5RA 3ZT4A
chains in the Genus database with same CATH superfamily
2JVHA 3AO5A 4LB5A 1KTQA 4L9JA 4KFCA 2HS5A 5I9EB 4DV1K 2XRLA 2V6EA 4NLBA 4L9VA 4FZXC 3O4WA 2CW0F 2KRHA 5EGOA 2CW8A 2IDOA 4X1EA 3TAFA 1JUPA 1RTJA 1FOYA 3CCLN 3Q5FA 4MFBA 3DOKA 2YSRA 5DEQA 1JUMA 1RNLA 1BI1A 5K5QA 4MGRA 3TAPA 4P55A 1B6AA 2Y31A 5M1QA 4BVPA 2F4IA 3KZIC 4H0VB 4LG0B 2ZJQL 2VI6A 1MIJA 3CJRB 1A36A 3I55N 3VQAA 4V2GA 2BGCA 2VQHA 4M3TA 1UG0A 2EBIA 3TDUC 5C24A 3WQTA 1BO5O 4JI8K 4JKBA 4H8KA 2F6CA 4JI6K 3SQNA 3O9TA 2O8DB 1UJ8A 2QWWA 3HM5A 2E5ZA 1JCEA 4I6MA 5E79C 3S14J 3CCUI 1RUNA 4CJSA 1E2XA 2HBLA 2QXFA 1XGNA 4FJKA 4F92B 3LFUA 2ELHA 4EP4A 1YS7A 4O0IA 4YFKF 3IRQA 3K4KA 3K4CA 4LK1F 1BA1A 3LSTA 4C3JJ 4CJQA 1NJWA 3PQJA 1W7PA 2R7VA 2LSNA 3CUQA 1V3FA 2Z1HA 5CPRB 1OCRH 2Q1ZB 4PJ0C 3LL3A 1XMOK 4PCQA 3M8RA 4LF7K 2HHWA 2DMNA 2O8CA 2DMPA 5AQIA 2DT6A 5HLTA 1ITYA 4CICA 5AQWA 4X6AJ 3PL8A 4EHTA 1HX1A 1LOTB 2OAZA 3F8NA 1GLEG 1VQ6N 1S8NA 2ZNYA 2CUFA 2OV7A 4BRDA 2OTLN 1U78A 1UHWA 1ZYQA 1NGCA 1QZEA 3GYHX 4N4OB 2K40A 3ALYA 2YNIA 3DF8A 1F5TA 1BL0A 5E26A 1U2WA 1WN7A 1WBDA 4IPAA 1G3YA 2O8KA 1D8JA 1FW6A 2GV9A 3SI6A 2IJLA 3CDLA 2R5YB 4HX8A 3T3FA 1YX3A 3ZSOA 3RI4A 2VN2A 3MN6A 3HTSB 3V9XA 2Y48A 1P4XA 4IHYA 3GFLA 4A3DJ 1WGXA 1KVBA 2VQFK 1WVRA 2HOAA 1J5OA 3VGLA 4K8ZA 1O3QA 4G1QA 4ELUA 4G9YA 2NVYJ 4I2OA 1G2HA 1VQ5I 2ECBA 3O8HA 3HDDA 2B5JA 3FMSA 4J01A 3OSFA 2VQLA 2OPTA 1IKVA 3NFAA 4UUSA 1RI7A 5EEAA 3ZT1A 2HNDA 2Q0UA 4CJVA 4AIJA 2XGXA 5DTDA 1VQKI 1QRYA 1KAYA 2QM1A 3PFYA 4FK2A 3WUHA 3OYGA 3K6GA 2WWYA 4UVAA 4DQSA 2E7XA 2ID3A 3GF2A 2QEXN 1K6YA 4AWXB 1KQ8A 3C3WA 3SEZA 2NRZA 3THXB 1U0JA 3VSKA 5C25A 3OMYA 3IH4A 1FYLA 3CERA 3ENBA 3QBWA 2XDVA 2BW3A 1E4GT 2IGKA 2W82A 4IHWA 2P5OA 4CCMA 4RBOA 3RR8A 3EUAA 4LFUA 4BYYA 2R7YA 2H27A 1I1GA 2X6WA 4WK8F 2OBPA 5B3SH 1NMDA 4GCVA 4B1RA 3E6DA 4DF8A 1MNMC 3K2ZA 2JLEA 2W25A 5BMZA 3HEFA 4HOBA 3RJPA 4D5FA 3LZIA 1ITGA 2NXNB 3OV8A 1FEXA 4M3FA 2VKHA 3DRRA 1ZH5A 1VQMI 2MW8A 3CC4I 5LY3A 1X1DA 4C3IJ 2Q36A 3KLFA 1D4XA 4WQ4C 3DLLL 5KI6A 4CEFA 1X1BA 1HJOA 4ZZDA 1SAXA 1LWEA 1D0XA 4Q0BA 1KA8A 2DMTA 4AIHA 2R7FA 4BU2A 4A3LJ 4D9JA 2P9KB 4FQGA 5BNGA 3VETA 4A59A 3JRIA 5A2QO 3EZWA 3NE6A 1VQKN 3AG3H 1IG7A 3W0LA 2DY4A 4OIQF 1DLOA 2VIXA 3KZZA 2P9IB 1R5GA 5LMUK 4JX5A 1MJAA 3OYCA 4BNCA 2KRCA 3ABUA 3D5SC 3AVCA 4C8NA 3O1BA 2VKVA 4Z4IA 3G71N 3HOSA 2WA0A 3HGYA 2F5VA 3WTSC 1UOCA 4B1UB 1IV6A 4YRVA 1VRTA 1JCGA 2HB5A 1F43A 1GXPA 1YTUA 4JKHA 2CV1A 4AHVA 3ZSVA 2KFZA 3C6HA 4D0PA 4W5NA 5FPDA 1OCZH 2MLGA 4AD9A 3GX4X 4AM7A 2EH3A 4S05A 1T3VA 3HSRA 1T38A 1BI2A 2LLKA 5EDNA 3TARA 1RDDA 1OCTC 4JKCA 1NBWA 4B48A 3LAKA 3DTIA 1ATNA 2KLAA 3I64A 1JXBA 2RGVA 3VQ4A 2OQGA 2E2PA 2JZYA 1I94K 1HKGA 4HCCA 2R93J 2FF3B 2VT3A 1KAXA 3A5MC 2MH9A 3W2WA 3PIPL 2PLYA 1I27A 1NG7A 2V26A 2F8TA 3NCIA 4GNIA 3CJTB 2P5KA 3LP2A 4HAMA 2BUPA 4WXHA 1XCBA 1KONA 5AQHA 3EZ5A 4FWKA 1SVLA 1WJEA 1LEAA 2P5VA 4RAFA 4Y4RA 5AR0A 1NK9A 2F9WA 4C8KA 5L3DA 4FJNA 1RBSA 5A2QK 2A05A 1S1VA 4FLUA 3HK2A 1W4MA 4XMYA 3WU2C 1YXQA 3BZ6A 3L9FA 1RCHA 2HHVA 1F36A 1QO0D 3BP8A 1U9NA 4I0BA 4CJ5A 3PUFA 2RQQA 4DR7K 3KETA 3MCZA 2R7RA 1I39A 4GDFA 1OH6A 4BS9A 1NJZA 1JTXA 3C0BA 2NRWA 4A3GJ 2WC2A 3JTHA 1G4DA 1TKTA 1GDTA 1SL2A 1C0GA 2Q1NA 5CZ1A 3H3NO 1IXRC 3M07A 1UG2A 4HYEA 5FLMJ 2FBTA 4NYFA 5GAGP 4DR3K 1V4RA 3A5OC 3HZ6A 4DLEA 4NC6A 3BJ6A 1B72A 1S29A 4UUVA 4I6ZA 2XAFA 4PUOA 3CD6N 1OYYA 3NHGA 4MFDA 4P5OA 4Y17A 3LDQA 5IP6A 1IXCA 3PY8A 2VCPA 4WFAL 1SEUA 1ZGAA 3CF5F 1FX7A 3Q0VA 3VOVA 2STWA 1FOKA 1BIZA 1VSLA 2O5RA 2XB0X 2FBXA 3SV4A 2RVCA 1S5JA 3MKLA 5FD5A 4QS9A 2ACJA 1B8IB 1DKGD 2YHBA 1SUQA 1NGIA 3BY5A 2VC1A 5KNLA 4CF1A 2K9MA 2CV0A 4CGGA 5C0YA 3ECHA 1VQ9I 4BROA 5DM6F 2LF8A 2DTRA 4CZEA 1NJIO 2ASPA 2UXCK 2XAJA 1SKSA 1NK8A 2LREA 2ZCWA 3WXKA 1FY7A 1J75A 3ATVA 4FJIA 2HHQA 3M8QA 4FHTA 3QICA 1LFBA 1GVDA 1WUAA 4DF4A 1FP2A 3MZYA 1BC7C 2G8FA 1SVMA 1ZRFA 3I9V2 2UUCK 4ELTA 2KTQA 2Y9YA 3QPTA 3OSGA 2M34A 5DCMA 3DXKB 1OCCH 1S72N 1TYQA 5BQTA 1ETOA 2P7CB 3W2AA 1BL3A 1DGRM 4UB6C 5LLQA 4IEEA 4W97A 3IWZA 4BH9A 3GTLJ 3LSKA 1X2NA 4U0WA 3MN5A 3ID8A 4XRSG 3H5NA 1LE8A 3NARA 2HF4A 4RW4A 2YX7A 2VKDA 1HJRA 3PNTA 4FWNA 2KZZA 3MZHA 2BVLA 2QM3A 2ZXWH 1S72I 2QUFA 1QHTA 1ZR2A 3WODF 3HOXJ 4A0XA 4ESFA 1W7PB 3SQ2A 2KZMA 1DGWY 2DK5A 3VGMA 5E41A 4M45A 2O8BA 1OQYA 2ZJPL 3O8MA 5J3LA 4GVEA 1JKQC 3KEOA 3K5NA 4QIWN 4NQWB 2Z33A 4FPAA 2RDPA 2XASA 3CQZJ 4BE1A 5BPDA 2P1JA 3G25A 4FW2A 3UR3C 2XROA 3CYMA 4BQZA 4PA1A 1TQIA 1KLNA 1QQCA 2IPQX 1TW2A 1X2MA 2LRDA 5CYVA 4UUTA 3HOYJ 4HX7A 1QHHD 3HRSA 3IHUA 4PGGA 3TKYA 4BAYA 2PG4A 1WZ2A 3S2WA 3NF7A 3ZETA 2VBYA 1XN7A 2WY8Q 2V1XA 1Z0XA 4M3YA 1U2VB 3TBIA 5DMRA 3GMEA 3IV5A 3WTWC 3CMMA 1ZG3A 3SJMA 3F22A 3ATUA 3ZX3A 2MD5A 3M1EA 3LPUA 4C8OA 3IWFA 4IHVA 3FISA 1Y1VJ 5FO5A 3EY1A 2KIFA 3H9QA 3I58A 1EP4A 1Q9XA 4GKKK 4XORA 3J7ZI 4EP5A 1S6PA 4YY3K 2E2HJ 4HSTA 2RE2A 3BTCA 3BUZB 2NRAC 4C2MJ 5CVIA 3E9LA 3OIOA 2JPBA 4YIIA 2PJRA 2VWBA 4AHCA 3VQ9A 4XL9A 4PKIA 2TCTA 3ULEB 1UZCA 2ELJA 4AM6A 4ENKA 4CW7B 4DSFA 1YTYA 3SCXA 1TUYA 4L0ZB 2D0OA 5E3MA 1CZ9A 3UKUB 4H5VA 3VQ6A 4OPKA 1OCPA 2Q3SA 1D9DA 3D2EB 3BPXA 3HSCA 3VQEA 1S9HA 3ZQHA 1H88C 2DA5A 4JI4K 3DKXA 3A01A 3DLEA 5EF6A 4A62A 2LG4A 1QVFM 1EWQA 3GXOA 2DJNA 4DQPA 1MD0A 1EO1A 1X1CA 4BY7J 3BLYA 3OBWA 3SV3A 3RPUD 1U9OA 1TP4A 5KCMA 3FXLA 2STTA 2MA3A 2BANA 3PV8A 4LLLA 2CGLA 4DS4A 4M3ZA 4BUPA 3T7ZA 3MN7A 3OS2A 5J47A 2KISA 3OYLA 3DYAA 3WTUC 1GV2A 4R8HA 4O6JA 2XSJC 5D8LB 2B6AA 1NHAA 2IA0A 2MBFA 2GUIA 3O3HA 3BG5A 1R1TA 1JLEA 5KGXA 4U67L 3QETA 1O4XA 2FSWA 2H8RA 2RKHA 2YV0X 4CK2A 1KYZA 2GIVA 1G6NA 2OF7A 2WAEA 1FYMA 2NVTJ 4HTLA 3TAEA 2R7DA 3EUHA 4FWPA 2VWKA 1D8KA 1IN5A 1D3YA 1GV5A 3WTZA 3C6AA 4E89A 4X0GA 2F8SA 4CF0A 2L4MA 3LM2A 3I59B 2OTJI 4DV4K 1TWHJ 3A5NC 2O61A 1HPZA 5AQXA 2CWEA 2DDBA 5CJ9A 2EILH 2E88A 1V54H 3S17J 4L8RB 5HDNA 1BJAA 1Z7LA 5DUIA 1G3SA 3S8PA 2NOJB 2CQKA 1T95A 5JHUA 3LSIA 2CV2A 1XTAA 3FXMA 1CXUA 1EX4A 2IEKA 4AC0A 1ZBSA 4HUGA 1S6QA 3CF5L 2AXLA 5IWAK 4CE9A 5LHIA 3TO6A 1PUFA 2JA6J 3E97A 5F1XA 3G6EN 2OA8A 1GLNA 2EFWA 5M3FJ 3CJAA 1U49A 2O7OA 3C18A 3C2GA 3DTKA 1LJ9A 4RAYA 4XNFA 3S2DJ 3FZFA 1Y0NA 2QKMB 5KAIC 2V9KA 4CEAA 3NWSA 4GY2B 2QWNA 1QVGM 4HPQA 3JRDA 4XEIA 3I0RA 4IXCA 4LB6B 4A6EA 4FM1A 2BHZA 5AQNA 3CFRA 1XGOA 2Z2SB 3MXJA 3WNEA 3UKRA 3R6MA 3ULDA 2TRTA 5E1XA 3S2HJ 3QIOA 2W1OA 4MDAA 3HSFA 4ON0A 2CQXA 2LY2A 1OMIA 2WAFA 2XPVA 4ASNA 2P9UA 3KHYA 3OYDA 4BHBA 4KH5A 1RPWA 1KC8O 2UXDK 4CZJA 3OYNA 4IFYA 3LSRA 4CVNE 1UA1A 4I98B 3H3OB 5FRNA 5CYMA 3CF2A 1BC8C 1SD5A 1U04A 3TR8A 4DMNA 3S9HA 2GWRA 3J80O 4KIBA 5KAFC 4E7ZA 5IT3A 1ZBFA 3GBTA 2YR2A 3S3NA 2LH9A 5KQDA 1I5ZA 1FMVA 4U7BA 3AAFA 1J9IA 2AXTC 1LWCA 4NO7A 4Z4CA 5F0XA 2JPCA 4IG3A 3HP6A 4MLEA 2HQNA 3TP3A 4OAYA 3RQIA 3BF3A 1KQ9A 2F48A 3QYFA 3L2WA 3EN9A 3SPZA 1VQ5N 3EKUA 4FJLA 5EEHA 3DOLA 1S6LA 4IEIA 3FR0A 4Y1DA 4N76A 5J2MA 2FOKA 4MEXF 3RQ4A 3HRGA 5BRDA 4O3MA 3DTEA 4ABZA 2K9LA 1WSGA 1VTNC 1XHXA 4MLHA 4F7ZA 4CGIA 1A6QA 1NK4A 2OZUA 3K5MA 5M1FA 3ZQLA 2UZKA 3RDIA 2K9QA 2KJBA 4YFUA 2A68F 2GA1A 1GLFO 4PSWA 4G7ZF 4ZDOA 4FSVA 1IAWA 5HLIA 3SUPA 3J7YJ 3O9SA 2H8WA 1W5TA 3V8JA 2B63J 1FKPA 3I71A 4G7HF 2OTLI 1MA9B 3V1RA 4W5OA 4CEEA 4M9SA 3OBYA 1HKTA 5LHHA 3S32A 1T08B 5AQGA 1VQ7I 1TTYA 2ZO4A 4NDLA 2IVMA 2EZLA 3H0DA 4FWSA 2L01A 4C9YA 4FLXA 2Z1JA 2D2WA 2L9VA 1ILYA 1KQ0A 2FQ4A 3LQQA 3Q0WA 3LAJA 3L09A 3VMFB 2NRVA 2QENA 4CBXA 1KQSM 2WOMA 4LIVA 1ZBIA 4OIOF 4F4KA 3VF6A 4DTXA 1X3MA 2W40A 5HS7A 4JK1X 3ASNH 5E3LA 1CZBA 1TBXA 1RFQA 4M7XA 3C94A 1TL8A 1KYWA 3K9JA 2YJFA 3KEYA 5GPCA 4H4KC 1RESA 3EE9A 2WV0A 3C7NA 3DU5A 3CM5A 3PIPF 4XOTA 3HXMA 3VA3A 5J2PA 4NC8A 1ENHA 1P4WA 1CF7A 1IGNA 3U1KA 1BHLA 1JUSA 3I5UA 3WE2A 1RR8C 2VUMJ 2YHWA 2YNHA 3NF6A 3FK7A 1HW1A 1WFXA 1TZLA 4PJJA 5EG0A 3D0PA 3QOEA 3MAQA 2E19A 1YYVA 2JUCA 2IP2A 3ZOBA 3M4OJ 3I55I 3ZQQA 2R92J 3LPTA 1Q1HA 4XKBA 3MFKA 4DV3K 1IBLK 1P4AA 3PNVA 1YE9A 2D1VA 1E4FT 1IBMK 1SKRA 2HNYA 3K9TA 3S1MJ 1C0UA 4BY9C 1FPQA 1BI4A 3NAEA 3MCAB 3GEZA 5KQ8A 1R9TJ 2AP1A 3QEVA 2O8FB 1T56A 3FMQA 3ZETB 3FF5A 2QKBA 1AU7A 3WTXC 1XWLA 2VJ4A 1SZ2A 5AQYA 2DA7A 2AA4A 1BJZA 3DMJA 3HHHA 3RKXA 1XDSA 1TQMA 3HJEA 3LDSA 3C2BA 5BPNA 1WB9A 1D5YA 1IJWC 3SUNA 5K7ZA 2HXIA 5ILSA 4BEHA 2IVOA 4IDHA 2HNHA 2P9IA 4TV7A 2JVGA 4WF2A 1L0OC 3DWLE 3TMOA 2O9LA 3L6QA 5BN8A 1VQON 5GIPA 4JS5A 3WEEB 4ESJA 2QI2A 1FOWA 1O3TA 2XC7A 1IV8A 5D4RA 3E0JB 4NCBA 4DTUA 2UUAK 1HUXA 3JTGA 2WB1N 3L2QA 3Q3SA 4HA8A 1GXQA 1WWXA 5MLCQ 1IDZA 3FMRA 1IJJA 3MMYB 1V5GA 1K7AA 4W5TA 2G8IA 1BBYA 1Q18A 4ISFA 4B9SA 1WJ5A 4KYWA 1NGEA 5M1KA 4JX6A 2O8XA 3OWTA 1FNNA 2O8CB 2DA1A 4UHTA 2XY5A 3DKWA 1IUYA 4AYBA 4CDGA 3A1YA 3W6VA 1JLQA 3AVNA 1FTTA 4E7JA 1K78B 3A02A 3ZT0A 1T6CA 2YX4A 4DTNA 3CM6A 3MMVA 1C1CA 4KICA 3TPQA 4IF4A 4F93B 2CU7A 2J5PA 4XIDA 4CHNA 4XIUA 3S1QJ 2V4JC 2H94A 2HDDA 4X66K 3PIOF 4DSIA 4P96A 4JP0A 2HKOA 3WTTC 2IGNA 3QNNA 2XVCA 1XSVA 4GYIA 2OU2A 1KZHA 5IOZA 3SJJA 2JRMA 1P6RA 1SL0A 5M3MJ 1H9GA 3RTRA 3AL0C 1BOBA 5EVZA 1IW7F 3LA3A 4DFMA 3I56I 3J7YP 2OD5A 4OU0A 2EHGA 4Q47A 1YO5C 4JKDA 4RLQA 3M8FA 1HRHA 2EB7A 1LVAA 3ZP5A 5C4XJ 1T7PA 2E35A 2NS0A 1HYVA 2DFFA 3L4IA 4DTJA 1M1EB 1VQPN 5IYBJ 5FPMA 3U3YA 3PQKA 3R3LA 3CCSN 4E0DA 3RMBA 1I1SA 2A5YB 2K4BA 4MEYF 3GE1A 1NGGA 3ENOA 4CJUA 4JD2B 2ESHA 3KE2A 4HTUA 3I59A 3E9OA 3J81Z 4BRFA 2IAJA 2EZKA 3OTOK 1RRJA 1XMKA 2G8VA 2FX0A 2QYOA 5FFZA 2FSNA 3L2VA 4AHUA 4CEZA 2VOPA 3L2RA 1U6GA 3T1HK 3ASMA 4EJUA 5EGOB 5K14A 4BGDA 5HODA 1OCOH 3GZNB 4JHDB 2PY5A 3RTVA 4P9UA 4ZYEA 4CHPA 1X9WA 2F4MB 3M5RA 2N8GA 4XBFA 3FE1A 1RT4A 4NXMK 2L54A 4R1HA 3O80A 2GELA 3CCEN 3FM5A 3PSIA 1C0FA 3C6UA 2P9SA 4KI6A 5L3CA 2XY7A 3GFJA 3VQ8A 4CZKA 1PP8F 5LEJA 3LSHA 4Y13A 4A0YA 2R0QC 2G8WA 3QFUA 1TVRA 3KP2A 2GLOA 3S41A 1K4SA 2A42A 2PMUA 4FZZA 3TU5A 4PZJA 4CIEA 4K0KK 2ZJPF 1YITI 4DG1A 4LD5A 4AVZA 3BG6A 1TK5A 2EA2A 3UKUA 1T05A 4H5TA 3HG9A 3O3KA 3W2VA 4DV6K 2YKNA 4DS5A 3K58A 1TT0A 3FXJA 1C1AA 5FKKA 4BC5A 2FXUA 2CS3A 4V2FA 2QBYB 3HOZJ 1BCOA 5AQOA 4WFNL 1W7AA 4KAZA 1XNRK 5AQZA 2HHHK 4UVCA 1RT7A 3OOPA 3OS0A 3ZSRA 3JREA 4YNQA 2QK9A 3JSMA 4EMSA 5FRMA 2VONA 4FISA 3K1NA 2K9SA 4B4CA 3G3ZA 1X3NA 4M3BA 3AVLA 1DU0A 4IWVA 1P7IA 3WG7H 1YS6A 1G15A 3A5LC 1U8RA 4K41A 2IBDA 5SWMA 3GZ6A 5CQGA 3KKRA 2VQEK 2Y75A 3B73A 3TL4X 1DT9A 3LM9A 4KV8A 4CA0A 5CZ2A 5CVUA 3E6CC 4KHNA 1X4OA 2K86A 1HOMA 1GLLO 1VHXA 2QWQA 3KKSA 1IO2A 1QPMA 2JRTA 4CCOA 3KYLA 4M3DA 1FSHA 1MWKA 4MNUA 1XQSC 1OPCA 4GKJK 3TSUA 3FM3A 4OMZA 3M8PA 2HI3A 2M7BA 3RKWA 3FZHA 4CZIA 3F8FA 1LDKB 4LLGF 2PJPA 3A0IX 1CXQA 1LPQA 3QLHA 1YUWA 3CCRN 4M3XA 1S3JA 3BQZA 3VODA 4FLTA 4XOPA 4CYDA 5CYQA 4XKCA 4JAXA 2CUZA 3CQ8A 4QS8A 2XKPA 1XMAA 2JWTA 2QKLB 2VJIA 1HLVA 1OVYA 3VB2A 1DU6A 2AO9A 2FBHA 1O3RA 1NK0A 1RDWX 1XMXA 2FMYA 5HLGA 1FJGK 1XS9A 1ASVA 3V8LA 1F1ZA 4HLYA 1ZN2A 3VWBA 2Y0MA 4A57A 4FM0A 3NWTA 4KTQA 3REOA 3CJ7A 4F3QA 2J4RA 3C95A 4M6VA 3K1PA 3L3UA 4C1NK 3L2CA 1K9MO 3LDPA 3P5JA 4H4MA 3UIQA 1S9EA 1POGA 3IUOA 2R7OA 4PFPA 3WGHA 4E70A 5I3UA 1EKEA 1Q86O 1KAZA 2I8DA 2IW5A 4RM2A 3A01B 4M9XA 4A3IJ 2FUG2 1BA0A 2D4WA 2QWMA 1YIOA 4H5RA 3VF4A 4DUYK 4RW6A 4Z4EA 2ZC2A 1SV5A 3HSEA 3E5QA 2ZM6K 4LFBK 1LW2A 4FO0A 3R0JA 1D5VA 4Z4FA 1ZG5A 4LG0A 3IKMA 5K5OA 1Q1VA 2R7WA 1KCFA 4DTRA 3CCSI 3PO2J 4OKKA 2IIRA 5CQEA 4LFAK 2K27A 1DGKN 4KMUX 3IC7A 2JSCA 1LDJA 2EV5A 2X6SA 3DRPA 3BGRA 3DXMA 2O8FA 4B3XA 2M7AA 4JI7K 1LV5A 2E2NA 4M9ZA 3ZSYA 3IAYA 1Y97A 1UB9A 3H9JA 2I5UA 2PJRB 4DQIA 3HYFA 1B59A 1HQCA 1W7PD 4XRSA 2AQEA 2E8AA 4BRKA 5ILVA 2VKEA 3AVKA 1GUUA 1ZELA 3RYPA 4GXOA 4CECA 4DFPA 2R7QA 3U1DA 3LAPA 3CCJN 2FOWA 1GLBG 4E1MA 1P92A 3ZMVA 5JHFA 1NKEA 5AQTA 1Y56A 4UY8I 3I0TA 5T7BA 5AZIB 4CGZA 5ICEA 2W41A 2UV1A 2EPFA 3HOWJ 2PEXA 3KYDB 3QPSA 3V4GA 2M8GX 5K5RA 1RTHA 4DQRA 2XHKA 1IF1A 3VEPA 1EWRA 2LDUA 2F4OB 4CJEA 1T8EA 1NK3P 2YNFA 1J54A 2DDAA 5LEKA 5KPRA 2L2OA 4L18B 3M3YJ 2QWLA 1EQYA 2BV6A 2MABA 1YAGA 4LSNA 5FFXA 4WCGA 4MIMA 1FT9A 2JK3A 1Z6RA 3TWHA 3AFHA 3G1OA 4JX4A 2M0CA 2L9NA 1X19A 4KN4X 4GV6A 1YHQI 1YIJN 3OJUA 5J1RA 4JK8A 1MDMA 1IRZA 4ELVA 1XDUA 5J6XA 1SL1A 4F3OA 1UMQA 3TAGA 3IDHA 4XSZF 4M6XA 4YOYA 3ERMA 1U2VA 3CUQC 1L3SA 4FJ9A 4U88A 5JFRA 3HRUA 3ELKA 4OIRF 1HLUA 2XAQA 2LBFA 1UHSA 5KRTA 3OIPA 4CJ3A 4NBQA 3UKRB 3QWLA 3DFGA 4DU4A 1R58A 2WBMA 2G0EA 2RN2A 4CHQA 4DV2K 4BWMA 5LGNA 3CETA 3O08A 2I10A 1YRNB 1TL3A 3L00A 2X85A 2IT0A 1DTQA 3V9UA 4B9LA 2ZB9A 2OC6A 5K7HA 1BR4A 3ISPA 1JHFA 1EH6A 4BQNA 4RB1A 4R79A 1ZQ3P 1V4SA 1ETVA 3BR0A 5DM6L 1K73O 4JI3K 1REVA 1TKXA 2QWOA 2ECCA 4M72A 2WTEA 1P7JA 3ERED 2HOSA 2JTVA 4HF2A 4A3CJ 3GZ5A 2YPRA 4XKWA 2EJRA 5JVTA 1U8BA 1JCFA 5J4VA 4D1QA 4FX4A 3FXOA 2HTSA 1B4AA 2RNGA 4DBQA 1JL2A 1B8IA 2K5CA 3BY6A 3TW6A 4IZ9A 4BR5A 4E19A 1MW7A 3VYUB 4FETA 2ITMA 1JHHA 3H5AA 5M1NA 4JYKA 2V7FA 1SC7A 3CC7I 4CGJA 3CXCM 1YJ9N 4BRGA 4G6TB 2D45A 4IRIA 5CVJA 3IG1A 4I9QA 1JLFA 1GVJA 5BPMA 1F21A 5A2QZ 2CFOA 2XB5A 3K57A 4CCLA 4ZC3A 1BIUA 4DYCA 5C2FA 2VJJA 1YJWN 3HJFA 2JJ7A 3NQOA 4EV0A 1VK0A 2E2QA 3J80Z 5JVGF 4G94A 3JRCA 4RB2C 2P9UB 3HZJA 2HVRA 3FZKA 2BE5F 1NTCA 2ETJA 5HRNA 5D3GA 4NHJA 4WFBL 2CH5A 2HFHA 2COBA 1DPRA 1XCVA 3AG2H 2LKXA 1K6OA 1HCRA 3DXKA 3DBHB 2FLOA 3KK7A 4U87A 3TABA 3LP1A 1ASWA 1JJ6C 1VQ7N 2V7ZA 5IYCJ 4KH4A 3U9GA 3LWMA 4A2UA 5GINA 1F9NA 4KHUA 4GVMA 1RKTA 2NS7A 1ONVA 3TO7A 4GMJB 4FLWA 4BREA 1IG8A 2V1NA 2VASA 2D1KA 4UNOA 2JQ7A 5CY4A 3VQDA 3GTQJ 2BY0A 1RIOH 1JXEA 3THYB 3TSPA 5TISC 3MD2A 4FLVA 3KIOA 4EJVA 2F5FA 3EPZA 2WB1A 3GFMA 3JAMO 4XLPF 1SD4A 1IUFA 1SMTA 4MHGA 2L5QA 1R1VA 2JUGA 2L02A 3JW4A 5AQFA 3QO9A 3C7NB 2LSOA 3WXIA 1TWCJ 4UVBA 1OH5A 2OZMA 2X78A 4J2AA 2BY2A 1O1WA 3WXMB 3DJCA 3DRSA 2I7PA 1S7OA 2FBIA 2ZGZA 1BI3A 2HZDA 4DV0K 2HPMA 4DR4K 1G99A 1O7LA 5AFUA 1X3ZB 3CQXA 3SUQA 5DUKA 2BVMA 4II2A 3AGRA 4YFXF 1SFOJ 1B9NA 3CLQA 4XN3A 3I4MJ 1CQTA 2D0PA 5J1EA 2V7YA 2DN0A 4LFCK 1R5HA 1E3HA 2O8DA 4B8AB 1ZBHA 1RUOA 4CEOA 6PAXA 4FX0A 3OYJA 4YG2F 3G4SN 2M0MA 4ILGB 3L8BA 1VSFA 4M73A 3GL1A 3CJCA 5EU7A 4BGBA 4JKEA 1ZYRF 3AA4A 2VQGA 3NVKA 5ELZA 4CEDA 3OYIA 2P6TA 5D5XB 5JLWA 3FXRA 4KITB 3EYIA 2MD0A 1RDCA 4C23A 1NK6A 3D2EA 3KLNA 4XH1A 2UU9K 2HW3A 2DODA 5GTHC 1A04A 1Z05A 3PSFA 3J7AY 1ATRA 5B8HA 2VJ5A 1Q9YA 4OO1J 3O2PE 3PIOL 4NXNK 4FPBA 3F6OA 2FF4A 2WADA 1ZBUA 1IG9A 5BR9A 2OYQA 3CCRI 4U0YA 2UYTA 1YG2A 4UXNA 1NG6A 1R36A 4CZGA 1W97L 5LJWA 2FQ3A 4EJTA 4FK0A 2HEOA 1RT2A 3NGZA 5GADP 1R4MB 3ZQCA 3JXUA 2H6CA 1FOXA 1TK0A 4IFVA 1V5EA 1P8ZA 3HGGA 1R6RA 3DM2A 3P9KA 4ZZLA 4P1WA 4CCJA 3L3VA 3MWPA 4PGHA 2Z9OA 1E3PA 3JAMZ 4YIRX 3CCVI 4BY1J 4V19K 2ASOA 5HRPA 3V7SA 4PK4A 4CYCB 2A3ZA 3DKYA 5H6QA 2XRIA 5M1OA 2CUJA 3RSEB 1OH7A 3G4SI 5IOYA 1XD7A 2FNPA 2CG4A 1NU0A 1QQOA 4H5WA 4CXFA 3PX4A 1O13A 1VI0A 2XAUA 4J8FA 5HDKA 4HQEA 2KIUA 4A3KJ 3G1LA 4IHSA 3QYEA 4ZYDA 3WEEA 4RM3A 2G9WA 5JMVA 1XUPO 3V4IA 4OGEA 1RTIA 3V6DA 2ZFUA 5EJCA 3E5UA 3B6AA 5LBQA 4XRMA 3D45A 2Q8KA 4YOWA 2KLOA 4M6YA 1SMYF 4DNCA 1JKPC 2DT7B 3AO4A 3VEVA 3SDBA 1FBQA 2O8EB 3I8BA 2NS8A 3KP7A 1O3SA 3F23A 1E17A 4M74A 1M1KO 3LA2A 3BR5A 3FXUA 1W1WE 3HM9A 3FHZA 1YITN 3VQPA 2KPMA 2HMPA 1MMNA 4I02A 4PJMA 4B8XA 1PP7U 5F0HA 3CIPA 3LDNA 1ETWA 2J5OA 2CH0A 3OYMA 1MBEA 1BR1A 5H20A 4JKGB 2CUEA 5GAEP 4CI6A 1UA0A 2VBWA 3CMEI 2L7FP 1W36D 5KHDA 5E20A 2VLAA 1V4TA 1HNWK 3CJ9A 3T1AA 1HNXK 1DTTA 1V55H 1WH7A 4A61A 1VFCA 2E34A 2IS4A 2E20A 3WE3A 4RAZA 3CCEI 2EZIA 4A3BJ 3OIQA 4Z4GA 2R7SA 4JEPA 4MTEA 1K8KA 3I33A 1IN6A 1EH8A 4YDUA 2WTUA 1KSPA 3WQUA 2UUBK 3ASOH 2VXDA 4IFEA 1NJXA 3I54A 3CESA 1WNSA 3BCBA 3QYBA 3KP5A 3RRGA 3LQRA 3VPRA 3ZCMA 4DR2K 2JMWA 1VQLN 1Y0UA 3A0BC 1QQMA 4B3AA 1QSSA 3ZMDA 1Y8RB 2FU4A 2KFDA 2CGKA 3ULEA 4QSHA 4ZDLA 5M5WJ 3AVFA 4BRPA 2A3SA 1GHCA 1QA6A 5C44J 3NH1A 3HOVJ 1U6ZA 4KHYA 3RKQA 1HF0A 2H3GX 3ISNC 2Y1IA 3L1PA 1YRNA 2IGIA 3SHFA 2KJCA 3ZMTA 3HM8A 1LAVA 3CJQB 4FWOA 4FVMA 2IRFG 1LB2A 2HDWA 1ZGJA 2ISYA 2W7NA 3OW2M 1QQNA 4RMNA 4L9NA 1TNTA 5FD6A 5J8CA 4JRPA 3SLCA 5E17F 3LMMA 1ZTRA 2YS9A 4FZYA 1VQNI 3JSPA 3HI0A 3BEXA 1YJ9I 2XKOA 2FE3A 2EINH 2WV1A 3RR7A 2Z3YA 4DGWB 1HW2A 1BI0A 2RAEA 4XLEA 4RGXA 4XLCA 1MSEC 2E2OA 3LALA 3QFPA 4M42A 1OYWA 3HL2A 3X2QH 2DK8A 3CP2A 1N25A 1SANA 3D5RC 5E3OA 3K70D 1RDBA 1RGIA 4XLNF 1HSTA 2G7UA 3CCLI 3CCYA 3A2KA 5IT9Z 1MGTA 1XC3A 3TOAA 1K78A 4BDPA 3KD5E 4J2BA 3I0SA 2ZMEA 2X1DA 1U4BA 2QSGX 4B44A 2AJQA 4LG3A 1QU3A 3LWLA 1ZARA 1J5EK 1D9FA 1KGSA 4CJPA 2ZFWA 2P9PA 3VEZA 1T0FA 1Z67A 2ZMEC 2GA2A 3EE8A 4B1XB 5E8IA 3DLRA 1XX5A 3J7AP 3VSLA 4DIQA 2GOMA 5H2FC 2BTFA 4JI2K 3O3FA 2DAOA 4AIKA 4K2EA 1YW8A 3P9IA 4ZDPA 4QPOA 1BCMA 1LAWA 3QODA 4ANJA 1OKJA 2DFEA 4KA4A 1VQ8I 3MKYB 2VPLA 2OANA 3CMAN 2L7ZA 2HMIA 4BJTA 1ZLKA 3KLOA 2NOGA 1APLC 4HEA2 4Y15A 5CVRA 4B47A 3HTVA 1J09A 3TP0A 4DBRA 3CCQI 2BXYA 1HR0K 4RCHA 1B72B 4QWQA 1TWAJ 4OVLA 1YX5A 1W0HA 5DK5A 1RILA 3JSOA 2AHQA 1XSXA 2MG4A 2AS5F 1I6HJ 4FK4A 3ZGKA 1JXSA 5AIPA 1ETYA 1HQUA 3QU6A 2NRHA 4FJ8A 4CJLA 3AO2A 1UAAA 3RMCA 3ZT4A 2PAVA 1REPC 4IXAA 4EZ9A 2HU9A 2M3AA 2KKOA 4YORA 4M41A 3ABLH 2EFPA 5TGTA 2Y30A 1FTZA 3HVTA 3IFRA 4BJ5C 4JKFA 1MZBA 1LCUA 3ZT2A 4CJKA 2X1EA 2IAIA 3VENA 3RZDJ 4AYBN 3CC2I 4C2UA 2IVPA 3NH2A 3F6VA 1BW5A 5DS9A 3V81A 5FLXO 4KB1A 4OX9K 4KI4A 3E1YA 4OLAA 3CJBA 1X9SA 5C2DA 3GLLA 3BOQA 1B9MA 4D5CA 2P9SB 2OCCH 3NF9A 4PY5A 5TRDA 1YI2N 3LSGA 3NVMA 1GLJO 3FDYA 3JCUC 4BQOA 1W9HA 2MGQA 2ZSIB 4KTZA 4ISGA 4K43A 3O9RA 5FDLA 4CHOA 5C10A 4N56A 3D7EO 2RC4A 1VSIA 5KGWA 2HHXA 1QS4A 4HSRA 3VEWA 4R5PA 1DEJA 3CCMI 3M6GA 4E1NA 2ADUA 1Z26A 4EFHA 3ZQGA 3D2FA 1XI1A 2ICWG 4ZYAA 4E7HA 3CZ6A 3OHRA 4EM1A 2RPIA 3BR1A 4NLCA 4DLGA 4FYDA 4IQ4A 3H36A 3N4PA 1L3LA 4LY7A 4F8RA 4OOIA 3O8GA 2EV6A 3DLAA 4DSJA 5LMNK 4KHQA 1EXQA 5IP9J 1P90A 4CCHA 3HBLA 4XM3A 3U3GA 1A6IA 5HLHA 4NQWA 4U7DA 2VC0A 3DAWA 3HPHA 1NKBA 2Z16A 2VQCA 2M1BA 4ICLA 5AQRA 4BVOA 1SAZA 5D6FA 2ID6A 5IPAA 2YHXA 3U9DA 3PJRA 5DM7L 3CMYA 3Q0UA 4IHTA 5JVGL 2VYPA 2ZKZA 2XPUA 3GDQA 4RLFA 3G0ZA 4EQQA 4YIFA 3T8TA 2X48A 2XF7A 4PDKA 1BIAA 1U5TC 3E7LA 1MBHA 1ASUA 1S9GA 3BROA 3GWZA 2YJEA 1HKQA 2EK5A 3BG3A 4MO5A 4WQ4A 2XIGA 1WLJA 5ADXH 3NH0A 4W1UA 3S1NJ 1TKDA 1ZC6A 2X74A 4JRQA 2LR8A 4DOZA 1LFPA 5GTIC 3QRFF 1WQ2A 3W6KB 5HBMA 1FWZA 2CQQA 2BEOA 2ME6A 4BQQA 4DKWA 1QZ6A 1QZYA 3EUHC 3AGKA 3VF2A 2NRXA 5L3GA 3WNHA 3H1CA 3W3DA 2VG7A 4PWDA 3HUGB 2ZJRF 4XN0A 2ZJQF 4FE4A 2ASMA 3R8EA 3VQ5A 4AH9A 1BG3A 1TK8A 4EZ6A 3HOUJ 4BRQA 4CGDA 1MBGA 3FHNA 3KD1E 3LANA 4CK3A 2E7WA 3MAJA 3HO1A 2LBFB 4CD3A 3PNYA 1RBRA 3TOBA 3EYZA 2A41A 5I42A 1WH5A 4BEHB 2E5LK 2A07F 2DPUA 2PX9A 2HYGD 4B8CA 3E9PA 1VQMN 4CGHA 3BDPA 4K25A 2IS3A 4ENNA 3V9SA 4B9VA 1R49A 4MQ3A 5AQKA 5B66C 4DR5K 2A1RA 2BYVE 3ZSWA 3FK6A 2ZXJA 5ICCA 3N97A 1QZ5A 1WAJA 3MEEA 3J7ZO 4A3FJ 2PMHA 1JGGA 5GIOA 3C65A 2XY6A 1UAXA 3BG7A 1QSLA 2PYLA 4OPJA 3OL3A 1X9MA 2ZBKA 3P31A 1BI4B 1MDMB 4GFBA 3HYIA 3QIPA 2E4LA 4CZFA 2FNAA 3QEWA 3FZVA 3QOPA 3N4QA 4JNEA 2E6LA 2IOCA 4II3A 2W4SA 5LGUA 4DV5K 1JT0A 4I7HA 1RR7A 3U21A 5LJVA 2E1MB 3CJ1A 4BC3A 2ATQA 1K8KB 3G6EI 3B6OA 4FCYA 4HRIA 3K2PA 3KZBA 1R00A 4OMYA 1RDAA 5AFUH 2F5EA 3M8EA 4I7FA 3DXMB 1N8RO 1FYKA 1I50J 3K4LA 4OLBA 5KVRA 2UXBK 3EYYA 3JRFA 3AAPA 5JLFA 2LY9A 5HP1A 5M5XJ 4DHYA 4Z4HA 4UV8A 1OR7A 3SQ4A 1WCMJ 3GTKJ 4AHRA 4JS4A 4LIUA 1ERDA 2GXAA 1ZBLA 4Z0UA 4E7SA 3AARA 3KWGA 4CFCA 2YHYA 3K69A 3O9QA 1Q7YO 4M3WA 4JD2A 2PN6A 3JYTA 3BJOA 4RGRA 1LUJB 2MFZA 1U3EM 3IL2A 3P39A 1U45A 2DPNA 3MDQA 1T6DA 4DZPA 3K5OA 4A69C 4JLHA 5GPAA 2DA3A 2NNWA 3D5LA 3AA3A 2RV8A 5CE3A 4G9ZA 2EZHA 1R71A 4FJMA 2O6GE 2JN6A 3CLOA 4RW9A 3H1VX 1EV7A 2P9LB 3AVMA 4H03B 3KWIA 1R22A 1SQKA 4EHUA 3EKSA 4PQUA 2HKXA 3QQAA 2WUSA 1IDYA 4JHDA 4FJ7A 3NBPA 2AQFA 5AQVA 4DFJA 3GTPJ 3BQYA 5BN9A 1OH8A 3WG9A 5AZJA 4F2RA 3RPUA 4BXXJ 2NUBA 3AG4H 1RBVA 1TNSA 1LWFA 2QTDA 3CCMN 2XHBA 4DTOA 2VPRA 3F0CA 1OFCX 4KB0A 2F4VK 2R7XA 3BC8A 2G7HA 3PFIA 4JI1K 3HT3A 1NJYA 4F3TA 1JLCA 3AA2A 4DU3A 3ULQB 1R59O 4O0JA 5HRRA 4DSLA 1LW0A 2GXGA 3V9ZA 4AU7A 1IBKK 2P5GA 2R5ZA 1BUPA 4NCGA 1ACIA 4A5NA 3SAFA 1D1CA 1R0AA 1D5AA 4LF9K 1MJ9A 3MKZA 2OZSA 4FWQA 4IJAA 2V1DA 2XRNA 1VSEA 2HOEA 3BZCA 3L7WA 2KZGA 3THWA 2PYJA 2YX6A 3LSMA 1XB4A 4LGWA 4XQFA 2GWKA 3R9PA 2HBKA 5FLVA 4LD0A 4IQJA 1X3UA 1Z3YA 3FBIB 4YFNF 3WU1B 5AQUA 1I3AA 5JS2A 3COAC 2HR3A 4G12A 1WSEA 3VYSB 2YU9J 3WNGA 4OKJA 4NYNA 4KREA 2V51B 1W0UA 2VGMA 4JK9A 2HHUA 4C30A 1WJFA 3DXJF 1Z1DA 4XICA 1KXPA 1AOYA 3T5XA 4CCKA 3V7RA 1FZPB 3ZSQA 1R1UA 1YLFA 5IYDJ 4S0HB 4CF8A 3D0SA 3LA7A 4YEJA 3DLLF 2Q2EB 1ON2A 3G1MA 1H1VA 3S3MA 3CG7A 3GOIA 2K4JA 2XY8A 2M9HA 4FVUA 4BBSJ 5L3EA 4JN4A 5DD8A 4O8KA 2W00A 2X6YA 1WSIA 2JWKA 2MC4A 3TTDA 2OA4A 4BR9A 3K4NA 3VOEA 1H9TA 3DPUA 3GTMJ 1S1XA 3UE5A 4PL7A 3KK1A 3F21A 4OWRB 3E1SA 4IOCF 4FWLA 1QVUA 3QAHA 1FK9A 4M7YA 1VQ4I 3ZMUA 2QBYA 4CJWA 1Z25A 3O5BA 1N6QA 3PO3J 2NRTA 3ZQFA 2COMA 3W3CA 4CFBA 3DP7A 3K70C 3LSJA 3AVBA 5E1ZB 4B08A 2PMZN 1JTYA 5B1AH 2ZWHA 4O4GA 2E1CA 4H0TB 3HRTA 4BRIA 1IN4A 3VEYA 3MXIA 4WCEL 4JYAK 2VXZA 3RYRA 3NF8A 4EIAA 4CJ4A 4PUSA 1R4NB 1HKBA 1XHZA 1VQNN 5LRRA 2HQ5A 3DV8A 2QF7A 2OPSA 1N32K 1QQIA 1SS6A 2NLXA 1Z6TA 3V1QA 3ABKH 2GWJA 3OVNA 4IBNA 2DA2A 1W36C 4IVNA 4A2BA 2LF7A 3VQCA 1BR2A 1WI3A 3KLGA 1RC9A 2KMUA 1A5XA 4HQMA 4UQGA 4QCLA 1TQPA 5HVQC 4A2AA 1L3TA 1C0TA 1VSHA 1X58A 1KU3A 1SFUA 1R5ID 3GTJJ 3WHBA 3U4LA 2CJJA 3N05A 1LNWA 2XV4S 2HVSA 4DJAA 3PX6A 3GBGA 3O4NA 4I0AA 5HS8A 2UWMA 2K7LA 1ATSA 2Q2RA 1Z91A 2NVQJ 4AHSA 4FOIA 2UXXA 4IRGA 1JJ8C 4QOZB 4B09A 2QWRA 2Z1IA 3VTIA 5BPLA 1U47A 2FC0A 3TTCA 4ISEA 2X6XA 3TTFA 5JLHA 4J00A 4RB0A 3E3VA 1VQLI 3VA0A 3NGYA 3ENHA 1KFSA 2ESNA 1HNIA 1HQEA 1LKXA 4N4NB 1PDNC 4DZJA 2HDCA 1JKOC 3OL4A 1NGJA 3SZTA 4RDUA 2RHKA 4ZHRA 2W57A 1W2BM 2O8EA 4EAHD 4N5SA 4HCBA 3OYEA 2LD5A 2M30A 2OZ6A 3GTOJ 2MH2A 4ILHA 2BZTA 4FTHA 1E3OC 3C6TA 3Q7CA 2V79A 4BHPA 4E4HA 4MO7A 3H5RA 4WWCA 2LVSA 1Z9CA 2W24A 5HL7L 4FOEA 4CJRA 4BG9A 2YCHA 3C7JA 3CO6C 3SBTA 3V42A 1JKRC 5FGMA 3MX2A 2NVXJ 4FJJA 1MDUB 5BR8K 4LC9B 5LD2C 2IVNA 3BPVA 2A6AA 2EX3A 4DB3A 1GT0C 3V9WA 1YOVB 3ML6A 5TKWA 4DQQA 3BTLA 4J2EA 5J4YA 4A5MA 2GM4A 1NK7A 1D0YA 3BT9A 3TAQA 3IP4B 2FSKA 3K7AJ 3KK2A 4LK0F 2BGGA 1MMGA 3LZJA 1G59A 4UY8O 2D1HA 1FIAA 1CZAN 4KIFA 5E3NA 1AKHB 1TWFJ 2XGCA 3ZQ7A 2R4GA 3JRAA 1ZKGA 1MSFC 1YVNA 3CHWA 3RWUA 3ZSXA 1YVUA 4UV9A 5JLXA 3WGIA 1DP7P 5C3EJ 2NNYA 1RT6A 4QS7A 3H0GJ 1OISA 4XK4A 4DYRA 2W6KA 3VGKA 1K8AO 2XPWA 3I4PA 2EA4A 3GO5A 3RKYA 4HNVA 2A6TA 3E6MA 5FJ8J 3CDHA 2QCOA 1YJNI 2O03A 1XPXA 2BXZA 3B6CA 5IP7J 3HOTA 2XGEA 2D0AA 4O44A 3THVA 3ECOA 2NYXA 4I9LA 3H08A 1YF5L 3CCVN 4V19S 4M71A 3IS9A 5ICFA 4OGCA 2L7KA 3QPHA 4HW0A 4AUXA 3VQ7A 3AVAA 2ZE2A 3SBGA 4FT8A 5D5UB 3SEQA 3QBXA 3G71I 3BDDA 3RSNA 3LDOA 4DR6K 4B1VA 3CFOA 1JLGA 4M63C 2A61A 2P7VB 2DOAA 2X6NA 4LF5K 2GX9A 2JA8J 3U8XA 1Y64A 2LY1A 2GOXB 3F8MA 4L3QA 1J6ZA 1J2XA 2KDOA 3SZGA 1AA7A 1FC3A 3CDIA 1BQNA 2KIQA 1Y39A 4IHXA 2VODA 4O55A 4YOXA 2YU3A 4DU1A 3T1YK 2P9LA 5D4SA 1H8AC 1P2FA 5HDGA 4BRCA 3ZEUB 4H0XB 4PSXA 1M90O 1IV0A 4K8XA 3RMDA 5CVVA 3B02A 1YJNN 1MNDA 1CGPA 5BRFA 4ENMA 1RZ4A 2HQAA 2VL8A 2Z5UA 3GVAA 3ZN0A 3FKJA 4DW6A 5J8FA 1PVEA 2L0KA 4NUBA 2VOOA 3R1XA 4IJNA 1BQMA 2BDPA 2NRRA 1ZREA 3QDKA 4YOUA 2LK2A 2R7UA 3SMPA 3MK6A 3U6FA 3F3XA 3VQQA 4IO8A 5AIQA 3K4BA 1IRFA 3HIFA 5F1RA 2QEXI 1Z7UA 1Y1WJ 3OYHA 2JSPA 4KIGA 3F8BA 1HNVA 3CI5A 3KLIA 3V7CA 2V1UA 4Y1CA 3UNGC 5LL6Z 4M3EA 3VEOA 4X65K 2VB6A 2CSOA 2DT5A 3HB9A 5JVHL 2CYYA 2HXOA 3FFKB 4BR7A 2HWVA 4BACA 3PO4A 2ZD1A 4WXCA 5J1YA 3JR9A 4XR6A 2XF5A 2XAHA 4LLNA 3FLCO 4MO4A 1WAFA 3ABTA 5B1BH 1ZR4A 2G8KA 2FRHA 1C1BA 1AWCA 3J80K 4CJTA 4HV6A 1IRXA 5FLXK 5FB2A 3K10A 2RF2A 3KCCA 2LYCA 2KT0A 3AO3A 3H46O 4PL8A 3FZLA 4FWRA 3TAMA 3ZX0A 4HX4A 3OYKA 3T19A 1S1TA 1WOQA 3P1GA 1R7JA 3CPWM 1FBUA 4B43A 2LKSA 2OJED 1W5SA 2DA4A 3O6WA 4Y0WA 2HBJA 4A3EJ 1UCRA 4CZCA 1Q8IA 1N36K 1JT6A 3HKZN 3IRXA 2O4GA 2VE8A 3THYA 3HPOA 3TGNA 3HSTB 4BRNA 4B3TK 2JA2A 1YJWI 3MKWB 1NGDA 2M45A 3CUQB 3DWLA 5DCMB 3J8AA 3LP0A 4OPHA 1WJDA 2FBKA 2EQRA 3BJAA 2ZQBA 3IH3A 4XH5A 2LKPA 2PBDA 4KHWA 3I3LA 4HLXA 2R7TA 2CO5A 1ODDA 4OJRA 1TAUA 1XSDA 3FX3A 3C2HA 3F72A 3T69A 3MN2A 1DUXC 2IA1A 1WSFA 1QZZA 1HKSA 3CUOA 4F91B 1RBTA 2FMLA 4IOAF 2LP0A 1V5FA 1MBFA 3I56N 3N4MA 2OPPA 3W6JB 1USSA 5FKLA 3O3GA 2K3FA 2LFBA 2X1CA 4MTDA 3M1FA 2KQRA 3QMLA 2L9RA 4FJ5A 1I6XA 3A4CA 2R5YA 4IOAL 3BR2A 1SFXA 4U0VA 4TSXA 1BW6A 4EGZA 2E1YA 3AY9A 4M3UA 5H1SQ 4F52A 5BS6A 3KP6A 1IH7A 3VERA 1YQAA 3JRGA 3LP3A 4LF8K 3F9KA 3GFIA 1N33K 1IKXA 4BE2A 3CPEA 3ZX2A 4HDUA 2Z1GA 4B9MA 2UUZA 4Z94A 2XGDA 4Y3OA 2HVIA 5CLSA 2HYFA 1YTAA 3RSEA 4G6QA 1HBXG 1L5UA 4A12A 1ZXOA 3SDGA 3ITHA 4FW1A 3OYBA 1NK2P 4K42A 3A0HC 4DSKA 2LC2A 1BIBA 4KNYA 1DP3A 4FJGA 5TKYA 3THXA 3D1NI 5FPNA 4HF1A 5AZIA 2ZGYA 3AO1A 1GLDG 2HYJA 4Q48A 1TL1A 2GBZA 5J40A 4J2DA 4JOMA 5L3BA 2OPQA 5EYRA 1HW5A 5HOOA 1VQOI 5AQJA 2VWJA 4BG8A 1NKCA 2E1OA 2PBIA 2FJ1A 1X1PA 4RAGA 4HUEA 1D1BA 4FXDA 3NEUA 5LHGA 2I7NA 2CGJA 3K4JA 3WU0A 4BL0B 4BBRJ 2CFXA 3DBRB 3TI0A 1O57A 1QBJA 1HA8A 1MBJA 4NCAA 3IRRA 4RWTA 2DYSH 1TLHB 3KVGA 1NWKA 2KIMA 1YFHA 2OCEA 4GW6A 4BQLA 3M8JA 3QB0A 5EZHA 4DSEA 4XONA 3WNFA 2IS2A 4B1ZA 4BR0A 3F73A 5F04A 5FKMA 4PFOA 4CYCA 3R6SA 4ITVA 1Z3XA 4YOVA 1WBBA 1KRPA 2ETHA 1NGHA 1VSJA 1Y8QB 4KJZA 1UHMA 3LNQA 4M3RA 3SFIA 2M8EA 2UXNA 1A5VA 4B3RK 4BR4A 4XKVA 1HC8A 5AQLA 3VYRB 1S7EA 1J9AA 5CR4A 3WXJA 1RKWA 4Q5VA 1SKWA 1J5YA 2ZXHA 2DI3A 1KLMA 4HNUA 1KVAA 2WC9A 3QP5A 3KFWX 4GV9A 5M5YJ 4M3GA 5EY4A 4KBOA 2GAUA 4DWIA 3OYAA 3GUDA 4ILJA 1VZ0A 5IY5H 3L4QA 4CZHA 3CQYA 4LH4A 4ESBA 4BRLA 4E3SA 2P0WA 4CHZA 4CSWA 1FLIA 3O9UA 3BWGA 3SK3A 4B3MK 3P4IA 1XG1A 5F64A 1W5CC 2W48A 2OQRA 2E1ZA 4GRIA 4XRFA 1ZRCA 3AVJA 1A31A 2V52B 1CLQA 2JT1A 1E0EA 2EFOA 1G8XA 2X0LA 2NZTA 4E7KA 2R7ZJ 1QE1A 3FKIJ 3T0YA 2MYSA 1N77A 4KHPK 2HOTA 3QEPA 3WTVC 1WJCA 3MECA 3QINA 2ME0A 5DCFA 3QPLA 2P9NA 3ID6A 3A8YA 4JKGA 3VN5A 2YI1A 2NAZA 4LH5A 1FBSA 2DMUA 4IKFA 3S16J 2A5WA 4BWJA 3ZQIA 4RB3C 5JICA 4DQ8A 4LF6K 1KU7A 1L3UA 1XNQK 2BY1A 1FIPA 4HG2A 3H92A 3VPZA 3DEWA 5F27A 3H3UA 3QU3A 1N75A 4IEJA 2ZJ2A 1PUFB 1YT3A 2EWSA 3SAHA 3VDXA 3FBNB 3DI6A 4I01A 5AZJB 2DJIA 2RN7A 4N9HA 1E3MA 1XGMA 4PHTX 2CQ7A 5DYMA 3B8AX 1OJLA 2R3SA 1ZHFA 5EEGA 3LSPA 1EF4A 1NLVA 3E66A 2GIZA 1T33A 3M9AA 2BY3A 3H45C 5FROA 3VQBA 3IH2A 4AQYK 2HGCA 1IC8A 1VAZA 1NOYA 2E5NA 2YKMA 3KP4A 4RS8A 2IS1A 2P51A 3F2KA 1NGAA 4KO0A 4BC2A 3O6BB 1YW9A 3MEXA 3IMXA 3ZSZA 2R5ZB 2P9PB 3ROUA 1VSKA 3L0QA 2DXIA 4HVJA 1NGFA 3TANA 3LAMA 4KHSA 4RW7A 2HSTA 2Z99A 2QSFX 2JA5J 3FZMA 2JWLA 4BKXA 3TDZC 4CZLA 2LOOA 2M5WA 4AF1A 5F1JA 1TWGJ 5KPTA 3SAGA 3KTQA 4IL6C 4HUFA 4EJWA 4D7NA 4CFDA 2B0LA 1S22A 4N41A 1QTMA 4J19A 2DTUA 3PO5A 1TC3C 3WTYC 3U2RA 2PQ8A 2QW9A 4KN7X 3NRVA 4PKHA 5M1PA 2P8TA 4BR2A 3HVRA 3DLBA 3SXYA 2QA4I 2DYRH 1IXSB 2PFUA 2WONA 1K83J 4PJNA 3RCOA 3KP3A 3J7AO 1C6VA 3E01A 2ZMEB 5HNFA 4MLOA 3SUOA 3SQ1A 1Q81O 1U5TA 3EQLF 3F8CA 3Q7BA 1GOCA 3CCJI 3EL2A 4FJHA 1GOBA 2D0BA 1K4TA 3QEXA 1VNDA 3NDKA 4HHTA 4CFAA 4B1WB 1XMQK 3JAMK 2X6OA 3K0LA 2F5CA 3O1WA 1MH4A 2CRGA 2BBYA 2IA2A 1XC5A 1IN8A 1BM9A 3HC7A 4WXDA 1C0WA 3GG4A 4GV3A 5GAHP 3CP8A 2GUPA 3H9GA 2P81A 2XF6A 2DCEA 2L3DA 3TW7A 3CFPA 4BE0A 3L2UA 2LTPA 5FKNA 1HSJA 2O4IA 4JKAA 3I4NJ 4FWMA 1RT5A 4RG8A 3AG1H 1J0RA 1U48A 3HRMA 1ZGWA 4XSXF 4ZTJA 3AVHA 3PLAA 3WHCA 2KKZA 3TQNA 4KKOA 4O8UA 5F0CA 4H0EA 3H35A 1QHGA 4DUZK 3CTAA 4CEBA 3OJSA 2HVHA 1KU2A 2D5VA 2F9TA 3DCFA 2HQRA 4H0PA 2OTJN 1S5LC 3P7NA 4I6MB 1O7FA 1WHUA 4WX9A 2ISZA 3D6RA 3LDLA 4RA2A 3RMAA 1JI8A 3AVIA 3RRHA 3M7GA 2DQRA 4AILC 4GO1A 2PZSA 4A6DA 4KUMA 5J1UA 3DPLC 4BXFA 3ABMH 1SFEA 2GXBA 1TV6A 3ZN1A 5GP9A 1JLAA 4LJZF 4CBUA 2ZNZA 1ZLJA 4FM2A 4N9IA 3MEGA 1A5JA 2FXAA 1ESVA 1BOTO 1OLTA 1STZA 5FLXZ 3H3ZA 4RGUA 4GYGA 2XAGA 1MMAA 2Y0SN 3S93A 2VGNA 3IKTA 5F2RA 2PI0A 4A5AA 2KP6A 1I3QJ 1RNHA 2OPRA 3BR3A 5HROA 3V1OA 4FL9A 2A5XA 4Y7NJ 3CCUN 3R0AA 1S3XA 2MC3A 1TUUA 2B4JA 4C8LA 1OYIA 4LOCA 2HHSA 1N78A 2A40A 2F96A 5D5WB 4CZMA 3KX2A 3R4KA 2B7EA 3WXLA 1VRUA 2EV0A 1T0FC 2ZSHB 2DU9A 2DMQA 2L7MP 2DFHA 5BOXA 3H6EA 1S7AA 2DBBA 4CEQA 4CD1A 2E71A 2I5JA 4JBAA 3FXKA 1YI2I 4RW8A 2HPIA 4HZFA 1FJLA 1A35A 1ETQA 4EATA 1RTDA 1FP1D 5LGTA 2RKIA 3ZYYX 4CJ7A 4QPQA 3HUGA 4UUSB 1QNTA 2KRFA 3EDPA 4CH7A 4DYQA 4AVPA 4Z6YA 1JLBA 2EIMH 4H0YB 3K4MA 4A3JJ 1S1UA 4C1NI 1XGSA 2E2JJ 4DCHA 3QERA 3ZPLA 1Q82O 3CC2N 2H6BA 3G10A 2H09A 2CMPA 2K02A 5E1WA 1TAQA 2YNGA 4CIFA 1HXDA 4CUGA 1LFUP 3CO7C 5BREA 1TGOA 3MWMA 4MQ9F 4O5VA 3ESWB 3BTJA 3GCMA 5HNHA 1MJBA 2BW3B 2DTZA 3I53A 2Z1DA 2E6MA 5F08A 1T39A 5CKTA 3K59A 2IGMA 3Q9VA 2HF3A 3A2FA 5JI6A 4RGSA 4LITA 3I8DA 4QLCU 2VG5A 3CCQN 4KRFA 1SD7A 2Y0SA 3LOCA 2CGPA 4QAGA 5FPEA 1MKMA 5H6RA 1HYZA 3CC7N 4DTMA 3MZ8A 1HKCA 1WKMA 5E18F 2FBYA 4WYBA 4YHHK 3DEEA 4F55A 4L5IA 4KH6A 1HYSA 4MDBA 1LDDA 3OA9A 3J81O 2QQBA 1J7KA 4ENJA 2DPDA 4B9TA 4WQ5C 5E8GA 4XLFA 5B5EC 4BJ6C 1FMWA 2P5LC 3M8SA 3IKVA 3SZPA 5J2NA 5C42A 4A5BA 1LVKA 3TEDA 2BE2A 3AA5X 4WQ5A 5C15A 3MN9A 1MMDA 3KJVA 1USTA 1T6SA 4KT5C 3ZLJA 4H5NA 4C3HJ 5GAEJ 1NOZA 1NGBA 4CHYA 1JJ2M 3O4QA 3DLHA 3A03A 3G73A 4OPAA 3SYZA 4KTWA 1G3TA 3KZYA 3M3ZA 3K2AA 4AHTA 1SD6A 2HHTA 3SMSA 3ZXSA 4RTFD 2W6LA 1VQ4N 4B9NA 1ETXA 3SFZA 1NNEA 4I2PA 2KW4A 2MSYA 1UFMA 2QLZA 3AVGA 5F0FA 5E84A 2EFQA 2P9NB 4CBWA 3FWEA 4MQVA 1ORKA 2L9SA 2E36A 3ONQA 4PJLA 4XLHA 2Y69H 2KHMA 2EFNA 4IZZA 2QSHX 1GOAA 3P38A 2DOEA 1QSYA 1BA5A 2GBYA 1RBUA 5EXWA 2WAQN 1QVTA 4CHUA 2XO7A 2HZTA 4FE7A 2DA6A 4A0ZA 1KFDA 3JS6A 2A1SA 3C1DA 1LQ1A 3KLEA 2LNBA 1WI9A 3K0SA 2P9KA 3KEQA 1YIJI 1B92A 1X3WB 1HNZK 2V9VA 2A6EF 2QQ8A 4I99C 4P9FA 3SYTA 3OYFA 2D0CA 3K5LA 4BC4A 5KRSA 2ELKA 5IT9O 3SZ2A 2FF6A 2F7TA 1ETKA 1MWMA 3T1BA 1TT5B 5AONA 3TO9A 3WGGA 3T8RA 3ZCOA 1EJ9A 3EO3A 3UB5A 1R23A 3DPTA 3AKZA 4ZYHA 1JL1A 1QGPA 1J53A 3R61A 1UWBA 2P4WA 3ZT3A 3KK3A 3CD6I 2KZVA 4IX7A 2QGUA 1UELB 2WY7Q 1JKHA 1GLCG 4IG0A 5AQQA 5EX5A 3VESA 4CESA 3IAS2 4EVIA 4BRAA 1X4PA 4F2SA 5K1YA 4HDVA 2CW7A 1EA3A 4E1JA 3DU6A 1BWFO 3MEDA 4B3SK 1MU2A 1EETA 2O8BB 1VF9A 4XH4A 1PJRA 3J81K 4EM0B 3ZMZA 4A93J 1JGSA 3CMEN 4B3OA 3HBTA 4ZTFA 3Q9SA 2DFIA 1DPUA 2H1LA 2DO7A 2A6HF 3K9KA 4H4OA 1OR7C 2W84A 3QP6A 3QNOA 4NB5A 4E7LA 1MNEA 3S15J 5J2QA 1NM1A 4JI5K 3B6PA 4OIPF 1BISA 3ZRGA 2JGUA 1DQUA 2C6YA 2QQAA 3HL8A 4NNJA 1HDPA 4IO9L 2Y2ZA 4HF0A 2DQLA 2Y1JA 3K1MA 1H0MA 2M87A 1U5TB 1J59A 5DD4A 1T8IA 1D1AA 4IRHA 3SPYA 4HBLA 4OINF 1JE8A 1T03A 2O3FA 2DW4A 4BHCA 4EJOA 1FSEA 5D5VB 5DM7F 4DTPA 2X9DA 3BTIA 4EGYA 4X64K 1MH3A 1T2KA 3MWTA 4BRHA 2DLLA 2Q31A 2V6CA 2Q0RA 3SQ0A 1L3VA 1BN5A 2QVOA 2XSDC 1HDDC 4YDUC 2FEZA 3KYCB 5ILUA 1RT1A 3D2FB 1FKOA 3H1QA 2QZ8A 4CIGA 3GTGJ 3KPHA 4DTSA 2G8HA 2E2IJ 4Y52J 3WT0A 2QXLA 1WPKA 4KISA 1GLAG 3THWB 3P83D 4BRMA 1CF7B 4KPYA 5C12A 4A3MJ 1T44A 2QWPA 5GAHJ 1Z77A 2RNJA 4BDZA 3AAQA 5EG0B 1C0MA 1BDGA 1KVCA 5AQMA 3E6BA 1PYVA 2F5DA 5GAGJ 2TDXA 2K9NA 3DBLB 4C2TA 3HHGA 1LE8B 4XLAA 5DV5A 2Q97A 4ID5A 1ZRDA 2KQ2A 5AJ3K 1N34K 4IOCL 4I09A 4B9UA 5SZTA 4JK7A 4G6DA 1WJAA 1WRJA 2ZXIA 5D6EA 4D7MA 1VSDA 4L0YB 4KMFA 1NK5A 1ON1A 1SFKA 2FA5A 2LMDA 1ZAOA 4LF4K 2FSJA 9ANTA 2Q2EA 1WSUA 2M4GA 3IAM2 2IS6A 4I2QA 5KTQA 3OOUA 4WF9L 1IN7A 3HTUA 2HTJA 1PUEE 3LWFA 1ULYA 3V8KA 2JA7J 2QQ9A 2RQPA 3G2BA 3OY9A 1SVOA 2EIKH 2MLKA 4IDKA 2WFBA 2L4AA 3VYTB 3SJHA 3NAUA 3JRHA 2Y9ZA 2F2EA 3VTHA 3DLGA 3BCAA 3NGIA 5BPIA 4AM3A 2BHYA 4OAZA 5IT9K 5L3FA 2KDZA 3MCPA 2QA4N 3HKZA 4UB8C 1TYQB 1OVQA 4CK1A 3CC4N 2HNZA 5AQPA 5TJJA 2CH6A 2KL4A 4BGAA 3M1CA 4FLZA 3CJNA 2ITGA 4FLYA 2W85A 3U9ZA 3AV9A 2WBNA 1YW7A 2PMZA 4QTRA 1IKYA 4BQAA 1FXXA 3JRBA 1RT3A 4YOTA 4CERA 1QHAA 5F6FA 1D0ZA 2Q0OA 3MVPA 2BOLA 1G3WA 4Q4ZF 3E5XA 1TW3A 5EZGA 4HNTA 3FGUA 2YUSA 3FFIA 4LSLA 3SNNA 1WJBA 3PX0A 2KFNA 1WSJA 3VFZA 2E1NA 4YELA 4MFEA 3OR2C 2EWNA 1K79A 1BU6O 3BZKA 2M2EA 2VBZA 3FXQA 4ID1A 4CZZA 4G7OF 4C8MA 2X4HA 5ADXA 4L5JA 4W5QA 2QKKA 4PKGA 1A5WA 3DEUA 3ZEUA 2A69F 4Q5SF 4FJXA 2VG6A 3RZOJ 4OKEA 4DQ2A 5LRSA 3RIRA 2IGOA 4BDYA 4L5EA 4NC7A 4FASD 3MQ0A 4LMYA 4HV5A 1NMNA 1X9JA 3BR6A 4L9TA 4ETSA 5AQSA 4DV7K 1BOAA 3OS1A 3HXLA 1IRGA 3H3VK 1RDUA 1VQ6I 2KHOA 1Y6IA 4N47A 4CGFA 4CJFA 1ZG1A 2IXSA 1SAUA 2NVUB 3LFKA 2X51A 4CF9A 1B9DA 4S04A 2HBMA 4B9QA 5HLFA 1N5YA 3MXMA 2XUBA 3BG9A 4KT6A 1DDNA 5CHIA 2OUMA 4N0BA 1QPIA 4O5FA 2H1KA 5K7FA 2EIJH 3GW2A 4BXUA 2YHAA 3NMUA 5C4JJ 3F9MA 1BGXT 4ZJZA 2V9PA 5JS1A 1B1BA 3FIWA 3HPGA 4E6KG 5LFAA 1VQPI 4CO8A 5BRHA 2O0YA 4AIDA 1H89C 3QESA 1ZK8A 2DOFA 2FBVA 3VEXA 1IZ1A 2ZF5O 3EEQA 4JQFA 5EOYA 3QEIA 4KDPA 5HS9A 1P9QC 1W0TA 3MX5A 4JI0K 1S1WA 5GADJ 2K85A 3EETA 2WAQA 5D8KB 5ICGA 2NNNA 2M4KA 3DLKA 5HRSA 1MBKA 2P6SA 1VSMA 1AKHA 2GTDA 1OKRA 4B1YB 2W42A 4GGGA 5FKOA 4IO9F 3OR1C 1MMSA 1F4KA 4IOXA 5KPZA 4JV5K 1IKWA 2IC3A 4Z2YA 1KU9A 3F5TA 4EEFG 2RREA 2PFBA 5JR3A 3TSQA 1K61A 3AL0B 2G8UA 3R60A 4CCNA 4H0OA 1HMVA 3IUCA 1X1AA 1HPMA 2GEMA 1AHDP 3P9CA 4X62K 4CF2A 3LL7A 1RETA 5DDGA 2ZJRL 4HWIA 5KK1A 2VE9A 4ZH4F 1Z21A 1WSHA 4ZYGA 3EUKL 1B9FA 4DFKA 3PUBA 4WE1A 3ZMSA 4F9OA 3GLXA 2E1MC 4NB4A 1T98A 4I76A 4E7IA 5ED4A 1KD1O 1NG9A 2HVQA 3RPQA 1D8YA 4G8XA 2VBXA 1VQ9N 3UKGA 1TKZA 3BF1A 2CQNA 3PM1A 1YHQN 4Y33A 2GQQA 2VT2A 3CMAI 5ERIA 4KFBA 3ZR8X 1VQ8N 1EH7A 2K3PA 2FD5A 2BH1A 4O5BA 2B9SA 2E60A 1LEBA 3HP9A 2GZWA 3DQVC 4EM2A 3S1RJ 1NH3A 1XC9A 3KLHA 4DR1K 3S3OA 3RVCA 2D5RA 4W5RA
chains in the Genus database with same CATH topology
3AO5A 4EZ9A 2XY5A 1KTQA 4GW6A 4M41A 4FZXC 1JLQA 4DSEA 3HVTA 3WNFA 3ZT2A 3AVNA 2IDOA 4CJKA 3F73A 4E7JA 3ZT0A 4DTNA 3TAFA 1KRPA 3CM6A 4KI6A 1C1CA 3NH2A 3V81A 1VSJA 4KB1A 1RTJA 4M3RA 4CHNA 4XIUA 4MFBA 3DOKA 1A5VA 4DSIA 4KI4A 4OLAA 1X9SA 1ZBIA 3QNNA 1SKWA 4Q5VA 1J9AA 3TAPA 3NF9A 3SJJA 4PY5A 1SL0A 1KLMA 1KVAA 1W9HA 4DWIA 4KTZA 5FDLA 3OYAA 3VQAA 4DFM