2DFHA

Crystal structure of tk-rnase hii(1-212)-c
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
221
structure length
221
Chain Sequence
MKIAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDDYVILELPPDVIGSREGTLNEFEVENFAKALNSLKVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYGEIGSGYPSDPRTRAFLENYYREHGEFPPIVRKGWKTLKKIAEKVESEKTQDMINKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title Conformational contagion in a protein: Structural properties of a chameleon sequence
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 74
structure length 221
sequence length 221
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.460 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribonuclease hii. Domain 2 2dfhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2dfhA01
4YNQA 3DLBA 3V9UA 3MEDA 2F8SA 4CIGA 2D5RA 3S9HA 1HYZA 2A1RA 1HNIA 2DFFA 2VG6A 3AO5A 4M3RA 1U04A 3K59A 3PY8A 3OYLA 1RT5A 3DM2A 3I8DA 1S1XA 4CJQA 3NAEA 2FBTA 4CJLA 4DQRA 4DSKA 4HTUA 3C6TA 1BI4B 3L2UA 3LP0A 3KK2A 4H8KA 1KCFA 3RR8A 4FK4A 2P51A 4IG3A 4KFBA 5CYQA 3PX6A 4HCBA 5J2QA 4UQGA 1XHZA 2D0AA 4ZTJA 1B9FA 2E6LA 3DLEA 3VQCA 4GVMA 2Z1HA 4DLGA 3QIOA 4DTSA 2P5OA 1UAXA 1S9EA 3V9ZA 1VSEA 2XRIA 3RRHA 3QEWA 1TL3A 2QXFA 4KV8A 1RTIA 4E89A 4W5NA 3NH0A 2PYJA 2OZSA 2XY8A 3CQ8A 2XY6A 2G8FA 4CIFA 4DSJA 1HMVA 5HROA 1IH7A 4CF9A 4ZHRA 3HL8A 1BHLA 4NYNA 4CIEA 1RBTA 3HK2A 5EU7A 3LPTA 3ZSXA 1VSIA 3TAEA 3ZSQA 1NK8A 4KTQA 4EZ9A 1IKVA 4YFUA 3PO5A 1LWCA 4KHNA 3RR7A 2FC0A 1VSKA 5CY4A 3HVTA 1KFDA 5KRSA 3OYMA 3KLFA 1WAJA 4CHZA 1U47A 4BDYA 1RT7A 4H4MA 3QIPA 4EP5A 5HP1A 1L3VA 4B9UA 4F4KA 2DFHA 3NH1A 2R7YA 3VQQA 3ZSOA 1SV5A 5I3UA 2KW4A 4FW2A 3LAMA 4M3XA 4LSNA 2XO7A 3DRRA 3C95A 3DLHA 4HCCA 3U3GA 1U49A 1NK0A 1T7PA 4C8LA 3CG7A 3CFOA 4JRQA 3RMAA 1NOYA 1RDBA 3EY1A 1J54A 1X1PA 3MXIA 3RRGA 4M42A 4DFKA 2ETJA 2G8WA 4DU4A 1TVRA 1S1TA 4JLHA 4O5BA 3VQEA 1NKBA 3C6UA 3NF9A 5KI6A 1X9WA 3LP3A 4FLUA 5J2PA 1RILA 4RG8A 4CGIA 3DRPA 2F8TA 2HHTA 3PX0A 4FVMA 2OYQA 1S9GA 1F21A 4NCGA 1Q8IA 1VRTA 1HJRA 4DG1A 4KHWA 2Y1JA 5T7BA 4CJ3A 4AHTA 4CJ4A 3P5JA 4B9LA 4BE0A 2IDOA 4RW7A 1JLAA 1QS4A 3OYCA 2VG7A 4LH4A 4ID5A 3T19A 4DTMA 3HYFA 1RTJA 3SPYA 4CF0A 3RMCA 1C6VA 4CERA 4HUEA 4Q0BA 3MXJA 3HPGA 1NK9A 3VQPA 4BE2A 4FZYA 2DFEA 3TAMA 4Z4EA 1LAWA 3AVBA 4F2SA 5JS1A 1ITGA 2YHBA 3TR8A 5KRTA 4E7JA 1UA0A 3PX4A 4ID1A 4NCAA 3OS1A 2HHUA 3AVJA 4CJEA 4DTXA 1IO2A 3LP2A 4CEEA 3QEVA 2XY7A 4KB1A 1TV6A 3RMDA 4OPJA 2YKMA 2B6AA 3AV9A 4M3TA 3ZT2A 1IG9A 4AHRA 4FJNA 4KI6A 2F96A 1JL2A 3AVHA 4B8CA 3HO1A 3O3HA 3HSTB 1YTAA 4CFAA 3LWLA 3NBPA 3NE6A 1C0TA 5CZ1A 4E7LA 3TABA 4BACA 4CFBA 4DFMA 3ZSVA 3KKSA 3L2VA 4NCBA 2OPQA 1S6PA 3I0RA 1XC9A 3KD1E 1EXQA 3MECA 1TK8A 1ASUA 4CJ5A 1TK0A 2QKBA 4QOZB 3AO4A 3NDKA 2O4IA 3CFRA 3KLIA 4FJXA 2B5JA 1R0AA 4CEOA 1I39A 3M8RA 1KRPA 4FZXC 1JLCA 3SPZA 1IKXA 5CZ2A 4C8KA 4CGDA 1MU2A 2HW3A 1X9MA 1LW0A 3HP9A 1ZBIA 1SL0A 2DY4A 4FW1A 3QNNA 3G10A 4ELUA 2KFZA 3L3UA 4ICLA 3U6FA 2OPPA 3S3OA 1S1UA 1HRHA 1T05A 1D5AA 1I3AA 4DTOA 3OYKA 4E7IA 2I5JA 4OLBA 2ATQA 3SUQA 3DMJA 2YHAA 1HQUA 4FZZA 2HVHA 3DLGA 3VQ9A 3DOLA 2GUIA 4Y1CA 4K8XA 1L5UA 2HHQA 3C94A 3F9KA 4M41A 4OVLA 3HP6A 3OYDA 4MQ3A 2PY5A 1RBUA 4FJMA 4M3YA 4PWDA 3KJVA 1C0MA 1VK0A 4I9LA 4ZTFA 2FBYA 4OKEA 4DLEA 3ZSZA 4CEDA 1BQMA 3VQAA 4DF4A 3V4IA 1U4BA 3ZT1A 4J2EA 4WE1A 1QHTA 1TKXA 1UOCA 2OPRA 3AO2A 2WOMA 4CK3A 5CYMA 3OYEA 4FLTA 5HLFA 4J2AA 4XIUA 2BGGA 4KAZA 3D0PA 3SJJA 4FLWA 3KLGA 3FFIA 1O1WA 2OPSA 4CJFA 3EZ5A 3OYFA 3H08A 1RTDA 1A5XA 1D8YA 1KLMA 1HPZA 1TKZA 1RBRA 4Z0UA 4DU1A 5D3GA 2IC3A 3O4NA 1RCHA 4I2PA 4CF1A 1D9FA 3SZ2A 2HHXA 3LDSA 2BDPA 2HHWA 3AO1A 3QO9A 4TSXA 3K5NA 3KLHA 4PY5A 1TGOA 3M8QA 3O4QA 1ZBUA 3OYJA 4J2BA 3NCIA 3ALYA 1T03A 5FRNA 3AVAA 1ZBLA 3NF7A 1WSJA 1Q9YA 1BIUA 2YV0X 3AVCA 3LAKA 3KLEA 4EZ6A 4L8RB 4FK0A 1K6YA 4QAGA 2G8KA 4CF8A 3OY9A 4C8NA 3SQ4A 3HPHA 3HPOA 2E4LA 3KIOA 4CJPA 4KKOA 3QNOA 1RDCA 1VSLA 1LV5A 3P83D 4B9VA 1EP4A 3L3VA 3V9SA 1HNVA 4PA1A 2OZMA 4FJHA 3SUOA 3AA2A 1KFSA 1SKWA 1KVAA 3KK1A 4BE1A 3K5OA 4E7HA 2KTQA 2YNHA 1S5JA 1L3TA 3SCXA 3VA3A 4CJKA 4OKJA 4KO0A 3VQ8A 2G8UA 2PZSA 4C8OA 1RT4A 5HRSA 3OYGA 4OGEA 4O0IA 3HT3A 3IAYA 3UIQA 3RTVA 1B9DA 1VSFA 3V1QA 1TKTA 1C1CA 3KKRA 4FJGA 4KHUA 4CK1A 1NKEA 4CGJA 4DS5A 4DWIA 2A1SA 1NJXA 1L3UA 4NYFA 1J5OA 4KB0A 4M3ZA 3VQDA 2FBXA 1VRUA 1HYVA 4OLAA 1XHXA 2RKIA 1VSHA 3NGZA 4DTNA 3K5LA 1DTTA 5FROA 1C1BA 1EKEA 3A2FA 4FLYA 4DF8A 2Z1GA 5HRPA 3S3NA 2ITGA 4K8ZA 1FKOA 4RW8A 4CF2A 4F3OA 5J1EA 3E01A 1JLQA 4W5TA 1N5YA 2G8IA 1SL1A 1ASVA 4F3TA 4E19A 4Z4IA 1GOCA 2KZZA 1VSJA 1WLJA 2D0BA 3MEEA 2RF2A 3QEIA 4FJ7A 2KFNA 4I9QA 3TI0A 3DI6A 3DOKA 3THVA 1LWFA 4Q5VA 2YNFA 3LP1A 1NK5A 3QERA 4FJLA 4Z4CA 5C42A 3V81A 4N41A 3LZJA 4AHVA 4O44A 3SQ0A 1RT2A 3D45A 3MEGA 3DYAA 3LPUA 3L2QA 4PQUA 1BCMA 3U3YA 1EETA 1JLEA 3CM6A 3WNHA 4N5SA 1N6QA 4KRFA 3DRSA 1CLQA 3V9WA 3QESA 2O4GA 3VN5A 4OPKA 4CHQA 3SQ1A 4B9SA 3NFAA 4HUGA 1RT1A 2D0CA 4CJRA 2HNZA 3ITHA 1WSFA 4KREA 3OS0A 3ZSYA 4DQQA 2FBVA 2G8HA 4GMJB 2X6NA 5HRNA 4BDZA 4DTUA 3VQ5A 3BDPA 3OYBA 3IG1A 4CJUA 1TAQA 5E41A 3V9XA 1NKCA 2Z1JA 4FYDA 1KVCA 1Q9XA 1TAUA 1RDDA 2HNYA 1HQEA 2JLEA 2GV9A 1C0UA 1CXQA 1BCOA 3ULDA 1QE1A 2VWKA 4DSEA 4DSIA 1S1VA 4JRPA 1QSLA 1A5VA 4ELVA 4DS4A 2OA8A 4CGFA 4OJRA 5K14A 1SKSA 3DLKA 2HB5A 3OJSA 4IFYA 4Z4HA 2B4JA 4JS4A 1W9HA 4CK2A 3LALA 1JKHA 4RW6A 1QQCA 5JS2A 3ZSWA 4DSLA 3QETA 4KHYA 4IG0A 4IBNA 3VQBA 3CFPA 5J2NA 1KSPA 3L8BA 3AVGA 4FJ5A 4J2DA 2AJQA 4LD0A 4BWMA 1C1AA 3KD5E 4AILC 1FXXA 2ZQBA 4AH9A 4FJ9A 3ZT0A 4PUOA 4KHSA 4Z4FA 4FJJA 1YTUA 2HVIA 1KTQA 2VWJA 4CEQA 3SV3A 3OJUA 3BGRA 4FM1A 2XY5A 3ZCMA 1WSHA 4RW4A 5KTQA 1Z25A 2Z1IA 3HJFA 1IKYA 3TAGA 4CHYA 3EYZA 4C8MA 3MXMA 4AHSA 3OYNA 1UA1A 5FRMA 2E6MA 3VA0A 1WSGA 4O4GA 2HHVA 4GW6A 1VSMA 1YVUA 4LY7A 1RT6A 4Y1DA 3TAQA 3WNEA 1JLGA 3SYZA 1NK4A 4N56A 1CXUA 1RBVA 3KK3A 4CFCA 4CJSA 1RNHA 3CYMA 4B08A 3RMBA 1RBSA 3ZSRA 1DLOA 4G1QA 1NK7A 2HMIA 4E0DA 4KI4A 3PUFA 1VSDA 2P5GA 3TAPA 1D9DA 5DMRA 4CESA 4FCYA 4B9TA 5HRRA 3AVKA 4CGGA 1ZBHA 1BL3A 4HHTA 1JLFA 4H4OA 4FK2A 3OS2A 4I7FA 4E1MA 2NUBA 2GBZA 4DTRA 1U48A 1Z26A 2IAJA 4N47A 4FM0A 5KGWA 4FJKA 4DFPA 5SZTA 4HVJA 3AVLA 1B92A 2YKNA 3L2WA 4DMNA 3LANA 3JSMA 1EX4A 4JS5A 3V1RA 1TK5A 4CHOA 3V1OA 2RN2A 4DFJA 3V6DA 4KTWA 4IFVA 4AHUA 3F73A 3SUPA 3HM9A 3IS9A 1NOZA 4CEBA 3RWUA 4KHQA 1ZBFA 3VQ4A 1BISA 1RT3A 2EHGA 1HYSA 2X74A 3T1AA 2YNGA 4AHCA 3SI6A 1ZYQA 2QKKA 4IKFA 1T8EA 4CECA 4CGHA 2KQ2A 4LSLA 4DSFA 3ZT3A 2XHBA 2DTUA 2BE2A 2W42A 4W5QA 1REVA 3OYIA 1ASWA 1WSEA 2QK9A 5SWMA 1GOBA 1DTQA 3WNFA 3TAFA 3AVFA 4CJVA 4KTZA 4FLXA 2ZD1A 1WN7A 1U45A 1LAVA 4M3WA 3JYTA 4Z4GA 3VQ6A 4HUFA 1JXEA 2VG5A 3B6OA 4DTPA 1SL2A 1BIZA 2IGIA 1WAFA 4CEFA 4FLVA 3I0SA 4CEAA 2WONA 3PO4A 4DTJA 4E3SA 3NF8A 1KLNA 5DK5A 4B3OA 3K2PA 1WNSA 5J2MA 4B9NA 3AA4A 1NK6A 3OVNA 3KTQA 1WSIA 1BQNA 4CJWA 3T3FA 2HNDA 1LW2A 4CHNA 1NJWA 5C24A 3AVNA 4OGCA 4W5OA 4O0JA 2ZE2A 4CJTA 3HXMA 4B9MA 4FXDA 4M45A 4CHPA 1L3SA 3VQ7A 3NF6A 3IRXA 2EX3A 3P1GA 4O55A 3O3GA 1QSSA 3SNNA 1J9AA 2G8VA 1RTHA 3B6PA 1IKWA 1GOAA 1S6QA 3CM5A 3DLRA 3K5MA 2Y1IA 3SQ2A 4MFBA 3O3FA 1FK9A 2Q3SA 4FM2A 4I2QA 1TKDA 1QTMA 3QLHA 1NJZA 4DQPA 4F2RA 4CE9A 5HBMA 4EP4A 3AA3A 3AA5X 1TL1A 4BWJA 3MAQA 3K58A 4CEZA 3OYAA 4FJIA 1Y97A 1JLBA 1SKRA 3NHGA 2KZMA 3G0ZA 3LZIA 4DQSA 1CZBA 1G15A 2X6SA 2PYLA 4B8AB 3M8SA 3SUNA 2YNIA 1FKPA 1RDAA 4FLZA 3TARA 2LSNA 3QINA 4N76A 1XI1A 3AVIA 4OKKA 4BDPA 2P1JA 1SUQA 4CFDA 5KGXA 3PV8A 4LH5A 1JL1A 1J53A 3OYHA 1BGXT 4R5PA 1A5WA 3NGYA 5I42A 4CCHA 2X78A 3WNGA 3LWMA 4F8RA 4QCLA 2RPIA 2BANA 3NH2A 3QEXA 1QSYA 1LWEA 3ASMA 2HHSA 3L2RA 1W0HA 3ISNC 3TWHA 4M3UA 4FJ8A 1CZ9A 1YT3A 3AO3A 3S3MA 4E7KA 1XWLA 5C25A 2JGUA 1UWBA 4IDKA 2IS3A 4RW9A 4W5RA 3QEPA 2IOCA 3ZT4A 3AVMA 3K57A 1X9SA 4DQIA 4KPYA 1KVBA 3HVRA 1JXBA 1S1WA 3SV4A 1BI4A 3NGIA 3TANA 1NJYA 4E1NA 4DU3A 3M8PA 4ELTA 5FDLA
chains in the Genus database with same CATH superfamily
2E5ZA 1HQCA 3N4MA 1HYZA 1FX7A 2MABA 4RS8A 1QZZA 2XAHA 3DM2A 2HDCA 3EUHC 5LMUK 2H8WA 4BHCA 3CD6I 1SD7A 4HCBA 1IDYA 2LF7A 3QIOA 3HC7A 4ABZA 2QXFA 5HROA 2HVRA 4EJOA 4JKEA 3HL8A 3LPTA 1TYQA 2FF3B 4YOVA 2E7XA 1GV5A 2IGKA 1U47A 1HC8A 3G6EN 2OQGA 1XSVA 5CKTA 4JOMA 4KIFA 4HLXA 1RKWA 4ESFA 1SAUA 3EY1A 4BHBA 4EJTA 4DU4A 1NGCA 3ATUA 5BR8K 4XLAA 4M9ZA 3CCRI 2RKHA 4HQEA 1JLAA 2VG7A 1B72B 2VONA 2CV2A 3LSJA 2KDZA 1X3WB 4E7JA 3AVJA 1MMDA 2CRGA 4L5IA 1IG9A 1JL2A 2ICWG 1IJWC 4G6QA 4JD2B 4NLCA 4CO8A 1M1KO 1ACIA 1P7JA 4FJXA 1O4XA 5CZ2A 3ID8A 4IWVA 2BV6A 2ATQA 1Z0XA 4C9YA 4FZZA 2Q97A 1MBJA 4H4KC 3EL2A 4MQ3A 5M1FA 4BC5A 2VPLA 5K7ZA 5AFUH 4L0ZB 3PL8A 2O8BB 3WQTA 1DP3A 2HI3A 3I71A 4B43A 1U2WA 1N25A 1TKZA 1W0UA 5CYVA 3J80Z 2XROA 3LDSA 3KLHA 3QPSA 2LH9A 1ZHFA 3HKZN 5H6RA 4NHJA 1KZHA 4ILHA 4B9VA 2AA4A 3SUOA 1VQ6N 2FD5A 2M30A 1RR8C 2AS5F 1G8XA 3VQ8A 5C12A 3P4IA 4WF2A 1MNMC 3UIQA 3L1PA 4I6MA 3KKRA 4QIWN 4YIRX 2LLKA 3HBTA 5J40A 4OU0A 5AQTA 3ZLJA 3HDDA 5FROA 2A6TA 3QPLA 3IFRA 5J1EA 4W5TA 3FKIJ 4IQJA 4E19A 4A5BA 4BGBA 3VEPA 4BR0A 2V4JC 4OIQF 4Z4CA 3TDUC 2VQEK 1XNRK 1FSEA 2Z3YA 1ZRCA 3W0LA 3K4CA 4DQQA 2FBVA 4I01A 2BW3B 4KMFA 5ICCA 1RDWX 3W2AA 3E9PA 4U7BA 3HOTA 2O61A 2MD5A 2L02A 4C30A 5GIOA 1OCCH 4ELVA 5LEJA 2BHYA 1MGTA 4EV0A 3O4WA 3BUZB 3U1DA 1DGKN 1IUFA 3TGNA 1K61A 1UELB 1IG7A 3L8BA 1ITYA 4FJ5A 1KU3A 2NOGA 3AFHA 4DKWA 3PJRA 3K1PA 2GELA 4AM7A 2NRXA 3ZMUA 1FPQA 3GBTA 3TAQA 3RSEB 4CSWA 1U78A 2O8FB 4CFCA 1HKSA 4BL0B 2DOFA 3TAPA 3DLLL 3H3NO 1BL3A 1NJIO 4HHTA 4YORA 1U48A 3Q0VA 3CC7N 1R7JA 2Q8KA 5F1JA 3WTUC 3BPVA 1D4XA 2ZJ2A 1CF7A 2JK3A 5J4VA 2EHGA 1LE8B 3HOXJ 3DPLC 2KQ2A 4RB3C 2FXAA 5IYBJ 3JAMZ 1WSEA 2MLKA 4YHHK 5SWMA 5ICEA 4EATA 2ZD1A 4RLQA 4Y52J 1SL2A 1BIZA 4YOWA 1RDUA 2IGIA 1WAFA 2D0OA 1B6AA 3ZX3A 1QZ5A 3EUHA 3O9RA 1BDGA 2H27A 3OVNA 2XAFA 3CJ7A 4B9MA 2DJIA 5ILSA 3IRXA 3HSRA 2MH2A 3G1MA 3BZKA 3PNYA 1VAZA 3GTGJ 3F5TA 3THXA 1FTTA 3PIOF 3M8SA 4WFNL 1FKPA 3QINA 3GEZA 1OH6A 1A5WA 4X64K 2I7PA 2KISA 4IHVA 4BRDA 2GIZA 4LFCK 1AKHB 1UWBA 3V7CA 3EPZA 2WV0A 4Q5VA 3B6CA 3FZMA 2O8CA 4YFKF 3I8DA 5J1RA 4CJLA 2P9IB 3CLOA 4II2A 4IG3A 4JKGB 5CYQA 1K8KA 1YO5C 2A42A 2P5OA 3OIOA 1G4DA 3ZQFA 4YEJA 5LD2C 1HXDA 2F9WA 1HKCA 3BTCA 4HOBA 1WBDA 3KLFA 4H4MA 1PUFB 3ZSOA 5ILVA 2A6EF 1NK0A 1T56A 2Y30A 1OYWA 1R1UA 2CSOA 1QQMA 3C6UA 1XMXA 4FLUA 1RILA 2F8TA 4FVMA 1ERDA 1XN7A 2W4SA 2GQQA 4KHWA 2RNJA 4IOXA 3I53A 3WU1B 4JX6A 1HNZK 3WG9A 3GL1A 2XHKA 3VQPA 2YHBA 1FEXA 4OO1J 4FJNA 1MDMA 4B8CA 4GYGA 3A5NC 1R4MB 3TO7A 2FMYA 5EZGA 1ETOA 4CJ5A 3QU3A 2B5JA 1I39A 2QF7A 4KICA 2DY4A 4ZZLA 3OV8A 4A2BA 2X6XA 1AHDP 1Q1HA 4G9YA 3PQJA 2XPUA 1JJ2M 1R59O 5F0FA 3GZ6A 2O8EB 1VK0A 2UXCK 4BRQA 4IVNA 6PAXA 1EO1A 1NGAA 2R7FA 5TKWA 3Q7CA 1O1WA 4NNJA 3WG7H 1D8YA 1HKQA 4PUSA 1RCHA 3DAWA 3SZ2A 3A03A 3FM3A 3NCIA 1RETA 1BA5A 3FZFA 3UE5A 3HPHA 1TUYA 1BU6O 4CJPA 2X6WA 2ZGYA 3G2BA 3MZHA 2IW5A 2PZSA 3KETA 3J7ZI 2Z33A 3OOUA 1C1CA 4ZYGA 4EJWA 4DS5A 2YI1A 1NJXA 3FZHA 3S3NA 2YHWA 3K1MA 1NMNA 3LFUA 1N5YA 1O3QA 5AQNA 3NVKA 3HXLA 3THVA 4BY9C 2IXSA 5AQXA 3V81A 4N41A 5TKYA 1RPWA 2B0LA 3VN5A 1OMIA 1QU3A 2QWMA 1ETKA 2Y0SN 3WEEA 5HRNA 4DTUA 1T6CA 3LA2A 3BDPA 3ULEB 3HSEA 2VXDA 2IVNA 2VODA 3LQQA 1ULYA 4DS4A 2OA8A 2HZDA 3EUKL 2LF8A 2KIFA 5CVUA 5E18F 2A40A 1O7FA 1JKHA 2M3AA 1KSPA 2F5CA 1X2MA 5J2NA 3FZKA 3THWB 2JRTA 4S05A 1MWMA 2NLXA 1VQLN 4CEQA 4RGUA 3OJUA 1HLVA 4G7OF 2ZGZA 4CHYA 4WXDA 1S22A 4AHSA 3OYNA 2OF7A 4RAZA 2HHVA 1YVUA 4Y1DA 3IRRA 3WNEA 2UXDK 3DBLB 3H3ZA 2W00A 2PG4A 2LMDA 1D9DA 1JLFA 4I7FA 4EQQA 3DEUA 1VQPN 1NNEA 4WQ4C 1TK5A 3IKVA 3T8TA 2PN6A 4RAFA 5KAIC 1B8IB 4JI2K 1NGBA 2ZO4A 3WTYC 2L9NA 1ASWA 3JSOA 3AVFA 4BU2A 3GTKJ 4PJMA 4AM3A 2XDVA 1WJDA 4DTPA 3CCJN 1N33K 3NF8A 3R60A 2QKLB 1YHQN 2M5WA 2L54A 5BRHA 1ILYA 2ELJA 3AA4A 3AL0B 5J8FA 2L4AA 2D1KA 1J9AA 3CM5A 1S6QA 2KRCA 4I2QA 4RM3A 2HTSA 2G0EA 4CCLA 3DWLA 5HBMA 1Y97A 2FOKA 2R5YA 3Q0UA 1N36K 1CZBA 4UVCA 2YNIA 4JHDA 2P9UB 3PV8A 4XLPF 1FMVA 2RC4A 4I0BA 4FASD 4CH7A 1AWCA 1JTXA 5F0XA 3K2ZA 5JVGL 3H6EA 2HHSA 1TP4A 1D0XA 1CZ9A 4C3JJ 3K57A 1NK3P 1T3VA 1ZAOA 3DTKA 3LDLA 1K8AO 4ELTA 3F21A 1TUUA 4BQZA 2V9KA 4LF5K 4V2GA 1OISA 4Y15A 4FWSA 5EGOA 4C1NK 1U6ZA 4CYDA 4G7ZF 3V9ZA 4E89A 5AQKA 2K9LA 5JLFA 1MJAA 4A6DA 4CIFA 3G1OA 4CYCA 2CFXA 3HK2A 4NYNA 3H92A 3HRMA 3RR7A 4B9UA 4BDYA 2P9NB 2R7YA 3O2PE 2L3DA 4CZEA 5E17F 1APLC 1E3MA 1U49A 2XPVA 3M3ZA 3M8JA 2ETJA 3P9KA 2QBYB 3ZQHA 4YG2F 2R7OA 1LB2A 1YS6A 2XGCA 1Q8IA 1WOQA 4JI4K 1EH8A 3M1CA 4CJ4A 5E3LA 4A3JJ 4AHTA 4B9LA 5DYMA 3QYEA 1G2HA 4N4NB 3HYIA 4P1WA 2TCTA 1DPRA 2WFBA 4CERA 2LVSA 5F1XA 1ITGA 4FL9A 4OWRB 3I8BA 5JVTA 2E71A 1NTCA 3RMDA 3AV9A 1ZH5A 2H8RA 2LOOA 3HO1A 4E7LA 1BL0A 1LVAA 3H35A 2OPQA 3DXJF 4DV7K 3AY9A 1BOAA 1H89C 3M8FA 3NDKA 1AKHA 1MU2A 3HP9A 1UZCA 1HRHA 3HJEA 3CQXA 5JMVA 4BREA 4KH6A 3M1EA 3KEYA 1JUSA 5CVVA 2XGEA 5AQMA 1G3YA 2P7CB 1BOBA 3ID6A 1QHTA 2WOMA 2XAJA 4A0YA 3BEXA 5A2QK 4Z0UA 4KIGA 3IH3A 2P0WA 1IW7F 4CW7B 1LV5A 1MBEA 2AQEA 4PA1A 2J4RA 4BJTA 2VBXA 3GVAA 3K2AA 4M63C 3MN7A 1S5JA 4CJKA 2G8UA 1ZLJA 5BPNA 5DCMB 3MKLA 4FJGA 1QZYA 3ZX0A 4AIHA 2VUMJ 2E35A 1VHXA 4M3ZA 4BRMA 2RKIA 1H9GA 3D5LA 5CJ9A 2UUZA 4YFXF 1EKEA 3DU5A 3DLAA 4V2FA 4HF1A 2TRTA 3GW2A 1J6ZA 2P8TA 1FOXA 1FSHA 3DOKA 2DPDA 4GY2B 3VGLA 3E9LA 3IWZA 2P7VB 2ZSIB 1WI3A 5EXWA 3DFGA 3GX4X 3SQ1A 1H0MA 2Q2EB 1WSFA 3M1FA 3U4LA 2O8KA 1T38A 2R7ZJ 3VEOA 3CC4N 4UUSB 1T44A 4FX0A 1RDDA 2Z16A 1GXPA 1CXQA 1PVEA 5DUKA 4JI1K 3L4QA 2HF3A 5M5XJ 2ACJA 2ZXJA 1ATRA 3LFKA 3CCUN 1W0TA 1VQ7I 2ZQBA 3J7AO 1YTUA 1Z9CA 5FKKA 5EJCA 5AQZA 2Z1IA 2UXXA 3BOQA 1X3ZB 4C8MA 3A5LC 2CUEA 3CERA 1YG2A 3VB2A 3O8HA 3TTCA 3RMBA 4LF8K 1LFBA 2P5GA 1XCVA 1BI0A 3AVKA 4CGGA 2GLOA 2F6CA 2XF5A 3MD2A 2F7TA 2P6TA 5D4RA 4JS5A 3V1OA 2QWNA 3TARA 1XI1A 4KTWA 1ZYRF 3RZOJ 3SUPA 3VETA 1JT6A 4QS7A 1HJOA 4A2AA 5EG0B 4C3IJ 2ZFWA 2DTUA 2HEOA 1BO5O 1IGNA 3WGGA 2ZCWA 1B59A 1UG0A 4M3WA 2A3ZA 1KYWA 3FXQA 5LBQA 4L0YB 2GXAA 4E7ZA 2W48A 3A8YA 1R9TJ 2H6BA 3L7WA 4IHTA 3SNNA 4C2MJ 4JV5K 1IKWA 4WYBA 3DBRB 2X6YA 1T95A 2X4HA 3U8XA 2K7LA 3F72A 1JI8A 4KH5A 3FXUA 4CFDA 1XPXA 2UXNA 4LB6B 4I0AA 3OYHA 4QCLA 2RPIA 1OLTA 3QEXA 1W5TA 1FBSA 4E7KA 1U8RA 3GWZA 1KONA 1S1WA 4ZYDA 2ZB9A 1GUUA 3MMVA 2D5RA 2A1RA 3UKGA 4CICA 3K59A 2HBMA 2PBDA 2P81A 1HNWK 1S1XA 1YIJN 2R4GA 1BI3A 3QFPA 1MW7A 5J2QA 1IXCA 2QWRA 3QMLA 1VSEA 2XUBA 1Q82O 2ZC2A 1IH7A 4CF9A 5C44J 4I98B 3KPHA 3E9OA 1D1CA 5D8KB 4CA0A 3S2HJ 3X2QH 2DFHA 1B4AA 1XD7A 3U3GA 2E2OA 4CBXA 3CFOA 4U67L 1U2VB 1G3TA 3ZQQA 1R36A 1X1PA 4D0PA 2UUAK 3G6EI 2A5WA 1ZELA 5EEHA 3TSUA 4HYEA 3ZP5A 2P9LA 4CHUA 5T7BA 4FWNA 5IT9K 4AQYK 2FE3A 3CJTB 3E6CC 4HUEA 2DFEA 1QQOA 3QPHA 4IEIA 3DU6A 5GTHC 3BG6A 1IN5A 2P5VA 4L3QA 2EFPA 5FGMA 2QLZA 3IAS2 3ZT2A 5IYCJ 1TQPA 2PEXA 3NBPA 1R49A 2FMLA 1QPMA 4MO7A 3E3VA 2IPQX 3QB0A 3R61A 4KN4X 2DO7A 4J8FA 1IKXA 1IF1A 3WTWC 1WRJA 1Z7UA 1EWRA 4KH4A 3TDZC 3WUHA 1W7PB 2HDDA 3GXOA 3C94A 1SVOA 4D5FA 3IUCA 2K9NA 2NVYJ 4M3YA 4OAZA 1ZTRA 3O80A 3ZEUB 3ZSZA 4OOIA 4CUGA 4FHTA 3L9FA 4CK3A 4OMYA 2PFBA 4B1ZA 2F48A 2YJEA 1P8ZA 3SLCA 1DKGD 2PI0A 2P9NA 2IS4A 5HVQC 4IHYA 3AG3H 5IWAK 2EPFA 1ZBLA 2BHZA 2NAZA 4FK0A 5IP9J 3HSCA 2WAEA 2HNHA 5F04A 2KP6A 3SQ4A 2OZMA 5KNLA 3AA2A 4B3XA 3J7YP 1RT4A 1ZG3A 2Z99A 2HYJA 5F08A 3OBYA 4LD5A 1VQ6I 3W3DA 1D8JA 3C1DA 2E2IJ 4D7MA 1VQ8N 3JRIA 4XLEA 3IKTA 3BF3A 3GCMA 3KHYA 2ID6A 2KHOA 4A5NA 3S15J 4ZYHA 4EEFG 3RTRA 1OH7A 3T7ZA 4BRPA 3DYAA 3TTFA 2E1OA 4XM3A 3V9WA 5FLXO 3BG5A 5LL6Z 5KHDA 2Y48A 3CUQA 1G3WA 4WCGA 2H6CA 3PNTA 5L3GA 2CGLA 3VQ5A 4XR6A 1KVCA 1P4XA 2PAVA 1S1VA 2ZXHA 3MEXA 1DT9A 5AIPA 3PFIA 4IFYA 4Z4HA 4AVPA 1XSXA 5JS2A 4AYBN 4LD0A 1S72N 1NWKA 3DLLF 4FJ9A 2LSOA 1C0FA 1K83J 2LDUA 2LY2A 5LHGA 2JWLA 1NU0A 3C65A 1KQ9A 1B9MA 4AIDA 1Q7YO 2D5VA 2E6MA 4LY7A 1LPQA 3HBLA 2WC9A 3OHRA 4MLHA 3F23A 3SYZA 5A2QZ 4CJSA 1B1BA 5DMRA 4FCYA 1G99A 2O7OA 1SZ2A 2IAJA 1S29A 3L0QA 1MIJA 2WBNA 3V7RA 1EX4A 3PO2J 2IGMA 2CV0A 3CC7I 2VQGA 1ZYQA 1T8EA 3JRGA 4B47A 1XQSC 3E1SA 2VB6A 4FLXA 1IBLK 2E88A 3ZX2A 3C6HA 2OPTA 2Q2EA 5CVJA 3U9ZA 5D6EA 4B09A 3KTQA 1BQNA 2HNDA 2DODA 3LOCA 4WWCA 3H1VX 3F8CA 5IOZA 1BA1A 1GLJO 4F7ZA 1IV0A 2M4GA 2P9PA 4N76A 3J7AY 4OKKA 4MO4A 5BRDA 1RR7A 3OWTA 4AF1A 5LHIA 4IPAA 3J81O 2HBJA 1V4SA 4DCHA 2A61A 2VC1A 3AO3A 1XWLA 1LEAA 4IDKA 2K3PA 3FZVA 1X9SA 3WTSC 3I4MJ 4DJAA 3UR3C 4KITB 2RQQA 2TDXA 2GAUA 3MMYB 4XONA 4BRLA 2FBTA 4F52A 5M1PA 2XIGA 2P51A 3H1CA 3EKSA 4GVMA 2DTRA 2VPRA 2STWA 4BY1J 1S9EA 3QEWA 3BZCA 2R7SA 2F5VA 2HGCA 4O8KA 2PYJA 3C2BA 1KAYA 4CIEA 1XMQK 1IKVA 4DUZK 2FC0A 1BR1A 4F4KA 4NDLA 3VQQA 3J7ZO 4B48A 2A5XA 1RUOA 4JRQA 3HOYJ 3CCQN 5L3DA 4S0HB 2E19A 4BRIA 2BVLA 3WE3A 2HHTA 2OYQA 4U0WA 4KA4A 3ZQIA 4FISA 4CD1A 3GZNB 2ESHA 3HYFA 2LKPA 2HOTA 3MXJA 3HPGA 3GTPJ 5KRTA 1N75A 1GHCA 4GXOA 2B6AA 2HBKA 4R79A 4A57A 3IV5A 4BACA 4CFBA 1XC9A 4LK1F 3K0LA 3HSFA 1B9NA 1J09A 2AHQA 3BT9A 3M8RA 1VNDA 4XRSA 3U6FA 3JR9A 3S3OA 1S1UA 3IAM2 4Z2YA 2KJCA 1EA3A 3EKUA 3I58A 1MMNA 4M41A 3RZDJ 2MYSA 3ZMTA 4OVLA 3OYDA 2PY5A 4RMNA 2O8DA 5IYDJ 1IRFA 4BBRJ 2HMPA 4Y7NJ 2OPSA 3CP2A 1VQKN 2L2OA 1A5XA 5D3GA 2QM1A 3RSNA 2IC3A 5D5VB 2HHXA 4XSZF 3AVAA 3LAKA 1HDDC 4B3RK 4B1VA 5AIQA 4PKIA 3GTJJ 1OCZH 1F4KA 1JUPA 5FB2A 5HRSA 1B9DA 2W82A 2IAIA 4CZFA 1XS9A 2E7WA 3TBIA 2E2JJ 4PCQA 1K4TA 3EZWA 4GNIA 3J8AA 1J59A 2P9KB 4FLYA 2KRHA 4QSHA 3I59A 3ENOA 4CCOA 1KQ0A 3CTAA 2G8IA 2QSFX 4Z4IA 2BE5F 2JRMA 2KFNA 2R7QA 3MZYA 2HVQA 5IT9Z 2V9PA 3MCPA 2FBIA 1RT2A 1UHWA 2PMZN 4N5SA 5AQRA 1XB4A 3KLOA 2VQFK 3RJPA 3LAJA 3WXKA 3EQLF 4KYWA 1IBMK 3MKZA 4BDZA 3BZ6A 2BY0A 2PMHA 5GADP 3Q9VA 5JVHL 2AO9A 1TAUA 2IS6A 1HQEA 1STZA 1Q18A 4XLFA 2W85A 1MBKA 1OVYA 2X51A 4XICA 5K14A 1SKSA 2PJRA 2EIKH 1J2XA 1SVLA 2LNBA 3ZSWA 4DSLA 2CH6A 2FQ3A 1FXXA 1GVDA 4PUOA 3MZ8A 5JICA 3KZBA 5J1YA 3LSPA 1YUWA 3FM5A 5EF6A 1SD6A 5AQHA 4RM2A 3F8NA 1VQLI 1ZRFA 3KK3A 1RNHA 5D5XB 3CESA 1P90A 1C0GA 1MKMA 1T0FC 3GTQJ 4BROA 3MN5A 2GBZA 3VESA 4CCKA 5HS9A 4FJKA 3M9AA 1WJFA 4DMNA 4H03B 4HLYA 4KHQA 1FZPB 2RVCA 2Z2SB 3W2WA 2QKKA 3CLQA 2VBZA 2XHBA 1VQPI 1QHAA 3R1XA 4K43A 4C23A 3G73A 1WPKA 2LYCA 3JYTA 3GOIA 4DV4K 4A3LJ 1JXEA 5AQOA 3GBGA 1VTNC 3K2PA 2M7BA 4RLFA 3S14J 3F6OA 2K9MA 3LL7A 3T3FA 1LW2A 2B9SA 3CCJI 3HRSA 4FXDA 3NF6A 1I94K 4O55A 1YHQI 1RTHA 2QZ8A 3ZMZA 3QLHA 3AA3A 3BP8A 1SKRA 1ZRDA 1P4WA 1RIOH 1X3MA 3DTEA 1JKPC 2LSNA 2P1JA 1J9IA 2HBLA 3WNGA 2NRAC 2KIMA 2LRDA 3WTXC 2DDAA 1SVMA 2E5LK 4FQGA 4DQIA 4PL8A 3DLBA 1OYYA 2YJFA 1LDJA 3JW4A 3D6RA 2X0LA 1FYKA 3K7AJ 1SMYF 5IP6A 3K4KA 1BI4B 3BR1A 5E1ZB 2Z1HA 3FWEA 3F22A 2VKDA 1YRNB 4LITA 4FVUA 4GV6A 4JN4A 5FLXK 1VSIA 5HDGA 5LJWA 4A3IJ 4AYBA 2DYRH 4I99C 2KW4A 3LAMA 2JPBA 1N32K 4FETA 3LA7A 1IUYA 3K0SA 2MLGA 1J54A 1TQMA 3K9TA 4LMYA 2P5LC 2W57A 5AQYA 1LUJB 3PSFA 2NNYA 3CI5A 1NBWA 3E66A 3OYCA 1WFXA 3CCYA 3KP5A 1ATNA 1X4OA 4EM1A 2WB1N 3SPYA 2IGOA 2ZJRF 1ON1A 2IGNA 3AVBA 4NCAA 3OS1A 2VGNA 5C15A 1GV2A 4AHRA 4P55A 2R7XA 3VF6A 1C0TA 1T6DA 1G6NA 1D5YA 1U5TA 1S6PA 3I0RA 3VSKA 3EYYA 2ZSHB 3CFRA 2VJ5A 1JGGA 4FZXC 4H5VA 4C8KA 2VQHA 4MLOA 4MEXF 4ELUA 4ICLA 5E3MA 1NLVA 4FWQA 3OYKA 3VEXA 1TW2A 5K7FA 4EVIA 1HQUA 3ZXSA 3VTIA 4FWPA 1LVKA 2DFIA 2HZTA 4U0VA 2LBFA 1XUPO 1R71A 1W7AA 2CQKA 3VQAA 4DF4A 3ZT1A 3IWFA 1USTA 3JS6A 3H9QA 4RWTA 3EZ5A 3OYFA 2FBKA 3CMAN 3GO5A 2BEOA 4DV5K 2NS7A 1F9NA 4HV6A 4M74A 5HLIA 1T03A 1BIUA 2O0YA 3JTHA 3VEWA 2JSPA 3LA3A 3DXKA 1BG3A 3WHCA 3VF2A 2X1EA 3A01A 1HNVA 4OINF 1KFSA 3KK1A 3UB5A 2DCEA 3SCXA 1FIAA 3HT3A 5FPMA 2VBYA 2JPCA 1ODDA 2EK5A 2WV1A 1GXQA 4D9JA 1R4NB 1FY7A 1YW9A 1Y8QB 3J81K 4DF8A 3GF2A 1GLEG 3HOUJ 2DTZA 2JA7J 4RAGA 1TWAJ 3IH2A 2COBA 1LWFA 2Z5UA 4KISA 3ABTA 1NK5A 3K70D 3ATVA 3DWLE 1P2FA 3B8AX 3HG9A 1T0FA 1DPUA 1JJ6C 4CHQA 2WAQN 4HUGA 4CJRA 5IY5H 4KREA 2QWLA 2G8HA 5GAHP 2Q2RA 5C4JJ 1NKCA 4OAYA 2Z1JA 2GV9A 1BJZA 4V19S 4CZCA 4XMYA 3CP8A 2FU4A 2VE8A 3ZRGA 3CC4I 3LALA 3HRTA 3DXMA 2XB5A 4KHYA 2DMNA 4GGGA 4BWMA 4FJJA 1MH3A 3AAQA 4B1XB 4AWXB 2GTDA 4FSVA 2XY5A 3ZCMA 3CZ6A 5KTQA 3JRBA 1IKYA 3KWIA 4F93B 5E26A 2FF6A 5FRMA 1L3LA 5C2FA 3BTLA 3CYMA 4B1RA 4PZJA 1I5ZA 4IOAL 2A5YB 5E79C 5GAGJ 2M8EA 4HNUA 1IN6A 4BR5A 3MN9A 1D1BA 2CUZA 4CHOA 2P9KA 4CCJA 4CD3A 4IEJA 1HYSA 1FIPA 4CZJA 4XOTA 4IKFA 1ZR4A 1W36D 1O3TA 3WU0A 1ZREA 2MD0A 3VQ6A 2M9HA 3TP0A 4CEAA 4ENKA 2LC2A 1U9NA 1FLIA 4ISEA 4FPBA 4B9NA 2NVQJ 2E36A 4RGSA 1WUAA 1XMAA 5E3NA 3BG7A 3F8MA 4IJNA 2PQ8A 2V1NA 3SQ2A 5BS6A 2E34A 4Z94A 4ZDLA 2CUJA 3RPQA 3J7YJ 4D5CA 1RI7A 1N8RO 1XTAA 2ITMA 1BGXT 3LWMA 1MBHA 4Q4ZF 1FP2A 3TWHA 3KE2A 3LDQA 4W5RA 2IOCA 3HTUA 1SANA 5DV5A 2IIRA 1XSDA 3CMYA 3ULQB 4JK8A 2YHYA 3V8KA 2HYFA 1WJBA 4DV0K 4K25A 1YS7A 2IA1A 1HA8A 1OH8A 2HTJA 3KP4A 4RB2C 2HWVA 2EA2A 3ZGKA 2AP1A 4JYKA 5E8GA 3THYB 4IX7A 3T1HK 3NH0A 3S32A 5EEAA 3LSIA 4KNYA 2HS5A 5LJVA 4QLCU 3TW6A 5KRSA 4W5NA 3DQVC 4XBFA 1KFDA 1WAJA 3QIPA 5JHUA 2V26A 3JRDA 3C95A 4C8LA 2RNGA 3CG7A 2HU9A 2WA0A 4DFKA 3LP3A 1MD0A 4MEYF 2L7MP 2JA8J 1S9GA 3HZJA 1X1DA 3SEQA 3GFIA 3I4NJ 2BXYA 4DHYA 2KJBA 4DTMA 2BZTA 5AZJA 3RMCA 4A59A 1TWHJ 1NK9A 1NG7A 3G1LA 1E3HA 1FT9A 1J5YA 2IJLA 5F1RA 3BY5A 4CJEA 2JMWA 1TV6A 4OPJA 4W97A 1Q81O 2BY2A 1YTAA 3LWLA 4UV9A 3VEVA 4DUYK 4CZMA 1ZG5A 3O8MA 3GLXA 3ZSVA 2KRFA 1A6QA 3KD1E 1O57A 1FBQA 1EXQA 5HODA 4CGDA 2F5DA 3FF5A 1KYZA 1KAXA 1RESA 2KFZA 5IOYA 3F6VA 3TPQA 2GM4A 5EZHA 2ECBA 2GUIA 1KGSA 3PIPL 3CETA 4JK7A 4NB4A 5F2RA 1LKXA 1ZARA 3SJJA 4CJFA 1GVJA 5HDNA 3OA9A 4W1UA 2NVXJ 4BS9A 2FJ1A 4LIUA 4TSXA 1JKQC 2M87A 5LEKA 4IRIA 5FLMJ 1UHSA 4Q5SF 3HPOA 2QQ8A 5I9EB 1T33A 1KVAA 4M9SA 3CC2N 2WTEA 3KEQA 2DT6A 4HSTA 3S2WA 2X6OA 4L9NA 4CBWA 1BC8C 4KHUA 4FWRA 4BC4A 3ZMDA 1HYVA 1VSHA 4DTNA 4UHTA 1SFEA 1FKOA 4RW8A 1POGA 3E01A 4DR6K 1GOCA 1VSJA 2QEXN 2PMUA 5DM7F 5KPZA 4L9VA 1VQ8I 3G3ZA 2NRRA 4FJLA 5BN8A 2VKHA 2Y31A 4BVOA 4KT5C 3HIFA 1EETA 1ORKA 3IL2A 4BR9A 1N6QA 3SMPA 2UUCK 4L5JA 3TMOA 1XDSA 1ZLKA 2X6NA 4LFUA 3V9XA 3SBTA 3QAHA 1BI2A 3S8PA 3WXMB 2XASA 4HX8A 1K73O 4CK2A 3MCAB 4RW6A 1QQCA 4JKDA 1LFUP 3ECOA 3CFPA 2VIXA 4PSXA 2FF4A 2XF7A 2PX9A 1C1AA 3S2DJ 3KD5E 3NVMA 5EY4A 3HHGA 4LC9B 3P31A 1OR7A 3I5UA 3KCCA 3KP2A 4UB6C 1S72I 3BR6A 5H6QA 3VA0A 1QA6A 3QODA 2ASOA 1RBSA 3MVPA 3ZSRA 2X48A 3GTOJ 3D2EB 3PUFA 4QWQA 2QSHX 3FLCO 4YDUC 1HCRA 2MC3A 4H4OA 5KAFC 3ZR8X 1K7AA 4DFPA 3H9GA 3T0YA 2R5ZA 5D8LB 3F73A 3RWUA 1ZBFA 3UKUB 1WBBA 2YX6A 4W5QA 3J80O 3TAFA 3L09A 2Y9YA 4HUFA 2COMA 4FOIA 4ESJA 4Z6YA 2WWYA 3PO4A 3C7NA 4PJ0C 5GPCA 3CCMN 3D5RC 5C0YA 1HSJA 1DU6A 5AQQA 3QPTA 4NB5A 2K5CA 1JCGA 4CHPA 4NQWA 4LG0B 3HEFA 2E5NA 3B6PA 5LGNA 2A68F 3WXIA 3LWFA 4EP4A 2CO5A 1MBFA 5KVRA 2KZMA 3WXJA 4JP0A 1UHMA 4DR2K 1ZN2A 4X62K 4FWMA 3N4PA 2Q31A 2PBIA 4TV7A 1R5GA 2BANA 3B73A 5BOXA 4M3UA 5M1NA 1S6LA 2CH0A 4P5OA 1RUNA 2MH9A 2G7UA 1Z6TA 3M8PA 4CCNA 4HA8A 2R7TA 2DFFA 2O03A 4LFAK 2HVSA 3BJAA 1RT5A 3GFJA 4KHPK 5MLCQ 3EDPA 1VF9A 2ZF5O 2VC0A 3C18A 3FHNA 4DTSA 4NC6A 4BR4A 3RRHA 1TL3A 5B1AH 4DSJA 1HMVA 3MDQA 5GADJ 4HNVA 4KTQA 2VCPA 3LDNA 4CHZA 1HKGA 2QSGX 4LSNA 4L9JA 2CG4A 1WVRA 1I27A 3D0SA 4O5BA 4QPQA 4HRIA 5J1UA 2CJJA 4PGHA 5FLVA 4CGIA 1F21A 4P96A 1VRTA 5C3EJ 3CCQI 4CJ3A 4IL6C 2JA2A 4LFBK 1ETYA 4ITVA 3O1BA 2L7FP 3D2FB 3K4BA 3O3HA 2K3FA 2EFNA 4CFAA 2UU9K 4YOYA 3JAMO 5IP7J 2KLAA 1G3SA 3LSTA 4ILGB 4DW6A 1KRPA 1W4MA 2JQ7A 2KLOA 5AQIA 4A3EJ 1YJWI 2DK8A 2LR8A 3C2GA 4Q47A 2HVHA 1QZ6A 3EE8A 1YX5A 1FOKA 3HP6A 1RBUA 2ASMA 3JREA 4CEDA 1BQMA 4J19A 3CF2A 1TKXA 1Z91A 5HLFA 2XAGA 3DEWA 4BH9A 1QO0D 1X9JA 1DEJA 2K02A 3H0GJ 3O4NA 1X2NA 4BR2A 3ERED 4EAHD 3LQRA 5LGUA 5EOYA 1WSJA 3KLEA 1VQKI 3OY9A 1WQ2A 4XNFA 4WCEL 5AQPA 3P83D 1EP4A 4FJHA 1X3NA 2BVMA 4JKFA 2V7ZA 3T69A 2QXLA 1ZGJA 3V1QA 3BPXA 3H45C 2CV1A 3HGGA 3HOVJ 4IJAA 1UJ8A 1XHXA 2OTJN 2I10A 2E1CA 3A2FA 4KUMA 2FUG2 2ZFUA 2ITGA 4MTDA 4CF2A 2JTVA 3RKYA 1TTYA 4FJ7A 2M0CA 3QERA 4OX9K 1DDNA 4JNEA 3SHFA 4IDHA 4CZZA 3L2QA 1EH7A 3EO3A 5AZIB 4M6YA 3KYDB 2WY7Q 3K69A 2DXIA 1PP8F 3ZETB 4YDUA 2MBFA 2D0CA 3BG9A 4YOTA 5AQFA 2HYGD 4BR7A 1YW8A 4F3QA 2YSRA 2KDOA 3E5XA 2R3SA 1C0UA 2ZBKA 5ILUA 3F8BA 1H88C 4O5VA 2HF4A 1EWQA 1YJ9I 2HB5A 5HOOA 3OW2M 4LOCA 4IG0A 1SFXA 4DGWB 4LG3A 5BMZA 1UB9A 1VFCA 2QWQA 2GA1A 3I9V2 5HNFA 2HVIA 2JZYA 3BGRA 4FM1A 2NRWA 5CE3A 1IDZA 2NNNA 2JUGA 5TJJA 5AJ3K 3BCAA 1JLGA 1C0WA 2DOAA 4IRHA 4G1QA 4KI4A 2NOJB 1FOWA 2QQBA 3BWGA 4DTRA 3O3KA 1QZEA 3LANA 1T8IA 2RN2A 4C2TA 2M0MA 1RT3A 2YPRA 1WGXA 4AHCA 3SI6A 2JN6A 3ZT3A 4NO7A 3OYIA 1REVA 3I55N 5E1XA 2OUMA 5CQGA 1SD4A 2BYVE 1VQ4N 3LSGA 4RGRA 4FLVA 1OQYA 2IP2A 2D0PA 4QPOA 2HHHK 3VOVA 3VEZA 2LY1A 3A0HC 3LM9A 4OGCA 3CF5F 4BC3A 3P1GA 1GOAA 1TKDA 4D7NA 3ISPA 3RKXA 5JI6A 1I50J 1Z1DA 1BOTO 2XSDC 2H09A 3SXYA 2LP0A 1MJBA 1S9HA 2BGCA 4R5PA 4AVZA 2WUSA 1BW5A 2CMPA 5C25A 2E2QA 3S41A 1K78B 3ZMSA 3VPZA 3HVRA 5L3CA 5AQLA 5BRFA 3QU6A 2ECCA 4E70A 3PY8A 2W25A 4IFEA 2QGUA 4XRMA 1VQ5N 3GDQA 4UQGA 4ZTJA 4WXCA 2W7NA 1DUXC 2V1UA 5GAHJ 3CQ8A 3P38A 3FK7A 3D1NI 3M7GA 4XEIA 4KHNA 4A0XA 4EMSA 2V7FA 3DF8A 2KQRA 1TYQB 1MMSA 3RMAA 2VGMA 3GTMJ 4FWOA 3VQEA 3CQZJ 3P7NA 2NRHA 3O08A 5J2PA 1B72A 4JK1X 3WXLA 4PKGA 3QOPA 4E6KG 5CLSA 4Z4EA 2QENA 4LB5A 1I1GA 3A1YA 4WQ5C 1UA0A 1KA8A 4JD2A 1DGWY 4M7YA 3LP2A 4JQFA 2E1MB 2EV6A 1OCOH 4M3DA 4AIJA 3K4JA 1MBGA 2UUBK 5ED4A 3QBWA 1T6SA 2XC7A 3C2HA 3ONQA 4I2OA 1I6XA 4K2EA 3L3UA 2H3GX 4OLBA 3SUQA 3VYUB 2JWTA 2O8BA 1PDNC 3F9KA 3LDPA 3K4NA 4BRCA 2GWRA 4B8XA 4FJMA 5EYRA 2GWJA 2F5FA 4C8OA 3J80K 3OYEA 3OTOK 4KAZA 2OCEA 4X6AJ 4FLWA 1KU2A 4NLBA 2F5EA 1OCTC 3H08A 3KVGA 1SMTA 1V55H 3E5UA 5CQEA 5FO5A 5HS8A 1RBRA 5GAEP 4N9HA 2CGKA 3BJOA 4PGGA 2LG4A 5FRNA 1SFOJ 2OCCH 4HW0A 3VPRA 3CMAI 3IC7A 4Y3OA 3PNVA 4O3MA 3DEEA 1RDCA 3HB9A 1XMKA 4BEHB 1IN4A 4JAXA 4HBLA 3OYGA 4M6XA 3DCFA 3KZZA 4IOCF 5L3BA 4CGJA 4A3CJ 3DPTA 1J5OA 2EFOA 4L5EA 2KZGA 2NXNB 2XAUA 4BRHA 4I6MB 2WY8Q 2Z1GA 5TISC 1JLQA 1KU9A 4JBAA 1SL1A 5ICFA 4OIOF 4I9QA 1JKRC 1V5FA 4CZGA 3H3VK 2A3SA 3LZJA 2A41A 2BW3A 4ZYAA 3CDIA 3HKZA 4UVAA 4ZH4F 4A3MJ 1GLDG 5CVIA 3C6AA 4B9QA 3OYBA 5LMNK 2W6KA 3NRVA 1RFQA 2LD5A 2HNYA 2EZHA 3MX2A 4LGWA 2JLEA 4EHUA 1Z3YA 4BQAA 5ADXA 3SBGA 3WTTC 1W9HA 4IOAF 3K4MA 4A61A 4I76A 3AVGA 4BKXA 4AH9A 4B44A 2AQFA 1BA0A 4BQNA 3RSEA 5F0CA 1VQNN 1VQ9N 2O8FA 1WSHA 5AQJA 2E1MC 3SAHA 3VTHA 1UA1A 4XSXF 1VSMA 3CCLI 2VBWA 3ELKA 1TWCJ 4BY7J 3VERA 1TT0A 4CESA 1G59A 2CU7A 5CHIA 1N77A 1LE8A 1P9QC 4PSWA 3JSMA 4DFJA 2V1XA 3IS9A 5LHHA 3BR0A 4CECA 1JGSA 2K9SA 1CF7B 2BE2A 1HW5A 3CCSI 1NMDA 4CJVA 2W40A 1ZGAA 4DR5K 2DMUA 5KCMA 5B8HA 1D0ZA 5AR0A 3B6OA 4LF6K 2ZJPF 1BJAA 2O3FA 4B3AA 3H36A 1QHHD 3BR3A 4CJWA 2XV4S 5JR3A 3ENHA 1NGGA 3ZCOA 1W97L 4PKHA 2G8VA 1UCRA 2D2WA 3H5AA 4JI0K 5DUIA 1TL1A 3K58A 3QOEA 2EBIA 5EDNA 3BCBA 5J4YA 2X6SA 4YFNF 2G7HA 4BDPA 3CJBA 2BBYA 5KGXA 4RGXA 3THXB 2CQNA 4R8HA 2X78A 2ZJRL 4CVNE 2A69F 2PJPA 1P6RA 1YT3A 3FMRA 4JEPA 2JGUA 3H46O 3AVMA 4KPYA 2FBHA 1BIAA 2P9IA 2MSYA 3SV4A 3GE1A 5FDLA 2DMTA 4JKGA 3AL0C 2VG6A 3OYLA 2DA4A 4CJQA 4XQFA 3L2UA 2O8CB 3F8FA 3WTZA 3QQAA 4UY8I 1B9FA 4WFAL 2Z1DA 3BTIA 4BQQA 1PUFA 1RGIA 1RBTA 1K8KB 5CR4A 2GIVA 4EZ9A 3PUBA 4G9ZA 3A5OC 2FEZA 2NS8A 4M3XA 1Z77A 3RKQA 4WK8F 2GOXB 1MDUB 2G8WA 5B1BH 4RG8A 3PX0A 1A35A 1MA9B 2YU9J 3O1WA 1R22A 4JI5K 1QS4A 1QHGA 3KWGA 3AAPA 2FSKA 3Q5FA 2CGJA 3TR8A 1K6OA 3K9KA 1LNWA 3PX4A 4ID1A 2VQCA 1NGFA 4A93J 1WH5A 1A6IA 3HUGB 4A3KJ 2ELHA 3SK3A 5F27A 3PIPF 5BREA 2F96A 3AVHA 3HSTB 4IXCA 1FWZA 1LCUA 3TABA 1MH4A 4QOZB 2O4IA 2GXGA 1MDMB 1JE8A 2QA4N 4WQ4A 3RYRA 1YYVA 1X9MA 1SL0A 3QNNA 1GLFO 2OPPA 2BXZA 2O8EA 3ABUA 2JSCA 3K6GA 1HF0A 1YJNN 4DR1K 3GMEA 4BAYA 1D3YA 3T5XA 4J2EA 1UOCA 3MAJA 2CW8A 3KLGA 3N97A 3SMSA 1FYMA 1YX3A 4G8XA 1HPZA 3PM1A 3QO9A 3M8QA 4FE4A 4L8RB 1U6GA 3LMMA 4EZ6A 5K5OA 4QAGA 3AG1H 2G8KA 2XKPA 2OQRA 4M6VA 3EYIA 2EV5A 1VSLA 5AQVA 3L3VA 2XKOA 4OKJA 1MZBA 3IAYA 3QFUA 4FT8A 3CC2I 4GKJK 2DU9A 4MDAA 4Y17A 5K7HA 2X1DA 2OAZA 2LREA 4YELA 2DQLA 4XH4A 3P9CA 3QEIA 4NUBA 3AGRA 2E1YA 5E84A 3A02A 1S7AA 5KQ8A 2XPWA 2MW8A 3LPUA 1ATSA 1JLEA 3LSMA 4H0EA 4KRFA 3DRSA 1XDUA 5AQGA 2QEXI 3BC8A 4KT6A 4FE7A 5BPMA 3EEQA 3ULEA 3CDHA 2R7RA 4HNTA 3S1QJ 4P9FA 1XX5A 2A6HF 2DT5A 1Q9XA 2BY3A 1BCOA 3ULDA 3WEEB 3I56N 4PJJA 2X9DA 3THWA 4OJRA 1TLHB 5H20A 2DA3A 3JCUC 3VF4A 1MMGA 1JJ8C 3QP6A 1IRGA 3F2KA 1J5EK 4H0XB 5LY3A 5FPNA 2FA5A 1R5HA 2F9TA 1NG6A 1A04A 2K85A 4A3FJ 1Z25A 1MSEC 2L01A 1W1WE 1OKRA 2R7VA 2RV8A 3UKRB 3FXLA 4ZDPA 2EV0A 4BEHA 4N56A 3FMSA 4B08A 2Y0SA 2HMIA 4A69C 4FOEA 3ESWB 2ZXWH 3R0AA 2NUBA 3QRFF 1B8IA 2HR3A 3BQZA 5SZTA 4BRGA 3N4QA 4EFHA 3V6DA 4AHUA 1NOZA 4I09A 3SAGA 4CGHA 1GLAG 4ISGA 4FO0A 5FFZA 1WN7A 2ZNZA 2VG5A 3ZYYX 3TL4X 3I0SA 3R0JA 4B3OA 5J2MA 2CGPA 3A4CA 1J7KA 1IN8A 1SFUA 2Y2ZA 2J5OA 5C24A 5HLTA 3SFIA 1L3SA 4JX4A 1QTMA 4MFBA 3O3FA 3ASOH 3CCMI 1D0YA 2JVHA 3VENA 2P9UA 3B02A 4CEZA 4ANJA 1JXSA 5JLXA 4H0YB 3JTGA 1EQYA 1SUQA 2R5YB 4S04A 4A12A 5FFXA 1J53A 3OSGA 4X1EA 4MTEA 2WC2A 1IZ1A 2CYYA 3HOSA 1W0HA 4JHDB 1T2KA 3TU5A 4GO1A 3S3MA 3LSKA 1IRXA 3B6AA 4FWKA 1KVBA 1FJLA 1JXBA 3V8LA 4IO8A 1NJYA 3G4SN 3MEDA 1T39A 1UMQA 3RVCA 4B3TK 1OCRH 2XVCA 2RAEA 3RQIA 2DQRA 4Y13A 4DSKA 4HTUA 1Z21A 2NVTJ 4KFBA 4F55A 5AFUA 2IRFG 3PFYA 3SQNA 1UAXA 1SQKA 3NWSA 3L4IA 4LLGF 2FSJA 2G8FA 5EGOB 3QYBA 4ZHRA 5TRDA 3ZSXA 3TAEA 2P9SB 4OPAA 4YY3K 4Y33A 2M1BA 5F64A 3KLNA 4CYCB 2QBYA 1TT5B 5I3UA 4GKKK 2XO7A 3DRRA 3O6WA 4HCCA 1T7PA 3DP7A 1CQTA 1WH7A 1OYIA 3CJCA 2VE9A 1VQMN 3RRGA 4JLHA 1NKBA 1IXRC 1XC5A 2N8GA 1JT0A 4M72A 5A2QO 5JLWA 3S93A 1HLUA 2CW7A 5FPDA 5C10A 1V3FA 1VQON 2XGXA 4ID5A 3H3UA 1BR4A 4M3GA 3KX2A 3TAMA 3OR2C 2FNAA 3V8JA 4DTXA 4KB1A 3QEVA 2DA7A 5TGTA 2AXLA 5CZ1A 3IH4A 1FOYA 4DFMA 3KKSA 3L2VA 1TK8A 3TEDA 1EJ9A 3KLIA 2LFBA 1SD5A 4A3GJ 4HX7A 1IV6A 4H5WA 2EFQA 5DM7L 1WCMJ 1E4GT 1S3XA 2HKOA 3DOLA 2V7YA 4KIBA 4IZ9A 2F4VK 2DT7B 4DB3A 4ZTFA 5F0HA 2Y0MA 3R6SA 4CZKA 4M71A 3AO2A 4XIUA 5GINA 3J7AP 1R5ID 3CJAA 4RAYA 5KPRA 4DU1A 4X65K 2FXUA 4CF1A 1R00A 1D8KA 3O4QA 9ANTA 4PK4A 1YLFA 1Q9YA 2FOWA 5KPTA 2NS0A 4WF9L 4BJ6C 4EGZA 3KIOA 1HUXA 5DCMA 2VN2A 4IO9L 3V9SA 3UNGC 2KKZA 4BE1A 3M3YJ 3H0DA 1FTZA 3IMXA 1DGRM 1OJLA 1VSFA 1GT0C 4NXNK 1TWFJ 3LAPA 4KB0A 3VQDA 2LKXA 4F9OA 5J47A 2RQPA 3MN2A 2HKXA 5HRPA 3CMEN 4I6ZA 3HUGA 5FD5A 3CQYA 4F3TA 2DA2A 5LFAA 3FKJA 2OTJI 2JT1A 1O3RA 4EGYA 1YQAA 5C42A 3M4OJ 3AAFA 1X1BA 3D45A 1QQIA 4UUSA 3CXCM 1DQUA 2YR2A 3ZSYA 2RDPA 3PSIA 2GZWA 3FXJA 5C4XJ 1OPCA 3W3CA 1E3PA 1HR0K 1Y0UA 2OV7A 1UG2A 1A5JA 3HTVA 4IXAA 3OJSA 4JS4A 1OVQA 3I54A 3MFKA 2GBYA 4A62A 1WSUA 1Q1VA 4XL9A 4KHSA 3BJ6A 1FMWA 2VWJA 4HAMA 1RRJA 4NC8A 2KHMA 4RW4A 3K70C 4X66K 3EYZA 2EWNA 2CS3A 2WADA 1WSGA 3U1KA 4YOUA 5DD4A 1ZK8A 4DR4K 1Y0NA 3O8GA 1DLOA 3OIPA 3Q0WA 2W84A 4CGZA 3SZGA 4PL7A 2NYXA 4Q48A 2VKEA 3WU2C 1W2BM 5EG0A 2P6SA 4A3BJ 4N47A 2DPUA 3VQ4A 1BISA 4MLEA 1MWKA 4UB8C 1RKTA 5JLHA 3PLAA 2DW4A 5K1YA 3JXUA 3MCZA 1WJAA 4XLCA 3BTJA 1O13A 4H5RA 4JI7K 2QKMB 1QGPA 1PJRA 3KP3A 3I55I 1WNSA 3ZMVA 1NK6A 1FBUA 5GAEJ 1L0OC 2JJ7A 1NJWA 3AVNA 1VQ4I 3O3GA 3SZPA 2OTLN 3A2KA 5LRSA 3K5MA 4FM2A 1FK9A 2QK9A 4BBSJ 3HRGA 2OJED 3AA5X 4H0VB 5H1SQ 2QUFA 4UXNA 1Y8RB 4DYQA 1HKTA 3U21A 2DBBA 5EX5A 2EWSA 2O8XA 4DV1K 1H9TA 1W36C 3ZQGA 5D4SA 2RN7A 5IT9O 5J6XA 1X3UA 1QSYA 3ASMA 3AG2H 3UKRA 5EEGA 4IRGA 3TANA 5GP9A 4E1NA 4DU3A 4YNQA 4RCHA 2F8SA 3MQ0A 3A0BC 4G6TB 3EUAA 3JRHA 4CJ7A 3NWTA 4DQRA 1Y1VJ 4GYIA 1KCFA 4BC2A 3CIPA 2E1ZA 4DLGA 3RPUA 1IV8A 2DMPA 1RTIA 4XORA 1ONVA 1VQ5I 1BM9A 4FWLA 2A07F 5EU7A 3N05A 4ETSA 4AU7A 2L9RA 1U2VA 5FD6A 2YUSA 5CY4A 1L3VA 4JYAK 2EQRA 3DLHA 3DJCA 4ESBA 3NARA 4GDFA 1WI9A 4PHTX 2L5QA 1TVRA 2H1KA 3A5MC 1DU0A 5HLHA 2HXIA 4X0GA 2CWEA 1YTYA 4BE0A 2EILH 2ZXIA 2NRTA 1JCEA 5AQUA 1IRZA 1KXPA 2YX4A 2QVOA 2P9LB 1OH5A 4R1HA 4XLHA 4DV6K 1WJCA 3EN9A 4QS9A 4BGDA 3VYSB 1W7PA 2FSNA 4MHGA 5BPDA 2KZVA 4B1WB 4KN7X 4H0OA 1D5AA 3TP3A 4PDKA 3ZEUA 3DMJA 2YHXA 4Y1CA 4N4OB 4LK0F 1C0MA 2FBYA 4AC0A 1UFMA 3MWMA 4A2UA 5JHFA 3V4IA 4II3A 2OPRA 1QVTA 3Q9SA 3E0JB 1IC8A 5F6FA 3NEUA 3OBWA 3FFIA 2K40A 1LEBA 1IG8A 2P9SA 3T8RA 3K10A 5IT3A 5HNHA 3DV8A 1X1AA 3ALYA 2VL8A 3NF7A 4LF9K 3FBIB 3AVCA 1QRYA 5E1WA 3WHBA 2KMUA 4JI8K 1YAGA 3HM5A 1HPMA 2QI2A 3S1MJ 3ABLH 4EHTA 3RTVA 2E8AA 1PYVA 1BC7C 2L9SA 1NKEA 3CCVN 1PUEE 1VRUA 2QQ9A 4DNCA 1LQ1A 1DTTA 4O5FA 1YFHA 4F3OA 4KFCA 4UVBA 4MIMA 2GXBA 2YNFA 1LDDA 1Y64A 2D1HA 4M3FA 4O44A 3MEGA 1BCMA 2DDBA 1W5CC 2O4GA 3CCEN 1RT1A 2HNZA 4B3SK 3OS0A 1MNDA 3CO6C 2HDWA 1YIOA 3RCOA 2M7AA 3SAFA 3CUQB 1QE1A 2VWKA 3VYTB 3FISA 1QSLA 4F91B 2RE2A 3TO6A 3HGYA 4BRNA 2F4OB 2RHKA 3CF5L 2QYOA 3SYTA 2K4JA 1HNXK 4KJZA 2ME0A 1ZG1A 4GV3A 2QM3A 4AUXA 2ZJQF 4BG8A 4UY8O 1ZBSA 4BRKA 5LLQA 1VZ0A 1NK4A 1VQNI 1VQ9I 2ESNA 2KIUA 4C2UA 1R1TA 1HDPA 1VSDA 2PLYA 5KQDA 4B9TA 1HKBA 4FK2A 2XRLA 3FXMA 4BXXJ 3QP5A 3HM9A 1NGIA 3T1AA 2YNGA 1Z7LA 4DSFA 4LSLA 4HV5A 1Y1WJ 2FLOA 5BNGA 3SDGA 3JRFA 4KTZA 3MK6A 1ZGWA 4E3SA 5E20A 3MWPA 3CMMA 4RDUA 1WSIA 4DQ8A 4XK4A 5IPAA 4O0JA 3LSHA 3SJHA 4PFOA 3O9SA 1U45A 4IEEA 1NJZA 3KFWX 3SZTA 1JLBA 3HHHA 2W1OA 3NHGA 5CVRA 5DM6F 3LZIA 2A6AA 3FR0A 3V42A 3SUNA 1U0JA 2KL4A 1AOYA 3KYCB 2P9PB 3HOZJ 2LKSA 2DLLA 2EB7A 4XKCA 2IS3A 3QEPA 3ZT4A 5M5WJ 1H8AC 1TW3A 4CIGA 4M3RA 3ZQ7A 3KK7A 3FGUA 1YE9A 3RR8A 4FK4A 2D0AA 1N78A 2E6LA 3KEOA 2QWPA 2ZMEB 3HM8A 3CUQC 3ZQLA 3COAC 2QQAA 1VSKA 3OYMA 3HVTA 5HP1A 4FW2A 1RDBA 2IBDA 2PFUA 3NF9A 3IP4B 2EH3A 3DRPA 1X1CA 3MX5A 1X19A 2DPNA 2E2NA 2Y1JA 3D5SC 3LNQA 1JTYA 2QTDA 2ID3A 4LH4A 1QVUA 1RTJA 1C6VA 4Q0BA 5DD8A 4FZYA 1LAWA 3HTSB 4XN3A 1IO2A 4CEEA 2YKMA 2OC6A 2Q0UA 3ZOBA 4KI6A 4IOCL 2Q1ZB 4HQMA 3DKWA 4NCBA 1IXSB 4FTHA 1ASUA 4B3MK 2IA2A 3FFKB 3REOA 4F92B 4MQ9F 2W24A 3SPZA 3EE9A 4LF7K 3CJ9A 3FX3A 1SFKA 1LW0A 1ZBIA 3E97A 4ZDOA 2I5JA 1MNEA 4J00A 4HG2A 2HHQA 2QA4I 2ZKZA 3BF1A 2XGDA 3E7LA 3TO9A 5BPIA 4FLTA 3GYHX 5D5UB 3AARA 1YJNI 3VWBA 1RNLA 2O8DB 4IHWA 3CCUI 1RTDA 3CJRB 3GLLA 1QQNA 4BXUA 2YS9A 3FBNB 3SFZA 2EIJH 4HPQA 1TGOA 4J2BA 3CUOA 4MDBA 4CDGA 2MC4A 2BOLA 1IAWA 1M1EB 3HL2A 4U7DA 3K5OA 1E2XA 5FKOA 2X1CA 4OGEA 1GLNA 2IS2A 1KC8O 1YI2N 1H1VA 4UNOA 3R4KA 2FBXA 2X85A 3E6DA 1FYLA 1REPC 2OZ6A 3NGZA 3D7EO 3ZN0A 4XIDA 5DDGA 4U87A 5M3FJ 5M5YJ 2M8GX 3MEEA 2RF2A 4B1UB 3I59B 2UZKA 2ZMEC 4AHVA 1P4AA 3FDYA 1GLCG 3QESA 4B9SA 3W6VA 4DR7K 3G71N 5B5EC 1WJ5A 5GAGP 5K5RA 3L6QA 4GMJB 2VXZA 1TWGJ 4HZFA 2ZJPL 4AM6A 4JRPA 1ETVA 1U8BA 3WTVC 2CH5A 4QTRA 3K9JA 3CO7C 2R7UA 4CZHA 4IBNA 5GIPA 3I56I 2AJQA 1HW1A 2JA6J 2I7NA 3ZT0A 2PJRB 4XRFA 2W6LA 4XLNF 2QW9A 5FKMA 1YITN 3Q7BA 3R3LA 4EM2A 2V9VA 3FXRA 2PMZA 2ISZA 4O4GA 1GDTA 2XAQA 3BY6A 3VDXA 3FHZA 1EH6A 1XGNA 3O9TA 4Y0WA 4L18B 3K1NA 4N9IA 1YIJI 4FM0A 5KGWA 1KAZA 1B92A 2YKNA 3L2WA 1YOVB 3V1RA 3HRUA 4BVPA 3FXOA 1BIBA 2X74A 3OR1C 4NXMK 2VASA 3BROA 2HQAA 2W42A 4N0BA 4RB1A 5FJ8J 3W2VA 3ABMH 4BYYA 1S7EA 5FPEA 2WONA 2H1LA 2DOEA 1WB9A 3O5BA 3BR2A 4OIRF 3RDIA 4M45A 3VQ7A 2EX3A 4G94A 1U9OA 3LL3A 1ETWA 2G9WA 2Q0RA 3TSPA 2VT2A 5E3OA 2DI3A 3JRCA 4FJIA 3R6MA 2ELKA 3G0ZA 2PYLA 3SDBA 4EIAA 4DIQA 4DOZA 4B4CA 1EF4A 2EFWA 4LH5A 4BXFA 4F8RA 5LGTA 5LRRA 3NH2A 3I0TA 1LWEA 4DZJA 4FJ8A 2K86A 4O6JA 2HPIA 2JUCA 3CD6N 2R92J 1BI4A 2D1VA 2YX7A 3S9HA 1HNIA 1U04A 2WAFA 4P9UA 1R58A 4GVEA 1TNTA 3KYLA 1YRNA 3G4SI 1IBKK 2ZM6K 3FE1A 3CDLA 1U3EM 2XRIA 3RKWA 2XY8A 4WX9A 4ZYEA 5C2DA 3QICA 4YFUA 5J3LA 1SV5A 1M90O 4XH1A 5FLXZ 1NOYA 3CCRN 3EETA 2V51B 3FZLA 4KBOA 2IVOA 4BG9A 3H1QA 1HJRA 4DG1A 1VQMI 4B1YB 2M4KA 3P5JA 4E4HA 2BY1A 4LF4K 4E7SA 1LOTB 4F2SA 3VMFB 3GFLA 4XH5A 2K27A 2E1NA 3TW7A 2NRZA 2UYTA 1VQOI 4K41A 2VOPA 3T1YK 3NE6A 4GFBA 3DTIA 4PFPA 4EJUA 3TQNA 1E3OC 4JI6K 3AO4A 2DA5A 3OMYA 4YRVA 1U5TB 2FRHA 1Z6RA 3IRQA 4DTOA 4M3EA 1HX1A 2XRNA 2L7KA 3DLGA 3VQ9A 1ENHA 2FX0A 1P92A 4PJLA 1TBXA 2WB1A 4J01A 1Z67A 4OKEA 2VYPA 2DYSH 4IO9F 2VWBA 5CYMA 2ZMEA 2BGGA 3D0PA 4K42A 2UXBK 2LBFB 1F1ZA 3Q3SA 2CFOA 1KLMA 4C3HJ 1GLLO 4DYCA 3IUOA 3M5RA 1NK2P 3QBXA 2YV0X 1K6YA 3VSLA 4CF8A 3QNOA 4D1QA 2DN0A 2CQXA 2IT0A 4OMZA 4E7HA 3WE2A 2YNHA 4HTLA 1QVFM 1L3TA 3DXKB 4O0IA 3TTDA 3A01B 2KFDA 2NRVA 1ETQA 4A3DJ 1V4TA 4OLAA 4GRIA 3BLYA 3K5LA 5ICGA 4G12A 1LFPA 2KZZA 4ENJA 4MFDA 3J81Z 3CMEI 3LP1A 4FX4A 3U3YA 3CM6A 2I5UA 1XGSA 5CPRB 1YJWN 1BR2A 5K5QA 2BTFA 4XOPA 4JKAA 5E8IA 3NMUA 1R1VA 3MKWB 3IG1A 5E41A 2V6CA 3O9QA 4DSEA 3ECHA 1NGEA 3LDOA 4EM0B 1JCFA 3S1NJ 1NG9A 3ERMA 3BDDA 3QETA 3TOBA 2IA0A 2J5PA 4QS8A 3DXMB 4G7HF 3HJFA 1RZ4A 1R23A 2HQNA 4I02A 3VODA 1CGPA 2R0QC 2CQ7A 3M6GA 2WAQA 3S17J 2NZTA 3ABKH 5DS9A 4H0TB 5JFRA 4DZPA 4E0DA 2I8DA 2V52B 3VEYA 1FC3A 1U5TC 3OS2A 4E1MA 2ADUA 5M1QA 1S5LC 1T08B 2IS1A 4DYRA 2R7WA 4DR3K 4ILJA 1LJ9A 1GLBG 1DTQA 5FKNA 2DAOA 2OD5A 2L0KA 4YIFA 2VI6A 4DTJA 2IVMA 3L2CA 2L4MA 4C1NI 2E20A 2HQRA 3MWTA 4CJTA 4HDUA 4RA2A 4G6DA 4MQVA 1PP7U 4HWIA 3DLRA 5BR9A 2Y1IA 4PY5A 2Q3SA 4DQPA 4BQLA 1YJ9N 3MAQA 4A5AA 4DQSA 2OTLI 4DBRA 4B8AB 2EA4A 5ERIA 3CHWA 3KP6A 2HXOA 3GFMA 3H5NA 3RIRA 1SC7A 4CI6A 3NGYA 3CJNA 1FP1D 3H9JA 4XRSG 2K4BA 3P9IA 3F3XA 1KQ8A 1QBJA 1OCPA 4DBQA 2HOAA 3PIOL 5EVZA 5H2FC 4MGRA 3O6BB 1UAAA 3THYA 5KK1A 3C6TA 1IN7A 3KK2A 1NGHA 4H8KA 2GWKA 3PX6A 3E5QA 2KIQA 4CCMA 2JWKA 1XHZA 2HPMA 4WFBL 2L9VA 4A5MA 2VT3A 3OL3A 2OZSA 2XY6A 2P5KA 3ZSQA 1QVGM 1ON2A 3R8EA 4BRFA 1EV7A 1HOMA 3C7JA 1HSTA 4RTFD 3JRAA 3MKYB 1ZC6A 4ASNA 1TZLA 1OFCX 2LY9A 3AKZA 3V4GA 4M42A 3QDKA 2EZLA 2HQ5A 1S1TA 5BQTA 5KI6A 2JVGA 4XKBA 2OANA 1X9WA 2HFHA 4XN0A 5ELZA 4NCGA 4ON0A 2M2EA 4E1JA 2KKOA 3TKYA 4KDPA 4A0ZA 2IDOA 5DTDA 2EZKA 3WGHA 1D5VA 3OL4A 3T19A 4CF0A 4BE2A 5JVGF 4L9TA 3G25A 2HHUA 2XY7A 2O5RA 2ME6A 1RC9A 4JK9A 5AZJB 4M3TA 5M3MJ 3U9DA 1X4PA 3U9GA 2YU3A 4RB0A 3MECA 1D1AA 1R0AA 4CEOA 3C0BA 1JLCA 4FW1A 4MNUA 1I6HJ 2EIMH 3E6BA 4H5TA 2V6EA 4E7IA 3I3LA 5L3FA 1ZR2A 1TQIA 4K8XA 4AIKA 3K4LA 1YVNA 1A31A 4JI3K 3JSPA 3CPWM 2H94A 4I9LA 2M45A 4DLEA 1U4BA 1SS6A 4ENMA 2VLAA 2A05A 4WE1A 1Q86O 3CPEA 4BJ5C 2STTA 1BN5A 4U0YA 1NM1A 1XC3A 3LSRA 2AXTC 5DEQA 4AD9A 1J75A 4GV9A 1D9FA 3OYJA 1ZBUA 3RPUD 2M34A 3ML6A 3PQKA 4C8NA 2E4LA 4KKOA 3VGMA 3DKYA 1Z3XA 3QWLA 2Y69H 2FNPA 1AA7A 1SKWA 3AGKA 3HZ6A 3BR5A 3VA3A 4KO0A 3O9UA 1KQSM 1TKTA 4JKBA 2V79A 1P7IA 4CK1A 2NVUB 2P4WA 4DWIA 2A1SA 1L3UA 5HLGA 1AU7A 3IKMA 3E6MA 1YXQA 4EJVA 2VJIA 1FW6A 5AONA 3ZPLA 4V19K 3CCVI 1WLJA 2D0BA 3TI0A 3VFZA 2UV1A 4IF4A 1XNQK 3SQ0A 4HSRA 2BH1A 1E17A 1CLQA 2GEMA 3CJQB 1VI0A 1BWFO 4OPKA 3NQOA 3NFAA 2YCHA 3GZ5A 4KMUX 3ROUA 3OSFA 4IHSA 3MN6A 1TAQA 3CCEI 3L00A 4YOXA 2WTUA 1A36A 1W7PD 4DSIA 3M07A 5B66C 1A5VA 4JKHA 4CGFA 1NHAA 1FJGK 4PJNA 2LK2A 3T1BA 4J2DA 3VQBA 1JUMA 1KTQA 4DQ2A 2K9QA 4BGAA 5BN9A 1K4SA 1ZXOA 1JHFA 3TAGA 2MA3A 3C3WA 3D2EA 2OA4A 4GW6A 3S16J 1Y56A 1RBVA 1E0EA 2E60A 1OKJA 1F36A 2JA5J 5HRRA 3VYRB 4BRAA 1ZBHA 2VKVA 3F0CA 3F9MA 1Z26A 1BW6A 3UKUA 3AVLA 1S7OA 4HF0A 4CZLA 4IFVA 5M1KA 2KT0A 2Q36A 2CQQA 2DA1A 3I4PA 3H3OB 2R5ZB 1MMAA 3VOEA 1JKOC 3WNFA 2QCOA 2R7DA 1ETXA 3GTLJ 4Z4GA 3NAUA 4CEFA 1E4FT 1KLNA 2FSWA 4LG0A 5DK5A 3PO3J 2R93J 1XCBA 2DJNA 2LTPA 4CHNA 2QWOA 2GA2A 1Z05A 3HXMA 5GPAA 2F2EA 3C7NB 1ESVA 1IJJA 2FQ4A 1S3JA 5ADXH 1DP7P 3LM2A 4BWJA 4NQWB 1QNTA 2CW0F 2NNWA 1G15A 4BHPA 3TOAA 4FLZA 1N34K 2OU2A 4U88A 3AVIA 2B7EA 2UWMA 1WZ2A 1JL1A 4NBQA 2MFZA 4UUTA 3HI0A 3ZN1A 2EZIA 3ISNC 3CCLN 3RQ4A 2MG4A 3NGIA 1BBYA 3M8EA 2XF6A 3V9UA 2VQLA 3AO5A 2KPMA 4DV2K 3WODF 1F5TA 3NAEA 3W6JB 3LP0A 1V5GA 1XMOK 3DLEA 4LIVA 3VQCA 1F43A 4JX5A 3KZYA 2WBMA 4KV8A 2OZUA 5J8CA 5D5WB 2IVPA 1BHLA 2W41A 1XGOA 4M9XA 1NK8A 2O6GE 4LLNA 3PO5A 3CCSN 1LWCA 1RT7A 1HW2A 4EP5A 3NH1A 3H5RA 2ASPA 1ZKGA 3KZIC 2MGQA 4M73A 4ENNA 3MXIA 4XKWA 3R9PA 5AQSA 1SAXA 3IHUA 2HOSA 2DK5A 3DPUA 4HX4A 2VJ4A 1OR7C 3AG4H 1ZQ3P 4RW7A 1K9MO 2HOEA 4HDVA 1SAZA 2VOOA 4CXFA 3D2FA 1O7LA 5JS1A 2XB0X 3SJMA 2EJRA 3WGIA 3GG4A 2L7ZA 2Q0OA 1BUPA 4HEA2 2ZNYA 1YF5L 4M3BA 3W6KB 4O8UA 2E2PA 1JHHA 2E2HJ 1TC3C 3P39A 1W5SA 1TK0A 2QKBA 4H0PA 1T98A 3HOWJ 3KP7A 2HW3A 4XKVA 3OIQA 1LDKB 3G10A 1T05A 1WJEA 2QWWA 1I3AA 3FK6A 1TL8A 2YHAA 1L5UA 5D6FA 4PWDA 3KJVA 1TNSA 4IZZA 1KU7A 2F4IA 2XSJC 4K0KK 2Y9ZA 4J2AA 4Y4RA 3VGKA 4M7XA 2CUFA 3BQYA 4I2PA 5M1OA 2BDPA 2HHWA 3AO1A 3K5NA 3DKXA 1FNNA 2D4WA 1NH3A 3SEZA 1V54H 2ISYA 2B63J 2EINH 3FXKA 1USSA 2Z9OA 1I3QJ 3I33A 2KTQA 4LLLA 2GX9A 3CJ1A 3ENBA 1R6RA 3JAMK 4FPAA 4CBUA 2ZJQL 1X58A 4NYFA 1V5EA 2O9LA 2ETHA 3DBHB 2Q1NA 1C1BA 4UV8A 3E1YA 1YI2I 4K8ZA 1NGDA 4GCVA 1ASVA 5DCFA 5AZIA 1CZAN 3ZETA 4MFEA 3DI6A 4A6EA 3FMQA 4PQUA 3WNHA 4ZZDA 3ITHA 2GUPA 4CZIA 2DA6A 5FKLA 5HL7L 4BUPA 4OIPF 4IHXA 4CJUA 3V7SA 4FYDA 5B3SH 4RBOA 5HDKA 3G71I 3S1RJ 4ZJZA 4NC7A 1VQ7N 4ISFA 1WHUA 3DLKA 2B4JA 4AILC 1WWXA 4BNCA 4Z4FA 2Y75A 1WKMA 3SV3A 3RI4A 1KD1O 2HSTA 2IEKA 5AQWA 5DM6L 3MXMA 4WQ5A 1RT6A 1J0RA 5HS7A 1CXUA 1BI1A 1S8NA 1YITI 3I64A 5GTIC 1NK7A 2RGVA 3QYFA 3GUDA 3U2RA 2GOMA 4HVJA 3RYPA 3ZQCA 3TSQA 3OOPA 3WQUA 4CEBA 3ASNH 1QPIA 4YIIA 4IQ4A 1XGMA 4I7HA 4H5NA 4UUVA 1GOBA 1LAVA 2VJJA 2DMQA 4OPHA 4DV3K 1YW7A 1MSFC 1XG1A 3IDHA 2ZWHA 2D45A 4W5OA 2ZE2A 4BQOA 1Y6IA 4LJZF 2C6YA 1QSSA 4HF2A 3BG3A 5BPLA 4MO5A 4ZC3A 4F2RA 2RREA 4CE9A 3A0IX 2F4MB 3OYAA 1NGJA 1SEUA 1RDAA 1HBXG 3FIWA 1Y39A 3WT0A 5L3EA 2V1DA 1K79A 4WXHA 1K78A 1V4RA 1O3SA 2BUPA 5I42A 4CCHA 2OBPA 4JKCA 3L2RA 4RW9A 1I1SA 1MJ9A
chains in the Genus database with same CATH topology
4YNQA 3DLBA 3V9UA 3MEDA 2F8SA 4CIGA 2D5RA 3S9HA 1HYZA 2A1RA 1HNIA 2DFFA 2VG6A 3AO5A 4M3RA 1U04A 3K59A 3PY8A 3OYLA 1RT5A 3DM2A 3I8DA 1S1XA 4CJQA 3NAEA 2FBTA 4CJLA 4DQRA 4DSKA 4HTUA 3C6TA 1BI4B 3L2UA 3LP0A 3KK2A 4H8KA 1KCFA 3RR8A 4FK4A 2P51A 4IG3A 4KFBA 5CYQA 3PX6A 4HCBA 5J2QA 4UQGA 1XHZA 2D0AA 4ZTJA 1B9FA 2E6LA 3DLEA 3VQCA 4GVMA 2Z1HA 4DLGA