4G9YA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
136
structure length
136
Chain Sequence
THPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords PcaV transcriptional regulator
total genus 52
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g9yA00
1XGMA 1ZH5A 2CO5A 4RS8A 3TO9A 1KGSA 2OZ6A 4KMUX 4R79A 2TDXA 1FY7A 2DI3A 2R7FA 2Q8KA 3GX4X 2K86A 4M6XA 5LGUA 3FWEA 4GO1A 1G4DA 4LFUA 5FLXZ 2MH2A 1ODDA 3O6BB 4CO8A 1R36A 4ZZLA 2HQRA 4OMYA 3KFWX 3KP4A 2DQLA 5BMZA 3VEPA 1TTYA 5HDNA 2XROA 1FOKA 4U0YA 2GA1A 3V4GA 2XGXA 3MAJA 2ZBKA 2F2EA 3MEXA 4HV6A 3HUGA 2DTRA 4Y15A 4RB2C 5E1WA 4G8XA 4YG2F 1ZG3A 1LVAA 3V8JA 2VBZA 1O3TA 1K7AA 1I1GA 3LAPA 3FMQA 2GXGA 1O3RA 3BJAA 1U5TB 2HR3A 1G3YA 5H20A 4ZH4F 4UNOA 1CF7A 2MBFA 2IT0A 3F8NA 4IXAA 2QLZA 4QWQA 3U2RA 1HKQA 2M1BA 5H6RA 2CSOA 4KA4A 1YTYA 3WTYC 3EETA 4XBFA 4MTEA 5FD6A 2XVCA 1HKSA 3QAHA 5LLQA 2P4WA 1WWXA 2EFNA 2HDCA 1R1VA 1HSJA 1AWCA 1CF7B 2O3FA 2NNNA 3QPHA 3QP5A 3CLOA 1QZZA 3WTZA 2DPUA 5HS9A 2RQPA 2GXBA 3HOTA 4RB1A 1WQ2A 3RKXA 1T98A 2OA4A 3GZ5A 2RN7A 4HQEA 1J5YA 2M5WA 4M72A 4D0PA 1W4MA 2VN2A 3DPLC 4O3MA 1ZREA 1SD4A 2LNBA 3L9FA 3TGNA 3WTVC 4LGWA 4UVCA 3LWFA 1E2XA 2DK5A 3D0SA 3QRFF 5BOXA 3BOQA 3KZYA 3PQKA 3RYRA 5HDGA 2ZMEA 2DBBA 3HOSA 3D5LA 1MDMB 1Z6TA 2KIUA 2FMYA 3J80K 2V1XA 1GHCA 2PBIA 4H0EA 3CUQB 1U5TC 5TRDA 1C0WA 3VFZA 1UFMA 5L3DA 3R0JA 2D2WA 5DYMA 2EA4A 3LA7A 3U1DA 2EV5A 2M45A 4LB5A 2QYOA 2DPDA 4F7ZA 4G7ZF 1P4AA 2LF8A 3QU3A 4EJUA 4OIRF 4A12A 4IRGA 5F64A 2FRHA 4IF4A 1D8KA 2IJLA 2JSCA 3P9KA 1FT9A 5D6FA 2XAFA 4IPAA 4BYYA 1ONVA 3JAMZ 2XKOA 4RGUA 3RTRA 2A5YB 2HTSA 1V3FA 4NHJA 2KIMA 3NQOA 3J80Z 1UB9A 3T5XA 3GWZA 3ABTA 4L9TA 3F3XA 4HOBA 2D45A 5IT3A 2HYGD 1O7FA 2JT1A 3HRMA 4N0BA 3OOPA 1ZRFA 3JAMK 1O57A 1PDNC 4WX9A 4YFNF 2F5FA 2EJRA 1IN8A 2R3SA 1BC8C 1UHMA 3ZN1A 5EEGA 4G94A 6PAXA 3MCZA 4OOIA 3WU1B 4UVAA 3R6SA 3TOAA 3KP6A 4UHTA 3ISPA 4HW0A 3FM3A 4LK1F 1J59A 3FZVA 5L3CA 2YX4A 3E3VA 1K6OA 2JTVA 5BQTA 4IJAA 2ADUA 1JHHA 3ZN0A 3EDPA 4WXDA 4MEYF 1IF1A 1XGSA 2ELHA 2MLGA 1DUXC 2EV0A 5FGMA 1S3JA 4GGGA 4G7HF 3IRQA 4P5OA 5J8CA 4FX4A 4XRFA 5LBQA 4EVIA 5AONA 2RNJA 4RB0A 2CGPA 4KDPA 2VOOA 1ZRCA 3K69A 4HDUA 5CVJA 4KYWA 4HDVA 1TQMA 2Y48A 5L3EA 1HSTA 3E5UA 3TOBA 3HIFA 4MTDA 3WGHA 2L4AA 2VONA 1BBYA 4BQAA 4HV5A 1P2FA 2E1CA 3COAC 2MC3A 2HGCA 4LK0F 4S05A 4M9XA 3IKVA 1QGPA 2YPRA 2O8XA 1Z05A 1KU7A 4R1HA 3WTSC 2IW5A 4KIBA 4BHPA 2YU3A 1OPCA 1FP2A 2VC0A 2DU9A 2PN6A 3JTGA 1GVJA 4U0WA 2EFPA 4ZYDA 2GA2A 2QBYB 1Z1DA 5ILSA 3MWMA 2FMLA 3LFKA 1BIAA 1PP8F 3E6MA 4ESJA 4MGRA 1U3EM 4MQ9F 2IPQX 5CJ9A 3RKWA 5D5WB 4ENJA 3SZPA 2O6GE 1ON2A 3U9GA 1A04A 2L02A 4HLXA 1STZA 3RI4A 2V79A 2HOEA 1MZBA 4Q5SF 1ZG1A 4CICA 2FBIA 4HZFA 1EV7A 3FMSA 2Z99A 1MJBA 4DQ2A 5LRSA 1I6XA 5HS8A 2E7WA 3HSFA 3FXRA 5AIQA 2WTEA 5E20A 2Z33A 2OZUA 2XAGA 4B09A 4AIJA 4P9UA 3KP3A 5CVVA 2ESHA 2K27A 2CG4A 2Y75A 1D3YA 3ZMUA 1G3WA 2EV6A 3PFIA 2A07F 3GFIA 5CVUA 1ULYA 5JFRA 2JRTA 1D8JA 1KU9A 1KQ8A 1SMYF 3HRUA 2V9VA 2KKOA 1CGPA 1B59A 1S6LA 1Z9CA 3GFJA 2IP2A 1XD7A 2YR2A 2DAOA 3J81Z 1IN4A 3RYPA 5D6EA 2W84A 4ZYHA 4M73A 1U5TA 1ZGAA 1TNSA 4YFXF 5KK1A 4I09A 3BJ6A 3RDIA 2FQ3A 3BPXA 3HRSA 2PG4A 2ZKZA 3WGIA 3WTUC 2BYVE 1JXSA 4FX0A 4BAYA 4WXCA 3IKTA 5DCMA 4XSXF 1HW2A 5LEJA 3MQ0A 2KIFA 3F8CA 4HF2A 1YQAA 1OMIA 5JR3A 4WCGA 1JHFA 2G7HA 4IRIA 4I98B 3VODA 3NEUA 3GF2A 3WTTC 3VB2A 2Z3YA 4EM2A 2PMUA 2UXXA 1HXDA 5A2QK 4HX4A 3W6KB 4GYGA 3JTHA 1HKTA 3RPUA 1OKRA 1YFHA 4O5VA 2RDPA 3ZMSA 3H92A 4L9JA 2FF4A 1IRGA 4ESBA 4RAZA 4DNCA 1IW7F 2KJCA 4Q47A 3RKYA 2QENA 4ASNA 1Z6RA 1SFEA 2A6HF 5LRRA 3TO7A 1U8RA 2D1VA 1BI1A 2GQQA 3LSTA 3SFZA 1IZ1A 1G3TA 2YX7A 4ZYEA 1YG2A 5LEKA 4HLYA 2EA2A 3J7AO 1EH8A 1U6GA 2IVMA 4OINF 3ML6A 4LLGF 4IVNA 3TDZC 3ULQB 1MDMA 4G6DA 3WODF 4CGZA 5ED4A 1J7KA 5HLIA 3V8LA 1QO0D 5E17F 3R60A 2FBHA 4LMYA 3I54A 1Z7UA 2FA5A 1ZLJA 2ZNZA 4U88A 1R1TA 1W7PB 3R0AA 4AD9A 1ZAOA 2HYFA 4A0ZA 3FM5A 1XCVA 3DXJF 4M9ZA 1LDDA 2VBWA 4ESFA 3FX3A 4LLNA 3K9TA 4EJVA 1XDSA 1HW1A 1Q1HA 3F72A 3J81K 3WTWC 1OR7A 1RIOH 1LJ9A 1S29A 2P5KA 4L9VA 1X3UA 4WXHA 1V4RA 3EYIA 1YIOA 5E1XA 4MEXF 1BI3A 2QVOA 1YS6A 5ERIA 3KEOA 1J9IA 2ISYA 1XN7A 3CJNA 4P9FA 1WI9A 4G7OF 1FPQA 1F1ZA 5D4SA 2M87A 3K1MA 3WE2A 4HQMA 4YIFA 1LQ1A 4IRHA 2LKPA 2HKXA 4ON0A 3REOA 3QU6A 1P6RA 1J0RA 1G3SA 1RUNA 1S8NA 4HYEA 5ICEA 1PP7U 4UV8A 3K1NA 2UWMA 3G73A 2QQAA 4Q48A 3IL2A 2GZWA 1KYWA 4ZZDA 4UV9A 3M1EA 4MQVA 3GW2A 1DPRA 1YYVA 4GXOA 3R61A 5ICFA 2QQBA 4M6YA 5K5OA 1FYKA 3F23A 2CFXA 3Q9VA 4OIPF 1P92A 2WV0A 1R7JA 3VOEA 3GYHX 2W57A 4XSZF 2EFQA 3SQNA 4HF0A 1B6AA 2NYXA 4U0VA 1TQPA 2IA2A 5DD8A 3FHZA 3FXUA 1FNNA 1K78B 2PJPA 2HQNA 3BROA 1BI0A 4Y13A 5LHIA 3G3ZA 1I1SA 4BHCA 2VT2A 1LDKB 3ELKA 4L5JA 1HQCA 3FMRA 5ICGA 1H9GA 2BBYA 3ZMZA 2FNAA 3O2PE 3O3KA 3N97A 3BPVA 1SFUA 1XGOA 3QP6A 3W6JB 3I58A 1G6NA 5LHHA 2YSRA 2OU2A 1DPUA 3C7JA 2F5EA 4WF2A 3DKWA 5FB2A 2V6CA 5EEHA 4QLCU 2ZXJA 4NB5A 5D4RA 1D5VA 3LA3A 3WGGA 2A68F 5JI6A 4XLPF 2W85A 4A2UA 1J2XA 2HWVA 1R58A 3MZYA 4I01A 3T0YA 1PUEE 3V7CA 1QZYA 3KETA 4AVPA 2FE3A 2E1NA 4KFCA 4LB6B 4L0YB 3NRVA 3I59B 1E17A 2PMHA 2VBXA 3GUDA 4A6EA 1UHWA 4FT8A 2VC1A 3M8EA 5DD4A 3I64A 1EH6A 3RJPA 4ENMA 1MGTA 1XMKA 3SHFA 1F5TA 3ECHA 3I4PA 3M9AA 3F8BA 3PQJA 1BM9A 2A69F 1RI7A 1L3LA 1T39A 1FBQA 1IAWA 3I53A 2QZ8A 4RGXA 3MZHA 2PLYA 2F5DA 2DLLA 5CLSA 2FBKA 1GXPA 4JBAA 1FX7A 4BHBA 4CXFA 3KCCA 3C18A 1ZLKA 4RGSA 1FBUA 5E8GA 5J8FA 5TJJA 2FU4A 3L2CA 4TV7A 2CW0F 1RZ4A 1J75A 3GXOA 4EMSA 2DQRA 4LG0B 4L0ZB 1P4XA 3CUQA 4M74A 5JHUA 1IXSB 4RB3C 2JPBA 2P8TA 2MH9A 1BJAA 2COMA 3K0LA 4BH9A 2ZCWA 3ABUA 3HYIA 1ON1A 3WTXC 1SD5A 3BJOA 1ZYRF 3GVAA 3TO6A 2CYYA 2QUFA 1ZGJA 3I5UA 5HLGA 1ZHFA 2A61A 3ERED 1WRJA 5DUKA 2VE8A 1T6SA 2HS5A 1FLIA 4U7BA 1UCRA 4A0YA 5J6XA 3F6VA 2ETHA 4O6JA 1O3SA 2H6CA 1YS7A 3I0TA 3H3UA 4GCVA 5BS6A 2CQKA 5K1YA 1SD6A 4UUVA 2H6BA 5DCFA 2O61A 2EWNA 2BE5F 2GIVA 3GFLA 3L00A 5ILUA 3Q5FA 1IUYA 5FFZA 2XV4S 3R4KA 4M9SA 3ZQ7A 1MKMA 1QPMA 4PZJA 1HW5A 4Y17A 3EUHA 2XUBA 4CYDA 2E7XA 4EM0B 2X4HA 2D1HA 5LGTA 4A5MA 3EYYA 1KQ9A 4KUMA 4A6DA 5DCMB 2V1UA 2M8EA 3JSOA 4RAYA 2DW4A 2O03A 5F1RA 1S7AA 5IT9Z 4ENNA 3TQNA 3KP7A 2BEOA 2GWRA 2RC4A 2NNYA 2HEOA 4AWXB 4ETSA 3K1PA 2B0LA 1WKMA 3IRRA 3L7WA 2ISZA 1B1BA 2XKPA 5FD5A 2GAUA 3F8MA 3QPTA 5HVQC 3KLOA 5AIPA 3P9IA 4P96A 5F6FA 5H6QA 2IA0A 1WSUA 3SZTA 1R23A 4IHTA 2UZKA 3DV8A 1DDNA 1XSVA 4K2EA 1RNLA 2H27A 1TBXA 4KN4X 1IXCA 4OU0A 4Q4ZF 1F4KA 5D8LB 2VE9A 2XRNA 2ZNYA 1R1UA 5L3BA 3CDHA 2VODA 5A2QZ 2OBPA 1SMTA 4AIKA 4OIOF 2L4MA 5HS7A 2K4BA 5IT9K 3JW4A 2K02A 3DEUA 2HZTA 1SAXA 2OD5A 4OMZA 2PI0A 2EFWA 3TDUC 1VTNC 2FNPA 3N4MA 3LQQA 2G9WA 4EM1A 3BZ6A 1W7PD 1OYWA 1OYIA 5D8KB 3DPTA 3C3WA 3LQRA 3F22A 5HOOA 2ESNA 2P7VB 4B8XA 1I5ZA 1ZARA 2P6TA 3B02A 1EH7A 3KE2A 2LDUA 4PCQA 2DK8A 1KA8A 2AS5F 2KRFA 2OQGA 5BPDA 1IN6A 1S7OA 1IN7A 2PEXA 5D5VB 2F5CA 1FZPB 1MD0A 1R5HA 3CO6C 3KEQA 5FO5A 2KJBA 1XSDA 4EV0A 4PGGA 1YW9A 5JVTA 4CHUA 3GO5A 2VOPA 2QM3A 2G7UA 2L01A 5FFXA 2QWWA 4EJTA 1K78A 4EGZA 4L9NA 5CVRA 1ZN2A 3V7RA 2Y0MA 2QBYA 1BN5A 2XIGA 1LB2A 1TW3A 2EB7A 1MJ9A 3CUOA 3HSEA 1Z91A 5E18F 1W7PA 4LD5A 5DEQA 1BI2A 5CYVA 4MHGA 3KP2A 1XDUA 3I71A 1XB4A 1RUOA 2XAJA 1I27A 3ZMTA 3SXYA 3ROUA 1B9MA 1FYLA 4ZYGA 4RGRA 2BV6A 5LGNA 5K5QA 5HDKA 4I02A 4JK1X 1H0MA 2DT5A 2ZFWA 5HLHA 1BC7C 1KYZA 1W5TA 1FBSA 2HTJA 2V1DA 5BPIA 1XGNA 3RIRA 2XAQA 2STWA 1NHAA 1FSEA 3TKYA 2MD5A 3QOPA 1O3QA 4EQQA 2ZJ2A 3HTSB 2Q0OA 3IWFA 1BIBA 3F8FA 2L3DA 3HTUA 1T2KA 2O0YA 1DP7P 1LDJA 1HBXG 1L0OC 3WE3A 4P55A 4LG0A 4L18B 3V7SA 1T38A 2M30A 3E5QA 3I59A 3HSRA 3CUQC 3GEZA 4ENKA 3T8RA 4I7HA 1IRFA 2RV8A 1FP1D 1OYYA 4G9YA 2C6YA 1MJAA 2VXZA 1YW8A 4M71A 2ACJA 2XHKA 4YIIA 2NS0A 1GXQA 4WK8F 2EK5A 4JQFA 1LEBA 1BOAA 1USSA 3EQLF 2XAHA 5DUIA 5FLXK 5DDGA 4I0BA 3Q9SA 4UXNA 2MLKA 1P4WA 3IWZA 3C1DA 3WG9A 4CZZA 3DF8A 3ZP5A 3S2WA 3HHHA 1AOYA 3KLNA 5LHGA 4I2OA 3ZMDA 2AXLA 4KIGA 3AAFA 4GYIA 1KQ0A 4EGYA 3HRTA 2NAZA 1YO5C 3ZPLA 3ECOA 4BXUA 3V8KA 4LJZF 1R22A 2FSWA 4LLLA 2L54A 3L09A 1KU3A 2J5OA 1FWZA 4FHTA 4HAMA 1FC3A 3BDDA 4KIFA 2BGCA 2A6EF 1U2WA 1ZG5A 2J5PA 4KNYA 2H09A 1IXRC 2A3SA 3BP8A 5CVIA 1Y0UA 2Z5UA 2DO7A 2RGVA 4NQWA 1U78A 2IA1A 2P6SA 2ZO4A 4G6QA 3IC7A 2IRFG 5KVRA 1T0FA 4EJOA 3E6CC 2LSOA 4YFKF 2XASA 2P5LC 2JZYA 1R00A 1XCBA 1SFXA 4HX8A 5D5UB 4U7DA 4E70A 4A5NA 3GFMA 3E6DA 5ICCA 4HBLA 3P7NA 2R7DA 2EFOA 2DFIA 2MA3A 4A0XA 2LF7A 4KMFA 1YLFA 1QNTA 3RPQA 1SD7A 1LNWA 2HKOA 1KU2A 2QQ9A 2P5VA 4N9IA 3CO7C 1REPC 3WU0A 5ILVA 4L5IA 4HA8A 1R5GA 3DQVC 5DV5A 1H9TA 5D5XB 1JE8A 2CWEA 2FXAA 1ZRDA 4XLNF 3FXQA 4UVBA 3JSPA 2STTA 2OAZA 4OIQF 4KN7X 3IHUA 2K7LA 2WWYA 2Q2EA 3T8TA 3F21A 3LA2A 3K2ZA 5L3FA 2VBYA 4PGHA 3P9CA 2WC2A 3B73A 1YW7A 1LEAA 2FOKA 3CTAA 2Z9OA 1TNTA 5E8IA 1TLHB 3DP7A 1B9NA 4R8HA 2PFBA 2OQRA 3FF5A 3ZMVA 4PDKA 1O7LA 3F6OA 4I0AA 4KICA 3KP5A 4MNUA 1K79A 1F9NA 4KT5C 4S04A 2RVCA 5K5RA 4Z2YA 2K4JA 2JPCA 1W5SA 4IHSA 2PQ8A 1XSXA 3E6BA 2X0LA 1TQIA 3LAJA 4BNCA 3M7GA 4HX7A 4HF1A 3KZZA 2W24A 3MFKA 2RKHA 2UXNA 3HHGA 2FEZA 3E97A 4N9HA 3E5XA 4CDGA 3GLXA 2HFHA 2ZMEB 3H3ZA 1B4AA 2NRAC 2P7CB 1USTA 2W25A 1FSHA 5E1ZB 1QQIA 2H94A 1FYMA 3OV8A 4EJWA 3GZ6A 1XMAA 3BWGA 1JGSA 3M8FA 1TW2A 5L3GA 3T1BA 3BY6A 2VT3A 1QBJA 3DFGA 4WWCA 1IN5A 4AIHA
chains in the Genus database with same CATH superfamily
1XGMA 3AG4H 1ZH5A 2CO5A 4RS8A 3TO9A 2V7FA 2CV2A 1KGSA 2OZ6A 4KMUX 4R79A 2TDXA 2FQ4A 1MIJA 1FY7A 2LD5A 2DI3A 2R7FA 3OMYA 2HDDA 2Q8KA 2IS1A 1RC9A 3RPUD 3GX4X 2K86A 3LFUA 3SEQA 1W5CC 4M6XA 1UG0A 5LGUA 3FWEA 1ETKA 4GO1A 4DYRA 4ZDLA 2NOGA 3NWSA 1IO2A 1G4DA 5J1UA 4LFUA 5FLXZ 2MH2A 3RQ4A 4CCMA 3OYNA 3S1MJ 1ODDA 3O6BB 4CO8A 1R36A 1TL8A 4ZZLA 2E5NA 2HQRA 3VSKA 4OMYA 3KFWX 3KP4A 5FLVA 2DQLA 4IOCF 5BMZA 3VEPA 1TTYA 5HDNA 2XROA 1FOKA 4U0YA 2GA1A 3G1LA 3GZNB 3V4GA 2R7VA 2WV1A 2EH3A 3MKWB 2LY2A 2XGXA 3MAJA 2ZBKA 3OR1C 2F2EA 3MEXA 3DBRB 4HV6A 3P5JA 3HUGA 2DTRA 2X1CA 2P81A 4Y15A 4RB2C 3FXMA 4XL9A 4AYBN 5E1WA 4G8XA 4D9JA 2R7SA 4YG2F 1ZG3A 2BVLA 1LVAA 4XORA 2DN0A 4A3BJ 3V8JA 2VBZA 3OY9A 3FK7A 1O3TA 3GTJJ 1XS9A 1K7AA 1FOXA 1I1GA 2DOFA 3BR5A 3FMQA 3LAPA 2I10A 4IHYA 2GXGA 1O3RA 3BJAA 1RKTA 1U5TB 2HR3A 1G3YA 1D0XA 4CZCA 5H20A 1X4OA 4ZH4F 4XR6A 4BE1A 4UNOA 1CF7A 4XQFA 2MBFA 2IT0A 3F8NA 4IXAA 2QLZA 2UUZA 4QWQA 3U2RA 1HKQA 4PJLA 2M1BA 5TGTA 3PO3J 1S72I 5H6RA 1YJWI 2CSOA 4KA4A 3HXLA 2K9QA 1POGA 1YTYA 4ZJZA 1SEUA 4BJ5C 3WTYC 2JA5J 3EETA 2IGNA 1PYVA 2CFOA 1VNDA 4BBSJ 4XBFA 4MTEA 4HNVA 2R7QA 3WU2C 5FD6A 2R5ZB 2KLOA 2XVCA 2NVTJ 1HKSA 1SFOJ 2EBIA 2ZXHA 3CF2A 3QAHA 2ID6A 5LLQA 2P4WA 1WWXA 2VASA 2EFNA 4ZTJA 2HDCA 2OC6A 1R1VA 2EZHA 1YIJI 2Y69H 1PVEA 5FKNA 3GTMJ 1MBJA 1HSJA 1AWCA 4OAYA 1CF7B 2O3FA 5GP9A 1MMNA 2NNNA 3QPHA 3QP5A 4KITB 3CLOA 3KZIC 3SZGA 1YI2I 1QZZA 3WTZA 1WH7A 2DPUA 5HS9A 1LFPA 2RQPA 3G2BA 4HSTA 3A1YA 2OV7A 2DOEA 2GXBA 1ITYA 2V9KA 3HOTA 4UUTA 2MG4A 4RB1A 1WQ2A 3ONQA 3RKXA 1E3HA 3OWTA 4D7MA 1T98A 2OA4A 4FQGA 3GZ5A 3HM5A 4BDYA 2RN7A 4FISA 4HQEA 1ORKA 1J5YA 1SVLA 1U9NA 2M5WA 4HSRA 4M72A 4D0PA 2DA6A 1W4MA 1ETXA 4E6KG 2VN2A 1R49A 3GBGA 3DPLC 3VYTB 5EYRA 4O3MA 1IDZA 1ZREA 1SD4A 1D0ZA 2JN6A 1MBGA 2LNBA 3L9FA 3TGNA 3WTVC 4RM3A 3SEZA 2FX0A 4LGWA 4UVCA 1MMSA 3LWFA 3A0BC 1E2XA 2DK5A 2AQEA 3D0SA 3QRFF 5BOXA 1XG1A 3OS0A 1QPIA 2IS6A 1UHSA 2M0MA 3BOQA 3KZYA 3PQKA 4XRMA 2L9NA 1AA7A 2XF7A 3RYRA 4BQNA 5E3NA 9ANTA 5HDGA 2ZMEA 2DBBA 4ZC3A 1HLVA 3HOSA 5HNHA 3D5LA 3DLAA 4ANJA 1MDMB 1Z6TA 2KIUA 4BUPA 1ZKGA 2FMYA 2LY9A 2E2HJ 3J80K 2F4MB 2V1XA 2DA2A 2EIMH 2XAUA 1GHCA 2PBIA 4H0EA 3CUQB 1U5TC 3FXOA 5TRDA 1C0WA 4JYKA 5K7HA 3VFZA 1VQ9I 4XLFA 2LP0A 1UFMA 5F04A 2H1LA 5L3DA 3R0JA 3HDDA 3S1NJ 2D2WA 3QODA 4PJJA 5DYMA 2EA4A 1Z67A 3LA7A 3U1DA 1QZEA 4B44A 2EV5A 2M45A 1W36D 3FXLA 4LB5A 1WJBA 4XOTA 2F5VA 3LSPA 1CQTA 3QPSA 2QYOA 2DPDA 1RR7A 4F7ZA 2MGQA 5J47A 4G7ZF 4A3CJ 2DDBA 4JX5A 1P4AA 2OPTA 1XPXA 5FLMJ 2LF8A 1HC8A 3QU3A 5FRMA 4EJUA 2ZJRF 4OIRF 1RR8C 4A12A 4RA2A 4IRGA 5F64A 3K4BA 2FRHA 1ZR2A 4IF4A 1D8KA 1R4NB 2IJLA 2JSCA 3P9KA 1FT9A 3VPRA 5D6FA 2XAFA 4IPAA 3IAS2 1SC7A 1B8IA 4BYYA 1ONVA 3JAMZ 2XKOA 4RGUA 1I3AA 2ZXIA 3RTRA 2A5YB 2HTSA 1V3FA 4NHJA 1JUMA 2KIMA 3NQOA 3J80Z 4A3FJ 3BG3A 1UB9A 5F0HA 1LE8A 3T5XA 2XF6A 2MYSA 3GWZA 2R4GA 3ABTA 4L9TA 1ENHA 3F3XA 4HOBA 2DFEA 4BU2A 2D45A 5IT3A 2HYGD 1U9OA 1A36A 3HUGB 4D1QA 1O7FA 2JT1A 3HRMA 3LL7A 5LFAA 2FUG2 4N0BA 2E2IJ 3OOPA 1ZRFA 3JAMK 3OYIA 3J7YJ 1O57A 1PDNC 4B3AA 4WX9A 4YFNF 2F5FA 3KEYA 2FOWA 2EJRA 3FBNB 3DBHB 1IN8A 2R3SA 1BC8C 1UHMA 3ZN1A 5EEGA 4PK4A 4G94A 4X6AJ 6PAXA 1Z7LA 3GCMA 2R92J 2DOAA 3MCZA 3S93A 3MKYB 1OQYA 4OOIA 1B8IB 3WU1B 3GTGJ 2HXIA 2XGEA 4UVAA 3K4LA 3ZQQA 3R6SA 3TOAA 3KP6A 4UHTA 3ISPA 1VF9A 4HRIA 2LLKA 4HW0A 3FM3A 4LK1F 1DU6A 4XOPA 1J59A 2ZMEC 3FZVA 3LSMA 4GFBA 5L3CA 2YX4A 2HVSA 1A6QA 2XPWA 3PUFA 3L2WA 2WADA 2W7NA 3E3VA 1K6OA 2JTVA 5BQTA 4IJAA 2R5YA 2DMUA 2ADUA 1JHHA 4W1UA 2LKXA 3ZN0A 2DFHA 4DYCA 4KISA 1FIPA 3EDPA 4WXDA 3UNGC 2OCEA 1T8IA 3L2VA 2CUZA 4MEYF 1ZGWA 1IF1A 2DMTA 5IP6A 1XGSA 2ELHA 2MLGA 2JK3A 3C2GA 1DUXC 2EILH 2EV0A 3S1RJ 2CQXA 3CCLI 5FGMA 1S3JA 4GGGA 5EJCA 4DOZA 4G7HF 3IRQA 4J00A 2E71A 4UY8I 4P5OA 5J8CA 2ZXWH 4FX4A 1YITI 3MVPA 3SDBA 1FTTA 3JRAA 4XRFA 4PSWA 3DKXA 2ELKA 3IAM2 2R5ZA 2EZIA 5LBQA 2E1MC 4HPQA 3JRIA 4EVIA 2JA8J 5AONA 3AL0C 3K10A 2RNJA 4RB0A 4XLAA 2CGPA 5E3MA 4KDPA 2VOOA 1ZRCA 3K69A 4HDUA 5CVJA 4KYWA 3EPZA 3H9GA 4HDVA 3A0HC 4RAGA 1TQMA 2Y48A 3JCUC 5L3EA 4C3JJ 4FETA 1UMQA 5K7FA 3BG6A 1HSTA 3L1PA 3E5UA 3TOBA 3HIFA 1Y1VJ 2FJ1A 1VQLI 3H9QA 4MTDA 2V1NA 2ZB9A 4IKFA 3WGHA 1VQOI 4IHXA 1A5JA 4BEHA 2L4AA 3GTQJ 3TP0A 2VONA 2JUGA 1BBYA 1Y6IA 4Z6YA 3WHBA 4BQAA 3LSGA 4HV5A 5J3LA 5B5EC 4CCJA 1P2FA 2L2OA 2HYJA 3CMAI 3KIOA 4XIDA 2E1CA 3COAC 2VXDA 2A5WA 1RESA 2MC3A 2HGCA 4AUXA 1X4PA 4LK0F 4S05A 1O4XA 2TCTA 4M9XA 3IKVA 3K4NA 4NC6A 4N4OB 1QGPA 2YPRA 2WAQA 2H8WA 2O8XA 1BOBA 1Z05A 1KU7A 3MKLA 4R1HA 3WTSC 2IW5A 4KIBA 4PJNA 4BEHB 4BHPA 2JA7J 2YU3A 1S5LC 1OPCA 2VQLA 1FP2A 2VC0A 1ETVA 2DU9A 1P9QC 2PN6A 1NG7A 3JTGA 1GVJA 4U0WA 1X19A 2EFPA 3FK6A 4ZYDA 2GA2A 4N4NB 3I4NJ 3CD6I 2MABA 2F48A 2QBYB 1Z1DA 2QKLB 5ILSA 3J7ZI 3MWMA 2OCCH 2LG4A 1YX5A 2FMLA 3LFKA 5F0FA 5EZHA 1BIAA 2X85A 3B6AA 1PP8F 3E6MA 4ESJA 1BJZA 3G1OA 2IEKA 4MGRA 1U3EM 4MQ9F 3M4OJ 2IPQX 3VYUB 5CJ9A 3V42A 3RKWA 5D5WB 2RREA 4ENJA 1JJ6C 2JUCA 2W00A 3JRBA 3VYRB 4BKXA 3SZPA 3IV5A 2O6GE 1WHUA 1ON2A 4LIUA 3Q0VA 3U9GA 2K5CA 1A04A 2KISA 2L02A 3HPHA 4HLXA 1Z3XA 1STZA 2IGKA 2V79A 3AKZA 2HOEA 3RI4A 1BR2A 5KAFC 4BY1J 1MZBA 2ZJQF 4Q5SF 1ZG1A 4CICA 2FBIA 2XC7A 4HZFA 3K70C 1EV7A 1V5EA 3UKGA 3DU5A 2Z99A 2LTPA 3FMSA 3PNYA 1MJBA 1N77A 2JSPA 3JRGA 4DQ2A 3CQZJ 5LRSA 1IC8A 1I6XA 2KDZA 2K3FA 1MMDA 5HS8A 2E7WA 3HSFA 3FXRA 5AIQA 3SDGA 2GM4A 5CQEA 2WTEA 5E20A 4E7KA 3OYFA 4E7IA 2Z33A 3A03A 2HPIA 2OZUA 2XAGA 4B09A 4AIJA 2K3PA 3EUHC 4P9UA 3KP3A 3LMMA 5CVVA 2ESHA 1UJ8A 4M3BA 2I8DA 2K27A 2CG4A 2Y75A 1D3YA 3KYDB 3ZMUA 1LFBA 1G3WA 2EV6A 3PFIA 3DU6A 1IJWC 2A07F 2VJIA 3GFIA 1JI8A 5CVUA 3ZQLA 3BG5A 1R5ID 1SVMA 3IP4B 4DJAA 1OCCH 2AQFA 3BT9A 2M9HA 1ULYA 2BY0A 5JFRA 1TC3C 2JRTA 1D8JA 1KU9A 1KQ8A 4IQJA 5KNLA 1I3QJ 1SMYF 3CP2A 3HRUA 1SVOA 2V9VA 2XPUA 1T56A 2KKOA 1CGPA 1YRNB 2X1DA 1B59A 4W97A 1S6LA 4AU7A 3IH2A 1Z9CA 1MBHA 2HZDA 3GFJA 3S16J 3ERMA 3JRHA 2IP2A 1XD7A 2YR2A 3DEWA 5F08A 2JA6J 1I39A 2DAOA 2KRCA 3J81Z 2JWTA 3ZRGA 1IN4A 2MD0A 3RYPA 3H5NA 2VB6A 2W84A 5D6EA 4ZYHA 4M73A 5M5YJ 3IH4A 1U5TA 1ZGAA 3OOUA 1TNSA 4YFXF 5KK1A 4I09A 3BJ6A 2LVSA 3RDIA 2FQ3A 3LSIA 4CYCB 2OTJI 4XICA 3BPXA 3O8HA 3HRSA 2PG4A 2ZKZA 1WI3A 5CPRB 3WGIA 3WTUC 2BYVE 1RETA 4FX0A 1JXSA 3JREA 3DTKA 2B7EA 4BAYA 2MFZA 2VKHA 4WXCA 1Z0XA 4BGDA 3IKTA 5DCMA 4XSXF 1HW2A 5LEJA 4EATA 5EEAA 4RMNA 1DP3A 3DLLF 3K2AA 1YE9A 3FIWA 3BZCA 3MQ0A 2KIFA 3F8CA 4HF2A 4QPOA 3LNQA 1YQAA 1OMIA 5JR3A 4WCGA 1WJEA 1JTYA 1JKQC 3ABMH 1JHFA 3FHNA 1WZ2A 2G7HA 4IRIA 4I98B 3VODA 2ECBA 1JT0A 2HQ5A 4AYBA 5CKTA 4LOCA 5JVGF 4RLQA 3NEUA 4BL0B 3GF2A 4Y4RA 2K9SA 3VB2A 3WTTC 2Z3YA 4EM2A 3I9V2 4NDLA 2PMUA 2R7UA 2UXXA 3OYKA 1HXDA 2CQNA 5A2QK 2ICWG 1J09A 4HX4A 4BE2A 3D5RC 4GYGA 3W6KB 3JTHA 1HKTA 3RPUA 1OKRA 1YFHA 4O5VA 2RDPA 3ZMSA 2RAEA 2QF7A 3H92A 4L9JA 3BG7A 2FF4A 5C44J 4Y3OA 1IRGA 2NOJB 2MC4A 2M8GX 1UZCA 3M8JA 3H1CA 4RAZA 1IW7F 2KJCA 4Q47A 4DNCA 3RKYA 2BW3B 2QENA 3NAUA 4ASNA 1PJRA 1Z6RA 1SFEA 2A6HF 3S14J 5LRRA 1WJCA 1MBKA 3TO7A 3H0DA 2D1VA 1U8RA 1BI1A 2Y2ZA 2GQQA 2BY3A 2KZVA 2VLAA 3LSTA 3SFZA 1IZ1A 1G3TA 2YX7A 4ZYEA 1YG2A 3X2QH 5LEKA 2EA2A 4HLYA 4L5EA 3J7AO 3SJMA 3BR6A 1EH8A 1U6GA 2IVMA 4OINF 3CJRB 3ML6A 4LLGF 4IVNA 1MNEA 3TDZC 5GAGJ 1QRYA 3ULQB 3LSRA 2IXSA 3ZXSA 4G6DA 1MDMA 4A3JJ 1I6HJ 1YJ9I 1X1CA 4BXXJ 3WODF 4CGZA 5ED4A 4B47A 1J7KA 2E19A 5M3MJ 1MH3A 1W0TA 5HLIA 1VQ4I 3G71I 3GTPJ 3V8LA 1MW7A 5E79C 1QO0D 5E17F 2XPVA 1OCPA 3CESA 3R60A 4RDUA 4XRSA 3PO2J 3FXJA 2FBHA 2E1OA 4LMYA 3I54A 1Z7UA 3W3CA 2HDWA 2DMPA 2FA5A 4MO7A 1ZLJA 2GBYA 2ZNZA 4U88A 3Q0UA 1R1TA 1W7PB 3R0AA 3TMOA 4AD9A 1ETWA 1ZAOA 2HYFA 3WG7H 3HG9A 4A0ZA 2AXTC 3FM5A 1ACIA 3KPHA 1XCVA 1WPKA 3DXJF 2KPMA 3RZDJ 4M9ZA 2CJJA 1TP4A 1LDDA 3MKZA 2VBWA 1VQ8I 4ESFA 5EG0A 3FX3A 2O9LA 4LLNA 3K9TA 3OSGA 3OS1A 3S17J 2ME0A 1RKWA 2Y0SA 4OWRB 4OAZA 4EJVA 4PUSA 1QU3A 1XDSA 4IQ4A 4ZTFA 3K6GA 1G8XA 1HW1A 1Q1HA 3F72A 1RRJA 5C3EJ 3J81K 3WTWC 5EGOA 1E0EA 2CW7A 1JKOC 3H0GJ 1OR7A 1RIOH 1LJ9A 4AC0A 2CV0A 2E2JJ 2M0CA 1S29A 2Q2EB 2P5KA 3H5RA 4L9VA 3ZQHA 1X3UA 4WXHA 4I99C 1V4RA 3U21A 1YIOA 3EYIA 3CLQA 5E1XA 4MEXF 4XLEA 1B72A 1BI3A 3KYLA 3ZOBA 2DYSH 2QVOA 1YS6A 4HEA2 5ERIA 3KEOA 2QSFX 2ISYA 1J9IA 2HPMA 1XN7A 3W6VA 3CJNA 3A4CA 4P9FA 1WI9A 2JMWA 5M5XJ 4JP0A 4G7OF 2CH0A 3H36A 4E7LA 4BS9A 2VKEA 3HKZA 4A3KJ 1FPQA 3QYEA 3FISA 5IP7J 1F1ZA 4Y33A 2LR8A 5D4SA 2M87A 3K1MA 3WE2A 4HQMA 2QSHX 4YIFA 5IOYA 1LQ1A 4IRHA 2LKPA 2HKXA 4J19A 4ON0A 4HNUA 4A3DJ 3REOA 3PSFA 3QU6A 1ETYA 1P6RA 1J0RA 3H9JA 3JRFA 1G3SA 1LUJB 1RUNA 1N25A 1S8NA 4HYEA 3I56I 1R9TJ 3QYBA 2DA5A 5ICEA 4CYCA 3I55I 1PP7U 2VQGA 4UV8A 4A3EJ 3K1NA 1AHDP 2UWMA 1FEXA 3G73A 2QQAA 4Q48A 3IL2A 2GZWA 1KYWA 4ZZDA 4UV9A 3M1EA 3HPGA 4MQVA 3GW2A 1X2NA 1DPRA 1YYVA 1ETQA 4GXOA 2KHMA 3R61A 5M5WJ 3VYSB 5ICFA 5GADJ 5KHDA 2QQBA 3GTOJ 4M6YA 5K5OA 2IS4A 2R7WA 3BR3A 1FYKA 3F23A 2W1OA 2CFXA 3Q9VA 4A3MJ 4MIMA 4LIVA 1W0UA 4OIPF 2BY2A 1P92A 3K4MA 2WV0A 1R7JA 3VOEA 2TRTA 2R7ZJ 3GYHX 3A01A 1IRXA 3H3VK 2W57A 4XSZF 2EFQA 4BJTA 3SQNA 4HF0A 1K6YA 2O5RA 1B6AA 4MFEA 2NYXA 3KX2A 2M4GA 4G12A 4U0VA 4IOAF 1TQPA 1YRNA 4G6TB 4D5FA 5BNGA 2QSGX 2IA2A 2AHQA 5DD8A 2BXYA 5F27A 2KFDA 5EZGA 2YS9A 3CF5F 3FHZA 3HGGA 2EZKA 1FNNA 3CJTB 3FXUA 2NVUB 3G4SI 1K78B 2PJPA 2HQNA 3CCSI 3BROA 3HB9A 1BI0A 2CQ7A 4M3GA 4Y13A 4PSXA 3RSNA 3TW6A 5LHIA 3G3ZA 1I1SA 1U8BA 1Z3YA 4BHCA 1VQ7I 1XC5A 5FROA 2VT2A 1LDKB 5HLTA 5C4XJ 2DT7B 2HU9A 1VQ5I 3ELKA 3S3MA 3HJEA 1HQCA 1Y0NA 3FMRA 4L5JA 5ICGA 3QYFA 4ESBA 1H9GA 1TWAJ 2R5YB 3QQAA 2BBYA 4DW6A 3ZMZA 2WAFA 1MNMC 2FNAA 3O2PE 3O3KA 3N97A 1K83J 3A01B 2XSJC 1T95A 2O8KA 3DEEA 3BPVA 3ABKH 1SFUA 2VIXA 4YEJA 1XGOA 5J4VA 3S1QJ 3QP6A 3W6JB 3I58A 1G6NA 5LHHA 2EQRA 3FKJA 2E1MB 2YSRA 1H89C 2OU2A 4DIQA 1AKHA 2ZJPF 3M07A 1DPUA 3JRCA 1RPWA 2ZSHB 1NTCA 2BY1A 2IGOA 3C7JA 3LSJA 2BXZA 1T33A 2L9SA 2DYRH 2F5EA 4WF2A 1OLTA 2V4JC 3DKWA 3FKIJ 5FB2A 4UUSB 3BCAA 2V6CA 5EEHA 4P1WA 4QLCU 3L2RA 2ZXJA 4BQOA 3OYGA 1R4MB 4NB5A 5D4RA 1D5VA 3LA3A 3WGGA 4BXFA 2A68F 5JI6A 4XLPF 4UB6C 1UAAA 3DBLB 1Y1WJ 4IO9F 4CCLA 4C2TA 3AG1H 5IYDJ 2W85A 3G1MA 4A2UA 1J2XA 2HWVA 3DPUA 1R58A 3MZYA 4I01A 3T0YA 1PUEE 1JUPA 3HBLA 2V26A 4XRSG 3V7CA 1QZYA 3KETA 4AVPA 2GOXB 2FE3A 1G2HA 2E1NA 4XNFA 4KFCA 3DKYA 4LB6B 4L0YB 1F43A 3NRVA 3OYLA 1G59A 1ZK8A 2E34A 3I59B 1E17A 2PMHA 2VBXA 2JA2A 3GUDA 3BG9A 4A6EA 3CMYA 3H5AA 1APLC 1UHWA 4FT8A 2VC1A 3FXKA 3M8EA 5DD4A 3I64A 4HNTA 1EH6A 3MMYB 3RJPA 4ENMA 1MGTA 3UR3C 4CUGA 1XMKA 3SHFA 1F5TA 1JUSA 3ECHA 3I4PA 3M9AA 1VQNI 2XGDA 3F8BA 3PQJA 3OYCA 1BM9A 2A69F 3HKZN 3DTIA 2DFFA 1M1EB 1RI7A 1L3LA 2CUFA 2W48A 1HF0A 1QVTA 2LC2A 4PJMA 1T39A 1FBQA 1V5FA 4D7NA 5FJ8J 1IAWA 1X3ZB 2A6TA 2QZ8A 3I53A 4RGXA 1K61A 3MZHA 1ETOA 4GRIA 2MSYA 1GDTA 1MH4A 2L5QA 3BC8A 2PLYA 2F5DA 2A05A 5KCMA 2DLLA 3PNTA 4KJZA 5CLSA 3CCVI 5B1AH 2FBKA 4B3XA 2Z2SB 2Y30A 1GXPA 2KL4A 3EUKL 1QVUA 2K9LA 4JBAA 2M3AA 1FX7A 3ASNH 5TISC 4BHBA 4CXFA 3KCCA 3C18A 3NARA 1ZLKA 4RGSA 1GV5A 1FBUA 1A31A 4IHWA 5E8GA 5J8FA 5TJJA 1MMGA 2FU4A 2R7OA 3L2CA 4TV7A 2CW0F 5J4YA 1RZ4A 3CMEI 1J75A 5GTHC 1N78A 2DMQA 1BW6A 3GXOA 2VQCA 4EMSA 2DQRA 3CC4I 2XDVA 4LG0B 4L0ZB 1FOWA 1DU0A 5B3SH 2E36A 2X1EA 3B6CA 4V19K 4A3GJ 2BW3A 3CUQA 1P4XA 2EPFA 1WFXA 2G0EA 3K7AJ 3CMMA 2PMZA 3OYDA 4FCYA 1IGNA 1A35A 4E7HA 3S15J 1N75A 3ZR8X 3W2AA 4M74A 3SFIA 5JHUA 1IXSB 4RB3C 5K7ZA 2JPBA 1IV8A 1D1AA 5DM7F 2P8TA 2X9DA 2MH9A 1BJAA 2COMA 5IYBJ 3K0LA 4BH9A 1WJ5A 4IX7A 2ZCWA 1X3WB 3ABUA 3HYIA 1ON1A 1JKRC 4FASD 1SD5A 3WTXC 3BJOA 5FKKA 1ZYRF 3GVAA 3TO6A 2CYYA 2QUFA 1ZGJA 3I5UA 2K85A 1MMAA 5HLGA 1T0FC 1ZHFA 2A61A 3ERED 4BQQA 1WRJA 5DUKA 1GVDA 4BY7J 2VE8A 1T6SA 2HS5A 2QCOA 4B43A 3S2HJ 1EF4A 1FLIA 5CQGA 4GDFA 4U7BA 3MD2A 1UCRA 3HC7A 4A0YA 5J6XA 2NXNB 2CRGA 2K9MA 2LBFA 3F6VA 2ETHA 4O6JA 1O3SA 2E35A 2H6CA 3QWLA 1YS7A 4X0GA 3I0TA 1Y56A 4B48A 3H3UA 4GCVA 2K9NA 4ZDOA 1HCRA 5BS6A 2CQKA 5K1YA 1SD6A 4UUVA 3Q0WA 1WGXA 5EDNA 3MZ8A 4M3FA 2H6BA 4ZYAA 2N8GA 5DCFA 2O61A 2EWNA 3PIPF 3JR9A 2BE5F 3AG2H 2GIVA 2WAEA 3GFLA 2GIZA 3L00A 2DMNA 4ITVA 1IRZA 4FE4A 5B1BH 5ILUA 4U87A 3CCRI 3Q5FA 1IUYA 4CCKA 3TL4X 5FFZA 2L9VA 2XV4S 4M3DA 3R4KA 1X1AA 4M9SA 3PFYA 3ZQ7A 2CQQA 4XLHA 1PUFA 3CCYA 4CSWA 1MKMA 1QPMA 4PZJA 5EGOB 2XB0X 2M2EA 2NS7A 1HW5A 4Y17A 3EUHA 2XUBA 4CYDA 2CW8A 2E7XA 4EM0B 2X4HA 2D1HA 5LGTA 4JX6A 3QOEA 2HXOA 3OIOA 4A5MA 2HI3A 3EYYA 4F3QA 3E1SA 4DBRA 4UUSA 1KQ9A 4KUMA 4A6DA 5DCMB 2V1UA 1VQ6I 4Y52J 3A2KA 2M8EA 1XMXA 4PJ0C 3JSOA 2DJIA 3F0CA 1B72B 2COBA 4RAYA 1LPQA 2DW4A 3S32A 4H4KC 3I4MJ 2O03A 2Z1DA 3DWLE 5F1RA 5GPCA 5FRNA 1S7AA 3ZQGA 1UG2A 5IT9Z 4ENNA 5GTIC 3ZQCA 1BR1A 2NVYJ 2PMZN 2QA4I 2KRHA 3KP7A 3TQNA 2KZGA 4NNJA 2BEOA 2GWRA 2RC4A 2NNYA 2HEOA 4AWXB 4ETSA 3M1CA 2IAIA 3K1PA 2B0LA 2Z16A 1WKMA 3IRRA 3L7WA 1EKEA 4F55A 4X1EA 3TEDA 2ISZA 2H1KA 3CDIA 1HDDC 1B1BA 2XKPA 5E3LA 2L7MP 3OIPA 3ZGKA 5C4JJ 2CS3A 2BHYA 5FD5A 2GAUA 3CJQB 3K4JA 3D5SC 5EG0B 3QPLA 3F8MA 3QPTA 5HVQC 3KLOA 5AIPA 3P9IA 2X6WA 1X1DA 2F6CA 4BJ6C 4P96A 3S8PA 4C9YA 3BTJA 3HZJA 3LOCA 5F6FA 5H6QA 2IA0A 1WSUA 3SZTA 1R23A 4IHTA 2UZKA 4XN0A 2VJ4A 3DV8A 1DDNA 2JJ7A 1XSVA 4K2EA 1RNLA 2H27A 1GUUA 3CC2I 1TBXA 1TT0A 2ZFUA 1QHHD 3F9KA 1IXCA 4KN4X 2Y31A 4OU0A 4Q4ZF 1F4KA 5D8LB 2LBFB 2VE9A 3CP8A 2XRNA 2ZNYA 4DZPA 4DBQA 1E3OC 1R1UA 5L3BA 1TWCJ 3CDHA 5IY5H 2BOLA 1FMVA 5A2QZ 2OBPA 2VODA 4AIDA 1AU7A 2EIKH 4II2A 1OCTC 1SMTA 3PUBA 1P7IA 4AIKA 4OIOF 4RM2A 2L4MA 5HS7A 2K4BA 5IT9K 3EUAA 3OSFA 3JW4A 3MN2A 2K02A 1VFCA 4DZJA 3DEUA 5FKOA 5FKLA 5LD2C 3VSLA 2HZTA 1SAXA 2OD5A 4OMZA 1W1WE 1HOMA 2PI0A 2EFWA 3HOYJ 3TDUC 1VTNC 1DQUA 2R0QC 2FNPA 2P0WA 5F0CA 1BW5A 3N4MA 3LQQA 4YELA 2KMUA 1A6IA 2V6EA 2B63J 2G9WA 4EM1A 3PSIA 3BZ6A 4Y7NJ 1W7PD 1OYWA 1S7EA 5IYCJ 2DTZA 3O8GA 1S9HA 2EIJH 1OYIA 5D8KB 1XX5A 4C3IJ 3FBIB 3DPTA 3C3WA 3LQRA 4QTRA 1JJ8C 3F22A 2BZTA 5HOOA 4QSHA 5GAEJ 2ESNA 2WAQN 3CCQI 2P7VB 4B8XA 1I5ZA 1ZARA 2P6TA 3B02A 3Q3SA 3TW7A 1WVRA 5J1RA 1EH7A 3KE2A 1FMWA 1SAUA 2QGUA 2NVXJ 2LDUA 4PCQA 3CCMI 1EA3A 2DK8A 3BTCA 1KA8A 2AS5F 2KRFA 4YRVA 3BTLA 2ELJA 2OQGA 5BPDA 1VQMI 1V55H 1OR7C 3AFHA 2DXIA 4M3EA 4B1RA 1IN6A 1S7OA 2WBMA 1IN7A 2PEXA 5D5VB 2F5CA 1FZPB 3BCBA 1MD0A 1R5HA 2KQRA 1SANA 4QPQA 3L2UA 3CO6C 4E4HA 3KEQA 4XKVA 5FO5A 2KJBA 1XSDA 4EV0A 1ZTRA 3OIQA 4PGGA 2F4OB 1OFCX 1YW9A 5JVTA 1D1CA 2QKMB 2W82A 2VUMJ 2ECCA 4CHUA 2M7BA 2HNHA 3GO5A 4RAFA 5GAHJ 2VOPA 2X6OA 2QM3A 1QHGA 1MSEC 2G7UA 2L01A 4ABZA 2DJNA 2YUSA 1LKXA 4XLCA 1NG6A 3ASOH 4LITA 3AL0B 2R7XA 1PUFB 4LG3A 2XGCA 5FFXA 3W2WA 4C2UA 1ZR4A 2QWWA 4EJTA 1K78A 4EGZA 1H8AC 4L9NA 5CVRA 5DS9A 2R7RA 1ZN2A 1K4SA 1VI0A 3HOWJ 4C2MJ 3V7RA 4CCNA 3CCJI 1ZELA 2FD5A 1DGRM 2F4IA 1JT6A 2Y0MA 5J40A 1JKPC 2QBYA 1YHQI 4NQWB 1BN5A 2WB1N 2XIGA 2XB5A 2LMDA 2GXAA 3BQZA 1FIAA 2RQQA 4IL6C 1TW3A 1LB2A 2EB7A 1MJ9A 3CUOA 3HSEA 4J01A 4XK4A 1Z91A 3G6EI 5B66C 3IUOA 5E18F 1W7PA 4LD5A 1Z21A 5DEQA 1BI2A 5CYVA 4MHGA 4E7JA 4AVZA 3KP2A 2VJ5A 1XDUA 3PNVA 2OF7A 4A93J 3I71A 1XB4A 2MW8A 3GTKJ 2D5VA 1RUOA 2XAJA 1I27A 3ZMTA 3SXYA 3ROUA 1B9MA 3K70D 1FYLA 2LK2A 1WJAA 2VL8A 4ZYGA 4RGRA 2BV6A 5LGNA 5K5QA 1D5YA 5HDKA 4I02A 4JK1X 1BA5A 2R93J 1H0MA 2DT5A 2ZFWA 5HLHA 2VKVA 1BC7C 5H2FC 1E3PA 1Z77A 1KYZA 1W5TA 1FBSA 4QIWN 3BR2A 4BACA 2AO9A 3RZOJ 1MNDA 2B9SA 2HTJA 2V1DA 5BPIA 1XGNA 2ID3A 3BLYA 3RIRA 4MLOA 1TZLA 4F93B 3CDLA 1WJDA 1QA6A 2HQAA 2DA4A 1OJLA 2XAQA 2STWA 2DODA 2DA1A 1NHAA 5GPAA 1FSEA 3SYTA 3TKYA 2MD5A 3QOPA 1O3QA 4ZDPA 4EQQA 2ZJ2A 3HTSB 2Q0OA 1X2MA 3IWFA 3OYMA 1BIBA 4XKWA 4XONA 4I76A 3I3LA 3F8FA 4AM3A 2L3DA 3HTUA 3CZ6A 5EF6A 1T2KA 2H8RA 2W4SA 5JLWA 2O0YA 1DP7P 1LDJA 1HBXG 3BQYA 1L0OC 3WE3A 4P55A 1TWHJ 1WCMJ 4LG0A 4L18B 3V7SA 1T38A 2M30A 3E5QA 3ESWB 2WB1A 3I59A 3HSRA 3CUQC 3GEZA 1BR4A 3FDYA 4ENKA 2QQ8A 2V9PA 3T8RA 4I7HA 1IRFA 3CC7I 2RV8A 1XTAA 4F91B 1FP1D 1OYYA 4G9YA 3J7AY 1TWGJ 2KDOA 2C6YA 1Y8RB 1MJAA 1WJFA 3L2QA 2DA3A 4II3A 2XF5A 3E0JB 2VXZA 3NWTA 1OISA 1BL0A 1HA8A 1IDYA 4C30A 1YW8A 3M3YJ 4IZZA 4M71A 2O7OA 3DTEA 3DCFA 2ACJA 1Y8QB 4CCOA 2XHKA 3TBIA 1LFUP 4YIIA 2NS0A 1GXQA 2E60A 4WK8F 1LVKA 1GLNA 2EK5A 2LH9A 1KZHA 4JQFA 3HGYA 1GT0C 2CUJA 1LEBA 2JVGA 4RLFA 3ZCOA 1BOAA 1USSA 3EQLF 2XAHA 5DUIA 2NVQJ 5FLXK 2CUEA 3TP3A 5DDGA 2L9RA 5FKMA 2XSDC 4I0BA 1X1BA 2VKDA 4BE0A 3Q9SA 4UXNA 4YIRX 2MLKA 3LSHA 1P4WA 3IWZA 3C1DA 2HVQA 3WG9A 4CZZA 5HNFA 3DF8A 3ZP5A 3S2WA 3HHHA 5KAIC 1AOYA 3KLNA 5LHGA 4KT6A 2PJRA 4I2OA 3ZMDA 2AXLA 4KIGA 3AAFA 4GYIA 1ZQ3P 1KQ0A 5DTDA 4EGYA 2ZC2A 3HRTA 2NAZA 1YO5C 3ZPLA 1OCRH 3ECOA 2CU7A 4BXUA 3V8KA 5F1JA 3PL8A 1R22A 4LJZF 2FSWA 4XM3A 4LLLA 2XRLA 1MSFC 2L54A 2X6YA 3L09A 3GTLJ 4B4CA 1KU3A 2J5OA 1FWZA 4FHTA 4UB8C 3ZQIA 1VZ0A 2CV1A 4IHVA 2R7TA 4NC7A 1NK2P 2Y9ZA 1VQPI 5E3OA 4HAMA 1FC3A 3BDDA 3CCUI 1D0YA 4C3HJ 5IP9J 4MFDA 4NC8A 4KIFA 4A3LJ 4A3IJ 2BGCA 1OCZH 2A6EF 4F92B 2KT0A 3H35A 1U2WA 3GLLA 3OYEA 2KP6A 1ZG5A 2E5ZA 2J5PA 4KNYA 1YOVB 2H09A 1IXRC 2A3SA 2VI6A 3BP8A 5CVIA 1Y0UA 2Z5UA 4XN3A 2DO7A 2RGVA 4NQWA 1U78A 2IA1A 3AG3H 2LREA 2M34A 2Q1ZB 3S3NA 1Q1VA 2L7KA 1IUFA 2P6SA 3OYAA 2YU9J 1MBEA 2LOOA 2ZO4A 2KIQA 4G6QA 3IC7A 4FE7A 2IRFG 5KVRA 1T0FA 2LRDA 4EJOA 1FOYA 3E6CC 2VQHA 2L7FP 3PIOF 2LSOA 4YFKF 2XASA 1H88C 2P5LC 1Y39A 2JZYA 3HOZJ 1R00A 1X58A 1XCBA 1TT5B 4E7SA 1SFXA 4XKCA 3BTIA 4HX8A 1UELB 2HOTA 5D5UB 1HDPA 3D1NI 3GMEA 3OL4A 4XMYA 2WY8Q 4U7DA 3OYHA 1NH3A 1NK3P 3JRDA 2L0KA 3HEFA 4PFOA 4E70A 4A5NA 3GFMA 1K4TA 3E6DA 1F36A 3PJRA 5ICCA 2Y9YA 4HBLA 3P7NA 4RBOA 2R7DA 3OL3A 2EFOA 2HOAA 2L7ZA 3OR2C 3HOVJ 3KYCB 3W2VA 4NUBA 2DFIA 2MA3A 1V54H 4A0XA 2NS8A 2JQ7A 1FTZA 2LF7A 4KMFA 2VPLA 1YLFA 2VPRA 1MBFA 1LE8B 2HVRA 4BDZA 2HOSA 2LYCA 1SFKA 4EEFG 1QNTA 3RPQA 1SD7A 1P7JA 2ZSIB 1LNWA 2LFBA 4XKBA 2EINH 2HKOA 4NBQA 1KU2A 2QQ9A 3VWBA 2P5VA 1ERDA 1V5GA 3CCEI 3RCOA 4N9IA 2BVMA 1R6RA 3CO7C 2GLOA 3BZKA 3E7LA 3K4KA 3OS2A 3WU0A 1REPC 2PJRB 5ILVA 2JRMA 4L5IA 4HA8A 1R5GA 3BR0A 3DQVC 2OTLI 2IS2A 2QEXI 5JHFA 5M3FJ 2K40A 1U0JA 1FJLA 5DV5A 1H9TA 5D5XB 3K4CA 5JLXA 2UV1A 1JE8A 2OUMA 4V2FA 4M6VA 3S3OA 1AKHB 3HOUJ 2CWEA 3LSKA 2FXAA 1ZRDA 2OJED 4HG2A 1JTXA 1WH5A 4XLNF 3FXQA 3OYJA 1I50J 2DA7A 4IEJA 4UVBA 3JSPA 1IG7A 2STTA 2OAZA 4OIQF 4KN7X 3IHUA 2K7LA 2WWYA 1D1BA 2M4KA 1DGWY 2Q2EA 3T8TA 3F21A 2DDAA 1X1PA 3LA2A 1GV2A 3K2ZA 2PX9A 2VBYA 4PGHA 4D5CA 2IBDA 5L3FA 4CA0A 4S0HB 3P9CA 2WC2A 3B73A 1YW7A 2EZLA 5IOZA 1LEAA 2FOKA 3VDXA 3CTAA 2Z9OA 4A69C 1TNTA 4F52A 5HODA 2I5UA 4FTHA 1R71A 3IH3A 5E8IA 2GOMA 1TLHB 3DP7A 1B9NA 4R8HA 5J1YA 2PFBA 2OQRA 3C2BA 3FF5A 3ZMVA 4PDKA 2LY1A 2ME6A 3A02A 5DM6F 1O7LA 3F6OA 4I0AA 1OCOH 4KICA 4JX4A 3KP5A 2DT6A 4MNUA 4E7ZA 1T08B 2DCEA 3HOXJ 1K79A 1F9NA 1W36C 4KT5C 4S04A 2RVCA 5K5RA 3C2HA 3BR1A 4Z2YA 2WY7Q 2K4JA 2JPCA 3N05A 4DGWB 2Y0SN 2VJJA 1W5SA 4IHSA 2PQ8A 1XSXA 3E6BA 1YX3A 4JOMA 4V2GA 2X0LA 1TQIA 2X51A 3LAJA 2X48A 4BNCA 3M7GA 4HX7A 1VQKI 1EJ9A 4HF1A 3KZZA 2W24A 3MFKA 2RKHA 3S2DJ 3WHCA 2UXNA 3HHGA 2IGMA 2WA0A 2FEZA 3E97A 1YJNI 4N9HA 4BBRJ 3E5XA 1JGGA 4CDGA 5IPAA 3RQIA 3GLXA 2HFHA 2ZMEB 3H3ZA 1TWFJ 1KONA 1B4AA 2NRAC 2JVHA 2P7CB 1USTA 2W25A 3RKQA 3ZQFA 1FSHA 2LKSA 5E1ZB 1QQIA 2H94A 2RNGA 4I6ZA 4CH7A 2X6XA 1FYMA 3OV8A 4PFPA 4EJWA 3ABLH 3GZ6A 1XMAA 3BWGA 3PM1A 1JGSA 3M8FA 2M7AA 3OYBA 1TW2A 5L3GA 1IV6A 3T1BA 3BY6A 2VT3A 3HL2A 2BHZA 1QBJA 3DFGA 2CMPA 4WWCA 3U1KA 4DYQA 1IN5A 4AIHA
chains in the Genus database with same CATH topology
1XGMA 1ZH5A 2CO5A 4RS8A 3TO9A 1KGSA 2OZ6A 4KMUX 4R79A 2TDXA 1FY7A 2DI3A 2R7FA 2Q8KA 3GX4X 2K86A 4M6XA 5LGUA 3FWEA 4GO1A 1G4DA 4LFUA 5FLXZ 2MH2A 1ODDA 3O6BB 4CO8A 1R36A 4ZZLA 2HQRA 4OMYA 3KFWX 3KP4A 2DQLA 5BMZA 3VEPA 1TTYA 5HDNA 2XROA 1FOKA 4U0YA 2GA1A 3V4GA 2XGXA 3MAJA 2ZBKA 2F2EA 3MEXA 4HV6A 3HUGA 2DTRA 4Y15A 4RB2C 5E1WA 4G8XA 4YG2F 1ZG3A 1LVAA 3V8JA 2VBZA 1O3TA 1K7AA 1I1GA 3LAPA 3FMQA 2GXGA 1O3RA 3BJAA 1U5TB 2HR3A 1G3YA 5H20A 4ZH4F 4UNOA 1CF7A 2MBFA 2IT0A 3F8NA 4IXAA 2QLZA 4QWQA 3U2RA 1HKQA 2M1BA 5H6RA 2CSOA 4KA4A 1YTYA 3WTYC 3EETA 4XBFA 4MTEA 5FD6A 2XVCA 1HKSA 3QAHA 5LLQA 2P4WA 1WWXA 2EFNA 2HDCA 1R1VA 1HSJA 1AWCA 1CF7B 2O3FA 2NNNA 3QPHA 3QP5A 3CLOA 1QZZA 3WTZA 2DPUA 5HS9A 2RQPA 2GXBA 3HOTA 4RB1A 1WQ2A 3RKXA 1T98A 2OA4A 3GZ5A 2RN7A 4HQEA 1J5YA 2M5WA 4M72A 4D0PA 1W4MA 2VN2A 3DPLC 4O3MA 1ZREA 1SD4A 2LNBA 3L9FA 3TGNA 3WTVC 4LGWA 4UVCA 3LWFA 1E2XA 2DK5A 3D0SA 3QRFF 5BOXA 3BOQA 3KZYA 3PQKA 3RYRA 5HDGA 2ZMEA 2DBBA 3HOSA 3D5LA 1MDMB 1Z6TA 2KIUA 2FMYA 3J80K 2V1XA 1GHCA 2PBIA 4H0EA 3CUQB 1U5TC 5TRDA 1C0WA 3VFZA 1UFMA 5L3DA 3R0JA 2D2WA 5DYMA 2EA4A 3LA7A 3U1DA 2EV5A 2M45A 4LB5A 2QYOA 2DPDA 4F7ZA 4G7ZF 1P4AA 2LF8A 3QU3A 4EJUA 4OIRF 4A12A 4IRGA 5F64A 2FRHA 4IF4A 1D8KA 2IJLA 2JSCA 3P9KA 1FT9A 5D6FA 2XAFA 4IPAA 4BYYA 1ONVA 3JAMZ 2XKOA 4RGUA 3RTRA 2A5YB 2HTSA 1V3FA 4NHJA 2KIMA 3NQOA 3J80Z 1UB9A 3T5XA 3GWZA 3ABTA 4L9TA 3F3XA 4HOBA 2D45A 5IT3A 2HYGD 1O7FA 2JT1A 3HRMA 4N0BA 3OOPA 1ZRFA 3JAMK 1O57A 1PDNC 4WX9A 4YFNF 2F5FA 2EJRA 1IN8A 2R3SA 1BC8C 1UHMA 3ZN1A 5EEGA 4G94A 6PAXA 3MCZA 4OOIA 3WU1B 4UVAA 3R6SA 3TOAA 3KP6A 4UHTA 3ISPA 4HW0A 3FM3A 4LK1F 1J59A 3FZVA 5L3CA 2YX4A 3E3VA 1K6OA 2JTVA 5BQTA 4IJAA 2ADUA 1JHHA 3ZN0A 3EDPA 4WXDA 4MEYF 1IF1A 1XGSA 2ELHA 2MLGA 1DUXC 2EV0A 5FGMA 1S3JA 4GGGA 4G7HF 3IRQA 4P5OA 5J8CA 4FX4A 4XRFA 5LBQA 4EVIA 5AONA 2RNJA 4RB0A 2CGPA 4KDPA 2VOOA 1ZRCA 3K69A 4HDUA 5CVJA 4KYWA 4HDVA 1TQMA 2Y48A 5L3EA 1HSTA 3E5UA 3TOBA 3HIFA 4MTDA 3WGHA 2L4AA 2VONA 1BBYA 4BQAA 4HV5A 1P2FA 2E1CA 3COAC 2MC3A 2HGCA 4LK0F 4S05A 4M9XA 3IKVA 1QGPA 2YPRA 2O8XA 1Z05A 1KU7A 4R1HA 3WTSC 2IW5A 4KIBA 4BHPA 2YU3A 1OPCA 1FP2A 2VC0A 2DU9A 2PN6A 3JTGA 1GVJA 4U0WA 2EFPA 4ZYDA 2GA2A 2QBYB 1Z1DA 5ILSA 3MWMA 2FMLA 3LFKA 1BIAA 1PP8F 3E6MA 4ESJA 4MGRA 1U3EM 4MQ9F 2IPQX 5CJ9A 3RKWA 5D5WB 4ENJA 3SZPA 2O6GE 1ON2A 3U9GA 1A04A 2L02A 4HLXA 1STZA 3RI4A 2V79A 2HOEA 1MZBA 4Q5SF 1ZG1A 4CICA 2FBIA 4HZFA 1EV7A 3FMSA 2Z99A 1MJBA 4DQ2A 5LRSA 1I6XA 5HS8A 2E7WA 3HSFA 3FXRA 5AIQA 2WTEA 5E20A 2Z33A 2OZUA 2XAGA 4B09A 4AIJA 4P9UA 3KP3A 5CVVA 2ESHA 2K27A 2CG4A 2Y75A 1D3YA 3ZMUA 1G3WA 2EV6A 3PFIA 2A07F 3GFIA 5CVUA 1ULYA 5JFRA 2JRTA 1D8JA 1KU9A 1KQ8A 1SMYF 3HRUA 2V9VA 2KKOA 1CGPA 1B59A 1S6LA 1Z9CA 3GFJA 2IP2A 1XD7A 2YR2A 2DAOA 3J81Z 1IN4A 3RYPA 5D6EA 2W84A 4ZYHA 4M73A 1U5TA 1ZGAA 1TNSA 4YFXF 5KK1A 4I09A 3BJ6A 3RDIA 2FQ3A 3BPXA 3HRSA 2PG4A 2ZKZA 3WGIA 3WTUC 2BYVE 1JXSA 4FX0A 4BAYA 4WXCA 3IKTA 5DCMA 4XSXF 1HW2A 5LEJA 3MQ0A 2KIFA 3F8CA 4HF2A 1YQAA 1OMIA 5JR3A 4WCGA 1JHFA 2G7HA 4IRIA 4I98B 3VODA 3NEUA 3GF2A 3WTTC 3VB2A 2Z3YA 4EM2A 2PMUA 2UXXA 1HXDA 5A2QK 4HX4A 3W6KB 4GYGA 3JTHA 1HKTA 3RPUA 1OKRA 1YFHA 4O5VA 2RDPA 3ZMSA 3H92A 4L9JA 2FF4A 1IRGA 4ESBA 4RAZA 4DNCA 1IW7F 2KJCA 4Q47A 3RKYA 2QENA 4ASNA 1Z6RA 1SFEA 2A6HF 5LRRA 3TO7A 1U8RA 2D1VA 1BI1A 2GQQA 3LSTA 3SFZA 1IZ1A 1G3TA 2YX7A 4ZYEA 1YG2A 5LEKA 4HLYA 2EA2A 3J7AO 1EH8A 1U6GA 2IVMA 4OINF 3ML6A 4LLGF 4IVNA 3TDZC 3ULQB 1MDMA 4G6DA 3WODF 4CGZA 5ED4A 1J7KA 5HLIA 3V8LA 1QO0D 5E17F 3R60A 2FBHA 4LMYA 3I54A 1Z7UA 2FA5A 1ZLJA 2ZNZA 4U88A 1R1TA 1W7PB 3R0AA 4AD9A 1ZAOA 2HYFA 4A0ZA 3FM5A 1XCVA 3DXJF 4M9ZA 1LDDA 2VBWA 4ESFA 3FX3A 4LLNA 3K9TA 4EJVA 1XDSA 1HW1A 1Q1HA 3F72A 3J81K 3WTWC 1OR7A 1RIOH 1LJ9A 1S29A 2P5KA 4L9VA 1X3UA 4WXHA 1V4RA 3EYIA 1YIOA 5E1XA 4MEXF 1BI3A 2QVOA 1YS6A 5ERIA 3KEOA 1J9IA 2ISYA 1XN7A 3CJNA 4P9FA 1WI9A 4G7OF 1FPQA 1F1ZA 5D4SA 2M87A 3K1MA 3WE2A 4HQMA 4YIFA 1LQ1A 4IRHA 2LKPA 2HKXA 4ON0A 3REOA 3QU6A 1P6RA 1J0RA 1G3SA 1RUNA 1S8NA 4HYEA 5ICEA 1PP7U 4UV8A 3K1NA 2UWMA 3G73A 2QQAA 4Q48A 3IL2A 2GZWA 1KYWA 4ZZDA 4UV9A 3M1EA 4MQVA 3GW2A 1DPRA 1YYVA 4GXOA 3R61A 5ICFA 2QQBA 4M6YA 5K5OA 1FYKA 3F23A 2CFXA 3Q9VA 4OIPF 1P92A 2WV0A 1R7JA 3VOEA 3GYHX 2W57A 4XSZF 2EFQA 3SQNA 4HF0A 1B6AA 2NYXA 4U0VA 1TQPA 2IA2A 5DD8A 3FHZA 3FXUA 1FNNA 1K78B 2PJPA 2HQNA 3BROA 1BI0A 4Y13A 5LHIA 3G3ZA 1I1SA 4BHCA 2VT2A 1LDKB 3ELKA 4L5JA 1HQCA 3FMRA 5ICGA 1H9GA 2BBYA 3ZMZA 2FNAA 3O2PE 3O3KA 3N97A 3BPVA 1SFUA 1XGOA 3QP6A 3W6JB 3I58A 1G6NA 5LHHA 2YSRA 2OU2A 1DPUA 3C7JA 2F5EA 4WF2A 3DKWA 5FB2A 2V6CA 5EEHA 4QLCU 2ZXJA 4NB5A 5D4RA 1D5VA 3LA3A 3WGGA 2A68F 5JI6A 4XLPF 2W85A 4A2UA 1J2XA 2HWVA 1R58A 3MZYA 4I01A 3T0YA 1PUEE 3V7CA 1QZYA 3KETA 4AVPA 2FE3A 2E1NA 4KFCA 4LB6B 4L0YB 3NRVA 3I59B 1E17A 2PMHA 2VBXA 3GUDA 4A6EA 1UHWA 4FT8A 2VC1A 3M8EA 5DD4A 3I64A 1EH6A 3RJPA 4ENMA 1MGTA 1XMKA 3SHFA 1F5TA 3ECHA 3I4PA 3M9AA 3F8BA 3PQJA 1BM9A 2A69F 1RI7A 1L3LA 1T39A 1FBQA 1IAWA 3I53A 2QZ8A 4RGXA 3MZHA 2PLYA 2F5DA 2DLLA 5CLSA 2FBKA 1GXPA 4JBAA 1FX7A 4BHBA 4CXFA 3KCCA 3C18A 1ZLKA 4RGSA 1FBUA 5E8GA 5J8FA 5TJJA 2FU4A 3L2CA 4TV7A 2CW0F 1RZ4A 1J75A 3GXOA 4EMSA 2DQRA 4LG0B 4L0ZB 1P4XA 3CUQA 4M74A 5JHUA 1IXSB 4RB3C 2JPBA 2P8TA 2MH9A 1BJAA 2COMA 3K0LA 4BH9A 2ZCWA 3ABUA 3HYIA 1ON1A 3WTXC 1SD5A 3BJOA 1ZYRF 3GVAA 3TO6A 2CYYA 2QUFA 1ZGJA 3I5UA 5HLGA 1ZHFA 2A61A 3ERED 1WRJA 5DUKA 2VE8A 1T6SA 2HS5A 1FLIA 4U7BA 1UCRA 4A0YA 5J6XA 3F6VA 2ETHA 4O6JA 1O3SA 2H6CA 1YS7A 3I0TA 3H3UA 4GCVA 5BS6A 2CQKA 5K1YA 1SD6A 4UUVA 2H6BA 5DCFA 2O61A 2EWNA 2BE5F 2GIVA 3GFLA 3L00A 5ILUA 3Q5FA 1IUYA 5FFZA 2XV4S 3R4KA 4M9SA 3ZQ7A 1MKMA 1QPMA 4PZJA 1HW5A 4Y17A 3EUHA 2XUBA 4CYDA 2E7XA 4EM0B 2X4HA 2D1HA 5LGTA 4A5MA 3EYYA 1KQ9A 4KUMA 4A6DA 5DCMB 2V1UA 2M8EA 3JSOA 4RAYA 2DW4A 2O03A 5F1RA 1S7AA 5IT9Z 4ENNA 3TQNA 3KP7A 2BEOA 2GWRA 2RC4A 2NNYA 2HEOA 4AWXB 4ETSA 3K1PA 2B0LA 1WKMA 3IRRA 3L7WA 2ISZA 1B1BA 2XKPA 5FD5A 2GAUA 3F8MA 3QPTA 5HVQC 3KLOA 5AIPA 3P9IA 4P96A 5F6FA 5H6QA 2IA0A 1WSUA 3SZTA 1R23A 4IHTA 2UZKA 3DV8A 1DDNA 1XSVA 4K2EA 1RNLA 2H27A 1TBXA 4KN4X 1IXCA 4OU0A 4Q4ZF 1F4KA 5D8LB 2VE9A 2XRNA 2ZNYA 1R1UA 5L3BA 3CDHA 2VODA 5A2QZ 2OBPA 1SMTA 4AIKA 4OIOF 2L4MA 5HS7A 2K4BA 5IT9K 3JW4A 2K02A 3DEUA 2HZTA 1SAXA 2OD5A 4OMZA 2PI0A 2EFWA 3TDUC 1VTNC 2FNPA 3N4MA 3LQQA 2G9WA 4EM1A 3BZ6A 1W7PD 1OYWA 1OYIA 5D8KB 3DPTA 3C3WA 3LQRA 3F22A 5HOOA 2ESNA 2P7VB 4B8XA 1I5ZA 1ZARA 2P6TA 3B02A 1EH7A 3KE2A 2LDUA 4PCQA 2DK8A 1KA8A 2AS5F 2KRFA 2OQGA 5BPDA 1IN6A 1S7OA 1IN7A 2PEXA 5D5VB 2F5CA 1FZPB 1MD0A 1R5HA 3CO6C 3KEQA 5FO5A 2KJBA 1XSDA 4EV0A 4PGGA 1YW9A 5JVTA 4CHUA 3GO5A 2VOPA 2QM3A 2G7UA 2L01A 5FFXA 2QWWA 4EJTA 1K78A 4EGZA 4L9NA 5CVRA 1ZN2A 3V7RA 2Y0MA 2QBYA 1BN5A 2XIGA 1LB2A 1TW3A 2EB7A 1MJ9A 3CUOA 3HSEA 1Z91A 5E18F 1W7PA 4LD5A 5DEQA 1BI2A 5CYVA 4MHGA 3KP2A 1XDUA 3I71A 1XB4A 1RUOA 2XAJA 1I27A 3ZMTA 3SXYA 3ROUA 1B9MA 1FYLA 4ZYGA 4RGRA 2BV6A 5LGNA 5K5QA 5HDKA 4I02A 4JK1X 1H0MA 2DT5A 2ZFWA 5HLHA 1BC7C 1KYZA 1W5TA 1FBSA 2HTJA 2V1DA 5BPIA 1XGNA 3RIRA 2XAQA 2STWA 1NHAA 1FSEA 3TKYA 2MD5A 3QOPA 1O3QA 4EQQA 2ZJ2A 3HTSB 2Q0OA 3IWFA 1BIBA 3F8FA 2L3DA 3HTUA 1T2KA 2O0YA 1DP7P 1LDJA 1HBXG 1L0OC 3WE3A 4P55A 4LG0A 4L18B 3V7SA 1T38A 2M30A 3E5QA 3I59A 3HSRA 3CUQC 3GEZA 4ENKA 3T8RA 4I7HA 1IRFA 2RV8A 1FP1D 1OYYA 4G9YA 2C6YA 1MJAA 2VXZA 1YW8A 4M71A 2ACJA 2XHKA 4YIIA 2NS0A 1GXQA 4WK8F 2EK5A 4JQFA 1LEBA 1BOAA 1USSA 3EQLF 2XAHA 5DUIA 5FLXK 5DDGA 4I0BA 3Q9SA 4UXNA 2MLKA 1P4WA 3IWZA 3C1DA 3WG9A 4CZZA 3DF8A 3ZP5A 3S2WA 3HHHA 1AOYA 3KLNA 5LHGA 4I2OA 3ZMDA 2AXLA 4KIGA 3AAFA 4GYIA 1KQ0A 4EGYA 3HRTA 2NAZA 1YO5C 3ZPLA 3ECOA 4BXUA 3V8KA 4LJZF 1R22A 2FSWA 4LLLA 2L54A 3L09A 1KU3A 2J5OA 1FWZA 4FHTA 4HAMA 1FC3A 3BDDA 4KIFA 2BGCA 2A6EF 1U2WA 1ZG5A 2J5PA 4KNYA 2H09A 1IXRC 2A3SA 3BP8A 5CVIA 1Y0UA 2Z5UA 2DO7A 2RGVA 4NQWA 1U78A 2IA1A 2P6SA 2ZO4A 4G6QA 3IC7A 2IRFG 5KVRA 1T0FA 4EJOA 3E6CC 2LSOA 4YFKF 2XASA 2P5LC 2JZYA 1R00A 1XCBA 1SFXA 4HX8A 5D5UB 4U7DA 4E70A 4A5NA 3GFMA 3E6DA 5ICCA 4HBLA 3P7NA 2R7DA 2EFOA 2DFIA 2MA3A 4A0XA 2LF7A 4KMFA 1YLFA 1QNTA 3RPQA 1SD7A 1LNWA 2HKOA 1KU2A 2QQ9A 2P5VA 4N9IA 3CO7C 1REPC 3WU0A 5ILVA 4L5IA 4HA8A 1R5GA 3DQVC 5DV5A 1H9TA 5D5XB 1JE8A 2CWEA 2FXAA 1ZRDA 4XLNF 3FXQA 4UVBA 3JSPA 2STTA 2OAZA 4OIQF 4KN7X 3IHUA 2K7LA 2WWYA 2Q2EA 3T8TA 3F21A 3LA2A 3K2ZA 5L3FA 2VBYA 4PGHA 3P9CA 2WC2A 3B73A 1YW7A 1LEAA 2FOKA 3CTAA 2Z9OA 1TNTA 5E8IA 1TLHB 3DP7A 1B9NA 4R8HA 2PFBA 2OQRA 3FF5A 3ZMVA 4PDKA 1O7LA 3F6OA 4I0AA 4KICA 3KP5A 4MNUA 1K79A 1F9NA 4KT5C 4S04A 2RVCA 5K5RA 4Z2YA 2K4JA 2JPCA 1W5SA 4IHSA 2PQ8A 1XSXA 3E6BA 2X0LA 1TQIA 3LAJA 4BNCA 3M7GA 4HX7A 4HF1A 3KZZA 2W24A 3MFKA 2RKHA 2UXNA 3HHGA 2FEZA 3E97A 4N9HA 3E5XA 4CDGA 3GLXA 2HFHA 2ZMEB 3H3ZA 1B4AA 2NRAC 2P7CB 1USTA 2W25A 1FSHA 5E1ZB 1QQIA 2H94A 1FYMA 3OV8A 4EJWA 3GZ6A 1XMAA 3BWGA 1JGSA 3M8FA 1TW2A 5L3GA 3T1BA 3BY6A 2VT3A 1QBJA 3DFGA 4WWCA 1IN5A 4AIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGM A;  1ZH5 A;  2CO5 A;  4RS8 A;  3TO9 A;  1KGS A;  2OZ6 A;  4KMU X;  4R79 A;  2TDX A;  1FY7 A;  2DI3 A;  2R7F A;  2Q8K A;  3GX4 X;  2K86 A;  4M6X A;  5LGU A;  3FWE A;  4GO1 A;  1G4D A;  4LFU A;  5FLX Z;  2MH2 A;  1ODD A;  3O6B B;  4CO8 A;  1R36 A;  4ZZL A;  2HQR A;  4OMY A;  3KFW X;  3KP4 A;  2DQL A;  5BMZ A;  3VEP A;  1TTY A;  5HDN A;  2XRO A;  1FOK A;  4U0Y A;  2GA1 A;  3V4G A;  2XGX A;  3MAJ A;  2ZBK A;  2F2E A;  3MEX A;  4HV6 A;  3HUG A;  2DTR A;  4Y15 A;  4RB2 C;  5E1W A;  4G8X A;  4YG2 F;  1ZG3 A;  1LVA A;  3V8J A;  2VBZ A;  1O3T A;  1K7A A;  1I1G A;  3LAP A;  3FMQ A;  2GXG A;  1O3R A;  3BJA A;  1U5T B;  2HR3 A;  1G3Y A;  5H20 A;  4ZH4 F;  4UNO A;  1CF7 A;  2MBF A;  2IT0 A;  3F8N A;  4IXA A;  2QLZ A;  4QWQ A;  3U2R A;  1HKQ A;  2M1B A;  5H6R A;  2CSO A;  4KA4 A;  1YTY A;  3WTY C;  3EET A;  4XBF A;  4MTE A;  5FD6 A;  2XVC A;  1HKS A;  3QAH A;  5LLQ A;  2P4W A;  1WWX A;  2EFN A;  2HDC A;  1R1V A;  1HSJ A;  1AWC A;  1CF7 B;  2O3F A;  2NNN A;  3QPH A;  3QP5 A;  3CLO A;  1QZZ A;  3WTZ A;  2DPU A;  5HS9 A;  2RQP A;  2GXB A;  3HOT A;  4RB1 A;  1WQ2 A;  3RKX A;  1T98 A;  2OA4 A;  3GZ5 A;  2RN7 A;  4HQE A;  1J5Y A;  2M5W A;  4M72 A;  4D0P A;  1W4M A;  2VN2 A;  3DPL C;  4O3M A;  1ZRE A;  1SD4 A;  2LNB A;  3L9F A;  3TGN A;  3WTV C;  4LGW A;  4UVC A;  3LWF A;  1E2X A;  2DK5 A;  3D0S A;  3QRF F;  5BOX A;  3BOQ A;  3KZY A;  3PQK A;  3RYR A;  5HDG A;  2ZME A;  2DBB A;  3HOS A;  3D5L A;  1MDM B;  1Z6T A;  2KIU A;  2FMY A;  3J80 K;  2V1X A;  1GHC A;  2PBI A;  4H0E A;  3CUQ B;  1U5T C;  5TRD A;  1C0W A;  3VFZ A;  1UFM A;  5L3D A;  3R0J A;  2D2W A;  5DYM A;  2EA4 A;  3LA7 A;  3U1D A;  2EV5 A;  2M45 A;  4LB5 A;  2QYO A;  2DPD A;  4F7Z A;  4G7Z F;  1P4A A;  2LF8 A;  3QU3 A;  4EJU A;  4OIR F;  4A12 A;  4IRG A;  5F64 A;  2FRH A;  4IF4 A;  1D8K A;  2IJL A;  2JSC A;  3P9K A;  1FT9 A;  5D6F A;  2XAF A;  4IPA A;  4BYY A;  1ONV A;  3JAM Z;  2XKO A;  4RGU A;  3RTR A;  2A5Y B;  2HTS A;  1V3F A;  4NHJ A;  2KIM A;  3NQO A;  3J80 Z;  1UB9 A;  3T5X A;  3GWZ A;  3ABT A;  4L9T A;  3F3X A;  4HOB A;  2D45 A;  5IT3 A;  2HYG D;  1O7F A;  2JT1 A;  3HRM A;  4N0B A;  3OOP A;  1ZRF A;  3JAM K;  1O57 A;  1PDN C;  4WX9 A;  4YFN F;  2F5F A;  2EJR A;  1IN8 A;  2R3S A;  1BC8 C;  1UHM A;  3ZN1 A;  5EEG A;  4G94 A;  6PAX A;  3MCZ A;  4OOI A;  3WU1 B;  4UVA A;  3R6S A;  3TOA A;  3KP6 A;  4UHT A;  3ISP A;  4HW0 A;  3FM3 A;  4LK1 F;  1J59 A;  3FZV A;  5L3C A;  2YX4 A;  3E3V A;  1K6O A;  2JTV A;  5BQT A;  4IJA A;  2ADU A;  1JHH A;  3ZN0 A;  3EDP A;  4WXD A;  4MEY F;  1IF1 A;  1XGS A;  2ELH A;  2MLG A;  1DUX C;  2EV0 A;  5FGM A;  1S3J A;  4GGG A;  4G7H F;  3IRQ A;  4P5O A;  5J8C A;  4FX4 A;  4XRF A;  5LBQ A;  4EVI A;  5AON A;  2RNJ A;  4RB0 A;  2CGP A;  4KDP A;  2VOO A;  1ZRC A;  3K69 A;  4HDU A;  5CVJ A;  4KYW A;  4HDV A;  1TQM A;  2Y48 A;  5L3E A;  1HST A;  3E5U A;  3TOB A;  3HIF A;  4MTD A;  3WGH A;  2L4A A;  2VON A;  1BBY A;  4BQA A;  4HV5 A;  1P2F A;  2E1C A;  3COA C;  2MC3 A;  2HGC A;  4LK0 F;  4S05 A;  4M9X A;  3IKV A;  1QGP A;  2YPR A;  2O8X A;  1Z05 A;  1KU7 A;  4R1H A;  3WTS C;  2IW5 A;  4KIB A;  4BHP A;  2YU3 A;  1OPC A;  1FP2 A;  2VC0 A;  2DU9 A;  2PN6 A;  3JTG A;  1GVJ A;  4U0W A;  2EFP A;  4ZYD A;  2GA2 A;  2QBY B;  1Z1D A;  5ILS A;  3MWM A;  2FML A;  3LFK A;  1BIA A;  1PP8 F;  3E6M A;  4ESJ A;  4MGR A;  1U3E M;  4MQ9 F;  2IPQ X;  5CJ9 A;  3RKW A;  5D5W B;  4ENJ A;  3SZP A;  2O6G E;  1ON2 A;  3U9G A;  1A04 A;  2L02 A;  4HLX A;  1STZ A;  3RI4 A;  2V79 A;  2HOE A;  1MZB A;  4Q5S F;  1ZG1 A;  4CIC A;  2FBI A;  4HZF A;  1EV7 A;  3FMS A;  2Z99 A;  1MJB A;  4DQ2 A;  5LRS A;  1I6X A;  5HS8 A;  2E7W A;  3HSF A;  3FXR A;  5AIQ A;  2WTE A;  5E20 A;  2Z33 A;  2OZU A;  2XAG A;  4B09 A;  4AIJ A;  4P9U A;  3KP3 A;  5CVV A;  2ESH A;  2K27 A;  2CG4 A;  2Y75 A;  1D3Y A;  3ZMU A;  1G3W A;  2EV6 A;  3PFI A;  2A07 F;  3GFI A;  5CVU A;  1ULY A;  5JFR A;  2JRT A;  1D8J A;  1KU9 A;  1KQ8 A;  1SMY F;  3HRU A;  2V9V A;  2KKO A;  1CGP A;  1B59 A;  1S6L A;  1Z9C A;  3GFJ A;  2IP2 A;  1XD7 A;  2YR2 A;  2DAO A;  3J81 Z;  1IN4 A;  3RYP A;  5D6E A;  2W84 A;  4ZYH A;  4M73 A;  1U5T A;  1ZGA A;  1TNS A;  4YFX F;  5KK1 A;  4I09 A;  3BJ6 A;  3RDI A;  2FQ3 A;  3BPX A;  3HRS A;  2PG4 A;  2ZKZ A;  3WGI A;  3WTU C;  2BYV E;  1JXS A;  4FX0 A;  4BAY A;  4WXC A;  3IKT A;  5DCM A;  4XSX F;  1HW2 A;  5LEJ A;  3MQ0 A;  2KIF A;  3F8C A;  4HF2 A;  1YQA A;  1OMI A;  5JR3 A;  4WCG A;  1JHF A;  2G7H A;  4IRI A;  4I98 B;  3VOD A;  3NEU A;  3GF2 A;  3WTT C;  3VB2 A;  2Z3Y A;  4EM2 A;  2PMU A;  2UXX A;  1HXD A;  5A2Q K;  4HX4 A;  3W6K B;  4GYG A;  3JTH A;  1HKT A;  3RPU A;  1OKR A;  1YFH A;  4O5V A;  2RDP A;  3ZMS A;  3H92 A;  4L9J A;  2FF4 A;  1IRG A;  4ESB A;  4RAZ A;  4DNC A;  1IW7 F;  2KJC A;  4Q47 A;  3RKY A;  2QEN A;  4ASN A;  1Z6R A;  1SFE A;  2A6H F;  5LRR A;  3TO7 A;  1U8R A;  2D1V A;  1BI1 A;  2GQQ A;  3LST A;  3SFZ A;  1IZ1 A;  1G3T A;  2YX7 A;  4ZYE A;  1YG2 A;  5LEK A;  4HLY A;  2EA2 A;  3J7A O;  1EH8 A;  1U6G A;  2IVM A;  4OIN F;  3ML6 A;  4LLG F;  4IVN A;  3TDZ C;  3ULQ B;  1MDM A;  4G6D A;  3WOD F;  4CGZ A;  5ED4 A;  1J7K A;  5HLI A;  3V8L A;  1QO0 D;  5E17 F;  3R60 A;  2FBH A;  4LMY A;  3I54 A;  1Z7U A;  2FA5 A;  1ZLJ A;  2ZNZ A;  4U88 A;  1R1T A;  1W7P B;  3R0A A;  4AD9 A;  1ZAO A;  2HYF A;  4A0Z A;  3FM5 A;  1XCV A;  3DXJ F;  4M9Z A;  1LDD A;  2VBW A;  4ESF A;  3FX3 A;  4LLN A;  3K9T A;  4EJV A;  1XDS A;  1HW1 A;  1Q1H A;  3F72 A;  3J81 K;  3WTW C;  1OR7 A;  1RIO H;  1LJ9 A;  1S29 A;  2P5K A;  4L9V A;  1X3U A;  4WXH A;  1V4R A;  3EYI A;  1YIO A;  5E1X A;  4MEX F;  1BI3 A;  2QVO A;  1YS6 A;  5ERI A;  3KEO A;  1J9I A;  2ISY A;  1XN7 A;  3CJN A;  4P9F A;  1WI9 A;  4G7O F;  1FPQ A;  1F1Z A;  5D4S A;  2M87 A;  3K1M A;  3WE2 A;  4HQM A;  4YIF A;  1LQ1 A;  4IRH A;  2LKP A;  2HKX A;  4ON0 A;  3REO A;  3QU6 A;  1P6R A;  1J0R A;  1G3S A;  1RUN A;  1S8N A;  4HYE A;  5ICE A;  1PP7 U;  4UV8 A;  3K1N A;  2UWM A;  3G73 A;  2QQA A;  4Q48 A;  3IL2 A;  2GZW A;  1KYW A;  4ZZD A;  4UV9 A;  3M1E A;  4MQV A;  3GW2 A;  1DPR A;  1YYV A;  4GXO A;  3R61 A;  5ICF A;  2QQB A;  4M6Y A;  5K5O A;  1FYK A;  3F23 A;  2CFX A;  3Q9V A;  4OIP F;  1P92 A;  2WV0 A;  1R7J A;  3VOE A;  3GYH X;  2W57 A;  4XSZ F;  2EFQ A;  3SQN A;  4HF0 A;  1B6A A;  2NYX A;  4U0V A;  1TQP A;  2IA2 A;  5DD8 A;  3FHZ A;  3FXU A;  1FNN A;  1K78 B;  2PJP A;  2HQN A;  3BRO A;  1BI0 A;  4Y13 A;  5LHI A;  3G3Z A;  1I1S A;  4BHC A;  2VT2 A;  1LDK B;  3ELK A;  4L5J A;  1HQC A;  3FMR A;  5ICG A;  1H9G A;  2BBY A;  3ZMZ A;  2FNA A;  3O2P E;  3O3K A;  3N97 A;  3BPV A;  1SFU A;  1XGO A;  3QP6 A;  3W6J B;  3I58 A;  1G6N A;  5LHH A;  2YSR A;  2OU2 A;  1DPU A;  3C7J A;  2F5E A;  4WF2 A;  3DKW A;  5FB2 A;  2V6C A;  5EEH A;  4QLC U;  2ZXJ A;  4NB5 A;  5D4R A;  1D5V A;  3LA3 A;  3WGG A;  2A68 F;  5JI6 A;  4XLP F;  2W85 A;  4A2U A;  1J2X A;  2HWV A;  1R58 A;  3MZY A;  4I01 A;  3T0Y A;  1PUE E;  3V7C A;  1QZY A;  3KET A;  4AVP A;  2FE3 A;  2E1N A;  4KFC A;  4LB6 B;  4L0Y B;  3NRV A;  3I59 B;  1E17 A;  2PMH A;  2VBX A;  3GUD A;  4A6E A;  1UHW A;  4FT8 A;  2VC1 A;  3M8E A;  5DD4 A;  3I64 A;  1EH6 A;  3RJP A;  4ENM A;  1MGT A;  1XMK A;  3SHF A;  1F5T A;  3ECH A;  3I4P A;  3M9A A;  3F8B A;  3PQJ A;  1BM9 A;  2A69 F;  1RI7 A;  1L3L A;  1T39 A;  1FBQ A;  1IAW A;  3I53 A;  2QZ8 A;  4RGX A;  3MZH A;  2PLY A;  2F5D A;  2DLL A;  5CLS A;  2FBK A;  1GXP A;  4JBA A;  1FX7 A;  4BHB A;  4CXF A;  3KCC A;  3C18 A;  1ZLK A;  4RGS A;  1FBU A;  5E8G A;  5J8F A;  5TJJ A;  2FU4 A;  3L2C A;  4TV7 A;  2CW0 F;  1RZ4 A;  1J75 A;  3GXO A;  4EMS A;  2DQR A;  4LG0 B;  4L0Z B;  1P4X A;  3CUQ A;  4M74 A;  5JHU A;  1IXS B;  4RB3 C;  2JPB A;  2P8T A;  2MH9 A;  1BJA A;  2COM A;  3K0L A;  4BH9 A;  2ZCW A;  3ABU A;  3HYI A;  1ON1 A;  3WTX C;  1SD5 A;  3BJO A;  1ZYR F;  3GVA A;  3TO6 A;  2CYY A;  2QUF A;  1ZGJ A;  3I5U A;  5HLG A;  1ZHF A;  2A61 A;  3ERE D;  1WRJ A;  5DUK A;  2VE8 A;  1T6S A;  2HS5 A;  1FLI A;  4U7B A;  1UCR A;  4A0Y A;  5J6X A;  3F6V A;  2ETH A;  4O6J A;  1O3S A;  2H6C A;  1YS7 A;  3I0T A;  3H3U A;  4GCV A;  5BS6 A;  2CQK A;  5K1Y A;  1SD6 A;  4UUV A;  2H6B A;  5DCF A;  2O61 A;  2EWN A;  2BE5 F;  2GIV A;  3GFL A;  3L00 A;  5ILU A;  3Q5F A;  1IUY A;  5FFZ A;  2XV4 S;  3R4K A;  4M9S A;  3ZQ7 A;  1MKM A;  1QPM A;  4PZJ A;  1HW5 A;  4Y17 A;  3EUH A;  2XUB A;  4CYD A;  2E7X A;  4EM0 B;  2X4H A;  2D1H A;  5LGT A;  4A5M A;  3EYY A;  1KQ9 A;  4KUM A;  4A6D A;  5DCM B;  2V1U A;  2M8E A;  3JSO A;  4RAY A;  2DW4 A;  2O03 A;  5F1R A;  1S7A A;  5IT9 Z;  4ENN A;  3TQN A;  3KP7 A;  2BEO A;  2GWR A;  2RC4 A;  2NNY A;  2HEO A;  4AWX B;  4ETS A;  3K1P A;  2B0L A;  1WKM A;  3IRR A;  3L7W A;  2ISZ A;  1B1B A;  2XKP A;  5FD5 A;  2GAU A;  3F8M A;  3QPT A;  5HVQ C;  3KLO A;  5AIP A;  3P9I A;  4P96 A;  5F6F A;  5H6Q A;  2IA0 A;  1WSU A;  3SZT A;  1R23 A;  4IHT A;  2UZK A;  3DV8 A;  1DDN A;  1XSV A;  4K2E A;  1RNL A;  2H27 A;  1TBX A;  4KN4 X;  1IXC A;  4OU0 A;  4Q4Z F;  1F4K A;  5D8L B;  2VE9 A;  2XRN A;  2ZNY A;  1R1U A;  5L3B A;  3CDH A;  2VOD A;  5A2Q Z;  2OBP A;  1SMT A;  4AIK A;  4OIO F;  2L4M A;  5HS7 A;  2K4B A;  5IT9 K;  3JW4 A;  2K02 A;  3DEU A;  2HZT A;  1SAX A;  2OD5 A;  4OMZ A;  2PI0 A;  2EFW A;  3TDU C;  1VTN C;  2FNP A;  3N4M A;  3LQQ A;  2G9W A;  4EM1 A;  3BZ6 A;  1W7P D;  1OYW A;  1OYI A;  5D8K B;  3DPT A;  3C3W A;  3LQR A;  3F22 A;  5HOO A;  2ESN A;  2P7V B;  4B8X A;  1I5Z A;  1ZAR A;  2P6T A;  3B02 A;  1EH7 A;  3KE2 A;  2LDU A;  4PCQ A;  2DK8 A;  1KA8 A;  2AS5 F;  2KRF A;  2OQG A;  5BPD A;  1IN6 A;  1S7O A;  1IN7 A;  2PEX A;  5D5V B;  2F5C A;  1FZP B;  1MD0 A;  1R5H A;  3CO6 C;  3KEQ A;  5FO5 A;  2KJB A;  1XSD A;  4EV0 A;  4PGG A;  1YW9 A;  5JVT A;  4CHU A;  3GO5 A;  2VOP A;  2QM3 A;  2G7U A;  2L01 A;  5FFX A;  2QWW A;  4EJT A;  1K78 A;  4EGZ A;  4L9N A;  5CVR A;  1ZN2 A;  3V7R A;  2Y0M A;  2QBY A;  1BN5 A;  2XIG A;  1LB2 A;  1TW3 A;  2EB7 A;  1MJ9 A;  3CUO A;  3HSE A;  1Z91 A;  5E18 F;  1W7P A;  4LD5 A;  5DEQ A;  1BI2 A;  5CYV A;  4MHG A;  3KP2 A;  1XDU A;  3I71 A;  1XB4 A;  1RUO A;  2XAJ A;  1I27 A;  3ZMT A;  3SXY A;  3ROU A;  1B9M A;  1FYL A;  4ZYG A;  4RGR A;  2BV6 A;  5LGN A;  5K5Q A;  5HDK A;  4I02 A;  4JK1 X;  1H0M A;  2DT5 A;  2ZFW A;  5HLH A;  1BC7 C;  1KYZ A;  1W5T A;  1FBS A;  2HTJ A;  2V1D A;  5BPI A;  1XGN A;  3RIR A;  2XAQ A;  2STW A;  1NHA A;  1FSE A;  3TKY A;  2MD5 A;  3QOP A;  1O3Q A;  4EQQ A;  2ZJ2 A;  3HTS B;  2Q0O A;  3IWF A;  1BIB A;  3F8F A;  2L3D A;  3HTU A;  1T2K A;  2O0Y A;  1DP7 P;  1LDJ A;  1HBX G;  1L0O C;  3WE3 A;  4P55 A;  4LG0 A;  4L18 B;  3V7S A;  1T38 A;  2M30 A;  3E5Q A;  3I59 A;  3HSR A;  3CUQ C;  3GEZ A;  4ENK A;  3T8R A;  4I7H A;  1IRF A;  2RV8 A;  1FP1 D;  1OYY A;  4G9Y A;  2C6Y A;  1MJA A;  2VXZ A;  1YW8 A;  4M71 A;  2ACJ A;  2XHK A;  4YII A;  2NS0 A;  1GXQ A;  4WK8 F;  2EK5 A;  4JQF A;  1LEB A;  1BOA A;  1USS A;  3EQL F;  2XAH A;  5DUI A;  5FLX K;  5DDG A;  4I0B A;  3Q9S A;  4UXN A;  2MLK A;  1P4W A;  3IWZ A;  3C1D A;  3WG9 A;  4CZZ A;  3DF8 A;  3ZP5 A;  3S2W A;  3HHH A;  1AOY A;  3KLN A;  5LHG A;  4I2O A;  3ZMD A;  2AXL A;  4KIG A;  3AAF A;  4GYI A;  1KQ0 A;  4EGY A;  3HRT A;  2NAZ A;  1YO5 C;  3ZPL A;  3ECO A;  4BXU A;  3V8K A;  4LJZ F;  1R22 A;  2FSW A;  4LLL A;  2L54 A;  3L09 A;  1KU3 A;  2J5O A;  1FWZ A;  4FHT A;  4HAM A;  1FC3 A;  3BDD A;  4KIF A;  2BGC A;  2A6E F;  1U2W A;  1ZG5 A;  2J5P A;  4KNY A;  2H09 A;  1IXR C;  2A3S A;  3BP8 A;  5CVI A;  1Y0U A;  2Z5U A;  2DO7 A;  2RGV A;  4NQW A;  1U78 A;  2IA1 A;  2P6S A;  2ZO4 A;  4G6Q A;  3IC7 A;  2IRF G;  5KVR A;  1T0F A;  4EJO A;  3E6C C;  2LSO A;  4YFK F;  2XAS A;  2P5L C;  2JZY A;  1R00 A;  1XCB A;  1SFX A;  4HX8 A;  5D5U B;  4U7D A;  4E70 A;  4A5N A;  3GFM A;  3E6D A;  5ICC A;  4HBL A;  3P7N A;  2R7D A;  2EFO A;  2DFI A;  2MA3 A;  4A0X A;  2LF7 A;  4KMF A;  1YLF A;  1QNT A;  3RPQ A;  1SD7 A;  1LNW A;  2HKO A;  1KU2 A;  2QQ9 A;  2P5V A;  4N9I A;  3CO7 C;  1REP C;  3WU0 A;  5ILV A;  4L5I A;  4HA8 A;  1R5G A;  3DQV C;  5DV5 A;  1H9T A;  5D5X B;  1JE8 A;  2CWE A;  2FXA A;  1ZRD A;  4XLN F;  3FXQ A;  4UVB A;  3JSP A;  2STT A;  2OAZ A;  4OIQ F;  4KN7 X;  3IHU A;  2K7L A;  2WWY A;  2Q2E A;  3T8T A;  3F21 A;  3LA2 A;  3K2Z A;  5L3F A;  2VBY A;  4PGH A;  3P9C A;  2WC2 A;  3B73 A;  1YW7 A;  1LEA A;  2FOK A;  3CTA A;  2Z9O A;  1TNT A;  5E8I A;  1TLH B;  3DP7 A;  1B9N A;  4R8H A;  2PFB A;  2OQR A;  3FF5 A;  3ZMV A;  4PDK A;  1O7L A;  3F6O A;  4I0A A;  4KIC A;  3KP5 A;  4MNU A;  1K79 A;  1F9N A;  4KT5 C;  4S04 A;  2RVC A;  5K5R A;  4Z2Y A;  2K4J A;  2JPC A;  1W5S A;  4IHS A;  2PQ8 A;  1XSX A;  3E6B A;  2X0L A;  1TQI A;  3LAJ A;  4BNC A;  3M7G A;  4HX7 A;  4HF1 A;  3KZZ A;  2W24 A;  3MFK A;  2RKH A;  2UXN A;  3HHG A;  2FEZ A;  3E97 A;  4N9H A;  3E5X A;  4CDG A;  3GLX A;  2HFH A;  2ZME B;  3H3Z A;  1B4A A;  2NRA C;  2P7C B;  1UST A;  2W25 A;  1FSH A;  5E1Z B;  1QQI A;  2H94 A;  1FYM A;  3OV8 A;  4EJW A;  3GZ6 A;  1XMA A;  3BWG A;  1JGS A;  3M8F A;  1TW2 A;  5L3G A;  3T1B A;  3BY6 A;  2VT3 A;  1QBJ A;  3DFG A;  4WWC A;  1IN5 A;  4AIH A; 
#chains in the Genus database with same CATH topology
 1XGM A;  3AG4 H;  1ZH5 A;  2CO5 A;  4RS8 A;  3TO9 A;  2V7F A;  2CV2 A;  1KGS A;  2OZ6 A;  4KMU X;  4R79 A;  2TDX A;  2FQ4 A;  1MIJ A;  1FY7 A;  2LD5 A;  2DI3 A;  2R7F A;  3OMY A;  2HDD A;  2Q8K A;  2IS1 A;  1RC9 A;  3RPU D;  3GX4 X;  2K86 A;  3LFU A;  3SEQ A;  1W5C C;  4M6X A;  1UG0 A;  5LGU A;  3FWE A;  1ETK A;  4GO1 A;  4DYR A;  4ZDL A;  2NOG A;  3NWS A;  1IO2 A;  1G4D A;  5J1U A;  4LFU A;  5FLX Z;  2MH2 A;  3RQ4 A;  4CCM A;  3OYN A;  3S1M J;  1ODD A;  3O6B B;  4CO8 A;  1R36 A;  1TL8 A;  4ZZL A;  2E5N A;  2HQR A;  3VSK A;  4OMY A;  3KFW X;  3KP4 A;  5FLV A;  2DQL A;  4IOC F;  5BMZ A;  3VEP A;  1TTY A;  5HDN A;  2XRO A;  1FOK A;  4U0Y A;  2GA1 A;  3G1L A;  3GZN B;  3V4G A;  2R7V A;  2WV1 A;  2EH3 A;  3MKW B;  2LY2 A;  2XGX A;  3MAJ A;  2ZBK A;  3OR1 C;  2F2E A;  3MEX A;  3DBR B;  4HV6 A;  3P5J A;  3HUG A;  2DTR A;  2X1C A;  2P81 A;  4Y15 A;  4RB2 C;  3FXM A;  4XL9 A;  4AYB N;  5E1W A;  4G8X A;  4D9J A;  2R7S A;  4YG2 F;  1ZG3 A;  2BVL A;  1LVA A;  4XOR A;  2DN0 A;  4A3B J;  3V8J A;  2VBZ A;  3OY9 A;  3FK7 A;  1O3T A;  3GTJ J;  1XS9 A;  1K7A A;  1FOX A;  1I1G A;  2DOF A;  3BR5 A;  3FMQ A;  3LAP A;  2I10 A;  4IHY A;  2GXG A;  1O3R A;  3BJA A;  1RKT A;  1U5T B;  2HR3 A;  1G3Y A;  1D0X A;  4CZC A;  5H20 A;  1X4O A;  4ZH4 F;  4XR6 A;  4BE1 A;  4UNO A;  1CF7 A;  4XQF A;  2MBF A;  2IT0 A;  3F8N A;  4IXA A;  2QLZ A;  2UUZ A;  4QWQ A;  3U2R A;  1HKQ A;  4PJL A;  2M1B A;  5TGT A;  3PO3 J;  1S72 I;  5H6R A;  1YJW I;  2CSO A;  4KA4 A;  3HXL A;  2K9Q A;  1POG A;  1YTY A;  4ZJZ A;  1SEU A;  4BJ5 C;  3WTY C;  2JA5 J;  3EET A;  2IGN A;  1PYV A;  2CFO A;  1VND A;  4BBS J;  4XBF A;  4MTE A;  4HNV A;  2R7Q A;  3WU2 C;  5FD6 A;  2R5Z B;  2KLO A;  2XVC A;  2NVT J;  1HKS A;  1SFO J;  2EBI A;  2ZXH A;  3CF2 A;  3QAH A;  2ID6 A;  5LLQ A;  2P4W A;  1WWX A;  2VAS A;  2EFN A;  4ZTJ A;  2HDC A;  2OC6 A;  1R1V A;  2EZH A;  1YIJ I;  2Y69 H;  1PVE A;  5FKN A;  3GTM J;  1MBJ A;  1HSJ A;  1AWC A;  4OAY A;  1CF7 B;  2O3F A;  5GP9 A;  1MMN A;  2NNN A;  3QPH A;  3QP5 A;  4KIT B;  3CLO A;  3KZI C;  3SZG A;  1YI2 I;  1QZZ A;  3WTZ A;  1WH7 A;  2DPU A;  5HS9 A;  1LFP A;  2RQP A;  3G2B A;  4HST A;  3A1Y A;  2OV7 A;  2DOE A;  2GXB A;  1ITY A;  2V9K A;  3HOT A;  4UUT A;  2MG4 A;  4RB1 A;  1WQ2 A;  3ONQ A;  3RKX A;  1E3H A;  3OWT A;  4D7M A;  1T98 A;  2OA4 A;  4FQG A;  3GZ5 A;  3HM5 A;  4BDY A;  2RN7 A;  4FIS A;  4HQE A;  1ORK A;  1J5Y A;  1SVL A;  1U9N A;  2M5W A;  4HSR A;  4M72 A;  4D0P A;  2DA6 A;  1W4M A;  1ETX A;  4E6K G;  2VN2 A;  1R49 A;  3GBG A;  3DPL C;  3VYT B;  5EYR A;  4O3M A;  1IDZ A;  1ZRE A;  1SD4 A;  1D0Z A;  2JN6 A;  1MBG A;  2LNB A;  3L9F A;  3TGN A;  3WTV C;  4RM3 A;  3SEZ A;  2FX0 A;  4LGW A;  4UVC A;  1MMS A;  3LWF A;  3A0B C;  1E2X A;  2DK5 A;  2AQE A;  3D0S A;  3QRF F;  5BOX A;  1XG1 A;  3OS0 A;  1QPI A;  2IS6 A;  1UHS A;  2M0M A;  3BOQ A;  3KZY A;  3PQK A;  4XRM A;  2L9N A;  1AA7 A;  2XF7 A;  3RYR A;  4BQN A;  5E3N A;  9ANT A;  5HDG A;  2ZME A;  2DBB A;  4ZC3 A;  1HLV A;  3HOS A;  5HNH A;  3D5L A;  3DLA A;  4ANJ A;  1MDM B;  1Z6T A;  2KIU A;  4BUP A;  1ZKG A;  2FMY A;  2LY9 A;  2E2H J;  3J80 K;  2F4M B;  2V1X A;  2DA2 A;  2EIM H;  2XAU A;  1GHC A;  2PBI A;  4H0E A;  3CUQ B;  1U5T C;  3FXO A;  5TRD A;  1C0W A;  4JYK A;  5K7H A;  3VFZ A;  1VQ9 I;  4XLF A;  2LP0 A;  1UFM A;  5F04 A;  2H1L A;  5L3D A;  3R0J A;  3HDD A;  3S1N J;  2D2W A;  3QOD A;  4PJJ A;  5DYM A;  2EA4 A;  1Z67 A;  3LA7 A;  3U1D A;  1QZE A;  4B44 A;  2EV5 A;  2M45 A;  1W36 D;  3FXL A;  4LB5 A;  1WJB A;  4XOT A;  2F5V A;  3LSP A;  1CQT A;  3QPS A;  2QYO A;  2DPD A;  1RR7 A;  4F7Z A;  2MGQ A;  5J47 A;  4G7Z F;  4A3C J;  2DDB A;  4JX5 A;  1P4A A;  2OPT A;  1XPX A;  5FLM J;  2LF8 A;  1HC8 A;  3QU3 A;  5FRM A;  4EJU A;  2ZJR F;  4OIR F;  1RR8 C;  4A12 A;  4RA2 A;  4IRG A;  5F64 A;  3K4B A;  2FRH A;  1ZR2 A;  4IF4 A;  1D8K A;  1R4N B;  2IJL A;  2JSC A;  3P9K A;  1FT9 A;  3VPR A;  5D6F A;  2XAF A;  4IPA A;  3IAS 2;  1SC7 A;  1B8I A;  4BYY A;  1ONV A;  3JAM Z;  2XKO A;  4RGU A;  1I3A A;  2ZXI A;  3RTR A;  2A5Y B;  2HTS A;  1V3F A;  4NHJ A;  1JUM A;  2KIM A;  3NQO A;  3J80 Z;  4A3F J;  3BG3 A;  1UB9 A;  5F0H A;  1LE8 A;  3T5X A;  2XF6 A;  2MYS A;  3GWZ A;  2R4G A;  3ABT A;  4L9T A;  1ENH A;  3F3X A;  4HOB A;  2DFE A;  4BU2 A;  2D45 A;  5IT3 A;  2HYG D;  1U9O A;  1A36 A;  3HUG B;  4D1Q A;  1O7F A;  2JT1 A;  3HRM A;  3LL7 A;  5LFA A;  2FUG 2;  4N0B A;  2E2I J;  3OOP A;  1ZRF A;  3JAM K;  3OYI A;  3J7Y J;  1O57 A;  1PDN C;  4B3A A;  4WX9 A;  4YFN F;  2F5F A;  3KEY A;  2FOW A;  2EJR A;  3FBN B;  3DBH B;  1IN8 A;  2R3S A;  1BC8 C;  1UHM A;  3ZN1 A;  5EEG A;  4PK4 A;  4G94 A;  4X6A J;  6PAX A;  1Z7L A;  3GCM A;  2R92 J;  2DOA A;  3MCZ A;  3S93 A;  3MKY B;  1OQY A;  4OOI A;  1B8I B;  3WU1 B;  3GTG J;  2HXI A;  2XGE A;  4UVA A;  3K4L A;  3ZQQ A;  3R6S A;  3TOA A;  3KP6 A;  4UHT A;  3ISP A;  1VF9 A;  4HRI A;  2LLK A;  4HW0 A;  3FM3 A;  4LK1 F;  1DU6 A;  4XOP A;  1J59 A;  2ZME C;  3FZV A;  3LSM A;  4GFB A;  5L3C A;  2YX4 A;  2HVS A;  1A6Q A;  2XPW A;  3PUF A;  3L2W A;  2WAD A;  2W7N A;  3E3V A;  1K6O A;  2JTV A;  5BQT A;  4IJA A;  2R5Y A;  2DMU A;  2ADU A;  1JHH A;  4W1U A;  2LKX A;  3ZN0 A;  2DFH A;  4DYC A;  4KIS A;  1FIP A;  3EDP A;  4WXD A;  3UNG C;  2OCE A;  1T8I A;  3L2V A;  2CUZ A;  4MEY F;  1ZGW A;  1IF1 A;  2DMT A;  5IP6 A;  1XGS A;  2ELH A;  2MLG A;  2JK3 A;  3C2G A;  1DUX C;  2EIL H;  2EV0 A;  3S1R J;  2CQX A;  3CCL I;  5FGM A;  1S3J A;  4GGG A;  5EJC A;  4DOZ A;  4G7H F;  3IRQ A;  4J00 A;  2E71 A;  4UY8 I;  4P5O A;  5J8C A;  2ZXW H;  4FX4 A;  1YIT I;  3MVP A;  3SDB A;  1FTT A;  3JRA A;  4XRF A;  4PSW A;  3DKX A;  2ELK A;  3IAM 2;  2R5Z A;  2EZI A;  5LBQ A;  2E1M C;  4HPQ A;  3JRI A;  4EVI A;  2JA8 J;  5AON A;  3AL0 C;  3K10 A;  2RNJ A;  4RB0 A;  4XLA A;  2CGP A;  5E3M A;  4KDP A;  2VOO A;  1ZRC A;  3K69 A;  4HDU A;  5CVJ A;  4KYW A;  3EPZ A;  3H9G A;  4HDV A;  3A0H C;  4RAG A;  1TQM A;  2Y48 A;  3JCU C;  5L3E A;  4C3J J;  4FET A;  1UMQ A;  5K7F A;  3BG6 A;  1HST A;  3L1P A;  3E5U A;  3TOB A;  3HIF A;  1Y1V J;  2FJ1 A;  1VQL I;  3H9Q A;  4MTD A;  2V1N A;  2ZB9 A;  4IKF A;  3WGH A;  1VQO I;  4IHX A;  1A5J A;  4BEH A;  2L4A A;  3GTQ J;  3TP0 A;  2VON A;  2JUG A;  1BBY A;  1Y6I A;  4Z6Y A;  3WHB A;  4BQA A;  3LSG A;  4HV5 A;  5J3L A;  5B5E C;  4CCJ A;  1P2F A;  2L2O A;  2HYJ A;  3CMA I;  3KIO A;  4XID A;  2E1C A;  3COA C;  2VXD A;  2A5W A;  1RES A;  2MC3 A;  2HGC A;  4AUX A;  1X4P A;  4LK0 F;  4S05 A;  1O4X A;  2TCT A;  4M9X A;  3IKV A;  3K4N A;  4NC6 A;  4N4O B;  1QGP A;  2YPR A;  2WAQ A;  2H8W A;  2O8X A;  1BOB A;  1Z05 A;  1KU7 A;  3MKL A;  4R1H A;  3WTS C;  2IW5 A;  4KIB A;  4PJN A;  4BEH B;  4BHP A;  2JA7 J;  2YU3 A;  1S5L C;  1OPC A;  2VQL A;  1FP2 A;  2VC0 A;  1ETV A;  2DU9 A;  1P9Q C;  2PN6 A;  1NG7 A;  3JTG A;  1GVJ A;  4U0W A;  1X19 A;  2EFP A;  3FK6 A;  4ZYD A;  2GA2 A;  4N4N B;  3I4N J;  3CD6 I;  2MAB A;  2F48 A;  2QBY B;  1Z1D A;  2QKL B;  5ILS A;  3J7Z I;  3MWM A;  2OCC H;  2LG4 A;  1YX5 A;  2FML A;  3LFK A;  5F0F A;  5EZH A;  1BIA A;  2X85 A;  3B6A A;  1PP8 F;  3E6M A;  4ESJ A;  1BJZ A;  3G1O A;  2IEK A;  4MGR A;  1U3E M;  4MQ9 F;  3M4O J;  2IPQ X;  3VYU B;  5CJ9 A;  3V42 A;  3RKW A;  5D5W B;  2RRE A;  4ENJ A;  1JJ6 C;  2JUC A;  2W00 A;  3JRB A;  3VYR B;  4BKX A;  3SZP A;  3IV5 A;  2O6G E;  1WHU A;  1ON2 A;  4LIU A;  3Q0V A;  3U9G A;  2K5C A;  1A04 A;  2KIS A;  2L02 A;  3HPH A;  4HLX A;  1Z3X A;  1STZ A;  2IGK A;  2V79 A;  3AKZ A;  2HOE A;  3RI4 A;  1BR2 A;  5KAF C;  4BY1 J;  1MZB A;  2ZJQ F;  4Q5S F;  1ZG1 A;  4CIC A;  2FBI A;  2XC7 A;  4HZF A;  3K70 C;  1EV7 A;  1V5E A;  3UKG A;  3DU5 A;  2Z99 A;  2LTP A;  3FMS A;  3PNY A;  1MJB A;  1N77 A;  2JSP A;  3JRG A;  4DQ2 A;  3CQZ J;  5LRS A;  1IC8 A;  1I6X A;  2KDZ A;  2K3F A;  1MMD A;  5HS8 A;  2E7W A;  3HSF A;  3FXR A;  5AIQ A;  3SDG A;  2GM4 A;  5CQE A;  2WTE A;  5E20 A;  4E7K A;  3OYF A;  4E7I A;  2Z33 A;  3A03 A;  2HPI A;  2OZU A;  2XAG A;  4B09 A;  4AIJ A;  2K3P A;  3EUH C;  4P9U A;  3KP3 A;  3LMM A;  5CVV A;  2ESH A;  1UJ8 A;  4M3B A;  2I8D A;  2K27 A;  2CG4 A;  2Y75 A;  1D3Y A;  3KYD B;  3ZMU A;  1LFB A;  1G3W A;  2EV6 A;  3PFI A;  3DU6 A;  1IJW C;  2A07 F;  2VJI A;  3GFI A;  1JI8 A;  5CVU A;  3ZQL A;  3BG5 A;  1R5I D;  1SVM A;  3IP4 B;  4DJA A;  1OCC H;  2AQF A;  3BT9 A;  2M9H A;  1ULY A;  2BY0 A;  5JFR A;  1TC3 C;  2JRT A;  1D8J A;  1KU9 A;  1KQ8 A;  4IQJ A;  5KNL A;  1I3Q J;  1SMY F;  3CP2 A;  3HRU A;  1SVO A;  2V9V A;  2XPU A;  1T56 A;  2KKO A;  1CGP A;  1YRN B;  2X1D A;  1B59 A;  4W97 A;  1S6L A;  4AU7 A;  3IH2 A;  1Z9C A;  1MBH A;  2HZD A;  3GFJ A;  3S16 J;  3ERM A;  3JRH A;  2IP2 A;  1XD7 A;  2YR2 A;  3DEW A;  5F08 A;  2JA6 J;  1I39 A;  2DAO A;  2KRC A;  3J81 Z;  2JWT A;  3ZRG A;  1IN4 A;  2MD0 A;  3RYP A;  3H5N A;  2VB6 A;  2W84 A;  5D6E A;  4ZYH A;  4M73 A;  5M5Y J;  3IH4 A;  1U5T A;  1ZGA A;  3OOU A;  1TNS A;  4YFX F;  5KK1 A;  4I09 A;  3BJ6 A;  2LVS A;  3RDI A;  2FQ3 A;  3LSI A;  4CYC B;  2OTJ I;  4XIC A;  3BPX A;  3O8H A;  3HRS A;  2PG4 A;  2ZKZ A;  1WI3 A;  5CPR B;  3WGI A;  3WTU C;  2BYV E;  1RET A;  4FX0 A;  1JXS A;  3JRE A;  3DTK A;  2B7E A;  4BAY A;  2MFZ A;  2VKH A;  4WXC A;  1Z0X A;  4BGD A;  3IKT A;  5DCM A;  4XSX F;  1HW2 A;  5LEJ A;  4EAT A;  5EEA A;  4RMN A;  1DP3 A;  3DLL F;  3K2A A;  1YE9 A;  3FIW A;  3BZC A;  3MQ0 A;  2KIF A;  3F8C A;  4HF2 A;  4QPO A;  3LNQ A;  1YQA A;  1OMI A;  5JR3 A;  4WCG A;  1WJE A;  1JTY A;  1JKQ C;  3ABM H;  1JHF A;  3FHN A;  1WZ2 A;  2G7H A;  4IRI A;  4I98 B;  3VOD A;  2ECB A;  1JT0 A;  2HQ5 A;  4AYB A;  5CKT A;  4LOC A;  5JVG F;  4RLQ A;  3NEU A;  4BL0 B;  3GF2 A;  4Y4R A;  2K9S A;  3VB2 A;  3WTT C;  2Z3Y A;  4EM2 A;  3I9V 2;  4NDL A;  2PMU A;  2R7U A;  2UXX A;  3OYK A;  1HXD A;  2CQN A;  5A2Q K;  2ICW G;  1J09 A;  4HX4 A;  4BE2 A;  3D5R C;  4GYG A;  3W6K B;  3JTH A;  1HKT A;  3RPU A;  1OKR A;  1YFH A;  4O5V A;  2RDP A;  3ZMS A;  2RAE A;  2QF7 A;  3H92 A;  4L9J A;  3BG7 A;  2FF4 A;  5C44 J;  4Y3O A;  1IRG A;  2NOJ B;  2MC4 A;  2M8G X;  1UZC A;  3M8J A;  3H1C A;  4RAZ A;  1IW7 F;  2KJC A;  4Q47 A;  4DNC A;  3RKY A;  2BW3 B;  2QEN A;  3NAU A;  4ASN A;  1PJR A;  1Z6R A;  1SFE A;  2A6H F;  3S14 J;  5LRR A;  1WJC A;  1MBK A;  3TO7 A;  3H0D A;  2D1V A;  1U8R A;  1BI1 A;  2Y2Z A;  2GQQ A;  2BY3 A;  2KZV A;  2VLA A;  3LST A;  3SFZ A;  1IZ1 A;  1G3T A;  2YX7 A;  4ZYE A;  1YG2 A;  3X2Q H;  5LEK A;  2EA2 A;  4HLY A;  4L5E A;  3J7A O;  3SJM A;  3BR6 A;  1EH8 A;  1U6G A;  2IVM A;  4OIN F;  3CJR B;  3ML6 A;  4LLG F;  4IVN A;  1MNE A;  3TDZ C;  5GAG J;  1QRY A;  3ULQ B;  3LSR A;  2IXS A;  3ZXS A;  4G6D A;  1MDM A;  4A3J J;  1I6H J;  1YJ9 I;  1X1C A;  4BXX J;  3WOD F;  4CGZ A;  5ED4 A;  4B47 A;  1J7K A;  2E19 A;  5M3M J;  1MH3 A;  1W0T A;  5HLI A;  1VQ4 I;  3G71 I;  3GTP J;  3V8L A;  1MW7 A;  5E79 C;  1QO0 D;  5E17 F;  2XPV A;  1OCP A;  3CES A;  3R60 A;  4RDU A;  4XRS A;  3PO2 J;  3FXJ A;  2FBH A;  2E1O A;  4LMY A;  3I54 A;  1Z7U A;  3W3C A;  2HDW A;  2DMP A;  2FA5 A;  4MO7 A;  1ZLJ A;  2GBY A;  2ZNZ A;  4U88 A;  3Q0U A;  1R1T A;  1W7P B;  3R0A A;  3TMO A;  4AD9 A;  1ETW A;  1ZAO A;  2HYF A;  3WG7 H;  3HG9 A;  4A0Z A;  2AXT C;  3FM5 A;  1ACI A;  3KPH A;  1XCV A;  1WPK A;  3DXJ F;  2KPM A;  3RZD J;  4M9Z A;  2CJJ A;  1TP4 A;  1LDD A;  3MKZ A;  2VBW A;  1VQ8 I;  4ESF A;  5EG0 A;  3FX3 A;  2O9L A;  4LLN A;  3K9T A;  3OSG A;  3OS1 A;  3S17 J;  2ME0 A;  1RKW A;  2Y0S A;  4OWR B;  4OAZ A;  4EJV A;  4PUS A;  1QU3 A;  1XDS A;  4IQ4 A;  4ZTF A;  3K6G A;  1G8X A;  1HW1 A;  1Q1H A;  3F72 A;  1RRJ A;  5C3E J;  3J81 K;  3WTW C;  5EGO A;  1E0E A;  2CW7 A;  1JKO C;  3H0G J;  1OR7 A;  1RIO H;  1LJ9 A;  4AC0 A;  2CV0 A;  2E2J J;  2M0C A;  1S29 A;  2Q2E B;  2P5K A;  3H5R A;  4L9V A;  3ZQH A;  1X3U A;  4WXH A;  4I99 C;  1V4R A;  3U21 A;  1YIO A;  3EYI A;  3CLQ A;  5E1X A;  4MEX F;  4XLE A;  1B72 A;  1BI3 A;  3KYL A;  3ZOB A;  2DYS H;  2QVO A;  1YS6 A;  4HEA 2;  5ERI A;  3KEO A;  2QSF X;  2ISY A;  1J9I A;  2HPM A;  1XN7 A;  3W6V A;  3CJN A;  3A4C A;  4P9F A;  1WI9 A;  2JMW A;  5M5X J;  4JP0 A;  4G7O F;  2CH0 A;  3H36 A;  4E7L A;  4BS9 A;  2VKE A;  3HKZ A;  4A3K J;  1FPQ A;  3QYE A;  3FIS A;  5IP7 J;  1F1Z A;  4Y33 A;  2LR8 A;  5D4S A;  2M87 A;  3K1M A;  3WE2 A;  4HQM A;  2QSH X;  4YIF A;  5IOY A;  1LQ1 A;  4IRH A;  2LKP A;  2HKX A;  4J19 A;  4ON0 A;  4HNU A;  4A3D J;  3REO A;  3PSF A;  3QU6 A;  1ETY A;  1P6R A;  1J0R A;  3H9J A;  3JRF A;  1G3S A;  1LUJ B;  1RUN A;  1N25 A;  1S8N A;  4HYE A;  3I56 I;  1R9T J;  3QYB A;  2DA5 A;  5ICE A;  4CYC A;  3I55 I;  1PP7 U;  2VQG A;  4UV8 A;  4A3E J;  3K1N A;  1AHD P;  2UWM A;  1FEX A;  3G73 A;  2QQA A;  4Q48 A;  3IL2 A;  2GZW A;  1KYW A;  4ZZD A;  4UV9 A;  3M1E A;  3HPG A;  4MQV A;  3GW2 A;  1X2N A;  1DPR A;  1YYV A;  1ETQ A;  4GXO A;  2KHM A;  3R61 A;  5M5W J;  3VYS B;  5ICF A;  5GAD J;  5KHD A;  2QQB A;  3GTO J;  4M6Y A;  5K5O A;  2IS4 A;  2R7W A;  3BR3 A;  1FYK A;  3F23 A;  2W1O A;  2CFX A;  3Q9V A;  4A3M J;  4MIM A;  4LIV A;  1W0U A;  4OIP F;  2BY2 A;  1P92 A;  3K4M A;  2WV0 A;  1R7J A;  3VOE A;  2TRT A;  2R7Z J;  3GYH X;  3A01 A;  1IRX A;  3H3V K;  2W57 A;  4XSZ F;  2EFQ A;  4BJT A;  3SQN A;  4HF0 A;  1K6Y A;  2O5R A;  1B6A A;  4MFE A;  2NYX A;  3KX2 A;  2M4G A;  4G12 A;  4U0V A;  4IOA F;  1TQP A;  1YRN A;  4G6T B;  4D5F A;  5BNG A;  2QSG X;  2IA2 A;  2AHQ A;  5DD8 A;  2BXY A;  5F27 A;  2KFD A;  5EZG A;  2YS9 A;  3CF5 F;  3FHZ A;  3HGG A;  2EZK A;  1FNN A;  3CJT B;  3FXU A;  2NVU B;  3G4S I;  1K78 B;  2PJP A;  2HQN A;  3CCS I;  3BRO A;  3HB9 A;  1BI0 A;  2CQ7 A;  4M3G A;  4Y13 A;  4PSX A;  3RSN A;  3TW6 A;  5LHI A;  3G3Z A;  1I1S A;  1U8B A;  1Z3Y A;  4BHC A;  1VQ7 I;  1XC5 A;  5FRO A;  2VT2 A;  1LDK B;  5HLT A;  5C4X J;  2DT7 B;  2HU9 A;  1VQ5 I;  3ELK A;  3S3M A;  3HJE A;  1HQC A;  1Y0N A;  3FMR A;  4L5J A;  5ICG A;  3QYF A;  4ESB A;  1H9G A;  1TWA J;  2R5Y B;  3QQA A;  2BBY A;  4DW6 A;  3ZMZ A;  2WAF A;  1MNM C;  2FNA A;  3O2P E;  3O3K A;  3N97 A;  1K83 J;  3A01 B;  2XSJ C;  1T95 A;  2O8K A;  3DEE A;  3BPV A;  3ABK H;  1SFU A;  2VIX A;  4YEJ A;  1XGO A;  5J4V A;  3S1Q J;  3QP6 A;  3W6J B;  3I58 A;  1G6N A;  5LHH A;  2EQR A;  3FKJ A;  2E1M B;  2YSR A;  1H89 C;  2OU2 A;  4DIQ A;  1AKH A;  2ZJP F;  3M07 A;  1DPU A;  3JRC A;  1RPW A;  2ZSH B;  1NTC A;  2BY1 A;  2IGO A;  3C7J A;  3LSJ A;  2BXZ A;  1T33 A;  2L9S A;  2DYR H;  2F5E A;  4WF2 A;  1OLT A;  2V4J C;  3DKW A;  3FKI J;  5FB2 A;  4UUS B;  3BCA A;  2V6C A;  5EEH A;  4P1W A;  4QLC U;  3L2R A;  2ZXJ A;  4BQO A;  3OYG A;  1R4M B;  4NB5 A;  5D4R A;  1D5V A;  3LA3 A;  3WGG A;  4BXF A;  2A68 F;  5JI6 A;  4XLP F;  4UB6 C;  1UAA A;  3DBL B;  1Y1W J;  4IO9 F;  4CCL A;  4C2T A;  3AG1 H;  5IYD J;  2W85 A;  3G1M A;  4A2U A;  1J2X A;  2HWV A;  3DPU A;  1R58 A;  3MZY A;  4I01 A;  3T0Y A;  1PUE E;  1JUP A;  3HBL A;  2V26 A;  4XRS G;  3V7C A;  1QZY A;  3KET A;  4AVP A;  2GOX B;  2FE3 A;  1G2H A;  2E1N A;  4XNF A;  4KFC A;  3DKY A;  4LB6 B;  4L0Y B;  1F43 A;  3NRV A;  3OYL A;  1G59 A;  1ZK8 A;  2E34 A;  3I59 B;  1E17 A;  2PMH A;  2VBX A;  2JA2 A;  3GUD A;  3BG9 A;  4A6E A;  3CMY A;  3H5A A;  1APL C;  1UHW A;  4FT8 A;  2VC1 A;  3FXK A;  3M8E A;  5DD4 A;  3I64 A;  4HNT A;  1EH6 A;  3MMY B;  3RJP A;  4ENM A;  1MGT A;  3UR3 C;  4CUG A;  1XMK A;  3SHF A;  1F5T A;  1JUS A;  3ECH A;  3I4P A;  3M9A A;  1VQN I;  2XGD A;  3F8B A;  3PQJ A;  3OYC A;  1BM9 A;  2A69 F;  3HKZ N;  3DTI A;  2DFF A;  1M1E B;  1RI7 A;  1L3L A;  2CUF A;  2W48 A;  1HF0 A;  1QVT A;  2LC2 A;  4PJM A;  1T39 A;  1FBQ A;  1V5F A;  4D7N A;  5FJ8 J;  1IAW A;  1X3Z B;  2A6T A;  2QZ8 A;  3I53 A;  4RGX A;  1K61 A;  3MZH A;  1ETO A;  4GRI A;  2MSY A;  1GDT A;  1MH4 A;  2L5Q A;  3BC8 A;  2PLY A;  2F5D A;  2A05 A;  5KCM A;  2DLL A;  3PNT A;  4KJZ A;  5CLS A;  3CCV I;  5B1A H;  2FBK A;  4B3X A;  2Z2S B;  2Y30 A;  1GXP A;  2KL4 A;  3EUK L;  1QVU A;  2K9L A;  4JBA A;  2M3A A;  1FX7 A;  3ASN H;  5TIS C;  4BHB A;  4CXF A;  3KCC A;  3C18 A;  3NAR A;  1ZLK A;  4RGS A;  1GV5 A;  1FBU A;  1A31 A;  4IHW A;  5E8G A;  5J8F A;  5TJJ A;  1MMG A;  2FU4 A;  2R7O A;  3L2C A;  4TV7 A;  2CW0 F;  5J4Y A;  1RZ4 A;  3CME I;  1J75 A;  5GTH C;  1N78 A;  2DMQ A;  1BW6 A;  3GXO A;  2VQC A;  4EMS A;  2DQR A;  3CC4 I;  2XDV A;  4LG0 B;  4L0Z B;  1FOW A;  1DU0 A;  5B3S H;  2E36 A;  2X1E A;  3B6C A;  4V19 K;  4A3G J;  2BW3 A;  3CUQ A;  1P4X A;  2EPF A;  1WFX A;  2G0E A;  3K7A J;  3CMM A;  2PMZ A;  3OYD A;  4FCY A;  1IGN A;  1A35 A;  4E7H A;  3S15 J;  1N75 A;  3ZR8 X;  3W2A A;  4M74 A;  3SFI A;  5JHU A;  1IXS B;  4RB3 C;  5K7Z A;  2JPB A;  1IV8 A;  1D1A A;  5DM7 F;  2P8T A;  2X9D A;  2MH9 A;  1BJA A;  2COM A;  5IYB J;  3K0L A;  4BH9 A;  1WJ5 A;  4IX7 A;  2ZCW A;  1X3W B;  3ABU A;  3HYI A;  1ON1 A;  1JKR C;  4FAS D;  1SD5 A;  3WTX C;  3BJO A;  5FKK A;  1ZYR F;  3GVA A;  3TO6 A;  2CYY A;  2QUF A;  1ZGJ A;  3I5U A;  2K85 A;  1MMA A;  5HLG A;  1T0F C;  1ZHF A;  2A61 A;  3ERE D;  4BQQ A;  1WRJ A;  5DUK A;  1GVD A;  4BY7 J;  2VE8 A;  1T6S A;  2HS5 A;  2QCO A;  4B43 A;  3S2H J;  1EF4 A;  1FLI A;  5CQG A;  4GDF A;  4U7B A;  3MD2 A;  1UCR A;  3HC7 A;  4A0Y A;  5J6X A;  2NXN B;  2CRG A;  2K9M A;  2LBF A;  3F6V A;  2ETH A;  4O6J A;  1O3S A;  2E35 A;  2H6C A;  3QWL A;  1YS7 A;  4X0G A;  3I0T A;  1Y56 A;  4B48 A;  3H3U A;  4GCV A;  2K9N A;  4ZDO A;  1HCR A;  5BS6 A;  2CQK A;  5K1Y A;  1SD6 A;  4UUV A;  3Q0W A;  1WGX A;  5EDN A;  3MZ8 A;  4M3F A;  2H6B A;  4ZYA A;  2N8G A;  5DCF A;  2O61 A;  2EWN A;  3PIP F;  3JR9 A;  2BE5 F;  3AG2 H;  2GIV A;  2WAE A;  3GFL A;  2GIZ A;  3L00 A;  2DMN A;  4ITV A;  1IRZ A;  4FE4 A;  5B1B H;  5ILU A;  4U87 A;  3CCR I;  3Q5F A;  1IUY A;  4CCK A;  3TL4 X;  5FFZ A;  2L9V A;  2XV4 S;  4M3D A;  3R4K A;  1X1A A;  4M9S A;  3PFY A;  3ZQ7 A;  2CQQ A;  4XLH A;  1PUF A;  3CCY A;  4CSW A;  1MKM A;  1QPM A;  4PZJ A;  5EGO B;  2XB0 X;  2M2E A;  2NS7 A;  1HW5 A;  4Y17 A;  3EUH A;  2XUB A;  4CYD A;  2CW8 A;  2E7X A;  4EM0 B;  2X4H A;  2D1H A;  5LGT A;  4JX6 A;  3QOE A;  2HXO A;  3OIO A;  4A5M A;  2HI3 A;  3EYY A;  4F3Q A;  3E1S A;  4DBR A;  4UUS A;  1KQ9 A;  4KUM A;  4A6D A;  5DCM B;  2V1U A;  1VQ6 I;  4Y52 J;  3A2K A;  2M8E A;  1XMX A;  4PJ0 C;  3JSO A;  2DJI A;  3F0C A;  1B72 B;  2COB A;  4RAY A;  1LPQ A;  2DW4 A;  3S32 A;  4H4K C;  3I4M J;  2O03 A;  2Z1D A;  3DWL E;  5F1R A;  5GPC A;  5FRN A;  1S7A A;  3ZQG A;  1UG2 A;  5IT9 Z;  4ENN A;  5GTI C;  3ZQC A;  1BR1 A;  2NVY J;  2PMZ N;  2QA4 I;  2KRH A;  3KP7 A;  3TQN A;  2KZG A;  4NNJ A;  2BEO A;  2GWR A;  2RC4 A;  2NNY A;  2HEO A;  4AWX B;  4ETS A;  3M1C A;  2IAI A;  3K1P A;  2B0L A;  2Z16 A;  1WKM A;  3IRR A;  3L7W A;  1EKE A;  4F55 A;  4X1E A;  3TED A;  2ISZ A;  2H1K A;  3CDI A;  1HDD C;  1B1B A;  2XKP A;  5E3L A;  2L7M P;  3OIP A;  3ZGK A;  5C4J J;  2CS3 A;  2BHY A;  5FD5 A;  2GAU A;  3CJQ B;  3K4J A;  3D5S C;  5EG0 B;  3QPL A;  3F8M A;  3QPT A;  5HVQ C;  3KLO A;  5AIP A;  3P9I A;  2X6W A;  1X1D A;  2F6C A;  4BJ6 C;  4P96 A;  3S8P A;  4C9Y A;  3BTJ A;  3HZJ A;  3LOC A;  5F6F A;  5H6Q A;  2IA0 A;  1WSU A;  3SZT A;  1R23 A;  4IHT A;  2UZK A;  4XN0 A;  2VJ4 A;  3DV8 A;  1DDN A;  2JJ7 A;  1XSV A;  4K2E A;  1RNL A;  2H27 A;  1GUU A;  3CC2 I;  1TBX A;  1TT0 A;  2ZFU A;  1QHH D;  3F9K A;  1IXC A;  4KN4 X;  2Y31 A;  4OU0 A;  4Q4Z F;  1F4K A;  5D8L B;  2LBF B;  2VE9 A;  3CP8 A;  2XRN A;  2ZNY A;  4DZP A;  4DBQ A;  1E3O C;  1R1U A;  5L3B A;  1TWC J;  3CDH A;  5IY5 H;  2BOL A;  1FMV A;  5A2Q Z;  2OBP A;  2VOD A;  4AID A;  1AU7 A;  2EIK H;  4II2 A;  1OCT C;  1SMT A;  3PUB A;  1P7I A;  4AIK A;  4OIO F;  4RM2 A;  2L4M A;  5HS7 A;  2K4B A;  5IT9 K;  3EUA A;  3OSF A;  3JW4 A;  3MN2 A;  2K02 A;  1VFC A;  4DZJ A;  3DEU A;  5FKO A;  5FKL A;  5LD2 C;  3VSL A;  2HZT A;  1SAX A;  2OD5 A;  4OMZ A;  1W1W E;  1HOM A;  2PI0 A;  2EFW A;  3HOY J;  3TDU C;  1VTN C;  1DQU A;  2R0Q C;  2FNP A;  2P0W A;  5F0C A;  1BW5 A;  3N4M A;  3LQQ A;  4YEL A;  2KMU A;  1A6I A;  2V6E A;  2B63 J;  2G9W A;  4EM1 A;  3PSI A;  3BZ6 A;  4Y7N J;  1W7P D;  1OYW A;  1S7E A;  5IYC J;  2DTZ A;  3O8G A;  1S9H A;  2EIJ H;  1OYI A;  5D8K B;  1XX5 A;  4C3I J;  3FBI B;  3DPT A;  3C3W A;  3LQR A;  4QTR A;  1JJ8 C;  3F22 A;  2BZT A;  5HOO A;  4QSH A;  5GAE J;  2ESN A;  2WAQ N;  3CCQ I;  2P7V B;  4B8X A;  1I5Z A;  1ZAR A;  2P6T A;  3B02 A;  3Q3S A;  3TW7 A;  1WVR A;  5J1R A;  1EH7 A;  3KE2 A;  1FMW A;  1SAU A;  2QGU A;  2NVX J;  2LDU A;  4PCQ A;  3CCM I;  1EA3 A;  2DK8 A;  3BTC A;  1KA8 A;  2AS5 F;  2KRF A;  4YRV A;  3BTL A;  2ELJ A;  2OQG A;  5BPD A;  1VQM I;  1V55 H;  1OR7 C;  3AFH A;  2DXI A;  4M3E A;  4B1R A;  1IN6 A;  1S7O A;  2WBM A;  1IN7 A;  2PEX A;  5D5V B;  2F5C A;  1FZP B;  3BCB A;  1MD0 A;  1R5H A;  2KQR A;  1SAN A;  4QPQ A;  3L2U A;  3CO6 C;  4E4H A;  3KEQ A;  4XKV A;  5FO5 A;  2KJB A;  1XSD A;  4EV0 A;  1ZTR A;  3OIQ A;  4PGG A;  2F4O B;  1OFC X;  1YW9 A;  5JVT A;  1D1C A;  2QKM B;  2W82 A;  2VUM J;  2ECC A;  4CHU A;  2M7B A;  2HNH A;  3GO5 A;  4RAF A;  5GAH J;  2VOP A;  2X6O A;  2QM3 A;  1QHG A;  1MSE C;  2G7U A;  2L01 A;  4ABZ A;  2DJN A;  2YUS A;  1LKX A;  4XLC A;  1NG6 A;  3ASO H;  4LIT A;  3AL0 B;  2R7X A;  1PUF B;  4LG3 A;  2XGC A;  5FFX A;  3W2W A;  4C2U A;  1ZR4 A;  2QWW A;  4EJT A;  1K78 A;  4EGZ A;  1H8A C;  4L9N A;  5CVR A;  5DS9 A;  2R7R A;  1ZN2 A;  1K4S A;  1VI0 A;  3HOW J;  4C2M J;  3V7R A;  4CCN A;  3CCJ I;  1ZEL A;  2FD5 A;  1DGR M;  2F4I A;  1JT6 A;  2Y0M A;  5J40 A;  1JKP C;  2QBY A;  1YHQ I;  4NQW B;  1BN5 A;  2WB1 N;  2XIG A;  2XB5 A;  2LMD A;  2GXA A;  3BQZ A;  1FIA A;  2RQQ A;  4IL6 C;  1TW3 A;  1LB2 A;  2EB7 A;  1MJ9 A;  3CUO A;  3HSE A;  4J01 A;  4XK4 A;  1Z91 A;  3G6E I;  5B66 C;  3IUO A;  5E18 F;  1W7P A;  4LD5 A;  1Z21 A;  5DEQ A;  1BI2 A;  5CYV A;  4MHG A;  4E7J A;  4AVZ A;  3KP2 A;  2VJ5 A;  1XDU A;  3PNV A;  2OF7 A;  4A93 J;  3I71 A;  1XB4 A;  2MW8 A;  3GTK J;  2D5V A;  1RUO A;  2XAJ A;  1I27 A;  3ZMT A;  3SXY A;  3ROU A;  1B9M A;  3K70 D;  1FYL A;  2LK2 A;  1WJA A;  2VL8 A;  4ZYG A;  4RGR A;  2BV6 A;  5LGN A;  5K5Q A;  1D5Y A;  5HDK A;  4I02 A;  4JK1 X;  1BA5 A;  2R93 J;  1H0M A;  2DT5 A;  2ZFW A;  5HLH A;  2VKV A;  1BC7 C;  5H2F C;  1E3P A;  1Z77 A;  1KYZ A;  1W5T A;  1FBS A;  4QIW N;  3BR2 A;  4BAC A;  2AO9 A;  3RZO J;  1MND A;  2B9S A;  2HTJ A;  2V1D A;  5BPI A;  1XGN A;  2ID3 A;  3BLY A;  3RIR A;  4MLO A;  1TZL A;  4F93 B;  3CDL A;  1WJD A;  1QA6 A;  2HQA A;  2DA4 A;  1OJL A;  2XAQ A;  2STW A;  2DOD A;  2DA1 A;  1NHA A;  5GPA A;  1FSE A;  3SYT A;  3TKY A;  2MD5 A;  3QOP A;  1O3Q A;  4ZDP A;  4EQQ A;  2ZJ2 A;  3HTS B;  2Q0O A;  1X2M A;  3IWF A;  3OYM A;  1BIB A;  4XKW A;  4XON A;  4I76 A;  3I3L A;  3F8F A;  4AM3 A;  2L3D A;  3HTU A;  3CZ6 A;  5EF6 A;  1T2K A;  2H8R A;  2W4S A;  5JLW A;  2O0Y A;  1DP7 P;  1LDJ A;  1HBX G;  3BQY A;  1L0O C;  3WE3 A;  4P55 A;  1TWH J;  1WCM J;  4LG0 A;  4L18 B;  3V7S A;  1T38 A;  2M30 A;  3E5Q A;  3ESW B;  2WB1 A;  3I59 A;  3HSR A;  3CUQ C;  3GEZ A;  1BR4 A;  3FDY A;  4ENK A;  2QQ8 A;  2V9P A;  3T8R A;  4I7H A;  1IRF A;  3CC7 I;  2RV8 A;  1XTA A;  4F91 B;  1FP1 D;  1OYY A;  4G9Y A;  3J7A Y;  1TWG J;  2KDO A;  2C6Y A;  1Y8R B;  1MJA A;  1WJF A;  3L2Q A;  2DA3 A;  4II3 A;  2XF5 A;  3E0J B;  2VXZ A;  3NWT A;  1OIS A;  1BL0 A;  1HA8 A;  1IDY A;  4C30 A;  1YW8 A;  3M3Y J;  4IZZ A;  4M71 A;  2O7O A;  3DTE A;  3DCF A;  2ACJ A;  1Y8Q B;  4CCO A;  2XHK A;  3TBI A;  1LFU P;  4YII A;  2NS0 A;  1GXQ A;  2E60 A;  4WK8 F;  1LVK A;  1GLN A;  2EK5 A;  2LH9 A;  1KZH A;  4JQF A;  3HGY A;  1GT0 C;  2CUJ A;  1LEB A;  2JVG A;  4RLF A;  3ZCO A;  1BOA A;  1USS A;  3EQL F;  2XAH A;  5DUI A;  2NVQ J;  5FLX K;  2CUE A;  3TP3 A;  5DDG A;  2L9R A;  5FKM A;  2XSD C;  4I0B A;  1X1B A;  2VKD A;  4BE0 A;  3Q9S A;  4UXN A;  4YIR X;  2MLK A;  3LSH A;  1P4W A;  3IWZ A;  3C1D A;  2HVQ A;  3WG9 A;  4CZZ A;  5HNF A;  3DF8 A;  3ZP5 A;  3S2W A;  3HHH A;  5KAI C;  1AOY A;  3KLN A;  5LHG A;  4KT6 A;  2PJR A;  4I2O A;  3ZMD A;  2AXL A;  4KIG A;  3AAF A;  4GYI A;  1ZQ3 P;  1KQ0 A;  5DTD A;  4EGY A;  2ZC2 A;  3HRT A;  2NAZ A;  1YO5 C;  3ZPL A;  1OCR H;  3ECO A;  2CU7 A;  4BXU A;  3V8K A;  5F1J A;  3PL8 A;  1R22 A;  4LJZ F;  2FSW A;  4XM3 A;  4LLL A;  2XRL A;  1MSF C;  2L54 A;  2X6Y A;  3L09 A;  3GTL J;  4B4C A;  1KU3 A;  2J5O A;  1FWZ A;  4FHT A;  4UB8 C;  3ZQI A;  1VZ0 A;  2CV1 A;  4IHV A;  2R7T A;  4NC7 A;  1NK2 P;  2Y9Z A;  1VQP I;  5E3O A;  4HAM A;  1FC3 A;  3BDD A;  3CCU I;  1D0Y A;  4C3H J;  5IP9 J;  4MFD A;  4NC8 A;  4KIF A;  4A3L J;  4A3I J;  2BGC A;  1OCZ H;  2A6E F;  4F92 B;  2KT0 A;  3H35 A;  1U2W A;  3GLL A;  3OYE A;  2KP6 A;  1ZG5 A;  2E5Z A;  2J5P A;  4KNY A;  1YOV B;  2H09 A;  1IXR C;  2A3S A;  2VI6 A;  3BP8 A;  5CVI A;  1Y0U A;  2Z5U A;  4XN3 A;  2DO7 A;  2RGV A;  4NQW A;  1U78 A;  2IA1 A;  3AG3 H;  2LRE A;  2M34 A;  2Q1Z B;  3S3N A;  1Q1V A;  2L7K A;  1IUF A;  2P6S A;  3OYA A;  2YU9 J;  1MBE A;  2LOO A;  2ZO4 A;  2KIQ A;  4G6Q A;  3IC7 A;  4FE7 A;  2IRF G;  5KVR A;  1T0F A;  2LRD A;  4EJO A;  1FOY A;  3E6C C;  2VQH A;  2L7F P;  3PIO F;  2LSO A;  4YFK F;  2XAS A;  1H88 C;  2P5L C;  1Y39 A;  2JZY A;  3HOZ J;  1R00 A;  1X58 A;  1XCB A;  1TT5 B;  4E7S A;  1SFX A;  4XKC A;  3BTI A;  4HX8 A;  1UEL B;  2HOT A;  5D5U B;  1HDP A;  3D1N I;  3GME A;  3OL4 A;  4XMY A;  2WY8 Q;  4U7D A;  3OYH A;  1NH3 A;  1NK3 P;  3JRD A;  2L0K A;  3HEF A;  4PFO A;  4E70 A;  4A5N A;  3GFM A;  1K4T A;  3E6D A;  1F36 A;  3PJR A;  5ICC A;  2Y9Y A;  4HBL A;  3P7N A;  4RBO A;  2R7D A;  3OL3 A;  2EFO A;  2HOA A;  2L7Z A;  3OR2 C;  3HOV J;  3KYC B;  3W2V A;  4NUB A;  2DFI A;  2MA3 A;  1V54 H;  4A0X A;  2NS8 A;  2JQ7 A;  1FTZ A;  2LF7 A;  4KMF A;  2VPL A;  1YLF A;  2VPR A;  1MBF A;  1LE8 B;  2HVR A;  4BDZ A;  2HOS A;  2LYC A;  1SFK A;  4EEF G;  1QNT A;  3RPQ A;  1SD7 A;  1P7J A;  2ZSI B;  1LNW A;  2LFB A;  4XKB A;  2EIN H;  2HKO A;  4NBQ A;  1KU2 A;  2QQ9 A;  3VWB A;  2P5V A;  1ERD A;  1V5G A;  3CCE I;  3RCO A;  4N9I A;  2BVM A;  1R6R A;  3CO7 C;  2GLO A;  3BZK A;  3E7L A;  3K4K A;  3OS2 A;  3WU0 A;  1REP C;  2PJR B;  5ILV A;  2JRM A;  4L5I A;  4HA8 A;  1R5G A;  3BR0 A;  3DQV C;  2OTL I;  2IS2 A;  2QEX I;  5JHF A;  5M3F J;  2K40 A;  1U0J A;  1FJL A;  5DV5 A;  1H9T A;  5D5X B;  3K4C A;  5JLX A;  2UV1 A;  1JE8 A;  2OUM A;  4V2F A;  4M6V A;  3S3O A;  1AKH B;  3HOU J;  2CWE A;  3LSK A;  2FXA A;  1ZRD A;  2OJE D;  4HG2 A;  1JTX A;  1WH5 A;  4XLN F;  3FXQ A;  3OYJ A;  1I50 J;  2DA7 A;  4IEJ A;  4UVB A;  3JSP A;  1IG7 A;  2STT A;  2OAZ A;  4OIQ F;  4KN7 X;  3IHU A;  2K7L A;  2WWY A;  1D1B A;  2M4K A;  1DGW Y;  2Q2E A;  3T8T A;  3F21 A;  2DDA A;  1X1P A;  3LA2 A;  1GV2 A;  3K2Z A;  2PX9 A;  2VBY A;  4PGH A;  4D5C A;  2IBD A;  5L3F A;  4CA0 A;  4S0H B;  3P9C A;  2WC2 A;  3B73 A;  1YW7 A;  2EZL A;  5IOZ A;  1LEA A;  2FOK A;  3VDX A;  3CTA A;  2Z9O A;  4A69 C;  1TNT A;  4F52 A;  5HOD A;  2I5U A;  4FTH A;  1R71 A;  3IH3 A;  5E8I A;  2GOM A;  1TLH B;  3DP7 A;  1B9N A;  4R8H A;  5J1Y A;  2PFB A;  2OQR A;  3C2B A;  3FF5 A;  3ZMV A;  4PDK A;  2LY1 A;  2ME6 A;  3A02 A;  5DM6 F;  1O7L A;  3F6O A;  4I0A A;  1OCO H;  4KIC A;  4JX4 A;  3KP5 A;  2DT6 A;  4MNU A;  4E7Z A;  1T08 B;  2DCE A;  3HOX J;  1K79 A;  1F9N A;  1W36 C;  4KT5 C;  4S04 A;  2RVC A;  5K5R A;  3C2H A;  3BR1 A;  4Z2Y A;  2WY7 Q;  2K4J A;  2JPC A;  3N05 A;  4DGW B;  2Y0S N;  2VJJ A;  1W5S A;  4IHS A;  2PQ8 A;  1XSX A;  3E6B A;  1YX3 A;  4JOM A;  4V2G A;  2X0L A;  1TQI A;  2X51 A;  3LAJ A;  2X48 A;  4BNC A;  3M7G A;  4HX7 A;  1VQK I;  1EJ9 A;  4HF1 A;  3KZZ A;  2W24 A;  3MFK A;  2RKH A;  3S2D J;  3WHC A;  2UXN A;  3HHG A;  2IGM A;  2WA0 A;  2FEZ A;  3E97 A;  1YJN I;  4N9H A;  4BBR J;  3E5X A;  1JGG A;  4CDG A;  5IPA A;  3RQI A;  3GLX A;  2HFH A;  2ZME B;  3H3Z A;  1TWF J;  1KON A;  1B4A A;  2NRA C;  2JVH A;  2P7C B;  1UST A;  2W25 A;  3RKQ A;  3ZQF A;  1FSH A;  2LKS A;  5E1Z B;  1QQI A;  2H94 A;  2RNG A;  4I6Z A;  4CH7 A;  2X6X A;  1FYM A;  3OV8 A;  4PFP A;  4EJW A;  3ABL H;  3GZ6 A;  1XMA A;  3BWG A;  3PM1 A;  1JGS A;  3M8F A;  2M7A A;  3OYB A;  1TW2 A;  5L3G A;  1IV6 A;  3T1B A;  3BY6 A;  2VT3 A;  3HL2 A;  2BHZ A;  1QBJ A;  3DFG A;  2CMP A;  4WWC A;  3U1K A;  4DYQ A;  1IN5 A;  4AIH A; 
#chains in the Genus database with same CATH homology
 1XGM A;  1ZH5 A;  2CO5 A;  4RS8 A;  3TO9 A;  1KGS A;  2OZ6 A;  4KMU X;  4R79 A;  2TDX A;  1FY7 A;  2DI3 A;  2R7F A;  2Q8K A;  3GX4 X;  2K86 A;  4M6X A;  5LGU A;  3FWE A;  4GO1 A;  1G4D A;  4LFU A;  5FLX Z;  2MH2 A;  1ODD A;  3O6B B;  4CO8 A;  1R36 A;  4ZZL A;  2HQR A;  4OMY A;  3KFW X;  3KP4 A;  2DQL A;  5BMZ A;  3VEP A;  1TTY A;  5HDN A;  2XRO A;  1FOK A;  4U0Y A;  2GA1 A;  3V4G A;  2XGX A;  3MAJ A;  2ZBK A;  2F2E A;  3MEX A;  4HV6 A;  3HUG A;  2DTR A;  4Y15 A;  4RB2 C;  5E1W A;  4G8X A;  4YG2 F;  1ZG3 A;  1LVA A;  3V8J A;  2VBZ A;  1O3T A;  1K7A A;  1I1G A;  3LAP A;  3FMQ A;  2GXG A;  1O3R A;  3BJA A;  1U5T B;  2HR3 A;  1G3Y A;  5H20 A;  4ZH4 F;  4UNO A;  1CF7 A;  2MBF A;  2IT0 A;  3F8N A;  4IXA A;  2QLZ A;  4QWQ A;  3U2R A;  1HKQ A;  2M1B A;  5H6R A;  2CSO A;  4KA4 A;  1YTY A;  3WTY C;  3EET A;  4XBF A;  4MTE A;  5FD6 A;  2XVC A;  1HKS A;  3QAH A;  5LLQ A;  2P4W A;  1WWX A;  2EFN A;  2HDC A;  1R1V A;  1HSJ A;  1AWC A;  1CF7 B;  2O3F A;  2NNN A;  3QPH A;  3QP5 A;  3CLO A;  1QZZ A;  3WTZ A;  2DPU A;  5HS9 A;  2RQP A;  2GXB A;  3HOT A;  4RB1 A;  1WQ2 A;  3RKX A;  1T98 A;  2OA4 A;  3GZ5 A;  2RN7 A;  4HQE A;  1J5Y A;  2M5W A;  4M72 A;  4D0P A;  1W4M A;  2VN2 A;  3DPL C;  4O3M A;  1ZRE A;  1SD4 A;  2LNB A;  3L9F A;  3TGN A;  3WTV C;  4LGW A;  4UVC A;  3LWF A;  1E2X A;  2DK5 A;  3D0S A;  3QRF F;  5BOX A;  3BOQ A;  3KZY A;  3PQK A;  3RYR A;  5HDG A;  2ZME A;  2DBB A;  3HOS A;  3D5L A;  1MDM B;  1Z6T A;  2KIU A;  2FMY A;  3J80 K;  2V1X A;  1GHC A;  2PBI A;  4H0E A;  3CUQ B;  1U5T C;  5TRD A;  1C0W A;  3VFZ A;  1UFM A;  5L3D A;  3R0J A;  2D2W A;  5DYM A;  2EA4 A;  3LA7 A;  3U1D A;  2EV5 A;  2M45 A;  4LB5 A;  2QYO A;  2DPD A;  4F7Z A;  4G7Z F;  1P4A A;  2LF8 A;  3QU3 A;  4EJU A;  4OIR F;  4A12 A;  4IRG A;  5F64 A;  2FRH A;  4IF4 A;  1D8K A;  2IJL A;  2JSC A;  3P9K A;  1FT9 A;  5D6F A;  2XAF A;  4IPA A;  4BYY A;  1ONV A;  3JAM Z;  2XKO A;  4RGU A;  3RTR A;  2A5Y B;  2HTS A;  1V3F A;  4NHJ A;  2KIM A;  3NQO A;  3J80 Z;  1UB9 A;  3T5X A;  3GWZ A;  3ABT A;  4L9T A;  3F3X A;  4HOB A;  2D45 A;  5IT3 A;  2HYG D;  1O7F A;  2JT1 A;  3HRM A;  4N0B A;  3OOP A;  1ZRF A;  3JAM K;  1O57 A;  1PDN C;  4WX9 A;  4YFN F;  2F5F A;  2EJR A;  1IN8 A;  2R3S A;  1BC8 C;  1UHM A;  3ZN1 A;  5EEG A;  4G94 A;  6PAX A;  3MCZ A;  4OOI A;  3WU1 B;  4UVA A;  3R6S A;  3TOA A;  3KP6 A;  4UHT A;  3ISP A;  4HW0 A;  3FM3 A;  4LK1 F;  1J59 A;  3FZV A;  5L3C A;  2YX4 A;  3E3V A;  1K6O A;  2JTV A;  5BQT A;  4IJA A;  2ADU A;  1JHH A;  3ZN0 A;  3EDP A;  4WXD A;  4MEY F;  1IF1 A;  1XGS A;  2ELH A;  2MLG A;  1DUX C;  2EV0 A;  5FGM A;  1S3J A;  4GGG A;  4G7H F;  3IRQ A;  4P5O A;  5J8C A;  4FX4 A;  4XRF A;  5LBQ A;  4EVI A;  5AON A;  2RNJ A;  4RB0 A;  2CGP A;  4KDP A;  2VOO A;  1ZRC A;  3K69 A;  4HDU A;  5CVJ A;  4KYW A;  4HDV A;  1TQM A;  2Y48 A;  5L3E A;  1HST A;  3E5U A;  3TOB A;  3HIF A;  4MTD A;  3WGH A;  2L4A A;  2VON A;  1BBY A;  4BQA A;  4HV5 A;  1P2F A;  2E1C A;  3COA C;  2MC3 A;  2HGC A;  4LK0 F;  4S05 A;  4M9X A;  3IKV A;  1QGP A;  2YPR A;  2O8X A;  1Z05 A;  1KU7 A;  4R1H A;  3WTS C;  2IW5 A;  4KIB A;  4BHP A;  2YU3 A;  1OPC A;  1FP2 A;  2VC0 A;  2DU9 A;  2PN6 A;  3JTG A;  1GVJ A;  4U0W A;  2EFP A;  4ZYD A;  2GA2 A;  2QBY B;  1Z1D A;  5ILS A;  3MWM A;  2FML A;  3LFK A;  1BIA A;  1PP8 F;  3E6M A;  4ESJ A;  4MGR A;  1U3E M;  4MQ9 F;  2IPQ X;  5CJ9 A;  3RKW A;  5D5W B;  4ENJ A;  3SZP A;  2O6G E;  1ON2 A;  3U9G A;  1A04 A;  2L02 A;  4HLX A;  1STZ A;  3RI4 A;  2V79 A;  2HOE A;  1MZB A;  4Q5S F;  1ZG1 A;  4CIC A;  2FBI A;  4HZF A;  1EV7 A;  3FMS A;  2Z99 A;  1MJB A;  4DQ2 A;  5LRS A;  1I6X A;  5HS8 A;  2E7W A;  3HSF A;  3FXR A;  5AIQ A;  2WTE A;  5E20 A;  2Z33 A;  2OZU A;  2XAG A;  4B09 A;  4AIJ A;  4P9U A;  3KP3 A;  5CVV A;  2ESH A;  2K27 A;  2CG4 A;  2Y75 A;  1D3Y A;  3ZMU A;  1G3W A;  2EV6 A;  3PFI A;  2A07 F;  3GFI A;  5CVU A;  1ULY A;  5JFR A;  2JRT A;  1D8J A;  1KU9 A;  1KQ8 A;  1SMY F;  3HRU A;  2V9V A;  2KKO A;  1CGP A;  1B59 A;  1S6L A;  1Z9C A;  3GFJ A;  2IP2 A;  1XD7 A;  2YR2 A;  2DAO A;  3J81 Z;  1IN4 A;  3RYP A;  5D6E A;  2W84 A;  4ZYH A;  4M73 A;  1U5T A;  1ZGA A;  1TNS A;  4YFX F;  5KK1 A;  4I09 A;  3BJ6 A;  3RDI A;  2FQ3 A;  3BPX A;  3HRS A;  2PG4 A;  2ZKZ A;  3WGI A;  3WTU C;  2BYV E;  1JXS A;  4FX0 A;  4BAY A;  4WXC A;  3IKT A;  5DCM A;  4XSX F;  1HW2 A;  5LEJ A;  3MQ0 A;  2KIF A;  3F8C A;  4HF2 A;  1YQA A;  1OMI A;  5JR3 A;  4WCG A;  1JHF A;  2G7H A;  4IRI A;  4I98 B;  3VOD A;  3NEU A;  3GF2 A;  3WTT C;  3VB2 A;  2Z3Y A;  4EM2 A;  2PMU A;  2UXX A;  1HXD A;  5A2Q K;  4HX4 A;  3W6K B;  4GYG A;  3JTH A;  1HKT A;  3RPU A;  1OKR A;  1YFH A;  4O5V A;  2RDP A;  3ZMS A;  3H92 A;  4L9J A;  2FF4 A;  1IRG A;  4ESB A;  4RAZ A;  4DNC A;  1IW7 F;  2KJC A;  4Q47 A;  3RKY A;  2QEN A;  4ASN A;  1Z6R A;  1SFE A;  2A6H F;  5LRR A;  3TO7 A;  1U8R A;  2D1V A;  1BI1 A;  2GQQ A;  3LST A;  3SFZ A;  1IZ1 A;  1G3T A;  2YX7 A;  4ZYE A;  1YG2 A;  5LEK A;  4HLY A;  2EA2 A;  3J7A O;  1EH8 A;  1U6G A;  2IVM A;  4OIN F;  3ML6 A;  4LLG F;  4IVN A;  3TDZ C;  3ULQ B;  1MDM A;  4G6D A;  3WOD F;  4CGZ A;  5ED4 A;  1J7K A;  5HLI A;  3V8L A;  1QO0 D;  5E17 F;  3R60 A;  2FBH A;  4LMY A;  3I54 A;  1Z7U A;  2FA5 A;  1ZLJ A;  2ZNZ A;  4U88 A;  1R1T A;  1W7P B;  3R0A A;  4AD9 A;  1ZAO A;  2HYF A;  4A0Z A;  3FM5 A;  1XCV A;  3DXJ F;  4M9Z A;  1LDD A;  2VBW A;  4ESF A;  3FX3 A;  4LLN A;  3K9T A;  4EJV A;  1XDS A;  1HW1 A;  1Q1H A;  3F72 A;  3J81 K;  3WTW C;  1OR7 A;  1RIO H;  1LJ9 A;  1S29 A;  2P5K A;  4L9V A;  1X3U A;  4WXH A;  1V4R A;  3EYI A;  1YIO A;  5E1X A;  4MEX F;  1BI3 A;  2QVO A;  1YS6 A;  5ERI A;  3KEO A;  1J9I A;  2ISY A;  1XN7 A;  3CJN A;  4P9F A;  1WI9 A;  4G7O F;  1FPQ A;  1F1Z A;  5D4S A;  2M87 A;  3K1M A;  3WE2 A;  4HQM A;  4YIF A;  1LQ1 A;  4IRH A;  2LKP A;  2HKX A;  4ON0 A;  3REO A;  3QU6 A;  1P6R A;  1J0R A;  1G3S A;  1RUN A;  1S8N A;  4HYE A;  5ICE A;  1PP7 U;  4UV8 A;  3K1N A;  2UWM A;  3G73 A;  2QQA A;  4Q48 A;  3IL2 A;  2GZW A;  1KYW A;  4ZZD A;  4UV9 A;  3M1E A;  4MQV A;  3GW2 A;  1DPR A;  1YYV A;  4GXO A;  3R61 A;  5ICF A;  2QQB A;  4M6Y A;  5K5O A;  1FYK A;  3F23 A;  2CFX A;  3Q9V A;  4OIP F;  1P92 A;  2WV0 A;  1R7J A;  3VOE A;  3GYH X;  2W57 A;  4XSZ F;  2EFQ A;  3SQN A;  4HF0 A;  1B6A A;  2NYX A;  4U0V A;  1TQP A;  2IA2 A;  5DD8 A;  3FHZ A;  3FXU A;  1FNN A;  1K78 B;  2PJP A;  2HQN A;  3BRO A;  1BI0 A;  4Y13 A;  5LHI A;  3G3Z A;  1I1S A;  4BHC A;  2VT2 A;  1LDK B;  3ELK A;  4L5J A;  1HQC A;  3FMR A;  5ICG A;  1H9G A;  2BBY A;  3ZMZ A;  2FNA A;  3O2P E;  3O3K A;  3N97 A;  3BPV A;  1SFU A;  1XGO A;  3QP6 A;  3W6J B;  3I58 A;  1G6N A;  5LHH A;  2YSR A;  2OU2 A;  1DPU A;  3C7J A;  2F5E A;  4WF2 A;  3DKW A;  5FB2 A;  2V6C A;  5EEH A;  4QLC U;  2ZXJ A;  4NB5 A;  5D4R A;  1D5V A;  3LA3 A;  3WGG A;  2A68 F;  5JI6 A;  4XLP F;  2W85 A;  4A2U A;  1J2X A;  2HWV A;  1R58 A;  3MZY A;  4I01 A;  3T0Y A;  1PUE E;  3V7C A;  1QZY A;  3KET A;  4AVP A;  2FE3 A;  2E1N A;  4KFC A;  4LB6 B;  4L0Y B;  3NRV A;  3I59 B;  1E17 A;  2PMH A;  2VBX A;  3GUD A;  4A6E A;  1UHW A;  4FT8 A;  2VC1 A;  3M8E A;  5DD4 A;  3I64 A;  1EH6 A;  3RJP A;  4ENM A;  1MGT A;  1XMK A;  3SHF A;  1F5T A;  3ECH A;  3I4P A;  3M9A A;  3F8B A;  3PQJ A;  1BM9 A;  2A69 F;  1RI7 A;  1L3L A;  1T39 A;  1FBQ A;  1IAW A;  3I53 A;  2QZ8 A;  4RGX A;  3MZH A;  2PLY A;  2F5D A;  2DLL A;  5CLS A;  2FBK A;  1GXP A;  4JBA A;  1FX7 A;  4BHB A;  4CXF A;  3KCC A;  3C18 A;  1ZLK A;  4RGS A;  1FBU A;  5E8G A;  5J8F A;  5TJJ A;  2FU4 A;  3L2C A;  4TV7 A;  2CW0 F;  1RZ4 A;  1J75 A;  3GXO A;  4EMS A;  2DQR A;  4LG0 B;  4L0Z B;  1P4X A;  3CUQ A;  4M74 A;  5JHU A;  1IXS B;  4RB3 C;  2JPB A;  2P8T A;  2MH9 A;  1BJA A;  2COM A;  3K0L A;  4BH9 A;  2ZCW A;  3ABU A;  3HYI A;  1ON1 A;  3WTX C;  1SD5 A;  3BJO A;  1ZYR F;  3GVA A;  3TO6 A;  2CYY A;  2QUF A;  1ZGJ A;  3I5U A;  5HLG A;  1ZHF A;  2A61 A;  3ERE D;  1WRJ A;  5DUK A;  2VE8 A;  1T6S A;  2HS5 A;  1FLI A;  4U7B A;  1UCR A;  4A0Y A;  5J6X A;  3F6V A;  2ETH A;  4O6J A;  1O3S A;  2H6C A;  1YS7 A;  3I0T A;  3H3U A;  4GCV A;  5BS6 A;  2CQK A;  5K1Y A;  1SD6 A;  4UUV A;  2H6B A;  5DCF A;  2O61 A;  2EWN A;  2BE5 F;  2GIV A;  3GFL A;  3L00 A;  5ILU A;  3Q5F A;  1IUY A;  5FFZ A;  2XV4 S;  3R4K A;  4M9S A;  3ZQ7 A;  1MKM A;  1QPM A;  4PZJ A;  1HW5 A;  4Y17 A;  3EUH A;  2XUB A;  4CYD A;  2E7X A;  4EM0 B;  2X4H A;  2D1H A;  5LGT A;  4A5M A;  3EYY A;  1KQ9 A;  4KUM A;  4A6D A;  5DCM B;  2V1U A;  2M8E A;  3JSO A;  4RAY A;  2DW4 A;  2O03 A;  5F1R A;  1S7A A;  5IT9 Z;  4ENN A;  3TQN A;  3KP7 A;  2BEO A;  2GWR A;  2RC4 A;  2NNY A;  2HEO A;  4AWX B;  4ETS A;  3K1P A;  2B0L A;  1WKM A;  3IRR A;  3L7W A;  2ISZ A;  1B1B A;  2XKP A;  5FD5 A;  2GAU A;  3F8M A;  3QPT A;  5HVQ C;  3KLO A;  5AIP A;  3P9I A;  4P96 A;  5F6F A;  5H6Q A;  2IA0 A;  1WSU A;  3SZT A;  1R23 A;  4IHT A;  2UZK A;  3DV8 A;  1DDN A;  1XSV A;  4K2E A;  1RNL A;  2H27 A;  1TBX A;  4KN4 X;  1IXC A;  4OU0 A;  4Q4Z F;  1F4K A;  5D8L B;  2VE9 A;  2XRN A;  2ZNY A;  1R1U A;  5L3B A;  3CDH A;  2VOD A;  5A2Q Z;  2OBP A;  1SMT A;  4AIK A;  4OIO F;  2L4M A;  5HS7 A;  2K4B A;  5IT9 K;  3JW4 A;  2K02 A;  3DEU A;  2HZT A;  1SAX A;  2OD5 A;  4OMZ A;  2PI0 A;  2EFW A;  3TDU C;  1VTN C;  2FNP A;  3N4M A;  3LQQ A;  2G9W A;  4EM1 A;  3BZ6 A;  1W7P D;  1OYW A;  1OYI A;  5D8K B;  3DPT A;  3C3W A;  3LQR A;  3F22 A;  5HOO A;  2ESN A;  2P7V B;  4B8X A;  1I5Z A;  1ZAR A;  2P6T A;  3B02 A;  1EH7 A;  3KE2 A;  2LDU A;  4PCQ A;  2DK8 A;  1KA8 A;  2AS5 F;  2KRF A;  2OQG A;  5BPD A;  1IN6 A;  1S7O A;  1IN7 A;  2PEX A;  5D5V B;  2F5C A;  1FZP B;  1MD0 A;  1R5H A;  3CO6 C;  3KEQ A;  5FO5 A;  2KJB A;  1XSD A;  4EV0 A;  4PGG A;  1YW9 A;  5JVT A;  4CHU A;  3GO5 A;  2VOP A;  2QM3 A;  2G7U A;  2L01 A;  5FFX A;  2QWW A;  4EJT A;  1K78 A;  4EGZ A;  4L9N A;  5CVR A;  1ZN2 A;  3V7R A;  2Y0M A;  2QBY A;  1BN5 A;  2XIG A;  1LB2 A;  1TW3 A;  2EB7 A;  1MJ9 A;  3CUO A;  3HSE A;  1Z91 A;  5E18 F;  1W7P A;  4LD5 A;  5DEQ A;  1BI2 A;  5CYV A;  4MHG A;  3KP2 A;  1XDU A;  3I71 A;  1XB4 A;  1RUO A;  2XAJ A;  1I27 A;  3ZMT A;  3SXY A;  3ROU A;  1B9M A;  1FYL A;  4ZYG A;  4RGR A;  2BV6 A;  5LGN A;  5K5Q A;  5HDK A;  4I02 A;  4JK1 X;  1H0M A;  2DT5 A;  2ZFW A;  5HLH A;  1BC7 C;  1KYZ A;  1W5T A;  1FBS A;  2HTJ A;  2V1D A;  5BPI A;  1XGN A;  3RIR A;  2XAQ A;  2STW A;  1NHA A;  1FSE A;  3TKY A;  2MD5 A;  3QOP A;  1O3Q A;  4EQQ A;  2ZJ2 A;  3HTS B;  2Q0O A;  3IWF A;  1BIB A;  3F8F A;  2L3D A;  3HTU A;  1T2K A;  2O0Y A;  1DP7 P;  1LDJ A;  1HBX G;  1L0O C;  3WE3 A;  4P55 A;  4LG0 A;  4L18 B;  3V7S A;  1T38 A;  2M30 A;  3E5Q A;  3I59 A;  3HSR A;  3CUQ C;  3GEZ A;  4ENK A;  3T8R A;  4I7H A;  1IRF A;  2RV8 A;  1FP1 D;  1OYY A;  4G9Y A;  2C6Y A;  1MJA A;  2VXZ A;  1YW8 A;  4M71 A;  2ACJ A;  2XHK A;  4YII A;  2NS0 A;  1GXQ A;  4WK8 F;  2EK5 A;  4JQF A;  1LEB A;  1BOA A;  1USS A;  3EQL F;  2XAH A;  5DUI A;  5FLX K;  5DDG A;  4I0B A;  3Q9S A;  4UXN A;  2MLK A;  1P4W A;  3IWZ A;  3C1D A;  3WG9 A;  4CZZ A;  3DF8 A;  3ZP5 A;  3S2W A;  3HHH A;  1AOY A;  3KLN A;  5LHG A;  4I2O A;  3ZMD A;  2AXL A;  4KIG A;  3AAF A;  4GYI A;  1KQ0 A;  4EGY A;  3HRT A;  2NAZ A;  1YO5 C;  3ZPL A;  3ECO A;  4BXU A;  3V8K A;  4LJZ F;  1R22 A;  2FSW A;  4LLL A;  2L54 A;  3L09 A;  1KU3 A;  2J5O A;  1FWZ A;  4FHT A;  4HAM A;  1FC3 A;  3BDD A;  4KIF A;  2BGC A;  2A6E F;  1U2W A;  1ZG5 A;  2J5P A;  4KNY A;  2H09 A;  1IXR C;  2A3S A;  3BP8 A;  5CVI A;  1Y0U A;  2Z5U A;  2DO7 A;  2RGV A;  4NQW A;  1U78 A;  2IA1 A;  2P6S A;  2ZO4 A;  4G6Q A;  3IC7 A;  2IRF G;  5KVR A;  1T0F A;  4EJO A;  3E6C C;  2LSO A;  4YFK F;  2XAS A;  2P5L C;  2JZY A;  1R00 A;  1XCB A;  1SFX A;  4HX8 A;  5D5U B;  4U7D A;  4E70 A;  4A5N A;  3GFM A;  3E6D A;  5ICC A;  4HBL A;  3P7N A;  2R7D A;  2EFO A;  2DFI A;  2MA3 A;  4A0X A;  2LF7 A;  4KMF A;  1YLF A;  1QNT A;  3RPQ A;  1SD7 A;  1LNW A;  2HKO A;  1KU2 A;  2QQ9 A;  2P5V A;  4N9I A;  3CO7 C;  1REP C;  3WU0 A;  5ILV A;  4L5I A;  4HA8 A;  1R5G A;  3DQV C;  5DV5 A;  1H9T A;  5D5X B;  1JE8 A;  2CWE A;  2FXA A;  1ZRD A;  4XLN F;  3FXQ A;  4UVB A;  3JSP A;  2STT A;  2OAZ A;  4OIQ F;  4KN7 X;  3IHU A;  2K7L A;  2WWY A;  2Q2E A;  3T8T A;  3F21 A;  3LA2 A;  3K2Z A;  5L3F A;  2VBY A;  4PGH A;  3P9C A;  2WC2 A;  3B73 A;  1YW7 A;  1LEA A;  2FOK A;  3CTA A;  2Z9O A;  1TNT A;  5E8I A;  1TLH B;  3DP7 A;  1B9N A;  4R8H A;  2PFB A;  2OQR A;  3FF5 A;  3ZMV A;  4PDK A;  1O7L A;  3F6O A;  4I0A A;  4KIC A;  3KP5 A;  4MNU A;  1K79 A;  1F9N A;  4KT5 C;  4S04 A;  2RVC A;  5K5R A;  4Z2Y A;  2K4J A;  2JPC A;  1W5S A;  4IHS A;  2PQ8 A;  1XSX A;  3E6B A;  2X0L A;  1TQI A;  3LAJ A;  4BNC A;  3M7G A;  4HX7 A;  4HF1 A;  3KZZ A;  2W24 A;  3MFK A;  2RKH A;  2UXN A;  3HHG A;  2FEZ A;  3E97 A;  4N9H A;  3E5X A;  4CDG A;  3GLX A;  2HFH A;  2ZME B;  3H3Z A;  1B4A A;  2NRA C;  2P7C B;  1UST A;  2W25 A;  1FSH A;  5E1Z B;  1QQI A;  2H94 A;  1FYM A;  3OV8 A;  4EJW A;  3GZ6 A;  1XMA A;  3BWG A;  1JGS A;  3M8F A;  1TW2 A;  5L3G A;  3T1B A;  3BY6 A;  2VT3 A;  1QBJ A;  3DFG A;  4WWC A;  1IN5 A;  4AIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...