4G9YA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
136
structure length
136
Chain Sequence
THPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcaV transcriptional regulator
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 52
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g9yA00
1XSVA 4HLXA 5H6RA 1OYYA 5D4SA 4I0AA 1XGOA 1JE8A 4L9VA 4O5VA 5D6FA 3VFZA 4WWCA 1S7AA 2OZUA 2RN7A 5LRRA 2DW4A 3WU1B 4KNYA 2M30A 3P9KA 2STTA 3WTXC 3MZYA 4QWQA 2K86A 4O6JA 1FWZA 3F8BA 4G6DA 3FMQA 2FNPA 5DYMA 1YS6A 2EFWA 1YS7A 4IJAA 5BQTA 3EUHA 1BC7C 2QLZA 3QP6A 4G6QA 3VOEA 3HRMA 2L02A 1QZYA 3WTWC 3DQVC 2H6CA 2W85A 3P7NA 3GFMA 4KICA 2BGCA 4I7HA 2IP2A 3RTRA 3Q5FA 4OIQF 3V7SA 3OV8A 1DUXC 3BJAA 3V7CA 1ZH5A 3ISPA 1ZGJA 2XV4S 2A3SA 2PG4A 2XROA 1MDMA 4A5MA 4MQ9F 3N97A 1OPCA 2BYVE 4LK1F 3JSOA 1PUEE 3HSRA 3V8KA 2LDUA 1HKSA 1D3YA 2Z99A 2Q8KA 1H9TA 1G3TA 2EB7A 2H6BA 1R58A 3E97A 4XLPF 4OOIA 5HDKA 2WWYA 1WI9A 5E17F 2WTEA 4JBAA 2Y75A 1BI3A 2XKOA 1CGPA 1O3RA 5BOXA 3I64A 2XIGA 2DBBA 3HYIA 3FXQA 4PDKA 1KQ0A 2ESHA 2A68F 1ON2A 3JSPA 4NQWA 1JHHA 1IRGA 1LJ9A 1BI0A 2MA3A 4E70A 5AIQA 2VOOA 4LGWA 1SFEA 1MJ9A 4MEYF 5J8FA 4KIFA 2IJLA 1Y0UA 5EEHA 5D5WB 2UXNA 5FD5A 4EJOA 5BPDA 2K4BA 1F9NA 3DXJF 4A2UA 5DD8A 2FRHA 2GXBA 2ZFWA 3IKVA 1V3FA 3HTUA 5JVTA 4OMYA 1R22A 1KU7A 5DCMA 4TV7A 2W24A 1ZHFA 3E6BA 3LAJA 3LWFA 2P5KA 4ZYEA 4MNUA 1YW9A 4BQAA 1ULYA 3ZP5A 4G7HF 5D8LB 1WRJA 3GO5A 2FMLA 3ERED 1BIAA 2E7XA 4L9NA 2AXLA 5HS8A 3ELKA 2ZMEA 3TKYA 2V1UA 4KYWA 3BY6A 3F6OA 2L01A 5JFRA 1TW3A 4ESBA 4YFXF 1U78A 2V1DA 2E1CA 2PBIA 1BI1A 4L0ZB 4BHBA 2ELHA 1U5TC 4KIGA 3MQ0A 5HOOA 4LB6B 5LHGA 3EYIA 1MDMB 4JK1X 4I09A 1B9MA 1R5HA 2FE3A 4ZYHA 4WXHA 1IN7A 2P5LC 2E7WA 3E6MA 4RGRA 4M9ZA 4ENKA 4EJUA 1O57A 2DTRA 1I27A 4RB0A 3WTZA 5LEKA 2IA2A 5J6XA 2FBKA 2VN2A 1ZG3A 3E6CC 4DQ2A 1FSHA 1USTA 4HA8A 3HSEA 2KKOA 1EV7A 1K79A 2GAUA 3K9TA 1R1VA 1Z1DA 4U0WA 4I98B 3GVAA 2PMUA 1FP2A 1P4XA 3REOA 2RVCA 2WC2A 3F3XA 1BOAA 2K02A 2UXXA 1IN8A 2EFQA 4GCVA 1R23A 1XGNA 3D5LA 3ABUA 1QBJA 2P7VB 1U5TA 5FO5A 3JAMK 3MZHA 2IT0A 3BOQA 2IVMA 1LQ1A 1G3WA 4PCQA 3KP2A 4AIKA 5FLXK 4EGYA 1ZG1A 3DPLC 1B9NA 2HKOA 3BJ6A 4Q48A 2QWWA 3SXYA 4P96A 1LEAA 3JW4A 1DPRA 2VE8A 4M71A 3M9AA 1P92A 2FXAA 2FEZA 2H09A 3QPHA 3KETA 4P9FA 4ZZDA 3E3VA 2NNYA 3D0SA 4BH9A 1S29A 2VODA 1U3EM 3GUDA 2CSOA 2A69F 1ZRCA 5LBQA 5K5QA 4MEXF 2DI3A 3QOPA 2D1VA 1QQIA 1XB4A 1P2FA 3U1DA 4HW0A 4RB3C 1Z6RA 4RGSA 5F1RA 3VEPA 2ZMEB 1VTNC 4WF2A 4UNOA 5D4RA 4ETSA 5A2QZ 3PQJA 1QZZA 2PLYA 5F64A 1HKQA 1J7KA 1MZBA 1J2XA 2L4MA 4HV6A 3GXOA 2FOKA 5CVRA 2MBFA 3BPVA 4D0PA 3RYPA 4Q47A 2DK5A 2AS5F 2VBZA 3IHUA 4ESFA 5ILVA 1XGMA 1AWCA 5JHUA 4KN7X 4HBLA 3HIFA 2M5WA 4P9UA 1IF1A 3CTAA 2FBIA 2O0YA 4KUMA 1WSUA 3LA2A 3EYYA 1K7AA 2NRAC 1LNWA 5CYVA 4R8HA 1ZN2A 4OIOF 1KQ8A 4BYYA 5FFZA 3KEOA 4AWXB 4EV0A 2XHKA 2JZYA 5E1WA 5IT3A 3I71A 3V8JA 3HOTA 5LGNA 2JPCA 1J0RA 1FBUA 3F8NA 2XRNA 5AIPA 2STWA 1UFMA 5L3BA 2LKPA 5CLSA 3BPXA 1GXPA 4G9YA 3ULQB 3G3ZA 3IRRA 4CDGA 4ENNA 3GLXA 1O3TA 1D8KA 1U5TB 5LRSA 1A04A 2HEOA 3QU3A 2KJCA 2Y48A 4HX4A 5ICGA 5CVIA 3T1BA 4EGZA 3J81K 4IRHA 1LEBA 1B59A 1RIOH 2UWMA 3V7RA 1LDKB 4L9JA 4MGRA 4EJVA 4NHJA 2YX4A 4FHTA 1TTYA 1YW7A 3HUGA 5J8CA 3RKWA 2HYFA 1HQCA 1MJAA 3B02A 3O6BB 2TDXA 4N9IA 3IL2A 5FFXA 1SD4A 1YO5C 2ACJA 1J59A 3M1EA 4L18B 5BS6A 5ICFA 3RIRA 1K6OA 5HVQC 3JTHA 2PEXA 3P9CA 3MFKA 1REPC 1U2WA 4M6YA 3O2PE 4GGGA 3I59B 3F21A 3TOBA 2J5PA 1YW8A 4HLYA 5LGTA 2VXZA 2PJPA 2HDCA 1LDJA 2QUFA 2QQBA 2ZBKA 1TBXA 4KMUX 2MD5A 4M9XA 2ESNA 1RNLA 2BEOA 1S3JA 3HHHA 4KIBA 2YSRA 1I6XA 1UCRA 3MEXA 1W7PD 4LFUA 2CYYA 1FBQA 5IT9K 1LDDA 3L2CA 1QO0D 4RGXA 1LVAA 2Q0OA 2O6GE 1FC3A 3E6DA 2DPDA 4GXOA 4R79A 3SZPA 1ZAOA 1J9IA 2RC4A 5DEQA 2PN6A 3LFKA 4LG0A 2V79A 2VONA 4U0VA 1FYMA 2YR2A 4UHTA 1FOKA 5L3CA 4YFKF 1K78A 1P6RA 2LSOA 1OKRA 5LLQA 3K1MA 4IXAA 2H94A 3RJPA 2F2EA 3R60A 1XCVA 3J80K 2BV6A 2OAZA 1T6SA 2DQRA 3F22A 3T0YA 2EJRA 4M74A 2KRFA 2DLLA 2QENA 2J5OA 3FXRA 1YYVA 2HTJA 2QQAA 1G6NA 3R0JA 4PGGA 3DPTA 4A5NA 4M72A 3GW2A 2QBYB 2HTSA 4MTEA 2ZO4A 1RUNA 2OBPA 3LA7A 5H6QA 2XAHA 5D8KB 1XDUA 1B1BA 1IUYA 4XRFA 1T2KA 4HX8A 4CXFA 2EFOA 4G7OF 3TGNA 1X3UA 4LK0F 2GA2A 3KP3A 3WGGA 2A07F 5FGMA 4EVIA 2A5YB 3MWMA 3R4KA 4HV5A 4L5IA 1ODDA 2QQ9A 3BROA 2HFHA 5DUIA 4HAMA 3DKWA 2HS5A 4I2OA 2HQRA 4HQEA 3R6SA 1H9GA 4N9HA 4BNCA 3V8LA 1PP7U 2PQ8A 4LJZF 3HRTA 3TDZC 3WGHA 5D5VB 2EA2A 4AVPA 1BI2A 2COMA 4G7ZF 1PDNC 3C1DA 2F5CA 3QPTA 1W5SA 4OU0A 2P6SA 1XDSA 2QYOA 4AIJA 4PZJA 3I0TA 3WODF 2M8EA 2GA1A 3ZPLA 1R1UA 5ILUA 1KU9A 2PMHA 1Z05A 4F7ZA 3E5UA 4NB5A 4ESJA 4ON0A 3RPUA 3HHGA 1W5TA 1YQAA 2IPQX 1W7PA 3RPQA 4LG0B 2GIVA 2R3SA 2MLGA 1TQIA 1KQ9A 5HS9A 1K78B 4UXNA 4A0XA 2VE9A 4I0BA 2GXGA 3Q9VA 3KZYA 3I4PA 2NNNA 1XSDA 3KCCA 5AONA 3GX4X 3FZVA 4BHCA 2M1BA 5HDNA 4EM1A 2KJBA 1F5TA 1FP1D 1IXCA 1P4AA 2L3DA 1IN6A 5EEGA 3PFIA 1S8NA 3E5QA 4FX0A 4R1HA 3ZMVA 1SD5A 2XKPA 1FY7A 1XD7A 1CF7A 1FBSA 2A6HF 1FNNA 3CUQC 4EM2A 1ZRFA 4U7DA 2E1NA 5ED4A 3SFZA 2XAQA 2VT3A 4IHTA 2BE5F 2IA0A 1HW5A 2EFPA 2MC3A 1YTYA 4RB2C 4UV9A 4LD5A 2R7FA 3K2ZA 3C3WA 2ZJ2A 1OYWA 1OR7A 1I5ZA 1L0OC 1TQPA 2O8XA 4Y17A 3GF2A 3KP7A 3IWZA 1IRFA 3DFGA 2FNAA 2RNJA 3BDDA 3I59A 1DP7P 2FA5A 4KN4X 4S04A 4RS8A 1NHAA 3F72A 2HOEA 3T8TA 1S6LA 3LQRA 4H0EA 2CGPA 3LAPA 5E8GA 2Q2EA 5JI6A 1G3YA 2IA1A 3HRSA 3JAMZ 2O61A 3PQKA 1O3QA 3WG9A 1U8RA 3CUQA 1SMYF 2K7LA 2VT2A 2HYGD 4OIPF 5FLXZ 3C7JA 1YLFA 3CDHA 5E20A 2EV6A 2OQGA 1RZ4A 4GYIA 1W7PB 1R7JA 3FMSA 4HF2A 2EV5A 3ZN1A 4L9TA 1P4WA 5K1YA 4CYDA 3BZ6A 4Z2YA 4K2EA 3TQNA 4BXUA 1MKMA 1O7LA 3CO7C 4B8XA 3DEUA 4XSZF 3MCZA 4S05A 2DFIA 1DPUA 5DV5A 3IWFA 3LSTA 3KFWX 4RB1A 2LF8A 3I58A 2OD5A 5K5RA 1IAWA 3BWGA 2XAGA 1WKMA 5CVUA 1XCBA 3WTUC 5CJ9A 1IXSB 3NRVA 2V6CA 3KLNA 4U88A 3L00A 2QVOA 3T8RA 2EWNA 3FMRA 2VBWA 1J75A 2H27A 3SHFA 4OMZA 5TJJA 3NEUA 4MQVA 4KT5C 1LB2A 1JXSA 1Z91A 4PGHA 3SQNA 3TO7A 2QBYA 4AD9A 4UUVA 2RGVA 1TNTA 2CG4A 1IN4A 1BIBA 1TW2A 3WTSC 1OMIA 5L3DA 1CF7B 2NYXA 1FX7A 2OZ6A 2HQNA 2YX7A 1T39A 5H20A 1IW7F 2M87A 2M45A 2CQKA 3ZMDA 2RV8A 1YFHA 3EQLF 3R61A 3GFLA 4A12A 5BPIA 1L3LA 4A0ZA 3TO6A 4RGUA 2GWRA 1HW2A 1AOYA 4P55A 3FX3A 1HBXG 2ISZA 1TLHB 3ZMUA 1SFUA 1KYZA 3U2RA 2G7HA 1F1ZA 5HLGA 4JQFA 3SZTA 2C6YA 1JGSA 3WTTC 1HSTA 3ZMTA 2LF7A 2K4JA 3GFJA 5HLHA 3ZMSA 3RKYA 3R0AA 2PI0A 1EH8A 1QGPA 3QP5A 4CO8A 4HDUA 1BJAA 3CUQB 2D45A 3AAFA 4WX9A 2O3FA 5ICCA 1I1GA 1R00A 2XUBA 3J81Z 3TDUC 2P6TA 1STZA 3W6JB 2GZWA 2L54A 1YG2A 1R1TA 2XVCA 2A61A 5FB2A 3HTSB 3IKTA 1T38A 1ZG5A 2FQ3A 1MJBA 4ZH4F 2XAFA 1FYLA 1EH6A 2VBYA 3CLOA 1XMKA 5HDGA 4U0YA 2UZKA 1XN7A 5KVRA 3L7WA 3IC7A 2JTVA 2EFNA 4U7BA 3K1PA 1ONVA 5L3GA 4KA4A 1RI7A 5CVJA 2D1HA 1IN5A 4CICA 3U9GA 2G7UA 1BN5A 1KYWA 1ZGAA 1GVJA 3F8CA 4I01A 2HGCA 4HX7A 1FYKA 2FMYA 4HDVA 4B09A 3FHZA 3ZMZA 2Z33A 4YFNF 2RDPA 3FWEA 3TOAA 3O3KA 1D5VA 2DQLA 4UV8A 3KP5A 2V1XA 1ZARA 1SD6A 4EQQA 3LQQA 4IRGA 4XLNF 1SMTA 3ECOA 3NQOA 1WQ2A 2JT1A 5TRDA 4MHGA 2X4HA 1HW1A 4KMFA 4XBFA 2Z5UA 3ECHA 4ENJA 4Q4ZF 1IZ1A 2XAJA 3VODA 3V4GA 2L4AA 2FSWA 2MLKA 4IVNA 2MH2A 2ZNZA 4AIHA 3BP8A 5IT9Z 1SAXA 4A0YA 1GXQA 2PFBA 5FD6A 2HKXA 5F6FA 3ZQ7A 3HRUA 4LMYA 2DK8A 3GYHX 3VB2A 2V9VA 3CUOA 2EV0A 3EDPA 3FXUA 3FM5A 4CGZA 2HR3A 1BBYA 4L5JA 2CFXA 5E8IA 1IXRC 3S2WA 1SD7A 2JPBA 3M7GA 2OU2A 1KU2A 2Y0MA 3F8MA 4LB5A 1HKTA 2NAZA 4N0BA 2FBHA 3N4MA 2IRFG 1YIOA 3J80Z 3I53A 1KGSA 1G4DA 4EMSA 4QLCU 4WXDA 4WXCA 1W4MA 2DPUA 3F6VA 5ICEA 4Q5SF 5L3EA 3W6KB 5DD4A 4HZFA 1V4RA 4YIIA 3ZN0A 4KFCA 1MD0A 1XMAA 4BAYA 1UB9A 3K69A 3B73A 3DV8A 4YIFA 1B4AA 1F4KA 5HS7A 5D5XB 4ENMA 2W57A 1SFXA 3KP6A 3L09A 1HSJA 4HF0A 3BJOA 3WE2A 4EM0B 3F8FA 5D6EA 3COAC 4GO1A 4I02A 1QPMA 1E17A 3WE3A 1O3SA 1FLIA 4WCGA 1WWXA 1XGSA 4EJWA 4A6DA 2YPRA 3KLOA 4P5OA 3F23A 3I54A 4LLLA 5ILSA 1B6AA 2VBXA 4ZYDA 4XSXF 4IHSA 2X0LA 4RAZA 5A2QK 3QAHA 4KDPA 2CWEA 1ZRDA 4UVCA 3KP4A 4ZYGA 3ML6A 2OQRA 3WGIA 3EETA 5LHIA 3TO9A 5KK1A 2F5EA 1FZPB 6PAXA 5HLIA 4MTDA 4IPAA 4UVBA 2DU9A 1ZLJA 3H92A 5D5UB 1JHFA 1UHMA 2KIMA 5E18F 4OINF 2FF4A 2VC0A 1FPQA 5BMZA 3MAJA 3K0LA 2VC1A 2W84A 2GQQA 3H3UA 2ZXJA 3QRFF 5E1XA 3DF8A 2Z3YA 3FM3A 1H0MA 3LA3A 3KEQA 2Z9OA 1KU3A 1USSA 3T5XA 3I5UA 2HWVA 4ASNA 4GYGA 4UVAA 4O3MA 4G94A 1I1SA 2KIUA 4Y15A 3G73A 4HYEA 3KE2A 3HOSA 3FF5A 1S7OA 5DCMB 1FT9A 5DUKA 4BHPA 2BBYA 3J7AO 2DAOA 4LLNA 2A6EF 5CVVA 4LLGF 1Q1HA 2D2WA 5LHHA 2WV0A 1Z7UA 2FU4A 1C0WA 2CO5A 5DCFA 3QU6A 1QNTA 3GZ6A 1BC8C 2IW5A 3Q9SA 5K5OA 2XGXA 3RI4A 1ZLKA 5LGUA 4IF4A 2W25A 4OIRF 3RDIA 4EJTA 2ZKZA 1ZREA 3WTYC 4M6XA 2R7DA 2P5VA 1FSEA 2ZCWA 4HQMA 4DNCA 2OA4A 2RKHA 4IRIA 4M9SA 2ISYA 2DO7A 4WK8F 1BM9A 5L3FA 5ERIA 3P9IA 3H3ZA 3CO6C 2ZNYA 3DP7A 2JSCA 5E1ZB 5JR3A 2HZTA 2YU3A 2ETHA 1G3SA 2F5DA 3KZZA 3GEZA 3HSFA 4HOBA 4FX4A 2MH9A 2CW0F 3GZ5A 2ADUA 1ON1A 2KIFA 1XSXA 1T98A 3C18A 3K1NA 1MGTA 4YG2F 2P8TA 1EH7A 1DDNA 2QZ8A 4FT8A 2O03A 3JTGA 3GWZA 1D8JA 1Z6TA 1Z9CA 4A6EA 4CHUA 3IRQA 1KA8A 1ZYRF 2RQPA 2NS0A 1TQMA 4HF1A 1O7FA 2P7CB 2G9WA 1PP8F 2EK5A 3L9FA 1OYIA 2LNBA 3M8FA 3WU0A 4RAYA 1R36A 1R5GA 2F5FA 2P4WA 4ZZLA 2QM3A 4L0YB 2VOPA 5LEJA 3M8EA 1HXDA 2DT5A 3ABTA 2B0LA 3WTVC 1J5YA 3RKXA 3E5XA 1T0FA 1U6GA 3CJNA 2JRTA 4G8XA 5DDGA 4CZZA 1TNSA 3RYRA 4Y13A 2K27A 1GHCA 1E2XA 3GFIA 2EA4A 1RUOA 1UHWA 3OOPA 3ROUA 4M73A 2XASA
chains in the Genus database with same CATH superfamily
1XSVA 4A3CJ 4HLXA 2R7XA 3HEFA 1ZKGA 5H6RA 1OYYA 5D4SA 4I0AA 1HDPA 1XGOA 3CCYA 1JE8A 3B6AA 3LSGA 4L9VA 4O5VA 5D6FA 5B1AH 3VFZA 4WWCA 2Y9ZA 1S7AA 2OZUA 2RN7A 2DA4A 5LRRA 1NG6A 2KIQA 2DW4A 3DKYA 3WU1B 4KNYA 2KLOA 3U1KA 3AL0C 5K7ZA 2M30A 2HDWA 3P9KA 2ID6A 3S14J 2STTA 3WTXC 3B6CA 1LKXA 3MZYA 4QWQA 1TC3C 2K86A 3AG4H 3ESWB 4O6JA 3H3VK 4XKCA 2X85A 1FWZA 2Q1ZB 3F8BA 4G6DA 3FMQA 3O8HA 4JX6A 2FNPA 5DYMA 1YS6A 3NWTA 1YS7A 4HG2A 3HXLA 3EUHA 4IJAA 4MLOA 5BQTA 4RLFA 4C2MJ 1BC7C 2QLZA 3QP6A 4G6QA 3VOEA 3HRMA 2L02A 4P1WA 1S7EA 1QZYA 3A4CA 4Z6YA 3WTWC 3DQVC 2H6CA 2DFHA 5F27A 5EZGA 2W85A 3DLAA 3P7NA 4OAYA 3GFMA 1BW5A 2OUMA 4RM3A 1Y1WJ 2ZB9A 4KICA 2BGCA 4I7HA 4F55A 2IP2A 2E71A 4XR6A 2VB6A 1LE8B 1GV5A 1PUFA 3RTRA 3Q5FA 4OIQF 3BTIA 3V7SA 3OV8A 1A6IA 2L9RA 3PM1A 2HVSA 1DUXC 2MSYA 1GLNA 3BJAA 1Y8RB 2MD0A 3V7CA 4BXXJ 1ZH5A 2DYRH 4G6TB 2MFZA 3A01B 3ISPA 2JWTA 1ZGJA 3QYFA 1TP4A 1WJCA 2XV4S 2A3SA 3ZOBA 2PG4A 1R4NB 2XROA 1MDMA 3S8PA 4A5MA 2Y69H 4MQ9F 1AKHA 1G2HA 2ELJA 1NK3P 2JA6J 3RQIA 3BR2A 3N97A 3I56I 1OPCA 5KCMA 2BYVE 4LK1F 4B47A 3JSOA 1PUEE 3HSRA 4FE7A 3V8KA 2LDUA 5DTDA 1HKSA 1D3YA 2Z99A 2Q8KA 1H9TA 1G3TA 2EB7A 2H6BA 1R58A 3A02A 3E97A 4XLPF 3W2WA 4OOIA 5HDKA 1JKRC 3SDGA 2WWYA 1WI9A 4BDYA 1MSEC 5E17F 2WTEA 4JBAA 4BJTA 2Y75A 2OC6A 3PO3J 1BI3A 2LRDA 2XKOA 1CGPA 2Y30A 1O3RA 5EGOB 5FRNA 3W3CA 3P5JA 5BOXA 5EJCA 3I64A 2XIGA 2DBBA 1QVUA 3HYIA 3FXQA 4PDKA 3FBNB 3LFUA 2P0WA 3BR5A 5H2FC 4XMYA 1JKPC 1DU6A 3JR9A 1KQ0A 3Q0VA 4M3DA 2DOAA 2ESHA 2ZMEC 4JP0A 3OY9A 5GTIC 2A68F 1ON2A 3JSPA 2DDBA 5HLTA 1CQTA 4W1UA 2ZJPF 4NQWA 4BKXA 3ZQFA 1JHHA 3LOCA 2EIJH 3S1RJ 1IRGA 1LJ9A 3WHBA 2GOXB 1BI0A 2LVSA 1JJ8C 2MA3A 2XPVA 4E70A 1RR8C 5AIQA 1PYVA 4NUBA 5GPAA 2Z1DA 3OYBA 1MMNA 2VOOA 4LGWA 1SFEA 1MJ9A 3HUGB 2LBFB 5E3MA 1RESA 2QF7A 4MEYF 4XOPA 1V54H 5J8FA 4KIFA 2IJLA 1Y0UA 5EEHA 5D5WB 2UXNA 3L2WA 5FD5A 4EJOA 3DTEA 4CCMA 3GTJJ 5BPDA 2CV2A 2K4BA 2LY9A 4J00A 1F9NA 3DXJF 4A2UA 5DD8A 2PJRA 2FRHA 1Z21A 2O7OA 2GXBA 2VIXA 2ZFWA 3IKVA 1V3FA 3HTUA 5JVTA 4OMYA 1R22A 2ECCA 1KU7A 5DCMA 4XKVA 3OL3A 4TV7A 2W24A 1ZHFA 3E6BA 3LAJA 3LWFA 2P5KA 1QA6A 4ZYEA 1ETOA 2Y9YA 4MNUA 1YW9A 3C2BA 4BQAA 2LLKA 5IP6A 3OS0A 5CQEA 2M4GA 1ULYA 2EILH 2UV1A 3ZP5A 4G7HF 3ZRGA 5D8LB 4NBQA 1WRJA 3GO5A 4MIMA 2FMLA 3ERED 2WY8Q 2HXIA 1BIAA 2E7XA 2CQ7A 4L9NA 2AXLA 5JHFA 1XTAA 2VKVA 3ELKA 5HS8A 5F0FA 5CPRB 2ZMEA 3TKYA 2V1UA 2LY1A 1K6YA 4KYWA 5F08A 3BY6A 3CCMI 3BQYA 3OYAA 3FK6A 2IGKA 3F6OA 1WGXA 2L01A 1A35A 5JFRA 2E5NA 1WJEA 5J4VA 2R7TA 4H4KC 4D5FA 1TW3A 4ESBA 5B66C 4YFXF 4XICA 1JTXA 1X3ZB 3S17J 1U78A 2V1DA 1F36A 4XK4A 2WAEA 2VLAA 2L2OA 2E1CA 2PBIA 1BI1A 3HZJA 4L0ZB 4BHBA 3VYUB 3OYCA 2ELHA 1U5TC 4I76A 4KIGA 3MQ0A 5HOOA 4LB6B 1IUFA 2OJED 5LHGA 3EYIA 2L9NA 3PNVA 1MDMB 1DQUA 4JK1X 3EUAA 4I09A 1B9MA 3VWBA 1R5HA 2FE3A 4ZYHA 2RAEA 1AKHB 2TRTA 1X1DA 4WXHA 1T08B 2R93J 1IN7A 2P5LC 2E7WA 3E6MA 3LSMA 4RGRA 1NH3A 3GTOJ 3LSRA 4M9ZA 4ENKA 4EJUA 2NVUB 1O57A 2DTRA 3A0HC 4G12A 3AL0B 1I27A 3CJQB 4RB0A 3WTZA 5LEKA 2RQQA 2DDAA 3F0CA 2IA2A 1MBEA 3S93A 1ACIA 2CS3A 5J6XA 2FBKA 4IX7A 2EZIA 2NVXJ 3S1QJ 2VN2A 1VZ0A 2N8GA 1ZG3A 3E6CC 4DQ2A 2LP0A 1FSHA 1USTA 4HA8A 3HC7A 1JGGA 3HSEA 1T56A 5C4XJ 2KKOA 2QQ8A 1EV7A 5FKOA 1K79A 2GAUA 3K9TA 1R1VA 2XF7A 2ZJRF 1Z1DA 4U0WA 4I98B 3X2QH 3HPGA 2L7FP 3GVAA 2PMUA 2DFEA 1FP2A 1P4XA 3REOA 4Y7NJ 3LMMA 2RVCA 4XQFA 1GV2A 3K4CA 2WC2A 3L2RA 3E7LA 3F3XA 1BOAA 2K02A 2UXXA 1IN8A 2M9HA 2DA5A 2EFQA 1HC8A 3QODA 4GCVA 1R23A 1XGNA 3D5LA 3C2GA 2ZSIB 3ABUA 2CV0A 2WB1A 3FXOA 4XONA 5EG0B 5E3OA 1QBJA 3J7ZI 4IHVA 1UJ8A 3CP8A 2P7VB 1U5TA 1X4OA 5FO5A 3JAMK 4NQWB 4FTHA 3MZHA 1FOYA 4V2GA 2IT0A 3BOQA 2IVMA 3KYDB 1LQ1A 1IV6A 1G3WA 4PCQA 2OCEA 3KP2A 4AIKA 5J1RA 3HL2A 3IAS2 1K4TA 5FLXK 4EGYA 1ZG1A 3DPLC 3ZQCA 1LFPA 4HSTA 2CW7A 5CKTA 1B9NA 2HKOA 3VDXA 2JJ7A 3BJ6A 4N4OB 2QWWA 4Q48A 3SXYA 4DYRA 4P96A 1LEAA 2BXZA 3JW4A 1DPRA 2CUEA 3CC4I 2BHZA 2VE8A 1OCRH 4M71A 3M9AA 5DS9A 4E7KA 5EYRA 1W0TA 5DM7F 1P92A 2FXAA 2FEZA 2H09A 2HVQA 3QPHA 4PFOA 3KETA 4P9FA 4XLCA 4ZZDA 3E3VA 2NNYA 3D0SA 4BH9A 2B7EA 2NS7A 4ZTFA 1S29A 3FHNA 2VODA 2ZSHB 1U3EM 3GUDA 1OCTC 2CSOA 3PFYA 4PJLA 2A69F 1P7IA 2G0EA 5FJ8J 1ZRCA 4U87A 2F48A 5GP9A 5LBQA 5K5QA 4MEXF 2DI3A 3QOPA 1S9HA 2D1VA 2NOJB 3KPHA 4M6VA 3S16J 1MNDA 2E1MC 3OYJA 4XN3A 4A93J 1QQIA 2K3FA 2JK3A 1P2FA 1XB4A 1IGNA 2XRLA 3U1DA 1IO2A 4HW0A 4RB3C 1Z6RA 4RGSA 2K9LA 2WAQN 3QQAA 5F1RA 3VEPA 2ZMEB 3BC8A 1VTNC 1LFUP 2DMNA 4WF2A 4UNOA 4AUXA 4ETSA 5D4RA 3PQJA 5A2QZ 1QZZA 5M3FJ 2PLYA 4IHXA 5F64A 1HKQA 3KIOA 1J7KA 3MKZA 3MN2A 4XLFA 1MZBA 1J2XA 2L4MA 4HV6A 3GXOA 5B1BH 2FOKA 5CVRA 2E2JJ 2MBFA 4CH7A 3IUOA 3JRIA 3BPVA 2QKLB 4D0PA 2WV1A 3S2HJ 2DCEA 2XDVA 3RYPA 4Q47A 2ZC2A 2DK5A 2AS5F 2VBZA 3IHUA 1X1CA 4ESFA 3ABLH 1R9TJ 3ASOH 4XORA 5ILVA 1MW7A 3G1LA 1XGMA 1ZR2A 2OV7A 5FRMA 3VYRB 1YJ9I 1AWCA 5JHUA 4KN7X 4HBLA 2ZJQF 3HIFA 2M5WA 4P9UA 1IF1A 3CTAA 3AKZA 2FBIA 2O0YA 4IHYA 1PVEA 4IL6C 2M34A 3EPZA 4KUMA 1WSUA 3LA2A 3EYYA 3I3LA 1OISA 2V7FA 1K7AA 3OYDA 2NRAC 2R5YA 1LNWA 5CYVA 2LYCA 4R8HA 1ZN2A 1E3OC 4OIOF 1DGWY 1KQ8A 1FJLA 4BYYA 5TISC 5FFZA 3KEOA 2L5QA 4AWXB 4EV0A 3QYBA 1H8AC 2XHKA 2ME6A 3D1NI 5IPAA 4B4CA 3JRAA 2MG4A 2JZYA 5E1WA 4E7JA 5IT3A 3JRFA 4A3GJ 3I71A 3V8JA 4J19A 4CCNA 3HOTA 1RRJA 5LGNA 2JPCA 3DTIA 1I3QJ 5FKLA 1J0RA 4IEJA 1FBUA 3F8NA 2XRNA 5AIPA 2STWA 2KDZA 5TGTA 2IGMA 1VQ9I 4Y3OA 1UFMA 5L3BA 2LKPA 5CLSA 3BPXA 1GXPA 2HDDA 3CDIA 1G8XA 4G9YA 3CJRB 3ULQB 3G3ZA 2M2EA 2LD5A 3LSKA 2LMDA 3LSPA 3IRRA 1BL0A 1HOMA 1QZEA 4CDGA 4ENNA 3GLXA 1O3TA 1D8KA 3RCOA 1U5TB 5LRSA 1BA5A 1A04A 3OR2C 4JOMA 2HEOA 2JA8J 1QHHD 3QU3A 2BZTA 1YHQI 4F3QA 2KJCA 3PL8A 2LKXA 1VQKI 2JSPA 5K7FA 2Y48A 4HX4A 3OYMA 4F93B 2KQRA 5ICGA 2WY7Q 3NAUA 1Y0NA 5CVIA 3OIOA 3OSFA 2CQQA 3T1BA 3TMOA 4EGZA 5C44J 2VKHA 4IRHA 3J81K 1ERDA 1LEBA 2PMZA 3OYKA 1MIJA 2LG4A 3ABMH 4BY1J 2LH9A 2TCTA 3QOEA 3MKWB 5GAGJ 1B59A 1RIOH 1PJRA 3V7RA 2UWMA 1LDKB 3HOVJ 4L9JA 4MGRA 4EJVA 4NHJA 2YX4A 4C9YA 4FHTA 1TTYA 1YW7A 2LBFA 2CW8A 3HUGA 2Y2ZA 5J8CA 3RKWA 4PJ0C 2QCOA 2B9SA 2HYFA 4E7IA 1MH4A 2R7WA 2QSHX 1HQCA 1MJAA 1NG7A 3B02A 2R4GA 3O6BB 3SDBA 4DIQA 2TDXA 4M3BA 1KONA 3ZGKA 4CCOA 4N9IA 3IL2A 1XX5A 1I50J 2R7SA 1RKWA 5FFXA 3HJEA 1SD4A 2V9PA 1YO5C 2ACJA 1J59A 2KT0A 4GRIA 4D5CA 3U21A 1VQ4I 3M1EA 2XPUA 4L18B 5BS6A 5ICFA 3S3OA 1FMVA 2R7RA 2BW3A 2QA4I 1ETWA 2EIMH 2H1LA 2HU9A 4Y33A 3CC2I 3RIRA 3VSKA 2QKMB 1K6OA 1FOWA 3JTHA 5HVQC 2PEXA 3P9CA 3SEZA 3MFKA 4E7HA 1SVMA 1AU7A 1REPC 1U2WA 3KYCB 4XN0A 4M6YA 3O2PE 4BUPA 4GGGA 3I59B 1TL8A 1OCCH 2AHQA 2K9QA 3F21A 3TOBA 2DTZA 2J5PA 1Z3YA 1LVKA 1M1EB 2A05A 1YW8A 3MD2A 3QYEA 3BR0A 5LGTA 5KAIC 2VXZA 4HLYA 4EATA 5KAFC 3CMEI 3E0JB 2PJPA 3Q0WA 5E79C 2HOTA 2HDCA 3W2AA 2EZLA 4C2UA 2Q2EB 1LDJA 2MABA 1SEUA 2QUFA 2QQBA 2ZBKA 2K40A 1TBXA 2XGEA 1R4MB 4AYBA 2XB5A 2CMPA 3PIOF 1D5YA 4KMUX 2MD5A 4M9XA 1Z3XA 3CCUI 1BR1A 2WB1N 1MBGA 3RQ4A 2ESNA 2R7ZJ 3GCMA 2W7NA 1RNLA 2KZGA 1B72B 1WJFA 5J4YA 2BEOA 1H88C 5IY5H 1S3JA 3HHHA 3RPUD 4KIBA 2YSRA 1I6XA 3OWTA 3I9V2 3ZQHA 1UCRA 3MEXA 1W7PD 3K70D 1MMAA 4LFUA 3V42A 2R5YB 5J40A 2KFDA 2CYYA 4D9JA 1N75A 2E1MB 1FBQA 1IG7A 2CV1A 5IT9K 3CESA 3UNGC 4BGDA 1LDDA 3ZXSA 2BOLA 1XG1A 3L2CA 2MC4A 3CD6I 1QO0D 4RGXA 2FUG2 3WG7H 4ZJZA 1LVAA 1FOXA 2X1EA 5M5XJ 2Q0OA 3ZQIA 2O6GE 1FC3A 2LC2A 3E6DA 4HPQA 4QSHA 2DPDA 4GXOA 4E7ZA 3EUKL 1JJ6C 4KISA 4BXFA 4R79A 3SZPA 2K3PA 1TWFJ 3HGYA 1ZAOA 3HGGA 1J9IA 1YE9A 2LOOA 2RC4A 3SZGA 2CU7A 3BG9A 5DEQA 2PN6A 3LFKA 4LG0A 1ZGWA 2V79A 4HNUA 3W6VA 2VONA 1VQLI 1E0EA 4U0VA 2DXIA 4JYKA 1FYMA 2W4SA 2YR2A 3IAM2 4UHTA 2A6TA 1MSFC 1FOKA 5L3CA 4YFKF 1K78A 1P6RA 4LIUA 3BG7A 3BT9A 2DA2A 2LSOA 1OKRA 5LLQA 5FKKA 3K1MA 4IXAA 4B44A 4F91B 4UUSA 2H94A 3RJPA 1U9OA 3OYEA 1ORKA 2F2EA 3R60A 2WADA 1XCVA 2EINH 1MBFA 3PSIA 4A3DJ 3J80K 1WFXA 2BV6A 2OAZA 1T6SA 3PNYA 5IOYA 2KRHA 1Z0XA 3GTMJ 1V5EA 3CCVI 2DQRA 2HQ5A 1OQYA 5EG0A 3F22A 3T0YA 2EJRA 3H9JA 4RBOA 1DGRM 4M74A 3JCUC 2KRFA 1ZK8A 2DLLA 1Y56A 2ME0A 2QENA 2J5OA 3FXRA 3DBRB 3FKJA 1YYVA 2HTJA 2QQAA 1G6NA 3R0JA 4PGGA 3DPTA 4A5NA 4RAFA 4M72A 2M8GX 2HVRA 3GW2A 2QBYB 2DJNA 2HTSA 4MTEA 2ZO4A 1MMDA 1RUNA 2OBPA 2DA3A 3LA7A 5H6QA 2XAHA 5D8KB 1XDUA 1B1BA 1A6QA 4A3MJ 4BL0B 1IUYA 2X9DA 2LK2A 3IH2A 4XRFA 1T2KA 3BG3A 2VKEA 3TP0A 4HX8A 1UG0A 1WCMJ 3KZIC 1LFBA 1SC7A 3WU2C 3ABKH 4CXFA 3M1CA 1FIAA 2R7QA 2EFOA 4G7OF 3TGNA 1X3UA 4LK0F 2GA2A 4AU7A 3KP3A 4PJMA 1Z77A 3WGGA 4LG3A 2A07F 5FGMA 4EVIA 2H8RA 2A5YB 3MWMA 3HKZA 2IGNA 3R4KA 4HV5A 5B5EC 2JVHA 2E2IJ 1UZCA 4L5IA 2BW3B 2DMPA 3DCFA 2EFWA 3FXKA 1ODDA 2QQ9A 1XC5A 1OCZH 3K70C 3CMAI 3BROA 2HFHA 3DBLB 5DUIA 1DU0A 4HAMA 4ANJA 3KYLA 3DKWA 4A3EJ 2HS5A 3SJMA 3AFHA 4I2OA 2K5CA 3DEWA 2HQRA 1NTCA 1BW6A 2L7ZA 4HQEA 3R6SA 1H9GA 2BVLA 4N9HA 4BNCA 2KL4A 3BR3A 3JREA 3V8LA 1PP7U 4A3LJ 2XF5A 4QIWN 2ECBA 2PQ8A 4LJZF 1WJBA 3HRTA 5LD2C 3VPRA 3TDZC 3WGHA 5D5VB 1JT6A 3BQZA 2EA2A 4AVPA 1BI2A 3PUBA 2COMA 2XPWA 4LOCA 2XSJC 4G7ZF 1IJWC 2JA2A 1PDNC 3BLYA 3C1DA 2F5CA 1JT0A 3QPTA 2DMTA 3FXLA 1W5SA 1R6RA 1VI0A 4OU0A 4D7NA 3M3YJ 4JX4A 2P6SA 1XDSA 5GAEJ 4IQJA 3SYTA 4IQ4A 2GBYA 4C2TA 2ZXHA 1RPWA 2QYOA 4AIJA 4BBSJ 4PZJA 3I0TA 4CYCA 3WODF 2M8EA 1LPQA 1YOVB 2EZKA 2GA1A 5E3LA 3ZPLA 1R1UA 1D1CA 5ILUA 1KU9A 2PMZN 2PMHA 1Z05A 4F7ZA 3E5UA 4DW6A 4NB5A 4X6AJ 4ESJA 4ON0A 4N4NB 3OYNA 4BE0A 3K4BA 3RPUA 3HHGA 1W5TA 1WJDA 1JUPA 1YQAA 1WZ2A 1X1BA 2IPQX 1W7PA 1VQ5I 3S2DJ 3RPQA 4LG0B 1IRZA 2GIVA 2R3SA 2MLGA 2JRMA 1TQIA 2JQ7A 1KQ9A 5HS9A 4AIDA 2XGCA 2VKDA 1K78B 2HYJA 2VJ5A 2VUMJ 4C3JJ 4NNJA 4UXNA 4MFEA 1A36A 4A0XA 2VE9A 3D5SC 3M07A 4I0BA 2GXGA 4UUSB 5F0HA 3Q9VA 4BQOA 2DA7A 2HPIA 2VPLA 1WH5A 3OR1C 2E35A 2ZXWH 3KZYA 3I4PA 1VQ8I 2NNNA 2KISA 1XSDA 3A03A 3KCCA 5AONA 2CUFA 2WBMA 3GX4X 3FZVA 3GTPJ 1QHGA 3OMYA 1OR7C 2VPRA 4BHCA 2M1BA 5HDNA 3PJRA 4EM1A 2DMQA 2KJBA 3KX2A 1F5TA 1T8IA 1FP1D 2W82A 2VI6A 1IXCA 4C3HJ 1X4PA 3OIQA 3JRCA 1P4AA 2HZDA 1MNEA 2EQRA 2L3DA 1IN6A 3LSJA 4I99C 3M4OJ 2H1KA 5EEGA 3H36A 3PFIA 1S8NA 1WPKA 3E5QA 1I6HJ 3LL7A 2H8WA 4FX0A 4AYBN 1XPXA 5J1UA 2CUJA 4R1HA 2K85A 3CF2A 2KP6A 3ZMVA 1SD5A 2XKPA 2I10A 1FY7A 4BY7J 3W2VA 2OF7A 4HEA2 1XD7A 4RAGA 5F04A 3ZR8X 1FBSA 1MBKA 2A6HF 3CUQC 1FNNA 1ZTRA 2E1OA 2F6CA 4EM2A 5IP7J 3JRHA 4A3KJ 1ZRFA 4U7DA 5KNLA 1VQOI 2E1NA 5ED4A 4UB8C 3SFZA 1SVOA 2XAQA 4MO7A 1SFKA 2VT3A 5GADJ 4OAZA 4IHTA 2F5VA 1UHSA 2BE5F 2F4OB 2IA0A 1BR2A 2OTLI 2QEXI 3BTLA 1HW5A 4II3A 1XMXA 1WI3A 1O4XA 4ZYAA 2EFPA 2MC3A 3OSGA 4CCKA 1YTYA 4ZC3A 4RB2C 4UV9A 3BCAA 4LD5A 2R7FA 3K2ZA 3C3WA 2ZJ2A 1OYWA 3S3NA 1OR7A 4PUSA 1IRXA 1I5ZA 5F1JA 1L0OC 1TQPA 2O8XA 4Y17A 3GF2A 3KP7A 3IWZA 3VYSB 4BU2A 3HOYJ 1IRFA 2V4JC 4IO9F 3DFGA 5CQGA 1K83J 2FNAA 2RNJA 3BDDA 3I59A 2O9LA 3GLLA 3GTQJ 3CC7I 3I4NJ 2R0QC 1DP7P 2FA5A 3BR6A 3G1MA 4KN4X 4S04A 2VJ4A 4RS8A 1NHAA 1Y1VJ 3F9KA 3F72A 2HOEA 4M3EA 3T8TA 1S6LA 3LQRA 2JN6A 4H0EA 4BQQA 1IC8A 2Z16A 2CGPA 3LAPA 5E8GA 3OYIA 5EF6A 1EF4A 2ELKA 2Q2EA 2P81A 3MKYB 4QPOA 1ZQ3P 5JI6A 1G3YA 3CCJI 1GDTA 2VXDA 2IA1A 1K4SA 3HRSA 3JAMZ 1ETXA 5C4JJ 3ERMA 2O61A 2VQHA 3FISA 3PQKA 4NDLA 2GIZA 3WG9A 1O3QA 1U8RA 3CUQA 1SMYF 5JLWA 4CYCB 1Y8QB 1T33A 2L0KA 1B72A 2K7LA 1BOBA 2DA6A 4QTRA 2VT2A 2HYGD 4OIPF 5FLXZ 3C7JA 1YLFA 3CDHA 3GTLJ 4LIVA 5E20A 4DJAA 2EV6A 3HOZJ 1RC9A 4A3BJ 2OQGA 1RZ4A 3HOXJ 4C3IJ 4GYIA 1W7PB 3I55I 1R7JA 4DBRA 3FMSA 4HF2A 2EV5A 3ZN1A 4L9TA 1ETKA 1P4WA 5K1YA 4CYDA 1H89C 2MW8A 3BZ6A 4Z2YA 4K2EA 5M5YJ 3TQNA 4LITA 4BXUA 1MKMA 1O7LA 3CO7C 4B8XA 3OL4A 3H1CA 4IHWA 2W00A 1ETQA 2F4MB 4ABZA 3DEUA 4XSZF 3MCZA 4S05A 2DFIA 1WHUA 3DKXA 5DV5A 5J3LA 1DPUA 3BTJA 3S1NJ 3IWFA 3LSTA 3KFWX 4RB1A 2LF8A 3I58A 2OD5A 3A0BC 1MMGA 5K5RA 1OCPA 4A69C 3HKZN 1IAWA 2KMUA 2XAGA 1FMWA 2ZFUA 3BWGA 1WKMA 1UMQA 4XKWA 5CVUA 4V19K 1XCBA 2FJ1A 3MVPA 4CA0A 1YJNI 1U9NA 3GBGA 3WTUC 2R92J 5CJ9A 1IXSB 3NRVA 3TW7A 2V6CA 1B8IA 1VNDA 4DOZA 3KLNA 4U88A 3L00A 2LTPA 2QVOA 3OIPA 4XIDA 2X6OA 4OWRB 3T8RA 4HRIA 4F92B 3CP2A 2MGQA 3NARA 1OCOH 3E1SA 2EWNA 3DWLE 3FMRA 2VQGA 1MNMC 2VBWA 1J75A 2H27A 4RMNA 3SHFA 4OMZA 1TWAJ 3LNQA 5TJJA 1D0ZA 3NEUA 4MQVA 4KT5C 1LB2A 1JXSA 1Z91A 4DYCA 1TZLA 4PGHA 3SQNA 3TO7A 1ZR4A 2QBYA 4AD9A 4UUVA 2RGVA 1TNTA 3BCBA 2LREA 3MMYB 5J47A 1V55H 1MH3A 1X1AA 2CG4A 2FOWA 1IN4A 1BIBA 1TW2A 3GTKJ 2XF6A 3WTSC 1OMIA 1HDDC 2EH3A 3ONQA 5L3DA 1CF7B 2NYXA 1FX7A 2LY2A 1GUUA 2OZ6A 4KITB 2HQNA 2YX7A 2IAIA 1T39A 1TWGJ 5H20A 1IW7F 4V2FA 2M87A 2M45A 2CQKA 3ZMDA 3PUFA 2LFBA 2RV8A 4D7MA 1YFHA 3EQLF 3H5RA 3R61A 2QGUA 3GFLA 4XKBA 4A12A 5BPIA 1L3LA 2NVQJ 2K9NA 3IV5A 1D1AA 4ITVA 4A0ZA 3TO6A 4RGUA 2GWRA 2KDOA 2V26A 4PJJA 4P55A 3CCRI 1HW2A 3FX3A 1AOYA 1I3AA 1SANA 2BXYA 4A3JJ 2HOAA 1TLHB 1HBXG 2ISZA 3IH4A 3ZMUA 3H35A 4FCYA 1SFUA 2BHYA 1R49A 3BZCA 1KYZA 3U2RA 4RLQA 2G7HA 1F1ZA 2BY1A 5HLGA 2X51A 4YEJA 1YJWI 4JQFA 2GLOA 1VF9A 1XS9A 3SZTA 3K4NA 3VSLA 1E3PA 1JGSA 3ASNH 3WTTC 1HSTA 2C6YA 1Z7LA 1SAUA 2GOMA 3CQZJ 3ZMTA 2LF7A 4Y4RA 2AQEA 1MMSA 1D1BA 2K4JA 3GFJA 4B48A 5HLHA 3ZMSA 3K4LA 2AO9A 4BJ6C 2HXOA 2I5UA 1JTYA 2FX0A 3RKYA 3R0AA 4JX5A 2PI0A 5C3EJ 1W1WE 1AHDP 1EH8A 4XLHA 1QGPA 2KHMA 3QP5A 4CO8A 4BACA 1F43A 1Y6IA 4HDUA 3LSHA 2VASA 1BJAA 2K9SA 3CUQB 2L7MP 2D45A 1N25A 3AAFA 4WX9A 2O3FA 5ICCA 2PX9A 1R71A 4AM3A 1I1GA 1R00A 4AC0A 3HOWJ 5GTHC 2XUBA 3J81Z 1A31A 1RETA 2OPTA 3TDUC 2P6TA 1STZA 1E3HA 3W6JB 2GZWA 4RDUA 3GTGJ 2L54A 2IS4A 1BR4A 1K61A 2MYSA 2DOFA 1YG2A 1R1TA 2RREA 4FQGA 2XVCA 1DP3A 2A61A 1APLC 2UUZA 5FB2A 1S72I 3HTSB 3IKTA 4DYQA 4II2A 1ZG5A 1T38A 3NWSA 3S1MJ 2FQ3A 1MJBA 3JRBA 4ZH4F 2XAFA 3HDDA 1FYLA 4NC6A 2JA7J 1EH6A 5F0CA 3RZOJ 2BVMA 2KPMA 2VBYA 3CLOA 3FXMA 1XMKA 5HDGA 3ZQGA 4U0YA 5FKNA 2UZKA 4I6ZA 1XN7A 4F52A 4E4HA 5KVRA 3PO2J 3L7WA 2Y0SA 3IC7A 1U8BA 2JTVA 2EFNA 4U7BA 1OJLA 3K1PA 5JLXA 1UAAA 5IYBJ 1ONVA 2HNHA 2WAQA 3FDYA 3G6EI 3OYHA 4YIRX 5L3GA 2X48A 1JUSA 1P7JA 2GXAA 3ZCOA 3MKLA 2R7OA 2IS1A 4KA4A 4DGWB 2Z2SB 1RI7A 2E60A 2D1HA 5CVJA 1D0XA 3AG1H 1IN5A 4CICA 3C2HA 3U9GA 2YS9A 1B8IB 2G7UA 5EDNA 1BN5A 1EJ9A 1KYWA 1ZGAA 2DA1A 4ZDOA 1GVJA 3F8CA 4I01A 3HOUJ 2HGCA 4HX7A 1FYKA 3BG6A 5J1YA 2FMYA 4HDVA 4B09A 1UELB 3FHZA 3ZMZA 2KRCA 2Z33A 4YFNF 1Y39A 2RDPA 3FWEA 1P9QC 3TOAA 3O3KA 1D5VA 2DQLA 4UV8A 3L2QA 1UG2A 3KP5A 2V1XA 1ZARA 1QU3A 1SD6A 4EQQA 3CMMA 3LQQA 4IRGA 4XLNF 3HG9A 4BE1A 1SMTA 3ECOA 3NQOA 1WQ2A 4XRMA 2JT1A 4BBRJ 5TRDA 4MHGA 2X4HA 4FISA 1HW1A 4KMFA 3ZQLA 4XBFA 3QWLA 2Z5UA 3ECHA 2XSDC 4FETA 2EBIA 4ENJA 4Q4ZF 2X6YA 1VQNI 1IZ1A 2XAJA 4CZCA 2AXTC 2M4KA 3VODA 3V4GA 3Q0UA 2XAUA 2L4AA 3G71I 2Y31A 4GDFA 2VQCA 4BEHB 1CF7A 2FSWA 2MLKA 4IVNA 2MH2A 2ZNZA 4AIHA 3BP8A 5IT9Z 2COBA 3GZNB 1SAXA 2L9VA 4A0YA 4B3AA 1GXQA 4BQNA 2PFBA 1HF0A 5FD6A 2B63J 2HKXA 5F6FA 5DM6F 3CJTB 3ZQ7A 1ENHA 3CLQA 3H0GJ 3HRUA 5JVGF 4LMYA 2DK8A 1EA3A 5BNGA 3N05A 3GYHX 1VQPI 2X1CA 3FXJA 1Q1VA 4E7LA 2DT6A 3I4MJ 2DODA 1FTTA 3QPLA 3JRGA 3VB2A 2EIKH 3RSNA 2V9VA 3CUOA 2EV0A 3TP3A 1X1PA 1BJZA 5EEAA 3TBIA 3EDPA 3FXUA 3FM5A 4IZZA 1YX5A 1OFCX 2M7AA 4CGZA 4NC7A 3PIPF 2HR3A 2E36A 1BBYA 4L5JA 2CFXA 5E8IA 2BY3A 2E2HJ 1IXRC 3S2WA 4B3XA 3UKGA 5KHDA 1SD7A 2JPBA 2VJJA 4E6KG 3M7GA 4E7SA 5K7HA 3L2UA 2CJJA 4ZDPA 2JUGA 2OU2A 2DYSH 1VQ7I 1KU2A 2Y0MA 1X3WB 3F8MA 1TT5B 1JUMA 4LB5A 1HKTA 3ZQQA 2NAZA 4N0BA 2FBHA 3N4MA 1X2MA 2JMWA 1YIOA 3J80Z 2IRFG 4GFBA 4IKFA 3I53A 1KGSA 4CUGA 1G4DA 2F4IA 4EMSA 4XOTA 2V6EA 4CCJA 4QLCU 2QSGX 4WXDA 4WXCA 2IS6A 3JRDA 1W4MA 2DPUA 3F6VA 3K2AA 2NVTJ 4W97A 3K10A 5ICEA 4Q5SF 1JI8A 5L3EA 3W6KB 5DD4A 1PUFB 4HZFA 1HLVA 1V4RA 2V9KA 3OOUA 3G2BA 4YIIA 1R5ID 1S5LC 4J01A 3ZN0A 5LFAA 3L2VA 2K9MA 4KFCA 1MD0A 2NVYJ 2AQFA 3HPHA 1XMAA 1YX3A 4BAYA 1UB9A 3K69A 3B73A 2O5RA 3DV8A 4YIFA 4YRVA 3J7AY 1FEXA 4IOCF 1B4AA 1F4KA 1V5FA 4M3GA 5HS7A 1WJAA 5D5XB 3DU6A 4ENMA 2W57A 1SFXA 2M0MA 3KP6A 3L1PA 3L09A 1HSJA 4HF0A 2IS2A 3BJOA 1YIJI 2DFFA 3WE2A 3H9GA 4EM0B 3DEEA 3F8FA 5D6EA 3COAC 4GO1A 3GMEA 2X6WA 4MFDA 4I02A 1QPMA 1E17A 3WE3A 1O3SA 3FIWA 2X6XA 2I8DA 2XC7A 1FLIA 2EPFA 4WCGA 1WWXA 1XGSA 3LSIA 3TW6A 4EJWA 5HNHA 4A6DA 2YPRA 2HPMA 1OLTA 1W5CC 3KLOA 4P5OA 3BG5A 3F23A 3I54A 1RR7A 2IGOA 4LLLA 5ILSA 1B6AA 4B43A 2VBXA 4ZYDA 2GM4A 4XSXF 4IHSA 2X0LA 4RAZA 1X58A 5A2QK 3QAHA 4KDPA 1X19A 4PSXA 4X1EA 2CWEA 1ZRDA 4ZDLA 4UVCA 3KP4A 5IOZA 4ZYGA 4PFPA 3ML6A 2OQRA 4XL9A 2CRGA 3IP4B 3WGIA 2A5WA 3EETA 5LHIA 3TO9A 5KK1A 2DJIA 1FIPA 2F5EA 5IYCJ 1FZPB 6PAXA 2IEKA 4KJZA 4KT6A 1J09A 5HLIA 4MTDA 4IPAA 1RKTA 3K4JA 2R5ZA 1IV8A 2BY0A 4FE4A 4A3IJ 1NK2P 3PSFA 1I39A 4UVBA 3PNTA 5EZHA 2DU9A 3CCSI 1ZLJA 3H92A 3HBLA 5D5UB 4PJNA 3BZKA 1MBJA 2IBDA 1JHFA 1UHMA 2KIMA 5E3NA 2X1DA 5E18F 4OINF 2FF4A 2VC0A 1FPQA 3H5AA 5BMZA 3MAJA 3K0LA 2VC1A 2W84A 2GQQA 1V5GA 3H3UA 3G1OA 2ZXJA 3QRFF 2WA0A 5E1XA 3DF8A 1YRNA 4RA2A 3TL4X 3S32A 2Z3YA 3FM3A 4XLEA 1H0MA 3LA3A 3AG2H 2O8KA 3A1YA 4DZJA 2DN0A 2LKSA 2NXNB 3KEQA 4A3FJ 2Z9OA 4S0HB 1KU3A 1YITI 1USSA 3T5XA 2D5VA 1POGA 3I5UA 2HWVA 4ASNA 3DPUA 4GYGA 4UVAA 1N77A 4XLAA 4XM3A 1X2NA 4O3MA 4YELA 2YU9J 2WAFA 3UR3C 2PJRB 4G94A 2DMUA 1I1SA 2KIUA 4ZTJA 5M5WJ 4Y15A 2CH0A 3G73A 4HYEA 3S3MA 3KE2A 2R7UA 3HOSA 3CCEI 3FF5A 1S7OA 5DCMB 1FT9A 5DUKA 4BHPA 1W36D 4RM2A 2BBYA 2ICWG 3J7AO 3QPSA 2DAOA 4LLNA 2RNGA 4XRSA 2A6EF 2XGDA 5CVVA 4LLGF 4X0GA 1VFCA 1Q1HA 4UUTA 2D2WA 1TWCJ 2HQAA 5LHHA 1ETYA 2WV0A 4BS9A 1Z7UA 2E19A 2FU4A 2M7BA 4AVZA 1C0WA 1HCRA 1HA8A 2CO5A 5DCFA 1MBHA 3QU6A 4IOAF 2Y0SN 4UY8I 5M3MJ 4PK4A 1LUJB 1QNTA 3GZ6A 2CQXA 1IDYA 1BC8C 2IW5A 3Q9SA 5K5OA 1GT0C 2XGXA 3RI4A 1ZLKA 4Y52J 1GVDA 3H5NA 5LGUA 2JUCA 1IDZA 1AA7A 4IF4A 2W25A 2EZHA 3M8JA 4EEFG 1YI2I 2YUSA 4OIRF 1ETVA 3RDIA 4HNTA 4EJTA 2ZKZA 1ZREA 2BY2A 2FD5A 4M6XA 4CSWA 3WTYC 2R7DA 2P5VA 1JKOC 2ID3A 1FSEA 2ZCWA 3BR1A 3AG3H 4HQMA 4DNCA 2NOGA 3K4KA 1ITYA 2OA4A 2RKHA 3OYLA 4D1QA 3TEDA 2JA5J 2HOSA 3A2KA 4QPQA 1QPIA 3DU5A 3H0DA 1W0UA 4IRIA 4M9SA 1LE8A 4NC8A 2ISYA 3O8GA 2DO7A 5FLMJ 5HNFA 4WK8F 3CZ6A 1BM9A 1WJ5A 5ERIA 3P9IA 5L3FA 3HB9A 3H3ZA 3OS1A 2ZNYA 3IH3A 3CO6C 1G59A 1N78A 3DP7A 3OYFA 2V1NA 2JSCA 2CQNA 3A01A 5E1ZB 3DTKA 1T0FC 1A5JA 3KEYA 5FROA 2L7KA 5JR3A 2HZTA 2YU3A 1QVTA 2ETHA 1D0YA 1JKQC 3OS2A 9ANTA 1G3SA 2F5DA 3KZZA 1KZHA 3CCQI 4BE2A 4HNVA 3GEZA 2OCCH 2ZXIA 3HSFA 4HOBA 4FX4A 2MH9A 2CW0F 3GZ5A 2CFOA 2ADUA 3J7YJ 3HM5A 3CMYA 5GAHJ 5IP9J 1ON1A 4BJ5C 4UB6C 3MZ8A 2KIFA 3VYTB 1EKEA 4CCLA 1XSXA 2W48A 1T98A 2FQ4A 3FBIB 3WHCA 3BTCA 2M3AA 1WVRA 5GPCA 3C18A 3K1NA 4DZPA 1MGTA 3DBHB 4YG2F 2OTJI 4B1RA 2P8TA 1EH7A 1DDNA 2QZ8A 2DT7B 4FT8A 2O03A 3JTGA 1VQMI 3GWZA 3OYGA 1D8JA 4FASD 3FKIJ 1Z6TA 3SEQA 1Z9CA 4A6EA 2R5ZB 5EGOA 4CHUA 4M3FA 1T95A 3IRQA 3RKQA 4DBQA 1KA8A 1W36C 1ZYRF 4PSWA 1SFOJ 3CDLA 2RQPA 2NS0A 1TQMA 4HF1A 1O7FA 3S15J 3RZDJ 2P7CB 2G9WA 1PP8F 2EK5A 1QRYA 1ZELA 3L9FA 1WH7A 1OYIA 5FLVA 2LNBA 4XRSG 2E34A 3M8FA 3WU0A 3K7AJ 4RAYA 5IYDJ 1R36A 2XB0X 3EUHC 1R5GA 1Z67A 2F5FA 2HI3A 2P4WA 2QM3A 4XNFA 4ZZLA 4L0YB 2VOPA 5LEJA 3M8EA 1HXDA 2DOEA 3K4MA 2DT5A 2CUZA 2VQLA 2B0LA 3ABTA 1YRNB 4C30A 2L9SA 3WTVC 1FTZA 4HSRA 1J5YA 2M0CA 3H9QA 3E5XA 3RKXA 2QSFX 1T0FA 3SFIA 2E5ZA 3G4SI 1U0JA 1U6GA 3CJNA 1TWHJ 5FKMA 2R7VA 4L5EA 2JRTA 2W1OA 4G8XA 5B3SH 5DDGA 2LR8A 4CZZA 2VL8A 1TNSA 4BDZA 3RYRA 4Y13A 2K27A 2KZVA 3Q3SA 1SVLA 1GHCA 4BEHA 5HODA 1E2XA 2VJIA 3K6GA 1TT0A 2IXSA 2NS8A 3DLLF 3CCLI 3GFIA 2EA4A 1RUOA 1UHWA 2JVGA 3OOPA 3ROUA 1VQ6I 3D5RC 4M73A 2XASA 3FK7A 3CF5F
chains in the Genus database with same CATH topology
1XSVA 4HLXA 5H6RA 1OYYA 5D4SA 4I0AA 1XGOA 1JE8A 4L9VA 4O5VA 5D6FA 3VFZA 4WWCA 1S7AA 2OZUA 2RN7A 5LRRA 2DW4A 3WU1B 4KNYA 2M30A 3P9KA 2STTA 3WTXC 3MZYA 4QWQA 2K86A 4O6JA 1FWZA 3F8BA 4G6DA 3FMQA 2FNPA 5DYMA 1YS6A 2EFWA 1YS7A 4IJAA 5BQTA 3EUHA 1BC7C 2QLZA 3QP6A 4G6QA 3VOEA 3HRMA 2L02A 1QZYA 3WTWC 3DQVC 2H6CA 2W85A 3P7NA 3GFMA 4KICA 2BGCA 4I7HA 2IP2A 3RTRA 3Q5FA 4OIQF 3V7SA 3OV8A 1DUXC 3BJAA 3V7CA 1ZH5A 3ISPA 1ZGJA 2XV4S 2A3SA 2PG4A 2XROA 1MDMA 4A5MA 4MQ9F 3N97A 1OPCA 2BYVE 4LK1F 3JSOA 1PUEE 3HSRA 3V8KA 2LDUA 1HKSA 1D3YA 2Z99A 2Q8KA 1H9TA 1G3TA 2EB7A 2H6BA 1R58A 3E97A 4XLPF 4OOIA 5HDKA 2WWYA 1WI9A 5E17F 2WTEA 4JBAA 2Y75A 1BI3A 2XKOA 1CGPA 1O3RA 5BOXA 3I64A 2XIGA 2DBBA 3HYIA 3FXQA 4PDKA 1KQ0A 2ESHA 2A68F 1ON2A 3JSPA 4NQWA 1JHHA 1IRGA 1LJ9A 1BI0A 2MA3A 4E70A 5AIQA 2VOOA 4LGWA 1SFEA 1MJ9A 4MEYF 5J8FA 4KIFA 2IJLA 1Y0UA 5EEHA 5D5WB 2UXNA 5FD5A 4EJOA 5BPDA 2K4BA 1F9NA 3DXJF 4A2UA 5DD8A 2FRHA 2GXBA 2ZFWA 3IKVA 1V3FA 3HTUA 5JVTA 4OMYA 1R22A 1KU7A 5DCMA 4TV7A 2W24A 1ZHFA 3E6BA 3LAJA 3LWFA 2P5KA 4ZYEA 4MNUA 1YW9A 4BQAA 1ULYA 3ZP5A 4G7HF 5D8LB 1WRJA 3GO5A 2FMLA 3ERED 1BIAA 2E7XA 4L9NA 2AXLA 5HS8A 3ELKA 2ZMEA 3TKYA 2V1UA 4KYWA 3BY6A 3F6OA 2L01A 5JFRA 1TW3A 4ESBA 4YFXF 1U78A 2V1DA 2E1CA 2PBIA 1BI1A 4L0ZB 4BHBA 2ELHA 1U5TC 4KIGA 3MQ0A 5HOOA 4LB6B 5LHGA 3EYIA 1MDMB 4JK1X 4I09A 1B9MA 1R5HA 2FE3A 4ZYHA 4WXHA 1IN7A 2P5LC 2E7WA 3E6MA 4RGRA 4M9ZA 4ENKA 4EJUA 1O57A 2DTRA 1I27A 4RB0A 3WTZA 5LEKA 2IA2A 5J6XA 2FBKA 2VN2A 1ZG3A 3E6CC 4DQ2A 1FSHA 1USTA 4HA8A 3HSEA 2KKOA 1EV7A 1K79A 2GAUA 3K9TA 1R1VA 1Z1DA 4U0WA 4I98B 3GVAA 2PMUA 1FP2A 1P4XA 3REOA 2RVCA 2WC2A 3F3XA 1BOAA 2K02A 2UXXA 1IN8A 2EFQA 4GCVA 1R23A 1XGNA 3D5LA 3ABUA 1QBJA 2P7VB 1U5TA 5FO5A 3JAMK 3MZHA 2IT0A 3BOQA 2IVMA 1LQ1A 1G3WA 4PCQA 3KP2A 4AIKA 5FLXK 4EGYA 1ZG1A 3DPLC 1B9NA 2HKOA 3BJ6A 4Q48A 2QWWA 3SXYA 4P96A 1LEAA 3JW4A 1DPRA 2VE8A 4M71A 3M9AA 1P92A 2FXAA 2FEZA 2H09A 3QPHA 3KETA 4P9FA 4ZZDA 3E3VA 2NNYA 3D0SA 4BH9A 1S29A 2VODA 1U3EM 3GUDA 2CSOA 2A69F 1ZRCA 5LBQA 5K5QA 4MEXF 2DI3A 3QOPA 2D1VA 1QQIA 1XB4A 1P2FA 3U1DA 4HW0A 4RB3C 1Z6RA 4RGSA 5F1RA 3VEPA 2ZMEB 1VTNC 4WF2A 4UNOA 5D4RA 4ETSA 5A2QZ 3PQJA 1QZZA 2PLYA 5F64A 1HKQA 1J7KA 1MZBA 1J2XA 2L4MA 4HV6A 3GXOA 2FOKA 5CVRA 2MBFA 3BPVA 4D0PA 3RYPA 4Q47A 2DK5A 2AS5F 2VBZA 3IHUA 4ESFA 5ILVA 1XGMA 1AWCA 5JHUA 4KN7X 4HBLA 3HIFA 2M5WA 4P9UA 1IF1A 3CTAA 2FBIA 2O0YA 4KUMA 1WSUA 3LA2A 3EYYA 1K7AA 2NRAC 1LNWA 5CYVA 4R8HA 1ZN2A 4OIOF 1KQ8A 4BYYA 5FFZA 3KEOA 4AWXB 4EV0A 2XHKA 2JZYA 5E1WA 5IT3A 3I71A 3V8JA 3HOTA 5LGNA 2JPCA 1J0RA 1FBUA 3F8NA 2XRNA 5AIPA 2STWA 1UFMA 5L3BA 2LKPA 5CLSA 3BPXA 1GXPA 4G9YA 3ULQB 3G3ZA 3IRRA 4CDGA 4ENNA 3GLXA 1O3TA 1D8KA 1U5TB 5LRSA 1A04A 2HEOA 3QU3A 2KJCA 2Y48A 4HX4A 5ICGA 5CVIA 3T1BA 4EGZA 3J81K 4IRHA 1LEBA 1B59A 1RIOH 2UWMA 3V7RA 1LDKB 4L9JA 4MGRA 4EJVA 4NHJA 2YX4A 4FHTA 1TTYA 1YW7A 3HUGA 5J8CA 3RKWA 2HYFA 1HQCA 1MJAA 3B02A 3O6BB 2TDXA 4N9IA 3IL2A 5FFXA 1SD4A 1YO5C 2ACJA 1J59A 3M1EA 4L18B 5BS6A 5ICFA 3RIRA 1K6OA 5HVQC 3JTHA 2PEXA 3P9CA 3MFKA 1REPC 1U2WA 4M6YA 3O2PE 4GGGA 3I59B 3F21A 3TOBA 2J5PA 1YW8A 4HLYA 5LGTA 2VXZA 2PJPA 2HDCA 1LDJA 2QUFA 2QQBA 2ZBKA 1TBXA 4KMUX 2MD5A 4M9XA 2ESNA 1RNLA 2BEOA 1S3JA 3HHHA 4KIBA 2YSRA 1I6XA 1UCRA 3MEXA 1W7PD 4LFUA 2CYYA 1FBQA 5IT9K 1LDDA 3L2CA 1QO0D 4RGXA 1LVAA 2Q0OA 2O6GE 1FC3A 3E6DA 2DPDA 4GXOA 4R79A 3SZPA 1ZAOA 1J9IA 2RC4A 5DEQA 2PN6A 3LFKA 4LG0A 2V79A 2VONA 4U0VA 1FYMA 2YR2A 4UHTA 1FOKA 5L3CA 4YFKF 1K78A 1P6RA 2LSOA 1OKRA 5LLQA 3K1MA 4IXAA 2H94A 3RJPA 2F2EA 3R60A 1XCVA 3J80K 2BV6A 2OAZA 1T6SA 2DQRA 3F22A 3T0YA 2EJRA 4M74A 2KRFA 2DLLA 2QENA 2J5OA 3FXRA 1YYVA 2HTJA 2QQAA 1G6NA 3R0JA 4PGGA 3DPTA 4A5NA 4M72A 3GW2A 2QBYB 2HTSA 4MTEA 2ZO4A 1RUNA 2OBPA 3LA7A 5H6QA 2XAHA 5D8KB 1XDUA 1B1BA 1IUYA 4XRFA 1T2KA 4HX8A 4CXFA 2EFOA 4G7OF 3TGNA 1X3UA 4LK0F 2GA2A 3KP3A 3WGGA 2A07F 5FGMA 4EVIA 2A5YB 3MWMA 3R4KA 4HV5A 4L5IA 1ODDA 2QQ9A 3BROA 2HFHA 5DUIA 4HAMA 3DKWA 2HS5A 4I2OA 2HQRA 4HQEA 3R6SA 1H9GA 4N9HA 4BNCA 3V8LA 1PP7U 2PQ8A 4LJZF 3HRTA 3TDZC 3WGHA 5D5VB 2EA2A 4AVPA 1BI2A 2COMA 4G7ZF 1PDNC 3C1DA 2F5CA 3QPTA 1W5SA 4OU0A 2P6SA 1XDSA 2QYOA 4AIJA 4PZJA 3I0TA 3WODF 2M8EA 2GA1A 3ZPLA 1R1UA 5ILUA 1KU9A 2PMHA 1Z05A 4F7ZA 3E5UA 4NB5A 4ESJA 4ON0A 3RPUA 3HHGA 1W5TA 1YQAA 2IPQX 1W7PA 3RPQA 4LG0B 2GIVA 2R3SA 2MLGA 1TQIA 1KQ9A 5HS9A 1K78B 4UXNA 4A0XA 2VE9A 4I0BA 2GXGA 3Q9VA 3KZYA 3I4PA 2NNNA 1XSDA 3KCCA 5AONA 3GX4X 3FZVA 4BHCA 2M1BA 5HDNA 4EM1A 2KJBA 1F5TA 1FP1D 1IXCA 1P4AA 2L3DA 1IN6A 5EEGA 3PFIA 1S8NA 3E5QA 4FX0A 4R1HA 3ZMVA 1SD5A 2XKPA 1FY7A 1XD7A 1CF7A 1FBSA 2A6HF 1FNNA 3CUQC 4EM2A 1ZRFA 4U7DA 2E1NA 5ED4A 3SFZA 2XAQA 2VT3A 4IHTA 2BE5F 2IA0A 1HW5A 2EFPA 2MC3A 1YTYA 4RB2C 4UV9A 4LD5A 2R7FA 3K2ZA 3C3WA 2ZJ2A 1OYWA 1OR7A 1I5ZA 1L0OC 1TQPA 2O8XA 4Y17A 3GF2A 3KP7A 3IWZA 1IRFA 3DFGA 2FNAA 2RNJA 3BDDA 3I59A 1DP7P 2FA5A 4KN4X 4S04A 4RS8A 1NHAA 3F72A 2HOEA 3T8TA 1S6LA 3LQRA 4H0EA 2CGPA 3LAPA 5E8GA 2Q2EA 5JI6A 1G3YA 2IA1A 3HRSA 3JAMZ 2O61A 3PQKA 1O3QA 3WG9A 1U8RA 3CUQA 1SMYF 2K7LA 2VT2A 2HYGD 4OIPF 5FLXZ 3C7JA 1YLFA 3CDHA 5E20A 2EV6A 2OQGA 1RZ4A 4GYIA 1W7PB 1R7JA 3FMSA 4HF2A 2EV5A 3ZN1A 4L9TA 1P4WA 5K1YA 4CYDA 3BZ6A 4Z2YA 4K2EA 3TQNA 4BXUA 1MKMA 1O7LA 3CO7C 4B8XA 3DEUA 4XSZF 3MCZA 4S05A 2DFIA 1DPUA 5DV5A 3IWFA 3LSTA 3KFWX 4RB1A 2LF8A 3I58A 2OD5A 5K5RA 1IAWA 3BWGA 2XAGA 1WKMA 5CVUA 1XCBA 3WTUC 5CJ9A 1IXSB 3NRVA 2V6CA 3KLNA 4U88A 3L00A 2QVOA 3T8RA 2EWNA 3FMRA 2VBWA 1J75A 2H27A 3SHFA 4OMZA 5TJJA 3NEUA 4MQVA 4KT5C 1LB2A 1JXSA 1Z91A 4PGHA 3SQNA 3TO7A 2QBYA 4AD9A 4UUVA 2RGVA 1TNTA 2CG4A 1IN4A 1BIBA 1TW2A 3WTSC 1OMIA 5L3DA 1CF7B 2NYXA 1FX7A 2OZ6A 2HQNA 2YX7A 1T39A 5H20A 1IW7F 2M87A 2M45A 2CQKA 3ZMDA 2RV8A 1YFHA 3EQLF 3R61A 3GFLA 4A12A 5BPIA 1L3LA 4A0ZA 3TO6A 4RGUA 2GWRA 1HW2A 1AOYA 4P55A 3FX3A 1HBXG 2ISZA 1TLHB 3ZMUA 1SFUA 1KYZA 3U2RA 2G7HA 1F1ZA 5HLGA 4JQFA 3SZTA 2C6YA 1JGSA 3WTTC 1HSTA 3ZMTA 2LF7A 2K4JA 3GFJA 5HLHA 3ZMSA 3RKYA 3R0AA 2PI0A 1EH8A 1QGPA 3QP5A 4CO8A 4HDUA 1BJAA 3CUQB 2D45A 3AAFA 4WX9A 2O3FA 5ICCA 1I1GA 1R00A 2XUBA 3J81Z 3TDUC 2P6TA 1STZA 3W6JB 2GZWA 2L54A 1YG2A 1R1TA 2XVCA 2A61A 5FB2A 3HTSB 3IKTA 1T38A 1ZG5A 2FQ3A 1MJBA 4ZH4F 2XAFA 1FYLA 1EH6A 2VBYA 3CLOA 1XMKA 5HDGA 4U0YA 2UZKA 1XN7A 5KVRA 3L7WA 3IC7A 2JTVA 2EFNA 4U7BA 3K1PA 1ONVA 5L3GA 4KA4A 1RI7A 5CVJA 2D1HA 1IN5A 4CICA 3U9GA 2G7UA 1BN5A 1KYWA 1ZGAA 1GVJA 3F8CA 4I01A 2HGCA 4HX7A 1FYKA 2FMYA 4HDVA 4B09A 3FHZA 3ZMZA 2Z33A 4YFNF 2RDPA 3FWEA 3TOAA 3O3KA 1D5VA 2DQLA 4UV8A 3KP5A 2V1XA 1ZARA 1SD6A 4EQQA 3LQQA 4IRGA 4XLNF 1SMTA 3ECOA 3NQOA 1WQ2A 2JT1A 5TRDA 4MHGA 2X4HA 1HW1A 4KMFA 4XBFA 2Z5UA 3ECHA 4ENJA 4Q4ZF 1IZ1A 2XAJA 3VODA 3V4GA 2L4AA 2FSWA 2MLKA 4IVNA 2MH2A 2ZNZA 4AIHA 3BP8A 5IT9Z 1SAXA 4A0YA 1GXQA 2PFBA 5FD6A 2HKXA 5F6FA 3ZQ7A 3HRUA 4LMYA 2DK8A 3GYHX 3VB2A 2V9VA 3CUOA 2EV0A 3EDPA 3FXUA 3FM5A 4CGZA 2HR3A 1BBYA 4L5JA 2CFXA 5E8IA 1IXRC 3S2WA 1SD7A 2JPBA 3M7GA 2OU2A 1KU2A 2Y0MA 3F8MA 4LB5A 1HKTA 2NAZA 4N0BA 2FBHA 3N4MA 2IRFG 1YIOA 3J80Z 3I53A 1KGSA 1G4DA 4EMSA 4QLCU 4WXDA 4WXCA 1W4MA 2DPUA 3F6VA 5ICEA 4Q5SF 5L3EA 3W6KB 5DD4A 4HZFA 1V4RA 4YIIA 3ZN0A 4KFCA 1MD0A 1XMAA 4BAYA 1UB9A 3K69A 3B73A 3DV8A 4YIFA 1B4AA 1F4KA 5HS7A 5D5XB 4ENMA 2W57A 1SFXA 3KP6A 3L09A 1HSJA 4HF0A 3BJOA 3WE2A 4EM0B 3F8FA 5D6EA 3COAC 4GO1A 4I02A 1QPMA 1E17A 3WE3A 1O3SA 1FLIA 4WCGA 1WWXA 1XGSA 4EJWA 4A6DA 2YPRA 3KLOA 4P5OA 3F23A 3I54A 4LLLA 5ILSA 1B6AA 2VBXA 4ZYDA 4XSXF 4IHSA 2X0LA 4RAZA 5A2QK 3QAHA 4KDPA 2CWEA 1ZRDA 4UVCA 3KP4A 4ZYGA 3ML6A 2OQRA 3WGIA 3EETA 5LHIA 3TO9A 5KK1A 2F5EA 1FZPB 6PAXA 5HLIA 4MTDA 4IPAA 4UVBA 2DU9A 1ZLJA 3H92A 5D5UB 1JHFA 1UHMA 2KIMA 5E18F 4OINF 2FF4A 2VC0A 1FPQA 5BMZA 3MAJA 3K0LA 2VC1A 2W84A 2GQQA 3H3UA 2ZXJA 3QRFF 5E1XA 3DF8A 2Z3YA 3FM3A 1H0MA 3LA3A 3KEQA 2Z9OA 1KU3A 1USSA 3T5XA 3I5UA 2HWVA 4ASNA 4GYGA 4UVAA 4O3MA 4G94A 1I1SA 2KIUA 4Y15A 3G73A 4HYEA 3KE2A 3HOSA 3FF5A 1S7OA 5DCMB 1FT9A 5DUKA 4BHPA 2BBYA 3J7AO 2DAOA 4LLNA 2A6EF 5CVVA 4LLGF 1Q1HA 2D2WA 5LHHA 2WV0A 1Z7UA 2FU4A 1C0WA 2CO5A 5DCFA 3QU6A 1QNTA 3GZ6A 1BC8C 2IW5A 3Q9SA 5K5OA 2XGXA 3RI4A 1ZLKA 5LGUA 4IF4A 2W25A 4OIRF 3RDIA 4EJTA 2ZKZA 1ZREA 3WTYC 4M6XA 2R7DA 2P5VA 1FSEA 2ZCWA 4HQMA 4DNCA 2OA4A 2RKHA 4IRIA 4M9SA 2ISYA 2DO7A 4WK8F 1BM9A 5L3FA 5ERIA 3P9IA 3H3ZA 3CO6C 2ZNYA 3DP7A 2JSCA 5E1ZB 5JR3A 2HZTA 2YU3A 2ETHA 1G3SA 2F5DA 3KZZA 3GEZA 3HSFA 4HOBA 4FX4A 2MH9A 2CW0F 3GZ5A 2ADUA 1ON1A 2KIFA 1XSXA 1T98A 3C18A 3K1NA 1MGTA 4YG2F 2P8TA 1EH7A 1DDNA 2QZ8A 4FT8A 2O03A 3JTGA 3GWZA 1D8JA 1Z6TA 1Z9CA 4A6EA 4CHUA 3IRQA 1KA8A 1ZYRF 2RQPA 2NS0A 1TQMA 4HF1A 1O7FA 2P7CB 2G9WA 1PP8F 2EK5A 3L9FA 1OYIA 2LNBA 3M8FA 3WU0A 4RAYA 1R36A 1R5GA 2F5FA 2P4WA 4ZZLA 2QM3A 4L0YB 2VOPA 5LEJA 3M8EA 1HXDA 2DT5A 3ABTA 2B0LA 3WTVC 1J5YA 3RKXA 3E5XA 1T0FA 1U6GA 3CJNA 2JRTA 4G8XA 5DDGA 4CZZA 1TNSA 3RYRA 4Y13A 2K27A 1GHCA 1E2XA 3GFIA 2EA4A 1RUOA 1UHWA 3OOPA 3ROUA 4M73A 2XASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSV A;  4HLX A;  5H6R A;  1OYY A;  5D4S A;  4I0A A;  1XGO A;  1JE8 A;  4L9V A;  4O5V A;  5D6F A;  3VFZ A;  4WWC A;  1S7A A;  2OZU A;  2RN7 A;  5LRR A;  2DW4 A;  3WU1 B;  4KNY A;  2M30 A;  3P9K A;  2STT A;  3WTX C;  3MZY A;  4QWQ A;  2K86 A;  4O6J A;  1FWZ A;  3F8B A;  4G6D A;  3FMQ A;  2FNP A;  5DYM A;  1YS6 A;  2EFW A;  1YS7 A;  4IJA A;  5BQT A;  3EUH A;  1BC7 C;  2QLZ A;  3QP6 A;  4G6Q A;  3VOE A;  3HRM A;  2L02 A;  1QZY A;  3WTW C;  3DQV C;  2H6C A;  2W85 A;  3P7N A;  3GFM A;  4KIC A;  2BGC A;  4I7H A;  2IP2 A;  3RTR A;  3Q5F A;  4OIQ F;  3V7S A;  3OV8 A;  1DUX C;  3BJA A;  3V7C A;  1ZH5 A;  3ISP A;  1ZGJ A;  2XV4 S;  2A3S A;  2PG4 A;  2XRO A;  1MDM A;  4A5M A;  4MQ9 F;  3N97 A;  1OPC A;  2BYV E;  4LK1 F;  3JSO A;  1PUE E;  3HSR A;  3V8K A;  2LDU A;  1HKS A;  1D3Y A;  2Z99 A;  2Q8K A;  1H9T A;  1G3T A;  2EB7 A;  2H6B A;  1R58 A;  3E97 A;  4XLP F;  4OOI A;  5HDK A;  2WWY A;  1WI9 A;  5E17 F;  2WTE A;  4JBA A;  2Y75 A;  1BI3 A;  2XKO A;  1CGP A;  1O3R A;  5BOX A;  3I64 A;  2XIG A;  2DBB A;  3HYI A;  3FXQ A;  4PDK A;  1KQ0 A;  2ESH A;  2A68 F;  1ON2 A;  3JSP A;  4NQW A;  1JHH A;  1IRG A;  1LJ9 A;  1BI0 A;  2MA3 A;  4E70 A;  5AIQ A;  2VOO A;  4LGW A;  1SFE A;  1MJ9 A;  4MEY F;  5J8F A;  4KIF A;  2IJL A;  1Y0U A;  5EEH A;  5D5W B;  2UXN A;  5FD5 A;  4EJO A;  5BPD A;  2K4B A;  1F9N A;  3DXJ F;  4A2U A;  5DD8 A;  2FRH A;  2GXB A;  2ZFW A;  3IKV A;  1V3F A;  3HTU A;  5JVT A;  4OMY A;  1R22 A;  1KU7 A;  5DCM A;  4TV7 A;  2W24 A;  1ZHF A;  3E6B A;  3LAJ A;  3LWF A;  2P5K A;  4ZYE A;  4MNU A;  1YW9 A;  4BQA A;  1ULY A;  3ZP5 A;  4G7H F;  5D8L B;  1WRJ A;  3GO5 A;  2FML A;  3ERE D;  1BIA A;  2E7X A;  4L9N A;  2AXL A;  5HS8 A;  3ELK A;  2ZME A;  3TKY A;  2V1U A;  4KYW A;  3BY6 A;  3F6O A;  2L01 A;  5JFR A;  1TW3 A;  4ESB A;  4YFX F;  1U78 A;  2V1D A;  2E1C A;  2PBI A;  1BI1 A;  4L0Z B;  4BHB A;  2ELH A;  1U5T C;  4KIG A;  3MQ0 A;  5HOO A;  4LB6 B;  5LHG A;  3EYI A;  1MDM B;  4JK1 X;  4I09 A;  1B9M A;  1R5H A;  2FE3 A;  4ZYH A;  4WXH A;  1IN7 A;  2P5L C;  2E7W A;  3E6M A;  4RGR A;  4M9Z A;  4ENK A;  4EJU A;  1O57 A;  2DTR A;  1I27 A;  4RB0 A;  3WTZ A;  5LEK A;  2IA2 A;  5J6X A;  2FBK A;  2VN2 A;  1ZG3 A;  3E6C C;  4DQ2 A;  1FSH A;  1UST A;  4HA8 A;  3HSE A;  2KKO A;  1EV7 A;  1K79 A;  2GAU A;  3K9T A;  1R1V A;  1Z1D A;  4U0W A;  4I98 B;  3GVA A;  2PMU A;  1FP2 A;  1P4X A;  3REO A;  2RVC A;  2WC2 A;  3F3X A;  1BOA A;  2K02 A;  2UXX A;  1IN8 A;  2EFQ A;  4GCV A;  1R23 A;  1XGN A;  3D5L A;  3ABU A;  1QBJ A;  2P7V B;  1U5T A;  5FO5 A;  3JAM K;  3MZH A;  2IT0 A;  3BOQ A;  2IVM A;  1LQ1 A;  1G3W A;  4PCQ A;  3KP2 A;  4AIK A;  5FLX K;  4EGY A;  1ZG1 A;  3DPL C;  1B9N A;  2HKO A;  3BJ6 A;  4Q48 A;  2QWW A;  3SXY A;  4P96 A;  1LEA A;  3JW4 A;  1DPR A;  2VE8 A;  4M71 A;  3M9A A;  1P92 A;  2FXA A;  2FEZ A;  2H09 A;  3QPH A;  3KET A;  4P9F A;  4ZZD A;  3E3V A;  2NNY A;  3D0S A;  4BH9 A;  1S29 A;  2VOD A;  1U3E M;  3GUD A;  2CSO A;  2A69 F;  1ZRC A;  5LBQ A;  5K5Q A;  4MEX F;  2DI3 A;  3QOP A;  2D1V A;  1QQI A;  1XB4 A;  1P2F A;  3U1D A;  4HW0 A;  4RB3 C;  1Z6R A;  4RGS A;  5F1R A;  3VEP A;  2ZME B;  1VTN C;  4WF2 A;  4UNO A;  5D4R A;  4ETS A;  5A2Q Z;  3PQJ A;  1QZZ A;  2PLY A;  5F64 A;  1HKQ A;  1J7K A;  1MZB A;  1J2X A;  2L4M A;  4HV6 A;  3GXO A;  2FOK A;  5CVR A;  2MBF A;  3BPV A;  4D0P A;  3RYP A;  4Q47 A;  2DK5 A;  2AS5 F;  2VBZ A;  3IHU A;  4ESF A;  5ILV A;  1XGM A;  1AWC A;  5JHU A;  4KN7 X;  4HBL A;  3HIF A;  2M5W A;  4P9U A;  1IF1 A;  3CTA A;  2FBI A;  2O0Y A;  4KUM A;  1WSU A;  3LA2 A;  3EYY A;  1K7A A;  2NRA C;  1LNW A;  5CYV A;  4R8H A;  1ZN2 A;  4OIO F;  1KQ8 A;  4BYY A;  5FFZ A;  3KEO A;  4AWX B;  4EV0 A;  2XHK A;  2JZY A;  5E1W A;  5IT3 A;  3I71 A;  3V8J A;  3HOT A;  5LGN A;  2JPC A;  1J0R A;  1FBU A;  3F8N A;  2XRN A;  5AIP A;  2STW A;  1UFM A;  5L3B A;  2LKP A;  5CLS A;  3BPX A;  1GXP A;  4G9Y A;  3ULQ B;  3G3Z A;  3IRR A;  4CDG A;  4ENN A;  3GLX A;  1O3T A;  1D8K A;  1U5T B;  5LRS A;  1A04 A;  2HEO A;  3QU3 A;  2KJC A;  2Y48 A;  4HX4 A;  5ICG A;  5CVI A;  3T1B A;  4EGZ A;  3J81 K;  4IRH A;  1LEB A;  1B59 A;  1RIO H;  2UWM A;  3V7R A;  1LDK B;  4L9J A;  4MGR A;  4EJV A;  4NHJ A;  2YX4 A;  4FHT A;  1TTY A;  1YW7 A;  3HUG A;  5J8C A;  3RKW A;  2HYF A;  1HQC A;  1MJA A;  3B02 A;  3O6B B;  2TDX A;  4N9I A;  3IL2 A;  5FFX A;  1SD4 A;  1YO5 C;  2ACJ A;  1J59 A;  3M1E A;  4L18 B;  5BS6 A;  5ICF A;  3RIR A;  1K6O A;  5HVQ C;  3JTH A;  2PEX A;  3P9C A;  3MFK A;  1REP C;  1U2W A;  4M6Y A;  3O2P E;  4GGG A;  3I59 B;  3F21 A;  3TOB A;  2J5P A;  1YW8 A;  4HLY A;  5LGT A;  2VXZ A;  2PJP A;  2HDC A;  1LDJ A;  2QUF A;  2QQB A;  2ZBK A;  1TBX A;  4KMU X;  2MD5 A;  4M9X A;  2ESN A;  1RNL A;  2BEO A;  1S3J A;  3HHH A;  4KIB A;  2YSR A;  1I6X A;  1UCR A;  3MEX A;  1W7P D;  4LFU A;  2CYY A;  1FBQ A;  5IT9 K;  1LDD A;  3L2C A;  1QO0 D;  4RGX A;  1LVA A;  2Q0O A;  2O6G E;  1FC3 A;  3E6D A;  2DPD A;  4GXO A;  4R79 A;  3SZP A;  1ZAO A;  1J9I A;  2RC4 A;  5DEQ A;  2PN6 A;  3LFK A;  4LG0 A;  2V79 A;  2VON A;  4U0V A;  1FYM A;  2YR2 A;  4UHT A;  1FOK A;  5L3C A;  4YFK F;  1K78 A;  1P6R A;  2LSO A;  1OKR A;  5LLQ A;  3K1M A;  4IXA A;  2H94 A;  3RJP A;  2F2E A;  3R60 A;  1XCV A;  3J80 K;  2BV6 A;  2OAZ A;  1T6S A;  2DQR A;  3F22 A;  3T0Y A;  2EJR A;  4M74 A;  2KRF A;  2DLL A;  2QEN A;  2J5O A;  3FXR A;  1YYV A;  2HTJ A;  2QQA A;  1G6N A;  3R0J A;  4PGG A;  3DPT A;  4A5N A;  4M72 A;  3GW2 A;  2QBY B;  2HTS A;  4MTE A;  2ZO4 A;  1RUN A;  2OBP A;  3LA7 A;  5H6Q A;  2XAH A;  5D8K B;  1XDU A;  1B1B A;  1IUY A;  4XRF A;  1T2K A;  4HX8 A;  4CXF A;  2EFO A;  4G7O F;  3TGN A;  1X3U A;  4LK0 F;  2GA2 A;  3KP3 A;  3WGG A;  2A07 F;  5FGM A;  4EVI A;  2A5Y B;  3MWM A;  3R4K A;  4HV5 A;  4L5I A;  1ODD A;  2QQ9 A;  3BRO A;  2HFH A;  5DUI A;  4HAM A;  3DKW A;  2HS5 A;  4I2O A;  2HQR A;  4HQE A;  3R6S A;  1H9G A;  4N9H A;  4BNC A;  3V8L A;  1PP7 U;  2PQ8 A;  4LJZ F;  3HRT A;  3TDZ C;  3WGH A;  5D5V B;  2EA2 A;  4AVP A;  1BI2 A;  2COM A;  4G7Z F;  1PDN C;  3C1D A;  2F5C A;  3QPT A;  1W5S A;  4OU0 A;  2P6S A;  1XDS A;  2QYO A;  4AIJ A;  4PZJ A;  3I0T A;  3WOD F;  2M8E A;  2GA1 A;  3ZPL A;  1R1U A;  5ILU A;  1KU9 A;  2PMH A;  1Z05 A;  4F7Z A;  3E5U A;  4NB5 A;  4ESJ A;  4ON0 A;  3RPU A;  3HHG A;  1W5T A;  1YQA A;  2IPQ X;  1W7P A;  3RPQ A;  4LG0 B;  2GIV A;  2R3S A;  2MLG A;  1TQI A;  1KQ9 A;  5HS9 A;  1K78 B;  4UXN A;  4A0X A;  2VE9 A;  4I0B A;  2GXG A;  3Q9V A;  3KZY A;  3I4P A;  2NNN A;  1XSD A;  3KCC A;  5AON A;  3GX4 X;  3FZV A;  4BHC A;  2M1B A;  5HDN A;  4EM1 A;  2KJB A;  1F5T A;  1FP1 D;  1IXC A;  1P4A A;  2L3D A;  1IN6 A;  5EEG A;  3PFI A;  1S8N A;  3E5Q A;  4FX0 A;  4R1H A;  3ZMV A;  1SD5 A;  2XKP A;  1FY7 A;  1XD7 A;  1CF7 A;  1FBS A;  2A6H F;  1FNN A;  3CUQ C;  4EM2 A;  1ZRF A;  4U7D A;  2E1N A;  5ED4 A;  3SFZ A;  2XAQ A;  2VT3 A;  4IHT A;  2BE5 F;  2IA0 A;  1HW5 A;  2EFP A;  2MC3 A;  1YTY A;  4RB2 C;  4UV9 A;  4LD5 A;  2R7F A;  3K2Z A;  3C3W A;  2ZJ2 A;  1OYW A;  1OR7 A;  1I5Z A;  1L0O C;  1TQP A;  2O8X A;  4Y17 A;  3GF2 A;  3KP7 A;  3IWZ A;  1IRF A;  3DFG A;  2FNA A;  2RNJ A;  3BDD A;  3I59 A;  1DP7 P;  2FA5 A;  4KN4 X;  4S04 A;  4RS8 A;  1NHA A;  3F72 A;  2HOE A;  3T8T A;  1S6L A;  3LQR A;  4H0E A;  2CGP A;  3LAP A;  5E8G A;  2Q2E A;  5JI6 A;  1G3Y A;  2IA1 A;  3HRS A;  3JAM Z;  2O61 A;  3PQK A;  1O3Q A;  3WG9 A;  1U8R A;  3CUQ A;  1SMY F;  2K7L A;  2VT2 A;  2HYG D;  4OIP F;  5FLX Z;  3C7J A;  1YLF A;  3CDH A;  5E20 A;  2EV6 A;  2OQG A;  1RZ4 A;  4GYI A;  1W7P B;  1R7J A;  3FMS A;  4HF2 A;  2EV5 A;  3ZN1 A;  4L9T A;  1P4W A;  5K1Y A;  4CYD A;  3BZ6 A;  4Z2Y A;  4K2E A;  3TQN A;  4BXU A;  1MKM A;  1O7L A;  3CO7 C;  4B8X A;  3DEU A;  4XSZ F;  3MCZ A;  4S05 A;  2DFI A;  1DPU A;  5DV5 A;  3IWF A;  3LST A;  3KFW X;  4RB1 A;  2LF8 A;  3I58 A;  2OD5 A;  5K5R A;  1IAW A;  3BWG A;  2XAG A;  1WKM A;  5CVU A;  1XCB A;  3WTU C;  5CJ9 A;  1IXS B;  3NRV A;  2V6C A;  3KLN A;  4U88 A;  3L00 A;  2QVO A;  3T8R A;  2EWN A;  3FMR A;  2VBW A;  1J75 A;  2H27 A;  3SHF A;  4OMZ A;  5TJJ A;  3NEU A;  4MQV A;  4KT5 C;  1LB2 A;  1JXS A;  1Z91 A;  4PGH A;  3SQN A;  3TO7 A;  2QBY A;  4AD9 A;  4UUV A;  2RGV A;  1TNT A;  2CG4 A;  1IN4 A;  1BIB A;  1TW2 A;  3WTS C;  1OMI A;  5L3D A;  1CF7 B;  2NYX A;  1FX7 A;  2OZ6 A;  2HQN A;  2YX7 A;  1T39 A;  5H20 A;  1IW7 F;  2M87 A;  2M45 A;  2CQK A;  3ZMD A;  2RV8 A;  1YFH A;  3EQL F;  3R61 A;  3GFL A;  4A12 A;  5BPI A;  1L3L A;  4A0Z A;  3TO6 A;  4RGU A;  2GWR A;  1HW2 A;  1AOY A;  4P55 A;  3FX3 A;  1HBX G;  2ISZ A;  1TLH B;  3ZMU A;  1SFU A;  1KYZ A;  3U2R A;  2G7H A;  1F1Z A;  5HLG A;  4JQF A;  3SZT A;  2C6Y A;  1JGS A;  3WTT C;  1HST A;  3ZMT A;  2LF7 A;  2K4J A;  3GFJ A;  5HLH A;  3ZMS A;  3RKY A;  3R0A A;  2PI0 A;  1EH8 A;  1QGP A;  3QP5 A;  4CO8 A;  4HDU A;  1BJA A;  3CUQ B;  2D45 A;  3AAF A;  4WX9 A;  2O3F A;  5ICC A;  1I1G A;  1R00 A;  2XUB A;  3J81 Z;  3TDU C;  2P6T A;  1STZ A;  3W6J B;  2GZW A;  2L54 A;  1YG2 A;  1R1T A;  2XVC A;  2A61 A;  5FB2 A;  3HTS B;  3IKT A;  1T38 A;  1ZG5 A;  2FQ3 A;  1MJB A;  4ZH4 F;  2XAF A;  1FYL A;  1EH6 A;  2VBY A;  3CLO A;  1XMK A;  5HDG A;  4U0Y A;  2UZK A;  1XN7 A;  5KVR A;  3L7W A;  3IC7 A;  2JTV A;  2EFN A;  4U7B A;  3K1P A;  1ONV A;  5L3G A;  4KA4 A;  1RI7 A;  5CVJ A;  2D1H A;  1IN5 A;  4CIC A;  3U9G A;  2G7U A;  1BN5 A;  1KYW A;  1ZGA A;  1GVJ A;  3F8C A;  4I01 A;  2HGC A;  4HX7 A;  1FYK A;  2FMY A;  4HDV A;  4B09 A;  3FHZ A;  3ZMZ A;  2Z33 A;  4YFN F;  2RDP A;  3FWE A;  3TOA A;  3O3K A;  1D5V A;  2DQL A;  4UV8 A;  3KP5 A;  2V1X A;  1ZAR A;  1SD6 A;  4EQQ A;  3LQQ A;  4IRG A;  4XLN F;  1SMT A;  3ECO A;  3NQO A;  1WQ2 A;  2JT1 A;  5TRD A;  4MHG A;  2X4H A;  1HW1 A;  4KMF A;  4XBF A;  2Z5U A;  3ECH A;  4ENJ A;  4Q4Z F;  1IZ1 A;  2XAJ A;  3VOD A;  3V4G A;  2L4A A;  2FSW A;  2MLK A;  4IVN A;  2MH2 A;  2ZNZ A;  4AIH A;  3BP8 A;  5IT9 Z;  1SAX A;  4A0Y A;  1GXQ A;  2PFB A;  5FD6 A;  2HKX A;  5F6F A;  3ZQ7 A;  3HRU A;  4LMY A;  2DK8 A;  3GYH X;  3VB2 A;  2V9V A;  3CUO A;  2EV0 A;  3EDP A;  3FXU A;  3FM5 A;  4CGZ A;  2HR3 A;  1BBY A;  4L5J A;  2CFX A;  5E8I A;  1IXR C;  3S2W A;  1SD7 A;  2JPB A;  3M7G A;  2OU2 A;  1KU2 A;  2Y0M A;  3F8M A;  4LB5 A;  1HKT A;  2NAZ A;  4N0B A;  2FBH A;  3N4M A;  2IRF G;  1YIO A;  3J80 Z;  3I53 A;  1KGS A;  1G4D A;  4EMS A;  4QLC U;  4WXD A;  4WXC A;  1W4M A;  2DPU A;  3F6V A;  5ICE A;  4Q5S F;  5L3E A;  3W6K B;  5DD4 A;  4HZF A;  1V4R A;  4YII A;  3ZN0 A;  4KFC A;  1MD0 A;  1XMA A;  4BAY A;  1UB9 A;  3K69 A;  3B73 A;  3DV8 A;  4YIF A;  1B4A A;  1F4K A;  5HS7 A;  5D5X B;  4ENM A;  2W57 A;  1SFX A;  3KP6 A;  3L09 A;  1HSJ A;  4HF0 A;  3BJO A;  3WE2 A;  4EM0 B;  3F8F A;  5D6E A;  3COA C;  4GO1 A;  4I02 A;  1QPM A;  1E17 A;  3WE3 A;  1O3S A;  1FLI A;  4WCG A;  1WWX A;  1XGS A;  4EJW A;  4A6D A;  2YPR A;  3KLO A;  4P5O A;  3F23 A;  3I54 A;  4LLL A;  5ILS A;  1B6A A;  2VBX A;  4ZYD A;  4XSX F;  4IHS A;  2X0L A;  4RAZ A;  5A2Q K;  3QAH A;  4KDP A;  2CWE A;  1ZRD A;  4UVC A;  3KP4 A;  4ZYG A;  3ML6 A;  2OQR A;  3WGI A;  3EET A;  5LHI A;  3TO9 A;  5KK1 A;  2F5E A;  1FZP B;  6PAX A;  5HLI A;  4MTD A;  4IPA A;  4UVB A;  2DU9 A;  1ZLJ A;  3H92 A;  5D5U B;  1JHF A;  1UHM A;  2KIM A;  5E18 F;  4OIN F;  2FF4 A;  2VC0 A;  1FPQ A;  5BMZ A;  3MAJ A;  3K0L A;  2VC1 A;  2W84 A;  2GQQ A;  3H3U A;  2ZXJ A;  3QRF F;  5E1X A;  3DF8 A;  2Z3Y A;  3FM3 A;  1H0M A;  3LA3 A;  3KEQ A;  2Z9O A;  1KU3 A;  1USS A;  3T5X A;  3I5U A;  2HWV A;  4ASN A;  4GYG A;  4UVA A;  4O3M A;  4G94 A;  1I1S A;  2KIU A;  4Y15 A;  3G73 A;  4HYE A;  3KE2 A;  3HOS A;  3FF5 A;  1S7O A;  5DCM B;  1FT9 A;  5DUK A;  4BHP A;  2BBY A;  3J7A O;  2DAO A;  4LLN A;  2A6E F;  5CVV A;  4LLG F;  1Q1H A;  2D2W A;  5LHH A;  2WV0 A;  1Z7U A;  2FU4 A;  1C0W A;  2CO5 A;  5DCF A;  3QU6 A;  1QNT A;  3GZ6 A;  1BC8 C;  2IW5 A;  3Q9S A;  5K5O A;  2XGX A;  3RI4 A;  1ZLK A;  5LGU A;  4IF4 A;  2W25 A;  4OIR F;  3RDI A;  4EJT A;  2ZKZ A;  1ZRE A;  3WTY C;  4M6X A;  2R7D A;  2P5V A;  1FSE A;  2ZCW A;  4HQM A;  4DNC A;  2OA4 A;  2RKH A;  4IRI A;  4M9S A;  2ISY A;  2DO7 A;  4WK8 F;  1BM9 A;  5L3F A;  5ERI A;  3P9I A;  3H3Z A;  3CO6 C;  2ZNY A;  3DP7 A;  2JSC A;  5E1Z B;  5JR3 A;  2HZT A;  2YU3 A;  2ETH A;  1G3S A;  2F5D A;  3KZZ A;  3GEZ A;  3HSF A;  4HOB A;  4FX4 A;  2MH9 A;  2CW0 F;  3GZ5 A;  2ADU A;  1ON1 A;  2KIF A;  1XSX A;  1T98 A;  3C18 A;  3K1N A;  1MGT A;  4YG2 F;  2P8T A;  1EH7 A;  1DDN A;  2QZ8 A;  4FT8 A;  2O03 A;  3JTG A;  3GWZ A;  1D8J A;  1Z6T A;  1Z9C A;  4A6E A;  4CHU A;  3IRQ A;  1KA8 A;  1ZYR F;  2RQP A;  2NS0 A;  1TQM A;  4HF1 A;  1O7F A;  2P7C B;  2G9W A;  1PP8 F;  2EK5 A;  3L9F A;  1OYI A;  2LNB A;  3M8F A;  3WU0 A;  4RAY A;  1R36 A;  1R5G A;  2F5F A;  2P4W A;  4ZZL A;  2QM3 A;  4L0Y B;  2VOP A;  5LEJ A;  3M8E A;  1HXD A;  2DT5 A;  3ABT A;  2B0L A;  3WTV C;  1J5Y A;  3RKX A;  3E5X A;  1T0F A;  1U6G A;  3CJN A;  2JRT A;  4G8X A;  5DDG A;  4CZZ A;  1TNS A;  3RYR A;  4Y13 A;  2K27 A;  1GHC A;  1E2X A;  3GFI A;  2EA4 A;  1RUO A;  1UHW A;  3OOP A;  3ROU A;  4M73 A;  2XAS A; 
#chains in the Genus database with same CATH topology
 1XSV A;  4A3C J;  4HLX A;  2R7X A;  3HEF A;  1ZKG A;  5H6R A;  1OYY A;  5D4S A;  4I0A A;  1HDP A;  1XGO A;  3CCY A;  1JE8 A;  3B6A A;  3LSG A;  4L9V A;  4O5V A;  5D6F A;  5B1A H;  3VFZ A;  4WWC A;  2Y9Z A;  1S7A A;  2OZU A;  2RN7 A;  2DA4 A;  5LRR A;  1NG6 A;  2KIQ A;  2DW4 A;  3DKY A;  3WU1 B;  4KNY A;  2KLO A;  3U1K A;  3AL0 C;  5K7Z A;  2M30 A;  2HDW A;  3P9K A;  2ID6 A;  3S14 J;  2STT A;  3WTX C;  3B6C A;  1LKX A;  3MZY A;  4QWQ A;  1TC3 C;  2K86 A;  3AG4 H;  3ESW B;  4O6J A;  3H3V K;  4XKC A;  2X85 A;  1FWZ A;  2Q1Z B;  3F8B A;  4G6D A;  3FMQ A;  3O8H A;  4JX6 A;  2FNP A;  5DYM A;  1YS6 A;  3NWT A;  1YS7 A;  4HG2 A;  3HXL A;  3EUH A;  4IJA A;  4MLO A;  5BQT A;  4RLF A;  4C2M J;  1BC7 C;  2QLZ A;  3QP6 A;  4G6Q A;  3VOE A;  3HRM A;  2L02 A;  4P1W A;  1S7E A;  1QZY A;  3A4C A;  4Z6Y A;  3WTW C;  3DQV C;  2H6C A;  2DFH A;  5F27 A;  5EZG A;  2W85 A;  3DLA A;  3P7N A;  4OAY A;  3GFM A;  1BW5 A;  2OUM A;  4RM3 A;  1Y1W J;  2ZB9 A;  4KIC A;  2BGC A;  4I7H A;  4F55 A;  2IP2 A;  2E71 A;  4XR6 A;  2VB6 A;  1LE8 B;  1GV5 A;  1PUF A;  3RTR A;  3Q5F A;  4OIQ F;  3BTI A;  3V7S A;  3OV8 A;  1A6I A;  2L9R A;  3PM1 A;  2HVS A;  1DUX C;  2MSY A;  1GLN A;  3BJA A;  1Y8R B;  2MD0 A;  3V7C A;  4BXX J;  1ZH5 A;  2DYR H;  4G6T B;  2MFZ A;  3A01 B;  3ISP A;  2JWT A;  1ZGJ A;  3QYF A;  1TP4 A;  1WJC A;  2XV4 S;  2A3S A;  3ZOB A;  2PG4 A;  1R4N B;  2XRO A;  1MDM A;  3S8P A;  4A5M A;  2Y69 H;  4MQ9 F;  1AKH A;  1G2H A;  2ELJ A;  1NK3 P;  2JA6 J;  3RQI A;  3BR2 A;  3N97 A;  3I56 I;  1OPC A;  5KCM A;  2BYV E;  4LK1 F;  4B47 A;  3JSO A;  1PUE E;  3HSR A;  4FE7 A;  3V8K A;  2LDU A;  5DTD A;  1HKS A;  1D3Y A;  2Z99 A;  2Q8K A;  1H9T A;  1G3T A;  2EB7 A;  2H6B A;  1R58 A;  3A02 A;  3E97 A;  4XLP F;  3W2W A;  4OOI A;  5HDK A;  1JKR C;  3SDG A;  2WWY A;  1WI9 A;  4BDY A;  1MSE C;  5E17 F;  2WTE A;  4JBA A;  4BJT A;  2Y75 A;  2OC6 A;  3PO3 J;  1BI3 A;  2LRD A;  2XKO A;  1CGP A;  2Y30 A;  1O3R A;  5EGO B;  5FRN A;  3W3C A;  3P5J A;  5BOX A;  5EJC A;  3I64 A;  2XIG A;  2DBB A;  1QVU A;  3HYI A;  3FXQ A;  4PDK A;  3FBN B;  3LFU A;  2P0W A;  3BR5 A;  5H2F C;  4XMY A;  1JKP C;  1DU6 A;  3JR9 A;  1KQ0 A;  3Q0V A;  4M3D A;  2DOA A;  2ESH A;  2ZME C;  4JP0 A;  3OY9 A;  5GTI C;  2A68 F;  1ON2 A;  3JSP A;  2DDB A;  5HLT A;  1CQT A;  4W1U A;  2ZJP F;  4NQW A;  4BKX A;  3ZQF A;  1JHH A;  3LOC A;  2EIJ H;  3S1R J;  1IRG A;  1LJ9 A;  3WHB A;  2GOX B;  1BI0 A;  2LVS A;  1JJ8 C;  2MA3 A;  2XPV A;  4E70 A;  1RR8 C;  5AIQ A;  1PYV A;  4NUB A;  5GPA A;  2Z1D A;  3OYB A;  1MMN A;  2VOO A;  4LGW A;  1SFE A;  1MJ9 A;  3HUG B;  2LBF B;  5E3M A;  1RES A;  2QF7 A;  4MEY F;  4XOP A;  1V54 H;  5J8F A;  4KIF A;  2IJL A;  1Y0U A;  5EEH A;  5D5W B;  2UXN A;  3L2W A;  5FD5 A;  4EJO A;  3DTE A;  4CCM A;  3GTJ J;  5BPD A;  2CV2 A;  2K4B A;  2LY9 A;  4J00 A;  1F9N A;  3DXJ F;  4A2U A;  5DD8 A;  2PJR A;  2FRH A;  1Z21 A;  2O7O A;  2GXB A;  2VIX A;  2ZFW A;  3IKV A;  1V3F A;  3HTU A;  5JVT A;  4OMY A;  1R22 A;  2ECC A;  1KU7 A;  5DCM A;  4XKV A;  3OL3 A;  4TV7 A;  2W24 A;  1ZHF A;  3E6B A;  3LAJ A;  3LWF A;  2P5K A;  1QA6 A;  4ZYE A;  1ETO A;  2Y9Y A;  4MNU A;  1YW9 A;  3C2B A;  4BQA A;  2LLK A;  5IP6 A;  3OS0 A;  5CQE A;  2M4G A;  1ULY A;  2EIL H;  2UV1 A;  3ZP5 A;  4G7H F;  3ZRG A;  5D8L B;  4NBQ A;  1WRJ A;  3GO5 A;  4MIM A;  2FML A;  3ERE D;  2WY8 Q;  2HXI A;  1BIA A;  2E7X A;  2CQ7 A;  4L9N A;  2AXL A;  5JHF A;  1XTA A;  2VKV A;  3ELK A;  5HS8 A;  5F0F A;  5CPR B;  2ZME A;  3TKY A;  2V1U A;  2LY1 A;  1K6Y A;  4KYW A;  5F08 A;  3BY6 A;  3CCM I;  3BQY A;  3OYA A;  3FK6 A;  2IGK A;  3F6O A;  1WGX A;  2L01 A;  1A35 A;  5JFR A;  2E5N A;  1WJE A;  5J4V A;  2R7T A;  4H4K C;  4D5F A;  1TW3 A;  4ESB A;  5B66 C;  4YFX F;  4XIC A;  1JTX A;  1X3Z B;  3S17 J;  1U78 A;  2V1D A;  1F36 A;  4XK4 A;  2WAE A;  2VLA A;  2L2O A;  2E1C A;  2PBI A;  1BI1 A;  3HZJ A;  4L0Z B;  4BHB A;  3VYU B;  3OYC A;  2ELH A;  1U5T C;  4I76 A;  4KIG A;  3MQ0 A;  5HOO A;  4LB6 B;  1IUF A;  2OJE D;  5LHG A;  3EYI A;  2L9N A;  3PNV A;  1MDM B;  1DQU A;  4JK1 X;  3EUA A;  4I09 A;  1B9M A;  3VWB A;  1R5H A;  2FE3 A;  4ZYH A;  2RAE A;  1AKH B;  2TRT A;  1X1D A;  4WXH A;  1T08 B;  2R93 J;  1IN7 A;  2P5L C;  2E7W A;  3E6M A;  3LSM A;  4RGR A;  1NH3 A;  3GTO J;  3LSR A;  4M9Z A;  4ENK A;  4EJU A;  2NVU B;  1O57 A;  2DTR A;  3A0H C;  4G12 A;  3AL0 B;  1I27 A;  3CJQ B;  4RB0 A;  3WTZ A;  5LEK A;  2RQQ A;  2DDA A;  3F0C A;  2IA2 A;  1MBE A;  3S93 A;  1ACI A;  2CS3 A;  5J6X A;  2FBK A;  4IX7 A;  2EZI A;  2NVX J;  3S1Q J;  2VN2 A;  1VZ0 A;  2N8G A;  1ZG3 A;  3E6C C;  4DQ2 A;  2LP0 A;  1FSH A;  1UST A;  4HA8 A;  3HC7 A;  1JGG A;  3HSE A;  1T56 A;  5C4X J;  2KKO A;  2QQ8 A;  1EV7 A;  5FKO A;  1K79 A;  2GAU A;  3K9T A;  1R1V A;  2XF7 A;  2ZJR F;  1Z1D A;  4U0W A;  4I98 B;  3X2Q H;  3HPG A;  2L7F P;  3GVA A;  2PMU A;  2DFE A;  1FP2 A;  1P4X A;  3REO A;  4Y7N J;  3LMM A;  2RVC A;  4XQF A;  1GV2 A;  3K4C A;  2WC2 A;  3L2R A;  3E7L A;  3F3X A;  1BOA A;  2K02 A;  2UXX A;  1IN8 A;  2M9H A;  2DA5 A;  2EFQ A;  1HC8 A;  3QOD A;  4GCV A;  1R23 A;  1XGN A;  3D5L A;  3C2G A;  2ZSI B;  3ABU A;  2CV0 A;  2WB1 A;  3FXO A;  4XON A;  5EG0 B;  5E3O A;  1QBJ A;  3J7Z I;  4IHV A;  1UJ8 A;  3CP8 A;  2P7V B;  1U5T A;  1X4O A;  5FO5 A;  3JAM K;  4NQW B;  4FTH A;  3MZH A;  1FOY A;  4V2G A;  2IT0 A;  3BOQ A;  2IVM A;  3KYD B;  1LQ1 A;  1IV6 A;  1G3W A;  4PCQ A;  2OCE A;  3KP2 A;  4AIK A;  5J1R A;  3HL2 A;  3IAS 2;  1K4T A;  5FLX K;  4EGY A;  1ZG1 A;  3DPL C;  3ZQC A;  1LFP A;  4HST A;  2CW7 A;  5CKT A;  1B9N A;  2HKO A;  3VDX A;  2JJ7 A;  3BJ6 A;  4N4O B;  2QWW A;  4Q48 A;  3SXY A;  4DYR A;  4P96 A;  1LEA A;  2BXZ A;  3JW4 A;  1DPR A;  2CUE A;  3CC4 I;  2BHZ A;  2VE8 A;  1OCR H;  4M71 A;  3M9A A;  5DS9 A;  4E7K A;  5EYR A;  1W0T A;  5DM7 F;  1P92 A;  2FXA A;  2FEZ A;  2H09 A;  2HVQ A;  3QPH A;  4PFO A;  3KET A;  4P9F A;  4XLC A;  4ZZD A;  3E3V A;  2NNY A;  3D0S A;  4BH9 A;  2B7E A;  2NS7 A;  4ZTF A;  1S29 A;  3FHN A;  2VOD A;  2ZSH B;  1U3E M;  3GUD A;  1OCT C;  2CSO A;  3PFY A;  4PJL A;  2A69 F;  1P7I A;  2G0E A;  5FJ8 J;  1ZRC A;  4U87 A;  2F48 A;  5GP9 A;  5LBQ A;  5K5Q A;  4MEX F;  2DI3 A;  3QOP A;  1S9H A;  2D1V A;  2NOJ B;  3KPH A;  4M6V A;  3S16 J;  1MND A;  2E1M C;  3OYJ A;  4XN3 A;  4A93 J;  1QQI A;  2K3F A;  2JK3 A;  1P2F A;  1XB4 A;  1IGN A;  2XRL A;  3U1D A;  1IO2 A;  4HW0 A;  4RB3 C;  1Z6R A;  4RGS A;  2K9L A;  2WAQ N;  3QQA A;  5F1R A;  3VEP A;  2ZME B;  3BC8 A;  1VTN C;  1LFU P;  2DMN A;  4WF2 A;  4UNO A;  4AUX A;  4ETS A;  5D4R A;  3PQJ A;  5A2Q Z;  1QZZ A;  5M3F J;  2PLY A;  4IHX A;  5F64 A;  1HKQ A;  3KIO A;  1J7K A;  3MKZ A;  3MN2 A;  4XLF A;  1MZB A;  1J2X A;  2L4M A;  4HV6 A;  3GXO A;  5B1B H;  2FOK A;  5CVR A;  2E2J J;  2MBF A;  4CH7 A;  3IUO A;  3JRI A;  3BPV A;  2QKL B;  4D0P A;  2WV1 A;  3S2H J;  2DCE A;  2XDV A;  3RYP A;  4Q47 A;  2ZC2 A;  2DK5 A;  2AS5 F;  2VBZ A;  3IHU A;  1X1C A;  4ESF A;  3ABL H;  1R9T J;  3ASO H;  4XOR A;  5ILV A;  1MW7 A;  3G1L A;  1XGM A;  1ZR2 A;  2OV7 A;  5FRM A;  3VYR B;  1YJ9 I;  1AWC A;  5JHU A;  4KN7 X;  4HBL A;  2ZJQ F;  3HIF A;  2M5W A;  4P9U A;  1IF1 A;  3CTA A;  3AKZ A;  2FBI A;  2O0Y A;  4IHY A;  1PVE A;  4IL6 C;  2M34 A;  3EPZ A;  4KUM A;  1WSU A;  3LA2 A;  3EYY A;  3I3L A;  1OIS A;  2V7F A;  1K7A A;  3OYD A;  2NRA C;  2R5Y A;  1LNW A;  5CYV A;  2LYC A;  4R8H A;  1ZN2 A;  1E3O C;  4OIO F;  1DGW Y;  1KQ8 A;  1FJL A;  4BYY A;  5TIS C;  5FFZ A;  3KEO A;  2L5Q A;  4AWX B;  4EV0 A;  3QYB A;  1H8A C;  2XHK A;  2ME6 A;  3D1N I;  5IPA A;  4B4C A;  3JRA A;  2MG4 A;  2JZY A;  5E1W A;  4E7J A;  5IT3 A;  3JRF A;  4A3G J;  3I71 A;  3V8J A;  4J19 A;  4CCN A;  3HOT A;  1RRJ A;  5LGN A;  2JPC A;  3DTI A;  1I3Q J;  5FKL A;  1J0R A;  4IEJ A;  1FBU A;  3F8N A;  2XRN A;  5AIP A;  2STW A;  2KDZ A;  5TGT A;  2IGM A;  1VQ9 I;  4Y3O A;  1UFM A;  5L3B A;  2LKP A;  5CLS A;  3BPX A;  1GXP A;  2HDD A;  3CDI A;  1G8X A;  4G9Y A;  3CJR B;  3ULQ B;  3G3Z A;  2M2E A;  2LD5 A;  3LSK A;  2LMD A;  3LSP A;  3IRR A;  1BL0 A;  1HOM A;  1QZE A;  4CDG A;  4ENN A;  3GLX A;  1O3T A;  1D8K A;  3RCO A;  1U5T B;  5LRS A;  1BA5 A;  1A04 A;  3OR2 C;  4JOM A;  2HEO A;  2JA8 J;  1QHH D;  3QU3 A;  2BZT A;  1YHQ I;  4F3Q A;  2KJC A;  3PL8 A;  2LKX A;  1VQK I;  2JSP A;  5K7F A;  2Y48 A;  4HX4 A;  3OYM A;  4F93 B;  2KQR A;  5ICG A;  2WY7 Q;  3NAU A;  1Y0N A;  5CVI A;  3OIO A;  3OSF A;  2CQQ A;  3T1B A;  3TMO A;  4EGZ A;  5C44 J;  2VKH A;  4IRH A;  3J81 K;  1ERD A;  1LEB A;  2PMZ A;  3OYK A;  1MIJ A;  2LG4 A;  3ABM H;  4BY1 J;  2LH9 A;  2TCT A;  3QOE A;  3MKW B;  5GAG J;  1B59 A;  1RIO H;  1PJR A;  3V7R A;  2UWM A;  1LDK B;  3HOV J;  4L9J A;  4MGR A;  4EJV A;  4NHJ A;  2YX4 A;  4C9Y A;  4FHT A;  1TTY A;  1YW7 A;  2LBF A;  2CW8 A;  3HUG A;  2Y2Z A;  5J8C A;  3RKW A;  4PJ0 C;  2QCO A;  2B9S A;  2HYF A;  4E7I A;  1MH4 A;  2R7W A;  2QSH X;  1HQC A;  1MJA A;  1NG7 A;  3B02 A;  2R4G A;  3O6B B;  3SDB A;  4DIQ A;  2TDX A;  4M3B A;  1KON A;  3ZGK A;  4CCO A;  4N9I A;  3IL2 A;  1XX5 A;  1I50 J;  2R7S A;  1RKW A;  5FFX A;  3HJE A;  1SD4 A;  2V9P A;  1YO5 C;  2ACJ A;  1J59 A;  2KT0 A;  4GRI A;  4D5C A;  3U21 A;  1VQ4 I;  3M1E A;  2XPU A;  4L18 B;  5BS6 A;  5ICF A;  3S3O A;  1FMV A;  2R7R A;  2BW3 A;  2QA4 I;  1ETW A;  2EIM H;  2H1L A;  2HU9 A;  4Y33 A;  3CC2 I;  3RIR A;  3VSK A;  2QKM B;  1K6O A;  1FOW A;  3JTH A;  5HVQ C;  2PEX A;  3P9C A;  3SEZ A;  3MFK A;  4E7H A;  1SVM A;  1AU7 A;  1REP C;  1U2W A;  3KYC B;  4XN0 A;  4M6Y A;  3O2P E;  4BUP A;  4GGG A;  3I59 B;  1TL8 A;  1OCC H;  2AHQ A;  2K9Q A;  3F21 A;  3TOB A;  2DTZ A;  2J5P A;  1Z3Y A;  1LVK A;  1M1E B;  2A05 A;  1YW8 A;  3MD2 A;  3QYE A;  3BR0 A;  5LGT A;  5KAI C;  2VXZ A;  4HLY A;  4EAT A;  5KAF C;  3CME I;  3E0J B;  2PJP A;  3Q0W A;  5E79 C;  2HOT A;  2HDC A;  3W2A A;  2EZL A;  4C2U A;  2Q2E B;  1LDJ A;  2MAB A;  1SEU A;  2QUF A;  2QQB A;  2ZBK A;  2K40 A;  1TBX A;  2XGE A;  1R4M B;  4AYB A;  2XB5 A;  2CMP A;  3PIO F;  1D5Y A;  4KMU X;  2MD5 A;  4M9X A;  1Z3X A;  3CCU I;  1BR1 A;  2WB1 N;  1MBG A;  3RQ4 A;  2ESN A;  2R7Z J;  3GCM A;  2W7N A;  1RNL A;  2KZG A;  1B72 B;  1WJF A;  5J4Y A;  2BEO A;  1H88 C;  5IY5 H;  1S3J A;  3HHH A;  3RPU D;  4KIB A;  2YSR A;  1I6X A;  3OWT A;  3I9V 2;  3ZQH A;  1UCR A;  3MEX A;  1W7P D;  3K70 D;  1MMA A;  4LFU A;  3V42 A;  2R5Y B;  5J40 A;  2KFD A;  2CYY A;  4D9J A;  1N75 A;  2E1M B;  1FBQ A;  1IG7 A;  2CV1 A;  5IT9 K;  3CES A;  3UNG C;  4BGD A;  1LDD A;  3ZXS A;  2BOL A;  1XG1 A;  3L2C A;  2MC4 A;  3CD6 I;  1QO0 D;  4RGX A;  2FUG 2;  3WG7 H;  4ZJZ A;  1LVA A;  1FOX A;  2X1E A;  5M5X J;  2Q0O A;  3ZQI A;  2O6G E;  1FC3 A;  2LC2 A;  3E6D A;  4HPQ A;  4QSH A;  2DPD A;  4GXO A;  4E7Z A;  3EUK L;  1JJ6 C;  4KIS A;  4BXF A;  4R79 A;  3SZP A;  2K3P A;  1TWF J;  3HGY A;  1ZAO A;  3HGG A;  1J9I A;  1YE9 A;  2LOO A;  2RC4 A;  3SZG A;  2CU7 A;  3BG9 A;  5DEQ A;  2PN6 A;  3LFK A;  4LG0 A;  1ZGW A;  2V79 A;  4HNU A;  3W6V A;  2VON A;  1VQL I;  1E0E A;  4U0V A;  2DXI A;  4JYK A;  1FYM A;  2W4S A;  2YR2 A;  3IAM 2;  4UHT A;  2A6T A;  1MSF C;  1FOK A;  5L3C A;  4YFK F;  1K78 A;  1P6R A;  4LIU A;  3BG7 A;  3BT9 A;  2DA2 A;  2LSO A;  1OKR A;  5LLQ A;  5FKK A;  3K1M A;  4IXA A;  4B44 A;  4F91 B;  4UUS A;  2H94 A;  3RJP A;  1U9O A;  3OYE A;  1ORK A;  2F2E A;  3R60 A;  2WAD A;  1XCV A;  2EIN H;  1MBF A;  3PSI A;  4A3D J;  3J80 K;  1WFX A;  2BV6 A;  2OAZ A;  1T6S A;  3PNY A;  5IOY A;  2KRH A;  1Z0X A;  3GTM J;  1V5E A;  3CCV I;  2DQR A;  2HQ5 A;  1OQY A;  5EG0 A;  3F22 A;  3T0Y A;  2EJR A;  3H9J A;  4RBO A;  1DGR M;  4M74 A;  3JCU C;  2KRF A;  1ZK8 A;  2DLL A;  1Y56 A;  2ME0 A;  2QEN A;  2J5O A;  3FXR A;  3DBR B;  3FKJ A;  1YYV A;  2HTJ A;  2QQA A;  1G6N A;  3R0J A;  4PGG A;  3DPT A;  4A5N A;  4RAF A;  4M72 A;  2M8G X;  2HVR A;  3GW2 A;  2QBY B;  2DJN A;  2HTS A;  4MTE A;  2ZO4 A;  1MMD A;  1RUN A;  2OBP A;  2DA3 A;  3LA7 A;  5H6Q A;  2XAH A;  5D8K B;  1XDU A;  1B1B A;  1A6Q A;  4A3M J;  4BL0 B;  1IUY A;  2X9D A;  2LK2 A;  3IH2 A;  4XRF A;  1T2K A;  3BG3 A;  2VKE A;  3TP0 A;  4HX8 A;  1UG0 A;  1WCM J;  3KZI C;  1LFB A;  1SC7 A;  3WU2 C;  3ABK H;  4CXF A;  3M1C A;  1FIA A;  2R7Q A;  2EFO A;  4G7O F;  3TGN A;  1X3U A;  4LK0 F;  2GA2 A;  4AU7 A;  3KP3 A;  4PJM A;  1Z77 A;  3WGG A;  4LG3 A;  2A07 F;  5FGM A;  4EVI A;  2H8R A;  2A5Y B;  3MWM A;  3HKZ A;  2IGN A;  3R4K A;  4HV5 A;  5B5E C;  2JVH A;  2E2I J;  1UZC A;  4L5I A;  2BW3 B;  2DMP A;  3DCF A;  2EFW A;  3FXK A;  1ODD A;  2QQ9 A;  1XC5 A;  1OCZ H;  3K70 C;  3CMA I;  3BRO A;  2HFH A;  3DBL B;  5DUI A;  1DU0 A;  4HAM A;  4ANJ A;  3KYL A;  3DKW A;  4A3E J;  2HS5 A;  3SJM A;  3AFH A;  4I2O A;  2K5C A;  3DEW A;  2HQR A;  1NTC A;  1BW6 A;  2L7Z A;  4HQE A;  3R6S A;  1H9G A;  2BVL A;  4N9H A;  4BNC A;  2KL4 A;  3BR3 A;  3JRE A;  3V8L A;  1PP7 U;  4A3L J;  2XF5 A;  4QIW N;  2ECB A;  2PQ8 A;  4LJZ F;  1WJB A;  3HRT A;  5LD2 C;  3VPR A;  3TDZ C;  3WGH A;  5D5V B;  1JT6 A;  3BQZ A;  2EA2 A;  4AVP A;  1BI2 A;  3PUB A;  2COM A;  2XPW A;  4LOC A;  2XSJ C;  4G7Z F;  1IJW C;  2JA2 A;  1PDN C;  3BLY A;  3C1D A;  2F5C A;  1JT0 A;  3QPT A;  2DMT A;  3FXL A;  1W5S A;  1R6R A;  1VI0 A;  4OU0 A;  4D7N A;  3M3Y J;  4JX4 A;  2P6S A;  1XDS A;  5GAE J;  4IQJ A;  3SYT A;  4IQ4 A;  2GBY A;  4C2T A;  2ZXH A;  1RPW A;  2QYO A;  4AIJ A;  4BBS J;  4PZJ A;  3I0T A;  4CYC A;  3WOD F;  2M8E A;  1LPQ A;  1YOV B;  2EZK A;  2GA1 A;  5E3L A;  3ZPL A;  1R1U A;  1D1C A;  5ILU A;  1KU9 A;  2PMZ N;  2PMH A;  1Z05 A;  4F7Z A;  3E5U A;  4DW6 A;  4NB5 A;  4X6A J;  4ESJ A;  4ON0 A;  4N4N B;  3OYN A;  4BE0 A;  3K4B A;  3RPU A;  3HHG A;  1W5T A;  1WJD A;  1JUP A;  1YQA A;  1WZ2 A;  1X1B A;  2IPQ X;  1W7P A;  1VQ5 I;  3S2D J;  3RPQ A;  4LG0 B;  1IRZ A;  2GIV A;  2R3S A;  2MLG A;  2JRM A;  1TQI A;  2JQ7 A;  1KQ9 A;  5HS9 A;  4AID A;  2XGC A;  2VKD A;  1K78 B;  2HYJ A;  2VJ5 A;  2VUM J;  4C3J J;  4NNJ A;  4UXN A;  4MFE A;  1A36 A;  4A0X A;  2VE9 A;  3D5S C;  3M07 A;  4I0B A;  2GXG A;  4UUS B;  5F0H A;  3Q9V A;  4BQO A;  2DA7 A;  2HPI A;  2VPL A;  1WH5 A;  3OR1 C;  2E35 A;  2ZXW H;  3KZY A;  3I4P A;  1VQ8 I;  2NNN A;  2KIS A;  1XSD A;  3A03 A;  3KCC A;  5AON A;  2CUF A;  2WBM A;  3GX4 X;  3FZV A;  3GTP J;  1QHG A;  3OMY A;  1OR7 C;  2VPR A;  4BHC A;  2M1B A;  5HDN A;  3PJR A;  4EM1 A;  2DMQ A;  2KJB A;  3KX2 A;  1F5T A;  1T8I A;  1FP1 D;  2W82 A;  2VI6 A;  1IXC A;  4C3H J;  1X4P A;  3OIQ A;  3JRC A;  1P4A A;  2HZD A;  1MNE A;  2EQR A;  2L3D A;  1IN6 A;  3LSJ A;  4I99 C;  3M4O J;  2H1K A;  5EEG A;  3H36 A;  3PFI A;  1S8N A;  1WPK A;  3E5Q A;  1I6H J;  3LL7 A;  2H8W A;  4FX0 A;  4AYB N;  1XPX A;  5J1U A;  2CUJ A;  4R1H A;  2K85 A;  3CF2 A;  2KP6 A;  3ZMV A;  1SD5 A;  2XKP A;  2I10 A;  1FY7 A;  4BY7 J;  3W2V A;  2OF7 A;  4HEA 2;  1XD7 A;  4RAG A;  5F04 A;  3ZR8 X;  1FBS A;  1MBK A;  2A6H F;  3CUQ C;  1FNN A;  1ZTR A;  2E1O A;  2F6C A;  4EM2 A;  5IP7 J;  3JRH A;  4A3K J;  1ZRF A;  4U7D A;  5KNL A;  1VQO I;  2E1N A;  5ED4 A;  4UB8 C;  3SFZ A;  1SVO A;  2XAQ A;  4MO7 A;  1SFK A;  2VT3 A;  5GAD J;  4OAZ A;  4IHT A;  2F5V A;  1UHS A;  2BE5 F;  2F4O B;  2IA0 A;  1BR2 A;  2OTL I;  2QEX I;  3BTL A;  1HW5 A;  4II3 A;  1XMX A;  1WI3 A;  1O4X A;  4ZYA A;  2EFP A;  2MC3 A;  3OSG A;  4CCK A;  1YTY A;  4ZC3 A;  4RB2 C;  4UV9 A;  3BCA A;  4LD5 A;  2R7F A;  3K2Z A;  3C3W A;  2ZJ2 A;  1OYW A;  3S3N A;  1OR7 A;  4PUS A;  1IRX A;  1I5Z A;  5F1J A;  1L0O C;  1TQP A;  2O8X A;  4Y17 A;  3GF2 A;  3KP7 A;  3IWZ A;  3VYS B;  4BU2 A;  3HOY J;  1IRF A;  2V4J C;  4IO9 F;  3DFG A;  5CQG A;  1K83 J;  2FNA A;  2RNJ A;  3BDD A;  3I59 A;  2O9L A;  3GLL A;  3GTQ J;  3CC7 I;  3I4N J;  2R0Q C;  1DP7 P;  2FA5 A;  3BR6 A;  3G1M A;  4KN4 X;  4S04 A;  2VJ4 A;  4RS8 A;  1NHA A;  1Y1V J;  3F9K A;  3F72 A;  2HOE A;  4M3E A;  3T8T A;  1S6L A;  3LQR A;  2JN6 A;  4H0E A;  4BQQ A;  1IC8 A;  2Z16 A;  2CGP A;  3LAP A;  5E8G A;  3OYI A;  5EF6 A;  1EF4 A;  2ELK A;  2Q2E A;  2P81 A;  3MKY B;  4QPO A;  1ZQ3 P;  5JI6 A;  1G3Y A;  3CCJ I;  1GDT A;  2VXD A;  2IA1 A;  1K4S A;  3HRS A;  3JAM Z;  1ETX A;  5C4J J;  3ERM A;  2O61 A;  2VQH A;  3FIS A;  3PQK A;  4NDL A;  2GIZ A;  3WG9 A;  1O3Q A;  1U8R A;  3CUQ A;  1SMY F;  5JLW A;  4CYC B;  1Y8Q B;  1T33 A;  2L0K A;  1B72 A;  2K7L A;  1BOB A;  2DA6 A;  4QTR A;  2VT2 A;  2HYG D;  4OIP F;  5FLX Z;  3C7J A;  1YLF A;  3CDH A;  3GTL J;  4LIV A;  5E20 A;  4DJA A;  2EV6 A;  3HOZ J;  1RC9 A;  4A3B J;  2OQG A;  1RZ4 A;  3HOX J;  4C3I J;  4GYI A;  1W7P B;  3I55 I;  1R7J A;  4DBR A;  3FMS A;  4HF2 A;  2EV5 A;  3ZN1 A;  4L9T A;  1ETK A;  1P4W A;  5K1Y A;  4CYD A;  1H89 C;  2MW8 A;  3BZ6 A;  4Z2Y A;  4K2E A;  5M5Y J;  3TQN A;  4LIT A;  4BXU A;  1MKM A;  1O7L A;  3CO7 C;  4B8X A;  3OL4 A;  3H1C A;  4IHW A;  2W00 A;  1ETQ A;  2F4M B;  4ABZ A;  3DEU A;  4XSZ F;  3MCZ A;  4S05 A;  2DFI A;  1WHU A;  3DKX A;  5DV5 A;  5J3L A;  1DPU A;  3BTJ A;  3S1N J;  3IWF A;  3LST A;  3KFW X;  4RB1 A;  2LF8 A;  3I58 A;  2OD5 A;  3A0B C;  1MMG A;  5K5R A;  1OCP A;  4A69 C;  3HKZ N;  1IAW A;  2KMU A;  2XAG A;  1FMW A;  2ZFU A;  3BWG A;  1WKM A;  1UMQ A;  4XKW A;  5CVU A;  4V19 K;  1XCB A;  2FJ1 A;  3MVP A;  4CA0 A;  1YJN I;  1U9N A;  3GBG A;  3WTU C;  2R92 J;  5CJ9 A;  1IXS B;  3NRV A;  3TW7 A;  2V6C A;  1B8I A;  1VND A;  4DOZ A;  3KLN A;  4U88 A;  3L00 A;  2LTP A;  2QVO A;  3OIP A;  4XID A;  2X6O A;  4OWR B;  3T8R A;  4HRI A;  4F92 B;  3CP2 A;  2MGQ A;  3NAR A;  1OCO H;  3E1S A;  2EWN A;  3DWL E;  3FMR A;  2VQG A;  1MNM C;  2VBW A;  1J75 A;  2H27 A;  4RMN A;  3SHF A;  4OMZ A;  1TWA J;  3LNQ A;  5TJJ A;  1D0Z A;  3NEU A;  4MQV A;  4KT5 C;  1LB2 A;  1JXS A;  1Z91 A;  4DYC A;  1TZL A;  4PGH A;  3SQN A;  3TO7 A;  1ZR4 A;  2QBY A;  4AD9 A;  4UUV A;  2RGV A;  1TNT A;  3BCB A;  2LRE A;  3MMY B;  5J47 A;  1V55 H;  1MH3 A;  1X1A A;  2CG4 A;  2FOW A;  1IN4 A;  1BIB A;  1TW2 A;  3GTK J;  2XF6 A;  3WTS C;  1OMI A;  1HDD C;  2EH3 A;  3ONQ A;  5L3D A;  1CF7 B;  2NYX A;  1FX7 A;  2LY2 A;  1GUU A;  2OZ6 A;  4KIT B;  2HQN A;  2YX7 A;  2IAI A;  1T39 A;  1TWG J;  5H20 A;  1IW7 F;  4V2F A;  2M87 A;  2M45 A;  2CQK A;  3ZMD A;  3PUF A;  2LFB A;  2RV8 A;  4D7M A;  1YFH A;  3EQL F;  3H5R A;  3R61 A;  2QGU A;  3GFL A;  4XKB A;  4A12 A;  5BPI A;  1L3L A;  2NVQ J;  2K9N A;  3IV5 A;  1D1A A;  4ITV A;  4A0Z A;  3TO6 A;  4RGU A;  2GWR A;  2KDO A;  2V26 A;  4PJJ A;  4P55 A;  3CCR I;  1HW2 A;  3FX3 A;  1AOY A;  1I3A A;  1SAN A;  2BXY A;  4A3J J;  2HOA A;  1TLH B;  1HBX G;  2ISZ A;  3IH4 A;  3ZMU A;  3H35 A;  4FCY A;  1SFU A;  2BHY A;  1R49 A;  3BZC A;  1KYZ A;  3U2R A;  4RLQ A;  2G7H A;  1F1Z A;  2BY1 A;  5HLG A;  2X51 A;  4YEJ A;  1YJW I;  4JQF A;  2GLO A;  1VF9 A;  1XS9 A;  3SZT A;  3K4N A;  3VSL A;  1E3P A;  1JGS A;  3ASN H;  3WTT C;  1HST A;  2C6Y A;  1Z7L A;  1SAU A;  2GOM A;  3CQZ J;  3ZMT A;  2LF7 A;  4Y4R A;  2AQE A;  1MMS A;  1D1B A;  2K4J A;  3GFJ A;  4B48 A;  5HLH A;  3ZMS A;  3K4L A;  2AO9 A;  4BJ6 C;  2HXO A;  2I5U A;  1JTY A;  2FX0 A;  3RKY A;  3R0A A;  4JX5 A;  2PI0 A;  5C3E J;  1W1W E;  1AHD P;  1EH8 A;  4XLH A;  1QGP A;  2KHM A;  3QP5 A;  4CO8 A;  4BAC A;  1F43 A;  1Y6I A;  4HDU A;  3LSH A;  2VAS A;  1BJA A;  2K9S A;  3CUQ B;  2L7M P;  2D45 A;  1N25 A;  3AAF A;  4WX9 A;  2O3F A;  5ICC A;  2PX9 A;  1R71 A;  4AM3 A;  1I1G A;  1R00 A;  4AC0 A;  3HOW J;  5GTH C;  2XUB A;  3J81 Z;  1A31 A;  1RET A;  2OPT A;  3TDU C;  2P6T A;  1STZ A;  1E3H A;  3W6J B;  2GZW A;  4RDU A;  3GTG J;  2L54 A;  2IS4 A;  1BR4 A;  1K61 A;  2MYS A;  2DOF A;  1YG2 A;  1R1T A;  2RRE A;  4FQG A;  2XVC A;  1DP3 A;  2A61 A;  1APL C;  2UUZ A;  5FB2 A;  1S72 I;  3HTS B;  3IKT A;  4DYQ A;  4II2 A;  1ZG5 A;  1T38 A;  3NWS A;  3S1M J;  2FQ3 A;  1MJB A;  3JRB A;  4ZH4 F;  2XAF A;  3HDD A;  1FYL A;  4NC6 A;  2JA7 J;  1EH6 A;  5F0C A;  3RZO J;  2BVM A;  2KPM A;  2VBY A;  3CLO A;  3FXM A;  1XMK A;  5HDG A;  3ZQG A;  4U0Y A;  5FKN A;  2UZK A;  4I6Z A;  1XN7 A;  4F52 A;  4E4H A;  5KVR A;  3PO2 J;  3L7W A;  2Y0S A;  3IC7 A;  1U8B A;  2JTV A;  2EFN A;  4U7B A;  1OJL A;  3K1P A;  5JLX A;  1UAA A;  5IYB J;  1ONV A;  2HNH A;  2WAQ A;  3FDY A;  3G6E I;  3OYH A;  4YIR X;  5L3G A;  2X48 A;  1JUS A;  1P7J A;  2GXA A;  3ZCO A;  3MKL A;  2R7O A;  2IS1 A;  4KA4 A;  4DGW B;  2Z2S B;  1RI7 A;  2E60 A;  2D1H A;  5CVJ A;  1D0X A;  3AG1 H;  1IN5 A;  4CIC A;  3C2H A;  3U9G A;  2YS9 A;  1B8I B;  2G7U A;  5EDN A;  1BN5 A;  1EJ9 A;  1KYW A;  1ZGA A;  2DA1 A;  4ZDO A;  1GVJ A;  3F8C A;  4I01 A;  3HOU J;  2HGC A;  4HX7 A;  1FYK A;  3BG6 A;  5J1Y A;  2FMY A;  4HDV A;  4B09 A;  1UEL B;  3FHZ A;  3ZMZ A;  2KRC A;  2Z33 A;  4YFN F;  1Y39 A;  2RDP A;  3FWE A;  1P9Q C;  3TOA A;  3O3K A;  1D5V A;  2DQL A;  4UV8 A;  3L2Q A;  1UG2 A;  3KP5 A;  2V1X A;  1ZAR A;  1QU3 A;  1SD6 A;  4EQQ A;  3CMM A;  3LQQ A;  4IRG A;  4XLN F;  3HG9 A;  4BE1 A;  1SMT A;  3ECO A;  3NQO A;  1WQ2 A;  4XRM A;  2JT1 A;  4BBR J;  5TRD A;  4MHG A;  2X4H A;  4FIS A;  1HW1 A;  4KMF A;  3ZQL A;  4XBF A;  3QWL A;  2Z5U A;  3ECH A;  2XSD C;  4FET A;  2EBI A;  4ENJ A;  4Q4Z F;  2X6Y A;  1VQN I;  1IZ1 A;  2XAJ A;  4CZC A;  2AXT C;  2M4K A;  3VOD A;  3V4G A;  3Q0U A;  2XAU A;  2L4A A;  3G71 I;  2Y31 A;  4GDF A;  2VQC A;  4BEH B;  1CF7 A;  2FSW A;  2MLK A;  4IVN A;  2MH2 A;  2ZNZ A;  4AIH A;  3BP8 A;  5IT9 Z;  2COB A;  3GZN B;  1SAX A;  2L9V A;  4A0Y A;  4B3A A;  1GXQ A;  4BQN A;  2PFB A;  1HF0 A;  5FD6 A;  2B63 J;  2HKX A;  5F6F A;  5DM6 F;  3CJT B;  3ZQ7 A;  1ENH A;  3CLQ A;  3H0G J;  3HRU A;  5JVG F;  4LMY A;  2DK8 A;  1EA3 A;  5BNG A;  3N05 A;  3GYH X;  1VQP I;  2X1C A;  3FXJ A;  1Q1V A;  4E7L A;  2DT6 A;  3I4M J;  2DOD A;  1FTT A;  3QPL A;  3JRG A;  3VB2 A;  2EIK H;  3RSN A;  2V9V A;  3CUO A;  2EV0 A;  3TP3 A;  1X1P A;  1BJZ A;  5EEA A;  3TBI A;  3EDP A;  3FXU A;  3FM5 A;  4IZZ A;  1YX5 A;  1OFC X;  2M7A A;  4CGZ A;  4NC7 A;  3PIP F;  2HR3 A;  2E36 A;  1BBY A;  4L5J A;  2CFX A;  5E8I A;  2BY3 A;  2E2H J;  1IXR C;  3S2W A;  4B3X A;  3UKG A;  5KHD A;  1SD7 A;  2JPB A;  2VJJ A;  4E6K G;  3M7G A;  4E7S A;  5K7H A;  3L2U A;  2CJJ A;  4ZDP A;  2JUG A;  2OU2 A;  2DYS H;  1VQ7 I;  1KU2 A;  2Y0M A;  1X3W B;  3F8M A;  1TT5 B;  1JUM A;  4LB5 A;  1HKT A;  3ZQQ A;  2NAZ A;  4N0B A;  2FBH A;  3N4M A;  1X2M A;  2JMW A;  1YIO A;  3J80 Z;  2IRF G;  4GFB A;  4IKF A;  3I53 A;  1KGS A;  4CUG A;  1G4D A;  2F4I A;  4EMS A;  4XOT A;  2V6E A;  4CCJ A;  4QLC U;  2QSG X;  4WXD A;  4WXC A;  2IS6 A;  3JRD A;  1W4M A;  2DPU A;  3F6V A;  3K2A A;  2NVT J;  4W97 A;  3K10 A;  5ICE A;  4Q5S F;  1JI8 A;  5L3E A;  3W6K B;  5DD4 A;  1PUF B;  4HZF A;  1HLV A;  1V4R A;  2V9K A;  3OOU A;  3G2B A;  4YII A;  1R5I D;  1S5L C;  4J01 A;  3ZN0 A;  5LFA A;  3L2V A;  2K9M A;  4KFC A;  1MD0 A;  2NVY J;  2AQF A;  3HPH A;  1XMA A;  1YX3 A;  4BAY A;  1UB9 A;  3K69 A;  3B73 A;  2O5R A;  3DV8 A;  4YIF A;  4YRV A;  3J7A Y;  1FEX A;  4IOC F;  1B4A A;  1F4K A;  1V5F A;  4M3G A;  5HS7 A;  1WJA A;  5D5X B;  3DU6 A;  4ENM A;  2W57 A;  1SFX A;  2M0M A;  3KP6 A;  3L1P A;  3L09 A;  1HSJ A;  4HF0 A;  2IS2 A;  3BJO A;  1YIJ I;  2DFF A;  3WE2 A;  3H9G A;  4EM0 B;  3DEE A;  3F8F A;  5D6E A;  3COA C;  4GO1 A;  3GME A;  2X6W A;  4MFD A;  4I02 A;  1QPM A;  1E17 A;  3WE3 A;  1O3S A;  3FIW A;  2X6X A;  2I8D A;  2XC7 A;  1FLI A;  2EPF A;  4WCG A;  1WWX A;  1XGS A;  3LSI A;  3TW6 A;  4EJW A;  5HNH A;  4A6D A;  2YPR A;  2HPM A;  1OLT A;  1W5C C;  3KLO A;  4P5O A;  3BG5 A;  3F23 A;  3I54 A;  1RR7 A;  2IGO A;  4LLL A;  5ILS A;  1B6A A;  4B43 A;  2VBX A;  4ZYD A;  2GM4 A;  4XSX F;  4IHS A;  2X0L A;  4RAZ A;  1X58 A;  5A2Q K;  3QAH A;  4KDP A;  1X19 A;  4PSX A;  4X1E A;  2CWE A;  1ZRD A;  4ZDL A;  4UVC A;  3KP4 A;  5IOZ A;  4ZYG A;  4PFP A;  3ML6 A;  2OQR A;  4XL9 A;  2CRG A;  3IP4 B;  3WGI A;  2A5W A;  3EET A;  5LHI A;  3TO9 A;  5KK1 A;  2DJI A;  1FIP A;  2F5E A;  5IYC J;  1FZP B;  6PAX A;  2IEK A;  4KJZ A;  4KT6 A;  1J09 A;  5HLI A;  4MTD A;  4IPA A;  1RKT A;  3K4J A;  2R5Z A;  1IV8 A;  2BY0 A;  4FE4 A;  4A3I J;  1NK2 P;  3PSF A;  1I39 A;  4UVB A;  3PNT A;  5EZH A;  2DU9 A;  3CCS I;  1ZLJ A;  3H92 A;  3HBL A;  5D5U B;  4PJN A;  3BZK A;  1MBJ A;  2IBD A;  1JHF A;  1UHM A;  2KIM A;  5E3N A;  2X1D A;  5E18 F;  4OIN F;  2FF4 A;  2VC0 A;  1FPQ A;  3H5A A;  5BMZ A;  3MAJ A;  3K0L A;  2VC1 A;  2W84 A;  2GQQ A;  1V5G A;  3H3U A;  3G1O A;  2ZXJ A;  3QRF F;  2WA0 A;  5E1X A;  3DF8 A;  1YRN A;  4RA2 A;  3TL4 X;  3S32 A;  2Z3Y A;  3FM3 A;  4XLE A;  1H0M A;  3LA3 A;  3AG2 H;  2O8K A;  3A1Y A;  4DZJ A;  2DN0 A;  2LKS A;  2NXN B;  3KEQ A;  4A3F J;  2Z9O A;  4S0H B;  1KU3 A;  1YIT I;  1USS A;  3T5X A;  2D5V A;  1POG A;  3I5U A;  2HWV A;  4ASN A;  3DPU A;  4GYG A;  4UVA A;  1N77 A;  4XLA A;  4XM3 A;  1X2N A;  4O3M A;  4YEL A;  2YU9 J;  2WAF A;  3UR3 C;  2PJR B;  4G94 A;  2DMU A;  1I1S A;  2KIU A;  4ZTJ A;  5M5W J;  4Y15 A;  2CH0 A;  3G73 A;  4HYE A;  3S3M A;  3KE2 A;  2R7U A;  3HOS A;  3CCE I;  3FF5 A;  1S7O A;  5DCM B;  1FT9 A;  5DUK A;  4BHP A;  1W36 D;  4RM2 A;  2BBY A;  2ICW G;  3J7A O;  3QPS A;  2DAO A;  4LLN A;  2RNG A;  4XRS A;  2A6E F;  2XGD A;  5CVV A;  4LLG F;  4X0G A;  1VFC A;  1Q1H A;  4UUT A;  2D2W A;  1TWC J;  2HQA A;  5LHH A;  1ETY A;  2WV0 A;  4BS9 A;  1Z7U A;  2E19 A;  2FU4 A;  2M7B A;  4AVZ A;  1C0W A;  1HCR A;  1HA8 A;  2CO5 A;  5DCF A;  1MBH A;  3QU6 A;  4IOA F;  2Y0S N;  4UY8 I;  5M3M J;  4PK4 A;  1LUJ B;  1QNT A;  3GZ6 A;  2CQX A;  1IDY A;  1BC8 C;  2IW5 A;  3Q9S A;  5K5O A;  1GT0 C;  2XGX A;  3RI4 A;  1ZLK A;  4Y52 J;  1GVD A;  3H5N A;  5LGU A;  2JUC A;  1IDZ A;  1AA7 A;  4IF4 A;  2W25 A;  2EZH A;  3M8J A;  4EEF G;  1YI2 I;  2YUS A;  4OIR F;  1ETV A;  3RDI A;  4HNT A;  4EJT A;  2ZKZ A;  1ZRE A;  2BY2 A;  2FD5 A;  4M6X A;  4CSW A;  3WTY C;  2R7D A;  2P5V A;  1JKO C;  2ID3 A;  1FSE A;  2ZCW A;  3BR1 A;  3AG3 H;  4HQM A;  4DNC A;  2NOG A;  3K4K A;  1ITY A;  2OA4 A;  2RKH A;  3OYL A;  4D1Q A;  3TED A;  2JA5 J;  2HOS A;  3A2K A;  4QPQ A;  1QPI A;  3DU5 A;  3H0D A;  1W0U A;  4IRI A;  4M9S A;  1LE8 A;  4NC8 A;  2ISY A;  3O8G A;  2DO7 A;  5FLM J;  5HNF A;  4WK8 F;  3CZ6 A;  1BM9 A;  1WJ5 A;  5ERI A;  3P9I A;  5L3F A;  3HB9 A;  3H3Z A;  3OS1 A;  2ZNY A;  3IH3 A;  3CO6 C;  1G59 A;  1N78 A;  3DP7 A;  3OYF A;  2V1N A;  2JSC A;  2CQN A;  3A01 A;  5E1Z B;  3DTK A;  1T0F C;  1A5J A;  3KEY A;  5FRO A;  2L7K A;  5JR3 A;  2HZT A;  2YU3 A;  1QVT A;  2ETH A;  1D0Y A;  1JKQ C;  3OS2 A;  9ANT A;  1G3S A;  2F5D A;  3KZZ A;  1KZH A;  3CCQ I;  4BE2 A;  4HNV A;  3GEZ A;  2OCC H;  2ZXI A;  3HSF A;  4HOB A;  4FX4 A;  2MH9 A;  2CW0 F;  3GZ5 A;  2CFO A;  2ADU A;  3J7Y J;  3HM5 A;  3CMY A;  5GAH J;  5IP9 J;  1ON1 A;  4BJ5 C;  4UB6 C;  3MZ8 A;  2KIF A;  3VYT B;  1EKE A;  4CCL A;  1XSX A;  2W48 A;  1T98 A;  2FQ4 A;  3FBI B;  3WHC A;  3BTC A;  2M3A A;  1WVR A;  5GPC A;  3C18 A;  3K1N A;  4DZP A;  1MGT A;  3DBH B;  4YG2 F;  2OTJ I;  4B1R A;  2P8T A;  1EH7 A;  1DDN A;  2QZ8 A;  2DT7 B;  4FT8 A;  2O03 A;  3JTG A;  1VQM I;  3GWZ A;  3OYG A;  1D8J A;  4FAS D;  3FKI J;  1Z6T A;  3SEQ A;  1Z9C A;  4A6E A;  2R5Z B;  5EGO A;  4CHU A;  4M3F A;  1T95 A;  3IRQ A;  3RKQ A;  4DBQ A;  1KA8 A;  1W36 C;  1ZYR F;  4PSW A;  1SFO J;  3CDL A;  2RQP A;  2NS0 A;  1TQM A;  4HF1 A;  1O7F A;  3S15 J;  3RZD J;  2P7C B;  2G9W A;  1PP8 F;  2EK5 A;  1QRY A;  1ZEL A;  3L9F A;  1WH7 A;  1OYI A;  5FLV A;  2LNB A;  4XRS G;  2E34 A;  3M8F A;  3WU0 A;  3K7A J;  4RAY A;  5IYD J;  1R36 A;  2XB0 X;  3EUH C;  1R5G A;  1Z67 A;  2F5F A;  2HI3 A;  2P4W A;  2QM3 A;  4XNF A;  4ZZL A;  4L0Y B;  2VOP A;  5LEJ A;  3M8E A;  1HXD A;  2DOE A;  3K4M A;  2DT5 A;  2CUZ A;  2VQL A;  2B0L A;  3ABT A;  1YRN B;  4C30 A;  2L9S A;  3WTV C;  1FTZ A;  4HSR A;  1J5Y A;  2M0C A;  3H9Q A;  3E5X A;  3RKX A;  2QSF X;  1T0F A;  3SFI A;  2E5Z A;  3G4S I;  1U0J A;  1U6G A;  3CJN A;  1TWH J;  5FKM A;  2R7V A;  4L5E A;  2JRT A;  2W1O A;  4G8X A;  5B3S H;  5DDG A;  2LR8 A;  4CZZ A;  2VL8 A;  1TNS A;  4BDZ A;  3RYR A;  4Y13 A;  2K27 A;  2KZV A;  3Q3S A;  1SVL A;  1GHC A;  4BEH A;  5HOD A;  1E2X A;  2VJI A;  3K6G A;  1TT0 A;  2IXS A;  2NS8 A;  3DLL F;  3CCL I;  3GFI A;  2EA4 A;  1RUO A;  1UHW A;  2JVG A;  3OOP A;  3ROU A;  1VQ6 I;  3D5R C;  4M73 A;  2XAS A;  3FK7 A;  3CF5 F; 
#chains in the Genus database with same CATH homology
 1XSV A;  4HLX A;  5H6R A;  1OYY A;  5D4S A;  4I0A A;  1XGO A;  1JE8 A;  4L9V A;  4O5V A;  5D6F A;  3VFZ A;  4WWC A;  1S7A A;  2OZU A;  2RN7 A;  5LRR A;  2DW4 A;  3WU1 B;  4KNY A;  2M30 A;  3P9K A;  2STT A;  3WTX C;  3MZY A;  4QWQ A;  2K86 A;  4O6J A;  1FWZ A;  3F8B A;  4G6D A;  3FMQ A;  2FNP A;  5DYM A;  1YS6 A;  2EFW A;  1YS7 A;  4IJA A;  5BQT A;  3EUH A;  1BC7 C;  2QLZ A;  3QP6 A;  4G6Q A;  3VOE A;  3HRM A;  2L02 A;  1QZY A;  3WTW C;  3DQV C;  2H6C A;  2W85 A;  3P7N A;  3GFM A;  4KIC A;  2BGC A;  4I7H A;  2IP2 A;  3RTR A;  3Q5F A;  4OIQ F;  3V7S A;  3OV8 A;  1DUX C;  3BJA A;  3V7C A;  1ZH5 A;  3ISP A;  1ZGJ A;  2XV4 S;  2A3S A;  2PG4 A;  2XRO A;  1MDM A;  4A5M A;  4MQ9 F;  3N97 A;  1OPC A;  2BYV E;  4LK1 F;  3JSO A;  1PUE E;  3HSR A;  3V8K A;  2LDU A;  1HKS A;  1D3Y A;  2Z99 A;  2Q8K A;  1H9T A;  1G3T A;  2EB7 A;  2H6B A;  1R58 A;  3E97 A;  4XLP F;  4OOI A;  5HDK A;  2WWY A;  1WI9 A;  5E17 F;  2WTE A;  4JBA A;  2Y75 A;  1BI3 A;  2XKO A;  1CGP A;  1O3R A;  5BOX A;  3I64 A;  2XIG A;  2DBB A;  3HYI A;  3FXQ A;  4PDK A;  1KQ0 A;  2ESH A;  2A68 F;  1ON2 A;  3JSP A;  4NQW A;  1JHH A;  1IRG A;  1LJ9 A;  1BI0 A;  2MA3 A;  4E70 A;  5AIQ A;  2VOO A;  4LGW A;  1SFE A;  1MJ9 A;  4MEY F;  5J8F A;  4KIF A;  2IJL A;  1Y0U A;  5EEH A;  5D5W B;  2UXN A;  5FD5 A;  4EJO A;  5BPD A;  2K4B A;  1F9N A;  3DXJ F;  4A2U A;  5DD8 A;  2FRH A;  2GXB A;  2ZFW A;  3IKV A;  1V3F A;  3HTU A;  5JVT A;  4OMY A;  1R22 A;  1KU7 A;  5DCM A;  4TV7 A;  2W24 A;  1ZHF A;  3E6B A;  3LAJ A;  3LWF A;  2P5K A;  4ZYE A;  4MNU A;  1YW9 A;  4BQA A;  1ULY A;  3ZP5 A;  4G7H F;  5D8L B;  1WRJ A;  3GO5 A;  2FML A;  3ERE D;  1BIA A;  2E7X A;  4L9N A;  2AXL A;  5HS8 A;  3ELK A;  2ZME A;  3TKY A;  2V1U A;  4KYW A;  3BY6 A;  3F6O A;  2L01 A;  5JFR A;  1TW3 A;  4ESB A;  4YFX F;  1U78 A;  2V1D A;  2E1C A;  2PBI A;  1BI1 A;  4L0Z B;  4BHB A;  2ELH A;  1U5T C;  4KIG A;  3MQ0 A;  5HOO A;  4LB6 B;  5LHG A;  3EYI A;  1MDM B;  4JK1 X;  4I09 A;  1B9M A;  1R5H A;  2FE3 A;  4ZYH A;  4WXH A;  1IN7 A;  2P5L C;  2E7W A;  3E6M A;  4RGR A;  4M9Z A;  4ENK A;  4EJU A;  1O57 A;  2DTR A;  1I27 A;  4RB0 A;  3WTZ A;  5LEK A;  2IA2 A;  5J6X A;  2FBK A;  2VN2 A;  1ZG3 A;  3E6C C;  4DQ2 A;  1FSH A;  1UST A;  4HA8 A;  3HSE A;  2KKO A;  1EV7 A;  1K79 A;  2GAU A;  3K9T A;  1R1V A;  1Z1D A;  4U0W A;  4I98 B;  3GVA A;  2PMU A;  1FP2 A;  1P4X A;  3REO A;  2RVC A;  2WC2 A;  3F3X A;  1BOA A;  2K02 A;  2UXX A;  1IN8 A;  2EFQ A;  4GCV A;  1R23 A;  1XGN A;  3D5L A;  3ABU A;  1QBJ A;  2P7V B;  1U5T A;  5FO5 A;  3JAM K;  3MZH A;  2IT0 A;  3BOQ A;  2IVM A;  1LQ1 A;  1G3W A;  4PCQ A;  3KP2 A;  4AIK A;  5FLX K;  4EGY A;  1ZG1 A;  3DPL C;  1B9N A;  2HKO A;  3BJ6 A;  4Q48 A;  2QWW A;  3SXY A;  4P96 A;  1LEA A;  3JW4 A;  1DPR A;  2VE8 A;  4M71 A;  3M9A A;  1P92 A;  2FXA A;  2FEZ A;  2H09 A;  3QPH A;  3KET A;  4P9F A;  4ZZD A;  3E3V A;  2NNY A;  3D0S A;  4BH9 A;  1S29 A;  2VOD A;  1U3E M;  3GUD A;  2CSO A;  2A69 F;  1ZRC A;  5LBQ A;  5K5Q A;  4MEX F;  2DI3 A;  3QOP A;  2D1V A;  1QQI A;  1XB4 A;  1P2F A;  3U1D A;  4HW0 A;  4RB3 C;  1Z6R A;  4RGS A;  5F1R A;  3VEP A;  2ZME B;  1VTN C;  4WF2 A;  4UNO A;  5D4R A;  4ETS A;  5A2Q Z;  3PQJ A;  1QZZ A;  2PLY A;  5F64 A;  1HKQ A;  1J7K A;  1MZB A;  1J2X A;  2L4M A;  4HV6 A;  3GXO A;  2FOK A;  5CVR A;  2MBF A;  3BPV A;  4D0P A;  3RYP A;  4Q47 A;  2DK5 A;  2AS5 F;  2VBZ A;  3IHU A;  4ESF A;  5ILV A;  1XGM A;  1AWC A;  5JHU A;  4KN7 X;  4HBL A;  3HIF A;  2M5W A;  4P9U A;  1IF1 A;  3CTA A;  2FBI A;  2O0Y A;  4KUM A;  1WSU A;  3LA2 A;  3EYY A;  1K7A A;  2NRA C;  1LNW A;  5CYV A;  4R8H A;  1ZN2 A;  4OIO F;  1KQ8 A;  4BYY A;  5FFZ A;  3KEO A;  4AWX B;  4EV0 A;  2XHK A;  2JZY A;  5E1W A;  5IT3 A;  3I71 A;  3V8J A;  3HOT A;  5LGN A;  2JPC A;  1J0R A;  1FBU A;  3F8N A;  2XRN A;  5AIP A;  2STW A;  1UFM A;  5L3B A;  2LKP A;  5CLS A;  3BPX A;  1GXP A;  4G9Y A;  3ULQ B;  3G3Z A;  3IRR A;  4CDG A;  4ENN A;  3GLX A;  1O3T A;  1D8K A;  1U5T B;  5LRS A;  1A04 A;  2HEO A;  3QU3 A;  2KJC A;  2Y48 A;  4HX4 A;  5ICG A;  5CVI A;  3T1B A;  4EGZ A;  3J81 K;  4IRH A;  1LEB A;  1B59 A;  1RIO H;  2UWM A;  3V7R A;  1LDK B;  4L9J A;  4MGR A;  4EJV A;  4NHJ A;  2YX4 A;  4FHT A;  1TTY A;  1YW7 A;  3HUG A;  5J8C A;  3RKW A;  2HYF A;  1HQC A;  1MJA A;  3B02 A;  3O6B B;  2TDX A;  4N9I A;  3IL2 A;  5FFX A;  1SD4 A;  1YO5 C;  2ACJ A;  1J59 A;  3M1E A;  4L18 B;  5BS6 A;  5ICF A;  3RIR A;  1K6O A;  5HVQ C;  3JTH A;  2PEX A;  3P9C A;  3MFK A;  1REP C;  1U2W A;  4M6Y A;  3O2P E;  4GGG A;  3I59 B;  3F21 A;  3TOB A;  2J5P A;  1YW8 A;  4HLY A;  5LGT A;  2VXZ A;  2PJP A;  2HDC A;  1LDJ A;  2QUF A;  2QQB A;  2ZBK A;  1TBX A;  4KMU X;  2MD5 A;  4M9X A;  2ESN A;  1RNL A;  2BEO A;  1S3J A;  3HHH A;  4KIB A;  2YSR A;  1I6X A;  1UCR A;  3MEX A;  1W7P D;  4LFU A;  2CYY A;  1FBQ A;  5IT9 K;  1LDD A;  3L2C A;  1QO0 D;  4RGX A;  1LVA A;  2Q0O A;  2O6G E;  1FC3 A;  3E6D A;  2DPD A;  4GXO A;  4R79 A;  3SZP A;  1ZAO A;  1J9I A;  2RC4 A;  5DEQ A;  2PN6 A;  3LFK A;  4LG0 A;  2V79 A;  2VON A;  4U0V A;  1FYM A;  2YR2 A;  4UHT A;  1FOK A;  5L3C A;  4YFK F;  1K78 A;  1P6R A;  2LSO A;  1OKR A;  5LLQ A;  3K1M A;  4IXA A;  2H94 A;  3RJP A;  2F2E A;  3R60 A;  1XCV A;  3J80 K;  2BV6 A;  2OAZ A;  1T6S A;  2DQR A;  3F22 A;  3T0Y A;  2EJR A;  4M74 A;  2KRF A;  2DLL A;  2QEN A;  2J5O A;  3FXR A;  1YYV A;  2HTJ A;  2QQA A;  1G6N A;  3R0J A;  4PGG A;  3DPT A;  4A5N A;  4M72 A;  3GW2 A;  2QBY B;  2HTS A;  4MTE A;  2ZO4 A;  1RUN A;  2OBP A;  3LA7 A;  5H6Q A;  2XAH A;  5D8K B;  1XDU A;  1B1B A;  1IUY A;  4XRF A;  1T2K A;  4HX8 A;  4CXF A;  2EFO A;  4G7O F;  3TGN A;  1X3U A;  4LK0 F;  2GA2 A;  3KP3 A;  3WGG A;  2A07 F;  5FGM A;  4EVI A;  2A5Y B;  3MWM A;  3R4K A;  4HV5 A;  4L5I A;  1ODD A;  2QQ9 A;  3BRO A;  2HFH A;  5DUI A;  4HAM A;  3DKW A;  2HS5 A;  4I2O A;  2HQR A;  4HQE A;  3R6S A;  1H9G A;  4N9H A;  4BNC A;  3V8L A;  1PP7 U;  2PQ8 A;  4LJZ F;  3HRT A;  3TDZ C;  3WGH A;  5D5V B;  2EA2 A;  4AVP A;  1BI2 A;  2COM A;  4G7Z F;  1PDN C;  3C1D A;  2F5C A;  3QPT A;  1W5S A;  4OU0 A;  2P6S A;  1XDS A;  2QYO A;  4AIJ A;  4PZJ A;  3I0T A;  3WOD F;  2M8E A;  2GA1 A;  3ZPL A;  1R1U A;  5ILU A;  1KU9 A;  2PMH A;  1Z05 A;  4F7Z A;  3E5U A;  4NB5 A;  4ESJ A;  4ON0 A;  3RPU A;  3HHG A;  1W5T A;  1YQA A;  2IPQ X;  1W7P A;  3RPQ A;  4LG0 B;  2GIV A;  2R3S A;  2MLG A;  1TQI A;  1KQ9 A;  5HS9 A;  1K78 B;  4UXN A;  4A0X A;  2VE9 A;  4I0B A;  2GXG A;  3Q9V A;  3KZY A;  3I4P A;  2NNN A;  1XSD A;  3KCC A;  5AON A;  3GX4 X;  3FZV A;  4BHC A;  2M1B A;  5HDN A;  4EM1 A;  2KJB A;  1F5T A;  1FP1 D;  1IXC A;  1P4A A;  2L3D A;  1IN6 A;  5EEG A;  3PFI A;  1S8N A;  3E5Q A;  4FX0 A;  4R1H A;  3ZMV A;  1SD5 A;  2XKP A;  1FY7 A;  1XD7 A;  1CF7 A;  1FBS A;  2A6H F;  1FNN A;  3CUQ C;  4EM2 A;  1ZRF A;  4U7D A;  2E1N A;  5ED4 A;  3SFZ A;  2XAQ A;  2VT3 A;  4IHT A;  2BE5 F;  2IA0 A;  1HW5 A;  2EFP A;  2MC3 A;  1YTY A;  4RB2 C;  4UV9 A;  4LD5 A;  2R7F A;  3K2Z A;  3C3W A;  2ZJ2 A;  1OYW A;  1OR7 A;  1I5Z A;  1L0O C;  1TQP A;  2O8X A;  4Y17 A;  3GF2 A;  3KP7 A;  3IWZ A;  1IRF A;  3DFG A;  2FNA A;  2RNJ A;  3BDD A;  3I59 A;  1DP7 P;  2FA5 A;  4KN4 X;  4S04 A;  4RS8 A;  1NHA A;  3F72 A;  2HOE A;  3T8T A;  1S6L A;  3LQR A;  4H0E A;  2CGP A;  3LAP A;  5E8G A;  2Q2E A;  5JI6 A;  1G3Y A;  2IA1 A;  3HRS A;  3JAM Z;  2O61 A;  3PQK A;  1O3Q A;  3WG9 A;  1U8R A;  3CUQ A;  1SMY F;  2K7L A;  2VT2 A;  2HYG D;  4OIP F;  5FLX Z;  3C7J A;  1YLF A;  3CDH A;  5E20 A;  2EV6 A;  2OQG A;  1RZ4 A;  4GYI A;  1W7P B;  1R7J A;  3FMS A;  4HF2 A;  2EV5 A;  3ZN1 A;  4L9T A;  1P4W A;  5K1Y A;  4CYD A;  3BZ6 A;  4Z2Y A;  4K2E A;  3TQN A;  4BXU A;  1MKM A;  1O7L A;  3CO7 C;  4B8X A;  3DEU A;  4XSZ F;  3MCZ A;  4S05 A;  2DFI A;  1DPU A;  5DV5 A;  3IWF A;  3LST A;  3KFW X;  4RB1 A;  2LF8 A;  3I58 A;  2OD5 A;  5K5R A;  1IAW A;  3BWG A;  2XAG A;  1WKM A;  5CVU A;  1XCB A;  3WTU C;  5CJ9 A;  1IXS B;  3NRV A;  2V6C A;  3KLN A;  4U88 A;  3L00 A;  2QVO A;  3T8R A;  2EWN A;  3FMR A;  2VBW A;  1J75 A;  2H27 A;  3SHF A;  4OMZ A;  5TJJ A;  3NEU A;  4MQV A;  4KT5 C;  1LB2 A;  1JXS A;  1Z91 A;  4PGH A;  3SQN A;  3TO7 A;  2QBY A;  4AD9 A;  4UUV A;  2RGV A;  1TNT A;  2CG4 A;  1IN4 A;  1BIB A;  1TW2 A;  3WTS C;  1OMI A;  5L3D A;  1CF7 B;  2NYX A;  1FX7 A;  2OZ6 A;  2HQN A;  2YX7 A;  1T39 A;  5H20 A;  1IW7 F;  2M87 A;  2M45 A;  2CQK A;  3ZMD A;  2RV8 A;  1YFH A;  3EQL F;  3R61 A;  3GFL A;  4A12 A;  5BPI A;  1L3L A;  4A0Z A;  3TO6 A;  4RGU A;  2GWR A;  1HW2 A;  1AOY A;  4P55 A;  3FX3 A;  1HBX G;  2ISZ A;  1TLH B;  3ZMU A;  1SFU A;  1KYZ A;  3U2R A;  2G7H A;  1F1Z A;  5HLG A;  4JQF A;  3SZT A;  2C6Y A;  1JGS A;  3WTT C;  1HST A;  3ZMT A;  2LF7 A;  2K4J A;  3GFJ A;  5HLH A;  3ZMS A;  3RKY A;  3R0A A;  2PI0 A;  1EH8 A;  1QGP A;  3QP5 A;  4CO8 A;  4HDU A;  1BJA A;  3CUQ B;  2D45 A;  3AAF A;  4WX9 A;  2O3F A;  5ICC A;  1I1G A;  1R00 A;  2XUB A;  3J81 Z;  3TDU C;  2P6T A;  1STZ A;  3W6J B;  2GZW A;  2L54 A;  1YG2 A;  1R1T A;  2XVC A;  2A61 A;  5FB2 A;  3HTS B;  3IKT A;  1T38 A;  1ZG5 A;  2FQ3 A;  1MJB A;  4ZH4 F;  2XAF A;  1FYL A;  1EH6 A;  2VBY A;  3CLO A;  1XMK A;  5HDG A;  4U0Y A;  2UZK A;  1XN7 A;  5KVR A;  3L7W A;  3IC7 A;  2JTV A;  2EFN A;  4U7B A;  3K1P A;  1ONV A;  5L3G A;  4KA4 A;  1RI7 A;  5CVJ A;  2D1H A;  1IN5 A;  4CIC A;  3U9G A;  2G7U A;  1BN5 A;  1KYW A;  1ZGA A;  1GVJ A;  3F8C A;  4I01 A;  2HGC A;  4HX7 A;  1FYK A;  2FMY A;  4HDV A;  4B09 A;  3FHZ A;  3ZMZ A;  2Z33 A;  4YFN F;  2RDP A;  3FWE A;  3TOA A;  3O3K A;  1D5V A;  2DQL A;  4UV8 A;  3KP5 A;  2V1X A;  1ZAR A;  1SD6 A;  4EQQ A;  3LQQ A;  4IRG A;  4XLN F;  1SMT A;  3ECO A;  3NQO A;  1WQ2 A;  2JT1 A;  5TRD A;  4MHG A;  2X4H A;  1HW1 A;  4KMF A;  4XBF A;  2Z5U A;  3ECH A;  4ENJ A;  4Q4Z F;  1IZ1 A;  2XAJ A;  3VOD A;  3V4G A;  2L4A A;  2FSW A;  2MLK A;  4IVN A;  2MH2 A;  2ZNZ A;  4AIH A;  3BP8 A;  5IT9 Z;  1SAX A;  4A0Y A;  1GXQ A;  2PFB A;  5FD6 A;  2HKX A;  5F6F A;  3ZQ7 A;  3HRU A;  4LMY A;  2DK8 A;  3GYH X;  3VB2 A;  2V9V A;  3CUO A;  2EV0 A;  3EDP A;  3FXU A;  3FM5 A;  4CGZ A;  2HR3 A;  1BBY A;  4L5J A;  2CFX A;  5E8I A;  1IXR C;  3S2W A;  1SD7 A;  2JPB A;  3M7G A;  2OU2 A;  1KU2 A;  2Y0M A;  3F8M A;  4LB5 A;  1HKT A;  2NAZ A;  4N0B A;  2FBH A;  3N4M A;  2IRF G;  1YIO A;  3J80 Z;  3I53 A;  1KGS A;  1G4D A;  4EMS A;  4QLC U;  4WXD A;  4WXC A;  1W4M A;  2DPU A;  3F6V A;  5ICE A;  4Q5S F;  5L3E A;  3W6K B;  5DD4 A;  4HZF A;  1V4R A;  4YII A;  3ZN0 A;  4KFC A;  1MD0 A;  1XMA A;  4BAY A;  1UB9 A;  3K69 A;  3B73 A;  3DV8 A;  4YIF A;  1B4A A;  1F4K A;  5HS7 A;  5D5X B;  4ENM A;  2W57 A;  1SFX A;  3KP6 A;  3L09 A;  1HSJ A;  4HF0 A;  3BJO A;  3WE2 A;  4EM0 B;  3F8F A;  5D6E A;  3COA C;  4GO1 A;  4I02 A;  1QPM A;  1E17 A;  3WE3 A;  1O3S A;  1FLI A;  4WCG A;  1WWX A;  1XGS A;  4EJW A;  4A6D A;  2YPR A;  3KLO A;  4P5O A;  3F23 A;  3I54 A;  4LLL A;  5ILS A;  1B6A A;  2VBX A;  4ZYD A;  4XSX F;  4IHS A;  2X0L A;  4RAZ A;  5A2Q K;  3QAH A;  4KDP A;  2CWE A;  1ZRD A;  4UVC A;  3KP4 A;  4ZYG A;  3ML6 A;  2OQR A;  3WGI A;  3EET A;  5LHI A;  3TO9 A;  5KK1 A;  2F5E A;  1FZP B;  6PAX A;  5HLI A;  4MTD A;  4IPA A;  4UVB A;  2DU9 A;  1ZLJ A;  3H92 A;  5D5U B;  1JHF A;  1UHM A;  2KIM A;  5E18 F;  4OIN F;  2FF4 A;  2VC0 A;  1FPQ A;  5BMZ A;  3MAJ A;  3K0L A;  2VC1 A;  2W84 A;  2GQQ A;  3H3U A;  2ZXJ A;  3QRF F;  5E1X A;  3DF8 A;  2Z3Y A;  3FM3 A;  1H0M A;  3LA3 A;  3KEQ A;  2Z9O A;  1KU3 A;  1USS A;  3T5X A;  3I5U A;  2HWV A;  4ASN A;  4GYG A;  4UVA A;  4O3M A;  4G94 A;  1I1S A;  2KIU A;  4Y15 A;  3G73 A;  4HYE A;  3KE2 A;  3HOS A;  3FF5 A;  1S7O A;  5DCM B;  1FT9 A;  5DUK A;  4BHP A;  2BBY A;  3J7A O;  2DAO A;  4LLN A;  2A6E F;  5CVV A;  4LLG F;  1Q1H A;  2D2W A;  5LHH A;  2WV0 A;  1Z7U A;  2FU4 A;  1C0W A;  2CO5 A;  5DCF A;  3QU6 A;  1QNT A;  3GZ6 A;  1BC8 C;  2IW5 A;  3Q9S A;  5K5O A;  2XGX A;  3RI4 A;  1ZLK A;  5LGU A;  4IF4 A;  2W25 A;  4OIR F;  3RDI A;  4EJT A;  2ZKZ A;  1ZRE A;  3WTY C;  4M6X A;  2R7D A;  2P5V A;  1FSE A;  2ZCW A;  4HQM A;  4DNC A;  2OA4 A;  2RKH A;  4IRI A;  4M9S A;  2ISY A;  2DO7 A;  4WK8 F;  1BM9 A;  5L3F A;  5ERI A;  3P9I A;  3H3Z A;  3CO6 C;  2ZNY A;  3DP7 A;  2JSC A;  5E1Z B;  5JR3 A;  2HZT A;  2YU3 A;  2ETH A;  1G3S A;  2F5D A;  3KZZ A;  3GEZ A;  3HSF A;  4HOB A;  4FX4 A;  2MH9 A;  2CW0 F;  3GZ5 A;  2ADU A;  1ON1 A;  2KIF A;  1XSX A;  1T98 A;  3C18 A;  3K1N A;  1MGT A;  4YG2 F;  2P8T A;  1EH7 A;  1DDN A;  2QZ8 A;  4FT8 A;  2O03 A;  3JTG A;  3GWZ A;  1D8J A;  1Z6T A;  1Z9C A;  4A6E A;  4CHU A;  3IRQ A;  1KA8 A;  1ZYR F;  2RQP A;  2NS0 A;  1TQM A;  4HF1 A;  1O7F A;  2P7C B;  2G9W A;  1PP8 F;  2EK5 A;  3L9F A;  1OYI A;  2LNB A;  3M8F A;  3WU0 A;  4RAY A;  1R36 A;  1R5G A;  2F5F A;  2P4W A;  4ZZL A;  2QM3 A;  4L0Y B;  2VOP A;  5LEJ A;  3M8E A;  1HXD A;  2DT5 A;  3ABT A;  2B0L A;  3WTV C;  1J5Y A;  3RKX A;  3E5X A;  1T0F A;  1U6G A;  3CJN A;  2JRT A;  4G8X A;  5DDG A;  4CZZ A;  1TNS A;  3RYR A;  4Y13 A;  2K27 A;  1GHC A;  1E2X A;  3GFI A;  2EA4 A;  1RUO A;  1UHW A;  3OOP A;  3ROU A;  4M73 A;  2XAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...