4G9YA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
136
structure length
136
Chain Sequence
b'THPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PcaV transcriptional regulator
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 52
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g9yA00
4ZYDA 3P7NA 1EH6A 3HYIA 3NEUA 4GO1A 3F8CA 4HF0A 5L3GA 1TQIA 4MQ9F 2PI0A 5ILVA 1SMTA 5EEGA 1UHWA 3GFMA 3KP6A 3VB2A 5DD8A 2QBYB 4NHJA 3GEZA 2WWYA 5K5RA 4RB0A 1UHMA 3U9GA 2EFQA 2H6BA 2DT5A 1D8KA 3COAC 2W57A 4M6YA 5D8KB 3ROUA 1CF7A 1K78A 1P6RA 2H6CA 3FMRA 2J5PA 1IRFA 2FNPA 1YYVA 1ZYRF 1WQ2A 3L09A 4RGUA 2PFBA 3WTSC 2LNBA 3F6VA 3FZVA 1FLIA 1DDNA 4A0XA 2GAUA 5E20A 2K7LA 4MTDA 5H20A 3IKVA 3TOAA 4OIPF 3RI4A 4I2OA 2IPQX 5DD4A 2Z5UA 4LK0F 3GVAA 4XRFA 2E7WA 3PFIA 3V7RA 2Q2EA 1FC3A 3IWFA 3DFGA 1S29A 1KQ9A 2D1HA 2UZKA 3IHUA 4I02A 3QU3A 3RIRA 3ECOA 1S8NA 2PMUA 3B02A 4YIIA 5HDNA 4KT5C 3FXRA 3TDUC 4P96A 2EFOA 1O3SA 4KA4A 1XSVA 2QZ8A 3CDHA 5IT3A 2RVCA 2G9WA 2OAZA 3DQVC 2PG4A 3HOSA 2M1BA 3M9AA 4WCGA 5HS8A 3ERED 4M6XA 5LRRA 1LNWA 4AIKA 5D4RA 2FBIA 3GO5A 3G3ZA 3ZMSA 3TO9A 1YS6A 2JPCA 4AVPA 2R7DA 3CUQC 5AIPA 5K1YA 1ZG3A 2EFWA 1R58A 4KIBA 5IT9Z 1STZA 2G7HA 1QZZA 2CW0F 3K1NA 3H3ZA 1LJ9A 3KFWX 4HQEA 1KGSA 4O6JA 4PCQA 1KU9A 4L9VA 4EGZA 3Q9VA 3LFKA 3ABTA 4WXHA 2BE5F 1TTYA 1ZN2A 2HTJA 2H09A 2JPBA 1GXQA 1DPUA 1U5TB 1LDJA 4K2EA 1XGOA 1PDNC 4EGYA 2BV6A 1O57A 1Z7UA 2STTA 5BMZA 1V3FA 3F8FA 3SZTA 4EJUA 4LLGF 1NHAA 4H0EA 1EV7A 2XHKA 3QP6A 4NB5A 2Y75A 4B8XA 2RDPA 2JZYA 1R1VA 5LHGA 1XCVA 2IW5A 3F22A 3HIFA 3FXQA 2Q0OA 5D5VB 3AAFA 2Z3YA 3EYIA 3C18A 1JE8A 3BP8A 1BOAA 4BHBA 2FRHA 2DK5A 2VOOA 4ZZDA 4MNUA 4KDPA 3GZ5A 5D5UB 2G7UA 2DQRA 2IRFG 2GA1A 1D3YA 4RGSA 4BQAA 2EB7A 2R3SA 3BJOA 4CHUA 2JTVA 1LQ1A 3K69A 2EJRA 1CF7B 1K78B 3EETA 2IP2A 4L5IA 1K79A 5D6FA 2EK5A 1P4AA 3LQQA 4P5OA 5DCMA 4FHTA 4M73A 1R5HA 2YSRA 3HRSA 3VEPA 3WGHA 3M8EA 2JSCA 4MHGA 4JBAA 4KIFA 1UFMA 2BEOA 4IRHA 4F7ZA 2YX7A 5IT9K 1ZH5A 2O61A 3SHFA 3VFZA 1J5YA 1Z05A 4S04A 2YR2A 2P7CB 3HUGA 2DBBA 3I71A 1BIAA 3V8JA 2F5DA 5LRSA 1Y0UA 1GVJA 1B9MA 1WKMA 2NAZA 1FOKA 4G7ZF 2P4WA 4IF4A 1F4KA 4XBFA 3I4PA 1J2XA 4NQWA 3CTAA 3MZHA 2XAJA 4PZJA 4L9TA 2EFNA 2OZUA 3TKYA 1L3LA 5E1ZB 1OMIA 1GHCA 2DAOA 2HQRA 2Y48A 1ONVA 5L3BA 3WTZA 4RB1A 3ZMVA 5KK1A 4MEYF 4LB5A 4ZYHA 4YIFA 2OZ6A 5ICCA 1PP7U 3HSFA 5JR3A 2CSOA 1F1ZA 4OU0A 1ZAOA 2L54A 3H92A 4LGWA 3F21A 3ABUA 4UXNA 2DPUA 3J80Z 1U78A 2KKOA 1LDDA 1B9NA 2MD5A 3MAJA 1I5ZA 3PQJA 4LG0A 3WTTC 3WU1B 2XASA 3ZMUA 3CO6C 2WTEA 5CJ9A 2ZXJA 4WK8F 1A04A 3V7SA 1RNLA 2A68F 1FPQA 2M87A 2QWWA 4ASNA 1UCRA 1XGMA 4GYIA 3TO7A 5E1WA 1OYYA 1O7LA 2EFPA 4HF2A 3NRVA 3GLXA 1XMKA 2F2EA 5E18F 1EH8A 1HKQA 1G3TA 1D5VA 5LHIA 4KN4X 1IN6A 3ULQB 3H3UA 1Z1DA 5J6XA 3LA2A 4HDUA 3ZMTA 1E17A 3FMSA 4CXFA 2QVOA 1HW5A 1R1TA 4HLXA 1T0FA 4IJAA 5A2QZ 1RIOH 4CDGA 2VC0A 1W7PA 2CO5A 2VN2A 1ZRDA 2XRNA 3T5XA 3C7JA 2NRAC 1RUOA 2XVCA 1S7OA 2DO7A 5BPIA 4Q47A 4G7HF 1QO0D 2MBFA 3CJNA 1YS7A 1R5GA 1ZREA 3I59A 4GCVA 1OR7A 3JSOA 3GZ6A 2EV5A 2O6GE 1FX7A 3OOPA 3RDIA 1H9TA 4A5MA 2MLKA 3IRQA 3E5UA 3VOEA 4Y17A 1H0MA 2HFHA 4A6DA 5FFXA 4L0ZB 3JSPA 1TBXA 2ZMEB 2TDXA 2K02A 1IAWA 3J80K 2A6EF 4EM2A 4UVAA 1Q1HA 1U2WA 4IXAA 3JTGA 4S05A 1J75A 5LGTA 4A12A 3F23A 5FGMA 3WTXC 2EV6A 4P55A 2W24A 3GX4X 1K7AA 3IL2A 2VBZA 2QQ9A 4BYYA 1EH7A 2JT1A 3B73A 1XD7A 3QAHA 5DCFA 1U3EM 4HOBA 3RJPA 1G6NA 5JFRA 1TW2A 4ON0A 2DTRA 3KZYA 2K4BA 5JHUA 4ENKA 4RAZA 3KZZA 5D6EA 4HAMA 1PUEE 4KNYA 3Q9SA 1WRJA 1ZHFA 4RAYA 1FT9A 3RPUA 4BAYA 3DP7A 1JXSA 2DI3A 1U5TC 5HLIA 2MH2A 5ED4A 1FBUA 4PGHA 5HDGA 4WF2A 1XCBA 2XAHA 1KU7A 1U8RA 4YG2F 4LG0B 4RB2C 4EM1A 3IC7A 5L3EA 3RTRA 4EJWA 4U0WA 2A6HF 2LKPA 2QQBA 5FD5A 5CVRA 1P92A 3JAMK 3WTVC 2A3SA 4DNCA 3FMQA 3MQ0A 5H6QA 3MCZA 5CVIA 3T8RA 4KMFA 1B4AA 2NNYA 5FO5A 1HSJA 1BI1A 3HHGA 4U0YA 2LSOA 2XROA 3G73A 2DLLA 2KIMA 3U2RA 2XAFA 1Z9CA 2L02A 3KCCA 1YQAA 4HW0A 1O3RA 1XSXA 2GQQA 1MZBA 5J8FA 1USTA 1BBYA 3I5UA 1L0OC 1ZGJA 2FF4A 1J7KA 4PGGA 1HW1A 2FNAA 3BY6A 1W7PB 1QPMA 1FBQA 1S6LA 1WSUA 3HSEA 2FMLA 4BHPA 4E70A 4WXDA 1QNTA 4IVNA 3FWEA 3R0AA 5BQTA 2ZNYA 2FA5A 4KN7X 1HBXG 3F6OA 3GFIA 3I59B 4YFKF 2OQRA 5D5XB 3SXYA 5ERIA 3E6MA 1R1UA 1OYIA 1VTNC 4M74A 1FYKA 2DPDA 5DV5A 2PN6A 4HV6A 1SMYF 4P9UA 4RGRA 1JGSA 3L9FA 4Z2YA 4HLYA 3V8LA 4CICA 3HRTA 2Q8KA 4XLPF 3KP5A 2W85A 4N0BA 3JTHA 1E2XA 3WG9A 4JQFA 1YG2A 6PAXA 2ACJA 1K6OA 1LEAA 2LF7A 4KYWA 4QWQA 2COMA 1MDMA 3S2WA 3D5LA 3I0TA 1HKTA 3FHZA 1KQ0A 5HOOA 2DK8A 1BI0A 1WWXA 2F5FA 4TV7A 5E1XA 5LGNA 4AIHA 3BROA 1I1SA 1ON2A 3KE2A 3EDPA 3GFJA 4HDVA 4OMYA 2IJLA 5D5WB 2XUBA 1KQ8A 4JK1X 1YTYA 1BI3A 2MLGA 3RKYA 2P5KA 5FFZA 4LLLA 2FE3A 2M8EA 1IN5A 5AIQA 1YIOA 2O3FA 3HTUA 1ZG1A 3CO7C 1F5TA 1HSTA 1XDSA 4EV0A 2OU2A 1R22A 1TQMA 1FBSA 1BIBA 2O8XA 2KRFA 2UXNA 2RN7A 3J7AO 1J9IA 3V7CA 1D8JA 3HHHA 2BGCA 3REOA 2VT3A 2V9VA 2XAGA 1XGNA 5TJJA 2IA1A 4RB3C 3HTSB 2DQLA 2RC4A 2O03A 2ZCWA 3E5XA 4OIQF 1B59A 2E7XA 2FSWA 1SD4A 3QPTA 1OKRA 4G7OF 4M9SA 2QBYA 5E17F 2P6TA 3KP2A 3WTYC 4I09A 2X0LA 1V4RA 1SFEA 1ZLKA 3GYHX 3R60A 3BPXA 2HKOA 5DUIA 3PQKA 3IKTA 5BPDA 4B09A 3HOTA 4U7BA 3SQNA 4L5JA 1FZPB 5DYMA 1MJ9A 4BHCA 1X3UA 2IT0A 2ADUA 3KP3A 1BN5A 1S7AA 2AS5F 1FYLA 4FX4A 1XN7A 2FQ3A 2J5OA 5FD6A 3ELKA 4IRGA 1IRGA 2OQGA 4ZYEA 2FOKA 2Z99A 4KFCA 2HEOA 3J81Z 1W7PD 4L18B 1P4WA 4MGRA 1P4XA 3LAPA 2XGXA 1MJBA 1JHFA 1T2KA 3DF8A 4AD9A 4G6QA 4WWCA 1YW8A 3P9CA 1UB9A 3IRRA 2M45A 3F3XA 4UHTA 2OD5A 2Z33A 1PP8F 3R61A 3BDDA 2WV0A 1XB4A 4PDKA 4BXUA 5CYVA 2L4MA 3GUDA 2VXZA 2MA3A 4I0AA 2C6YA 1ULYA 2YX4A 2GWRA 4KICA 5LGUA 1TW3A 3EYYA 2PLYA 2HS5A 1G4DA 4M71A 2HWVA 1QBJA 5H6RA 2H27A 4M9XA 1LB2A 3P9KA 3W6KB 4A2UA 3ZQ7A 2F5CA 2ESNA 2HQNA 2Y0MA 3HRUA 4ETSA 1IF1A 5AONA 3M7GA 1MKMA 4DQ2A 4U7DA 2K4JA 5ICFA 3I58A 4LD5A 1ZARA 3DV8A 2HKXA 1I6XA 2P7VB 1ZG5A 2QENA 2P6SA 2L01A 2YU3A 2VBXA 4ZH4F 4OIOF 1IXCA 2ZJ2A 2VC1A 4QLCU 3OV8A 3DPLC 4ZYGA 5DCMB 2ZFWA 2FXAA 2QQAA 3L7WA 3V8KA 2VBYA 4D0PA 4AWXB 3TQNA 1Z6RA 2FBHA 2UXXA 3RYRA 2GZWA 3ZP5A 2A07F 2D45A 1LVAA 3M1EA 1IUYA 2ISZA 5F6FA 3BJ6A 5FLXZ 2KJBA 3C1DA 2ZO4A 4CYDA 2K86A 3DKWA 3LWFA 4UNOA 4EQQA 2O0YA 3WE3A 3KEOA 3J81K 3K1PA 4ESFA 1FSHA 1KYWA 2Z9OA 4A5NA 3QRFF 3BJAA 4OOIA 5JVTA 4HF1A 3RPQA 2BYVE 1ZLJA 2ISYA 4RS8A 3CUQA 1TNTA 3IWZA 1G3SA 3U1DA 4LLNA 5HVQC 5KVRA 4HQMA 5HLGA 3ML6A 1HKSA 3LQRA 3F8MA 3TDZC 3WE2A 2W84A 1RI7A 3RKXA 1R7JA 4LK1F 2IA0A 4FT8A 3KETA 4O3MA 1TQPA 4L9JA 3JW4A 4I7HA 2YPRA 5L3DA 4IRIA 1MD0A 2CFXA 4EVIA 1ZRFA 4HYEA 4N9HA 4RGXA 3LA3A 2VE8A 2E1CA 5ICGA 2QUFA 3ECHA 5A2QK 4CZZA 2CYYA 3GWZA 3C3WA 1T39A 2QM3A 3E5QA 3QOPA 4HV5A 1T38A 2ZKZA 5F64A 2MC3A 4G9YA 1BM9A 2DFIA 2RNJA 2PJPA 4WXCA 1W5TA 2ZBKA 1ZRCA 3DPTA 2EWNA 1FY7A 2HYFA 4MQVA 2ETHA 2R7FA 2JRTA 3FM5A 2HZTA 4GYGA 2P5LC 3TOBA 3KP4A 3VODA 1W5SA 2PBIA 2CQKA 1O3TA 1YW7A 2P5VA 1SD6A 2HR3A 4HX4A 2KIUA 3MEXA 3W6JB 1LEBA 5E8IA 4G94A 4O5VA 5LEKA 2L4AA 2KJCA 3WTUC 5D4SA 1O3QA 2B0LA 2PQ8A 5FLXK 5L3FA 1BJAA 4LFUA 1KA8A 3BPVA 2ESHA 5CLSA 3R4KA 1XDUA 1IN7A 5J8CA 5ILUA 3MWMA 2VONA 4UUVA 2UWMA 4UV8A 2L3DA 3M8FA 3GXOA 1HXDA 2RGVA 4P9FA 1YLFA 3WODF 4XLNF 1FP1D 4LB6B 4Q48A 4OMZA 5DDGA 4ENNA 2EV0A 4A0ZA 4Y13A 4G6DA 1I1GA 2XV4S 1JHHA 5CVVA 5F1RA 1QGPA 4BNCA 4HA8A 1YO5C 3QU6A 4KUMA 4LJZF 3N97A 4L0YB 3L2CA 3FXUA 4HZFA 2AXLA 5TRDA 5LHHA 2LF8A 3WU0A 1IN8A 4M72A 2GA2A 3BZ6A 1RZ4A 4AIJA 3LA7A 3F8NA 1FYMA 1J59A 2WC2A 3T0YA 2VT2A 1U6GA 5FB2A 3BOQA 2DW4A 3BWGA 1H9GA 1BI2A 3ISPA 3K2ZA 1KU2A 4YFXF 3FM3A 3T8TA 3RKWA 1ODDA 3WGIA 2OBPA 3K9TA 4GXOA 3E6CC 5K5OA 2QLZA 3I64A 2A61A 5LEJA 1IZ1A 2XKPA 1DP7P 1DUXC 2BBYA 1SFUA 4G8XA 3E6DA 1FSEA 3E97A 2HDCA 2V6CA 3CUQB 4CGZA 5ICEA 1SAXA 1IXSB 1C0WA 1SD7A 1YFHA 3MZYA 4Y15A 2NNNA 2OA4A 2NS0A 2CGPA 4Q5SF 1XSDA 2VE9A 2A69F 1QQIA 2V1UA 1FNNA 4I98B 1J0RA 3KLOA 1AWCA 2V1XA 4KMUX 2XAQA 3Q5FA 3GFLA 2RV8A 2GXBA 2FEZA 3KP7A 1F9NA 1GXPA 2W25A 1MGTA 1OYWA 1TNSA 3HRMA 1ZGAA 3N4MA 3RYPA 3K0LA 2GXGA 2D2WA 4ESBA 4I01A 4IPAA 2F5EA 5L3CA 2ZMEA 2H94A 5JI6A 3F72A 1SD5A 3ZN0A 5CVJA 2E1NA 4EJVA 2XKOA 2GIVA 5ILSA 5K5QA 1OPCA 2MH9A 2FU4A 3GF2A 3WTWC 5BOXA 5LLQA 3CUOA 2LDUA 3FX3A 1RUNA 5E8GA 3NQOA 1B1BA 1T6SA 5LBQA 1KYZA 3R6SA 1CGPA 3LAJA 2FMYA 2M5WA 2VBWA 5HS7A 1LDKB 2HGCA 2RKHA 4HX8A 4U88A 5DEQA 4M9ZA 1P2FA 4XSZF 1W4MA 5HDKA 4UV9A 4GGGA 4R1HA 5D8LB 2CWEA 1G3WA 3F8BA 4MTEA 2M30A 2EA4A 1XGSA 3EQLF 4OIRF 3ZPLA 2HTSA 4YFNF 2ZNZA 3QP5A 1R23A 3E6BA 2PMHA 2V79A 3I54A 2KIFA 2DU9A 4Q4ZF 1REPC 1KU3A 4L9NA 4OINF 4EM0B 4LMYA 4IHSA 1IW7F 4CO8A 1WI9A 4ESJA 1TLHB 5BS6A 1XMAA 4KIGA 1DPRA 5EEHA 2X4HA 2QYOA 4A6EA 4MEXF 3FF5A 1O7FA 3GW2A 3DXJF 3QPHA 5HLHA 4ENJA 2NYXA 3V4GA 1BC8C 1IN4A 3KLNA 3L00A 3ZN1A 4I0BA 2HOEA 2ELHA 1HQCA 1MDMB 3EUHA 1Z6TA 2FBKA 1FWZA 3LSTA 3D0SA 1QZYA 1Z91A 2VODA 1R36A 3KEQA 1R00A 4BH9A 3O6BB 3WGGA 4HX7A 2K27A 4XSXF 1B6AA 4R79A 1S3JA 1MJAA 5DUKA 1HW2A 3K1MA 3R0JA 3SFZA 4ZZLA 1ON1A 1I27A 4EJOA 1AOYA 2EA2A 3ZMZA 4FX0A 1G3YA 4R8HA 4A0YA 2PEXA 4EMSA 3T1BA 1T98A 1U5TA 3O2PE 2VOPA 1SFXA 5CVUA 3DEUA 3E3VA 1YW9A 3CLOA 4N9IA 2A5YB 1FP2A 2IA2A 4UVCA 2IVMA 3JAMZ 2STWA 4IHTA 2P8TA 2V1DA 3I53A 3HSRA 3MFKA 3ZMDA 4WX9A 4U0VA 3TO6A 3TGNA 2XIGA 1IXRC 1USSA 2HYGD 2CG4A 3O3KA 4UVBA 4EJTA 4ENMA 3SZPA 2D1VA 3P9IA 1BC7C 4HBLA 2RQPA 5HS9A
chains in the Genus database with same CATH superfamily
4B47A 4B48A 4ZYDA 3P7NA 1EH6A 1WJDA 3M1CA 3PNYA 3HYIA 2V9PA 3NEUA 3S1RJ 4GO1A 1OCTC 3F8CA 1HOMA 1VQOI 4A3BJ 4HF0A 2CV1A 4BXXJ 3UKGA 5L3GA 1TQIA 1UHSA 3H36A 4MQ9F 2PI0A 3ERMA 5ILVA 1SMTA 1H88C 5EEGA 3L2WA 1UHWA 3GFMA 3KP6A 1GT0C 2DA2A 3VB2A 2ID3A 5DD8A 3K4JA 2DMUA 2QBYB 4NHJA 4Z6YA 3GEZA 2WWYA 5K5RA 4RB0A 3K10A 1UHMA 3U9GA 2EFQA 2H6BA 2DT5A 2N8GA 3OYHA 1D8KA 5K7FA 3COAC 3HC7A 1YITI 1TC3C 2W57A 3ZQIA 4M6YA 1OFCX 5D8KB 2BZTA 1JJ8C 2COBA 1S72I 3BR3A 3ROUA 3FKJA 1CF7A 3O8HA 1K78A 5JHFA 2HOSA 5GAHJ 1P6RA 2H6CA 3FMRA 3LOCA 5J40A 2J5PA 3H5RA 3ABLH 1IRFA 1ORKA 3A01B 3HZJA 2FNPA 1YYVA 1ZYRF 1WQ2A 2ECCA 4W97A 3L09A 4RGUA 2PFBA 2AXTC 1DP3A 3WTSC 3DU6A 3FXJA 3PJRA 1Y8RB 2LNBA 3F6VA 3G4SI 3FZVA 1ETQA 3P5JA 3RQ4A 1FLIA 1DDNA 2XAUA 4A0XA 1Z77A 2WY7Q 1QPIA 2GAUA 5E20A 2K7LA 3J7ZI 4MTDA 2L7KA 4I6ZA 5H20A 3IKVA 3TOAA 4BKXA 3K70C 4OIPF 1A6IA 3RI4A 4I2OA 1LE8B 5FKMA 3ABKH 2IPQX 2JSPA 2DMNA 2DYRH 3SDGA 5DD4A 4DW6A 1E0EA 2Z5UA 3W6VA 4LK0F 2NVXJ 3GVAA 3LSPA 2M8GX 3QYFA 3A2KA 1E3PA 4XRFA 2DOAA 3Q0VA 2E7WA 3PFIA 4FE7A 3V7RA 2AO9A 3OYIA 2Q2EA 2NS8A 1FC3A 4N4NB 1QZEA 1ZELA 3DFGA 1S29A 3IWFA 3M8JA 5IYCJ 3DTEA 3AL0C 1KQ9A 2D1HA 3CCQI 3L2VA 2UZKA 3IHUA 3OYEA 2V9KA 2UV1A 4I02A 3QU3A 3RIRA 1R9TJ 1CQTA 2HVSA 3ECOA 4RM2A 2L0KA 1S8NA 2PMUA 3B02A 4YIIA 3DBRB 4KT5C 2OJED 3FXRA 5HDNA 2IS1A 2ME0A 3TDUC 2ZFUA 4KISA 4P96A 2XGDA 1JKRC 2H1KA 3F0CA 2EFOA 2M0CA 1O3SA 3J7YJ 3M07A 4F92B 4KA4A 1XSVA 2QZ8A 4CCNA 3VYRB 3CDHA 5IT3A 2X9DA 3MN2A 3BC8A 4F52A 4I99C 2RVCA 2G9WA 2OAZA 3WHBA 3DQVC 2Z16A 1ITYA 2PG4A 4A69C 3VSKA 3HOSA 2M1BA 3M9AA 4WCGA 1VZ0A 5HS8A 3ERED 1ZTRA 4UB8C 3ASNH 2F4OB 3PNVA 4M6XA 5LRRA 1LNWA 4AIKA 2K85A 1HCRA 1V55H 5D4RA 2FBIA 3GO5A 3G3ZA 2E36A 3ZMSA 3TO9A 1YS6A 2JPCA 4AVPA 2R7DA 4II3A 3CUQC 5AIPA 1SVMA 1TWAJ 5K1YA 1ZG3A 2HQ5A 5C44J 2EFWA 1R58A 1XMXA 3ZQQA 4KIBA 2V6EA 5IT9Z 1STZA 2G7HA 1QZZA 3OIPA 2CW0F 4ZYAA 3K1NA 3EUKL 3H3ZA 1TZLA 1FOXA 1XPXA 2KMUA 1Z7LA 2CQQA 1LJ9A 3KFWX 4DJAA 4GRIA 2GM4A 4HQEA 3B6CA 4FASD 3I9V2 1KGSA 1MH3A 4HSRA 4O6JA 4PCQA 1KU9A 4L9VA 2WAEA 4EGZA 3Q9VA 3LFKA 3OYKA 3ABTA 3BLYA 4NDLA 4WXHA 2BE5F 1TTYA 1ZN2A 2HTJA 2H09A 2JPBA 1GXQA 1DPUA 1U5TB 4E7JA 3TBIA 1LDJA 1S9HA 4K2EA 1XGOA 2R4GA 1PDNC 4EGYA 2DMPA 2BV6A 1O57A 1Z7UA 4QIWN 2STTA 4E4HA 2XF5A 5BMZA 1B72A 2CQ7A 1V3FA 1R6RA 3F8FA 2BXYA 1BOBA 3SZTA 1VQ6I 1IDZA 2E5ZA 4EJUA 4LLGF 1NHAA 3KYDB 3CDLA 4H0EA 1EV7A 2XHKA 5B1AH 3QP6A 4IQJA 4NB5A 2Y75A 3SEZA 4B8XA 1JKPC 1HDDC 1B8IB 3Q3SA 2RDPA 2DJIA 5LD2C 2JZYA 5JLWA 3L2QA 2LC2A 1R1VA 5LHGA 1XCVA 2IW5A 2PMZA 3F22A 3HIFA 3FXQA 2E34A 2Q0OA 5D5VB 3M3YJ 3AAFA 2HOTA 2Z3YA 4IO9F 2DA6A 3EYIA 3C18A 1N25A 1MBFA 3CJTB 4BJ5C 1JE8A 3BP8A 1BOAA 3OR1C 3TEDA 4BHBA 1Y39A 2FRHA 2DK5A 2BY1A 1MNDA 5IY5H 2VOOA 2BHZA 4ZZDA 4OAYA 4MNUA 2E2IJ 2XC7A 3GZ5A 1EJ9A 4KDPA 1OCZH 1MW7A 3RQIA 2G7UA 3K4MA 4DYCA 5D5UB 4YEJA 3JRGA 1JI8A 3G6EI 2DQRA 4PUSA 2IRFG 2KPMA 2GA1A 3JRHA 4IQ4A 1D3YA 3S93A 4X0GA 4RGSA 4BQAA 2EB7A 2R3SA 3BJOA 3JRAA 4CHUA 4CUGA 1F36A 2KDZA 2M9HA 3CP8A 3HOXJ 2JTVA 1LQ1A 3K69A 2ZXIA 1Y1WJ 2EJRA 3WU2C 1CF7B 2F4MB 1K78B 1Y1VJ 3EETA 2IP2A 4S0HB 2X6WA 4L5IA 1K79A 3CCJI 3OYFA 3C2BA 3HEFA 5D6FA 3H5AA 2EK5A 1P4AA 3CMYA 3LQQA 1HC8A 4P5OA 4CZCA 2HU9A 2XGCA 5DCMA 4FHTA 4CH7A 2E1MC 4M73A 1OCPA 3QOEA 2MC4A 1R5HA 2YSRA 2IGMA 3CCMI 5EG0A 2WY8Q 3HRSA 3VEPA 2L7ZA 3WGHA 3LNQA 3M8EA 2JSCA 2WB1A 4BY1J 3AG4H 3IP4B 3AG3H 3FIWA 2LTPA 2VKVA 4MHGA 1D0YA 4JBAA 3S1QJ 2BY3A 4KIFA 5EZHA 1UFMA 2BEOA 3FBIB 1GUUA 3HB9A 4IRHA 4F7ZA 2ZJQF 2YX7A 4JX5A 2BOLA 3QPLA 4CCLA 5IOZA 3RZOJ 5IT9K 4C30A 4AYBN 3S16J 1Z3XA 4RDUA 3L1PA 1ZH5A 2O61A 2KRHA 3SHFA 3VFZA 1J5YA 1Z05A 4M3BA 1EA3A 4S04A 2YR2A 2P7CB 3JRDA 3HUGA 2DBBA 3I71A 1BIAA 3V8JA 2F5DA 4N4OB 5LRSA 2Q2EB 1Y0UA 4KT6A 2VKEA 1YJNI 2GBYA 1GVJA 2VJ5A 2R7RA 1B9MA 4C3JJ 2K3PA 1A5JA 2I8DA 4JP0A 4NUBA 3NARA 3OOUA 1POGA 3FXKA 1WKMA 4ANJA 2NAZA 1FOKA 2EZKA 4G7ZF 2P4WA 3OYMA 4IF4A 1F4KA 4BBSJ 4XBFA 3I4PA 1J2XA 2YUSA 4NQWA 1BR1A 1ETWA 1SVLA 3CTAA 3MZHA 2CQNA 2XAJA 2PJRA 2JWTA 4PZJA 4L9TA 2EFNA 2OZUA 1MNMC 3TKYA 3S8PA 1L3LA 2X1CA 3U21A 5E1ZB 1FMVA 3ZCOA 2XSJC 1JUPA 2X51A 1OMIA 1GHCA 2GXAA 1JTYA 1MH4A 3UR3C 2DAOA 2HQRA 2Y48A 3GTQJ 2QA4I 2M7AA 1ONVA 5L3BA 2FX0A 3OYGA 5FROA 3WTZA 4RB1A 4XL9A 3ZMVA 3BTJA 1D5YA 3D5SC 5KK1A 4B4CA 5M5YJ 4MEYF 4LB5A 1HA8A 3LSKA 4ZYHA 1A6QA 4YIFA 3CCRI 2OZ6A 1TWGJ 5ICCA 1X2NA 2XF6A 4XQFA 1PP7U 3MKLA 2JA5J 3HSFA 3CMAI 5JR3A 2CSOA 2K40A 1F1ZA 2DA4A 2Z2SB 4OU0A 1ZAOA 2L54A 3H92A 3FKIJ 4LGWA 3A02A 2M4GA 4QPQA 2R7UA 5E79C 5GTHC 4XKWA 3F21A 3ABUA 4PFOA 2HNHA 4UXNA 5GADJ 5IYDJ 3G71I 3RCOA 2V1NA 2DPUA 3LSRA 4XIDA 1U9OA 3J80Z 1U78A 2KKOA 1LDDA 4D7MA 2CFOA 1B9NA 2MD5A 1N75A 1TWFJ 2BHYA 2IS6A 3MAJA 3MKZA 1I5ZA 4G6TB 3H0DA 3QODA 4BJ6C 1HF0A 4HNTA 2EIKH 3PQJA 4LG0A 3WTTC 2G0EA 3CF5F 3WU1B 2XASA 3BR0A 4ZJZA 1IG7A 5J1RA 3ZMUA 2E1OA 3CC4I 2Z1DA 2LREA 3KYCB 3CO6C 2WTEA 3OY9A 1KONA 5CJ9A 9ANTA 1X19A 2ZXJA 3K70D 4X1EA 4WK8F 1A04A 3V7SA 1RNLA 2B7EA 2A68F 3H9QA 1FPQA 2M87A 1UAAA 2QWWA 3JCUC 2F6CA 3A1YA 1UCRA 4ASNA 1XGMA 4GYIA 3TO7A 1V5FA 1RETA 1B72B 4RM3A 5E1WA 2ZMEC 1OYYA 1XS9A 2H1LA 1O7LA 1MBGA 2CMPA 3K7AJ 2EFPA 3CC7I 1TT5B 2KHMA 2DOFA 3BG3A 4HF2A 3NRVA 1VQNI 2EZHA 2CH0A 1BW5A 3GLXA 1D0XA 1Z21A 2R7OA 1XMKA 4EATA 1FTZA 4Y4RA 2F2EA 5E18F 4X6AJ 1NH3A 1Z67A 2X6OA 3H9GA 1A31A 1EH8A 1HKQA 2JA7J 2VKHA 3BTCA 2P0WA 1G3TA 2L2OA 1D5VA 2LP0A 1VNDA 5LHIA 4KN4X 1IN6A 1AA7A 2LBFA 3ULQB 3H3UA 1Z1DA 3PM1A 5J6XA 1V54H 3LA2A 1JKQC 1WCMJ 2DDBA 4HDUA 3ZMTA 1E17A 5B1BH 3DKXA 1IO2A 2ELJA 3FMSA 4B3XA 3HBLA 4CXFA 2QVOA 2HXOA 3DPUA 1W0TA 1HW5A 1R1TA 2CU7A 4HLXA 1T0FA 4IJAA 2ICWG 4YIRX 1WH7A 5A2QZ 1RIOH 2GOMA 4CDGA 2VC0A 1W7PA 2K5CA 2CO5A 2VN2A 4FETA 1ZRDA 1X1PA 2XRNA 3GMEA 2VPLA 4C9YA 3OYCA 3T5XA 3C7JA 4L5EA 4PJMA 3BG5A 1SC7A 2NRAC 3GCMA 1VQMI 2LY2A 2JRMA 1RUOA 4C2UA 2XVCA 1IC8A 1S7OA 2DO7A 5BPIA 1A35A 4Q47A 3PSIA 4G7HF 2OV7A 5F0FA 1QO0D 2MBFA 3N05A 1O4XA 4H4KC 1QU3A 1BW6A 1YS7A 2BY2A 3CJNA 4B44A 1IV6A 1R5GA 4V2FA 1ZREA 2XDVA 1OCRH 3I59A 4GCVA 1OR7A 3JSOA 3GZ6A 2EV5A 2O6GE 1FX7A 3OOPA 1RC9A 3PO2J 2WADA 3BCBA 3IH3A 3L2RA 5EG0B 3RDIA 1H9TA 4A5MA 2LY1A 5EGOB 2MLKA 3IRQA 3E5UA 5C4JJ 3VOEA 3FXOA 3DTKA 3WG7H 4IL6C 3VYUB 4Y17A 2KLOA 1H0MA 1VQ5I 2HFHA 2O5RA 3BR6A 4A6DA 2H8WA 5FFXA 3S32A 4L0ZB 2XB5A 3JSPA 1UMQA 1TBXA 2ZMEB 4IOCF 5HNHA 4A3LJ 1VQ7I 2TDXA 2K02A 1IAWA 3J80K 2A6EF 4EM2A 3HUGB 4MFDA 1Q1HA 4UVAA 4XORA 5KAIC 1U2WA 4IXAA 4BE0A 4XM3A 4XN3A 3JTGA 4S05A 2P81A 1J75A 5LGTA 4A12A 1I3AA 4IZZA 3FXMA 1R71A 3F23A 5FGMA 4AIDA 1H89C 3WTXC 4XNFA 2EV6A 4P55A 1ZKGA 5B66C 5EF6A 4LIVA 2W24A 3GX4X 5HLTA 1RR8C 1K7AA 4NQWB 4XLFA 3IL2A 2VBZA 1WJFA 2QQ9A 4BYYA 1T8IA 2PJRB 3EUHC 4QSHA 1K4SA 5F1JA 1PUFA 1EH7A 2R5YA 5E3NA 3BQZA 2Y9YA 2JT1A 4MIMA 3B73A 1IRXA 1VQKI 1XD7A 3QAHA 5DCFA 5KHDA 1DU6A 1U3EM 3CF2A 4HOBA 1R4MB 3RJPA 4P1WA 5J4YA 1G6NA 3S1NJ 3DEWA 5JFRA 2F5VA 1TW2A 2DFFA 4ON0A 2DTRA 5JVGF 3KZYA 3E0JB 2K4BA 5JHUA 4ENKA 4E7HA 4RAZA 2F4IA 3A0HC 2CV0A 1XC5A 3KZZA 2QQ8A 2E35A 1LPQA 5D6EA 5CQEA 5IPAA 4HAMA 1JUMA 2CW8A 2HQAA 1PUEE 4KNYA 3Q9SA 1WRJA 1ZHFA 2MABA 3D1NI 4RAYA 1FT9A 3RPUA 3ZQGA 2Y0SA 4CCOA 4PSXA 4BAYA 3GTKJ 3DP7A 1JXSA 2DI3A 1U5TC 5HLIA 4A3EJ 2O9LA 2MH2A 3JRFA 5ED4A 1FBUA 1YX3A 4LITA 3SJMA 2LLKA 2L9RA 3G1LA 5FLVA 2DCEA 2VASA 3PUFA 4PGHA 5HDGA 3W2VA 1WPKA 4WF2A 1XCBA 2XAHA 2RNGA 1KU7A 3H3VK 3G1MA 2DOEA 1U8RA 3I4NJ 4AM3A 4YG2F 4LG0B 2MW8A 2VUMJ 4RB2C 4EM1A 3GTMJ 4D9JA 3H1CA 3IC7A 5L3EA 1Z0XA 3RTRA 4EJWA 2JA6J 1WJBA 4LG3A 4U0WA 2A6HF 1RESA 2LKPA 1ZK8A 2QQBA 5FD5A 5CVRA 3FHNA 1MSFC 1P92A 3JAMK 2OCEA 2W48A 3WTVC 3KEYA 3CQZJ 4KJZA 3GTGJ 2A3SA 4DNCA 4XKCA 3FMQA 2JMWA 3MQ0A 5H6QA 3MCZA 5M3FJ 3S2DJ 5CVIA 3VDXA 2MYSA 2QSHX 3T8RA 2FOWA 4KMFA 1BL0A 4FISA 4CCMA 2MD0A 1B4AA 2D5VA 2NNYA 4ZTFA 2Y9ZA 5DM6F 2KL4A 3U1KA 4IHXA 1T56A 5FO5A 4E7SA 1HSJA 1BI1A 3HHGA 4U0YA 2LSOA 2XROA 3G73A 1AKHA 3GTJJ 1TL8A 2DLLA 2KIMA 4PJNA 2ZC2A 2LBFB 3U2RA 3FBNB 2XAFA 3ZR8X 4UUSA 2E2HJ 2CW7A 3H0GJ 1Z9CA 2L02A 4CSWA 5J1YA 4C3IJ 3KCCA 4IKFA 1YQAA 4HW0A 1O3RA 1XSXA 2GQQA 1MZBA 4M3DA 5J8FA 1USTA 3DKYA 1BBYA 3I5UA 1L0OC 1QVUA 1I6HJ 1ZGJA 2FF4A 3PUBA 2ZXHA 2KFDA 3QPSA 2DA7A 4RLQA 1J7KA 4PK4A 1QRYA 1HW1A 4PGGA 2FNAA 3BY6A 4XK4A 4C3HJ 3VYTB 2HDDA 1W7PB 2I5UA 3NWSA 1JKOC 1QPMA 5M5WJ 1FBQA 1S6LA 5E3MA 1WSUA 3DTIA 3HSEA 2FMLA 4U87A 1KZHA 4BHPA 4E70A 4WXDA 4CCJA 2I10A 4PJ0C 4RMNA 1WH5A 1QNTA 4IVNA 5E3LA 3FWEA 3R0AA 5BQTA 2ZNYA 2HI3A 2VIXA 1JGGA 2VKDA 2FA5A 4KN7X 1HBXG 2L7MP 3F6OA 3GFIA 3I59B 4YFKF 2OQRA 3QQAA 5D5XB 3SXYA 5ERIA 3GLLA 3E6MA 1R1UA 1Z3YA 1OYIA 1ACIA 3H35A 1FIPA 5F04A 1VTNC 3BZKA 2BXZA 4M74A 2XSDC 1IUFA 1FYKA 2DPDA 5TISC 1SFKA 5DV5A 2PN6A 2VJ4A 4HV6A 1SMYF 4P9UA 4RGRA 5KAFC 3HOUJ 5J4VA 1JGSA 2JN6A 3L9FA 4Z2YA 2ME6A 2R7VA 2B63J 4HLYA 1NG6A 3V8LA 2ZJPF 1PVEA 3HRTA 4CICA 2Q8KA 1X3WB 1F43A 2X1EA 4XLPF 3RKQA 3KP5A 4D7NA 4FE4A 2W85A 3MD2A 1VQLI 4N0BA 4IX7A 3JTHA 2DDAA 1E2XA 3WHCA 3WG9A 4JQFA 2R7XA 3SEQA 2NVQJ 1Q1VA 1YG2A 6PAXA 2ACJA 2KZGA 3LSMA 1K6OA 1LEAA 2XRLA 2LF7A 2LOOA 4KYWA 4QWQA 2MFZA 2COMA 3OYNA 1MDMA 3S2WA 3RZDJ 3D5LA 3JREA 3I0TA 1HKTA 2WV1A 3FHZA 2XB0X 1KQ0A 3S1MJ 2KP6A 1SAUA 2X85A 5HOOA 3CESA 2WBMA 2EBIA 2DK8A 1UG2A 4CCKA 1OJLA 1BI0A 1WWXA 3RSNA 2F5FA 5IYBJ 4TV7A 5E1XA 2ZSIB 5LGNA 4AIHA 1ETKA 2MG4A 1LFUP 3UNGC 3K4LA 4UUTA 4RBOA 1EKEA 4DZJA 1G59A 3BROA 1I1SA 1ON2A 3KE2A 4A3JJ 3EDPA 4AUXA 1GLNA 3GFJA 3ZXSA 2M0MA 5GAEJ 4HDVA 4OMYA 2R5YB 3I4MJ 2IJLA 5D5WB 2XUBA 1KQ8A 2VB6A 3QYEA 2IS2A 4JK1X 1YTYA 4DYRA 1JT6A 3D5RC 3GTOJ 2HXIA 2RQQA 3LL7A 4HNVA 1BI3A 2MLGA 4XOPA 2P5KA 3RKYA 2BVLA 5FFZA 2LR8A 3HXLA 2BW3A 4LLLA 3OSGA 2FE3A 2M8EA 2E2JJ 3OS2A 1IN5A 1T08B 2E5NA 5AIQA 1YIOA 2O3FA 3HTUA 1ZG1A 2DA1A 3CO7C 1YOVB 1F5TA 1HSTA 1XDSA 1X3ZB 4EV0A 3I55I 3W2AA 2E60A 1YJ9I 2OU2A 4FQGA 5F27A 4BEHA 1R22A 2WB1N 1RR7A 3HKZN 1X2MA 3CMEI 1TQMA 1FBSA 1BIBA 2O8XA 1FIAA 2KRFA 2R92J 2FJ1A 3DWLE 2UXNA 4FCYA 5GP9A 2ZJRF 2JK3A 2LH9A 2RN7A 1MBHA 2YU9J 3J7AO 1J9IA 2CUZA 3V7CA 1D8JA 3HHHA 1W0UA 2BGCA 3REOA 2VT3A 2MGQA 2M7BA 2V9VA 2XAGA 1XGNA 4AVZA 4AYBA 5TJJA 2IA1A 4RB3C 3HTSB 2DQLA 2RC4A 1E3HA 2O03A 2ZCWA 2DN0A 2R7QA 1NK3P 4M3EA 3ZQFA 2FD5A 3E5XA 1WJAA 4OIQF 3HPHA 3AG1H 3CJRB 2EQRA 3K2AA 1B59A 2W4SA 2XPWA 2E7XA 1S7EA 2FSWA 1SD4A 2XPUA 3QPTA 2LMDA 2F48A 1OKRA 1MIJA 1IV8A 4G7OF 4LOCA 3IUOA 4M9SA 2QBYA 3AFHA 2P6TA 2QSFX 3KP2A 5E17F 3WTYC 1MNEA 4AC0A 2WAQA 4I09A 2RAEA 2EZLA 2X0LA 1V4RA 2IBDA 3PSFA 3JRIA 3C2HA 3PNTA 2OF7A 4MLOA 1SFEA 1ZLKA 1PJRA 1R49A 4DIQA 3JR9A 4IHVA 3GYHX 3R60A 3KX2A 3BPXA 2B9SA 3HDDA 1WJCA 1VI0A 2HKOA 5J47A 3E7LA 1RPWA 3HPGA 5DUIA 3PQKA 3IKTA 5BPDA 1BA5A 1AKHB 4B09A 3HOTA 4U7BA 4UUSB 1RRJA 3SQNA 4L5JA 1FZPB 2CV2A 5DYMA 4HRIA 1MJ9A 3OYDA 4BHCA 1X3UA 2IT0A 2ADUA 4JOMA 3KP3A 3EPZA 1BN5A 4XRSA 1S7AA 2AS5F 1FYLA 2QEXI 4FX4A 1XN7A 1XX5A 2JUGA 3ABMH 3I3LA 1JTXA 1Y8QB 2FQ3A 2J5OA 4ITVA 5FD6A 3ELKA 4IRGA 1G2HA 1IRGA 5F0HA 2OQGA 4ZYEA 3OWTA 4PSWA 2Y2ZA 2EILH 2FOKA 2Z99A 4KFCA 4XLCA 2HEOA 3J81Z 1W7PD 4L18B 1P4WA 4MGRA 1P4XA 3LAPA 2XGXA 1D1BA 1MJBA 1JHFA 1WGXA 2K9QA 3DF8A 4AD9A 1T2KA 3ZQHA 3GZNB 1ZGWA 4G6QA 2XPVA 2GLOA 2NS7A 4WWCA 1YW8A 3CCLI 3P9CA 4MFEA 3IAS2 1UB9A 2X48A 2VQHA 2M45A 4XLHA 3IRRA 3F3XA 4UHTA 2OD5A 4BS9A 2Z33A 1J09A 2VQLA 1HLVA 1PP8F 3R61A 3BDDA 3DBLB 5FRNA 2WV0A 1XB4A 1XG1A 1NTCA 4PDKA 2DA3A 2CS3A 4BXUA 5CYVA 2L4MA 4G12A 4D1QA 4C2MJ 2OTLI 3GUDA 2VXZA 2MA3A 4I0AA 4BQNA 2C6YA 1VQ9I 1ULYA 2YX4A 2GIZA 3CP2A 3OYLA 1DGWY 1LFPA 2GWRA 1ETXA 2KT0A 1K6YA 4KICA 5LGUA 1MBKA 1TW3A 5E3OA 3EYYA 2NXNB 3C2GA 1WFXA 3S3NA 2TCTA 2V7FA 2JUCA 2PLYA 2HS5A 2HPMA 1G4DA 2OTJI 4M71A 2HWVA 3L2UA 1QBJA 5H6RA 2H27A 3J7AY 4M9XA 1SEUA 4DOZA 5FKKA 1LB2A 1OCCH 1MMAA 3P9KA 3W6KB 2EZIA 4A2UA 3FK7A 1TT0A 3ZQ7A 3CLQA 2LRDA 2F5CA 2ESNA 4Y33A 3ESWB 2HQNA 2Y0MA 3HRUA 3LSIA 4LIUA 1DGRM 5BNGA 4ETSA 1IF1A 1YRNA 5AONA 5IP6A 3BR2A 2A05A 3M7GA 1MKMA 4DQ2A 2HZDA 4U7DA 2K4JA 4BJTA 5ICFA 3PL8A 3I58A 4LD5A 1ETOA 2KZVA 1TP4A 4QPOA 3AG2H 1ZARA 2DODA 3DV8A 2HKXA 1I6XA 2P7VB 2Q1ZB 3G2BA 1ZG5A 4DGWB 2QENA 1LKXA 2P6SA 1BR4A 2L01A 2YU3A 2KDOA 2VBXA 3W2WA 2LG4A 4ZH4F 4OIOF 3PIOF 3PO3J 1IXCA 2ZJ2A 2VC1A 5FLMJ 1OQYA 3ZQLA 4QLCU 2BW3B 3OV8A 1A36A 3DPLC 3S15J 4ZYGA 5GPAA 3SZGA 5DCMB 4XRMA 1N77A 2ZFWA 2CUFA 3B6AA 2KIQA 4JX6A 3F9KA 4I76A 2FXAA 2QQAA 3L7WA 1R5ID 1ZR4A 5B3SH 3V8KA 3W3CA 4A93J 2VBYA 4HEA2 1BJZA 4D0PA 4BEHB 4AWXB 4XMYA 3TQNA 1Z6RA 4A3FJ 2FBHA 2UXXA 3RYRA 2GZWA 3ZP5A 2A07F 2D45A 1LVAA 3M1EA 1IUYA 1EF4A 1U8BA 2ISZA 2CQXA 2IXSA 5F6FA 3BJ6A 2DT7B 1WJEA 5FLXZ 2R93J 2KJBA 3FDYA 3VWBA 1X58A 3C1DA 2ZO4A 4B1RA 2E71A 4CYDA 2K86A 3DKWA 2VL8A 3LWFA 4UNOA 3A03A 1JUSA 4EQQA 1Y56A 1LUJB 3BR5A 4OAZA 2O0YA 3BT9A 3KEOA 3WE3A 2ZXWH 1SANA 3K1PA 4ESFA 4F91B 3J81K 2H8RA 1FSHA 3HL2A 3ZQCA 1GV2A 1NK2P 1KYWA 4RAFA 4XR6A 3H5NA 4BACA 3KPHA 1YIJI 3O8GA 2Z9OA 2R7TA 4A5NA 3QRFF 3BJAA 4KITB 3HOYJ 4OOIA 2ECBA 5C3EJ 4RAGA 2ELKA 3MMYB 5JVTA 3OIQA 4XLAA 3CCSI 2A6TA 3KYLA 3IH2A 4HF1A 2CUJA 3RPQA 2BYVE 1ZLJA 2ISYA 2QF7A 5EEAA 4RS8A 4IOAF 3CUQA 4NC7A 4BL0B 4CYCA 4GDFA 2VJJA 1TNTA 3IWZA 4DZPA 1G3SA 3HOWJ 3U1DA 2GOXB 3K6GA 4LLNA 5HVQC 2A5WA 3ZOBA 2FQ4A 3HGGA 3CJQB 4HQMA 3BCAA 5KVRA 3ML6A 5HLGA 4E7LA 1HKSA 3LQRA 3F8MA 1T0FC 5CQGA 4ZDLA 3TDZC 3WE2A 1IJWC 3CDIA 4ZTJA 3S3OA 2W84A 2NVTJ 1RI7A 4M3GA 4Y7NJ 3RKXA 3NWTA 1R7JA 4LK1F 2IA0A 4FT8A 2HDWA 3KETA 5KNLA 4O3MA 5B5EC 2Y0SN 1P7IA 1TQPA 4UB6C 4L9JA 4BDYA 3JW4A 3BQYA 3Q0WA 1I39A 4I7HA 2AHQA 1U9NA 1P7JA 2YPRA 5L3DA 4IRIA 2OUMA 1MD0A 2CFXA 4EVIA 1ZRFA 5IP7J 4HYEA 4N9HA 2EINH 4E7IA 4RGXA 4A3GJ 3LA3A 2VE8A 3OMYA 3PFYA 2E1CA 5ICGA 1LFBA 2QUFA 3ECHA 5A2QK 4CZZA 2CYYA 2IGNA 3GWZA 3C3WA 1T39A 1OR7C 2QM3A 3E5QA 3QOPA 4HV5A 3PIPF 2LK2A 3TP0A 1S5LC 3HG9A 1T38A 4DYQA 2ZKZA 4NNJA 5F64A 5IP9J 3A0BC 4BE2A 2MC3A 4G9YA 1BM9A 2DFIA 2RNJA 2AQFA 2PJPA 2HPIA 4RLFA 1X4PA 3K4NA 3FXLA 4WXCA 1W5TA 2ZBKA 1ZRCA 3DPTA 3S2HJ 1R4NB 2EWNA 1FY7A 2HYFA 4MQVA 2ETHA 3DCFA 2R7FA 2JRTA 2NOGA 3FM5A 2HZTA 3IH4A 4GYGA 2P5LC 4HPQA 3TOBA 4BE1A 4NC8A 2IGOA 3JRCA 4HG2A 3KP4A 1OCOH 4XKBA 3VODA 1W5SA 2PBIA 3M4OJ 1AHDP 5TGTA 2CQKA 1O3TA 2EIJH 1I3QJ 1YW7A 2P5VA 1SD6A 2HR3A 4HX4A 3TW6A 1YE9A 3KIOA 4A3DJ 2KIUA 3MEXA 1UZCA 2XGEA 3W6JB 5HODA 2LD5A 1LEBA 5E8IA 5EDNA 4G94A 4O5VA 5LEKA 2L4AA 2KJCA 3WTUC 5D4SA 5JLXA 1O3QA 2B0LA 2PQ8A 5FLXK 1OISA 5L3FA 1BJAA 1QHHD 3BTIA 4LFUA 1KA8A 3BPVA 2ESHA 5CLSA 5K7ZA 3R4KA 1XDUA 2X6YA 3OYBA 1IN7A 2HOAA 5J8CA 5ILUA 5M3MJ 3LSHA 3MWMA 2VONA 2HVQA 4UUVA 2UWMA 4UV8A 2DT6A 1UG0A 2L3DA 3M8FA 3X2QH 3ZRGA 4ZDOA 3GXOA 1HXDA 4XLEA 2RGVA 4P9FA 1YLFA 3WODF 1ETVA 2VQGA 4XLNF 1W36C 1I50J 1FP1D 1APLC 2VJIA 4LB6B 4Q48A 4OMZA 3DLLF 5DDGA 1YRNB 4ENNA 2LY9A 2EV0A 1QHGA 3V42A 4A0ZA 3HM5A 3OYAA 4Y13A 4G6DA 1I1GA 2XV4S 2ZB9A 5FKOA 1JHHA 3BG7A 2X6XA 5CVVA 5F1RA 4A3KJ 1QGPA 2LFBA 4BNCA 3OR2C 1AU7A 1MMSA 4HA8A 2L9SA 1YO5C 2EIMH 3QU6A 4YELA 1XTAA 1ZR2A 4KUMA 3CC2I 1D1AA 4LJZF 1FMWA 3N97A 4DBQA 3L2CA 4L0YB 4NC6A 5H2FC 3FXUA 4HZFA 2AXLA 2OCCH 3Q0UA 4BDZA 1MMDA 4OWRB 5TRDA 5HNFA 5LHHA 2LF8A 4BQQA 3WU0A 1IN8A 4M72A 2GA2A 5GAGJ 4BUPA 3BZ6A 3GTLJ 4BU2A 2Y69H 1RZ4A 4GFBA 4AIJA 3LA7A 1U0JA 4HNUA 2M2EA 3F8NA 1FYMA 1J59A 2NOJB 3VPRA 2ZSHB 4QTRA 3AL0B 2WC2A 4XONA 3T0YA 2VT2A 1UJ8A 3VYSB 2PMZN 5FKNA 1U6GA 2KQRA 5CKTA 5FB2A 3BOQA 2Y30A 2DW4A 3BWGA 1X1CA 4XKVA 4DBRA 3IV5A 1H9GA 1BI2A 3GTPJ 5DM7F 1FTTA 4XN0A 3ISPA 3K2ZA 5C4XJ 2HYJA 2M3AA 2R7WA 1KU2A 4YFXF 3FM3A 3T8TA 2QSGX 2OC6A 1GV5A 3RKWA 1ODDA 3WGIA 1Y6IA 2OBPA 3K9TA 4GXOA 2CJJA 4CA0A 1K61A 3E6CC 1X1AA 1IDYA 2X1DA 1W1WE 5K5OA 5GTIC 2IS4A 2Y31A 4JX4A 2QLZA 3I64A 2A61A 3AKZA 1DU0A 5LEJA 1IZ1A 2XKPA 1DP7P 4V2GA 1DUXC 2BBYA 1X1BA 1HDPA 3LSGA 1SFUA 1PUFB 2R5ZA 4IEJA 4G8XA 2E19A 2DJNA 5M5XJ 1VFCA 3LSJA 4F3QA 3MVPA 3E6DA 2K9NA 1OLTA 1QVTA 1FSEA 3E97A 2HDCA 2NVUB 1WVRA 4D5FA 2V6CA 2QCOA 3CUQB 2HVRA 4CYCB 4CGZA 3S17J 2PX9A 5ICEA 1SAXA 4D5CA 4E7ZA 1FOYA 1IXSB 1C0WA 1SD7A 5LFAA 1YFHA 3MZYA 1YJWI 4Y15A 2NNNA 1M1EB 2EH3A 2QKLB 2OA4A 2NS0A 4J19A 4B43A 2CGPA 4Y52J 1W5CC 2EPFA 2DMTA 4Q5SF 1XSDA 1Y0NA 1X1DA 4FTHA 2LKSA 2VE9A 2A69F 1QQIA 3G1OA 2V1UA 1ERDA 4ZDPA 3E1SA 1FNNA 4I98B 3H9JA 4M3FA 1J0RA 2NVYJ 3KLOA 1AWCA 2V1XA 4KMUX 2XAQA 3Q5FA 3GFLA 2RV8A 2GXBA 2FEZA 2V4JC 3KP7A 1F9NA 1GXPA 2W25A 1MGTA 1OYWA 1TNSA 3MZ8A 1N78A 2IAIA 3HRMA 3SDBA 3HGYA 5EGOA 3HKZA 1ZGAA 3N4MA 3RYPA 3K0LA 3K4CA 2GXGA 4E6KG 2D2WA 4ESBA 1WJ5A 4I01A 5F0CA 4IPAA 2O8KA 2F5EA 5L3CA 3S14J 5DTDA 2ZMEA 1K83J 2H94A 3EUAA 5JI6A 4A3CJ 1PYVA 3F72A 2LVSA 1SD5A 3HOZJ 3KZIC 2W1OA 2K3FA 2TRTA 3MKWB 3CMMA 3ZN0A 5CVJA 1UELB 4IHYA 1MSEC 2E1NA 3HJEA 2VPRA 4PFPA 4EJVA 3BTLA 2AQEA 1FEXA 2XKOA 2GIVA 1WZ2A 5ILSA 2VQCA 5K5QA 1OPCA 5GPCA 3LMMA 2MH9A 1H8AC 2W82A 2JJ7A 1JT0A 2FU4A 3GF2A 5EJCA 3WTWC 5LLQA 3TP3A 5BOXA 4IHWA 2WAQN 3CZ6A 1MBJA 4E7KA 3CUOA 1TWHJ 4XICA 3OL3A 2LDUA 3FX3A 1RUNA 5E8GA 3NQOA 5FRMA 1B1BA 4J00A 1T6SA 4AU7A 5LBQA 1KYZA 3OYJA 4B3AA 3R6SA 1CGPA 4NBQA 3LAJA 2FMYA 1D0ZA 2M5WA 2VBWA 2K9LA 1FJLA 1VQ8I 3A01A 5HS7A 1E3OC 1G8XA 1LDKB 2HGCA 2JQ7A 2RKHA 1P9QC 4HX8A 4U88A 3SYTA 2JVGA 5DEQA 5K7HA 4M6VA 4M9ZA 1P2FA 4XSZF 2XF7A 3DLAA 1W4MA 5HDKA 3HOVJ 1V5GA 4UV9A 2W7NA 1YHQI 1FOWA 2K9SA 3OS0A 2JA2A 3BG9A 4F93B 4GGGA 1V5EA 4R1HA 5D8LB 1VQPI 2BVMA 4A3IJ 2CWEA 5EZGA 1G3WA 3F8BA 4MTEA 2LKXA 2M30A 1LE8A 1WI3A 2EA4A 2ID6A 1XGSA 5FKLA 2R7SA 2L7FP 3EQLF 4OIRF 3ZPLA 1MMNA 2HTSA 1K4TA 4YFNF 2QKMB 4JYKA 4A3MJ 2RREA 2ZNZA 2M4KA 3BG6A 3DBHB 3QP5A 1R23A 3E6BA 3CCUI 2E1MB 4HSTA 2PMHA 1LVKA 2V79A 3FISA 2M34A 1ENHA 2KIFA 3FK6A 3I54A 2DU9A 1IGNA 4Q4ZF 1REPC 4RA2A 5J3LA 1KU3A 4L9NA 2DFHA 2KISA 4OINF 1JJ6C 4EM0B 1GDTA 2JA8J 4LMYA 2L9VA 4IHSA 1IW7F 4ZC3A 4CO8A 1WI9A 3DEEA 4ESJA 1TLHB 5BS6A 2O7OA 1QA6A 4ABZA 1XMAA 4KIGA 1DPRA 4XRSG 1TWCJ 3ASOH 3BR1A 3JRBA 2K9MA 5EEHA 2X4HA 3S3MA 3GBGA 2R7ZJ 5EYRA 2QYOA 3A4CA 3QYBA 4YRVA 1RKTA 3K4KA 4A6EA 4PJLA 3OSFA 4MEXF 3FF5A 1O7FA 5FJ8J 3DU5A 1WHUA 3GW2A 1X4OA 3DXJF 4F55A 3QPHA 1ZQ3P 3CCEI 5HLHA 2LYCA 4ENJA 1GVDA 2NYXA 3V4GA 2FUG2 1BC8C 3VSLA 1RKWA 4XOTA 2L9NA 1IN4A 3KLNA 3L00A 3ZN1A 4I0BA 2HOEA 2ELHA 1HQCA 4BXFA 1VF9A 1MDMB 3EUHA 2MSYA 1Z6TA 2WAFA 2DFEA 2FBKA 1FWZA 3CCYA 3LSTA 5J1UA 3D0SA 1QZYA 3CD6I 4C2TA 1D1CA 1Z91A 4BQOA 1R36A 1NG7A 3KEQA 1SFOJ 2VODA 2DMQA 1R00A 4BH9A 2WA0A 3LFUA 2VLAA 3O6BB 2DYSH 3K4BA 3WGGA 1T33A 2IEKA 3BZCA 4PJJA 2W00A 4HX7A 1BR2A 2BY0A 2K27A 4XSXF 2V26A 3ZGKA 1ETYA 4UY8I 1B6AA 1YX5A 3IAM2 4Y3OA 4R79A 1S3JA 1MJAA 5DUKA 1HW2A 3K1MA 3R0JA 2R5ZB 3SFZA 2UUZA 4ZZLA 3TL4X 1ON1A 3OL4A 1I27A 4EJOA 1AOYA 2R0QC 4W1UA 2EA2A 4EEFG 3ZMZA 4FX0A 1G3YA 4MO7A 4R8HA 4A0YA 3NAUA 2PEXA 2IGKA 2YS9A 3T1BA 1T98A 4EMSA 1IRZA 1U5TA 3O2PE 5DS9A 2L5QA 3TW7A 2VOPA 5IOYA 1SFXA 2DTZA 4II2A 1MMGA 5CVUA 3TMOA 3OS1A 3MKYB 2VI6A 1W36D 3DEUA 3E3VA 1SVOA 3SFIA 3QWLA 1YW9A 3CLOA 1MBEA 4N9IA 2A5YB 4V19K 1FP2A 2IA2A 3ONQA 4UVCA 2IVMA 4BY7J 3JAMZ 2STWA 3OIOA 2P8TA 3I56I 4IHTA 2V1DA 3I53A 3CCVI 5CPRB 3HSRA 3MFKA 3ZMDA 1VQ4I 4WX9A 4U0VA 1DQUA 3RPUD 4BBRJ 5KCMA 2CRGA 3TO6A 3TGNA 2XIGA 1YI2I 2DXIA 1IXRC 1USSA 2HYGD 2CG4A 3O3KA 1B8IA 2DA5A 4BGDA 4UVBA 4EJTA 2CUEA 1T95A 4J01A 2QGUA 4ENMA 3SZPA 2VXDA 2OPTA 2D1VA 3P9IA 2JVHA 5F08A 1BC7C 4HBLA 2RQPA 5HS9A 2KRCA
chains in the Genus database with same CATH topology
4ZYDA 3P7NA 1EH6A 3HYIA 3NEUA 4GO1A 3F8CA 4HF0A 5L3GA 1TQIA 4MQ9F 2PI0A 5ILVA 1SMTA 5EEGA 1UHWA 3GFMA 3KP6A 3VB2A 5DD8A 2QBYB 4NHJA 3GEZA 2WWYA 5K5RA 4RB0A 1UHMA 3U9GA 2EFQA 2H6BA 2DT5A 1D8KA 3COAC 2W57A 4M6YA 5D8KB 3ROUA 1CF7A 1K78A 1P6RA 2H6CA 3FMRA 2J5PA 1IRFA 2FNPA 1YYVA 1ZYRF 1WQ2A 3L09A 4RGUA 2PFBA 3WTSC 2LNBA 3F6VA 3FZVA 1FLIA 1DDNA 4A0XA 2GAUA 5E20A 2K7LA 4MTDA 5H20A 3IKVA 3TOAA 4OIPF 3RI4A 4I2OA 2IPQX 5DD4A 2Z5UA 4LK0F 3GVAA 4XRFA 2E7WA 3PFIA 3V7RA 2Q2EA 1FC3A 3IWFA 3DFGA 1S29A 1KQ9A 2D1HA 2UZKA 3IHUA 4I02A 3QU3A 3RIRA 3ECOA 1S8NA 2PMUA 3B02A 4YIIA 5HDNA 4KT5C 3FXRA 3TDUC 4P96A 2EFOA 1O3SA 4KA4A 1XSVA 2QZ8A 3CDHA 5IT3A 2RVCA 2G9WA 2OAZA 3DQVC 2PG4A 3HOSA 2M1BA 3M9AA 4WCGA 5HS8A 3ERED 4M6XA 5LRRA 1LNWA 4AIKA 5D4RA 2FBIA 3GO5A 3G3ZA 3ZMSA 3TO9A 1YS6A 2JPCA 4AVPA 2R7DA 3CUQC 5AIPA 5K1YA 1ZG3A 2EFWA 1R58A 4KIBA 5IT9Z 1STZA 2G7HA 1QZZA 2CW0F 3K1NA 3H3ZA 1LJ9A 3KFWX 4HQEA 1KGSA 4O6JA 4PCQA 1KU9A 4L9VA 4EGZA 3Q9VA 3LFKA 3ABTA 4WXHA 2BE5F 1TTYA 1ZN2A 2HTJA 2H09A 2JPBA 1GXQA 1DPUA 1U5TB 1LDJA 4K2EA 1XGOA 1PDNC 4EGYA 2BV6A 1O57A 1Z7UA 2STTA 5BMZA 1V3FA 3F8FA 3SZTA 4EJUA 4LLGF 1NHAA 4H0EA 1EV7A 2XHKA 3QP6A 4NB5A 2Y75A 4B8XA 2RDPA 2JZYA 1R1VA 5LHGA 1XCVA 2IW5A 3F22A 3HIFA 3FXQA 2Q0OA 5D5VB 3AAFA 2Z3YA 3EYIA 3C18A 1JE8A 3BP8A 1BOAA 4BHBA 2FRHA 2DK5A 2VOOA 4ZZDA 4MNUA 4KDPA 3GZ5A 5D5UB 2G7UA 2DQRA 2IRFG 2GA1A 1D3YA 4RGSA 4BQAA 2EB7A 2R3SA 3BJOA 4CHUA 2JTVA 1LQ1A 3K69A 2EJRA 1CF7B 1K78B 3EETA 2IP2A 4L5IA 1K79A 5D6FA 2EK5A 1P4AA 3LQQA 4P5OA 5DCMA 4FHTA 4M73A 1R5HA 2YSRA 3HRSA 3VEPA 3WGHA 3M8EA 2JSCA 4MHGA 4JBAA 4KIFA 1UFMA 2BEOA 4IRHA 4F7ZA 2YX7A 5IT9K 1ZH5A 2O61A 3SHFA 3VFZA 1J5YA 1Z05A 4S04A 2YR2A 2P7CB 3HUGA 2DBBA 3I71A 1BIAA 3V8JA 2F5DA 5LRSA 1Y0UA 1GVJA 1B9MA 1WKMA 2NAZA 1FOKA 4G7ZF 2P4WA 4IF4A 1F4KA 4XBFA 3I4PA 1J2XA 4NQWA 3CTAA 3MZHA 2XAJA 4PZJA 4L9TA 2EFNA 2OZUA 3TKYA 1L3LA 5E1ZB 1OMIA 1GHCA 2DAOA 2HQRA 2Y48A 1ONVA 5L3BA 3WTZA 4RB1A 3ZMVA 5KK1A 4MEYF 4LB5A 4ZYHA 4YIFA 2OZ6A 5ICCA 1PP7U 3HSFA 5JR3A 2CSOA 1F1ZA 4OU0A 1ZAOA 2L54A 3H92A 4LGWA 3F21A 3ABUA 4UXNA 2DPUA 3J80Z 1U78A 2KKOA 1LDDA 1B9NA 2MD5A 3MAJA 1I5ZA 3PQJA 4LG0A 3WTTC 3WU1B 2XASA 3ZMUA 3CO6C 2WTEA 5CJ9A 2ZXJA 4WK8F 1A04A 3V7SA 1RNLA 2A68F 1FPQA 2M87A 2QWWA 4ASNA 1UCRA 1XGMA 4GYIA 3TO7A 5E1WA 1OYYA 1O7LA 2EFPA 4HF2A 3NRVA 3GLXA 1XMKA 2F2EA 5E18F 1EH8A 1HKQA 1G3TA 1D5VA 5LHIA 4KN4X 1IN6A 3ULQB 3H3UA 1Z1DA 5J6XA 3LA2A 4HDUA 3ZMTA 1E17A 3FMSA 4CXFA 2QVOA 1HW5A 1R1TA 4HLXA 1T0FA 4IJAA 5A2QZ 1RIOH 4CDGA 2VC0A 1W7PA 2CO5A 2VN2A 1ZRDA 2XRNA 3T5XA 3C7JA 2NRAC 1RUOA 2XVCA 1S7OA 2DO7A 5BPIA 4Q47A 4G7HF 1QO0D 2MBFA 3CJNA 1YS7A 1R5GA 1ZREA 3I59A 4GCVA 1OR7A 3JSOA 3GZ6A 2EV5A 2O6GE 1FX7A 3OOPA 3RDIA 1H9TA 4A5MA 2MLKA 3IRQA 3E5UA 3VOEA 4Y17A 1H0MA 2HFHA 4A6DA 5FFXA 4L0ZB 3JSPA 1TBXA 2ZMEB 2TDXA 2K02A 1IAWA 3J80K 2A6EF 4EM2A 4UVAA 1Q1HA 1U2WA 4IXAA 3JTGA 4S05A 1J75A 5LGTA 4A12A 3F23A 5FGMA 3WTXC 2EV6A 4P55A 2W24A 3GX4X 1K7AA 3IL2A 2VBZA 2QQ9A 4BYYA 1EH7A 2JT1A 3B73A 1XD7A 3QAHA 5DCFA 1U3EM 4HOBA 3RJPA 1G6NA 5JFRA 1TW2A 4ON0A 2DTRA 3KZYA 2K4BA 5JHUA 4ENKA 4RAZA 3KZZA 5D6EA 4HAMA 1PUEE 4KNYA 3Q9SA 1WRJA 1ZHFA 4RAYA 1FT9A 3RPUA 4BAYA 3DP7A 1JXSA 2DI3A 1U5TC 5HLIA 2MH2A 5ED4A 1FBUA 4PGHA 5HDGA 4WF2A 1XCBA 2XAHA 1KU7A 1U8RA 4YG2F 4LG0B 4RB2C 4EM1A 3IC7A 5L3EA 3RTRA 4EJWA 4U0WA 2A6HF 2LKPA 2QQBA 5FD5A 5CVRA 1P92A 3JAMK 3WTVC 2A3SA 4DNCA 3FMQA 3MQ0A 5H6QA 3MCZA 5CVIA 3T8RA 4KMFA 1B4AA 2NNYA 5FO5A 1HSJA 1BI1A 3HHGA 4U0YA 2LSOA 2XROA 3G73A 2DLLA 2KIMA 3U2RA 2XAFA 1Z9CA 2L02A 3KCCA 1YQAA 4HW0A 1O3RA 1XSXA 2GQQA 1MZBA 5J8FA 1USTA 1BBYA 3I5UA 1L0OC 1ZGJA 2FF4A 1J7KA 4PGGA 1HW1A 2FNAA 3BY6A 1W7PB 1QPMA 1FBQA 1S6LA 1WSUA 3HSEA 2FMLA 4BHPA 4E70A 4WXDA 1QNTA 4IVNA 3FWEA 3R0AA 5BQTA 2ZNYA 2FA5A 4KN7X 1HBXG 3F6OA 3GFIA 3I59B 4YFKF 2OQRA 5D5XB 3SXYA 5ERIA 3E6MA 1R1UA 1OYIA 1VTNC 4M74A 1FYKA 2DPDA 5DV5A 2PN6A 4HV6A 1SMYF 4P9UA 4RGRA 1JGSA 3L9FA 4Z2YA 4HLYA 3V8LA 4CICA 3HRTA 2Q8KA 4XLPF 3KP5A 2W85A 4N0BA 3JTHA 1E2XA 3WG9A 4JQFA 1YG2A 6PAXA 2ACJA 1K6OA 1LEAA 2LF7A 4KYWA 4QWQA 2COMA 1MDMA 3S2WA 3D5LA 3I0TA 1HKTA 3FHZA 1KQ0A 5HOOA 2DK8A 1BI0A 1WWXA 2F5FA 4TV7A 5E1XA 5LGNA 4AIHA 3BROA 1I1SA 1ON2A 3KE2A 3EDPA 3GFJA 4HDVA 4OMYA 2IJLA 5D5WB 2XUBA 1KQ8A 4JK1X 1YTYA 1BI3A 2MLGA 3RKYA 2P5KA 5FFZA 4LLLA 2FE3A 2M8EA 1IN5A 5AIQA 1YIOA 2O3FA 3HTUA 1ZG1A 3CO7C 1F5TA 1HSTA 1XDSA 4EV0A 2OU2A 1R22A 1TQMA 1FBSA 1BIBA 2O8XA 2KRFA 2UXNA 2RN7A 3J7AO 1J9IA 3V7CA 1D8JA 3HHHA 2BGCA 3REOA 2VT3A 2V9VA 2XAGA 1XGNA 5TJJA 2IA1A 4RB3C 3HTSB 2DQLA 2RC4A 2O03A 2ZCWA 3E5XA 4OIQF 1B59A 2E7XA 2FSWA 1SD4A 3QPTA 1OKRA 4G7OF 4M9SA 2QBYA 5E17F 2P6TA 3KP2A 3WTYC 4I09A 2X0LA 1V4RA 1SFEA 1ZLKA 3GYHX 3R60A 3BPXA 2HKOA 5DUIA 3PQKA 3IKTA 5BPDA 4B09A 3HOTA 4U7BA 3SQNA 4L5JA 1FZPB 5DYMA 1MJ9A 4BHCA 1X3UA 2IT0A 2ADUA 3KP3A 1BN5A 1S7AA 2AS5F 1FYLA 4FX4A 1XN7A 2FQ3A 2J5OA 5FD6A 3ELKA 4IRGA 1IRGA 2OQGA 4ZYEA 2FOKA 2Z99A 4KFCA 2HEOA 3J81Z 1W7PD 4L18B 1P4WA 4MGRA 1P4XA 3LAPA 2XGXA 1MJBA 1JHFA 1T2KA 3DF8A 4AD9A 4G6QA 4WWCA 1YW8A 3P9CA 1UB9A 3IRRA 2M45A 3F3XA 4UHTA 2OD5A 2Z33A 1PP8F 3R61A 3BDDA 2WV0A 1XB4A 4PDKA 4BXUA 5CYVA 2L4MA 3GUDA 2VXZA 2MA3A 4I0AA 2C6YA 1ULYA 2YX4A 2GWRA 4KICA 5LGUA 1TW3A 3EYYA 2PLYA 2HS5A 1G4DA 4M71A 2HWVA 1QBJA 5H6RA 2H27A 4M9XA 1LB2A 3P9KA 3W6KB 4A2UA 3ZQ7A 2F5CA 2ESNA 2HQNA 2Y0MA 3HRUA 4ETSA 1IF1A 5AONA 3M7GA 1MKMA 4DQ2A 4U7DA 2K4JA 5ICFA 3I58A 4LD5A 1ZARA 3DV8A 2HKXA 1I6XA 2P7VB 1ZG5A 2QENA 2P6SA 2L01A 2YU3A 2VBXA 4ZH4F 4OIOF 1IXCA 2ZJ2A 2VC1A 4QLCU 3OV8A 3DPLC 4ZYGA 5DCMB 2ZFWA 2FXAA 2QQAA 3L7WA 3V8KA 2VBYA 4D0PA 4AWXB 3TQNA 1Z6RA 2FBHA 2UXXA 3RYRA 2GZWA 3ZP5A 2A07F 2D45A 1LVAA 3M1EA 1IUYA 2ISZA 5F6FA 3BJ6A 5FLXZ 2KJBA 3C1DA 2ZO4A 4CYDA 2K86A 3DKWA 3LWFA 4UNOA 4EQQA 2O0YA 3WE3A 3KEOA 3J81K 3K1PA 4ESFA 1FSHA 1KYWA 2Z9OA 4A5NA 3QRFF 3BJAA 4OOIA 5JVTA 4HF1A 3RPQA 2BYVE 1ZLJA 2ISYA 4RS8A 3CUQA 1TNTA 3IWZA 1G3SA 3U1DA 4LLNA 5HVQC 5KVRA 4HQMA 5HLGA 3ML6A 1HKSA 3LQRA 3F8MA 3TDZC 3WE2A 2W84A 1RI7A 3RKXA 1R7JA 4LK1F 2IA0A 4FT8A 3KETA 4O3MA 1TQPA 4L9JA 3JW4A 4I7HA 2YPRA 5L3DA 4IRIA 1MD0A 2CFXA 4EVIA 1ZRFA 4HYEA 4N9HA 4RGXA 3LA3A 2VE8A 2E1CA 5ICGA 2QUFA 3ECHA 5A2QK 4CZZA 2CYYA 3GWZA 3C3WA 1T39A 2QM3A 3E5QA 3QOPA 4HV5A 1T38A 2ZKZA 5F64A 2MC3A 4G9YA 1BM9A 2DFIA 2RNJA 2PJPA 4WXCA 1W5TA 2ZBKA 1ZRCA 3DPTA 2EWNA 1FY7A 2HYFA 4MQVA 2ETHA 2R7FA 2JRTA 3FM5A 2HZTA 4GYGA 2P5LC 3TOBA 3KP4A 3VODA 1W5SA 2PBIA 2CQKA 1O3TA 1YW7A 2P5VA 1SD6A 2HR3A 4HX4A 2KIUA 3MEXA 3W6JB 1LEBA 5E8IA 4G94A 4O5VA 5LEKA 2L4AA 2KJCA 3WTUC 5D4SA 1O3QA 2B0LA 2PQ8A 5FLXK 5L3FA 1BJAA 4LFUA 1KA8A 3BPVA 2ESHA 5CLSA 3R4KA 1XDUA 1IN7A 5J8CA 5ILUA 3MWMA 2VONA 4UUVA 2UWMA 4UV8A 2L3DA 3M8FA 3GXOA 1HXDA 2RGVA 4P9FA 1YLFA 3WODF 4XLNF 1FP1D 4LB6B 4Q48A 4OMZA 5DDGA 4ENNA 2EV0A 4A0ZA 4Y13A 4G6DA 1I1GA 2XV4S 1JHHA 5CVVA 5F1RA 1QGPA 4BNCA 4HA8A 1YO5C 3QU6A 4KUMA 4LJZF 3N97A 4L0YB 3L2CA 3FXUA 4HZFA 2AXLA 5TRDA 5LHHA 2LF8A 3WU0A 1IN8A 4M72A 2GA2A 3BZ6A 1RZ4A 4AIJA 3LA7A 3F8NA 1FYMA 1J59A 2WC2A 3T0YA 2VT2A 1U6GA 5FB2A 3BOQA 2DW4A 3BWGA 1H9GA 1BI2A 3ISPA 3K2ZA 1KU2A 4YFXF 3FM3A 3T8TA 3RKWA 1ODDA 3WGIA 2OBPA 3K9TA 4GXOA 3E6CC 5K5OA 2QLZA 3I64A 2A61A 5LEJA 1IZ1A 2XKPA 1DP7P 1DUXC 2BBYA 1SFUA 4G8XA 3E6DA 1FSEA 3E97A 2HDCA 2V6CA 3CUQB 4CGZA 5ICEA 1SAXA 1IXSB 1C0WA 1SD7A 1YFHA 3MZYA 4Y15A 2NNNA 2OA4A 2NS0A 2CGPA 4Q5SF 1XSDA 2VE9A 2A69F 1QQIA 2V1UA 1FNNA 4I98B 1J0RA 3KLOA 1AWCA 2V1XA 4KMUX 2XAQA 3Q5FA 3GFLA 2RV8A 2GXBA 2FEZA 3KP7A 1F9NA 1GXPA 2W25A 1MGTA 1OYWA 1TNSA 3HRMA 1ZGAA 3N4MA 3RYPA 3K0LA 2GXGA 2D2WA 4ESBA 4I01A 4IPAA 2F5EA 5L3CA 2ZMEA 2H94A 5JI6A 3F72A 1SD5A 3ZN0A 5CVJA 2E1NA 4EJVA 2XKOA 2GIVA 5ILSA 5K5QA 1OPCA 2MH9A 2FU4A 3GF2A 3WTWC 5BOXA 5LLQA 3CUOA 2LDUA 3FX3A 1RUNA 5E8GA 3NQOA 1B1BA 1T6SA 5LBQA 1KYZA 3R6SA 1CGPA 3LAJA 2FMYA 2M5WA 2VBWA 5HS7A 1LDKB 2HGCA 2RKHA 4HX8A 4U88A 5DEQA 4M9ZA 1P2FA 4XSZF 1W4MA 5HDKA 4UV9A 4GGGA 4R1HA 5D8LB 2CWEA 1G3WA 3F8BA 4MTEA 2M30A 2EA4A 1XGSA 3EQLF 4OIRF 3ZPLA 2HTSA 4YFNF 2ZNZA 3QP5A 1R23A 3E6BA 2PMHA 2V79A 3I54A 2KIFA 2DU9A 4Q4ZF 1REPC 1KU3A 4L9NA 4OINF 4EM0B 4LMYA 4IHSA 1IW7F 4CO8A 1WI9A 4ESJA 1TLHB 5BS6A 1XMAA 4KIGA 1DPRA 5EEHA 2X4HA 2QYOA 4A6EA 4MEXF 3FF5A 1O7FA 3GW2A 3DXJF 3QPHA 5HLHA 4ENJA 2NYXA 3V4GA 1BC8C 1IN4A 3KLNA 3L00A 3ZN1A 4I0BA 2HOEA 2ELHA 1HQCA 1MDMB 3EUHA 1Z6TA 2FBKA 1FWZA 3LSTA 3D0SA 1QZYA 1Z91A 2VODA 1R36A 3KEQA 1R00A 4BH9A 3O6BB 3WGGA 4HX7A 2K27A 4XSXF 1B6AA 4R79A 1S3JA 1MJAA 5DUKA 1HW2A 3K1MA 3R0JA 3SFZA 4ZZLA 1ON1A 1I27A 4EJOA 1AOYA 2EA2A 3ZMZA 4FX0A 1G3YA 4R8HA 4A0YA 2PEXA 4EMSA 3T1BA 1T98A 1U5TA 3O2PE 2VOPA 1SFXA 5CVUA 3DEUA 3E3VA 1YW9A 3CLOA 4N9IA 2A5YB 1FP2A 2IA2A 4UVCA 2IVMA 3JAMZ 2STWA 4IHTA 2P8TA 2V1DA 3I53A 3HSRA 3MFKA 3ZMDA 4WX9A 4U0VA 3TO6A 3TGNA 2XIGA 1IXRC 1USSA 2HYGD 2CG4A 3O3KA 4UVBA 4EJTA 4ENMA 3SZPA 2D1VA 3P9IA 1BC7C 4HBLA 2RQPA 5HS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYD A;  3P7N A;  1EH6 A;  3HYI A;  3NEU A;  4GO1 A;  3F8C A;  4HF0 A;  5L3G A;  1TQI A;  4MQ9 F;  2PI0 A;  5ILV A;  1SMT A;  5EEG A;  1UHW A;  3GFM A;  3KP6 A;  3VB2 A;  5DD8 A;  2QBY B;  4NHJ A;  3GEZ A;  2WWY A;  5K5R A;  4RB0 A;  1UHM A;  3U9G A;  2EFQ A;  2H6B A;  2DT5 A;  1D8K A;  3COA C;  2W57 A;  4M6Y A;  5D8K B;  3ROU A;  1CF7 A;  1K78 A;  1P6R A;  2H6C A;  3FMR A;  2J5P A;  1IRF A;  2FNP A;  1YYV A;  1ZYR F;  1WQ2 A;  3L09 A;  4RGU A;  2PFB A;  3WTS C;  2LNB A;  3F6V A;  3FZV A;  1FLI A;  1DDN A;  4A0X A;  2GAU A;  5E20 A;  2K7L A;  4MTD A;  5H20 A;  3IKV A;  3TOA A;  4OIP F;  3RI4 A;  4I2O A;  2IPQ X;  5DD4 A;  2Z5U A;  4LK0 F;  3GVA A;  4XRF A;  2E7W A;  3PFI A;  3V7R A;  2Q2E A;  1FC3 A;  3IWF A;  3DFG A;  1S29 A;  1KQ9 A;  2D1H A;  2UZK A;  3IHU A;  4I02 A;  3QU3 A;  3RIR A;  3ECO A;  1S8N A;  2PMU A;  3B02 A;  4YII A;  5HDN A;  4KT5 C;  3FXR A;  3TDU C;  4P96 A;  2EFO A;  1O3S A;  4KA4 A;  1XSV A;  2QZ8 A;  3CDH A;  5IT3 A;  2RVC A;  2G9W A;  2OAZ A;  3DQV C;  2PG4 A;  3HOS A;  2M1B A;  3M9A A;  4WCG A;  5HS8 A;  3ERE D;  4M6X A;  5LRR A;  1LNW A;  4AIK A;  5D4R A;  2FBI A;  3GO5 A;  3G3Z A;  3ZMS A;  3TO9 A;  1YS6 A;  2JPC A;  4AVP A;  2R7D A;  3CUQ C;  5AIP A;  5K1Y A;  1ZG3 A;  2EFW A;  1R58 A;  4KIB A;  5IT9 Z;  1STZ A;  2G7H A;  1QZZ A;  2CW0 F;  3K1N A;  3H3Z A;  1LJ9 A;  3KFW X;  4HQE A;  1KGS A;  4O6J A;  4PCQ A;  1KU9 A;  4L9V A;  4EGZ A;  3Q9V A;  3LFK A;  3ABT A;  4WXH A;  2BE5 F;  1TTY A;  1ZN2 A;  2HTJ A;  2H09 A;  2JPB A;  1GXQ A;  1DPU A;  1U5T B;  1LDJ A;  4K2E A;  1XGO A;  1PDN C;  4EGY A;  2BV6 A;  1O57 A;  1Z7U A;  2STT A;  5BMZ A;  1V3F A;  3F8F A;  3SZT A;  4EJU A;  4LLG F;  1NHA A;  4H0E A;  1EV7 A;  2XHK A;  3QP6 A;  4NB5 A;  2Y75 A;  4B8X A;  2RDP A;  2JZY A;  1R1V A;  5LHG A;  1XCV A;  2IW5 A;  3F22 A;  3HIF A;  3FXQ A;  2Q0O A;  5D5V B;  3AAF A;  2Z3Y A;  3EYI A;  3C18 A;  1JE8 A;  3BP8 A;  1BOA A;  4BHB A;  2FRH A;  2DK5 A;  2VOO A;  4ZZD A;  4MNU A;  4KDP A;  3GZ5 A;  5D5U B;  2G7U A;  2DQR A;  2IRF G;  2GA1 A;  1D3Y A;  4RGS A;  4BQA A;  2EB7 A;  2R3S A;  3BJO A;  4CHU A;  2JTV A;  1LQ1 A;  3K69 A;  2EJR A;  1CF7 B;  1K78 B;  3EET A;  2IP2 A;  4L5I A;  1K79 A;  5D6F A;  2EK5 A;  1P4A A;  3LQQ A;  4P5O A;  5DCM A;  4FHT A;  4M73 A;  1R5H A;  2YSR A;  3HRS A;  3VEP A;  3WGH A;  3M8E A;  2JSC A;  4MHG A;  4JBA A;  4KIF A;  1UFM A;  2BEO A;  4IRH A;  4F7Z A;  2YX7 A;  5IT9 K;  1ZH5 A;  2O61 A;  3SHF A;  3VFZ A;  1J5Y A;  1Z05 A;  4S04 A;  2YR2 A;  2P7C B;  3HUG A;  2DBB A;  3I71 A;  1BIA A;  3V8J A;  2F5D A;  5LRS A;  1Y0U A;  1GVJ A;  1B9M A;  1WKM A;  2NAZ A;  1FOK A;  4G7Z F;  2P4W A;  4IF4 A;  1F4K A;  4XBF A;  3I4P A;  1J2X A;  4NQW A;  3CTA A;  3MZH A;  2XAJ A;  4PZJ A;  4L9T A;  2EFN A;  2OZU A;  3TKY A;  1L3L A;  5E1Z B;  1OMI A;  1GHC A;  2DAO A;  2HQR A;  2Y48 A;  1ONV A;  5L3B A;  3WTZ A;  4RB1 A;  3ZMV A;  5KK1 A;  4MEY F;  4LB5 A;  4ZYH A;  4YIF A;  2OZ6 A;  5ICC A;  1PP7 U;  3HSF A;  5JR3 A;  2CSO A;  1F1Z A;  4OU0 A;  1ZAO A;  2L54 A;  3H92 A;  4LGW A;  3F21 A;  3ABU A;  4UXN A;  2DPU A;  3J80 Z;  1U78 A;  2KKO A;  1LDD A;  1B9N A;  2MD5 A;  3MAJ A;  1I5Z A;  3PQJ A;  4LG0 A;  3WTT C;  3WU1 B;  2XAS A;  3ZMU A;  3CO6 C;  2WTE A;  5CJ9 A;  2ZXJ A;  4WK8 F;  1A04 A;  3V7S A;  1RNL A;  2A68 F;  1FPQ A;  2M87 A;  2QWW A;  4ASN A;  1UCR A;  1XGM A;  4GYI A;  3TO7 A;  5E1W A;  1OYY A;  1O7L A;  2EFP A;  4HF2 A;  3NRV A;  3GLX A;  1XMK A;  2F2E A;  5E18 F;  1EH8 A;  1HKQ A;  1G3T A;  1D5V A;  5LHI A;  4KN4 X;  1IN6 A;  3ULQ B;  3H3U A;  1Z1D A;  5J6X A;  3LA2 A;  4HDU A;  3ZMT A;  1E17 A;  3FMS A;  4CXF A;  2QVO A;  1HW5 A;  1R1T A;  4HLX A;  1T0F A;  4IJA A;  5A2Q Z;  1RIO H;  4CDG A;  2VC0 A;  1W7P A;  2CO5 A;  2VN2 A;  1ZRD A;  2XRN A;  3T5X A;  3C7J A;  2NRA C;  1RUO A;  2XVC A;  1S7O A;  2DO7 A;  5BPI A;  4Q47 A;  4G7H F;  1QO0 D;  2MBF A;  3CJN A;  1YS7 A;  1R5G A;  1ZRE A;  3I59 A;  4GCV A;  1OR7 A;  3JSO A;  3GZ6 A;  2EV5 A;  2O6G E;  1FX7 A;  3OOP A;  3RDI A;  1H9T A;  4A5M A;  2MLK A;  3IRQ A;  3E5U A;  3VOE A;  4Y17 A;  1H0M A;  2HFH A;  4A6D A;  5FFX A;  4L0Z B;  3JSP A;  1TBX A;  2ZME B;  2TDX A;  2K02 A;  1IAW A;  3J80 K;  2A6E F;  4EM2 A;  4UVA A;  1Q1H A;  1U2W A;  4IXA A;  3JTG A;  4S05 A;  1J75 A;  5LGT A;  4A12 A;  3F23 A;  5FGM A;  3WTX C;  2EV6 A;  4P55 A;  2W24 A;  3GX4 X;  1K7A A;  3IL2 A;  2VBZ A;  2QQ9 A;  4BYY A;  1EH7 A;  2JT1 A;  3B73 A;  1XD7 A;  3QAH A;  5DCF A;  1U3E M;  4HOB A;  3RJP A;  1G6N A;  5JFR A;  1TW2 A;  4ON0 A;  2DTR A;  3KZY A;  2K4B A;  5JHU A;  4ENK A;  4RAZ A;  3KZZ A;  5D6E A;  4HAM A;  1PUE E;  4KNY A;  3Q9S A;  1WRJ A;  1ZHF A;  4RAY A;  1FT9 A;  3RPU A;  4BAY A;  3DP7 A;  1JXS A;  2DI3 A;  1U5T C;  5HLI A;  2MH2 A;  5ED4 A;  1FBU A;  4PGH A;  5HDG A;  4WF2 A;  1XCB A;  2XAH A;  1KU7 A;  1U8R A;  4YG2 F;  4LG0 B;  4RB2 C;  4EM1 A;  3IC7 A;  5L3E A;  3RTR A;  4EJW A;  4U0W A;  2A6H F;  2LKP A;  2QQB A;  5FD5 A;  5CVR A;  1P92 A;  3JAM K;  3WTV C;  2A3S A;  4DNC A;  3FMQ A;  3MQ0 A;  5H6Q A;  3MCZ A;  5CVI A;  3T8R A;  4KMF A;  1B4A A;  2NNY A;  5FO5 A;  1HSJ A;  1BI1 A;  3HHG A;  4U0Y A;  2LSO A;  2XRO A;  3G73 A;  2DLL A;  2KIM A;  3U2R A;  2XAF A;  1Z9C A;  2L02 A;  3KCC A;  1YQA A;  4HW0 A;  1O3R A;  1XSX A;  2GQQ A;  1MZB A;  5J8F A;  1UST A;  1BBY A;  3I5U A;  1L0O C;  1ZGJ A;  2FF4 A;  1J7K A;  4PGG A;  1HW1 A;  2FNA A;  3BY6 A;  1W7P B;  1QPM A;  1FBQ A;  1S6L A;  1WSU A;  3HSE A;  2FML A;  4BHP A;  4E70 A;  4WXD A;  1QNT A;  4IVN A;  3FWE A;  3R0A A;  5BQT A;  2ZNY A;  2FA5 A;  4KN7 X;  1HBX G;  3F6O A;  3GFI A;  3I59 B;  4YFK F;  2OQR A;  5D5X B;  3SXY A;  5ERI A;  3E6M A;  1R1U A;  1OYI A;  1VTN C;  4M74 A;  1FYK A;  2DPD A;  5DV5 A;  2PN6 A;  4HV6 A;  1SMY F;  4P9U A;  4RGR A;  1JGS A;  3L9F A;  4Z2Y A;  4HLY A;  3V8L A;  4CIC A;  3HRT A;  2Q8K A;  4XLP F;  3KP5 A;  2W85 A;  4N0B A;  3JTH A;  1E2X A;  3WG9 A;  4JQF A;  1YG2 A;  6PAX A;  2ACJ A;  1K6O A;  1LEA A;  2LF7 A;  4KYW A;  4QWQ A;  2COM A;  1MDM A;  3S2W A;  3D5L A;  3I0T A;  1HKT A;  3FHZ A;  1KQ0 A;  5HOO A;  2DK8 A;  1BI0 A;  1WWX A;  2F5F A;  4TV7 A;  5E1X A;  5LGN A;  4AIH A;  3BRO A;  1I1S A;  1ON2 A;  3KE2 A;  3EDP A;  3GFJ A;  4HDV A;  4OMY A;  2IJL A;  5D5W B;  2XUB A;  1KQ8 A;  4JK1 X;  1YTY A;  1BI3 A;  2MLG A;  3RKY A;  2P5K A;  5FFZ A;  4LLL A;  2FE3 A;  2M8E A;  1IN5 A;  5AIQ A;  1YIO A;  2O3F A;  3HTU A;  1ZG1 A;  3CO7 C;  1F5T A;  1HST A;  1XDS A;  4EV0 A;  2OU2 A;  1R22 A;  1TQM A;  1FBS A;  1BIB A;  2O8X A;  2KRF A;  2UXN A;  2RN7 A;  3J7A O;  1J9I A;  3V7C A;  1D8J A;  3HHH A;  2BGC A;  3REO A;  2VT3 A;  2V9V A;  2XAG A;  1XGN A;  5TJJ A;  2IA1 A;  4RB3 C;  3HTS B;  2DQL A;  2RC4 A;  2O03 A;  2ZCW A;  3E5X A;  4OIQ F;  1B59 A;  2E7X A;  2FSW A;  1SD4 A;  3QPT A;  1OKR A;  4G7O F;  4M9S A;  2QBY A;  5E17 F;  2P6T A;  3KP2 A;  3WTY C;  4I09 A;  2X0L A;  1V4R A;  1SFE A;  1ZLK A;  3GYH X;  3R60 A;  3BPX A;  2HKO A;  5DUI A;  3PQK A;  3IKT A;  5BPD A;  4B09 A;  3HOT A;  4U7B A;  3SQN A;  4L5J A;  1FZP B;  5DYM A;  1MJ9 A;  4BHC A;  1X3U A;  2IT0 A;  2ADU A;  3KP3 A;  1BN5 A;  1S7A A;  2AS5 F;  1FYL A;  4FX4 A;  1XN7 A;  2FQ3 A;  2J5O A;  5FD6 A;  3ELK A;  4IRG A;  1IRG A;  2OQG A;  4ZYE A;  2FOK A;  2Z99 A;  4KFC A;  2HEO A;  3J81 Z;  1W7P D;  4L18 B;  1P4W A;  4MGR A;  1P4X A;  3LAP A;  2XGX A;  1MJB A;  1JHF A;  1T2K A;  3DF8 A;  4AD9 A;  4G6Q A;  4WWC A;  1YW8 A;  3P9C A;  1UB9 A;  3IRR A;  2M45 A;  3F3X A;  4UHT A;  2OD5 A;  2Z33 A;  1PP8 F;  3R61 A;  3BDD A;  2WV0 A;  1XB4 A;  4PDK A;  4BXU A;  5CYV A;  2L4M A;  3GUD A;  2VXZ A;  2MA3 A;  4I0A A;  2C6Y A;  1ULY A;  2YX4 A;  2GWR A;  4KIC A;  5LGU A;  1TW3 A;  3EYY A;  2PLY A;  2HS5 A;  1G4D A;  4M71 A;  2HWV A;  1QBJ A;  5H6R A;  2H27 A;  4M9X A;  1LB2 A;  3P9K A;  3W6K B;  4A2U A;  3ZQ7 A;  2F5C A;  2ESN A;  2HQN A;  2Y0M A;  3HRU A;  4ETS A;  1IF1 A;  5AON A;  3M7G A;  1MKM A;  4DQ2 A;  4U7D A;  2K4J A;  5ICF A;  3I58 A;  4LD5 A;  1ZAR A;  3DV8 A;  2HKX A;  1I6X A;  2P7V B;  1ZG5 A;  2QEN A;  2P6S A;  2L01 A;  2YU3 A;  2VBX A;  4ZH4 F;  4OIO F;  1IXC A;  2ZJ2 A;  2VC1 A;  4QLC U;  3OV8 A;  3DPL C;  4ZYG A;  5DCM B;  2ZFW A;  2FXA A;  2QQA A;  3L7W A;  3V8K A;  2VBY A;  4D0P A;  4AWX B;  3TQN A;  1Z6R A;  2FBH A;  2UXX A;  3RYR A;  2GZW A;  3ZP5 A;  2A07 F;  2D45 A;  1LVA A;  3M1E A;  1IUY A;  2ISZ A;  5F6F A;  3BJ6 A;  5FLX Z;  2KJB A;  3C1D A;  2ZO4 A;  4CYD A;  2K86 A;  3DKW A;  3LWF A;  4UNO A;  4EQQ A;  2O0Y A;  3WE3 A;  3KEO A;  3J81 K;  3K1P A;  4ESF A;  1FSH A;  1KYW A;  2Z9O A;  4A5N A;  3QRF F;  3BJA A;  4OOI A;  5JVT A;  4HF1 A;  3RPQ A;  2BYV E;  1ZLJ A;  2ISY A;  4RS8 A;  3CUQ A;  1TNT A;  3IWZ A;  1G3S A;  3U1D A;  4LLN A;  5HVQ C;  5KVR A;  4HQM A;  5HLG A;  3ML6 A;  1HKS A;  3LQR A;  3F8M A;  3TDZ C;  3WE2 A;  2W84 A;  1RI7 A;  3RKX A;  1R7J A;  4LK1 F;  2IA0 A;  4FT8 A;  3KET A;  4O3M A;  1TQP A;  4L9J A;  3JW4 A;  4I7H A;  2YPR A;  5L3D A;  4IRI A;  1MD0 A;  2CFX A;  4EVI A;  1ZRF A;  4HYE A;  4N9H A;  4RGX A;  3LA3 A;  2VE8 A;  2E1C A;  5ICG A;  2QUF A;  3ECH A;  5A2Q K;  4CZZ A;  2CYY A;  3GWZ A;  3C3W A;  1T39 A;  2QM3 A;  3E5Q A;  3QOP A;  4HV5 A;  1T38 A;  2ZKZ A;  5F64 A;  2MC3 A;  4G9Y A;  1BM9 A;  2DFI A;  2RNJ A;  2PJP A;  4WXC A;  1W5T A;  2ZBK A;  1ZRC A;  3DPT A;  2EWN A;  1FY7 A;  2HYF A;  4MQV A;  2ETH A;  2R7F A;  2JRT A;  3FM5 A;  2HZT A;  4GYG A;  2P5L C;  3TOB A;  3KP4 A;  3VOD A;  1W5S A;  2PBI A;  2CQK A;  1O3T A;  1YW7 A;  2P5V A;  1SD6 A;  2HR3 A;  4HX4 A;  2KIU A;  3MEX A;  3W6J B;  1LEB A;  5E8I A;  4G94 A;  4O5V A;  5LEK A;  2L4A A;  2KJC A;  3WTU C;  5D4S A;  1O3Q A;  2B0L A;  2PQ8 A;  5FLX K;  5L3F A;  1BJA A;  4LFU A;  1KA8 A;  3BPV A;  2ESH A;  5CLS A;  3R4K A;  1XDU A;  1IN7 A;  5J8C A;  5ILU A;  3MWM A;  2VON A;  4UUV A;  2UWM A;  4UV8 A;  2L3D A;  3M8F A;  3GXO A;  1HXD A;  2RGV A;  4P9F A;  1YLF A;  3WOD F;  4XLN F;  1FP1 D;  4LB6 B;  4Q48 A;  4OMZ A;  5DDG A;  4ENN A;  2EV0 A;  4A0Z A;  4Y13 A;  4G6D A;  1I1G A;  2XV4 S;  1JHH A;  5CVV A;  5F1R A;  1QGP A;  4BNC A;  4HA8 A;  1YO5 C;  3QU6 A;  4KUM A;  4LJZ F;  3N97 A;  4L0Y B;  3L2C A;  3FXU A;  4HZF A;  2AXL A;  5TRD A;  5LHH A;  2LF8 A;  3WU0 A;  1IN8 A;  4M72 A;  2GA2 A;  3BZ6 A;  1RZ4 A;  4AIJ A;  3LA7 A;  3F8N A;  1FYM A;  1J59 A;  2WC2 A;  3T0Y A;  2VT2 A;  1U6G A;  5FB2 A;  3BOQ A;  2DW4 A;  3BWG A;  1H9G A;  1BI2 A;  3ISP A;  3K2Z A;  1KU2 A;  4YFX F;  3FM3 A;  3T8T A;  3RKW A;  1ODD A;  3WGI A;  2OBP A;  3K9T A;  4GXO A;  3E6C C;  5K5O A;  2QLZ A;  3I64 A;  2A61 A;  5LEJ A;  1IZ1 A;  2XKP A;  1DP7 P;  1DUX C;  2BBY A;  1SFU A;  4G8X A;  3E6D A;  1FSE A;  3E97 A;  2HDC A;  2V6C A;  3CUQ B;  4CGZ A;  5ICE A;  1SAX A;  1IXS B;  1C0W A;  1SD7 A;  1YFH A;  3MZY A;  4Y15 A;  2NNN A;  2OA4 A;  2NS0 A;  2CGP A;  4Q5S F;  1XSD A;  2VE9 A;  2A69 F;  1QQI A;  2V1U A;  1FNN A;  4I98 B;  1J0R A;  3KLO A;  1AWC A;  2V1X A;  4KMU X;  2XAQ A;  3Q5F A;  3GFL A;  2RV8 A;  2GXB A;  2FEZ A;  3KP7 A;  1F9N A;  1GXP A;  2W25 A;  1MGT A;  1OYW A;  1TNS A;  3HRM A;  1ZGA A;  3N4M A;  3RYP A;  3K0L A;  2GXG A;  2D2W A;  4ESB A;  4I01 A;  4IPA A;  2F5E A;  5L3C A;  2ZME A;  2H94 A;  5JI6 A;  3F72 A;  1SD5 A;  3ZN0 A;  5CVJ A;  2E1N A;  4EJV A;  2XKO A;  2GIV A;  5ILS A;  5K5Q A;  1OPC A;  2MH9 A;  2FU4 A;  3GF2 A;  3WTW C;  5BOX A;  5LLQ A;  3CUO A;  2LDU A;  3FX3 A;  1RUN A;  5E8G A;  3NQO A;  1B1B A;  1T6S A;  5LBQ A;  1KYZ A;  3R6S A;  1CGP A;  3LAJ A;  2FMY A;  2M5W A;  2VBW A;  5HS7 A;  1LDK B;  2HGC A;  2RKH A;  4HX8 A;  4U88 A;  5DEQ A;  4M9Z A;  1P2F A;  4XSZ F;  1W4M A;  5HDK A;  4UV9 A;  4GGG A;  4R1H A;  5D8L B;  2CWE A;  1G3W A;  3F8B A;  4MTE A;  2M30 A;  2EA4 A;  1XGS A;  3EQL F;  4OIR F;  3ZPL A;  2HTS A;  4YFN F;  2ZNZ A;  3QP5 A;  1R23 A;  3E6B A;  2PMH A;  2V79 A;  3I54 A;  2KIF A;  2DU9 A;  4Q4Z F;  1REP C;  1KU3 A;  4L9N A;  4OIN F;  4EM0 B;  4LMY A;  4IHS A;  1IW7 F;  4CO8 A;  1WI9 A;  4ESJ A;  1TLH B;  5BS6 A;  1XMA A;  4KIG A;  1DPR A;  5EEH A;  2X4H A;  2QYO A;  4A6E A;  4MEX F;  3FF5 A;  1O7F A;  3GW2 A;  3DXJ F;  3QPH A;  5HLH A;  4ENJ A;  2NYX A;  3V4G A;  1BC8 C;  1IN4 A;  3KLN A;  3L00 A;  3ZN1 A;  4I0B A;  2HOE A;  2ELH A;  1HQC A;  1MDM B;  3EUH A;  1Z6T A;  2FBK A;  1FWZ A;  3LST A;  3D0S A;  1QZY A;  1Z91 A;  2VOD A;  1R36 A;  3KEQ A;  1R00 A;  4BH9 A;  3O6B B;  3WGG A;  4HX7 A;  2K27 A;  4XSX F;  1B6A A;  4R79 A;  1S3J A;  1MJA A;  5DUK A;  1HW2 A;  3K1M A;  3R0J A;  3SFZ A;  4ZZL A;  1ON1 A;  1I27 A;  4EJO A;  1AOY A;  2EA2 A;  3ZMZ A;  4FX0 A;  1G3Y A;  4R8H A;  4A0Y A;  2PEX A;  4EMS A;  3T1B A;  1T98 A;  1U5T A;  3O2P E;  2VOP A;  1SFX A;  5CVU A;  3DEU A;  3E3V A;  1YW9 A;  3CLO A;  4N9I A;  2A5Y B;  1FP2 A;  2IA2 A;  4UVC A;  2IVM A;  3JAM Z;  2STW A;  4IHT A;  2P8T A;  2V1D A;  3I53 A;  3HSR A;  3MFK A;  3ZMD A;  4WX9 A;  4U0V A;  3TO6 A;  3TGN A;  2XIG A;  1IXR C;  1USS A;  2HYG D;  2CG4 A;  3O3K A;  4UVB A;  4EJT A;  4ENM A;  3SZP A;  2D1V A;  3P9I A;  1BC7 C;  4HBL A;  2RQP A;  5HS9 A; 
#chains in the Genus database with same CATH topology
 4B47 A;  4B48 A;  4ZYD A;  3P7N A;  1EH6 A;  1WJD A;  3M1C A;  3PNY A;  3HYI A;  2V9P A;  3NEU A;  3S1R J;  4GO1 A;  1OCT C;  3F8C A;  1HOM A;  1VQO I;  4A3B J;  4HF0 A;  2CV1 A;  4BXX J;  3UKG A;  5L3G A;  1TQI A;  1UHS A;  3H36 A;  4MQ9 F;  2PI0 A;  3ERM A;  5ILV A;  1SMT A;  1H88 C;  5EEG A;  3L2W A;  1UHW A;  3GFM A;  3KP6 A;  1GT0 C;  2DA2 A;  3VB2 A;  2ID3 A;  5DD8 A;  3K4J A;  2DMU A;  2QBY B;  4NHJ A;  4Z6Y A;  3GEZ A;  2WWY A;  5K5R A;  4RB0 A;  3K10 A;  1UHM A;  3U9G A;  2EFQ A;  2H6B A;  2DT5 A;  2N8G A;  3OYH A;  1D8K A;  5K7F A;  3COA C;  3HC7 A;  1YIT I;  1TC3 C;  2W57 A;  3ZQI A;  4M6Y A;  1OFC X;  5D8K B;  2BZT A;  1JJ8 C;  2COB A;  1S72 I;  3BR3 A;  3ROU A;  3FKJ A;  1CF7 A;  3O8H A;  1K78 A;  5JHF A;  2HOS A;  5GAH J;  1P6R A;  2H6C A;  3FMR A;  3LOC A;  5J40 A;  2J5P A;  3H5R A;  3ABL H;  1IRF A;  1ORK A;  3A01 B;  3HZJ A;  2FNP A;  1YYV A;  1ZYR F;  1WQ2 A;  2ECC A;  4W97 A;  3L09 A;  4RGU A;  2PFB A;  2AXT C;  1DP3 A;  3WTS C;  3DU6 A;  3FXJ A;  3PJR A;  1Y8R B;  2LNB A;  3F6V A;  3G4S I;  3FZV A;  1ETQ A;  3P5J A;  3RQ4 A;  1FLI A;  1DDN A;  2XAU A;  4A0X A;  1Z77 A;  2WY7 Q;  1QPI A;  2GAU A;  5E20 A;  2K7L A;  3J7Z I;  4MTD A;  2L7K A;  4I6Z A;  5H20 A;  3IKV A;  3TOA A;  4BKX A;  3K70 C;  4OIP F;  1A6I A;  3RI4 A;  4I2O A;  1LE8 B;  5FKM A;  3ABK H;  2IPQ X;  2JSP A;  2DMN A;  2DYR H;  3SDG A;  5DD4 A;  4DW6 A;  1E0E A;  2Z5U A;  3W6V A;  4LK0 F;  2NVX J;  3GVA A;  3LSP A;  2M8G X;  3QYF A;  3A2K A;  1E3P A;  4XRF A;  2DOA A;  3Q0V A;  2E7W A;  3PFI A;  4FE7 A;  3V7R A;  2AO9 A;  3OYI A;  2Q2E A;  2NS8 A;  1FC3 A;  4N4N B;  1QZE A;  1ZEL A;  3DFG A;  1S29 A;  3IWF A;  3M8J A;  5IYC J;  3DTE A;  3AL0 C;  1KQ9 A;  2D1H A;  3CCQ I;  3L2V A;  2UZK A;  3IHU A;  3OYE A;  2V9K A;  2UV1 A;  4I02 A;  3QU3 A;  3RIR A;  1R9T J;  1CQT A;  2HVS A;  3ECO A;  4RM2 A;  2L0K A;  1S8N A;  2PMU A;  3B02 A;  4YII A;  3DBR B;  4KT5 C;  2OJE D;  3FXR A;  5HDN A;  2IS1 A;  2ME0 A;  3TDU C;  2ZFU A;  4KIS A;  4P96 A;  2XGD A;  1JKR C;  2H1K A;  3F0C A;  2EFO A;  2M0C A;  1O3S A;  3J7Y J;  3M07 A;  4F92 B;  4KA4 A;  1XSV A;  2QZ8 A;  4CCN A;  3VYR B;  3CDH A;  5IT3 A;  2X9D A;  3MN2 A;  3BC8 A;  4F52 A;  4I99 C;  2RVC A;  2G9W A;  2OAZ A;  3WHB A;  3DQV C;  2Z16 A;  1ITY A;  2PG4 A;  4A69 C;  3VSK A;  3HOS A;  2M1B A;  3M9A A;  4WCG A;  1VZ0 A;  5HS8 A;  3ERE D;  1ZTR A;  4UB8 C;  3ASN H;  2F4O B;  3PNV A;  4M6X A;  5LRR A;  1LNW A;  4AIK A;  2K85 A;  1HCR A;  1V55 H;  5D4R A;  2FBI A;  3GO5 A;  3G3Z A;  2E36 A;  3ZMS A;  3TO9 A;  1YS6 A;  2JPC A;  4AVP A;  2R7D A;  4II3 A;  3CUQ C;  5AIP A;  1SVM A;  1TWA J;  5K1Y A;  1ZG3 A;  2HQ5 A;  5C44 J;  2EFW A;  1R58 A;  1XMX A;  3ZQQ A;  4KIB A;  2V6E A;  5IT9 Z;  1STZ A;  2G7H A;  1QZZ A;  3OIP A;  2CW0 F;  4ZYA A;  3K1N A;  3EUK L;  3H3Z A;  1TZL A;  1FOX A;  1XPX A;  2KMU A;  1Z7L A;  2CQQ A;  1LJ9 A;  3KFW X;  4DJA A;  4GRI A;  2GM4 A;  4HQE A;  3B6C A;  4FAS D;  3I9V 2;  1KGS A;  1MH3 A;  4HSR A;  4O6J A;  4PCQ A;  1KU9 A;  4L9V A;  2WAE A;  4EGZ A;  3Q9V A;  3LFK A;  3OYK A;  3ABT A;  3BLY A;  4NDL A;  4WXH A;  2BE5 F;  1TTY A;  1ZN2 A;  2HTJ A;  2H09 A;  2JPB A;  1GXQ A;  1DPU A;  1U5T B;  4E7J A;  3TBI A;  1LDJ A;  1S9H A;  4K2E A;  1XGO A;  2R4G A;  1PDN C;  4EGY A;  2DMP A;  2BV6 A;  1O57 A;  1Z7U A;  4QIW N;  2STT A;  4E4H A;  2XF5 A;  5BMZ A;  1B72 A;  2CQ7 A;  1V3F A;  1R6R A;  3F8F A;  2BXY A;  1BOB A;  3SZT A;  1VQ6 I;  1IDZ A;  2E5Z A;  4EJU A;  4LLG F;  1NHA A;  3KYD B;  3CDL A;  4H0E A;  1EV7 A;  2XHK A;  5B1A H;  3QP6 A;  4IQJ A;  4NB5 A;  2Y75 A;  3SEZ A;  4B8X A;  1JKP C;  1HDD C;  1B8I B;  3Q3S A;  2RDP A;  2DJI A;  5LD2 C;  2JZY A;  5JLW A;  3L2Q A;  2LC2 A;  1R1V A;  5LHG A;  1XCV A;  2IW5 A;  2PMZ A;  3F22 A;  3HIF A;  3FXQ A;  2E34 A;  2Q0O A;  5D5V B;  3M3Y J;  3AAF A;  2HOT A;  2Z3Y A;  4IO9 F;  2DA6 A;  3EYI A;  3C18 A;  1N25 A;  1MBF A;  3CJT B;  4BJ5 C;  1JE8 A;  3BP8 A;  1BOA A;  3OR1 C;  3TED A;  4BHB A;  1Y39 A;  2FRH A;  2DK5 A;  2BY1 A;  1MND A;  5IY5 H;  2VOO A;  2BHZ A;  4ZZD A;  4OAY A;  4MNU A;  2E2I J;  2XC7 A;  3GZ5 A;  1EJ9 A;  4KDP A;  1OCZ H;  1MW7 A;  3RQI A;  2G7U A;  3K4M A;  4DYC A;  5D5U B;  4YEJ A;  3JRG A;  1JI8 A;  3G6E I;  2DQR A;  4PUS A;  2IRF G;  2KPM A;  2GA1 A;  3JRH A;  4IQ4 A;  1D3Y A;  3S93 A;  4X0G A;  4RGS A;  4BQA A;  2EB7 A;  2R3S A;  3BJO A;  3JRA A;  4CHU A;  4CUG A;  1F36 A;  2KDZ A;  2M9H A;  3CP8 A;  3HOX J;  2JTV A;  1LQ1 A;  3K69 A;  2ZXI A;  1Y1W J;  2EJR A;  3WU2 C;  1CF7 B;  2F4M B;  1K78 B;  1Y1V J;  3EET A;  2IP2 A;  4S0H B;  2X6W A;  4L5I A;  1K79 A;  3CCJ I;  3OYF A;  3C2B A;  3HEF A;  5D6F A;  3H5A A;  2EK5 A;  1P4A A;  3CMY A;  3LQQ A;  1HC8 A;  4P5O A;  4CZC A;  2HU9 A;  2XGC A;  5DCM A;  4FHT A;  4CH7 A;  2E1M C;  4M73 A;  1OCP A;  3QOE A;  2MC4 A;  1R5H A;  2YSR A;  2IGM A;  3CCM I;  5EG0 A;  2WY8 Q;  3HRS A;  3VEP A;  2L7Z A;  3WGH A;  3LNQ A;  3M8E A;  2JSC A;  2WB1 A;  4BY1 J;  3AG4 H;  3IP4 B;  3AG3 H;  3FIW A;  2LTP A;  2VKV A;  4MHG A;  1D0Y A;  4JBA A;  3S1Q J;  2BY3 A;  4KIF A;  5EZH A;  1UFM A;  2BEO A;  3FBI B;  1GUU A;  3HB9 A;  4IRH A;  4F7Z A;  2ZJQ F;  2YX7 A;  4JX5 A;  2BOL A;  3QPL A;  4CCL A;  5IOZ A;  3RZO J;  5IT9 K;  4C30 A;  4AYB N;  3S16 J;  1Z3X A;  4RDU A;  3L1P A;  1ZH5 A;  2O61 A;  2KRH A;  3SHF A;  3VFZ A;  1J5Y A;  1Z05 A;  4M3B A;  1EA3 A;  4S04 A;  2YR2 A;  2P7C B;  3JRD A;  3HUG A;  2DBB A;  3I71 A;  1BIA A;  3V8J A;  2F5D A;  4N4O B;  5LRS A;  2Q2E B;  1Y0U A;  4KT6 A;  2VKE A;  1YJN I;  2GBY A;  1GVJ A;  2VJ5 A;  2R7R A;  1B9M A;  4C3J J;  2K3P A;  1A5J A;  2I8D A;  4JP0 A;  4NUB A;  3NAR A;  3OOU A;  1POG A;  3FXK A;  1WKM A;  4ANJ A;  2NAZ A;  1FOK A;  2EZK A;  4G7Z F;  2P4W A;  3OYM A;  4IF4 A;  1F4K A;  4BBS J;  4XBF A;  3I4P A;  1J2X A;  2YUS A;  4NQW A;  1BR1 A;  1ETW A;  1SVL A;  3CTA A;  3MZH A;  2CQN A;  2XAJ A;  2PJR A;  2JWT A;  4PZJ A;  4L9T A;  2EFN A;  2OZU A;  1MNM C;  3TKY A;  3S8P A;  1L3L A;  2X1C A;  3U21 A;  5E1Z B;  1FMV A;  3ZCO A;  2XSJ C;  1JUP A;  2X51 A;  1OMI A;  1GHC A;  2GXA A;  1JTY A;  1MH4 A;  3UR3 C;  2DAO A;  2HQR A;  2Y48 A;  3GTQ J;  2QA4 I;  2M7A A;  1ONV A;  5L3B A;  2FX0 A;  3OYG A;  5FRO A;  3WTZ A;  4RB1 A;  4XL9 A;  3ZMV A;  3BTJ A;  1D5Y A;  3D5S C;  5KK1 A;  4B4C A;  5M5Y J;  4MEY F;  4LB5 A;  1HA8 A;  3LSK A;  4ZYH A;  1A6Q A;  4YIF A;  3CCR I;  2OZ6 A;  1TWG J;  5ICC A;  1X2N A;  2XF6 A;  4XQF A;  1PP7 U;  3MKL A;  2JA5 J;  3HSF A;  3CMA I;  5JR3 A;  2CSO A;  2K40 A;  1F1Z A;  2DA4 A;  2Z2S B;  4OU0 A;  1ZAO A;  2L54 A;  3H92 A;  3FKI J;  4LGW A;  3A02 A;  2M4G A;  4QPQ A;  2R7U A;  5E79 C;  5GTH C;  4XKW A;  3F21 A;  3ABU A;  4PFO A;  2HNH A;  4UXN A;  5GAD J;  5IYD J;  3G71 I;  3RCO A;  2V1N A;  2DPU A;  3LSR A;  4XID A;  1U9O A;  3J80 Z;  1U78 A;  2KKO A;  1LDD A;  4D7M A;  2CFO A;  1B9N A;  2MD5 A;  1N75 A;  1TWF J;  2BHY A;  2IS6 A;  3MAJ A;  3MKZ A;  1I5Z A;  4G6T B;  3H0D A;  3QOD A;  4BJ6 C;  1HF0 A;  4HNT A;  2EIK H;  3PQJ A;  4LG0 A;  3WTT C;  2G0E A;  3CF5 F;  3WU1 B;  2XAS A;  3BR0 A;  4ZJZ A;  1IG7 A;  5J1R A;  3ZMU A;  2E1O A;  3CC4 I;  2Z1D A;  2LRE A;  3KYC B;  3CO6 C;  2WTE A;  3OY9 A;  1KON A;  5CJ9 A;  9ANT A;  1X19 A;  2ZXJ A;  3K70 D;  4X1E A;  4WK8 F;  1A04 A;  3V7S A;  1RNL A;  2B7E A;  2A68 F;  3H9Q A;  1FPQ A;  2M87 A;  1UAA A;  2QWW A;  3JCU C;  2F6C A;  3A1Y A;  1UCR A;  4ASN A;  1XGM A;  4GYI A;  3TO7 A;  1V5F A;  1RET A;  1B72 B;  4RM3 A;  5E1W A;  2ZME C;  1OYY A;  1XS9 A;  2H1L A;  1O7L A;  1MBG A;  2CMP A;  3K7A J;  2EFP A;  3CC7 I;  1TT5 B;  2KHM A;  2DOF A;  3BG3 A;  4HF2 A;  3NRV A;  1VQN I;  2EZH A;  2CH0 A;  1BW5 A;  3GLX A;  1D0X A;  1Z21 A;  2R7O A;  1XMK A;  4EAT A;  1FTZ A;  4Y4R A;  2F2E A;  5E18 F;  4X6A J;  1NH3 A;  1Z67 A;  2X6O A;  3H9G A;  1A31 A;  1EH8 A;  1HKQ A;  2JA7 J;  2VKH A;  3BTC A;  2P0W A;  1G3T A;  2L2O A;  1D5V A;  2LP0 A;  1VND A;  5LHI A;  4KN4 X;  1IN6 A;  1AA7 A;  2LBF A;  3ULQ B;  3H3U A;  1Z1D A;  3PM1 A;  5J6X A;  1V54 H;  3LA2 A;  1JKQ C;  1WCM J;  2DDB A;  4HDU A;  3ZMT A;  1E17 A;  5B1B H;  3DKX A;  1IO2 A;  2ELJ A;  3FMS A;  4B3X A;  3HBL A;  4CXF A;  2QVO A;  2HXO A;  3DPU A;  1W0T A;  1HW5 A;  1R1T A;  2CU7 A;  4HLX A;  1T0F A;  4IJA A;  2ICW G;  4YIR X;  1WH7 A;  5A2Q Z;  1RIO H;  2GOM A;  4CDG A;  2VC0 A;  1W7P A;  2K5C A;  2CO5 A;  2VN2 A;  4FET A;  1ZRD A;  1X1P A;  2XRN A;  3GME A;  2VPL A;  4C9Y A;  3OYC A;  3T5X A;  3C7J A;  4L5E A;  4PJM A;  3BG5 A;  1SC7 A;  2NRA C;  3GCM A;  1VQM I;  2LY2 A;  2JRM A;  1RUO A;  4C2U A;  2XVC A;  1IC8 A;  1S7O A;  2DO7 A;  5BPI A;  1A35 A;  4Q47 A;  3PSI A;  4G7H F;  2OV7 A;  5F0F A;  1QO0 D;  2MBF A;  3N05 A;  1O4X A;  4H4K C;  1QU3 A;  1BW6 A;  1YS7 A;  2BY2 A;  3CJN A;  4B44 A;  1IV6 A;  1R5G A;  4V2F A;  1ZRE A;  2XDV A;  1OCR H;  3I59 A;  4GCV A;  1OR7 A;  3JSO A;  3GZ6 A;  2EV5 A;  2O6G E;  1FX7 A;  3OOP A;  1RC9 A;  3PO2 J;  2WAD A;  3BCB A;  3IH3 A;  3L2R A;  5EG0 B;  3RDI A;  1H9T A;  4A5M A;  2LY1 A;  5EGO B;  2MLK A;  3IRQ A;  3E5U A;  5C4J J;  3VOE A;  3FXO A;  3DTK A;  3WG7 H;  4IL6 C;  3VYU B;  4Y17 A;  2KLO A;  1H0M A;  1VQ5 I;  2HFH A;  2O5R A;  3BR6 A;  4A6D A;  2H8W A;  5FFX A;  3S32 A;  4L0Z B;  2XB5 A;  3JSP A;  1UMQ A;  1TBX A;  2ZME B;  4IOC F;  5HNH A;  4A3L J;  1VQ7 I;  2TDX A;  2K02 A;  1IAW A;  3J80 K;  2A6E F;  4EM2 A;  3HUG B;  4MFD A;  1Q1H A;  4UVA A;  4XOR A;  5KAI C;  1U2W A;  4IXA A;  4BE0 A;  4XM3 A;  4XN3 A;  3JTG A;  4S05 A;  2P81 A;  1J75 A;  5LGT A;  4A12 A;  1I3A A;  4IZZ A;  3FXM A;  1R71 A;  3F23 A;  5FGM A;  4AID A;  1H89 C;  3WTX C;  4XNF A;  2EV6 A;  4P55 A;  1ZKG A;  5B66 C;  5EF6 A;  4LIV A;  2W24 A;  3GX4 X;  5HLT A;  1RR8 C;  1K7A A;  4NQW B;  4XLF A;  3IL2 A;  2VBZ A;  1WJF A;  2QQ9 A;  4BYY A;  1T8I A;  2PJR B;  3EUH C;  4QSH A;  1K4S A;  5F1J A;  1PUF A;  1EH7 A;  2R5Y A;  5E3N A;  3BQZ A;  2Y9Y A;  2JT1 A;  4MIM A;  3B73 A;  1IRX A;  1VQK I;  1XD7 A;  3QAH A;  5DCF A;  5KHD A;  1DU6 A;  1U3E M;  3CF2 A;  4HOB A;  1R4M B;  3RJP A;  4P1W A;  5J4Y A;  1G6N A;  3S1N J;  3DEW A;  5JFR A;  2F5V A;  1TW2 A;  2DFF A;  4ON0 A;  2DTR A;  5JVG F;  3KZY A;  3E0J B;  2K4B A;  5JHU A;  4ENK A;  4E7H A;  4RAZ A;  2F4I A;  3A0H C;  2CV0 A;  1XC5 A;  3KZZ A;  2QQ8 A;  2E35 A;  1LPQ A;  5D6E A;  5CQE A;  5IPA A;  4HAM A;  1JUM A;  2CW8 A;  2HQA A;  1PUE E;  4KNY A;  3Q9S A;  1WRJ A;  1ZHF A;  2MAB A;  3D1N I;  4RAY A;  1FT9 A;  3RPU A;  3ZQG A;  2Y0S A;  4CCO A;  4PSX A;  4BAY A;  3GTK J;  3DP7 A;  1JXS A;  2DI3 A;  1U5T C;  5HLI A;  4A3E J;  2O9L A;  2MH2 A;  3JRF A;  5ED4 A;  1FBU A;  1YX3 A;  4LIT A;  3SJM A;  2LLK A;  2L9R A;  3G1L A;  5FLV A;  2DCE A;  2VAS A;  3PUF A;  4PGH A;  5HDG A;  3W2V A;  1WPK A;  4WF2 A;  1XCB A;  2XAH A;  2RNG A;  1KU7 A;  3H3V K;  3G1M A;  2DOE A;  1U8R A;  3I4N J;  4AM3 A;  4YG2 F;  4LG0 B;  2MW8 A;  2VUM J;  4RB2 C;  4EM1 A;  3GTM J;  4D9J A;  3H1C A;  3IC7 A;  5L3E A;  1Z0X A;  3RTR A;  4EJW A;  2JA6 J;  1WJB A;  4LG3 A;  4U0W A;  2A6H F;  1RES A;  2LKP A;  1ZK8 A;  2QQB A;  5FD5 A;  5CVR A;  3FHN A;  1MSF C;  1P92 A;  3JAM K;  2OCE A;  2W48 A;  3WTV C;  3KEY A;  3CQZ J;  4KJZ A;  3GTG J;  2A3S A;  4DNC A;  4XKC A;  3FMQ A;  2JMW A;  3MQ0 A;  5H6Q A;  3MCZ A;  5M3F J;  3S2D J;  5CVI A;  3VDX A;  2MYS A;  2QSH X;  3T8R A;  2FOW A;  4KMF A;  1BL0 A;  4FIS A;  4CCM A;  2MD0 A;  1B4A A;  2D5V A;  2NNY A;  4ZTF A;  2Y9Z A;  5DM6 F;  2KL4 A;  3U1K A;  4IHX A;  1T56 A;  5FO5 A;  4E7S A;  1HSJ A;  1BI1 A;  3HHG A;  4U0Y A;  2LSO A;  2XRO A;  3G73 A;  1AKH A;  3GTJ J;  1TL8 A;  2DLL A;  2KIM A;  4PJN A;  2ZC2 A;  2LBF B;  3U2R A;  3FBN B;  2XAF A;  3ZR8 X;  4UUS A;  2E2H J;  2CW7 A;  3H0G J;  1Z9C A;  2L02 A;  4CSW A;  5J1Y A;  4C3I J;  3KCC A;  4IKF A;  1YQA A;  4HW0 A;  1O3R A;  1XSX A;  2GQQ A;  1MZB A;  4M3D A;  5J8F A;  1UST A;  3DKY A;  1BBY A;  3I5U A;  1L0O C;  1QVU A;  1I6H J;  1ZGJ A;  2FF4 A;  3PUB A;  2ZXH A;  2KFD A;  3QPS A;  2DA7 A;  4RLQ A;  1J7K A;  4PK4 A;  1QRY A;  1HW1 A;  4PGG A;  2FNA A;  3BY6 A;  4XK4 A;  4C3H J;  3VYT B;  2HDD A;  1W7P B;  2I5U A;  3NWS A;  1JKO C;  1QPM A;  5M5W J;  1FBQ A;  1S6L A;  5E3M A;  1WSU A;  3DTI A;  3HSE A;  2FML A;  4U87 A;  1KZH A;  4BHP A;  4E70 A;  4WXD A;  4CCJ A;  2I10 A;  4PJ0 C;  4RMN A;  1WH5 A;  1QNT A;  4IVN A;  5E3L A;  3FWE A;  3R0A A;  5BQT A;  2ZNY A;  2HI3 A;  2VIX A;  1JGG A;  2VKD A;  2FA5 A;  4KN7 X;  1HBX G;  2L7M P;  3F6O A;  3GFI A;  3I59 B;  4YFK F;  2OQR A;  3QQA A;  5D5X B;  3SXY A;  5ERI A;  3GLL A;  3E6M A;  1R1U A;  1Z3Y A;  1OYI A;  1ACI A;  3H35 A;  1FIP A;  5F04 A;  1VTN C;  3BZK A;  2BXZ A;  4M74 A;  2XSD C;  1IUF A;  1FYK A;  2DPD A;  5TIS C;  1SFK A;  5DV5 A;  2PN6 A;  2VJ4 A;  4HV6 A;  1SMY F;  4P9U A;  4RGR A;  5KAF C;  3HOU J;  5J4V A;  1JGS A;  2JN6 A;  3L9F A;  4Z2Y A;  2ME6 A;  2R7V A;  2B63 J;  4HLY A;  1NG6 A;  3V8L A;  2ZJP F;  1PVE A;  3HRT A;  4CIC A;  2Q8K A;  1X3W B;  1F43 A;  2X1E A;  4XLP F;  3RKQ A;  3KP5 A;  4D7N A;  4FE4 A;  2W85 A;  3MD2 A;  1VQL I;  4N0B A;  4IX7 A;  3JTH A;  2DDA A;  1E2X A;  3WHC A;  3WG9 A;  4JQF A;  2R7X A;  3SEQ A;  2NVQ J;  1Q1V A;  1YG2 A;  6PAX A;  2ACJ A;  2KZG A;  3LSM A;  1K6O A;  1LEA A;  2XRL A;  2LF7 A;  2LOO A;  4KYW A;  4QWQ A;  2MFZ A;  2COM A;  3OYN A;  1MDM A;  3S2W A;  3RZD J;  3D5L A;  3JRE A;  3I0T A;  1HKT A;  2WV1 A;  3FHZ A;  2XB0 X;  1KQ0 A;  3S1M J;  2KP6 A;  1SAU A;  2X85 A;  5HOO A;  3CES A;  2WBM A;  2EBI A;  2DK8 A;  1UG2 A;  4CCK A;  1OJL A;  1BI0 A;  1WWX A;  3RSN A;  2F5F A;  5IYB J;  4TV7 A;  5E1X A;  2ZSI B;  5LGN A;  4AIH A;  1ETK A;  2MG4 A;  1LFU P;  3UNG C;  3K4L A;  4UUT A;  4RBO A;  1EKE A;  4DZJ A;  1G59 A;  3BRO A;  1I1S A;  1ON2 A;  3KE2 A;  4A3J J;  3EDP A;  4AUX A;  1GLN A;  3GFJ A;  3ZXS A;  2M0M A;  5GAE J;  4HDV A;  4OMY A;  2R5Y B;  3I4M J;  2IJL A;  5D5W B;  2XUB A;  1KQ8 A;  2VB6 A;  3QYE A;  2IS2 A;  4JK1 X;  1YTY A;  4DYR A;  1JT6 A;  3D5R C;  3GTO J;  2HXI A;  2RQQ A;  3LL7 A;  4HNV A;  1BI3 A;  2MLG A;  4XOP A;  2P5K A;  3RKY A;  2BVL A;  5FFZ A;  2LR8 A;  3HXL A;  2BW3 A;  4LLL A;  3OSG A;  2FE3 A;  2M8E A;  2E2J J;  3OS2 A;  1IN5 A;  1T08 B;  2E5N A;  5AIQ A;  1YIO A;  2O3F A;  3HTU A;  1ZG1 A;  2DA1 A;  3CO7 C;  1YOV B;  1F5T A;  1HST A;  1XDS A;  1X3Z B;  4EV0 A;  3I55 I;  3W2A A;  2E60 A;  1YJ9 I;  2OU2 A;  4FQG A;  5F27 A;  4BEH A;  1R22 A;  2WB1 N;  1RR7 A;  3HKZ N;  1X2M A;  3CME I;  1TQM A;  1FBS A;  1BIB A;  2O8X A;  1FIA A;  2KRF A;  2R92 J;  2FJ1 A;  3DWL E;  2UXN A;  4FCY A;  5GP9 A;  2ZJR F;  2JK3 A;  2LH9 A;  2RN7 A;  1MBH A;  2YU9 J;  3J7A O;  1J9I A;  2CUZ A;  3V7C A;  1D8J A;  3HHH A;  1W0U A;  2BGC A;  3REO A;  2VT3 A;  2MGQ A;  2M7B A;  2V9V A;  2XAG A;  1XGN A;  4AVZ A;  4AYB A;  5TJJ A;  2IA1 A;  4RB3 C;  3HTS B;  2DQL A;  2RC4 A;  1E3H A;  2O03 A;  2ZCW A;  2DN0 A;  2R7Q A;  1NK3 P;  4M3E A;  3ZQF A;  2FD5 A;  3E5X A;  1WJA A;  4OIQ F;  3HPH A;  3AG1 H;  3CJR B;  2EQR A;  3K2A A;  1B59 A;  2W4S A;  2XPW A;  2E7X A;  1S7E A;  2FSW A;  1SD4 A;  2XPU A;  3QPT A;  2LMD A;  2F48 A;  1OKR A;  1MIJ A;  1IV8 A;  4G7O F;  4LOC A;  3IUO A;  4M9S A;  2QBY A;  3AFH A;  2P6T A;  2QSF X;  3KP2 A;  5E17 F;  3WTY C;  1MNE A;  4AC0 A;  2WAQ A;  4I09 A;  2RAE A;  2EZL A;  2X0L A;  1V4R A;  2IBD A;  3PSF A;  3JRI A;  3C2H A;  3PNT A;  2OF7 A;  4MLO A;  1SFE A;  1ZLK A;  1PJR A;  1R49 A;  4DIQ A;  3JR9 A;  4IHV A;  3GYH X;  3R60 A;  3KX2 A;  3BPX A;  2B9S A;  3HDD A;  1WJC A;  1VI0 A;  2HKO A;  5J47 A;  3E7L A;  1RPW A;  3HPG A;  5DUI A;  3PQK A;  3IKT A;  5BPD A;  1BA5 A;  1AKH B;  4B09 A;  3HOT A;  4U7B A;  4UUS B;  1RRJ A;  3SQN A;  4L5J A;  1FZP B;  2CV2 A;  5DYM A;  4HRI A;  1MJ9 A;  3OYD A;  4BHC A;  1X3U A;  2IT0 A;  2ADU A;  4JOM A;  3KP3 A;  3EPZ A;  1BN5 A;  4XRS A;  1S7A A;  2AS5 F;  1FYL A;  2QEX I;  4FX4 A;  1XN7 A;  1XX5 A;  2JUG A;  3ABM H;  3I3L A;  1JTX A;  1Y8Q B;  2FQ3 A;  2J5O A;  4ITV A;  5FD6 A;  3ELK A;  4IRG A;  1G2H A;  1IRG A;  5F0H A;  2OQG A;  4ZYE A;  3OWT A;  4PSW A;  2Y2Z A;  2EIL H;  2FOK A;  2Z99 A;  4KFC A;  4XLC A;  2HEO A;  3J81 Z;  1W7P D;  4L18 B;  1P4W A;  4MGR A;  1P4X A;  3LAP A;  2XGX A;  1D1B A;  1MJB A;  1JHF A;  1WGX A;  2K9Q A;  3DF8 A;  4AD9 A;  1T2K A;  3ZQH A;  3GZN B;  1ZGW A;  4G6Q A;  2XPV A;  2GLO A;  2NS7 A;  4WWC A;  1YW8 A;  3CCL I;  3P9C A;  4MFE A;  3IAS 2;  1UB9 A;  2X48 A;  2VQH A;  2M45 A;  4XLH A;  3IRR A;  3F3X A;  4UHT A;  2OD5 A;  4BS9 A;  2Z33 A;  1J09 A;  2VQL A;  1HLV A;  1PP8 F;  3R61 A;  3BDD A;  3DBL B;  5FRN A;  2WV0 A;  1XB4 A;  1XG1 A;  1NTC A;  4PDK A;  2DA3 A;  2CS3 A;  4BXU A;  5CYV A;  2L4M A;  4G12 A;  4D1Q A;  4C2M J;  2OTL I;  3GUD A;  2VXZ A;  2MA3 A;  4I0A A;  4BQN A;  2C6Y A;  1VQ9 I;  1ULY A;  2YX4 A;  2GIZ A;  3CP2 A;  3OYL A;  1DGW Y;  1LFP A;  2GWR A;  1ETX A;  2KT0 A;  1K6Y A;  4KIC A;  5LGU A;  1MBK A;  1TW3 A;  5E3O A;  3EYY A;  2NXN B;  3C2G A;  1WFX A;  3S3N A;  2TCT A;  2V7F A;  2JUC A;  2PLY A;  2HS5 A;  2HPM A;  1G4D A;  2OTJ I;  4M71 A;  2HWV A;  3L2U A;  1QBJ A;  5H6R A;  2H27 A;  3J7A Y;  4M9X A;  1SEU A;  4DOZ A;  5FKK A;  1LB2 A;  1OCC H;  1MMA A;  3P9K A;  3W6K B;  2EZI A;  4A2U A;  3FK7 A;  1TT0 A;  3ZQ7 A;  3CLQ A;  2LRD A;  2F5C A;  2ESN A;  4Y33 A;  3ESW B;  2HQN A;  2Y0M A;  3HRU A;  3LSI A;  4LIU A;  1DGR M;  5BNG A;  4ETS A;  1IF1 A;  1YRN A;  5AON A;  5IP6 A;  3BR2 A;  2A05 A;  3M7G A;  1MKM A;  4DQ2 A;  2HZD A;  4U7D A;  2K4J A;  4BJT A;  5ICF A;  3PL8 A;  3I58 A;  4LD5 A;  1ETO A;  2KZV A;  1TP4 A;  4QPO A;  3AG2 H;  1ZAR A;  2DOD A;  3DV8 A;  2HKX A;  1I6X A;  2P7V B;  2Q1Z B;  3G2B A;  1ZG5 A;  4DGW B;  2QEN A;  1LKX A;  2P6S A;  1BR4 A;  2L01 A;  2YU3 A;  2KDO A;  2VBX A;  3W2W A;  2LG4 A;  4ZH4 F;  4OIO F;  3PIO F;  3PO3 J;  1IXC A;  2ZJ2 A;  2VC1 A;  5FLM J;  1OQY A;  3ZQL A;  4QLC U;  2BW3 B;  3OV8 A;  1A36 A;  3DPL C;  3S15 J;  4ZYG A;  5GPA A;  3SZG A;  5DCM B;  4XRM A;  1N77 A;  2ZFW A;  2CUF A;  3B6A A;  2KIQ A;  4JX6 A;  3F9K A;  4I76 A;  2FXA A;  2QQA A;  3L7W A;  1R5I D;  1ZR4 A;  5B3S H;  3V8K A;  3W3C A;  4A93 J;  2VBY A;  4HEA 2;  1BJZ A;  4D0P A;  4BEH B;  4AWX B;  4XMY A;  3TQN A;  1Z6R A;  4A3F J;  2FBH A;  2UXX A;  3RYR A;  2GZW A;  3ZP5 A;  2A07 F;  2D45 A;  1LVA A;  3M1E A;  1IUY A;  1EF4 A;  1U8B A;  2ISZ A;  2CQX A;  2IXS A;  5F6F A;  3BJ6 A;  2DT7 B;  1WJE A;  5FLX Z;  2R93 J;  2KJB A;  3FDY A;  3VWB A;  1X58 A;  3C1D A;  2ZO4 A;  4B1R A;  2E71 A;  4CYD A;  2K86 A;  3DKW A;  2VL8 A;  3LWF A;  4UNO A;  3A03 A;  1JUS A;  4EQQ A;  1Y56 A;  1LUJ B;  3BR5 A;  4OAZ A;  2O0Y A;  3BT9 A;  3KEO A;  3WE3 A;  2ZXW H;  1SAN A;  3K1P A;  4ESF A;  4F91 B;  3J81 K;  2H8R A;  1FSH A;  3HL2 A;  3ZQC A;  1GV2 A;  1NK2 P;  1KYW A;  4RAF A;  4XR6 A;  3H5N A;  4BAC A;  3KPH A;  1YIJ I;  3O8G A;  2Z9O A;  2R7T A;  4A5N A;  3QRF F;  3BJA A;  4KIT B;  3HOY J;  4OOI A;  2ECB A;  5C3E J;  4RAG A;  2ELK A;  3MMY B;  5JVT A;  3OIQ A;  4XLA A;  3CCS I;  2A6T A;  3KYL A;  3IH2 A;  4HF1 A;  2CUJ A;  3RPQ A;  2BYV E;  1ZLJ A;  2ISY A;  2QF7 A;  5EEA A;  4RS8 A;  4IOA F;  3CUQ A;  4NC7 A;  4BL0 B;  4CYC A;  4GDF A;  2VJJ A;  1TNT A;  3IWZ A;  4DZP A;  1G3S A;  3HOW J;  3U1D A;  2GOX B;  3K6G A;  4LLN A;  5HVQ C;  2A5W A;  3ZOB A;  2FQ4 A;  3HGG A;  3CJQ B;  4HQM A;  3BCA A;  5KVR A;  3ML6 A;  5HLG A;  4E7L A;  1HKS A;  3LQR A;  3F8M A;  1T0F C;  5CQG A;  4ZDL A;  3TDZ C;  3WE2 A;  1IJW C;  3CDI A;  4ZTJ A;  3S3O A;  2W84 A;  2NVT J;  1RI7 A;  4M3G A;  4Y7N J;  3RKX A;  3NWT A;  1R7J A;  4LK1 F;  2IA0 A;  4FT8 A;  2HDW A;  3KET A;  5KNL A;  4O3M A;  5B5E C;  2Y0S N;  1P7I A;  1TQP A;  4UB6 C;  4L9J A;  4BDY A;  3JW4 A;  3BQY A;  3Q0W A;  1I39 A;  4I7H A;  2AHQ A;  1U9N A;  1P7J A;  2YPR A;  5L3D A;  4IRI A;  2OUM A;  1MD0 A;  2CFX A;  4EVI A;  1ZRF A;  5IP7 J;  4HYE A;  4N9H A;  2EIN H;  4E7I A;  4RGX A;  4A3G J;  3LA3 A;  2VE8 A;  3OMY A;  3PFY A;  2E1C A;  5ICG A;  1LFB A;  2QUF A;  3ECH A;  5A2Q K;  4CZZ A;  2CYY A;  2IGN A;  3GWZ A;  3C3W A;  1T39 A;  1OR7 C;  2QM3 A;  3E5Q A;  3QOP A;  4HV5 A;  3PIP F;  2LK2 A;  3TP0 A;  1S5L C;  3HG9 A;  1T38 A;  4DYQ A;  2ZKZ A;  4NNJ A;  5F64 A;  5IP9 J;  3A0B C;  4BE2 A;  2MC3 A;  4G9Y A;  1BM9 A;  2DFI A;  2RNJ A;  2AQF A;  2PJP A;  2HPI A;  4RLF A;  1X4P A;  3K4N A;  3FXL A;  4WXC A;  1W5T A;  2ZBK A;  1ZRC A;  3DPT A;  3S2H J;  1R4N B;  2EWN A;  1FY7 A;  2HYF A;  4MQV A;  2ETH A;  3DCF A;  2R7F A;  2JRT A;  2NOG A;  3FM5 A;  2HZT A;  3IH4 A;  4GYG A;  2P5L C;  4HPQ A;  3TOB A;  4BE1 A;  4NC8 A;  2IGO A;  3JRC A;  4HG2 A;  3KP4 A;  1OCO H;  4XKB A;  3VOD A;  1W5S A;  2PBI A;  3M4O J;  1AHD P;  5TGT A;  2CQK A;  1O3T A;  2EIJ H;  1I3Q J;  1YW7 A;  2P5V A;  1SD6 A;  2HR3 A;  4HX4 A;  3TW6 A;  1YE9 A;  3KIO A;  4A3D J;  2KIU A;  3MEX A;  1UZC A;  2XGE A;  3W6J B;  5HOD A;  2LD5 A;  1LEB A;  5E8I A;  5EDN A;  4G94 A;  4O5V A;  5LEK A;  2L4A A;  2KJC A;  3WTU C;  5D4S A;  5JLX A;  1O3Q A;  2B0L A;  2PQ8 A;  5FLX K;  1OIS A;  5L3F A;  1BJA A;  1QHH D;  3BTI A;  4LFU A;  1KA8 A;  3BPV A;  2ESH A;  5CLS A;  5K7Z A;  3R4K A;  1XDU A;  2X6Y A;  3OYB A;  1IN7 A;  2HOA A;  5J8C A;  5ILU A;  5M3M J;  3LSH A;  3MWM A;  2VON A;  2HVQ A;  4UUV A;  2UWM A;  4UV8 A;  2DT6 A;  1UG0 A;  2L3D A;  3M8F A;  3X2Q H;  3ZRG A;  4ZDO A;  3GXO A;  1HXD A;  4XLE A;  2RGV A;  4P9F A;  1YLF A;  3WOD F;  1ETV A;  2VQG A;  4XLN F;  1W36 C;  1I50 J;  1FP1 D;  1APL C;  2VJI A;  4LB6 B;  4Q48 A;  4OMZ A;  3DLL F;  5DDG A;  1YRN B;  4ENN A;  2LY9 A;  2EV0 A;  1QHG A;  3V42 A;  4A0Z A;  3HM5 A;  3OYA A;  4Y13 A;  4G6D A;  1I1G A;  2XV4 S;  2ZB9 A;  5FKO A;  1JHH A;  3BG7 A;  2X6X A;  5CVV A;  5F1R A;  4A3K J;  1QGP A;  2LFB A;  4BNC A;  3OR2 C;  1AU7 A;  1MMS A;  4HA8 A;  2L9S A;  1YO5 C;  2EIM H;  3QU6 A;  4YEL A;  1XTA A;  1ZR2 A;  4KUM A;  3CC2 I;  1D1A A;  4LJZ F;  1FMW A;  3N97 A;  4DBQ A;  3L2C A;  4L0Y B;  4NC6 A;  5H2F C;  3FXU A;  4HZF A;  2AXL A;  2OCC H;  3Q0U A;  4BDZ A;  1MMD A;  4OWR B;  5TRD A;  5HNF A;  5LHH A;  2LF8 A;  4BQQ A;  3WU0 A;  1IN8 A;  4M72 A;  2GA2 A;  5GAG J;  4BUP A;  3BZ6 A;  3GTL J;  4BU2 A;  2Y69 H;  1RZ4 A;  4GFB A;  4AIJ A;  3LA7 A;  1U0J A;  4HNU A;  2M2E A;  3F8N A;  1FYM A;  1J59 A;  2NOJ B;  3VPR A;  2ZSH B;  4QTR A;  3AL0 B;  2WC2 A;  4XON A;  3T0Y A;  2VT2 A;  1UJ8 A;  3VYS B;  2PMZ N;  5FKN A;  1U6G A;  2KQR A;  5CKT A;  5FB2 A;  3BOQ A;  2Y30 A;  2DW4 A;  3BWG A;  1X1C A;  4XKV A;  4DBR A;  3IV5 A;  1H9G A;  1BI2 A;  3GTP J;  5DM7 F;  1FTT A;  4XN0 A;  3ISP A;  3K2Z A;  5C4X J;  2HYJ A;  2M3A A;  2R7W A;  1KU2 A;  4YFX F;  3FM3 A;  3T8T A;  2QSG X;  2OC6 A;  1GV5 A;  3RKW A;  1ODD A;  3WGI A;  1Y6I A;  2OBP A;  3K9T A;  4GXO A;  2CJJ A;  4CA0 A;  1K61 A;  3E6C C;  1X1A A;  1IDY A;  2X1D A;  1W1W E;  5K5O A;  5GTI C;  2IS4 A;  2Y31 A;  4JX4 A;  2QLZ A;  3I64 A;  2A61 A;  3AKZ A;  1DU0 A;  5LEJ A;  1IZ1 A;  2XKP A;  1DP7 P;  4V2G A;  1DUX C;  2BBY A;  1X1B A;  1HDP A;  3LSG A;  1SFU A;  1PUF B;  2R5Z A;  4IEJ A;  4G8X A;  2E19 A;  2DJN A;  5M5X J;  1VFC A;  3LSJ A;  4F3Q A;  3MVP A;  3E6D A;  2K9N A;  1OLT A;  1QVT A;  1FSE A;  3E97 A;  2HDC A;  2NVU B;  1WVR A;  4D5F A;  2V6C A;  2QCO A;  3CUQ B;  2HVR A;  4CYC B;  4CGZ A;  3S17 J;  2PX9 A;  5ICE A;  1SAX A;  4D5C A;  4E7Z A;  1FOY A;  1IXS B;  1C0W A;  1SD7 A;  5LFA A;  1YFH A;  3MZY A;  1YJW I;  4Y15 A;  2NNN A;  1M1E B;  2EH3 A;  2QKL B;  2OA4 A;  2NS0 A;  4J19 A;  4B43 A;  2CGP A;  4Y52 J;  1W5C C;  2EPF A;  2DMT A;  4Q5S F;  1XSD A;  1Y0N A;  1X1D A;  4FTH A;  2LKS A;  2VE9 A;  2A69 F;  1QQI A;  3G1O A;  2V1U A;  1ERD A;  4ZDP A;  3E1S A;  1FNN A;  4I98 B;  3H9J A;  4M3F A;  1J0R A;  2NVY J;  3KLO A;  1AWC A;  2V1X A;  4KMU X;  2XAQ A;  3Q5F A;  3GFL A;  2RV8 A;  2GXB A;  2FEZ A;  2V4J C;  3KP7 A;  1F9N A;  1GXP A;  2W25 A;  1MGT A;  1OYW A;  1TNS A;  3MZ8 A;  1N78 A;  2IAI A;  3HRM A;  3SDB A;  3HGY A;  5EGO A;  3HKZ A;  1ZGA A;  3N4M A;  3RYP A;  3K0L A;  3K4C A;  2GXG A;  4E6K G;  2D2W A;  4ESB A;  1WJ5 A;  4I01 A;  5F0C A;  4IPA A;  2O8K A;  2F5E A;  5L3C A;  3S14 J;  5DTD A;  2ZME A;  1K83 J;  2H94 A;  3EUA A;  5JI6 A;  4A3C J;  1PYV A;  3F72 A;  2LVS A;  1SD5 A;  3HOZ J;  3KZI C;  2W1O A;  2K3F A;  2TRT A;  3MKW B;  3CMM A;  3ZN0 A;  5CVJ A;  1UEL B;  4IHY A;  1MSE C;  2E1N A;  3HJE A;  2VPR A;  4PFP A;  4EJV A;  3BTL A;  2AQE A;  1FEX A;  2XKO A;  2GIV A;  1WZ2 A;  5ILS A;  2VQC A;  5K5Q A;  1OPC A;  5GPC A;  3LMM A;  2MH9 A;  1H8A C;  2W82 A;  2JJ7 A;  1JT0 A;  2FU4 A;  3GF2 A;  5EJC A;  3WTW C;  5LLQ A;  3TP3 A;  5BOX A;  4IHW A;  2WAQ N;  3CZ6 A;  1MBJ A;  4E7K A;  3CUO A;  1TWH J;  4XIC A;  3OL3 A;  2LDU A;  3FX3 A;  1RUN A;  5E8G A;  3NQO A;  5FRM A;  1B1B A;  4J00 A;  1T6S A;  4AU7 A;  5LBQ A;  1KYZ A;  3OYJ A;  4B3A A;  3R6S A;  1CGP A;  4NBQ A;  3LAJ A;  2FMY A;  1D0Z A;  2M5W A;  2VBW A;  2K9L A;  1FJL A;  1VQ8 I;  3A01 A;  5HS7 A;  1E3O C;  1G8X A;  1LDK B;  2HGC A;  2JQ7 A;  2RKH A;  1P9Q C;  4HX8 A;  4U88 A;  3SYT A;  2JVG A;  5DEQ A;  5K7H A;  4M6V A;  4M9Z A;  1P2F A;  4XSZ F;  2XF7 A;  3DLA A;  1W4M A;  5HDK A;  3HOV J;  1V5G A;  4UV9 A;  2W7N A;  1YHQ I;  1FOW A;  2K9S A;  3OS0 A;  2JA2 A;  3BG9 A;  4F93 B;  4GGG A;  1V5E A;  4R1H A;  5D8L B;  1VQP I;  2BVM A;  4A3I J;  2CWE A;  5EZG A;  1G3W A;  3F8B A;  4MTE A;  2LKX A;  2M30 A;  1LE8 A;  1WI3 A;  2EA4 A;  2ID6 A;  1XGS A;  5FKL A;  2R7S A;  2L7F P;  3EQL F;  4OIR F;  3ZPL A;  1MMN A;  2HTS A;  1K4T A;  4YFN F;  2QKM B;  4JYK A;  4A3M J;  2RRE A;  2ZNZ A;  2M4K A;  3BG6 A;  3DBH B;  3QP5 A;  1R23 A;  3E6B A;  3CCU I;  2E1M B;  4HST A;  2PMH A;  1LVK A;  2V79 A;  3FIS A;  2M34 A;  1ENH A;  2KIF A;  3FK6 A;  3I54 A;  2DU9 A;  1IGN A;  4Q4Z F;  1REP C;  4RA2 A;  5J3L A;  1KU3 A;  4L9N A;  2DFH A;  2KIS A;  4OIN F;  1JJ6 C;  4EM0 B;  1GDT A;  2JA8 J;  4LMY A;  2L9V A;  4IHS A;  1IW7 F;  4ZC3 A;  4CO8 A;  1WI9 A;  3DEE A;  4ESJ A;  1TLH B;  5BS6 A;  2O7O A;  1QA6 A;  4ABZ A;  1XMA A;  4KIG A;  1DPR A;  4XRS G;  1TWC J;  3ASO H;  3BR1 A;  3JRB A;  2K9M A;  5EEH A;  2X4H A;  3S3M A;  3GBG A;  2R7Z J;  5EYR A;  2QYO A;  3A4C A;  3QYB A;  4YRV A;  1RKT A;  3K4K A;  4A6E A;  4PJL A;  3OSF A;  4MEX F;  3FF5 A;  1O7F A;  5FJ8 J;  3DU5 A;  1WHU A;  3GW2 A;  1X4O A;  3DXJ F;  4F55 A;  3QPH A;  1ZQ3 P;  3CCE I;  5HLH A;  2LYC A;  4ENJ A;  1GVD A;  2NYX A;  3V4G A;  2FUG 2;  1BC8 C;  3VSL A;  1RKW A;  4XOT A;  2L9N A;  1IN4 A;  3KLN A;  3L00 A;  3ZN1 A;  4I0B A;  2HOE A;  2ELH A;  1HQC A;  4BXF A;  1VF9 A;  1MDM B;  3EUH A;  2MSY A;  1Z6T A;  2WAF A;  2DFE A;  2FBK A;  1FWZ A;  3CCY A;  3LST A;  5J1U A;  3D0S A;  1QZY A;  3CD6 I;  4C2T A;  1D1C A;  1Z91 A;  4BQO A;  1R36 A;  1NG7 A;  3KEQ A;  1SFO J;  2VOD A;  2DMQ A;  1R00 A;  4BH9 A;  2WA0 A;  3LFU A;  2VLA A;  3O6B B;  2DYS H;  3K4B A;  3WGG A;  1T33 A;  2IEK A;  3BZC A;  4PJJ A;  2W00 A;  4HX7 A;  1BR2 A;  2BY0 A;  2K27 A;  4XSX F;  2V26 A;  3ZGK A;  1ETY A;  4UY8 I;  1B6A A;  1YX5 A;  3IAM 2;  4Y3O A;  4R79 A;  1S3J A;  1MJA A;  5DUK A;  1HW2 A;  3K1M A;  3R0J A;  2R5Z B;  3SFZ A;  2UUZ A;  4ZZL A;  3TL4 X;  1ON1 A;  3OL4 A;  1I27 A;  4EJO A;  1AOY A;  2R0Q C;  4W1U A;  2EA2 A;  4EEF G;  3ZMZ A;  4FX0 A;  1G3Y A;  4MO7 A;  4R8H A;  4A0Y A;  3NAU A;  2PEX A;  2IGK A;  2YS9 A;  3T1B A;  1T98 A;  4EMS A;  1IRZ A;  1U5T A;  3O2P E;  5DS9 A;  2L5Q A;  3TW7 A;  2VOP A;  5IOY A;  1SFX A;  2DTZ A;  4II2 A;  1MMG A;  5CVU A;  3TMO A;  3OS1 A;  3MKY B;  2VI6 A;  1W36 D;  3DEU A;  3E3V A;  1SVO A;  3SFI A;  3QWL A;  1YW9 A;  3CLO A;  1MBE A;  4N9I A;  2A5Y B;  4V19 K;  1FP2 A;  2IA2 A;  3ONQ A;  4UVC A;  2IVM A;  4BY7 J;  3JAM Z;  2STW A;  3OIO A;  2P8T A;  3I56 I;  4IHT A;  2V1D A;  3I53 A;  3CCV I;  5CPR B;  3HSR A;  3MFK A;  3ZMD A;  1VQ4 I;  4WX9 A;  4U0V A;  1DQU A;  3RPU D;  4BBR J;  5KCM A;  2CRG A;  3TO6 A;  3TGN A;  2XIG A;  1YI2 I;  2DXI A;  1IXR C;  1USS A;  2HYG D;  2CG4 A;  3O3K A;  1B8I A;  2DA5 A;  4BGD A;  4UVB A;  4EJT A;  2CUE A;  1T95 A;  4J01 A;  2QGU A;  4ENM A;  3SZP A;  2VXD A;  2OPT A;  2D1V A;  3P9I A;  2JVH A;  5F08 A;  1BC7 C;  4HBL A;  2RQP A;  5HS9 A;  2KRC A; 
#chains in the Genus database with same CATH homology
 4ZYD A;  3P7N A;  1EH6 A;  3HYI A;  3NEU A;  4GO1 A;  3F8C A;  4HF0 A;  5L3G A;  1TQI A;  4MQ9 F;  2PI0 A;  5ILV A;  1SMT A;  5EEG A;  1UHW A;  3GFM A;  3KP6 A;  3VB2 A;  5DD8 A;  2QBY B;  4NHJ A;  3GEZ A;  2WWY A;  5K5R A;  4RB0 A;  1UHM A;  3U9G A;  2EFQ A;  2H6B A;  2DT5 A;  1D8K A;  3COA C;  2W57 A;  4M6Y A;  5D8K B;  3ROU A;  1CF7 A;  1K78 A;  1P6R A;  2H6C A;  3FMR A;  2J5P A;  1IRF A;  2FNP A;  1YYV A;  1ZYR F;  1WQ2 A;  3L09 A;  4RGU A;  2PFB A;  3WTS C;  2LNB A;  3F6V A;  3FZV A;  1FLI A;  1DDN A;  4A0X A;  2GAU A;  5E20 A;  2K7L A;  4MTD A;  5H20 A;  3IKV A;  3TOA A;  4OIP F;  3RI4 A;  4I2O A;  2IPQ X;  5DD4 A;  2Z5U A;  4LK0 F;  3GVA A;  4XRF A;  2E7W A;  3PFI A;  3V7R A;  2Q2E A;  1FC3 A;  3IWF A;  3DFG A;  1S29 A;  1KQ9 A;  2D1H A;  2UZK A;  3IHU A;  4I02 A;  3QU3 A;  3RIR A;  3ECO A;  1S8N A;  2PMU A;  3B02 A;  4YII A;  5HDN A;  4KT5 C;  3FXR A;  3TDU C;  4P96 A;  2EFO A;  1O3S A;  4KA4 A;  1XSV A;  2QZ8 A;  3CDH A;  5IT3 A;  2RVC A;  2G9W A;  2OAZ A;  3DQV C;  2PG4 A;  3HOS A;  2M1B A;  3M9A A;  4WCG A;  5HS8 A;  3ERE D;  4M6X A;  5LRR A;  1LNW A;  4AIK A;  5D4R A;  2FBI A;  3GO5 A;  3G3Z A;  3ZMS A;  3TO9 A;  1YS6 A;  2JPC A;  4AVP A;  2R7D A;  3CUQ C;  5AIP A;  5K1Y A;  1ZG3 A;  2EFW A;  1R58 A;  4KIB A;  5IT9 Z;  1STZ A;  2G7H A;  1QZZ A;  2CW0 F;  3K1N A;  3H3Z A;  1LJ9 A;  3KFW X;  4HQE A;  1KGS A;  4O6J A;  4PCQ A;  1KU9 A;  4L9V A;  4EGZ A;  3Q9V A;  3LFK A;  3ABT A;  4WXH A;  2BE5 F;  1TTY A;  1ZN2 A;  2HTJ A;  2H09 A;  2JPB A;  1GXQ A;  1DPU A;  1U5T B;  1LDJ A;  4K2E A;  1XGO A;  1PDN C;  4EGY A;  2BV6 A;  1O57 A;  1Z7U A;  2STT A;  5BMZ A;  1V3F A;  3F8F A;  3SZT A;  4EJU A;  4LLG F;  1NHA A;  4H0E A;  1EV7 A;  2XHK A;  3QP6 A;  4NB5 A;  2Y75 A;  4B8X A;  2RDP A;  2JZY A;  1R1V A;  5LHG A;  1XCV A;  2IW5 A;  3F22 A;  3HIF A;  3FXQ A;  2Q0O A;  5D5V B;  3AAF A;  2Z3Y A;  3EYI A;  3C18 A;  1JE8 A;  3BP8 A;  1BOA A;  4BHB A;  2FRH A;  2DK5 A;  2VOO A;  4ZZD A;  4MNU A;  4KDP A;  3GZ5 A;  5D5U B;  2G7U A;  2DQR A;  2IRF G;  2GA1 A;  1D3Y A;  4RGS A;  4BQA A;  2EB7 A;  2R3S A;  3BJO A;  4CHU A;  2JTV A;  1LQ1 A;  3K69 A;  2EJR A;  1CF7 B;  1K78 B;  3EET A;  2IP2 A;  4L5I A;  1K79 A;  5D6F A;  2EK5 A;  1P4A A;  3LQQ A;  4P5O A;  5DCM A;  4FHT A;  4M73 A;  1R5H A;  2YSR A;  3HRS A;  3VEP A;  3WGH A;  3M8E A;  2JSC A;  4MHG A;  4JBA A;  4KIF A;  1UFM A;  2BEO A;  4IRH A;  4F7Z A;  2YX7 A;  5IT9 K;  1ZH5 A;  2O61 A;  3SHF A;  3VFZ A;  1J5Y A;  1Z05 A;  4S04 A;  2YR2 A;  2P7C B;  3HUG A;  2DBB A;  3I71 A;  1BIA A;  3V8J A;  2F5D A;  5LRS A;  1Y0U A;  1GVJ A;  1B9M A;  1WKM A;  2NAZ A;  1FOK A;  4G7Z F;  2P4W A;  4IF4 A;  1F4K A;  4XBF A;  3I4P A;  1J2X A;  4NQW A;  3CTA A;  3MZH A;  2XAJ A;  4PZJ A;  4L9T A;  2EFN A;  2OZU A;  3TKY A;  1L3L A;  5E1Z B;  1OMI A;  1GHC A;  2DAO A;  2HQR A;  2Y48 A;  1ONV A;  5L3B A;  3WTZ A;  4RB1 A;  3ZMV A;  5KK1 A;  4MEY F;  4LB5 A;  4ZYH A;  4YIF A;  2OZ6 A;  5ICC A;  1PP7 U;  3HSF A;  5JR3 A;  2CSO A;  1F1Z A;  4OU0 A;  1ZAO A;  2L54 A;  3H92 A;  4LGW A;  3F21 A;  3ABU A;  4UXN A;  2DPU A;  3J80 Z;  1U78 A;  2KKO A;  1LDD A;  1B9N A;  2MD5 A;  3MAJ A;  1I5Z A;  3PQJ A;  4LG0 A;  3WTT C;  3WU1 B;  2XAS A;  3ZMU A;  3CO6 C;  2WTE A;  5CJ9 A;  2ZXJ A;  4WK8 F;  1A04 A;  3V7S A;  1RNL A;  2A68 F;  1FPQ A;  2M87 A;  2QWW A;  4ASN A;  1UCR A;  1XGM A;  4GYI A;  3TO7 A;  5E1W A;  1OYY A;  1O7L A;  2EFP A;  4HF2 A;  3NRV A;  3GLX A;  1XMK A;  2F2E A;  5E18 F;  1EH8 A;  1HKQ A;  1G3T A;  1D5V A;  5LHI A;  4KN4 X;  1IN6 A;  3ULQ B;  3H3U A;  1Z1D A;  5J6X A;  3LA2 A;  4HDU A;  3ZMT A;  1E17 A;  3FMS A;  4CXF A;  2QVO A;  1HW5 A;  1R1T A;  4HLX A;  1T0F A;  4IJA A;  5A2Q Z;  1RIO H;  4CDG A;  2VC0 A;  1W7P A;  2CO5 A;  2VN2 A;  1ZRD A;  2XRN A;  3T5X A;  3C7J A;  2NRA C;  1RUO A;  2XVC A;  1S7O A;  2DO7 A;  5BPI A;  4Q47 A;  4G7H F;  1QO0 D;  2MBF A;  3CJN A;  1YS7 A;  1R5G A;  1ZRE A;  3I59 A;  4GCV A;  1OR7 A;  3JSO A;  3GZ6 A;  2EV5 A;  2O6G E;  1FX7 A;  3OOP A;  3RDI A;  1H9T A;  4A5M A;  2MLK A;  3IRQ A;  3E5U A;  3VOE A;  4Y17 A;  1H0M A;  2HFH A;  4A6D A;  5FFX A;  4L0Z B;  3JSP A;  1TBX A;  2ZME B;  2TDX A;  2K02 A;  1IAW A;  3J80 K;  2A6E F;  4EM2 A;  4UVA A;  1Q1H A;  1U2W A;  4IXA A;  3JTG A;  4S05 A;  1J75 A;  5LGT A;  4A12 A;  3F23 A;  5FGM A;  3WTX C;  2EV6 A;  4P55 A;  2W24 A;  3GX4 X;  1K7A A;  3IL2 A;  2VBZ A;  2QQ9 A;  4BYY A;  1EH7 A;  2JT1 A;  3B73 A;  1XD7 A;  3QAH A;  5DCF A;  1U3E M;  4HOB A;  3RJP A;  1G6N A;  5JFR A;  1TW2 A;  4ON0 A;  2DTR A;  3KZY A;  2K4B A;  5JHU A;  4ENK A;  4RAZ A;  3KZZ A;  5D6E A;  4HAM A;  1PUE E;  4KNY A;  3Q9S A;  1WRJ A;  1ZHF A;  4RAY A;  1FT9 A;  3RPU A;  4BAY A;  3DP7 A;  1JXS A;  2DI3 A;  1U5T C;  5HLI A;  2MH2 A;  5ED4 A;  1FBU A;  4PGH A;  5HDG A;  4WF2 A;  1XCB A;  2XAH A;  1KU7 A;  1U8R A;  4YG2 F;  4LG0 B;  4RB2 C;  4EM1 A;  3IC7 A;  5L3E A;  3RTR A;  4EJW A;  4U0W A;  2A6H F;  2LKP A;  2QQB A;  5FD5 A;  5CVR A;  1P92 A;  3JAM K;  3WTV C;  2A3S A;  4DNC A;  3FMQ A;  3MQ0 A;  5H6Q A;  3MCZ A;  5CVI A;  3T8R A;  4KMF A;  1B4A A;  2NNY A;  5FO5 A;  1HSJ A;  1BI1 A;  3HHG A;  4U0Y A;  2LSO A;  2XRO A;  3G73 A;  2DLL A;  2KIM A;  3U2R A;  2XAF A;  1Z9C A;  2L02 A;  3KCC A;  1YQA A;  4HW0 A;  1O3R A;  1XSX A;  2GQQ A;  1MZB A;  5J8F A;  1UST A;  1BBY A;  3I5U A;  1L0O C;  1ZGJ A;  2FF4 A;  1J7K A;  4PGG A;  1HW1 A;  2FNA A;  3BY6 A;  1W7P B;  1QPM A;  1FBQ A;  1S6L A;  1WSU A;  3HSE A;  2FML A;  4BHP A;  4E70 A;  4WXD A;  1QNT A;  4IVN A;  3FWE A;  3R0A A;  5BQT A;  2ZNY A;  2FA5 A;  4KN7 X;  1HBX G;  3F6O A;  3GFI A;  3I59 B;  4YFK F;  2OQR A;  5D5X B;  3SXY A;  5ERI A;  3E6M A;  1R1U A;  1OYI A;  1VTN C;  4M74 A;  1FYK A;  2DPD A;  5DV5 A;  2PN6 A;  4HV6 A;  1SMY F;  4P9U A;  4RGR A;  1JGS A;  3L9F A;  4Z2Y A;  4HLY A;  3V8L A;  4CIC A;  3HRT A;  2Q8K A;  4XLP F;  3KP5 A;  2W85 A;  4N0B A;  3JTH A;  1E2X A;  3WG9 A;  4JQF A;  1YG2 A;  6PAX A;  2ACJ A;  1K6O A;  1LEA A;  2LF7 A;  4KYW A;  4QWQ A;  2COM A;  1MDM A;  3S2W A;  3D5L A;  3I0T A;  1HKT A;  3FHZ A;  1KQ0 A;  5HOO A;  2DK8 A;  1BI0 A;  1WWX A;  2F5F A;  4TV7 A;  5E1X A;  5LGN A;  4AIH A;  3BRO A;  1I1S A;  1ON2 A;  3KE2 A;  3EDP A;  3GFJ A;  4HDV A;  4OMY A;  2IJL A;  5D5W B;  2XUB A;  1KQ8 A;  4JK1 X;  1YTY A;  1BI3 A;  2MLG A;  3RKY A;  2P5K A;  5FFZ A;  4LLL A;  2FE3 A;  2M8E A;  1IN5 A;  5AIQ A;  1YIO A;  2O3F A;  3HTU A;  1ZG1 A;  3CO7 C;  1F5T A;  1HST A;  1XDS A;  4EV0 A;  2OU2 A;  1R22 A;  1TQM A;  1FBS A;  1BIB A;  2O8X A;  2KRF A;  2UXN A;  2RN7 A;  3J7A O;  1J9I A;  3V7C A;  1D8J A;  3HHH A;  2BGC A;  3REO A;  2VT3 A;  2V9V A;  2XAG A;  1XGN A;  5TJJ A;  2IA1 A;  4RB3 C;  3HTS B;  2DQL A;  2RC4 A;  2O03 A;  2ZCW A;  3E5X A;  4OIQ F;  1B59 A;  2E7X A;  2FSW A;  1SD4 A;  3QPT A;  1OKR A;  4G7O F;  4M9S A;  2QBY A;  5E17 F;  2P6T A;  3KP2 A;  3WTY C;  4I09 A;  2X0L A;  1V4R A;  1SFE A;  1ZLK A;  3GYH X;  3R60 A;  3BPX A;  2HKO A;  5DUI A;  3PQK A;  3IKT A;  5BPD A;  4B09 A;  3HOT A;  4U7B A;  3SQN A;  4L5J A;  1FZP B;  5DYM A;  1MJ9 A;  4BHC A;  1X3U A;  2IT0 A;  2ADU A;  3KP3 A;  1BN5 A;  1S7A A;  2AS5 F;  1FYL A;  4FX4 A;  1XN7 A;  2FQ3 A;  2J5O A;  5FD6 A;  3ELK A;  4IRG A;  1IRG A;  2OQG A;  4ZYE A;  2FOK A;  2Z99 A;  4KFC A;  2HEO A;  3J81 Z;  1W7P D;  4L18 B;  1P4W A;  4MGR A;  1P4X A;  3LAP A;  2XGX A;  1MJB A;  1JHF A;  1T2K A;  3DF8 A;  4AD9 A;  4G6Q A;  4WWC A;  1YW8 A;  3P9C A;  1UB9 A;  3IRR A;  2M45 A;  3F3X A;  4UHT A;  2OD5 A;  2Z33 A;  1PP8 F;  3R61 A;  3BDD A;  2WV0 A;  1XB4 A;  4PDK A;  4BXU A;  5CYV A;  2L4M A;  3GUD A;  2VXZ A;  2MA3 A;  4I0A A;  2C6Y A;  1ULY A;  2YX4 A;  2GWR A;  4KIC A;  5LGU A;  1TW3 A;  3EYY A;  2PLY A;  2HS5 A;  1G4D A;  4M71 A;  2HWV A;  1QBJ A;  5H6R A;  2H27 A;  4M9X A;  1LB2 A;  3P9K A;  3W6K B;  4A2U A;  3ZQ7 A;  2F5C A;  2ESN A;  2HQN A;  2Y0M A;  3HRU A;  4ETS A;  1IF1 A;  5AON A;  3M7G A;  1MKM A;  4DQ2 A;  4U7D A;  2K4J A;  5ICF A;  3I58 A;  4LD5 A;  1ZAR A;  3DV8 A;  2HKX A;  1I6X A;  2P7V B;  1ZG5 A;  2QEN A;  2P6S A;  2L01 A;  2YU3 A;  2VBX A;  4ZH4 F;  4OIO F;  1IXC A;  2ZJ2 A;  2VC1 A;  4QLC U;  3OV8 A;  3DPL C;  4ZYG A;  5DCM B;  2ZFW A;  2FXA A;  2QQA A;  3L7W A;  3V8K A;  2VBY A;  4D0P A;  4AWX B;  3TQN A;  1Z6R A;  2FBH A;  2UXX A;  3RYR A;  2GZW A;  3ZP5 A;  2A07 F;  2D45 A;  1LVA A;  3M1E A;  1IUY A;  2ISZ A;  5F6F A;  3BJ6 A;  5FLX Z;  2KJB A;  3C1D A;  2ZO4 A;  4CYD A;  2K86 A;  3DKW A;  3LWF A;  4UNO A;  4EQQ A;  2O0Y A;  3WE3 A;  3KEO A;  3J81 K;  3K1P A;  4ESF A;  1FSH A;  1KYW A;  2Z9O A;  4A5N A;  3QRF F;  3BJA A;  4OOI A;  5JVT A;  4HF1 A;  3RPQ A;  2BYV E;  1ZLJ A;  2ISY A;  4RS8 A;  3CUQ A;  1TNT A;  3IWZ A;  1G3S A;  3U1D A;  4LLN A;  5HVQ C;  5KVR A;  4HQM A;  5HLG A;  3ML6 A;  1HKS A;  3LQR A;  3F8M A;  3TDZ C;  3WE2 A;  2W84 A;  1RI7 A;  3RKX A;  1R7J A;  4LK1 F;  2IA0 A;  4FT8 A;  3KET A;  4O3M A;  1TQP A;  4L9J A;  3JW4 A;  4I7H A;  2YPR A;  5L3D A;  4IRI A;  1MD0 A;  2CFX A;  4EVI A;  1ZRF A;  4HYE A;  4N9H A;  4RGX A;  3LA3 A;  2VE8 A;  2E1C A;  5ICG A;  2QUF A;  3ECH A;  5A2Q K;  4CZZ A;  2CYY A;  3GWZ A;  3C3W A;  1T39 A;  2QM3 A;  3E5Q A;  3QOP A;  4HV5 A;  1T38 A;  2ZKZ A;  5F64 A;  2MC3 A;  4G9Y A;  1BM9 A;  2DFI A;  2RNJ A;  2PJP A;  4WXC A;  1W5T A;  2ZBK A;  1ZRC A;  3DPT A;  2EWN A;  1FY7 A;  2HYF A;  4MQV A;  2ETH A;  2R7F A;  2JRT A;  3FM5 A;  2HZT A;  4GYG A;  2P5L C;  3TOB A;  3KP4 A;  3VOD A;  1W5S A;  2PBI A;  2CQK A;  1O3T A;  1YW7 A;  2P5V A;  1SD6 A;  2HR3 A;  4HX4 A;  2KIU A;  3MEX A;  3W6J B;  1LEB A;  5E8I A;  4G94 A;  4O5V A;  5LEK A;  2L4A A;  2KJC A;  3WTU C;  5D4S A;  1O3Q A;  2B0L A;  2PQ8 A;  5FLX K;  5L3F A;  1BJA A;  4LFU A;  1KA8 A;  3BPV A;  2ESH A;  5CLS A;  3R4K A;  1XDU A;  1IN7 A;  5J8C A;  5ILU A;  3MWM A;  2VON A;  4UUV A;  2UWM A;  4UV8 A;  2L3D A;  3M8F A;  3GXO A;  1HXD A;  2RGV A;  4P9F A;  1YLF A;  3WOD F;  4XLN F;  1FP1 D;  4LB6 B;  4Q48 A;  4OMZ A;  5DDG A;  4ENN A;  2EV0 A;  4A0Z A;  4Y13 A;  4G6D A;  1I1G A;  2XV4 S;  1JHH A;  5CVV A;  5F1R A;  1QGP A;  4BNC A;  4HA8 A;  1YO5 C;  3QU6 A;  4KUM A;  4LJZ F;  3N97 A;  4L0Y B;  3L2C A;  3FXU A;  4HZF A;  2AXL A;  5TRD A;  5LHH A;  2LF8 A;  3WU0 A;  1IN8 A;  4M72 A;  2GA2 A;  3BZ6 A;  1RZ4 A;  4AIJ A;  3LA7 A;  3F8N A;  1FYM A;  1J59 A;  2WC2 A;  3T0Y A;  2VT2 A;  1U6G A;  5FB2 A;  3BOQ A;  2DW4 A;  3BWG A;  1H9G A;  1BI2 A;  3ISP A;  3K2Z A;  1KU2 A;  4YFX F;  3FM3 A;  3T8T A;  3RKW A;  1ODD A;  3WGI A;  2OBP A;  3K9T A;  4GXO A;  3E6C C;  5K5O A;  2QLZ A;  3I64 A;  2A61 A;  5LEJ A;  1IZ1 A;  2XKP A;  1DP7 P;  1DUX C;  2BBY A;  1SFU A;  4G8X A;  3E6D A;  1FSE A;  3E97 A;  2HDC A;  2V6C A;  3CUQ B;  4CGZ A;  5ICE A;  1SAX A;  1IXS B;  1C0W A;  1SD7 A;  1YFH A;  3MZY A;  4Y15 A;  2NNN A;  2OA4 A;  2NS0 A;  2CGP A;  4Q5S F;  1XSD A;  2VE9 A;  2A69 F;  1QQI A;  2V1U A;  1FNN A;  4I98 B;  1J0R A;  3KLO A;  1AWC A;  2V1X A;  4KMU X;  2XAQ A;  3Q5F A;  3GFL A;  2RV8 A;  2GXB A;  2FEZ A;  3KP7 A;  1F9N A;  1GXP A;  2W25 A;  1MGT A;  1OYW A;  1TNS A;  3HRM A;  1ZGA A;  3N4M A;  3RYP A;  3K0L A;  2GXG A;  2D2W A;  4ESB A;  4I01 A;  4IPA A;  2F5E A;  5L3C A;  2ZME A;  2H94 A;  5JI6 A;  3F72 A;  1SD5 A;  3ZN0 A;  5CVJ A;  2E1N A;  4EJV A;  2XKO A;  2GIV A;  5ILS A;  5K5Q A;  1OPC A;  2MH9 A;  2FU4 A;  3GF2 A;  3WTW C;  5BOX A;  5LLQ A;  3CUO A;  2LDU A;  3FX3 A;  1RUN A;  5E8G A;  3NQO A;  1B1B A;  1T6S A;  5LBQ A;  1KYZ A;  3R6S A;  1CGP A;  3LAJ A;  2FMY A;  2M5W A;  2VBW A;  5HS7 A;  1LDK B;  2HGC A;  2RKH A;  4HX8 A;  4U88 A;  5DEQ A;  4M9Z A;  1P2F A;  4XSZ F;  1W4M A;  5HDK A;  4UV9 A;  4GGG A;  4R1H A;  5D8L B;  2CWE A;  1G3W A;  3F8B A;  4MTE A;  2M30 A;  2EA4 A;  1XGS A;  3EQL F;  4OIR F;  3ZPL A;  2HTS A;  4YFN F;  2ZNZ A;  3QP5 A;  1R23 A;  3E6B A;  2PMH A;  2V79 A;  3I54 A;  2KIF A;  2DU9 A;  4Q4Z F;  1REP C;  1KU3 A;  4L9N A;  4OIN F;  4EM0 B;  4LMY A;  4IHS A;  1IW7 F;  4CO8 A;  1WI9 A;  4ESJ A;  1TLH B;  5BS6 A;  1XMA A;  4KIG A;  1DPR A;  5EEH A;  2X4H A;  2QYO A;  4A6E A;  4MEX F;  3FF5 A;  1O7F A;  3GW2 A;  3DXJ F;  3QPH A;  5HLH A;  4ENJ A;  2NYX A;  3V4G A;  1BC8 C;  1IN4 A;  3KLN A;  3L00 A;  3ZN1 A;  4I0B A;  2HOE A;  2ELH A;  1HQC A;  1MDM B;  3EUH A;  1Z6T A;  2FBK A;  1FWZ A;  3LST A;  3D0S A;  1QZY A;  1Z91 A;  2VOD A;  1R36 A;  3KEQ A;  1R00 A;  4BH9 A;  3O6B B;  3WGG A;  4HX7 A;  2K27 A;  4XSX F;  1B6A A;  4R79 A;  1S3J A;  1MJA A;  5DUK A;  1HW2 A;  3K1M A;  3R0J A;  3SFZ A;  4ZZL A;  1ON1 A;  1I27 A;  4EJO A;  1AOY A;  2EA2 A;  3ZMZ A;  4FX0 A;  1G3Y A;  4R8H A;  4A0Y A;  2PEX A;  4EMS A;  3T1B A;  1T98 A;  1U5T A;  3O2P E;  2VOP A;  1SFX A;  5CVU A;  3DEU A;  3E3V A;  1YW9 A;  3CLO A;  4N9I A;  2A5Y B;  1FP2 A;  2IA2 A;  4UVC A;  2IVM A;  3JAM Z;  2STW A;  4IHT A;  2P8T A;  2V1D A;  3I53 A;  3HSR A;  3MFK A;  3ZMD A;  4WX9 A;  4U0V A;  3TO6 A;  3TGN A;  2XIG A;  1IXR C;  1USS A;  2HYG D;  2CG4 A;  3O3K A;  4UVB A;  4EJT A;  4ENM A;  3SZP A;  2D1V A;  3P9I A;  1BC7 C;  4HBL A;  2RQP A;  5HS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...