4G9YA

Crystal structure of the pcav transcriptional regulator from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
136
structure length
136
Chain Sequence
THPGHLARRLQQAHYLLWNTMVSEETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADAAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PcaV transcriptional regulator
publication title Study of PcaV from Streptomyces coelicolor yields new insights into ligand-responsive MarR family transcription factors.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 52
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4g9yA00
4JK1X 1AOYA 4G94A 3KLOA 3RDIA 3F8BA 2EFWA 1REPC 2G7UA 1LVAA 4LMYA 2VXZA 1ZREA 3NEUA 4Q48A 1KU9A 1WQ2A 5DCFA 1YIOA 1AWCA 2H94A 2FA5A 4YG2F 2DBBA 2M5WA 3PFIA 4CICA 3KEQA 1EV7A 1XMKA 2KRFA 4YIIA 1SD6A 2W24A 4LGWA 1QGPA 1QO0D 1O7LA 2G9WA 2FQ3A 2F5FA 2RDPA 1LDKB 2A69F 1XD7A 2HQNA 5DUIA 4KMUX 5ICCA 1IN4A 2VE8A 3I0TA 4BXUA 3RJPA 4S04A 3GFIA 4HW0A 1Z6RA 3GLXA 4A6DA 2ZBKA 4M6YA 3U9GA 4YFXF 3IHUA 4D0PA 1ZAOA 3Q9VA 3GX4X 1CF7B 4LD5A 5L3DA 4UNOA 1KQ8A 2D1VA 4UUVA 3I64A 1WI9A 3CUQA 1TW2A 4L0YB 3GFJA 3KETA 4XSXF 1SFEA 2IVMA 2YX4A 3R0JA 4KT5C 2YR2A 3JW4A 2MC3A 2DI3A 3F22A 3W6JB 1ODDA 2NNNA 4L9NA 3I5UA 4Z2YA 1T39A 5LEJA 3FXQA 2R7FA 4I0AA 2E7XA 2W85A 2L02A 3H3ZA 4HZFA 3C18A 4CO8A 2A3SA 1I1GA 4KFCA 1P6RA 4L9VA 4B09A 3E6CC 1I5ZA 4AWXB 3QPHA 3F8NA 4MEXF 2ZNYA 2GA2A 2Y0MA 3R61A 1KQ0A 2CW0F 1Z91A 1CGPA 5HDKA 2NYXA 1MZBA 3ZMZA 3CUQC 3WTZA 1EH7A 3ZMUA 2EWNA 2FBKA 1STZA 2FNPA 3J81K 1YW7A 2H6CA 4M6XA 1HBXG 1YW8A 2FSWA 1LDDA 2DLLA 4WX9A 1JXSA 1IN6A 5D4SA 2VONA 1JHHA 1HSTA 2XVCA 4PCQA 3FWEA 3H3UA 1LEAA 4EV0A 1O57A 4DNCA 3K1NA 4EJTA 1D5VA 4HQEA 1ZG1A 4Y17A 2HS5A 1FNNA 3VEPA 3I59B 2QBYB 4A5NA 5L3BA 3LQRA 3RKXA 1ZGAA 5LGTA 4R8HA 1DPRA 2O61A 4KIFA 3DEUA 1BN5A 1USSA 1MJ9A 4XBFA 4CXFA 1K6OA 1ONVA 1JE8A 1D8KA 5AONA 3CO6C 2OD5A 2IA1A 3F3XA 5D5XB 4RGUA 3Q9SA 3MEXA 2V1DA 2R7DA 4EMSA 3TOBA 2Z5UA 1TQPA 4I2OA 4UXNA 3J81Z 2H6BA 4RB3C 1ZG3A 2V6CA 4M9XA 1OMIA 1KQ9A 1MGTA 3V8JA 4M9SA 4OIOF 5ERIA 4WWCA 1R23A 3GEZA 2MBFA 1FP2A 3TO9A 3SZTA 3OV8A 5E1WA 2Z33A 2PN6A 2VOOA 4HV6A 1R1VA 2DT5A 4GO1A 2TDXA 4S05A 1IAWA 3SXYA 3IC7A 1SAXA 1HKQA 5D8LB 2G7HA 5L3GA 2NRAC 3FM3A 4ESBA 2K86A 3L9FA 4AIJA 2EFPA 3E5UA 3KFWX 5J8CA 1XSXA 2VODA 1G3SA 3EETA 2DPUA 3HSRA 4CZZA 4L9TA 1IXRC 2VBZA 5BS6A 2JZYA 4RAZA 1I1SA 3P9CA 3V8LA 4L18B 2ZFWA 3G3ZA 2DFIA 1K7AA 4IRGA 3WGHA 3TO6A 1J0RA 5BMZA 1GXQA 2YU3A 3F6VA 3T0YA 2L3DA 1R1TA 3AAFA 4KICA 5J6XA 2A6EF 3EYIA 3Q5FA 2P6SA 4A12A 3R4KA 2J5OA 2BGCA 1EH8A 2MH9A 3CJNA 3VFZA 3BWGA 3E5QA 3QU3A 4AVPA 3LWFA 3RKYA 4L0ZB 2M45A 2ZKZA 3HIFA 2XKPA 2PLYA 2HDCA 3ZP5A 3QU6A 5L3EA 2NNYA 2E1NA 3TQNA 1TQIA 2OU2A 2ISZA 1T2KA 2Q2EA 3GUDA 2EFOA 4RB0A 2KKOA 4WF2A 3KP7A 2EK5A 4HYEA 4L9JA 2PMHA 3CLOA 3GO5A 2FXAA 5ILUA 4RGRA 1GHCA 1J75A 2DK8A 4KN7X 3HOTA 2A68F 3KP6A 1QZYA 5FD5A 3GWZA 2KJBA 1KYZA 3WE2A 3C7JA 3P7NA 4GYIA 5FFZA 2HZTA 2E1CA 5CYVA 1IRFA 4HA8A 1ON1A 4M73A 4TV7A 4N0BA 4U0VA 4XRFA 1B9MA 5CVRA 1I27A 1FSHA 1XDUA 4R79A 3K69A 4BYYA 3U1DA 3I53A 3WG9A 2GXGA 2HKOA 1DUXC 1RUNA 1ZN2A 2KJCA 2KIUA 1O7FA 4M74A 2Z99A 1GXPA 1P4XA 1OYIA 1R7JA 1O3SA 2X4HA 3V4GA 1MD0A 1UFMA 2CFXA 2HR3A 3DP7A 3TGNA 1X3UA 3BDDA 4GCVA 4P96A 5H6RA 5HOOA 4HV5A 3C1DA 1Z7UA 2ELHA 4M71A 2DAOA 5FO5A 4WXHA 1ULYA 2ETHA 3D5LA 3I4PA 2XV4S 2EV5A 4A6EA 3GYHX 2PFBA 2Z9OA 3TKYA 2OAZA 1P92A 2LSOA 3H92A 2VOPA 2ZJ2A 3RIRA 1H0MA 4O3MA 2XROA 2KIMA 1UCRA 4WXDA 2XHKA 4OINF 3K1PA 2XAGA 5HDNA 1PP8F 3DFGA 3RYRA 2LF7A 4ON0A 3K1MA 4ESFA 2IA2A 4UVAA 3KEOA 2M30A 1LJ9A 1TNTA 3IRQA 2QM3A 1E2XA 1R58A 5ILSA 4U7BA 1Z1DA 2RV8A 2VT3A 3J80K 2RVCA 2OQRA 3RPQA 3K0LA 2GWRA 2MLGA 1EH6A 4G6QA 3NRVA 1S7AA 1TNSA 1C0WA 2O3FA 1ZRDA 1P2FA 3JSOA 4ENKA 5DCMB 2YSRA 3FX3A 3EDPA 2D45A 3ECHA 4UHTA 1ZG5A 4I02A 5D8KB 5JVTA 4UV9A 3WTXC 2XAFA 3REOA 1Q1HA 5E8GA 5L3CA 3FMRA 3SFZA 1K79A 4PDKA 2UXNA 3QP6A 5H20A 3DF8A 4Q47A 3F8MA 4A2UA 2RQPA 2P5LC 5K5OA 2EA4A 3G73A 4CGZA 1W5TA 2EJRA 2ACJA 3GZ6A 3IKTA 2DTRA 1JHFA 4OMYA 3KP3A 4A5MA 5ED4A 3PQKA 2R3SA 1YQAA 1FYLA 1YG2A 4FX4A 4KUMA 3J80Z 2FNAA 2A5YB 2O03A 4HF2A 4JBAA 2XRNA 4KDPA 5HVQC 4ENMA 3FF5A 4IHSA 4E70A 1OPCA 3E97A 3V7SA 3M7GA 1K78A 1DPUA 2M87A 2HWVA 4G7OF 1YFHA 2RC4A 4HAMA 1O3TA 4HQMA 4LG0B 2A6HF 5ICEA 5LHHA 3F23A 1CF7A 3P9KA 4HDUA 2PI0A 2W57A 1LB2A 3HRMA 4U0WA 3ZMSA 5BPDA 3MZHA 2AS5F 2VBWA 3M8FA 3HHHA 2DO7A 3DV8A 2A61A 3M1EA 3R0AA 1S3JA 5AIPA 1HSJA 5HS8A 1G3YA 1FT9A 2BEOA 1OR7A 2FRHA 3BJAA 2EV6A 2XASA 2XKOA 3JTGA 1ZRCA 1WWXA 4P9UA 4MQ9F 3M8EA 3V7CA 4GYGA 1J7KA 3LSTA 3LA3A 5FFXA 4I7HA 3LAPA 1R1UA 3LA7A 5D5VB 2Q8KA 4RGXA 4PZJA 3IKVA 3DPTA 3ZMVA 1ZRFA 2CO5A 2Y75A 4HLYA 4FT8A 4EM1A 3SZPA 5LRRA 3VODA 5JI6A 1UHMA 2M1BA 3MZYA 1XGMA 1O3RA 5KVRA 3EUHA 1KU7A 2B0LA 4M72A 3COAC 5KK1A 4YFNF 3LA2A 3KZZA 3BJ6A 3WTTC 2XUBA 5BQTA 4LK1F 2QZ8A 4OIQF 1F9NA 5ICFA 2P4WA 3O6BB 3K9TA 2HFHA 3FHZA 5HS7A 4I09A 2IP2A 3S2WA 3WTWC 1FBUA 1R5HA 1J59A 1IW7F 2CSOA 2RKHA 2L4MA 2QUFA 4IHTA 3BROA 2XIGA 3N4MA 3HTSB 3I59A 1BIAA 2HYGD 2QBYA 5BPIA 4F7ZA 2ISYA 3GVAA 1W7PA 3KZYA 4ZYHA 3D0SA 1RNLA 3RPUA 5J8FA 2ESHA 4L5JA 3F8CA 5CVUA 5K1YA 4IRHA 4EGZA 1KGSA 4G7ZF 2VBXA 1RZ4A 5DV5A 5LLQA 2RGVA 5BOXA 3T8TA 5D5WB 5JHUA 4DQ2A 1XGSA 3ZMDA 5CVIA 2PJPA 1G3WA 2FOKA 1U5TB 5JR3A 1B9NA 3O2PE 5EEHA 2DU9A 3E6MA 5FGMA 3HRUA 1MJAA 4ZH4F 2FBHA 2F5DA 2V79A 3L00A 3W6KB 1TLHB 3CDHA 3GZ5A 2QLZA 4HX4A 5K5QA 3WU1B 3ML6A 3F6OA 4HX8A 2XAHA 1LQ1A 2CGPA 2QENA 2Z3YA 4LB6B 1KYWA 2FBIA 1HQCA 4FX0A 4I98B 4G7HF 3O3KA 4ZYGA 2MA3A 1Z9CA 4Y13A 4CHUA 1I6XA 1OYYA 3E6BA 1T0FA 2XAQA 3FMSA 4WXCA 4HBLA 5CVJA 2E7WA 4R1HA 3BPVA 1R36A 4HDVA 2K02A 5LRSA 1MDMB 2C6YA 4MQVA 2J5PA 4LLLA 3MQ0A 2OZ6A 1SFUA 4ASNA 3N97A 1P4AA 2WV0A 3WU0A 5AIQA 2F5EA 4A0ZA 2FF4A 4YFKF 4IRIA 3LAJA 2MH2A 3FXRA 1IZ1A 1G4DA 2K4JA 1YS6A 4BNCA 3ISPA 3RTRA 5HLIA 4A0XA 2P6TA 4K2EA 2HYFA 1B1BA 5DEQA 1A04A 5LEKA 4HF1A 2F5CA 1BJAA 4XLNF 2QQBA 1FYKA 4LLGF 1XB4A 2VC1A 1YYVA 4OU0A 2HQRA 1BOAA 4EQQA 1IUYA 3MFKA 1IN5A 1MJBA 5JFRA 1KU2A 1S29A 4GXOA 4G6DA 2ADUA 3WGGA 1ZARA 1HW5A 2ZMEB 4NQWA 3R6SA 1MKMA 2FEZA 1XSDA 1IXCA 2VC0A 1FYMA 3ZN1A 2JPCA 3TDUC 1HW2A 3GFLA 1FSEA 5HLHA 3EYYA 1FZPB 1R5GA 3ERED 1HKTA 1XMAA 1TTYA 3P9IA 2PEXA 4GGGA 2OBPA 1W5SA 2L54A 1BC7C 5HDGA 1J5YA 3V8KA 2IJLA 3JSPA 2W25A 2YPRA 2UZKA 3QAHA 2L4AA 4XSZF 5DD8A 3RYPA 4MNUA 4RGSA 2EA2A 2LKPA 4CYDA 3EQLF 1BIBA 1V3FA 1TBXA 2VT2A 3QRFF 1LEBA 2PQ8A 2XGXA 2PBIA 3M9AA 4Y15A 1B4AA 3MWMA 4EJWA 2W84A 3E6DA 2FMYA 2JSCA 3NQOA 4LLNA 5DD4A 2LF8A 1S7OA 4NHJA 1QQIA 1FY7A 4KNYA 2MLKA 5D4RA 4MEYF 1U6GA 4QLCU 1ZGJA 2Q0OA 3JAMK 3F21A 2NAZA 3PQJA 1ZHFA 1J9IA 4MTEA 5FLXK 3KP2A 4B8XA 4AD9A 4IJAA 3BOQA 3WODF 3ECOA 3GFMA 2NS0A 1KU3A 3CUQB 2HEOA 4FHTA 3VOEA 4EJUA 4KMFA 3DXJF 3ABUA 1F4KA 3QOPA 2H09A 3E3VA 2OA4A 1IXSB 3F72A 5E17F 5E1XA 1XGNA 1K78B 3JTHA 1DDNA 1B59A 1L3LA 4LFUA 1WRJA 1FBSA 4A0YA 4M9ZA 1IF1A 1H9GA 1T6SA 1XN7A 3HUGA 1BC8C 5DCMA 3RKWA 1G6NA 3KP4A 3QP5A 5EEGA 1XCBA 4RB2C 2GQQA 2BYVE 2P8TA 3TDZC 1U78A 4G8XA 4I01A 4Q5SF 4OMZA 1O3QA 4N9IA 1RI7A 5LGUA 3WTYC 3JAMZ 2DW4A 4YIFA 1BI1A 2O0YA 3B73A 3KCCA 3WTSC 2EFNA 5FLXZ 1Y0UA 2V1XA 3R60A 1IRGA 1XGOA 2DK5A 2QWWA 3TOAA 1W7PD 1P4WA 2OQGA 3IWFA 1U3EM 2QVOA 3ELKA 3L7WA 3BZ6A 3WTUC 2DQLA 3FZVA 4BAYA 3CTAA 4EJOA 2A07F 1RUOA 4G9YA 5IT3A 4KYWA 2EB7A 3GXOA 3I71A 3L09A 5IT9K 4MHGA 2OZUA 2F2EA 2DQRA 3GF2A 2P5KA 1FWZA 2P7VB 3FM5A 4BHPA 4IVNA 1H9TA 2WC2A 1WSUA 1XSVA 5LBQA 4IXAA 3DQVC 1L0OC 1ON2A 2FE3A 3HHGA 2UWMA 5TRDA 2ZCWA 5E20A 4LG0A 4HOBA 3T8RA 4KIGA 2GA1A 1T98A 1PDNC 4XLPF 4PGHA 4HX7A 1PP7U 4ZZDA 2LNBA 1UHWA 1PUEE 3ULQB 2CG4A 4EM0B 5DUKA 5F64A 2JRTA 2CYYA 3HOSA 4IF4A 1JGSA 4AIHA 2P5VA 4BH9A 1XCVA 1D3YA 4EGYA 2VBYA 4KN4X 2XAJA 3SQNA 5LGNA 1W7PB 3BPXA 6PAXA 4UVCA 2PG4A 1OKRA 4OOIA 2YX7A 5F6FA 3T5XA 2ZO4A 2ZNZA 1FPQA 5IT9Z 2ESNA 2WWYA 5CJ9A 2GZWA 5TJJA 4JQFA 3ABTA 5E8IA 5ICGA 2K4BA 1Z05A 1LNWA 3MCZA 2HTSA 2IRFG 2IT0A 1WKMA 4HF0A 4L5IA 4UVBA 3IL2A 3E5XA 1QNTA 3WTVC 4RAYA 5HLGA 1FX7A 4EM2A 4ZYDA 1IN8A 5D6FA 1LDJA 1KA8A 4RS8A 3HSEA 1SD5A 1G3TA 4H0EA 3L2CA 4UV8A 1VTNC 4WCGA 1SFXA 2JTVA 1OYWA 1SD4A 4P55A 2JT1A 2M8EA 2EFQA 4MTDA 3DKWA 3BP8A 4ETSA 4ENJA 1S6LA 2X0LA 1FBQA 4ESJA 4O6JA 1NHAA 4KA4A 2HKXA 2WTEA 4O5VA 1F5TA 2HGCA 3DPLC 1XDSA 4ZZLA 1TQMA 5E1ZB 5E18F 1YW9A 2GXBA 3C3WA 3KLNA 1SMTA 4EVIA 3FXUA 1F1ZA 1BI3A 5FD6A 1S8NA 4MGRA 4OIRF 2O8XA 1DP7P 3ZN0A 1QZZA 3FMQA 3K2ZA 2JPBA 2HTJA 2V9VA 3U2RA 5F1RA 3BY6A 3CUOA 4U0YA 3QPTA 3ROUA 2STWA 1U5TA 1ZYRF 2Y48A 2H27A 3SHFA 5A2QK 4RB1A 4N9HA 2P7CB 2QYOA 1BI0A 2FU4A 1BBYA 2GIVA 2IPQX 5H6QA 3IWZA 2GAUA 2PMUA 2RNJA 2L01A 4OIPF 1FLIA 1ZLJA 2D1HA 1ZH5A 2ZXJA 3CO7C 4P9FA 2VE9A 1D8JA 1R22A 4WK8F 2K27A 1SMYF 4BQAA 2RN7A 4BHBA 5K5RA 3HTUA 2V1UA 1QPMA 1BI2A 2BE5F 2O6GE 1RIOH 4PGGA 3VB2A 5ILVA 1J2XA 3I54A 2BV6A 1HKSA 2QQ9A 5LHGA 1ZLKA 2FMLA 1YLFA 4QWQA 3WE3A 4Q4ZF 2DPDA 4LB5A 3WGIA 2CQKA 3HSFA 5DYMA 1E17A 1U5TC 1MDMA 2IA0A 3T1BA 5L3FA 2EV0A 4NB5A 1U8RA 1U2WA 4U7DA 2CWEA 3ZPLA 1BM9A 1HXDA 3KE2A 4U88A 2UXXA 3GW2A 1FP1D 4ENNA 1Z6TA 4I0BA 5A2QZ 3OOPA 1W4MA 2AXLA 3F8FA 2HOEA 3BJOA 1USTA 3J7AO 3TO7A 4EJVA 1T38A 3HYIA 1V4RA 5FB2A 3HRTA 1YTYA 1HW1A 5D5UB 4LK0F 3B02A 4CDGA 5DDGA 4P5OA 1TW3A 2BBYA 2LDUA 1YO5C 2VN2A 2COMA 3LQQA 4AIKA 5CLSA 1B6AA 4BHCA 1YS7A 3KP5A 3LFKA 3I58A 4KIBA 1UB9A 2ZMEA 2MD5A 4ZYEA 3ZMTA 4HLXA 1GVJA 2KIFA 4LJZF 5D6EA 2QQAA 3HRSA 3MAJA 5HS9A 1IN7A 4IPAA 2STTA 1FC3A 1R00A 1SD7A 3RI4A 2D2WA 2IW5A 3V7RA 2K7LA 3ZQ7A 1QBJA 5LHIA 3IRRA 1FOKA 5CVVA
chains in the Genus database with same CATH superfamily
2WY7Q 2QCOA 2FX0A 4JK1X 3HL2A 1AOYA 1WHUA 3H3VK 2IGOA 4G94A 2H8WA 4DBRA 2DXIA 3KLOA 3E7LA 4PSXA 3RDIA 4LIVA 3F8BA 5J47A 3B6AA 2EFWA 1REPC 4JX5A 3H35A 3BTJA 1W36D 2XB5A 4RAFA 2G7UA 4XICA 4XKCA 1LVAA 4LMYA 2IAIA 4BQQA 4CCMA 2VXZA 1ZREA 2WAFA 2DODA 3FXMA 3NEUA 1Z3XA 2JA8J 5CPRB 4Q48A 2LY1A 2OTLI 1KU9A 2HVQA 1WQ2A 5DCFA 5FKLA 5EEAA 1YIOA 1SC7A 2ZMEC 1AWCA 1TL8A 2H94A 2DA6A 3GTLJ 2VQHA 3DLLF 2FA5A 4YG2F 2X1CA 1WJDA 2DBBA 2M5WA 3PFIA 4QTRA 3OIQA 2WA0A 3JCUC 5GAHJ 4CICA 3TBIA 3KEQA 2KRFA 1EV7A 1XMKA 4FE4A 1SD6A 4XOTA 4YIIA 4KITB 1VQ9I 2W24A 1K61A 4LGWA 4C3IJ 1GUUA 2M7BA 1QGPA 2RREA 4HEA2 3K4JA 4LG3A 3SEZA 1QO0D 1O7LA 3X2QH 2G9WA 1W5CC 2FQ3A 2F5FA 2RDPA 1LDKB 3CF5F 5M5WJ 3HXLA 2A69F 1XD7A 2HQNA 2XGDA 5DUIA 4II3A 4KMUX 5ICCA 5E3LA 2KIQA 5FKMA 2XPWA 1WJCA 1IN4A 2W82A 3CMYA 2VE8A 3M3YJ 3I0TA 3K4BA 4BXUA 3RJPA 1FTZA 3DBLB 3WHCA 4S04A 3GFIA 3KIOA 2KQRA 2BXZA 4HW0A 3TW6A 1Z6RA 3HGGA 4X1EA 3GLXA 1F43A 2OCEA 3B6CA 4A6DA 2ZBKA 4M6YA 3U9GA 3BZCA 4YFXF 3IHUA 1SVOA 4D0PA 1ZAOA 3Q9VA 4AC0A 1POGA 3GX4X 1CF7B 3M4OJ 4LD5A 5L3DA 3OIPA 4UNOA 1KQ8A 2D1VA 1R4MB 1MNDA 4ABZA 4UUVA 2NVXJ 3I64A 1P9QC 4RDUA 1WI9A 2HOAA 3CUQA 1TW2A 2K9NA 3U21A 4ZTJA 1JKOC 4L0YB 2JWTA 3GFJA 3KETA 4XSXF 3CDLA 5CVVA 1SFEA 2VQLA 4BE2A 2XGCA 2NOJB 2IVMA 2YX4A 3R0JA 4KT5C 2YR2A 3JW4A 5B1AH 2MC3A 2DI3A 3F22A 3W6JB 2XF6A 4I6ZA 1TWFJ 1ODDA 2NNNA 5EF6A 4L9NA 3I5UA 4Z2YA 3ZOBA 1T39A 1OCRH 3FXQA 4Y4RA 5LEJA 2R7FA 4I0AA 3HOWJ 2E7XA 2W85A 2E35A 2R7SA 2L02A 3H3ZA 4HZFA 3RPUD 3C18A 4CO8A 2IGNA 3BCAA 4NC8A 1NG6A 2A3SA 2EPFA 1A35A 1I1GA 2V26A 2GM4A 1VQOI 4HRIA 4XK4A 2DOFA 4QPQA 4KFCA 1P6RA 4L9VA 5B66C 5FKKA 4B09A 3E6CC 1I5ZA 4AWXB 3QPHA 3F8NA 1EF4A 3HKZA 4MEXF 2ZNYA 2OC6A 2GXAA 4ZDOA 2GA2A 2CQXA 2Y0MA 4BY1J 5DS9A 3R61A 1KQ0A 2X51A 2VQCA 1OLTA 2CW0F 1Z91A 1CGPA 2Y69H 1YI2I 5HDKA 2NYXA 1MZBA 4M3FA 3ZMZA 3A4CA 2JVHA 3CUQC 3WTZA 1EH7A 3ZMUA 2EWNA 3PM1A 1MBKA 3E1SA 2ME6A 2KLOA 2FBKA 1STZA 4IL6C 2FNPA 2N8GA 3J81K 2YU9J 1ETVA 4BJ5C 1YW7A 2H6CA 4YEJA 5IP6A 1D1AA 2NOGA 4DJAA 4M6XA 1HBXG 1YW8A 2V4JC 4C9YA 2FSWA 3TL4X 1LDDA 4CYCA 2DLLA 1XTAA 4UUSB 2R92J 2K3FA 3CC7I 3ASOH 4WX9A 2R5YB 1JXSA 4V19K 1IN6A 5D4SA 2EZLA 2QA4I 2VONA 1JHHA 2LKXA 1HSTA 3GTGJ 1ETWA 2XVCA 2HVRA 3S17J 4PCQA 3FWEA 3H3UA 5IP7J 2VIXA 2LH9A 2M34A 4ANJA 4J00A 1LEAA 1RESA 1VQ8I 1XMXA 5C3EJ 3ZRGA 2EILH 2DMTA 2VPRA 4EV0A 1O57A 4DNCA 3K1NA 4PJ0C 4EJTA 2M9HA 4HQEA 1D5VA 2F6CA 3LSPA 2V1NA 3GTJJ 5FRMA 1ZG1A 4HSTA 4Y17A 2HS5A 1Z7LA 1FNNA 3VEPA 3I59B 2QBYB 3MD2A 4A5NA 5L3BA 3BG7A 3LQRA 3RKXA 4D7NA 5E3NA 1ZGAA 4D5FA 5LGTA 1D5YA 4R8HA 1DPRA 2O61A 4KIFA 3DEUA 1FOWA 1BN5A 4J19A 1USSA 4IZZA 4UY8I 1MJ9A 1I50J 4XBFA 4CXFA 1K6OA 1ONVA 5K7ZA 3OYKA 4LITA 2VXDA 3CCLI 1JE8A 1D8KA 1WJBA 2LMDA 5AONA 3V42A 5K7HA 2ZJPF 4A3CJ 3CO6C 5IOYA 2IS2A 1ENHA 1BR1A 2CUEA 2OD5A 2IA1A 3JRIA 1BR4A 2JMWA 3F3XA 5D5XB 1OR7C 2X6YA 4RGUA 3Q9SA 2KHMA 3MEXA 2V1DA 3ZR8X 2R7RA 2R7DA 4EMSA 3TOBA 4CCKA 2K3PA 2Z5UA 3OYGA 1TQPA 4I2OA 3I9V2 4B48A 3JRAA 2K9SA 4Z6YA 4Y7NJ 3GBGA 4UXNA 3J81Z 2DFHA 2H6BA 4RB3C 1Y56A 1ZG3A 2V6CA 5IY5H 2LVSA 4M9XA 3C2GA 1OMIA 1KQ9A 1MBEA 1MGTA 5GPAA 3V8JA 1X1AA 2VJ4A 4CCNA 1FIPA 4M9SA 1N77A 4OIOF 3JRDA 5ERIA 4F92B 4WWCA 1R23A 1QZEA 3BTCA 3GEZA 2MBFA 1FP2A 3G6EI 1WJFA 3TO9A 3SZTA 3OV8A 5E1WA 4IX7A 2R7TA 1OCOH 2Z33A 4BE0A 2PN6A 3MZ8A 2VOOA 4HV6A 1MBHA 1R1VA 2DT5A 4GO1A 3LSHA 2TDXA 5JHFA 1A31A 4S05A 1IAWA 3SXYA 3IC7A 3CC2I 3MKYB 4LOCA 1IUFA 1SAXA 1DU0A 3DLAA 1HKQA 3QYFA 5D8LB 2A5WA 2ZSIB 3EUHC 2G7HA 3OL3A 5L3GA 2ICWG 1R49A 2NRAC 2LBFB 3FM3A 3MKLA 2BW3A 1YRNA 3BQZA 1FEXA 2L9SA 4ESBA 2K86A 3OYIA 3L9FA 1RRJA 2EFPA 4AIJA 4L5EA 1X4OA 3E5UA 3KFWX 4KJZA 5J8CA 1XSXA 2VODA 2IS6A 1G3SA 3NAUA 3EETA 5HNHA 2DPUA 3OYBA 3H0GJ 3HSRA 2CQ7A 4CZZA 2MD0A 3BZKA 4L9TA 1IXRC 1V5GA 2VBZA 5BS6A 4BBSJ 1X1PA 2JZYA 4RAZA 4C3HJ 1I1SA 2DOAA 3OMYA 4S0HB 3P9CA 3V8LA 2GBYA 3FBNB 4XLCA 2WV1A 4L18B 2ZFWA 3G3ZA 5H2FC 2DFIA 4XLEA 1K7AA 3FXJA 1A36A 1NK3P 3LSRA 3ABMH 3K2AA 4IRGA 3WGHA 3TO6A 1J0RA 5BMZA 3EUKL 1GXQA 1YITI 1GV5A 2YU3A 3F6VA 3T0YA 2L3DA 2ZXHA 1R1TA 2E1OA 2L7FP 4A3FJ 3AAFA 3PO2J 2WY8Q 3PNVA 3GZNB 4KICA 5DM6F 3BR5A 3DKXA 5J6XA 2A6EF 1Y6IA 3ZQGA 3ZQIA 5KHDA 5GPCA 4M3EA 3EYIA 4G6TB 3Q5FA 2AQFA 2P6SA 4A12A 2ID6A 2LTPA 2PMZN 1IG7A 4ZJZA 4BDZA 3R4KA 3DTEA 2GLOA 2XAUA 1SAUA 2J5OA 3HPHA 2BGCA 5FKOA 1JT6A 1MMGA 4M3DA 1EH8A 3CC4I 2MH9A 3CJNA 2LP0A 3BWGA 3FXLA 3H5NA 1Z3YA 3VFZA 2LK2A 3E5QA 3QU3A 4AVPA 3LWFA 4XN3A 3U1KA 3JREA 1Y1WJ 3RKYA 4RA2A 4L0ZB 2M45A 2ZKZA 2X85A 4NC7A 1JI8A 3H5AA 2MFZA 3HIFA 2XKPA 4OAYA 2A05A 2PLYA 2HDCA 4A3IJ 4ZDLA 3ZP5A 3QU6A 5L3EA 3QYEA 2E1NA 3TQNA 2NNYA 4Y52J 2PX9A 1TQIA 2OU2A 2ISZA 1AKHB 1T2KA 1K83J 2Q2EA 2L7ZA 2OPTA 1D1CA 3GUDA 4FASD 2HPMA 2EFOA 1B72B 3OY9A 4RB0A 2KKOA 1DP3A 4WF2A 4NQWB 3KP7A 2EK5A 4HYEA 4F91B 2FD5A 4L9JA 3CLOA 2I10A 2PMHA 3GO5A 3J7ZI 2FXAA 1WCMJ 5ILUA 4RGRA 4M6VA 4A3LJ 1HC8A 1GHCA 1J75A 2DK8A 4KN7X 3HOTA 3W2AA 2A68F 3KP6A 2L0KA 1QZYA 2MSYA 3LSMA 3LSJA 5FD5A 3IUOA 3GWZA 2KJBA 2VASA 3CCSI 1KYZA 3WE2A 2W48A 2LY9A 3C7JA 2CH0A 3P7NA 4GYIA 1UELB 1XPXA 5FFZA 2W00A 2BXYA 3ZQLA 4M3BA 3SZGA 3S16J 2HZTA 3RKQA 4CUGA 4I76A 2E1CA 4M3GA 5CYVA 1T0FC 1IRFA 1PJRA 2DDBA 2ME0A 4HA8A 1ON1A 4M73A 4TV7A 5IYBJ 5GADJ 3AL0B 2ZFUA 3CESA 4N0BA 4BGDA 4U0VA 1K6YA 3IV5A 1HF0A 4E4HA 4XRFA 4NNJA 1B9MA 1UG0A 1OCZH 1T95A 2WB1A 3FHNA 3OYEA 2L7KA 5CVRA 1I27A 1PUFA 1FSHA 1XDUA 4P1WA 4CA0A 4R79A 3K69A 4BYYA 2Z1DA 2BHZA 3U1DA 3CJRB 3L2RA 1MSFC 1MSEC 3I53A 3WG9A 2GXGA 2HKOA 1DUXC 3CJQB 1RUNA 2E71A 1PYVA 1IDZA 1ZN2A 2KJCA 2JJ7A 2KIUA 3SEQA 1SVMA 5J3LA 4QPOA 1O7FA 3TW7A 5EDNA 4M74A 2QSHX 2Z99A 4DOZA 3TEDA 1GXPA 2IS4A 4BJTA 5JLWA 1P4XA 1OYIA 1R4NB 2CS3A 1R7JA 4I99C 2XPVA 1GDTA 4Y3OA 1O3SA 2X4HA 3V4GA 2F48A 3CCQI 1MD0A 1UFMA 1LUJB 2CFXA 3TP0A 2HR3A 3DP7A 3TGNA 1X3ZB 5GAGJ 1TWAJ 1X3UA 2DCEA 3HB9A 5HODA 3BDDA 3OIOA 4GCVA 4P96A 2Z2SB 5H6RA 3QYBA 5M3FJ 5HOOA 3BR0A 3OYFA 4HV5A 1BA5A 3C1DA 3FXOA 3M1CA 1Z7UA 4E6KG 5EG0B 4E7KA 2DA2A 3HC7A 3OS1A 1BOBA 2ELHA 3A01B 3S3MA 3MN2A 2QKMB 4M71A 2HXIA 2DAOA 3MVPA 5FO5A 3G1LA 1Q1VA 4WXHA 1ULYA 3HKZN 1I3AA 2ETHA 3D5LA 3I4PA 1MW7A 1A6QA 2XV4S 3IRRA 2EV5A 4A6EA 3GYHX 3TMOA 2PFBA 1R5ID 2DMNA 3WG7H 2Z9OA 1E3PA 3TKYA 4A3DJ 2OAZA 1P92A 2LSOA 3H92A 2VLAA 2VOPA 2XF7A 2ZJ2A 1WJEA 2LFBA 3RIRA 1H0MA 4O3MA 2XROA 2KIMA 1UCRA 3PIOF 2DMPA 4WXDA 1Y8RB 4J01A 2XHKA 4OINF 3K1PA 3D5RC 2XAGA 4BQOA 1FIAA 1X1CA 5HDNA 1PP8F 2DT7B 3DFGA 4II2A 1MNEA 4OWRB 3RCOA 1NG7A 3RYRA 1UG2A 2LF7A 4ON0A 3K1MA 4ESFA 2IA2A 4UVAA 3KEOA 2M30A 1XS9A 1LJ9A 1JJ6C 5HNFA 2CW8A 2PJRA 1TNTA 3IRQA 2VKEA 2QM3A 1E2XA 1R58A 1OCPA 1D0YA 3G1MA 2KZGA 4JP0A 5ILSA 4U7BA 1Z1DA 1YJWI 2RV8A 1RPWA 4PFOA 2VT3A 4AYBA 4HG2A 3FDYA 3J80K 2RVCA 2EBIA 2OQRA 3RPQA 2M3AA 3K0LA 2GWRA 2MLGA 3H0DA 3WHBA 2IXSA 1EH6A 4G6QA 3NRVA 3BR6A 1S7AA 1TNSA 1C0WA 2O3FA 1ZRDA 1P2FA 3DKYA 3JSOA 3HUGB 3PJRA 4ENKA 5DCMB 2YSRA 3FX3A 2AQEA 1VQ5I 3EDPA 3AL0C 2D45A 1ZK8A 1V54H 3ECHA 2JK3A 4F93B 4UHTA 1ZG5A 4NDLA 2CJJA 3S1QJ 1VQKI 2K85A 1IRXA 4I02A 5D8KB 1RR7A 5JVTA 5IPAA 4UV9A 3WTXC 2E36A 2XAFA 1Y8QB 3REOA 5F0CA 1ZR4A 1R6RA 4FISA 4LIUA 1Q1HA 5E8GA 5L3CA 3FMRA 3SFZA 1KZHA 1K79A 4PDKA 2UXNA 5M5XJ 2EQRA 3QP6A 4V2FA 5H20A 3LMMA 4EEFG 3DF8A 5F27A 9ANTA 2KP6A 4Q47A 1E3OC 3F8MA 4YIRX 4AU7A 1Z77A 1MMSA 4A2UA 2RQPA 2Y30A 1MNMC 4AIDA 3CMAI 2P5LC 5K5OA 1DU6A 2EA4A 3G73A 4CGZA 3OYCA 1W5TA 3H9QA 3LSKA 2KDOA 1WH5A 4B3XA 1EA3A 2O7OA 5EJCA 3HOVJ 1P7JA 1FJLA 1QVUA 2EJRA 3H5RA 3KX2A 2ACJA 3GZ6A 1E0EA 3S1MJ 4DW6A 1TP4A 3IKTA 1BL0A 3H9GA 2DTRA 3CCRI 1JHFA 1D0XA 3S8PA 4OMYA 3KP3A 3RSNA 3VYSB 4A5MA 5ED4A 4B1RA 4RBOA 3PQKA 2R3SA 1YQAA 2JA2A 5B5EC 1Y39A 2VKVA 1YG2A 1FYLA 4FX4A 4KUMA 1Z0XA 3J80Z 3Q0WA 2FNAA 2VJ5A 2A5YB 2O03A 1ZELA 2R7UA 1K4SA 2B7EA 3OR2C 3W3CA 1YX5A 3BR1A 4HF2A 4JBAA 4FTHA 2XRNA 4KDPA 2QKLB 1S7EA 5HVQC 4ENMA 2ID3A 3FF5A 3GCMA 4E70A 4XNFA 4IHSA 1OPCA 3E97A 3V7SA 3DEWA 3M7GA 3OYNA 1K78A 1S5LC 1DPUA 3W2VA 2EZIA 3HOXJ 2KL4A 3Q0UA 2Q1ZB 4IHWA 2NVQJ 2CW7A 2M87A 2HWVA 4G7OF 4XRSA 1U8BA 2E2JJ 2NS7A 2WAEA 4A3GJ 1H89C 4RMNA 1YFHA 5FLVA 2RC4A 1V5FA 4HAMA 3FK7A 4H4KC 1O3TA 3OYMA 2DA4A 4HQMA 3CCVI 2HDWA 1U9OA 3HGYA 4BXFA 4LG0B 2A6HF 2X6XA 3C2HA 5IOZA 2YUSA 5ICEA 2QQ8A 3CCUI 3OWTA 5LHHA 2ZJRF 3F23A 1CF7A 2KPMA 2XSJC 1ETOA 3P9KA 2DT6A 4HDUA 2PI0A 4CCOA 2W57A 3GTKJ 2KMUA 3I56I 3HRMA 1LB2A 2JVGA 1XC5A 5J4YA 4U0WA 3UR3C 3ZMSA 5BPDA 3I4MJ 3O8HA 4RLQA 1D0ZA 3MZHA 2AS5F 2VBWA 4XKWA 2HVSA 3M8FA 3HHHA 5JVGF 2DO7A 2EIKH 3DV8A 4PJLA 1MBFA 2A61A 3M1EA 3J7AY 3DWLE 3CLQA 3R0AA 3BG6A 4PSWA 1S3JA 3IP4B 1CQTA 3JRCA 5AIPA 1HSJA 5HS8A 1G3YA 3NWTA 1X2NA 1QHGA 1VQMI 2KDZA 1FT9A 2BEOA 2JN6A 4DZPA 1OR7A 2FRHA 2VKDA 3NARA 3S3OA 2LG4A 3BJAA 2EV6A 2XASA 4ITVA 2XKOA 3JTGA 1LE8B 1ZRCA 1WWXA 4P9UA 3H36A 5FLMJ 1TZLA 4MQ9F 1YJNI 3LFUA 3FIWA 1LPQA 1AU7A 3M8EA 3V7CA 4GYGA 1J7KA 3LSTA 3LA3A 5FFXA 4I7HA 3BR2A 4DZJA 3BTIA 3LAPA 2BY2A 1R1UA 3LA7A 2Y2ZA 2EINH 5D5VB 2Q8KA 4XR6A 4RGXA 2Y31A 1ETKA 3IKVA 4PZJA 3DPTA 3ZMVA 1ZRFA 2CO5A 2Y75A 4HLYA 4FT8A 4EM1A 3SZPA 4XORA 5LRRA 3VODA 4JX4A 5JI6A 1UHMA 2M1BA 1ACIA 5J4VA 2VQGA 2L5QA 3QODA 5JLXA 3MZYA 1XGMA 5IP9J 2IGMA 1O3RA 5KVRA 3EUHA 1KU7A 4A3JJ 4HNTA 1UHSA 1OCCH 2MC4A 2W1OA 2XSDC 1ZKGA 2XC7A 2B0LA 4M72A 3COAC 5KK1A 4BACA 2GOMA 2ZXWH 4YFNF 1WJ5A 2M0MA 3K10A 3LA2A 1GVDA 2HU9A 4XM3A 3KZZA 3S93A 4UUSA 3BJ6A 3WTTC 2XUBA 5BQTA 4LK1F 3K4NA 2QZ8A 2R5YA 4OIQF 1F9NA 5KCMA 1W36C 4DIQA 5ICFA 2P4WA 3O6BB 1QA6A 3K9TA 2HFHA 3DPUA 4PJNA 4C30A 3UKGA 3FHZA 5HS7A 4I09A 1Z21A 2IP2A 3S2WA 3WTWC 4UUTA 1FBUA 1R5HA 1J59A 1IW7F 5CQGA 2CSOA 4PJMA 3JRBA 4GDFA 2WB1N 1HLVA 2RKHA 2L4MA 2QUFA 4IHTA 1RKTA 3S3NA 4A3BJ 4N4NB 1G8XA 4PJJA 5EGOA 4XKVA 3DTIA 1LKXA 3BROA 2XIGA 3N4MA 1I3QJ 3HTSB 3KPHA 3I59A 1BIAA 2HYGD 1OQYA 1OFCX 2Y0SA 2QBYA 5BPIA 4F7ZA 3BC8A 2ISYA 3GVAA 4D5CA 1W7PA 4D9JA 3KZYA 4ZYHA 3D0SA 1RNLA 3RPUA 3Q3SA 5J8FA 2ESHA 3OSFA 4L5JA 3F8CA 2R5ZB 1MIJA 5CVUA 5K1YA 4IRHA 4EGZA 1KGSA 4G7ZF 2VBXA 5FJ8J 1RZ4A 5DV5A 5LLQA 3LSIA 2RGVA 5BOXA 3T8TA 2E1MB 3FISA 5D5WB 1PVEA 5JHUA 4DQ2A 4IHYA 4XN0A 2QSGX 2VJJA 4YRVA 1XGSA 3ZMDA 5CVIA 2PJPA 1G3WA 2FOKA 1I6HJ 1U5TB 5JR3A 1B9NA 3O2PE 3OL4A 2OF7A 5EEHA 4CCJA 2DU9A 1VFCA 1XG1A 3E6MA 5FGMA 4CCLA 3HRUA 3JRHA 2L9VA 1MJAA 2X48A 2R7OA 4ZH4F 2FBHA 2F5DA 2V79A 3L00A 3S32A 1HA8A 5M5YJ 3A02A 1WGXA 3ESWB 1TLHB 2DA7A 3W6KB 3CDHA 1MH4A 1BR2A 3GZ5A 2QLZA 4HX4A 3VYUB 2HOSA 4BUPA 5K5QA 3BG5A 3WU1B 3ML6A 2F5VA 4A93J 3PL8A 1X3WB 3F6OA 4HX8A 2DA1A 4E7JA 1AA7A 3AG2H 1R71A 2XAHA 1AHDP 2QF7A 1TWHJ 4MFDA 1LQ1A 2TRTA 2CGPA 2QENA 2Y9YA 2ECCA 2Z3YA 4LB6B 1GT0C 1KYWA 2FBIA 5J1RA 1HQCA 4FX0A 5KAFC 4I98B 4G7HF 3ABKH 3OS2A 2E2IJ 2OTJI 1BW5A 3O3KA 4ZYGA 2MA3A 3Q0VA 1Z9CA 2LBFA 2AHQA 4Y13A 2LKSA 1K4TA 4CHUA 1I6XA 2LREA 1OYYA 4AYBN 4NC6A 3GTPJ 3QPSA 3E6BA 4A3EJ 1T0FA 2XAQA 3FMSA 4WXCA 1MMNA 2BY0A 4HBLA 5CVJA 2TCTA 2BVLA 2E7WA 3SDBA 2K9MA 4E7SA 4R1HA 5EZGA 3BPVA 1R36A 1MMAA 3CQZJ 3VSKA 4HDVA 2JSPA 2K02A 4F3QA 4IQ4A 1QHHD 2VJIA 5LRSA 1MDMB 2P0WA 1DQUA 4UB8C 4MQVA 2C6YA 2J5PA 4LLLA 4DYRA 3J7YJ 1QPIA 3MQ0A 2V6EA 2OZ6A 1SFUA 2D5VA 4ASNA 5TISC 3N97A 1A5JA 2ZJQF 1P4AA 5C4JJ 2WV0A 2HYJA 3WU0A 3ZQQA 1SVLA 1JUSA 5AIQA 1ZTRA 2I5UA 3OOUA 3WU2C 2F5EA 4A0ZA 2E2HJ 2V7FA 2EZHA 1VI0A 3QOEA 1G2HA 2FF4A 4W97A 2AXTC 2LRDA 1OJLA 5EYRA 1U0JA 4YFKF 3S15J 4IRIA 3LAJA 2MH2A 3FXRA 5F0FA 2WADA 1IZ1A 2L7MP 4RLFA 1G4DA 2CUZA 2K9QA 2K4JA 1WJAA 4E7HA 1YS6A 4BNCA 3ISPA 2E60A 3RTRA 5HLIA 4A0XA 3CP8A 2P6TA 5HLTA 2IBDA 4K2EA 2HYFA 1B1BA 5DEQA 2A6TA 1A04A 5LEKA 4HF1A 3JR9A 2F5CA 1BJAA 4XLNF 2QQBA 4HNVA 1FYKA 4LLGF 1XB4A 1HDDC 5C4XJ 2VC1A 2M4KA 1YYVA 4OU0A 2BVMA 1HDPA 2HQRA 1BOAA 1YJ9I 4EQQA 5KAIC 5B3SH 2M2EA 4F52A 1WVRA 1IUYA 3MFKA 1IN5A 1JGGA 1MJBA 5JFRA 1KU2A 1S29A 2X1DA 5J1UA 2O8KA 2W4SA 1AKHA 4GXOA 4G6DA 3K6GA 4QSHA 1SFOJ 1JUMA 2ADUA 1B72A 3WGGA 1ZARA 1HW5A 2ZMEB 1T08B 3ERMA 4BEHB 1A6IA 4NQWA 3R6SA 1MKMA 3EPZA 2CQQA 2FEZA 2KFDA 4MO7A 1B8IB 1MBJA 1IXCA 1XSDA 3RQ4A 3LSGA 2VC0A 5C44J 1FYMA 1WH7A 2XGEA 3ZN1A 1S72I 5F0HA 1E3HA 2M7AA 2JPCA 3TDUC 1HW2A 5GAEJ 3GFLA 1FSEA 5HLHA 1WPKA 1ERDA 1UAAA 3A1YA 3I55I 1O4XA 1OCTC 3C2BA 3BG3A 2KZVA 1FZPB 1R5GA 2NXNB 2CRGA 3AG3H 3ERED 1HKTA 1SANA 2DA5A 1XMAA 1TTYA 4FQGA 3P9IA 1YX3A 2RNGA 3CJTB 2VB6A 1QRYA 3KZIC 5J40A 2PEXA 4GGGA 2OBPA 1W5SA 3ASNH 3MMYB 3QQAA 2L54A 3ZGKA 1BC7C 2R7QA 3G1OA 5HDGA 1J5YA 1JJ8C 1FOXA 3V8KA 2VPLA 2IJLA 4F55A 3FK6A 1TT0A 3AFHA 3JSPA 2COBA 4ZDPA 2X6OA 2W25A 5GTHC 2YPRA 2Y9ZA 4IQJA 4BXXJ 2UZKA 1VF9A 2L4AA 3QAHA 3CMMA 3DEEA 4XSZF 5DD8A 2XF5A 3RYPA 4MNUA 4RGSA 2NVUB 5K7FA 2EA2A 2LKPA 4CYDA 3EQLF 1BIBA 1V3FA 4MFEA 4XLHA 1TBXA 3SFIA 2VT2A 3G2BA 2DA3A 3IAS2 3QRFF 1LEBA 2PQ8A 2XGXA 2PBIA 1YIJI 3M9AA 1JTYA 4Y15A 1B4AA 3MWMA 4EJWA 3AG4H 2DJNA 2W84A 3ZXSA 3PNTA 3E6DA 2FMYA 2JSCA 3NQOA 4MLOA 3PSFA 3OYJA 4LLNA 5DD4A 4E7LA 2CV2A 3I4NJ 1X1DA 2LR8A 2V9PA 3CCEI 1T56A 4IOCF 2LF8A 1S7OA 5EG0A 4NHJA 3S2HJ 1QQIA 1IGNA 2BY3A 3IH3A 3OS0A 1NK2P 3A01A 1FY7A 2LYCA 2MLKA 4A69C 4XQFA 3M8JA 4KNYA 5D4RA 3BLYA 4MEYF 4AM3A 1IDYA 1U6GA 4QLCU 1ZGJA 3LNQA 4C2TA 1F36A 5FRNA 2Q0OA 3BQYA 3JAMK 3F21A 2NAZA 4FCYA 4RM3A 1DGRM 1APLC 3PQJA 5F1JA 1ZHFA 2AO9A 1J9IA 1SFKA 4MTEA 4BY7J 4E7IA 5FLXK 3KP2A 3GLLA 4B8XA 2R7VA 4AD9A 4IJAA 3BOQA 4PK4A 3WODF 3ECOA 1X2MA 3GFMA 2NS0A 1KU3A 2WBMA 1LFPA 3CUQB 2CV1A 2HI3A 2XB0X 2HEOA 3FKIJ 4FHTA 3VOEA 3P5JA 3LOCA 4EJUA 2FQ4A 1GLNA 2UUZA 4KMFA 2NVYJ 1BJZA 3DXJF 1H88C 3ABUA 1F4KA 2GIZA 3QOPA 4N4OB 2H09A 3E3VA 2E5NA 2OA4A 1IXSB 3F72A 5E17F 2OUMA 1W0TA 5E1XA 4JYKA 1XGNA 4XRMA 1LFUP 1EJ9A 4X6AJ 1N78A 5KNLA 1V5EA 2QEXI 1K78B 3JTHA 1DDNA 1B59A 2E5ZA 4DGWB 1L3LA 2F4OB 2OJED 4LFUA 4DYCA 4HPQA 1I39A 2KISA 1WRJA 1FBSA 4A0YA 4M9ZA 1IF1A 1H9GA 1T6SA 1XN7A 3HUGA 1BC8C 5DCMA 3RKWA 1G6NA 3KP4A 3QP5A 1ITYA 3HJEA 2Y0SN 5EEGA 1IJWC 1UZCA 3L2UA 3K70C 4BS9A 1XCBA 4RB2C 4ZC3A 1VQPI 1ORKA 2GQQA 3G4SI 2WAQA 2BYVE 2P8TA 3TDZC 3PFYA 1RR8C 1MBGA 1X1BA 1U78A 4G8XA 4I01A 4Q5SF 3A03A 4OMZA 1O3QA 3UNGC 4N9IA 4D7MA 1VQ4I 1RI7A 5LGUA 4DBQA 3WTYC 3I3LA 3JAMZ 1LFBA 2DW4A 3SDGA 4YIFA 1X4PA 2M8GX 1BI1A 3OYDA 2O0YA 3B73A 3KCCA 4BBRJ 3WTSC 4HNUA 2EFNA 3CCMI 5FLXZ 4BE1A 5DTDA 4JX6A 1TT5B 4CYCB 2B63J 1Y0UA 4GFBA 4EATA 2V1XA 3R60A 1IRGA 1XGOA 2DK5A 2QWWA 3TOAA 1W7PD 4CSWA 3PUBA 2X9DA 1P4WA 2OQGA 1NTCA 1GV2A 2CMPA 3H9JA 2R7XA 3IWFA 1U3EM 3FBIB 1WI3A 2X1EA 2QVOA 3ELKA 3L7WA 3PSIA 3BZ6A 3K4LA 3WTUC 2M0CA 2DQLA 2DJIA 3FZVA 4BAYA 2L2OA 3KEYA 3CTAA 4EJOA 1VQ6I 2A07F 2FUG2 2HZDA 4XMYA 1RUOA 4G9YA 4IO9F 4XIDA 5IT3A 4KYWA 3ZQHA 5FROA 2EB7A 3GXOA 3I71A 3L09A 5IT9K 4MHGA 3K4CA 3IH2A 1IV8A 2OZUA 2F2EA 2DQRA 1VQLI 3GF2A 3LL7A 2P5KA 3HZJA 1S9HA 2VL8A 1FWZA 2P7VB 1QU3A 3HBLA 3FM5A 4BHPA 3H1CA 4IVNA 4B44A 1H9TA 3S1NJ 1FMWA 2CUFA 2WC2A 2F4IA 4CZCA 2FJ1A 3F0CA 2Z16A 5GP9A 2KT0A 2L9NA 4OAZA 2VKHA 2BZTA 4C2UA 2H1KA 3A0BC 2FOWA 3JRGA 3HOYJ 1WSUA 1HOMA 1XSVA 3OSGA 5LBQA 1U9NA 1YHQI 4IXAA 3DQVC 3S2DJ 1L0OC 1ON2A 2FE3A 3HHGA 5B1BH 1VQ7I 2UWMA 5TRDA 4BQNA 4JOMA 2DDAA 4A3KJ 4RM2A 2ZCWA 5E20A 4LG0A 1RETA 2K9LA 4HOBA 3SYTA 3T8RA 4KIGA 2GA1A 1T98A 5BNGA 1PDNC 4G12A 4XLPF 3QPLA 3A0HC 4PGHA 4HX7A 1PP7U 3D5SC 4ZZDA 2LNBA 1TC3C 1M1EB 1UHWA 4GRIA 2MGQA 1PUEE 2JA6J 2R4GA 3ULQB 2V9KA 1JT0A 2CG4A 2VI6A 4EM0B 3OR1C 5DUKA 5F64A 2DMUA 2JRTA 2CYYA 2RAEA 5EGOB 4IF4A 3HOSA 2R7ZJ 1JGSA 4AIHA 2P5VA 4BH9A 1XCVA 1V55H 1D3YA 1UJ8A 2XPUA 3G71I 4EGYA 3DU5A 2JUCA 2VBYA 4KN4X 2XAJA 3SQNA 3L2WA 3CZ6A 3CCJI 5LGNA 1W7PB 3BPXA 6PAXA 4UVCA 2PG4A 1OKRA 4BL0B 3L2VA 3VDXA 3W6VA 1TWGJ 2LY2A 2BOLA 4OOIA 2YX7A 5F6FA 1G59A 4IKFA 3HM5A 3T5XA 2ZO4A 2X6WA 4A3MJ 2ZNZA 3PNYA 4IOAF 1LE8A 1FPQA 1OISA 2BW3B 2ESNA 1YRNB 5IT9Z 2WWYA 5CJ9A 3BTLA 2EIJH 2GZWA 1ZR2A 5TJJA 4JQFA 1MH3A 3ABTA 5E8IA 3D1NI 5ICGA 3F9KA 3K4MA 4RAGA 2K4BA 3FXKA 1Z05A 3IH4A 3FKJA 1LNWA 3MCZA 4PUSA 2HTSA 2IRFG 2CV0A 4KISA 3TP3A 2IT0A 2QGUA 2DOEA 1WKMA 4HF0A 4L5IA 4UVBA 5E79C 2ZSHB 2QSFX 3E5XA 3IL2A 1QNTA 2HOTA 3WTVC 3MKZA 4RAYA 4ZYAA 5HLGA 1FX7A 1H8AC 4B47A 4EM2A 3S14J 4ZYDA 1IN8A 3AKZA 2R93J 3W2WA 2F4MB 3RZDJ 5D6FA 1IRZA 1LDJA 1KA8A 4RS8A 5CKTA 2HQAA 3HSEA 4D1QA 1SD5A 1G3TA 1Y1VJ 2K5CA 2XRLA 3KYCB 4FETA 4H0EA 4XLAA 3L2CA 4UV8A 1JUPA 1VTNC 2GOXB 3GTMJ 4WCGA 2M4GA 4U87A 2KRCA 1SFXA 2JTVA 1OYWA 1SD4A 2DMQA 3CMEI 4P55A 2JT1A 4NBQA 2VUMJ 2RQQA 1T33A 2HDDA 2M8EA 3PO3J 2EFQA 3CP2A 3CCYA 2G0EA 2BHYA 4MTDA 1JKQC 3DKWA 4W1UA 4XKBA 3BP8A 3OYLA 4ETSA 4ENJA 5F04A 1S6LA 5FKNA 4B43A 2OV7A 1IV6A 4XLFA 2X0LA 2H1LA 1FBQA 2ECBA 3HEFA 3AG1H 4ESJA 4O6JA 1NHAA 4KA4A 1VZ0A 5CQEA 2W7NA 1N75A 2ELJA 2HKXA 3VYTB 2WTEA 4IEJA 4XL9A 4O5VA 2OCCH 2HPIA 2DFFA 2XDVA 5EZHA 1DGWY 2IEKA 1F5TA 3BR3A 2HGCA 3DPLC 3ZCOA 1XDSA 2ZB9A 5LFAA 2BY1A 2Q2EB 3HDDA 3IAM2 3PUFA 4ZZLA 1TQMA 5E1ZB 3VPRA 5E18F 1YW9A 2GXBA 3C3WA 3KLNA 3DTKA 2R5ZA 1SMTA 2HNHA 2P81A 4EVIA 3DCFA 3FXUA 1F1ZA 1BI3A 5FD6A 1S8NA 4MGRA 4IHXA 2O5RA 3EUAA 4OIRF 2O8XA 3L2QA 3DBHB 1DP7P 3ZN0A 2CFOA 2IGKA 1QZZA 3HOUJ 3VSLA 4BDYA 5GTIC 3FMQA 3K2ZA 3GMEA 2CQNA 2JPBA 2HTJA 2V9VA 3U2RA 5F1RA 3PIPF 3BY6A 3CUOA 4U0YA 4YELA 3QPTA 2JA7J 3ROUA 2STWA 1FTTA 1U5TA 1ZYRF 2Y48A 3OYAA 1HCRA 2H27A 3SHFA 5A2QK 2NS8A 2HXOA 1NH3A 4RB1A 1N25A 4N9HA 2P7CB 2QYOA 1BI0A 2FU4A 1BBYA 2GIVA 1JKPC 1W0UA 3RQIA 2IPQX 5H6QA 4BJ6C 3SJMA 1J09A 3IWZA 2GAUA 4Y33A 2MG4A 1D1BA 2PMUA 2RNJA 2DYRH 2L01A 4OIPF 3K4KA 1FLIA 4XOPA 5E3OA 1PUFB 5TGTA 1ZLJA 2JUGA 4NUBA 2D1HA 1ZH5A 2ZXJA 3E0JB 3CO7C 1WZ2A 4P9FA 3HOZJ 4XRSG 2VE9A 3GTOJ 2MW8A 1D8JA 2E19A 1R22A 4WK8F 2K27A 4QIWN 2EZKA 1SMYF 4BQAA 4BU2A 2RN7A 4BHBA 2EIMH 5K5RA 4AVZA 3ONQA 3HTUA 4DYQA 2V1UA 2K40A 2LLKA 3K70D 1QPMA 1BI2A 1FOYA 2BE5F 2O6GE 1JKRC 1RIOH 1X58A 4PGGA 3VB2A 1BW6A 5ILVA 1J2XA 3CD6I 5LD2C 3I54A 2BV6A 2E1MC 1HKSA 2QQ9A 5DM7F 5LHGA 4V2GA 1ZLKA 1IC8A 2FMLA 1YLFA 4QWQA 1ZGWA 3WE3A 3HPGA 2MYSA 4Q4ZF 2DPDA 2JA5J 4LB5A 1XX5A 3L1PA 2H8RA 4KT6A 1X19A 4B4CA 2CQKA 3WGIA 3HSFA 5DYMA 2JQ7A 1ETXA 1U5TC 1VNDA 2DYSH 1MDMA 1E17A 1ETYA 4E7ZA 2IA0A 3T1BA 3GTQJ 5L3FA 2EV0A 2IS1A 1W1WE 3ZQCA 4NB5A 2DN0A 1U8RA 1U2WA 4U7DA 2ZXIA 4XONA 3VWBA 1T8IA 2CWEA 3ZPLA 1BM9A 2WAQN 3ZQFA 1HXDA 3KE2A 2R0QC 1JTXA 4U88A 2UXXA 3GW2A 1TWCJ 3A2KA 1R9TJ 4ZTFA 1FP1D 4ENNA 1UMQA 4C2MJ 1Z6TA 2CUJA 4I0BA 5A2QZ 1LVKA 3OOPA 2LOOA 5M3MJ 2UV1A 1W4MA 2AXLA 5E3MA 3N05A 2EH3A 3F8FA 4CH7A 1QVTA 2HOEA 2R7WA 3VYRB 3BJOA 1USTA 3J7AO 4HSRA 3TO7A 4AUXA 4EJVA 1T38A 1Z67A 3BG9A 3HYIA 3S1RJ 1V4RA 2LD5A 3JRFA 5J1YA 5FB2A 3HRTA 1YTYA 5IYDJ 2PJRB 1HW1A 1EKEA 1RKWA 3BT9A 5D5UB 4LK0F 3B02A 4CDGA 2DTZA 4P5OA 2JRMA 1TW3A 5DDGA 4B3AA 1VQNI 1KONA 2BBYA 2LDUA 1YO5C 2VN2A 1P7IA 2E34A 1MMDA 5IYCJ 1IO2A 1YOVB 2LC2A 2COMA 2HQ5A 5F08A 3LQQA 4AIKA 2ELKA 2NVTJ 5CLSA 3M07A 1B6AA 4BHCA 3DBRB 1YS7A 4MIMA 3KP5A 3HG9A 1RC9A 3LFKA 4C3JJ 3I58A 4KIBA 1UB9A 3KYLA 2MABA 4BKXA 3O8GA 2ZMEA 4BEHA 2MD5A 4ZYEA 2CU7A 3K7AJ 4X0GA 3DU6A 3ZMTA 4HLXA 1GVJA 3OYHA 2KIFA 3QWLA 2ZC2A 4FE7A 4LJZF 5D6EA 1B8IA 4UB6C 2QQAA 3CDIA 1ETQA 3HRSA 4IHVA 3MAJA 2YS9A 1Y0NA 2O9LA 5HS9A 1IN7A 4IPAA 2STTA 3NWSA 1YE9A 4PFPA 3ABLH 2L9RA 2I8DA 1FC3A 1R00A 1FMVA 3KYDB 1SD7A 2B9SA 3RI4A 1ZQ3P 2D2WA 3CF2A 2IW5A 2DFEA 3V7RA 2K7LA 1SEUA 3ZQ7A 3BCBA 3MKWB 1WFXA 2PMZA 1QBJA 5LHIA 2KRHA 1FOKA 3RZOJ 3EYYA
chains in the Genus database with same CATH topology
4JK1X 1AOYA 4G94A 3KLOA 3RDIA 3F8BA 2EFWA 1REPC 2G7UA 1LVAA 4LMYA 2VXZA 1ZREA 3NEUA 4Q48A 1KU9A 1WQ2A 5DCFA 1YIOA 1AWCA 2H94A 2FA5A 4YG2F 2DBBA 2M5WA 3PFIA 4CICA 3KEQA 1EV7A 1XMKA 2KRFA 4YIIA 1SD6A 2W24A 4LGWA 1QGPA 1QO0D 1O7LA 2G9WA 2FQ3A 2F5FA 2RDPA 1LDKB 2A69F 1XD7A 2HQNA 5DUIA 4KMUX 5ICCA 1IN4A 2VE8A 3I0TA 4BXUA 3RJPA 4S04A 3GFIA 4HW0A 1Z6RA 3GLXA 4A6DA 2ZBKA 4M6YA 3U9GA 4YFXF 3IHUA 4D0PA 1ZAOA 3Q9VA 3GX4X 1CF7B 4LD5A 5L3DA 4UNOA 1KQ8A 2D1VA 4UUVA 3I64A 1WI9A 3CUQA 1TW2A 4L0YB 3GFJA 3KETA 4XSXF 1SFEA 2IVMA 2YX4A 3R0JA 4KT5C 2YR2A 3JW4A 2MC3A 2DI3A 3F22A 3W6JB 1ODDA 2NNNA 4L9NA 3I5UA 4Z2YA 1T39A 5LEJA 3FXQA 2R7FA 4I0AA 2E7XA 2W85A 2L02A 3H3ZA 4HZFA 3C18A 4CO8A 2A3SA 1I1GA 4KFCA 1P6RA 4L9VA 4B09A 3E6CC 1I5ZA 4AWXB 3QPHA 3F8NA 4MEXF 2ZNYA 2GA2A 2Y0MA 3R61A 1KQ0A 2CW0F 1Z91A 1CGPA 5HDKA 2NYXA 1MZBA 3ZMZA 3CUQC 3WTZA 1EH7A 3ZMUA 2EWNA 2FBKA 1STZA 2FNPA 3J81K 1YW7A 2H6CA 4M6XA 1HBXG 1YW8A 2FSWA 1LDDA 2DLLA 4WX9A 1JXSA 1IN6A 5D4SA 2VONA 1JHHA 1HSTA 2XVCA 4PCQA 3FWEA 3H3UA 1LEAA 4EV0A 1O57A 4DNCA 3K1NA 4EJTA 1D5VA 4HQEA 1ZG1A 4Y17A 2HS5A 1FNNA 3VEPA 3I59B 2QBYB 4A5NA 5L3BA 3LQRA 3RKXA 1ZGAA 5LGTA 4R8HA 1DPRA 2O61A 4KIFA 3DEUA 1BN5A 1USSA 1MJ9A 4XBFA 4CXFA 1K6OA 1ONVA 1JE8A 1D8KA 5AONA 3CO6C 2OD5A 2IA1A 3F3XA 5D5XB 4RGUA 3Q9SA 3MEXA 2V1DA 2R7DA 4EMSA 3TOBA 2Z5UA 1TQPA 4I2OA 4UXNA 3J81Z 2H6BA 4RB3C 1ZG3A 2V6CA 4M9XA 1OMIA 1KQ9A 1MGTA 3V8JA 4M9SA 4OIOF 5ERIA 4WWCA 1R23A 3GEZA 2MBFA 1FP2A 3TO9A 3SZTA 3OV8A 5E1WA 2Z33A 2PN6A 2VOOA 4HV6A 1R1VA 2DT5A 4GO1A 2TDXA 4S05A 1IAWA 3SXYA 3IC7A 1SAXA 1HKQA 5D8LB 2G7HA 5L3GA 2NRAC 3FM3A 4ESBA 2K86A 3L9FA 4AIJA 2EFPA 3E5UA 3KFWX 5J8CA 1XSXA 2VODA 1G3SA 3EETA 2DPUA 3HSRA 4CZZA 4L9TA 1IXRC 2VBZA 5BS6A 2JZYA 4RAZA 1I1SA 3P9CA 3V8LA 4L18B 2ZFWA 3G3ZA 2DFIA 1K7AA 4IRGA 3WGHA 3TO6A 1J0RA 5BMZA 1GXQA 2YU3A 3F6VA 3T0YA 2L3DA 1R1TA 3AAFA 4KICA 5J6XA 2A6EF 3EYIA 3Q5FA 2P6SA 4A12A 3R4KA 2J5OA 2BGCA 1EH8A 2MH9A 3CJNA 3VFZA 3BWGA 3E5QA 3QU3A 4AVPA 3LWFA 3RKYA 4L0ZB 2M45A 2ZKZA 3HIFA 2XKPA 2PLYA 2HDCA 3ZP5A 3QU6A 5L3EA 2NNYA 2E1NA 3TQNA 1TQIA 2OU2A 2ISZA 1T2KA 2Q2EA 3GUDA 2EFOA 4RB0A 2KKOA 4WF2A 3KP7A 2EK5A 4HYEA 4L9JA 2PMHA 3CLOA 3GO5A 2FXAA 5ILUA 4RGRA 1GHCA 1J75A 2DK8A 4KN7X 3HOTA 2A68F 3KP6A 1QZYA 5FD5A 3GWZA 2KJBA 1KYZA 3WE2A 3C7JA 3P7NA 4GYIA 5FFZA 2HZTA 2E1CA 5CYVA 1IRFA 4HA8A 1ON1A 4M73A 4TV7A 4N0BA 4U0VA 4XRFA 1B9MA 5CVRA 1I27A 1FSHA 1XDUA 4R79A 3K69A 4BYYA 3U1DA 3I53A 3WG9A 2GXGA 2HKOA 1DUXC 1RUNA 1ZN2A 2KJCA 2KIUA 1O7FA 4M74A 2Z99A 1GXPA 1P4XA 1OYIA 1R7JA 1O3SA 2X4HA 3V4GA 1MD0A 1UFMA 2CFXA 2HR3A 3DP7A 3TGNA 1X3UA 3BDDA 4GCVA 4P96A 5H6RA 5HOOA 4HV5A 3C1DA 1Z7UA 2ELHA 4M71A 2DAOA 5FO5A 4WXHA 1ULYA 2ETHA 3D5LA 3I4PA 2XV4S 2EV5A 4A6EA 3GYHX 2PFBA 2Z9OA 3TKYA 2OAZA 1P92A 2LSOA 3H92A 2VOPA 2ZJ2A 3RIRA 1H0MA 4O3MA 2XROA 2KIMA 1UCRA 4WXDA 2XHKA 4OINF 3K1PA 2XAGA 5HDNA 1PP8F 3DFGA 3RYRA 2LF7A 4ON0A 3K1MA 4ESFA 2IA2A 4UVAA 3KEOA 2M30A 1LJ9A 1TNTA 3IRQA 2QM3A 1E2XA 1R58A 5ILSA 4U7BA 1Z1DA 2RV8A 2VT3A 3J80K 2RVCA 2OQRA 3RPQA 3K0LA 2GWRA 2MLGA 1EH6A 4G6QA 3NRVA 1S7AA 1TNSA 1C0WA 2O3FA 1ZRDA 1P2FA 3JSOA 4ENKA 5DCMB 2YSRA 3FX3A 3EDPA 2D45A 3ECHA 4UHTA 1ZG5A 4I02A 5D8KB 5JVTA 4UV9A 3WTXC 2XAFA 3REOA 1Q1HA 5E8GA 5L3CA 3FMRA 3SFZA 1K79A 4PDKA 2UXNA 3QP6A 5H20A 3DF8A 4Q47A 3F8MA 4A2UA 2RQPA 2P5LC 5K5OA 2EA4A 3G73A 4CGZA 1W5TA 2EJRA 2ACJA 3GZ6A 3IKTA 2DTRA 1JHFA 4OMYA 3KP3A 4A5MA 5ED4A 3PQKA 2R3SA 1YQAA 1FYLA 1YG2A 4FX4A 4KUMA 3J80Z 2FNAA 2A5YB 2O03A 4HF2A 4JBAA 2XRNA 4KDPA 5HVQC 4ENMA 3FF5A 4IHSA 4E70A 1OPCA 3E97A 3V7SA 3M7GA 1K78A 1DPUA 2M87A 2HWVA 4G7OF 1YFHA 2RC4A 4HAMA 1O3TA 4HQMA 4LG0B 2A6HF 5ICEA 5LHHA 3F23A 1CF7A 3P9KA 4HDUA 2PI0A 2W57A 1LB2A 3HRMA 4U0WA 3ZMSA 5BPDA 3MZHA 2AS5F 2VBWA 3M8FA 3HHHA 2DO7A 3DV8A 2A61A 3M1EA 3R0AA 1S3JA 5AIPA 1HSJA 5HS8A 1G3YA 1FT9A 2BEOA 1OR7A 2FRHA 3BJAA 2EV6A 2XASA 2XKOA 3JTGA 1ZRCA 1WWXA 4P9UA 4MQ9F 3M8EA 3V7CA 4GYGA 1J7KA 3LSTA 3LA3A 5FFXA 4I7HA 3LAPA 1R1UA 3LA7A 5D5VB 2Q8KA 4RGXA 4PZJA 3IKVA 3DPTA 3ZMVA 1ZRFA 2CO5A 2Y75A 4HLYA 4FT8A 4EM1A 3SZPA 5LRRA 3VODA 5JI6A 1UHMA 2M1BA 3MZYA 1XGMA 1O3RA 5KVRA 3EUHA 1KU7A 2B0LA 4M72A 3COAC 5KK1A 4YFNF 3LA2A 3KZZA 3BJ6A 3WTTC 2XUBA 5BQTA 4LK1F 2QZ8A 4OIQF 1F9NA 5ICFA 2P4WA 3O6BB 3K9TA 2HFHA 3FHZA 5HS7A 4I09A 2IP2A 3S2WA 3WTWC 1FBUA 1R5HA 1J59A 1IW7F 2CSOA 2RKHA 2L4MA 2QUFA 4IHTA 3BROA 2XIGA 3N4MA 3HTSB 3I59A 1BIAA 2HYGD 2QBYA 5BPIA 4F7ZA 2ISYA 3GVAA 1W7PA 3KZYA 4ZYHA 3D0SA 1RNLA 3RPUA 5J8FA 2ESHA 4L5JA 3F8CA 5CVUA 5K1YA 4IRHA 4EGZA 1KGSA 4G7ZF 2VBXA 1RZ4A 5DV5A 5LLQA 2RGVA 5BOXA 3T8TA 5D5WB 5JHUA 4DQ2A 1XGSA 3ZMDA 5CVIA 2PJPA 1G3WA 2FOKA 1U5TB 5JR3A 1B9NA 3O2PE 5EEHA 2DU9A 3E6MA 5FGMA 3HRUA 1MJAA 4ZH4F 2FBHA 2F5DA 2V79A 3L00A 3W6KB 1TLHB 3CDHA 3GZ5A 2QLZA 4HX4A 5K5QA 3WU1B 3ML6A 3F6OA 4HX8A 2XAHA 1LQ1A 2CGPA 2QENA 2Z3YA 4LB6B 1KYWA 2FBIA 1HQCA 4FX0A 4I98B 4G7HF 3O3KA 4ZYGA 2MA3A 1Z9CA 4Y13A 4CHUA 1I6XA 1OYYA 3E6BA 1T0FA 2XAQA 3FMSA 4WXCA 4HBLA 5CVJA 2E7WA 4R1HA 3BPVA 1R36A 4HDVA 2K02A 5LRSA 1MDMB 2C6YA 4MQVA 2J5PA 4LLLA 3MQ0A 2OZ6A 1SFUA 4ASNA 3N97A 1P4AA 2WV0A 3WU0A 5AIQA 2F5EA 4A0ZA 2FF4A 4YFKF 4IRIA 3LAJA 2MH2A 3FXRA 1IZ1A 1G4DA 2K4JA 1YS6A 4BNCA 3ISPA 3RTRA 5HLIA 4A0XA 2P6TA 4K2EA 2HYFA 1B1BA 5DEQA 1A04A 5LEKA 4HF1A 2F5CA 1BJAA 4XLNF 2QQBA 1FYKA 4LLGF 1XB4A 2VC1A 1YYVA 4OU0A 2HQRA 1BOAA 4EQQA 1IUYA 3MFKA 1IN5A 1MJBA 5JFRA 1KU2A 1S29A 4GXOA 4G6DA 2ADUA 3WGGA 1ZARA 1HW5A 2ZMEB 4NQWA 3R6SA 1MKMA 2FEZA 1XSDA 1IXCA 2VC0A 1FYMA 3ZN1A 2JPCA 3TDUC 1HW2A 3GFLA 1FSEA 5HLHA 3EYYA 1FZPB 1R5GA 3ERED 1HKTA 1XMAA 1TTYA 3P9IA 2PEXA 4GGGA 2OBPA 1W5SA 2L54A 1BC7C 5HDGA 1J5YA 3V8KA 2IJLA 3JSPA 2W25A 2YPRA 2UZKA 3QAHA 2L4AA 4XSZF 5DD8A 3RYPA 4MNUA 4RGSA 2EA2A 2LKPA 4CYDA 3EQLF 1BIBA 1V3FA 1TBXA 2VT2A 3QRFF 1LEBA 2PQ8A 2XGXA 2PBIA 3M9AA 4Y15A 1B4AA 3MWMA 4EJWA 2W84A 3E6DA 2FMYA 2JSCA 3NQOA 4LLNA 5DD4A 2LF8A 1S7OA 4NHJA 1QQIA 1FY7A 4KNYA 2MLKA 5D4RA 4MEYF 1U6GA 4QLCU 1ZGJA 2Q0OA 3JAMK 3F21A 2NAZA 3PQJA 1ZHFA 1J9IA 4MTEA 5FLXK 3KP2A 4B8XA 4AD9A 4IJAA 3BOQA 3WODF 3ECOA 3GFMA 2NS0A 1KU3A 3CUQB 2HEOA 4FHTA 3VOEA 4EJUA 4KMFA 3DXJF 3ABUA 1F4KA 3QOPA 2H09A 3E3VA 2OA4A 1IXSB 3F72A 5E17F 5E1XA 1XGNA 1K78B 3JTHA 1DDNA 1B59A 1L3LA 4LFUA 1WRJA 1FBSA 4A0YA 4M9ZA 1IF1A 1H9GA 1T6SA 1XN7A 3HUGA 1BC8C 5DCMA 3RKWA 1G6NA 3KP4A 3QP5A 5EEGA 1XCBA 4RB2C 2GQQA 2BYVE 2P8TA 3TDZC 1U78A 4G8XA 4I01A 4Q5SF 4OMZA 1O3QA 4N9IA 1RI7A 5LGUA 3WTYC 3JAMZ 2DW4A 4YIFA 1BI1A 2O0YA 3B73A 3KCCA 3WTSC 2EFNA 5FLXZ 1Y0UA 2V1XA 3R60A 1IRGA 1XGOA 2DK5A 2QWWA 3TOAA 1W7PD 1P4WA 2OQGA 3IWFA 1U3EM 2QVOA 3ELKA 3L7WA 3BZ6A 3WTUC 2DQLA 3FZVA 4BAYA 3CTAA 4EJOA 2A07F 1RUOA 4G9YA 5IT3A 4KYWA 2EB7A 3GXOA 3I71A 3L09A 5IT9K 4MHGA 2OZUA 2F2EA 2DQRA 3GF2A 2P5KA 1FWZA 2P7VB 3FM5A 4BHPA 4IVNA 1H9TA 2WC2A 1WSUA 1XSVA 5LBQA 4IXAA 3DQVC 1L0OC 1ON2A 2FE3A 3HHGA 2UWMA 5TRDA 2ZCWA 5E20A 4LG0A 4HOBA 3T8RA 4KIGA 2GA1A 1T98A 1PDNC 4XLPF 4PGHA 4HX7A 1PP7U 4ZZDA 2LNBA 1UHWA 1PUEE 3ULQB 2CG4A 4EM0B 5DUKA 5F64A 2JRTA 2CYYA 3HOSA 4IF4A 1JGSA 4AIHA 2P5VA 4BH9A 1XCVA 1D3YA 4EGYA 2VBYA 4KN4X 2XAJA 3SQNA 5LGNA 1W7PB 3BPXA 6PAXA 4UVCA 2PG4A 1OKRA 4OOIA 2YX7A 5F6FA 3T5XA 2ZO4A 2ZNZA 1FPQA 5IT9Z 2ESNA 2WWYA 5CJ9A 2GZWA 5TJJA 4JQFA 3ABTA 5E8IA 5ICGA 2K4BA 1Z05A 1LNWA 3MCZA 2HTSA 2IRFG 2IT0A 1WKMA 4HF0A 4L5IA 4UVBA 3IL2A 3E5XA 1QNTA 3WTVC 4RAYA 5HLGA 1FX7A 4EM2A 4ZYDA 1IN8A 5D6FA 1LDJA 1KA8A 4RS8A 3HSEA 1SD5A 1G3TA 4H0EA 3L2CA 4UV8A 1VTNC 4WCGA 1SFXA 2JTVA 1OYWA 1SD4A 4P55A 2JT1A 2M8EA 2EFQA 4MTDA 3DKWA 3BP8A 4ETSA 4ENJA 1S6LA 2X0LA 1FBQA 4ESJA 4O6JA 1NHAA 4KA4A 2HKXA 2WTEA 4O5VA 1F5TA 2HGCA 3DPLC 1XDSA 4ZZLA 1TQMA 5E1ZB 5E18F 1YW9A 2GXBA 3C3WA 3KLNA 1SMTA 4EVIA 3FXUA 1F1ZA 1BI3A 5FD6A 1S8NA 4MGRA 4OIRF 2O8XA 1DP7P 3ZN0A 1QZZA 3FMQA 3K2ZA 2JPBA 2HTJA 2V9VA 3U2RA 5F1RA 3BY6A 3CUOA 4U0YA 3QPTA 3ROUA 2STWA 1U5TA 1ZYRF 2Y48A 2H27A 3SHFA 5A2QK 4RB1A 4N9HA 2P7CB 2QYOA 1BI0A 2FU4A 1BBYA 2GIVA 2IPQX 5H6QA 3IWZA 2GAUA 2PMUA 2RNJA 2L01A 4OIPF 1FLIA 1ZLJA 2D1HA 1ZH5A 2ZXJA 3CO7C 4P9FA 2VE9A 1D8JA 1R22A 4WK8F 2K27A 1SMYF 4BQAA 2RN7A 4BHBA 5K5RA 3HTUA 2V1UA 1QPMA 1BI2A 2BE5F 2O6GE 1RIOH 4PGGA 3VB2A 5ILVA 1J2XA 3I54A 2BV6A 1HKSA 2QQ9A 5LHGA 1ZLKA 2FMLA 1YLFA 4QWQA 3WE3A 4Q4ZF 2DPDA 4LB5A 3WGIA 2CQKA 3HSFA 5DYMA 1E17A 1U5TC 1MDMA 2IA0A 3T1BA 5L3FA 2EV0A 4NB5A 1U8RA 1U2WA 4U7DA 2CWEA 3ZPLA 1BM9A 1HXDA 3KE2A 4U88A 2UXXA 3GW2A 1FP1D 4ENNA 1Z6TA 4I0BA 5A2QZ 3OOPA 1W4MA 2AXLA 3F8FA 2HOEA 3BJOA 1USTA 3J7AO 3TO7A 4EJVA 1T38A 3HYIA 1V4RA 5FB2A 3HRTA 1YTYA 1HW1A 5D5UB 4LK0F 3B02A 4CDGA 5DDGA 4P5OA 1TW3A 2BBYA 2LDUA 1YO5C 2VN2A 2COMA 3LQQA 4AIKA 5CLSA 1B6AA 4BHCA 1YS7A 3KP5A 3LFKA 3I58A 4KIBA 1UB9A 2ZMEA 2MD5A 4ZYEA 3ZMTA 4HLXA 1GVJA 2KIFA 4LJZF 5D6EA 2QQAA 3HRSA 3MAJA 5HS9A 1IN7A 4IPAA 2STTA 1FC3A 1R00A 1SD7A 3RI4A 2D2WA 2IW5A 3V7RA 2K7LA 3ZQ7A 1QBJA 5LHIA 3IRRA 1FOKA 5CVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 X;  1AOY A;  4G94 A;  3KLO A;  3RDI A;  3F8B A;  2EFW A;  1REP C;  2G7U A;  1LVA A;  4LMY A;  2VXZ A;  1ZRE A;  3NEU A;  4Q48 A;  1KU9 A;  1WQ2 A;  5DCF A;  1YIO A;  1AWC A;  2H94 A;  2FA5 A;  4YG2 F;  2DBB A;  2M5W A;  3PFI A;  4CIC A;  3KEQ A;  1EV7 A;  1XMK A;  2KRF A;  4YII A;  1SD6 A;  2W24 A;  4LGW A;  1QGP A;  1QO0 D;  1O7L A;  2G9W A;  2FQ3 A;  2F5F A;  2RDP A;  1LDK B;  2A69 F;  1XD7 A;  2HQN A;  5DUI A;  4KMU X;  5ICC A;  1IN4 A;  2VE8 A;  3I0T A;  4BXU A;  3RJP A;  4S04 A;  3GFI A;  4HW0 A;  1Z6R A;  3GLX A;  4A6D A;  2ZBK A;  4M6Y A;  3U9G A;  4YFX F;  3IHU A;  4D0P A;  1ZAO A;  3Q9V A;  3GX4 X;  1CF7 B;  4LD5 A;  5L3D A;  4UNO A;  1KQ8 A;  2D1V A;  4UUV A;  3I64 A;  1WI9 A;  3CUQ A;  1TW2 A;  4L0Y B;  3GFJ A;  3KET A;  4XSX F;  1SFE A;  2IVM A;  2YX4 A;  3R0J A;  4KT5 C;  2YR2 A;  3JW4 A;  2MC3 A;  2DI3 A;  3F22 A;  3W6J B;  1ODD A;  2NNN A;  4L9N A;  3I5U A;  4Z2Y A;  1T39 A;  5LEJ A;  3FXQ A;  2R7F A;  4I0A A;  2E7X A;  2W85 A;  2L02 A;  3H3Z A;  4HZF A;  3C18 A;  4CO8 A;  2A3S A;  1I1G A;  4KFC A;  1P6R A;  4L9V A;  4B09 A;  3E6C C;  1I5Z A;  4AWX B;  3QPH A;  3F8N A;  4MEX F;  2ZNY A;  2GA2 A;  2Y0M A;  3R61 A;  1KQ0 A;  2CW0 F;  1Z91 A;  1CGP A;  5HDK A;  2NYX A;  1MZB A;  3ZMZ A;  3CUQ C;  3WTZ A;  1EH7 A;  3ZMU A;  2EWN A;  2FBK A;  1STZ A;  2FNP A;  3J81 K;  1YW7 A;  2H6C A;  4M6X A;  1HBX G;  1YW8 A;  2FSW A;  1LDD A;  2DLL A;  4WX9 A;  1JXS A;  1IN6 A;  5D4S A;  2VON A;  1JHH A;  1HST A;  2XVC A;  4PCQ A;  3FWE A;  3H3U A;  1LEA A;  4EV0 A;  1O57 A;  4DNC A;  3K1N A;  4EJT A;  1D5V A;  4HQE A;  1ZG1 A;  4Y17 A;  2HS5 A;  1FNN A;  3VEP A;  3I59 B;  2QBY B;  4A5N A;  5L3B A;  3LQR A;  3RKX A;  1ZGA A;  5LGT A;  4R8H A;  1DPR A;  2O61 A;  4KIF A;  3DEU A;  1BN5 A;  1USS A;  1MJ9 A;  4XBF A;  4CXF A;  1K6O A;  1ONV A;  1JE8 A;  1D8K A;  5AON A;  3CO6 C;  2OD5 A;  2IA1 A;  3F3X A;  5D5X B;  4RGU A;  3Q9S A;  3MEX A;  2V1D A;  2R7D A;  4EMS A;  3TOB A;  2Z5U A;  1TQP A;  4I2O A;  4UXN A;  3J81 Z;  2H6B A;  4RB3 C;  1ZG3 A;  2V6C A;  4M9X A;  1OMI A;  1KQ9 A;  1MGT A;  3V8J A;  4M9S A;  4OIO F;  5ERI A;  4WWC A;  1R23 A;  3GEZ A;  2MBF A;  1FP2 A;  3TO9 A;  3SZT A;  3OV8 A;  5E1W A;  2Z33 A;  2PN6 A;  2VOO A;  4HV6 A;  1R1V A;  2DT5 A;  4GO1 A;  2TDX A;  4S05 A;  1IAW A;  3SXY A;  3IC7 A;  1SAX A;  1HKQ A;  5D8L B;  2G7H A;  5L3G A;  2NRA C;  3FM3 A;  4ESB A;  2K86 A;  3L9F A;  4AIJ A;  2EFP A;  3E5U A;  3KFW X;  5J8C A;  1XSX A;  2VOD A;  1G3S A;  3EET A;  2DPU A;  3HSR A;  4CZZ A;  4L9T A;  1IXR C;  2VBZ A;  5BS6 A;  2JZY A;  4RAZ A;  1I1S A;  3P9C A;  3V8L A;  4L18 B;  2ZFW A;  3G3Z A;  2DFI A;  1K7A A;  4IRG A;  3WGH A;  3TO6 A;  1J0R A;  5BMZ A;  1GXQ A;  2YU3 A;  3F6V A;  3T0Y A;  2L3D A;  1R1T A;  3AAF A;  4KIC A;  5J6X A;  2A6E F;  3EYI A;  3Q5F A;  2P6S A;  4A12 A;  3R4K A;  2J5O A;  2BGC A;  1EH8 A;  2MH9 A;  3CJN A;  3VFZ A;  3BWG A;  3E5Q A;  3QU3 A;  4AVP A;  3LWF A;  3RKY A;  4L0Z B;  2M45 A;  2ZKZ A;  3HIF A;  2XKP A;  2PLY A;  2HDC A;  3ZP5 A;  3QU6 A;  5L3E A;  2NNY A;  2E1N A;  3TQN A;  1TQI A;  2OU2 A;  2ISZ A;  1T2K A;  2Q2E A;  3GUD A;  2EFO A;  4RB0 A;  2KKO A;  4WF2 A;  3KP7 A;  2EK5 A;  4HYE A;  4L9J A;  2PMH A;  3CLO A;  3GO5 A;  2FXA A;  5ILU A;  4RGR A;  1GHC A;  1J75 A;  2DK8 A;  4KN7 X;  3HOT A;  2A68 F;  3KP6 A;  1QZY A;  5FD5 A;  3GWZ A;  2KJB A;  1KYZ A;  3WE2 A;  3C7J A;  3P7N A;  4GYI A;  5FFZ A;  2HZT A;  2E1C A;  5CYV A;  1IRF A;  4HA8 A;  1ON1 A;  4M73 A;  4TV7 A;  4N0B A;  4U0V A;  4XRF A;  1B9M A;  5CVR A;  1I27 A;  1FSH A;  1XDU A;  4R79 A;  3K69 A;  4BYY A;  3U1D A;  3I53 A;  3WG9 A;  2GXG A;  2HKO A;  1DUX C;  1RUN A;  1ZN2 A;  2KJC A;  2KIU A;  1O7F A;  4M74 A;  2Z99 A;  1GXP A;  1P4X A;  1OYI A;  1R7J A;  1O3S A;  2X4H A;  3V4G A;  1MD0 A;  1UFM A;  2CFX A;  2HR3 A;  3DP7 A;  3TGN A;  1X3U A;  3BDD A;  4GCV A;  4P96 A;  5H6R A;  5HOO A;  4HV5 A;  3C1D A;  1Z7U A;  2ELH A;  4M71 A;  2DAO A;  5FO5 A;  4WXH A;  1ULY A;  2ETH A;  3D5L A;  3I4P A;  2XV4 S;  2EV5 A;  4A6E A;  3GYH X;  2PFB A;  2Z9O A;  3TKY A;  2OAZ A;  1P92 A;  2LSO A;  3H92 A;  2VOP A;  2ZJ2 A;  3RIR A;  1H0M A;  4O3M A;  2XRO A;  2KIM A;  1UCR A;  4WXD A;  2XHK A;  4OIN F;  3K1P A;  2XAG A;  5HDN A;  1PP8 F;  3DFG A;  3RYR A;  2LF7 A;  4ON0 A;  3K1M A;  4ESF A;  2IA2 A;  4UVA A;  3KEO A;  2M30 A;  1LJ9 A;  1TNT A;  3IRQ A;  2QM3 A;  1E2X A;  1R58 A;  5ILS A;  4U7B A;  1Z1D A;  2RV8 A;  2VT3 A;  3J80 K;  2RVC A;  2OQR A;  3RPQ A;  3K0L A;  2GWR A;  2MLG A;  1EH6 A;  4G6Q A;  3NRV A;  1S7A A;  1TNS A;  1C0W A;  2O3F A;  1ZRD A;  1P2F A;  3JSO A;  4ENK A;  5DCM B;  2YSR A;  3FX3 A;  3EDP A;  2D45 A;  3ECH A;  4UHT A;  1ZG5 A;  4I02 A;  5D8K B;  5JVT A;  4UV9 A;  3WTX C;  2XAF A;  3REO A;  1Q1H A;  5E8G A;  5L3C A;  3FMR A;  3SFZ A;  1K79 A;  4PDK A;  2UXN A;  3QP6 A;  5H20 A;  3DF8 A;  4Q47 A;  3F8M A;  4A2U A;  2RQP A;  2P5L C;  5K5O A;  2EA4 A;  3G73 A;  4CGZ A;  1W5T A;  2EJR A;  2ACJ A;  3GZ6 A;  3IKT A;  2DTR A;  1JHF A;  4OMY A;  3KP3 A;  4A5M A;  5ED4 A;  3PQK A;  2R3S A;  1YQA A;  1FYL A;  1YG2 A;  4FX4 A;  4KUM A;  3J80 Z;  2FNA A;  2A5Y B;  2O03 A;  4HF2 A;  4JBA A;  2XRN A;  4KDP A;  5HVQ C;  4ENM A;  3FF5 A;  4IHS A;  4E70 A;  1OPC A;  3E97 A;  3V7S A;  3M7G A;  1K78 A;  1DPU A;  2M87 A;  2HWV A;  4G7O F;  1YFH A;  2RC4 A;  4HAM A;  1O3T A;  4HQM A;  4LG0 B;  2A6H F;  5ICE A;  5LHH A;  3F23 A;  1CF7 A;  3P9K A;  4HDU A;  2PI0 A;  2W57 A;  1LB2 A;  3HRM A;  4U0W A;  3ZMS A;  5BPD A;  3MZH A;  2AS5 F;  2VBW A;  3M8F A;  3HHH A;  2DO7 A;  3DV8 A;  2A61 A;  3M1E A;  3R0A A;  1S3J A;  5AIP A;  1HSJ A;  5HS8 A;  1G3Y A;  1FT9 A;  2BEO A;  1OR7 A;  2FRH A;  3BJA A;  2EV6 A;  2XAS A;  2XKO A;  3JTG A;  1ZRC A;  1WWX A;  4P9U A;  4MQ9 F;  3M8E A;  3V7C A;  4GYG A;  1J7K A;  3LST A;  3LA3 A;  5FFX A;  4I7H A;  3LAP A;  1R1U A;  3LA7 A;  5D5V B;  2Q8K A;  4RGX A;  4PZJ A;  3IKV A;  3DPT A;  3ZMV A;  1ZRF A;  2CO5 A;  2Y75 A;  4HLY A;  4FT8 A;  4EM1 A;  3SZP A;  5LRR A;  3VOD A;  5JI6 A;  1UHM A;  2M1B A;  3MZY A;  1XGM A;  1O3R A;  5KVR A;  3EUH A;  1KU7 A;  2B0L A;  4M72 A;  3COA C;  5KK1 A;  4YFN F;  3LA2 A;  3KZZ A;  3BJ6 A;  3WTT C;  2XUB A;  5BQT A;  4LK1 F;  2QZ8 A;  4OIQ F;  1F9N A;  5ICF A;  2P4W A;  3O6B B;  3K9T A;  2HFH A;  3FHZ A;  5HS7 A;  4I09 A;  2IP2 A;  3S2W A;  3WTW C;  1FBU A;  1R5H A;  1J59 A;  1IW7 F;  2CSO A;  2RKH A;  2L4M A;  2QUF A;  4IHT A;  3BRO A;  2XIG A;  3N4M A;  3HTS B;  3I59 A;  1BIA A;  2HYG D;  2QBY A;  5BPI A;  4F7Z A;  2ISY A;  3GVA A;  1W7P A;  3KZY A;  4ZYH A;  3D0S A;  1RNL A;  3RPU A;  5J8F A;  2ESH A;  4L5J A;  3F8C A;  5CVU A;  5K1Y A;  4IRH A;  4EGZ A;  1KGS A;  4G7Z F;  2VBX A;  1RZ4 A;  5DV5 A;  5LLQ A;  2RGV A;  5BOX A;  3T8T A;  5D5W B;  5JHU A;  4DQ2 A;  1XGS A;  3ZMD A;  5CVI A;  2PJP A;  1G3W A;  2FOK A;  1U5T B;  5JR3 A;  1B9N A;  3O2P E;  5EEH A;  2DU9 A;  3E6M A;  5FGM A;  3HRU A;  1MJA A;  4ZH4 F;  2FBH A;  2F5D A;  2V79 A;  3L00 A;  3W6K B;  1TLH B;  3CDH A;  3GZ5 A;  2QLZ A;  4HX4 A;  5K5Q A;  3WU1 B;  3ML6 A;  3F6O A;  4HX8 A;  2XAH A;  1LQ1 A;  2CGP A;  2QEN A;  2Z3Y A;  4LB6 B;  1KYW A;  2FBI A;  1HQC A;  4FX0 A;  4I98 B;  4G7H F;  3O3K A;  4ZYG A;  2MA3 A;  1Z9C A;  4Y13 A;  4CHU A;  1I6X A;  1OYY A;  3E6B A;  1T0F A;  2XAQ A;  3FMS A;  4WXC A;  4HBL A;  5CVJ A;  2E7W A;  4R1H A;  3BPV A;  1R36 A;  4HDV A;  2K02 A;  5LRS A;  1MDM B;  2C6Y A;  4MQV A;  2J5P A;  4LLL A;  3MQ0 A;  2OZ6 A;  1SFU A;  4ASN A;  3N97 A;  1P4A A;  2WV0 A;  3WU0 A;  5AIQ A;  2F5E A;  4A0Z A;  2FF4 A;  4YFK F;  4IRI A;  3LAJ A;  2MH2 A;  3FXR A;  1IZ1 A;  1G4D A;  2K4J A;  1YS6 A;  4BNC A;  3ISP A;  3RTR A;  5HLI A;  4A0X A;  2P6T A;  4K2E A;  2HYF A;  1B1B A;  5DEQ A;  1A04 A;  5LEK A;  4HF1 A;  2F5C A;  1BJA A;  4XLN F;  2QQB A;  1FYK A;  4LLG F;  1XB4 A;  2VC1 A;  1YYV A;  4OU0 A;  2HQR A;  1BOA A;  4EQQ A;  1IUY A;  3MFK A;  1IN5 A;  1MJB A;  5JFR A;  1KU2 A;  1S29 A;  4GXO A;  4G6D A;  2ADU A;  3WGG A;  1ZAR A;  1HW5 A;  2ZME B;  4NQW A;  3R6S A;  1MKM A;  2FEZ A;  1XSD A;  1IXC A;  2VC0 A;  1FYM A;  3ZN1 A;  2JPC A;  3TDU C;  1HW2 A;  3GFL A;  1FSE A;  5HLH A;  3EYY A;  1FZP B;  1R5G A;  3ERE D;  1HKT A;  1XMA A;  1TTY A;  3P9I A;  2PEX A;  4GGG A;  2OBP A;  1W5S A;  2L54 A;  1BC7 C;  5HDG A;  1J5Y A;  3V8K A;  2IJL A;  3JSP A;  2W25 A;  2YPR A;  2UZK A;  3QAH A;  2L4A A;  4XSZ F;  5DD8 A;  3RYP A;  4MNU A;  4RGS A;  2EA2 A;  2LKP A;  4CYD A;  3EQL F;  1BIB A;  1V3F A;  1TBX A;  2VT2 A;  3QRF F;  1LEB A;  2PQ8 A;  2XGX A;  2PBI A;  3M9A A;  4Y15 A;  1B4A A;  3MWM A;  4EJW A;  2W84 A;  3E6D A;  2FMY A;  2JSC A;  3NQO A;  4LLN A;  5DD4 A;  2LF8 A;  1S7O A;  4NHJ A;  1QQI A;  1FY7 A;  4KNY A;  2MLK A;  5D4R A;  4MEY F;  1U6G A;  4QLC U;  1ZGJ A;  2Q0O A;  3JAM K;  3F21 A;  2NAZ A;  3PQJ A;  1ZHF A;  1J9I A;  4MTE A;  5FLX K;  3KP2 A;  4B8X A;  4AD9 A;  4IJA A;  3BOQ A;  3WOD F;  3ECO A;  3GFM A;  2NS0 A;  1KU3 A;  3CUQ B;  2HEO A;  4FHT A;  3VOE A;  4EJU A;  4KMF A;  3DXJ F;  3ABU A;  1F4K A;  3QOP A;  2H09 A;  3E3V A;  2OA4 A;  1IXS B;  3F72 A;  5E17 F;  5E1X A;  1XGN A;  1K78 B;  3JTH A;  1DDN A;  1B59 A;  1L3L A;  4LFU A;  1WRJ A;  1FBS A;  4A0Y A;  4M9Z A;  1IF1 A;  1H9G A;  1T6S A;  1XN7 A;  3HUG A;  1BC8 C;  5DCM A;  3RKW A;  1G6N A;  3KP4 A;  3QP5 A;  5EEG A;  1XCB A;  4RB2 C;  2GQQ A;  2BYV E;  2P8T A;  3TDZ C;  1U78 A;  4G8X A;  4I01 A;  4Q5S F;  4OMZ A;  1O3Q A;  4N9I A;  1RI7 A;  5LGU A;  3WTY C;  3JAM Z;  2DW4 A;  4YIF A;  1BI1 A;  2O0Y A;  3B73 A;  3KCC A;  3WTS C;  2EFN A;  5FLX Z;  1Y0U A;  2V1X A;  3R60 A;  1IRG A;  1XGO A;  2DK5 A;  2QWW A;  3TOA A;  1W7P D;  1P4W A;  2OQG A;  3IWF A;  1U3E M;  2QVO A;  3ELK A;  3L7W A;  3BZ6 A;  3WTU C;  2DQL A;  3FZV A;  4BAY A;  3CTA A;  4EJO A;  2A07 F;  1RUO A;  4G9Y A;  5IT3 A;  4KYW A;  2EB7 A;  3GXO A;  3I71 A;  3L09 A;  5IT9 K;  4MHG A;  2OZU A;  2F2E A;  2DQR A;  3GF2 A;  2P5K A;  1FWZ A;  2P7V B;  3FM5 A;  4BHP A;  4IVN A;  1H9T A;  2WC2 A;  1WSU A;  1XSV A;  5LBQ A;  4IXA A;  3DQV C;  1L0O C;  1ON2 A;  2FE3 A;  3HHG A;  2UWM A;  5TRD A;  2ZCW A;  5E20 A;  4LG0 A;  4HOB A;  3T8R A;  4KIG A;  2GA1 A;  1T98 A;  1PDN C;  4XLP F;  4PGH A;  4HX7 A;  1PP7 U;  4ZZD A;  2LNB A;  1UHW A;  1PUE E;  3ULQ B;  2CG4 A;  4EM0 B;  5DUK A;  5F64 A;  2JRT A;  2CYY A;  3HOS A;  4IF4 A;  1JGS A;  4AIH A;  2P5V A;  4BH9 A;  1XCV A;  1D3Y A;  4EGY A;  2VBY A;  4KN4 X;  2XAJ A;  3SQN A;  5LGN A;  1W7P B;  3BPX A;  6PAX A;  4UVC A;  2PG4 A;  1OKR A;  4OOI A;  2YX7 A;  5F6F A;  3T5X A;  2ZO4 A;  2ZNZ A;  1FPQ A;  5IT9 Z;  2ESN A;  2WWY A;  5CJ9 A;  2GZW A;  5TJJ A;  4JQF A;  3ABT A;  5E8I A;  5ICG A;  2K4B A;  1Z05 A;  1LNW A;  3MCZ A;  2HTS A;  2IRF G;  2IT0 A;  1WKM A;  4HF0 A;  4L5I A;  4UVB A;  3IL2 A;  3E5X A;  1QNT A;  3WTV C;  4RAY A;  5HLG A;  1FX7 A;  4EM2 A;  4ZYD A;  1IN8 A;  5D6F A;  1LDJ A;  1KA8 A;  4RS8 A;  3HSE A;  1SD5 A;  1G3T A;  4H0E A;  3L2C A;  4UV8 A;  1VTN C;  4WCG A;  1SFX A;  2JTV A;  1OYW A;  1SD4 A;  4P55 A;  2JT1 A;  2M8E A;  2EFQ A;  4MTD A;  3DKW A;  3BP8 A;  4ETS A;  4ENJ A;  1S6L A;  2X0L A;  1FBQ A;  4ESJ A;  4O6J A;  1NHA A;  4KA4 A;  2HKX A;  2WTE A;  4O5V A;  1F5T A;  2HGC A;  3DPL C;  1XDS A;  4ZZL A;  1TQM A;  5E1Z B;  5E18 F;  1YW9 A;  2GXB A;  3C3W A;  3KLN A;  1SMT A;  4EVI A;  3FXU A;  1F1Z A;  1BI3 A;  5FD6 A;  1S8N A;  4MGR A;  4OIR F;  2O8X A;  1DP7 P;  3ZN0 A;  1QZZ A;  3FMQ A;  3K2Z A;  2JPB A;  2HTJ A;  2V9V A;  3U2R A;  5F1R A;  3BY6 A;  3CUO A;  4U0Y A;  3QPT A;  3ROU A;  2STW A;  1U5T A;  1ZYR F;  2Y48 A;  2H27 A;  3SHF A;  5A2Q K;  4RB1 A;  4N9H A;  2P7C B;  2QYO A;  1BI0 A;  2FU4 A;  1BBY A;  2GIV A;  2IPQ X;  5H6Q A;  3IWZ A;  2GAU A;  2PMU A;  2RNJ A;  2L01 A;  4OIP F;  1FLI A;  1ZLJ A;  2D1H A;  1ZH5 A;  2ZXJ A;  3CO7 C;  4P9F A;  2VE9 A;  1D8J A;  1R22 A;  4WK8 F;  2K27 A;  1SMY F;  4BQA A;  2RN7 A;  4BHB A;  5K5R A;  3HTU A;  2V1U A;  1QPM A;  1BI2 A;  2BE5 F;  2O6G E;  1RIO H;  4PGG A;  3VB2 A;  5ILV A;  1J2X A;  3I54 A;  2BV6 A;  1HKS A;  2QQ9 A;  5LHG A;  1ZLK A;  2FML A;  1YLF A;  4QWQ A;  3WE3 A;  4Q4Z F;  2DPD A;  4LB5 A;  3WGI A;  2CQK A;  3HSF A;  5DYM A;  1E17 A;  1U5T C;  1MDM A;  2IA0 A;  3T1B A;  5L3F A;  2EV0 A;  4NB5 A;  1U8R A;  1U2W A;  4U7D A;  2CWE A;  3ZPL A;  1BM9 A;  1HXD A;  3KE2 A;  4U88 A;  2UXX A;  3GW2 A;  1FP1 D;  4ENN A;  1Z6T A;  4I0B A;  5A2Q Z;  3OOP A;  1W4M A;  2AXL A;  3F8F A;  2HOE A;  3BJO A;  1UST A;  3J7A O;  3TO7 A;  4EJV A;  1T38 A;  3HYI A;  1V4R A;  5FB2 A;  3HRT A;  1YTY A;  1HW1 A;  5D5U B;  4LK0 F;  3B02 A;  4CDG A;  5DDG A;  4P5O A;  1TW3 A;  2BBY A;  2LDU A;  1YO5 C;  2VN2 A;  2COM A;  3LQQ A;  4AIK A;  5CLS A;  1B6A A;  4BHC A;  1YS7 A;  3KP5 A;  3LFK A;  3I58 A;  4KIB A;  1UB9 A;  2ZME A;  2MD5 A;  4ZYE A;  3ZMT A;  4HLX A;  1GVJ A;  2KIF A;  4LJZ F;  5D6E A;  2QQA A;  3HRS A;  3MAJ A;  5HS9 A;  1IN7 A;  4IPA A;  2STT A;  1FC3 A;  1R00 A;  1SD7 A;  3RI4 A;  2D2W A;  2IW5 A;  3V7R A;  2K7L A;  3ZQ7 A;  1QBJ A;  5LHI A;  3IRR A;  1FOK A;  5CVV A; 
#chains in the Genus database with same CATH topology
 2WY7 Q;  2QCO A;  2FX0 A;  4JK1 X;  3HL2 A;  1AOY A;  1WHU A;  3H3V K;  2IGO A;  4G94 A;  2H8W A;  4DBR A;  2DXI A;  3KLO A;  3E7L A;  4PSX A;  3RDI A;  4LIV A;  3F8B A;  5J47 A;  3B6A A;  2EFW A;  1REP C;  4JX5 A;  3H35 A;  3BTJ A;  1W36 D;  2XB5 A;  4RAF A;  2G7U A;  4XIC A;  4XKC A;  1LVA A;  4LMY A;  2IAI A;  4BQQ A;  4CCM A;  2VXZ A;  1ZRE A;  2WAF A;  2DOD A;  3FXM A;  3NEU A;  1Z3X A;  2JA8 J;  5CPR B;  4Q48 A;  2LY1 A;  2OTL I;  1KU9 A;  2HVQ A;  1WQ2 A;  5DCF A;  5FKL A;  5EEA A;  1YIO A;  1SC7 A;  2ZME C;  1AWC A;  1TL8 A;  2H94 A;  2DA6 A;  3GTL J;  2VQH A;  3DLL F;  2FA5 A;  4YG2 F;  2X1C A;  1WJD A;  2DBB A;  2M5W A;  3PFI A;  4QTR A;  3OIQ A;  2WA0 A;  3JCU C;  5GAH J;  4CIC A;  3TBI A;  3KEQ A;  2KRF A;  1EV7 A;  1XMK A;  4FE4 A;  1SD6 A;  4XOT A;  4YII A;  4KIT B;  1VQ9 I;  2W24 A;  1K61 A;  4LGW A;  4C3I J;  1GUU A;  2M7B A;  1QGP A;  2RRE A;  4HEA 2;  3K4J A;  4LG3 A;  3SEZ A;  1QO0 D;  1O7L A;  3X2Q H;  2G9W A;  1W5C C;  2FQ3 A;  2F5F A;  2RDP A;  1LDK B;  3CF5 F;  5M5W J;  3HXL A;  2A69 F;  1XD7 A;  2HQN A;  2XGD A;  5DUI A;  4II3 A;  4KMU X;  5ICC A;  5E3L A;  2KIQ A;  5FKM A;  2XPW A;  1WJC A;  1IN4 A;  2W82 A;  3CMY A;  2VE8 A;  3M3Y J;  3I0T A;  3K4B A;  4BXU A;  3RJP A;  1FTZ A;  3DBL B;  3WHC A;  4S04 A;  3GFI A;  3KIO A;  2KQR A;  2BXZ A;  4HW0 A;  3TW6 A;  1Z6R A;  3HGG A;  4X1E A;  3GLX A;  1F43 A;  2OCE A;  3B6C A;  4A6D A;  2ZBK A;  4M6Y A;  3U9G A;  3BZC A;  4YFX F;  3IHU A;  1SVO A;  4D0P A;  1ZAO A;  3Q9V A;  4AC0 A;  1POG A;  3GX4 X;  1CF7 B;  3M4O J;  4LD5 A;  5L3D A;  3OIP A;  4UNO A;  1KQ8 A;  2D1V A;  1R4M B;  1MND A;  4ABZ A;  4UUV A;  2NVX J;  3I64 A;  1P9Q C;  4RDU A;  1WI9 A;  2HOA A;  3CUQ A;  1TW2 A;  2K9N A;  3U21 A;  4ZTJ A;  1JKO C;  4L0Y B;  2JWT A;  3GFJ A;  3KET A;  4XSX F;  3CDL A;  5CVV A;  1SFE A;  2VQL A;  4BE2 A;  2XGC A;  2NOJ B;  2IVM A;  2YX4 A;  3R0J A;  4KT5 C;  2YR2 A;  3JW4 A;  5B1A H;  2MC3 A;  2DI3 A;  3F22 A;  3W6J B;  2XF6 A;  4I6Z A;  1TWF J;  1ODD A;  2NNN A;  5EF6 A;  4L9N A;  3I5U A;  4Z2Y A;  3ZOB A;  1T39 A;  1OCR H;  3FXQ A;  4Y4R A;  5LEJ A;  2R7F A;  4I0A A;  3HOW J;  2E7X A;  2W85 A;  2E35 A;  2R7S A;  2L02 A;  3H3Z A;  4HZF A;  3RPU D;  3C18 A;  4CO8 A;  2IGN A;  3BCA A;  4NC8 A;  1NG6 A;  2A3S A;  2EPF A;  1A35 A;  1I1G A;  2V26 A;  2GM4 A;  1VQO I;  4HRI A;  4XK4 A;  2DOF A;  4QPQ A;  4KFC A;  1P6R A;  4L9V A;  5B66 C;  5FKK A;  4B09 A;  3E6C C;  1I5Z A;  4AWX B;  3QPH A;  3F8N A;  1EF4 A;  3HKZ A;  4MEX F;  2ZNY A;  2OC6 A;  2GXA A;  4ZDO A;  2GA2 A;  2CQX A;  2Y0M A;  4BY1 J;  5DS9 A;  3R61 A;  1KQ0 A;  2X51 A;  2VQC A;  1OLT A;  2CW0 F;  1Z91 A;  1CGP A;  2Y69 H;  1YI2 I;  5HDK A;  2NYX A;  1MZB A;  4M3F A;  3ZMZ A;  3A4C A;  2JVH A;  3CUQ C;  3WTZ A;  1EH7 A;  3ZMU A;  2EWN A;  3PM1 A;  1MBK A;  3E1S A;  2ME6 A;  2KLO A;  2FBK A;  1STZ A;  4IL6 C;  2FNP A;  2N8G A;  3J81 K;  2YU9 J;  1ETV A;  4BJ5 C;  1YW7 A;  2H6C A;  4YEJ A;  5IP6 A;  1D1A A;  2NOG A;  4DJA A;  4M6X A;  1HBX G;  1YW8 A;  2V4J C;  4C9Y A;  2FSW A;  3TL4 X;  1LDD A;  4CYC A;  2DLL A;  1XTA A;  4UUS B;  2R92 J;  2K3F A;  3CC7 I;  3ASO H;  4WX9 A;  2R5Y B;  1JXS A;  4V19 K;  1IN6 A;  5D4S A;  2EZL A;  2QA4 I;  2VON A;  1JHH A;  2LKX A;  1HST A;  3GTG J;  1ETW A;  2XVC A;  2HVR A;  3S17 J;  4PCQ A;  3FWE A;  3H3U A;  5IP7 J;  2VIX A;  2LH9 A;  2M34 A;  4ANJ A;  4J00 A;  1LEA A;  1RES A;  1VQ8 I;  1XMX A;  5C3E J;  3ZRG A;  2EIL H;  2DMT A;  2VPR A;  4EV0 A;  1O57 A;  4DNC A;  3K1N A;  4PJ0 C;  4EJT A;  2M9H A;  4HQE A;  1D5V A;  2F6C A;  3LSP A;  2V1N A;  3GTJ J;  5FRM A;  1ZG1 A;  4HST A;  4Y17 A;  2HS5 A;  1Z7L A;  1FNN A;  3VEP A;  3I59 B;  2QBY B;  3MD2 A;  4A5N A;  5L3B A;  3BG7 A;  3LQR A;  3RKX A;  4D7N A;  5E3N A;  1ZGA A;  4D5F A;  5LGT A;  1D5Y A;  4R8H A;  1DPR A;  2O61 A;  4KIF A;  3DEU A;  1FOW A;  1BN5 A;  4J19 A;  1USS A;  4IZZ A;  4UY8 I;  1MJ9 A;  1I50 J;  4XBF A;  4CXF A;  1K6O A;  1ONV A;  5K7Z A;  3OYK A;  4LIT A;  2VXD A;  3CCL I;  1JE8 A;  1D8K A;  1WJB A;  2LMD A;  5AON A;  3V42 A;  5K7H A;  2ZJP F;  4A3C J;  3CO6 C;  5IOY A;  2IS2 A;  1ENH A;  1BR1 A;  2CUE A;  2OD5 A;  2IA1 A;  3JRI A;  1BR4 A;  2JMW A;  3F3X A;  5D5X B;  1OR7 C;  2X6Y A;  4RGU A;  3Q9S A;  2KHM A;  3MEX A;  2V1D A;  3ZR8 X;  2R7R A;  2R7D A;  4EMS A;  3TOB A;  4CCK A;  2K3P A;  2Z5U A;  3OYG A;  1TQP A;  4I2O A;  3I9V 2;  4B48 A;  3JRA A;  2K9S A;  4Z6Y A;  4Y7N J;  3GBG A;  4UXN A;  3J81 Z;  2DFH A;  2H6B A;  4RB3 C;  1Y56 A;  1ZG3 A;  2V6C A;  5IY5 H;  2LVS A;  4M9X A;  3C2G A;  1OMI A;  1KQ9 A;  1MBE A;  1MGT A;  5GPA A;  3V8J A;  1X1A A;  2VJ4 A;  4CCN A;  1FIP A;  4M9S A;  1N77 A;  4OIO F;  3JRD A;  5ERI A;  4F92 B;  4WWC A;  1R23 A;  1QZE A;  3BTC A;  3GEZ A;  2MBF A;  1FP2 A;  3G6E I;  1WJF A;  3TO9 A;  3SZT A;  3OV8 A;  5E1W A;  4IX7 A;  2R7T A;  1OCO H;  2Z33 A;  4BE0 A;  2PN6 A;  3MZ8 A;  2VOO A;  4HV6 A;  1MBH A;  1R1V A;  2DT5 A;  4GO1 A;  3LSH A;  2TDX A;  5JHF A;  1A31 A;  4S05 A;  1IAW A;  3SXY A;  3IC7 A;  3CC2 I;  3MKY B;  4LOC A;  1IUF A;  1SAX A;  1DU0 A;  3DLA A;  1HKQ A;  3QYF A;  5D8L B;  2A5W A;  2ZSI B;  3EUH C;  2G7H A;  3OL3 A;  5L3G A;  2ICW G;  1R49 A;  2NRA C;  2LBF B;  3FM3 A;  3MKL A;  2BW3 A;  1YRN A;  3BQZ A;  1FEX A;  2L9S A;  4ESB A;  2K86 A;  3OYI A;  3L9F A;  1RRJ A;  2EFP A;  4AIJ A;  4L5E A;  1X4O A;  3E5U A;  3KFW X;  4KJZ A;  5J8C A;  1XSX A;  2VOD A;  2IS6 A;  1G3S A;  3NAU A;  3EET A;  5HNH A;  2DPU A;  3OYB A;  3H0G J;  3HSR A;  2CQ7 A;  4CZZ A;  2MD0 A;  3BZK A;  4L9T A;  1IXR C;  1V5G A;  2VBZ A;  5BS6 A;  4BBS J;  1X1P A;  2JZY A;  4RAZ A;  4C3H J;  1I1S A;  2DOA A;  3OMY A;  4S0H B;  3P9C A;  3V8L A;  2GBY A;  3FBN B;  4XLC A;  2WV1 A;  4L18 B;  2ZFW A;  3G3Z A;  5H2F C;  2DFI A;  4XLE A;  1K7A A;  3FXJ A;  1A36 A;  1NK3 P;  3LSR A;  3ABM H;  3K2A A;  4IRG A;  3WGH A;  3TO6 A;  1J0R A;  5BMZ A;  3EUK L;  1GXQ A;  1YIT I;  1GV5 A;  2YU3 A;  3F6V A;  3T0Y A;  2L3D A;  2ZXH A;  1R1T A;  2E1O A;  2L7F P;  4A3F J;  3AAF A;  3PO2 J;  2WY8 Q;  3PNV A;  3GZN B;  4KIC A;  5DM6 F;  3BR5 A;  3DKX A;  5J6X A;  2A6E F;  1Y6I A;  3ZQG A;  3ZQI A;  5KHD A;  5GPC A;  4M3E A;  3EYI A;  4G6T B;  3Q5F A;  2AQF A;  2P6S A;  4A12 A;  2ID6 A;  2LTP A;  2PMZ N;  1IG7 A;  4ZJZ A;  4BDZ A;  3R4K A;  3DTE A;  2GLO A;  2XAU A;  1SAU A;  2J5O A;  3HPH A;  2BGC A;  5FKO A;  1JT6 A;  1MMG A;  4M3D A;  1EH8 A;  3CC4 I;  2MH9 A;  3CJN A;  2LP0 A;  3BWG A;  3FXL A;  3H5N A;  1Z3Y A;  3VFZ A;  2LK2 A;  3E5Q A;  3QU3 A;  4AVP A;  3LWF A;  4XN3 A;  3U1K A;  3JRE A;  1Y1W J;  3RKY A;  4RA2 A;  4L0Z B;  2M45 A;  2ZKZ A;  2X85 A;  4NC7 A;  1JI8 A;  3H5A A;  2MFZ A;  3HIF A;  2XKP A;  4OAY A;  2A05 A;  2PLY A;  2HDC A;  4A3I J;  4ZDL A;  3ZP5 A;  3QU6 A;  5L3E A;  3QYE A;  2E1N A;  3TQN A;  2NNY A;  4Y52 J;  2PX9 A;  1TQI A;  2OU2 A;  2ISZ A;  1AKH B;  1T2K A;  1K83 J;  2Q2E A;  2L7Z A;  2OPT A;  1D1C A;  3GUD A;  4FAS D;  2HPM A;  2EFO A;  1B72 B;  3OY9 A;  4RB0 A;  2KKO A;  1DP3 A;  4WF2 A;  4NQW B;  3KP7 A;  2EK5 A;  4HYE A;  4F91 B;  2FD5 A;  4L9J A;  3CLO A;  2I10 A;  2PMH A;  3GO5 A;  3J7Z I;  2FXA A;  1WCM J;  5ILU A;  4RGR A;  4M6V A;  4A3L J;  1HC8 A;  1GHC A;  1J75 A;  2DK8 A;  4KN7 X;  3HOT A;  3W2A A;  2A68 F;  3KP6 A;  2L0K A;  1QZY A;  2MSY A;  3LSM A;  3LSJ A;  5FD5 A;  3IUO A;  3GWZ A;  2KJB A;  2VAS A;  3CCS I;  1KYZ A;  3WE2 A;  2W48 A;  2LY9 A;  3C7J A;  2CH0 A;  3P7N A;  4GYI A;  1UEL B;  1XPX A;  5FFZ A;  2W00 A;  2BXY A;  3ZQL A;  4M3B A;  3SZG A;  3S16 J;  2HZT A;  3RKQ A;  4CUG A;  4I76 A;  2E1C A;  4M3G A;  5CYV A;  1T0F C;  1IRF A;  1PJR A;  2DDB A;  2ME0 A;  4HA8 A;  1ON1 A;  4M73 A;  4TV7 A;  5IYB J;  5GAD J;  3AL0 B;  2ZFU A;  3CES A;  4N0B A;  4BGD A;  4U0V A;  1K6Y A;  3IV5 A;  1HF0 A;  4E4H A;  4XRF A;  4NNJ A;  1B9M A;  1UG0 A;  1OCZ H;  1T95 A;  2WB1 A;  3FHN A;  3OYE A;  2L7K A;  5CVR A;  1I27 A;  1PUF A;  1FSH A;  1XDU A;  4P1W A;  4CA0 A;  4R79 A;  3K69 A;  4BYY A;  2Z1D A;  2BHZ A;  3U1D A;  3CJR B;  3L2R A;  1MSF C;  1MSE C;  3I53 A;  3WG9 A;  2GXG A;  2HKO A;  1DUX C;  3CJQ B;  1RUN A;  2E71 A;  1PYV A;  1IDZ A;  1ZN2 A;  2KJC A;  2JJ7 A;  2KIU A;  3SEQ A;  1SVM A;  5J3L A;  4QPO A;  1O7F A;  3TW7 A;  5EDN A;  4M74 A;  2QSH X;  2Z99 A;  4DOZ A;  3TED A;  1GXP A;  2IS4 A;  4BJT A;  5JLW A;  1P4X A;  1OYI A;  1R4N B;  2CS3 A;  1R7J A;  4I99 C;  2XPV A;  1GDT A;  4Y3O A;  1O3S A;  2X4H A;  3V4G A;  2F48 A;  3CCQ I;  1MD0 A;  1UFM A;  1LUJ B;  2CFX A;  3TP0 A;  2HR3 A;  3DP7 A;  3TGN A;  1X3Z B;  5GAG J;  1TWA J;  1X3U A;  2DCE A;  3HB9 A;  5HOD A;  3BDD A;  3OIO A;  4GCV A;  4P96 A;  2Z2S B;  5H6R A;  3QYB A;  5M3F J;  5HOO A;  3BR0 A;  3OYF A;  4HV5 A;  1BA5 A;  3C1D A;  3FXO A;  3M1C A;  1Z7U A;  4E6K G;  5EG0 B;  4E7K A;  2DA2 A;  3HC7 A;  3OS1 A;  1BOB A;  2ELH A;  3A01 B;  3S3M A;  3MN2 A;  2QKM B;  4M71 A;  2HXI A;  2DAO A;  3MVP A;  5FO5 A;  3G1L A;  1Q1V A;  4WXH A;  1ULY A;  3HKZ N;  1I3A A;  2ETH A;  3D5L A;  3I4P A;  1MW7 A;  1A6Q A;  2XV4 S;  3IRR A;  2EV5 A;  4A6E A;  3GYH X;  3TMO A;  2PFB A;  1R5I D;  2DMN A;  3WG7 H;  2Z9O A;  1E3P A;  3TKY A;  4A3D J;  2OAZ A;  1P92 A;  2LSO A;  3H92 A;  2VLA A;  2VOP A;  2XF7 A;  2ZJ2 A;  1WJE A;  2LFB A;  3RIR A;  1H0M A;  4O3M A;  2XRO A;  2KIM A;  1UCR A;  3PIO F;  2DMP A;  4WXD A;  1Y8R B;  4J01 A;  2XHK A;  4OIN F;  3K1P A;  3D5R C;  2XAG A;  4BQO A;  1FIA A;  1X1C A;  5HDN A;  1PP8 F;  2DT7 B;  3DFG A;  4II2 A;  1MNE A;  4OWR B;  3RCO A;  1NG7 A;  3RYR A;  1UG2 A;  2LF7 A;  4ON0 A;  3K1M A;  4ESF A;  2IA2 A;  4UVA A;  3KEO A;  2M30 A;  1XS9 A;  1LJ9 A;  1JJ6 C;  5HNF A;  2CW8 A;  2PJR A;  1TNT A;  3IRQ A;  2VKE A;  2QM3 A;  1E2X A;  1R58 A;  1OCP A;  1D0Y A;  3G1M A;  2KZG A;  4JP0 A;  5ILS A;  4U7B A;  1Z1D A;  1YJW I;  2RV8 A;  1RPW A;  4PFO A;  2VT3 A;  4AYB A;  4HG2 A;  3FDY A;  3J80 K;  2RVC A;  2EBI A;  2OQR A;  3RPQ A;  2M3A A;  3K0L A;  2GWR A;  2MLG A;  3H0D A;  3WHB A;  2IXS A;  1EH6 A;  4G6Q A;  3NRV A;  3BR6 A;  1S7A A;  1TNS A;  1C0W A;  2O3F A;  1ZRD A;  1P2F A;  3DKY A;  3JSO A;  3HUG B;  3PJR A;  4ENK A;  5DCM B;  2YSR A;  3FX3 A;  2AQE A;  1VQ5 I;  3EDP A;  3AL0 C;  2D45 A;  1ZK8 A;  1V54 H;  3ECH A;  2JK3 A;  4F93 B;  4UHT A;  1ZG5 A;  4NDL A;  2CJJ A;  3S1Q J;  1VQK I;  2K85 A;  1IRX A;  4I02 A;  5D8K B;  1RR7 A;  5JVT A;  5IPA A;  4UV9 A;  3WTX C;  2E36 A;  2XAF A;  1Y8Q B;  3REO A;  5F0C A;  1ZR4 A;  1R6R A;  4FIS A;  4LIU A;  1Q1H A;  5E8G A;  5L3C A;  3FMR A;  3SFZ A;  1KZH A;  1K79 A;  4PDK A;  2UXN A;  5M5X J;  2EQR A;  3QP6 A;  4V2F A;  5H20 A;  3LMM A;  4EEF G;  3DF8 A;  5F27 A;  9ANT A;  2KP6 A;  4Q47 A;  1E3O C;  3F8M A;  4YIR X;  4AU7 A;  1Z77 A;  1MMS A;  4A2U A;  2RQP A;  2Y30 A;  1MNM C;  4AID A;  3CMA I;  2P5L C;  5K5O A;  1DU6 A;  2EA4 A;  3G73 A;  4CGZ A;  3OYC A;  1W5T A;  3H9Q A;  3LSK A;  2KDO A;  1WH5 A;  4B3X A;  1EA3 A;  2O7O A;  5EJC A;  3HOV J;  1P7J A;  1FJL A;  1QVU A;  2EJR A;  3H5R A;  3KX2 A;  2ACJ A;  3GZ6 A;  1E0E A;  3S1M J;  4DW6 A;  1TP4 A;  3IKT A;  1BL0 A;  3H9G A;  2DTR A;  3CCR I;  1JHF A;  1D0X A;  3S8P A;  4OMY A;  3KP3 A;  3RSN A;  3VYS B;  4A5M A;  5ED4 A;  4B1R A;  4RBO A;  3PQK A;  2R3S A;  1YQA A;  2JA2 A;  5B5E C;  1Y39 A;  2VKV A;  1YG2 A;  1FYL A;  4FX4 A;  4KUM A;  1Z0X A;  3J80 Z;  3Q0W A;  2FNA A;  2VJ5 A;  2A5Y B;  2O03 A;  1ZEL A;  2R7U A;  1K4S A;  2B7E A;  3OR2 C;  3W3C A;  1YX5 A;  3BR1 A;  4HF2 A;  4JBA A;  4FTH A;  2XRN A;  4KDP A;  2QKL B;  1S7E A;  5HVQ C;  4ENM A;  2ID3 A;  3FF5 A;  3GCM A;  4E70 A;  4XNF A;  4IHS A;  1OPC A;  3E97 A;  3V7S A;  3DEW A;  3M7G A;  3OYN A;  1K78 A;  1S5L C;  1DPU A;  3W2V A;  2EZI A;  3HOX J;  2KL4 A;  3Q0U A;  2Q1Z B;  4IHW A;  2NVQ J;  2CW7 A;  2M87 A;  2HWV A;  4G7O F;  4XRS A;  1U8B A;  2E2J J;  2NS7 A;  2WAE A;  4A3G J;  1H89 C;  4RMN A;  1YFH A;  5FLV A;  2RC4 A;  1V5F A;  4HAM A;  3FK7 A;  4H4K C;  1O3T A;  3OYM A;  2DA4 A;  4HQM A;  3CCV I;  2HDW A;  1U9O A;  3HGY A;  4BXF A;  4LG0 B;  2A6H F;  2X6X A;  3C2H A;  5IOZ A;  2YUS A;  5ICE A;  2QQ8 A;  3CCU I;  3OWT A;  5LHH A;  2ZJR F;  3F23 A;  1CF7 A;  2KPM A;  2XSJ C;  1ETO A;  3P9K A;  2DT6 A;  4HDU A;  2PI0 A;  4CCO A;  2W57 A;  3GTK J;  2KMU A;  3I56 I;  3HRM A;  1LB2 A;  2JVG A;  1XC5 A;  5J4Y A;  4U0W A;  3UR3 C;  3ZMS A;  5BPD A;  3I4M J;  3O8H A;  4RLQ A;  1D0Z A;  3MZH A;  2AS5 F;  2VBW A;  4XKW A;  2HVS A;  3M8F A;  3HHH A;  5JVG F;  2DO7 A;  2EIK H;  3DV8 A;  4PJL A;  1MBF A;  2A61 A;  3M1E A;  3J7A Y;  3DWL E;  3CLQ A;  3R0A A;  3BG6 A;  4PSW A;  1S3J A;  3IP4 B;  1CQT A;  3JRC A;  5AIP A;  1HSJ A;  5HS8 A;  1G3Y A;  3NWT A;  1X2N A;  1QHG A;  1VQM I;  2KDZ A;  1FT9 A;  2BEO A;  2JN6 A;  4DZP A;  1OR7 A;  2FRH A;  2VKD A;  3NAR A;  3S3O A;  2LG4 A;  3BJA A;  2EV6 A;  2XAS A;  4ITV A;  2XKO A;  3JTG A;  1LE8 B;  1ZRC A;  1WWX A;  4P9U A;  3H36 A;  5FLM J;  1TZL A;  4MQ9 F;  1YJN I;  3LFU A;  3FIW A;  1LPQ A;  1AU7 A;  3M8E A;  3V7C A;  4GYG A;  1J7K A;  3LST A;  3LA3 A;  5FFX A;  4I7H A;  3BR2 A;  4DZJ A;  3BTI A;  3LAP A;  2BY2 A;  1R1U A;  3LA7 A;  2Y2Z A;  2EIN H;  5D5V B;  2Q8K A;  4XR6 A;  4RGX A;  2Y31 A;  1ETK A;  3IKV A;  4PZJ A;  3DPT A;  3ZMV A;  1ZRF A;  2CO5 A;  2Y75 A;  4HLY A;  4FT8 A;  4EM1 A;  3SZP A;  4XOR A;  5LRR A;  3VOD A;  4JX4 A;  5JI6 A;  1UHM A;  2M1B A;  1ACI A;  5J4V A;  2VQG A;  2L5Q A;  3QOD A;  5JLX A;  3MZY A;  1XGM A;  5IP9 J;  2IGM A;  1O3R A;  5KVR A;  3EUH A;  1KU7 A;  4A3J J;  4HNT A;  1UHS A;  1OCC H;  2MC4 A;  2W1O A;  2XSD C;  1ZKG A;  2XC7 A;  2B0L A;  4M72 A;  3COA C;  5KK1 A;  4BAC A;  2GOM A;  2ZXW H;  4YFN F;  1WJ5 A;  2M0M A;  3K10 A;  3LA2 A;  1GVD A;  2HU9 A;  4XM3 A;  3KZZ A;  3S93 A;  4UUS A;  3BJ6 A;  3WTT C;  2XUB A;  5BQT A;  4LK1 F;  3K4N A;  2QZ8 A;  2R5Y A;  4OIQ F;  1F9N A;  5KCM A;  1W36 C;  4DIQ A;  5ICF A;  2P4W A;  3O6B B;  1QA6 A;  3K9T A;  2HFH A;  3DPU A;  4PJN A;  4C30 A;  3UKG A;  3FHZ A;  5HS7 A;  4I09 A;  1Z21 A;  2IP2 A;  3S2W A;  3WTW C;  4UUT A;  1FBU A;  1R5H A;  1J59 A;  1IW7 F;  5CQG A;  2CSO A;  4PJM A;  3JRB A;  4GDF A;  2WB1 N;  1HLV A;  2RKH A;  2L4M A;  2QUF A;  4IHT A;  1RKT A;  3S3N A;  4A3B J;  4N4N B;  1G8X A;  4PJJ A;  5EGO A;  4XKV A;  3DTI A;  1LKX A;  3BRO A;  2XIG A;  3N4M A;  1I3Q J;  3HTS B;  3KPH A;  3I59 A;  1BIA A;  2HYG D;  1OQY A;  1OFC X;  2Y0S A;  2QBY A;  5BPI A;  4F7Z A;  3BC8 A;  2ISY A;  3GVA A;  4D5C A;  1W7P A;  4D9J A;  3KZY A;  4ZYH A;  3D0S A;  1RNL A;  3RPU A;  3Q3S A;  5J8F A;  2ESH A;  3OSF A;  4L5J A;  3F8C A;  2R5Z B;  1MIJ A;  5CVU A;  5K1Y A;  4IRH A;  4EGZ A;  1KGS A;  4G7Z F;  2VBX A;  5FJ8 J;  1RZ4 A;  5DV5 A;  5LLQ A;  3LSI A;  2RGV A;  5BOX A;  3T8T A;  2E1M B;  3FIS A;  5D5W B;  1PVE A;  5JHU A;  4DQ2 A;  4IHY A;  4XN0 A;  2QSG X;  2VJJ A;  4YRV A;  1XGS A;  3ZMD A;  5CVI A;  2PJP A;  1G3W A;  2FOK A;  1I6H J;  1U5T B;  5JR3 A;  1B9N A;  3O2P E;  3OL4 A;  2OF7 A;  5EEH A;  4CCJ A;  2DU9 A;  1VFC A;  1XG1 A;  3E6M A;  5FGM A;  4CCL A;  3HRU A;  3JRH A;  2L9V A;  1MJA A;  2X48 A;  2R7O A;  4ZH4 F;  2FBH A;  2F5D A;  2V79 A;  3L00 A;  3S32 A;  1HA8 A;  5M5Y J;  3A02 A;  1WGX A;  3ESW B;  1TLH B;  2DA7 A;  3W6K B;  3CDH A;  1MH4 A;  1BR2 A;  3GZ5 A;  2QLZ A;  4HX4 A;  3VYU B;  2HOS A;  4BUP A;  5K5Q A;  3BG5 A;  3WU1 B;  3ML6 A;  2F5V A;  4A93 J;  3PL8 A;  1X3W B;  3F6O A;  4HX8 A;  2DA1 A;  4E7J A;  1AA7 A;  3AG2 H;  1R71 A;  2XAH A;  1AHD P;  2QF7 A;  1TWH J;  4MFD A;  1LQ1 A;  2TRT A;  2CGP A;  2QEN A;  2Y9Y A;  2ECC A;  2Z3Y A;  4LB6 B;  1GT0 C;  1KYW A;  2FBI A;  5J1R A;  1HQC A;  4FX0 A;  5KAF C;  4I98 B;  4G7H F;  3ABK H;  3OS2 A;  2E2I J;  2OTJ I;  1BW5 A;  3O3K A;  4ZYG A;  2MA3 A;  3Q0V A;  1Z9C A;  2LBF A;  2AHQ A;  4Y13 A;  2LKS A;  1K4T A;  4CHU A;  1I6X A;  2LRE A;  1OYY A;  4AYB N;  4NC6 A;  3GTP J;  3QPS A;  3E6B A;  4A3E J;  1T0F A;  2XAQ A;  3FMS A;  4WXC A;  1MMN A;  2BY0 A;  4HBL A;  5CVJ A;  2TCT A;  2BVL A;  2E7W A;  3SDB A;  2K9M A;  4E7S A;  4R1H A;  5EZG A;  3BPV A;  1R36 A;  1MMA A;  3CQZ J;  3VSK A;  4HDV A;  2JSP A;  2K02 A;  4F3Q A;  4IQ4 A;  1QHH D;  2VJI A;  5LRS A;  1MDM B;  2P0W A;  1DQU A;  4UB8 C;  4MQV A;  2C6Y A;  2J5P A;  4LLL A;  4DYR A;  3J7Y J;  1QPI A;  3MQ0 A;  2V6E A;  2OZ6 A;  1SFU A;  2D5V A;  4ASN A;  5TIS C;  3N97 A;  1A5J A;  2ZJQ F;  1P4A A;  5C4J J;  2WV0 A;  2HYJ A;  3WU0 A;  3ZQQ A;  1SVL A;  1JUS A;  5AIQ A;  1ZTR A;  2I5U A;  3OOU A;  3WU2 C;  2F5E A;  4A0Z A;  2E2H J;  2V7F A;  2EZH A;  1VI0 A;  3QOE A;  1G2H A;  2FF4 A;  4W97 A;  2AXT C;  2LRD A;  1OJL A;  5EYR A;  1U0J A;  4YFK F;  3S15 J;  4IRI A;  3LAJ A;  2MH2 A;  3FXR A;  5F0F A;  2WAD A;  1IZ1 A;  2L7M P;  4RLF A;  1G4D A;  2CUZ A;  2K9Q A;  2K4J A;  1WJA A;  4E7H A;  1YS6 A;  4BNC A;  3ISP A;  2E60 A;  3RTR A;  5HLI A;  4A0X A;  3CP8 A;  2P6T A;  5HLT A;  2IBD A;  4K2E A;  2HYF A;  1B1B A;  5DEQ A;  2A6T A;  1A04 A;  5LEK A;  4HF1 A;  3JR9 A;  2F5C A;  1BJA A;  4XLN F;  2QQB A;  4HNV A;  1FYK A;  4LLG F;  1XB4 A;  1HDD C;  5C4X J;  2VC1 A;  2M4K A;  1YYV A;  4OU0 A;  2BVM A;  1HDP A;  2HQR A;  1BOA A;  1YJ9 I;  4EQQ A;  5KAI C;  5B3S H;  2M2E A;  4F52 A;  1WVR A;  1IUY A;  3MFK A;  1IN5 A;  1JGG A;  1MJB A;  5JFR A;  1KU2 A;  1S29 A;  2X1D A;  5J1U A;  2O8K A;  2W4S A;  1AKH A;  4GXO A;  4G6D A;  3K6G A;  4QSH A;  1SFO J;  1JUM A;  2ADU A;  1B72 A;  3WGG A;  1ZAR A;  1HW5 A;  2ZME B;  1T08 B;  3ERM A;  4BEH B;  1A6I A;  4NQW A;  3R6S A;  1MKM A;  3EPZ A;  2CQQ A;  2FEZ A;  2KFD A;  4MO7 A;  1B8I B;  1MBJ A;  1IXC A;  1XSD A;  3RQ4 A;  3LSG A;  2VC0 A;  5C44 J;  1FYM A;  1WH7 A;  2XGE A;  3ZN1 A;  1S72 I;  5F0H A;  1E3H A;  2M7A A;  2JPC A;  3TDU C;  1HW2 A;  5GAE J;  3GFL A;  1FSE A;  5HLH A;  1WPK A;  1ERD A;  1UAA A;  3A1Y A;  3I55 I;  1O4X A;  1OCT C;  3C2B A;  3BG3 A;  2KZV A;  1FZP B;  1R5G A;  2NXN B;  2CRG A;  3AG3 H;  3ERE D;  1HKT A;  1SAN A;  2DA5 A;  1XMA A;  1TTY A;  4FQG A;  3P9I A;  1YX3 A;  2RNG A;  3CJT B;  2VB6 A;  1QRY A;  3KZI C;  5J40 A;  2PEX A;  4GGG A;  2OBP A;  1W5S A;  3ASN H;  3MMY B;  3QQA A;  2L54 A;  3ZGK A;  1BC7 C;  2R7Q A;  3G1O A;  5HDG A;  1J5Y A;  1JJ8 C;  1FOX A;  3V8K A;  2VPL A;  2IJL A;  4F55 A;  3FK6 A;  1TT0 A;  3AFH A;  3JSP A;  2COB A;  4ZDP A;  2X6O A;  2W25 A;  5GTH C;  2YPR A;  2Y9Z A;  4IQJ A;  4BXX J;  2UZK A;  1VF9 A;  2L4A A;  3QAH A;  3CMM A;  3DEE A;  4XSZ F;  5DD8 A;  2XF5 A;  3RYP A;  4MNU A;  4RGS A;  2NVU B;  5K7F A;  2EA2 A;  2LKP A;  4CYD A;  3EQL F;  1BIB A;  1V3F A;  4MFE A;  4XLH A;  1TBX A;  3SFI A;  2VT2 A;  3G2B A;  2DA3 A;  3IAS 2;  3QRF F;  1LEB A;  2PQ8 A;  2XGX A;  2PBI A;  1YIJ I;  3M9A A;  1JTY A;  4Y15 A;  1B4A A;  3MWM A;  4EJW A;  3AG4 H;  2DJN A;  2W84 A;  3ZXS A;  3PNT A;  3E6D A;  2FMY A;  2JSC A;  3NQO A;  4MLO A;  3PSF A;  3OYJ A;  4LLN A;  5DD4 A;  4E7L A;  2CV2 A;  3I4N J;  1X1D A;  2LR8 A;  2V9P A;  3CCE I;  1T56 A;  4IOC F;  2LF8 A;  1S7O A;  5EG0 A;  4NHJ A;  3S2H J;  1QQI A;  1IGN A;  2BY3 A;  3IH3 A;  3OS0 A;  1NK2 P;  3A01 A;  1FY7 A;  2LYC A;  2MLK A;  4A69 C;  4XQF A;  3M8J A;  4KNY A;  5D4R A;  3BLY A;  4MEY F;  4AM3 A;  1IDY A;  1U6G A;  4QLC U;  1ZGJ A;  3LNQ A;  4C2T A;  1F36 A;  5FRN A;  2Q0O A;  3BQY A;  3JAM K;  3F21 A;  2NAZ A;  4FCY A;  4RM3 A;  1DGR M;  1APL C;  3PQJ A;  5F1J A;  1ZHF A;  2AO9 A;  1J9I A;  1SFK A;  4MTE A;  4BY7 J;  4E7I A;  5FLX K;  3KP2 A;  3GLL A;  4B8X A;  2R7V A;  4AD9 A;  4IJA A;  3BOQ A;  4PK4 A;  3WOD F;  3ECO A;  1X2M A;  3GFM A;  2NS0 A;  1KU3 A;  2WBM A;  1LFP A;  3CUQ B;  2CV1 A;  2HI3 A;  2XB0 X;  2HEO A;  3FKI J;  4FHT A;  3VOE A;  3P5J A;  3LOC A;  4EJU A;  2FQ4 A;  1GLN A;  2UUZ A;  4KMF A;  2NVY J;  1BJZ A;  3DXJ F;  1H88 C;  3ABU A;  1F4K A;  2GIZ A;  3QOP A;  4N4O B;  2H09 A;  3E3V A;  2E5N A;  2OA4 A;  1IXS B;  3F72 A;  5E17 F;  2OUM A;  1W0T A;  5E1X A;  4JYK A;  1XGN A;  4XRM A;  1LFU P;  1EJ9 A;  4X6A J;  1N78 A;  5KNL A;  1V5E A;  2QEX I;  1K78 B;  3JTH A;  1DDN A;  1B59 A;  2E5Z A;  4DGW B;  1L3L A;  2F4O B;  2OJE D;  4LFU A;  4DYC A;  4HPQ A;  1I39 A;  2KIS A;  1WRJ A;  1FBS A;  4A0Y A;  4M9Z A;  1IF1 A;  1H9G A;  1T6S A;  1XN7 A;  3HUG A;  1BC8 C;  5DCM A;  3RKW A;  1G6N A;  3KP4 A;  3QP5 A;  1ITY A;  3HJE A;  2Y0S N;  5EEG A;  1IJW C;  1UZC A;  3L2U A;  3K70 C;  4BS9 A;  1XCB A;  4RB2 C;  4ZC3 A;  1VQP I;  1ORK A;  2GQQ A;  3G4S I;  2WAQ A;  2BYV E;  2P8T A;  3TDZ C;  3PFY A;  1RR8 C;  1MBG A;  1X1B A;  1U78 A;  4G8X A;  4I01 A;  4Q5S F;  3A03 A;  4OMZ A;  1O3Q A;  3UNG C;  4N9I A;  4D7M A;  1VQ4 I;  1RI7 A;  5LGU A;  4DBQ A;  3WTY C;  3I3L A;  3JAM Z;  1LFB A;  2DW4 A;  3SDG A;  4YIF A;  1X4P A;  2M8G X;  1BI1 A;  3OYD A;  2O0Y A;  3B73 A;  3KCC A;  4BBR J;  3WTS C;  4HNU A;  2EFN A;  3CCM I;  5FLX Z;  4BE1 A;  5DTD A;  4JX6 A;  1TT5 B;  4CYC B;  2B63 J;  1Y0U A;  4GFB A;  4EAT A;  2V1X A;  3R60 A;  1IRG A;  1XGO A;  2DK5 A;  2QWW A;  3TOA A;  1W7P D;  4CSW A;  3PUB A;  2X9D A;  1P4W A;  2OQG A;  1NTC A;  1GV2 A;  2CMP A;  3H9J A;  2R7X A;  3IWF A;  1U3E M;  3FBI B;  1WI3 A;  2X1E A;  2QVO A;  3ELK A;  3L7W A;  3PSI A;  3BZ6 A;  3K4L A;  3WTU C;  2M0C A;  2DQL A;  2DJI A;  3FZV A;  4BAY A;  2L2O A;  3KEY A;  3CTA A;  4EJO A;  1VQ6 I;  2A07 F;  2FUG 2;  2HZD A;  4XMY A;  1RUO A;  4G9Y A;  4IO9 F;  4XID A;  5IT3 A;  4KYW A;  3ZQH A;  5FRO A;  2EB7 A;  3GXO A;  3I71 A;  3L09 A;  5IT9 K;  4MHG A;  3K4C A;  3IH2 A;  1IV8 A;  2OZU A;  2F2E A;  2DQR A;  1VQL I;  3GF2 A;  3LL7 A;  2P5K A;  3HZJ A;  1S9H A;  2VL8 A;  1FWZ A;  2P7V B;  1QU3 A;  3HBL A;  3FM5 A;  4BHP A;  3H1C A;  4IVN A;  4B44 A;  1H9T A;  3S1N J;  1FMW A;  2CUF A;  2WC2 A;  2F4I A;  4CZC A;  2FJ1 A;  3F0C A;  2Z16 A;  5GP9 A;  2KT0 A;  2L9N A;  4OAZ A;  2VKH A;  2BZT A;  4C2U A;  2H1K A;  3A0B C;  2FOW A;  3JRG A;  3HOY J;  1WSU A;  1HOM A;  1XSV A;  3OSG A;  5LBQ A;  1U9N A;  1YHQ I;  4IXA A;  3DQV C;  3S2D J;  1L0O C;  1ON2 A;  2FE3 A;  3HHG A;  5B1B H;  1VQ7 I;  2UWM A;  5TRD A;  4BQN A;  4JOM A;  2DDA A;  4A3K J;  4RM2 A;  2ZCW A;  5E20 A;  4LG0 A;  1RET A;  2K9L A;  4HOB A;  3SYT A;  3T8R A;  4KIG A;  2GA1 A;  1T98 A;  5BNG A;  1PDN C;  4G12 A;  4XLP F;  3QPL A;  3A0H C;  4PGH A;  4HX7 A;  1PP7 U;  3D5S C;  4ZZD A;  2LNB A;  1TC3 C;  1M1E B;  1UHW A;  4GRI A;  2MGQ A;  1PUE E;  2JA6 J;  2R4G A;  3ULQ B;  2V9K A;  1JT0 A;  2CG4 A;  2VI6 A;  4EM0 B;  3OR1 C;  5DUK A;  5F64 A;  2DMU A;  2JRT A;  2CYY A;  2RAE A;  5EGO B;  4IF4 A;  3HOS A;  2R7Z J;  1JGS A;  4AIH A;  2P5V A;  4BH9 A;  1XCV A;  1V55 H;  1D3Y A;  1UJ8 A;  2XPU A;  3G71 I;  4EGY A;  3DU5 A;  2JUC A;  2VBY A;  4KN4 X;  2XAJ A;  3SQN A;  3L2W A;  3CZ6 A;  3CCJ I;  5LGN A;  1W7P B;  3BPX A;  6PAX A;  4UVC A;  2PG4 A;  1OKR A;  4BL0 B;  3L2V A;  3VDX A;  3W6V A;  1TWG J;  2LY2 A;  2BOL A;  4OOI A;  2YX7 A;  5F6F A;  1G59 A;  4IKF A;  3HM5 A;  3T5X A;  2ZO4 A;  2X6W A;  4A3M J;  2ZNZ A;  3PNY A;  4IOA F;  1LE8 A;  1FPQ A;  1OIS A;  2BW3 B;  2ESN A;  1YRN B;  5IT9 Z;  2WWY A;  5CJ9 A;  3BTL A;  2EIJ H;  2GZW A;  1ZR2 A;  5TJJ A;  4JQF A;  1MH3 A;  3ABT A;  5E8I A;  3D1N I;  5ICG A;  3F9K A;  3K4M A;  4RAG A;  2K4B A;  3FXK A;  1Z05 A;  3IH4 A;  3FKJ A;  1LNW A;  3MCZ A;  4PUS A;  2HTS A;  2IRF G;  2CV0 A;  4KIS A;  3TP3 A;  2IT0 A;  2QGU A;  2DOE A;  1WKM A;  4HF0 A;  4L5I A;  4UVB A;  5E79 C;  2ZSH B;  2QSF X;  3E5X A;  3IL2 A;  1QNT A;  2HOT A;  3WTV C;  3MKZ A;  4RAY A;  4ZYA A;  5HLG A;  1FX7 A;  1H8A C;  4B47 A;  4EM2 A;  3S14 J;  4ZYD A;  1IN8 A;  3AKZ A;  2R93 J;  3W2W A;  2F4M B;  3RZD J;  5D6F A;  1IRZ A;  1LDJ A;  1KA8 A;  4RS8 A;  5CKT A;  2HQA A;  3HSE A;  4D1Q A;  1SD5 A;  1G3T A;  1Y1V J;  2K5C A;  2XRL A;  3KYC B;  4FET A;  4H0E A;  4XLA A;  3L2C A;  4UV8 A;  1JUP A;  1VTN C;  2GOX B;  3GTM J;  4WCG A;  2M4G A;  4U87 A;  2KRC A;  1SFX A;  2JTV A;  1OYW A;  1SD4 A;  2DMQ A;  3CME I;  4P55 A;  2JT1 A;  4NBQ A;  2VUM J;  2RQQ A;  1T33 A;  2HDD A;  2M8E A;  3PO3 J;  2EFQ A;  3CP2 A;  3CCY A;  2G0E A;  2BHY A;  4MTD A;  1JKQ C;  3DKW A;  4W1U A;  4XKB A;  3BP8 A;  3OYL A;  4ETS A;  4ENJ A;  5F04 A;  1S6L A;  5FKN A;  4B43 A;  2OV7 A;  1IV6 A;  4XLF A;  2X0L A;  2H1L A;  1FBQ A;  2ECB A;  3HEF A;  3AG1 H;  4ESJ A;  4O6J A;  1NHA A;  4KA4 A;  1VZ0 A;  5CQE A;  2W7N A;  1N75 A;  2ELJ A;  2HKX A;  3VYT B;  2WTE A;  4IEJ A;  4XL9 A;  4O5V A;  2OCC H;  2HPI A;  2DFF A;  2XDV A;  5EZH A;  1DGW Y;  2IEK A;  1F5T A;  3BR3 A;  2HGC A;  3DPL C;  3ZCO A;  1XDS A;  2ZB9 A;  5LFA A;  2BY1 A;  2Q2E B;  3HDD A;  3IAM 2;  3PUF A;  4ZZL A;  1TQM A;  5E1Z B;  3VPR A;  5E18 F;  1YW9 A;  2GXB A;  3C3W A;  3KLN A;  3DTK A;  2R5Z A;  1SMT A;  2HNH A;  2P81 A;  4EVI A;  3DCF A;  3FXU A;  1F1Z A;  1BI3 A;  5FD6 A;  1S8N A;  4MGR A;  4IHX A;  2O5R A;  3EUA A;  4OIR F;  2O8X A;  3L2Q A;  3DBH B;  1DP7 P;  3ZN0 A;  2CFO A;  2IGK A;  1QZZ A;  3HOU J;  3VSL A;  4BDY A;  5GTI C;  3FMQ A;  3K2Z A;  3GME A;  2CQN A;  2JPB A;  2HTJ A;  2V9V A;  3U2R A;  5F1R A;  3PIP F;  3BY6 A;  3CUO A;  4U0Y A;  4YEL A;  3QPT A;  2JA7 J;  3ROU A;  2STW A;  1FTT A;  1U5T A;  1ZYR F;  2Y48 A;  3OYA A;  1HCR A;  2H27 A;  3SHF A;  5A2Q K;  2NS8 A;  2HXO A;  1NH3 A;  4RB1 A;  1N25 A;  4N9H A;  2P7C B;  2QYO A;  1BI0 A;  2FU4 A;  1BBY A;  2GIV A;  1JKP C;  1W0U A;  3RQI A;  2IPQ X;  5H6Q A;  4BJ6 C;  3SJM A;  1J09 A;  3IWZ A;  2GAU A;  4Y33 A;  2MG4 A;  1D1B A;  2PMU A;  2RNJ A;  2DYR H;  2L01 A;  4OIP F;  3K4K A;  1FLI A;  4XOP A;  5E3O A;  1PUF B;  5TGT A;  1ZLJ A;  2JUG A;  4NUB A;  2D1H A;  1ZH5 A;  2ZXJ A;  3E0J B;  3CO7 C;  1WZ2 A;  4P9F A;  3HOZ J;  4XRS G;  2VE9 A;  3GTO J;  2MW8 A;  1D8J A;  2E19 A;  1R22 A;  4WK8 F;  2K27 A;  4QIW N;  2EZK A;  1SMY F;  4BQA A;  4BU2 A;  2RN7 A;  4BHB A;  2EIM H;  5K5R A;  4AVZ A;  3ONQ A;  3HTU A;  4DYQ A;  2V1U A;  2K40 A;  2LLK A;  3K70 D;  1QPM A;  1BI2 A;  1FOY A;  2BE5 F;  2O6G E;  1JKR C;  1RIO H;  1X58 A;  4PGG A;  3VB2 A;  1BW6 A;  5ILV A;  1J2X A;  3CD6 I;  5LD2 C;  3I54 A;  2BV6 A;  2E1M C;  1HKS A;  2QQ9 A;  5DM7 F;  5LHG A;  4V2G A;  1ZLK A;  1IC8 A;  2FML A;  1YLF A;  4QWQ A;  1ZGW A;  3WE3 A;  3HPG A;  2MYS A;  4Q4Z F;  2DPD A;  2JA5 J;  4LB5 A;  1XX5 A;  3L1P A;  2H8R A;  4KT6 A;  1X19 A;  4B4C A;  2CQK A;  3WGI A;  3HSF A;  5DYM A;  2JQ7 A;  1ETX A;  1U5T C;  1VND A;  2DYS H;  1MDM A;  1E17 A;  1ETY A;  4E7Z A;  2IA0 A;  3T1B A;  3GTQ J;  5L3F A;  2EV0 A;  2IS1 A;  1W1W E;  3ZQC A;  4NB5 A;  2DN0 A;  1U8R A;  1U2W A;  4U7D A;  2ZXI A;  4XON A;  3VWB A;  1T8I A;  2CWE A;  3ZPL A;  1BM9 A;  2WAQ N;  3ZQF A;  1HXD A;  3KE2 A;  2R0Q C;  1JTX A;  4U88 A;  2UXX A;  3GW2 A;  1TWC J;  3A2K A;  1R9T J;  4ZTF A;  1FP1 D;  4ENN A;  1UMQ A;  4C2M J;  1Z6T A;  2CUJ A;  4I0B A;  5A2Q Z;  1LVK A;  3OOP A;  2LOO A;  5M3M J;  2UV1 A;  1W4M A;  2AXL A;  5E3M A;  3N05 A;  2EH3 A;  3F8F A;  4CH7 A;  1QVT A;  2HOE A;  2R7W A;  3VYR B;  3BJO A;  1UST A;  3J7A O;  4HSR A;  3TO7 A;  4AUX A;  4EJV A;  1T38 A;  1Z67 A;  3BG9 A;  3HYI A;  3S1R J;  1V4R A;  2LD5 A;  3JRF A;  5J1Y A;  5FB2 A;  3HRT A;  1YTY A;  5IYD J;  2PJR B;  1HW1 A;  1EKE A;  1RKW A;  3BT9 A;  5D5U B;  4LK0 F;  3B02 A;  4CDG A;  2DTZ A;  4P5O A;  2JRM A;  1TW3 A;  5DDG A;  4B3A A;  1VQN I;  1KON A;  2BBY A;  2LDU A;  1YO5 C;  2VN2 A;  1P7I A;  2E34 A;  1MMD A;  5IYC J;  1IO2 A;  1YOV B;  2LC2 A;  2COM A;  2HQ5 A;  5F08 A;  3LQQ A;  4AIK A;  2ELK A;  2NVT J;  5CLS A;  3M07 A;  1B6A A;  4BHC A;  3DBR B;  1YS7 A;  4MIM A;  3KP5 A;  3HG9 A;  1RC9 A;  3LFK A;  4C3J J;  3I58 A;  4KIB A;  1UB9 A;  3KYL A;  2MAB A;  4BKX A;  3O8G A;  2ZME A;  4BEH A;  2MD5 A;  4ZYE A;  2CU7 A;  3K7A J;  4X0G A;  3DU6 A;  3ZMT A;  4HLX A;  1GVJ A;  3OYH A;  2KIF A;  3QWL A;  2ZC2 A;  4FE7 A;  4LJZ F;  5D6E A;  1B8I A;  4UB6 C;  2QQA A;  3CDI A;  1ETQ A;  3HRS A;  4IHV A;  3MAJ A;  2YS9 A;  1Y0N A;  2O9L A;  5HS9 A;  1IN7 A;  4IPA A;  2STT A;  3NWS A;  1YE9 A;  4PFP A;  3ABL H;  2L9R A;  2I8D A;  1FC3 A;  1R00 A;  1FMV A;  3KYD B;  1SD7 A;  2B9S A;  3RI4 A;  1ZQ3 P;  2D2W A;  3CF2 A;  2IW5 A;  2DFE A;  3V7R A;  2K7L A;  1SEU A;  3ZQ7 A;  3BCB A;  3MKW B;  1WFX A;  2PMZ A;  1QBJ A;  5LHI A;  2KRH A;  1FOK A;  3RZO J;  3EYY A; 
#chains in the Genus database with same CATH homology
 4JK1 X;  1AOY A;  4G94 A;  3KLO A;  3RDI A;  3F8B A;  2EFW A;  1REP C;  2G7U A;  1LVA A;  4LMY A;  2VXZ A;  1ZRE A;  3NEU A;  4Q48 A;  1KU9 A;  1WQ2 A;  5DCF A;  1YIO A;  1AWC A;  2H94 A;  2FA5 A;  4YG2 F;  2DBB A;  2M5W A;  3PFI A;  4CIC A;  3KEQ A;  1EV7 A;  1XMK A;  2KRF A;  4YII A;  1SD6 A;  2W24 A;  4LGW A;  1QGP A;  1QO0 D;  1O7L A;  2G9W A;  2FQ3 A;  2F5F A;  2RDP A;  1LDK B;  2A69 F;  1XD7 A;  2HQN A;  5DUI A;  4KMU X;  5ICC A;  1IN4 A;  2VE8 A;  3I0T A;  4BXU A;  3RJP A;  4S04 A;  3GFI A;  4HW0 A;  1Z6R A;  3GLX A;  4A6D A;  2ZBK A;  4M6Y A;  3U9G A;  4YFX F;  3IHU A;  4D0P A;  1ZAO A;  3Q9V A;  3GX4 X;  1CF7 B;  4LD5 A;  5L3D A;  4UNO A;  1KQ8 A;  2D1V A;  4UUV A;  3I64 A;  1WI9 A;  3CUQ A;  1TW2 A;  4L0Y B;  3GFJ A;  3KET A;  4XSX F;  1SFE A;  2IVM A;  2YX4 A;  3R0J A;  4KT5 C;  2YR2 A;  3JW4 A;  2MC3 A;  2DI3 A;  3F22 A;  3W6J B;  1ODD A;  2NNN A;  4L9N A;  3I5U A;  4Z2Y A;  1T39 A;  5LEJ A;  3FXQ A;  2R7F A;  4I0A A;  2E7X A;  2W85 A;  2L02 A;  3H3Z A;  4HZF A;  3C18 A;  4CO8 A;  2A3S A;  1I1G A;  4KFC A;  1P6R A;  4L9V A;  4B09 A;  3E6C C;  1I5Z A;  4AWX B;  3QPH A;  3F8N A;  4MEX F;  2ZNY A;  2GA2 A;  2Y0M A;  3R61 A;  1KQ0 A;  2CW0 F;  1Z91 A;  1CGP A;  5HDK A;  2NYX A;  1MZB A;  3ZMZ A;  3CUQ C;  3WTZ A;  1EH7 A;  3ZMU A;  2EWN A;  2FBK A;  1STZ A;  2FNP A;  3J81 K;  1YW7 A;  2H6C A;  4M6X A;  1HBX G;  1YW8 A;  2FSW A;  1LDD A;  2DLL A;  4WX9 A;  1JXS A;  1IN6 A;  5D4S A;  2VON A;  1JHH A;  1HST A;  2XVC A;  4PCQ A;  3FWE A;  3H3U A;  1LEA A;  4EV0 A;  1O57 A;  4DNC A;  3K1N A;  4EJT A;  1D5V A;  4HQE A;  1ZG1 A;  4Y17 A;  2HS5 A;  1FNN A;  3VEP A;  3I59 B;  2QBY B;  4A5N A;  5L3B A;  3LQR A;  3RKX A;  1ZGA A;  5LGT A;  4R8H A;  1DPR A;  2O61 A;  4KIF A;  3DEU A;  1BN5 A;  1USS A;  1MJ9 A;  4XBF A;  4CXF A;  1K6O A;  1ONV A;  1JE8 A;  1D8K A;  5AON A;  3CO6 C;  2OD5 A;  2IA1 A;  3F3X A;  5D5X B;  4RGU A;  3Q9S A;  3MEX A;  2V1D A;  2R7D A;  4EMS A;  3TOB A;  2Z5U A;  1TQP A;  4I2O A;  4UXN A;  3J81 Z;  2H6B A;  4RB3 C;  1ZG3 A;  2V6C A;  4M9X A;  1OMI A;  1KQ9 A;  1MGT A;  3V8J A;  4M9S A;  4OIO F;  5ERI A;  4WWC A;  1R23 A;  3GEZ A;  2MBF A;  1FP2 A;  3TO9 A;  3SZT A;  3OV8 A;  5E1W A;  2Z33 A;  2PN6 A;  2VOO A;  4HV6 A;  1R1V A;  2DT5 A;  4GO1 A;  2TDX A;  4S05 A;  1IAW A;  3SXY A;  3IC7 A;  1SAX A;  1HKQ A;  5D8L B;  2G7H A;  5L3G A;  2NRA C;  3FM3 A;  4ESB A;  2K86 A;  3L9F A;  4AIJ A;  2EFP A;  3E5U A;  3KFW X;  5J8C A;  1XSX A;  2VOD A;  1G3S A;  3EET A;  2DPU A;  3HSR A;  4CZZ A;  4L9T A;  1IXR C;  2VBZ A;  5BS6 A;  2JZY A;  4RAZ A;  1I1S A;  3P9C A;  3V8L A;  4L18 B;  2ZFW A;  3G3Z A;  2DFI A;  1K7A A;  4IRG A;  3WGH A;  3TO6 A;  1J0R A;  5BMZ A;  1GXQ A;  2YU3 A;  3F6V A;  3T0Y A;  2L3D A;  1R1T A;  3AAF A;  4KIC A;  5J6X A;  2A6E F;  3EYI A;  3Q5F A;  2P6S A;  4A12 A;  3R4K A;  2J5O A;  2BGC A;  1EH8 A;  2MH9 A;  3CJN A;  3VFZ A;  3BWG A;  3E5Q A;  3QU3 A;  4AVP A;  3LWF A;  3RKY A;  4L0Z B;  2M45 A;  2ZKZ A;  3HIF A;  2XKP A;  2PLY A;  2HDC A;  3ZP5 A;  3QU6 A;  5L3E A;  2NNY A;  2E1N A;  3TQN A;  1TQI A;  2OU2 A;  2ISZ A;  1T2K A;  2Q2E A;  3GUD A;  2EFO A;  4RB0 A;  2KKO A;  4WF2 A;  3KP7 A;  2EK5 A;  4HYE A;  4L9J A;  2PMH A;  3CLO A;  3GO5 A;  2FXA A;  5ILU A;  4RGR A;  1GHC A;  1J75 A;  2DK8 A;  4KN7 X;  3HOT A;  2A68 F;  3KP6 A;  1QZY A;  5FD5 A;  3GWZ A;  2KJB A;  1KYZ A;  3WE2 A;  3C7J A;  3P7N A;  4GYI A;  5FFZ A;  2HZT A;  2E1C A;  5CYV A;  1IRF A;  4HA8 A;  1ON1 A;  4M73 A;  4TV7 A;  4N0B A;  4U0V A;  4XRF A;  1B9M A;  5CVR A;  1I27 A;  1FSH A;  1XDU A;  4R79 A;  3K69 A;  4BYY A;  3U1D A;  3I53 A;  3WG9 A;  2GXG A;  2HKO A;  1DUX C;  1RUN A;  1ZN2 A;  2KJC A;  2KIU A;  1O7F A;  4M74 A;  2Z99 A;  1GXP A;  1P4X A;  1OYI A;  1R7J A;  1O3S A;  2X4H A;  3V4G A;  1MD0 A;  1UFM A;  2CFX A;  2HR3 A;  3DP7 A;  3TGN A;  1X3U A;  3BDD A;  4GCV A;  4P96 A;  5H6R A;  5HOO A;  4HV5 A;  3C1D A;  1Z7U A;  2ELH A;  4M71 A;  2DAO A;  5FO5 A;  4WXH A;  1ULY A;  2ETH A;  3D5L A;  3I4P A;  2XV4 S;  2EV5 A;  4A6E A;  3GYH X;  2PFB A;  2Z9O A;  3TKY A;  2OAZ A;  1P92 A;  2LSO A;  3H92 A;  2VOP A;  2ZJ2 A;  3RIR A;  1H0M A;  4O3M A;  2XRO A;  2KIM A;  1UCR A;  4WXD A;  2XHK A;  4OIN F;  3K1P A;  2XAG A;  5HDN A;  1PP8 F;  3DFG A;  3RYR A;  2LF7 A;  4ON0 A;  3K1M A;  4ESF A;  2IA2 A;  4UVA A;  3KEO A;  2M30 A;  1LJ9 A;  1TNT A;  3IRQ A;  2QM3 A;  1E2X A;  1R58 A;  5ILS A;  4U7B A;  1Z1D A;  2RV8 A;  2VT3 A;  3J80 K;  2RVC A;  2OQR A;  3RPQ A;  3K0L A;  2GWR A;  2MLG A;  1EH6 A;  4G6Q A;  3NRV A;  1S7A A;  1TNS A;  1C0W A;  2O3F A;  1ZRD A;  1P2F A;  3JSO A;  4ENK A;  5DCM B;  2YSR A;  3FX3 A;  3EDP A;  2D45 A;  3ECH A;  4UHT A;  1ZG5 A;  4I02 A;  5D8K B;  5JVT A;  4UV9 A;  3WTX C;  2XAF A;  3REO A;  1Q1H A;  5E8G A;  5L3C A;  3FMR A;  3SFZ A;  1K79 A;  4PDK A;  2UXN A;  3QP6 A;  5H20 A;  3DF8 A;  4Q47 A;  3F8M A;  4A2U A;  2RQP A;  2P5L C;  5K5O A;  2EA4 A;  3G73 A;  4CGZ A;  1W5T A;  2EJR A;  2ACJ A;  3GZ6 A;  3IKT A;  2DTR A;  1JHF A;  4OMY A;  3KP3 A;  4A5M A;  5ED4 A;  3PQK A;  2R3S A;  1YQA A;  1FYL A;  1YG2 A;  4FX4 A;  4KUM A;  3J80 Z;  2FNA A;  2A5Y B;  2O03 A;  4HF2 A;  4JBA A;  2XRN A;  4KDP A;  5HVQ C;  4ENM A;  3FF5 A;  4IHS A;  4E70 A;  1OPC A;  3E97 A;  3V7S A;  3M7G A;  1K78 A;  1DPU A;  2M87 A;  2HWV A;  4G7O F;  1YFH A;  2RC4 A;  4HAM A;  1O3T A;  4HQM A;  4LG0 B;  2A6H F;  5ICE A;  5LHH A;  3F23 A;  1CF7 A;  3P9K A;  4HDU A;  2PI0 A;  2W57 A;  1LB2 A;  3HRM A;  4U0W A;  3ZMS A;  5BPD A;  3MZH A;  2AS5 F;  2VBW A;  3M8F A;  3HHH A;  2DO7 A;  3DV8 A;  2A61 A;  3M1E A;  3R0A A;  1S3J A;  5AIP A;  1HSJ A;  5HS8 A;  1G3Y A;  1FT9 A;  2BEO A;  1OR7 A;  2FRH A;  3BJA A;  2EV6 A;  2XAS A;  2XKO A;  3JTG A;  1ZRC A;  1WWX A;  4P9U A;  4MQ9 F;  3M8E A;  3V7C A;  4GYG A;  1J7K A;  3LST A;  3LA3 A;  5FFX A;  4I7H A;  3LAP A;  1R1U A;  3LA7 A;  5D5V B;  2Q8K A;  4RGX A;  4PZJ A;  3IKV A;  3DPT A;  3ZMV A;  1ZRF A;  2CO5 A;  2Y75 A;  4HLY A;  4FT8 A;  4EM1 A;  3SZP A;  5LRR A;  3VOD A;  5JI6 A;  1UHM A;  2M1B A;  3MZY A;  1XGM A;  1O3R A;  5KVR A;  3EUH A;  1KU7 A;  2B0L A;  4M72 A;  3COA C;  5KK1 A;  4YFN F;  3LA2 A;  3KZZ A;  3BJ6 A;  3WTT C;  2XUB A;  5BQT A;  4LK1 F;  2QZ8 A;  4OIQ F;  1F9N A;  5ICF A;  2P4W A;  3O6B B;  3K9T A;  2HFH A;  3FHZ A;  5HS7 A;  4I09 A;  2IP2 A;  3S2W A;  3WTW C;  1FBU A;  1R5H A;  1J59 A;  1IW7 F;  2CSO A;  2RKH A;  2L4M A;  2QUF A;  4IHT A;  3BRO A;  2XIG A;  3N4M A;  3HTS B;  3I59 A;  1BIA A;  2HYG D;  2QBY A;  5BPI A;  4F7Z A;  2ISY A;  3GVA A;  1W7P A;  3KZY A;  4ZYH A;  3D0S A;  1RNL A;  3RPU A;  5J8F A;  2ESH A;  4L5J A;  3F8C A;  5CVU A;  5K1Y A;  4IRH A;  4EGZ A;  1KGS A;  4G7Z F;  2VBX A;  1RZ4 A;  5DV5 A;  5LLQ A;  2RGV A;  5BOX A;  3T8T A;  5D5W B;  5JHU A;  4DQ2 A;  1XGS A;  3ZMD A;  5CVI A;  2PJP A;  1G3W A;  2FOK A;  1U5T B;  5JR3 A;  1B9N A;  3O2P E;  5EEH A;  2DU9 A;  3E6M A;  5FGM A;  3HRU A;  1MJA A;  4ZH4 F;  2FBH A;  2F5D A;  2V79 A;  3L00 A;  3W6K B;  1TLH B;  3CDH A;  3GZ5 A;  2QLZ A;  4HX4 A;  5K5Q A;  3WU1 B;  3ML6 A;  3F6O A;  4HX8 A;  2XAH A;  1LQ1 A;  2CGP A;  2QEN A;  2Z3Y A;  4LB6 B;  1KYW A;  2FBI A;  1HQC A;  4FX0 A;  4I98 B;  4G7H F;  3O3K A;  4ZYG A;  2MA3 A;  1Z9C A;  4Y13 A;  4CHU A;  1I6X A;  1OYY A;  3E6B A;  1T0F A;  2XAQ A;  3FMS A;  4WXC A;  4HBL A;  5CVJ A;  2E7W A;  4R1H A;  3BPV A;  1R36 A;  4HDV A;  2K02 A;  5LRS A;  1MDM B;  2C6Y A;  4MQV A;  2J5P A;  4LLL A;  3MQ0 A;  2OZ6 A;  1SFU A;  4ASN A;  3N97 A;  1P4A A;  2WV0 A;  3WU0 A;  5AIQ A;  2F5E A;  4A0Z A;  2FF4 A;  4YFK F;  4IRI A;  3LAJ A;  2MH2 A;  3FXR A;  1IZ1 A;  1G4D A;  2K4J A;  1YS6 A;  4BNC A;  3ISP A;  3RTR A;  5HLI A;  4A0X A;  2P6T A;  4K2E A;  2HYF A;  1B1B A;  5DEQ A;  1A04 A;  5LEK A;  4HF1 A;  2F5C A;  1BJA A;  4XLN F;  2QQB A;  1FYK A;  4LLG F;  1XB4 A;  2VC1 A;  1YYV A;  4OU0 A;  2HQR A;  1BOA A;  4EQQ A;  1IUY A;  3MFK A;  1IN5 A;  1MJB A;  5JFR A;  1KU2 A;  1S29 A;  4GXO A;  4G6D A;  2ADU A;  3WGG A;  1ZAR A;  1HW5 A;  2ZME B;  4NQW A;  3R6S A;  1MKM A;  2FEZ A;  1XSD A;  1IXC A;  2VC0 A;  1FYM A;  3ZN1 A;  2JPC A;  3TDU C;  1HW2 A;  3GFL A;  1FSE A;  5HLH A;  3EYY A;  1FZP B;  1R5G A;  3ERE D;  1HKT A;  1XMA A;  1TTY A;  3P9I A;  2PEX A;  4GGG A;  2OBP A;  1W5S A;  2L54 A;  1BC7 C;  5HDG A;  1J5Y A;  3V8K A;  2IJL A;  3JSP A;  2W25 A;  2YPR A;  2UZK A;  3QAH A;  2L4A A;  4XSZ F;  5DD8 A;  3RYP A;  4MNU A;  4RGS A;  2EA2 A;  2LKP A;  4CYD A;  3EQL F;  1BIB A;  1V3F A;  1TBX A;  2VT2 A;  3QRF F;  1LEB A;  2PQ8 A;  2XGX A;  2PBI A;  3M9A A;  4Y15 A;  1B4A A;  3MWM A;  4EJW A;  2W84 A;  3E6D A;  2FMY A;  2JSC A;  3NQO A;  4LLN A;  5DD4 A;  2LF8 A;  1S7O A;  4NHJ A;  1QQI A;  1FY7 A;  4KNY A;  2MLK A;  5D4R A;  4MEY F;  1U6G A;  4QLC U;  1ZGJ A;  2Q0O A;  3JAM K;  3F21 A;  2NAZ A;  3PQJ A;  1ZHF A;  1J9I A;  4MTE A;  5FLX K;  3KP2 A;  4B8X A;  4AD9 A;  4IJA A;  3BOQ A;  3WOD F;  3ECO A;  3GFM A;  2NS0 A;  1KU3 A;  3CUQ B;  2HEO A;  4FHT A;  3VOE A;  4EJU A;  4KMF A;  3DXJ F;  3ABU A;  1F4K A;  3QOP A;  2H09 A;  3E3V A;  2OA4 A;  1IXS B;  3F72 A;  5E17 F;  5E1X A;  1XGN A;  1K78 B;  3JTH A;  1DDN A;  1B59 A;  1L3L A;  4LFU A;  1WRJ A;  1FBS A;  4A0Y A;  4M9Z A;  1IF1 A;  1H9G A;  1T6S A;  1XN7 A;  3HUG A;  1BC8 C;  5DCM A;  3RKW A;  1G6N A;  3KP4 A;  3QP5 A;  5EEG A;  1XCB A;  4RB2 C;  2GQQ A;  2BYV E;  2P8T A;  3TDZ C;  1U78 A;  4G8X A;  4I01 A;  4Q5S F;  4OMZ A;  1O3Q A;  4N9I A;  1RI7 A;  5LGU A;  3WTY C;  3JAM Z;  2DW4 A;  4YIF A;  1BI1 A;  2O0Y A;  3B73 A;  3KCC A;  3WTS C;  2EFN A;  5FLX Z;  1Y0U A;  2V1X A;  3R60 A;  1IRG A;  1XGO A;  2DK5 A;  2QWW A;  3TOA A;  1W7P D;  1P4W A;  2OQG A;  3IWF A;  1U3E M;  2QVO A;  3ELK A;  3L7W A;  3BZ6 A;  3WTU C;  2DQL A;  3FZV A;  4BAY A;  3CTA A;  4EJO A;  2A07 F;  1RUO A;  4G9Y A;  5IT3 A;  4KYW A;  2EB7 A;  3GXO A;  3I71 A;  3L09 A;  5IT9 K;  4MHG A;  2OZU A;  2F2E A;  2DQR A;  3GF2 A;  2P5K A;  1FWZ A;  2P7V B;  3FM5 A;  4BHP A;  4IVN A;  1H9T A;  2WC2 A;  1WSU A;  1XSV A;  5LBQ A;  4IXA A;  3DQV C;  1L0O C;  1ON2 A;  2FE3 A;  3HHG A;  2UWM A;  5TRD A;  2ZCW A;  5E20 A;  4LG0 A;  4HOB A;  3T8R A;  4KIG A;  2GA1 A;  1T98 A;  1PDN C;  4XLP F;  4PGH A;  4HX7 A;  1PP7 U;  4ZZD A;  2LNB A;  1UHW A;  1PUE E;  3ULQ B;  2CG4 A;  4EM0 B;  5DUK A;  5F64 A;  2JRT A;  2CYY A;  3HOS A;  4IF4 A;  1JGS A;  4AIH A;  2P5V A;  4BH9 A;  1XCV A;  1D3Y A;  4EGY A;  2VBY A;  4KN4 X;  2XAJ A;  3SQN A;  5LGN A;  1W7P B;  3BPX A;  6PAX A;  4UVC A;  2PG4 A;  1OKR A;  4OOI A;  2YX7 A;  5F6F A;  3T5X A;  2ZO4 A;  2ZNZ A;  1FPQ A;  5IT9 Z;  2ESN A;  2WWY A;  5CJ9 A;  2GZW A;  5TJJ A;  4JQF A;  3ABT A;  5E8I A;  5ICG A;  2K4B A;  1Z05 A;  1LNW A;  3MCZ A;  2HTS A;  2IRF G;  2IT0 A;  1WKM A;  4HF0 A;  4L5I A;  4UVB A;  3IL2 A;  3E5X A;  1QNT A;  3WTV C;  4RAY A;  5HLG A;  1FX7 A;  4EM2 A;  4ZYD A;  1IN8 A;  5D6F A;  1LDJ A;  1KA8 A;  4RS8 A;  3HSE A;  1SD5 A;  1G3T A;  4H0E A;  3L2C A;  4UV8 A;  1VTN C;  4WCG A;  1SFX A;  2JTV A;  1OYW A;  1SD4 A;  4P55 A;  2JT1 A;  2M8E A;  2EFQ A;  4MTD A;  3DKW A;  3BP8 A;  4ETS A;  4ENJ A;  1S6L A;  2X0L A;  1FBQ A;  4ESJ A;  4O6J A;  1NHA A;  4KA4 A;  2HKX A;  2WTE A;  4O5V A;  1F5T A;  2HGC A;  3DPL C;  1XDS A;  4ZZL A;  1TQM A;  5E1Z B;  5E18 F;  1YW9 A;  2GXB A;  3C3W A;  3KLN A;  1SMT A;  4EVI A;  3FXU A;  1F1Z A;  1BI3 A;  5FD6 A;  1S8N A;  4MGR A;  4OIR F;  2O8X A;  1DP7 P;  3ZN0 A;  1QZZ A;  3FMQ A;  3K2Z A;  2JPB A;  2HTJ A;  2V9V A;  3U2R A;  5F1R A;  3BY6 A;  3CUO A;  4U0Y A;  3QPT A;  3ROU A;  2STW A;  1U5T A;  1ZYR F;  2Y48 A;  2H27 A;  3SHF A;  5A2Q K;  4RB1 A;  4N9H A;  2P7C B;  2QYO A;  1BI0 A;  2FU4 A;  1BBY A;  2GIV A;  2IPQ X;  5H6Q A;  3IWZ A;  2GAU A;  2PMU A;  2RNJ A;  2L01 A;  4OIP F;  1FLI A;  1ZLJ A;  2D1H A;  1ZH5 A;  2ZXJ A;  3CO7 C;  4P9F A;  2VE9 A;  1D8J A;  1R22 A;  4WK8 F;  2K27 A;  1SMY F;  4BQA A;  2RN7 A;  4BHB A;  5K5R A;  3HTU A;  2V1U A;  1QPM A;  1BI2 A;  2BE5 F;  2O6G E;  1RIO H;  4PGG A;  3VB2 A;  5ILV A;  1J2X A;  3I54 A;  2BV6 A;  1HKS A;  2QQ9 A;  5LHG A;  1ZLK A;  2FML A;  1YLF A;  4QWQ A;  3WE3 A;  4Q4Z F;  2DPD A;  4LB5 A;  3WGI A;  2CQK A;  3HSF A;  5DYM A;  1E17 A;  1U5T C;  1MDM A;  2IA0 A;  3T1B A;  5L3F A;  2EV0 A;  4NB5 A;  1U8R A;  1U2W A;  4U7D A;  2CWE A;  3ZPL A;  1BM9 A;  1HXD A;  3KE2 A;  4U88 A;  2UXX A;  3GW2 A;  1FP1 D;  4ENN A;  1Z6T A;  4I0B A;  5A2Q Z;  3OOP A;  1W4M A;  2AXL A;  3F8F A;  2HOE A;  3BJO A;  1UST A;  3J7A O;  3TO7 A;  4EJV A;  1T38 A;  3HYI A;  1V4R A;  5FB2 A;  3HRT A;  1YTY A;  1HW1 A;  5D5U B;  4LK0 F;  3B02 A;  4CDG A;  5DDG A;  4P5O A;  1TW3 A;  2BBY A;  2LDU A;  1YO5 C;  2VN2 A;  2COM A;  3LQQ A;  4AIK A;  5CLS A;  1B6A A;  4BHC A;  1YS7 A;  3KP5 A;  3LFK A;  3I58 A;  4KIB A;  1UB9 A;  2ZME A;  2MD5 A;  4ZYE A;  3ZMT A;  4HLX A;  1GVJ A;  2KIF A;  4LJZ F;  5D6E A;  2QQA A;  3HRS A;  3MAJ A;  5HS9 A;  1IN7 A;  4IPA A;  2STT A;  1FC3 A;  1R00 A;  1SD7 A;  3RI4 A;  2D2W A;  2IW5 A;  3V7R A;  2K7L A;  3ZQ7 A;  1QBJ A;  5LHI A;  3IRR A;  1FOK A;  5CVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...