1TWGJ

Rna polymerase ii complexed with ctp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twgJ00
1MH4A 2DMTA 1MNMC 2TRTA 2GBYA 2XGEA 4JYKA 2E19A 5IP9J 5E3OA 1LFUP 3GTMJ 1JUMA 4J19A 1NK3P 3UKGA 2ME0A 2HXIA 4AYBN 3JREA 2XPUA 2O7OA 1GV2A 4JX5A 1D5YA 2MW8A 1LFBA 1MBFA 2VPRA 2HOTA 4M3FA 5DS9A 4RDUA 1RETA 2HQ5A 3WHCA 1Z0XA 3S15J 4A3CJ 1RESA 2LVSA 2Y0SN 5FJ8J 4BXXJ 1WH5A 3S1RJ 5EDNA 4A93J 3FISA 5F08A 5M5WJ 5C44J 2R5ZB 2R7ZJ 1VFCA 2DA1A 2GM4A 5IOZA 1IG7A 1BW5A 2DA4A 2CQQA 1FJLA 5JLXA 1B72B 3JRBA 3W6VA 3LSGA 5J1UA 2FQ4A 1OFCX 1WI3A 4DW6A 1ENHA 1UMQA 2R5YB 5F1JA 4A3BJ 3NAUA 1HOMA 3ZQIA 1XC5A 2CUEA 2JK3A 2GLOA 4A3IJ 3I4MJ 1TWFJ 2LR8A 1JT0A 4DZPA 2OF7A 3PO2J 2JA8J 2XSDC 3BTJA 3LSPA 1TWCJ 3GTLJ 1RR7A 1BL0A 3LNQA 2WB1N 4L5EA 2G0EA 4AUXA 2K9NA 1JGGA 3Q3SA 1BA5A 3BG9A 2X6OA 1OJLA 3JR9A 3ZQLA 4X1EA 2XGDA 3ZOBA 4B1RA 1MSEC 1ZKGA 1HCRA 5BNGA 3BR3A 5IOYA 4UUSA 1IDYA 3GTKJ 4XIDA 1P7JA 3DEWA 2DTZA 1GV5A 1G2HA 1JJ6C 2ID3A 2EH3A 3HBLA 2MGQA 2M2EA 2D5VA 1R9TJ 1FIAA 2XRLA 1WH7A 2LKXA 4V2FA 1JKQC 5M5XJ 1I3QJ 1MBKA 1ZTRA 5F0HA 2DMNA 1IC8A 2YS9A 3S16J 3GTGJ 1JTXA 2L7MP 4M3BA 3BTCA 1B8IB 2NOGA 4D7MA 2VUMJ 1JKOC 2B63J 4BBRJ 5M5YJ 2LLKA 3NARA 2CJJA 1Q1VA 1AKHB 5F0CA 1T33A 1IV6A 2DA6A 4S0HB 5EZHA 3HM5A 1T56A 5C4JJ 5M3FJ 2R5ZA 1FTTA 2L7FP 3JRFA 1LE8B 3F0CA 4B4CA 4UUSB 5IYBJ 3K7AJ 3H0GJ 2EZLA 2L7ZA 4MIMA 3JRIA 2HI3A 1POGA 3BTIA 1TC3C 3RQIA 2LD5A 5GP9A 2R5YA 4G12A 2QF7A 3BT9A 5FKMA 3S17J 4IHYA 2DA7A 2E2HJ 4C3IJ 1WGXA 4I76A 3O8GA 2X48A 3HOVJ 3IH4A 1TWHJ 5C3EJ 1VNDA 5HODA 2DA3A 2KDZA 1NK2P 3G1OA 3JRAA 1A6IA 1ETKA 3Q0UA 3G1MA 1GT0C 1X2MA 5IP7J 1F36A 5F04A 2EBIA 2QCOA 3OOUA 3OIOA 2Y9YA 3WHBA 2Y9ZA 1MSFC 1U9NA 2LY9A 2AHQA 9ANTA 3BR5A 4V2GA 1AU7A 3A03A 2RAEA 2XPWA 1X58A 1ZK8A 2DMUA 3ZQHA 4FE4A 1WPKA 3TW7A 2R0QC 1JKRC 1GVDA 2Y31A 4MFDA 5EGOB 3BG3A 3O8HA 4DYCA 1IJWC 3HEFA 2CU7A 1ETXA 3HOXJ 2VKVA 1APLC 3CQZJ 1S7EA 1RPWA 1OCPA 2EQRA 5F0FA 4JX4A 2EZKA 3C2BA 1I6HJ 2DA2A 1B8IA 3PO3J 2EZHA 2K9SA 1QRYA 4XRMA 3M3YJ 3A02A 3LOCA 2I10A 2W48A 1ETOA 3HGGA 4AC0A 4ABZA 5FKKA 1AKHA 5EZGA 1JUPA 2L9RA 1RKWA 1SANA 1U78A 1LE8A 1JKPC 4A3FJ 1ZGWA 1UG2A 3HOYJ 2ZB9A 4MFEA 3ZQCA 2EZIA 3M4OJ 3RZDJ 4NDLA 5K7HA 2H8RA 1H88C 3S2HJ 3GTQJ 3IH3A 5EEAA 5JLWA 2DA5A 1AHDP 4DZJA 4A3JJ 4FISA 3BTLA 1GUUA 3Q0WA 2N8GA 4MLOA 2NVTJ 4QTRA 4A69C 3HKZN 3VPRA 4M6VA 3PM1A 2YUSA 4DYRA 4RBOA 2R93J 3HB9A 2VI6A 2JMWA 3BQZA 5DTDA 2DN0A 3JRGA 1I50J 2FD5A 4M3EA 5GPCA 1YRNB 2CUFA 3TW6A 2OPTA 4GFBA 3IH2A 3TEDA 4BBSJ 1PUFB 2IEKA 2H1KA 1ETVA 3D1NI 4HNVA 5FKLA 3MKLA 3BR6A 4IHWA 1JJ8C 3TP0A 2M8GX 3JRCA 3Q0VA 4A3LJ 2HDDA 5EGOA 3FK6A 4XRSG 2MG4A 1K83J 1ZR2A 4Y7NJ 3MN2A 1BW6A 1P7IA 2HYJA 4XICA 3S1QJ 1BJZA 2E1OA 2JA6J 4QIWN 2WV1A 5M3MJ 2XPVA 3HGYA 3HOUJ 2LK2A 2JA7J 1MBGA 1Y1WJ 4A3DJ 2JN6A 5E3LA 2E2JJ 3A01B 3FK7A 5FKOA 3S14J 4UUTA 2ME6A 3RZOJ 2JWTA 2ID6A 5EF6A 4C3HJ 1ETQA 1GDTA 4BKXA 1W0TA 1FEXA 5J1RA 3QQAA 5F27A 1MBHA 4DYQA 4D5CA 3ZQFA 1ZQ3P 4M3GA 4FE7A 2DMPA 3SJMA 4BY1J 1IGNA 3LSJA 5J1YA 1RKTA 3BR0A 4C2MJ 4MO7A 2Y2ZA 1ZR4A 3S1NJ 1VI0A 3IV5A 1A5JA 4W1UA 1IRZA 3BR2A 1NTCA 4FCYA 5EG0A 2KT0A 2M9HA 3CCYA 5FLVA 2HXOA 4M3DA 1HDDC 1MBEA 5E3MA 5IYCJ 2JA5J 3LSRA 3GBGA 1XG1A 4D7NA 1E3OC 2COBA 5FLMJ 4A3GJ 5EYRA 3OSGA 1OCTC 2K40A 1JT6A 1FIPA 1MBJA 2ECBA 1DU0A 4Y52J 1O4XA 3BG5A 3S2DJ 1X2NA 1YRNA 2XGCA 2M34A 1PUFA 4IEJA 2M0CA 1IDZA 3RKQA 2ELKA 2DJNA 4JP0A 1VF9A 4IHVA 1HLVA 1QPIA 2IAIA 5J3LA 3GTJJ 4JX6A 2L0KA 1TWGJ 3ZQGA 1HF0A 1JTYA 4LOCA 3BR1A 2VKEA 3G1LA 4D5FA 5IP6A 2LTPA 1IUFA 1ITYA 5IPAA 1UHSA 2XB0X 1QVTA 2NVXJ 1ORKA 3FKIJ 1QVUA 2FX0A 1ETYA 5K7ZA 1TWAJ 4I6ZA 1U9OA 2DMQA 2O8KA 2TCTA 2R92J 2P81A 2IBDA 5GPAA 5EG0B 1F43A 3A01A 4W97A 2PMZN 2HOAA 4BY7J 1Y1VJ 3CMYA 1U8BA 4CYCA 2WAQN 4EEFG 5IYDJ 5K7FA 3OSFA 3E7LA 3CDLA 4B3AA 5C4XJ 3JRDA 1WCMJ 4XRSA 2YU9J 4C3JJ 2MSYA 3HOZJ 4QSHA 1MH3A 3DCFA 4FTHA 2NVYJ 2CQXA 3QPSA 1DU6A 2O9LA 1Z77A 1HDPA 3I4NJ 1K61A 3FIWA 2NS8A 1W0UA 2XB5A 1FTZA 3B6AA 2Y30A 2LP0A 3GTPJ 3K2AA 1H89C 4X6AJ 3MVPA 1SFOJ 2E2IJ 3SDGA 2LFBA 2JJ7A 4A3KJ 3HDDA 4IHXA 2NS7A 5FKNA 4A3MJ 2FJ1A 2K9QA 3QPLA 1CQTA 3TP3A 3SFIA 4XK4A 3BQYA 1H8AC 1JUSA 3B6CA 3HOWJ 3S1MJ 2X9DA 1EF4A 3H3VK 2AO9A 2CRGA 5E3NA 3L1PA 3JRHA 1XS9A 3GTOJ 2ECCA 1ETWA 1B72A 2HOSA 2NVQJ 4A3EJ 4CYCB
chains in the Genus database with same CATH superfamily
2J5PA 1XGOA 3DPUA 2PG4A 2HS5A 2GBYA 4JYKA 3GTMJ 1LFUP 4BL0B 2H94A 1JUMA 2W7NA 2ME0A 3KP6A 4A5MA 3ASNH 4ENMA 4IOAF 4G9YA 1R5GA 4WXCA 2BY2A 2O7OA 4BE0A 4NB5A 1W5CC 1LFBA 4ZYAA 1X4OA 4PDKA 3KIOA 1D3YA 2Z3YA 2X4HA 3DBLB 3M7GA 4M6YA 2HQ5A 3H5AA 5J6XA 2YX4A 5K5OA 1FT9A 3I53A 3GYHX 4GYIA 2K9LA 3OYEA 2KRCA 3HRSA 5EDNA 2P6SA 5ILVA 2Q8KA 2VJ5A 2HKXA 2O3FA 4E70A 3EPZA 4HSRA 3ROUA 1VFCA 4CA0A 3RKWA 1IG7A 2ACJA 2W25A 3U2RA 2CQQA 3CCEI 5JLXA 3WTVC 4G7ZF 4FQGA 3LSGA 5FRNA 5D6EA 4R1HA 1OR7A 2L2OA 3ECHA 2VBZA 3GFIA 4HDUA 4G6DA 2DK5A 1R1TA 1T0FA 1Y0UA 3DBRB 3X2QH 2O61A 1HOMA 1SAUA 4HV5A 3OYFA 4P1WA 2VXZA 4XLNF 1TWFJ 4IHSA 1D0XA 2NVUB 2XROA 3C3WA 4YFNF 2LR8A 1S8NA 3MQ0A 4DZPA 4V19K 3CO7C 3ZMZA 1E2XA 3PO2J 2JA8J 2OJED 2K5CA 3BTJA 1TWCJ 3OY9A 1Z6TA 2YU3A 1BL0A 2VL8A 4L5EA 1YITI 1JGGA 3Q3SA 1BA5A 5D8LB 4OIQF 2DXIA 3O3KA 4HNTA 1OJLA 2QBYB 4P55A 3ZQLA 2NNNA 2PQ8A 2XGDA 1FSEA 3DTEA 1LVKA 3ZOBA 3KCCA 1Z05A 4A6DA 5IOYA 3WTTC 2DTZA 3F8CA 4M74A 2OA4A 2IT0A 2WV0A 1ZGAA 2D5VA 1R9TJ 2Y69H 2QKMB 4DBQA 1I3AA 1SD5A 2KDOA 1HBXG 1KU7A 2BXYA 1MBKA 3AG3H 2W1OA 3CLQA 2DMNA 1FZPB 2NNYA 2BY3A 4N4OB 2DTRA 3GTGJ 2X6YA 2L7MP 3BTCA 2M0MA 3CMMA 3JCUC 1JKOC 2X51A 3E6CC 1ZG5A 4BE1A 5HDKA 1OCOH 4IL6C 1IUYA 2LKSA 2ELHA 1T33A 4PGGA 5E1ZB 5ICCA 1T98A 2CQNA 1VQ8I 2BE5F 4LGWA 4PSWA 1FPQA 2STTA 5D5WB 2QM3A 2R5ZA 2O5RA 3CTAA 3KP3A 2L7FP 3JRFA 1USTA 3WE2A 2L9NA 4ZH4F 5K5RA 2GXAA 2A6TA 1ZHFA 5IYBJ 4BUPA 1ZYRF 4Y4RA 4BQQA 4MQVA 2L7ZA 4RMNA 3MZHA 4FX0A 5DM6F 3CC7I 3I0TA 5CVUA 3RQIA 5GP9A 4QPOA 4E7JA 5FKMA 3BT9A 1ZH5A 2PMHA 2XGXA 3K1NA 1WJDA 4G6QA 1R58A 2L4MA 3KX2A 3EDPA 2UV1A 4KN4X 1N78A 2IPQX 1UJ8A 2PX9A 3S3MA 4I76A 1E3HA 2O8XA 1TWHJ 3FM3A 4PSXA 5F1RA 2IS1A 3M8FA 2KDZA 1XTAA 3G1OA 1K4SA 2Z1DA 1GT0C 1X2MA 5LGNA 4G6TB 3CCJI 3GWZA 3LL7A 1F36A 3A1YA 4C30A 5KVRA 1KU2A 1K78A 4P96A 2BY1A 4RM2A 4Y33A 3K1MA 2R7DA 4WK8F 1U0JA 5GTIC 2FMLA 2GWRA 3D5SC 3M8JA 2W82A 2VT3A 3A03A 4N4NB 3H5NA 3RDIA 5E1WA 3HRTA 1ZK8A 1S9HA 2FXAA 1BM9A 2HFHA 2L01A 2V1XA 3MZYA 4XNFA 4FE4A 3ZQ7A 2HWVA 1DP7P 4MFDA 4DYCA 1IJWC 2BEOA 3I5UA 1LDDA 2VKVA 3FBNB 2XKPA 1LNWA 1PDNC 1RPWA 1S7EA 4GCVA 1OCPA 1SC7A 1G4DA 2K4JA 1PJRA 5F0FA 3J7AY 4JX4A 1RI7A 1B8IA 1UG0A 3QRFF 3OYLA 1P6RA 3M3YJ 1KGSA 3HZJA 4JOMA 2GOMA 3A02A 4E4HA 5B1BH 3A2KA 1ETOA 1AKHA 1HSJA 3K4NA 1E0EA 5L3CA 2L9RA 2IA2A 1BIBA 2XAFA 1FOKA 1WZ2A 1J75A 1VQMI 1LVAA 1BBYA 1JKPC 1BI2A 2ZFWA 2RVCA 2VODA 2KZGA 4XL9A 3BZCA 3HOYJ 3GFJA 4CCKA 2BVLA 4MFEA 2XIGA 4XR6A 3TOBA 2M30A 1ACIA 3K1PA 3M4OJ 3LSHA 1O3SA 1H88C 3GMEA 3WODF 3IH3A 1YQAA 5EEAA 5JLWA 4I0AA 3AAFA 2EFQA 2P7CB 1XSXA 4FISA 1GUUA 1O3QA 2AS5F 3IWZA 4LG0A 4OINF 4PCQA 2F4OB 3CF5F 3PM1A 2YUSA 1YYVA 4QLCU 2V1NA 2JMWA 4XOPA 1O7LA 2DN0A 3HHGA 2IA1A 1MIJA 4Y13A 1YW7A 3CLOA 2KFDA 3DU6A 3VFZA 4P9FA 2OPTA 4CH7A 2PMUA 3TL4X 4XKBA 2ZCWA 2FOKA 4IPAA 5FKLA 4G7OF 1LKXA 4RB2C 2ZSIB 3UNGC 4XOTA 5CJ9A 3HIFA 1HKSA 3M8EA 4EJVA 4FASD 3TP0A 3CUQB 4Q47A 3ERMA 2KKOA 1I6XA 5H20A 4AIJA 5EGOA 3FK6A 1XMXA 5CLSA 3VEPA 3DXJF 4AIKA 1P7IA 1TZLA 1U5TA 2MYSA 4KT6A 4CXFA 2NS0A 2ZO4A 1HQCA 3KP7A 1Z91A 3HUGA 1KU3A 2LK2A 2JA7J 2JN6A 3A01B 2VONA 5FROA 3RCOA 4P9UA 3O2PE 4BJTA 4EJOA 4EJTA 1E3PA 2ZC2A 1TQIA 2L4AA 3RZOJ 3IRQA 3NRVA 1Z3YA 3FMQA 3QQAA 4OAYA 5J1RA 3MFKA 4BH9A 4DYQA 3CCMI 4D5CA 3ZQFA 5ED4A 2V6EA 2K7LA 3IL2A 5HOOA 2R7RA 5D4SA 3R61A 3WTYC 4XLAA 2K4BA 1IGNA 2FMYA 2W4SA 4GRIA 3VYRB 5DCMA 5D5UB 1D1BA 2F5FA 4NHJA 3E6MA 5LEKA 2CG4A 3I3LA 3S1NJ 5CQEA 3IV5A 4W1UA 1NG6A 3BJ6A 3G73A 3CCSI 2M5WA 2Y75A 2HQNA 1C0WA 3F8NA 3KZYA 1U5TB 3CP2A 2W84A 2Y0MA 2HZDA 1ZELA 1MW7A 1X3WB 5FLVA 2MC4A 2A5YB 1MBEA 1X1CA 1Y8RB 3HUGB 3KZZA 5IYCJ 2DO7A 4BQOA 1TQPA 4N9IA 2DCEA 3W6KB 2EPFA 5EYRA 2GAUA 4RGUA 1JT6A 1BJAA 3H36A 3S2DJ 1T95A 3P9IA 1YRNA 4U0YA 5LLQA 3L9FA 3EUHC 4M9ZA 1KA8A 2CW0F 1PUFA 2ADUA 4XN0A 1WSUA 2DT7B 2HKOA 4JP0A 1VF9A 1VQOI 2CV0A 3LA7A 3LA3A 4XLPF 4IHVA 1RZ4A 2IAIA 3BP8A 3DKXA 3GFLA 2EIKH 1J7KA 3H9GA 3N05A 3QU3A 1QZYA 5J3LA 3MKZA 4AWXB 1RIOH 2HQRA 3AG2H 4AVPA 4H0EA 1HW1A 2VKEA 1W5TA 3G1LA 2LTPA 1V5FA 1W4MA 4M73A 5IPAA 3HYIA 1IN4A 4RGSA 5HLHA 1ORKA 4IZZA 1UZCA 4I0BA 3I4PA 4BJ6C 1U9OA 4NNJA 2TCTA 3D0SA 3I54A 2MFZA 2P81A 3VYUB 2UZKA 3FXUA 1B9MA 2XAQA 1RNLA 3FXRA 4Z2YA 3CMYA 1E17A 3E5QA 3TBIA 4CYCA 5TJJA 2DDBA 1FSHA 5K7FA 1SFEA 3AKZA 3M9AA 3BWGA 3JRDA 3KEYA 4ON0A 1WCMJ 5BMZA 2O03A 3J7AO 3HOZJ 2VBYA 3CZ6A 3ONQA 3D5RC 3OYNA 2E5ZA 2CQXA 2NVYJ 5CYVA 3I4NJ 4BQAA 3MKYB 4F7ZA 2GA2A 3DV8A 5FRMA 4BGDA 3GLXA 1D1AA 3B6AA 2RN7A 2H6BA 5D6FA 1H89C 1JI8A 3E5XA 2YX7A 4IHXA 4KDPA 3TP3A 1X19A 3SFIA 4R79A 3BQYA 1R4MB 3KZIC 1H8AC 1QBJA 1YW8A 1JUSA 2GOXB 5JVGF 1U3EM 4KISA 2AO9A 2HEOA 1ZN2A 3QWLA 4IF4A 3KYLA 4AM3A 1EV7A 4CYCB 1UHMA 3AFHA 4ETSA 2DMTA 2VBWA 3TQNA 5E3OA 2E19A 3BG7A 4HA8A 4CYDA 1RUNA 3ABKH 2X6WA 4I2OA 4KIGA 3EETA 1XN7A 2ICWG 1GV2A 4JK1X 2IA0A 5KAIC 2Q2EB 3IKTA 2R7OA 2HOTA 4M3FA 5DS9A 4RDUA 4RAYA 4HDVA 1RETA 4I7HA 5AIQA 4EM0B 2ZBKA 4B43A 1OCRH 1FBUA 4KMUX 4A3CJ 4AIHA 1RESA 3PNTA 2H8WA 3I59A 3EQLF 2L02A 4CICA 5FJ8J 1XB4A 1WH5A 2PFBA 1R00A 3CUQC 4A93J 1G3WA 2O0YA 3VDXA 2ZNZA 2BBYA 3PQJA 3Q9VA 2V79A 2A3SA 2DA1A 3TKYA 1BI0A 4LB6B 2K86A 1X1DA 3ZMSA 3DQVC 5IOZA 2FQ3A 3PIOF 1BW5A 2P7VB 3U1KA 3W6VA 2KQRA 1LFPA 3W6JB 1MDMB 3IAM2 1FBQA 1WI3A 3EUKL 2RQPA 2ZJ2A 2YSRA 3CJNA 3LQQA 2R5YB 2DJIA 2E1NA 5F1JA 4IX7A 1H9TA 4L5JA 3ZQIA 2JK3A 3KEQA 4A3IJ 3I4MJ 2RDPA 3E1SA 4I01A 2DPUA 1FLIA 2MD5A 2OF7A 5EEGA 2F5VA 3H1CA 2ZJQF 3EYIA 3HG9A 3LSPA 1P9QC 1RR7A 2G0EA 3R4KA 4AUXA 2ZXJA 3MMYB 4ZJZA 3M1EA 4OMZA 4ENKA 1O3TA 1V4RA 1FC3A 3BY6A 4L9TA 3J7ZI 1NH3A 3SZTA 3BR3A 4ZYGA 3BPXA 2K85A 3GTKJ 3VODA 3K2ZA 1P7JA 4LFUA 2MLGA 4BYYA 2MGQA 3PIPF 2QWWA 3CDHA 4HOBA 1R1UA 4AYBA 1LEBA 3QPHA 2OAZA 1AA7A 1WH7A 2XRLA 4DNCA 4S04A 2HDWA 1I3QJ 3RPUD 3I71A 4QWQA 1OISA 1BOAA 2QKLB 1SVLA 1IC8A 3S16J 4LLLA 1JTXA 2AQEA 3AG4H 3PSIA 4M3BA 4RM3A 1R23A 1O3RA 2NOGA 2UXNA 3IUOA 3F8FA 3DBHB 2ZKZA 3SYTA 4EGYA 5HNHA 3QYBA 2LLKA 1ZRFA 1Q1VA 5BPIA 2A07F 1WJ5A 4S0HB 1JGSA 2KMUA 1T56A 5C4JJ 4OIOF 3WGHA 2E71A 1VQKI 1LE8B 2W00A 2Y48A 5TISC 3TO9A 3F0CA 4BXFA 1SVOA 2KRFA 4I98B 3ZMVA 5DEQA 1VQ9I 2VQCA 2EV5A 2CV2A 2DOAA 3RTRA 4BNCA 1J0RA 1IRFA 5BQTA 1L3LA 3BZ6A 5H2FC 5D8KB 4EATA 2LD5A 3FXLA 1BOBA 2QSFX 2XV4S 2ZJRF 4IHYA 4CCMA 2MD0A 2E2HJ 2WY8Q 4HF2A 4KITB 1YTYA 1YHQI 3HOVJ 2WB1A 3IH4A 4G94A 5HODA 1BR2A 3KYCB 3JSOA 1S72I 2NRAC 1ZG1A 1ETKA 3Q0UA 3G1MA 2WAFA 2VC1A 2P5KA 1VQ6I 1G6NA 2ISZA 2QBYA 1KYZA 2QQ9A 3OOUA 3OIOA 4BE2A 2WBMA 1MSFC 2AHQA 2RGVA 1AU7A 3AL0C 3K10A 1TL8A 2BXZA 1ZRDA 3QPTA 2E7XA 1QNTA 1I1GA 1GVDA 2Y31A 4U87A 3RPUA 5L3GA 1MKMA 3O8HA 4MEXF 2CFOA 4XKVA 1ETXA 3D5LA 2M87A 2E34A 2DOEA 4DIQA 4CZZA 3PJRA 3VYSB 1DQUA 3IC7A 4OIRF 4PZJA 2DA2A 5F6FA 1QQIA 5BOXA 3GX4X 1YJ9I 2JRMA 1QRYA 4NUBA 3LFKA 1UFMA 3ZCOA 2I10A 3EYYA 2MBFA 5HLGA 4OOIA 3HGGA 3P7NA 3CDIA 2E1MC 2L9VA 1VQ7I 3FKJA 3PUBA 4E7SA 3ABUA 1M1EB 2HPMA 2HOEA 1X3UA 4PJNA 4A3FJ 2CSOA 4YFXF 2M7AA 2IJLA 3LAJA 3PSFA 1XSVA 4EV0A 3E6DA 4WXDA 1KYWA 2TDXA 2R7XA 4WCGA 3PL8A 3ZQCA 2DPDA 2CUZA 5E8GA 2P4WA 5J4VA 2M4GA 3RZDJ 4NDLA 5K7HA 5ICGA 3S2HJ 1WQ2A 2JUCA 1OKRA 4JBAA 3LMMA 3ZP5A 1YIJI 3HC7A 3J80Z 4IVNA 3DWLE 5B1AH 1XDSA 2RQQA 4HF1A 1B9NA 4M6VA 4NC6A 1NG7A 3FX3A 2M4KA 3HRMA 3QYFA 2ZNYA 1A31A 2EINH 3J81Z 5DD4A 2DW4A 5LEJA 1I50J 1UAAA 3BJOA 4BHCA 2FD5A 2L3DA 4M3EA 2Z33A 2ESNA 5GPCA 3TW6A 3T5XA 4GFBA 3TEDA 2FBIA 4BBSJ 3BOQA 2AXTC 2VXDA 2K02A 2IRFG 1B1BA 3WG9A 3I55I 2R3SA 3LWFA 1ODDA 4IRGA 3TDUC 3MKLA 3BR6A 4BXUA 4EMSA 1OYYA 2JA2A 2A68F 3JRCA 4BAYA 4ZDPA 1X3ZB 3Q0VA 4ZYHA 3P9KA 3K9TA 3BDDA 1FYKA 2DFHA 4XRSG 4YRVA 4Y7NJ 1BW6A 5HDGA 4NQWB 2IGKA 1BJZA 2JA6J 2DQLA 4QIWN 2ETHA 2BHZA 4MTEA 5LGTA 5M3MJ 4LMYA 4BEHA 4H4KC 3V8KA 4A3DJ 4G7HF 1O7FA 1D0ZA 4IXAA 3IKVA 4L0YB 5FKOA 5B5EC 2OCEA 3HTSB 3S14J 2DOFA 1KU9A 4XLHA 2GIZA 1EH8A 3OYJA 1VTNC 2JWTA 3IRRA 3RPQA 5EF6A 3OL3A 1D8KA 4HYEA 2OTJI 1FX7A 1FEXA 2LBFB 2E7WA 3FHZA 2D2WA 1ZLKA 2H1LA 3L2VA 3CCRI 1ZQ3P 5BPDA 4M3GA 4CUGA 4EVIA 2I8DA 2QQ8A 3ZXSA 2H27A 4BY1J 2W57A 3T0YA 4CGZA 1RKTA 3G2BA 5LHIA 2M45A 3KP5A 5CVRA 2EK5A 2EFOA 3H3UA 4C2MJ 4MO7A 1T2KA 1OCCH 5HS8A 1U8RA 1VI0A 5D5XB 1UHWA 1CF7A 3DEUA 5DM7F 1XSDA 2KIMA 3I64A 2KISA 4LB5A 1NTCA 2QQBA 2CW8A 2GIVA 1DUXC 4HSTA 1TT0A 2A05A 3GO5A 4BEHB 3LSRA 1XG1A 4EGZA 1E3OC 1QU3A 5FLMJ 3OSGA 1YX3A 2JRTA 2QGUA 1FYLA 4EQQA 1DU0A 1O4XA 1X2NA 2HYGD 1XMKA 4EJUA 1QZZA 1YE9A 2QZ8A 4HG2A 2HDCA 5L3DA 3W2VA 3RKQA 4QPQA 4I99C 4UV8A 1FY7A 2DJNA 4KICA 1H0MA 2Z9OA 2LRDA 3F22A 3IP4B 1QPIA 1BC7C 3CUQA 1IO2A 4JX6A 3RKXA 3T8TA 2L0KA 1TWGJ 4M71A 5FD5A 4HBLA 1LDJA 1FOWA 2ZXWH 3V8JA 4B48A 1HF0A 2NAZA 4WX9A 3PNVA 2FBKA 3GXOA 1S7AA 5J8CA 4HRIA 1ITYA 3B02A 1UHSA 2XB0X 3TMOA 2O6GE 1CF7B 2KL4A 1IN6A 2FX0A 4I6ZA 1ETYA 1TWAJ 2A6HF 4RAGA 2DMQA 4CSWA 3PNYA 2O8KA 2IBDA 5F64A 3U1DA 5DD8A 3A01A 4W97A 3FXOA 4PJ0C 2B7EA 1MMNA 2VT2A 1U8BA 2QSHX 2WAQN 4EEFG 1OQYA 3OSFA 3F72A 3PUFA 1WJBA 3E7LA 3G3ZA 3JTHA 1ZRCA 3CDLA 3L7WA 5C4XJ 3WTWC 3OS2A 3FMSA 2FNPA 2YU9J 2QUFA 5JI6A 2OC6A 3HSEA 2MSYA 2UUZA 4O5VA 1QA6A 2RREA 4QSHA 1MH3A 3WU2C 1MZBA 1MNEA 3DEEA 3V7RA 4ASNA 5DUKA 1K6OA 4IQ4A 3A4CA 4CCLA 1HDPA 2V1UA 1D5VA 4CO8A 3GFMA 1K61A 2NS8A 3KYDB 2D1VA 2R4GA 5HS7A 2X1EA 1IV8A 3GTPJ 4B3XA 4IO9F 3MVPA 3SDGA 3K4KA 4A2UA 1BR1A 4A3KJ 5FKNA 2VJIA 3REOA 4A3MJ 3QPLA 1CQTA 3WTSC 2K27A 3P9CA 1XX5A 4ZTFA 4XSXF 4UXNA 4YEJA 3OWTA 4S05A 4KT5C 3B6CA 4UY8I 4CHUA 4F55A 2CRGA 3L1PA 5IT9Z 1V55H 2ECCA 2HOSA 4KFCA 2NVQJ 1HXDA 2QENA 2CMPA 1N25A 1PP8F 1WHUA 4XM3A 2KJBA 3A0HC 1LEAA 2TRTA 2XGEA 4MGRA 5IP9J 3WTUC 4J19A 3UKGA 3HSFA 1MD0A 2JVGA 3CMEI 1XPXA 4MHGA 3HRUA 2XPUA 1BN5A 4AD9A 1D5YA 3K6GA 2MW8A 1OR7C 4HPQA 1MBFA 3F21A 4BHPA 2VPRA 2V4JC 2JPCA 1P92A 5K5QA 2KIQA 4WWCA 1S7OA 1XCBA 3WHCA 1YI2I 1QZEA 1Z0XA 3MEXA 3S15J 4X0GA 3K4BA 3CCQI 3ZMDA 1OYWA 1AOYA 2V9PA 3HTUA 3SZPA 2Y0SN 3Q5FA 4BXXJ 4YFKF 2K9MA 2GA1A 3S1RJ 4XQFA 1IN7A 5F08A 2LY1A 1WJFA 5M5WJ 1V54H 4E7KA 2GM4A 2LDUA 3I56I 3F6VA 3RYRA 2FA5A 5KK1A 2RNJA 2RC4A 1ZGJA 3ZMTA 4HX7A 3SHFA 2FQ4A 2R7QA 1HW2A 1VQ5I 1A04A 1J09A 4DW6A 5FLXK 1K79A 2AXLA 4WXHA 1HA8A 4GXOA 3V7SA 1UMQA 2WTEA 3T8RA 2EIMH 2UWMA 4RB3C 4A3BJ 3NAUA 1XC5A 2DLLA 2GLOA 1J59A 4F92B 5J40A 2E36A 2BZTA 1DGWY 5FFZA 3FHNA 2XF6A 1T38A 2IGNA 3GTLJ 2ZSHB 1PP7U 4II2A 1P4XA 3LNQA 1X1AA 3QP6A 3V7CA 1ERDA 3KLOA 2VE8A 4O3MA 1KQ8A 3KEOA 4XLEA 5HNFA 1N75A 2DU9A 1D0YA 1ZKGA 2M3AA 4HNUA 4PFPA 5BNGA 5H6RA 1HCRA 4GYGA 1IDYA 2CS3A 4XIDA 4C2UA 2DBBA 1V5GA 1GV5A 1G2HA 2F6CA 2EH3A 2LG4A 4F3QA 1TBXA 1S5LC 4MQ9F 2W24A 1FIAA 2WY7Q 4Q48A 1SD6A 1YJNI 2LKXA 4V2FA 2V9KA 1JKQC 4ESFA 5F0HA 3H35A 1ZAOA 3LSKA 1I39A 2Q2EA 2FBHA 3W3CA 2LOOA 1KZHA 3RJPA 3S32A 3KP2A 3JSPA 2XAJA 1TT5B 2HVRA 4U0VA 4OIPF 2XHKA 1FOYA 2STWA 2JSCA 2G7UA 5M5YJ 1XD7A 4UB6C 2BGCA 2EWNA 3OL4A 5DCFA 2CJJA 2CQ7A 3E5UA 3AL0B 2DA6A 2D1HA 4RLQA 2R7VA 3QOPA 2GZWA 2A69F 4O6JA 2F4IA 4ZC3A 1FTTA 2VASA 1EKEA 4E7IA 4KYWA 4K2EA 4KMFA 1ZREA 1DDNA 4B4CA 1Z7UA 2L54A 3K7AJ 3H0GJ 3K70C 3UR3C 5FLXZ 2NYXA 2VLAA 1MDMA 2IW5A 4MIMA 2MH9A 3DPTA 1YOVB 1POGA 3FXJA 2P5LC 1TC3C 2GXGA 3ZQQA 2BY0A 1ONVA 4G8XA 2R5YA 2ESHA 2QF7A 1Z9CA 3OYAA 1MMDA 3SXYA 4IRIA 4IKFA 2E1MB 1WGXA 4XKWA 4RAZA 2JVHA 5C3EJ 1F4KA 2DA3A 1S3JA 1U2WA 1TQMA 2K3FA 5IP7J 5E79C 3RQ4A 2MLKA 5LHGA 5F04A 3T1BA 1KQ0A 1WJAA 2EBIA 3J7YJ 4ESJA 2QVOA 1PVEA 2QCOA 3A0BC 3V8LA 3FZVA 1S6LA 1U9NA 3WE3A 3SEQA 3ZPLA 2LY9A 2DK8A 4XRFA 1A36A 9ANTA 4L9JA 3BR5A 4DBRA 3MD2A 3OS1A 2XPWA 3WTXC 5IY5H 5EJCA 3ZQHA 1WPKA 3TW7A 3S2WA 4BS9A 2R0QC 3BPVA 1J9IA 3O6BB 2QQAA 3BG3A 3C1DA 3LSTA 3OYGA 2Q0OA 3HEFA 2CU7A 3H92A 5J8FA 3E3VA 4HLXA 4C9YA 3VYTB 3CJRB 3NQOA 3ERED 1GXPA 3VB2A 1ULYA 2IS6A 2EQRA 4U7DA 1JE8A 2Z99A 2E60A 2EZKA 3C2BA 1GVJA 1OPCA 2MABA 2CQKA 3PO3J 1YJWI 3H3ZA 2XRNA 4UV9A 1MGTA 2HGCA 4XRMA 5GTHC 1FP2A 3LOCA 3P5JA 2KHMA 5FKKA 1S29A 2BW3B 4R8HA 4HQEA 4DQ2A 1RKWA 3CJTB 4RAFA 1Z21A 2NOJB 3PFYA 4FHTA 3W2WA 1PYVA 1SANA 2LH9A 4KN7X 1U78A 1LE8A 4L0ZB 4FX4A 2PJRB 1WVRA 1WWXA 2X1DA 2LSOA 1VZ0A 2ZB9A 1OYIA 1TNSA 4NC8A 5KNLA 3GZ6A 5LD2C 1W36C 4E7LA 2XAGA 1SD4A 3DKYA 4ZDLA 5J47A 2CGPA 2DYRH 3GUDA 4ZDOA 5E1XA 1LQ1A 3JAMZ 2ZXIA 5CVIA 5JVTA 3CF2A 1TW2A 2LKPA 4A3JJ 3RI4A 4LJZF 1VQ4I 3BTLA 3DLAA 5AIPA 2V26A 2N8GA 5KCMA 4JQFA 4QTRA 4Y3OA 3HKZN 4A69C 1DPUA 3R6SA 4Q5SF 3CP8A 4ENJA 3TGNA 1W7PB 3C18A 4HEA2 3HB9A 3L09A 2F5DA 5CVJA 3BQZA 3FM5A 5DTDA 2XC7A 4IJAA 4B09A 4L9NA 2L5QA 4OMYA 2KLOA 2KP6A 5HLTA 4U7BA 2BHYA 1UELB 5L3FA 2VJ4A 3IH2A 2LF8A 4LD5A 2XAHA 3L00A 2H1KA 1ETVA 1G3YA 1FP1D 4Y15A 3FXMA 4HNVA 3BCBA 2CWEA 1R71A 1JJ8C 3R0AA 1ZG3A 3PQKA 3L2QA 2M7BA 2ZXHA 2HDDA 2FF4A 2DFIA 2VKDA 1SMYF 3HSRA 2FUG2 2MG4A 1XGMA 1K83J 2ISYA 3MN2A 4BQNA 2DAOA 4A0YA 2F5EA 1EH7A 1Z1DA 3E6BA 2OTLI 4Y17A 5E3LA 5D5VB 1FMVA 1BC8C 1IF1A 1OLTA 3FK7A 1SFKA 1FNNA 3J80K 1HKTA 4A0XA 1YS7A 2V7FA 4UUTA 4LIVA 3ZMUA 2HVSA 3TOAA 3NWTA 4ZTJA 1ETQA 1GDTA 3J81K 1LDKB 1BR4A 1MBHA 4II3A 4PGHA 4ANJA 3ISPA 2DODA 1X1BA 2DDAA 3DTKA 1JHHA 2PEXA 3KFWX 5IT3A 1B4AA 3ELKA 4FE7A 2KIFA 2ZMEB 4LITA 3SJMA 2QYOA 2B9SA 3LSJA 2CFXA 2OCCH 4YELA 1MJBA 2FRHA 4F91B 4HW0A 1SEUA 1LUJB 3S93A 3NWSA 4Q4ZF 2Y2ZA 2VQGA 5FD6A 1ZR4A 2D45A 1R5HA 1IRZA 1MMGA 1NHAA 3BR2A 3R0JA 3JW4A 4F93B 3CCYA 1WJCA 2HXOA 4UHTA 3QOEA 2E1CA 2WAQA 5E3MA 5ERIA 2OQGA 1UB9A 2JA5J 3VSKA 4CCNA 5EEHA 4BDYA 1UCRA 4A3GJ 4RS8A 2K40A 2LMDA 2W85A 3W2AA 2L9SA 4LK0F 1FIPA 1MBJA 4Y52J 5JHUA 4FT8A 2WA0A 3WU0A 1T08B 5AONA 2F2EA 1CGPA 3BROA 3Q9SA 2M0CA 1IDZA 2ELKA 4GDFA 4RGXA 1G59A 4A6EA 2FOWA 4N9HA 1HLVA 1Y39A 3WG7H 4U88A 2Z16A 3GTJJ 1MNDA 1YLFA 1JTYA 3WU1B 3K4JA 3PFIA 3BR1A 3ABMH 3H9QA 4FETA 3B73A 3FXQA 1IUFA 1Z7LA 2EFWA 5FGMA 5E17F 1IRGA 4NQWA 1QVTA 2DI3A 5GAGJ 3DTIA 3C7JA 4B8XA 2XAUA 3FKIJ 1QVUA 5K7ZA 4HF0A 3LQRA 1VQLI 2G7HA 2CH0A 4HX4A 3K70D 1OMIA 2KPMA 1F43A 3KE2A 2PMZN 2HTJA 3EUHA 2HOAA 2EFNA 1Y1VJ 4RA2A 1R36A 2L7KA 2Q1ZB 5ILSA 3G4SI 1DPRA 1BI3A 3QU6A 4GGGA 2LBFA 2E35A 2EV0A 4XRSA 3S3OA 2CW7A 4BDZA 4PJJA 4Z6YA 4BU2A 1DGRM 3DCFA 1YX5A 2WADA 1WI9A 3CD6I 1DU6A 3HOSA 1SMTA 1Z77A 2OU2A 2CV1A 1USSA 2Y0SA 2KJCA 3DFGA 3OV8A 2XF7A 2XB5A 1FTZA 2A6EF 4X6AJ 2Y30A 2LP0A 1T39A 3IAS2 3F8MA 2E2IJ 2LFBA 2JJ7A 2XUBA 3HDDA 1TTYA 2NS7A 4DOZA 2DFEA 1ON1A 4XK4A 2OD5A 2XF5A 1GLNA 2HNHA 1ZLJA 4BHBA 2PJPA 1GXQA 3HOWJ 5CQGA 2X9DA 4GO1A 5E18F 3S1MJ 5E3NA 1XS9A 3GTOJ 4PK4A 1ETWA 1B72A 1YS6A 3E97A 3SDBA 1AWCA 4A3EJ 3MCZA 1MH4A 2JTVA 4E7HA 1SD7A 1XGNA 1MNMC 2WWYA 1W5SA 1YW9A 1NK3P 3ECOA 1Y0NA 2HXIA 4AYBN 3JREA 4EM1A 1GHCA 1IN8A 3LFUA 1R7JA 4JX5A 5E8IA 5GAEJ 4XKCA 1T6SA 2DYSH 4L9VA 4J01A 1YO5C 4HLYA 1KQ9A 3OYBA 3H5RA 2CUJA 4NBQA 2HYFA 2LVSA 4UVAA 2A61A 2RKHA 1KONA 2RNGA 3MWMA 1IZ1A 2F5CA 5HLIA 2ZJPF 3FISA 5C44J 3R60A 2R5ZB 1W36D 2R7ZJ 3HJEA 1Z67A 3OYCA 4E6KG 1STZA 2VN2A 2DA4A 1FJLA 3ESWB 1B72B 3JRBA 2X0LA 2P0WA 1WFXA 3K69A 5J1UA 1OFCX 5IT9K 1O57A 2BYVE 5KHDA 1IN5A 4AIDA 1ENHA 3NEUA 4LK1F 3CO6C 1MMSA 2G9WA 2CUEA 4HQMA 1VQPI 2IGOA 3V42A 1MJ9A 2KIUA 3ZR8X 3H0DA 3HXLA 3RYPA 1JT0A 2FU4A 3WTZA 3OMYA 2XSDC 2HPIA 4LIUA 2WB1N 2VOOA 1D1CA 2K9NA 5LFAA 3VWBA 1Y6IA 2FEZA 2VQLA 4YIFA 2XVCA 2ZMEC 3BG9A 1J2XA 1K78B 2X6OA 3CJQB 3JR9A 4X1EA 1REPC 3GZ5A 2EFPA 1W1WE 4U0WA 3SFZA 4B1RA 1P4WA 3GEZA 5TRDA 1MSEC 1HW5A 4IRHA 2EB7A 3L2RA 2JSPA 3VOEA 4UUSA 3G6EI 2P8TA 2JPBA 3DP7A 2XKOA 3DEWA 2OV7A 1JJ6C 2ID3A 3HBLA 3S3NA 2M2EA 4B44A 2FNAA 1B59A 5H6QA 4XBFA 1F9NA 4OWRB 5M5XJ 1ZTRA 3ML6A 1D8JA 2YS9A 2A5WA 2MH2A 1LPQA 2MC3A 1B8IB 1XMAA 4D7MA 2IP2A 2P6TA 1BIAA 4F52A 2VUMJ 2B63J 1IRXA 4BBRJ 1K6YA 4AVZA 4ZYEA 1FOXA 3RSNA 3BLYA 3NARA 3DKWA 4M72A 3OIQA 5F0CA 1AKHB 2WAEA 1IV6A 2J5OA 1RR8C 3FXKA 4A0ZA 4C2TA 5EZHA 4I09A 2FE3A 3HM5A 4OAZA 3M1CA 3QAHA 5DDGA 5M3FJ 3OOPA 5K1YA 4XMYA 4HX8A 3ZRGA 2HTSA 1FMWA 2EA2A 3KETA 1IW7F 3LAPA 4UUSB 2EZLA 2DT5A 2OQRA 2KRHA 4AU7A 1Z3XA 3SQNA 2X85A 3L2WA 1A6QA 3WGIA 4A12A 4TV7A 3ABTA 3GVAA 4M9SA 2HI3A 2LC2A 1F1ZA 3OYKA 2R7FA 3JRIA 3BTIA 4MTDA 5HDNA 3ULQB 3DPLC 1IXCA 5B3SH 5L3BA 4G12A 1DP3A 5LRSA 3S17J 2HR3A 3K4CA 4D0PA 3OYDA 1HKQA 2VE9A 2QSGX 2DA7A 2GQQA 4C3IJ 4CCJA 1XDUA 2BOLA 1IAWA 1WRJA 1SFXA 2X48A 3O8GA 1HSTA 1ON2A 1TP4A 4CCOA 3OR1C 4LG0B 3OYMA 2VQHA 1VNDA 5KAFC 2OBPA 2RV8A 3K0LA 1NK2P 1QHGA 2XSJC 2AQFA 3E0JB 2Z2SB 1T0FC 3JRAA 1V3FA 1A6IA 4PJLA 2EA4A 5JFRA 1B6AA 4ZZLA 1I5ZA 3COAC 2HVQA 3ZN0A 2F48A 2Y9YA 3WHBA 2Y9ZA 5D4RA 1QHHD 3MZ8A 3EUAA 5LRRA 2LF7A 2X6XA 1Z6RA 4V2GA 3F23A 2RAEA 2GXBA 4LLNA 4XLCA 2LYCA 3CC2I 1X58A 3CC4I 2VB6A 4OU0A 3ASOH 3U9GA 2DMUA 5TGTA 4EJWA 1JKRC 4ESBA 5EGOB 2YR2A 2R7TA 3IWFA 4KIBA 3OIPA 3HOXJ 1APLC 3CQZJ 4HV6A 3QP5A 4L18B 3HKZA 3HOTA 2DQRA 4UVCA 5CPRB 1EJ9A 6PAXA 3ZGKA 2Z5UA 3CCUI 5DYMA 3ABLH 1I6HJ 3HL2A 2EZHA 3GLLA 2K9SA 5FFXA 3F6OA 2W48A 2LNBA 3DLLF 4AC0A 4ABZA 4RGRA 5EZGA 3L2CA 1JUPA 2FSWA 4N0BA 4HZFA 1J5YA 3DF8A 1X4PA 2VBXA 4MNUA 4CDGA 1MMAA 3GF2A 1ZGWA 3JTGA 2COMA 1UG2A 1RUOA 3BZKA 1EA3A 2EZIA 4KNYA 1A35A 4PJMA 5DCMB 1OCZH 3GW2A 4L5IA 2H8RA 1L0OC 1G3SA 1HC8A 1XCVA 2V6CA 3GTQJ 2IXSA 3SZGA 5LGUA 1FBSA 2DA5A 1AHDP 4DZJA 2VOPA 2EIJH 2HZTA 5JR3A 4I02A 1V5EA 4B47A 3Q0WA 4D1QA 1XGSA 4MLOA 5E20A 2NVTJ 3SEZA 2R7SA 5GADJ 2QLZA 3VPRA 4PFOA 4IOCF 1R22A 4RBOA 4DYRA 4PUSA 2R93J 2VI6A 1TW3A 3TO7A 3MKWB 2JT1A 3JRGA 1W7PD 2VIXA 2B0LA 2I5UA 4P5OA 3M07A 3C2HA 1F5TA 1VQNI 3CESA 1YRNB 1FYMA 2CUFA 3C2GA 5ILUA 2OZ6A 2VJJA 1PUFB 2IEKA 3N4MA 3D1NI 4IQJA 2OZUA 3K4LA 1G3TA 1R1VA 5LBQA 4YIIA 4RB1A 4IHWA 4M9XA 4M6XA 1T8IA 2HQAA 2M8GX 2LREA 3AG1H 5FB2A 4A3LJ 3I58A 1YFHA 3BCAA 1QO0D 1Q1HA 1JHFA 2P5VA 3K4MA 1K7AA 1ZR2A 4RB0A 5CVVA 4A5NA 5HVQC 4UUVA 1X1PA 2HYJA 3QODA 2UXXA 4XICA 3S1QJ 1P2FA 2E1OA 2R7WA 2PLYA 4NC7A 2XASA 2WV1A 1H9GA 1P4AA 2VC0A 2XPVA 3HGYA 2BVMA 3JAMK 2WC2A 3KPHA 5J4YA 3HOUJ 1MBGA 2EJRA 2K3PA 1Y1WJ 2E2JJ 2JZYA 1U6GA 2F4MB 1EH6A 3TDZC 2DFFA 2BW3A 2ME6A 4BACA 3HHHA 3ZN1A 2ID6A 3IHUA 4C3HJ 4BKXA 1W0TA 2CYYA 3CMAI 1R4NB 1BI1A 5F27A 1LB2A 4KIFA 1WJEA 2M8EA 4RLFA 2PJRA 4YG2F 3DU5A 4MEYF 2DMPA 4ZZDA 2XDVA 3S8PA 1SFUA 3OYHA 1YIOA 2LY2A 4KUMA 1I27A 5J1YA 3BR0A 3FBIB 1SVMA 2YPRA 3CCLI 4UVBA 2VPLA 5HS9A 2JQ7A 1R5ID 1A5JA 2X1CA 4UNOA 3OR2C 2IS2A 2PMZA 4FCYA 5EG0A 2CO5A 2KT0A 1QGPA 2H6CA 2M9HA 3I9V2 4M3DA 5A2QK 1RRJA 1HDDC 2V1DA 5ICFA 5JHFA 3FMRA 1ZARA 3GBGA 2NXNB 1W7PA 3MAJA 5BS6A 4D7NA 4XLFA 2COBA 1YG2A 2KZVA 1OCTC 3HPGA 2BV6A 1RC9A 2IVMA 2ECBA 1IXRC 3QYEA 4ENNA 3BG5A 3V4GA 4WF2A 2OUMA 2XGCA 1WKMA 2M34A 4IEJA 3OS0A 1LJ9A 2QA4I 3KP4A 2PN6A 5CKTA 2E5NA 1JXSA 4ZYDA 3RIRA 4BJ5C 3ZQGA 3LSMA 4LOCA 4XORA 4LG3A 1PUEE 3CUOA 4D5FA 5IP6A 4DJAA 2C6YA 1Y56A 3RKYA 2NVXJ 5FO5A 2IS4A 3I59B 1R49A 2IGMA 3GZNB 1TLHB 2VKHA 2R92J 4LLGF 4IHTA 5GPAA 2DT6A 5EG0B 5L3EA 5ICEA 3OYIA 4XONA 4UB8C 1FWZA 4BY7J 2R7UA 3LSIA 3F9KA 4J00A 3G71I 1MJAA 1U5TC 5IYDJ 5LHHA 1R6RA 3KLNA 3BJAA 4EM2A 4CZCA 3LA2A 3FF5A 4YIRX 4B3AA 2H09A 3GCMA 3TO6A 4C3JJ 4D9JA 4XN3A 2JUGA 2V9VA 2M1BA 5GAHJ 4FTHA 1G8XA 2HU9A 3QPSA 2ZFUA 2O9LA 2PI0A 2ZMEA 2PBIA 5B66C 4DGWB 1I1SA 4HAMA 2ELJA 3CCVI 3FDYA 3FIWA 3FWEA 4XSZF 1W0UA 4KJZA 5DUIA 3F8BA 3K2AA 3VSLA 1K4TA 1QPMA 1SFOJ 1IXSB 2EV6A 5A2QZ 2FJ1A 2K9QA 5DV5A 3WGGA 2EILH 3BG6A 3BC8A 3U21A 2QEXI 1N77A 2MA3A 1EF4A 1SAXA 1Y8QB 3H3VK 1TNTA 3JRHA 4KA4A 3HPHA 3H9JA 4ITVA 3L2UA 4E7ZA 3N97A 3F3XA
chains in the Genus database with same CATH topology
1MH4A 2DMTA 1MNMC 2TRTA 2GBYA 2XGEA 4JYKA 2E19A 5IP9J 5E3OA 1LFUP 3GTMJ 1JUMA 4J19A 1NK3P 3UKGA 2ME0A 2HXIA 4AYBN 3JREA 2XPUA 2O7OA 1GV2A 4JX5A 1D5YA 2MW8A 1LFBA 1MBFA 2VPRA 2HOTA 4M3FA 5DS9A 4RDUA 1RETA 2HQ5A 3WHCA 1Z0XA 3S15J 4A3CJ 1RESA 2LVSA 2Y0SN 5FJ8J 4BXXJ 1WH5A 3S1RJ 5EDNA 4A93J 3FISA 5F08A 5M5WJ 5C44J 2R5ZB 2R7ZJ 1VFCA 2DA1A 2GM4A 5IOZA 1IG7A 1BW5A 2DA4A 2CQQA 1FJLA 5JLXA 1B72B 3JRBA 3W6VA 3LSGA 5J1UA 2FQ4A 1OFCX 1WI3A 4DW6A 1ENHA 1UMQA 2R5YB 5F1JA 4A3BJ 3NAUA 1HOMA 3ZQIA 1XC5A 2CUEA 2JK3A 2GLOA 4A3IJ 3I4MJ 1TWFJ 2LR8A 1JT0A 4DZPA 2OF7A 3PO2J 2JA8J 2XSDC 3BTJA 3LSPA 1TWCJ 3GTLJ 1RR7A 1BL0A 3LNQA 2WB1N 4L5EA 2G0EA 4AUXA 2K9NA 1JGGA 3Q3SA 1BA5A 3BG9A 2X6OA 1OJLA 3JR9A 3ZQLA 4X1EA 2XGDA 3ZOBA 4B1RA 1MSEC 1ZKGA 1HCRA 5BNGA 3BR3A 5IOYA 4UUSA 1IDYA 3GTKJ 4XIDA 1P7JA 3DEWA 2DTZA 1GV5A 1G2HA 1JJ6C 2ID3A 2EH3A 3HBLA 2MGQA 2M2EA 2D5VA 1R9TJ 1FIAA 2XRLA 1WH7A 2LKXA 4V2FA 1JKQC 5M5XJ 1I3QJ 1MBKA 1ZTRA 5F0HA 2DMNA 1IC8A 2YS9A 3S16J 3GTGJ 1JTXA 2L7MP 4M3BA 3BTCA 1B8IB 2NOGA 4D7MA 2VUMJ 1JKOC 2B63J 4BBRJ 5M5YJ 2LLKA 3NARA 2CJJA 1Q1VA 1AKHB 5F0CA 1T33A 1IV6A 2DA6A 4S0HB 5EZHA 3HM5A 1T56A 5C4JJ 5M3FJ 2R5ZA 1FTTA 2L7FP 3JRFA 1LE8B 3F0CA 4B4CA 4UUSB 5IYBJ 3K7AJ 3H0GJ 2EZLA 2L7ZA 4MIMA 3JRIA 2HI3A 1POGA 3BTIA 1TC3C 3RQIA 2LD5A 5GP9A 2R5YA 4G12A 2QF7A 3BT9A 5FKMA 3S17J 4IHYA 2DA7A 2E2HJ 4C3IJ 1WGXA 4I76A 3O8GA 2X48A 3HOVJ 3IH4A 1TWHJ 5C3EJ 1VNDA 5HODA 2DA3A 2KDZA 1NK2P 3G1OA 3JRAA 1A6IA 1ETKA 3Q0UA 3G1MA 1GT0C 1X2MA 5IP7J 1F36A 5F04A 2EBIA 2QCOA 3OOUA 3OIOA 2Y9YA 3WHBA 2Y9ZA 1MSFC 1U9NA 2LY9A 2AHQA 9ANTA 3BR5A 4V2GA 1AU7A 3A03A 2RAEA 2XPWA 1X58A 1ZK8A 2DMUA 3ZQHA 4FE4A 1WPKA 3TW7A 2R0QC 1JKRC 1GVDA 2Y31A 4MFDA 5EGOB 3BG3A 3O8HA 4DYCA 1IJWC 3HEFA 2CU7A 1ETXA 3HOXJ 2VKVA 1APLC 3CQZJ 1S7EA 1RPWA 1OCPA 2EQRA 5F0FA 4JX4A 2EZKA 3C2BA 1I6HJ 2DA2A 1B8IA 3PO3J 2EZHA 2K9SA 1QRYA 4XRMA 3M3YJ 3A02A 3LOCA 2I10A 2W48A 1ETOA 3HGGA 4AC0A 4ABZA 5FKKA 1AKHA 5EZGA 1JUPA 2L9RA 1RKWA 1SANA 1U78A 1LE8A 1JKPC 4A3FJ 1ZGWA 1UG2A 3HOYJ 2ZB9A 4MFEA 3ZQCA 2EZIA 3M4OJ 3RZDJ 4NDLA 5K7HA 2H8RA 1H88C 3S2HJ 3GTQJ 3IH3A 5EEAA 5JLWA 2DA5A 1AHDP 4DZJA 4A3JJ 4FISA 3BTLA 1GUUA 3Q0WA 2N8GA 4MLOA 2NVTJ 4QTRA 4A69C 3HKZN 3VPRA 4M6VA 3PM1A 2YUSA 4DYRA 4RBOA 2R93J 3HB9A 2VI6A 2JMWA 3BQZA 5DTDA 2DN0A 3JRGA 1I50J 2FD5A 4M3EA 5GPCA 1YRNB 2CUFA 3TW6A 2OPTA 4GFBA 3IH2A 3TEDA 4BBSJ 1PUFB 2IEKA 2H1KA 1ETVA 3D1NI 4HNVA 5FKLA 3MKLA 3BR6A 4IHWA 1JJ8C 3TP0A 2M8GX 3JRCA 3Q0VA 4A3LJ 2HDDA 5EGOA 3FK6A 4XRSG 2MG4A 1K83J 1ZR2A 4Y7NJ 3MN2A 1BW6A 1P7IA 2HYJA 4XICA 3S1QJ 1BJZA 2E1OA 2JA6J 4QIWN 2WV1A 5M3MJ 2XPVA 3HGYA 3HOUJ 2LK2A 2JA7J 1MBGA 1Y1WJ 4A3DJ 2JN6A 5E3LA 2E2JJ 3A01B 3FK7A 5FKOA 3S14J 4UUTA 2ME6A 3RZOJ 2JWTA 2ID6A 5EF6A 4C3HJ 1ETQA 1GDTA 4BKXA 1W0TA 1FEXA 5J1RA 3QQAA 5F27A 1MBHA 4DYQA 4D5CA 3ZQFA 1ZQ3P 4M3GA 4FE7A 2DMPA 3SJMA 4BY1J 1IGNA 3LSJA 5J1YA 1RKTA 3BR0A 4C2MJ 4MO7A 2Y2ZA 1ZR4A 3S1NJ 1VI0A 3IV5A 1A5JA 4W1UA 1IRZA 3BR2A 1NTCA 4FCYA 5EG0A 2KT0A 2M9HA 3CCYA 5FLVA 2HXOA 4M3DA 1HDDC 1MBEA 5E3MA 5IYCJ 2JA5J 3LSRA 3GBGA 1XG1A 4D7NA 1E3OC 2COBA 5FLMJ 4A3GJ 5EYRA 3OSGA 1OCTC 2K40A 1JT6A 1FIPA 1MBJA 2ECBA 1DU0A 4Y52J 1O4XA 3BG5A 3S2DJ 1X2NA 1YRNA 2XGCA 2M34A 1PUFA 4IEJA 2M0CA 1IDZA 3RKQA 2ELKA 2DJNA 4JP0A 1VF9A 4IHVA 1HLVA 1QPIA 2IAIA 5J3LA 3GTJJ 4JX6A 2L0KA 1TWGJ 3ZQGA 1HF0A 1JTYA 4LOCA 3BR1A 2VKEA 3G1LA 4D5FA 5IP6A 2LTPA 1IUFA 1ITYA 5IPAA 1UHSA 2XB0X 1QVTA 2NVXJ 1ORKA 3FKIJ 1QVUA 2FX0A 1ETYA 5K7ZA 1TWAJ 4I6ZA 1U9OA 2DMQA 2O8KA 2TCTA 2R92J 2P81A 2IBDA 5GPAA 5EG0B 1F43A 3A01A 4W97A 2PMZN 2HOAA 4BY7J 1Y1VJ 3CMYA 1U8BA 4CYCA 2WAQN 4EEFG 5IYDJ 5K7FA 3OSFA 3E7LA 3CDLA 4B3AA 5C4XJ 3JRDA 1WCMJ 4XRSA 2YU9J 4C3JJ 2MSYA 3HOZJ 4QSHA 1MH3A 3DCFA 4FTHA 2NVYJ 2CQXA 3QPSA 1DU6A 2O9LA 1Z77A 1HDPA 3I4NJ 1K61A 3FIWA 2NS8A 1W0UA 2XB5A 1FTZA 3B6AA 2Y30A 2LP0A 3GTPJ 3K2AA 1H89C 4X6AJ 3MVPA 1SFOJ 2E2IJ 3SDGA 2LFBA 2JJ7A 4A3KJ 3HDDA 4IHXA 2NS7A 5FKNA 4A3MJ 2FJ1A 2K9QA 3QPLA 1CQTA 3TP3A 3SFIA 4XK4A 3BQYA 1H8AC 1JUSA 3B6CA 3HOWJ 3S1MJ 2X9DA 1EF4A 3H3VK 2AO9A 2CRGA 5E3NA 3L1PA 3JRHA 1XS9A 3GTOJ 2ECCA 1ETWA 1B72A 2HOSA 2NVQJ 4A3EJ 4CYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH4 A;  2DMT A;  1MNM C;  2TRT A;  2GBY A;  2XGE A;  4JYK A;  2E19 A;  5IP9 J;  5E3O A;  1LFU P;  3GTM J;  1JUM A;  4J19 A;  1NK3 P;  3UKG A;  2ME0 A;  2HXI A;  4AYB N;  3JRE A;  2XPU A;  2O7O A;  1GV2 A;  4JX5 A;  1D5Y A;  2MW8 A;  1LFB A;  1MBF A;  2VPR A;  2HOT A;  4M3F A;  5DS9 A;  4RDU A;  1RET A;  2HQ5 A;  3WHC A;  1Z0X A;  3S15 J;  4A3C J;  1RES A;  2LVS A;  2Y0S N;  5FJ8 J;  4BXX J;  1WH5 A;  3S1R J;  5EDN A;  4A93 J;  3FIS A;  5F08 A;  5M5W J;  5C44 J;  2R5Z B;  2R7Z J;  1VFC A;  2DA1 A;  2GM4 A;  5IOZ A;  1IG7 A;  1BW5 A;  2DA4 A;  2CQQ A;  1FJL A;  5JLX A;  1B72 B;  3JRB A;  3W6V A;  3LSG A;  5J1U A;  2FQ4 A;  1OFC X;  1WI3 A;  4DW6 A;  1ENH A;  1UMQ A;  2R5Y B;  5F1J A;  4A3B J;  3NAU A;  1HOM A;  3ZQI A;  1XC5 A;  2CUE A;  2JK3 A;  2GLO A;  4A3I J;  3I4M J;  1TWF J;  2LR8 A;  1JT0 A;  4DZP A;  2OF7 A;  3PO2 J;  2JA8 J;  2XSD C;  3BTJ A;  3LSP A;  1TWC J;  3GTL J;  1RR7 A;  1BL0 A;  3LNQ A;  2WB1 N;  4L5E A;  2G0E A;  4AUX A;  2K9N A;  1JGG A;  3Q3S A;  1BA5 A;  3BG9 A;  2X6O A;  1OJL A;  3JR9 A;  3ZQL A;  4X1E A;  2XGD A;  3ZOB A;  4B1R A;  1MSE C;  1ZKG A;  1HCR A;  5BNG A;  3BR3 A;  5IOY A;  4UUS A;  1IDY A;  3GTK J;  4XID A;  1P7J A;  3DEW A;  2DTZ A;  1GV5 A;  1G2H A;  1JJ6 C;  2ID3 A;  2EH3 A;  3HBL A;  2MGQ A;  2M2E A;  2D5V A;  1R9T J;  1FIA A;  2XRL A;  1WH7 A;  2LKX A;  4V2F A;  1JKQ C;  5M5X J;  1I3Q J;  1MBK A;  1ZTR A;  5F0H A;  2DMN A;  1IC8 A;  2YS9 A;  3S16 J;  3GTG J;  1JTX A;  2L7M P;  4M3B A;  3BTC A;  1B8I B;  2NOG A;  4D7M A;  2VUM J;  1JKO C;  2B63 J;  4BBR J;  5M5Y J;  2LLK A;  3NAR A;  2CJJ A;  1Q1V A;  1AKH B;  5F0C A;  1T33 A;  1IV6 A;  2DA6 A;  4S0H B;  5EZH A;  3HM5 A;  1T56 A;  5C4J J;  5M3F J;  2R5Z A;  1FTT A;  2L7F P;  3JRF A;  1LE8 B;  3F0C A;  4B4C A;  4UUS B;  5IYB J;  3K7A J;  3H0G J;  2EZL A;  2L7Z A;  4MIM A;  3JRI A;  2HI3 A;  1POG A;  3BTI A;  1TC3 C;  3RQI A;  2LD5 A;  5GP9 A;  2R5Y A;  4G12 A;  2QF7 A;  3BT9 A;  5FKM A;  3S17 J;  4IHY A;  2DA7 A;  2E2H J;  4C3I J;  1WGX A;  4I76 A;  3O8G A;  2X48 A;  3HOV J;  3IH4 A;  1TWH J;  5C3E J;  1VND A;  5HOD A;  2DA3 A;  2KDZ A;  1NK2 P;  3G1O A;  3JRA A;  1A6I A;  1ETK A;  3Q0U A;  3G1M A;  1GT0 C;  1X2M A;  5IP7 J;  1F36 A;  5F04 A;  2EBI A;  2QCO A;  3OOU A;  3OIO A;  2Y9Y A;  3WHB A;  2Y9Z A;  1MSF C;  1U9N A;  2LY9 A;  2AHQ A;  9ANT A;  3BR5 A;  4V2G A;  1AU7 A;  3A03 A;  2RAE A;  2XPW A;  1X58 A;  1ZK8 A;  2DMU A;  3ZQH A;  4FE4 A;  1WPK A;  3TW7 A;  2R0Q C;  1JKR C;  1GVD A;  2Y31 A;  4MFD A;  5EGO B;  3BG3 A;  3O8H A;  4DYC A;  1IJW C;  3HEF A;  2CU7 A;  1ETX A;  3HOX J;  2VKV A;  1APL C;  3CQZ J;  1S7E A;  1RPW A;  1OCP A;  2EQR A;  5F0F A;  4JX4 A;  2EZK A;  3C2B A;  1I6H J;  2DA2 A;  1B8I A;  3PO3 J;  2EZH A;  2K9S A;  1QRY A;  4XRM A;  3M3Y J;  3A02 A;  3LOC A;  2I10 A;  2W48 A;  1ETO A;  3HGG A;  4AC0 A;  4ABZ A;  5FKK A;  1AKH A;  5EZG A;  1JUP A;  2L9R A;  1RKW A;  1SAN A;  1U78 A;  1LE8 A;  1JKP C;  4A3F J;  1ZGW A;  1UG2 A;  3HOY J;  2ZB9 A;  4MFE A;  3ZQC A;  2EZI A;  3M4O J;  3RZD J;  4NDL A;  5K7H A;  2H8R A;  1H88 C;  3S2H J;  3GTQ J;  3IH3 A;  5EEA A;  5JLW A;  2DA5 A;  1AHD P;  4DZJ A;  4A3J J;  4FIS A;  3BTL A;  1GUU A;  3Q0W A;  2N8G A;  4MLO A;  2NVT J;  4QTR A;  4A69 C;  3HKZ N;  3VPR A;  4M6V A;  3PM1 A;  2YUS A;  4DYR A;  4RBO A;  2R93 J;  3HB9 A;  2VI6 A;  2JMW A;  3BQZ A;  5DTD A;  2DN0 A;  3JRG A;  1I50 J;  2FD5 A;  4M3E A;  5GPC A;  1YRN B;  2CUF A;  3TW6 A;  2OPT A;  4GFB A;  3IH2 A;  3TED A;  4BBS J;  1PUF B;  2IEK A;  2H1K A;  1ETV A;  3D1N I;  4HNV A;  5FKL A;  3MKL A;  3BR6 A;  4IHW A;  1JJ8 C;  3TP0 A;  2M8G X;  3JRC A;  3Q0V A;  4A3L J;  2HDD A;  5EGO A;  3FK6 A;  4XRS G;  2MG4 A;  1K83 J;  1ZR2 A;  4Y7N J;  3MN2 A;  1BW6 A;  1P7I A;  2HYJ A;  4XIC A;  3S1Q J;  1BJZ A;  2E1O A;  2JA6 J;  4QIW N;  2WV1 A;  5M3M J;  2XPV A;  3HGY A;  3HOU J;  2LK2 A;  2JA7 J;  1MBG A;  1Y1W J;  4A3D J;  2JN6 A;  5E3L A;  2E2J J;  3A01 B;  3FK7 A;  5FKO A;  3S14 J;  4UUT A;  2ME6 A;  3RZO J;  2JWT A;  2ID6 A;  5EF6 A;  4C3H J;  1ETQ A;  1GDT A;  4BKX A;  1W0T A;  1FEX A;  5J1R A;  3QQA A;  5F27 A;  1MBH A;  4DYQ A;  4D5C A;  3ZQF A;  1ZQ3 P;  4M3G A;  4FE7 A;  2DMP A;  3SJM A;  4BY1 J;  1IGN A;  3LSJ A;  5J1Y A;  1RKT A;  3BR0 A;  4C2M J;  4MO7 A;  2Y2Z A;  1ZR4 A;  3S1N J;  1VI0 A;  3IV5 A;  1A5J A;  4W1U A;  1IRZ A;  3BR2 A;  1NTC A;  4FCY A;  5EG0 A;  2KT0 A;  2M9H A;  3CCY A;  5FLV A;  2HXO A;  4M3D A;  1HDD C;  1MBE A;  5E3M A;  5IYC J;  2JA5 J;  3LSR A;  3GBG A;  1XG1 A;  4D7N A;  1E3O C;  2COB A;  5FLM J;  4A3G J;  5EYR A;  3OSG A;  1OCT C;  2K40 A;  1JT6 A;  1FIP A;  1MBJ A;  2ECB A;  1DU0 A;  4Y52 J;  1O4X A;  3BG5 A;  3S2D J;  1X2N A;  1YRN A;  2XGC A;  2M34 A;  1PUF A;  4IEJ A;  2M0C A;  1IDZ A;  3RKQ A;  2ELK A;  2DJN A;  4JP0 A;  1VF9 A;  4IHV A;  1HLV A;  1QPI A;  2IAI A;  5J3L A;  3GTJ J;  4JX6 A;  2L0K A;  1TWG J;  3ZQG A;  1HF0 A;  1JTY A;  4LOC A;  3BR1 A;  2VKE A;  3G1L A;  4D5F A;  5IP6 A;  2LTP A;  1IUF A;  1ITY A;  5IPA A;  1UHS A;  2XB0 X;  1QVT A;  2NVX J;  1ORK A;  3FKI J;  1QVU A;  2FX0 A;  1ETY A;  5K7Z A;  1TWA J;  4I6Z A;  1U9O A;  2DMQ A;  2O8K A;  2TCT A;  2R92 J;  2P81 A;  2IBD A;  5GPA A;  5EG0 B;  1F43 A;  3A01 A;  4W97 A;  2PMZ N;  2HOA A;  4BY7 J;  1Y1V J;  3CMY A;  1U8B A;  4CYC A;  2WAQ N;  4EEF G;  5IYD J;  5K7F A;  3OSF A;  3E7L A;  3CDL A;  4B3A A;  5C4X J;  3JRD A;  1WCM J;  4XRS A;  2YU9 J;  4C3J J;  2MSY A;  3HOZ J;  4QSH A;  1MH3 A;  3DCF A;  4FTH A;  2NVY J;  2CQX A;  3QPS A;  1DU6 A;  2O9L A;  1Z77 A;  1HDP A;  3I4N J;  1K61 A;  3FIW A;  2NS8 A;  1W0U A;  2XB5 A;  1FTZ A;  3B6A A;  2Y30 A;  2LP0 A;  3GTP J;  3K2A A;  1H89 C;  4X6A J;  3MVP A;  1SFO J;  2E2I J;  3SDG A;  2LFB A;  2JJ7 A;  4A3K J;  3HDD A;  4IHX A;  2NS7 A;  5FKN A;  4A3M J;  2FJ1 A;  2K9Q A;  3QPL A;  1CQT A;  3TP3 A;  3SFI A;  4XK4 A;  3BQY A;  1H8A C;  1JUS A;  3B6C A;  3HOW J;  3S1M J;  2X9D A;  1EF4 A;  3H3V K;  2AO9 A;  2CRG A;  5E3N A;  3L1P A;  3JRH A;  1XS9 A;  3GTO J;  2ECC A;  1ETW A;  1B72 A;  2HOS A;  2NVQ J;  4A3E J;  4CYC B; 
#chains in the Genus database with same CATH topology
 2J5P A;  1XGO A;  3DPU A;  2PG4 A;  2HS5 A;  2GBY A;  4JYK A;  3GTM J;  1LFU P;  4BL0 B;  2H94 A;  1JUM A;  2W7N A;  2ME0 A;  3KP6 A;  4A5M A;  3ASN H;  4ENM A;  4IOA F;  4G9Y A;  1R5G A;  4WXC A;  2BY2 A;  2O7O A;  4BE0 A;  4NB5 A;  1W5C C;  1LFB A;  4ZYA A;  1X4O A;  4PDK A;  3KIO A;  1D3Y A;  2Z3Y A;  2X4H A;  3DBL B;  3M7G A;  4M6Y A;  2HQ5 A;  3H5A A;  5J6X A;  2YX4 A;  5K5O A;  1FT9 A;  3I53 A;  3GYH X;  4GYI A;  2K9L A;  3OYE A;  2KRC A;  3HRS A;  5EDN A;  2P6S A;  5ILV A;  2Q8K A;  2VJ5 A;  2HKX A;  2O3F A;  4E70 A;  3EPZ A;  4HSR A;  3ROU A;  1VFC A;  4CA0 A;  3RKW A;  1IG7 A;  2ACJ A;  2W25 A;  3U2R A;  2CQQ A;  3CCE I;  5JLX A;  3WTV C;  4G7Z F;  4FQG A;  3LSG A;  5FRN A;  5D6E A;  4R1H A;  1OR7 A;  2L2O A;  3ECH A;  2VBZ A;  3GFI A;  4HDU A;  4G6D A;  2DK5 A;  1R1T A;  1T0F A;  1Y0U A;  3DBR B;  3X2Q H;  2O61 A;  1HOM A;  1SAU A;  4HV5 A;  3OYF A;  4P1W A;  2VXZ A;  4XLN F;  1TWF J;  4IHS A;  1D0X A;  2NVU B;  2XRO A;  3C3W A;  4YFN F;  2LR8 A;  1S8N A;  3MQ0 A;  4DZP A;  4V19 K;  3CO7 C;  3ZMZ A;  1E2X A;  3PO2 J;  2JA8 J;  2OJE D;  2K5C A;  3BTJ A;  1TWC J;  3OY9 A;  1Z6T A;  2YU3 A;  1BL0 A;  2VL8 A;  4L5E A;  1YIT I;  1JGG A;  3Q3S A;  1BA5 A;  5D8L B;  4OIQ F;  2DXI A;  3O3K A;  4HNT A;  1OJL A;  2QBY B;  4P55 A;  3ZQL A;  2NNN A;  2PQ8 A;  2XGD A;  1FSE A;  3DTE A;  1LVK A;  3ZOB A;  3KCC A;  1Z05 A;  4A6D A;  5IOY A;  3WTT C;  2DTZ A;  3F8C A;  4M74 A;  2OA4 A;  2IT0 A;  2WV0 A;  1ZGA A;  2D5V A;  1R9T J;  2Y69 H;  2QKM B;  4DBQ A;  1I3A A;  1SD5 A;  2KDO A;  1HBX G;  1KU7 A;  2BXY A;  1MBK A;  3AG3 H;  2W1O A;  3CLQ A;  2DMN A;  1FZP B;  2NNY A;  2BY3 A;  4N4O B;  2DTR A;  3GTG J;  2X6Y A;  2L7M P;  3BTC A;  2M0M A;  3CMM A;  3JCU C;  1JKO C;  2X51 A;  3E6C C;  1ZG5 A;  4BE1 A;  5HDK A;  1OCO H;  4IL6 C;  1IUY A;  2LKS A;  2ELH A;  1T33 A;  4PGG A;  5E1Z B;  5ICC A;  1T98 A;  2CQN A;  1VQ8 I;  2BE5 F;  4LGW A;  4PSW A;  1FPQ A;  2STT A;  5D5W B;  2QM3 A;  2R5Z A;  2O5R A;  3CTA A;  3KP3 A;  2L7F P;  3JRF A;  1UST A;  3WE2 A;  2L9N A;  4ZH4 F;  5K5R A;  2GXA A;  2A6T A;  1ZHF A;  5IYB J;  4BUP A;  1ZYR F;  4Y4R A;  4BQQ A;  4MQV A;  2L7Z A;  4RMN A;  3MZH A;  4FX0 A;  5DM6 F;  3CC7 I;  3I0T A;  5CVU A;  3RQI A;  5GP9 A;  4QPO A;  4E7J A;  5FKM A;  3BT9 A;  1ZH5 A;  2PMH A;  2XGX A;  3K1N A;  1WJD A;  4G6Q A;  1R58 A;  2L4M A;  3KX2 A;  3EDP A;  2UV1 A;  4KN4 X;  1N78 A;  2IPQ X;  1UJ8 A;  2PX9 A;  3S3M A;  4I76 A;  1E3H A;  2O8X A;  1TWH J;  3FM3 A;  4PSX A;  5F1R A;  2IS1 A;  3M8F A;  2KDZ A;  1XTA A;  3G1O A;  1K4S A;  2Z1D A;  1GT0 C;  1X2M A;  5LGN A;  4G6T B;  3CCJ I;  3GWZ A;  3LL7 A;  1F36 A;  3A1Y A;  4C30 A;  5KVR A;  1KU2 A;  1K78 A;  4P96 A;  2BY1 A;  4RM2 A;  4Y33 A;  3K1M A;  2R7D A;  4WK8 F;  1U0J A;  5GTI C;  2FML A;  2GWR A;  3D5S C;  3M8J A;  2W82 A;  2VT3 A;  3A03 A;  4N4N B;  3H5N A;  3RDI A;  5E1W A;  3HRT A;  1ZK8 A;  1S9H A;  2FXA A;  1BM9 A;  2HFH A;  2L01 A;  2V1X A;  3MZY A;  4XNF A;  4FE4 A;  3ZQ7 A;  2HWV A;  1DP7 P;  4MFD A;  4DYC A;  1IJW C;  2BEO A;  3I5U A;  1LDD A;  2VKV A;  3FBN B;  2XKP A;  1LNW A;  1PDN C;  1RPW A;  1S7E A;  4GCV A;  1OCP A;  1SC7 A;  1G4D A;  2K4J A;  1PJR A;  5F0F A;  3J7A Y;  4JX4 A;  1RI7 A;  1B8I A;  1UG0 A;  3QRF F;  3OYL A;  1P6R A;  3M3Y J;  1KGS A;  3HZJ A;  4JOM A;  2GOM A;  3A02 A;  4E4H A;  5B1B H;  3A2K A;  1ETO A;  1AKH A;  1HSJ A;  3K4N A;  1E0E A;  5L3C A;  2L9R A;  2IA2 A;  1BIB A;  2XAF A;  1FOK A;  1WZ2 A;  1J75 A;  1VQM I;  1LVA A;  1BBY A;  1JKP C;  1BI2 A;  2ZFW A;  2RVC A;  2VOD A;  2KZG A;  4XL9 A;  3BZC A;  3HOY J;  3GFJ A;  4CCK A;  2BVL A;  4MFE A;  2XIG A;  4XR6 A;  3TOB A;  2M30 A;  1ACI A;  3K1P A;  3M4O J;  3LSH A;  1O3S A;  1H88 C;  3GME A;  3WOD F;  3IH3 A;  1YQA A;  5EEA A;  5JLW A;  4I0A A;  3AAF A;  2EFQ A;  2P7C B;  1XSX A;  4FIS A;  1GUU A;  1O3Q A;  2AS5 F;  3IWZ A;  4LG0 A;  4OIN F;  4PCQ A;  2F4O B;  3CF5 F;  3PM1 A;  2YUS A;  1YYV A;  4QLC U;  2V1N A;  2JMW A;  4XOP A;  1O7L A;  2DN0 A;  3HHG A;  2IA1 A;  1MIJ A;  4Y13 A;  1YW7 A;  3CLO A;  2KFD A;  3DU6 A;  3VFZ A;  4P9F A;  2OPT A;  4CH7 A;  2PMU A;  3TL4 X;  4XKB A;  2ZCW A;  2FOK A;  4IPA A;  5FKL A;  4G7O F;  1LKX A;  4RB2 C;  2ZSI B;  3UNG C;  4XOT A;  5CJ9 A;  3HIF A;  1HKS A;  3M8E A;  4EJV A;  4FAS D;  3TP0 A;  3CUQ B;  4Q47 A;  3ERM A;  2KKO A;  1I6X A;  5H20 A;  4AIJ A;  5EGO A;  3FK6 A;  1XMX A;  5CLS A;  3VEP A;  3DXJ F;  4AIK A;  1P7I A;  1TZL A;  1U5T A;  2MYS A;  4KT6 A;  4CXF A;  2NS0 A;  2ZO4 A;  1HQC A;  3KP7 A;  1Z91 A;  3HUG A;  1KU3 A;  2LK2 A;  2JA7 J;  2JN6 A;  3A01 B;  2VON A;  5FRO A;  3RCO A;  4P9U A;  3O2P E;  4BJT A;  4EJO A;  4EJT A;  1E3P A;  2ZC2 A;  1TQI A;  2L4A A;  3RZO J;  3IRQ A;  3NRV A;  1Z3Y A;  3FMQ A;  3QQA A;  4OAY A;  5J1R A;  3MFK A;  4BH9 A;  4DYQ A;  3CCM I;  4D5C A;  3ZQF A;  5ED4 A;  2V6E A;  2K7L A;  3IL2 A;  5HOO A;  2R7R A;  5D4S A;  3R61 A;  3WTY C;  4XLA A;  2K4B A;  1IGN A;  2FMY A;  2W4S A;  4GRI A;  3VYR B;  5DCM A;  5D5U B;  1D1B A;  2F5F A;  4NHJ A;  3E6M A;  5LEK A;  2CG4 A;  3I3L A;  3S1N J;  5CQE A;  3IV5 A;  4W1U A;  1NG6 A;  3BJ6 A;  3G73 A;  3CCS I;  2M5W A;  2Y75 A;  2HQN A;  1C0W A;  3F8N A;  3KZY A;  1U5T B;  3CP2 A;  2W84 A;  2Y0M A;  2HZD A;  1ZEL A;  1MW7 A;  1X3W B;  5FLV A;  2MC4 A;  2A5Y B;  1MBE A;  1X1C A;  1Y8R B;  3HUG B;  3KZZ A;  5IYC J;  2DO7 A;  4BQO A;  1TQP A;  4N9I A;  2DCE A;  3W6K B;  2EPF A;  5EYR A;  2GAU A;  4RGU A;  1JT6 A;  1BJA A;  3H36 A;  3S2D J;  1T95 A;  3P9I A;  1YRN A;  4U0Y A;  5LLQ A;  3L9F A;  3EUH C;  4M9Z A;  1KA8 A;  2CW0 F;  1PUF A;  2ADU A;  4XN0 A;  1WSU A;  2DT7 B;  2HKO A;  4JP0 A;  1VF9 A;  1VQO I;  2CV0 A;  3LA7 A;  3LA3 A;  4XLP F;  4IHV A;  1RZ4 A;  2IAI A;  3BP8 A;  3DKX A;  3GFL A;  2EIK H;  1J7K A;  3H9G A;  3N05 A;  3QU3 A;  1QZY A;  5J3L A;  3MKZ A;  4AWX B;  1RIO H;  2HQR A;  3AG2 H;  4AVP A;  4H0E A;  1HW1 A;  2VKE A;  1W5T A;  3G1L A;  2LTP A;  1V5F A;  1W4M A;  4M73 A;  5IPA A;  3HYI A;  1IN4 A;  4RGS A;  5HLH A;  1ORK A;  4IZZ A;  1UZC A;  4I0B A;  3I4P A;  4BJ6 C;  1U9O A;  4NNJ A;  2TCT A;  3D0S A;  3I54 A;  2MFZ A;  2P81 A;  3VYU B;  2UZK A;  3FXU A;  1B9M A;  2XAQ A;  1RNL A;  3FXR A;  4Z2Y A;  3CMY A;  1E17 A;  3E5Q A;  3TBI A;  4CYC A;  5TJJ A;  2DDB A;  1FSH A;  5K7F A;  1SFE A;  3AKZ A;  3M9A A;  3BWG A;  3JRD A;  3KEY A;  4ON0 A;  1WCM J;  5BMZ A;  2O03 A;  3J7A O;  3HOZ J;  2VBY A;  3CZ6 A;  3ONQ A;  3D5R C;  3OYN A;  2E5Z A;  2CQX A;  2NVY J;  5CYV A;  3I4N J;  4BQA A;  3MKY B;  4F7Z A;  2GA2 A;  3DV8 A;  5FRM A;  4BGD A;  3GLX A;  1D1A A;  3B6A A;  2RN7 A;  2H6B A;  5D6F A;  1H89 C;  1JI8 A;  3E5X A;  2YX7 A;  4IHX A;  4KDP A;  3TP3 A;  1X19 A;  3SFI A;  4R79 A;  3BQY A;  1R4M B;  3KZI C;  1H8A C;  1QBJ A;  1YW8 A;  1JUS A;  2GOX B;  5JVG F;  1U3E M;  4KIS A;  2AO9 A;  2HEO A;  1ZN2 A;  3QWL A;  4IF4 A;  3KYL A;  4AM3 A;  1EV7 A;  4CYC B;  1UHM A;  3AFH A;  4ETS A;  2DMT A;  2VBW A;  3TQN A;  5E3O A;  2E19 A;  3BG7 A;  4HA8 A;  4CYD A;  1RUN A;  3ABK H;  2X6W A;  4I2O A;  4KIG A;  3EET A;  1XN7 A;  2ICW G;  1GV2 A;  4JK1 X;  2IA0 A;  5KAI C;  2Q2E B;  3IKT A;  2R7O A;  2HOT A;  4M3F A;  5DS9 A;  4RDU A;  4RAY A;  4HDV A;  1RET A;  4I7H A;  5AIQ A;  4EM0 B;  2ZBK A;  4B43 A;  1OCR H;  1FBU A;  4KMU X;  4A3C J;  4AIH A;  1RES A;  3PNT A;  2H8W A;  3I59 A;  3EQL F;  2L02 A;  4CIC A;  5FJ8 J;  1XB4 A;  1WH5 A;  2PFB A;  1R00 A;  3CUQ C;  4A93 J;  1G3W A;  2O0Y A;  3VDX A;  2ZNZ A;  2BBY A;  3PQJ A;  3Q9V A;  2V79 A;  2A3S A;  2DA1 A;  3TKY A;  1BI0 A;  4LB6 B;  2K86 A;  1X1D A;  3ZMS A;  3DQV C;  5IOZ A;  2FQ3 A;  3PIO F;  1BW5 A;  2P7V B;  3U1K A;  3W6V A;  2KQR A;  1LFP A;  3W6J B;  1MDM B;  3IAM 2;  1FBQ A;  1WI3 A;  3EUK L;  2RQP A;  2ZJ2 A;  2YSR A;  3CJN A;  3LQQ A;  2R5Y B;  2DJI A;  2E1N A;  5F1J A;  4IX7 A;  1H9T A;  4L5J A;  3ZQI A;  2JK3 A;  3KEQ A;  4A3I J;  3I4M J;  2RDP A;  3E1S A;  4I01 A;  2DPU A;  1FLI A;  2MD5 A;  2OF7 A;  5EEG A;  2F5V A;  3H1C A;  2ZJQ F;  3EYI A;  3HG9 A;  3LSP A;  1P9Q C;  1RR7 A;  2G0E A;  3R4K A;  4AUX A;  2ZXJ A;  3MMY B;  4ZJZ A;  3M1E A;  4OMZ A;  4ENK A;  1O3T A;  1V4R A;  1FC3 A;  3BY6 A;  4L9T A;  3J7Z I;  1NH3 A;  3SZT A;  3BR3 A;  4ZYG A;  3BPX A;  2K85 A;  3GTK J;  3VOD A;  3K2Z A;  1P7J A;  4LFU A;  2MLG A;  4BYY A;  2MGQ A;  3PIP F;  2QWW A;  3CDH A;  4HOB A;  1R1U A;  4AYB A;  1LEB A;  3QPH A;  2OAZ A;  1AA7 A;  1WH7 A;  2XRL A;  4DNC A;  4S04 A;  2HDW A;  1I3Q J;  3RPU D;  3I71 A;  4QWQ A;  1OIS A;  1BOA A;  2QKL B;  1SVL A;  1IC8 A;  3S16 J;  4LLL A;  1JTX A;  2AQE A;  3AG4 H;  3PSI A;  4M3B A;  4RM3 A;  1R23 A;  1O3R A;  2NOG A;  2UXN A;  3IUO A;  3F8F A;  3DBH B;  2ZKZ A;  3SYT A;  4EGY A;  5HNH A;  3QYB A;  2LLK A;  1ZRF A;  1Q1V A;  5BPI A;  2A07 F;  1WJ5 A;  4S0H B;  1JGS A;  2KMU A;  1T56 A;  5C4J J;  4OIO F;  3WGH A;  2E71 A;  1VQK I;  1LE8 B;  2W00 A;  2Y48 A;  5TIS C;  3TO9 A;  3F0C A;  4BXF A;  1SVO A;  2KRF A;  4I98 B;  3ZMV A;  5DEQ A;  1VQ9 I;  2VQC A;  2EV5 A;  2CV2 A;  2DOA A;  3RTR A;  4BNC A;  1J0R A;  1IRF A;  5BQT A;  1L3L A;  3BZ6 A;  5H2F C;  5D8K B;  4EAT A;  2LD5 A;  3FXL A;  1BOB A;  2QSF X;  2XV4 S;  2ZJR F;  4IHY A;  4CCM A;  2MD0 A;  2E2H J;  2WY8 Q;  4HF2 A;  4KIT B;  1YTY A;  1YHQ I;  3HOV J;  2WB1 A;  3IH4 A;  4G94 A;  5HOD A;  1BR2 A;  3KYC B;  3JSO A;  1S72 I;  2NRA C;  1ZG1 A;  1ETK A;  3Q0U A;  3G1M A;  2WAF A;  2VC1 A;  2P5K A;  1VQ6 I;  1G6N A;  2ISZ A;  2QBY A;  1KYZ A;  2QQ9 A;  3OOU A;  3OIO A;  4BE2 A;  2WBM A;  1MSF C;  2AHQ A;  2RGV A;  1AU7 A;  3AL0 C;  3K10 A;  1TL8 A;  2BXZ A;  1ZRD A;  3QPT A;  2E7X A;  1QNT A;  1I1G A;  1GVD A;  2Y31 A;  4U87 A;  3RPU A;  5L3G A;  1MKM A;  3O8H A;  4MEX F;  2CFO A;  4XKV A;  1ETX A;  3D5L A;  2M87 A;  2E34 A;  2DOE A;  4DIQ A;  4CZZ A;  3PJR A;  3VYS B;  1DQU A;  3IC7 A;  4OIR F;  4PZJ A;  2DA2 A;  5F6F A;  1QQI A;  5BOX A;  3GX4 X;  1YJ9 I;  2JRM A;  1QRY A;  4NUB A;  3LFK A;  1UFM A;  3ZCO A;  2I10 A;  3EYY A;  2MBF A;  5HLG A;  4OOI A;  3HGG A;  3P7N A;  3CDI A;  2E1M C;  2L9V A;  1VQ7 I;  3FKJ A;  3PUB A;  4E7S A;  3ABU A;  1M1E B;  2HPM A;  2HOE A;  1X3U A;  4PJN A;  4A3F J;  2CSO A;  4YFX F;  2M7A A;  2IJL A;  3LAJ A;  3PSF A;  1XSV A;  4EV0 A;  3E6D A;  4WXD A;  1KYW A;  2TDX A;  2R7X A;  4WCG A;  3PL8 A;  3ZQC A;  2DPD A;  2CUZ A;  5E8G A;  2P4W A;  5J4V A;  2M4G A;  3RZD J;  4NDL A;  5K7H A;  5ICG A;  3S2H J;  1WQ2 A;  2JUC A;  1OKR A;  4JBA A;  3LMM A;  3ZP5 A;  1YIJ I;  3HC7 A;  3J80 Z;  4IVN A;  3DWL E;  5B1A H;  1XDS A;  2RQQ A;  4HF1 A;  1B9N A;  4M6V A;  4NC6 A;  1NG7 A;  3FX3 A;  2M4K A;  3HRM A;  3QYF A;  2ZNY A;  1A31 A;  2EIN H;  3J81 Z;  5DD4 A;  2DW4 A;  5LEJ A;  1I50 J;  1UAA A;  3BJO A;  4BHC A;  2FD5 A;  2L3D A;  4M3E A;  2Z33 A;  2ESN A;  5GPC A;  3TW6 A;  3T5X A;  4GFB A;  3TED A;  2FBI A;  4BBS J;  3BOQ A;  2AXT C;  2VXD A;  2K02 A;  2IRF G;  1B1B A;  3WG9 A;  3I55 I;  2R3S A;  3LWF A;  1ODD A;  4IRG A;  3TDU C;  3MKL A;  3BR6 A;  4BXU A;  4EMS A;  1OYY A;  2JA2 A;  2A68 F;  3JRC A;  4BAY A;  4ZDP A;  1X3Z B;  3Q0V A;  4ZYH A;  3P9K A;  3K9T A;  3BDD A;  1FYK A;  2DFH A;  4XRS G;  4YRV A;  4Y7N J;  1BW6 A;  5HDG A;  4NQW B;  2IGK A;  1BJZ A;  2JA6 J;  2DQL A;  4QIW N;  2ETH A;  2BHZ A;  4MTE A;  5LGT A;  5M3M J;  4LMY A;  4BEH A;  4H4K C;  3V8K A;  4A3D J;  4G7H F;  1O7F A;  1D0Z A;  4IXA A;  3IKV A;  4L0Y B;  5FKO A;  5B5E C;  2OCE A;  3HTS B;  3S14 J;  2DOF A;  1KU9 A;  4XLH A;  2GIZ A;  1EH8 A;  3OYJ A;  1VTN C;  2JWT A;  3IRR A;  3RPQ A;  5EF6 A;  3OL3 A;  1D8K A;  4HYE A;  2OTJ I;  1FX7 A;  1FEX A;  2LBF B;  2E7W A;  3FHZ A;  2D2W A;  1ZLK A;  2H1L A;  3L2V A;  3CCR I;  1ZQ3 P;  5BPD A;  4M3G A;  4CUG A;  4EVI A;  2I8D A;  2QQ8 A;  3ZXS A;  2H27 A;  4BY1 J;  2W57 A;  3T0Y A;  4CGZ A;  1RKT A;  3G2B A;  5LHI A;  2M45 A;  3KP5 A;  5CVR A;  2EK5 A;  2EFO A;  3H3U A;  4C2M J;  4MO7 A;  1T2K A;  1OCC H;  5HS8 A;  1U8R A;  1VI0 A;  5D5X B;  1UHW A;  1CF7 A;  3DEU A;  5DM7 F;  1XSD A;  2KIM A;  3I64 A;  2KIS A;  4LB5 A;  1NTC A;  2QQB A;  2CW8 A;  2GIV A;  1DUX C;  4HST A;  1TT0 A;  2A05 A;  3GO5 A;  4BEH B;  3LSR A;  1XG1 A;  4EGZ A;  1E3O C;  1QU3 A;  5FLM J;  3OSG A;  1YX3 A;  2JRT A;  2QGU A;  1FYL A;  4EQQ A;  1DU0 A;  1O4X A;  1X2N A;  2HYG D;  1XMK A;  4EJU A;  1QZZ A;  1YE9 A;  2QZ8 A;  4HG2 A;  2HDC A;  5L3D A;  3W2V A;  3RKQ A;  4QPQ A;  4I99 C;  4UV8 A;  1FY7 A;  2DJN A;  4KIC A;  1H0M A;  2Z9O A;  2LRD A;  3F22 A;  3IP4 B;  1QPI A;  1BC7 C;  3CUQ A;  1IO2 A;  4JX6 A;  3RKX A;  3T8T A;  2L0K A;  1TWG J;  4M71 A;  5FD5 A;  4HBL A;  1LDJ A;  1FOW A;  2ZXW H;  3V8J A;  4B48 A;  1HF0 A;  2NAZ A;  4WX9 A;  3PNV A;  2FBK A;  3GXO A;  1S7A A;  5J8C A;  4HRI A;  1ITY A;  3B02 A;  1UHS A;  2XB0 X;  3TMO A;  2O6G E;  1CF7 B;  2KL4 A;  1IN6 A;  2FX0 A;  4I6Z A;  1ETY A;  1TWA J;  2A6H F;  4RAG A;  2DMQ A;  4CSW A;  3PNY A;  2O8K A;  2IBD A;  5F64 A;  3U1D A;  5DD8 A;  3A01 A;  4W97 A;  3FXO A;  4PJ0 C;  2B7E A;  1MMN A;  2VT2 A;  1U8B A;  2QSH X;  2WAQ N;  4EEF G;  1OQY A;  3OSF A;  3F72 A;  3PUF A;  1WJB A;  3E7L A;  3G3Z A;  3JTH A;  1ZRC A;  3CDL A;  3L7W A;  5C4X J;  3WTW C;  3OS2 A;  3FMS A;  2FNP A;  2YU9 J;  2QUF A;  5JI6 A;  2OC6 A;  3HSE A;  2MSY A;  2UUZ A;  4O5V A;  1QA6 A;  2RRE A;  4QSH A;  1MH3 A;  3WU2 C;  1MZB A;  1MNE A;  3DEE A;  3V7R A;  4ASN A;  5DUK A;  1K6O A;  4IQ4 A;  3A4C A;  4CCL A;  1HDP A;  2V1U A;  1D5V A;  4CO8 A;  3GFM A;  1K61 A;  2NS8 A;  3KYD B;  2D1V A;  2R4G A;  5HS7 A;  2X1E A;  1IV8 A;  3GTP J;  4B3X A;  4IO9 F;  3MVP A;  3SDG A;  3K4K A;  4A2U A;  1BR1 A;  4A3K J;  5FKN A;  2VJI A;  3REO A;  4A3M J;  3QPL A;  1CQT A;  3WTS C;  2K27 A;  3P9C A;  1XX5 A;  4ZTF A;  4XSX F;  4UXN A;  4YEJ A;  3OWT A;  4S05 A;  4KT5 C;  3B6C A;  4UY8 I;  4CHU A;  4F55 A;  2CRG A;  3L1P A;  5IT9 Z;  1V55 H;  2ECC A;  2HOS A;  4KFC A;  2NVQ J;  1HXD A;  2QEN A;  2CMP A;  1N25 A;  1PP8 F;  1WHU A;  4XM3 A;  2KJB A;  3A0H C;  1LEA A;  2TRT A;  2XGE A;  4MGR A;  5IP9 J;  3WTU C;  4J19 A;  3UKG A;  3HSF A;  1MD0 A;  2JVG A;  3CME I;  1XPX A;  4MHG A;  3HRU A;  2XPU A;  1BN5 A;  4AD9 A;  1D5Y A;  3K6G A;  2MW8 A;  1OR7 C;  4HPQ A;  1MBF A;  3F21 A;  4BHP A;  2VPR A;  2V4J C;  2JPC A;  1P92 A;  5K5Q A;  2KIQ A;  4WWC A;  1S7O A;  1XCB A;  3WHC A;  1YI2 I;  1QZE A;  1Z0X A;  3MEX A;  3S15 J;  4X0G A;  3K4B A;  3CCQ I;  3ZMD A;  1OYW A;  1AOY A;  2V9P A;  3HTU A;  3SZP A;  2Y0S N;  3Q5F A;  4BXX J;  4YFK F;  2K9M A;  2GA1 A;  3S1R J;  4XQF A;  1IN7 A;  5F08 A;  2LY1 A;  1WJF A;  5M5W J;  1V54 H;  4E7K A;  2GM4 A;  2LDU A;  3I56 I;  3F6V A;  3RYR A;  2FA5 A;  5KK1 A;  2RNJ A;  2RC4 A;  1ZGJ A;  3ZMT A;  4HX7 A;  3SHF A;  2FQ4 A;  2R7Q A;  1HW2 A;  1VQ5 I;  1A04 A;  1J09 A;  4DW6 A;  5FLX K;  1K79 A;  2AXL A;  4WXH A;  1HA8 A;  4GXO A;  3V7S A;  1UMQ A;  2WTE A;  3T8R A;  2EIM H;  2UWM A;  4RB3 C;  4A3B J;  3NAU A;  1XC5 A;  2DLL A;  2GLO A;  1J59 A;  4F92 B;  5J40 A;  2E36 A;  2BZT A;  1DGW Y;  5FFZ A;  3FHN A;  2XF6 A;  1T38 A;  2IGN A;  3GTL J;  2ZSH B;  1PP7 U;  4II2 A;  1P4X A;  3LNQ A;  1X1A A;  3QP6 A;  3V7C A;  1ERD A;  3KLO A;  2VE8 A;  4O3M A;  1KQ8 A;  3KEO A;  4XLE A;  5HNF A;  1N75 A;  2DU9 A;  1D0Y A;  1ZKG A;  2M3A A;  4HNU A;  4PFP A;  5BNG A;  5H6R A;  1HCR A;  4GYG A;  1IDY A;  2CS3 A;  4XID A;  4C2U A;  2DBB A;  1V5G A;  1GV5 A;  1G2H A;  2F6C A;  2EH3 A;  2LG4 A;  4F3Q A;  1TBX A;  1S5L C;  4MQ9 F;  2W24 A;  1FIA A;  2WY7 Q;  4Q48 A;  1SD6 A;  1YJN I;  2LKX A;  4V2F A;  2V9K A;  1JKQ C;  4ESF A;  5F0H A;  3H35 A;  1ZAO A;  3LSK A;  1I39 A;  2Q2E A;  2FBH A;  3W3C A;  2LOO A;  1KZH A;  3RJP A;  3S32 A;  3KP2 A;  3JSP A;  2XAJ A;  1TT5 B;  2HVR A;  4U0V A;  4OIP F;  2XHK A;  1FOY A;  2STW A;  2JSC A;  2G7U A;  5M5Y J;  1XD7 A;  4UB6 C;  2BGC A;  2EWN A;  3OL4 A;  5DCF A;  2CJJ A;  2CQ7 A;  3E5U A;  3AL0 B;  2DA6 A;  2D1H A;  4RLQ A;  2R7V A;  3QOP A;  2GZW A;  2A69 F;  4O6J A;  2F4I A;  4ZC3 A;  1FTT A;  2VAS A;  1EKE A;  4E7I A;  4KYW A;  4K2E A;  4KMF A;  1ZRE A;  1DDN A;  4B4C A;  1Z7U A;  2L54 A;  3K7A J;  3H0G J;  3K70 C;  3UR3 C;  5FLX Z;  2NYX A;  2VLA A;  1MDM A;  2IW5 A;  4MIM A;  2MH9 A;  3DPT A;  1YOV B;  1POG A;  3FXJ A;  2P5L C;  1TC3 C;  2GXG A;  3ZQQ A;  2BY0 A;  1ONV A;  4G8X A;  2R5Y A;  2ESH A;  2QF7 A;  1Z9C A;  3OYA A;  1MMD A;  3SXY A;  4IRI A;  4IKF A;  2E1M B;  1WGX A;  4XKW A;  4RAZ A;  2JVH A;  5C3E J;  1F4K A;  2DA3 A;  1S3J A;  1U2W A;  1TQM A;  2K3F A;  5IP7 J;  5E79 C;  3RQ4 A;  2MLK A;  5LHG A;  5F04 A;  3T1B A;  1KQ0 A;  1WJA A;  2EBI A;  3J7Y J;  4ESJ A;  2QVO A;  1PVE A;  2QCO A;  3A0B C;  3V8L A;  3FZV A;  1S6L A;  1U9N A;  3WE3 A;  3SEQ A;  3ZPL A;  2LY9 A;  2DK8 A;  4XRF A;  1A36 A;  9ANT A;  4L9J A;  3BR5 A;  4DBR A;  3MD2 A;  3OS1 A;  2XPW A;  3WTX C;  5IY5 H;  5EJC A;  3ZQH A;  1WPK A;  3TW7 A;  3S2W A;  4BS9 A;  2R0Q C;  3BPV A;  1J9I A;  3O6B B;  2QQA A;  3BG3 A;  3C1D A;  3LST A;  3OYG A;  2Q0O A;  3HEF A;  2CU7 A;  3H92 A;  5J8F A;  3E3V A;  4HLX A;  4C9Y A;  3VYT B;  3CJR B;  3NQO A;  3ERE D;  1GXP A;  3VB2 A;  1ULY A;  2IS6 A;  2EQR A;  4U7D A;  1JE8 A;  2Z99 A;  2E60 A;  2EZK A;  3C2B A;  1GVJ A;  1OPC A;  2MAB A;  2CQK A;  3PO3 J;  1YJW I;  3H3Z A;  2XRN A;  4UV9 A;  1MGT A;  2HGC A;  4XRM A;  5GTH C;  1FP2 A;  3LOC A;  3P5J A;  2KHM A;  5FKK A;  1S29 A;  2BW3 B;  4R8H A;  4HQE A;  4DQ2 A;  1RKW A;  3CJT B;  4RAF A;  1Z21 A;  2NOJ B;  3PFY A;  4FHT A;  3W2W A;  1PYV A;  1SAN A;  2LH9 A;  4KN7 X;  1U78 A;  1LE8 A;  4L0Z B;  4FX4 A;  2PJR B;  1WVR A;  1WWX A;  2X1D A;  2LSO A;  1VZ0 A;  2ZB9 A;  1OYI A;  1TNS A;  4NC8 A;  5KNL A;  3GZ6 A;  5LD2 C;  1W36 C;  4E7L A;  2XAG A;  1SD4 A;  3DKY A;  4ZDL A;  5J47 A;  2CGP A;  2DYR H;  3GUD A;  4ZDO A;  5E1X A;  1LQ1 A;  3JAM Z;  2ZXI A;  5CVI A;  5JVT A;  3CF2 A;  1TW2 A;  2LKP A;  4A3J J;  3RI4 A;  4LJZ F;  1VQ4 I;  3BTL A;  3DLA A;  5AIP A;  2V26 A;  2N8G A;  5KCM A;  4JQF A;  4QTR A;  4Y3O A;  3HKZ N;  4A69 C;  1DPU A;  3R6S A;  4Q5S F;  3CP8 A;  4ENJ A;  3TGN A;  1W7P B;  3C18 A;  4HEA 2;  3HB9 A;  3L09 A;  2F5D A;  5CVJ A;  3BQZ A;  3FM5 A;  5DTD A;  2XC7 A;  4IJA A;  4B09 A;  4L9N A;  2L5Q A;  4OMY A;  2KLO A;  2KP6 A;  5HLT A;  4U7B A;  2BHY A;  1UEL B;  5L3F A;  2VJ4 A;  3IH2 A;  2LF8 A;  4LD5 A;  2XAH A;  3L00 A;  2H1K A;  1ETV A;  1G3Y A;  1FP1 D;  4Y15 A;  3FXM A;  4HNV A;  3BCB A;  2CWE A;  1R71 A;  1JJ8 C;  3R0A A;  1ZG3 A;  3PQK A;  3L2Q A;  2M7B A;  2ZXH A;  2HDD A;  2FF4 A;  2DFI A;  2VKD A;  1SMY F;  3HSR A;  2FUG 2;  2MG4 A;  1XGM A;  1K83 J;  2ISY A;  3MN2 A;  4BQN A;  2DAO A;  4A0Y A;  2F5E A;  1EH7 A;  1Z1D A;  3E6B A;  2OTL I;  4Y17 A;  5E3L A;  5D5V B;  1FMV A;  1BC8 C;  1IF1 A;  1OLT A;  3FK7 A;  1SFK A;  1FNN A;  3J80 K;  1HKT A;  4A0X A;  1YS7 A;  2V7F A;  4UUT A;  4LIV A;  3ZMU A;  2HVS A;  3TOA A;  3NWT A;  4ZTJ A;  1ETQ A;  1GDT A;  3J81 K;  1LDK B;  1BR4 A;  1MBH A;  4II3 A;  4PGH A;  4ANJ A;  3ISP A;  2DOD A;  1X1B A;  2DDA A;  3DTK A;  1JHH A;  2PEX A;  3KFW X;  5IT3 A;  1B4A A;  3ELK A;  4FE7 A;  2KIF A;  2ZME B;  4LIT A;  3SJM A;  2QYO A;  2B9S A;  3LSJ A;  2CFX A;  2OCC H;  4YEL A;  1MJB A;  2FRH A;  4F91 B;  4HW0 A;  1SEU A;  1LUJ B;  3S93 A;  3NWS A;  4Q4Z F;  2Y2Z A;  2VQG A;  5FD6 A;  1ZR4 A;  2D45 A;  1R5H A;  1IRZ A;  1MMG A;  1NHA A;  3BR2 A;  3R0J A;  3JW4 A;  4F93 B;  3CCY A;  1WJC A;  2HXO A;  4UHT A;  3QOE A;  2E1C A;  2WAQ A;  5E3M A;  5ERI A;  2OQG A;  1UB9 A;  2JA5 J;  3VSK A;  4CCN A;  5EEH A;  4BDY A;  1UCR A;  4A3G J;  4RS8 A;  2K40 A;  2LMD A;  2W85 A;  3W2A A;  2L9S A;  4LK0 F;  1FIP A;  1MBJ A;  4Y52 J;  5JHU A;  4FT8 A;  2WA0 A;  3WU0 A;  1T08 B;  5AON A;  2F2E A;  1CGP A;  3BRO A;  3Q9S A;  2M0C A;  1IDZ A;  2ELK A;  4GDF A;  4RGX A;  1G59 A;  4A6E A;  2FOW A;  4N9H A;  1HLV A;  1Y39 A;  3WG7 H;  4U88 A;  2Z16 A;  3GTJ J;  1MND A;  1YLF A;  1JTY A;  3WU1 B;  3K4J A;  3PFI A;  3BR1 A;  3ABM H;  3H9Q A;  4FET A;  3B73 A;  3FXQ A;  1IUF A;  1Z7L A;  2EFW A;  5FGM A;  5E17 F;  1IRG A;  4NQW A;  1QVT A;  2DI3 A;  5GAG J;  3DTI A;  3C7J A;  4B8X A;  2XAU A;  3FKI J;  1QVU A;  5K7Z A;  4HF0 A;  3LQR A;  1VQL I;  2G7H A;  2CH0 A;  4HX4 A;  3K70 D;  1OMI A;  2KPM A;  1F43 A;  3KE2 A;  2PMZ N;  2HTJ A;  3EUH A;  2HOA A;  2EFN A;  1Y1V J;  4RA2 A;  1R36 A;  2L7K A;  2Q1Z B;  5ILS A;  3G4S I;  1DPR A;  1BI3 A;  3QU6 A;  4GGG A;  2LBF A;  2E35 A;  2EV0 A;  4XRS A;  3S3O A;  2CW7 A;  4BDZ A;  4PJJ A;  4Z6Y A;  4BU2 A;  1DGR M;  3DCF A;  1YX5 A;  2WAD A;  1WI9 A;  3CD6 I;  1DU6 A;  3HOS A;  1SMT A;  1Z77 A;  2OU2 A;  2CV1 A;  1USS A;  2Y0S A;  2KJC A;  3DFG A;  3OV8 A;  2XF7 A;  2XB5 A;  1FTZ A;  2A6E F;  4X6A J;  2Y30 A;  2LP0 A;  1T39 A;  3IAS 2;  3F8M A;  2E2I J;  2LFB A;  2JJ7 A;  2XUB A;  3HDD A;  1TTY A;  2NS7 A;  4DOZ A;  2DFE A;  1ON1 A;  4XK4 A;  2OD5 A;  2XF5 A;  1GLN A;  2HNH A;  1ZLJ A;  4BHB A;  2PJP A;  1GXQ A;  3HOW J;  5CQG A;  2X9D A;  4GO1 A;  5E18 F;  3S1M J;  5E3N A;  1XS9 A;  3GTO J;  4PK4 A;  1ETW A;  1B72 A;  1YS6 A;  3E97 A;  3SDB A;  1AWC A;  4A3E J;  3MCZ A;  1MH4 A;  2JTV A;  4E7H A;  1SD7 A;  1XGN A;  1MNM C;  2WWY A;  1W5S A;  1YW9 A;  1NK3 P;  3ECO A;  1Y0N A;  2HXI A;  4AYB N;  3JRE A;  4EM1 A;  1GHC A;  1IN8 A;  3LFU A;  1R7J A;  4JX5 A;  5E8I A;  5GAE J;  4XKC A;  1T6S A;  2DYS H;  4L9V A;  4J01 A;  1YO5 C;  4HLY A;  1KQ9 A;  3OYB A;  3H5R A;  2CUJ A;  4NBQ A;  2HYF A;  2LVS A;  4UVA A;  2A61 A;  2RKH A;  1KON A;  2RNG A;  3MWM A;  1IZ1 A;  2F5C A;  5HLI A;  2ZJP F;  3FIS A;  5C44 J;  3R60 A;  2R5Z B;  1W36 D;  2R7Z J;  3HJE A;  1Z67 A;  3OYC A;  4E6K G;  1STZ A;  2VN2 A;  2DA4 A;  1FJL A;  3ESW B;  1B72 B;  3JRB A;  2X0L A;  2P0W A;  1WFX A;  3K69 A;  5J1U A;  1OFC X;  5IT9 K;  1O57 A;  2BYV E;  5KHD A;  1IN5 A;  4AID A;  1ENH A;  3NEU A;  4LK1 F;  3CO6 C;  1MMS A;  2G9W A;  2CUE A;  4HQM A;  1VQP I;  2IGO A;  3V42 A;  1MJ9 A;  2KIU A;  3ZR8 X;  3H0D A;  3HXL A;  3RYP A;  1JT0 A;  2FU4 A;  3WTZ A;  3OMY A;  2XSD C;  2HPI A;  4LIU A;  2WB1 N;  2VOO A;  1D1C A;  2K9N A;  5LFA A;  3VWB A;  1Y6I A;  2FEZ A;  2VQL A;  4YIF A;  2XVC A;  2ZME C;  3BG9 A;  1J2X A;  1K78 B;  2X6O A;  3CJQ B;  3JR9 A;  4X1E A;  1REP C;  3GZ5 A;  2EFP A;  1W1W E;  4U0W A;  3SFZ A;  4B1R A;  1P4W A;  3GEZ A;  5TRD A;  1MSE C;  1HW5 A;  4IRH A;  2EB7 A;  3L2R A;  2JSP A;  3VOE A;  4UUS A;  3G6E I;  2P8T A;  2JPB A;  3DP7 A;  2XKO A;  3DEW A;  2OV7 A;  1JJ6 C;  2ID3 A;  3HBL A;  3S3N A;  2M2E A;  4B44 A;  2FNA A;  1B59 A;  5H6Q A;  4XBF A;  1F9N A;  4OWR B;  5M5X J;  1ZTR A;  3ML6 A;  1D8J A;  2YS9 A;  2A5W A;  2MH2 A;  1LPQ A;  2MC3 A;  1B8I B;  1XMA A;  4D7M A;  2IP2 A;  2P6T A;  1BIA A;  4F52 A;  2VUM J;  2B63 J;  1IRX A;  4BBR J;  1K6Y A;  4AVZ A;  4ZYE A;  1FOX A;  3RSN A;  3BLY A;  3NAR A;  3DKW A;  4M72 A;  3OIQ A;  5F0C A;  1AKH B;  2WAE A;  1IV6 A;  2J5O A;  1RR8 C;  3FXK A;  4A0Z A;  4C2T A;  5EZH A;  4I09 A;  2FE3 A;  3HM5 A;  4OAZ A;  3M1C A;  3QAH A;  5DDG A;  5M3F J;  3OOP A;  5K1Y A;  4XMY A;  4HX8 A;  3ZRG A;  2HTS A;  1FMW A;  2EA2 A;  3KET A;  1IW7 F;  3LAP A;  4UUS B;  2EZL A;  2DT5 A;  2OQR A;  2KRH A;  4AU7 A;  1Z3X A;  3SQN A;  2X85 A;  3L2W A;  1A6Q A;  3WGI A;  4A12 A;  4TV7 A;  3ABT A;  3GVA A;  4M9S A;  2HI3 A;  2LC2 A;  1F1Z A;  3OYK A;  2R7F A;  3JRI A;  3BTI A;  4MTD A;  5HDN A;  3ULQ B;  3DPL C;  1IXC A;  5B3S H;  5L3B A;  4G12 A;  1DP3 A;  5LRS A;  3S17 J;  2HR3 A;  3K4C A;  4D0P A;  3OYD A;  1HKQ A;  2VE9 A;  2QSG X;  2DA7 A;  2GQQ A;  4C3I J;  4CCJ A;  1XDU A;  2BOL A;  1IAW A;  1WRJ A;  1SFX A;  2X48 A;  3O8G A;  1HST A;  1ON2 A;  1TP4 A;  4CCO A;  3OR1 C;  4LG0 B;  3OYM A;  2VQH A;  1VND A;  5KAF C;  2OBP A;  2RV8 A;  3K0L A;  1NK2 P;  1QHG A;  2XSJ C;  2AQF A;  3E0J B;  2Z2S B;  1T0F C;  3JRA A;  1V3F A;  1A6I A;  4PJL A;  2EA4 A;  5JFR A;  1B6A A;  4ZZL A;  1I5Z A;  3COA C;  2HVQ A;  3ZN0 A;  2F48 A;  2Y9Y A;  3WHB A;  2Y9Z A;  5D4R A;  1QHH D;  3MZ8 A;  3EUA A;  5LRR A;  2LF7 A;  2X6X A;  1Z6R A;  4V2G A;  3F23 A;  2RAE A;  2GXB A;  4LLN A;  4XLC A;  2LYC A;  3CC2 I;  1X58 A;  3CC4 I;  2VB6 A;  4OU0 A;  3ASO H;  3U9G A;  2DMU A;  5TGT A;  4EJW A;  1JKR C;  4ESB A;  5EGO B;  2YR2 A;  2R7T A;  3IWF A;  4KIB A;  3OIP A;  3HOX J;  1APL C;  3CQZ J;  4HV6 A;  3QP5 A;  4L18 B;  3HKZ A;  3HOT A;  2DQR A;  4UVC A;  5CPR B;  1EJ9 A;  6PAX A;  3ZGK A;  2Z5U A;  3CCU I;  5DYM A;  3ABL H;  1I6H J;  3HL2 A;  2EZH A;  3GLL A;  2K9S A;  5FFX A;  3F6O A;  2W48 A;  2LNB A;  3DLL F;  4AC0 A;  4ABZ A;  4RGR A;  5EZG A;  3L2C A;  1JUP A;  2FSW A;  4N0B A;  4HZF A;  1J5Y A;  3DF8 A;  1X4P A;  2VBX A;  4MNU A;  4CDG A;  1MMA A;  3GF2 A;  1ZGW A;  3JTG A;  2COM A;  1UG2 A;  1RUO A;  3BZK A;  1EA3 A;  2EZI A;  4KNY A;  1A35 A;  4PJM A;  5DCM B;  1OCZ H;  3GW2 A;  4L5I A;  2H8R A;  1L0O C;  1G3S A;  1HC8 A;  1XCV A;  2V6C A;  3GTQ J;  2IXS A;  3SZG A;  5LGU A;  1FBS A;  2DA5 A;  1AHD P;  4DZJ A;  2VOP A;  2EIJ H;  2HZT A;  5JR3 A;  4I02 A;  1V5E A;  4B47 A;  3Q0W A;  4D1Q A;  1XGS A;  4MLO A;  5E20 A;  2NVT J;  3SEZ A;  2R7S A;  5GAD J;  2QLZ A;  3VPR A;  4PFO A;  4IOC F;  1R22 A;  4RBO A;  4DYR A;  4PUS A;  2R93 J;  2VI6 A;  1TW3 A;  3TO7 A;  3MKW B;  2JT1 A;  3JRG A;  1W7P D;  2VIX A;  2B0L A;  2I5U A;  4P5O A;  3M07 A;  3C2H A;  1F5T A;  1VQN I;  3CES A;  1YRN B;  1FYM A;  2CUF A;  3C2G A;  5ILU A;  2OZ6 A;  2VJJ A;  1PUF B;  2IEK A;  3N4M A;  3D1N I;  4IQJ A;  2OZU A;  3K4L A;  1G3T A;  1R1V A;  5LBQ A;  4YII A;  4RB1 A;  4IHW A;  4M9X A;  4M6X A;  1T8I A;  2HQA A;  2M8G X;  2LRE A;  3AG1 H;  5FB2 A;  4A3L J;  3I58 A;  1YFH A;  3BCA A;  1QO0 D;  1Q1H A;  1JHF A;  2P5V A;  3K4M A;  1K7A A;  1ZR2 A;  4RB0 A;  5CVV A;  4A5N A;  5HVQ C;  4UUV A;  1X1P A;  2HYJ A;  3QOD A;  2UXX A;  4XIC A;  3S1Q J;  1P2F A;  2E1O A;  2R7W A;  2PLY A;  4NC7 A;  2XAS A;  2WV1 A;  1H9G A;  1P4A A;  2VC0 A;  2XPV A;  3HGY A;  2BVM A;  3JAM K;  2WC2 A;  3KPH A;  5J4Y A;  3HOU J;  1MBG A;  2EJR A;  2K3P A;  1Y1W J;  2E2J J;  2JZY A;  1U6G A;  2F4M B;  1EH6 A;  3TDZ C;  2DFF A;  2BW3 A;  2ME6 A;  4BAC A;  3HHH A;  3ZN1 A;  2ID6 A;  3IHU A;  4C3H J;  4BKX A;  1W0T A;  2CYY A;  3CMA I;  1R4N B;  1BI1 A;  5F27 A;  1LB2 A;  4KIF A;  1WJE A;  2M8E A;  4RLF A;  2PJR A;  4YG2 F;  3DU5 A;  4MEY F;  2DMP A;  4ZZD A;  2XDV A;  3S8P A;  1SFU A;  3OYH A;  1YIO A;  2LY2 A;  4KUM A;  1I27 A;  5J1Y A;  3BR0 A;  3FBI B;  1SVM A;  2YPR A;  3CCL I;  4UVB A;  2VPL A;  5HS9 A;  2JQ7 A;  1R5I D;  1A5J A;  2X1C A;  4UNO A;  3OR2 C;  2IS2 A;  2PMZ A;  4FCY A;  5EG0 A;  2CO5 A;  2KT0 A;  1QGP A;  2H6C A;  2M9H A;  3I9V 2;  4M3D A;  5A2Q K;  1RRJ A;  1HDD C;  2V1D A;  5ICF A;  5JHF A;  3FMR A;  1ZAR A;  3GBG A;  2NXN B;  1W7P A;  3MAJ A;  5BS6 A;  4D7N A;  4XLF A;  2COB A;  1YG2 A;  2KZV A;  1OCT C;  3HPG A;  2BV6 A;  1RC9 A;  2IVM A;  2ECB A;  1IXR C;  3QYE A;  4ENN A;  3BG5 A;  3V4G A;  4WF2 A;  2OUM A;  2XGC A;  1WKM A;  2M34 A;  4IEJ A;  3OS0 A;  1LJ9 A;  2QA4 I;  3KP4 A;  2PN6 A;  5CKT A;  2E5N A;  1JXS A;  4ZYD A;  3RIR A;  4BJ5 C;  3ZQG A;  3LSM A;  4LOC A;  4XOR A;  4LG3 A;  1PUE E;  3CUO A;  4D5F A;  5IP6 A;  4DJA A;  2C6Y A;  1Y56 A;  3RKY A;  2NVX J;  5FO5 A;  2IS4 A;  3I59 B;  1R49 A;  2IGM A;  3GZN B;  1TLH B;  2VKH A;  2R92 J;  4LLG F;  4IHT A;  5GPA A;  2DT6 A;  5EG0 B;  5L3E A;  5ICE A;  3OYI A;  4XON A;  4UB8 C;  1FWZ A;  4BY7 J;  2R7U A;  3LSI A;  3F9K A;  4J00 A;  3G71 I;  1MJA A;  1U5T C;  5IYD J;  5LHH A;  1R6R A;  3KLN A;  3BJA A;  4EM2 A;  4CZC A;  3LA2 A;  3FF5 A;  4YIR X;  4B3A A;  2H09 A;  3GCM A;  3TO6 A;  4C3J J;  4D9J A;  4XN3 A;  2JUG A;  2V9V A;  2M1B A;  5GAH J;  4FTH A;  1G8X A;  2HU9 A;  3QPS A;  2ZFU A;  2O9L A;  2PI0 A;  2ZME A;  2PBI A;  5B66 C;  4DGW B;  1I1S A;  4HAM A;  2ELJ A;  3CCV I;  3FDY A;  3FIW A;  3FWE A;  4XSZ F;  1W0U A;  4KJZ A;  5DUI A;  3F8B A;  3K2A A;  3VSL A;  1K4T A;  1QPM A;  1SFO J;  1IXS B;  2EV6 A;  5A2Q Z;  2FJ1 A;  2K9Q A;  5DV5 A;  3WGG A;  2EIL H;  3BG6 A;  3BC8 A;  3U21 A;  2QEX I;  1N77 A;  2MA3 A;  1EF4 A;  1SAX A;  1Y8Q B;  3H3V K;  1TNT A;  3JRH A;  4KA4 A;  3HPH A;  3H9J A;  4ITV A;  3L2U A;  4E7Z A;  3N97 A;  3F3X A; 
#chains in the Genus database with same CATH homology
 1MH4 A;  2DMT A;  1MNM C;  2TRT A;  2GBY A;  2XGE A;  4JYK A;  2E19 A;  5IP9 J;  5E3O A;  1LFU P;  3GTM J;  1JUM A;  4J19 A;  1NK3 P;  3UKG A;  2ME0 A;  2HXI A;  4AYB N;  3JRE A;  2XPU A;  2O7O A;  1GV2 A;  4JX5 A;  1D5Y A;  2MW8 A;  1LFB A;  1MBF A;  2VPR A;  2HOT A;  4M3F A;  5DS9 A;  4RDU A;  1RET A;  2HQ5 A;  3WHC A;  1Z0X A;  3S15 J;  4A3C J;  1RES A;  2LVS A;  2Y0S N;  5FJ8 J;  4BXX J;  1WH5 A;  3S1R J;  5EDN A;  4A93 J;  3FIS A;  5F08 A;  5M5W J;  5C44 J;  2R5Z B;  2R7Z J;  1VFC A;  2DA1 A;  2GM4 A;  5IOZ A;  1IG7 A;  1BW5 A;  2DA4 A;  2CQQ A;  1FJL A;  5JLX A;  1B72 B;  3JRB A;  3W6V A;  3LSG A;  5J1U A;  2FQ4 A;  1OFC X;  1WI3 A;  4DW6 A;  1ENH A;  1UMQ A;  2R5Y B;  5F1J A;  4A3B J;  3NAU A;  1HOM A;  3ZQI A;  1XC5 A;  2CUE A;  2JK3 A;  2GLO A;  4A3I J;  3I4M J;  1TWF J;  2LR8 A;  1JT0 A;  4DZP A;  2OF7 A;  3PO2 J;  2JA8 J;  2XSD C;  3BTJ A;  3LSP A;  1TWC J;  3GTL J;  1RR7 A;  1BL0 A;  3LNQ A;  2WB1 N;  4L5E A;  2G0E A;  4AUX A;  2K9N A;  1JGG A;  3Q3S A;  1BA5 A;  3BG9 A;  2X6O A;  1OJL A;  3JR9 A;  3ZQL A;  4X1E A;  2XGD A;  3ZOB A;  4B1R A;  1MSE C;  1ZKG A;  1HCR A;  5BNG A;  3BR3 A;  5IOY A;  4UUS A;  1IDY A;  3GTK J;  4XID A;  1P7J A;  3DEW A;  2DTZ A;  1GV5 A;  1G2H A;  1JJ6 C;  2ID3 A;  2EH3 A;  3HBL A;  2MGQ A;  2M2E A;  2D5V A;  1R9T J;  1FIA A;  2XRL A;  1WH7 A;  2LKX A;  4V2F A;  1JKQ C;  5M5X J;  1I3Q J;  1MBK A;  1ZTR A;  5F0H A;  2DMN A;  1IC8 A;  2YS9 A;  3S16 J;  3GTG J;  1JTX A;  2L7M P;  4M3B A;  3BTC A;  1B8I B;  2NOG A;  4D7M A;  2VUM J;  1JKO C;  2B63 J;  4BBR J;  5M5Y J;  2LLK A;  3NAR A;  2CJJ A;  1Q1V A;  1AKH B;  5F0C A;  1T33 A;  1IV6 A;  2DA6 A;  4S0H B;  5EZH A;  3HM5 A;  1T56 A;  5C4J J;  5M3F J;  2R5Z A;  1FTT A;  2L7F P;  3JRF A;  1LE8 B;  3F0C A;  4B4C A;  4UUS B;  5IYB J;  3K7A J;  3H0G J;  2EZL A;  2L7Z A;  4MIM A;  3JRI A;  2HI3 A;  1POG A;  3BTI A;  1TC3 C;  3RQI A;  2LD5 A;  5GP9 A;  2R5Y A;  4G12 A;  2QF7 A;  3BT9 A;  5FKM A;  3S17 J;  4IHY A;  2DA7 A;  2E2H J;  4C3I J;  1WGX A;  4I76 A;  3O8G A;  2X48 A;  3HOV J;  3IH4 A;  1TWH J;  5C3E J;  1VND A;  5HOD A;  2DA3 A;  2KDZ A;  1NK2 P;  3G1O A;  3JRA A;  1A6I A;  1ETK A;  3Q0U A;  3G1M A;  1GT0 C;  1X2M A;  5IP7 J;  1F36 A;  5F04 A;  2EBI A;  2QCO A;  3OOU A;  3OIO A;  2Y9Y A;  3WHB A;  2Y9Z A;  1MSF C;  1U9N A;  2LY9 A;  2AHQ A;  9ANT A;  3BR5 A;  4V2G A;  1AU7 A;  3A03 A;  2RAE A;  2XPW A;  1X58 A;  1ZK8 A;  2DMU A;  3ZQH A;  4FE4 A;  1WPK A;  3TW7 A;  2R0Q C;  1JKR C;  1GVD A;  2Y31 A;  4MFD A;  5EGO B;  3BG3 A;  3O8H A;  4DYC A;  1IJW C;  3HEF A;  2CU7 A;  1ETX A;  3HOX J;  2VKV A;  1APL C;  3CQZ J;  1S7E A;  1RPW A;  1OCP A;  2EQR A;  5F0F A;  4JX4 A;  2EZK A;  3C2B A;  1I6H J;  2DA2 A;  1B8I A;  3PO3 J;  2EZH A;  2K9S A;  1QRY A;  4XRM A;  3M3Y J;  3A02 A;  3LOC A;  2I10 A;  2W48 A;  1ETO A;  3HGG A;  4AC0 A;  4ABZ A;  5FKK A;  1AKH A;  5EZG A;  1JUP A;  2L9R A;  1RKW A;  1SAN A;  1U78 A;  1LE8 A;  1JKP C;  4A3F J;  1ZGW A;  1UG2 A;  3HOY J;  2ZB9 A;  4MFE A;  3ZQC A;  2EZI A;  3M4O J;  3RZD J;  4NDL A;  5K7H A;  2H8R A;  1H88 C;  3S2H J;  3GTQ J;  3IH3 A;  5EEA A;  5JLW A;  2DA5 A;  1AHD P;  4DZJ A;  4A3J J;  4FIS A;  3BTL A;  1GUU A;  3Q0W A;  2N8G A;  4MLO A;  2NVT J;  4QTR A;  4A69 C;  3HKZ N;  3VPR A;  4M6V A;  3PM1 A;  2YUS A;  4DYR A;  4RBO A;  2R93 J;  3HB9 A;  2VI6 A;  2JMW A;  3BQZ A;  5DTD A;  2DN0 A;  3JRG A;  1I50 J;  2FD5 A;  4M3E A;  5GPC A;  1YRN B;  2CUF A;  3TW6 A;  2OPT A;  4GFB A;  3IH2 A;  3TED A;  4BBS J;  1PUF B;  2IEK A;  2H1K A;  1ETV A;  3D1N I;  4HNV A;  5FKL A;  3MKL A;  3BR6 A;  4IHW A;  1JJ8 C;  3TP0 A;  2M8G X;  3JRC A;  3Q0V A;  4A3L J;  2HDD A;  5EGO A;  3FK6 A;  4XRS G;  2MG4 A;  1K83 J;  1ZR2 A;  4Y7N J;  3MN2 A;  1BW6 A;  1P7I A;  2HYJ A;  4XIC A;  3S1Q J;  1BJZ A;  2E1O A;  2JA6 J;  4QIW N;  2WV1 A;  5M3M J;  2XPV A;  3HGY A;  3HOU J;  2LK2 A;  2JA7 J;  1MBG A;  1Y1W J;  4A3D J;  2JN6 A;  5E3L A;  2E2J J;  3A01 B;  3FK7 A;  5FKO A;  3S14 J;  4UUT A;  2ME6 A;  3RZO J;  2JWT A;  2ID6 A;  5EF6 A;  4C3H J;  1ETQ A;  1GDT A;  4BKX A;  1W0T A;  1FEX A;  5J1R A;  3QQA A;  5F27 A;  1MBH A;  4DYQ A;  4D5C A;  3ZQF A;  1ZQ3 P;  4M3G A;  4FE7 A;  2DMP A;  3SJM A;  4BY1 J;  1IGN A;  3LSJ A;  5J1Y A;  1RKT A;  3BR0 A;  4C2M J;  4MO7 A;  2Y2Z A;  1ZR4 A;  3S1N J;  1VI0 A;  3IV5 A;  1A5J A;  4W1U A;  1IRZ A;  3BR2 A;  1NTC A;  4FCY A;  5EG0 A;  2KT0 A;  2M9H A;  3CCY A;  5FLV A;  2HXO A;  4M3D A;  1HDD C;  1MBE A;  5E3M A;  5IYC J;  2JA5 J;  3LSR A;  3GBG A;  1XG1 A;  4D7N A;  1E3O C;  2COB A;  5FLM J;  4A3G J;  5EYR A;  3OSG A;  1OCT C;  2K40 A;  1JT6 A;  1FIP A;  1MBJ A;  2ECB A;  1DU0 A;  4Y52 J;  1O4X A;  3BG5 A;  3S2D J;  1X2N A;  1YRN A;  2XGC A;  2M34 A;  1PUF A;  4IEJ A;  2M0C A;  1IDZ A;  3RKQ A;  2ELK A;  2DJN A;  4JP0 A;  1VF9 A;  4IHV A;  1HLV A;  1QPI A;  2IAI A;  5J3L A;  3GTJ J;  4JX6 A;  2L0K A;  1TWG J;  3ZQG A;  1HF0 A;  1JTY A;  4LOC A;  3BR1 A;  2VKE A;  3G1L A;  4D5F A;  5IP6 A;  2LTP A;  1IUF A;  1ITY A;  5IPA A;  1UHS A;  2XB0 X;  1QVT A;  2NVX J;  1ORK A;  3FKI J;  1QVU A;  2FX0 A;  1ETY A;  5K7Z A;  1TWA J;  4I6Z A;  1U9O A;  2DMQ A;  2O8K A;  2TCT A;  2R92 J;  2P81 A;  2IBD A;  5GPA A;  5EG0 B;  1F43 A;  3A01 A;  4W97 A;  2PMZ N;  2HOA A;  4BY7 J;  1Y1V J;  3CMY A;  1U8B A;  4CYC A;  2WAQ N;  4EEF G;  5IYD J;  5K7F A;  3OSF A;  3E7L A;  3CDL A;  4B3A A;  5C4X J;  3JRD A;  1WCM J;  4XRS A;  2YU9 J;  4C3J J;  2MSY A;  3HOZ J;  4QSH A;  1MH3 A;  3DCF A;  4FTH A;  2NVY J;  2CQX A;  3QPS A;  1DU6 A;  2O9L A;  1Z77 A;  1HDP A;  3I4N J;  1K61 A;  3FIW A;  2NS8 A;  1W0U A;  2XB5 A;  1FTZ A;  3B6A A;  2Y30 A;  2LP0 A;  3GTP J;  3K2A A;  1H89 C;  4X6A J;  3MVP A;  1SFO J;  2E2I J;  3SDG A;  2LFB A;  2JJ7 A;  4A3K J;  3HDD A;  4IHX A;  2NS7 A;  5FKN A;  4A3M J;  2FJ1 A;  2K9Q A;  3QPL A;  1CQT A;  3TP3 A;  3SFI A;  4XK4 A;  3BQY A;  1H8A C;  1JUS A;  3B6C A;  3HOW J;  3S1M J;  2X9D A;  1EF4 A;  3H3V K;  2AO9 A;  2CRG A;  5E3N A;  3L1P A;  3JRH A;  1XS9 A;  3GTO J;  2ECC A;  1ETW A;  1B72 A;  2HOS A;  2NVQ J;  4A3E J;  4CYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...