1TWGJ

Rna polymerase ii complexed with ctp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 18
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twgJ00
3S2DJ 1ZK8A 2DA7A 1X2MA 3TP3A 1A5JA 1JT6A 2CRGA 5IYCJ 3JRAA 1RPWA 5M3MJ 5FKOA 5C44J 2CUFA 3VPRA 3BG3A 1MSFC 2G0EA 1DU0A 2XGEA 3M3YJ 3Q0WA 1P7IA 3PM1A 1VF9A 3JRHA 2DMTA 5IP9J 4FCYA 4ABZA 4DYRA 3JRBA 1FTTA 2VPRA 3HOXJ 2L7MP 2ID3A 2LFBA 3ZQGA 1IJWC 3S1MJ 4FISA 1ETKA 2LVSA 5K7ZA 5E3NA 3IV5A 2P81A 1AKHA 4DZPA 3IH4A 3HOYJ 3BG9A 4A93J 4G12A 1DU6A 5J1RA 2ECCA 5FLMJ 2JA8J 9ANTA 1UG2A 1F43A 1RKWA 4BBRJ 2LR8A 3DCFA 4Y52J 2E19A 3BQYA 2XB0X 1AU7A 4AC0A 1G2HA 2NVXJ 4M3EA 1IDYA 1TWAJ 1ZKGA 3JR9A 2X48A 3RZOJ 4A3CJ 2Y0SN 1IV6A 5E3MA 4JX4A 2LKXA 3S1NJ 2CQXA 1ZR2A 1GVDA 3G1MA 4W1UA 4B1RA 5EZGA 2QCOA 1ETXA 1U9OA 1ZQ3P 3HB9A 3B6AA 5J1YA 1RESA 4XIDA 4A3LJ 1K61A 5FKNA 4JP0A 3SDGA 2DMPA 5GP9A 3GTJJ 4UUSA 2DA3A 2H8RA 5F0CA 1ENHA 1VNDA 4XICA 3HOVJ 2COBA 2DA5A 1NK3P 4X1EA 3TP0A 3GTMJ 2E2HJ 1I6HJ 2FD5A 1BW6A 3ZQIA 2IBDA 2GBYA 2ME6A 3LOCA 1JJ6C 1JUPA 4I76A 1WH5A 4QIWN 3JRCA 2OPTA 1BW5A 2M0CA 2ELKA 1XS9A 3WHBA 4A3BJ 3HBLA 1U8BA 3MVPA 1IC8A 2L7ZA 4B3AA 4A3EJ 2HXIA 3FK7A 3A01A 2VUMJ 4EEFG 2VI6A 4FTHA 1JGGA 5M5XJ 5JLXA 4XRSA 2E1OA 3JRGA 1IDZA 4UUTA 3B6CA 2L7FP 4M3FA 3G1LA 3GTLJ 1MBGA 2GLOA 2NS7A 2DA1A 1JUMA 2MW8A 4XK4A 3S1RJ 4M6VA 4X6AJ 3HEFA 2H1KA 2M9HA 2DTZA 2HOSA 3JRIA 3FK6A 4DZJA 4FE7A 1JTXA 1T56A 5M5YJ 1RETA 1UHSA 2WAQN 1YRNB 4IHXA 4M3BA 3Q0UA 2LTPA 1TWCJ 2XGDA 3GTQJ 2MGQA 2N8GA 1UMQA 3A03A 3WHCA 1ZGWA 4FE4A 1Z77A 1I50J 3HOZJ 2E2JJ 1HDPA 1NK2P 1MBKA 3OOUA 3FIWA 2L0KA 3QQAA 4HNVA 2O7OA 3M4OJ 2Y30A 2Y2ZA 5EEAA 3JREA 5E3LA 4IHVA 1VFCA 4JX5A 2HXOA 2YU9J 3W6VA 3O8GA 5IP7J 1B8IB 3BR1A 4GFBA 4J19A 1X2NA 3RZDJ 1IG7A 2JA6J 2OF7A 1VI0A 2K9NA 1B72B 2AHQA 1O4XA 3HDDA 2FX0A 5F0HA 1JTYA 4D7MA 4A69C 2LY9A 2HYJA 3HKZN 1HDDC 1ETVA 5J1UA 3BR5A 1D5YA 4S0HB 5IOYA 3TW7A 3ZOBA 4BKXA 4MIMA 5EYRA 2RAEA 4AUXA 2KDZA 4MLOA 2Y9ZA 1PUFB 3LSJA 3S2HJ 1AHDP 2MSYA 1MSEC 4CYCB 4BY7J 1P7JA 5F04A 2JMWA 1B8IA 1GUUA 2M8GX 3I4MJ 3JRDA 4C3HJ 1XG1A 1JT0A 1MBHA 3O8HA 2TCTA 3H3VK 1TWHJ 2R0QC 3S1QJ 1RKTA 3BG5A 2B63J 3OSFA 1MH4A 3BT9A 4AYBN 3S17J 1HOMA 2IAIA 2NOGA 5M3FJ 1ORKA 4A3GJ 3QPLA 3BR6A 4RDUA 2JK3A 4LOCA 1E3OC 2HOAA 4RBOA 1BJZA 1Q1VA 2DA6A 1ETOA 2VKVA 3C2BA 4XRSG 4V2GA 4C3JJ 2R93J 2EZHA 3F0CA 5C3EJ 4QTRA 2DN0A 1PUFA 1HF0A 4Y7NJ 3ZQFA 5E3OA 1H89C 1FTZA 3NARA 4CYCA 1JKPC 4BBSJ 3IH2A 1Y1WJ 5BNGA 2XPWA 2GM4A 3RQIA 2DMQA 2X9DA 1JKQC 5EG0B 2R5YB 1W0UA 4C3IJ 1T33A 3A02A 1SFOJ 1OCTC 1XC5A 2M34A 2CQQA 5FJ8J 3BTIA 3CCYA 5C4JJ 3MN2A 2I10A 3ZQCA 2NVYJ 2JJ7A 5FKKA 2VKEA 3ZQHA 4B4CA 1W0TA 3E7LA 2NS8A 3BTLA 1OCPA 5EZHA 4NDLA 2D5VA 1QRYA 2FQ4A 3ZQLA 2KT0A 2E2IJ 2JN6A 1WCMJ 5FLVA 5JLWA 1ETQA 1H88C 1GV2A 3GBGA 2L9RA 5J3LA 2WB1N 1GDTA 3BTJA 1TC3C 1MH3A 2LP0A 1GV5A 2CU7A 2DA2A 2EBIA 3S14J 2ID6A 2ZB9A 1R9TJ 3TEDA 3OSGA 1AKHB 2EH3A 2K40A 4A3MJ 4IEJA 5EG0A 2K9SA 5FKMA 1WGXA 2DA4A 3DEWA 1HLVA 4V2FA 3S15J 3I4NJ 2DMNA 2XSDC 1NTCA 5IP6A 2FJ1A 3K7AJ 4A3KJ 3PO3J 1OJLA 4JX6A 5M5WJ 1F36A 2TRTA 1JUSA 2Y31A 2K9QA 1S7EA 4C2MJ 5F27A 1MBFA 3CMYA 1LE8B 3S16J 1FEXA 2PMZN 5FKLA 1ITYA 4W97A 1FIAA 1YRNA 2JA5J 3LSGA 2NVQJ 1JKRC 2MG4A 3GTPJ 2O9LA 2LK2A 1JKOC 3Q0VA 1FIPA 4UUSB 5F1JA 1A6IA 3GTKJ 4D5FA 1U78A 1MBJA 1WH7A 2R7ZJ 2Y9YA 1MBEA 3HOUJ 4BXXJ 5K7HA 4JYKA 3LSRA 4D7NA 2X6OA 3D1NI 1B72A 1H8AC 3NAUA 1POGA 2EZKA 1HCRA 1LFUP 2QF7A 2JA7J 3LNQA 3GTGJ 1ZTRA 2WV1A 3CDLA 2AO9A 1LE8A 5EGOB 3Q3SA 1Z0XA 4MFDA 3LSPA 2R5ZB 1MNMC 1U9NA 2XB5A 1BA5A 5IPAA 5F08A 3A01B 3UKGA 1QPIA 4A3DJ 1LFBA 4M3DA 3H0GJ 3L1PA 1JJ8C 2XGCA 2ECBA 2HOTA 2CUEA 4IHYA 3MKLA 1ETYA 1APLC 1IUFA 2XPVA 4MFEA 5DS9A 1WI3A 5IYBJ 2NVTJ 3BR2A 3JRFA 1IGNA 2W48A 1FJLA 4MO7A 5IOZA 1TWFJ 2CJJA 1OFCX 5C4XJ 3BR0A 2DJNA 1K83J 4BY1J 1IRZA 4L5EA 2XPUA 3CQZJ 3PO2J 2DMUA 3OIOA 4DYCA 2XRLA 2HQ5A 3BR3A 5F0FA 5IYDJ 1WPKA 3SJMA 2EQRA 4A3IJ 3SFIA 1GT0C 4A3FJ 1RR7A 5DTDA 5EGOA 2R5ZA 3FKIJ 4DYQA 2HDDA 2HI3A 1QVTA 2YUSA 3QPSA 2LLKA 1X58A 3HGYA 3HOWJ 4D5CA 2LD5A 3RKQA 5GPCA 5EDNA 2ME0A 2YS9A 1TWGJ 1SANA 5HODA 3HGGA 3G1OA 1Y1VJ 2EZIA 2M2EA 1ETWA 3FISA 4M3GA 5EF6A 2R92J 1ZR4A 1EF4A 5GPAA 3IH3A 4A3JJ 4QSHA 3GTOJ 4IHWA 2JWTA 1QVUA 4DW6A 4XRMA 4I6ZA 2R5YA 5K7FA 3BTCA 3K2AA 2EZLA 3TW6A 2IEKA 1BL0A 1CQTA 1I3QJ 3BQZA 3HM5A 2O8KA
chains in the Genus database with same CATH superfamily
2ZJQF 5J40A 3S2DJ 1ZK8A 2DQRA 3DTKA 4F92B 2CRGA 4ZTFA 2CUFA 4L5IA 3WGGA 1REPC 4LD5A 4BJ5C 1MZBA 2GXGA 1TQIA 1MMGA 5D6FA 1DU0A 3MCZA 2DT7B 2XGEA 5TJJA 5L3EA 2HEOA 5DCMA 1P7IA 3PM1A 4LG0B 2M7BA 2DMTA 3F8FA 4I99C 2E5ZA 2ISYA 3FM5A 4LFUA 3JRBA 2E7WA 3BC8A 2VPRA 2BW3B 3QPHA 3FXLA 3ZQGA 1K7AA 3S1MJ 5B66C 1ETKA 5K7ZA 5JVGF 2IA0A 3ISPA 3N97A 1HKQA 3HPGA 1X4OA 1DU6A 5CQEA 1MJAA 2OAZA 2PJRB 4XOTA 1TLHB 1UG2A 4RS8A 4QPOA 1SFKA 1LFPA 3TOBA 5EEHA 1RKWA 4BBRJ 1L3LA 2KDOA 2Y75A 2LR8A 4Y52J 3TBIA 1SD4A 3K4NA 3D5LA 1OLTA 1AU7A 2HS5A 2DFEA 2NVXJ 4PJJA 4M3EA 2V26A 1PUEE 1ZKGA 3RZOJ 2HOEA 3H1CA 2Y0SN 1IV6A 2F4OB 2RVCA 1GVJA 2ZCWA 2VLAA 1ZR2A 4W1UA 5EZGA 1RRJA 1T08B 1UHMA 2QQ8A 3HB9A 2JVGA 5FKNA 4JP0A 4L5JA 1UJ8A 2WTEA 4UUSA 4B09A 5F0CA 2CYYA 4XICA 5EEGA 2VQGA 3WGHA 2E2HJ 2QM3A 2W85A 3TMOA 1P9QC 2LSOA 2DJIA 4YFXF 2ADUA 2CO5A 3F8BA 2L9VA 2M45A 1JUPA 5JHUA 1ZLKA 1Z67A 3JRCA 1P92A 3E5UA 5HLTA 4RB0A 5H2FC 3OYKA 4YG2F 3KIOA 1Z3XA 1MNDA 3KYCB 2K02A 1YJWI 3M8EA 4A3EJ 1IW7F 4LITA 3A01A 4I7HA 2P8TA 2VE9A 1OR7A 3OR1C 5ICGA 4RAGA 1ZYRF 1XMXA 1CF7A 2DQLA 4F3QA 3JRGA 1IDZA 3DWLE 2IVMA 4XKWA 3GTLJ 1MBGA 2GLOA 2BVLA 2QWWA 2ELJA 1ZGJA 2MW8A 3U2RA 5HDKA 4AM3A 1VQ9I 3DBRB 5GAEJ 1VQ7I 2A5YB 4PK4A 3VSKA 2K9LA 4OOIA 2UXNA 4IVNA 3C18A 2HU9A 5E18F 1EH6A 2X4HA 1AA7A 3DEEA 3MFKA 1T56A 2XAUA 2A05A 4U88A 5HDGA 4CCOA 4IHXA 2LTPA 2XGDA 5FO5A 2MGQA 2N8GA 6PAXA 5K5QA 4FE4A 3OWTA 4ESJA 1MBKA 3N4MA 4ZDLA 3GX4X 3QQAA 1T8IA 2Y30A 3WTXC 3F6OA 2B0LA 2F5CA 3JREA 5HS8A 4JX5A 4IOAF 2XUBA 5FLXZ 1O7LA 3O8GA 4B43A 1Z05A 2P6TA 1S7OA 3DFGA 5EJCA 5IP7J 3IKTA 2VT2A 1B8IB 3ZRGA 1L0OC 4Z6YA 3FKJA 1A36A 1X2NA 3ZCOA 1VI0A 2Y0MA 1TNTA 2K9NA 3OL4A 1Z9CA 3HDDA 2VN2A 4BH9A 2VC1A 3TO9A 2OA4A 1FYMA 1SMYF 1ON1A 4F93B 2M0MA 3MZYA 3V8KA 5A2QK 2LY9A 3HKZN 2A6EF 4N4NB 3CCEI 1OCCH 2UUZA 3H9QA 5LRRA 3U1DA 4NHJA 4HA8A 2X0LA 2KJBA 3L00A 4J00A 1D5YA 3H5RA 4S0HB 5IOYA 3EETA 2DOEA 2LY2A 3AG3H 3GLXA 1W5SA 4MIMA 3PSFA 4BKXA 2R7UA 2R7TA 2RAEA 5LEJA 3EUAA 2A3SA 4KUMA 1X3UA 3WG9A 3S2HJ 4A5MA 1X19A 5KK1A 3I5UA 3SZTA 3CC7I 5HS7A 4BY7J 2CS3A 1P7JA 2KP6A 3KP4A 3QOEA 4BXUA 1FX7A 4RLQA 4A6EA 3LQQA 3ROUA 4WCGA 1RUOA 2KZGA 2VQLA 3E6BA 1S9HA 1TL8A 2VBXA 1DQUA 1W7PB 1HA8A 4CO8A 3B02A 2ESNA 1QQIA 1VQNI 1MBHA 1PVEA 3BOQA 4UB8C 2JA2A 3SZGA 3H3VK 1TNSA 2WB1A 1R5GA 4EJTA 2B63J 3OSFA 3ZGKA 1W4MA 3S17J 2NOGA 4YIRX 3CCRI 5M3FJ 4DQ2A 3QPLA 3DU5A 1HBXG 3J81Z 5GADJ 3FHZA 3H3ZA 4CHUA 4Q4ZF 4KN7X 1WI9A 2ZJ2A 4HRIA 3C2BA 4XRSG 1IRXA 4V2GA 4C3JJ 2R93J 3AL0C 1K6YA 2F4MB 2HYGD 3ZMSA 3T8TA 5C3EJ 2V1XA 1LEAA 3E3VA 3T0YA 1ACIA 2QBYA 4ENNA 4FX0A 1ZREA 3ZQFA 1I6XA 4CYCA 2FEZA 5KVRA 4PSWA 3OYBA 2OTLI 3IKVA 3HXLA 4RAYA 1Y1WJ 4KIFA 2XPWA 3RQIA 3SEQA 2D1HA 2PMZA 3FXMA 1JKQC 1J0RA 2K85A 3GFIA 1IXCA 4C3IJ 3EUKL 1J75A 1SFEA 2FQ3A 2NAZA 1OCTC 2A61A 3WE2A 3G71I 1ZG3A 3L2QA 5JVTA 5FJ8J 2DYRH 2CQQA 5K5RA 3BTIA 1IN5A 2HR3A 3MN2A 5C4JJ 1USSA 3ZQCA 1SAXA 2VKHA 2O6GE 4AIDA 4KFCA 2NVYJ 1KU9A 2JJ7A 3H9GA 1W0TA 1K6OA 1B6AA 3K6GA 4KA4A 2R7RA 1XGOA 2FQ4A 4B48A 2YR2A 3ZQLA 2W82A 2FF4A 2ESHA 5ILUA 1VQ6I 2G9WA 2EK5A 5BMZA 4UUVA 4L0YB 3HUGA 1ETQA 2RNGA 5DCMB 2EFPA 4D0PA 1GV2A 2STWA 4L9JA 4ZTJA 3F22A 3C2HA 1ZELA 3BZKA 3PIPF 4YELA 1GV5A 5KCMA 3DTEA 3RPQA 3S14J 2ID6A 2ZB9A 4XLPF 4P1WA 2QEXI 3DF8A 3ECOA 1P4WA 1J59A 2EH3A 2K27A 3WE3A 3LAPA 4IEJA 3CMEI 3ASOH 4CSWA 2K9SA 5DM6F 2ZXIA 2JPBA 2R3SA 2DA4A 3AG4H 1HLVA 2DFIA 3I4NJ 2MH9A 2WC2A 3PFIA 1ODDA 3OYJA 1X1CA 4M9ZA 5CKTA 4I0BA 5IP6A 1MJ9A 2GOXB 3KEQA 2VASA 4FQGA 3SQNA 3PO3J 5M5WJ 2LRDA 2TRTA 5F27A 2Q8KA 4ZYEA 3CMYA 1K78B 1LEBA 4G8XA 4G6QA 1VQKI 4BJTA 1O3SA 1OYYA 4ZJZA 2YX4A 2HZDA 5TGTA 5E1ZB 2IA2A 4ZC3A 2NVQJ 3OMYA 2FOWA 1XPXA 4BAYA 4Y15A 4UUSB 5F1JA 3K9TA 2ZNZA 2GAUA 2ZSIB 2DLLA 2DPUA 1Z91A 2BV6A 4PJLA 4A2UA 3CMAI 1JGSA 2QSGX 3TOAA 1WH7A 4HX8A 3P5JA 5HNHA 2ZSHB 2X6WA 2Y9YA 2E34A 3M1CA 5HLIA 3F8MA 3FMSA 1HXDA 5L3DA 5K7HA 3LSRA 1RNLA 2JT1A 1TW2A 3D1NI 5BS6A 2X1CA 5TRDA 3NAUA 4LB6B 1POGA 3C7JA 2Y48A 5LRSA 3OL3A 3GTGJ 4BDZA 2KJCA 1N77A 2KIUA 4U0WA 1E2XA 5EGOB 4J01A 4MFDA 2R5ZB 3DQVC 3A01B 3UKGA 4P96A 4UVAA 4A3DJ 2QKLB 3H0GJ 4E7JA 1CF7B 2CUEA 1O7FA 2HVQA 3W6JB 4KYWA 5H6QA 1LVKA 1FYKA 2HDCA 3PL8A 2YSRA 4Q48A 1I39A 3FBNB 4MFEA 5DD8A 4EMSA 5IYBJ 3SYTA 5LHGA 4QLCU 3RDIA 1G8XA 4HSTA 3HSEA 3REOA 1MW7A 2W48A 1WKMA 4A0ZA 5IOZA 3GLLA 2LYCA 3BR0A 3WU0A 1K83J 2ZMEC 2X6XA 4OMZA 4L5EA 3CCJI 2TDXA 3CQZJ 3K1MA 1BIBA 3OIOA 2ZKZA 3AAFA 3BP8A 3D5RC 4CCKA 1H9GA 2HQ5A 1SD6A 5F0FA 2XSJC 1ZAOA 2WY8Q 3WTTC 3OYCA 3SJMA 4HF2A 4XKBA 3SFIA 2A69F 5DTDA 1LVAA 4YFNF 4HX4A 4DYQA 2HI3A 3E97A 3R61A 2XAQA 2W1OA 1QO0D 3N05A 3QOPA 4D5CA 4Q47A 2LD5A 2CQ7A 3CCUI 4BACA 1BIAA 5FD5A 2M2EA 1ETWA 4M3GA 3IAS2 2KIFA 2NOJB 5EF6A 3J7AY 1IF1A 3ZN1A 3GFJA 2F5EA 5GPAA 3IH3A 4UB6C 1GXPA 4IHWA 4N4OB 2CQNA 5DUKA 4K2EA 5FD6A 3ZP5A 2EB7A 1Z1DA 2VBWA 1D1AA 4LIUA 2H27A 4CCMA 4MNUA 4XLNF 3R0AA 4XM3A 3TW6A 2IEKA 2AXTC 2J5PA 3HM5A 4BXXJ 2O8KA 2Q1ZB 5FRMA 4BHBA 2DA7A 1X2MA 3TP3A 1A5JA 3V8LA 1JT6A 2YPRA 2Z3YA 3VYUB 2VT3A 5IYCJ 1PP7U 2XDVA 1PP8F 3PJRA 3VPRA 4E4HA 4RAFA 1BI0A 2EWNA 3H5NA 2G0EA 3MD2A 5HLHA 4LMYA 3JSOA 3LAJA 1FBSA 2DOAA 3KZYA 1IZ1A 4I01A 3OYDA 4EGYA 4NC8A 2M1BA 3PUBA 1I3AA 2LY1A 5B1AH 5IP9J 2STTA 3ZMZA 4DYRA 3ECHA 5B3SH 1PYVA 2ID3A 2LFBA 1BI1A 4HLYA 3NWSA 3ZPLA 4FISA 1S6LA 3R0JA 1MMNA 5E1XA 3A0HC 4KISA 1Y0NA 1VQ8I 4DBQA 3CCMI 3CF5F 1Q1HA 4DJAA 9ANTA 1WJAA 1A31A 2LG4A 1R1UA 1E3HA 1T95A 4BL0B 1QBJA 1ZRCA 1X1AA 1D8KA 4HX7A 4L9NA 3PNTA 4B44A 2F4IA 3DCFA 2E19A 4AIHA 1AOYA 2QBYB 3I59A 3CC2I 2EIKH 5E1WA 1RZ4A 2HYFA 1TWAJ 2PMHA 3JR9A 1YJNI 4OINF 4GYGA 5E3MA 4XBFA 4WXDA 1I1GA 4A6DA 5E8GA 1GVDA 2D1VA 4ZZDA 2E35A 2D2WA 3WODF 1U9OA 3F3XA 3I58A 1ZQ3P 3KP3A 3CDIA 1B9MA 4XIDA 4A3LJ 2ZXJA 1K61A 1ZARA 2HZTA 1I27A 3ESWB 3SDGA 4I0AA 5GP9A 3GTJJ 3S3OA 2DA3A 1ENHA 2K3FA 4XSXF 2COBA 4IJAA 4CYDA 3MKZA 4EM2A 1Z21A 1QZEA 3GTMJ 1I6HJ 2IJLA 1MMAA 1BW6A 2BY1A 2IBDA 2HNHA 2VBYA 3ZQIA 1IAWA 4XN3A 2DDBA 2GBYA 2L01A 4CZZA 4EM0B 4EQQA 1FYLA 4MTDA 1JJ6C 1R00A 3BCAA 3HUGB 4BNCA 1FBUA 1WH5A 2M0CA 1UFMA 4MQ9F 3CJRB 1XS9A 2BY0A 4G9YA 4A3BJ 1FOXA 1JHFA 3I9V2 1U8BA 1Y0UA 4RB3C 2L7ZA 4B3AA 1NG7A 2HXIA 3FK7A 2OJED 3TDZC 1IO2A 1EA3A 4EEFG 1F5TA 1KU7A 1G3WA 1DGWY 1Z6TA 3B6CA 2L7FP 4ESFA 2HQAA 3K4BA 3G1LA 1E17A 3OIQA 1TW3A 4ZDOA 2DA1A 3CLOA 3I53A 3FWEA 1MNEA 2X1EA 2LKSA 3SHFA 4X6AJ 4M6VA 3HEFA 2V1UA 2H1KA 3HOTA 2DTZA 2HOSA 3JRIA 3ERED 1JE8A 4DZJA 2QYOA 4FE7A 1UAAA 2R7QA 2VJIA 4BEHA 1RETA 1T98A 1UHSA 3HOSA 2FBKA 3BLYA 5LEKA 2ZFWA 4OMYA 3A03A 2XC7A 3L09A 2VOOA 3L2CA 4AYBA 1I50J 3HOZJ 4D1QA 5JHFA 2E2JJ 1HDPA 3OOUA 3C1DA 4HNVA 2O7OA 3M4OJ 2Y2ZA 3D0SA 2EIMH 1FBQA 1XB4A 4KDPA 2F48A 3RKYA 2P7CB 3CJQB 2YU9J 3KPHA 3M07A 3BPVA 1X1PA 2PMUA 1V55H 1Y8RB 4BQQA 4CH7A 4NB5A 4HOBA 2EV6A 2W7NA 2E5NA 3OS0A 2V6EA 2K86A 4IRIA 2E71A 1JTYA 3OYEA 1R4NB 2HYJA 1HDDC 3BCBA 5KAFC 2BBYA 1YQAA 2PJPA 1HKSA 1XSVA 5LBQA 2L7KA 3MKWB 5J1UA 2FRHA 3TO7A 3DP7A 4I98B 4N9IA 2M5WA 3KLOA 3BR5A 2KFDA 3NEUA 3ZOBA 5LHIA 1FC3A 4AUXA 2DK8A 2VXDA 1YX5A 1PUFB 3KP7A 2H6BA 3HZJA 1AHDP 3O6BB 3GW2A 1E3PA 5F04A 2JMWA 4YIIA 2PEXA 2XV4S 3IUOA 5BPIA 1YG2A 3AL0B 2KL4A 3KP2A 2GA2A 4RB2C 3IP4B 2W84A 2M4KA 5K1YA 3J80K 3MZ8A 4RM3A 3V7RA 1QU3A 1UZCA 2F5VA 4A12A 1O3RA 1RKTA 3BG5A 4F52A 3BT9A 1HOMA 3OIPA 2IAIA 4HQMA 2VQCA 3OYGA 3DLLF 1ORKA 2WAEA 3W3CA 4LGWA 1J2XA 3F72A 1FP1D 1F9NA 1P2FA 2QKMB 1BJZA 3L2UA 2JUCA 1ETOA 1RR8C 3H3UA 4L18B 5F6FA 2XIGA 1O3TA 4M9SA 3ZXSA 2BHYA 4MQVA 4QTRA 4GDFA 3ASNH 1D1CA 1Y8QB 3GZ6A 4E7LA 1HW5A 1FP2A 2UV1A 5E3OA 1H89C 1I5ZA 2KIQA 4BBSJ 4IO9F 2IGNA 2GM4A 2DMQA 4R79A 2Z33A 2CSOA 4MGRA 3LL7A 3IWZA 2X9DA 3QU6A 5CVJA 5EG0B 3KYLA 1W0UA 4UNOA 5DEQA 1T33A 3LSTA 1HW1A 3KE2A 4ZH4F 2VKDA 1SFOJ 3BG6A 2LNBA 1ZRFA 3CUOA 4M6XA 3V7SA 1KQ9A 2R7FA 2I10A 3E1SA 2G7UA 2OQRA 4B4CA 3F6VA 3ZQHA 3K70D 1MDMA 2NS8A 4FX4A 1OCPA 2V79A 1OQYA 4NDLA 5IY5H 3OYHA 2CW8A 4HQEA 1WFXA 2D5VA 3ZMDA 1O3QA 4IHTA 4GCVA 1WCMJ 2LBFA 3ABLH 3A2KA 2Z99A 2ZXWH 1WJFA 4BE2A 2DYSH 2R7OA 1H88C 2NVUB 4DIQA 2JSPA 1YW7A 2L9RA 3IRRA 1GDTA 2WB1N 2VQHA 3S8PA 5E17F 4ENMA 4RMNA 1W5CC 2HQRA 1R9TJ 4ZYDA 2Y0SA 2JSCA 5HS9A 1DGRM 4E7HA 4A3MJ 4ZYAA 4YRVA 2GIZA 3ZR8X 3DEWA 2FSWA 2FU4A 2DMNA 3BJAA 1G3TA 2GA1A 2DFFA 2HPMA 1R7JA 3E0JB 2GIVA 1G4DA 2CW0F 4C2TA 2Y31A 2HKXA 3LSHA 4YEJA 2M3AA 4DGWB 2ISZA 2H1LA 1XX5A 1LE8B 5E8IA 2I8DA 2RNJA 1OISA 3WTWC 2PMZN 2OCCH 3COAC 5HLGA 1V5EA 1X1BA 2ZFUA 3GFMA 5DM7F 1YRNA 3LSGA 1KQ0A 4ANJA 2MG4A 1JKRC 3GTPJ 2ETHA 1JKOC 5CVVA 1ZG1A 1ZGAA 3Q0VA 1LDKB 5CVUA 3IWFA 3QPTA 1GXQA 2FNAA 1BM9A 1WSUA 2PBIA 1MBJA 2DT6A 3QRFF 2R7ZJ 2V9PA 4RA2A 4BU2A 1MBEA 1SEUA 4NQWA 2VODA 3HOUJ 5GAGJ 4E70A 1LPQA 3BDDA 3GF2A 2MYSA 4JYKA 2K7LA 3PSIA 1ZRDA 3ZQ7A 3DKYA 2V9VA 4KT6A 1B72A 5DV5A 3E5XA 3K4CA 1BC8C 3BZ6A 1HCRA 1KU3A 1TT0A 1UB9A 2QF7A 4HV5A 1LFUP 4IZZA 2OTJI 3LNQA 3HC7A 2WV1A 3CDLA 3NRVA 3DLAA 1K4TA 2G7HA 2ZMEB 1X1DA 5ERIA 5KHDA 3LSPA 1J9IA 1EV7A 1MNMC 4U7BA 1FT9A 3W2VA 3IHUA 1A6QA 1LFBA 4M3DA 5DDGA 4U87A 2XGCA 3I0TA 2AQEA 2HOTA 3QP6A 3JTHA 1HC8A 3MKLA 1LKXA 1APLC 4AWXB 3CLQA 4U7DA 1UELB 2NVTJ 3BPXA 2ELHA 3WTZA 4E6KG 4N9HA 4B8XA 1FJLA 2WADA 5C4XJ 2PI0A 1Y56A 3ABTA 2DJNA 4A0XA 1KZHA 3CZ6A 2XPUA 4EATA 3PO2J 4C2UA 3UNGC 3H92A 4CCNA 2Z2SB 3JW4A 3M9AA 4S05A 3WTUC 2IT0A 4LIVA 5D5VB 2HTJA 1ZH5A 3ZQQA 5KAIC 2FA5A 1OKRA 2ICWG 3FKIJ 5L3CA 5AIPA 2K9MA 5CVRA 1YIOA 4HDVA 3HOWJ 3H36A 4BJ6C 4L0ZB 3CF2A 5GPCA 3RQ4A 1SANA 2EZIA 3TL4X 2R92J 1ZR4A 1EF4A 2GWRA 3RKWA 2Z9OA 2RN7A 4BQNA 3DBHB 1FSEA 1R4MB 3PFYA 1KYZA 4RGRA 1XMKA 1QVUA 2L9SA 1YI2I 4RGXA 4OIOF 2EV0A 4D9JA 4XRMA 5D5UB 2PG4A 3BTCA 2RQQA 3RI4A 1R5HA 2VONA 1P4AA 2EZLA 2CQKA 1CQTA 3BQZA 2EILH 3LWFA 2OD5A 2BE5F 4BE0A 3QYBA 4E7KA 2EINH 4RGSA 1B1BA 1RPWA 5M3MJ 5C44J 1V5GA 2MFZA 1XDSA 2QA4I 1LDDA 2KMUA 5K5OA 1FMWA 2E1MC 3V7CA 3M3YJ 3W6KB 3Q0WA 3JRHA 2KPMA 3FM3A 2BZTA 5CQGA 4FCYA 4ABZA 3LFKA 3WU2C 2GQQA 4Y4RA 3HOXJ 5LD2C 1FTTA 2L7MP 4NC6A 1W5TA 3E6MA 2HTSA 3AG1H 4BXFA 4II3A 1O57A 2PLYA 2ZBKA 2IS2A 2LVSA 5E3NA 3G3ZA 1AKHA 4DZPA 2WBMA 3HOYJ 3BG9A 2LDUA 2R7SA 2HWVA 5J1RA 4LJZF 2JRTA 3MQ0A 4HAMA 2IGKA 3CD6I 2JA8J 2OCEA 4QWQA 2VBZA 1F43A 3MMYB 3CMMA 1U6GA 2K5CA 2FOKA 1EKEA 2RGVA 3OY9A 1MMSA 2XB0X 4AC0A 4M74A 1BI3A 2OC6A 1IDYA 4ZYHA 2P5VA 2X48A 4A3CJ 2R7VA 4IXAA 5J47A 2CQXA 3G1MA 1WWXA 1D8JA 3P9CA 4LG0A 3IAM2 1D0ZA 5E20A 1WRJA 4AIJA 2L02A 5J1YA 3CC4I 2FMLA 3HJEA 3H35A 3OR2C 3PNYA 4GYIA 2BW3A 1U0JA 4P9UA 4N0BA 1I1SA 4I09A 1VNDA 3DU6A 3V8JA 1LB2A 3RYPA 1MDMB 2V6CA 2OQGA 3S2WA 4CCLA 4XKVA 2FUG2 3CP8A 1N78A 3S3MA 3K4JA 3KEYA 4B3XA 2LBFB 1DP7P 2XF7A 3CCLI 3LOCA 1W36C 3PUFA 2UZKA 3GFLA 4KJZA 4I76A 1R23A 4QIWN 3OS2A 2DODA 5AONA 4XLCA 3VSLA 2ELKA 1STZA 2PFBA 3MKYB 1SFUA 2BEOA 2M4GA 3HBLA 4HNUA 2OZUA 1U2WA 3BZCA 3W2WA 2BY3A 1IC8A 1MKMA 5HVQC 2PX9A 1LDJA 1YX3A 1YS7A 1YW8A 4FTHA 1JGGA 3HTSB 3CJTB 1IV8A 1XCBA 4YFKF 4CDGA 2RC4A 2E1OA 3F9KA 4BQOA 4UUTA 3T8RA 3W2AA 2V1NA 3LQRA 2QSFX 1EH7A 1J09A 1JUMA 3QU3A 2XVCA 1SFXA 2BHZA 1XSDA 1MMDA 2R7DA 2BVMA 1NH3A 1FWZA 4XK4A 1VQ4I 2M9HA 3VDXA 4Y13A 3ZMVA 3KZIC 4PZJA 4LG3A 2BOLA 3OYFA 4YIFA 3TKYA 1LUJB 3OYMA 5J8CA 2JRMA 2WAQN 1YRNB 5KNLA 2EJRA 1SD5A 2MABA 4M3BA 2BY2A 2DCEA 3BJ6A 3GTQJ 5B1BH 4G7HF 2EFWA 3WHCA 1Z77A 1UCRA 3WGIA 4DOZA 5FROA 4RB1A 3FIWA 2L0KA 2X51A 5E3LA 1A04A 4IHVA 3FMQA 5ICEA 1VFCA 3FX3A 4MEYF 2HXOA 4IQ4A 3G2BA 4HV6A 2W4SA 3BR1A 1RUNA 4GFBA 1USTA 3RZDJ 1IG7A 2JA6J 2OF7A 3RSNA 4KITB 1YW9A 1XSXA 2IP2A 1B72B 4RLFA 5CLSA 1O4XA 2O0YA 1W36D 3BJOA 2FX0A 5F0HA 4G6TB 4PFPA 4D7MA 4BGDA 1W7PD 4HPQA 3HHHA 4HDUA 4M72A 5ILVA 1ETVA 3CUQC 3LA3A 3U1KA 2DT5A 3T1BA 5CJ9A 1OCOH 4ON0A 2CW7A 3DEUA 4RAZA 3FXUA 4BUPA 2ACJA 1XD7A 4LK1F 2JTVA 3TQNA 1WJEA 1NHAA 4MLOA 2Y9ZA 1YYVA 4ITVA 2P5LC 1FMVA 3UR3C 3TGNA 2RV8A 2L5QA 2MSYA 1MSEC 4CYCB 1D3YA 3KX2A 3OYLA 2A6HF 5A2QZ 1BOBA 2MLGA 1FZPB 4BS9A 4WF2A 2GXBA 4IX7A 1B8IA 1XDUA 3PIOF 4IQJA 2M8GX 1LQ1A 1LNWA 4WWCA 2LOOA 3JRDA 2CUJA 5JR3A 1VQ5I 2H8WA 2CFOA 4EV0A 3K4KA 3LSKA 3ZN0A 2O61A 1TWHJ 2R0QC 1MH4A 4EVIA 4AYBN 4OIPF 2CGPA 3TO6A 1H9TA 5F1RA 2DAOA 3GO5A 2KRCA 3S32A 3BR6A 5IT3A 4RDUA 2IA1A 4LOCA 1U8RA 1E3OC 3I56I 2HOAA 4RBOA 1MD0A 2D45A 3QWLA 4XNFA 1WVRA 2DA6A 4XQFA 2KRHA 1QNTA 2QUFA 2ZO4A 2WA0A 2DU9A 3F0CA 4JOMA 4PGHA 5H6RA 2R7XA 2DN0A 5LGNA 2QSHX 5LLQA 2Q2EA 4Y7NJ 1D0XA 3MEXA 1FTZA 2E1NA 3NARA 1UHWA 1JKPC 4NNJA 2WAFA 2KHMA 5BQTA 3IH2A 4UV9A 1QZYA 4PFOA 1W7PA 4UVCA 1K79A 2VJ4A 3B73A 3OS1A 3A02A 2F6CA 3HRSA 2VPLA 4EJUA 2E60A 1P4XA 4CXFA 3IRQA 1XC5A 2M34A 3ONQA 3OOPA 4NC7A 2NNYA 2EFOA 2VKEA 3SXYA 3E7LA 3ELKA 1HQCA 5EZHA 1JHHA 5FFZA 2HDWA 1WJ5A 4M71A 1QRYA 3EUHA 2JN6A 2BXZA 4EGZA 3IL2A 2HVRA 5FLVA 3OYNA 5JLWA 3W6VA 2K4JA 4OU0A 1TQMA 3C3WA 3X2QH 2CV0A 1U3EM 1QHHD 1LJ9A 1QZZA 3GBGA 4G7ZF 3GCMA 2VXZA 4P55A 1MH3A 1SVMA 5GAHJ 2LP0A 3ULQB 3QYFA 2EBIA 2WV0A 1V5FA 1G6NA 3TEDA 5FGMA 3OSGA 1AKHB 2IW5A 3ERMA 3DXJF 3I4PA 4BE1A 3EDPA 5FRNA 3CP2A 1DP3A 5FKMA 4XLAA 4V2FA 4U0VA 1IN6A 1BBYA 1NTCA 2B7EA 2FE3A 1X3ZB 1YFHA 4AD9A 2FJ1A 3I54A 2FXAA 1OJLA 1F36A 2LKPA 3NQOA 1JUSA 4R8HA 1TP4A 2K9QA 4C2MJ 1ERDA 3ML6A 1MBFA 1ULYA 3EQLF 3VEPA 2IGOA 3S16J 3IC7A 3FDYA 1FEXA 4IRHA 3ABKH 4W97A 2JA5J 1ITYA 2M87A 3HG9A 3K70C 1ZN2A 1OYIA 1FNNA 4MTEA 5J4VA 5DYMA 2A6TA 2V1DA 2QVOA 2VJ5A 2LK2A 5DCFA 1S7AA 2Z1DA 4OWRB 3EYIA 1FIPA 1BR1A 2RKHA 2YU3A 1A6IA 3CUQA 2XGXA 3GZNB 3GTKJ 2L9NA 4ESBA 3FBIB 1R58A 3FHNA 1EH8A 4U0YA 1U5TC 1A35A 4O3MA 1SVOA 3DPUA 4KICA 3U21A 1QA6A 2XROA 2XAGA 4JBAA 1HSJA 5LFAA 2X6OA 2KISA 4UY8I 2W00A 1B59A 2EZKA 2JA7J 2DFHA 2OUMA 3DPTA 4XKCA 1R1VA 1VQMI 5FB2A 3I64A 2YX7A 3DKWA 3PNVA 3ZMUA 3F8CA 1T38A 1K78A 2F5FA 1IXSB 1DPRA 2IPQX 3Q3SA 2QLZA 1U9NA 2O03A 1BA5A 1IUYA 3LSIA 1QPIA 4M6YA 3I71A 4KNYA 3G4SI 3L1PA 4UHTA 1J5YA 1TZLA 2QQAA 1JJ8C 1GHCA 1JXSA 2O8XA 4IHYA 2X6YA 1ETYA 3H0DA 3OYAA 2CV2A 1IUFA 2XPVA 2RQPA 5DS9A 5D4RA 1WI3A 1SD7A 4B47A 2V7FA 4LK0F 2CMPA 1MJBA 3K1PA 3PQKA 1OFCX 4GXOA 4BY1J 1QPMA 3GEZA 4MHGA 1Y39A 2DMUA 3BWGA 4RGUA 2HKOA 1HKTA 4WK8F 2MD0A 3VWBA 4ASNA 3BR3A 3FF5A 1P6RA 1OYWA 4BYYA 4AVPA 5L3FA 1GT0C 3ABMH 2XKPA 3WU1B 4G7OF 1RR7A 5EGOA 2R5ZA 3G73A 2HDDA 1QHGA 2VC0A 3QPSA 4KIGA 4H0EA 2LLKA 3GXOA 3HGYA 3DTIA 4Z2YA 4MEXF 4BQAA 2RREA 2COMA 2YS9A 4FASD 5HODA 3HGGA 3G1OA 1AWCA 1R6RA 1Y1VJ 4XOPA 2FBHA 4IOCF 3CCSI 4XRFA 4A0YA 3FISA 2LREA 4EJVA 4IF4A 3JAMK 2M8EA 3RTRA 1RC9A 4AU7A 4A3JJ 2M7AA 4QSHA 1DDNA 4ZYGA 2B9SA 3FXRA 3BG7A 2E1MB 5HOOA 1DPUA 1JI8A 2NXNB 1SAUA 1KA8A 1T0FC 2R5YA 3A4CA 5K7FA 3L2VA 3K69A 1T39A 3KCCA 5DD4A 4JK1X 1BL0A 3Q5FA 1XGSA 3MZHA 4Q5SF 3GUDA 2VL8A 5F64A 1KGSA 2L2OA 2P5KA 3QODA 3JRAA 3I59B 4I2OA 5FKOA 2F2EA 4BHCA 3VOEA 3KEOA 1S5LC 2AQFA 3M8FA 3HIFA 3BG3A 1D0YA 4PJNA 3FMRA 1MSFC 2V9KA 4G94A 4OAYA 1TBXA 1Z7UA 4PSXA 2A5WA 2E1CA 2LMDA 4CICA 1VF9A 4OIQF 2DOFA 3KETA 2IGMA 4TV7A 3RYRA 2HQNA 2GOMA 3DV8A 1C0WA 2ZC2A 1IJWC 3IV5A 1EJ9A 5IT9K 2P81A 5L3GA 5LGTA 3IH4A 4HF0A 2DK5A 1WJBA 4A93J 4G12A 2ECCA 2AXLA 5FLMJ 2BGCA 4P9FA 5ILSA 3VYTB 1BC7C 3EYYA 3D5SC 3KZZA 5GTHC 1OCRH 2PQ8A 3J7AO 2UWMA 5E79C 4I02A 2MD5A 5D8LB 3BQYA 3OV8A 2RDPA 1U5TA 4XSZF 2Q2EB 4IHSA 1XCVA 3M8JA 4G6DA 1G2HA 3HSRA 2HPIA 5CVIA 5J4YA 2Y69H 3CO6C 2LF7A 2IS6A 4JX4A 2LKXA 3K4LA 2MC4A 1F4KA 3S1NJ 2DDAA 2XAFA 1Y6IA 4B1RA 1TT5B 2QCOA 3J7YJ 2IS4A 3R4KA 1ETXA 4EJOA 3SDBA 1ON2A 3B6AA 2XHKA 3VYSB 3H9JA 4IL6C 4AVZA 1RESA 3JSPA 3I3LA 2IRFG 3K4MA 2DMPA 2OU2A 2H8RA 3SEZA 5CYVA 3L2RA 3HOVJ 3CJNA 2DA5A 4ENJA 2LC2A 2OBPA 2K3PA 4X1EA 3TP0A 1NK3P 3J7ZI 4GGGA 2FD5A 4F7ZA 1VQLI 3U9GA 4OAZA 2XF6A 1VQPI 3HSFA 5TISC 2ZNYA 1B9NA 3M1EA 2ME6A 2QENA 1T2KA 4BEHB 4FETA 1YTYA 2OPTA 2WY7Q 1BW5A 4KN4X 1KQ8A 2L3DA 2DO7A 4BDYA 1S8NA 4XMYA 4S04A 2VOPA 3WHBA 1HW2A 1Z3YA 2NS0A 3HRUA 1FOWA 4XORA 3MVPA 1KU2A 2FNPA 2VE8A 2CH0A 3HKZA 3QYEA 4R1HA 4Y17A 1RI7A 4M73A 2DBBA 2VUMJ 1ZHFA 2VI6A 1KONA 1ZLJA 3CESA 5M5XJ 1ZG5A 3Q9VA 5JLXA 2FMYA 2HVSA 4XRSA 3RIRA 1YE9A 2QQ9A 3SZPA 3P9IA 2KRFA 3AFHA 4M3FA 2ZJRF 2V4JC 5D6EA 2JUGA 2NS7A 3GWZA 2EFNA 3R60A 3TDUC 3A0BC 3LA7A 1X4PA 1WHUA 3S1RJ 4LLNA 3CTAA 1XMAA 2L4AA 3FK6A 2MA3A 1E0EA 2JPCA 2H6CA 1JTXA 2DXIA 2Q0OA 1FY7A 5M5YJ 3DPLC 2XKOA 4HEA2 3Q0UA 1TWCJ 1BI2A 5D5WB 1YIJI 1UMQA 2ZXHA 5ICCA 5HNFA 3MAJA 3H5AA 4Y33A 1ZGWA 4HW0A 1NK2P 1MGTA 2XASA 1T0FA 3VODA 3CUQB 4NBQA 2L54A 1FOKA 3LSMA 5EEAA 5B5EC 2MC3A 5H20A 2F5DA 2O5RA 2IS1A 2LF8A 3RKXA 2UXXA 2XAJA 4IKFA 4KT5C 1TTYA 3HTUA 4J19A 3HRMA 5CPRB 1SC7A 2AHQA 1BR2A 4JQFA 4XL9A 1R22A 1OMIA 2EA4A 3HYIA 3WG7H 1RIOH 1HSTA 4HG2A 1YO5C 4A69C 1KYWA 2OZ6A 2JVHA 4P5OA 3O2PE 2XF5A 4KMUX 1XGNA 4HF1A 1YS6A 2BYVE 2VIXA 3QAHA 4AIKA 3TW7A 2NYXA 4HZFA 3WTVC 3CCQI 3C2GA 2JQ7A 5D4SA 3P7NA 2E7XA 5EYRA 1NG6A 4GO1A 2KDZA 1YITI 3CO7C 4BHPA 3LA2A 3OYIA 1T6SA 3LSJA 4XLHA 2MBFA 2KQRA 4XLEA 3QP5A 2EA2A 5ED4A 5JI6A 1G3YA 4XN0A 1BN5A 4ZZLA 4ENKA 5DUIA 1G59A 1IXRC 2XAHA 1GUUA 3K0LA 3I4MJ 3L7WA 3WTYC 2J5OA 3E5QA 4C3HJ 1R49A 5D8KB 3P9KA 1XG1A 1JT0A 2OV7A 3CDHA 3O8HA 2TCTA 1YOVB 3ZMTA 3K1NA 4UXNA 1G3SA 3R6SA 3S1QJ 2HFHA 2DW4A 2PN6A 1S3JA 3GVAA 2EV5A 2P4WA 1X3WB 3M7GA 4A3GJ 2HGCA 4HLXA 1MIJA 2H94A 2FBIA 2JK3A 4E7SA 3WTSC 2PJRA 4Y3OA 1WZ2A 1Q1VA 3I55I 4DNCA 1N25A 1IRGA 2VKVA 1IN8A 1S72I 3J80Z 3F8NA 4KMFA 2EZHA 2P0WA 3NWTA 3G6EI 2Z16A 2C6YA 1PUFA 4PUSA 5ICFA 3LFUA 1R71A 1YHQI 1IRFA 1HF0A 4L9VA 4HNTA 4F91B 1D5VA 2EFQA 5BNGA 4CUGA 3VB2A 2GXAA 3GMEA 5AIQA 3GZ5A 2O3FA 4PGGA 4PDKA 4PJMA 4CGZA 2R5YB 4QPQA 3Q9SA 3EUHC 2K4BA 2M30A 3FZVA 4V19K 1B4AA 1V3FA 3CCYA 1W1WE 5D5XB 4WX9A 1FLIA 3CCVI 4F55A 5FKKA 3BTLA 2W25A 3AKZA 3K10A 2QQBA 4CZCA 3MWMA 3O3KA 4DBRA 5JFRA 5BOXA 5L3BA 5FLXK 1H0MA 2DI3A 2KT0A 2E2IJ 5FFXA 2A68F 1SMTA 4ZDPA 1YJ9I 1OCZH 3JCUC 2P6SA 1XGMA 1VTNC 5J3LA 1TC3C 3E6CC 3BTJA 2ZJPF 4FHTA 2IXSA 3LMMA 3S3NA 2CU7A 5BPDA 2CV1A 2DA2A 4OIRF 2Z5UA 5J8FA 1K4SA 1VZ0A 4XR6A 3RJPA 5GTIC 2EPFA 3DKXA 2K40A 5J6XA 5EG0A 1UG0A 4NQWB 1WGXA 2JZYA 4FT8A 4ETSA 3S15J 4O6JA 2R4GA 2XSDC 2DTRA 2CG4A 2WWYA 4HYEA 2BXYA 4UVBA 4LB5A 3KP6A 4WXHA 3K7AJ 3RPUD 4A3KJ 2VB6A 3FXJA 2CWEA 3FXOA 1WJDA 1U5TB 4JX6A 1WJCA 3JAMZ 4M9XA 1XN7A 2R7WA 1PJRA 3BY6A 2QGUA 2I5UA 1S7EA 3F23A 2P7VB 4LLLA 1ONVA 3ABUA 2EIJH 1V4RA 5FKLA 4GRIA 1FIAA 3BROA 2E36A 3V42A 5HDNA 3A1YA 1Z6RA 4UV8A 2O9LA 1D1BA 4IPAA 1J7KA 4O5VA 4D5FA 4RM2A 2KIMA 1U78A 4CA0A 4KIBA 3J81K 4HSRA 1Z7LA 1FSHA 2KLOA 1R1TA 2VJJA 1F1ZA 4LLGF 1IN7A 3AG2H 3SFZA 4D7NA 3KFWX 4PJ0C 4C30A 2W24A 1H8AC 4X0GA 1TQPA 3L9FA 1S29A 2CFXA 3KP5A 4EM1A 4CCJA 4EJWA 1ZTRA 2MH2A 5IT9Z 1YLFA 2XRNA 2AO9A 1LE8A 1Z0XA 2XB5A 5IPAA 5F08A 1XTAA 2CUZA 2WAQA 3T5XA 3FXQA 1CGPA 4H4KC 2ECBA 1V54H 1GLNA 1R5ID 3KLNA 3RCOA 4C9YA 4PCQA 1FPQA 1VQOI 1PDNC 3HRTA 3BR2A 1FOYA 4WXCA 2DPDA 3RPUA 3JRFA 1IGNA 4MO7A 4XLFA 1TWFJ 2CJJA 3S93A 2NRAC 1BOAA 2QZ8A 1M1EB 1WQ2A 1IRZA 3KYDB 2MLKA 2A07F 4DYCA 1OR7C 3EPZA 2L4MA 2XRLA 1OPCA 5IYDJ 4II2A 2LH9A 1WPKA 2EQRA 4A3IJ 2W57A 3HL2A 4A3FJ 2ZMEA 4XONA 1SVLA 1QVTA 2YUSA 3K2ZA 1N75A 1DUXC 3VYRB 1X58A 2X1DA 3PQJA 4A5NA 3GYHX 1BJAA 3RKQA 5EDNA 2ME0A 1R36A 1TWGJ 3FXKA 3E6DA 4HBLA 3HHGA 4IRGA 3DBLB 3GTOJ 2GZWA 2JWTA 3F21A 3HPHA 2KKOA 4DW6A 2H09A 4I6ZA 1BR4A 5LHHA 3V4GA 5LGUA 3L2WA 1IN4A 3JTGA 4E7ZA 4L9TA 3VFZA 2X85A 2NNNA 3K2AA 4NUBA 2AS5F 4E7IA 2KZVA 1QGPA 1I3QJ
chains in the Genus database with same CATH topology
3S2DJ 1ZK8A 2DA7A 1X2MA 3TP3A 1A5JA 1JT6A 2CRGA 5IYCJ 3JRAA 1RPWA 5M3MJ 5FKOA 5C44J 2CUFA 3VPRA 3BG3A 1MSFC 2G0EA 1DU0A 2XGEA 3M3YJ 3Q0WA 1P7IA 3PM1A 1VF9A 3JRHA 2DMTA 5IP9J 4FCYA 4ABZA 4DYRA 3JRBA 1FTTA 2VPRA 3HOXJ 2L7MP 2ID3A 2LFBA 3ZQGA 1IJWC 3S1MJ 4FISA 1ETKA 2LVSA 5K7ZA 5E3NA 3IV5A 2P81A 1AKHA 4DZPA 3IH4A 3HOYJ 3BG9A 4A93J 4G12A 1DU6A 5J1RA 2ECCA 5FLMJ 2JA8J 9ANTA 1UG2A 1F43A 1RKWA 4BBRJ 2LR8A 3DCFA 4Y52J 2E19A 3BQYA 2XB0X 1AU7A 4AC0A 1G2HA 2NVXJ 4M3EA 1IDYA 1TWAJ 1ZKGA 3JR9A 2X48A 3RZOJ 4A3CJ 2Y0SN 1IV6A 5E3MA 4JX4A 2LKXA 3S1NJ 2CQXA 1ZR2A 1GVDA 3G1MA 4W1UA 4B1RA 5EZGA 2QCOA 1ETXA 1U9OA 1ZQ3P 3HB9A 3B6AA 5J1YA 1RESA 4XIDA 4A3LJ 1K61A 5FKNA 4JP0A 3SDGA 2DMPA 5GP9A 3GTJJ 4UUSA 2DA3A 2H8RA 5F0CA 1ENHA 1VNDA 4XICA 3HOVJ 2COBA 2DA5A 1NK3P 4X1EA 3TP0A 3GTMJ 2E2HJ 1I6HJ 2FD5A 1BW6A 3ZQIA 2IBDA 2GBYA 2ME6A 3LOCA 1JJ6C 1JUPA 4I76A 1WH5A 4QIWN 3JRCA 2OPTA 1BW5A 2M0CA 2ELKA 1XS9A 3WHBA 4A3BJ 3HBLA 1U8BA 3MVPA 1IC8A 2L7ZA 4B3AA 4A3EJ 2HXIA 3FK7A 3A01A 2VUMJ 4EEFG 2VI6A 4FTHA 1JGGA 5M5XJ 5JLXA 4XRSA 2E1OA 3JRGA 1IDZA 4UUTA 3B6CA 2L7FP 4M3FA 3G1LA 3GTLJ 1MBGA 2GLOA 2NS7A 2DA1A 1JUMA 2MW8A 4XK4A 3S1RJ 4M6VA 4X6AJ 3HEFA 2H1KA 2M9HA 2DTZA 2HOSA 3JRIA 3FK6A 4DZJA 4FE7A 1JTXA 1T56A 5M5YJ 1RETA 1UHSA 2WAQN 1YRNB 4IHXA 4M3BA 3Q0UA 2LTPA 1TWCJ 2XGDA 3GTQJ 2MGQA 2N8GA 1UMQA 3A03A 3WHCA 1ZGWA 4FE4A 1Z77A 1I50J 3HOZJ 2E2JJ 1HDPA 1NK2P 1MBKA 3OOUA 3FIWA 2L0KA 3QQAA 4HNVA 2O7OA 3M4OJ 2Y30A 2Y2ZA 5EEAA 3JREA 5E3LA 4IHVA 1VFCA 4JX5A 2HXOA 2YU9J 3W6VA 3O8GA 5IP7J 1B8IB 3BR1A 4GFBA 4J19A 1X2NA 3RZDJ 1IG7A 2JA6J 2OF7A 1VI0A 2K9NA 1B72B 2AHQA 1O4XA 3HDDA 2FX0A 5F0HA 1JTYA 4D7MA 4A69C 2LY9A 2HYJA 3HKZN 1HDDC 1ETVA 5J1UA 3BR5A 1D5YA 4S0HB 5IOYA 3TW7A 3ZOBA 4BKXA 4MIMA 5EYRA 2RAEA 4AUXA 2KDZA 4MLOA 2Y9ZA 1PUFB 3LSJA 3S2HJ 1AHDP 2MSYA 1MSEC 4CYCB 4BY7J 1P7JA 5F04A 2JMWA 1B8IA 1GUUA 2M8GX 3I4MJ 3JRDA 4C3HJ 1XG1A 1JT0A 1MBHA 3O8HA 2TCTA 3H3VK 1TWHJ 2R0QC 3S1QJ 1RKTA 3BG5A 2B63J 3OSFA 1MH4A 3BT9A 4AYBN 3S17J 1HOMA 2IAIA 2NOGA 5M3FJ 1ORKA 4A3GJ 3QPLA 3BR6A 4RDUA 2JK3A 4LOCA 1E3OC 2HOAA 4RBOA 1BJZA 1Q1VA 2DA6A 1ETOA 2VKVA 3C2BA 4XRSG 4V2GA 4C3JJ 2R93J 2EZHA 3F0CA 5C3EJ 4QTRA 2DN0A 1PUFA 1HF0A 4Y7NJ 3ZQFA 5E3OA 1H89C 1FTZA 3NARA 4CYCA 1JKPC 4BBSJ 3IH2A 1Y1WJ 5BNGA 2XPWA 2GM4A 3RQIA 2DMQA 2X9DA 1JKQC 5EG0B 2R5YB 1W0UA 4C3IJ 1T33A 3A02A 1SFOJ 1OCTC 1XC5A 2M34A 2CQQA 5FJ8J 3BTIA 3CCYA 5C4JJ 3MN2A 2I10A 3ZQCA 2NVYJ 2JJ7A 5FKKA 2VKEA 3ZQHA 4B4CA 1W0TA 3E7LA 2NS8A 3BTLA 1OCPA 5EZHA 4NDLA 2D5VA 1QRYA 2FQ4A 3ZQLA 2KT0A 2E2IJ 2JN6A 1WCMJ 5FLVA 5JLWA 1ETQA 1H88C 1GV2A 3GBGA 2L9RA 5J3LA 2WB1N 1GDTA 3BTJA 1TC3C 1MH3A 2LP0A 1GV5A 2CU7A 2DA2A 2EBIA 3S14J 2ID6A 2ZB9A 1R9TJ 3TEDA 3OSGA 1AKHB 2EH3A 2K40A 4A3MJ 4IEJA 5EG0A 2K9SA 5FKMA 1WGXA 2DA4A 3DEWA 1HLVA 4V2FA 3S15J 3I4NJ 2DMNA 2XSDC 1NTCA 5IP6A 2FJ1A 3K7AJ 4A3KJ 3PO3J 1OJLA 4JX6A 5M5WJ 1F36A 2TRTA 1JUSA 2Y31A 2K9QA 1S7EA 4C2MJ 5F27A 1MBFA 3CMYA 1LE8B 3S16J 1FEXA 2PMZN 5FKLA 1ITYA 4W97A 1FIAA 1YRNA 2JA5J 3LSGA 2NVQJ 1JKRC 2MG4A 3GTPJ 2O9LA 2LK2A 1JKOC 3Q0VA 1FIPA 4UUSB 5F1JA 1A6IA 3GTKJ 4D5FA 1U78A 1MBJA 1WH7A 2R7ZJ 2Y9YA 1MBEA 3HOUJ 4BXXJ 5K7HA 4JYKA 3LSRA 4D7NA 2X6OA 3D1NI 1B72A 1H8AC 3NAUA 1POGA 2EZKA 1HCRA 1LFUP 2QF7A 2JA7J 3LNQA 3GTGJ 1ZTRA 2WV1A 3CDLA 2AO9A 1LE8A 5EGOB 3Q3SA 1Z0XA 4MFDA 3LSPA 2R5ZB 1MNMC 1U9NA 2XB5A 1BA5A 5IPAA 5F08A 3A01B 3UKGA 1QPIA 4A3DJ 1LFBA 4M3DA 3H0GJ 3L1PA 1JJ8C 2XGCA 2ECBA 2HOTA 2CUEA 4IHYA 3MKLA 1ETYA 1APLC 1IUFA 2XPVA 4MFEA 5DS9A 1WI3A 5IYBJ 2NVTJ 3BR2A 3JRFA 1IGNA 2W48A 1FJLA 4MO7A 5IOZA 1TWFJ 2CJJA 1OFCX 5C4XJ 3BR0A 2DJNA 1K83J 4BY1J 1IRZA 4L5EA 2XPUA 3CQZJ 3PO2J 2DMUA 3OIOA 4DYCA 2XRLA 2HQ5A 3BR3A 5F0FA 5IYDJ 1WPKA 3SJMA 2EQRA 4A3IJ 3SFIA 1GT0C 4A3FJ 1RR7A 5DTDA 5EGOA 2R5ZA 3FKIJ 4DYQA 2HDDA 2HI3A 1QVTA 2YUSA 3QPSA 2LLKA 1X58A 3HGYA 3HOWJ 4D5CA 2LD5A 3RKQA 5GPCA 5EDNA 2ME0A 2YS9A 1TWGJ 1SANA 5HODA 3HGGA 3G1OA 1Y1VJ 2EZIA 2M2EA 1ETWA 3FISA 4M3GA 5EF6A 2R92J 1ZR4A 1EF4A 5GPAA 3IH3A 4A3JJ 4QSHA 3GTOJ 4IHWA 2JWTA 1QVUA 4DW6A 4XRMA 4I6ZA 2R5YA 5K7FA 3BTCA 3K2AA 2EZLA 3TW6A 2IEKA 1BL0A 1CQTA 1I3QJ 3BQZA 3HM5A 2O8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D J;  1ZK8 A;  2DA7 A;  1X2M A;  3TP3 A;  1A5J A;  1JT6 A;  2CRG A;  5IYC J;  3JRA A;  1RPW A;  5M3M J;  5FKO A;  5C44 J;  2CUF A;  3VPR A;  3BG3 A;  1MSF C;  2G0E A;  1DU0 A;  2XGE A;  3M3Y J;  3Q0W A;  1P7I A;  3PM1 A;  1VF9 A;  3JRH A;  2DMT A;  5IP9 J;  4FCY A;  4ABZ A;  4DYR A;  3JRB A;  1FTT A;  2VPR A;  3HOX J;  2L7M P;  2ID3 A;  2LFB A;  3ZQG A;  1IJW C;  3S1M J;  4FIS A;  1ETK A;  2LVS A;  5K7Z A;  5E3N A;  3IV5 A;  2P81 A;  1AKH A;  4DZP A;  3IH4 A;  3HOY J;  3BG9 A;  4A93 J;  4G12 A;  1DU6 A;  5J1R A;  2ECC A;  5FLM J;  2JA8 J;  9ANT A;  1UG2 A;  1F43 A;  1RKW A;  4BBR J;  2LR8 A;  3DCF A;  4Y52 J;  2E19 A;  3BQY A;  2XB0 X;  1AU7 A;  4AC0 A;  1G2H A;  2NVX J;  4M3E A;  1IDY A;  1TWA J;  1ZKG A;  3JR9 A;  2X48 A;  3RZO J;  4A3C J;  2Y0S N;  1IV6 A;  5E3M A;  4JX4 A;  2LKX A;  3S1N J;  2CQX A;  1ZR2 A;  1GVD A;  3G1M A;  4W1U A;  4B1R A;  5EZG A;  2QCO A;  1ETX A;  1U9O A;  1ZQ3 P;  3HB9 A;  3B6A A;  5J1Y A;  1RES A;  4XID A;  4A3L J;  1K61 A;  5FKN A;  4JP0 A;  3SDG A;  2DMP A;  5GP9 A;  3GTJ J;  4UUS A;  2DA3 A;  2H8R A;  5F0C A;  1ENH A;  1VND A;  4XIC A;  3HOV J;  2COB A;  2DA5 A;  1NK3 P;  4X1E A;  3TP0 A;  3GTM J;  2E2H J;  1I6H J;  2FD5 A;  1BW6 A;  3ZQI A;  2IBD A;  2GBY A;  2ME6 A;  3LOC A;  1JJ6 C;  1JUP A;  4I76 A;  1WH5 A;  4QIW N;  3JRC A;  2OPT A;  1BW5 A;  2M0C A;  2ELK A;  1XS9 A;  3WHB A;  4A3B J;  3HBL A;  1U8B A;  3MVP A;  1IC8 A;  2L7Z A;  4B3A A;  4A3E J;  2HXI A;  3FK7 A;  3A01 A;  2VUM J;  4EEF G;  2VI6 A;  4FTH A;  1JGG A;  5M5X J;  5JLX A;  4XRS A;  2E1O A;  3JRG A;  1IDZ A;  4UUT A;  3B6C A;  2L7F P;  4M3F A;  3G1L A;  3GTL J;  1MBG A;  2GLO A;  2NS7 A;  2DA1 A;  1JUM A;  2MW8 A;  4XK4 A;  3S1R J;  4M6V A;  4X6A J;  3HEF A;  2H1K A;  2M9H A;  2DTZ A;  2HOS A;  3JRI A;  3FK6 A;  4DZJ A;  4FE7 A;  1JTX A;  1T56 A;  5M5Y J;  1RET A;  1UHS A;  2WAQ N;  1YRN B;  4IHX A;  4M3B A;  3Q0U A;  2LTP A;  1TWC J;  2XGD A;  3GTQ J;  2MGQ A;  2N8G A;  1UMQ A;  3A03 A;  3WHC A;  1ZGW A;  4FE4 A;  1Z77 A;  1I50 J;  3HOZ J;  2E2J J;  1HDP A;  1NK2 P;  1MBK A;  3OOU A;  3FIW A;  2L0K A;  3QQA A;  4HNV A;  2O7O A;  3M4O J;  2Y30 A;  2Y2Z A;  5EEA A;  3JRE A;  5E3L A;  4IHV A;  1VFC A;  4JX5 A;  2HXO A;  2YU9 J;  3W6V A;  3O8G A;  5IP7 J;  1B8I B;  3BR1 A;  4GFB A;  4J19 A;  1X2N A;  3RZD J;  1IG7 A;  2JA6 J;  2OF7 A;  1VI0 A;  2K9N A;  1B72 B;  2AHQ A;  1O4X A;  3HDD A;  2FX0 A;  5F0H A;  1JTY A;  4D7M A;  4A69 C;  2LY9 A;  2HYJ A;  3HKZ N;  1HDD C;  1ETV A;  5J1U A;  3BR5 A;  1D5Y A;  4S0H B;  5IOY A;  3TW7 A;  3ZOB A;  4BKX A;  4MIM A;  5EYR A;  2RAE A;  4AUX A;  2KDZ A;  4MLO A;  2Y9Z A;  1PUF B;  3LSJ A;  3S2H J;  1AHD P;  2MSY A;  1MSE C;  4CYC B;  4BY7 J;  1P7J A;  5F04 A;  2JMW A;  1B8I A;  1GUU A;  2M8G X;  3I4M J;  3JRD A;  4C3H J;  1XG1 A;  1JT0 A;  1MBH A;  3O8H A;  2TCT A;  3H3V K;  1TWH J;  2R0Q C;  3S1Q J;  1RKT A;  3BG5 A;  2B63 J;  3OSF A;  1MH4 A;  3BT9 A;  4AYB N;  3S17 J;  1HOM A;  2IAI A;  2NOG A;  5M3F J;  1ORK A;  4A3G J;  3QPL A;  3BR6 A;  4RDU A;  2JK3 A;  4LOC A;  1E3O C;  2HOA A;  4RBO A;  1BJZ A;  1Q1V A;  2DA6 A;  1ETO A;  2VKV A;  3C2B A;  4XRS G;  4V2G A;  4C3J J;  2R93 J;  2EZH A;  3F0C A;  5C3E J;  4QTR A;  2DN0 A;  1PUF A;  1HF0 A;  4Y7N J;  3ZQF A;  5E3O A;  1H89 C;  1FTZ A;  3NAR A;  4CYC A;  1JKP C;  4BBS J;  3IH2 A;  1Y1W J;  5BNG A;  2XPW A;  2GM4 A;  3RQI A;  2DMQ A;  2X9D A;  1JKQ C;  5EG0 B;  2R5Y B;  1W0U A;  4C3I J;  1T33 A;  3A02 A;  1SFO J;  1OCT C;  1XC5 A;  2M34 A;  2CQQ A;  5FJ8 J;  3BTI A;  3CCY A;  5C4J J;  3MN2 A;  2I10 A;  3ZQC A;  2NVY J;  2JJ7 A;  5FKK A;  2VKE A;  3ZQH A;  4B4C A;  1W0T A;  3E7L A;  2NS8 A;  3BTL A;  1OCP A;  5EZH A;  4NDL A;  2D5V A;  1QRY A;  2FQ4 A;  3ZQL A;  2KT0 A;  2E2I J;  2JN6 A;  1WCM J;  5FLV A;  5JLW A;  1ETQ A;  1H88 C;  1GV2 A;  3GBG A;  2L9R A;  5J3L A;  2WB1 N;  1GDT A;  3BTJ A;  1TC3 C;  1MH3 A;  2LP0 A;  1GV5 A;  2CU7 A;  2DA2 A;  2EBI A;  3S14 J;  2ID6 A;  2ZB9 A;  1R9T J;  3TED A;  3OSG A;  1AKH B;  2EH3 A;  2K40 A;  4A3M J;  4IEJ A;  5EG0 A;  2K9S A;  5FKM A;  1WGX A;  2DA4 A;  3DEW A;  1HLV A;  4V2F A;  3S15 J;  3I4N J;  2DMN A;  2XSD C;  1NTC A;  5IP6 A;  2FJ1 A;  3K7A J;  4A3K J;  3PO3 J;  1OJL A;  4JX6 A;  5M5W J;  1F36 A;  2TRT A;  1JUS A;  2Y31 A;  2K9Q A;  1S7E A;  4C2M J;  5F27 A;  1MBF A;  3CMY A;  1LE8 B;  3S16 J;  1FEX A;  2PMZ N;  5FKL A;  1ITY A;  4W97 A;  1FIA A;  1YRN A;  2JA5 J;  3LSG A;  2NVQ J;  1JKR C;  2MG4 A;  3GTP J;  2O9L A;  2LK2 A;  1JKO C;  3Q0V A;  1FIP A;  4UUS B;  5F1J A;  1A6I A;  3GTK J;  4D5F A;  1U78 A;  1MBJ A;  1WH7 A;  2R7Z J;  2Y9Y A;  1MBE A;  3HOU J;  4BXX J;  5K7H A;  4JYK A;  3LSR A;  4D7N A;  2X6O A;  3D1N I;  1B72 A;  1H8A C;  3NAU A;  1POG A;  2EZK A;  1HCR A;  1LFU P;  2QF7 A;  2JA7 J;  3LNQ A;  3GTG J;  1ZTR A;  2WV1 A;  3CDL A;  2AO9 A;  1LE8 A;  5EGO B;  3Q3S A;  1Z0X A;  4MFD A;  3LSP A;  2R5Z B;  1MNM C;  1U9N A;  2XB5 A;  1BA5 A;  5IPA A;  5F08 A;  3A01 B;  3UKG A;  1QPI A;  4A3D J;  1LFB A;  4M3D A;  3H0G J;  3L1P A;  1JJ8 C;  2XGC A;  2ECB A;  2HOT A;  2CUE A;  4IHY A;  3MKL A;  1ETY A;  1APL C;  1IUF A;  2XPV A;  4MFE A;  5DS9 A;  1WI3 A;  5IYB J;  2NVT J;  3BR2 A;  3JRF A;  1IGN A;  2W48 A;  1FJL A;  4MO7 A;  5IOZ A;  1TWF J;  2CJJ A;  1OFC X;  5C4X J;  3BR0 A;  2DJN A;  1K83 J;  4BY1 J;  1IRZ A;  4L5E A;  2XPU A;  3CQZ J;  3PO2 J;  2DMU A;  3OIO A;  4DYC A;  2XRL A;  2HQ5 A;  3BR3 A;  5F0F A;  5IYD J;  1WPK A;  3SJM A;  2EQR A;  4A3I J;  3SFI A;  1GT0 C;  4A3F J;  1RR7 A;  5DTD A;  5EGO A;  2R5Z A;  3FKI J;  4DYQ A;  2HDD A;  2HI3 A;  1QVT A;  2YUS A;  3QPS A;  2LLK A;  1X58 A;  3HGY A;  3HOW J;  4D5C A;  2LD5 A;  3RKQ A;  5GPC A;  5EDN A;  2ME0 A;  2YS9 A;  1TWG J;  1SAN A;  5HOD A;  3HGG A;  3G1O A;  1Y1V J;  2EZI A;  2M2E A;  1ETW A;  3FIS A;  4M3G A;  5EF6 A;  2R92 J;  1ZR4 A;  1EF4 A;  5GPA A;  3IH3 A;  4A3J J;  4QSH A;  3GTO J;  4IHW A;  2JWT A;  1QVU A;  4DW6 A;  4XRM A;  4I6Z A;  2R5Y A;  5K7F A;  3BTC A;  3K2A A;  2EZL A;  3TW6 A;  2IEK A;  1BL0 A;  1CQT A;  1I3Q J;  3BQZ A;  3HM5 A;  2O8K A; 
#chains in the Genus database with same CATH topology
 2ZJQ F;  5J40 A;  3S2D J;  1ZK8 A;  2DQR A;  3DTK A;  4F92 B;  2CRG A;  4ZTF A;  2CUF A;  4L5I A;  3WGG A;  1REP C;  4LD5 A;  4BJ5 C;  1MZB A;  2GXG A;  1TQI A;  1MMG A;  5D6F A;  1DU0 A;  3MCZ A;  2DT7 B;  2XGE A;  5TJJ A;  5L3E A;  2HEO A;  5DCM A;  1P7I A;  3PM1 A;  4LG0 B;  2M7B A;  2DMT A;  3F8F A;  4I99 C;  2E5Z A;  2ISY A;  3FM5 A;  4LFU A;  3JRB A;  2E7W A;  3BC8 A;  2VPR A;  2BW3 B;  3QPH A;  3FXL A;  3ZQG A;  1K7A A;  3S1M J;  5B66 C;  1ETK A;  5K7Z A;  5JVG F;  2IA0 A;  3ISP A;  3N97 A;  1HKQ A;  3HPG A;  1X4O A;  1DU6 A;  5CQE A;  1MJA A;  2OAZ A;  2PJR B;  4XOT A;  1TLH B;  1UG2 A;  4RS8 A;  4QPO A;  1SFK A;  1LFP A;  3TOB A;  5EEH A;  1RKW A;  4BBR J;  1L3L A;  2KDO A;  2Y75 A;  2LR8 A;  4Y52 J;  3TBI A;  1SD4 A;  3K4N A;  3D5L A;  1OLT A;  1AU7 A;  2HS5 A;  2DFE A;  2NVX J;  4PJJ A;  4M3E A;  2V26 A;  1PUE E;  1ZKG A;  3RZO J;  2HOE A;  3H1C A;  2Y0S N;  1IV6 A;  2F4O B;  2RVC A;  1GVJ A;  2ZCW A;  2VLA A;  1ZR2 A;  4W1U A;  5EZG A;  1RRJ A;  1T08 B;  1UHM A;  2QQ8 A;  3HB9 A;  2JVG A;  5FKN A;  4JP0 A;  4L5J A;  1UJ8 A;  2WTE A;  4UUS A;  4B09 A;  5F0C A;  2CYY A;  4XIC A;  5EEG A;  2VQG A;  3WGH A;  2E2H J;  2QM3 A;  2W85 A;  3TMO A;  1P9Q C;  2LSO A;  2DJI A;  4YFX F;  2ADU A;  2CO5 A;  3F8B A;  2L9V A;  2M45 A;  1JUP A;  5JHU A;  1ZLK A;  1Z67 A;  3JRC A;  1P92 A;  3E5U A;  5HLT A;  4RB0 A;  5H2F C;  3OYK A;  4YG2 F;  3KIO A;  1Z3X A;  1MND A;  3KYC B;  2K02 A;  1YJW I;  3M8E A;  4A3E J;  1IW7 F;  4LIT A;  3A01 A;  4I7H A;  2P8T A;  2VE9 A;  1OR7 A;  3OR1 C;  5ICG A;  4RAG A;  1ZYR F;  1XMX A;  1CF7 A;  2DQL A;  4F3Q A;  3JRG A;  1IDZ A;  3DWL E;  2IVM A;  4XKW A;  3GTL J;  1MBG A;  2GLO A;  2BVL A;  2QWW A;  2ELJ A;  1ZGJ A;  2MW8 A;  3U2R A;  5HDK A;  4AM3 A;  1VQ9 I;  3DBR B;  5GAE J;  1VQ7 I;  2A5Y B;  4PK4 A;  3VSK A;  2K9L A;  4OOI A;  2UXN A;  4IVN A;  3C18 A;  2HU9 A;  5E18 F;  1EH6 A;  2X4H A;  1AA7 A;  3DEE A;  3MFK A;  1T56 A;  2XAU A;  2A05 A;  4U88 A;  5HDG A;  4CCO A;  4IHX A;  2LTP A;  2XGD A;  5FO5 A;  2MGQ A;  2N8G A;  6PAX A;  5K5Q A;  4FE4 A;  3OWT A;  4ESJ A;  1MBK A;  3N4M A;  4ZDL A;  3GX4 X;  3QQA A;  1T8I A;  2Y30 A;  3WTX C;  3F6O A;  2B0L A;  2F5C A;  3JRE A;  5HS8 A;  4JX5 A;  4IOA F;  2XUB A;  5FLX Z;  1O7L A;  3O8G A;  4B43 A;  1Z05 A;  2P6T A;  1S7O A;  3DFG A;  5EJC A;  5IP7 J;  3IKT A;  2VT2 A;  1B8I B;  3ZRG A;  1L0O C;  4Z6Y A;  3FKJ A;  1A36 A;  1X2N A;  3ZCO A;  1VI0 A;  2Y0M A;  1TNT A;  2K9N A;  3OL4 A;  1Z9C A;  3HDD A;  2VN2 A;  4BH9 A;  2VC1 A;  3TO9 A;  2OA4 A;  1FYM A;  1SMY F;  1ON1 A;  4F93 B;  2M0M A;  3MZY A;  3V8K A;  5A2Q K;  2LY9 A;  3HKZ N;  2A6E F;  4N4N B;  3CCE I;  1OCC H;  2UUZ A;  3H9Q A;  5LRR A;  3U1D A;  4NHJ A;  4HA8 A;  2X0L A;  2KJB A;  3L00 A;  4J00 A;  1D5Y A;  3H5R A;  4S0H B;  5IOY A;  3EET A;  2DOE A;  2LY2 A;  3AG3 H;  3GLX A;  1W5S A;  4MIM A;  3PSF A;  4BKX A;  2R7U A;  2R7T A;  2RAE A;  5LEJ A;  3EUA A;  2A3S A;  4KUM A;  1X3U A;  3WG9 A;  3S2H J;  4A5M A;  1X19 A;  5KK1 A;  3I5U A;  3SZT A;  3CC7 I;  5HS7 A;  4BY7 J;  2CS3 A;  1P7J A;  2KP6 A;  3KP4 A;  3QOE A;  4BXU A;  1FX7 A;  4RLQ A;  4A6E A;  3LQQ A;  3ROU A;  4WCG A;  1RUO A;  2KZG A;  2VQL A;  3E6B A;  1S9H A;  1TL8 A;  2VBX A;  1DQU A;  1W7P B;  1HA8 A;  4CO8 A;  3B02 A;  2ESN A;  1QQI A;  1VQN I;  1MBH A;  1PVE A;  3BOQ A;  4UB8 C;  2JA2 A;  3SZG A;  3H3V K;  1TNS A;  2WB1 A;  1R5G A;  4EJT A;  2B63 J;  3OSF A;  3ZGK A;  1W4M A;  3S17 J;  2NOG A;  4YIR X;  3CCR I;  5M3F J;  4DQ2 A;  3QPL A;  3DU5 A;  1HBX G;  3J81 Z;  5GAD J;  3FHZ A;  3H3Z A;  4CHU A;  4Q4Z F;  4KN7 X;  1WI9 A;  2ZJ2 A;  4HRI A;  3C2B A;  4XRS G;  1IRX A;  4V2G A;  4C3J J;  2R93 J;  3AL0 C;  1K6Y A;  2F4M B;  2HYG D;  3ZMS A;  3T8T A;  5C3E J;  2V1X A;  1LEA A;  3E3V A;  3T0Y A;  1ACI A;  2QBY A;  4ENN A;  4FX0 A;  1ZRE A;  3ZQF A;  1I6X A;  4CYC A;  2FEZ A;  5KVR A;  4PSW A;  3OYB A;  2OTL I;  3IKV A;  3HXL A;  4RAY A;  1Y1W J;  4KIF A;  2XPW A;  3RQI A;  3SEQ A;  2D1H A;  2PMZ A;  3FXM A;  1JKQ C;  1J0R A;  2K85 A;  3GFI A;  1IXC A;  4C3I J;  3EUK L;  1J75 A;  1SFE A;  2FQ3 A;  2NAZ A;  1OCT C;  2A61 A;  3WE2 A;  3G71 I;  1ZG3 A;  3L2Q A;  5JVT A;  5FJ8 J;  2DYR H;  2CQQ A;  5K5R A;  3BTI A;  1IN5 A;  2HR3 A;  3MN2 A;  5C4J J;  1USS A;  3ZQC A;  1SAX A;  2VKH A;  2O6G E;  4AID A;  4KFC A;  2NVY J;  1KU9 A;  2JJ7 A;  3H9G A;  1W0T A;  1K6O A;  1B6A A;  3K6G A;  4KA4 A;  2R7R A;  1XGO A;  2FQ4 A;  4B48 A;  2YR2 A;  3ZQL A;  2W82 A;  2FF4 A;  2ESH A;  5ILU A;  1VQ6 I;  2G9W A;  2EK5 A;  5BMZ A;  4UUV A;  4L0Y B;  3HUG A;  1ETQ A;  2RNG A;  5DCM B;  2EFP A;  4D0P A;  1GV2 A;  2STW A;  4L9J A;  4ZTJ A;  3F22 A;  3C2H A;  1ZEL A;  3BZK A;  3PIP F;  4YEL A;  1GV5 A;  5KCM A;  3DTE A;  3RPQ A;  3S14 J;  2ID6 A;  2ZB9 A;  4XLP F;  4P1W A;  2QEX I;  3DF8 A;  3ECO A;  1P4W A;  1J59 A;  2EH3 A;  2K27 A;  3WE3 A;  3LAP A;  4IEJ A;  3CME I;  3ASO H;  4CSW A;  2K9S A;  5DM6 F;  2ZXI A;  2JPB A;  2R3S A;  2DA4 A;  3AG4 H;  1HLV A;  2DFI A;  3I4N J;  2MH9 A;  2WC2 A;  3PFI A;  1ODD A;  3OYJ A;  1X1C A;  4M9Z A;  5CKT A;  4I0B A;  5IP6 A;  1MJ9 A;  2GOX B;  3KEQ A;  2VAS A;  4FQG A;  3SQN A;  3PO3 J;  5M5W J;  2LRD A;  2TRT A;  5F27 A;  2Q8K A;  4ZYE A;  3CMY A;  1K78 B;  1LEB A;  4G8X A;  4G6Q A;  1VQK I;  4BJT A;  1O3S A;  1OYY A;  4ZJZ A;  2YX4 A;  2HZD A;  5TGT A;  5E1Z B;  2IA2 A;  4ZC3 A;  2NVQ J;  3OMY A;  2FOW A;  1XPX A;  4BAY A;  4Y15 A;  4UUS B;  5F1J A;  3K9T A;  2ZNZ A;  2GAU A;  2ZSI B;  2DLL A;  2DPU A;  1Z91 A;  2BV6 A;  4PJL A;  4A2U A;  3CMA I;  1JGS A;  2QSG X;  3TOA A;  1WH7 A;  4HX8 A;  3P5J A;  5HNH A;  2ZSH B;  2X6W A;  2Y9Y A;  2E34 A;  3M1C A;  5HLI A;  3F8M A;  3FMS A;  1HXD A;  5L3D A;  5K7H A;  3LSR A;  1RNL A;  2JT1 A;  1TW2 A;  3D1N I;  5BS6 A;  2X1C A;  5TRD A;  3NAU A;  4LB6 B;  1POG A;  3C7J A;  2Y48 A;  5LRS A;  3OL3 A;  3GTG J;  4BDZ A;  2KJC A;  1N77 A;  2KIU A;  4U0W A;  1E2X A;  5EGO B;  4J01 A;  4MFD A;  2R5Z B;  3DQV C;  3A01 B;  3UKG A;  4P96 A;  4UVA A;  4A3D J;  2QKL B;  3H0G J;  4E7J A;  1CF7 B;  2CUE A;  1O7F A;  2HVQ A;  3W6J B;  4KYW A;  5H6Q A;  1LVK A;  1FYK A;  2HDC A;  3PL8 A;  2YSR A;  4Q48 A;  1I39 A;  3FBN B;  4MFE A;  5DD8 A;  4EMS A;  5IYB J;  3SYT A;  5LHG A;  4QLC U;  3RDI A;  1G8X A;  4HST A;  3HSE A;  3REO A;  1MW7 A;  2W48 A;  1WKM A;  4A0Z A;  5IOZ A;  3GLL A;  2LYC A;  3BR0 A;  3WU0 A;  1K83 J;  2ZME C;  2X6X A;  4OMZ A;  4L5E A;  3CCJ I;  2TDX A;  3CQZ J;  3K1M A;  1BIB A;  3OIO A;  2ZKZ A;  3AAF A;  3BP8 A;  3D5R C;  4CCK A;  1H9G A;  2HQ5 A;  1SD6 A;  5F0F A;  2XSJ C;  1ZAO A;  2WY8 Q;  3WTT C;  3OYC A;  3SJM A;  4HF2 A;  4XKB A;  3SFI A;  2A69 F;  5DTD A;  1LVA A;  4YFN F;  4HX4 A;  4DYQ A;  2HI3 A;  3E97 A;  3R61 A;  2XAQ A;  2W1O A;  1QO0 D;  3N05 A;  3QOP A;  4D5C A;  4Q47 A;  2LD5 A;  2CQ7 A;  3CCU I;  4BAC A;  1BIA A;  5FD5 A;  2M2E A;  1ETW A;  4M3G A;  3IAS 2;  2KIF A;  2NOJ B;  5EF6 A;  3J7A Y;  1IF1 A;  3ZN1 A;  3GFJ A;  2F5E A;  5GPA A;  3IH3 A;  4UB6 C;  1GXP A;  4IHW A;  4N4O B;  2CQN A;  5DUK A;  4K2E A;  5FD6 A;  3ZP5 A;  2EB7 A;  1Z1D A;  2VBW A;  1D1A A;  4LIU A;  2H27 A;  4CCM A;  4MNU A;  4XLN F;  3R0A A;  4XM3 A;  3TW6 A;  2IEK A;  2AXT C;  2J5P A;  3HM5 A;  4BXX J;  2O8K A;  2Q1Z B;  5FRM A;  4BHB A;  2DA7 A;  1X2M A;  3TP3 A;  1A5J A;  3V8L A;  1JT6 A;  2YPR A;  2Z3Y A;  3VYU B;  2VT3 A;  5IYC J;  1PP7 U;  2XDV A;  1PP8 F;  3PJR A;  3VPR A;  4E4H A;  4RAF A;  1BI0 A;  2EWN A;  3H5N A;  2G0E A;  3MD2 A;  5HLH A;  4LMY A;  3JSO A;  3LAJ A;  1FBS A;  2DOA A;  3KZY A;  1IZ1 A;  4I01 A;  3OYD A;  4EGY A;  4NC8 A;  2M1B A;  3PUB A;  1I3A A;  2LY1 A;  5B1A H;  5IP9 J;  2STT A;  3ZMZ A;  4DYR A;  3ECH A;  5B3S H;  1PYV A;  2ID3 A;  2LFB A;  1BI1 A;  4HLY A;  3NWS A;  3ZPL A;  4FIS A;  1S6L A;  3R0J A;  1MMN A;  5E1X A;  3A0H C;  4KIS A;  1Y0N A;  1VQ8 I;  4DBQ A;  3CCM I;  3CF5 F;  1Q1H A;  4DJA A;  9ANT A;  1WJA A;  1A31 A;  2LG4 A;  1R1U A;  1E3H A;  1T95 A;  4BL0 B;  1QBJ A;  1ZRC A;  1X1A A;  1D8K A;  4HX7 A;  4L9N A;  3PNT A;  4B44 A;  2F4I A;  3DCF A;  2E19 A;  4AIH A;  1AOY A;  2QBY B;  3I59 A;  3CC2 I;  2EIK H;  5E1W A;  1RZ4 A;  2HYF A;  1TWA J;  2PMH A;  3JR9 A;  1YJN I;  4OIN F;  4GYG A;  5E3M A;  4XBF A;  4WXD A;  1I1G A;  4A6D A;  5E8G A;  1GVD A;  2D1V A;  4ZZD A;  2E35 A;  2D2W A;  3WOD F;  1U9O A;  3F3X A;  3I58 A;  1ZQ3 P;  3KP3 A;  3CDI A;  1B9M A;  4XID A;  4A3L J;  2ZXJ A;  1K61 A;  1ZAR A;  2HZT A;  1I27 A;  3ESW B;  3SDG A;  4I0A A;  5GP9 A;  3GTJ J;  3S3O A;  2DA3 A;  1ENH A;  2K3F A;  4XSX F;  2COB A;  4IJA A;  4CYD A;  3MKZ A;  4EM2 A;  1Z21 A;  1QZE A;  3GTM J;  1I6H J;  2IJL A;  1MMA A;  1BW6 A;  2BY1 A;  2IBD A;  2HNH A;  2VBY A;  3ZQI A;  1IAW A;  4XN3 A;  2DDB A;  2GBY A;  2L01 A;  4CZZ A;  4EM0 B;  4EQQ A;  1FYL A;  4MTD A;  1JJ6 C;  1R00 A;  3BCA A;  3HUG B;  4BNC A;  1FBU A;  1WH5 A;  2M0C A;  1UFM A;  4MQ9 F;  3CJR B;  1XS9 A;  2BY0 A;  4G9Y A;  4A3B J;  1FOX A;  1JHF A;  3I9V 2;  1U8B A;  1Y0U A;  4RB3 C;  2L7Z A;  4B3A A;  1NG7 A;  2HXI A;  3FK7 A;  2OJE D;  3TDZ C;  1IO2 A;  1EA3 A;  4EEF G;  1F5T A;  1KU7 A;  1G3W A;  1DGW Y;  1Z6T A;  3B6C A;  2L7F P;  4ESF A;  2HQA A;  3K4B A;  3G1L A;  1E17 A;  3OIQ A;  1TW3 A;  4ZDO A;  2DA1 A;  3CLO A;  3I53 A;  3FWE A;  1MNE A;  2X1E A;  2LKS A;  3SHF A;  4X6A J;  4M6V A;  3HEF A;  2V1U A;  2H1K A;  3HOT A;  2DTZ A;  2HOS A;  3JRI A;  3ERE D;  1JE8 A;  4DZJ A;  2QYO A;  4FE7 A;  1UAA A;  2R7Q A;  2VJI A;  4BEH A;  1RET A;  1T98 A;  1UHS A;  3HOS A;  2FBK A;  3BLY A;  5LEK A;  2ZFW A;  4OMY A;  3A03 A;  2XC7 A;  3L09 A;  2VOO A;  3L2C A;  4AYB A;  1I50 J;  3HOZ J;  4D1Q A;  5JHF A;  2E2J J;  1HDP A;  3OOU A;  3C1D A;  4HNV A;  2O7O A;  3M4O J;  2Y2Z A;  3D0S A;  2EIM H;  1FBQ A;  1XB4 A;  4KDP A;  2F48 A;  3RKY A;  2P7C B;  3CJQ B;  2YU9 J;  3KPH A;  3M07 A;  3BPV A;  1X1P A;  2PMU A;  1V55 H;  1Y8R B;  4BQQ A;  4CH7 A;  4NB5 A;  4HOB A;  2EV6 A;  2W7N A;  2E5N A;  3OS0 A;  2V6E A;  2K86 A;  4IRI A;  2E71 A;  1JTY A;  3OYE A;  1R4N B;  2HYJ A;  1HDD C;  3BCB A;  5KAF C;  2BBY A;  1YQA A;  2PJP A;  1HKS A;  1XSV A;  5LBQ A;  2L7K A;  3MKW B;  5J1U A;  2FRH A;  3TO7 A;  3DP7 A;  4I98 B;  4N9I A;  2M5W A;  3KLO A;  3BR5 A;  2KFD A;  3NEU A;  3ZOB A;  5LHI A;  1FC3 A;  4AUX A;  2DK8 A;  2VXD A;  1YX5 A;  1PUF B;  3KP7 A;  2H6B A;  3HZJ A;  1AHD P;  3O6B B;  3GW2 A;  1E3P A;  5F04 A;  2JMW A;  4YII A;  2PEX A;  2XV4 S;  3IUO A;  5BPI A;  1YG2 A;  3AL0 B;  2KL4 A;  3KP2 A;  2GA2 A;  4RB2 C;  3IP4 B;  2W84 A;  2M4K A;  5K1Y A;  3J80 K;  3MZ8 A;  4RM3 A;  3V7R A;  1QU3 A;  1UZC A;  2F5V A;  4A12 A;  1O3R A;  1RKT A;  3BG5 A;  4F52 A;  3BT9 A;  1HOM A;  3OIP A;  2IAI A;  4HQM A;  2VQC A;  3OYG A;  3DLL F;  1ORK A;  2WAE A;  3W3C A;  4LGW A;  1J2X A;  3F72 A;  1FP1 D;  1F9N A;  1P2F A;  2QKM B;  1BJZ A;  3L2U A;  2JUC A;  1ETO A;  1RR8 C;  3H3U A;  4L18 B;  5F6F A;  2XIG A;  1O3T A;  4M9S A;  3ZXS A;  2BHY A;  4MQV A;  4QTR A;  4GDF A;  3ASN H;  1D1C A;  1Y8Q B;  3GZ6 A;  4E7L A;  1HW5 A;  1FP2 A;  2UV1 A;  5E3O A;  1H89 C;  1I5Z A;  2KIQ A;  4BBS J;  4IO9 F;  2IGN A;  2GM4 A;  2DMQ A;  4R79 A;  2Z33 A;  2CSO A;  4MGR A;  3LL7 A;  3IWZ A;  2X9D A;  3QU6 A;  5CVJ A;  5EG0 B;  3KYL A;  1W0U A;  4UNO A;  5DEQ A;  1T33 A;  3LST A;  1HW1 A;  3KE2 A;  4ZH4 F;  2VKD A;  1SFO J;  3BG6 A;  2LNB A;  1ZRF A;  3CUO A;  4M6X A;  3V7S A;  1KQ9 A;  2R7F A;  2I10 A;  3E1S A;  2G7U A;  2OQR A;  4B4C A;  3F6V A;  3ZQH A;  3K70 D;  1MDM A;  2NS8 A;  4FX4 A;  1OCP A;  2V79 A;  1OQY A;  4NDL A;  5IY5 H;  3OYH A;  2CW8 A;  4HQE A;  1WFX A;  2D5V A;  3ZMD A;  1O3Q A;  4IHT A;  4GCV A;  1WCM J;  2LBF A;  3ABL H;  3A2K A;  2Z99 A;  2ZXW H;  1WJF A;  4BE2 A;  2DYS H;  2R7O A;  1H88 C;  2NVU B;  4DIQ A;  2JSP A;  1YW7 A;  2L9R A;  3IRR A;  1GDT A;  2WB1 N;  2VQH A;  3S8P A;  5E17 F;  4ENM A;  4RMN A;  1W5C C;  2HQR A;  1R9T J;  4ZYD A;  2Y0S A;  2JSC A;  5HS9 A;  1DGR M;  4E7H A;  4A3M J;  4ZYA A;  4YRV A;  2GIZ A;  3ZR8 X;  3DEW A;  2FSW A;  2FU4 A;  2DMN A;  3BJA A;  1G3T A;  2GA1 A;  2DFF A;  2HPM A;  1R7J A;  3E0J B;  2GIV A;  1G4D A;  2CW0 F;  4C2T A;  2Y31 A;  2HKX A;  3LSH A;  4YEJ A;  2M3A A;  4DGW B;  2ISZ A;  2H1L A;  1XX5 A;  1LE8 B;  5E8I A;  2I8D A;  2RNJ A;  1OIS A;  3WTW C;  2PMZ N;  2OCC H;  3COA C;  5HLG A;  1V5E A;  1X1B A;  2ZFU A;  3GFM A;  5DM7 F;  1YRN A;  3LSG A;  1KQ0 A;  4ANJ A;  2MG4 A;  1JKR C;  3GTP J;  2ETH A;  1JKO C;  5CVV A;  1ZG1 A;  1ZGA A;  3Q0V A;  1LDK B;  5CVU A;  3IWF A;  3QPT A;  1GXQ A;  2FNA A;  1BM9 A;  1WSU A;  2PBI A;  1MBJ A;  2DT6 A;  3QRF F;  2R7Z J;  2V9P A;  4RA2 A;  4BU2 A;  1MBE A;  1SEU A;  4NQW A;  2VOD A;  3HOU J;  5GAG J;  4E70 A;  1LPQ A;  3BDD A;  3GF2 A;  2MYS A;  4JYK A;  2K7L A;  3PSI A;  1ZRD A;  3ZQ7 A;  3DKY A;  2V9V A;  4KT6 A;  1B72 A;  5DV5 A;  3E5X A;  3K4C A;  1BC8 C;  3BZ6 A;  1HCR A;  1KU3 A;  1TT0 A;  1UB9 A;  2QF7 A;  4HV5 A;  1LFU P;  4IZZ A;  2OTJ I;  3LNQ A;  3HC7 A;  2WV1 A;  3CDL A;  3NRV A;  3DLA A;  1K4T A;  2G7H A;  2ZME B;  1X1D A;  5ERI A;  5KHD A;  3LSP A;  1J9I A;  1EV7 A;  1MNM C;  4U7B A;  1FT9 A;  3W2V A;  3IHU A;  1A6Q A;  1LFB A;  4M3D A;  5DDG A;  4U87 A;  2XGC A;  3I0T A;  2AQE A;  2HOT A;  3QP6 A;  3JTH A;  1HC8 A;  3MKL A;  1LKX A;  1APL C;  4AWX B;  3CLQ A;  4U7D A;  1UEL B;  2NVT J;  3BPX A;  2ELH A;  3WTZ A;  4E6K G;  4N9H A;  4B8X A;  1FJL A;  2WAD A;  5C4X J;  2PI0 A;  1Y56 A;  3ABT A;  2DJN A;  4A0X A;  1KZH A;  3CZ6 A;  2XPU A;  4EAT A;  3PO2 J;  4C2U A;  3UNG C;  3H92 A;  4CCN A;  2Z2S B;  3JW4 A;  3M9A A;  4S05 A;  3WTU C;  2IT0 A;  4LIV A;  5D5V B;  2HTJ A;  1ZH5 A;  3ZQQ A;  5KAI C;  2FA5 A;  1OKR A;  2ICW G;  3FKI J;  5L3C A;  5AIP A;  2K9M A;  5CVR A;  1YIO A;  4HDV A;  3HOW J;  3H36 A;  4BJ6 C;  4L0Z B;  3CF2 A;  5GPC A;  3RQ4 A;  1SAN A;  2EZI A;  3TL4 X;  2R92 J;  1ZR4 A;  1EF4 A;  2GWR A;  3RKW A;  2Z9O A;  2RN7 A;  4BQN A;  3DBH B;  1FSE A;  1R4M B;  3PFY A;  1KYZ A;  4RGR A;  1XMK A;  1QVU A;  2L9S A;  1YI2 I;  4RGX A;  4OIO F;  2EV0 A;  4D9J A;  4XRM A;  5D5U B;  2PG4 A;  3BTC A;  2RQQ A;  3RI4 A;  1R5H A;  2VON A;  1P4A A;  2EZL A;  2CQK A;  1CQT A;  3BQZ A;  2EIL H;  3LWF A;  2OD5 A;  2BE5 F;  4BE0 A;  3QYB A;  4E7K A;  2EIN H;  4RGS A;  1B1B A;  1RPW A;  5M3M J;  5C44 J;  1V5G A;  2MFZ A;  1XDS A;  2QA4 I;  1LDD A;  2KMU A;  5K5O A;  1FMW A;  2E1M C;  3V7C A;  3M3Y J;  3W6K B;  3Q0W A;  3JRH A;  2KPM A;  3FM3 A;  2BZT A;  5CQG A;  4FCY A;  4ABZ A;  3LFK A;  3WU2 C;  2GQQ A;  4Y4R A;  3HOX J;  5LD2 C;  1FTT A;  2L7M P;  4NC6 A;  1W5T A;  3E6M A;  2HTS A;  3AG1 H;  4BXF A;  4II3 A;  1O57 A;  2PLY A;  2ZBK A;  2IS2 A;  2LVS A;  5E3N A;  3G3Z A;  1AKH A;  4DZP A;  2WBM A;  3HOY J;  3BG9 A;  2LDU A;  2R7S A;  2HWV A;  5J1R A;  4LJZ F;  2JRT A;  3MQ0 A;  4HAM A;  2IGK A;  3CD6 I;  2JA8 J;  2OCE A;  4QWQ A;  2VBZ A;  1F43 A;  3MMY B;  3CMM A;  1U6G A;  2K5C A;  2FOK A;  1EKE A;  2RGV A;  3OY9 A;  1MMS A;  2XB0 X;  4AC0 A;  4M74 A;  1BI3 A;  2OC6 A;  1IDY A;  4ZYH A;  2P5V A;  2X48 A;  4A3C J;  2R7V A;  4IXA A;  5J47 A;  2CQX A;  3G1M A;  1WWX A;  1D8J A;  3P9C A;  4LG0 A;  3IAM 2;  1D0Z A;  5E20 A;  1WRJ A;  4AIJ A;  2L02 A;  5J1Y A;  3CC4 I;  2FML A;  3HJE A;  3H35 A;  3OR2 C;  3PNY A;  4GYI A;  2BW3 A;  1U0J A;  4P9U A;  4N0B A;  1I1S A;  4I09 A;  1VND A;  3DU6 A;  3V8J A;  1LB2 A;  3RYP A;  1MDM B;  2V6C A;  2OQG A;  3S2W A;  4CCL A;  4XKV A;  2FUG 2;  3CP8 A;  1N78 A;  3S3M A;  3K4J A;  3KEY A;  4B3X A;  2LBF B;  1DP7 P;  2XF7 A;  3CCL I;  3LOC A;  1W36 C;  3PUF A;  2UZK A;  3GFL A;  4KJZ A;  4I76 A;  1R23 A;  4QIW N;  3OS2 A;  2DOD A;  5AON A;  4XLC A;  3VSL A;  2ELK A;  1STZ A;  2PFB A;  3MKY B;  1SFU A;  2BEO A;  2M4G A;  3HBL A;  4HNU A;  2OZU A;  1U2W A;  3BZC A;  3W2W A;  2BY3 A;  1IC8 A;  1MKM A;  5HVQ C;  2PX9 A;  1LDJ A;  1YX3 A;  1YS7 A;  1YW8 A;  4FTH A;  1JGG A;  3HTS B;  3CJT B;  1IV8 A;  1XCB A;  4YFK F;  4CDG A;  2RC4 A;  2E1O A;  3F9K A;  4BQO A;  4UUT A;  3T8R A;  3W2A A;  2V1N A;  3LQR A;  2QSF X;  1EH7 A;  1J09 A;  1JUM A;  3QU3 A;  2XVC A;  1SFX A;  2BHZ A;  1XSD A;  1MMD A;  2R7D A;  2BVM A;  1NH3 A;  1FWZ A;  4XK4 A;  1VQ4 I;  2M9H A;  3VDX A;  4Y13 A;  3ZMV A;  3KZI C;  4PZJ A;  4LG3 A;  2BOL A;  3OYF A;  4YIF A;  3TKY A;  1LUJ B;  3OYM A;  5J8C A;  2JRM A;  2WAQ N;  1YRN B;  5KNL A;  2EJR A;  1SD5 A;  2MAB A;  4M3B A;  2BY2 A;  2DCE A;  3BJ6 A;  3GTQ J;  5B1B H;  4G7H F;  2EFW A;  3WHC A;  1Z77 A;  1UCR A;  3WGI A;  4DOZ A;  5FRO A;  4RB1 A;  3FIW A;  2L0K A;  2X51 A;  5E3L A;  1A04 A;  4IHV A;  3FMQ A;  5ICE A;  1VFC A;  3FX3 A;  4MEY F;  2HXO A;  4IQ4 A;  3G2B A;  4HV6 A;  2W4S A;  3BR1 A;  1RUN A;  4GFB A;  1UST A;  3RZD J;  1IG7 A;  2JA6 J;  2OF7 A;  3RSN A;  4KIT B;  1YW9 A;  1XSX A;  2IP2 A;  1B72 B;  4RLF A;  5CLS A;  1O4X A;  2O0Y A;  1W36 D;  3BJO A;  2FX0 A;  5F0H A;  4G6T B;  4PFP A;  4D7M A;  4BGD A;  1W7P D;  4HPQ A;  3HHH A;  4HDU A;  4M72 A;  5ILV A;  1ETV A;  3CUQ C;  3LA3 A;  3U1K A;  2DT5 A;  3T1B A;  5CJ9 A;  1OCO H;  4ON0 A;  2CW7 A;  3DEU A;  4RAZ A;  3FXU A;  4BUP A;  2ACJ A;  1XD7 A;  4LK1 F;  2JTV A;  3TQN A;  1WJE A;  1NHA A;  4MLO A;  2Y9Z A;  1YYV A;  4ITV A;  2P5L C;  1FMV A;  3UR3 C;  3TGN A;  2RV8 A;  2L5Q A;  2MSY A;  1MSE C;  4CYC B;  1D3Y A;  3KX2 A;  3OYL A;  2A6H F;  5A2Q Z;  1BOB A;  2MLG A;  1FZP B;  4BS9 A;  4WF2 A;  2GXB A;  4IX7 A;  1B8I A;  1XDU A;  3PIO F;  4IQJ A;  2M8G X;  1LQ1 A;  1LNW A;  4WWC A;  2LOO A;  3JRD A;  2CUJ A;  5JR3 A;  1VQ5 I;  2H8W A;  2CFO A;  4EV0 A;  3K4K A;  3LSK A;  3ZN0 A;  2O61 A;  1TWH J;  2R0Q C;  1MH4 A;  4EVI A;  4AYB N;  4OIP F;  2CGP A;  3TO6 A;  1H9T A;  5F1R A;  2DAO A;  3GO5 A;  2KRC A;  3S32 A;  3BR6 A;  5IT3 A;  4RDU A;  2IA1 A;  4LOC A;  1U8R A;  1E3O C;  3I56 I;  2HOA A;  4RBO A;  1MD0 A;  2D45 A;  3QWL A;  4XNF A;  1WVR A;  2DA6 A;  4XQF A;  2KRH A;  1QNT A;  2QUF A;  2ZO4 A;  2WA0 A;  2DU9 A;  3F0C A;  4JOM A;  4PGH A;  5H6R A;  2R7X A;  2DN0 A;  5LGN A;  2QSH X;  5LLQ A;  2Q2E A;  4Y7N J;  1D0X A;  3MEX A;  1FTZ A;  2E1N A;  3NAR A;  1UHW A;  1JKP C;  4NNJ A;  2WAF A;  2KHM A;  5BQT A;  3IH2 A;  4UV9 A;  1QZY A;  4PFO A;  1W7P A;  4UVC A;  1K79 A;  2VJ4 A;  3B73 A;  3OS1 A;  3A02 A;  2F6C A;  3HRS A;  2VPL A;  4EJU A;  2E60 A;  1P4X A;  4CXF A;  3IRQ A;  1XC5 A;  2M34 A;  3ONQ A;  3OOP A;  4NC7 A;  2NNY A;  2EFO A;  2VKE A;  3SXY A;  3E7L A;  3ELK A;  1HQC A;  5EZH A;  1JHH A;  5FFZ A;  2HDW A;  1WJ5 A;  4M71 A;  1QRY A;  3EUH A;  2JN6 A;  2BXZ A;  4EGZ A;  3IL2 A;  2HVR A;  5FLV A;  3OYN A;  5JLW A;  3W6V A;  2K4J A;  4OU0 A;  1TQM A;  3C3W A;  3X2Q H;  2CV0 A;  1U3E M;  1QHH D;  1LJ9 A;  1QZZ A;  3GBG A;  4G7Z F;  3GCM A;  2VXZ A;  4P55 A;  1MH3 A;  1SVM A;  5GAH J;  2LP0 A;  3ULQ B;  3QYF A;  2EBI A;  2WV0 A;  1V5F A;  1G6N A;  3TED A;  5FGM A;  3OSG A;  1AKH B;  2IW5 A;  3ERM A;  3DXJ F;  3I4P A;  4BE1 A;  3EDP A;  5FRN A;  3CP2 A;  1DP3 A;  5FKM A;  4XLA A;  4V2F A;  4U0V A;  1IN6 A;  1BBY A;  1NTC A;  2B7E A;  2FE3 A;  1X3Z B;  1YFH A;  4AD9 A;  2FJ1 A;  3I54 A;  2FXA A;  1OJL A;  1F36 A;  2LKP A;  3NQO A;  1JUS A;  4R8H A;  1TP4 A;  2K9Q A;  4C2M J;  1ERD A;  3ML6 A;  1MBF A;  1ULY A;  3EQL F;  3VEP A;  2IGO A;  3S16 J;  3IC7 A;  3FDY A;  1FEX A;  4IRH A;  3ABK H;  4W97 A;  2JA5 J;  1ITY A;  2M87 A;  3HG9 A;  3K70 C;  1ZN2 A;  1OYI A;  1FNN A;  4MTE A;  5J4V A;  5DYM A;  2A6T A;  2V1D A;  2QVO A;  2VJ5 A;  2LK2 A;  5DCF A;  1S7A A;  2Z1D A;  4OWR B;  3EYI A;  1FIP A;  1BR1 A;  2RKH A;  2YU3 A;  1A6I A;  3CUQ A;  2XGX A;  3GZN B;  3GTK J;  2L9N A;  4ESB A;  3FBI B;  1R58 A;  3FHN A;  1EH8 A;  4U0Y A;  1U5T C;  1A35 A;  4O3M A;  1SVO A;  3DPU A;  4KIC A;  3U21 A;  1QA6 A;  2XRO A;  2XAG A;  4JBA A;  1HSJ A;  5LFA A;  2X6O A;  2KIS A;  4UY8 I;  2W00 A;  1B59 A;  2EZK A;  2JA7 J;  2DFH A;  2OUM A;  3DPT A;  4XKC A;  1R1V A;  1VQM I;  5FB2 A;  3I64 A;  2YX7 A;  3DKW A;  3PNV A;  3ZMU A;  3F8C A;  1T38 A;  1K78 A;  2F5F A;  1IXS B;  1DPR A;  2IPQ X;  3Q3S A;  2QLZ A;  1U9N A;  2O03 A;  1BA5 A;  1IUY A;  3LSI A;  1QPI A;  4M6Y A;  3I71 A;  4KNY A;  3G4S I;  3L1P A;  4UHT A;  1J5Y A;  1TZL A;  2QQA A;  1JJ8 C;  1GHC A;  1JXS A;  2O8X A;  4IHY A;  2X6Y A;  1ETY A;  3H0D A;  3OYA A;  2CV2 A;  1IUF A;  2XPV A;  2RQP A;  5DS9 A;  5D4R A;  1WI3 A;  1SD7 A;  4B47 A;  2V7F A;  4LK0 F;  2CMP A;  1MJB A;  3K1P A;  3PQK A;  1OFC X;  4GXO A;  4BY1 J;  1QPM A;  3GEZ A;  4MHG A;  1Y39 A;  2DMU A;  3BWG A;  4RGU A;  2HKO A;  1HKT A;  4WK8 F;  2MD0 A;  3VWB A;  4ASN A;  3BR3 A;  3FF5 A;  1P6R A;  1OYW A;  4BYY A;  4AVP A;  5L3F A;  1GT0 C;  3ABM H;  2XKP A;  3WU1 B;  4G7O F;  1RR7 A;  5EGO A;  2R5Z A;  3G73 A;  2HDD A;  1QHG A;  2VC0 A;  3QPS A;  4KIG A;  4H0E A;  2LLK A;  3GXO A;  3HGY A;  3DTI A;  4Z2Y A;  4MEX F;  4BQA A;  2RRE A;  2COM A;  2YS9 A;  4FAS D;  5HOD A;  3HGG A;  3G1O A;  1AWC A;  1R6R A;  1Y1V J;  4XOP A;  2FBH A;  4IOC F;  3CCS I;  4XRF A;  4A0Y A;  3FIS A;  2LRE A;  4EJV A;  4IF4 A;  3JAM K;  2M8E A;  3RTR A;  1RC9 A;  4AU7 A;  4A3J J;  2M7A A;  4QSH A;  1DDN A;  4ZYG A;  2B9S A;  3FXR A;  3BG7 A;  2E1M B;  5HOO A;  1DPU A;  1JI8 A;  2NXN B;  1SAU A;  1KA8 A;  1T0F C;  2R5Y A;  3A4C A;  5K7F A;  3L2V A;  3K69 A;  1T39 A;  3KCC A;  5DD4 A;  4JK1 X;  1BL0 A;  3Q5F A;  1XGS A;  3MZH A;  4Q5S F;  3GUD A;  2VL8 A;  5F64 A;  1KGS A;  2L2O A;  2P5K A;  3QOD A;  3JRA A;  3I59 B;  4I2O A;  5FKO A;  2F2E A;  4BHC A;  3VOE A;  3KEO A;  1S5L C;  2AQF A;  3M8F A;  3HIF A;  3BG3 A;  1D0Y A;  4PJN A;  3FMR A;  1MSF C;  2V9K A;  4G94 A;  4OAY A;  1TBX A;  1Z7U A;  4PSX A;  2A5W A;  2E1C A;  2LMD A;  4CIC A;  1VF9 A;  4OIQ F;  2DOF A;  3KET A;  2IGM A;  4TV7 A;  3RYR A;  2HQN A;  2GOM A;  3DV8 A;  1C0W A;  2ZC2 A;  1IJW C;  3IV5 A;  1EJ9 A;  5IT9 K;  2P81 A;  5L3G A;  5LGT A;  3IH4 A;  4HF0 A;  2DK5 A;  1WJB A;  4A93 J;  4G12 A;  2ECC A;  2AXL A;  5FLM J;  2BGC A;  4P9F A;  5ILS A;  3VYT B;  1BC7 C;  3EYY A;  3D5S C;  3KZZ A;  5GTH C;  1OCR H;  2PQ8 A;  3J7A O;  2UWM A;  5E79 C;  4I02 A;  2MD5 A;  5D8L B;  3BQY A;  3OV8 A;  2RDP A;  1U5T A;  4XSZ F;  2Q2E B;  4IHS A;  1XCV A;  3M8J A;  4G6D A;  1G2H A;  3HSR A;  2HPI A;  5CVI A;  5J4Y A;  2Y69 H;  3CO6 C;  2LF7 A;  2IS6 A;  4JX4 A;  2LKX A;  3K4L A;  2MC4 A;  1F4K A;  3S1N J;  2DDA A;  2XAF A;  1Y6I A;  4B1R A;  1TT5 B;  2QCO A;  3J7Y J;  2IS4 A;  3R4K A;  1ETX A;  4EJO A;  3SDB A;  1ON2 A;  3B6A A;  2XHK A;  3VYS B;  3H9J A;  4IL6 C;  4AVZ A;  1RES A;  3JSP A;  3I3L A;  2IRF G;  3K4M A;  2DMP A;  2OU2 A;  2H8R A;  3SEZ A;  5CYV A;  3L2R A;  3HOV J;  3CJN A;  2DA5 A;  4ENJ A;  2LC2 A;  2OBP A;  2K3P A;  4X1E A;  3TP0 A;  1NK3 P;  3J7Z I;  4GGG A;  2FD5 A;  4F7Z A;  1VQL I;  3U9G A;  4OAZ A;  2XF6 A;  1VQP I;  3HSF A;  5TIS C;  2ZNY A;  1B9N A;  3M1E A;  2ME6 A;  2QEN A;  1T2K A;  4BEH B;  4FET A;  1YTY A;  2OPT A;  2WY7 Q;  1BW5 A;  4KN4 X;  1KQ8 A;  2L3D A;  2DO7 A;  4BDY A;  1S8N A;  4XMY A;  4S04 A;  2VOP A;  3WHB A;  1HW2 A;  1Z3Y A;  2NS0 A;  3HRU A;  1FOW A;  4XOR A;  3MVP A;  1KU2 A;  2FNP A;  2VE8 A;  2CH0 A;  3HKZ A;  3QYE A;  4R1H A;  4Y17 A;  1RI7 A;  4M73 A;  2DBB A;  2VUM J;  1ZHF A;  2VI6 A;  1KON A;  1ZLJ A;  3CES A;  5M5X J;  1ZG5 A;  3Q9V A;  5JLX A;  2FMY A;  2HVS A;  4XRS A;  3RIR A;  1YE9 A;  2QQ9 A;  3SZP A;  3P9I A;  2KRF A;  3AFH A;  4M3F A;  2ZJR F;  2V4J C;  5D6E A;  2JUG A;  2NS7 A;  3GWZ A;  2EFN A;  3R60 A;  3TDU C;  3A0B C;  3LA7 A;  1X4P A;  1WHU A;  3S1R J;  4LLN A;  3CTA A;  1XMA A;  2L4A A;  3FK6 A;  2MA3 A;  1E0E A;  2JPC A;  2H6C A;  1JTX A;  2DXI A;  2Q0O A;  1FY7 A;  5M5Y J;  3DPL C;  2XKO A;  4HEA 2;  3Q0U A;  1TWC J;  1BI2 A;  5D5W B;  1YIJ I;  1UMQ A;  2ZXH A;  5ICC A;  5HNF A;  3MAJ A;  3H5A A;  4Y33 A;  1ZGW A;  4HW0 A;  1NK2 P;  1MGT A;  2XAS A;  1T0F A;  3VOD A;  3CUQ B;  4NBQ A;  2L54 A;  1FOK A;  3LSM A;  5EEA A;  5B5E C;  2MC3 A;  5H20 A;  2F5D A;  2O5R A;  2IS1 A;  2LF8 A;  3RKX A;  2UXX A;  2XAJ A;  4IKF A;  4KT5 C;  1TTY A;  3HTU A;  4J19 A;  3HRM A;  5CPR B;  1SC7 A;  2AHQ A;  1BR2 A;  4JQF A;  4XL9 A;  1R22 A;  1OMI A;  2EA4 A;  3HYI A;  3WG7 H;  1RIO H;  1HST A;  4HG2 A;  1YO5 C;  4A69 C;  1KYW A;  2OZ6 A;  2JVH A;  4P5O A;  3O2P E;  2XF5 A;  4KMU X;  1XGN A;  4HF1 A;  1YS6 A;  2BYV E;  2VIX A;  3QAH A;  4AIK A;  3TW7 A;  2NYX A;  4HZF A;  3WTV C;  3CCQ I;  3C2G A;  2JQ7 A;  5D4S A;  3P7N A;  2E7X A;  5EYR A;  1NG6 A;  4GO1 A;  2KDZ A;  1YIT I;  3CO7 C;  4BHP A;  3LA2 A;  3OYI A;  1T6S A;  3LSJ A;  4XLH A;  2MBF A;  2KQR A;  4XLE A;  3QP5 A;  2EA2 A;  5ED4 A;  5JI6 A;  1G3Y A;  4XN0 A;  1BN5 A;  4ZZL A;  4ENK A;  5DUI A;  1G59 A;  1IXR C;  2XAH A;  1GUU A;  3K0L A;  3I4M J;  3L7W A;  3WTY C;  2J5O A;  3E5Q A;  4C3H J;  1R49 A;  5D8K B;  3P9K A;  1XG1 A;  1JT0 A;  2OV7 A;  3CDH A;  3O8H A;  2TCT A;  1YOV B;  3ZMT A;  3K1N A;  4UXN A;  1G3S A;  3R6S A;  3S1Q J;  2HFH A;  2DW4 A;  2PN6 A;  1S3J A;  3GVA A;  2EV5 A;  2P4W A;  1X3W B;  3M7G A;  4A3G J;  2HGC A;  4HLX A;  1MIJ A;  2H94 A;  2FBI A;  2JK3 A;  4E7S A;  3WTS C;  2PJR A;  4Y3O A;  1WZ2 A;  1Q1V A;  3I55 I;  4DNC A;  1N25 A;  1IRG A;  2VKV A;  1IN8 A;  1S72 I;  3J80 Z;  3F8N A;  4KMF A;  2EZH A;  2P0W A;  3NWT A;  3G6E I;  2Z16 A;  2C6Y A;  1PUF A;  4PUS A;  5ICF A;  3LFU A;  1R71 A;  1YHQ I;  1IRF A;  1HF0 A;  4L9V A;  4HNT A;  4F91 B;  1D5V A;  2EFQ A;  5BNG A;  4CUG A;  3VB2 A;  2GXA A;  3GME A;  5AIQ A;  3GZ5 A;  2O3F A;  4PGG A;  4PDK A;  4PJM A;  4CGZ A;  2R5Y B;  4QPQ A;  3Q9S A;  3EUH C;  2K4B A;  2M30 A;  3FZV A;  4V19 K;  1B4A A;  1V3F A;  3CCY A;  1W1W E;  5D5X B;  4WX9 A;  1FLI A;  3CCV I;  4F55 A;  5FKK A;  3BTL A;  2W25 A;  3AKZ A;  3K10 A;  2QQB A;  4CZC A;  3MWM A;  3O3K A;  4DBR A;  5JFR A;  5BOX A;  5L3B A;  5FLX K;  1H0M A;  2DI3 A;  2KT0 A;  2E2I J;  5FFX A;  2A68 F;  1SMT A;  4ZDP A;  1YJ9 I;  1OCZ H;  3JCU C;  2P6S A;  1XGM A;  1VTN C;  5J3L A;  1TC3 C;  3E6C C;  3BTJ A;  2ZJP F;  4FHT A;  2IXS A;  3LMM A;  3S3N A;  2CU7 A;  5BPD A;  2CV1 A;  2DA2 A;  4OIR F;  2Z5U A;  5J8F A;  1K4S A;  1VZ0 A;  4XR6 A;  3RJP A;  5GTI C;  2EPF A;  3DKX A;  2K40 A;  5J6X A;  5EG0 A;  1UG0 A;  4NQW B;  1WGX A;  2JZY A;  4FT8 A;  4ETS A;  3S15 J;  4O6J A;  2R4G A;  2XSD C;  2DTR A;  2CG4 A;  2WWY A;  4HYE A;  2BXY A;  4UVB A;  4LB5 A;  3KP6 A;  4WXH A;  3K7A J;  3RPU D;  4A3K J;  2VB6 A;  3FXJ A;  2CWE A;  3FXO A;  1WJD A;  1U5T B;  4JX6 A;  1WJC A;  3JAM Z;  4M9X A;  1XN7 A;  2R7W A;  1PJR A;  3BY6 A;  2QGU A;  2I5U A;  1S7E A;  3F23 A;  2P7V B;  4LLL A;  1ONV A;  3ABU A;  2EIJ H;  1V4R A;  5FKL A;  4GRI A;  1FIA A;  3BRO A;  2E36 A;  3V42 A;  5HDN A;  3A1Y A;  1Z6R A;  4UV8 A;  2O9L A;  1D1B A;  4IPA A;  1J7K A;  4O5V A;  4D5F A;  4RM2 A;  2KIM A;  1U78 A;  4CA0 A;  4KIB A;  3J81 K;  4HSR A;  1Z7L A;  1FSH A;  2KLO A;  1R1T A;  2VJJ A;  1F1Z A;  4LLG F;  1IN7 A;  3AG2 H;  3SFZ A;  4D7N A;  3KFW X;  4PJ0 C;  4C30 A;  2W24 A;  1H8A C;  4X0G A;  1TQP A;  3L9F A;  1S29 A;  2CFX A;  3KP5 A;  4EM1 A;  4CCJ A;  4EJW A;  1ZTR A;  2MH2 A;  5IT9 Z;  1YLF A;  2XRN A;  2AO9 A;  1LE8 A;  1Z0X A;  2XB5 A;  5IPA A;  5F08 A;  1XTA A;  2CUZ A;  2WAQ A;  3T5X A;  3FXQ A;  1CGP A;  4H4K C;  2ECB A;  1V54 H;  1GLN A;  1R5I D;  3KLN A;  3RCO A;  4C9Y A;  4PCQ A;  1FPQ A;  1VQO I;  1PDN C;  3HRT A;  3BR2 A;  1FOY A;  4WXC A;  2DPD A;  3RPU A;  3JRF A;  1IGN A;  4MO7 A;  4XLF A;  1TWF J;  2CJJ A;  3S93 A;  2NRA C;  1BOA A;  2QZ8 A;  1M1E B;  1WQ2 A;  1IRZ A;  3KYD B;  2MLK A;  2A07 F;  4DYC A;  1OR7 C;  3EPZ A;  2L4M A;  2XRL A;  1OPC A;  5IYD J;  4II2 A;  2LH9 A;  1WPK A;  2EQR A;  4A3I J;  2W57 A;  3HL2 A;  4A3F J;  2ZME A;  4XON A;  1SVL A;  1QVT A;  2YUS A;  3K2Z A;  1N75 A;  1DUX C;  3VYR B;  1X58 A;  2X1D A;  3PQJ A;  4A5N A;  3GYH X;  1BJA A;  3RKQ A;  5EDN A;  2ME0 A;  1R36 A;  1TWG J;  3FXK A;  3E6D A;  4HBL A;  3HHG A;  4IRG A;  3DBL B;  3GTO J;  2GZW A;  2JWT A;  3F21 A;  3HPH A;  2KKO A;  4DW6 A;  2H09 A;  4I6Z A;  1BR4 A;  5LHH A;  3V4G A;  5LGU A;  3L2W A;  1IN4 A;  3JTG A;  4E7Z A;  4L9T A;  3VFZ A;  2X85 A;  2NNN A;  3K2A A;  4NUB A;  2AS5 F;  4E7I A;  2KZV A;  1QGP A;  1I3Q J; 
#chains in the Genus database with same CATH homology
 3S2D J;  1ZK8 A;  2DA7 A;  1X2M A;  3TP3 A;  1A5J A;  1JT6 A;  2CRG A;  5IYC J;  3JRA A;  1RPW A;  5M3M J;  5FKO A;  5C44 J;  2CUF A;  3VPR A;  3BG3 A;  1MSF C;  2G0E A;  1DU0 A;  2XGE A;  3M3Y J;  3Q0W A;  1P7I A;  3PM1 A;  1VF9 A;  3JRH A;  2DMT A;  5IP9 J;  4FCY A;  4ABZ A;  4DYR A;  3JRB A;  1FTT A;  2VPR A;  3HOX J;  2L7M P;  2ID3 A;  2LFB A;  3ZQG A;  1IJW C;  3S1M J;  4FIS A;  1ETK A;  2LVS A;  5K7Z A;  5E3N A;  3IV5 A;  2P81 A;  1AKH A;  4DZP A;  3IH4 A;  3HOY J;  3BG9 A;  4A93 J;  4G12 A;  1DU6 A;  5J1R A;  2ECC A;  5FLM J;  2JA8 J;  9ANT A;  1UG2 A;  1F43 A;  1RKW A;  4BBR J;  2LR8 A;  3DCF A;  4Y52 J;  2E19 A;  3BQY A;  2XB0 X;  1AU7 A;  4AC0 A;  1G2H A;  2NVX J;  4M3E A;  1IDY A;  1TWA J;  1ZKG A;  3JR9 A;  2X48 A;  3RZO J;  4A3C J;  2Y0S N;  1IV6 A;  5E3M A;  4JX4 A;  2LKX A;  3S1N J;  2CQX A;  1ZR2 A;  1GVD A;  3G1M A;  4W1U A;  4B1R A;  5EZG A;  2QCO A;  1ETX A;  1U9O A;  1ZQ3 P;  3HB9 A;  3B6A A;  5J1Y A;  1RES A;  4XID A;  4A3L J;  1K61 A;  5FKN A;  4JP0 A;  3SDG A;  2DMP A;  5GP9 A;  3GTJ J;  4UUS A;  2DA3 A;  2H8R A;  5F0C A;  1ENH A;  1VND A;  4XIC A;  3HOV J;  2COB A;  2DA5 A;  1NK3 P;  4X1E A;  3TP0 A;  3GTM J;  2E2H J;  1I6H J;  2FD5 A;  1BW6 A;  3ZQI A;  2IBD A;  2GBY A;  2ME6 A;  3LOC A;  1JJ6 C;  1JUP A;  4I76 A;  1WH5 A;  4QIW N;  3JRC A;  2OPT A;  1BW5 A;  2M0C A;  2ELK A;  1XS9 A;  3WHB A;  4A3B J;  3HBL A;  1U8B A;  3MVP A;  1IC8 A;  2L7Z A;  4B3A A;  4A3E J;  2HXI A;  3FK7 A;  3A01 A;  2VUM J;  4EEF G;  2VI6 A;  4FTH A;  1JGG A;  5M5X J;  5JLX A;  4XRS A;  2E1O A;  3JRG A;  1IDZ A;  4UUT A;  3B6C A;  2L7F P;  4M3F A;  3G1L A;  3GTL J;  1MBG A;  2GLO A;  2NS7 A;  2DA1 A;  1JUM A;  2MW8 A;  4XK4 A;  3S1R J;  4M6V A;  4X6A J;  3HEF A;  2H1K A;  2M9H A;  2DTZ A;  2HOS A;  3JRI A;  3FK6 A;  4DZJ A;  4FE7 A;  1JTX A;  1T56 A;  5M5Y J;  1RET A;  1UHS A;  2WAQ N;  1YRN B;  4IHX A;  4M3B A;  3Q0U A;  2LTP A;  1TWC J;  2XGD A;  3GTQ J;  2MGQ A;  2N8G A;  1UMQ A;  3A03 A;  3WHC A;  1ZGW A;  4FE4 A;  1Z77 A;  1I50 J;  3HOZ J;  2E2J J;  1HDP A;  1NK2 P;  1MBK A;  3OOU A;  3FIW A;  2L0K A;  3QQA A;  4HNV A;  2O7O A;  3M4O J;  2Y30 A;  2Y2Z A;  5EEA A;  3JRE A;  5E3L A;  4IHV A;  1VFC A;  4JX5 A;  2HXO A;  2YU9 J;  3W6V A;  3O8G A;  5IP7 J;  1B8I B;  3BR1 A;  4GFB A;  4J19 A;  1X2N A;  3RZD J;  1IG7 A;  2JA6 J;  2OF7 A;  1VI0 A;  2K9N A;  1B72 B;  2AHQ A;  1O4X A;  3HDD A;  2FX0 A;  5F0H A;  1JTY A;  4D7M A;  4A69 C;  2LY9 A;  2HYJ A;  3HKZ N;  1HDD C;  1ETV A;  5J1U A;  3BR5 A;  1D5Y A;  4S0H B;  5IOY A;  3TW7 A;  3ZOB A;  4BKX A;  4MIM A;  5EYR A;  2RAE A;  4AUX A;  2KDZ A;  4MLO A;  2Y9Z A;  1PUF B;  3LSJ A;  3S2H J;  1AHD P;  2MSY A;  1MSE C;  4CYC B;  4BY7 J;  1P7J A;  5F04 A;  2JMW A;  1B8I A;  1GUU A;  2M8G X;  3I4M J;  3JRD A;  4C3H J;  1XG1 A;  1JT0 A;  1MBH A;  3O8H A;  2TCT A;  3H3V K;  1TWH J;  2R0Q C;  3S1Q J;  1RKT A;  3BG5 A;  2B63 J;  3OSF A;  1MH4 A;  3BT9 A;  4AYB N;  3S17 J;  1HOM A;  2IAI A;  2NOG A;  5M3F J;  1ORK A;  4A3G J;  3QPL A;  3BR6 A;  4RDU A;  2JK3 A;  4LOC A;  1E3O C;  2HOA A;  4RBO A;  1BJZ A;  1Q1V A;  2DA6 A;  1ETO A;  2VKV A;  3C2B A;  4XRS G;  4V2G A;  4C3J J;  2R93 J;  2EZH A;  3F0C A;  5C3E J;  4QTR A;  2DN0 A;  1PUF A;  1HF0 A;  4Y7N J;  3ZQF A;  5E3O A;  1H89 C;  1FTZ A;  3NAR A;  4CYC A;  1JKP C;  4BBS J;  3IH2 A;  1Y1W J;  5BNG A;  2XPW A;  2GM4 A;  3RQI A;  2DMQ A;  2X9D A;  1JKQ C;  5EG0 B;  2R5Y B;  1W0U A;  4C3I J;  1T33 A;  3A02 A;  1SFO J;  1OCT C;  1XC5 A;  2M34 A;  2CQQ A;  5FJ8 J;  3BTI A;  3CCY A;  5C4J J;  3MN2 A;  2I10 A;  3ZQC A;  2NVY J;  2JJ7 A;  5FKK A;  2VKE A;  3ZQH A;  4B4C A;  1W0T A;  3E7L A;  2NS8 A;  3BTL A;  1OCP A;  5EZH A;  4NDL A;  2D5V A;  1QRY A;  2FQ4 A;  3ZQL A;  2KT0 A;  2E2I J;  2JN6 A;  1WCM J;  5FLV A;  5JLW A;  1ETQ A;  1H88 C;  1GV2 A;  3GBG A;  2L9R A;  5J3L A;  2WB1 N;  1GDT A;  3BTJ A;  1TC3 C;  1MH3 A;  2LP0 A;  1GV5 A;  2CU7 A;  2DA2 A;  2EBI A;  3S14 J;  2ID6 A;  2ZB9 A;  1R9T J;  3TED A;  3OSG A;  1AKH B;  2EH3 A;  2K40 A;  4A3M J;  4IEJ A;  5EG0 A;  2K9S A;  5FKM A;  1WGX A;  2DA4 A;  3DEW A;  1HLV A;  4V2F A;  3S15 J;  3I4N J;  2DMN A;  2XSD C;  1NTC A;  5IP6 A;  2FJ1 A;  3K7A J;  4A3K J;  3PO3 J;  1OJL A;  4JX6 A;  5M5W J;  1F36 A;  2TRT A;  1JUS A;  2Y31 A;  2K9Q A;  1S7E A;  4C2M J;  5F27 A;  1MBF A;  3CMY A;  1LE8 B;  3S16 J;  1FEX A;  2PMZ N;  5FKL A;  1ITY A;  4W97 A;  1FIA A;  1YRN A;  2JA5 J;  3LSG A;  2NVQ J;  1JKR C;  2MG4 A;  3GTP J;  2O9L A;  2LK2 A;  1JKO C;  3Q0V A;  1FIP A;  4UUS B;  5F1J A;  1A6I A;  3GTK J;  4D5F A;  1U78 A;  1MBJ A;  1WH7 A;  2R7Z J;  2Y9Y A;  1MBE A;  3HOU J;  4BXX J;  5K7H A;  4JYK A;  3LSR A;  4D7N A;  2X6O A;  3D1N I;  1B72 A;  1H8A C;  3NAU A;  1POG A;  2EZK A;  1HCR A;  1LFU P;  2QF7 A;  2JA7 J;  3LNQ A;  3GTG J;  1ZTR A;  2WV1 A;  3CDL A;  2AO9 A;  1LE8 A;  5EGO B;  3Q3S A;  1Z0X A;  4MFD A;  3LSP A;  2R5Z B;  1MNM C;  1U9N A;  2XB5 A;  1BA5 A;  5IPA A;  5F08 A;  3A01 B;  3UKG A;  1QPI A;  4A3D J;  1LFB A;  4M3D A;  3H0G J;  3L1P A;  1JJ8 C;  2XGC A;  2ECB A;  2HOT A;  2CUE A;  4IHY A;  3MKL A;  1ETY A;  1APL C;  1IUF A;  2XPV A;  4MFE A;  5DS9 A;  1WI3 A;  5IYB J;  2NVT J;  3BR2 A;  3JRF A;  1IGN A;  2W48 A;  1FJL A;  4MO7 A;  5IOZ A;  1TWF J;  2CJJ A;  1OFC X;  5C4X J;  3BR0 A;  2DJN A;  1K83 J;  4BY1 J;  1IRZ A;  4L5E A;  2XPU A;  3CQZ J;  3PO2 J;  2DMU A;  3OIO A;  4DYC A;  2XRL A;  2HQ5 A;  3BR3 A;  5F0F A;  5IYD J;  1WPK A;  3SJM A;  2EQR A;  4A3I J;  3SFI A;  1GT0 C;  4A3F J;  1RR7 A;  5DTD A;  5EGO A;  2R5Z A;  3FKI J;  4DYQ A;  2HDD A;  2HI3 A;  1QVT A;  2YUS A;  3QPS A;  2LLK A;  1X58 A;  3HGY A;  3HOW J;  4D5C A;  2LD5 A;  3RKQ A;  5GPC A;  5EDN A;  2ME0 A;  2YS9 A;  1TWG J;  1SAN A;  5HOD A;  3HGG A;  3G1O A;  1Y1V J;  2EZI A;  2M2E A;  1ETW A;  3FIS A;  4M3G A;  5EF6 A;  2R92 J;  1ZR4 A;  1EF4 A;  5GPA A;  3IH3 A;  4A3J J;  4QSH A;  3GTO J;  4IHW A;  2JWT A;  1QVU A;  4DW6 A;  4XRM A;  4I6Z A;  2R5Y A;  5K7F A;  3BTC A;  3K2A A;  2EZL A;  3TW6 A;  2IEK A;  1BL0 A;  1CQT A;  1I3Q J;  3BQZ A;  3HM5 A;  2O8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...