1TWGJ

Rna polymerase ii complexed with ctp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twgJ00
1WPKA 4UUSA 3VPRA 3A03A 1FIPA 4AUXA 3M3YJ 3SFIA 4JYKA 2LD5A 3OSFA 3DEWA 1QVUA 4B1RA 3WHBA 3BG5A 4DW6A 3MVPA 2Y0SN 2FD5A 2E19A 3BR6A 2L7MP 3GTOJ 4M3BA 2NS7A 1G2HA 1I6HJ 5FKMA 3L1PA 3BR5A 1JT6A 2OPTA 3S17J 1GUUA 2KT0A 4X6AJ 1JKQC 3K7AJ 1QRYA 3K2AA 9ANTA 3FK6A 3LOCA 4A3MJ 4DZPA 4FE7A 5IYDJ 1LE8B 1FEXA 2DMUA 1WI3A 1B72A 5M5XJ 4MFDA 3B6AA 3PM1A 1H89C 1CQTA 4BKXA 1A6IA 1TWFJ 1ETYA 1MSEC 4M3FA 1LE8A 1ZKGA 3HOZJ 3S15J 1EF4A 1OFCX 5FKKA 2L7FP 2XGCA 5GPCA 1HDDC 3QQAA 2LK2A 2WV1A 4FISA 2M9HA 2GBYA 4V2FA 1ZQ3P 2CUEA 1OCPA 2LLKA 1D5YA 2DMPA 1O4XA 2DMQA 3JRCA 1Z77A 2XPUA 3TP3A 4CYCB 5IP7J 4L5EA 2D5VA 2O8KA 2XRLA 2LR8A 3CDLA 3HEFA 5FLMJ 5J1YA 3A02A 4D5CA 2CJJA 4AYBN 2NVYJ 3FISA 3S1MJ 4C3IJ 2ECBA 2YU9J 1VF9A 1HCRA 1T33A 4NDLA 4A3KJ 3HGGA 4JX6A 2CQQA 1JGGA 1OJLA 5FJ8J 2K9SA 3SDGA 3CCYA 1AU7A 5F0CA 3FIWA 2DMTA 4Y52J 3BR3A 5M5WJ 2L0KA 2XGEA 5FKOA 3GBGA 1MH3A 4FTHA 2XSDC 2HDDA 4IHWA 1Y1WJ 1X58A 2ID3A 1ETXA 1JUSA 3LNQA 1ETVA 2ELKA 3H3VK 4IHYA 1GV5A 2PMZN 4XRSG 3S2HJ 5K7HA 5EYRA 3JRAA 1IUFA 1IDYA 4B3AA 3FKIJ 3G1OA 2JA7J 1ETKA 1ZR2A 4B4CA 3TW7A 2R93J 1GV2A 4MO7A 5F0HA 1DU0A 1TWGJ 2R7ZJ 5F04A 2XPWA 3ZOBA 1RR7A 1JKPC 2K9QA 3NAUA 4XICA 2E1OA 5F0FA 3GTMJ 1YRNB 2VUMJ 3H0GJ 1FIAA 1I50J 3S2DJ 1OCTC 2HXIA 3BR1A 5IP6A 2HOSA 1IC8A 3TEDA 2OF7A 2EZLA 2W48A 1UHSA 2O7OA 2RAEA 4M6VA 4MLOA 5IOYA 3LSRA 2ZB9A 1U9OA 3PO3J 2HOAA 5IYCJ 1E3OC 2E2HJ 2XGDA 1Q1VA 2JK3A 1GVDA 2GLOA 1LFBA 1YRNA 5EDNA 5DTDA 3E7LA 3Q0WA 2K40A 4I76A 3B6CA 2JN6A 2ID6A 5E3NA 1PUFB 3S1QJ 3O8GA 3OIOA 1WH5A 3HOUJ 3GTPJ 5E3MA 3QPSA 2HQ5A 3I4MJ 3UKGA 2O9LA 3QPLA 3FK7A 2Y30A 4QSHA 1RKWA 2MSYA 4XIDA 4ABZA 2TCTA 1MBFA 1PUFA 1XG1A 3PO2J 2P81A 4LOCA 4C2MJ 5EEAA 3G1LA 1AHDP 1IDZA 1X2NA 2NVQJ 3HOYJ 5C3EJ 2NS8A 2CUFA 1BL0A 3IV5A 5C44J 2JWTA 2DN0A 3ZQGA 2DA5A 1HF0A 3Q3SA 2KDZA 3IH2A 4MIMA 1JJ6C 2NOGA 4DYCA 2NVTJ 1H88C 3W6VA 3LSPA 3BR0A 3LSGA 3BTCA 3MN2A 5EGOB 1Y1VJ 4D7MA 4W1UA 5BNGA 3GTJJ 2JA6J 5FKLA 3HOWJ 1VFCA 1ZTRA 5EG0B 1ETQA 5GPAA 4W97A 1QVTA 1RETA 2HYJA 2H8RA 3ZQFA 3JRFA 2DA1A 3C2BA 1NTCA 4A93J 5M5YJ 2DA6A 2VKVA 2G0EA 1ZR4A 1RKTA 4DYQA 5EGOA 2R5ZB 2LVSA 4CYCA 1W0UA 3HOXJ 1U9NA 4IHVA 2EH3A 4A3BJ 2JMWA 4Y7NJ 3S16J 2DA2A 2E2IJ 3G1MA 4I6ZA 2L7ZA 4M3EA 5DS9A 5K7FA 2R0QC 3HDDA 1A5JA 2NVXJ 2R92J 5F08A 3WHCA 3ZQCA 1TWHJ 3RZDJ 3BR2A 1F36A 2EQRA 3TP0A 4A3CJ 4DYRA 4RDUA 3ZQHA 5E3LA 2TRTA 3D1NI 2LTPA 4FE4A 2I10A 4A69C 2Y2ZA 2JA8J 4JX5A 4M3GA 4BY7J 4BBSJ 1NK2P 1XC5A 2WB1N 1R9TJ 1VI0A 4A3EJ 1JT0A 1B8IB 3M4OJ 1HLVA 5GP9A 1ORKA 4IEJA 4C3HJ 3F0CA 3JR9A 5C4XJ 2B63J 5M3MJ 3BTJA 1ETWA 3MKLA 5FLVA 4V2GA 4MFEA 2LFBA 1WH7A 4A3LJ 2CRGA 3IH3A 3HKZN 5JLXA 1DU6A 4BBRJ 1APLC 1MBJA 1AKHB 3JRDA 5J1RA 4A3GJ 1ITYA 1WCMJ 1RPWA 3HB9A 1I3QJ 1W0TA 4C3JJ 1IGNA 2VKEA 3GTQJ 1MSFC 1H8AC 1LFUP 3LSJA 3HOVJ 2YUSA 4G12A 2DA4A 1HOMA 2X9DA 3A01B 4EEFG 1XS9A 1SANA 1ZK8A 5HODA 4FCYA 2MGQA 1F43A 3GTGJ 4XRSA 2H1KA 5C4JJ 3BG3A 1TWAJ 5IOZA 2JJ7A 2EZIA 2XB0X 2XB5A 4A3JJ 1SFOJ 1BW5A 4AC0A 2IEKA 3IH4A 1WGXA 2HI3A 3A01A 5IPAA 2Y31A 1UG2A 1JUMA 2M34A 4RBOA 4A3FJ 3O8HA 2YS9A 1B72B 4GFBA 1BA5A 4UUTA 2HXOA 4XK4A 2ECCA 3NARA 3DCFA 3RZOJ 1NK3P 2DJNA 3OOUA 1IRZA 3Q0VA 3BTIA 2COBA 4J19A 1MBKA 1K61A 3JREA 1MH4A 3HM5A 2GM4A 4D5FA 3JRIA 2CU7A 3JRHA 2ME0A 1JKRC 5F27A 3GTKJ 5E3OA 4JP0A 1Z0XA 3BG9A 1ZGWA 2QCOA 2DA3A 1P7JA 4M3DA 2FJ1A 2X6OA 1TWCJ 3RKQA 4IHXA 5IYBJ 1X2MA 2DTZA 1BW6A 5M3FJ 2ME6A 3CQZJ 2LY9A 2VI6A 1MBHA 5EG0A 1RESA 2K9NA 3CMYA 2IBDA 2R5YB 1GDTA 2LP0A 4DZJA 5EF6A 3ZQIA 2R5ZA 1JUPA 1TC3C 2FQ4A 1MNMC 2FX0A 5EZHA 2MW8A 3S14J 4QTRA 3OSGA 3JRBA 3I4NJ 1K83J 5J3LA 3BQZA 1JTYA 2AO9A 1HDPA 4JX4A 4QIWN 2R5YA 2AHQA 1POGA 1ENHA 4XRMA 1IG7A 3RQIA 1QPIA 1BJZA 5J1UA 2WAQN 2IAIA 4A3DJ 3TW6A 1FTZA 3S1NJ 2CQXA 4BXXJ 2EZHA 3JRGA 1JKOC 1U78A 2EZKA 4X1EA 2M2EA 5FKNA 1FJLA 1B8IA 1T56A 3S1RJ 2MG4A 5EZGA 1S7EA 2L9RA 2N8GA 1GT0C 1U8BA 4S0HB 5JLWA 4HNVA 1VNDA 1JJ8C 3SJMA 2DMNA 3Q0UA 4A3IJ 4BY1J 1P7IA 2DA7A 2E2JJ 2JA5J 5K7ZA 1FTTA 2Y9YA 1MBGA 4UUSB 1JTXA 2LKXA 3BQYA 3HBLA 3BT9A 1UMQA 3BTLA 4D7NA 3GTLJ 1ETOA 2VPRA 1AKHA 1IV6A 2HOTA 1MBEA 2QF7A 2XPVA 3HGYA 5IP9J 2M8GX 2Y9ZA 2M0CA 1IJWC 5F1JA 3ZQLA 2X48A 2EBIA
chains in the Genus database with same CATH superfamily
1WPKA 2LDUA 3O6BB 3RIRA 1LFPA 4RAGA 3VPRA 1FIPA 4XL9A 2DT7B 1ZAOA 4RAZA 4F91B 3CC2I 4PJLA 1YJ9I 1IN8A 4HDUA 4B1RA 2P6SA 1EV7A 2JPBA 2E19A 4EJUA 3GTOJ 1G2HA 2UXXA 2L01A 3BR5A 1RUNA 3V7RA 3S17J 4TV7A 4U88A 3KP5A 1JKQC 3L2WA 1QRYA 4RM3A 3FK6A 4C2TA 1YS7A 4OMZA 3LOCA 2R7TA 4AYBA 3IWZA 4G9YA 2PBIA 2OBPA 1WJ5A 1LE8B 4OIPF 1FEXA 3LFUA 2PJRB 2HZDA 5LGTA 1P4XA 4BQQA 3PL8A 2O3FA 2QM3A 5A2QK 1H89C 3V8JA 4BKXA 1T0FA 5KCMA 2A69F 4U7BA 2M0MA 2P5KA 1RR8C 3KZZA 1LE8A 1JHHA 1ZYRF 2W82A 2XV4S 3RPUD 2V9VA 2PJRA 1OFCX 1R4MB 5FKKA 5B1AH 3ABMH 2K9LA 1W36D 2L7FP 5DM7F 2XGCA 1GHCA 1TBXA 1A04A 4G7HF 2STWA 3V7SA 3X2QH 2F6CA 2KL4A 3I71A 2VBXA 3HSFA 4HDVA 1ZQ3P 1E3HA 1OCPA 1D5YA 2DMPA 4C2UA 1YW7A 3I4PA 1XN7A 3JRCA 4F52A 1R5GA 4A0YA 4CYCB 4RB3C 5IP7J 2D5VA 3CDLA 2JUGA 1HSTA 3HEFA 2HDWA 3ZN0A 2PQ8A 3OOPA 2CJJA 3I3LA 2NVYJ 3Q9VA 4FQGA 3F8MA 3WU1B 2V4JC 2CQQA 5FJ8J 3OS1A 5F0CA 2LNBA 3RDIA 2DMTA 3ABUA 3ECHA 1LDDA 2Z5UA 2XGEA 3GBGA 3KE2A 2EV6A 4FTHA 2HDDA 2QLZA 5LGNA 4N9IA 4IHWA 3OIQA 1Y1WJ 1X58A 2ID3A 4HAMA 3LNQA 1ETVA 5LLQA 2PMZN 1FSEA 2HNHA 3S2HJ 5K7HA 4GGGA 5EYRA 4KUMA 3BROA 2GOXB 1WWXA 3J7YJ 2R7DA 1PJRA 3I0TA 3FKIJ 3G1OA 4PJJA 5BPDA 1ETKA 4E7LA 1R5HA 4YIIA 2X4HA 5F0HA 4PSWA 1DU0A 1TWGJ 1BN5A 1IN4A 1E3PA 2XUBA 2V1UA 1LB2A 3OS2A 1IXRC 4LB6B 1BIBA 1I1GA 4XKBA 1S6LA 2GA2A 1DP7P 3MZ8A 1I1SA 3V7CA 3L9FA 3GWZA 5F0FA 2MC3A 3FXOA 3WU2C 1YRNB 3W3CA 4EV0A 4II3A 2Q2EB 1FIAA 1U5TC 1K4TA 2GAUA 2HR3A 3EQLF 3FHNA 2HOSA 1G3YA 3TEDA 2K7LA 2OF7A 2EZLA 4LK0F 1UHSA 1XMXA 2O7OA 1YI2I 1FYKA 1U9OA 4ON0A 4BH9A 3LA3A 2MD0A 2O03A 2VN2A 2ZKZA 2XGDA 2HKXA 1XX5A 2JK3A 3E6CC 2GLOA 2BHZA 1D3YA 1VQLI 1YRNA 4KICA 5J40A 3WODF 2Q2EA 1F5TA 1RNLA 3CJTB 3E7LA 3Q0WA 1R4NB 4XORA 4BJ6C 2CFOA 2V9PA 3OYHA 1U3EM 5CKTA 2KZGA 1FWZA 2DDAA 3WTSC 1AOYA 4BQNA 2MABA 3E0JB 4YFXF 4ZTJA 2GIZA 3GTPJ 5E3MA 2L7KA 5CQEA 2NNNA 4JQFA 2HQ5A 5DD4A 3WTYC 5AIPA 2CV0A 3CF5F 2K9MA 2Y30A 2OC6A 4QSHA 1RKWA 2MSYA 4I99C 2HVQA 2TCTA 3PIPF 3DP7A 3DLLF 2VKDA 4C2MJ 1WJCA 1X2NA 1G3TA 2Y69H 5F64A 1J9IA 3HOYJ 3CMEI 2DTRA 2F5FA 2BY0A 2LOOA 2OA4A 3H9JA 3SYTA 4AM3A 3M7GA 3G6EI 2NS8A 1HKSA 1MJBA 2H27A 2M7BA 6PAXA 1KU2A 2DN0A 3NWTA 3I56I 2DA5A 1BC7C 2DCEA 2F4OB 1HKTA 3Q3SA 3TDZC 4E70A 2HEOA 2LMDA 3QRFF 3CP2A 3S3OA 1XGSA 4OINF 4HNUA 1OISA 1FOXA 3DTIA 3ZMTA 3LSGA 2ZMEC 3CUOA 1E2XA 1U2WA 4FX0A 2WB1A 1DQUA 4D7MA 5BNGA 2X6XA 2Q1ZB 2JA6J 2OQRA 5FKLA 2IGNA 2JA2A 4W97A 1QVTA 2HYJA 5HDKA 2X85A 1Q1HA 4XSXF 2VQGA 3OIPA 3V8LA 2ZBKA 1QU3A 3GF2A 2UXNA 1XCBA 1IO2A 3GVAA 3OYIA 4DNCA 1Y0NA 3VYTB 4Y7NJ 3V8KA 3CUQA 2E2IJ 4JOMA 5HDNA 2WY8Q 3REOA 4YEJA 1ULYA 1V54H 3JSPA 1A5JA 2HFHA 3I64A 5F08A 3WHCA 1S29A 5L3DA 2EK5A 4HZFA 1SMYF 3CCVI 4B47A 3O3KA 5F1RA 3ZQHA 3PUFA 4ZYAA 3D1NI 1Z67A 2I10A 3AG1H 2CV1A 4K2EA 4LIUA 4CZCA 4B3XA 2JA8J 1Y8RB 1YQAA 3AG4H 4XLEA 2ZFUA 1B8IB 1HLVA 1IV8A 2V9KA 4IEJA 4IPAA 1VQ8I 2DOAA 3F0CA 1QPMA 5C4XJ 3BPVA 5M3MJ 3BG6A 1KU7A 4E6KG 3S3MA 4HBLA 2JRTA 1QHGA 2M3AA 1B6AA 3IHUA 3VOEA 4MFEA 1YHQI 2KIFA 3IAS2 3HKZN 4RB0A 2JPCA 2KZVA 4GYGA 3SZGA 2MFZA 1IRXA 3V42A 1JHFA 1MJ9A 3A4CA 1MBJA 2G7UA 4A3GJ 1TQIA 1XTAA 3DKXA 4MQ9F 1XB4A 3FX3A 4M9ZA 4HPQA 4EM0B 5TRDA 1YIJI 3LAJA 1W0TA 2QBYB 3ZMUA 4Y13A 4M9SA 4KT6A 3GTQJ 4YFNF 2PLYA 4DIQA 4BE2A 2YUSA 1BR4A 1ZRCA 1FT9A 3I5UA 1NG6A 3T1BA 3BPXA 3QODA 5LEKA 2EINH 1SANA 2R7QA 3A0HC 4Z6YA 2R7OA 5GADJ 2MGQA 4BQOA 3I59A 3WGGA 1MNEA 1TWAJ 2GOMA 1SFOJ 2XB0X 5GAHJ 3HUGB 3EYYA 2HI3A 2BXZA 1L3LA 2HVRA 2DOEA 4FT8A 1UG2A 1G8XA 4M71A 3KEOA 3TO9A 2P8TA 3U21A 1BA5A 5HOOA 2LKPA 2UZKA 3CZ6A 2MD5A 1S5LC 1HW5A 1YOVB 2DJNA 3JAMZ 2VQHA 4EMSA 2AQFA 1QZEA 2KJBA 4LIVA 1P4WA 1IRZA 3Q0VA 1MMSA 3BTIA 2COBA 1MBKA 1MH4A 2QEXI 1X4PA 1UB9A 2VE9A 4IOAF 2DQRA 3HYIA 4LLGF 3EUAA 1MDMB 1OR7C 2CWEA 3HRTA 5LD2C 2IVMA 3EUKL 5IT9Z 4M3DA 1RC9A 2XF5A 4PFPA 4R1HA 4Y3OA 3RKQA 3H5NA 4IHXA 1BW6A 3CDIA 3CQZJ 2K5CA 2VI6A 1MBHA 5EG0A 1MDMA 3W2AA 4HF1A 2RGVA 4ITVA 3JW4A 2LG4A 3QU3A 5TGTA 1RIOH 4RS8A 3HTSB 2LP0A 3DEEA 4B09A 2RVCA 5IT9K 2TDXA 5EF6A 4M6YA 1FYLA 5GTIC 4L18B 1T39A 4Y17A 5DEQA 4UNOA 3KLNA 1TW3A 3OSGA 2DOFA 1SMTA 2A6EF 3DBLB 2DFEA 2JSCA 1OPCA 1R6RA 3KP4A 2FF4A 4GO1A 3RQIA 2RREA 2A5YB 2GA1A 2KJCA 2DW4A 3CESA 1BC8C 3TW6A 1FTZA 3RJPA 4CH7A 2HTSA 2Y0SA 1LDJA 4BXXJ 1QHHD 4LMYA 2KP6A 3HIFA 4KA4A 4I2OA 2O0YA 2V6EA 2NVUB 2IGOA 1W1WE 3I54A 2M2EA 5FKNA 2FE3A 4AD9A 2DYSH 4BDZA 1S7EA 2L9RA 5DUKA 3FXRA 1GT0C 1U8BA 2XF6A 1HA8A 3H35A 3L2UA 1BR1A 1LNWA 1X1BA 4A0ZA 4EJOA 5LHGA 2LF7A 4A3IJ 3LFKA 3DKWA 1P7IA 4PJ0C 4QWQA 2E2JJ 3WGHA 2BVMA 3ZQQA 4UUVA 2EB7A 5B5EC 3M9AA 2LKXA 1O57A 2CMPA 3K9TA 5CJ9A 4OIOF 3BQYA 2HS5A 2WV0A 2L3DA 4XRFA 4WXHA 3BTLA 1TT5B 4D7NA 2E7WA 4ZZDA 3M8EA 1ETOA 2VPRA 1AKHA 2QF7A 2XPVA 5IP9J 3O2PE 4ZDLA 1LQ1A 3K1NA 2D1VA 2ZXHA 1EJ9A 3G71I 4G6TB 1WSUA 5E79C 3M3YJ 3OYCA 3ZPLA 2H94A 5CVRA 2OU2A 1UG0A 4DW6A 1CF7A 2E34A 1S9HA 3OV8A 1OYYA 1IN5A 1ZARA 2L7MP 5CQGA 4XLNF 1ZN2A 3DPLC 1SD5A 4PFOA 3DLAA 2J5OA 1SC7A 2JRMA 3L1PA 3OYNA 4HF2A 3FM3A 3CF2A 1P2FA 3OMYA 3E3VA 3HSEA 2IGKA 1IF1A 1X1DA 3M8JA 4DZPA 4FE7A 3RYRA 1BBYA 2DMUA 1U6GA 1J59A 2KLOA 2VT2A 1B72A 1D5VA 3IKTA 2LRDA 5M5XJ 3K0LA 1BOAA 5KNLA 1CQTA 2LH9A 1A6IA 1TWFJ 2CUJA 5BOXA 1R22A 1R7JA 1GVJA 1MSEC 2HGCA 3U9GA 4DGWB 3PJRA 3GFMA 1FSHA 3E97A 3MKWB 2IRFG 1ZKGA 2Q0OA 5KVRA 1LVKA 2UWMA 3FXKA 2V6CA 2P4WA 3EUHC 2EV0A 3FXUA 5FLXZ 3QQAA 2LK2A 2VXDA 3CCQI 4GRIA 2GBYA 1N25A 2L9VA 5LHHA 3FMRA 2CUEA 2XAUA 1OCOH 2XDVA 1LEAA 4HSTA 4R8HA 4KMFA 4L0ZB 4UB6C 2Z33A 3RYPA 4L5EA 2O8KA 2LR8A 1I6XA 3KP6A 4J00A 2LY2A 4DBQA 5FLMJ 4LG3A 1ZREA 1RZ4A 4AYBN 1UCRA 5FLXK 2L4AA 2VBYA 3H5RA 3FISA 3HJEA 5HLTA 3OY9A 2JT1A 2HVSA 1H9TA 4C3IJ 3HL2A 2YU9J 3QOEA 3PQJA 4A5MA 3DKYA 3AAFA 1JGGA 3CCYA 5LRSA 1AU7A 4ENMA 5FO5A 1I27A 3BR3A 5FKOA 2ZXIA 1MH3A 4ENKA 2XSDC 2KMUA 4AVPA 1BI1A 5K5QA 1JUSA 4CICA 4IHYA 1GV5A 3LMMA 2HQAA 3SZPA 1E0EA 4XRSG 2L5QA 2KRFA 2RNJA 1IUFA 1IDYA 5FRMA 2M45A 3F8CA 4NC8A 2JA7J 2L54A 4FETA 2F5DA 3TW7A 5D6FA 2R93J 3KP2A 4MO7A 1BJAA 2UUZA 3BC8A 4NB5A 1DDNA 4IZZA 3J81Z 3K1MA 1R1VA 2R7ZJ 1KONA 2V1NA 1BM9A 2OCCH 3ZOBA 1RR7A 1SFEA 1R49A 1JKPC 1D0YA 4ZZLA 3OR2C 1R1UA 2E1OA 5D5UB 1BR2A 4XLAA 3H0GJ 3JTGA 1FMVA 5B3SH 2WBMA 2STTA 5E8GA 3S2DJ 2CH0A 2DFIA 2F48A 1WQ2A 5IP6A 1IC8A 3MZYA 5CVJA 3J81K 3U2RA 5IOYA 3LSHA 5ILSA 3LSRA 2M5WA 1L0OC 5IYCJ 2PFBA 3L2VA 2E2HJ 2CUZA 1K4SA 3FMSA 3FZVA 2MBFA 3TL4X 2K40A 3AKZA 2JN6A 1XD7A 2BV6A 5E3NA 2R7XA 5HNFA 1NG7A 2XC7A 4QPQA 3HOUJ 3WTZA 2FA5A 4LG0B 2W1OA 3I4MJ 3GCMA 3KX2A 3SHFA 2FUG2 3OYKA 4ABZA 4HG2A 1MBFA 1XG1A 2EFNA 3OYJA 5FRNA 2OV7A 1BI3A 3G1LA 1IDZA 3K70C 3SFZA 2ELHA 4BHPA 1HSJA 1ERDA 5ICCA 5C3EJ 2COMA 3IRQA 4ZC3A 2ZCWA 2IS6A 3W2VA 1BL0A 3LL7A 1X1PA 1PVEA 3A0BC 2X1EA 2BY1A 2IPQX 1R00A 4B8XA 2HYFA 3PNYA 2DFFA 1XSDA 3DU5A 2KDZA 1YX3A 5E1WA 4XBFA 2NOGA 4DYCA 4Y15A 2XVCA 3F8BA 1R58A 5D8KB 1MD0A 1TT0A 2QKLB 1YJNI 1H88C 3BR0A 3MQ0A 4II2A 4MNUA 2IT0A 3BTCA 2H09A 3TDUC 5EGOB 3ZCOA 3S3NA 2BW3B 3CMMA 1U5TB 3AG3H 4IHTA 4U7DA 1UELB 3KPHA 3FM5A 1RETA 1G6NA 2JVHA 3CJNA 3VYSB 1FP1D 1EH8A 1TW2A 3LSTA 1XSXA 3HOTA 2BGCA 1D8JA 2DA6A 3VSKA 1ZR4A 2F5CA 5EGOA 2VQLA 1H0MA 4CYCA 1W0UA 1U5TA 1U9NA 5LRRA 2EH3A 3LSMA 4I01A 3S16J 3G1MA 2W24A 1OYWA 4PSXA 2A61A 1TLHB 3KZYA 1KU3A 3HDDA 3HXLA 2NVXJ 2QGUA 5L3FA 2QUFA 2ISZA 4E7HA 2EQRA 4RGSA 4E7ZA 4RDUA 2X1DA 5E3LA 4YELA 2PI0A 4OMYA 2IXSA 3NRVA 2Z9OA 2Y2ZA 4YIFA 1T0FC 2JVGA 2O6GE 1R9TJ 2WB1N 3F22A 1VI0A 4IKFA 4OOIA 3R0JA 5GP9A 1E17A 4BE0A 3GW2A 5H6RA 5D4RA 4MTDA 2H8WA 2R3SA 4CXFA 2FSWA 4BE1A 4RAYA 2BY3A 1VQNI 4RM2A 1ETWA 4I0BA 5J8CA 2FRHA 3HRMA 3E6DA 4DJAA 4KDPA 1SD6A 4PJNA 1WH7A 3F72A 3TBIA 1I3AA 4EGYA 1XSVA 1EH6A 4U0YA 4NQWB 2HTJA 1T95A 4XNFA 4CCOA 4ENNA 3RKXA 3ASOH 2ZMEB 3CCMI 5J1RA 1ITYA 1WCMJ 5JHFA 1V5FA 2V26A 1FBQA 2BZTA 4CCLA 1MMNA 1FP2A 5DM6F 3CCEI 3D0SA 3S8PA 2VJ5A 4N9HA 2KIQA 2FXAA 1IGNA 4G7OF 3ZRGA 4JK1X 4NQWA 3VEPA 3LSJA 2Y48A 1XGOA 3A1YA 2EA4A 2ZMEA 1WJBA 2XSJC 4LLLA 2FNPA 3EETA 5ILVA 4EEFG 2K27A 3H1CA 5HODA 4FCYA 3H9GA 1F9NA 3K6GA 3BP8A 2JUCA 1F43A 2KHMA 2W00A 1F1ZA 3D5SC 3JTHA 3BG7A 2EZIA 3FXJA 3GZ5A 2C6YA 3WTTC 3IC7A 1HBXG 4LB5A 2LSOA 3MKZA 5IPAA 2VONA 1JUMA 2M8EA 4CCKA 1Z7UA 4RBOA 3HG9A 4A3FJ 1USTA 3O8HA 1FZPB 2YS9A 4EATA 1AWCA 2HXOA 4XK4A 4R79A 2ECCA 3NARA 3GUDA 4WXDA 1YTYA 2QQAA 1VTNC 3DCFA 4N0BA 1D0ZA 2DJIA 3RZOJ 4XR6A 1Z6TA 1XGNA 2BOLA 2EILH 4RLQA 4PUSA 4J19A 1SVMA 2F2EA 4RAFA 3TOAA 3G2BA 1RUOA 4B43A 2CU7A 4HV5A 3JRIA 3BOQA 1UHWA 2JSPA 1LVAA 4P1WA 3JRHA 3C18A 1LDKB 3CTAA 4XKVA 3CP8A 3GTKJ 2VLAA 2YPRA 2L9NA 1O3RA 2IS4A 2WAQA 4E7KA 4OAZA 3GMEA 1QNTA 2FJ1A 2XIGA 1OLTA 4WXCA 2IS2A 1TWCJ 2OTJI 2DTZA 2P5LC 5M3FJ 2ME6A 3J7AY 1SVLA 1B9MA 2EJRA 3GX4X 5D4SA 1QBJA 1J5YA 3ONQA 2CW8A 2W85A 3BZCA 2LBFB 2KQRA 4L5JA 3KEQA 1BIAA 3KP7A 4BHBA 4RB1A 3GZ6A 2CGPA 4UV9A 3C1DA 3KFWX 2L9SA 1UAAA 3B02A 3ZMSA 2DO7A 1Z6RA 4BU2A 2MH2A 1ON1A 3K4CA 5EJCA 2E1NA 2DI3A 2W25A 4HX7A 4A2UA 3VSLA 2AO9A 2LBFA 4JX4A 3NWSA 4RMNA 5E18F 4XRMA 4GXOA 1FLIA 4HF0A 2W84A 1J2XA 3N4MA 2QQ9A 1TNSA 3Q9SA 3PNTA 1WJAA 3S1NJ 3GYHX 3GEZA 4KYWA 2EZHA 3KIOA 2EZKA 4QLCU 3IRRA 5CVUA 2V79A 1B8IA 1T56A 1STZA 2GXGA 2I5UA 4D1QA 3G73A 2MG4A 3DFGA 2N8GA 4Q5SF 1DGRM 4S0HB 5JLWA 1X3UA 4XONA 2P7CB 2A5WA 4KN7X 1JJ8C 1ZGAA 3SQNA 3IKVA 4BY1J 2CSOA 3FF5A 2JA5J 4UUSB 2X1CA 1S8NA 1KGSA 1G3SA 2MA3A 4U0VA 3ZMVA 1IN6A 3BZ6A 1Z21A 2NS0A 1BI2A 3Q5FA 3GTLJ 3P7NA 3WTUC 2XAJA 1TZLA 2M0CA 1LUJB 3RKWA 3CUQC 4D0PA 3ZQLA 3VB2A 2DPUA 4HSRA 2QBYA 4UUSA 1KU9A 1OR7A 1IZ1A 4AUXA 2X6WA 2XAGA 2CQKA 3SFIA 4JYKA 2LD5A 3DEWA 2K3FA 1QVUA 3WHBA 3BG5A 3R0AA 2Y0SN 2ETHA 3BR6A 1D1CA 3PQKA 3AL0C 2CW7A 2NS7A 3J7AO 1N75A 1YYVA 2F5VA 3I9V2 5FKMA 2B0LA 2FBKA 2P6TA 1GUUA 4X6AJ 2VT3A 1XCVA 1W5TA 4KMUX 4OWRB 3K2AA 3HUGA 2NXNB 2WY7Q 5BMZA 3CCLI 3WTWC 1FNNA 3DPUA 5AIQA 2FMLA 4P5OA 4ETSA 1OMIA 2ESNA 4F7ZA 2AXLA 1MMDA 1WI3A 1OKRA 3B73A 1WVRA 2QQ8A 3B6AA 4ZDPA 3HZJA 1QA6A 3QOPA 2E7XA 4XSZF 3TQNA 3FDYA 4PZJA 3PFIA 2E60A 3BCAA 4HYEA 4A12A 1FOKA 2P7VB 3ESWB 4IQ4A 1S3JA 4BL0B 3JAMK 2XROA 1DPUA 3HOZJ 3S15J 1TQMA 1LEBA 2WWYA 3QPHA 3BJAA 1OCCH 3MCZA 1MNDA 1HDDC 2GWRA 1B59A 2LYCA 3VFZA 3K4JA 4KJZA 4XQFA 3HTUA 3BDDA 1K78B 4BXUA 4CGZA 1J7KA 2DMQA 1Z77A 2XPUA 4IX7A 2WC2A 4LD5A 2M4GA 4CCMA 2JTVA 4LLNA 5GAGJ 2NNYA 4IO9F 2OTLI 3IWFA 5J1YA 1MGTA 5D6EA 1W7PB 4HX4A 1W5CC 3S1MJ 2DK8A 1FY7A 1KYZA 2XHKA 3LWFA 3GXOA 5HS7A 2KFDA 4ZYHA 1T33A 4A3KJ 2E1MC 4JX6A 5D5VB 3HKZA 1UJ8A 2K9SA 1X4OA 2CW0F 4XN3A 3I53A 1R1TA 4ZYEA 2Y75A 3ABTA 4Y52J 3ISPA 4IOCF 2DLLA 1O7FA 2L0KA 1W7PA 2VOOA 3RSNA 4N4OB 1Y56A 4GDFA 3H3VK 2VE8A 4OU0A 2FOKA 3JRAA 1X19A 2WADA 2Z2SB 4B3AA 2E35A 5HLIA 2CV2A 1XMAA 3E5QA 1ZR2A 2V7FA 4B4CA 4EVIA 3WTXC 1GV2A 2VKHA 4F93B 3CJQB 1IAWA 2CO5A 5CLSA 1DGWY 3QP5A 2XPWA 1G59A 3CJRB 3K1PA 5JHUA 2K9QA 1KZHA 5KK1A 2XASA 3NAUA 4XICA 2EPFA 3GTMJ 2E71A 2XRNA 2VUMJ 5HS8A 2HPIA 1OCTC 2HXIA 4ZJZA 3DQVC 2OJED 3WG9A 5BPIA 3FXMA 4M6VA 2RAEA 4MLOA 3CCJI 2OUMA 1U8RA 2ZB9A 3I55I 2HOAA 5F6FA 2X0LA 1DUXC 1TP4A 1Q1VA 5H2FC 1GVDA 1LFBA 3HC7A 2IJLA 5HVQC 3L2RA 3DWLE 5DTDA 4XMYA 2HDCA 4I76A 2HU9A 2DT6A 3S1QJ 2VL8A 3O8GA 3OIOA 1WH5A 4LITA 1W7PD 4BAYA 3NQOA 3K4KA 1A31A 1ODDA 3UKGA 1KYWA 3QPLA 3FK7A 3HHGA 5L3GA 2P0WA 3L2CA 3QAHA 2QSHX 2X6YA 2ICWG 3PO2J 2VXZA 2P81A 3S93A 4E4HA 1AHDP 3HOSA 2B9SA 4Q48A 1K6YA 3GLXA 5L3CA 1R23A 2E36A 4XKWA 4LK1F 3G4SI 1FOWA 2KPMA 4BXFA 3IV5A 4M9XA 3M1EA 4AIDA 3ZR8X 3ZQGA 2XF7A 3C2HA 5LHIA 1XDSA 1HF0A 1D1BA 3MZHA 2NOJB 1QQIA 1JJ6C 3G3ZA 4L5IA 2EFPA 2A6HF 1VQMI 3W6VA 3LSPA 1EKEA 1ZHFA 1N77A 1GLNA 3DTEA 2PEXA 3SDBA 3MN2A 4I09A 2FMYA 5B1BH 1Y1VJ 5HNHA 3GTJJ 4BACA 2BY2A 2K4BA 1ZGJA 3HOWJ 3PUBA 1ZTRA 4ZDOA 3K4LA 1Z1DA 1V5EA 3GO5A 4UVBA 4CZZA 3S2WA 3ZQFA 3JRFA 2DA1A 3C2BA 1NTCA 3U1DA 1UHMA 4IJAA 2IGMA 1X1CA 2FOWA 3N05A 2R5ZB 3OYFA 2LREA 2K3PA 3HOXJ 1O3TA 3ULQB 2RV8A 4MEXF 4BJ5C 4A3BJ 2JMWA 2YX7A 4GYIA 5LGUA 1SAUA 2ZSIB 4Q47A 2L7ZA 3RTRA 1BI0A 1VQ9I 5L3BA 2FBIA 3OS0A 5K7FA 3J80Z 2R0QC 2RNGA 4ZYDA 1YS6A 4KN4X 1QZZA 3ZQCA 3BR2A 3F3XA 1F36A 1Z3YA 2VC1A 4CYDA 5FD5A 5E1ZB 2LTPA 4BHCA 3VDXA 2ZXWH 2VJ4A 1FMWA 1HQCA 3TGNA 5IY5H 4JX5A 4M3GA 4BY7J 1ZRFA 3K2ZA 1XC5A 1NK2P 4BBSJ 4A3EJ 1JT0A 2XAQA 3M4OJ 4E7JA 1RRJA 3ELKA 2F4MB 3J80K 3FXLA 5HDGA 4ESJA 3RKYA 3CCSI 3GFIA 3MD2A 1IW7F 3ERED 3FMQA 1JI8A 1X3WB 2B63J 4IQJA 3BTJA 4ENJA 1TQPA 3V4GA 1T8IA 4UV8A 1IXCA 2DODA 4IRGA 3TMOA 2B7EA 2XKPA 4AWXB 1PP7U 2CRGA 3IH3A 4O5VA 1S7AA 2PN6A 3P5JA 3S32A 1DU6A 4BBRJ 3WE2A 1APLC 5CVVA 2A05A 2MLKA 4N4NB 4P9UA 1SD4A 3DU6A 3H5AA 3JRDA 4UXNA 5ICFA 1RPWA 2D45A 2K4JA 3DPTA 1I3QJ 2XKOA 3VODA 1YW9A 2R4GA 4C3JJ 1FBSA 3PNVA 4D9JA 4EGZA 3FKJA 1V55H 2R7VA 1H9GA 1VQ5I 4NNJA 3KZIC 1Z91A 2EWNA 3ZGKA 1MSFC 4BNCA 1LFUP 3HOVJ 4G12A 2DA4A 4ZH4F 1HOMA 1K7AA 2ZJRF 4M72A 1W5SA 5D8LB 2VBWA 1ZK8A 3QWLA 3F23A 1K6OA 3QYBA 5ERIA 2QENA 3H0DA 3H3UA 3QYFA 1SFKA 5C4JJ 2MLGA 2WA0A 2K85A 5IOZA 1BW5A 4AC0A 2IEKA 4RB2C 1YO5C 2OAZA 3KLOA 2K86A 5BS6A 3IH4A 3HHHA 1J09A 2OZUA 4FHTA 2P5VA 2Y31A 4AU7A 3PIOF 2M34A 3IUOA 5LEJA 3LA7A 4P9FA 1YFHA 4LG0A 4UUTA 4M6XA 3ZN1A 3C2GA 5L3EA 5A2QZ 3L2QA 4EQQA 1LKXA 1FYMA 1NK3P 4X0GA 4O3MA 3OOUA 4CUGA 3H9QA 4HQMA 1W36C 2WAFA 2Z1DA 2L2OA 3HPHA 5FFZA 4ANJA 3K70D 1FC3A 1WJDA 2BEOA 3HM5A 2V1XA 2GM4A 2IA1A 1VQPI 2ME0A 2QKMB 1ZH5A 2VJJA 4BGDA 3E6BA 1KQ8A 1JKRC 2DXIA 2HWVA 1NHAA 3JSOA 2YSRA 2QYOA 1ZGWA 3MKYB 2O61A 2VODA 2QCOA 3KYLA 3QPTA 3C7JA 2R7SA 2X6OA 4YFKF 2BHYA 4XOPA 4HW0A 1RI7A 2BW3A 1O7LA 5ILUA 1ZG3A 2XAFA 4UVAA 2AS5F 1RESA 2K9NA 2ESHA 3ZMZA 4G94A 1G3WA 2QZ8A 3CMYA 1A35A 1S7OA 4XKCA 4NC6A 2GXAA 1T98A 3WU0A 5D5WB 1FX7A 5J8FA 3ZQIA 1TC3C 1JUPA 1MIJA 3CMAI 1MNMC 2FX0A 1MMGA 5EZHA 2MW8A 3OWTA 3VYUB 3I4NJ 3JRBA 2ADUA 1K83J 1CGPA 4HNTA 3OYAA 4MGRA 1YITI 2HPMA 1YIOA 1F4KA 3BQZA 1JTYA 4QIWN 1HDPA 3SEZA 4Q4ZF 3CD6I 2AHQA 2IP2A 3FXQA 4HLXA 3CLOA 1VQKI 4L9NA 1IG7A 2ZC2A 2Y0MA 1EH7A 2NAZA 3KYCB 1BJZA 5J1UA 3OYEA 3CO7C 2ZXJA 1P4AA 2IAIA 2WAQN 1JGSA 2RQQA 2HKOA 1V5GA 1VQ4I 2JQ7A 1FJLA 1MKMA 2AQEA 3S1RJ 5EZGA 4MHGA 5ED4A 3R61A 4CA0A 3M8FA 5E20A 3K10A 5AONA 4HNVA 3K69A 5JR3A 1KA8A 2DMNA 3Q0UA 3GZNB 1Z05A 4UB8C 2PMHA 2J5PA 2F4IA 3BJOA 1DP3A 5K7ZA 1MBGA 5LBQA 2O5RA 3KETA 3RCOA 3EYIA 3NEUA 4KIFA 1IRGA 3HBLA 3FBNB 1UMQA 1S72I 4IF4A 4BDYA 4ZTFA 2LF8A 3ML6A 3JCUC 4LGWA 1MBEA 5FB2A 2Y9ZA 2M8GX 5F1JA 5DCMB 2G9WA 2DBBA 4F92B 1J75A 1O3QA 5EEGA 3A03A 3FHZA 1V4RA 5JVGF 1YJWI 4B44A 3OSFA 4KITB 1Y39A 2EV5A 3R60A 3MVPA 1K79A 2FD5A 2ZJ2A 3FBIB 1T38A 2DPDA 3ZMDA 2GIVA 1C0WA 4M3BA 5DCMA 4HLYA 2QSGX 5ICEA 2XGXA 2EFWA 1I6HJ 1EA3A 1JT6A 2OPTA 5HLHA 4E7IA 4P55A 2RKHA 4BUPA 2KT0A 4WX9A 1HC8A 3K4BA 2D2WA 3K7AJ 1ZRDA 3DXJF 9ANTA 2PMUA 4NUBA 4A3MJ 3BZKA 1AA7A 4EJVA 3DTKA 5IYDJ 3OYBA 1OCRH 3F6OA 5J6XA 1T08B 3T8TA 5TJJA 3LA2A 1B9NA 2R7UA 3UR3C 4MFDA 2M4KA 3WGIA 2HYGD 1P92A 3PM1A 4Z2YA 2EFQA 1XPXA 3PSIA 1WHUA 1ETYA 1HW1A 4M3FA 3DEUA 4FX4A 5IT3A 1D8KA 3BJ6A 1EF4A 1QZYA 3BY6A 3UNGC 4XM3A 1LJ9A 5H20A 5GPCA 2PMZA 4XLFA 1MZBA 2L4MA 2WV1A 4C30A 2M9HA 3DBRB 4FISA 4V2FA 3IL2A 1R5ID 2OD5A 2QA4I 4HX8A 2LLKA 1O4XA 4GCVA 2ZJQF 3FWEA 3TP3A 1Z3XA 2IA2A 2GZWA 2XRLA 3H3ZA 2YR2A 4G8XA 3LSIA 3CUQB 3MMYB 3A02A 5DDGA 4D5CA 3D5RC 4DOZA 2O8XA 3T8RA 2KIMA 4A5NA 5LFAA 5J47A 2BXYA 3HRSA 2ECBA 2VQCA 1VF9A 4U0WA 1O3SA 1HCRA 4NDLA 3DBHB 4XLHA 3CCUI 3HGGA 1OJLA 2H1LA 3SDGA 1KQ9A 4NC7A 2G7HA 5FGMA 3FIWA 3AL0B 1PP8F 1VZ0A 1BOBA 5M5WJ 2K02A 1ZG5A 2VASA 1P6RA 5B66C 4L9TA 4A0XA 5JVTA 1ETXA 3DV8A 4PCQA 2IW5A 2ELKA 1Z7LA 4PDKA 4J01A 2OCEA 2A68F 3KEYA 4FASD 1P9QC 1VQOI 3COAC 3OYMA 3ECOA 1FOYA 2WAEA 5JI6A 3J7ZI 2EFOA 2NYXA 2VB6A 2CFXA 2I8DA 1N78A 3ABKH 4RGUA 2DT5A 1WFXA 1JE8A 2DK5A 2DAOA 1W4MA 5F04A 2ISYA 4NHJA 3T5XA 4CCNA 4HOBA 3M07A 5E8IA 4KNYA 2BVLA 4WCGA 1REPC 2PJPA 2VBZA 3EDPA 4NBQA 3K4MA 3U1KA 1I50J 4LJZF 3ASNH 3BR1A 5K5OA 2W48A 4KIGA 4F3QA 4UY8I 3OL4A 3PO3J 4HA8A 2DYRH 1E3OC 2VIXA 4KFCA 2QQBA 3I59B 4H4KC 3LAPA 3RPQA 5EDNA 4AIJA 2HOEA 1I39A 1M1EB 3ZXSA 1WRJA 2M30A 3KYDB 4IL6C 1HW2A 2CS3A 3B6CA 2ID6A 4MTEA 1PUFB 4L9VA 4C9YA 2EIMH 4P96A 1WJFA 2LC2A 3BLYA 1X1AA 2R7WA 4HQEA 2E1MB 2F5EA 4DBRA 1DPRA 3QPSA 2FNAA 2MC4A 2FQ3A 2O9LA 1SD7A 2VJIA 3WE3A 4XIDA 1PUFA 1IN7A 4LOCA 1NH3A 3RI4A 2IS1A 1MW7A 4ASNA 5EEAA 1B1BA 2NVQJ 5DD8A 1YX5A 2OQGA 4I7HA 4A6DA 2E1CA 2CUFA 3M1CA 5DCFA 5C44J 2JWTA 4ESFA 3E1SA 4JBAA 3L09A 2ACJA 3ZP5A 2RQPA 2X51A 2BBYA 1Y8QB 2EIJH 3L00A 1R36A 3IH2A 1TL8A 4MIMA 1GXQA 4XN0A 2IA0A 2NVTJ 3R4KA 3HSRA 2PG4A 3VWBA 4IRIA 3P9KA 4G6DA 1SFXA 4B48A 2Z3YA 2ZNYA 4IVNA 4G7ZF 1MMAA 3CDHA 5K1YA 4RA2A 4W1UA 1KQ0A 3T0YA 1FPQA 4AVZA 2NRAC 4V19K 1B4AA 1VFCA 5D5XB 5EG0B 3F21A 1ETQA 1U0JA 2DQLA 5GPAA 4WK8F 4BQAA 3CC4I 3ROUA 2ELJA 5FFXA 2H8RA 3QP6A 3L7WA 3E5UA 3E5XA 1SFUA 1SAXA 3RQ4A 3H36A 4A93J 1YE9A 3LSKA 3SXYA 5M5YJ 3OYDA 4QPOA 1IUYA 2VKVA 1K78A 2G0EA 5GTHC 1RKTA 4DYQA 3ABLH 2LVSA 4ESBA 2M87A 4MEYF 1LPQA 4IHVA 4S04A 1UZCA 4HV6A 4I0AA 1T6SA 5DV5A 2DA2A 4L0YB 3R6SA 4I6ZA 4M3EA 5DS9A 2XAHA 4AIHA 2R92J 3RZDJ 1MJAA 3GFLA 1TWHJ 3H92A 1TNTA 1PDNC 1OCZH 3K4NA 3MWMA 3TOBA 3TP0A 4A3CJ 2DFHA 4DYRA 2ZJPF 3AFHA 4G6QA 2TRTA 1XGMA 2W4SA 3C3WA 4FE4A 4A69C 1GXPA 2AXTC 3SEQA 2DDBA 2V1DA 4RLFA 2KRHA 5H6QA 2KKOA 2CQNA 3TO7A 3W6JB 2E5NA 4CSWA 4ZYGA 1ORKA 3MFKA 2BYVE 2ZO4A 4C3HJ 1WKMA 3JR9A 2EA2A 2R7RA 2A07F 3KCCA 2CYYA 3P9IA 5EEHA 1VQ7I 2Q8KA 3MKLA 5FLVA 1YLFA 4PK4A 4V2GA 2LFBA 4IHSA 2D1HA 4A3LJ 2GQQA 5JLXA 4OIRF 3OL3A 2MYSA 1R71A 1AKHB 4CO8A 2Z99A 5HS9A 3F8FA 3HB9A 4L9JA 4HEA2 3OYLA 4I02A 2FBHA 1PYVA 1Y0UA 3EUHA 1ZLJA 3WG7H 4I98B 1A36A 2VKEA 3OR1C 2ZSHB 1H8AC 4Y33A 2LKSA 4KIBA 2OZ6A 1ON2A 2W57A 1V3FA 1CF7B 1I5ZA 2X9DA 3A01B 2H6CA 4AIKA 2QWWA 1ZLKA 1SVOA 1XS9A 5GAEJ 4IXAA 4F55A 3GTGJ 4XRSA 1PUEE 2H1KA 3IAM2 3BG3A 4S05A 2KRCA 4Y4RA 2DU9A 3BCBA 2JJ7A 2XB5A 4A3JJ 3PFYA 1HXDA 5DUIA 4A6EA 4E7SA 1WGXA 3A01A 1WZ2A 3TKYA 1A6QA 2CG4A 2A6TA 5KHDA 4PGGA 4H0EA 2GXBA 1ZELA 3TO6A 3BWGA 2M1BA 5FROA 1B72B 4GFBA 3WTVC 4XLPF 3F6VA 3MAJA 3A2KA 1ACIA 4CCJA 2EIKH 1Z9CA 1ONVA 4M74A 3GLLA 5CVIA 4CHUA 1VQ6I 2HQRA 2FEZA 3D5LA 3CCRI 4EM2A 1WI9A 1K61A 3JREA 1FBUA 4LFUA 2YU3A 5DYMA 4D5FA 1XDUA 3QU6A 3ZQ7A 1Y6IA 5CYVA 2RN7A 4BEHB 1OQYA 2VPLA 5F27A 5E3OA 2E5ZA 4JP0A 2FU4A 1Z0XA 2JZYA 3BG9A 4MQVA 3MEXA 3VYRB 4DQ2A 3KP3A 2DA3A 1P7JA 1SEUA 1T2KA 1ZG1A 5E1XA 4RGRA 1J0RA 5IYBJ 1X2MA 4U87A 4BYYA 5HLGA 2LY9A 4BEHA 2VC0A 1WJEA 4IRHA 5BQTA 5J4VA 3CO6C 4HRIA 1TTYA 3GFJA 5K5RA 3F8NA 5FD6A 1D0XA 4BJTA 2R5YB 2IBDA 2KDOA 1GDTA 3E6MA 2CQ7A 4DZJA 2LY1A 2ZNZA 2KIUA 5KAIC 2R5ZA 2FQ4A 2W7NA 3P9CA 1YW8A 4BS9A 3S14J 2RDPA 4QTRA 3W6KB 2VOPA 1IXSB 4PGHA 4XLCA 2Z16A 3ERMA 5J3LA 2R5YA 1POGA 2WTEA 1ENHA 1OYIA 4CDGA 1QPIA 4WF2A 5E17F 4A3DJ 3LQRA 5TISC 2BE5F 2PX9A 1D1AA 4YIRX 2CQXA 3N97A 1QO0D 4YRVA 3JRGA 2R7FA 4KISA 3W2WA 2MH9A 1U78A 1JKOC 3HRUA 4X1EA 5ICGA 2HQNA 1YG2A 2KISA 2QSFX 4O6JA 1QGPA 4XOTA 3F9KA 4KT5C 3QYEA 1XMKA 2HZTA 2A3SA 4UVCA 1UFMA 2ZFWA 2QVOA 2M7AA 3SZTA 4UHTA 3DF8A 1VNDA 3OYGA 3HPGA 3SJMA 4WWCA 2H6BA 4OAYA 1G4DA 4M73A 2DA7A 3RPUA 1FTTA 2Y9YA 2YX4A 4EJWA 1JTXA 3LQQA 1IRFA 4PJMA 4RGXA 1JXSA 5CPRB 4EJTA 1X3ZB 2RC4A 2UV1A 4OIQF 3CLQA 3BT9A 4EM1A 3PSFA 1IV6A 3EPZA 1USSA 3I58A 5KAFC 3IP4B 5JFRA 3HGYA 1IJWC 2HOTA 2L02A 4YG2F 3CC7I 5J4YA 1HKQA 2X48A 2EBIA 3AG2H
chains in the Genus database with same CATH topology
1WPKA 4UUSA 3VPRA 3A03A 1FIPA 4AUXA 3M3YJ 3SFIA 4JYKA 2LD5A 3OSFA 3DEWA 1QVUA 4B1RA 3WHBA 3BG5A 4DW6A 3MVPA 2Y0SN 2FD5A 2E19A 3BR6A 2L7MP 3GTOJ 4M3BA 2NS7A 1G2HA 1I6HJ 5FKMA 3L1PA 3BR5A 1JT6A 2OPTA 3S17J 1GUUA 2KT0A 4X6AJ 1JKQC 3K7AJ 1QRYA 3K2AA 9ANTA 3FK6A 3LOCA 4A3MJ 4DZPA 4FE7A 5IYDJ 1LE8B 1FEXA 2DMUA 1WI3A 1B72A 5M5XJ 4MFDA 3B6AA 3PM1A 1H89C 1CQTA 4BKXA 1A6IA 1TWFJ 1ETYA 1MSEC 4M3FA 1LE8A 1ZKGA 3HOZJ 3S15J 1EF4A 1OFCX 5FKKA 2L7FP 2XGCA 5GPCA 1HDDC 3QQAA 2LK2A 2WV1A 4FISA 2M9HA 2GBYA 4V2FA 1ZQ3P 2CUEA 1OCPA 2LLKA 1D5YA 2DMPA 1O4XA 2DMQA 3JRCA 1Z77A 2XPUA 3TP3A 4CYCB 5IP7J 4L5EA 2D5VA 2O8KA 2XRLA 2LR8A 3CDLA 3HEFA 5FLMJ 5J1YA 3A02A 4D5CA 2CJJA 4AYBN 2NVYJ 3FISA 3S1MJ 4C3IJ 2ECBA 2YU9J 1VF9A 1HCRA 1T33A 4NDLA 4A3KJ 3HGGA 4JX6A 2CQQA 1JGGA 1OJLA 5FJ8J 2K9SA 3SDGA 3CCYA 1AU7A 5F0CA 3FIWA 2DMTA 4Y52J 3BR3A 5M5WJ 2L0KA 2XGEA 5FKOA 3GBGA 1MH3A 4FTHA 2XSDC 2HDDA 4IHWA 1Y1WJ 1X58A 2ID3A 1ETXA 1JUSA 3LNQA 1ETVA 2ELKA 3H3VK 4IHYA 1GV5A 2PMZN 4XRSG 3S2HJ 5K7HA 5EYRA 3JRAA 1IUFA 1IDYA 4B3AA 3FKIJ 3G1OA 2JA7J 1ETKA 1ZR2A 4B4CA 3TW7A 2R93J 1GV2A 4MO7A 5F0HA 1DU0A 1TWGJ 2R7ZJ 5F04A 2XPWA 3ZOBA 1RR7A 1JKPC 2K9QA 3NAUA 4XICA 2E1OA 5F0FA 3GTMJ 1YRNB 2VUMJ 3H0GJ 1FIAA 1I50J 3S2DJ 1OCTC 2HXIA 3BR1A 5IP6A 2HOSA 1IC8A 3TEDA 2OF7A 2EZLA 2W48A 1UHSA 2O7OA 2RAEA 4M6VA 4MLOA 5IOYA 3LSRA 2ZB9A 1U9OA 3PO3J 2HOAA 5IYCJ 1E3OC 2E2HJ 2XGDA 1Q1VA 2JK3A 1GVDA 2GLOA 1LFBA 1YRNA 5EDNA 5DTDA 3E7LA 3Q0WA 2K40A 4I76A 3B6CA 2JN6A 2ID6A 5E3NA 1PUFB 3S1QJ 3O8GA 3OIOA 1WH5A 3HOUJ 3GTPJ 5E3MA 3QPSA 2HQ5A 3I4MJ 3UKGA 2O9LA 3QPLA 3FK7A 2Y30A 4QSHA 1RKWA 2MSYA 4XIDA 4ABZA 2TCTA 1MBFA 1PUFA 1XG1A 3PO2J 2P81A 4LOCA 4C2MJ 5EEAA 3G1LA 1AHDP 1IDZA 1X2NA 2NVQJ 3HOYJ 5C3EJ 2NS8A 2CUFA 1BL0A 3IV5A 5C44J 2JWTA 2DN0A 3ZQGA 2DA5A 1HF0A 3Q3SA 2KDZA 3IH2A 4MIMA 1JJ6C 2NOGA 4DYCA 2NVTJ 1H88C 3W6VA 3LSPA 3BR0A 3LSGA 3BTCA 3MN2A 5EGOB 1Y1VJ 4D7MA 4W1UA 5BNGA 3GTJJ 2JA6J 5FKLA 3HOWJ 1VFCA 1ZTRA 5EG0B 1ETQA 5GPAA 4W97A 1QVTA 1RETA 2HYJA 2H8RA 3ZQFA 3JRFA 2DA1A 3C2BA 1NTCA 4A93J 5M5YJ 2DA6A 2VKVA 2G0EA 1ZR4A 1RKTA 4DYQA 5EGOA 2R5ZB 2LVSA 4CYCA 1W0UA 3HOXJ 1U9NA 4IHVA 2EH3A 4A3BJ 2JMWA 4Y7NJ 3S16J 2DA2A 2E2IJ 3G1MA 4I6ZA 2L7ZA 4M3EA 5DS9A 5K7FA 2R0QC 3HDDA 1A5JA 2NVXJ 2R92J 5F08A 3WHCA 3ZQCA 1TWHJ 3RZDJ 3BR2A 1F36A 2EQRA 3TP0A 4A3CJ 4DYRA 4RDUA 3ZQHA 5E3LA 2TRTA 3D1NI 2LTPA 4FE4A 2I10A 4A69C 2Y2ZA 2JA8J 4JX5A 4M3GA 4BY7J 4BBSJ 1NK2P 1XC5A 2WB1N 1R9TJ 1VI0A 4A3EJ 1JT0A 1B8IB 3M4OJ 1HLVA 5GP9A 1ORKA 4IEJA 4C3HJ 3F0CA 3JR9A 5C4XJ 2B63J 5M3MJ 3BTJA 1ETWA 3MKLA 5FLVA 4V2GA 4MFEA 2LFBA 1WH7A 4A3LJ 2CRGA 3IH3A 3HKZN 5JLXA 1DU6A 4BBRJ 1APLC 1MBJA 1AKHB 3JRDA 5J1RA 4A3GJ 1ITYA 1WCMJ 1RPWA 3HB9A 1I3QJ 1W0TA 4C3JJ 1IGNA 2VKEA 3GTQJ 1MSFC 1H8AC 1LFUP 3LSJA 3HOVJ 2YUSA 4G12A 2DA4A 1HOMA 2X9DA 3A01B 4EEFG 1XS9A 1SANA 1ZK8A 5HODA 4FCYA 2MGQA 1F43A 3GTGJ 4XRSA 2H1KA 5C4JJ 3BG3A 1TWAJ 5IOZA 2JJ7A 2EZIA 2XB0X 2XB5A 4A3JJ 1SFOJ 1BW5A 4AC0A 2IEKA 3IH4A 1WGXA 2HI3A 3A01A 5IPAA 2Y31A 1UG2A 1JUMA 2M34A 4RBOA 4A3FJ 3O8HA 2YS9A 1B72B 4GFBA 1BA5A 4UUTA 2HXOA 4XK4A 2ECCA 3NARA 3DCFA 3RZOJ 1NK3P 2DJNA 3OOUA 1IRZA 3Q0VA 3BTIA 2COBA 4J19A 1MBKA 1K61A 3JREA 1MH4A 3HM5A 2GM4A 4D5FA 3JRIA 2CU7A 3JRHA 2ME0A 1JKRC 5F27A 3GTKJ 5E3OA 4JP0A 1Z0XA 3BG9A 1ZGWA 2QCOA 2DA3A 1P7JA 4M3DA 2FJ1A 2X6OA 1TWCJ 3RKQA 4IHXA 5IYBJ 1X2MA 2DTZA 1BW6A 5M3FJ 2ME6A 3CQZJ 2LY9A 2VI6A 1MBHA 5EG0A 1RESA 2K9NA 3CMYA 2IBDA 2R5YB 1GDTA 2LP0A 4DZJA 5EF6A 3ZQIA 2R5ZA 1JUPA 1TC3C 2FQ4A 1MNMC 2FX0A 5EZHA 2MW8A 3S14J 4QTRA 3OSGA 3JRBA 3I4NJ 1K83J 5J3LA 3BQZA 1JTYA 2AO9A 1HDPA 4JX4A 4QIWN 2R5YA 2AHQA 1POGA 1ENHA 4XRMA 1IG7A 3RQIA 1QPIA 1BJZA 5J1UA 2WAQN 2IAIA 4A3DJ 3TW6A 1FTZA 3S1NJ 2CQXA 4BXXJ 2EZHA 3JRGA 1JKOC 1U78A 2EZKA 4X1EA 2M2EA 5FKNA 1FJLA 1B8IA 1T56A 3S1RJ 2MG4A 5EZGA 1S7EA 2L9RA 2N8GA 1GT0C 1U8BA 4S0HB 5JLWA 4HNVA 1VNDA 1JJ8C 3SJMA 2DMNA 3Q0UA 4A3IJ 4BY1J 1P7IA 2DA7A 2E2JJ 2JA5J 5K7ZA 1FTTA 2Y9YA 1MBGA 4UUSB 1JTXA 2LKXA 3BQYA 3HBLA 3BT9A 1UMQA 3BTLA 4D7NA 3GTLJ 1ETOA 2VPRA 1AKHA 1IV6A 2HOTA 1MBEA 2QF7A 2XPVA 3HGYA 5IP9J 2M8GX 2Y9ZA 2M0CA 1IJWC 5F1JA 3ZQLA 2X48A 2EBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPK A;  4UUS A;  3VPR A;  3A03 A;  1FIP A;  4AUX A;  3M3Y J;  3SFI A;  4JYK A;  2LD5 A;  3OSF A;  3DEW A;  1QVU A;  4B1R A;  3WHB A;  3BG5 A;  4DW6 A;  3MVP A;  2Y0S N;  2FD5 A;  2E19 A;  3BR6 A;  2L7M P;  3GTO J;  4M3B A;  2NS7 A;  1G2H A;  1I6H J;  5FKM A;  3L1P A;  3BR5 A;  1JT6 A;  2OPT A;  3S17 J;  1GUU A;  2KT0 A;  4X6A J;  1JKQ C;  3K7A J;  1QRY A;  3K2A A;  9ANT A;  3FK6 A;  3LOC A;  4A3M J;  4DZP A;  4FE7 A;  5IYD J;  1LE8 B;  1FEX A;  2DMU A;  1WI3 A;  1B72 A;  5M5X J;  4MFD A;  3B6A A;  3PM1 A;  1H89 C;  1CQT A;  4BKX A;  1A6I A;  1TWF J;  1ETY A;  1MSE C;  4M3F A;  1LE8 A;  1ZKG A;  3HOZ J;  3S15 J;  1EF4 A;  1OFC X;  5FKK A;  2L7F P;  2XGC A;  5GPC A;  1HDD C;  3QQA A;  2LK2 A;  2WV1 A;  4FIS A;  2M9H A;  2GBY A;  4V2F A;  1ZQ3 P;  2CUE A;  1OCP A;  2LLK A;  1D5Y A;  2DMP A;  1O4X A;  2DMQ A;  3JRC A;  1Z77 A;  2XPU A;  3TP3 A;  4CYC B;  5IP7 J;  4L5E A;  2D5V A;  2O8K A;  2XRL A;  2LR8 A;  3CDL A;  3HEF A;  5FLM J;  5J1Y A;  3A02 A;  4D5C A;  2CJJ A;  4AYB N;  2NVY J;  3FIS A;  3S1M J;  4C3I J;  2ECB A;  2YU9 J;  1VF9 A;  1HCR A;  1T33 A;  4NDL A;  4A3K J;  3HGG A;  4JX6 A;  2CQQ A;  1JGG A;  1OJL A;  5FJ8 J;  2K9S A;  3SDG A;  3CCY A;  1AU7 A;  5F0C A;  3FIW A;  2DMT A;  4Y52 J;  3BR3 A;  5M5W J;  2L0K A;  2XGE A;  5FKO A;  3GBG A;  1MH3 A;  4FTH A;  2XSD C;  2HDD A;  4IHW A;  1Y1W J;  1X58 A;  2ID3 A;  1ETX A;  1JUS A;  3LNQ A;  1ETV A;  2ELK A;  3H3V K;  4IHY A;  1GV5 A;  2PMZ N;  4XRS G;  3S2H J;  5K7H A;  5EYR A;  3JRA A;  1IUF A;  1IDY A;  4B3A A;  3FKI J;  3G1O A;  2JA7 J;  1ETK A;  1ZR2 A;  4B4C A;  3TW7 A;  2R93 J;  1GV2 A;  4MO7 A;  5F0H A;  1DU0 A;  1TWG J;  2R7Z J;  5F04 A;  2XPW A;  3ZOB A;  1RR7 A;  1JKP C;  2K9Q A;  3NAU A;  4XIC A;  2E1O A;  5F0F A;  3GTM J;  1YRN B;  2VUM J;  3H0G J;  1FIA A;  1I50 J;  3S2D J;  1OCT C;  2HXI A;  3BR1 A;  5IP6 A;  2HOS A;  1IC8 A;  3TED A;  2OF7 A;  2EZL A;  2W48 A;  1UHS A;  2O7O A;  2RAE A;  4M6V A;  4MLO A;  5IOY A;  3LSR A;  2ZB9 A;  1U9O A;  3PO3 J;  2HOA A;  5IYC J;  1E3O C;  2E2H J;  2XGD A;  1Q1V A;  2JK3 A;  1GVD A;  2GLO A;  1LFB A;  1YRN A;  5EDN A;  5DTD A;  3E7L A;  3Q0W A;  2K40 A;  4I76 A;  3B6C A;  2JN6 A;  2ID6 A;  5E3N A;  1PUF B;  3S1Q J;  3O8G A;  3OIO A;  1WH5 A;  3HOU J;  3GTP J;  5E3M A;  3QPS A;  2HQ5 A;  3I4M J;  3UKG A;  2O9L A;  3QPL A;  3FK7 A;  2Y30 A;  4QSH A;  1RKW A;  2MSY A;  4XID A;  4ABZ A;  2TCT A;  1MBF A;  1PUF A;  1XG1 A;  3PO2 J;  2P81 A;  4LOC A;  4C2M J;  5EEA A;  3G1L A;  1AHD P;  1IDZ A;  1X2N A;  2NVQ J;  3HOY J;  5C3E J;  2NS8 A;  2CUF A;  1BL0 A;  3IV5 A;  5C44 J;  2JWT A;  2DN0 A;  3ZQG A;  2DA5 A;  1HF0 A;  3Q3S A;  2KDZ A;  3IH2 A;  4MIM A;  1JJ6 C;  2NOG A;  4DYC A;  2NVT J;  1H88 C;  3W6V A;  3LSP A;  3BR0 A;  3LSG A;  3BTC A;  3MN2 A;  5EGO B;  1Y1V J;  4D7M A;  4W1U A;  5BNG A;  3GTJ J;  2JA6 J;  5FKL A;  3HOW J;  1VFC A;  1ZTR A;  5EG0 B;  1ETQ A;  5GPA A;  4W97 A;  1QVT A;  1RET A;  2HYJ A;  2H8R A;  3ZQF A;  3JRF A;  2DA1 A;  3C2B A;  1NTC A;  4A93 J;  5M5Y J;  2DA6 A;  2VKV A;  2G0E A;  1ZR4 A;  1RKT A;  4DYQ A;  5EGO A;  2R5Z B;  2LVS A;  4CYC A;  1W0U A;  3HOX J;  1U9N A;  4IHV A;  2EH3 A;  4A3B J;  2JMW A;  4Y7N J;  3S16 J;  2DA2 A;  2E2I J;  3G1M A;  4I6Z A;  2L7Z A;  4M3E A;  5DS9 A;  5K7F A;  2R0Q C;  3HDD A;  1A5J A;  2NVX J;  2R92 J;  5F08 A;  3WHC A;  3ZQC A;  1TWH J;  3RZD J;  3BR2 A;  1F36 A;  2EQR A;  3TP0 A;  4A3C J;  4DYR A;  4RDU A;  3ZQH A;  5E3L A;  2TRT A;  3D1N I;  2LTP A;  4FE4 A;  2I10 A;  4A69 C;  2Y2Z A;  2JA8 J;  4JX5 A;  4M3G A;  4BY7 J;  4BBS J;  1NK2 P;  1XC5 A;  2WB1 N;  1R9T J;  1VI0 A;  4A3E J;  1JT0 A;  1B8I B;  3M4O J;  1HLV A;  5GP9 A;  1ORK A;  4IEJ A;  4C3H J;  3F0C A;  3JR9 A;  5C4X J;  2B63 J;  5M3M J;  3BTJ A;  1ETW A;  3MKL A;  5FLV A;  4V2G A;  4MFE A;  2LFB A;  1WH7 A;  4A3L J;  2CRG A;  3IH3 A;  3HKZ N;  5JLX A;  1DU6 A;  4BBR J;  1APL C;  1MBJ A;  1AKH B;  3JRD A;  5J1R A;  4A3G J;  1ITY A;  1WCM J;  1RPW A;  3HB9 A;  1I3Q J;  1W0T A;  4C3J J;  1IGN A;  2VKE A;  3GTQ J;  1MSF C;  1H8A C;  1LFU P;  3LSJ A;  3HOV J;  2YUS A;  4G12 A;  2DA4 A;  1HOM A;  2X9D A;  3A01 B;  4EEF G;  1XS9 A;  1SAN A;  1ZK8 A;  5HOD A;  4FCY A;  2MGQ A;  1F43 A;  3GTG J;  4XRS A;  2H1K A;  5C4J J;  3BG3 A;  1TWA J;  5IOZ A;  2JJ7 A;  2EZI A;  2XB0 X;  2XB5 A;  4A3J J;  1SFO J;  1BW5 A;  4AC0 A;  2IEK A;  3IH4 A;  1WGX A;  2HI3 A;  3A01 A;  5IPA A;  2Y31 A;  1UG2 A;  1JUM A;  2M34 A;  4RBO A;  4A3F J;  3O8H A;  2YS9 A;  1B72 B;  4GFB A;  1BA5 A;  4UUT A;  2HXO A;  4XK4 A;  2ECC A;  3NAR A;  3DCF A;  3RZO J;  1NK3 P;  2DJN A;  3OOU A;  1IRZ A;  3Q0V A;  3BTI A;  2COB A;  4J19 A;  1MBK A;  1K61 A;  3JRE A;  1MH4 A;  3HM5 A;  2GM4 A;  4D5F A;  3JRI A;  2CU7 A;  3JRH A;  2ME0 A;  1JKR C;  5F27 A;  3GTK J;  5E3O A;  4JP0 A;  1Z0X A;  3BG9 A;  1ZGW A;  2QCO A;  2DA3 A;  1P7J A;  4M3D A;  2FJ1 A;  2X6O A;  1TWC J;  3RKQ A;  4IHX A;  5IYB J;  1X2M A;  2DTZ A;  1BW6 A;  5M3F J;  2ME6 A;  3CQZ J;  2LY9 A;  2VI6 A;  1MBH A;  5EG0 A;  1RES A;  2K9N A;  3CMY A;  2IBD A;  2R5Y B;  1GDT A;  2LP0 A;  4DZJ A;  5EF6 A;  3ZQI A;  2R5Z A;  1JUP A;  1TC3 C;  2FQ4 A;  1MNM C;  2FX0 A;  5EZH A;  2MW8 A;  3S14 J;  4QTR A;  3OSG A;  3JRB A;  3I4N J;  1K83 J;  5J3L A;  3BQZ A;  1JTY A;  2AO9 A;  1HDP A;  4JX4 A;  4QIW N;  2R5Y A;  2AHQ A;  1POG A;  1ENH A;  4XRM A;  1IG7 A;  3RQI A;  1QPI A;  1BJZ A;  5J1U A;  2WAQ N;  2IAI A;  4A3D J;  3TW6 A;  1FTZ A;  3S1N J;  2CQX A;  4BXX J;  2EZH A;  3JRG A;  1JKO C;  1U78 A;  2EZK A;  4X1E A;  2M2E A;  5FKN A;  1FJL A;  1B8I A;  1T56 A;  3S1R J;  2MG4 A;  5EZG A;  1S7E A;  2L9R A;  2N8G A;  1GT0 C;  1U8B A;  4S0H B;  5JLW A;  4HNV A;  1VND A;  1JJ8 C;  3SJM A;  2DMN A;  3Q0U A;  4A3I J;  4BY1 J;  1P7I A;  2DA7 A;  2E2J J;  2JA5 J;  5K7Z A;  1FTT A;  2Y9Y A;  1MBG A;  4UUS B;  1JTX A;  2LKX A;  3BQY A;  3HBL A;  3BT9 A;  1UMQ A;  3BTL A;  4D7N A;  3GTL J;  1ETO A;  2VPR A;  1AKH A;  1IV6 A;  2HOT A;  1MBE A;  2QF7 A;  2XPV A;  3HGY A;  5IP9 J;  2M8G X;  2Y9Z A;  2M0C A;  1IJW C;  5F1J A;  3ZQL A;  2X48 A;  2EBI A; 
#chains in the Genus database with same CATH topology
 1WPK A;  2LDU A;  3O6B B;  3RIR A;  1LFP A;  4RAG A;  3VPR A;  1FIP A;  4XL9 A;  2DT7 B;  1ZAO A;  4RAZ A;  4F91 B;  3CC2 I;  4PJL A;  1YJ9 I;  1IN8 A;  4HDU A;  4B1R A;  2P6S A;  1EV7 A;  2JPB A;  2E19 A;  4EJU A;  3GTO J;  1G2H A;  2UXX A;  2L01 A;  3BR5 A;  1RUN A;  3V7R A;  3S17 J;  4TV7 A;  4U88 A;  3KP5 A;  1JKQ C;  3L2W A;  1QRY A;  4RM3 A;  3FK6 A;  4C2T A;  1YS7 A;  4OMZ A;  3LOC A;  2R7T A;  4AYB A;  3IWZ A;  4G9Y A;  2PBI A;  2OBP A;  1WJ5 A;  1LE8 B;  4OIP F;  1FEX A;  3LFU A;  2PJR B;  2HZD A;  5LGT A;  1P4X A;  4BQQ A;  3PL8 A;  2O3F A;  2QM3 A;  5A2Q K;  1H89 C;  3V8J A;  4BKX A;  1T0F A;  5KCM A;  2A69 F;  4U7B A;  2M0M A;  2P5K A;  1RR8 C;  3KZZ A;  1LE8 A;  1JHH A;  1ZYR F;  2W82 A;  2XV4 S;  3RPU D;  2V9V A;  2PJR A;  1OFC X;  1R4M B;  5FKK A;  5B1A H;  3ABM H;  2K9L A;  1W36 D;  2L7F P;  5DM7 F;  2XGC A;  1GHC A;  1TBX A;  1A04 A;  4G7H F;  2STW A;  3V7S A;  3X2Q H;  2F6C A;  2KL4 A;  3I71 A;  2VBX A;  3HSF A;  4HDV A;  1ZQ3 P;  1E3H A;  1OCP A;  1D5Y A;  2DMP A;  4C2U A;  1YW7 A;  3I4P A;  1XN7 A;  3JRC A;  4F52 A;  1R5G A;  4A0Y A;  4CYC B;  4RB3 C;  5IP7 J;  2D5V A;  3CDL A;  2JUG A;  1HST A;  3HEF A;  2HDW A;  3ZN0 A;  2PQ8 A;  3OOP A;  2CJJ A;  3I3L A;  2NVY J;  3Q9V A;  4FQG A;  3F8M A;  3WU1 B;  2V4J C;  2CQQ A;  5FJ8 J;  3OS1 A;  5F0C A;  2LNB A;  3RDI A;  2DMT A;  3ABU A;  3ECH A;  1LDD A;  2Z5U A;  2XGE A;  3GBG A;  3KE2 A;  2EV6 A;  4FTH A;  2HDD A;  2QLZ A;  5LGN A;  4N9I A;  4IHW A;  3OIQ A;  1Y1W J;  1X58 A;  2ID3 A;  4HAM A;  3LNQ A;  1ETV A;  5LLQ A;  2PMZ N;  1FSE A;  2HNH A;  3S2H J;  5K7H A;  4GGG A;  5EYR A;  4KUM A;  3BRO A;  2GOX B;  1WWX A;  3J7Y J;  2R7D A;  1PJR A;  3I0T A;  3FKI J;  3G1O A;  4PJJ A;  5BPD A;  1ETK A;  4E7L A;  1R5H A;  4YII A;  2X4H A;  5F0H A;  4PSW A;  1DU0 A;  1TWG J;  1BN5 A;  1IN4 A;  1E3P A;  2XUB A;  2V1U A;  1LB2 A;  3OS2 A;  1IXR C;  4LB6 B;  1BIB A;  1I1G A;  4XKB A;  1S6L A;  2GA2 A;  1DP7 P;  3MZ8 A;  1I1S A;  3V7C A;  3L9F A;  3GWZ A;  5F0F A;  2MC3 A;  3FXO A;  3WU2 C;  1YRN B;  3W3C A;  4EV0 A;  4II3 A;  2Q2E B;  1FIA A;  1U5T C;  1K4T A;  2GAU A;  2HR3 A;  3EQL F;  3FHN A;  2HOS A;  1G3Y A;  3TED A;  2K7L A;  2OF7 A;  2EZL A;  4LK0 F;  1UHS A;  1XMX A;  2O7O A;  1YI2 I;  1FYK A;  1U9O A;  4ON0 A;  4BH9 A;  3LA3 A;  2MD0 A;  2O03 A;  2VN2 A;  2ZKZ A;  2XGD A;  2HKX A;  1XX5 A;  2JK3 A;  3E6C C;  2GLO A;  2BHZ A;  1D3Y A;  1VQL I;  1YRN A;  4KIC A;  5J40 A;  3WOD F;  2Q2E A;  1F5T A;  1RNL A;  3CJT B;  3E7L A;  3Q0W A;  1R4N B;  4XOR A;  4BJ6 C;  2CFO A;  2V9P A;  3OYH A;  1U3E M;  5CKT A;  2KZG A;  1FWZ A;  2DDA A;  3WTS C;  1AOY A;  4BQN A;  2MAB A;  3E0J B;  4YFX F;  4ZTJ A;  2GIZ A;  3GTP J;  5E3M A;  2L7K A;  5CQE A;  2NNN A;  4JQF A;  2HQ5 A;  5DD4 A;  3WTY C;  5AIP A;  2CV0 A;  3CF5 F;  2K9M A;  2Y30 A;  2OC6 A;  4QSH A;  1RKW A;  2MSY A;  4I99 C;  2HVQ A;  2TCT A;  3PIP F;  3DP7 A;  3DLL F;  2VKD A;  4C2M J;  1WJC A;  1X2N A;  1G3T A;  2Y69 H;  5F64 A;  1J9I A;  3HOY J;  3CME I;  2DTR A;  2F5F A;  2BY0 A;  2LOO A;  2OA4 A;  3H9J A;  3SYT A;  4AM3 A;  3M7G A;  3G6E I;  2NS8 A;  1HKS A;  1MJB A;  2H27 A;  2M7B A;  6PAX A;  1KU2 A;  2DN0 A;  3NWT A;  3I56 I;  2DA5 A;  1BC7 C;  2DCE A;  2F4O B;  1HKT A;  3Q3S A;  3TDZ C;  4E70 A;  2HEO A;  2LMD A;  3QRF F;  3CP2 A;  3S3O A;  1XGS A;  4OIN F;  4HNU A;  1OIS A;  1FOX A;  3DTI A;  3ZMT A;  3LSG A;  2ZME C;  3CUO A;  1E2X A;  1U2W A;  4FX0 A;  2WB1 A;  1DQU A;  4D7M A;  5BNG A;  2X6X A;  2Q1Z B;  2JA6 J;  2OQR A;  5FKL A;  2IGN A;  2JA2 A;  4W97 A;  1QVT A;  2HYJ A;  5HDK A;  2X85 A;  1Q1H A;  4XSX F;  2VQG A;  3OIP A;  3V8L A;  2ZBK A;  1QU3 A;  3GF2 A;  2UXN A;  1XCB A;  1IO2 A;  3GVA A;  3OYI A;  4DNC A;  1Y0N A;  3VYT B;  4Y7N J;  3V8K A;  3CUQ A;  2E2I J;  4JOM A;  5HDN A;  2WY8 Q;  3REO A;  4YEJ A;  1ULY A;  1V54 H;  3JSP A;  1A5J A;  2HFH A;  3I64 A;  5F08 A;  3WHC A;  1S29 A;  5L3D A;  2EK5 A;  4HZF A;  1SMY F;  3CCV I;  4B47 A;  3O3K A;  5F1R A;  3ZQH A;  3PUF A;  4ZYA A;  3D1N I;  1Z67 A;  2I10 A;  3AG1 H;  2CV1 A;  4K2E A;  4LIU A;  4CZC A;  4B3X A;  2JA8 J;  1Y8R B;  1YQA A;  3AG4 H;  4XLE A;  2ZFU A;  1B8I B;  1HLV A;  1IV8 A;  2V9K A;  4IEJ A;  4IPA A;  1VQ8 I;  2DOA A;  3F0C A;  1QPM A;  5C4X J;  3BPV A;  5M3M J;  3BG6 A;  1KU7 A;  4E6K G;  3S3M A;  4HBL A;  2JRT A;  1QHG A;  2M3A A;  1B6A A;  3IHU A;  3VOE A;  4MFE A;  1YHQ I;  2KIF A;  3IAS 2;  3HKZ N;  4RB0 A;  2JPC A;  2KZV A;  4GYG A;  3SZG A;  2MFZ A;  1IRX A;  3V42 A;  1JHF A;  1MJ9 A;  3A4C A;  1MBJ A;  2G7U A;  4A3G J;  1TQI A;  1XTA A;  3DKX A;  4MQ9 F;  1XB4 A;  3FX3 A;  4M9Z A;  4HPQ A;  4EM0 B;  5TRD A;  1YIJ I;  3LAJ A;  1W0T A;  2QBY B;  3ZMU A;  4Y13 A;  4M9S A;  4KT6 A;  3GTQ J;  4YFN F;  2PLY A;  4DIQ A;  4BE2 A;  2YUS A;  1BR4 A;  1ZRC A;  1FT9 A;  3I5U A;  1NG6 A;  3T1B A;  3BPX A;  3QOD A;  5LEK A;  2EIN H;  1SAN A;  2R7Q A;  3A0H C;  4Z6Y A;  2R7O A;  5GAD J;  2MGQ A;  4BQO A;  3I59 A;  3WGG A;  1MNE A;  1TWA J;  2GOM A;  1SFO J;  2XB0 X;  5GAH J;  3HUG B;  3EYY A;  2HI3 A;  2BXZ A;  1L3L A;  2HVR A;  2DOE A;  4FT8 A;  1UG2 A;  1G8X A;  4M71 A;  3KEO A;  3TO9 A;  2P8T A;  3U21 A;  1BA5 A;  5HOO A;  2LKP A;  2UZK A;  3CZ6 A;  2MD5 A;  1S5L C;  1HW5 A;  1YOV B;  2DJN A;  3JAM Z;  2VQH A;  4EMS A;  2AQF A;  1QZE A;  2KJB A;  4LIV A;  1P4W A;  1IRZ A;  3Q0V A;  1MMS A;  3BTI A;  2COB A;  1MBK A;  1MH4 A;  2QEX I;  1X4P A;  1UB9 A;  2VE9 A;  4IOA F;  2DQR A;  3HYI A;  4LLG F;  3EUA A;  1MDM B;  1OR7 C;  2CWE A;  3HRT A;  5LD2 C;  2IVM A;  3EUK L;  5IT9 Z;  4M3D A;  1RC9 A;  2XF5 A;  4PFP A;  4R1H A;  4Y3O A;  3RKQ A;  3H5N A;  4IHX A;  1BW6 A;  3CDI A;  3CQZ J;  2K5C A;  2VI6 A;  1MBH A;  5EG0 A;  1MDM A;  3W2A A;  4HF1 A;  2RGV A;  4ITV A;  3JW4 A;  2LG4 A;  3QU3 A;  5TGT A;  1RIO H;  4RS8 A;  3HTS B;  2LP0 A;  3DEE A;  4B09 A;  2RVC A;  5IT9 K;  2TDX A;  5EF6 A;  4M6Y A;  1FYL A;  5GTI C;  4L18 B;  1T39 A;  4Y17 A;  5DEQ A;  4UNO A;  3KLN A;  1TW3 A;  3OSG A;  2DOF A;  1SMT A;  2A6E F;  3DBL B;  2DFE A;  2JSC A;  1OPC A;  1R6R A;  3KP4 A;  2FF4 A;  4GO1 A;  3RQI A;  2RRE A;  2A5Y B;  2GA1 A;  2KJC A;  2DW4 A;  3CES A;  1BC8 C;  3TW6 A;  1FTZ A;  3RJP A;  4CH7 A;  2HTS A;  2Y0S A;  1LDJ A;  4BXX J;  1QHH D;  4LMY A;  2KP6 A;  3HIF A;  4KA4 A;  4I2O A;  2O0Y A;  2V6E A;  2NVU B;  2IGO A;  1W1W E;  3I54 A;  2M2E A;  5FKN A;  2FE3 A;  4AD9 A;  2DYS H;  4BDZ A;  1S7E A;  2L9R A;  5DUK A;  3FXR A;  1GT0 C;  1U8B A;  2XF6 A;  1HA8 A;  3H35 A;  3L2U A;  1BR1 A;  1LNW A;  1X1B A;  4A0Z A;  4EJO A;  5LHG A;  2LF7 A;  4A3I J;  3LFK A;  3DKW A;  1P7I A;  4PJ0 C;  4QWQ A;  2E2J J;  3WGH A;  2BVM A;  3ZQQ A;  4UUV A;  2EB7 A;  5B5E C;  3M9A A;  2LKX A;  1O57 A;  2CMP A;  3K9T A;  5CJ9 A;  4OIO F;  3BQY A;  2HS5 A;  2WV0 A;  2L3D A;  4XRF A;  4WXH A;  3BTL A;  1TT5 B;  4D7N A;  2E7W A;  4ZZD A;  3M8E A;  1ETO A;  2VPR A;  1AKH A;  2QF7 A;  2XPV A;  5IP9 J;  3O2P E;  4ZDL A;  1LQ1 A;  3K1N A;  2D1V A;  2ZXH A;  1EJ9 A;  3G71 I;  4G6T B;  1WSU A;  5E79 C;  3M3Y J;  3OYC A;  3ZPL A;  2H94 A;  5CVR A;  2OU2 A;  1UG0 A;  4DW6 A;  1CF7 A;  2E34 A;  1S9H A;  3OV8 A;  1OYY A;  1IN5 A;  1ZAR A;  2L7M P;  5CQG A;  4XLN F;  1ZN2 A;  3DPL C;  1SD5 A;  4PFO A;  3DLA A;  2J5O A;  1SC7 A;  2JRM A;  3L1P A;  3OYN A;  4HF2 A;  3FM3 A;  3CF2 A;  1P2F A;  3OMY A;  3E3V A;  3HSE A;  2IGK A;  1IF1 A;  1X1D A;  3M8J A;  4DZP A;  4FE7 A;  3RYR A;  1BBY A;  2DMU A;  1U6G A;  1J59 A;  2KLO A;  2VT2 A;  1B72 A;  1D5V A;  3IKT A;  2LRD A;  5M5X J;  3K0L A;  1BOA A;  5KNL A;  1CQT A;  2LH9 A;  1A6I A;  1TWF J;  2CUJ A;  5BOX A;  1R22 A;  1R7J A;  1GVJ A;  1MSE C;  2HGC A;  3U9G A;  4DGW B;  3PJR A;  3GFM A;  1FSH A;  3E97 A;  3MKW B;  2IRF G;  1ZKG A;  2Q0O A;  5KVR A;  1LVK A;  2UWM A;  3FXK A;  2V6C A;  2P4W A;  3EUH C;  2EV0 A;  3FXU A;  5FLX Z;  3QQA A;  2LK2 A;  2VXD A;  3CCQ I;  4GRI A;  2GBY A;  1N25 A;  2L9V A;  5LHH A;  3FMR A;  2CUE A;  2XAU A;  1OCO H;  2XDV A;  1LEA A;  4HST A;  4R8H A;  4KMF A;  4L0Z B;  4UB6 C;  2Z33 A;  3RYP A;  4L5E A;  2O8K A;  2LR8 A;  1I6X A;  3KP6 A;  4J00 A;  2LY2 A;  4DBQ A;  5FLM J;  4LG3 A;  1ZRE A;  1RZ4 A;  4AYB N;  1UCR A;  5FLX K;  2L4A A;  2VBY A;  3H5R A;  3FIS A;  3HJE A;  5HLT A;  3OY9 A;  2JT1 A;  2HVS A;  1H9T A;  4C3I J;  3HL2 A;  2YU9 J;  3QOE A;  3PQJ A;  4A5M A;  3DKY A;  3AAF A;  1JGG A;  3CCY A;  5LRS A;  1AU7 A;  4ENM A;  5FO5 A;  1I27 A;  3BR3 A;  5FKO A;  2ZXI A;  1MH3 A;  4ENK A;  2XSD C;  2KMU A;  4AVP A;  1BI1 A;  5K5Q A;  1JUS A;  4CIC A;  4IHY A;  1GV5 A;  3LMM A;  2HQA A;  3SZP A;  1E0E A;  4XRS G;  2L5Q A;  2KRF A;  2RNJ A;  1IUF A;  1IDY A;  5FRM A;  2M45 A;  3F8C A;  4NC8 A;  2JA7 J;  2L54 A;  4FET A;  2F5D A;  3TW7 A;  5D6F A;  2R93 J;  3KP2 A;  4MO7 A;  1BJA A;  2UUZ A;  3BC8 A;  4NB5 A;  1DDN A;  4IZZ A;  3J81 Z;  3K1M A;  1R1V A;  2R7Z J;  1KON A;  2V1N A;  1BM9 A;  2OCC H;  3ZOB A;  1RR7 A;  1SFE A;  1R49 A;  1JKP C;  1D0Y A;  4ZZL A;  3OR2 C;  1R1U A;  2E1O A;  5D5U B;  1BR2 A;  4XLA A;  3H0G J;  3JTG A;  1FMV A;  5B3S H;  2WBM A;  2STT A;  5E8G A;  3S2D J;  2CH0 A;  2DFI A;  2F48 A;  1WQ2 A;  5IP6 A;  1IC8 A;  3MZY A;  5CVJ A;  3J81 K;  3U2R A;  5IOY A;  3LSH A;  5ILS A;  3LSR A;  2M5W A;  1L0O C;  5IYC J;  2PFB A;  3L2V A;  2E2H J;  2CUZ A;  1K4S A;  3FMS A;  3FZV A;  2MBF A;  3TL4 X;  2K40 A;  3AKZ A;  2JN6 A;  1XD7 A;  2BV6 A;  5E3N A;  2R7X A;  5HNF A;  1NG7 A;  2XC7 A;  4QPQ A;  3HOU J;  3WTZ A;  2FA5 A;  4LG0 B;  2W1O A;  3I4M J;  3GCM A;  3KX2 A;  3SHF A;  2FUG 2;  3OYK A;  4ABZ A;  4HG2 A;  1MBF A;  1XG1 A;  2EFN A;  3OYJ A;  5FRN A;  2OV7 A;  1BI3 A;  3G1L A;  1IDZ A;  3K70 C;  3SFZ A;  2ELH A;  4BHP A;  1HSJ A;  1ERD A;  5ICC A;  5C3E J;  2COM A;  3IRQ A;  4ZC3 A;  2ZCW A;  2IS6 A;  3W2V A;  1BL0 A;  3LL7 A;  1X1P A;  1PVE A;  3A0B C;  2X1E A;  2BY1 A;  2IPQ X;  1R00 A;  4B8X A;  2HYF A;  3PNY A;  2DFF A;  1XSD A;  3DU5 A;  2KDZ A;  1YX3 A;  5E1W A;  4XBF A;  2NOG A;  4DYC A;  4Y15 A;  2XVC A;  3F8B A;  1R58 A;  5D8K B;  1MD0 A;  1TT0 A;  2QKL B;  1YJN I;  1H88 C;  3BR0 A;  3MQ0 A;  4II2 A;  4MNU A;  2IT0 A;  3BTC A;  2H09 A;  3TDU C;  5EGO B;  3ZCO A;  3S3N A;  2BW3 B;  3CMM A;  1U5T B;  3AG3 H;  4IHT A;  4U7D A;  1UEL B;  3KPH A;  3FM5 A;  1RET A;  1G6N A;  2JVH A;  3CJN A;  3VYS B;  1FP1 D;  1EH8 A;  1TW2 A;  3LST A;  1XSX A;  3HOT A;  2BGC A;  1D8J A;  2DA6 A;  3VSK A;  1ZR4 A;  2F5C A;  5EGO A;  2VQL A;  1H0M A;  4CYC A;  1W0U A;  1U5T A;  1U9N A;  5LRR A;  2EH3 A;  3LSM A;  4I01 A;  3S16 J;  3G1M A;  2W24 A;  1OYW A;  4PSX A;  2A61 A;  1TLH B;  3KZY A;  1KU3 A;  3HDD A;  3HXL A;  2NVX J;  2QGU A;  5L3F A;  2QUF A;  2ISZ A;  4E7H A;  2EQR A;  4RGS A;  4E7Z A;  4RDU A;  2X1D A;  5E3L A;  4YEL A;  2PI0 A;  4OMY A;  2IXS A;  3NRV A;  2Z9O A;  2Y2Z A;  4YIF A;  1T0F C;  2JVG A;  2O6G E;  1R9T J;  2WB1 N;  3F22 A;  1VI0 A;  4IKF A;  4OOI A;  3R0J A;  5GP9 A;  1E17 A;  4BE0 A;  3GW2 A;  5H6R A;  5D4R A;  4MTD A;  2H8W A;  2R3S A;  4CXF A;  2FSW A;  4BE1 A;  4RAY A;  2BY3 A;  1VQN I;  4RM2 A;  1ETW A;  4I0B A;  5J8C A;  2FRH A;  3HRM A;  3E6D A;  4DJA A;  4KDP A;  1SD6 A;  4PJN A;  1WH7 A;  3F72 A;  3TBI A;  1I3A A;  4EGY A;  1XSV A;  1EH6 A;  4U0Y A;  4NQW B;  2HTJ A;  1T95 A;  4XNF A;  4CCO A;  4ENN A;  3RKX A;  3ASO H;  2ZME B;  3CCM I;  5J1R A;  1ITY A;  1WCM J;  5JHF A;  1V5F A;  2V26 A;  1FBQ A;  2BZT A;  4CCL A;  1MMN A;  1FP2 A;  5DM6 F;  3CCE I;  3D0S A;  3S8P A;  2VJ5 A;  4N9H A;  2KIQ A;  2FXA A;  1IGN A;  4G7O F;  3ZRG A;  4JK1 X;  4NQW A;  3VEP A;  3LSJ A;  2Y48 A;  1XGO A;  3A1Y A;  2EA4 A;  2ZME A;  1WJB A;  2XSJ C;  4LLL A;  2FNP A;  3EET A;  5ILV A;  4EEF G;  2K27 A;  3H1C A;  5HOD A;  4FCY A;  3H9G A;  1F9N A;  3K6G A;  3BP8 A;  2JUC A;  1F43 A;  2KHM A;  2W00 A;  1F1Z A;  3D5S C;  3JTH A;  3BG7 A;  2EZI A;  3FXJ A;  3GZ5 A;  2C6Y A;  3WTT C;  3IC7 A;  1HBX G;  4LB5 A;  2LSO A;  3MKZ A;  5IPA A;  2VON A;  1JUM A;  2M8E A;  4CCK A;  1Z7U A;  4RBO A;  3HG9 A;  4A3F J;  1UST A;  3O8H A;  1FZP B;  2YS9 A;  4EAT A;  1AWC A;  2HXO A;  4XK4 A;  4R79 A;  2ECC A;  3NAR A;  3GUD A;  4WXD A;  1YTY A;  2QQA A;  1VTN C;  3DCF A;  4N0B A;  1D0Z A;  2DJI A;  3RZO J;  4XR6 A;  1Z6T A;  1XGN A;  2BOL A;  2EIL H;  4RLQ A;  4PUS A;  4J19 A;  1SVM A;  2F2E A;  4RAF A;  3TOA A;  3G2B A;  1RUO A;  4B43 A;  2CU7 A;  4HV5 A;  3JRI A;  3BOQ A;  1UHW A;  2JSP A;  1LVA A;  4P1W A;  3JRH A;  3C18 A;  1LDK B;  3CTA A;  4XKV A;  3CP8 A;  3GTK J;  2VLA A;  2YPR A;  2L9N A;  1O3R A;  2IS4 A;  2WAQ A;  4E7K A;  4OAZ A;  3GME A;  1QNT A;  2FJ1 A;  2XIG A;  1OLT A;  4WXC A;  2IS2 A;  1TWC J;  2OTJ I;  2DTZ A;  2P5L C;  5M3F J;  2ME6 A;  3J7A Y;  1SVL A;  1B9M A;  2EJR A;  3GX4 X;  5D4S A;  1QBJ A;  1J5Y A;  3ONQ A;  2CW8 A;  2W85 A;  3BZC A;  2LBF B;  2KQR A;  4L5J A;  3KEQ A;  1BIA A;  3KP7 A;  4BHB A;  4RB1 A;  3GZ6 A;  2CGP A;  4UV9 A;  3C1D A;  3KFW X;  2L9S A;  1UAA A;  3B02 A;  3ZMS A;  2DO7 A;  1Z6R A;  4BU2 A;  2MH2 A;  1ON1 A;  3K4C A;  5EJC A;  2E1N A;  2DI3 A;  2W25 A;  4HX7 A;  4A2U A;  3VSL A;  2AO9 A;  2LBF A;  4JX4 A;  3NWS A;  4RMN A;  5E18 F;  4XRM A;  4GXO A;  1FLI A;  4HF0 A;  2W84 A;  1J2X A;  3N4M A;  2QQ9 A;  1TNS A;  3Q9S A;  3PNT A;  1WJA A;  3S1N J;  3GYH X;  3GEZ A;  4KYW A;  2EZH A;  3KIO A;  2EZK A;  4QLC U;  3IRR A;  5CVU A;  2V79 A;  1B8I A;  1T56 A;  1STZ A;  2GXG A;  2I5U A;  4D1Q A;  3G73 A;  2MG4 A;  3DFG A;  2N8G A;  4Q5S F;  1DGR M;  4S0H B;  5JLW A;  1X3U A;  4XON A;  2P7C B;  2A5W A;  4KN7 X;  1JJ8 C;  1ZGA A;  3SQN A;  3IKV A;  4BY1 J;  2CSO A;  3FF5 A;  2JA5 J;  4UUS B;  2X1C A;  1S8N A;  1KGS A;  1G3S A;  2MA3 A;  4U0V A;  3ZMV A;  1IN6 A;  3BZ6 A;  1Z21 A;  2NS0 A;  1BI2 A;  3Q5F A;  3GTL J;  3P7N A;  3WTU C;  2XAJ A;  1TZL A;  2M0C A;  1LUJ B;  3RKW A;  3CUQ C;  4D0P A;  3ZQL A;  3VB2 A;  2DPU A;  4HSR A;  2QBY A;  4UUS A;  1KU9 A;  1OR7 A;  1IZ1 A;  4AUX A;  2X6W A;  2XAG A;  2CQK A;  3SFI A;  4JYK A;  2LD5 A;  3DEW A;  2K3F A;  1QVU A;  3WHB A;  3BG5 A;  3R0A A;  2Y0S N;  2ETH A;  3BR6 A;  1D1C A;  3PQK A;  3AL0 C;  2CW7 A;  2NS7 A;  3J7A O;  1N75 A;  1YYV A;  2F5V A;  3I9V 2;  5FKM A;  2B0L A;  2FBK A;  2P6T A;  1GUU A;  4X6A J;  2VT3 A;  1XCV A;  1W5T A;  4KMU X;  4OWR B;  3K2A A;  3HUG A;  2NXN B;  2WY7 Q;  5BMZ A;  3CCL I;  3WTW C;  1FNN A;  3DPU A;  5AIQ A;  2FML A;  4P5O A;  4ETS A;  1OMI A;  2ESN A;  4F7Z A;  2AXL A;  1MMD A;  1WI3 A;  1OKR A;  3B73 A;  1WVR A;  2QQ8 A;  3B6A A;  4ZDP A;  3HZJ A;  1QA6 A;  3QOP A;  2E7X A;  4XSZ F;  3TQN A;  3FDY A;  4PZJ A;  3PFI A;  2E60 A;  3BCA A;  4HYE A;  4A12 A;  1FOK A;  2P7V B;  3ESW B;  4IQ4 A;  1S3J A;  4BL0 B;  3JAM K;  2XRO A;  1DPU A;  3HOZ J;  3S15 J;  1TQM A;  1LEB A;  2WWY A;  3QPH A;  3BJA A;  1OCC H;  3MCZ A;  1MND A;  1HDD C;  2GWR A;  1B59 A;  2LYC A;  3VFZ A;  3K4J A;  4KJZ A;  4XQF A;  3HTU A;  3BDD A;  1K78 B;  4BXU A;  4CGZ A;  1J7K A;  2DMQ A;  1Z77 A;  2XPU A;  4IX7 A;  2WC2 A;  4LD5 A;  2M4G A;  4CCM A;  2JTV A;  4LLN A;  5GAG J;  2NNY A;  4IO9 F;  2OTL I;  3IWF A;  5J1Y A;  1MGT A;  5D6E A;  1W7P B;  4HX4 A;  1W5C C;  3S1M J;  2DK8 A;  1FY7 A;  1KYZ A;  2XHK A;  3LWF A;  3GXO A;  5HS7 A;  2KFD A;  4ZYH A;  1T33 A;  4A3K J;  2E1M C;  4JX6 A;  5D5V B;  3HKZ A;  1UJ8 A;  2K9S A;  1X4O A;  2CW0 F;  4XN3 A;  3I53 A;  1R1T A;  4ZYE A;  2Y75 A;  3ABT A;  4Y52 J;  3ISP A;  4IOC F;  2DLL A;  1O7F A;  2L0K A;  1W7P A;  2VOO A;  3RSN A;  4N4O B;  1Y56 A;  4GDF A;  3H3V K;  2VE8 A;  4OU0 A;  2FOK A;  3JRA A;  1X19 A;  2WAD A;  2Z2S B;  4B3A A;  2E35 A;  5HLI A;  2CV2 A;  1XMA A;  3E5Q A;  1ZR2 A;  2V7F A;  4B4C A;  4EVI A;  3WTX C;  1GV2 A;  2VKH A;  4F93 B;  3CJQ B;  1IAW A;  2CO5 A;  5CLS A;  1DGW Y;  3QP5 A;  2XPW A;  1G59 A;  3CJR B;  3K1P A;  5JHU A;  2K9Q A;  1KZH A;  5KK1 A;  2XAS A;  3NAU A;  4XIC A;  2EPF A;  3GTM J;  2E71 A;  2XRN A;  2VUM J;  5HS8 A;  2HPI A;  1OCT C;  2HXI A;  4ZJZ A;  3DQV C;  2OJE D;  3WG9 A;  5BPI A;  3FXM A;  4M6V A;  2RAE A;  4MLO A;  3CCJ I;  2OUM A;  1U8R A;  2ZB9 A;  3I55 I;  2HOA A;  5F6F A;  2X0L A;  1DUX C;  1TP4 A;  1Q1V A;  5H2F C;  1GVD A;  1LFB A;  3HC7 A;  2IJL A;  5HVQ C;  3L2R A;  3DWL E;  5DTD A;  4XMY A;  2HDC A;  4I76 A;  2HU9 A;  2DT6 A;  3S1Q J;  2VL8 A;  3O8G A;  3OIO A;  1WH5 A;  4LIT A;  1W7P D;  4BAY A;  3NQO A;  3K4K A;  1A31 A;  1ODD A;  3UKG A;  1KYW A;  3QPL A;  3FK7 A;  3HHG A;  5L3G A;  2P0W A;  3L2C A;  3QAH A;  2QSH X;  2X6Y A;  2ICW G;  3PO2 J;  2VXZ A;  2P81 A;  3S93 A;  4E4H A;  1AHD P;  3HOS A;  2B9S A;  4Q48 A;  1K6Y A;  3GLX A;  5L3C A;  1R23 A;  2E36 A;  4XKW A;  4LK1 F;  3G4S I;  1FOW A;  2KPM A;  4BXF A;  3IV5 A;  4M9X A;  3M1E A;  4AID A;  3ZR8 X;  3ZQG A;  2XF7 A;  3C2H A;  5LHI A;  1XDS A;  1HF0 A;  1D1B A;  3MZH A;  2NOJ B;  1QQI A;  1JJ6 C;  3G3Z A;  4L5I A;  2EFP A;  2A6H F;  1VQM I;  3W6V A;  3LSP A;  1EKE A;  1ZHF A;  1N77 A;  1GLN A;  3DTE A;  2PEX A;  3SDB A;  3MN2 A;  4I09 A;  2FMY A;  5B1B H;  1Y1V J;  5HNH A;  3GTJ J;  4BAC A;  2BY2 A;  2K4B A;  1ZGJ A;  3HOW J;  3PUB A;  1ZTR A;  4ZDO A;  3K4L A;  1Z1D A;  1V5E A;  3GO5 A;  4UVB A;  4CZZ A;  3S2W A;  3ZQF A;  3JRF A;  2DA1 A;  3C2B A;  1NTC A;  3U1D A;  1UHM A;  4IJA A;  2IGM A;  1X1C A;  2FOW A;  3N05 A;  2R5Z B;  3OYF A;  2LRE A;  2K3P A;  3HOX J;  1O3T A;  3ULQ B;  2RV8 A;  4MEX F;  4BJ5 C;  4A3B J;  2JMW A;  2YX7 A;  4GYI A;  5LGU A;  1SAU A;  2ZSI B;  4Q47 A;  2L7Z A;  3RTR A;  1BI0 A;  1VQ9 I;  5L3B A;  2FBI A;  3OS0 A;  5K7F A;  3J80 Z;  2R0Q C;  2RNG A;  4ZYD A;  1YS6 A;  4KN4 X;  1QZZ A;  3ZQC A;  3BR2 A;  3F3X A;  1F36 A;  1Z3Y A;  2VC1 A;  4CYD A;  5FD5 A;  5E1Z B;  2LTP A;  4BHC A;  3VDX A;  2ZXW H;  2VJ4 A;  1FMW A;  1HQC A;  3TGN A;  5IY5 H;  4JX5 A;  4M3G A;  4BY7 J;  1ZRF A;  3K2Z A;  1XC5 A;  1NK2 P;  4BBS J;  4A3E J;  1JT0 A;  2XAQ A;  3M4O J;  4E7J A;  1RRJ A;  3ELK A;  2F4M B;  3J80 K;  3FXL A;  5HDG A;  4ESJ A;  3RKY A;  3CCS I;  3GFI A;  3MD2 A;  1IW7 F;  3ERE D;  3FMQ A;  1JI8 A;  1X3W B;  2B63 J;  4IQJ A;  3BTJ A;  4ENJ A;  1TQP A;  3V4G A;  1T8I A;  4UV8 A;  1IXC A;  2DOD A;  4IRG A;  3TMO A;  2B7E A;  2XKP A;  4AWX B;  1PP7 U;  2CRG A;  3IH3 A;  4O5V A;  1S7A A;  2PN6 A;  3P5J A;  3S32 A;  1DU6 A;  4BBR J;  3WE2 A;  1APL C;  5CVV A;  2A05 A;  2MLK A;  4N4N B;  4P9U A;  1SD4 A;  3DU6 A;  3H5A A;  3JRD A;  4UXN A;  5ICF A;  1RPW A;  2D45 A;  2K4J A;  3DPT A;  1I3Q J;  2XKO A;  3VOD A;  1YW9 A;  2R4G A;  4C3J J;  1FBS A;  3PNV A;  4D9J A;  4EGZ A;  3FKJ A;  1V55 H;  2R7V A;  1H9G A;  1VQ5 I;  4NNJ A;  3KZI C;  1Z91 A;  2EWN A;  3ZGK A;  1MSF C;  4BNC A;  1LFU P;  3HOV J;  4G12 A;  2DA4 A;  4ZH4 F;  1HOM A;  1K7A A;  2ZJR F;  4M72 A;  1W5S A;  5D8L B;  2VBW A;  1ZK8 A;  3QWL A;  3F23 A;  1K6O A;  3QYB A;  5ERI A;  2QEN A;  3H0D A;  3H3U A;  3QYF A;  1SFK A;  5C4J J;  2MLG A;  2WA0 A;  2K85 A;  5IOZ A;  1BW5 A;  4AC0 A;  2IEK A;  4RB2 C;  1YO5 C;  2OAZ A;  3KLO A;  2K86 A;  5BS6 A;  3IH4 A;  3HHH A;  1J09 A;  2OZU A;  4FHT A;  2P5V A;  2Y31 A;  4AU7 A;  3PIO F;  2M34 A;  3IUO A;  5LEJ A;  3LA7 A;  4P9F A;  1YFH A;  4LG0 A;  4UUT A;  4M6X A;  3ZN1 A;  3C2G A;  5L3E A;  5A2Q Z;  3L2Q A;  4EQQ A;  1LKX A;  1FYM A;  1NK3 P;  4X0G A;  4O3M A;  3OOU A;  4CUG A;  3H9Q A;  4HQM A;  1W36 C;  2WAF A;  2Z1D A;  2L2O A;  3HPH A;  5FFZ A;  4ANJ A;  3K70 D;  1FC3 A;  1WJD A;  2BEO A;  3HM5 A;  2V1X A;  2GM4 A;  2IA1 A;  1VQP I;  2ME0 A;  2QKM B;  1ZH5 A;  2VJJ A;  4BGD A;  3E6B A;  1KQ8 A;  1JKR C;  2DXI A;  2HWV A;  1NHA A;  3JSO A;  2YSR A;  2QYO A;  1ZGW A;  3MKY B;  2O61 A;  2VOD A;  2QCO A;  3KYL A;  3QPT A;  3C7J A;  2R7S A;  2X6O A;  4YFK F;  2BHY A;  4XOP A;  4HW0 A;  1RI7 A;  2BW3 A;  1O7L A;  5ILU A;  1ZG3 A;  2XAF A;  4UVA A;  2AS5 F;  1RES A;  2K9N A;  2ESH A;  3ZMZ A;  4G94 A;  1G3W A;  2QZ8 A;  3CMY A;  1A35 A;  1S7O A;  4XKC A;  4NC6 A;  2GXA A;  1T98 A;  3WU0 A;  5D5W B;  1FX7 A;  5J8F A;  3ZQI A;  1TC3 C;  1JUP A;  1MIJ A;  3CMA I;  1MNM C;  2FX0 A;  1MMG A;  5EZH A;  2MW8 A;  3OWT A;  3VYU B;  3I4N J;  3JRB A;  2ADU A;  1K83 J;  1CGP A;  4HNT A;  3OYA A;  4MGR A;  1YIT I;  2HPM A;  1YIO A;  1F4K A;  3BQZ A;  1JTY A;  4QIW N;  1HDP A;  3SEZ A;  4Q4Z F;  3CD6 I;  2AHQ A;  2IP2 A;  3FXQ A;  4HLX A;  3CLO A;  1VQK I;  4L9N A;  1IG7 A;  2ZC2 A;  2Y0M A;  1EH7 A;  2NAZ A;  3KYC B;  1BJZ A;  5J1U A;  3OYE A;  3CO7 C;  2ZXJ A;  1P4A A;  2IAI A;  2WAQ N;  1JGS A;  2RQQ A;  2HKO A;  1V5G A;  1VQ4 I;  2JQ7 A;  1FJL A;  1MKM A;  2AQE A;  3S1R J;  5EZG A;  4MHG A;  5ED4 A;  3R61 A;  4CA0 A;  3M8F A;  5E20 A;  3K10 A;  5AON A;  4HNV A;  3K69 A;  5JR3 A;  1KA8 A;  2DMN A;  3Q0U A;  3GZN B;  1Z05 A;  4UB8 C;  2PMH A;  2J5P A;  2F4I A;  3BJO A;  1DP3 A;  5K7Z A;  1MBG A;  5LBQ A;  2O5R A;  3KET A;  3RCO A;  3EYI A;  3NEU A;  4KIF A;  1IRG A;  3HBL A;  3FBN B;  1UMQ A;  1S72 I;  4IF4 A;  4BDY A;  4ZTF A;  2LF8 A;  3ML6 A;  3JCU C;  4LGW A;  1MBE A;  5FB2 A;  2Y9Z A;  2M8G X;  5F1J A;  5DCM B;  2G9W A;  2DBB A;  4F92 B;  1J75 A;  1O3Q A;  5EEG A;  3A03 A;  3FHZ A;  1V4R A;  5JVG F;  1YJW I;  4B44 A;  3OSF A;  4KIT B;  1Y39 A;  2EV5 A;  3R60 A;  3MVP A;  1K79 A;  2FD5 A;  2ZJ2 A;  3FBI B;  1T38 A;  2DPD A;  3ZMD A;  2GIV A;  1C0W A;  4M3B A;  5DCM A;  4HLY A;  2QSG X;  5ICE A;  2XGX A;  2EFW A;  1I6H J;  1EA3 A;  1JT6 A;  2OPT A;  5HLH A;  4E7I A;  4P55 A;  2RKH A;  4BUP A;  2KT0 A;  4WX9 A;  1HC8 A;  3K4B A;  2D2W A;  3K7A J;  1ZRD A;  3DXJ F;  9ANT A;  2PMU A;  4NUB A;  4A3M J;  3BZK A;  1AA7 A;  4EJV A;  3DTK A;  5IYD J;  3OYB A;  1OCR H;  3F6O A;  5J6X A;  1T08 B;  3T8T A;  5TJJ A;  3LA2 A;  1B9N A;  2R7U A;  3UR3 C;  4MFD A;  2M4K A;  3WGI A;  2HYG D;  1P92 A;  3PM1 A;  4Z2Y A;  2EFQ A;  1XPX A;  3PSI A;  1WHU A;  1ETY A;  1HW1 A;  4M3F A;  3DEU A;  4FX4 A;  5IT3 A;  1D8K A;  3BJ6 A;  1EF4 A;  1QZY A;  3BY6 A;  3UNG C;  4XM3 A;  1LJ9 A;  5H20 A;  5GPC A;  2PMZ A;  4XLF A;  1MZB A;  2L4M A;  2WV1 A;  4C30 A;  2M9H A;  3DBR B;  4FIS A;  4V2F A;  3IL2 A;  1R5I D;  2OD5 A;  2QA4 I;  4HX8 A;  2LLK A;  1O4X A;  4GCV A;  2ZJQ F;  3FWE A;  3TP3 A;  1Z3X A;  2IA2 A;  2GZW A;  2XRL A;  3H3Z A;  2YR2 A;  4G8X A;  3LSI A;  3CUQ B;  3MMY B;  3A02 A;  5DDG A;  4D5C A;  3D5R C;  4DOZ A;  2O8X A;  3T8R A;  2KIM A;  4A5N A;  5LFA A;  5J47 A;  2BXY A;  3HRS A;  2ECB A;  2VQC A;  1VF9 A;  4U0W A;  1O3S A;  1HCR A;  4NDL A;  3DBH B;  4XLH A;  3CCU I;  3HGG A;  1OJL A;  2H1L A;  3SDG A;  1KQ9 A;  4NC7 A;  2G7H A;  5FGM A;  3FIW A;  3AL0 B;  1PP8 F;  1VZ0 A;  1BOB A;  5M5W J;  2K02 A;  1ZG5 A;  2VAS A;  1P6R A;  5B66 C;  4L9T A;  4A0X A;  5JVT A;  1ETX A;  3DV8 A;  4PCQ A;  2IW5 A;  2ELK A;  1Z7L A;  4PDK A;  4J01 A;  2OCE A;  2A68 F;  3KEY A;  4FAS D;  1P9Q C;  1VQO I;  3COA C;  3OYM A;  3ECO A;  1FOY A;  2WAE A;  5JI6 A;  3J7Z I;  2EFO A;  2NYX A;  2VB6 A;  2CFX A;  2I8D A;  1N78 A;  3ABK H;  4RGU A;  2DT5 A;  1WFX A;  1JE8 A;  2DK5 A;  2DAO A;  1W4M A;  5F04 A;  2ISY A;  4NHJ A;  3T5X A;  4CCN A;  4HOB A;  3M07 A;  5E8I A;  4KNY A;  2BVL A;  4WCG A;  1REP C;  2PJP A;  2VBZ A;  3EDP A;  4NBQ A;  3K4M A;  3U1K A;  1I50 J;  4LJZ F;  3ASN H;  3BR1 A;  5K5O A;  2W48 A;  4KIG A;  4F3Q A;  4UY8 I;  3OL4 A;  3PO3 J;  4HA8 A;  2DYR H;  1E3O C;  2VIX A;  4KFC A;  2QQB A;  3I59 B;  4H4K C;  3LAP A;  3RPQ A;  5EDN A;  4AIJ A;  2HOE A;  1I39 A;  1M1E B;  3ZXS A;  1WRJ A;  2M30 A;  3KYD B;  4IL6 C;  1HW2 A;  2CS3 A;  3B6C A;  2ID6 A;  4MTE A;  1PUF B;  4L9V A;  4C9Y A;  2EIM H;  4P96 A;  1WJF A;  2LC2 A;  3BLY A;  1X1A A;  2R7W A;  4HQE A;  2E1M B;  2F5E A;  4DBR A;  1DPR A;  3QPS A;  2FNA A;  2MC4 A;  2FQ3 A;  2O9L A;  1SD7 A;  2VJI A;  3WE3 A;  4XID A;  1PUF A;  1IN7 A;  4LOC A;  1NH3 A;  3RI4 A;  2IS1 A;  1MW7 A;  4ASN A;  5EEA A;  1B1B A;  2NVQ J;  5DD8 A;  1YX5 A;  2OQG A;  4I7H A;  4A6D A;  2E1C A;  2CUF A;  3M1C A;  5DCF A;  5C44 J;  2JWT A;  4ESF A;  3E1S A;  4JBA A;  3L09 A;  2ACJ A;  3ZP5 A;  2RQP A;  2X51 A;  2BBY A;  1Y8Q B;  2EIJ H;  3L00 A;  1R36 A;  3IH2 A;  1TL8 A;  4MIM A;  1GXQ A;  4XN0 A;  2IA0 A;  2NVT J;  3R4K A;  3HSR A;  2PG4 A;  3VWB A;  4IRI A;  3P9K A;  4G6D A;  1SFX A;  4B48 A;  2Z3Y A;  2ZNY A;  4IVN A;  4G7Z F;  1MMA A;  3CDH A;  5K1Y A;  4RA2 A;  4W1U A;  1KQ0 A;  3T0Y A;  1FPQ A;  4AVZ A;  2NRA C;  4V19 K;  1B4A A;  1VFC A;  5D5X B;  5EG0 B;  3F21 A;  1ETQ A;  1U0J A;  2DQL A;  5GPA A;  4WK8 F;  4BQA A;  3CC4 I;  3ROU A;  2ELJ A;  5FFX A;  2H8R A;  3QP6 A;  3L7W A;  3E5U A;  3E5X A;  1SFU A;  1SAX A;  3RQ4 A;  3H36 A;  4A93 J;  1YE9 A;  3LSK A;  3SXY A;  5M5Y J;  3OYD A;  4QPO A;  1IUY A;  2VKV A;  1K78 A;  2G0E A;  5GTH C;  1RKT A;  4DYQ A;  3ABL H;  2LVS A;  4ESB A;  2M87 A;  4MEY F;  1LPQ A;  4IHV A;  4S04 A;  1UZC A;  4HV6 A;  4I0A A;  1T6S A;  5DV5 A;  2DA2 A;  4L0Y B;  3R6S A;  4I6Z A;  4M3E A;  5DS9 A;  2XAH A;  4AIH A;  2R92 J;  3RZD J;  1MJA A;  3GFL A;  1TWH J;  3H92 A;  1TNT A;  1PDN C;  1OCZ H;  3K4N A;  3MWM A;  3TOB A;  3TP0 A;  4A3C J;  2DFH A;  4DYR A;  2ZJP F;  3AFH A;  4G6Q A;  2TRT A;  1XGM A;  2W4S A;  3C3W A;  4FE4 A;  4A69 C;  1GXP A;  2AXT C;  3SEQ A;  2DDB A;  2V1D A;  4RLF A;  2KRH A;  5H6Q A;  2KKO A;  2CQN A;  3TO7 A;  3W6J B;  2E5N A;  4CSW A;  4ZYG A;  1ORK A;  3MFK A;  2BYV E;  2ZO4 A;  4C3H J;  1WKM A;  3JR9 A;  2EA2 A;  2R7R A;  2A07 F;  3KCC A;  2CYY A;  3P9I A;  5EEH A;  1VQ7 I;  2Q8K A;  3MKL A;  5FLV A;  1YLF A;  4PK4 A;  4V2G A;  2LFB A;  4IHS A;  2D1H A;  4A3L J;  2GQQ A;  5JLX A;  4OIR F;  3OL3 A;  2MYS A;  1R71 A;  1AKH B;  4CO8 A;  2Z99 A;  5HS9 A;  3F8F A;  3HB9 A;  4L9J A;  4HEA 2;  3OYL A;  4I02 A;  2FBH A;  1PYV A;  1Y0U A;  3EUH A;  1ZLJ A;  3WG7 H;  4I98 B;  1A36 A;  2VKE A;  3OR1 C;  2ZSH B;  1H8A C;  4Y33 A;  2LKS A;  4KIB A;  2OZ6 A;  1ON2 A;  2W57 A;  1V3F A;  1CF7 B;  1I5Z A;  2X9D A;  3A01 B;  2H6C A;  4AIK A;  2QWW A;  1ZLK A;  1SVO A;  1XS9 A;  5GAE J;  4IXA A;  4F55 A;  3GTG J;  4XRS A;  1PUE E;  2H1K A;  3IAM 2;  3BG3 A;  4S05 A;  2KRC A;  4Y4R A;  2DU9 A;  3BCB A;  2JJ7 A;  2XB5 A;  4A3J J;  3PFY A;  1HXD A;  5DUI A;  4A6E A;  4E7S A;  1WGX A;  3A01 A;  1WZ2 A;  3TKY A;  1A6Q A;  2CG4 A;  2A6T A;  5KHD A;  4PGG A;  4H0E A;  2GXB A;  1ZEL A;  3TO6 A;  3BWG A;  2M1B A;  5FRO A;  1B72 B;  4GFB A;  3WTV C;  4XLP F;  3F6V A;  3MAJ A;  3A2K A;  1ACI A;  4CCJ A;  2EIK H;  1Z9C A;  1ONV A;  4M74 A;  3GLL A;  5CVI A;  4CHU A;  1VQ6 I;  2HQR A;  2FEZ A;  3D5L A;  3CCR I;  4EM2 A;  1WI9 A;  1K61 A;  3JRE A;  1FBU A;  4LFU A;  2YU3 A;  5DYM A;  4D5F A;  1XDU A;  3QU6 A;  3ZQ7 A;  1Y6I A;  5CYV A;  2RN7 A;  4BEH B;  1OQY A;  2VPL A;  5F27 A;  5E3O A;  2E5Z A;  4JP0 A;  2FU4 A;  1Z0X A;  2JZY A;  3BG9 A;  4MQV A;  3MEX A;  3VYR B;  4DQ2 A;  3KP3 A;  2DA3 A;  1P7J A;  1SEU A;  1T2K A;  1ZG1 A;  5E1X A;  4RGR A;  1J0R A;  5IYB J;  1X2M A;  4U87 A;  4BYY A;  5HLG A;  2LY9 A;  4BEH A;  2VC0 A;  1WJE A;  4IRH A;  5BQT A;  5J4V A;  3CO6 C;  4HRI A;  1TTY A;  3GFJ A;  5K5R A;  3F8N A;  5FD6 A;  1D0X A;  4BJT A;  2R5Y B;  2IBD A;  2KDO A;  1GDT A;  3E6M A;  2CQ7 A;  4DZJ A;  2LY1 A;  2ZNZ A;  2KIU A;  5KAI C;  2R5Z A;  2FQ4 A;  2W7N A;  3P9C A;  1YW8 A;  4BS9 A;  3S14 J;  2RDP A;  4QTR A;  3W6K B;  2VOP A;  1IXS B;  4PGH A;  4XLC A;  2Z16 A;  3ERM A;  5J3L A;  2R5Y A;  1POG A;  2WTE A;  1ENH A;  1OYI A;  4CDG A;  1QPI A;  4WF2 A;  5E17 F;  4A3D J;  3LQR A;  5TIS C;  2BE5 F;  2PX9 A;  1D1A A;  4YIR X;  2CQX A;  3N97 A;  1QO0 D;  4YRV A;  3JRG A;  2R7F A;  4KIS A;  3W2W A;  2MH9 A;  1U78 A;  1JKO C;  3HRU A;  4X1E A;  5ICG A;  2HQN A;  1YG2 A;  2KIS A;  2QSF X;  4O6J A;  1QGP A;  4XOT A;  3F9K A;  4KT5 C;  3QYE A;  1XMK A;  2HZT A;  2A3S A;  4UVC A;  1UFM A;  2ZFW A;  2QVO A;  2M7A A;  3SZT A;  4UHT A;  3DF8 A;  1VND A;  3OYG A;  3HPG A;  3SJM A;  4WWC A;  2H6B A;  4OAY A;  1G4D A;  4M73 A;  2DA7 A;  3RPU A;  1FTT A;  2Y9Y A;  2YX4 A;  4EJW A;  1JTX A;  3LQQ A;  1IRF A;  4PJM A;  4RGX A;  1JXS A;  5CPR B;  4EJT A;  1X3Z B;  2RC4 A;  2UV1 A;  4OIQ F;  3CLQ A;  3BT9 A;  4EM1 A;  3PSF A;  1IV6 A;  3EPZ A;  1USS A;  3I58 A;  5KAF C;  3IP4 B;  5JFR A;  3HGY A;  1IJW C;  2HOT A;  2L02 A;  4YG2 F;  3CC7 I;  5J4Y A;  1HKQ A;  2X48 A;  2EBI A;  3AG2 H; 
#chains in the Genus database with same CATH homology
 1WPK A;  4UUS A;  3VPR A;  3A03 A;  1FIP A;  4AUX A;  3M3Y J;  3SFI A;  4JYK A;  2LD5 A;  3OSF A;  3DEW A;  1QVU A;  4B1R A;  3WHB A;  3BG5 A;  4DW6 A;  3MVP A;  2Y0S N;  2FD5 A;  2E19 A;  3BR6 A;  2L7M P;  3GTO J;  4M3B A;  2NS7 A;  1G2H A;  1I6H J;  5FKM A;  3L1P A;  3BR5 A;  1JT6 A;  2OPT A;  3S17 J;  1GUU A;  2KT0 A;  4X6A J;  1JKQ C;  3K7A J;  1QRY A;  3K2A A;  9ANT A;  3FK6 A;  3LOC A;  4A3M J;  4DZP A;  4FE7 A;  5IYD J;  1LE8 B;  1FEX A;  2DMU A;  1WI3 A;  1B72 A;  5M5X J;  4MFD A;  3B6A A;  3PM1 A;  1H89 C;  1CQT A;  4BKX A;  1A6I A;  1TWF J;  1ETY A;  1MSE C;  4M3F A;  1LE8 A;  1ZKG A;  3HOZ J;  3S15 J;  1EF4 A;  1OFC X;  5FKK A;  2L7F P;  2XGC A;  5GPC A;  1HDD C;  3QQA A;  2LK2 A;  2WV1 A;  4FIS A;  2M9H A;  2GBY A;  4V2F A;  1ZQ3 P;  2CUE A;  1OCP A;  2LLK A;  1D5Y A;  2DMP A;  1O4X A;  2DMQ A;  3JRC A;  1Z77 A;  2XPU A;  3TP3 A;  4CYC B;  5IP7 J;  4L5E A;  2D5V A;  2O8K A;  2XRL A;  2LR8 A;  3CDL A;  3HEF A;  5FLM J;  5J1Y A;  3A02 A;  4D5C A;  2CJJ A;  4AYB N;  2NVY J;  3FIS A;  3S1M J;  4C3I J;  2ECB A;  2YU9 J;  1VF9 A;  1HCR A;  1T33 A;  4NDL A;  4A3K J;  3HGG A;  4JX6 A;  2CQQ A;  1JGG A;  1OJL A;  5FJ8 J;  2K9S A;  3SDG A;  3CCY A;  1AU7 A;  5F0C A;  3FIW A;  2DMT A;  4Y52 J;  3BR3 A;  5M5W J;  2L0K A;  2XGE A;  5FKO A;  3GBG A;  1MH3 A;  4FTH A;  2XSD C;  2HDD A;  4IHW A;  1Y1W J;  1X58 A;  2ID3 A;  1ETX A;  1JUS A;  3LNQ A;  1ETV A;  2ELK A;  3H3V K;  4IHY A;  1GV5 A;  2PMZ N;  4XRS G;  3S2H J;  5K7H A;  5EYR A;  3JRA A;  1IUF A;  1IDY A;  4B3A A;  3FKI J;  3G1O A;  2JA7 J;  1ETK A;  1ZR2 A;  4B4C A;  3TW7 A;  2R93 J;  1GV2 A;  4MO7 A;  5F0H A;  1DU0 A;  1TWG J;  2R7Z J;  5F04 A;  2XPW A;  3ZOB A;  1RR7 A;  1JKP C;  2K9Q A;  3NAU A;  4XIC A;  2E1O A;  5F0F A;  3GTM J;  1YRN B;  2VUM J;  3H0G J;  1FIA A;  1I50 J;  3S2D J;  1OCT C;  2HXI A;  3BR1 A;  5IP6 A;  2HOS A;  1IC8 A;  3TED A;  2OF7 A;  2EZL A;  2W48 A;  1UHS A;  2O7O A;  2RAE A;  4M6V A;  4MLO A;  5IOY A;  3LSR A;  2ZB9 A;  1U9O A;  3PO3 J;  2HOA A;  5IYC J;  1E3O C;  2E2H J;  2XGD A;  1Q1V A;  2JK3 A;  1GVD A;  2GLO A;  1LFB A;  1YRN A;  5EDN A;  5DTD A;  3E7L A;  3Q0W A;  2K40 A;  4I76 A;  3B6C A;  2JN6 A;  2ID6 A;  5E3N A;  1PUF B;  3S1Q J;  3O8G A;  3OIO A;  1WH5 A;  3HOU J;  3GTP J;  5E3M A;  3QPS A;  2HQ5 A;  3I4M J;  3UKG A;  2O9L A;  3QPL A;  3FK7 A;  2Y30 A;  4QSH A;  1RKW A;  2MSY A;  4XID A;  4ABZ A;  2TCT A;  1MBF A;  1PUF A;  1XG1 A;  3PO2 J;  2P81 A;  4LOC A;  4C2M J;  5EEA A;  3G1L A;  1AHD P;  1IDZ A;  1X2N A;  2NVQ J;  3HOY J;  5C3E J;  2NS8 A;  2CUF A;  1BL0 A;  3IV5 A;  5C44 J;  2JWT A;  2DN0 A;  3ZQG A;  2DA5 A;  1HF0 A;  3Q3S A;  2KDZ A;  3IH2 A;  4MIM A;  1JJ6 C;  2NOG A;  4DYC A;  2NVT J;  1H88 C;  3W6V A;  3LSP A;  3BR0 A;  3LSG A;  3BTC A;  3MN2 A;  5EGO B;  1Y1V J;  4D7M A;  4W1U A;  5BNG A;  3GTJ J;  2JA6 J;  5FKL A;  3HOW J;  1VFC A;  1ZTR A;  5EG0 B;  1ETQ A;  5GPA A;  4W97 A;  1QVT A;  1RET A;  2HYJ A;  2H8R A;  3ZQF A;  3JRF A;  2DA1 A;  3C2B A;  1NTC A;  4A93 J;  5M5Y J;  2DA6 A;  2VKV A;  2G0E A;  1ZR4 A;  1RKT A;  4DYQ A;  5EGO A;  2R5Z B;  2LVS A;  4CYC A;  1W0U A;  3HOX J;  1U9N A;  4IHV A;  2EH3 A;  4A3B J;  2JMW A;  4Y7N J;  3S16 J;  2DA2 A;  2E2I J;  3G1M A;  4I6Z A;  2L7Z A;  4M3E A;  5DS9 A;  5K7F A;  2R0Q C;  3HDD A;  1A5J A;  2NVX J;  2R92 J;  5F08 A;  3WHC A;  3ZQC A;  1TWH J;  3RZD J;  3BR2 A;  1F36 A;  2EQR A;  3TP0 A;  4A3C J;  4DYR A;  4RDU A;  3ZQH A;  5E3L A;  2TRT A;  3D1N I;  2LTP A;  4FE4 A;  2I10 A;  4A69 C;  2Y2Z A;  2JA8 J;  4JX5 A;  4M3G A;  4BY7 J;  4BBS J;  1NK2 P;  1XC5 A;  2WB1 N;  1R9T J;  1VI0 A;  4A3E J;  1JT0 A;  1B8I B;  3M4O J;  1HLV A;  5GP9 A;  1ORK A;  4IEJ A;  4C3H J;  3F0C A;  3JR9 A;  5C4X J;  2B63 J;  5M3M J;  3BTJ A;  1ETW A;  3MKL A;  5FLV A;  4V2G A;  4MFE A;  2LFB A;  1WH7 A;  4A3L J;  2CRG A;  3IH3 A;  3HKZ N;  5JLX A;  1DU6 A;  4BBR J;  1APL C;  1MBJ A;  1AKH B;  3JRD A;  5J1R A;  4A3G J;  1ITY A;  1WCM J;  1RPW A;  3HB9 A;  1I3Q J;  1W0T A;  4C3J J;  1IGN A;  2VKE A;  3GTQ J;  1MSF C;  1H8A C;  1LFU P;  3LSJ A;  3HOV J;  2YUS A;  4G12 A;  2DA4 A;  1HOM A;  2X9D A;  3A01 B;  4EEF G;  1XS9 A;  1SAN A;  1ZK8 A;  5HOD A;  4FCY A;  2MGQ A;  1F43 A;  3GTG J;  4XRS A;  2H1K A;  5C4J J;  3BG3 A;  1TWA J;  5IOZ A;  2JJ7 A;  2EZI A;  2XB0 X;  2XB5 A;  4A3J J;  1SFO J;  1BW5 A;  4AC0 A;  2IEK A;  3IH4 A;  1WGX A;  2HI3 A;  3A01 A;  5IPA A;  2Y31 A;  1UG2 A;  1JUM A;  2M34 A;  4RBO A;  4A3F J;  3O8H A;  2YS9 A;  1B72 B;  4GFB A;  1BA5 A;  4UUT A;  2HXO A;  4XK4 A;  2ECC A;  3NAR A;  3DCF A;  3RZO J;  1NK3 P;  2DJN A;  3OOU A;  1IRZ A;  3Q0V A;  3BTI A;  2COB A;  4J19 A;  1MBK A;  1K61 A;  3JRE A;  1MH4 A;  3HM5 A;  2GM4 A;  4D5F A;  3JRI A;  2CU7 A;  3JRH A;  2ME0 A;  1JKR C;  5F27 A;  3GTK J;  5E3O A;  4JP0 A;  1Z0X A;  3BG9 A;  1ZGW A;  2QCO A;  2DA3 A;  1P7J A;  4M3D A;  2FJ1 A;  2X6O A;  1TWC J;  3RKQ A;  4IHX A;  5IYB J;  1X2M A;  2DTZ A;  1BW6 A;  5M3F J;  2ME6 A;  3CQZ J;  2LY9 A;  2VI6 A;  1MBH A;  5EG0 A;  1RES A;  2K9N A;  3CMY A;  2IBD A;  2R5Y B;  1GDT A;  2LP0 A;  4DZJ A;  5EF6 A;  3ZQI A;  2R5Z A;  1JUP A;  1TC3 C;  2FQ4 A;  1MNM C;  2FX0 A;  5EZH A;  2MW8 A;  3S14 J;  4QTR A;  3OSG A;  3JRB A;  3I4N J;  1K83 J;  5J3L A;  3BQZ A;  1JTY A;  2AO9 A;  1HDP A;  4JX4 A;  4QIW N;  2R5Y A;  2AHQ A;  1POG A;  1ENH A;  4XRM A;  1IG7 A;  3RQI A;  1QPI A;  1BJZ A;  5J1U A;  2WAQ N;  2IAI A;  4A3D J;  3TW6 A;  1FTZ A;  3S1N J;  2CQX A;  4BXX J;  2EZH A;  3JRG A;  1JKO C;  1U78 A;  2EZK A;  4X1E A;  2M2E A;  5FKN A;  1FJL A;  1B8I A;  1T56 A;  3S1R J;  2MG4 A;  5EZG A;  1S7E A;  2L9R A;  2N8G A;  1GT0 C;  1U8B A;  4S0H B;  5JLW A;  4HNV A;  1VND A;  1JJ8 C;  3SJM A;  2DMN A;  3Q0U A;  4A3I J;  4BY1 J;  1P7I A;  2DA7 A;  2E2J J;  2JA5 J;  5K7Z A;  1FTT A;  2Y9Y A;  1MBG A;  4UUS B;  1JTX A;  2LKX A;  3BQY A;  3HBL A;  3BT9 A;  1UMQ A;  3BTL A;  4D7N A;  3GTL J;  1ETO A;  2VPR A;  1AKH A;  1IV6 A;  2HOT A;  1MBE A;  2QF7 A;  2XPV A;  3HGY A;  5IP9 J;  2M8G X;  2Y9Z A;  2M0C A;  1IJW C;  5F1J A;  3ZQL A;  2X48 A;  2EBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...