1VQ9I

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq9I00
1YI2I 3G71I 5GAEJ 2OTJI 3CMAI 1VQ7I 2ZJRF 5GADJ 2H8WA 2ZJQF 1VQOI 5GAGJ 5JVGF 1YITI 1YJNI 1MMSA 5DM6F 1Y39A 5DM7F 3CCVI 3PIOF 4V19K 4IO9F 2JQ7A 1VQ8I 2E34A 1ACIA 3CMEI 2NXNB 3DLLF 1S72I 2E35A 1YIJI 3CCRI 1QA6A 2OTLI 3CD6I 3CCLI 1FOYA 2QEXI 3CCEI 1VQMI 3CCSI 1FOWA 1VQLI 4IOCF 2E36A 1VQ4I 5GAHJ 1YJWI 2FOWA 1FOXA 2QA4I 3G6EI 1VQ6I 3J7ZI 2K3FA 3CC4I 3CCUI 3J7YJ 1VQNI 1VQ9I 1HC8A 3CCMI 2ZJPF 3CJTB 1YHQI 4UY8I 3CCJI 4IOAF 3G4SI 3PIPF 3CF5F 1VQPI 3I55I 1VQKI 1VQ5I 3CC7I 3CC2I 3CCQI 1YJ9I 3I56I
chains in the Genus database with same CATH superfamily
4YFKF 1HLVA 3S8PA 1HSTA 4PJMA 3WTSC 3X2QH 1PVEA 4N4NB 3FXOA 1WZ2A 2BY2A 3FKIJ 2OTJI 1JUSA 1HW1A 1Q1HA 2DQLA 2RREA 3GO5A 2K9LA 3HG9A 4ZDOA 1HXDA 1YIOA 2QGUA 3OYHA 3UNGC 1Z1DA 2EZLA 2FJ1A 2KJCA 2MC3A 3FHNA 2RQPA 3JRIA 1ZGWA 3L2QA 3BR1A 3B73A 2IP2A 1R7JA 1VQOI 4HAMA 1ZREA 1PUEE 1K61A 5K5QA 2VLAA 1W1WE 3FM5A 4D9JA 2VBXA 1GLNA 1QGPA 2K3PA 4WCGA 4LD5A 4CZZA 1VNDA 2DT7B 4MEYF 5IT3A 1P4AA 2MYSA 2FU4A 1D1BA 4X0GA 2HZDA 1O7LA 2LLKA 5FLMJ 3L2WA 3TKYA 4IO9F 3JRFA 3LAJA 1SAUA 4FX4A 2BW3A 3QP5A 4W97A 3TBIA 4B8XA 4MQVA 4KA4A 5F1JA 3VWBA 3CUOA 4ENMA 1YRNB 3RYPA 1Z05A 2CQXA 2VC1A 3F6OA 3GFMA 1MDMB 4CUGA 4K2EA 2LF8A 4EJVA 5DDGA 5EZHA 2K85A 2MLGA 2OQGA 3LFUA 2CUJA 2LG4A 2HQNA 2PX9A 1LUJB 3OYJA 1YW9A 2KMUA 2F5CA 3BPVA 2OF7A 4KN4X 9ANTA 4HV5A 3FKJA 4M3FA 5GAHJ 2R7VA 3GVAA 3S93A 3HOWJ 1YG2A 3PM1A 4BXUA 4ANJA 2ME6A 4AUXA 3QU3A 3DKYA 4ZZLA 3FHZA 4YIRX 4XLFA 2GIZA 3KX2A 2A68F 1MBGA 5GTIC 1R23A 2ZJPF 2LNBA 1EA3A 5JHFA 2X6YA 4IF4A 3L2CA 5HS7A 3E6CC 4AIDA 2Y9ZA 1DDNA 4RB3C 1MZBA 2WADA 5HODA 2B9SA 2RDPA 3MN2A 2OAZA 1U5TB 2PJRB 4D5CA 4BXXJ 2P5LC 2IXSA 1VQ5I 4D7MA 2XF5A 2WB1A 4AC0A 5C44J 4ENNA 3M9AA 4UUSB 2LY2A 3HSFA 2O8KA 4AIHA 1JJ8C 3M8FA 2M8EA 5F0CA 2HEOA 2DI3A 4AVPA 5DUIA 5DV5A 1CGPA 5BPDA 3GFJA 2LOOA 1G3YA 3FBIB 4F52A 4YG2F 4KIFA 3GTLJ 1FPQA 1IUFA 1D1CA 3HJEA 1DU0A 4FTHA 1T95A 4GO1A 2RKHA 1HKQA 2DTRA 4L9JA 1R58A 1DUXC 3CO6C 2QQ8A 3DF8A 4WWCA 1CQTA 1X1CA 1JKQC 1W7PA 2FA5A 2RVCA 4RMNA 3W2VA 2RV8A 1YFHA 3DPUA 2V79A 1VF9A 1BIBA 1XCVA 2LSOA 4G6DA 4YFXF 1ODDA 5EG0A 3RZOJ 3S14J 3K4NA 3TDUC 2QKLB 5CVVA 1AHDP 5DM6F 2KIMA 1NK3P 2Z3YA 3FBNB 4BH9A 2QSHX 1MJ9A 2ZC2A 3M07A 3U1DA 5IOYA 2IA1A 4BUPA 1BR4A 3NQOA 1R49A 1LFBA 2KISA 2OU2A 1MBEA 1UMQA 2E34A 2R7QA 4NB5A 1PP7U 1V54H 1IV8A 2XF6A 5H6QA 1XSDA 3A02A 3EYYA 1Z3XA 2QVOA 3EDPA 1Z0XA 4B3XA 1NTCA 2H09A 1BI0A 1AWCA 4DZJA 1B59A 4G7OF 2HYJA 5E8IA 3BZCA 3GWZA 3IKVA 3ZQHA 4B09A 2MH9A 3VYRB 1RNLA 4NDLA 2O5RA 2VKDA 3ZMZA 5IYDJ 2HOSA 5EEHA 2P5KA 4MFEA 2OD5A 3OYCA 4IKFA 2DK5A 4Y15A 3MZHA 2YPRA 3BR6A 6PAXA 1EH6A 4XKWA 4BY1J 1R71A 4A3IJ 3J81Z 2W00A 4ESFA 3BR5A 1ZLJA 3G6EI 3CC4I 3M1EA 2L54A 4PJ0C 1Y6IA 3KZZA 1ZLKA 3W6KB 3WGGA 3SZPA 4UHTA 1LPQA 2QF7A 2P7VB 5D5UB 2XB5A 4IRGA 2K27A 4U0WA 4CCLA 2VPRA 4RAFA 1ZRDA 3H3VK 2R7UA 1BC7C 3GMEA 4UV9A 2GQQA 1ORKA 4M3EA 3PIPF 4PSWA 2LYCA 1ZKGA 5DD4A 3SEQA 3BR2A 2AXLA 2PFBA 3KP3A 2DMTA 4JYKA 1DQUA 1D5YA 1A5JA 1VQKI 1REPC 4A0YA 1ETXA 2LBFA 5LHHA 2ELHA 3G3ZA 1EH7A 4IHVA 1SANA 5FD6A 4HQEA 4HSTA 4RAYA 1DU6A 2CV2A 4Q47A 5EZGA 1T08B 3RPUD 3BG9A 5EEAA 1FBQA 3HGYA 4A93J 1XX5A 2UWMA 5EDNA 3TDZC 1ZG1A 2A5WA 1N77A 5FB2A 1T33A 3QWLA 2GOMA 4ZZDA 2KRCA 4ZH4F 2K4JA 3GZNB 2COMA 1SD5A 1FEXA 1WGXA 4XR6A 2E7XA 1L3LA 2XSDC 1BA5A 4XN0A 2STTA 4CA0A 3ZMUA 2A6TA 4DZPA 4M9ZA 2VOPA 3QYEA 2DA4A 1DP7P 4YFNF 5C4XJ 4HQMA 2EFWA 3K70C 5KVRA 4BHPA 4C3HJ 2JN6A 4MFDA 4RAGA 4RAZA 3MFKA 2OPTA 2GBYA 3SDGA 2HKOA 3HXLA 2BVLA 1MW7A 3VYSB 1PYVA 3E97A 4Z2YA 2E19A 1A31A 1NK2P 3BQZA 3O6BB 4NC7A 4MTEA 5H20A 3M7GA 3JRHA 4L0ZB 4KMFA 1ACIA 5L3BA 3NEUA 3MQ0A 3HOUJ 1KQ8A 1SFUA 5CVUA 2HWVA 4Y4RA 3AL0B 3IAS2 2P6TA 2NNYA 1IO2A 1WPKA 1T39A 4LIUA 1PDNC 2R7WA 5K7HA 4PK4A 1TW3A 3KLNA 2UZKA 2LP0A 3ABMH 3D5RC 3K4BA 4F91B 2F4IA 5F08A 3I64A 3ASOH 4B1RA 2HNHA 1FTZA 4V2FA 3NWTA 4ON0A 4OIRF 3LAPA 2DFHA 2QSFX 4ZDLA 2R5ZA 2QYOA 3WODF 3DEWA 2W82A 4D0PA 1S3JA 3R0AA 1FOKA 2EIJH 4LB6B 1FX7A 1OCOH 1QPMA 2R7DA 3QOEA 1NHAA 2VB6A 3D5LA 3SZTA 1UHSA 3G1OA 1T8IA 1Z91A 4U0VA 2XGDA 4HV6A 2DAOA 2EJRA 3JRCA 2QBYB 1H9TA 5J4VA 4XRMA 3I71A 1UZCA 3OYMA 3WE2A 4BAYA 2JT1A 5J40A 3JW4A 4A5MA 1F1ZA 1Q1VA 2FD5A 1OCZH 3BWGA 2FBHA 5FRMA 2KRHA 5EEGA 2XRNA 2L02A 2LK2A 3HM5A 3BG3A 2A07F 4CCNA 2VOOA 1RZ4A 3VODA 1USTA 4F92B 4I99C 1LVKA 2JA8J 4L5JA 3GX4X 3GTPJ 2CFOA 2QQAA 2RGVA 5DD8A 2GIVA 1MBJA 1B6AA 4QPOA 3CDLA 3BZKA 3CESA 4RGRA 3AG3H 4Q48A 1QRYA 5CQEA 1VQ7I 2ZXWH 2ZSHB 5J4YA 4F7ZA 2ELKA 3WTWC 2B0LA 3KYCB 2QLZA 2VJJA 4JQFA 3LSMA 3FXQA 3MKLA 2E2IJ 3GTQJ 4XRSG 3BJ6A 3BZ6A 3E5XA 3F22A 5JVGF 1LEBA 5TGTA 3RKYA 4FE4A 4KNYA 2MABA 1E3OC 1OCCH 2Y48A 3ZQ7A 5D4RA 5CVRA 2VIXA 2I10A 1XSVA 1K6OA 5J1YA 3LSGA 1UELB 1O4XA 3AG2H 3RQIA 1Y0NA 4BKXA 4A3BJ 1X1PA 5GPAA 3K0LA 3LSIA 4OAYA 3RIRA 3CLQA 3BTIA 3W2AA 5D4SA 1YE9A 5JVTA 5L3EA 1IAWA 4LK0F 3LA3A 3EUAA 3S1QJ 2KIFA 1UCRA 4FHTA 3BCBA 1E2XA 3KEYA 3H35A 3QYFA 2NOJB 3KIOA 1POGA 3TOAA 3AFHA 2X1DA 2YU3A 2CJJA 3RJPA 2R7SA 4BEHB 1KGSA 5GTHC 4MNUA 3GLXA 2DXIA 2FUG2 3LSRA 3FXKA 3H36A 3Q9VA 5IY5H 2E1MB 4O6JA 1STZA 3BDDA 3DV8A 2EILH 5E1WA 3H0GJ 2RNGA 1WKMA 4IX7A 4XSZF 1TL8A 2KHMA 4F93B 4KFCA 3RDIA 1IZ1A 1YJWI 4UV8A 2KDZA 1IV6A 1XCBA 2D2WA 1U8BA 2W57A 3OSFA 3J7YJ 4HDVA 3RCOA 1J9IA 2EIKH 5ICGA 2DTZA 1X3ZB 1ZYRF 1G3TA 3DU5A 3JAMZ 5EGOB 2HDCA 4IQJA 1WSUA 2L4MA 3OYBA 1B72A 4D1QA 2JPBA 4RLQA 1AOYA 3JTHA 5JFRA 1U0JA 1WI3A 2F5DA 4JBAA 2O9LA 2EV5A 2NVYJ 3K10A 1HOMA 3G1LA 4UVBA 2IBDA 2QENA 4CYCA 3OY9A 3I55I 2MFZA 2DQRA 3S2WA 4U88A 3N97A 3F8FA 3WG7H 1SAXA 1AU7A 4KN7X 2TRTA 1IJWC 2E2JJ 2O6GE 2IA2A 2HZTA 3C2BA 1WWXA 2HDDA 2ZSIB 1LVAA 2V9KA 4BYYA 2MBFA 4RGXA 3L2RA 3S3MA 4FE7A 1VFCA 4IL6C 5LGNA 3QYBA 4J00A 1Z67A 3TEDA 1QBJA 5B5EC 3H3ZA 2VE9A 3WTVC 3GF2A 2EZIA 4N4OB 2AS5F 3JCUC 3OIQA 4HF0A 5D8LB 2Y69H 1XDSA 2CUEA 2NOGA 3P9CA 1JTXA 5E3NA 3J7AO 3Q3SA 4UVCA 4L18B 2VE8A 4F3QA 1JKRC 3NAUA 3W3CA 1NG7A 4LG0B 3EQLF 3BOQA 1IN5A 4UVAA 1KU2A 3LSJA 2G7HA 1X58A 1C0WA 3PIOF 2M2EA 2V9VA 3ABLH 1SMYF 2V6CA 4ZJZA 4BJ6C 1JKPC 4Y3OA 1JE8A 1F5TA 3KLOA 5BNGA 3LSPA 3L1PA 1VQ8I 1T6SA 2RN7A 2WY8Q 4P5OA 2NXNB 5D8KB 2OZUA 1Z6RA 2GWRA 5LRRA 4J19A 4E7KA 3KYLA 3BG6A 1ONVA 3KP2A 4KIGA 1E0EA 4AIJA 3ZQQA 1Y1WJ 4OOIA 2E71A 3H5NA 4RBOA 1FNNA 1LKXA 3DPTA 4M6XA 2JTVA 2R7ZJ 3SFZA 3CCSI 2LF7A 3BG7A 1BW6A 4XMYA 1KYZA 2M1BA 3Q9SA 3F8NA 2CMPA 2JPCA 4C30A 2XKOA 3TQNA 2O0YA 2Y0SN 1FOXA 1O57A 3BTCA 4AIKA 5KK1A 3H9QA 5D5XB 5IOZA 1U3EM 1ZQ3P 5ILUA 1JI8A 4QLCU 4G6TB 2CGPA 2JUCA 5DYMA 5DCMB 3K69A 2DPDA 4N9IA 2O8XA 3HC7A 1B4AA 3F0CA 4IJAA 1UFMA 3T8RA 3MMYB 2KDOA 2ZNZA 4BACA 4M9XA 5HLHA 4MHGA 2DOAA 1ZK8A 2NRAC 4X6AJ 1Z7LA 3OMYA 3PNYA 3HL2A 1YRNA 4OMYA 1IDZA 1W0UA 2MC4A 3CF5F 1MDMA 1UB9A 4DBQA 2EV0A 3OV8A 3DTEA 2EWNA 3GEZA 4UB8C 1IW7F 4HF2A 4HF1A 3GW2A 5JLWA 4P55A 2HI3A 1ENHA 2BY3A 1U8RA 2IS2A 5B1AH 3ZXSA 2VKHA 1HW2A 2L4AA 4C2MJ 5LFAA 3MZ8A 2DODA 3ECHA 3V7SA 4D5FA 4A3KJ 1DGRM 4A0ZA 3ABKH 1W5SA 4FQGA 3RTRA 3OYLA 2DMNA 1BR2A 3KP5A 4E7HA 3ZCOA 4CCKA 3S1NJ 3GTGJ 1W0TA 5GADJ 2M30A 1WVRA 2BHZA 2L9SA 2R7OA 2L2OA 5E17F 3ZQGA 3Q5FA 2QM3A 3MD2A 3ZP5A 4Y33A 4GGGA 3I4PA 1PUFB 1LB2A 3ZPLA 2CQQA 1FY7A 4EJTA 4YELA 1LE8B 2A05A 3F8CA 1ZH5A 1U5TA 2WC2A 1ZG5A 2EA2A 3M8EA 2PJRA 5E20A 2DU9A 4L9NA 4PGGA 2GA1A 4ZYDA 4BDYA 3T1BA 2XSJC 3LWFA 4XKCA 3HKZN 4UUSA 3B6CA 2N8GA 4E6KG 2F6CA 1D8JA 1ERDA 5CQGA 2L01A 1FT9A 2GXBA 3K2ZA 1HKTA 2MD5A 2IGKA 2HOTA 1E3PA 3F72A 2ISYA 5F1RA 5A2QZ 2HQAA 1BI3A 4BL0B 2FQ4A 1A35A 4NHJA 1IC8A 4B43A 1IUYA 1U9OA 1W5TA 1ZGAA 2L3DA 4X1EA 2OJED 1U5TC 2K02A 3FXMA 5J1UA 3C2HA 1VQLI 3KYDB 4M74A 3QQAA 3U2RA 5CKTA 1R4NB 5L3FA 1F36A 2MD0A 3K1NA 1TZLA 5M5XJ 1VQ6I 4PSXA 3ECOA 1XPXA 4HNUA 3WTUC 2BV6A 1IN6A 2QWWA 2K5CA 3BLYA 2LR8A 4XKVA 4KT6A 3N05A 1YHQI 5FO5A 2F48A 5K5RA 5HOOA 1JT6A 1P6RA 2Y9YA 2Y30A 4AD9A 3TP3A 3CMMA 5LEKA 5FLXZ 2HVQA 2XGEA 2QSGX 3LA2A 2IEKA 1G4DA 2FEZA 2Y0SA 3GBGA 3LOCA 2DCEA 2I5UA 4M72A 3DU6A 1IXRC 4I7HA 2KJBA 3CC2I 1T56A 5FKNA 4J01A 3M8JA 2KKOA 3Q0VA 2DW4A 2Z99A 3HIFA 1MH3A 3I56I 2JA6J 5L3CA 2HQRA 3DKWA 4G94A 1TNTA 1E3HA 1XTAA 4UUVA 4EVIA 2IGMA 2WWYA 4ASNA 4PJJA 2LMDA 2WBMA 4UXNA 3VEPA 2L7MP 4ENKA 1Y56A 1GT0C 3A0HC 1H8AC 3AKZA 1B9MA 5LHIA 1KA8A 3TL4X 1IN8A 2NVXJ 1EH8A 1Z9CA 3JRBA 2Z33A 1SVLA 1XSXA 4DQ2A 3JRGA 2AQEA 2O61A 5AIQA 1X3WB 2KPMA 1MD0A 2IAIA 1QVUA 2CYYA 2FQ3A 4XORA 1HA8A 1X1DA 3ZGKA 1I6HJ 3KETA 1E17A 1I1SA 1TWGJ 1MGTA 1S5LC 2L9NA 2G0EA 2BXZA 1MBKA 2EQRA 3WTTC 1EKEA 2VPLA 3K70D 2JZYA 2Q1ZB 2V6EA 3DTIA 2W7NA 3KEOA 2PEXA 3W6JB 2M0CA 3HSEA 4FETA 2H8RA 2EZHA 3OYKA 4E7JA 2BEOA 4XM3A 4R1HA 4NC6A 1ZHFA 1GVJA 1OYWA 4BXFA 2VXDA 3BCAA 5KCMA 5K7ZA 4HDUA 1BN5A 4XLPF 2A69F 2K86A 3PUFA 3HKZA 3KCCA 5HDNA 4EM1A 1XDUA 3J81K 3FXUA 3QPLA 4IOCF 3HBLA 2BY1A 1TT0A 2CV1A 3W2WA 5E3MA 3V7RA 2GAUA 3O8HA 3OIOA 4XLAA 2C6YA 4IHYA 5CYVA 3FF5A 3RKWA 1VQNI 4Q5SF 2XPWA 2L0KA 1HC8A 3SFIA 1F4KA 3IH4A 4GXOA 4A12A 2DYRH 1IN7A 2CW0F 4LLNA 1R5ID 1R5GA 4EMSA 2Z16A 3CJNA 3JSOA 4IHTA 1N78A 1UHMA 5E1XA 1XGSA 1G59A 2HDWA 1RR7A 4XONA 3ZMTA 3L7WA 4PCQA 2A6EF 3QPTA 1QVTA 4C9YA 5F64A 2VQGA 5IP6A 1K83J 1MNDA 1XGNA 4U7BA 3VPRA 3IHUA 5LBQA 1S7AA 1ZN2A 2RAEA 2ZJ2A 4ETSA 3R60A 2IW5A 1O3QA 5C3EJ 3K1PA 2Z9OA 2D45A 1JHFA 3VYUB 5J3LA 2PQ8A 2DLLA 5FKKA 3CCQI 3F9KA 1K79A 3REOA 3C18A 4P9UA 2KT0A 1FIPA 1YI2I 3Q0UA 3JREA 5GAEJ 1MSFC 1JXSA 5LLQA 2IPQX 4GRIA 2YX4A 1T2KA 2IGOA 2DT5A 3GTOJ 4UB6C 5K1YA 2QBYA 2V1NA 3MAJA 5FGMA 5F04A 4BHBA 1R9TJ 3S16J 2ME0A 3IV5A 5H2FC 5TISC 4M73A 4XN3A 2FBIA 3PSFA 1X2MA 3IUOA 2FMLA 4B47A 3WU1B 3IC7A 4JX5A 1X19A 4PDKA 2R5YB 3GZ5A 3R4KA 3DLAA 1RRJA 1FSEA 3SYTA 2NS8A 1TQPA 3GLLA 4I01A 1XC5A 1X4PA 3GFIA 3PSIA 2FMYA 2FNPA 4MGRA 3K4CA 4NUBA 5JLXA 4DYCA 2XAUA 3I59B 3ZQIA 2WV1A 4HG2A 2TDXA 1AKHB 4DGWB 5LRSA 4DYRA 1RKWA 1TWFJ 2WAQN 2CSOA 4P9FA 2E35A 3A03A 2LD5A 3H92A 4LMYA 4BBRJ 2VODA 3ULQB 3VSKA 3OYIA 3HTUA 4BNCA 2GOXB 2LC2A 2D5VA 4I0BA 4M3GA 2FRHA 4EJWA 2ECBA 1VQMI 3SQNA 4QTRA 2DBBA 3OYAA 1B8IB 1G3WA 4O3MA 3NWSA 1RUOA 2H6CA 3MWMA 2MG4A 2EFQA 2JRMA 5K7FA 3PNVA 1MNEA 2MH2A 4YEJA 1S6LA 3F21A 2J5OA 2G7UA 1P2FA 2CV0A 3WHBA 1LDJA 3IH3A 2Y31A 2QQ9A 3EPZA 1TWAJ 3EYIA 5DEQA 5DUKA 1BL0A 3S3NA 5B3SH 3G73A 1Z6TA 3G4SI 3MKYB 2DOFA 3EUKL 3HOYJ 1VQPI 3FK6A 2W1OA 3RSNA 4RA2A 4BEHA 2CU7A 2FE3A 1SMTA 1QPIA 3C2GA 4AU7A 4OAZA 3A4CA 2LTPA 3OS1A 4WK8F 3DEEA 1YJ9I 2XIGA 3IRQA 4O5VA 1YTYA 3OS0A 2DA6A 4M9SA 2ISZA 2DOEA 2I8DA 2MW8A 4EJUA 4OIOF 3KPHA 1DP3A 4PJLA 2WA0A 5HVQC 3IH2A 2HOEA 2WY7Q 2CQ7A 2ZJRF 5EGOA 3GTMJ 3ZMSA 3P9KA 1O3RA 2ECCA 2PMZN 4II3A 2AQFA 3BQYA 1G8XA 2FX0A 5JHUA 4KICA 5GAGJ 3CDHA 1P92A 5IP7J 3JRDA 2XAGA 1BOBA 2NVUB 1ZELA 1D0XA 3GTKJ 2WAEA 3BJAA 2VJ5A 5KHDA 1RPWA 2E1MC 1X4OA 4ESJA 1O3SA 4BE0A 3DP7A 2XASA 2R7FA 3GUDA 3RPUA 2JRTA 1YOVB 1UG0A 1R6RA 3HDDA 3GZ6A 1QZZA 2HYFA 4KISA 2DO7A 4V19K 4XNFA 1QO0D 1ZRFA 3D1NI 4PUSA 4BJ5C 4DOZA 1SEUA 3I4MJ 3I9V2 2ZMEB 3L00A 3ZN0A 3CCRI 3SDBA 2VASA 3U9GA 1ETYA 2IA0A 3ZR8X 4IPAA 1QA6A 2F5VA 2XAQA 1SVOA 4S05A 3F23A 1OYIA 3LSTA 3OSGA 4ZYEA 1BJZA 1D3YA 2LREA 5H6RA 4KITB 2VBWA 4JK1X 3TO9A 3TO7A 3VFZA 4Z6YA 1UHWA 3WG9A 4PGHA 3KE2A 3OYGA 2WAQA 1IF1A 1F43A 4MQ9F 1KZHA 5K5OA 2MLKA 4XLNF 2VKVA 2YUSA 4LG0A 4IRHA 3BP8A 3BT9A 2FSWA 2COBA 4L5IA 1FLIA 3JAMK 1DGWY 1BR1A 4HA8A 5CPRB 2PN6A 1XS9A 5LGTA 2BGCA 1SD4A 1G3SA 3CJTB 1W5CC 1KU7A 4M3DA 1J2XA 2ELJA 2R7XA 1JUPA 4IQ4A 3PFIA 5FRNA 3E5QA 4QIWN 2JVGA 4IOAF 2DMQA 2PG4A 4JX4A 3K4LA 3CDIA 3FDYA 4BGDA 3UR3C 3PJRA 4LGWA 4L5EA 1LEAA 1OLTA 4ZYAA 2BXYA 2D1VA 1VI0A 1XMAA 4XL9A 4BBSJ 1YQAA 2HTJA 2EFPA 3TOBA 4A0XA 2CS3A 5L3GA 3I5UA 1GV2A 3G71I 2X1EA 2Q2EB 3U21A 3ZQCA 1ON1A 3M1CA 4A69C 2XAJA 2XGXA 3HYIA 1FC3A 1XN7A 4PFPA 5DCMA 1KQ9A 2OV7A 3IWFA 3OWTA 1NH3A 4XOTA 1G2HA 1TWCJ 1MSEC 5EYRA 3TMOA 4AWXB 3HOXJ 2CWEA 5E8GA 4LLGF 3ABTA 4AYBN 2KQRA 3E3VA 1OQYA 1FJLA 3OOPA 2LH9A 4CXFA 2IGNA 1PP8F 1FIAA 1Y8RB 2BBYA 4IVNA 1TBXA 2XUBA 3ISPA 3LMMA 2EB7A 4HYEA 3V7CA 3CCVI 3FMQA 4NQWB 3WE3A 2LFBA 2PMZA 3R0JA 1WFXA 1MBFA 2DJIA 4PJNA 1XGMA 2KFDA 4GDFA 4A2UA 3ZN1A 1FP2A 2KLOA 2W85A 2UUZA 3PQJA 3OS2A 4CCMA 5FFXA 3DFGA 2W84A 4ZTFA 2ADUA 5D5VB 3WTZA 4CDGA 2JSCA 2R7RA 2E5NA 3CCLI 4BJTA 3OR2C 4R79A 5FJ8J 3K7AJ 2NYXA 1PUFA 3COAC 1LE8A 4N0BA 4B48A 3IP4B 4DIQA 1FP1D 3HPHA 1OCPA 2R93J 1DPRA 5EJCA 1TWHJ 4EGZA 4KYWA 1IRFA 3T8TA 2H94A 2K3FA 3BTLA 4KMUX 2K40A 3QAHA 2AHQA 5HS8A 2F2EA 2M34A 3MKZA 4EGYA 2X1CA 1P4XA 3BPXA 1FBSA 1PJRA 5CVIA 3B6AA 4A3LJ 3TGNA 3OYFA 3V8KA 2CUZA 1FMWA 3K4JA 3V8JA 1APLC 2O7OA 2P8TA 1A6QA 3HGGA 2QZ8A 3SZGA 3LSKA 1WJFA 2KRFA 4HBLA 5FLVA 2M7AA 2WTEA 4RB2C 1Y0UA 1N25A 1V5EA 2MGQA 2M87A 2HPMA 2X0LA 1JT0A 4OWRB 1J09A 5BS6A 1T0FA 5AONA 3HOSA 1W36C 2JVHA 3CUQB 1CF7B 2DA2A 1YX5A 1K6YA 4E4HA 1I27A 2BVMA 3ZRGA 4H0EA 1SC7A 1K7AA 2DA3A 3QU6A 3HHGA 4UUTA 1IXSB 3AAFA 1WJBA 3WHCA 1I6XA 4E7LA 4E70A 2Z2SB 2VKEA 3FK7A 3E1SA 4LK1F 1ZRCA 3I4NJ 3JTGA 1HQCA 2QUFA 2X6XA 4JX6A 3IWZA 4QWQA 1WJAA 1S7OA 2KL4A 4Y13A 4Y52J 2LY9A 4CYDA 2OA4A 1TC3C 2PJPA 3RKQA 4BS9A 4S04A 4LOCA 2VBYA 1S9HA 1BC8C 4HLXA 1YLFA 5GP9A 3WU2C 5HLTA 3HOZJ 1T0FC 1WI9A 1RIOH 3E0JB 3FZVA 1Z7UA 3LNQA 3ONQA 3WGHA 1LDDA 4ESBA 1SVMA 1S72I 3S17J 5F27A 3KP7A 4EEFG 2CFXA 2EV6A 4AYBA 2XDVA 4LG3A 3L2VA 3D5SC 3LQQA 3GFLA 3NARA 4XK4A 5FKLA 5A2QK 2B63J 4RM3A 5BOXA 4ABZA 4A3CJ 3OL4A 3P5JA 1V5FA 2GXAA 4P96A 3S3OA 2K7LA 4EQQA 2LKSA 2AXTC 3DQVC 3AG1H 4FT8A 2ESHA 3R61A 2XROA 3F3XA 2UV1A 3TW7A 4HW0A 4HNVA 1RUNA 2L9VA 3RQ4A 2FOWA 5GPCA 2QA4I 2DMUA 4HNTA 1U9NA 3K2AA 1J75A 4JP0A 3VYTB 1MNMC 1A36A 4OIQF 4DJAA 2TCTA 2YSRA 1SD6A 1IDYA 3HUGB 1BI1A 5F6FA 3DEUA 4A6EA 5KNLA 3CCMI 2NVQJ 3CO7C 5FLXK 2VI6A 2ZXIA 3HSRA 2CW8A 1R1VA 2V26A 5BMZA 4G7HF 2CUFA 4KIBA 1A04A 3CZ6A 4HRIA 1ZTRA 3DCFA 1I50J 1YYVA 1TQIA 1W7PD 3CJQB 1GXQA 3OIPA 1LDKB 1OJLA 2BOLA 2JA5J 1R1UA 3PL8A 4H4KC 5HDGA 4CSWA 1HCRA 2V1UA 4M71A 4CHUA 2XAFA 2V1DA 2A3SA 2F4OB 2E7WA 3KZIC 4A5NA 3ZMVA 4GYIA 1HBXG 5EF6A 2HVSA 4HEA2 5J1RA 1X1AA 1Z77A 1BJAA 2GLOA 1HSJA 1FSHA 3WGIA 5BPIA 1M1EB 4R8HA 4HX7A 1P4WA 2XC7A 1ZR2A 1FWZA 5FROA 3GXOA 1P9QC 3HRTA 4WXCA 3GTJJ 2UXNA 4FX0A 4L9TA 4HX8A 4RGSA 2O03A 3ZQLA 1QZYA 3L9FA 5ERIA 1X1BA 1Y8QB 3A01B 2VN2A 3L2UA 3Q0WA 3HTSB 5D5WB 2P6SA 1G6NA 4KUMA 2ZNYA 2L7FP 5JR3A 2ZFWA 5E79C 4Y7NJ 1Y39A 2XPVA 4G6QA 4KDPA 1V3FA 3S1RJ 1BIAA 3ASNH 1OFCX 4AM3A 3CMEI 4I02A 1ZR4A 1IGNA 2KP6A 5TJJA 1S7EA 4I2OA 4RLFA 1S29A 1K78B 1SD7A 3QOPA 2OTLI 3PUBA 3CD6I 4HX4A 1WCMJ 1WJ5A 2MA3A 4Q4ZF 1KYWA 1FOYA 1RESA 2ZCWA 1XMXA 2E60A 2ACJA 4NC8A 1RI7A 1FMVA 4PFOA 1HDPA 3FISA 2IRFG 2HXOA 4G12A 2R5YA 1S8NA 1VQ4I 4NNJA 3V8LA 2OUMA 1VZ0A 5FKOA 3OYEA 1LFUP 1B9NA 2HVRA 3I59A 3S32A 4IHXA 4OMZA 1AKHA 2KZGA 3G1MA 4V2GA 1I3AA 4EATA 1J7KA 1JGSA 2M4GA 2R92J 4EM0B 3MCZA 4C2TA 2E1OA 3C1DA 1IXCA 3DKXA 3QP6A 2CG4A 2CQNA 5D6FA 3CMYA 1HKSA 4RB1A 2BY0A 2R3SA 4CCOA 1FTTA 1UAAA 2KIUA 2QQBA 4BQOA 1N75A 1O7FA 1RKTA 4P1WA 3N4MA 1V4RA 3CCYA 3IAM2 4L9VA 4DW6A 3ZOBA 4ZDPA 3F8MA 1B8IA 2BW3B 2JA7J 2X51A 2ZXHA 3FWEA 4GYGA 2GA2A 2IS4A 2LVSA 4MTDA 1D1AA 2P81A 5HS9A 2LDUA 3VOEA 4XLCA 4W1UA 5E18F 3CF2A 1EV7A 1T98A 2RQQA 3BROA 5E1ZB 2HGCA 2ZXJA 3HRUA 1TLHB 2YR2A 1I39A 3WTYC 1H9GA 2LKPA 5D6EA 1X2NA 4YIIA 4WXDA 2V1XA 2OQRA 3DWLE 1TQMA 4E7SA 5M3MJ 1MMSA 2DDAA 3O3KA 4MIMA 2CRGA 4IHSA 3LQRA 3CP8A 4BQQA 4XKBA 1SFXA 3L09A 1YO5C 3ESWB 2NAZA 5ICCA 2EZKA 2HR3A 3CTAA 4HPQA 3OYNA 2VONA 1MH4A 3AL0C 2JK3A 4FASD 2EPFA 2Q0OA 5ICFA 2VQLA 4HOBA 4OINF 4YIFA 5IPAA 1BOAA 1GV5A 2Y0MA 3HRSA 2K9QA 3R6SA 2JSPA 2PBIA 2CQKA 2HS5A 2HXIA 2VL8A 3DBLB 2MSYA 1K4TA 2M8GX 3CQZJ 2VUMJ 4QSHA 3UKGA 2X48A 3JSPA 2QCOA 2VT2A 1H88C 1OKRA 1QZEA 2K4BA 1ON2A 2A61A 1IN4A 2FXAA 1WQ2A 3PO3J 1OR7A 2E5ZA 2K9MA 2CH0A 2DA5A 2DPUA 4I98B 5HDKA 1YS7A 2CO5A 5ICEA 4KT5C 4WF2A 3GYHX 2DFFA 4ZC3A 1K4SA 3QODA 1R36A 3H5AA 3J80K 2OCEA 4NBQA 4XLEA 1D0ZA 2W24A 3U1KA 4UY8I 1EF4A 1W7PB 3DTKA 4RM2A 2IS6A 2ZMEA 3J7AY 3H5RA 2D1HA 2H1KA 4EJOA 4I09A 3IL2A 2EINH 3KFWX 5EG0B 4U7DA 3QRFF 3E6MA 2E1CA 1Z3YA 2X6WA 5F0FA 5IT9K 5L3DA 1R00A 2UXXA 3AG4H 4M3BA 2ZKZA 4XRFA 2EA4A 2DFIA 1XG1A 2AO9A 1AA7A 3QPHA 1GHCA 1BBYA 3KP4A 2M45A 1OR7C 2FOKA 3TO6A 1WJCA 5LD2C 1XB4A 2ZBKA 1HW5A 5CVJA 3IKTA 1FBUA 1UG2A 3KP6A 2P4WA 1TP4A 1T38A 4A3DJ 3J80Z 1FZPB 2VT3A 2F5EA 2FBKA 1ETWA 1V55H 2ETHA 3K4KA 4A3EJ 3O2PE 1GXPA 1A6IA 2Z5UA 2M9HA 1ZARA 4LIVA 5J47A 2ZMEC 2P7CB 3DPLC 1QHGA 1ZG3A 2ZJQF 3V42A 2WAFA 3S2HJ 2W4SA 3LSHA 1ZAOA 5IT9Z 1R4MB 1ULYA 2XKPA 4II2A 2EH3A 4QPQA 4B44A 5B66C 2RC4A 1UJ8A 1YITI 2M5WA 1YW7A 1QNTA 4XQFA 1GUUA 1GDTA 2BZTA 2XB0X 2XVCA 3A2KA 1WJEA 2DN0A 1MMDA 1R1TA 3D0SA 1WRJA 3HHHA 4F55A 2ID3A 5J8FA 4Y17A 2ZO4A 1OISA 2M0MA 2FF4A 1OCRH 2VC0A 3NRVA 2P5VA 3BR3A 4XSXF 3I3LA 1MIJA 5KAFC 4XRSA 1BM9A 2Q2EA 3JR9A 3FX3A 3E7LA 5IYBJ 3SHFA 2P0WA 3HRMA 2E1NA 5DCFA 2RNJA 3A1YA 2XAHA 3ELKA 3RKXA 1KU3A 2ZB9A 5E3LA 3MZYA 2LBFB 3CCEI 2JWTA 3S1MJ 3KZYA 1JUMA 1EJ9A 1W4MA 3WTXC 2E36A 2F4MB 2GZWA 4EV0A 4BE2A 2VBZA 4G7ZF 2JUGA 3FM3A 3FIWA 4U0YA 3K4MA 2YS9A 1VTNC 2HQ5A 3S2DJ 3J7ZI 3EUHA 1BI2A 1D0YA 2X9DA 4NQWA 1OPCA 4LFUA 5E3OA 4E7ZA 3SEZA 2F5FA 3F8BA 3PFYA 5C4JJ 2X85A 4BE1A 3QPSA 3ABUA 3BTJA 3WU0A 1WH5A 2V4JC 3OL3A 2PLYA 1WJDA 3CCJI 4RB0A 3I54A 5JI6A 4U87A 3RPQA 4EM2A 2L7ZA 2A6HF 2PI0A 4AVZA 2W48A 1LQ1A 4BQNA 2STWA 1P7JA 1SFEA 3C3WA 3OR1C 2DK8A 3H0DA 3EUHC 1XD7A 4RS8A 2E2HJ 1KU9A 2GXGA 4ZYGA 3HB9A 2XPUA 5DS9A 5M5YJ 5FKMA 3CMAI 1MBHA 1MMAA 2K9NA 2IT0A 2DFEA 3BY6A 4HLYA 2XV4S 2BE5F 1HDDC 1W36D 2XF7A 3K1MA 2YU9J 3I58A 4N9HA 1OCTC 2M7BA 1YS6A 1RR8C 4BDZA 2BHYA 2R4GA 2DDBA 5HLGA 3RI4A 2R5ZB 4BQAA 1YJNI 2HTSA 1O3TA 2ESNA 1I5ZA 3F6VA 3LFKA 3MVPA 3VSLA 3BG5A 4XBFA 4IHWA 4CGZA 4ITVA 2H27A 4G8XA 3LL7A 2VQCA 3K6GA 5LEJA 3ERED 2JQ7A 3S15J 5FFZA 3ZMDA 2ID6A 2BYVE 2M4KA 3CUQA 3ZQFA 4XICA 3DLLF 1CF7A 2H6BA 4G9YA 1YIJI 2O3FA 2KIQA 3VB2A 5ILVA 1V5GA 5IP9J 2EK5A 3I0TA 1TT5B 1ZGJA 4B4CA 2IVMA 1H0MA 3H9GA 2VJIA 4BU2A 4XIDA 1QHHD 4ZYHA 3I53A 2VJ4A 3HOTA 2QEXI 3HEFA 2HOAA 2V7FA 3MKWB 3KEQA 5KAIC 2Y2ZA 3K9TA 4CH7A 1FOWA 2JMWA 2L7KA 4JOMA 3G2BA 3E5UA 3DBHB 1XMKA 4CCJA 3M4OJ 1IRXA 3SJMA 5HNHA 2EFNA 1RC9A 5CLSA 4DBRA 1SFKA 1Y1VJ 4DNCA 1J59A 4GFBA 5HNFA 3O8GA 3T5XA 1F9NA 2CW7A 2VXZA 2K9SA 1J5YA 2NS7A 3CCUI 5LHGA 3CUQC 2QKMB 3TP0A 2WV0A 1NG6A 2LY1A 2ZFUA 3E6BA 2XRLA 4IXAA 4A3GJ 2A5YB 2DA7A 3C7JA 2XGCA 3E6DA 4A6DA 3BC8A 3A0BC 3CP2A 1MJBA 2YX7A 4CICA 3FXRA 5DTDA 4OIPF 2XHKA 1U2WA 3ROUA 3P7NA 4LJZF 2PMUA 4OU0A 1TTYA 3PO2J 1TNSA 3BJOA 1HF0A 1I1GA 1IRGA 3ERMA 3H1CA 1RETA 3H9JA 2OZ6A 4LITA 3EETA 1ETKA 2IS1A 4C2UA 4DYQA 3P9IA 2L5QA 4RGUA 4LLLA 4BY7J 2NVTJ 1ITYA 4I76A 4GCVA 1WHUA 4YRVA 4I0AA 1YW8A 4L0YB 4IZZA 2NNNA 2M3AA 1X3UA 4D7NA 5HLIA 5J6XA 1JHHA 2DA1A 4FISA 2HU9A 3V4GA 3CLOA 2H8WA 3HUGA 1LNWA 4TV7A 1XGOA 1WH7A 4MEXF 1JJ6C 4E7IA 1MJAA 2DYSH 1IG7A 4I6ZA 2G9WA 2R0QC 3CJRB 2J5PA 4KJZA 4M6YA 1QQIA 5BQTA 3GCMA 5B1BH 2FNAA 4HZFA 5FD5A 4A3JJ 3OYDA 3HOVJ 3FMSA 2OC6A 1BW5A 2PMHA 1FYMA 2V9PA 3PNTA 3ML6A 4MO7A 2KZVA 2Y75A 4A3MJ 2HYGD 5DM7F 4ENJA 2VQHA 4WX9A 1R5HA 2EIMH 1J0RA 2EFOA 3VDXA 2HPIA 2LRDA 4XLHA 3B02A 1USSA 2OBPA 4CO8A 1B72B 4RDUA 3FXJA 3FXLA 4M6VA 3OOUA 1JTYA 2HKXA 3PQKA 1ETQA 2JJ7A 5J8CA 3W6VA 4IRIA 1GVDA 5AIPA 1FYLA 2HFHA 3MEXA 4XOPA 4IEJA 1QU3A 4BHCA 2LKXA 3BR0A 4CYCB 1KONA 1LJ9A 3FMRA 4A3FJ 1Z21A 2EBIA 3LA7A 2W25A 4UNOA 1ETOA 3RZDJ 2X4HA 1U78A 5F0HA 3A01A 4CZCA 2NS0A 1ETVA 2B7EA 4HSRA 4PZJA 4C3JJ 5M5WJ 4C3IJ 4WXHA 2DT6A 1D8KA 3IRRA 2IJLA 5CJ9A 2OCCH 4MLOA 5LGUA 4B3AA 5TRDA 1YX3A 2R7TA 1FYKA 1VQ9I 1LFPA 2Q8KA 1U6GA 1I3QJ 1MKMA 1TW2A 2WB1N 1H89C 1DPUA 3TW6A 1OYYA 4LB5A 1JGGA 3JRAA 3DBRB 1L0OC 3HZJA 3HPGA 4S0HB 3M3YJ 1P7IA 1K78A 1B1BA 3T0YA 3DXJF 5IYCJ 1MMGA 1R22A 5M3FJ 3RYRA 3SXYA 1SFOJ 5ILSA 2DJNA 1JKOC 2X6OA 2ICWG 4FCYA 3CC7I 2JA2A 1IRZA 1KQ0A 2DMPA 3H3UA 2L9RA 2Z1DA 4ZTJA 1D5VA 1MMNA 1OMIA 2H1LA 2GM4A 5ED4A
chains in the Genus database with same CATH topology
1YI2I 3G71I 5GAEJ 2OTJI 3CMAI 1VQ7I 2ZJRF 5GADJ 2H8WA 2ZJQF 1VQOI 5GAGJ 5JVGF 1YITI 1YJNI 1MMSA 5DM6F 1Y39A 5DM7F 3CCVI 3PIOF 4V19K 4IO9F 2JQ7A 1VQ8I 2E34A 1ACIA 3CMEI 2NXNB 3DLLF 1S72I 2E35A 1YIJI 3CCRI 1QA6A 2OTLI 3CD6I 3CCLI 1FOYA 2QEXI 3CCEI 1VQMI 3CCSI 1FOWA 1VQLI 4IOCF 2E36A 1VQ4I 5GAHJ 1YJWI 2FOWA 1FOXA 2QA4I 3G6EI 1VQ6I 3J7ZI 2K3FA 3CC4I 3CCUI 3J7YJ 1VQNI 1VQ9I 1HC8A 3CCMI 2ZJPF 3CJTB 1YHQI 4UY8I 3CCJI 4IOAF 3G4SI 3PIPF 3CF5F 1VQPI 3I55I 1VQKI 1VQ5I 3CC7I 3CC2I 3CCQI 1YJ9I 3I56I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 I;  3G71 I;  5GAE J;  2OTJ I;  3CMA I;  1VQ7 I;  2ZJR F;  5GAD J;  2H8W A;  2ZJQ F;  1VQO I;  5GAG J;  5JVG F;  1YIT I;  1YJN I;  1MMS A;  5DM6 F;  1Y39 A;  5DM7 F;  3CCV I;  3PIO F;  4V19 K;  4IO9 F;  2JQ7 A;  1VQ8 I;  2E34 A;  1ACI A;  3CME I;  2NXN B;  3DLL F;  1S72 I;  2E35 A;  1YIJ I;  3CCR I;  1QA6 A;  2OTL I;  3CD6 I;  3CCL I;  1FOY A;  2QEX I;  3CCE I;  1VQM I;  3CCS I;  1FOW A;  1VQL I;  4IOC F;  2E36 A;  1VQ4 I;  5GAH J;  1YJW I;  2FOW A;  1FOX A;  2QA4 I;  3G6E I;  1VQ6 I;  3J7Z I;  2K3F A;  3CC4 I;  3CCU I;  3J7Y J;  1VQN I;  1VQ9 I;  1HC8 A;  3CCM I;  2ZJP F;  3CJT B;  1YHQ I;  4UY8 I;  3CCJ I;  4IOA F;  3G4S I;  3PIP F;  3CF5 F;  1VQP I;  3I55 I;  1VQK I;  1VQ5 I;  3CC7 I;  3CC2 I;  3CCQ I;  1YJ9 I;  3I56 I; 
#chains in the Genus database with same CATH topology
 4YFK F;  1HLV A;  3S8P A;  1HST A;  4PJM A;  3WTS C;  3X2Q H;  1PVE A;  4N4N B;  3FXO A;  1WZ2 A;  2BY2 A;  3FKI J;  2OTJ I;  1JUS A;  1HW1 A;  1Q1H A;  2DQL A;  2RRE A;  3GO5 A;  2K9L A;  3HG9 A;  4ZDO A;  1HXD A;  1YIO A;  2QGU A;  3OYH A;  3UNG C;  1Z1D A;  2EZL A;  2FJ1 A;  2KJC A;  2MC3 A;  3FHN A;  2RQP A;  3JRI A;  1ZGW A;  3L2Q A;  3BR1 A;  3B73 A;  2IP2 A;  1R7J A;  1VQO I;  4HAM A;  1ZRE A;  1PUE E;  1K61 A;  5K5Q A;  2VLA A;  1W1W E;  3FM5 A;  4D9J A;  2VBX A;  1GLN A;  1QGP A;  2K3P A;  4WCG A;  4LD5 A;  4CZZ A;  1VND A;  2DT7 B;  4MEY F;  5IT3 A;  1P4A A;  2MYS A;  2FU4 A;  1D1B A;  4X0G A;  2HZD A;  1O7L A;  2LLK A;  5FLM J;  3L2W A;  3TKY A;  4IO9 F;  3JRF A;  3LAJ A;  1SAU A;  4FX4 A;  2BW3 A;  3QP5 A;  4W97 A;  3TBI A;  4B8X A;  4MQV A;  4KA4 A;  5F1J A;  3VWB A;  3CUO A;  4ENM A;  1YRN B;  3RYP A;  1Z05 A;  2CQX A;  2VC1 A;  3F6O A;  3GFM A;  1MDM B;  4CUG A;  4K2E A;  2LF8 A;  4EJV A;  5DDG A;  5EZH A;  2K85 A;  2MLG A;  2OQG A;  3LFU A;  2CUJ A;  2LG4 A;  2HQN A;  2PX9 A;  1LUJ B;  3OYJ A;  1YW9 A;  2KMU A;  2F5C A;  3BPV A;  2OF7 A;  4KN4 X;  9ANT A;  4HV5 A;  3FKJ A;  4M3F A;  5GAH J;  2R7V A;  3GVA A;  3S93 A;  3HOW J;  1YG2 A;  3PM1 A;  4BXU A;  4ANJ A;  2ME6 A;  4AUX A;  3QU3 A;  3DKY A;  4ZZL A;  3FHZ A;  4YIR X;  4XLF A;  2GIZ A;  3KX2 A;  2A68 F;  1MBG A;  5GTI C;  1R23 A;  2ZJP F;  2LNB A;  1EA3 A;  5JHF A;  2X6Y A;  4IF4 A;  3L2C A;  5HS7 A;  3E6C C;  4AID A;  2Y9Z A;  1DDN A;  4RB3 C;  1MZB A;  2WAD A;  5HOD A;  2B9S A;  2RDP A;  3MN2 A;  2OAZ A;  1U5T B;  2PJR B;  4D5C A;  4BXX J;  2P5L C;  2IXS A;  1VQ5 I;  4D7M A;  2XF5 A;  2WB1 A;  4AC0 A;  5C44 J;  4ENN A;  3M9A A;  4UUS B;  2LY2 A;  3HSF A;  2O8K A;  4AIH A;  1JJ8 C;  3M8F A;  2M8E A;  5F0C A;  2HEO A;  2DI3 A;  4AVP A;  5DUI A;  5DV5 A;  1CGP A;  5BPD A;  3GFJ A;  2LOO A;  1G3Y A;  3FBI B;  4F52 A;  4YG2 F;  4KIF A;  3GTL J;  1FPQ A;  1IUF A;  1D1C A;  3HJE A;  1DU0 A;  4FTH A;  1T95 A;  4GO1 A;  2RKH A;  1HKQ A;  2DTR A;  4L9J A;  1R58 A;  1DUX C;  3CO6 C;  2QQ8 A;  3DF8 A;  4WWC A;  1CQT A;  1X1C A;  1JKQ C;  1W7P A;  2FA5 A;  2RVC A;  4RMN A;  3W2V A;  2RV8 A;  1YFH A;  3DPU A;  2V79 A;  1VF9 A;  1BIB A;  1XCV A;  2LSO A;  4G6D A;  4YFX F;  1ODD A;  5EG0 A;  3RZO J;  3S14 J;  3K4N A;  3TDU C;  2QKL B;  5CVV A;  1AHD P;  5DM6 F;  2KIM A;  1NK3 P;  2Z3Y A;  3FBN B;  4BH9 A;  2QSH X;  1MJ9 A;  2ZC2 A;  3M07 A;  3U1D A;  5IOY A;  2IA1 A;  4BUP A;  1BR4 A;  3NQO A;  1R49 A;  1LFB A;  2KIS A;  2OU2 A;  1MBE A;  1UMQ A;  2E34 A;  2R7Q A;  4NB5 A;  1PP7 U;  1V54 H;  1IV8 A;  2XF6 A;  5H6Q A;  1XSD A;  3A02 A;  3EYY A;  1Z3X A;  2QVO A;  3EDP A;  1Z0X A;  4B3X A;  1NTC A;  2H09 A;  1BI0 A;  1AWC A;  4DZJ A;  1B59 A;  4G7O F;  2HYJ A;  5E8I A;  3BZC A;  3GWZ A;  3IKV A;  3ZQH A;  4B09 A;  2MH9 A;  3VYR B;  1RNL A;  4NDL A;  2O5R A;  2VKD A;  3ZMZ A;  5IYD J;  2HOS A;  5EEH A;  2P5K A;  4MFE A;  2OD5 A;  3OYC A;  4IKF A;  2DK5 A;  4Y15 A;  3MZH A;  2YPR A;  3BR6 A;  6PAX A;  1EH6 A;  4XKW A;  4BY1 J;  1R71 A;  4A3I J;  3J81 Z;  2W00 A;  4ESF A;  3BR5 A;  1ZLJ A;  3G6E I;  3CC4 I;  3M1E A;  2L54 A;  4PJ0 C;  1Y6I A;  3KZZ A;  1ZLK A;  3W6K B;  3WGG A;  3SZP A;  4UHT A;  1LPQ A;  2QF7 A;  2P7V B;  5D5U B;  2XB5 A;  4IRG A;  2K27 A;  4U0W A;  4CCL A;  2VPR A;  4RAF A;  1ZRD A;  3H3V K;  2R7U A;  1BC7 C;  3GME A;  4UV9 A;  2GQQ A;  1ORK A;  4M3E A;  3PIP F;  4PSW A;  2LYC A;  1ZKG A;  5DD4 A;  3SEQ A;  3BR2 A;  2AXL A;  2PFB A;  3KP3 A;  2DMT A;  4JYK A;  1DQU A;  1D5Y A;  1A5J A;  1VQK I;  1REP C;  4A0Y A;  1ETX A;  2LBF A;  5LHH A;  2ELH A;  3G3Z A;  1EH7 A;  4IHV A;  1SAN A;  5FD6 A;  4HQE A;  4HST A;  4RAY A;  1DU6 A;  2CV2 A;  4Q47 A;  5EZG A;  1T08 B;  3RPU D;  3BG9 A;  5EEA A;  1FBQ A;  3HGY A;  4A93 J;  1XX5 A;  2UWM A;  5EDN A;  3TDZ C;  1ZG1 A;  2A5W A;  1N77 A;  5FB2 A;  1T33 A;  3QWL A;  2GOM A;  4ZZD A;  2KRC A;  4ZH4 F;  2K4J A;  3GZN B;  2COM A;  1SD5 A;  1FEX A;  1WGX A;  4XR6 A;  2E7X A;  1L3L A;  2XSD C;  1BA5 A;  4XN0 A;  2STT A;  4CA0 A;  3ZMU A;  2A6T A;  4DZP A;  4M9Z A;  2VOP A;  3QYE A;  2DA4 A;  1DP7 P;  4YFN F;  5C4X J;  4HQM A;  2EFW A;  3K70 C;  5KVR A;  4BHP A;  4C3H J;  2JN6 A;  4MFD A;  4RAG A;  4RAZ A;  3MFK A;  2OPT A;  2GBY A;  3SDG A;  2HKO A;  3HXL A;  2BVL A;  1MW7 A;  3VYS B;  1PYV A;  3E97 A;  4Z2Y A;  2E19 A;  1A31 A;  1NK2 P;  3BQZ A;  3O6B B;  4NC7 A;  4MTE A;  5H20 A;  3M7G A;  3JRH A;  4L0Z B;  4KMF A;  1ACI A;  5L3B A;  3NEU A;  3MQ0 A;  3HOU J;  1KQ8 A;  1SFU A;  5CVU A;  2HWV A;  4Y4R A;  3AL0 B;  3IAS 2;  2P6T A;  2NNY A;  1IO2 A;  1WPK A;  1T39 A;  4LIU A;  1PDN C;  2R7W A;  5K7H A;  4PK4 A;  1TW3 A;  3KLN A;  2UZK A;  2LP0 A;  3ABM H;  3D5R C;  3K4B A;  4F91 B;  2F4I A;  5F08 A;  3I64 A;  3ASO H;  4B1R A;  2HNH A;  1FTZ A;  4V2F A;  3NWT A;  4ON0 A;  4OIR F;  3LAP A;  2DFH A;  2QSF X;  4ZDL A;  2R5Z A;  2QYO A;  3WOD F;  3DEW A;  2W82 A;  4D0P A;  1S3J A;  3R0A A;  1FOK A;  2EIJ H;  4LB6 B;  1FX7 A;  1OCO H;  1QPM A;  2R7D A;  3QOE A;  1NHA A;  2VB6 A;  3D5L A;  3SZT A;  1UHS A;  3G1O A;  1T8I A;  1Z91 A;  4U0V A;  2XGD A;  4HV6 A;  2DAO A;  2EJR A;  3JRC A;  2QBY B;  1H9T A;  5J4V A;  4XRM A;  3I71 A;  1UZC A;  3OYM A;  3WE2 A;  4BAY A;  2JT1 A;  5J40 A;  3JW4 A;  4A5M A;  1F1Z A;  1Q1V A;  2FD5 A;  1OCZ H;  3BWG A;  2FBH A;  5FRM A;  2KRH A;  5EEG A;  2XRN A;  2L02 A;  2LK2 A;  3HM5 A;  3BG3 A;  2A07 F;  4CCN A;  2VOO A;  1RZ4 A;  3VOD A;  1UST A;  4F92 B;  4I99 C;  1LVK A;  2JA8 J;  4L5J A;  3GX4 X;  3GTP J;  2CFO A;  2QQA A;  2RGV A;  5DD8 A;  2GIV A;  1MBJ A;  1B6A A;  4QPO A;  3CDL A;  3BZK A;  3CES A;  4RGR A;  3AG3 H;  4Q48 A;  1QRY A;  5CQE A;  1VQ7 I;  2ZXW H;  2ZSH B;  5J4Y A;  4F7Z A;  2ELK A;  3WTW C;  2B0L A;  3KYC B;  2QLZ A;  2VJJ A;  4JQF A;  3LSM A;  3FXQ A;  3MKL A;  2E2I J;  3GTQ J;  4XRS G;  3BJ6 A;  3BZ6 A;  3E5X A;  3F22 A;  5JVG F;  1LEB A;  5TGT A;  3RKY A;  4FE4 A;  4KNY A;  2MAB A;  1E3O C;  1OCC H;  2Y48 A;  3ZQ7 A;  5D4R A;  5CVR A;  2VIX A;  2I10 A;  1XSV A;  1K6O A;  5J1Y A;  3LSG A;  1UEL B;  1O4X A;  3AG2 H;  3RQI A;  1Y0N A;  4BKX A;  4A3B J;  1X1P A;  5GPA A;  3K0L A;  3LSI A;  4OAY A;  3RIR A;  3CLQ A;  3BTI A;  3W2A A;  5D4S A;  1YE9 A;  5JVT A;  5L3E A;  1IAW A;  4LK0 F;  3LA3 A;  3EUA A;  3S1Q J;  2KIF A;  1UCR A;  4FHT A;  3BCB A;  1E2X A;  3KEY A;  3H35 A;  3QYF A;  2NOJ B;  3KIO A;  1POG A;  3TOA A;  3AFH A;  2X1D A;  2YU3 A;  2CJJ A;  3RJP A;  2R7S A;  4BEH B;  1KGS A;  5GTH C;  4MNU A;  3GLX A;  2DXI A;  2FUG 2;  3LSR A;  3FXK A;  3H36 A;  3Q9V A;  5IY5 H;  2E1M B;  4O6J A;  1STZ A;  3BDD A;  3DV8 A;  2EIL H;  5E1W A;  3H0G J;  2RNG A;  1WKM A;  4IX7 A;  4XSZ F;  1TL8 A;  2KHM A;  4F93 B;  4KFC A;  3RDI A;  1IZ1 A;  1YJW I;  4UV8 A;  2KDZ A;  1IV6 A;  1XCB A;  2D2W A;  1U8B A;  2W57 A;  3OSF A;  3J7Y J;  4HDV A;  3RCO A;  1J9I A;  2EIK H;  5ICG A;  2DTZ A;  1X3Z B;  1ZYR F;  1G3T A;  3DU5 A;  3JAM Z;  5EGO B;  2HDC A;  4IQJ A;  1WSU A;  2L4M A;  3OYB A;  1B72 A;  4D1Q A;  2JPB A;  4RLQ A;  1AOY A;  3JTH A;  5JFR A;  1U0J A;  1WI3 A;  2F5D A;  4JBA A;  2O9L A;  2EV5 A;  2NVY J;  3K10 A;  1HOM A;  3G1L A;  4UVB A;  2IBD A;  2QEN A;  4CYC A;  3OY9 A;  3I55 I;  2MFZ A;  2DQR A;  3S2W A;  4U88 A;  3N97 A;  3F8F A;  3WG7 H;  1SAX A;  1AU7 A;  4KN7 X;  2TRT A;  1IJW C;  2E2J J;  2O6G E;  2IA2 A;  2HZT A;  3C2B A;  1WWX A;  2HDD A;  2ZSI B;  1LVA A;  2V9K A;  4BYY A;  2MBF A;  4RGX A;  3L2R A;  3S3M A;  4FE7 A;  1VFC A;  4IL6 C;  5LGN A;  3QYB A;  4J00 A;  1Z67 A;  3TED A;  1QBJ A;  5B5E C;  3H3Z A;  2VE9 A;  3WTV C;  3GF2 A;  2EZI A;  4N4O B;  2AS5 F;  3JCU C;  3OIQ A;  4HF0 A;  5D8L B;  2Y69 H;  1XDS A;  2CUE A;  2NOG A;  3P9C A;  1JTX A;  5E3N A;  3J7A O;  3Q3S A;  4UVC A;  4L18 B;  2VE8 A;  4F3Q A;  1JKR C;  3NAU A;  3W3C A;  1NG7 A;  4LG0 B;  3EQL F;  3BOQ A;  1IN5 A;  4UVA A;  1KU2 A;  3LSJ A;  2G7H A;  1X58 A;  1C0W A;  3PIO F;  2M2E A;  2V9V A;  3ABL H;  1SMY F;  2V6C A;  4ZJZ A;  4BJ6 C;  1JKP C;  4Y3O A;  1JE8 A;  1F5T A;  3KLO A;  5BNG A;  3LSP A;  3L1P A;  1VQ8 I;  1T6S A;  2RN7 A;  2WY8 Q;  4P5O A;  2NXN B;  5D8K B;  2OZU A;  1Z6R A;  2GWR A;  5LRR A;  4J19 A;  4E7K A;  3KYL A;  3BG6 A;  1ONV A;  3KP2 A;  4KIG A;  1E0E A;  4AIJ A;  3ZQQ A;  1Y1W J;  4OOI A;  2E71 A;  3H5N A;  4RBO A;  1FNN A;  1LKX A;  3DPT A;  4M6X A;  2JTV A;  2R7Z J;  3SFZ A;  3CCS I;  2LF7 A;  3BG7 A;  1BW6 A;  4XMY A;  1KYZ A;  2M1B A;  3Q9S A;  3F8N A;  2CMP A;  2JPC A;  4C30 A;  2XKO A;  3TQN A;  2O0Y A;  2Y0S N;  1FOX A;  1O57 A;  3BTC A;  4AIK A;  5KK1 A;  3H9Q A;  5D5X B;  5IOZ A;  1U3E M;  1ZQ3 P;  5ILU A;  1JI8 A;  4QLC U;  4G6T B;  2CGP A;  2JUC A;  5DYM A;  5DCM B;  3K69 A;  2DPD A;  4N9I A;  2O8X A;  3HC7 A;  1B4A A;  3F0C A;  4IJA A;  1UFM A;  3T8R A;  3MMY B;  2KDO A;  2ZNZ A;  4BAC A;  4M9X A;  5HLH A;  4MHG A;  2DOA A;  1ZK8 A;  2NRA C;  4X6A J;  1Z7L A;  3OMY A;  3PNY A;  3HL2 A;  1YRN A;  4OMY A;  1IDZ A;  1W0U A;  2MC4 A;  3CF5 F;  1MDM A;  1UB9 A;  4DBQ A;  2EV0 A;  3OV8 A;  3DTE A;  2EWN A;  3GEZ A;  4UB8 C;  1IW7 F;  4HF2 A;  4HF1 A;  3GW2 A;  5JLW A;  4P55 A;  2HI3 A;  1ENH A;  2BY3 A;  1U8R A;  2IS2 A;  5B1A H;  3ZXS A;  2VKH A;  1HW2 A;  2L4A A;  4C2M J;  5LFA A;  3MZ8 A;  2DOD A;  3ECH A;  3V7S A;  4D5F A;  4A3K J;  1DGR M;  4A0Z A;  3ABK H;  1W5S A;  4FQG A;  3RTR A;  3OYL A;  2DMN A;  1BR2 A;  3KP5 A;  4E7H A;  3ZCO A;  4CCK A;  3S1N J;  3GTG J;  1W0T A;  5GAD J;  2M30 A;  1WVR A;  2BHZ A;  2L9S A;  2R7O A;  2L2O A;  5E17 F;  3ZQG A;  3Q5F A;  2QM3 A;  3MD2 A;  3ZP5 A;  4Y33 A;  4GGG A;  3I4P A;  1PUF B;  1LB2 A;  3ZPL A;  2CQQ A;  1FY7 A;  4EJT A;  4YEL A;  1LE8 B;  2A05 A;  3F8C A;  1ZH5 A;  1U5T A;  2WC2 A;  1ZG5 A;  2EA2 A;  3M8E A;  2PJR A;  5E20 A;  2DU9 A;  4L9N A;  4PGG A;  2GA1 A;  4ZYD A;  4BDY A;  3T1B A;  2XSJ C;  3LWF A;  4XKC A;  3HKZ N;  4UUS A;  3B6C A;  2N8G A;  4E6K G;  2F6C A;  1D8J A;  1ERD A;  5CQG A;  2L01 A;  1FT9 A;  2GXB A;  3K2Z A;  1HKT A;  2MD5 A;  2IGK A;  2HOT A;  1E3P A;  3F72 A;  2ISY A;  5F1R A;  5A2Q Z;  2HQA A;  1BI3 A;  4BL0 B;  2FQ4 A;  1A35 A;  4NHJ A;  1IC8 A;  4B43 A;  1IUY A;  1U9O A;  1W5T A;  1ZGA A;  2L3D A;  4X1E A;  2OJE D;  1U5T C;  2K02 A;  3FXM A;  5J1U A;  3C2H A;  1VQL I;  3KYD B;  4M74 A;  3QQA A;  3U2R A;  5CKT A;  1R4N B;  5L3F A;  1F36 A;  2MD0 A;  3K1N A;  1TZL A;  5M5X J;  1VQ6 I;  4PSX A;  3ECO A;  1XPX A;  4HNU A;  3WTU C;  2BV6 A;  1IN6 A;  2QWW A;  2K5C A;  3BLY A;  2LR8 A;  4XKV A;  4KT6 A;  3N05 A;  1YHQ I;  5FO5 A;  2F48 A;  5K5R A;  5HOO A;  1JT6 A;  1P6R A;  2Y9Y A;  2Y30 A;  4AD9 A;  3TP3 A;  3CMM A;  5LEK A;  5FLX Z;  2HVQ A;  2XGE A;  2QSG X;  3LA2 A;  2IEK A;  1G4D A;  2FEZ A;  2Y0S A;  3GBG A;  3LOC A;  2DCE A;  2I5U A;  4M72 A;  3DU6 A;  1IXR C;  4I7H A;  2KJB A;  3CC2 I;  1T56 A;  5FKN A;  4J01 A;  3M8J A;  2KKO A;  3Q0V A;  2DW4 A;  2Z99 A;  3HIF A;  1MH3 A;  3I56 I;  2JA6 J;  5L3C A;  2HQR A;  3DKW A;  4G94 A;  1TNT A;  1E3H A;  1XTA A;  4UUV A;  4EVI A;  2IGM A;  2WWY A;  4ASN A;  4PJJ A;  2LMD A;  2WBM A;  4UXN A;  3VEP A;  2L7M P;  4ENK A;  1Y56 A;  1GT0 C;  3A0H C;  1H8A C;  3AKZ A;  1B9M A;  5LHI A;  1KA8 A;  3TL4 X;  1IN8 A;  2NVX J;  1EH8 A;  1Z9C A;  3JRB A;  2Z33 A;  1SVL A;  1XSX A;  4DQ2 A;  3JRG A;  2AQE A;  2O61 A;  5AIQ A;  1X3W B;  2KPM A;  1MD0 A;  2IAI A;  1QVU A;  2CYY A;  2FQ3 A;  4XOR A;  1HA8 A;  1X1D A;  3ZGK A;  1I6H J;  3KET A;  1E17 A;  1I1S A;  1TWG J;  1MGT A;  1S5L C;  2L9N A;  2G0E A;  2BXZ A;  1MBK A;  2EQR A;  3WTT C;  1EKE A;  2VPL A;  3K70 D;  2JZY A;  2Q1Z B;  2V6E A;  3DTI A;  2W7N A;  3KEO A;  2PEX A;  3W6J B;  2M0C A;  3HSE A;  4FET A;  2H8R A;  2EZH A;  3OYK A;  4E7J A;  2BEO A;  4XM3 A;  4R1H A;  4NC6 A;  1ZHF A;  1GVJ A;  1OYW A;  4BXF A;  2VXD A;  3BCA A;  5KCM A;  5K7Z A;  4HDU A;  1BN5 A;  4XLP F;  2A69 F;  2K86 A;  3PUF A;  3HKZ A;  3KCC A;  5HDN A;  4EM1 A;  1XDU A;  3J81 K;  3FXU A;  3QPL A;  4IOC F;  3HBL A;  2BY1 A;  1TT0 A;  2CV1 A;  3W2W A;  5E3M A;  3V7R A;  2GAU A;  3O8H A;  3OIO A;  4XLA A;  2C6Y A;  4IHY A;  5CYV A;  3FF5 A;  3RKW A;  1VQN I;  4Q5S F;  2XPW A;  2L0K A;  1HC8 A;  3SFI A;  1F4K A;  3IH4 A;  4GXO A;  4A12 A;  2DYR H;  1IN7 A;  2CW0 F;  4LLN A;  1R5I D;  1R5G A;  4EMS A;  2Z16 A;  3CJN A;  3JSO A;  4IHT A;  1N78 A;  1UHM A;  5E1X A;  1XGS A;  1G59 A;  2HDW A;  1RR7 A;  4XON A;  3ZMT A;  3L7W A;  4PCQ A;  2A6E F;  3QPT A;  1QVT A;  4C9Y A;  5F64 A;  2VQG A;  5IP6 A;  1K83 J;  1MND A;  1XGN A;  4U7B A;  3VPR A;  3IHU A;  5LBQ A;  1S7A A;  1ZN2 A;  2RAE A;  2ZJ2 A;  4ETS A;  3R60 A;  2IW5 A;  1O3Q A;  5C3E J;  3K1P A;  2Z9O A;  2D45 A;  1JHF A;  3VYU B;  5J3L A;  2PQ8 A;  2DLL A;  5FKK A;  3CCQ I;  3F9K A;  1K79 A;  3REO A;  3C18 A;  4P9U A;  2KT0 A;  1FIP A;  1YI2 I;  3Q0U A;  3JRE A;  5GAE J;  1MSF C;  1JXS A;  5LLQ A;  2IPQ X;  4GRI A;  2YX4 A;  1T2K A;  2IGO A;  2DT5 A;  3GTO J;  4UB6 C;  5K1Y A;  2QBY A;  2V1N A;  3MAJ A;  5FGM A;  5F04 A;  4BHB A;  1R9T J;  3S16 J;  2ME0 A;  3IV5 A;  5H2F C;  5TIS C;  4M73 A;  4XN3 A;  2FBI A;  3PSF A;  1X2M A;  3IUO A;  2FML A;  4B47 A;  3WU1 B;  3IC7 A;  4JX5 A;  1X19 A;  4PDK A;  2R5Y B;  3GZ5 A;  3R4K A;  3DLA A;  1RRJ A;  1FSE A;  3SYT A;  2NS8 A;  1TQP A;  3GLL A;  4I01 A;  1XC5 A;  1X4P A;  3GFI A;  3PSI A;  2FMY A;  2FNP A;  4MGR A;  3K4C A;  4NUB A;  5JLX A;  4DYC A;  2XAU A;  3I59 B;  3ZQI A;  2WV1 A;  4HG2 A;  2TDX A;  1AKH B;  4DGW B;  5LRS A;  4DYR A;  1RKW A;  1TWF J;  2WAQ N;  2CSO A;  4P9F A;  2E35 A;  3A03 A;  2LD5 A;  3H92 A;  4LMY A;  4BBR J;  2VOD A;  3ULQ B;  3VSK A;  3OYI A;  3HTU A;  4BNC A;  2GOX B;  2LC2 A;  2D5V A;  4I0B A;  4M3G A;  2FRH A;  4EJW A;  2ECB A;  1VQM I;  3SQN A;  4QTR A;  2DBB A;  3OYA A;  1B8I B;  1G3W A;  4O3M A;  3NWS A;  1RUO A;  2H6C A;  3MWM A;  2MG4 A;  2EFQ A;  2JRM A;  5K7F A;  3PNV A;  1MNE A;  2MH2 A;  4YEJ A;  1S6L A;  3F21 A;  2J5O A;  2G7U A;  1P2F A;  2CV0 A;  3WHB A;  1LDJ A;  3IH3 A;  2Y31 A;  2QQ9 A;  3EPZ A;  1TWA J;  3EYI A;  5DEQ A;  5DUK A;  1BL0 A;  3S3N A;  5B3S H;  3G73 A;  1Z6T A;  3G4S I;  3MKY B;  2DOF A;  3EUK L;  3HOY J;  1VQP I;  3FK6 A;  2W1O A;  3RSN A;  4RA2 A;  4BEH A;  2CU7 A;  2FE3 A;  1SMT A;  1QPI A;  3C2G A;  4AU7 A;  4OAZ A;  3A4C A;  2LTP A;  3OS1 A;  4WK8 F;  3DEE A;  1YJ9 I;  2XIG A;  3IRQ A;  4O5V A;  1YTY A;  3OS0 A;  2DA6 A;  4M9S A;  2ISZ A;  2DOE A;  2I8D A;  2MW8 A;  4EJU A;  4OIO F;  3KPH A;  1DP3 A;  4PJL A;  2WA0 A;  5HVQ C;  3IH2 A;  2HOE A;  2WY7 Q;  2CQ7 A;  2ZJR F;  5EGO A;  3GTM J;  3ZMS A;  3P9K A;  1O3R A;  2ECC A;  2PMZ N;  4II3 A;  2AQF A;  3BQY A;  1G8X A;  2FX0 A;  5JHU A;  4KIC A;  5GAG J;  3CDH A;  1P92 A;  5IP7 J;  3JRD A;  2XAG A;  1BOB A;  2NVU B;  1ZEL A;  1D0X A;  3GTK J;  2WAE A;  3BJA A;  2VJ5 A;  5KHD A;  1RPW A;  2E1M C;  1X4O A;  4ESJ A;  1O3S A;  4BE0 A;  3DP7 A;  2XAS A;  2R7F A;  3GUD A;  3RPU A;  2JRT A;  1YOV B;  1UG0 A;  1R6R A;  3HDD A;  3GZ6 A;  1QZZ A;  2HYF A;  4KIS A;  2DO7 A;  4V19 K;  4XNF A;  1QO0 D;  1ZRF A;  3D1N I;  4PUS A;  4BJ5 C;  4DOZ A;  1SEU A;  3I4M J;  3I9V 2;  2ZME B;  3L00 A;  3ZN0 A;  3CCR I;  3SDB A;  2VAS A;  3U9G A;  1ETY A;  2IA0 A;  3ZR8 X;  4IPA A;  1QA6 A;  2F5V A;  2XAQ A;  1SVO A;  4S05 A;  3F23 A;  1OYI A;  3LST A;  3OSG A;  4ZYE A;  1BJZ A;  1D3Y A;  2LRE A;  5H6R A;  4KIT B;  2VBW A;  4JK1 X;  3TO9 A;  3TO7 A;  3VFZ A;  4Z6Y A;  1UHW A;  3WG9 A;  4PGH A;  3KE2 A;  3OYG A;  2WAQ A;  1IF1 A;  1F43 A;  4MQ9 F;  1KZH A;  5K5O A;  2MLK A;  4XLN F;  2VKV A;  2YUS A;  4LG0 A;  4IRH A;  3BP8 A;  3BT9 A;  2FSW A;  2COB A;  4L5I A;  1FLI A;  3JAM K;  1DGW Y;  1BR1 A;  4HA8 A;  5CPR B;  2PN6 A;  1XS9 A;  5LGT A;  2BGC A;  1SD4 A;  1G3S A;  3CJT B;  1W5C C;  1KU7 A;  4M3D A;  1J2X A;  2ELJ A;  2R7X A;  1JUP A;  4IQ4 A;  3PFI A;  5FRN A;  3E5Q A;  4QIW N;  2JVG A;  4IOA F;  2DMQ A;  2PG4 A;  4JX4 A;  3K4L A;  3CDI A;  3FDY A;  4BGD A;  3UR3 C;  3PJR A;  4LGW A;  4L5E A;  1LEA A;  1OLT A;  4ZYA A;  2BXY A;  2D1V A;  1VI0 A;  1XMA A;  4XL9 A;  4BBS J;  1YQA A;  2HTJ A;  2EFP A;  3TOB A;  4A0X A;  2CS3 A;  5L3G A;  3I5U A;  1GV2 A;  3G71 I;  2X1E A;  2Q2E B;  3U21 A;  3ZQC A;  1ON1 A;  3M1C A;  4A69 C;  2XAJ A;  2XGX A;  3HYI A;  1FC3 A;  1XN7 A;  4PFP A;  5DCM A;  1KQ9 A;  2OV7 A;  3IWF A;  3OWT A;  1NH3 A;  4XOT A;  1G2H A;  1TWC J;  1MSE C;  5EYR A;  3TMO A;  4AWX B;  3HOX J;  2CWE A;  5E8G A;  4LLG F;  3ABT A;  4AYB N;  2KQR A;  3E3V A;  1OQY A;  1FJL A;  3OOP A;  2LH9 A;  4CXF A;  2IGN A;  1PP8 F;  1FIA A;  1Y8R B;  2BBY A;  4IVN A;  1TBX A;  2XUB A;  3ISP A;  3LMM A;  2EB7 A;  4HYE A;  3V7C A;  3CCV I;  3FMQ A;  4NQW B;  3WE3 A;  2LFB A;  2PMZ A;  3R0J A;  1WFX A;  1MBF A;  2DJI A;  4PJN A;  1XGM A;  2KFD A;  4GDF A;  4A2U A;  3ZN1 A;  1FP2 A;  2KLO A;  2W85 A;  2UUZ A;  3PQJ A;  3OS2 A;  4CCM A;  5FFX A;  3DFG A;  2W84 A;  4ZTF A;  2ADU A;  5D5V B;  3WTZ A;  4CDG A;  2JSC A;  2R7R A;  2E5N A;  3CCL I;  4BJT A;  3OR2 C;  4R79 A;  5FJ8 J;  3K7A J;  2NYX A;  1PUF A;  3COA C;  1LE8 A;  4N0B A;  4B48 A;  3IP4 B;  4DIQ A;  1FP1 D;  3HPH A;  1OCP A;  2R93 J;  1DPR A;  5EJC A;  1TWH J;  4EGZ A;  4KYW A;  1IRF A;  3T8T A;  2H94 A;  2K3F A;  3BTL A;  4KMU X;  2K40 A;  3QAH A;  2AHQ A;  5HS8 A;  2F2E A;  2M34 A;  3MKZ A;  4EGY A;  2X1C A;  1P4X A;  3BPX A;  1FBS A;  1PJR A;  5CVI A;  3B6A A;  4A3L J;  3TGN A;  3OYF A;  3V8K A;  2CUZ A;  1FMW A;  3K4J A;  3V8J A;  1APL C;  2O7O A;  2P8T A;  1A6Q A;  3HGG A;  2QZ8 A;  3SZG A;  3LSK A;  1WJF A;  2KRF A;  4HBL A;  5FLV A;  2M7A A;  2WTE A;  4RB2 C;  1Y0U A;  1N25 A;  1V5E A;  2MGQ A;  2M87 A;  2HPM A;  2X0L A;  1JT0 A;  4OWR B;  1J09 A;  5BS6 A;  1T0F A;  5AON A;  3HOS A;  1W36 C;  2JVH A;  3CUQ B;  1CF7 B;  2DA2 A;  1YX5 A;  1K6Y A;  4E4H A;  1I27 A;  2BVM A;  3ZRG A;  4H0E A;  1SC7 A;  1K7A A;  2DA3 A;  3QU6 A;  3HHG A;  4UUT A;  1IXS B;  3AAF A;  1WJB A;  3WHC A;  1I6X A;  4E7L A;  4E70 A;  2Z2S B;  2VKE A;  3FK7 A;  3E1S A;  4LK1 F;  1ZRC A;  3I4N J;  3JTG A;  1HQC A;  2QUF A;  2X6X A;  4JX6 A;  3IWZ A;  4QWQ A;  1WJA A;  1S7O A;  2KL4 A;  4Y13 A;  4Y52 J;  2LY9 A;  4CYD A;  2OA4 A;  1TC3 C;  2PJP A;  3RKQ A;  4BS9 A;  4S04 A;  4LOC A;  2VBY A;  1S9H A;  1BC8 C;  4HLX A;  1YLF A;  5GP9 A;  3WU2 C;  5HLT A;  3HOZ J;  1T0F C;  1WI9 A;  1RIO H;  3E0J B;  3FZV A;  1Z7U A;  3LNQ A;  3ONQ A;  3WGH A;  1LDD A;  4ESB A;  1SVM A;  1S72 I;  3S17 J;  5F27 A;  3KP7 A;  4EEF G;  2CFX A;  2EV6 A;  4AYB A;  2XDV A;  4LG3 A;  3L2V A;  3D5S C;  3LQQ A;  3GFL A;  3NAR A;  4XK4 A;  5FKL A;  5A2Q K;  2B63 J;  4RM3 A;  5BOX A;  4ABZ A;  4A3C J;  3OL4 A;  3P5J A;  1V5F A;  2GXA A;  4P96 A;  3S3O A;  2K7L A;  4EQQ A;  2LKS A;  2AXT C;  3DQV C;  3AG1 H;  4FT8 A;  2ESH A;  3R61 A;  2XRO A;  3F3X A;  2UV1 A;  3TW7 A;  4HW0 A;  4HNV A;  1RUN A;  2L9V A;  3RQ4 A;  2FOW A;  5GPC A;  2QA4 I;  2DMU A;  4HNT A;  1U9N A;  3K2A A;  1J75 A;  4JP0 A;  3VYT B;  1MNM C;  1A36 A;  4OIQ F;  4DJA A;  2TCT A;  2YSR A;  1SD6 A;  1IDY A;  3HUG B;  1BI1 A;  5F6F A;  3DEU A;  4A6E A;  5KNL A;  3CCM I;  2NVQ J;  3CO7 C;  5FLX K;  2VI6 A;  2ZXI A;  3HSR A;  2CW8 A;  1R1V A;  2V26 A;  5BMZ A;  4G7H F;  2CUF A;  4KIB A;  1A04 A;  3CZ6 A;  4HRI A;  1ZTR A;  3DCF A;  1I50 J;  1YYV A;  1TQI A;  1W7P D;  3CJQ B;  1GXQ A;  3OIP A;  1LDK B;  1OJL A;  2BOL A;  2JA5 J;  1R1U A;  3PL8 A;  4H4K C;  5HDG A;  4CSW A;  1HCR A;  2V1U A;  4M71 A;  4CHU A;  2XAF A;  2V1D A;  2A3S A;  2F4O B;  2E7W A;  3KZI C;  4A5N A;  3ZMV A;  4GYI A;  1HBX G;  5EF6 A;  2HVS A;  4HEA 2;  5J1R A;  1X1A A;  1Z77 A;  1BJA A;  2GLO A;  1HSJ A;  1FSH A;  3WGI A;  5BPI A;  1M1E B;  4R8H A;  4HX7 A;  1P4W A;  2XC7 A;  1ZR2 A;  1FWZ A;  5FRO A;  3GXO A;  1P9Q C;  3HRT A;  4WXC A;  3GTJ J;  2UXN A;  4FX0 A;  4L9T A;  4HX8 A;  4RGS A;  2O03 A;  3ZQL A;  1QZY A;  3L9F A;  5ERI A;  1X1B A;  1Y8Q B;  3A01 B;  2VN2 A;  3L2U A;  3Q0W A;  3HTS B;  5D5W B;  2P6S A;  1G6N A;  4KUM A;  2ZNY A;  2L7F P;  5JR3 A;  2ZFW A;  5E79 C;  4Y7N J;  1Y39 A;  2XPV A;  4G6Q A;  4KDP A;  1V3F A;  3S1R J;  1BIA A;  3ASN H;  1OFC X;  4AM3 A;  3CME I;  4I02 A;  1ZR4 A;  1IGN A;  2KP6 A;  5TJJ A;  1S7E A;  4I2O A;  4RLF A;  1S29 A;  1K78 B;  1SD7 A;  3QOP A;  2OTL I;  3PUB A;  3CD6 I;  4HX4 A;  1WCM J;  1WJ5 A;  2MA3 A;  4Q4Z F;  1KYW A;  1FOY A;  1RES A;  2ZCW A;  1XMX A;  2E60 A;  2ACJ A;  4NC8 A;  1RI7 A;  1FMV A;  4PFO A;  1HDP A;  3FIS A;  2IRF G;  2HXO A;  4G12 A;  2R5Y A;  1S8N A;  1VQ4 I;  4NNJ A;  3V8L A;  2OUM A;  1VZ0 A;  5FKO A;  3OYE A;  1LFU P;  1B9N A;  2HVR A;  3I59 A;  3S32 A;  4IHX A;  4OMZ A;  1AKH A;  2KZG A;  3G1M A;  4V2G A;  1I3A A;  4EAT A;  1J7K A;  1JGS A;  2M4G A;  2R92 J;  4EM0 B;  3MCZ A;  4C2T A;  2E1O A;  3C1D A;  1IXC A;  3DKX A;  3QP6 A;  2CG4 A;  2CQN A;  5D6F A;  3CMY A;  1HKS A;  4RB1 A;  2BY0 A;  2R3S A;  4CCO A;  1FTT A;  1UAA A;  2KIU A;  2QQB A;  4BQO A;  1N75 A;  1O7F A;  1RKT A;  4P1W A;  3N4M A;  1V4R A;  3CCY A;  3IAM 2;  4L9V A;  4DW6 A;  3ZOB A;  4ZDP A;  3F8M A;  1B8I A;  2BW3 B;  2JA7 J;  2X51 A;  2ZXH A;  3FWE A;  4GYG A;  2GA2 A;  2IS4 A;  2LVS A;  4MTD A;  1D1A A;  2P81 A;  5HS9 A;  2LDU A;  3VOE A;  4XLC A;  4W1U A;  5E18 F;  3CF2 A;  1EV7 A;  1T98 A;  2RQQ A;  3BRO A;  5E1Z B;  2HGC A;  2ZXJ A;  3HRU A;  1TLH B;  2YR2 A;  1I39 A;  3WTY C;  1H9G A;  2LKP A;  5D6E A;  1X2N A;  4YII A;  4WXD A;  2V1X A;  2OQR A;  3DWL E;  1TQM A;  4E7S A;  5M3M J;  1MMS A;  2DDA A;  3O3K A;  4MIM A;  2CRG A;  4IHS A;  3LQR A;  3CP8 A;  4BQQ A;  4XKB A;  1SFX A;  3L09 A;  1YO5 C;  3ESW B;  2NAZ A;  5ICC A;  2EZK A;  2HR3 A;  3CTA A;  4HPQ A;  3OYN A;  2VON A;  1MH4 A;  3AL0 C;  2JK3 A;  4FAS D;  2EPF A;  2Q0O A;  5ICF A;  2VQL A;  4HOB A;  4OIN F;  4YIF A;  5IPA A;  1BOA A;  1GV5 A;  2Y0M A;  3HRS A;  2K9Q A;  3R6S A;  2JSP A;  2PBI A;  2CQK A;  2HS5 A;  2HXI A;  2VL8 A;  3DBL B;  2MSY A;  1K4T A;  2M8G X;  3CQZ J;  2VUM J;  4QSH A;  3UKG A;  2X48 A;  3JSP A;  2QCO A;  2VT2 A;  1H88 C;  1OKR A;  1QZE A;  2K4B A;  1ON2 A;  2A61 A;  1IN4 A;  2FXA A;  1WQ2 A;  3PO3 J;  1OR7 A;  2E5Z A;  2K9M A;  2CH0 A;  2DA5 A;  2DPU A;  4I98 B;  5HDK A;  1YS7 A;  2CO5 A;  5ICE A;  4KT5 C;  4WF2 A;  3GYH X;  2DFF A;  4ZC3 A;  1K4S A;  3QOD A;  1R36 A;  3H5A A;  3J80 K;  2OCE A;  4NBQ A;  4XLE A;  1D0Z A;  2W24 A;  3U1K A;  4UY8 I;  1EF4 A;  1W7P B;  3DTK A;  4RM2 A;  2IS6 A;  2ZME A;  3J7A Y;  3H5R A;  2D1H A;  2H1K A;  4EJO A;  4I09 A;  3IL2 A;  2EIN H;  3KFW X;  5EG0 B;  4U7D A;  3QRF F;  3E6M A;  2E1C A;  1Z3Y A;  2X6W A;  5F0F A;  5IT9 K;  5L3D A;  1R00 A;  2UXX A;  3AG4 H;  4M3B A;  2ZKZ A;  4XRF A;  2EA4 A;  2DFI A;  1XG1 A;  2AO9 A;  1AA7 A;  3QPH A;  1GHC A;  1BBY A;  3KP4 A;  2M45 A;  1OR7 C;  2FOK A;  3TO6 A;  1WJC A;  5LD2 C;  1XB4 A;  2ZBK A;  1HW5 A;  5CVJ A;  3IKT A;  1FBU A;  1UG2 A;  3KP6 A;  2P4W A;  1TP4 A;  1T38 A;  4A3D J;  3J80 Z;  1FZP B;  2VT3 A;  2F5E A;  2FBK A;  1ETW A;  1V55 H;  2ETH A;  3K4K A;  4A3E J;  3O2P E;  1GXP A;  1A6I A;  2Z5U A;  2M9H A;  1ZAR A;  4LIV A;  5J47 A;  2ZME C;  2P7C B;  3DPL C;  1QHG A;  1ZG3 A;  2ZJQ F;  3V42 A;  2WAF A;  3S2H J;  2W4S A;  3LSH A;  1ZAO A;  5IT9 Z;  1R4M B;  1ULY A;  2XKP A;  4II2 A;  2EH3 A;  4QPQ A;  4B44 A;  5B66 C;  2RC4 A;  1UJ8 A;  1YIT I;  2M5W A;  1YW7 A;  1QNT A;  4XQF A;  1GUU A;  1GDT A;  2BZT A;  2XB0 X;  2XVC A;  3A2K A;  1WJE A;  2DN0 A;  1MMD A;  1R1T A;  3D0S A;  1WRJ A;  3HHH A;  4F55 A;  2ID3 A;  5J8F A;  4Y17 A;  2ZO4 A;  1OIS A;  2M0M A;  2FF4 A;  1OCR H;  2VC0 A;  3NRV A;  2P5V A;  3BR3 A;  4XSX F;  3I3L A;  1MIJ A;  5KAF C;  4XRS A;  1BM9 A;  2Q2E A;  3JR9 A;  3FX3 A;  3E7L A;  5IYB J;  3SHF A;  2P0W A;  3HRM A;  2E1N A;  5DCF A;  2RNJ A;  3A1Y A;  2XAH A;  3ELK A;  3RKX A;  1KU3 A;  2ZB9 A;  5E3L A;  3MZY A;  2LBF B;  3CCE I;  2JWT A;  3S1M J;  3KZY A;  1JUM A;  1EJ9 A;  1W4M A;  3WTX C;  2E36 A;  2F4M B;  2GZW A;  4EV0 A;  4BE2 A;  2VBZ A;  4G7Z F;  2JUG A;  3FM3 A;  3FIW A;  4U0Y A;  3K4M A;  2YS9 A;  1VTN C;  2HQ5 A;  3S2D J;  3J7Z I;  3EUH A;  1BI2 A;  1D0Y A;  2X9D A;  4NQW A;  1OPC A;  4LFU A;  5E3O A;  4E7Z A;  3SEZ A;  2F5F A;  3F8B A;  3PFY A;  5C4J J;  2X85 A;  4BE1 A;  3QPS A;  3ABU A;  3BTJ A;  3WU0 A;  1WH5 A;  2V4J C;  3OL3 A;  2PLY A;  1WJD A;  3CCJ I;  4RB0 A;  3I54 A;  5JI6 A;  4U87 A;  3RPQ A;  4EM2 A;  2L7Z A;  2A6H F;  2PI0 A;  4AVZ A;  2W48 A;  1LQ1 A;  4BQN A;  2STW A;  1P7J A;  1SFE A;  3C3W A;  3OR1 C;  2DK8 A;  3H0D A;  3EUH C;  1XD7 A;  4RS8 A;  2E2H J;  1KU9 A;  2GXG A;  4ZYG A;  3HB9 A;  2XPU A;  5DS9 A;  5M5Y J;  5FKM A;  3CMA I;  1MBH A;  1MMA A;  2K9N A;  2IT0 A;  2DFE A;  3BY6 A;  4HLY A;  2XV4 S;  2BE5 F;  1HDD C;  1W36 D;  2XF7 A;  3K1M A;  2YU9 J;  3I58 A;  4N9H A;  1OCT C;  2M7B A;  1YS6 A;  1RR8 C;  4BDZ A;  2BHY A;  2R4G A;  2DDB A;  5HLG A;  3RI4 A;  2R5Z B;  4BQA A;  1YJN I;  2HTS A;  1O3T A;  2ESN A;  1I5Z A;  3F6V A;  3LFK A;  3MVP A;  3VSL A;  3BG5 A;  4XBF A;  4IHW A;  4CGZ A;  4ITV A;  2H27 A;  4G8X A;  3LL7 A;  2VQC A;  3K6G A;  5LEJ A;  3ERE D;  2JQ7 A;  3S15 J;  5FFZ A;  3ZMD A;  2ID6 A;  2BYV E;  2M4K A;  3CUQ A;  3ZQF A;  4XIC A;  3DLL F;  1CF7 A;  2H6B A;  4G9Y A;  1YIJ I;  2O3F A;  2KIQ A;  3VB2 A;  5ILV A;  1V5G A;  5IP9 J;  2EK5 A;  3I0T A;  1TT5 B;  1ZGJ A;  4B4C A;  2IVM A;  1H0M A;  3H9G A;  2VJI A;  4BU2 A;  4XID A;  1QHH D;  4ZYH A;  3I53 A;  2VJ4 A;  3HOT A;  2QEX I;  3HEF A;  2HOA A;  2V7F A;  3MKW B;  3KEQ A;  5KAI C;  2Y2Z A;  3K9T A;  4CH7 A;  1FOW A;  2JMW A;  2L7K A;  4JOM A;  3G2B A;  3E5U A;  3DBH B;  1XMK A;  4CCJ A;  3M4O J;  1IRX A;  3SJM A;  5HNH A;  2EFN A;  1RC9 A;  5CLS A;  4DBR A;  1SFK A;  1Y1V J;  4DNC A;  1J59 A;  4GFB A;  5HNF A;  3O8G A;  3T5X A;  1F9N A;  2CW7 A;  2VXZ A;  2K9S A;  1J5Y A;  2NS7 A;  3CCU I;  5LHG A;  3CUQ C;  2QKM B;  3TP0 A;  2WV0 A;  1NG6 A;  2LY1 A;  2ZFU A;  3E6B A;  2XRL A;  4IXA A;  4A3G J;  2A5Y B;  2DA7 A;  3C7J A;  2XGC A;  3E6D A;  4A6D A;  3BC8 A;  3A0B C;  3CP2 A;  1MJB A;  2YX7 A;  4CIC A;  3FXR A;  5DTD A;  4OIP F;  2XHK A;  1U2W A;  3ROU A;  3P7N A;  4LJZ F;  2PMU A;  4OU0 A;  1TTY A;  3PO2 J;  1TNS A;  3BJO A;  1HF0 A;  1I1G A;  1IRG A;  3ERM A;  3H1C A;  1RET A;  3H9J A;  2OZ6 A;  4LIT A;  3EET A;  1ETK A;  2IS1 A;  4C2U A;  4DYQ A;  3P9I A;  2L5Q A;  4RGU A;  4LLL A;  4BY7 J;  2NVT J;  1ITY A;  4I76 A;  4GCV A;  1WHU A;  4YRV A;  4I0A A;  1YW8 A;  4L0Y B;  4IZZ A;  2NNN A;  2M3A A;  1X3U A;  4D7N A;  5HLI A;  5J6X A;  1JHH A;  2DA1 A;  4FIS A;  2HU9 A;  3V4G A;  3CLO A;  2H8W A;  3HUG A;  1LNW A;  4TV7 A;  1XGO A;  1WH7 A;  4MEX F;  1JJ6 C;  4E7I A;  1MJA A;  2DYS H;  1IG7 A;  4I6Z A;  2G9W A;  2R0Q C;  3CJR B;  2J5P A;  4KJZ A;  4M6Y A;  1QQI A;  5BQT A;  3GCM A;  5B1B H;  2FNA A;  4HZF A;  5FD5 A;  4A3J J;  3OYD A;  3HOV J;  3FMS A;  2OC6 A;  1BW5 A;  2PMH A;  1FYM A;  2V9P A;  3PNT A;  3ML6 A;  4MO7 A;  2KZV A;  2Y75 A;  4A3M J;  2HYG D;  5DM7 F;  4ENJ A;  2VQH A;  4WX9 A;  1R5H A;  2EIM H;  1J0R A;  2EFO A;  3VDX A;  2HPI A;  2LRD A;  4XLH A;  3B02 A;  1USS A;  2OBP A;  4CO8 A;  1B72 B;  4RDU A;  3FXJ A;  3FXL A;  4M6V A;  3OOU A;  1JTY A;  2HKX A;  3PQK A;  1ETQ A;  2JJ7 A;  5J8C A;  3W6V A;  4IRI A;  1GVD A;  5AIP A;  1FYL A;  2HFH A;  3MEX A;  4XOP A;  4IEJ A;  1QU3 A;  4BHC A;  2LKX A;  3BR0 A;  4CYC B;  1KON A;  1LJ9 A;  3FMR A;  4A3F J;  1Z21 A;  2EBI A;  3LA7 A;  2W25 A;  4UNO A;  1ETO A;  3RZD J;  2X4H A;  1U78 A;  5F0H A;  3A01 A;  4CZC A;  2NS0 A;  1ETV A;  2B7E A;  4HSR A;  4PZJ A;  4C3J J;  5M5W J;  4C3I J;  4WXH A;  2DT6 A;  1D8K A;  3IRR A;  2IJL A;  5CJ9 A;  2OCC H;  4MLO A;  5LGU A;  4B3A A;  5TRD A;  1YX3 A;  2R7T A;  1FYK A;  1VQ9 I;  1LFP A;  2Q8K A;  1U6G A;  1I3Q J;  1MKM A;  1TW2 A;  2WB1 N;  1H89 C;  1DPU A;  3TW6 A;  1OYY A;  4LB5 A;  1JGG A;  3JRA A;  3DBR B;  1L0O C;  3HZJ A;  3HPG A;  4S0H B;  3M3Y J;  1P7I A;  1K78 A;  1B1B A;  3T0Y A;  3DXJ F;  5IYC J;  1MMG A;  1R22 A;  5M3F J;  3RYR A;  3SXY A;  1SFO J;  5ILS A;  2DJN A;  1JKO C;  2X6O A;  2ICW G;  4FCY A;  3CC7 I;  2JA2 A;  1IRZ A;  1KQ0 A;  2DMP A;  3H3U A;  2L9R A;  2Z1D A;  4ZTJ A;  1D5V A;  1MMN A;  1OMI A;  2H1L A;  2GM4 A;  5ED4 A; 
#chains in the Genus database with same CATH homology
 1YI2 I;  3G71 I;  5GAE J;  2OTJ I;  3CMA I;  1VQ7 I;  2ZJR F;  5GAD J;  2H8W A;  2ZJQ F;  1VQO I;  5GAG J;  5JVG F;  1YIT I;  1YJN I;  1MMS A;  5DM6 F;  1Y39 A;  5DM7 F;  3CCV I;  3PIO F;  4V19 K;  4IO9 F;  2JQ7 A;  1VQ8 I;  2E34 A;  1ACI A;  3CME I;  2NXN B;  3DLL F;  1S72 I;  2E35 A;  1YIJ I;  3CCR I;  1QA6 A;  2OTL I;  3CD6 I;  3CCL I;  1FOY A;  2QEX I;  3CCE I;  1VQM I;  3CCS I;  1FOW A;  1VQL I;  4IOC F;  2E36 A;  1VQ4 I;  5GAH J;  1YJW I;  2FOW A;  1FOX A;  2QA4 I;  3G6E I;  1VQ6 I;  3J7Z I;  2K3F A;  3CC4 I;  3CCU I;  3J7Y J;  1VQN I;  1VQ9 I;  1HC8 A;  3CCM I;  2ZJP F;  3CJT B;  1YHQ I;  4UY8 I;  3CCJ I;  4IOA F;  3G4S I;  3PIP F;  3CF5 F;  1VQP I;  3I55 I;  1VQK I;  1VQ5 I;  3CC7 I;  3CC2 I;  3CCQ I;  1YJ9 I;  3I56 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...