4IZZA

Crystal structure of fischerella transcription factor hetr complexed with 21mer dna target
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
total genus 83
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA02
4J00A 3QOEA 4YRVA 3QODA 4J01A 4HRIA 4IZZA
chains in the Genus database with same CATH superfamily
4IOAF 1R1TA 1WJFA 3QU3A 1PYVA 2NNNA 5AONA 1TW3A 5FFZA 2XSDC 3PNTA 3OL3A 4A5MA 4M6YA 2LF7A 2ZCWA 5E1ZB 5IYDJ 1C0WA 2DYRH 2NVUB 2OUMA 2VJIA 3DBLB 1IG7A 3KZYA 3GTQJ 2Z9OA 1HW5A 4E6KG 2VKEA 1MMGA 3AL0C 5EGOB 1H89C 4V2FA 1G3SA 2VC1A 2G7HA 1IXSB 4GYIA 3WTSC 4UB8C 2FF4A 3VWBA 4Q5SF 3BROA 2MH2A 2L01A 3PUFA 2A69F 1XC5A 1ZRCA 3GUDA 2NNYA 3PO3J 4G7ZF 2P8TA 3DXJF 2DT7B 5EEGA 5GAEJ 2I10A 1HXDA 4HW0A 2O61A 2CUEA 5AIPA 3L2CA 4HZFA 2PJRB 3DTKA 5M3MJ 1XS9A 1D3YA 1TC3C 2EFNA 3FMRA 2Y2ZA 1MH4A 3BR0A 2CS3A 3EYYA 3TP0A 3X2QH 2KZGA 2P4WA 5FLVA 1EH6A 2HKXA 4LITA 3MFKA 3RDIA 2XPVA 2PMHA 1IUFA 3WGIA 2CQQA 5HVQC 5EG0B 1TW2A 3M3YJ 3LL7A 3OYKA 4BHPA 4M6XA 3MZHA 4A0XA 3D1NI 2HDCA 1R36A 3B73A 2A5WA 1VQ5I 2XAFA 2P5KA 1HKQA 1O7FA 1YYVA 1MW7A 4P5OA 4UUSA 2CV1A 4EQQA 2K02A 4M9ZA 3DBHB 4J01A 1XDUA 2EIMH 3TEDA 4UVCA 1LVAA 2DA2A 1JT6A 4CGZA 3KP3A 1SVOA 2DPDA 4AYBA 3FHNA 1JTYA 3F0CA 2GZWA 2DQRA 2VQGA 1TZLA 3HOXJ 3KP5A 3QYFA 5FKOA 1WHUA 5B66C 4XLPF 3B02A 2W84A 1GVDA 4LG0B 3DEWA 4A3BJ 2IT0A 4MQVA 3HOUJ 2X9DA 1SEUA 3ESWB 2DW4A 1N75A 4HX7A 1ETQA 3TW6A 2R7RA 1WWXA 3WU0A 3VYSB 1O3QA 5H6RA 1R71A 2IXSA 3T0YA 1GV5A 1SD6A 3RYRA 2BV6A 3U1DA 1YJWI 1U5TA 4IVNA 1R5HA 2FMLA 4RB3C 1U78A 4LLGF 4FASD 3VSKA 4L0YB 2LC2A 4XSZF 4NB5A 1ZN2A 1S8NA 1WJEA 2CFXA 3IAS2 4A0YA 1ETKA 4RBOA 4BUPA 3HTUA 3HUGA 1UG2A 2A3SA 3M7GA 4DYCA 1FYLA 2FE3A 2OQGA 1A36A 1D1CA 5E20A 2QZ8A 3IAM2 3BR1A 5KK1A 3CJRB 3D5RC 3RYPA 2LBFA 5L3EA 2IA2A 1YX3A 3HOZJ 3CESA 2X6YA 4AC0A 1MBHA 2ZJ2A 1IC8A 4L9JA 3E6DA 1TQIA 4IHXA 2RQPA 2LRDA 1W1WE 2QENA 4DBRA 4D9JA 3UR3C 2WB1A 4PJ0C 2JA5J 2W7NA 3K4NA 2B7EA 1R00A 1FSEA 1TT0A 3R6SA 2E36A 4AWXB 4BBRJ 2OTJI 1FOWA 1YX5A 3IH4A 2CO5A 4LGWA 1HSJA 2P81A 3WTXC 4KNYA 3BTCA 2XRNA 2LF8A 3E97A 1FOKA 1HDPA 3OOPA 1Y8RB 2Z5UA 3I9V2 3MN2A 4CSWA 1P92A 1MIJA 2B0LA 3N4MA 3CZ6A 1GXQA 1T8IA 3JAMZ 2QGUA 2L4AA 4R8HA 5E3NA 3KZZA 5D6FA 3ZQIA 1ETVA 3ECOA 5EYRA 2JJ7A 2BZTA 2Y75A 1R58A 2DA7A 3FM3A 3QRFF 1U5TB 3BWGA 2OZ6A 3HJEA 3FX3A 3WE3A 4B47A 1R6RA 1QQIA 5IT3A 3JREA 2L5QA 3FK7A 2ELJA 2DTRA 1VQPI 3CUQA 1DUXC 4MHGA 3OYLA 3K10A 1CGPA 1VQ9I 2Z99A 2Y9YA 3MVPA 2R93J 4RLFA 3LMMA 2R7FA 1IRGA 2LKSA 1D8JA 3F8BA 2QF7A 2XV4S 4Y17A 2E5NA 2IGNA 2XDVA 3LSIA 3OYJA 1GUUA 2B9SA 3CJTB 3J7ZI 3KFWX 1W7PA 3UNGC 2XKOA 4XKWA 3TMOA 1I6HJ 2OV7A 4IOCF 1KQ0A 2HI3A 3E1SA 3FXOA 4IJAA 3KEYA 4RM2A 5H20A 5TGTA 1SAXA 2ZXJA 1MMNA 3PNVA 2M30A 2JSPA 2MC4A 1IF1A 3SHFA 5D8LB 3BDDA 3K2AA 4MQ9F 1T08B 2WTEA 2OCCH 2Y31A 4OAZA 4IRIA 2RREA 3ZMTA 4IKFA 3IKVA 1RR8C 3L2RA 4ON0A 2VODA 2EPFA 4HX4A 1N77A 1O3RA 2KL4A 3BJOA 3QPTA 3BG5A 3F8MA 5HNFA 5A2QZ 1USSA 1YHQI 2X6OA 2VPLA 3Q5FA 2O0YA 3JRAA 3TO9A 3K7AJ 1W4MA 4G6QA 1T38A 3GZ5A 4KFCA 4HLXA 2ZNZA 4IL6C 5J1UA 5IT9K 2DU9A 1D8KA 2ID6A 4LIUA 1DGWY 3OS2A 4XQFA 1W5TA 4EJWA 3FBIB 4BKXA 1BN5A 4IF4A 4BJTA 1I1GA 5B5EC 2YS9A 2COBA 1YS7A 3FISA 3NAUA 3BPVA 3ECHA 2M45A 1MBKA 3G1LA 1OR7A 4FE4A 5LGUA 3VYUB 5HDGA 3IP4B 4UXNA 1YTYA 5DV5A 4FX4A 2LSOA 2UZKA 2CH0A 3PFIA 3PFYA 1IN4A 2WC2A 1Z1DA 3LWFA 1LFBA 1W0TA 3ZN0A 1OKRA 1POGA 2Y0MA 2RNJA 4G6TB 1RNLA 4CCNA 4DZPA 1A04A 4BL0B 2CSOA 5FRNA 2AQEA 2RC4A 1FBQA 3V7RA 2DDAA 2E1MB 3HKZN 2LFBA 4P9UA 3ZQCA 3GWZA 4E7HA 3S1RJ 1IRXA 1K83J 4N0BA 3BCBA 4XLNF 4IHVA 2C6YA 2HOTA 1J09A 5K7HA 3H3VK 3TDUC 3A01B 2XF6A 4AVPA 3FMQA 1JXSA 1WJDA 1KONA 1V5GA 1YE9A 2A05A 2VKDA 2A5YB 3I55I 5FO5A 3KEOA 4S04A 1F1ZA 1XSXA 3BR5A 1ZG3A 3H1CA 4A3JJ 2CGPA 1H88C 5FLXK 5LEJA 4JYKA 2ZO4A 3GO5A 2EZHA 2COMA 3AG3H 4JP0A 1F43A 1Y39A 2HYFA 1PDNC 3LSPA 1U0JA 3E5QA 3G2BA 2HQNA 1IDYA 4IPAA 2UWMA 3ISPA 3A4CA 2H6BA 3V7CA 4BXUA 1UHMA 2ZFWA 1Q1VA 4CCKA 2CWEA 2STTA 4YELA 1T0FC 5JLXA 4AIDA 2FOKA 2KMUA 2FQ3A 2DFFA 2P6TA 1G8XA 1BOBA 3CCRI 1TT5B 2IS4A 3KETA 3EUHA 4CCJA 2RNGA 4HLYA 3GFIA 5DCMB 4E7KA 1RIOH 1X3UA 4LLLA 4UUSB 1FMVA 4XKBA 2XAHA 2CUZA 3FMSA 3HXLA 4EATA 4Y13A 4RS8A 3CC7I 3F22A 2M7AA 4HV6A 2RAEA 1QVTA 2OCEA 1BOAA 2M1BA 5FKNA 2CJJA 3OYBA 1WFXA 5KNLA 3OYNA 1ODDA 2VUMJ 1U2WA 2W82A 2L9SA 4WK8F 5C44J 1V5EA 3S1QJ 1OCZH 2DT6A 3FXJA 3RKWA 4E70A 1XX5A 2CG4A 4O6JA 2QQBA 3ZPLA 2DA3A 3RIRA 1Z91A 1A5JA 2F5FA 1E3HA 3A1YA 1U9NA 2EH3A 2H8RA 3R0AA 1WJAA 3C3WA 2KFDA 1WH7A 1WJCA 3HOSA 3LOCA 5CQEA 3EUKL 1MNMC 2R7ZJ 3OYMA 1ON2A 2MBFA 1K79A 2DCEA 3LSJA 1XGSA 4DIQA 5LEKA 3O8GA 4FETA 2M9HA 4A3GJ 2VKHA 4AIKA 4BDYA 4E7JA 2R5YB 4HNVA 2D1HA 5FD5A 2FBHA 2ZBKA 1FX7A 1OCCH 4IHYA 3KX2A 4PDKA 2P7VB 4FE7A 3OS0A 1I27A 4ENNA 3FF5A 1E0EA 5H6QA 5HODA 2IAIA 3I5UA 1O4XA 1VQOI 2DOFA 4YRVA 3QODA 2GIVA 2K4JA 3C1DA 3HOTA 3IH2A 3FIWA 5CVRA 1S72I 1KQ8A 5ILSA 3LFUA 3S17J 2MH9A 4XRSA 5IOYA 4ZJZA 5CVVA 1LFPA 1D1BA 2WAEA 4A12A 1APLC 3ABLH 4RAZA 1MD0A 2M8EA 3HBLA 3KP4A 4M9SA 1ZR4A 1TL8A 1P4XA 3I0TA 3ML6A 5M5XJ 3MZYA 1GDTA 1FSHA 2EA2A 2VBZA 4AD9A 4RAFA 3BG9A 2BEOA 2EK5A 2IJLA 2VXZA 1H9TA 4NUBA 1IN6A 3KZIC 1I6XA 1DU6A 1F9NA 1Y56A 1FWZA 1S7OA 1MNDA 2HDWA 2HYGD 2Q1ZB 2V1XA 4TV7A 3NEUA 3WTVC 4FCYA 4B3AA 1OYYA 2STWA 4ASNA 3SYTA 2P6SA 4CYCB 2XPUA 2YU9J 3K0LA 4BJ5C 3H0GJ 4G7OF 2BYVE 3KPHA 5IYCJ 2FA5A 1VQMI 1XG1A 3FM5A 3ZN1A 1TWFJ 2XAUA 1NG6A 1JE8A 3EDPA 4A3EJ 3GTMJ 3NARA 4HA8A 3KLOA 5E3OA 4A93J 5E1WA 4L5EA 1XPXA 2TRTA 1SVMA 4M3BA 1Y6IA 5HS7A 5J8FA 3OSFA 3IWFA 3GW2A 4I76A 5DD8A 3S15J 4I7HA 4S05A 4OIOF 2AXLA 2JA2A 2ETHA 5K7ZA 3TDZC 4FQGA 2ZB9A 2EV0A 5ILVA 2A6HF 2IEKA 2JN6A 1HSTA 3JSOA 2CU7A 2CQNA 3CF2A 5K5RA 3HL2A 2F5VA 3EETA 3R4KA 2NVYJ 1EH8A 1G3YA 4K2EA 2EJRA 2BVLA 4BXXJ 4EGYA 4WF2A 1YITI 1R4MB 3CMMA 4MEYF 1QNTA 4BGDA 5DCMA 2XB0X 5DM6F 4EM2A 3T8TA 5LFAA 3SJMA 1YW7A 2XF7A 2JUCA 2L7FP 1QBJA 3DU5A 2XGCA 4HF0A 2EFOA 3WG7H 2L2OA 1LEAA 1B6AA 1Z7LA 1ZG1A 3AG1H 3A2KA 2FX0A 2W1OA 5F0HA 3TKYA 2HU9A 4CA0A 2R92J 1R5ID 3TL4X 2IBDA 2LP0A 4UUVA 2ID3A 4OIRF 1E2XA 1PP7U 1J5YA 1DPRA 3FZVA 1JGGA 1HLVA 2YSRA 3K70C 3HOWJ 5LRRA 1IN8A 2L9VA 1MDMA 4M74A 1STZA 1T6SA 1MSEC 1OJLA 2AO9A 1D0YA 2M7BA 1FIPA 1IAWA 2H6CA 2NXNB 4KMUX 1Z77A 3QPLA 3RPUD 5J4YA 1IXRC 4YIRX 3FDYA 3DQVC 2ELHA 3J80Z 1BBYA 1OR7C 1UELB 2ME0A 2VT2A 2EFPA 3DKWA 5DCFA 5J3LA 4Z2YA 3LA3A 3S2WA 2GA1A 3OIQA 4BEHA 4C9YA 2P7CB 3ZCOA 2V1DA 4QWQA 2Z3YA 1VQ6I 2FJ1A 1HA8A 5HS8A 2VJ5A 2HQRA 4FT8A 5IT9Z 1Z3XA 3IH3A 5EGOA 2V6EA 4JX4A 3ZQHA 2DBBA 4W1UA 1UZCA 3BZ6A 4ITVA 2M2EA 4L9TA 2R5YA 2VQCA 2V9VA 3FXQA 2K3PA 3F21A 2KRFA 1U3EM 3WTZA 1T56A 4O3MA 4YIFA 3GZ6A 2RGVA 1D5VA 2PMZN 3HSRA 3HGYA 1GHCA 4D7NA 1VZ0A 3VODA 5GPCA 3U21A 5ICCA 1HW2A 1Z21A 2EWNA 2HKOA 4HX8A 1J59A 2V9PA 3C18A 4LFUA 2O8XA 2LR8A 5D8KB 1SAUA 1BC8C 4IO9F 4KDPA 1J0RA 2FMYA 1F36A 4Y15A 3RZDJ 1H8AC 1FP1D 2GLOA 1WRJA 1ETOA 3I59A 5HLHA 3P9CA 4ZZLA 3BCAA 2JA7J 5FLXZ 1P4AA 4PJNA 4LJZF 5DUIA 2CV2A 1RC9A 3ZR8X 3DWLE 4LG3A 5LGTA 1UAAA 2K9SA 1JKQC 4MFDA 4LG0A 3LAPA 4JQFA 2P5LC 5JHFA 4A3DJ 4LK1F 3WU1B 2A6EF 3WODF 1MKMA 2XGDA 5E1XA 1XCBA 3GFLA 3VSLA 5KAFC 2CW7A 2VKVA 1GLNA 1QZYA 1LE8B 4C2TA 1WQ2A 3HB9A 2GAUA 4U7BA 1ZRFA 3CDIA 1T95A 2JRTA 1HKSA 1RESA 1XGOA 2GA2A 2G9WA 4Q47A 9ANTA 1LNWA 3KP6A 4G9YA 2RQQA 5HNHA 3BR6A 2F4MB 1X1CA 4DW6A 5LHGA 4PJJA 2XF5A 2DJIA 2XRLA 2FEZA 2HZDA 3K2ZA 1OCRH 2DA1A 3F3XA 1P4WA 5HLTA 3WE2A 4L0ZB 4I0BA 1LDJA 1Z3YA 3ZXSA 1WH5A 4P1WA 4ESJA 4KMFA 2DTZA 3DKYA 3JTHA 1PVEA 2HOAA 2KZVA 5BPIA 3PO2J 2FNAA 5A2QK 5L3CA 2DN0A 2F5EA 5GP9A 1Z67A 5L3FA 2R7DA 2OPTA 1UG0A 5IP7J 3RKYA 2H09A 3BR2A 3R61A 1XGNA 4OOIA 1JTXA 1S9HA 3A01A 1MJBA 2DT5A 4IQJA 2KRHA 2VL8A 2M5WA 4XSXF 2JTVA 2VXDA 4EM1A 2PEXA 4HSRA 2EZIA 4HBLA 2K9LA 1SD5A 1ON1A 1S6LA 1ULYA 5CJ9A 4KIBA 3IRQA 2RDPA 2RVCA 1JJ8C 4A5NA 1ONVA 2GXAA 2O9LA 3LSHA 2LMDA 4A69C 1LJ9A 4DZJA 1K78A 3G1MA 5LLQA 3EQLF 2IS2A 2GOXB 3M8FA 2ZJRF 2ZXWH 3TGNA 2ZSIB 1IN7A 2CW0F 4F55A 1UHSA 1YW8A 2WV1A 4U88A 5F08A 3FBNB 3KEQA 3OYCA 4Y4RA 4A3FJ 2E1OA 3ZRGA 1FYKA 2ECBA 3GVAA 5ED4A 4RA2A 2WADA 1FP2A 4RLQA 5H2FC 2LREA 2QBYA 4IRGA 3KLNA 1YRNA 5B3SH 2E2HJ 2IGMA 2WB1N 2KLOA 2FNPA 2JVGA 2JRMA 2NOGA 5M5YJ 4GO1A 1VF9A 3I56I 3E6MA 2XROA 3G1OA 3LSKA 4C2MJ 3PQJA 5CYVA 2TCTA 5FRMA 1JKRC 1W0UA 1B9MA 1ZGJA 5DYMA 2IP2A 2WAFA 1TP4A 2PMZA 3QPHA 4BDZA 1DGRM 3CUOA 3ABTA 4WXCA 5BPDA 3I4MJ 2DFEA 5HS9A 2G7UA 4DNCA 1ZQ3P 4BAYA 2F4OB 1BJAA 4XKCA 4I2OA 2X85A 4NC8A 2JA6J 2M8GX 3BT9A 1S7EA 5DEQA 5LRSA 2FQ4A 3F6OA 3JRBA 4DYQA 2X1EA 4NHJA 4ZDOA 2VT3A 1Y8QB 2O5RA 1WGXA 1ACIA 1JUSA 2DOAA 4B44A 2OAZA 4BU2A 3LSGA 1O3SA 4G94A 3HYIA 2BHZA 3TW7A 2IVMA 2BVMA 4WX9A 4U0YA 4XORA 2VI6A 3HTSB 5LD2C 1QU3A 3LQRA 2LBFB 4A3CJ 4XOPA 2X0LA 3HDDA 1GXPA 1U6GA 3H36A 2L7MP 4BY7J 1WI3A 1OCTC 2X1DA 3W2AA 3DU6A 4ZYEA 1X4OA 4KA4A 2DODA 4M3FA 1B72A 1MMAA 3OR2C 3E7LA 3GTJJ 2AHQA 3BTLA 5LBQA 4XR6A 3VOEA 2XUBA 1BI0A 3F8FA 2OF7A 2F4IA 3GXOA 3HG9A 4ZTJA 4A3LJ 2PG4A 1BIAA 1VI0A 4P96A 3CTAA 3M1EA 4G8XA 3CCJI 1R5GA 5E79C 4XLEA 2W24A 4XRFA 1XMAA 4X6AJ 3QAHA 4NBQA 1T2KA 4PSXA 3CJNA 3QOPA 4YG2F 3F6VA 4ENKA 3UKGA 2QM3A 1YOVB 2EILH 4MNUA 4I09A 3M1CA 2DK5A 4JBAA 3N97A 1ZARA 1J9IA 1SFUA 4D5FA 1XB4A 5C3EJ 4JOMA 3J7YJ 4OIPF 3D5SC 3LFKA 2EV5A 2XSJC 1ZGAA 2DYSH 2L7KA 1S29A 3VFZA 3FXKA 1JKPC 2BY3A 1DPUA 4GFBA 5JHUA 5K7FA 3RQ4A 2EQRA 5IP6A 1ZYRF 2LD5A 2KT0A 1UB9A 1L0OC 3F23A 5FLMJ 2K3FA 1Z05A 4ZYAA 5F1RA 3RQIA 2E2IJ 4EV0A 2RKHA 2YPRA 4B8XA 4FISA 4JX5A 1O7LA 4PGHA 4CCLA 2HFHA 1I50J 3VYRB 1GVJA 1JHHA 3S3MA 2JUGA 2QQAA 3V8KA 2UV1A 4CYCA 1X1BA 4LB5A 5CVUA 4HAMA 4ZYGA 5TRDA 3OV8A 2M0CA 4ZTFA 5HLIA 3DP7A 3U2RA 5TJJA 3BG7A 3CCYA 4HSTA 1WVRA 2IS6A 1X1PA 4NQWB 4MFEA 1ZLKA 4B3XA 1BW5A 4RDUA 3IRRA 4D7MA 2EBIA 3GMEA 3TOBA 3CUQB 2VE8A 5J47A 2MW8A 2QSGX 1IUYA 1BC7C 4QLCU 2IGOA 4ZH4F 3DEEA 1VQKI 5CQGA 3S14J 1B4AA 3O3KA 3Q3SA 4IEJA 1BR2A 1JUPA 4BHCA 2KHMA 5GTHC 1X19A 4G12A 3B6AA 3RKQA 2D45A 4WXDA 1FLIA 1A6IA 3OWTA 2YX7A 2LNBA 4AYBN 4RAYA 3T8RA 4Z6YA 5E18F 1QO0D 1IDZA 2Q0OA 2VOOA 3JSPA 2L9RA 1TNTA 1ETWA 2PFBA 3S8PA 4CCOA 3M4OJ 1BR4A 3O2PE 3KYDB 1YS6A 4C3IJ 1ZLJA 3M8EA 2V79A 1EF4A 2VBXA 3O8HA 4M3GA 4EVIA 5J8CA 3OS1A 4BE0A 3J80K 1G2HA 4FHTA 1MMSA 4GYGA 3SZPA 1P6RA 5DM7F 2PX9A 5EF6A 2DJNA 5ICGA 3GTPJ 4BBSJ 1EH7A 2K9MA 1KZHA 3VDXA 2KDOA 2DDBA 3OSGA 1SFEA 4G7HF 1QPIA 3MD2A 3HRSA 1BA5A 5FKLA 1Z0XA 3BY6A 1R49A 4NC6A 2MABA 1XMXA 4BEHB 3BQYA 1G3TA 2QQ9A 3KYLA 2MYSA 2VE9A 5B1AH 4I99C 3J7AY 2QUFA 4PJLA 2Q8KA 2NVQJ 2W57A 1MSFC 1RRJA 3E5XA 3V4GA 2DO7A 5GADJ 4N4OB 4AVZA 5BOXA 3TBIA 4BHBA 3E0JB 1J75A 5F0FA 5D5WB 2K9QA 1USTA 2BXYA 4KISA 3ZP5A 1LE8A 4MTDA 1U5TC 3LAJA 5AIQA 3CP8A 4CDGA 1FT9A 2OQRA 1AOYA 4LB6B 2KIUA 3JRDA 4HQMA 4RGRA 1F5TA 1FIAA 3EPZA 2L9NA 3DFGA 1LB2A 2VOPA 1T33A 2L54A 2K5CA 3DEUA 4PCQA 3OYFA 1NHAA 3G4SI 1FZPB 2EV6A 3E3VA 4KIGA 3S1NJ 4YFXF 2E7WA 4XN3A 3GTOJ 1ORKA 1HW1A 4RGUA 1Z6RA 4H0EA 2CV0A 1SFKA 5D5XB 4HDUA 2R0QC 2R7SA 2V9KA 2EB7A 6PAXA 2VONA 5GTIC 1DQUA 4XICA 1LFUP 2DMTA 2L3DA 4ZYDA 4F52A 3S2HJ 3W6VA 2BHYA 2PJRA 5JLWA 2F6CA 2QKLB 2X51A 1YJNI 1A6QA 5GAHJ 5F1JA 5ILUA 1ETXA 2HQAA 2KP6A 3BG6A 4UVAA 1VQ8I 5BS6A 3D0SA 4M71A 3CCEI 1HOMA 2FOWA 1UMQA 1YFHA 3HHHA 3S3OA 3BP8A 2DI3A 2LYCA 3CMYA 1Z6TA 2FSWA 4Y3OA 2CRGA 3CDLA 4KT6A 5J1RA 1MGTA 4LMYA 2MSYA 4ENMA 3K4JA 4MIMA 3SFZA 3BC8A 4XLFA 3HSFA 2ESHA 4U0WA 2FU4A 3G73A 5EDNA 4EGZA 1O57A 2IW5A 4XRSG 1QHHD 4XLCA 2DMUA 4OIQF 2A6TA 1G3WA 4HG2A 2Z2SB 4MTEA 2J5OA 3WHBA 4IHTA 1FTZA 4MO7A 3HEFA 3GTGJ 2R7VA 3AAFA 3I64A 1B8IA 5CVJA 3OMYA 3W2WA 3RJPA 3W6JB 4A3IJ 2BBYA 5CKTA 2V1UA 3Q9VA 5L3GA 3ABUA 3ABMH 2VN2A 5IY5H 3CC2I 5IP9J 2LKXA 5DUKA 3IHUA 3K1MA 4CICA 2JZYA 3FXUA 4YFNF 4HRIA 3WTUC 4M72A 2VBWA 3I4PA 2BY0A 3BQZA 4B48A 4LLNA 1K78B 1B8IB 1O3TA 1HBXG 2GXBA 2BY1A 3PUBA 3NWSA 4HQEA 4GDFA 1D1AA 2X6XA 1FMWA 3NWTA 4U7DA 4MLOA 2BGCA 5FROA 3BJAA 3ERMA 1CF7B 3I59B 1SMYF 1D5YA 2H8WA 5F04A 4KUMA 1QZZA 5F6FA 2CYYA 2Y69H 5EJCA 3RPQA 1PUFA 2XHKA 2JA8J 2RV8A 1YRNB 4FTHA 1H0MA 3HSEA 3GTLJ 3JRFA 1TLHB 2LVSA 4XM3A 5LHIA 2NVTJ 1XCVA 2JK3A 1RI7A 1R4NB 3PQKA 1YG2A 4UVBA 2FBKA 1SFXA 2HYJA 1LEBA 2LY1A 4IQ4A 3SFIA 3C2GA 4PGGA 1ZH5A 3L2QA 2R7OA 2E71A 1W7PD 1PJRA 3V42A 5D4SA 1RETA 1ZG5A 2E34A 3CQZJ 1RZ4A 1QPMA 3CJQB 1WSUA 2HQ5A 3FXLA 1D0XA 5C4XJ 1MJAA 4A3MJ 2K85A 3K1NA 5F0CA 3OYGA 2M4KA 4EEFG 1P2FA 3J81K 4M73A 1OQYA 3PM1A 4BQNA 5LHHA 5JVGF 3S2DJ 2WBMA 3W3CA 4F7ZA 3H35A 2ACJA 3U1KA 3TQNA 5D5VB 1X4PA 3M8JA 1JHFA 4II3A 3DBRB 1U8BA 5DTDA 1MBEA 2HVRA 2BXZA 1ZK8A 2HXOA 2KJBA 1SFOJ 2K9NA 2H94A 2X6WA 3LSTA 3ABKH 3CUQC 3L00A 3OIPA 4IRHA 1FNNA 3ZMDA 2FBIA 3MEXA 4KT5C 2ISZA 2TDXA 3BTJA 4E7ZA 1XGMA 3N05A 5EEHA 5C4JJ 5LGNA 2M4GA 4EMSA 1PUEE 2WAQN 2QKMB 2E5ZA 1R1UA 2EFQA 2VBYA 5JFRA 1EKEA 1Y1VJ 3KP7A 2GQQA 1W36D 5F27A 1SVLA 1I3AA 2L7ZA 1K4SA 3CD6I 2HGCA 2JPBA 1S3JA 3S32A 3VB2A 4Q48A 3BOQA 2JWTA 2M3AA 3H3UA 4U87A 1RUNA 2Q2EB 1JKOC 4RMNA 2E1NA 2E2JJ 1KU3A 4L5JA 2BE5F 1VQ7I 2V7FA 5FJ8J 3P9KA 2KIQA 1WJ5A 4M3DA 4Q4ZF 2KDZA 4E7IA 1K6OA 2MLGA 1LQ1A 3A03A 3E5UA 3GF2A 3MAJA 5K1YA 4ANJA 1NH3A 2KIMA 2OBPA 3IV5A 2DA5A 2XAQA 1TWAJ 2LOOA 2O3FA 1ENHA 2HNHA 3H5AA 5JI6A 5KHDA 4AUXA 2Y9ZA 1J2XA 3RTRA 3HPGA 3COAC 3A02A 3BJ6A 3M9AA 1BR1A 1JT0A 2ESNA 3HOYJ 1AHDP 4M9XA 1VFCA 5GAGJ 1VQNI 3S1MJ 4EJUA 3IL2A 1N78A 2E19A 2F48A 3K4LA 3TP3A 1WI9A 4A6EA 2Y0SN 4BQQA 3QOEA 1IJWC 1Z9CA 3BLYA 4BE2A 3CLQA 3H5NA 3WG9A 3MMYB 1RKWA 3FXRA 2ECCA 2CQXA 1EV7A 4XLHA 2M87A 3HRMA 1Q1HA 4QTRA 2G0EA 3CCLI 4P9FA 3G71I 4DQ2A 3L1PA 1ZRDA 2JPCA 1AWCA 3JRHA 2QQ8A 1SC7A 2OD5A 1ZTRA 2R4GA 4NC7A 3SDBA 3JRGA 1LUJB 2HTJA 1NG7A 3HC7A 3WTYC 2ZMEC 1D0ZA 4A0ZA 1IV6A 2ELKA 2AQFA 3RZOJ 3S93A 2Y30A 4M6VA 4IHSA 2D1VA 4ESFA 1U8RA 2VB6A 4YIIA 2HVSA 3FKJA 2XVCA 2PJPA 3H9QA 5M5WJ 2E35A 3G6EI 1P7JA 1MJ9A 1U9OA 2IA1A 1B72B 3JTGA 1QZEA 3EUHC 4OMZA 1IZ1A 3WTTC 4IZZA 4E4HA 2QLZA 3K4KA 5K5OA 4IHWA 1LDDA 3MKZA 2EZLA 3KCCA 2LLKA 4F92B 2R5ZB 4GCVA 1RR7A 2VASA 2GOMA 5J1YA 1OCOH 3RCOA 4QSHA 3VYTB 4AM3A 3CCVI 1LVKA 3CF5F 4B4CA 3MKWB 2RN7A 2ICWG 2MFZA 1KA8A 3LNQA 1TWGJ 1HC8A 2H1LA 2R7UA 2KISA 4ZZDA 5ICFA 1V4RA 2B63J 1OYIA 2BOLA 2Y48A 3WGGA 2PN6A 3L2WA 4I6ZA 4BNCA 1MNEA 3H9GA 4CZCA 2CUJA 5L3BA 4CHUA 4DBQA 3I4NJ 4BQAA 1YQAA 3AFHA 2MC3A 5KAIC 1BJZA 1E3PA 5D5UB 3SXYA 3LSMA 1X3WB 3Q0VA 3E6BA 3F8NA 4FX0A 2MG4A 3OYDA 2UXNA 2ZKZA 1FBSA 1R1VA 1WPKA 2GIZA 3DPTA 1K4TA 4F91B 1NTCA 2BY2A 3HIFA 5FD6A 3OYHA 2O6GE 2QA4I 2O8KA 2ZMEB 3GFMA 4LOCA 3DPLC 1W36C 3ASNH 5CPRB 1BIBA 2JVHA 2OZUA 4LIVA 3VEPA 1SANA 3GLXA 4KICA 4D0PA 4CUGA 1X58A 2VQLA 1FYMA 4UY8I 2K40A 2QBYB 4HV5A 3CLOA 2V4JC 2HVQA 1AU7A 1YJ9I 3I53A 1MH3A 3IKTA 1TWCJ 1IO2A 1XD7A 2A68F 1S7AA 2OJED 1S5LC 4Y33A 1FOYA 4R1HA 2IPQX 3OR1C 1WZ2A 3CCUI 4PSWA 1IN5A 4BQOA 3PSIA 1DP3A 3ZGKA 1ZGWA 1Y0NA 1BI1A 4G6DA 2E7XA 1OCPA 2LG4A 3BPXA 5IPAA 2OU2A 2ZJQF 3QYEA 1ERDA 1QRYA 2DOEA 2YUSA 2YX4A 3I54A 3K70D 1K7AA 2GWRA 2V6CA 2DLLA 4BJ6C 4F93B 2DFIA 1Y1WJ 4P55A 3CCMI 1IV8A 2EA4A 3AKZA 1XN7A 3Q0UA 5L3DA 1WJBA 1I5ZA 4X0GA 2X1CA 2DQLA 3ZMSA 1W5SA 2EIKH 3H92A 4X1EA 5EEAA 4J00A 3MWMA 1HDDC 1TWHJ 3C2BA 3AL0B 1M1EB 4PUSA 4RGSA 3ASOH 4XONA 1B1BA 3TO7A 1N25A 1XDSA 3W6KB 4UB6C 3RI4A 1KYZA 2MGQA 1A35A 2P0WA 4O5VA 4HPQA 4JX6A 2EZKA 1X3ZB 3OOUA 1FPQA 4M3EA 3HHGA 3OIOA 3MKYB 3DLLF 5GPAA 1IW7F 1LKXA 4GXOA 5KCMA 5IOZA 3O6BB 3M07A 4ETSA 1XMKA 3H9JA 3BTIA 2HOEA 2V26A 2HEOA 4Y52J 1HKTA 2JMWA 1I1SA 1VQ4I 1F4KA 1J7KA 1SD7A 4CCMA 2CMPA 3CDHA 3DCFA 5E3MA 4QPOA 2YU3A 1R22A 3HUGB 4A2UA 4RB2C 1IGNA 4WWCA 1B9NA 4UV8A 3HPHA 2LY2A 5J40A 3OYIA 3A0BC 3DV8A 4AIHA 5EG0A 2J5PA 2M0MA 1ZREA 4BH9A 1RKTA 4RB0A 4ZDPA 3HM5A 1FJLA 1R23A 3Q0WA 3VPRA 4HNTA 4CZZA 2HR3A 1NK3P 4HEA2 5EZGA 3BR3A 4RB1A 4J19A 1JI8A 4IXAA 4GRIA 3JCUC 4RM3A 2XPWA 1TBXA 1FC3A 2L4MA 4YEJA 4ZDLA 1E17A 2VIXA 2X4HA 4WXHA 3EYIA 4N9IA 3ZQLA 4XK4A 2VJ4A 4DYRA 2ZJPF 2ZMEA 3ZMZA 2Y0SA 3QP6A 4EJTA 2WV0A 1BW6A 2HWVA 1W5CC 2W25A 3I58A 2R7WA 2D5VA 1XTAA 3RSNA 1QGPA 4MGRA 2R7QA 3GX4X 1ZKGA 4HYEA 4OINF 1ZELA 3HRTA 3TOAA 3H3ZA 2LDUA 3SQNA 2ZC2A 2P5VA 1UCRA 1QHGA 5J6XA 2XGEA 1T98A 3K4CA 2NOJB 4II2A 4OWRB 4DGWB 3JW4A 2FXAA 3FHZA 2VQHA 1RUOA 2CW8A 3ZQFA 1W7PB 1YLFA 3TO6A 2L0KA 5FKKA 3BZKA 3P7NA 3ZMUA 2FRHA 2M34A 3KE2A 4QIWN 3GEZA 2XAGA 4KN4X 3PIPF 1KQ9A 3WHCA 2QEXI 1IRFA 1MBGA 4RGXA 1DP7P 2Z1DA 3DLAA 3FKIJ 3IWZA 1GV2A 2DA4A 3H0DA 1MDMB 4JK1X 1OISA 5E8IA 3K4BA 4C3HJ 4XKVA 1EA3A 2NAZA 3T1BA 2DFHA 3C2HA 1A31A 3KP2A 2AS5F 2XKPA 4N4NB 1IXCA 1X2NA 5HDNA 4I01A 2LTPA 3FXMA 3HKZA 3CC4I 3MKLA 2WY7Q 3GTKJ 2XB5A 1OMIA 4L9VA 4RAGA 2ADUA 3GCMA 3T5XA 3B6CA 4BY1J 3OYEA 1BI3A 4NQWA 3CP2A 4UUTA 3V8LA 2K7LA 1ZR2A 2HZTA 1SMTA 1G6NA 3F9KA 2F5CA 2NRAC 1HCRA 4V19K 3HRUA 1X1DA 5DDGA 3NRVA 2O7OA 3LQQA 1REPC 4Y7NJ 4W97A 4HF1A 2CUFA 1R7JA 2EIJH 3K1PA 2ZNYA 2PBIA 5DD4A 4NNJA 3ZOBA 3REOA 2W4SA 2XIGA 4BACA 2VC0A 1Y0UA 3SEZA 2A07F 4KJZA 2ZSHB 3K6GA 3ZQ7A 4PZJA 2QYOA 1PP8F 1WCMJ 4BE1A 1T0FA 2FUG2 4C30A 3SEQA 5HOOA 3FWEA 2LK2A 5IYBJ 5FB2A 3DTIA 1G59A 4LD5A 5FGMA 5EZHA 2DPUA 4U0VA 4AIJA 5D6EA 2YR2A 2QVOA 1V5FA 2D2WA 1VNDA 3I71A 1H9GA 3KYCB 1JUMA 3G3ZA 2XASA 5HLGA 2NS0A 2BW3B 2PQ8A 2X48A 1PUFB 4N9HA 4ENJA 1FTTA 3HZJA 2QSHX 5TISC 3PSFA 2OA4A 3BG3A 1RPWA 1YI2I 5B1BH 1EJ9A 3PJRA 1YIOA 3V7SA 3J81Z 1YIJI 4I98B 1LDKB 2ISYA 3R0JA 3LA7A 4ZYHA 4C2UA 2XC7A 2CQ7A 1CF7A 2HDDA 3PNYA 3K9TA 3K69A 4WCGA 2WWYA 1QA6A 2I5UA 3ROUA 3CCQI 1BI2A 1BL0A 4CO8A 3DKXA 2Z16A 4CYDA 1K6YA 3MQ0A 3QWLA 4EJVA 2DXIA 1BM9A 5D4RA 3GYHX 2AXTC 5E8GA 4KYWA 4C3JJ 1UFMA 5CLSA 5ICEA 2V1NA 1MBFA 3OY9A 1CQTA 1JJ6C 3KIOA 4ABZA 1KU2A 3S16J 4HOBA 2VPRA 3IUOA 1V3FA 1TNSA 1I3QJ 4IX7A 4HF2A 1X2MA 2DK8A 3GBGA 4A3KJ 2H27A 4XN0A 2H1KA 3AG4H 1DU0A 1P7IA 4S0HB 2I8DA 3E6CC 2R3SA 3OL4A 4V2GA 3QU6A 3ERED 3L7WA 2QCOA 1YO5C 3CMAI 2K4BA 4B43A 4HDVA 3FK6A 4UNOA 5E17F 1XSDA 2WY8Q 3QP5A 4B1RA 1X1AA 4EM0B 1V54H 4GGGA 4A6DA 2CQKA 1KU9A 2PI0A 1OLTA 2NS8A 4F3QA 2Z33A 2BW3A 2EINH 1KGSA 5CVIA 1KU7A 4MEXF 1WKMA 4XMYA 2HOSA 4CH7A 2QWWA 2NVXJ 3MZ8A 2E1MC 1ETYA 2FD5A 2JQ7A 4UV9A 2VJJA 1V55H 2QSFX 1JGSA 1FOXA 3ZQGA 1MMDA 2ZXHA 3BZCA 1QVUA 2KKOA 1OYWA 3U9GA 5F64A 1I39A 2PMUA 4OMYA 2W48A 2LKPA 3R60A 3CCSI 2R7TA 4HNUA 4OU0A 1XSVA 3JRCA 3H5RA 2HS5A 2L02A 2WAQA 4PFOA 2DAOA 2DA6A 2KJCA 3SDGA 2JSCA 3RPUA 4KIFA 5FKMA 2LH9A 1FBUA 4PK4A 1T39A 1FY7A 2O03A 2JT1A 2NYXA 4XBFA 2PLYA 3SZGA 2XGXA 4QPQA 3A0HC 4E7SA 2F5DA 2EFWA 4B09A 2KQRA 1E3OC 2NS7A 3GFJA 1ITYA 3DF8A 1SD4A 2E1CA 4D1QA 5M3FJ 2DMPA 3C7JA 2MD5A 2CFOA 3QPSA 1FEXA 2KIFA 3PL8A 2UXXA 3F8CA 2IA0A 1DDNA 4NDLA 3P9IA 1VQLI 1G4DA 2A61A 2DMNA 2OC6A 4H4KC 5KVRA 4EJOA 3L2VA 2LY9A 3ULQB 4L18B 2F2EA 4BXFA 4BS9A 1AKHB 1Z7UA 3CO7C 3S3NA 3ZMVA 1ZAOA 2IRFG 4KN7X 3L2UA 2R5ZA 4UHTA 4I0AA 4DOZA 3J7AO 1R9TJ 5J4VA 2WA0A 2IGKA 3K4MA 3L09A 4R79A 2KPMA 4BYYA 3CMEI 2DMQA 1GT0C 1B59A 5DS9A 1AKHA 3W2VA 1OPCA 1LPQA 2HPMA 3F72A 1P9QC 1L3LA 2W00A 3AG2H 5JR3A 3V8JA 2IS1A 1TTYA 2VLAA 3HOVJ 5JVTA 2OTLI 2MD0A 5K5QA 1TQMA 2GBYA 4PJMA 3JRIA 4ZC3A 4E7LA 2K27A 2KRCA 5E3LA 1HQCA 1MZBA 2XAJA 3OYAA 4XLAA 4YFKF 4OAYA 3EUAA 3DPUA 4XNFA 4XRMA 2GXGA 2N8GA 3ELKA 2HXIA 1K61A 3QQAA 3JR9A 3CO6C 2W85A 2MA3A 3IC7A 1NK2P 5ERIA 2HTSA 1AA7A 5FFXA 3GLLA 4L5IA 4XL9A 3WGHA 4LK0F 3P5JA 5BMZA 4D5CA 5BQTA 3LSRA 3Q9SA 4CXFA 2ME6A 1IRZA 1TQPA 1VTNC 3DTEA 3I3LA 2ZXIA 3WU2C 1HF0A 3SZTA 2GM4A 3GZNB 1YW9A 2Q2EA 3LA2A 1MBJA 4I02A 2ZFUA 3D5LA 1KYWA 4XIDA 4L9NA 4DJAA 3NQOA 3QYBA 3ZQQA 4PFPA 2MLKA 3L9FA 4AU7A 3JAMK 2K86A 2UUZA 3WTWC 2HPIA 3MCZA 5BNGA 1UJ8A 3PIOF 5HDKA 4KITB 4XOTA 1ZHFA 3RKXA 4ESBA 3HGGA 3ONQA 2E60A 2R7XA 1UHWA 1OFCX
chains in the Genus database with same CATH topology
3ZGKA 1WJFA 2VXZA 3OWTA 1PYVA 4NUBA 2LG4A 3PNTA 1Y56A 2HDWA 3OL3A 1MNDA 2Q1ZB 3QYEA 1ERDA 3K70D 2OUMA 2VJIA 3S8PA 4BJ6C 4CCOA 4F93B 1BR4A 3AKZA 3SYTA 4E6KG 1MMGA 1WJBA 3OS1A 3AL0C 4BE0A 4BJ5C 4X0GA 2X1CA 2XAUA 1NG6A 4J00A 2K9MA 3VDXA 3VWBA 3AL0B 4PUSA 2KDOA 4XONA 3MD2A 2MABA 2P0WA 4BEHB 1Y6IA 4HPQA 2DT7B 3KYLA 2MYSA 2JA2A 3OOUA 3J7AY 4PJLA 3MKYB 2PJRB 3DTKA 1LKXA 2CS3A 5KCMA 3CF2A 4N4OB 4AVZA 3TBIA 3E0JB 3HL2A 2F5VA 3H9JA 2V26A 4LITA 2BVLA 4KISA 5HVQC 3CP8A 3LL7A 4CCMA 3OYKA 2CMPA 4QPOA 3HUGB 3CMMA 2A5WA 4BGDA 3EPZA 2L9NA 4P5OA 2CV1A 1MW7A 2LY2A 3HPHA 5LFAA 2K5CA 2XF7A 4J01A 3DU5A 3OYIA 3OYFA 2L2OA 2M0MA 1Z7LA 3A2KA 4AYBA 2W1OA 4ZDPA 4XN3A 2HU9A 3FHNA 4CA0A 3TL4X 2VQGA 1TZLA 3QYFA 4HNTA 4HEA2 2CV0A 1SFKA 1JI8A 2R7SA 2V9KA 4GRIA 1DQUA 4RM3A 3K70C 4YEJA 4ZDLA 1N75A 2R7RA 2VIXA 4F52A 3VYSB 1D0YA 2IXSA 2VJ4A 2M7BA 2PJRA 2F6CA 2QKLB 2Y0SA 3RPUD 2X51A 3FDYA 3DQVC 2HQAA 4FASD 2KP6A 3BG6A 1OR7C 3VSKA 1UELB 2R7WA 3RSNA 2R7QA 2LC2A 4C9YA 3OIQA 4BEHA 1ZELA 3ZCOA 3IAS2 1WJEA 3S3OA 2LYCA 1HA8A 4Y3OA 4KT6A 2VJ5A 4BUPA 1QHGA 1Z3XA 2V6EA 3K4CA 1D1CA 3K4JA 2NOJB 4II2A 4OWRB 4DGWB 3IAM2 3BC8A 4XLFA 2VQHA 4ITVA 3CJRB 3D5RC 2LBFA 2CW8A 1YX3A 2VQCA 3CESA 2X6YA 1QHHD 2K3PA 4XLCA 2A6TA 4HG2A 2Z2SB 1VZ0A 2R7VA 3U21A 2LRDA 1Z21A 4DBRA 4D9JA 3OMYA 2WB1A 2Z1DA 3UR3C 3W2WA 2W7NA 3DLAA 3K4NA 1TT0A 3H0DA 5CKTA 1SAUA 1YX5A 3K4BA 4XKVA 1EA3A 3C2HA 3BCAA 4N4NB 4PJNA 3HKZA 2CV2A 2WY7Q 3ZR8X 3DWLE 3I9V2 4HRIA 4LG3A 4CSWA 1UAAA 4B48A 3OYEA 4JQFA 3CZ6A 5JHFA 3CP2A 3F9KA 3PUBA 3NWSA 1D1AA 1X1DA 2X6XA 1FMWA 3NWTA 4MLOA 3VSLA 5FROA 2CW7A 1GLNA 4C2TA 4B47A 4U7BA 1R6RA 1T95A 4NNJA 2L5QA 2W4SA 4BACA 2ELJA 3SEZA 2RQQA 5HNHA 3OYLA 4KJZA 2ZSHB 3K6GA 3K10A 4XM3A 1X1CA 4PJJA 2XF5A 2DJIA 2HZDA 4RLFA 4BE1A 2LY1A 2FUG2 3LMMA 3C2GA 4IQ4A 4C30A 3SEQA 5HLTA 5HOOA 3L2QA 3DTIA 2R7OA 1G59A 1Z3YA 1DP3A 3ZXSA 1PJRA 2E5NA 3V42A 4P1WA 2IGNA 2XDVA 3LSIA 3OYJA 3DKYA 3CJQB 2KZVA 3UNGC 4XKWA 1D0XA 3TMOA 1V5FA 2OV7A 4RM2A 3E1SA 5TGTA 3KEYA 3OYGA 2M4KA 1MMNA 3PNVA 2MC4A 2JSPA 1UG0A 2BW3B 4BQNA 2WBMA 3W3CA 3H35A 1S9HA 4OAZA 2RREA 4IQJA 1X4PA 2KRHA 2VL8A 3M8JA 4IKFA 3PSFA 4II3A 3L2RA 3PJRA 2VXDA 4HSRA 1N77A 2KL4A 2K9LA 1LDKB 2HVRA 4C2UA 2XC7A 5HNFA 2VPLA 2X6WA 3LSHA 3PNYA 3OIPA 2IS2A 2GOXB 4E7ZA 3N05A 2ZSIB 4F55A 2M4GA 3FBNB 3DKXA 3OYCA 4LIUA 1DGWY 2Z16A 4Y4RA 3OS2A 3ZRGA 4XQFA 1K6YA 2QKMB 3FBIB 2E5ZA 2DXIA 4BJTA 2WADA 1W36D 4RLQA 2V1NA 3VYUB 2LREA 3IP4B 3S32A 3OY9A 2CH0A 2IGMA 2KLOA 2M3AA 3IUOA 2JVGA 3PFYA 4U87A 4IX7A 3GBGA 2Q2EB 4XN0A 3LSKA 4RMNA 5FRMA 2I8DA 2V7FA 3OL4A 4E7IA 1WJ5A 2WAFA 4G6TB 4CCNA 4B43A 4BL0B 2PMZA 4BDZA 5FRNA 1DGRM 2WY8Q 2AQEA 2E1MB 4ANJA 1X1AA 4E7HA 1IRXA 2LOOA 1OLTA 4XKCA 4F3QA 2X85A 2HNHA 3BCBA 2BW3A 4NC8A 3H5AA 1J09A 5KHDA 4XMYA 4CH7A 2XF6A 3RTRA 2E1MC 3HPGA 1WJDA 2X1EA 1KONA 1V5GA 1BR1A 4ZDOA 1YE9A 2O5RA 2VKDA 2VJJA 2DOAA 4B44A 4BU2A 3LSGA 1MMDA 1N78A 3K4LA 2ZXHA 2BVMA 4BQQA 3QOEA 4XORA 3BLYA 5LD2C 1QU3A 4BE2A 3H5NA 3MMYB 2LBFB 1U0JA 2R7TA 4XOPA 3G2BA 4XLHA 4HNUA 2UWMA 3A4CA 2R7XA 3H5RA 2WAQA 4PFOA 2X1DA 4CCKA 2LH9A 3DU6A 4PK4A 3W2AA 1X4OA 4YELA 1T0FC 3SZGA 4QPQA 4E7SA 1MMAA 2R4GA 3OR2C 2KQRA 4NC7A 3SDBA 2KMUA 3HC7A 1NG7A 1G8XA 1BOBA 4D1QA 4XR6A 1D0ZA 2IS4A 2CFOA 4CCJA 2RNGA 2AQFA 2F4IA 3PL8A 4E7KA 3HG9A 4ZTJA 3S93A 1FMVA 4XKBA 2CUZA 2VB6A 2HVSA 2OC6A 4H4KC 4EATA 3HXLA 3FKJA 3L2VA 2M7AA 4XLEA 4BXFA 4BS9A 3H9QA 3S3NA 4PSXA 3OYBA 3L2UA 1WFXA 4DOZA 5KNLA 3OYNA 2WA0A 2IGKA 3K4MA 3EUHC 2W82A 4R79A 2KPMA 2L9SA 3M1CA 1V5EA 4PSWA 4IZZA 4E4HA 2DT6A 3K4KA 3MKZA 3W2VA 2HPMA 4F92B 4JOMA 2VASA 2GOMA 1P9QC 3RCOA 3D5SC 3VYTB 2XSJC 2W00A 1LVKA 3MKWB 2L7KA 2IS1A 2VLAA 3A1YA 2MFZA 2MD0A 1WJAA 4PJMA 4ZC3A 1WJCA 3HOSA 5CQEA 4E7LA 2R7UA 2KRCA 3RQ4A 3EUKL 3OYAA 4XLAA 4OAYA 3EUAA 3OYMA 2BOLA 3DPUA 4XNFA 3L2WA 4ZYAA 1MNEA 2DCEA 3H9GA 4CZCA 4DIQA 2CUJA 4FETA 4DBQA 2VKHA 4BDYA 4E7JA 3AFHA 4CCLA 3LSMA 3VYRB 3S3MA 2JUGA 1AA7A 3OYDA 2UV1A 1X1BA 4XL9A 3KX2A 3OS0A 1E0EA 4ZTFA 3DPTA 4F91B 3OYHA 3BG7A 4YRVA 3DTEA 3I3LA 2ZXIA 3QODA 3HOTA 4HSTA 3DPLC 1W36C 2IS6A 5CPRB 2JVHA 3LFUA 4LIVA 4NQWB 2ZFUA 4ZJZA 3D5LA 1LFPA 4B3XA 4CUGA 1D1BA 2WAEA 2VQLA 4DJAA 3QYBA 3ZQQA 2V4JC 2HVQA 4PFPA 4AU7A 2UUZA 2HPIA 2IGOA 3DEEA 5CQGA 4KITB 4XOTA 4Y33A 1BR2A 3OR1C 3ONQA 2KHMA 2E60A 1X19A 4BQOA 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  3QOE A;  4YRV A;  3QOD A;  4J01 A;  4HRI A;  4IZZ A; 
#chains in the Genus database with same CATH topology
 4IOA F;  1R1T A;  1WJF A;  3QU3 A;  1PYV A;  2NNN A;  5AON A;  1TW3 A;  5FFZ A;  2XSD C;  3PNT A;  3OL3 A;  4A5M A;  4M6Y A;  2LF7 A;  2ZCW A;  5E1Z B;  5IYD J;  1C0W A;  2DYR H;  2NVU B;  2OUM A;  2VJI A;  3DBL B;  1IG7 A;  3KZY A;  3GTQ J;  2Z9O A;  1HW5 A;  4E6K G;  2VKE A;  1MMG A;  3AL0 C;  5EGO B;  1H89 C;  4V2F A;  1G3S A;  2VC1 A;  2G7H A;  1IXS B;  4GYI A;  3WTS C;  4UB8 C;  2FF4 A;  3VWB A;  4Q5S F;  3BRO A;  2MH2 A;  2L01 A;  3PUF A;  2A69 F;  1XC5 A;  1ZRC A;  3GUD A;  2NNY A;  3PO3 J;  4G7Z F;  2P8T A;  3DXJ F;  2DT7 B;  5EEG A;  5GAE J;  2I10 A;  1HXD A;  4HW0 A;  2O61 A;  2CUE A;  5AIP A;  3L2C A;  4HZF A;  2PJR B;  3DTK A;  5M3M J;  1XS9 A;  1D3Y A;  1TC3 C;  2EFN A;  3FMR A;  2Y2Z A;  1MH4 A;  3BR0 A;  2CS3 A;  3EYY A;  3TP0 A;  3X2Q H;  2KZG A;  2P4W A;  5FLV A;  1EH6 A;  2HKX A;  4LIT A;  3MFK A;  3RDI A;  2XPV A;  2PMH A;  1IUF A;  3WGI A;  2CQQ A;  5HVQ C;  5EG0 B;  1TW2 A;  3M3Y J;  3LL7 A;  3OYK A;  4BHP A;  4M6X A;  3MZH A;  4A0X A;  3D1N I;  2HDC A;  1R36 A;  3B73 A;  2A5W A;  1VQ5 I;  2XAF A;  2P5K A;  1HKQ A;  1O7F A;  1YYV A;  1MW7 A;  4P5O A;  4UUS A;  2CV1 A;  4EQQ A;  2K02 A;  4M9Z A;  3DBH B;  4J01 A;  1XDU A;  2EIM H;  3TED A;  4UVC A;  1LVA A;  2DA2 A;  1JT6 A;  4CGZ A;  3KP3 A;  1SVO A;  2DPD A;  4AYB A;  3FHN A;  1JTY A;  3F0C A;  2GZW A;  2DQR A;  2VQG A;  1TZL A;  3HOX J;  3KP5 A;  3QYF A;  5FKO A;  1WHU A;  5B66 C;  4XLP F;  3B02 A;  2W84 A;  1GVD A;  4LG0 B;  3DEW A;  4A3B J;  2IT0 A;  4MQV A;  3HOU J;  2X9D A;  1SEU A;  3ESW B;  2DW4 A;  1N75 A;  4HX7 A;  1ETQ A;  3TW6 A;  2R7R A;  1WWX A;  3WU0 A;  3VYS B;  1O3Q A;  5H6R A;  1R71 A;  2IXS A;  3T0Y A;  1GV5 A;  1SD6 A;  3RYR A;  2BV6 A;  3U1D A;  1YJW I;  1U5T A;  4IVN A;  1R5H A;  2FML A;  4RB3 C;  1U78 A;  4LLG F;  4FAS D;  3VSK A;  4L0Y B;  2LC2 A;  4XSZ F;  4NB5 A;  1ZN2 A;  1S8N A;  1WJE A;  2CFX A;  3IAS 2;  4A0Y A;  1ETK A;  4RBO A;  4BUP A;  3HTU A;  3HUG A;  1UG2 A;  2A3S A;  3M7G A;  4DYC A;  1FYL A;  2FE3 A;  2OQG A;  1A36 A;  1D1C A;  5E20 A;  2QZ8 A;  3IAM 2;  3BR1 A;  5KK1 A;  3CJR B;  3D5R C;  3RYP A;  2LBF A;  5L3E A;  2IA2 A;  1YX3 A;  3HOZ J;  3CES A;  2X6Y A;  4AC0 A;  1MBH A;  2ZJ2 A;  1IC8 A;  4L9J A;  3E6D A;  1TQI A;  4IHX A;  2RQP A;  2LRD A;  1W1W E;  2QEN A;  4DBR A;  4D9J A;  3UR3 C;  2WB1 A;  4PJ0 C;  2JA5 J;  2W7N A;  3K4N A;  2B7E A;  1R00 A;  1FSE A;  1TT0 A;  3R6S A;  2E36 A;  4AWX B;  4BBR J;  2OTJ I;  1FOW A;  1YX5 A;  3IH4 A;  2CO5 A;  4LGW A;  1HSJ A;  2P81 A;  3WTX C;  4KNY A;  3BTC A;  2XRN A;  2LF8 A;  3E97 A;  1FOK A;  1HDP A;  3OOP A;  1Y8R B;  2Z5U A;  3I9V 2;  3MN2 A;  4CSW A;  1P92 A;  1MIJ A;  2B0L A;  3N4M A;  3CZ6 A;  1GXQ A;  1T8I A;  3JAM Z;  2QGU A;  2L4A A;  4R8H A;  5E3N A;  3KZZ A;  5D6F A;  3ZQI A;  1ETV A;  3ECO A;  5EYR A;  2JJ7 A;  2BZT A;  2Y75 A;  1R58 A;  2DA7 A;  3FM3 A;  3QRF F;  1U5T B;  3BWG A;  2OZ6 A;  3HJE A;  3FX3 A;  3WE3 A;  4B47 A;  1R6R A;  1QQI A;  5IT3 A;  3JRE A;  2L5Q A;  3FK7 A;  2ELJ A;  2DTR A;  1VQP I;  3CUQ A;  1DUX C;  4MHG A;  3OYL A;  3K10 A;  1CGP A;  1VQ9 I;  2Z99 A;  2Y9Y A;  3MVP A;  2R93 J;  4RLF A;  3LMM A;  2R7F A;  1IRG A;  2LKS A;  1D8J A;  3F8B A;  2QF7 A;  2XV4 S;  4Y17 A;  2E5N A;  2IGN A;  2XDV A;  3LSI A;  3OYJ A;  1GUU A;  2B9S A;  3CJT B;  3J7Z I;  3KFW X;  1W7P A;  3UNG C;  2XKO A;  4XKW A;  3TMO A;  1I6H J;  2OV7 A;  4IOC F;  1KQ0 A;  2HI3 A;  3E1S A;  3FXO A;  4IJA A;  3KEY A;  4RM2 A;  5H20 A;  5TGT A;  1SAX A;  2ZXJ A;  1MMN A;  3PNV A;  2M30 A;  2JSP A;  2MC4 A;  1IF1 A;  3SHF A;  5D8L B;  3BDD A;  3K2A A;  4MQ9 F;  1T08 B;  2WTE A;  2OCC H;  2Y31 A;  4OAZ A;  4IRI A;  2RRE A;  3ZMT A;  4IKF A;  3IKV A;  1RR8 C;  3L2R A;  4ON0 A;  2VOD A;  2EPF A;  4HX4 A;  1N77 A;  1O3R A;  2KL4 A;  3BJO A;  3QPT A;  3BG5 A;  3F8M A;  5HNF A;  5A2Q Z;  1USS A;  1YHQ I;  2X6O A;  2VPL A;  3Q5F A;  2O0Y A;  3JRA A;  3TO9 A;  3K7A J;  1W4M A;  4G6Q A;  1T38 A;  3GZ5 A;  4KFC A;  4HLX A;  2ZNZ A;  4IL6 C;  5J1U A;  5IT9 K;  2DU9 A;  1D8K A;  2ID6 A;  4LIU A;  1DGW Y;  3OS2 A;  4XQF A;  1W5T A;  4EJW A;  3FBI B;  4BKX A;  1BN5 A;  4IF4 A;  4BJT A;  1I1G A;  5B5E C;  2YS9 A;  2COB A;  1YS7 A;  3FIS A;  3NAU A;  3BPV A;  3ECH A;  2M45 A;  1MBK A;  3G1L A;  1OR7 A;  4FE4 A;  5LGU A;  3VYU B;  5HDG A;  3IP4 B;  4UXN A;  1YTY A;  5DV5 A;  4FX4 A;  2LSO A;  2UZK A;  2CH0 A;  3PFI A;  3PFY A;  1IN4 A;  2WC2 A;  1Z1D A;  3LWF A;  1LFB A;  1W0T A;  3ZN0 A;  1OKR A;  1POG A;  2Y0M A;  2RNJ A;  4G6T B;  1RNL A;  4CCN A;  4DZP A;  1A04 A;  4BL0 B;  2CSO A;  5FRN A;  2AQE A;  2RC4 A;  1FBQ A;  3V7R A;  2DDA A;  2E1M B;  3HKZ N;  2LFB A;  4P9U A;  3ZQC A;  3GWZ A;  4E7H A;  3S1R J;  1IRX A;  1K83 J;  4N0B A;  3BCB A;  4XLN F;  4IHV A;  2C6Y A;  2HOT A;  1J09 A;  5K7H A;  3H3V K;  3TDU C;  3A01 B;  2XF6 A;  4AVP A;  3FMQ A;  1JXS A;  1WJD A;  1KON A;  1V5G A;  1YE9 A;  2A05 A;  2VKD A;  2A5Y B;  3I55 I;  5FO5 A;  3KEO A;  4S04 A;  1F1Z A;  1XSX A;  3BR5 A;  1ZG3 A;  3H1C A;  4A3J J;  2CGP A;  1H88 C;  5FLX K;  5LEJ A;  4JYK A;  2ZO4 A;  3GO5 A;  2EZH A;  2COM A;  3AG3 H;  4JP0 A;  1F43 A;  1Y39 A;  2HYF A;  1PDN C;  3LSP A;  1U0J A;  3E5Q A;  3G2B A;  2HQN A;  1IDY A;  4IPA A;  2UWM A;  3ISP A;  3A4C A;  2H6B A;  3V7C A;  4BXU A;  1UHM A;  2ZFW A;  1Q1V A;  4CCK A;  2CWE A;  2STT A;  4YEL A;  1T0F C;  5JLX A;  4AID A;  2FOK A;  2KMU A;  2FQ3 A;  2DFF A;  2P6T A;  1G8X A;  1BOB A;  3CCR I;  1TT5 B;  2IS4 A;  3KET A;  3EUH A;  4CCJ A;  2RNG A;  4HLY A;  3GFI A;  5DCM B;  4E7K A;  1RIO H;  1X3U A;  4LLL A;  4UUS B;  1FMV A;  4XKB A;  2XAH A;  2CUZ A;  3FMS A;  3HXL A;  4EAT A;  4Y13 A;  4RS8 A;  3CC7 I;  3F22 A;  2M7A A;  4HV6 A;  2RAE A;  1QVT A;  2OCE A;  1BOA A;  2M1B A;  5FKN A;  2CJJ A;  3OYB A;  1WFX A;  5KNL A;  3OYN A;  1ODD A;  2VUM J;  1U2W A;  2W82 A;  2L9S A;  4WK8 F;  5C44 J;  1V5E A;  3S1Q J;  1OCZ H;  2DT6 A;  3FXJ A;  3RKW A;  4E70 A;  1XX5 A;  2CG4 A;  4O6J A;  2QQB A;  3ZPL A;  2DA3 A;  3RIR A;  1Z91 A;  1A5J A;  2F5F A;  1E3H A;  3A1Y A;  1U9N A;  2EH3 A;  2H8R A;  3R0A A;  1WJA A;  3C3W A;  2KFD A;  1WH7 A;  1WJC A;  3HOS A;  3LOC A;  5CQE A;  3EUK L;  1MNM C;  2R7Z J;  3OYM A;  1ON2 A;  2MBF A;  1K79 A;  2DCE A;  3LSJ A;  1XGS A;  4DIQ A;  5LEK A;  3O8G A;  4FET A;  2M9H A;  4A3G J;  2VKH A;  4AIK A;  4BDY A;  4E7J A;  2R5Y B;  4HNV A;  2D1H A;  5FD5 A;  2FBH A;  2ZBK A;  1FX7 A;  1OCC H;  4IHY A;  3KX2 A;  4PDK A;  2P7V B;  4FE7 A;  3OS0 A;  1I27 A;  4ENN A;  3FF5 A;  1E0E A;  5H6Q A;  5HOD A;  2IAI A;  3I5U A;  1O4X A;  1VQO I;  2DOF A;  4YRV A;  3QOD A;  2GIV A;  2K4J A;  3C1D A;  3HOT A;  3IH2 A;  3FIW A;  5CVR A;  1S72 I;  1KQ8 A;  5ILS A;  3LFU A;  3S17 J;  2MH9 A;  4XRS A;  5IOY A;  4ZJZ A;  5CVV A;  1LFP A;  1D1B A;  2WAE A;  4A12 A;  1APL C;  3ABL H;  4RAZ A;  1MD0 A;  2M8E A;  3HBL A;  3KP4 A;  4M9S A;  1ZR4 A;  1TL8 A;  1P4X A;  3I0T A;  3ML6 A;  5M5X J;  3MZY A;  1GDT A;  1FSH A;  2EA2 A;  2VBZ A;  4AD9 A;  4RAF A;  3BG9 A;  2BEO A;  2EK5 A;  2IJL A;  2VXZ A;  1H9T A;  4NUB A;  1IN6 A;  3KZI C;  1I6X A;  1DU6 A;  1F9N A;  1Y56 A;  1FWZ A;  1S7O A;  1MND A;  2HDW A;  2HYG D;  2Q1Z B;  2V1X A;  4TV7 A;  3NEU A;  3WTV C;  4FCY A;  4B3A A;  1OYY A;  2STW A;  4ASN A;  3SYT A;  2P6S A;  4CYC B;  2XPU A;  2YU9 J;  3K0L A;  4BJ5 C;  3H0G J;  4G7O F;  2BYV E;  3KPH A;  5IYC J;  2FA5 A;  1VQM I;  1XG1 A;  3FM5 A;  3ZN1 A;  1TWF J;  2XAU A;  1NG6 A;  1JE8 A;  3EDP A;  4A3E J;  3GTM J;  3NAR A;  4HA8 A;  3KLO A;  5E3O A;  4A93 J;  5E1W A;  4L5E A;  1XPX A;  2TRT A;  1SVM A;  4M3B A;  1Y6I A;  5HS7 A;  5J8F A;  3OSF A;  3IWF A;  3GW2 A;  4I76 A;  5DD8 A;  3S15 J;  4I7H A;  4S05 A;  4OIO F;  2AXL A;  2JA2 A;  2ETH A;  5K7Z A;  3TDZ C;  4FQG A;  2ZB9 A;  2EV0 A;  5ILV A;  2A6H F;  2IEK A;  2JN6 A;  1HST A;  3JSO A;  2CU7 A;  2CQN A;  3CF2 A;  5K5R A;  3HL2 A;  2F5V A;  3EET A;  3R4K A;  2NVY J;  1EH8 A;  1G3Y A;  4K2E A;  2EJR A;  2BVL A;  4BXX J;  4EGY A;  4WF2 A;  1YIT I;  1R4M B;  3CMM A;  4MEY F;  1QNT A;  4BGD A;  5DCM A;  2XB0 X;  5DM6 F;  4EM2 A;  3T8T A;  5LFA A;  3SJM A;  1YW7 A;  2XF7 A;  2JUC A;  2L7F P;  1QBJ A;  3DU5 A;  2XGC A;  4HF0 A;  2EFO A;  3WG7 H;  2L2O A;  1LEA A;  1B6A A;  1Z7L A;  1ZG1 A;  3AG1 H;  3A2K A;  2FX0 A;  2W1O A;  5F0H A;  3TKY A;  2HU9 A;  4CA0 A;  2R92 J;  1R5I D;  3TL4 X;  2IBD A;  2LP0 A;  4UUV A;  2ID3 A;  4OIR F;  1E2X A;  1PP7 U;  1J5Y A;  1DPR A;  3FZV A;  1JGG A;  1HLV A;  2YSR A;  3K70 C;  3HOW J;  5LRR A;  1IN8 A;  2L9V A;  1MDM A;  4M74 A;  1STZ A;  1T6S A;  1MSE C;  1OJL A;  2AO9 A;  1D0Y A;  2M7B A;  1FIP A;  1IAW A;  2H6C A;  2NXN B;  4KMU X;  1Z77 A;  3QPL A;  3RPU D;  5J4Y A;  1IXR C;  4YIR X;  3FDY A;  3DQV C;  2ELH A;  3J80 Z;  1BBY A;  1OR7 C;  1UEL B;  2ME0 A;  2VT2 A;  2EFP A;  3DKW A;  5DCF A;  5J3L A;  4Z2Y A;  3LA3 A;  3S2W A;  2GA1 A;  3OIQ A;  4BEH A;  4C9Y A;  2P7C B;  3ZCO A;  2V1D A;  4QWQ A;  2Z3Y A;  1VQ6 I;  2FJ1 A;  1HA8 A;  5HS8 A;  2VJ5 A;  2HQR A;  4FT8 A;  5IT9 Z;  1Z3X A;  3IH3 A;  5EGO A;  2V6E A;  4JX4 A;  3ZQH A;  2DBB A;  4W1U A;  1UZC A;  3BZ6 A;  4ITV A;  2M2E A;  4L9T A;  2R5Y A;  2VQC A;  2V9V A;  3FXQ A;  2K3P A;  3F21 A;  2KRF A;  1U3E M;  3WTZ A;  1T56 A;  4O3M A;  4YIF A;  3GZ6 A;  2RGV A;  1D5V A;  2PMZ N;  3HSR A;  3HGY A;  1GHC A;  4D7N A;  1VZ0 A;  3VOD A;  5GPC A;  3U21 A;  5ICC A;  1HW2 A;  1Z21 A;  2EWN A;  2HKO A;  4HX8 A;  1J59 A;  2V9P A;  3C18 A;  4LFU A;  2O8X A;  2LR8 A;  5D8K B;  1SAU A;  1BC8 C;  4IO9 F;  4KDP A;  1J0R A;  2FMY A;  1F36 A;  4Y15 A;  3RZD J;  1H8A C;  1FP1 D;  2GLO A;  1WRJ A;  1ETO A;  3I59 A;  5HLH A;  3P9C A;  4ZZL A;  3BCA A;  2JA7 J;  5FLX Z;  1P4A A;  4PJN A;  4LJZ F;  5DUI A;  2CV2 A;  1RC9 A;  3ZR8 X;  3DWL E;  4LG3 A;  5LGT A;  1UAA A;  2K9S A;  1JKQ C;  4MFD A;  4LG0 A;  3LAP A;  4JQF A;  2P5L C;  5JHF A;  4A3D J;  4LK1 F;  3WU1 B;  2A6E F;  3WOD F;  1MKM A;  2XGD A;  5E1X A;  1XCB A;  3GFL A;  3VSL A;  5KAF C;  2CW7 A;  2VKV A;  1GLN A;  1QZY A;  1LE8 B;  4C2T A;  1WQ2 A;  3HB9 A;  2GAU A;  4U7B A;  1ZRF A;  3CDI A;  1T95 A;  2JRT A;  1HKS A;  1RES A;  1XGO A;  2GA2 A;  2G9W A;  4Q47 A;  9ANT A;  1LNW A;  3KP6 A;  4G9Y A;  2RQQ A;  5HNH A;  3BR6 A;  2F4M B;  1X1C A;  4DW6 A;  5LHG A;  4PJJ A;  2XF5 A;  2DJI A;  2XRL A;  2FEZ A;  2HZD A;  3K2Z A;  1OCR H;  2DA1 A;  3F3X A;  1P4W A;  5HLT A;  3WE2 A;  4L0Z B;  4I0B A;  1LDJ A;  1Z3Y A;  3ZXS A;  1WH5 A;  4P1W A;  4ESJ A;  4KMF A;  2DTZ A;  3DKY A;  3JTH A;  1PVE A;  2HOA A;  2KZV A;  5BPI A;  3PO2 J;  2FNA A;  5A2Q K;  5L3C A;  2DN0 A;  2F5E A;  5GP9 A;  1Z67 A;  5L3F A;  2R7D A;  2OPT A;  1UG0 A;  5IP7 J;  3RKY A;  2H09 A;  3BR2 A;  3R61 A;  1XGN A;  4OOI A;  1JTX A;  1S9H A;  3A01 A;  1MJB A;  2DT5 A;  4IQJ A;  2KRH A;  2VL8 A;  2M5W A;  4XSX F;  2JTV A;  2VXD A;  4EM1 A;  2PEX A;  4HSR A;  2EZI A;  4HBL A;  2K9L A;  1SD5 A;  1ON1 A;  1S6L A;  1ULY A;  5CJ9 A;  4KIB A;  3IRQ A;  2RDP A;  2RVC A;  1JJ8 C;  4A5N A;  1ONV A;  2GXA A;  2O9L A;  3LSH A;  2LMD A;  4A69 C;  1LJ9 A;  4DZJ A;  1K78 A;  3G1M A;  5LLQ A;  3EQL F;  2IS2 A;  2GOX B;  3M8F A;  2ZJR F;  2ZXW H;  3TGN A;  2ZSI B;  1IN7 A;  2CW0 F;  4F55 A;  1UHS A;  1YW8 A;  2WV1 A;  4U88 A;  5F08 A;  3FBN B;  3KEQ A;  3OYC A;  4Y4R A;  4A3F J;  2E1O A;  3ZRG A;  1FYK A;  2ECB A;  3GVA A;  5ED4 A;  4RA2 A;  2WAD A;  1FP2 A;  4RLQ A;  5H2F C;  2LRE A;  2QBY A;  4IRG A;  3KLN A;  1YRN A;  5B3S H;  2E2H J;  2IGM A;  2WB1 N;  2KLO A;  2FNP A;  2JVG A;  2JRM A;  2NOG A;  5M5Y J;  4GO1 A;  1VF9 A;  3I56 I;  3E6M A;  2XRO A;  3G1O A;  3LSK A;  4C2M J;  3PQJ A;  5CYV A;  2TCT A;  5FRM A;  1JKR C;  1W0U A;  1B9M A;  1ZGJ A;  5DYM A;  2IP2 A;  2WAF A;  1TP4 A;  2PMZ A;  3QPH A;  4BDZ A;  1DGR M;  3CUO A;  3ABT A;  4WXC A;  5BPD A;  3I4M J;  2DFE A;  5HS9 A;  2G7U A;  4DNC A;  1ZQ3 P;  4BAY A;  2F4O B;  1BJA A;  4XKC A;  4I2O A;  2X85 A;  4NC8 A;  2JA6 J;  2M8G X;  3BT9 A;  1S7E A;  5DEQ A;  5LRS A;  2FQ4 A;  3F6O A;  3JRB A;  4DYQ A;  2X1E A;  4NHJ A;  4ZDO A;  2VT3 A;  1Y8Q B;  2O5R A;  1WGX A;  1ACI A;  1JUS A;  2DOA A;  4B44 A;  2OAZ A;  4BU2 A;  3LSG A;  1O3S A;  4G94 A;  3HYI A;  2BHZ A;  3TW7 A;  2IVM A;  2BVM A;  4WX9 A;  4U0Y A;  4XOR A;  2VI6 A;  3HTS B;  5LD2 C;  1QU3 A;  3LQR A;  2LBF B;  4A3C J;  4XOP A;  2X0L A;  3HDD A;  1GXP A;  1U6G A;  3H36 A;  2L7M P;  4BY7 J;  1WI3 A;  1OCT C;  2X1D A;  3W2A A;  3DU6 A;  4ZYE A;  1X4O A;  4KA4 A;  2DOD A;  4M3F A;  1B72 A;  1MMA A;  3OR2 C;  3E7L A;  3GTJ J;  2AHQ A;  3BTL A;  5LBQ A;  4XR6 A;  3VOE A;  2XUB A;  1BI0 A;  3F8F A;  2OF7 A;  2F4I A;  3GXO A;  3HG9 A;  4ZTJ A;  4A3L J;  2PG4 A;  1BIA A;  1VI0 A;  4P96 A;  3CTA A;  3M1E A;  4G8X A;  3CCJ I;  1R5G A;  5E79 C;  4XLE A;  2W24 A;  4XRF A;  1XMA A;  4X6A J;  3QAH A;  4NBQ A;  1T2K A;  4PSX A;  3CJN A;  3QOP A;  4YG2 F;  3F6V A;  4ENK A;  3UKG A;  2QM3 A;  1YOV B;  2EIL H;  4MNU A;  4I09 A;  3M1C A;  2DK5 A;  4JBA A;  3N97 A;  1ZAR A;  1J9I A;  1SFU A;  4D5F A;  1XB4 A;  5C3E J;  4JOM A;  3J7Y J;  4OIP F;  3D5S C;  3LFK A;  2EV5 A;  2XSJ C;  1ZGA A;  2DYS H;  2L7K A;  1S29 A;  3VFZ A;  3FXK A;  1JKP C;  2BY3 A;  1DPU A;  4GFB A;  5JHU A;  5K7F A;  3RQ4 A;  2EQR A;  5IP6 A;  1ZYR F;  2LD5 A;  2KT0 A;  1UB9 A;  1L0O C;  3F23 A;  5FLM J;  2K3F A;  1Z05 A;  4ZYA A;  5F1R A;  3RQI A;  2E2I J;  4EV0 A;  2RKH A;  2YPR A;  4B8X A;  4FIS A;  4JX5 A;  1O7L A;  4PGH A;  4CCL A;  2HFH A;  1I50 J;  3VYR B;  1GVJ A;  1JHH A;  3S3M A;  2JUG A;  2QQA A;  3V8K A;  2UV1 A;  4CYC A;  1X1B A;  4LB5 A;  5CVU A;  4HAM A;  4ZYG A;  5TRD A;  3OV8 A;  2M0C A;  4ZTF A;  5HLI A;  3DP7 A;  3U2R A;  5TJJ A;  3BG7 A;  3CCY A;  4HST A;  1WVR A;  2IS6 A;  1X1P A;  4NQW B;  4MFE A;  1ZLK A;  4B3X A;  1BW5 A;  4RDU A;  3IRR A;  4D7M A;  2EBI A;  3GME A;  3TOB A;  3CUQ B;  2VE8 A;  5J47 A;  2MW8 A;  2QSG X;  1IUY A;  1BC7 C;  4QLC U;  2IGO A;  4ZH4 F;  3DEE A;  1VQK I;  5CQG A;  3S14 J;  1B4A A;  3O3K A;  3Q3S A;  4IEJ A;  1BR2 A;  1JUP A;  4BHC A;  2KHM A;  5GTH C;  1X19 A;  4G12 A;  3B6A A;  3RKQ A;  2D45 A;  4WXD A;  1FLI A;  1A6I A;  3OWT A;  2YX7 A;  2LNB A;  4AYB N;  4RAY A;  3T8R A;  4Z6Y A;  5E18 F;  1QO0 D;  1IDZ A;  2Q0O A;  2VOO A;  3JSP A;  2L9R A;  1TNT A;  1ETW A;  2PFB A;  3S8P A;  4CCO A;  3M4O J;  1BR4 A;  3O2P E;  3KYD B;  1YS6 A;  4C3I J;  1ZLJ A;  3M8E A;  2V79 A;  1EF4 A;  2VBX A;  3O8H A;  4M3G A;  4EVI A;  5J8C A;  3OS1 A;  4BE0 A;  3J80 K;  1G2H A;  4FHT A;  1MMS A;  4GYG A;  3SZP A;  1P6R A;  5DM7 F;  2PX9 A;  5EF6 A;  2DJN A;  5ICG A;  3GTP J;  4BBS J;  1EH7 A;  2K9M A;  1KZH A;  3VDX A;  2KDO A;  2DDB A;  3OSG A;  1SFE A;  4G7H F;  1QPI A;  3MD2 A;  3HRS A;  1BA5 A;  5FKL A;  1Z0X A;  3BY6 A;  1R49 A;  4NC6 A;  2MAB A;  1XMX A;  4BEH B;  3BQY A;  1G3T A;  2QQ9 A;  3KYL A;  2MYS A;  2VE9 A;  5B1A H;  4I99 C;  3J7A Y;  2QUF A;  4PJL A;  2Q8K A;  2NVQ J;  2W57 A;  1MSF C;  1RRJ A;  3E5X A;  3V4G A;  2DO7 A;  5GAD J;  4N4O B;  4AVZ A;  5BOX A;  3TBI A;  4BHB A;  3E0J B;  1J75 A;  5F0F A;  5D5W B;  2K9Q A;  1UST A;  2BXY A;  4KIS A;  3ZP5 A;  1LE8 A;  4MTD A;  1U5T C;  3LAJ A;  5AIQ A;  3CP8 A;  4CDG A;  1FT9 A;  2OQR A;  1AOY A;  4LB6 B;  2KIU A;  3JRD A;  4HQM A;  4RGR A;  1F5T A;  1FIA A;  3EPZ A;  2L9N A;  3DFG A;  1LB2 A;  2VOP A;  1T33 A;  2L54 A;  2K5C A;  3DEU A;  4PCQ A;  3OYF A;  1NHA A;  3G4S I;  1FZP B;  2EV6 A;  3E3V A;  4KIG A;  3S1N J;  4YFX F;  2E7W A;  4XN3 A;  3GTO J;  1ORK A;  1HW1 A;  4RGU A;  1Z6R A;  4H0E A;  2CV0 A;  1SFK A;  5D5X B;  4HDU A;  2R0Q C;  2R7S A;  2V9K A;  2EB7 A;  6PAX A;  2VON A;  5GTI C;  1DQU A;  4XIC A;  1LFU P;  2DMT A;  2L3D A;  4ZYD A;  4F52 A;  3S2H J;  3W6V A;  2BHY A;  2PJR A;  5JLW A;  2F6C A;  2QKL B;  2X51 A;  1YJN I;  1A6Q A;  5GAH J;  5F1J A;  5ILU A;  1ETX A;  2HQA A;  2KP6 A;  3BG6 A;  4UVA A;  1VQ8 I;  5BS6 A;  3D0S A;  4M71 A;  3CCE I;  1HOM A;  2FOW A;  1UMQ A;  1YFH A;  3HHH A;  3S3O A;  3BP8 A;  2DI3 A;  2LYC A;  3CMY A;  1Z6T A;  2FSW A;  4Y3O A;  2CRG A;  3CDL A;  4KT6 A;  5J1R A;  1MGT A;  4LMY A;  2MSY A;  4ENM A;  3K4J A;  4MIM A;  3SFZ A;  3BC8 A;  4XLF A;  3HSF A;  2ESH A;  4U0W A;  2FU4 A;  3G73 A;  5EDN A;  4EGZ A;  1O57 A;  2IW5 A;  4XRS G;  1QHH D;  4XLC A;  2DMU A;  4OIQ F;  2A6T A;  1G3W A;  4HG2 A;  2Z2S B;  4MTE A;  2J5O A;  3WHB A;  4IHT A;  1FTZ A;  4MO7 A;  3HEF A;  3GTG J;  2R7V A;  3AAF A;  3I64 A;  1B8I A;  5CVJ A;  3OMY A;  3W2W A;  3RJP A;  3W6J B;  4A3I J;  2BBY A;  5CKT A;  2V1U A;  3Q9V A;  5L3G A;  3ABU A;  3ABM H;  2VN2 A;  5IY5 H;  3CC2 I;  5IP9 J;  2LKX A;  5DUK A;  3IHU A;  3K1M A;  4CIC A;  2JZY A;  3FXU A;  4YFN F;  4HRI A;  3WTU C;  4M72 A;  2VBW A;  3I4P A;  2BY0 A;  3BQZ A;  4B48 A;  4LLN A;  1K78 B;  1B8I B;  1O3T A;  1HBX G;  2GXB A;  2BY1 A;  3PUB A;  3NWS A;  4HQE A;  4GDF A;  1D1A A;  2X6X A;  1FMW A;  3NWT A;  4U7D A;  4MLO A;  2BGC A;  5FRO A;  3BJA A;  3ERM A;  1CF7 B;  3I59 B;  1SMY F;  1D5Y A;  2H8W A;  5F04 A;  4KUM A;  1QZZ A;  5F6F A;  2CYY A;  2Y69 H;  5EJC A;  3RPQ A;  1PUF A;  2XHK A;  2JA8 J;  2RV8 A;  1YRN B;  4FTH A;  1H0M A;  3HSE A;  3GTL J;  3JRF A;  1TLH B;  2LVS A;  4XM3 A;  5LHI A;  2NVT J;  1XCV A;  2JK3 A;  1RI7 A;  1R4N B;  3PQK A;  1YG2 A;  4UVB A;  2FBK A;  1SFX A;  2HYJ A;  1LEB A;  2LY1 A;  4IQ4 A;  3SFI A;  3C2G A;  4PGG A;  1ZH5 A;  3L2Q A;  2R7O A;  2E71 A;  1W7P D;  1PJR A;  3V42 A;  5D4S A;  1RET A;  1ZG5 A;  2E34 A;  3CQZ J;  1RZ4 A;  1QPM A;  3CJQ B;  1WSU A;  2HQ5 A;  3FXL A;  1D0X A;  5C4X J;  1MJA A;  4A3M J;  2K85 A;  3K1N A;  5F0C A;  3OYG A;  2M4K A;  4EEF G;  1P2F A;  3J81 K;  4M73 A;  1OQY A;  3PM1 A;  4BQN A;  5LHH A;  5JVG F;  3S2D J;  2WBM A;  3W3C A;  4F7Z A;  3H35 A;  2ACJ A;  3U1K A;  3TQN A;  5D5V B;  1X4P A;  3M8J A;  1JHF A;  4II3 A;  3DBR B;  1U8B A;  5DTD A;  1MBE A;  2HVR A;  2BXZ A;  1ZK8 A;  2HXO A;  2KJB A;  1SFO J;  2K9N A;  2H94 A;  2X6W A;  3LST A;  3ABK H;  3CUQ C;  3L00 A;  3OIP A;  4IRH A;  1FNN A;  3ZMD A;  2FBI A;  3MEX A;  4KT5 C;  2ISZ A;  2TDX A;  3BTJ A;  4E7Z A;  1XGM A;  3N05 A;  5EEH A;  5C4J J;  5LGN A;  2M4G A;  4EMS A;  1PUE E;  2WAQ N;  2QKM B;  2E5Z A;  1R1U A;  2EFQ A;  2VBY A;  5JFR A;  1EKE A;  1Y1V J;  3KP7 A;  2GQQ A;  1W36 D;  5F27 A;  1SVL A;  1I3A A;  2L7Z A;  1K4S A;  3CD6 I;  2HGC A;  2JPB A;  1S3J A;  3S32 A;  3VB2 A;  4Q48 A;  3BOQ A;  2JWT A;  2M3A A;  3H3U A;  4U87 A;  1RUN A;  2Q2E B;  1JKO C;  4RMN A;  2E1N A;  2E2J J;  1KU3 A;  4L5J A;  2BE5 F;  1VQ7 I;  2V7F A;  5FJ8 J;  3P9K A;  2KIQ A;  1WJ5 A;  4M3D A;  4Q4Z F;  2KDZ A;  4E7I A;  1K6O A;  2MLG A;  1LQ1 A;  3A03 A;  3E5U A;  3GF2 A;  3MAJ A;  5K1Y A;  4ANJ A;  1NH3 A;  2KIM A;  2OBP A;  3IV5 A;  2DA5 A;  2XAQ A;  1TWA J;  2LOO A;  2O3F A;  1ENH A;  2HNH A;  3H5A A;  5JI6 A;  5KHD A;  4AUX A;  2Y9Z A;  1J2X A;  3RTR A;  3HPG A;  3COA C;  3A02 A;  3BJ6 A;  3M9A A;  1BR1 A;  1JT0 A;  2ESN A;  3HOY J;  1AHD P;  4M9X A;  1VFC A;  5GAG J;  1VQN I;  3S1M J;  4EJU A;  3IL2 A;  1N78 A;  2E19 A;  2F48 A;  3K4L A;  3TP3 A;  1WI9 A;  4A6E A;  2Y0S N;  4BQQ A;  3QOE A;  1IJW C;  1Z9C A;  3BLY A;  4BE2 A;  3CLQ A;  3H5N A;  3WG9 A;  3MMY B;  1RKW A;  3FXR A;  2ECC A;  2CQX A;  1EV7 A;  4XLH A;  2M87 A;  3HRM A;  1Q1H A;  4QTR A;  2G0E A;  3CCL I;  4P9F A;  3G71 I;  4DQ2 A;  3L1P A;  1ZRD A;  2JPC A;  1AWC A;  3JRH A;  2QQ8 A;  1SC7 A;  2OD5 A;  1ZTR A;  2R4G A;  4NC7 A;  3SDB A;  3JRG A;  1LUJ B;  2HTJ A;  1NG7 A;  3HC7 A;  3WTY C;  2ZME C;  1D0Z A;  4A0Z A;  1IV6 A;  2ELK A;  2AQF A;  3RZO J;  3S93 A;  2Y30 A;  4M6V A;  4IHS A;  2D1V A;  4ESF A;  1U8R A;  2VB6 A;  4YII A;  2HVS A;  3FKJ A;  2XVC A;  2PJP A;  3H9Q A;  5M5W J;  2E35 A;  3G6E I;  1P7J A;  1MJ9 A;  1U9O A;  2IA1 A;  1B72 B;  3JTG A;  1QZE A;  3EUH C;  4OMZ A;  1IZ1 A;  3WTT C;  4IZZ A;  4E4H A;  2QLZ A;  3K4K A;  5K5O A;  4IHW A;  1LDD A;  3MKZ A;  2EZL A;  3KCC A;  2LLK A;  4F92 B;  2R5Z B;  4GCV A;  1RR7 A;  2VAS A;  2GOM A;  5J1Y A;  1OCO H;  3RCO A;  4QSH A;  3VYT B;  4AM3 A;  3CCV I;  1LVK A;  3CF5 F;  4B4C A;  3MKW B;  2RN7 A;  2ICW G;  2MFZ A;  1KA8 A;  3LNQ A;  1TWG J;  1HC8 A;  2H1L A;  2R7U A;  2KIS A;  4ZZD A;  5ICF A;  1V4R A;  2B63 J;  1OYI A;  2BOL A;  2Y48 A;  3WGG A;  2PN6 A;  3L2W A;  4I6Z A;  4BNC A;  1MNE A;  3H9G A;  4CZC A;  2CUJ A;  5L3B A;  4CHU A;  4DBQ A;  3I4N J;  4BQA A;  1YQA A;  3AFH A;  2MC3 A;  5KAI C;  1BJZ A;  1E3P A;  5D5U B;  3SXY A;  3LSM A;  1X3W B;  3Q0V A;  3E6B A;  3F8N A;  4FX0 A;  2MG4 A;  3OYD A;  2UXN A;  2ZKZ A;  1FBS A;  1R1V A;  1WPK A;  2GIZ A;  3DPT A;  1K4T A;  4F91 B;  1NTC A;  2BY2 A;  3HIF A;  5FD6 A;  3OYH A;  2O6G E;  2QA4 I;  2O8K A;  2ZME B;  3GFM A;  4LOC A;  3DPL C;  1W36 C;  3ASN H;  5CPR B;  1BIB A;  2JVH A;  2OZU A;  4LIV A;  3VEP A;  1SAN A;  3GLX A;  4KIC A;  4D0P A;  4CUG A;  1X58 A;  2VQL A;  1FYM A;  4UY8 I;  2K40 A;  2QBY B;  4HV5 A;  3CLO A;  2V4J C;  2HVQ A;  1AU7 A;  1YJ9 I;  3I53 A;  1MH3 A;  3IKT A;  1TWC J;  1IO2 A;  1XD7 A;  2A68 F;  1S7A A;  2OJE D;  1S5L C;  4Y33 A;  1FOY A;  4R1H A;  2IPQ X;  3OR1 C;  1WZ2 A;  3CCU I;  4PSW A;  1IN5 A;  4BQO A;  3PSI A;  1DP3 A;  3ZGK A;  1ZGW A;  1Y0N A;  1BI1 A;  4G6D A;  2E7X A;  1OCP A;  2LG4 A;  3BPX A;  5IPA A;  2OU2 A;  2ZJQ F;  3QYE A;  1ERD A;  1QRY A;  2DOE A;  2YUS A;  2YX4 A;  3I54 A;  3K70 D;  1K7A A;  2GWR A;  2V6C A;  2DLL A;  4BJ6 C;  4F93 B;  2DFI A;  1Y1W J;  4P55 A;  3CCM I;  1IV8 A;  2EA4 A;  3AKZ A;  1XN7 A;  3Q0U A;  5L3D A;  1WJB A;  1I5Z A;  4X0G A;  2X1C A;  2DQL A;  3ZMS A;  1W5S A;  2EIK H;  3H92 A;  4X1E A;  5EEA A;  4J00 A;  3MWM A;  1HDD C;  1TWH J;  3C2B A;  3AL0 B;  1M1E B;  4PUS A;  4RGS A;  3ASO H;  4XON A;  1B1B A;  3TO7 A;  1N25 A;  1XDS A;  3W6K B;  4UB6 C;  3RI4 A;  1KYZ A;  2MGQ A;  1A35 A;  2P0W A;  4O5V A;  4HPQ A;  4JX6 A;  2EZK A;  1X3Z B;  3OOU A;  1FPQ A;  4M3E A;  3HHG A;  3OIO A;  3MKY B;  3DLL F;  5GPA A;  1IW7 F;  1LKX A;  4GXO A;  5KCM A;  5IOZ A;  3O6B B;  3M07 A;  4ETS A;  1XMK A;  3H9J A;  3BTI A;  2HOE A;  2V26 A;  2HEO A;  4Y52 J;  1HKT A;  2JMW A;  1I1S A;  1VQ4 I;  1F4K A;  1J7K A;  1SD7 A;  4CCM A;  2CMP A;  3CDH A;  3DCF A;  5E3M A;  4QPO A;  2YU3 A;  1R22 A;  3HUG B;  4A2U A;  4RB2 C;  1IGN A;  4WWC A;  1B9N A;  4UV8 A;  3HPH A;  2LY2 A;  5J40 A;  3OYI A;  3A0B C;  3DV8 A;  4AIH A;  5EG0 A;  2J5P A;  2M0M A;  1ZRE A;  4BH9 A;  1RKT A;  4RB0 A;  4ZDP A;  3HM5 A;  1FJL A;  1R23 A;  3Q0W A;  3VPR A;  4HNT A;  4CZZ A;  2HR3 A;  1NK3 P;  4HEA 2;  5EZG A;  3BR3 A;  4RB1 A;  4J19 A;  1JI8 A;  4IXA A;  4GRI A;  3JCU C;  4RM3 A;  2XPW A;  1TBX A;  1FC3 A;  2L4M A;  4YEJ A;  4ZDL A;  1E17 A;  2VIX A;  2X4H A;  4WXH A;  3EYI A;  4N9I A;  3ZQL A;  4XK4 A;  2VJ4 A;  4DYR A;  2ZJP F;  2ZME A;  3ZMZ A;  2Y0S A;  3QP6 A;  4EJT A;  2WV0 A;  1BW6 A;  2HWV A;  1W5C C;  2W25 A;  3I58 A;  2R7W A;  2D5V A;  1XTA A;  3RSN A;  1QGP A;  4MGR A;  2R7Q A;  3GX4 X;  1ZKG A;  4HYE A;  4OIN F;  1ZEL A;  3HRT A;  3TOA A;  3H3Z A;  2LDU A;  3SQN A;  2ZC2 A;  2P5V A;  1UCR A;  1QHG A;  5J6X A;  2XGE A;  1T98 A;  3K4C A;  2NOJ B;  4II2 A;  4OWR B;  4DGW B;  3JW4 A;  2FXA A;  3FHZ A;  2VQH A;  1RUO A;  2CW8 A;  3ZQF A;  1W7P B;  1YLF A;  3TO6 A;  2L0K A;  5FKK A;  3BZK A;  3P7N A;  3ZMU A;  2FRH A;  2M34 A;  3KE2 A;  4QIW N;  3GEZ A;  2XAG A;  4KN4 X;  3PIP F;  1KQ9 A;  3WHC A;  2QEX I;  1IRF A;  1MBG A;  4RGX A;  1DP7 P;  2Z1D A;  3DLA A;  3FKI J;  3IWZ A;  1GV2 A;  2DA4 A;  3H0D A;  1MDM B;  4JK1 X;  1OIS A;  5E8I A;  3K4B A;  4C3H J;  4XKV A;  1EA3 A;  2NAZ A;  3T1B A;  2DFH A;  3C2H A;  1A31 A;  3KP2 A;  2AS5 F;  2XKP A;  4N4N B;  1IXC A;  1X2N A;  5HDN A;  4I01 A;  2LTP A;  3FXM A;  3HKZ A;  3CC4 I;  3MKL A;  2WY7 Q;  3GTK J;  2XB5 A;  1OMI A;  4L9V A;  4RAG A;  2ADU A;  3GCM A;  3T5X A;  3B6C A;  4BY1 J;  3OYE A;  1BI3 A;  4NQW A;  3CP2 A;  4UUT A;  3V8L A;  2K7L A;  1ZR2 A;  2HZT A;  1SMT A;  1G6N A;  3F9K A;  2F5C A;  2NRA C;  1HCR A;  4V19 K;  3HRU A;  1X1D A;  5DDG A;  3NRV A;  2O7O A;  3LQQ A;  1REP C;  4Y7N J;  4W97 A;  4HF1 A;  2CUF A;  1R7J A;  2EIJ H;  3K1P A;  2ZNY A;  2PBI A;  5DD4 A;  4NNJ A;  3ZOB A;  3REO A;  2W4S A;  2XIG A;  4BAC A;  2VC0 A;  1Y0U A;  3SEZ A;  2A07 F;  4KJZ A;  2ZSH B;  3K6G A;  3ZQ7 A;  4PZJ A;  2QYO A;  1PP8 F;  1WCM J;  4BE1 A;  1T0F A;  2FUG 2;  4C30 A;  3SEQ A;  5HOO A;  3FWE A;  2LK2 A;  5IYB J;  5FB2 A;  3DTI A;  1G59 A;  4LD5 A;  5FGM A;  5EZH A;  2DPU A;  4U0V A;  4AIJ A;  5D6E A;  2YR2 A;  2QVO A;  1V5F A;  2D2W A;  1VND A;  3I71 A;  1H9G A;  3KYC B;  1JUM A;  3G3Z A;  2XAS A;  5HLG A;  2NS0 A;  2BW3 B;  2PQ8 A;  2X48 A;  1PUF B;  4N9H A;  4ENJ A;  1FTT A;  3HZJ A;  2QSH X;  5TIS C;  3PSF A;  2OA4 A;  3BG3 A;  1RPW A;  1YI2 I;  5B1B H;  1EJ9 A;  3PJR A;  1YIO A;  3V7S A;  3J81 Z;  1YIJ I;  4I98 B;  1LDK B;  2ISY A;  3R0J A;  3LA7 A;  4ZYH A;  4C2U A;  2XC7 A;  2CQ7 A;  1CF7 A;  2HDD A;  3PNY A;  3K9T A;  3K69 A;  4WCG A;  2WWY A;  1QA6 A;  2I5U A;  3ROU A;  3CCQ I;  1BI2 A;  1BL0 A;  4CO8 A;  3DKX A;  2Z16 A;  4CYD A;  1K6Y A;  3MQ0 A;  3QWL A;  4EJV A;  2DXI A;  1BM9 A;  5D4R A;  3GYH X;  2AXT C;  5E8G A;  4KYW A;  4C3J J;  1UFM A;  5CLS A;  5ICE A;  2V1N A;  1MBF A;  3OY9 A;  1CQT A;  1JJ6 C;  3KIO A;  4ABZ A;  1KU2 A;  3S16 J;  4HOB A;  2VPR A;  3IUO A;  1V3F A;  1TNS A;  1I3Q J;  4IX7 A;  4HF2 A;  1X2M A;  2DK8 A;  3GBG A;  4A3K J;  2H27 A;  4XN0 A;  2H1K A;  3AG4 H;  1DU0 A;  1P7I A;  4S0H B;  2I8D A;  3E6C C;  2R3S A;  3OL4 A;  4V2G A;  3QU6 A;  3ERE D;  3L7W A;  2QCO A;  1YO5 C;  3CMA I;  2K4B A;  4B43 A;  4HDV A;  3FK6 A;  4UNO A;  5E17 F;  1XSD A;  2WY8 Q;  3QP5 A;  4B1R A;  1X1A A;  4EM0 B;  1V54 H;  4GGG A;  4A6D A;  2CQK A;  1KU9 A;  2PI0 A;  1OLT A;  2NS8 A;  4F3Q A;  2Z33 A;  2BW3 A;  2EIN H;  1KGS A;  5CVI A;  1KU7 A;  4MEX F;  1WKM A;  4XMY A;  2HOS A;  4CH7 A;  2QWW A;  2NVX J;  3MZ8 A;  2E1M C;  1ETY A;  2FD5 A;  2JQ7 A;  4UV9 A;  2VJJ A;  1V55 H;  2QSF X;  1JGS A;  1FOX A;  3ZQG A;  1MMD A;  2ZXH A;  3BZC A;  1QVU A;  2KKO A;  1OYW A;  3U9G A;  5F64 A;  1I39 A;  2PMU A;  4OMY A;  2W48 A;  2LKP A;  3R60 A;  3CCS I;  2R7T A;  4HNU A;  4OU0 A;  1XSV A;  3JRC A;  3H5R A;  2HS5 A;  2L02 A;  2WAQ A;  4PFO A;  2DAO A;  2DA6 A;  2KJC A;  3SDG A;  2JSC A;  3RPU A;  4KIF A;  5FKM A;  2LH9 A;  1FBU A;  4PK4 A;  1T39 A;  1FY7 A;  2O03 A;  2JT1 A;  2NYX A;  4XBF A;  2PLY A;  3SZG A;  2XGX A;  4QPQ A;  3A0H C;  4E7S A;  2F5D A;  2EFW A;  4B09 A;  2KQR A;  1E3O C;  2NS7 A;  3GFJ A;  1ITY A;  3DF8 A;  1SD4 A;  2E1C A;  4D1Q A;  5M3F J;  2DMP A;  3C7J A;  2MD5 A;  2CFO A;  3QPS A;  1FEX A;  2KIF A;  3PL8 A;  2UXX A;  3F8C A;  2IA0 A;  1DDN A;  4NDL A;  3P9I A;  1VQL I;  1G4D A;  2A61 A;  2DMN A;  2OC6 A;  4H4K C;  5KVR A;  4EJO A;  3L2V A;  2LY9 A;  3ULQ B;  4L18 B;  2F2E A;  4BXF A;  4BS9 A;  1AKH B;  1Z7U A;  3CO7 C;  3S3N A;  3ZMV A;  1ZAO A;  2IRF G;  4KN7 X;  3L2U A;  2R5Z A;  4UHT A;  4I0A A;  4DOZ A;  3J7A O;  1R9T J;  5J4V A;  2WA0 A;  2IGK A;  3K4M A;  3L09 A;  4R79 A;  2KPM A;  4BYY A;  3CME I;  2DMQ A;  1GT0 C;  1B59 A;  5DS9 A;  1AKH A;  3W2V A;  1OPC A;  1LPQ A;  2HPM A;  3F72 A;  1P9Q C;  1L3L A;  2W00 A;  3AG2 H;  5JR3 A;  3V8J A;  2IS1 A;  1TTY A;  2VLA A;  3HOV J;  5JVT A;  2OTL I;  2MD0 A;  5K5Q A;  1TQM A;  2GBY A;  4PJM A;  3JRI A;  4ZC3 A;  4E7L A;  2K27 A;  2KRC A;  5E3L A;  1HQC A;  1MZB A;  2XAJ A;  3OYA A;  4XLA A;  4YFK F;  4OAY A;  3EUA A;  3DPU A;  4XNF A;  4XRM A;  2GXG A;  2N8G A;  3ELK A;  2HXI A;  1K61 A;  3QQA A;  3JR9 A;  3CO6 C;  2W85 A;  2MA3 A;  3IC7 A;  1NK2 P;  5ERI A;  2HTS A;  1AA7 A;  5FFX A;  3GLL A;  4L5I A;  4XL9 A;  3WGH A;  4LK0 F;  3P5J A;  5BMZ A;  4D5C A;  5BQT A;  3LSR A;  3Q9S A;  4CXF A;  2ME6 A;  1IRZ A;  1TQP A;  1VTN C;  3DTE A;  3I3L A;  2ZXI A;  3WU2 C;  1HF0 A;  3SZT A;  2GM4 A;  3GZN B;  1YW9 A;  2Q2E A;  3LA2 A;  1MBJ A;  4I02 A;  2ZFU A;  3D5L A;  1KYW A;  4XID A;  4L9N A;  4DJA A;  3NQO A;  3QYB A;  3ZQQ A;  4PFP A;  2MLK A;  3L9F A;  4AU7 A;  3JAM K;  2K86 A;  2UUZ A;  3WTW C;  2HPI A;  3MCZ A;  5BNG A;  1UJ8 A;  3PIO F;  5HDK A;  4KIT B;  4XOT A;  1ZHF A;  3RKX A;  4ESB A;  3HGG A;  3ONQ A;  2E60 A;  2R7X A;  1UHW A;  1OFC X; 
#chains in the Genus database with same CATH homology
 3ZGK A;  1WJF A;  2VXZ A;  3OWT A;  1PYV A;  4NUB A;  2LG4 A;  3PNT A;  1Y56 A;  2HDW A;  3OL3 A;  1MND A;  2Q1Z B;  3QYE A;  1ERD A;  3K70 D;  2OUM A;  2VJI A;  3S8P A;  4BJ6 C;  4CCO A;  4F93 B;  1BR4 A;  3AKZ A;  3SYT A;  4E6K G;  1MMG A;  1WJB A;  3OS1 A;  3AL0 C;  4BE0 A;  4BJ5 C;  4X0G A;  2X1C A;  2XAU A;  1NG6 A;  4J00 A;  2K9M A;  3VDX A;  3VWB A;  3AL0 B;  4PUS A;  2KDO A;  4XON A;  3MD2 A;  2MAB A;  2P0W A;  4BEH B;  1Y6I A;  4HPQ A;  2DT7 B;  3KYL A;  2MYS A;  2JA2 A;  3OOU A;  3J7A Y;  4PJL A;  3MKY B;  2PJR B;  3DTK A;  1LKX A;  2CS3 A;  5KCM A;  3CF2 A;  4N4O B;  4AVZ A;  3TBI A;  3E0J B;  3HL2 A;  2F5V A;  3H9J A;  2V26 A;  4LIT A;  2BVL A;  4KIS A;  5HVQ C;  3CP8 A;  3LL7 A;  4CCM A;  3OYK A;  2CMP A;  4QPO A;  3HUG B;  3CMM A;  2A5W A;  4BGD A;  3EPZ A;  2L9N A;  4P5O A;  2CV1 A;  1MW7 A;  2LY2 A;  3HPH A;  5LFA A;  2K5C A;  2XF7 A;  4J01 A;  3DU5 A;  3OYI A;  3OYF A;  2L2O A;  2M0M A;  1Z7L A;  3A2K A;  4AYB A;  2W1O A;  4ZDP A;  4XN3 A;  2HU9 A;  3FHN A;  4CA0 A;  3TL4 X;  2VQG A;  1TZL A;  3QYF A;  4HNT A;  4HEA 2;  2CV0 A;  1SFK A;  1JI8 A;  2R7S A;  2V9K A;  4GRI A;  1DQU A;  4RM3 A;  3K70 C;  4YEJ A;  4ZDL A;  1N75 A;  2R7R A;  2VIX A;  4F52 A;  3VYS B;  1D0Y A;  2IXS A;  2VJ4 A;  2M7B A;  2PJR A;  2F6C A;  2QKL B;  2Y0S A;  3RPU D;  2X51 A;  3FDY A;  3DQV C;  2HQA A;  4FAS D;  2KP6 A;  3BG6 A;  1OR7 C;  3VSK A;  1UEL B;  2R7W A;  3RSN A;  2R7Q A;  2LC2 A;  4C9Y A;  3OIQ A;  4BEH A;  1ZEL A;  3ZCO A;  3IAS 2;  1WJE A;  3S3O A;  2LYC A;  1HA8 A;  4Y3O A;  4KT6 A;  2VJ5 A;  4BUP A;  1QHG A;  1Z3X A;  2V6E A;  3K4C A;  1D1C A;  3K4J A;  2NOJ B;  4II2 A;  4OWR B;  4DGW B;  3IAM 2;  3BC8 A;  4XLF A;  2VQH A;  4ITV A;  3CJR B;  3D5R C;  2LBF A;  2CW8 A;  1YX3 A;  2VQC A;  3CES A;  2X6Y A;  1QHH D;  2K3P A;  4XLC A;  2A6T A;  4HG2 A;  2Z2S B;  1VZ0 A;  2R7V A;  3U21 A;  2LRD A;  1Z21 A;  4DBR A;  4D9J A;  3OMY A;  2WB1 A;  2Z1D A;  3UR3 C;  3W2W A;  2W7N A;  3DLA A;  3K4N A;  1TT0 A;  3H0D A;  5CKT A;  1SAU A;  1YX5 A;  3K4B A;  4XKV A;  1EA3 A;  3C2H A;  3BCA A;  4N4N B;  4PJN A;  3HKZ A;  2CV2 A;  2WY7 Q;  3ZR8 X;  3DWL E;  3I9V 2;  4HRI A;  4LG3 A;  4CSW A;  1UAA A;  4B48 A;  3OYE A;  4JQF A;  3CZ6 A;  5JHF A;  3CP2 A;  3F9K A;  3PUB A;  3NWS A;  1D1A A;  1X1D A;  2X6X A;  1FMW A;  3NWT A;  4MLO A;  3VSL A;  5FRO A;  2CW7 A;  1GLN A;  4C2T A;  4B47 A;  4U7B A;  1R6R A;  1T95 A;  4NNJ A;  2L5Q A;  2W4S A;  4BAC A;  2ELJ A;  3SEZ A;  2RQQ A;  5HNH A;  3OYL A;  4KJZ A;  2ZSH B;  3K6G A;  3K10 A;  4XM3 A;  1X1C A;  4PJJ A;  2XF5 A;  2DJI A;  2HZD A;  4RLF A;  4BE1 A;  2LY1 A;  2FUG 2;  3LMM A;  3C2G A;  4IQ4 A;  4C30 A;  3SEQ A;  5HLT A;  5HOO A;  3L2Q A;  3DTI A;  2R7O A;  1G59 A;  1Z3Y A;  1DP3 A;  3ZXS A;  1PJR A;  2E5N A;  3V42 A;  4P1W A;  2IGN A;  2XDV A;  3LSI A;  3OYJ A;  3DKY A;  3CJQ B;  2KZV A;  3UNG C;  4XKW A;  1D0X A;  3TMO A;  1V5F A;  2OV7 A;  4RM2 A;  3E1S A;  5TGT A;  3KEY A;  3OYG A;  2M4K A;  1MMN A;  3PNV A;  2MC4 A;  2JSP A;  1UG0 A;  2BW3 B;  4BQN A;  2WBM A;  3W3C A;  3H35 A;  1S9H A;  4OAZ A;  2RRE A;  4IQJ A;  1X4P A;  2KRH A;  2VL8 A;  3M8J A;  4IKF A;  3PSF A;  4II3 A;  3L2R A;  3PJR A;  2VXD A;  4HSR A;  1N77 A;  2KL4 A;  2K9L A;  1LDK B;  2HVR A;  4C2U A;  2XC7 A;  5HNF A;  2VPL A;  2X6W A;  3LSH A;  3PNY A;  3OIP A;  2IS2 A;  2GOX B;  4E7Z A;  3N05 A;  2ZSI B;  4F55 A;  2M4G A;  3FBN B;  3DKX A;  3OYC A;  4LIU A;  1DGW Y;  2Z16 A;  4Y4R A;  3OS2 A;  3ZRG A;  4XQF A;  1K6Y A;  2QKM B;  3FBI B;  2E5Z A;  2DXI A;  4BJT A;  2WAD A;  1W36 D;  4RLQ A;  2V1N A;  3VYU B;  2LRE A;  3IP4 B;  3S32 A;  3OY9 A;  2CH0 A;  2IGM A;  2KLO A;  2M3A A;  3IUO A;  2JVG A;  3PFY A;  4U87 A;  4IX7 A;  3GBG A;  2Q2E B;  4XN0 A;  3LSK A;  4RMN A;  5FRM A;  2I8D A;  2V7F A;  3OL4 A;  4E7I A;  1WJ5 A;  2WAF A;  4G6T B;  4CCN A;  4B43 A;  4BL0 B;  2PMZ A;  4BDZ A;  5FRN A;  1DGR M;  2WY8 Q;  2AQE A;  2E1M B;  4ANJ A;  1X1A A;  4E7H A;  1IRX A;  2LOO A;  1OLT A;  4XKC A;  4F3Q A;  2X85 A;  2HNH A;  3BCB A;  2BW3 A;  4NC8 A;  3H5A A;  1J09 A;  5KHD A;  4XMY A;  4CH7 A;  2XF6 A;  3RTR A;  2E1M C;  3HPG A;  1WJD A;  2X1E A;  1KON A;  1V5G A;  1BR1 A;  4ZDO A;  1YE9 A;  2O5R A;  2VKD A;  2VJJ A;  2DOA A;  4B44 A;  4BU2 A;  3LSG A;  1MMD A;  1N78 A;  3K4L A;  2ZXH A;  2BVM A;  4BQQ A;  3QOE A;  4XOR A;  3BLY A;  5LD2 C;  1QU3 A;  4BE2 A;  3H5N A;  3MMY B;  2LBF B;  1U0J A;  2R7T A;  4XOP A;  3G2B A;  4XLH A;  4HNU A;  2UWM A;  3A4C A;  2R7X A;  3H5R A;  2WAQ A;  4PFO A;  2X1D A;  4CCK A;  2LH9 A;  3DU6 A;  4PK4 A;  3W2A A;  1X4O A;  4YEL A;  1T0F C;  3SZG A;  4QPQ A;  4E7S A;  1MMA A;  2R4G A;  3OR2 C;  2KQR A;  4NC7 A;  3SDB A;  2KMU A;  3HC7 A;  1NG7 A;  1G8X A;  1BOB A;  4D1Q A;  4XR6 A;  1D0Z A;  2IS4 A;  2CFO A;  4CCJ A;  2RNG A;  2AQF A;  2F4I A;  3PL8 A;  4E7K A;  3HG9 A;  4ZTJ A;  3S93 A;  1FMV A;  4XKB A;  2CUZ A;  2VB6 A;  2HVS A;  2OC6 A;  4H4K C;  4EAT A;  3HXL A;  3FKJ A;  3L2V A;  2M7A A;  4XLE A;  4BXF A;  4BS9 A;  3H9Q A;  3S3N A;  4PSX A;  3OYB A;  3L2U A;  1WFX A;  4DOZ A;  5KNL A;  3OYN A;  2WA0 A;  2IGK A;  3K4M A;  3EUH C;  2W82 A;  4R79 A;  2KPM A;  2L9S A;  3M1C A;  1V5E A;  4PSW A;  4IZZ A;  4E4H A;  2DT6 A;  3K4K A;  3MKZ A;  3W2V A;  2HPM A;  4F92 B;  4JOM A;  2VAS A;  2GOM A;  1P9Q C;  3RCO A;  3D5S C;  3VYT B;  2XSJ C;  2W00 A;  1LVK A;  3MKW B;  2L7K A;  2IS1 A;  2VLA A;  3A1Y A;  2MFZ A;  2MD0 A;  1WJA A;  4PJM A;  4ZC3 A;  1WJC A;  3HOS A;  5CQE A;  4E7L A;  2R7U A;  2KRC A;  3RQ4 A;  3EUK L;  3OYA A;  4XLA A;  4OAY A;  3EUA A;  3OYM A;  2BOL A;  3DPU A;  4XNF A;  3L2W A;  4ZYA A;  1MNE A;  2DCE A;  3H9G A;  4CZC A;  4DIQ A;  2CUJ A;  4FET A;  4DBQ A;  2VKH A;  4BDY A;  4E7J A;  3AFH A;  4CCL A;  3LSM A;  3VYR B;  3S3M A;  2JUG A;  1AA7 A;  3OYD A;  2UV1 A;  1X1B A;  4XL9 A;  3KX2 A;  3OS0 A;  1E0E A;  4ZTF A;  3DPT A;  4F91 B;  3OYH A;  3BG7 A;  4YRV A;  3DTE A;  3I3L A;  2ZXI A;  3QOD A;  3HOT A;  4HST A;  3DPL C;  1W36 C;  2IS6 A;  5CPR B;  2JVH A;  3LFU A;  4LIV A;  4NQW B;  2ZFU A;  4ZJZ A;  3D5L A;  1LFP A;  4B3X A;  4CUG A;  1D1B A;  2WAE A;  2VQL A;  4DJA A;  3QYB A;  3ZQQ A;  2V4J C;  2HVQ A;  4PFP A;  4AU7 A;  2UUZ A;  2HPI A;  2IGO A;  3DEE A;  5CQG A;  4KIT B;  4XOT A;  4Y33 A;  1BR2 A;  3OR1 C;  3ONQ A;  2KHM A;  2E60 A;  1X19 A;  4BQO A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...