4IZZA

Crystal structure of fischerella transcription factor hetr complexed with 21mer dna target
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 83
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA02
4J00A 4J01A 3QODA 4YRVA 3QOEA 4IZZA 4HRIA
chains in the Genus database with same CATH superfamily
3M8FA 2KIUA 3A4CA 4CICA 3R60A 1K78B 1V54H 1Y1WJ 2O3FA 3ABLH 3M7GA 3PNTA 1STZA 1DUXC 1FJLA 3HDDA 5F08A 3GX4X 4F52A 3G71I 2QWWA 1SVLA 5FKOA 3CF5F 2CJJA 3JREA 2GA1A 2HKOA 3HHGA 2XC7A 1FMVA 1FOYA 3FISA 4M3BA 2LKPA 2L5QA 1Z6TA 1UMQA 4GGGA 4DOZA 2EFOA 3D5LA 2LTPA 1ZRFA 1TC3C 1WZ2A 5F1JA 3ZCOA 2IA0A 5L3EA 2V1UA 2AXLA 3FK6A 1IZ1A 1E3HA 3K0LA 3U1DA 5J4VA 3S2HJ 2L01A 1BI0A 2ID3A 1Z6RA 1T39A 2K4BA 2MC3A 2RGVA 3E0JB 4CZCA 1KONA 3HOUJ 4M9SA 1G3SA 1OYYA 3CO7C 2ZSHB 1MJBA 1R5ID 2X9DA 4E4HA 4ENMA 5FKKA 3GYHX 3FWEA 2JVHA 2WV0A 2K9NA 3JRFA 1QQIA 5GP9A 2XKPA 4A0YA 3C2GA 4NUBA 3BZ6A 4M72A 3F8MA 2ZXHA 3ABKH 3CCRI 2RN7A 2WAEA 3ZQHA 1MGTA 2R7RA 2STWA 4BE2A 2L4AA 3M3YJ 1S72I 3J7ZI 3H9JA 2Y31A 1XX5A 1BR2A 1D5VA 2MSYA 3LSKA 2EK5A 2V9KA 3JRDA 3ERMA 3VYTB 4A0XA 5ICFA 3LAJA 3Q0WA 3BG5A 4HNUA 3RYRA 1B1BA 3KYCB 2LH9A 5A2QZ 1X1BA 2P5LC 2ESNA 3F6VA 4XSXF 3IH3A 5FB2A 2FSWA 3TOBA 2HI3A 4KT5C 2O8KA 4IHYA 1Q1VA 2KP6A 1LKXA 1USSA 3KP5A 1OQYA 2DFIA 1APLC 4EATA 1XGSA 1XCVA 3OOPA 4HSRA 1ERDA 2XAFA 1FNNA 2DO7A 5GAHJ 4B4CA 5K1YA 2ZJPF 2BE5F 2VXDA 2HYJA 3SDBA 1YS6A 4V2GA 1DGWY 4CZZA 5JLWA 2WWYA 1REPC 1DU6A 4KN7X 2J5PA 1U5TA 1RRJA 5BOXA 5E79C 4R8HA 4W1UA 4RGRA 3MCZA 4U88A 4EM2A 2CV2A 1T0FA 2JJ7A 2VUMJ 3ZMUA 1AWCA 2FNAA 2E7WA 1Z91A 1S5LC 3SJMA 4KNYA 1ZG3A 4ZTFA 1IRGA 3I59B 1QGPA 3DEUA 1G8XA 4JX4A 1TWCJ 2E5ZA 3H5RA 3Q0UA 2ZCWA 3LSPA 3OR2C 3I4PA 3I0TA 5D6FA 2Y69H 3DLLF 2KHMA 1JKPC 1GXQA 3TGNA 4Q4ZF 3BTCA 1ZAOA 3ESWB 3GFLA 4UUSA 2KFDA 4ENKA 2DI3A 5HS7A 4XBFA 5E1WA 3WU2C 3CO6C 1YTYA 4OU0A 3L2RA 1X1DA 5E3OA 2QBYB 3JTGA 3EYIA 2PMZA 4IJAA 4HLYA 1O3TA 2Z5UA 1F43A 4IXAA 3T1BA 1U0JA 2OPTA 2VBZA 3CMMA 2GIZA 2JMWA 4J00A 1KU9A 1R4MB 2Y75A 2YX7A 2DQLA 1ZK8A 3DF8A 5LEJA 5ED4A 3OYEA 1B8IB 4P96A 2HZDA 3NAUA 3S32A 1ETKA 2CG4A 2IW5A 3JSOA 1P7IA 3OIOA 4ON0A 4IOCF 4HF0A 2A07F 2ZXJA 1IXCA 3HOSA 1N25A 4YELA 3QAHA 1BN5A 3OYNA 3DBLB 2QENA 2FE3A 5DD4A 2JRMA 1PP7U 4J19A 2EFPA 1FBQA 4II2A 1D0ZA 2JA5J 2A3SA 3C3WA 2P5VA 2RQQA 1OCPA 1WJ5A 2OV7A 1YJWI 2IBDA 1LB2A 5L3DA 3GTOJ 2KRCA 2P81A 3CDIA 2COBA 4X1EA 1I27A 3B6AA 3C2BA 2KL4A 3HC7A 3VFZA 3VYRB 1XC5A 3U9GA 1HQCA 1MMGA 1YG2A 2D2WA 4W97A 4XIDA 3PJRA 4XKWA 3F8FA 2VONA 2JVGA 3K6GA 1NG7A 2JSCA 3KP6A 4P9FA 1UHSA 5FJ8J 4IOAF 4S04A 3HTSB 3DPUA 5EZHA 1JT0A 3MQ0A 3LA3A 2Z1DA 3FHZA 1VQKI 4M3DA 3LWFA 1WJAA 2EBIA 2W57A 5H20A 2KIMA 3JRBA 2E60A 2M7BA 1SVOA 1Y56A 1O7LA 3I3LA 4G7ZF 2K7LA 2DFEA 2M87A 3GVAA 4ZH4F 1QZYA 2OUMA 3TEDA 2CSOA 3J7YJ 2P6TA 2JA8J 2WB1N 2L2OA 3MZYA 4B09A 4PJNA 4WXHA 3T0YA 5TRDA 4EGYA 4H0EA 3GLLA 2HDDA 1QHHD 1D1AA 3ZQ7A 5K7HA 5F1RA 1E17A 2DA1A 3LSMA 4IPAA 3JRAA 5KHDA 4MLOA 3RZDJ 1MSFC 1KZHA 1GV2A 3BR2A 1TWFJ 4ZDOA 2P7CB 1WJDA 2AHQA 2NYXA 3WTXC 5ERIA 2DLLA 4QLCU 3HGGA 3LA2A 2FF4A 1P2FA 3VYSB 5FLVA 3FXOA 1T33A 1IUFA 1SD6A 2XRNA 5ILUA 1K6YA 3K1MA 4BJ5C 1F5TA 3REOA 1XSXA 5LRSA 2I10A 1IRZA 2ZXWH 3DKWA 4E7ZA 2Z3YA 1IN5A 1DP7P 2CQQA 5LGUA 3HUGB 1NH3A 1HSTA 4JOMA 2DYRH 1YIOA 4EJWA 1MBJA 1FSEA 3FHNA 4B48A 2FQ3A 1WFXA 2XF7A 2XASA 3A0HC 5HNHA 1MNDA 4XQFA 2CRGA 3A02A 3G1MA 4MIMA 2EZLA 5FD5A 2CW0F 2XAUA 5LBQA 3FDYA 4ZYEA 4L18B 4M74A 1C0WA 1W5SA 5IT9K 3K69A 3F0CA 3CCUI 2EV5A 1OCTC 5ICCA 2E2HJ 1ZN2A 2OCCH 2Q0OA 2KMUA 1IO2A 3DEEA 4IHWA 4ITVA 1OJLA 2DFFA 2JTVA 2WBMA 2GOMA 2P5KA 3GEZA 2W82A 1S7AA 4GO1A 5DDGA 5J4YA 2W4SA 2HOAA 3ULQB 4LG0B 3H9QA 2R7WA 5DYMA 5E18F 2YUSA 1V3FA 1XB4A 5FFZA 3FXQA 1ZGAA 3JRCA 2R5ZA 3WGIA 4LOCA 3WU1B 1I1SA 5LGNA 3I56I 2MD0A 5JHUA 1SMTA 5IT3A 4WWCA 3IL2A 3RIRA 1UHWA 4CHUA 1M1EB 2RKHA 5EJCA 5IY5H 4UB6C 3HM5A 4PDKA 4NNJA 4AVPA 1VQ5I 1SANA 1XMAA 4EMSA 2VPLA 4JX5A 3OYHA 1GVJA 1LNWA 1TWAJ 3PNYA 4RM2A 3OYDA 3G4SI 4FCYA 3GTGJ 4BEHA 5CPRB 5IOYA 3VPRA 1T2KA 2Z2SB 2R7DA 4HBLA 2V1NA 2VT2A 2OJED 1LJ9A 2ETHA 3PSIA 5TISC 2V1DA 3WTWC 2Y0SA 2CV1A 3VYUB 4BXXJ 4II3A 4UVAA 1LVAA 4V19K 1XDSA 1YW7A 2E1MB 3DLAA 5C4JJ 2VBXA 3V8KA 1Y1VJ 4RA2A 1RKTA 1IRFA 2XSDC 4IX7A 4OOIA 4C3JJ 1BI1A 3HOXJ 3QWLA 3QOEA 1RUOA 5M3MJ 3OYBA 4Q5SF 3BY6A 4RAGA 4BNCA 1B72A 4NC6A 4CH7A 2EFWA 1NK3P 3H0GJ 1D8KA 2Y0MA 4RB1A 1BC7C 2VE8A 1YIJI 3FMQA 3Q3SA 1YJNI 1CGPA 3BLYA 2DU9A 3OS1A 2O0YA 4XRSA 1FBSA 3DU6A 5HLHA 3ML6A 2VXZA 5FFXA 1MH3A 4IRGA 2BW3A 5LHHA 5LFAA 2ZFWA 3EUKL 2BVLA 1BJAA 2O03A 4BS9A 3CC2I 1U78A 4L0YB 2KIFA 2M4GA 3RPUD 4HX8A 1QZEA 5JI6A 3KEYA 3WTYC 5CVIA 2XGXA 1OCCH 1Z67A 2BV6A 2F4OB 4ZYHA 1UB9A 3OL4A 1T56A 4A6DA 1JKQC 1HKSA 1LEBA 3CF2A 4KMUX 3HXLA 2MH9A 3NRVA 2DJNA 1BI2A 2DODA 4RGSA 3TO9A 1O3QA 2DOAA 1ZQ3P 2DDBA 3TW7A 4BDYA 4ZDLA 3CCQI 1DQUA 4MEYF 2R92J 2DW4A 1ULYA 2JQ7A 2QM3A 5DCMB 2IGOA 4G7HF 1FSHA 1N78A 4D7MA 9ANTA 3WGGA 2EH3A 4A69C 1QVUA 2K9MA 5CQGA 2JUGA 1E3PA 1TW2A 3W6JB 4B44A 1LFBA 4A3EJ 1GDTA 2IGKA 2DT6A 2VN2A 3J80Z 5FLXZ 1GT0C 3GLXA 3KZYA 5CYVA 5BQTA 3HPGA 3CCLI 4IQ4A 2XGDA 2V4JC 4OAZA 3MFKA 1I6HJ 1O7FA 3M8JA 1JKOC 2XSJC 1X3ZB 3WHCA 3P9IA 5L3CA 1USTA 3ZQIA 4ETSA 4KJZA 3NARA 2QA4I 2BGCA 5HODA 2ID6A 2KIQA 2NAZA 2ESHA 3GFIA 2K02A 3I9V2 2YSRA 3DBHB 2IS2A 2OZ6A 5HLTA 5EGOB 5KAIC 1SFKA 2X1CA 4GDFA 2EA4A 2UWMA 1QO0D 3FXUA 3GZNB 4QTRA 1BIBA 1VQ8I 3HHHA 1I3QJ 4WK8F 1MSEC 2NS8A 1ZR4A 4QPOA 1Z21A 3E5QA 1F4KA 1PYVA 2DCEA 3CESA 3ZMSA 1U2WA 2KDOA 1JHFA 4PSXA 2ISYA 3B6CA 3MKZA 2G0EA 2M8EA 3OV8A 2TCTA 4KUMA 5E8GA 4A3FJ 2WAQA 5K7ZA 1JUMA 3CJRB 3ZN0A 1WJCA 4A3LJ 5KCMA 3ZXSA 1MMDA 4HF1A 2YU3A 2EZHA 3JR9A 2NVXJ 1WJFA 2CQKA 2XAHA 2V9PA 3CCJI 3DFGA 3ZMVA 2KJCA 4HOBA 2ECCA 2K85A 2OQRA 1VQOI 1YJ9I 2CQNA 3CUQB 5CVJA 2A6HF 2XB5A 1RZ4A 4FX0A 3GTQJ 3ONQA 4HX4A 1ON1A 2CO5A 4L9NA 3GXOA 1JE8A 4MNUA 3WTTC 1MMNA 2AQFA 5F0HA 3H0DA 2LOOA 4XL9A 5HNFA 3ZQFA 3I5UA 3F6OA 1ZTRA 1CF7A 1J0RA 2LBFB 4C30A 1AKHB 2DA2A 1SC7A 2E5NA 2UXXA 2STTA 4ESBA 1R5GA 1YRNB 2H8RA 1S7OA 4I7HA 1Y8QB 2VQLA 3G1LA 1FYLA 3KZIC 3S1RJ 2X48A 1RR8C 1IDZA 2TRTA 4E7KA 3HJEA 4FISA 4CUGA 2M5WA 5D8LB 4MO7A 4E7HA 4IL6C 2W48A 2DAOA 4JQFA 2R7OA 5EDNA 1BW6A 2XPWA 2RDPA 5JR3A 2HQAA 3L9FA 4JK1X 4C3IJ 3BOQA 1DGRM 1D3YA 1SAXA 3KEOA 1OCRH 4NC7A 2AXTC 4PJLA 1YHQI 2MBFA 3FX3A 2R7SA 4RGXA 4XKVA 2PFBA 1F9NA 2OTLI 4HYEA 2GXBA 2R7VA 4LLGF 1A35A 2BEOA 2D1HA 2VQGA 2CH0A 5TGTA 2UUZA 1FOKA 4KICA 3ABTA 1OR7C 3T8RA 2PJRA 1IXRC 2HNHA 2Y30A 4U7DA 4Y7NJ 3DKYA 1Z0XA 4PJJA 4E7IA 1YQAA 1KYWA 2X4HA 1LDDA 2GWRA 1TWGJ 1U6GA 2CQXA 3EPZA 2M30A 4AIDA 2R7XA 4XLFA 1TT0A 2LYCA 2DA5A 1XD7A 1T98A 2QQAA 3S3NA 2IGMA 4KYWA 4KN4X 2Y9ZA 5BPDA 2HWVA 4AIHA 1RC9A 1ODDA 2F48A 2ME6A 4EV0A 1DPUA 1XPXA 4HV5A 1W0TA 1VQ4I 3ZOBA 3H36A 2HYFA 1IAWA 3QU6A 1VQPI 2X6XA 2P0WA 5M5WJ 1BL0A 4HZFA 2IPQX 2K9QA 2QUFA 3HKZN 3NQOA 4IRHA 1NG6A 3ZN1A 1R58A 5J8CA 2L3DA 5E3MA 1SFXA 3RYPA 2LC2A 4BXFA 3QRFF 4BQQA 2BHYA 2GXAA 4IHTA 2JA7J 3P9CA 2FOKA 2WADA 3LAPA 2COMA 2EV6A 3IAM2 1YX5A 2X6WA 3W6KB 2NVUB 4U0YA 3H92A 4L9JA 1FP2A 3HSRA 3LNQA 2D5VA 3H3ZA 3FKIJ 5M5YJ 2PX9A 2DTRA 2FUG2 5B3SH 1WQ2A 3V4GA 2E1MC 3KX2A 1WH5A 1XS9A 2XDVA 1FC3A 4EVIA 1SD5A 3L7WA 4AU7A 2KT0A 1GLNA 2OU2A 2VJ5A 2IJLA 4KDPA 1MJAA 2CU7A 3BG9A 4XSZF 4KFCA 2CS3A 5J6XA 1U3EM 1JUPA 1PUFB 3SFIA 2QKLB 4KIBA 3BDDA 2LFBA 3KPHA 5J1UA 4LLLA 2L7KA 4XLPF 4AIJA 1E2XA 2Q2EA 3L2WA 1SVMA 3A2KA 3G73A 2GQQA 5BS6A 2E35A 2KRHA 5F6FA 4BY1J 2L7MP 2PBIA 5L3BA 3FIWA 4BACA 1UCRA 4DIQA 2L9SA 3LQQA 4L5EA 3J7AO 3BROA 1MDMA 4YFNF 4I01A 1ZG1A 5M3FJ 3S1QJ 5LHGA 5L3FA 4A2UA 2N8GA 3W2WA 3HOYJ 2HDWA 1YITI 1TZLA 2A05A 3BPXA 4LB6B 1ZRDA 1BA5A 4EM1A 4XLCA 4YRVA 1BW5A 4A3BJ 3H9GA 3EDPA 3C7JA 1JXSA 3IV5A 3V7CA 3CCVI 3AG4H 3BR3A 1U8BA 5AIQA 5D8KB 4ANJA 3S2DJ 1K61A 2L02A 1VQ6I 5D5UB 1U8RA 2IGNA 5GADJ 3QPLA 3ZPLA 4BAYA 5KNLA 4CYDA 2P8TA 2VIXA 2VOPA 2M45A 1XG1A 2E1OA 1WH7A 5E8IA 4WCGA 4C2TA 5HDGA 1ZGWA 3Q5FA 5FLMJ 1PP8F 2DBBA 4M6XA 2HS5A 3O8HA 4NC8A 1S3JA 4BQAA 1QU3A 2V6CA 4DGWB 1SMYF 1ZKGA 5HDKA 2LKXA 4PGHA 1OLTA 3D5SC 1OISA 3UR3C 2G7UA 2GLOA 1PDNC 1F36A 1LDJA 2H6CA 3W2AA 4A3IJ 3OL3A 1SD7A 1X1AA 3C18A 4RM3A 5FKLA 2FNPA 2FU4A 4UUVA 2ICWG 3QP6A 1H8AC 4M71A 3K70D 1TT5B 2QEXI 1FZPB 2K3PA 1XCBA 1VQLI 4G9YA 5FO5A 3PQJA 4WX9A 3BC8A 2L9RA 4FE4A 3H5AA 1KYZA 1J75A 2YU9J 3WE2A 2XIGA 4RB0A 4BUPA 3L09A 3QODA 1PUEE 2E34A 2R0QC 4FE7A 2ZBKA 3JSPA 3FMRA 3U1KA 1IN6A 1I1GA 2BZTA 1ETVA 3TL4X 3ZMZA 4CDGA 2ZNZA 4NQWA 2XF5A 3O3KA 4RS8A 2GZWA 4IO9F 5IT9Z 3CP2A 3CMYA 4XLHA 4CYCA 3QOPA 1SD4A 2LDUA 4LIVA 5H6QA 5DS9A 3K10A 4RBOA 2VOOA 4L9TA 4G7OF 4XOPA 1LEAA 3K4MA 4PFOA 1IGNA 2DQRA 3GBGA 1T08B 3BPVA 4LG3A 4DQ2A 2NNYA 1U5TB 3UKGA 4WXDA 2J5OA 4IKFA 3CUQC 1HW2A 2GBYA 2KISA 3IWZA 2L0KA 1ETXA 1G3WA 2ZO4A 3MKYB 4P55A 2Q1ZB 1VI0A 4ABZA 2LG4A 3WTVC 1D5YA 3V7SA 3V8JA 2F5EA 3IAS2 2MLGA 4XK4A 2QSFX 3DTEA 3KCCA 5EEHA 4YIFA 2DMPA 3NWSA 3DCFA 2XRLA 4HNTA 5CQEA 5IPAA 5ILVA 3OOUA 4Y13A 5ILSA 4KIFA 4UUSB 5LD2C 3QP5A 4L0ZB 1D8JA 1K7AA 4G94A 4M6VA 5J8FA 2JWTA 4LIUA 2E19A 2GXGA 2QCOA 3H3VK 4RLQA 3ZR8X 3H1CA 3VSLA 2ZKZA 5IP7J 1MBFA 3R0AA 4EJOA 1D0XA 2VB6A 4H4KC 3ASOH 5A2QK 4XLAA 4QWQA 5J47A 1J59A 3O8GA 2GIVA 4KMFA 2ZMEA 5D5WB 4CSWA 4YFKF 4ZYDA 2CFXA 5EEGA 2W24A 3PUFA 5F04A 4PJMA 2NOGA 2ZXIA 3GO5A 1QZZA 2P4WA 2Q8KA 3DTIA 4IRIA 2DFHA 4F92B 2DDAA 2KJBA 2KQRA 3R4KA 3DPTA 2R7ZJ 2A69F 3IH4A 5IYBJ 3D0SA 2CUJA 3CCYA 1FYKA 1AA7A 3OIQA 4S05A 1BOAA 4ZYGA 1AHDP 1RUNA 1P6RA 4XRSG 3U2RA 1P4AA 5E1ZB 2HVSA 2X6OA 1GUUA 2L54A 2A68F 1X4PA 2FOWA 3OSGA 1YFHA 3TO7A 2W00A 3LOCA 1UFMA 2DMQA 2IAIA 2OF7A 2CYYA 4OIRF 3HOTA 2ZC2A 5JVTA 4MFEA 3D5RC 3JRIA 3WTUC 4XOTA 3CMAI 1TW3A 1YS7A 1BR4A 2X1DA 3KZZA 1HBXG 1RPWA 2XAJA 4IHXA 2DMNA 1J2XA 1OCOH 4PSWA 2ISZA 3MKLA 4UXNA 1NK2P 1JHHA 1U9NA 3Q9SA 2DMTA 4LLNA 4LK0F 3HZJA 5K7FA 3TO6A 2KZGA 5M5XJ 4PJ0C 2NNNA 4RLFA 2DTZA 4GFBA 2V6EA 2WB1A 4FETA 3U21A 2Z33A 2QZ8A 2DXIA 2PLYA 1MBHA 3LSHA 2RV8A 4M9ZA 4IZZA 4XKBA 3LFUA 5GTHC 1LE8A 3I4NJ 4U0WA 5FD6A 2VLAA 4AYBN 1GHCA 1O4XA 2E1CA 2D45A 1VQ9I 2W1OA 4BE1A 3EUAA 2JPBA 2K5CA 4XRMA 3PM1A 4OAYA 2RREA 2EJRA 1ETQA 3QQAA 4HQEA 1JJ8C 3EUHA 3A01A 2KZVA 2M0CA 2JRTA 1WI9A 5E20A 4PCQA 2CUFA 3IRRA 4UHTA 1FOXA 4UUTA 1BIAA 4D1QA 2IEKA 3DWLE 3GZ6A 1Z7UA 3BG6A 2FBKA 3QU3A 3COAC 1H9GA 1IN7A 2VKEA 4P5OA 5C4XJ 2DYSH 2X1EA 4BHPA 3H5NA 1TQPA 2KKOA 5DEQA 2DA3A 2IS4A 3WGHA 3GTJJ 4DYCA 1D1BA 4NHJA 2G7HA 4IVNA 4CCJA 3E6CC 1H0MA 2CQ7A 3OYJA 4CCKA 5IYCJ 3BZKA 3GUDA 3PO3J 3FXLA 3GWZA 2HXIA 1UAAA 4BKXA 1S6LA 3HPHA 2XF6A 3RPQA 4BYYA 1FBUA 2D1VA 3PSFA 5HDNA 4DYQA 2V79A 2X51A 4AC0A 2F5VA 4RDUA 3TP3A 4PUSA 2M2EA 2OD5A 1G59A 3M4OJ 4OIOF 4LGWA 2W7NA 1W5CC 3I54A 1Y8RB 4F55A 4J01A 2XPVA 5FROA 4HQMA 3MWMA 4A3CJ 3OYGA 4O5VA 5J40A 3RPUA 1SFUA 4BU2A 2X85A 4X0GA 5IP6A 1LFUP 2HGCA 3LSGA 1Z77A 4UVCA 4HDUA 2FMLA 1EH6A 1A6IA 1WKMA 2HOEA 2HXOA 4E7SA 1B4AA 4RAFA 2W84A 3BG3A 3MMYB 4DW6A 2R5ZB 3F9KA 3HGYA 1JGGA 1P4XA 5BNGA 2OZUA 5DV5A 3RQIA 1BJZA 4ENJA 2LK2A 4HDVA 1HXDA 2IP2A 1ETYA 3K2ZA 2RQPA 3S15J 1D0YA 2BHZA 4N0BA 3I55I 1ONVA 4CCNA 4ZZLA 5AIPA 3F8CA 2PI0A 2EA2A 1IXSB 4BEHB 1TQMA 1OFCX 5IOZA 2VC0A 1ZGJA 3OSFA 2RNJA 1HDPA 3TDUC 1S7EA 2QVOA 1KQ9A 2PN6A 3KE2A 4I98B 2RVCA 3NWTA 2FBIA 4Q47A 2QKMB 4U7BA 1T38A 2NXNB 1OCZH 3BR5A 4HPQA 1Y6IA 1FMWA 1R23A 1MJ9A 3CCSI 4RMNA 2Y9YA 1T8IA 3DXJF 3S1NJ 5GPCA 3AG3H 3LA7A 1HKTA 4B8XA 1W7PA 4YFXF 3FXRA 4JYKA 3PO2J 3B02A 1WRJA 3K70C 3P9KA 1I50J 3SDGA 5CVVA 4EEFG 1EH7A 2M0MA 2DMUA 3SXYA 2XAGA 1HCRA 1LFPA 3IHUA 1B72B 2DA7A 1HW1A 4M73A 1UHMA 4D9JA 3EQLF 2H1KA 2OCEA 1TNSA 4UB8C 3GTMJ 4F3QA 5DM6F 2YR2A 1V5EA 2Z99A 3S16J 5F64A 1A31A 1U5TC 1YW9A 2NVYJ 1LVKA 2XAQA 1FTTA 1JI8A 3F21A 1JKRC 1X2MA 1T0FC 2BW3B 2JK3A 4OWRB 3AKZA 5DD8A 3M1CA 4UV8A 1G6NA 3O6BB 3V7RA 3GF2A 1JJ6C 1E0EA 3K4LA 2LR8A 2HOTA 5KK1A 1V55H 1KU3A 3MD2A 3P7NA 4MTDA 1WCMJ 3OYCA 3N4MA 2BY2A 4LK1F 3AL0B 2R3SA 4BGDA 3KP3A 3BQYA 2K86A 2V7FA 2MG4A 1DP3A 1IUYA 2R5YA 1ON2A 1O3RA 3ERED 3VSKA 2CMPA 3W3CA 5CJ9A 4CCMA 2LNBA 4K2EA 2FXAA 1ZYRF 1LDKB 5DTDA 4ZZDA 3A1YA 4MTEA 3CCEI 3K4CA 2Z16A 2VE9A 1HDDC 3S14J 1Y39A 1A04A 3MVPA 4I99C 4KT6A 4A5MA 4IHSA 3BTLA 4PFPA 2HEOA 2VL8A 1JTXA 3GW2A 3E5UA 2E2JJ 2M1BA 5H6RA 3GFJA 4HF2A 1ZRCA 3DQVC 1I39A 4IEJA 1G4DA 3R61A 1TNTA 2LY1A 2IS6A 4Z2YA 2GM4A 4FHTA 1X1CA 3WTSC 2LLKA 3E6MA 4M3EA 4Y52J 3PUBA 2LSOA 3C2HA 3M9AA 3HL2A 4B1RA 2IRFG 2YPRA 1BBYA 5LRRA 2LF7A 1QBJA 3BP8A 3E7LA 1V5GA 2DA4A 3HEFA 3HTUA 4OINF 4B3XA 1W0UA 1O3SA 1R1UA 1Z7LA 4IQJA 3ZP5A 3G6EI 2O8XA 1A6QA 5DM7F 2BY3A 1MMSA 4XN0A 1VFCA 5GTIC 3I58A 2EFNA 5FRNA 3I53A 3IP4B 1S9HA 5EZGA 4NB5A 5E3NA 3JAMK 4LJZF 4AD9A 1Z05A 2DN0A 1ZREA 3CMEI 2EIMH 1ETOA 2VI6A 4E7LA 2HPMA 4QSHA 4I02A 3CQZJ 1K4TA 3SEQA 1FT9A 1ACIA 4YIIA 3R6SA 1YE9A 1AOYA 4A5NA 3I71A 2K40A 4ZDPA 3J80K 1CQTA 4DZJA 3RKQA 2R7QA 2A5WA 2HPIA 2OAZA 2AO9A 3DV8A 3HOWJ 2W85A 3GZ5A 2XV4S 3WG9A 2FQ4A 4BJTA 2H27A 5HS9A 4GCVA 2VQHA 3ASNH 3WE3A 2LRDA 1EA3A 2PQ8A 4XM3A 5HS8A 1ENHA 1CF7B 3HYIA 3BZCA 2H09A 5K5RA 3MN2A 2JA6J 1FTZA 3KETA 3DBRB 2HQRA 5EG0A 4HAMA 3F8BA 1GV5A 1FYMA 5B1AH 3GTKJ 3ELKA 4BXUA 3BJAA 2MC4A 3KP2A 2I5UA 1FOWA 2M7AA 1F1ZA 4C3HJ 1R36A 3H3UA 2HR3A 4XORA 1YI2I 4D7NA 3RQ4A 1BC8C 4F91B 1TLHB 4B47A 1IV6A 5CVUA 3MKWB 4PK4A 3RI4A 2XKOA 4I2OA 2L9VA 4I0AA 1EKEA 4M6YA 2MGQA 2OQGA 2WY7Q 1AU7A 2O6GE 4LMYA 2IA1A 5ICEA 2K27A 3L2QA 5E1XA 1YLFA 2ZNYA 3SQNA 1V4RA 1SEUA 1J9IA 2DA6A 1XMKA 1MBKA 2QLZA 3TDZC 4WF2A 3A03A 4LFUA 1WI3A 3PNVA 4JX6A 5FKNA 4A12A 1Q1HA 3J81K 2K9SA 3HOVJ 2K9LA 2PJRB 4O3MA 2B63J 2ELKA 4MQ9F 3BT9A 4CCOA 4CXFA 2UXNA 5F0CA 1I3AA 3GFMA 4AIKA 3F72A 5CKTA 2QQ8A 1S29A 3EUHC 2CWEA 3I59A 4N9IA 1Z3YA 3HRSA 1X19A 2VKVA 2X0LA 2L4MA 1QNTA 1GXPA 2X6YA 1WVRA 4EJVA 1BM9A 1MBEA 4HW0A 1Y0NA 2WY8Q 1HKQA 2PEXA 3OR1C 1EH8A 3HKZA 3S8PA 1FPQA 3LMMA 2HTJA 4NDLA 4PGGA 5EG0B 1IW7F 3AG1H 2JA2A 2VT3A 1K4SA 3BQZA 1S8NA 2XVCA 2M3AA 4XICA 2PMHA 3BR0A 3KIOA 2QBYA 4O6JA 3S17J 1A5JA 2CFOA 2CW7A 3VDXA 3JCUC 3RKWA 1L0OC 2A6TA 4FTHA 2MH2A 1Z1DA 3HB9A 2WAFA 1ZARA 4Y15A 3FXMA 4N4NB 3ROUA 2VJIA 1RR7A 2PMZN 4V2FA 1B8IA 3FK7A 2E2IJ 2BBYA 3QYFA 3LSTA 1YW8A 2L9NA 3ECOA 3PQKA 3OY9A 2R7UA 1XN7A 3LSRA 3BR1A 2CW8A 3E5XA 1NTCA 2HKXA 1EJ9A 3T5XA 4HRIA 3VOEA 1QHGA 1PVEA 3GCMA 2VQCA 3LSJA 3VB2A 2GOXB 1WSUA 4EQQA 3CC7I 2Y2ZA 2H94A 5DUIA 2DOEA 3J7AY 3EYYA 5LGTA 2HVQA 3RKXA 4ZTJA 2FRHA 4AUXA 2Z9OA 2TDXA 2HU9A 1HF0A 2BOLA 1R9TJ 1HLVA 4A3GJ 2BY0A 2M4KA 2XGEA 2DK8A 4AM3A 2EQRA 2Q2EB 1R6RA 3KLOA 4G8XA 1X3WB 5FGMA 4BBSJ 3JRHA 1X1PA 4I0BA 4S0HB 1EV7A 3OYAA 4TV7A 4HNVA 1W36C 2YS9A 3JTHA 3OYLA 3AFHA 4I09A 3ZQCA 1MDMB 3T8TA 3MZHA 4A93J 2OC6A 4XRFA 3OYMA 4E7JA 1KU7A 3CZ6A 4BQOA 1RI7A 4HV6A 4P9UA 2DPUA 3BWGA 4HLXA 2H1LA 5HOOA 3CDHA 3WU0A 2E7XA 1ZELA 1Y0UA 4OIQF 3AL0C 3KP4A 3IWFA 1RIOH 3CC4I 4LB5A 1E3OC 4RAZA 2M34A 2LREA 3HBLA 1TWHJ 1IN4A 3F23A 3FXKA 2QSHX 3ZMDA 3PIPF 2NVTJ 4MFDA 2VJJA 2O7OA 1IV8A 5E17F 3QYBA 3R0JA 4DNCA 2BYVE 1MNMC 2HFHA 3K9TA 3MZ8A 1MBGA 1SFOJ 1XGNA 5GAGJ 4YG2F 1JGSA 1KA8A 1QPMA 2MW8A 5K5QA 5EEAA 4UY8I 1YOVB 3FM5A 4DJAA 3TOAA 4HEA2 3VEPA 2HQNA 5EYRA 2HOSA 4Q48A 3S2WA 5DUKA 1R4NB 3HUGA 5AONA 4UNOA 2R7TA 1FEXA 4CA0A 2LVSA 2JN6A 3SFZA 1ORKA 4F7ZA 3GTLJ 1P92A 6PAXA 4ESFA 1QA6A 3MAJA 4M9XA 2FA5A 3BR6A 1IG7A 4DBRA 2HYGD 1VNDA 2EILH 5C44J 1XSVA 1EF4A 1MIJA 3F3XA 3UNGC 3L2CA 4E6KG 3KLNA 2QQBA 5DCFA 3Q9VA 1W5TA 4FQGA 4NBQA 5FRMA 1VQ7I 2QSGX 1G3TA 4BH9A 1WHUA 4BL0B 2BXZA 4RGUA 2UV1A 2VC1A 2ELHA 5JFRA 5ICGA 2VASA 1XTAA 4NQWB 1TBXA 4BY7J 1QVTA 1OR7A 5LHIA 1SAUA 1QRYA 3S3OA 4AWXB 4FT8A 4CYCB 2E36A 2MD5A 2QQ9A 5B5EC 3X2QH 3HRUA 1IJWC 1WJEA 2FBHA 3ABMH 4C2UA 3BJOA 1YYVA 1FX7A 3CJTB 5LEKA 1X58A 4LG0A 4OMZA 2F6CA 2EWNA 2NOJB 5D4SA 2IA2A 1DU0A 5D5XB 1IF1A 2VBYA 3FM3A 1P4WA 4G6QA 2O9LA 3S1MJ 3ZRGA 1U9OA 1WGXA 1H9TA 1VZ0A 2IS1A 2FMYA 1VQNI 1R49A 1PJRA 2K3FA 1BI3A 2EIJH 2LMDA 3L00A 2F2EA 4A3MJ 1MH4A 1POGA 2NRAC 4P1WA 1K79A 3ECHA 4G12A 1KU2A 4XLNF 5D5VB 1J7KA 1B9NA 2FJ1A 4KIGA 4AVZA 5H2FC 5B66C 4R1HA 3FBIB 1IDYA 1JUSA 3ZMTA 2HZTA 4QIWN 4M3GA 2IXSA 2I8DA 3L2VA 3N05A 5IYDJ 1O57A 2NS7A 1H88C 1TTYA 4FASD 4WXCA 3KFWX 3KYDB 3E3VA 2EFQA 1DPRA 1NHAA 2AS5F 1UZCA 1OYWA 2DT7B 1XDUA 3TBIA 4BHCA 3LQRA 2JT1A 3D1NI 3F8NA 2DJIA 2RC4A 2W25A 1N75A 2ZMEB 3HG9A 4A3KJ 2NS0A 1VF9A 3E1SA 5C3EJ 1ZG5A 2VKHA 2RAEA 2LKSA 2LD5A 4U0VA 3BTJA 1K6OA 4CO8A 4UV9A 2Y0SN 3OS2A 4IF4A 1IRXA 3CUOA 1UG2A 4PZJA 1ZHFA 4XR6A 4XLEA 3CJNA 4ZJZA 3KEQA 2OBPA 5GAEJ 3F22A 5CLSA 2LY9A 2MYSA 4B3AA 2IVMA 2FX0A 2F5CA 3PFIA 2ELJA 4M3FA 1J5YA 3SHFA 3H35A 3BJ6A 1ZLJA 4GRIA 3BG7A 3NEUA 4D0PA 5E3LA 2JSPA 5HVQC 3LFKA 1WWXA 5IP9J 2EV0A 3G3ZA 4XKCA 1VTNC 5D4RA 3WHBA 3CCMI 4E70A 3AG2H 3DTKA 4G6TB 2VPRA 4L9VA 3IH2A 4C9YA 1XSDA 1J09A 3EETA 2KLOA 3OYKA 1H89C 1T95A 4AYBA 1MD0A 4R79A 5JLXA 1FIAA 3DP7A 2EIKH 3OS0A 2BXYA 5LLQA 1LE8B 2P7VB 3RJPA 3JRGA 2A6EF 1ITYA 3V8LA 1OKRA 4MEXF 2O61A 1UG0A 1I6XA 2ECBA 3W6VA 2K4JA 1MW7A 2F5DA 1JTYA 5DCMA 2HVRA 2QF7A 3SZTA 2ADUA 4D5CA 4RB3C 1TL8A 2H8WA 1P7JA 3HRMA 3RZOJ 3ZQQA 3A01B 5KAFC 3KYLA 1YO5C 3L1PA 3OYIA 1I5ZA 2PG4A 2QGUA 3K4NA 3RKYA 1HSJA 3HIFA 2WA0A 5D6EA 5JVGF 1WPKA 4I76A 2CGPA 3IC7A 3RSNA 4XMYA 5J3LA 2EINH 2XUBA 5CVRA 2P6SA 1UELB 4A6EA 3QPHA 2MFZA 5F0FA 4BJ6C 5GPAA 3FF5A 1R1TA 4N4OB 4OIPF 1L3LA 1MKMA 3FXJA 1WJBA 2H6BA 3TMOA 4BBRJ 2BY1A 5EGOA 4YIRX 2VJ4A 3SEZA 3AAFA 2OA4A 3K1PA 3OIPA 5BPIA 5J1RA 2OTJI 1FLIA 3FZVA 1B9MA 4ASNA 2JPCA 2LP0A 2BVMA 2DPDA 3M8EA 3M1EA 2KPMA 1MNEA 2KRFA 1K83J 2VBWA 3PIOF 4RAYA 3HSFA 2VODA 2ZJRF 1GVDA 3Q0VA 3G1OA 2M8GX 3HSEA 4ESJA 3W2VA 3QPSA 2ZSIB 2GAUA 4JP0A 3TQNA 2E1NA 1KGSA 1D1CA 2PMUA 2YX4A 2XROA 1HOMA 1W1WE 1W36D 1Z9CA 1TP4A 3SYTA 4Y3OA 3A0BC 2B0LA 2EZIA 3JAMZ 5EF6A 1DDNA 4A3DJ 1X3UA 1JT6A 2E71A 2WAQN 5J1YA 3VWBA 3RCOA 1OPCA 3CUQA 5HLIA 2FEZA 3TP0A 3P5JA 2NVQJ 1FP1D 1R1VA 1IC8A 3QPTA 2MABA 3N97A 4U87A 3OYFA 4G6DA 1ZR2A 2DOFA 3K4JA 1P9QC 2HQ5A 3CTAA 4OMYA 1G2HA 3RDIA 4HG2A 3WTZA 3S3MA 1XGMA 3S93A 3LL7A 4XONA 2B9SA 3OWTA 4BE0A 2JZYA 4BHBA 3IRQA 3I64A 1BOBA 2LF8A 2LBFA 1AKHA 2GA2A 4CCLA 1HA8A 1V5FA 3TKYA 3I4MJ 4IHVA 1X4OA 3E97A 1YRNA 2HDCA 4HA8A 1ETWA 4ENNA 2ME0A 3WG7H 4C2MJ 2XB0X 3KP7A 4DZPA 3K1NA 5F27A 2WC2A 3WODF 2PJPA 1FWZA 1W7PD 3GMEA 1RNLA 1UJ8A 1B59A 1FY7A 4EJUA 3L2UA 2AQEA 1RETA 3QYEA 3G2BA 2R93J 4XN3A 4QPQA 5HLGA 1VQMI 2O5RA 4N9HA 4JBAA 3BCBA 2R7FA 3LSIA 2WV1A 3IKVA 2FD5A 3DKXA 3CDLA 3DU5A 4EGZA 4Y17A 2L7FP 3ISPA 1W7PB 2EPFA 2JUCA 3SZGA 2ZJQF 1BR1A 2EZKA 3BCAA 3TW6A 2G9WA 3ZQLA 4D5FA 2R4GA 1XMXA 3O2PE 4KA4A 4GYGA 3FKJA 4Y33A 4X6AJ 5K5OA 4F93B 2EB7A 2XGCA 2ACJA 1R22A 3IUOA 3J81Z 1G3YA 3CJQB 3K7AJ 4ZYAA 1LUJB 3ZGKA 2XPUA 2WTEA 1ZH5A 4L5JA 3IKTA 1MZBA 4RB2C 3DPLC 3V42A 2CUEA 4Y4RA 4B43A 5TJJA 5B1BH 1YX3A 1R00A 5FKMA 4HSTA 2B7EA 4I6ZA 3HOZJ 2A5YB 1LPQA 2QYOA 1K78A 4XNFA 1OYIA 4LITA 2UZKA 2MLKA 3C1DA 4GXOA 5L3GA 4EM0B 4HX7A 2HTSA 2F4IA 5BMZA 1MMAA 1SFEA 1X2NA 2ZJ2A 3E6DA 3BTIA 4MQVA 1KQ8A 3FMSA 3FBNB 4BDZA 1XGOA 1FIPA 2V26A 3B73A 1RESA 3CLQA 2Y48A 4ZC3A 4DBQA 1IN8A 3CD6I 2R5YB 1ZLKA 4UVBA 3E6BA 3VODA 2M9HA 3PL8A 2CV0A 2L7ZA 4GYIA 2ZB9A 3ABUA 2RNGA 3DEWA 1A36A 1Z3XA 4A0ZA 1HC8A 1KQ0A 4BQNA 3M07A 4MGRA 1B6AA 2ZMEC 2ZFUA 2V9VA 2CUZA 4LD5A 5FLXK 3K4BA 4KITB 4L5IA 4MHGA 1QPIA 1T6SA 2VKDA 3RTRA 4KISA 2DK5A 5JHFA 1R5HA 1N77A 3CP8A 4Z6YA 1R71A 1R7JA 1OMIA 3HRTA 3K2AA 2IT0A 3GTPJ 2MA3A 4A3JJ 4EJTA 2F5FA 3OMYA 4CGZA 2V1XA 4DYRA 1PUFA 5KVRA 1LQ1A 3K4KA 4YEJA 1HW5A 2KDZA 2XHKA 2DT5A 2LY2A 2C6YA 1RKWA 1TQIA 3ZQGA 3MEXA 1W4MA 2F4MB 2A61A 3PFYA 3SZPA 3JW4A 4FX4A 3CLOA
chains in the Genus database with same CATH topology
4BQOA 2XSJC 3A4CA 2KZVA 5HOOA 3PNTA 4KJZA 4D1QA 1ZELA 3DWLE 3BG6A 3AL0C 4F52A 3I9V2 2IS2A 4P5OA 5HLTA 2LREA 2X1EA 3H5NA 1SFKA 2X1CA 2UWMA 2VJJA 2XC7A 2IS4A 1FMVA 2L5QA 4DOZA 3QYBA 1D1BA 3D5LA 4QPOA 4CCJA 1Z21A 3OYJA 1PYVA 3ZCOA 2DCEA 3CESA 4CCKA 4DJAA 2KDOA 4PSXA 3MKZA 1UAAA 4HEA2 2WAQA 3E0JB 3HPHA 4CZCA 3CJRB 1KONA 1WJCA 2XF6A 2ZSHB 3PSFA 4E4HA 5KCMA 3ZXSA 1MMDA 2X51A 2F5VA 2R7TA 1WJFA 4CA0A 2JVHA 4PUSA 1G59A 3C2GA 2W7NA 4NUBA 4F55A 4J01A 5FROA 2ZXHA 4DBRA 3ONQA 2WAEA 3OYGA 2R7RA 4BE2A 3UNGC 4BU2A 4E6KG 2X85A 4X0GA 3LSGA 3H9JA 1MMNA 5FRMA 2AQFA 1BR2A 3H0DA 3LSKA 2LOOA 4XL9A 4BL0B 5HNFA 2V9KA 2UV1A 3VYTB 4E7SA 2VASA 2LBFB 4NQWB 4C30A 4HNUA 2E5NA 1SAUA 2LH9A 3S3OA 1X1BA 3MMYB 3F9KA 1WJEA 2VQLA 2KP6A 4C2UA 1LKXA 4E7KA 4EATA 4CUGA 4HSRA 2F6CA 1ERDA 2NOJB 4E7HA 4JQFA 1D0YA 2R7OA 2VXDA 3ZRGA 3SDBA 2HQAA 4CCNA 1DGWY 1VZ0A 2IS1A 4BEHB 1PJRA 1DGRM 4P1WA 4NC7A 4PJLA 2R7SA 2CV2A 3NWTA 4U7BA 2QKMB 4XKVA 2R7VA 4AVZA 2VQGA 4HPQA 2CH0A 3FBIB 1Y6IA 1FMWA 5TGTA 4ZTFA 2UUZA 4RMNA 2IXSA 2I8DA 1OR7C 1G8XA 3N05A 3H5RA 2E5ZA 3L2VA 2PJRA 4FASD 3OR2C 2HNHA 3DKYA 4PJJA 4E7IA 2KHMA 2DT7B 3TBIA 3EPZA 2DJIA 3K70C 1N75A 3HG9A 2R7XA 2M0MA 3E1SA 2VKHA 4XLFA 1TT0A 2LYCA 1LFPA 3L2RA 3S3NA 1X1DA 2IGMA 4D9JA 2PMZA 4F3QA 3OS2A 1IRXA 1V5EA 1U0JA 4XR6A 4XLEA 3CMMA 4ZJZA 4J00A 1LVKA 1JI8A 2MYSA 1T0FC 2BW3B 2P0WA 2X6XA 3OYEA 4OWRB 2HZDA 3AKZA 3M1CA 3S32A 1NG6A 2ELJA 3H35A 2LC2A 4BXFA 3HOSA 4GRIA 4BQQA 4YELA 1E0EA 3BG7A 2WADA 3K4LA 3OYNA 3IAM2 1YX5A 3MD2A 2JSPA 2X6WA 5HVQC 3OYCA 4XKCA 3AL0B 4II2A 1D0ZA 4BGDA 3DTKA 2V7FA 4G6TB 4C9YA 1DP3A 2FUG2 1J09A 2RQQA 1WJ5A 3VSKA 2CMPA 2KLOA 2OV7A 3W3CA 3OYKA 1T95A 2E1MC 3KX2A 4CCMA 2XDVA 2KRCA 4AYBA 4R79A 1LDKB 3HC7A 2KL4A 3A1YA 3VYRB 4AU7A 3K4CA 2Z16A 1GLNA 2VJ5A 3OS0A 2CS3A 1MMGA 4KT6A 3PJRA 4PFPA 4XKWA 2QKLB 2JVGA 2VL8A 3K6GA 1NG7A 1UG0A 2L7KA 1MW7A 3DPUA 3L2WA 2HVRA 2Z1DA 3A2KA 2KRHA 3DQVC 1WJAA 2E60A 2M7BA 2LY1A 1Y56A 3I3LA 3ZQQA 4BACA 2IS6A 4DIQA 3KYLA 2L9SA 2OUMA 3OYIA 3K4NA 2L2OA 4PJNA 1X1CA 2WA0A 4OAZA 3PUBA 3RSNA 3C2HA 4XMYA 3W2WA 1QHHD 1D1AA 3HL2A 2HDWA 1UELB 1TZLA 3LSMA 4XLCA 5KHDA 4MLOA 2MFZA 3H9GA 4YRVA 4BJ6C 1V5GA 4ZDOA 1WJDA 4ANJA 4B3XA 4N4OB 1Z7LA 4IQJA 1WJBA 2IGNA 3TMOA 2VJ4A 3VYSB 3SEZA 5KNLA 3OIPA 2VIXA 1K6YA 4XN0A 2BVMA 4C2TA 4BJ5C 5FRNA 2KPMA 3IP4B 1S9HA 1MNEA 4E7ZA 3HUGB 4NC8A 4JOMA 4E7LA 2HPMA 1QU3A 4DGWB 3FHNA 3SEQA 3W2VA 4B48A 1YE9A 2ZSIB 1OLTA 3D5SC 1WFXA 2XF7A 3UR3C 1D1CA 5HNHA 1MNDA 4XQFA 4ZDPA 3W2AA 1W36D 3OL3A 3SYTA 1X1AA 4RM3A 4Y3OA 2R7QA 2A5WA 2HPIA 3K70D 2XAUA 4BJTA 3VWBA 3FDYA 2K3PA 3RCOA 2VQHA 2LRDA 3BC8A 1EA3A 4XM3A 2MABA 3H5AA 4U87A 3OYFA 3K4JA 1P9QC 4BUPA 3QODA 2KMUA 3DEEA 4HG2A 4ITVA 3S3MA 2WBMA 3S93A 2GOMA 3LL7A 4XONA 3OWTA 2MC4A 4BE0A 2W82A 1BOBA 2M7AA 3TL4X 2W4SA 4XORA 2LBFA 3H9QA 2XF5A 4CCLA 3RQ4A 1HA8A 1V5FA 4F91B 2R7WA 3CP2A 4XLHA 4B47A 4LIVA 1X4OA 3MKWB 4PK4A 3K10A 2MD0A 2WY7Q 4XOPA 3K4MA 4PFOA 3GBGA 4LG3A 3L2QA 4NNJA 2VPLA 4IKFA 3OYHA 4RM2A 3PNYA 3OYDA 3L2UA 2AQEA 4BEHA 3QYEA 3G2BA 5CPRB 3PNVA 4XN3A 4QPQA 3MKYB 2O5RA 2Q1ZB 2Z2SB 3BCBA 2LG4A 3LSIA 2V1NA 2K9LA 2PJRB 3DKXA 3IAS2 3DU5A 3DTEA 4CCOA 3SZGA 3NWSA 1BR1A 4HNTA 3PSIA 5CQEA 3BCAA 3OOUA 5CKTA 2Y0SA 3EUHC 4OAYA 3VYUB 5LD2C 2CV1A 2R4GA 4II3A 1Z3YA 1X19A 3FKJA 4LIUA 4Y33A 2E1MB 4RLQA 3VSLA 3ZR8X 4F93B 2X6YA 3DLAA 3IUOA 4ZYAA 3CJQB 1D0XA 3ZGKA 2WY8Q 2VB6A 4H4KC 3OR1C 4IX7A 3DPLC 4XLAA 3V42A 3HKZA 3S8PA 3QOEA 4CSWA 3LMMA 4Y4RA 4B43A 3OYBA 1YX3A 4HSTA 2JA2A 4CH7A 4PJMA 2M3AA 2ZXIA 4XNFA 3DTIA 4LITA 4F92B 2CFOA 2KQRA 2CW7A 3VDXA 3DPTA 3BLYA 2A6TA 3OS1A 2CUJA 2WAFA 3DU6A 1AA7A 2F4IA 1MMAA 3OIQA 4N4NB 2VXZA 2VJIA 2BW3A 2HVSA 3FBNB 4BDZA 3QYFA 5LFAA 2V26A 2BVLA 2L9NA 1X4PA 3EUKL 3OY9A 2R7UA 4BS9A 2W00A 4DBQA 2M4GA 4ZC3A 2CW8A 3RPUD 3M8JA 3HOTA 4HRIA 3PL8A 3KEYA 1QHGA 2CV0A 2VQCA 2GOXB 3D5RC 4XOTA 2X1DA 1BR4A 2RNGA 3OL4A 1Z3XA 4BQNA 4PSWA 3CF2A 2ZFUA 3J7AY 2CUZA 2HVQA 3HXLA 4ZTJA 3K4BA 4KITB 4RLFA 2DOAA 2HU9A 2BOLA 4BDYA 4ZDLA 2M4KA 1DQUA 2VKDA 3RTRA 4KISA 2V6EA 2Q2EB 5JHFA 1R6RA 2WB1A 4FETA 2IGOA 3CP8A 3U21A 1N77A 1N78A 2DXIA 3LSHA 4IZZA 4XKBA 3LFUA 3OYAA 3OMYA 2K9MA 5CQGA 1W36C 2JUGA 4B44A 2VLAA 3OYLA 3AFHA 2IGKA 2DT6A 3K4KA 4YEJA 2LY2A 2W1OA 4BE1A 3EUAA 2K5CA 2OC6A 3HPGA 4IQ4A 2V4JC 3PFYA 3OYMA 2RREA 4E7JA 3CZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  4J01 A;  3QOD A;  4YRV A;  3QOE A;  4IZZ A;  4HRI A; 
#chains in the Genus database with same CATH topology
 3M8F A;  2KIU A;  3A4C A;  4CIC A;  3R60 A;  1K78 B;  1V54 H;  1Y1W J;  2O3F A;  3ABL H;  3M7G A;  3PNT A;  1STZ A;  1DUX C;  1FJL A;  3HDD A;  5F08 A;  3GX4 X;  4F52 A;  3G71 I;  2QWW A;  1SVL A;  5FKO A;  3CF5 F;  2CJJ A;  3JRE A;  2GA1 A;  2HKO A;  3HHG A;  2XC7 A;  1FMV A;  1FOY A;  3FIS A;  4M3B A;  2LKP A;  2L5Q A;  1Z6T A;  1UMQ A;  4GGG A;  4DOZ A;  2EFO A;  3D5L A;  2LTP A;  1ZRF A;  1TC3 C;  1WZ2 A;  5F1J A;  3ZCO A;  2IA0 A;  5L3E A;  2V1U A;  2AXL A;  3FK6 A;  1IZ1 A;  1E3H A;  3K0L A;  3U1D A;  5J4V A;  3S2H J;  2L01 A;  1BI0 A;  2ID3 A;  1Z6R A;  1T39 A;  2K4B A;  2MC3 A;  2RGV A;  3E0J B;  4CZC A;  1KON A;  3HOU J;  4M9S A;  1G3S A;  1OYY A;  3CO7 C;  2ZSH B;  1MJB A;  1R5I D;  2X9D A;  4E4H A;  4ENM A;  5FKK A;  3GYH X;  3FWE A;  2JVH A;  2WV0 A;  2K9N A;  3JRF A;  1QQI A;  5GP9 A;  2XKP A;  4A0Y A;  3C2G A;  4NUB A;  3BZ6 A;  4M72 A;  3F8M A;  2ZXH A;  3ABK H;  3CCR I;  2RN7 A;  2WAE A;  3ZQH A;  1MGT A;  2R7R A;  2STW A;  4BE2 A;  2L4A A;  3M3Y J;  1S72 I;  3J7Z I;  3H9J A;  2Y31 A;  1XX5 A;  1BR2 A;  1D5V A;  2MSY A;  3LSK A;  2EK5 A;  2V9K A;  3JRD A;  3ERM A;  3VYT B;  4A0X A;  5ICF A;  3LAJ A;  3Q0W A;  3BG5 A;  4HNU A;  3RYR A;  1B1B A;  3KYC B;  2LH9 A;  5A2Q Z;  1X1B A;  2P5L C;  2ESN A;  3F6V A;  4XSX F;  3IH3 A;  5FB2 A;  2FSW A;  3TOB A;  2HI3 A;  4KT5 C;  2O8K A;  4IHY A;  1Q1V A;  2KP6 A;  1LKX A;  1USS A;  3KP5 A;  1OQY A;  2DFI A;  1APL C;  4EAT A;  1XGS A;  1XCV A;  3OOP A;  4HSR A;  1ERD A;  2XAF A;  1FNN A;  2DO7 A;  5GAH J;  4B4C A;  5K1Y A;  2ZJP F;  2BE5 F;  2VXD A;  2HYJ A;  3SDB A;  1YS6 A;  4V2G A;  1DGW Y;  4CZZ A;  5JLW A;  2WWY A;  1REP C;  1DU6 A;  4KN7 X;  2J5P A;  1U5T A;  1RRJ A;  5BOX A;  5E79 C;  4R8H A;  4W1U A;  4RGR A;  3MCZ A;  4U88 A;  4EM2 A;  2CV2 A;  1T0F A;  2JJ7 A;  2VUM J;  3ZMU A;  1AWC A;  2FNA A;  2E7W A;  1Z91 A;  1S5L C;  3SJM A;  4KNY A;  1ZG3 A;  4ZTF A;  1IRG A;  3I59 B;  1QGP A;  3DEU A;  1G8X A;  4JX4 A;  1TWC J;  2E5Z A;  3H5R A;  3Q0U A;  2ZCW A;  3LSP A;  3OR2 C;  3I4P A;  3I0T A;  5D6F A;  2Y69 H;  3DLL F;  2KHM A;  1JKP C;  1GXQ A;  3TGN A;  4Q4Z F;  3BTC A;  1ZAO A;  3ESW B;  3GFL A;  4UUS A;  2KFD A;  4ENK A;  2DI3 A;  5HS7 A;  4XBF A;  5E1W A;  3WU2 C;  3CO6 C;  1YTY A;  4OU0 A;  3L2R A;  1X1D A;  5E3O A;  2QBY B;  3JTG A;  3EYI A;  2PMZ A;  4IJA A;  4HLY A;  1O3T A;  2Z5U A;  1F43 A;  4IXA A;  3T1B A;  1U0J A;  2OPT A;  2VBZ A;  3CMM A;  2GIZ A;  2JMW A;  4J00 A;  1KU9 A;  1R4M B;  2Y75 A;  2YX7 A;  2DQL A;  1ZK8 A;  3DF8 A;  5LEJ A;  5ED4 A;  3OYE A;  1B8I B;  4P96 A;  2HZD A;  3NAU A;  3S32 A;  1ETK A;  2CG4 A;  2IW5 A;  3JSO A;  1P7I A;  3OIO A;  4ON0 A;  4IOC F;  4HF0 A;  2A07 F;  2ZXJ A;  1IXC A;  3HOS A;  1N25 A;  4YEL A;  3QAH A;  1BN5 A;  3OYN A;  3DBL B;  2QEN A;  2FE3 A;  5DD4 A;  2JRM A;  1PP7 U;  4J19 A;  2EFP A;  1FBQ A;  4II2 A;  1D0Z A;  2JA5 J;  2A3S A;  3C3W A;  2P5V A;  2RQQ A;  1OCP A;  1WJ5 A;  2OV7 A;  1YJW I;  2IBD A;  1LB2 A;  5L3D A;  3GTO J;  2KRC A;  2P81 A;  3CDI A;  2COB A;  4X1E A;  1I27 A;  3B6A A;  3C2B A;  2KL4 A;  3HC7 A;  3VFZ A;  3VYR B;  1XC5 A;  3U9G A;  1HQC A;  1MMG A;  1YG2 A;  2D2W A;  4W97 A;  4XID A;  3PJR A;  4XKW A;  3F8F A;  2VON A;  2JVG A;  3K6G A;  1NG7 A;  2JSC A;  3KP6 A;  4P9F A;  1UHS A;  5FJ8 J;  4IOA F;  4S04 A;  3HTS B;  3DPU A;  5EZH A;  1JT0 A;  3MQ0 A;  3LA3 A;  2Z1D A;  3FHZ A;  1VQK I;  4M3D A;  3LWF A;  1WJA A;  2EBI A;  2W57 A;  5H20 A;  2KIM A;  3JRB A;  2E60 A;  2M7B A;  1SVO A;  1Y56 A;  1O7L A;  3I3L A;  4G7Z F;  2K7L A;  2DFE A;  2M87 A;  3GVA A;  4ZH4 F;  1QZY A;  2OUM A;  3TED A;  2CSO A;  3J7Y J;  2P6T A;  2JA8 J;  2WB1 N;  2L2O A;  3MZY A;  4B09 A;  4PJN A;  4WXH A;  3T0Y A;  5TRD A;  4EGY A;  4H0E A;  3GLL A;  2HDD A;  1QHH D;  1D1A A;  3ZQ7 A;  5K7H A;  5F1R A;  1E17 A;  2DA1 A;  3LSM A;  4IPA A;  3JRA A;  5KHD A;  4MLO A;  3RZD J;  1MSF C;  1KZH A;  1GV2 A;  3BR2 A;  1TWF J;  4ZDO A;  2P7C B;  1WJD A;  2AHQ A;  2NYX A;  3WTX C;  5ERI A;  2DLL A;  4QLC U;  3HGG A;  3LA2 A;  2FF4 A;  1P2F A;  3VYS B;  5FLV A;  3FXO A;  1T33 A;  1IUF A;  1SD6 A;  2XRN A;  5ILU A;  1K6Y A;  3K1M A;  4BJ5 C;  1F5T A;  3REO A;  1XSX A;  5LRS A;  2I10 A;  1IRZ A;  2ZXW H;  3DKW A;  4E7Z A;  2Z3Y A;  1IN5 A;  1DP7 P;  2CQQ A;  5LGU A;  3HUG B;  1NH3 A;  1HST A;  4JOM A;  2DYR H;  1YIO A;  4EJW A;  1MBJ A;  1FSE A;  3FHN A;  4B48 A;  2FQ3 A;  1WFX A;  2XF7 A;  2XAS A;  3A0H C;  5HNH A;  1MND A;  4XQF A;  2CRG A;  3A02 A;  3G1M A;  4MIM A;  2EZL A;  5FD5 A;  2CW0 F;  2XAU A;  5LBQ A;  3FDY A;  4ZYE A;  4L18 B;  4M74 A;  1C0W A;  1W5S A;  5IT9 K;  3K69 A;  3F0C A;  3CCU I;  2EV5 A;  1OCT C;  5ICC A;  2E2H J;  1ZN2 A;  2OCC H;  2Q0O A;  2KMU A;  1IO2 A;  3DEE A;  4IHW A;  4ITV A;  1OJL A;  2DFF A;  2JTV A;  2WBM A;  2GOM A;  2P5K A;  3GEZ A;  2W82 A;  1S7A A;  4GO1 A;  5DDG A;  5J4Y A;  2W4S A;  2HOA A;  3ULQ B;  4LG0 B;  3H9Q A;  2R7W A;  5DYM A;  5E18 F;  2YUS A;  1V3F A;  1XB4 A;  5FFZ A;  3FXQ A;  1ZGA A;  3JRC A;  2R5Z A;  3WGI A;  4LOC A;  3WU1 B;  1I1S A;  5LGN A;  3I56 I;  2MD0 A;  5JHU A;  1SMT A;  5IT3 A;  4WWC A;  3IL2 A;  3RIR A;  1UHW A;  4CHU A;  1M1E B;  2RKH A;  5EJC A;  5IY5 H;  4UB6 C;  3HM5 A;  4PDK A;  4NNJ A;  4AVP A;  1VQ5 I;  1SAN A;  1XMA A;  4EMS A;  2VPL A;  4JX5 A;  3OYH A;  1GVJ A;  1LNW A;  1TWA J;  3PNY A;  4RM2 A;  3OYD A;  3G4S I;  4FCY A;  3GTG J;  4BEH A;  5CPR B;  5IOY A;  3VPR A;  1T2K A;  2Z2S B;  2R7D A;  4HBL A;  2V1N A;  2VT2 A;  2OJE D;  1LJ9 A;  2ETH A;  3PSI A;  5TIS C;  2V1D A;  3WTW C;  2Y0S A;  2CV1 A;  3VYU B;  4BXX J;  4II3 A;  4UVA A;  1LVA A;  4V19 K;  1XDS A;  1YW7 A;  2E1M B;  3DLA A;  5C4J J;  2VBX A;  3V8K A;  1Y1V J;  4RA2 A;  1RKT A;  1IRF A;  2XSD C;  4IX7 A;  4OOI A;  4C3J J;  1BI1 A;  3HOX J;  3QWL A;  3QOE A;  1RUO A;  5M3M J;  3OYB A;  4Q5S F;  3BY6 A;  4RAG A;  4BNC A;  1B72 A;  4NC6 A;  4CH7 A;  2EFW A;  1NK3 P;  3H0G J;  1D8K A;  2Y0M A;  4RB1 A;  1BC7 C;  2VE8 A;  1YIJ I;  3FMQ A;  3Q3S A;  1YJN I;  1CGP A;  3BLY A;  2DU9 A;  3OS1 A;  2O0Y A;  4XRS A;  1FBS A;  3DU6 A;  5HLH A;  3ML6 A;  2VXZ A;  5FFX A;  1MH3 A;  4IRG A;  2BW3 A;  5LHH A;  5LFA A;  2ZFW A;  3EUK L;  2BVL A;  1BJA A;  2O03 A;  4BS9 A;  3CC2 I;  1U78 A;  4L0Y B;  2KIF A;  2M4G A;  3RPU D;  4HX8 A;  1QZE A;  5JI6 A;  3KEY A;  3WTY C;  5CVI A;  2XGX A;  1OCC H;  1Z67 A;  2BV6 A;  2F4O B;  4ZYH A;  1UB9 A;  3OL4 A;  1T56 A;  4A6D A;  1JKQ C;  1HKS A;  1LEB A;  3CF2 A;  4KMU X;  3HXL A;  2MH9 A;  3NRV A;  2DJN A;  1BI2 A;  2DOD A;  4RGS A;  3TO9 A;  1O3Q A;  2DOA A;  1ZQ3 P;  2DDB A;  3TW7 A;  4BDY A;  4ZDL A;  3CCQ I;  1DQU A;  4MEY F;  2R92 J;  2DW4 A;  1ULY A;  2JQ7 A;  2QM3 A;  5DCM B;  2IGO A;  4G7H F;  1FSH A;  1N78 A;  4D7M A;  9ANT A;  3WGG A;  2EH3 A;  4A69 C;  1QVU A;  2K9M A;  5CQG A;  2JUG A;  1E3P A;  1TW2 A;  3W6J B;  4B44 A;  1LFB A;  4A3E J;  1GDT A;  2IGK A;  2DT6 A;  2VN2 A;  3J80 Z;  5FLX Z;  1GT0 C;  3GLX A;  3KZY A;  5CYV A;  5BQT A;  3HPG A;  3CCL I;  4IQ4 A;  2XGD A;  2V4J C;  4OAZ A;  3MFK A;  1I6H J;  1O7F A;  3M8J A;  1JKO C;  2XSJ C;  1X3Z B;  3WHC A;  3P9I A;  5L3C A;  1UST A;  3ZQI A;  4ETS A;  4KJZ A;  3NAR A;  2QA4 I;  2BGC A;  5HOD A;  2ID6 A;  2KIQ A;  2NAZ A;  2ESH A;  3GFI A;  2K02 A;  3I9V 2;  2YSR A;  3DBH B;  2IS2 A;  2OZ6 A;  5HLT A;  5EGO B;  5KAI C;  1SFK A;  2X1C A;  4GDF A;  2EA4 A;  2UWM A;  1QO0 D;  3FXU A;  3GZN B;  4QTR A;  1BIB A;  1VQ8 I;  3HHH A;  1I3Q J;  4WK8 F;  1MSE C;  2NS8 A;  1ZR4 A;  4QPO A;  1Z21 A;  3E5Q A;  1F4K A;  1PYV A;  2DCE A;  3CES A;  3ZMS A;  1U2W A;  2KDO A;  1JHF A;  4PSX A;  2ISY A;  3B6C A;  3MKZ A;  2G0E A;  2M8E A;  3OV8 A;  2TCT A;  4KUM A;  5E8G A;  4A3F J;  2WAQ A;  5K7Z A;  1JUM A;  3CJR B;  3ZN0 A;  1WJC A;  4A3L J;  5KCM A;  3ZXS A;  1MMD A;  4HF1 A;  2YU3 A;  2EZH A;  3JR9 A;  2NVX J;  1WJF A;  2CQK A;  2XAH A;  2V9P A;  3CCJ I;  3DFG A;  3ZMV A;  2KJC A;  4HOB A;  2ECC A;  2K85 A;  2OQR A;  1VQO I;  1YJ9 I;  2CQN A;  3CUQ B;  5CVJ A;  2A6H F;  2XB5 A;  1RZ4 A;  4FX0 A;  3GTQ J;  3ONQ A;  4HX4 A;  1ON1 A;  2CO5 A;  4L9N A;  3GXO A;  1JE8 A;  4MNU A;  3WTT C;  1MMN A;  2AQF A;  5F0H A;  3H0D A;  2LOO A;  4XL9 A;  5HNF A;  3ZQF A;  3I5U A;  3F6O A;  1ZTR A;  1CF7 A;  1J0R A;  2LBF B;  4C30 A;  1AKH B;  2DA2 A;  1SC7 A;  2E5N A;  2UXX A;  2STT A;  4ESB A;  1R5G A;  1YRN B;  2H8R A;  1S7O A;  4I7H A;  1Y8Q B;  2VQL A;  3G1L A;  1FYL A;  3KZI C;  3S1R J;  2X48 A;  1RR8 C;  1IDZ A;  2TRT A;  4E7K A;  3HJE A;  4FIS A;  4CUG A;  2M5W A;  5D8L B;  4MO7 A;  4E7H A;  4IL6 C;  2W48 A;  2DAO A;  4JQF A;  2R7O A;  5EDN A;  1BW6 A;  2XPW A;  2RDP A;  5JR3 A;  2HQA A;  3L9F A;  4JK1 X;  4C3I J;  3BOQ A;  1DGR M;  1D3Y A;  1SAX A;  3KEO A;  1OCR H;  4NC7 A;  2AXT C;  4PJL A;  1YHQ I;  2MBF A;  3FX3 A;  2R7S A;  4RGX A;  4XKV A;  2PFB A;  1F9N A;  2OTL I;  4HYE A;  2GXB A;  2R7V A;  4LLG F;  1A35 A;  2BEO A;  2D1H A;  2VQG A;  2CH0 A;  5TGT A;  2UUZ A;  1FOK A;  4KIC A;  3ABT A;  1OR7 C;  3T8R A;  2PJR A;  1IXR C;  2HNH A;  2Y30 A;  4U7D A;  4Y7N J;  3DKY A;  1Z0X A;  4PJJ A;  4E7I A;  1YQA A;  1KYW A;  2X4H A;  1LDD A;  2GWR A;  1TWG J;  1U6G A;  2CQX A;  3EPZ A;  2M30 A;  4AID A;  2R7X A;  4XLF A;  1TT0 A;  2LYC A;  2DA5 A;  1XD7 A;  1T98 A;  2QQA A;  3S3N A;  2IGM A;  4KYW A;  4KN4 X;  2Y9Z A;  5BPD A;  2HWV A;  4AIH A;  1RC9 A;  1ODD A;  2F48 A;  2ME6 A;  4EV0 A;  1DPU A;  1XPX A;  4HV5 A;  1W0T A;  1VQ4 I;  3ZOB A;  3H36 A;  2HYF A;  1IAW A;  3QU6 A;  1VQP I;  2X6X A;  2P0W A;  5M5W J;  1BL0 A;  4HZF A;  2IPQ X;  2K9Q A;  2QUF A;  3HKZ N;  3NQO A;  4IRH A;  1NG6 A;  3ZN1 A;  1R58 A;  5J8C A;  2L3D A;  5E3M A;  1SFX A;  3RYP A;  2LC2 A;  4BXF A;  3QRF F;  4BQQ A;  2BHY A;  2GXA A;  4IHT A;  2JA7 J;  3P9C A;  2FOK A;  2WAD A;  3LAP A;  2COM A;  2EV6 A;  3IAM 2;  1YX5 A;  2X6W A;  3W6K B;  2NVU B;  4U0Y A;  3H92 A;  4L9J A;  1FP2 A;  3HSR A;  3LNQ A;  2D5V A;  3H3Z A;  3FKI J;  5M5Y J;  2PX9 A;  2DTR A;  2FUG 2;  5B3S H;  1WQ2 A;  3V4G A;  2E1M C;  3KX2 A;  1WH5 A;  1XS9 A;  2XDV A;  1FC3 A;  4EVI A;  1SD5 A;  3L7W A;  4AU7 A;  2KT0 A;  1GLN A;  2OU2 A;  2VJ5 A;  2IJL A;  4KDP A;  1MJA A;  2CU7 A;  3BG9 A;  4XSZ F;  4KFC A;  2CS3 A;  5J6X A;  1U3E M;  1JUP A;  1PUF B;  3SFI A;  2QKL B;  4KIB A;  3BDD A;  2LFB A;  3KPH A;  5J1U A;  4LLL A;  2L7K A;  4XLP F;  4AIJ A;  1E2X A;  2Q2E A;  3L2W A;  1SVM A;  3A2K A;  3G73 A;  2GQQ A;  5BS6 A;  2E35 A;  2KRH A;  5F6F A;  4BY1 J;  2L7M P;  2PBI A;  5L3B A;  3FIW A;  4BAC A;  1UCR A;  4DIQ A;  2L9S A;  3LQQ A;  4L5E A;  3J7A O;  3BRO A;  1MDM A;  4YFN F;  4I01 A;  1ZG1 A;  5M3F J;  3S1Q J;  5LHG A;  5L3F A;  4A2U A;  2N8G A;  3W2W A;  3HOY J;  2HDW A;  1YIT I;  1TZL A;  2A05 A;  3BPX A;  4LB6 B;  1ZRD A;  1BA5 A;  4EM1 A;  4XLC A;  4YRV A;  1BW5 A;  4A3B J;  3H9G A;  3EDP A;  3C7J A;  1JXS A;  3IV5 A;  3V7C A;  3CCV I;  3AG4 H;  3BR3 A;  1U8B A;  5AIQ A;  5D8K B;  4ANJ A;  3S2D J;  1K61 A;  2L02 A;  1VQ6 I;  5D5U B;  1U8R A;  2IGN A;  5GAD J;  3QPL A;  3ZPL A;  4BAY A;  5KNL A;  4CYD A;  2P8T A;  2VIX A;  2VOP A;  2M45 A;  1XG1 A;  2E1O A;  1WH7 A;  5E8I A;  4WCG A;  4C2T A;  5HDG A;  1ZGW A;  3Q5F A;  5FLM J;  1PP8 F;  2DBB A;  4M6X A;  2HS5 A;  3O8H A;  4NC8 A;  1S3J A;  4BQA A;  1QU3 A;  2V6C A;  4DGW B;  1SMY F;  1ZKG A;  5HDK A;  2LKX A;  4PGH A;  1OLT A;  3D5S C;  1OIS A;  3UR3 C;  2G7U A;  2GLO A;  1PDN C;  1F36 A;  1LDJ A;  2H6C A;  3W2A A;  4A3I J;  3OL3 A;  1SD7 A;  1X1A A;  3C18 A;  4RM3 A;  5FKL A;  2FNP A;  2FU4 A;  4UUV A;  2ICW G;  3QP6 A;  1H8A C;  4M71 A;  3K70 D;  1TT5 B;  2QEX I;  1FZP B;  2K3P A;  1XCB A;  1VQL I;  4G9Y A;  5FO5 A;  3PQJ A;  4WX9 A;  3BC8 A;  2L9R A;  4FE4 A;  3H5A A;  1KYZ A;  1J75 A;  2YU9 J;  3WE2 A;  2XIG A;  4RB0 A;  4BUP A;  3L09 A;  3QOD A;  1PUE E;  2E34 A;  2R0Q C;  4FE7 A;  2ZBK A;  3JSP A;  3FMR A;  3U1K A;  1IN6 A;  1I1G A;  2BZT A;  1ETV A;  3TL4 X;  3ZMZ A;  4CDG A;  2ZNZ A;  4NQW A;  2XF5 A;  3O3K A;  4RS8 A;  2GZW A;  4IO9 F;  5IT9 Z;  3CP2 A;  3CMY A;  4XLH A;  4CYC A;  3QOP A;  1SD4 A;  2LDU A;  4LIV A;  5H6Q A;  5DS9 A;  3K10 A;  4RBO A;  2VOO A;  4L9T A;  4G7O F;  4XOP A;  1LEA A;  3K4M A;  4PFO A;  1IGN A;  2DQR A;  3GBG A;  1T08 B;  3BPV A;  4LG3 A;  4DQ2 A;  2NNY A;  1U5T B;  3UKG A;  4WXD A;  2J5O A;  4IKF A;  3CUQ C;  1HW2 A;  2GBY A;  2KIS A;  3IWZ A;  2L0K A;  1ETX A;  1G3W A;  2ZO4 A;  3MKY B;  4P55 A;  2Q1Z B;  1VI0 A;  4ABZ A;  2LG4 A;  3WTV C;  1D5Y A;  3V7S A;  3V8J A;  2F5E A;  3IAS 2;  2MLG A;  4XK4 A;  2QSF X;  3DTE A;  3KCC A;  5EEH A;  4YIF A;  2DMP A;  3NWS A;  3DCF A;  2XRL A;  4HNT A;  5CQE A;  5IPA A;  5ILV A;  3OOU A;  4Y13 A;  5ILS A;  4KIF A;  4UUS B;  5LD2 C;  3QP5 A;  4L0Z B;  1D8J A;  1K7A A;  4G94 A;  4M6V A;  5J8F A;  2JWT A;  4LIU A;  2E19 A;  2GXG A;  2QCO A;  3H3V K;  4RLQ A;  3ZR8 X;  3H1C A;  3VSL A;  2ZKZ A;  5IP7 J;  1MBF A;  3R0A A;  4EJO A;  1D0X A;  2VB6 A;  4H4K C;  3ASO H;  5A2Q K;  4XLA A;  4QWQ A;  5J47 A;  1J59 A;  3O8G A;  2GIV A;  4KMF A;  2ZME A;  5D5W B;  4CSW A;  4YFK F;  4ZYD A;  2CFX A;  5EEG A;  2W24 A;  3PUF A;  5F04 A;  4PJM A;  2NOG A;  2ZXI A;  3GO5 A;  1QZZ A;  2P4W A;  2Q8K A;  3DTI A;  4IRI A;  2DFH A;  4F92 B;  2DDA A;  2KJB A;  2KQR A;  3R4K A;  3DPT A;  2R7Z J;  2A69 F;  3IH4 A;  5IYB J;  3D0S A;  2CUJ A;  3CCY A;  1FYK A;  1AA7 A;  3OIQ A;  4S05 A;  1BOA A;  4ZYG A;  1AHD P;  1RUN A;  1P6R A;  4XRS G;  3U2R A;  1P4A A;  5E1Z B;  2HVS A;  2X6O A;  1GUU A;  2L54 A;  2A68 F;  1X4P A;  2FOW A;  3OSG A;  1YFH A;  3TO7 A;  2W00 A;  3LOC A;  1UFM A;  2DMQ A;  2IAI A;  2OF7 A;  2CYY A;  4OIR F;  3HOT A;  2ZC2 A;  5JVT A;  4MFE A;  3D5R C;  3JRI A;  3WTU C;  4XOT A;  3CMA I;  1TW3 A;  1YS7 A;  1BR4 A;  2X1D A;  3KZZ A;  1HBX G;  1RPW A;  2XAJ A;  4IHX A;  2DMN A;  1J2X A;  1OCO H;  4PSW A;  2ISZ A;  3MKL A;  4UXN A;  1NK2 P;  1JHH A;  1U9N A;  3Q9S A;  2DMT A;  4LLN A;  4LK0 F;  3HZJ A;  5K7F A;  3TO6 A;  2KZG A;  5M5X J;  4PJ0 C;  2NNN A;  4RLF A;  2DTZ A;  4GFB A;  2V6E A;  2WB1 A;  4FET A;  3U21 A;  2Z33 A;  2QZ8 A;  2DXI A;  2PLY A;  1MBH A;  3LSH A;  2RV8 A;  4M9Z A;  4IZZ A;  4XKB A;  3LFU A;  5GTH C;  1LE8 A;  3I4N J;  4U0W A;  5FD6 A;  2VLA A;  4AYB N;  1GHC A;  1O4X A;  2E1C A;  2D45 A;  1VQ9 I;  2W1O A;  4BE1 A;  3EUA A;  2JPB A;  2K5C A;  4XRM A;  3PM1 A;  4OAY A;  2RRE A;  2EJR A;  1ETQ A;  3QQA A;  4HQE A;  1JJ8 C;  3EUH A;  3A01 A;  2KZV A;  2M0C A;  2JRT A;  1WI9 A;  5E20 A;  4PCQ A;  2CUF A;  3IRR A;  4UHT A;  1FOX A;  4UUT A;  1BIA A;  4D1Q A;  2IEK A;  3DWL E;  3GZ6 A;  1Z7U A;  3BG6 A;  2FBK A;  3QU3 A;  3COA C;  1H9G A;  1IN7 A;  2VKE A;  4P5O A;  5C4X J;  2DYS H;  2X1E A;  4BHP A;  3H5N A;  1TQP A;  2KKO A;  5DEQ A;  2DA3 A;  2IS4 A;  3WGH A;  3GTJ J;  4DYC A;  1D1B A;  4NHJ A;  2G7H A;  4IVN A;  4CCJ A;  3E6C C;  1H0M A;  2CQ7 A;  3OYJ A;  4CCK A;  5IYC J;  3BZK A;  3GUD A;  3PO3 J;  3FXL A;  3GWZ A;  2HXI A;  1UAA A;  4BKX A;  1S6L A;  3HPH A;  2XF6 A;  3RPQ A;  4BYY A;  1FBU A;  2D1V A;  3PSF A;  5HDN A;  4DYQ A;  2V79 A;  2X51 A;  4AC0 A;  2F5V A;  4RDU A;  3TP3 A;  4PUS A;  2M2E A;  2OD5 A;  1G59 A;  3M4O J;  4OIO F;  4LGW A;  2W7N A;  1W5C C;  3I54 A;  1Y8R B;  4F55 A;  4J01 A;  2XPV A;  5FRO A;  4HQM A;  3MWM A;  4A3C J;  3OYG A;  4O5V A;  5J40 A;  3RPU A;  1SFU A;  4BU2 A;  2X85 A;  4X0G A;  5IP6 A;  1LFU P;  2HGC A;  3LSG A;  1Z77 A;  4UVC A;  4HDU A;  2FML A;  1EH6 A;  1A6I A;  1WKM A;  2HOE A;  2HXO A;  4E7S A;  1B4A A;  4RAF A;  2W84 A;  3BG3 A;  3MMY B;  4DW6 A;  2R5Z B;  3F9K A;  3HGY A;  1JGG A;  1P4X A;  5BNG A;  2OZU A;  5DV5 A;  3RQI A;  1BJZ A;  4ENJ A;  2LK2 A;  4HDV A;  1HXD A;  2IP2 A;  1ETY A;  3K2Z A;  2RQP A;  3S15 J;  1D0Y A;  2BHZ A;  4N0B A;  3I55 I;  1ONV A;  4CCN A;  4ZZL A;  5AIP A;  3F8C A;  2PI0 A;  2EA2 A;  1IXS B;  4BEH B;  1TQM A;  1OFC X;  5IOZ A;  2VC0 A;  1ZGJ A;  3OSF A;  2RNJ A;  1HDP A;  3TDU C;  1S7E A;  2QVO A;  1KQ9 A;  2PN6 A;  3KE2 A;  4I98 B;  2RVC A;  3NWT A;  2FBI A;  4Q47 A;  2QKM B;  4U7B A;  1T38 A;  2NXN B;  1OCZ H;  3BR5 A;  4HPQ A;  1Y6I A;  1FMW A;  1R23 A;  1MJ9 A;  3CCS I;  4RMN A;  2Y9Y A;  1T8I A;  3DXJ F;  3S1N J;  5GPC A;  3AG3 H;  3LA7 A;  1HKT A;  4B8X A;  1W7P A;  4YFX F;  3FXR A;  4JYK A;  3PO2 J;  3B02 A;  1WRJ A;  3K70 C;  3P9K A;  1I50 J;  3SDG A;  5CVV A;  4EEF G;  1EH7 A;  2M0M A;  2DMU A;  3SXY A;  2XAG A;  1HCR A;  1LFP A;  3IHU A;  1B72 B;  2DA7 A;  1HW1 A;  4M73 A;  1UHM A;  4D9J A;  3EQL F;  2H1K A;  2OCE A;  1TNS A;  4UB8 C;  3GTM J;  4F3Q A;  5DM6 F;  2YR2 A;  1V5E A;  2Z99 A;  3S16 J;  5F64 A;  1A31 A;  1U5T C;  1YW9 A;  2NVY J;  1LVK A;  2XAQ A;  1FTT A;  1JI8 A;  3F21 A;  1JKR C;  1X2M A;  1T0F C;  2BW3 B;  2JK3 A;  4OWR B;  3AKZ A;  5DD8 A;  3M1C A;  4UV8 A;  1G6N A;  3O6B B;  3V7R A;  3GF2 A;  1JJ6 C;  1E0E A;  3K4L A;  2LR8 A;  2HOT A;  5KK1 A;  1V55 H;  1KU3 A;  3MD2 A;  3P7N A;  4MTD A;  1WCM J;  3OYC A;  3N4M A;  2BY2 A;  4LK1 F;  3AL0 B;  2R3S A;  4BGD A;  3KP3 A;  3BQY A;  2K86 A;  2V7F A;  2MG4 A;  1DP3 A;  1IUY A;  2R5Y A;  1ON2 A;  1O3R A;  3ERE D;  3VSK A;  2CMP A;  3W3C A;  5CJ9 A;  4CCM A;  2LNB A;  4K2E A;  2FXA A;  1ZYR F;  1LDK B;  5DTD A;  4ZZD A;  3A1Y A;  4MTE A;  3CCE I;  3K4C A;  2Z16 A;  2VE9 A;  1HDD C;  3S14 J;  1Y39 A;  1A04 A;  3MVP A;  4I99 C;  4KT6 A;  4A5M A;  4IHS A;  3BTL A;  4PFP A;  2HEO A;  2VL8 A;  1JTX A;  3GW2 A;  3E5U A;  2E2J J;  2M1B A;  5H6R A;  3GFJ A;  4HF2 A;  1ZRC A;  3DQV C;  1I39 A;  4IEJ A;  1G4D A;  3R61 A;  1TNT A;  2LY1 A;  2IS6 A;  4Z2Y A;  2GM4 A;  4FHT A;  1X1C A;  3WTS C;  2LLK A;  3E6M A;  4M3E A;  4Y52 J;  3PUB A;  2LSO A;  3C2H A;  3M9A A;  3HL2 A;  4B1R A;  2IRF G;  2YPR A;  1BBY A;  5LRR A;  2LF7 A;  1QBJ A;  3BP8 A;  3E7L A;  1V5G A;  2DA4 A;  3HEF A;  3HTU A;  4OIN F;  4B3X A;  1W0U A;  1O3S A;  1R1U A;  1Z7L A;  4IQJ A;  3ZP5 A;  3G6E I;  2O8X A;  1A6Q A;  5DM7 F;  2BY3 A;  1MMS A;  4XN0 A;  1VFC A;  5GTI C;  3I58 A;  2EFN A;  5FRN A;  3I53 A;  3IP4 B;  1S9H A;  5EZG A;  4NB5 A;  5E3N A;  3JAM K;  4LJZ F;  4AD9 A;  1Z05 A;  2DN0 A;  1ZRE A;  3CME I;  2EIM H;  1ETO A;  2VI6 A;  4E7L A;  2HPM A;  4QSH A;  4I02 A;  3CQZ J;  1K4T A;  3SEQ A;  1FT9 A;  1ACI A;  4YII A;  3R6S A;  1YE9 A;  1AOY A;  4A5N A;  3I71 A;  2K40 A;  4ZDP A;  3J80 K;  1CQT A;  4DZJ A;  3RKQ A;  2R7Q A;  2A5W A;  2HPI A;  2OAZ A;  2AO9 A;  3DV8 A;  3HOW J;  2W85 A;  3GZ5 A;  2XV4 S;  3WG9 A;  2FQ4 A;  4BJT A;  2H27 A;  5HS9 A;  4GCV A;  2VQH A;  3ASN H;  3WE3 A;  2LRD A;  1EA3 A;  2PQ8 A;  4XM3 A;  5HS8 A;  1ENH A;  1CF7 B;  3HYI A;  3BZC A;  2H09 A;  5K5R A;  3MN2 A;  2JA6 J;  1FTZ A;  3KET A;  3DBR B;  2HQR A;  5EG0 A;  4HAM A;  3F8B A;  1GV5 A;  1FYM A;  5B1A H;  3GTK J;  3ELK A;  4BXU A;  3BJA A;  2MC4 A;  3KP2 A;  2I5U A;  1FOW A;  2M7A A;  1F1Z A;  4C3H J;  1R36 A;  3H3U A;  2HR3 A;  4XOR A;  1YI2 I;  4D7N A;  3RQ4 A;  1BC8 C;  4F91 B;  1TLH B;  4B47 A;  1IV6 A;  5CVU A;  3MKW B;  4PK4 A;  3RI4 A;  2XKO A;  4I2O A;  2L9V A;  4I0A A;  1EKE A;  4M6Y A;  2MGQ A;  2OQG A;  2WY7 Q;  1AU7 A;  2O6G E;  4LMY A;  2IA1 A;  5ICE A;  2K27 A;  3L2Q A;  5E1X A;  1YLF A;  2ZNY A;  3SQN A;  1V4R A;  1SEU A;  1J9I A;  2DA6 A;  1XMK A;  1MBK A;  2QLZ A;  3TDZ C;  4WF2 A;  3A03 A;  4LFU A;  1WI3 A;  3PNV A;  4JX6 A;  5FKN A;  4A12 A;  1Q1H A;  3J81 K;  2K9S A;  3HOV J;  2K9L A;  2PJR B;  4O3M A;  2B63 J;  2ELK A;  4MQ9 F;  3BT9 A;  4CCO A;  4CXF A;  2UXN A;  5F0C A;  1I3A A;  3GFM A;  4AIK A;  3F72 A;  5CKT A;  2QQ8 A;  1S29 A;  3EUH C;  2CWE A;  3I59 A;  4N9I A;  1Z3Y A;  3HRS A;  1X19 A;  2VKV A;  2X0L A;  2L4M A;  1QNT A;  1GXP A;  2X6Y A;  1WVR A;  4EJV A;  1BM9 A;  1MBE A;  4HW0 A;  1Y0N A;  2WY8 Q;  1HKQ A;  2PEX A;  3OR1 C;  1EH8 A;  3HKZ A;  3S8P A;  1FPQ A;  3LMM A;  2HTJ A;  4NDL A;  4PGG A;  5EG0 B;  1IW7 F;  3AG1 H;  2JA2 A;  2VT3 A;  1K4S A;  3BQZ A;  1S8N A;  2XVC A;  2M3A A;  4XIC A;  2PMH A;  3BR0 A;  3KIO A;  2QBY A;  4O6J A;  3S17 J;  1A5J A;  2CFO A;  2CW7 A;  3VDX A;  3JCU C;  3RKW A;  1L0O C;  2A6T A;  4FTH A;  2MH2 A;  1Z1D A;  3HB9 A;  2WAF A;  1ZAR A;  4Y15 A;  3FXM A;  4N4N B;  3ROU A;  2VJI A;  1RR7 A;  2PMZ N;  4V2F A;  1B8I A;  3FK7 A;  2E2I J;  2BBY A;  3QYF A;  3LST A;  1YW8 A;  2L9N A;  3ECO A;  3PQK A;  3OY9 A;  2R7U A;  1XN7 A;  3LSR A;  3BR1 A;  2CW8 A;  3E5X A;  1NTC A;  2HKX A;  1EJ9 A;  3T5X A;  4HRI A;  3VOE A;  1QHG A;  1PVE A;  3GCM A;  2VQC A;  3LSJ A;  3VB2 A;  2GOX B;  1WSU A;  4EQQ A;  3CC7 I;  2Y2Z A;  2H94 A;  5DUI A;  2DOE A;  3J7A Y;  3EYY A;  5LGT A;  2HVQ A;  3RKX A;  4ZTJ A;  2FRH A;  4AUX A;  2Z9O A;  2TDX A;  2HU9 A;  1HF0 A;  2BOL A;  1R9T J;  1HLV A;  4A3G J;  2BY0 A;  2M4K A;  2XGE A;  2DK8 A;  4AM3 A;  2EQR A;  2Q2E B;  1R6R A;  3KLO A;  4G8X A;  1X3W B;  5FGM A;  4BBS J;  3JRH A;  1X1P A;  4I0B A;  4S0H B;  1EV7 A;  3OYA A;  4TV7 A;  4HNV A;  1W36 C;  2YS9 A;  3JTH A;  3OYL A;  3AFH A;  4I09 A;  3ZQC A;  1MDM B;  3T8T A;  3MZH A;  4A93 J;  2OC6 A;  4XRF A;  3OYM A;  4E7J A;  1KU7 A;  3CZ6 A;  4BQO A;  1RI7 A;  4HV6 A;  4P9U A;  2DPU A;  3BWG A;  4HLX A;  2H1L A;  5HOO A;  3CDH A;  3WU0 A;  2E7X A;  1ZEL A;  1Y0U A;  4OIQ F;  3AL0 C;  3KP4 A;  3IWF A;  1RIO H;  3CC4 I;  4LB5 A;  1E3O C;  4RAZ A;  2M34 A;  2LRE A;  3HBL A;  1TWH J;  1IN4 A;  3F23 A;  3FXK A;  2QSH X;  3ZMD A;  3PIP F;  2NVT J;  4MFD A;  2VJJ A;  2O7O A;  1IV8 A;  5E17 F;  3QYB A;  3R0J A;  4DNC A;  2BYV E;  1MNM C;  2HFH A;  3K9T A;  3MZ8 A;  1MBG A;  1SFO J;  1XGN A;  5GAG J;  4YG2 F;  1JGS A;  1KA8 A;  1QPM A;  2MW8 A;  5K5Q A;  5EEA A;  4UY8 I;  1YOV B;  3FM5 A;  4DJA A;  3TOA A;  4HEA 2;  3VEP A;  2HQN A;  5EYR A;  2HOS A;  4Q48 A;  3S2W A;  5DUK A;  1R4N B;  3HUG A;  5AON A;  4UNO A;  2R7T A;  1FEX A;  4CA0 A;  2LVS A;  2JN6 A;  3SFZ A;  1ORK A;  4F7Z A;  3GTL J;  1P92 A;  6PAX A;  4ESF A;  1QA6 A;  3MAJ A;  4M9X A;  2FA5 A;  3BR6 A;  1IG7 A;  4DBR A;  2HYG D;  1VND A;  2EIL H;  5C44 J;  1XSV A;  1EF4 A;  1MIJ A;  3F3X A;  3UNG C;  3L2C A;  4E6K G;  3KLN A;  2QQB A;  5DCF A;  3Q9V A;  1W5T A;  4FQG A;  4NBQ A;  5FRM A;  1VQ7 I;  2QSG X;  1G3T A;  4BH9 A;  1WHU A;  4BL0 B;  2BXZ A;  4RGU A;  2UV1 A;  2VC1 A;  2ELH A;  5JFR A;  5ICG A;  2VAS A;  1XTA A;  4NQW B;  1TBX A;  4BY7 J;  1QVT A;  1OR7 A;  5LHI A;  1SAU A;  1QRY A;  3S3O A;  4AWX B;  4FT8 A;  4CYC B;  2E36 A;  2MD5 A;  2QQ9 A;  5B5E C;  3X2Q H;  3HRU A;  1IJW C;  1WJE A;  2FBH A;  3ABM H;  4C2U A;  3BJO A;  1YYV A;  1FX7 A;  3CJT B;  5LEK A;  1X58 A;  4LG0 A;  4OMZ A;  2F6C A;  2EWN A;  2NOJ B;  5D4S A;  2IA2 A;  1DU0 A;  5D5X B;  1IF1 A;  2VBY A;  3FM3 A;  1P4W A;  4G6Q A;  2O9L A;  3S1M J;  3ZRG A;  1U9O A;  1WGX A;  1H9T A;  1VZ0 A;  2IS1 A;  2FMY A;  1VQN I;  1R49 A;  1PJR A;  2K3F A;  1BI3 A;  2EIJ H;  2LMD A;  3L00 A;  2F2E A;  4A3M J;  1MH4 A;  1POG A;  2NRA C;  4P1W A;  1K79 A;  3ECH A;  4G12 A;  1KU2 A;  4XLN F;  5D5V B;  1J7K A;  1B9N A;  2FJ1 A;  4KIG A;  4AVZ A;  5H2F C;  5B66 C;  4R1H A;  3FBI B;  1IDY A;  1JUS A;  3ZMT A;  2HZT A;  4QIW N;  4M3G A;  2IXS A;  2I8D A;  3L2V A;  3N05 A;  5IYD J;  1O57 A;  2NS7 A;  1H88 C;  1TTY A;  4FAS D;  4WXC A;  3KFW X;  3KYD B;  3E3V A;  2EFQ A;  1DPR A;  1NHA A;  2AS5 F;  1UZC A;  1OYW A;  2DT7 B;  1XDU A;  3TBI A;  4BHC A;  3LQR A;  2JT1 A;  3D1N I;  3F8N A;  2DJI A;  2RC4 A;  2W25 A;  1N75 A;  2ZME B;  3HG9 A;  4A3K J;  2NS0 A;  1VF9 A;  3E1S A;  5C3E J;  1ZG5 A;  2VKH A;  2RAE A;  2LKS A;  2LD5 A;  4U0V A;  3BTJ A;  1K6O A;  4CO8 A;  4UV9 A;  2Y0S N;  3OS2 A;  4IF4 A;  1IRX A;  3CUO A;  1UG2 A;  4PZJ A;  1ZHF A;  4XR6 A;  4XLE A;  3CJN A;  4ZJZ A;  3KEQ A;  2OBP A;  5GAE J;  3F22 A;  5CLS A;  2LY9 A;  2MYS A;  4B3A A;  2IVM A;  2FX0 A;  2F5C A;  3PFI A;  2ELJ A;  4M3F A;  1J5Y A;  3SHF A;  3H35 A;  3BJ6 A;  1ZLJ A;  4GRI A;  3BG7 A;  3NEU A;  4D0P A;  5E3L A;  2JSP A;  5HVQ C;  3LFK A;  1WWX A;  5IP9 J;  2EV0 A;  3G3Z A;  4XKC A;  1VTN C;  5D4R A;  3WHB A;  3CCM I;  4E70 A;  3AG2 H;  3DTK A;  4G6T B;  2VPR A;  4L9V A;  3IH2 A;  4C9Y A;  1XSD A;  1J09 A;  3EET A;  2KLO A;  3OYK A;  1H89 C;  1T95 A;  4AYB A;  1MD0 A;  4R79 A;  5JLX A;  1FIA A;  3DP7 A;  2EIK H;  3OS0 A;  2BXY A;  5LLQ A;  1LE8 B;  2P7V B;  3RJP A;  3JRG A;  2A6E F;  1ITY A;  3V8L A;  1OKR A;  4MEX F;  2O61 A;  1UG0 A;  1I6X A;  2ECB A;  3W6V A;  2K4J A;  1MW7 A;  2F5D A;  1JTY A;  5DCM A;  2HVR A;  2QF7 A;  3SZT A;  2ADU A;  4D5C A;  4RB3 C;  1TL8 A;  2H8W A;  1P7J A;  3HRM A;  3RZO J;  3ZQQ A;  3A01 B;  5KAF C;  3KYL A;  1YO5 C;  3L1P A;  3OYI A;  1I5Z A;  2PG4 A;  2QGU A;  3K4N A;  3RKY A;  1HSJ A;  3HIF A;  2WA0 A;  5D6E A;  5JVG F;  1WPK A;  4I76 A;  2CGP A;  3IC7 A;  3RSN A;  4XMY A;  5J3L A;  2EIN H;  2XUB A;  5CVR A;  2P6S A;  1UEL B;  4A6E A;  3QPH A;  2MFZ A;  5F0F A;  4BJ6 C;  5GPA A;  3FF5 A;  1R1T A;  4N4O B;  4OIP F;  1L3L A;  1MKM A;  3FXJ A;  1WJB A;  2H6B A;  3TMO A;  4BBR J;  2BY1 A;  5EGO A;  4YIR X;  2VJ4 A;  3SEZ A;  3AAF A;  2OA4 A;  3K1P A;  3OIP A;  5BPI A;  5J1R A;  2OTJ I;  1FLI A;  3FZV A;  1B9M A;  4ASN A;  2JPC A;  2LP0 A;  2BVM A;  2DPD A;  3M8E A;  3M1E A;  2KPM A;  1MNE A;  2KRF A;  1K83 J;  2VBW A;  3PIO F;  4RAY A;  3HSF A;  2VOD A;  2ZJR F;  1GVD A;  3Q0V A;  3G1O A;  2M8G X;  3HSE A;  4ESJ A;  3W2V A;  3QPS A;  2ZSI B;  2GAU A;  4JP0 A;  3TQN A;  2E1N A;  1KGS A;  1D1C A;  2PMU A;  2YX4 A;  2XRO A;  1HOM A;  1W1W E;  1W36 D;  1Z9C A;  1TP4 A;  3SYT A;  4Y3O A;  3A0B C;  2B0L A;  2EZI A;  3JAM Z;  5EF6 A;  1DDN A;  4A3D J;  1X3U A;  1JT6 A;  2E71 A;  2WAQ N;  5J1Y A;  3VWB A;  3RCO A;  1OPC A;  3CUQ A;  5HLI A;  2FEZ A;  3TP0 A;  3P5J A;  2NVQ J;  1FP1 D;  1R1V A;  1IC8 A;  3QPT A;  2MAB A;  3N97 A;  4U87 A;  3OYF A;  4G6D A;  1ZR2 A;  2DOF A;  3K4J A;  1P9Q C;  2HQ5 A;  3CTA A;  4OMY A;  1G2H A;  3RDI A;  4HG2 A;  3WTZ A;  3S3M A;  1XGM A;  3S93 A;  3LL7 A;  4XON A;  2B9S A;  3OWT A;  4BE0 A;  2JZY A;  4BHB A;  3IRQ A;  3I64 A;  1BOB A;  2LF8 A;  2LBF A;  1AKH A;  2GA2 A;  4CCL A;  1HA8 A;  1V5F A;  3TKY A;  3I4M J;  4IHV A;  1X4O A;  3E97 A;  1YRN A;  2HDC A;  4HA8 A;  1ETW A;  4ENN A;  2ME0 A;  3WG7 H;  4C2M J;  2XB0 X;  3KP7 A;  4DZP A;  3K1N A;  5F27 A;  2WC2 A;  3WOD F;  2PJP A;  1FWZ A;  1W7P D;  3GME A;  1RNL A;  1UJ8 A;  1B59 A;  1FY7 A;  4EJU A;  3L2U A;  2AQE A;  1RET A;  3QYE A;  3G2B A;  2R93 J;  4XN3 A;  4QPQ A;  5HLG A;  1VQM I;  2O5R A;  4N9H A;  4JBA A;  3BCB A;  2R7F A;  3LSI A;  2WV1 A;  3IKV A;  2FD5 A;  3DKX A;  3CDL A;  3DU5 A;  4EGZ A;  4Y17 A;  2L7F P;  3ISP A;  1W7P B;  2EPF A;  2JUC A;  3SZG A;  2ZJQ F;  1BR1 A;  2EZK A;  3BCA A;  3TW6 A;  2G9W A;  3ZQL A;  4D5F A;  2R4G A;  1XMX A;  3O2P E;  4KA4 A;  4GYG A;  3FKJ A;  4Y33 A;  4X6A J;  5K5O A;  4F93 B;  2EB7 A;  2XGC A;  2ACJ A;  1R22 A;  3IUO A;  3J81 Z;  1G3Y A;  3CJQ B;  3K7A J;  4ZYA A;  1LUJ B;  3ZGK A;  2XPU A;  2WTE A;  1ZH5 A;  4L5J A;  3IKT A;  1MZB A;  4RB2 C;  3DPL C;  3V42 A;  2CUE A;  4Y4R A;  4B43 A;  5TJJ A;  5B1B H;  1YX3 A;  1R00 A;  5FKM A;  4HST A;  2B7E A;  4I6Z A;  3HOZ J;  2A5Y B;  1LPQ A;  2QYO A;  1K78 A;  4XNF A;  1OYI A;  4LIT A;  2UZK A;  2MLK A;  3C1D A;  4GXO A;  5L3G A;  4EM0 B;  4HX7 A;  2HTS A;  2F4I A;  5BMZ A;  1MMA A;  1SFE A;  1X2N A;  2ZJ2 A;  3E6D A;  3BTI A;  4MQV A;  1KQ8 A;  3FMS A;  3FBN B;  4BDZ A;  1XGO A;  1FIP A;  2V26 A;  3B73 A;  1RES A;  3CLQ A;  2Y48 A;  4ZC3 A;  4DBQ A;  1IN8 A;  3CD6 I;  2R5Y B;  1ZLK A;  4UVB A;  3E6B A;  3VOD A;  2M9H A;  3PL8 A;  2CV0 A;  2L7Z A;  4GYI A;  2ZB9 A;  3ABU A;  2RNG A;  3DEW A;  1A36 A;  1Z3X A;  4A0Z A;  1HC8 A;  1KQ0 A;  4BQN A;  3M07 A;  4MGR A;  1B6A A;  2ZME C;  2ZFU A;  2V9V A;  2CUZ A;  4LD5 A;  5FLX K;  3K4B A;  4KIT B;  4L5I A;  4MHG A;  1QPI A;  1T6S A;  2VKD A;  3RTR A;  4KIS A;  2DK5 A;  5JHF A;  1R5H A;  1N77 A;  3CP8 A;  4Z6Y A;  1R71 A;  1R7J A;  1OMI A;  3HRT A;  3K2A A;  2IT0 A;  3GTP J;  2MA3 A;  4A3J J;  4EJT A;  2F5F A;  3OMY A;  4CGZ A;  2V1X A;  4DYR A;  1PUF A;  5KVR A;  1LQ1 A;  3K4K A;  4YEJ A;  1HW5 A;  2KDZ A;  2XHK A;  2DT5 A;  2LY2 A;  2C6Y A;  1RKW A;  1TQI A;  3ZQG A;  3MEX A;  1W4M A;  2F4M B;  2A61 A;  3PFY A;  3SZP A;  3JW4 A;  4FX4 A;  3CLO A; 
#chains in the Genus database with same CATH homology
 4BQO A;  2XSJ C;  3A4C A;  2KZV A;  5HOO A;  3PNT A;  4KJZ A;  4D1Q A;  1ZEL A;  3DWL E;  3BG6 A;  3AL0 C;  4F52 A;  3I9V 2;  2IS2 A;  4P5O A;  5HLT A;  2LRE A;  2X1E A;  3H5N A;  1SFK A;  2X1C A;  2UWM A;  2VJJ A;  2XC7 A;  2IS4 A;  1FMV A;  2L5Q A;  4DOZ A;  3QYB A;  1D1B A;  3D5L A;  4QPO A;  4CCJ A;  1Z21 A;  3OYJ A;  1PYV A;  3ZCO A;  2DCE A;  3CES A;  4CCK A;  4DJA A;  2KDO A;  4PSX A;  3MKZ A;  1UAA A;  4HEA 2;  2WAQ A;  3E0J B;  3HPH A;  4CZC A;  3CJR B;  1KON A;  1WJC A;  2XF6 A;  2ZSH B;  3PSF A;  4E4H A;  5KCM A;  3ZXS A;  1MMD A;  2X51 A;  2F5V A;  2R7T A;  1WJF A;  4CA0 A;  2JVH A;  4PUS A;  1G59 A;  3C2G A;  2W7N A;  4NUB A;  4F55 A;  4J01 A;  5FRO A;  2ZXH A;  4DBR A;  3ONQ A;  2WAE A;  3OYG A;  2R7R A;  4BE2 A;  3UNG C;  4BU2 A;  4E6K G;  2X85 A;  4X0G A;  3LSG A;  3H9J A;  1MMN A;  5FRM A;  2AQF A;  1BR2 A;  3H0D A;  3LSK A;  2LOO A;  4XL9 A;  4BL0 B;  5HNF A;  2V9K A;  2UV1 A;  3VYT B;  4E7S A;  2VAS A;  2LBF B;  4NQW B;  4C30 A;  4HNU A;  2E5N A;  1SAU A;  2LH9 A;  3S3O A;  1X1B A;  3MMY B;  3F9K A;  1WJE A;  2VQL A;  2KP6 A;  4C2U A;  1LKX A;  4E7K A;  4EAT A;  4CUG A;  4HSR A;  2F6C A;  1ERD A;  2NOJ B;  4E7H A;  4JQF A;  1D0Y A;  2R7O A;  2VXD A;  3ZRG A;  3SDB A;  2HQA A;  4CCN A;  1DGW Y;  1VZ0 A;  2IS1 A;  4BEH B;  1PJR A;  1DGR M;  4P1W A;  4NC7 A;  4PJL A;  2R7S A;  2CV2 A;  3NWT A;  4U7B A;  2QKM B;  4XKV A;  2R7V A;  4AVZ A;  2VQG A;  4HPQ A;  2CH0 A;  3FBI B;  1Y6I A;  1FMW A;  5TGT A;  4ZTF A;  2UUZ A;  4RMN A;  2IXS A;  2I8D A;  1OR7 C;  1G8X A;  3N05 A;  3H5R A;  2E5Z A;  3L2V A;  2PJR A;  4FAS D;  3OR2 C;  2HNH A;  3DKY A;  4PJJ A;  4E7I A;  2KHM A;  2DT7 B;  3TBI A;  3EPZ A;  2DJI A;  3K70 C;  1N75 A;  3HG9 A;  2R7X A;  2M0M A;  3E1S A;  2VKH A;  4XLF A;  1TT0 A;  2LYC A;  1LFP A;  3L2R A;  3S3N A;  1X1D A;  2IGM A;  4D9J A;  2PMZ A;  4F3Q A;  3OS2 A;  1IRX A;  1V5E A;  1U0J A;  4XR6 A;  4XLE A;  3CMM A;  4ZJZ A;  4J00 A;  1LVK A;  1JI8 A;  2MYS A;  1T0F C;  2BW3 B;  2P0W A;  2X6X A;  3OYE A;  4OWR B;  2HZD A;  3AKZ A;  3M1C A;  3S32 A;  1NG6 A;  2ELJ A;  3H35 A;  2LC2 A;  4BXF A;  3HOS A;  4GRI A;  4BQQ A;  4YEL A;  1E0E A;  3BG7 A;  2WAD A;  3K4L A;  3OYN A;  3IAM 2;  1YX5 A;  3MD2 A;  2JSP A;  2X6W A;  5HVQ C;  3OYC A;  4XKC A;  3AL0 B;  4II2 A;  1D0Z A;  4BGD A;  3DTK A;  2V7F A;  4G6T B;  4C9Y A;  1DP3 A;  2FUG 2;  1J09 A;  2RQQ A;  1WJ5 A;  3VSK A;  2CMP A;  2KLO A;  2OV7 A;  3W3C A;  3OYK A;  1T95 A;  2E1M C;  3KX2 A;  4CCM A;  2XDV A;  2KRC A;  4AYB A;  4R79 A;  1LDK B;  3HC7 A;  2KL4 A;  3A1Y A;  3VYR B;  4AU7 A;  3K4C A;  2Z16 A;  1GLN A;  2VJ5 A;  3OS0 A;  2CS3 A;  1MMG A;  4KT6 A;  3PJR A;  4PFP A;  4XKW A;  2QKL B;  2JVG A;  2VL8 A;  3K6G A;  1NG7 A;  1UG0 A;  2L7K A;  1MW7 A;  3DPU A;  3L2W A;  2HVR A;  2Z1D A;  3A2K A;  2KRH A;  3DQV C;  1WJA A;  2E60 A;  2M7B A;  2LY1 A;  1Y56 A;  3I3L A;  3ZQQ A;  4BAC A;  2IS6 A;  4DIQ A;  3KYL A;  2L9S A;  2OUM A;  3OYI A;  3K4N A;  2L2O A;  4PJN A;  1X1C A;  2WA0 A;  4OAZ A;  3PUB A;  3RSN A;  3C2H A;  4XMY A;  3W2W A;  1QHH D;  1D1A A;  3HL2 A;  2HDW A;  1UEL B;  1TZL A;  3LSM A;  4XLC A;  5KHD A;  4MLO A;  2MFZ A;  3H9G A;  4YRV A;  4BJ6 C;  1V5G A;  4ZDO A;  1WJD A;  4ANJ A;  4B3X A;  4N4O B;  1Z7L A;  4IQJ A;  1WJB A;  2IGN A;  3TMO A;  2VJ4 A;  3VYS B;  3SEZ A;  5KNL A;  3OIP A;  2VIX A;  1K6Y A;  4XN0 A;  2BVM A;  4C2T A;  4BJ5 C;  5FRN A;  2KPM A;  3IP4 B;  1S9H A;  1MNE A;  4E7Z A;  3HUG B;  4NC8 A;  4JOM A;  4E7L A;  2HPM A;  1QU3 A;  4DGW B;  3FHN A;  3SEQ A;  3W2V A;  4B48 A;  1YE9 A;  2ZSI B;  1OLT A;  3D5S C;  1WFX A;  2XF7 A;  3UR3 C;  1D1C A;  5HNH A;  1MND A;  4XQF A;  4ZDP A;  3W2A A;  1W36 D;  3OL3 A;  3SYT A;  1X1A A;  4RM3 A;  4Y3O A;  2R7Q A;  2A5W A;  2HPI A;  3K70 D;  2XAU A;  4BJT A;  3VWB A;  3FDY A;  2K3P A;  3RCO A;  2VQH A;  2LRD A;  3BC8 A;  1EA3 A;  4XM3 A;  2MAB A;  3H5A A;  4U87 A;  3OYF A;  3K4J A;  1P9Q C;  4BUP A;  3QOD A;  2KMU A;  3DEE A;  4HG2 A;  4ITV A;  3S3M A;  2WBM A;  3S93 A;  2GOM A;  3LL7 A;  4XON A;  3OWT A;  2MC4 A;  4BE0 A;  2W82 A;  1BOB A;  2M7A A;  3TL4 X;  2W4S A;  4XOR A;  2LBF A;  3H9Q A;  2XF5 A;  4CCL A;  3RQ4 A;  1HA8 A;  1V5F A;  4F91 B;  2R7W A;  3CP2 A;  4XLH A;  4B47 A;  4LIV A;  1X4O A;  3MKW B;  4PK4 A;  3K10 A;  2MD0 A;  2WY7 Q;  4XOP A;  3K4M A;  4PFO A;  3GBG A;  4LG3 A;  3L2Q A;  4NNJ A;  2VPL A;  4IKF A;  3OYH A;  4RM2 A;  3PNY A;  3OYD A;  3L2U A;  2AQE A;  4BEH A;  3QYE A;  3G2B A;  5CPR B;  3PNV A;  4XN3 A;  4QPQ A;  3MKY B;  2O5R A;  2Q1Z B;  2Z2S B;  3BCB A;  2LG4 A;  3LSI A;  2V1N A;  2K9L A;  2PJR B;  3DKX A;  3IAS 2;  3DU5 A;  3DTE A;  4CCO A;  3SZG A;  3NWS A;  1BR1 A;  4HNT A;  3PSI A;  5CQE A;  3BCA A;  3OOU A;  5CKT A;  2Y0S A;  3EUH C;  4OAY A;  3VYU B;  5LD2 C;  2CV1 A;  2R4G A;  4II3 A;  1Z3Y A;  1X19 A;  3FKJ A;  4LIU A;  4Y33 A;  2E1M B;  4RLQ A;  3VSL A;  3ZR8 X;  4F93 B;  2X6Y A;  3DLA A;  3IUO A;  4ZYA A;  3CJQ B;  1D0X A;  3ZGK A;  2WY8 Q;  2VB6 A;  4H4K C;  3OR1 C;  4IX7 A;  3DPL C;  4XLA A;  3V42 A;  3HKZ A;  3S8P A;  3QOE A;  4CSW A;  3LMM A;  4Y4R A;  4B43 A;  3OYB A;  1YX3 A;  4HST A;  2JA2 A;  4CH7 A;  4PJM A;  2M3A A;  2ZXI A;  4XNF A;  3DTI A;  4LIT A;  4F92 B;  2CFO A;  2KQR A;  2CW7 A;  3VDX A;  3DPT A;  3BLY A;  2A6T A;  3OS1 A;  2CUJ A;  2WAF A;  3DU6 A;  1AA7 A;  2F4I A;  1MMA A;  3OIQ A;  4N4N B;  2VXZ A;  2VJI A;  2BW3 A;  2HVS A;  3FBN B;  4BDZ A;  3QYF A;  5LFA A;  2V26 A;  2BVL A;  2L9N A;  1X4P A;  3EUK L;  3OY9 A;  2R7U A;  4BS9 A;  2W00 A;  4DBQ A;  2M4G A;  4ZC3 A;  2CW8 A;  3RPU D;  3M8J A;  3HOT A;  4HRI A;  3PL8 A;  3KEY A;  1QHG A;  2CV0 A;  2VQC A;  2GOX B;  3D5R C;  4XOT A;  2X1D A;  1BR4 A;  2RNG A;  3OL4 A;  1Z3X A;  4BQN A;  4PSW A;  3CF2 A;  2ZFU A;  3J7A Y;  2CUZ A;  2HVQ A;  3HXL A;  4ZTJ A;  3K4B A;  4KIT B;  4RLF A;  2DOA A;  2HU9 A;  2BOL A;  4BDY A;  4ZDL A;  2M4K A;  1DQU A;  2VKD A;  3RTR A;  4KIS A;  2V6E A;  2Q2E B;  5JHF A;  1R6R A;  2WB1 A;  4FET A;  2IGO A;  3CP8 A;  3U21 A;  1N77 A;  1N78 A;  2DXI A;  3LSH A;  4IZZ A;  4XKB A;  3LFU A;  3OYA A;  3OMY A;  2K9M A;  5CQG A;  1W36 C;  2JUG A;  4B44 A;  2VLA A;  3OYL A;  3AFH A;  2IGK A;  2DT6 A;  3K4K A;  4YEJ A;  2LY2 A;  2W1O A;  4BE1 A;  3EUA A;  2K5C A;  2OC6 A;  3HPG A;  4IQ4 A;  2V4J C;  3PFY A;  3OYM A;  2RRE A;  4E7J A;  3CZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...