4IZZA

Crystal structure of fischerella transcription factor hetr complexed with 21mer dna target
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
total genus 83
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA02
4J00A 4J01A 4IZZA 4HRIA 3QOEA 3QODA 4YRVA
chains in the Genus database with same CATH superfamily
4ZYEA 3IH2A 4G7ZF 3WODF 2FSWA 3BY6A 3MCZA 3MKWB 4ZTJA 5E8GA 5L3BA 3DTEA 4DYQA 1AU7A 1IN5A 2M4GA 2M3AA 1JT0A 2K9NA 3AFHA 2HXOA 5IPAA 2AQEA 2QQ8A 2RC4A 3KZZA 5IP9J 1FT9A 2FXAA 2GZWA 4A69C 1MNMC 2WAQA 1HKSA 2VOOA 3E97A 2H6BA 1DP7P 3EQLF 2B0LA 2HTJA 5BNGA 1R22A 1K61A 2X6XA 5BOXA 4O6JA 2LLKA 4GYGA 2ME6A 1J59A 2LDUA 3JR9A 1M1EB 1YS6A 3BR0A 1H89C 1R71A 3C1DA 3HPHA 4NUBA 1YFHA 1MNEA 2QENA 1BL0A 2P7CB 2LKSA 4QSHA 3CCUI 2WAQN 2ZJPF 1LFPA 2RKHA 2XGCA 2A05A 1TT0A 3IH4A 4P55A 1EH6A 3CF2A 4XBFA 4BQOA 2DMUA 3V8LA 1WVRA 2DFHA 2FNPA 3NAUA 4HAMA 3BROA 1W5TA 2L7MP 2P8TA 2BV6A 2DA4A 1ZHFA 4UNOA 1STZA 2ECBA 1IDYA 2JUGA 3H0DA 4DQ2A 1MBJA 3JRHA 1ZR4A 3GF2A 3KYDB 2CRGA 3CCYA 2EFWA 2E2HJ 4D5CA 3PUBA 1YTYA 3R6SA 1L0OC 1Y6IA 3HRUA 4ZZDA 2ISZA 3CCRI 2L4AA 2WAEA 3RZOJ 3HBLA 1WJBA 3F6OA 3GTKJ 5J4VA 3U1KA 1XSDA 4CCJA 3KZYA 4C2TA 2RQQA 5GPAA 3S3NA 2ZFUA 4Y7NJ 1V55H 2ZKZA 2K02A 1FTTA 4G8XA 3L9FA 1ZGWA 1R5HA 5ED4A 1RR7A 3HKZA 1MBKA 3KPHA 1JI8A 2VT2A 4NHJA 4LIVA 3U1DA 3L2WA 5JLWA 4HG2A 4V19K 1J2XA 1RUOA 2P81A 1ITYA 4E7LA 2F5FA 1KZHA 2H27A 4I2OA 2AQFA 2A3SA 3FK7A 2LH9A 4XIDA 3J7AO 1YW7A 1BI2A 3VYTB 4J19A 4MEXF 3MKLA 3JRDA 2EV0A 3GFIA 1VQ8I 1JGSA 3L1PA 2GAUA 3GEZA 3V8JA 3MEXA 3HKZN 4M3GA 3HOTA 1BI1A 3G1MA 2QA4I 2X4HA 4M9ZA 1XN7A 4BE1A 2BOLA 3DBRB 3AAFA 2P7VB 2KFDA 1JKQC 3AG2H 1WH5A 3GYHX 2XAGA 2XSDC 2A6HF 2VLAA 3E1SA 1FYLA 3BTCA 3CDIA 3M8JA 2DT5A 2STTA 2UV1A 2JVHA 4GDFA 1UELB 2VONA 1DPRA 4L18B 2WADA 1VTNC 1V54H 1NK2P 2GIZA 2NVQJ 3K4JA 3ECOA 3LSTA 3F8BA 3G1LA 4UY8I 2HFHA 4AU7A 3EPZA 3S2DJ 3K2AA 4F3QA 2STWA 1YJWI 4D7NA 3DEEA 1U0JA 5CVVA 2E35A 2OAZA 2EQRA 4PJ0C 5F08A 4E7SA 3F72A 4QPQA 1ORKA 1Z0XA 5CVRA 4AIHA 4E6KG 2R5ZA 3AL0B 2B7EA 2CMPA 1BBYA 2NOJB 2A07F 4BQAA 1YW9A 4AD9A 2O9LA 3ASOH 2P5VA 4J00A 4IF4A 4D7MA 3KP3A 3OYLA 5D5VB 1SD7A 1B9NA 3DV8A 4BJTA 5K5QA 3LSKA 2HPMA 3DKWA 4ENJA 1MMAA 3S1QJ 3RTRA 3RCOA 2BXYA 2NOGA 4DBRA 5LD2C 1U78A 2Y69H 2E5NA 2DK5A 3WTWC 1JHHA 2MD0A 1JKRC 1TWGJ 3TDUC 2XF6A 5B1BH 3I3LA 2W84A 5B3SH 2HI3A 3KX2A 1L3LA 3S93A 2EILH 3D5LA 1EJ9A 4OMYA 2EV6A 3V8KA 1UG2A 2F5CA 3LSIA 1WJDA 4XKBA 3Q0VA 4D5FA 1GV5A 2OV7A 1R1VA 2JSCA 2HTSA 1R23A 2L7FP 3HTUA 2X85A 3Q9VA 4XK4A 1AWCA 1MH3A 1O57A 5GTHC 1TNTA 3C2BA 4MTEA 2VT3A 3ZRGA 2WB1A 4CCKA 1UHSA 2JPBA 3K4BA 1Z6TA 5E20A 1ULYA 4Y33A 4UUTA 1FOYA 5J1UA 2LTPA 2ZCWA 5LHGA 4HSRA 2M7BA 2A6TA 4B4CA 3P5JA 1FPQA 1IC8A 1B8IA 5L3GA 3OSFA 3WU1B 3FXUA 3SEQA 2DQLA 2GIVA 3OYMA 4FQGA 4ZDOA 3LAJA 4Z6YA 2IJLA 2QGUA 4B48A 4F7ZA 2OJED 2MABA 2WB1N 5IYDJ 1SMYF 1WJEA 4Z2YA 2ZJQF 1HOMA 2Z1DA 4Q48A 4UB6C 3GFJA 5TGTA 4HLYA 2DDBA 1R1TA 3H9GA 4IX7A 4PCQA 5C4XJ 3LAPA 4W97A 2Q2EA 2V9PA 1X3WB 2WC2A 5ICFA 2JK3A 3IRQA 4L9NA 2XIGA 3A2KA 4LLGF 1I50J 2M7AA 3ZMSA 1R36A 3GZNB 1FMWA 1VQ9I 2A69F 2ZSHB 1RZ4A 3JRAA 2OBPA 2DAOA 3BPVA 1YIJI 1NH3A 2KMUA 5FRMA 2DODA 4FISA 3DPUA 5FLMJ 3NEUA 3OYGA 2VN2A 3F23A 2FD5A 2TRTA 4EJOA 2L9VA 5DCMA 1XS9A 2E36A 4N9IA 4Y15A 3H0GJ 1BIAA 2OZ6A 2KKOA 5E1WA 3M07A 5IT3A 1DGWY 2F4OB 4Q5SF 2R92J 2F48A 1QHHD 5CYVA 3HIFA 3CUOA 1E0EA 2X1EA 1GDTA 2DU9A 3GTQJ 3V4GA 3ZMZA 4BHCA 2V1DA 1TQMA 2OF7A 4R1HA 1SVMA 2K9LA 1S7AA 4ZYGA 2XC7A 4J01A 1B72A 1LKXA 1BI3A 2IGOA 1T6SA 4CICA 2L7KA 4NQWA 4AUXA 1X4PA 3ZQGA 5E3NA 1IO2A 2Y75A 4BE2A 2HPIA 1YX3A 1IRXA 3BR5A 2W57A 3E3VA 4NDLA 1E3HA 2PMZA 3B73A 3H5AA 3KP4A 3KP2A 1WI9A 1CF7A 5J47A 3CMYA 2HDCA 1J09A 1S7OA 3L2CA 3CP8A 1LQ1A 3F3XA 3S17J 2UZKA 5FKKA 3J7ZI 4RAFA 2Y48A 4WXCA 2R3SA 4B8XA 4L0YB 1MJBA 2HQRA 5JVGF 2FUG2 1A35A 4MHGA 2VQCA 3K9TA 1SD4A 3LQQA 5E3MA 2PMZN 2IAIA 2UXXA 1BIBA 1ZK8A 3SXYA 2VC0A 3PM1A 3GTGJ 1REPC 1R4NB 5HNHA 1GLNA 3LSGA 1RC9A 3OYKA 3LA7A 4M3DA 2A5WA 3LSJA 3R61A 5CQEA 4S05A 1IW7F 1IN6A 1FBQA 4IO9F 3S2HJ 1XD7A 2UXNA 3ABLH 3OYIA 3WTUC 5LLQA 1MJAA 2PJPA 1RI7A 2XDVA 4LG3A 3WE3A 4BU2A 4C3IJ 3GTPJ 2PMUA 4EV0A 4WXDA 2KJCA 4I01A 2ID6A 4C2MJ 2R5YA 1R00A 5DUKA 1MSFC 4KN7X 3TKYA 1IRZA 1YX5A 4OWRB 3W6JB 4HPQA 4JX5A 4HQEA 2VKVA 2H1KA 1X3UA 4EMSA 4BQQA 1B9MA 1W1WE 1P4WA 1JUSA 2DT6A 2BY0A 1ENHA 2BZTA 2ISYA 2I5UA 2X1CA 2M8EA 3TO7A 3KP7A 3A0BC 3IWFA 2H94A 1G2HA 3ASNH 4ZDLA 4I98B 3WTVC 1I1GA 3HRMA 4UUSB 4HF2A 2GOMA 5ICEA 5L3CA 3ISPA 2M34A 4XICA 1S7EA 3CCMI 4BBSJ 1T95A 4XOPA 1FIAA 1MMGA 2CQKA 2OC6A 5LEJA 4EJUA 4A3EJ 1P7JA 2ADUA 1YJNI 3BTLA 1HC8A 2DFFA 4U87A 3AL0C 2WY8Q 4U7BA 5D4RA 1F36A 2Z3YA 2XRLA 4DZPA 1Q1VA 2L54A 1MBEA 4A3GJ 4LG0B 2K4BA 1DP3A 3I9V2 3VYRB 4EGYA 5HNFA 2KRCA 1U3EM 5HDKA 3DLLF 4EEFG 1I3QJ 3OMYA 2O8XA 3I54A 2XGXA 3K70C 3M7GA 4ZYHA 3FXQA 1P4XA 3DBLB 4H0EA 4WX9A 2CV0A 2QEXI 5M3MJ 4IRIA 4E70A 1YQAA 2HQAA 4BKXA 2JT1A 3DKYA 3KCCA 2VKHA 5M5YJ 3BG9A 3VPRA 4TV7A 2KRHA 5D5UB 1OCZH 3HZJA 4ENKA 2CSOA 2HYJA 5FLXZ 3K4KA 4UV9A 2D2WA 2V7FA 1EV7A 4HBLA 4IPAA 4M73A 3RKQA 4I0AA 1O3SA 1HDPA 4N4OB 3ROUA 2DBBA 4E4HA 3FBIB 1W0UA 3V7SA 1KYZA 4S04A 5EGOA 1MGTA 3FM3A 3HRSA 2RVCA 3GFLA 5LRRA 1U6GA 2VUMJ 2EWNA 1FOXA 1T38A 5HDNA 2HU9A 2LOOA 3L09A 2W00A 2QQBA 2WV1A 3HOVJ 3FX3A 2DYRH 1XCVA 1ERDA 2MBFA 2LD5A 1SMTA 3MAJA 1ACIA 2V26A 4AM3A 4RA2A 4IHWA 4NBQA 4C30A 3C2GA 2DYSH 3SFZA 1SAXA 3RZDJ 1IF1A 1T39A 5EYRA 4YFNF 4FX0A 5HS7A 4MGRA 3HJEA 2R7ZJ 4L9JA 2V4JC 3BCAA 4CH7A 3NWSA 4CXFA 3HGGA 4GXOA 5LGNA 4X0GA 3LNQA 3RI4A 3AG3H 1LVKA 1VQ4I 1O3QA 2W48A 3BG6A 1VI0A 2QBYB 1H0MA 4QPOA 2PI0A 4C9YA 2CWEA 1F43A 1T98A 3COAC 5IT9Z 4DOZA 3IWZA 2FBIA 3IL2A 3OR1C 1Z21A 1HBXG 5EF6A 4M3EA 1W0TA 2IPQX 1JKOC 4KYWA 3QOPA 3Q5FA 1QRYA 4ANJA 2IEKA 1HSTA 1JUMA 3LOCA 3SDGA 1OKRA 2X0LA 5DTDA 5FFZA 1LFBA 1MIJA 1EH7A 3H5RA 4H4KC 2NVYJ 1XTAA 2V79A 5ICCA 1KU7A 3PO2J 3ESWB 2LKXA 2OQGA 2JA5J 2QWWA 3I0TA 4KN4X 5HLHA 3EUAA 1D5YA 1MZBA 2JRMA 4CGZA 3K0LA 2BXZA 2R7FA 5LHHA 1X1CA 1P2FA 3PSFA 4XSXF 2FU4A 3ZCOA 1VQNI 1G59A 4CA0A 5L3FA 3H92A 4O5VA 2A68F 3VYSB 5HODA 3DCFA 4JX6A 4M6YA 4XLCA 3I56I 1YE9A 4BEHB 1GXQA 3A01A 1BW6A 2HQ5A 4EJTA 1ZG3A 2KQRA 2IS1A 2VIXA 1T56A 3C3WA 2AXLA 2NVTJ 3EUHA 4UV8A 2PLYA 4O3MA 1ZLJA 1I6XA 2IA1A 2A5YB 2E5ZA 4A12A 3OS0A 1P7IA 1HKTA 3F8NA 3W2VA 3SFIA 5K1YA 2DCEA 1IG7A 2DMPA 3I64A 3P9IA 4P96A 4I02A 4PUSA 4YFKF 1LE8A 3FZVA 2JA7J 1OFCX 2K3FA 3A0HC 3FIWA 1Z3YA 3K4MA 4OAZA 1IN7A 1BA5A 3FXLA 1H8AC 4EJVA 3BC8A 3GWZA 2KT0A 4A3BJ 2FF4A 4LMYA 3O8HA 1OISA 4I0BA 4C3JJ 2VQHA 4B47A 4LK0F 5GAHJ 4U7DA 2VL8A 9ANTA 5FKLA 2IRFG 4EM0B 2HVSA 1U5TA 4XR6A 1OPCA 2IP2A 3C18A 4JP0A 2VBXA 1BJZA 2R7OA 4HF0A 1S29A 5KHDA 5BPDA 2BHYA 2IGMA 2CUJA 1UG0A 3H3UA 1SAUA 1FX7A 1K4SA 3Q0UA 2E1CA 2L5QA 1JGGA 4LOCA 4B3XA 1BI0A 2M2EA 1QQIA 1ETQA 1DPUA 3S2WA 1J75A 2HGCA 1G4DA 3W3CA 1LFUP 4A0YA 3FWEA 4CZCA 2E71A 1KGSA 4MO7A 2HOEA 2WTEA 4RLQA 1PYVA 2WA0A 3HPGA 2DXIA 1TW2A 4KJZA 1PDNC 4HDVA 4P9FA 2P5LC 4G6DA 2BVMA 1IAWA 1E2XA 1TWCJ 2NS0A 2F4MB 2VJJA 5F1RA 3CUQA 2E2JJ 1B4AA 1VQLI 5AONA 2CW7A 1A04A 5K7HA 1WJAA 4D0PA 4HW0A 1UCRA 4IHYA 1BJAA 2MC4A 3SZGA 2DW4A 1D0XA 2K4JA 3I59A 3OYNA 3GZ6A 1RESA 2FMYA 1TLHB 5F0HA 3GLXA 4N4NB 1U9NA 3OOPA 4II3A 2HQNA 3VSLA 2AHQA 3KP6A 5GAGJ 3M3YJ 2MLKA 2H8RA 2IS2A 4FT8A 4I09A 5A2QZ 1WRJA 1IN8A 1D1AA 2EFPA 4IKFA 5GP9A 2OZUA 3HOXJ 2K5CA 1DDNA 4G7OF 5H6RA 1K79A 3QPLA 5FLVA 2Y2ZA 3PSIA 4KT6A 4DZJA 2AS5F 2W82A 4Y17A 1YRNB 2IW5A 5JHUA 1WHUA 4QIWN 3ULQB 3GW2A 4BHBA 3KEOA 2FOKA 4PFOA 2O6GE 2VBZA 1HW5A 1W7PB 2EIMH 4M6XA 1GVJA 3BLYA 1H9GA 5LFAA 4L0ZB 1HSJA 2I10A 1DU0A 1X4OA 2RGVA 2BGCA 5EJCA 3GUDA 1F9NA 2HOSA 2HOTA 4OIPF 1KQ0A 2KP6A 2YX7A 1B6AA 2D1VA 3D5SC 4P5OA 3T8RA 4U0WA 2V1NA 3RYRA 4ESBA 3RKXA 3DF8A 5IYCJ 4BNCA 5F04A 5D5XB 2F5DA 1IXSB 3OYEA 4FX4A 2IA0A 3QYBA 2ZXJA 1MDMA 4M72A 3JRBA 2FQ4A 3T0YA 3IAS2 4Q4ZF 4V2FA 2VODA 2IGKA 4ZH4F 3TOAA 5KAIC 2ZXIA 1ODDA 2HKXA 4PJMA 4BH9A 1EH8A 3DTKA 3ZMVA 1QZYA 1W5CC 1N75A 3K1MA 5C44J 3JAMZ 4IHSA 1E3PA 3MMYB 4DNCA 3FM5A 2Q0OA 4B44A 3BR2A 5M5XJ 5F1JA 1D0ZA 1IN4A 3GTOJ 4WXHA 2ZJ2A 3OIPA 3LSPA 1AKHA 1O7LA 3KE2A 1TTYA 2FBHA 2XGDA 3HSFA 1MW7A 3ZQFA 1Z67A 2DO7A 2VE9A 1KU2A 4RM2A 1GT0C 4KT5C 3MZHA 3F8MA 2K40A 3FMRA 1RUNA 4KDPA 2W24A 3PNYA 1FBSA 1RPWA 1MNDA 1LJ9A 3CESA 1ZYRF 2GQQA 2CYYA 2FEZA 3HUGA 5CPRB 1K78B 3S15J 4PGHA 4E7HA 3ECHA 2XVCA 3BR3A 1SFKA 2P5KA 3A02A 4HX7A 3WG7H 2H1LA 4RGUA 1VQKI 3ZXSA 1T2KA 2DMNA 3ZGKA 1VQ7I 1BOAA 2CGPA 3D0SA 3R0AA 3V42A 2LG4A 1ZR2A 1H9TA 3TL4X 1S8NA 1BN5A 2EINH 2LR8A 5CLSA 3OYAA 5ILUA 2EIJH 3HDDA 3TMOA 1XSXA 2PEXA 4AWXB 2V6CA 4BDYA 2M45A 1Y1VJ 2QKMB 5D5WB 4GGGA 5H20A 2BW3B 1ETVA 3WTSC 5FGMA 1BW5A 3K4CA 4M6VA 3S16J 3KEYA 3FF5A 2MD5A 3IP4B 4F92B 1FYMA 3DXJF 2MC3A 1POGA 3W6KB 4AVZA 3EUKL 1ZARA 1IZ1A 1QU3A 2ZNZA 3FBNB 3FHZA 1RIOH 4A3CJ 1XCBA 2QYOA 1YS7A 3T8TA 2YU3A 4IHTA 4I99C 4RB3C 1T0FA 2MSYA 1TBXA 4PZJA 2W7NA 2L0KA 2XAJA 4NB5A 4G6QA 2MG4A 5J6XA 1FLIA 5H6QA 1C0WA 3RPUD 2XHKA 3P9KA 1ZRDA 3QAHA 4PSXA 1FNNA 5EZHA 2JWTA 5J1RA 1OR7A 3G73A 2BEOA 3F21A 3F0CA 3WG9A 4PDKA 1D3YA 2LMDA 1FWZA 2QZ8A 2YX4A 2LK2A 2LF8A 1OCTC 4E7JA 1A5JA 4EVIA 5L3EA 4B43A 4HNVA 2JTVA 3R4KA 4MFEA 5KCMA 2XRNA 3RSNA 4PFPA 3VYUB 1PUFA 3JSPA 3L2UA 3Q0WA 4KUMA 5E3LA 5K5OA 2KJBA 3JTHA 3HC7A 5IP6A 1X58A 2GM4A 2R7UA 3CC2I 4XLNF 3HEFA 4R8HA 2CV1A 3H1CA 5DEQA 4DJAA 3M8FA 4ZTFA 2V6EA 1Y8RB 2XKOA 3SYTA 3Q9SA 4HSTA 4MQ9F 3S8PA 5D8KB 4WWCA 4IZZA 1CQTA 2XAHA 3IC7A 3HB9A 1I5ZA 4F55A 2JZYA 1LEAA 3J80K 1DUXC 3TO6A 4DYRA 5J1YA 2FJ1A 3LFKA 4X6AJ 1K4TA 1VQ6I 1A31A 2P6TA 3LWFA 1IV8A 1LUJB 1TZLA 3H9QA 5IOYA 3U2RA 2HVRA 2LBFA 1E17A 5E18F 3I4NJ 2WAFA 5LHIA 2JA6J 5JFRA 4A0ZA 4ZYDA 2L7ZA 3AG4H 2QSFX 3L7WA 3JRGA 3QYEA 4ZZLA 4M3BA 3X2QH 3TO9A 5M5WJ 3VWBA 3HHHA 1WI3A 2DOAA 5ILVA 4RDUA 1HA8A 4IL6C 4A0XA 3TP0A 4MFDA 1W4MA 1FMVA 3CJRB 2NS7A 4Y3OA 3SJMA 1N25A 1P92A 2ZNYA 3FXJA 1FEXA 4YFXF 1EF4A 1VQOI 2CJJA 2B63J 1A6QA 3FDYA 2O8KA 3FMQA 3I53A 3I55I 5JVTA 1X2NA 2R7RA 4FETA 3EYYA 3CO6C 5E3OA 5FKMA 3IUOA 3W2WA 5EEAA 4LD5A 1ONVA 3CZ6A 2DA6A 2XGEA 2DDAA 5F6FA 3S1NJ 5E1ZB 3CMMA 5D4SA 2DFEA 5IT9K 2DK8A 2LRDA 1DQUA 3MFKA 3RQ4A 2Q8KA 4YIFA 2F4IA 3DEWA 5HOOA 5F0FA 2R5ZB 4ENMA 3F6VA 1F1ZA 3CLQA 3FISA 4UHTA 3BZCA 1HKQA 1LNWA 2GA1A 3GXOA 1XG1A 5FKOA 2E7XA 2PBIA 1Y1WJ 3BG5A 1ETXA 5J8CA 4WCGA 2W25A 2JRTA 2R7TA 3DFGA 1FOKA 1KYWA 2CW8A 3CO7C 3CMAI 1QVTA 2ZFWA 1GV2A 5DDGA 4IXAA 2ESHA 4A5NA 2HEOA 3QP5A 1XB4A 1WPKA 2MH9A 2HDDA 1Z05A 2OTLI 2XKPA 2EZKA 2A6EF 2NXNB 3HL2A 4E7KA 1TL8A 2L4MA 1W7PD 2EPFA 3K1NA 5J3LA 2R7DA 4MLOA 1XMXA 4YG2F 2XPUA 3EDPA 5HLGA 4LJZF 1SC7A 3GCMA 1K7AA 2JJ7A 4RM3A 2DN0A 5F27A 1MJ9A 4I76A 2RV8A 5DM7F 2KPMA 3KIOA 1FSEA 5KVRA 3OYDA 3JREA 4QWQA 3GTJJ 1ETKA 1ZQ3P 2GOXB 2DPUA 2JA8J 2ELJA 3EUHC 1FP1D 3LA3A 3TP3A 1YO5C 2XF7A 2KISA 4IOAF 3BG7A 3ZMTA 3REOA 4MTDA 1T33A 3MZYA 3UNGC 2X6YA 3IKTA 3BZ6A 1RR8C 1S6LA 1PUEE 2LNBA 4ABZA 3DWLE 4LGWA 1B8IB 1OCOH 2FMLA 2QQAA 2O3FA 2GLOA 1YW8A 3E5XA 5E1XA 3WGHA 2ICWG 4BL0B 5D6EA 2CQNA 5IP7J 3PFIA 5ERIA 5B1AH 2EH3A 2KHMA 4CYCA 2KL4A 1V5EA 3G3ZA 5EG0A 2XF5A 1HQCA 1KA8A 1U5TC 3JRCA 4B3AA 3HSEA 4M71A 1MKMA 1JJ6C 2X48A 1APLC 2H6CA 2ZMEA 2Q2EB 4HV6A 4HV5A 2CV2A 1GXPA 3FKIJ 1TWHJ 5FKNA 4MNUA 1LEBA 3QPHA 1WZ2A 1IRGA 3ABMH 3BCBA 4OOIA 4IHXA 2M0MA 3HM5A 1TW3A 2R0QC 3G1OA 2CG4A 2E1MB 3DTIA 1YJ9I 3FXKA 4GYIA 4DBQA 4CCOA 4AYBA 1ZN2A 1LVAA 2JA2A 1VF9A 3RJPA 5DCMB 1XGSA 2FRHA 3F8FA 5C3EJ 2XPVA 2IS4A 3KEQA 1CGPA 4XLAA 4EATA 1QPMA 1MD0A 2VPRA 2RQPA 1YHQI 3ELKA 4PJNA 3K4NA 4GFBA 4YIRX 3R60A 5LRSA 1UAAA 2KDZA 3CUQC 3N05A 1OYYA 2HWVA 2JVGA 3QOEA 2RNJA 2OQRA 2KRFA 3R0JA 3K70D 4CCLA 2QKLB 4XNFA 2OCEA 2M4KA 3ABKH 5A2QK 3FHNA 2ZXHA 2HOAA 4JOMA 4AYBN 1XDSA 4LK1F 1RETA 5FROA 1B72B 1WWXA 1LPQA 4CCNA 1U8RA 4NQWB 1ZGAA 2ELHA 4ZJZA 2WY7Q 2X6OA 3BJAA 5DYMA 3C2HA 3SZTA 1GHCA 1JUPA 2K7LA 3RKYA 3HRTA 1G3SA 4GCVA 1XC5A 2M8GX 3CDLA 1ZAOA 3BWGA 1CF7B 3B6AA 1HCRA 3WHCA 4XRFA 1R5ID 4P9UA 4RGSA 4LLLA 1AOYA 1WFXA 1ZELA 2VJIA 4IJAA 1PJRA 2LREA 3FXOA 3ZQIA 1D0YA 2ZO4A 5CQGA 4A6EA 2EFQA 1ETYA 4G6TB 1FSHA 2DTRA 2VI6A 2VASA 2CO5A 2PQ8A 4XKCA 1I27A 3TW7A 2GXBA 4LFUA 2GWRA 2R93J 4XLFA 4JX4A 2K3PA 3BJ6A 1SVOA 5HDGA 3TQNA 5M3FJ 1SFOJ 1MMSA 1R49A 2HNHA 2BBYA 3K7AJ 2KIFA 3NRVA 3QU6A 3OIOA 3BP8A 3V7CA 3SDBA 2B9SA 3OS2A 1XPXA 1ZG5A 2L9SA 1AHDP 1X1DA 4RB2C 1J0RA 4AVPA 1OLTA 4DW6A 4EM1A 3LSRA 3PJRA 3JAMK 5B66C 2V1XA 1WCMJ 2PX9A 4HA8A 1KQ9A 2Y0MA 1HXDA 2F5EA 2R5YB 3MKYB 4L5IA 2BE5F 1IDZA 3LQRA 2P4WA 3HOWJ 2DA1A 2QQ9A 4I7HA 2R7XA 2Q1ZB 4NC7A 2GBYA 4XM3A 1I1SA 2W85A 2EV5A 2CS3A 3PIOF 3JTGA 3WHBA 1QVUA 3JSOA 1KU3A 4M9XA 2M9HA 1QA6A 4KMFA 4N9HA 2IXSA 2YU9J 1UHMA 2L2OA 1Y56A 4Y4RA 1ZTRA 1XMAA 1A6IA 4BBRJ 3OYBA 4U0VA 1IV6A 1JJ8C 3UR3C 4HZFA 3O6BB 3QPTA 5K7ZA 1O4XA 4U88A 4YIIA 1VQMI 2P0WA 3T1BA 3A03A 3IV5A 3PQJA 1FBUA 1MBFA 1D1BA 3B6CA 1FJLA 2VE8A 3S3MA 3F9KA 4M9SA 2OA4A 1JTYA 4IQJA 2LSOA 3ZQ7A 1YOVB 1K6OA 2FE3A 2O0YA 2QSGX 4BXUA 3CF5F 5LGTA 5TJJA 2CQXA 4E7IA 1R9TJ 2Y31A 1QZEA 2YPRA 5KNLA 1V4RA 2A61A 2OPTA 1FYKA 1NK3P 2LKPA 2Y9YA 3HTSB 1QNTA 1Y8QB 1ZRFA 1USSA 1XX5A 2BY2A 2CQQA 2N8GA 2HZTA 3O3KA 1UHWA 3MVPA 3PUFA 3K4LA 4LITA 1MSEC 1JKPC 3RIRA 2XV4S 1OCCH 2K9QA 5DUIA 3E0JB 4XL9A 2ZC2A 4OMZA 3KLNA 4BHPA 5ICGA 4IQ4A 2Y0SA 2D1HA 2XASA 2PG4A 1T0FC 2CUZA 2ID3A 2R7QA 2HDWA 3PL8A 5TISC 1BOBA 3BDDA 1JTXA 3KZIC 1Y0UA 3L2RA 1FOWA 4WF2A 5J40A 3OYFA 1SD5A 4A3MJ 3CC4I 4B09A 3J7AY 2EIKH 5E79C 1KQ8A 1EA3A 1NHAA 4ESJA 4A5MA 2RREA 5EGOB 3HOZJ 4IRHA 2NVUB 2EJRA 4R79A 1OR7C 1RRJA 3W6VA 4S0HB 2J5OA 5DD8A 2ETHA 3E6BA 1D8KA 2Y0SN 3H5NA 3S3OA 1IXRC 3D5RC 4G94A 1SVLA 3DEUA 4XMYA 1ZH5A 2LY2A 4IOCF 2F2EA 3ZMUA 3GMEA 4XSZF 2VOPA 4BXFA 2I8DA 4OIRF 1Q1HA 1MBHA 2DA5A 4N0BA 4B1RA 2OTJI 2YUSA 5J4YA 4XLPF 6PAXA 2LY9A 4MIMA 1TWAJ 2G9WA 2R7WA 3OYCA 2HS5A 2LP0A 1B59A 1U9OA 5L3DA 5HS9A 1B1BA 5FFXA 2O61A 3SEZA 3ERED 3E5QA 3CTAA 4V2GA 4XRMA 5B5EC 2LVSA 2VC1A 3ZQQA 4JYKA 2MH2A 3J81Z 2VJ4A 2CH0A 2L9RA 4W1UA 2IA2A 2E1MC 3OWTA 5EEGA 1S5LC 3QU3A 4CCMA 2DOEA 3SZPA 5LBQA 2MFZA 3NQOA 4G7HF 2Y30A 1N77A 1TWFJ 4FE4A 4LIUA 3DQVC 4QTRA 4BACA 2O7OA 3PO3J 4HNTA 2E1OA 3L2QA 3TGNA 3KFWX 5HVQC 4CSWA 1ZLKA 1FY7A 1J9IA 3FKJA 4CZZA 3CQZJ 3MD2A 2LY1A 4UVCA 1I6HJ 2M0CA 2ACJA 2YR2A 3DU5A 1S9HA 3IRRA 1YLFA 2K9MA 4RAGA 2K86A 4UB8C 3DKXA 3RYPA 1P4AA 2PN6A 4BDZA 2MA3A 3I5UA 3WTYC 2OCCH 1J5YA 3BPXA 2EB7A 3GLLA 4BJ5C 2H8WA 3NWTA 4JQFA 2RAEA 3GTLJ 4ZC3A 3E7LA 4MEYF 1TP4A 4XRSG 2KIQA 2VJ5A 1VQ5I 1IRFA 3BR1A 2KIUA 3H36A 1I3AA 2V9VA 3J7YJ 5E17F 4XQFA 3A01B 5DCFA 2IBDA 2XB0X 5JR3A 4A3IJ 2M1BA 1ETWA 1JE8A 4KFCA 2BYVE 3M4OJ 2VQGA 4A2UA 2XSJC 1TC3C 2ZB9A 2ZBKA 4KIGA 4XN0A 2NYXA 3WU0A 2XAUA 3CJNA 3CCEI 4RGRA 4D9JA 4A3LJ 4HDUA 3FXMA 3CCSI 1XMKA 1QHGA 4NC8A 2HVQA 1E3OC 5E8IA 2NNNA 1LE8B 4HQMA 1X3ZB 3ZP5A 2AXTC 2V9KA 4XOTA 2XAFA 1MH4A 1TQPA 3HGYA 5CVUA 2OUMA 2IVMA 4LLNA 2OD5A 1HW1A 3JCUC 1ZRCA 1OCRH 2FOWA 2CFXA 1J7KA 4XONA 2KIMA 3DP7A 2NRAC 3H3VK 1BC7C 1U5TB 1OYIA 3VB2A 1Z1DA 2MGQA 1OMIA 3JRFA 1HF0A 2VXZA 5EZGA 1Z3XA 2VBYA 3M9AA 2WWYA 3VSKA 3ONQA 5BS6A 5KAFC 4Y52J 3MN2A 3VEPA 2DMTA 1PVEA 2E60A 2VBWA 2GA2A 1D8JA 4C2UA 1YG2A 2IT0A 4A93J 2VPLA 2O5RA 4ZDPA 2COBA 1IJWC 2Z2SB 5KK1A 2WBMA 1UJ8A 3QRFF 5D6FA 2HR3A 1WH7A 3BT9A 3JW4A 1Z77A 2K9SA 2R7VA 4XLHA 3VODA 5DV5A 3S32A 3SHFA 4ENNA 2JMWA 3F22A 2JUCA 3CJQB 4K2EA 1D1CA 4AC0A 4DYCA 5JI6A 3WGIA 3O2PE 4RMNA 4GRIA 3RDIA 3BZKA 3QODA 1YI2I 3MQ0A 1HW2A 4UVAA 5C4JJ 3RPQA 3H35A 4XN3A 1SD6A 4A3JJ 5HS8A 4CO8A 2KZGA 3IKVA 1QZZA 3CUQB 3IHUA 1G3YA 2NVXJ 1R1UA 2EA4A 4OINF 3W2AA 2VKEA 3I59B 1NG7A 1W5SA 1WKMA 4FCYA 3B02A 3BQYA 3U21A 2E7WA 4RGXA 2CUFA 2R7SA 2Y9ZA 2BY1A 2H09A 4C3HJ 3A1YA 2ECCA 4DGWB 3LFUA 2YSRA 1H88C 3LA2A 4KISA 1G3WA 3CC7I 2QF7A 1UMQA 1UB9A 3OL4A 3BTIA 4MQVA 5H2FC 4UUSA 1LB2A 4BY1J 3HOYJ 5FRNA 2DJNA 4BS9A 2TDXA 2ZMEC 3M1CA 1PP7U 4RB1A 5FD6A 1IXCA 1YIOA 3WTZA 3MKZA 3BJOA 1X1AA 5AIQA 3GTMJ 1V3FA 2J5PA 4KITB 4JK1X 3WTXC 5DD4A 3G4SI 1Y39A 1KU9A 1WJCA 4ESFA 3KLOA 4ZYAA 4BAYA 1IUYA 3HOSA 1IGNA 2KLOA 1DGRM 5K5RA 2Z16A 1HDDC 5FLXK 4FTHA 3G6EI 5GTIC 1X1PA 2M30A 4XLEA 4LG0A 3TW6A 4ASNA 2DI3A 4FHTA 2FA5A 3EETA 3DPLC 4Q47A 4CYDA 3U9GA 5JHFA 1WQ2A 2QM3A 3PNVA 2QLZA 4KICA 5J8FA 1QPIA 4PJLA 2K27A 5FB2A 5CVJA 4ITVA 1MDMB 3Q3SA 1MMDA 2GXAA 4UXNA 3KYLA 4BQNA 1S72I 1GUUA 3ABTA 4YRVA 1K6YA 2X9DA 4AIKA 3CCJI 2E34A 2QUFA 1A36A 5EDNA 5DS9A 3VFZA 3L2VA 3BOQA 3SQNA 2PJRA 2G7UA 4EM2A 2YS9A 2TCTA 1K83J 4CUGA 3C7JA 1AKHB 5LGUA 1T08B 5IYBJ 3WE2A 1BR4A 1HLVA 3WTTC 4P1WA 2QCOA 1LDJA 4RS8A 1XGMA 3I58A 2E19A 3CP2A 3QP6A 2JSPA 1XGNA 3HUGB 3ZQCA 3TBIA 4WK8F 3GO5A 2BVLA 2HXIA 4X1EA 3K10A 2ZXWH 3BQZA 2XROA 2VKDA 1SFEA 3OOUA 5BMZA 4BJ6C 2NNYA 3CCLI 4HX8A 1D5VA 3UKGA 1ETOA 4A3FJ 1R7JA 2CQ7A 3HSRA 4OIOF 1BC8C 5F0CA 1Z7UA 2DA2A 3MZ8A 2W1OA 3K6GA 1Z91A 2G7HA 4A3KJ 5IY5H 1W36C 4PSWA 1OCPA 2DOFA 2QBYA 3GZ5A 3S1MJ 3BR6A 4UVBA 3GX4X 1UFMA 3RKWA 1RKWA 2MYSA 1Y0NA 3MWMA 4IEJA 5CVIA 3RPUA 3QPSA 1O3TA 1JXSA 1S3JA 2NAZA 4BUPA 3G71I 1U8BA 3GBGA 2OU2A 4PJJA 1SEUA 2AO9A 2RN7A 5BQTA 2FNAA 3CD6I 1QBJA 2M5WA 2DT7B 3BTJA 1OJLA 3KP5A 1X19A 1W36D 1USTA 3ZMDA 1N78A 3E6MA 4AIDA 1O7FA 1YYVA 4BXXJ 5DM6F 4QLCU 3K69A 3CJTB 3OYJA 4XKVA 3E6CC 4G9YA 4E7ZA 4CHUA 2MLGA 3HYIA 1V5FA 4KNYA 1RNLA 3ZPLA 2CUEA 3O8GA 2HYGD 2DA3A 1MMNA 4KIFA 1PUFB 4EGZA 4BEHA 4HF1A 1ZKGA 1NG6A 2K85A 4ETSA 4A6DA 2C6YA 3OL3A 5BPIA 4G12A 3HXLA 2CU7A 1V5GA 3GVAA 3ZN1A 4FASD 4L5EA 3PIPF 2DJIA 2EA2A 2G0EA 3F8CA 5HLIA 4M3FA 1WJFA 1WSUA 5TRDA 2VB6A 4BGDA 1MBGA 1R6RA 3LSMA 4NNJA 2RNGA 3WU2C 1R5GA 3PFYA 3N4MA 1WJ5A 2V1UA 3TDZC 2BY3A 2ELKA 1TQIA 1VFCA 5FJ8J 2RDPA 1ZREA 3BG3A 3DLAA 3FXRA 2LBFB 3HG9A 3S1RJ 1VQPI 3ABUA 2X1DA 3H9JA 3H3ZA 1R58A 2NS8A 3VOEA 3M8EA 1RKTA 4IVNA 2M87A 4M74A 1UZCA 4KA4A 1I39A 3QWLA 2LYCA 4KMUX 4HYEA 2WV0A 2E1NA 3IH3A 5CJ9A 5AIPA 3TEDA 3AG1H 4RB0A 1O3RA 3EYIA 3ZQHA 5JLXA 3KETA 3K1PA 2F5VA 4YELA 1TNSA 4OU0A 3L00A 4HEA2 4CDGA 2PJRB 2DA7A 4HX4A 2FX0A 3CLOA 1ON1A 5IOZA 3J80Z 3WGGA 2Z99A 1U2WA 3OYHA 5CKTA 2EZLA 2HZDA 3P7NA 3VDXA 4HLXA 2O03A 4KIBA 1F4KA 4JBAA 2MW8A 3OSGA 2ME0A 2VQLA 1OQYA 1XDUA 3NARA 2JQ7A 4RAYA 3HHGA 1SANA 1ON2A 2EZHA 2ZSIB 3FK6A 2XAQA 4DIQA 4L9VA 3ML6A 1FTZA 3J81K 4F91B 1VZ0A 5GADJ 1WGXA 2GXGA 5LEKA 2X51A 4IRGA 1SFXA 2L02A 1OYWA 1IUFA 3OV8A 2PFBA 5K7FA 3QYFA 4RAZA 1JT6A 5D8LB 3OS1A 2W4SA 4HNUA 2COMA 3ZQLA 2DTZA 3GFMA 4GO1A 3E5UA 3CCVI 3PNTA 3KYCB 2F6CA 1ZGJA 4ON0A 1TT5B 3JRIA 1XGOA 1G3TA 3K2ZA 1XSVA 1YRNA 2LF7A 4OIQF 5ILSA 5F64A 5FD5A 1G6NA 3ZR8X 4PK4A 3DU6A 3G2BA 1W7PA 1X2MA 2DPDA 1LDDA 1P6RA 4L5JA 3T5XA 3A4CA 3RQIA 2D5VA 2QSHX 2LC2A 2CFOA 2DLLA 5EEHA 1Z6RA 4Y13A 3TOBA 1QGPA 3CDHA 3ZN0A 2LFBA 3LMMA 4EJWA 3I4MJ 4BY7J 2UWMA 2ESNA 2X6WA 3QQAA 2ZJRF 2KZVA 2HKOA 3FMSA 1GVDA 4II2A 2Z9OA 4XORA 4EQQA 2R4GA 4RLFA 5HLTA 2DFIA 2D45A 1KONA 4NC6A 1EKEA 2Z33A 5GPCA 1R4MB 2CW0F 2EFOA 4UUVA 3I4PA 4XRSA 4I6ZA 2E2IJ 2QVOA 2L01A 4RBOA 2DMQA 1VNDA 4LB5A 2EFNA 4LB6B 1FZPB 2EZIA 3OY9A 3HOUJ 4HOBA 4U0YA 4D1QA 1JHFA 1FP2A 2DQRA 1T8IA 1P9QC 1BM9A 2JN6A 2Z5UA 2FQ3A 2L3DA 3OIQA 2KDOA 1NTCA 5FO5A 2XPWA 1SFUA 1AA7A 2FBKA 1LDKB 2VXDA 2P6SA 3V7RA 2JPCA 4OAYA 4CYCB 4AIJA 3PQKA 2IS6A 1Z7LA 2BHZA 3CMEI 5EG0B 1PP8F 3LL7A 2PMHA 4YEJA 1X1BA 3S14J 3D1NI 3DBHB 4F93B 2EK5A 1K78A 1F5TA 2EBIA 2XUBA 2ZMEB 1DU6A 3IAM2 1BR2A 3AKZA 4BE0A 3OR2C 3ZOBA 4F52A 2XB5A 3DPTA 4BYYA 4A3DJ 1FIPA 3E6DA 2L9NA 4PGGA 1QO0D 4IHVA 1FC3A 3N97A 3LSHA 1BR1A 3CCQI 3P9CA 4FE7A 1G8XA 1ZG1A 1Z9CA 1YITI 4L9TA 5GAEJ 2BW3A 2UUZA 3I71A 4HRIA 3ERMA 2IGNA 3M1EA 4XKWA 2HYFA
chains in the Genus database with same CATH topology
3FBIB 3CZ6A 2VXZA 3MKWB 4ZTJA 3DTEA 1Z3XA 3VSKA 2M4GA 3CMMA 3ONQA 2M3AA 2LRDA 1DQUA 2HU9A 2LOOA 3AFHA 3RQ4A 2E60A 2AQEA 4C2UA 2W00A 2VPLA 2F4IA 2O5RA 4ZDPA 5HOOA 2Z2SB 2WBMA 2WAQA 1ERDA 2R7VA 4XLHA 3S32A 2V26A 2X6XA 3CJQB 1D1CA 4C30A 3C2GA 2R7TA 2CW8A 4RMNA 4GRIA 3QODA 3H35A 4XN3A 2V4JC 3BCAA 3HPHA 3NWSA 1MNEA 4NUBA 4CH7A 4X0GA 1LVKA 1LFPA 3W2AA 3HL2A 3BG6A 4E7KA 1TT0A 4QPOA 3CF2A 1NG7A 4BQOA 4C9YA 3U21A 4MLOA 4DOZA 2R7SA 3OR1C 3A1YA 1Z21A 4DGWB 3LFUA 2JUGA 3H0DA 4RM3A 4KISA 3OL4A 4ANJA 3PUBA 2KPMA 3OYDA 5FRNA 1Y6IA 4BS9A 2GOXB 2WAEA 2ELJA 3EUHC 1WJBA 3M1CA 3H5RA 4H4KC 3MKZA 1X1AA 4CCJA 2XF7A 4C2TA 2RQQA 3S3NA 3BG7A 4KITB 2ZFUA 1WJCA 3UNGC 2X6YA 4ZYAA 3HOSA 3EUAA 3DWLE 2KLOA 1DGRM 3HKZA 2Z16A 1JI8A 1X1CA 4LIVA 3PSFA 4BL0B 3L2WA 4XLEA 4HG2A 3ZCOA 1G59A 4CA0A 4E7LA 2KHMA 3VYSB 2AQFA 3DPLC 2KL4A 1V5EA 2LH9A 4XLCA 2XF5A 5JHFA 3VYTB 3PNVA 1YE9A 4BEHB 4PJLA 2KQRA 2IS1A 4ITVA 2VIXA 1MMDA 2Q2EB 2CV2A 3KYLA 4BQNA 2E5ZA 3HOTA 4YRVA 3OS0A 1K6YA 3W2VA 4BE1A 2BOLA 2DCEA 3BCBA 2M0MA 4PUSA 2E1MB 3DTIA 3L2VA 4OAZA 2VLAA 1Z3YA 3K4MA 2PJRA 3E1SA 3M8JA 4DBQA 2UV1A 2JVHA 3BC8A 4CCOA 1UELB 4AYBA 4CUGA 2JA2A 2WADA 2VQHA 4B47A 3K4JA 2VL8A 2IS4A 2HVSA 4XLAA 4XR6A 3EPZA 4AU7A 4EATA 4F3QA 1BR4A 2R7OA 4PJNA 4P1WA 3K4NA 1UAAA 5KHDA 3DEEA 3N05A 1U0JA 2IGMA 2JVGA 2CUJA 1UG0A 3QOEA 3CP2A 1SAUA 2JSPA 3K70D 3HUGB 4CCLA 2L5QA 2QKLB 4XNFA 3TBIA 4E7SA 2M4KA 4B3XA 3FHNA 2ZXHA 2BVLA 4JOMA 4QPQA 4E6KG 3AL0B 5FROA 2CMPA 3K10A 2VKDA 3OOUA 4CCNA 2NOJB 3W3CA 4BJ6C 4NQWB 4ZJZA 2WY7Q 4CZCA 3C2HA 4J00A 3OYLA 4RLQA 1PYVA 2WA0A 3HPGA 2DXIA 4BJTA 4KJZA 3LSKA 2HPMA 2W1OA 1MMAA 3K6GA 3RTRA 2BVMA 3RCOA 4DBRA 2VJJA 1WFXA 5LD2C 1W36C 1ZELA 2VJIA 2E5NA 4PSWA 1PJRA 2LREA 2CW7A 2MD0A 1WJAA 1D0YA 5CQGA 2XF6A 2MC4A 4G6TB 3SZGA 3I3LA 1D0XA 3OYNA 2VASA 3KX2A 3S93A 4N4NB 4II3A 4XKCA 3D5LA 3VSLA 2MYSA 4XLFA 3LSIA 2IS2A 2K3PA 1WJDA 4XKBA 1D1AA 4IKFA 2OV7A 2HNHA 2K5CA 2X85A 3PSIA 3SDBA 3OS2A 4KT6A 2L9SA 2W82A 4BUPA 3GBGA 3ZRGA 4PJJA 2WB1A 1X1DA 3K4BA 4CCKA 4Y33A 1OLTA 4PFOA 3PJRA 2DT7B 1X19A 1W36D 3BLYA 1N78A 4HSRA 2M7BA 2A6TA 5LFAA 3MKYB 1X4OA 3SEQA 2R7XA 4ZDOA 2Q1ZB 4NC7A 3OYMA 3OYJA 4XKVA 4E7ZA 4XM3A 1V5FA 2CS3A 2KP6A 4B48A 3D5SC 2MABA 4P5OA 1WJEA 2V1NA 1MMNA 2Z1DA 2IXSA 4BEHA 5TGTA 1NG6A 2L2OA 1Y56A 4Y4RA 3OYEA 3H9GA 3OL3A 3QYBA 4IX7A 3HXLA 3OYBA 1V5GA 4FASD 3IAS2 3UR3C 2DJIA 2IGKA 2P0WA 2ZXIA 3A2KA 2M7AA 4PJMA 1WJFA 1FMWA 1D1BA 2ZSHB 3DTKA 1N75A 3S3MA 2VB6A 3F9KA 4BGDA 1R6RA 2KMUA 3LSMA 3MMYB 5FRMA 4NNJA 3DPUA 4B44A 3OYGA 2RNGA 4IQJA 1D0ZA 3PFYA 3OIPA 1WJ5A 1MW7A 3DLAA 2LBFB 3HG9A 4RM2A 4E7IA 2X1DA 3H9JA 1DGWY 5KNLA 1QHHD 3PNYA 1E0EA 2X1EA 1MNDA 2LYCA 3CESA 5CPRB 4E7HA 2K9LA 1SFKA 2XC7A 4J01A 1LKXA 2F5VA 2IGOA 4YELA 3ZXSA 3ZGKA 4HEA2 2PJRB 3K4LA 4LITA 2L7KA 3V42A 2LG4A 1X4PA 3E0JB 4XL9A 3TL4X 4BE2A 2HPIA 3OYAA 4IQ4A 1YX3A 2Y0SA 1IRXA 3TMOA 5CKTA 2HZDA 3VDXA 3OYHA 1T0FC 2CUZA 3PL8A 2PMZA 2R7QA 2HDWA 4BDYA 1BOBA 3H5AA 2QKMB 2VQLA 2BW3B 1J09A 3L2RA 3CP8A 3OYFA 3K4CA 3J7AY 1EA3A 2ZSIB 3IP4B 3KEYA 4DIQA 4F92B 2RREA 4F91B 1VZ0A 4R79A 1OR7C 2X51A 2FUG2 4AVZA 2VQCA 3H5NA 3OS1A 3S3OA 3QYFA 3EUKL 3D5RC 2W4SA 1QU3A 4HNUA 3FBNB 4XMYA 2LY2A 5HNHA 3PNTA 1GLNA 2I8DA 3LSGA 4BXFA 3OYKA 2F6CA 2A5WA 5CQEA 2W7NA 2R7WA 3OYCA 3OYIA 3RPUD 3ZR8X 4PK4A 2XDVA 4LG3A 3DU6A 3G2BA 4BU2A 3SEZA 4PSXA 1YX5A 4OWRB 3A4CA 3ZQQA 4HPQA 2LC2A 2CFOA 2CH0A 2VJ4A 4BQQA 2E1MC 3OWTA 4E7JA 2DT6A 3LMMA 4CCMA 4B43A 2UWMA 2X1CA 3RSNA 5KCMA 3VYUB 4PFPA 2MFZA 2X6WA 3L2UA 4ZDLA 2KZVA 1N77A 4LIUA 3DQVC 3HC7A 4II2A 4BACA 4HNTA 4XORA 2R7UA 2GOMA 3L2QA 2R4GA 4RLFA 5HLTA 2CV1A 1KONA 4DJAA 4ZTFA 2V6EA 1T95A 3SYTA 5HVQC 4XOPA 4CSWA 3FKJA 1MMGA 4HSTA 3S8PA 2OC6A 3MD2A 2LY1A 4IZZA 3OY9A 3DU5A 1S9HA 4F55A 4D1QA 2K9MA 4U87A 3AL0C 2WY8Q 4U7BA 1P9QC 3DKXA 3OIQA 2KDOA 4BDZA 1TZLA 3H9QA 1AA7A 2HVRA 4BJ5C 3NWTA 2LBFA 1LDKB 2VXDA 4OAYA 4JQFA 4ZC3A 1DP3A 2WAFA 3I9V2 3VYRB 1Z7LA 5HNFA 2IS6A 2KRCA 2VJ5A 3LL7A 4YEJA 4XQFA 3OMYA 1X1BA 3K70C 4F93B 2VQGA 2XSJC 3QYEA 3IAM2 1BR2A 4XN0A 3AKZA 4BE0A 2CV0A 3VWBA 2DOAA 2XAUA 3OR2C 4F52A 3DPTA 4D9JA 2HQAA 1HA8A 3DKYA 2VKHA 2L9NA 1QHGA 4NC8A 1FMVA 2HVQA 3CJRB 4Y3OA 2KRHA 3LSHA 1BR1A 2V9KA 4XOTA 3FDYA 3K4KA 1G8XA 2OUMA 2V7FA 2R7RA 2BW3A 2UUZA 4FETA 4XONA 4HRIA 4N4OB 2IGNA 3IUOA 3W2WA 4XKWA 4E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J00 A;  4J01 A;  4IZZ A;  4HRI A;  3QOE A;  3QOD A;  4YRV A; 
#chains in the Genus database with same CATH topology
 4ZYE A;  3IH2 A;  4G7Z F;  3WOD F;  2FSW A;  3BY6 A;  3MCZ A;  3MKW B;  4ZTJ A;  5E8G A;  5L3B A;  3DTE A;  4DYQ A;  1AU7 A;  1IN5 A;  2M4G A;  2M3A A;  1JT0 A;  2K9N A;  3AFH A;  2HXO A;  5IPA A;  2AQE A;  2QQ8 A;  2RC4 A;  3KZZ A;  5IP9 J;  1FT9 A;  2FXA A;  2GZW A;  4A69 C;  1MNM C;  2WAQ A;  1HKS A;  2VOO A;  3E97 A;  2H6B A;  1DP7 P;  3EQL F;  2B0L A;  2HTJ A;  5BNG A;  1R22 A;  1K61 A;  2X6X A;  5BOX A;  4O6J A;  2LLK A;  4GYG A;  2ME6 A;  1J59 A;  2LDU A;  3JR9 A;  1M1E B;  1YS6 A;  3BR0 A;  1H89 C;  1R71 A;  3C1D A;  3HPH A;  4NUB A;  1YFH A;  1MNE A;  2QEN A;  1BL0 A;  2P7C B;  2LKS A;  4QSH A;  3CCU I;  2WAQ N;  2ZJP F;  1LFP A;  2RKH A;  2XGC A;  2A05 A;  1TT0 A;  3IH4 A;  4P55 A;  1EH6 A;  3CF2 A;  4XBF A;  4BQO A;  2DMU A;  3V8L A;  1WVR A;  2DFH A;  2FNP A;  3NAU A;  4HAM A;  3BRO A;  1W5T A;  2L7M P;  2P8T A;  2BV6 A;  2DA4 A;  1ZHF A;  4UNO A;  1STZ A;  2ECB A;  1IDY A;  2JUG A;  3H0D A;  4DQ2 A;  1MBJ A;  3JRH A;  1ZR4 A;  3GF2 A;  3KYD B;  2CRG A;  3CCY A;  2EFW A;  2E2H J;  4D5C A;  3PUB A;  1YTY A;  3R6S A;  1L0O C;  1Y6I A;  3HRU A;  4ZZD A;  2ISZ A;  3CCR I;  2L4A A;  2WAE A;  3RZO J;  3HBL A;  1WJB A;  3F6O A;  3GTK J;  5J4V A;  3U1K A;  1XSD A;  4CCJ A;  3KZY A;  4C2T A;  2RQQ A;  5GPA A;  3S3N A;  2ZFU A;  4Y7N J;  1V55 H;  2ZKZ A;  2K02 A;  1FTT A;  4G8X A;  3L9F A;  1ZGW A;  1R5H A;  5ED4 A;  1RR7 A;  3HKZ A;  1MBK A;  3KPH A;  1JI8 A;  2VT2 A;  4NHJ A;  4LIV A;  3U1D A;  3L2W A;  5JLW A;  4HG2 A;  4V19 K;  1J2X A;  1RUO A;  2P81 A;  1ITY A;  4E7L A;  2F5F A;  1KZH A;  2H27 A;  4I2O A;  2AQF A;  2A3S A;  3FK7 A;  2LH9 A;  4XID A;  3J7A O;  1YW7 A;  1BI2 A;  3VYT B;  4J19 A;  4MEX F;  3MKL A;  3JRD A;  2EV0 A;  3GFI A;  1VQ8 I;  1JGS A;  3L1P A;  2GAU A;  3GEZ A;  3V8J A;  3MEX A;  3HKZ N;  4M3G A;  3HOT A;  1BI1 A;  3G1M A;  2QA4 I;  2X4H A;  4M9Z A;  1XN7 A;  4BE1 A;  2BOL A;  3DBR B;  3AAF A;  2P7V B;  2KFD A;  1JKQ C;  3AG2 H;  1WH5 A;  3GYH X;  2XAG A;  2XSD C;  2A6H F;  2VLA A;  3E1S A;  1FYL A;  3BTC A;  3CDI A;  3M8J A;  2DT5 A;  2STT A;  2UV1 A;  2JVH A;  4GDF A;  1UEL B;  2VON A;  1DPR A;  4L18 B;  2WAD A;  1VTN C;  1V54 H;  1NK2 P;  2GIZ A;  2NVQ J;  3K4J A;  3ECO A;  3LST A;  3F8B A;  3G1L A;  4UY8 I;  2HFH A;  4AU7 A;  3EPZ A;  3S2D J;  3K2A A;  4F3Q A;  2STW A;  1YJW I;  4D7N A;  3DEE A;  1U0J A;  5CVV A;  2E35 A;  2OAZ A;  2EQR A;  4PJ0 C;  5F08 A;  4E7S A;  3F72 A;  4QPQ A;  1ORK A;  1Z0X A;  5CVR A;  4AIH A;  4E6K G;  2R5Z A;  3AL0 B;  2B7E A;  2CMP A;  1BBY A;  2NOJ B;  2A07 F;  4BQA A;  1YW9 A;  4AD9 A;  2O9L A;  3ASO H;  2P5V A;  4J00 A;  4IF4 A;  4D7M A;  3KP3 A;  3OYL A;  5D5V B;  1SD7 A;  1B9N A;  3DV8 A;  4BJT A;  5K5Q A;  3LSK A;  2HPM A;  3DKW A;  4ENJ A;  1MMA A;  3S1Q J;  3RTR A;  3RCO A;  2BXY A;  2NOG A;  4DBR A;  5LD2 C;  1U78 A;  2Y69 H;  2E5N A;  2DK5 A;  3WTW C;  1JHH A;  2MD0 A;  1JKR C;  1TWG J;  3TDU C;  2XF6 A;  5B1B H;  3I3L A;  2W84 A;  5B3S H;  2HI3 A;  3KX2 A;  1L3L A;  3S93 A;  2EIL H;  3D5L A;  1EJ9 A;  4OMY A;  2EV6 A;  3V8K A;  1UG2 A;  2F5C A;  3LSI A;  1WJD A;  4XKB A;  3Q0V A;  4D5F A;  1GV5 A;  2OV7 A;  1R1V A;  2JSC A;  2HTS A;  1R23 A;  2L7F P;  3HTU A;  2X85 A;  3Q9V A;  4XK4 A;  1AWC A;  1MH3 A;  1O57 A;  5GTH C;  1TNT A;  3C2B A;  4MTE A;  2VT3 A;  3ZRG A;  2WB1 A;  4CCK A;  1UHS A;  2JPB A;  3K4B A;  1Z6T A;  5E20 A;  1ULY A;  4Y33 A;  4UUT A;  1FOY A;  5J1U A;  2LTP A;  2ZCW A;  5LHG A;  4HSR A;  2M7B A;  2A6T A;  4B4C A;  3P5J A;  1FPQ A;  1IC8 A;  1B8I A;  5L3G A;  3OSF A;  3WU1 B;  3FXU A;  3SEQ A;  2DQL A;  2GIV A;  3OYM A;  4FQG A;  4ZDO A;  3LAJ A;  4Z6Y A;  2IJL A;  2QGU A;  4B48 A;  4F7Z A;  2OJE D;  2MAB A;  2WB1 N;  5IYD J;  1SMY F;  1WJE A;  4Z2Y A;  2ZJQ F;  1HOM A;  2Z1D A;  4Q48 A;  4UB6 C;  3GFJ A;  5TGT A;  4HLY A;  2DDB A;  1R1T A;  3H9G A;  4IX7 A;  4PCQ A;  5C4X J;  3LAP A;  4W97 A;  2Q2E A;  2V9P A;  1X3W B;  2WC2 A;  5ICF A;  2JK3 A;  3IRQ A;  4L9N A;  2XIG A;  3A2K A;  4LLG F;  1I50 J;  2M7A A;  3ZMS A;  1R36 A;  3GZN B;  1FMW A;  1VQ9 I;  2A69 F;  2ZSH B;  1RZ4 A;  3JRA A;  2OBP A;  2DAO A;  3BPV A;  1YIJ I;  1NH3 A;  2KMU A;  5FRM A;  2DOD A;  4FIS A;  3DPU A;  5FLM J;  3NEU A;  3OYG A;  2VN2 A;  3F23 A;  2FD5 A;  2TRT A;  4EJO A;  2L9V A;  5DCM A;  1XS9 A;  2E36 A;  4N9I A;  4Y15 A;  3H0G J;  1BIA A;  2OZ6 A;  2KKO A;  5E1W A;  3M07 A;  5IT3 A;  1DGW Y;  2F4O B;  4Q5S F;  2R92 J;  2F48 A;  1QHH D;  5CYV A;  3HIF A;  3CUO A;  1E0E A;  2X1E A;  1GDT A;  2DU9 A;  3GTQ J;  3V4G A;  3ZMZ A;  4BHC A;  2V1D A;  1TQM A;  2OF7 A;  4R1H A;  1SVM A;  2K9L A;  1S7A A;  4ZYG A;  2XC7 A;  4J01 A;  1B72 A;  1LKX A;  1BI3 A;  2IGO A;  1T6S A;  4CIC A;  2L7K A;  4NQW A;  4AUX A;  1X4P A;  3ZQG A;  5E3N A;  1IO2 A;  2Y75 A;  4BE2 A;  2HPI A;  1YX3 A;  1IRX A;  3BR5 A;  2W57 A;  3E3V A;  4NDL A;  1E3H A;  2PMZ A;  3B73 A;  3H5A A;  3KP4 A;  3KP2 A;  1WI9 A;  1CF7 A;  5J47 A;  3CMY A;  2HDC A;  1J09 A;  1S7O A;  3L2C A;  3CP8 A;  1LQ1 A;  3F3X A;  3S17 J;  2UZK A;  5FKK A;  3J7Z I;  4RAF A;  2Y48 A;  4WXC A;  2R3S A;  4B8X A;  4L0Y B;  1MJB A;  2HQR A;  5JVG F;  2FUG 2;  1A35 A;  4MHG A;  2VQC A;  3K9T A;  1SD4 A;  3LQQ A;  5E3M A;  2PMZ N;  2IAI A;  2UXX A;  1BIB A;  1ZK8 A;  3SXY A;  2VC0 A;  3PM1 A;  3GTG J;  1REP C;  1R4N B;  5HNH A;  1GLN A;  3LSG A;  1RC9 A;  3OYK A;  3LA7 A;  4M3D A;  2A5W A;  3LSJ A;  3R61 A;  5CQE A;  4S05 A;  1IW7 F;  1IN6 A;  1FBQ A;  4IO9 F;  3S2H J;  1XD7 A;  2UXN A;  3ABL H;  3OYI A;  3WTU C;  5LLQ A;  1MJA A;  2PJP A;  1RI7 A;  2XDV A;  4LG3 A;  3WE3 A;  4BU2 A;  4C3I J;  3GTP J;  2PMU A;  4EV0 A;  4WXD A;  2KJC A;  4I01 A;  2ID6 A;  4C2M J;  2R5Y A;  1R00 A;  5DUK A;  1MSF C;  4KN7 X;  3TKY A;  1IRZ A;  1YX5 A;  4OWR B;  3W6J B;  4HPQ A;  4JX5 A;  4HQE A;  2VKV A;  2H1K A;  1X3U A;  4EMS A;  4BQQ A;  1B9M A;  1W1W E;  1P4W A;  1JUS A;  2DT6 A;  2BY0 A;  1ENH A;  2BZT A;  2ISY A;  2I5U A;  2X1C A;  2M8E A;  3TO7 A;  3KP7 A;  3A0B C;  3IWF A;  2H94 A;  1G2H A;  3ASN H;  4ZDL A;  4I98 B;  3WTV C;  1I1G A;  3HRM A;  4UUS B;  4HF2 A;  2GOM A;  5ICE A;  5L3C A;  3ISP A;  2M34 A;  4XIC A;  1S7E A;  3CCM I;  4BBS J;  1T95 A;  4XOP A;  1FIA A;  1MMG A;  2CQK A;  2OC6 A;  5LEJ A;  4EJU A;  4A3E J;  1P7J A;  2ADU A;  1YJN I;  3BTL A;  1HC8 A;  2DFF A;  4U87 A;  3AL0 C;  2WY8 Q;  4U7B A;  5D4R A;  1F36 A;  2Z3Y A;  2XRL A;  4DZP A;  1Q1V A;  2L54 A;  1MBE A;  4A3G J;  4LG0 B;  2K4B A;  1DP3 A;  3I9V 2;  3VYR B;  4EGY A;  5HNF A;  2KRC A;  1U3E M;  5HDK A;  3DLL F;  4EEF G;  1I3Q J;  3OMY A;  2O8X A;  3I54 A;  2XGX A;  3K70 C;  3M7G A;  4ZYH A;  3FXQ A;  1P4X A;  3DBL B;  4H0E A;  4WX9 A;  2CV0 A;  2QEX I;  5M3M J;  4IRI A;  4E70 A;  1YQA A;  2HQA A;  4BKX A;  2JT1 A;  3DKY A;  3KCC A;  2VKH A;  5M5Y J;  3BG9 A;  3VPR A;  4TV7 A;  2KRH A;  5D5U B;  1OCZ H;  3HZJ A;  4ENK A;  2CSO A;  2HYJ A;  5FLX Z;  3K4K A;  4UV9 A;  2D2W A;  2V7F A;  1EV7 A;  4HBL A;  4IPA A;  4M73 A;  3RKQ A;  4I0A A;  1O3S A;  1HDP A;  4N4O B;  3ROU A;  2DBB A;  4E4H A;  3FBI B;  1W0U A;  3V7S A;  1KYZ A;  4S04 A;  5EGO A;  1MGT A;  3FM3 A;  3HRS A;  2RVC A;  3GFL A;  5LRR A;  1U6G A;  2VUM J;  2EWN A;  1FOX A;  1T38 A;  5HDN A;  2HU9 A;  2LOO A;  3L09 A;  2W00 A;  2QQB A;  2WV1 A;  3HOV J;  3FX3 A;  2DYR H;  1XCV A;  1ERD A;  2MBF A;  2LD5 A;  1SMT A;  3MAJ A;  1ACI A;  2V26 A;  4AM3 A;  4RA2 A;  4IHW A;  4NBQ A;  4C30 A;  3C2G A;  2DYS H;  3SFZ A;  1SAX A;  3RZD J;  1IF1 A;  1T39 A;  5EYR A;  4YFN F;  4FX0 A;  5HS7 A;  4MGR A;  3HJE A;  2R7Z J;  4L9J A;  2V4J C;  3BCA A;  4CH7 A;  3NWS A;  4CXF A;  3HGG A;  4GXO A;  5LGN A;  4X0G A;  3LNQ A;  3RI4 A;  3AG3 H;  1LVK A;  1VQ4 I;  1O3Q A;  2W48 A;  3BG6 A;  1VI0 A;  2QBY B;  1H0M A;  4QPO A;  2PI0 A;  4C9Y A;  2CWE A;  1F43 A;  1T98 A;  3COA C;  5IT9 Z;  4DOZ A;  3IWZ A;  2FBI A;  3IL2 A;  3OR1 C;  1Z21 A;  1HBX G;  5EF6 A;  4M3E A;  1W0T A;  2IPQ X;  1JKO C;  4KYW A;  3QOP A;  3Q5F A;  1QRY A;  4ANJ A;  2IEK A;  1HST A;  1JUM A;  3LOC A;  3SDG A;  1OKR A;  2X0L A;  5DTD A;  5FFZ A;  1LFB A;  1MIJ A;  1EH7 A;  3H5R A;  4H4K C;  2NVY J;  1XTA A;  2V79 A;  5ICC A;  1KU7 A;  3PO2 J;  3ESW B;  2LKX A;  2OQG A;  2JA5 J;  2QWW A;  3I0T A;  4KN4 X;  5HLH A;  3EUA A;  1D5Y A;  1MZB A;  2JRM A;  4CGZ A;  3K0L A;  2BXZ A;  2R7F A;  5LHH A;  1X1C A;  1P2F A;  3PSF A;  4XSX F;  2FU4 A;  3ZCO A;  1VQN I;  1G59 A;  4CA0 A;  5L3F A;  3H92 A;  4O5V A;  2A68 F;  3VYS B;  5HOD A;  3DCF A;  4JX6 A;  4M6Y A;  4XLC A;  3I56 I;  1YE9 A;  4BEH B;  1GXQ A;  3A01 A;  1BW6 A;  2HQ5 A;  4EJT A;  1ZG3 A;  2KQR A;  2IS1 A;  2VIX A;  1T56 A;  3C3W A;  2AXL A;  2NVT J;  3EUH A;  4UV8 A;  2PLY A;  4O3M A;  1ZLJ A;  1I6X A;  2IA1 A;  2A5Y B;  2E5Z A;  4A12 A;  3OS0 A;  1P7I A;  1HKT A;  3F8N A;  3W2V A;  3SFI A;  5K1Y A;  2DCE A;  1IG7 A;  2DMP A;  3I64 A;  3P9I A;  4P96 A;  4I02 A;  4PUS A;  4YFK F;  1LE8 A;  3FZV A;  2JA7 J;  1OFC X;  2K3F A;  3A0H C;  3FIW A;  1Z3Y A;  3K4M A;  4OAZ A;  1IN7 A;  1BA5 A;  3FXL A;  1H8A C;  4EJV A;  3BC8 A;  3GWZ A;  2KT0 A;  4A3B J;  2FF4 A;  4LMY A;  3O8H A;  1OIS A;  4I0B A;  4C3J J;  2VQH A;  4B47 A;  4LK0 F;  5GAH J;  4U7D A;  2VL8 A;  9ANT A;  5FKL A;  2IRF G;  4EM0 B;  2HVS A;  1U5T A;  4XR6 A;  1OPC A;  2IP2 A;  3C18 A;  4JP0 A;  2VBX A;  1BJZ A;  2R7O A;  4HF0 A;  1S29 A;  5KHD A;  5BPD A;  2BHY A;  2IGM A;  2CUJ A;  1UG0 A;  3H3U A;  1SAU A;  1FX7 A;  1K4S A;  3Q0U A;  2E1C A;  2L5Q A;  1JGG A;  4LOC A;  4B3X A;  1BI0 A;  2M2E A;  1QQI A;  1ETQ A;  1DPU A;  3S2W A;  1J75 A;  2HGC A;  1G4D A;  3W3C A;  1LFU P;  4A0Y A;  3FWE A;  4CZC A;  2E71 A;  1KGS A;  4MO7 A;  2HOE A;  2WTE A;  4RLQ A;  1PYV A;  2WA0 A;  3HPG A;  2DXI A;  1TW2 A;  4KJZ A;  1PDN C;  4HDV A;  4P9F A;  2P5L C;  4G6D A;  2BVM A;  1IAW A;  1E2X A;  1TWC J;  2NS0 A;  2F4M B;  2VJJ A;  5F1R A;  3CUQ A;  2E2J J;  1B4A A;  1VQL I;  5AON A;  2CW7 A;  1A04 A;  5K7H A;  1WJA A;  4D0P A;  4HW0 A;  1UCR A;  4IHY A;  1BJA A;  2MC4 A;  3SZG A;  2DW4 A;  1D0X A;  2K4J A;  3I59 A;  3OYN A;  3GZ6 A;  1RES A;  2FMY A;  1TLH B;  5F0H A;  3GLX A;  4N4N B;  1U9N A;  3OOP A;  4II3 A;  2HQN A;  3VSL A;  2AHQ A;  3KP6 A;  5GAG J;  3M3Y J;  2MLK A;  2H8R A;  2IS2 A;  4FT8 A;  4I09 A;  5A2Q Z;  1WRJ A;  1IN8 A;  1D1A A;  2EFP A;  4IKF A;  5GP9 A;  2OZU A;  3HOX J;  2K5C A;  1DDN A;  4G7O F;  5H6R A;  1K79 A;  3QPL A;  5FLV A;  2Y2Z A;  3PSI A;  4KT6 A;  4DZJ A;  2AS5 F;  2W82 A;  4Y17 A;  1YRN B;  2IW5 A;  5JHU A;  1WHU A;  4QIW N;  3ULQ B;  3GW2 A;  4BHB A;  3KEO A;  2FOK A;  4PFO A;  2O6G E;  2VBZ A;  1HW5 A;  1W7P B;  2EIM H;  4M6X A;  1GVJ A;  3BLY A;  1H9G A;  5LFA A;  4L0Z B;  1HSJ A;  2I10 A;  1DU0 A;  1X4O A;  2RGV A;  2BGC A;  5EJC A;  3GUD A;  1F9N A;  2HOS A;  2HOT A;  4OIP F;  1KQ0 A;  2KP6 A;  2YX7 A;  1B6A A;  2D1V A;  3D5S C;  4P5O A;  3T8R A;  4U0W A;  2V1N A;  3RYR A;  4ESB A;  3RKX A;  3DF8 A;  5IYC J;  4BNC A;  5F04 A;  5D5X B;  2F5D A;  1IXS B;  3OYE A;  4FX4 A;  2IA0 A;  3QYB A;  2ZXJ A;  1MDM A;  4M72 A;  3JRB A;  2FQ4 A;  3T0Y A;  3IAS 2;  4Q4Z F;  4V2F A;  2VOD A;  2IGK A;  4ZH4 F;  3TOA A;  5KAI C;  2ZXI A;  1ODD A;  2HKX A;  4PJM A;  4BH9 A;  1EH8 A;  3DTK A;  3ZMV A;  1QZY A;  1W5C C;  1N75 A;  3K1M A;  5C44 J;  3JAM Z;  4IHS A;  1E3P A;  3MMY B;  4DNC A;  3FM5 A;  2Q0O A;  4B44 A;  3BR2 A;  5M5X J;  5F1J A;  1D0Z A;  1IN4 A;  3GTO J;  4WXH A;  2ZJ2 A;  3OIP A;  3LSP A;  1AKH A;  1O7L A;  3KE2 A;  1TTY A;  2FBH A;  2XGD A;  3HSF A;  1MW7 A;  3ZQF A;  1Z67 A;  2DO7 A;  2VE9 A;  1KU2 A;  4RM2 A;  1GT0 C;  4KT5 C;  3MZH A;  3F8M A;  2K40 A;  3FMR A;  1RUN A;  4KDP A;  2W24 A;  3PNY A;  1FBS A;  1RPW A;  1MND A;  1LJ9 A;  3CES A;  1ZYR F;  2GQQ A;  2CYY A;  2FEZ A;  3HUG A;  5CPR B;  1K78 B;  3S15 J;  4PGH A;  4E7H A;  3ECH A;  2XVC A;  3BR3 A;  1SFK A;  2P5K A;  3A02 A;  4HX7 A;  3WG7 H;  2H1L A;  4RGU A;  1VQK I;  3ZXS A;  1T2K A;  2DMN A;  3ZGK A;  1VQ7 I;  1BOA A;  2CGP A;  3D0S A;  3R0A A;  3V42 A;  2LG4 A;  1ZR2 A;  1H9T A;  3TL4 X;  1S8N A;  1BN5 A;  2EIN H;  2LR8 A;  5CLS A;  3OYA A;  5ILU A;  2EIJ H;  3HDD A;  3TMO A;  1XSX A;  2PEX A;  4AWX B;  2V6C A;  4BDY A;  2M45 A;  1Y1V J;  2QKM B;  5D5W B;  4GGG A;  5H20 A;  2BW3 B;  1ETV A;  3WTS C;  5FGM A;  1BW5 A;  3K4C A;  4M6V A;  3S16 J;  3KEY A;  3FF5 A;  2MD5 A;  3IP4 B;  4F92 B;  1FYM A;  3DXJ F;  2MC3 A;  1POG A;  3W6K B;  4AVZ A;  3EUK L;  1ZAR A;  1IZ1 A;  1QU3 A;  2ZNZ A;  3FBN B;  3FHZ A;  1RIO H;  4A3C J;  1XCB A;  2QYO A;  1YS7 A;  3T8T A;  2YU3 A;  4IHT A;  4I99 C;  4RB3 C;  1T0F A;  2MSY A;  1TBX A;  4PZJ A;  2W7N A;  2L0K A;  2XAJ A;  4NB5 A;  4G6Q A;  2MG4 A;  5J6X A;  1FLI A;  5H6Q A;  1C0W A;  3RPU D;  2XHK A;  3P9K A;  1ZRD A;  3QAH A;  4PSX A;  1FNN A;  5EZH A;  2JWT A;  5J1R A;  1OR7 A;  3G73 A;  2BEO A;  3F21 A;  3F0C A;  3WG9 A;  4PDK A;  1D3Y A;  2LMD A;  1FWZ A;  2QZ8 A;  2YX4 A;  2LK2 A;  2LF8 A;  1OCT C;  4E7J A;  1A5J A;  4EVI A;  5L3E A;  4B43 A;  4HNV A;  2JTV A;  3R4K A;  4MFE A;  5KCM A;  2XRN A;  3RSN A;  4PFP A;  3VYU B;  1PUF A;  3JSP A;  3L2U A;  3Q0W A;  4KUM A;  5E3L A;  5K5O A;  2KJB A;  3JTH A;  3HC7 A;  5IP6 A;  1X58 A;  2GM4 A;  2R7U A;  3CC2 I;  4XLN F;  3HEF A;  4R8H A;  2CV1 A;  3H1C A;  5DEQ A;  4DJA A;  3M8F A;  4ZTF A;  2V6E A;  1Y8R B;  2XKO A;  3SYT A;  3Q9S A;  4HST A;  4MQ9 F;  3S8P A;  5D8K B;  4WWC A;  4IZZ A;  1CQT A;  2XAH A;  3IC7 A;  3HB9 A;  1I5Z A;  4F55 A;  2JZY A;  1LEA A;  3J80 K;  1DUX C;  3TO6 A;  4DYR A;  5J1Y A;  2FJ1 A;  3LFK A;  4X6A J;  1K4T A;  1VQ6 I;  1A31 A;  2P6T A;  3LWF A;  1IV8 A;  1LUJ B;  1TZL A;  3H9Q A;  5IOY A;  3U2R A;  2HVR A;  2LBF A;  1E17 A;  5E18 F;  3I4N J;  2WAF A;  5LHI A;  2JA6 J;  5JFR A;  4A0Z A;  4ZYD A;  2L7Z A;  3AG4 H;  2QSF X;  3L7W A;  3JRG A;  3QYE A;  4ZZL A;  4M3B A;  3X2Q H;  3TO9 A;  5M5W J;  3VWB A;  3HHH A;  1WI3 A;  2DOA A;  5ILV A;  4RDU A;  1HA8 A;  4IL6 C;  4A0X A;  3TP0 A;  4MFD A;  1W4M A;  1FMV A;  3CJR B;  2NS7 A;  4Y3O A;  3SJM A;  1N25 A;  1P92 A;  2ZNY A;  3FXJ A;  1FEX A;  4YFX F;  1EF4 A;  1VQO I;  2CJJ A;  2B63 J;  1A6Q A;  3FDY A;  2O8K A;  3FMQ A;  3I53 A;  3I55 I;  5JVT A;  1X2N A;  2R7R A;  4FET A;  3EYY A;  3CO6 C;  5E3O A;  5FKM A;  3IUO A;  3W2W A;  5EEA A;  4LD5 A;  1ONV A;  3CZ6 A;  2DA6 A;  2XGE A;  2DDA A;  5F6F A;  3S1N J;  5E1Z B;  3CMM A;  5D4S A;  2DFE A;  5IT9 K;  2DK8 A;  2LRD A;  1DQU A;  3MFK A;  3RQ4 A;  2Q8K A;  4YIF A;  2F4I A;  3DEW A;  5HOO A;  5F0F A;  2R5Z B;  4ENM A;  3F6V A;  1F1Z A;  3CLQ A;  3FIS A;  4UHT A;  3BZC A;  1HKQ A;  1LNW A;  2GA1 A;  3GXO A;  1XG1 A;  5FKO A;  2E7X A;  2PBI A;  1Y1W J;  3BG5 A;  1ETX A;  5J8C A;  4WCG A;  2W25 A;  2JRT A;  2R7T A;  3DFG A;  1FOK A;  1KYW A;  2CW8 A;  3CO7 C;  3CMA I;  1QVT A;  2ZFW A;  1GV2 A;  5DDG A;  4IXA A;  2ESH A;  4A5N A;  2HEO A;  3QP5 A;  1XB4 A;  1WPK A;  2MH9 A;  2HDD A;  1Z05 A;  2OTL I;  2XKP A;  2EZK A;  2A6E F;  2NXN B;  3HL2 A;  4E7K A;  1TL8 A;  2L4M A;  1W7P D;  2EPF A;  3K1N A;  5J3L A;  2R7D A;  4MLO A;  1XMX A;  4YG2 F;  2XPU A;  3EDP A;  5HLG A;  4LJZ F;  1SC7 A;  3GCM A;  1K7A A;  2JJ7 A;  4RM3 A;  2DN0 A;  5F27 A;  1MJ9 A;  4I76 A;  2RV8 A;  5DM7 F;  2KPM A;  3KIO A;  1FSE A;  5KVR A;  3OYD A;  3JRE A;  4QWQ A;  3GTJ J;  1ETK A;  1ZQ3 P;  2GOX B;  2DPU A;  2JA8 J;  2ELJ A;  3EUH C;  1FP1 D;  3LA3 A;  3TP3 A;  1YO5 C;  2XF7 A;  2KIS A;  4IOA F;  3BG7 A;  3ZMT A;  3REO A;  4MTD A;  1T33 A;  3MZY A;  3UNG C;  2X6Y A;  3IKT A;  3BZ6 A;  1RR8 C;  1S6L A;  1PUE E;  2LNB A;  4ABZ A;  3DWL E;  4LGW A;  1B8I B;  1OCO H;  2FML A;  2QQA A;  2O3F A;  2GLO A;  1YW8 A;  3E5X A;  5E1X A;  3WGH A;  2ICW G;  4BL0 B;  5D6E A;  2CQN A;  5IP7 J;  3PFI A;  5ERI A;  5B1A H;  2EH3 A;  2KHM A;  4CYC A;  2KL4 A;  1V5E A;  3G3Z A;  5EG0 A;  2XF5 A;  1HQC A;  1KA8 A;  1U5T C;  3JRC A;  4B3A A;  3HSE A;  4M71 A;  1MKM A;  1JJ6 C;  2X48 A;  1APL C;  2H6C A;  2ZME A;  2Q2E B;  4HV6 A;  4HV5 A;  2CV2 A;  1GXP A;  3FKI J;  1TWH J;  5FKN A;  4MNU A;  1LEB A;  3QPH A;  1WZ2 A;  1IRG A;  3ABM H;  3BCB A;  4OOI A;  4IHX A;  2M0M A;  3HM5 A;  1TW3 A;  2R0Q C;  3G1O A;  2CG4 A;  2E1M B;  3DTI A;  1YJ9 I;  3FXK A;  4GYI A;  4DBQ A;  4CCO A;  4AYB A;  1ZN2 A;  1LVA A;  2JA2 A;  1VF9 A;  3RJP A;  5DCM B;  1XGS A;  2FRH A;  3F8F A;  5C3E J;  2XPV A;  2IS4 A;  3KEQ A;  1CGP A;  4XLA A;  4EAT A;  1QPM A;  1MD0 A;  2VPR A;  2RQP A;  1YHQ I;  3ELK A;  4PJN A;  3K4N A;  4GFB A;  4YIR X;  3R60 A;  5LRS A;  1UAA A;  2KDZ A;  3CUQ C;  3N05 A;  1OYY A;  2HWV A;  2JVG A;  3QOE A;  2RNJ A;  2OQR A;  2KRF A;  3R0J A;  3K70 D;  4CCL A;  2QKL B;  4XNF A;  2OCE A;  2M4K A;  3ABK H;  5A2Q K;  3FHN A;  2ZXH A;  2HOA A;  4JOM A;  4AYB N;  1XDS A;  4LK1 F;  1RET A;  5FRO A;  1B72 B;  1WWX A;  1LPQ A;  4CCN A;  1U8R A;  4NQW B;  1ZGA A;  2ELH A;  4ZJZ A;  2WY7 Q;  2X6O A;  3BJA A;  5DYM A;  3C2H A;  3SZT A;  1GHC A;  1JUP A;  2K7L A;  3RKY A;  3HRT A;  1G3S A;  4GCV A;  1XC5 A;  2M8G X;  3CDL A;  1ZAO A;  3BWG A;  1CF7 B;  3B6A A;  1HCR A;  3WHC A;  4XRF A;  1R5I D;  4P9U A;  4RGS A;  4LLL A;  1AOY A;  1WFX A;  1ZEL A;  2VJI A;  4IJA A;  1PJR A;  2LRE A;  3FXO A;  3ZQI A;  1D0Y A;  2ZO4 A;  5CQG A;  4A6E A;  2EFQ A;  1ETY A;  4G6T B;  1FSH A;  2DTR A;  2VI6 A;  2VAS A;  2CO5 A;  2PQ8 A;  4XKC A;  1I27 A;  3TW7 A;  2GXB A;  4LFU A;  2GWR A;  2R93 J;  4XLF A;  4JX4 A;  2K3P A;  3BJ6 A;  1SVO A;  5HDG A;  3TQN A;  5M3F J;  1SFO J;  1MMS A;  1R49 A;  2HNH A;  2BBY A;  3K7A J;  2KIF A;  3NRV A;  3QU6 A;  3OIO A;  3BP8 A;  3V7C A;  3SDB A;  2B9S A;  3OS2 A;  1XPX A;  1ZG5 A;  2L9S A;  1AHD P;  1X1D A;  4RB2 C;  1J0R A;  4AVP A;  1OLT A;  4DW6 A;  4EM1 A;  3LSR A;  3PJR A;  3JAM K;  5B66 C;  2V1X A;  1WCM J;  2PX9 A;  4HA8 A;  1KQ9 A;  2Y0M A;  1HXD A;  2F5E A;  2R5Y B;  3MKY B;  4L5I A;  2BE5 F;  1IDZ A;  3LQR A;  2P4W A;  3HOW J;  2DA1 A;  2QQ9 A;  4I7H A;  2R7X A;  2Q1Z B;  4NC7 A;  2GBY A;  4XM3 A;  1I1S A;  2W85 A;  2EV5 A;  2CS3 A;  3PIO F;  3JTG A;  3WHB A;  1QVU A;  3JSO A;  1KU3 A;  4M9X A;  2M9H A;  1QA6 A;  4KMF A;  4N9H A;  2IXS A;  2YU9 J;  1UHM A;  2L2O A;  1Y56 A;  4Y4R A;  1ZTR A;  1XMA A;  1A6I A;  4BBR J;  3OYB A;  4U0V A;  1IV6 A;  1JJ8 C;  3UR3 C;  4HZF A;  3O6B B;  3QPT A;  5K7Z A;  1O4X A;  4U88 A;  4YII A;  1VQM I;  2P0W A;  3T1B A;  3A03 A;  3IV5 A;  3PQJ A;  1FBU A;  1MBF A;  1D1B A;  3B6C A;  1FJL A;  2VE8 A;  3S3M A;  3F9K A;  4M9S A;  2OA4 A;  1JTY A;  4IQJ A;  2LSO A;  3ZQ7 A;  1YOV B;  1K6O A;  2FE3 A;  2O0Y A;  2QSG X;  4BXU A;  3CF5 F;  5LGT A;  5TJJ A;  2CQX A;  4E7I A;  1R9T J;  2Y31 A;  1QZE A;  2YPR A;  5KNL A;  1V4R A;  2A61 A;  2OPT A;  1FYK A;  1NK3 P;  2LKP A;  2Y9Y A;  3HTS B;  1QNT A;  1Y8Q B;  1ZRF A;  1USS A;  1XX5 A;  2BY2 A;  2CQQ A;  2N8G A;  2HZT A;  3O3K A;  1UHW A;  3MVP A;  3PUF A;  3K4L A;  4LIT A;  1MSE C;  1JKP C;  3RIR A;  2XV4 S;  1OCC H;  2K9Q A;  5DUI A;  3E0J B;  4XL9 A;  2ZC2 A;  4OMZ A;  3KLN A;  4BHP A;  5ICG A;  4IQ4 A;  2Y0S A;  2D1H A;  2XAS A;  2PG4 A;  1T0F C;  2CUZ A;  2ID3 A;  2R7Q A;  2HDW A;  3PL8 A;  5TIS C;  1BOB A;  3BDD A;  1JTX A;  3KZI C;  1Y0U A;  3L2R A;  1FOW A;  4WF2 A;  5J40 A;  3OYF A;  1SD5 A;  4A3M J;  3CC4 I;  4B09 A;  3J7A Y;  2EIK H;  5E79 C;  1KQ8 A;  1EA3 A;  1NHA A;  4ESJ A;  4A5M A;  2RRE A;  5EGO B;  3HOZ J;  4IRH A;  2NVU B;  2EJR A;  4R79 A;  1OR7 C;  1RRJ A;  3W6V A;  4S0H B;  2J5O A;  5DD8 A;  2ETH A;  3E6B A;  1D8K A;  2Y0S N;  3H5N A;  3S3O A;  1IXR C;  3D5R C;  4G94 A;  1SVL A;  3DEU A;  4XMY A;  1ZH5 A;  2LY2 A;  4IOC F;  2F2E A;  3ZMU A;  3GME A;  4XSZ F;  2VOP A;  4BXF A;  2I8D A;  4OIR F;  1Q1H A;  1MBH A;  2DA5 A;  4N0B A;  4B1R A;  2OTJ I;  2YUS A;  5J4Y A;  4XLP F;  6PAX A;  2LY9 A;  4MIM A;  1TWA J;  2G9W A;  2R7W A;  3OYC A;  2HS5 A;  2LP0 A;  1B59 A;  1U9O A;  5L3D A;  5HS9 A;  1B1B A;  5FFX A;  2O61 A;  3SEZ A;  3ERE D;  3E5Q A;  3CTA A;  4V2G A;  4XRM A;  5B5E C;  2LVS A;  2VC1 A;  3ZQQ A;  4JYK A;  2MH2 A;  3J81 Z;  2VJ4 A;  2CH0 A;  2L9R A;  4W1U A;  2IA2 A;  2E1M C;  3OWT A;  5EEG A;  1S5L C;  3QU3 A;  4CCM A;  2DOE A;  3SZP A;  5LBQ A;  2MFZ A;  3NQO A;  4G7H F;  2Y30 A;  1N77 A;  1TWF J;  4FE4 A;  4LIU A;  3DQV C;  4QTR A;  4BAC A;  2O7O A;  3PO3 J;  4HNT A;  2E1O A;  3L2Q A;  3TGN A;  3KFW X;  5HVQ C;  4CSW A;  1ZLK A;  1FY7 A;  1J9I A;  3FKJ A;  4CZZ A;  3CQZ J;  3MD2 A;  2LY1 A;  4UVC A;  1I6H J;  2M0C A;  2ACJ A;  2YR2 A;  3DU5 A;  1S9H A;  3IRR A;  1YLF A;  2K9M A;  4RAG A;  2K86 A;  4UB8 C;  3DKX A;  3RYP A;  1P4A A;  2PN6 A;  4BDZ A;  2MA3 A;  3I5U A;  3WTY C;  2OCC H;  1J5Y A;  3BPX A;  2EB7 A;  3GLL A;  4BJ5 C;  2H8W A;  3NWT A;  4JQF A;  2RAE A;  3GTL J;  4ZC3 A;  3E7L A;  4MEY F;  1TP4 A;  4XRS G;  2KIQ A;  2VJ5 A;  1VQ5 I;  1IRF A;  3BR1 A;  2KIU A;  3H36 A;  1I3A A;  2V9V A;  3J7Y J;  5E17 F;  4XQF A;  3A01 B;  5DCF A;  2IBD A;  2XB0 X;  5JR3 A;  4A3I J;  2M1B A;  1ETW A;  1JE8 A;  4KFC A;  2BYV E;  3M4O J;  2VQG A;  4A2U A;  2XSJ C;  1TC3 C;  2ZB9 A;  2ZBK A;  4KIG A;  4XN0 A;  2NYX A;  3WU0 A;  2XAU A;  3CJN A;  3CCE I;  4RGR A;  4D9J A;  4A3L J;  4HDU A;  3FXM A;  3CCS I;  1XMK A;  1QHG A;  4NC8 A;  2HVQ A;  1E3O C;  5E8I A;  2NNN A;  1LE8 B;  4HQM A;  1X3Z B;  3ZP5 A;  2AXT C;  2V9K A;  4XOT A;  2XAF A;  1MH4 A;  1TQP A;  3HGY A;  5CVU A;  2OUM A;  2IVM A;  4LLN A;  2OD5 A;  1HW1 A;  3JCU C;  1ZRC A;  1OCR H;  2FOW A;  2CFX A;  1J7K A;  4XON A;  2KIM A;  3DP7 A;  2NRA C;  3H3V K;  1BC7 C;  1U5T B;  1OYI A;  3VB2 A;  1Z1D A;  2MGQ A;  1OMI A;  3JRF A;  1HF0 A;  2VXZ A;  5EZG A;  1Z3X A;  2VBY A;  3M9A A;  2WWY A;  3VSK A;  3ONQ A;  5BS6 A;  5KAF C;  4Y52 J;  3MN2 A;  3VEP A;  2DMT A;  1PVE A;  2E60 A;  2VBW A;  2GA2 A;  1D8J A;  4C2U A;  1YG2 A;  2IT0 A;  4A93 J;  2VPL A;  2O5R A;  4ZDP A;  2COB A;  1IJW C;  2Z2S B;  5KK1 A;  2WBM A;  1UJ8 A;  3QRF F;  5D6F A;  2HR3 A;  1WH7 A;  3BT9 A;  3JW4 A;  1Z77 A;  2K9S A;  2R7V A;  4XLH A;  3VOD A;  5DV5 A;  3S32 A;  3SHF A;  4ENN A;  2JMW A;  3F22 A;  2JUC A;  3CJQ B;  4K2E A;  1D1C A;  4AC0 A;  4DYC A;  5JI6 A;  3WGI A;  3O2P E;  4RMN A;  4GRI A;  3RDI A;  3BZK A;  3QOD A;  1YI2 I;  3MQ0 A;  1HW2 A;  4UVA A;  5C4J J;  3RPQ A;  3H35 A;  4XN3 A;  1SD6 A;  4A3J J;  5HS8 A;  4CO8 A;  2KZG A;  3IKV A;  1QZZ A;  3CUQ B;  3IHU A;  1G3Y A;  2NVX J;  1R1U A;  2EA4 A;  4OIN F;  3W2A A;  2VKE A;  3I59 B;  1NG7 A;  1W5S A;  1WKM A;  4FCY A;  3B02 A;  3BQY A;  3U21 A;  2E7W A;  4RGX A;  2CUF A;  2R7S A;  2Y9Z A;  2BY1 A;  2H09 A;  4C3H J;  3A1Y A;  2ECC A;  4DGW B;  3LFU A;  2YSR A;  1H88 C;  3LA2 A;  4KIS A;  1G3W A;  3CC7 I;  2QF7 A;  1UMQ A;  1UB9 A;  3OL4 A;  3BTI A;  4MQV A;  5H2F C;  4UUS A;  1LB2 A;  4BY1 J;  3HOY J;  5FRN A;  2DJN A;  4BS9 A;  2TDX A;  2ZME C;  3M1C A;  1PP7 U;  4RB1 A;  5FD6 A;  1IXC A;  1YIO A;  3WTZ A;  3MKZ A;  3BJO A;  1X1A A;  5AIQ A;  3GTM J;  1V3F A;  2J5P A;  4KIT B;  4JK1 X;  3WTX C;  5DD4 A;  3G4S I;  1Y39 A;  1KU9 A;  1WJC A;  4ESF A;  3KLO A;  4ZYA A;  4BAY A;  1IUY A;  3HOS A;  1IGN A;  2KLO A;  1DGR M;  5K5R A;  2Z16 A;  1HDD C;  5FLX K;  4FTH A;  3G6E I;  5GTI C;  1X1P A;  2M30 A;  4XLE A;  4LG0 A;  3TW6 A;  4ASN A;  2DI3 A;  4FHT A;  2FA5 A;  3EET A;  3DPL C;  4Q47 A;  4CYD A;  3U9G A;  5JHF A;  1WQ2 A;  2QM3 A;  3PNV A;  2QLZ A;  4KIC A;  5J8F A;  1QPI A;  4PJL A;  2K27 A;  5FB2 A;  5CVJ A;  4ITV A;  1MDM B;  3Q3S A;  1MMD A;  2GXA A;  4UXN A;  3KYL A;  4BQN A;  1S72 I;  1GUU A;  3ABT A;  4YRV A;  1K6Y A;  2X9D A;  4AIK A;  3CCJ I;  2E34 A;  2QUF A;  1A36 A;  5EDN A;  5DS9 A;  3VFZ A;  3L2V A;  3BOQ A;  3SQN A;  2PJR A;  2G7U A;  4EM2 A;  2YS9 A;  2TCT A;  1K83 J;  4CUG A;  3C7J A;  1AKH B;  5LGU A;  1T08 B;  5IYB J;  3WE2 A;  1BR4 A;  1HLV A;  3WTT C;  4P1W A;  2QCO A;  1LDJ A;  4RS8 A;  1XGM A;  3I58 A;  2E19 A;  3CP2 A;  3QP6 A;  2JSP A;  1XGN A;  3HUG B;  3ZQC A;  3TBI A;  4WK8 F;  3GO5 A;  2BVL A;  2HXI A;  4X1E A;  3K10 A;  2ZXW H;  3BQZ A;  2XRO A;  2VKD A;  1SFE A;  3OOU A;  5BMZ A;  4BJ6 C;  2NNY A;  3CCL I;  4HX8 A;  1D5V A;  3UKG A;  1ETO A;  4A3F J;  1R7J A;  2CQ7 A;  3HSR A;  4OIO F;  1BC8 C;  5F0C A;  1Z7U A;  2DA2 A;  3MZ8 A;  2W1O A;  3K6G A;  1Z91 A;  2G7H A;  4A3K J;  5IY5 H;  1W36 C;  4PSW A;  1OCP A;  2DOF A;  2QBY A;  3GZ5 A;  3S1M J;  3BR6 A;  4UVB A;  3GX4 X;  1UFM A;  3RKW A;  1RKW A;  2MYS A;  1Y0N A;  3MWM A;  4IEJ A;  5CVI A;  3RPU A;  3QPS A;  1O3T A;  1JXS A;  1S3J A;  2NAZ A;  4BUP A;  3G71 I;  1U8B A;  3GBG A;  2OU2 A;  4PJJ A;  1SEU A;  2AO9 A;  2RN7 A;  5BQT A;  2FNA A;  3CD6 I;  1QBJ A;  2M5W A;  2DT7 B;  3BTJ A;  1OJL A;  3KP5 A;  1X19 A;  1W36 D;  1UST A;  3ZMD A;  1N78 A;  3E6M A;  4AID A;  1O7F A;  1YYV A;  4BXX J;  5DM6 F;  4QLC U;  3K69 A;  3CJT B;  3OYJ A;  4XKV A;  3E6C C;  4G9Y A;  4E7Z A;  4CHU A;  2MLG A;  3HYI A;  1V5F A;  4KNY A;  1RNL A;  3ZPL A;  2CUE A;  3O8G A;  2HYG D;  2DA3 A;  1MMN A;  4KIF A;  1PUF B;  4EGZ A;  4BEH A;  4HF1 A;  1ZKG A;  1NG6 A;  2K85 A;  4ETS A;  4A6D A;  2C6Y A;  3OL3 A;  5BPI A;  4G12 A;  3HXL A;  2CU7 A;  1V5G A;  3GVA A;  3ZN1 A;  4FAS D;  4L5E A;  3PIP F;  2DJI A;  2EA2 A;  2G0E A;  3F8C A;  5HLI A;  4M3F A;  1WJF A;  1WSU A;  5TRD A;  2VB6 A;  4BGD A;  1MBG A;  1R6R A;  3LSM A;  4NNJ A;  2RNG A;  3WU2 C;  1R5G A;  3PFY A;  3N4M A;  1WJ5 A;  2V1U A;  3TDZ C;  2BY3 A;  2ELK A;  1TQI A;  1VFC A;  5FJ8 J;  2RDP A;  1ZRE A;  3BG3 A;  3DLA A;  3FXR A;  2LBF B;  3HG9 A;  3S1R J;  1VQP I;  3ABU A;  2X1D A;  3H9J A;  3H3Z A;  1R58 A;  2NS8 A;  3VOE A;  3M8E A;  1RKT A;  4IVN A;  2M87 A;  4M74 A;  1UZC A;  4KA4 A;  1I39 A;  3QWL A;  2LYC A;  4KMU X;  4HYE A;  2WV0 A;  2E1N A;  3IH3 A;  5CJ9 A;  5AIP A;  3TED A;  3AG1 H;  4RB0 A;  1O3R A;  3EYI A;  3ZQH A;  5JLX A;  3KET A;  3K1P A;  2F5V A;  4YEL A;  1TNS A;  4OU0 A;  3L00 A;  4HEA 2;  4CDG A;  2PJR B;  2DA7 A;  4HX4 A;  2FX0 A;  3CLO A;  1ON1 A;  5IOZ A;  3J80 Z;  3WGG A;  2Z99 A;  1U2W A;  3OYH A;  5CKT A;  2EZL A;  2HZD A;  3P7N A;  3VDX A;  4HLX A;  2O03 A;  4KIB A;  1F4K A;  4JBA A;  2MW8 A;  3OSG A;  2ME0 A;  2VQL A;  1OQY A;  1XDU A;  3NAR A;  2JQ7 A;  4RAY A;  3HHG A;  1SAN A;  1ON2 A;  2EZH A;  2ZSI B;  3FK6 A;  2XAQ A;  4DIQ A;  4L9V A;  3ML6 A;  1FTZ A;  3J81 K;  4F91 B;  1VZ0 A;  5GAD J;  1WGX A;  2GXG A;  5LEK A;  2X51 A;  4IRG A;  1SFX A;  2L02 A;  1OYW A;  1IUF A;  3OV8 A;  2PFB A;  5K7F A;  3QYF A;  4RAZ A;  1JT6 A;  5D8L B;  3OS1 A;  2W4S A;  4HNU A;  2COM A;  3ZQL A;  2DTZ A;  3GFM A;  4GO1 A;  3E5U A;  3CCV I;  3PNT A;  3KYC B;  2F6C A;  1ZGJ A;  4ON0 A;  1TT5 B;  3JRI A;  1XGO A;  1G3T A;  3K2Z A;  1XSV A;  1YRN A;  2LF7 A;  4OIQ F;  5ILS A;  5F64 A;  5FD5 A;  1G6N A;  3ZR8 X;  4PK4 A;  3DU6 A;  3G2B A;  1W7P A;  1X2M A;  2DPD A;  1LDD A;  1P6R A;  4L5J A;  3T5X A;  3A4C A;  3RQI A;  2D5V A;  2QSH X;  2LC2 A;  2CFO A;  2DLL A;  5EEH A;  1Z6R A;  4Y13 A;  3TOB A;  1QGP A;  3CDH A;  3ZN0 A;  2LFB A;  3LMM A;  4EJW A;  3I4M J;  4BY7 J;  2UWM A;  2ESN A;  2X6W A;  3QQA A;  2ZJR F;  2KZV A;  2HKO A;  3FMS A;  1GVD A;  4II2 A;  2Z9O A;  4XOR A;  4EQQ A;  2R4G A;  4RLF A;  5HLT A;  2DFI A;  2D45 A;  1KON A;  4NC6 A;  1EKE A;  2Z33 A;  5GPC A;  1R4M B;  2CW0 F;  2EFO A;  4UUV A;  3I4P A;  4XRS A;  4I6Z A;  2E2I J;  2QVO A;  2L01 A;  4RBO A;  2DMQ A;  1VND A;  4LB5 A;  2EFN A;  4LB6 B;  1FZP B;  2EZI A;  3OY9 A;  3HOU J;  4HOB A;  4U0Y A;  4D1Q A;  1JHF A;  1FP2 A;  2DQR A;  1T8I A;  1P9Q C;  1BM9 A;  2JN6 A;  2Z5U A;  2FQ3 A;  2L3D A;  3OIQ A;  2KDO A;  1NTC A;  5FO5 A;  2XPW A;  1SFU A;  1AA7 A;  2FBK A;  1LDK B;  2VXD A;  2P6S A;  3V7R A;  2JPC A;  4OAY A;  4CYC B;  4AIJ A;  3PQK A;  2IS6 A;  1Z7L A;  2BHZ A;  3CME I;  5EG0 B;  1PP8 F;  3LL7 A;  2PMH A;  4YEJ A;  1X1B A;  3S14 J;  3D1N I;  3DBH B;  4F93 B;  2EK5 A;  1K78 A;  1F5T A;  2EBI A;  2XUB A;  2ZME B;  1DU6 A;  3IAM 2;  1BR2 A;  3AKZ A;  4BE0 A;  3OR2 C;  3ZOB A;  4F52 A;  2XB5 A;  3DPT A;  4BYY A;  4A3D J;  1FIP A;  3E6D A;  2L9N A;  4PGG A;  1QO0 D;  4IHV A;  1FC3 A;  3N97 A;  3LSH A;  1BR1 A;  3CCQ I;  3P9C A;  4FE7 A;  1G8X A;  1ZG1 A;  1Z9C A;  1YIT I;  4L9T A;  5GAE J;  2BW3 A;  2UUZ A;  3I71 A;  4HRI A;  3ERM A;  2IGN A;  3M1E A;  4XKW A;  2HYF A; 
#chains in the Genus database with same CATH homology
 3FBI B;  3CZ6 A;  2VXZ A;  3MKW B;  4ZTJ A;  3DTE A;  1Z3X A;  3VSK A;  2M4G A;  3CMM A;  3ONQ A;  2M3A A;  2LRD A;  1DQU A;  2HU9 A;  2LOO A;  3AFH A;  3RQ4 A;  2E60 A;  2AQE A;  4C2U A;  2W00 A;  2VPL A;  2F4I A;  2O5R A;  4ZDP A;  5HOO A;  2Z2S B;  2WBM A;  2WAQ A;  1ERD A;  2R7V A;  4XLH A;  3S32 A;  2V26 A;  2X6X A;  3CJQ B;  1D1C A;  4C30 A;  3C2G A;  2R7T A;  2CW8 A;  4RMN A;  4GRI A;  3QOD A;  3H35 A;  4XN3 A;  2V4J C;  3BCA A;  3HPH A;  3NWS A;  1MNE A;  4NUB A;  4CH7 A;  4X0G A;  1LVK A;  1LFP A;  3W2A A;  3HL2 A;  3BG6 A;  4E7K A;  1TT0 A;  4QPO A;  3CF2 A;  1NG7 A;  4BQO A;  4C9Y A;  3U21 A;  4MLO A;  4DOZ A;  2R7S A;  3OR1 C;  3A1Y A;  1Z21 A;  4DGW B;  3LFU A;  2JUG A;  3H0D A;  4RM3 A;  4KIS A;  3OL4 A;  4ANJ A;  3PUB A;  2KPM A;  3OYD A;  5FRN A;  1Y6I A;  4BS9 A;  2GOX B;  2WAE A;  2ELJ A;  3EUH C;  1WJB A;  3M1C A;  3H5R A;  4H4K C;  3MKZ A;  1X1A A;  4CCJ A;  2XF7 A;  4C2T A;  2RQQ A;  3S3N A;  3BG7 A;  4KIT B;  2ZFU A;  1WJC A;  3UNG C;  2X6Y A;  4ZYA A;  3HOS A;  3EUA A;  3DWL E;  2KLO A;  1DGR M;  3HKZ A;  2Z16 A;  1JI8 A;  1X1C A;  4LIV A;  3PSF A;  4BL0 B;  3L2W A;  4XLE A;  4HG2 A;  3ZCO A;  1G59 A;  4CA0 A;  4E7L A;  2KHM A;  3VYS B;  2AQF A;  3DPL C;  2KL4 A;  1V5E A;  2LH9 A;  4XLC A;  2XF5 A;  5JHF A;  3VYT B;  3PNV A;  1YE9 A;  4BEH B;  4PJL A;  2KQR A;  2IS1 A;  4ITV A;  2VIX A;  1MMD A;  2Q2E B;  2CV2 A;  3KYL A;  4BQN A;  2E5Z A;  3HOT A;  4YRV A;  3OS0 A;  1K6Y A;  3W2V A;  4BE1 A;  2BOL A;  2DCE A;  3BCB A;  2M0M A;  4PUS A;  2E1M B;  3DTI A;  3L2V A;  4OAZ A;  2VLA A;  1Z3Y A;  3K4M A;  2PJR A;  3E1S A;  3M8J A;  4DBQ A;  2UV1 A;  2JVH A;  3BC8 A;  4CCO A;  1UEL B;  4AYB A;  4CUG A;  2JA2 A;  2WAD A;  2VQH A;  4B47 A;  3K4J A;  2VL8 A;  2IS4 A;  2HVS A;  4XLA A;  4XR6 A;  3EPZ A;  4AU7 A;  4EAT A;  4F3Q A;  1BR4 A;  2R7O A;  4PJN A;  4P1W A;  3K4N A;  1UAA A;  5KHD A;  3DEE A;  3N05 A;  1U0J A;  2IGM A;  2JVG A;  2CUJ A;  1UG0 A;  3QOE A;  3CP2 A;  1SAU A;  2JSP A;  3K70 D;  3HUG B;  4CCL A;  2L5Q A;  2QKL B;  4XNF A;  3TBI A;  4E7S A;  2M4K A;  4B3X A;  3FHN A;  2ZXH A;  2BVL A;  4JOM A;  4QPQ A;  4E6K G;  3AL0 B;  5FRO A;  2CMP A;  3K10 A;  2VKD A;  3OOU A;  4CCN A;  2NOJ B;  3W3C A;  4BJ6 C;  4NQW B;  4ZJZ A;  2WY7 Q;  4CZC A;  3C2H A;  4J00 A;  3OYL A;  4RLQ A;  1PYV A;  2WA0 A;  3HPG A;  2DXI A;  4BJT A;  4KJZ A;  3LSK A;  2HPM A;  2W1O A;  1MMA A;  3K6G A;  3RTR A;  2BVM A;  3RCO A;  4DBR A;  2VJJ A;  1WFX A;  5LD2 C;  1W36 C;  1ZEL A;  2VJI A;  2E5N A;  4PSW A;  1PJR A;  2LRE A;  2CW7 A;  2MD0 A;  1WJA A;  1D0Y A;  5CQG A;  2XF6 A;  2MC4 A;  4G6T B;  3SZG A;  3I3L A;  1D0X A;  3OYN A;  2VAS A;  3KX2 A;  3S93 A;  4N4N B;  4II3 A;  4XKC A;  3D5L A;  3VSL A;  2MYS A;  4XLF A;  3LSI A;  2IS2 A;  2K3P A;  1WJD A;  4XKB A;  1D1A A;  4IKF A;  2OV7 A;  2HNH A;  2K5C A;  2X85 A;  3PSI A;  3SDB A;  3OS2 A;  4KT6 A;  2L9S A;  2W82 A;  4BUP A;  3GBG A;  3ZRG A;  4PJJ A;  2WB1 A;  1X1D A;  3K4B A;  4CCK A;  4Y33 A;  1OLT A;  4PFO A;  3PJR A;  2DT7 B;  1X19 A;  1W36 D;  3BLY A;  1N78 A;  4HSR A;  2M7B A;  2A6T A;  5LFA A;  3MKY B;  1X4O A;  3SEQ A;  2R7X A;  4ZDO A;  2Q1Z B;  4NC7 A;  3OYM A;  3OYJ A;  4XKV A;  4E7Z A;  4XM3 A;  1V5F A;  2CS3 A;  2KP6 A;  4B48 A;  3D5S C;  2MAB A;  4P5O A;  1WJE A;  2V1N A;  1MMN A;  2Z1D A;  2IXS A;  4BEH A;  5TGT A;  1NG6 A;  2L2O A;  1Y56 A;  4Y4R A;  3OYE A;  3H9G A;  3OL3 A;  3QYB A;  4IX7 A;  3HXL A;  3OYB A;  1V5G A;  4FAS D;  3IAS 2;  3UR3 C;  2DJI A;  2IGK A;  2P0W A;  2ZXI A;  3A2K A;  2M7A A;  4PJM A;  1WJF A;  1FMW A;  1D1B A;  2ZSH B;  3DTK A;  1N75 A;  3S3M A;  2VB6 A;  3F9K A;  4BGD A;  1R6R A;  2KMU A;  3LSM A;  3MMY B;  5FRM A;  4NNJ A;  3DPU A;  4B44 A;  3OYG A;  2RNG A;  4IQJ A;  1D0Z A;  3PFY A;  3OIP A;  1WJ5 A;  1MW7 A;  3DLA A;  2LBF B;  3HG9 A;  4RM2 A;  4E7I A;  2X1D A;  3H9J A;  1DGW Y;  5KNL A;  1QHH D;  3PNY A;  1E0E A;  2X1E A;  1MND A;  2LYC A;  3CES A;  5CPR B;  4E7H A;  2K9L A;  1SFK A;  2XC7 A;  4J01 A;  1LKX A;  2F5V A;  2IGO A;  4YEL A;  3ZXS A;  3ZGK A;  4HEA 2;  2PJR B;  3K4L A;  4LIT A;  2L7K A;  3V42 A;  2LG4 A;  1X4P A;  3E0J B;  4XL9 A;  3TL4 X;  4BE2 A;  2HPI A;  3OYA A;  4IQ4 A;  1YX3 A;  2Y0S A;  1IRX A;  3TMO A;  5CKT A;  2HZD A;  3VDX A;  3OYH A;  1T0F C;  2CUZ A;  3PL8 A;  2PMZ A;  2R7Q A;  2HDW A;  4BDY A;  1BOB A;  3H5A A;  2QKM B;  2VQL A;  2BW3 B;  1J09 A;  3L2R A;  3CP8 A;  3OYF A;  3K4C A;  3J7A Y;  1EA3 A;  2ZSI B;  3IP4 B;  3KEY A;  4DIQ A;  4F92 B;  2RRE A;  4F91 B;  1VZ0 A;  4R79 A;  1OR7 C;  2X51 A;  2FUG 2;  4AVZ A;  2VQC A;  3H5N A;  3OS1 A;  3S3O A;  3QYF A;  3EUK L;  3D5R C;  2W4S A;  1QU3 A;  4HNU A;  3FBN B;  4XMY A;  2LY2 A;  5HNH A;  3PNT A;  1GLN A;  2I8D A;  3LSG A;  4BXF A;  3OYK A;  2F6C A;  2A5W A;  5CQE A;  2W7N A;  2R7W A;  3OYC A;  3OYI A;  3RPU D;  3ZR8 X;  4PK4 A;  2XDV A;  4LG3 A;  3DU6 A;  3G2B A;  4BU2 A;  3SEZ A;  4PSX A;  1YX5 A;  4OWR B;  3A4C A;  3ZQQ A;  4HPQ A;  2LC2 A;  2CFO A;  2CH0 A;  2VJ4 A;  4BQQ A;  2E1M C;  3OWT A;  4E7J A;  2DT6 A;  3LMM A;  4CCM A;  4B43 A;  2UWM A;  2X1C A;  3RSN A;  5KCM A;  3VYU B;  4PFP A;  2MFZ A;  2X6W A;  3L2U A;  4ZDL A;  2KZV A;  1N77 A;  4LIU A;  3DQV C;  3HC7 A;  4II2 A;  4BAC A;  4HNT A;  4XOR A;  2R7U A;  2GOM A;  3L2Q A;  2R4G A;  4RLF A;  5HLT A;  2CV1 A;  1KON A;  4DJA A;  4ZTF A;  2V6E A;  1T95 A;  3SYT A;  5HVQ C;  4XOP A;  4CSW A;  3FKJ A;  1MMG A;  4HST A;  3S8P A;  2OC6 A;  3MD2 A;  2LY1 A;  4IZZ A;  3OY9 A;  3DU5 A;  1S9H A;  4F55 A;  4D1Q A;  2K9M A;  4U87 A;  3AL0 C;  2WY8 Q;  4U7B A;  1P9Q C;  3DKX A;  3OIQ A;  2KDO A;  4BDZ A;  1TZL A;  3H9Q A;  1AA7 A;  2HVR A;  4BJ5 C;  3NWT A;  2LBF A;  1LDK B;  2VXD A;  4OAY A;  4JQF A;  4ZC3 A;  1DP3 A;  2WAF A;  3I9V 2;  3VYR B;  1Z7L A;  5HNF A;  2IS6 A;  2KRC A;  2VJ5 A;  3LL7 A;  4YEJ A;  4XQF A;  3OMY A;  1X1B A;  3K70 C;  4F93 B;  2VQG A;  2XSJ C;  3QYE A;  3IAM 2;  1BR2 A;  4XN0 A;  3AKZ A;  4BE0 A;  2CV0 A;  3VWB A;  2DOA A;  2XAU A;  3OR2 C;  4F52 A;  3DPT A;  4D9J A;  2HQA A;  1HA8 A;  3DKY A;  2VKH A;  2L9N A;  1QHG A;  4NC8 A;  1FMV A;  2HVQ A;  3CJR B;  4Y3O A;  2KRH A;  3LSH A;  1BR1 A;  2V9K A;  4XOT A;  3FDY A;  3K4K A;  1G8X A;  2OUM A;  2V7F A;  2R7R A;  2BW3 A;  2UUZ A;  4FET A;  4XON A;  4HRI A;  4N4O B;  2IGN A;  3IUO A;  3W2W A;  4XKW A;  4E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...