4IZZA

Crystal structure of fischerella transcription factor hetr complexed with 21mer dna target
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
b'VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 83
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA02
3QOEA 4YRVA 4HRIA 4J01A 4IZZA 4J00A 3QODA
chains in the Genus database with same CATH superfamily
5B66C 2VJ4A 1BI0A 1U5TB 2E7XA 4N9HA 3RSNA 1S7AA 3BPXA 1TTYA 2F5EA 4CYCB 3DKXA 3KP4A 4BE1A 2F6CA 2HZTA 3J7AO 3OYHA 2HYJA 3OS0A 1I3QJ 3ECOA 1IRZA 1N77A 3K4LA 2A05A 3FKJA 2DDAA 2GXAA 2K3FA 4XOPA 2EIJH 2IA2A 1H88C 1LE8B 1UAAA 2ZMEA 5D6EA 1O57A 3F8CA 3BG7A 1ZREA 2IRFG 1TWAJ 2L7KA 4RB1A 2A5YB 2JSCA 2WB1N 2YU3A 4IEJA 4BQAA 3K4NA 1ZRFA 1JT6A 4C3JJ 3OYKA 4JBAA 4RB0A 1DU6A 2IA1A 2EH3A 3IWFA 2EV6A 1FNNA 3I54A 1TQPA 4HF0A 1ZGJA 3BOQA 3B73A 3H3UA 3HOUJ 1OKRA 1U6GA 5C4JJ 2IGOA 2Z99A 3LSMA 1AA7A 3ROUA 1FSHA 1R23A 2E5NA 5F6FA 3U2RA 3E0JB 1D1CA 1B9MA 3OYDA 1JKQC 5E20A 1PUFB 1ZN2A 2E2HJ 1Y1WJ 4HG2A 4P55A 3LSIA 1HKTA 3BWGA 2L9SA 3QYEA 1XX5A 4OAZA 5LLQA 3HJEA 3OIPA 2IXSA 3MWMA 4KICA 3ZXSA 1W36C 1KONA 2M8EA 5HDKA 2P7VB 4HV5A 1QZZA 2L9NA 1FIAA 2HKXA 2DMUA 3ZN1A 2XGDA 3AG2H 3JCUC 3HOYJ 5BPIA 2M3AA 4Z6YA 2W85A 1ZG3A 2ME6A 1RUNA 1MZBA 1YG2A 4BAYA 2NYXA 1MSEC 5DDGA 4FT8A 4HV6A 2FXAA 4D5CA 4DQ2A 3DFGA 3KYCB 1I3AA 3CUQB 3IH3A 2PBIA 1MBFA 3CDLA 1EJ9A 2OTJI 5FRNA 2OZUA 1MJBA 2P5VA 1O4XA 3ABMH 3QU6A 1ZGAA 4WXDA 2X1DA 4V2FA 4CDGA 1P92A 1U9NA 4OIQF 4I02A 4YFKF 2V7FA 4KN4X 3JRAA 2LF7A 5ILUA 4XLFA 1TQIA 3BZCA 1S29A 2FMLA 3AKZA 2FX0A 1IN8A 5ED4A 3DCFA 2QSGX 3H3VK 2LP0A 1BI2A 2QCOA 4EVIA 1YYVA 1ETQA 1K83J 1E17A 5IOYA 5ILVA 4XRFA 3LSJA 3PNYA 5B3SH 1A31A 1GVJA 4MFEA 2GOMA 4IHVA 3A01B 4XLEA 1RC9A 4OAYA 5J8FA 2DI3A 2IGKA 3GTGJ 2FNAA 2K4BA 3A0BC 4MEXF 1G3SA 5E1WA 4LJZF 2KPMA 2A07F 4M3BA 4A12A 4OIPF 3S3MA 2QLZA 2VC0A 2WA0A 3B6CA 1HSTA 4KA4A 4XQFA 4I76A 2EWNA 2DJIA 5LGNA 2ZCWA 1WI3A 3S93A 1ZRDA 1ERDA 4HF2A 4E7SA 1SAUA 3EUHC 5GPAA 2QKMB 1APLC 3PUFA 1HDPA 2FRHA 2E34A 2NVXJ 4O6JA 4ESBA 2K9NA 3K4BA 2LOOA 3S2DJ 2VJ5A 4M3GA 2Y75A 3ABUA 2XGCA 4JK1X 4R1HA 5EGOA 1QHHD 2IA0A 4M74A 5F04A 2KJCA 4OINF 3M8EA 4IO9F 2L54A 1CF7B 4FTHA 1T6SA 1VNDA 2VPLA 4BL0B 3F21A 5JHFA 2VBYA 1D3YA 2A3SA 2ZJRF 2X6OA 2HR3A 3FXJA 1TC3C 3GTMJ 1XGOA 3R0AA 4YELA 2VKHA 4XSXF 1ZLKA 2PJRA 4K2EA 2CV2A 4D7NA 4XLPF 3WG9A 1I5ZA 3CP2A 2KDZA 4G7HF 1IDYA 2FF4A 4FX4A 1B1BA 4QSHA 4G8XA 3LFKA 2NNNA 2EBIA 3TEDA 2FQ3A 1VQ6I 4L5JA 1YIOA 1FYMA 3W6VA 2ZJ2A 4BDYA 3OYJA 4XLNF 2ACJA 3HOVJ 4IHSA 4HA8A 5EYRA 1JJ8C 3RPUA 2XKOA 3V8JA 2XF7A 2F5FA 3QOPA 2XDVA 5A2QK 1Z9CA 3I59B 1LVAA 3QODA 3D5RC 2L0KA 2JK3A 3BR1A 2CYYA 5FKKA 3MFKA 1Z1DA 2AQEA 1HF0A 3C2GA 4LLLA 5IT9Z 3BC8A 5K7HA 4IRHA 3OV8A 5JLXA 1PYVA 2ZMEC 3B02A 4L9VA 3PIOF 3CDHA 3MQ0A 2YS9A 1W1WE 2LLKA 2XAHA 3L9FA 4BGDA 1MSFC 1X3ZB 2UWMA 1OCOH 3ZQHA 1GHCA 1XMKA 2CS3A 5FLMJ 3NARA 4KIFA 4U7BA 1TL8A 1WJBA 3HUGA 3P9IA 2ESNA 2L01A 1IW7F 1FMVA 4NQWB 5JHUA 3QYBA 2L4AA 4IXAA 3HOTA 4HX7A 5CVUA 4BHPA 4I98B 4HAMA 3E97A 3IKTA 2P7CB 2GBYA 3RKYA 3PFIA 4CXFA 2LH9A 3DEUA 1XPXA 4M3EA 4NB5A 4N4NB 2BE5F 2QM3A 5HOOA 2Y0SN 1O3TA 1X4PA 2M87A 3H5RA 1NG7A 1YLFA 5IYCJ 2A6EF 3K4JA 2XHKA 4KISA 2H09A 1RKWA 5B1AH 3S3NA 3SQNA 3ZPLA 3DKWA 1TWCJ 3PNTA 2LVSA 5FRMA 2AXTC 3H0GJ 3LAPA 3T5XA 3CF5F 2DBBA 3EDPA 1BL0A 2P81A 1WFXA 2UXXA 3OYNA 3L2RA 2EZIA 4AIDA 4MFDA 3DTKA 3KLNA 5HLIA 2RDPA 5BOXA 5TISC 2GXGA 4KDPA 3PO3J 1HW1A 5L3BA 1MBEA 2R5ZB 1HLVA 1QA6A 1Z6RA 1MGTA 1A5JA 1I1SA 4OWRB 4HW0A 5HLTA 3DBHB 2GIZA 4XRMA 4DNCA 2X48A 2HVRA 1GV2A 2M1BA 4HZFA 2IAIA 2MABA 3HRMA 3ZMUA 3E5QA 4N4OB 4LLNA 4YFNF 2K5CA 4XRSA 4IHXA 2EA2A 4PUSA 5LFAA 3K70C 2L4MA 3TDZC 3V7SA 1KU7A 2GXBA 1U0JA 1WRJA 2XRNA 1UJ8A 3AAFA 1MMDA 2GIVA 3CESA 3QAHA 4BJ6C 3FXOA 1UZCA 3M1EA 4KIGA 1LQ1A 1MNDA 3T1BA 2GZWA 4CCKA 1A6QA 1X1DA 4ZYHA 2P4WA 2Z5UA 5FKNA 2PLYA 2W00A 4BY7J 3WTWC 1VI0A 2QF7A 3S2HJ 2XB0X 3W6JB 2HVQA 5CVVA 5KAFC 3PO2J 5B1BH 1XGMA 2A68F 3OOPA 3EPZA 3REOA 4ZTFA 1V54H 1IRXA 5LRSA 4ZDOA 1KZHA 5CVIA 2E1NA 1SEUA 1YRNB 1B4AA 1BIAA 1LFPA 3MVPA 1LFBA 1K4TA 4RMNA 4LK0F 5DCFA 4F7ZA 1GXPA 1S8NA 2QGUA 3S1RJ 2O8KA 1I1GA 3LMMA 3LSRA 5F0FA 1XSVA 1IRGA 2CV0A 4C2MJ 4Z2YA 2D1VA 1Z05A 3LA2A 2XIGA 1RESA 3U1DA 1YX5A 1E2XA 1WJCA 4NNJA 5F08A 1IV8A 3JTGA 1J9IA 3R6SA 3AL0C 4CH7A 1MMNA 2JJ7A 3BQZA 2MG4A 3OIOA 3RIRA 1X2MA 2LYCA 1GV5A 1VQ8I 3VDXA 3P9KA 5D5WB 3CJRB 2CRGA 4DBQA 3U9GA 1R5ID 1P4WA 3ZOBA 1ITYA 2AXLA 4RLFA 4EMSA 5GAGJ 4KMUX 2NVTJ 4DGWB 2DK5A 1SFOJ 1YIJI 1OYIA 1H8AC 2VB6A 5F27A 2MC3A 3ZQFA 4EM1A 4A3IJ 3WTZA 1FJLA 3BPVA 1ZTRA 1JKPC 1Q1HA 3E5UA 5E3LA 1IV6A 2BY3A 2JMWA 1R49A 2COBA 2XSDC 1T98A 3CQZJ 3R60A 2KIFA 4Y33A 4XK4A 4ZYGA 3F6VA 4PFPA 3ZQIA 2XGEA 3HOWJ 4J19A 2NVUB 3VYUB 1YX3A 2FOKA 4J00A 3AG3H 5KVRA 4A3CJ 2RGVA 3I64A 4ON0A 3JSOA 4I09A 2FEZA 4E6KG 1BW6A 1S3JA 2RNGA 1ZH5A 2FD5A 2VUMJ 1BA5A 3WTYC 1LKXA 4A5MA 2K9MA 5EF6A 2EV0A 1HSJA 5D4SA 4V19K 3CCYA 1IRFA 3J7AY 2Q0OA 2CFOA 2L2OA 2Q2EB 3FBNB 1XMXA 1VQPI 1MNEA 1ON2A 2CGPA 5E3OA 4BHCA 3FHZA 3DQVC 3ABTA 3HYIA 1W7PA 3SHFA 3I4NJ 2Z16A 1OYYA 2V1UA 4D5FA 4BNCA 1DP3A 1VF9A 3S8PA 5GAHJ 4B47A 3V7CA 1FBUA 2R7SA 3TO7A 3M3YJ 1BM9A 4LD5A 3JRFA 3RQ4A 3UR3C 2OPTA 1RRJA 5HNFA 1L3LA 3MKWB 4XBFA 2M4KA 2XAFA 3RZOJ 5E3MA 1IGNA 3FM3A 1O3QA 5KAIC 3A1YA 2CQ7A 4PFOA 1WH7A 2LFBA 2UV1A 2XB5A 3IAS2 1YO5C 4RAYA 3WHCA 1RUOA 1IXCA 1EA3A 4M6XA 2RC4A 3N05A 5LEKA 3WGIA 3PSIA 4UVBA 3TGNA 5K1YA 1OCZH 2OJED 3SZTA 1HBXG 3MAJA 2XVCA 2CMPA 2DOEA 3HOSA 2NOJB 2R7WA 2P5KA 3GFLA 2WY7Q 2PMHA 3MMYB 4OIRF 1YOVB 2A61A 2JA5J 3VSLA 4XKVA 2QQ8A 5BMZA 2Y0SA 5J40A 4A0ZA 5KCMA 2H6BA 4Y15A 3KP3A 5BPDA 2WV0A 1B6AA 2R7RA 2VASA 2H1LA 3ERMA 5BQTA 4JX6A 3J81Z 3QU3A 2EZLA 5FB2A 2E1MC 1T08B 3FHNA 4CCJA 1R1VA 3DU6A 3JW4A 4CUGA 4L5EA 4A3BJ 2FMYA 1SMYF 5ICEA 3RJPA 2JT1A 4ENMA 2DDBA 1U2WA 1K4SA 2B9SA 1FOYA 4LG0A 2M2EA 1B8IB 2M30A 1MJAA 3IC7A 1MIJA 2F2EA 2LDUA 2O0YA 2H8WA 1J5YA 2YU9J 2QWWA 3ABLH 1TQMA 2EFOA 2RV8A 5HDNA 4W1UA 1XN7A 1W36D 1JKOC 1NH3A 3CCSI 3J80K 4RAZA 2ZXJA 5EG0A 4AIJA 1BR4A 1NHAA 3UKGA 1WH5A 1K78A 2QKLB 5H6QA 1MDMB 1JGGA 4OOIA 3DF8A 2QQBA 4AVZA 3L2UA 3C7JA 3MEXA 4QWQA 4BU2A 2IEKA 2XROA 2DXIA 1ZR4A 4L0YB 2X1EA 2QEXI 3LL7A 3I0TA 2STTA 1XMAA 2V6EA 3DU5A 3SFZA 3OYLA 4GXOA 2ZFUA 3O6BB 4P9FA 4IRGA 4EM2A 3OYCA 3GO5A 1G2HA 5K5OA 2BOLA 3IHUA 1P4AA 5AONA 2LY1A 3DPUA 1TLHB 4OIOF 2H27A 1DUXC 1WWXA 5FKMA 1ZR2A 3RCOA 2CSOA 3F9KA 3JRCA 1YITI 1LVKA 2AQFA 3MCZA 1MKMA 4JQFA 1ON1A 3QRFF 2M0CA 3LWFA 5LRRA 2Y31A 1VQ9I 3AG1H 1OCRH 2DA2A 3I4PA 4XSZF 1K7AA 3TO9A 4Y3OA 3PM1A 3AL0B 3KYDB 3CCLI 3FK6A 5EGOB 3KEOA 5FGMA 3T8TA 5FKLA 3DEEA 4LG3A 3GLLA 3HRUA 4B48A 6PAXA 4MO7A 3FF5A 4M6YA 3JREA 3QQAA 1Z77A 1JGSA 2MC4A 4W97A 5K5RA 1WSUA 2CW7A 1ZGWA 3LFUA 4PDKA 3OYGA 2VE9A 1BC7C 1FOXA 4DYCA 2OBPA 4UXNA 5L3CA 3GWZA 2TCTA 1CGPA 3PNVA 2P5LC 1B72B 4EJTA 4CZZA 2XPWA 2VOPA 1YJ9I 1AHDP 2W1OA 4S05A 4ZYDA 1KYZA 2IS6A 2ID3A 3S2WA 2DODA 1T56A 3FKIJ 4G6QA 3L00A 3U1KA 1VQ7I 2ADUA 3CTAA 3S32A 3HTUA 2BV6A 4E7LA 1WCMJ 3IL2A 3ZN0A 2EV5A 4CYDA 4I6ZA 4QPQA 2Z1DA 3M07A 1V4RA 4RAFA 1D0XA 2RQQA 3ASOH 2QSFX 1TNSA 2RAEA 3HSEA 3QPTA 3SXYA 3C3WA 1F9NA 1S9HA 3WE2A 1XG1A 4JP0A 4XKCA 1BJZA 2HS5A 3FXKA 2W57A 2KISA 2L7ZA 5GTIC 3CC4I 3VB2A 2ID6A 1OLTA 3SEZA 3CCMI 1XD7A 2Y2ZA 3KFWX 4I2OA 4ZTJA 3SZPA 4U7DA 4L5IA 2HOEA 1R6RA 3IH2A 5F1RA 3MZHA 2ZXIA 1IN6A 2A6HF 2O5RA 4MHGA 3GFJA 1O3SA 2V1NA 2X1CA 4BQQA 1HDDC 4AM3A 3BG5A 4D9JA 1LEBA 2HFHA 1OFCX 5JVGF 4A3JJ 2I5UA 3HL2A 3IWZA 1QNTA 3O8GA 2M34A 3ZP5A 2X6XA 2LG4A 3KE2A 3MN2A 1HOMA 3ESWB 4O3MA 4A3FJ 1R5GA 3DXJF 3F3XA 2E5ZA 1P4XA 4G94A 4UV9A 1FYKA 5GADJ 3GTKJ 1R00A 4WWCA 2DAOA 2XAJA 1HKQA 4I01A 4P9UA 4LB6B 2VL8A 3C1DA 1D1BA 2VQHA 1HKSA 2E19A 3GXOA 3LAJA 2NS7A 2FU4A 1P7IA 3CMYA 3R0JA 4FASD 4RA2A 2LY9A 1OQYA 4RGUA 2E1CA 3F8FA 3CD6I 3N4MA 4E7ZA 1UG2A 3EYIA 1VTNC 1U8BA 2VBZA 2XAQA 2Z3YA 2LY2A 1Z21A 1DU0A 1KGSA 1GUUA 4S04A 2QENA 3BY6A 5H6RA 3HKZA 2VOOA 3BG9A 2R0QC 3JAMZ 3GW2A 3LNQA 3FXRA 3T8RA 4BEHA 2V26A 5ERIA 1YFHA 2L7MP 3I9V2 3KPHA 2JPCA 1ZQ3P 3TL4X 4EJUA 3ZMTA 1BBYA 3E1SA 1MBGA 3OL3A 2ZO4A 4BY1J 5HS9A 5IT3A 2E1MB 4AD9A 2LMDA 3GFIA 1I6HJ 4D7MA 3OYAA 2QBYB 2CQQA 1Z7LA 3BJAA 1D8JA 5DM6F 5CJ9A 3E3VA 2JTVA 2LKPA 3G1LA 1WQ2A 3IH4A 4NBQA 3HSRA 3WU0A 4BH9A 2R4GA 2FNPA 3CUOA 1F43A 2KL4A 2OF7A 1KQ0A 2EIMH 2LK2A 3CCEI 1ZARA 2EINH 4PJLA 3FXQA 1XCBA 4I0AA 4ENKA 1GLNA 2XAGA 3BJ6A 3GTOJ 1R4MB 3PL8A 4XORA 4GRIA 1IDZA 3RPQA 1ETYA 2DN0A 1DDNA 2LD5A 5FLVA 1FZPB 3PJRA 1T8IA 1LDKB 4BBRJ 1XB4A 2V79A 2BVMA 5BS6A 1UELB 2DLLA 2R5YA 1JTXA 1ZKGA 2TRTA 2LBFA 1JTYA 3KLOA 4U0WA 2PX9A 1XDSA 2CQNA 2FE3A 5DEQA 1S5LC 4RGRA 2MLGA 1T33A 1FPQA 5D5VB 2G7UA 4M3FA 2N8GA 1TW3A 4B09A 1UCRA 4MNUA 1SD6A 2H1KA 3HGGA 3GTJJ 3TOBA 1XGNA 2VKDA 4HQMA 2HQRA 4WK8F 1AKHB 4UUSA 3U21A 4ESJA 1X1PA 3HEFA 1SD7A 1U5TA 3ZQGA 2ZNYA 2JUCA 1U8RA 2HNHA 3OYEA 4CYCA 3H1CA 3L2QA 3K70D 3JRBA 2CG4A 2ZXHA 2COMA 2F5VA 5HVQC 3F8BA 1WJAA 5ICCA 2AS5F 1JHFA 3K4KA 3K4CA 4PJ0C 2VBWA 3K2ZA 1H9GA 5FROA 1S7EA 1P6RA 1QGPA 3RI4A 4A69C 3ZGKA 1S6LA 3BTCA 1LE8A 3K1PA 3WGGA 2IS2A 2E71A 4HSRA 4ZZDA 1PVEA 1FTZA 5FLXZ 1NG6A 5GAEJ 3E6CC 3CO7C 1O7FA 5IPAA 2HQNA 2QQ9A 4H4KC 2ZNZA 1UHWA 3HGYA 4P5OA 2CQXA 4B3XA 4JX4A 5LGUA 3ZR8X 5DUKA 3HBLA 5FFXA 3JRHA 3VODA 5J47A 4II3A 3RDIA 2MD5A 5JR3A 4ZYEA 2DK8A 5DD8A 2IJLA 3HZJA 2MD0A 1YI2I 2HTSA 3ZQQA 1W5CC 2ZJPF 4Y7NJ 2GLOA 2OU2A 3KZYA 4BHBA 1X4OA 2KIMA 2DT6A 5C3EJ 3GLXA 1RI7A 1DPRA 4HOBA 1PUFA 5F64A 4AWXB 3FK7A 2VN2A 3OR1C 3HHHA 2HPIA 1RR8C 4ENNA 2L3DA 3FM5A 3VPRA 1BIBA 2XAUA 4GFBA 2VT3A 4M3DA 1R4NB 3QPLA 3RKWA 4Q5SF 2VJJA 1H0MA 4YG2F 2P8TA 3WE3A 2HQAA 4Y17A 1IJWC 2KP6A 1YW8A 3ECHA 3IKVA 3LOCA 4AU7A 4B1RA 5C44J 1YHQI 1Y0UA 1FT9A 2FJ1A 1S7OA 2DW4A 3D0SA 2OTLI 3VYSB 4PJJA 2LF8A 1GVDA 3KP5A 4GYGA 3B6AA 3PIPF 3K6GA 2RNJA 1J7KA 1EH7A 5DCMB 2ELJA 2VONA 4BJ5C 2EILH 3CUQA 1QVUA 4MEYF 3VSKA 4BUPA 4CSWA 2BZTA 4EJOA 1SANA 2YX4A 1GT0C 5TGTA 1T39A 4R79A 2RREA 1B59A 2CUJA 1KU3A 2VJIA 2WBMA 1RNLA 2PG4A 3Q0WA 4BXFA 3G73A 1SMTA 3CO6C 3DLLF 3Q0VA 3LSTA 1TW2A 2CQKA 1A36A 2FQ4A 2VLAA 5CPRB 2W48A 1HCRA 3G4SI 4CHUA 1X1AA 2WTEA 5IP6A 3Q3SA 1ETWA 4YRVA 2VQLA 4XLHA 1D8KA 5M5YJ 4UUVA 1QPIA 2HWVA 4XKBA 2V9KA 4A3EJ 2OAZA 5ICGA 1ACIA 1QVTA 5E1ZB 1CQTA 3A01A 3WTXC 4UNOA 3J7ZI 2L5QA 4Q47A 2GQQA 2V6CA 4EEFG 1USTA 3VYTB 5BNGA 2DA1A 2X85A 4PGHA 3RKQA 2QSHX 2F4IA 4RB2C 4AVPA 3JRIA 5L3FA 5E17F 1UHMA 3WU2C 3CC2I 2R7FA 4N0BA 4IHWA 1I50J 5HDGA 2ZFWA 1USSA 4UV8A 2K7LA 3HXLA 3BJOA 4IJAA 1A04A 5D5UB 3BTIA 5F1JA 2KJBA 4ZDPA 3GZ6A 2AO9A 2BEOA 1LNWA 4ASNA 2K27A 3VEPA 2M0MA 2CW8A 2HU9A 3HDDA 3KP2A 4HEA2 2E2JJ 4LGWA 3WGHA 3KP6A 3EYYA 4J01A 4E7JA 1W4MA 3GFMA 1O7LA 3E6BA 3QWLA 2XKPA 5E1XA 2F5DA 4F52A 4KYWA 1JUMA 5L3GA 3W3CA 4IRIA 2Y69H 2I8DA 5KK1A 3E5XA 2DA4A 4FHTA 5EG0B 5IOZA 2PEXA 4KT6A 2BY1A 5IT9K 3I56I 3J7YJ 1CF7A 5EEAA 4ZYAA 2BHZA 3BROA 3FBIB 3LQRA 3HPHA 4XM3A 4AYBN 1JUPA 2IBDA 4KJZA 2RVCA 2CH0A 2GA1A 3DLAA 2DT5A 4LMYA 2LSOA 4XOTA 1VQ5I 1TZLA 2WADA 1V3FA 5GP9A 2BGCA 3H9QA 2VKEA 5LGTA 3GZ5A 4GCVA 3NQOA 1OJLA 2EB7A 4HX8A 4P96A 3L2WA 2R93J 4X6AJ 2EPFA 4M9XA 3DV8A 4KN7X 3VFZA 2VPRA 2BXZA 9ANTA 1E3PA 1F36A 3WTSC 4C9YA 4ABZA 2OV7A 3IRQA 3ZCOA 3DPTA 1G6NA 3ZMVA 3WODF 3BCBA 2KLOA 3S14J 2F4OB 1PP7U 1MJ9A 4F93B 2TDXA 5DS9A 1FP1D 2HKOA 2DOAA 1KQ8A 4M72A 1LDJA 3D5LA 4EJVA 4A6EA 3KYLA 3I59A 1ZK8A 2B7EA 2JVGA 1SC7A 2BXYA 1BOAA 4LFUA 4DJAA 2YR2A 4CO8A 1Z3YA 3BZ6A 3CF2A 1HW5A 1E3HA 4PJNA 4AIHA 1QO0D 1YE9A 5GPCA 2FBKA 3E7LA 2XASA 2VQCA 1PJRA 2QQAA 2JA8J 2JWTA 3KZIC 2ECBA 2ZJQF 3WU1B 3KIOA 4IHYA 2PMZN 3O3KA 2MH2A 2O8XA 1U78A 2R92J 4EJWA 4NHJA 2ZMEB 3MKLA 1W5SA 1ZAOA 4XONA 4RAGA 4NQWA 3GVAA 2PI0A 2DT7B 4ZC3A 3PQJA 1JKRC 1FC3A 4BBSJ 2GM4A 4BYYA 2WAQN 4C30A 4UVCA 1JI8A 2B63J 5DUIA 4U87A 4IX7A 1E0EA 1MBJA 3JR9A 4HDVA 5IYBJ 2YSRA 5HLHA 3OIQA 3NAUA 4UUTA 2HDDA 5M5XJ 1MNMC 3W6KB 4EQQA 1IXSB 4FE7A 1HQCA 3HC7A 2X6WA 2GOXB 4M71A 4XLCA 3ZMZA 3HRTA 3G1OA 4O5VA 1KQ9A 3HKZN 5EDNA 3GUDA 3A0HC 2W4SA 2PMUA 2E36A 2WC2A 1D5YA 2DPDA 1T95A 3JRGA 2DFHA 2LTPA 2LR8A 4IOCF 2R7XA 4MTEA 4BACA 3CUQC 3I58A 3VOEA 2O6GE 2Q8KA 2Z2SB 3CLOA 5M3FJ 4C3HJ 3A03A 1R58A 3QPHA 2LKXA 1SAXA 2R5ZA 1ZHFA 3D5SC 3HB9A 4YIFA 3GTQJ 2O61A 1TNTA 4HNTA 2F4MB 1WJ5A 4P1WA 1JJ6C 1E3OC 1Z7UA 3BTJA 2JVHA 5LHHA 2F48A 3VYRB 2W84A 3F8NA 3KX2A 3TDUC 4BJTA 1ULYA 2O03A 3E6MA 1YW7A 3DBLB 1TWFJ 1WPKA 3GCMA 3GTLJ 1ZYRF 3G3ZA 2FSWA 1V5FA 2VODA 2PQ8A 2DO7A 3OL4A 1VFCA 5E8IA 1OCCH 1W7PD 3GF2A 3I53A 1LB2A 4LITA 2PN6A 2QUFA 3WHBA 3IRRA 1WVRA 3V7RA 1POGA 1SFXA 1WGXA 1BJAA 4HYEA 3H92A 3BZKA 4A0YA 3H36A 2VC1A 5CQEA 2E7WA 1BN5A 1R5HA 2DA5A 1MMGA 1IN5A 3F23A 1DP7P 4IF4A 1H89C 2VI6A 1YRNA 1F5TA 2OC6A 2DCEA 2G0EA 4M9ZA 3TKYA 2V1XA 2JPBA 3KCCA 3GYHX 2VQGA 4MGRA 5DTDA 1WJDA 3V8LA 3K2AA 2HOAA 3EUHA 1EKEA 2JN6A 5EZHA 2VBXA 1ZG1A 2K9LA 2XF6A 1I39A 3G1MA 1ODDA 2XPUA 2MH9A 3IAM2 4DW6A 3OYFA 1WZ2A 4L18B 1N78A 4E7KA 2L7FP 4B43A 5ICFA 3ABKH 2IVMA 2GWRA 2KRFA 1IC8A 2MLKA 1ETKA 2DMQA 5EEGA 1UHSA 5E3NA 4ETSA 3CMAI 3PSFA 1X2NA 1Q1VA 2EJRA 1LDDA 3EUAA 1KU2A 1J59A 4XIDA 3FWEA 5FD6A 3ISPA 5D8LB 3RQIA 5ILSA 4PGGA 4ZDLA 3G71I 3CCUI 4C2UA 4AYBA 1TWHJ 1IZ1A 4JOMA 3KEQA 2OD5A 3X2QH 2D45A 2LRDA 5DM7F 5J1RA 3WTTC 4LOCA 5CLSA 3FDYA 1IAWA 1T38A 1ORKA 4M73A 2M45A 4CICA 3CZ6A 3LSHA 2JUGA 1RR7A 2JA7J 1SVLA 3BQYA 2PJRB 4WXHA 1OCPA 2X4HA 1V5EA 4CCMA 2BVLA 1XC5A 2D1HA 4EM0B 5JLWA 4DIQA 5H20A 2J5PA 4DYRA 2EFPA 4MLOA 3TOAA 1FBQA 1BI3A 4TV7A 4IQ4A 5F0HA 1RETA 3NWTA 4EGZA 1X1CA 5H2FC 2Q2EA 4NDLA 3NRVA 4L9JA 5J6XA 3BR3A 2NVYJ 1BC8C 4C2TA 4BQOA 1D0YA 4BS9A 3S15J 1G3WA 3GBGA 1MMAA 3I71A 2HZDA 4WF2A 2A6TA 2KQRA 3HG9A 5DV5A 2MA3A 2R3SA 1W0UA 3S1NJ 3FIWA 4OMYA 3P5JA 5M5WJ 2JQ7A 3TMOA 3J81K 3JTHA 4CZCA 4BE0A 4HQEA 1L0OC 5EEHA 3W2WA 1HC8A 2DFFA 1PP8F 3C18A 2KRHA 3M7GA 2EK5A 4DBRA 5J4YA 1HA8A 4XR6A 4G7ZF 1BW5A 2BW3A 5L3EA 4UY8I 2PMZA 4YIRX 1XSDA 4WX9A 5L3DA 2ZKZA 1SFEA 1Y56A 3D1NI 1Z3XA 3HUGB 3L2CA 2R7VA 4DZJA 1Y8RB 2HOTA 2R7QA 1YQAA 4KITB 1FP2A 3F6OA 4PCQA 1YS6A 4Q4ZF 4IZZA 3H9GA 2EFNA 2Y30A 2HGCA 2HTJA 4XLAA 2V1DA 3ZMDA 2K02A 2WAQA 2HDWA 4OU0A 4HBLA 1ETXA 2LC2A 2XGXA 2QA4I 3CJQB 1ZRCA 4GGGA 3H5AA 2CUEA 3FXMA 3A2KA 4II2A 1WHUA 5JI6A 5A2QZ 1D1AA 1Y8QB 1Z0XA 4DOZA 5CKTA 3HOXJ 3IUOA 4KMFA 1REPC 2K3PA 1OR7A 4ESFA 4RB3C 4RGSA 2MSYA 3ERED 3ONQA 3SYTA 1OYWA 3CMEI 2NS8A 1JXSA 1V55H 4X0GA 1I27A 3UNGC 2WV1A 2CV1A 2ECCA 3R61A 2ZXWH 2Z9OA 2FBHA 5IP9J 1OISA 4B8XA 4L9NA 3PFYA 3LQQA 1NK2P 4B44A 1HW2A 4A3DJ 1R1TA 2KIQA 2PFBA 4FQGA 3ZQ7A 1BOBA 1B8IA 3ELKA 1Z67A 1G3TA 4R8HA 4QIWN 3L1PA 2HXIA 3KZZA 4I0BA 2DYSH 2K9SA 2X9DA 1X58A 2MW8A 2HYFA 3BR2A 5GTHC 4E4HA 3M4OJ 2W25A 1MW7A 1MD0A 1X3UA 4CA0A 3FXUA 1P2FA 3KEYA 3BCAA 1O3RA 1X1BA 2O7OA 3K69A 1TP4A 1F1ZA 1MDMA 4IPAA 2OCEA 1TWGJ 1ZLJA 2D5VA 1G59A 5EJCA 2JA2A 2NS0A 3IP4B 1J0RA 2Y0MA 2MBFA 2K40A 3S16J 3ZQCA 1VQ4I 1RZ4A 1FTTA 3FMRA 2G9WA 2XF5A 2KZGA 2V4JC 5DD4A 3M8FA 1T2KA 4BXUA 3R4KA 3GTPJ 2JZYA 2CFXA 2ZC2A 1MBHA 4RM3A 3QPSA 2L9RA 1TBXA 3S17J 3FMSA 2DA7A 2ELKA 1DPUA 5CQGA 4RLQA 4UB6C 1QBJA 3EQLF 5J8CA 4IOAF 4DZPA 4E7HA 5HNHA 1UMQA 3BP8A 1FWZA 1FBSA 2D2WA 3G6EI 3H3ZA 4RM2A 3CP8A 4JYKA 2GAUA 2YX7A 3JRDA 1G3YA 2X6YA 3BDDA 4XRSG 2ZBKA 4L9TA 4D1QA 3OMYA 1BI1A 5LHIA 2DFEA 4HNVA 1ETOA 1ETVA 1RIOH 3HTSB 1FOKA 1IO2A 2G7HA 2P6TA 2P6SA 2E2IJ 4FISA 4NC6A 4BQNA 4M9SA 1Y6IA 3CLQA 2FUG2 3P7NA 2DQRA 4G7OF 1NK3P 2XPVA 1B72A 1FMWA 1NTCA 2YPRA 5D4RA 2V9VA 4B3AA 4M6VA 1JE8A 1VQOI 3DP7A 4UB8C 3TW6A 3ZMSA 1ZG5A 1LFUP 2H8RA 2NVQJ 3S3OA 1WI9A 2CWEA 3RYPA 1AU7A 2CU7A 2HOSA 3SDGA 5HS7A 4QTRA 1FYLA 4QLCU 3MZ8A 1EH6A 4JX5A 1FIPA 3OS1A 4LLGF 2DPUA 1K6YA 3CCRI 3I55I 2DMPA 3CMMA 3HM5A 1WJEA 4PK4A 1GXQA 3K9TA 3MD2A 4PJMA 2NNYA 1EF4A 2Q1ZB 2QZ8A 4MQ9F 4XL9A 2MYSA 1UFMA 2UZKA 2M7BA 2DYRH 4ZJZA 2O9LA 3L09A 1N75A 3K0LA 2ZB9A 4D0PA 3OY9A 4KUMA 2XSJC 3MKZA 2W82A 5FKOA 3COAC 1QHGA 3W2AA 1D5VA 3NEUA 3JAMK 4EATA 4MIMA 3OWTA 5AIQA 3RYRA 3L2VA 2ETHA 4HDUA 1A35A 3F72A 1QZYA 2ZSHB 5J1UA 2R7DA 5FFZA 1P7JA 1TT0A 2OCCH 1W7PB 2AHQA 1VQKI 5DYMA 2WB1A 3M8JA 1G4DA 3H35A 2OQRA 2DOFA 2IGMA 3V42A 4F92B 2R7ZJ 1HXDA 1V5GA 2KFDA 2KKOA 4RS8A 4U0VA 3OOUA 3H5NA 2STWA 4NC7A 1YTYA 1J2XA 4HLXA 3EUKL 3BR6A 2MGQA 1QPMA 2KDOA 4GYIA 5E18F 3WTUC 2FA5A 2DA6A 5D8KB 4HSTA 4PSXA 1U3EM 3K10A 3T0YA 4IHTA 3RPUD 2CW0F 2P0WA 2OQGA 4F91B 2XV4S 2VE8A 2FBIA 3ASNH 1MBKA 4WXCA 3I5UA 1R36A 3F0CA 1FX7A 2QYOA 3AFHA 4Q48A 2L02A 1X3WB 1OR7C 3BG3A 2DJNA 4A93J 2K86A 4RDUA 1DGWY 1RPWA 5D5XB 1MH4A 4H0EA 2IGNA 3BLYA 3VWBA 2BHYA 3DEWA 3CJTB 2XUBA 4G6TB 4BXXJ 4CCLA 3GZNB 1TT5B 2RQPA 5K5QA 2Y9YA 1Y39A 3ZQLA 2QBYA 4U0YA 2EFWA 4FCYA 1QU3A 3K4MA 4ITVA 4CCNA 2QVOA 5M3MJ 4UVAA 4BKXA 2E1OA 1T0FA 3SEQA 5CVJA 3E6DA 4XN3A 4ENJA 1BR2A 4LG0B 1P9QC 1WJFA 2DTRA 2LNBA 3F22A 4HX4A 1IUFA 4F3QA 3BTLA 2E35A 3TO6A 3AG4H 4EV0A 2C6YA 4Y4RA 1G8XA 5F0CA 1FSEA 2ME0A 2IPQX 3HSFA 3MZYA 5CYVA 2WAEA 2XC7A 5FLXK 4ANJA 1IUYA 1K78B 4S0HB 4A3MJ 3OR2C 1IG7A 2X51A 2ISZA 5B5EC 3HOZJ 4BDZA 4I99C 4G12A 1IXRC 2O3FA 1YS7A 4LIUA 2IS1A 2BY2A 5TJJA 3RKXA 5FJ8J 3WG7H 4F55A 2KIUA 1EV7A 3M1CA 2IT0A 3NWSA 2WAFA 2BY0A 1STZA 4XMYA 3DTEA 1LUJB 1JT0A 1QZEA 4KFCA 3BG6A 3FXLA 4XICA 3DBRB 1AKHA 2HQ5A 3K1NA 2IS4A 1JUSA 4CGZA 5C4XJ 1EH8A 3FX3A 1Z91A 2ISYA 5FO5A 5J1YA 3FMQA 2XRLA 4KNYA 1XS9A 5LHGA 3BR0A 1ENHA 1IN4A 4FE4A 4GDFA 1AWCA 1U5TC 2HDCA 2I10A 1VZ0A 3DWLE 4U88A 3Q5FA 4LB5A 3S1MJ 4MTDA 3QP5A 3GX4X 4A3LJ 3KETA 4HPQA 3H9JA 4IKFA 2NXNB 4HLYA 3V4GA 4DYQA 2MFZA 1UB9A 3J80Z 2EZKA 1N25A 3A02A 4OMZA 1KU9A 4V2GA 1H9TA 2H94A 2LKSA 3Q0UA 2EIKH 2WY8Q 3TBIA 4FETA 3OSGA 3W2VA 5HLGA 2M5WA 3HHGA 1BR1A 5J3LA 5D6FA 1VQMI 1D0ZA 1OMIA 4A0XA 2VIXA 1I6XA 4E70A 4IQJA 4A3GJ 4WCGA 1A6IA 1MH3A 3Q9VA 3CCVI 4BE2A 1MMSA 2J5OA 3DKYA 3M9AA 5KHDA 1R9TJ 4L0ZB 4Y13A 2M8GX 5EZGA 2ESHA 1YW9A 4KT5C 2VXZA 4UHTA 1XTAA 3IV5A 2WWYA 1FY7A 1R22A 2GA2A 1DGRM 2V9PA 4I7HA 1K79A 3ML6A 1SFUA 1Z6TA 4HRIA 2JSPA 3ULQB 2H6CA 2BBYA 2ELHA 2NAZA 1C0WA 2OZ6A 1AOYA 2K85A 2Y9ZA 2EA4A 3LA3A 4KIBA 2B0LA 2VKVA 4G9YA 1XDUA 3BR5A 1SFKA 2M9HA 3O2PE 2W7NA 2KMUA 5DCMA 2X0LA 1WKMA 1XSXA 3N97A 2OUMA 3TW7A 2KRCA 3LSPA 5LBQA 4G6DA 3FZVA 3O8HA 4YFXF 2UXNA 4A3KJ 2W24A 5J4VA 2BW3B 3ZRGA 3OSFA 1B9NA 4IL6C 2YUSA 4E7IA 1K6OA 1S72I 1ZELA 2R7OA 3GEZA 5AIPA 4C3IJ 5LD2C 1LPQA 4XKWA 1W5TA 4MQVA 1SVMA 2DMTA 1R71A 1GDTA 2RKHA 4LK1F 2LREA 3SFIA 5HS8A 4HNUA 2E60A 4RGXA 2DTZA 2A69F 2KT0A 1IN7A 3RTRA 3CCQI 4N9IA 1LJ9A 1OPCA 2HXOA 3CC7I 1OCTC 1FLIA 3CCJI 1SD5A 3TP3A 3K7AJ 5CVRA 2JRTA 3P9CA 1PDNC 5JFRA 5KNLA 4CCOA 3MKYB 4YEJA 5TRDA 5HODA 4AC0A 1LEAA 2R7UA 3DPLC 1UG0A 1QRYA 1XGSA 3I3LA 3JSPA 3PUBA 1J75A 2JRMA 2K4JA 3KP7A 4ZZLA 2DFIA 5LEJA 1K61A 1J09A 2DA3A 3HIFA 4RBOA 1R7JA 2HEOA 3OS2A 3RZDJ 3DTIA 3K1MA 3BT9A 4BEHB 3SZGA 3SJMA 5FD5A 2FOWA 3HRSA 4HF1A 3OYIA 3HPGA 1FOWA 2CUZA 3CDIA 3FISA 3OYMA 4A2UA 1R1UA 3LSGA 2PJPA 4PSWA 3A4CA 2ICWG 2K9QA 3CJNA 1SVOA 4A5NA 1T0FC 1QQIA 1DQUA 2VXDA 4AIKA 2IW5A 1U9OA 3TQNA 1JHHA 1XCVA 3GMEA 4IVNA 1W0TA 4YIIA 1VQLI 1FEXA 3F8MA 2DMNA 4EGYA 1KYWA 1VQNI 4LIVA 1YJNI 3PQKA 2HI3A 2CUFA 2NRAC 2R7TA 3H0DA 3I4MJ 5E8GA 2Y48A 2ZSIB 2DU9A 2EFQA 4X1EA 3WTVC 3QYFA 4PZJA 2IP2A 5E79C 4ZH4F 3LA7A 5JVTA 4GO1A 2CO5A 3C2HA 3V8KA 3QOEA 2KHMA 4Y52J 3EETA 3S1QJ 5IYDJ 3QP6A 4AUXA 4FX0A 2RN7A 2BYVE 4XNFA 4QPOA 2HVSA 2EQRA 2A5WA 3G2BA 3LSKA 2HPMA 2UUZA 2M4GA 2R5YB 3C2BA 2LBFB 2KZVA 4A6DA 2NOGA 3Q9SA 4NUBA 2L9VA 2EZHA 1F4KA 1ONVA 2HYGD 5IY5H 4XN0A 2VT2A 1M1EB 5IP7J 2CJJA 5K7FA 2F5CA 2Z33A 3TP0A 3L7WA 1YJWI 1SD4A 2OA4A 3OYBA 1Y0NA 3SDBA 2DQLA 1IF1A 1X19A 1RKTA 1KA8A 1Y1VJ 4B4CA 5K7ZA 4UUSB 4NC8A 2JA6J 1PUEE 2M7AA
chains in the Genus database with same CATH topology
2VJ4A 2R7SA 3RSNA 4YRVA 2VQLA 4XLHA 3DKXA 3RQ4A 3UR3C 4BE1A 2F6CA 5HNFA 4XKBA 5CQGA 2V9KA 3OYHA 4RLQA 3MKWB 3OS0A 2M4KA 4E7HA 5HNHA 1N77A 3K4LA 3FKJA 2L5QA 3A1YA 4PFOA 4RM2A 2UV1A 3CP8A 4XOPA 3IAS2 3VYTB 2X85A 2F4IA 1UAAA 1EA3A 3BG7A 2L7KA 3N05A 2X6YA 3PSIA 4D1QA 3OMYA 3K4NA 3HXLA 2CMPA 3OYKA 3HOSA 2NOJB 2R7WA 4ZDPA 2WY7Q 3MMYB 3VSLA 2M0MA 4XKVA 2CW8A 2HU9A 4HEA2 4BQNA 2IGOA 2Y0SA 3LSMA 1AA7A 5KCMA 1Y6IA 2FUG2 4J01A 4E7JA 2E5NA 3E0JB 1D1CA 4F52A 1FMWA 2R7RA 3OYDA 2VASA 3W3CA 2I8DA 4HG2A 3S3OA 2E1MC 3LSIA 3FHNA 4KT6A 4CCJA 2L9SA 3DU6A 3QYEA 4CUGA 4OAZA 3OIPA 4ZYAA 2IXSA 3FBIB 4XM3A 3ZXSA 3HPHA 1KONA 3OS1A 1W36C 1K6YA 4KJZA 2CH0A 2L9NA 3CMMA 3DLAA 1WJEA 4XOTA 4PK4A 1TZLA 2WADA 2M3AA 3MD2A 4PJMA 2Q1ZB 3H9QA 4XL9A 3L2WA 2MYSA 2M7BA 4ZJZA 1W36D 1N75A 3OY9A 1BR4A 2XSJC 2QKLB 2W82A 4C9YA 3MKZA 1QHGA 3W2AA 5FRNA 2OV7A 4EATA 3ZCOA 3OWTA 3DPTA 4AVZA 3L2UA 3L2VA 3BCBA 4BU2A 2KLOA 2DXIA 2X1EA 2X1DA 3LL7A 4F93B 2V6EA 2DOAA 3DU5A 2ZSHB 2V7FA 3D5LA 3OYLA 2ZFUA 1TT0A 3KYLA 4XLFA 3OYCA 3AKZA 2JVGA 4DJAA 2WB1A 1Z3YA 3M8JA 3H35A 3CF2A 2BOLA 2IGMA 3V42A 2LY1A 4F92B 3DPUA 4PJNA 1V5GA 1YE9A 3OOUA 3H5NA 2VQCA 4NC7A 1PJRA 3PNYA 2GOMA 3RCOA 3F9KA 1LVKA 3EUKL 2AQFA 4XLEA 4JQFA 4OAYA 2IGKA 2KDOA 4Y3OA 4HSTA 4PSXA 3K10A 2KPMA 3AL0B 3RPUD 4XONA 3S3MA 2P0WA 4F91B 2WA0A 2DT7B 4ZC3A 3DEEA 4LG3A 4XQFA 3AFHA 2DJIA 1OR7C 4B48A 4C30A 1DGWY 3S93A 1JI8A 1ERDA 4E7SA 2MC4A 1SAUA 3EUHC 2IGNA 2CW7A 2QKMB 3BLYA 3LFUA 4U87A 3OYGA 4IX7A 3VWBA 1E0EA 4G6TB 3OIQA 4CCLA 3PNVA 3K4BA 2LOOA 2VJ5A 3HC7A 1QU3A 2X6WA 2GOXB 4XLCA 2W1OA 3K4MA 1QHHD 4ITVA 2IS6A 4CCNA 2W4SA 1T95A 2VPLA 3S32A 4E7LA 2R7XA 4BL0B 5JHFA 3SEQA 4QPQA 4BACA 4XN3A 2Z1DA 1BR2A 1D0XA 2RQQA 1P9QC 1WJFA 2Z2SB 4YELA 4F3QA 2VKHA 2PJRA 1S9HA 4Y4RA 2CV2A 3D5SC 4XKCA 4HNTA 1G8XA 1WJ5A 3CP2A 1OLTA 3SEZA 2WAEA 2XC7A 4P1WA 4ANJA 3OR2C 2X51A 4ZTJA 2JVHA 1R6RA 3VYRB 4BDZA 3KX2A 4BJTA 2ZXIA 2O5RA 4LIUA 2IS1A 4BDYA 3OYJA 2V1NA 2X1CA 4BQQA 4F55A 4D9JA 3M1CA 3NWSA 2WAFA 1V5FA 4XMYA 2XF7A 2XDVA 3DTEA 3OL4A 3HL2A 3QODA 3D5RC 2X6XA 3BG6A 2LG4A 4LITA 2AQEA 3C2GA 2IS4A 2E5ZA 3BC8A 1PYVA 5CQEA 2VL8A 1D1BA 2VQHA 1MMGA 4BGDA 2UWMA 4FASD 2OC6A 2CS3A 1VZ0A 2DCEA 3DWLE 4U7BA 4E7ZA 1WJBA 4HPQA 3H9JA 4IKFA 2LY2A 1Z21A 1FMVA 2VQGA 2MFZA 4NQWB 1WJDA 3QYBA 3HKZA 3HOTA 3TBIA 2WY8Q 4FETA 2K9LA 2XF6A 3W2VA 4BEHA 2V26A 1BR1A 3I9V2 3IAM2 3TL4X 1D0ZA 3OYFA 2VIXA 1N78A 2LH9A 3E1SA 4E7KA 4N4NB 4IQJA 5HOOA 3OL3A 4B43A 1X4PA 2E1MB 3H5RA 1NG7A 3OYAA 4BE2A 3K4JA 4KISA 1Z7LA 3DKYA 5KHDA 3PSFA 3EUAA 3S3NA 2VXZA 2R4GA 2KL4A 4ZDLA 3PNTA 4C2UA 1DGRM 4AYBA 4JOMA 5FRMA 4PJLA 4HRIA 2JSPA 2LRDA 3OYNA 1WFXA 3L2RA 1GLNA 3FDYA 3DTKA 3PL8A 4XORA 3CZ6A 3LSHA 4GRIA 2JUGA 2PJRB 3PJRA 1SFKA 2W7NA 1LDKB 4OWRB 5HLTA 1V5EA 2KMUA 2BVMA 2BVLA 4CCMA 2OUMA 1UELB 4DIQA 2KRCA 2LBFA 2HVRA 4MLOA 2MABA 4IQ4A 3NWTA 4N4OB 1X1CA 2BW3B 3ZRGA 2K5CA 5LFAA 4PUSA 3K70C 4E7IA 1U0JA 4C2TA 1MMDA 4BQOA 1ZELA 2R7OA 1D0YA 3CESA 4BS9A 4BJ6C 5LD2C 3GBGA 1MMAA 2HZDA 1MNDA 2A6TA 2KQRA 3HG9A 4CCKA 1X1DA 2VKDA 4XKWA 3U21A 2W00A 3TMOA 2LREA 4HNUA 4CZCA 2E60A 4BE0A 3W2WA 2HNHA 3OYEA 2HVQA 3L2QA 3K70D 2KRHA 4DBRA 2ZXHA 4ZTFA 2F5VA 3EPZA 5HVQC 4ZDOA 3RTRA 1IRXA 1HA8A 4XR6A 1WJAA 3K4KA 1LFPA 2BW3A 3K4CA 2PMZA 5KNLA 4CCOA 3MKYB 4YEJA 5FROA 4RMNA 1Y56A 3ZGKA 1Z3XA 3HUGB 2R7UA 2R7VA 2IS2A 2R7QA 3DPLC 4HSRA 4KITB 3LMMA 1UG0A 3I3LA 3PUBA 2CV0A 1NG6A 4IZZA 3H9GA 4H4KC 1J09A 4P5OA 4B3XA 4XLAA 1YX5A 1WJCA 4NNJA 3ZR8X 3OS2A 2WAQA 2HDWA 3DTIA 2LC2A 4BEHB 3AL0C 3SZGA 4CH7A 1MMNA 3CJQB 4II3A 3H5AA 3OYIA 3HPGA 2CUZA 2LYCA 3A2KA 3OYMA 4II2A 3VDXA 2MD0A 3LSGA 4PSWA 1D1AA 3A4CA 4DOZA 5CKTA 3CJRB 3IUOA 3ZQQA 4DBQA 1T0FC 2K3PA 4RLFA 1DQUA 2VXDA 4DGWB 1X4OA 2DT6A 3ONQA 3SYTA 3OR1C 2VB6A 2HPIA 4LIVA 4X0GA 2XAUA 3UNGC 2CV1A 2R7TA 3H0DA 3PFYA 4Y33A 2VJJA 2ZSIB 4PFPA 4B44A 3QYFA 3VYUB 1YX3A 1BOBA 2HQAA 4J00A 3C2HA 3QOEA 2KP6A 4AU7A 2KHMA 3VYSB 4PJJA 4E6KG 4XNFA 4QPOA 3K6GA 4E4HA 2HVSA 2RNGA 3G2BA 2A5WA 1MW7A 2ELJA 4CA0A 3LSKA 2HPMA 2UUZA 2M4GA 4BJ5C 3KEYA 1LKXA 2LBFB 3BCAA 3VSKA 4BUPA 4CSWA 1X1BA 2K9MA 2KZVA 4NUBA 5TGTA 4R79A 2RREA 2CUJA 4XN0A 3J7AY 2VJIA 2CFOA 2WBMA 4BXFA 1G59A 2L2OA 2JA2A 2Q2EB 3FBNB 3IP4B 1MNEA 3DQVC 3OYBA 3SDBA 1X19A 2XF5A 2VLAA 2Z16A 5CPRB 2V4JC 1DP3A 3S8PA 1X1AA 4NC8A 4B47A 4RM3A 2M7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOE A;  4YRV A;  4HRI A;  4J01 A;  4IZZ A;  4J00 A;  3QOD A; 
#chains in the Genus database with same CATH topology
 5B66 C;  2VJ4 A;  1BI0 A;  1U5T B;  2E7X A;  4N9H A;  3RSN A;  1S7A A;  3BPX A;  1TTY A;  2F5E A;  4CYC B;  3DKX A;  3KP4 A;  4BE1 A;  2F6C A;  2HZT A;  3J7A O;  3OYH A;  2HYJ A;  3OS0 A;  1I3Q J;  3ECO A;  1IRZ A;  1N77 A;  3K4L A;  2A05 A;  3FKJ A;  2DDA A;  2GXA A;  2K3F A;  4XOP A;  2EIJ H;  2IA2 A;  1H88 C;  1LE8 B;  1UAA A;  2ZME A;  5D6E A;  1O57 A;  3F8C A;  3BG7 A;  1ZRE A;  2IRF G;  1TWA J;  2L7K A;  4RB1 A;  2A5Y B;  2JSC A;  2WB1 N;  2YU3 A;  4IEJ A;  4BQA A;  3K4N A;  1ZRF A;  1JT6 A;  4C3J J;  3OYK A;  4JBA A;  4RB0 A;  1DU6 A;  2IA1 A;  2EH3 A;  3IWF A;  2EV6 A;  1FNN A;  3I54 A;  1TQP A;  4HF0 A;  1ZGJ A;  3BOQ A;  3B73 A;  3H3U A;  3HOU J;  1OKR A;  1U6G A;  5C4J J;  2IGO A;  2Z99 A;  3LSM A;  1AA7 A;  3ROU A;  1FSH A;  1R23 A;  2E5N A;  5F6F A;  3U2R A;  3E0J B;  1D1C A;  1B9M A;  3OYD A;  1JKQ C;  5E20 A;  1PUF B;  1ZN2 A;  2E2H J;  1Y1W J;  4HG2 A;  4P55 A;  3LSI A;  1HKT A;  3BWG A;  2L9S A;  3QYE A;  1XX5 A;  4OAZ A;  5LLQ A;  3HJE A;  3OIP A;  2IXS A;  3MWM A;  4KIC A;  3ZXS A;  1W36 C;  1KON A;  2M8E A;  5HDK A;  2P7V B;  4HV5 A;  1QZZ A;  2L9N A;  1FIA A;  2HKX A;  2DMU A;  3ZN1 A;  2XGD A;  3AG2 H;  3JCU C;  3HOY J;  5BPI A;  2M3A A;  4Z6Y A;  2W85 A;  1ZG3 A;  2ME6 A;  1RUN A;  1MZB A;  1YG2 A;  4BAY A;  2NYX A;  1MSE C;  5DDG A;  4FT8 A;  4HV6 A;  2FXA A;  4D5C A;  4DQ2 A;  3DFG A;  3KYC B;  1I3A A;  3CUQ B;  3IH3 A;  2PBI A;  1MBF A;  3CDL A;  1EJ9 A;  2OTJ I;  5FRN A;  2OZU A;  1MJB A;  2P5V A;  1O4X A;  3ABM H;  3QU6 A;  1ZGA A;  4WXD A;  2X1D A;  4V2F A;  4CDG A;  1P92 A;  1U9N A;  4OIQ F;  4I02 A;  4YFK F;  2V7F A;  4KN4 X;  3JRA A;  2LF7 A;  5ILU A;  4XLF A;  1TQI A;  3BZC A;  1S29 A;  2FML A;  3AKZ A;  2FX0 A;  1IN8 A;  5ED4 A;  3DCF A;  2QSG X;  3H3V K;  2LP0 A;  1BI2 A;  2QCO A;  4EVI A;  1YYV A;  1ETQ A;  1K83 J;  1E17 A;  5IOY A;  5ILV A;  4XRF A;  3LSJ A;  3PNY A;  5B3S H;  1A31 A;  1GVJ A;  4MFE A;  2GOM A;  4IHV A;  3A01 B;  4XLE A;  1RC9 A;  4OAY A;  5J8F A;  2DI3 A;  2IGK A;  3GTG J;  2FNA A;  2K4B A;  3A0B C;  4MEX F;  1G3S A;  5E1W A;  4LJZ F;  2KPM A;  2A07 F;  4M3B A;  4A12 A;  4OIP F;  3S3M A;  2QLZ A;  2VC0 A;  2WA0 A;  3B6C A;  1HST A;  4KA4 A;  4XQF A;  4I76 A;  2EWN A;  2DJI A;  5LGN A;  2ZCW A;  1WI3 A;  3S93 A;  1ZRD A;  1ERD A;  4HF2 A;  4E7S A;  1SAU A;  3EUH C;  5GPA A;  2QKM B;  1APL C;  3PUF A;  1HDP A;  2FRH A;  2E34 A;  2NVX J;  4O6J A;  4ESB A;  2K9N A;  3K4B A;  2LOO A;  3S2D J;  2VJ5 A;  4M3G A;  2Y75 A;  3ABU A;  2XGC A;  4JK1 X;  4R1H A;  5EGO A;  1QHH D;  2IA0 A;  4M74 A;  5F04 A;  2KJC A;  4OIN F;  3M8E A;  4IO9 F;  2L54 A;  1CF7 B;  4FTH A;  1T6S A;  1VND A;  2VPL A;  4BL0 B;  3F21 A;  5JHF A;  2VBY A;  1D3Y A;  2A3S A;  2ZJR F;  2X6O A;  2HR3 A;  3FXJ A;  1TC3 C;  3GTM J;  1XGO A;  3R0A A;  4YEL A;  2VKH A;  4XSX F;  1ZLK A;  2PJR A;  4K2E A;  2CV2 A;  4D7N A;  4XLP F;  3WG9 A;  1I5Z A;  3CP2 A;  2KDZ A;  4G7H F;  1IDY A;  2FF4 A;  4FX4 A;  1B1B A;  4QSH A;  4G8X A;  3LFK A;  2NNN A;  2EBI A;  3TED A;  2FQ3 A;  1VQ6 I;  4L5J A;  1YIO A;  1FYM A;  3W6V A;  2ZJ2 A;  4BDY A;  3OYJ A;  4XLN F;  2ACJ A;  3HOV J;  4IHS A;  4HA8 A;  5EYR A;  1JJ8 C;  3RPU A;  2XKO A;  3V8J A;  2XF7 A;  2F5F A;  3QOP A;  2XDV A;  5A2Q K;  1Z9C A;  3I59 B;  1LVA A;  3QOD A;  3D5R C;  2L0K A;  2JK3 A;  3BR1 A;  2CYY A;  5FKK A;  3MFK A;  1Z1D A;  2AQE A;  1HF0 A;  3C2G A;  4LLL A;  5IT9 Z;  3BC8 A;  5K7H A;  4IRH A;  3OV8 A;  5JLX A;  1PYV A;  2ZME C;  3B02 A;  4L9V A;  3PIO F;  3CDH A;  3MQ0 A;  2YS9 A;  1W1W E;  2LLK A;  2XAH A;  3L9F A;  4BGD A;  1MSF C;  1X3Z B;  2UWM A;  1OCO H;  3ZQH A;  1GHC A;  1XMK A;  2CS3 A;  5FLM J;  3NAR A;  4KIF A;  4U7B A;  1TL8 A;  1WJB A;  3HUG A;  3P9I A;  2ESN A;  2L01 A;  1IW7 F;  1FMV A;  4NQW B;  5JHU A;  3QYB A;  2L4A A;  4IXA A;  3HOT A;  4HX7 A;  5CVU A;  4BHP A;  4I98 B;  4HAM A;  3E97 A;  3IKT A;  2P7C B;  2GBY A;  3RKY A;  3PFI A;  4CXF A;  2LH9 A;  3DEU A;  1XPX A;  4M3E A;  4NB5 A;  4N4N B;  2BE5 F;  2QM3 A;  5HOO A;  2Y0S N;  1O3T A;  1X4P A;  2M87 A;  3H5R A;  1NG7 A;  1YLF A;  5IYC J;  2A6E F;  3K4J A;  2XHK A;  4KIS A;  2H09 A;  1RKW A;  5B1A H;  3S3N A;  3SQN A;  3ZPL A;  3DKW A;  1TWC J;  3PNT A;  2LVS A;  5FRM A;  2AXT C;  3H0G J;  3LAP A;  3T5X A;  3CF5 F;  2DBB A;  3EDP A;  1BL0 A;  2P81 A;  1WFX A;  2UXX A;  3OYN A;  3L2R A;  2EZI A;  4AID A;  4MFD A;  3DTK A;  3KLN A;  5HLI A;  2RDP A;  5BOX A;  5TIS C;  2GXG A;  4KDP A;  3PO3 J;  1HW1 A;  5L3B A;  1MBE A;  2R5Z B;  1HLV A;  1QA6 A;  1Z6R A;  1MGT A;  1A5J A;  1I1S A;  4OWR B;  4HW0 A;  5HLT A;  3DBH B;  2GIZ A;  4XRM A;  4DNC A;  2X48 A;  2HVR A;  1GV2 A;  2M1B A;  4HZF A;  2IAI A;  2MAB A;  3HRM A;  3ZMU A;  3E5Q A;  4N4O B;  4LLN A;  4YFN F;  2K5C A;  4XRS A;  4IHX A;  2EA2 A;  4PUS A;  5LFA A;  3K70 C;  2L4M A;  3TDZ C;  3V7S A;  1KU7 A;  2GXB A;  1U0J A;  1WRJ A;  2XRN A;  1UJ8 A;  3AAF A;  1MMD A;  2GIV A;  3CES A;  3QAH A;  4BJ6 C;  3FXO A;  1UZC A;  3M1E A;  4KIG A;  1LQ1 A;  1MND A;  3T1B A;  2GZW A;  4CCK A;  1A6Q A;  1X1D A;  4ZYH A;  2P4W A;  2Z5U A;  5FKN A;  2PLY A;  2W00 A;  4BY7 J;  3WTW C;  1VI0 A;  2QF7 A;  3S2H J;  2XB0 X;  3W6J B;  2HVQ A;  5CVV A;  5KAF C;  3PO2 J;  5B1B H;  1XGM A;  2A68 F;  3OOP A;  3EPZ A;  3REO A;  4ZTF A;  1V54 H;  1IRX A;  5LRS A;  4ZDO A;  1KZH A;  5CVI A;  2E1N A;  1SEU A;  1YRN B;  1B4A A;  1BIA A;  1LFP A;  3MVP A;  1LFB A;  1K4T A;  4RMN A;  4LK0 F;  5DCF A;  4F7Z A;  1GXP A;  1S8N A;  2QGU A;  3S1R J;  2O8K A;  1I1G A;  3LMM A;  3LSR A;  5F0F A;  1XSV A;  1IRG A;  2CV0 A;  4C2M J;  4Z2Y A;  2D1V A;  1Z05 A;  3LA2 A;  2XIG A;  1RES A;  3U1D A;  1YX5 A;  1E2X A;  1WJC A;  4NNJ A;  5F08 A;  1IV8 A;  3JTG A;  1J9I A;  3R6S A;  3AL0 C;  4CH7 A;  1MMN A;  2JJ7 A;  3BQZ A;  2MG4 A;  3OIO A;  3RIR A;  1X2M A;  2LYC A;  1GV5 A;  1VQ8 I;  3VDX A;  3P9K A;  5D5W B;  3CJR B;  2CRG A;  4DBQ A;  3U9G A;  1R5I D;  1P4W A;  3ZOB A;  1ITY A;  2AXL A;  4RLF A;  4EMS A;  5GAG J;  4KMU X;  2NVT J;  4DGW B;  2DK5 A;  1SFO J;  1YIJ I;  1OYI A;  1H8A C;  2VB6 A;  5F27 A;  2MC3 A;  3ZQF A;  4EM1 A;  4A3I J;  3WTZ A;  1FJL A;  3BPV A;  1ZTR A;  1JKP C;  1Q1H A;  3E5U A;  5E3L A;  1IV6 A;  2BY3 A;  2JMW A;  1R49 A;  2COB A;  2XSD C;  1T98 A;  3CQZ J;  3R60 A;  2KIF A;  4Y33 A;  4XK4 A;  4ZYG A;  3F6V A;  4PFP A;  3ZQI A;  2XGE A;  3HOW J;  4J19 A;  2NVU B;  3VYU B;  1YX3 A;  2FOK A;  4J00 A;  3AG3 H;  5KVR A;  4A3C J;  2RGV A;  3I64 A;  4ON0 A;  3JSO A;  4I09 A;  2FEZ A;  4E6K G;  1BW6 A;  1S3J A;  2RNG A;  1ZH5 A;  2FD5 A;  2VUM J;  1BA5 A;  3WTY C;  1LKX A;  4A5M A;  2K9M A;  5EF6 A;  2EV0 A;  1HSJ A;  5D4S A;  4V19 K;  3CCY A;  1IRF A;  3J7A Y;  2Q0O A;  2CFO A;  2L2O A;  2Q2E B;  3FBN B;  1XMX A;  1VQP I;  1MNE A;  1ON2 A;  2CGP A;  5E3O A;  4BHC A;  3FHZ A;  3DQV C;  3ABT A;  3HYI A;  1W7P A;  3SHF A;  3I4N J;  2Z16 A;  1OYY A;  2V1U A;  4D5F A;  4BNC A;  1DP3 A;  1VF9 A;  3S8P A;  5GAH J;  4B47 A;  3V7C A;  1FBU A;  2R7S A;  3TO7 A;  3M3Y J;  1BM9 A;  4LD5 A;  3JRF A;  3RQ4 A;  3UR3 C;  2OPT A;  1RRJ A;  5HNF A;  1L3L A;  3MKW B;  4XBF A;  2M4K A;  2XAF A;  3RZO J;  5E3M A;  1IGN A;  3FM3 A;  1O3Q A;  5KAI C;  3A1Y A;  2CQ7 A;  4PFO A;  1WH7 A;  2LFB A;  2UV1 A;  2XB5 A;  3IAS 2;  1YO5 C;  4RAY A;  3WHC A;  1RUO A;  1IXC A;  1EA3 A;  4M6X A;  2RC4 A;  3N05 A;  5LEK A;  3WGI A;  3PSI A;  4UVB A;  3TGN A;  5K1Y A;  1OCZ H;  2OJE D;  3SZT A;  1HBX G;  3MAJ A;  2XVC A;  2CMP A;  2DOE A;  3HOS A;  2NOJ B;  2R7W A;  2P5K A;  3GFL A;  2WY7 Q;  2PMH A;  3MMY B;  4OIR F;  1YOV B;  2A61 A;  2JA5 J;  3VSL A;  4XKV A;  2QQ8 A;  5BMZ A;  2Y0S A;  5J40 A;  4A0Z A;  5KCM A;  2H6B A;  4Y15 A;  3KP3 A;  5BPD A;  2WV0 A;  1B6A A;  2R7R A;  2VAS A;  2H1L A;  3ERM A;  5BQT A;  4JX6 A;  3J81 Z;  3QU3 A;  2EZL A;  5FB2 A;  2E1M C;  1T08 B;  3FHN A;  4CCJ A;  1R1V A;  3DU6 A;  3JW4 A;  4CUG A;  4L5E A;  4A3B J;  2FMY A;  1SMY F;  5ICE A;  3RJP A;  2JT1 A;  4ENM A;  2DDB A;  1U2W A;  1K4S A;  2B9S A;  1FOY A;  4LG0 A;  2M2E A;  1B8I B;  2M30 A;  1MJA A;  3IC7 A;  1MIJ A;  2F2E A;  2LDU A;  2O0Y A;  2H8W A;  1J5Y A;  2YU9 J;  2QWW A;  3ABL H;  1TQM A;  2EFO A;  2RV8 A;  5HDN A;  4W1U A;  1XN7 A;  1W36 D;  1JKO C;  1NH3 A;  3CCS I;  3J80 K;  4RAZ A;  2ZXJ A;  5EG0 A;  4AIJ A;  1BR4 A;  1NHA A;  3UKG A;  1WH5 A;  1K78 A;  2QKL B;  5H6Q A;  1MDM B;  1JGG A;  4OOI A;  3DF8 A;  2QQB A;  4AVZ A;  3L2U A;  3C7J A;  3MEX A;  4QWQ A;  4BU2 A;  2IEK A;  2XRO A;  2DXI A;  1ZR4 A;  4L0Y B;  2X1E A;  2QEX I;  3LL7 A;  3I0T A;  2STT A;  1XMA A;  2V6E A;  3DU5 A;  3SFZ A;  3OYL A;  4GXO A;  2ZFU A;  3O6B B;  4P9F A;  4IRG A;  4EM2 A;  3OYC A;  3GO5 A;  1G2H A;  5K5O A;  2BOL A;  3IHU A;  1P4A A;  5AON A;  2LY1 A;  3DPU A;  1TLH B;  4OIO F;  2H27 A;  1DUX C;  1WWX A;  5FKM A;  1ZR2 A;  3RCO A;  2CSO A;  3F9K A;  3JRC A;  1YIT I;  1LVK A;  2AQF A;  3MCZ A;  1MKM A;  4JQF A;  1ON1 A;  3QRF F;  2M0C A;  3LWF A;  5LRR A;  2Y31 A;  1VQ9 I;  3AG1 H;  1OCR H;  2DA2 A;  3I4P A;  4XSZ F;  1K7A A;  3TO9 A;  4Y3O A;  3PM1 A;  3AL0 B;  3KYD B;  3CCL I;  3FK6 A;  5EGO B;  3KEO A;  5FGM A;  3T8T A;  5FKL A;  3DEE A;  4LG3 A;  3GLL A;  3HRU A;  4B48 A;  6PAX A;  4MO7 A;  3FF5 A;  4M6Y A;  3JRE A;  3QQA A;  1Z77 A;  1JGS A;  2MC4 A;  4W97 A;  5K5R A;  1WSU A;  2CW7 A;  1ZGW A;  3LFU A;  4PDK A;  3OYG A;  2VE9 A;  1BC7 C;  1FOX A;  4DYC A;  2OBP A;  4UXN A;  5L3C A;  3GWZ A;  2TCT A;  1CGP A;  3PNV A;  2P5L C;  1B72 B;  4EJT A;  4CZZ A;  2XPW A;  2VOP A;  1YJ9 I;  1AHD P;  2W1O A;  4S05 A;  4ZYD A;  1KYZ A;  2IS6 A;  2ID3 A;  3S2W A;  2DOD A;  1T56 A;  3FKI J;  4G6Q A;  3L00 A;  3U1K A;  1VQ7 I;  2ADU A;  3CTA A;  3S32 A;  3HTU A;  2BV6 A;  4E7L A;  1WCM J;  3IL2 A;  3ZN0 A;  2EV5 A;  4CYD A;  4I6Z A;  4QPQ A;  2Z1D A;  3M07 A;  1V4R A;  4RAF A;  1D0X A;  2RQQ A;  3ASO H;  2QSF X;  1TNS A;  2RAE A;  3HSE A;  3QPT A;  3SXY A;  3C3W A;  1F9N A;  1S9H A;  3WE2 A;  1XG1 A;  4JP0 A;  4XKC A;  1BJZ A;  2HS5 A;  3FXK A;  2W57 A;  2KIS A;  2L7Z A;  5GTI C;  3CC4 I;  3VB2 A;  2ID6 A;  1OLT A;  3SEZ A;  3CCM I;  1XD7 A;  2Y2Z A;  3KFW X;  4I2O A;  4ZTJ A;  3SZP A;  4U7D A;  4L5I A;  2HOE A;  1R6R A;  3IH2 A;  5F1R A;  3MZH A;  2ZXI A;  1IN6 A;  2A6H F;  2O5R A;  4MHG A;  3GFJ A;  1O3S A;  2V1N A;  2X1C A;  4BQQ A;  1HDD C;  4AM3 A;  3BG5 A;  4D9J A;  1LEB A;  2HFH A;  1OFC X;  5JVG F;  4A3J J;  2I5U A;  3HL2 A;  3IWZ A;  1QNT A;  3O8G A;  2M34 A;  3ZP5 A;  2X6X A;  2LG4 A;  3KE2 A;  3MN2 A;  1HOM A;  3ESW B;  4O3M A;  4A3F J;  1R5G A;  3DXJ F;  3F3X A;  2E5Z A;  1P4X A;  4G94 A;  4UV9 A;  1FYK A;  5GAD J;  3GTK J;  1R00 A;  4WWC A;  2DAO A;  2XAJ A;  1HKQ A;  4I01 A;  4P9U A;  4LB6 B;  2VL8 A;  3C1D A;  1D1B A;  2VQH A;  1HKS A;  2E19 A;  3GXO A;  3LAJ A;  2NS7 A;  2FU4 A;  1P7I A;  3CMY A;  3R0J A;  4FAS D;  4RA2 A;  2LY9 A;  1OQY A;  4RGU A;  2E1C A;  3F8F A;  3CD6 I;  3N4M A;  4E7Z A;  1UG2 A;  3EYI A;  1VTN C;  1U8B A;  2VBZ A;  2XAQ A;  2Z3Y A;  2LY2 A;  1Z21 A;  1DU0 A;  1KGS A;  1GUU A;  4S04 A;  2QEN A;  3BY6 A;  5H6R A;  3HKZ A;  2VOO A;  3BG9 A;  2R0Q C;  3JAM Z;  3GW2 A;  3LNQ A;  3FXR A;  3T8R A;  4BEH A;  2V26 A;  5ERI A;  1YFH A;  2L7M P;  3I9V 2;  3KPH A;  2JPC A;  1ZQ3 P;  3TL4 X;  4EJU A;  3ZMT A;  1BBY A;  3E1S A;  1MBG A;  3OL3 A;  2ZO4 A;  4BY1 J;  5HS9 A;  5IT3 A;  2E1M B;  4AD9 A;  2LMD A;  3GFI A;  1I6H J;  4D7M A;  3OYA A;  2QBY B;  2CQQ A;  1Z7L A;  3BJA A;  1D8J A;  5DM6 F;  5CJ9 A;  3E3V A;  2JTV A;  2LKP A;  3G1L A;  1WQ2 A;  3IH4 A;  4NBQ A;  3HSR A;  3WU0 A;  4BH9 A;  2R4G A;  2FNP A;  3CUO A;  1F43 A;  2KL4 A;  2OF7 A;  1KQ0 A;  2EIM H;  2LK2 A;  3CCE I;  1ZAR A;  2EIN H;  4PJL A;  3FXQ A;  1XCB A;  4I0A A;  4ENK A;  1GLN A;  2XAG A;  3BJ6 A;  3GTO J;  1R4M B;  3PL8 A;  4XOR A;  4GRI A;  1IDZ A;  3RPQ A;  1ETY A;  2DN0 A;  1DDN A;  2LD5 A;  5FLV A;  1FZP B;  3PJR A;  1T8I A;  1LDK B;  4BBR J;  1XB4 A;  2V79 A;  2BVM A;  5BS6 A;  1UEL B;  2DLL A;  2R5Y A;  1JTX A;  1ZKG A;  2TRT A;  2LBF A;  1JTY A;  3KLO A;  4U0W A;  2PX9 A;  1XDS A;  2CQN A;  2FE3 A;  5DEQ A;  1S5L C;  4RGR A;  2MLG A;  1T33 A;  1FPQ A;  5D5V B;  2G7U A;  4M3F A;  2N8G A;  1TW3 A;  4B09 A;  1UCR A;  4MNU A;  1SD6 A;  2H1K A;  3HGG A;  3GTJ J;  3TOB A;  1XGN A;  2VKD A;  4HQM A;  2HQR A;  4WK8 F;  1AKH B;  4UUS A;  3U21 A;  4ESJ A;  1X1P A;  3HEF A;  1SD7 A;  1U5T A;  3ZQG A;  2ZNY A;  2JUC A;  1U8R A;  2HNH A;  3OYE A;  4CYC A;  3H1C A;  3L2Q A;  3K70 D;  3JRB A;  2CG4 A;  2ZXH A;  2COM A;  2F5V A;  5HVQ C;  3F8B A;  1WJA A;  5ICC A;  2AS5 F;  1JHF A;  3K4K A;  3K4C A;  4PJ0 C;  2VBW A;  3K2Z A;  1H9G A;  5FRO A;  1S7E A;  1P6R A;  1QGP A;  3RI4 A;  4A69 C;  3ZGK A;  1S6L A;  3BTC A;  1LE8 A;  3K1P A;  3WGG A;  2IS2 A;  2E71 A;  4HSR A;  4ZZD A;  1PVE A;  1FTZ A;  5FLX Z;  1NG6 A;  5GAE J;  3E6C C;  3CO7 C;  1O7F A;  5IPA A;  2HQN A;  2QQ9 A;  4H4K C;  2ZNZ A;  1UHW A;  3HGY A;  4P5O A;  2CQX A;  4B3X A;  4JX4 A;  5LGU A;  3ZR8 X;  5DUK A;  3HBL A;  5FFX A;  3JRH A;  3VOD A;  5J47 A;  4II3 A;  3RDI A;  2MD5 A;  5JR3 A;  4ZYE A;  2DK8 A;  5DD8 A;  2IJL A;  3HZJ A;  2MD0 A;  1YI2 I;  2HTS A;  3ZQQ A;  1W5C C;  2ZJP F;  4Y7N J;  2GLO A;  2OU2 A;  3KZY A;  4BHB A;  1X4O A;  2KIM A;  2DT6 A;  5C3E J;  3GLX A;  1RI7 A;  1DPR A;  4HOB A;  1PUF A;  5F64 A;  4AWX B;  3FK7 A;  2VN2 A;  3OR1 C;  3HHH A;  2HPI A;  1RR8 C;  4ENN A;  2L3D A;  3FM5 A;  3VPR A;  1BIB A;  2XAU A;  4GFB A;  2VT3 A;  4M3D A;  1R4N B;  3QPL A;  3RKW A;  4Q5S F;  2VJJ A;  1H0M A;  4YG2 F;  2P8T A;  3WE3 A;  2HQA A;  4Y17 A;  1IJW C;  2KP6 A;  1YW8 A;  3ECH A;  3IKV A;  3LOC A;  4AU7 A;  4B1R A;  5C44 J;  1YHQ I;  1Y0U A;  1FT9 A;  2FJ1 A;  1S7O A;  2DW4 A;  3D0S A;  2OTL I;  3VYS B;  4PJJ A;  2LF8 A;  1GVD A;  3KP5 A;  4GYG A;  3B6A A;  3PIP F;  3K6G A;  2RNJ A;  1J7K A;  1EH7 A;  5DCM B;  2ELJ A;  2VON A;  4BJ5 C;  2EIL H;  3CUQ A;  1QVU A;  4MEY F;  3VSK A;  4BUP A;  4CSW A;  2BZT A;  4EJO A;  1SAN A;  2YX4 A;  1GT0 C;  5TGT A;  1T39 A;  4R79 A;  2RRE A;  1B59 A;  2CUJ A;  1KU3 A;  2VJI A;  2WBM A;  1RNL A;  2PG4 A;  3Q0W A;  4BXF A;  3G73 A;  1SMT A;  3CO6 C;  3DLL F;  3Q0V A;  3LST A;  1TW2 A;  2CQK A;  1A36 A;  2FQ4 A;  2VLA A;  5CPR B;  2W48 A;  1HCR A;  3G4S I;  4CHU A;  1X1A A;  2WTE A;  5IP6 A;  3Q3S A;  1ETW A;  4YRV A;  2VQL A;  4XLH A;  1D8K A;  5M5Y J;  4UUV A;  1QPI A;  2HWV A;  4XKB A;  2V9K A;  4A3E J;  2OAZ A;  5ICG A;  1ACI A;  1QVT A;  5E1Z B;  1CQT A;  3A01 A;  3WTX C;  4UNO A;  3J7Z I;  2L5Q A;  4Q47 A;  2GQQ A;  2V6C A;  4EEF G;  1UST A;  3VYT B;  5BNG A;  2DA1 A;  2X85 A;  4PGH A;  3RKQ A;  2QSH X;  2F4I A;  4RB2 C;  4AVP A;  3JRI A;  5L3F A;  5E17 F;  1UHM A;  3WU2 C;  3CC2 I;  2R7F A;  4N0B A;  4IHW A;  1I50 J;  5HDG A;  2ZFW A;  1USS A;  4UV8 A;  2K7L A;  3HXL A;  3BJO A;  4IJA A;  1A04 A;  5D5U B;  3BTI A;  5F1J A;  2KJB A;  4ZDP A;  3GZ6 A;  2AO9 A;  2BEO A;  1LNW A;  4ASN A;  2K27 A;  3VEP A;  2M0M A;  2CW8 A;  2HU9 A;  3HDD A;  3KP2 A;  4HEA 2;  2E2J J;  4LGW A;  3WGH A;  3KP6 A;  3EYY A;  4J01 A;  4E7J A;  1W4M A;  3GFM A;  1O7L A;  3E6B A;  3QWL A;  2XKP A;  5E1X A;  2F5D A;  4F52 A;  4KYW A;  1JUM A;  5L3G A;  3W3C A;  4IRI A;  2Y69 H;  2I8D A;  5KK1 A;  3E5X A;  2DA4 A;  4FHT A;  5EG0 B;  5IOZ A;  2PEX A;  4KT6 A;  2BY1 A;  5IT9 K;  3I56 I;  3J7Y J;  1CF7 A;  5EEA A;  4ZYA A;  2BHZ A;  3BRO A;  3FBI B;  3LQR A;  3HPH A;  4XM3 A;  4AYB N;  1JUP A;  2IBD A;  4KJZ A;  2RVC A;  2CH0 A;  2GA1 A;  3DLA A;  2DT5 A;  4LMY A;  2LSO A;  4XOT A;  1VQ5 I;  1TZL A;  2WAD A;  1V3F A;  5GP9 A;  2BGC A;  3H9Q A;  2VKE A;  5LGT A;  3GZ5 A;  4GCV A;  3NQO A;  1OJL A;  2EB7 A;  4HX8 A;  4P96 A;  3L2W A;  2R93 J;  4X6A J;  2EPF A;  4M9X A;  3DV8 A;  4KN7 X;  3VFZ A;  2VPR A;  2BXZ A;  9ANT A;  1E3P A;  1F36 A;  3WTS C;  4C9Y A;  4ABZ A;  2OV7 A;  3IRQ A;  3ZCO A;  3DPT A;  1G6N A;  3ZMV A;  3WOD F;  3BCB A;  2KLO A;  3S14 J;  2F4O B;  1PP7 U;  1MJ9 A;  4F93 B;  2TDX A;  5DS9 A;  1FP1 D;  2HKO A;  2DOA A;  1KQ8 A;  4M72 A;  1LDJ A;  3D5L A;  4EJV A;  4A6E A;  3KYL A;  3I59 A;  1ZK8 A;  2B7E A;  2JVG A;  1SC7 A;  2BXY A;  1BOA A;  4LFU A;  4DJA A;  2YR2 A;  4CO8 A;  1Z3Y A;  3BZ6 A;  3CF2 A;  1HW5 A;  1E3H A;  4PJN A;  4AIH A;  1QO0 D;  1YE9 A;  5GPC A;  2FBK A;  3E7L A;  2XAS A;  2VQC A;  1PJR A;  2QQA A;  2JA8 J;  2JWT A;  3KZI C;  2ECB A;  2ZJQ F;  3WU1 B;  3KIO A;  4IHY A;  2PMZ N;  3O3K A;  2MH2 A;  2O8X A;  1U78 A;  2R92 J;  4EJW A;  4NHJ A;  2ZME B;  3MKL A;  1W5S A;  1ZAO A;  4XON A;  4RAG A;  4NQW A;  3GVA A;  2PI0 A;  2DT7 B;  4ZC3 A;  3PQJ A;  1JKR C;  1FC3 A;  4BBS J;  2GM4 A;  4BYY A;  2WAQ N;  4C30 A;  4UVC A;  1JI8 A;  2B63 J;  5DUI A;  4U87 A;  4IX7 A;  1E0E A;  1MBJ A;  3JR9 A;  4HDV A;  5IYB J;  2YSR A;  5HLH A;  3OIQ A;  3NAU A;  4UUT A;  2HDD A;  5M5X J;  1MNM C;  3W6K B;  4EQQ A;  1IXS B;  4FE7 A;  1HQC A;  3HC7 A;  2X6W A;  2GOX B;  4M71 A;  4XLC A;  3ZMZ A;  3HRT A;  3G1O A;  4O5V A;  1KQ9 A;  3HKZ N;  5EDN A;  3GUD A;  3A0H C;  2W4S A;  2PMU A;  2E36 A;  2WC2 A;  1D5Y A;  2DPD A;  1T95 A;  3JRG A;  2DFH A;  2LTP A;  2LR8 A;  4IOC F;  2R7X A;  4MTE A;  4BAC A;  3CUQ C;  3I58 A;  3VOE A;  2O6G E;  2Q8K A;  2Z2S B;  3CLO A;  5M3F J;  4C3H J;  3A03 A;  1R58 A;  3QPH A;  2LKX A;  1SAX A;  2R5Z A;  1ZHF A;  3D5S C;  3HB9 A;  4YIF A;  3GTQ J;  2O61 A;  1TNT A;  4HNT A;  2F4M B;  1WJ5 A;  4P1W A;  1JJ6 C;  1E3O C;  1Z7U A;  3BTJ A;  2JVH A;  5LHH A;  2F48 A;  3VYR B;  2W84 A;  3F8N A;  3KX2 A;  3TDU C;  4BJT A;  1ULY A;  2O03 A;  3E6M A;  1YW7 A;  3DBL B;  1TWF J;  1WPK A;  3GCM A;  3GTL J;  1ZYR F;  3G3Z A;  2FSW A;  1V5F A;  2VOD A;  2PQ8 A;  2DO7 A;  3OL4 A;  1VFC A;  5E8I A;  1OCC H;  1W7P D;  3GF2 A;  3I53 A;  1LB2 A;  4LIT A;  2PN6 A;  2QUF A;  3WHB A;  3IRR A;  1WVR A;  3V7R A;  1POG A;  1SFX A;  1WGX A;  1BJA A;  4HYE A;  3H92 A;  3BZK A;  4A0Y A;  3H36 A;  2VC1 A;  5CQE A;  2E7W A;  1BN5 A;  1R5H A;  2DA5 A;  1MMG A;  1IN5 A;  3F23 A;  1DP7 P;  4IF4 A;  1H89 C;  2VI6 A;  1YRN A;  1F5T A;  2OC6 A;  2DCE A;  2G0E A;  4M9Z A;  3TKY A;  2V1X A;  2JPB A;  3KCC A;  3GYH X;  2VQG A;  4MGR A;  5DTD A;  1WJD A;  3V8L A;  3K2A A;  2HOA A;  3EUH A;  1EKE A;  2JN6 A;  5EZH A;  2VBX A;  1ZG1 A;  2K9L A;  2XF6 A;  1I39 A;  3G1M A;  1ODD A;  2XPU A;  2MH9 A;  3IAM 2;  4DW6 A;  3OYF A;  1WZ2 A;  4L18 B;  1N78 A;  4E7K A;  2L7F P;  4B43 A;  5ICF A;  3ABK H;  2IVM A;  2GWR A;  2KRF A;  1IC8 A;  2MLK A;  1ETK A;  2DMQ A;  5EEG A;  1UHS A;  5E3N A;  4ETS A;  3CMA I;  3PSF A;  1X2N A;  1Q1V A;  2EJR A;  1LDD A;  3EUA A;  1KU2 A;  1J59 A;  4XID A;  3FWE A;  5FD6 A;  3ISP A;  5D8L B;  3RQI A;  5ILS A;  4PGG A;  4ZDL A;  3G71 I;  3CCU I;  4C2U A;  4AYB A;  1TWH J;  1IZ1 A;  4JOM A;  3KEQ A;  2OD5 A;  3X2Q H;  2D45 A;  2LRD A;  5DM7 F;  5J1R A;  3WTT C;  4LOC A;  5CLS A;  3FDY A;  1IAW A;  1T38 A;  1ORK A;  4M73 A;  2M45 A;  4CIC A;  3CZ6 A;  3LSH A;  2JUG A;  1RR7 A;  2JA7 J;  1SVL A;  3BQY A;  2PJR B;  4WXH A;  1OCP A;  2X4H A;  1V5E A;  4CCM A;  2BVL A;  1XC5 A;  2D1H A;  4EM0 B;  5JLW A;  4DIQ A;  5H20 A;  2J5P A;  4DYR A;  2EFP A;  4MLO A;  3TOA A;  1FBQ A;  1BI3 A;  4TV7 A;  4IQ4 A;  5F0H A;  1RET A;  3NWT A;  4EGZ A;  1X1C A;  5H2F C;  2Q2E A;  4NDL A;  3NRV A;  4L9J A;  5J6X A;  3BR3 A;  2NVY J;  1BC8 C;  4C2T A;  4BQO A;  1D0Y A;  4BS9 A;  3S15 J;  1G3W A;  3GBG A;  1MMA A;  3I71 A;  2HZD A;  4WF2 A;  2A6T A;  2KQR A;  3HG9 A;  5DV5 A;  2MA3 A;  2R3S A;  1W0U A;  3S1N J;  3FIW A;  4OMY A;  3P5J A;  5M5W J;  2JQ7 A;  3TMO A;  3J81 K;  3JTH A;  4CZC A;  4BE0 A;  4HQE A;  1L0O C;  5EEH A;  3W2W A;  1HC8 A;  2DFF A;  1PP8 F;  3C18 A;  2KRH A;  3M7G A;  2EK5 A;  4DBR A;  5J4Y A;  1HA8 A;  4XR6 A;  4G7Z F;  1BW5 A;  2BW3 A;  5L3E A;  4UY8 I;  2PMZ A;  4YIR X;  1XSD A;  4WX9 A;  5L3D A;  2ZKZ A;  1SFE A;  1Y56 A;  3D1N I;  1Z3X A;  3HUG B;  3L2C A;  2R7V A;  4DZJ A;  1Y8R B;  2HOT A;  2R7Q A;  1YQA A;  4KIT B;  1FP2 A;  3F6O A;  4PCQ A;  1YS6 A;  4Q4Z F;  4IZZ A;  3H9G A;  2EFN A;  2Y30 A;  2HGC A;  2HTJ A;  4XLA A;  2V1D A;  3ZMD A;  2K02 A;  2WAQ A;  2HDW A;  4OU0 A;  4HBL A;  1ETX A;  2LC2 A;  2XGX A;  2QA4 I;  3CJQ B;  1ZRC A;  4GGG A;  3H5A A;  2CUE A;  3FXM A;  3A2K A;  4II2 A;  1WHU A;  5JI6 A;  5A2Q Z;  1D1A A;  1Y8Q B;  1Z0X A;  4DOZ A;  5CKT A;  3HOX J;  3IUO A;  4KMF A;  1REP C;  2K3P A;  1OR7 A;  4ESF A;  4RB3 C;  4RGS A;  2MSY A;  3ERE D;  3ONQ A;  3SYT A;  1OYW A;  3CME I;  2NS8 A;  1JXS A;  1V55 H;  4X0G A;  1I27 A;  3UNG C;  2WV1 A;  2CV1 A;  2ECC A;  3R61 A;  2ZXW H;  2Z9O A;  2FBH A;  5IP9 J;  1OIS A;  4B8X A;  4L9N A;  3PFY A;  3LQQ A;  1NK2 P;  4B44 A;  1HW2 A;  4A3D J;  1R1T A;  2KIQ A;  2PFB A;  4FQG A;  3ZQ7 A;  1BOB A;  1B8I A;  3ELK A;  1Z67 A;  1G3T A;  4R8H A;  4QIW N;  3L1P A;  2HXI A;  3KZZ A;  4I0B A;  2DYS H;  2K9S A;  2X9D A;  1X58 A;  2MW8 A;  2HYF A;  3BR2 A;  5GTH C;  4E4H A;  3M4O J;  2W25 A;  1MW7 A;  1MD0 A;  1X3U A;  4CA0 A;  3FXU A;  1P2F A;  3KEY A;  3BCA A;  1O3R A;  1X1B A;  2O7O A;  3K69 A;  1TP4 A;  1F1Z A;  1MDM A;  4IPA A;  2OCE A;  1TWG J;  1ZLJ A;  2D5V A;  1G59 A;  5EJC A;  2JA2 A;  2NS0 A;  3IP4 B;  1J0R A;  2Y0M A;  2MBF A;  2K40 A;  3S16 J;  3ZQC A;  1VQ4 I;  1RZ4 A;  1FTT A;  3FMR A;  2G9W A;  2XF5 A;  2KZG A;  2V4J C;  5DD4 A;  3M8F A;  1T2K A;  4BXU A;  3R4K A;  3GTP J;  2JZY A;  2CFX A;  2ZC2 A;  1MBH A;  4RM3 A;  3QPS A;  2L9R A;  1TBX A;  3S17 J;  3FMS A;  2DA7 A;  2ELK A;  1DPU A;  5CQG A;  4RLQ A;  4UB6 C;  1QBJ A;  3EQL F;  5J8C A;  4IOA F;  4DZP A;  4E7H A;  5HNH A;  1UMQ A;  3BP8 A;  1FWZ A;  1FBS A;  2D2W A;  3G6E I;  3H3Z A;  4RM2 A;  3CP8 A;  4JYK A;  2GAU A;  2YX7 A;  3JRD A;  1G3Y A;  2X6Y A;  3BDD A;  4XRS G;  2ZBK A;  4L9T A;  4D1Q A;  3OMY A;  1BI1 A;  5LHI A;  2DFE A;  4HNV A;  1ETO A;  1ETV A;  1RIO H;  3HTS B;  1FOK A;  1IO2 A;  2G7H A;  2P6T A;  2P6S A;  2E2I J;  4FIS A;  4NC6 A;  4BQN A;  4M9S A;  1Y6I A;  3CLQ A;  2FUG 2;  3P7N A;  2DQR A;  4G7O F;  1NK3 P;  2XPV A;  1B72 A;  1FMW A;  1NTC A;  2YPR A;  5D4R A;  2V9V A;  4B3A A;  4M6V A;  1JE8 A;  1VQO I;  3DP7 A;  4UB8 C;  3TW6 A;  3ZMS A;  1ZG5 A;  1LFU P;  2H8R A;  2NVQ J;  3S3O A;  1WI9 A;  2CWE A;  3RYP A;  1AU7 A;  2CU7 A;  2HOS A;  3SDG A;  5HS7 A;  4QTR A;  1FYL A;  4QLC U;  3MZ8 A;  1EH6 A;  4JX5 A;  1FIP A;  3OS1 A;  4LLG F;  2DPU A;  1K6Y A;  3CCR I;  3I55 I;  2DMP A;  3CMM A;  3HM5 A;  1WJE A;  4PK4 A;  1GXQ A;  3K9T A;  3MD2 A;  4PJM A;  2NNY A;  1EF4 A;  2Q1Z B;  2QZ8 A;  4MQ9 F;  4XL9 A;  2MYS A;  1UFM A;  2UZK A;  2M7B A;  2DYR H;  4ZJZ A;  2O9L A;  3L09 A;  1N75 A;  3K0L A;  2ZB9 A;  4D0P A;  3OY9 A;  4KUM A;  2XSJ C;  3MKZ A;  2W82 A;  5FKO A;  3COA C;  1QHG A;  3W2A A;  1D5V A;  3NEU A;  3JAM K;  4EAT A;  4MIM A;  3OWT A;  5AIQ A;  3RYR A;  3L2V A;  2ETH A;  4HDU A;  1A35 A;  3F72 A;  1QZY A;  2ZSH B;  5J1U A;  2R7D A;  5FFZ A;  1P7J A;  1TT0 A;  2OCC H;  1W7P B;  2AHQ A;  1VQK I;  5DYM A;  2WB1 A;  3M8J A;  1G4D A;  3H35 A;  2OQR A;  2DOF A;  2IGM A;  3V42 A;  4F92 B;  2R7Z J;  1HXD A;  1V5G A;  2KFD A;  2KKO A;  4RS8 A;  4U0V A;  3OOU A;  3H5N A;  2STW A;  4NC7 A;  1YTY A;  1J2X A;  4HLX A;  3EUK L;  3BR6 A;  2MGQ A;  1QPM A;  2KDO A;  4GYI A;  5E18 F;  3WTU C;  2FA5 A;  2DA6 A;  5D8K B;  4HST A;  4PSX A;  1U3E M;  3K10 A;  3T0Y A;  4IHT A;  3RPU D;  2CW0 F;  2P0W A;  2OQG A;  4F91 B;  2XV4 S;  2VE8 A;  2FBI A;  3ASN H;  1MBK A;  4WXC A;  3I5U A;  1R36 A;  3F0C A;  1FX7 A;  2QYO A;  3AFH A;  4Q48 A;  2L02 A;  1X3W B;  1OR7 C;  3BG3 A;  2DJN A;  4A93 J;  2K86 A;  4RDU A;  1DGW Y;  1RPW A;  5D5X B;  1MH4 A;  4H0E A;  2IGN A;  3BLY A;  3VWB A;  2BHY A;  3DEW A;  3CJT B;  2XUB A;  4G6T B;  4BXX J;  4CCL A;  3GZN B;  1TT5 B;  2RQP A;  5K5Q A;  2Y9Y A;  1Y39 A;  3ZQL A;  2QBY A;  4U0Y A;  2EFW A;  4FCY A;  1QU3 A;  3K4M A;  4ITV A;  4CCN A;  2QVO A;  5M3M J;  4UVA A;  4BKX A;  2E1O A;  1T0F A;  3SEQ A;  5CVJ A;  3E6D A;  4XN3 A;  4ENJ A;  1BR2 A;  4LG0 B;  1P9Q C;  1WJF A;  2DTR A;  2LNB A;  3F22 A;  4HX4 A;  1IUF A;  4F3Q A;  3BTL A;  2E35 A;  3TO6 A;  3AG4 H;  4EV0 A;  2C6Y A;  4Y4R A;  1G8X A;  5F0C A;  1FSE A;  2ME0 A;  2IPQ X;  3HSF A;  3MZY A;  5CYV A;  2WAE A;  2XC7 A;  5FLX K;  4ANJ A;  1IUY A;  1K78 B;  4S0H B;  4A3M J;  3OR2 C;  1IG7 A;  2X51 A;  2ISZ A;  5B5E C;  3HOZ J;  4BDZ A;  4I99 C;  4G12 A;  1IXR C;  2O3F A;  1YS7 A;  4LIU A;  2IS1 A;  2BY2 A;  5TJJ A;  3RKX A;  5FJ8 J;  3WG7 H;  4F55 A;  2KIU A;  1EV7 A;  3M1C A;  2IT0 A;  3NWS A;  2WAF A;  2BY0 A;  1STZ A;  4XMY A;  3DTE A;  1LUJ B;  1JT0 A;  1QZE A;  4KFC A;  3BG6 A;  3FXL A;  4XIC A;  3DBR B;  1AKH A;  2HQ5 A;  3K1N A;  2IS4 A;  1JUS A;  4CGZ A;  5C4X J;  1EH8 A;  3FX3 A;  1Z91 A;  2ISY A;  5FO5 A;  5J1Y A;  3FMQ A;  2XRL A;  4KNY A;  1XS9 A;  5LHG A;  3BR0 A;  1ENH A;  1IN4 A;  4FE4 A;  4GDF A;  1AWC A;  1U5T C;  2HDC A;  2I10 A;  1VZ0 A;  3DWL E;  4U88 A;  3Q5F A;  4LB5 A;  3S1M J;  4MTD A;  3QP5 A;  3GX4 X;  4A3L J;  3KET A;  4HPQ A;  3H9J A;  4IKF A;  2NXN B;  4HLY A;  3V4G A;  4DYQ A;  2MFZ A;  1UB9 A;  3J80 Z;  2EZK A;  1N25 A;  3A02 A;  4OMZ A;  1KU9 A;  4V2G A;  1H9T A;  2H94 A;  2LKS A;  3Q0U A;  2EIK H;  2WY8 Q;  3TBI A;  4FET A;  3OSG A;  3W2V A;  5HLG A;  2M5W A;  3HHG A;  1BR1 A;  5J3L A;  5D6F A;  1VQM I;  1D0Z A;  1OMI A;  4A0X A;  2VIX A;  1I6X A;  4E70 A;  4IQJ A;  4A3G J;  4WCG A;  1A6I A;  1MH3 A;  3Q9V A;  3CCV I;  4BE2 A;  1MMS A;  2J5O A;  3DKY A;  3M9A A;  5KHD A;  1R9T J;  4L0Z B;  4Y13 A;  2M8G X;  5EZG A;  2ESH A;  1YW9 A;  4KT5 C;  2VXZ A;  4UHT A;  1XTA A;  3IV5 A;  2WWY A;  1FY7 A;  1R22 A;  2GA2 A;  1DGR M;  2V9P A;  4I7H A;  1K79 A;  3ML6 A;  1SFU A;  1Z6T A;  4HRI A;  2JSP A;  3ULQ B;  2H6C A;  2BBY A;  2ELH A;  2NAZ A;  1C0W A;  2OZ6 A;  1AOY A;  2K85 A;  2Y9Z A;  2EA4 A;  3LA3 A;  4KIB A;  2B0L A;  2VKV A;  4G9Y A;  1XDU A;  3BR5 A;  1SFK A;  2M9H A;  3O2P E;  2W7N A;  2KMU A;  5DCM A;  2X0L A;  1WKM A;  1XSX A;  3N97 A;  2OUM A;  3TW7 A;  2KRC A;  3LSP A;  5LBQ A;  4G6D A;  3FZV A;  3O8H A;  4YFX F;  2UXN A;  4A3K J;  2W24 A;  5J4V A;  2BW3 B;  3ZRG A;  3OSF A;  1B9N A;  4IL6 C;  2YUS A;  4E7I A;  1K6O A;  1S72 I;  1ZEL A;  2R7O A;  3GEZ A;  5AIP A;  4C3I J;  5LD2 C;  1LPQ A;  4XKW A;  1W5T A;  4MQV A;  1SVM A;  2DMT A;  1R71 A;  1GDT A;  2RKH A;  4LK1 F;  2LRE A;  3SFI A;  5HS8 A;  4HNU A;  2E60 A;  4RGX A;  2DTZ A;  2A69 F;  2KT0 A;  1IN7 A;  3RTR A;  3CCQ I;  4N9I A;  1LJ9 A;  1OPC A;  2HXO A;  3CC7 I;  1OCT C;  1FLI A;  3CCJ I;  1SD5 A;  3TP3 A;  3K7A J;  5CVR A;  2JRT A;  3P9C A;  1PDN C;  5JFR A;  5KNL A;  4CCO A;  3MKY B;  4YEJ A;  5TRD A;  5HOD A;  4AC0 A;  1LEA A;  2R7U A;  3DPL C;  1UG0 A;  1QRY A;  1XGS A;  3I3L A;  3JSP A;  3PUB A;  1J75 A;  2JRM A;  2K4J A;  3KP7 A;  4ZZL A;  2DFI A;  5LEJ A;  1K61 A;  1J09 A;  2DA3 A;  3HIF A;  4RBO A;  1R7J A;  2HEO A;  3OS2 A;  3RZD J;  3DTI A;  3K1M A;  3BT9 A;  4BEH B;  3SZG A;  3SJM A;  5FD5 A;  2FOW A;  3HRS A;  4HF1 A;  3OYI A;  3HPG A;  1FOW A;  2CUZ A;  3CDI A;  3FIS A;  3OYM A;  4A2U A;  1R1U A;  3LSG A;  2PJP A;  4PSW A;  3A4C A;  2ICW G;  2K9Q A;  3CJN A;  1SVO A;  4A5N A;  1T0F C;  1QQI A;  1DQU A;  2VXD A;  4AIK A;  2IW5 A;  1U9O A;  3TQN A;  1JHH A;  1XCV A;  3GME A;  4IVN A;  1W0T A;  4YII A;  1VQL I;  1FEX A;  3F8M A;  2DMN A;  4EGY A;  1KYW A;  1VQN I;  4LIV A;  1YJN I;  3PQK A;  2HI3 A;  2CUF A;  2NRA C;  2R7T A;  3H0D A;  3I4M J;  5E8G A;  2Y48 A;  2ZSI B;  2DU9 A;  2EFQ A;  4X1E A;  3WTV C;  3QYF A;  4PZJ A;  2IP2 A;  5E79 C;  4ZH4 F;  3LA7 A;  5JVT A;  4GO1 A;  2CO5 A;  3C2H A;  3V8K A;  3QOE A;  2KHM A;  4Y52 J;  3EET A;  3S1Q J;  5IYD J;  3QP6 A;  4AUX A;  4FX0 A;  2RN7 A;  2BYV E;  4XNF A;  4QPO A;  2HVS A;  2EQR A;  2A5W A;  3G2B A;  3LSK A;  2HPM A;  2UUZ A;  2M4G A;  2R5Y B;  3C2B A;  2LBF B;  2KZV A;  4A6D A;  2NOG A;  3Q9S A;  4NUB A;  2L9V A;  2EZH A;  1F4K A;  1ONV A;  2HYG D;  5IY5 H;  4XN0 A;  2VT2 A;  1M1E B;  5IP7 J;  2CJJ A;  5K7F A;  2F5C A;  2Z33 A;  3TP0 A;  3L7W A;  1YJW I;  1SD4 A;  2OA4 A;  3OYB A;  1Y0N A;  3SDB A;  2DQL A;  1IF1 A;  1X19 A;  1RKT A;  1KA8 A;  1Y1V J;  4B4C A;  5K7Z A;  4UUS B;  4NC8 A;  2JA6 J;  1PUE E;  2M7A A; 
#chains in the Genus database with same CATH homology
 2VJ4 A;  2R7S A;  3RSN A;  4YRV A;  2VQL A;  4XLH A;  3DKX A;  3RQ4 A;  3UR3 C;  4BE1 A;  2F6C A;  5HNF A;  4XKB A;  5CQG A;  2V9K A;  3OYH A;  4RLQ A;  3MKW B;  3OS0 A;  2M4K A;  4E7H A;  5HNH A;  1N77 A;  3K4L A;  3FKJ A;  2L5Q A;  3A1Y A;  4PFO A;  4RM2 A;  2UV1 A;  3CP8 A;  4XOP A;  3IAS 2;  3VYT B;  2X85 A;  2F4I A;  1UAA A;  1EA3 A;  3BG7 A;  2L7K A;  3N05 A;  2X6Y A;  3PSI A;  4D1Q A;  3OMY A;  3K4N A;  3HXL A;  2CMP A;  3OYK A;  3HOS A;  2NOJ B;  2R7W A;  4ZDP A;  2WY7 Q;  3MMY B;  3VSL A;  2M0M A;  4XKV A;  2CW8 A;  2HU9 A;  4HEA 2;  4BQN A;  2IGO A;  2Y0S A;  3LSM A;  1AA7 A;  5KCM A;  1Y6I A;  2FUG 2;  4J01 A;  4E7J A;  2E5N A;  3E0J B;  1D1C A;  4F52 A;  1FMW A;  2R7R A;  3OYD A;  2VAS A;  3W3C A;  2I8D A;  4HG2 A;  3S3O A;  2E1M C;  3LSI A;  3FHN A;  4KT6 A;  4CCJ A;  2L9S A;  3DU6 A;  3QYE A;  4CUG A;  4OAZ A;  3OIP A;  4ZYA A;  2IXS A;  3FBI B;  4XM3 A;  3ZXS A;  3HPH A;  1KON A;  3OS1 A;  1W36 C;  1K6Y A;  4KJZ A;  2CH0 A;  2L9N A;  3CMM A;  3DLA A;  1WJE A;  4XOT A;  4PK4 A;  1TZL A;  2WAD A;  2M3A A;  3MD2 A;  4PJM A;  2Q1Z B;  3H9Q A;  4XL9 A;  3L2W A;  2MYS A;  2M7B A;  4ZJZ A;  1W36 D;  1N75 A;  3OY9 A;  1BR4 A;  2XSJ C;  2QKL B;  2W82 A;  4C9Y A;  3MKZ A;  1QHG A;  3W2A A;  5FRN A;  2OV7 A;  4EAT A;  3ZCO A;  3OWT A;  3DPT A;  4AVZ A;  3L2U A;  3L2V A;  3BCB A;  4BU2 A;  2KLO A;  2DXI A;  2X1E A;  2X1D A;  3LL7 A;  4F93 B;  2V6E A;  2DOA A;  3DU5 A;  2ZSH B;  2V7F A;  3D5L A;  3OYL A;  2ZFU A;  1TT0 A;  3KYL A;  4XLF A;  3OYC A;  3AKZ A;  2JVG A;  4DJA A;  2WB1 A;  1Z3Y A;  3M8J A;  3H35 A;  3CF2 A;  2BOL A;  2IGM A;  3V42 A;  2LY1 A;  4F92 B;  3DPU A;  4PJN A;  1V5G A;  1YE9 A;  3OOU A;  3H5N A;  2VQC A;  4NC7 A;  1PJR A;  3PNY A;  2GOM A;  3RCO A;  3F9K A;  1LVK A;  3EUK L;  2AQF A;  4XLE A;  4JQF A;  4OAY A;  2IGK A;  2KDO A;  4Y3O A;  4HST A;  4PSX A;  3K10 A;  2KPM A;  3AL0 B;  3RPU D;  4XON A;  3S3M A;  2P0W A;  4F91 B;  2WA0 A;  2DT7 B;  4ZC3 A;  3DEE A;  4LG3 A;  4XQF A;  3AFH A;  2DJI A;  1OR7 C;  4B48 A;  4C30 A;  1DGW Y;  3S93 A;  1JI8 A;  1ERD A;  4E7S A;  2MC4 A;  1SAU A;  3EUH C;  2IGN A;  2CW7 A;  2QKM B;  3BLY A;  3LFU A;  4U87 A;  3OYG A;  4IX7 A;  3VWB A;  1E0E A;  4G6T B;  3OIQ A;  4CCL A;  3PNV A;  3K4B A;  2LOO A;  2VJ5 A;  3HC7 A;  1QU3 A;  2X6W A;  2GOX B;  4XLC A;  2W1O A;  3K4M A;  1QHH D;  4ITV A;  2IS6 A;  4CCN A;  2W4S A;  1T95 A;  2VPL A;  3S32 A;  4E7L A;  2R7X A;  4BL0 B;  5JHF A;  3SEQ A;  4QPQ A;  4BAC A;  4XN3 A;  2Z1D A;  1BR2 A;  1D0X A;  2RQQ A;  1P9Q C;  1WJF A;  2Z2S B;  4YEL A;  4F3Q A;  2VKH A;  2PJR A;  1S9H A;  4Y4R A;  2CV2 A;  3D5S C;  4XKC A;  4HNT A;  1G8X A;  1WJ5 A;  3CP2 A;  1OLT A;  3SEZ A;  2WAE A;  2XC7 A;  4P1W A;  4ANJ A;  3OR2 C;  2X51 A;  4ZTJ A;  2JVH A;  1R6R A;  3VYR B;  4BDZ A;  3KX2 A;  4BJT A;  2ZXI A;  2O5R A;  4LIU A;  2IS1 A;  4BDY A;  3OYJ A;  2V1N A;  2X1C A;  4BQQ A;  4F55 A;  4D9J A;  3M1C A;  3NWS A;  2WAF A;  1V5F A;  4XMY A;  2XF7 A;  2XDV A;  3DTE A;  3OL4 A;  3HL2 A;  3QOD A;  3D5R C;  2X6X A;  3BG6 A;  2LG4 A;  4LIT A;  2AQE A;  3C2G A;  2IS4 A;  2E5Z A;  3BC8 A;  1PYV A;  5CQE A;  2VL8 A;  1D1B A;  2VQH A;  1MMG A;  4BGD A;  2UWM A;  4FAS D;  2OC6 A;  2CS3 A;  1VZ0 A;  2DCE A;  3DWL E;  4U7B A;  4E7Z A;  1WJB A;  4HPQ A;  3H9J A;  4IKF A;  2LY2 A;  1Z21 A;  1FMV A;  2VQG A;  2MFZ A;  4NQW B;  1WJD A;  3QYB A;  3HKZ A;  3HOT A;  3TBI A;  2WY8 Q;  4FET A;  2K9L A;  2XF6 A;  3W2V A;  4BEH A;  2V26 A;  1BR1 A;  3I9V 2;  3IAM 2;  3TL4 X;  1D0Z A;  3OYF A;  2VIX A;  1N78 A;  2LH9 A;  3E1S A;  4E7K A;  4N4N B;  4IQJ A;  5HOO A;  3OL3 A;  4B43 A;  1X4P A;  2E1M B;  3H5R A;  1NG7 A;  3OYA A;  4BE2 A;  3K4J A;  4KIS A;  1Z7L A;  3DKY A;  5KHD A;  3PSF A;  3EUA A;  3S3N A;  2VXZ A;  2R4G A;  2KL4 A;  4ZDL A;  3PNT A;  4C2U A;  1DGR M;  4AYB A;  4JOM A;  5FRM A;  4PJL A;  4HRI A;  2JSP A;  2LRD A;  3OYN A;  1WFX A;  3L2R A;  1GLN A;  3FDY A;  3DTK A;  3PL8 A;  4XOR A;  3CZ6 A;  3LSH A;  4GRI A;  2JUG A;  2PJR B;  3PJR A;  1SFK A;  2W7N A;  1LDK B;  4OWR B;  5HLT A;  1V5E A;  2KMU A;  2BVM A;  2BVL A;  4CCM A;  2OUM A;  1UEL B;  4DIQ A;  2KRC A;  2LBF A;  2HVR A;  4MLO A;  2MAB A;  4IQ4 A;  3NWT A;  4N4O B;  1X1C A;  2BW3 B;  3ZRG A;  2K5C A;  5LFA A;  4PUS A;  3K70 C;  4E7I A;  1U0J A;  4C2T A;  1MMD A;  4BQO A;  1ZEL A;  2R7O A;  1D0Y A;  3CES A;  4BS9 A;  4BJ6 C;  5LD2 C;  3GBG A;  1MMA A;  2HZD A;  1MND A;  2A6T A;  2KQR A;  3HG9 A;  4CCK A;  1X1D A;  2VKD A;  4XKW A;  3U21 A;  2W00 A;  3TMO A;  2LRE A;  4HNU A;  4CZC A;  2E60 A;  4BE0 A;  3W2W A;  2HNH A;  3OYE A;  2HVQ A;  3L2Q A;  3K70 D;  2KRH A;  4DBR A;  2ZXH A;  4ZTF A;  2F5V A;  3EPZ A;  5HVQ C;  4ZDO A;  3RTR A;  1IRX A;  1HA8 A;  4XR6 A;  1WJA A;  3K4K A;  1LFP A;  2BW3 A;  3K4C A;  2PMZ A;  5KNL A;  4CCO A;  3MKY B;  4YEJ A;  5FRO A;  4RMN A;  1Y56 A;  3ZGK A;  1Z3X A;  3HUG B;  2R7U A;  2R7V A;  2IS2 A;  2R7Q A;  3DPL C;  4HSR A;  4KIT B;  3LMM A;  1UG0 A;  3I3L A;  3PUB A;  2CV0 A;  1NG6 A;  4IZZ A;  3H9G A;  4H4K C;  1J09 A;  4P5O A;  4B3X A;  4XLA A;  1YX5 A;  1WJC A;  4NNJ A;  3ZR8 X;  3OS2 A;  2WAQ A;  2HDW A;  3DTI A;  2LC2 A;  4BEH B;  3AL0 C;  3SZG A;  4CH7 A;  1MMN A;  3CJQ B;  4II3 A;  3H5A A;  3OYI A;  3HPG A;  2CUZ A;  2LYC A;  3A2K A;  3OYM A;  4II2 A;  3VDX A;  2MD0 A;  3LSG A;  4PSW A;  1D1A A;  3A4C A;  4DOZ A;  5CKT A;  3CJR B;  3IUO A;  3ZQQ A;  4DBQ A;  1T0F C;  2K3P A;  4RLF A;  1DQU A;  2VXD A;  4DGW B;  1X4O A;  2DT6 A;  3ONQ A;  3SYT A;  3OR1 C;  2VB6 A;  2HPI A;  4LIV A;  4X0G A;  2XAU A;  3UNG C;  2CV1 A;  2R7T A;  3H0D A;  3PFY A;  4Y33 A;  2VJJ A;  2ZSI B;  4PFP A;  4B44 A;  3QYF A;  3VYU B;  1YX3 A;  1BOB A;  2HQA A;  4J00 A;  3C2H A;  3QOE A;  2KP6 A;  4AU7 A;  2KHM A;  3VYS B;  4PJJ A;  4E6K G;  4XNF A;  4QPO A;  3K6G A;  4E4H A;  2HVS A;  2RNG A;  3G2B A;  2A5W A;  1MW7 A;  2ELJ A;  4CA0 A;  3LSK A;  2HPM A;  2UUZ A;  2M4G A;  4BJ5 C;  3KEY A;  1LKX A;  2LBF B;  3BCA A;  3VSK A;  4BUP A;  4CSW A;  1X1B A;  2K9M A;  2KZV A;  4NUB A;  5TGT A;  4R79 A;  2RRE A;  2CUJ A;  4XN0 A;  3J7A Y;  2VJI A;  2CFO A;  2WBM A;  4BXF A;  1G59 A;  2L2O A;  2JA2 A;  2Q2E B;  3FBN B;  3IP4 B;  1MNE A;  3DQV C;  3OYB A;  3SDB A;  1X19 A;  2XF5 A;  2VLA A;  2Z16 A;  5CPR B;  2V4J C;  1DP3 A;  3S8P A;  1X1A A;  4NC8 A;  4B47 A;  4RM3 A;  2M7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...