4IZZA

Crystal structure of fischerella transcription factor hetr complexed with 21mer dna target
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
294
structure length
294
Chain Sequence
VDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 83
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4izzA02
4IZZA 4HRIA 3QOEA 3QODA 4J00A 4YRVA 4J01A
chains in the Genus database with same CATH superfamily
1VQ9I 5K7HA 1RNLA 1VTNC 4L9TA 5CQEA 2KLOA 3A1YA 4NC7A 1KZHA 1PDNC 3S1QJ 1U5TC 1FPQA 3DEWA 4LITA 1RR8C 2DQLA 1PVEA 2E1NA 2IBDA 2TDXA 3W3CA 1MKMA 5FFXA 1FOWA 2IGKA 5K5OA 1RESA 4B44A 1JGSA 1Y6IA 1ZK8A 1Y0NA 2FUG2 4IHYA 2ZO4A 1VQLI 4CHUA 4AVPA 4CCMA 2CJJA 3FHNA 4XL9A 4LB6B 1VQ8I 5FRNA 2NVTJ 1MJBA 5EEGA 4XONA 3TBIA 1JT0A 3GUDA 4PSXA 3S3NA 4X0GA 4AYBA 2R7DA 2NOGA 3KEYA 5EDNA 1G6NA 1TWCJ 2Y30A 3JRIA 5J47A 2NAZA 4V19K 2VPLA 2P0WA 2ZFWA 3M3YJ 4XN3A 2DT6A 2Y75A 4HQMA 4M6XA 2HDDA 3JAMZ 4IHSA 1EH6A 4XRMA 2KIMA 2V79A 4P5OA 1H89C 3M7GA 2LY2A 5M5XJ 1W5CC 4YELA 4ZYHA 2O7OA 1R58A 1ONVA 1AKHB 4XKVA 4BU2A 4L5EA 1BC8C 3TOBA 4GCVA 1G3YA 5DM6F 3C7JA 1JKQC 2DCEA 2ZMEC 1LDKB 4IRHA 1BC7C 3WU0A 1IUFA 1IXCA 3LA7A 2HDWA 3P9CA 2KIQA 4BY1J 3FIWA 2D5VA 1EKEA 4CH7A 4CCJA 2JZYA 3KP6A 4QTRA 4NDLA 3W6VA 5F64A 1FOKA 4ZYGA 4UV9A 3ZCOA 1N75A 4BQQA 1T39A 3M4OJ 2LOOA 2P5VA 2B0LA 4LIUA 2H27A 3FHZA 2CW0F 1SFKA 3PL8A 4L5IA 3LAJA 3MKYB 2EFQA 5EGOA 4G12A 3S1NJ 3ULQB 2PN6A 1BW5A 4W1UA 5D5WB 4UXNA 3CJTB 3CCMI 2L3DA 4FCYA 3GTKJ 5IT3A 2COBA 3MMYB 3PNTA 3PFYA 2VI6A 1MZBA 2IA2A 1X19A 2V7FA 3OL4A 3FDYA 4DQ2A 4JP0A 3BJAA 4HNUA 2XUBA 4JK1X 4R79A 3I9V2 3DLAA 2OU2A 2B63J 3T0YA 3DWLE 3KPHA 3TMOA 5DCFA 5HS8A 5HOOA 4QSHA 4F52A 2UXXA 3S2WA 4HG2A 3G6EI 3HOUJ 2MG4A 4O5VA 2XHKA 2MH2A 2ZBKA 4R8HA 5IT9K 4MTEA 4XLPF 2OAZA 2L0KA 4AWXB 1SFXA 4KISA 1DGWY 3C2HA 2X1EA 1G59A 3MAJA 4ZJZA 2LNBA 3PO2J 1ETQA 2X6XA 2Y0SN 2W4SA 3Q0UA 4GXOA 3UNGC 3CLOA 5K7ZA 2F2EA 5D6EA 1FWZA 2JVHA 4LG0A 3KEQA 3KCCA 1YIJI 1LFPA 3OIQA 3DBRB 1BR1A 4IOAF 3ABMH 4XOTA 3LL7A 2KFDA 1HA8A 1MBKA 3SZTA 4D0PA 4P55A 1SD6A 2W24A 4N4OB 4F3QA 2CQNA 1SAUA 2DT5A 4E7SA 4EJOA 2LD5A 4PDKA 1KQ8A 1HW5A 2CUEA 1ZARA 3KE2A 3OR2C 3OYMA 1WI9A 1O3RA 5GPCA 3VEPA 4HDVA 3W6JB 4BQAA 2Z3YA 3HSEA 4LLLA 3SDBA 3L2VA 4D1QA 2GXGA 3MN2A 2HOTA 1G3WA 1O3TA 3LSHA 5ILVA 3ZQIA 1ZAOA 3E97A 2XAHA 1HKSA 5GTHC 4UB6C 3WTXC 3DV8A 4IRIA 4E7ZA 2MSYA 1YW7A 2LG4A 5F6FA 2BE5F 1JUPA 1YRNA 2ZJRF 3OOUA 2LBFA 5A2QK 5LGUA 5IOYA 1BJAA 2V4JC 3DEUA 3J7AY 2ZJ2A 3U1KA 4HNVA 4BUPA 3Q0VA 2PX9A 3BG5A 4WF2A 4ON0A 2VJIA 1R49A 3ECHA 3L2RA 4HF0A 3VDXA 3B6AA 5F0FA 2Y69H 4AC0A 3I55I 5ICEA 2NRAC 2QM3A 4RBOA 3HDDA 2XB5A 3SZGA 2BVLA 5GAGJ 2K85A 4EMSA 1A36A 1IAWA 3HUGB 4ASNA 1IJWC 2ID6A 2JMWA 3V7CA 3EUHC 2BW3A 2DAOA 3D5SC 3TDZC 2CFXA 3L2UA 1X1PA 2R0QC 5EG0A 3LNQA 4CDGA 5FB2A 5TRDA 2P5LC 2RGVA 4EV0A 2KJCA 2VUMJ 4MEYF 3RKQA 2EV6A 1HDDC 1XC5A 1VQKI 2DYSH 4DBQA 4J01A 4Y52J 4HZFA 2CU7A 3TOAA 3NAUA 3I59B 2DA5A 5EF6A 1PJRA 1K4TA 1UELB 3KFWX 2X0LA 3GXOA 2M0MA 1JT6A 3BR3A 2IA0A 1R00A 3A01A 1ZRDA 1K78B 1YQAA 2MYSA 3K4BA 2WC2A 2FQ3A 4RB0A 4LB5A 4F7ZA 1K61A 1N25A 2MLGA 2FEZA 3PM1A 2FQ4A 3I5UA 4DYCA 3T8RA 2P6SA 2LRDA 4Q5SF 3OYGA 4ENKA 4KYWA 3JCUC 5IYBJ 2L9NA 4OAYA 5JLWA 2K9LA 3M1EA 4BAYA 5EZHA 1B1BA 1KYZA 4XLFA 3S2HJ 3C2BA 2IGMA 5L3CA 1VQ7I 1B6AA 2JN6A 2BY0A 4F92B 4QWQA 3QOEA 3ZMVA 3HL2A 2HR3A 4XICA 2H09A 2KJBA 2CV1A 4ZZDA 3BROA 1FSEA 1ITYA 2R4GA 3HRMA 4TV7A 3HRSA 2LKXA 1WSUA 2LREA 1ZGAA 1REPC 1D1BA 1BN5A 1X4PA 1HQCA 1MGTA 4BEHA 1FP2A 4ENJA 1I50J 3F8NA 1J75A 1USTA 3LSRA 3IHUA 3I4MJ 3HKZN 4JX6A 5FKKA 1YW8A 2DFFA 2W00A 1UMQA 4EQQA 2H94A 1H9TA 4ZDPA 2GOXB 3IAM2 3N97A 2L4MA 1X58A 1SVOA 1YJ9I 1SVMA 2M1BA 3T5XA 4CCLA 3JTHA 4AD9A 1U8RA 1FSHA 3M8JA 1LQ1A 1LE8B 2HTJA 1UCRA 3GTMJ 4Y4RA 3JRFA 1CF7B 1P4AA 2HVQA 3DXJF 5BS6A 2O8KA 1J5YA 4A93J 1VFCA 3I64A 2BHZA 3GZNB 3F8FA 4C9YA 1VQPI 1W5SA 3HGGA 1TNTA 3GF2A 3VYSB 1BIBA 5JHUA 4ZYEA 3OYBA 3L7WA 1ZR2A 4BGDA 3BTLA 4MGRA 4RDUA 1G3SA 1UG0A 2QBYB 4YIIA 1Y56A 2VN2A 1FOYA 5M3MJ 1UHMA 5F0HA 4Q47A 1P6RA 2NXNB 2OF7A 3LSJA 4G94A 4A3KJ 2FF4A 2K3PA 2WWYA 2XPVA 1W36C 5GP9A 3HOTA 3LAPA 3L2QA 3W2AA 3BG6A 4U0YA 5EEHA 4HNTA 1ODDA 1ZRCA 4ZDLA 4KICA 4BS9A 3ZOBA 1B72B 5F04A 2WA0A 4C3IJ 2F5FA 4BQOA 1ETWA 1PYVA 4BY7J 1YO5C 5GAHJ 5GADJ 2VT2A 4ZYAA 5CVIA 3HEFA 3V8KA 3G1OA 1MD0A 1X1DA 2XGEA 3ML6A 3GTJJ 3R61A 4GFBA 3TO7A 3G3ZA 4IZZA 2F48A 3HRTA 4EVIA 1YFHA 1W0UA 2F5CA 4BBSJ 1R7JA 3JRBA 1SFEA 1IN7A 1ZLKA 2R7TA 4A3JJ 3K0LA 2WAQN 3ZN0A 1RKTA 2OCCH 5F1RA 4HX8A 2ZSIB 4RA2A 1DQUA 2VASA 3CDLA 2CRGA 4D7NA 3BCAA 3JSOA 1ZRFA 4IRGA 4Q4ZF 3BY6A 2HFHA 1FMWA 1LJ9A 4PGGA 1JJ6C 2EPFA 3IKTA 2QZ8A 1R1UA 3IRQA 1XPXA 3K7AJ 2A5YB 3V7RA 2WY8Q 4IQJA 5CLSA 1NG7A 5DCMA 4P9UA 3K69A 1ZN2A 2DXIA 1R1TA 3MEXA 5EYRA 2XB0X 1EH8A 4G9YA 1UJ8A 1WRJA 4X1EA 1S3JA 3QPLA 1Z9CA 2FJ1A 2P81A 4XLEA 2VXDA 3WU2C 4C2MJ 2JPBA 5FLMJ 1BOAA 1QRYA 3ELKA 4Y7NJ 1ZH5A 1A04A 3BR1A 2F4OB 1FBSA 3F8MA 5FKOA 2HS5A 2XROA 4L0ZB 1BR4A 4UY8I 2V9KA 5E17F 3FXJA 3OR1C 2XC7A 3ZMDA 3CESA 2E19A 3JW4A 3CLQA 2E35A 2L7MP 2E36A 1TQPA 2BBYA 3H1CA 3HBLA 3WTZA 3QPTA 1GV2A 4C3HJ 2B7EA 5K5RA 3M1CA 2HOSA 4MHGA 1JUMA 2WB1N 1LEAA 2BEOA 2UXNA 2H1KA 1BR2A 4QPQA 3OYEA 4M72A 2LVSA 1WH7A 1LVAA 2XGXA 4IL6C 1T33A 2YX7A 4HOBA 3FXOA 5BOXA 3E6DA 3W6KB 2E2IJ 1S7EA 1IDZA 1OLTA 1PUFA 1R71A 1Y1WJ 3ASNH 3QPHA 2JPCA 2KL4A 2RDPA 4G7ZF 2E5ZA 1IW7F 2QQ8A 3OYIA 3E5UA 4BL0B 2M5WA 4L9VA 2EJRA 1T38A 1QHGA 1HXDA 4GO1A 4HSRA 5CVVA 1MMNA 3CP2A 3J81K 2JUCA 3HM5A 2DW4A 1ETOA 1AHDP 2E1OA 3HIFA 2LP0A 3W2VA 1VQOI 1ZYRF 3VSLA 3K4LA 1TW3A 1I3QJ 4XSXF 4A6EA 5E18F 2QA4I 2C6YA 2HU9A 4A0ZA 3GFJA 4CYDA 4LFUA 1ZQ3P 3FKJA 2PQ8A 1WJEA 3KZYA 2I8DA 4PUSA 1QVUA 5F0CA 3W2WA 3C2GA 1LPQA 3QYBA 4ZZLA 1GLNA 2AQFA 2V26A 4MIMA 4CUGA 2G0EA 2ZXIA 3HSRA 3FBNB 2DJIA 4XBFA 4M3EA 1BL0A 4JYKA 4CYCA 2EZLA 4II3A 1YTYA 1ULYA 3CZ6A 3H36A 1YW9A 3G1MA 3VYUB 2VOOA 5HS9A 3VFZA 2IS1A 1QQIA 4UVBA 2K4BA 2Z1DA 1HLVA 1UHSA 3KP3A 3M8FA 4YFXF 5LEKA 1WQ2A 2K4JA 2HYFA 2W82A 3QP6A 2A68F 1T08B 4D9JA 2CV0A 2MH9A 1FY7A 1YS7A 4X6AJ 1TP4A 2ZMEA 4WCGA 1HKTA 2H1LA 2MGQA 4ABZA 4N9HA 2OBPA 3FXLA 2DMUA 2STTA 4XORA 4PJJA 1R22A 2ELHA 5E1WA 5ICFA 3GTLJ 4EM1A 2BHYA 4BXFA 1X1CA 2P7VB 2QEXI 3CMAI 2CUJA 3BTJA 1USSA 3HYIA 2VL8A 3OYCA 3V42A 1OFCX 3NWSA 3V8LA 1WJFA 3MZ8A 4AVZA 3ZMUA 3AKZA 5D4SA 2P7CB 2EB7A 3TW7A 3SEZA 3GTPJ 1VZ0A 2DA6A 3PJRA 3PSFA 2R5YB 2NVYJ 4AIKA 3RZOJ 1A6IA 4ANJA 1YG2A 2OZUA 1R4NB 3A02A 3K4JA 3TKYA 5JFRA 2AXTC 4XOPA 2FBIA 2KT0A 3N05A 4G6DA 2M4GA 5CVUA 1YOVB 3ZGKA 5LHGA 4FHTA 4PJNA 3HTSB 3QU3A 2QWWA 1MW7A 2H6CA 1EV7A 4PSWA 3E6BA 3WGGA 2NS7A 2XDVA 4F93B 3ONQA 1X4OA 1GUUA 2NYXA 4F91B 1WH5A 4UUSB 1R36A 2M87A 5FKNA 1VNDA 3IKVA 1O57A 3DPLC 2DA4A 3OS2A 3WHCA 3I54A 2DO7A 1W7PD 4BDZA 2EA2A 4BHPA 5IY5H 4DYRA 3MZYA 1EF4A 1Z67A 2BGCA 2GBYA 5ED4A 4CCNA 3HJEA 2IRFG 1FBQA 1BI3A 2M8EA 5ICCA 4AU7A 5KK1A 4Y3OA 2VC0A 2PJPA 4NQWB 5F08A 2GA2A 1E17A 1FTTA 4ZYDA 5IYDJ 4YIRX 4A69C 1IXRC 3FM3A 2VLAA 2MC3A 3FF5A 3PUFA 2IAIA 1DU6A 2VQLA 2Y9YA 1FEXA 1T56A 3L2CA 3JREA 2CQXA 4XRSG 4IX7A 1OR7A 1ZKGA 2E1MC 5B66C 2YS9A 2ZB9A 1TBXA 1BOBA 4YG2F 2XGCA 3IH2A 3DU5A 3WTWC 2R3SA 2Z33A 4G7HF 1TWGJ 2IGOA 2RQQA 3OV8A 5CKTA 3TL4X 5F1JA 1OCZH 1ZG3A 3LA2A 3NRVA 3BG7A 3SQNA 1X1AA 3DKXA 1W4MA 2W25A 5M5YJ 4A12A 5LEJA 4UUTA 3IH4A 4HW0A 1W5TA 4I98B 2QUFA 1I6HJ 1IN8A 2PMZA 4UUVA 4BJ5C 4L9NA 1WGXA 3E6CC 3FMRA 1D8KA 3C1DA 3TP3A 1MBEA 5CVRA 2K5CA 4MEXF 1RPWA 2ZC2A 4NHJA 4M6VA 3EUKL 2HYJA 2GA1A 2FOWA 4N0BA 5K1YA 1GHCA 1R5GA 2P4WA 3O6BB 4P9FA 4OIQF 5EGOB 2DOAA 5HLHA 5GTIC 2XAUA 1E2XA 4HBLA 4A5NA 4HAMA 4U0VA 5FO5A 2RVCA 4XMYA 3OY9A 2MD5A 2QKLB 3ZRGA 3FXRA 3BWGA 4B43A 4LIVA 3HPHA 4RS8A 2Y9ZA 2NOJB 1SANA 2LLKA 3F3XA 4HX4A 2W84A 1R1VA 1SFOJ 3F21A 4NC6A 2OQGA 2HOEA 3BCBA 2F5VA 2VKHA 1ZG5A 3N4MA 3EETA 2JRMA 5DS9A 5E8GA 2YR2A 2QQAA 2LF7A 1L0OC 2YPRA 4A3DJ 5BQTA 4GDFA 2L01A 4II2A 4RGUA 4FE7A 5L3EA 1OJLA 3DLLF 1SC7A 1B9NA 1OCTC 2HGCA 1TL8A 2QVOA 2O5RA 1H9GA 1MNEA 2FXAA 1DDNA 5J4VA 2GXBA 1MDMA 2K27A 2DMQA 4KUMA 2RV8A 2F4MB 3X2QH 2QQBA 1IF1A 1JI8A 3G73A 1F43A 4RB2C 3L00A 1HDPA 2EBIA 1ON1A 3HZJA 2XF7A 4FTHA 2IW5A 2P6TA 4HF2A 2ECBA 2YSRA 3OIPA 1WJAA 4LMYA 3WE3A 1A31A 3EYIA 2V6EA 1FP1D 3CCEI 1ACIA 3HXLA 3KP7A 4KMFA 2EWNA 2PMUA 2K86A 2V9PA 4KMUX 3AG2H 4QIWN 3KYDB 2H8WA 5FFZA 3SFZA 1Z0XA 4DOZA 3A03A 4AUXA 2FD5A 2LFBA 4HSTA 1MMGA 1OYWA 2XSJC 4E7KA 3SXYA 4QPOA 4C30A 1HF0A 2V9VA 2FBKA 2FX0A 4OOIA 1P7IA 5LRSA 2IA1A 3KIOA 1T95A 2K3FA 5B1BH 3ZPLA 3FZVA 3NARA 3F0CA 3ZR8X 4DNCA 1ZELA 5FROA 5E3LA 3J81Z 1OKRA 3DPUA 3D5LA 2DA2A 1ZHFA 1TTYA 2JT1A 2R92J 2EV0A 2JA2A 3ZQFA 4KA4A 4IEJA 5ERIA 3PNVA 4BDYA 1Z3XA 1UHWA 5KHDA 2LBFB 4I09A 1LDDA 1OMIA 2RNGA 2PFBA 1FMVA 1OISA 4Z6YA 5FLXZ 3GWZA 2EV5A 3TDUC 2GM4A 1D0YA 4LLGF 3WG7H 1V55H 1WCMJ 2AQEA 2NVXJ 1X3WB 1KQ0A 1QA6A 3AL0B 3IH3A 3RPUD 4CA0A 1LDJA 4RAFA 4WXDA 1PP8F 2KKOA 3NQOA 2DBBA 2DDAA 4IHVA 3MKWB 2GIZA 2IGNA 1V5EA 3BG3A 3ZXSA 1SD7A 1TW2A 1O7FA 5TJJA 2Q2EB 2VQCA 3HUGA 1Y1VJ 4YFKF 2ZJPF 5BPDA 1NK3P 2L4AA 3UR3C 3MFKA 4RLQA 5HLGA 1R23A 4HV6A 4M9ZA 4U7BA 3E5QA 5D8KB 2ZJQF 3I4NJ 3S2DJ 2P8TA 3VPRA 1IV6A 3IUOA 4A3LJ 2WAQA 5IOZA 2LKSA 3KYLA 2DQRA 2EINH 4HEA2 3H0DA 3VWBA 2Q0OA 3BR6A 3CC2I 3DKYA 3I59A 3S3OA 1XGOA 2IEKA 2OTLI 3MKZA 5GPAA 2CFOA 5J1RA 3ZQ7A 5HDGA 2JRTA 5LD2C 5KNLA 3CCVI 3CMEI 4BE0A 4IQ4A 1Z7LA 3GZ5A 2NVUB 1K78A 1IC8A 1F4KA 2K9SA 2XV4S 2CWEA 1K83J 1QU3A 1Z91A 1D0ZA 2UZKA 3TEDA 2TRTA 2K7LA 1JJ8C 2STWA 3WE2A 2KQRA 2D2WA 4MTDA 1MH3A 3R60A 2VE8A 4AIDA 5LRRA 4B48A 1JHHA 4BBRJ 1ZLJA 3MWMA 4EGYA 4ZTFA 4BNCA 1IUYA 3VOEA 3B73A 2BY1A 1Q1HA 4LK1F 3FK7A 2JSCA 2E2JJ 3HPGA 4G8XA 1QNTA 4F55A 5E1XA 2B9SA 1KU3A 3AG4H 4B3XA 4S04A 2OQRA 2R7SA 2GWRA 2HQAA 3IWFA 2R7ZJ 3MCZA 3DTIA 1UB9A 1B8IB 2V6CA 2M45A 4FISA 4LD5A 4MQVA 1WKMA 5HODA 4XM3A 5D6FA 5D5VB 4WXHA 1WHUA 2DN0A 4O6JA 3VB2A 2WB1A 2M2EA 4MQ9F 4BACA 2OV7A 2K9MA 1WJCA 3QQAA 3P7NA 3QAHA 4HF1A 3U1DA 4DZJA 9ANTA 2HWVA 1T2KA 3U9GA 3OYJA 1Z21A 3R4KA 2DTRA 3S3MA 1ON2A 4M74A 3BG9A 4KT6A 1QZEA 4CSWA 3HG9A 2D1HA 2HZTA 5B3SH 3FM5A 4XLNF 5C4JJ 3KLNA 3A0BC 3AL0C 2CW8A 3RPQA 2DFHA 4RAZA 1G8XA 3DTKA 1LE8A 2L2OA 1FLIA 2RAEA 3J7YJ 2HPMA 4KN4X 2GQQA 1I5ZA 3FX3A 3NEUA 1QGPA 2HPIA 3D0SA 2KRHA 2M7BA 1W36D 3OMYA 3JRHA 4CGZA 4BXUA 4FETA 2QKMB 2QF7A 4I7HA 4MFEA 4ZTJA 3H35A 4A0YA 5DDGA 3CF5F 1R5HA 2F4IA 1P92A 4BQNA 2QBYA 2EFOA 4B3AA 1BBYA 3GTOJ 3FKIJ 2HQRA 3HHHA 3IRRA 2VONA 2DPDA 3RZDJ 4RLFA 4I99C 2VC1A 3REOA 2BYVE 4NNJA 4NB5A 2A5WA 3RYRA 5ILSA 4D5CA 5FRMA 2EA4A 3CMMA 4JX4A 1RIOH 5D4RA 2HQNA 1HCRA 1U6GA 2HTSA 3SFIA 4LG3A 2CQKA 2E7WA 3LSKA 3E6MA 1IRGA 1HSJA 4A3IJ 1X3ZB 3E3VA 4XK4A 3PIPF 4ETSA 3SEQA 1IRXA 1X2MA 3QRFF 2BZTA 2X6OA 3S1MJ 2MFZA 1TT0A 2HDCA 2UV1A 1I6XA 3LSIA 1VQ4I 4FX4A 1B72A 2EZIA 2R7FA 3LFKA 4ITVA 1GVJA 4ZDOA 3CCJI 2BXZA 3S1RJ 1OYIA 1GXPA 3PUBA 4G6QA 4XR6A 4AIHA 2WV1A 3H0GJ 3DBHB 1Y8QB 3CMYA 4H0EA 2IT0A 1XGNA 4C2UA 1T0FA 3GFMA 2X6WA 2X6YA 2DOFA 1MMDA 3H9QA 1D8JA 1MBGA 2CG4A 2E34A 5J1UA 2DTZA 3HOSA 4XRFA 3ZMZA 4CCOA 5M5WJ 3TQNA 3F22A 1FYMA 3HB9A 1HOMA 2UWMA 5IT9Z 1IG7A 2ZXJA 3GFIA 1FJLA 1YITI 2M34A 1D3YA 2VQHA 5JR3A 1SMTA 1GV5A 3A4CA 3TO9A 4NC8A 1U2WA 1S9HA 2LSOA 2A61A 4K2EA 2GIVA 1AA7A 3EUAA 4E4HA 1DPUA 1B9MA 3LMMA 5E3NA 5L3DA 5ILUA 2COMA 2DA1A 2E2HJ 3B6CA 3GO5A 3OWTA 4A5MA 2X9DA 3FXQA 2E5NA 3CO7C 2EZHA 2FA5A 3KX2A 3OS0A 5DM7F 3JAMK 2YU3A 4XN0A 1RI7A 2ME6A 5FLVA 4Y13A 2HI3A 1CGPA 2IVMA 5IYCJ 3G2BA 4Y15A 3A2KA 3M07A 2KDZA 2WV0A 2I10A 1FNNA 2VQGA 1XMKA 1MSEC 4I0BA 3GZ6A 1U3EM 2OC6A 2A6TA 1TZLA 2XAJA 3O8GA 3RJPA 3OS1A 2X1DA 1FYLA 3P9IA 4I02A 3LSGA 4A2UA 1O3QA 3CUQB 3WTYC 1OQYA 2VODA 3K4CA 3LSTA 3JRCA 3I4PA 5IP7J 3QOPA 1VQ6I 1TNSA 2CMPA 2AS5F 1LNWA 3Q9SA 3E1SA 3JTGA 5A2QZ 2HXIA 2LY9A 2VE9A 2QSGX 5J40A 1FIAA 4QLCU 4BE1A 4BE2A 4ESFA 4JOMA 4NBQA 3DU6A 2DMNA 2FNAA 3EQLF 2CUFA 3F9KA 1FYKA 3IWZA 2VBXA 2LTPA 4OU0A 4I6ZA 2BXYA 1R4MB 1EH7A 1A6QA 1YLFA 1PUFB 3BZ6A 4M6YA 4KITB 3CCRI 1WI3A 3S8PA 3H92A 1H88C 3ERMA 2XSDC 1SD5A 2R5ZB 1AU7A 1MSFC 4YRVA 1TC3C 2L9RA 5LGNA 3K70C 1YJNI 3G1LA 3SZPA 1DP7P 1U5TA 3VYTB 1D1AA 3GCMA 4M3DA 1MNDA 4MFDA 4OIOF 1GDTA 1CQTA 4LLNA 2TCTA 1YYVA 3RCOA 2MABA 4WWCA 3K2AA 2DDBA 1K79A 1QVTA 3RKYA 1QBJA 4P96A 3KZIC 5JVGF 3CUOA 2V1NA 2CV2A 3V4GA 1WWXA 3OYHA 1RETA 1BW6A 3PO3J 4IOCF 2ZKZA 2JA6J 5HS7A 3EPZA 1W7PB 2MW8A 4CICA 2WTEA 3HOWJ 5H6QA 4BJ6C 4L18B 2X48A 4OAZA 3RDIA 4N4NB 2F5EA 3ABKH 4OWRB 1UAAA 3ABUA 3CTAA 4L5JA 4ESBA 2W57A 4S05A 4XRSA 3AAFA 2E1MB 3CCSI 5J4YA 3GTQJ 3TO6A 4RMNA 2VBWA 2YU9J 3I0TA 2KP6A 5HDKA 2V1DA 1Y0UA 2A6EF 2BY2A 2KIFA 5DD8A 1XMXA 4PCQA 1LFUP 3A0HC 4A0XA 4B09A 2QGUA 2VIXA 3D5RC 3KP5A 1J59A 2L02A 4XKCA 3FMSA 2XGDA 3K4MA 3Q3SA 3CP8A 1VF9A 3RQ4A 2Y0SA 3KEOA 1I3AA 2L9VA 1B4AA 2LYCA 2ISZA 3F6OA 2Z16A 3E0JB 2ID3A 2M0CA 3AG3H 3JRDA 3CUQC 3I58A 5FJ8J 1S7OA 3VYRB 2PJRB 4HDUA 5FGMA 1IO2A 1R5ID 4CZCA 3S14J 2OJED 1KQ9A 5AIQA 2VJJA 3C18A 2RREA 3BR2A 4J19A 5E8IA 1BIAA 1XG1A 2DI3A 2E7XA 3FXUA 3KLOA 4GYIA 2R5YA 5DEQA 2LK2A 3RTRA 3GTGJ 3F23A 3LSPA 2RKHA 3DBLB 3PSIA 4A3MJ 1IN5A 2OPTA 2W48A 3CC4I 4WXCA 1V5GA 5KAIC 1RR7A 2MLKA 1WVRA 4FX0A 1MJAA 1IRFA 1N78A 2BV6A 3H5AA 4O3MA 1BJZA 2L7KA 2R7UA 3MZHA 2PEXA 1E3HA 2QLZA 1S72I 2MA3A 3DQVC 2DPUA 4UUSA 3CCQI 2Y0MA 2ESHA 2BY3A 3S93A 2PI0A 4IHWA 3K4KA 1VQNI 1BI1A 3F8BA 2CO5A 5LGTA 5L3GA 2MD0A 3E5XA 3K6GA 2O9LA 4RB3C 4UB8C 4UVCA 3CCYA 2L9SA 4E7IA 3H3VK 2DFIA 3G4SI 1QZZA 4DJAA 2O61A 4B1RA 2HXOA 4CCKA 4I76A 4KN7X 3LSMA 3GFLA 4B8XA 3DEEA 3FK6A 3H9JA 4A3CJ 4DZPA 4EATA 2EZKA 1J09A 4RGSA 4RAGA 4NQWA 1T8IA 4BYYA 4DBRA 1JKRC 2LC2A 1TQMA 5DYMA 4Z2YA 1Z7UA 3D1NI 3LQQA 3BQZA 1WZ2A 1I39A 1MH4A 3FISA 4I01A 1I1GA 3BZKA 2F5DA 3K1MA 5BMZA 3BPVA 1HBXG 3K9TA 2JA8J 3S15J 5K7FA 1AKHA 1A35A 5GAEJ 2VOPA 1VQ5I 2KISA 1V54H 3BLYA 3P5JA 3WGIA 1POGA 4S0HB 5KAFC 2WAFA 4N9IA 1X2NA 2OUMA 2KPMA 4KT5C 1XSDA 1XTAA 1P4XA 5CVJA 1K7AA 1EJ9A 5CYVA 2K02A 3BQYA 3K1NA 2MBFA 1Y8RB 4EJWA 5E3OA 2DMPA 3GW2A 2LH9A 4D5FA 1H0MA 4OIRF 5H6RA 1OCPA 4AM3A 3H5RA 3PIOF 3U2RA 4ZC3A 1FOXA 4ENNA 4U0WA 1APLC 1ZGJA 1T98A 1Z3YA 5HNFA 4XKWA 4BHCA 5IPAA 2CS3A 1YHQI 1YI2I 2Z9OA 4KNYA 3RQIA 3SYTA 1O7LA 1OCCH 3KP4A 2L54A 1V3FA 4IF4A 4A3EJ 2K9NA 5CQGA 4IXAA 3EUHA 2KZVA 1GVDA 1OCOH 5HNHA 2EIMH 1QZYA 2JVGA 3TGNA 5JVTA 3R6SA 3H9GA 2QCOA 2XRNA 2O6GE 4HQEA 4HV5A 1QO0D 4RM2A 3GX4X 2FRHA 3RPUA 5AONA 4E7HA 2OTJI 2E1CA 4YFNF 2O03A 3DTEA 3EDPA 3I71A 5BNGA 3HKZA 5CJ9A 4PJMA 4MO7A 3DKWA 1ERDA 1XDUA 2WAEA 2XAQA 2JQ7A 4RGRA 1FT9A 1R6RA 1D5YA 5LFAA 1VI0A 1H8AC 4U7DA 3MQ0A 5HLIA 3IL2A 3QU6A 2VKEA 3HOYJ 2F6CA 4MLOA 4EEFG 1MDMB 4LG0B 2PBIA 3LA3A 1STZA 3BZCA 4UHTA 1OPCA 2ZSHB 2XF5A 4IHXA 1E3PA 1P4WA 1JHFA 3S16J 3CCLI 3BPXA 4UNOA 4J00A 3OYAA 2FE3A 3GVAA 1RUOA 1FZPB 2A3SA 2K9QA 5HVQC 1L3LA 1LEBA 2HOAA 1BM9A 2ISYA 3LQRA 1OR7C 5LBQA 4EJUA 2IXSA 5D5UB 4EJTA 5J8CA 1WJDA 1HKQA 4OIPF 1NK2P 1I27A 3HC7A 1W1WE 4W97A 2R7RA 4KJZA 2R7QA 2ELJA 1IV8A 5M3FJ 1HC8A 3OYDA 2A05A 2O0YA 1YE9A 2R7WA 4EM2A 1S7AA 2DLLA 6PAXA 1K4SA 2R7VA 3S17J 1YIOA 3GBGA 1YRNB 1V4RA 3M8EA 2EFWA 1KU7A 2HNHA 4XIDA 2QQ9A 4GGGA 3ESWB 1S5LC 3WHBA 2R7XA 1LUJB 1SFUA 2ME0A 3QPSA 3WGHA 1RRJA 3GLXA 3DP7A 3ECOA 2L7ZA 1K6YA 3H3ZA 2D45A 2G7UA 4A3GJ 4PFOA 4OMZA 2X85A 1Z05A 4HLYA 3QP5A 1HW1A 5KCMA 3JRGA 2D1VA 4L0YB 3DPTA 2ICWG 1GXQA 2XIGA 2HVRA 3SDGA 2XRLA 3OYFA 5J3LA 3FBIB 4E7LA 4PZJA 1MMAA 1IZ1A 3GEZA 2Z99A 4M3GA 5H20A 4AYBN 4Q48A 2EK5A 1R9TJ 2DODA 1ETKA 2A6HF 1UZCA 2V1UA 2LY1A 5D8LB 2M3AA 2PG4A 2ACJA 3ABLH 2BW3B 2MC4A 2XPWA 4A6DA 1PUEE 2NS0A 1XDSA 1Z1DA 5EG0B 3LWFA 2OCEA 3J7ZI 2Q2EA 4KDPA 4GRIA 4YIFA 3KZZA 4Y17A 5EZGA 4E70A 2O3FA 2IS4A 3BDDA 4MNUA 1E0EA 1O3SA 2ZXHA 4HLXA 1MBJA 3RIRA 1W0TA 3QWLA 3IV5A 3QODA 1RUNA 3HOVJ 5B5EC 3R0JA 4PK4A 4ZH4F 2M4KA 4M73A 2IS2A 3TW6A 2X51A 1ETYA 4B47A 4WK8F 2A07F 5EEAA 3A01B 5FD6A 3L1PA 2HEOA 3IP4B 3BJOA 4M9XA 3WTTC 3I56I 3L2WA 2FOKA 5DTDA 5K5QA 2L7FP 2VBZA 1U78A 1S29A 3QYFA 2PMZN 4DYQA 1FC3A 4XNFA 5H2FC 5E1ZB 1SMYF 3ZN1A 4XQFA 2J5PA 1BI0A 2ZFUA 1XGSA 2KDOA 1MBFA 1XGMA 4XLAA 2DK8A 5CPRB 2LF8A 4M71A 5E79C 1YS6A 2HYGD 2RNJA 2HKOA 4WX9A 2BOLA 3O2PE 2I5UA 2VBYA 4KIBA 2XASA 1JKOC 1ZG1A 2OZ6A 3CJQB 1LVKA 5J6XA 2G9WA 3U21A 3ROUA 4NUBA 5DUIA 1YX3A 3J80K 5IP9J 1GT0C 3CJNA 4JQFA 3VODA 1QPMA 2HQ5A 1I1SA 1XCVA 1IRZA 2Q1ZB 2DK5A 3S32A 1TWFJ 3E7LA 3ZQGA 4BEHB 2ETHA 2VJ4A 2WY7Q 1AWCA 1ZTRA 1B8IA 1J9IA 4RB1A 3CD6I 4KIFA 2Y48A 2YX4A 2JK3A 1ETVA 3LFUA 1NTCA 2VXZA 3BOQA 4Y33A 1ETXA 1D5VA 2KMUA 4XLHA 3COAC 2VT3A 4JBAA 1Q1VA 1SVLA 3GMEA 1ZGWA 1G3TA 2AXLA 5J8FA 2IPQX 3AG1H 1P9QC 2XF6A 3C3WA 3DF8A 1P7JA 4FE4A 1MJ9A 4EM0B 2CSOA 1LB2A 1WPKA 2X4HA 2VJ5A 3MVPA 4HA8A 2Z5UA 4BKXA 1CF7A 3LOCA 4E6KG 1QHHD 1J7KA 1HSTA 4CXFA 1KA8A 2CYYA 5TISC 1A5JA 2X1CA 4L9JA 4EGZA 3Q9VA 4A3BJ 2DJNA 3HGYA 3ASOH 4OINF 3CC7I 4CO8A 3ABTA 4P1WA 1MNMC 1JE8A 2FBHA 1DPRA 4B4CA 1S8NA 2VKVA 1KU9A 4XSZF 1XX5A 1X1BA 2ESNA 5KVRA 1QPIA 3H5NA 4I0AA 4JX5A 3RKXA 4A3FJ 1EA3A 3V8JA 3GYHX 4V2GA 3VSKA 4KIGA 4FT8A 3FWEA 1F9NA 2JUGA 3FMQA 3L9FA 2GLOA 4LGWA 4U87A 1ZR4A 4BXXJ 3R0AA 5B1AH 2H6BA 2L5QA 2VB6A 3BJ6A 2DU9A 3I3LA 3NWTA 3KYCB 5DUKA 2ECCA 5HDNA 2DOEA 4ENMA 2M30A 1ORKA 1MMSA 1O4XA 1JXSA 1UFMA 3BT9A 2EQRA 5FKLA 1Y39A 1IDYA 3L09A 2EFNA 5LHIA 3FXMA 3K4NA 1N77A 1IN4A 5C3EJ 3BR5A 3RSNA 3P9KA 2Z2SB 3HOXJ 1U9NA 2M9HA 5FKMA 1OYYA 1K6OA 2IS6A 1DGRM 3CQZJ 3SJMA 4XKBA 4HX7A 2LKPA 5IP6A 4DIQA 3OSFA 4PGHA 3TP0A 3WU1B 3I53A 3HSFA 2H8RA 3OYKA 2JTVA 2Q8KA 1IN6A 5E3MA 4E7JA 1XB4A 4HYEA 5DD4A 2NVQJ 2V1XA 5BPIA 3CDIA 4C2TA 2ZNZA 3WG9A 1NHAA 2GXAA 3PQJA 4R1HA 2CH0A 1J2XA 2KRCA 2JSPA 4PJLA 1IGNA 3ZQLA 2P5KA 1RKWA 5DCMB 3OOPA 1T6SA 4IJAA 1XMAA 4OMYA 2FU4A 4LOCA 3IC7A 1B59A 4PFPA 2EIJH 3EYYA 4IPAA 2QSHX 2XPUA 1KONA 2RQPA 3F6VA 4EJVA 1RC9A 1FBUA 4FQGA 4XLCA 1F1ZA 1SAXA 2LR8A 2E71A 2HZDA 1C0WA 2DA7A 3G71I 3ZMTA 2PMHA 4LJZF 1XSXA 2HVSA 2JJ7A 4DW6A 2CGPA 3BTIA 4DGWB 1AOYA 1WFXA 3CDHA 2IP2A 1RZ4A 2DT7B 2M8GX 3OYNA 4RAYA 4FASD 3ZMSA 1WJ5A 2XVCA 1BI2A 2DFEA 1JTXA 3OSGA 2ZCWA 5JLXA 4IHTA 1LKXA 3WODF 3HOZJ 1XN7A 1D1CA 3V7SA 3CUQA 2Y2ZA 2EILH 2AO9A 2FMYA 3K70D 4IKFA 2FMLA 1NH3A 2DYRH 2QENA 2ZNYA 5TGTA 2OD5A 4PJ0C 3DFGA 3ZQHA 1DU0A 2KZGA 2RC4A 2R93J 2JWTA 3CF2A 4KFCA 2BVMA 3F8CA 2FNPA 3O8HA 3WTVC 3JSPA 3Q5FA 1UG2A 1Z6RA 4ESJA 3CCUI 2CUZA 2ADUA 2E60A 5EJCA 2W1OA 1FX7A 5L3FA 1FIPA 1F36A 2XKOA 3PFIA 4BJTA 1BA5A 1KU2A 1S6LA 2XKPA 4I2OA 3RKWA 3K2ZA 2JA7J 1TWHJ 4IO9F 1YX5A 2VPRA 3UKGA 1JTYA 1XS9A 2YUSA 3HHGA 1F5TA 4M9SA 2R5ZA 2LDUA 1MIJA 2KRFA 2EH3A 2WBMA 4UVAA 1LFBA 4H4KC 3OYLA 1U5TB 1NG6A 3CO6C 1TLHB 1ENHA 2CQQA 2ZXWH 1PP7U 3JR9A 2M7AA 5J1YA 5C4XJ 3QYEA 1KYWA 3MKLA 1TWAJ 1TT5B 3KP2A 4M3FA 5HLTA 2XAGA 4U88A 5C44J 3OIOA 4D7MA 1T0FC 2W85A 3BP8A 2UUZA 5E20A 3J7AO 3SHFA 1SEUA 1HW2A 3T1BA 1TQIA 2GAUA 3WTSC 3ZQQA 5FLXK 2G7HA 2NS8A 1E3OC 1W7PA 1MBHA 5DV5A 1DP3A 1XSVA 2KIUA 3BR0A 1SD4A 1ZREA 1JGGA 2R7OA 3HRUA 3AFHA 4GYGA 2LMDA 4RGXA 5JHFA 3H3UA 4CYCB 3IAS2 1IXSB 2QSFX 1Z6TA 3FXKA 3MD2A 2N8GA 3ZP5A 2Y31A 2HKXA 3O3KA 3K10A 3ERED 5F27A 2PLYA 2NNNA 1KGSA 3ZQCA 3OL3A 1FTZA 3PQKA 2IJLA 4CZZA 2RN7A 2VKDA 3CJRB 2ZMEB 1VQMI 2J5OA 3B02A 4M3BA 1OCRH 1WJBA 4BH9A 3BC8A 4HPQA 2WADA 2FSWA 2EFPA 1G4DA 2KHMA 3RYPA 3WTUC 2A69F 3HTUA 1YJWI 2CW7A 4C3JJ 5L3BA 4RM3A 1G2HA 1U0JA 3F72A 5ICGA 2GOMA 1JKPC 2AHQA 3DCFA 1JUSA 1P2FA 2DMTA 2GZWA 5AIPA 5D5XB 3RI4A 3BTCA 3J80Z 5JI6A 3T8TA 4AIJA 2W7NA 1U9OA 4BHBA 1V5FA 2O8XA 1XCBA 1J0RA 3JRAA 4UV8A 2NNYA 2PJRA 4V2FA 4HRIA 1X3UA 4IVNA 1D0XA 2EIKH 1U8BA 2OA4A 2DA3A 2CQ7A 1M1EB 3Q0WA 2JA5J 3KETA 2ELKA 1DUXC 5LLQA 2XAFA 1XD7A 1Z77A 2QYOA 3GLLA 4G7OF 4LK0F 2K40A 3PNYA 3ISPA 4G6TB 3M9AA 5FD5A 4YEJA 3K1PA 5LHHA
chains in the Genus database with same CATH topology
3OYJA 1Z21A 3S3MA 4J00A 5CQEA 3OYAA 4KT6A 2KLOA 3A1YA 4NC7A 4CSWA 3HG9A 4LITA 5HVQC 3M1CA 3W3CA 1BR2A 1OR7C 4QPQA 3OYEA 2CW8A 2IGKA 3AL0C 2IXSA 4B44A 1WJDA 1G8XA 3HC7A 3DTKA 1Y6IA 2L2OA 4KJZA 2R7RA 2R7QA 2ELJA 2FUG2 3OYDA 2HPMA 1YE9A 2R7WA 1OLTA 2R7VA 3GBGA 2KL4A 2HPIA 3FHNA 4XL9A 2KRHA 4CCMA 2M7BA 1W36D 2E5ZA 3OMYA 2HNHA 4XONA 4FETA 2QKMB 3OYIA 3TBIA 4BL0B 4PSXA 2R7XA 3S3NA 4X0GA 4ZTJA 3H35A 4AYBA 1QHGA 3KEYA 4HSRA 2F4IA 1MMNA 3CP2A 1K6YA 4BQNA 2VPLA 2P0WA 4PFOA 4XN3A 2X85A 2DT6A 5KCMA 3DPTA 2HVRA 4P5OA 3W2VA 3OYFA 2LY2A 4RLFA 3FBIB 4YELA 4E7LA 4NNJA 2A5WA 1MMAA 5FRMA 4XKVA 3CMMA 3VSLA 4BU2A 3K4LA 2HU9A 4LG3A 2DCEA 1LDKB 3LSKA 2LY1A 3FKJA 2M3AA 1WJEA 2BW3B 2MC4A 2I8DA 4PUSA 2HDWA 3W2WA 3C2GA 3QYBA 3SEQA 1IRXA 1GLNA 4CH7A 4CCJA 2AQFA 4GRIA 2V26A 2MFZA 4CUGA 1TT0A 2IS4A 2UV1A 2ZXIA 3LSIA 3FBNB 1N75A 2DJIA 3ZCOA 4BQQA 1E0EA 2LOOA 4ITVA 2ZXHA 4ZDOA 4LIUA 3QODA 4II3A 3CZ6A 3PUBA 4PK4A 1SFKA 3PL8A 2M4KA 2IS2A 3VYUB 4XR6A 3MKYB 2IS1A 2X51A 4B47A 2Z1DA 4C2UA 3IP4B 2W82A 2X6WA 2X6YA 1MMDA 3H9QA 3HOSA 3L2WA 4D9JA 2CV0A 4CCOA 3QYFA 3MMYB 3PNTA 4XNFA 3PFYA 2UWMA 1X19A 2V7FA 3OL4A 3FDYA 4XQFA 4HNUA 4R79A 2ZFUA 2KDOA 2VQHA 3I9V2 3DLAA 4PJJA 4XORA 4XLAA 5CPRB 3A4CA 3DWLE 3TMOA 4NC8A 1S9HA 5HOOA 4F52A 4BXFA 2BOLA 1X1CA 4HG2A 1AA7A 2CUJA 3EUAA 4E4HA 3LMMA 2VL8A 3CJQB 1LVKA 3OYCA 3V42A 3U21A 3NWSA 1WJFA 4NUBA 4AVZA 1YX3A 3AKZA 3OWTA 4JQFA 3SEZA 1VZ0A 3PJRA 2E5NA 4KISA 1DGWY 3C2HA 2X1EA 3KX2A 2Q1ZB 3PSFA 3OS0A 4ZJZA 3S32A 1G59A 4XN0A 4ANJA 3K4JA 2X6XA 2W4SA 4BEHB 4XOPA 2VJ4A 2WY7Q 3UNGC 3G2BA 3N05A 3A2KA 2M4GA 2JVHA 3ZGKA 4PJNA 1LFPA 2VQGA 3OIQA 4Y33A 1BR1A 2VXZA 3LFUA 1MW7A 4XOTA 2KMUA 3LL7A 4PSWA 2OC6A 4XLHA 1HA8A 2XDVA 2A6TA 3ONQA 4F93B 1X4OA 1TZLA 4F91B 4N4OB 3OS1A 2X1DA 3LSGA 4F3QA 1SAUA 4E7SA 1P9QC 2XF6A 3K4CA 3OR2C 3OYMA 3DPLC 3OS2A 2CMPA 2VJ5A 3E1SA 4BDZA 3SDBA 3L2VA 4D1QA 4E6KG 1QHHD 4BE1A 4CCNA 4BE2A 3LSHA 4JOMA 3DU6A 2X1CA 3F9KA 4AU7A 4Y3OA 4E7ZA 4NQWB 4P1WA 2LG4A 3OOUA 4KITB 2LBFA 1X1BA 3S8PA 4YRVA 2V4JC 3H5NA 3K70C 2VLAA 3J7AY 4BUPA 3VYTB 1D1AA 2VQLA 1MNDA 1EA3A 2VJIA 3RCOA 4IX7A 3L2RA 2MABA 3VSKA 2E1MC 3VDXA 1BOBA 2JUGA 2V1NA 2CV2A 3DU5A 4U87A 3OYHA 3SZGA 2IGOA 2RQQA 2BVLA 2L5QA 2VB6A 3I3LA 3NWTA 5CKTA 3TL4X 3EPZA 3HUGB 3BG7A 1X1AA 3DKXA 3EUHC 4BJ6C 2BW3A 4OAZA 4N4NB 3D5SC 4OWRB 2PMZA 3L2UA 4BJ5C 1UAAA 3K4NA 1N77A 2K5CA 2E1MB 3RSNA 2Z2SB 4DBQA 4J01A 3EUKL 4RMNA 1PJRA 2IS6A 1DGRM 2KP6A 1UELB 4XKBA 2M0MA 2DOAA 4DIQA 2XAUA 3OYKA 2VIXA 2MYSA 3D5RC 4E7JA 3K4BA 4XKCA 4XMYA 3OY9A 3K4MA 2QKLB 3ZRGA 4B43A 4LIVA 3CP8A 3HPHA 3RQ4A 4C2TA 2NOJB 2Y0SA 2LRDA 2CH0A 3OYGA 2KRCA 3BCBA 2JSPA 2LYCA 4PJLA 2L9NA 3E0JB 2Z16A 2F5VA 4OAYA 2VKHA 2K9LA 4XLFA 2PJRB 3VYRB 2IGMA 4II2A 4PFPA 4CZCA 2VJJA 4F92B 3QOEA 2RREA 1KONA 3HL2A 2O5RA 4XLCA 1MNEA 2CV1A 2HZDA 3RTRA 2R4GA 2LREA 2HVSA 1JI8A 1D1BA 4BEHA 1X4PA 4DGWB 3PSIA 1WFXA 1V5GA 2DT7B 2XF7A 3OYNA 4FASD 1N78A 3H5AA 1WJ5A 1WJAA 3OIPA 2L7KA 2V6EA 2R7UA 2W00A 4ZDPA 3HXLA 3DQVC 2GOXB 3IAM2 1LKXA 3S93A 1D1CA 3K4KA 4DOZA 4CCLA 3K70D 4IKFA 4HSTA 5TGTA 3M8JA 2MD0A 1MMGA 3K6GA 2XSJC 3CF2A 4E7KA 4QPOA 2BVMA 4C30A 4Y4RA 2L9SA 2HVQA 4E7IA 4DJAA 1T95A 2CUZA 4C9YA 4CCKA 2E60A 3ZR8X 2W1OA 1ZELA 3LSMA 5FROA 3DEEA 3H9JA 4EATA 3DPUA 4BJTA 3D5LA 3VYSB 1J09A 2JA2A 4DBRA 2LC2A 3OYBA 3PNVA 4BDYA 1Z3XA 1YX5A 4BGDA 5KHDA 2LBFB 1UG0A 1Y56A 2WBMA 2RNGA 1FMVA 4H4KC 3OYLA 1NG6A 1D0YA 2AQEA 2M7AA 3QYEA 3AL0B 5HLTA 3BLYA 2K3PA 3RPUD 4CA0A 2WAFA 1T0FC 1W36C 3HOTA 3L2QA 2UUZA 3W2AA 3BG6A 2OUMA 2KPMA 4HNTA 3MKWB 3ZQQA 2IGNA 1V5EA 3ZXSA 5FRNA 1DP3A 2Q2EB 2VQCA 4ZDLA 3UR3C 4RLQA 4BS9A 2LH9A 4U7BA 2R7OA 2WA0A 3AFHA 4BQOA 5JHFA 1PYVA 3H5RA 3IAS2 3IUOA 3MD2A 4ZYAA 2WAQA 1X1DA 3KYLA 4HEA2 3H0DA 4ZC3A 3K10A 3VWBA 1Z3YA 5HNFA 4IZZA 4XKWA 3DKYA 3S3OA 3OL3A 2CS3A 3MKZA 2CFOA 5LD2C 2VKDA 3CJRB 3SYTA 5KNLA 4BE0A 4IQ4A 1Z7LA 2R7TA 1WJBA 5CQGA 3BC8A 4HPQA 2WADA 1QU3A 2KHMA 1D0ZA 2ZSIB 2KZVA 1DQUA 5HNHA 2CW7A 2JVGA 2VASA 4RM3A 2KQRA 1U0JA 3BCAA 3H9GA 2GOMA 4B48A 1FMWA 4RM2A 4ZTFA 4E7HA 3DTEA 2W7NA 2WY8Q 4IQJA 3HPGA 1V5FA 3HKZA 4F55A 1NG7A 4PJMA 2PJRA 4B3XA 4HRIA 1ERDA 2DXIA 2WAEA 2R7SA 1D0XA 1R6RA 2HQAA 4XLEA 5LFAA 2VXDA 3DTIA 2F6CA 4MLOA 4XM3A 2ZSHB 2XF5A 2WB1A 3PNYA 4BACA 1BR4A 4G6TB 2V9KA 2OV7A 2K9MA 3OR1C 1WJCA 4YEJA 2XC7A 3CESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZZ A;  4HRI A;  3QOE A;  3QOD A;  4J00 A;  4YRV A;  4J01 A; 
#chains in the Genus database with same CATH topology
 1VQ9 I;  5K7H A;  1RNL A;  1VTN C;  4L9T A;  5CQE A;  2KLO A;  3A1Y A;  4NC7 A;  1KZH A;  1PDN C;  3S1Q J;  1U5T C;  1FPQ A;  3DEW A;  4LIT A;  1RR8 C;  2DQL A;  1PVE A;  2E1N A;  2IBD A;  2TDX A;  3W3C A;  1MKM A;  5FFX A;  1FOW A;  2IGK A;  5K5O A;  1RES A;  4B44 A;  1JGS A;  1Y6I A;  1ZK8 A;  1Y0N A;  2FUG 2;  4IHY A;  2ZO4 A;  1VQL I;  4CHU A;  4AVP A;  4CCM A;  2CJJ A;  3FHN A;  4XL9 A;  4LB6 B;  1VQ8 I;  5FRN A;  2NVT J;  1MJB A;  5EEG A;  4XON A;  3TBI A;  1JT0 A;  3GUD A;  4PSX A;  3S3N A;  4X0G A;  4AYB A;  2R7D A;  2NOG A;  3KEY A;  5EDN A;  1G6N A;  1TWC J;  2Y30 A;  3JRI A;  5J47 A;  2NAZ A;  4V19 K;  2VPL A;  2P0W A;  2ZFW A;  3M3Y J;  4XN3 A;  2DT6 A;  2Y75 A;  4HQM A;  4M6X A;  2HDD A;  3JAM Z;  4IHS A;  1EH6 A;  4XRM A;  2KIM A;  2V79 A;  4P5O A;  1H89 C;  3M7G A;  2LY2 A;  5M5X J;  1W5C C;  4YEL A;  4ZYH A;  2O7O A;  1R58 A;  1ONV A;  1AKH B;  4XKV A;  4BU2 A;  4L5E A;  1BC8 C;  3TOB A;  4GCV A;  1G3Y A;  5DM6 F;  3C7J A;  1JKQ C;  2DCE A;  2ZME C;  1LDK B;  4IRH A;  1BC7 C;  3WU0 A;  1IUF A;  1IXC A;  3LA7 A;  2HDW A;  3P9C A;  2KIQ A;  4BY1 J;  3FIW A;  2D5V A;  1EKE A;  4CH7 A;  4CCJ A;  2JZY A;  3KP6 A;  4QTR A;  4NDL A;  3W6V A;  5F64 A;  1FOK A;  4ZYG A;  4UV9 A;  3ZCO A;  1N75 A;  4BQQ A;  1T39 A;  3M4O J;  2LOO A;  2P5V A;  2B0L A;  4LIU A;  2H27 A;  3FHZ A;  2CW0 F;  1SFK A;  3PL8 A;  4L5I A;  3LAJ A;  3MKY B;  2EFQ A;  5EGO A;  4G12 A;  3S1N J;  3ULQ B;  2PN6 A;  1BW5 A;  4W1U A;  5D5W B;  4UXN A;  3CJT B;  3CCM I;  2L3D A;  4FCY A;  3GTK J;  5IT3 A;  2COB A;  3MMY B;  3PNT A;  3PFY A;  2VI6 A;  1MZB A;  2IA2 A;  1X19 A;  2V7F A;  3OL4 A;  3FDY A;  4DQ2 A;  4JP0 A;  3BJA A;  4HNU A;  2XUB A;  4JK1 X;  4R79 A;  3I9V 2;  3DLA A;  2OU2 A;  2B63 J;  3T0Y A;  3DWL E;  3KPH A;  3TMO A;  5DCF A;  5HS8 A;  5HOO A;  4QSH A;  4F52 A;  2UXX A;  3S2W A;  4HG2 A;  3G6E I;  3HOU J;  2MG4 A;  4O5V A;  2XHK A;  2MH2 A;  2ZBK A;  4R8H A;  5IT9 K;  4MTE A;  4XLP F;  2OAZ A;  2L0K A;  4AWX B;  1SFX A;  4KIS A;  1DGW Y;  3C2H A;  2X1E A;  1G59 A;  3MAJ A;  4ZJZ A;  2LNB A;  3PO2 J;  1ETQ A;  2X6X A;  2Y0S N;  2W4S A;  3Q0U A;  4GXO A;  3UNG C;  3CLO A;  5K7Z A;  2F2E A;  5D6E A;  1FWZ A;  2JVH A;  4LG0 A;  3KEQ A;  3KCC A;  1YIJ I;  1LFP A;  3OIQ A;  3DBR B;  1BR1 A;  4IOA F;  3ABM H;  4XOT A;  3LL7 A;  2KFD A;  1HA8 A;  1MBK A;  3SZT A;  4D0P A;  4P55 A;  1SD6 A;  2W24 A;  4N4O B;  4F3Q A;  2CQN A;  1SAU A;  2DT5 A;  4E7S A;  4EJO A;  2LD5 A;  4PDK A;  1KQ8 A;  1HW5 A;  2CUE A;  1ZAR A;  3KE2 A;  3OR2 C;  3OYM A;  1WI9 A;  1O3R A;  5GPC A;  3VEP A;  4HDV A;  3W6J B;  4BQA A;  2Z3Y A;  3HSE A;  4LLL A;  3SDB A;  3L2V A;  4D1Q A;  2GXG A;  3MN2 A;  2HOT A;  1G3W A;  1O3T A;  3LSH A;  5ILV A;  3ZQI A;  1ZAO A;  3E97 A;  2XAH A;  1HKS A;  5GTH C;  4UB6 C;  3WTX C;  3DV8 A;  4IRI A;  4E7Z A;  2MSY A;  1YW7 A;  2LG4 A;  5F6F A;  2BE5 F;  1JUP A;  1YRN A;  2ZJR F;  3OOU A;  2LBF A;  5A2Q K;  5LGU A;  5IOY A;  1BJA A;  2V4J C;  3DEU A;  3J7A Y;  2ZJ2 A;  3U1K A;  4HNV A;  4BUP A;  3Q0V A;  2PX9 A;  3BG5 A;  4WF2 A;  4ON0 A;  2VJI A;  1R49 A;  3ECH A;  3L2R A;  4HF0 A;  3VDX A;  3B6A A;  5F0F A;  2Y69 H;  4AC0 A;  3I55 I;  5ICE A;  2NRA C;  2QM3 A;  4RBO A;  3HDD A;  2XB5 A;  3SZG A;  2BVL A;  5GAG J;  2K85 A;  4EMS A;  1A36 A;  1IAW A;  3HUG B;  4ASN A;  1IJW C;  2ID6 A;  2JMW A;  3V7C A;  3EUH C;  2BW3 A;  2DAO A;  3D5S C;  3TDZ C;  2CFX A;  3L2U A;  1X1P A;  2R0Q C;  5EG0 A;  3LNQ A;  4CDG A;  5FB2 A;  5TRD A;  2P5L C;  2RGV A;  4EV0 A;  2KJC A;  2VUM J;  4MEY F;  3RKQ A;  2EV6 A;  1HDD C;  1XC5 A;  1VQK I;  2DYS H;  4DBQ A;  4J01 A;  4Y52 J;  4HZF A;  2CU7 A;  3TOA A;  3NAU A;  3I59 B;  2DA5 A;  5EF6 A;  1PJR A;  1K4T A;  1UEL B;  3KFW X;  2X0L A;  3GXO A;  2M0M A;  1JT6 A;  3BR3 A;  2IA0 A;  1R00 A;  3A01 A;  1ZRD A;  1K78 B;  1YQA A;  2MYS A;  3K4B A;  2WC2 A;  2FQ3 A;  4RB0 A;  4LB5 A;  4F7Z A;  1K61 A;  1N25 A;  2MLG A;  2FEZ A;  3PM1 A;  2FQ4 A;  3I5U A;  4DYC A;  3T8R A;  2P6S A;  2LRD A;  4Q5S F;  3OYG A;  4ENK A;  4KYW A;  3JCU C;  5IYB J;  2L9N A;  4OAY A;  5JLW A;  2K9L A;  3M1E A;  4BAY A;  5EZH A;  1B1B A;  1KYZ A;  4XLF A;  3S2H J;  3C2B A;  2IGM A;  5L3C A;  1VQ7 I;  1B6A A;  2JN6 A;  2BY0 A;  4F92 B;  4QWQ A;  3QOE A;  3ZMV A;  3HL2 A;  2HR3 A;  4XIC A;  2H09 A;  2KJB A;  2CV1 A;  4ZZD A;  3BRO A;  1FSE A;  1ITY A;  2R4G A;  3HRM A;  4TV7 A;  3HRS A;  2LKX A;  1WSU A;  2LRE A;  1ZGA A;  1REP C;  1D1B A;  1BN5 A;  1X4P A;  1HQC A;  1MGT A;  4BEH A;  1FP2 A;  4ENJ A;  1I50 J;  3F8N A;  1J75 A;  1UST A;  3LSR A;  3IHU A;  3I4M J;  3HKZ N;  4JX6 A;  5FKK A;  1YW8 A;  2DFF A;  2W00 A;  1UMQ A;  4EQQ A;  2H94 A;  1H9T A;  4ZDP A;  2GOX B;  3IAM 2;  3N97 A;  2L4M A;  1X58 A;  1SVO A;  1YJ9 I;  1SVM A;  2M1B A;  3T5X A;  4CCL A;  3JTH A;  4AD9 A;  1U8R A;  1FSH A;  3M8J A;  1LQ1 A;  1LE8 B;  2HTJ A;  1UCR A;  3GTM J;  4Y4R A;  3JRF A;  1CF7 B;  1P4A A;  2HVQ A;  3DXJ F;  5BS6 A;  2O8K A;  1J5Y A;  4A93 J;  1VFC A;  3I64 A;  2BHZ A;  3GZN B;  3F8F A;  4C9Y A;  1VQP I;  1W5S A;  3HGG A;  1TNT A;  3GF2 A;  3VYS B;  1BIB A;  5JHU A;  4ZYE A;  3OYB A;  3L7W A;  1ZR2 A;  4BGD A;  3BTL A;  4MGR A;  4RDU A;  1G3S A;  1UG0 A;  2QBY B;  4YII A;  1Y56 A;  2VN2 A;  1FOY A;  5M3M J;  1UHM A;  5F0H A;  4Q47 A;  1P6R A;  2NXN B;  2OF7 A;  3LSJ A;  4G94 A;  4A3K J;  2FF4 A;  2K3P A;  2WWY A;  2XPV A;  1W36 C;  5GP9 A;  3HOT A;  3LAP A;  3L2Q A;  3W2A A;  3BG6 A;  4U0Y A;  5EEH A;  4HNT A;  1ODD A;  1ZRC A;  4ZDL A;  4KIC A;  4BS9 A;  3ZOB A;  1B72 B;  5F04 A;  2WA0 A;  4C3I J;  2F5F A;  4BQO A;  1ETW A;  1PYV A;  4BY7 J;  1YO5 C;  5GAH J;  5GAD J;  2VT2 A;  4ZYA A;  5CVI A;  3HEF A;  3V8K A;  3G1O A;  1MD0 A;  1X1D A;  2XGE A;  3ML6 A;  3GTJ J;  3R61 A;  4GFB A;  3TO7 A;  3G3Z A;  4IZZ A;  2F48 A;  3HRT A;  4EVI A;  1YFH A;  1W0U A;  2F5C A;  4BBS J;  1R7J A;  3JRB A;  1SFE A;  1IN7 A;  1ZLK A;  2R7T A;  4A3J J;  3K0L A;  2WAQ N;  3ZN0 A;  1RKT A;  2OCC H;  5F1R A;  4HX8 A;  2ZSI B;  4RA2 A;  1DQU A;  2VAS A;  3CDL A;  2CRG A;  4D7N A;  3BCA A;  3JSO A;  1ZRF A;  4IRG A;  4Q4Z F;  3BY6 A;  2HFH A;  1FMW A;  1LJ9 A;  4PGG A;  1JJ6 C;  2EPF A;  3IKT A;  2QZ8 A;  1R1U A;  3IRQ A;  1XPX A;  3K7A J;  2A5Y B;  3V7R A;  2WY8 Q;  4IQJ A;  5CLS A;  1NG7 A;  5DCM A;  4P9U A;  3K69 A;  1ZN2 A;  2DXI A;  1R1T A;  3MEX A;  5EYR A;  2XB0 X;  1EH8 A;  4G9Y A;  1UJ8 A;  1WRJ A;  4X1E A;  1S3J A;  3QPL A;  1Z9C A;  2FJ1 A;  2P81 A;  4XLE A;  2VXD A;  3WU2 C;  4C2M J;  2JPB A;  5FLM J;  1BOA A;  1QRY A;  3ELK A;  4Y7N J;  1ZH5 A;  1A04 A;  3BR1 A;  2F4O B;  1FBS A;  3F8M A;  5FKO A;  2HS5 A;  2XRO A;  4L0Z B;  1BR4 A;  4UY8 I;  2V9K A;  5E17 F;  3FXJ A;  3OR1 C;  2XC7 A;  3ZMD A;  3CES A;  2E19 A;  3JW4 A;  3CLQ A;  2E35 A;  2L7M P;  2E36 A;  1TQP A;  2BBY A;  3H1C A;  3HBL A;  3WTZ A;  3QPT A;  1GV2 A;  4C3H J;  2B7E A;  5K5R A;  3M1C A;  2HOS A;  4MHG A;  1JUM A;  2WB1 N;  1LEA A;  2BEO A;  2UXN A;  2H1K A;  1BR2 A;  4QPQ A;  3OYE A;  4M72 A;  2LVS A;  1WH7 A;  1LVA A;  2XGX A;  4IL6 C;  1T33 A;  2YX7 A;  4HOB A;  3FXO A;  5BOX A;  3E6D A;  3W6K B;  2E2I J;  1S7E A;  1IDZ A;  1OLT A;  1PUF A;  1R71 A;  1Y1W J;  3ASN H;  3QPH A;  2JPC A;  2KL4 A;  2RDP A;  4G7Z F;  2E5Z A;  1IW7 F;  2QQ8 A;  3OYI A;  3E5U A;  4BL0 B;  2M5W A;  4L9V A;  2EJR A;  1T38 A;  1QHG A;  1HXD A;  4GO1 A;  4HSR A;  5CVV A;  1MMN A;  3CP2 A;  3J81 K;  2JUC A;  3HM5 A;  2DW4 A;  1ETO A;  1AHD P;  2E1O A;  3HIF A;  2LP0 A;  3W2V A;  1VQO I;  1ZYR F;  3VSL A;  3K4L A;  1TW3 A;  1I3Q J;  4XSX F;  4A6E A;  5E18 F;  2QA4 I;  2C6Y A;  2HU9 A;  4A0Z A;  3GFJ A;  4CYD A;  4LFU A;  1ZQ3 P;  3FKJ A;  2PQ8 A;  1WJE A;  3KZY A;  2I8D A;  4PUS A;  1QVU A;  5F0C A;  3W2W A;  3C2G A;  1LPQ A;  3QYB A;  4ZZL A;  1GLN A;  2AQF A;  2V26 A;  4MIM A;  4CUG A;  2G0E A;  2ZXI A;  3HSR A;  3FBN B;  2DJI A;  4XBF A;  4M3E A;  1BL0 A;  4JYK A;  4CYC A;  2EZL A;  4II3 A;  1YTY A;  1ULY A;  3CZ6 A;  3H36 A;  1YW9 A;  3G1M A;  3VYU B;  2VOO A;  5HS9 A;  3VFZ A;  2IS1 A;  1QQI A;  4UVB A;  2K4B A;  2Z1D A;  1HLV A;  1UHS A;  3KP3 A;  3M8F A;  4YFX F;  5LEK A;  1WQ2 A;  2K4J A;  2HYF A;  2W82 A;  3QP6 A;  2A68 F;  1T08 B;  4D9J A;  2CV0 A;  2MH9 A;  1FY7 A;  1YS7 A;  4X6A J;  1TP4 A;  2ZME A;  4WCG A;  1HKT A;  2H1L A;  2MGQ A;  4ABZ A;  4N9H A;  2OBP A;  3FXL A;  2DMU A;  2STT A;  4XOR A;  4PJJ A;  1R22 A;  2ELH A;  5E1W A;  5ICF A;  3GTL J;  4EM1 A;  2BHY A;  4BXF A;  1X1C A;  2P7V B;  2QEX I;  3CMA I;  2CUJ A;  3BTJ A;  1USS A;  3HYI A;  2VL8 A;  3OYC A;  3V42 A;  1OFC X;  3NWS A;  3V8L A;  1WJF A;  3MZ8 A;  4AVZ A;  3ZMU A;  3AKZ A;  5D4S A;  2P7C B;  2EB7 A;  3TW7 A;  3SEZ A;  3GTP J;  1VZ0 A;  2DA6 A;  3PJR A;  3PSF A;  2R5Y B;  2NVY J;  4AIK A;  3RZO J;  1A6I A;  4ANJ A;  1YG2 A;  2OZU A;  1R4N B;  3A02 A;  3K4J A;  3TKY A;  5JFR A;  2AXT C;  4XOP A;  2FBI A;  2KT0 A;  3N05 A;  4G6D A;  2M4G A;  5CVU A;  1YOV B;  3ZGK A;  5LHG A;  4FHT A;  4PJN A;  3HTS B;  3QU3 A;  2QWW A;  1MW7 A;  2H6C A;  1EV7 A;  4PSW A;  3E6B A;  3WGG A;  2NS7 A;  2XDV A;  4F93 B;  3ONQ A;  1X4O A;  1GUU A;  2NYX A;  4F91 B;  1WH5 A;  4UUS B;  1R36 A;  2M87 A;  5FKN A;  1VND A;  3IKV A;  1O57 A;  3DPL C;  2DA4 A;  3OS2 A;  3WHC A;  3I54 A;  2DO7 A;  1W7P D;  4BDZ A;  2EA2 A;  4BHP A;  5IY5 H;  4DYR A;  3MZY A;  1EF4 A;  1Z67 A;  2BGC A;  2GBY A;  5ED4 A;  4CCN A;  3HJE A;  2IRF G;  1FBQ A;  1BI3 A;  2M8E A;  5ICC A;  4AU7 A;  5KK1 A;  4Y3O A;  2VC0 A;  2PJP A;  4NQW B;  5F08 A;  2GA2 A;  1E17 A;  1FTT A;  4ZYD A;  5IYD J;  4YIR X;  4A69 C;  1IXR C;  3FM3 A;  2VLA A;  2MC3 A;  3FF5 A;  3PUF A;  2IAI A;  1DU6 A;  2VQL A;  2Y9Y A;  1FEX A;  1T56 A;  3L2C A;  3JRE A;  2CQX A;  4XRS G;  4IX7 A;  1OR7 A;  1ZKG A;  2E1M C;  5B66 C;  2YS9 A;  2ZB9 A;  1TBX A;  1BOB A;  4YG2 F;  2XGC A;  3IH2 A;  3DU5 A;  3WTW C;  2R3S A;  2Z33 A;  4G7H F;  1TWG J;  2IGO A;  2RQQ A;  3OV8 A;  5CKT A;  3TL4 X;  5F1J A;  1OCZ H;  1ZG3 A;  3LA2 A;  3NRV A;  3BG7 A;  3SQN A;  1X1A A;  3DKX A;  1W4M A;  2W25 A;  5M5Y J;  4A12 A;  5LEJ A;  4UUT A;  3IH4 A;  4HW0 A;  1W5T A;  4I98 B;  2QUF A;  1I6H J;  1IN8 A;  2PMZ A;  4UUV A;  4BJ5 C;  4L9N A;  1WGX A;  3E6C C;  3FMR A;  1D8K A;  3C1D A;  3TP3 A;  1MBE A;  5CVR A;  2K5C A;  4MEX F;  1RPW A;  2ZC2 A;  4NHJ A;  4M6V A;  3EUK L;  2HYJ A;  2GA1 A;  2FOW A;  4N0B A;  5K1Y A;  1GHC A;  1R5G A;  2P4W A;  3O6B B;  4P9F A;  4OIQ F;  5EGO B;  2DOA A;  5HLH A;  5GTI C;  2XAU A;  1E2X A;  4HBL A;  4A5N A;  4HAM A;  4U0V A;  5FO5 A;  2RVC A;  4XMY A;  3OY9 A;  2MD5 A;  2QKL B;  3ZRG A;  3FXR A;  3BWG A;  4B43 A;  4LIV A;  3HPH A;  4RS8 A;  2Y9Z A;  2NOJ B;  1SAN A;  2LLK A;  3F3X A;  4HX4 A;  2W84 A;  1R1V A;  1SFO J;  3F21 A;  4NC6 A;  2OQG A;  2HOE A;  3BCB A;  2F5V A;  2VKH A;  1ZG5 A;  3N4M A;  3EET A;  2JRM A;  5DS9 A;  5E8G A;  2YR2 A;  2QQA A;  2LF7 A;  1L0O C;  2YPR A;  4A3D J;  5BQT A;  4GDF A;  2L01 A;  4II2 A;  4RGU A;  4FE7 A;  5L3E A;  1OJL A;  3DLL F;  1SC7 A;  1B9N A;  1OCT C;  2HGC A;  1TL8 A;  2QVO A;  2O5R A;  1H9G A;  1MNE A;  2FXA A;  1DDN A;  5J4V A;  2GXB A;  1MDM A;  2K27 A;  2DMQ A;  4KUM A;  2RV8 A;  2F4M B;  3X2Q H;  2QQB A;  1IF1 A;  1JI8 A;  3G73 A;  1F43 A;  4RB2 C;  3L00 A;  1HDP A;  2EBI A;  1ON1 A;  3HZJ A;  2XF7 A;  4FTH A;  2IW5 A;  2P6T A;  4HF2 A;  2ECB A;  2YSR A;  3OIP A;  1WJA A;  4LMY A;  3WE3 A;  1A31 A;  3EYI A;  2V6E A;  1FP1 D;  3CCE I;  1ACI A;  3HXL A;  3KP7 A;  4KMF A;  2EWN A;  2PMU A;  2K86 A;  2V9P A;  4KMU X;  3AG2 H;  4QIW N;  3KYD B;  2H8W A;  5FFZ A;  3SFZ A;  1Z0X A;  4DOZ A;  3A03 A;  4AUX A;  2FD5 A;  2LFB A;  4HST A;  1MMG A;  1OYW A;  2XSJ C;  4E7K A;  3SXY A;  4QPO A;  4C30 A;  1HF0 A;  2V9V A;  2FBK A;  2FX0 A;  4OOI A;  1P7I A;  5LRS A;  2IA1 A;  3KIO A;  1T95 A;  2K3F A;  5B1B H;  3ZPL A;  3FZV A;  3NAR A;  3F0C A;  3ZR8 X;  4DNC A;  1ZEL A;  5FRO A;  5E3L A;  3J81 Z;  1OKR A;  3DPU A;  3D5L A;  2DA2 A;  1ZHF A;  1TTY A;  2JT1 A;  2R92 J;  2EV0 A;  2JA2 A;  3ZQF A;  4KA4 A;  4IEJ A;  5ERI A;  3PNV A;  4BDY A;  1Z3X A;  1UHW A;  5KHD A;  2LBF B;  4I09 A;  1LDD A;  1OMI A;  2RNG A;  2PFB A;  1FMV A;  1OIS A;  4Z6Y A;  5FLX Z;  3GWZ A;  2EV5 A;  3TDU C;  2GM4 A;  1D0Y A;  4LLG F;  3WG7 H;  1V55 H;  1WCM J;  2AQE A;  2NVX J;  1X3W B;  1KQ0 A;  1QA6 A;  3AL0 B;  3IH3 A;  3RPU D;  4CA0 A;  1LDJ A;  4RAF A;  4WXD A;  1PP8 F;  2KKO A;  3NQO A;  2DBB A;  2DDA A;  4IHV A;  3MKW B;  2GIZ A;  2IGN A;  1V5E A;  3BG3 A;  3ZXS A;  1SD7 A;  1TW2 A;  1O7F A;  5TJJ A;  2Q2E B;  2VQC A;  3HUG A;  1Y1V J;  4YFK F;  2ZJP F;  5BPD A;  1NK3 P;  2L4A A;  3UR3 C;  3MFK A;  4RLQ A;  5HLG A;  1R23 A;  4HV6 A;  4M9Z A;  4U7B A;  3E5Q A;  5D8K B;  2ZJQ F;  3I4N J;  3S2D J;  2P8T A;  3VPR A;  1IV6 A;  3IUO A;  4A3L J;  2WAQ A;  5IOZ A;  2LKS A;  3KYL A;  2DQR A;  2EIN H;  4HEA 2;  3H0D A;  3VWB A;  2Q0O A;  3BR6 A;  3CC2 I;  3DKY A;  3I59 A;  3S3O A;  1XGO A;  2IEK A;  2OTL I;  3MKZ A;  5GPA A;  2CFO A;  5J1R A;  3ZQ7 A;  5HDG A;  2JRT A;  5LD2 C;  5KNL A;  3CCV I;  3CME I;  4BE0 A;  4IQ4 A;  1Z7L A;  3GZ5 A;  2NVU B;  1K78 A;  1IC8 A;  1F4K A;  2K9S A;  2XV4 S;  2CWE A;  1K83 J;  1QU3 A;  1Z91 A;  1D0Z A;  2UZK A;  3TED A;  2TRT A;  2K7L A;  1JJ8 C;  2STW A;  3WE2 A;  2KQR A;  2D2W A;  4MTD A;  1MH3 A;  3R60 A;  2VE8 A;  4AID A;  5LRR A;  4B48 A;  1JHH A;  4BBR J;  1ZLJ A;  3MWM A;  4EGY A;  4ZTF A;  4BNC A;  1IUY A;  3VOE A;  3B73 A;  2BY1 A;  1Q1H A;  4LK1 F;  3FK7 A;  2JSC A;  2E2J J;  3HPG A;  4G8X A;  1QNT A;  4F55 A;  5E1X A;  2B9S A;  1KU3 A;  3AG4 H;  4B3X A;  4S04 A;  2OQR A;  2R7S A;  2GWR A;  2HQA A;  3IWF A;  2R7Z J;  3MCZ A;  3DTI A;  1UB9 A;  1B8I B;  2V6C A;  2M45 A;  4FIS A;  4LD5 A;  4MQV A;  1WKM A;  5HOD A;  4XM3 A;  5D6F A;  5D5V B;  4WXH A;  1WHU A;  2DN0 A;  4O6J A;  3VB2 A;  2WB1 A;  2M2E A;  4MQ9 F;  4BAC A;  2OV7 A;  2K9M A;  1WJC A;  3QQA A;  3P7N A;  3QAH A;  4HF1 A;  3U1D A;  4DZJ A;  9ANT A;  2HWV A;  1T2K A;  3U9G A;  3OYJ A;  1Z21 A;  3R4K A;  2DTR A;  3S3M A;  1ON2 A;  4M74 A;  3BG9 A;  4KT6 A;  1QZE A;  4CSW A;  3HG9 A;  2D1H A;  2HZT A;  5B3S H;  3FM5 A;  4XLN F;  5C4J J;  3KLN A;  3A0B C;  3AL0 C;  2CW8 A;  3RPQ A;  2DFH A;  4RAZ A;  1G8X A;  3DTK A;  1LE8 A;  2L2O A;  1FLI A;  2RAE A;  3J7Y J;  2HPM A;  4KN4 X;  2GQQ A;  1I5Z A;  3FX3 A;  3NEU A;  1QGP A;  2HPI A;  3D0S A;  2KRH A;  2M7B A;  1W36 D;  3OMY A;  3JRH A;  4CGZ A;  4BXU A;  4FET A;  2QKM B;  2QF7 A;  4I7H A;  4MFE A;  4ZTJ A;  3H35 A;  4A0Y A;  5DDG A;  3CF5 F;  1R5H A;  2F4I A;  1P92 A;  4BQN A;  2QBY A;  2EFO A;  4B3A A;  1BBY A;  3GTO J;  3FKI J;  2HQR A;  3HHH A;  3IRR A;  2VON A;  2DPD A;  3RZD J;  4RLF A;  4I99 C;  2VC1 A;  3REO A;  2BYV E;  4NNJ A;  4NB5 A;  2A5W A;  3RYR A;  5ILS A;  4D5C A;  5FRM A;  2EA4 A;  3CMM A;  4JX4 A;  1RIO H;  5D4R A;  2HQN A;  1HCR A;  1U6G A;  2HTS A;  3SFI A;  4LG3 A;  2CQK A;  2E7W A;  3LSK A;  3E6M A;  1IRG A;  1HSJ A;  4A3I J;  1X3Z B;  3E3V A;  4XK4 A;  3PIP F;  4ETS A;  3SEQ A;  1IRX A;  1X2M A;  3QRF F;  2BZT A;  2X6O A;  3S1M J;  2MFZ A;  1TT0 A;  2HDC A;  2UV1 A;  1I6X A;  3LSI A;  1VQ4 I;  4FX4 A;  1B72 A;  2EZI A;  2R7F A;  3LFK A;  4ITV A;  1GVJ A;  4ZDO A;  3CCJ I;  2BXZ A;  3S1R J;  1OYI A;  1GXP A;  3PUB A;  4G6Q A;  4XR6 A;  4AIH A;  2WV1 A;  3H0G J;  3DBH B;  1Y8Q B;  3CMY A;  4H0E A;  2IT0 A;  1XGN A;  4C2U A;  1T0F A;  3GFM A;  2X6W A;  2X6Y A;  2DOF A;  1MMD A;  3H9Q A;  1D8J A;  1MBG A;  2CG4 A;  2E34 A;  5J1U A;  2DTZ A;  3HOS A;  4XRF A;  3ZMZ A;  4CCO A;  5M5W J;  3TQN A;  3F22 A;  1FYM A;  3HB9 A;  1HOM A;  2UWM A;  5IT9 Z;  1IG7 A;  2ZXJ A;  3GFI A;  1FJL A;  1YIT I;  2M34 A;  1D3Y A;  2VQH A;  5JR3 A;  1SMT A;  1GV5 A;  3A4C A;  3TO9 A;  4NC8 A;  1U2W A;  1S9H A;  2LSO A;  2A61 A;  4K2E A;  2GIV A;  1AA7 A;  3EUA A;  4E4H A;  1DPU A;  1B9M A;  3LMM A;  5E3N A;  5L3D A;  5ILU A;  2COM A;  2DA1 A;  2E2H J;  3B6C A;  3GO5 A;  3OWT A;  4A5M A;  2X9D A;  3FXQ A;  2E5N A;  3CO7 C;  2EZH A;  2FA5 A;  3KX2 A;  3OS0 A;  5DM7 F;  3JAM K;  2YU3 A;  4XN0 A;  1RI7 A;  2ME6 A;  5FLV A;  4Y13 A;  2HI3 A;  1CGP A;  2IVM A;  5IYC J;  3G2B A;  4Y15 A;  3A2K A;  3M07 A;  2KDZ A;  2WV0 A;  2I10 A;  1FNN A;  2VQG A;  1XMK A;  1MSE C;  4I0B A;  3GZ6 A;  1U3E M;  2OC6 A;  2A6T A;  1TZL A;  2XAJ A;  3O8G A;  3RJP A;  3OS1 A;  2X1D A;  1FYL A;  3P9I A;  4I02 A;  3LSG A;  4A2U A;  1O3Q A;  3CUQ B;  3WTY C;  1OQY A;  2VOD A;  3K4C A;  3LST A;  3JRC A;  3I4P A;  5IP7 J;  3QOP A;  1VQ6 I;  1TNS A;  2CMP A;  2AS5 F;  1LNW A;  3Q9S A;  3E1S A;  3JTG A;  5A2Q Z;  2HXI A;  2LY9 A;  2VE9 A;  2QSG X;  5J40 A;  1FIA A;  4QLC U;  4BE1 A;  4BE2 A;  4ESF A;  4JOM A;  4NBQ A;  3DU6 A;  2DMN A;  2FNA A;  3EQL F;  2CUF A;  3F9K A;  1FYK A;  3IWZ A;  2VBX A;  2LTP A;  4OU0 A;  4I6Z A;  2BXY A;  1R4M B;  1EH7 A;  1A6Q A;  1YLF A;  1PUF B;  3BZ6 A;  4M6Y A;  4KIT B;  3CCR I;  1WI3 A;  3S8P A;  3H92 A;  1H88 C;  3ERM A;  2XSD C;  1SD5 A;  2R5Z B;  1AU7 A;  1MSF C;  4YRV A;  1TC3 C;  2L9R A;  5LGN A;  3K70 C;  1YJN I;  3G1L A;  3SZP A;  1DP7 P;  1U5T A;  3VYT B;  1D1A A;  3GCM A;  4M3D A;  1MND A;  4MFD A;  4OIO F;  1GDT A;  1CQT A;  4LLN A;  2TCT A;  1YYV A;  3RCO A;  2MAB A;  4WWC A;  3K2A A;  2DDB A;  1K79 A;  1QVT A;  3RKY A;  1QBJ A;  4P96 A;  3KZI C;  5JVG F;  3CUO A;  2V1N A;  2CV2 A;  3V4G A;  1WWX A;  3OYH A;  1RET A;  1BW6 A;  3PO3 J;  4IOC F;  2ZKZ A;  2JA6 J;  5HS7 A;  3EPZ A;  1W7P B;  2MW8 A;  4CIC A;  2WTE A;  3HOW J;  5H6Q A;  4BJ6 C;  4L18 B;  2X48 A;  4OAZ A;  3RDI A;  4N4N B;  2F5E A;  3ABK H;  4OWR B;  1UAA A;  3ABU A;  3CTA A;  4L5J A;  4ESB A;  2W57 A;  4S05 A;  4XRS A;  3AAF A;  2E1M B;  3CCS I;  5J4Y A;  3GTQ J;  3TO6 A;  4RMN A;  2VBW A;  2YU9 J;  3I0T A;  2KP6 A;  5HDK A;  2V1D A;  1Y0U A;  2A6E F;  2BY2 A;  2KIF A;  5DD8 A;  1XMX A;  4PCQ A;  1LFU P;  3A0H C;  4A0X A;  4B09 A;  2QGU A;  2VIX A;  3D5R C;  3KP5 A;  1J59 A;  2L02 A;  4XKC A;  3FMS A;  2XGD A;  3K4M A;  3Q3S A;  3CP8 A;  1VF9 A;  3RQ4 A;  2Y0S A;  3KEO A;  1I3A A;  2L9V A;  1B4A A;  2LYC A;  2ISZ A;  3F6O A;  2Z16 A;  3E0J B;  2ID3 A;  2M0C A;  3AG3 H;  3JRD A;  3CUQ C;  3I58 A;  5FJ8 J;  1S7O A;  3VYR B;  2PJR B;  4HDU A;  5FGM A;  1IO2 A;  1R5I D;  4CZC A;  3S14 J;  2OJE D;  1KQ9 A;  5AIQ A;  2VJJ A;  3C18 A;  2RRE A;  3BR2 A;  4J19 A;  5E8I A;  1BIA A;  1XG1 A;  2DI3 A;  2E7X A;  3FXU A;  3KLO A;  4GYI A;  2R5Y A;  5DEQ A;  2LK2 A;  3RTR A;  3GTG J;  3F23 A;  3LSP A;  2RKH A;  3DBL B;  3PSI A;  4A3M J;  1IN5 A;  2OPT A;  2W48 A;  3CC4 I;  4WXC A;  1V5G A;  5KAI C;  1RR7 A;  2MLK A;  1WVR A;  4FX0 A;  1MJA A;  1IRF A;  1N78 A;  2BV6 A;  3H5A A;  4O3M A;  1BJZ A;  2L7K A;  2R7U A;  3MZH A;  2PEX A;  1E3H A;  2QLZ A;  1S72 I;  2MA3 A;  3DQV C;  2DPU A;  4UUS A;  3CCQ I;  2Y0M A;  2ESH A;  2BY3 A;  3S93 A;  2PI0 A;  4IHW A;  3K4K A;  1VQN I;  1BI1 A;  3F8B A;  2CO5 A;  5LGT A;  5L3G A;  2MD0 A;  3E5X A;  3K6G A;  2O9L A;  4RB3 C;  4UB8 C;  4UVC A;  3CCY A;  2L9S A;  4E7I A;  3H3V K;  2DFI A;  3G4S I;  1QZZ A;  4DJA A;  2O61 A;  4B1R A;  2HXO A;  4CCK A;  4I76 A;  4KN7 X;  3LSM A;  3GFL A;  4B8X A;  3DEE A;  3FK6 A;  3H9J A;  4A3C J;  4DZP A;  4EAT A;  2EZK A;  1J09 A;  4RGS A;  4RAG A;  4NQW A;  1T8I A;  4BYY A;  4DBR A;  1JKR C;  2LC2 A;  1TQM A;  5DYM A;  4Z2Y A;  1Z7U A;  3D1N I;  3LQQ A;  3BQZ A;  1WZ2 A;  1I39 A;  1MH4 A;  3FIS A;  4I01 A;  1I1G A;  3BZK A;  2F5D A;  3K1M A;  5BMZ A;  3BPV A;  1HBX G;  3K9T A;  2JA8 J;  3S15 J;  5K7F A;  1AKH A;  1A35 A;  5GAE J;  2VOP A;  1VQ5 I;  2KIS A;  1V54 H;  3BLY A;  3P5J A;  3WGI A;  1POG A;  4S0H B;  5KAF C;  2WAF A;  4N9I A;  1X2N A;  2OUM A;  2KPM A;  4KT5 C;  1XSD A;  1XTA A;  1P4X A;  5CVJ A;  1K7A A;  1EJ9 A;  5CYV A;  2K02 A;  3BQY A;  3K1N A;  2MBF A;  1Y8R B;  4EJW A;  5E3O A;  2DMP A;  3GW2 A;  2LH9 A;  4D5F A;  1H0M A;  4OIR F;  5H6R A;  1OCP A;  4AM3 A;  3H5R A;  3PIO F;  3U2R A;  4ZC3 A;  1FOX A;  4ENN A;  4U0W A;  1APL C;  1ZGJ A;  1T98 A;  1Z3Y A;  5HNF A;  4XKW A;  4BHC A;  5IPA A;  2CS3 A;  1YHQ I;  1YI2 I;  2Z9O A;  4KNY A;  3RQI A;  3SYT A;  1O7L A;  1OCC H;  3KP4 A;  2L54 A;  1V3F A;  4IF4 A;  4A3E J;  2K9N A;  5CQG A;  4IXA A;  3EUH A;  2KZV A;  1GVD A;  1OCO H;  5HNH A;  2EIM H;  1QZY A;  2JVG A;  3TGN A;  5JVT A;  3R6S A;  3H9G A;  2QCO A;  2XRN A;  2O6G E;  4HQE A;  4HV5 A;  1QO0 D;  4RM2 A;  3GX4 X;  2FRH A;  3RPU A;  5AON A;  4E7H A;  2OTJ I;  2E1C A;  4YFN F;  2O03 A;  3DTE A;  3EDP A;  3I71 A;  5BNG A;  3HKZ A;  5CJ9 A;  4PJM A;  4MO7 A;  3DKW A;  1ERD A;  1XDU A;  2WAE A;  2XAQ A;  2JQ7 A;  4RGR A;  1FT9 A;  1R6R A;  1D5Y A;  5LFA A;  1VI0 A;  1H8A C;  4U7D A;  3MQ0 A;  5HLI A;  3IL2 A;  3QU6 A;  2VKE A;  3HOY J;  2F6C A;  4MLO A;  4EEF G;  1MDM B;  4LG0 B;  2PBI A;  3LA3 A;  1STZ A;  3BZC A;  4UHT A;  1OPC A;  2ZSH B;  2XF5 A;  4IHX A;  1E3P A;  1P4W A;  1JHF A;  3S16 J;  3CCL I;  3BPX A;  4UNO A;  4J00 A;  3OYA A;  2FE3 A;  3GVA A;  1RUO A;  1FZP B;  2A3S A;  2K9Q A;  5HVQ C;  1L3L A;  1LEB A;  2HOA A;  1BM9 A;  2ISY A;  3LQR A;  1OR7 C;  5LBQ A;  4EJU A;  2IXS A;  5D5U B;  4EJT A;  5J8C A;  1WJD A;  1HKQ A;  4OIP F;  1NK2 P;  1I27 A;  3HC7 A;  1W1W E;  4W97 A;  2R7R A;  4KJZ A;  2R7Q A;  2ELJ A;  1IV8 A;  5M3F J;  1HC8 A;  3OYD A;  2A05 A;  2O0Y A;  1YE9 A;  2R7W A;  4EM2 A;  1S7A A;  2DLL A;  6PAX A;  1K4S A;  2R7V A;  3S17 J;  1YIO A;  3GBG A;  1YRN B;  1V4R A;  3M8E A;  2EFW A;  1KU7 A;  2HNH A;  4XID A;  2QQ9 A;  4GGG A;  3ESW B;  1S5L C;  3WHB A;  2R7X A;  1LUJ B;  1SFU A;  2ME0 A;  3QPS A;  3WGH A;  1RRJ A;  3GLX A;  3DP7 A;  3ECO A;  2L7Z A;  1K6Y A;  3H3Z A;  2D45 A;  2G7U A;  4A3G J;  4PFO A;  4OMZ A;  2X85 A;  1Z05 A;  4HLY A;  3QP5 A;  1HW1 A;  5KCM A;  3JRG A;  2D1V A;  4L0Y B;  3DPT A;  2ICW G;  1GXQ A;  2XIG A;  2HVR A;  3SDG A;  2XRL A;  3OYF A;  5J3L A;  3FBI B;  4E7L A;  4PZJ A;  1MMA A;  1IZ1 A;  3GEZ A;  2Z99 A;  4M3G A;  5H20 A;  4AYB N;  4Q48 A;  2EK5 A;  1R9T J;  2DOD A;  1ETK A;  2A6H F;  1UZC A;  2V1U A;  2LY1 A;  5D8L B;  2M3A A;  2PG4 A;  2ACJ A;  3ABL H;  2BW3 B;  2MC4 A;  2XPW A;  4A6D A;  1PUE E;  2NS0 A;  1XDS A;  1Z1D A;  5EG0 B;  3LWF A;  2OCE A;  3J7Z I;  2Q2E A;  4KDP A;  4GRI A;  4YIF A;  3KZZ A;  4Y17 A;  5EZG A;  4E70 A;  2O3F A;  2IS4 A;  3BDD A;  4MNU A;  1E0E A;  1O3S A;  2ZXH A;  4HLX A;  1MBJ A;  3RIR A;  1W0T A;  3QWL A;  3IV5 A;  3QOD A;  1RUN A;  3HOV J;  5B5E C;  3R0J A;  4PK4 A;  4ZH4 F;  2M4K A;  4M73 A;  2IS2 A;  3TW6 A;  2X51 A;  1ETY A;  4B47 A;  4WK8 F;  2A07 F;  5EEA A;  3A01 B;  5FD6 A;  3L1P A;  2HEO A;  3IP4 B;  3BJO A;  4M9X A;  3WTT C;  3I56 I;  3L2W A;  2FOK A;  5DTD A;  5K5Q A;  2L7F P;  2VBZ A;  1U78 A;  1S29 A;  3QYF A;  2PMZ N;  4DYQ A;  1FC3 A;  4XNF A;  5H2F C;  5E1Z B;  1SMY F;  3ZN1 A;  4XQF A;  2J5P A;  1BI0 A;  2ZFU A;  1XGS A;  2KDO A;  1MBF A;  1XGM A;  4XLA A;  2DK8 A;  5CPR B;  2LF8 A;  4M71 A;  5E79 C;  1YS6 A;  2HYG D;  2RNJ A;  2HKO A;  4WX9 A;  2BOL A;  3O2P E;  2I5U A;  2VBY A;  4KIB A;  2XAS A;  1JKO C;  1ZG1 A;  2OZ6 A;  3CJQ B;  1LVK A;  5J6X A;  2G9W A;  3U21 A;  3ROU A;  4NUB A;  5DUI A;  1YX3 A;  3J80 K;  5IP9 J;  1GT0 C;  3CJN A;  4JQF A;  3VOD A;  1QPM A;  2HQ5 A;  1I1S A;  1XCV A;  1IRZ A;  2Q1Z B;  2DK5 A;  3S32 A;  1TWF J;  3E7L A;  3ZQG A;  4BEH B;  2ETH A;  2VJ4 A;  2WY7 Q;  1AWC A;  1ZTR A;  1B8I A;  1J9I A;  4RB1 A;  3CD6 I;  4KIF A;  2Y48 A;  2YX4 A;  2JK3 A;  1ETV A;  3LFU A;  1NTC A;  2VXZ A;  3BOQ A;  4Y33 A;  1ETX A;  1D5V A;  2KMU A;  4XLH A;  3COA C;  2VT3 A;  4JBA A;  1Q1V A;  1SVL A;  3GME A;  1ZGW A;  1G3T A;  2AXL A;  5J8F A;  2IPQ X;  3AG1 H;  1P9Q C;  2XF6 A;  3C3W A;  3DF8 A;  1P7J A;  4FE4 A;  1MJ9 A;  4EM0 B;  2CSO A;  1LB2 A;  1WPK A;  2X4H A;  2VJ5 A;  3MVP A;  4HA8 A;  2Z5U A;  4BKX A;  1CF7 A;  3LOC A;  4E6K G;  1QHH D;  1J7K A;  1HST A;  4CXF A;  1KA8 A;  2CYY A;  5TIS C;  1A5J A;  2X1C A;  4L9J A;  4EGZ A;  3Q9V A;  4A3B J;  2DJN A;  3HGY A;  3ASO H;  4OIN F;  3CC7 I;  4CO8 A;  3ABT A;  4P1W A;  1MNM C;  1JE8 A;  2FBH A;  1DPR A;  4B4C A;  1S8N A;  2VKV A;  1KU9 A;  4XSZ F;  1XX5 A;  1X1B A;  2ESN A;  5KVR A;  1QPI A;  3H5N A;  4I0A A;  4JX5 A;  3RKX A;  4A3F J;  1EA3 A;  3V8J A;  3GYH X;  4V2G A;  3VSK A;  4KIG A;  4FT8 A;  3FWE A;  1F9N A;  2JUG A;  3FMQ A;  3L9F A;  2GLO A;  4LGW A;  4U87 A;  1ZR4 A;  4BXX J;  3R0A A;  5B1A H;  2H6B A;  2L5Q A;  2VB6 A;  3BJ6 A;  2DU9 A;  3I3L A;  3NWT A;  3KYC B;  5DUK A;  2ECC A;  5HDN A;  2DOE A;  4ENM A;  2M30 A;  1ORK A;  1MMS A;  1O4X A;  1JXS A;  1UFM A;  3BT9 A;  2EQR A;  5FKL A;  1Y39 A;  1IDY A;  3L09 A;  2EFN A;  5LHI A;  3FXM A;  3K4N A;  1N77 A;  1IN4 A;  5C3E J;  3BR5 A;  3RSN A;  3P9K A;  2Z2S B;  3HOX J;  1U9N A;  2M9H A;  5FKM A;  1OYY A;  1K6O A;  2IS6 A;  1DGR M;  3CQZ J;  3SJM A;  4XKB A;  4HX7 A;  2LKP A;  5IP6 A;  4DIQ A;  3OSF A;  4PGH A;  3TP0 A;  3WU1 B;  3I53 A;  3HSF A;  2H8R A;  3OYK A;  2JTV A;  2Q8K A;  1IN6 A;  5E3M A;  4E7J A;  1XB4 A;  4HYE A;  5DD4 A;  2NVQ J;  2V1X A;  5BPI A;  3CDI A;  4C2T A;  2ZNZ A;  3WG9 A;  1NHA A;  2GXA A;  3PQJ A;  4R1H A;  2CH0 A;  1J2X A;  2KRC A;  2JSP A;  4PJL A;  1IGN A;  3ZQL A;  2P5K A;  1RKW A;  5DCM B;  3OOP A;  1T6S A;  4IJA A;  1XMA A;  4OMY A;  2FU4 A;  4LOC A;  3IC7 A;  1B59 A;  4PFP A;  2EIJ H;  3EYY A;  4IPA A;  2QSH X;  2XPU A;  1KON A;  2RQP A;  3F6V A;  4EJV A;  1RC9 A;  1FBU A;  4FQG A;  4XLC A;  1F1Z A;  1SAX A;  2LR8 A;  2E71 A;  2HZD A;  1C0W A;  2DA7 A;  3G71 I;  3ZMT A;  2PMH A;  4LJZ F;  1XSX A;  2HVS A;  2JJ7 A;  4DW6 A;  2CGP A;  3BTI A;  4DGW B;  1AOY A;  1WFX A;  3CDH A;  2IP2 A;  1RZ4 A;  2DT7 B;  2M8G X;  3OYN A;  4RAY A;  4FAS D;  3ZMS A;  1WJ5 A;  2XVC A;  1BI2 A;  2DFE A;  1JTX A;  3OSG A;  2ZCW A;  5JLX A;  4IHT A;  1LKX A;  3WOD F;  3HOZ J;  1XN7 A;  1D1C A;  3V7S A;  3CUQ A;  2Y2Z A;  2EIL H;  2AO9 A;  2FMY A;  3K70 D;  4IKF A;  2FML A;  1NH3 A;  2DYR H;  2QEN A;  2ZNY A;  5TGT A;  2OD5 A;  4PJ0 C;  3DFG A;  3ZQH A;  1DU0 A;  2KZG A;  2RC4 A;  2R93 J;  2JWT A;  3CF2 A;  4KFC A;  2BVM A;  3F8C A;  2FNP A;  3O8H A;  3WTV C;  3JSP A;  3Q5F A;  1UG2 A;  1Z6R A;  4ESJ A;  3CCU I;  2CUZ A;  2ADU A;  2E60 A;  5EJC A;  2W1O A;  1FX7 A;  5L3F A;  1FIP A;  1F36 A;  2XKO A;  3PFI A;  4BJT A;  1BA5 A;  1KU2 A;  1S6L A;  2XKP A;  4I2O A;  3RKW A;  3K2Z A;  2JA7 J;  1TWH J;  4IO9 F;  1YX5 A;  2VPR A;  3UKG A;  1JTY A;  1XS9 A;  2YUS A;  3HHG A;  1F5T A;  4M9S A;  2R5Z A;  2LDU A;  1MIJ A;  2KRF A;  2EH3 A;  2WBM A;  4UVA A;  1LFB A;  4H4K C;  3OYL A;  1U5T B;  1NG6 A;  3CO6 C;  1TLH B;  1ENH A;  2CQQ A;  2ZXW H;  1PP7 U;  3JR9 A;  2M7A A;  5J1Y A;  5C4X J;  3QYE A;  1KYW A;  3MKL A;  1TWA J;  1TT5 B;  3KP2 A;  4M3F A;  5HLT A;  2XAG A;  4U88 A;  5C44 J;  3OIO A;  4D7M A;  1T0F C;  2W85 A;  3BP8 A;  2UUZ A;  5E20 A;  3J7A O;  3SHF A;  1SEU A;  1HW2 A;  3T1B A;  1TQI A;  2GAU A;  3WTS C;  3ZQQ A;  5FLX K;  2G7H A;  2NS8 A;  1E3O C;  1W7P A;  1MBH A;  5DV5 A;  1DP3 A;  1XSV A;  2KIU A;  3BR0 A;  1SD4 A;  1ZRE A;  1JGG A;  2R7O A;  3HRU A;  3AFH A;  4GYG A;  2LMD A;  4RGX A;  5JHF A;  3H3U A;  4CYC B;  3IAS 2;  1IXS B;  2QSF X;  1Z6T A;  3FXK A;  3MD2 A;  2N8G A;  3ZP5 A;  2Y31 A;  2HKX A;  3O3K A;  3K10 A;  3ERE D;  5F27 A;  2PLY A;  2NNN A;  1KGS A;  3ZQC A;  3OL3 A;  1FTZ A;  3PQK A;  2IJL A;  4CZZ A;  2RN7 A;  2VKD A;  3CJR B;  2ZME B;  1VQM I;  2J5O A;  3B02 A;  4M3B A;  1OCR H;  1WJB A;  4BH9 A;  3BC8 A;  4HPQ A;  2WAD A;  2FSW A;  2EFP A;  1G4D A;  2KHM A;  3RYP A;  3WTU C;  2A69 F;  3HTU A;  1YJW I;  2CW7 A;  4C3J J;  5L3B A;  4RM3 A;  1G2H A;  1U0J A;  3F72 A;  5ICG A;  2GOM A;  1JKP C;  2AHQ A;  3DCF A;  1JUS A;  1P2F A;  2DMT A;  2GZW A;  5AIP A;  5D5X B;  3RI4 A;  3BTC A;  3J80 Z;  5JI6 A;  3T8T A;  4AIJ A;  2W7N A;  1U9O A;  4BHB A;  1V5F A;  2O8X A;  1XCB A;  1J0R A;  3JRA A;  4UV8 A;  2NNY A;  2PJR A;  4V2F A;  4HRI A;  1X3U A;  4IVN A;  1D0X A;  2EIK H;  1U8B A;  2OA4 A;  2DA3 A;  2CQ7 A;  1M1E B;  3Q0W A;  2JA5 J;  3KET A;  2ELK A;  1DUX C;  5LLQ A;  2XAF A;  1XD7 A;  1Z77 A;  2QYO A;  3GLL A;  4G7O F;  4LK0 F;  2K40 A;  3PNY A;  3ISP A;  4G6T B;  3M9A A;  5FD5 A;  4YEJ A;  3K1P A;  5LHH A; 
#chains in the Genus database with same CATH homology
 3OYJ A;  1Z21 A;  3S3M A;  4J00 A;  5CQE A;  3OYA A;  4KT6 A;  2KLO A;  3A1Y A;  4NC7 A;  4CSW A;  3HG9 A;  4LIT A;  5HVQ C;  3M1C A;  3W3C A;  1BR2 A;  1OR7 C;  4QPQ A;  3OYE A;  2CW8 A;  2IGK A;  3AL0 C;  2IXS A;  4B44 A;  1WJD A;  1G8X A;  3HC7 A;  3DTK A;  1Y6I A;  2L2O A;  4KJZ A;  2R7R A;  2R7Q A;  2ELJ A;  2FUG 2;  3OYD A;  2HPM A;  1YE9 A;  2R7W A;  1OLT A;  2R7V A;  3GBG A;  2KL4 A;  2HPI A;  3FHN A;  4XL9 A;  2KRH A;  4CCM A;  2M7B A;  1W36 D;  2E5Z A;  3OMY A;  2HNH A;  4XON A;  4FET A;  2QKM B;  3OYI A;  3TBI A;  4BL0 B;  4PSX A;  2R7X A;  3S3N A;  4X0G A;  4ZTJ A;  3H35 A;  4AYB A;  1QHG A;  3KEY A;  4HSR A;  2F4I A;  1MMN A;  3CP2 A;  1K6Y A;  4BQN A;  2VPL A;  2P0W A;  4PFO A;  4XN3 A;  2X85 A;  2DT6 A;  5KCM A;  3DPT A;  2HVR A;  4P5O A;  3W2V A;  3OYF A;  2LY2 A;  4RLF A;  3FBI B;  4YEL A;  4E7L A;  4NNJ A;  2A5W A;  1MMA A;  5FRM A;  4XKV A;  3CMM A;  3VSL A;  4BU2 A;  3K4L A;  2HU9 A;  4LG3 A;  2DCE A;  1LDK B;  3LSK A;  2LY1 A;  3FKJ A;  2M3A A;  1WJE A;  2BW3 B;  2MC4 A;  2I8D A;  4PUS A;  2HDW A;  3W2W A;  3C2G A;  3QYB A;  3SEQ A;  1IRX A;  1GLN A;  4CH7 A;  4CCJ A;  2AQF A;  4GRI A;  2V26 A;  2MFZ A;  4CUG A;  1TT0 A;  2IS4 A;  2UV1 A;  2ZXI A;  3LSI A;  3FBN B;  1N75 A;  2DJI A;  3ZCO A;  4BQQ A;  1E0E A;  2LOO A;  4ITV A;  2ZXH A;  4ZDO A;  4LIU A;  3QOD A;  4II3 A;  3CZ6 A;  3PUB A;  4PK4 A;  1SFK A;  3PL8 A;  2M4K A;  2IS2 A;  3VYU B;  4XR6 A;  3MKY B;  2IS1 A;  2X51 A;  4B47 A;  2Z1D A;  4C2U A;  3IP4 B;  2W82 A;  2X6W A;  2X6Y A;  1MMD A;  3H9Q A;  3HOS A;  3L2W A;  4D9J A;  2CV0 A;  4CCO A;  3QYF A;  3MMY B;  3PNT A;  4XNF A;  3PFY A;  2UWM A;  1X19 A;  2V7F A;  3OL4 A;  3FDY A;  4XQF A;  4HNU A;  4R79 A;  2ZFU A;  2KDO A;  2VQH A;  3I9V 2;  3DLA A;  4PJJ A;  4XOR A;  4XLA A;  5CPR B;  3A4C A;  3DWL E;  3TMO A;  4NC8 A;  1S9H A;  5HOO A;  4F52 A;  4BXF A;  2BOL A;  1X1C A;  4HG2 A;  1AA7 A;  2CUJ A;  3EUA A;  4E4H A;  3LMM A;  2VL8 A;  3CJQ B;  1LVK A;  3OYC A;  3V42 A;  3U21 A;  3NWS A;  1WJF A;  4NUB A;  4AVZ A;  1YX3 A;  3AKZ A;  3OWT A;  4JQF A;  3SEZ A;  1VZ0 A;  3PJR A;  2E5N A;  4KIS A;  1DGW Y;  3C2H A;  2X1E A;  3KX2 A;  2Q1Z B;  3PSF A;  3OS0 A;  4ZJZ A;  3S32 A;  1G59 A;  4XN0 A;  4ANJ A;  3K4J A;  2X6X A;  2W4S A;  4BEH B;  4XOP A;  2VJ4 A;  2WY7 Q;  3UNG C;  3G2B A;  3N05 A;  3A2K A;  2M4G A;  2JVH A;  3ZGK A;  4PJN A;  1LFP A;  2VQG A;  3OIQ A;  4Y33 A;  1BR1 A;  2VXZ A;  3LFU A;  1MW7 A;  4XOT A;  2KMU A;  3LL7 A;  4PSW A;  2OC6 A;  4XLH A;  1HA8 A;  2XDV A;  2A6T A;  3ONQ A;  4F93 B;  1X4O A;  1TZL A;  4F91 B;  4N4O B;  3OS1 A;  2X1D A;  3LSG A;  4F3Q A;  1SAU A;  4E7S A;  1P9Q C;  2XF6 A;  3K4C A;  3OR2 C;  3OYM A;  3DPL C;  3OS2 A;  2CMP A;  2VJ5 A;  3E1S A;  4BDZ A;  3SDB A;  3L2V A;  4D1Q A;  4E6K G;  1QHH D;  4BE1 A;  4CCN A;  4BE2 A;  3LSH A;  4JOM A;  3DU6 A;  2X1C A;  3F9K A;  4AU7 A;  4Y3O A;  4E7Z A;  4NQW B;  4P1W A;  2LG4 A;  3OOU A;  4KIT B;  2LBF A;  1X1B A;  3S8P A;  4YRV A;  2V4J C;  3H5N A;  3K70 C;  2VLA A;  3J7A Y;  4BUP A;  3VYT B;  1D1A A;  2VQL A;  1MND A;  1EA3 A;  2VJI A;  3RCO A;  4IX7 A;  3L2R A;  2MAB A;  3VSK A;  2E1M C;  3VDX A;  1BOB A;  2JUG A;  2V1N A;  2CV2 A;  3DU5 A;  4U87 A;  3OYH A;  3SZG A;  2IGO A;  2RQQ A;  2BVL A;  2L5Q A;  2VB6 A;  3I3L A;  3NWT A;  5CKT A;  3TL4 X;  3EPZ A;  3HUG B;  3BG7 A;  1X1A A;  3DKX A;  3EUH C;  4BJ6 C;  2BW3 A;  4OAZ A;  4N4N B;  3D5S C;  4OWR B;  2PMZ A;  3L2U A;  4BJ5 C;  1UAA A;  3K4N A;  1N77 A;  2K5C A;  2E1M B;  3RSN A;  2Z2S B;  4DBQ A;  4J01 A;  3EUK L;  4RMN A;  1PJR A;  2IS6 A;  1DGR M;  2KP6 A;  1UEL B;  4XKB A;  2M0M A;  2DOA A;  4DIQ A;  2XAU A;  3OYK A;  2VIX A;  2MYS A;  3D5R C;  4E7J A;  3K4B A;  4XKC A;  4XMY A;  3OY9 A;  3K4M A;  2QKL B;  3ZRG A;  4B43 A;  4LIV A;  3CP8 A;  3HPH A;  3RQ4 A;  4C2T A;  2NOJ B;  2Y0S A;  2LRD A;  2CH0 A;  3OYG A;  2KRC A;  3BCB A;  2JSP A;  2LYC A;  4PJL A;  2L9N A;  3E0J B;  2Z16 A;  2F5V A;  4OAY A;  2VKH A;  2K9L A;  4XLF A;  2PJR B;  3VYR B;  2IGM A;  4II2 A;  4PFP A;  4CZC A;  2VJJ A;  4F92 B;  3QOE A;  2RRE A;  1KON A;  3HL2 A;  2O5R A;  4XLC A;  1MNE A;  2CV1 A;  2HZD A;  3RTR A;  2R4G A;  2LRE A;  2HVS A;  1JI8 A;  1D1B A;  4BEH A;  1X4P A;  4DGW B;  3PSI A;  1WFX A;  1V5G A;  2DT7 B;  2XF7 A;  3OYN A;  4FAS D;  1N78 A;  3H5A A;  1WJ5 A;  1WJA A;  3OIP A;  2L7K A;  2V6E A;  2R7U A;  2W00 A;  4ZDP A;  3HXL A;  3DQV C;  2GOX B;  3IAM 2;  1LKX A;  3S93 A;  1D1C A;  3K4K A;  4DOZ A;  4CCL A;  3K70 D;  4IKF A;  4HST A;  5TGT A;  3M8J A;  2MD0 A;  1MMG A;  3K6G A;  2XSJ C;  3CF2 A;  4E7K A;  4QPO A;  2BVM A;  4C30 A;  4Y4R A;  2L9S A;  2HVQ A;  4E7I A;  4DJA A;  1T95 A;  2CUZ A;  4C9Y A;  4CCK A;  2E60 A;  3ZR8 X;  2W1O A;  1ZEL A;  3LSM A;  5FRO A;  3DEE A;  3H9J A;  4EAT A;  3DPU A;  4BJT A;  3D5L A;  3VYS B;  1J09 A;  2JA2 A;  4DBR A;  2LC2 A;  3OYB A;  3PNV A;  4BDY A;  1Z3X A;  1YX5 A;  4BGD A;  5KHD A;  2LBF B;  1UG0 A;  1Y56 A;  2WBM A;  2RNG A;  1FMV A;  4H4K C;  3OYL A;  1NG6 A;  1D0Y A;  2AQE A;  2M7A A;  3QYE A;  3AL0 B;  5HLT A;  3BLY A;  2K3P A;  3RPU D;  4CA0 A;  2WAF A;  1T0F C;  1W36 C;  3HOT A;  3L2Q A;  2UUZ A;  3W2A A;  3BG6 A;  2OUM A;  2KPM A;  4HNT A;  3MKW B;  3ZQQ A;  2IGN A;  1V5E A;  3ZXS A;  5FRN A;  1DP3 A;  2Q2E B;  2VQC A;  4ZDL A;  3UR3 C;  4RLQ A;  4BS9 A;  2LH9 A;  4U7B A;  2R7O A;  2WA0 A;  3AFH A;  4BQO A;  5JHF A;  1PYV A;  3H5R A;  3IAS 2;  3IUO A;  3MD2 A;  4ZYA A;  2WAQ A;  1X1D A;  3KYL A;  4HEA 2;  3H0D A;  4ZC3 A;  3K10 A;  3VWB A;  1Z3Y A;  5HNF A;  4IZZ A;  4XKW A;  3DKY A;  3S3O A;  3OL3 A;  2CS3 A;  3MKZ A;  2CFO A;  5LD2 C;  2VKD A;  3CJR B;  3SYT A;  5KNL A;  4BE0 A;  4IQ4 A;  1Z7L A;  2R7T A;  1WJB A;  5CQG A;  3BC8 A;  4HPQ A;  2WAD A;  1QU3 A;  2KHM A;  1D0Z A;  2ZSI B;  2KZV A;  1DQU A;  5HNH A;  2CW7 A;  2JVG A;  2VAS A;  4RM3 A;  2KQR A;  1U0J A;  3BCA A;  3H9G A;  2GOM A;  4B48 A;  1FMW A;  4RM2 A;  4ZTF A;  4E7H A;  3DTE A;  2W7N A;  2WY8 Q;  4IQJ A;  3HPG A;  1V5F A;  3HKZ A;  4F55 A;  1NG7 A;  4PJM A;  2PJR A;  4B3X A;  4HRI A;  1ERD A;  2DXI A;  2WAE A;  2R7S A;  1D0X A;  1R6R A;  2HQA A;  4XLE A;  5LFA A;  2VXD A;  3DTI A;  2F6C A;  4MLO A;  4XM3 A;  2ZSH B;  2XF5 A;  2WB1 A;  3PNY A;  4BAC A;  1BR4 A;  4G6T B;  2V9K A;  2OV7 A;  2K9M A;  3OR1 C;  1WJC A;  4YEJ A;  2XC7 A;  3CES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...