1SFKA

Core (c) protein from west nile virus, subtype kunjin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
b'LSLTGLKRAMLSLIDGRGPTRFVLALLAFFRFTAIAPTRAVLDRWRSVNKQTAMKHLLSFKKELGTLTSAINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Core protein
publication title West nile virus core protein; tetramer structure and ribbon formation
pubmed doi rcsb
source organism Kunjin virus
molecule tags Viral protein
total genus 27
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1sfkA00
1R6RA 1SFKA
chains in the Genus database with same CATH superfamily
4UV8A 5FLVA 4PSXA 4EVIA 1T39A 4RAFA 2CH0A 4JK1X 1SFOJ 4P96A 3QYBA 2XPVA 1DGRM 3FIWA 1JUPA 2DFHA 2E2HJ 5CVUA 1Y0UA 2A3SA 2OA4A 3N05A 4IKFA 1T0FC 2GIZA 4Z2YA 3VSLA 2E1NA 4HPQA 2FNPA 2EFWA 4ZC3A 5HNHA 3ROUA 1LDKB 5J3LA 1A36A 2MC3A 1LFBA 2BVMA 4E7IA 2XVCA 5TISC 3GXOA 2VXDA 5GAEJ 1WJBA 4HF0A 2HR3A 1ETKA 2BZTA 5K7HA 4LB5A 1MMNA 1V5GA 3VB2A 3EDPA 2IS2A 3BR3A 1VQKI 4LIVA 3SEZA 3W6VA 3LFUA 3K0LA 5GAGJ 2VT2A 3BTCA 3LA7A 1LPQA 3EUKL 3TQNA 4WF2A 1QVUA 3OIQA 2EV5A 4IEJA 1M1EB 1P2FA 3IL2A 4RAZA 3CCVI 3IC7A 2MABA 1XDUA 3PIPF 1OCRH 1Y0NA 2Q0OA 2L3DA 1JJ8C 3O8GA 3PM1A 4L0ZB 1NTCA 3CJRB 2CUZA 3V7CA 1XD7A 3CCEI 2STWA 2R7FA 1U3EM 1EKEA 1WCMJ 3COAC 1JKPC 4CGZA 1G6NA 5FD5A 2HKOA 3RTRA 1O7LA 3W2AA 3JTHA 1N25A 1UFMA 2XB0X 1UCRA 2ZMEB 3FM3A 2VJ5A 2UXXA 4D9JA 3WTUC 2PLYA 1FIPA 1W0UA 5H20A 2OUMA 3J81K 3CCQI 2FXAA 4XLNF 2X6WA 1T38A 3MQ0A 4FETA 2ZSHB 4BE1A 2DN0A 4V19K 1HXDA 4PCQA 4S0HB 4JX6A 1YX3A 3HTUA 3MCZA 2Y30A 4FCYA 2R7WA 1D0YA 4B8XA 3F8NA 4CYCA 2HDWA 1LUJB 2V4JC 1I1SA 4QWQA 1OCCH 5KNLA 4WCGA 2ELJA 2YSRA 3BP8A 1W36D 3M8JA 2R92J 4V2FA 5F27A 1V4RA 4EM1A 3AG1H 1ZRFA 3WG9A 2XAFA 4M3GA 2HOSA 1FSEA 4IOCF 3GEZA 4U87A 2LD5A 2P6SA 2MC4A 1U6GA 3QYEA 2HVQA 1DP7P 3VFZA 2LSOA 1A35A 1HW1A 1OQYA 1WJDA 1IAWA 4A0XA 4OIQF 1LB2A 1LNWA 3OL3A 1IJWC 4EM2A 2YU9J 3R0AA 2F4OB 1RC9A 2GXGA 3LQRA 2CUFA 3BTIA 2O0YA 2CWEA 2X0LA 4NQWA 1FC3A 4N4OB 3L2RA 3PFYA 3HPHA 4UXNA 2JA8J 2X9DA 4F52A 3OOUA 4OOIA 1AKHB 2ZBKA 3QU3A 1Z7LA 1JT6A 2XGXA 2H09A 3DBRB 3GCMA 4IRHA 4RMNA 3JRHA 3HOXJ 4YG2F 4BH9A 3GTPJ 1GLNA 2ZXWH 4U0VA 1W0TA 4AVZA 3Q5FA 4EEFG 3F22A 2IAIA 2KKOA 4XLHA 4ETSA 5FROA 2V1DA 2KZGA 3UR3C 1K4SA 2Z33A 2JA5J 1MBFA 3PQKA 2RNJA 2BOLA 2L02A 3S3NA 1BW6A 2ESHA 2JRMA 2OJED 3JCUC 4W1UA 3K2ZA 2VC1A 1XGOA 2A69F 2ISYA 3E5QA 4XONA 3JREA 3CDHA 1MBHA 2I8DA 5J1YA 1QO0D 4XNFA 1BJZA 1OKRA 2FBHA 5LRRA 5FKOA 4IOAF 3WHCA 1HQCA 3ASNH 1YW8A 2E7WA 3CMYA 1YIJI 3I59B 3E97A 2LF7A 5HDKA 1ZARA 4GYIA 2MLKA 4AYBA 2DPUA 2QLZA 2KMUA 3LSHA 1SC7A 4IF4A 3I59A 3Q0UA 5HDNA 1LVKA 4L9NA 4C2MJ 3L7WA 4OAYA 5L3BA 1U2WA 1TWAJ 3ZQLA 3IHUA 3OR1C 4LG0A 4A2UA 2IGOA 2OF7A 4ESFA 2R5ZA 3GVAA 4EJWA 1VQ6I 2QCOA 2GOXB 4J01A 1Y6IA 2H8RA 1I6XA 2VPRA 1B8IA 2BE5F 4ZJZA 2JA6J 5DM7F 4XLAA 3ELKA 4GO1A 2JVGA 1W5TA 2BY2A 3V7RA 3H36A 4C2TA 3DTIA 2BHYA 4UVCA 3OYBA 2ZXIA 2DI3A 5EGOA 2FUG2 3OL4A 4OIOF 1RPWA 1ULYA 2VUMJ 5ILVA 3TOBA 3E7LA 1T98A 3QP6A 1D3YA 2E2JJ 1SFEA 3KP3A 1R6RA 4WWCA 1LE8B 1K79A 3SFIA 1J5YA 3MFKA 1QPMA 1IXCA 4AC0A 2H1LA 4HEA2 1JTYA 3DP7A 1P6RA 5DCFA 3KLOA 1TT5B 4S04A 4RBOA 5ED4A 5KK1A 2V79A 4ZYEA 2BGCA 5EG0A 1JGGA 1SD7A 1MNEA 4W97A 1JUMA 2WTEA 2WWYA 3GTLJ 2RV8A 1R00A 3V8KA 1BOAA 1IDYA 4ZYDA 3FMRA 3ZMSA 5DD8A 2DMNA 3CCMI 3LNQA 4HDUA 4PJJA 2DFFA 2EB7A 1UHSA 4QLCU 4CXFA 3LSRA 3OYKA 4R79A 2R7OA 2HYFA 2LNBA 3KP2A 1Z77A 4K2EA 3F21A 4IQJA 1ETOA 2K02A 4E6KG 2Z5UA 2QKMB 2O03A 1FBUA 5TJJA 2R7DA 3WGHA 2OTJI 4DIQA 1FYLA 1USTA 2GXBA 1FBQA 2Y0MA 4MNUA 1U0JA 2BXYA 1XTAA 1MMDA 3L09A 1F36A 1UG0A 1EF4A 2K85A 2EQRA 2CQXA 2MFZA 1ON2A 4Y33A 3HM5A 1K78A 3JSPA 3K69A 4BE2A 4ZYHA 1X3WB 4XL9A 1QZYA 4AUXA 2LY2A 2XSJC 3OY9A 4PJNA 5LFAA 2HS5A 5M5YJ 5E20A 3P9IA 1IG7A 1IDZA 1HKQA 3DKYA 3K2AA 2ZJ2A 4JP0A 4FE7A 4MTEA 2CUJA 5E3NA 1Z9CA 4XLFA 4ANJA 3KP5A 4C2UA 2VONA 1YW7A 2PQ8A 5HLHA 1WRJA 1WJCA 5ERIA 1F9NA 1TZLA 1OR7C 3C7JA 1R1VA 3HZJA 3A01B 1MMAA 3L2VA 4NB5A 1XSXA 3QRFF 1YO5C 2CV0A 2LOOA 3IRQA 3E6DA 1LDDA 5JR3A 3K1MA 2ZMEC 2W24A 3G1LA 3I53A 2PI0A 5F0FA 4G94A 1ZH5A 3MWMA 3VEPA 5D6EA 1RR7A 4A3KJ 3H3ZA 1GV2A 1V5FA 4A3JJ 3CO7C 3J81Z 3S2HJ 2OZ6A 4MQ9F 1B4AA 1IXSB 2M3AA 4L5EA 3SHFA 2R5YB 2D1VA 2IA0A 2LFBA 1VQ8I 3NRVA 3H9QA 3G6EI 1WSUA 3RIRA 3GFIA 3ZQCA 4DGWB 1P4WA 3Q9VA 3MZHA 2ACJA 3HL2A 1OCTC 4MO7A 1KONA 1XCVA 3ECHA 3OR2C 3DPTA 3FWEA 1RR8C 1KQ9A 2JMWA 4RAGA 3B73A 4CICA 4HV5A 3VYUB 2K9SA 3ZMVA 3AL0B 3MD2A 1X3ZB 3BPVA 3B6CA 1ETVA 2VBXA 3MKZA 1QVTA 1X1AA 4Q5SF 3ZCOA 4OIPF 1T08B 3FMQA 2F48A 3A4CA 4PK4A 1D1BA 1ZELA 2A5YB 5IYDJ 4HLYA 4LOCA 5HS8A 2CRGA 1S3JA 1J75A 1SAUA 2F2EA 2QQ9A 1IV6A 2KRCA 1RUNA 5F1RA 1X2MA 1REPC 2HFHA 1VQ7I 2QQ8A 2FOWA 2J5PA 1ODDA 2NOJB 3S1QJ 1GHCA 4A5MA 1TWHJ 4IHVA 2BV6A 3SXYA 2X1CA 2GQQA 1ON1A 3Q0VA 5JVTA 3S1RJ 3M7GA 2F5DA 1U9OA 4BY1J 3LSTA 1VZ0A 3NAUA 4ESBA 4CCKA 4BXXJ 3GTOJ 1ACIA 1PYVA 2HTJA 2MH2A 2UV1A 3MN2A 1FIAA 2K40A 4D5FA 3ZQIA 5A2QK 1D8JA 5IPAA 1BW5A 4A69C 5M3MJ 3K4NA 2Q2EA 3M8EA 4X1EA 2LKXA 2LY9A 4ZYAA 2ZSIB 4P55A 1VQMI 1R58A 1SD6A 3BZKA 2V1XA 2K9QA 2KHMA 3ZMZA 1HDDC 5EYRA 3I71A 2BY0A 1K4TA 1HDPA 2O8KA 1TL8A 4CO8A 2OTLI 1G3SA 2ID6A 1I27A 2M7AA 3CCSI 1MBGA 2DA2A 2JTVA 1ZTRA 1TT0A 1YTYA 1R7JA 2E1OA 3DLAA 1ORKA 2COMA 4BEHA 4XOPA 3MKLA 4BBRJ 2ZB9A 4EGYA 5LBQA 2C6YA 2UUZA 2AS5F 1SEUA 3DF8A 3PO2J 5F08A 4Y3OA 3H3UA 4OAZA 2DJNA 1DPRA 3DEUA 4XLCA 3S2DJ 2L01A 2M4KA 2IW5A 5DCMB 3S32A 3E6MA 2O9LA 9ANTA 2RC4A 2XAUA 1SFXA 1BL0A 1H9GA 4ZTJA 5ICGA 4EV0A 1KU7A 2VJ4A 1YX5A 2ZO4A 3BR2A 2MH9A 1WH7A 2KDOA 4H4KC 3U1KA 5IYBJ 2DPDA 2IGKA 1IN7A 3DBLB 2QQAA 4HYEA 5AONA 2Z99A 5JLXA 1A6QA 5J8CA 5FKNA 3K9TA 3KX2A 3I64A 2M87A 2PEXA 1TWGJ 4M6VA 4A12A 3BT9A 5D4RA 1I3AA 2A6HF 4KA4A 4M9XA 2CQKA 1RNLA 1TWFJ 4I09A 4OMYA 4BHPA 4C30A 2I5UA 5B5EC 1OCOH 1UJ8A 3CZ6A 5IOYA 2QSHX 3HOTA 2FBIA 1JHFA 1ETYA 1R1UA 3OYDA 3S16J 3DPLC 1S8NA 1YHQI 2HQAA 3NEUA 3H5NA 6PAXA 3GLXA 3H3VK 1RUOA 2XAJA 4RAYA 5IYCJ 1MBKA 3RI4A 1WQ2A 1JJ6C 2L7ZA 2BY3A 1FMVA 3KYLA 1KA8A 5DYMA 5CVIA 3FHZA 1C0WA 3A2KA 2JRTA 3LA3A 3RQIA 3D5RC 3Q0WA 1AA7A 5H6RA 3DKXA 3VOEA 1VQ4I 2EJRA 2VBYA 2GLOA 1MIJA 4B1RA 2P7CB 2LF8A 3GTGJ 2VOOA 1OYYA 3HUGA 4HOBA 1QA6A 3J7AY 3BR5A 1B72B 2DMUA 1OFCX 3HGYA 1RI7A 1MNMC 3CUOA 1QPIA 2P7VB 4P9UA 1PP7U 2ME6A 2VKHA 3J7YJ 4YFKF 3EETA 2X4HA 3GZ5A 4HW0A 4QTRA 1J9IA 5H6QA 1HOMA 2BHZA 4M6XA 4KMFA 1FLIA 4A3MJ 3R61A 3FBNB 2XRNA 3M9AA 1I5ZA 3S1NJ 4CCOA 3HIFA 1ZAOA 3RSNA 2XGEA 1XSVA 1A5JA 1IZ1A 2V7FA 2IA1A 1XGMA 3IKTA 1R49A 4EQQA 4HNVA 3K7AJ 5F1JA 1EV7A 5B3SH 4II3A 1IF1A 2WAFA 3KEOA 1ZGWA 3CJTB 3GFJA 2QBYB 2G0EA 2H94A 2KJCA 4Q48A 3ERMA 2QQBA 4HAMA 3V8LA 4E7LA 3KZZA 1R4MB 2QENA 4MLOA 3FDYA 1D5VA 4M6YA 1XB4A 1O4XA 3H92A 2VQCA 2EWNA 1J09A 2PG4A 2RVCA 3VODA 3BR0A 3G71I 3MMYB 1DU0A 4BQNA 2HQRA 3CDLA 2VL8A 2W25A 2DMPA 1H8AC 3RZOJ 5DD4A 3C2GA 3WTZA 3LAJA 3W3CA 2LTPA 1WHUA 2UXNA 2E36A 4BY7J 2IRFG 3O2PE 5BS6A 3TW7A 3I9V2 4EJUA 4J00A 2KL4A 1QRYA 1Z91A 2HQNA 2QZ8A 3CC7I 3WTWC 2LRDA 2HPIA 4LD5A 3ZR8X 3G73A 3AL0C 5L3FA 1T56A 4IRGA 1V3FA 1BR4A 3HDDA 4BDYA 2OQGA 4UUSA 2A5WA 1XSDA 3LSJA 2ZC2A 4PFOA 5DV5A 1B59A 5CKTA 4XLEA 4DZPA 5M3FJ 1UMQA 2RQPA 2AXLA 5IP7J 3S3MA 3DWLE 3GUDA 5D8KB 1O3RA 2HPMA 1IGNA 3OOPA 4L18B 4E7JA 2JQ7A 3FMSA 4HA8A 1MH3A 3ZMTA 3MAJA 4I2OA 2QUFA 2Z9OA 3RPQA 5ILSA 3PSFA 5K5OA 3VPRA 2ID3A 1KU9A 1GDTA 2GIVA 1HKTA 1O3SA 3HRMA 3R60A 3ABMH 1V5EA 2JJ7A 2BW3B 3AFHA 4B09A 2UWMA 3OMYA 1EH7A 1G3WA 4ZDOA 1YLFA 3MEXA 2E34A 1JXSA 5D8LB 2M1BA 1KZHA 2H6BA 5A2QZ 2DODA 2IP2A 3KE2A 4OINF 1G2HA 1NK3P 2WADA 2K7LA 2OD5A 1OPCA 2GWRA 2DXIA 2MBFA 3ZGKA 4HNTA 3S15J 1BA5A 5F64A 2QA4I 2V6EA 2HXOA 3BY6A 4A6EA 1UELB 4HLXA 4XKVA 4BKXA 3E5XA 4ABZA 3TEDA 4LITA 2GM4A 2HYGD 4BS9A 4JBAA 4JX5A 1DQUA 1UZCA 3WTYC 1FSHA 4CUGA 1RZ4A 2NS8A 1OR7A 3BG6A 3O6BB 1E3HA 2H1KA 1XN7A 4AD9A 2COBA 4LG3A 2ZMEA 5DUKA 2JPBA 3I56I 4FX4A 3KIOA 4XN0A 1TLHB 3CLOA 3EYIA 4IHYA 3OSGA 2UZKA 2KPMA 4IZZA 1HA8A 4IHTA 4F93B 2EV0A 4Q47A 4CCNA 3TGNA 3LAPA 2BVLA 1YI2I 2PMZN 3TDUC 3OYHA 3F8FA 1YIOA 1SMYF 4P1WA 2IEKA 1TNSA 2DA5A 2EIJH 2P5VA 4DYRA 1PUFB 4II2A 1I39A 2ZXHA 1IV8A 2M9HA 4ZH4F 2LKPA 4MEXF 5E17F 1E3PA 4LFUA 3CMEI 3TDZC 4I01A 2CFXA 4OWRB 3C18A 4E7ZA 1R71A 3G1OA 3PQJA 3HRSA 2GA2A 3BG9A 4BDZA 2DYRH 4CHUA 1Q1VA 3RKQA 3NWTA 2EFNA 2IS4A 1NHAA 2KISA 1ETQA 3NQOA 5DS9A 2ETHA 2VQHA 2MW8A 4AYBN 2F6CA 1VQ5I 3HTSB 2PMZA 3KP6A 3JRFA 5FKMA 3FXJA 1LDJA 3DEWA 1AKHA 2YX7A 1QZEA 4M9SA 2K3FA 3MVPA 2M45A 1S6LA 1WPKA 2E5ZA 3F6OA 1MSEC 4ON0A 3F3XA 5LHHA 3TBIA 2FE3A 3AG2H 2DT5A 2HOEA 2QKLB 1B9MA 2DAOA 3F9KA 3LSMA 2EIKH 4BQQA 1R22A 1W7PB 2WB1N 5DDGA 5CVVA 5LGTA 5D4SA 5IY5H 2ZXJA 5GTHC 3DEEA 3K10A 3REOA 4RLQA 3H1CA 2VI6A 2A6TA 5E1ZB 1KU2A 2EA4A 3CCRI 4NC8A 2DQLA 3W2WA 1W5SA 5FO5A 1FX7A 5K1YA 4HV6A 3CC4I 4TV7A 4O3MA 4IL6C 2CV1A 3GW2A 3AG3H 4ESJA 1PVEA 2X85A 3HGGA 4CA0A 5L3EA 2VKEA 2XRLA 2X1EA 4E7SA 2BXZA 2DQRA 4A3FJ 1FBSA 3M8FA 2O6GE 2K5CA 4G7HF 1Z21A 4MEYF 1XMKA 2PJRB 4JQFA 1J7KA 5LGNA 1VQOI 2DYSH 5CQEA 1IXRC 5HOOA 1AWCA 2WB1A 1D0ZA 5FGMA 4HF1A 1NG7A 1XG1A 2GZWA 2HTSA 5BPIA 5FFZA 1UHWA 1MW7A 2EBIA 2HZDA 3OSFA 4ITVA 3OS1A 3T8RA 3HEFA 1HW2A 2NVQJ 1L3LA 2CG4A 1Z67A 3LFKA 2VBWA 1BR2A 4KIGA 2DA3A 3ZPLA 1J2XA 2DFIA 5L3DA 5HODA 5E8IA 2IS1A 3GWZA 2WBMA 4U0YA 1HSJA 2FMYA 3HPGA 2CW0F 1ZGAA 4Y17A 4KDPA 1VQ9I 1V54H 3SFZA 4IHXA 1GUUA 1K6OA 2HDCA 5KHDA 1Z6TA 3OS2A 1LE8A 3HOWJ 5HLIA 4M71A 4IHSA 3HJEA 3K4BA 3JRIA 3L2WA 2FD5A 1XMAA 2L4MA 4XSXF 1O3QA 2R7XA 2R4GA 4KJZA 3ONQA 3GFLA 2DA6A 5HVQC 3HOSA 5E79C 2EZLA 3FM5A 3E1SA 1A04A 2KIFA 3BG3A 3C2BA 3D5LA 4Q4ZF 1ZRDA 3FX3A 3OYAA 5E3LA 2IS6A 1MDMB 1MNDA 3DTKA 1G3YA 4B3AA 3KYCB 5EZGA 1MGTA 5BPDA 2IGMA 3CD6I 3CMAI 3FXMA 1VFCA 1BC7C 1YRNB 2VXZA 1X1PA 2XF6A 3BDDA 2FJ1A 5IP9J 3M1CA 3P9KA 2LKSA 4KT5C 2A05A 3WODF 3K4JA 1IUYA 2H6CA 2LYCA 4DYQA 5J40A 4KNYA 3KEYA 1XCBA 2FU4A 1YJWI 5IT9K 2KDZA 4WXDA 4BJ5C 1IW7F 2ZFUA 1TW2A 4RM3A 4YFNF 4LLNA 4XKWA 4M3FA 1J59A 3CUQB 2M8GX 5E1WA 5JHUA 3KP7A 3W6JB 1NH3A 1CF7B 1TTYA 2XGCA 3CCYA 2Q8KA 3FISA 1JKRC 1SVMA 3G4SI 1AHDP 2K9NA 2NVXJ 2R3SA 3TO6A 1R4NB 2L7FP 4RB3C 4U88A 1F43A 4ENMA 4D7NA 4B48A 1I6HJ 5LRSA 1WI3A 2LREA 4R8HA 3OYGA 4A3BJ 2Z16A 2NXNB 1S7AA 1KGSA 1QQIA 3S17J 3ECOA 1TQMA 2EH3A 2EZKA 2ZJRF 2X48A 2ZCWA 4KIFA 2E60A 1NK2P 3FBIB 2CFOA 2DA4A 3A01A 1W4MA 5HNFA 2VASA 3TMOA 2D1HA 5B66C 3I4PA 1E3OC 1ZG5A 2MGQA 2QSFX 3FXOA 2CW7A 2VKDA 2XV4S 3ASOH 5FKKA 3DU5A 3GFMA 1IN4A 5E18F 4HX8A 2M0CA 4C3IJ 3OYNA 3K1NA 2MD5A 4IPAA 3OYJA 3H35A 4YIRX 4EJOA 2WAEA 2HGCA 4IVNA 2R5YA 2CJJA 1IN6A 4I7HA 4GFBA 4M74A 1DPUA 2CYYA 2DOEA 4Y7NJ 3K70C 3T5XA 4UNOA 1YJNI 4WK8F 4ENJA 2P5KA 4AIDA 3DTEA 3M3YJ 1BOBA 1N78A 3GX4X 1G3TA 3WE3A 2E1MB 3I55I 1Z7UA 2CUEA 1KYWA 1QU3A 1S7OA 3RDIA 4I0BA 3M4OJ 5D5WB 2Y69H 3DKWA 2KZVA 2EIMH 1YS6A 4EMSA 2RQQA 2FOKA 2K9MA 2JK3A 5BNGA 4PGHA 2M8EA 4JX4A 2W4SA 2VN2A 4YRVA 2D45A 2LMDA 3AAFA 1RIOH 4QIWN 2W84A 3E3VA 2QWWA 1ETXA 1T0FA 1G59A 3S1MJ 2Y48A 3O3KA 4M73A 3R6SA 1GT0C 2JWTA 2XDVA 3FF5A 2W85A 4KT6A 1MZBA 1X3UA 1P7IA 4CH7A 5DEQA 3KCCA 2O3FA 2A68F 2GXAA 2EK5A 4KN4X 4DZJA 4ZDLA 4M3EA 1R36A 3LL7A 2VE9A 5TRDA 4FX0A 4CZCA 1FOKA 2VBZA 1ERDA 1FTZA 4XMYA 2XASA 4AIHA 4CDGA 1HW5A 1Y1WJ 2R7QA 3U21A 3BR1A 1FY7A 4A3EJ 5FLMJ 4DYCA 3LSGA 3ABLH 3GO5A 3ZP5A 1T8IA 5M5XJ 1X2NA 2JZYA 3HSEA 5FRNA 1MJBA 2ZJQF 2RNGA 4RGRA 2OZUA 4NBQA 1JTXA 3CESA 2W82A 1DGWY 4EJTA 3SYTA 1JHHA 2ADUA 2RGVA 3F23A 3SZPA 4XIDA 3SEQA 1YFHA 1RRJA 1LQ1A 3EUAA 5FLXK 1IO2A 2WY7Q 3V42A 3T1BA 1AOYA 2HNHA 1OJLA 3V7SA 2ISZA 3GTKJ 3B6AA 1U5TB 2OAZA 2DA1A 2M7BA 4CSWA 3L1PA 3BZ6A 2YS9A 3KYDB 1X4PA 5HLGA 3LSPA 5DCMA 2H27A 1ZYRF 5E3OA 3BJAA 1LVAA 2K4JA 2Y9ZA 3KLNA 2YPRA 4UVAA 2XAHA 3WTVC 2HOTA 2EINH 2FF4A 2OBPA 4BE0A 3QP5A 3W2VA 1WJAA 4BAYA 2E5NA 1VQLI 1OLTA 4Y4RA 5K7FA 1EH8A 1K83J 2E1CA 5DTDA 4EM0B 1RETA 3RQ4A 4LK1F 1ITYA 3QOEA 4MHGA 3CP2A 2FEZA 1QBJA 5AIQA 1U78A 1FT9A 2YUSA 1OCPA 3OYEA 4A6DA 4XRSA 2VB6A 4N0BA 4A3IJ 1GXQA 1ZN2A 1TBXA 4I99C 4HBLA 4NC7A 2Z1DA 4PZJA 5JLWA 1E17A 3S8PA 1R1TA 1XMXA 3GZ6A 2PFBA 3IUOA 1R5ID 3KZIC 4GRIA 4MIMA 2GBYA 4IRIA 3BTJA 4ENNA 4A3CJ 4KITB 4U0WA 2D5VA 4KN7X 3J7ZI 2CV2A 4PSWA 1SAXA 4G6TB 2X51A 3LMMA 1ONVA 2XKPA 3G2BA 2XROA 2QVOA 3EQLF 3EUHC 2NVTJ 3S14J 4FTHA 3TP0A 5K5QA 2CW8A 2EFOA 1GXPA 3VYRB 2IA2A 3BQYA 2RKHA 4IX7A 4QPQA 1FMWA 2LR8A 3Q9SA 5B1BH 1W1WE 4KICA 1U8BA 2WY8Q 4UUVA 3HOVJ 3OIPA 5KAIC 4IQ4A 4U7BA 4D1QA 2XF5A 1BN5A 1JUSA 3A1YA 3CCJI 4E7HA 1B72A 3QODA 1D1CA 1OISA 3CUQC 1LJ9A 5J8FA 5IT9Z 5CJ9A 5D5UB 3J80Z 2QEXI 4HX4A 4FHTA 3T8TA 3S2WA 1UG2A 3WGIA 2L5QA 4F92B 3TO7A 4BHCA 4C3JJ 2A6EF 2AQEA 4KFCA 1BI2A 1S72I 3VWBA 3RKYA 4LMYA 1QNTA 3K1PA 2JSCA 4XSZF 4DBQA 3S3OA 4WXHA 1RESA 2XAGA 1GVJA 2FA5A 2E19A 4MQVA 3MZYA 3CTAA 5GP9A 3CJQB 2CQ7A 3ABTA 4L5JA 3HB9A 4D5CA 2QBYA 1UAAA 3L2UA 2B9SA 3EYYA 5K5RA 1X1BA 1HCRA 1R5GA 2KP6A 2XAQA 5L3GA 1DU6A 1TW3A 2K3PA 2R7ZJ 1LEAA 2R7TA 3RPUA 2TRTA 4BXFA 3BQZA 1ZG1A 4RB2C 3A0BC 2Y75A 3BCBA 2OV7A 3DFGA 5IT3A 2DT7B 1ETWA 2QYOA 1EJ9A 3P5JA 4ZDPA 3SQNA 1SMTA 1SD4A 5J6XA 4B3XA 3D5SC 4HQMA 2JSPA 2NYXA 3ZN0A 1XPXA 3AG4H 1F4KA 3MKYB 3BWGA 2E1MC 2G9WA 2LY1A 2KJBA 2DA7A 4FT8A 4BACA 5J1UA 1VF9A 4HDVA 4AM3A 5JI6A 3U1DA 4I76A 1YE9A 5LHGA 2DK5A 4X0GA 3TKYA 3U2RA 2MLGA 2IBDA 1STZA 5EF6A 3LA2A 4E4HA 3HOUJ 3JSOA 4XKBA 2IJLA 5FKLA 4DJAA 5LD2C 4G9YA 2RAEA 5F04A 3TOAA 3N97A 1FTTA 3CF2A 2A61A 1O57A 2DMTA 3FXRA 3H9JA 3FHNA 4PFPA 4M3BA 3IH2A 4RLFA 3SDBA 3DV8A 4NNJA 5C4JJ 3A03A 2M0MA 3BG5A 2PJPA 1SFKA 2BY1A 2Y0SA 1UB9A 4XRMA 1EH6A 3JRGA 3LWFA 4HZFA 4KYWA 2E71A 2JVHA 3NARA 1FP1D 3JAMK 5CVJA 2L9SA 2BW3A 2BYVE 2HYJA 3G3ZA 5J4VA 4XN3A 1YOVB 3FK7A 3RPUD 1TWCJ 2XIGA 1SD5A 2AQFA 1JE8A 2TDXA 3FKJA 2G7UA 3HC7A 3HRTA 2ECCA 2HWVA 3V4GA 1FPQA 3B02A 5FRMA 2HI3A 4C9YA 2PMUA 2L4AA 2PN6A 5ILUA 4GDFA 1LKXA 3E6CC 4UV9A 1BM9A 1HF0A 2L9RA 4BU2A 3OYLA 3ULQB 2GOMA 4CCLA 1T6SA 3OYIA 3JRAA 2DBBA 4XR6A 4YIIA 1I1GA 1N77A 3ABUA 2XHKA 2YR2A 5ICFA 2KRFA 3WE2A 1VI0A 1TQIA 3IH4A 4KUMA 2D2WA 1MJAA 2ZFWA 3QOPA 1ZLJA 2XB5A 3X2QH 2Y9YA 4AIKA 3BOQA 3RCOA 1U5TC 5LGUA 5FLXZ 3TP3A 1WZ2A 2XGDA 2F5FA 4FASD 4F3QA 3CC2I 1TNTA 3V8JA 2GAUA 1JKQC 3WG7H 4ENKA 4CYCB 2VE8A 3WU0A 5HLTA 2XC7A 2M2EA 4XM3A 2DTZA 4RDUA 1GV5A 2P4WA 4HSTA 1YQAA 5M5WJ 1JKOC 3IP4B 2KLOA 3N4MA 4BXUA 4N9HA 4UB6C 1JT0A 5GPCA 4LK0F 5HS9A 2OU2A 3FXKA 5CYVA 4CYDA 4XRFA 2LBFB 3ZQQA 1X1CA 1BI1A 3ZN1A 5CLSA 4CCMA 1P7JA 1PUFA 4HSRA 4Y13A 1CQTA 2KRHA 2NVUB 2W1OA 4B47A 1VNDA 1Y8RB 3KP4A 1XX5A 2LBFA 4WXCA 1WFXA 5CVRA 3PNVA 5E1XA 1XGSA 3H5AA 1KQ0A 4V2GA 2JPCA 2FNAA 4UHTA 4NQWB 3SZTA 3ZQHA 5D5XB 5ICCA 4A3LJ 3SJMA 3QQAA 4EJVA 2XPUA 1RKWA 3D1NI 3CDIA 4GGGA 3PJRA 2DW4A 3HOZJ 1GVDA 4PJLA 2XUBA 1SVLA 1ZRCA 2QM3A 2Z3YA 3MKWB 2L7KA 4DOZA 5LEKA 1Q1HA 5BQTA 5FFXA 1T33A 3WTSC 4XOTA 5KCMA 1SVOA 3HSRA 2VC0A 3BLYA 4I02A 3I4MJ 3TO9A 3FXLA 1SANA 1YW9A 4D7MA 2CQNA 3ZRGA 5LEJA 2LDUA 5GADJ 4Y52J 1VQNI 1MSFC 3HG9A 2N8GA 4A0ZA 3VYTB 3GF2A 5EEHA 3OV8A 2X6XA 2WC2A 1I3QJ 1XC5A 1HLVA 3ZMUA 2DT6A 3CMMA 2BEOA 2O8XA 5D6FA 3UNGC 3CP8A 5GTIC 3KZYA 3O8HA 3LOCA 3IH3A 3BPXA 1FOXA 3VDXA 1K7AA 4XORA 1W7PA 1BI0A 2STTA 2R7VA 1SFUA 4F7ZA 1Z3XA 3CF5F 2HDDA 3KFWX 1QHGA 3P7NA 3K70D 2ELKA 1BI3A 2ME0A 2DOFA 1T2KA 1D0XA 1APLC 4BQAA 2LP0A 2M34A 1WJEA 1TC3C 2CMPA 1DDNA 4LJZF 1OYWA 5IOZA 5FB2A 3QPTA 3AKZA 4P9FA 2XSDC 1FEXA 4ZZLA 3LSKA 3CCUI 4LG0B 4HF2A 4HG2A 5LHIA 2R5ZB 2KFDA 2M4GA 4RGSA 3RKWA 3BC8A 1B8IB 1BJAA 1KYZA 4G8XA 1XS9A 2PJRA 4UB8C 5EEGA 4YFXF 4J19A 1BC8C 2R93J 1E0EA 2DK8A 4LGWA 1VTNC 1D5YA 1X19A 5F0HA 3K4LA 1H0MA 4EATA 4MFEA 2I10A 2P81A 2HEOA 5EGOB 1MBEA 2CO5A 3PNTA 4RGUA 2L9NA 5EEAA 4XK4A 1D1AA 1DP3A 1F1ZA 4G6QA 1ENHA 4YEJA 4DNCA 3PO3J 4C3HJ 2WV0A 1ZQ3P 2P8TA 2V1NA 3F72A 3BJOA 2RREA 3J7AO 4B43A 1HC8A 2WV1A 3QAHA 4L0YB 1MMSA 4ZTFA 4BGDA 1Y56A 2DDBA 5L3CA 2L2OA 4A93J 2VJIA 3HYIA 4G7ZF 5EG0B 2P0WA 1FWZA 1P4AA 2EZIA 3JRDA 1JI8A 2V9VA 3IRRA 1W7PD 3R4KA 3DBHB 1MBJA 1ZK8A 3FKIJ 5F6FA 1H89C 4XRSG 2FBKA 1F5TA 2NNYA 2HVSA 1BBYA 1USSA 3JW4A 4UY8I 2M30A 1B9NA 1D8KA 1UHMA 2BBYA 2HXIA 2KIUA 5FJ8J 3WTXC 2LVSA 1HBXG 1WI9A 5ICEA 3I58A 3ESWB 2KIMA 1OMIA 2GA1A 5C44J 4HX7A 2B0LA 4I0AA 3HOYJ 2MSYA 4G6DA 1ZR4A 3T0YA 1MDMA 1IRXA 4MFDA 5KVRA 1W36C 3HKZN 3EUHA 3TW6A 3F0CA 5K7ZA 3ZMDA 3QPLA 3GTMJ 2W48A 1Z0XA 1YRNA 1IRGA 1Z6RA 3PUBA 1FOWA 5BMZA 5GAHJ 3J80K 1K78B 1HKSA 2E7XA 1B6AA 4R1HA 1IRFA 5D5VB 1Z3YA 1K6YA 4UVBA 1BR1A 2K4BA 4OMZA 5J4YA 5JVGF 1LFPA 2RDPA 4BL0B 2FQ4A 4XKCA 1P9QC 2ESNA 2DMQA 3JAMZ 2LLKA 2XPWA 3L2CA 1ZLKA 4S05A 1J0RA 3GBGA 4BBSJ 1N75A 3CUQA 2NAZA 1CF7A 2VQGA 3H0DA 2P6TA 1K61A 1FP2A 2NNNA 1PJRA 2ICWG 3WHBA 3IKVA 1AU7A 2QGUA 3PL8A 3ML6A 3QYFA 4N4NB 1DUXC 3CQZJ 3HKZA 4AWXB 5E8GA 1PUEE 3UKGA 4E70A 3QWLA 1G4DA 4X6AJ 3GTQJ 2B63J 4IJAA 3ZXSA 2HKXA 2YX4A 3C2HA 5HS7A 4RGXA 2IGNA 2Z2SB 3SDGA 4O6JA 4M3DA 1L0OC 1FOYA 1VQPI 3OWTA 1IUFA 4A5NA 3FXQA 3S93A 1S7EA 2VT3A 3E0JB 4FE4A 2V9PA 2OC6A 4L9JA 3ZOBA 3RZDJ 2KT0A 4YELA 2O7OA 3A02A 4H0EA 1R9TJ 4GXOA 3GYHX 2O61A 1QHHD 1Y8QB 5F0CA 2IVMA 1A31A 2IPQX 4LB6B 4PUSA 2JA7J 1I50J 2F5EA 5GPAA 3D0SA 1PP8F 4NUBA 2EZHA 1TP4A 1ZKGA 3NWSA 3ZQGA 2VJJA 4KISA 1O3TA 2NOGA 2F5VA 2MA3A 2QF7A 2DU9A 4B44A 2PBIA 1KU3A 4PJMA 2VIXA 2FRHA 5LLQA 3CO6C 4AIJA 3PFIA 4A0YA 4M9ZA 1NG6A 3BR6A 2LC2A 4XBFA 1YJ9I 2X6YA 2ECBA 1QZZA 2H8WA 2JN6A 3WGGA 1KQ8A 4ZZDA 4CZZA 4NDLA 3SZGA 3JTGA 2ELHA 3JR9A 3ERED 2HZTA 4A3GJ 2WAQN 4O5VA 1U9NA 2AXTC 2JUCA 3RYRA 1P4XA 3IWFA 1YG2A 2CQQA 4JYKA 1ZGJA 3K4KA 4FQGA 4IXAA 1IRZA 1ZHFA 2LK2A 4RB0A 1YITI 3HHHA 2CSOA 2ZNYA 4BHBA 1BIAA 1Z05A 3P9CA 3BTLA 2VODA 1T95A 2IT0A 4BUPA 2DO7A 2VKVA 2TCTA 2ZJPF 4LLGF 4OIRF 3BROA 1WH5A 1MD0A 2V26A 2Q2EB 3HRUA 3L00A 3OS0A 5EDNA 2Q1ZB 4L5IA 5KAFC 2W57A 2OQRA 3VSKA 3K4CA 3H0GJ 3KETA 5CPRB 3LQQA 3DLLF 2VPLA 4RM2A 2EFPA 1LEBA 3I0TA 2VLAA 2E35A 4L9TA 3GMEA 2EFQA 2V9KA 3JRCA 1R5HA 3I3LA 4PGGA 4AU7A 2WAQA 3MZ8A 1U8RA 4Z6YA 2HOAA 4DW6A 4F55A 4RB1A 1ZR2A 3W6KB 1XDSA 2P5LC 4GCVA 1FNNA 3VYSB 4WX9A 3OYCA 2X6OA 4BEHB 1WVRA 3OIOA 4U7DA 2EPFA 2EV6A 3WU2C 3BG7A 4OU0A 2M5WA 2JT1A 3KEQA 2IXSA 4MTDA 2NVYJ 4EGZA 3F8CA 2G7HA 5JHFA 4RA2A 3RYPA 3ZQ7A 1S29A 2L54A 4RS8A 4B4CA 1MH4A 2EA2A 2K9LA 4AVPA 2DTRA 4XICA 3PUFA 4BQOA 2JUGA 3M07A 1U5TA 2JA2A 2FX0A 3C3WA 4DBRA 3L2QA 4BJ6C 3ISPA 5BOXA 3CLQA 1S5LC 1R23A 3DU6A 5AIPA 4A3DJ 1MKMA 2EILH 1HSTA 3HXLA 3C1DA 1WJFA 3HSFA 4HRIA 3CJNA 1P92A 1IN5A 5DUIA 2OPTA 5FD6A 5CQGA 5C4XJ 3M1EA 2E2IJ 2OCCH 1OYIA 1FZPB 2AO9A 2FSWA 3IAS2 4ZYGA 4CCJA 3KPHA 2MD0A 1O7FA 3FXUA 3I5UA 4LLLA 2CGPA 2FMLA 2R0QC 4M72A 2CS3A 4YIFA 4P5OA 1IC8A 3H9GA 1X4OA 2W00A 3PNYA 3WTTC 2DFEA 1FYMA 3PIOF 2XF7A 4NC6A 5J47A 2PMHA 3FK6A 4ASNA 5C3EJ 4GYGA 4BJTA 2R7UA 3L9FA 3HBLA 1LFUP 2CU7A 3BJ6A 4I98B 2R7SA 1BIBA 3GLLA 5EZHA 4KMUX 4PJ0C 1ZREA 3U9GA 1OCZH 2KIQA 2L0KA 1W5CC 1G8XA 4XLPF 1FYKA 1H9TA 2DLLA 2V1UA 2RN7A 3BCAA 5IP6A 1X1DA 2VOPA 4I6ZA 2F4MB 2Y31A 3G1MA 1WWXA 4F91B 3HUGB 3LSIA 3E5UA 4BYYA 1MJ9A 2K86A 3OYMA 2HU9A 3I54A 1E2XA 2QSGX 3IAM2 2AHQA 2B7EA 1YYVA 2DDAA 3A0HC 3BZCA 3DQVC 3HHGA 5E3MA 2X1DA 2NS7A 3F8MA 3K4MA 4UUTA 2ZKZA 1TQPA 2HQ5A 3JRBA 1JGSA 2DJIA 1ZG3A 4E7KA 2WA0A 3RKXA 1B1BA 5DM6F 4LIUA 4QPOA 4G12A 3WU1B 2MG4A 3QU6A 2NRAC 4IHWA 2V6CA 4D0PA 2FQ3A 2O5RA 5TGTA 5HDGA 4IO9F 3ABKH 2VQLA 2MYSA 4Y15A 4MGRA 3Q3SA 1WGXA 2NS0A 2DCEA 4N9IA 5J1RA 3F6VA 3GTJJ 3FZVA 1X58A 3IWZA 4BNCA 3DCFA 2OCEA 1A6IA 2YU3A 4HNUA 1CGPA 3OYFA 5B1AH 1Z1DA 3DPUA 2DOAA 3EPZA 3GZNB 4G7OF 1FJLA 1IN8A 4JOMA 4FISA 2A07F 1YS7A 2LH9A 2L7MP 3PSIA 2KQRA 4XQFA 3R0JA 3DXJF 4QSHA 5JFRA 5H2FC 3E6BA 3K6GA 2HVRA 1POGA 1Y1VJ 2XKOA 1EA3A 4DQ2A 2J5OA 4L9VA 1WJ5A 2F5CA 2K27A 2PX9A 2Y0SN 1MMGA 3I4NJ 2LG4A 3ZQFA 1Y39A 4HQEA 1PDNC 2L9VA 2Y2ZA 1WKMA 3H5RA 1QGPA 2F4IA 4PDKA 3RJPA 1S9HA 1RKTA 3QPSA 4UUSB 3TL4X 1H88C 5EJCA 3QPHA 3IV5A 2ZNZA 1V55H 3F8BA 4KIBA 2R7RA 3CCLI 1XGNA 2W7NA 4NHJA
chains in the Genus database with same CATH topology
4PSXA 2DT6A 3CMMA 2CH0A 3UNGC 2E60A 3CP8A 3KX2A 3FBIB 2CFOA 3VDXA 4XORA 5HNFA 2VASA 3TMOA 2R7VA 3QYBA 1DGRM 1Z3XA 2CW7A 2VKDA 4C30A 3N05A 4IKFA 3DU5A 1T0FC 1QHGA 3CZ6A 3K70D 3VSLA 4HPQA 3HOTA 4ZC3A 1D0XA 5HNHA 3OYNA 3OYJA 3OYDA 1LDKB 3H35A 1WJEA 2BVMA 3DPLC 2CMPA 4E7IA 2WAEA 2VXDA 2HQAA 3H5NA 3AKZA 1WJBA 3LSKA 1MMNA 1V5GA 4HG2A 2IS2A 3K70C 4LIVA 3SEZA 2M4GA 3BC8A 3DTEA 3LFUA 1BOBA 1FMVA 3KYLA 1N78A 3EUKL 2E1MB 2PJRA 3OIQA 3A2KA 1QU3A 1E0EA 3D5RC 1AA7A 1X19A 2MABA 3K4LA 3DKXA 4EATA 3CJRB 2CUZA 3PNTA 2L9NA 1D1AA 2KZVA 3J7AY 1DP3A 3RTRA 2RQQA 2K9MA 4YEJA 3W2AA 2W4SA 4YRVA 4D9JA 2VJ5A 2V1NA 2RREA 4B43A 2OUMA 2VKHA 4ZTFA 4BGDA 1Y56A 2X6WA 1G59A 4FETA 2ZSHB 4BE1A 2L2OA 2VJIA 2XDVA 1YX3A 2P0WA 4KT6A 1JI8A 2R7WA 4CH7A 1D0YA 3FBNB 4CCOA 2HDWA 3RSNA 2V4JC 4ZDLA 2V7FA 2HVSA 3LL7A 5KNLA 4CZCA 2ELJA 1ERDA 4XMYA 1W36D 3M8JA 4II3A 2WAFA 2R7QA 3U21A 4U87A 3LSGA 2MC4A 3QYEA 2HVQA 4E7LA 1IRXA 4MLOA 3FDYA 1W36C 5FRNA 2VQCA 1WJDA 1J09A 2RNGA 3OL3A 3CESA 2W82A 3MMYB 3PUBA 1DGWY 4BQNA 3SYTA 2VL8A 3SEQA 4N4OB 3L2RA 1Z3YA 3C2GA 1K6YA 3PFYA 3HPHA 1BR1A 3EUAA 1LFPA 2WY7Q 3W3CA 3V42A 4F52A 3OOUA 2HNHA 4BL0B 1Z7LA 4XKCA 1P9QC 4RMNA 2M7BA 4CSWA 1GLNA 3GBGA 3I9V2 1N75A 4J00A 2KL4A 4AVZA 2VQGA 3H0DA 1X4PA 2LRDA 2HPIA 3ZR8X 1PJRA 3AL0C 4XLHA 5FROA 3UR3C 3PL8A 1BR4A 4BDYA 2A5WA 3QYFA 4N4NB 3HKZA 2BOLA 3S3NA 4PFOA 5CKTA 4XLEA 3ZXSA 4BE0A 3S3MA 3C2HA 4XONA 1WJAA 3DWLE 3W2VA 2IGNA 2E5NA 2Z2SB 2HPMA 2I8DA 1OLTA 4Y4RA 4E7JA 3OWTA 4XNFA 3S93A 3E0JB 2OC6A 3PSFA 3RQ4A 3QOEA 3CP2A 4YELA 4AYBA 1QHHD 3OYEA 1V5EA 3AFHA 2BW3B 2UWMA 3OMYA 2KMUA 4ZDOA 4PUSA 2VB6A 3LSHA 4NC7A 2Z1DA 3S8PA 1LVKA 3IUOA 4OAYA 4GRIA 4NUBA 3NWSA 2WADA 4KITB 2VJJA 3OR1C 4KISA 2IGOA 2CV2A 4PSWA 2F5VA 4G6TB 2DXIA 2X51A 3LMMA 3G2BA 4HNTA 2GOXB 3ZGKA 4J01A 1Y6IA 3EUHC 4B44A 2V6EA 4ZJZA 1UELB 4XLAA 4PJMA 2CW8A 2VIXA 4XKVA 2JVGA 3VYRB 4C2TA 1NG6A 3DTIA 2LC2A 4LITA 4IX7A 4QPQA 2X6YA 4BS9A 1FMWA 1DQUA 3OYBA 2ZXIA 3SZGA 2WY8Q 2FUG2 3OL4A 4CUGA 3OIPA 4IQ4A 4U7BA 3BG6A 4D1QA 2XF5A 3A1YA 4E7HA 3QODA 1D1CA 3K4KA 4LG3A 1R6RA 4HEA2 4XN0A 1T95A 4BUPA 2L5QA 4F92B 2KPMA 4IZZA 1HA8A 2V26A 4F93B 2Q2EB 4CCNA 1MNEA 2AQEA 3OS0A 2BVLA 2Q1ZB 3OYHA 3VSKA 3K4CA 3VWBA 5CPRB 4P1WA 4DBQA 3S3OA 2VPLA 4RM2A 2VLAA 4PJJA 4II2A 3OYKA 4R79A 2V9KA 2ZXHA 2R7OA 3CJQB 3I3LA 4AU7A 4IQJA 2WAQA 4E6KG 1UAAA 3L2UA 2QKMB 4F55A 3VYSB 4DIQA 1X1BA 4OWRB 3OYCA 4BEHB 2KP6A 4E7ZA 1U0JA 2K3PA 1MMDA 2R7TA 4BXFA 1UG0A 3BG7A 4BDZA 3BCBA 2OV7A 3NWTA 2MFZA 2DT7B 4Y33A 2IS4A 2IXSA 5JHFA 4ZDPA 4BE2A 2VQHA 4XL9A 2F6CA 4B3XA 3D5SC 2LY2A 2PMZA 2JSPA 2XSJC 3OY9A 4PJNA 5LFAA 2K9LA 3MKYB 2E1MC 2JUGA 4BQOA 2JA2A 2LY1A 3DKYA 2E5ZA 4DBRA 3L2QA 4BACA 4BJ6C 2CUJA 4XLFA 4ANJA 4C2UA 3TBIA 1WJCA 3DU6A 1YE9A 4X0GA 2QKLB 3F9KA 3HXLA 1TZLA 1WJFA 1OR7C 4E4HA 3LSMA 4XKBA 4BQQA 1MMAA 4DJAA 4HRIA 3L2VA 2CV0A 5LD2C 2LOOA 3DEEA 3K10A 4RLQA 3CF2A 2A6TA 3H9JA 5CQGA 3FHNA 4PFPA 3SDBA 4RLFA 4NC8A 3W2WA 4NNJA 3IAS2 4CCJA 2M0MA 1V5FA 2MD0A 1SFKA 2Y0SA 2CV1A 2M3AA 2CS3A 4P5OA 3H9GA 1X4OA 2W00A 3PNYA 2X85A 2JVHA 3H9QA 4CA0A 4E7SA 2X1EA 2XF7A 4DGWB 2L9SA 2BW3A 4BJTA 3HL2A 2R7UA 2K5CA 1Z21A 1KONA 3OR2C 4XN3A 2R7SA 3DPTA 3RPUD 4JQFA 2PJRB 5CQEA 2AQFA 5HOOA 2WB1A 3FKJA 1D0ZA 3HC7A 3VYUB 1NG7A 1G8XA 1MW7A 3MD2A 3AL0B 3BCAA 1X1DA 5FRMA 2HZDA 4F91B 3MKZA 4ITVA 1X1AA 4C9YA 3ZCOA 3OS1A 3HUGB 3LSIA 1LKXA 3A4CA 3OYMA 4PK4A 2HU9A 4BU2A 1D1BA 1ZELA 2GOMA 3OYLA 1BR2A 4CCLA 3IAM2 3OYIA 3DQVC 4XR6A 1N77A 1SAUA 2IS1A 2X1DA 2WBMA 3K4MA 2KRCA 3HPGA 2DJIA 4E7KA 2NOJB 2WA0A 4LIUA 4QPOA 2X1CA 3RCOA 5KHDA 4FASD 4F3QA 3OS2A 2O5RA 5TGTA 3K4BA 3L2WA 1VZ0A 4CCKA 5HLTA 2XC7A 4XM3A 1PYVA 2UV1A 2VQLA 2R4GA 4KJZA 2R7XA 3ONQA 4HSTA 3IP4B 2KLOA 5HVQC 3HOSA 2MYSA 3E1SA 3K4NA 4ZYAA 2ZSIB 3D5LA 2DCEA 2LBFB 3ZQQA 3OYAA 2KHMA 2IS6A 1MNDA 3DTKA 1X1CA 4CCMA 4HSRA 4HNUA 2KRHA 3OYFA 3DPUA 2DOAA 2M7AA 2IGMA 2W1OA 3EPZA 4B47A 4JOMA 2LBFA 1WFXA 3PNVA 2LH9A 1TT0A 2VXZA 2XF6A 3H5AA 2KQRA 3PSIA 4XQFA 3M1CA 3DLAA 4NQWB 3K6GA 3K4JA 2HVRA 4BEHA 2LYCA 4XOPA 1EA3A 3KEYA 1WJ5A 3PJRA 4PJLA 2UUZA 4BJ5C 3MKWB 4Y3OA 2L7KA 1MMGA 2ZFUA 4DOZA 4RM3A 4XKWA 2LG4A 4OAZA 4XOTA 5KCMA 4XLCA 3BLYA 2M4KA 3S32A 2XAUA 3H5RA 2F4IA 3ZRGA 1S9HA 4ZTJA 2VJ4A 3HG9A 3TL4X 1YX5A 4B48A 2LREA 3VYTB 3OYGA 2KDOA 4H4KC 2R7RA 2IGKA 2X6XA 2W7NA 2Z16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6R A;  1SFK A; 
#chains in the Genus database with same CATH topology
 4UV8 A;  5FLV A;  4PSX A;  4EVI A;  1T39 A;  4RAF A;  2CH0 A;  4JK1 X;  1SFO J;  4P96 A;  3QYB A;  2XPV A;  1DGR M;  3FIW A;  1JUP A;  2DFH A;  2E2H J;  5CVU A;  1Y0U A;  2A3S A;  2OA4 A;  3N05 A;  4IKF A;  1T0F C;  2GIZ A;  4Z2Y A;  3VSL A;  2E1N A;  4HPQ A;  2FNP A;  2EFW A;  4ZC3 A;  5HNH A;  3ROU A;  1LDK B;  5J3L A;  1A36 A;  2MC3 A;  1LFB A;  2BVM A;  4E7I A;  2XVC A;  5TIS C;  3GXO A;  2VXD A;  5GAE J;  1WJB A;  4HF0 A;  2HR3 A;  1ETK A;  2BZT A;  5K7H A;  4LB5 A;  1MMN A;  1V5G A;  3VB2 A;  3EDP A;  2IS2 A;  3BR3 A;  1VQK I;  4LIV A;  3SEZ A;  3W6V A;  3LFU A;  3K0L A;  5GAG J;  2VT2 A;  3BTC A;  3LA7 A;  1LPQ A;  3EUK L;  3TQN A;  4WF2 A;  1QVU A;  3OIQ A;  2EV5 A;  4IEJ A;  1M1E B;  1P2F A;  3IL2 A;  4RAZ A;  3CCV I;  3IC7 A;  2MAB A;  1XDU A;  3PIP F;  1OCR H;  1Y0N A;  2Q0O A;  2L3D A;  1JJ8 C;  3O8G A;  3PM1 A;  4L0Z B;  1NTC A;  3CJR B;  2CUZ A;  3V7C A;  1XD7 A;  3CCE I;  2STW A;  2R7F A;  1U3E M;  1EKE A;  1WCM J;  3COA C;  1JKP C;  4CGZ A;  1G6N A;  5FD5 A;  2HKO A;  3RTR A;  1O7L A;  3W2A A;  3JTH A;  1N25 A;  1UFM A;  2XB0 X;  1UCR A;  2ZME B;  3FM3 A;  2VJ5 A;  2UXX A;  4D9J A;  3WTU C;  2PLY A;  1FIP A;  1W0U A;  5H20 A;  2OUM A;  3J81 K;  3CCQ I;  2FXA A;  4XLN F;  2X6W A;  1T38 A;  3MQ0 A;  4FET A;  2ZSH B;  4BE1 A;  2DN0 A;  4V19 K;  1HXD A;  4PCQ A;  4S0H B;  4JX6 A;  1YX3 A;  3HTU A;  3MCZ A;  2Y30 A;  4FCY A;  2R7W A;  1D0Y A;  4B8X A;  3F8N A;  4CYC A;  2HDW A;  1LUJ B;  2V4J C;  1I1S A;  4QWQ A;  1OCC H;  5KNL A;  4WCG A;  2ELJ A;  2YSR A;  3BP8 A;  1W36 D;  3M8J A;  2R92 J;  4V2F A;  5F27 A;  1V4R A;  4EM1 A;  3AG1 H;  1ZRF A;  3WG9 A;  2XAF A;  4M3G A;  2HOS A;  1FSE A;  4IOC F;  3GEZ A;  4U87 A;  2LD5 A;  2P6S A;  2MC4 A;  1U6G A;  3QYE A;  2HVQ A;  1DP7 P;  3VFZ A;  2LSO A;  1A35 A;  1HW1 A;  1OQY A;  1WJD A;  1IAW A;  4A0X A;  4OIQ F;  1LB2 A;  1LNW A;  3OL3 A;  1IJW C;  4EM2 A;  2YU9 J;  3R0A A;  2F4O B;  1RC9 A;  2GXG A;  3LQR A;  2CUF A;  3BTI A;  2O0Y A;  2CWE A;  2X0L A;  4NQW A;  1FC3 A;  4N4O B;  3L2R A;  3PFY A;  3HPH A;  4UXN A;  2JA8 J;  2X9D A;  4F52 A;  3OOU A;  4OOI A;  1AKH B;  2ZBK A;  3QU3 A;  1Z7L A;  1JT6 A;  2XGX A;  2H09 A;  3DBR B;  3GCM A;  4IRH A;  4RMN A;  3JRH A;  3HOX J;  4YG2 F;  4BH9 A;  3GTP J;  1GLN A;  2ZXW H;  4U0V A;  1W0T A;  4AVZ A;  3Q5F A;  4EEF G;  3F22 A;  2IAI A;  2KKO A;  4XLH A;  4ETS A;  5FRO A;  2V1D A;  2KZG A;  3UR3 C;  1K4S A;  2Z33 A;  2JA5 J;  1MBF A;  3PQK A;  2RNJ A;  2BOL A;  2L02 A;  3S3N A;  1BW6 A;  2ESH A;  2JRM A;  2OJE D;  3JCU C;  4W1U A;  3K2Z A;  2VC1 A;  1XGO A;  2A69 F;  2ISY A;  3E5Q A;  4XON A;  3JRE A;  3CDH A;  1MBH A;  2I8D A;  5J1Y A;  1QO0 D;  4XNF A;  1BJZ A;  1OKR A;  2FBH A;  5LRR A;  5FKO A;  4IOA F;  3WHC A;  1HQC A;  3ASN H;  1YW8 A;  2E7W A;  3CMY A;  1YIJ I;  3I59 B;  3E97 A;  2LF7 A;  5HDK A;  1ZAR A;  4GYI A;  2MLK A;  4AYB A;  2DPU A;  2QLZ A;  2KMU A;  3LSH A;  1SC7 A;  4IF4 A;  3I59 A;  3Q0U A;  5HDN A;  1LVK A;  4L9N A;  4C2M J;  3L7W A;  4OAY A;  5L3B A;  1U2W A;  1TWA J;  3ZQL A;  3IHU A;  3OR1 C;  4LG0 A;  4A2U A;  2IGO A;  2OF7 A;  4ESF A;  2R5Z A;  3GVA A;  4EJW A;  1VQ6 I;  2QCO A;  2GOX B;  4J01 A;  1Y6I A;  2H8R A;  1I6X A;  2VPR A;  1B8I A;  2BE5 F;  4ZJZ A;  2JA6 J;  5DM7 F;  4XLA A;  3ELK A;  4GO1 A;  2JVG A;  1W5T A;  2BY2 A;  3V7R A;  3H36 A;  4C2T A;  3DTI A;  2BHY A;  4UVC A;  3OYB A;  2ZXI A;  2DI3 A;  5EGO A;  2FUG 2;  3OL4 A;  4OIO F;  1RPW A;  1ULY A;  2VUM J;  5ILV A;  3TOB A;  3E7L A;  1T98 A;  3QP6 A;  1D3Y A;  2E2J J;  1SFE A;  3KP3 A;  1R6R A;  4WWC A;  1LE8 B;  1K79 A;  3SFI A;  1J5Y A;  3MFK A;  1QPM A;  1IXC A;  4AC0 A;  2H1L A;  4HEA 2;  1JTY A;  3DP7 A;  1P6R A;  5DCF A;  3KLO A;  1TT5 B;  4S04 A;  4RBO A;  5ED4 A;  5KK1 A;  2V79 A;  4ZYE A;  2BGC A;  5EG0 A;  1JGG A;  1SD7 A;  1MNE A;  4W97 A;  1JUM A;  2WTE A;  2WWY A;  3GTL J;  2RV8 A;  1R00 A;  3V8K A;  1BOA A;  1IDY A;  4ZYD A;  3FMR A;  3ZMS A;  5DD8 A;  2DMN A;  3CCM I;  3LNQ A;  4HDU A;  4PJJ A;  2DFF A;  2EB7 A;  1UHS A;  4QLC U;  4CXF A;  3LSR A;  3OYK A;  4R79 A;  2R7O A;  2HYF A;  2LNB A;  3KP2 A;  1Z77 A;  4K2E A;  3F21 A;  4IQJ A;  1ETO A;  2K02 A;  4E6K G;  2Z5U A;  2QKM B;  2O03 A;  1FBU A;  5TJJ A;  2R7D A;  3WGH A;  2OTJ I;  4DIQ A;  1FYL A;  1UST A;  2GXB A;  1FBQ A;  2Y0M A;  4MNU A;  1U0J A;  2BXY A;  1XTA A;  1MMD A;  3L09 A;  1F36 A;  1UG0 A;  1EF4 A;  2K85 A;  2EQR A;  2CQX A;  2MFZ A;  1ON2 A;  4Y33 A;  3HM5 A;  1K78 A;  3JSP A;  3K69 A;  4BE2 A;  4ZYH A;  1X3W B;  4XL9 A;  1QZY A;  4AUX A;  2LY2 A;  2XSJ C;  3OY9 A;  4PJN A;  5LFA A;  2HS5 A;  5M5Y J;  5E20 A;  3P9I A;  1IG7 A;  1IDZ A;  1HKQ A;  3DKY A;  3K2A A;  2ZJ2 A;  4JP0 A;  4FE7 A;  4MTE A;  2CUJ A;  5E3N A;  1Z9C A;  4XLF A;  4ANJ A;  3KP5 A;  4C2U A;  2VON A;  1YW7 A;  2PQ8 A;  5HLH A;  1WRJ A;  1WJC A;  5ERI A;  1F9N A;  1TZL A;  1OR7 C;  3C7J A;  1R1V A;  3HZJ A;  3A01 B;  1MMA A;  3L2V A;  4NB5 A;  1XSX A;  3QRF F;  1YO5 C;  2CV0 A;  2LOO A;  3IRQ A;  3E6D A;  1LDD A;  5JR3 A;  3K1M A;  2ZME C;  2W24 A;  3G1L A;  3I53 A;  2PI0 A;  5F0F A;  4G94 A;  1ZH5 A;  3MWM A;  3VEP A;  5D6E A;  1RR7 A;  4A3K J;  3H3Z A;  1GV2 A;  1V5F A;  4A3J J;  3CO7 C;  3J81 Z;  3S2H J;  2OZ6 A;  4MQ9 F;  1B4A A;  1IXS B;  2M3A A;  4L5E A;  3SHF A;  2R5Y B;  2D1V A;  2IA0 A;  2LFB A;  1VQ8 I;  3NRV A;  3H9Q A;  3G6E I;  1WSU A;  3RIR A;  3GFI A;  3ZQC A;  4DGW B;  1P4W A;  3Q9V A;  3MZH A;  2ACJ A;  3HL2 A;  1OCT C;  4MO7 A;  1KON A;  1XCV A;  3ECH A;  3OR2 C;  3DPT A;  3FWE A;  1RR8 C;  1KQ9 A;  2JMW A;  4RAG A;  3B73 A;  4CIC A;  4HV5 A;  3VYU B;  2K9S A;  3ZMV A;  3AL0 B;  3MD2 A;  1X3Z B;  3BPV A;  3B6C A;  1ETV A;  2VBX A;  3MKZ A;  1QVT A;  1X1A A;  4Q5S F;  3ZCO A;  4OIP F;  1T08 B;  3FMQ A;  2F48 A;  3A4C A;  4PK4 A;  1D1B A;  1ZEL A;  2A5Y B;  5IYD J;  4HLY A;  4LOC A;  5HS8 A;  2CRG A;  1S3J A;  1J75 A;  1SAU A;  2F2E A;  2QQ9 A;  1IV6 A;  2KRC A;  1RUN A;  5F1R A;  1X2M A;  1REP C;  2HFH A;  1VQ7 I;  2QQ8 A;  2FOW A;  2J5P A;  1ODD A;  2NOJ B;  3S1Q J;  1GHC A;  4A5M A;  1TWH J;  4IHV A;  2BV6 A;  3SXY A;  2X1C A;  2GQQ A;  1ON1 A;  3Q0V A;  5JVT A;  3S1R J;  3M7G A;  2F5D A;  1U9O A;  4BY1 J;  3LST A;  1VZ0 A;  3NAU A;  4ESB A;  4CCK A;  4BXX J;  3GTO J;  1ACI A;  1PYV A;  2HTJ A;  2MH2 A;  2UV1 A;  3MN2 A;  1FIA A;  2K40 A;  4D5F A;  3ZQI A;  5A2Q K;  1D8J A;  5IPA A;  1BW5 A;  4A69 C;  5M3M J;  3K4N A;  2Q2E A;  3M8E A;  4X1E A;  2LKX A;  2LY9 A;  4ZYA A;  2ZSI B;  4P55 A;  1VQM I;  1R58 A;  1SD6 A;  3BZK A;  2V1X A;  2K9Q A;  2KHM A;  3ZMZ A;  1HDD C;  5EYR A;  3I71 A;  2BY0 A;  1K4T A;  1HDP A;  2O8K A;  1TL8 A;  4CO8 A;  2OTL I;  1G3S A;  2ID6 A;  1I27 A;  2M7A A;  3CCS I;  1MBG A;  2DA2 A;  2JTV A;  1ZTR A;  1TT0 A;  1YTY A;  1R7J A;  2E1O A;  3DLA A;  1ORK A;  2COM A;  4BEH A;  4XOP A;  3MKL A;  4BBR J;  2ZB9 A;  4EGY A;  5LBQ A;  2C6Y A;  2UUZ A;  2AS5 F;  1SEU A;  3DF8 A;  3PO2 J;  5F08 A;  4Y3O A;  3H3U A;  4OAZ A;  2DJN A;  1DPR A;  3DEU A;  4XLC A;  3S2D J;  2L01 A;  2M4K A;  2IW5 A;  5DCM B;  3S32 A;  3E6M A;  2O9L A;  9ANT A;  2RC4 A;  2XAU A;  1SFX A;  1BL0 A;  1H9G A;  4ZTJ A;  5ICG A;  4EV0 A;  1KU7 A;  2VJ4 A;  1YX5 A;  2ZO4 A;  3BR2 A;  2MH9 A;  1WH7 A;  2KDO A;  4H4K C;  3U1K A;  5IYB J;  2DPD A;  2IGK A;  1IN7 A;  3DBL B;  2QQA A;  4HYE A;  5AON A;  2Z99 A;  5JLX A;  1A6Q A;  5J8C A;  5FKN A;  3K9T A;  3KX2 A;  3I64 A;  2M87 A;  2PEX A;  1TWG J;  4M6V A;  4A12 A;  3BT9 A;  5D4R A;  1I3A A;  2A6H F;  4KA4 A;  4M9X A;  2CQK A;  1RNL A;  1TWF J;  4I09 A;  4OMY A;  4BHP A;  4C30 A;  2I5U A;  5B5E C;  1OCO H;  1UJ8 A;  3CZ6 A;  5IOY A;  2QSH X;  3HOT A;  2FBI A;  1JHF A;  1ETY A;  1R1U A;  3OYD A;  3S16 J;  3DPL C;  1S8N A;  1YHQ I;  2HQA A;  3NEU A;  3H5N A;  6PAX A;  3GLX A;  3H3V K;  1RUO A;  2XAJ A;  4RAY A;  5IYC J;  1MBK A;  3RI4 A;  1WQ2 A;  1JJ6 C;  2L7Z A;  2BY3 A;  1FMV A;  3KYL A;  1KA8 A;  5DYM A;  5CVI A;  3FHZ A;  1C0W A;  3A2K A;  2JRT A;  3LA3 A;  3RQI A;  3D5R C;  3Q0W A;  1AA7 A;  5H6R A;  3DKX A;  3VOE A;  1VQ4 I;  2EJR A;  2VBY A;  2GLO A;  1MIJ A;  4B1R A;  2P7C B;  2LF8 A;  3GTG J;  2VOO A;  1OYY A;  3HUG A;  4HOB A;  1QA6 A;  3J7A Y;  3BR5 A;  1B72 B;  2DMU A;  1OFC X;  3HGY A;  1RI7 A;  1MNM C;  3CUO A;  1QPI A;  2P7V B;  4P9U A;  1PP7 U;  2ME6 A;  2VKH A;  3J7Y J;  4YFK F;  3EET A;  2X4H A;  3GZ5 A;  4HW0 A;  4QTR A;  1J9I A;  5H6Q A;  1HOM A;  2BHZ A;  4M6X A;  4KMF A;  1FLI A;  4A3M J;  3R61 A;  3FBN B;  2XRN A;  3M9A A;  1I5Z A;  3S1N J;  4CCO A;  3HIF A;  1ZAO A;  3RSN A;  2XGE A;  1XSV A;  1A5J A;  1IZ1 A;  2V7F A;  2IA1 A;  1XGM A;  3IKT A;  1R49 A;  4EQQ A;  4HNV A;  3K7A J;  5F1J A;  1EV7 A;  5B3S H;  4II3 A;  1IF1 A;  2WAF A;  3KEO A;  1ZGW A;  3CJT B;  3GFJ A;  2QBY B;  2G0E A;  2H94 A;  2KJC A;  4Q48 A;  3ERM A;  2QQB A;  4HAM A;  3V8L A;  4E7L A;  3KZZ A;  1R4M B;  2QEN A;  4MLO A;  3FDY A;  1D5V A;  4M6Y A;  1XB4 A;  1O4X A;  3H92 A;  2VQC A;  2EWN A;  1J09 A;  2PG4 A;  2RVC A;  3VOD A;  3BR0 A;  3G71 I;  3MMY B;  1DU0 A;  4BQN A;  2HQR A;  3CDL A;  2VL8 A;  2W25 A;  2DMP A;  1H8A C;  3RZO J;  5DD4 A;  3C2G A;  3WTZ A;  3LAJ A;  3W3C A;  2LTP A;  1WHU A;  2UXN A;  2E36 A;  4BY7 J;  2IRF G;  3O2P E;  5BS6 A;  3TW7 A;  3I9V 2;  4EJU A;  4J00 A;  2KL4 A;  1QRY A;  1Z91 A;  2HQN A;  2QZ8 A;  3CC7 I;  3WTW C;  2LRD A;  2HPI A;  4LD5 A;  3ZR8 X;  3G73 A;  3AL0 C;  5L3F A;  1T56 A;  4IRG A;  1V3F A;  1BR4 A;  3HDD A;  4BDY A;  2OQG A;  4UUS A;  2A5W A;  1XSD A;  3LSJ A;  2ZC2 A;  4PFO A;  5DV5 A;  1B59 A;  5CKT A;  4XLE A;  4DZP A;  5M3F J;  1UMQ A;  2RQP A;  2AXL A;  5IP7 J;  3S3M A;  3DWL E;  3GUD A;  5D8K B;  1O3R A;  2HPM A;  1IGN A;  3OOP A;  4L18 B;  4E7J A;  2JQ7 A;  3FMS A;  4HA8 A;  1MH3 A;  3ZMT A;  3MAJ A;  4I2O A;  2QUF A;  2Z9O A;  3RPQ A;  5ILS A;  3PSF A;  5K5O A;  3VPR A;  2ID3 A;  1KU9 A;  1GDT A;  2GIV A;  1HKT A;  1O3S A;  3HRM A;  3R60 A;  3ABM H;  1V5E A;  2JJ7 A;  2BW3 B;  3AFH A;  4B09 A;  2UWM A;  3OMY A;  1EH7 A;  1G3W A;  4ZDO A;  1YLF A;  3MEX A;  2E34 A;  1JXS A;  5D8L B;  2M1B A;  1KZH A;  2H6B A;  5A2Q Z;  2DOD A;  2IP2 A;  3KE2 A;  4OIN F;  1G2H A;  1NK3 P;  2WAD A;  2K7L A;  2OD5 A;  1OPC A;  2GWR A;  2DXI A;  2MBF A;  3ZGK A;  4HNT A;  3S15 J;  1BA5 A;  5F64 A;  2QA4 I;  2V6E A;  2HXO A;  3BY6 A;  4A6E A;  1UEL B;  4HLX A;  4XKV A;  4BKX A;  3E5X A;  4ABZ A;  3TED A;  4LIT A;  2GM4 A;  2HYG D;  4BS9 A;  4JBA A;  4JX5 A;  1DQU A;  1UZC A;  3WTY C;  1FSH A;  4CUG A;  1RZ4 A;  2NS8 A;  1OR7 A;  3BG6 A;  3O6B B;  1E3H A;  2H1K A;  1XN7 A;  4AD9 A;  2COB A;  4LG3 A;  2ZME A;  5DUK A;  2JPB A;  3I56 I;  4FX4 A;  3KIO A;  4XN0 A;  1TLH B;  3CLO A;  3EYI A;  4IHY A;  3OSG A;  2UZK A;  2KPM A;  4IZZ A;  1HA8 A;  4IHT A;  4F93 B;  2EV0 A;  4Q47 A;  4CCN A;  3TGN A;  3LAP A;  2BVL A;  1YI2 I;  2PMZ N;  3TDU C;  3OYH A;  3F8F A;  1YIO A;  1SMY F;  4P1W A;  2IEK A;  1TNS A;  2DA5 A;  2EIJ H;  2P5V A;  4DYR A;  1PUF B;  4II2 A;  1I39 A;  2ZXH A;  1IV8 A;  2M9H A;  4ZH4 F;  2LKP A;  4MEX F;  5E17 F;  1E3P A;  4LFU A;  3CME I;  3TDZ C;  4I01 A;  2CFX A;  4OWR B;  3C18 A;  4E7Z A;  1R71 A;  3G1O A;  3PQJ A;  3HRS A;  2GA2 A;  3BG9 A;  4BDZ A;  2DYR H;  4CHU A;  1Q1V A;  3RKQ A;  3NWT A;  2EFN A;  2IS4 A;  1NHA A;  2KIS A;  1ETQ A;  3NQO A;  5DS9 A;  2ETH A;  2VQH A;  2MW8 A;  4AYB N;  2F6C A;  1VQ5 I;  3HTS B;  2PMZ A;  3KP6 A;  3JRF A;  5FKM A;  3FXJ A;  1LDJ A;  3DEW A;  1AKH A;  2YX7 A;  1QZE A;  4M9S A;  2K3F A;  3MVP A;  2M45 A;  1S6L A;  1WPK A;  2E5Z A;  3F6O A;  1MSE C;  4ON0 A;  3F3X A;  5LHH A;  3TBI A;  2FE3 A;  3AG2 H;  2DT5 A;  2HOE A;  2QKL B;  1B9M A;  2DAO A;  3F9K A;  3LSM A;  2EIK H;  4BQQ A;  1R22 A;  1W7P B;  2WB1 N;  5DDG A;  5CVV A;  5LGT A;  5D4S A;  5IY5 H;  2ZXJ A;  5GTH C;  3DEE A;  3K10 A;  3REO A;  4RLQ A;  3H1C A;  2VI6 A;  2A6T A;  5E1Z B;  1KU2 A;  2EA4 A;  3CCR I;  4NC8 A;  2DQL A;  3W2W A;  1W5S A;  5FO5 A;  1FX7 A;  5K1Y A;  4HV6 A;  3CC4 I;  4TV7 A;  4O3M A;  4IL6 C;  2CV1 A;  3GW2 A;  3AG3 H;  4ESJ A;  1PVE A;  2X85 A;  3HGG A;  4CA0 A;  5L3E A;  2VKE A;  2XRL A;  2X1E A;  4E7S A;  2BXZ A;  2DQR A;  4A3F J;  1FBS A;  3M8F A;  2O6G E;  2K5C A;  4G7H F;  1Z21 A;  4MEY F;  1XMK A;  2PJR B;  4JQF A;  1J7K A;  5LGN A;  1VQO I;  2DYS H;  5CQE A;  1IXR C;  5HOO A;  1AWC A;  2WB1 A;  1D0Z A;  5FGM A;  4HF1 A;  1NG7 A;  1XG1 A;  2GZW A;  2HTS A;  5BPI A;  5FFZ A;  1UHW A;  1MW7 A;  2EBI A;  2HZD A;  3OSF A;  4ITV A;  3OS1 A;  3T8R A;  3HEF A;  1HW2 A;  2NVQ J;  1L3L A;  2CG4 A;  1Z67 A;  3LFK A;  2VBW A;  1BR2 A;  4KIG A;  2DA3 A;  3ZPL A;  1J2X A;  2DFI A;  5L3D A;  5HOD A;  5E8I A;  2IS1 A;  3GWZ A;  2WBM A;  4U0Y A;  1HSJ A;  2FMY A;  3HPG A;  2CW0 F;  1ZGA A;  4Y17 A;  4KDP A;  1VQ9 I;  1V54 H;  3SFZ A;  4IHX A;  1GUU A;  1K6O A;  2HDC A;  5KHD A;  1Z6T A;  3OS2 A;  1LE8 A;  3HOW J;  5HLI A;  4M71 A;  4IHS A;  3HJE A;  3K4B A;  3JRI A;  3L2W A;  2FD5 A;  1XMA A;  2L4M A;  4XSX F;  1O3Q A;  2R7X A;  2R4G A;  4KJZ A;  3ONQ A;  3GFL A;  2DA6 A;  5HVQ C;  3HOS A;  5E79 C;  2EZL A;  3FM5 A;  3E1S A;  1A04 A;  2KIF A;  3BG3 A;  3C2B A;  3D5L A;  4Q4Z F;  1ZRD A;  3FX3 A;  3OYA A;  5E3L A;  2IS6 A;  1MDM B;  1MND A;  3DTK A;  1G3Y A;  4B3A A;  3KYC B;  5EZG A;  1MGT A;  5BPD A;  2IGM A;  3CD6 I;  3CMA I;  3FXM A;  1VFC A;  1BC7 C;  1YRN B;  2VXZ A;  1X1P A;  2XF6 A;  3BDD A;  2FJ1 A;  5IP9 J;  3M1C A;  3P9K A;  2LKS A;  4KT5 C;  2A05 A;  3WOD F;  3K4J A;  1IUY A;  2H6C A;  2LYC A;  4DYQ A;  5J40 A;  4KNY A;  3KEY A;  1XCB A;  2FU4 A;  1YJW I;  5IT9 K;  2KDZ A;  4WXD A;  4BJ5 C;  1IW7 F;  2ZFU A;  1TW2 A;  4RM3 A;  4YFN F;  4LLN A;  4XKW A;  4M3F A;  1J59 A;  3CUQ B;  2M8G X;  5E1W A;  5JHU A;  3KP7 A;  3W6J B;  1NH3 A;  1CF7 B;  1TTY A;  2XGC A;  3CCY A;  2Q8K A;  3FIS A;  1JKR C;  1SVM A;  3G4S I;  1AHD P;  2K9N A;  2NVX J;  2R3S A;  3TO6 A;  1R4N B;  2L7F P;  4RB3 C;  4U88 A;  1F43 A;  4ENM A;  4D7N A;  4B48 A;  1I6H J;  5LRS A;  1WI3 A;  2LRE A;  4R8H A;  3OYG A;  4A3B J;  2Z16 A;  2NXN B;  1S7A A;  1KGS A;  1QQI A;  3S17 J;  3ECO A;  1TQM A;  2EH3 A;  2EZK A;  2ZJR F;  2X48 A;  2ZCW A;  4KIF A;  2E60 A;  1NK2 P;  3FBI B;  2CFO A;  2DA4 A;  3A01 A;  1W4M A;  5HNF A;  2VAS A;  3TMO A;  2D1H A;  5B66 C;  3I4P A;  1E3O C;  1ZG5 A;  2MGQ A;  2QSF X;  3FXO A;  2CW7 A;  2VKD A;  2XV4 S;  3ASO H;  5FKK A;  3DU5 A;  3GFM A;  1IN4 A;  5E18 F;  4HX8 A;  2M0C A;  4C3I J;  3OYN A;  3K1N A;  2MD5 A;  4IPA A;  3OYJ A;  3H35 A;  4YIR X;  4EJO A;  2WAE A;  2HGC A;  4IVN A;  2R5Y A;  2CJJ A;  1IN6 A;  4I7H A;  4GFB A;  4M74 A;  1DPU A;  2CYY A;  2DOE A;  4Y7N J;  3K70 C;  3T5X A;  4UNO A;  1YJN I;  4WK8 F;  4ENJ A;  2P5K A;  4AID A;  3DTE A;  3M3Y J;  1BOB A;  1N78 A;  3GX4 X;  1G3T A;  3WE3 A;  2E1M B;  3I55 I;  1Z7U A;  2CUE A;  1KYW A;  1QU3 A;  1S7O A;  3RDI A;  4I0B A;  3M4O J;  5D5W B;  2Y69 H;  3DKW A;  2KZV A;  2EIM H;  1YS6 A;  4EMS A;  2RQQ A;  2FOK A;  2K9M A;  2JK3 A;  5BNG A;  4PGH A;  2M8E A;  4JX4 A;  2W4S A;  2VN2 A;  4YRV A;  2D45 A;  2LMD A;  3AAF A;  1RIO H;  4QIW N;  2W84 A;  3E3V A;  2QWW A;  1ETX A;  1T0F A;  1G59 A;  3S1M J;  2Y48 A;  3O3K A;  4M73 A;  3R6S A;  1GT0 C;  2JWT A;  2XDV A;  3FF5 A;  2W85 A;  4KT6 A;  1MZB A;  1X3U A;  1P7I A;  4CH7 A;  5DEQ A;  3KCC A;  2O3F A;  2A68 F;  2GXA A;  2EK5 A;  4KN4 X;  4DZJ A;  4ZDL A;  4M3E A;  1R36 A;  3LL7 A;  2VE9 A;  5TRD A;  4FX0 A;  4CZC A;  1FOK A;  2VBZ A;  1ERD A;  1FTZ A;  4XMY A;  2XAS A;  4AIH A;  4CDG A;  1HW5 A;  1Y1W J;  2R7Q A;  3U21 A;  3BR1 A;  1FY7 A;  4A3E J;  5FLM J;  4DYC A;  3LSG A;  3ABL H;  3GO5 A;  3ZP5 A;  1T8I A;  5M5X J;  1X2N A;  2JZY A;  3HSE A;  5FRN A;  1MJB A;  2ZJQ F;  2RNG A;  4RGR A;  2OZU A;  4NBQ A;  1JTX A;  3CES A;  2W82 A;  1DGW Y;  4EJT A;  3SYT A;  1JHH A;  2ADU A;  2RGV A;  3F23 A;  3SZP A;  4XID A;  3SEQ A;  1YFH A;  1RRJ A;  1LQ1 A;  3EUA A;  5FLX K;  1IO2 A;  2WY7 Q;  3V42 A;  3T1B A;  1AOY A;  2HNH A;  1OJL A;  3V7S A;  2ISZ A;  3GTK J;  3B6A A;  1U5T B;  2OAZ A;  2DA1 A;  2M7B A;  4CSW A;  3L1P A;  3BZ6 A;  2YS9 A;  3KYD B;  1X4P A;  5HLG A;  3LSP A;  5DCM A;  2H27 A;  1ZYR F;  5E3O A;  3BJA A;  1LVA A;  2K4J A;  2Y9Z A;  3KLN A;  2YPR A;  4UVA A;  2XAH A;  3WTV C;  2HOT A;  2EIN H;  2FF4 A;  2OBP A;  4BE0 A;  3QP5 A;  3W2V A;  1WJA A;  4BAY A;  2E5N A;  1VQL I;  1OLT A;  4Y4R A;  5K7F A;  1EH8 A;  1K83 J;  2E1C A;  5DTD A;  4EM0 B;  1RET A;  3RQ4 A;  4LK1 F;  1ITY A;  3QOE A;  4MHG A;  3CP2 A;  2FEZ A;  1QBJ A;  5AIQ A;  1U78 A;  1FT9 A;  2YUS A;  1OCP A;  3OYE A;  4A6D A;  4XRS A;  2VB6 A;  4N0B A;  4A3I J;  1GXQ A;  1ZN2 A;  1TBX A;  4I99 C;  4HBL A;  4NC7 A;  2Z1D A;  4PZJ A;  5JLW A;  1E17 A;  3S8P A;  1R1T A;  1XMX A;  3GZ6 A;  2PFB A;  3IUO A;  1R5I D;  3KZI C;  4GRI A;  4MIM A;  2GBY A;  4IRI A;  3BTJ A;  4ENN A;  4A3C J;  4KIT B;  4U0W A;  2D5V A;  4KN7 X;  3J7Z I;  2CV2 A;  4PSW A;  1SAX A;  4G6T B;  2X51 A;  3LMM A;  1ONV A;  2XKP A;  3G2B A;  2XRO A;  2QVO A;  3EQL F;  3EUH C;  2NVT J;  3S14 J;  4FTH A;  3TP0 A;  5K5Q A;  2CW8 A;  2EFO A;  1GXP A;  3VYR B;  2IA2 A;  3BQY A;  2RKH A;  4IX7 A;  4QPQ A;  1FMW A;  2LR8 A;  3Q9S A;  5B1B H;  1W1W E;  4KIC A;  1U8B A;  2WY8 Q;  4UUV A;  3HOV J;  3OIP A;  5KAI C;  4IQ4 A;  4U7B A;  4D1Q A;  2XF5 A;  1BN5 A;  1JUS A;  3A1Y A;  3CCJ I;  4E7H A;  1B72 A;  3QOD A;  1D1C A;  1OIS A;  3CUQ C;  1LJ9 A;  5J8F A;  5IT9 Z;  5CJ9 A;  5D5U B;  3J80 Z;  2QEX I;  4HX4 A;  4FHT A;  3T8T A;  3S2W A;  1UG2 A;  3WGI A;  2L5Q A;  4F92 B;  3TO7 A;  4BHC A;  4C3J J;  2A6E F;  2AQE A;  4KFC A;  1BI2 A;  1S72 I;  3VWB A;  3RKY A;  4LMY A;  1QNT A;  3K1P A;  2JSC A;  4XSZ F;  4DBQ A;  3S3O A;  4WXH A;  1RES A;  2XAG A;  1GVJ A;  2FA5 A;  2E19 A;  4MQV A;  3MZY A;  3CTA A;  5GP9 A;  3CJQ B;  2CQ7 A;  3ABT A;  4L5J A;  3HB9 A;  4D5C A;  2QBY A;  1UAA A;  3L2U A;  2B9S A;  3EYY A;  5K5R A;  1X1B A;  1HCR A;  1R5G A;  2KP6 A;  2XAQ A;  5L3G A;  1DU6 A;  1TW3 A;  2K3P A;  2R7Z J;  1LEA A;  2R7T A;  3RPU A;  2TRT A;  4BXF A;  3BQZ A;  1ZG1 A;  4RB2 C;  3A0B C;  2Y75 A;  3BCB A;  2OV7 A;  3DFG A;  5IT3 A;  2DT7 B;  1ETW A;  2QYO A;  1EJ9 A;  3P5J A;  4ZDP A;  3SQN A;  1SMT A;  1SD4 A;  5J6X A;  4B3X A;  3D5S C;  4HQM A;  2JSP A;  2NYX A;  3ZN0 A;  1XPX A;  3AG4 H;  1F4K A;  3MKY B;  3BWG A;  2E1M C;  2G9W A;  2LY1 A;  2KJB A;  2DA7 A;  4FT8 A;  4BAC A;  5J1U A;  1VF9 A;  4HDV A;  4AM3 A;  5JI6 A;  3U1D A;  4I76 A;  1YE9 A;  5LHG A;  2DK5 A;  4X0G A;  3TKY A;  3U2R A;  2MLG A;  2IBD A;  1STZ A;  5EF6 A;  3LA2 A;  4E4H A;  3HOU J;  3JSO A;  4XKB A;  2IJL A;  5FKL A;  4DJA A;  5LD2 C;  4G9Y A;  2RAE A;  5F04 A;  3TOA A;  3N97 A;  1FTT A;  3CF2 A;  2A61 A;  1O57 A;  2DMT A;  3FXR A;  3H9J A;  3FHN A;  4PFP A;  4M3B A;  3IH2 A;  4RLF A;  3SDB A;  3DV8 A;  4NNJ A;  5C4J J;  3A03 A;  2M0M A;  3BG5 A;  2PJP A;  1SFK A;  2BY1 A;  2Y0S A;  1UB9 A;  4XRM A;  1EH6 A;  3JRG A;  3LWF A;  4HZF A;  4KYW A;  2E71 A;  2JVH A;  3NAR A;  1FP1 D;  3JAM K;  5CVJ A;  2L9S A;  2BW3 A;  2BYV E;  2HYJ A;  3G3Z A;  5J4V A;  4XN3 A;  1YOV B;  3FK7 A;  3RPU D;  1TWC J;  2XIG A;  1SD5 A;  2AQF A;  1JE8 A;  2TDX A;  3FKJ A;  2G7U A;  3HC7 A;  3HRT A;  2ECC A;  2HWV A;  3V4G A;  1FPQ A;  3B02 A;  5FRM A;  2HI3 A;  4C9Y A;  2PMU A;  2L4A A;  2PN6 A;  5ILU A;  4GDF A;  1LKX A;  3E6C C;  4UV9 A;  1BM9 A;  1HF0 A;  2L9R A;  4BU2 A;  3OYL A;  3ULQ B;  2GOM A;  4CCL A;  1T6S A;  3OYI A;  3JRA A;  2DBB A;  4XR6 A;  4YII A;  1I1G A;  1N77 A;  3ABU A;  2XHK A;  2YR2 A;  5ICF A;  2KRF A;  3WE2 A;  1VI0 A;  1TQI A;  3IH4 A;  4KUM A;  2D2W A;  1MJA A;  2ZFW A;  3QOP A;  1ZLJ A;  2XB5 A;  3X2Q H;  2Y9Y A;  4AIK A;  3BOQ A;  3RCO A;  1U5T C;  5LGU A;  5FLX Z;  3TP3 A;  1WZ2 A;  2XGD A;  2F5F A;  4FAS D;  4F3Q A;  3CC2 I;  1TNT A;  3V8J A;  2GAU A;  1JKQ C;  3WG7 H;  4ENK A;  4CYC B;  2VE8 A;  3WU0 A;  5HLT A;  2XC7 A;  2M2E A;  4XM3 A;  2DTZ A;  4RDU A;  1GV5 A;  2P4W A;  4HST A;  1YQA A;  5M5W J;  1JKO C;  3IP4 B;  2KLO A;  3N4M A;  4BXU A;  4N9H A;  4UB6 C;  1JT0 A;  5GPC A;  4LK0 F;  5HS9 A;  2OU2 A;  3FXK A;  5CYV A;  4CYD A;  4XRF A;  2LBF B;  3ZQQ A;  1X1C A;  1BI1 A;  3ZN1 A;  5CLS A;  4CCM A;  1P7J A;  1PUF A;  4HSR A;  4Y13 A;  1CQT A;  2KRH A;  2NVU B;  2W1O A;  4B47 A;  1VND A;  1Y8R B;  3KP4 A;  1XX5 A;  2LBF A;  4WXC A;  1WFX A;  5CVR A;  3PNV A;  5E1X A;  1XGS A;  3H5A A;  1KQ0 A;  4V2G A;  2JPC A;  2FNA A;  4UHT A;  4NQW B;  3SZT A;  3ZQH A;  5D5X B;  5ICC A;  4A3L J;  3SJM A;  3QQA A;  4EJV A;  2XPU A;  1RKW A;  3D1N I;  3CDI A;  4GGG A;  3PJR A;  2DW4 A;  3HOZ J;  1GVD A;  4PJL A;  2XUB A;  1SVL A;  1ZRC A;  2QM3 A;  2Z3Y A;  3MKW B;  2L7K A;  4DOZ A;  5LEK A;  1Q1H A;  5BQT A;  5FFX A;  1T33 A;  3WTS C;  4XOT A;  5KCM A;  1SVO A;  3HSR A;  2VC0 A;  3BLY A;  4I02 A;  3I4M J;  3TO9 A;  3FXL A;  1SAN A;  1YW9 A;  4D7M A;  2CQN A;  3ZRG A;  5LEJ A;  2LDU A;  5GAD J;  4Y52 J;  1VQN I;  1MSF C;  3HG9 A;  2N8G A;  4A0Z A;  3VYT B;  3GF2 A;  5EEH A;  3OV8 A;  2X6X A;  2WC2 A;  1I3Q J;  1XC5 A;  1HLV A;  3ZMU A;  2DT6 A;  3CMM A;  2BEO A;  2O8X A;  5D6F A;  3UNG C;  3CP8 A;  5GTI C;  3KZY A;  3O8H A;  3LOC A;  3IH3 A;  3BPX A;  1FOX A;  3VDX A;  1K7A A;  4XOR A;  1W7P A;  1BI0 A;  2STT A;  2R7V A;  1SFU A;  4F7Z A;  1Z3X A;  3CF5 F;  2HDD A;  3KFW X;  1QHG A;  3P7N A;  3K70 D;  2ELK A;  1BI3 A;  2ME0 A;  2DOF A;  1T2K A;  1D0X A;  1APL C;  4BQA A;  2LP0 A;  2M34 A;  1WJE A;  1TC3 C;  2CMP A;  1DDN A;  4LJZ F;  1OYW A;  5IOZ A;  5FB2 A;  3QPT A;  3AKZ A;  4P9F A;  2XSD C;  1FEX A;  4ZZL A;  3LSK A;  3CCU I;  4LG0 B;  4HF2 A;  4HG2 A;  5LHI A;  2R5Z B;  2KFD A;  2M4G A;  4RGS A;  3RKW A;  3BC8 A;  1B8I B;  1BJA A;  1KYZ A;  4G8X A;  1XS9 A;  2PJR A;  4UB8 C;  5EEG A;  4YFX F;  4J19 A;  1BC8 C;  2R93 J;  1E0E A;  2DK8 A;  4LGW A;  1VTN C;  1D5Y A;  1X19 A;  5F0H A;  3K4L A;  1H0M A;  4EAT A;  4MFE A;  2I10 A;  2P81 A;  2HEO A;  5EGO B;  1MBE A;  2CO5 A;  3PNT A;  4RGU A;  2L9N A;  5EEA A;  4XK4 A;  1D1A A;  1DP3 A;  1F1Z A;  4G6Q A;  1ENH A;  4YEJ A;  4DNC A;  3PO3 J;  4C3H J;  2WV0 A;  1ZQ3 P;  2P8T A;  2V1N A;  3F72 A;  3BJO A;  2RRE A;  3J7A O;  4B43 A;  1HC8 A;  2WV1 A;  3QAH A;  4L0Y B;  1MMS A;  4ZTF A;  4BGD A;  1Y56 A;  2DDB A;  5L3C A;  2L2O A;  4A93 J;  2VJI A;  3HYI A;  4G7Z F;  5EG0 B;  2P0W A;  1FWZ A;  1P4A A;  2EZI A;  3JRD A;  1JI8 A;  2V9V A;  3IRR A;  1W7P D;  3R4K A;  3DBH B;  1MBJ A;  1ZK8 A;  3FKI J;  5F6F A;  1H89 C;  4XRS G;  2FBK A;  1F5T A;  2NNY A;  2HVS A;  1BBY A;  1USS A;  3JW4 A;  4UY8 I;  2M30 A;  1B9N A;  1D8K A;  1UHM A;  2BBY A;  2HXI A;  2KIU A;  5FJ8 J;  3WTX C;  2LVS A;  1HBX G;  1WI9 A;  5ICE A;  3I58 A;  3ESW B;  2KIM A;  1OMI A;  2GA1 A;  5C44 J;  4HX7 A;  2B0L A;  4I0A A;  3HOY J;  2MSY A;  4G6D A;  1ZR4 A;  3T0Y A;  1MDM A;  1IRX A;  4MFD A;  5KVR A;  1W36 C;  3HKZ N;  3EUH A;  3TW6 A;  3F0C A;  5K7Z A;  3ZMD A;  3QPL A;  3GTM J;  2W48 A;  1Z0X A;  1YRN A;  1IRG A;  1Z6R A;  3PUB A;  1FOW A;  5BMZ A;  5GAH J;  3J80 K;  1K78 B;  1HKS A;  2E7X A;  1B6A A;  4R1H A;  1IRF A;  5D5V B;  1Z3Y A;  1K6Y A;  4UVB A;  1BR1 A;  2K4B A;  4OMZ A;  5J4Y A;  5JVG F;  1LFP A;  2RDP A;  4BL0 B;  2FQ4 A;  4XKC A;  1P9Q C;  2ESN A;  2DMQ A;  3JAM Z;  2LLK A;  2XPW A;  3L2C A;  1ZLK A;  4S05 A;  1J0R A;  3GBG A;  4BBS J;  1N75 A;  3CUQ A;  2NAZ A;  1CF7 A;  2VQG A;  3H0D A;  2P6T A;  1K61 A;  1FP2 A;  2NNN A;  1PJR A;  2ICW G;  3WHB A;  3IKV A;  1AU7 A;  2QGU A;  3PL8 A;  3ML6 A;  3QYF A;  4N4N B;  1DUX C;  3CQZ J;  3HKZ A;  4AWX B;  5E8G A;  1PUE E;  3UKG A;  4E70 A;  3QWL A;  1G4D A;  4X6A J;  3GTQ J;  2B63 J;  4IJA A;  3ZXS A;  2HKX A;  2YX4 A;  3C2H A;  5HS7 A;  4RGX A;  2IGN A;  2Z2S B;  3SDG A;  4O6J A;  4M3D A;  1L0O C;  1FOY A;  1VQP I;  3OWT A;  1IUF A;  4A5N A;  3FXQ A;  3S93 A;  1S7E A;  2VT3 A;  3E0J B;  4FE4 A;  2V9P A;  2OC6 A;  4L9J A;  3ZOB A;  3RZD J;  2KT0 A;  4YEL A;  2O7O A;  3A02 A;  4H0E A;  1R9T J;  4GXO A;  3GYH X;  2O61 A;  1QHH D;  1Y8Q B;  5F0C A;  2IVM A;  1A31 A;  2IPQ X;  4LB6 B;  4PUS A;  2JA7 J;  1I50 J;  2F5E A;  5GPA A;  3D0S A;  1PP8 F;  4NUB A;  2EZH A;  1TP4 A;  1ZKG A;  3NWS A;  3ZQG A;  2VJJ A;  4KIS A;  1O3T A;  2NOG A;  2F5V A;  2MA3 A;  2QF7 A;  2DU9 A;  4B44 A;  2PBI A;  1KU3 A;  4PJM A;  2VIX A;  2FRH A;  5LLQ A;  3CO6 C;  4AIJ A;  3PFI A;  4A0Y A;  4M9Z A;  1NG6 A;  3BR6 A;  2LC2 A;  4XBF A;  1YJ9 I;  2X6Y A;  2ECB A;  1QZZ A;  2H8W A;  2JN6 A;  3WGG A;  1KQ8 A;  4ZZD A;  4CZZ A;  4NDL A;  3SZG A;  3JTG A;  2ELH A;  3JR9 A;  3ERE D;  2HZT A;  4A3G J;  2WAQ N;  4O5V A;  1U9N A;  2AXT C;  2JUC A;  3RYR A;  1P4X A;  3IWF A;  1YG2 A;  2CQQ A;  4JYK A;  1ZGJ A;  3K4K A;  4FQG A;  4IXA A;  1IRZ A;  1ZHF A;  2LK2 A;  4RB0 A;  1YIT I;  3HHH A;  2CSO A;  2ZNY A;  4BHB A;  1BIA A;  1Z05 A;  3P9C A;  3BTL A;  2VOD A;  1T95 A;  2IT0 A;  4BUP A;  2DO7 A;  2VKV A;  2TCT A;  2ZJP F;  4LLG F;  4OIR F;  3BRO A;  1WH5 A;  1MD0 A;  2V26 A;  2Q2E B;  3HRU A;  3L00 A;  3OS0 A;  5EDN A;  2Q1Z B;  4L5I A;  5KAF C;  2W57 A;  2OQR A;  3VSK A;  3K4C A;  3H0G J;  3KET A;  5CPR B;  3LQQ A;  3DLL F;  2VPL A;  4RM2 A;  2EFP A;  1LEB A;  3I0T A;  2VLA A;  2E35 A;  4L9T A;  3GME A;  2EFQ A;  2V9K A;  3JRC A;  1R5H A;  3I3L A;  4PGG A;  4AU7 A;  2WAQ A;  3MZ8 A;  1U8R A;  4Z6Y A;  2HOA A;  4DW6 A;  4F55 A;  4RB1 A;  1ZR2 A;  3W6K B;  1XDS A;  2P5L C;  4GCV A;  1FNN A;  3VYS B;  4WX9 A;  3OYC A;  2X6O A;  4BEH B;  1WVR A;  3OIO A;  4U7D A;  2EPF A;  2EV6 A;  3WU2 C;  3BG7 A;  4OU0 A;  2M5W A;  2JT1 A;  3KEQ A;  2IXS A;  4MTD A;  2NVY J;  4EGZ A;  3F8C A;  2G7H A;  5JHF A;  4RA2 A;  3RYP A;  3ZQ7 A;  1S29 A;  2L54 A;  4RS8 A;  4B4C A;  1MH4 A;  2EA2 A;  2K9L A;  4AVP A;  2DTR A;  4XIC A;  3PUF A;  4BQO A;  2JUG A;  3M07 A;  1U5T A;  2JA2 A;  2FX0 A;  3C3W A;  4DBR A;  3L2Q A;  4BJ6 C;  3ISP A;  5BOX A;  3CLQ A;  1S5L C;  1R23 A;  3DU6 A;  5AIP A;  4A3D J;  1MKM A;  2EIL H;  1HST A;  3HXL A;  3C1D A;  1WJF A;  3HSF A;  4HRI A;  3CJN A;  1P92 A;  1IN5 A;  5DUI A;  2OPT A;  5FD6 A;  5CQG A;  5C4X J;  3M1E A;  2E2I J;  2OCC H;  1OYI A;  1FZP B;  2AO9 A;  2FSW A;  3IAS 2;  4ZYG A;  4CCJ A;  3KPH A;  2MD0 A;  1O7F A;  3FXU A;  3I5U A;  4LLL A;  2CGP A;  2FML A;  2R0Q C;  4M72 A;  2CS3 A;  4YIF A;  4P5O A;  1IC8 A;  3H9G A;  1X4O A;  2W00 A;  3PNY A;  3WTT C;  2DFE A;  1FYM A;  3PIO F;  2XF7 A;  4NC6 A;  5J47 A;  2PMH A;  3FK6 A;  4ASN A;  5C3E J;  4GYG A;  4BJT A;  2R7U A;  3L9F A;  3HBL A;  1LFU P;  2CU7 A;  3BJ6 A;  4I98 B;  2R7S A;  1BIB A;  3GLL A;  5EZH A;  4KMU X;  4PJ0 C;  1ZRE A;  3U9G A;  1OCZ H;  2KIQ A;  2L0K A;  1W5C C;  1G8X A;  4XLP F;  1FYK A;  1H9T A;  2DLL A;  2V1U A;  2RN7 A;  3BCA A;  5IP6 A;  1X1D A;  2VOP A;  4I6Z A;  2F4M B;  2Y31 A;  3G1M A;  1WWX A;  4F91 B;  3HUG B;  3LSI A;  3E5U A;  4BYY A;  1MJ9 A;  2K86 A;  3OYM A;  2HU9 A;  3I54 A;  1E2X A;  2QSG X;  3IAM 2;  2AHQ A;  2B7E A;  1YYV A;  2DDA A;  3A0H C;  3BZC A;  3DQV C;  3HHG A;  5E3M A;  2X1D A;  2NS7 A;  3F8M A;  3K4M A;  4UUT A;  2ZKZ A;  1TQP A;  2HQ5 A;  3JRB A;  1JGS A;  2DJI A;  1ZG3 A;  4E7K A;  2WA0 A;  3RKX A;  1B1B A;  5DM6 F;  4LIU A;  4QPO A;  4G12 A;  3WU1 B;  2MG4 A;  3QU6 A;  2NRA C;  4IHW A;  2V6C A;  4D0P A;  2FQ3 A;  2O5R A;  5TGT A;  5HDG A;  4IO9 F;  3ABK H;  2VQL A;  2MYS A;  4Y15 A;  4MGR A;  3Q3S A;  1WGX A;  2NS0 A;  2DCE A;  4N9I A;  5J1R A;  3F6V A;  3GTJ J;  3FZV A;  1X58 A;  3IWZ A;  4BNC A;  3DCF A;  2OCE A;  1A6I A;  2YU3 A;  4HNU A;  1CGP A;  3OYF A;  5B1A H;  1Z1D A;  3DPU A;  2DOA A;  3EPZ A;  3GZN B;  4G7O F;  1FJL A;  1IN8 A;  4JOM A;  4FIS A;  2A07 F;  1YS7 A;  2LH9 A;  2L7M P;  3PSI A;  2KQR A;  4XQF A;  3R0J A;  3DXJ F;  4QSH A;  5JFR A;  5H2F C;  3E6B A;  3K6G A;  2HVR A;  1POG A;  1Y1V J;  2XKO A;  1EA3 A;  4DQ2 A;  2J5O A;  4L9V A;  1WJ5 A;  2F5C A;  2K27 A;  2PX9 A;  2Y0S N;  1MMG A;  3I4N J;  2LG4 A;  3ZQF A;  1Y39 A;  4HQE A;  1PDN C;  2L9V A;  2Y2Z A;  1WKM A;  3H5R A;  1QGP A;  2F4I A;  4PDK A;  3RJP A;  1S9H A;  1RKT A;  3QPS A;  4UUS B;  3TL4 X;  1H88 C;  5EJC A;  3QPH A;  3IV5 A;  2ZNZ A;  1V55 H;  3F8B A;  4KIB A;  2R7R A;  3CCL I;  1XGN A;  2W7N A;  4NHJ A; 
#chains in the Genus database with same CATH homology
 4PSX A;  2DT6 A;  3CMM A;  2CH0 A;  3UNG C;  2E60 A;  3CP8 A;  3KX2 A;  3FBI B;  2CFO A;  3VDX A;  4XOR A;  5HNF A;  2VAS A;  3TMO A;  2R7V A;  3QYB A;  1DGR M;  1Z3X A;  2CW7 A;  2VKD A;  4C30 A;  3N05 A;  4IKF A;  3DU5 A;  1T0F C;  1QHG A;  3CZ6 A;  3K70 D;  3VSL A;  4HPQ A;  3HOT A;  4ZC3 A;  1D0X A;  5HNH A;  3OYN A;  3OYJ A;  3OYD A;  1LDK B;  3H35 A;  1WJE A;  2BVM A;  3DPL C;  2CMP A;  4E7I A;  2WAE A;  2VXD A;  2HQA A;  3H5N A;  3AKZ A;  1WJB A;  3LSK A;  1MMN A;  1V5G A;  4HG2 A;  2IS2 A;  3K70 C;  4LIV A;  3SEZ A;  2M4G A;  3BC8 A;  3DTE A;  3LFU A;  1BOB A;  1FMV A;  3KYL A;  1N78 A;  3EUK L;  2E1M B;  2PJR A;  3OIQ A;  3A2K A;  1QU3 A;  1E0E A;  3D5R C;  1AA7 A;  1X19 A;  2MAB A;  3K4L A;  3DKX A;  4EAT A;  3CJR B;  2CUZ A;  3PNT A;  2L9N A;  1D1A A;  2KZV A;  3J7A Y;  1DP3 A;  3RTR A;  2RQQ A;  2K9M A;  4YEJ A;  3W2A A;  2W4S A;  4YRV A;  4D9J A;  2VJ5 A;  2V1N A;  2RRE A;  4B43 A;  2OUM A;  2VKH A;  4ZTF A;  4BGD A;  1Y56 A;  2X6W A;  1G59 A;  4FET A;  2ZSH B;  4BE1 A;  2L2O A;  2VJI A;  2XDV A;  1YX3 A;  2P0W A;  4KT6 A;  1JI8 A;  2R7W A;  4CH7 A;  1D0Y A;  3FBN B;  4CCO A;  2HDW A;  3RSN A;  2V4J C;  4ZDL A;  2V7F A;  2HVS A;  3LL7 A;  5KNL A;  4CZC A;  2ELJ A;  1ERD A;  4XMY A;  1W36 D;  3M8J A;  4II3 A;  2WAF A;  2R7Q A;  3U21 A;  4U87 A;  3LSG A;  2MC4 A;  3QYE A;  2HVQ A;  4E7L A;  1IRX A;  4MLO A;  3FDY A;  1W36 C;  5FRN A;  2VQC A;  1WJD A;  1J09 A;  2RNG A;  3OL3 A;  3CES A;  2W82 A;  3MMY B;  3PUB A;  1DGW Y;  4BQN A;  3SYT A;  2VL8 A;  3SEQ A;  4N4O B;  3L2R A;  1Z3Y A;  3C2G A;  1K6Y A;  3PFY A;  3HPH A;  1BR1 A;  3EUA A;  1LFP A;  2WY7 Q;  3W3C A;  3V42 A;  4F52 A;  3OOU A;  2HNH A;  4BL0 B;  1Z7L A;  4XKC A;  1P9Q C;  4RMN A;  2M7B A;  4CSW A;  1GLN A;  3GBG A;  3I9V 2;  1N75 A;  4J00 A;  2KL4 A;  4AVZ A;  2VQG A;  3H0D A;  1X4P A;  2LRD A;  2HPI A;  3ZR8 X;  1PJR A;  3AL0 C;  4XLH A;  5FRO A;  3UR3 C;  3PL8 A;  1BR4 A;  4BDY A;  2A5W A;  3QYF A;  4N4N B;  3HKZ A;  2BOL A;  3S3N A;  4PFO A;  5CKT A;  4XLE A;  3ZXS A;  4BE0 A;  3S3M A;  3C2H A;  4XON A;  1WJA A;  3DWL E;  3W2V A;  2IGN A;  2E5N A;  2Z2S B;  2HPM A;  2I8D A;  1OLT A;  4Y4R A;  4E7J A;  3OWT A;  4XNF A;  3S93 A;  3E0J B;  2OC6 A;  3PSF A;  3RQ4 A;  3QOE A;  3CP2 A;  4YEL A;  4AYB A;  1QHH D;  3OYE A;  1V5E A;  3AFH A;  2BW3 B;  2UWM A;  3OMY A;  2KMU A;  4ZDO A;  4PUS A;  2VB6 A;  3LSH A;  4NC7 A;  2Z1D A;  3S8P A;  1LVK A;  3IUO A;  4OAY A;  4GRI A;  4NUB A;  3NWS A;  2WAD A;  4KIT B;  2VJJ A;  3OR1 C;  4KIS A;  2IGO A;  2CV2 A;  4PSW A;  2F5V A;  4G6T B;  2DXI A;  2X51 A;  3LMM A;  3G2B A;  4HNT A;  2GOX B;  3ZGK A;  4J01 A;  1Y6I A;  3EUH C;  4B44 A;  2V6E A;  4ZJZ A;  1UEL B;  4XLA A;  4PJM A;  2CW8 A;  2VIX A;  4XKV A;  2JVG A;  3VYR B;  4C2T A;  1NG6 A;  3DTI A;  2LC2 A;  4LIT A;  4IX7 A;  4QPQ A;  2X6Y A;  4BS9 A;  1FMW A;  1DQU A;  3OYB A;  2ZXI A;  3SZG A;  2WY8 Q;  2FUG 2;  3OL4 A;  4CUG A;  3OIP A;  4IQ4 A;  4U7B A;  3BG6 A;  4D1Q A;  2XF5 A;  3A1Y A;  4E7H A;  3QOD A;  1D1C A;  3K4K A;  4LG3 A;  1R6R A;  4HEA 2;  4XN0 A;  1T95 A;  4BUP A;  2L5Q A;  4F92 B;  2KPM A;  4IZZ A;  1HA8 A;  2V26 A;  4F93 B;  2Q2E B;  4CCN A;  1MNE A;  2AQE A;  3OS0 A;  2BVL A;  2Q1Z B;  3OYH A;  3VSK A;  3K4C A;  3VWB A;  5CPR B;  4P1W A;  4DBQ A;  3S3O A;  2VPL A;  4RM2 A;  2VLA A;  4PJJ A;  4II2 A;  3OYK A;  4R79 A;  2V9K A;  2ZXH A;  2R7O A;  3CJQ B;  3I3L A;  4AU7 A;  4IQJ A;  2WAQ A;  4E6K G;  1UAA A;  3L2U A;  2QKM B;  4F55 A;  3VYS B;  4DIQ A;  1X1B A;  4OWR B;  3OYC A;  4BEH B;  2KP6 A;  4E7Z A;  1U0J A;  2K3P A;  1MMD A;  2R7T A;  4BXF A;  1UG0 A;  3BG7 A;  4BDZ A;  3BCB A;  2OV7 A;  3NWT A;  2MFZ A;  2DT7 B;  4Y33 A;  2IS4 A;  2IXS A;  5JHF A;  4ZDP A;  4BE2 A;  2VQH A;  4XL9 A;  2F6C A;  4B3X A;  3D5S C;  2LY2 A;  2PMZ A;  2JSP A;  2XSJ C;  3OY9 A;  4PJN A;  5LFA A;  2K9L A;  3MKY B;  2E1M C;  2JUG A;  4BQO A;  2JA2 A;  2LY1 A;  3DKY A;  2E5Z A;  4DBR A;  3L2Q A;  4BAC A;  4BJ6 C;  2CUJ A;  4XLF A;  4ANJ A;  4C2U A;  3TBI A;  1WJC A;  3DU6 A;  1YE9 A;  4X0G A;  2QKL B;  3F9K A;  3HXL A;  1TZL A;  1WJF A;  1OR7 C;  4E4H A;  3LSM A;  4XKB A;  4BQQ A;  1MMA A;  4DJA A;  4HRI A;  3L2V A;  2CV0 A;  5LD2 C;  2LOO A;  3DEE A;  3K10 A;  4RLQ A;  3CF2 A;  2A6T A;  3H9J A;  5CQG A;  3FHN A;  4PFP A;  3SDB A;  4RLF A;  4NC8 A;  3W2W A;  4NNJ A;  3IAS 2;  4CCJ A;  2M0M A;  1V5F A;  2MD0 A;  1SFK A;  2Y0S A;  2CV1 A;  2M3A A;  2CS3 A;  4P5O A;  3H9G A;  1X4O A;  2W00 A;  3PNY A;  2X85 A;  2JVH A;  3H9Q A;  4CA0 A;  4E7S A;  2X1E A;  2XF7 A;  4DGW B;  2L9S A;  2BW3 A;  4BJT A;  3HL2 A;  2R7U A;  2K5C A;  1Z21 A;  1KON A;  3OR2 C;  4XN3 A;  2R7S A;  3DPT A;  3RPU D;  4JQF A;  2PJR B;  5CQE A;  2AQF A;  5HOO A;  2WB1 A;  3FKJ A;  1D0Z A;  3HC7 A;  3VYU B;  1NG7 A;  1G8X A;  1MW7 A;  3MD2 A;  3AL0 B;  3BCA A;  1X1D A;  5FRM A;  2HZD A;  4F91 B;  3MKZ A;  4ITV A;  1X1A A;  4C9Y A;  3ZCO A;  3OS1 A;  3HUG B;  3LSI A;  1LKX A;  3A4C A;  3OYM A;  4PK4 A;  2HU9 A;  4BU2 A;  1D1B A;  1ZEL A;  2GOM A;  3OYL A;  1BR2 A;  4CCL A;  3IAM 2;  3OYI A;  3DQV C;  4XR6 A;  1N77 A;  1SAU A;  2IS1 A;  2X1D A;  2WBM A;  3K4M A;  2KRC A;  3HPG A;  2DJI A;  4E7K A;  2NOJ B;  2WA0 A;  4LIU A;  4QPO A;  2X1C A;  3RCO A;  5KHD A;  4FAS D;  4F3Q A;  3OS2 A;  2O5R A;  5TGT A;  3K4B A;  3L2W A;  1VZ0 A;  4CCK A;  5HLT A;  2XC7 A;  4XM3 A;  1PYV A;  2UV1 A;  2VQL A;  2R4G A;  4KJZ A;  2R7X A;  3ONQ A;  4HST A;  3IP4 B;  2KLO A;  5HVQ C;  3HOS A;  2MYS A;  3E1S A;  3K4N A;  4ZYA A;  2ZSI B;  3D5L A;  2DCE A;  2LBF B;  3ZQQ A;  3OYA A;  2KHM A;  2IS6 A;  1MND A;  3DTK A;  1X1C A;  4CCM A;  4HSR A;  4HNU A;  2KRH A;  3OYF A;  3DPU A;  2DOA A;  2M7A A;  2IGM A;  2W1O A;  3EPZ A;  4B47 A;  4JOM A;  2LBF A;  1WFX A;  3PNV A;  2LH9 A;  1TT0 A;  2VXZ A;  2XF6 A;  3H5A A;  2KQR A;  3PSI A;  4XQF A;  3M1C A;  3DLA A;  4NQW B;  3K6G A;  3K4J A;  2HVR A;  4BEH A;  2LYC A;  4XOP A;  1EA3 A;  3KEY A;  1WJ5 A;  3PJR A;  4PJL A;  2UUZ A;  4BJ5 C;  3MKW B;  4Y3O A;  2L7K A;  1MMG A;  2ZFU A;  4DOZ A;  4RM3 A;  4XKW A;  2LG4 A;  4OAZ A;  4XOT A;  5KCM A;  4XLC A;  3BLY A;  2M4K A;  3S32 A;  2XAU A;  3H5R A;  2F4I A;  3ZRG A;  1S9H A;  4ZTJ A;  2VJ4 A;  3HG9 A;  3TL4 X;  1YX5 A;  4B48 A;  2LRE A;  3VYT B;  3OYG A;  2KDO A;  4H4K C;  2R7R A;  2IGK A;  2X6X A;  2W7N A;  2Z16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...