1SFKA

Core (c) protein from west nile virus, subtype kunjin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
LSLTGLKRAMLSLIDGRGPTRFVLALLAFFRFTAIAPTRAVLDRWRSVNKQTAMKHLLSFKKELGTLTSAINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Core protein
publication title West nile virus core protein; tetramer structure and ribbon formation
pubmed doi rcsb
source organism Kunjin virus
total genus 27
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2004-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1sfkA00
1SFKA 1R6RA
chains in the Genus database with same CATH superfamily
2HZTA 1IN7A 1LVKA 1I39A 2RQQA 3A0BC 3PNTA 4C2MJ 4G8XA 5KHDA 4EM1A 3OWTA 3OYJA 4YEJA 4L9TA 2DJNA 4DBRA 2P7CB 4IPAA 2EV0A 3ML6A 3AG2H 3ERED 4A2UA 5FB2A 3Q9VA 2YS9A 2PMUA 2KP6A 3TL4X 2O5RA 5BQTA 2XV4S 1MBEA 2EILH 2LY2A 5E3LA 4PFOA 2ESHA 4XSZF 5H6QA 3Q0UA 3QP5A 3H92A 1CQTA 4BBRJ 3BPVA 3EQLF 5EEAA 2X0LA 3L9FA 4E7SA 1VI0A 1B59A 4P1WA 4A3KJ 2HDCA 4XLPF 3AKZA 1FTZA 1LPQA 1ZELA 2KT0A 2F5EA 2IGKA 5GAHJ 1HDDC 3K1NA 3RCOA 2LBFB 3OL3A 2K3FA 4UUSA 5EGOA 3OS0A 1FTTA 1O3SA 3LSIA 2UWMA 3GW2A 2O8XA 4BY1J 1S9HA 3A01A 1LEBA 2Y2ZA 1AU7A 1SFKA 4O5VA 3I55I 1AWCA 2L4AA 1SD5A 3ZQQA 2EV6A 1SD6A 5ED4A 3S2HJ 2L5QA 1MBFA 2M7BA 2R5ZA 1O7FA 1J75A 2NAZA 1R36A 1P92A 3G4SI 2L9NA 2DN0A 1SVLA 2VJIA 3S32A 5LHHA 1FOXA 5HLIA 4I2OA 2CFOA 1FT9A 3BJOA 2HPMA 1XX5A 2V4JC 2K02A 1MBGA 3AL0C 1XC5A 3BZ6A 3DKXA 2D5VA 5KAFC 5HS7A 3ONQA 3EYYA 2LFBA 2DYSH 1FEXA 2PJRA 3RZOJ 3KYLA 3W2WA 1OYWA 1W7PA 1QVTA 4KN4X 4HNUA 4E7HA 1R49A 4FQGA 4D5FA 5FGMA 4LG3A 1KU9A 2JVHA 1FIPA 4EM2A 3HPHA 3F8MA 2ZMEC 4HA8A 3VOEA 2O61A 3ABLH 2QUFA 1WJEA 3IRRA 4JP0A 5IY5H 1U3EM 3FXLA 4A0ZA 5E3MA 4WX9A 2VB6A 1SMYF 2ZNYA 2OV7A 5FD6A 1U78A 2HVRA 2BHYA 2K9MA 4YIIA 2W1OA 3KPHA 2Z9OA 1R1VA 4X6AJ 1TWFJ 3CCYA 3FBNB 4DOZA 2DU9A 1SAXA 2DLLA 1YO5C 4LK1F 1YW9A 2A68F 2YX7A 1RKWA 4IRHA 4LG0B 2FX0A 2OCCH 4E7IA 3FXKA 2DQRA 4UV9A 5FKLA 2L01A 1ZGAA 1X19A 2PFBA 3IH2A 2OPTA 3VYTB 4PGGA 2DCEA 4PJJA 5BOXA 2R7OA 3NWSA 2OD5A 1IG7A 5J1UA 3C18A 1YG2A 1FC3A 2MD5A 2QSFX 2CJJA 4Y33A 2W7NA 2JA7J 3WGGA 4RA2A 4MTDA 1ZGWA 1TT0A 4NB5A 2LG4A 4HZFA 2IA2A 1OKRA 2WAFA 1UCRA 2X6XA 4CCOA 5A2QZ 3ZMTA 2E60A 2OBPA 2EK5A 3FXQA 3DPUA 4JX6A 1HSJA 1XG1A 3RIRA 4QLCU 1HF0A 4CCKA 1X4OA 4OINF 1S5LC 4LIUA 4XONA 2HS5A 4M3DA 2DMQA 1L3LA 4BXFA 2P7VB 1WGXA 2GIZA 1XSXA 3HOZJ 4M6XA 1EF4A 5EG0B 4LLLA 5BPIA 4JK1X 1ZG5A 1DGRM 3JR9A 1Y56A 1U5TA 4Z2YA 3GTMJ 1BA5A 1ZRFA 3K1MA 2KHMA 3LWFA 4ENJA 5LGNA 2RREA 2HDDA 1MH3A 3MWMA 1IDYA 3OR2C 1OYYA 1ULYA 4LITA 4HQMA 3SDBA 1J0RA 2P0WA 2LF8A 1O3RA 2IJLA 2HOTA 4HV5A 1UZCA 1ORKA 4PDKA 3R0AA 2Z5UA 4XBFA 1E0EA 5ICCA 4IKFA 1R5ID 2L0KA 2FBHA 2KIMA 5L3DA 2J5PA 3G1MA 3WTYC 3GF2A 2PBIA 1BR4A 2EPFA 3M1CA 3GCMA 3K4NA 1XGMA 1JKOC 1P2FA 1UJ8A 2BVLA 2WADA 5B3SH 5E17F 3OY9A 1XMAA 1MBKA 4F92B 1P7JA 1T8IA 4XRSG 5JVTA 4ZZLA 3KETA 3E6CC 3BG6A 4HX4A 4Y17A 5D4SA 1FP1D 2FU4A 4HF2A 3JRFA 3F0CA 4U7DA 3L09A 4HF0A 2DA3A 4A3MJ 4IHWA 3RYPA 4A3BJ 3H9QA 2F6CA 4BAYA 2KJCA 3HEFA 1VQ4I 2QF7A 4MHGA 3OYBA 5E20A 1ZR4A 3H0GJ 1LNWA 4M3GA 1T2KA 2QKMB 4M73A 3E5QA 4XLHA 3HTSB 1BI3A 1HW2A 1BJAA 4W1UA 4M72A 2OUMA 4KUMA 5LRRA 1XPXA 2QSHX 1YS7A 2D2WA 2WAEA 2XB0X 4RAYA 1B9NA 2NYXA 3OYFA 1R6RA 3IH3A 3K7AJ 2Z99A 3LAPA 3Q5FA 3BY6A 3S8PA 3UKGA 3F23A 1U9NA 1RKTA 4OU0A 1OCTC 3VDXA 2F4IA 4ZTJA 4YG2F 5D5WB 4G7HF 1MBHA 3TGNA 2BHZA 1KA8A 2DOAA 3DPLC 2JPBA 4OAYA 3WTSC 1D1CA 2IVMA 4C3HJ 1LE8A 1RESA 2KDOA 5GADJ 4LLNA 3GTOJ 2DMTA 2XASA 2IS2A 1ZGJA 2DXIA 4NDLA 3W2VA 3CLQA 3QPHA 4XL9A 1W5SA 2QBYB 3DEUA 2ECCA 3H1CA 4KITB 3K2ZA 4KT6A 4XICA 1C0WA 1DGWY 3WHCA 2V6EA 2Z33A 4L5IA 1Z77A 1GV5A 3LL7A 3DEWA 5EEGA 1O3TA 4GDFA 2FA5A 1Q1VA 1V5EA 3I56I 3D5SC 4CSWA 1OPCA 5GTHC 2BY0A 3K9TA 4HV6A 1D5VA 1DPRA 1XDSA 4BQNA 1LDKB 5F6FA 2F2EA 5F04A 2H6CA 4OWRB 2BXYA 4BJ6C 1JXSA 2VL8A 2RNJA 4ETSA 4LFUA 2VXZA 2G0EA 2PI0A 1A6IA 2X6OA 1IRGA 1BR2A 3KP5A 3RKXA 2DOEA 3VWBA 5DCMA 3HSEA 2RNGA 2HR3A 2IS6A 4RS8A 1G59A 3GEZA 3I59B 1RPWA 3DTEA 2A6HF 2AXLA 2RAEA 3R61A 4XN0A 3TP0A 3RPUA 1N25A 2FQ3A 1IXSB 3OYIA 1IF1A 4M71A 1BIBA 1L0OC 3HOTA 2XAUA 5CKTA 4XLFA 4YELA 1BR1A 3GLLA 4PJNA 3H5NA 3S1MJ 1ZLJA 2WY7Q 1BI2A 2F48A 1STZA 3PIOF 3OYKA 2WB1N 3O3KA 1E17A 2L7ZA 1SAUA 1MMSA 3PNYA 2VBYA 5GPAA 4AC0A 3PM1A 3PO2J 4CZCA 5F0FA 1Y6IA 2VUMJ 1QPMA 2COBA 1APLC 1R9TJ 1YW8A 4FETA 4CHUA 4EJWA 3GUDA 3CUQB 2OC6A 3ZMSA 2Z3YA 4XRFA 3QWLA 4BHPA 2HTJA 4DQ2A 2P5VA 3DU5A 4F91B 1VQPI 3A2KA 1ZQ3P 4NQWA 4B3AA 2Y0SA 4UV8A 3KIOA 3BG5A 3V4GA 5DV5A 3E1SA 2VPRA 4AIDA 3H35A 4RGUA 3ZPLA 1ETWA 1MKMA 2LOOA 1EJ9A 2HVQA 3CCJI 5B1AH 3VEPA 2A6EF 1IRFA 4KDPA 2HTSA 4Y15A 1Z3YA 4DW6A 4BJTA 1JGSA 5EDNA 2JZYA 1K6YA 2Y75A 4OIRF 3SEQA 2HXOA 2PMZN 2Y69H 1B8IA 5HS9A 4BYYA 4CH7A 2FMLA 3S16J 5JHFA 1T56A 1Y0UA 4TV7A 4MO7A 3C7JA 2Z2SB 5D8KB 3FWEA 1XSDA 1SFEA 2HGCA 2LRDA 1SVOA 4EVIA 2JRMA 2L2OA 5K5OA 3KLOA 1OCCH 4WXDA 1Z67A 2ZXJA 4L9JA 5ICFA 1SMTA 2JK3A 1LDDA 5C44J 2DA6A 2DK8A 3H36A 3F6VA 3JW4A 3GFJA 5FLMJ 3GFMA 1B4AA 1FY7A 1R1UA 3ERMA 2H09A 5JI6A 2RDPA 3KP2A 2QCOA 2Y48A 4CCMA 2R92J 4WXCA 1HW5A 1TLHB 3ZQFA 2NVYJ 4AYBN 2O8KA 2WA0A 2LREA 3S2DJ 3WU0A 1IZ1A 5IT9K 2JSCA 4M9ZA 3CO7C 3CF2A 3HPGA 1PVEA 3BT9A 1YJ9I 4LB5A 4Y7NJ 3BG7A 3WGHA 1REPC 3E7LA 1MSFC 3F8CA 1Z21A 3FM5A 1K4SA 4MLOA 4A5MA 2R7ZJ 2B0LA 4H0EA 3S1RJ 4F55A 3KEOA 1P6RA 5EF6A 2JN6A 1JKRC 1PDNC 1ZKGA 2MG4A 5HLHA 4ZDOA 1T38A 1SVMA 2N8GA 2E1NA 3FKIJ 4IO9F 3P7NA 2V9PA 1JJ6C 2X85A 2FRHA 5E3OA 4CO8A 3PIPF 5F0CA 1BJZA 2WY8Q 1E3HA 4PZJA 1TTYA 4I01A 1B72A 3K0LA 3J7AO 1YYVA 4C3JJ 3HKZN 2DA7A 4NC8A 2KQRA 2VBWA 3FMRA 2MD0A 1BW6A 2GIVA 2NOGA 2WWYA 2R5YB 3U21A 2FNPA 4BNCA 2FOKA 4C9YA 2OCEA 3L2VA 4IVNA 4LK0F 4BDYA 2VT2A 2H8WA 2J5OA 2BV6A 3ECOA 1VQMI 3QRFF 3I71A 2W48A 2VQLA 2DI3A 1O57A 4V2GA 2Y9YA 5K5QA 1JJ8C 2FUG2 1HKQA 1AA7A 2LMDA 1DP7P 4XM3A 2YSRA 4I7HA 1ZG3A 2M8EA 1MMDA 4A12A 3OR1C 4UVBA 1VQKI 3CP2A 3RI4A 5CQEA 2XAHA 3MKWB 3OL4A 2KJBA 1GXQA 1X2MA 3LSGA 4UVAA 2X1CA 4JX4A 1JE8A 3R4KA 2YUSA 2CW7A 4L18B 1PP8F 3WTTC 1FBSA 1EA3A 4UXNA 1K79A 4J00A 2OA4A 3BROA 3KZZA 5F08A 2VLAA 1ODDA 4BQQA 1RUNA 2NOJB 3A4CA 3PJRA 1ZYRF 5JFRA 4BEHB 1YI2I 3FK6A 4KJZA 3IP4B 4BH9A 2NNYA 1V55H 3HUGA 2LH9A 2KL4A 5D8LB 2ZXHA 3OS2A 5F27A 1JKQC 2ZFUA 4IRIA 1OMIA 2DT5A 1DDNA 3H9GA 3KX2A 4FE4A 4I0BA 3JRGA 2EV5A 4DJAA 3H5AA 2GXBA 5E3NA 5DTDA 1ZAOA 2HKOA 3VYSB 4D0PA 2C6YA 4ESFA 3DWLE 1BC7C 2M5WA 3VSLA 1VQ8I 1XCBA 1VQOI 1Z05A 3BR1A 2HOEA 3J80K 3CCLI 3CUQC 1Y8RB 2R3SA 4MQVA 4EJVA 3LSRA 2HNHA 4O6JA 3CCRI 3O8HA 1G4DA 3OMYA 4GRIA 1XGSA 3S15J 2Q2EA 2K86A 1HBXG 3KE2A 3ZP5A 2V1NA 3C1DA 3BTIA 5L3BA 1LEAA 2EA4A 3IWFA 2IEKA 1GXPA 2LK2A 2KMUA 2M3AA 1XDUA 2DO7A 3JSPA 3HGGA 2K4BA 3ZXSA 2F4MB 3HKZA 5IYDJ 5LGUA 1YW7A 4QIWN 3CMMA 3IL2A 2LVSA 3HJEA 1SFXA 3AAFA 1YRNA 2QQ9A 2A05A 2LR8A 4GCVA 3QODA 4IOCF 5C4XJ 1HA8A 2H6BA 2MC4A 2QQAA 1JHHA 2V79A 3ESWB 4U87A 4E4HA 4RAZA 3FK7A 2ZJ2A 4Y13A 2XRNA 4XR6A 2X9DA 3SJMA 3N05A 1TQPA 5H6RA 3L1PA 2XB5A 4C2UA 5IP6A 1OCPA 2OTLI 3BR2A 1RETA 3JSOA 2G9WA 4HRIA 3HTUA 2GM4A 1QNTA 4MFEA 1OISA 1T6SA 2UXXA 2DT6A 3MD2A 4AUXA 2CG4A 5M3MJ 1D0XA 1FBQA 1MD0A 3ULQB 2ME0A 2E1OA 1HSTA 1HOMA 2BY2A 2JTVA 3C3WA 2IA0A 2DBBA 2ZMEA 1QA6A 5FD5A 3L00A 3FXOA 4ZDLA 4Q47A 4UNOA 4HSTA 3BTCA 3ZR8X 4JBAA 3EPZA 5KK1A 4RMNA 4BHCA 1LJ9A 5K7FA 1OJLA 1P4XA 1WJFA 3BQZA 1A31A 2EIMH 3COAC 1AHDP 2EB7A 1P7IA 2LTPA 3HHHA 2L9SA 4I02A 2Q0OA 3H3VK 3TO7A 1X3WB 3Q0WA 2HYGD 3UNGC 3MFKA 1RR8C 3I53A 4J19A 5FRMA 3VB2A 4OIQF 1B6AA 5LGTA 1SD7A 1OLTA 3SDGA 4KN7X 3IWZA 2XGDA 4V2FA 1ETYA 3DTKA 1MIJA 3TOBA 2YX4A 2L7MP 2JT1A 2OQRA 4YFKF 4CUGA 1IN4A 3FDYA 4U88A 1Z3XA 4H4KC 1X1BA 3F72A 2B7EA 3I54A 2GOXB 5DD4A 2FJ1A 3HG9A 4FTHA 3MAJA 3OYMA 2CGPA 1GVJA 5HVQC 3M4OJ 2D1HA 2W57A 3JAMK 2DYRH 3TMOA 3E6DA 5F1RA 1WI3A 5TISC 1WKMA 1X58A 2BW3B 5AIQA 4AIHA 2F5DA 2X6YA 4G12A 4ENMA 2LY9A 2CV2A 2VJ4A 5J3LA 2IS1A 3BPXA 2P5LC 3OV8A 2OQGA 1USTA 5EJCA 2HOSA 3I4PA 4FCYA 1YIJI 4L5JA 2WAQA 4E7KA 1KU7A 5DDGA 3KYCB 3FXRA 4NC6A 3DQVC 1FOKA 3E5UA 4Z6YA 1MDMA 1ERDA 2QYOA 3FF5A 1D5YA 4IOAF 3N4MA 4RGRA 1F5TA 1N78A 3K4JA 3JRHA 2JUGA 5E8GA 1F4KA 1KZHA 3ABTA 3MMYB 4HEA2 5EEHA 3U1KA 2ADUA 1VQ6I 4LOCA 5E1XA 5GAGJ 2EZHA 5DEQA 2V26A 4MEXF 3H5RA 4B1RA 2OF7A 1PP7U 3K4MA 4Y3OA 4G9YA 3MZYA 2VC1A 2VQCA 1X1CA 2GA2A 4CXFA 4UHTA 5D6FA 1MJBA 5CVVA 2TCTA 4IHXA 3CD6I 3LA2A 2NXNB 1FMWA 1R23A 2NVQJ 4PCQA 2ELKA 1QZEA 2OZUA 5IOYA 2Q1ZB 2V1UA 2DOFA 4PGHA 3SHFA 2XF7A 4DYRA 4EEFG 5J8FA 4XNFA 2ZSIB 4U0WA 5CVJA 3MKYB 4BE1A 2LBFA 1ZREA 1JTYA 2O7OA 5HLGA 1FP2A 1YX3A 2DA1A 1NTCA 2IP2A 2BY3A 3QOPA 1Z6RA 4CYCB 2QA4I 5CYVA 1HQCA 3PQJA 1XMKA 2KISA 3E6BA 2A61A 2P8TA 2XAJA 3CF5F 4XLCA 3S2WA 3BG3A 5FLXK 1Z9CA 1R71A 4XK4A 1R5HA 2M1BA 3QPTA 1G3YA 4YRVA 1V54H 2JPCA 3HXLA 1KQ8A 1F36A 2ZJQF 1NG6A 2OJED 5K5RA 5KAIC 1PJRA 1Z0XA 3GMEA 4QPOA 4AD9A 4CCNA 2KRHA 4XLAA 4P9FA 1W0UA 3I64A 4XKVA 2QZ8A 3TEDA 2BYVE 1DP3A 1GLNA 4PSXA 3JTHA 4XMYA 3QP6A 1ETKA 4B47A 1JUPA 3B6CA 1WFXA 5HDNA 2COMA 1LB2A 4G6QA 3PFIA 1TNSA 3SZPA 4FISA 5HNFA 1VQ7I 1HXDA 4BGDA 2Y0MA 2W85A 3K4CA 2MLKA 2P6TA 2R7QA 4IRGA 5FFZA 4Q48A 4HAMA 2XAGA 1O3QA 2EIJH 2W00A 3JREA 4KA4A 1VFCA 2DMUA 1IW7F 1V4RA 1T39A 4PUSA 1I3AA 3BG9A 3BLYA 4LG0A 2DDBA 3BZKA 5AONA 2KLOA 1CF7B 4OMZA 1G3TA 2VPLA 2KIQA 4ZTFA 3D1NI 1KYZA 3K6GA 2ID3A 3BR0A 3LAJA 3HOVJ 5DS9A 2LDUA 5IT3A 3OYDA 2IPQX 5FKMA 3CMAI 1F43A 1OYIA 3LSMA 3I9V2 2NVUB 9ANTA 4HLXA 2HQRA 5KNLA 1R00A 2LNBA 3CCVI 3CZ6A 3T0YA 1ON2A 1MJ9A 4RGXA 1E2XA 2XF6A 1B1BA 1J2XA 4HOBA 5L3GA 3WGIA 3BP8A 1N75A 2W82A 4BBSJ 1GUUA 2F5FA 2ELJA 4BDZA 1S72I 2W4SA 2E7XA 5H2FC 2ESNA 5C3EJ 2W24A 3ELKA 2M0CA 2NS0A 4EATA 3GTKJ 4M3FA 5FKKA 3E5XA 1LVAA 4HW0A 2XKOA 1ZG1A 4NHJA 1LFBA 4ZZDA 5EG0A 1W5CC 2VI6A 5DCFA 2E2IJ 4ABZA 2Z16A 2CWEA 1LDJA 1J09A 1ZLKA 1X4PA 2G7UA 3ZN0A 5HS8A 3A03A 3BCAA 2CRGA 2CUZA 3EUAA 1VNDA 1MMGA 1B9MA 4XN3A 3G73A 2MA3A 3BDDA 4B3XA 4FE7A 1PUFB 4BQAA 2H1LA 2IA1A 3WTZA 2CW8A 2X6WA 5LHIA 2HU9A 1IGNA 3PL8A 2CYYA 3LFUA 2HYFA 3HM5A 4A5NA 2VKDA 1Q1HA 1FLIA 2GAUA 4II2A 4W97A 2D1VA 3GWZA 3SZTA 4RB3C 1ZR2A 4M9SA 1FYLA 5CLSA 2MH2A 3BR3A 1XD7A 2AQFA 2M4KA 1J59A 4II3A 1BN5A 1WJAA 1VQNI 1TZLA 3ZQGA 1I50J 1QPIA 4E7LA 2CFXA 4GYGA 3HOYJ 3EUKL 1WHUA 5CVRA 3V7SA 3D0SA 3KCCA 1YHQI 3OOPA 4DIQA 2FBIA 1QQIA 5ILUA 3DV8A 1Z6TA 5F64A 3MQ0A 3V7RA 1D0ZA 3VYUB 1AKHB 1RUOA 1UAAA 3B02A 4KIFA 2VKHA 3RQIA 5B5EC 3RSNA 1YLFA 3SXYA 1R58A 1NHAA 3LNQA 1P9QC 5DUIA 4ANJA 4RM3A 3TO9A 1W0TA 1T08B 4MTEA 1I27A 2VE9A 2DAOA 2K7LA 1WJDA 1X3ZB 4A69C 3CDIA 4HYEA 3NRVA 1NK3P 3AG3H 1JGGA 3ZCOA 4ZYGA 1FZPB 1K83J 3W3CA 2IGOA 4K2EA 4BACA 4YFNF 4EJOA 2NVTJ 4XOTA 3Q0VA 4JYKA 3EUHC 1QRYA 2ZFWA 2CO5A 1TWHJ 2M30A 3NEUA 3LFKA 1YIOA 2M4GA 2O0YA 1I1GA 2M0MA 2R93J 2BGCA 5IT9Z 3OS1A 1UG2A 1MW7A 5DD8A 3HOSA 2DDAA 1U2WA 1W7PD 1WH7A 2RN7A 4B09A 2QBYA 5F1JA 2DTZA 2EIKH 5LEKA 2DQLA 3QYFA 5LD2C 1RC9A 3GZ5A 1IN8A 1JUMA 3VYRB 5IPAA 2ZCWA 2DODA 4BUPA 4AM3A 1D3YA 3PO3J 1YITI 3LQRA 4E7JA 3I3LA 2VKVA 5LFAA 3X2QH 3DKWA 4DGWB 3FISA 2CH0A 4C30A 1FWZA 5DYMA 3TO6A 2KIFA 2BVMA 3BZCA 3TW7A 1RZ4A 2GXAA 2DK5A 1WSUA 4WF2A 4J01A 2PG4A 1VZ0A 2VBZA 5K1YA 3WHBA 4RB2C 3PSIA 2M2EA 3P9IA 1IO2A 3DXJF 1J5YA 4FASD 2HVSA 4D7NA 3FIWA 1HCRA 3IC7A 1G8XA 1IN6A 2DJIA 2HDWA 2NNNA 3FXJA 2EFNA 4G6TB 4YIFA 3J7ZI 3I59A 3WU2C 4PSWA 2R7VA 3HBLA 1LKXA 3G1OA 3H3UA 2E34A 2E5NA 5CQGA 3FM3A 3F3XA 2X1EA 3MN2A 4XQFA 3R6SA 2QQ8A 5KCMA 4CGZA 3KP4A 4A6DA 2I10A 2EQRA 1Y8QB 4Q5SF 5FJ8J 4F3QA 4A3JJ 3RKYA 5JR3A 3BCBA 1TL8A 2GA1A 3HHGA 5LHGA 3CUOA 1TC3C 3K70D 3FMSA 4KMUX 4BY7J 4PJ0C 2V1DA 4N9IA 4O3MA 4MIMA 2H27A 5DM6F 4N4OB 3I4MJ 5IP9J 5J8CA 1U6GA 3R0JA 2LY1A 3KP7A 4OAZA 3CMYA 2ECBA 1T95A 2DW4A 4M74A 4EGZA 4G6DA 3B6AA 1S6LA 4AIJA 2CQQA 4ZC3A 4P9UA 3AFHA 4QTRA 2WB1A 3BTLA 3V7CA 4F7ZA 3K4LA 2DMNA 2ISYA 5E8IA 3TKYA 2Q8KA 3LSJA 3CUQA 1WWXA 3MZ8A 3ZQ7A 4ENKA 3AG1H 3GZNB 3FX3A 4D1QA 3F22A 2R7WA 1XB4A 1BI0A 2XKPA 4U7BA 1LUJB 3NAUA 3VSKA 4P96A 1RI7A 2FD5A 3BJ6A 3MCZA 3QU3A 3M1EA 4GGGA 3CC7I 1U8RA 1WCMJ 1BBYA 1K78B 2AHQA 3DBLB 1K61A 3OYCA 1FSEA 4RDUA 3DU6A 3J80Z 1H0MA 4XOPA 2DMPA 1QO0D 3OIOA 3P5JA 1JT0A 4MGRA 3S1QJ 1R22A 2HKXA 3G3ZA 3IKVA 3H0DA 5FRNA 4FT8A 5KVRA 2QENA 4WXHA 2XGXA 4DBQA 2CQXA 2LYCA 1J7KA 3RTRA 5IP7J 4FX0A 2L7FP 1T98A 2PMZA 4P55A 1R5GA 2FEZA 2O03A 3Q3SA 4E6KG 3CP8A 3DFGA 4IHYA 2EA2A 1JT6A 1RR7A 2ZXIA 3KFWX 4L5EA 1UMQA 1OQYA 3DF8A 1HKSA 2L7KA 3HOXJ 1CGPA 4NNJA 5J1RA 1FIAA 2GXGA 4ZJZA 4IQ4A 2H94A 2XRLA 3D5RC 3TOAA 2EZLA 1TQIA 3DP7A 4KT5C 3G1LA 3GFLA 3LOCA 4A0YA 2VXDA 4AYBA 1EH6A 3O2PE 5HLTA 3IUOA 1A36A 3QYBA 2CU7A 2DT7B 2ELHA 3BC8A 4LLGF 3SZGA 2X1DA 3CQZJ 4RM2A 4XLEA 2B9SA 3HRSA 3BR5A 3CO6C 3DEEA 3M8EA 1KYWA 2HOAA 5E79C 3RZDJ 2V6CA 2GZWA 4X0GA 1MBJA 4GFBA 3W6JB 4B48A 1SC7A 1H8AC 3OIPA 2EFOA 4RAFA 1GT0C 2R7DA 4F52A 2AS5F 1IV8A 3FHZA 4R8HA 3ZMVA 3A02A 2R5YA 2FMYA 1JI8A 3HOWJ 1V5GA 2NVXJ 1Y1VJ 2RKHA 1U0JA 2K3PA 2XPUA 5C4JJ 1ZRDA 1BM9A 3LSPA 2MFZA 4MQ9F 3ZRGA 5GPCA 3ABKH 1OR7C 5EZHA 2WC2A 1UB9A 2A07F 1MSEC 3HOUJ 4XSXF 3QOEA 4XORA 2XC7A 1D8JA 1P4AA 2K9NA 3DLLF 1GDTA 3RYRA 2L3DA 2HFHA 2JMWA 4UUSB 5EGOB 2CQNA 4ESBA 3I5UA 2JWTA 2YPRA 2R7UA 3ABMH 1FPQA 4LJZF 3A01B 2STWA 5J40A 3M8FA 1W4MA 1EH7A 4P5OA 4BXXJ 2XAFA 4NBQA 4ASNA 2X4HA 1D1AA 3QPSA 3JRIA 1A04A 1GV2A 4KISA 4ITVA 1KU2A 1MMNA 1XCVA 2JUCA 4A0XA 2R5ZB 1ETOA 4OOIA 5IYCJ 1NK2P 2CUFA 5D5XB 1T0FC 3CJRB 3RPUD 2DFFA 4I6ZA 3JCUC 4ZH4F 3B73A 3IHUA 2GQQA 4CYDA 1EKEA 1MGTA 2L9VA 3L2UA 2LKSA 3CJNA 3CJQB 4EJUA 2AO9A 4LIVA 4S04A 3S14J 2QWWA 3E97A 5J47A 4BEHA 3E6MA 2PJRB 1XTAA 3WTWC 1W7PB 3OIQA 3OYEA 1A35A 2FE3A 3FKJA 3MKLA 2ZKZA 3JAMZ 5LBQA 4M3EA 3ROUA 3KZYA 4IEJA 5M5WJ 3ASNH 2R7SA 1WPKA 1ONVA 2PX9A 5ILSA 3PUBA 1O4XA 1T33A 1YFHA 3O8GA 1DQUA 5CVUA 2R7TA 3RKWA 2V9KA 4AU7A 4BHBA 2ISZA 3RPQA 4QPQA 3SEZA 1S29A 3WU1B 2VOPA 1PYVA 4C3IJ 2E2HJ 1YS6A 4BS9A 3WE2A 2W84A 3GTPJ 3JRBA 3HIFA 4RB0A 1S7AA 3A1YA 3GFIA 1ZH5A 3MEXA 4FHTA 4ON0A 2XIGA 1ZTRA 3JTGA 3EDPA 3O6BB 3KEYA 4GO1A 3DLAA 4HSRA 5K7HA 1YQAA 2KDZA 2F5CA 2XSJC 1SFOJ 1XGNA 3DCFA 2XDVA 5F0HA 3QAHA 3ZQLA 2R4GA 1H9GA 2M34A 1FOYA 2HEOA 3I58A 3L2RA 1BL0A 1K6OA 1TT5B 2M45A 2XSDC 4IQJA 4OIPF 4HDUA 2JQ7A 1JUSA 2E19A 5TGTA 1R4MB 4L9NA 3T8RA 4IHVA 1ON1A 3OSGA 1D1BA 3NWTA 3QPLA 2JA2A 5B1BH 4DYQA 4CICA 1U9OA 4N0BA 3M07A 1RNLA 4D5CA 1DU6A 2LC2A 3PUFA 3KZIC 1U5TB 5M5YJ 4ENNA 2UV1A 2PMHA 2IRFG 5D6EA 3L2QA 2STTA 4A3FJ 3ZQCA 4I76A 2RGVA 3WE3A 2BY1A 4NC7A 3PQKA 5J4VA 5FLXZ 2R7FA 3L2WA 1QGPA 1XN7A 2E7WA 2XAQA 1HDPA 2VN2A 4E7ZA 2ZJPF 1W36D 4IJAA 2DA4A 1WVRA 4C2TA 1IDZA 2Y30A 3RDIA 2VT3A 4A6EA 3TDZC 1FBUA 1D8KA 3ZN1A 5FKNA 1TP4A 4CA0A 2VQHA 5FKOA 2KKOA 3NQOA 2X48A 2M87A 2CV1A 2EZKA 1IJWC 2DPUA 3TDUC 1IXRC 3FHNA 1MMAA 4B4CA 2R0QC 3RQ4A 1VQLI 4XIDA 3C2BA 4A3IJ 2KRCA 1UELB 3F9KA 2L54A 3W6KB 4EGYA 2ETHA 5D4RA 3CJTB 1WZ2A 4MEYF 3U1DA 4XKWA 4I0AA 2JVGA 3C2GA 5M5XJ 2V9VA 2IS4A 3Q9SA 2JJ7A 2CV0A 3S3MA 5E1WA 2JSPA 1ZARA 1UHWA 2HXIA 2YU3A 3U2RA 2QSGX 3DBHB 3SFIA 3WTUC 3DTIA 3HZJA 2JA8J 3IH4A 2VJJA 3ECHA 4QWQA 1F1ZA 3K69A 4B43A 2LKXA 2XGEA 3FMQA 3WTVC 1OCRH 2HZDA 4XKCA 1RIOH 5HDGA 4YIRX 2HWVA 4ZDPA 4X1EA 2K5CA 1BI1A 4MFDA 5BPDA 1NH3A 4D7MA 1LFUP 3BQYA 2E36A 2P5KA 2BW3A 2YU9J 4L9VA 3ISPA 1LE8B 4BL0B 4HG2A 3PSFA 4D9JA 4BJ5C 3R60A 4MNUA 3CCUI 1BC8C 2BEOA 3E0JB 2E71A 2BZTA 1Y39A 1YOVB 1XS9A 1ZRCA 3ZOBA 2IXSA 4PK4A 5LLQA 5GTIC 2QGUA 4HBLA 3K4BA 2CMPA 2PQ8A 1ITYA 2RQPA 1TW3A 2LKPA 2P6SA 3BR6A 2BE5F 2CW0F 3WG7H 4A3LJ 3A0HC 5E1ZB 4HX7A 4BKXA 3GO5A 5JLXA 5J1YA 1IRZA 2O9LA 2ZBKA 2KZGA 1WRJA 2K9LA 3M7GA 3CLOA 3GTGJ 3HL2A 3QU6A 1U8BA 4AVZA 3FXUA 5A2QK 2DA5A 3V8JA 4PJMA 2AQEA 4ZYHA 3J7YJ 3F8FA 2JA5J 2UZKA 3HB9A 3GTJJ 5DCMB 4QSHA 2O6GE 4CZZA 4EQQA 2LF7A 2GLOA 2ZSHB 2IGMA 5H20A 1VTNC 1SD4A 4ESJA 4G94A 5IYBJ 4BE0A 4FX4A 2MSYA 4UUVA 4Y4RA 2ZJRF 2UXNA 1TW2A 4PFPA 5JLWA 3EETA 1FJLA 4KIBA 1S8NA 2VBXA 1H89C 2FF4A 4CYCA 1K4TA 1AOYA 3LQQA 2V1XA 6PAXA 2MGQA 2ZNZA 3K70C 2B63J 2EZIA 4EV0A 2K27A 3JRDA 1TQMA 3EUHA 3ZMDA 2I8DA 2VJ5A 3SFZA 1XSVA 2OTJI 2K4JA 2I5UA 2HQNA 2RV8A 4DNCA 1WJBA 1ETXA 2Y0SN 1POGA 1U5TC 4BQOA 1V3FA 3GZ6A 1QBJA 3AG4H 3IV5A 3U9GA 2DFEA 2VASA 1TWCJ 1YX5A 4DZPA 5GAEJ 2FOWA 1GVDA 4E70A 3HDDA 2E1MB 3T8TA 1ZK8A 4NQWB 1SANA 2CQKA 2IW5A 1WJCA 2A3SA 5FLVA 2LSOA 2OU2A 2K9SA 5JHUA 1IC8A 2H1KA 4B44A 5ERIA 2XGCA 4Y52J 2FQ4A 4I09A 1G3SA 2BOLA 3ZMZA 1MNDA 1XGOA 4ZYDA 4IZZA 4HX8A 1X1PA 2CS3A 5BS6A 3K2AA 2QKLB 2CUJA 2V7FA 5FFXA 1EV7A 1FOWA 2KIUA 2NS7A 1TNTA 4AWXB 2WV1A 2K85A 2EJRA 2QLZA 3GLXA 1B8IB 5LEJA 1ETVA 3GYHX 3ASOH 2ID6A 3LA7A 3J81Z 4UUTA 2XVCA 3DPTA 3WODF 1CF7A 3S93A 2VONA 1MZBA 3KEQA 5ICEA 2HPIA 2WV0A 3S1NJ 4M3BA 3JRCA 4JOMA 1FX7A 4A3DJ 2IT0A 2M7AA 2X51A 5TJJA 4CCLA 3FZVA 2E35A 2ME6A 2WTEA 2A69F 1O7LA 2ACJA 1LFPA 4IHTA 4ZYAA 1I3QJ 3QQAA 1JHFA 2K9QA 1WH5A 4IX7A 1E3OC 2NRAC 1R7JA 5E18F 2HYJA 4U0VA 3CTAA 3TP3A 2AXTC 2XPWA 2E2JJ 2VIXA 2KRFA 3BJAA 4KICA 2EWNA 3OYLA 3SYTA 3JRAA 1V5FA 1IRXA 5B66C 3CCEI 2G7HA 2LP0A 3M8JA 1ENHA 1IV6A 2BBYA 1UFMA 2VC0A 4NUBA 5J4YA 1FYKA 1FSHA 5J6XA 1Z7UA 2A5WA 4R1HA 1H88C 1PUEE 5HDKA 2CQ7A 3TW6A 1A5JA 3OYGA 2W25A 3T5XA 3T1BA 4EM0B 3P9CA 5L3FA 4RB1A 1LQ1A 2O3FA 1B72B 2XF5A 4KIGA 2F4OB 4UB6C 3J81K 2LLKA 1KONA 3HRUA 1PUFA 2R7XA 1X1AA 1JTXA 5HODA 1UHSA 4BU2A 3OYNA 3VODA 3ZQHA 1M1EB 3GXOA 4XKBA 2QQBA 3F6OA 3ZMUA 4A3GJ 2D45A 3MKZA 2LD5A 1IAWA 3REOA 4UB8C 3L2CA 3GVAA 3FXMA 1I6XA 1I5ZA 2VKEA 3RJPA 4WWCA 1MNMC 4KMFA 1OCOH 2EFWA 3IRQA 3PNVA 1QHHD 3EYIA 2QM3A 4RLQA 1R4NB 2UUZA 5M3FJ 2VOOA 1SFUA 2F5VA 1X3UA 2PEXA 1VF9A 5TRDA 1YJNI 1WJ5A 2FNAA 4XLNF 5DM7F 2CSOA 4M9XA 2DFIA 1KQ0A 3KYDB 3CCSI 2QVOA 1BOAA 1AKHA 5DUKA 3D5LA 3M3YJ 4BE2A 1ZHFA 1ZN2A 3OYAA 3WG9A 2CUEA 4Q4ZF 1HLVA 1XMXA 2RVCA 3GBGA 2R7RA 3LSKA 3V42A 1RRJA 5K7ZA 5AIPA 2ZO4A 1UHMA 4RAGA 2E1CA 2H8RA 3K10A 4LGWA 3OOUA 2Y9ZA 1A6QA 1EH8A 1S7EA 2IAIA 2TRTA 2ZB9A 3HUGB 4IF4A 4PJLA 5D5VB 1NG7A 2GBYA 3CMEI 4OMYA 5ICGA 5BMZA 2KZVA 5CVIA 4GXOA 2KFDA 3W2AA 2M9HA 4B8XA 2HQ5A 2MH9A 3I0TA 1D0YA 2DTRA 5EYRA 5FO5A 5IOZA 2YR2A 3K4KA 4HPQA 3HSRA 4EJTA 5L3CA 3TBIA 1USSA 1MJAA 3LSTA 1YTYA 2MYSA 4KNYA 3CCMI 2DPDA 4OIOF 3LSHA 3G71I 1S7OA 3BTJA 2E1MC 3KLNA 4S05A 2JA6J 2RC4A 1G6NA 1JKPC 3H3ZA 1P4WA 5CJ9A 2DFHA 2DA2A 3C2HA 4R79A 3VFZA 2L02A 1S3JA 2Q2EB 1Z91A 3ZQIA 5CPRB 1IXCA 1OFCX 2XUBA 1QZZA 3MZHA 1OR7A 3SQNA 1I1SA 2MLGA 3KP6A 2JRTA 1Y1WJ 2KPMA 2XHKA 3GTQJ 3ABUA 3TQNA 4S0HB 2XPVA 1DUXC 2ZC2A 4V19K 2P81A 3HSFA 2XROA 1OCZH 2HQAA 2K40A 3RKQA 2EH3A 2HI3A 1YRNB 4L0YB 2IGNA 1KQ9A 3HRTA 3OSFA 1BW5A 3G2BA 5EZGA 4AVPA 1VQ9I 4HQEA 2ZXWH 1W1WE 4WK8F 3H9JA 2PLYA 2QEXI 2MBFA 3E3VA 4N4NB 1E3PA 1K7AA 1T0FA 2GOMA 2VE8A 4LB6B 1VQ5I 4AIKA 2Z1DA 2MW8A 1WQ2A 4M6YA 4M6VA 1Y0NA 2A6TA 3KP3A 4A3EJ 1QZYA 3AL0B 4HDVA 1BOBA 2PN6A 4UY8I 5D5UB 4A3CJ 3PFYA 4IHSA 2Y31A 1SEUA 1MH4A 3CDHA 4DZJA 1BIAA 1G3WA 2FSWA 2NS8A 3QYEA 1G2HA 3GTLJ 2IBDA 1W36C 3S17J 2ZMEB 4I99C 2A5YB 5GP9A 1DPUA 3G6EI 2GWRA 3V8LA 2EFPA 1IUFA 2VQGA 4I98B 2MABA 4N9HA 2ICWG 4HF1A 4F93B 1FYMA 1W5TA 3IAM2 1UG0A 3S3OA 1IN5A 4ZYEA 4LD5A 3LA3A 4U0YA 4RGSA 3FBIB 1TWGJ 4CDGA 4XRSA 1R1TA 2M8GX 1H9TA 3HC7A 1GHCA 4EMSA 4BXUA 2VODA 4JQFA 4WCGA 4IXAA 2PJPA 1I6HJ 1TBXA 3NARA 1TWAJ 5JVGF 3BOQA 2L9RA 3W6VA 2OAZA 3L7WA 3OYHA 4HLYA 4A93J 1Z1DA 1K78A 3HYIA 4RBOA 3BWGA 5FROA 1QVUA 3HGYA 3UR3C 1J9IA 1ETQA 3K1PA 5HNHA 5ILVA 3IAS2 5L3EA 2EFQA 2BXZA 5BNGA 1KGSA 4G7ZF 3DKYA 1MNEA 1YE9A 4HNTA 1FNNA 3LMMA 3CDLA 4RLFA 2FBKA 4HNVA 1IUYA 3VPRA 1KU3A 4G7OF 3F21A 4JX5A 1HW1A 1YJWI 3F8NA 2WAQN 4KFCA 1FMVA 3MVPA 1N77A 1X2NA 1X1DA 3DBRB 1WI9A 3CESA 3J7AY 3GX4X 2L4MA 3F8BA 4UVCA 4DYCA 1DU0A 3V8KA 3HRMA 3N97A 2FXAA 3CC2I 4XRMA 5LRSA 2MC3A 1QHGA 1QU3A 1HC8A 2WBMA 4LMYA 4CCJA 3S3NA 2TDXA 3CCQI 4IL6C 1HKTA 3M9AA 4YFXF 3I4NJ 2EINH 1MDMB 2E5ZA 3P9KA 4KYWA 2EBIA 1Z7LA 2P4WA 1ACIA 4GYIA 3CC4I 5HOOA 3ZGKA 3IKTA 3WTXC 4L0ZB 1F9NA 2OZ6A
chains in the Genus database with same CATH topology
1D0ZA 1LVKA 1UAAA 2RQQA 2VKHA 3PNTA 3RSNA 4BDYA 2BW3A 5KHDA 1P9QC 3OWTA 4C9YA 3OYJA 2VQLA 4BL0B 4ANJA 4RM3A 4YEJA 4HG2A 3PSFA 4D9JA 4DBRA 4BJ5C 2FUG2 1AA7A 4XM3A 1WJDA 3E0JB 1MMDA 3OR1C 2KP6A 3CP2A 2O5RA 3TL4X 5CQEA 3ZCOA 2LY2A 3MKWB 4PFOA 3W3CA 2IXSA 2IGOA 3OL4A 4BACA 4PK4A 3LSGA 2X1CA 4XOTA 2CW7A 1EA3A 3K4BA 3EUHC 2CMPA 4E7SA 4P1WA 3AKZA 4J00A 2M4GA 1ZELA 2IGKA 2VLAA 2M0MA 3RCOA 2LBFB 3OS1A 4BQQA 1MW7A 3OL3A 2NOJB 3A4CA 3OS0A 3PJRA 3HOSA 2K9LA 4BEHB 3LSIA 2UWMA 3HL2A 4AVZA 4KJZA 1S9HA 3IP4B 3QYFA 5LD2C 1SFKA 4PJMA 2AQEA 2LH9A 2KL4A 3VYRB 3ZQQA 2ZXHA 3OS2A 4BUPA 2ZFUA 2L5QA 3H9GA 2M7BA 3KX2A 2ZSHB 2IGMA 4E7JA 2L9NA 4DJAA 3I3LA 3H5AA 4BE0A 5LFAA 3VYSB 2VJIA 3S32A 3DWLE 4DGWB 3VSLA 2CFOA 2HPMA 2CH0A 2V4JC 4Y4RA 4C30A 3AL0C 3DKXA 4PFPA 2BVMA 3ONQA 4J01A 2PJRA 1VZ0A 3W2WA 3KYLA 3PSIA 2HNHA 4HNUA 4E7HA 4LG3A 3K70C 4FASD 2HVSA 2JVHA 3OMYA 4GRIA 3HPHA 1G8XA 2DJIA 2HDWA 4G6TB 2V1NA 4PSWA 1WJEA 2I8DA 2VJ5A 1LKXA 5CQGA 2R7VA 2E5NA 4XQFA 2X1EA 2VB6A 1WJBA 2KMUA 2M3AA 5KCMA 2OV7A 4BQOA 2HVRA 2K9MA 2W1OA 3ZXSA 3HKZA 4F3QA 4DOZA 3FBNB 2VASA 3CMMA 3BCBA 1YX5A 3QODA 4E7IA 2E1MB 4NQWB 3K70D 1WJCA 1HA8A 2MC4A 4B44A 1X19A 4E4HA 4U87A 4N4OB 3VYTB 2DCEA 4XR6A 3N05A 2LY1A 4OAZA 4PJJA 2BOLA 1T95A 2R7OA 3NWSA 1MNDA 4IZZA 4C2UA 4Y33A 2CS3A 2W7NA 2QKLB 2CUJA 2V7FA 1TT0A 4ZC3A 2LG4A 3AFHA 4HRIA 2WB1A 2WAFA 3K4LA 2X6XA 4CCOA 2E60A 2DT6A 4D1QA 2R7WA 3MD2A 3DPUA 3DPTA 3S93A 1D0XA 4U7BA 4CCKA 1X4OA 3VSKA 2HPIA 4LIUA 4XONA 4JOMA 4BXFA 2M7AA 4ZDLA 2X51A 4CCLA 4HSTA 3ZR8X 3OYCA 1DGRM 3EPZA 3DU6A 1LFPA 1Y56A 4RMNA 4ZYAA 4XOPA 1WJFA 2KHMA 2RREA 3H0DA 3OR2C 4LITA 4IX7A 5FRNA 2L9SA 3SDBA 2P0WA 4DBQA 3UNGC 2LYCA 1E0EA 2VIXA 3RTRA 4IKFA 3OYLA 3SYTA 5FRMA 1V5FA 1IRXA 2PMZA 1BR4A 3M1CA 3M8JA 3K4NA 4E6KG 2BVLA 1OLTA 2WADA 4NUBA 3OY9A 3CP8A 4F92B 2A5WA 3DTKA 2ZXIA 3OYGA 3BG6A 2L7KA 4NNJA 4CUGA 2XF5A 3FDYA 4ZJZA 1Z3XA 4IQ4A 3D5RC 1KONA 4H4KC 1X1BA 2GOXB 2R7XA 1X1AA 3H9QA 3HG9A 2F6CA 3OYMA 4BU2A 5HVQC 3OYNA 2VXDA 4AYBA 5HLTA 3TMOA 3IUOA 3QYBA 4XKBA 3OYBA 3MKZA 2DT7B 3BC8A 2BW3B 3SZGA 2X1DA 4RM2A 4XLEA 2X6YA 2CV2A 2IS1A 2QKMB 2VJ4A 4XLHA 3DEEA 3PNVA 2OUMA 1QHHD 4E7KA 2WAQA 4RLQA 4X0GA 2UUZA 4B48A 2WAEA 2F5VA 3OIPA 3OYFA 1R6RA 4F52A 3DQVC 1ERDA 1WJ5A 1JI8A 1V5GA 3S8PA 1U0JA 2K3PA 1N78A 3VDXA 2F4IA 3K4JA 2MFZA 3ZRGA 4ZTJA 3D5LA 1OR7C 2JUGA 4BE2A 2DOAA 3DPLC 4OAYA 3OYAA 1D1CA 3QOEA 3MMYB 4HEA2 4XORA 2XC7A 3GBGA 2KDOA 2R7RA 3LSKA 2IS2A 3V42A 2DXIA 3W2VA 4XL9A 2V26A 3H5RA 4KITB 2R7UA 4KT6A 3K4MA 1DGWY 4Y3OA 3K10A 2V6EA 4P5OA 3OOUA 3HUGB 4PJLA 3LL7A 2VQCA 1X1CA 1NG7A 1D1AA 2KZVA 4KISA 4ITVA 3W2AA 1MMNA 1FMWA 1V5EA 1D0YA 1T0FC 3CJRB 3RPUD 2Q1ZB 3D5SC 4CSWA 2XF7A 4XNFA 3K4KA 4HPQA 2ZSIB 3MKYB 4BE1A 4BQNA 1LDKB 2LBFA 3TBIA 3L2UA 1YX3A 2MYSA 3CJQB 4LIVA 4OWRB 4BJ6C 3LSHA 2VL8A 4BEHA 2PJRB 2VXZA 2E1MC 3OIQA 3OYEA 3FKJA 1BR2A 4XLCA 3VWBA 3C2HA 4R79A 2Q2EB 2RNGA 4YRVA 2IS6A 1G59A 5CPRB 3HXLA 2R7SA 1NG6A 1PJRA 4QPOA 3PUBA 4CCNA 3DTEA 2KRHA 4XN0A 1DQUA 4XLAA 2KPMA 4XKVA 3OYIA 2R7TA 3HOTA 2XAUA 1DP3A 5CKTA 2V9KA 2HQAA 4AU7A 4XLFA 1GLNA 4PSXA 4YELA 4QPQA 1BR1A 4XMYA 3SEZA 4PJNA 4B47A 3H5NA 2IGNA 1WFXA 1PYVA 2WY7Q 3G2BA 4BS9A 5HNFA 3OYKA 3H9JA 1SAUA 4BGDA 3K4CA 3PNYA 3A1YA 4N4NB 2GOMA 2R7QA 4CZCA 1Y6IA 2Z1DA 2A6TA 2W00A 3KEYA 3DLAA 4HSRA 3AL0B 1BOBA 2XSJC 3PFYA 4FETA 4PUSA 2OC6A 2XDVA 2R4GA 3BLYA 4F91B 3DU5A 3A2KA 2KLOA 3QYEA 2VPLA 2Y0SA 3L2RA 4ZTFA 4IQJA 3K6GA 3E1SA 1W36C 5TGTA 3H35A 3OYDA 2LOOA 2HVQA 1D1BA 3NWTA 2VQGA 2JA2A 2MABA 3LSMA 3I9V2 4F93B 1Z3YA 5KNLA 2LC2A 4BJTA 3IAM2 1UG0A 3S3OA 1K6YA 3CZ6A 2UV1A 3SEQA 2XF6A 3L2QA 3FBIB 1N75A 4CH7A 2W82A 5JHFA 2ELJA 4NC7A 4BDZA 3HC7A 2W4SA 3L2WA 2Z2SB 4JQFA 1W36D 4E7ZA 2LRDA 4C2TA 2L2OA 4EATA 3OYHA 4CA0A 2VQHA 5FROA 2Z16A 3UR3C 2CV1A 5HNHA 3IAS2 4CCMA 1J09A 2WA0A 1MMAA 2LREA 3DKYA 1MNEA 1X4PA 3FHNA 1YE9A 3BCAA 4HNTA 3CF2A 2CUZA 3EUAA 3HPGA 3LMMA 3RQ4A 1MMGA 4RLFA 4XN3A 2KRCA 4B3XA 3BG7A 1UELB 1Z21A 3F9KA 4MLOA 2CW8A 2X6WA 4XKWA 2HU9A 3PL8A 4F55A 3LFUA 1FMVA 2JVGA 1N77A 1X1DA 3C2GA 2VKDA 3CESA 3J7AY 2IS4A 4II2A 4ZDOA 2CV0A 3S3MA 2JSPA 2X85A 2AQFA 2WY8Q 2M4KA 3DTIA 1QHGA 1QU3A 4II3A 2WBMA 4CCJA 3S3NA 1WJAA 2VJJA 4NC8A 2KQRA 1TZLA 4E7LA 2MD0A 4B43A 3EUKL 2HZDA 4XKCA 2E5ZA 3U21A 1Z7LA 4ZDPA 4DIQA 5HOOA 3ZGKA 2K5CA 3L2VA 3VYUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFK A;  1R6R A; 
#chains in the Genus database with same CATH topology
 2HZT A;  1IN7 A;  1LVK A;  1I39 A;  2RQQ A;  3A0B C;  3PNT A;  4C2M J;  4G8X A;  5KHD A;  4EM1 A;  3OWT A;  3OYJ A;  4YEJ A;  4L9T A;  2DJN A;  4DBR A;  2P7C B;  4IPA A;  2EV0 A;  3ML6 A;  3AG2 H;  3ERE D;  4A2U A;  5FB2 A;  3Q9V A;  2YS9 A;  2PMU A;  2KP6 A;  3TL4 X;  2O5R A;  5BQT A;  2XV4 S;  1MBE A;  2EIL H;  2LY2 A;  5E3L A;  4PFO A;  2ESH A;  4XSZ F;  5H6Q A;  3Q0U A;  3QP5 A;  3H92 A;  1CQT A;  4BBR J;  3BPV A;  3EQL F;  5EEA A;  2X0L A;  3L9F A;  4E7S A;  1VI0 A;  1B59 A;  4P1W A;  4A3K J;  2HDC A;  4XLP F;  3AKZ A;  1FTZ A;  1LPQ A;  1ZEL A;  2KT0 A;  2F5E A;  2IGK A;  5GAH J;  1HDD C;  3K1N A;  3RCO A;  2LBF B;  3OL3 A;  2K3F A;  4UUS A;  5EGO A;  3OS0 A;  1FTT A;  1O3S A;  3LSI A;  2UWM A;  3GW2 A;  2O8X A;  4BY1 J;  1S9H A;  3A01 A;  1LEB A;  2Y2Z A;  1AU7 A;  1SFK A;  4O5V A;  3I55 I;  1AWC A;  2L4A A;  1SD5 A;  3ZQQ A;  2EV6 A;  1SD6 A;  5ED4 A;  3S2H J;  2L5Q A;  1MBF A;  2M7B A;  2R5Z A;  1O7F A;  1J75 A;  2NAZ A;  1R36 A;  1P92 A;  3G4S I;  2L9N A;  2DN0 A;  1SVL A;  2VJI A;  3S32 A;  5LHH A;  1FOX A;  5HLI A;  4I2O A;  2CFO A;  1FT9 A;  3BJO A;  2HPM A;  1XX5 A;  2V4J C;  2K02 A;  1MBG A;  3AL0 C;  1XC5 A;  3BZ6 A;  3DKX A;  2D5V A;  5KAF C;  5HS7 A;  3ONQ A;  3EYY A;  2LFB A;  2DYS H;  1FEX A;  2PJR A;  3RZO J;  3KYL A;  3W2W A;  1OYW A;  1W7P A;  1QVT A;  4KN4 X;  4HNU A;  4E7H A;  1R49 A;  4FQG A;  4D5F A;  5FGM A;  4LG3 A;  1KU9 A;  2JVH A;  1FIP A;  4EM2 A;  3HPH A;  3F8M A;  2ZME C;  4HA8 A;  3VOE A;  2O61 A;  3ABL H;  2QUF A;  1WJE A;  3IRR A;  4JP0 A;  5IY5 H;  1U3E M;  3FXL A;  4A0Z A;  5E3M A;  4WX9 A;  2VB6 A;  1SMY F;  2ZNY A;  2OV7 A;  5FD6 A;  1U78 A;  2HVR A;  2BHY A;  2K9M A;  4YII A;  2W1O A;  3KPH A;  2Z9O A;  1R1V A;  4X6A J;  1TWF J;  3CCY A;  3FBN B;  4DOZ A;  2DU9 A;  1SAX A;  2DLL A;  1YO5 C;  4LK1 F;  1YW9 A;  2A68 F;  2YX7 A;  1RKW A;  4IRH A;  4LG0 B;  2FX0 A;  2OCC H;  4E7I A;  3FXK A;  2DQR A;  4UV9 A;  5FKL A;  2L01 A;  1ZGA A;  1X19 A;  2PFB A;  3IH2 A;  2OPT A;  3VYT B;  4PGG A;  2DCE A;  4PJJ A;  5BOX A;  2R7O A;  3NWS A;  2OD5 A;  1IG7 A;  5J1U A;  3C18 A;  1YG2 A;  1FC3 A;  2MD5 A;  2QSF X;  2CJJ A;  4Y33 A;  2W7N A;  2JA7 J;  3WGG A;  4RA2 A;  4MTD A;  1ZGW A;  1TT0 A;  4NB5 A;  2LG4 A;  4HZF A;  2IA2 A;  1OKR A;  2WAF A;  1UCR A;  2X6X A;  4CCO A;  5A2Q Z;  3ZMT A;  2E60 A;  2OBP A;  2EK5 A;  3FXQ A;  3DPU A;  4JX6 A;  1HSJ A;  1XG1 A;  3RIR A;  4QLC U;  1HF0 A;  4CCK A;  1X4O A;  4OIN F;  1S5L C;  4LIU A;  4XON A;  2HS5 A;  4M3D A;  2DMQ A;  1L3L A;  4BXF A;  2P7V B;  1WGX A;  2GIZ A;  1XSX A;  3HOZ J;  4M6X A;  1EF4 A;  5EG0 B;  4LLL A;  5BPI A;  4JK1 X;  1ZG5 A;  1DGR M;  3JR9 A;  1Y56 A;  1U5T A;  4Z2Y A;  3GTM J;  1BA5 A;  1ZRF A;  3K1M A;  2KHM A;  3LWF A;  4ENJ A;  5LGN A;  2RRE A;  2HDD A;  1MH3 A;  3MWM A;  1IDY A;  3OR2 C;  1OYY A;  1ULY A;  4LIT A;  4HQM A;  3SDB A;  1J0R A;  2P0W A;  2LF8 A;  1O3R A;  2IJL A;  2HOT A;  4HV5 A;  1UZC A;  1ORK A;  4PDK A;  3R0A A;  2Z5U A;  4XBF A;  1E0E A;  5ICC A;  4IKF A;  1R5I D;  2L0K A;  2FBH A;  2KIM A;  5L3D A;  2J5P A;  3G1M A;  3WTY C;  3GF2 A;  2PBI A;  1BR4 A;  2EPF A;  3M1C A;  3GCM A;  3K4N A;  1XGM A;  1JKO C;  1P2F A;  1UJ8 A;  2BVL A;  2WAD A;  5B3S H;  5E17 F;  3OY9 A;  1XMA A;  1MBK A;  4F92 B;  1P7J A;  1T8I A;  4XRS G;  5JVT A;  4ZZL A;  3KET A;  3E6C C;  3BG6 A;  4HX4 A;  4Y17 A;  5D4S A;  1FP1 D;  2FU4 A;  4HF2 A;  3JRF A;  3F0C A;  4U7D A;  3L09 A;  4HF0 A;  2DA3 A;  4A3M J;  4IHW A;  3RYP A;  4A3B J;  3H9Q A;  2F6C A;  4BAY A;  2KJC A;  3HEF A;  1VQ4 I;  2QF7 A;  4MHG A;  3OYB A;  5E20 A;  1ZR4 A;  3H0G J;  1LNW A;  4M3G A;  1T2K A;  2QKM B;  4M73 A;  3E5Q A;  4XLH A;  3HTS B;  1BI3 A;  1HW2 A;  1BJA A;  4W1U A;  4M72 A;  2OUM A;  4KUM A;  5LRR A;  1XPX A;  2QSH X;  1YS7 A;  2D2W A;  2WAE A;  2XB0 X;  4RAY A;  1B9N A;  2NYX A;  3OYF A;  1R6R A;  3IH3 A;  3K7A J;  2Z99 A;  3LAP A;  3Q5F A;  3BY6 A;  3S8P A;  3UKG A;  3F23 A;  1U9N A;  1RKT A;  4OU0 A;  1OCT C;  3VDX A;  2F4I A;  4ZTJ A;  4YG2 F;  5D5W B;  4G7H F;  1MBH A;  3TGN A;  2BHZ A;  1KA8 A;  2DOA A;  3DPL C;  2JPB A;  4OAY A;  3WTS C;  1D1C A;  2IVM A;  4C3H J;  1LE8 A;  1RES A;  2KDO A;  5GAD J;  4LLN A;  3GTO J;  2DMT A;  2XAS A;  2IS2 A;  1ZGJ A;  2DXI A;  4NDL A;  3W2V A;  3CLQ A;  3QPH A;  4XL9 A;  1W5S A;  2QBY B;  3DEU A;  2ECC A;  3H1C A;  4KIT B;  3K2Z A;  4KT6 A;  4XIC A;  1C0W A;  1DGW Y;  3WHC A;  2V6E A;  2Z33 A;  4L5I A;  1Z77 A;  1GV5 A;  3LL7 A;  3DEW A;  5EEG A;  1O3T A;  4GDF A;  2FA5 A;  1Q1V A;  1V5E A;  3I56 I;  3D5S C;  4CSW A;  1OPC A;  5GTH C;  2BY0 A;  3K9T A;  4HV6 A;  1D5V A;  1DPR A;  1XDS A;  4BQN A;  1LDK B;  5F6F A;  2F2E A;  5F04 A;  2H6C A;  4OWR B;  2BXY A;  4BJ6 C;  1JXS A;  2VL8 A;  2RNJ A;  4ETS A;  4LFU A;  2VXZ A;  2G0E A;  2PI0 A;  1A6I A;  2X6O A;  1IRG A;  1BR2 A;  3KP5 A;  3RKX A;  2DOE A;  3VWB A;  5DCM A;  3HSE A;  2RNG A;  2HR3 A;  2IS6 A;  4RS8 A;  1G59 A;  3GEZ A;  3I59 B;  1RPW A;  3DTE A;  2A6H F;  2AXL A;  2RAE A;  3R61 A;  4XN0 A;  3TP0 A;  3RPU A;  1N25 A;  2FQ3 A;  1IXS B;  3OYI A;  1IF1 A;  4M71 A;  1BIB A;  1L0O C;  3HOT A;  2XAU A;  5CKT A;  4XLF A;  4YEL A;  1BR1 A;  3GLL A;  4PJN A;  3H5N A;  3S1M J;  1ZLJ A;  2WY7 Q;  1BI2 A;  2F48 A;  1STZ A;  3PIO F;  3OYK A;  2WB1 N;  3O3K A;  1E17 A;  2L7Z A;  1SAU A;  1MMS A;  3PNY A;  2VBY A;  5GPA A;  4AC0 A;  3PM1 A;  3PO2 J;  4CZC A;  5F0F A;  1Y6I A;  2VUM J;  1QPM A;  2COB A;  1APL C;  1R9T J;  1YW8 A;  4FET A;  4CHU A;  4EJW A;  3GUD A;  3CUQ B;  2OC6 A;  3ZMS A;  2Z3Y A;  4XRF A;  3QWL A;  4BHP A;  2HTJ A;  4DQ2 A;  2P5V A;  3DU5 A;  4F91 B;  1VQP I;  3A2K A;  1ZQ3 P;  4NQW A;  4B3A A;  2Y0S A;  4UV8 A;  3KIO A;  3BG5 A;  3V4G A;  5DV5 A;  3E1S A;  2VPR A;  4AID A;  3H35 A;  4RGU A;  3ZPL A;  1ETW A;  1MKM A;  2LOO A;  1EJ9 A;  2HVQ A;  3CCJ I;  5B1A H;  3VEP A;  2A6E F;  1IRF A;  4KDP A;  2HTS A;  4Y15 A;  1Z3Y A;  4DW6 A;  4BJT A;  1JGS A;  5EDN A;  2JZY A;  1K6Y A;  2Y75 A;  4OIR F;  3SEQ A;  2HXO A;  2PMZ N;  2Y69 H;  1B8I A;  5HS9 A;  4BYY A;  4CH7 A;  2FML A;  3S16 J;  5JHF A;  1T56 A;  1Y0U A;  4TV7 A;  4MO7 A;  3C7J A;  2Z2S B;  5D8K B;  3FWE A;  1XSD A;  1SFE A;  2HGC A;  2LRD A;  1SVO A;  4EVI A;  2JRM A;  2L2O A;  5K5O A;  3KLO A;  1OCC H;  4WXD A;  1Z67 A;  2ZXJ A;  4L9J A;  5ICF A;  1SMT A;  2JK3 A;  1LDD A;  5C44 J;  2DA6 A;  2DK8 A;  3H36 A;  3F6V A;  3JW4 A;  3GFJ A;  5FLM J;  3GFM A;  1B4A A;  1FY7 A;  1R1U A;  3ERM A;  2H09 A;  5JI6 A;  2RDP A;  3KP2 A;  2QCO A;  2Y48 A;  4CCM A;  2R92 J;  4WXC A;  1HW5 A;  1TLH B;  3ZQF A;  2NVY J;  4AYB N;  2O8K A;  2WA0 A;  2LRE A;  3S2D J;  3WU0 A;  1IZ1 A;  5IT9 K;  2JSC A;  4M9Z A;  3CO7 C;  3CF2 A;  3HPG A;  1PVE A;  3BT9 A;  1YJ9 I;  4LB5 A;  4Y7N J;  3BG7 A;  3WGH A;  1REP C;  3E7L A;  1MSF C;  3F8C A;  1Z21 A;  3FM5 A;  1K4S A;  4MLO A;  4A5M A;  2R7Z J;  2B0L A;  4H0E A;  3S1R J;  4F55 A;  3KEO A;  1P6R A;  5EF6 A;  2JN6 A;  1JKR C;  1PDN C;  1ZKG A;  2MG4 A;  5HLH A;  4ZDO A;  1T38 A;  1SVM A;  2N8G A;  2E1N A;  3FKI J;  4IO9 F;  3P7N A;  2V9P A;  1JJ6 C;  2X85 A;  2FRH A;  5E3O A;  4CO8 A;  3PIP F;  5F0C A;  1BJZ A;  2WY8 Q;  1E3H A;  4PZJ A;  1TTY A;  4I01 A;  1B72 A;  3K0L A;  3J7A O;  1YYV A;  4C3J J;  3HKZ N;  2DA7 A;  4NC8 A;  2KQR A;  2VBW A;  3FMR A;  2MD0 A;  1BW6 A;  2GIV A;  2NOG A;  2WWY A;  2R5Y B;  3U21 A;  2FNP A;  4BNC A;  2FOK A;  4C9Y A;  2OCE A;  3L2V A;  4IVN A;  4LK0 F;  4BDY A;  2VT2 A;  2H8W A;  2J5O A;  2BV6 A;  3ECO A;  1VQM I;  3QRF F;  3I71 A;  2W48 A;  2VQL A;  2DI3 A;  1O57 A;  4V2G A;  2Y9Y A;  5K5Q A;  1JJ8 C;  2FUG 2;  1HKQ A;  1AA7 A;  2LMD A;  1DP7 P;  4XM3 A;  2YSR A;  4I7H A;  1ZG3 A;  2M8E A;  1MMD A;  4A12 A;  3OR1 C;  4UVB A;  1VQK I;  3CP2 A;  3RI4 A;  5CQE A;  2XAH A;  3MKW B;  3OL4 A;  2KJB A;  1GXQ A;  1X2M A;  3LSG A;  4UVA A;  2X1C A;  4JX4 A;  1JE8 A;  3R4K A;  2YUS A;  2CW7 A;  4L18 B;  1PP8 F;  3WTT C;  1FBS A;  1EA3 A;  4UXN A;  1K79 A;  4J00 A;  2OA4 A;  3BRO A;  3KZZ A;  5F08 A;  2VLA A;  1ODD A;  4BQQ A;  1RUN A;  2NOJ B;  3A4C A;  3PJR A;  1ZYR F;  5JFR A;  4BEH B;  1YI2 I;  3FK6 A;  4KJZ A;  3IP4 B;  4BH9 A;  2NNY A;  1V55 H;  3HUG A;  2LH9 A;  2KL4 A;  5D8L B;  2ZXH A;  3OS2 A;  5F27 A;  1JKQ C;  2ZFU A;  4IRI A;  1OMI A;  2DT5 A;  1DDN A;  3H9G A;  3KX2 A;  4FE4 A;  4I0B A;  3JRG A;  2EV5 A;  4DJA A;  3H5A A;  2GXB A;  5E3N A;  5DTD A;  1ZAO A;  2HKO A;  3VYS B;  4D0P A;  2C6Y A;  4ESF A;  3DWL E;  1BC7 C;  2M5W A;  3VSL A;  1VQ8 I;  1XCB A;  1VQO I;  1Z05 A;  3BR1 A;  2HOE A;  3J80 K;  3CCL I;  3CUQ C;  1Y8R B;  2R3S A;  4MQV A;  4EJV A;  3LSR A;  2HNH A;  4O6J A;  3CCR I;  3O8H A;  1G4D A;  3OMY A;  4GRI A;  1XGS A;  3S15 J;  2Q2E A;  2K86 A;  1HBX G;  3KE2 A;  3ZP5 A;  2V1N A;  3C1D A;  3BTI A;  5L3B A;  1LEA A;  2EA4 A;  3IWF A;  2IEK A;  1GXP A;  2LK2 A;  2KMU A;  2M3A A;  1XDU A;  2DO7 A;  3JSP A;  3HGG A;  2K4B A;  3ZXS A;  2F4M B;  3HKZ A;  5IYD J;  5LGU A;  1YW7 A;  4QIW N;  3CMM A;  3IL2 A;  2LVS A;  3HJE A;  1SFX A;  3AAF A;  1YRN A;  2QQ9 A;  2A05 A;  2LR8 A;  4GCV A;  3QOD A;  4IOC F;  5C4X J;  1HA8 A;  2H6B A;  2MC4 A;  2QQA A;  1JHH A;  2V79 A;  3ESW B;  4U87 A;  4E4H A;  4RAZ A;  3FK7 A;  2ZJ2 A;  4Y13 A;  2XRN A;  4XR6 A;  2X9D A;  3SJM A;  3N05 A;  1TQP A;  5H6R A;  3L1P A;  2XB5 A;  4C2U A;  5IP6 A;  1OCP A;  2OTL I;  3BR2 A;  1RET A;  3JSO A;  2G9W A;  4HRI A;  3HTU A;  2GM4 A;  1QNT A;  4MFE A;  1OIS A;  1T6S A;  2UXX A;  2DT6 A;  3MD2 A;  4AUX A;  2CG4 A;  5M3M J;  1D0X A;  1FBQ A;  1MD0 A;  3ULQ B;  2ME0 A;  2E1O A;  1HST A;  1HOM A;  2BY2 A;  2JTV A;  3C3W A;  2IA0 A;  2DBB A;  2ZME A;  1QA6 A;  5FD5 A;  3L00 A;  3FXO A;  4ZDL A;  4Q47 A;  4UNO A;  4HST A;  3BTC A;  3ZR8 X;  4JBA A;  3EPZ A;  5KK1 A;  4RMN A;  4BHC A;  1LJ9 A;  5K7F A;  1OJL A;  1P4X A;  1WJF A;  3BQZ A;  1A31 A;  2EIM H;  3COA C;  1AHD P;  2EB7 A;  1P7I A;  2LTP A;  3HHH A;  2L9S A;  4I02 A;  2Q0O A;  3H3V K;  3TO7 A;  1X3W B;  3Q0W A;  2HYG D;  3UNG C;  3MFK A;  1RR8 C;  3I53 A;  4J19 A;  5FRM A;  3VB2 A;  4OIQ F;  1B6A A;  5LGT A;  1SD7 A;  1OLT A;  3SDG A;  4KN7 X;  3IWZ A;  2XGD A;  4V2F A;  1ETY A;  3DTK A;  1MIJ A;  3TOB A;  2YX4 A;  2L7M P;  2JT1 A;  2OQR A;  4YFK F;  4CUG A;  1IN4 A;  3FDY A;  4U88 A;  1Z3X A;  4H4K C;  1X1B A;  3F72 A;  2B7E A;  3I54 A;  2GOX B;  5DD4 A;  2FJ1 A;  3HG9 A;  4FTH A;  3MAJ A;  3OYM A;  2CGP A;  1GVJ A;  5HVQ C;  3M4O J;  2D1H A;  2W57 A;  3JAM K;  2DYR H;  3TMO A;  3E6D A;  5F1R A;  1WI3 A;  5TIS C;  1WKM A;  1X58 A;  2BW3 B;  5AIQ A;  4AIH A;  2F5D A;  2X6Y A;  4G12 A;  4ENM A;  2LY9 A;  2CV2 A;  2VJ4 A;  5J3L A;  2IS1 A;  3BPX A;  2P5L C;  3OV8 A;  2OQG A;  1UST A;  5EJC A;  2HOS A;  3I4P A;  4FCY A;  1YIJ I;  4L5J A;  2WAQ A;  4E7K A;  1KU7 A;  5DDG A;  3KYC B;  3FXR A;  4NC6 A;  3DQV C;  1FOK A;  3E5U A;  4Z6Y A;  1MDM A;  1ERD A;  2QYO A;  3FF5 A;  1D5Y A;  4IOA F;  3N4M A;  4RGR A;  1F5T A;  1N78 A;  3K4J A;  3JRH A;  2JUG A;  5E8G A;  1F4K A;  1KZH A;  3ABT A;  3MMY B;  4HEA 2;  5EEH A;  3U1K A;  2ADU A;  1VQ6 I;  4LOC A;  5E1X A;  5GAG J;  2EZH A;  5DEQ A;  2V26 A;  4MEX F;  3H5R A;  4B1R A;  2OF7 A;  1PP7 U;  3K4M A;  4Y3O A;  4G9Y A;  3MZY A;  2VC1 A;  2VQC A;  1X1C A;  2GA2 A;  4CXF A;  4UHT A;  5D6F A;  1MJB A;  5CVV A;  2TCT A;  4IHX A;  3CD6 I;  3LA2 A;  2NXN B;  1FMW A;  1R23 A;  2NVQ J;  4PCQ A;  2ELK A;  1QZE A;  2OZU A;  5IOY A;  2Q1Z B;  2V1U A;  2DOF A;  4PGH A;  3SHF A;  2XF7 A;  4DYR A;  4EEF G;  5J8F A;  4XNF A;  2ZSI B;  4U0W A;  5CVJ A;  3MKY B;  4BE1 A;  2LBF A;  1ZRE A;  1JTY A;  2O7O A;  5HLG A;  1FP2 A;  1YX3 A;  2DA1 A;  1NTC A;  2IP2 A;  2BY3 A;  3QOP A;  1Z6R A;  4CYC B;  2QA4 I;  5CYV A;  1HQC A;  3PQJ A;  1XMK A;  2KIS A;  3E6B A;  2A61 A;  2P8T A;  2XAJ A;  3CF5 F;  4XLC A;  3S2W A;  3BG3 A;  5FLX K;  1Z9C A;  1R71 A;  4XK4 A;  1R5H A;  2M1B A;  3QPT A;  1G3Y A;  4YRV A;  1V54 H;  2JPC A;  3HXL A;  1KQ8 A;  1F36 A;  2ZJQ F;  1NG6 A;  2OJE D;  5K5R A;  5KAI C;  1PJR A;  1Z0X A;  3GME A;  4QPO A;  4AD9 A;  4CCN A;  2KRH A;  4XLA A;  4P9F A;  1W0U A;  3I64 A;  4XKV A;  2QZ8 A;  3TED A;  2BYV E;  1DP3 A;  1GLN A;  4PSX A;  3JTH A;  4XMY A;  3QP6 A;  1ETK A;  4B47 A;  1JUP A;  3B6C A;  1WFX A;  5HDN A;  2COM A;  1LB2 A;  4G6Q A;  3PFI A;  1TNS A;  3SZP A;  4FIS A;  5HNF A;  1VQ7 I;  1HXD A;  4BGD A;  2Y0M A;  2W85 A;  3K4C A;  2MLK A;  2P6T A;  2R7Q A;  4IRG A;  5FFZ A;  4Q48 A;  4HAM A;  2XAG A;  1O3Q A;  2EIJ H;  2W00 A;  3JRE A;  4KA4 A;  1VFC A;  2DMU A;  1IW7 F;  1V4R A;  1T39 A;  4PUS A;  1I3A A;  3BG9 A;  3BLY A;  4LG0 A;  2DDB A;  3BZK A;  5AON A;  2KLO A;  1CF7 B;  4OMZ A;  1G3T A;  2VPL A;  2KIQ A;  4ZTF A;  3D1N I;  1KYZ A;  3K6G A;  2ID3 A;  3BR0 A;  3LAJ A;  3HOV J;  5DS9 A;  2LDU A;  5IT3 A;  3OYD A;  2IPQ X;  5FKM A;  3CMA I;  1F43 A;  1OYI A;  3LSM A;  3I9V 2;  2NVU B;  9ANT A;  4HLX A;  2HQR A;  5KNL A;  1R00 A;  2LNB A;  3CCV I;  3CZ6 A;  3T0Y A;  1ON2 A;  1MJ9 A;  4RGX A;  1E2X A;  2XF6 A;  1B1B A;  1J2X A;  4HOB A;  5L3G A;  3WGI A;  3BP8 A;  1N75 A;  2W82 A;  4BBS J;  1GUU A;  2F5F A;  2ELJ A;  4BDZ A;  1S72 I;  2W4S A;  2E7X A;  5H2F C;  2ESN A;  5C3E J;  2W24 A;  3ELK A;  2M0C A;  2NS0 A;  4EAT A;  3GTK J;  4M3F A;  5FKK A;  3E5X A;  1LVA A;  4HW0 A;  2XKO A;  1ZG1 A;  4NHJ A;  1LFB A;  4ZZD A;  5EG0 A;  1W5C C;  2VI6 A;  5DCF A;  2E2I J;  4ABZ A;  2Z16 A;  2CWE A;  1LDJ A;  1J09 A;  1ZLK A;  1X4P A;  2G7U A;  3ZN0 A;  5HS8 A;  3A03 A;  3BCA A;  2CRG A;  2CUZ A;  3EUA A;  1VND A;  1MMG A;  1B9M A;  4XN3 A;  3G73 A;  2MA3 A;  3BDD A;  4B3X A;  4FE7 A;  1PUF B;  4BQA A;  2H1L A;  2IA1 A;  3WTZ A;  2CW8 A;  2X6W A;  5LHI A;  2HU9 A;  1IGN A;  3PL8 A;  2CYY A;  3LFU A;  2HYF A;  3HM5 A;  4A5N A;  2VKD A;  1Q1H A;  1FLI A;  2GAU A;  4II2 A;  4W97 A;  2D1V A;  3GWZ A;  3SZT A;  4RB3 C;  1ZR2 A;  4M9S A;  1FYL A;  5CLS A;  2MH2 A;  3BR3 A;  1XD7 A;  2AQF A;  2M4K A;  1J59 A;  4II3 A;  1BN5 A;  1WJA A;  1VQN I;  1TZL A;  3ZQG A;  1I50 J;  1QPI A;  4E7L A;  2CFX A;  4GYG A;  3HOY J;  3EUK L;  1WHU A;  5CVR A;  3V7S A;  3D0S A;  3KCC A;  1YHQ I;  3OOP A;  4DIQ A;  2FBI A;  1QQI A;  5ILU A;  3DV8 A;  1Z6T A;  5F64 A;  3MQ0 A;  3V7R A;  1D0Z A;  3VYU B;  1AKH B;  1RUO A;  1UAA A;  3B02 A;  4KIF A;  2VKH A;  3RQI A;  5B5E C;  3RSN A;  1YLF A;  3SXY A;  1R58 A;  1NHA A;  3LNQ A;  1P9Q C;  5DUI A;  4ANJ A;  4RM3 A;  3TO9 A;  1W0T A;  1T08 B;  4MTE A;  1I27 A;  2VE9 A;  2DAO A;  2K7L A;  1WJD A;  1X3Z B;  4A69 C;  3CDI A;  4HYE A;  3NRV A;  1NK3 P;  3AG3 H;  1JGG A;  3ZCO A;  4ZYG A;  1FZP B;  1K83 J;  3W3C A;  2IGO A;  4K2E A;  4BAC A;  4YFN F;  4EJO A;  2NVT J;  4XOT A;  3Q0V A;  4JYK A;  3EUH C;  1QRY A;  2ZFW A;  2CO5 A;  1TWH J;  2M30 A;  3NEU A;  3LFK A;  1YIO A;  2M4G A;  2O0Y A;  1I1G A;  2M0M A;  2R93 J;  2BGC A;  5IT9 Z;  3OS1 A;  1UG2 A;  1MW7 A;  5DD8 A;  3HOS A;  2DDA A;  1U2W A;  1W7P D;  1WH7 A;  2RN7 A;  4B09 A;  2QBY A;  5F1J A;  2DTZ A;  2EIK H;  5LEK A;  2DQL A;  3QYF A;  5LD2 C;  1RC9 A;  3GZ5 A;  1IN8 A;  1JUM A;  3VYR B;  5IPA A;  2ZCW A;  2DOD A;  4BUP A;  4AM3 A;  1D3Y A;  3PO3 J;  1YIT I;  3LQR A;  4E7J A;  3I3L A;  2VKV A;  5LFA A;  3X2Q H;  3DKW A;  4DGW B;  3FIS A;  2CH0 A;  4C30 A;  1FWZ A;  5DYM A;  3TO6 A;  2KIF A;  2BVM A;  3BZC A;  3TW7 A;  1RZ4 A;  2GXA A;  2DK5 A;  1WSU A;  4WF2 A;  4J01 A;  2PG4 A;  1VZ0 A;  2VBZ A;  5K1Y A;  3WHB A;  4RB2 C;  3PSI A;  2M2E A;  3P9I A;  1IO2 A;  3DXJ F;  1J5Y A;  4FAS D;  2HVS A;  4D7N A;  3FIW A;  1HCR A;  3IC7 A;  1G8X A;  1IN6 A;  2DJI A;  2HDW A;  2NNN A;  3FXJ A;  2EFN A;  4G6T B;  4YIF A;  3J7Z I;  3I59 A;  3WU2 C;  4PSW A;  2R7V A;  3HBL A;  1LKX A;  3G1O A;  3H3U A;  2E34 A;  2E5N A;  5CQG A;  3FM3 A;  3F3X A;  2X1E A;  3MN2 A;  4XQF A;  3R6S A;  2QQ8 A;  5KCM A;  4CGZ A;  3KP4 A;  4A6D A;  2I10 A;  2EQR A;  1Y8Q B;  4Q5S F;  5FJ8 J;  4F3Q A;  4A3J J;  3RKY A;  5JR3 A;  3BCB A;  1TL8 A;  2GA1 A;  3HHG A;  5LHG A;  3CUO A;  1TC3 C;  3K70 D;  3FMS A;  4KMU X;  4BY7 J;  4PJ0 C;  2V1D A;  4N9I A;  4O3M A;  4MIM A;  2H27 A;  5DM6 F;  4N4O B;  3I4M J;  5IP9 J;  5J8C A;  1U6G A;  3R0J A;  2LY1 A;  3KP7 A;  4OAZ A;  3CMY A;  2ECB A;  1T95 A;  2DW4 A;  4M74 A;  4EGZ A;  4G6D A;  3B6A A;  1S6L A;  4AIJ A;  2CQQ A;  4ZC3 A;  4P9U A;  3AFH A;  4QTR A;  2WB1 A;  3BTL A;  3V7C A;  4F7Z A;  3K4L A;  2DMN A;  2ISY A;  5E8I A;  3TKY A;  2Q8K A;  3LSJ A;  3CUQ A;  1WWX A;  3MZ8 A;  3ZQ7 A;  4ENK A;  3AG1 H;  3GZN B;  3FX3 A;  4D1Q A;  3F22 A;  2R7W A;  1XB4 A;  1BI0 A;  2XKP A;  4U7B A;  1LUJ B;  3NAU A;  3VSK A;  4P96 A;  1RI7 A;  2FD5 A;  3BJ6 A;  3MCZ A;  3QU3 A;  3M1E A;  4GGG A;  3CC7 I;  1U8R A;  1WCM J;  1BBY A;  1K78 B;  2AHQ A;  3DBL B;  1K61 A;  3OYC A;  1FSE A;  4RDU A;  3DU6 A;  3J80 Z;  1H0M A;  4XOP A;  2DMP A;  1QO0 D;  3OIO A;  3P5J A;  1JT0 A;  4MGR A;  3S1Q J;  1R22 A;  2HKX A;  3G3Z A;  3IKV A;  3H0D A;  5FRN A;  4FT8 A;  5KVR A;  2QEN A;  4WXH A;  2XGX A;  4DBQ A;  2CQX A;  2LYC A;  1J7K A;  3RTR A;  5IP7 J;  4FX0 A;  2L7F P;  1T98 A;  2PMZ A;  4P55 A;  1R5G A;  2FEZ A;  2O03 A;  3Q3S A;  4E6K G;  3CP8 A;  3DFG A;  4IHY A;  2EA2 A;  1JT6 A;  1RR7 A;  2ZXI A;  3KFW X;  4L5E A;  1UMQ A;  1OQY A;  3DF8 A;  1HKS A;  2L7K A;  3HOX J;  1CGP A;  4NNJ A;  5J1R A;  1FIA A;  2GXG A;  4ZJZ A;  4IQ4 A;  2H94 A;  2XRL A;  3D5R C;  3TOA A;  2EZL A;  1TQI A;  3DP7 A;  4KT5 C;  3G1L A;  3GFL A;  3LOC A;  4A0Y A;  2VXD A;  4AYB A;  1EH6 A;  3O2P E;  5HLT A;  3IUO A;  1A36 A;  3QYB A;  2CU7 A;  2DT7 B;  2ELH A;  3BC8 A;  4LLG F;  3SZG A;  2X1D A;  3CQZ J;  4RM2 A;  4XLE A;  2B9S A;  3HRS A;  3BR5 A;  3CO6 C;  3DEE A;  3M8E A;  1KYW A;  2HOA A;  5E79 C;  3RZD J;  2V6C A;  2GZW A;  4X0G A;  1MBJ A;  4GFB A;  3W6J B;  4B48 A;  1SC7 A;  1H8A C;  3OIP A;  2EFO A;  4RAF A;  1GT0 C;  2R7D A;  4F52 A;  2AS5 F;  1IV8 A;  3FHZ A;  4R8H A;  3ZMV A;  3A02 A;  2R5Y A;  2FMY A;  1JI8 A;  3HOW J;  1V5G A;  2NVX J;  1Y1V J;  2RKH A;  1U0J A;  2K3P A;  2XPU A;  5C4J J;  1ZRD A;  1BM9 A;  3LSP A;  2MFZ A;  4MQ9 F;  3ZRG A;  5GPC A;  3ABK H;  1OR7 C;  5EZH A;  2WC2 A;  1UB9 A;  2A07 F;  1MSE C;  3HOU J;  4XSX F;  3QOE A;  4XOR A;  2XC7 A;  1D8J A;  1P4A A;  2K9N A;  3DLL F;  1GDT A;  3RYR A;  2L3D A;  2HFH A;  2JMW A;  4UUS B;  5EGO B;  2CQN A;  4ESB A;  3I5U A;  2JWT A;  2YPR A;  2R7U A;  3ABM H;  1FPQ A;  4LJZ F;  3A01 B;  2STW A;  5J40 A;  3M8F A;  1W4M A;  1EH7 A;  4P5O A;  4BXX J;  2XAF A;  4NBQ A;  4ASN A;  2X4H A;  1D1A A;  3QPS A;  3JRI A;  1A04 A;  1GV2 A;  4KIS A;  4ITV A;  1KU2 A;  1MMN A;  1XCV A;  2JUC A;  4A0X A;  2R5Z B;  1ETO A;  4OOI A;  5IYC J;  1NK2 P;  2CUF A;  5D5X B;  1T0F C;  3CJR B;  3RPU D;  2DFF A;  4I6Z A;  3JCU C;  4ZH4 F;  3B73 A;  3IHU A;  2GQQ A;  4CYD A;  1EKE A;  1MGT A;  2L9V A;  3L2U A;  2LKS A;  3CJN A;  3CJQ B;  4EJU A;  2AO9 A;  4LIV A;  4S04 A;  3S14 J;  2QWW A;  3E97 A;  5J47 A;  4BEH A;  3E6M A;  2PJR B;  1XTA A;  3WTW C;  1W7P B;  3OIQ A;  3OYE A;  1A35 A;  2FE3 A;  3FKJ A;  3MKL A;  2ZKZ A;  3JAM Z;  5LBQ A;  4M3E A;  3ROU A;  3KZY A;  4IEJ A;  5M5W J;  3ASN H;  2R7S A;  1WPK A;  1ONV A;  2PX9 A;  5ILS A;  3PUB A;  1O4X A;  1T33 A;  1YFH A;  3O8G A;  1DQU A;  5CVU A;  2R7T A;  3RKW A;  2V9K A;  4AU7 A;  4BHB A;  2ISZ A;  3RPQ A;  4QPQ A;  3SEZ A;  1S29 A;  3WU1 B;  2VOP A;  1PYV A;  4C3I J;  2E2H J;  1YS6 A;  4BS9 A;  3WE2 A;  2W84 A;  3GTP J;  3JRB A;  3HIF A;  4RB0 A;  1S7A A;  3A1Y A;  3GFI A;  1ZH5 A;  3MEX A;  4FHT A;  4ON0 A;  2XIG A;  1ZTR A;  3JTG A;  3EDP A;  3O6B B;  3KEY A;  4GO1 A;  3DLA A;  4HSR A;  5K7H A;  1YQA A;  2KDZ A;  2F5C A;  2XSJ C;  1SFO J;  1XGN A;  3DCF A;  2XDV A;  5F0H A;  3QAH A;  3ZQL A;  2R4G A;  1H9G A;  2M34 A;  1FOY A;  2HEO A;  3I58 A;  3L2R A;  1BL0 A;  1K6O A;  1TT5 B;  2M45 A;  2XSD C;  4IQJ A;  4OIP F;  4HDU A;  2JQ7 A;  1JUS A;  2E19 A;  5TGT A;  1R4M B;  4L9N A;  3T8R A;  4IHV A;  1ON1 A;  3OSG A;  1D1B A;  3NWT A;  3QPL A;  2JA2 A;  5B1B H;  4DYQ A;  4CIC A;  1U9O A;  4N0B A;  3M07 A;  1RNL A;  4D5C A;  1DU6 A;  2LC2 A;  3PUF A;  3KZI C;  1U5T B;  5M5Y J;  4ENN A;  2UV1 A;  2PMH A;  2IRF G;  5D6E A;  3L2Q A;  2STT A;  4A3F J;  3ZQC A;  4I76 A;  2RGV A;  3WE3 A;  2BY1 A;  4NC7 A;  3PQK A;  5J4V A;  5FLX Z;  2R7F A;  3L2W A;  1QGP A;  1XN7 A;  2E7W A;  2XAQ A;  1HDP A;  2VN2 A;  4E7Z A;  2ZJP F;  1W36 D;  4IJA A;  2DA4 A;  1WVR A;  4C2T A;  1IDZ A;  2Y30 A;  3RDI A;  2VT3 A;  4A6E A;  3TDZ C;  1FBU A;  1D8K A;  3ZN1 A;  5FKN A;  1TP4 A;  4CA0 A;  2VQH A;  5FKO A;  2KKO A;  3NQO A;  2X48 A;  2M87 A;  2CV1 A;  2EZK A;  1IJW C;  2DPU A;  3TDU C;  1IXR C;  3FHN A;  1MMA A;  4B4C A;  2R0Q C;  3RQ4 A;  1VQL I;  4XID A;  3C2B A;  4A3I J;  2KRC A;  1UEL B;  3F9K A;  2L54 A;  3W6K B;  4EGY A;  2ETH A;  5D4R A;  3CJT B;  1WZ2 A;  4MEY F;  3U1D A;  4XKW A;  4I0A A;  2JVG A;  3C2G A;  5M5X J;  2V9V A;  2IS4 A;  3Q9S A;  2JJ7 A;  2CV0 A;  3S3M A;  5E1W A;  2JSP A;  1ZAR A;  1UHW A;  2HXI A;  2YU3 A;  3U2R A;  2QSG X;  3DBH B;  3SFI A;  3WTU C;  3DTI A;  3HZJ A;  2JA8 J;  3IH4 A;  2VJJ A;  3ECH A;  4QWQ A;  1F1Z A;  3K69 A;  4B43 A;  2LKX A;  2XGE A;  3FMQ A;  3WTV C;  1OCR H;  2HZD A;  4XKC A;  1RIO H;  5HDG A;  4YIR X;  2HWV A;  4ZDP A;  4X1E A;  2K5C A;  1BI1 A;  4MFD A;  5BPD A;  1NH3 A;  4D7M A;  1LFU P;  3BQY A;  2E36 A;  2P5K A;  2BW3 A;  2YU9 J;  4L9V A;  3ISP A;  1LE8 B;  4BL0 B;  4HG2 A;  3PSF A;  4D9J A;  4BJ5 C;  3R60 A;  4MNU A;  3CCU I;  1BC8 C;  2BEO A;  3E0J B;  2E71 A;  2BZT A;  1Y39 A;  1YOV B;  1XS9 A;  1ZRC A;  3ZOB A;  2IXS A;  4PK4 A;  5LLQ A;  5GTI C;  2QGU A;  4HBL A;  3K4B A;  2CMP A;  2PQ8 A;  1ITY A;  2RQP A;  1TW3 A;  2LKP A;  2P6S A;  3BR6 A;  2BE5 F;  2CW0 F;  3WG7 H;  4A3L J;  3A0H C;  5E1Z B;  4HX7 A;  4BKX A;  3GO5 A;  5JLX A;  5J1Y A;  1IRZ A;  2O9L A;  2ZBK A;  2KZG A;  1WRJ A;  2K9L A;  3M7G A;  3CLO A;  3GTG J;  3HL2 A;  3QU6 A;  1U8B A;  4AVZ A;  3FXU A;  5A2Q K;  2DA5 A;  3V8J A;  4PJM A;  2AQE A;  4ZYH A;  3J7Y J;  3F8F A;  2JA5 J;  2UZK A;  3HB9 A;  3GTJ J;  5DCM B;  4QSH A;  2O6G E;  4CZZ A;  4EQQ A;  2LF7 A;  2GLO A;  2ZSH B;  2IGM A;  5H20 A;  1VTN C;  1SD4 A;  4ESJ A;  4G94 A;  5IYB J;  4BE0 A;  4FX4 A;  2MSY A;  4UUV A;  4Y4R A;  2ZJR F;  2UXN A;  1TW2 A;  4PFP A;  5JLW A;  3EET A;  1FJL A;  4KIB A;  1S8N A;  2VBX A;  1H89 C;  2FF4 A;  4CYC A;  1K4T A;  1AOY A;  3LQQ A;  2V1X A;  6PAX A;  2MGQ A;  2ZNZ A;  3K70 C;  2B63 J;  2EZI A;  4EV0 A;  2K27 A;  3JRD A;  1TQM A;  3EUH A;  3ZMD A;  2I8D A;  2VJ5 A;  3SFZ A;  1XSV A;  2OTJ I;  2K4J A;  2I5U A;  2HQN A;  2RV8 A;  4DNC A;  1WJB A;  1ETX A;  2Y0S N;  1POG A;  1U5T C;  4BQO A;  1V3F A;  3GZ6 A;  1QBJ A;  3AG4 H;  3IV5 A;  3U9G A;  2DFE A;  2VAS A;  1TWC J;  1YX5 A;  4DZP A;  5GAE J;  2FOW A;  1GVD A;  4E70 A;  3HDD A;  2E1M B;  3T8T A;  1ZK8 A;  4NQW B;  1SAN A;  2CQK A;  2IW5 A;  1WJC A;  2A3S A;  5FLV A;  2LSO A;  2OU2 A;  2K9S A;  5JHU A;  1IC8 A;  2H1K A;  4B44 A;  5ERI A;  2XGC A;  4Y52 J;  2FQ4 A;  4I09 A;  1G3S A;  2BOL A;  3ZMZ A;  1MND A;  1XGO A;  4ZYD A;  4IZZ A;  4HX8 A;  1X1P A;  2CS3 A;  5BS6 A;  3K2A A;  2QKL B;  2CUJ A;  2V7F A;  5FFX A;  1EV7 A;  1FOW A;  2KIU A;  2NS7 A;  1TNT A;  4AWX B;  2WV1 A;  2K85 A;  2EJR A;  2QLZ A;  3GLX A;  1B8I B;  5LEJ A;  1ETV A;  3GYH X;  3ASO H;  2ID6 A;  3LA7 A;  3J81 Z;  4UUT A;  2XVC A;  3DPT A;  3WOD F;  1CF7 A;  3S93 A;  2VON A;  1MZB A;  3KEQ A;  5ICE A;  2HPI A;  2WV0 A;  3S1N J;  4M3B A;  3JRC A;  4JOM A;  1FX7 A;  4A3D J;  2IT0 A;  2M7A A;  2X51 A;  5TJJ A;  4CCL A;  3FZV A;  2E35 A;  2ME6 A;  2WTE A;  2A69 F;  1O7L A;  2ACJ A;  1LFP A;  4IHT A;  4ZYA A;  1I3Q J;  3QQA A;  1JHF A;  2K9Q A;  1WH5 A;  4IX7 A;  1E3O C;  2NRA C;  1R7J A;  5E18 F;  2HYJ A;  4U0V A;  3CTA A;  3TP3 A;  2AXT C;  2XPW A;  2E2J J;  2VIX A;  2KRF A;  3BJA A;  4KIC A;  2EWN A;  3OYL A;  3SYT A;  3JRA A;  1V5F A;  1IRX A;  5B66 C;  3CCE I;  2G7H A;  2LP0 A;  3M8J A;  1ENH A;  1IV6 A;  2BBY A;  1UFM A;  2VC0 A;  4NUB A;  5J4Y A;  1FYK A;  1FSH A;  5J6X A;  1Z7U A;  2A5W A;  4R1H A;  1H88 C;  1PUE E;  5HDK A;  2CQ7 A;  3TW6 A;  1A5J A;  3OYG A;  2W25 A;  3T5X A;  3T1B A;  4EM0 B;  3P9C A;  5L3F A;  4RB1 A;  1LQ1 A;  2O3F A;  1B72 B;  2XF5 A;  4KIG A;  2F4O B;  4UB6 C;  3J81 K;  2LLK A;  1KON A;  3HRU A;  1PUF A;  2R7X A;  1X1A A;  1JTX A;  5HOD A;  1UHS A;  4BU2 A;  3OYN A;  3VOD A;  3ZQH A;  1M1E B;  3GXO A;  4XKB A;  2QQB A;  3F6O A;  3ZMU A;  4A3G J;  2D45 A;  3MKZ A;  2LD5 A;  1IAW A;  3REO A;  4UB8 C;  3L2C A;  3GVA A;  3FXM A;  1I6X A;  1I5Z A;  2VKE A;  3RJP A;  4WWC A;  1MNM C;  4KMF A;  1OCO H;  2EFW A;  3IRQ A;  3PNV A;  1QHH D;  3EYI A;  2QM3 A;  4RLQ A;  1R4N B;  2UUZ A;  5M3F J;  2VOO A;  1SFU A;  2F5V A;  1X3U A;  2PEX A;  1VF9 A;  5TRD A;  1YJN I;  1WJ5 A;  2FNA A;  4XLN F;  5DM7 F;  2CSO A;  4M9X A;  2DFI A;  1KQ0 A;  3KYD B;  3CCS I;  2QVO A;  1BOA A;  1AKH A;  5DUK A;  3D5L A;  3M3Y J;  4BE2 A;  1ZHF A;  1ZN2 A;  3OYA A;  3WG9 A;  2CUE A;  4Q4Z F;  1HLV A;  1XMX A;  2RVC A;  3GBG A;  2R7R A;  3LSK A;  3V42 A;  1RRJ A;  5K7Z A;  5AIP A;  2ZO4 A;  1UHM A;  4RAG A;  2E1C A;  2H8R A;  3K10 A;  4LGW A;  3OOU A;  2Y9Z A;  1A6Q A;  1EH8 A;  1S7E A;  2IAI A;  2TRT A;  2ZB9 A;  3HUG B;  4IF4 A;  4PJL A;  5D5V B;  1NG7 A;  2GBY A;  3CME I;  4OMY A;  5ICG A;  5BMZ A;  2KZV A;  5CVI A;  4GXO A;  2KFD A;  3W2A A;  2M9H A;  4B8X A;  2HQ5 A;  2MH9 A;  3I0T A;  1D0Y A;  2DTR A;  5EYR A;  5FO5 A;  5IOZ A;  2YR2 A;  3K4K A;  4HPQ A;  3HSR A;  4EJT A;  5L3C A;  3TBI A;  1USS A;  1MJA A;  3LST A;  1YTY A;  2MYS A;  4KNY A;  3CCM I;  2DPD A;  4OIO F;  3LSH A;  3G71 I;  1S7O A;  3BTJ A;  2E1M C;  3KLN A;  4S05 A;  2JA6 J;  2RC4 A;  1G6N A;  1JKP C;  3H3Z A;  1P4W A;  5CJ9 A;  2DFH A;  2DA2 A;  3C2H A;  4R79 A;  3VFZ A;  2L02 A;  1S3J A;  2Q2E B;  1Z91 A;  3ZQI A;  5CPR B;  1IXC A;  1OFC X;  2XUB A;  1QZZ A;  3MZH A;  1OR7 A;  3SQN A;  1I1S A;  2MLG A;  3KP6 A;  2JRT A;  1Y1W J;  2KPM A;  2XHK A;  3GTQ J;  3ABU A;  3TQN A;  4S0H B;  2XPV A;  1DUX C;  2ZC2 A;  4V19 K;  2P81 A;  3HSF A;  2XRO A;  1OCZ H;  2HQA A;  2K40 A;  3RKQ A;  2EH3 A;  2HI3 A;  1YRN B;  4L0Y B;  2IGN A;  1KQ9 A;  3HRT A;  3OSF A;  1BW5 A;  3G2B A;  5EZG A;  4AVP A;  1VQ9 I;  4HQE A;  2ZXW H;  1W1W E;  4WK8 F;  3H9J A;  2PLY A;  2QEX I;  2MBF A;  3E3V A;  4N4N B;  1E3P A;  1K7A A;  1T0F A;  2GOM A;  2VE8 A;  4LB6 B;  1VQ5 I;  4AIK A;  2Z1D A;  2MW8 A;  1WQ2 A;  4M6Y A;  4M6V A;  1Y0N A;  2A6T A;  3KP3 A;  4A3E J;  1QZY A;  3AL0 B;  4HDV A;  1BOB A;  2PN6 A;  4UY8 I;  5D5U B;  4A3C J;  3PFY A;  4IHS A;  2Y31 A;  1SEU A;  1MH4 A;  3CDH A;  4DZJ A;  1BIA A;  1G3W A;  2FSW A;  2NS8 A;  3QYE A;  1G2H A;  3GTL J;  2IBD A;  1W36 C;  3S17 J;  2ZME B;  4I99 C;  2A5Y B;  5GP9 A;  1DPU A;  3G6E I;  2GWR A;  3V8L A;  2EFP A;  1IUF A;  2VQG A;  4I98 B;  2MAB A;  4N9H A;  2ICW G;  4HF1 A;  4F93 B;  1FYM A;  1W5T A;  3IAM 2;  1UG0 A;  3S3O A;  1IN5 A;  4ZYE A;  4LD5 A;  3LA3 A;  4U0Y A;  4RGS A;  3FBI B;  1TWG J;  4CDG A;  4XRS A;  1R1T A;  2M8G X;  1H9T A;  3HC7 A;  1GHC A;  4EMS A;  4BXU A;  2VOD A;  4JQF A;  4WCG A;  4IXA A;  2PJP A;  1I6H J;  1TBX A;  3NAR A;  1TWA J;  5JVG F;  3BOQ A;  2L9R A;  3W6V A;  2OAZ A;  3L7W A;  3OYH A;  4HLY A;  4A93 J;  1Z1D A;  1K78 A;  3HYI A;  4RBO A;  3BWG A;  5FRO A;  1QVU A;  3HGY A;  3UR3 C;  1J9I A;  1ETQ A;  3K1P A;  5HNH A;  5ILV A;  3IAS 2;  5L3E A;  2EFQ A;  2BXZ A;  5BNG A;  1KGS A;  4G7Z F;  3DKY A;  1MNE A;  1YE9 A;  4HNT A;  1FNN A;  3LMM A;  3CDL A;  4RLF A;  2FBK A;  4HNV A;  1IUY A;  3VPR A;  1KU3 A;  4G7O F;  3F21 A;  4JX5 A;  1HW1 A;  1YJW I;  3F8N A;  2WAQ N;  4KFC A;  1FMV A;  3MVP A;  1N77 A;  1X2N A;  1X1D A;  3DBR B;  1WI9 A;  3CES A;  3J7A Y;  3GX4 X;  2L4M A;  3F8B A;  4UVC A;  4DYC A;  1DU0 A;  3V8K A;  3HRM A;  3N97 A;  2FXA A;  3CC2 I;  4XRM A;  5LRS A;  2MC3 A;  1QHG A;  1QU3 A;  1HC8 A;  2WBM A;  4LMY A;  4CCJ A;  3S3N A;  2TDX A;  3CCQ I;  4IL6 C;  1HKT A;  3M9A A;  4YFX F;  3I4N J;  2EIN H;  1MDM B;  2E5Z A;  3P9K A;  4KYW A;  2EBI A;  1Z7L A;  2P4W A;  1ACI A;  4GYI A;  3CC4 I;  5HOO A;  3ZGK A;  3IKT A;  3WTX C;  4L0Z B;  1F9N A;  2OZ6 A; 
#chains in the Genus database with same CATH homology
 1D0Z A;  1LVK A;  1UAA A;  2RQQ A;  2VKH A;  3PNT A;  3RSN A;  4BDY A;  2BW3 A;  5KHD A;  1P9Q C;  3OWT A;  4C9Y A;  3OYJ A;  2VQL A;  4BL0 B;  4ANJ A;  4RM3 A;  4YEJ A;  4HG2 A;  3PSF A;  4D9J A;  4DBR A;  4BJ5 C;  2FUG 2;  1AA7 A;  4XM3 A;  1WJD A;  3E0J B;  1MMD A;  3OR1 C;  2KP6 A;  3CP2 A;  2O5R A;  3TL4 X;  5CQE A;  3ZCO A;  2LY2 A;  3MKW B;  4PFO A;  3W3C A;  2IXS A;  2IGO A;  3OL4 A;  4BAC A;  4PK4 A;  3LSG A;  2X1C A;  4XOT A;  2CW7 A;  1EA3 A;  3K4B A;  3EUH C;  2CMP A;  4E7S A;  4P1W A;  3AKZ A;  4J00 A;  2M4G A;  1ZEL A;  2IGK A;  2VLA A;  2M0M A;  3RCO A;  2LBF B;  3OS1 A;  4BQQ A;  1MW7 A;  3OL3 A;  2NOJ B;  3A4C A;  3OS0 A;  3PJR A;  3HOS A;  2K9L A;  4BEH B;  3LSI A;  2UWM A;  3HL2 A;  4AVZ A;  4KJZ A;  1S9H A;  3IP4 B;  3QYF A;  5LD2 C;  1SFK A;  4PJM A;  2AQE A;  2LH9 A;  2KL4 A;  3VYR B;  3ZQQ A;  2ZXH A;  3OS2 A;  4BUP A;  2ZFU A;  2L5Q A;  3H9G A;  2M7B A;  3KX2 A;  2ZSH B;  2IGM A;  4E7J A;  2L9N A;  4DJA A;  3I3L A;  3H5A A;  4BE0 A;  5LFA A;  3VYS B;  2VJI A;  3S32 A;  3DWL E;  4DGW B;  3VSL A;  2CFO A;  2HPM A;  2CH0 A;  2V4J C;  4Y4R A;  4C30 A;  3AL0 C;  3DKX A;  4PFP A;  2BVM A;  3ONQ A;  4J01 A;  2PJR A;  1VZ0 A;  3W2W A;  3KYL A;  3PSI A;  2HNH A;  4HNU A;  4E7H A;  4LG3 A;  3K70 C;  4FAS D;  2HVS A;  2JVH A;  3OMY A;  4GRI A;  3HPH A;  1G8X A;  2DJI A;  2HDW A;  4G6T B;  2V1N A;  4PSW A;  1WJE A;  2I8D A;  2VJ5 A;  1LKX A;  5CQG A;  2R7V A;  2E5N A;  4XQF A;  2X1E A;  2VB6 A;  1WJB A;  2KMU A;  2M3A A;  5KCM A;  2OV7 A;  4BQO A;  2HVR A;  2K9M A;  2W1O A;  3ZXS A;  3HKZ A;  4F3Q A;  4DOZ A;  3FBN B;  2VAS A;  3CMM A;  3BCB A;  1YX5 A;  3QOD A;  4E7I A;  2E1M B;  4NQW B;  3K70 D;  1WJC A;  1HA8 A;  2MC4 A;  4B44 A;  1X19 A;  4E4H A;  4U87 A;  4N4O B;  3VYT B;  2DCE A;  4XR6 A;  3N05 A;  2LY1 A;  4OAZ A;  4PJJ A;  2BOL A;  1T95 A;  2R7O A;  3NWS A;  1MND A;  4IZZ A;  4C2U A;  4Y33 A;  2CS3 A;  2W7N A;  2QKL B;  2CUJ A;  2V7F A;  1TT0 A;  4ZC3 A;  2LG4 A;  3AFH A;  4HRI A;  2WB1 A;  2WAF A;  3K4L A;  2X6X A;  4CCO A;  2E60 A;  2DT6 A;  4D1Q A;  2R7W A;  3MD2 A;  3DPU A;  3DPT A;  3S93 A;  1D0X A;  4U7B A;  4CCK A;  1X4O A;  3VSK A;  2HPI A;  4LIU A;  4XON A;  4JOM A;  4BXF A;  2M7A A;  4ZDL A;  2X51 A;  4CCL A;  4HST A;  3ZR8 X;  3OYC A;  1DGR M;  3EPZ A;  3DU6 A;  1LFP A;  1Y56 A;  4RMN A;  4ZYA A;  4XOP A;  1WJF A;  2KHM A;  2RRE A;  3H0D A;  3OR2 C;  4LIT A;  4IX7 A;  5FRN A;  2L9S A;  3SDB A;  2P0W A;  4DBQ A;  3UNG C;  2LYC A;  1E0E A;  2VIX A;  3RTR A;  4IKF A;  3OYL A;  3SYT A;  5FRM A;  1V5F A;  1IRX A;  2PMZ A;  1BR4 A;  3M1C A;  3M8J A;  3K4N A;  4E6K G;  2BVL A;  1OLT A;  2WAD A;  4NUB A;  3OY9 A;  3CP8 A;  4F92 B;  2A5W A;  3DTK A;  2ZXI A;  3OYG A;  3BG6 A;  2L7K A;  4NNJ A;  4CUG A;  2XF5 A;  3FDY A;  4ZJZ A;  1Z3X A;  4IQ4 A;  3D5R C;  1KON A;  4H4K C;  1X1B A;  2GOX B;  2R7X A;  1X1A A;  3H9Q A;  3HG9 A;  2F6C A;  3OYM A;  4BU2 A;  5HVQ C;  3OYN A;  2VXD A;  4AYB A;  5HLT A;  3TMO A;  3IUO A;  3QYB A;  4XKB A;  3OYB A;  3MKZ A;  2DT7 B;  3BC8 A;  2BW3 B;  3SZG A;  2X1D A;  4RM2 A;  4XLE A;  2X6Y A;  2CV2 A;  2IS1 A;  2QKM B;  2VJ4 A;  4XLH A;  3DEE A;  3PNV A;  2OUM A;  1QHH D;  4E7K A;  2WAQ A;  4RLQ A;  4X0G A;  2UUZ A;  4B48 A;  2WAE A;  2F5V A;  3OIP A;  3OYF A;  1R6R A;  4F52 A;  3DQV C;  1ERD A;  1WJ5 A;  1JI8 A;  1V5G A;  3S8P A;  1U0J A;  2K3P A;  1N78 A;  3VDX A;  2F4I A;  3K4J A;  2MFZ A;  3ZRG A;  4ZTJ A;  3D5L A;  1OR7 C;  2JUG A;  4BE2 A;  2DOA A;  3DPL C;  4OAY A;  3OYA A;  1D1C A;  3QOE A;  3MMY B;  4HEA 2;  4XOR A;  2XC7 A;  3GBG A;  2KDO A;  2R7R A;  3LSK A;  2IS2 A;  3V42 A;  2DXI A;  3W2V A;  4XL9 A;  2V26 A;  3H5R A;  4KIT B;  2R7U A;  4KT6 A;  3K4M A;  1DGW Y;  4Y3O A;  3K10 A;  2V6E A;  4P5O A;  3OOU A;  3HUG B;  4PJL A;  3LL7 A;  2VQC A;  1X1C A;  1NG7 A;  1D1A A;  2KZV A;  4KIS A;  4ITV A;  3W2A A;  1MMN A;  1FMW A;  1V5E A;  1D0Y A;  1T0F C;  3CJR B;  3RPU D;  2Q1Z B;  3D5S C;  4CSW A;  2XF7 A;  4XNF A;  3K4K A;  4HPQ A;  2ZSI B;  3MKY B;  4BE1 A;  4BQN A;  1LDK B;  2LBF A;  3TBI A;  3L2U A;  1YX3 A;  2MYS A;  3CJQ B;  4LIV A;  4OWR B;  4BJ6 C;  3LSH A;  2VL8 A;  4BEH A;  2PJR B;  2VXZ A;  2E1M C;  3OIQ A;  3OYE A;  3FKJ A;  1BR2 A;  4XLC A;  3VWB A;  3C2H A;  4R79 A;  2Q2E B;  2RNG A;  4YRV A;  2IS6 A;  1G59 A;  5CPR B;  3HXL A;  2R7S A;  1NG6 A;  1PJR A;  4QPO A;  3PUB A;  4CCN A;  3DTE A;  2KRH A;  4XN0 A;  1DQU A;  4XLA A;  2KPM A;  4XKV A;  3OYI A;  2R7T A;  3HOT A;  2XAU A;  1DP3 A;  5CKT A;  2V9K A;  2HQA A;  4AU7 A;  4XLF A;  1GLN A;  4PSX A;  4YEL A;  4QPQ A;  1BR1 A;  4XMY A;  3SEZ A;  4PJN A;  4B47 A;  3H5N A;  2IGN A;  1WFX A;  1PYV A;  2WY7 Q;  3G2B A;  4BS9 A;  5HNF A;  3OYK A;  3H9J A;  1SAU A;  4BGD A;  3K4C A;  3PNY A;  3A1Y A;  4N4N B;  2GOM A;  2R7Q A;  4CZC A;  1Y6I A;  2Z1D A;  2A6T A;  2W00 A;  3KEY A;  3DLA A;  4HSR A;  3AL0 B;  1BOB A;  2XSJ C;  3PFY A;  4FET A;  4PUS A;  2OC6 A;  2XDV A;  2R4G A;  3BLY A;  4F91 B;  3DU5 A;  3A2K A;  2KLO A;  3QYE A;  2VPL A;  2Y0S A;  3L2R A;  4ZTF A;  4IQJ A;  3K6G A;  3E1S A;  1W36 C;  5TGT A;  3H35 A;  3OYD A;  2LOO A;  2HVQ A;  1D1B A;  3NWT A;  2VQG A;  2JA2 A;  2MAB A;  3LSM A;  3I9V 2;  4F93 B;  1Z3Y A;  5KNL A;  2LC2 A;  4BJT A;  3IAM 2;  1UG0 A;  3S3O A;  1K6Y A;  3CZ6 A;  2UV1 A;  3SEQ A;  2XF6 A;  3L2Q A;  3FBI B;  1N75 A;  4CH7 A;  2W82 A;  5JHF A;  2ELJ A;  4NC7 A;  4BDZ A;  3HC7 A;  2W4S A;  3L2W A;  2Z2S B;  4JQF A;  1W36 D;  4E7Z A;  2LRD A;  4C2T A;  2L2O A;  4EAT A;  3OYH A;  4CA0 A;  2VQH A;  5FRO A;  2Z16 A;  3UR3 C;  2CV1 A;  5HNH A;  3IAS 2;  4CCM A;  1J09 A;  2WA0 A;  1MMA A;  2LRE A;  3DKY A;  1MNE A;  1X4P A;  3FHN A;  1YE9 A;  3BCA A;  4HNT A;  3CF2 A;  2CUZ A;  3EUA A;  3HPG A;  3LMM A;  3RQ4 A;  1MMG A;  4RLF A;  4XN3 A;  2KRC A;  4B3X A;  3BG7 A;  1UEL B;  1Z21 A;  3F9K A;  4MLO A;  2CW8 A;  2X6W A;  4XKW A;  2HU9 A;  3PL8 A;  4F55 A;  3LFU A;  1FMV A;  2JVG A;  1N77 A;  1X1D A;  3C2G A;  2VKD A;  3CES A;  3J7A Y;  2IS4 A;  4II2 A;  4ZDO A;  2CV0 A;  3S3M A;  2JSP A;  2X85 A;  2AQF A;  2WY8 Q;  2M4K A;  3DTI A;  1QHG A;  1QU3 A;  4II3 A;  2WBM A;  4CCJ A;  3S3N A;  1WJA A;  2VJJ A;  4NC8 A;  2KQR A;  1TZL A;  4E7L A;  2MD0 A;  4B43 A;  3EUK L;  2HZD A;  4XKC A;  2E5Z A;  3U21 A;  1Z7L A;  4ZDP A;  4DIQ A;  5HOO A;  3ZGK A;  2K5C A;  3L2V A;  3VYU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...