4C2MJ

Structure of rna polymerase i at 2.8 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4
publication title RNA Polymerase I Structure and Transcription Regulation.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c2mJ00
3IH2A 4A93J 1O4XA 4RBOA 2DJNA 2LR8A 2LP0A 2DA6A 3QPLA 1RETA 1IDZA 5IPAA 2I10A 4A3MJ 3S14J 1F43A 1SANA 2ID3A 1IRZA 1Y1VJ 3OOUA 3G1LA 2DA3A 2VKEA 1JTYA 2COBA 2PMZN 1VF9A 4BXXJ 1X2NA 5K7ZA 1P7JA 2XRLA 3VPRA 1H8AC 3CMYA 3BR6A 4W1UA 1A5JA 2L7FP 2ZB9A 2DMPA 1A6IA 3BR1A 4AC0A 1TWGJ 1ZR2A 5K7HA 5J1RA 2GBYA 3BQZA 2X48A 4X1EA 2EBIA 2ME6A 2JWTA 3FIWA 3Q0WA 4W97A 1GVDA 1ZKGA 3S1NJ 2K9QA 2DA4A 3TP3A 1TC3C 4XRMA 3S17J 3JRCA 1FIPA 4UUSA 4A3IJ 1TWFJ 3JRBA 2NVQJ 1FEXA 1RPWA 3IH4A 3S2DJ 3LOCA 1Y1WJ 4X6AJ 3JRAA 1IDYA 2L7ZA 2YS9A 4JX5A 2EQRA 1JT6A 1VNDA 2OPTA 1MH4A 1HDDC 2GLOA 3H0GJ 5GPCA 1U8BA 1BL0A 2EZLA 1WI3A 2XGEA 4EEFG 5EGOA 2RAEA 1ZGWA 2NVXJ 1ETQA 3CDLA 1ZQ3P 1WH7A 1MSFC 2ECCA 3HOZJ 5C4XJ 4DW6A 4DYCA 1B72B 3JRGA 2TRTA 1Q1VA 5F08A 4V2FA 4CYCA 2CRGA 2JA7J 1TWCJ 2CQQA 5EEAA 4A3CJ 2R5ZA 5FKKA 5EYRA 1GV2A 3TP0A 1U78A 3S15J 1RKTA 1XG1A 4M3GA 1MBFA 4Y7NJ 1HDPA 1MBJA 1MBEA 3FK6A 1GUUA 4MLOA 4LOCA 4IHWA 1WCMJ 3D1NI 1ETXA 1JKRC 2X9DA 3RZDJ 1MBHA 2E2HJ 4C3HJ 1JUMA 5K7FA 3C2BA 5F0FA 2KDZA 2XB0X 4MFEA 2HDDA 2HI3A 1ETKA 2FQ4A 1HCRA 1BJZA 2IEKA 1ZTRA 3S2HJ 1APLC 4A3DJ 1B8IB 5E3LA 1OCPA 2R5YB 1IC8A 2O8KA 3WHBA 3BTIA 3I4NJ 5M5WJ 1OCTC 2Y0SN 3ZQIA 2HQ5A 3BR5A 3DEWA 3PO3J 4MFDA 1B72A 3CQZJ 2DMUA 1AU7A 2FD5A 1H88C 2CU7A 4A3BJ 2E19A 1Z77A 1ITYA 1OFCX 2LY9A 2L9RA 4C3IJ 2WAQN 3GTOJ 5EG0B 1RESA 2NOGA 3HGGA 3JRHA 3FKIJ 5EGOB 2JN6A 1R9TJ 2AO9A 2CJJA 1XS9A 1K61A 4XICA 2H1KA 3HB9A 3BR2A 4S0HB 1WH5A 3RKQA 3BR3A 2HOTA 2N8GA 3TW6A 4CYCB 4A69C 3BG3A 5C4JJ 4JX6A 2LTPA 2XPWA 3NAUA 1JJ8C 1MBGA 2XSDC 4IHVA 5HODA 3S16J 4C3JJ 3O8GA 2E2IJ 2R5ZB 1ENHA 3O8HA 3ZQLA 4A3EJ 1UG2A 1B8IA 3SDGA 1X2MA 4GFBA 1IUFA 2MGQA 2NVYJ 2DTZA 2OF7A 4D5FA 2R5YA 3ZQGA 4FCYA 1JGGA 2H8RA 2VKVA 2XGCA 4D5CA 2WV1A 3B6AA 1F36A 2YU9J 1GDTA 2LVSA 2JK3A 4I76A 1U9OA 5IOZA 2CQXA 2EZHA 1QVTA 2ME0A 4M3BA 1LE8B 4DYRA 4XRSG 4B3AA 2Y31A 4JP0A 1TWHJ 2DMTA 1IV6A 1UHSA 5M3MJ 5EG0A 1XC5A 2ID6A 3HOVJ 1D5YA 2Y2ZA 1IJWC 3PM1A 4FE7A 2NVTJ 2Y9ZA 3A01A 2DA5A 2P81A 4G12A 3OSFA 3RZOJ 2QCOA 2VPRA 3GTQJ 5J1UA 5EF6A 4QSHA 2E2JJ 2DA2A 2YUSA 3ZQFA 4AYBN 5IP7J 2TCTA 1HLVA 3CCYA 4QTRA 1JJ6C 1GT0C 1MBKA 1ETOA 1QVUA 1POGA 2G0EA 3IV5A 4BY1J 2JMWA 1T56A 3HGYA 1NK3P 3B6CA 5E3OA 3ZQCA 3LSJA 3HOXJ 2CUEA 1WPKA 1JT0A 1BA5A 3E7LA 2ECBA 5F0CA 3LSRA 3BG5A 1YRNB 1UMQA 2KT0A 1IG7A 2W48A 2ELKA 2M34A 3LSGA 3PO2J 1LE8A 2DN0A 5FLVA 2R7ZJ 4A3LJ 2HOSA 5E3MA 2XPUA 2AHQA 2JA5J 1LFBA 9ANTA 3BR0A 4C2MJ 3HOYJ 3BQYA 3HDDA 4L5EA 1W0TA 3OSGA 2M8GX 3GTKJ 3S1MJ 5F04A 3TEDA 5M5XJ 4FE4A 5DTDA 3HOWJ 2QF7A 1P7IA 3ZQHA 1JTXA 2M9HA 2WB1N 3JRFA 5EZGA 1H89C 4Y52J 1U9NA 1MSEC 4M3EA 2E1OA 3GBGA 5FJ8J 3GTGJ 3H3VK 5IP9J 1QPIA 3BTCA 3Q0VA 3FK7A 3IH3A 2DMQA 2IAIA 1AKHB 1W0UA 4DYQA 2JJ7A 2LK2A 1JUSA 3A01B 4IHXA 5F27A 1G2HA 5IYBJ 2DA7A 1HF0A 3G1OA 5IYCJ 2HOAA 3JREA 2JA8J 1GV5A 2VUMJ 1YRNA 2Y30A 4DZJA 3GTLJ 2NS7A 1I6HJ 5GP9A 2MSYA 1BW6A 4QIWN 1QRYA 5JLXA 5C44J 1CQTA 3GTMJ 1OJLA 4BBRJ 4I6ZA 1MH3A 3UKGA 4IHYA 1RR7A 3BT9A 2MG4A 3DCFA 2JA6J 2HXIA 4RDUA 1ORKA 3A02A 4MIMA 4DZPA 4BY7J 1TWAJ 2K40A 2X6OA 4BKXA 3FISA 3K2AA 4D7NA 1VFCA 3TW7A 4A3FJ 5IP6A 1ETWA 4HNVA 1IGNA 1RKWA 1JKQC 2XB5A 1E3OC 3OIOA 4ABZA 2EH3A 2XPVA 1ETVA 3LNQA 3S1RJ 2D5VA 4UUTA 1I3QJ 4J19A 1S7EA 2LD5A 1FTZA 2MW8A 3M3YJ 1JUPA 5FKMA 1I50J 4B4CA 4FTHA 2HXOA 1JKOC 5J3LA 1AKHA 2GM4A 1JKPC 5FKOA 5GPAA 4MO7A 2LLKA 1DU0A 3GTPJ 3M4OJ 2K9NA 1WGXA 1FIAA 4D7MA 3SJMA 1FJLA 3RQIA 3HOUJ 1ZK8A 1ZR4A 1VI0A 1PUFB 3HBLA 4B1RA 3G1MA 1NTCA 3BG9A 1HOMA 3Q0UA 5M5YJ 2K9SA 1BW5A 2R93J 2FX0A 3JR9A 3W6VA 1K83J 5E3NA 3LSPA 1LFUP 5IOYA 5FLMJ 1DU6A 4A3KJ 5EDNA 4JX4A 5C3EJ 3BTJA 1X58A 1Z0XA 1ETYA 4FISA 2VI6A 3QPSA 5JLWA 3F0CA 4BBSJ 4M3FA 1SFOJ 3HKZN 4IEJA 4V2GA 5F1JA 2L0KA 2CUFA 2R92J 3A03A 5BNGA 3HM5A 4AUXA 4XIDA 3GTJJ 5M3FJ 2NS8A 2LFBA 4A3JJ 2IBDA 4XK4A 2FJ1A 3MKLA 5FKLA 3WHCA 2O7OA 3NARA 4M3DA 5J1YA 2M2EA 5IYDJ 1T33A 3Q3SA 3JRIA 2HYJA 3JRDA 4M6VA 3ZOBA 1PUFA 1MNMC 3QQAA 1EF4A 3K7AJ 1FTTA 2DA1A 2R0QC 4NDLA 4XRSA 3HEFA 2B63J 2M0CA 2L7MP 2EZKA 3L1PA 4A3GJ 4UUSB 5FKNA 3I4MJ 2XGDA 5EZHA 2Y9YA 4JYKA 5F0HA 5DS9A 1AHDP 1NK2P 3SFIA 3S1QJ 2EZIA 3MVPA 3MN2A 2O9LA 3BTLA 2LKXA 2DMNA
chains in the Genus database with same CATH superfamily
2A5YB 3IH2A 1HSJA 5KAFC 1IN5A 4BH9A 1IDZA 1WQ2A 4E4HA 2I10A 2EIKH 4YRVA 4I01A 3HKZA 5DYMA 2P5KA 2RN7A 3BZ6A 3M8FA 5J8CA 4B43A 3I5UA 1Y1VJ 5H20A 1P6RA 3ZMUA 5J47A 3AG3H 4MEYF 1JE8A 1ZAOA 3O3KA 2M5WA 4C2UA 1SVOA 4P96A 4DNCA 3VPRA 3CMYA 3K10A 4W1UA 3EYYA 1HKSA 2ZXHA 4B3XA 4J01A 4EJTA 3WTYC 5J1RA 3WE2A 3RKXA 3H3UA 5E1WA 3V7CA 4I98B 2ME6A 2X51A 2JWTA 3J7AO 1YS7A 1ONVA 1QA6A 1SFKA 2Z2SB 2DYSH 4L9TA 4XONA 2M1BA 5LLQA 2K9QA 1EJ9A 3TP3A 3FHNA 2HKOA 3K4LA 1MNDA 1BOBA 3RJPA 1PP7U 3R60A 1DPRA 4NBQA 2QBYA 3W2WA 4A2UA 5H2FC 3JRCA 4UUSA 3JRBA 2BE5F 3GF2A 1FT9A 3WTZA 3AKZA 2GXAA 2EINH 4ZYHA 2O3FA 3LOCA 3NEUA 5IT9K 3KEQA 3FF5A 2EV0A 1X1CA 2OUMA 3RDIA 2MABA 2L7ZA 4XLHA 4JX5A 2XF6A 2OPTA 3F23A 2GLOA 2UV1A 3H0GJ 1U8RA 1H9TA 1F4KA 3BZKA 2EZLA 4XLPF 1KQ0A 2DCEA 2IP2A 1CF7B 5B5EC 1ZGWA 2Z99A 3K1MA 1WJFA 1WH7A 2G7UA 3HOZJ 3TOBA 4QWQA 4DW6A 2ZMEC 1GXQA 2CFXA 1MMNA 4F92B 4CYCA 1VQ8I 3A2KA 3GXOA 2CRGA 2P6SA 1KYWA 5FD5A 1TW2A 4ENJA 1W36C 1Y0NA 4KDPA 3OYFA 4HSRA 4G7ZF 1EH6A 3S15J 2ADUA 1ZELA 3OY9A 2R7WA 4HDUA 3W6JB 2Z16A 1HDPA 1MNEA 5DCFA 2VN2A 4CICA 4RB2C 1MMDA 2W4SA 3FK6A 2FNPA 4RLFA 4AM3A 4L9JA 2RNGA 1Z1DA 2DT6A 1WCMJ 3RYPA 2X9DA 4I0BA 4M72A 3C2BA 3EPZA 5F0FA 4BNCA 4P55A 4G94A 2HDDA 2FQ4A 1SD5A 2CG4A 2E71A 1BJZA 1WZ2A 3IL2A 1R36A 1ODDA 1RNLA 3OIPA 3E5QA 4XN3A 2WTEA 2X4HA 2XVCA 2KIFA 5LEJA 3PNVA 5DUKA 5JHFA 4BHBA 3K4JA 1EH8A 4UB6C 4PFPA 4EV0A 2Y0SN 2K85A 3BR5A 3DP7A 3PO3J 1B72A 3QAHA 2FOKA 4OU0A 2R3SA 4KN7X 4D9JA 4UVAA 2FD5A 1KU9A 4FASD 2EFQA 2OQRA 1EKEA 3OYCA 1AOYA 4II2A 4Q5SF 3FXMA 2EIMH 3PUBA 4A0YA 2LY9A 4N4OB 5D5XB 3DBLB 4L5JA 3JTGA 4ENKA 3I59A 2O8XA 3HRSA 3ZMZA 3QPTA 5A2QK 3GZ5A 1IF1A 2DFHA 2DI3A 3OYBA 1K61A 2R7XA 2QSGX 4BU2A 2EFWA 4I09A 4BS9A 1UELB 4M71A 2WWYA 2FOWA 2XSJC 3RKQA 3V4GA 2VJ4A 2ELHA 1P2FA 4G7OF 4NHJA 1J09A 3FXQA 1MBGA 4ZTFA 4KFCA 1KA8A 3O8GA 2JPBA 2VJIA 4EGZA 4NQWA 1TT0A 4R79A 1UG2A 1B8IA 5B1AH 3HZJA 5CQGA 2E5ZA 3PFIA 4D5FA 1OMIA 3SZGA 3DTEA 5FLXZ 2R5YA 1JGGA 3KYLA 2WBMA 2WV1A 2GWRA 2LKPA 3CP8A 2IS1A 2M7AA 2NOJB 4PJNA 1BR1A 2JK3A 3VB2A 1U9OA 1YQAA 5CVVA 4RAZA 3AAFA 4LFUA 2ME0A 4L5IA 1Z7UA 2E34A 1YW9A 2XC7A 1TQIA 2Y31A 1IUYA 2P6TA 3ABKH 4LB6B 2WAQA 3FZVA 3ML6A 5EG0A 5HS9A 3HOVJ 4MTDA 1XTAA 1P4AA 4WXDA 1D5YA 1LDKB 2A6TA 4EJWA 4FE7A 2NRAC 1Z21A 4XR6A 3GFMA 2JSCA 1LDDA 4G12A 3ZMSA 3OSFA 4ASNA 3KCCA 2XUBA 3OYDA 2V1UA 4CCKA 5EF6A 4GRIA 1A6QA 2PG4A 3ZQFA 1ZG5A 4AYBN 3F8CA 4QTRA 1JJ6C 3PSIA 1MBKA 1T2KA 1ETOA 2A61A 2GIZA 1QPMA 1RI7A 1D8JA 1XGSA 1IXRC 4XKWA 4P9UA 2ZFWA 1UFMA 1QVUA 4JQFA 4Z2YA 1PJRA 1UCRA 2R7OA 2XAUA 2EFPA 3KLNA 3N05A 3HGYA 2PX9A 5HNFA 3BROA 5FFZA 3JSPA 3ZQCA 2BY2A 2AXTC 3LSJA 4JOMA 2HNHA 1AWCA 1WPKA 2YU3A 1JHFA 1NG6A 1BA5A 4XRFA 2ECBA 3LSRA 4YIIA 1UMQA 2KT0A 3KP7A 1VQNI 4BQAA 4EVIA 2W48A 2V6EA 3I58A 1DP3A 4RM2A 3NRVA 1LE8A 2DDBA 2DN0A 1FSHA 4ITVA 4A3LJ 1Y8RB 3RI4A 3S3OA 3H92A 2R7VA 2JA5J 2AHQA 3PSFA 4B47A 2BOLA 2M8EA 3BQYA 4M73A 2B0LA 1BM9A 4AU7A 5GTHC 3HDDA 1DQUA 4L5EA 4BXFA 2P4WA 3OOPA 2VT2A 1D0ZA 2A6EF 1ZLKA 1FMWA 2BY3A 4A5NA 3GTKJ 3X2QH 5M5XJ 3DU6A 3DLAA 2E7XA 2KMUA 2QF7A 1R6RA 3OYNA 2EV6A 3GFJA 4UV8A 4XLEA 2DBBA 2VL8A 1JTXA 3ZQHA 3QYEA 2IXSA 1DGWY 2ETHA 3ZP5A 4DBQA 3GWZA 3WTVC 1UHMA 1BR2A 5IP9J 3Q9SA 3S3NA 1RIOH 1QPIA 3I4PA 3IH3A 1J9IA 4OMZA 2JJ7A 3VSLA 5F27A 4BJ6C 4BUPA 2FQ3A 1O57A 2DPDA 3G1OA 1H9GA 2JA8J 1YRNA 3GTLJ 1V3FA 2EB7A 5J40A 3CP2A 3OYLA 1QRYA 2PBIA 1FLIA 3B02A 2V9VA 4YFXF 3HIFA 3J7ZI 4J00A 1OJLA 4E7LA 1MH3A 2VJ5A 4IQJA 2R7TA 3REOA 1RR7A 5B1BH 2HXIA 2ZXIA 3FWEA 5B3SH 2HZDA 5FLXK 4MIMA 4PGHA 1KONA 1FPQA 1Z6RA 4DZPA 3V8KA 2PJRB 2K40A 4HPQA 4HV5A 4AVZA 3VSKA 3K2AA 1VFCA 1W5TA 3L9FA 3TW7A 2ZXWH 2OTLI 1T08B 2J5OA 3H9JA 2XB5A 1VQOI 2P8TA 1E3OC 3HHHA 1WI9A 3S1RJ 3WG9A 4BJ5C 1WJ5A 4Y17A 4NC7A 2H27A 2LD5A 3HPGA 2MW8A 3C7JA 3M3YJ 1JUPA 1HSTA 5FKMA 1I50J 3IWZA 1JKOC 5AONA 2GM4A 3T8RA 2M4KA 3EYIA 4XNFA 2M45A 2LLKA 3QP6A 2HDWA 4PDKA 1DUXC 4GCVA 3CD6I 5LHIA 1TL8A 2CUZA 3C3WA 4D7MA 4ENNA 1XGMA 1FJLA 4D0PA 3RQIA 2IRFG 2V9PA 1XSDA 3K4BA 3PIPF 2O0YA 2QSHX 1W5SA 3PL8A 4KIBA 2KDOA 2W1OA 3BG9A 4N4NB 5D5UB 1HOMA 3L2WA 2K9SA 3ZQQA 1G3SA 1BW5A 2FX0A 3KYDB 2K3PA 2JPCA 3JR9A 2CO5A 5IOYA 3K4KA 2DT7B 2HOEA 5EDNA 2L02A 1B9MA 1VTNC 4JX4A 3CCEI 2LKXA 1HXDA 3D0SA 4IPAA 1HW1A 1R5ID 3TQNA 4E7KA 3FXUA 1Z0XA 1XCBA 4G6TB 1RC9A 3FHZA 2VI6A 4ZC3A 4CCJA 4DGWB 3F0CA 5IT3A 4E7IA 4P9FA 5L3DA 4V2GA 2HVSA 2L0KA 2CUFA 3VYRB 2R92J 2W25A 2GXGA 2LMDA 4EM0B 3GTJJ 4A3JJ 2LFBA 2IBDA 2OBPA 3CLQA 3OS1A 2O7OA 3NARA 3F6VA 5J1YA 2HTJA 4GXOA 1B6AA 2STTA 4ZYGA 4E7HA 1SEUA 4IL6C 4EQQA 1BI0A 3JRIA 5CVRA 3WGIA 2HYJA 4M6VA 1PUFA 4KIFA 4XLFA 3QQAA 3RPUD 4D1QA 1Z3YA 3QOEA 4E7ZA 2R0QC 2GA1A 2M0CA 1Y0UA 4U88A 2L7MP 3P9CA 2F5DA 4KYWA 5CJ9A 2EZKA 1OYWA 2WADA 2Y48A 3MKZA 3VWBA 5F0HA 1K6OA 1AHDP 2RC4A 1NK2P 1BIAA 3S1QJ 1D1CA 4AIHA 1V4RA 1X1AA 5AIQA 3CCJI 3MVPA 2O9LA 3BCAA 4LG3A 1PDNC 1Y8QB 1O4XA 4EM2A 3EUHA 2DJNA 2GZWA 2EJRA 2LP0A 2DA6A 3QPLA 4HYEA 5DD8A 3T8TA 2OA4A 3H5AA 2CGPA 4ZDLA 2VC0A 1F43A 1SANA 2NS0A 1MD0A 2ID3A 3F8NA 4H0EA 3GVAA 5ICCA 3BWGA 3G1LA 2VXZA 3IAM2 5CVIA 1USTA 4U7BA 1YJWI 4BHCA 3HOSA 2COBA 4BXXJ 2PMZN 3DKWA 4AIJA 2XASA 1SAXA 3HUGA 1A5JA 3LWFA 3MQ0A 3S8PA 3VYTB 1O3RA 2Q2EB 5L3CA 2E1CA 2F5FA 4A5MA 3CJTB 5K7HA 1J0RA 1MKMA 3WGGA 2IT0A 3BQZA 3VYUB 1D8KA 2OD5A 3K2ZA 3EETA 2HFHA 2VBXA 3EUHC 1VQPI 3I55I 3KFWX 3S1NJ 3FXJA 2DA4A 4IVNA 5D8KB 3NQOA 4PJJA 2BW3B 3FM3A 3O6BB 2LSOA 1FIPA 3CUQA 3TMOA 4A3IJ 1RPWA 3TO7A 1F1ZA 4XSXF 1HBXG 1GLNA 3KE2A 4CCMA 4X6AJ 2M3AA 3CCQI 1Z9CA 2EQRA 1LJ9A 1JT6A 1VNDA 2H6BA 3RCOA 3WU2C 1U8BA 4ZJZA 3I9V2 3HRUA 1E3PA 4IRHA 5ED4A 4M6YA 5CQEA 3H1CA 3MD2A 1GHCA 2HS5A 1XDUA 4LK1F 2XGEA 1I3AA 4EEFG 2JA2A 1ZARA 5E17F 2VQGA 3B73A 3GFLA 2NVXJ 1ETQA 2RREA 2H6CA 4NNJA 2F5CA 3CUQC 3CDLA 1ZQ3P 3IWFA 2ECCA 1IN8A 5E8GA 4XOTA 3AL0B 3K69A 1TT5B 5K5RA 5F08A 2YPRA 1XN7A 2DQRA 4S05A 4ZZLA 2E1NA 2QLZA 5JVTA 2ICWG 3AG4H 3S2WA 4UNOA 4UHTA 1X4PA 2CFOA 5HS7A 3IRRA 2CQQA 3F6OA 1KU2A 2VONA 3DBRB 2L3DA 3KX2A 2BV6A 1RKTA 2W00A 2Y69H 4JK1X 2PFBA 3I56I 4DBRA 1FY7A 1SFEA 2K9MA 2FEZA 2V4JC 1OCZH 4Y7NJ 2GOXB 4RS8A 3WTTC 3H5RA 2ZO4A 4N9IA 2LY2A 3L00A 4MLOA 4E7JA 2QZ8A 3BY6A 1IRGA 3D1NI 2LOOA 2V26A 4XKVA 4BL0B 2V7FA 3G71I 3L09A 2KDZA 2O6GE 2XB0X 2HI3A 3E97A 3AG1H 3MAJA 1FMVA 3ESWB 2HGCA 3F8MA 2IEKA 2VJJA 2JRMA 4CO8A 3W6KB 3I0TA 1YI2I 1OCOH 2IGOA 3OYAA 2DYRH 4RGRA 1E17A 2KRFA 1SFUA 3PNTA 5M5WJ 3W3CA 1J75A 1OCTC 1Z6TA 3ZQIA 4G7HF 3PIOF 4Q48A 4BQQA 3CQZJ 2BGCA 2D1VA 2DW4A 4KISA 2ACJA 5CPRB 4BQNA 2CU7A 4Y4RA 3OYGA 1FSEA 3QWLA 1OFCX 2CSOA 3A0HC 2FXAA 1I5ZA 5HLIA 4LB5A 1RESA 1ON1A 5DDGA 4RMNA 3JRHA 5EGOB 2HR3A 2XAFA 5A2QZ 4YFNF 1R9TJ 2AO9A 5J6XA 1XS9A 4BACA 1WH5A 1QZEA 1OCRH 3BR3A 1X3ZB 3LMMA 3SEQA 2WC2A 5C4JJ 5FD6A 5J8FA 4JX6A 2HQRA 3GFIA 1LEAA 2XSDC 4IHVA 2PI0A 4IOCF 1VQMI 3ZPLA 4MQ9F 5LRRA 3K9TA 5K5OA 3S16J 4CDGA 2R5ZB 3O8HA 5LEKA 1FNNA 2KIUA 3ZQLA 1R5GA 4A3EJ 2ZSHB 1X2MA 3JSOA 3OYJA 1IUFA 2MGQA 3K70D 3TO9A 1FBUA 2H8RA 4HX4A 3BDDA 4NC8A 1N75A 1J7KA 2WA0A 5FFXA 3J81Z 4KNYA 2ZMEA 2C6YA 4WK8F 2YU9J 3BPVA 3CCMI 2OQGA 5DEQA 4U0YA 4I76A 4GO1A 5IOZA 2CQXA 2LRDA 2PJPA 2MYSA 3KP5A 1U5TA 1VQLI 4DYRA 4LMYA 4B3AA 2DMTA 1UHSA 3KPHA 2K7LA 3D5SC 5M3MJ 1Z3XA 3KP3A 1KU3A 1XC5A 2W57A 2Y2ZA 4MGRA 2L5QA 5HOOA 3PM1A 3BJOA 5DM7F 3HSRA 4PGGA 2Y9ZA 4OAZA 2NVTJ 2DA5A 4MHGA 5LHHA 4OIRF 2IA2A 1R22A 2QCOA 2WAFA 4B09A 3CF5F 3QODA 2HEOA 1HC8A 3GTQJ 5J1UA 2DOEA 4M6XA 4IKFA 3F8FA 4HSTA 2H8WA 2E2JJ 3FDYA 5IP7J 2TCTA 3TDZC 1U5TC 3H35A 3LFKA 2VE9A 2AQFA 5JR3A 1D0XA 4L0YB 1R4NB 1W7PA 1POGA 3IV5A 3H9QA 4U87A 4CZZA 3N4MA 4HAMA 2QA4I 1REPC 2JVGA 1K4TA 5E3OA 3I53A 3F22A 2CUEA 4EATA 2PJRA 2I5UA 3BC8A 3E7LA 2V6CA 5FROA 2IGMA 5HVQC 3BG5A 5BPDA 2HYFA 3FBIB 4P1WA 5HNHA 4L18B 1VQ6I 1SVLA 4HX7A 3ABUA 1KU7A 2M34A 2EFNA 3PO2J 2H1LA 5FLVA 2R7ZJ 2HOSA 2GIVA 5E3MA 1XCVA 2P7VB 2TDXA 4HOBA 3LSTA 2OJED 4RGSA 3HOYJ 3G6EI 4DOZA 2LY1A 1XB4A 3RPQA 4QPOA 3V7RA 4L9NA 4XM3A 1A31A 1MMAA 5ILUA 1W0TA 5CVUA 3MCZA 1S9HA 2DT5A 4HLXA 4ESJA 2M8GX 2JQ7A 2L4AA 4HA8A 5E18F 2F5EA 3TEDA 1NH3A 3KETA 3SFZA 5DTDA 1P7IA 3E0JB 3OWTA 4WX9A 5EZGA 1H89C 3E3VA 2DFFA 2F5VA 4AIDA 1MSEC 2XDVA 4M3EA 4NB5A 5FJ8J 3DKXA 1KQ8A 2DOFA 3VYSB 2DPUA 3Q0VA 3FK7A 4CCOA 1MMSA 5D4RA 1XMAA 2OCCH 3M8JA 2VKHA 3E5XA 2X1DA 3A01B 1Y39A 2L7KA 2DK8A 2KJCA 1G2HA 3E6MA 1HF0A 1HA8A 1LDJA 2VIXA 1SMTA 4IRIA 3JREA 2HOAA 2VUMJ 2NS7A 5LD2C 3GCMA 2M4GA 2ELJA 3LAPA 3SDBA 1BW6A 2RDPA 3EUKL 3T0YA 4QIWN 3ABMH 4PK4A 4ETSA 1N78A 1CQTA 4IJAA 4Y33A 3S3MA 3UKGA 3QP5A 4CA0A 1BI2A 4EJOA 2XROA 3BT9A 2MG4A 5HLHA 2FMLA 3F21A 2MFZA 4A12A 3C1DA 4OIQF 3J81K 1USSA 2VQLA 2XAGA 3KEYA 4BKXA 3MZHA 4PFOA 3DEEA 4A3FJ 1I6XA 3VFZA 2WV0A 2CS3A 4HNVA 2QWWA 5B66C 1HKTA 1FZPB 2WB1A 1BOAA 5DCMA 1WFXA 2EH3A 4ZZDA 2FA5A 1ETVA 4KA4A 4UUTA 1K79A 4PCQA 1I3QJ 4J19A 2OCEA 3VODA 3DXJF 1MDMA 3K4MA 4DQ2A 3IHUA 2HXOA 3J80Z 1AKHA 2YX4A 2JRTA 3KYCB 3GZNB 4TV7A 5GPAA 3QU3A 4MO7A 5LRSA 2FSWA 4UVBA 4EJVA 4BHPA 1B4AA 2LBFA 4H4KC 1YITI 1ZR4A 1VI0A 2K86A 3MZYA 2QVOA 5IY5H 2KRHA 1ZG1A 1J59A 4KT6A 2RNJA 2DK5A 2X6XA 1NTCA 1HW5A 5JHUA 5M5YJ 2R93J 2NYXA 2OZUA 3W6VA 1K83J 5E3NA 3WTSC 5FLMJ 5DM6F 2E36A 3FXKA 2E60A 2R7RA 5C3EJ 2H94A 3W2VA 2MBFA 2ESNA 1LPQA 3JW4A 3BTJA 1X58A 2X6YA 2NAZA 2QQ8A 1FYMA 4FISA 4M9XA 1ZGAA 3TO6A 4HNUA 4O3MA 2X1EA 3QPSA 3CC2I 5FGMA 2L9NA 3HKZN 2A05A 4IEJA 5F1JA 5D5VB 3ABTA 5HLTA 3OS2A 3CCSI 1OLTA 3RIRA 4AUXA 1GXPA 4XIDA 3HC7A 1VZ0A 4HG2A 5M3FJ 2NS8A 1TBXA 2CQ7A 2OV7A 5K1YA 2FJ1A 5FKLA 3P5JA 2RV8A 1YTYA 2LH9A 2W82A 4HEA2 1IAWA 5IYDJ 2XAJA 1T33A 4XMYA 1VQ9I 1XGOA 2JVHA 3KZIC 4YIRX 4YG2F 4XSZF 2ZKZA 1MNMC 2IA0A 3PJRA 2V1DA 2ZCWA 1MJ9A 2K4BA 1G3WA 3K7AJ 1FTTA 1QZYA 3KZYA 1K78B 1A36A 3DWLE 1S5LC 4UB8C 4XRSA 3OYMA 2KRCA 2BEOA 2IGKA 2QSFX 1YX3A 3HPHA 2QBYB 4U7DA 3CC7I 3L1PA 4UUSB 2ZJRF 5FKNA 2PMUA 2XGDA 1O7FA 2IW5A 2KJBA 1FOXA 4JYKA 5DS9A 3LAJA 3LSHA 1VQKI 1OYIA 4HLYA 4ZDPA 2VE8A 3MEXA 1OKRA 2CUJA 2Y75A 3RSNA 2MLGA 4Q47A 4WF2A 2F4IA 3LSIA 2PQ8A 1X19A 3FXOA 1PUEE 4A93J 2QKMB 2LR8A 6PAXA 2DAOA 1RETA 1G3TA 2GA2A 2XHKA 3ONQA 4C9YA 4N9HA 5IPAA 4XKCA 4A3MJ 4NC6A 3OOUA 2VKEA 1C0WA 1JTYA 1MMGA 2V1NA 2Z5UA 1RR8C 3WTXC 1PYVA 3K70C 1R1UA 2H09A 1V55H 2CW0F 5KK1A 1H8AC 3TL4X 3DFGA 4RAGA 3IKTA 4I02A 2DMPA 1J5YA 1P92A 3T1BA 3IRQA 3BR1A 2VODA 2VBYA 4AC0A 1R00A 1TWGJ 4BE0A 1ZR2A 2J5PA 2EIJH 2XAHA 3JCUC 4GYGA 3HHGA 3NWSA 3TKYA 3Q0WA 4W97A 2BY0A 4ZYEA 1BN5A 2CW8A 4OIOF 4CZCA 3WODF 2D45A 1XSXA 2Z3YA 5TGTA 1TC3C 4HF2A 1FX7A 4O6JA 3J80K 3I54A 5FRMA 3S17J 1TWFJ 4HDVA 1FEXA 3SXYA 2PMHA 3ZN1A 3OYHA 3IH4A 3S2DJ 3GUDA 1Y1WJ 4HX8A 3KP2A 3JRAA 2R7SA 3P9IA 2P7CB 3FMQA 1TQMA 2YS9A 1E0EA 2F2EA 4ZDOA 1HDDC 1MH4A 1R49A 5GPCA 1FYKA 3H9GA 3QYBA 4FT8A 3OV8A 1QZZA 2QKLB 3IC7A 1WI3A 2O5RA 5TRDA 2XKOA 3E6BA 5EGOA 2RAEA 2E7WA 4R8HA 1MSFC 4PUSA 1B72B 2HQAA 2M0MA 3TOAA 2TRTA 1Q1VA 3HG9A 3RKWA 2QUFA 1SC7A 1KYZA 1VQ7I 5E8IA 2ZNZA 3PUFA 2GAUA 2BZTA 1TTYA 3ULQB 5H6QA 5EEAA 2R5ZA 3I59B 2FBIA 3TP0A 3M1EA 4C30A 2QQ9A 4M3GA 1MBFA 4XL9A 1YLFA 2KP6A 2FE3A 1OR7A 2XAQA 2VASA 1IXCA 5LGNA 4PJMA 2JUGA 2F6CA 2LF8A 1RZ4A 2KFDA 3ASOH 3F9KA 1JKRC 1BC7C 2E2HJ 5KHDA 1JUMA 1U0JA 2JTVA 4PJLA 3ZCOA 5K7FA 4WWCA 4F91B 4XN0A 4LLNA 1ETKA 2QGUA 3CF2A 1FP2A 4NQWB 5HLGA 1HCRA 2FBKA 3CUOA 1B8IB 3OL4A 4BQOA 5E3LA 3ECOA 5KCMA 1OCPA 4NUBA 1CF7A 2R5YB 3BTIA 2EA4A 3I4NJ 2K27A 1ZHFA 1W1WE 3T5XA 2EFOA 1OR7C 1Y6IA 4AD9A 2F4MB 3L2VA 3CMEI 4CHUA 1XMXA 3FMRA 4LG0B 1XMKA 2Q1ZB 3FKJA 2LF7A 4A6EA 4ESBA 1AU7A 1VQ4I 2OAZA 2B7EA 2K9LA 3A1YA 3EQLF 4A3BJ 2MLKA 5D6FA 1Z77A 5BPIA 3PQKA 2A5WA 1V54H 1SD6A 4OINF 1R71A 2MD5A 2QQAA 2WAQN 3G2BA 5EG0B 3HGGA 5GTIC 1XX5A 1L0OC 2A3SA 2CJJA 3CMMA 1TZLA 3AG2H 3HSEA 4XICA 2H1KA 3HB9A 3EUAA 2VPLA 2COMA 3BR2A 2JSPA 4HRIA 1WVRA 2HOTA 2N8GA 1F5TA 3H5NA 4PJ0C 2ZJPF 3WG7H 5EJCA 1YX5A 2P0WA 2XPWA 5ERIA 3LA2A 3U9GA 1V5FA 3FXLA 5HODA 2R7QA 2L54A 1EA3A 1ENHA 4MEXF 3ZN0A 4HNTA 2PEXA 3SDGA 4GFBA 4E70A 1E2XA 3ZQGA 2VKVA 2VOOA 3I64A 2XGCA 3ZQ7A 4D5CA 5K5QA 1D5VA 3B6AA 2BYVE 2Y0SA 4WCGA 4ZYAA 5E20A 1QVTA 3H3ZA 1LFPA 3ZMTA 4M3BA 1LE8B 1ACIA 1U6GA 4A0XA 4BAYA 4XRSG 4IOAF 4F7ZA 4LGWA 4LLLA 4JP0A 3WTUC 1TWHJ 4IXAA 5AIPA 3HTUA 3IAS2 3SQNA 1OYYA 2ESHA 2HWVA 2ID6A 1SAUA 3OIQA 4S04A 2NNNA 3CCVI 5KNLA 2KZVA 3A01A 3K6GA 3CTAA 1D0YA 3DPLC 2P81A 4ON0A 4B48A 4FX4A 3RZOJ 5GAHJ 1TLHB 2VPRA 2F48A 4XQFA 4QSHA 2YUSA 5H6RA 1MZBA 1YHQI 3DTKA 4BGDA 4ANJA 4DJAA 3MZ8A 3F72A 3M8EA 4F3QA 2V9KA 4GGGA 4L9VA 3ERED 4RGUA 5D6EA 1S3JA 2G0EA 1OPCA 3U1DA 3L2CA 2JMWA 2ZBKA 3M7GA 1NK3P 3BG7A 3B6CA 1G59A 2DU9A 4UVCA 3H0DA 3ERMA 2OU2A 3HOXJ 4AWXB 3L7WA 5FB2A 4HQMA 2XRNA 4FX0A 5F0CA 3OL3A 2DDAA 1YRNB 1UZCA 4OOIA 4RB1A 1IG7A 4I2OA 5CKTA 5LGUA 5EEGA 2ZFUA 4LK0F 2KHMA 4GDFA 1LVAA 1XD7A 2XPUA 5KAIC 3L2RA 1LFBA 1R4MB 3BR0A 1IN7A 4G8XA 2FU4A 4JBAA 3M1CA 2Z1DA 1FOWA 3OSGA 3O2PE 4M9ZA 1QQIA 1IXSB 3H36A 3GO5A 3HL2A 4CCNA 5E1XA 3S1MJ 5F04A 3ISPA 4E7SA 3L2UA 2M30A 3V8JA 4FE4A 1BC8C 4M9SA 3HOWJ 2DFIA 3J7YJ 3CESA 4AYBA 3JRFA 3BPXA 2XKPA 1ZG3A 4YELA 1K4SA 3QPHA 3GBGA 3DLLF 3G4SI 5TISC 3GYHX 3K4NA 3BTCA 2GOMA 2IAIA 1SVMA 2RGVA 2YX7A 1W0UA 4DYQA 2VT3A 4IHXA 3JTHA 3CMAI 1IN6A 3OYEA 1ZRDA 3DEUA 2BHZA 1RUOA 2E1MB 2DA7A 2LDUA 1YS6A 5TJJA 2GQQA 2VKDA 3HXLA 1GV5A 1P9QC 3DU5A 2R4GA 1G3YA 2Y30A 2Q8KA 1LVKA 4DZJA 4E6KG 5GP9A 1I6HJ 1K6YA 2A69F 1WJEA 5D8LB 2K4JA 3TBIA 2MSYA 2CV1A 2XF5A 1U2WA 1W4MA 3DBHB 3K4CA 1T98A 2XGXA 4IHYA 3LQQA 3GX4X 1BI3A 2AXLA 2JA6J 4M74A 4RDUA 1YO5C 4BY7J 4BXUA 1X1DA 3KP6A 3A4CA 2XV4S 1YYVA 3FBNB 5FRNA 2KLOA 1O3QA 4P5OA 2CH0A 5IP6A 1HQCA 1XPXA 1ETWA 5F6FA 5GADJ 2UXXA 1LQ1A 2O03A 3IP4B 4BEHB 1QO0D 1X1PA 2XPVA 1YW8A 3BOQA 3LL7A 2HDCA 2IA1A 1LNWA 4IRGA 3LNQA 1K78A 1WJCA 1S7EA 4OAYA 3CCLI 1NG7A 3IKVA 4F52A 2BXYA 2LREA 5J3LA 1ZN2A 3SYTA 4A0ZA 1I39A 5FKOA 3CCRI 2ZSIB 3LA7A 3M4OJ 2K9NA 4QLCU 4IHTA 4N0BA 4EM1A 1Q1HA 3G3ZA 3SJMA 1JXSA 1R23A 1ZK8A 1PUFB 2KQRA 1SMYF 2LNBA 5BQTA 3RPUA 4I0AA 4B1RA 3VDXA 3R4KA 3SHFA 3Q0UA 1W5CC 3SZPA 5ILVA 4IQ4A 3COAC 2WAEA 1YJNI 3LSPA 3BCBA 1LFUP 2MC4A 2YR2A 4EGYA 2VC1A 1PP8F 5CVJA 1BIBA 3KP4A 1DU6A 1SD4A 4UUVA 4CCLA 1KQ9A 3ELKA 5HDKA 2BVMA 1ETYA 3DV8A 2CV0A 3ZXSA 4M3FA 3MMYB 3WU1B 1T95A 2KZGA 5JFRA 3E1SA 3LSMA 3GMEA 4IO9F 2MA3A 1YW7A 2K3FA 4XK4A 3HUGB 3WHCA 4MTEA 2HQNA 4M3DA 4LJZF 4PSWA 3DTIA 4LD5A 3EDPA 2M2EA 2L9SA 3TGNA 4ZTJA 3ROUA 3ASNH 1SFXA 1ZREA 2VQHA 1V5GA 2PLYA 3JRDA 2L2OA 3ZMDA 4CGZA 4ZYDA 1O7LA 1YIJI 3KEOA 4MNUA 2QEXI 1IW7F 2DA1A 2VBZA 1XGNA 1G8XA 1QBJA 4NDLA 4EJUA 3HEFA 2B63J 3UNGC 1X1BA 1P4XA 3IUOA 3CUQB 4LIVA 2NXNB 3VEPA 3I4MJ 3LA3A 3MWMA 1JGSA 3QRFF 1WJAA 4ZH4F 1FC3A 1ULYA 3SFIA 2EZIA 1LB2A 3KLOA 3BLYA 2DQLA 4RM3A 1DDNA 2VLAA 2DMNA 4LITA 4CUGA 4BJTA 4RBOA 4RAFA 1MGTA 2I8DA 3V42A 3OYKA 1JHHA 3S14J 3M9AA 2UXNA 1IRZA 4CXFA 5D5WB 4RLQA 2DA3A 1ZH5A 4UXNA 3I3LA 1VF9A 1YFHA 4RB0A 1X2NA 2ZNYA 5K7ZA 1UB9A 4LLGF 1P7JA 4RB3C 4K2EA 1STZA 2XRLA 3BR6A 5CLSA 3CLOA 2L7FP 2ZB9A 1FOKA 1GVJA 1XSVA 3E6CC 4U0WA 1A6IA 1I1SA 2BY1A 2GBYA 1D3YA 2X48A 4X1EA 2EBIA 3CZ6A 4LIUA 3FIWA 1GVDA 1ZKGA 3ZR8X 4ESFA 1QHHD 1T0FA 4CSWA 4XRMA 3W2AA 2NVQJ 1LUJB 4YEJA 1MJBA 2X85A 1QGPA 3G73A 1B59A 3ZGKA 3C2GA 4LG0A 1IDYA 2V1XA 2IS4A 4EMSA 3DPTA 1IRXA 3CCUI 1I27A 3CJRB 3LFUA 1VQ5I 1M1EB 4A6DA 1BL0A 1N25A 3SEZA 4XORA 3UR3C 4II3A 5L3EA 2RVCA 4HBLA 1T6SA 1Y56A 2PMZA 2WY8Q 3AFHA 5L3FA 4DIQA 3MKYB 1T0FC 1UHWA 2ISZA 2M7BA 3GLXA 1FWZA 3GEZA 5C4XJ 3PNYA 4DYCA 3JRGA 2DTRA 1RUNA 2UUZA 3BZCA 2Q2EA 4HV6A 4V2FA 1OCCH 4MQVA 1B1BA 2JA7J 1I1GA 1TWCJ 4X0GA 2A07F 5HS8A 2HU9A 2X0LA 3RKYA 4A3CJ 5FKKA 2W85A 5EYRA 1GV2A 2DODA 1U78A 2F4OB 2EWNA 1XG1A 2KIMA 3RYRA 1Z91A 2BW3A 3J7AY 3BJ6A 1MBJA 1MBEA 1GUUA 2VB6A 4LOCA 4IHWA 2DLLA 3K0LA 3U2RA 1ETXA 3WGHA 3RZDJ 1MBHA 2VOPA 4ENMA 4C3HJ 5JI6A 2AS5F 1J2XA 4MFEA 3OMYA 2D2WA 3R0AA 5GAEJ 2DFEA 2LG4A 3R61A 1YJ9I 3C2HA 4BDYA 3S2HJ 1ZTRA 4RGXA 1APLC 4A3DJ 5FO5A 2R7DA 2R7UA 2D1HA 1IC8A 2O8KA 3WHBA 4XOPA 1FBSA 2EV5A 3V8LA 5BMZA 2ZMEB 4GYIA 2G9WA 2JT1A 3L2QA 2HQ5A 4G6QA 3DEWA 3FX3A 4MFDA 2DMUA 3VOEA 1K7AA 1ON2A 1H88C 1U5TB 2E19A 1ITYA 1ZRFA 1D1BA 3HTSB 2L9RA 3WE3A 4C3IJ 3M07A 1F9NA 3GTOJ 2EA2A 2O61A 2NOGA 1S6LA 2QENA 3FKIJ 4C2TA 4XBFA 2EPFA 2JN6A 2FF4A 1WSUA 2A68F 5BOXA 3WU0A 3GW2A 2DO7A 3P9KA 1WHUA 4HZFA 4V19K 1OQYA 4S0HB 3AL0C 1MIJA 1OISA 3ABLH 1IZ1A 3TW6A 3MFKA 3LSKA 3U21A 4CYCB 3Q5FA 1TNTA 4A69C 3BG3A 3WTWC 2NNYA 3CO6C 2LTPA 2DJIA 3NAUA 1JJ8C 3ZRGA 5ICGA 4C3JJ 4F93B 3HRMA 3E6DA 2E2IJ 1DGRM 2CWEA 1W7PB 2MH2A 2V79A 2CQNA 4PSXA 2NVYJ 4I99C 4Q4ZF 2DTZA 2OF7A 4FCYA 1EH7A 4PZJA 1D1AA 5ICFA 1F36A 4UV9A 1BI1A 1DPUA 1MW7A 2HKXA 2IJLA 2LVSA 3CJNA 2CQKA 1GDTA 3SZTA 2EZHA 5DV5A 1X4OA 2IVMA 4O5VA 1MJAA 2W7NA 4IX7A 1QU3A 1IV6A 1P4WA 4CYDA 1S8NA 2LYCA 1IJWC 1R5HA 4KUMA 1O3TA 3F3XA 2X1CA 3CJQB 2HVRA 3OR1C 3DKYA 4R1HA 2RKHA 4FHTA 5HDGA 4AIKA 3V7SA 3HOTA 2DA2A 1HLVA 3CCYA 2R7FA 1GT0C 2OC6A 3JAMZ 1R1VA 4UY8I 4BYYA 4IZZA 3HJEA 1QHGA 1Z05A 2HYGD 4BY1J 2L01A 3LQRA 1T56A 4OWRB 4KIGA 4WXCA 2DOAA 4XLAA 2NVUB 4OMYA 2GXBA 1FBQA 2L4MA 5KVRA 2VXDA 2BVLA 2A6HF 1A04A 2QQBA 1JT0A 3FXRA 2E1MC 3OYIA 2QM3A 1BJAA 4B44A 4Y3OA 2M87A 1R7JA 2ELKA 5LGTA 5CYVA 3LSGA 4BEHA 1LKXA 1FOYA 2HTSA 1W36D 2EILH 2FBHA 3QYFA 5ILSA 5JVGF 2JUCA 3F8BA 9ANTA 3HYIA 4C2MJ 1B9NA 2B9SA 4Z6YA 4IF4A 3RQ4A 2Y0MA 3HRTA 3K1NA 5E79C 1R58A 2EK5A 3CDIA 2CYYA 4BE2A 1YE9A 2HPMA 1YOVB 1S72I 2KPMA 1T39A 2UZKA 2RQPA 3GLLA 1QNTA 2ISYA 2M9HA 2WB1N 2XF7A 5DCMB 2K02A 1FP1D 1E3HA 1CGPA 4Y52J 2KL4A 4XKBA 2G7HA 5LFAA 1U9NA 4XLCA 1EV7A 3CC4I 2E1OA 2OTJI 1W7PD 3R0JA 1MDMB 3GTGJ 3H3VK 3D5LA 4QPQA 1N77A 2FRHA 2DMQA 1BBYA 4HW0A 3HSFA 1AKHB 4BE1A 2LK2A 5LBQA 1JUSA 1G4DA 2BBYA 5LHGA 4Y13A 2HPIA 2E5NA 2STWA 5L3GA 5IYBJ 2BXZA 5F64A 1XDSA 4YIFA 2LBFB 1S7OA 5EEHA 5HDNA 1UAAA 2IPQX 5IYCJ 3DPUA 3ECHA 5DUIA 1A35A 2QYOA 4FETA 5F1RA 4G6DA 2LC2A 3R6SA 5JLXA 4Y15A 5C44J 3GTMJ 4I6ZA 4BBRJ 2LKSA 2UWMA 1WRJA 2JZYA 4KICA 1YIOA 1S29A 1TP4A 3DCFA 2HZTA 1ORKA 3A02A 1TWAJ 4KMUX 1T8IA 1ZRCA 4F55A 2X6OA 4I7HA 3FISA 5D4SA 4D7NA 2BHYA 1DP7P 4B8XA 1IGNA 2Z33A 1RKWA 1WJBA 3E5UA 5J4YA 4KJZA 1JKQC 3OIOA 1KGSA 4ABZA 2ZJQF 3I71A 1T38A 2D5VA 1FTZA 4OIPF 4G9YA 3MKWB 3KIOA 1UG0A 3OR2C 4KT5C 4B4CA 4FTHA 3KZZA 1L3LA 2Z9OA 3ZMVA 1IN4A 2FNAA 1JKPC 1H0MA 2X6WA 3BG6A 4BDZA 4FQGA 1ERDA 1SD7A 1DU0A 2P5LC 3GTPJ 5IT9Z 3QOPA 1FYLA 1WGXA 4HQEA 1FIAA 1ZYRF 2ZJ2A 3HOUJ 1TW3A 4RAYA 2MH9A 4RA2A 2P5VA 2CV2A 3HBLA 2ZC2A 2RQQA 3JAMK 1UJ8A 4U0VA 1G6NA 1IO2A 3G1MA 1X3WB 2W84A 2PN6A 2VQCA 2CMPA 3CO7C 4KITB 3RTRA 4XLNF 1Z67A 3NWTA 2W24A 4HF1A 3DQVC 4A3KJ 2MC3A 1IRFA 2CW7A 1V5EA 3S93A 2VBWA 2IS2A 1WJDA 5DD4A 3OS0A 2Q0OA 3DF8A 2E35A 2OZ6A 3BP8A 3A0BC 5J4VA 1O3SA 2WY7Q 5JLWA 4BBSJ 1TNSA 4WXHA 2L9VA 2IGNA 4IHSA 2K5CA 1SFOJ 5GAGJ 4KMFA 4HF0A 1LEBA 2ZXJA 3A03A 1Z7LA 5BNGA 3HM5A 2AQEA 3PFYA 3P7NA 3MKLA 2YSRA 2KKOA 1R1TA 3C18A 3FM5A 2XIGA 1JI8A 3FMSA 1WWXA 3Q3SA 3GZ6A 3CDHA 1HW2A 1YG2A 3BJAA 2KISA 3ZOBA 1S7AA 5E1ZB 5BS6A 3N97A 1KZHA 1EF4A 1BR4A 3Q9VA 1PVEA 1NHAA 3U1KA 4AVPA 2HVQA 4L0ZB 1U3EM 1ZGJA 4CH7A 2FMYA 5L3BA 4A3GJ 2MD0A 3S32A 2IS6A 2KIQA 1WKMA 1TQPA 5EZHA 2Y9YA 2FUG2 1X3UA 1RRJA 4KN4X 3TDUC 3PQJA 3D5RC 3K1PA 1IV8A 3MN2A 3QU6A 1HKQA 1ZLJA 3BTLA 5ICEA 2DXIA 4YFKF 1AA7A
chains in the Genus database with same CATH topology
3IH2A 4A93J 1O4XA 4RBOA 2DJNA 2LR8A 2LP0A 2DA6A 3QPLA 1RETA 1IDZA 5IPAA 2I10A 4A3MJ 3S14J 1F43A 1SANA 2ID3A 1IRZA 1Y1VJ 3OOUA 3G1LA 2DA3A 2VKEA 1JTYA 2COBA 2PMZN 1VF9A 4BXXJ 1X2NA 5K7ZA 1P7JA 2XRLA 3VPRA 1H8AC 3CMYA 3BR6A 4W1UA 1A5JA 2L7FP 2ZB9A 2DMPA 1A6IA 3BR1A 4AC0A 1TWGJ 1ZR2A 5K7HA 5J1RA 2GBYA 3BQZA 2X48A 4X1EA 2EBIA 2ME6A 2JWTA 3FIWA 3Q0WA 4W97A 1GVDA 1ZKGA 3S1NJ 2K9QA 2DA4A 3TP3A 1TC3C 4XRMA 3S17J 3JRCA 1FIPA 4UUSA 4A3IJ 1TWFJ 3JRBA 2NVQJ 1FEXA 1RPWA 3IH4A 3S2DJ 3LOCA 1Y1WJ 4X6AJ 3JRAA 1IDYA 2L7ZA 2YS9A 4JX5A 2EQRA 1JT6A 1VNDA 2OPTA 1MH4A 1HDDC 2GLOA 3H0GJ 5GPCA 1U8BA 1BL0A 2EZLA 1WI3A 2XGEA 4EEFG 5EGOA 2RAEA 1ZGWA 2NVXJ 1ETQA 3CDLA 1ZQ3P 1WH7A 1MSFC 2ECCA 3HOZJ 5C4XJ 4DW6A 4DYCA 1B72B 3JRGA 2TRTA 1Q1VA 5F08A 4V2FA 4CYCA 2CRGA 2JA7J 1TWCJ 2CQQA 5EEAA 4A3CJ 2R5ZA 5FKKA 5EYRA 1GV2A 3TP0A 1U78A 3S15J 1RKTA 1XG1A 4M3GA 1MBFA 4Y7NJ 1HDPA 1MBJA 1MBEA 3FK6A 1GUUA 4MLOA 4LOCA 4IHWA 1WCMJ 3D1NI 1ETXA 1JKRC 2X9DA 3RZDJ 1MBHA 2E2HJ 4C3HJ 1JUMA 5K7FA 3C2BA 5F0FA 2KDZA 2XB0X 4MFEA 2HDDA 2HI3A 1ETKA 2FQ4A 1HCRA 1BJZA 2IEKA 1ZTRA 3S2HJ 1APLC 4A3DJ 1B8IB 5E3LA 1OCPA 2R5YB 1IC8A 2O8KA 3WHBA 3BTIA 3I4NJ 5M5WJ 1OCTC 2Y0SN 3ZQIA 2HQ5A 3BR5A 3DEWA 3PO3J 4MFDA 1B72A 3CQZJ 2DMUA 1AU7A 2FD5A 1H88C 2CU7A 4A3BJ 2E19A 1Z77A 1ITYA 1OFCX 2LY9A 2L9RA 4C3IJ 2WAQN 3GTOJ 5EG0B 1RESA 2NOGA 3HGGA 3JRHA 3FKIJ 5EGOB 2JN6A 1R9TJ 2AO9A 2CJJA 1XS9A 1K61A 4XICA 2H1KA 3HB9A 3BR2A 4S0HB 1WH5A 3RKQA 3BR3A 2HOTA 2N8GA 3TW6A 4CYCB 4A69C 3BG3A 5C4JJ 4JX6A 2LTPA 2XPWA 3NAUA 1JJ8C 1MBGA 2XSDC 4IHVA 5HODA 3S16J 4C3JJ 3O8GA 2E2IJ 2R5ZB 1ENHA 3O8HA 3ZQLA 4A3EJ 1UG2A 1B8IA 3SDGA 1X2MA 4GFBA 1IUFA 2MGQA 2NVYJ 2DTZA 2OF7A 4D5FA 2R5YA 3ZQGA 4FCYA 1JGGA 2H8RA 2VKVA 2XGCA 4D5CA 2WV1A 3B6AA 1F36A 2YU9J 1GDTA 2LVSA 2JK3A 4I76A 1U9OA 5IOZA 2CQXA 2EZHA 1QVTA 2ME0A 4M3BA 1LE8B 4DYRA 4XRSG 4B3AA 2Y31A 4JP0A 1TWHJ 2DMTA 1IV6A 1UHSA 5M3MJ 5EG0A 1XC5A 2ID6A 3HOVJ 1D5YA 2Y2ZA 1IJWC 3PM1A 4FE7A 2NVTJ 2Y9ZA 3A01A 2DA5A 2P81A 4G12A 3OSFA 3RZOJ 2QCOA 2VPRA 3GTQJ 5J1UA 5EF6A 4QSHA 2E2JJ 2DA2A 2YUSA 3ZQFA 4AYBN 5IP7J 2TCTA 1HLVA 3CCYA 4QTRA 1JJ6C 1GT0C 1MBKA 1ETOA 1QVUA 1POGA 2G0EA 3IV5A 4BY1J 2JMWA 1T56A 3HGYA 1NK3P 3B6CA 5E3OA 3ZQCA 3LSJA 3HOXJ 2CUEA 1WPKA 1JT0A 1BA5A 3E7LA 2ECBA 5F0CA 3LSRA 3BG5A 1YRNB 1UMQA 2KT0A 1IG7A 2W48A 2ELKA 2M34A 3LSGA 3PO2J 1LE8A 2DN0A 5FLVA 2R7ZJ 4A3LJ 2HOSA 5E3MA 2XPUA 2AHQA 2JA5J 1LFBA 9ANTA 3BR0A 4C2MJ 3HOYJ 3BQYA 3HDDA 4L5EA 1W0TA 3OSGA 2M8GX 3GTKJ 3S1MJ 5F04A 3TEDA 5M5XJ 4FE4A 5DTDA 3HOWJ 2QF7A 1P7IA 3ZQHA 1JTXA 2M9HA 2WB1N 3JRFA 5EZGA 1H89C 4Y52J 1U9NA 1MSEC 4M3EA 2E1OA 3GBGA 5FJ8J 3GTGJ 3H3VK 5IP9J 1QPIA 3BTCA 3Q0VA 3FK7A 3IH3A 2DMQA 2IAIA 1AKHB 1W0UA 4DYQA 2JJ7A 2LK2A 1JUSA 3A01B 4IHXA 5F27A 1G2HA 5IYBJ 2DA7A 1HF0A 3G1OA 5IYCJ 2HOAA 3JREA 2JA8J 1GV5A 2VUMJ 1YRNA 2Y30A 4DZJA 3GTLJ 2NS7A 1I6HJ 5GP9A 2MSYA 1BW6A 4QIWN 1QRYA 5JLXA 5C44J 1CQTA 3GTMJ 1OJLA 4BBRJ 4I6ZA 1MH3A 3UKGA 4IHYA 1RR7A 3BT9A 2MG4A 3DCFA 2JA6J 2HXIA 4RDUA 1ORKA 3A02A 4MIMA 4DZPA 4BY7J 1TWAJ 2K40A 2X6OA 4BKXA 3FISA 3K2AA 4D7NA 1VFCA 3TW7A 4A3FJ 5IP6A 1ETWA 4HNVA 1IGNA 1RKWA 1JKQC 2XB5A 1E3OC 3OIOA 4ABZA 2EH3A 2XPVA 1ETVA 3LNQA 3S1RJ 2D5VA 4UUTA 1I3QJ 4J19A 1S7EA 2LD5A 1FTZA 2MW8A 3M3YJ 1JUPA 5FKMA 1I50J 4B4CA 4FTHA 2HXOA 1JKOC 5J3LA 1AKHA 2GM4A 1JKPC 5FKOA 5GPAA 4MO7A 2LLKA 1DU0A 3GTPJ 3M4OJ 2K9NA 1WGXA 1FIAA 4D7MA 3SJMA 1FJLA 3RQIA 3HOUJ 1ZK8A 1ZR4A 1VI0A 1PUFB 3HBLA 4B1RA 3G1MA 1NTCA 3BG9A 1HOMA 3Q0UA 5M5YJ 2K9SA 1BW5A 2R93J 2FX0A 3JR9A 3W6VA 1K83J 5E3NA 3LSPA 1LFUP 5IOYA 5FLMJ 1DU6A 4A3KJ 5EDNA 4JX4A 5C3EJ 3BTJA 1X58A 1Z0XA 1ETYA 4FISA 2VI6A 3QPSA 5JLWA 3F0CA 4BBSJ 4M3FA 1SFOJ 3HKZN 4IEJA 4V2GA 5F1JA 2L0KA 2CUFA 2R92J 3A03A 5BNGA 3HM5A 4AUXA 4XIDA 3GTJJ 5M3FJ 2NS8A 2LFBA 4A3JJ 2IBDA 4XK4A 2FJ1A 3MKLA 5FKLA 3WHCA 2O7OA 3NARA 4M3DA 5J1YA 2M2EA 5IYDJ 1T33A 3Q3SA 3JRIA 2HYJA 3JRDA 4M6VA 3ZOBA 1PUFA 1MNMC 3QQAA 1EF4A 3K7AJ 1FTTA 2DA1A 2R0QC 4NDLA 4XRSA 3HEFA 2B63J 2M0CA 2L7MP 2EZKA 3L1PA 4A3GJ 4UUSB 5FKNA 3I4MJ 2XGDA 5EZHA 2Y9YA 4JYKA 5F0HA 5DS9A 1AHDP 1NK2P 3SFIA 3S1QJ 2EZIA 3MVPA 3MN2A 2O9LA 3BTLA 2LKXA 2DMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH2 A;  4A93 J;  1O4X A;  4RBO A;  2DJN A;  2LR8 A;  2LP0 A;  2DA6 A;  3QPL A;  1RET A;  1IDZ A;  5IPA A;  2I10 A;  4A3M J;  3S14 J;  1F43 A;  1SAN A;  2ID3 A;  1IRZ A;  1Y1V J;  3OOU A;  3G1L A;  2DA3 A;  2VKE A;  1JTY A;  2COB A;  2PMZ N;  1VF9 A;  4BXX J;  1X2N A;  5K7Z A;  1P7J A;  2XRL A;  3VPR A;  1H8A C;  3CMY A;  3BR6 A;  4W1U A;  1A5J A;  2L7F P;  2ZB9 A;  2DMP A;  1A6I A;  3BR1 A;  4AC0 A;  1TWG J;  1ZR2 A;  5K7H A;  5J1R A;  2GBY A;  3BQZ A;  2X48 A;  4X1E A;  2EBI A;  2ME6 A;  2JWT A;  3FIW A;  3Q0W A;  4W97 A;  1GVD A;  1ZKG A;  3S1N J;  2K9Q A;  2DA4 A;  3TP3 A;  1TC3 C;  4XRM A;  3S17 J;  3JRC A;  1FIP A;  4UUS A;  4A3I J;  1TWF J;  3JRB A;  2NVQ J;  1FEX A;  1RPW A;  3IH4 A;  3S2D J;  3LOC A;  1Y1W J;  4X6A J;  3JRA A;  1IDY A;  2L7Z A;  2YS9 A;  4JX5 A;  2EQR A;  1JT6 A;  1VND A;  2OPT A;  1MH4 A;  1HDD C;  2GLO A;  3H0G J;  5GPC A;  1U8B A;  1BL0 A;  2EZL A;  1WI3 A;  2XGE A;  4EEF G;  5EGO A;  2RAE A;  1ZGW A;  2NVX J;  1ETQ A;  3CDL A;  1ZQ3 P;  1WH7 A;  1MSF C;  2ECC A;  3HOZ J;  5C4X J;  4DW6 A;  4DYC A;  1B72 B;  3JRG A;  2TRT A;  1Q1V A;  5F08 A;  4V2F A;  4CYC A;  2CRG A;  2JA7 J;  1TWC J;  2CQQ A;  5EEA A;  4A3C J;  2R5Z A;  5FKK A;  5EYR A;  1GV2 A;  3TP0 A;  1U78 A;  3S15 J;  1RKT A;  1XG1 A;  4M3G A;  1MBF A;  4Y7N J;  1HDP A;  1MBJ A;  1MBE A;  3FK6 A;  1GUU A;  4MLO A;  4LOC A;  4IHW A;  1WCM J;  3D1N I;  1ETX A;  1JKR C;  2X9D A;  3RZD J;  1MBH A;  2E2H J;  4C3H J;  1JUM A;  5K7F A;  3C2B A;  5F0F A;  2KDZ A;  2XB0 X;  4MFE A;  2HDD A;  2HI3 A;  1ETK A;  2FQ4 A;  1HCR A;  1BJZ A;  2IEK A;  1ZTR A;  3S2H J;  1APL C;  4A3D J;  1B8I B;  5E3L A;  1OCP A;  2R5Y B;  1IC8 A;  2O8K A;  3WHB A;  3BTI A;  3I4N J;  5M5W J;  1OCT C;  2Y0S N;  3ZQI A;  2HQ5 A;  3BR5 A;  3DEW A;  3PO3 J;  4MFD A;  1B72 A;  3CQZ J;  2DMU A;  1AU7 A;  2FD5 A;  1H88 C;  2CU7 A;  4A3B J;  2E19 A;  1Z77 A;  1ITY A;  1OFC X;  2LY9 A;  2L9R A;  4C3I J;  2WAQ N;  3GTO J;  5EG0 B;  1RES A;  2NOG A;  3HGG A;  3JRH A;  3FKI J;  5EGO B;  2JN6 A;  1R9T J;  2AO9 A;  2CJJ A;  1XS9 A;  1K61 A;  4XIC A;  2H1K A;  3HB9 A;  3BR2 A;  4S0H B;  1WH5 A;  3RKQ A;  3BR3 A;  2HOT A;  2N8G A;  3TW6 A;  4CYC B;  4A69 C;  3BG3 A;  5C4J J;  4JX6 A;  2LTP A;  2XPW A;  3NAU A;  1JJ8 C;  1MBG A;  2XSD C;  4IHV A;  5HOD A;  3S16 J;  4C3J J;  3O8G A;  2E2I J;  2R5Z B;  1ENH A;  3O8H A;  3ZQL A;  4A3E J;  1UG2 A;  1B8I A;  3SDG A;  1X2M A;  4GFB A;  1IUF A;  2MGQ A;  2NVY J;  2DTZ A;  2OF7 A;  4D5F A;  2R5Y A;  3ZQG A;  4FCY A;  1JGG A;  2H8R A;  2VKV A;  2XGC A;  4D5C A;  2WV1 A;  3B6A A;  1F36 A;  2YU9 J;  1GDT A;  2LVS A;  2JK3 A;  4I76 A;  1U9O A;  5IOZ A;  2CQX A;  2EZH A;  1QVT A;  2ME0 A;  4M3B A;  1LE8 B;  4DYR A;  4XRS G;  4B3A A;  2Y31 A;  4JP0 A;  1TWH J;  2DMT A;  1IV6 A;  1UHS A;  5M3M J;  5EG0 A;  1XC5 A;  2ID6 A;  3HOV J;  1D5Y A;  2Y2Z A;  1IJW C;  3PM1 A;  4FE7 A;  2NVT J;  2Y9Z A;  3A01 A;  2DA5 A;  2P81 A;  4G12 A;  3OSF A;  3RZO J;  2QCO A;  2VPR A;  3GTQ J;  5J1U A;  5EF6 A;  4QSH A;  2E2J J;  2DA2 A;  2YUS A;  3ZQF A;  4AYB N;  5IP7 J;  2TCT A;  1HLV A;  3CCY A;  4QTR A;  1JJ6 C;  1GT0 C;  1MBK A;  1ETO A;  1QVU A;  1POG A;  2G0E A;  3IV5 A;  4BY1 J;  2JMW A;  1T56 A;  3HGY A;  1NK3 P;  3B6C A;  5E3O A;  3ZQC A;  3LSJ A;  3HOX J;  2CUE A;  1WPK A;  1JT0 A;  1BA5 A;  3E7L A;  2ECB A;  5F0C A;  3LSR A;  3BG5 A;  1YRN B;  1UMQ A;  2KT0 A;  1IG7 A;  2W48 A;  2ELK A;  2M34 A;  3LSG A;  3PO2 J;  1LE8 A;  2DN0 A;  5FLV A;  2R7Z J;  4A3L J;  2HOS A;  5E3M A;  2XPU A;  2AHQ A;  2JA5 J;  1LFB A;  9ANT A;  3BR0 A;  4C2M J;  3HOY J;  3BQY A;  3HDD A;  4L5E A;  1W0T A;  3OSG A;  2M8G X;  3GTK J;  3S1M J;  5F04 A;  3TED A;  5M5X J;  4FE4 A;  5DTD A;  3HOW J;  2QF7 A;  1P7I A;  3ZQH A;  1JTX A;  2M9H A;  2WB1 N;  3JRF A;  5EZG A;  1H89 C;  4Y52 J;  1U9N A;  1MSE C;  4M3E A;  2E1O A;  3GBG A;  5FJ8 J;  3GTG J;  3H3V K;  5IP9 J;  1QPI A;  3BTC A;  3Q0V A;  3FK7 A;  3IH3 A;  2DMQ A;  2IAI A;  1AKH B;  1W0U A;  4DYQ A;  2JJ7 A;  2LK2 A;  1JUS A;  3A01 B;  4IHX A;  5F27 A;  1G2H A;  5IYB J;  2DA7 A;  1HF0 A;  3G1O A;  5IYC J;  2HOA A;  3JRE A;  2JA8 J;  1GV5 A;  2VUM J;  1YRN A;  2Y30 A;  4DZJ A;  3GTL J;  2NS7 A;  1I6H J;  5GP9 A;  2MSY A;  1BW6 A;  4QIW N;  1QRY A;  5JLX A;  5C44 J;  1CQT A;  3GTM J;  1OJL A;  4BBR J;  4I6Z A;  1MH3 A;  3UKG A;  4IHY A;  1RR7 A;  3BT9 A;  2MG4 A;  3DCF A;  2JA6 J;  2HXI A;  4RDU A;  1ORK A;  3A02 A;  4MIM A;  4DZP A;  4BY7 J;  1TWA J;  2K40 A;  2X6O A;  4BKX A;  3FIS A;  3K2A A;  4D7N A;  1VFC A;  3TW7 A;  4A3F J;  5IP6 A;  1ETW A;  4HNV A;  1IGN A;  1RKW A;  1JKQ C;  2XB5 A;  1E3O C;  3OIO A;  4ABZ A;  2EH3 A;  2XPV A;  1ETV A;  3LNQ A;  3S1R J;  2D5V A;  4UUT A;  1I3Q J;  4J19 A;  1S7E A;  2LD5 A;  1FTZ A;  2MW8 A;  3M3Y J;  1JUP A;  5FKM A;  1I50 J;  4B4C A;  4FTH A;  2HXO A;  1JKO C;  5J3L A;  1AKH A;  2GM4 A;  1JKP C;  5FKO A;  5GPA A;  4MO7 A;  2LLK A;  1DU0 A;  3GTP J;  3M4O J;  2K9N A;  1WGX A;  1FIA A;  4D7M A;  3SJM A;  1FJL A;  3RQI A;  3HOU J;  1ZK8 A;  1ZR4 A;  1VI0 A;  1PUF B;  3HBL A;  4B1R A;  3G1M A;  1NTC A;  3BG9 A;  1HOM A;  3Q0U A;  5M5Y J;  2K9S A;  1BW5 A;  2R93 J;  2FX0 A;  3JR9 A;  3W6V A;  1K83 J;  5E3N A;  3LSP A;  1LFU P;  5IOY A;  5FLM J;  1DU6 A;  4A3K J;  5EDN A;  4JX4 A;  5C3E J;  3BTJ A;  1X58 A;  1Z0X A;  1ETY A;  4FIS A;  2VI6 A;  3QPS A;  5JLW A;  3F0C A;  4BBS J;  4M3F A;  1SFO J;  3HKZ N;  4IEJ A;  4V2G A;  5F1J A;  2L0K A;  2CUF A;  2R92 J;  3A03 A;  5BNG A;  3HM5 A;  4AUX A;  4XID A;  3GTJ J;  5M3F J;  2NS8 A;  2LFB A;  4A3J J;  2IBD A;  4XK4 A;  2FJ1 A;  3MKL A;  5FKL A;  3WHC A;  2O7O A;  3NAR A;  4M3D A;  5J1Y A;  2M2E A;  5IYD J;  1T33 A;  3Q3S A;  3JRI A;  2HYJ A;  3JRD A;  4M6V A;  3ZOB A;  1PUF A;  1MNM C;  3QQA A;  1EF4 A;  3K7A J;  1FTT A;  2DA1 A;  2R0Q C;  4NDL A;  4XRS A;  3HEF A;  2B63 J;  2M0C A;  2L7M P;  2EZK A;  3L1P A;  4A3G J;  4UUS B;  5FKN A;  3I4M J;  2XGD A;  5EZH A;  2Y9Y A;  4JYK A;  5F0H A;  5DS9 A;  1AHD P;  1NK2 P;  3SFI A;  3S1Q J;  2EZI A;  3MVP A;  3MN2 A;  2O9L A;  3BTL A;  2LKX A;  2DMN A; 
#chains in the Genus database with same CATH topology
 2A5Y B;  3IH2 A;  1HSJ A;  5KAF C;  1IN5 A;  4BH9 A;  1IDZ A;  1WQ2 A;  4E4H A;  2I10 A;  2EIK H;  4YRV A;  4I01 A;  3HKZ A;  5DYM A;  2P5K A;  2RN7 A;  3BZ6 A;  3M8F A;  5J8C A;  4B43 A;  3I5U A;  1Y1V J;  5H20 A;  1P6R A;  3ZMU A;  5J47 A;  3AG3 H;  4MEY F;  1JE8 A;  1ZAO A;  3O3K A;  2M5W A;  4C2U A;  1SVO A;  4P96 A;  4DNC A;  3VPR A;  3CMY A;  3K10 A;  4W1U A;  3EYY A;  1HKS A;  2ZXH A;  4B3X A;  4J01 A;  4EJT A;  3WTY C;  5J1R A;  3WE2 A;  3RKX A;  3H3U A;  5E1W A;  3V7C A;  4I98 B;  2ME6 A;  2X51 A;  2JWT A;  3J7A O;  1YS7 A;  1ONV A;  1QA6 A;  1SFK A;  2Z2S B;  2DYS H;  4L9T A;  4XON A;  2M1B A;  5LLQ A;  2K9Q A;  1EJ9 A;  3TP3 A;  3FHN A;  2HKO A;  3K4L A;  1MND A;  1BOB A;  3RJP A;  1PP7 U;  3R60 A;  1DPR A;  4NBQ A;  2QBY A;  3W2W A;  4A2U A;  5H2F C;  3JRC A;  4UUS A;  3JRB A;  2BE5 F;  3GF2 A;  1FT9 A;  3WTZ A;  3AKZ A;  2GXA A;  2EIN H;  4ZYH A;  2O3F A;  3LOC A;  3NEU A;  5IT9 K;  3KEQ A;  3FF5 A;  2EV0 A;  1X1C A;  2OUM A;  3RDI A;  2MAB A;  2L7Z A;  4XLH A;  4JX5 A;  2XF6 A;  2OPT A;  3F23 A;  2GLO A;  2UV1 A;  3H0G J;  1U8R A;  1H9T A;  1F4K A;  3BZK A;  2EZL A;  4XLP F;  1KQ0 A;  2DCE A;  2IP2 A;  1CF7 B;  5B5E C;  1ZGW A;  2Z99 A;  3K1M A;  1WJF A;  1WH7 A;  2G7U A;  3HOZ J;  3TOB A;  4QWQ A;  4DW6 A;  2ZME C;  1GXQ A;  2CFX A;  1MMN A;  4F92 B;  4CYC A;  1VQ8 I;  3A2K A;  3GXO A;  2CRG A;  2P6S A;  1KYW A;  5FD5 A;  1TW2 A;  4ENJ A;  1W36 C;  1Y0N A;  4KDP A;  3OYF A;  4HSR A;  4G7Z F;  1EH6 A;  3S15 J;  2ADU A;  1ZEL A;  3OY9 A;  2R7W A;  4HDU A;  3W6J B;  2Z16 A;  1HDP A;  1MNE A;  5DCF A;  2VN2 A;  4CIC A;  4RB2 C;  1MMD A;  2W4S A;  3FK6 A;  2FNP A;  4RLF A;  4AM3 A;  4L9J A;  2RNG A;  1Z1D A;  2DT6 A;  1WCM J;  3RYP A;  2X9D A;  4I0B A;  4M72 A;  3C2B A;  3EPZ A;  5F0F A;  4BNC A;  4P55 A;  4G94 A;  2HDD A;  2FQ4 A;  1SD5 A;  2CG4 A;  2E71 A;  1BJZ A;  1WZ2 A;  3IL2 A;  1R36 A;  1ODD A;  1RNL A;  3OIP A;  3E5Q A;  4XN3 A;  2WTE A;  2X4H A;  2XVC A;  2KIF A;  5LEJ A;  3PNV A;  5DUK A;  5JHF A;  4BHB A;  3K4J A;  1EH8 A;  4UB6 C;  4PFP A;  4EV0 A;  2Y0S N;  2K85 A;  3BR5 A;  3DP7 A;  3PO3 J;  1B72 A;  3QAH A;  2FOK A;  4OU0 A;  2R3S A;  4KN7 X;  4D9J A;  4UVA A;  2FD5 A;  1KU9 A;  4FAS D;  2EFQ A;  2OQR A;  1EKE A;  3OYC A;  1AOY A;  4II2 A;  4Q5S F;  3FXM A;  2EIM H;  3PUB A;  4A0Y A;  2LY9 A;  4N4O B;  5D5X B;  3DBL B;  4L5J A;  3JTG A;  4ENK A;  3I59 A;  2O8X A;  3HRS A;  3ZMZ A;  3QPT A;  5A2Q K;  3GZ5 A;  1IF1 A;  2DFH A;  2DI3 A;  3OYB A;  1K61 A;  2R7X A;  2QSG X;  4BU2 A;  2EFW A;  4I09 A;  4BS9 A;  1UEL B;  4M71 A;  2WWY A;  2FOW A;  2XSJ C;  3RKQ A;  3V4G A;  2VJ4 A;  2ELH A;  1P2F A;  4G7O F;  4NHJ A;  1J09 A;  3FXQ A;  1MBG A;  4ZTF A;  4KFC A;  1KA8 A;  3O8G A;  2JPB A;  2VJI A;  4EGZ A;  4NQW A;  1TT0 A;  4R79 A;  1UG2 A;  1B8I A;  5B1A H;  3HZJ A;  5CQG A;  2E5Z A;  3PFI A;  4D5F A;  1OMI A;  3SZG A;  3DTE A;  5FLX Z;  2R5Y A;  1JGG A;  3KYL A;  2WBM A;  2WV1 A;  2GWR A;  2LKP A;  3CP8 A;  2IS1 A;  2M7A A;  2NOJ B;  4PJN A;  1BR1 A;  2JK3 A;  3VB2 A;  1U9O A;  1YQA A;  5CVV A;  4RAZ A;  3AAF A;  4LFU A;  2ME0 A;  4L5I A;  1Z7U A;  2E34 A;  1YW9 A;  2XC7 A;  1TQI A;  2Y31 A;  1IUY A;  2P6T A;  3ABK H;  4LB6 B;  2WAQ A;  3FZV A;  3ML6 A;  5EG0 A;  5HS9 A;  3HOV J;  4MTD A;  1XTA A;  1P4A A;  4WXD A;  1D5Y A;  1LDK B;  2A6T A;  4EJW A;  4FE7 A;  2NRA C;  1Z21 A;  4XR6 A;  3GFM A;  2JSC A;  1LDD A;  4G12 A;  3ZMS A;  3OSF A;  4ASN A;  3KCC A;  2XUB A;  3OYD A;  2V1U A;  4CCK A;  5EF6 A;  4GRI A;  1A6Q A;  2PG4 A;  3ZQF A;  1ZG5 A;  4AYB N;  3F8C A;  4QTR A;  1JJ6 C;  3PSI A;  1MBK A;  1T2K A;  1ETO A;  2A61 A;  2GIZ A;  1QPM A;  1RI7 A;  1D8J A;  1XGS A;  1IXR C;  4XKW A;  4P9U A;  2ZFW A;  1UFM A;  1QVU A;  4JQF A;  4Z2Y A;  1PJR A;  1UCR A;  2R7O A;  2XAU A;  2EFP A;  3KLN A;  3N05 A;  3HGY A;  2PX9 A;  5HNF A;  3BRO A;  5FFZ A;  3JSP A;  3ZQC A;  2BY2 A;  2AXT C;  3LSJ A;  4JOM A;  2HNH A;  1AWC A;  1WPK A;  2YU3 A;  1JHF A;  1NG6 A;  1BA5 A;  4XRF A;  2ECB A;  3LSR A;  4YII A;  1UMQ A;  2KT0 A;  3KP7 A;  1VQN I;  4BQA A;  4EVI A;  2W48 A;  2V6E A;  3I58 A;  1DP3 A;  4RM2 A;  3NRV A;  1LE8 A;  2DDB A;  2DN0 A;  1FSH A;  4ITV A;  4A3L J;  1Y8R B;  3RI4 A;  3S3O A;  3H92 A;  2R7V A;  2JA5 J;  2AHQ A;  3PSF A;  4B47 A;  2BOL A;  2M8E A;  3BQY A;  4M73 A;  2B0L A;  1BM9 A;  4AU7 A;  5GTH C;  3HDD A;  1DQU A;  4L5E A;  4BXF A;  2P4W A;  3OOP A;  2VT2 A;  1D0Z A;  2A6E F;  1ZLK A;  1FMW A;  2BY3 A;  4A5N A;  3GTK J;  3X2Q H;  5M5X J;  3DU6 A;  3DLA A;  2E7X A;  2KMU A;  2QF7 A;  1R6R A;  3OYN A;  2EV6 A;  3GFJ A;  4UV8 A;  4XLE A;  2DBB A;  2VL8 A;  1JTX A;  3ZQH A;  3QYE A;  2IXS A;  1DGW Y;  2ETH A;  3ZP5 A;  4DBQ A;  3GWZ A;  3WTV C;  1UHM A;  1BR2 A;  5IP9 J;  3Q9S A;  3S3N A;  1RIO H;  1QPI A;  3I4P A;  3IH3 A;  1J9I A;  4OMZ A;  2JJ7 A;  3VSL A;  5F27 A;  4BJ6 C;  4BUP A;  2FQ3 A;  1O57 A;  2DPD A;  3G1O A;  1H9G A;  2JA8 J;  1YRN A;  3GTL J;  1V3F A;  2EB7 A;  5J40 A;  3CP2 A;  3OYL A;  1QRY A;  2PBI A;  1FLI A;  3B02 A;  2V9V A;  4YFX F;  3HIF A;  3J7Z I;  4J00 A;  1OJL A;  4E7L A;  1MH3 A;  2VJ5 A;  4IQJ A;  2R7T A;  3REO A;  1RR7 A;  5B1B H;  2HXI A;  2ZXI A;  3FWE A;  5B3S H;  2HZD A;  5FLX K;  4MIM A;  4PGH A;  1KON A;  1FPQ A;  1Z6R A;  4DZP A;  3V8K A;  2PJR B;  2K40 A;  4HPQ A;  4HV5 A;  4AVZ A;  3VSK A;  3K2A A;  1VFC A;  1W5T A;  3L9F A;  3TW7 A;  2ZXW H;  2OTL I;  1T08 B;  2J5O A;  3H9J A;  2XB5 A;  1VQO I;  2P8T A;  1E3O C;  3HHH A;  1WI9 A;  3S1R J;  3WG9 A;  4BJ5 C;  1WJ5 A;  4Y17 A;  4NC7 A;  2H27 A;  2LD5 A;  3HPG A;  2MW8 A;  3C7J A;  3M3Y J;  1JUP A;  1HST A;  5FKM A;  1I50 J;  3IWZ A;  1JKO C;  5AON A;  2GM4 A;  3T8R A;  2M4K A;  3EYI A;  4XNF A;  2M45 A;  2LLK A;  3QP6 A;  2HDW A;  4PDK A;  1DUX C;  4GCV A;  3CD6 I;  5LHI A;  1TL8 A;  2CUZ A;  3C3W A;  4D7M A;  4ENN A;  1XGM A;  1FJL A;  4D0P A;  3RQI A;  2IRF G;  2V9P A;  1XSD A;  3K4B A;  3PIP F;  2O0Y A;  2QSH X;  1W5S A;  3PL8 A;  4KIB A;  2KDO A;  2W1O A;  3BG9 A;  4N4N B;  5D5U B;  1HOM A;  3L2W A;  2K9S A;  3ZQQ A;  1G3S A;  1BW5 A;  2FX0 A;  3KYD B;  2K3P A;  2JPC A;  3JR9 A;  2CO5 A;  5IOY A;  3K4K A;  2DT7 B;  2HOE A;  5EDN A;  2L02 A;  1B9M A;  1VTN C;  4JX4 A;  3CCE I;  2LKX A;  1HXD A;  3D0S A;  4IPA A;  1HW1 A;  1R5I D;  3TQN A;  4E7K A;  3FXU A;  1Z0X A;  1XCB A;  4G6T B;  1RC9 A;  3FHZ A;  2VI6 A;  4ZC3 A;  4CCJ A;  4DGW B;  3F0C A;  5IT3 A;  4E7I A;  4P9F A;  5L3D A;  4V2G A;  2HVS A;  2L0K A;  2CUF A;  3VYR B;  2R92 J;  2W25 A;  2GXG A;  2LMD A;  4EM0 B;  3GTJ J;  4A3J J;  2LFB A;  2IBD A;  2OBP A;  3CLQ A;  3OS1 A;  2O7O A;  3NAR A;  3F6V A;  5J1Y A;  2HTJ A;  4GXO A;  1B6A A;  2STT A;  4ZYG A;  4E7H A;  1SEU A;  4IL6 C;  4EQQ A;  1BI0 A;  3JRI A;  5CVR A;  3WGI A;  2HYJ A;  4M6V A;  1PUF A;  4KIF A;  4XLF A;  3QQA A;  3RPU D;  4D1Q A;  1Z3Y A;  3QOE A;  4E7Z A;  2R0Q C;  2GA1 A;  2M0C A;  1Y0U A;  4U88 A;  2L7M P;  3P9C A;  2F5D A;  4KYW A;  5CJ9 A;  2EZK A;  1OYW A;  2WAD A;  2Y48 A;  3MKZ A;  3VWB A;  5F0H A;  1K6O A;  1AHD P;  2RC4 A;  1NK2 P;  1BIA A;  3S1Q J;  1D1C A;  4AIH A;  1V4R A;  1X1A A;  5AIQ A;  3CCJ I;  3MVP A;  2O9L A;  3BCA A;  4LG3 A;  1PDN C;  1Y8Q B;  1O4X A;  4EM2 A;  3EUH A;  2DJN A;  2GZW A;  2EJR A;  2LP0 A;  2DA6 A;  3QPL A;  4HYE A;  5DD8 A;  3T8T A;  2OA4 A;  3H5A A;  2CGP A;  4ZDL A;  2VC0 A;  1F43 A;  1SAN A;  2NS0 A;  1MD0 A;  2ID3 A;  3F8N A;  4H0E A;  3GVA A;  5ICC A;  3BWG A;  3G1L A;  2VXZ A;  3IAM 2;  5CVI A;  1UST A;  4U7B A;  1YJW I;  4BHC A;  3HOS A;  2COB A;  4BXX J;  2PMZ N;  3DKW A;  4AIJ A;  2XAS A;  1SAX A;  3HUG A;  1A5J A;  3LWF A;  3MQ0 A;  3S8P A;  3VYT B;  1O3R A;  2Q2E B;  5L3C A;  2E1C A;  2F5F A;  4A5M A;  3CJT B;  5K7H A;  1J0R A;  1MKM A;  3WGG A;  2IT0 A;  3BQZ A;  3VYU B;  1D8K A;  2OD5 A;  3K2Z A;  3EET A;  2HFH A;  2VBX A;  3EUH C;  1VQP I;  3I55 I;  3KFW X;  3S1N J;  3FXJ A;  2DA4 A;  4IVN A;  5D8K B;  3NQO A;  4PJJ A;  2BW3 B;  3FM3 A;  3O6B B;  2LSO A;  1FIP A;  3CUQ A;  3TMO A;  4A3I J;  1RPW A;  3TO7 A;  1F1Z A;  4XSX F;  1HBX G;  1GLN A;  3KE2 A;  4CCM A;  4X6A J;  2M3A A;  3CCQ I;  1Z9C A;  2EQR A;  1LJ9 A;  1JT6 A;  1VND A;  2H6B A;  3RCO A;  3WU2 C;  1U8B A;  4ZJZ A;  3I9V 2;  3HRU A;  1E3P A;  4IRH A;  5ED4 A;  4M6Y A;  5CQE A;  3H1C A;  3MD2 A;  1GHC A;  2HS5 A;  1XDU A;  4LK1 F;  2XGE A;  1I3A A;  4EEF G;  2JA2 A;  1ZAR A;  5E17 F;  2VQG A;  3B73 A;  3GFL A;  2NVX J;  1ETQ A;  2RRE A;  2H6C A;  4NNJ A;  2F5C A;  3CUQ C;  3CDL A;  1ZQ3 P;  3IWF A;  2ECC A;  1IN8 A;  5E8G A;  4XOT A;  3AL0 B;  3K69 A;  1TT5 B;  5K5R A;  5F08 A;  2YPR A;  1XN7 A;  2DQR A;  4S05 A;  4ZZL A;  2E1N A;  2QLZ A;  5JVT A;  2ICW G;  3AG4 H;  3S2W A;  4UNO A;  4UHT A;  1X4P A;  2CFO A;  5HS7 A;  3IRR A;  2CQQ A;  3F6O A;  1KU2 A;  2VON A;  3DBR B;  2L3D A;  3KX2 A;  2BV6 A;  1RKT A;  2W00 A;  2Y69 H;  4JK1 X;  2PFB A;  3I56 I;  4DBR A;  1FY7 A;  1SFE A;  2K9M A;  2FEZ A;  2V4J C;  1OCZ H;  4Y7N J;  2GOX B;  4RS8 A;  3WTT C;  3H5R A;  2ZO4 A;  4N9I A;  2LY2 A;  3L00 A;  4MLO A;  4E7J A;  2QZ8 A;  3BY6 A;  1IRG A;  3D1N I;  2LOO A;  2V26 A;  4XKV A;  4BL0 B;  2V7F A;  3G71 I;  3L09 A;  2KDZ A;  2O6G E;  2XB0 X;  2HI3 A;  3E97 A;  3AG1 H;  3MAJ A;  1FMV A;  3ESW B;  2HGC A;  3F8M A;  2IEK A;  2VJJ A;  2JRM A;  4CO8 A;  3W6K B;  3I0T A;  1YI2 I;  1OCO H;  2IGO A;  3OYA A;  2DYR H;  4RGR A;  1E17 A;  2KRF A;  1SFU A;  3PNT A;  5M5W J;  3W3C A;  1J75 A;  1OCT C;  1Z6T A;  3ZQI A;  4G7H F;  3PIO F;  4Q48 A;  4BQQ A;  3CQZ J;  2BGC A;  2D1V A;  2DW4 A;  4KIS A;  2ACJ A;  5CPR B;  4BQN A;  2CU7 A;  4Y4R A;  3OYG A;  1FSE A;  3QWL A;  1OFC X;  2CSO A;  3A0H C;  2FXA A;  1I5Z A;  5HLI A;  4LB5 A;  1RES A;  1ON1 A;  5DDG A;  4RMN A;  3JRH A;  5EGO B;  2HR3 A;  2XAF A;  5A2Q Z;  4YFN F;  1R9T J;  2AO9 A;  5J6X A;  1XS9 A;  4BAC A;  1WH5 A;  1QZE A;  1OCR H;  3BR3 A;  1X3Z B;  3LMM A;  3SEQ A;  2WC2 A;  5C4J J;  5FD6 A;  5J8F A;  4JX6 A;  2HQR A;  3GFI A;  1LEA A;  2XSD C;  4IHV A;  2PI0 A;  4IOC F;  1VQM I;  3ZPL A;  4MQ9 F;  5LRR A;  3K9T A;  5K5O A;  3S16 J;  4CDG A;  2R5Z B;  3O8H A;  5LEK A;  1FNN A;  2KIU A;  3ZQL A;  1R5G A;  4A3E J;  2ZSH B;  1X2M A;  3JSO A;  3OYJ A;  1IUF A;  2MGQ A;  3K70 D;  3TO9 A;  1FBU A;  2H8R A;  4HX4 A;  3BDD A;  4NC8 A;  1N75 A;  1J7K A;  2WA0 A;  5FFX A;  3J81 Z;  4KNY A;  2ZME A;  2C6Y A;  4WK8 F;  2YU9 J;  3BPV A;  3CCM I;  2OQG A;  5DEQ A;  4U0Y A;  4I76 A;  4GO1 A;  5IOZ A;  2CQX A;  2LRD A;  2PJP A;  2MYS A;  3KP5 A;  1U5T A;  1VQL I;  4DYR A;  4LMY A;  4B3A A;  2DMT A;  1UHS A;  3KPH A;  2K7L A;  3D5S C;  5M3M J;  1Z3X A;  3KP3 A;  1KU3 A;  1XC5 A;  2W57 A;  2Y2Z A;  4MGR A;  2L5Q A;  5HOO A;  3PM1 A;  3BJO A;  5DM7 F;  3HSR A;  4PGG A;  2Y9Z A;  4OAZ A;  2NVT J;  2DA5 A;  4MHG A;  5LHH A;  4OIR F;  2IA2 A;  1R22 A;  2QCO A;  2WAF A;  4B09 A;  3CF5 F;  3QOD A;  2HEO A;  1HC8 A;  3GTQ J;  5J1U A;  2DOE A;  4M6X A;  4IKF A;  3F8F A;  4HST A;  2H8W A;  2E2J J;  3FDY A;  5IP7 J;  2TCT A;  3TDZ C;  1U5T C;  3H35 A;  3LFK A;  2VE9 A;  2AQF A;  5JR3 A;  1D0X A;  4L0Y B;  1R4N B;  1W7P A;  1POG A;  3IV5 A;  3H9Q A;  4U87 A;  4CZZ A;  3N4M A;  4HAM A;  2QA4 I;  1REP C;  2JVG A;  1K4T A;  5E3O A;  3I53 A;  3F22 A;  2CUE A;  4EAT A;  2PJR A;  2I5U A;  3BC8 A;  3E7L A;  2V6C A;  5FRO A;  2IGM A;  5HVQ C;  3BG5 A;  5BPD A;  2HYF A;  3FBI B;  4P1W A;  5HNH A;  4L18 B;  1VQ6 I;  1SVL A;  4HX7 A;  3ABU A;  1KU7 A;  2M34 A;  2EFN A;  3PO2 J;  2H1L A;  5FLV A;  2R7Z J;  2HOS A;  2GIV A;  5E3M A;  1XCV A;  2P7V B;  2TDX A;  4HOB A;  3LST A;  2OJE D;  4RGS A;  3HOY J;  3G6E I;  4DOZ A;  2LY1 A;  1XB4 A;  3RPQ A;  4QPO A;  3V7R A;  4L9N A;  4XM3 A;  1A31 A;  1MMA A;  5ILU A;  1W0T A;  5CVU A;  3MCZ A;  1S9H A;  2DT5 A;  4HLX A;  4ESJ A;  2M8G X;  2JQ7 A;  2L4A A;  4HA8 A;  5E18 F;  2F5E A;  3TED A;  1NH3 A;  3KET A;  3SFZ A;  5DTD A;  1P7I A;  3E0J B;  3OWT A;  4WX9 A;  5EZG A;  1H89 C;  3E3V A;  2DFF A;  2F5V A;  4AID A;  1MSE C;  2XDV A;  4M3E A;  4NB5 A;  5FJ8 J;  3DKX A;  1KQ8 A;  2DOF A;  3VYS B;  2DPU A;  3Q0V A;  3FK7 A;  4CCO A;  1MMS A;  5D4R A;  1XMA A;  2OCC H;  3M8J A;  2VKH A;  3E5X A;  2X1D A;  3A01 B;  1Y39 A;  2L7K A;  2DK8 A;  2KJC A;  1G2H A;  3E6M A;  1HF0 A;  1HA8 A;  1LDJ A;  2VIX A;  1SMT A;  4IRI A;  3JRE A;  2HOA A;  2VUM J;  2NS7 A;  5LD2 C;  3GCM A;  2M4G A;  2ELJ A;  3LAP A;  3SDB A;  1BW6 A;  2RDP A;  3EUK L;  3T0Y A;  4QIW N;  3ABM H;  4PK4 A;  4ETS A;  1N78 A;  1CQT A;  4IJA A;  4Y33 A;  3S3M A;  3UKG A;  3QP5 A;  4CA0 A;  1BI2 A;  4EJO A;  2XRO A;  3BT9 A;  2MG4 A;  5HLH A;  2FML A;  3F21 A;  2MFZ A;  4A12 A;  3C1D A;  4OIQ F;  3J81 K;  1USS A;  2VQL A;  2XAG A;  3KEY A;  4BKX A;  3MZH A;  4PFO A;  3DEE A;  4A3F J;  1I6X A;  3VFZ A;  2WV0 A;  2CS3 A;  4HNV A;  2QWW A;  5B66 C;  1HKT A;  1FZP B;  2WB1 A;  1BOA A;  5DCM A;  1WFX A;  2EH3 A;  4ZZD A;  2FA5 A;  1ETV A;  4KA4 A;  4UUT A;  1K79 A;  4PCQ A;  1I3Q J;  4J19 A;  2OCE A;  3VOD A;  3DXJ F;  1MDM A;  3K4M A;  4DQ2 A;  3IHU A;  2HXO A;  3J80 Z;  1AKH A;  2YX4 A;  2JRT A;  3KYC B;  3GZN B;  4TV7 A;  5GPA A;  3QU3 A;  4MO7 A;  5LRS A;  2FSW A;  4UVB A;  4EJV A;  4BHP A;  1B4A A;  2LBF A;  4H4K C;  1YIT I;  1ZR4 A;  1VI0 A;  2K86 A;  3MZY A;  2QVO A;  5IY5 H;  2KRH A;  1ZG1 A;  1J59 A;  4KT6 A;  2RNJ A;  2DK5 A;  2X6X A;  1NTC A;  1HW5 A;  5JHU A;  5M5Y J;  2R93 J;  2NYX A;  2OZU A;  3W6V A;  1K83 J;  5E3N A;  3WTS C;  5FLM J;  5DM6 F;  2E36 A;  3FXK A;  2E60 A;  2R7R A;  5C3E J;  2H94 A;  3W2V A;  2MBF A;  2ESN A;  1LPQ A;  3JW4 A;  3BTJ A;  1X58 A;  2X6Y A;  2NAZ A;  2QQ8 A;  1FYM A;  4FIS A;  4M9X A;  1ZGA A;  3TO6 A;  4HNU A;  4O3M A;  2X1E A;  3QPS A;  3CC2 I;  5FGM A;  2L9N A;  3HKZ N;  2A05 A;  4IEJ A;  5F1J A;  5D5V B;  3ABT A;  5HLT A;  3OS2 A;  3CCS I;  1OLT A;  3RIR A;  4AUX A;  1GXP A;  4XID A;  3HC7 A;  1VZ0 A;  4HG2 A;  5M3F J;  2NS8 A;  1TBX A;  2CQ7 A;  2OV7 A;  5K1Y A;  2FJ1 A;  5FKL A;  3P5J A;  2RV8 A;  1YTY A;  2LH9 A;  2W82 A;  4HEA 2;  1IAW A;  5IYD J;  2XAJ A;  1T33 A;  4XMY A;  1VQ9 I;  1XGO A;  2JVH A;  3KZI C;  4YIR X;  4YG2 F;  4XSZ F;  2ZKZ A;  1MNM C;  2IA0 A;  3PJR A;  2V1D A;  2ZCW A;  1MJ9 A;  2K4B A;  1G3W A;  3K7A J;  1FTT A;  1QZY A;  3KZY A;  1K78 B;  1A36 A;  3DWL E;  1S5L C;  4UB8 C;  4XRS A;  3OYM A;  2KRC A;  2BEO A;  2IGK A;  2QSF X;  1YX3 A;  3HPH A;  2QBY B;  4U7D A;  3CC7 I;  3L1P A;  4UUS B;  2ZJR F;  5FKN A;  2PMU A;  2XGD A;  1O7F A;  2IW5 A;  2KJB A;  1FOX A;  4JYK A;  5DS9 A;  3LAJ A;  3LSH A;  1VQK I;  1OYI A;  4HLY A;  4ZDP A;  2VE8 A;  3MEX A;  1OKR A;  2CUJ A;  2Y75 A;  3RSN A;  2MLG A;  4Q47 A;  4WF2 A;  2F4I A;  3LSI A;  2PQ8 A;  1X19 A;  3FXO A;  1PUE E;  4A93 J;  2QKM B;  2LR8 A;  6PAX A;  2DAO A;  1RET A;  1G3T A;  2GA2 A;  2XHK A;  3ONQ A;  4C9Y A;  4N9H A;  5IPA A;  4XKC A;  4A3M J;  4NC6 A;  3OOU A;  2VKE A;  1C0W A;  1JTY A;  1MMG A;  2V1N A;  2Z5U A;  1RR8 C;  3WTX C;  1PYV A;  3K70 C;  1R1U A;  2H09 A;  1V55 H;  2CW0 F;  5KK1 A;  1H8A C;  3TL4 X;  3DFG A;  4RAG A;  3IKT A;  4I02 A;  2DMP A;  1J5Y A;  1P92 A;  3T1B A;  3IRQ A;  3BR1 A;  2VOD A;  2VBY A;  4AC0 A;  1R00 A;  1TWG J;  4BE0 A;  1ZR2 A;  2J5P A;  2EIJ H;  2XAH A;  3JCU C;  4GYG A;  3HHG A;  3NWS A;  3TKY A;  3Q0W A;  4W97 A;  2BY0 A;  4ZYE A;  1BN5 A;  2CW8 A;  4OIO F;  4CZC A;  3WOD F;  2D45 A;  1XSX A;  2Z3Y A;  5TGT A;  1TC3 C;  4HF2 A;  1FX7 A;  4O6J A;  3J80 K;  3I54 A;  5FRM A;  3S17 J;  1TWF J;  4HDV A;  1FEX A;  3SXY A;  2PMH A;  3ZN1 A;  3OYH A;  3IH4 A;  3S2D J;  3GUD A;  1Y1W J;  4HX8 A;  3KP2 A;  3JRA A;  2R7S A;  3P9I A;  2P7C B;  3FMQ A;  1TQM A;  2YS9 A;  1E0E A;  2F2E A;  4ZDO A;  1HDD C;  1MH4 A;  1R49 A;  5GPC A;  1FYK A;  3H9G A;  3QYB A;  4FT8 A;  3OV8 A;  1QZZ A;  2QKL B;  3IC7 A;  1WI3 A;  2O5R A;  5TRD A;  2XKO A;  3E6B A;  5EGO A;  2RAE A;  2E7W A;  4R8H A;  1MSF C;  4PUS A;  1B72 B;  2HQA A;  2M0M A;  3TOA A;  2TRT A;  1Q1V A;  3HG9 A;  3RKW A;  2QUF A;  1SC7 A;  1KYZ A;  1VQ7 I;  5E8I A;  2ZNZ A;  3PUF A;  2GAU A;  2BZT A;  1TTY A;  3ULQ B;  5H6Q A;  5EEA A;  2R5Z A;  3I59 B;  2FBI A;  3TP0 A;  3M1E A;  4C30 A;  2QQ9 A;  4M3G A;  1MBF A;  4XL9 A;  1YLF A;  2KP6 A;  2FE3 A;  1OR7 A;  2XAQ A;  2VAS A;  1IXC A;  5LGN A;  4PJM A;  2JUG A;  2F6C A;  2LF8 A;  1RZ4 A;  2KFD A;  3ASO H;  3F9K A;  1JKR C;  1BC7 C;  2E2H J;  5KHD A;  1JUM A;  1U0J A;  2JTV A;  4PJL A;  3ZCO A;  5K7F A;  4WWC A;  4F91 B;  4XN0 A;  4LLN A;  1ETK A;  2QGU A;  3CF2 A;  1FP2 A;  4NQW B;  5HLG A;  1HCR A;  2FBK A;  3CUO A;  1B8I B;  3OL4 A;  4BQO A;  5E3L A;  3ECO A;  5KCM A;  1OCP A;  4NUB A;  1CF7 A;  2R5Y B;  3BTI A;  2EA4 A;  3I4N J;  2K27 A;  1ZHF A;  1W1W E;  3T5X A;  2EFO A;  1OR7 C;  1Y6I A;  4AD9 A;  2F4M B;  3L2V A;  3CME I;  4CHU A;  1XMX A;  3FMR A;  4LG0 B;  1XMK A;  2Q1Z B;  3FKJ A;  2LF7 A;  4A6E A;  4ESB A;  1AU7 A;  1VQ4 I;  2OAZ A;  2B7E A;  2K9L A;  3A1Y A;  3EQL F;  4A3B J;  2MLK A;  5D6F A;  1Z77 A;  5BPI A;  3PQK A;  2A5W A;  1V54 H;  1SD6 A;  4OIN F;  1R71 A;  2MD5 A;  2QQA A;  2WAQ N;  3G2B A;  5EG0 B;  3HGG A;  5GTI C;  1XX5 A;  1L0O C;  2A3S A;  2CJJ A;  3CMM A;  1TZL A;  3AG2 H;  3HSE A;  4XIC A;  2H1K A;  3HB9 A;  3EUA A;  2VPL A;  2COM A;  3BR2 A;  2JSP A;  4HRI A;  1WVR A;  2HOT A;  2N8G A;  1F5T A;  3H5N A;  4PJ0 C;  2ZJP F;  3WG7 H;  5EJC A;  1YX5 A;  2P0W A;  2XPW A;  5ERI A;  3LA2 A;  3U9G A;  1V5F A;  3FXL A;  5HOD A;  2R7Q A;  2L54 A;  1EA3 A;  1ENH A;  4MEX F;  3ZN0 A;  4HNT A;  2PEX A;  3SDG A;  4GFB A;  4E70 A;  1E2X A;  3ZQG A;  2VKV A;  2VOO A;  3I64 A;  2XGC A;  3ZQ7 A;  4D5C A;  5K5Q A;  1D5V A;  3B6A A;  2BYV E;  2Y0S A;  4WCG A;  4ZYA A;  5E20 A;  1QVT A;  3H3Z A;  1LFP A;  3ZMT A;  4M3B A;  1LE8 B;  1ACI A;  1U6G A;  4A0X A;  4BAY A;  4XRS G;  4IOA F;  4F7Z A;  4LGW A;  4LLL A;  4JP0 A;  3WTU C;  1TWH J;  4IXA A;  5AIP A;  3HTU A;  3IAS 2;  3SQN A;  1OYY A;  2ESH A;  2HWV A;  2ID6 A;  1SAU A;  3OIQ A;  4S04 A;  2NNN A;  3CCV I;  5KNL A;  2KZV A;  3A01 A;  3K6G A;  3CTA A;  1D0Y A;  3DPL C;  2P81 A;  4ON0 A;  4B48 A;  4FX4 A;  3RZO J;  5GAH J;  1TLH B;  2VPR A;  2F48 A;  4XQF A;  4QSH A;  2YUS A;  5H6R A;  1MZB A;  1YHQ I;  3DTK A;  4BGD A;  4ANJ A;  4DJA A;  3MZ8 A;  3F72 A;  3M8E A;  4F3Q A;  2V9K A;  4GGG A;  4L9V A;  3ERE D;  4RGU A;  5D6E A;  1S3J A;  2G0E A;  1OPC A;  3U1D A;  3L2C A;  2JMW A;  2ZBK A;  3M7G A;  1NK3 P;  3BG7 A;  3B6C A;  1G59 A;  2DU9 A;  4UVC A;  3H0D A;  3ERM A;  2OU2 A;  3HOX J;  4AWX B;  3L7W A;  5FB2 A;  4HQM A;  2XRN A;  4FX0 A;  5F0C A;  3OL3 A;  2DDA A;  1YRN B;  1UZC A;  4OOI A;  4RB1 A;  1IG7 A;  4I2O A;  5CKT A;  5LGU A;  5EEG A;  2ZFU A;  4LK0 F;  2KHM A;  4GDF A;  1LVA A;  1XD7 A;  2XPU A;  5KAI C;  3L2R A;  1LFB A;  1R4M B;  3BR0 A;  1IN7 A;  4G8X A;  2FU4 A;  4JBA A;  3M1C A;  2Z1D A;  1FOW A;  3OSG A;  3O2P E;  4M9Z A;  1QQI A;  1IXS B;  3H36 A;  3GO5 A;  3HL2 A;  4CCN A;  5E1X A;  3S1M J;  5F04 A;  3ISP A;  4E7S A;  3L2U A;  2M30 A;  3V8J A;  4FE4 A;  1BC8 C;  4M9S A;  3HOW J;  2DFI A;  3J7Y J;  3CES A;  4AYB A;  3JRF A;  3BPX A;  2XKP A;  1ZG3 A;  4YEL A;  1K4S A;  3QPH A;  3GBG A;  3DLL F;  3G4S I;  5TIS C;  3GYH X;  3K4N A;  3BTC A;  2GOM A;  2IAI A;  1SVM A;  2RGV A;  2YX7 A;  1W0U A;  4DYQ A;  2VT3 A;  4IHX A;  3JTH A;  3CMA I;  1IN6 A;  3OYE A;  1ZRD A;  3DEU A;  2BHZ A;  1RUO A;  2E1M B;  2DA7 A;  2LDU A;  1YS6 A;  5TJJ A;  2GQQ A;  2VKD A;  3HXL A;  1GV5 A;  1P9Q C;  3DU5 A;  2R4G A;  1G3Y A;  2Y30 A;  2Q8K A;  1LVK A;  4DZJ A;  4E6K G;  5GP9 A;  1I6H J;  1K6Y A;  2A69 F;  1WJE A;  5D8L B;  2K4J A;  3TBI A;  2MSY A;  2CV1 A;  2XF5 A;  1U2W A;  1W4M A;  3DBH B;  3K4C A;  1T98 A;  2XGX A;  4IHY A;  3LQQ A;  3GX4 X;  1BI3 A;  2AXL A;  2JA6 J;  4M74 A;  4RDU A;  1YO5 C;  4BY7 J;  4BXU A;  1X1D A;  3KP6 A;  3A4C A;  2XV4 S;  1YYV A;  3FBN B;  5FRN A;  2KLO A;  1O3Q A;  4P5O A;  2CH0 A;  5IP6 A;  1HQC A;  1XPX A;  1ETW A;  5F6F A;  5GAD J;  2UXX A;  1LQ1 A;  2O03 A;  3IP4 B;  4BEH B;  1QO0 D;  1X1P A;  2XPV A;  1YW8 A;  3BOQ A;  3LL7 A;  2HDC A;  2IA1 A;  1LNW A;  4IRG A;  3LNQ A;  1K78 A;  1WJC A;  1S7E A;  4OAY A;  3CCL I;  1NG7 A;  3IKV A;  4F52 A;  2BXY A;  2LRE A;  5J3L A;  1ZN2 A;  3SYT A;  4A0Z A;  1I39 A;  5FKO A;  3CCR I;  2ZSI B;  3LA7 A;  3M4O J;  2K9N A;  4QLC U;  4IHT A;  4N0B A;  4EM1 A;  1Q1H A;  3G3Z A;  3SJM A;  1JXS A;  1R23 A;  1ZK8 A;  1PUF B;  2KQR A;  1SMY F;  2LNB A;  5BQT A;  3RPU A;  4I0A A;  4B1R A;  3VDX A;  3R4K A;  3SHF A;  3Q0U A;  1W5C C;  3SZP A;  5ILV A;  4IQ4 A;  3COA C;  2WAE A;  1YJN I;  3LSP A;  3BCB A;  1LFU P;  2MC4 A;  2YR2 A;  4EGY A;  2VC1 A;  1PP8 F;  5CVJ A;  1BIB A;  3KP4 A;  1DU6 A;  1SD4 A;  4UUV A;  4CCL A;  1KQ9 A;  3ELK A;  5HDK A;  2BVM A;  1ETY A;  3DV8 A;  2CV0 A;  3ZXS A;  4M3F A;  3MMY B;  3WU1 B;  1T95 A;  2KZG A;  5JFR A;  3E1S A;  3LSM A;  3GME A;  4IO9 F;  2MA3 A;  1YW7 A;  2K3F A;  4XK4 A;  3HUG B;  3WHC A;  4MTE A;  2HQN A;  4M3D A;  4LJZ F;  4PSW A;  3DTI A;  4LD5 A;  3EDP A;  2M2E A;  2L9S A;  3TGN A;  4ZTJ A;  3ROU A;  3ASN H;  1SFX A;  1ZRE A;  2VQH A;  1V5G A;  2PLY A;  3JRD A;  2L2O A;  3ZMD A;  4CGZ A;  4ZYD A;  1O7L A;  1YIJ I;  3KEO A;  4MNU A;  2QEX I;  1IW7 F;  2DA1 A;  2VBZ A;  1XGN A;  1G8X A;  1QBJ A;  4NDL A;  4EJU A;  3HEF A;  2B63 J;  3UNG C;  1X1B A;  1P4X A;  3IUO A;  3CUQ B;  4LIV A;  2NXN B;  3VEP A;  3I4M J;  3LA3 A;  3MWM A;  1JGS A;  3QRF F;  1WJA A;  4ZH4 F;  1FC3 A;  1ULY A;  3SFI A;  2EZI A;  1LB2 A;  3KLO A;  3BLY A;  2DQL A;  4RM3 A;  1DDN A;  2VLA A;  2DMN A;  4LIT A;  4CUG A;  4BJT A;  4RBO A;  4RAF A;  1MGT A;  2I8D A;  3V42 A;  3OYK A;  1JHH A;  3S14 J;  3M9A A;  2UXN A;  1IRZ A;  4CXF A;  5D5W B;  4RLQ A;  2DA3 A;  1ZH5 A;  4UXN A;  3I3L A;  1VF9 A;  1YFH A;  4RB0 A;  1X2N A;  2ZNY A;  5K7Z A;  1UB9 A;  4LLG F;  1P7J A;  4RB3 C;  4K2E A;  1STZ A;  2XRL A;  3BR6 A;  5CLS A;  3CLO A;  2L7F P;  2ZB9 A;  1FOK A;  1GVJ A;  1XSV A;  3E6C C;  4U0W A;  1A6I A;  1I1S A;  2BY1 A;  2GBY A;  1D3Y A;  2X48 A;  4X1E A;  2EBI A;  3CZ6 A;  4LIU A;  3FIW A;  1GVD A;  1ZKG A;  3ZR8 X;  4ESF A;  1QHH D;  1T0F A;  4CSW A;  4XRM A;  3W2A A;  2NVQ J;  1LUJ B;  4YEJ A;  1MJB A;  2X85 A;  1QGP A;  3G73 A;  1B59 A;  3ZGK A;  3C2G A;  4LG0 A;  1IDY A;  2V1X A;  2IS4 A;  4EMS A;  3DPT A;  1IRX A;  3CCU I;  1I27 A;  3CJR B;  3LFU A;  1VQ5 I;  1M1E B;  4A6D A;  1BL0 A;  1N25 A;  3SEZ A;  4XOR A;  3UR3 C;  4II3 A;  5L3E A;  2RVC A;  4HBL A;  1T6S A;  1Y56 A;  2PMZ A;  2WY8 Q;  3AFH A;  5L3F A;  4DIQ A;  3MKY B;  1T0F C;  1UHW A;  2ISZ A;  2M7B A;  3GLX A;  1FWZ A;  3GEZ A;  5C4X J;  3PNY A;  4DYC A;  3JRG A;  2DTR A;  1RUN A;  2UUZ A;  3BZC A;  2Q2E A;  4HV6 A;  4V2F A;  1OCC H;  4MQV A;  1B1B A;  2JA7 J;  1I1G A;  1TWC J;  4X0G A;  2A07 F;  5HS8 A;  2HU9 A;  2X0L A;  3RKY A;  4A3C J;  5FKK A;  2W85 A;  5EYR A;  1GV2 A;  2DOD A;  1U78 A;  2F4O B;  2EWN A;  1XG1 A;  2KIM A;  3RYR A;  1Z91 A;  2BW3 A;  3J7A Y;  3BJ6 A;  1MBJ A;  1MBE A;  1GUU A;  2VB6 A;  4LOC A;  4IHW A;  2DLL A;  3K0L A;  3U2R A;  1ETX A;  3WGH A;  3RZD J;  1MBH A;  2VOP A;  4ENM A;  4C3H J;  5JI6 A;  2AS5 F;  1J2X A;  4MFE A;  3OMY A;  2D2W A;  3R0A A;  5GAE J;  2DFE A;  2LG4 A;  3R61 A;  1YJ9 I;  3C2H A;  4BDY A;  3S2H J;  1ZTR A;  4RGX A;  1APL C;  4A3D J;  5FO5 A;  2R7D A;  2R7U A;  2D1H A;  1IC8 A;  2O8K A;  3WHB A;  4XOP A;  1FBS A;  2EV5 A;  3V8L A;  5BMZ A;  2ZME B;  4GYI A;  2G9W A;  2JT1 A;  3L2Q A;  2HQ5 A;  4G6Q A;  3DEW A;  3FX3 A;  4MFD A;  2DMU A;  3VOE A;  1K7A A;  1ON2 A;  1H88 C;  1U5T B;  2E19 A;  1ITY A;  1ZRF A;  1D1B A;  3HTS B;  2L9R A;  3WE3 A;  4C3I J;  3M07 A;  1F9N A;  3GTO J;  2EA2 A;  2O61 A;  2NOG A;  1S6L A;  2QEN A;  3FKI J;  4C2T A;  4XBF A;  2EPF A;  2JN6 A;  2FF4 A;  1WSU A;  2A68 F;  5BOX A;  3WU0 A;  3GW2 A;  2DO7 A;  3P9K A;  1WHU A;  4HZF A;  4V19 K;  1OQY A;  4S0H B;  3AL0 C;  1MIJ A;  1OIS A;  3ABL H;  1IZ1 A;  3TW6 A;  3MFK A;  3LSK A;  3U21 A;  4CYC B;  3Q5F A;  1TNT A;  4A69 C;  3BG3 A;  3WTW C;  2NNY A;  3CO6 C;  2LTP A;  2DJI A;  3NAU A;  1JJ8 C;  3ZRG A;  5ICG A;  4C3J J;  4F93 B;  3HRM A;  3E6D A;  2E2I J;  1DGR M;  2CWE A;  1W7P B;  2MH2 A;  2V79 A;  2CQN A;  4PSX A;  2NVY J;  4I99 C;  4Q4Z F;  2DTZ A;  2OF7 A;  4FCY A;  1EH7 A;  4PZJ A;  1D1A A;  5ICF A;  1F36 A;  4UV9 A;  1BI1 A;  1DPU A;  1MW7 A;  2HKX A;  2IJL A;  2LVS A;  3CJN A;  2CQK A;  1GDT A;  3SZT A;  2EZH A;  5DV5 A;  1X4O A;  2IVM A;  4O5V A;  1MJA A;  2W7N A;  4IX7 A;  1QU3 A;  1IV6 A;  1P4W A;  4CYD A;  1S8N A;  2LYC A;  1IJW C;  1R5H A;  4KUM A;  1O3T A;  3F3X A;  2X1C A;  3CJQ B;  2HVR A;  3OR1 C;  3DKY A;  4R1H A;  2RKH A;  4FHT A;  5HDG A;  4AIK A;  3V7S A;  3HOT A;  2DA2 A;  1HLV A;  3CCY A;  2R7F A;  1GT0 C;  2OC6 A;  3JAM Z;  1R1V A;  4UY8 I;  4BYY A;  4IZZ A;  3HJE A;  1QHG A;  1Z05 A;  2HYG D;  4BY1 J;  2L01 A;  3LQR A;  1T56 A;  4OWR B;  4KIG A;  4WXC A;  2DOA A;  4XLA A;  2NVU B;  4OMY A;  2GXB A;  1FBQ A;  2L4M A;  5KVR A;  2VXD A;  2BVL A;  2A6H F;  1A04 A;  2QQB A;  1JT0 A;  3FXR A;  2E1M C;  3OYI A;  2QM3 A;  1BJA A;  4B44 A;  4Y3O A;  2M87 A;  1R7J A;  2ELK A;  5LGT A;  5CYV A;  3LSG A;  4BEH A;  1LKX A;  1FOY A;  2HTS A;  1W36 D;  2EIL H;  2FBH A;  3QYF A;  5ILS A;  5JVG F;  2JUC A;  3F8B A;  9ANT A;  3HYI A;  4C2M J;  1B9N A;  2B9S A;  4Z6Y A;  4IF4 A;  3RQ4 A;  2Y0M A;  3HRT A;  3K1N A;  5E79 C;  1R58 A;  2EK5 A;  3CDI A;  2CYY A;  4BE2 A;  1YE9 A;  2HPM A;  1YOV B;  1S72 I;  2KPM A;  1T39 A;  2UZK A;  2RQP A;  3GLL A;  1QNT A;  2ISY A;  2M9H A;  2WB1 N;  2XF7 A;  5DCM B;  2K02 A;  1FP1 D;  1E3H A;  1CGP A;  4Y52 J;  2KL4 A;  4XKB A;  2G7H A;  5LFA A;  1U9N A;  4XLC A;  1EV7 A;  3CC4 I;  2E1O A;  2OTJ I;  1W7P D;  3R0J A;  1MDM B;  3GTG J;  3H3V K;  3D5L A;  4QPQ A;  1N77 A;  2FRH A;  2DMQ A;  1BBY A;  4HW0 A;  3HSF A;  1AKH B;  4BE1 A;  2LK2 A;  5LBQ A;  1JUS A;  1G4D A;  2BBY A;  5LHG A;  4Y13 A;  2HPI A;  2E5N A;  2STW A;  5L3G A;  5IYB J;  2BXZ A;  5F64 A;  1XDS A;  4YIF A;  2LBF B;  1S7O A;  5EEH A;  5HDN A;  1UAA A;  2IPQ X;  5IYC J;  3DPU A;  3ECH A;  5DUI A;  1A35 A;  2QYO A;  4FET A;  5F1R A;  4G6D A;  2LC2 A;  3R6S A;  5JLX A;  4Y15 A;  5C44 J;  3GTM J;  4I6Z A;  4BBR J;  2LKS A;  2UWM A;  1WRJ A;  2JZY A;  4KIC A;  1YIO A;  1S29 A;  1TP4 A;  3DCF A;  2HZT A;  1ORK A;  3A02 A;  1TWA J;  4KMU X;  1T8I A;  1ZRC A;  4F55 A;  2X6O A;  4I7H A;  3FIS A;  5D4S A;  4D7N A;  2BHY A;  1DP7 P;  4B8X A;  1IGN A;  2Z33 A;  1RKW A;  1WJB A;  3E5U A;  5J4Y A;  4KJZ A;  1JKQ C;  3OIO A;  1KGS A;  4ABZ A;  2ZJQ F;  3I71 A;  1T38 A;  2D5V A;  1FTZ A;  4OIP F;  4G9Y A;  3MKW B;  3KIO A;  1UG0 A;  3OR2 C;  4KT5 C;  4B4C A;  4FTH A;  3KZZ A;  1L3L A;  2Z9O A;  3ZMV A;  1IN4 A;  2FNA A;  1JKP C;  1H0M A;  2X6W A;  3BG6 A;  4BDZ A;  4FQG A;  1ERD A;  1SD7 A;  1DU0 A;  2P5L C;  3GTP J;  5IT9 Z;  3QOP A;  1FYL A;  1WGX A;  4HQE A;  1FIA A;  1ZYR F;  2ZJ2 A;  3HOU J;  1TW3 A;  4RAY A;  2MH9 A;  4RA2 A;  2P5V A;  2CV2 A;  3HBL A;  2ZC2 A;  2RQQ A;  3JAM K;  1UJ8 A;  4U0V A;  1G6N A;  1IO2 A;  3G1M A;  1X3W B;  2W84 A;  2PN6 A;  2VQC A;  2CMP A;  3CO7 C;  4KIT B;  3RTR A;  4XLN F;  1Z67 A;  3NWT A;  2W24 A;  4HF1 A;  3DQV C;  4A3K J;  2MC3 A;  1IRF A;  2CW7 A;  1V5E A;  3S93 A;  2VBW A;  2IS2 A;  1WJD A;  5DD4 A;  3OS0 A;  2Q0O A;  3DF8 A;  2E35 A;  2OZ6 A;  3BP8 A;  3A0B C;  5J4V A;  1O3S A;  2WY7 Q;  5JLW A;  4BBS J;  1TNS A;  4WXH A;  2L9V A;  2IGN A;  4IHS A;  2K5C A;  1SFO J;  5GAG J;  4KMF A;  4HF0 A;  1LEB A;  2ZXJ A;  3A03 A;  1Z7L A;  5BNG A;  3HM5 A;  2AQE A;  3PFY A;  3P7N A;  3MKL A;  2YSR A;  2KKO A;  1R1T A;  3C18 A;  3FM5 A;  2XIG A;  1JI8 A;  3FMS A;  1WWX A;  3Q3S A;  3GZ6 A;  3CDH A;  1HW2 A;  1YG2 A;  3BJA A;  2KIS A;  3ZOB A;  1S7A A;  5E1Z B;  5BS6 A;  3N97 A;  1KZH A;  1EF4 A;  1BR4 A;  3Q9V A;  1PVE A;  1NHA A;  3U1K A;  4AVP A;  2HVQ A;  4L0Z B;  1U3E M;  1ZGJ A;  4CH7 A;  2FMY A;  5L3B A;  4A3G J;  2MD0 A;  3S32 A;  2IS6 A;  2KIQ A;  1WKM A;  1TQP A;  5EZH A;  2Y9Y A;  2FUG 2;  1X3U A;  1RRJ A;  4KN4 X;  3TDU C;  3PQJ A;  3D5R C;  3K1P A;  1IV8 A;  3MN2 A;  3QU6 A;  1HKQ A;  1ZLJ A;  3BTL A;  5ICE A;  2DXI A;  4YFK F;  1AA7 A; 
#chains in the Genus database with same CATH homology
 3IH2 A;  4A93 J;  1O4X A;  4RBO A;  2DJN A;  2LR8 A;  2LP0 A;  2DA6 A;  3QPL A;  1RET A;  1IDZ A;  5IPA A;  2I10 A;  4A3M J;  3S14 J;  1F43 A;  1SAN A;  2ID3 A;  1IRZ A;  1Y1V J;  3OOU A;  3G1L A;  2DA3 A;  2VKE A;  1JTY A;  2COB A;  2PMZ N;  1VF9 A;  4BXX J;  1X2N A;  5K7Z A;  1P7J A;  2XRL A;  3VPR A;  1H8A C;  3CMY A;  3BR6 A;  4W1U A;  1A5J A;  2L7F P;  2ZB9 A;  2DMP A;  1A6I A;  3BR1 A;  4AC0 A;  1TWG J;  1ZR2 A;  5K7H A;  5J1R A;  2GBY A;  3BQZ A;  2X48 A;  4X1E A;  2EBI A;  2ME6 A;  2JWT A;  3FIW A;  3Q0W A;  4W97 A;  1GVD A;  1ZKG A;  3S1N J;  2K9Q A;  2DA4 A;  3TP3 A;  1TC3 C;  4XRM A;  3S17 J;  3JRC A;  1FIP A;  4UUS A;  4A3I J;  1TWF J;  3JRB A;  2NVQ J;  1FEX A;  1RPW A;  3IH4 A;  3S2D J;  3LOC A;  1Y1W J;  4X6A J;  3JRA A;  1IDY A;  2L7Z A;  2YS9 A;  4JX5 A;  2EQR A;  1JT6 A;  1VND A;  2OPT A;  1MH4 A;  1HDD C;  2GLO A;  3H0G J;  5GPC A;  1U8B A;  1BL0 A;  2EZL A;  1WI3 A;  2XGE A;  4EEF G;  5EGO A;  2RAE A;  1ZGW A;  2NVX J;  1ETQ A;  3CDL A;  1ZQ3 P;  1WH7 A;  1MSF C;  2ECC A;  3HOZ J;  5C4X J;  4DW6 A;  4DYC A;  1B72 B;  3JRG A;  2TRT A;  1Q1V A;  5F08 A;  4V2F A;  4CYC A;  2CRG A;  2JA7 J;  1TWC J;  2CQQ A;  5EEA A;  4A3C J;  2R5Z A;  5FKK A;  5EYR A;  1GV2 A;  3TP0 A;  1U78 A;  3S15 J;  1RKT A;  1XG1 A;  4M3G A;  1MBF A;  4Y7N J;  1HDP A;  1MBJ A;  1MBE A;  3FK6 A;  1GUU A;  4MLO A;  4LOC A;  4IHW A;  1WCM J;  3D1N I;  1ETX A;  1JKR C;  2X9D A;  3RZD J;  1MBH A;  2E2H J;  4C3H J;  1JUM A;  5K7F A;  3C2B A;  5F0F A;  2KDZ A;  2XB0 X;  4MFE A;  2HDD A;  2HI3 A;  1ETK A;  2FQ4 A;  1HCR A;  1BJZ A;  2IEK A;  1ZTR A;  3S2H J;  1APL C;  4A3D J;  1B8I B;  5E3L A;  1OCP A;  2R5Y B;  1IC8 A;  2O8K A;  3WHB A;  3BTI A;  3I4N J;  5M5W J;  1OCT C;  2Y0S N;  3ZQI A;  2HQ5 A;  3BR5 A;  3DEW A;  3PO3 J;  4MFD A;  1B72 A;  3CQZ J;  2DMU A;  1AU7 A;  2FD5 A;  1H88 C;  2CU7 A;  4A3B J;  2E19 A;  1Z77 A;  1ITY A;  1OFC X;  2LY9 A;  2L9R A;  4C3I J;  2WAQ N;  3GTO J;  5EG0 B;  1RES A;  2NOG A;  3HGG A;  3JRH A;  3FKI J;  5EGO B;  2JN6 A;  1R9T J;  2AO9 A;  2CJJ A;  1XS9 A;  1K61 A;  4XIC A;  2H1K A;  3HB9 A;  3BR2 A;  4S0H B;  1WH5 A;  3RKQ A;  3BR3 A;  2HOT A;  2N8G A;  3TW6 A;  4CYC B;  4A69 C;  3BG3 A;  5C4J J;  4JX6 A;  2LTP A;  2XPW A;  3NAU A;  1JJ8 C;  1MBG A;  2XSD C;  4IHV A;  5HOD A;  3S16 J;  4C3J J;  3O8G A;  2E2I J;  2R5Z B;  1ENH A;  3O8H A;  3ZQL A;  4A3E J;  1UG2 A;  1B8I A;  3SDG A;  1X2M A;  4GFB A;  1IUF A;  2MGQ A;  2NVY J;  2DTZ A;  2OF7 A;  4D5F A;  2R5Y A;  3ZQG A;  4FCY A;  1JGG A;  2H8R A;  2VKV A;  2XGC A;  4D5C A;  2WV1 A;  3B6A A;  1F36 A;  2YU9 J;  1GDT A;  2LVS A;  2JK3 A;  4I76 A;  1U9O A;  5IOZ A;  2CQX A;  2EZH A;  1QVT A;  2ME0 A;  4M3B A;  1LE8 B;  4DYR A;  4XRS G;  4B3A A;  2Y31 A;  4JP0 A;  1TWH J;  2DMT A;  1IV6 A;  1UHS A;  5M3M J;  5EG0 A;  1XC5 A;  2ID6 A;  3HOV J;  1D5Y A;  2Y2Z A;  1IJW C;  3PM1 A;  4FE7 A;  2NVT J;  2Y9Z A;  3A01 A;  2DA5 A;  2P81 A;  4G12 A;  3OSF A;  3RZO J;  2QCO A;  2VPR A;  3GTQ J;  5J1U A;  5EF6 A;  4QSH A;  2E2J J;  2DA2 A;  2YUS A;  3ZQF A;  4AYB N;  5IP7 J;  2TCT A;  1HLV A;  3CCY A;  4QTR A;  1JJ6 C;  1GT0 C;  1MBK A;  1ETO A;  1QVU A;  1POG A;  2G0E A;  3IV5 A;  4BY1 J;  2JMW A;  1T56 A;  3HGY A;  1NK3 P;  3B6C A;  5E3O A;  3ZQC A;  3LSJ A;  3HOX J;  2CUE A;  1WPK A;  1JT0 A;  1BA5 A;  3E7L A;  2ECB A;  5F0C A;  3LSR A;  3BG5 A;  1YRN B;  1UMQ A;  2KT0 A;  1IG7 A;  2W48 A;  2ELK A;  2M34 A;  3LSG A;  3PO2 J;  1LE8 A;  2DN0 A;  5FLV A;  2R7Z J;  4A3L J;  2HOS A;  5E3M A;  2XPU A;  2AHQ A;  2JA5 J;  1LFB A;  9ANT A;  3BR0 A;  4C2M J;  3HOY J;  3BQY A;  3HDD A;  4L5E A;  1W0T A;  3OSG A;  2M8G X;  3GTK J;  3S1M J;  5F04 A;  3TED A;  5M5X J;  4FE4 A;  5DTD A;  3HOW J;  2QF7 A;  1P7I A;  3ZQH A;  1JTX A;  2M9H A;  2WB1 N;  3JRF A;  5EZG A;  1H89 C;  4Y52 J;  1U9N A;  1MSE C;  4M3E A;  2E1O A;  3GBG A;  5FJ8 J;  3GTG J;  3H3V K;  5IP9 J;  1QPI A;  3BTC A;  3Q0V A;  3FK7 A;  3IH3 A;  2DMQ A;  2IAI A;  1AKH B;  1W0U A;  4DYQ A;  2JJ7 A;  2LK2 A;  1JUS A;  3A01 B;  4IHX A;  5F27 A;  1G2H A;  5IYB J;  2DA7 A;  1HF0 A;  3G1O A;  5IYC J;  2HOA A;  3JRE A;  2JA8 J;  1GV5 A;  2VUM J;  1YRN A;  2Y30 A;  4DZJ A;  3GTL J;  2NS7 A;  1I6H J;  5GP9 A;  2MSY A;  1BW6 A;  4QIW N;  1QRY A;  5JLX A;  5C44 J;  1CQT A;  3GTM J;  1OJL A;  4BBR J;  4I6Z A;  1MH3 A;  3UKG A;  4IHY A;  1RR7 A;  3BT9 A;  2MG4 A;  3DCF A;  2JA6 J;  2HXI A;  4RDU A;  1ORK A;  3A02 A;  4MIM A;  4DZP A;  4BY7 J;  1TWA J;  2K40 A;  2X6O A;  4BKX A;  3FIS A;  3K2A A;  4D7N A;  1VFC A;  3TW7 A;  4A3F J;  5IP6 A;  1ETW A;  4HNV A;  1IGN A;  1RKW A;  1JKQ C;  2XB5 A;  1E3O C;  3OIO A;  4ABZ A;  2EH3 A;  2XPV A;  1ETV A;  3LNQ A;  3S1R J;  2D5V A;  4UUT A;  1I3Q J;  4J19 A;  1S7E A;  2LD5 A;  1FTZ A;  2MW8 A;  3M3Y J;  1JUP A;  5FKM A;  1I50 J;  4B4C A;  4FTH A;  2HXO A;  1JKO C;  5J3L A;  1AKH A;  2GM4 A;  1JKP C;  5FKO A;  5GPA A;  4MO7 A;  2LLK A;  1DU0 A;  3GTP J;  3M4O J;  2K9N A;  1WGX A;  1FIA A;  4D7M A;  3SJM A;  1FJL A;  3RQI A;  3HOU J;  1ZK8 A;  1ZR4 A;  1VI0 A;  1PUF B;  3HBL A;  4B1R A;  3G1M A;  1NTC A;  3BG9 A;  1HOM A;  3Q0U A;  5M5Y J;  2K9S A;  1BW5 A;  2R93 J;  2FX0 A;  3JR9 A;  3W6V A;  1K83 J;  5E3N A;  3LSP A;  1LFU P;  5IOY A;  5FLM J;  1DU6 A;  4A3K J;  5EDN A;  4JX4 A;  5C3E J;  3BTJ A;  1X58 A;  1Z0X A;  1ETY A;  4FIS A;  2VI6 A;  3QPS A;  5JLW A;  3F0C A;  4BBS J;  4M3F A;  1SFO J;  3HKZ N;  4IEJ A;  4V2G A;  5F1J A;  2L0K A;  2CUF A;  2R92 J;  3A03 A;  5BNG A;  3HM5 A;  4AUX A;  4XID A;  3GTJ J;  5M3F J;  2NS8 A;  2LFB A;  4A3J J;  2IBD A;  4XK4 A;  2FJ1 A;  3MKL A;  5FKL A;  3WHC A;  2O7O A;  3NAR A;  4M3D A;  5J1Y A;  2M2E A;  5IYD J;  1T33 A;  3Q3S A;  3JRI A;  2HYJ A;  3JRD A;  4M6V A;  3ZOB A;  1PUF A;  1MNM C;  3QQA A;  1EF4 A;  3K7A J;  1FTT A;  2DA1 A;  2R0Q C;  4NDL A;  4XRS A;  3HEF A;  2B63 J;  2M0C A;  2L7M P;  2EZK A;  3L1P A;  4A3G J;  4UUS B;  5FKN A;  3I4M J;  2XGD A;  5EZH A;  2Y9Y A;  4JYK A;  5F0H A;  5DS9 A;  1AHD P;  1NK2 P;  3SFI A;  3S1Q J;  2EZI A;  3MVP A;  3MN2 A;  2O9L A;  3BTL A;  2LKX A;  2DMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...