4C2MJ

Structure of rna polymerase i at 2.8 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4
publication title RNA Polymerase I Structure and Transcription Regulation.
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 69
sequence length 69
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4c2mJ00
1T33A 3LSPA 4IHWA 2R5YB 1H89C 3G1MA 2VKVA 1DU0A 1Z0XA 3HKZN 5EG0B 2LK2A 2R5ZA 1ZGWA 5J1UA 4UUSB 3HDDA 1B8IA 1ETOA 4FE4A 4FE7A 5FLMJ 3G1OA 2LFBA 1MBKA 2DA1A 4Y52J 4BY7J 1FEXA 1AKHA 2XPVA 2JJ7A 3BG5A 3Q0WA 2DA7A 3GTMJ 2VI6A 1IV6A 3M4OJ 3HOXJ 1EF4A 1G2HA 4MLOA 4M3BA 1I6HJ 1LFBA 3CDLA 3MN2A 1R9TJ 3FKIJ 4B3AA 2IBDA 3B6AA 2HXIA 3O8HA 3RQIA 1PUFA 2ECBA 3H3VK 3BTLA 4C3HJ 2E1OA 2D5VA 4XIDA 4IHVA 3S1MJ 1VI0A 2M0CA 1IC8A 1AU7A 1TWHJ 2XGEA 1U9OA 1HCRA 2DMPA 1D5YA 2B63J 1JTYA 2QF7A 5M5WJ 2DA5A 1CQTA 4IHYA 3FK6A 5C3EJ 1ETKA 3LSGA 3NARA 3S1QJ 2YU9J 1I3QJ 1HLVA 2TRTA 3IV5A 4DZJA 2ZB9A 1X58A 1QVUA 4JP0A 2GM4A 1BJZA 2JK3A 1UG2A 2G0EA 2DJNA 2XRLA 2AO9A 5F0FA 1ETXA 2Y30A 1GDTA 3FIWA 1Q1VA 2HOSA 4A3CJ 3BR0A 5J3LA 1GV2A 1JGGA 5K7ZA 2NVQJ 3G1LA 4UUSA 4RBOA 5EZGA 4FCYA 1O4XA 5FKLA 3ZQGA 4W1UA 5IYDJ 2HOAA 1VFCA 3WHCA 3ZOBA 3RZOJ 3CCYA 9ANTA 3TP3A 4A3JJ 4B4CA 2HXOA 2XB0X 5DS9A 2FJ1A 3HM5A 2EQRA 3FISA 4I76A 1JUPA 2XGDA 3SJMA 2OPTA 5F04A 3PO3J 2LLKA 2DMNA 4X6AJ 1IDZA 1YRNB 4DW6A 1RESA 4M6VA 2R7ZJ 1W0TA 2E2HJ 5E3MA 1S7EA 1WCMJ 2XPUA 1WH7A 3MVPA 1JKQC 3Q0UA 4QSHA 3JRHA 5M5YJ 1H88C 1QVTA 4C3IJ 3JRGA 1XS9A 3HB9A 2CJJA 1ZR2A 4BKXA 3IH4A 1IGNA 3QPLA 4ABZA 5F1JA 2NVYJ 2HDDA 2EBIA 4GFBA 5F08A 1X2MA 2DA6A 4EEFG 2M34A 4A3FJ 1K61A 2HYJA 2R93J 3I4NJ 3H0GJ 3TP0A 4X1EA 1ETWA 4J19A 2GLOA 2ELKA 2EZIA 1ORKA 3ZQIA 5IPAA 3GBGA 2ID6A 1IJWC 2ME0A 2M2EA 1U8BA 4IHXA 1JKPC 5C44J 2AHQA 2L0KA 2Y0SN 2YS9A 1SFOJ 3SDGA 1GUUA 5FLVA 1OCPA 4A3GJ 4D5FA 4FTHA 5M3MJ 2LTPA 2XB5A 1MBHA 1LFUP 4MIMA 1F36A 3D1NI 2DA4A 3QQAA 1RETA 2ID3A 3LOCA 1GV5A 1Z77A 1TWCJ 5C4XJ 5IP9J 1ZQ3P 2HOTA 3HGGA 2JA7J 4BY1J 1IUFA 1MSFC 3JRIA 3S1NJ 3NAUA 4B1RA 5GPAA 3UKGA 3K2AA 3TEDA 2VKEA 2N8GA 3S14J 3TW7A 1FIPA 4AYBN 2DN0A 2YUSA 3HBLA 3HOWJ 1IRZA 2COBA 3SFIA 1W0UA 1HF0A 3C2BA 1JKRC 1OFCX 1RR7A 1ZKGA 2DA2A 1P7IA 1HDPA 3GTQJ 2K9SA 2R92J 2DTZA 1B72A 3VPRA 5EZHA 3GTOJ 2LP0A 3WHBA 3BQYA 4XRMA 2R5YA 2LY9A 3OIOA 2X6OA 4BBSJ 3RKQA 5EG0A 3M3YJ 4JX4A 4A3KJ 3ZQLA 5IYCJ 2L7ZA 1A5JA 2O7OA 1MH3A 2Y31A 5EYRA 3BQZA 3B6CA 1I50J 1NK2P 4JYKA 1MBFA 1ETQA 1IG7A 1BL0A 1A6IA 5IP6A 1GVDA 1UMQA 4JX5A 1JUSA 2IAIA 3K7AJ 5E3NA 2L9RA 5M5XJ 2JA8J 5J1YA 1E3OC 3BR3A 4L5EA 3ZQFA 1DU6A 3F0CA 1QPIA 2EZKA 4V2FA 3S17J 1BA5A 2JWTA 1TWFJ 1XG1A 5GPCA 4M3DA 4MFDA 1SANA 2K9QA 4D5CA 1JUMA 3TW6A 3OSGA 3IH3A 4CYCB 4M3GA 1NTCA 3DCFA 4I6ZA 2WB1N 3HOUJ 2MG4A 3Q3SA 5FKKA 5K7FA 4QTRA 2CQQA 5IYBJ 5M3FJ 2PMZN 2XGCA 4XICA 1JT6A 2NS8A 5EGOB 4A3MJ 2W48A 3MKLA 3BG9A 2XPWA 4A3IJ 5JLWA 4D7MA 3RZDJ 2E2IJ 3BTIA 4IEJA 5J1RA 2HQ5A 1U78A 2JMWA 3S15J 5IP7J 3JRAA 3LSRA 4W97A 1UHSA 2P81A 4C3JJ 1XC5A 2HI3A 5FKOA 2O9LA 1WI3A 1JKOC 2L7FP 3GTKJ 2Y2ZA 2FX0A 2O8KA 1AHDP 2RAEA 1WGXA 2VUMJ 3HGYA 3IH2A 1ITYA 3O8GA 5BNGA 5E3OA 1OJLA 4A3EJ 2CUEA 4BBRJ 4A3DJ 3HOVJ 5EF6A 3LSJA 1H8AC 1LE8B 1P7JA 3FK7A 4AC0A 1ETYA 1HOMA 2EH3A 3DEWA 1YRNA 2NVTJ 1TWGJ 4DYRA 3OOUA 5C4JJ 1QRYA 3CQZJ 2MGQA 2TCTA 4V2GA 3QPSA 4HNVA 2H1KA 3CMYA 3GTPJ 1VF9A 1FTTA 4RDUA 1WPKA 3BR2A 4CYCA 2ECCA 1Y1VJ 1U9NA 2MW8A 3BTCA 1FIAA 4AUXA 1ZR4A 3L1PA 2EZHA 3W6VA 1ETVA 3A01B 1TC3C 5EGOA 1WH5A 5E3LA 4Y7NJ 1K83J 5F27A 1F43A 2EZLA 1RPWA 1VNDA 1OCTC 1ZTRA 2LR8A 2M8GX 1JJ8C 1T56A 1JT0A 4A93J 1JTXA 3S2DJ 1APLC 2X48A 2Y9ZA 3A03A 2ME6A 5FJ8J 3PO2J 2H8RA 2LVSA 4JX6A 2JN6A 3GTLJ 4S0HB 3GTJJ 3BR1A 4NDLA 5IOZA 5IOYA 3JRDA 1RKWA 2X9DA 5EEAA 1JJ6C 4UUTA 2KT0A 1HDDC 4M3FA 4MO7A 2K9NA 4FISA 3S16J 2NOGA 1GT0C 1X2NA 1NK3P 4XRSG 4BXXJ 2I10A 1LE8A 4DYCA 5F0CA 1FJLA 3JREA 2DMQA 3HOYJ 4DYQA 1ZK8A 1MBJA 2JA6J 3A02A 3JRBA 5JLXA 3I4MJ 3JRCA 4LOCA 2NS7A 5HODA 2LKXA 5FKMA 5DTDA 3S2HJ 2GBYA 2DA3A 2R0QC 3PM1A 3JRFA 1IDYA 3E7LA 5FKNA 5K7HA 2R5ZB 2CU7A 4XK4A 1MSEC 2E19A 1ENHA 1B8IB 3ZQCA 3S1RJ 2FD5A 2NVXJ 3A01A 2FQ4A 3BR6A 2L7MP 1RKTA 3Q0VA 1AKHB 3BT9A 3LNQA 4MFEA 1TWAJ 3GTGJ 4C2MJ 1MBGA 4M3EA 3JR9A 4A69C 5GP9A 2DMUA 2XSDC 1BW6A 3BG3A 5EDNA 4D7NA 1Y1WJ 3ZQHA 4G12A 1PUFB 3BR5A 3OSFA 2OF7A 2QCOA 2WV1A 2K40A 4A3LJ 1MNMC 1POGA 2KDZA 3HOZJ 4QIWN 1MH4A 3HEFA 3BTJA 2WAQN 2Y9YA 1BW5A 2CRGA 2CUFA 2IEKA 2M9HA 2E2JJ 2DMTA 4DZPA 1FTZA 4A3BJ 2LD5A 2JA5J 1MBEA 2CQXA 2MSYA 2VPRA 4XRSA 1B72B 5F0HA
chains in the Genus database with same CATH superfamily
2LREA 3HL2A 5JVGF 3LSIA 1K4SA 2VKVA 1UG0A 5E1XA 4UUSB 2EIJH 1SD5A 1W1WE 3CJRB 4FE4A 4FE7A 4OAZA 3G1OA 2HU9A 2TDXA 2ZFUA 3U1DA 2MH2A 4LGWA 3WU2C 5KK1A 3ZN1A 1D8JA 4BY7J 3R6SA 2EV5A 3TDZC 2XPVA 4DGWB 1VQPI 2STWA 3CD6I 1XCBA 5ILSA 5J4YA 1T0FA 5H2FC 5ED4A 1IV6A 2XAFA 3HOXJ 4CA0A 2R7XA 4M3BA 3FMRA 3FKIJ 2OTJI 1WWXA 1SD7A 2IBDA 1U5TB 3DU6A 4XLHA 3RQIA 2OU2A 2RGVA 1T98A 2HZTA 3BJAA 3F23A 2E1OA 2D5VA 4XIDA 2KIFA 1EH7A 2BW3B 4GDFA 2M0CA 4LK0F 4NNJA 2HNHA 2VQHA 4HAMA 5HNHA 2W00A 2XAUA 5B5EC 2EIMH 2NXNB 1HCRA 1RR8C 2E1NA 1JTYA 3R0JA 1O7LA 2QF7A 3QYBA 3L2RA 5M5WJ 4NBQA 1X1DA 3FK6A 2JQ7A 1ETKA 2VQCA 3DTIA 4G8XA 3S1QJ 1W7PA 1SFUA 1WJCA 4LB5A 1X58A 4XMYA 2H8WA 2NYXA 2IS4A 5FB2A 1ZGJA 2JK3A 4M9XA 3JCUC 5F0FA 2DJNA 1UELB 2BYVE 4DJAA 2NVUB 2XKPA 1R36A 2CV2A 2VBZA 2QA4I 1STZA 2W25A 1MD0A 1IN8A 1ZG1A 1X1AA 3DBLB 5J3LA 1B4AA 1GV2A 1Z7UA 2CMPA 2LY2A 3BCAA 3A4CA 5CLSA 2ESHA 4FCYA 4IRIA 4IO9F 5TGTA 3IRQA 4MEYF 5IT9K 5D5XB 2HOAA 3KYLA 3ZMZA 3WTSC 1L3LA 4RGRA 2PMUA 3ZOBA 9ANTA 3GF2A 2QQBA 2VJ5A 2X51A 3C7JA 4B4CA 3WTYC 2GWRA 3SEQA 2FJ1A 3HM5A 3FISA 1FYMA 3IKVA 4I76A 2KLOA 2LY1A 5A2QZ 1Z9CA 1K78B 2WADA 3FXJA 4XKWA 4HZFA 5FFXA 4X6AJ 1XCVA 4HF0A 2L3DA 5LEKA 3AG2H 1IO2A 5E3MA 2V6EA 3LQRA 5K5OA 2PEXA 5E8IA 1MJBA 1WH7A 1QNTA 3Q0UA 3ZMDA 4UVCA 2M1BA 3F8FA 3K69A 3CC4I 1H88C 1S6LA 4B43A 2V9KA 4C3IJ 3PUFA 1X19A 2JVGA 4IL6C 3JRGA 1XS9A 1VQ5I 3BY6A 4BKXA 2KHMA 2P4WA 4HW0A 5D4RA 2OD5A 1RUOA 3QPLA 4BQOA 3LL7A 4Z2YA 3E6MA 1FY7A 4NQWA 2HEOA 1ULYA 2DU9A 1YIJI 3F8CA 1JXSA 1G6NA 3I4NJ 3TP0A 3ASOH 5HS8A 2YR2A 4J19A 4ESFA 5BOXA 2HOEA 2ELKA 2EZIA 1ORKA 2BY0A 3CMEI 4E6KG 3TGNA 1IJWC 1O57A 2ME0A 3E6BA 3RYRA 1JKPC 3L2UA 5FLVA 1FNNA 3OMYA 4ESBA 3G2BA 4D5FA 4KN7X 2DOAA 4C9YA 4HLXA 3WTZA 4OIRF 1LVKA 3L9FA 3W3CA 3D5SC 3BG7A 1LB2A 4ZZDA 2E71A 3ASNH 3QQAA 4XLEA 4UV9A 3ULQB 1GV5A 1Z77A 1E17A 4G94A 1UFMA 3K2ZA 6PAXA 5LFAA 1MSFC 3S1NJ 3TQNA 4RB2C 3DPLC 1RC9A 3R4KA 5GPAA 2DFIA 2R7VA 3ZPLA 2H94A 4BNCA 2MA3A 1VQ7I 4M73A 1WHUA 2WAQA 5DCMB 3JAMK 2BVLA 3KP6A 4BUPA 4FQGA 2LMDA 2DN0A 1OKRA 2XV4S 4EMSA 3HBLA 4KNYA 3HOWJ 3OS0A 1WJAA 4IOAF 3Q5FA 1R23A 1HF0A 3C2BA 2B9SA 2V4JC 2LC2A 4F93B 4YEJA 2DA2A 1PP8F 2DQLA 5D8KB 1P7IA 1LDJA 2K9SA 3GLLA 4BQQA 2R92J 2XAJA 2PLYA 5LLQA 2X1DA 3WHBA 2PJRB 3BQYA 3L2WA 2QKMB 1FP1D 1ZRDA 4XRMA 2R5YA 2XVCA 3RI4A 2LY9A 1ODDA 3KIOA 4F52A 3ZQLA 1S8NA 5D5UB 1A5JA 4FX0A 3NWSA 5JFRA 3V8JA 3B6CA 4E7JA 2M0MA 2V1DA 1QO0D 4V19K 4PJMA 1BL0A 1BIBA 1A6IA 1S5LC 2DDAA 3VYTB 5DM6F 3F22A 4BXFA 5B1AH 1UMQA 1JUSA 4PJNA 1ON1A 1OCCH 2HR3A 2XF6A 5J1YA 4IRHA 2E5ZA 3IL2A 2R4GA 1IXRC 3RQ4A 1DU6A 3F0CA 4V2FA 3OL4A 2FMYA 1TT5B 2UXXA 1W5CC 4GYIA 2QQ8A 2K3FA 2R7QA 1LVAA 1FP2A 4MFDA 3TOAA 5GPCA 4N0BA 3B02A 2VQGA 3HTUA 3OSGA 3WG9A 3M07A 3GEZA 1KGSA 1XN7A 3DCFA 4I6ZA 2L4MA 1N78A 3DPUA 4M9SA 4QTRA 3I58A 4UVAA 5EGOB 1JT6A 1QHHD 2EB7A 2OQGA 2ZXIA 4OIPF 4IEJA 2VN2A 3LFKA 4A5MA 2GA1A 2O61A 1D0YA 2JMWA 2EINH 3FDYA 4M6XA 1FMVA 2OCCH 2P81A 2EV6A 4C3JJ 5FKOA 4I0BA 1WI3A 2FX0A 2HVQA 2HVSA 3WTVC 3QAHA 1MZBA 2Y48A 5GAGJ 3E5UA 2VUMJ 1MNDA 2YSRA 5E3OA 1OJLA 1MMGA 2WA0A 2FEZA 4A3DJ 3ECHA 1OCZH 2M87A 3CLOA 1IV8A 3EUKL 4I01A 1ETYA 2X0LA 1X4PA 2EA2A 3DEWA 2NVTJ 1V55H 3OOUA 2XAHA 4CZZA 3MD2A 5HLTA 4IVNA 1ZGAA 1UB9A 2MGQA 4E7KA 1FLIA 1X1CA 5CVJA 4YRVA 4HOBA 1F5TA 2R7UA 2H1KA 2CFXA 4ZYEA 3P5JA 4E7ZA 3OY9A 4BHCA 1FTTA 1BI0A 4HV5A 5FRNA 3I55I 4CYCA 4G6QA 1U9NA 2MW8A 3ZGKA 2R7WA 2KJBA 1FIAA 2QSGX 1XMAA 4WWCA 3EQLF 2HZDA 1Z05A 3ABMH 5FGMA 4WXHA 1XDSA 2DPDA 5D8LB 4KIFA 5F27A 2OV7A 4P55A 3G4SI 1SFXA 4A0ZA 2FQ3A 1ZTRA 3EPZA 5HDGA 4NC6A 1MDMB 1A04A 2Z9OA 3EDPA 5LRRA 2FOWA 2Y9ZA 4QWQA 4EJTA 2Y0SA 4YIIA 3VDXA 3CP2A 1IN5A 4HQEA 2JN6A 4HSTA 3JW4A 4RB3C 2ESNA 3GTLJ 3OYKA 1TL8A 2QYOA 2V9VA 1FZPB 1RKWA 2X9DA 4ENKA 1HDDC 3S3OA 4AVPA 1DPRA 4FISA 2M3AA 3ERED 1GT0C 3M9AA 2DI3A 2ZFWA 4A0XA 1B6AA 2QQAA 3V7RA 2I10A 4G6DA 3CCMI 3BPVA 5B66C 4DYQA 1I1SA 3OR1C 2L9VA 3JRCA 1EH8A 2XSJC 5DTDA 1UHMA 4IF4A 3FHNA 3S2HJ 1WVRA 2OBPA 1HA8A 4KJZA 3BLYA 3I3LA 4A12A 1HKTA 3FBNB 2R0QC 1O3TA 2ZJRF 2X1EA 1B59A 2Z3YA 3ZCOA 4G7ZF 3JRFA 1VQMI 4AYBA 2LG4A 5FKNA 3WGHA 1OMIA 2ELJA 3ZQCA 1YW7A 2VJ4A 2VBWA 4XLFA 3HTSB 4U7BA 2CV0A 1J09A 2L7MP 1RKTA 3I59A 5L3DA 1YI2I 1IW7F 2CQKA 4YFKF 3TMOA 1AKHB 1LUJB 4MFEA 3GTGJ 2OQRA 3CCQI 2DMUA 3D5RC 2BY2A 4PFOA 1FX7A 1SVOA 1BW6A 3BG3A 1DP7P 3TL4X 3K4CA 1T6SA 2GXAA 3RSNA 1Y1WJ 2EV0A 4G12A 2H6CA 1PUFB 2WAFA 2ZO4A 4PJLA 3GZNB 3OSFA 4JK1X 1PYVA 2QCOA 3P7NA 3QP5A 3CCUI 1KQ0A 5CQGA 4CCJA 4LK1F 1MH4A 4LG0A 2L7KA 3VB2A 2K27A 2D1VA 3BTJA 3L00A 4HNTA 5LGNA 2MD5A 2CRGA 2XDVA 1VQ8I 2EILH 4Y17A 4MEXF 1YHQI 2HQNA 2DMTA 4CZCA 2X1CA 1BN5A 4DZPA 2R7RA 2LD5A 1D3YA 3IP4B 1IRXA 3DKWA 3HHHA 5H20A 1G3YA 3FX3A 2K4BA 4BDZA 4RGSA 3DTKA 3NQOA 2BZTA 2P5VA 3FBIB 3PNTA 3LSPA 2VE9A 2R5YB 1O7FA 1T39A 1H89C 1DU0A 1Z0XA 2M8EA 1XSXA 5TJJA 2QEXI 2FUG2 1EV7A 2NNYA 2O3FA 5J4VA 4KYWA 4D1QA 5J1UA 3HDDA 1Z7LA 3EUAA 1FOYA 3SZTA 5FLMJ 2RVCA 1MBKA 2DA1A 3K1MA 4Y52J 4XL9A 5L3BA 3SZPA 1VQNI 2UWMA 4OINF 1SD6A 1OCRH 5F1RA 3GTMJ 4PCQA 2VI6A 1OYIA 1EF4A 1WJFA 2FNPA 1R9TJ 4B3AA 5IT9Z 3B6AA 4U0WA 5K5QA 2E1CA 1OYYA 3BTLA 3H3VK 5KAFC 2L54A 5HS7A 3RYPA 2A69F 4IHVA 3OYJA 4QPOA 1OQYA 1YIOA 3KP3A 4UHTA 2O03A 2JT1A 2K4JA 1ON2A 5BPIA 3RTRA 2K3PA 4KT6A 2DT7B 2KIMA 2ZXHA 2OUMA 2MC4A 3D0SA 1IXSB 2DA5A 4G6TB 4R79A 1CQTA 2IS1A 3FWEA 3NARA 3RKWA 2KQRA 3HSRA 2HVRA 2TRTA 3E5XA 3NEUA 2F2EA 2O0YA 2F5VA 1UJ8A 1RZ4A 1QVUA 4JP0A 3CUQA 1UG2A 1WSUA 3BG6A 2LKPA 4XRFA 1ETXA 2YU3A 3C18A 2DPUA 4OWRB 2G9WA 2Y30A 5H6QA 5JHUA 2XRNA 3FXRA 3FIWA 4RMNA 1R49A 1GDTA 2QZ8A 1VQLI 3BR0A 2J5PA 1JGGA 4RBOA 1T2KA 5DYMA 4IRGA 1BM9A 3UNGC 2FNAA 4KIGA 3REOA 4W1UA 2EJRA 5IYDJ 2F5CA 2VPLA 3LA2A 3CCYA 1QHGA 4A3JJ 2CUJA 2V1UA 5DS9A 3WTTC 1P4WA 1KYWA 1X3WB 1SVMA 4LLLA 1MGTA 1W5TA 3IAS2 2OPTA 1U0JA 3ABUA 3PO3J 3H3ZA 4AU7A 4M6VA 4BEHB 2E2HJ 3EYYA 2KPMA 1E3HA 4L9VA 2M4KA 4U0VA 1FYLA 1WCMJ 3OIQA 4C2TA 2WAEA 4ZH4F 2YX4A 4ZYDA 1PP7U 4L18B 2E7WA 4FT8A 2CV1A 4RLQA 1SFKA 2FRHA 2YX7A 1ERDA 3I54A 3SFZA 2CJJA 1Z3YA 4IPAA 1K6YA 2DOFA 2LF7A 3DV8A 5TRDA 1R1TA 3KP5A 3IH4A 3BZ6A 5F1JA 2NVYJ 3CLQA 2PX9A 1V5EA 3MWMA 2R7DA 3ISPA 4MQVA 1J0RA 1KU9A 1WJDA 4EEFG 3JAMZ 3E5QA 1GHCA 4PJJA 1K61A 2HYJA 3PQKA 1VTNC 3H0GJ 4N9IA 1FBQA 4L0YB 1OYWA 3SQNA 3OS2A 2QSHX 2ACJA 4IHXA 2XF5A 2KRFA 5J8FA 2L0KA 5C44J 1SFOJ 2KL4A 3KP2A 4A3GJ 3CCJI 4IQJA 2LTPA 2UXNA 4AIDA 1ACIA 3BZKA 3IWFA 4LLNA 1J2XA 2ELHA 3OV8A 1F36A 3KPHA 1RETA 4UV8A 2IGOA 4EJWA 3LOCA 4DOZA 4Z6YA 2BOLA 3QU3A 1BJAA 1IUFA 4Y33A 3JRIA 4B47A 4BGDA 4B1RA 4P96A 2Q2EA 3FXLA 5D5VB 3J81K 2WY8Q 3QWLA 3TEDA 4EM1A 4ZC3A 2VB6A 2IGKA 4LIUA 1CGPA 4WX9A 1KYZA 2N8GA 4BH9A 3I71A 4CSWA 2UUZA 3S14J 3KP7A 1UZCA 1U8RA 1FYKA 3OYBA 2M30A 1ZN2A 1D1AA 1YJWI 4FETA 2W85A 1QU3A 5CVVA 2YUSA 4EGYA 3I4PA 1MMDA 1IZ1A 1V54H 2C6YA 5ICFA 1YFHA 2COBA 3DTEA 4J00A 1X1PA 2JPCA 1ZLKA 3IHUA 4HSRA 1IRZA 2FOKA 3GLXA 4I7HA 3OYCA 2VXZA 1OR7C 4RA2A 3MAJA 1HDPA 3VYUB 3I56I 1KQ8A 2IA1A 3HKZA 3EYIA 1B72A 1OCOH 2A3SA 2VL8A 2I8DA 1A6QA 1ZG5A 4L9JA 2GOXB 4DBQA 1IXCA 3E0JB 3OIOA 5BPDA 2PBIA 3WGIA 5EG0A 3LA7A 4M9ZA 1QGPA 5IYCJ 3WU1B 1GVJA 3EUHC 4EGZA 1UHWA 5IT3A 3BQZA 3CZ6A 3JTHA 4JYKA 1MBFA 3ABLH 1K79A 1ZREA 1IG7A 2HDWA 2OCEA 4ZYGA 1IRFA 2ZCWA 3GCMA 1S7OA 2JUCA 2JPBA 4ZYHA 2IAIA 5E3NA 2FA5A 1AOYA 1E3OC 3T1BA 2PN6A 3E3VA 2CH0A 2O5RA 3KP4A 3PUBA 4L9TA 3ZQFA 5HDNA 1O3SA 1QPIA 1QZEA 3S17J 1BA5A 1Z1DA 4NC7A 3RCOA 1LKXA 4HX4A 4AIJA 1HC8A 2FBKA 1SANA 1UCRA 3J7AO 2QWWA 1BOAA 2KKOA 3C3WA 3TW6A 2HYFA 4H4KC 3CUOA 1NTCA 3K4KA 3HOUJ 2MG4A 2ZXJA 4HNUA 4X0GA 4RM2A 3OYIA 5M3FJ 1JHFA 4LLGF 3MZYA 2DTRA 2W48A 3I64A 4XKCA 2LBFA 2E2IJ 3RZDJ 1X3UA 3BTIA 3COAC 3V7CA 3ZQ7A 4E7LA 1P4XA 2MABA 3GZ5A 5JR3A 3DEUA 1YS7A 3JSOA 5IP7J 1R6RA 3LSRA 1YQAA 2RKHA 4B3XA 1UHSA 4ASNA 1XC5A 2QSFX 5D5WB 1JKOC 2Y2ZA 4XLPF 3PIPF 3M1EA 1A35A 2IP2A 1DGWY 4PUSA 1AHDP 2RAEA 2E36A 2IA2A 4A3EJ 1FOXA 4PGGA 2CUEA 4ENMA 2FXAA 3V4GA 4EJUA 3LSKA 3LSJA 3V8KA 1XB4A 1T8IA 2OTLI 2VASA 3GO5A 4AC0A 1IF1A 2LOOA 1HOMA 2EH3A 4U0YA 4B09A 2IGMA 4Q4ZF 5C4JJ 1VQ4I 3CO7C 2VT2A 5KVRA 3PFYA 3BJOA 3CQZJ 1BBYA 4Y15A 4V2GA 2BY1A 2DFEA 2LH9A 3CMYA 4M6YA 2K86A 3WTXC 3DKXA 5B3SH 4KFCA 2VKDA 2ECCA 1U2WA 1Y1VJ 3QOPA 2K9MA 1BR4A 4AUXA 1ZR4A 3L1PA 3W6VA 1T0FC 1ETVA 3DEEA 5HNFA 2X4HA 4RAFA 2OC6A 3CCRI 2L02A 2Z33A 2NOJB 3VSLA 1USSA 2LR8A 3KLNA 4A93J 4HPQA 1TW3A 1MKMA 2DFHA 2OZ6A 3ZMVA 4CO8A 3E97A 4II3A 4BJ6C 3PO2J 3AFHA 1BIAA 4BDYA 1SMTA 3ZMSA 2IRFG 2IA0A 1NG7A 1PJRA 1QPMA 1I39A 5FFZA 1BC8C 2L9SA 4AWXB 4S0HB 1KU3A 1S9HA 3BR1A 1RRJA 1BR1A 5IOYA 3MKYB 3RPUD 3OYHA 1KA8A 5GADJ 2EFQA 1JJ6C 4UNOA 4E7SA 4M3FA 4MO7A 4FASD 2K9NA 2QUFA 3BROA 2D1HA 1XD7A 4RAZA 1NK3P 2VC1A 4BXXJ 1HKQA 5D6EA 2M45A 1LE8A 5LHGA 3LFUA 3F8BA 3K0LA 1HW2A 3JREA 3RKXA 1REPC 1FBUA 1QQIA 3JRBA 2MYSA 4LOCA 2LKXA 3P9IA 3ECOA 1RI7A 3ONQA 2XC7A 2AQFA 2DA3A 4XNFA 3QYEA 4LITA 1ZAOA 4KDPA 3KX2A 2RV8A 3FMSA 1TBXA 5LBQA 3H5AA 3IC7A 2VBXA 1DUXC 1VQ6I 2GXBA 4ANJA 1T95A 2MLKA 3AG1H 4HQMA 1WI9A 2XAGA 3EETA 1LQ1A 2EPFA 2IT0A 4KIBA 3A01A 2FQ4A 1HKSA 3WE3A 2QGUA 3AG3H 2HTSA 2ZMEA 4B48A 3BT9A 5ILVA 2L01A 4C2MJ 4BAYA 4A69C 3N97A 5GP9A 4CDGA 4GRIA 4E4HA 1FBSA 5EDNA 3T5XA 2H1LA 4ZDLA 3OWTA 2I5UA 3CCSI 3LAPA 3WE2A 3VOEA 4C2UA 3S8PA 5E8GA 3AKZA 2OF7A 5E17F 3KCCA 3OYMA 1EA3A 2PMHA 3HJEA 2P6TA 4BXUA 1MNMC 1R00A 3GZ6A 4QIWN 1V3FA 3X2QH 2CQNA 4ENNA 1QA6A 1MW7A 2G7UA 4G7OF 4N4NB 1I6XA 2WAQN 2Y9YA 2V26A 1I27A 2M9HA 2EA4A 3CF2A 2E2JJ 4QPQA 1XDUA 3RJPA 3K70C 3VWBA 1W7PB 4CYDA 3TO7A 1MBEA 2QVOA 1AWCA 2MSYA 4CCOA 2VPRA 4XRSA 4LMYA 4EM0B 1B72B 1G8XA 3U2RA 2VT3A 5CVIA 4IHWA 4U88A 3G1MA 4BE0A 4KN4X 2R7OA 5EG0B 2LK2A 1QZZA 2R5ZA 3K1NA 1ZGWA 2LRDA 3QRFF 1CF7A 2WB1A 1B8IA 4II2A 1P9QC 3E6CC 3DU5A 1EJ9A 4A6DA 4DNCA 2PMZA 3HOTA 1FEXA 2FBIA 3BG5A 5J8CA 4BQNA 2DA7A 3M4OJ 1G2HA 4MLOA 1BR2A 3A1YA 3HG9A 4LD5A 4CUGA 2XROA 1LFBA 3MN2A 1D0ZA 3HRMA 2UZKA 2COMA 1RIOH 1LDDA 2QBYA 1B9MA 3HUGA 5HLGA 4C3HJ 1TZLA 4A6EA 4E7HA 1FSHA 2GIZA 2HFHA 3F21A 4XR6A 1IC8A 1AU7A 2PQ8A 4Y4RA 2JVHA 2XGEA 3I9V2 4WF2A 2VOPA 3VYSB 1U9OA 1NH3A 3OYGA 1ZG3A 4MGRA 5DCFA 3V42A 4GGGA 2KMUA 3GX4X 2YU9J 3T8RA 1HLVA 1WJEA 3IV5A 4DZJA 3CC2I 2ZB9A 1WZ2A 2VIXA 5AIQA 2V6CA 4CH7A 3CTAA 2KZGA 2GM4A 1BJZA 2XRLA 4AM3A 1R58A 1M1EB 4NQWB 2XKOA 3DBHB 3K6GA 2HOSA 2P7VB 1YYVA 2DYRH 2ZNYA 2L9NA 4LB6B 3BCBA 1SAXA 4I02A 4UUSA 1Z21A 1Z91A 4CCKA 2MBFA 4B8XA 3L7WA 3MZHA 2V1NA 4GO1A 5DDGA 1RNLA 3QYFA 2HYGD 4WXDA 4OOIA 1S29A 4BU2A 4F3QA 3IRRA 2XB0X 3CJQB 4I0AA 1Z6TA 3PSFA 2A6TA 2EFNA 3C1DA 1XMXA 1JUPA 2JA2A 2Y75A 4P9UA 3SJMA 3V8LA 1YW8A 1BI1A 4PGHA 5F04A 1U5TA 2DMNA 2NAZA 1IDZA 5KCMA 4DW6A 1RESA 3BDDA 1Y8QB 2V1XA 4DBRA 1W0TA 3HRTA 1BC7C 3ZMTA 4CCLA 1SEUA 2BW3A 3L2QA 2XPUA 2W1OA 2DJIA 2RDPA 4QSHA 3VFZA 4RM3A 4CICA 3G6EI 2DW4A 1E0EA 2NS0A 2ZJQF 3TBIA 3BPXA 2D45A 2ZSHB 2VJJA 3PSIA 1F1ZA 1P4AA 4G7HF 3CF5F 1HQCA 2DBBA 2ZSIB 3J81Z 5D4SA 2P5LC 2HDDA 5LRSA 5FD5A 2NNNA 2X85A 5F08A 2K02A 1X2MA 2DA6A 2M34A 3LSHA 3ZN0A 5BS6A 3GFJA 4F7ZA 1L0OC 1Y39A 2R93J 1R1UA 1I5ZA 1ETWA 2GLOA 1V5FA 5GAEJ 4ZJZA 2ZBKA 3OIPA 3ZQIA 4S04A 2ID6A 4U7DA 2W24A 1D1BA 1W5SA 3LMMA 3WTWC 2CS3A 2AHQA 3O6BB 2Y0SN 2NRAC 2HGCA 1WKMA 2ICWG 3S3MA 4FTHA 5HLHA 1VQOI 1XGSA 1YO5C 3AG4H 1A36A 1MBHA 1LFUP 1TLHB 3J7AY 1K78A 2DA4A 5E18F 1R5ID 3M8EA 2ID3A 4I99C 2DXIA 1QZYA 1YLFA 1IN7A 1TWCJ 3A0HC 5IP9J 2HOTA 3HGGA 3HPGA 3ZMUA 3ML6A 3PFIA 3HIFA 3KZYA 1NHAA 2P8TA 3KYDB 3I5UA 4ZDOA 3BJ6A 3UKGA 1R4MB 1FOKA 5E20A 2IJLA 3TDUC 4I98B 2VKEA 1XGMA 4PJ0C 3F8MA 1X3ZB 3QP6A 1J5YA 1TNTA 3L09A 2OA4A 2BHYA 3MEXA 3TW7A 1FIPA 2DODA 4AYBN 4YELA 2ZMEB 1HSJA 5FD6A 1WQ2A 4EV0A 3SFIA 5JI6A 5KHDA 2BY3A 3HPHA 3DLLF 3MFKA 1W36C 1OFCX 1FMWA 2KZVA 1ZKGA 4H0EA 2FU4A 4ETSA 2IGNA 2RREA 4HA8A 2DTZA 3E1SA 3VPRA 3R0AA 2LP0A 2YPRA 4K2EA 1TNSA 3R61A 4ENJA 4E7IA 4KISA 2LNBA 2X6OA 4BBSJ 1E2XA 3RKQA 2WC2A 5AONA 3M3YJ 4JX4A 3I0TA 4A3KJ 3HYIA 1XX5A 2FBHA 3HC7A 2F4OB 4AVZA 4E70A 1MH3A 2AXTC 5EYRA 1I50J 3SZGA 1R5GA 1ETQA 1W7PD 1XSDA 4M72A 5IP6A 1MMSA 2Y0MA 3J80K 2DFFA 1GVDA 2ZC2A 4JX5A 3F72A 4L9NA 3K7AJ 3M1CA 3WTUC 2PFBA 4BHBA 3BR3A 5LHIA 4KMUX 3FKJA 2LF8A 4HEA2 1H0MA 3K4BA 4ESJA 1XG1A 2GOMA 3QPHA 5DCMA 4MHGA 2H27A 2K9QA 2W84A 3F8NA 5KAIC 4D5CA 5DEQA 2HDCA 1JUMA 4CYCB 2BBYA 2XHKA 4N9HA 1TQMA 3FM3A 4F55A 2GIVA 5LHHA 3TO9A 4LG3A 2DAOA 4XICA 2FMLA 2XGCA 2NS8A 3HSEA 3KEOA 2EK5A 4A3MJ 3I53A 3MKLA 3W6JB 2R3SA 2XPWA 2JTVA 5CKTA 2GXGA 4XM3A 2RC4A 2PJRA 1ZLJA 2CGPA 5J1RA 2HQ5A 1R4NB 3LSTA 1U78A 3S15J 2JRTA 2MLGA 4TV7A 5EEGA 4AD9A 3FZVA 4W97A 5LGUA 4CGZA 2XGXA 2O9LA 1FT9A 4PFPA 3BP8A 2L7FP 4NB5A 4EJOA 3GTKJ 5JHFA 2O8KA 2Q0OA 2R7TA 5FLXK 3Q9VA 1SFEA 3O8GA 5BNGA 1R5HA 4OU0A 4XOPA 4XN0A 2IPQX 4ZYAA 4HX7A 3HOVJ 1H8AC 4GCVA 2KP6A 3RIRA 1P7JA 3VEPA 1OPCA 3Q9SA 3K70D 1N25A 2IS6A 4MTDA 1YRNA 4DIQA 4YFNF 3SHFA 1G3TA 3F6OA 2UV1A 2CQ7A 3GWZA 3ZP5A 2IS2A 2TCTA 5DV5A 3BOQA 3QPSA 2AQEA 4HNVA 3OS1A 2M7BA 1MMNA 1Z6RA 4HX8A 3JTGA 4IJAA 1WPKA 3NRVA 1YX3A 4O5VA 2PJPA 2L4AA 2BXYA 3PQJA 2HKXA 3QOEA 1E3PA 4A2UA 1R7JA 2EZHA 4ON0A 3P9CA 3I59B 2DOEA 5HOOA 5EGOA 1TC3C 1XPXA 1WH5A 4P9FA 1X1BA 4MQ9F 5E3LA 4Y7NJ 1LEBA 4A0YA 1ZRFA 4NHJA 1F43A 1RPWA 2STTA 4LJZF 3DQVC 1T56A 1JT0A 1ZYRF 3K1PA 1JE8A 2ME6A 5FJ8J 1S72I 3NWTA 2QQ9A 2H8RA 1XGOA 2LVSA 2RQQA 2MC3A 4L0ZB 3DKYA 3TO6A 3GTJJ 4NDLA 5GTHC 5IOZA 3JRDA 2HWVA 4EVIA 3H9GA 3GMEA 2E34A 4HYEA 3U1KA 4YIFA 1S7AA 4AIHA 3JSPA 4LG0B 2RNJA 3MMYB 3AL0C 3S16J 5HS9A 2X6YA 4OIOF 4XRSG 3CUQC 3J7ZI 3A0BC 4DYCA 5JVTA 1FJLA 2CYYA 1Q1HA 1J75A 2JA6J 1MBJA 4XSXF 3A02A 2A68F 3I4MJ 3KETA 2H09A 2NS7A 2A05A 2LKSA 4R1HA 5FKMA 5AIPA 2X6WA 4RB1A 2EWNA 4IKFA 4YG2F 2GBYA 2RNGA 3GFIA 1WJ5A 1EH6A 3W6KB 3ESWB 3C2GA 4ITVA 3OOPA 2V7FA 2X6XA 1P92A 4Q5SF 2V9PA 2MH9A 4WXCA 4HLYA 1IDYA 3CO6C 2CWEA 3E7LA 5K7HA 4IOCF 2D2WA 4KA4A 3BWGA 2CU7A 4XK4A 1MSEC 5CPRB 3U9GA 4PZJA 3S1RJ 2FD5A 2NVXJ 3ROUA 1B1BA 4XKVA 2RQPA 1I3AA 2PI0A 3WODF 1KU2A 2E7XA 5K1YA 3W2WA 5L3FA 4UY8I 1YJ9I 1DPUA 4M3EA 1G3SA 1MDMA 3AAFA 2VONA 2DYSH 2QLZA 3H36A 2A5YB 4IXAA 1YG2A 4D7NA 3P9KA 3ZQHA 3F6VA 1G59A 1D8KA 4HDVA 2K9LA 2WV1A 4XSZF 3SDBA 2BHZA 2K40A 1POGA 2KDZA 3HOZJ 5F6FA 2VQLA 3MZ8A 2XUBA 4BJ5C 1BI2A 3H92A 3HEFA 3VYRB 2BEOA 1USTA 1T38A 2E1MC 2IEKA 4QLCU 5DUIA 4MTEA 2E60A 2WBMA 4XONA 3AL0B 1LDKB 1R1VA 5GTIC 1O3RA 2WV0A 4EQQA 1SD4A 2CW7A 3CUQB 3O2PE 2XAQA 4J01A 3KYCB 4DQ2A 3QODA 3N05A 1T33A 3ZXSA 1D0XA 4HF2A 2W4SA 1HW5A 4Y3OA 3HKZN 4F91B 1J9IA 3IAM2 4Y13A 4RLFA 1ETOA 1HSTA 1KZHA 4UVBA 2KDOA 2KRCA 3O3KA 3GYHX 1X4OA 2DK5A 2LFBA 2OJED 1VQKI 2F4MB 1I1GA 3GW2A 1AKHA 2JJ7A 3Q0WA 4KMFA 5BQTA 2CW0F 1F9NA 1FWZA 2ZNZA 4O3MA 2VJIA 5DUKA 1I6HJ 3CDLA 1LEAA 3HZJA 5LEJA 4AIKA 4XQFA 1F4KA 2HXIA 2Z99A 3O8HA 3FXQA 1V4RA 1PUFA 2ECBA 4PSWA 1D5VA 2F5DA 4N4OB 2JSPA 4IHSA 1P2FA 2OAZA 4CCNA 3S1MJ 1VI0A 2PG4A 3L2VA 5DM7F 1R22A 4KUMA 4NUBA 4JQFA 5DD8A 1TWHJ 4BJTA 3LAJA 4EATA 5IY5H 3RKYA 3IUOA 2M5WA 2DMPA 1D5YA 2B63J 1TW2A 2Z5UA 2K85A 3K4MA 2EFPA 3S93A 4IHYA 3HHGA 5C3EJ 3M8JA 5ICEA 3LSGA 3H3UA 1BI3A 1I3QJ 1MIJA 3C2HA 3CMMA 3OYDA 3ZR8X 1Y56A 1SVLA 5ICGA 2G0EA 3FF5A 1DP3A 2AO9A 2RN7A 4Q47A 2E1MB 2F5EA 1W36D 3ERMA 1YTYA 2QM3A 2LYCA 3G3ZA 1YW9A 4PK4A 2W57A 1Q1VA 2M7AA 4A3CJ 5K5RA 2LSOA 3DFGA 2EFWA 2K5CA 5K7ZA 2NVQJ 1MNEA 3G1LA 2BE5F 2ISYA 5HDKA 5EZGA 3PNVA 1O4XA 5FKLA 1LFPA 1YE9A 3ZQGA 4EJVA 2VC0A 2IXSA 3MKWB 2BGCA 1VFCA 3WHCA 5ICCA 4U87A 3RZOJ 3OYNA 3TP3A 1S3JA 2HXOA 1Y0NA 2EIKH 3K10A 2DK8A 4KT5C 2EQRA 2IVMA 2O6GE 4OMYA 2XF7A 2XGDA 3MKZA 3BC8A 3F9KA 1T08B 2BXZA 2LLKA 1MMAA 5ERIA 1YRNB 2Y69H 2R7ZJ 2KISA 2DQRA 4FHTA 3RDIA 1S7EA 2BVMA 2Q2EB 2P0WA 3MCZA 2ZJ2A 2WTEA 2G7HA 2VXDA 2DT6A 3MVPA 1JKQC 3JRHA 5M5YJ 5CVUA 3FXMA 4I2OA 4XLCA 1QVTA 2KRHA 3HRUA 3DBRB 4XLAA 5CQEA 1U6GA 1XSVA 3HB9A 1ZR2A 2VE8A 4FX4A 1IGNA 4ABZA 3FXUA 3GFLA 3H9QA 4OMZA 3WG7H 2B0LA 4C30A 1J7KA 2EBIA 1YITI 4GFBA 2BV6A 1PUEE 5H6RA 3W2AA 3E6DA 3M7GA 4ZZLA 4CCMA 4UXNA 4A3FJ 1H9TA 2MFZA 4XLNF 1GLNA 2VODA 1ONVA 4X1EA 4CXFA 5A2QK 1IUYA 5IPAA 3GBGA 2Z16A 3F3XA 3QPTA 2WWYA 1SC7A 2M2EA 3T0YA 4XN3A 1U8BA 2YS9A 3PL8A 3SDGA 1GUUA 1OCPA 5FROA 2LDUA 5M3MJ 4XKBA 4ZTJA 3LQQA 4XORA 3ZRGA 1OLTA 2XB5A 1JI8A 2HTJA 3H5NA 3S3NA 4MIMA 3MQ0A 1FOWA 3CDHA 3DP7A 4LFUA 4S05A 3D1NI 1RUNA 4PDKA 2CUZA 5FRMA 3S2WA 1DQUA 5L3CA 2DT5A 5C4XJ 4IHTA 1TQPA 1R71A 1ZQ3P 2JA7J 4BY1J 4BEHA 3T8TA 2GAUA 3FHZA 1TP4A 3NAUA 4EM2A 5KNLA 4IZZA 3K2AA 2AS5F 3H35A 1QBJA 2JUGA 2WY7Q 3K4JA 3LSMA 1ZELA 3J80Z 2XASA 4RAYA 4L5JA 3B73A 3CESA 2CO5A 3HSFA 3RPUA 2IW5A 1A31A 3IKTA 2DO7A 3PIOF 2FF4A 4WK8F 2K7LA 2L5QA 2KFDA 3DXJF 2MD0A 1W0UA 3CP8A 1JKRC 1RR7A 4UB6C 3GTQJ 1PVEA 2Q8KA 2VLAA 2LBFB 3DWLE 5EZHA 3H1CA 2F6CA 3GTOJ 2ISZA 5E79C 3UR3C 5FO5A 1O3QA 4P1WA 5F64A 3OR2C 3V7SA 3IWZA 2L7ZA 1JHHA 1VZ0A 2O7OA 1ZRCA 3KZZA 2Y31A 4JBAA 1NK2P 4GXOA 4HDUA 1U3EM 3GVAA 3H5RA 1OISA 1B9NA 1XMKA 2ZXWH 2DCEA 1YX5A 3VODA 1TTYA 5HLIA 1WRJA 1G3WA 2A5WA 2L9RA 3CCLI 5M5XJ 2JA8J 1J59A 4KICA 3OL3A 4L5EA 2R7SA 4UB8C 1Z67A 4M71A 5GAHJ 2EZKA 5FLXZ 2M4GA 2GZWA 2QKLB 1WFXA 2JWTA 2P7CB 2F4IA 3DLAA 2DDBA 1TWFJ 1MJAA 2QENA 4OAYA 4M3DA 5EJCA 4HRIA 1UAAA 3HXLA 1GXPA 3CJNA 1V5GA 3R60A 2ZMEC 3IH3A 1XTAA 3PNYA 1Z3XA 2E35A 2AXLA 2KIQA 4M3GA 4O6JA 3SYTA 2WB1N 1HBXG 1JGSA 3Q3SA 5FKKA 2H6BA 2FSWA 5K7FA 2CQQA 5IYBJ 4YIRX 2PMZN 5LD2C 3N4MA 2A6HF 2V79A 1TQIA 3BG9A 3KE2A 4HG2A 4A3IJ 5JLWA 2DLLA 4RS8A 4D7MA 1LPQA 3M8FA 4B44A 1KONA 3SEZA 2CFOA 3OYEA 1K6OA 2JZYA 1GXQA 5J47A 3JRAA 3OYLA 4WCGA 3OYAA 4RGXA 2HKOA 1IAWA 3BZCA 2HI3A 3KZIC 1PDNC 1EKEA 2OZUA 3FM5A 2Z2SB 3CCEI 1MJ9A 1WGXA 5E1WA 3GXOA 3HGYA 1Y8RB 3IH2A 5E1ZB 3ABKH 4IX7A 1ITYA 2ZKZA 1HW1A 1SAUA 4RGUA 1NG6A 4BBRJ 4I09A 5EF6A 3D5LA 3K4NA 3DPTA 4PSXA 1LE8B 2VOOA 3FK7A 3RPQA 3CCVI 2ZJPF 4HF1A 1G4DA 5J40A 1TWGJ 4DYRA 1KQ9A 1SMYF 1QRYA 3HOSA 1YJNI 3H9JA 4D9JA 2HS5A 4BHPA 2F48A 3GTPJ 1VF9A 5CVRA 4MNUA 2EFOA 4RDUA 3SXYA 3BR2A 3WU0A 5ILUA 1FSEA 3OYFA 4NC8A 3BTCA 3G71I 4M74A 4XOTA 1Y0UA 1YS6A 2GA2A 2P6SA 3A01B 1FPQA 1P6RA 2W82A 2A07F 1IN4A 4GYGA 2CSOA 4R8HA 1YOVB 2Q1ZB 3H0DA 1K83J 2KJCA 4IQ4A 2ETHA 2GQQA 2EZLA 5EEHA 4BE1A 4G9YA 1VNDA 1OCTC 3ABTA 1H9GA 2M8GX 1JJ8C 1DGRM 1JTXA 3S2DJ 4RB0A 1OR7A 2X48A 4BS9A 1APLC 1FC3A 3CDIA 3A03A 4LIVA 4CHUA 4JX6A 5CJ9A 4D0PA 3W2VA 1K4TA 2HPIA 3KLOA 3KEYA 4BL0B 3VSKA 3CJTB 2JSCA 2HQAA 4Q48A 3PJRA 1ZHFA 5EEAA 5BMZA 4UUTA 2KT0A 3LA3A 1W4MA 5LGTA 2NOGA 3EUHA 1X2NA 2L2OA 2VKHA 5DD4A 4ZTFA 1D1CA 3KFWX 5F0CA 2CG4A 1N77A 2DMQA 3FMQA 4P5OA 3HOYJ 1ZK8A 4YFXF 4JOMA 3K9TA 5JLXA 4OIQF 4F92B 5HODA 1LJ9A 4ZDPA 1DDNA 4L5IA 2CW8A 3A2KA 1TT0A 2E5NA 1HXDA 3CC7I 3PM1A 4HBLA 5J6XA 2HPMA 3L2CA 2R5ZB 5TISC 3KEQA 2ADUA 2E19A 1ENHA 1CF7B 1B8IB 2A6EF 3QU6A 2R7FA 3BR6A 5L3GA 2JRMA 3WGGA 3K4LA 1IN6A 3Q0VA 3HRSA 1VQ9I 1ZH5A 3FXOA 4KITB 1U5TC 3LNQA 1TWAJ 4XBFA 5CYVA 1MBGA 2Z1DA 1K7AA 3JR9A 2FE3A 2F5FA 5L3EA 2XSDC 2A61A 5B1BH 1LNWA 3G73A 3TKYA 3TOBA 4UUVA 2QBYB 1XGNA 2O8XA 2HQRA 3BR5A 3HUGB 4A5NA 1Y6IA 3FXKA 3ELKA 3GUDA 1BOBA 1AA7A 4A3LJ 3LWFA 4BACA 2W7NA 1ZARA 1IRGA 4BQAA 2VBYA 1WJBA 2P5KA 3J7YJ 4BYYA 1BW5A 1C0WA 2CUFA 3U21A 4RAGA 3CMAI 3ZQQA 1FTZA 4A3BJ 4BE2A 2JA5J 3DF8A 2CQXA 2J5OA 4HV6A 2XIGA 2B7EA 3S32A 5HVQC 1KU7A 2KIUA 3GFMA 1N75A 5F0HA 5D6FA
chains in the Genus database with same CATH topology
1T33A 3LSPA 4IHWA 2R5YB 1H89C 3G1MA 2VKVA 1DU0A 1Z0XA 3HKZN 5EG0B 2LK2A 2R5ZA 1ZGWA 5J1UA 4UUSB 3HDDA 1B8IA 1ETOA 4FE4A 4FE7A 5FLMJ 3G1OA 2LFBA 1MBKA 2DA1A 4Y52J 4BY7J 1FEXA 1AKHA 2XPVA 2JJ7A 3BG5A 3Q0WA 2DA7A 3GTMJ 2VI6A 1IV6A 3M4OJ 3HOXJ 1EF4A 1G2HA 4MLOA 4M3BA 1I6HJ 1LFBA 3CDLA 3MN2A 1R9TJ 3FKIJ 4B3AA 2IBDA 3B6AA 2HXIA 3O8HA 3RQIA 1PUFA 2ECBA 3H3VK 3BTLA 4C3HJ 2E1OA 2D5VA 4XIDA 4IHVA 3S1MJ 1VI0A 2M0CA 1IC8A 1AU7A 1TWHJ 2XGEA 1U9OA 1HCRA 2DMPA 1D5YA 2B63J 1JTYA 2QF7A 5M5WJ 2DA5A 1CQTA 4IHYA 3FK6A 5C3EJ 1ETKA 3LSGA 3NARA 3S1QJ 2YU9J 1I3QJ 1HLVA 2TRTA 3IV5A 4DZJA 2ZB9A 1X58A 1QVUA 4JP0A 2GM4A 1BJZA 2JK3A 1UG2A 2G0EA 2DJNA 2XRLA 2AO9A 5F0FA 1ETXA 2Y30A 1GDTA 3FIWA 1Q1VA 2HOSA 4A3CJ 3BR0A 5J3LA 1GV2A 1JGGA 5K7ZA 2NVQJ 3G1LA 4UUSA 4RBOA 5EZGA 4FCYA 1O4XA 5FKLA 3ZQGA 4W1UA 5IYDJ 2HOAA 1VFCA 3WHCA 3ZOBA 3RZOJ 3CCYA 9ANTA 3TP3A 4A3JJ 4B4CA 2HXOA 2XB0X 5DS9A 2FJ1A 3HM5A 2EQRA 3FISA 4I76A 1JUPA 2XGDA 3SJMA 2OPTA 5F04A 3PO3J 2LLKA 2DMNA 4X6AJ 1IDZA 1YRNB 4DW6A 1RESA 4M6VA 2R7ZJ 1W0TA 2E2HJ 5E3MA 1S7EA 1WCMJ 2XPUA 1WH7A 3MVPA 1JKQC 3Q0UA 4QSHA 3JRHA 5M5YJ 1H88C 1QVTA 4C3IJ 3JRGA 1XS9A 3HB9A 2CJJA 1ZR2A 4BKXA 3IH4A 1IGNA 3QPLA 4ABZA 5F1JA 2NVYJ 2HDDA 2EBIA 4GFBA 5F08A 1X2MA 2DA6A 4EEFG 2M34A 4A3FJ 1K61A 2HYJA 2R93J 3I4NJ 3H0GJ 3TP0A 4X1EA 1ETWA 4J19A 2GLOA 2ELKA 2EZIA 1ORKA 3ZQIA 5IPAA 3GBGA 2ID6A 1IJWC 2ME0A 2M2EA 1U8BA 4IHXA 1JKPC 5C44J 2AHQA 2L0KA 2Y0SN 2YS9A 1SFOJ 3SDGA 1GUUA 5FLVA 1OCPA 4A3GJ 4D5FA 4FTHA 5M3MJ 2LTPA 2XB5A 1MBHA 1LFUP 4MIMA 1F36A 3D1NI 2DA4A 3QQAA 1RETA 2ID3A 3LOCA 1GV5A 1Z77A 1TWCJ 5C4XJ 5IP9J 1ZQ3P 2HOTA 3HGGA 2JA7J 4BY1J 1IUFA 1MSFC 3JRIA 3S1NJ 3NAUA 4B1RA 5GPAA 3UKGA 3K2AA 3TEDA 2VKEA 2N8GA 3S14J 3TW7A 1FIPA 4AYBN 2DN0A 2YUSA 3HBLA 3HOWJ 1IRZA 2COBA 3SFIA 1W0UA 1HF0A 3C2BA 1JKRC 1OFCX 1RR7A 1ZKGA 2DA2A 1P7IA 1HDPA 3GTQJ 2K9SA 2R92J 2DTZA 1B72A 3VPRA 5EZHA 3GTOJ 2LP0A 3WHBA 3BQYA 4XRMA 2R5YA 2LY9A 3OIOA 2X6OA 4BBSJ 3RKQA 5EG0A 3M3YJ 4JX4A 4A3KJ 3ZQLA 5IYCJ 2L7ZA 1A5JA 2O7OA 1MH3A 2Y31A 5EYRA 3BQZA 3B6CA 1I50J 1NK2P 4JYKA 1MBFA 1ETQA 1IG7A 1BL0A 1A6IA 5IP6A 1GVDA 1UMQA 4JX5A 1JUSA 2IAIA 3K7AJ 5E3NA 2L9RA 5M5XJ 2JA8J 5J1YA 1E3OC 3BR3A 4L5EA 3ZQFA 1DU6A 3F0CA 1QPIA 2EZKA 4V2FA 3S17J 1BA5A 2JWTA 1TWFJ 1XG1A 5GPCA 4M3DA 4MFDA 1SANA 2K9QA 4D5CA 1JUMA 3TW6A 3OSGA 3IH3A 4CYCB 4M3GA 1NTCA 3DCFA 4I6ZA 2WB1N 3HOUJ 2MG4A 3Q3SA 5FKKA 5K7FA 4QTRA 2CQQA 5IYBJ 5M3FJ 2PMZN 2XGCA 4XICA 1JT6A 2NS8A 5EGOB 4A3MJ 2W48A 3MKLA 3BG9A 2XPWA 4A3IJ 5JLWA 4D7MA 3RZDJ 2E2IJ 3BTIA 4IEJA 5J1RA 2HQ5A 1U78A 2JMWA 3S15J 5IP7J 3JRAA 3LSRA 4W97A 1UHSA 2P81A 4C3JJ 1XC5A 2HI3A 5FKOA 2O9LA 1WI3A 1JKOC 2L7FP 3GTKJ 2Y2ZA 2FX0A 2O8KA 1AHDP 2RAEA 1WGXA 2VUMJ 3HGYA 3IH2A 1ITYA 3O8GA 5BNGA 5E3OA 1OJLA 4A3EJ 2CUEA 4BBRJ 4A3DJ 3HOVJ 5EF6A 3LSJA 1H8AC 1LE8B 1P7JA 3FK7A 4AC0A 1ETYA 1HOMA 2EH3A 3DEWA 1YRNA 2NVTJ 1TWGJ 4DYRA 3OOUA 5C4JJ 1QRYA 3CQZJ 2MGQA 2TCTA 4V2GA 3QPSA 4HNVA 2H1KA 3CMYA 3GTPJ 1VF9A 1FTTA 4RDUA 1WPKA 3BR2A 4CYCA 2ECCA 1Y1VJ 1U9NA 2MW8A 3BTCA 1FIAA 4AUXA 1ZR4A 3L1PA 2EZHA 3W6VA 1ETVA 3A01B 1TC3C 5EGOA 1WH5A 5E3LA 4Y7NJ 1K83J 5F27A 1F43A 2EZLA 1RPWA 1VNDA 1OCTC 1ZTRA 2LR8A 2M8GX 1JJ8C 1T56A 1JT0A 4A93J 1JTXA 3S2DJ 1APLC 2X48A 2Y9ZA 3A03A 2ME6A 5FJ8J 3PO2J 2H8RA 2LVSA 4JX6A 2JN6A 3GTLJ 4S0HB 3GTJJ 3BR1A 4NDLA 5IOZA 5IOYA 3JRDA 1RKWA 2X9DA 5EEAA 1JJ6C 4UUTA 2KT0A 1HDDC 4M3FA 4MO7A 2K9NA 4FISA 3S16J 2NOGA 1GT0C 1X2NA 1NK3P 4XRSG 4BXXJ 2I10A 1LE8A 4DYCA 5F0CA 1FJLA 3JREA 2DMQA 3HOYJ 4DYQA 1ZK8A 1MBJA 2JA6J 3A02A 3JRBA 5JLXA 3I4MJ 3JRCA 4LOCA 2NS7A 5HODA 2LKXA 5FKMA 5DTDA 3S2HJ 2GBYA 2DA3A 2R0QC 3PM1A 3JRFA 1IDYA 3E7LA 5FKNA 5K7HA 2R5ZB 2CU7A 4XK4A 1MSEC 2E19A 1ENHA 1B8IB 3ZQCA 3S1RJ 2FD5A 2NVXJ 3A01A 2FQ4A 3BR6A 2L7MP 1RKTA 3Q0VA 1AKHB 3BT9A 3LNQA 4MFEA 1TWAJ 3GTGJ 4C2MJ 1MBGA 4M3EA 3JR9A 4A69C 5GP9A 2DMUA 2XSDC 1BW6A 3BG3A 5EDNA 4D7NA 1Y1WJ 3ZQHA 4G12A 1PUFB 3BR5A 3OSFA 2OF7A 2QCOA 2WV1A 2K40A 4A3LJ 1MNMC 1POGA 2KDZA 3HOZJ 4QIWN 1MH4A 3HEFA 3BTJA 2WAQN 2Y9YA 1BW5A 2CRGA 2CUFA 2IEKA 2M9HA 2E2JJ 2DMTA 4DZPA 1FTZA 4A3BJ 2LD5A 2JA5J 1MBEA 2CQXA 2MSYA 2VPRA 4XRSA 1B72B 5F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T33 A;  3LSP A;  4IHW A;  2R5Y B;  1H89 C;  3G1M A;  2VKV A;  1DU0 A;  1Z0X A;  3HKZ N;  5EG0 B;  2LK2 A;  2R5Z A;  1ZGW A;  5J1U A;  4UUS B;  3HDD A;  1B8I A;  1ETO A;  4FE4 A;  4FE7 A;  5FLM J;  3G1O A;  2LFB A;  1MBK A;  2DA1 A;  4Y52 J;  4BY7 J;  1FEX A;  1AKH A;  2XPV A;  2JJ7 A;  3BG5 A;  3Q0W A;  2DA7 A;  3GTM J;  2VI6 A;  1IV6 A;  3M4O J;  3HOX J;  1EF4 A;  1G2H A;  4MLO A;  4M3B A;  1I6H J;  1LFB A;  3CDL A;  3MN2 A;  1R9T J;  3FKI J;  4B3A A;  2IBD A;  3B6A A;  2HXI A;  3O8H A;  3RQI A;  1PUF A;  2ECB A;  3H3V K;  3BTL A;  4C3H J;  2E1O A;  2D5V A;  4XID A;  4IHV A;  3S1M J;  1VI0 A;  2M0C A;  1IC8 A;  1AU7 A;  1TWH J;  2XGE A;  1U9O A;  1HCR A;  2DMP A;  1D5Y A;  2B63 J;  1JTY A;  2QF7 A;  5M5W J;  2DA5 A;  1CQT A;  4IHY A;  3FK6 A;  5C3E J;  1ETK A;  3LSG A;  3NAR A;  3S1Q J;  2YU9 J;  1I3Q J;  1HLV A;  2TRT A;  3IV5 A;  4DZJ A;  2ZB9 A;  1X58 A;  1QVU A;  4JP0 A;  2GM4 A;  1BJZ A;  2JK3 A;  1UG2 A;  2G0E A;  2DJN A;  2XRL A;  2AO9 A;  5F0F A;  1ETX A;  2Y30 A;  1GDT A;  3FIW A;  1Q1V A;  2HOS A;  4A3C J;  3BR0 A;  5J3L A;  1GV2 A;  1JGG A;  5K7Z A;  2NVQ J;  3G1L A;  4UUS A;  4RBO A;  5EZG A;  4FCY A;  1O4X A;  5FKL A;  3ZQG A;  4W1U A;  5IYD J;  2HOA A;  1VFC A;  3WHC A;  3ZOB A;  3RZO J;  3CCY A;  9ANT A;  3TP3 A;  4A3J J;  4B4C A;  2HXO A;  2XB0 X;  5DS9 A;  2FJ1 A;  3HM5 A;  2EQR A;  3FIS A;  4I76 A;  1JUP A;  2XGD A;  3SJM A;  2OPT A;  5F04 A;  3PO3 J;  2LLK A;  2DMN A;  4X6A J;  1IDZ A;  1YRN B;  4DW6 A;  1RES A;  4M6V A;  2R7Z J;  1W0T A;  2E2H J;  5E3M A;  1S7E A;  1WCM J;  2XPU A;  1WH7 A;  3MVP A;  1JKQ C;  3Q0U A;  4QSH A;  3JRH A;  5M5Y J;  1H88 C;  1QVT A;  4C3I J;  3JRG A;  1XS9 A;  3HB9 A;  2CJJ A;  1ZR2 A;  4BKX A;  3IH4 A;  1IGN A;  3QPL A;  4ABZ A;  5F1J A;  2NVY J;  2HDD A;  2EBI A;  4GFB A;  5F08 A;  1X2M A;  2DA6 A;  4EEF G;  2M34 A;  4A3F J;  1K61 A;  2HYJ A;  2R93 J;  3I4N J;  3H0G J;  3TP0 A;  4X1E A;  1ETW A;  4J19 A;  2GLO A;  2ELK A;  2EZI A;  1ORK A;  3ZQI A;  5IPA A;  3GBG A;  2ID6 A;  1IJW C;  2ME0 A;  2M2E A;  1U8B A;  4IHX A;  1JKP C;  5C44 J;  2AHQ A;  2L0K A;  2Y0S N;  2YS9 A;  1SFO J;  3SDG A;  1GUU A;  5FLV A;  1OCP A;  4A3G J;  4D5F A;  4FTH A;  5M3M J;  2LTP A;  2XB5 A;  1MBH A;  1LFU P;  4MIM A;  1F36 A;  3D1N I;  2DA4 A;  3QQA A;  1RET A;  2ID3 A;  3LOC A;  1GV5 A;  1Z77 A;  1TWC J;  5C4X J;  5IP9 J;  1ZQ3 P;  2HOT A;  3HGG A;  2JA7 J;  4BY1 J;  1IUF A;  1MSF C;  3JRI A;  3S1N J;  3NAU A;  4B1R A;  5GPA A;  3UKG A;  3K2A A;  3TED A;  2VKE A;  2N8G A;  3S14 J;  3TW7 A;  1FIP A;  4AYB N;  2DN0 A;  2YUS A;  3HBL A;  3HOW J;  1IRZ A;  2COB A;  3SFI A;  1W0U A;  1HF0 A;  3C2B A;  1JKR C;  1OFC X;  1RR7 A;  1ZKG A;  2DA2 A;  1P7I A;  1HDP A;  3GTQ J;  2K9S A;  2R92 J;  2DTZ A;  1B72 A;  3VPR A;  5EZH A;  3GTO J;  2LP0 A;  3WHB A;  3BQY A;  4XRM A;  2R5Y A;  2LY9 A;  3OIO A;  2X6O A;  4BBS J;  3RKQ A;  5EG0 A;  3M3Y J;  4JX4 A;  4A3K J;  3ZQL A;  5IYC J;  2L7Z A;  1A5J A;  2O7O A;  1MH3 A;  2Y31 A;  5EYR A;  3BQZ A;  3B6C A;  1I50 J;  1NK2 P;  4JYK A;  1MBF A;  1ETQ A;  1IG7 A;  1BL0 A;  1A6I A;  5IP6 A;  1GVD A;  1UMQ A;  4JX5 A;  1JUS A;  2IAI A;  3K7A J;  5E3N A;  2L9R A;  5M5X J;  2JA8 J;  5J1Y A;  1E3O C;  3BR3 A;  4L5E A;  3ZQF A;  1DU6 A;  3F0C A;  1QPI A;  2EZK A;  4V2F A;  3S17 J;  1BA5 A;  2JWT A;  1TWF J;  1XG1 A;  5GPC A;  4M3D A;  4MFD A;  1SAN A;  2K9Q A;  4D5C A;  1JUM A;  3TW6 A;  3OSG A;  3IH3 A;  4CYC B;  4M3G A;  1NTC A;  3DCF A;  4I6Z A;  2WB1 N;  3HOU J;  2MG4 A;  3Q3S A;  5FKK A;  5K7F A;  4QTR A;  2CQQ A;  5IYB J;  5M3F J;  2PMZ N;  2XGC A;  4XIC A;  1JT6 A;  2NS8 A;  5EGO B;  4A3M J;  2W48 A;  3MKL A;  3BG9 A;  2XPW A;  4A3I J;  5JLW A;  4D7M A;  3RZD J;  2E2I J;  3BTI A;  4IEJ A;  5J1R A;  2HQ5 A;  1U78 A;  2JMW A;  3S15 J;  5IP7 J;  3JRA A;  3LSR A;  4W97 A;  1UHS A;  2P81 A;  4C3J J;  1XC5 A;  2HI3 A;  5FKO A;  2O9L A;  1WI3 A;  1JKO C;  2L7F P;  3GTK J;  2Y2Z A;  2FX0 A;  2O8K A;  1AHD P;  2RAE A;  1WGX A;  2VUM J;  3HGY A;  3IH2 A;  1ITY A;  3O8G A;  5BNG A;  5E3O A;  1OJL A;  4A3E J;  2CUE A;  4BBR J;  4A3D J;  3HOV J;  5EF6 A;  3LSJ A;  1H8A C;  1LE8 B;  1P7J A;  3FK7 A;  4AC0 A;  1ETY A;  1HOM A;  2EH3 A;  3DEW A;  1YRN A;  2NVT J;  1TWG J;  4DYR A;  3OOU A;  5C4J J;  1QRY A;  3CQZ J;  2MGQ A;  2TCT A;  4V2G A;  3QPS A;  4HNV A;  2H1K A;  3CMY A;  3GTP J;  1VF9 A;  1FTT A;  4RDU A;  1WPK A;  3BR2 A;  4CYC A;  2ECC A;  1Y1V J;  1U9N A;  2MW8 A;  3BTC A;  1FIA A;  4AUX A;  1ZR4 A;  3L1P A;  2EZH A;  3W6V A;  1ETV A;  3A01 B;  1TC3 C;  5EGO A;  1WH5 A;  5E3L A;  4Y7N J;  1K83 J;  5F27 A;  1F43 A;  2EZL A;  1RPW A;  1VND A;  1OCT C;  1ZTR A;  2LR8 A;  2M8G X;  1JJ8 C;  1T56 A;  1JT0 A;  4A93 J;  1JTX A;  3S2D J;  1APL C;  2X48 A;  2Y9Z A;  3A03 A;  2ME6 A;  5FJ8 J;  3PO2 J;  2H8R A;  2LVS A;  4JX6 A;  2JN6 A;  3GTL J;  4S0H B;  3GTJ J;  3BR1 A;  4NDL A;  5IOZ A;  5IOY A;  3JRD A;  1RKW A;  2X9D A;  5EEA A;  1JJ6 C;  4UUT A;  2KT0 A;  1HDD C;  4M3F A;  4MO7 A;  2K9N A;  4FIS A;  3S16 J;  2NOG A;  1GT0 C;  1X2N A;  1NK3 P;  4XRS G;  4BXX J;  2I10 A;  1LE8 A;  4DYC A;  5F0C A;  1FJL A;  3JRE A;  2DMQ A;  3HOY J;  4DYQ A;  1ZK8 A;  1MBJ A;  2JA6 J;  3A02 A;  3JRB A;  5JLX A;  3I4M J;  3JRC A;  4LOC A;  2NS7 A;  5HOD A;  2LKX A;  5FKM A;  5DTD A;  3S2H J;  2GBY A;  2DA3 A;  2R0Q C;  3PM1 A;  3JRF A;  1IDY A;  3E7L A;  5FKN A;  5K7H A;  2R5Z B;  2CU7 A;  4XK4 A;  1MSE C;  2E19 A;  1ENH A;  1B8I B;  3ZQC A;  3S1R J;  2FD5 A;  2NVX J;  3A01 A;  2FQ4 A;  3BR6 A;  2L7M P;  1RKT A;  3Q0V A;  1AKH B;  3BT9 A;  3LNQ A;  4MFE A;  1TWA J;  3GTG J;  4C2M J;  1MBG A;  4M3E A;  3JR9 A;  4A69 C;  5GP9 A;  2DMU A;  2XSD C;  1BW6 A;  3BG3 A;  5EDN A;  4D7N A;  1Y1W J;  3ZQH A;  4G12 A;  1PUF B;  3BR5 A;  3OSF A;  2OF7 A;  2QCO A;  2WV1 A;  2K40 A;  4A3L J;  1MNM C;  1POG A;  2KDZ A;  3HOZ J;  4QIW N;  1MH4 A;  3HEF A;  3BTJ A;  2WAQ N;  2Y9Y A;  1BW5 A;  2CRG A;  2CUF A;  2IEK A;  2M9H A;  2E2J J;  2DMT A;  4DZP A;  1FTZ A;  4A3B J;  2LD5 A;  2JA5 J;  1MBE A;  2CQX A;  2MSY A;  2VPR A;  4XRS A;  1B72 B;  5F0H A; 
#chains in the Genus database with same CATH topology
 2LRE A;  3HL2 A;  5JVG F;  3LSI A;  1K4S A;  2VKV A;  1UG0 A;  5E1X A;  4UUS B;  2EIJ H;  1SD5 A;  1W1W E;  3CJR B;  4FE4 A;  4FE7 A;  4OAZ A;  3G1O A;  2HU9 A;  2TDX A;  2ZFU A;  3U1D A;  2MH2 A;  4LGW A;  3WU2 C;  5KK1 A;  3ZN1 A;  1D8J A;  4BY7 J;  3R6S A;  2EV5 A;  3TDZ C;  2XPV A;  4DGW B;  1VQP I;  2STW A;  3CD6 I;  1XCB A;  5ILS A;  5J4Y A;  1T0F A;  5H2F C;  5ED4 A;  1IV6 A;  2XAF A;  3HOX J;  4CA0 A;  2R7X A;  4M3B A;  3FMR A;  3FKI J;  2OTJ I;  1WWX A;  1SD7 A;  2IBD A;  1U5T B;  3DU6 A;  4XLH A;  3RQI A;  2OU2 A;  2RGV A;  1T98 A;  2HZT A;  3BJA A;  3F23 A;  2E1O A;  2D5V A;  4XID A;  2KIF A;  1EH7 A;  2BW3 B;  4GDF A;  2M0C A;  4LK0 F;  4NNJ A;  2HNH A;  2VQH A;  4HAM A;  5HNH A;  2W00 A;  2XAU A;  5B5E C;  2EIM H;  2NXN B;  1HCR A;  1RR8 C;  2E1N A;  1JTY A;  3R0J A;  1O7L A;  2QF7 A;  3QYB A;  3L2R A;  5M5W J;  4NBQ A;  1X1D A;  3FK6 A;  2JQ7 A;  1ETK A;  2VQC A;  3DTI A;  4G8X A;  3S1Q J;  1W7P A;  1SFU A;  1WJC A;  4LB5 A;  1X58 A;  4XMY A;  2H8W A;  2NYX A;  2IS4 A;  5FB2 A;  1ZGJ A;  2JK3 A;  4M9X A;  3JCU C;  5F0F A;  2DJN A;  1UEL B;  2BYV E;  4DJA A;  2NVU B;  2XKP A;  1R36 A;  2CV2 A;  2VBZ A;  2QA4 I;  1STZ A;  2W25 A;  1MD0 A;  1IN8 A;  1ZG1 A;  1X1A A;  3DBL B;  5J3L A;  1B4A A;  1GV2 A;  1Z7U A;  2CMP A;  2LY2 A;  3BCA A;  3A4C A;  5CLS A;  2ESH A;  4FCY A;  4IRI A;  4IO9 F;  5TGT A;  3IRQ A;  4MEY F;  5IT9 K;  5D5X B;  2HOA A;  3KYL A;  3ZMZ A;  3WTS C;  1L3L A;  4RGR A;  2PMU A;  3ZOB A;  9ANT A;  3GF2 A;  2QQB A;  2VJ5 A;  2X51 A;  3C7J A;  4B4C A;  3WTY C;  2GWR A;  3SEQ A;  2FJ1 A;  3HM5 A;  3FIS A;  1FYM A;  3IKV A;  4I76 A;  2KLO A;  2LY1 A;  5A2Q Z;  1Z9C A;  1K78 B;  2WAD A;  3FXJ A;  4XKW A;  4HZF A;  5FFX A;  4X6A J;  1XCV A;  4HF0 A;  2L3D A;  5LEK A;  3AG2 H;  1IO2 A;  5E3M A;  2V6E A;  3LQR A;  5K5O A;  2PEX A;  5E8I A;  1MJB A;  1WH7 A;  1QNT A;  3Q0U A;  3ZMD A;  4UVC A;  2M1B A;  3F8F A;  3K69 A;  3CC4 I;  1H88 C;  1S6L A;  4B43 A;  2V9K A;  4C3I J;  3PUF A;  1X19 A;  2JVG A;  4IL6 C;  3JRG A;  1XS9 A;  1VQ5 I;  3BY6 A;  4BKX A;  2KHM A;  2P4W A;  4HW0 A;  5D4R A;  2OD5 A;  1RUO A;  3QPL A;  4BQO A;  3LL7 A;  4Z2Y A;  3E6M A;  1FY7 A;  4NQW A;  2HEO A;  1ULY A;  2DU9 A;  1YIJ I;  3F8C A;  1JXS A;  1G6N A;  3I4N J;  3TP0 A;  3ASO H;  5HS8 A;  2YR2 A;  4J19 A;  4ESF A;  5BOX A;  2HOE A;  2ELK A;  2EZI A;  1ORK A;  2BY0 A;  3CME I;  4E6K G;  3TGN A;  1IJW C;  1O57 A;  2ME0 A;  3E6B A;  3RYR A;  1JKP C;  3L2U A;  5FLV A;  1FNN A;  3OMY A;  4ESB A;  3G2B A;  4D5F A;  4KN7 X;  2DOA A;  4C9Y A;  4HLX A;  3WTZ A;  4OIR F;  1LVK A;  3L9F A;  3W3C A;  3D5S C;  3BG7 A;  1LB2 A;  4ZZD A;  2E71 A;  3ASN H;  3QQA A;  4XLE A;  4UV9 A;  3ULQ B;  1GV5 A;  1Z77 A;  1E17 A;  4G94 A;  1UFM A;  3K2Z A;  6PAX A;  5LFA A;  1MSF C;  3S1N J;  3TQN A;  4RB2 C;  3DPL C;  1RC9 A;  3R4K A;  5GPA A;  2DFI A;  2R7V A;  3ZPL A;  2H94 A;  4BNC A;  2MA3 A;  1VQ7 I;  4M73 A;  1WHU A;  2WAQ A;  5DCM B;  3JAM K;  2BVL A;  3KP6 A;  4BUP A;  4FQG A;  2LMD A;  2DN0 A;  1OKR A;  2XV4 S;  4EMS A;  3HBL A;  4KNY A;  3HOW J;  3OS0 A;  1WJA A;  4IOA F;  3Q5F A;  1R23 A;  1HF0 A;  3C2B A;  2B9S A;  2V4J C;  2LC2 A;  4F93 B;  4YEJ A;  2DA2 A;  1PP8 F;  2DQL A;  5D8K B;  1P7I A;  1LDJ A;  2K9S A;  3GLL A;  4BQQ A;  2R92 J;  2XAJ A;  2PLY A;  5LLQ A;  2X1D A;  3WHB A;  2PJR B;  3BQY A;  3L2W A;  2QKM B;  1FP1 D;  1ZRD A;  4XRM A;  2R5Y A;  2XVC A;  3RI4 A;  2LY9 A;  1ODD A;  3KIO A;  4F52 A;  3ZQL A;  1S8N A;  5D5U B;  1A5J A;  4FX0 A;  3NWS A;  5JFR A;  3V8J A;  3B6C A;  4E7J A;  2M0M A;  2V1D A;  1QO0 D;  4V19 K;  4PJM A;  1BL0 A;  1BIB A;  1A6I A;  1S5L C;  2DDA A;  3VYT B;  5DM6 F;  3F22 A;  4BXF A;  5B1A H;  1UMQ A;  1JUS A;  4PJN A;  1ON1 A;  1OCC H;  2HR3 A;  2XF6 A;  5J1Y A;  4IRH A;  2E5Z A;  3IL2 A;  2R4G A;  1IXR C;  3RQ4 A;  1DU6 A;  3F0C A;  4V2F A;  3OL4 A;  2FMY A;  1TT5 B;  2UXX A;  1W5C C;  4GYI A;  2QQ8 A;  2K3F A;  2R7Q A;  1LVA A;  1FP2 A;  4MFD A;  3TOA A;  5GPC A;  4N0B A;  3B02 A;  2VQG A;  3HTU A;  3OSG A;  3WG9 A;  3M07 A;  3GEZ A;  1KGS A;  1XN7 A;  3DCF A;  4I6Z A;  2L4M A;  1N78 A;  3DPU A;  4M9S A;  4QTR A;  3I58 A;  4UVA A;  5EGO B;  1JT6 A;  1QHH D;  2EB7 A;  2OQG A;  2ZXI A;  4OIP F;  4IEJ A;  2VN2 A;  3LFK A;  4A5M A;  2GA1 A;  2O61 A;  1D0Y A;  2JMW A;  2EIN H;  3FDY A;  4M6X A;  1FMV A;  2OCC H;  2P81 A;  2EV6 A;  4C3J J;  5FKO A;  4I0B A;  1WI3 A;  2FX0 A;  2HVQ A;  2HVS A;  3WTV C;  3QAH A;  1MZB A;  2Y48 A;  5GAG J;  3E5U A;  2VUM J;  1MND A;  2YSR A;  5E3O A;  1OJL A;  1MMG A;  2WA0 A;  2FEZ A;  4A3D J;  3ECH A;  1OCZ H;  2M87 A;  3CLO A;  1IV8 A;  3EUK L;  4I01 A;  1ETY A;  2X0L A;  1X4P A;  2EA2 A;  3DEW A;  2NVT J;  1V55 H;  3OOU A;  2XAH A;  4CZZ A;  3MD2 A;  5HLT A;  4IVN A;  1ZGA A;  1UB9 A;  2MGQ A;  4E7K A;  1FLI A;  1X1C A;  5CVJ A;  4YRV A;  4HOB A;  1F5T A;  2R7U A;  2H1K A;  2CFX A;  4ZYE A;  3P5J A;  4E7Z A;  3OY9 A;  4BHC A;  1FTT A;  1BI0 A;  4HV5 A;  5FRN A;  3I55 I;  4CYC A;  4G6Q A;  1U9N A;  2MW8 A;  3ZGK A;  2R7W A;  2KJB A;  1FIA A;  2QSG X;  1XMA A;  4WWC A;  3EQL F;  2HZD A;  1Z05 A;  3ABM H;  5FGM A;  4WXH A;  1XDS A;  2DPD A;  5D8L B;  4KIF A;  5F27 A;  2OV7 A;  4P55 A;  3G4S I;  1SFX A;  4A0Z A;  2FQ3 A;  1ZTR A;  3EPZ A;  5HDG A;  4NC6 A;  1MDM B;  1A04 A;  2Z9O A;  3EDP A;  5LRR A;  2FOW A;  2Y9Z A;  4QWQ A;  4EJT A;  2Y0S A;  4YII A;  3VDX A;  3CP2 A;  1IN5 A;  4HQE A;  2JN6 A;  4HST A;  3JW4 A;  4RB3 C;  2ESN A;  3GTL J;  3OYK A;  1TL8 A;  2QYO A;  2V9V A;  1FZP B;  1RKW A;  2X9D A;  4ENK A;  1HDD C;  3S3O A;  4AVP A;  1DPR A;  4FIS A;  2M3A A;  3ERE D;  1GT0 C;  3M9A A;  2DI3 A;  2ZFW A;  4A0X A;  1B6A A;  2QQA A;  3V7R A;  2I10 A;  4G6D A;  3CCM I;  3BPV A;  5B66 C;  4DYQ A;  1I1S A;  3OR1 C;  2L9V A;  3JRC A;  1EH8 A;  2XSJ C;  5DTD A;  1UHM A;  4IF4 A;  3FHN A;  3S2H J;  1WVR A;  2OBP A;  1HA8 A;  4KJZ A;  3BLY A;  3I3L A;  4A12 A;  1HKT A;  3FBN B;  2R0Q C;  1O3T A;  2ZJR F;  2X1E A;  1B59 A;  2Z3Y A;  3ZCO A;  4G7Z F;  3JRF A;  1VQM I;  4AYB A;  2LG4 A;  5FKN A;  3WGH A;  1OMI A;  2ELJ A;  3ZQC A;  1YW7 A;  2VJ4 A;  2VBW A;  4XLF A;  3HTS B;  4U7B A;  2CV0 A;  1J09 A;  2L7M P;  1RKT A;  3I59 A;  5L3D A;  1YI2 I;  1IW7 F;  2CQK A;  4YFK F;  3TMO A;  1AKH B;  1LUJ B;  4MFE A;  3GTG J;  2OQR A;  3CCQ I;  2DMU A;  3D5R C;  2BY2 A;  4PFO A;  1FX7 A;  1SVO A;  1BW6 A;  3BG3 A;  1DP7 P;  3TL4 X;  3K4C A;  1T6S A;  2GXA A;  3RSN A;  1Y1W J;  2EV0 A;  4G12 A;  2H6C A;  1PUF B;  2WAF A;  2ZO4 A;  4PJL A;  3GZN B;  3OSF A;  4JK1 X;  1PYV A;  2QCO A;  3P7N A;  3QP5 A;  3CCU I;  1KQ0 A;  5CQG A;  4CCJ A;  4LK1 F;  1MH4 A;  4LG0 A;  2L7K A;  3VB2 A;  2K27 A;  2D1V A;  3BTJ A;  3L00 A;  4HNT A;  5LGN A;  2MD5 A;  2CRG A;  2XDV A;  1VQ8 I;  2EIL H;  4Y17 A;  4MEX F;  1YHQ I;  2HQN A;  2DMT A;  4CZC A;  2X1C A;  1BN5 A;  4DZP A;  2R7R A;  2LD5 A;  1D3Y A;  3IP4 B;  1IRX A;  3DKW A;  3HHH A;  5H20 A;  1G3Y A;  3FX3 A;  2K4B A;  4BDZ A;  4RGS A;  3DTK A;  3NQO A;  2BZT A;  2P5V A;  3FBI B;  3PNT A;  3LSP A;  2VE9 A;  2R5Y B;  1O7F A;  1T39 A;  1H89 C;  1DU0 A;  1Z0X A;  2M8E A;  1XSX A;  5TJJ A;  2QEX I;  2FUG 2;  1EV7 A;  2NNY A;  2O3F A;  5J4V A;  4KYW A;  4D1Q A;  5J1U A;  3HDD A;  1Z7L A;  3EUA A;  1FOY A;  3SZT A;  5FLM J;  2RVC A;  1MBK A;  2DA1 A;  3K1M A;  4Y52 J;  4XL9 A;  5L3B A;  3SZP A;  1VQN I;  2UWM A;  4OIN F;  1SD6 A;  1OCR H;  5F1R A;  3GTM J;  4PCQ A;  2VI6 A;  1OYI A;  1EF4 A;  1WJF A;  2FNP A;  1R9T J;  4B3A A;  5IT9 Z;  3B6A A;  4U0W A;  5K5Q A;  2E1C A;  1OYY A;  3BTL A;  3H3V K;  5KAF C;  2L54 A;  5HS7 A;  3RYP A;  2A69 F;  4IHV A;  3OYJ A;  4QPO A;  1OQY A;  1YIO A;  3KP3 A;  4UHT A;  2O03 A;  2JT1 A;  2K4J A;  1ON2 A;  5BPI A;  3RTR A;  2K3P A;  4KT6 A;  2DT7 B;  2KIM A;  2ZXH A;  2OUM A;  2MC4 A;  3D0S A;  1IXS B;  2DA5 A;  4G6T B;  4R79 A;  1CQT A;  2IS1 A;  3FWE A;  3NAR A;  3RKW A;  2KQR A;  3HSR A;  2HVR A;  2TRT A;  3E5X A;  3NEU A;  2F2E A;  2O0Y A;  2F5V A;  1UJ8 A;  1RZ4 A;  1QVU A;  4JP0 A;  3CUQ A;  1UG2 A;  1WSU A;  3BG6 A;  2LKP A;  4XRF A;  1ETX A;  2YU3 A;  3C18 A;  2DPU A;  4OWR B;  2G9W A;  2Y30 A;  5H6Q A;  5JHU A;  2XRN A;  3FXR A;  3FIW A;  4RMN A;  1R49 A;  1GDT A;  2QZ8 A;  1VQL I;  3BR0 A;  2J5P A;  1JGG A;  4RBO A;  1T2K A;  5DYM A;  4IRG A;  1BM9 A;  3UNG C;  2FNA A;  4KIG A;  3REO A;  4W1U A;  2EJR A;  5IYD J;  2F5C A;  2VPL A;  3LA2 A;  3CCY A;  1QHG A;  4A3J J;  2CUJ A;  2V1U A;  5DS9 A;  3WTT C;  1P4W A;  1KYW A;  1X3W B;  1SVM A;  4LLL A;  1MGT A;  1W5T A;  3IAS 2;  2OPT A;  1U0J A;  3ABU A;  3PO3 J;  3H3Z A;  4AU7 A;  4M6V A;  4BEH B;  2E2H J;  3EYY A;  2KPM A;  1E3H A;  4L9V A;  2M4K A;  4U0V A;  1FYL A;  1WCM J;  3OIQ A;  4C2T A;  2WAE A;  4ZH4 F;  2YX4 A;  4ZYD A;  1PP7 U;  4L18 B;  2E7W A;  4FT8 A;  2CV1 A;  4RLQ A;  1SFK A;  2FRH A;  2YX7 A;  1ERD A;  3I54 A;  3SFZ A;  2CJJ A;  1Z3Y A;  4IPA A;  1K6Y A;  2DOF A;  2LF7 A;  3DV8 A;  5TRD A;  1R1T A;  3KP5 A;  3IH4 A;  3BZ6 A;  5F1J A;  2NVY J;  3CLQ A;  2PX9 A;  1V5E A;  3MWM A;  2R7D A;  3ISP A;  4MQV A;  1J0R A;  1KU9 A;  1WJD A;  4EEF G;  3JAM Z;  3E5Q A;  1GHC A;  4PJJ A;  1K61 A;  2HYJ A;  3PQK A;  1VTN C;  3H0G J;  4N9I A;  1FBQ A;  4L0Y B;  1OYW A;  3SQN A;  3OS2 A;  2QSH X;  2ACJ A;  4IHX A;  2XF5 A;  2KRF A;  5J8F A;  2L0K A;  5C44 J;  1SFO J;  2KL4 A;  3KP2 A;  4A3G J;  3CCJ I;  4IQJ A;  2LTP A;  2UXN A;  4AID A;  1ACI A;  3BZK A;  3IWF A;  4LLN A;  1J2X A;  2ELH A;  3OV8 A;  1F36 A;  3KPH A;  1RET A;  4UV8 A;  2IGO A;  4EJW A;  3LOC A;  4DOZ A;  4Z6Y A;  2BOL A;  3QU3 A;  1BJA A;  1IUF A;  4Y33 A;  3JRI A;  4B47 A;  4BGD A;  4B1R A;  4P96 A;  2Q2E A;  3FXL A;  5D5V B;  3J81 K;  2WY8 Q;  3QWL A;  3TED A;  4EM1 A;  4ZC3 A;  2VB6 A;  2IGK A;  4LIU A;  1CGP A;  4WX9 A;  1KYZ A;  2N8G A;  4BH9 A;  3I71 A;  4CSW A;  2UUZ A;  3S14 J;  3KP7 A;  1UZC A;  1U8R A;  1FYK A;  3OYB A;  2M30 A;  1ZN2 A;  1D1A A;  1YJW I;  4FET A;  2W85 A;  1QU3 A;  5CVV A;  2YUS A;  4EGY A;  3I4P A;  1MMD A;  1IZ1 A;  1V54 H;  2C6Y A;  5ICF A;  1YFH A;  2COB A;  3DTE A;  4J00 A;  1X1P A;  2JPC A;  1ZLK A;  3IHU A;  4HSR A;  1IRZ A;  2FOK A;  3GLX A;  4I7H A;  3OYC A;  2VXZ A;  1OR7 C;  4RA2 A;  3MAJ A;  1HDP A;  3VYU B;  3I56 I;  1KQ8 A;  2IA1 A;  3HKZ A;  3EYI A;  1B72 A;  1OCO H;  2A3S A;  2VL8 A;  2I8D A;  1A6Q A;  1ZG5 A;  4L9J A;  2GOX B;  4DBQ A;  1IXC A;  3E0J B;  3OIO A;  5BPD A;  2PBI A;  3WGI A;  5EG0 A;  3LA7 A;  4M9Z A;  1QGP A;  5IYC J;  3WU1 B;  1GVJ A;  3EUH C;  4EGZ A;  1UHW A;  5IT3 A;  3BQZ A;  3CZ6 A;  3JTH A;  4JYK A;  1MBF A;  3ABL H;  1K79 A;  1ZRE A;  1IG7 A;  2HDW A;  2OCE A;  4ZYG A;  1IRF A;  2ZCW A;  3GCM A;  1S7O A;  2JUC A;  2JPB A;  4ZYH A;  2IAI A;  5E3N A;  2FA5 A;  1AOY A;  1E3O C;  3T1B A;  2PN6 A;  3E3V A;  2CH0 A;  2O5R A;  3KP4 A;  3PUB A;  4L9T A;  3ZQF A;  5HDN A;  1O3S A;  1QPI A;  1QZE A;  3S17 J;  1BA5 A;  1Z1D A;  4NC7 A;  3RCO A;  1LKX A;  4HX4 A;  4AIJ A;  1HC8 A;  2FBK A;  1SAN A;  1UCR A;  3J7A O;  2QWW A;  1BOA A;  2KKO A;  3C3W A;  3TW6 A;  2HYF A;  4H4K C;  3CUO A;  1NTC A;  3K4K A;  3HOU J;  2MG4 A;  2ZXJ A;  4HNU A;  4X0G A;  4RM2 A;  3OYI A;  5M3F J;  1JHF A;  4LLG F;  3MZY A;  2DTR A;  2W48 A;  3I64 A;  4XKC A;  2LBF A;  2E2I J;  3RZD J;  1X3U A;  3BTI A;  3COA C;  3V7C A;  3ZQ7 A;  4E7L A;  1P4X A;  2MAB A;  3GZ5 A;  5JR3 A;  3DEU A;  1YS7 A;  3JSO A;  5IP7 J;  1R6R A;  3LSR A;  1YQA A;  2RKH A;  4B3X A;  1UHS A;  4ASN A;  1XC5 A;  2QSF X;  5D5W B;  1JKO C;  2Y2Z A;  4XLP F;  3PIP F;  3M1E A;  1A35 A;  2IP2 A;  1DGW Y;  4PUS A;  1AHD P;  2RAE A;  2E36 A;  2IA2 A;  4A3E J;  1FOX A;  4PGG A;  2CUE A;  4ENM A;  2FXA A;  3V4G A;  4EJU A;  3LSK A;  3LSJ A;  3V8K A;  1XB4 A;  1T8I A;  2OTL I;  2VAS A;  3GO5 A;  4AC0 A;  1IF1 A;  2LOO A;  1HOM A;  2EH3 A;  4U0Y A;  4B09 A;  2IGM A;  4Q4Z F;  5C4J J;  1VQ4 I;  3CO7 C;  2VT2 A;  5KVR A;  3PFY A;  3BJO A;  3CQZ J;  1BBY A;  4Y15 A;  4V2G A;  2BY1 A;  2DFE A;  2LH9 A;  3CMY A;  4M6Y A;  2K86 A;  3WTX C;  3DKX A;  5B3S H;  4KFC A;  2VKD A;  2ECC A;  1U2W A;  1Y1V J;  3QOP A;  2K9M A;  1BR4 A;  4AUX A;  1ZR4 A;  3L1P A;  3W6V A;  1T0F C;  1ETV A;  3DEE A;  5HNF A;  2X4H A;  4RAF A;  2OC6 A;  3CCR I;  2L02 A;  2Z33 A;  2NOJ B;  3VSL A;  1USS A;  2LR8 A;  3KLN A;  4A93 J;  4HPQ A;  1TW3 A;  1MKM A;  2DFH A;  2OZ6 A;  3ZMV A;  4CO8 A;  3E97 A;  4II3 A;  4BJ6 C;  3PO2 J;  3AFH A;  1BIA A;  4BDY A;  1SMT A;  3ZMS A;  2IRF G;  2IA0 A;  1NG7 A;  1PJR A;  1QPM A;  1I39 A;  5FFZ A;  1BC8 C;  2L9S A;  4AWX B;  4S0H B;  1KU3 A;  1S9H A;  3BR1 A;  1RRJ A;  1BR1 A;  5IOY A;  3MKY B;  3RPU D;  3OYH A;  1KA8 A;  5GAD J;  2EFQ A;  1JJ6 C;  4UNO A;  4E7S A;  4M3F A;  4MO7 A;  4FAS D;  2K9N A;  2QUF A;  3BRO A;  2D1H A;  1XD7 A;  4RAZ A;  1NK3 P;  2VC1 A;  4BXX J;  1HKQ A;  5D6E A;  2M45 A;  1LE8 A;  5LHG A;  3LFU A;  3F8B A;  3K0L A;  1HW2 A;  3JRE A;  3RKX A;  1REP C;  1FBU A;  1QQI A;  3JRB A;  2MYS A;  4LOC A;  2LKX A;  3P9I A;  3ECO A;  1RI7 A;  3ONQ A;  2XC7 A;  2AQF A;  2DA3 A;  4XNF A;  3QYE A;  4LIT A;  1ZAO A;  4KDP A;  3KX2 A;  2RV8 A;  3FMS A;  1TBX A;  5LBQ A;  3H5A A;  3IC7 A;  2VBX A;  1DUX C;  1VQ6 I;  2GXB A;  4ANJ A;  1T95 A;  2MLK A;  3AG1 H;  4HQM A;  1WI9 A;  2XAG A;  3EET A;  1LQ1 A;  2EPF A;  2IT0 A;  4KIB A;  3A01 A;  2FQ4 A;  1HKS A;  3WE3 A;  2QGU A;  3AG3 H;  2HTS A;  2ZME A;  4B48 A;  3BT9 A;  5ILV A;  2L01 A;  4C2M J;  4BAY A;  4A69 C;  3N97 A;  5GP9 A;  4CDG A;  4GRI A;  4E4H A;  1FBS A;  5EDN A;  3T5X A;  2H1L A;  4ZDL A;  3OWT A;  2I5U A;  3CCS I;  3LAP A;  3WE2 A;  3VOE A;  4C2U A;  3S8P A;  5E8G A;  3AKZ A;  2OF7 A;  5E17 F;  3KCC A;  3OYM A;  1EA3 A;  2PMH A;  3HJE A;  2P6T A;  4BXU A;  1MNM C;  1R00 A;  3GZ6 A;  4QIW N;  1V3F A;  3X2Q H;  2CQN A;  4ENN A;  1QA6 A;  1MW7 A;  2G7U A;  4G7O F;  4N4N B;  1I6X A;  2WAQ N;  2Y9Y A;  2V26 A;  1I27 A;  2M9H A;  2EA4 A;  3CF2 A;  2E2J J;  4QPQ A;  1XDU A;  3RJP A;  3K70 C;  3VWB A;  1W7P B;  4CYD A;  3TO7 A;  1MBE A;  2QVO A;  1AWC A;  2MSY A;  4CCO A;  2VPR A;  4XRS A;  4LMY A;  4EM0 B;  1B72 B;  1G8X A;  3U2R A;  2VT3 A;  5CVI A;  4IHW A;  4U88 A;  3G1M A;  4BE0 A;  4KN4 X;  2R7O A;  5EG0 B;  2LK2 A;  1QZZ A;  2R5Z A;  3K1N A;  1ZGW A;  2LRD A;  3QRF F;  1CF7 A;  2WB1 A;  1B8I A;  4II2 A;  1P9Q C;  3E6C C;  3DU5 A;  1EJ9 A;  4A6D A;  4DNC A;  2PMZ A;  3HOT A;  1FEX A;  2FBI A;  3BG5 A;  5J8C A;  4BQN A;  2DA7 A;  3M4O J;  1G2H A;  4MLO A;  1BR2 A;  3A1Y A;  3HG9 A;  4LD5 A;  4CUG A;  2XRO A;  1LFB A;  3MN2 A;  1D0Z A;  3HRM A;  2UZK A;  2COM A;  1RIO H;  1LDD A;  2QBY A;  1B9M A;  3HUG A;  5HLG A;  4C3H J;  1TZL A;  4A6E A;  4E7H A;  1FSH A;  2GIZ A;  2HFH A;  3F21 A;  4XR6 A;  1IC8 A;  1AU7 A;  2PQ8 A;  4Y4R A;  2JVH A;  2XGE A;  3I9V 2;  4WF2 A;  2VOP A;  3VYS B;  1U9O A;  1NH3 A;  3OYG A;  1ZG3 A;  4MGR A;  5DCF A;  3V42 A;  4GGG A;  2KMU A;  3GX4 X;  2YU9 J;  3T8R A;  1HLV A;  1WJE A;  3IV5 A;  4DZJ A;  3CC2 I;  2ZB9 A;  1WZ2 A;  2VIX A;  5AIQ A;  2V6C A;  4CH7 A;  3CTA A;  2KZG A;  2GM4 A;  1BJZ A;  2XRL A;  4AM3 A;  1R58 A;  1M1E B;  4NQW B;  2XKO A;  3DBH B;  3K6G A;  2HOS A;  2P7V B;  1YYV A;  2DYR H;  2ZNY A;  2L9N A;  4LB6 B;  3BCB A;  1SAX A;  4I02 A;  4UUS A;  1Z21 A;  1Z91 A;  4CCK A;  2MBF A;  4B8X A;  3L7W A;  3MZH A;  2V1N A;  4GO1 A;  5DDG A;  1RNL A;  3QYF A;  2HYG D;  4WXD A;  4OOI A;  1S29 A;  4BU2 A;  4F3Q A;  3IRR A;  2XB0 X;  3CJQ B;  4I0A A;  1Z6T A;  3PSF A;  2A6T A;  2EFN A;  3C1D A;  1XMX A;  1JUP A;  2JA2 A;  2Y75 A;  4P9U A;  3SJM A;  3V8L A;  1YW8 A;  1BI1 A;  4PGH A;  5F04 A;  1U5T A;  2DMN A;  2NAZ A;  1IDZ A;  5KCM A;  4DW6 A;  1RES A;  3BDD A;  1Y8Q B;  2V1X A;  4DBR A;  1W0T A;  3HRT A;  1BC7 C;  3ZMT A;  4CCL A;  1SEU A;  2BW3 A;  3L2Q A;  2XPU A;  2W1O A;  2DJI A;  2RDP A;  4QSH A;  3VFZ A;  4RM3 A;  4CIC A;  3G6E I;  2DW4 A;  1E0E A;  2NS0 A;  2ZJQ F;  3TBI A;  3BPX A;  2D45 A;  2ZSH B;  2VJJ A;  3PSI A;  1F1Z A;  1P4A A;  4G7H F;  3CF5 F;  1HQC A;  2DBB A;  2ZSI B;  3J81 Z;  5D4S A;  2P5L C;  2HDD A;  5LRS A;  5FD5 A;  2NNN A;  2X85 A;  5F08 A;  2K02 A;  1X2M A;  2DA6 A;  2M34 A;  3LSH A;  3ZN0 A;  5BS6 A;  3GFJ A;  4F7Z A;  1L0O C;  1Y39 A;  2R93 J;  1R1U A;  1I5Z A;  1ETW A;  2GLO A;  1V5F A;  5GAE J;  4ZJZ A;  2ZBK A;  3OIP A;  3ZQI A;  4S04 A;  2ID6 A;  4U7D A;  2W24 A;  1D1B A;  1W5S A;  3LMM A;  3WTW C;  2CS3 A;  2AHQ A;  3O6B B;  2Y0S N;  2NRA C;  2HGC A;  1WKM A;  2ICW G;  3S3M A;  4FTH A;  5HLH A;  1VQO I;  1XGS A;  1YO5 C;  3AG4 H;  1A36 A;  1MBH A;  1LFU P;  1TLH B;  3J7A Y;  1K78 A;  2DA4 A;  5E18 F;  1R5I D;  3M8E A;  2ID3 A;  4I99 C;  2DXI A;  1QZY A;  1YLF A;  1IN7 A;  1TWC J;  3A0H C;  5IP9 J;  2HOT A;  3HGG A;  3HPG A;  3ZMU A;  3ML6 A;  3PFI A;  3HIF A;  3KZY A;  1NHA A;  2P8T A;  3KYD B;  3I5U A;  4ZDO A;  3BJ6 A;  3UKG A;  1R4M B;  1FOK A;  5E20 A;  2IJL A;  3TDU C;  4I98 B;  2VKE A;  1XGM A;  4PJ0 C;  3F8M A;  1X3Z B;  3QP6 A;  1J5Y A;  1TNT A;  3L09 A;  2OA4 A;  2BHY A;  3MEX A;  3TW7 A;  1FIP A;  2DOD A;  4AYB N;  4YEL A;  2ZME B;  1HSJ A;  5FD6 A;  1WQ2 A;  4EV0 A;  3SFI A;  5JI6 A;  5KHD A;  2BY3 A;  3HPH A;  3DLL F;  3MFK A;  1W36 C;  1OFC X;  1FMW A;  2KZV A;  1ZKG A;  4H0E A;  2FU4 A;  4ETS A;  2IGN A;  2RRE A;  4HA8 A;  2DTZ A;  3E1S A;  3VPR A;  3R0A A;  2LP0 A;  2YPR A;  4K2E A;  1TNS A;  3R61 A;  4ENJ A;  4E7I A;  4KIS A;  2LNB A;  2X6O A;  4BBS J;  1E2X A;  3RKQ A;  2WC2 A;  5AON A;  3M3Y J;  4JX4 A;  3I0T A;  4A3K J;  3HYI A;  1XX5 A;  2FBH A;  3HC7 A;  2F4O B;  4AVZ A;  4E70 A;  1MH3 A;  2AXT C;  5EYR A;  1I50 J;  3SZG A;  1R5G A;  1ETQ A;  1W7P D;  1XSD A;  4M72 A;  5IP6 A;  1MMS A;  2Y0M A;  3J80 K;  2DFF A;  1GVD A;  2ZC2 A;  4JX5 A;  3F72 A;  4L9N A;  3K7A J;  3M1C A;  3WTU C;  2PFB A;  4BHB A;  3BR3 A;  5LHI A;  4KMU X;  3FKJ A;  2LF8 A;  4HEA 2;  1H0M A;  3K4B A;  4ESJ A;  1XG1 A;  2GOM A;  3QPH A;  5DCM A;  4MHG A;  2H27 A;  2K9Q A;  2W84 A;  3F8N A;  5KAI C;  4D5C A;  5DEQ A;  2HDC A;  1JUM A;  4CYC B;  2BBY A;  2XHK A;  4N9H A;  1TQM A;  3FM3 A;  4F55 A;  2GIV A;  5LHH A;  3TO9 A;  4LG3 A;  2DAO A;  4XIC A;  2FML A;  2XGC A;  2NS8 A;  3HSE A;  3KEO A;  2EK5 A;  4A3M J;  3I53 A;  3MKL A;  3W6J B;  2R3S A;  2XPW A;  2JTV A;  5CKT A;  2GXG A;  4XM3 A;  2RC4 A;  2PJR A;  1ZLJ A;  2CGP A;  5J1R A;  2HQ5 A;  1R4N B;  3LST A;  1U78 A;  3S15 J;  2JRT A;  2MLG A;  4TV7 A;  5EEG A;  4AD9 A;  3FZV A;  4W97 A;  5LGU A;  4CGZ A;  2XGX A;  2O9L A;  1FT9 A;  4PFP A;  3BP8 A;  2L7F P;  4NB5 A;  4EJO A;  3GTK J;  5JHF A;  2O8K A;  2Q0O A;  2R7T A;  5FLX K;  3Q9V A;  1SFE A;  3O8G A;  5BNG A;  1R5H A;  4OU0 A;  4XOP A;  4XN0 A;  2IPQ X;  4ZYA A;  4HX7 A;  3HOV J;  1H8A C;  4GCV A;  2KP6 A;  3RIR A;  1P7J A;  3VEP A;  1OPC A;  3Q9S A;  3K70 D;  1N25 A;  2IS6 A;  4MTD A;  1YRN A;  4DIQ A;  4YFN F;  3SHF A;  1G3T A;  3F6O A;  2UV1 A;  2CQ7 A;  3GWZ A;  3ZP5 A;  2IS2 A;  2TCT A;  5DV5 A;  3BOQ A;  3QPS A;  2AQE A;  4HNV A;  3OS1 A;  2M7B A;  1MMN A;  1Z6R A;  4HX8 A;  3JTG A;  4IJA A;  1WPK A;  3NRV A;  1YX3 A;  4O5V A;  2PJP A;  2L4A A;  2BXY A;  3PQJ A;  2HKX A;  3QOE A;  1E3P A;  4A2U A;  1R7J A;  2EZH A;  4ON0 A;  3P9C A;  3I59 B;  2DOE A;  5HOO A;  5EGO A;  1TC3 C;  1XPX A;  1WH5 A;  4P9F A;  1X1B A;  4MQ9 F;  5E3L A;  4Y7N J;  1LEB A;  4A0Y A;  1ZRF A;  4NHJ A;  1F43 A;  1RPW A;  2STT A;  4LJZ F;  3DQV C;  1T56 A;  1JT0 A;  1ZYR F;  3K1P A;  1JE8 A;  2ME6 A;  5FJ8 J;  1S72 I;  3NWT A;  2QQ9 A;  2H8R A;  1XGO A;  2LVS A;  2RQQ A;  2MC3 A;  4L0Z B;  3DKY A;  3TO6 A;  3GTJ J;  4NDL A;  5GTH C;  5IOZ A;  3JRD A;  2HWV A;  4EVI A;  3H9G A;  3GME A;  2E34 A;  4HYE A;  3U1K A;  4YIF A;  1S7A A;  4AIH A;  3JSP A;  4LG0 B;  2RNJ A;  3MMY B;  3AL0 C;  3S16 J;  5HS9 A;  2X6Y A;  4OIO F;  4XRS G;  3CUQ C;  3J7Z I;  3A0B C;  4DYC A;  5JVT A;  1FJL A;  2CYY A;  1Q1H A;  1J75 A;  2JA6 J;  1MBJ A;  4XSX F;  3A02 A;  2A68 F;  3I4M J;  3KET A;  2H09 A;  2NS7 A;  2A05 A;  2LKS A;  4R1H A;  5FKM A;  5AIP A;  2X6W A;  4RB1 A;  2EWN A;  4IKF A;  4YG2 F;  2GBY A;  2RNG A;  3GFI A;  1WJ5 A;  1EH6 A;  3W6K B;  3ESW B;  3C2G A;  4ITV A;  3OOP A;  2V7F A;  2X6X A;  1P92 A;  4Q5S F;  2V9P A;  2MH9 A;  4WXC A;  4HLY A;  1IDY A;  3CO6 C;  2CWE A;  3E7L A;  5K7H A;  4IOC F;  2D2W A;  4KA4 A;  3BWG A;  2CU7 A;  4XK4 A;  1MSE C;  5CPR B;  3U9G A;  4PZJ A;  3S1R J;  2FD5 A;  2NVX J;  3ROU A;  1B1B A;  4XKV A;  2RQP A;  1I3A A;  2PI0 A;  3WOD F;  1KU2 A;  2E7X A;  5K1Y A;  3W2W A;  5L3F A;  4UY8 I;  1YJ9 I;  1DPU A;  4M3E A;  1G3S A;  1MDM A;  3AAF A;  2VON A;  2DYS H;  2QLZ A;  3H36 A;  2A5Y B;  4IXA A;  1YG2 A;  4D7N A;  3P9K A;  3ZQH A;  3F6V A;  1G59 A;  1D8K A;  4HDV A;  2K9L A;  2WV1 A;  4XSZ F;  3SDB A;  2BHZ A;  2K40 A;  1POG A;  2KDZ A;  3HOZ J;  5F6F A;  2VQL A;  3MZ8 A;  2XUB A;  4BJ5 C;  1BI2 A;  3H92 A;  3HEF A;  3VYR B;  2BEO A;  1UST A;  1T38 A;  2E1M C;  2IEK A;  4QLC U;  5DUI A;  4MTE A;  2E60 A;  2WBM A;  4XON A;  3AL0 B;  1LDK B;  1R1V A;  5GTI C;  1O3R A;  2WV0 A;  4EQQ A;  1SD4 A;  2CW7 A;  3CUQ B;  3O2P E;  2XAQ A;  4J01 A;  3KYC B;  4DQ2 A;  3QOD A;  3N05 A;  1T33 A;  3ZXS A;  1D0X A;  4HF2 A;  2W4S A;  1HW5 A;  4Y3O A;  3HKZ N;  4F91 B;  1J9I A;  3IAM 2;  4Y13 A;  4RLF A;  1ETO A;  1HST A;  1KZH A;  4UVB A;  2KDO A;  2KRC A;  3O3K A;  3GYH X;  1X4O A;  2DK5 A;  2LFB A;  2OJE D;  1VQK I;  2F4M B;  1I1G A;  3GW2 A;  1AKH A;  2JJ7 A;  3Q0W A;  4KMF A;  5BQT A;  2CW0 F;  1F9N A;  1FWZ A;  2ZNZ A;  4O3M A;  2VJI A;  5DUK A;  1I6H J;  3CDL A;  1LEA A;  3HZJ A;  5LEJ A;  4AIK A;  4XQF A;  1F4K A;  2HXI A;  2Z99 A;  3O8H A;  3FXQ A;  1V4R A;  1PUF A;  2ECB A;  4PSW A;  1D5V A;  2F5D A;  4N4O B;  2JSP A;  4IHS A;  1P2F A;  2OAZ A;  4CCN A;  3S1M J;  1VI0 A;  2PG4 A;  3L2V A;  5DM7 F;  1R22 A;  4KUM A;  4NUB A;  4JQF A;  5DD8 A;  1TWH J;  4BJT A;  3LAJ A;  4EAT A;  5IY5 H;  3RKY A;  3IUO A;  2M5W A;  2DMP A;  1D5Y A;  2B63 J;  1TW2 A;  2Z5U A;  2K85 A;  3K4M A;  2EFP A;  3S93 A;  4IHY A;  3HHG A;  5C3E J;  3M8J A;  5ICE A;  3LSG A;  3H3U A;  1BI3 A;  1I3Q J;  1MIJ A;  3C2H A;  3CMM A;  3OYD A;  3ZR8 X;  1Y56 A;  1SVL A;  5ICG A;  2G0E A;  3FF5 A;  1DP3 A;  2AO9 A;  2RN7 A;  4Q47 A;  2E1M B;  2F5E A;  1W36 D;  3ERM A;  1YTY A;  2QM3 A;  2LYC A;  3G3Z A;  1YW9 A;  4PK4 A;  2W57 A;  1Q1V A;  2M7A A;  4A3C J;  5K5R A;  2LSO A;  3DFG A;  2EFW A;  2K5C A;  5K7Z A;  2NVQ J;  1MNE A;  3G1L A;  2BE5 F;  2ISY A;  5HDK A;  5EZG A;  3PNV A;  1O4X A;  5FKL A;  1LFP A;  1YE9 A;  3ZQG A;  4EJV A;  2VC0 A;  2IXS A;  3MKW B;  2BGC A;  1VFC A;  3WHC A;  5ICC A;  4U87 A;  3RZO J;  3OYN A;  3TP3 A;  1S3J A;  2HXO A;  1Y0N A;  2EIK H;  3K10 A;  2DK8 A;  4KT5 C;  2EQR A;  2IVM A;  2O6G E;  4OMY A;  2XF7 A;  2XGD A;  3MKZ A;  3BC8 A;  3F9K A;  1T08 B;  2BXZ A;  2LLK A;  1MMA A;  5ERI A;  1YRN B;  2Y69 H;  2R7Z J;  2KIS A;  2DQR A;  4FHT A;  3RDI A;  1S7E A;  2BVM A;  2Q2E B;  2P0W A;  3MCZ A;  2ZJ2 A;  2WTE A;  2G7H A;  2VXD A;  2DT6 A;  3MVP A;  1JKQ C;  3JRH A;  5M5Y J;  5CVU A;  3FXM A;  4I2O A;  4XLC A;  1QVT A;  2KRH A;  3HRU A;  3DBR B;  4XLA A;  5CQE A;  1U6G A;  1XSV A;  3HB9 A;  1ZR2 A;  2VE8 A;  4FX4 A;  1IGN A;  4ABZ A;  3FXU A;  3GFL A;  3H9Q A;  4OMZ A;  3WG7 H;  2B0L A;  4C30 A;  1J7K A;  2EBI A;  1YIT I;  4GFB A;  2BV6 A;  1PUE E;  5H6R A;  3W2A A;  3E6D A;  3M7G A;  4ZZL A;  4CCM A;  4UXN A;  4A3F J;  1H9T A;  2MFZ A;  4XLN F;  1GLN A;  2VOD A;  1ONV A;  4X1E A;  4CXF A;  5A2Q K;  1IUY A;  5IPA A;  3GBG A;  2Z16 A;  3F3X A;  3QPT A;  2WWY A;  1SC7 A;  2M2E A;  3T0Y A;  4XN3 A;  1U8B A;  2YS9 A;  3PL8 A;  3SDG A;  1GUU A;  1OCP A;  5FRO A;  2LDU A;  5M3M J;  4XKB A;  4ZTJ A;  3LQQ A;  4XOR A;  3ZRG A;  1OLT A;  2XB5 A;  1JI8 A;  2HTJ A;  3H5N A;  3S3N A;  4MIM A;  3MQ0 A;  1FOW A;  3CDH A;  3DP7 A;  4LFU A;  4S05 A;  3D1N I;  1RUN A;  4PDK A;  2CUZ A;  5FRM A;  3S2W A;  1DQU A;  5L3C A;  2DT5 A;  5C4X J;  4IHT A;  1TQP A;  1R71 A;  1ZQ3 P;  2JA7 J;  4BY1 J;  4BEH A;  3T8T A;  2GAU A;  3FHZ A;  1TP4 A;  3NAU A;  4EM2 A;  5KNL A;  4IZZ A;  3K2A A;  2AS5 F;  3H35 A;  1QBJ A;  2JUG A;  2WY7 Q;  3K4J A;  3LSM A;  1ZEL A;  3J80 Z;  2XAS A;  4RAY A;  4L5J A;  3B73 A;  3CES A;  2CO5 A;  3HSF A;  3RPU A;  2IW5 A;  1A31 A;  3IKT A;  2DO7 A;  3PIO F;  2FF4 A;  4WK8 F;  2K7L A;  2L5Q A;  2KFD A;  3DXJ F;  2MD0 A;  1W0U A;  3CP8 A;  1JKR C;  1RR7 A;  4UB6 C;  3GTQ J;  1PVE A;  2Q8K A;  2VLA A;  2LBF B;  3DWL E;  5EZH A;  3H1C A;  2F6C A;  3GTO J;  2ISZ A;  5E79 C;  3UR3 C;  5FO5 A;  1O3Q A;  4P1W A;  5F64 A;  3OR2 C;  3V7S A;  3IWZ A;  2L7Z A;  1JHH A;  1VZ0 A;  2O7O A;  1ZRC A;  3KZZ A;  2Y31 A;  4JBA A;  1NK2 P;  4GXO A;  4HDU A;  1U3E M;  3GVA A;  3H5R A;  1OIS A;  1B9N A;  1XMK A;  2ZXW H;  2DCE A;  1YX5 A;  3VOD A;  1TTY A;  5HLI A;  1WRJ A;  1G3W A;  2A5W A;  2L9R A;  3CCL I;  5M5X J;  2JA8 J;  1J59 A;  4KIC A;  3OL3 A;  4L5E A;  2R7S A;  4UB8 C;  1Z67 A;  4M71 A;  5GAH J;  2EZK A;  5FLX Z;  2M4G A;  2GZW A;  2QKL B;  1WFX A;  2JWT A;  2P7C B;  2F4I A;  3DLA A;  2DDB A;  1TWF J;  1MJA A;  2QEN A;  4OAY A;  4M3D A;  5EJC A;  4HRI A;  1UAA A;  3HXL A;  1GXP A;  3CJN A;  1V5G A;  3R60 A;  2ZME C;  3IH3 A;  1XTA A;  3PNY A;  1Z3X A;  2E35 A;  2AXL A;  2KIQ A;  4M3G A;  4O6J A;  3SYT A;  2WB1 N;  1HBX G;  1JGS A;  3Q3S A;  5FKK A;  2H6B A;  2FSW A;  5K7F A;  2CQQ A;  5IYB J;  4YIR X;  2PMZ N;  5LD2 C;  3N4M A;  2A6H F;  2V79 A;  1TQI A;  3BG9 A;  3KE2 A;  4HG2 A;  4A3I J;  5JLW A;  2DLL A;  4RS8 A;  4D7M A;  1LPQ A;  3M8F A;  4B44 A;  1KON A;  3SEZ A;  2CFO A;  3OYE A;  1K6O A;  2JZY A;  1GXQ A;  5J47 A;  3JRA A;  3OYL A;  4WCG A;  3OYA A;  4RGX A;  2HKO A;  1IAW A;  3BZC A;  2HI3 A;  3KZI C;  1PDN C;  1EKE A;  2OZU A;  3FM5 A;  2Z2S B;  3CCE I;  1MJ9 A;  1WGX A;  5E1W A;  3GXO A;  3HGY A;  1Y8R B;  3IH2 A;  5E1Z B;  3ABK H;  4IX7 A;  1ITY A;  2ZKZ A;  1HW1 A;  1SAU A;  4RGU A;  1NG6 A;  4BBR J;  4I09 A;  5EF6 A;  3D5L A;  3K4N A;  3DPT A;  4PSX A;  1LE8 B;  2VOO A;  3FK7 A;  3RPQ A;  3CCV I;  2ZJP F;  4HF1 A;  1G4D A;  5J40 A;  1TWG J;  4DYR A;  1KQ9 A;  1SMY F;  1QRY A;  3HOS A;  1YJN I;  3H9J A;  4D9J A;  2HS5 A;  4BHP A;  2F48 A;  3GTP J;  1VF9 A;  5CVR A;  4MNU A;  2EFO A;  4RDU A;  3SXY A;  3BR2 A;  3WU0 A;  5ILU A;  1FSE A;  3OYF A;  4NC8 A;  3BTC A;  3G71 I;  4M74 A;  4XOT A;  1Y0U A;  1YS6 A;  2GA2 A;  2P6S A;  3A01 B;  1FPQ A;  1P6R A;  2W82 A;  2A07 F;  1IN4 A;  4GYG A;  2CSO A;  4R8H A;  1YOV B;  2Q1Z B;  3H0D A;  1K83 J;  2KJC A;  4IQ4 A;  2ETH A;  2GQQ A;  2EZL A;  5EEH A;  4BE1 A;  4G9Y A;  1VND A;  1OCT C;  3ABT A;  1H9G A;  2M8G X;  1JJ8 C;  1DGR M;  1JTX A;  3S2D J;  4RB0 A;  1OR7 A;  2X48 A;  4BS9 A;  1APL C;  1FC3 A;  3CDI A;  3A03 A;  4LIV A;  4CHU A;  4JX6 A;  5CJ9 A;  4D0P A;  3W2V A;  1K4T A;  2HPI A;  3KLO A;  3KEY A;  4BL0 B;  3VSK A;  3CJT B;  2JSC A;  2HQA A;  4Q48 A;  3PJR A;  1ZHF A;  5EEA A;  5BMZ A;  4UUT A;  2KT0 A;  3LA3 A;  1W4M A;  5LGT A;  2NOG A;  3EUH A;  1X2N A;  2L2O A;  2VKH A;  5DD4 A;  4ZTF A;  1D1C A;  3KFW X;  5F0C A;  2CG4 A;  1N77 A;  2DMQ A;  3FMQ A;  4P5O A;  3HOY J;  1ZK8 A;  4YFX F;  4JOM A;  3K9T A;  5JLX A;  4OIQ F;  4F92 B;  5HOD A;  1LJ9 A;  4ZDP A;  1DDN A;  4L5I A;  2CW8 A;  3A2K A;  1TT0 A;  2E5N A;  1HXD A;  3CC7 I;  3PM1 A;  4HBL A;  5J6X A;  2HPM A;  3L2C A;  2R5Z B;  5TIS C;  3KEQ A;  2ADU A;  2E19 A;  1ENH A;  1CF7 B;  1B8I B;  2A6E F;  3QU6 A;  2R7F A;  3BR6 A;  5L3G A;  2JRM A;  3WGG A;  3K4L A;  1IN6 A;  3Q0V A;  3HRS A;  1VQ9 I;  1ZH5 A;  3FXO A;  4KIT B;  1U5T C;  3LNQ A;  1TWA J;  4XBF A;  5CYV A;  1MBG A;  2Z1D A;  1K7A A;  3JR9 A;  2FE3 A;  2F5F A;  5L3E A;  2XSD C;  2A61 A;  5B1B H;  1LNW A;  3G73 A;  3TKY A;  3TOB A;  4UUV A;  2QBY B;  1XGN A;  2O8X A;  2HQR A;  3BR5 A;  3HUG B;  4A5N A;  1Y6I A;  3FXK A;  3ELK A;  3GUD A;  1BOB A;  1AA7 A;  4A3L J;  3LWF A;  4BAC A;  2W7N A;  1ZAR A;  1IRG A;  4BQA A;  2VBY A;  1WJB A;  2P5K A;  3J7Y J;  4BYY A;  1BW5 A;  1C0W A;  2CUF A;  3U21 A;  4RAG A;  3CMA I;  3ZQQ A;  1FTZ A;  4A3B J;  4BE2 A;  2JA5 J;  3DF8 A;  2CQX A;  2J5O A;  4HV6 A;  2XIG A;  2B7E A;  3S32 A;  5HVQ C;  1KU7 A;  2KIU A;  3GFM A;  1N75 A;  5F0H A;  5D6F A; 
#chains in the Genus database with same CATH homology
 1T33 A;  3LSP A;  4IHW A;  2R5Y B;  1H89 C;  3G1M A;  2VKV A;  1DU0 A;  1Z0X A;  3HKZ N;  5EG0 B;  2LK2 A;  2R5Z A;  1ZGW A;  5J1U A;  4UUS B;  3HDD A;  1B8I A;  1ETO A;  4FE4 A;  4FE7 A;  5FLM J;  3G1O A;  2LFB A;  1MBK A;  2DA1 A;  4Y52 J;  4BY7 J;  1FEX A;  1AKH A;  2XPV A;  2JJ7 A;  3BG5 A;  3Q0W A;  2DA7 A;  3GTM J;  2VI6 A;  1IV6 A;  3M4O J;  3HOX J;  1EF4 A;  1G2H A;  4MLO A;  4M3B A;  1I6H J;  1LFB A;  3CDL A;  3MN2 A;  1R9T J;  3FKI J;  4B3A A;  2IBD A;  3B6A A;  2HXI A;  3O8H A;  3RQI A;  1PUF A;  2ECB A;  3H3V K;  3BTL A;  4C3H J;  2E1O A;  2D5V A;  4XID A;  4IHV A;  3S1M J;  1VI0 A;  2M0C A;  1IC8 A;  1AU7 A;  1TWH J;  2XGE A;  1U9O A;  1HCR A;  2DMP A;  1D5Y A;  2B63 J;  1JTY A;  2QF7 A;  5M5W J;  2DA5 A;  1CQT A;  4IHY A;  3FK6 A;  5C3E J;  1ETK A;  3LSG A;  3NAR A;  3S1Q J;  2YU9 J;  1I3Q J;  1HLV A;  2TRT A;  3IV5 A;  4DZJ A;  2ZB9 A;  1X58 A;  1QVU A;  4JP0 A;  2GM4 A;  1BJZ A;  2JK3 A;  1UG2 A;  2G0E A;  2DJN A;  2XRL A;  2AO9 A;  5F0F A;  1ETX A;  2Y30 A;  1GDT A;  3FIW A;  1Q1V A;  2HOS A;  4A3C J;  3BR0 A;  5J3L A;  1GV2 A;  1JGG A;  5K7Z A;  2NVQ J;  3G1L A;  4UUS A;  4RBO A;  5EZG A;  4FCY A;  1O4X A;  5FKL A;  3ZQG A;  4W1U A;  5IYD J;  2HOA A;  1VFC A;  3WHC A;  3ZOB A;  3RZO J;  3CCY A;  9ANT A;  3TP3 A;  4A3J J;  4B4C A;  2HXO A;  2XB0 X;  5DS9 A;  2FJ1 A;  3HM5 A;  2EQR A;  3FIS A;  4I76 A;  1JUP A;  2XGD A;  3SJM A;  2OPT A;  5F04 A;  3PO3 J;  2LLK A;  2DMN A;  4X6A J;  1IDZ A;  1YRN B;  4DW6 A;  1RES A;  4M6V A;  2R7Z J;  1W0T A;  2E2H J;  5E3M A;  1S7E A;  1WCM J;  2XPU A;  1WH7 A;  3MVP A;  1JKQ C;  3Q0U A;  4QSH A;  3JRH A;  5M5Y J;  1H88 C;  1QVT A;  4C3I J;  3JRG A;  1XS9 A;  3HB9 A;  2CJJ A;  1ZR2 A;  4BKX A;  3IH4 A;  1IGN A;  3QPL A;  4ABZ A;  5F1J A;  2NVY J;  2HDD A;  2EBI A;  4GFB A;  5F08 A;  1X2M A;  2DA6 A;  4EEF G;  2M34 A;  4A3F J;  1K61 A;  2HYJ A;  2R93 J;  3I4N J;  3H0G J;  3TP0 A;  4X1E A;  1ETW A;  4J19 A;  2GLO A;  2ELK A;  2EZI A;  1ORK A;  3ZQI A;  5IPA A;  3GBG A;  2ID6 A;  1IJW C;  2ME0 A;  2M2E A;  1U8B A;  4IHX A;  1JKP C;  5C44 J;  2AHQ A;  2L0K A;  2Y0S N;  2YS9 A;  1SFO J;  3SDG A;  1GUU A;  5FLV A;  1OCP A;  4A3G J;  4D5F A;  4FTH A;  5M3M J;  2LTP A;  2XB5 A;  1MBH A;  1LFU P;  4MIM A;  1F36 A;  3D1N I;  2DA4 A;  3QQA A;  1RET A;  2ID3 A;  3LOC A;  1GV5 A;  1Z77 A;  1TWC J;  5C4X J;  5IP9 J;  1ZQ3 P;  2HOT A;  3HGG A;  2JA7 J;  4BY1 J;  1IUF A;  1MSF C;  3JRI A;  3S1N J;  3NAU A;  4B1R A;  5GPA A;  3UKG A;  3K2A A;  3TED A;  2VKE A;  2N8G A;  3S14 J;  3TW7 A;  1FIP A;  4AYB N;  2DN0 A;  2YUS A;  3HBL A;  3HOW J;  1IRZ A;  2COB A;  3SFI A;  1W0U A;  1HF0 A;  3C2B A;  1JKR C;  1OFC X;  1RR7 A;  1ZKG A;  2DA2 A;  1P7I A;  1HDP A;  3GTQ J;  2K9S A;  2R92 J;  2DTZ A;  1B72 A;  3VPR A;  5EZH A;  3GTO J;  2LP0 A;  3WHB A;  3BQY A;  4XRM A;  2R5Y A;  2LY9 A;  3OIO A;  2X6O A;  4BBS J;  3RKQ A;  5EG0 A;  3M3Y J;  4JX4 A;  4A3K J;  3ZQL A;  5IYC J;  2L7Z A;  1A5J A;  2O7O A;  1MH3 A;  2Y31 A;  5EYR A;  3BQZ A;  3B6C A;  1I50 J;  1NK2 P;  4JYK A;  1MBF A;  1ETQ A;  1IG7 A;  1BL0 A;  1A6I A;  5IP6 A;  1GVD A;  1UMQ A;  4JX5 A;  1JUS A;  2IAI A;  3K7A J;  5E3N A;  2L9R A;  5M5X J;  2JA8 J;  5J1Y A;  1E3O C;  3BR3 A;  4L5E A;  3ZQF A;  1DU6 A;  3F0C A;  1QPI A;  2EZK A;  4V2F A;  3S17 J;  1BA5 A;  2JWT A;  1TWF J;  1XG1 A;  5GPC A;  4M3D A;  4MFD A;  1SAN A;  2K9Q A;  4D5C A;  1JUM A;  3TW6 A;  3OSG A;  3IH3 A;  4CYC B;  4M3G A;  1NTC A;  3DCF A;  4I6Z A;  2WB1 N;  3HOU J;  2MG4 A;  3Q3S A;  5FKK A;  5K7F A;  4QTR A;  2CQQ A;  5IYB J;  5M3F J;  2PMZ N;  2XGC A;  4XIC A;  1JT6 A;  2NS8 A;  5EGO B;  4A3M J;  2W48 A;  3MKL A;  3BG9 A;  2XPW A;  4A3I J;  5JLW A;  4D7M A;  3RZD J;  2E2I J;  3BTI A;  4IEJ A;  5J1R A;  2HQ5 A;  1U78 A;  2JMW A;  3S15 J;  5IP7 J;  3JRA A;  3LSR A;  4W97 A;  1UHS A;  2P81 A;  4C3J J;  1XC5 A;  2HI3 A;  5FKO A;  2O9L A;  1WI3 A;  1JKO C;  2L7F P;  3GTK J;  2Y2Z A;  2FX0 A;  2O8K A;  1AHD P;  2RAE A;  1WGX A;  2VUM J;  3HGY A;  3IH2 A;  1ITY A;  3O8G A;  5BNG A;  5E3O A;  1OJL A;  4A3E J;  2CUE A;  4BBR J;  4A3D J;  3HOV J;  5EF6 A;  3LSJ A;  1H8A C;  1LE8 B;  1P7J A;  3FK7 A;  4AC0 A;  1ETY A;  1HOM A;  2EH3 A;  3DEW A;  1YRN A;  2NVT J;  1TWG J;  4DYR A;  3OOU A;  5C4J J;  1QRY A;  3CQZ J;  2MGQ A;  2TCT A;  4V2G A;  3QPS A;  4HNV A;  2H1K A;  3CMY A;  3GTP J;  1VF9 A;  1FTT A;  4RDU A;  1WPK A;  3BR2 A;  4CYC A;  2ECC A;  1Y1V J;  1U9N A;  2MW8 A;  3BTC A;  1FIA A;  4AUX A;  1ZR4 A;  3L1P A;  2EZH A;  3W6V A;  1ETV A;  3A01 B;  1TC3 C;  5EGO A;  1WH5 A;  5E3L A;  4Y7N J;  1K83 J;  5F27 A;  1F43 A;  2EZL A;  1RPW A;  1VND A;  1OCT C;  1ZTR A;  2LR8 A;  2M8G X;  1JJ8 C;  1T56 A;  1JT0 A;  4A93 J;  1JTX A;  3S2D J;  1APL C;  2X48 A;  2Y9Z A;  3A03 A;  2ME6 A;  5FJ8 J;  3PO2 J;  2H8R A;  2LVS A;  4JX6 A;  2JN6 A;  3GTL J;  4S0H B;  3GTJ J;  3BR1 A;  4NDL A;  5IOZ A;  5IOY A;  3JRD A;  1RKW A;  2X9D A;  5EEA A;  1JJ6 C;  4UUT A;  2KT0 A;  1HDD C;  4M3F A;  4MO7 A;  2K9N A;  4FIS A;  3S16 J;  2NOG A;  1GT0 C;  1X2N A;  1NK3 P;  4XRS G;  4BXX J;  2I10 A;  1LE8 A;  4DYC A;  5F0C A;  1FJL A;  3JRE A;  2DMQ A;  3HOY J;  4DYQ A;  1ZK8 A;  1MBJ A;  2JA6 J;  3A02 A;  3JRB A;  5JLX A;  3I4M J;  3JRC A;  4LOC A;  2NS7 A;  5HOD A;  2LKX A;  5FKM A;  5DTD A;  3S2H J;  2GBY A;  2DA3 A;  2R0Q C;  3PM1 A;  3JRF A;  1IDY A;  3E7L A;  5FKN A;  5K7H A;  2R5Z B;  2CU7 A;  4XK4 A;  1MSE C;  2E19 A;  1ENH A;  1B8I B;  3ZQC A;  3S1R J;  2FD5 A;  2NVX J;  3A01 A;  2FQ4 A;  3BR6 A;  2L7M P;  1RKT A;  3Q0V A;  1AKH B;  3BT9 A;  3LNQ A;  4MFE A;  1TWA J;  3GTG J;  4C2M J;  1MBG A;  4M3E A;  3JR9 A;  4A69 C;  5GP9 A;  2DMU A;  2XSD C;  1BW6 A;  3BG3 A;  5EDN A;  4D7N A;  1Y1W J;  3ZQH A;  4G12 A;  1PUF B;  3BR5 A;  3OSF A;  2OF7 A;  2QCO A;  2WV1 A;  2K40 A;  4A3L J;  1MNM C;  1POG A;  2KDZ A;  3HOZ J;  4QIW N;  1MH4 A;  3HEF A;  3BTJ A;  2WAQ N;  2Y9Y A;  1BW5 A;  2CRG A;  2CUF A;  2IEK A;  2M9H A;  2E2J J;  2DMT A;  4DZP A;  1FTZ A;  4A3B J;  2LD5 A;  2JA5 J;  1MBE A;  2CQX A;  2MSY A;  2VPR A;  4XRS A;  1B72 B;  5F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...