1B72A

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
68
Chain Sequence
ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/dna
total genus 21
structure length 68
sequence length 88
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72A00
2ID6A 4A3JJ 3JR9A 1LFUP 1U9OA 3H0GJ 2ELKA 5J1YA 5EEAA 3BTIA 2GM4A 3CCYA 1GV2A 1ZR2A 4BBSJ 2FJ1A 2YS9A 2CU7A 1IRZA 3PO2J 2M2EA 2ECBA 2XRLA 4V2GA 3JRCA 4XRMA 2CJJA 5M3FJ 1ITYA 1ZKGA 1VF9A 4IHYA 1WCMJ 2P81A 2DJNA 2R5YA 2EBIA 2DMUA 2DA5A 2VKVA 1RR7A 3WHCA 2B63J 3BR0A 2ECCA 3PM1A 3NAUA 3GTGJ 1O4XA 4AUXA 2IEKA 4V2FA 1ETXA 2JN6A 2LFBA 1E3OC 1ETWA 1JKRC 2Y0SN 1Z0XA 2L7FP 2NVQJ 3LSRA 1WPKA 5EG0B 3GTMJ 3HM5A 5F0CA 3S1NJ 2LVSA 5JLWA 1A6IA 3GTOJ 1MNMC 3TEDA 3A01A 3LNQA 4RBOA 3B6AA 1QRYA 1ETOA 4RDUA 4FISA 1DU0A 2O7OA 1IDZA 2E2IJ 1A5JA 1JTXA 1FIAA 4C3IJ 3S2HJ 3BR5A 1BJZA 3RZDJ 3FK7A 1ZQ3P 3FIWA 1MBJA 1ETVA 3HKZN 3BTJA 3BG5A 3DCFA 5J1UA 2KDZA 3FKIJ 5E3NA 1U78A 1XS9A 5FKLA 2H8RA 2MGQA 1LE8B 3ZQLA 3IH3A 5FKOA 3BG9A 2EZHA 3HGYA 2XPWA 2CRGA 3W6VA 3ZQGA 5BNGA 4G12A 1RPWA 1HLVA 2NS7A 2FQ4A 4A3MJ 1HOMA 2Y9ZA 4FTHA 2LK2A 1GV5A 1B72A 4A3DJ 1WGXA 3S17J 3BT9A 1ETKA 5M5XJ 3B6CA 4M6VA 2LY9A 2IAIA 3A02A 4M3DA 1BA5A 4C2MJ 2R92J 1CQTA 1XG1A 2MG4A 2EZLA 3S1MJ 3JREA 2KT0A 3SFIA 3ZQIA 1X2NA 5EZHA 3M3YJ 1UG2A 4A3IJ 4D7MA 5EGOB 1RKTA 2JK3A 1MBEA 2MSYA 4AYBN 1POGA 2TRTA 3TP3A 1RESA 4D5FA 1HDPA 5FKNA 4Y52J 4JYKA 2PMZN 2ZB9A 1ZK8A 1YRNB 2JMWA 2EZIA 2HXIA 4CYCA 5EZGA 2VPRA 4I6ZA 3G1MA 4MFEA 5IP9J 4A3FJ 3HOUJ 4C3HJ 1AU7A 1Z77A 4IHXA 5F27A 1P7JA 2R5ZB 2O8KA 1AKHB 3HOZJ 2E19A 5IP6A 1LFBA 1Q1VA 4IEJA 2E2JJ 1JKOC 2DMQA 4IHWA 2DMNA 2X6OA 4JX5A 5F08A 4XRSA 3CMYA 2E1OA 1TWGJ 4D5CA 2AO9A 5EF6A 1D5YA 3S1QJ 3GTQJ 4A69C 4D7NA 4JX6A 2JA7J 2OF7A 4HNVA 2K40A 2XSDC 2WB1N 5IYCJ 2WV1A 2X48A 3Q0VA 1OFCX 1I6HJ 4UUSB 1R9TJ 1TC3C 1RETA 2Y2ZA 3BR2A 1K61A 5FLVA 1GVDA 4Y7NJ 3OOUA 4A3BJ 1Y1VJ 2JA8J 3JRGA 3MVPA 1T56A 2LD5A 4JX4A 4A3GJ 3HB9A 2HI3A 1OJLA 1PUFB 1K83J 1FJLA 1ENHA 2DMTA 3OSGA 3IV5A 3HDDA 4UUTA 1IG7A 1MSFC 3HOWJ 5GPAA 4A3CJ 1B8IB 2I10A 5FJ8J 1FTZA 1SANA 1JT0A 2GLOA 2X9DA 3S2DJ 4EEFG 4A93J 3JRAA 2NVXJ 5J3LA 1I3QJ 1TWFJ 2VKEA 2DA1A 1MSEC 1JUPA 3JRDA 2HOAA 1WI3A 5E3MA 2LR8A 2DN0A 2DTZA 1VNDA 2M9HA 3BQYA 5IOYA 3BQZA 3E7LA 1F36A 3CQZJ 1FIPA 1QPIA 3ZOBA 3RKQA 1I50J 2R5YB 2W48A 3HOYJ 1DU6A 1APLC 4FE7A 3S15J 5C44J 1QVTA 4DYCA 4BY7J 2FD5A 3IH4A 3DEWA 1P7IA 2OPTA 2M8GX 1TWHJ 1JKQC 3NARA 4X1EA 1ZGWA 1X2MA 2G0EA 3IH2A 1JTYA 5IYBJ 2YU9J 3HGGA 3S16J 1EF4A 3BR1A 4DYQA 5JLXA 1H89C 5IPAA 3QQAA 2EQRA 1JJ6C 2XGDA 2HXOA 3A03A 2M0CA 3S1RJ 4BBRJ 3I4MJ 3LSPA 3SDGA 4ABZA 2XGCA 2GBYA 1W0UA 1MH4A 4XRSG 2NVYJ 3A01B 2DA3A 1HCRA 2LLKA 3GTLJ 3OIOA 2NOGA 2ME6A 9ANTA 4MLOA 1ZTRA 4DZPA 5DTDA 1GT0C 1SFOJ 2QCOA 1MH3A 2L7ZA 4X6AJ 2TCTA 5EG0A 3JRIA 3GTKJ 4A3EJ 1JUMA 2ME0A 2ID3A 1ETYA 3G1OA 5EYRA 3FISA 2VUMJ 2Y31A 1HF0A 3Q3SA 1VI0A 2VI6A 3LSJA 3HOVJ 2D5VA 3MKLA 1AHDP 1IV6A 3D1NI 5K7FA 2CUFA 3JRFA 4MO7A 1JKPC 4I76A 5IYDJ 3OSFA 1MBHA 2LP0A 1MBFA 2K9SA 1S7EA 3BR3A 4J19A 5F1JA 2HQ5A 2XPUA 1ETQA 3H3VK 5M5YJ 5GP9A 1UMQA 5F04A 2DA6A 2FX0A 5E3LA 3TW6A 1B72B 1HDDC 2CQQA 3Q0WA 1JUSA 5FLMJ 3LOCA 3Q0UA 1LE8A 1XC5A 3O8HA 1JGGA 4DZJA 1TWAJ 1ORKA 2L0KA 2HOSA 2R93J 1RKWA 3F0CA 4GFBA 2MW8A 3MN2A 2E2HJ 2CUEA 2XPVA 1BW5A 1IGNA 3WHBA 5K7ZA 4AC0A 3QPLA 5M5WJ 3S14J 1W0TA 2L7MP 2H1KA 2R7ZJ 5GPCA 4QTRA 2CQXA 4MFDA 4W97A 3QPSA 4L5EA 4QIWN 1U8BA 1T33A 1G2HA 4B3AA 5F0FA 1GDTA 3RQIA 4CYCB 1FEXA 1QVUA 1BL0A 1H8AC 5J1RA 1NTCA 2R0QC 1BW6A 2DMPA 2NS8A 4DYRA 5EGOA 1JT6A 2K9NA 5IOZA 4LOCA 2EH3A 4XK4A 3SJMA 3G1LA 3GTJJ 5E3OA 4A3KJ 2XB0X 2DA4A 1ZR4A 3LSGA 2JA6J 3HEFA 1GUUA 1Y1WJ 1WH5A 3BG3A 1YRNA 1IJWC 2NVTJ 5K7HA 4B1RA 3HBLA 4B4CA 1IC8A 2XB5A 2QF7A 3L1PA 3I4NJ 2DA7A 1UHSA 1WH7A 2R5ZA 2JJ7A 3ZQHA 1AKHA 4M3GA 5HODA 3BR6A 4BKXA 3JRBA 1X58A 2AHQA 4JP0A 2K9QA 4M3FA 2M34A 2WAQN 2HDDA 2YUSA 5M3MJ 4NDLA 3JRHA 3RZOJ 1IUFA 3O8GA 3PO3J 3FK6A 3TP0A 2O9LA 2JWTA 3K2AA 5FKKA 2Y9YA 4A3LJ 5DS9A 2EZKA 2L9RA 5F0HA 2XGEA 2Y30A 4S0HB 4BY1J 3ZQCA 3GBGA 4M3EA 1TWCJ 4DW6A 4UUSA 1NK2P 2HOTA 1OCTC 4MIMA 3M4OJ 1OCPA 3CDLA 4M3BA 4FE4A 5FKMA 4XICA 1U9NA 5C4XJ 1MBGA 5C3EJ 5C4JJ 2DA2A 2JA5J 3ZQFA 3GTPJ 1FTTA 1PUFA 2COBA 5EDNA 3BTLA 3C2BA 1VFCA 4XIDA 3K7AJ 1MBKA 1H88C 1JJ8C 4IHVA 4QSHA 3TW7A 1NK3P 4FCYA 2N8GA 3BTCA 3UKGA 4BXXJ 4W1UA 5IP7J 2RAEA 3VPRA 4C3JJ 1B8IA 1F43A 3HOXJ 2LTPA 2IBDA 1IDYA 2LKXA 2HYJA
chains in the Genus database with same CATH superfamily
1V3FA 2K9MA 3JR9A 2F5DA 2ZKZA 5GAGJ 1XCVA 3V7CA 2GM4A 1D0YA 3CCYA 4RMNA 1AOYA 2VQCA 1ZR2A 2ELHA 2QA4I 1KQ8A 4FHTA 3VFZA 4N9HA 3CMMA 1VQOI 4OAZA 2O03A 1R6RA 4OIOF 4HX7A 2L01A 4B47A 2CJJA 4PCQA 3OOPA 4L5IA 1N25A 4WXHA 2DJNA 2R5YA 2XAFA 4UVCA 1RR7A 3V7RA 1W5SA 2AQFA 2LH9A 3J7AY 3QU6A 3PM1A 1I27A 2X51A 4AUXA 2ZNZA 4OWRB 4LFUA 1QZZA 4F91B 2BE5F 4CYDA 1W7PA 2NYXA 4G6DA 3T8RA 1OLTA 3ZN1A 2NVQJ 1WPKA 4E70A 1A04A 4WXDA 2O61A 1LQ1A 4EVIA 4BDZA 3DKYA 1Y0NA 3HM5A 5H20A 1FBSA 5F0CA 3S1NJ 4QLCU 2PJRB 2XKPA 1PYVA 2M7AA 1MNMC 4N9IA 4AYBA 2VODA 2EB7A 4CUGA 1X1PA 4HG2A 3J80Z 2CMPA 3OS0A 3B6AA 3PNYA 2HTSA 2K86A 4FISA 3I56I 4G7ZF 3HPHA 1GXQA 2F4OB 4LIVA 2WADA 2K27A 3KEOA 2ADUA 4HF1A 3FIWA 2PBIA 4PSWA 3PSIA 1OR7C 3V8JA 2K4BA 3MZHA 1RR8C 2IW5A 5E3NA 2XHKA 3P9KA 3UNGC 2P5KA 1HSTA 5FKLA 4G7OF 4CXFA 1WJCA 4UHTA 3FF5A 4ZZLA 3A4CA 1SVMA 3ZQLA 2YSRA 3IH3A 2NRAC 5E18F 3BG9A 2XF6A 2XPWA 1MGTA 4IO9F 4G12A 2GIVA 2NS7A 4MTEA 2BBYA 5E1XA 1QPMA 5CPRB 2AS5F 2Y9ZA 1I1SA 5HS8A 3OYNA 2JRTA 1B72A 1WGXA 2DT5A 1YIOA 3FMRA 2CV0A 4AIKA 2CH0A 1XTAA 2L4AA 3V8LA 3E6BA 2DTRA 1XG1A 1XMKA 3S1MJ 3K1NA 6PAXA 1VQ7I 3LAPA 1X2NA 2WA0A 3IKTA 3R4KA 2OBPA 1UG2A 4A3IJ 4GO1A 3K4JA 2JTVA 3E0JB 4EJUA 2FBHA 4AYBN 2TRTA 3EUAA 4JK1X 2AQEA 3M8EA 4LK1F 3TP3A 3KYLA 2FMLA 1HDPA 2ZJ2A 4Y52J 2PMZN 4KN4X 5K1YA 3AKZA 2HXIA 5LHHA 3NRVA 2WBMA 3P7NA 2QKMB 5EZGA 4CYCA 1O57A 1F9NA 3HZJA 4O3MA 2PFBA 3IRRA 3A0BC 1K78B 5H6RA 1HW1A 3GMEA 5JHFA 2V79A 2KISA 4IHXA 5E79C 1BC7C 2ETHA 2MLGA 1TBXA 2QENA 1ZARA 3OYEA 3CCMI 2E19A 1VQPI 4ANJA 1LFBA 4GDFA 2BZTA 2PN6A 4IEJA 1JKOC 1EH7A 2P6SA 3ZGKA 3CCVI 4L9JA 2B7EA 1BOBA 2RQPA 4ZTFA 2EWNA 2X6OA 3SYTA 4XRSA 4KYWA 2E1OA 2QLZA 4UVAA 1O3RA 2EIJH 4JX6A 2JA7J 2LF7A 2OF7A 4HNVA 4U0VA 5DCMA 2DOFA 4AIJA 2XSDC 4BS9A 2WB1N 5IYCJ 4OOIA 2R7SA 2X48A 1QQIA 3TDUC 1LUJB 2HU9A 4S04A 1I6HJ 2STTA 1S9HA 2XVCA 4GYGA 1TC3C 2CUZA 3ASNH 4PK4A 5AIPA 5D5WB 2Z33A 2XF7A 4IVNA 1J9IA 1U5TC 4Y7NJ 3OOUA 4HLXA 2WAQA 3CC4I 4XMYA 2BVMA 5GAEJ 3JTGA 3MVPA 1SD4A 1XSDA 3OY9A 5EJCA 4HOBA 4E7KA 3VWBA 1HKSA 5JI6A 4EGZA 1ENHA 1Z7LA 1FP2A 1HQCA 1IG7A 4R79A 3HOWJ 3TBIA 1FT9A 3C18A 4A3CJ 2CW7A 3DKWA 2A69F 2I10A 3I4PA 3KLOA 4XORA 1IXCA 3M1CA 4PUSA 1FTZA 1SANA 2CG4A 3EUHC 3KP4A 3SZGA 4X0GA 3CP2A 4EEFG 1WWXA 2HQRA 2JA2A 5LFAA 2R7WA 3I3LA 1W36C 1MMNA 4PJMA 2L02A 3U2RA 3MZ8A 1RUOA 1UG0A 1Z3YA 4P1WA 2R7TA 4P5OA 1JUPA 3SQNA 1FBUA 2Z2SB 5E3MA 3CF5F 2LR8A 1UZCA 1R5HA 1T0FC 5B1AH 4XSZF 2LY1A 2FNAA 4HEA2 4HRIA 1IRGA 5ERIA 1I50J 5ICGA 2W48A 3HOYJ 5CKTA 3S15J 1G3TA 1QVTA 4DYCA 1IXRC 3QWLA 3MD2A 3DEWA 3OR1C 3T8TA 2L4MA 1ZH5A 1UB9A 3DP7A 3NWTA 5EEGA 4HDVA 2OPTA 2BGCA 1J5YA 1TP4A 1JKQC 4L9VA 2FUG2 1ZGWA 5FLXK 2M45A 5IYBJ 2YU9J 2H1LA 2X6WA 3O2PE 4HNTA 5B66C 3GYHX 2R7DA 1JJ6C 4IOAF 2XGDA 3AL0B 4BBRJ 1D1BA 3SDGA 3ECOA 2J5OA 1J59A 4E7IA 2HFHA 1KU7A 4XRSG 4BQNA 2P8TA 1X3ZB 2QQ9A 4P9UA 2LLKA 1Z05A 2DOEA 1K4SA 1SFXA 2Z9OA 2Y0SA 3D5LA 4MLOA 2CW0F 2VL8A 4HPQA 4RM3A 1SFOJ 2QCOA 2L7ZA 3ABMH 2HZTA 5KAIC 4X6AJ 2QBYA 1LKXA 5E20A 4ZDLA 3JRIA 3FWEA 4A3EJ 3G1OA 3EUHA 1F5TA 5A2QK 3FISA 1ZREA 5DD4A 3W3CA 1BI0A 2RV8A 2V4JC 1SAUA 4MQVA 1ZYRF 4ZYGA 2OD5A 2D5VA 4E6KG 3IAS2 3MKLA 3OS2A 2CS3A 1I5ZA 2VKHA 3S8PA 1X4OA 3D1NI 2P0WA 3GWZA 4EJWA 5HLGA 3WE3A 3K70C 1BBYA 3H35A 1OCCH 4KJZA 2Q2EA 1H0MA 4I02A 5IYDJ 1T0FA 2K9SA 1S7EA 2M5WA 2VIXA 1O7FA 2HQ5A 3HKZA 5M5YJ 3A0HC 1UMQA 3H1CA 1XSVA 2DA6A 4BGDA 1X3UA 2CQQA 2ZC2A 4ZDOA 1WJAA 2A07F 1BIBA 2YX7A 3Q0UA 1LE8A 3KYDB 1XC5A 3WE2A 1JGGA 1QHGA 4DBRA 1SFEA 2QSGX 3L7WA 4DZJA 1TWAJ 4Y4RA 3EYIA 2KKOA 1U5TB 1UFMA 5CLSA 3DPTA 2DFIA 3IL2A 3R6SA 4RA2A 2XPVA 4OAYA 5FGMA 3HYIA 4KIFA 2Y69H 2HKOA 1FPQA 3QPLA 3QYFA 4BQAA 4PJ0C 2K5CA 1YITI 5FFXA 3RTRA 1X19A 4BU2A 5F6FA 4ZDPA 2H1KA 2JSPA 5JHUA 2ZXIA 3LSMA 3QPSA 3SXYA 1T33A 4DBQA 3K6GA 3QYEA 2V7FA 4ASNA 3MKYB 2HZDA 4NB5A 4OIRF 1FEXA 1QVUA 1WJFA 1XD7A 1VQ5I 4EJTA 3J81K 3LA7A 1NTCA 2DW4A 3OIPA 3I59B 3OYCA 2VOPA 4L5JA 5KNLA 3MWMA 4E7ZA 2K9NA 3PUFA 2W25A 4IQ4A 4LOCA 2EH3A 4XK4A 3GTJJ 5E3OA 3OIQA 5DV5A 2XB0X 3TOBA 4WX9A 2QQBA 2CQ7A 3KX2A 4IL6C 1EH6A 3BJAA 3BG3A 3OYLA 1YRNA 4IX7A 1IJWC 4A0ZA 4G9YA 5K7HA 4KFCA 2LNBA 2RDPA 3QAHA 4B4CA 2NS0A 1O7LA 2VJIA 3CD6I 1TW2A 1LEAA 1X1BA 2L54A 2QF7A 4M9SA 3I4NJ 1JGSA 4EQQA 1T8IA 1WRJA 1UHSA 1WH7A 3F3XA 2JJ7A 2JVHA 2GA2A 3K4MA 1J09A 3V42A 1S72I 2BHZA 4WWCA 4BKXA 3BY6A 4ZYAA 4LLNA 1R1TA 3HJEA 4JP0A 3O6BB 5D5UB 3BWGA 3AG3H 2M34A 3FXMA 2PG4A 3M8FA 4HYEA 3W2AA 2P4WA 3RCOA 2A6TA 4B44A 1BC8C 1MJAA 2LRDA 2JWTA 3ABTA 2AXTC 2IS2A 3WU1B 3BJ6A 3ZQCA 3GBGA 1NK2P 4MIMA 1G3WA 5HNFA 4GXOA 1R5ID 5FKMA 5J40A 4KNYA 1U9NA 2KQRA 5C4XJ 1MBGA 3U1DA 2CV2A 2M0MA 5C3EJ 4BE1A 1FNNA 1BR2A 2JA5J 3WTUC 4WXCA 1F1ZA 4MEXF 3CLOA 2R7UA 2EA4A 3BTLA 3TO7A 2DYRH 2ZXJA 2L7KA 2OTLI 3DFGA 5GTIC 2P5LC 5D6FA 1H88C 1R4MB 2BXZA 4QSHA 1XGNA 2W84A 1X4PA 3ZMUA 3BJOA 5B3SH 4BXXJ 4W1UA 2F5FA 4KICA 2KL4A 3K1MA 2RNJA 3ASOH 1HW2A 2Z16A 2WY8Q 2A05A 2ID6A 1ACIA 3GZ6A 3BG6A 1U9OA 4D9JA 2A6HF 3K4LA 3BTIA 1IW7F 4HAMA 2RGVA 2NXNB 4XLFA 3LSKA 4U0WA 2PI0A 3F9KA 3GZNB 3QP6A 2CU7A 3FX3A 3ZPLA 3PO2J 5E8GA 2VLAA 2V9KA 4EJOA 3JRCA 1D3YA 1N75A 2W00A 4XRMA 4I2OA 1ITYA 4XRFA 1ZKGA 1U6GA 3BG7A 2P81A 1XDSA 5HS7A 5IT9Z 3BROA 3SHFA 2EBIA 3DF8A 2DA5A 1O3SA 2LDUA 3DEUA 3NAUA 4D0PA 1BJAA 1YHQI 1YOVB 3BOQA 1FZPB 2MC3A 4BEHB 2LFBA 1JKRC 3HC7A 3HUGB 2IRFG 1IRXA 3IKVA 1Z0XA 1LEBA 3LSRA 3IWZA 1FLIA 3GTMJ 5L3BA 3DPLC 2KLOA 4II3A 2LVSA 1A6IA 1T98A 3B73A 1ZHFA 5J6XA 1OYYA 4BH9A 1DPUA 2BY0A 1N77A 4A0XA 3LNQA 4Y33A 2W82A 1A6QA 3BZ6A 5ILVA 5HNHA 1YS7A 3AG1H 2CW8A 4KT5C 1D5VA 4RDUA 1H9GA 4RB1A 3M07A 4BE2A 2PMUA 2E2IJ 3HSEA 2HEOA 1FIAA 2M4KA 1BJZA 1E2XA 3W6KB 3PNVA 3RZDJ 3FK7A 1FP1D 2KRFA 3S32A 2BY1A 3RYPA 1FOWA 3DXJF 1ETVA 4ZZDA 5J1UA 4HNUA 2W85A 3FKIJ 4KISA 1XS9A 2F4IA 3L00A 1FX7A 2H8RA 1OPCA 1Z1DA 3PFIA 4BQQA 2A3SA 2GXAA 1MMAA 2EZHA 4B8XA 1BI1A 5ED4A 4UB8C 2XGXA 2R7OA 1EH8A 5D5VB 1BI3A 3CCUI 4S05A 2P7CB 3LFUA 3G4SI 3C2HA 4XONA 3V7SA 4A5NA 4BAYA 1CF7A 1IZ1A 4ZJZA 2G9WA 2XV4S 1GV5A 3DLLF 4A3DJ 3BT9A 3R61A 3CC7I 4BXFA 2VXZA 3B6CA 1QA6A 1V5GA 2LY9A 5GTHC 2UV1A 2XASA 1UHWA 1CQTA 1MDMB 4CA0A 1Z7UA 1P6RA 3JREA 4ZYDA 4HX4A 2BVLA 2IGMA 3ZQIA 1Z3XA 5EZHA 2ZJQF 1FOYA 1HSJA 3HSRA 3NQOA 3W6JB 5L3CA 3M3YJ 1B4AA 3TDZC 4ZH4F 1TT5B 4MGRA 4D7MA 5EGOB 1QHHD 1YS6A 2JK3A 4KIGA 4BXUA 3TKYA 3S93A 4FQGA 1POGA 3ABUA 4K2EA 3LAJA 4BHCA 1ONVA 3P9IA 1ODDA 4G6QA 1UHMA 4JYKA 2P6TA 2H94A 2ZB9A 4BJ5C 2PJPA 2LSOA 2CQNA 3P5JA 2HYGD 2EZIA 4RB0A 3AG4H 2HKXA 4PJJA 2XAUA 3BZCA 3FBNB 3G1MA 3JCUC 4MFEA 2M4GA 2G7UA 1G59A 4C3HJ 2CUJA 4B09A 1X1CA 2UZKA 3F6VA 4CSWA 1YIJI 4TV7A 5F27A 2V1XA 5HDNA 3K1PA 2R5ZB 4XKWA 2ZFWA 2V1DA 1KQ0A 1KYWA 1SFUA 1KGSA 3KFWX 1F4KA 2E2JJ 1W5TA 3VSKA 5F08A 2QUFA 3CMYA 4LGWA 1HKTA 1REPC 2AO9A 4ENMA 3MEXA 3S1QJ 1QNTA 4D7NA 2ZNYA 4O6JA 3S3MA 3WTZA 2GA1A 4MNUA 5AIQA 4XBFA 4ITVA 3FXOA 3OYMA 2WV1A 2GIZA 3V8KA 3F6OA 3Q0VA 3OWTA 1OFCX 4BDYA 4PZJA 4CH7A 2ESNA 5J47A 4UUSB 5HLHA 1RETA 2Y2ZA 4MQ9F 3WU2C 5FLVA 1ZLJA 1L0OC 3IP4B 3LQRA 3VYRB 2W57A 1GVDA 1PP8F 3K4KA 3GXOA 2JA8J 3JRGA 3IRQA 1T56A 4XLEA 2LD5A 2IP2A 4YEJA 3IAM2 3GLLA 2HI3A 4Y15A 3RKXA 3T0YA 2IS4A 1IN4A 4MEYF 1NHAA 5FB2A 2GWRA 2VJ5A 4R8HA 4CICA 4PJLA 3I55I 1DPRA 5GPAA 1S8NA 1YX5A 3WTWC 3OYHA 1B8IB 2H27A 2VE8A 3SDBA 3MFKA 2RKHA 3B02A 2E71A 1XGMA 1JT0A 4B48A 5IY5H 2RQQA 4H0EA 4A93J 1WI9A 2NVXJ 3RPUD 5K5RA 5J3LA 4E7SA 2X1DA 4RAFA 3BC8A 4XLHA 3HTUA 4HBLA 5KAFC 1WI3A 2LOOA 1TQMA 1YW7A 2E1CA 3BQYA 1LPQA 4XOTA 5IOYA 3CCJI 3AFHA 2Z99A 1FIPA 1QPIA 3VDXA 4DJAA 3RKQA 2R5YB 2BW3A 1DU6A 2WY7Q 1APLC 4FE7A 1IUYA 3WG9A 2OUMA 3LQQA 5FO5A 3RIRA 2RREA 3DTKA 2Y48A 4BY7J 4U7BA 2F48A 3BLYA 4J00A 4EM1A 4E7JA 3F8MA 3PFYA 3NARA 1I6XA 1W7PB 4CO8A 2G0EA 1JTYA 4RGSA 1RZ4A 2E35A 1UCRA 4DYQA 3F22A 3D0SA 2E1MC 1MJ9A 2HXOA 2M0CA 3KP6A 4ZC3A 3LSPA 2FBKA 4OIPF 4KITB 3L2UA 2JQ7A 2XGCA 3NEUA 4IHSA 2GBYA 4E4HA 1MH4A 2EPFA 1IV8A 2DA3A 1B9MA 2FMYA 1HCRA 2NOGA 3KIOA 5B5EC 1ZTRA 3OYKA 2VQHA 5JR3A 2IA2A 1GT0C 2E5ZA 3ERMA 1MH3A 2D1VA 2EJRA 2A6EF 2KRCA 4G8XA 1IAWA 2FOKA 1OCZH 2LBFA 2ZJPF 5EG0A 2RNGA 3WTVC 4UUVA 3GTKJ 1ETYA 3WODF 3DQVC 2Y31A 4A6EA 1VI0A 1WJDA 2VI6A 2Y0MA 2X85A 4UNOA 3GZ5A 3QOEA 2DQLA 4YFNF 3RKWA 1AHDP 3LFKA 5DUIA 3CJNA 3WGHA 2V9PA 1S5LC 2KIUA 4I76A 2LP0A 2XF5A 4XLAA 2EV6A 2GXBA 3BR3A 2HOEA 2XPUA 1ETQA 1GVJA 1S7AA 3CDHA 3H3VK 2QM3A 5F04A 1BR4A 1SMTA 4RB2C 5E3LA 2DPUA 3ZN0A 1B72B 4EM0B 3WTXC 1ZG1A 4O5VA 1JUSA 5FLMJ 1A35A 4M74A 3WU0A 3GFIA 2VJJA 4ESBA 4NC6A 4Q48A 1LFPA 4LG0A 3O8HA 2X0LA 3IUOA 3Q9VA 4B3XA 1YO5C 1KU2A 2FNPA 2L0KA 2XDVA 2HOSA 1RKWA 4GFBA 3QPHA 1LDKB 2CFOA 3MN2A 4F7ZA 2CUEA 2E2HJ 1BW5A 4I99C 3L09A 4II2A 1IGNA 3WHBA 4AC0A 3KZZA 5M5WJ 4BHBA 3S14J 3DU6A 2L7MP 2XAGA 2CFXA 5GPCA 4V19K 3FBIB 4QWQA 1R49A 1RI7A 4ETSA 1T38A 2FRHA 1G2HA 1BR1A 5KK1A 5KCMA 1ON2A 4CYCB 5LRRA 1QZEA 1BL0A 1SAXA 1H8AC 3U9GA 3FM3A 1TL8A 3SEQA 4CCKA 1IN6A 2R0QC 2OTJI 2VBZA 1BW6A 2OQGA 2DMPA 1JT6A 3LA2A 1YX3A 2GOMA 1YW8A 4HA8A 3CO6C 3J7ZI 2DOAA 1KYZA 1K6YA 2WWYA 5LHGA 4IKFA 3RDIA 1IN5A 2JA6J 1MMSA 1X3WB 3EPZA 3ZXSA 2NOJB 4Q5SF 2NVTJ 3JAMK 3WG7H 2VE9A 5F64A 2MH2A 2EFWA 2XAHA 5DCMB 1ZG5A 3CLQA 4C30A 1RIOH 2P7VB 5FD6A 3FMQA 1MMGA 4UY8I 1G3YA 2VASA 3HIFA 1A36A 3SZTA 1AKHA 1Y8RB 3E3VA 5HODA 2WC2A 3BR6A 3JRBA 1B6AA 2VBXA 5FROA 2KFDA 2ZMEC 3HHGA 2BXYA 1Z6RA 4M9XA 5L3FA 4Y13A 2VBYA 2WAQN 1YI2I 5M3MJ 2VONA 2CGPA 4XLPF 3BCAA 3FHNA 4RAZA 4M6YA 1J2XA 3FK6A 1X1DA 3DPUA 3K2AA 5FKKA 2Y9YA 3PL8A 5DS9A 2WV0A 2XGEA 1AA7A 2KMUA 4YFXF 3UR3C 4BY1J 4M3EA 4NQWA 5CQEA 2HOTA 1YYVA 3M9AA 1OCTC 3FXKA 1ON1A 4CCNA 1DDNA 2JPBA 1KA8A 1E0EA 4FE4A 1XDUA 1VQNI 4PSXA 2X6YA 2MLKA 2DLLA 3QRFF 2HDCA 5D8KB 3CDIA 2VC0A 3G2BA 2HWVA 1P4AA 1B9NA 1GHCA 2DA2A 2LC2A 2A68F 2UUZA 3KP3A 2VQLA 3KZYA 2COBA 2ZBKA 5EDNA 1PUFA 2QZ8A 4D1QA 1NG7A 3KEYA 2BY2A 3ZQQA 4IHVA 2PX9A 4ZYEA 2EFPA 4LITA 4UV9A 4FCYA 1KU9A 1IXSB 1MJBA 3VYUB 2K3FA 4WCGA 2RAEA 4C3JJ 4GYIA 4A6DA 1OISA 1XSXA 4A3JJ 4U0YA 4XSXF 3FXLA 4E7HA 3CUOA 3H0GJ 3HRUA 5EEAA 2KHMA 1IN8A 3F8FA 2W4SA 1GV2A 3K9TA 2OQRA 2BY3A 1USTA 4HV5A 2YS9A 2V6CA 2M2EA 2ECBA 3F23A 4V2GA 1SD6A 5M3FJ 3ZMVA 2ZMEA 1VF9A 1ZG3A 2E7XA 2DJIA 3PSFA 1Q1HA 1TQIA 1W5CC 2DMUA 3H0DA 2VKVA 3WHCA 2FQ3A 2ECCA 1ZAOA 3CUQC 2O8XA 4AVZA 1O4XA 2Q8KA 1L3LA 4V2FA 4XN3A 5TISC 1LVAA 3A1YA 3TO9A 4KA4A 3QOPA 1ETWA 3OL3A 2Y0SN 3KP2A 1HKQA 4FX4A 1VQ4I 2L7FP 2OC6A 2I5UA 4C2UA 2QBYB 2Y75A 4Y17A 5J4VA 3OL4A 5L3GA 5JLWA 2MBFA 3GTOJ 2EK5A 4YIFA 4FASD 3A01A 2XUBA 3R60A 3TGNA 2XSJC 4UV8A 1R22A 4LD5A 3BPVA 2H6CA 4XOPA 4IJAA 1ETOA 2Q2EB 1OCRH 2O7OA 2GAUA 1WHUA 1IDZA 1ZRDA 5BQTA 3BR5A 4DGWB 2BHYA 1B1BA 4KUMA 1MMDA 1ULYA 3HKZN 3BG5A 3DCFA 2VPLA 3L2WA 4KT6A 1A31A 4UXNA 2DCEA 2IA1A 1SEUA 1JHHA 3GCMA 3CCLI 1OYWA 1LE8B 4EMSA 4XL9A 4AM3A 3HGYA 2O0YA 2CRGA 5K5OA 1MIJA 3CJQB 1ZGJA 1RPWA 1HLVA 1FYLA 1FYMA 2FQ4A 3H9GA 3WGGA 1FOKA 4A3MJ 3BP8A 1HOMA 4A2UA 1JXSA 4M71A 4EATA 3DV8A 3U1KA 5HDGA 3GX4X 1U8RA 3CUQA 3S17J 1ETKA 1LJ9A 1TW3A 3CESA 3K69A 1KQ9A 4L0YB 2FA5A 4JQFA 2IAIA 2JZYA 2HPIA 3EETA 3I64A 1BA5A 4NBQA 1VZ0A 2R92J 2R4GA 2M7BA 2EZLA 5D4SA 1WJBA 2KT0A 3J80K 1Y6IA 2ZSHB 2BOLA 4L9TA 3CCRI 4LB5A 1RKTA 1MBEA 4RLQA 4RAGA 3COAC 4GRIA 2MSYA 2LG4A 1NG6A 3KP5A 2RC4A 1U0JA 1ZK8A 2ZSIB 1YRNB 2JVGA 4LK0F 1HA8A 2M87A 2NAZA 3H3UA 3SFZA 2VPRA 4I6ZA 4XKBA 3ZMTA 3OYIA 2W1OA 2FE3A 3ELKA 5IP9J 4KDPA 2E5NA 3HOUJ 1AU7A 2MFZA 4FETA 2KP6A 1Z77A 3N4MA 2E36A 1WKMA 2XAQA 4BJ6C 1W1WE 1DQUA 5ILUA 5IP6A 3PNTA 1P4XA 3RSNA 4HF2A 4CHUA 1J7KA 2DMQA 4JBAA 1LB2A 2DMNA 3MCZA 4JX5A 3LA3A 1TWGJ 3GW2A 3CJRB 1D5YA 3ZRGA 3GTQJ 4A69C 3S3OA 2HPMA 1PDNC 1VTNC 2OZ6A 3K4BA 2NNNA 1HC8A 2IT0A 3M7GA 1R9TJ 5FRNA 2QSFX 2VXDA 3KETA 4Q4ZF 2DK8A 1SC7A 4IF4A 2ZXWH 2IVMA 2OA4A 2UXXA 3CZ6A 1G3SA 5FLXZ 3P9CA 2QYOA 4U88A 4A3GJ 1OJLA 1Y8QB 1K83J 2DMTA 5FD5A 4P55A 3M1EA 2H8WA 4U87A 1WJEA 5E8IA 4JOMA 3HDDA 2F5CA 1MSFC 1FOXA 4M73A 1OYIA 2OZUA 4EJVA 4KMFA 4XN0A 1PVEA 2GZWA 4OINF 3KEQA 2QVOA 4MHGA 2GLOA 3F8NA 2X9DA 4G6TB 2ZXHA 4EV0A 2EA2A 2K02A 1IF1A 3I9V2 2IS1A 3K10A 3RKYA 1TWFJ 2VKEA 2FSWA 4Y3OA 3SEZA 5HDKA 1DUXC 3VEPA 2DA1A 5LBQA 2LKSA 3JRDA 3GO5A 2FOWA 5A2QZ 4A0YA 2VC1A 4DIQA 3F21A 1V5FA 3DWLE 1K7AA 1D8JA 2IGNA 3E7LA 2JT1A 4GGGA 3DBHB 5DDGA 3GFMA 2E60A 5LGNA 2LYCA 3RPQA 4L18B 1DP3A 4RB3C 3NWSA 2L3DA 3D5SC 2PQ8A 3W2WA 3PIPF 2R3SA 1AWCA 5LEKA 1XMAA 3RI4A 2M8GX 5J4YA 1X2MA 2G7HA 3DLAA 1EJ9A 2OAZA 2XROA 3HGGA 1QGPA 3BR1A 3BCBA 3HG9A 5JLXA 5DCFA 1H89C 5IPAA 5LRSA 2YPRA 2PEXA 1NH3A 3I4MJ 3IC7A 2MABA 3GLXA 3V4GA 2IGOA 1QO0D 3EUKL 2K9LA 2LKPA 4F92B 1W0UA 3OYDA 3O3KA 3EYYA 3ABLH 5L3DA 3GTLJ 3OIOA 2EINH 3VODA 2LREA 4DZPA 5CVIA 5DTDA 1KZHA 1G4DA 3GUDA 2RN7A 3MAJA 3Q5FA 2TCTA 2W7NA 2ME0A 4I0BA 1VQ6I 4N4OB 3L2CA 4P9FA 2D2WA 5D6EA 4BJTA 1HF0A 1BM9A 2PJRA 3Q3SA 1W36D 2Z3YA 2V1NA 5ICEA 3LSJA 5J8CA 1UAAA 4BHPA 3J81Z 2F5VA 2K7LA 4YRVA 2F4MB 5DYMA 3OSFA 1Z67A 1P2FA 1MBFA 3E5XA 3WTTC 2FU4A 3TL4X 1CF7B 2ISYA 3H36A 3U21A 5GP9A 4CZZA 2YU3A 1P9QC 2HR3A 2KRHA 1LDJA 2FX0A 2LMDA 3Q9SA 3I54A 5HS9A 3JSPA 1T2KA 3N97A 2EFNA 2XIGA 1KU3A 2EFQA 4GCVA 1YJ9I 3SZPA 4YELA 1ORKA 4J01A 3F0CA 4ENKA 4AWXB 4B43A 2DPDA 3JSOA 4OIQF 4UB6C 2NVUB 2K85A 1T08B 3ZR8X 1LVKA 4LLLA 5IT3A 3D5RC 5F1RA 1W0TA 4HF0A 3HXLA 3I53A 5LGUA 3I58A 2I8DA 4QTRA 5FFZA 4W97A 2DODA 5CVUA 3R0AA 3PIOF 4RAYA 2DI3A 1O3TA 1D0XA 5DD8A 3RQIA 1MW7A 2HGCA 4BYYA 1R00A 1ZRCA 1W4MA 1JHFA 1XN7A 4OU0A 5J1RA 2PMHA 4ZYHA 2NS8A 4DYRA 1XX5A 5EEHA 5D4RA 2FEZA 1FYKA 4NNJA 1YW9A 3SJMA 2X1EA 1Z91A 2DFHA 1ERDA 3TQNA 1HXDA 2PMZA 3S2WA 1BIAA 1BOAA 3K70D 3HEFA 1Y1WJ 1YJWI 2JSCA 3JW4A 5LGTA 3OYJA 3QPTA 1MNEA 3PQKA 1XGOA 4XNFA 3REOA 4NHJA 2VBWA 4UVBA 1S29A 3HBLA 1IC8A 1R4NB 2ZO4A 1V4RA 1SVOA 1K78A 2XB5A 5DM7F 3L1PA 2DA7A 2W24A 3ROUA 3OYAA 4CCJA 1XGSA 3H5AA 3ERED 5BMZA 2J5PA 2QKLB 1P4WA 2CWEA 4M3GA 1USSA 3CMAI 2A5YB 2E1NA 3PQJA 1DGRM 2K9QA 2COMA 2XAJA 2HTJA 4HSTA 4N4NB 1KONA 4U7DA 1Z9CA 2YUSA 3CC2I 4NDLA 3JRHA 3M8JA 5ICCA 2WB1A 3PO3J 1RRJA 2O9LA 4KIBA 2L9RA 5F0HA 3MMYB 1X1AA 3E6MA 4DW6A 2MH9A 2D1HA 1XCBA 4CCLA 1IRFA 3WTSC 3CDLA 4IRIA 3L2QA 5BS6A 3H3ZA 4XICA 4I0AA 4ZTJA 5HVQC 3J7AO 1ZELA 1M1EB 4XR6A 3AL0C 1RUNA 4G7HF 2A61A 4M72A 5C4JJ 1FSEA 3GTPJ 2CO5A 1WSUA 1STZA 4I7HA 4F55A 3E5UA 1K4TA 5E1ZB 3K0LA 4XIDA 1MZBA 4FX0A 1NK3P 3TW7A 2N8GA 3BTCA 3UKGA 1K79A 4IHTA 3QP5A 5IP7J 3OYFA 4I01A 5LD2C 1F43A 2LTPA 1R7JA 2IBDA 3TMOA 2BW3B 2LKXA 2HYJA 2X4HA 1I1GA 1LFUP 3H5RA 5BPDA 2ELKA 5J1YA 1WFXA 2ESHA 1OR7A 3F72A 4IPAA 3AAFA 4PDKA 3ECHA 1E3PA 2NNYA 4BBSJ 3E97A 1I39A 2FJ1A 1O3QA 1IRZA 3FHZA 2IJLA 4R1HA 2XRLA 3TOAA 3G73A 2JPCA 2L5QA 4A5MA 3A2KA 4DNCA 4IHYA 1WCMJ 5B1BH 1UELB 2F5EA 1QU3A 3N05A 2HVQA 1UJ8A 2KJCA 2B63J 3BR0A 2V6EA 2KZGA 2VB6A 2F2EA 3GTGJ 2IEKA 1VQMI 1ETXA 3KE2A 2JN6A 4DOZA 1E3OC 5E1WA 2FXAA 3MZYA 1LNWA 3ZQ7A 3L2RA 3LSIA 2JUGA 1YTYA 2DBBA 2LBFB 4PFPA 5EG0B 3TO6A 1YE9A 1HBXG 3FM5A 1P92A 4OMZA 3CO7C 5GADJ 5CQGA 2HVRA 2FF4A 3TEDA 4DQ2A 5CVRA 2VN2A 4RBOA 2V26A 2ACJA 2X6XA 2HYFA 1QRYA 5JFRA 2CYYA 3QYBA 3T5XA 1DU0A 1TLHB 4BL0B 4F93B 2QSHX 1A5JA 1R1UA 1JTXA 4C3IJ 2R7QA 3L9FA 3S2HJ 3FZVA 1ZQ3P 2IS6A 2GOXB 3S3NA 1R58A 1MBJA 4IRGA 2B0LA 3BTJA 2KDZA 1C0WA 4NC8A 1WJ5A 2H6BA 1U78A 3C2GA 2BV6A 1K6OA 2MGQA 4I09A 4LG0B 5IT9K 2KIQA 5FKOA 1VQKI 3E6DA 3GF2A 4A12A 5FRMA 3W6VA 3ZQGA 5BNGA 2M1BA 2R7XA 3HTSB 2GXGA 2E1MB 2L9VA 1U2WA 2L9SA 4LB6B 2IPQX 4HV6A 3DU5A 1V5EA 4FTHA 2LK2A 4EM2A 2QWWA 3CTAA 3C1DA 4CZCA 3WTYC 4HQEA 4LMYA 3J7YJ 5M5XJ 1YJNI 3OS1A 1D8KA 4M6VA 3ZCOA 1EV7A 2OV7A 2KPMA 3BPXA 3A02A 3ABKH 3GFJA 4M3DA 5AONA 4C2MJ 1ZN2A 2RVCA 2MG4A 3KLNA 4LJZF 4Z6YA 3E5QA 1U5TA 1D1CA 1OMIA 1VQ9I 2JRMA 1BI2A 3SFIA 4YFKF 1FWZA 1VQLI 4HX8A 3BZKA 4BACA 3KPHA 1PUEE 1Z6TA 1FSHA 4HQMA 1BN5A 1VQ8I 3GVAA 5LEJA 3RQ4A 3HRSA 2YX4A 3ZMZA 4HW0A 4YG2F 1RESA 3FXJA 5FKNA 4D5FA 2E34A 2EFOA 3QU3A 1TTYA 3K4NA 4KN7X 1EKEA 2JMWA 4PGHA 3KP7A 3PJRA 4XKCA 1U3EM 2VT3A 4RLFA 4BQOA 1YFHA 3VOEA 3R0JA 2A5WA 3OYBA 1GXPA 2ZCWA 4A3FJ 3QODA 3I59A 5CVVA 3ISPA 1RC9A 2WAFA 1R5GA 1P7JA 3HOTA 2DT7B 2O8KA 1AKHB 3HOZJ 1R36A 1Q1VA 4RGUA 3I0TA 5ILSA 3I71A 4IHWA 2H09A 2TDXA 4E7LA 4ESJA 4D5CA 5EF6A 5CJ9A 2IGKA 2YR2A 1CGPA 3FXUA 5JVTA 3EQLF 2K40A 2OU2A 1MNDA 3F8BA 2KJBA 1TNSA 5BOXA 1R23A 1WQ2A 5L3EA 1PJRA 5TRDA 4NQWB 1W7PD 4AVPA 3G71I 5JVGF 4HZFA 3BR2A 1K61A 1FC3A 3CF2A 1SFKA 3BDDA 4A3BJ 2HS5A 1Y1VJ 2DK5A 4IXAA 1FMWA 1Y56A 3HSFA 4Z2YA 3VSLA 5K5QA 4HDUA 5LLQA 4JX4A 1TT0A 2D45A 3HB9A 3CJTB 3L2VA 1PUFB 1D0ZA 3K2ZA 1FJLA 3OSGA 1XPXA 3AG2H 3IV5A 3LSHA 5E17F 2ELJA 4UUTA 2Q0OA 5ICFA 2DFEA 3OYGA 2BEOA 1N78A 3LL7A 4IOCF 1S7OA 5FJ8J 4PGGA 2B9SA 5BPIA 1E3HA 3S2DJ 2LF8A 3JRAA 5HOOA 1H9TA 2V9VA 3RPUA 1I3QJ 3H5NA 2QQ8A 3OV8A 2EILH 2V1UA 1MSEC 2KDOA 3DTIA 5D5XB 3HRMA 3VYSB 2HOAA 4ESFA 1DP7P 4IRHA 1G6NA 2E7WA 4RGXA 5D8LB 2DN0A 2DTZA 1LDDA 1VNDA 2M9HA 4M9ZA 4P96A 2MD5A 2C6YA 2ZMEB 3BQZA 5LHIA 2MC4A 1F36A 2HNHA 3CQZJ 1OKRA 4PFOA 3RYRA 3ZOBA 1R71A 4QPQA 3VB2A 3FMSA 2L9NA 3IHUA 5C44J 4MTDA 3H9JA 2F6CA 4Q47A 1V54H 2FD5A 3IH4A 3ONQA 2ZJRF 4PJNA 3WGIA 1P7IA 4XM3A 4HSRA 1T39A 1TWHJ 4X1EA 2MA3A 3I5UA 3IH2A 3HHHA 3ESWB 3GEZA 3S16J 2PLYA 2DFFA 1V55H 1EF4A 2ZFUA 4IZZA 3QQAA 2EQRA 3A03A 3S1RJ 2XKOA 4ABZA 4F52A 3EDPA 3HPGA 4L0ZB 1GLNA 2NVYJ 3A01B 2KIFA 5KHDA 3ZP5A 3K4CA 2VT2A 4KMUX 2DDAA 2ME6A 4AIDA 4BEHA 2VJ4A 9ANTA 5TJJA 3C3WA 3F8CA 2MD0A 5DEQA 3HUGA 4LG3A 4NC7A 2MYSA 2DU9A 4C9YA 2DT6A 1JUMA 1SVLA 2ID3A 5EYRA 4AIHA 1OQYA 4CCOA 3HL2A 2VUMJ 2M8EA 1MKMA 4LLGF 5DUKA 3MKZA 1Y0UA 2DO7A 3PUBA 3HOVJ 1IV6A 5K7FA 2CUFA 4AU7A 3CCEI 2DXIA 3JRFA 4MO7A 1ZRFA 2O5RA 1JKPC 4NUBA 1JI8A 1MBHA 1I3AA 1TQPA 2EV0A 1EA3A 3RJPA 4J19A 5F1JA 1D1AA 2Q1ZB 2R7RA 2M30A 3OR2C 3TW6A 1HDDC 4ENJA 1S3JA 2CQKA 3Q0WA 4LIUA 3CUQB 2XC7A 4CGZA 3LOCA 2R7FA 1R1VA 3LWFA 1DGWY 3JAMZ 3G6EI 3E6CC 3DEEA 1TNTA 2EIMH 1WZ2A 3JTHA 2DYSH 2R93J 1FMVA 3KYCB 2MW8A 2HQNA 2DDBA 2L2OA 2O6GE 4BNCA 4I98B 5K7ZA 2HDWA 3T1BA 3DBRB 3OMYA 5KVRA 3HRTA 1WVRA 2R7ZJ 2DAOA 2CQXA 4MFDA 2ICWG 4FT8A 2M3AA 4L5EA 4RM2A 3W2VA 4QIWN 5CYVA 5J8FA 4CCMA 1U8BA 4B3AA 1MDMA 1B59A 5F0FA 1GDTA 3E1SA 1IO2A 2ISZA 2O3FA 2QQAA 2VKDA 1T95A 1YQAA 3CP8A 1T6SA 4WF2A 4ENNA 4RS8A 2XRNA 4IQJA 2K4JA 5EGOA 1QBJA 3DBLB 2QEXI 5IOZA 1HW5A 3FXQA 3G1LA 2DQRA 4A3KJ 1FBQA 2UWMA 2DA4A 3CCSI 1ZR4A 3LSGA 4HLYA 2WTEA 1GUUA 1WH5A 4WK8F 2STWA 1YLFA 5TGTA 5GAHJ 2EIKH 4BE0A 3IWFA 3ML6A 1XMXA 4QPOA 1OCOH 3VYTB 5DM6F 2VOOA 4B1RA 1YG2A 1Z21A 2JUCA 3MKWB 4XKVA 3X2QH 3GFLA 3G3ZA 2CV1A 3LMMA 2Z5UA 2QGUA 4CDGA 3FXRA 3FDYA 4RGRA 2R5ZA 5HLTA 3ZQHA 1SD5A 2WAEA 1SD7A 3ZMSA 2IXSA 4G94A 4EGYA 1X58A 2AHQA 2OCCH 3DTEA 4OMYA 4M3FA 2VQGA 3H9QA 1J0RA 2HDDA 2FBIA 2IA0A 1E17A 1J75A 4BUPA 1PP7U 2EV5A 3RZOJ 3C7JA 5H2FC 1IUFA 5CVJA 3O8GA 4XLNF 1RNLA 2Z1DA 4ON0A 1XB4A 3TP0A 4C2TA 4YIRX 5HLIA 4A3LJ 2EZKA 5H6QA 2Y30A 4S0HB 4YIIA 1ZGAA 3ZMDA 3CMEI 2UXNA 1TWCJ 3KZIC 3HOSA 1TZLA 4AD9A 4UUSA 4N0BA 3FKJA 3M4OJ 1OCPA 4M3BA 1QZYA 2KIMA 4H4KC 2AXLA 1S6LA 2K3PA 1FY7A 2KZVA 1Y39A 2GQQA 2BYVE 3KCCA 2LY2A 2X1CA 1SMYF 3CCQI 3ULQB 1ZLKA 2OJED 3ZQFA 4XQFA 2R7VA 1FTTA 4M6XA 2HQAA 4L9NA 3C2BA 2HVSA 1VFCA 1G8XA 3MQ0A 1IN7A 3K7AJ 1MBKA 3H92A 1JJ8C 3DKXA 4F3QA 4XLCA 3LSTA 3VPRA 1B8IA 2P5VA 2OCEA 1JE8A 3HOXJ 1MD0A 1IDYA 2CSOA
chains in the Genus database with same CATH topology
2ID6A 4A3JJ 3JR9A 1LFUP 1U9OA 3H0GJ 2ELKA 5J1YA 5EEAA 3BTIA 2GM4A 3CCYA 1GV2A 1ZR2A 4BBSJ 2FJ1A 2YS9A 2CU7A 1IRZA 3PO2J 2M2EA 2ECBA 2XRLA 4V2GA 3JRCA 4XRMA 2CJJA 5M3FJ 1ITYA 1ZKGA 1VF9A 4IHYA 1WCMJ 2P81A 2DJNA 2R5YA 2EBIA 2DMUA 2DA5A 2VKVA 1RR7A 3WHCA 2B63J 3BR0A 2ECCA 3PM1A 3NAUA 3GTGJ 1O4XA 4AUXA 2IEKA 4V2FA 1ETXA 2JN6A 2LFBA 1E3OC 1ETWA 1JKRC 2Y0SN 1Z0XA 2L7FP 2NVQJ 3LSRA 1WPKA 5EG0B 3GTMJ 3HM5A 5F0CA 3S1NJ 2LVSA 5JLWA 1A6IA 3GTOJ 1MNMC 3TEDA 3A01A 3LNQA 4RBOA 3B6AA 1QRYA 1ETOA 4RDUA 4FISA 1DU0A 2O7OA 1IDZA 2E2IJ 1A5JA 1JTXA 1FIAA 4C3IJ 3S2HJ 3BR5A 1BJZA 3RZDJ 3FK7A 1ZQ3P 3FIWA 1MBJA 1ETVA 3HKZN 3BTJA 3BG5A 3DCFA 5J1UA 2KDZA 3FKIJ 5E3NA 1U78A 1XS9A 5FKLA 2H8RA 2MGQA 1LE8B 3ZQLA 3IH3A 5FKOA 3BG9A 2EZHA 3HGYA 2XPWA 2CRGA 3W6VA 3ZQGA 5BNGA 4G12A 1RPWA 1HLVA 2NS7A 2FQ4A 4A3MJ 1HOMA 2Y9ZA 4FTHA 2LK2A 1GV5A 1B72A 4A3DJ 1WGXA 3S17J 3BT9A 1ETKA 5M5XJ 3B6CA 4M6VA 2LY9A 2IAIA 3A02A 4M3DA 1BA5A 4C2MJ 2R92J 1CQTA 1XG1A 2MG4A 2EZLA 3S1MJ 3JREA 2KT0A 3SFIA 3ZQIA 1X2NA 5EZHA 3M3YJ 1UG2A 4A3IJ 4D7MA 5EGOB 1RKTA 2JK3A 1MBEA 2MSYA 4AYBN 1POGA 2TRTA 3TP3A 1RESA 4D5FA 1HDPA 5FKNA 4Y52J 4JYKA 2PMZN 2ZB9A 1ZK8A 1YRNB 2JMWA 2EZIA 2HXIA 4CYCA 5EZGA 2VPRA 4I6ZA 3G1MA 4MFEA 5IP9J 4A3FJ 3HOUJ 4C3HJ 1AU7A 1Z77A 4IHXA 5F27A 1P7JA 2R5ZB 2O8KA 1AKHB 3HOZJ 2E19A 5IP6A 1LFBA 1Q1VA 4IEJA 2E2JJ 1JKOC 2DMQA 4IHWA 2DMNA 2X6OA 4JX5A 5F08A 4XRSA 3CMYA 2E1OA 1TWGJ 4D5CA 2AO9A 5EF6A 1D5YA 3S1QJ 3GTQJ 4A69C 4D7NA 4JX6A 2JA7J 2OF7A 4HNVA 2K40A 2XSDC 2WB1N 5IYCJ 2WV1A 2X48A 3Q0VA 1OFCX 1I6HJ 4UUSB 1R9TJ 1TC3C 1RETA 2Y2ZA 3BR2A 1K61A 5FLVA 1GVDA 4Y7NJ 3OOUA 4A3BJ 1Y1VJ 2JA8J 3JRGA 3MVPA 1T56A 2LD5A 4JX4A 4A3GJ 3HB9A 2HI3A 1OJLA 1PUFB 1K83J 1FJLA 1ENHA 2DMTA 3OSGA 3IV5A 3HDDA 4UUTA 1IG7A 1MSFC 3HOWJ 5GPAA 4A3CJ 1B8IB 2I10A 5FJ8J 1FTZA 1SANA 1JT0A 2GLOA 2X9DA 3S2DJ 4EEFG 4A93J 3JRAA 2NVXJ 5J3LA 1I3QJ 1TWFJ 2VKEA 2DA1A 1MSEC 1JUPA 3JRDA 2HOAA 1WI3A 5E3MA 2LR8A 2DN0A 2DTZA 1VNDA 2M9HA 3BQYA 5IOYA 3BQZA 3E7LA 1F36A 3CQZJ 1FIPA 1QPIA 3ZOBA 3RKQA 1I50J 2R5YB 2W48A 3HOYJ 1DU6A 1APLC 4FE7A 3S15J 5C44J 1QVTA 4DYCA 4BY7J 2FD5A 3IH4A 3DEWA 1P7IA 2OPTA 2M8GX 1TWHJ 1JKQC 3NARA 4X1EA 1ZGWA 1X2MA 2G0EA 3IH2A 1JTYA 5IYBJ 2YU9J 3HGGA 3S16J 1EF4A 3BR1A 4DYQA 5JLXA 1H89C 5IPAA 3QQAA 2EQRA 1JJ6C 2XGDA 2HXOA 3A03A 2M0CA 3S1RJ 4BBRJ 3I4MJ 3LSPA 3SDGA 4ABZA 2XGCA 2GBYA 1W0UA 1MH4A 4XRSG 2NVYJ 3A01B 2DA3A 1HCRA 2LLKA 3GTLJ 3OIOA 2NOGA 2ME6A 9ANTA 4MLOA 1ZTRA 4DZPA 5DTDA 1GT0C 1SFOJ 2QCOA 1MH3A 2L7ZA 4X6AJ 2TCTA 5EG0A 3JRIA 3GTKJ 4A3EJ 1JUMA 2ME0A 2ID3A 1ETYA 3G1OA 5EYRA 3FISA 2VUMJ 2Y31A 1HF0A 3Q3SA 1VI0A 2VI6A 3LSJA 3HOVJ 2D5VA 3MKLA 1AHDP 1IV6A 3D1NI 5K7FA 2CUFA 3JRFA 4MO7A 1JKPC 4I76A 5IYDJ 3OSFA 1MBHA 2LP0A 1MBFA 2K9SA 1S7EA 3BR3A 4J19A 5F1JA 2HQ5A 2XPUA 1ETQA 3H3VK 5M5YJ 5GP9A 1UMQA 5F04A 2DA6A 2FX0A 5E3LA 3TW6A 1B72B 1HDDC 2CQQA 3Q0WA 1JUSA 5FLMJ 3LOCA 3Q0UA 1LE8A 1XC5A 3O8HA 1JGGA 4DZJA 1TWAJ 1ORKA 2L0KA 2HOSA 2R93J 1RKWA 3F0CA 4GFBA 2MW8A 3MN2A 2E2HJ 2CUEA 2XPVA 1BW5A 1IGNA 3WHBA 5K7ZA 4AC0A 3QPLA 5M5WJ 3S14J 1W0TA 2L7MP 2H1KA 2R7ZJ 5GPCA 4QTRA 2CQXA 4MFDA 4W97A 3QPSA 4L5EA 4QIWN 1U8BA 1T33A 1G2HA 4B3AA 5F0FA 1GDTA 3RQIA 4CYCB 1FEXA 1QVUA 1BL0A 1H8AC 5J1RA 1NTCA 2R0QC 1BW6A 2DMPA 2NS8A 4DYRA 5EGOA 1JT6A 2K9NA 5IOZA 4LOCA 2EH3A 4XK4A 3SJMA 3G1LA 3GTJJ 5E3OA 4A3KJ 2XB0X 2DA4A 1ZR4A 3LSGA 2JA6J 3HEFA 1GUUA 1Y1WJ 1WH5A 3BG3A 1YRNA 1IJWC 2NVTJ 5K7HA 4B1RA 3HBLA 4B4CA 1IC8A 2XB5A 2QF7A 3L1PA 3I4NJ 2DA7A 1UHSA 1WH7A 2R5ZA 2JJ7A 3ZQHA 1AKHA 4M3GA 5HODA 3BR6A 4BKXA 3JRBA 1X58A 2AHQA 4JP0A 2K9QA 4M3FA 2M34A 2WAQN 2HDDA 2YUSA 5M3MJ 4NDLA 3JRHA 3RZOJ 1IUFA 3O8GA 3PO3J 3FK6A 3TP0A 2O9LA 2JWTA 3K2AA 5FKKA 2Y9YA 4A3LJ 5DS9A 2EZKA 2L9RA 5F0HA 2XGEA 2Y30A 4S0HB 4BY1J 3ZQCA 3GBGA 4M3EA 1TWCJ 4DW6A 4UUSA 1NK2P 2HOTA 1OCTC 4MIMA 3M4OJ 1OCPA 3CDLA 4M3BA 4FE4A 5FKMA 4XICA 1U9NA 5C4XJ 1MBGA 5C3EJ 5C4JJ 2DA2A 2JA5J 3ZQFA 3GTPJ 1FTTA 1PUFA 2COBA 5EDNA 3BTLA 3C2BA 1VFCA 4XIDA 3K7AJ 1MBKA 1H88C 1JJ8C 4IHVA 4QSHA 3TW7A 1NK3P 4FCYA 2N8GA 3BTCA 3UKGA 4BXXJ 4W1UA 5IP7J 2RAEA 3VPRA 4C3JJ 1B8IA 1F43A 3HOXJ 2LTPA 2IBDA 1IDYA 2LKXA 2HYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID6 A;  4A3J J;  3JR9 A;  1LFU P;  1U9O A;  3H0G J;  2ELK A;  5J1Y A;  5EEA A;  3BTI A;  2GM4 A;  3CCY A;  1GV2 A;  1ZR2 A;  4BBS J;  2FJ1 A;  2YS9 A;  2CU7 A;  1IRZ A;  3PO2 J;  2M2E A;  2ECB A;  2XRL A;  4V2G A;  3JRC A;  4XRM A;  2CJJ A;  5M3F J;  1ITY A;  1ZKG A;  1VF9 A;  4IHY A;  1WCM J;  2P81 A;  2DJN A;  2R5Y A;  2EBI A;  2DMU A;  2DA5 A;  2VKV A;  1RR7 A;  3WHC A;  2B63 J;  3BR0 A;  2ECC A;  3PM1 A;  3NAU A;  3GTG J;  1O4X A;  4AUX A;  2IEK A;  4V2F A;  1ETX A;  2JN6 A;  2LFB A;  1E3O C;  1ETW A;  1JKR C;  2Y0S N;  1Z0X A;  2L7F P;  2NVQ J;  3LSR A;  1WPK A;  5EG0 B;  3GTM J;  3HM5 A;  5F0C A;  3S1N J;  2LVS A;  5JLW A;  1A6I A;  3GTO J;  1MNM C;  3TED A;  3A01 A;  3LNQ A;  4RBO A;  3B6A A;  1QRY A;  1ETO A;  4RDU A;  4FIS A;  1DU0 A;  2O7O A;  1IDZ A;  2E2I J;  1A5J A;  1JTX A;  1FIA A;  4C3I J;  3S2H J;  3BR5 A;  1BJZ A;  3RZD J;  3FK7 A;  1ZQ3 P;  3FIW A;  1MBJ A;  1ETV A;  3HKZ N;  3BTJ A;  3BG5 A;  3DCF A;  5J1U A;  2KDZ A;  3FKI J;  5E3N A;  1U78 A;  1XS9 A;  5FKL A;  2H8R A;  2MGQ A;  1LE8 B;  3ZQL A;  3IH3 A;  5FKO A;  3BG9 A;  2EZH A;  3HGY A;  2XPW A;  2CRG A;  3W6V A;  3ZQG A;  5BNG A;  4G12 A;  1RPW A;  1HLV A;  2NS7 A;  2FQ4 A;  4A3M J;  1HOM A;  2Y9Z A;  4FTH A;  2LK2 A;  1GV5 A;  1B72 A;  4A3D J;  1WGX A;  3S17 J;  3BT9 A;  1ETK A;  5M5X J;  3B6C A;  4M6V A;  2LY9 A;  2IAI A;  3A02 A;  4M3D A;  1BA5 A;  4C2M J;  2R92 J;  1CQT A;  1XG1 A;  2MG4 A;  2EZL A;  3S1M J;  3JRE A;  2KT0 A;  3SFI A;  3ZQI A;  1X2N A;  5EZH A;  3M3Y J;  1UG2 A;  4A3I J;  4D7M A;  5EGO B;  1RKT A;  2JK3 A;  1MBE A;  2MSY A;  4AYB N;  1POG A;  2TRT A;  3TP3 A;  1RES A;  4D5F A;  1HDP A;  5FKN A;  4Y52 J;  4JYK A;  2PMZ N;  2ZB9 A;  1ZK8 A;  1YRN B;  2JMW A;  2EZI A;  2HXI A;  4CYC A;  5EZG A;  2VPR A;  4I6Z A;  3G1M A;  4MFE A;  5IP9 J;  4A3F J;  3HOU J;  4C3H J;  1AU7 A;  1Z77 A;  4IHX A;  5F27 A;  1P7J A;  2R5Z B;  2O8K A;  1AKH B;  3HOZ J;  2E19 A;  5IP6 A;  1LFB A;  1Q1V A;  4IEJ A;  2E2J J;  1JKO C;  2DMQ A;  4IHW A;  2DMN A;  2X6O A;  4JX5 A;  5F08 A;  4XRS A;  3CMY A;  2E1O A;  1TWG J;  4D5C A;  2AO9 A;  5EF6 A;  1D5Y A;  3S1Q J;  3GTQ J;  4A69 C;  4D7N A;  4JX6 A;  2JA7 J;  2OF7 A;  4HNV A;  2K40 A;  2XSD C;  2WB1 N;  5IYC J;  2WV1 A;  2X48 A;  3Q0V A;  1OFC X;  1I6H J;  4UUS B;  1R9T J;  1TC3 C;  1RET A;  2Y2Z A;  3BR2 A;  1K61 A;  5FLV A;  1GVD A;  4Y7N J;  3OOU A;  4A3B J;  1Y1V J;  2JA8 J;  3JRG A;  3MVP A;  1T56 A;  2LD5 A;  4JX4 A;  4A3G J;  3HB9 A;  2HI3 A;  1OJL A;  1PUF B;  1K83 J;  1FJL A;  1ENH A;  2DMT A;  3OSG A;  3IV5 A;  3HDD A;  4UUT A;  1IG7 A;  1MSF C;  3HOW J;  5GPA A;  4A3C J;  1B8I B;  2I10 A;  5FJ8 J;  1FTZ A;  1SAN A;  1JT0 A;  2GLO A;  2X9D A;  3S2D J;  4EEF G;  4A93 J;  3JRA A;  2NVX J;  5J3L A;  1I3Q J;  1TWF J;  2VKE A;  2DA1 A;  1MSE C;  1JUP A;  3JRD A;  2HOA A;  1WI3 A;  5E3M A;  2LR8 A;  2DN0 A;  2DTZ A;  1VND A;  2M9H A;  3BQY A;  5IOY A;  3BQZ A;  3E7L A;  1F36 A;  3CQZ J;  1FIP A;  1QPI A;  3ZOB A;  3RKQ A;  1I50 J;  2R5Y B;  2W48 A;  3HOY J;  1DU6 A;  1APL C;  4FE7 A;  3S15 J;  5C44 J;  1QVT A;  4DYC A;  4BY7 J;  2FD5 A;  3IH4 A;  3DEW A;  1P7I A;  2OPT A;  2M8G X;  1TWH J;  1JKQ C;  3NAR A;  4X1E A;  1ZGW A;  1X2M A;  2G0E A;  3IH2 A;  1JTY A;  5IYB J;  2YU9 J;  3HGG A;  3S16 J;  1EF4 A;  3BR1 A;  4DYQ A;  5JLX A;  1H89 C;  5IPA A;  3QQA A;  2EQR A;  1JJ6 C;  2XGD A;  2HXO A;  3A03 A;  2M0C A;  3S1R J;  4BBR J;  3I4M J;  3LSP A;  3SDG A;  4ABZ A;  2XGC A;  2GBY A;  1W0U A;  1MH4 A;  4XRS G;  2NVY J;  3A01 B;  2DA3 A;  1HCR A;  2LLK A;  3GTL J;  3OIO A;  2NOG A;  2ME6 A;  9ANT A;  4MLO A;  1ZTR A;  4DZP A;  5DTD A;  1GT0 C;  1SFO J;  2QCO A;  1MH3 A;  2L7Z A;  4X6A J;  2TCT A;  5EG0 A;  3JRI A;  3GTK J;  4A3E J;  1JUM A;  2ME0 A;  2ID3 A;  1ETY A;  3G1O A;  5EYR A;  3FIS A;  2VUM J;  2Y31 A;  1HF0 A;  3Q3S A;  1VI0 A;  2VI6 A;  3LSJ A;  3HOV J;  2D5V A;  3MKL A;  1AHD P;  1IV6 A;  3D1N I;  5K7F A;  2CUF A;  3JRF A;  4MO7 A;  1JKP C;  4I76 A;  5IYD J;  3OSF A;  1MBH A;  2LP0 A;  1MBF A;  2K9S A;  1S7E A;  3BR3 A;  4J19 A;  5F1J A;  2HQ5 A;  2XPU A;  1ETQ A;  3H3V K;  5M5Y J;  5GP9 A;  1UMQ A;  5F04 A;  2DA6 A;  2FX0 A;  5E3L A;  3TW6 A;  1B72 B;  1HDD C;  2CQQ A;  3Q0W A;  1JUS A;  5FLM J;  3LOC A;  3Q0U A;  1LE8 A;  1XC5 A;  3O8H A;  1JGG A;  4DZJ A;  1TWA J;  1ORK A;  2L0K A;  2HOS A;  2R93 J;  1RKW A;  3F0C A;  4GFB A;  2MW8 A;  3MN2 A;  2E2H J;  2CUE A;  2XPV A;  1BW5 A;  1IGN A;  3WHB A;  5K7Z A;  4AC0 A;  3QPL A;  5M5W J;  3S14 J;  1W0T A;  2L7M P;  2H1K A;  2R7Z J;  5GPC A;  4QTR A;  2CQX A;  4MFD A;  4W97 A;  3QPS A;  4L5E A;  4QIW N;  1U8B A;  1T33 A;  1G2H A;  4B3A A;  5F0F A;  1GDT A;  3RQI A;  4CYC B;  1FEX A;  1QVU A;  1BL0 A;  1H8A C;  5J1R A;  1NTC A;  2R0Q C;  1BW6 A;  2DMP A;  2NS8 A;  4DYR A;  5EGO A;  1JT6 A;  2K9N A;  5IOZ A;  4LOC A;  2EH3 A;  4XK4 A;  3SJM A;  3G1L A;  3GTJ J;  5E3O A;  4A3K J;  2XB0 X;  2DA4 A;  1ZR4 A;  3LSG A;  2JA6 J;  3HEF A;  1GUU A;  1Y1W J;  1WH5 A;  3BG3 A;  1YRN A;  1IJW C;  2NVT J;  5K7H A;  4B1R A;  3HBL A;  4B4C A;  1IC8 A;  2XB5 A;  2QF7 A;  3L1P A;  3I4N J;  2DA7 A;  1UHS A;  1WH7 A;  2R5Z A;  2JJ7 A;  3ZQH A;  1AKH A;  4M3G A;  5HOD A;  3BR6 A;  4BKX A;  3JRB A;  1X58 A;  2AHQ A;  4JP0 A;  2K9Q A;  4M3F A;  2M34 A;  2WAQ N;  2HDD A;  2YUS A;  5M3M J;  4NDL A;  3JRH A;  3RZO J;  1IUF A;  3O8G A;  3PO3 J;  3FK6 A;  3TP0 A;  2O9L A;  2JWT A;  3K2A A;  5FKK A;  2Y9Y A;  4A3L J;  5DS9 A;  2EZK A;  2L9R A;  5F0H A;  2XGE A;  2Y30 A;  4S0H B;  4BY1 J;  3ZQC A;  3GBG A;  4M3E A;  1TWC J;  4DW6 A;  4UUS A;  1NK2 P;  2HOT A;  1OCT C;  4MIM A;  3M4O J;  1OCP A;  3CDL A;  4M3B A;  4FE4 A;  5FKM A;  4XIC A;  1U9N A;  5C4X J;  1MBG A;  5C3E J;  5C4J J;  2DA2 A;  2JA5 J;  3ZQF A;  3GTP J;  1FTT A;  1PUF A;  2COB A;  5EDN A;  3BTL A;  3C2B A;  1VFC A;  4XID A;  3K7A J;  1MBK A;  1H88 C;  1JJ8 C;  4IHV A;  4QSH A;  3TW7 A;  1NK3 P;  4FCY A;  2N8G A;  3BTC A;  3UKG A;  4BXX J;  4W1U A;  5IP7 J;  2RAE A;  3VPR A;  4C3J J;  1B8I A;  1F43 A;  3HOX J;  2LTP A;  2IBD A;  1IDY A;  2LKX A;  2HYJ A; 
#chains in the Genus database with same CATH topology
 1V3F A;  2K9M A;  3JR9 A;  2F5D A;  2ZKZ A;  5GAG J;  1XCV A;  3V7C A;  2GM4 A;  1D0Y A;  3CCY A;  4RMN A;  1AOY A;  2VQC A;  1ZR2 A;  2ELH A;  2QA4 I;  1KQ8 A;  4FHT A;  3VFZ A;  4N9H A;  3CMM A;  1VQO I;  4OAZ A;  2O03 A;  1R6R A;  4OIO F;  4HX7 A;  2L01 A;  4B47 A;  2CJJ A;  4PCQ A;  3OOP A;  4L5I A;  1N25 A;  4WXH A;  2DJN A;  2R5Y A;  2XAF A;  4UVC A;  1RR7 A;  3V7R A;  1W5S A;  2AQF A;  2LH9 A;  3J7A Y;  3QU6 A;  3PM1 A;  1I27 A;  2X51 A;  4AUX A;  2ZNZ A;  4OWR B;  4LFU A;  1QZZ A;  4F91 B;  2BE5 F;  4CYD A;  1W7P A;  2NYX A;  4G6D A;  3T8R A;  1OLT A;  3ZN1 A;  2NVQ J;  1WPK A;  4E70 A;  1A04 A;  4WXD A;  2O61 A;  1LQ1 A;  4EVI A;  4BDZ A;  3DKY A;  1Y0N A;  3HM5 A;  5H20 A;  1FBS A;  5F0C A;  3S1N J;  4QLC U;  2PJR B;  2XKP A;  1PYV A;  2M7A A;  1MNM C;  4N9I A;  4AYB A;  2VOD A;  2EB7 A;  4CUG A;  1X1P A;  4HG2 A;  3J80 Z;  2CMP A;  3OS0 A;  3B6A A;  3PNY A;  2HTS A;  2K86 A;  4FIS A;  3I56 I;  4G7Z F;  3HPH A;  1GXQ A;  2F4O B;  4LIV A;  2WAD A;  2K27 A;  3KEO A;  2ADU A;  4HF1 A;  3FIW A;  2PBI A;  4PSW A;  3PSI A;  1OR7 C;  3V8J A;  2K4B A;  3MZH A;  1RR8 C;  2IW5 A;  5E3N A;  2XHK A;  3P9K A;  3UNG C;  2P5K A;  1HST A;  5FKL A;  4G7O F;  4CXF A;  1WJC A;  4UHT A;  3FF5 A;  4ZZL A;  3A4C A;  1SVM A;  3ZQL A;  2YSR A;  3IH3 A;  2NRA C;  5E18 F;  3BG9 A;  2XF6 A;  2XPW A;  1MGT A;  4IO9 F;  4G12 A;  2GIV A;  2NS7 A;  4MTE A;  2BBY A;  5E1X A;  1QPM A;  5CPR B;  2AS5 F;  2Y9Z A;  1I1S A;  5HS8 A;  3OYN A;  2JRT A;  1B72 A;  1WGX A;  2DT5 A;  1YIO A;  3FMR A;  2CV0 A;  4AIK A;  2CH0 A;  1XTA A;  2L4A A;  3V8L A;  3E6B A;  2DTR A;  1XG1 A;  1XMK A;  3S1M J;  3K1N A;  6PAX A;  1VQ7 I;  3LAP A;  1X2N A;  2WA0 A;  3IKT A;  3R4K A;  2OBP A;  1UG2 A;  4A3I J;  4GO1 A;  3K4J A;  2JTV A;  3E0J B;  4EJU A;  2FBH A;  4AYB N;  2TRT A;  3EUA A;  4JK1 X;  2AQE A;  3M8E A;  4LK1 F;  3TP3 A;  3KYL A;  2FML A;  1HDP A;  2ZJ2 A;  4Y52 J;  2PMZ N;  4KN4 X;  5K1Y A;  3AKZ A;  2HXI A;  5LHH A;  3NRV A;  2WBM A;  3P7N A;  2QKM B;  5EZG A;  4CYC A;  1O57 A;  1F9N A;  3HZJ A;  4O3M A;  2PFB A;  3IRR A;  3A0B C;  1K78 B;  5H6R A;  1HW1 A;  3GME A;  5JHF A;  2V79 A;  2KIS A;  4IHX A;  5E79 C;  1BC7 C;  2ETH A;  2MLG A;  1TBX A;  2QEN A;  1ZAR A;  3OYE A;  3CCM I;  2E19 A;  1VQP I;  4ANJ A;  1LFB A;  4GDF A;  2BZT A;  2PN6 A;  4IEJ A;  1JKO C;  1EH7 A;  2P6S A;  3ZGK A;  3CCV I;  4L9J A;  2B7E A;  1BOB A;  2RQP A;  4ZTF A;  2EWN A;  2X6O A;  3SYT A;  4XRS A;  4KYW A;  2E1O A;  2QLZ A;  4UVA A;  1O3R A;  2EIJ H;  4JX6 A;  2JA7 J;  2LF7 A;  2OF7 A;  4HNV A;  4U0V A;  5DCM A;  2DOF A;  4AIJ A;  2XSD C;  4BS9 A;  2WB1 N;  5IYC J;  4OOI A;  2R7S A;  2X48 A;  1QQI A;  3TDU C;  1LUJ B;  2HU9 A;  4S04 A;  1I6H J;  2STT A;  1S9H A;  2XVC A;  4GYG A;  1TC3 C;  2CUZ A;  3ASN H;  4PK4 A;  5AIP A;  5D5W B;  2Z33 A;  2XF7 A;  4IVN A;  1J9I A;  1U5T C;  4Y7N J;  3OOU A;  4HLX A;  2WAQ A;  3CC4 I;  4XMY A;  2BVM A;  5GAE J;  3JTG A;  3MVP A;  1SD4 A;  1XSD A;  3OY9 A;  5EJC A;  4HOB A;  4E7K A;  3VWB A;  1HKS A;  5JI6 A;  4EGZ A;  1ENH A;  1Z7L A;  1FP2 A;  1HQC A;  1IG7 A;  4R79 A;  3HOW J;  3TBI A;  1FT9 A;  3C18 A;  4A3C J;  2CW7 A;  3DKW A;  2A69 F;  2I10 A;  3I4P A;  3KLO A;  4XOR A;  1IXC A;  3M1C A;  4PUS A;  1FTZ A;  1SAN A;  2CG4 A;  3EUH C;  3KP4 A;  3SZG A;  4X0G A;  3CP2 A;  4EEF G;  1WWX A;  2HQR A;  2JA2 A;  5LFA A;  2R7W A;  3I3L A;  1W36 C;  1MMN A;  4PJM A;  2L02 A;  3U2R A;  3MZ8 A;  1RUO A;  1UG0 A;  1Z3Y A;  4P1W A;  2R7T A;  4P5O A;  1JUP A;  3SQN A;  1FBU A;  2Z2S B;  5E3M A;  3CF5 F;  2LR8 A;  1UZC A;  1R5H A;  1T0F C;  5B1A H;  4XSZ F;  2LY1 A;  2FNA A;  4HEA 2;  4HRI A;  1IRG A;  5ERI A;  1I50 J;  5ICG A;  2W48 A;  3HOY J;  5CKT A;  3S15 J;  1G3T A;  1QVT A;  4DYC A;  1IXR C;  3QWL A;  3MD2 A;  3DEW A;  3OR1 C;  3T8T A;  2L4M A;  1ZH5 A;  1UB9 A;  3DP7 A;  3NWT A;  5EEG A;  4HDV A;  2OPT A;  2BGC A;  1J5Y A;  1TP4 A;  1JKQ C;  4L9V A;  2FUG 2;  1ZGW A;  5FLX K;  2M45 A;  5IYB J;  2YU9 J;  2H1L A;  2X6W A;  3O2P E;  4HNT A;  5B66 C;  3GYH X;  2R7D A;  1JJ6 C;  4IOA F;  2XGD A;  3AL0 B;  4BBR J;  1D1B A;  3SDG A;  3ECO A;  2J5O A;  1J59 A;  4E7I A;  2HFH A;  1KU7 A;  4XRS G;  4BQN A;  2P8T A;  1X3Z B;  2QQ9 A;  4P9U A;  2LLK A;  1Z05 A;  2DOE A;  1K4S A;  1SFX A;  2Z9O A;  2Y0S A;  3D5L A;  4MLO A;  2CW0 F;  2VL8 A;  4HPQ A;  4RM3 A;  1SFO J;  2QCO A;  2L7Z A;  3ABM H;  2HZT A;  5KAI C;  4X6A J;  2QBY A;  1LKX A;  5E20 A;  4ZDL A;  3JRI A;  3FWE A;  4A3E J;  3G1O A;  3EUH A;  1F5T A;  5A2Q K;  3FIS A;  1ZRE A;  5DD4 A;  3W3C A;  1BI0 A;  2RV8 A;  2V4J C;  1SAU A;  4MQV A;  1ZYR F;  4ZYG A;  2OD5 A;  2D5V A;  4E6K G;  3IAS 2;  3MKL A;  3OS2 A;  2CS3 A;  1I5Z A;  2VKH A;  3S8P A;  1X4O A;  3D1N I;  2P0W A;  3GWZ A;  4EJW A;  5HLG A;  3WE3 A;  3K70 C;  1BBY A;  3H35 A;  1OCC H;  4KJZ A;  2Q2E A;  1H0M A;  4I02 A;  5IYD J;  1T0F A;  2K9S A;  1S7E A;  2M5W A;  2VIX A;  1O7F A;  2HQ5 A;  3HKZ A;  5M5Y J;  3A0H C;  1UMQ A;  3H1C A;  1XSV A;  2DA6 A;  4BGD A;  1X3U A;  2CQQ A;  2ZC2 A;  4ZDO A;  1WJA A;  2A07 F;  1BIB A;  2YX7 A;  3Q0U A;  1LE8 A;  3KYD B;  1XC5 A;  3WE2 A;  1JGG A;  1QHG A;  4DBR A;  1SFE A;  2QSG X;  3L7W A;  4DZJ A;  1TWA J;  4Y4R A;  3EYI A;  2KKO A;  1U5T B;  1UFM A;  5CLS A;  3DPT A;  2DFI A;  3IL2 A;  3R6S A;  4RA2 A;  2XPV A;  4OAY A;  5FGM A;  3HYI A;  4KIF A;  2Y69 H;  2HKO A;  1FPQ A;  3QPL A;  3QYF A;  4BQA A;  4PJ0 C;  2K5C A;  1YIT I;  5FFX A;  3RTR A;  1X19 A;  4BU2 A;  5F6F A;  4ZDP A;  2H1K A;  2JSP A;  5JHU A;  2ZXI A;  3LSM A;  3QPS A;  3SXY A;  1T33 A;  4DBQ A;  3K6G A;  3QYE A;  2V7F A;  4ASN A;  3MKY B;  2HZD A;  4NB5 A;  4OIR F;  1FEX A;  1QVU A;  1WJF A;  1XD7 A;  1VQ5 I;  4EJT A;  3J81 K;  3LA7 A;  1NTC A;  2DW4 A;  3OIP A;  3I59 B;  3OYC A;  2VOP A;  4L5J A;  5KNL A;  3MWM A;  4E7Z A;  2K9N A;  3PUF A;  2W25 A;  4IQ4 A;  4LOC A;  2EH3 A;  4XK4 A;  3GTJ J;  5E3O A;  3OIQ A;  5DV5 A;  2XB0 X;  3TOB A;  4WX9 A;  2QQB A;  2CQ7 A;  3KX2 A;  4IL6 C;  1EH6 A;  3BJA A;  3BG3 A;  3OYL A;  1YRN A;  4IX7 A;  1IJW C;  4A0Z A;  4G9Y A;  5K7H A;  4KFC A;  2LNB A;  2RDP A;  3QAH A;  4B4C A;  2NS0 A;  1O7L A;  2VJI A;  3CD6 I;  1TW2 A;  1LEA A;  1X1B A;  2L54 A;  2QF7 A;  4M9S A;  3I4N J;  1JGS A;  4EQQ A;  1T8I A;  1WRJ A;  1UHS A;  1WH7 A;  3F3X A;  2JJ7 A;  2JVH A;  2GA2 A;  3K4M A;  1J09 A;  3V42 A;  1S72 I;  2BHZ A;  4WWC A;  4BKX A;  3BY6 A;  4ZYA A;  4LLN A;  1R1T A;  3HJE A;  4JP0 A;  3O6B B;  5D5U B;  3BWG A;  3AG3 H;  2M34 A;  3FXM A;  2PG4 A;  3M8F A;  4HYE A;  3W2A A;  2P4W A;  3RCO A;  2A6T A;  4B44 A;  1BC8 C;  1MJA A;  2LRD A;  2JWT A;  3ABT A;  2AXT C;  2IS2 A;  3WU1 B;  3BJ6 A;  3ZQC A;  3GBG A;  1NK2 P;  4MIM A;  1G3W A;  5HNF A;  4GXO A;  1R5I D;  5FKM A;  5J40 A;  4KNY A;  1U9N A;  2KQR A;  5C4X J;  1MBG A;  3U1D A;  2CV2 A;  2M0M A;  5C3E J;  4BE1 A;  1FNN A;  1BR2 A;  2JA5 J;  3WTU C;  4WXC A;  1F1Z A;  4MEX F;  3CLO A;  2R7U A;  2EA4 A;  3BTL A;  3TO7 A;  2DYR H;  2ZXJ A;  2L7K A;  2OTL I;  3DFG A;  5GTI C;  2P5L C;  5D6F A;  1H88 C;  1R4M B;  2BXZ A;  4QSH A;  1XGN A;  2W84 A;  1X4P A;  3ZMU A;  3BJO A;  5B3S H;  4BXX J;  4W1U A;  2F5F A;  4KIC A;  2KL4 A;  3K1M A;  2RNJ A;  3ASO H;  1HW2 A;  2Z16 A;  2WY8 Q;  2A05 A;  2ID6 A;  1ACI A;  3GZ6 A;  3BG6 A;  1U9O A;  4D9J A;  2A6H F;  3K4L A;  3BTI A;  1IW7 F;  4HAM A;  2RGV A;  2NXN B;  4XLF A;  3LSK A;  4U0W A;  2PI0 A;  3F9K A;  3GZN B;  3QP6 A;  2CU7 A;  3FX3 A;  3ZPL A;  3PO2 J;  5E8G A;  2VLA A;  2V9K A;  4EJO A;  3JRC A;  1D3Y A;  1N75 A;  2W00 A;  4XRM A;  4I2O A;  1ITY A;  4XRF A;  1ZKG A;  1U6G A;  3BG7 A;  2P81 A;  1XDS A;  5HS7 A;  5IT9 Z;  3BRO A;  3SHF A;  2EBI A;  3DF8 A;  2DA5 A;  1O3S A;  2LDU A;  3DEU A;  3NAU A;  4D0P A;  1BJA A;  1YHQ I;  1YOV B;  3BOQ A;  1FZP B;  2MC3 A;  4BEH B;  2LFB A;  1JKR C;  3HC7 A;  3HUG B;  2IRF G;  1IRX A;  3IKV A;  1Z0X A;  1LEB A;  3LSR A;  3IWZ A;  1FLI A;  3GTM J;  5L3B A;  3DPL C;  2KLO A;  4II3 A;  2LVS A;  1A6I A;  1T98 A;  3B73 A;  1ZHF A;  5J6X A;  1OYY A;  4BH9 A;  1DPU A;  2BY0 A;  1N77 A;  4A0X A;  3LNQ A;  4Y33 A;  2W82 A;  1A6Q A;  3BZ6 A;  5ILV A;  5HNH A;  1YS7 A;  3AG1 H;  2CW8 A;  4KT5 C;  1D5V A;  4RDU A;  1H9G A;  4RB1 A;  3M07 A;  4BE2 A;  2PMU A;  2E2I J;  3HSE A;  2HEO A;  1FIA A;  2M4K A;  1BJZ A;  1E2X A;  3W6K B;  3PNV A;  3RZD J;  3FK7 A;  1FP1 D;  2KRF A;  3S32 A;  2BY1 A;  3RYP A;  1FOW A;  3DXJ F;  1ETV A;  4ZZD A;  5J1U A;  4HNU A;  2W85 A;  3FKI J;  4KIS A;  1XS9 A;  2F4I A;  3L00 A;  1FX7 A;  2H8R A;  1OPC A;  1Z1D A;  3PFI A;  4BQQ A;  2A3S A;  2GXA A;  1MMA A;  2EZH A;  4B8X A;  1BI1 A;  5ED4 A;  4UB8 C;  2XGX A;  2R7O A;  1EH8 A;  5D5V B;  1BI3 A;  3CCU I;  4S05 A;  2P7C B;  3LFU A;  3G4S I;  3C2H A;  4XON A;  3V7S A;  4A5N A;  4BAY A;  1CF7 A;  1IZ1 A;  4ZJZ A;  2G9W A;  2XV4 S;  1GV5 A;  3DLL F;  4A3D J;  3BT9 A;  3R61 A;  3CC7 I;  4BXF A;  2VXZ A;  3B6C A;  1QA6 A;  1V5G A;  2LY9 A;  5GTH C;  2UV1 A;  2XAS A;  1UHW A;  1CQT A;  1MDM B;  4CA0 A;  1Z7U A;  1P6R A;  3JRE A;  4ZYD A;  4HX4 A;  2BVL A;  2IGM A;  3ZQI A;  1Z3X A;  5EZH A;  2ZJQ F;  1FOY A;  1HSJ A;  3HSR A;  3NQO A;  3W6J B;  5L3C A;  3M3Y J;  1B4A A;  3TDZ C;  4ZH4 F;  1TT5 B;  4MGR A;  4D7M A;  5EGO B;  1QHH D;  1YS6 A;  2JK3 A;  4KIG A;  4BXU A;  3TKY A;  3S93 A;  4FQG A;  1POG A;  3ABU A;  4K2E A;  3LAJ A;  4BHC A;  1ONV A;  3P9I A;  1ODD A;  4G6Q A;  1UHM A;  4JYK A;  2P6T A;  2H94 A;  2ZB9 A;  4BJ5 C;  2PJP A;  2LSO A;  2CQN A;  3P5J A;  2HYG D;  2EZI A;  4RB0 A;  3AG4 H;  2HKX A;  4PJJ A;  2XAU A;  3BZC A;  3FBN B;  3G1M A;  3JCU C;  4MFE A;  2M4G A;  2G7U A;  1G59 A;  4C3H J;  2CUJ A;  4B09 A;  1X1C A;  2UZK A;  3F6V A;  4CSW A;  1YIJ I;  4TV7 A;  5F27 A;  2V1X A;  5HDN A;  3K1P A;  2R5Z B;  4XKW A;  2ZFW A;  2V1D A;  1KQ0 A;  1KYW A;  1SFU A;  1KGS A;  3KFW X;  1F4K A;  2E2J J;  1W5T A;  3VSK A;  5F08 A;  2QUF A;  3CMY A;  4LGW A;  1HKT A;  1REP C;  2AO9 A;  4ENM A;  3MEX A;  3S1Q J;  1QNT A;  4D7N A;  2ZNY A;  4O6J A;  3S3M A;  3WTZ A;  2GA1 A;  4MNU A;  5AIQ A;  4XBF A;  4ITV A;  3FXO A;  3OYM A;  2WV1 A;  2GIZ A;  3V8K A;  3F6O A;  3Q0V A;  3OWT A;  1OFC X;  4BDY A;  4PZJ A;  4CH7 A;  2ESN A;  5J47 A;  4UUS B;  5HLH A;  1RET A;  2Y2Z A;  4MQ9 F;  3WU2 C;  5FLV A;  1ZLJ A;  1L0O C;  3IP4 B;  3LQR A;  3VYR B;  2W57 A;  1GVD A;  1PP8 F;  3K4K A;  3GXO A;  2JA8 J;  3JRG A;  3IRQ A;  1T56 A;  4XLE A;  2LD5 A;  2IP2 A;  4YEJ A;  3IAM 2;  3GLL A;  2HI3 A;  4Y15 A;  3RKX A;  3T0Y A;  2IS4 A;  1IN4 A;  4MEY F;  1NHA A;  5FB2 A;  2GWR A;  2VJ5 A;  4R8H A;  4CIC A;  4PJL A;  3I55 I;  1DPR A;  5GPA A;  1S8N A;  1YX5 A;  3WTW C;  3OYH A;  1B8I B;  2H27 A;  2VE8 A;  3SDB A;  3MFK A;  2RKH A;  3B02 A;  2E71 A;  1XGM A;  1JT0 A;  4B48 A;  5IY5 H;  2RQQ A;  4H0E A;  4A93 J;  1WI9 A;  2NVX J;  3RPU D;  5K5R A;  5J3L A;  4E7S A;  2X1D A;  4RAF A;  3BC8 A;  4XLH A;  3HTU A;  4HBL A;  5KAF C;  1WI3 A;  2LOO A;  1TQM A;  1YW7 A;  2E1C A;  3BQY A;  1LPQ A;  4XOT A;  5IOY A;  3CCJ I;  3AFH A;  2Z99 A;  1FIP A;  1QPI A;  3VDX A;  4DJA A;  3RKQ A;  2R5Y B;  2BW3 A;  1DU6 A;  2WY7 Q;  1APL C;  4FE7 A;  1IUY A;  3WG9 A;  2OUM A;  3LQQ A;  5FO5 A;  3RIR A;  2RRE A;  3DTK A;  2Y48 A;  4BY7 J;  4U7B A;  2F48 A;  3BLY A;  4J00 A;  4EM1 A;  4E7J A;  3F8M A;  3PFY A;  3NAR A;  1I6X A;  1W7P B;  4CO8 A;  2G0E A;  1JTY A;  4RGS A;  1RZ4 A;  2E35 A;  1UCR A;  4DYQ A;  3F22 A;  3D0S A;  2E1M C;  1MJ9 A;  2HXO A;  2M0C A;  3KP6 A;  4ZC3 A;  3LSP A;  2FBK A;  4OIP F;  4KIT B;  3L2U A;  2JQ7 A;  2XGC A;  3NEU A;  4IHS A;  2GBY A;  4E4H A;  1MH4 A;  2EPF A;  1IV8 A;  2DA3 A;  1B9M A;  2FMY A;  1HCR A;  2NOG A;  3KIO A;  5B5E C;  1ZTR A;  3OYK A;  2VQH A;  5JR3 A;  2IA2 A;  1GT0 C;  2E5Z A;  3ERM A;  1MH3 A;  2D1V A;  2EJR A;  2A6E F;  2KRC A;  4G8X A;  1IAW A;  2FOK A;  1OCZ H;  2LBF A;  2ZJP F;  5EG0 A;  2RNG A;  3WTV C;  4UUV A;  3GTK J;  1ETY A;  3WOD F;  3DQV C;  2Y31 A;  4A6E A;  1VI0 A;  1WJD A;  2VI6 A;  2Y0M A;  2X85 A;  4UNO A;  3GZ5 A;  3QOE A;  2DQL A;  4YFN F;  3RKW A;  1AHD P;  3LFK A;  5DUI A;  3CJN A;  3WGH A;  2V9P A;  1S5L C;  2KIU A;  4I76 A;  2LP0 A;  2XF5 A;  4XLA A;  2EV6 A;  2GXB A;  3BR3 A;  2HOE A;  2XPU A;  1ETQ A;  1GVJ A;  1S7A A;  3CDH A;  3H3V K;  2QM3 A;  5F04 A;  1BR4 A;  1SMT A;  4RB2 C;  5E3L A;  2DPU A;  3ZN0 A;  1B72 B;  4EM0 B;  3WTX C;  1ZG1 A;  4O5V A;  1JUS A;  5FLM J;  1A35 A;  4M74 A;  3WU0 A;  3GFI A;  2VJJ A;  4ESB A;  4NC6 A;  4Q48 A;  1LFP A;  4LG0 A;  3O8H A;  2X0L A;  3IUO A;  3Q9V A;  4B3X A;  1YO5 C;  1KU2 A;  2FNP A;  2L0K A;  2XDV A;  2HOS A;  1RKW A;  4GFB A;  3QPH A;  1LDK B;  2CFO A;  3MN2 A;  4F7Z A;  2CUE A;  2E2H J;  1BW5 A;  4I99 C;  3L09 A;  4II2 A;  1IGN A;  3WHB A;  4AC0 A;  3KZZ A;  5M5W J;  4BHB A;  3S14 J;  3DU6 A;  2L7M P;  2XAG A;  2CFX A;  5GPC A;  4V19 K;  3FBI B;  4QWQ A;  1R49 A;  1RI7 A;  4ETS A;  1T38 A;  2FRH A;  1G2H A;  1BR1 A;  5KK1 A;  5KCM A;  1ON2 A;  4CYC B;  5LRR A;  1QZE A;  1BL0 A;  1SAX A;  1H8A C;  3U9G A;  3FM3 A;  1TL8 A;  3SEQ A;  4CCK A;  1IN6 A;  2R0Q C;  2OTJ I;  2VBZ A;  1BW6 A;  2OQG A;  2DMP A;  1JT6 A;  3LA2 A;  1YX3 A;  2GOM A;  1YW8 A;  4HA8 A;  3CO6 C;  3J7Z I;  2DOA A;  1KYZ A;  1K6Y A;  2WWY A;  5LHG A;  4IKF A;  3RDI A;  1IN5 A;  2JA6 J;  1MMS A;  1X3W B;  3EPZ A;  3ZXS A;  2NOJ B;  4Q5S F;  2NVT J;  3JAM K;  3WG7 H;  2VE9 A;  5F64 A;  2MH2 A;  2EFW A;  2XAH A;  5DCM B;  1ZG5 A;  3CLQ A;  4C30 A;  1RIO H;  2P7V B;  5FD6 A;  3FMQ A;  1MMG A;  4UY8 I;  1G3Y A;  2VAS A;  3HIF A;  1A36 A;  3SZT A;  1AKH A;  1Y8R B;  3E3V A;  5HOD A;  2WC2 A;  3BR6 A;  3JRB A;  1B6A A;  2VBX A;  5FRO A;  2KFD A;  2ZME C;  3HHG A;  2BXY A;  1Z6R A;  4M9X A;  5L3F A;  4Y13 A;  2VBY A;  2WAQ N;  1YI2 I;  5M3M J;  2VON A;  2CGP A;  4XLP F;  3BCA A;  3FHN A;  4RAZ A;  4M6Y A;  1J2X A;  3FK6 A;  1X1D A;  3DPU A;  3K2A A;  5FKK A;  2Y9Y A;  3PL8 A;  5DS9 A;  2WV0 A;  2XGE A;  1AA7 A;  2KMU A;  4YFX F;  3UR3 C;  4BY1 J;  4M3E A;  4NQW A;  5CQE A;  2HOT A;  1YYV A;  3M9A A;  1OCT C;  3FXK A;  1ON1 A;  4CCN A;  1DDN A;  2JPB A;  1KA8 A;  1E0E A;  4FE4 A;  1XDU A;  1VQN I;  4PSX A;  2X6Y A;  2MLK A;  2DLL A;  3QRF F;  2HDC A;  5D8K B;  3CDI A;  2VC0 A;  3G2B A;  2HWV A;  1P4A A;  1B9N A;  1GHC A;  2DA2 A;  2LC2 A;  2A68 F;  2UUZ A;  3KP3 A;  2VQL A;  3KZY A;  2COB A;  2ZBK A;  5EDN A;  1PUF A;  2QZ8 A;  4D1Q A;  1NG7 A;  3KEY A;  2BY2 A;  3ZQQ A;  4IHV A;  2PX9 A;  4ZYE A;  2EFP A;  4LIT A;  4UV9 A;  4FCY A;  1KU9 A;  1IXS B;  1MJB A;  3VYU B;  2K3F A;  4WCG A;  2RAE A;  4C3J J;  4GYI A;  4A6D A;  1OIS A;  1XSX A;  4A3J J;  4U0Y A;  4XSX F;  3FXL A;  4E7H A;  3CUO A;  3H0G J;  3HRU A;  5EEA A;  2KHM A;  1IN8 A;  3F8F A;  2W4S A;  1GV2 A;  3K9T A;  2OQR A;  2BY3 A;  1UST A;  4HV5 A;  2YS9 A;  2V6C A;  2M2E A;  2ECB A;  3F23 A;  4V2G A;  1SD6 A;  5M3F J;  3ZMV A;  2ZME A;  1VF9 A;  1ZG3 A;  2E7X A;  2DJI A;  3PSF A;  1Q1H A;  1TQI A;  1W5C C;  2DMU A;  3H0D A;  2VKV A;  3WHC A;  2FQ3 A;  2ECC A;  1ZAO A;  3CUQ C;  2O8X A;  4AVZ A;  1O4X A;  2Q8K A;  1L3L A;  4V2F A;  4XN3 A;  5TIS C;  1LVA A;  3A1Y A;  3TO9 A;  4KA4 A;  3QOP A;  1ETW A;  3OL3 A;  2Y0S N;  3KP2 A;  1HKQ A;  4FX4 A;  1VQ4 I;  2L7F P;  2OC6 A;  2I5U A;  4C2U A;  2QBY B;  2Y75 A;  4Y17 A;  5J4V A;  3OL4 A;  5L3G A;  5JLW A;  2MBF A;  3GTO J;  2EK5 A;  4YIF A;  4FAS D;  3A01 A;  2XUB A;  3R60 A;  3TGN A;  2XSJ C;  4UV8 A;  1R22 A;  4LD5 A;  3BPV A;  2H6C A;  4XOP A;  4IJA A;  1ETO A;  2Q2E B;  1OCR H;  2O7O A;  2GAU A;  1WHU A;  1IDZ A;  1ZRD A;  5BQT A;  3BR5 A;  4DGW B;  2BHY A;  1B1B A;  4KUM A;  1MMD A;  1ULY A;  3HKZ N;  3BG5 A;  3DCF A;  2VPL A;  3L2W A;  4KT6 A;  1A31 A;  4UXN A;  2DCE A;  2IA1 A;  1SEU A;  1JHH A;  3GCM A;  3CCL I;  1OYW A;  1LE8 B;  4EMS A;  4XL9 A;  4AM3 A;  3HGY A;  2O0Y A;  2CRG A;  5K5O A;  1MIJ A;  3CJQ B;  1ZGJ A;  1RPW A;  1HLV A;  1FYL A;  1FYM A;  2FQ4 A;  3H9G A;  3WGG A;  1FOK A;  4A3M J;  3BP8 A;  1HOM A;  4A2U A;  1JXS A;  4M71 A;  4EAT A;  3DV8 A;  3U1K A;  5HDG A;  3GX4 X;  1U8R A;  3CUQ A;  3S17 J;  1ETK A;  1LJ9 A;  1TW3 A;  3CES A;  3K69 A;  1KQ9 A;  4L0Y B;  2FA5 A;  4JQF A;  2IAI A;  2JZY A;  2HPI A;  3EET A;  3I64 A;  1BA5 A;  4NBQ A;  1VZ0 A;  2R92 J;  2R4G A;  2M7B A;  2EZL A;  5D4S A;  1WJB A;  2KT0 A;  3J80 K;  1Y6I A;  2ZSH B;  2BOL A;  4L9T A;  3CCR I;  4LB5 A;  1RKT A;  1MBE A;  4RLQ A;  4RAG A;  3COA C;  4GRI A;  2MSY A;  2LG4 A;  1NG6 A;  3KP5 A;  2RC4 A;  1U0J A;  1ZK8 A;  2ZSI B;  1YRN B;  2JVG A;  4LK0 F;  1HA8 A;  2M87 A;  2NAZ A;  3H3U A;  3SFZ A;  2VPR A;  4I6Z A;  4XKB A;  3ZMT A;  3OYI A;  2W1O A;  2FE3 A;  3ELK A;  5IP9 J;  4KDP A;  2E5N A;  3HOU J;  1AU7 A;  2MFZ A;  4FET A;  2KP6 A;  1Z77 A;  3N4M A;  2E36 A;  1WKM A;  2XAQ A;  4BJ6 C;  1W1W E;  1DQU A;  5ILU A;  5IP6 A;  3PNT A;  1P4X A;  3RSN A;  4HF2 A;  4CHU A;  1J7K A;  2DMQ A;  4JBA A;  1LB2 A;  2DMN A;  3MCZ A;  4JX5 A;  3LA3 A;  1TWG J;  3GW2 A;  3CJR B;  1D5Y A;  3ZRG A;  3GTQ J;  4A69 C;  3S3O A;  2HPM A;  1PDN C;  1VTN C;  2OZ6 A;  3K4B A;  2NNN A;  1HC8 A;  2IT0 A;  3M7G A;  1R9T J;  5FRN A;  2QSF X;  2VXD A;  3KET A;  4Q4Z F;  2DK8 A;  1SC7 A;  4IF4 A;  2ZXW H;  2IVM A;  2OA4 A;  2UXX A;  3CZ6 A;  1G3S A;  5FLX Z;  3P9C A;  2QYO A;  4U88 A;  4A3G J;  1OJL A;  1Y8Q B;  1K83 J;  2DMT A;  5FD5 A;  4P55 A;  3M1E A;  2H8W A;  4U87 A;  1WJE A;  5E8I A;  4JOM A;  3HDD A;  2F5C A;  1MSF C;  1FOX A;  4M73 A;  1OYI A;  2OZU A;  4EJV A;  4KMF A;  4XN0 A;  1PVE A;  2GZW A;  4OIN F;  3KEQ A;  2QVO A;  4MHG A;  2GLO A;  3F8N A;  2X9D A;  4G6T B;  2ZXH A;  4EV0 A;  2EA2 A;  2K02 A;  1IF1 A;  3I9V 2;  2IS1 A;  3K10 A;  3RKY A;  1TWF J;  2VKE A;  2FSW A;  4Y3O A;  3SEZ A;  5HDK A;  1DUX C;  3VEP A;  2DA1 A;  5LBQ A;  2LKS A;  3JRD A;  3GO5 A;  2FOW A;  5A2Q Z;  4A0Y A;  2VC1 A;  4DIQ A;  3F21 A;  1V5F A;  3DWL E;  1K7A A;  1D8J A;  2IGN A;  3E7L A;  2JT1 A;  4GGG A;  3DBH B;  5DDG A;  3GFM A;  2E60 A;  5LGN A;  2LYC A;  3RPQ A;  4L18 B;  1DP3 A;  4RB3 C;  3NWS A;  2L3D A;  3D5S C;  2PQ8 A;  3W2W A;  3PIP F;  2R3S A;  1AWC A;  5LEK A;  1XMA A;  3RI4 A;  2M8G X;  5J4Y A;  1X2M A;  2G7H A;  3DLA A;  1EJ9 A;  2OAZ A;  2XRO A;  3HGG A;  1QGP A;  3BR1 A;  3BCB A;  3HG9 A;  5JLX A;  5DCF A;  1H89 C;  5IPA A;  5LRS A;  2YPR A;  2PEX A;  1NH3 A;  3I4M J;  3IC7 A;  2MAB A;  3GLX A;  3V4G A;  2IGO A;  1QO0 D;  3EUK L;  2K9L A;  2LKP A;  4F92 B;  1W0U A;  3OYD A;  3O3K A;  3EYY A;  3ABL H;  5L3D A;  3GTL J;  3OIO A;  2EIN H;  3VOD A;  2LRE A;  4DZP A;  5CVI A;  5DTD A;  1KZH A;  1G4D A;  3GUD A;  2RN7 A;  3MAJ A;  3Q5F A;  2TCT A;  2W7N A;  2ME0 A;  4I0B A;  1VQ6 I;  4N4O B;  3L2C A;  4P9F A;  2D2W A;  5D6E A;  4BJT A;  1HF0 A;  1BM9 A;  2PJR A;  3Q3S A;  1W36 D;  2Z3Y A;  2V1N A;  5ICE A;  3LSJ A;  5J8C A;  1UAA A;  4BHP A;  3J81 Z;  2F5V A;  2K7L A;  4YRV A;  2F4M B;  5DYM A;  3OSF A;  1Z67 A;  1P2F A;  1MBF A;  3E5X A;  3WTT C;  2FU4 A;  3TL4 X;  1CF7 B;  2ISY A;  3H36 A;  3U21 A;  5GP9 A;  4CZZ A;  2YU3 A;  1P9Q C;  2HR3 A;  2KRH A;  1LDJ A;  2FX0 A;  2LMD A;  3Q9S A;  3I54 A;  5HS9 A;  3JSP A;  1T2K A;  3N97 A;  2EFN A;  2XIG A;  1KU3 A;  2EFQ A;  4GCV A;  1YJ9 I;  3SZP A;  4YEL A;  1ORK A;  4J01 A;  3F0C A;  4ENK A;  4AWX B;  4B43 A;  2DPD A;  3JSO A;  4OIQ F;  4UB6 C;  2NVU B;  2K85 A;  1T08 B;  3ZR8 X;  1LVK A;  4LLL A;  5IT3 A;  3D5R C;  5F1R A;  1W0T A;  4HF0 A;  3HXL A;  3I53 A;  5LGU A;  3I58 A;  2I8D A;  4QTR A;  5FFZ A;  4W97 A;  2DOD A;  5CVU A;  3R0A A;  3PIO F;  4RAY A;  2DI3 A;  1O3T A;  1D0X A;  5DD8 A;  3RQI A;  1MW7 A;  2HGC A;  4BYY A;  1R00 A;  1ZRC A;  1W4M A;  1JHF A;  1XN7 A;  4OU0 A;  5J1R A;  2PMH A;  4ZYH A;  2NS8 A;  4DYR A;  1XX5 A;  5EEH A;  5D4R A;  2FEZ A;  1FYK A;  4NNJ A;  1YW9 A;  3SJM A;  2X1E A;  1Z91 A;  2DFH A;  1ERD A;  3TQN A;  1HXD A;  2PMZ A;  3S2W A;  1BIA A;  1BOA A;  3K70 D;  3HEF A;  1Y1W J;  1YJW I;  2JSC A;  3JW4 A;  5LGT A;  3OYJ A;  3QPT A;  1MNE A;  3PQK A;  1XGO A;  4XNF A;  3REO A;  4NHJ A;  2VBW A;  4UVB A;  1S29 A;  3HBL A;  1IC8 A;  1R4N B;  2ZO4 A;  1V4R A;  1SVO A;  1K78 A;  2XB5 A;  5DM7 F;  3L1P A;  2DA7 A;  2W24 A;  3ROU A;  3OYA A;  4CCJ A;  1XGS A;  3H5A A;  3ERE D;  5BMZ A;  2J5P A;  2QKL B;  1P4W A;  2CWE A;  4M3G A;  1USS A;  3CMA I;  2A5Y B;  2E1N A;  3PQJ A;  1DGR M;  2K9Q A;  2COM A;  2XAJ A;  2HTJ A;  4HST A;  4N4N B;  1KON A;  4U7D A;  1Z9C A;  2YUS A;  3CC2 I;  4NDL A;  3JRH A;  3M8J A;  5ICC A;  2WB1 A;  3PO3 J;  1RRJ A;  2O9L A;  4KIB A;  2L9R A;  5F0H A;  3MMY B;  1X1A A;  3E6M A;  4DW6 A;  2MH9 A;  2D1H A;  1XCB A;  4CCL A;  1IRF A;  3WTS C;  3CDL A;  4IRI A;  3L2Q A;  5BS6 A;  3H3Z A;  4XIC A;  4I0A A;  4ZTJ A;  5HVQ C;  3J7A O;  1ZEL A;  1M1E B;  4XR6 A;  3AL0 C;  1RUN A;  4G7H F;  2A61 A;  4M72 A;  5C4J J;  1FSE A;  3GTP J;  2CO5 A;  1WSU A;  1STZ A;  4I7H A;  4F55 A;  3E5U A;  1K4T A;  5E1Z B;  3K0L A;  4XID A;  1MZB A;  4FX0 A;  1NK3 P;  3TW7 A;  2N8G A;  3BTC A;  3UKG A;  1K79 A;  4IHT A;  3QP5 A;  5IP7 J;  3OYF A;  4I01 A;  5LD2 C;  1F43 A;  2LTP A;  1R7J A;  2IBD A;  3TMO A;  2BW3 B;  2LKX A;  2HYJ A;  2X4H A;  1I1G A;  1LFU P;  3H5R A;  5BPD A;  2ELK A;  5J1Y A;  1WFX A;  2ESH A;  1OR7 A;  3F72 A;  4IPA A;  3AAF A;  4PDK A;  3ECH A;  1E3P A;  2NNY A;  4BBS J;  3E97 A;  1I39 A;  2FJ1 A;  1O3Q A;  1IRZ A;  3FHZ A;  2IJL A;  4R1H A;  2XRL A;  3TOA A;  3G73 A;  2JPC A;  2L5Q A;  4A5M A;  3A2K A;  4DNC A;  4IHY A;  1WCM J;  5B1B H;  1UEL B;  2F5E A;  1QU3 A;  3N05 A;  2HVQ A;  1UJ8 A;  2KJC A;  2B63 J;  3BR0 A;  2V6E A;  2KZG A;  2VB6 A;  2F2E A;  3GTG J;  2IEK A;  1VQM I;  1ETX A;  3KE2 A;  2JN6 A;  4DOZ A;  1E3O C;  5E1W A;  2FXA A;  3MZY A;  1LNW A;  3ZQ7 A;  3L2R A;  3LSI A;  2JUG A;  1YTY A;  2DBB A;  2LBF B;  4PFP A;  5EG0 B;  3TO6 A;  1YE9 A;  1HBX G;  3FM5 A;  1P92 A;  4OMZ A;  3CO7 C;  5GAD J;  5CQG A;  2HVR A;  2FF4 A;  3TED A;  4DQ2 A;  5CVR A;  2VN2 A;  4RBO A;  2V26 A;  2ACJ A;  2X6X A;  2HYF A;  1QRY A;  5JFR A;  2CYY A;  3QYB A;  3T5X A;  1DU0 A;  1TLH B;  4BL0 B;  4F93 B;  2QSH X;  1A5J A;  1R1U A;  1JTX A;  4C3I J;  2R7Q A;  3L9F A;  3S2H J;  3FZV A;  1ZQ3 P;  2IS6 A;  2GOX B;  3S3N A;  1R58 A;  1MBJ A;  4IRG A;  2B0L A;  3BTJ A;  2KDZ A;  1C0W A;  4NC8 A;  1WJ5 A;  2H6B A;  1U78 A;  3C2G A;  2BV6 A;  1K6O A;  2MGQ A;  4I09 A;  4LG0 B;  5IT9 K;  2KIQ A;  5FKO A;  1VQK I;  3E6D A;  3GF2 A;  4A12 A;  5FRM A;  3W6V A;  3ZQG A;  5BNG A;  2M1B A;  2R7X A;  3HTS B;  2GXG A;  2E1M B;  2L9V A;  1U2W A;  2L9S A;  4LB6 B;  2IPQ X;  4HV6 A;  3DU5 A;  1V5E A;  4FTH A;  2LK2 A;  4EM2 A;  2QWW A;  3CTA A;  3C1D A;  4CZC A;  3WTY C;  4HQE A;  4LMY A;  3J7Y J;  5M5X J;  1YJN I;  3OS1 A;  1D8K A;  4M6V A;  3ZCO A;  1EV7 A;  2OV7 A;  2KPM A;  3BPX A;  3A02 A;  3ABK H;  3GFJ A;  4M3D A;  5AON A;  4C2M J;  1ZN2 A;  2RVC A;  2MG4 A;  3KLN A;  4LJZ F;  4Z6Y A;  3E5Q A;  1U5T A;  1D1C A;  1OMI A;  1VQ9 I;  2JRM A;  1BI2 A;  3SFI A;  4YFK F;  1FWZ A;  1VQL I;  4HX8 A;  3BZK A;  4BAC A;  3KPH A;  1PUE E;  1Z6T A;  1FSH A;  4HQM A;  1BN5 A;  1VQ8 I;  3GVA A;  5LEJ A;  3RQ4 A;  3HRS A;  2YX4 A;  3ZMZ A;  4HW0 A;  4YG2 F;  1RES A;  3FXJ A;  5FKN A;  4D5F A;  2E34 A;  2EFO A;  3QU3 A;  1TTY A;  3K4N A;  4KN7 X;  1EKE A;  2JMW A;  4PGH A;  3KP7 A;  3PJR A;  4XKC A;  1U3E M;  2VT3 A;  4RLF A;  4BQO A;  1YFH A;  3VOE A;  3R0J A;  2A5W A;  3OYB A;  1GXP A;  2ZCW A;  4A3F J;  3QOD A;  3I59 A;  5CVV A;  3ISP A;  1RC9 A;  2WAF A;  1R5G A;  1P7J A;  3HOT A;  2DT7 B;  2O8K A;  1AKH B;  3HOZ J;  1R36 A;  1Q1V A;  4RGU A;  3I0T A;  5ILS A;  3I71 A;  4IHW A;  2H09 A;  2TDX A;  4E7L A;  4ESJ A;  4D5C A;  5EF6 A;  5CJ9 A;  2IGK A;  2YR2 A;  1CGP A;  3FXU A;  5JVT A;  3EQL F;  2K40 A;  2OU2 A;  1MND A;  3F8B A;  2KJB A;  1TNS A;  5BOX A;  1R23 A;  1WQ2 A;  5L3E A;  1PJR A;  5TRD A;  4NQW B;  1W7P D;  4AVP A;  3G71 I;  5JVG F;  4HZF A;  3BR2 A;  1K61 A;  1FC3 A;  3CF2 A;  1SFK A;  3BDD A;  4A3B J;  2HS5 A;  1Y1V J;  2DK5 A;  4IXA A;  1FMW A;  1Y56 A;  3HSF A;  4Z2Y A;  3VSL A;  5K5Q A;  4HDU A;  5LLQ A;  4JX4 A;  1TT0 A;  2D45 A;  3HB9 A;  3CJT B;  3L2V A;  1PUF B;  1D0Z A;  3K2Z A;  1FJL A;  3OSG A;  1XPX A;  3AG2 H;  3IV5 A;  3LSH A;  5E17 F;  2ELJ A;  4UUT A;  2Q0O A;  5ICF A;  2DFE A;  3OYG A;  2BEO A;  1N78 A;  3LL7 A;  4IOC F;  1S7O A;  5FJ8 J;  4PGG A;  2B9S A;  5BPI A;  1E3H A;  3S2D J;  2LF8 A;  3JRA A;  5HOO A;  1H9T A;  2V9V A;  3RPU A;  1I3Q J;  3H5N A;  2QQ8 A;  3OV8 A;  2EIL H;  2V1U A;  1MSE C;  2KDO A;  3DTI A;  5D5X B;  3HRM A;  3VYS B;  2HOA A;  4ESF A;  1DP7 P;  4IRH A;  1G6N A;  2E7W A;  4RGX A;  5D8L B;  2DN0 A;  2DTZ A;  1LDD A;  1VND A;  2M9H A;  4M9Z A;  4P96 A;  2MD5 A;  2C6Y A;  2ZME B;  3BQZ A;  5LHI A;  2MC4 A;  1F36 A;  2HNH A;  3CQZ J;  1OKR A;  4PFO A;  3RYR A;  3ZOB A;  1R71 A;  4QPQ A;  3VB2 A;  3FMS A;  2L9N A;  3IHU A;  5C44 J;  4MTD A;  3H9J A;  2F6C A;  4Q47 A;  1V54 H;  2FD5 A;  3IH4 A;  3ONQ A;  2ZJR F;  4PJN A;  3WGI A;  1P7I A;  4XM3 A;  4HSR A;  1T39 A;  1TWH J;  4X1E A;  2MA3 A;  3I5U A;  3IH2 A;  3HHH A;  3ESW B;  3GEZ A;  3S16 J;  2PLY A;  2DFF A;  1V55 H;  1EF4 A;  2ZFU A;  4IZZ A;  3QQA A;  2EQR A;  3A03 A;  3S1R J;  2XKO A;  4ABZ A;  4F52 A;  3EDP A;  3HPG A;  4L0Z B;  1GLN A;  2NVY J;  3A01 B;  2KIF A;  5KHD A;  3ZP5 A;  3K4C A;  2VT2 A;  4KMU X;  2DDA A;  2ME6 A;  4AID A;  4BEH A;  2VJ4 A;  9ANT A;  5TJJ A;  3C3W A;  3F8C A;  2MD0 A;  5DEQ A;  3HUG A;  4LG3 A;  4NC7 A;  2MYS A;  2DU9 A;  4C9Y A;  2DT6 A;  1JUM A;  1SVL A;  2ID3 A;  5EYR A;  4AIH A;  1OQY A;  4CCO A;  3HL2 A;  2VUM J;  2M8E A;  1MKM A;  4LLG F;  5DUK A;  3MKZ A;  1Y0U A;  2DO7 A;  3PUB A;  3HOV J;  1IV6 A;  5K7F A;  2CUF A;  4AU7 A;  3CCE I;  2DXI A;  3JRF A;  4MO7 A;  1ZRF A;  2O5R A;  1JKP C;  4NUB A;  1JI8 A;  1MBH A;  1I3A A;  1TQP A;  2EV0 A;  1EA3 A;  3RJP A;  4J19 A;  5F1J A;  1D1A A;  2Q1Z B;  2R7R A;  2M30 A;  3OR2 C;  3TW6 A;  1HDD C;  4ENJ A;  1S3J A;  2CQK A;  3Q0W A;  4LIU A;  3CUQ B;  2XC7 A;  4CGZ A;  3LOC A;  2R7F A;  1R1V A;  3LWF A;  1DGW Y;  3JAM Z;  3G6E I;  3E6C C;  3DEE A;  1TNT A;  2EIM H;  1WZ2 A;  3JTH A;  2DYS H;  2R93 J;  1FMV A;  3KYC B;  2MW8 A;  2HQN A;  2DDB A;  2L2O A;  2O6G E;  4BNC A;  4I98 B;  5K7Z A;  2HDW A;  3T1B A;  3DBR B;  3OMY A;  5KVR A;  3HRT A;  1WVR A;  2R7Z J;  2DAO A;  2CQX A;  4MFD A;  2ICW G;  4FT8 A;  2M3A A;  4L5E A;  4RM2 A;  3W2V A;  4QIW N;  5CYV A;  5J8F A;  4CCM A;  1U8B A;  4B3A A;  1MDM A;  1B59 A;  5F0F A;  1GDT A;  3E1S A;  1IO2 A;  2ISZ A;  2O3F A;  2QQA A;  2VKD A;  1T95 A;  1YQA A;  3CP8 A;  1T6S A;  4WF2 A;  4ENN A;  4RS8 A;  2XRN A;  4IQJ A;  2K4J A;  5EGO A;  1QBJ A;  3DBL B;  2QEX I;  5IOZ A;  1HW5 A;  3FXQ A;  3G1L A;  2DQR A;  4A3K J;  1FBQ A;  2UWM A;  2DA4 A;  3CCS I;  1ZR4 A;  3LSG A;  4HLY A;  2WTE A;  1GUU A;  1WH5 A;  4WK8 F;  2STW A;  1YLF A;  5TGT A;  5GAH J;  2EIK H;  4BE0 A;  3IWF A;  3ML6 A;  1XMX A;  4QPO A;  1OCO H;  3VYT B;  5DM6 F;  2VOO A;  4B1R A;  1YG2 A;  1Z21 A;  2JUC A;  3MKW B;  4XKV A;  3X2Q H;  3GFL A;  3G3Z A;  2CV1 A;  3LMM A;  2Z5U A;  2QGU A;  4CDG A;  3FXR A;  3FDY A;  4RGR A;  2R5Z A;  5HLT A;  3ZQH A;  1SD5 A;  2WAE A;  1SD7 A;  3ZMS A;  2IXS A;  4G94 A;  4EGY A;  1X58 A;  2AHQ A;  2OCC H;  3DTE A;  4OMY A;  4M3F A;  2VQG A;  3H9Q A;  1J0R A;  2HDD A;  2FBI A;  2IA0 A;  1E17 A;  1J75 A;  4BUP A;  1PP7 U;  2EV5 A;  3RZO J;  3C7J A;  5H2F C;  1IUF A;  5CVJ A;  3O8G A;  4XLN F;  1RNL A;  2Z1D A;  4ON0 A;  1XB4 A;  3TP0 A;  4C2T A;  4YIR X;  5HLI A;  4A3L J;  2EZK A;  5H6Q A;  2Y30 A;  4S0H B;  4YII A;  1ZGA A;  3ZMD A;  3CME I;  2UXN A;  1TWC J;  3KZI C;  3HOS A;  1TZL A;  4AD9 A;  4UUS A;  4N0B A;  3FKJ A;  3M4O J;  1OCP A;  4M3B A;  1QZY A;  2KIM A;  4H4K C;  2AXL A;  1S6L A;  2K3P A;  1FY7 A;  2KZV A;  1Y39 A;  2GQQ A;  2BYV E;  3KCC A;  2LY2 A;  2X1C A;  1SMY F;  3CCQ I;  3ULQ B;  1ZLK A;  2OJE D;  3ZQF A;  4XQF A;  2R7V A;  1FTT A;  4M6X A;  2HQA A;  4L9N A;  3C2B A;  2HVS A;  1VFC A;  1G8X A;  3MQ0 A;  1IN7 A;  3K7A J;  1MBK A;  3H92 A;  1JJ8 C;  3DKX A;  4F3Q A;  4XLC A;  3LST A;  3VPR A;  1B8I A;  2P5V A;  2OCE A;  1JE8 A;  3HOX J;  1MD0 A;  1IDY A;  2CSO A; 
#chains in the Genus database with same CATH homology
 2ID6 A;  4A3J J;  3JR9 A;  1LFU P;  1U9O A;  3H0G J;  2ELK A;  5J1Y A;  5EEA A;  3BTI A;  2GM4 A;  3CCY A;  1GV2 A;  1ZR2 A;  4BBS J;  2FJ1 A;  2YS9 A;  2CU7 A;  1IRZ A;  3PO2 J;  2M2E A;  2ECB A;  2XRL A;  4V2G A;  3JRC A;  4XRM A;  2CJJ A;  5M3F J;  1ITY A;  1ZKG A;  1VF9 A;  4IHY A;  1WCM J;  2P81 A;  2DJN A;  2R5Y A;  2EBI A;  2DMU A;  2DA5 A;  2VKV A;  1RR7 A;  3WHC A;  2B63 J;  3BR0 A;  2ECC A;  3PM1 A;  3NAU A;  3GTG J;  1O4X A;  4AUX A;  2IEK A;  4V2F A;  1ETX A;  2JN6 A;  2LFB A;  1E3O C;  1ETW A;  1JKR C;  2Y0S N;  1Z0X A;  2L7F P;  2NVQ J;  3LSR A;  1WPK A;  5EG0 B;  3GTM J;  3HM5 A;  5F0C A;  3S1N J;  2LVS A;  5JLW A;  1A6I A;  3GTO J;  1MNM C;  3TED A;  3A01 A;  3LNQ A;  4RBO A;  3B6A A;  1QRY A;  1ETO A;  4RDU A;  4FIS A;  1DU0 A;  2O7O A;  1IDZ A;  2E2I J;  1A5J A;  1JTX A;  1FIA A;  4C3I J;  3S2H J;  3BR5 A;  1BJZ A;  3RZD J;  3FK7 A;  1ZQ3 P;  3FIW A;  1MBJ A;  1ETV A;  3HKZ N;  3BTJ A;  3BG5 A;  3DCF A;  5J1U A;  2KDZ A;  3FKI J;  5E3N A;  1U78 A;  1XS9 A;  5FKL A;  2H8R A;  2MGQ A;  1LE8 B;  3ZQL A;  3IH3 A;  5FKO A;  3BG9 A;  2EZH A;  3HGY A;  2XPW A;  2CRG A;  3W6V A;  3ZQG A;  5BNG A;  4G12 A;  1RPW A;  1HLV A;  2NS7 A;  2FQ4 A;  4A3M J;  1HOM A;  2Y9Z A;  4FTH A;  2LK2 A;  1GV5 A;  1B72 A;  4A3D J;  1WGX A;  3S17 J;  3BT9 A;  1ETK A;  5M5X J;  3B6C A;  4M6V A;  2LY9 A;  2IAI A;  3A02 A;  4M3D A;  1BA5 A;  4C2M J;  2R92 J;  1CQT A;  1XG1 A;  2MG4 A;  2EZL A;  3S1M J;  3JRE A;  2KT0 A;  3SFI A;  3ZQI A;  1X2N A;  5EZH A;  3M3Y J;  1UG2 A;  4A3I J;  4D7M A;  5EGO B;  1RKT A;  2JK3 A;  1MBE A;  2MSY A;  4AYB N;  1POG A;  2TRT A;  3TP3 A;  1RES A;  4D5F A;  1HDP A;  5FKN A;  4Y52 J;  4JYK A;  2PMZ N;  2ZB9 A;  1ZK8 A;  1YRN B;  2JMW A;  2EZI A;  2HXI A;  4CYC A;  5EZG A;  2VPR A;  4I6Z A;  3G1M A;  4MFE A;  5IP9 J;  4A3F J;  3HOU J;  4C3H J;  1AU7 A;  1Z77 A;  4IHX A;  5F27 A;  1P7J A;  2R5Z B;  2O8K A;  1AKH B;  3HOZ J;  2E19 A;  5IP6 A;  1LFB A;  1Q1V A;  4IEJ A;  2E2J J;  1JKO C;  2DMQ A;  4IHW A;  2DMN A;  2X6O A;  4JX5 A;  5F08 A;  4XRS A;  3CMY A;  2E1O A;  1TWG J;  4D5C A;  2AO9 A;  5EF6 A;  1D5Y A;  3S1Q J;  3GTQ J;  4A69 C;  4D7N A;  4JX6 A;  2JA7 J;  2OF7 A;  4HNV A;  2K40 A;  2XSD C;  2WB1 N;  5IYC J;  2WV1 A;  2X48 A;  3Q0V A;  1OFC X;  1I6H J;  4UUS B;  1R9T J;  1TC3 C;  1RET A;  2Y2Z A;  3BR2 A;  1K61 A;  5FLV A;  1GVD A;  4Y7N J;  3OOU A;  4A3B J;  1Y1V J;  2JA8 J;  3JRG A;  3MVP A;  1T56 A;  2LD5 A;  4JX4 A;  4A3G J;  3HB9 A;  2HI3 A;  1OJL A;  1PUF B;  1K83 J;  1FJL A;  1ENH A;  2DMT A;  3OSG A;  3IV5 A;  3HDD A;  4UUT A;  1IG7 A;  1MSF C;  3HOW J;  5GPA A;  4A3C J;  1B8I B;  2I10 A;  5FJ8 J;  1FTZ A;  1SAN A;  1JT0 A;  2GLO A;  2X9D A;  3S2D J;  4EEF G;  4A93 J;  3JRA A;  2NVX J;  5J3L A;  1I3Q J;  1TWF J;  2VKE A;  2DA1 A;  1MSE C;  1JUP A;  3JRD A;  2HOA A;  1WI3 A;  5E3M A;  2LR8 A;  2DN0 A;  2DTZ A;  1VND A;  2M9H A;  3BQY A;  5IOY A;  3BQZ A;  3E7L A;  1F36 A;  3CQZ J;  1FIP A;  1QPI A;  3ZOB A;  3RKQ A;  1I50 J;  2R5Y B;  2W48 A;  3HOY J;  1DU6 A;  1APL C;  4FE7 A;  3S15 J;  5C44 J;  1QVT A;  4DYC A;  4BY7 J;  2FD5 A;  3IH4 A;  3DEW A;  1P7I A;  2OPT A;  2M8G X;  1TWH J;  1JKQ C;  3NAR A;  4X1E A;  1ZGW A;  1X2M A;  2G0E A;  3IH2 A;  1JTY A;  5IYB J;  2YU9 J;  3HGG A;  3S16 J;  1EF4 A;  3BR1 A;  4DYQ A;  5JLX A;  1H89 C;  5IPA A;  3QQA A;  2EQR A;  1JJ6 C;  2XGD A;  2HXO A;  3A03 A;  2M0C A;  3S1R J;  4BBR J;  3I4M J;  3LSP A;  3SDG A;  4ABZ A;  2XGC A;  2GBY A;  1W0U A;  1MH4 A;  4XRS G;  2NVY J;  3A01 B;  2DA3 A;  1HCR A;  2LLK A;  3GTL J;  3OIO A;  2NOG A;  2ME6 A;  9ANT A;  4MLO A;  1ZTR A;  4DZP A;  5DTD A;  1GT0 C;  1SFO J;  2QCO A;  1MH3 A;  2L7Z A;  4X6A J;  2TCT A;  5EG0 A;  3JRI A;  3GTK J;  4A3E J;  1JUM A;  2ME0 A;  2ID3 A;  1ETY A;  3G1O A;  5EYR A;  3FIS A;  2VUM J;  2Y31 A;  1HF0 A;  3Q3S A;  1VI0 A;  2VI6 A;  3LSJ A;  3HOV J;  2D5V A;  3MKL A;  1AHD P;  1IV6 A;  3D1N I;  5K7F A;  2CUF A;  3JRF A;  4MO7 A;  1JKP C;  4I76 A;  5IYD J;  3OSF A;  1MBH A;  2LP0 A;  1MBF A;  2K9S A;  1S7E A;  3BR3 A;  4J19 A;  5F1J A;  2HQ5 A;  2XPU A;  1ETQ A;  3H3V K;  5M5Y J;  5GP9 A;  1UMQ A;  5F04 A;  2DA6 A;  2FX0 A;  5E3L A;  3TW6 A;  1B72 B;  1HDD C;  2CQQ A;  3Q0W A;  1JUS A;  5FLM J;  3LOC A;  3Q0U A;  1LE8 A;  1XC5 A;  3O8H A;  1JGG A;  4DZJ A;  1TWA J;  1ORK A;  2L0K A;  2HOS A;  2R93 J;  1RKW A;  3F0C A;  4GFB A;  2MW8 A;  3MN2 A;  2E2H J;  2CUE A;  2XPV A;  1BW5 A;  1IGN A;  3WHB A;  5K7Z A;  4AC0 A;  3QPL A;  5M5W J;  3S14 J;  1W0T A;  2L7M P;  2H1K A;  2R7Z J;  5GPC A;  4QTR A;  2CQX A;  4MFD A;  4W97 A;  3QPS A;  4L5E A;  4QIW N;  1U8B A;  1T33 A;  1G2H A;  4B3A A;  5F0F A;  1GDT A;  3RQI A;  4CYC B;  1FEX A;  1QVU A;  1BL0 A;  1H8A C;  5J1R A;  1NTC A;  2R0Q C;  1BW6 A;  2DMP A;  2NS8 A;  4DYR A;  5EGO A;  1JT6 A;  2K9N A;  5IOZ A;  4LOC A;  2EH3 A;  4XK4 A;  3SJM A;  3G1L A;  3GTJ J;  5E3O A;  4A3K J;  2XB0 X;  2DA4 A;  1ZR4 A;  3LSG A;  2JA6 J;  3HEF A;  1GUU A;  1Y1W J;  1WH5 A;  3BG3 A;  1YRN A;  1IJW C;  2NVT J;  5K7H A;  4B1R A;  3HBL A;  4B4C A;  1IC8 A;  2XB5 A;  2QF7 A;  3L1P A;  3I4N J;  2DA7 A;  1UHS A;  1WH7 A;  2R5Z A;  2JJ7 A;  3ZQH A;  1AKH A;  4M3G A;  5HOD A;  3BR6 A;  4BKX A;  3JRB A;  1X58 A;  2AHQ A;  4JP0 A;  2K9Q A;  4M3F A;  2M34 A;  2WAQ N;  2HDD A;  2YUS A;  5M3M J;  4NDL A;  3JRH A;  3RZO J;  1IUF A;  3O8G A;  3PO3 J;  3FK6 A;  3TP0 A;  2O9L A;  2JWT A;  3K2A A;  5FKK A;  2Y9Y A;  4A3L J;  5DS9 A;  2EZK A;  2L9R A;  5F0H A;  2XGE A;  2Y30 A;  4S0H B;  4BY1 J;  3ZQC A;  3GBG A;  4M3E A;  1TWC J;  4DW6 A;  4UUS A;  1NK2 P;  2HOT A;  1OCT C;  4MIM A;  3M4O J;  1OCP A;  3CDL A;  4M3B A;  4FE4 A;  5FKM A;  4XIC A;  1U9N A;  5C4X J;  1MBG A;  5C3E J;  5C4J J;  2DA2 A;  2JA5 J;  3ZQF A;  3GTP J;  1FTT A;  1PUF A;  2COB A;  5EDN A;  3BTL A;  3C2B A;  1VFC A;  4XID A;  3K7A J;  1MBK A;  1H88 C;  1JJ8 C;  4IHV A;  4QSH A;  3TW7 A;  1NK3 P;  4FCY A;  2N8G A;  3BTC A;  3UKG A;  4BXX J;  4W1U A;  5IP7 J;  2RAE A;  3VPR A;  4C3J J;  1B8I A;  1F43 A;  3HOX J;  2LTP A;  2IBD A;  1IDY A;  2LKX A;  2HYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...