1B72A

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
68
Chain Sequence
ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein/dna
molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 68
sequence length 88
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72A00
5J1UA 2JA5J 3BTLA 3CCYA 3DEWA 4CYCA 2VKVA 3S17J 5EZHA 4DZPA 3CMYA 5IYCJ 2ME6A 4UUTA 1I50J 2D5VA 2DA4A 2K9SA 3HM5A 2XGEA 2VKEA 4XRSA 3B6CA 2ID3A 4DYCA 2Y30A 2FD5A 1Z77A 1FTZA 1B72B 1JT0A 1A5JA 2L9RA 1FEXA 5F0FA 1TC3C 5J1YA 3O8GA 1BJZA 2FJ1A 2XGCA 3HOUJ 3H0GJ 2HQ5A 1JT6A 4RBOA 4BKXA 4IHXA 2OPTA 4QSHA 3LOCA 1GUUA 1R9TJ 2LK2A 3IH4A 4AC0A 4JX4A 2HXIA 5K7ZA 1JKRC 1IV6A 2XB0X 3S2HJ 1JKQC 1WGXA 2OF7A 1JKPC 3BTIA 2JA6J 3G1MA 1S7EA 1JTYA 3HB9A 2GBYA 4FTHA 4JP0A 1U9NA 2K9QA 2R5ZB 4CYCB 3S16J 2L7FP 1B8IB 3MKLA 2DA5A 1W0UA 1DU6A 4D7NA 2GM4A 3ZQFA 2GLOA 3SFIA 2JA8J 2DA3A 4D7MA 3NARA 4Y7NJ 1CQTA 2LP0A 3BR0A 2M9HA 3TP0A 1ZK8A 3BR3A 2MSYA 1P7JA 4X6AJ 1WH5A 1XC5A 2NOGA 3BG3A 3QQAA 1XG1A 3K7AJ 1AHDP 5EYRA 3GBGA 3HOXJ 2NS7A 1GV5A 1OCPA 5C4XJ 4GFBA 3G1LA 4IEJA 3PO3J 2HOAA 2EQRA 3LNQA 4M3FA 2XRLA 4M3EA 3PO2J 4B4CA 1APLC 1MH4A 3CQZJ 1ETKA 2PMZN 5EEAA 1MSFC 2DA1A 4DYRA 3S1QJ 3JRBA 2WB1N 5F0CA 4A3JJ 5EDNA 3JRAA 1X58A 5EF6A 3BTCA 4MLOA 4IHWA 3VPRA 3TP3A 3RZOJ 3BR5A 3S15J 2HI3A 5C44J 3PM1A 2Y9ZA 1XS9A 3FIWA 4XIDA 3HBLA 1MBGA 1X2NA 2WV1A 1FTTA 3FK7A 1E3OC 1AKHA 1ZQ3P 5FKMA 3TEDA 2R5YA 1ZR2A 5C3EJ 1UMQA 3A01A 4EEFG 1ITYA 2ECBA 4JX6A 2DTZA 5M3MJ 9ANTA 1IDYA 4BBRJ 2DA2A 4V2FA 4FCYA 3BR1A 1SFOJ 1W0TA 3GTGJ 5IOZA 2R7ZJ 3NAUA 3FK6A 1K83J 3BR2A 4M6VA 4MO7A 4A3MJ 3HGYA 2M34A 2L7ZA 4MFEA 2CUFA 3ZQIA 1EF4A 1D5YA 4FISA 4IHVA 3TW7A 5F1JA 1HDPA 1LE8A 3MN2A 1GV2A 1JKOC 2LY9A 1SANA 2LKXA 2FQ4A 2O9LA 1RKTA 4A69C 2Y2ZA 4JX5A 2E19A 4C2MJ 1ETWA 2M2EA 2Y9YA 4UUSA 2HOSA 2X9DA 5E3LA 1RESA 3RZDJ 3M3YJ 1TWAJ 1Q1VA 1Z0XA 1ZKGA 2XGDA 1AKHB 1FIPA 3BQZA 1MNMC 2CUEA 2YS9A 1JJ8C 4QIWN 2R5YB 2XPWA 2DMPA 2ME0A 1OCTC 3HOZJ 3SJMA 4NDLA 2CU7A 2LLKA 2E2HJ 3CDLA 2NVXJ 1HOMA 5JLWA 2EBIA 4HNVA 2VPRA 2H1KA 2HDDA 1BA5A 1JJ6C 3JRIA 2LR8A 1ZR4A 4BY7J 3GTPJ 2JWTA 3G1OA 2EH3A 3HOWJ 1HF0A 1RPWA 3TW6A 5GPAA 2E2JJ 1UHSA 5C4JJ 3UKGA 3JRDA 1U9OA 3L1PA 1K61A 1A6IA 1GVDA 2RAEA 1MH3A 4UUSB 3HKZN 4L5EA 4BBSJ 5FKLA 2FX0A 3JRFA 2B63J 3LSPA 1MBHA 4IHYA 4M3DA 1U8BA 1FIAA 1HDDC 2W48A 2JA7J 3BT9A 1TWGJ 4DYQA 5F0HA 1VFCA 1H89C 3A02A 4MIMA 1G2HA 1U78A 2MGQA 3LSGA 2X6OA 2I10A 4A3KJ 2ID6A 1VI0A 3MVPA 1Y1WJ 1HLVA 2E1OA 2TRTA 1ZTRA 2X48A 1P7IA 2DA7A 2DA6A 3IH2A 3E7LA 3LSRA 5IOYA 5E3NA 3M4OJ 4Y52J 2QF7A 2MW8A 1OJLA 2CQQA 2M0CA 3OSFA 1TWHJ 3RQIA 3F0CA 4BXXJ 2HXOA 1JUPA 1ZGWA 3GTMJ 4XK4A 1IJWC 3OOUA 4M3GA 2HOTA 3QPSA 4XRSG 2R93J 2CRGA 3ZQHA 5FKNA 1ETVA 3JR9A 2XPVA 2NS8A 1NK3P 2L7MP 1ETOA 5DS9A 4D5FA 3H3VK 4C3HJ 2TCTA 4D5CA 3C2BA 1QPIA 3IH3A 5HODA 1B72A 2P81A 3BTJA 1NTCA 2AO9A 1RR7A 2VUMJ 3FISA 2MG4A 3BG9A 1RKWA 4V2GA 1AU7A 4A93J 4XICA 1BL0A 3BQYA 4M3BA 5J1RA 2LD5A 1I6HJ 1ENHA 4J19A 1MBEA 5M5XJ 2WAQN 1X2MA 5IYDJ 2O8KA 1H8AC 1UG2A 2G0EA 3JRGA 5K7HA 3JREA 5EGOA 2K40A 2CJJA 2EZKA 5IYBJ 2O7OA 2ZB9A 3S2DJ 4JYKA 2LFBA 2DMNA 4A3GJ 1IG7A 3Q0WA 2R5ZA 3DCFA 1B8IA 1F43A 3B6AA 2Y0SN 1QRYA 1BW6A 5K7FA 5FJ8J 4A3CJ 1ETQA 5IP7J 5F08A 3A01B 2COBA 3WHCA 3Q0VA 3W6VA 3Q0UA 3S1NJ 4DZJA 2NVQJ 3OSGA 4AYBN 1OFCX 5M5WJ 3HOVJ 1MBKA 2LTPA 1MSEC 1F36A 2DMQA 1WI3A 5BNGA 2KDZA 1IDZA 1WH7A 4LOCA 3OIOA 4MFDA 3GTOJ 4W97A 3K2AA 1VNDA 1IGNA 1LE8B 1VF9A 2AHQA 2M8GX 5F27A 3S1RJ 5FKKA 2QCOA 5EG0A 1T56A 1TWFJ 2IBDA 3WHBA 5JLXA 2N8GA 2JJ7A 3I4NJ 4ABZA 3BG5A 5EGOB 2EZHA 3RKQA 3QPLA 3A03A 2Y31A 1QVUA 3HEFA 1IRZA 1JUMA 4B1RA 3GTKJ 4A3DJ 2HYJA 1JTXA 4FE7A 3HGGA 4X1EA 4I76A 4I6ZA 1YRNA 5F04A 2VI6A 4A3LJ 5EZGA 1TWCJ 3ZQGA 5E3OA 3FKIJ 2IEKA 3S14J 1T33A 1WCMJ 1POGA 2IAIA 5DTDA 4G12A 2E2IJ 4A3FJ 1FJLA 1NK2P 4DW6A 1LFBA 1RETA 2KT0A 3S1MJ 2H8RA 4S0HB 3BR6A 1JGGA 2CQXA 1ORKA 2DJNA 3D1NI 1O4XA 5FLVA 3Q3SA 4A3EJ 1LFUP 2EZLA 2XSDC 4C3JJ 1JUSA 1H88C 2R92J 2ELKA 2K9NA 4XRMA 1PUFA 1GDTA 2JMWA 4B3AA 1DU0A 5EG0B 3GTLJ 1ETXA 3SDGA 3I4MJ 3ZOBA 2LVSA 1HCRA 4A3BJ 2ECCA 3O8HA 5FKOA 2JK3A 5GPCA 2R0QC 4QTRA 1WPKA 2JN6A 4AUXA 1YRNB 4RDUA 1MBJA 5IPAA 5E3MA 5GP9A 2NVYJ 2YUSA 3HDDA 5M3FJ 2DMUA 2XPUA 4A3IJ 3JRHA 1IUFA 3JRCA 2L0KA 1GT0C 3ZQLA 1I3QJ 2YU9J 1IC8A 4C3IJ 2DMTA 3GTJJ 3HOYJ 2EZIA 5FLMJ 3ZQCA 3GTQJ 1QVTA 1Y1VJ 2DN0A 5IP6A 2XB5A 2NVTJ 4BY1J 1ETYA 4W1UA 3LSJA 5IP9J 1BW5A 1MBFA 4FE4A 3IV5A 5M5YJ 1PUFB 5J3LA
chains in the Genus database with same CATH superfamily
4IX7A 5J1UA 2BVLA 3GLXA 2JA5J 1X4PA 1ZLJA 3JTGA 2YX4A 4HLYA 3WGHA 1LQ1A 1XCVA 1YX3A 3ZMVA 2KFDA 4XONA 1W7PB 1RI7A 4KFCA 4UUTA 2QQAA 3OYNA 2D5VA 1DUXC 3L09A 4QPQA 2P7CB 4CCJA 1J0RA 1SFEA 4PSXA 1Y0UA 3S32A 3SFZA 1WJ5A 2RVCA 1XPXA 4ENKA 2VQHA 4DBQA 4G6TB 1WJEA 2FEZA 2PN6A 2VBXA 4G6DA 2MABA 4LFUA 4A5MA 2M30A 4B44A 2HZTA 2HQ5A 3CCUI 2QWWA 4L9TA 4HA8A 3F8MA 2J5PA 5CVJA 4K2EA 2FUG2 3LOCA 1GUUA 1BIAA 3BZKA 3AKZA 1LPQA 3IH4A 2YPRA 3GLLA 2PX9A 4ZZDA 4ESBA 3TL4X 1IV6A 3D5RC 3I5UA 2OTLI 3G1MA 1JTYA 3AG3H 2BY3A 4JP0A 4FTHA 5CVRA 1U9NA 2K9QA 4QWQA 2Q8KA 2FNAA 5CVVA 2AS5F 4U0VA 1BI1A 3HHHA 4S05A 3I54A 1FLIA 4G6QA 1B8IB 2W85A 3LAJA 1W0UA 2DA5A 1DU6A 3Q5FA 2HTSA 2YX7A 3OYFA 3HTSB 5K1YA 3DTEA 2L54A 1K4SA 2LP0A 3CTAA 1R36A 3BR3A 2C6YA 2NOGA 4NNJA 4F52A 4HRIA 4HSTA 5L3CA 4HG2A 3R0JA 3HOXJ 2FE3A 2XAFA 1OKRA 2NS7A 1OCPA 3IKVA 4RB1A 5ICCA 4NB5A 1O3TA 4GFBA 3VYUB 3PO3J 2HOAA 1U3EM 2O8XA 2XRLA 4IF4A 2LH9A 5J40A 3RIRA 4B4CA 1S6LA 2FOWA 5EEAA 2DA1A 1MSFC 2R7UA 3IP4B 4DYRA 2OTJI 2CUJA 3ZRGA 1DPUA 1J5YA 3JRBA 1KZHA 1FC3A 5EDNA 1FWZA 4BAYA 2EILH 4LG0A 2QLZA 2VQGA 2EWNA 2OQGA 4MLOA 3RKXA 2X1EA 1T0FC 4ZYDA 4IHWA 3RZOJ 4AU7A 4H4KC 2HI3A 3KLNA 4DJAA 3EYYA 1ZG1A 3HBLA 1T39A 3ELKA 4FQGA 3QAHA 1FTTA 2WY8Q 4KT5C 4M74A 1ZQ3P 1AKHA 1TNTA 5H20A 2ZXJA 1Z91A 2CUZA 5J47A 3EUHA 1ZR2A 3KYDB 4EEFG 2WC2A 4JX6A 5M3MJ 5LHHA 1IDYA 3SEZA 1YIOA 2DA2A 1UZCA 3BROA 1PJRA 5KVRA 3GTGJ 3KP2A 5KCMA 4I99C 1QGPA 1LFPA 1OYIA 3IAS2 5FLXZ 2WAFA 3QWLA 4KIBA 4XORA 1VQ8I 4AIHA 4FETA 1TTYA 1M1EB 3LFUA 4HX7A 3TW7A 3MN2A 1GV2A 3WGGA 1GXPA 1JI8A 3K0LA 4R1HA 2E1NA 2LY9A 2LKXA 1USTA 2K5CA 1SVLA 2GWRA 2KMUA 4J00A 2O9LA 5CLSA 1TW2A 1B4AA 1V5EA 2E19A 2M3AA 2P7VB 4JX5A 4A69C 1ETWA 2Y9YA 1K78A 3DWLE 1YS6A 3MEXA 2X9DA 4EJOA 3S3NA 4IO9F 5HNHA 3JCUC 5E8GA 1VQ9I 2OAZA 5L3FA 2ZJQF 1AKHB 1QO0D 2Y0SA 2ETHA 4L9JA 1LVAA 5J8CA 1DGWY 2F5CA 3JTHA 4BQNA 3G73A 2DMPA 1OCTC 1FYKA 1A36A 5EJCA 3CLQA 1BC7C 1MMDA 3E5UA 2CU7A 1V54H 3V7CA 2E2HJ 1UFMA 4AYBA 3R4KA 3GF2A 1IN7A 2EBIA 3ABKH 3PSIA 4XN0A 4N0BA 5D6FA 2KIUA 4JK1X 2M4GA 1MGTA 1XGOA 3MD2A 3S3OA 1UJ8A 2K9LA 3ABTA 1WQ2A 4UB8C 3GTPJ 3I59A 4FX4A 4N9IA 4GGGA 1RPWA 3DP7A 2H6CA 4HLXA 2CMPA 3TW6A 2R3SA 2P6SA 1O7FA 4CO8A 2EFOA 2UXXA 2Z3YA 4P9FA 5E1XA 1K78B 1GVDA 4JOMA 2RAEA 3QP5A 4BBSJ 4L5EA 1E0EA 4ZTJA 1U2WA 2JA2A 5FKLA 2DFEA 1FP1D 2IA2A 2EFPA 4CA0A 1EA3A 2B63J 3T8RA 1MBHA 4L0ZB 4NQWB 3K4MA 3CUQA 1X1PA 4UNOA 2JA7J 1TWGJ 4DYQA 5F0HA 4BDYA 4DOZA 1VQOI 2MFZA 2X6YA 1FSEA 3LSGA 1O3QA 3I71A 1OR7A 1FYMA 2X6OA 2MLGA 3MVPA 1HLVA 3QYEA 2E1OA 2TRTA 1ZTRA 4IPAA 3IL2A 3IWFA 2DA6A 3H5RA 4CCKA 4XRFA 3E7LA 1KYWA 2VXDA 4MTDA 4IRIA 2D1VA 1YG2A 2JSCA 2W1OA 1SD4A 1G59A 3FMSA 2M0CA 3HHGA 1S8NA 1TWHJ 3RQIA 3F0CA 4BXXJ 4DGWB 1S7AA 2MD5A 1P6RA 1YYVA 2FMLA 3F6VA 4XK4A 3BDDA 1IJWC 2BW3B 3B73A 3L2CA 2QM3A 4U7DA 3QPSA 4XRSG 2V1DA 1PUEE 3V4GA 1UHWA 2K27A 2STTA 1TQMA 2ICWG 3JR9A 2R7TA 3R61A 3H36A 4OAYA 2K7LA 4NBQA 4RGSA 2L7MP 2Z99A 3QPHA 4Y4RA 1MNDA 5DS9A 4C3HJ 3WU0A 3OYBA 3C2BA 3PSFA 2MC4A 5HODA 4HQEA 2XAGA 2HVRA 1Z05A 2P81A 5GTHC 3S3MA 1IZ1A 2HS5A 1RR7A 3E6MA 3ZGKA 3G3ZA 2MYSA 3FISA 3BG9A 2EINH 1UG0A 3GX4X 4LLNA 2OV7A 4ZDLA 3LFKA 3SXYA 3BQYA 4FX0A 4CUGA 1I6HJ 3FXQA 1J9IA 2GIVA 1BM9A 5M5XJ 4GRIA 2WAQN 4YELA 3KCCA 2IGNA 3DTIA 3OL4A 3JRGA 1P9QC 1HKQA 2F4MB 1SD7A 3HRUA 4HYEA 2ESNA 2HZDA 1LDJA 1VQPI 3NWSA 2XASA 2ZSHB 2UXNA 2ACJA 3FXKA 2BBYA 4KN7X 3Q0WA 3JAMZ 3M07A 4Y33A 1FY7A 2RKHA 3SZTA 3D5SC 3B6AA 2I8DA 2P6TA 5FJ8J 4XOPA 3RQ4A 5IP7J 3A01B 3CDIA 3G2BA 5ILVA 3PUBA 1X1DA 2H94A 3VWBA 2ZFWA 3Q0UA 2K85A 3IRQA 4GYIA 2CSOA 1OFCX 5M5WJ 1MBKA 4G94A 2XHKA 1RZ4A 3DPTA 2DMQA 5BNGA 2RV8A 3OIOA 3GTOJ 4XKVA 3SHFA 2X1DA 3K2AA 1OCRH 3WTZA 2BE5F 3LMMA 1FPQA 1HKSA 3JW4A 5DD8A 5F27A 1LE8B 2DODA 2QCOA 4RLQA 3KX2A 1T56A 2DXIA 1R1VA 2IRFG 2QKMB 1F5TA 3VOEA 5DCMA 3ZMUA 1D3YA 5DD4A 3WHBA 1T8IA 2X0LA 2N8GA 2W00A 4ABZA 1A6QA 4IRGA 1SFKA 1D1CA 4E7ZA 2KIMA 1QVUA 2CS3A 3H5NA 1JUMA 5JR3A 3ECOA 1C0WA 2HQRA 2KLOA 2VI6A 5HLTA 1BOAA 3NRVA 3E5XA 4M6XA 4ZH4F 5E3OA 3FKIJ 2XAHA 3C18A 4X0GA 2X6WA 3P9KA 4DW6A 3TBIA 4F91B 4XM3A 2HPIA 4S0HB 4Y17A 2R7VA 2DJNA 1UB9A 3E3VA 3ISPA 1P4XA 5ICFA 1SVMA 2BXZA 3E0JB 4BHBA 4A3EJ 2OZ6A 2VC1A 2XUBA 3LL7A 2XSDC 1LFUP 3CD6I 1ZYRF 2OA4A 1ZGAA 3ASOH 3Q9VA 2IP2A 2JMWA 4B3AA 1DU0A 3TOBA 3GTLJ 2DT5A 3TO6A 1PP7U 4B09A 2R7XA 3WTWC 4MEYF 2PMZA 2L9SA 1OYWA 2A3SA 2JRMA 3VSLA 4E7SA 4HDVA 2DAOA 1O3SA 1XGMA 1GHCA 1E3HA 3ZOBA 1KGSA 4BL0B 4IL6C 3OYAA 2HDCA 1YLFA 3VFZA 3FMQA 1XCBA 3ONQA 5HOOA 3ZN0A 2R0QC 4QTRA 3ABUA 2PI0A 4F3QA 2LREA 1CF7A 2HR3A 5IPAA 2KHMA 3AG4H 2COMA 2D2WA 2XF6A 1RC9A 2RNJA 4I0AA 1BJAA 2NVYJ 5LGNA 3AL0B 2EIMH 4BS9A 5J4VA 3BOQA 5HLGA 2VJ5A 2KQRA 4Z6YA 1E17A 1VQ4I 1N77A 4EJTA 1D1BA 4CCNA 1IC8A 2NXNB 4BXUA 3J81Z 5FLMJ 3KP6A 1X1AA 4LITA 2OCCH 4OAZA 2PJPA 4M9XA 4YG2F 3T1BA 2IW5A 3IWZA 5BQTA 1XSVA 4NHJA 2A6TA 3E1SA 3FHZA 4L18B 1TLHB 3DU6A 3S93A 1ZHFA 3UR3C 4C9YA 2FU4A 2M8EA 3DEWA 5LBQA 1P92A 5IYCJ 3HJEA 2XF5A 2VKHA 4HNUA 4BE1A 2DA4A 2B9SA 3CC7I 3HM5A 3J80K 2XGEA 4XRSA 4QPOA 2OC6A 1Z3XA 2DQLA 2DYSH 2FD5A 4IQ4A 4KT6A 3BWGA 3GZ6A 1CF7B 1XDSA 1T95A 4EQQA 1FTZA 2O3FA 2HDWA 3K4KA 1JT0A 5F0FA 2DCEA 1ODDA 3MAJA 5J1YA 3O8GA 2XGCA 4I01A 2G9WA 2QGUA 1B59A 2ZSIB 1MMGA 2ZJPF 4IHXA 2XAJA 2XAUA 2OPTA 1OCZH 2QSFX 2NNYA 4ZTFA 5L3DA 1HXDA 3S2HJ 5K7ZA 2ZJ2A 3CCMI 2XB0X 1Y8QB 1YW7A 2JA6J 5HS8A 3HB9A 3M7GA 2F5EA 2X51A 4U0WA 4ESJA 1W1WE 3M1EA 4BJ5C 3HPGA 2LF8A 2A07F 2ZJRF 1YFHA 3RKWA 3S16J 1W7PD 1Z7LA 2F5DA 4MHGA 5E17F 1IW7F 4IJAA 2LY2A 5F64A 4BUPA 2KPMA 3ZQFA 3KETA 3SFIA 2DA3A 5FROA 5B66C 4D7MA 3LSKA 4Y7NJ 2EIKH 2AXLA 1SMTA 4UVBA 1R49A 1DDNA 1CQTA 1XSXA 4II3A 2KRCA 3CLOA 3WTVC 5HDGA 2MSYA 4AIDA 4X6AJ 3LSMA 1VQMI 3CJTB 3VYRB 4HF0A 4CCLA 4WWCA 1XG1A 4LD5A 3KPHA 3GBGA 2XVCA 3GWZA 1TZLA 5L3BA 4LIUA 3JAMK 1PYVA 2J5OA 3OMYA 2Z9OA 3GCMA 4IEJA 3GZNB 3PNVA 4D0PA 1YI2I 2R7WA 1MKMA 3IHUA 1VTNC 3PJRA 3CQZJ 1B9NA 3BJ6A 3R0AA 3H3UA 4V19K 2DFHA 5GAEJ 2FOKA 5FGMA 1I1GA 3FM5A 4A3JJ 1I3AA 2IA1A 1TT5B 3BTCA 3F21A 3TP3A 3VEPA 2JUCA 1F4KA 3MFKA 1HKTA 5C44J 2Y9ZA 4HSRA 4BHCA 3J7AY 1FSHA 4BDZA 2WV1A 1E3OC 2AQEA 5FKMA 4ZC3A 3TEDA 4L5IA 2OQRA 4MTEA 4BQOA 2V1XA 1EKEA 2WTEA 4EM2A 3H3ZA 3KP5A 2DO7A 4OIQF 5GAHJ 9ANTA 2NNNA 3HSFA 2EPFA 2EV5A 3GUDA 2OCEA 3FZVA 2K02A 5ICGA 3DF8A 3PIPF 3FBIB 5IOZA 2V6CA 3NAUA 3FK6A 2XDVA 4MO7A 2BY2A 1BR2A 3DXJF 5B5EC 2ELJA 3L2UA 2M34A 3TQNA 4CGZA 3PUFA 4OMYA 4MFEA 2KIFA 3ZXSA 3ZQIA 1ON2A 1D5YA 1VZ0A 1O3RA 3OYCA 4ZYHA 1ZRFA 1RIOH 2G7UA 1WJBA 2FQ4A 2H1LA 4NC8A 2Y2ZA 4A2UA 2WY7Q 1SD5A 2JTVA 2V4JC 4C2MJ 3FXJA 2VC0A 1ZG3A 2K9MA 1TWAJ 1Q1VA 4IHSA 1FMVA 2ZNZA 1FZPB 4L9VA 4PSWA 3RTRA 1Z0XA 2EFWA 1ZKGA 4L0YB 3I53A 2FA5A 3OIPA 3PIOF 2ME0A 2B0LA 4NDLA 3CUQC 3ROUA 1OCCH 2LLKA 1XMAA 3CDLA 1YW9A 4RB3C 1ZAOA 3CCSI 4PGHA 4E6KG 2WV0A 1L3LA 2VPRA 1OR7C 1JXSA 1DPRA 2KRFA 3DTKA 1BA5A 3FMRA 2DOAA 2O61A 2LR8A 4ZYGA 1R58A 2JWTA 3G1OA 5KAIC 1UAAA 1HF0A 2L4MA 1DP7P 3F8BA 4HOBA 5TJJA 3DBLB 3J81K 4YFNF 3OYJA 4OU0A 2E2JJ 3UKGA 2R7DA 1DGRM 5FD5A 3HG9A 3HKZA 5J6XA 2K4JA 3HKZN 3QODA 3CF2A 2CQ7A 2DK5A 4RB0A 1AA7A 3SQNA 1T98A 3LSPA 4IHYA 3M8JA 1FIAA 4DBRA 2W48A 2CFOA 3BT9A 3FDYA 3OYKA 2ZXHA 1G6NA 2H6BA 1G2HA 1U78A 4RM2A 2MGQA 2GQQA 2I10A 4A3KJ 2ID6A 3FKJA 2A6EF 2V79A 1P4AA 2OZUA 2DDAA 2X48A 2UV1A 3VSKA 3VODA 1P7IA 2L7KA 3DFGA 4U0YA 1REPC 2DA7A 2QQ8A 3MKWB 3ZPLA 3HOSA 1LDKB 1TL8A 3T0YA 5IT9Z 3CMEI 2D45A 2CH0A 3M4OJ 2HU9A 2OJED 4A0XA 4AIKA 3S8PA 3SZPA 3BG7A 5BOXA 1SFUA 1ZELA 4BACA 2CQQA 3OYHA 1DP3A 3OSFA 2CYYA 2HXOA 3QRFF 3ZMTA 1ZGWA 3DBHB 1XB4A 3GTMJ 4IVNA 1QA6A 4LLLA 3F3XA 4GXOA 4AD9A 2CRGA 4IXAA 1W5TA 5CVUA 3ZQHA 5H2FC 4EM0B 2Z5UA 1HSJA 5DYMA 1NK3P 3EYIA 4D5FA 2JVGA 2DT7B 2GOXB 3HYIA 2QZ8A 3QPTA 1V5GA 3E97A 1B72A 3V8KA 2LF7A 2DFFA 4M6YA 3V7SA 4XLHA 4Q5SF 2X4HA 3BTJA 3L2WA 5BS6A 2VUMJ 4F7ZA 1RKWA 5FB2A 2QBYA 2HKXA 1YJNI 1BL0A 3FBNB 3LSTA 5J1RA 3K4NA 5LHGA 4LG0B 4E7JA 1X2MA 2O03A 2GXBA 5IYDJ 5D4SA 3AG1H 2B7EA 2WBMA 2W57A 2RGVA 5EGOA 4N4NB 2EZKA 4IHTA 2KJCA 2ZO4A 2O7OA 1JE8A 2LG4A 3U1KA 2LFBA 4XMYA 2Y75A 2E60A 2R5ZA 1S9HA 2HQAA 3HTUA 3WU2C 3LA2A 3V8LA 1F43A 3U21A 4G7OF 2Y0SN 1SAXA 4A3CJ 1UHMA 3ZMZA 3WHCA 4Y3OA 3ML6A 3Q0VA 4XNFA 1ONVA 4A0YA 1STZA 5LEKA 4RAYA 2VBYA 1TBXA 3KEOA 3LA3A 3O6BB 4DZJA 2HVSA 2A05A 3OSGA 2QEXI 4AYBN 4A6EA 3CCEI 2LTPA 4MGRA 1KQ9A 1KYZA 2DLLA 2JPCA 3AL0C 1XSDA 1I39A 2KDZA 4LK0F 4XL9A 3SZGA 2M4KA 2Q2EA 1KU7A 5K5OA 4ENJA 3OS1A 4OMZA 3RYPA 2QBYB 1HSTA 2LY1A 1BI0A 4BEHA 2M8GX 4UV9A 3S1RJ 5FKKA 1KQ0A 5EG0A 3K1PA 3W6JB 2CFXA 3KP3A 3BPVA 1TWFJ 2LKSA 3CO6C 2L02A 2JJ7A 3I4NJ 1BR1A 5EGOB 1KONA 1W5SA 2EZHA 5KHDA 3I56I 4M71A 3RPUA 3RKQA 2X6XA 1Y8RB 1HA8A 1A04A 5K5RA 2L5QA 3FXUA 4EGYA 3KE2A 2PMHA 4B1RA 3OYEA 1N25A 2HYJA 1K6YA 3KFWX 2K3PA 2VBZA 1YRNA 1ZRDA 3DKWA 2P5LC 4A3LJ 3WE3A 4OIOF 2L2OA 1MD0A 3ZQGA 1TWCJ 4HX8A 4CDGA 1MMNA 2IEKA 3LSIA 4R8HA 2MA3A 3COAC 2UWMA 4LJZF 2IAIA 4G12A 4HF1A 2KZVA 4A3FJ 1XX5A 5J8FA 3K6GA 1YW8A 4RGUA 3H9JA 2KT0A 2H8RA 1XN7A 4LB6B 3SDBA 3BR6A 3ULQB 5HNFA 2BHZA 4HDUA 1XMKA 2IJLA 2XKPA 3FXMA 5BPDA 2Q2EB 3MMYB 1O4XA 4C3JJ 3KP4A 3I59B 1JUSA 2R4GA 3MZHA 2DU9A 4BEHB 1PUFA 4C2TA 5GAGJ 5EG0B 1BOBA 1ETXA 4WF2A 2XC7A 1BR4A 2K3FA 1HW5A 4OOIA 3M8EA 3IRRA 2VT3A 3QOPA 2ZNYA 3VDXA 3O8HA 2XROA 4ETSA 1WZ2A 5GTIC 5FKOA 1HC8A 2QKLB 3ERMA 2EK5A 1ZG5A 3CUQB 2JN6A 4AUXA 4IOCF 4PZJA 1YRNB 5CJ9A 2WADA 3PNTA 2CGPA 4B8XA 4G8XA 5GP9A 4E7IA 2H27A 1V55H 2YUSA 4LK1F 4KNYA 5M3FJ 2DMUA 2XPUA 4CYDA 5LGTA 4A3IJ 3K4BA 1GT0C 4UVAA 3EUKL 4Z2YA 2YU9J 4C3IJ 4BE2A 2DMTA 4I0BA 2DTRA 1QVTA 1N78A 5IP6A 4LG3A 2NVTJ 1ETYA 4RS8A 4W1UA 1MZBA 3ASNH 4U88A 5LD2C 2V1NA 3E6BA 4J01A 1ZARA 4FE4A 4M72A 4EJVA 2EA4A 5M5YJ 1PUFB 4EGZA 4S04A 3IKTA 1S3JA 3BTLA 4MEXF 3SEQA 1TQPA 1FOXA 1QPMA 3QU3A 4CYCA 3V42A 3LQQA 3S17J 5EZHA 3T8TA 2VE9A 4I02A 2HNHA 2K9SA 2V9VA 3H9QA 3P9IA 3HXLA 4ITVA 1IRXA 3OY9A 2Y30A 4F92B 1Z77A 4BJ6C 2NOJB 3W2AA 1EH7A 3CP8A 1A5JA 2L9RA 3BJOA 1FEXA 4EV0A 4MQVA 1BJZA 2E7XA 2FJ1A 2ZXWH 3OR1C 4P55A 6PAXA 4YFKF 3HOUJ 1QZYA 4XKWA 4M9ZA 3F8CA 3CCQI 2DOFA 4QSHA 3CJNA 1R9TJ 3K2ZA 1WSUA 4KYWA 1G3WA 4HZFA 5H6RA 2LK2A 3NWTA 4AC0A 2RQQA 4E7LA 2XV4S 2HXIA 4XLCA 1JKQC 1WGXA 2OF7A 1JKPC 2QSGX 3BTIA 2XIGA 4PCQA 3LSHA 2BOLA 3W2VA 3C3WA 5JI6A 3CCLI 1R7JA 4RA2A 3FF5A 3HRTA 3QYFA 3OYGA 4AVZA 1SD6A 2IS6A 1KU9A 4G7ZF 4NC7A 2HWVA 3L9FA 4CYCB 1Z9CA 1WJCA 2L7FP 3FX3A 1OMIA 3N97A 2VQLA 3MKLA 4P1WA 5FLXK 4PFOA 2RREA 5L3GA 2GM4A 2GLOA 2JA8J 4HAMA 3NARA 4RLFA 3BR0A 3NEUA 4XBFA 2L9NA 2VLAA 1WH5A 1XC5A 2Z1DA 3HPHA 1Q1HA 3K4LA 1AHDP 5EYRA 1VQ7I 2IT0A 2VE8A 1GV5A 5C4XJ 4HEA2 3EETA 4KMFA 3WTUC 3PO2J 4M3EA 5DCMB 2P5VA 2VIXA 2ZBKA 1MH4A 3BZ6A 3B02A 1ETKA 1IN6A 5DDGA 3H0DA 1G4DA 2PMZN 3C2GA 5K5QA 1ACIA 3K1MA 3S1QJ 4WCGA 4MNUA 3P7NA 2VASA 2KKOA 4GCVA 5F0CA 2XF7A 2XAQA 1YE9A 1G8XA 2AXTC 5HVQC 3WGIA 2F4IA 5CQGA 2BEOA 4YIFA 1RRJA 4YRVA 3ABMH 3BR5A 3PM1A 1XDUA 3FIWA 1XS9A 4XLAA 1U5TA 2GZWA 2IXSA 1X2NA 4FHTA 5E1ZB 5IT3A 2DPDA 2NRAC 2P0WA 2I5UA 4UVCA 3G4SI 4XLEA 2GOMA 2JQ7A 4CXFA 3CJQB 2W82A 4ZJZA 5C3EJ 2CWEA 2TDXA 2R7SA 2E7WA 2VJIA 2GXGA 4B3XA 5F1RA 1ITYA 2PQ8A 2DTZA 5A2QZ 3TDUC 4Y13A 1D8KA 2XSJC 1Y39A 1FNNA 1ZGJA 2R7ZJ 4M6VA 3GFIA 3HGYA 3L2QA 2CUFA 2KIQA 4LB5A 1EF4A 4FISA 4BU2A 3U9GA 5F1JA 1D5VA 5LHIA 3G6EI 2R7QA 2EV6A 1QNTA 2A61A 5E79C 2HEOA 5EEGA 3DEUA 1HQCA 1FOKA 1MIJA 3AFHA 2M2EA 1IRGA 2DK8A 4UUSA 3HRSA 4HQMA 1IAWA 2HOSA 1A35A 3PFYA 1LB2A 3M3YJ 4E7HA 4G7HF 1IO2A 5DV5A 1FMWA 2E35A 2DOEA 3LQRA 2CUEA 1R5GA 2YS9A 1JJ8C 3U1DA 2WAEA 4L5JA 1X4OA 2CQNA 4LMYA 1B1BA 1E2XA 4CSWA 2PMUA 1ZLKA 2OU2A 3E6DA 3EQLF 3P5JA 2K4BA 2NS0A 2V9KA 2RN7A 2RC4A 4RMNA 3ABLH 5TISC 5ILUA 3DPUA 2LBFA 2NVXJ 2UZKA 4BGDA 3OL3A 2VQCA 2A5WA 3PNYA 1K6OA 1AWCA 1ZR4A 2F5VA 4BY7J 1FP2A 3W6VA 2EH3A 1T08B 2P8TA 4D1QA 4PJNA 2DQRA 2RQPA 1K79A 3C2HA 1S29A 3L2RA 3C1DA 2HTJA 4CCOA 2A5YB 3L1PA 5F6FA 1H9TA 2P4WA 1A6IA 1K61A 2PLYA 4UUSB 3CC2I 1X1CA 3RKYA 4FT8A 2FX0A 1X3UA 1LDDA 1YOVB 3FXLA 2ZCWA 4BE0A 5D8KB 3X2QH 1U0JA 3ZCOA 4HBLA 3GMEA 4M3DA 4ZZLA 1U8BA 1HDDC 3N05A 1EH6A 2V6EA 4C30A 4F55A 1H89C 4ZDOA 4YFXF 2KDOA 3L7WA 3V7RA 4LGWA 4PJLA 1F9NA 2IGMA 4PJ0C 2EFNA 2WWYA 4IQJA 2ELHA 3A0HC 1VI0A 3KYCB 3KZZA 2MH9A 1FBQA 2DDBA 1BC8C 4PJJA 1G3YA 4Q4ZF 2QUFA 2ZFUA 1PVEA 1X1BA 3OOPA 2FNPA 2VONA 1OLTA 3A0BC 4A6DA 1SC7A 1FYLA 4Y52J 5LEJA 3I64A 1MDMA 3GFMA 1D0ZA 1FT9A 1YX5A 3HUGA 4EATA 4AIJA 4A5NA 3OOUA 4YIRX 2CO5A 2HOTA 1YO5C 1V3FA 2HFHA 4XSZF 2KJBA 3K4CA 3VYTB 1X3ZB 2HKOA 3G71I 1B6AA 3OS0A 2FBKA 2P5KA 3HZJA 2CG4A 2XPVA 1R71A 4KMUX 2QQBA 2ZXIA 1ETOA 3DKXA 1S72I 2VKDA 2TCTA 4D5CA 2BYVE 1USSA 1QPIA 3IH3A 1GVJA 2IGKA 4O3MA 3PL8A 2IS2A 3E5QA 2QQ9A 4I2OA 2M7BA 3ECHA 3OYDA 2KP6A 3K9TA 3MKYB 1AU7A 4A93J 4A12A 4WX9A 3J7AO 4XICA 1ZN2A 4M3BA 3MKZA 2LD5A 3DKYA 5BMZA 1ENHA 4J19A 3KYLA 1MBEA 1TQIA 1T2KA 4E7KA 4KN4X 1D0XA 1UG2A 2O8KA 2ESHA 1MDMB 2Z2SB 3MWMA 3JSPA 3JREA 2FF4A 2CJJA 1S5LC 2FQ3A 3HUGB 2Q1ZB 2ZB9A 2BXYA 2CV0A 2FBHA 1WJDA 3W6KB 3H5AA 4UY8I 3DU5A 1MMAA 1B8IA 1IXCA 2L3DA 3U2RA 2LRDA 2H09A 4M9SA 2Z16A 1K7AA 2COBA 5AIPA 2IS1A 3DLLF 3S1NJ 2LC2A 2VN2A 4QLCU 2NVQJ 1UCRA 1MSEC 3GXOA 1FOWA 1F36A 2ZMEA 1IRFA 5D5VB 3CZ6A 4P5OA 1WI3A 1J75A 1RNLA 3ZR8X 1IDZA 1WH7A 3F23A 4LOCA 4MFDA 1BN5A 4W97A 2GXAA 5IY5H 2HOEA 3R60A 1IGNA 2EV0A 2W25A 2IBDA 2IGOA 5E20A 5JLXA 5D5UB 3GFLA 4EVIA 5A2QK 1R22A 4RM3A 5JHUA 3ZP5A 3QPLA 4XLFA 3BPXA 1IN8A 1VQKI 2Y31A 3I9V2 3HEFA 2VJJA 3GTKJ 4FE7A 2OBPA 4I76A 4I6ZA 5F04A 4EMSA 3RJPA 2GIZA 2E1CA 4KDPA 3T5XA 3UNGC 2VXZA 2WA0A 1PDNC 1T6SA 4HPQA 3S14J 2EFQA 4KIGA 4XKCA 1YTYA 1OCOH 1FJLA 1RETA 3I3LA 1V5FA 2OUMA 4YIIA 1J59A 3O3KA 3BC8A 4CHUA 2R7OA 2ZMEB 1LEAA 1ORKA 1IN5A 2MH2A 3D1NI 4HV5A 1I1SA 3CCVI 4TV7A 1QHHD 3Q3SA 5D5WB 1MW7A 2EZLA 2CV1A 1H88C 4ASNA 2ELKA 1J09A 3GEZA 4XRMA 4HNTA 4IOAF 4KJZA 4KUMA 1BI2A 2XRNA 1YS7A 3BLYA 2E36A 5E18F 2MLKA 1WI9A 3A1YA 3RSNA 2NAZA 1LJ9A 2VPLA 3IUOA 1YITI 5DCFA 5CKTA 2CV2A 2JZYA 4A3BJ 2LVSA 1HCRA 2IS4A 1Z1DA 3KZYA 1YJ9I 3CUOA 4PFPA 1R5ID 2MD0A 4RAFA 5GPCA 1SEUA 1VQLI 1WPKA 3GYHX 3K1NA 2L9VA 1MBJA 3OV8A 1JHFA 2IPQX 5HLIA 3DBRB 3HDDA 2BHYA 3QOEA 4O6JA 1FX7A 3D5LA 3ZMDA 3HC7A 2R7FA 2FMYA 2XKOA 3JRHA 2VB6A 1NHAA 2L0KA 1D1AA 3GTJJ 2AQFA 2EZIA 3DPLC 4MQ9F 4RAZA 3ZQCA 1RR8C 3GTQJ 1Y1VJ 1KU3A 3I55I 2XB5A 1ULYA 4BY1J 5IP9J 1BW5A 4UV8A 3F6OA 1MBFA 3IV5A 3WTSC 4RBOA 3WU1B 1MJBA 3BCBA 3M9AA 2W4SA 2RNGA 4PK4A 2M1BA 4CH7A 3CCYA 2RDPA 3CC4I 2VKVA 3RPUD 2W7NA 3REOA 5B1AH 2GA2A 1W4MA 5HDKA 2K86A 4DZPA 3CMYA 2ME6A 1KA8A 2JT1A 1I50J 1SFXA 2VKEA 1GLNA 3DQVC 3B6CA 5LRSA 2ID3A 4XOTA 5DM6F 4DYCA 5KNLA 3HSEA 2LDUA 3CMMA 5LFAA 1B72B 5DM7F 2E34A 1P4WA 1TC3C 5B3SH 4P96A 3K4JA 2FXAA 3PFIA 4PGGA 3H0GJ 5EEHA 1JT6A 4NQWA 4ZYAA 4BKXA 2FRHA 1MMSA 1IV8A 1HW1A 4BJTA 3NQOA 4XLNF 1W5CC 3CF5F 2YR2A 3I58A 4JX4A 2PFBA 3BCAA 1UELB 3DEEA 4RGRA 1JKRC 4OIPF 4BQQA 3WTTC 1Z21A 3LAPA 2H8WA 1S7EA 2F4OB 2LNBA 2GBYA 1X3WB 2CW7A 1NH3A 5DEQA 3KZIC 2HYFA 1R1TA 1H9GA 1IXSB 2R5ZB 3ESWB 4PUSA 3HOTA 3FXOA 3VB2A 2M5WA 3CMAI 4XN3A 5JVTA 1VQ6I 4B47A 1RUOA 4D7NA 1H0MA 2GAUA 4LLGF 3CCRI 2LMDA 4B43A 2LYCA 4I09A 4XKBA 5FD6A 3TO9A 3RI4A 4JQFA 2BW3A 2M9HA 3TP0A 1ZK8A 4GYGA 1P7JA 3GO5A 2DYRH 1U5TC 2M45A 3BG3A 1KU2A 3QQAA 3QYBA 3EDPA 3K7AJ 4BH9A 2QSHX 2HPMA 1JHHA 2A69F 2JSPA 5CQEA 3P9CA 1K4TA 1HW2A 4FASD 1U8RA 5LLQA 3D0SA 4PDKA 3G1LA 5HS7A 4Q47A 4I98B 2EQRA 3CO7C 2X85A 1N75A 2PG4A 3K10A 3LNQA 4M3FA 1APLC 1LKXA 1Y0NA 1D8JA 3O2PE 5H6QA 1EV7A 1MNEA 3J80Z 2M7AA 2WB1A 3BJAA 3C7JA 4OINF 1G3SA 3AG2H 2WB1N 3QP6A 3FXRA 3WTYC 4ZDPA 3A2KA 3JRAA 2BY1A 1X58A 5EF6A 5D5XB 1NG7A 5CVIA 5E1WA 3WE2A 1I6XA 2YSRA 3V8JA 3VPRA 3KEYA 1Z7UA 3S15J 3F8FA 3WG9A 3F8NA 4XIDA 1MBGA 2D1HA 3I4PA 2EJRA 3FK7A 1G3TA 3N4MA 2STWA 4AM3A 3CCJI 2FBIA 2R5YA 3H35A 3TKYA 5DUIA 1UMQA 3A01A 1FBSA 2EA2A 4ZYEA 3J7ZI 2ECBA 2OD5A 2R7RA 4H0EA 2V26A 2FSWA 1X19A 3TMOA 4BBRJ 4V2FA 4FCYA 3BR1A 3EUAA 1IXRC 2L01A 1SFOJ 1W0TA 3WODF 3KP7A 1K83J 3BR2A 4GDFA 4HW0A 1Y6IA 3BZCA 5JHFA 4A3MJ 4E70A 4HX4A 4GO1A 4PJMA 2L7ZA 2JPBA 3EPZA 2DPUA 2QA4I 4IHVA 1T0FA 1HDPA 1LE8A 4D9JA 1JKOC 2WAQA 1QU3A 1EH8A 3DV8A 1SANA 3GZ5A 3MCZA 2M87A 1RKTA 5IT9K 3DLAA 4P9UA 2Q0OA 4LIVA 2VODA 2L4AA 3W3CA 3FWEA 4CCMA 3TOAA 5E3LA 3K70C 2QYOA 3ZMSA 5AONA 1RESA 3RZDJ 1W36C 4OWRB 4N4OB 1BI3A 1GXQA 2IVMA 2VJ4A 3FHNA 2XGDA 1FIPA 3BQZA 1MNMC 4BYYA 2E71A 3M8FA 1J2XA 5LRRA 4QIWN 2R5YB 1TT0A 2XPWA 3HOZJ 3SJMA 4KA4A 1U6GA 4RAGA 1MJAA 4DIQA 4RB2C 1QZEA 3I0TA 1WJFA 3MZYA 1B9MA 5J4YA 1HOMA 5JLWA 1I27A 4CZCA 4HNVA 2EB7A 2CW8A 3ZQQA 2H1KA 3L00A 5D6EA 1XGSA 5TGTA 1XD7A 2E1MC 2HDDA 1JJ6C 3KLOA 3JRIA 4JBAA 2MBFA 1PP8F 2M0MA 2KZGA 2DBBA 3RDIA 3H9GA 2VOPA 3HOWJ 1J7KA 1WJAA 2PJRA 1TP4A 1SVOA 1XMXA 2HYGD 5GPAA 2CQKA 2F2EA 5KAFC 5L3EA 4WK8F 4E4HA 4HF2A 1Z6TA 1Y56A 1UHSA 4BXFA 5C4JJ 3OYMA 3JRDA 1U9OA 1QHGA 1MH3A 5KK1A 3RCOA 2ISYA 5D4RA 1S7OA 1FOYA 4IZZA 4XR6A 3JRFA 4R79A 4XSXF 4ON0A 4BQAA 2DFIA 3CP2A 1Z3YA 3OR2C 2KISA 5FO5A 1TW3A 1VFCA 2Y0MA 3LA7A 4UXNA 3A02A 4MIMA 3W2WA 4ENNA 1YHQI 1SAUA 2BZTA 3IAM2 3A4CA 1HBXG 4Y15A 5HS9A 1Y1WJ 1ZRCA 2KL4A 3IH2A 1LVKA 1XGNA 3LSRA 5IOYA 2XGXA 5E3NA 1F1ZA 3Q9SA 5JFRA 5D8LB 2F48A 4RGXA 2QF7A 3AAFA 2MW8A 1OJLA 4BNCA 1ERDA 1R4MB 2PJRB 1IF1A 2Y69H 4KISA 3FM3A 1JUPA 2VBWA 4IRHA 1WHUA 1P2FA 5BPIA 2EIJH 1R6RA 3GFJA 2QENA 4M3GA 2F6CA 3KIOA 5ERIA 4UHTA 1FBUA 3GW2A 2R93J 1IUYA 3L2VA 1JGSA 4ESFA 5FKNA 1ETVA 3PQJA 4U7BA 3TO7A 4YEJA 3CESA 2NS8A 1TNSA 2O0YA 5AIQA 4EJWA 2MC3A 1SMYF 3HIFA 3H3VK 4M73A 2A6HF 4XLPF 1MJ9A 3BY6A 5JVGF 3OYIA 1R00A 2A68F 1NTCA 5CYVA 2AO9A 3LWFA 1WRJA 2JVHA 3JSOA 1QBJA 2MG4A 4V2GA 2ZMEC 4ENMA 4WXHA 1OPCA 3TDZC 2LKPA 4NC6A 4UB6C 1YJWI 1ZH5A 1Z6RA 1WKMA 3H1CA 3WG7H 2V1UA 1H8AC 1CGPA 1E3PA 1XTAA 3ZN1A 2G0EA 5K7HA 1R23A 2UUZA 3S2WA 2YU3A 2K40A 2DJIA 5IYBJ 3K70D 1I5ZA 3S2DJ 1W36D 4C2UA 3CDHA 1U5TB 4JYKA 5HLHA 4A3GJ 2DMNA 5FRMA 1IG7A 3DCFA 3OWTA 4KITB 3IC7A 4I7HA 5ICEA 1T38A 1QRYA 1BW6A 5K7FA 5FFXA 1DQUA 1YIJI 3F22A 1ETQA 2JRTA 2PEXA 5F08A 2V7FA 2BVMA 2DT6A 4DNCA 3PQKA 4CICA 3ZQ7A 3F9KA 3HOVJ 2JUGA 2LSOA 2V9PA 3F72A 3MZ8A 2ZC2A 4AWXB 2E5ZA 2BGCA 4UUVA 4CZZA 3HSRA 3H92A 2O6GE 1OYYA 1BIBA 5GADJ 1VNDA 2HQNA 1WVRA 1LEBA 1VF9A 2AHQA 1QZZA 1AOYA 1OQYA 4WXCA 2VL8A 1ZREA 5LGUA 3VYSB 1YQAA 4Q48A 4O5VA 1OISA 2DI3A 5TRDA 1VQ5I 4OIRF 5ED4A 3BG5A 2ADUA 1RUNA 4A0ZA 3A03A 3GVAA 1WFXA 1LUJB 3HL2A 1IRZA 4A3DJ 2BY0A 2NVUB 1JTXA 3HRMA 3HGGA 3M1CA 4X1EA 2ISZA 2QVOA 3TGNA 2VT2A 1IN4A 4NUBA 2X1CA 4U87A 5EZGA 5B1BH 3OS2A 1R5HA 1L0OC 1BBYA 2KRHA 1T33A 1WCMJ 1POGA 5DTDA 4KIFA 4N9HA 4WXDA 2E2IJ 1V4RA 4EM1A 4B48A 1NK2P 1LFBA 2LBFB 1WWXA 5FFZA 3S1MJ 4HV6A 1D0YA 1JGGA 2CQXA 1LNWA 2BV6A 2HVQA 2HGCA 2PBIA 3CJRB 1O7LA 5FLVA 2LOOA 3EUHC 4G9YA 3OYLA 1R1UA 2R92J 1R4NB 2F5FA 1QQIA 2K9NA 1GDTA 2O5RA 1NG6A 2NYXA 2W24A 1Z67A 3QU6A 4L9NA 2Y48A 4IKFA 3ERED 4II2A 4F93B 3OIQA 3SDGA 4DQ2A 2G7HA 1W7PA 2ZKZA 3E6CC 3I4MJ 2ECCA 3RYRA 3BP8A 5DUKA 4BHPA 2JK3A 4KICA 3SYTA 3J7YJ 5E8IA 4RDUA 1EJ9A 4XQFA 2DW4A 5E3MA 3MQ0A 2VOOA 2E5NA 1ON1A 3KEQA 5HDNA 2CW0F 5ILSA 2E1MB 3K69A 5FRNA 2GA1A 2Z33A 1IUFA 3JRCA 4ANJA 1KQ8A 3ZQLA 1I3QJ 3BG6A 2IA0A 3HOYJ 1A31A 3R6SA 2W84A 3WTXC 2DN0A 3RPQA 1VQNI 3LSJA 4AVPA 4EJUA 1O57A 5CPRB 5J3LA
chains in the Genus database with same CATH topology
5J1UA 2JA5J 3BTLA 3CCYA 3DEWA 4CYCA 2VKVA 3S17J 5EZHA 4DZPA 3CMYA 5IYCJ 2ME6A 4UUTA 1I50J 2D5VA 2DA4A 2K9SA 3HM5A 2XGEA 2VKEA 4XRSA 3B6CA 2ID3A 4DYCA 2Y30A 2FD5A 1Z77A 1FTZA 1B72B 1JT0A 1A5JA 2L9RA 1FEXA 5F0FA 1TC3C 5J1YA 3O8GA 1BJZA 2FJ1A 2XGCA 3HOUJ 3H0GJ 2HQ5A 1JT6A 4RBOA 4BKXA 4IHXA 2OPTA 4QSHA 3LOCA 1GUUA 1R9TJ 2LK2A 3IH4A 4AC0A 4JX4A 2HXIA 5K7ZA 1JKRC 1IV6A 2XB0X 3S2HJ 1JKQC 1WGXA 2OF7A 1JKPC 3BTIA 2JA6J 3G1MA 1S7EA 1JTYA 3HB9A 2GBYA 4FTHA 4JP0A 1U9NA 2K9QA 2R5ZB 4CYCB 3S16J 2L7FP 1B8IB 3MKLA 2DA5A 1W0UA 1DU6A 4D7NA 2GM4A 3ZQFA 2GLOA 3SFIA 2JA8J 2DA3A 4D7MA 3NARA 4Y7NJ 1CQTA 2LP0A 3BR0A 2M9HA 3TP0A 1ZK8A 3BR3A 2MSYA 1P7JA 4X6AJ 1WH5A 1XC5A 2NOGA 3BG3A 3QQAA 1XG1A 3K7AJ 1AHDP 5EYRA 3GBGA 3HOXJ 2NS7A 1GV5A 1OCPA 5C4XJ 4GFBA 3G1LA 4IEJA 3PO3J 2HOAA 2EQRA 3LNQA 4M3FA 2XRLA 4M3EA 3PO2J 4B4CA 1APLC 1MH4A 3CQZJ 1ETKA 2PMZN 5EEAA 1MSFC 2DA1A 4DYRA 3S1QJ 3JRBA 2WB1N 5F0CA 4A3JJ 5EDNA 3JRAA 1X58A 5EF6A 3BTCA 4MLOA 4IHWA 3VPRA 3TP3A 3RZOJ 3BR5A 3S15J 2HI3A 5C44J 3PM1A 2Y9ZA 1XS9A 3FIWA 4XIDA 3HBLA 1MBGA 1X2NA 2WV1A 1FTTA 3FK7A 1E3OC 1AKHA 1ZQ3P 5FKMA 3TEDA 2R5YA 1ZR2A 5C3EJ 1UMQA 3A01A 4EEFG 1ITYA 2ECBA 4JX6A 2DTZA 5M3MJ 9ANTA 1IDYA 4BBRJ 2DA2A 4V2FA 4FCYA 3BR1A 1SFOJ 1W0TA 3GTGJ 5IOZA 2R7ZJ 3NAUA 3FK6A 1K83J 3BR2A 4M6VA 4MO7A 4A3MJ 3HGYA 2M34A 2L7ZA 4MFEA 2CUFA 3ZQIA 1EF4A 1D5YA 4FISA 4IHVA 3TW7A 5F1JA 1HDPA 1LE8A 3MN2A 1GV2A 1JKOC 2LY9A 1SANA 2LKXA 2FQ4A 2O9LA 1RKTA 4A69C 2Y2ZA 4JX5A 2E19A 4C2MJ 1ETWA 2M2EA 2Y9YA 4UUSA 2HOSA 2X9DA 5E3LA 1RESA 3RZDJ 3M3YJ 1TWAJ 1Q1VA 1Z0XA 1ZKGA 2XGDA 1AKHB 1FIPA 3BQZA 1MNMC 2CUEA 2YS9A 1JJ8C 4QIWN 2R5YB 2XPWA 2DMPA 2ME0A 1OCTC 3HOZJ 3SJMA 4NDLA 2CU7A 2LLKA 2E2HJ 3CDLA 2NVXJ 1HOMA 5JLWA 2EBIA 4HNVA 2VPRA 2H1KA 2HDDA 1BA5A 1JJ6C 3JRIA 2LR8A 1ZR4A 4BY7J 3GTPJ 2JWTA 3G1OA 2EH3A 3HOWJ 1HF0A 1RPWA 3TW6A 5GPAA 2E2JJ 1UHSA 5C4JJ 3UKGA 3JRDA 1U9OA 3L1PA 1K61A 1A6IA 1GVDA 2RAEA 1MH3A 4UUSB 3HKZN 4L5EA 4BBSJ 5FKLA 2FX0A 3JRFA 2B63J 3LSPA 1MBHA 4IHYA 4M3DA 1U8BA 1FIAA 1HDDC 2W48A 2JA7J 3BT9A 1TWGJ 4DYQA 5F0HA 1VFCA 1H89C 3A02A 4MIMA 1G2HA 1U78A 2MGQA 3LSGA 2X6OA 2I10A 4A3KJ 2ID6A 1VI0A 3MVPA 1Y1WJ 1HLVA 2E1OA 2TRTA 1ZTRA 2X48A 1P7IA 2DA7A 2DA6A 3IH2A 3E7LA 3LSRA 5IOYA 5E3NA 3M4OJ 4Y52J 2QF7A 2MW8A 1OJLA 2CQQA 2M0CA 3OSFA 1TWHJ 3RQIA 3F0CA 4BXXJ 2HXOA 1JUPA 1ZGWA 3GTMJ 4XK4A 1IJWC 3OOUA 4M3GA 2HOTA 3QPSA 4XRSG 2R93J 2CRGA 3ZQHA 5FKNA 1ETVA 3JR9A 2XPVA 2NS8A 1NK3P 2L7MP 1ETOA 5DS9A 4D5FA 3H3VK 4C3HJ 2TCTA 4D5CA 3C2BA 1QPIA 3IH3A 5HODA 1B72A 2P81A 3BTJA 1NTCA 2AO9A 1RR7A 2VUMJ 3FISA 2MG4A 3BG9A 1RKWA 4V2GA 1AU7A 4A93J 4XICA 1BL0A 3BQYA 4M3BA 5J1RA 2LD5A 1I6HJ 1ENHA 4J19A 1MBEA 5M5XJ 2WAQN 1X2MA 5IYDJ 2O8KA 1H8AC 1UG2A 2G0EA 3JRGA 5K7HA 3JREA 5EGOA 2K40A 2CJJA 2EZKA 5IYBJ 2O7OA 2ZB9A 3S2DJ 4JYKA 2LFBA 2DMNA 4A3GJ 1IG7A 3Q0WA 2R5ZA 3DCFA 1B8IA 1F43A 3B6AA 2Y0SN 1QRYA 1BW6A 5K7FA 5FJ8J 4A3CJ 1ETQA 5IP7J 5F08A 3A01B 2COBA 3WHCA 3Q0VA 3W6VA 3Q0UA 3S1NJ 4DZJA 2NVQJ 3OSGA 4AYBN 1OFCX 5M5WJ 3HOVJ 1MBKA 2LTPA 1MSEC 1F36A 2DMQA 1WI3A 5BNGA 2KDZA 1IDZA 1WH7A 4LOCA 3OIOA 4MFDA 3GTOJ 4W97A 3K2AA 1VNDA 1IGNA 1LE8B 1VF9A 2AHQA 2M8GX 5F27A 3S1RJ 5FKKA 2QCOA 5EG0A 1T56A 1TWFJ 2IBDA 3WHBA 5JLXA 2N8GA 2JJ7A 3I4NJ 4ABZA 3BG5A 5EGOB 2EZHA 3RKQA 3QPLA 3A03A 2Y31A 1QVUA 3HEFA 1IRZA 1JUMA 4B1RA 3GTKJ 4A3DJ 2HYJA 1JTXA 4FE7A 3HGGA 4X1EA 4I76A 4I6ZA 1YRNA 5F04A 2VI6A 4A3LJ 5EZGA 1TWCJ 3ZQGA 5E3OA 3FKIJ 2IEKA 3S14J 1T33A 1WCMJ 1POGA 2IAIA 5DTDA 4G12A 2E2IJ 4A3FJ 1FJLA 1NK2P 4DW6A 1LFBA 1RETA 2KT0A 3S1MJ 2H8RA 4S0HB 3BR6A 1JGGA 2CQXA 1ORKA 2DJNA 3D1NI 1O4XA 5FLVA 3Q3SA 4A3EJ 1LFUP 2EZLA 2XSDC 4C3JJ 1JUSA 1H88C 2R92J 2ELKA 2K9NA 4XRMA 1PUFA 1GDTA 2JMWA 4B3AA 1DU0A 5EG0B 3GTLJ 1ETXA 3SDGA 3I4MJ 3ZOBA 2LVSA 1HCRA 4A3BJ 2ECCA 3O8HA 5FKOA 2JK3A 5GPCA 2R0QC 4QTRA 1WPKA 2JN6A 4AUXA 1YRNB 4RDUA 1MBJA 5IPAA 5E3MA 5GP9A 2NVYJ 2YUSA 3HDDA 5M3FJ 2DMUA 2XPUA 4A3IJ 3JRHA 1IUFA 3JRCA 2L0KA 1GT0C 3ZQLA 1I3QJ 2YU9J 1IC8A 4C3IJ 2DMTA 3GTJJ 3HOYJ 2EZIA 5FLMJ 3ZQCA 3GTQJ 1QVTA 1Y1VJ 2DN0A 5IP6A 2XB5A 2NVTJ 4BY1J 1ETYA 4W1UA 3LSJA 5IP9J 1BW5A 1MBFA 4FE4A 3IV5A 5M5YJ 1PUFB 5J3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1U A;  2JA5 J;  3BTL A;  3CCY A;  3DEW A;  4CYC A;  2VKV A;  3S17 J;  5EZH A;  4DZP A;  3CMY A;  5IYC J;  2ME6 A;  4UUT A;  1I50 J;  2D5V A;  2DA4 A;  2K9S A;  3HM5 A;  2XGE A;  2VKE A;  4XRS A;  3B6C A;  2ID3 A;  4DYC A;  2Y30 A;  2FD5 A;  1Z77 A;  1FTZ A;  1B72 B;  1JT0 A;  1A5J A;  2L9R A;  1FEX A;  5F0F A;  1TC3 C;  5J1Y A;  3O8G A;  1BJZ A;  2FJ1 A;  2XGC A;  3HOU J;  3H0G J;  2HQ5 A;  1JT6 A;  4RBO A;  4BKX A;  4IHX A;  2OPT A;  4QSH A;  3LOC A;  1GUU A;  1R9T J;  2LK2 A;  3IH4 A;  4AC0 A;  4JX4 A;  2HXI A;  5K7Z A;  1JKR C;  1IV6 A;  2XB0 X;  3S2H J;  1JKQ C;  1WGX A;  2OF7 A;  1JKP C;  3BTI A;  2JA6 J;  3G1M A;  1S7E A;  1JTY A;  3HB9 A;  2GBY A;  4FTH A;  4JP0 A;  1U9N A;  2K9Q A;  2R5Z B;  4CYC B;  3S16 J;  2L7F P;  1B8I B;  3MKL A;  2DA5 A;  1W0U A;  1DU6 A;  4D7N A;  2GM4 A;  3ZQF A;  2GLO A;  3SFI A;  2JA8 J;  2DA3 A;  4D7M A;  3NAR A;  4Y7N J;  1CQT A;  2LP0 A;  3BR0 A;  2M9H A;  3TP0 A;  1ZK8 A;  3BR3 A;  2MSY A;  1P7J A;  4X6A J;  1WH5 A;  1XC5 A;  2NOG A;  3BG3 A;  3QQA A;  1XG1 A;  3K7A J;  1AHD P;  5EYR A;  3GBG A;  3HOX J;  2NS7 A;  1GV5 A;  1OCP A;  5C4X J;  4GFB A;  3G1L A;  4IEJ A;  3PO3 J;  2HOA A;  2EQR A;  3LNQ A;  4M3F A;  2XRL A;  4M3E A;  3PO2 J;  4B4C A;  1APL C;  1MH4 A;  3CQZ J;  1ETK A;  2PMZ N;  5EEA A;  1MSF C;  2DA1 A;  4DYR A;  3S1Q J;  3JRB A;  2WB1 N;  5F0C A;  4A3J J;  5EDN A;  3JRA A;  1X58 A;  5EF6 A;  3BTC A;  4MLO A;  4IHW A;  3VPR A;  3TP3 A;  3RZO J;  3BR5 A;  3S15 J;  2HI3 A;  5C44 J;  3PM1 A;  2Y9Z A;  1XS9 A;  3FIW A;  4XID A;  3HBL A;  1MBG A;  1X2N A;  2WV1 A;  1FTT A;  3FK7 A;  1E3O C;  1AKH A;  1ZQ3 P;  5FKM A;  3TED A;  2R5Y A;  1ZR2 A;  5C3E J;  1UMQ A;  3A01 A;  4EEF G;  1ITY A;  2ECB A;  4JX6 A;  2DTZ A;  5M3M J;  9ANT A;  1IDY A;  4BBR J;  2DA2 A;  4V2F A;  4FCY A;  3BR1 A;  1SFO J;  1W0T A;  3GTG J;  5IOZ A;  2R7Z J;  3NAU A;  3FK6 A;  1K83 J;  3BR2 A;  4M6V A;  4MO7 A;  4A3M J;  3HGY A;  2M34 A;  2L7Z A;  4MFE A;  2CUF A;  3ZQI A;  1EF4 A;  1D5Y A;  4FIS A;  4IHV A;  3TW7 A;  5F1J A;  1HDP A;  1LE8 A;  3MN2 A;  1GV2 A;  1JKO C;  2LY9 A;  1SAN A;  2LKX A;  2FQ4 A;  2O9L A;  1RKT A;  4A69 C;  2Y2Z A;  4JX5 A;  2E19 A;  4C2M J;  1ETW A;  2M2E A;  2Y9Y A;  4UUS A;  2HOS A;  2X9D A;  5E3L A;  1RES A;  3RZD J;  3M3Y J;  1TWA J;  1Q1V A;  1Z0X A;  1ZKG A;  2XGD A;  1AKH B;  1FIP A;  3BQZ A;  1MNM C;  2CUE A;  2YS9 A;  1JJ8 C;  4QIW N;  2R5Y B;  2XPW A;  2DMP A;  2ME0 A;  1OCT C;  3HOZ J;  3SJM A;  4NDL A;  2CU7 A;  2LLK A;  2E2H J;  3CDL A;  2NVX J;  1HOM A;  5JLW A;  2EBI A;  4HNV A;  2VPR A;  2H1K A;  2HDD A;  1BA5 A;  1JJ6 C;  3JRI A;  2LR8 A;  1ZR4 A;  4BY7 J;  3GTP J;  2JWT A;  3G1O A;  2EH3 A;  3HOW J;  1HF0 A;  1RPW A;  3TW6 A;  5GPA A;  2E2J J;  1UHS A;  5C4J J;  3UKG A;  3JRD A;  1U9O A;  3L1P A;  1K61 A;  1A6I A;  1GVD A;  2RAE A;  1MH3 A;  4UUS B;  3HKZ N;  4L5E A;  4BBS J;  5FKL A;  2FX0 A;  3JRF A;  2B63 J;  3LSP A;  1MBH A;  4IHY A;  4M3D A;  1U8B A;  1FIA A;  1HDD C;  2W48 A;  2JA7 J;  3BT9 A;  1TWG J;  4DYQ A;  5F0H A;  1VFC A;  1H89 C;  3A02 A;  4MIM A;  1G2H A;  1U78 A;  2MGQ A;  3LSG A;  2X6O A;  2I10 A;  4A3K J;  2ID6 A;  1VI0 A;  3MVP A;  1Y1W J;  1HLV A;  2E1O A;  2TRT A;  1ZTR A;  2X48 A;  1P7I A;  2DA7 A;  2DA6 A;  3IH2 A;  3E7L A;  3LSR A;  5IOY A;  5E3N A;  3M4O J;  4Y52 J;  2QF7 A;  2MW8 A;  1OJL A;  2CQQ A;  2M0C A;  3OSF A;  1TWH J;  3RQI A;  3F0C A;  4BXX J;  2HXO A;  1JUP A;  1ZGW A;  3GTM J;  4XK4 A;  1IJW C;  3OOU A;  4M3G A;  2HOT A;  3QPS A;  4XRS G;  2R93 J;  2CRG A;  3ZQH A;  5FKN A;  1ETV A;  3JR9 A;  2XPV A;  2NS8 A;  1NK3 P;  2L7M P;  1ETO A;  5DS9 A;  4D5F A;  3H3V K;  4C3H J;  2TCT A;  4D5C A;  3C2B A;  1QPI A;  3IH3 A;  5HOD A;  1B72 A;  2P81 A;  3BTJ A;  1NTC A;  2AO9 A;  1RR7 A;  2VUM J;  3FIS A;  2MG4 A;  3BG9 A;  1RKW A;  4V2G A;  1AU7 A;  4A93 J;  4XIC A;  1BL0 A;  3BQY A;  4M3B A;  5J1R A;  2LD5 A;  1I6H J;  1ENH A;  4J19 A;  1MBE A;  5M5X J;  2WAQ N;  1X2M A;  5IYD J;  2O8K A;  1H8A C;  1UG2 A;  2G0E A;  3JRG A;  5K7H A;  3JRE A;  5EGO A;  2K40 A;  2CJJ A;  2EZK A;  5IYB J;  2O7O A;  2ZB9 A;  3S2D J;  4JYK A;  2LFB A;  2DMN A;  4A3G J;  1IG7 A;  3Q0W A;  2R5Z A;  3DCF A;  1B8I A;  1F43 A;  3B6A A;  2Y0S N;  1QRY A;  1BW6 A;  5K7F A;  5FJ8 J;  4A3C J;  1ETQ A;  5IP7 J;  5F08 A;  3A01 B;  2COB A;  3WHC A;  3Q0V A;  3W6V A;  3Q0U A;  3S1N J;  4DZJ A;  2NVQ J;  3OSG A;  4AYB N;  1OFC X;  5M5W J;  3HOV J;  1MBK A;  2LTP A;  1MSE C;  1F36 A;  2DMQ A;  1WI3 A;  5BNG A;  2KDZ A;  1IDZ A;  1WH7 A;  4LOC A;  3OIO A;  4MFD A;  3GTO J;  4W97 A;  3K2A A;  1VND A;  1IGN A;  1LE8 B;  1VF9 A;  2AHQ A;  2M8G X;  5F27 A;  3S1R J;  5FKK A;  2QCO A;  5EG0 A;  1T56 A;  1TWF J;  2IBD A;  3WHB A;  5JLX A;  2N8G A;  2JJ7 A;  3I4N J;  4ABZ A;  3BG5 A;  5EGO B;  2EZH A;  3RKQ A;  3QPL A;  3A03 A;  2Y31 A;  1QVU A;  3HEF A;  1IRZ A;  1JUM A;  4B1R A;  3GTK J;  4A3D J;  2HYJ A;  1JTX A;  4FE7 A;  3HGG A;  4X1E A;  4I76 A;  4I6Z A;  1YRN A;  5F04 A;  2VI6 A;  4A3L J;  5EZG A;  1TWC J;  3ZQG A;  5E3O A;  3FKI J;  2IEK A;  3S14 J;  1T33 A;  1WCM J;  1POG A;  2IAI A;  5DTD A;  4G12 A;  2E2I J;  4A3F J;  1FJL A;  1NK2 P;  4DW6 A;  1LFB A;  1RET A;  2KT0 A;  3S1M J;  2H8R A;  4S0H B;  3BR6 A;  1JGG A;  2CQX A;  1ORK A;  2DJN A;  3D1N I;  1O4X A;  5FLV A;  3Q3S A;  4A3E J;  1LFU P;  2EZL A;  2XSD C;  4C3J J;  1JUS A;  1H88 C;  2R92 J;  2ELK A;  2K9N A;  4XRM A;  1PUF A;  1GDT A;  2JMW A;  4B3A A;  1DU0 A;  5EG0 B;  3GTL J;  1ETX A;  3SDG A;  3I4M J;  3ZOB A;  2LVS A;  1HCR A;  4A3B J;  2ECC A;  3O8H A;  5FKO A;  2JK3 A;  5GPC A;  2R0Q C;  4QTR A;  1WPK A;  2JN6 A;  4AUX A;  1YRN B;  4RDU A;  1MBJ A;  5IPA A;  5E3M A;  5GP9 A;  2NVY J;  2YUS A;  3HDD A;  5M3F J;  2DMU A;  2XPU A;  4A3I J;  3JRH A;  1IUF A;  3JRC A;  2L0K A;  1GT0 C;  3ZQL A;  1I3Q J;  2YU9 J;  1IC8 A;  4C3I J;  2DMT A;  3GTJ J;  3HOY J;  2EZI A;  5FLM J;  3ZQC A;  3GTQ J;  1QVT A;  1Y1V J;  2DN0 A;  5IP6 A;  2XB5 A;  2NVT J;  4BY1 J;  1ETY A;  4W1U A;  3LSJ A;  5IP9 J;  1BW5 A;  1MBF A;  4FE4 A;  3IV5 A;  5M5Y J;  1PUF B;  5J3L A; 
#chains in the Genus database with same CATH topology
 4IX7 A;  5J1U A;  2BVL A;  3GLX A;  2JA5 J;  1X4P A;  1ZLJ A;  3JTG A;  2YX4 A;  4HLY A;  3WGH A;  1LQ1 A;  1XCV A;  1YX3 A;  3ZMV A;  2KFD A;  4XON A;  1W7P B;  1RI7 A;  4KFC A;  4UUT A;  2QQA A;  3OYN A;  2D5V A;  1DUX C;  3L09 A;  4QPQ A;  2P7C B;  4CCJ A;  1J0R A;  1SFE A;  4PSX A;  1Y0U A;  3S32 A;  3SFZ A;  1WJ5 A;  2RVC A;  1XPX A;  4ENK A;  2VQH A;  4DBQ A;  4G6T B;  1WJE A;  2FEZ A;  2PN6 A;  2VBX A;  4G6D A;  2MAB A;  4LFU A;  4A5M A;  2M30 A;  4B44 A;  2HZT A;  2HQ5 A;  3CCU I;  2QWW A;  4L9T A;  4HA8 A;  3F8M A;  2J5P A;  5CVJ A;  4K2E A;  2FUG 2;  3LOC A;  1GUU A;  1BIA A;  3BZK A;  3AKZ A;  1LPQ A;  3IH4 A;  2YPR A;  3GLL A;  2PX9 A;  4ZZD A;  4ESB A;  3TL4 X;  1IV6 A;  3D5R C;  3I5U A;  2OTL I;  3G1M A;  1JTY A;  3AG3 H;  2BY3 A;  4JP0 A;  4FTH A;  5CVR A;  1U9N A;  2K9Q A;  4QWQ A;  2Q8K A;  2FNA A;  5CVV A;  2AS5 F;  4U0V A;  1BI1 A;  3HHH A;  4S05 A;  3I54 A;  1FLI A;  4G6Q A;  1B8I B;  2W85 A;  3LAJ A;  1W0U A;  2DA5 A;  1DU6 A;  3Q5F A;  2HTS A;  2YX7 A;  3OYF A;  3HTS B;  5K1Y A;  3DTE A;  2L54 A;  1K4S A;  2LP0 A;  3CTA A;  1R36 A;  3BR3 A;  2C6Y A;  2NOG A;  4NNJ A;  4F52 A;  4HRI A;  4HST A;  5L3C A;  4HG2 A;  3R0J A;  3HOX J;  2FE3 A;  2XAF A;  1OKR A;  2NS7 A;  1OCP A;  3IKV A;  4RB1 A;  5ICC A;  4NB5 A;  1O3T A;  4GFB A;  3VYU B;  3PO3 J;  2HOA A;  1U3E M;  2O8X A;  2XRL A;  4IF4 A;  2LH9 A;  5J40 A;  3RIR A;  4B4C A;  1S6L A;  2FOW A;  5EEA A;  2DA1 A;  1MSF C;  2R7U A;  3IP4 B;  4DYR A;  2OTJ I;  2CUJ A;  3ZRG A;  1DPU A;  1J5Y A;  3JRB A;  1KZH A;  1FC3 A;  5EDN A;  1FWZ A;  4BAY A;  2EIL H;  4LG0 A;  2QLZ A;  2VQG A;  2EWN A;  2OQG A;  4MLO A;  3RKX A;  2X1E A;  1T0F C;  4ZYD A;  4IHW A;  3RZO J;  4AU7 A;  4H4K C;  2HI3 A;  3KLN A;  4DJA A;  3EYY A;  1ZG1 A;  3HBL A;  1T39 A;  3ELK A;  4FQG A;  3QAH A;  1FTT A;  2WY8 Q;  4KT5 C;  4M74 A;  1ZQ3 P;  1AKH A;  1TNT A;  5H20 A;  2ZXJ A;  1Z91 A;  2CUZ A;  5J47 A;  3EUH A;  1ZR2 A;  3KYD B;  4EEF G;  2WC2 A;  4JX6 A;  5M3M J;  5LHH A;  1IDY A;  3SEZ A;  1YIO A;  2DA2 A;  1UZC A;  3BRO A;  1PJR A;  5KVR A;  3GTG J;  3KP2 A;  5KCM A;  4I99 C;  1QGP A;  1LFP A;  1OYI A;  3IAS 2;  5FLX Z;  2WAF A;  3QWL A;  4KIB A;  4XOR A;  1VQ8 I;  4AIH A;  4FET A;  1TTY A;  1M1E B;  3LFU A;  4HX7 A;  3TW7 A;  3MN2 A;  1GV2 A;  3WGG A;  1GXP A;  1JI8 A;  3K0L A;  4R1H A;  2E1N A;  2LY9 A;  2LKX A;  1UST A;  2K5C A;  1SVL A;  2GWR A;  2KMU A;  4J00 A;  2O9L A;  5CLS A;  1TW2 A;  1B4A A;  1V5E A;  2E19 A;  2M3A A;  2P7V B;  4JX5 A;  4A69 C;  1ETW A;  2Y9Y A;  1K78 A;  3DWL E;  1YS6 A;  3MEX A;  2X9D A;  4EJO A;  3S3N A;  4IO9 F;  5HNH A;  3JCU C;  5E8G A;  1VQ9 I;  2OAZ A;  5L3F A;  2ZJQ F;  1AKH B;  1QO0 D;  2Y0S A;  2ETH A;  4L9J A;  1LVA A;  5J8C A;  1DGW Y;  2F5C A;  3JTH A;  4BQN A;  3G73 A;  2DMP A;  1OCT C;  1FYK A;  1A36 A;  5EJC A;  3CLQ A;  1BC7 C;  1MMD A;  3E5U A;  2CU7 A;  1V54 H;  3V7C A;  2E2H J;  1UFM A;  4AYB A;  3R4K A;  3GF2 A;  1IN7 A;  2EBI A;  3ABK H;  3PSI A;  4XN0 A;  4N0B A;  5D6F A;  2KIU A;  4JK1 X;  2M4G A;  1MGT A;  1XGO A;  3MD2 A;  3S3O A;  1UJ8 A;  2K9L A;  3ABT A;  1WQ2 A;  4UB8 C;  3GTP J;  3I59 A;  4FX4 A;  4N9I A;  4GGG A;  1RPW A;  3DP7 A;  2H6C A;  4HLX A;  2CMP A;  3TW6 A;  2R3S A;  2P6S A;  1O7F A;  4CO8 A;  2EFO A;  2UXX A;  2Z3Y A;  4P9F A;  5E1X A;  1K78 B;  1GVD A;  4JOM A;  2RAE A;  3QP5 A;  4BBS J;  4L5E A;  1E0E A;  4ZTJ A;  1U2W A;  2JA2 A;  5FKL A;  2DFE A;  1FP1 D;  2IA2 A;  2EFP A;  4CA0 A;  1EA3 A;  2B63 J;  3T8R A;  1MBH A;  4L0Z B;  4NQW B;  3K4M A;  3CUQ A;  1X1P A;  4UNO A;  2JA7 J;  1TWG J;  4DYQ A;  5F0H A;  4BDY A;  4DOZ A;  1VQO I;  2MFZ A;  2X6Y A;  1FSE A;  3LSG A;  1O3Q A;  3I71 A;  1OR7 A;  1FYM A;  2X6O A;  2MLG A;  3MVP A;  1HLV A;  3QYE A;  2E1O A;  2TRT A;  1ZTR A;  4IPA A;  3IL2 A;  3IWF A;  2DA6 A;  3H5R A;  4CCK A;  4XRF A;  3E7L A;  1KYW A;  2VXD A;  4MTD A;  4IRI A;  2D1V A;  1YG2 A;  2JSC A;  2W1O A;  1SD4 A;  1G59 A;  3FMS A;  2M0C A;  3HHG A;  1S8N A;  1TWH J;  3RQI A;  3F0C A;  4BXX J;  4DGW B;  1S7A A;  2MD5 A;  1P6R A;  1YYV A;  2FML A;  3F6V A;  4XK4 A;  3BDD A;  1IJW C;  2BW3 B;  3B73 A;  3L2C A;  2QM3 A;  4U7D A;  3QPS A;  4XRS G;  2V1D A;  1PUE E;  3V4G A;  1UHW A;  2K27 A;  2STT A;  1TQM A;  2ICW G;  3JR9 A;  2R7T A;  3R61 A;  3H36 A;  4OAY A;  2K7L A;  4NBQ A;  4RGS A;  2L7M P;  2Z99 A;  3QPH A;  4Y4R A;  1MND A;  5DS9 A;  4C3H J;  3WU0 A;  3OYB A;  3C2B A;  3PSF A;  2MC4 A;  5HOD A;  4HQE A;  2XAG A;  2HVR A;  1Z05 A;  2P81 A;  5GTH C;  3S3M A;  1IZ1 A;  2HS5 A;  1RR7 A;  3E6M A;  3ZGK A;  3G3Z A;  2MYS A;  3FIS A;  3BG9 A;  2EIN H;  1UG0 A;  3GX4 X;  4LLN A;  2OV7 A;  4ZDL A;  3LFK A;  3SXY A;  3BQY A;  4FX0 A;  4CUG A;  1I6H J;  3FXQ A;  1J9I A;  2GIV A;  1BM9 A;  5M5X J;  4GRI A;  2WAQ N;  4YEL A;  3KCC A;  2IGN A;  3DTI A;  3OL4 A;  3JRG A;  1P9Q C;  1HKQ A;  2F4M B;  1SD7 A;  3HRU A;  4HYE A;  2ESN A;  2HZD A;  1LDJ A;  1VQP I;  3NWS A;  2XAS A;  2ZSH B;  2UXN A;  2ACJ A;  3FXK A;  2BBY A;  4KN7 X;  3Q0W A;  3JAM Z;  3M07 A;  4Y33 A;  1FY7 A;  2RKH A;  3SZT A;  3D5S C;  3B6A A;  2I8D A;  2P6T A;  5FJ8 J;  4XOP A;  3RQ4 A;  5IP7 J;  3A01 B;  3CDI A;  3G2B A;  5ILV A;  3PUB A;  1X1D A;  2H94 A;  3VWB A;  2ZFW A;  3Q0U A;  2K85 A;  3IRQ A;  4GYI A;  2CSO A;  1OFC X;  5M5W J;  1MBK A;  4G94 A;  2XHK A;  1RZ4 A;  3DPT A;  2DMQ A;  5BNG A;  2RV8 A;  3OIO A;  3GTO J;  4XKV A;  3SHF A;  2X1D A;  3K2A A;  1OCR H;  3WTZ A;  2BE5 F;  3LMM A;  1FPQ A;  1HKS A;  3JW4 A;  5DD8 A;  5F27 A;  1LE8 B;  2DOD A;  2QCO A;  4RLQ A;  3KX2 A;  1T56 A;  2DXI A;  1R1V A;  2IRF G;  2QKM B;  1F5T A;  3VOE A;  5DCM A;  3ZMU A;  1D3Y A;  5DD4 A;  3WHB A;  1T8I A;  2X0L A;  2N8G A;  2W00 A;  4ABZ A;  1A6Q A;  4IRG A;  1SFK A;  1D1C A;  4E7Z A;  2KIM A;  1QVU A;  2CS3 A;  3H5N A;  1JUM A;  5JR3 A;  3ECO A;  1C0W A;  2HQR A;  2KLO A;  2VI6 A;  5HLT A;  1BOA A;  3NRV A;  3E5X A;  4M6X A;  4ZH4 F;  5E3O A;  3FKI J;  2XAH A;  3C18 A;  4X0G A;  2X6W A;  3P9K A;  4DW6 A;  3TBI A;  4F91 B;  4XM3 A;  2HPI A;  4S0H B;  4Y17 A;  2R7V A;  2DJN A;  1UB9 A;  3E3V A;  3ISP A;  1P4X A;  5ICF A;  1SVM A;  2BXZ A;  3E0J B;  4BHB A;  4A3E J;  2OZ6 A;  2VC1 A;  2XUB A;  3LL7 A;  2XSD C;  1LFU P;  3CD6 I;  1ZYR F;  2OA4 A;  1ZGA A;  3ASO H;  3Q9V A;  2IP2 A;  2JMW A;  4B3A A;  1DU0 A;  3TOB A;  3GTL J;  2DT5 A;  3TO6 A;  1PP7 U;  4B09 A;  2R7X A;  3WTW C;  4MEY F;  2PMZ A;  2L9S A;  1OYW A;  2A3S A;  2JRM A;  3VSL A;  4E7S A;  4HDV A;  2DAO A;  1O3S A;  1XGM A;  1GHC A;  1E3H A;  3ZOB A;  1KGS A;  4BL0 B;  4IL6 C;  3OYA A;  2HDC A;  1YLF A;  3VFZ A;  3FMQ A;  1XCB A;  3ONQ A;  5HOO A;  3ZN0 A;  2R0Q C;  4QTR A;  3ABU A;  2PI0 A;  4F3Q A;  2LRE A;  1CF7 A;  2HR3 A;  5IPA A;  2KHM A;  3AG4 H;  2COM A;  2D2W A;  2XF6 A;  1RC9 A;  2RNJ A;  4I0A A;  1BJA A;  2NVY J;  5LGN A;  3AL0 B;  2EIM H;  4BS9 A;  5J4V A;  3BOQ A;  5HLG A;  2VJ5 A;  2KQR A;  4Z6Y A;  1E17 A;  1VQ4 I;  1N77 A;  4EJT A;  1D1B A;  4CCN A;  1IC8 A;  2NXN B;  4BXU A;  3J81 Z;  5FLM J;  3KP6 A;  1X1A A;  4LIT A;  2OCC H;  4OAZ A;  2PJP A;  4M9X A;  4YG2 F;  3T1B A;  2IW5 A;  3IWZ A;  5BQT A;  1XSV A;  4NHJ A;  2A6T A;  3E1S A;  3FHZ A;  4L18 B;  1TLH B;  3DU6 A;  3S93 A;  1ZHF A;  3UR3 C;  4C9Y A;  2FU4 A;  2M8E A;  3DEW A;  5LBQ A;  1P92 A;  5IYC J;  3HJE A;  2XF5 A;  2VKH A;  4HNU A;  4BE1 A;  2DA4 A;  2B9S A;  3CC7 I;  3HM5 A;  3J80 K;  2XGE A;  4XRS A;  4QPO A;  2OC6 A;  1Z3X A;  2DQL A;  2DYS H;  2FD5 A;  4IQ4 A;  4KT6 A;  3BWG A;  3GZ6 A;  1CF7 B;  1XDS A;  1T95 A;  4EQQ A;  1FTZ A;  2O3F A;  2HDW A;  3K4K A;  1JT0 A;  5F0F A;  2DCE A;  1ODD A;  3MAJ A;  5J1Y A;  3O8G A;  2XGC A;  4I01 A;  2G9W A;  2QGU A;  1B59 A;  2ZSI B;  1MMG A;  2ZJP F;  4IHX A;  2XAJ A;  2XAU A;  2OPT A;  1OCZ H;  2QSF X;  2NNY A;  4ZTF A;  5L3D A;  1HXD A;  3S2H J;  5K7Z A;  2ZJ2 A;  3CCM I;  2XB0 X;  1Y8Q B;  1YW7 A;  2JA6 J;  5HS8 A;  3HB9 A;  3M7G A;  2F5E A;  2X51 A;  4U0W A;  4ESJ A;  1W1W E;  3M1E A;  4BJ5 C;  3HPG A;  2LF8 A;  2A07 F;  2ZJR F;  1YFH A;  3RKW A;  3S16 J;  1W7P D;  1Z7L A;  2F5D A;  4MHG A;  5E17 F;  1IW7 F;  4IJA A;  2LY2 A;  5F64 A;  4BUP A;  2KPM A;  3ZQF A;  3KET A;  3SFI A;  2DA3 A;  5FRO A;  5B66 C;  4D7M A;  3LSK A;  4Y7N J;  2EIK H;  2AXL A;  1SMT A;  4UVB A;  1R49 A;  1DDN A;  1CQT A;  1XSX A;  4II3 A;  2KRC A;  3CLO A;  3WTV C;  5HDG A;  2MSY A;  4AID A;  4X6A J;  3LSM A;  1VQM I;  3CJT B;  3VYR B;  4HF0 A;  4CCL A;  4WWC A;  1XG1 A;  4LD5 A;  3KPH A;  3GBG A;  2XVC A;  3GWZ A;  1TZL A;  5L3B A;  4LIU A;  3JAM K;  1PYV A;  2J5O A;  3OMY A;  2Z9O A;  3GCM A;  4IEJ A;  3GZN B;  3PNV A;  4D0P A;  1YI2 I;  2R7W A;  1MKM A;  3IHU A;  1VTN C;  3PJR A;  3CQZ J;  1B9N A;  3BJ6 A;  3R0A A;  3H3U A;  4V19 K;  2DFH A;  5GAE J;  2FOK A;  5FGM A;  1I1G A;  3FM5 A;  4A3J J;  1I3A A;  2IA1 A;  1TT5 B;  3BTC A;  3F21 A;  3TP3 A;  3VEP A;  2JUC A;  1F4K A;  3MFK A;  1HKT A;  5C44 J;  2Y9Z A;  4HSR A;  4BHC A;  3J7A Y;  1FSH A;  4BDZ A;  2WV1 A;  1E3O C;  2AQE A;  5FKM A;  4ZC3 A;  3TED A;  4L5I A;  2OQR A;  4MTE A;  4BQO A;  2V1X A;  1EKE A;  2WTE A;  4EM2 A;  3H3Z A;  3KP5 A;  2DO7 A;  4OIQ F;  5GAH J;  9ANT A;  2NNN A;  3HSF A;  2EPF A;  2EV5 A;  3GUD A;  2OCE A;  3FZV A;  2K02 A;  5ICG A;  3DF8 A;  3PIP F;  3FBI B;  5IOZ A;  2V6C A;  3NAU A;  3FK6 A;  2XDV A;  4MO7 A;  2BY2 A;  1BR2 A;  3DXJ F;  5B5E C;  2ELJ A;  3L2U A;  2M34 A;  3TQN A;  4CGZ A;  3PUF A;  4OMY A;  4MFE A;  2KIF A;  3ZXS A;  3ZQI A;  1ON2 A;  1D5Y A;  1VZ0 A;  1O3R A;  3OYC A;  4ZYH A;  1ZRF A;  1RIO H;  2G7U A;  1WJB A;  2FQ4 A;  2H1L A;  4NC8 A;  2Y2Z A;  4A2U A;  2WY7 Q;  1SD5 A;  2JTV A;  2V4J C;  4C2M J;  3FXJ A;  2VC0 A;  1ZG3 A;  2K9M A;  1TWA J;  1Q1V A;  4IHS A;  1FMV A;  2ZNZ A;  1FZP B;  4L9V A;  4PSW A;  3RTR A;  1Z0X A;  2EFW A;  1ZKG A;  4L0Y B;  3I53 A;  2FA5 A;  3OIP A;  3PIO F;  2ME0 A;  2B0L A;  4NDL A;  3CUQ C;  3ROU A;  1OCC H;  2LLK A;  1XMA A;  3CDL A;  1YW9 A;  4RB3 C;  1ZAO A;  3CCS I;  4PGH A;  4E6K G;  2WV0 A;  1L3L A;  2VPR A;  1OR7 C;  1JXS A;  1DPR A;  2KRF A;  3DTK A;  1BA5 A;  3FMR A;  2DOA A;  2O61 A;  2LR8 A;  4ZYG A;  1R58 A;  2JWT A;  3G1O A;  5KAI C;  1UAA A;  1HF0 A;  2L4M A;  1DP7 P;  3F8B A;  4HOB A;  5TJJ A;  3DBL B;  3J81 K;  4YFN F;  3OYJ A;  4OU0 A;  2E2J J;  3UKG A;  2R7D A;  1DGR M;  5FD5 A;  3HG9 A;  3HKZ A;  5J6X A;  2K4J A;  3HKZ N;  3QOD A;  3CF2 A;  2CQ7 A;  2DK5 A;  4RB0 A;  1AA7 A;  3SQN A;  1T98 A;  3LSP A;  4IHY A;  3M8J A;  1FIA A;  4DBR A;  2W48 A;  2CFO A;  3BT9 A;  3FDY A;  3OYK A;  2ZXH A;  1G6N A;  2H6B A;  1G2H A;  1U78 A;  4RM2 A;  2MGQ A;  2GQQ A;  2I10 A;  4A3K J;  2ID6 A;  3FKJ A;  2A6E F;  2V79 A;  1P4A A;  2OZU A;  2DDA A;  2X48 A;  2UV1 A;  3VSK A;  3VOD A;  1P7I A;  2L7K A;  3DFG A;  4U0Y A;  1REP C;  2DA7 A;  2QQ8 A;  3MKW B;  3ZPL A;  3HOS A;  1LDK B;  1TL8 A;  3T0Y A;  5IT9 Z;  3CME I;  2D45 A;  2CH0 A;  3M4O J;  2HU9 A;  2OJE D;  4A0X A;  4AIK A;  3S8P A;  3SZP A;  3BG7 A;  5BOX A;  1SFU A;  1ZEL A;  4BAC A;  2CQQ A;  3OYH A;  1DP3 A;  3OSF A;  2CYY A;  2HXO A;  3QRF F;  3ZMT A;  1ZGW A;  3DBH B;  1XB4 A;  3GTM J;  4IVN A;  1QA6 A;  4LLL A;  3F3X A;  4GXO A;  4AD9 A;  2CRG A;  4IXA A;  1W5T A;  5CVU A;  3ZQH A;  5H2F C;  4EM0 B;  2Z5U A;  1HSJ A;  5DYM A;  1NK3 P;  3EYI A;  4D5F A;  2JVG A;  2DT7 B;  2GOX B;  3HYI A;  2QZ8 A;  3QPT A;  1V5G A;  3E97 A;  1B72 A;  3V8K A;  2LF7 A;  2DFF A;  4M6Y A;  3V7S A;  4XLH A;  4Q5S F;  2X4H A;  3BTJ A;  3L2W A;  5BS6 A;  2VUM J;  4F7Z A;  1RKW A;  5FB2 A;  2QBY A;  2HKX A;  1YJN I;  1BL0 A;  3FBN B;  3LST A;  5J1R A;  3K4N A;  5LHG A;  4LG0 B;  4E7J A;  1X2M A;  2O03 A;  2GXB A;  5IYD J;  5D4S A;  3AG1 H;  2B7E A;  2WBM A;  2W57 A;  2RGV A;  5EGO A;  4N4N B;  2EZK A;  4IHT A;  2KJC A;  2ZO4 A;  2O7O A;  1JE8 A;  2LG4 A;  3U1K A;  2LFB A;  4XMY A;  2Y75 A;  2E60 A;  2R5Z A;  1S9H A;  2HQA A;  3HTU A;  3WU2 C;  3LA2 A;  3V8L A;  1F43 A;  3U21 A;  4G7O F;  2Y0S N;  1SAX A;  4A3C J;  1UHM A;  3ZMZ A;  3WHC A;  4Y3O A;  3ML6 A;  3Q0V A;  4XNF A;  1ONV A;  4A0Y A;  1STZ A;  5LEK A;  4RAY A;  2VBY A;  1TBX A;  3KEO A;  3LA3 A;  3O6B B;  4DZJ A;  2HVS A;  2A05 A;  3OSG A;  2QEX I;  4AYB N;  4A6E A;  3CCE I;  2LTP A;  4MGR A;  1KQ9 A;  1KYZ A;  2DLL A;  2JPC A;  3AL0 C;  1XSD A;  1I39 A;  2KDZ A;  4LK0 F;  4XL9 A;  3SZG A;  2M4K A;  2Q2E A;  1KU7 A;  5K5O A;  4ENJ A;  3OS1 A;  4OMZ A;  3RYP A;  2QBY B;  1HST A;  2LY1 A;  1BI0 A;  4BEH A;  2M8G X;  4UV9 A;  3S1R J;  5FKK A;  1KQ0 A;  5EG0 A;  3K1P A;  3W6J B;  2CFX A;  3KP3 A;  3BPV A;  1TWF J;  2LKS A;  3CO6 C;  2L02 A;  2JJ7 A;  3I4N J;  1BR1 A;  5EGO B;  1KON A;  1W5S A;  2EZH A;  5KHD A;  3I56 I;  4M71 A;  3RPU A;  3RKQ A;  2X6X A;  1Y8R B;  1HA8 A;  1A04 A;  5K5R A;  2L5Q A;  3FXU A;  4EGY A;  3KE2 A;  2PMH A;  4B1R A;  3OYE A;  1N25 A;  2HYJ A;  1K6Y A;  3KFW X;  2K3P A;  2VBZ A;  1YRN A;  1ZRD A;  3DKW A;  2P5L C;  4A3L J;  3WE3 A;  4OIO F;  2L2O A;  1MD0 A;  3ZQG A;  1TWC J;  4HX8 A;  4CDG A;  1MMN A;  2IEK A;  3LSI A;  4R8H A;  2MA3 A;  3COA C;  2UWM A;  4LJZ F;  2IAI A;  4G12 A;  4HF1 A;  2KZV A;  4A3F J;  1XX5 A;  5J8F A;  3K6G A;  1YW8 A;  4RGU A;  3H9J A;  2KT0 A;  2H8R A;  1XN7 A;  4LB6 B;  3SDB A;  3BR6 A;  3ULQ B;  5HNF A;  2BHZ A;  4HDU A;  1XMK A;  2IJL A;  2XKP A;  3FXM A;  5BPD A;  2Q2E B;  3MMY B;  1O4X A;  4C3J J;  3KP4 A;  3I59 B;  1JUS A;  2R4G A;  3MZH A;  2DU9 A;  4BEH B;  1PUF A;  4C2T A;  5GAG J;  5EG0 B;  1BOB A;  1ETX A;  4WF2 A;  2XC7 A;  1BR4 A;  2K3F A;  1HW5 A;  4OOI A;  3M8E A;  3IRR A;  2VT3 A;  3QOP A;  2ZNY A;  3VDX A;  3O8H A;  2XRO A;  4ETS A;  1WZ2 A;  5GTI C;  5FKO A;  1HC8 A;  2QKL B;  3ERM A;  2EK5 A;  1ZG5 A;  3CUQ B;  2JN6 A;  4AUX A;  4IOC F;  4PZJ A;  1YRN B;  5CJ9 A;  2WAD A;  3PNT A;  2CGP A;  4B8X A;  4G8X A;  5GP9 A;  4E7I A;  2H27 A;  1V55 H;  2YUS A;  4LK1 F;  4KNY A;  5M3F J;  2DMU A;  2XPU A;  4CYD A;  5LGT A;  4A3I J;  3K4B A;  1GT0 C;  4UVA A;  3EUK L;  4Z2Y A;  2YU9 J;  4C3I J;  4BE2 A;  2DMT A;  4I0B A;  2DTR A;  1QVT A;  1N78 A;  5IP6 A;  4LG3 A;  2NVT J;  1ETY A;  4RS8 A;  4W1U A;  1MZB A;  3ASN H;  4U88 A;  5LD2 C;  2V1N A;  3E6B A;  4J01 A;  1ZAR A;  4FE4 A;  4M72 A;  4EJV A;  2EA4 A;  5M5Y J;  1PUF B;  4EGZ A;  4S04 A;  3IKT A;  1S3J A;  3BTL A;  4MEX F;  3SEQ A;  1TQP A;  1FOX A;  1QPM A;  3QU3 A;  4CYC A;  3V42 A;  3LQQ A;  3S17 J;  5EZH A;  3T8T A;  2VE9 A;  4I02 A;  2HNH A;  2K9S A;  2V9V A;  3H9Q A;  3P9I A;  3HXL A;  4ITV A;  1IRX A;  3OY9 A;  2Y30 A;  4F92 B;  1Z77 A;  4BJ6 C;  2NOJ B;  3W2A A;  1EH7 A;  3CP8 A;  1A5J A;  2L9R A;  3BJO A;  1FEX A;  4EV0 A;  4MQV A;  1BJZ A;  2E7X A;  2FJ1 A;  2ZXW H;  3OR1 C;  4P55 A;  6PAX A;  4YFK F;  3HOU J;  1QZY A;  4XKW A;  4M9Z A;  3F8C A;  3CCQ I;  2DOF A;  4QSH A;  3CJN A;  1R9T J;  3K2Z A;  1WSU A;  4KYW A;  1G3W A;  4HZF A;  5H6R A;  2LK2 A;  3NWT A;  4AC0 A;  2RQQ A;  4E7L A;  2XV4 S;  2HXI A;  4XLC A;  1JKQ C;  1WGX A;  2OF7 A;  1JKP C;  2QSG X;  3BTI A;  2XIG A;  4PCQ A;  3LSH A;  2BOL A;  3W2V A;  3C3W A;  5JI6 A;  3CCL I;  1R7J A;  4RA2 A;  3FF5 A;  3HRT A;  3QYF A;  3OYG A;  4AVZ A;  1SD6 A;  2IS6 A;  1KU9 A;  4G7Z F;  4NC7 A;  2HWV A;  3L9F A;  4CYC B;  1Z9C A;  1WJC A;  2L7F P;  3FX3 A;  1OMI A;  3N97 A;  2VQL A;  3MKL A;  4P1W A;  5FLX K;  4PFO A;  2RRE A;  5L3G A;  2GM4 A;  2GLO A;  2JA8 J;  4HAM A;  3NAR A;  4RLF A;  3BR0 A;  3NEU A;  4XBF A;  2L9N A;  2VLA A;  1WH5 A;  1XC5 A;  2Z1D A;  3HPH A;  1Q1H A;  3K4L A;  1AHD P;  5EYR A;  1VQ7 I;  2IT0 A;  2VE8 A;  1GV5 A;  5C4X J;  4HEA 2;  3EET A;  4KMF A;  3WTU C;  3PO2 J;  4M3E A;  5DCM B;  2P5V A;  2VIX A;  2ZBK A;  1MH4 A;  3BZ6 A;  3B02 A;  1ETK A;  1IN6 A;  5DDG A;  3H0D A;  1G4D A;  2PMZ N;  3C2G A;  5K5Q A;  1ACI A;  3K1M A;  3S1Q J;  4WCG A;  4MNU A;  3P7N A;  2VAS A;  2KKO A;  4GCV A;  5F0C A;  2XF7 A;  2XAQ A;  1YE9 A;  1G8X A;  2AXT C;  5HVQ C;  3WGI A;  2F4I A;  5CQG A;  2BEO A;  4YIF A;  1RRJ A;  4YRV A;  3ABM H;  3BR5 A;  3PM1 A;  1XDU A;  3FIW A;  1XS9 A;  4XLA A;  1U5T A;  2GZW A;  2IXS A;  1X2N A;  4FHT A;  5E1Z B;  5IT3 A;  2DPD A;  2NRA C;  2P0W A;  2I5U A;  4UVC A;  3G4S I;  4XLE A;  2GOM A;  2JQ7 A;  4CXF A;  3CJQ B;  2W82 A;  4ZJZ A;  5C3E J;  2CWE A;  2TDX A;  2R7S A;  2E7W A;  2VJI A;  2GXG A;  4B3X A;  5F1R A;  1ITY A;  2PQ8 A;  2DTZ A;  5A2Q Z;  3TDU C;  4Y13 A;  1D8K A;  2XSJ C;  1Y39 A;  1FNN A;  1ZGJ A;  2R7Z J;  4M6V A;  3GFI A;  3HGY A;  3L2Q A;  2CUF A;  2KIQ A;  4LB5 A;  1EF4 A;  4FIS A;  4BU2 A;  3U9G A;  5F1J A;  1D5V A;  5LHI A;  3G6E I;  2R7Q A;  2EV6 A;  1QNT A;  2A61 A;  5E79 C;  2HEO A;  5EEG A;  3DEU A;  1HQC A;  1FOK A;  1MIJ A;  3AFH A;  2M2E A;  1IRG A;  2DK8 A;  4UUS A;  3HRS A;  4HQM A;  1IAW A;  2HOS A;  1A35 A;  3PFY A;  1LB2 A;  3M3Y J;  4E7H A;  4G7H F;  1IO2 A;  5DV5 A;  1FMW A;  2E35 A;  2DOE A;  3LQR A;  2CUE A;  1R5G A;  2YS9 A;  1JJ8 C;  3U1D A;  2WAE A;  4L5J A;  1X4O A;  2CQN A;  4LMY A;  1B1B A;  1E2X A;  4CSW A;  2PMU A;  1ZLK A;  2OU2 A;  3E6D A;  3EQL F;  3P5J A;  2K4B A;  2NS0 A;  2V9K A;  2RN7 A;  2RC4 A;  4RMN A;  3ABL H;  5TIS C;  5ILU A;  3DPU A;  2LBF A;  2NVX J;  2UZK A;  4BGD A;  3OL3 A;  2VQC A;  2A5W A;  3PNY A;  1K6O A;  1AWC A;  1ZR4 A;  2F5V A;  4BY7 J;  1FP2 A;  3W6V A;  2EH3 A;  1T08 B;  2P8T A;  4D1Q A;  4PJN A;  2DQR A;  2RQP A;  1K79 A;  3C2H A;  1S29 A;  3L2R A;  3C1D A;  2HTJ A;  4CCO A;  2A5Y B;  3L1P A;  5F6F A;  1H9T A;  2P4W A;  1A6I A;  1K61 A;  2PLY A;  4UUS B;  3CC2 I;  1X1C A;  3RKY A;  4FT8 A;  2FX0 A;  1X3U A;  1LDD A;  1YOV B;  3FXL A;  2ZCW A;  4BE0 A;  5D8K B;  3X2Q H;  1U0J A;  3ZCO A;  4HBL A;  3GME A;  4M3D A;  4ZZL A;  1U8B A;  1HDD C;  3N05 A;  1EH6 A;  2V6E A;  4C30 A;  4F55 A;  1H89 C;  4ZDO A;  4YFX F;  2KDO A;  3L7W A;  3V7R A;  4LGW A;  4PJL A;  1F9N A;  2IGM A;  4PJ0 C;  2EFN A;  2WWY A;  4IQJ A;  2ELH A;  3A0H C;  1VI0 A;  3KYC B;  3KZZ A;  2MH9 A;  1FBQ A;  2DDB A;  1BC8 C;  4PJJ A;  1G3Y A;  4Q4Z F;  2QUF A;  2ZFU A;  1PVE A;  1X1B A;  3OOP A;  2FNP A;  2VON A;  1OLT A;  3A0B C;  4A6D A;  1SC7 A;  1FYL A;  4Y52 J;  5LEJ A;  3I64 A;  1MDM A;  3GFM A;  1D0Z A;  1FT9 A;  1YX5 A;  3HUG A;  4EAT A;  4AIJ A;  4A5N A;  3OOU A;  4YIR X;  2CO5 A;  2HOT A;  1YO5 C;  1V3F A;  2HFH A;  4XSZ F;  2KJB A;  3K4C A;  3VYT B;  1X3Z B;  2HKO A;  3G71 I;  1B6A A;  3OS0 A;  2FBK A;  2P5K A;  3HZJ A;  2CG4 A;  2XPV A;  1R71 A;  4KMU X;  2QQB A;  2ZXI A;  1ETO A;  3DKX A;  1S72 I;  2VKD A;  2TCT A;  4D5C A;  2BYV E;  1USS A;  1QPI A;  3IH3 A;  1GVJ A;  2IGK A;  4O3M A;  3PL8 A;  2IS2 A;  3E5Q A;  2QQ9 A;  4I2O A;  2M7B A;  3ECH A;  3OYD A;  2KP6 A;  3K9T A;  3MKY B;  1AU7 A;  4A93 J;  4A12 A;  4WX9 A;  3J7A O;  4XIC A;  1ZN2 A;  4M3B A;  3MKZ A;  2LD5 A;  3DKY A;  5BMZ A;  1ENH A;  4J19 A;  3KYL A;  1MBE A;  1TQI A;  1T2K A;  4E7K A;  4KN4 X;  1D0X A;  1UG2 A;  2O8K A;  2ESH A;  1MDM B;  2Z2S B;  3MWM A;  3JSP A;  3JRE A;  2FF4 A;  2CJJ A;  1S5L C;  2FQ3 A;  3HUG B;  2Q1Z B;  2ZB9 A;  2BXY A;  2CV0 A;  2FBH A;  1WJD A;  3W6K B;  3H5A A;  4UY8 I;  3DU5 A;  1MMA A;  1B8I A;  1IXC A;  2L3D A;  3U2R A;  2LRD A;  2H09 A;  4M9S A;  2Z16 A;  1K7A A;  2COB A;  5AIP A;  2IS1 A;  3DLL F;  3S1N J;  2LC2 A;  2VN2 A;  4QLC U;  2NVQ J;  1UCR A;  1MSE C;  3GXO A;  1FOW A;  1F36 A;  2ZME A;  1IRF A;  5D5V B;  3CZ6 A;  4P5O A;  1WI3 A;  1J75 A;  1RNL A;  3ZR8 X;  1IDZ A;  1WH7 A;  3F23 A;  4LOC A;  4MFD A;  1BN5 A;  4W97 A;  2GXA A;  5IY5 H;  2HOE A;  3R60 A;  1IGN A;  2EV0 A;  2W25 A;  2IBD A;  2IGO A;  5E20 A;  5JLX A;  5D5U B;  3GFL A;  4EVI A;  5A2Q K;  1R22 A;  4RM3 A;  5JHU A;  3ZP5 A;  3QPL A;  4XLF A;  3BPX A;  1IN8 A;  1VQK I;  2Y31 A;  3I9V 2;  3HEF A;  2VJJ A;  3GTK J;  4FE7 A;  2OBP A;  4I76 A;  4I6Z A;  5F04 A;  4EMS A;  3RJP A;  2GIZ A;  2E1C A;  4KDP A;  3T5X A;  3UNG C;  2VXZ A;  2WA0 A;  1PDN C;  1T6S A;  4HPQ A;  3S14 J;  2EFQ A;  4KIG A;  4XKC A;  1YTY A;  1OCO H;  1FJL A;  1RET A;  3I3L A;  1V5F A;  2OUM A;  4YII A;  1J59 A;  3O3K A;  3BC8 A;  4CHU A;  2R7O A;  2ZME B;  1LEA A;  1ORK A;  1IN5 A;  2MH2 A;  3D1N I;  4HV5 A;  1I1S A;  3CCV I;  4TV7 A;  1QHH D;  3Q3S A;  5D5W B;  1MW7 A;  2EZL A;  2CV1 A;  1H88 C;  4ASN A;  2ELK A;  1J09 A;  3GEZ A;  4XRM A;  4HNT A;  4IOA F;  4KJZ A;  4KUM A;  1BI2 A;  2XRN A;  1YS7 A;  3BLY A;  2E36 A;  5E18 F;  2MLK A;  1WI9 A;  3A1Y A;  3RSN A;  2NAZ A;  1LJ9 A;  2VPL A;  3IUO A;  1YIT I;  5DCF A;  5CKT A;  2CV2 A;  2JZY A;  4A3B J;  2LVS A;  1HCR A;  2IS4 A;  1Z1D A;  3KZY A;  1YJ9 I;  3CUO A;  4PFP A;  1R5I D;  2MD0 A;  4RAF A;  5GPC A;  1SEU A;  1VQL I;  1WPK A;  3GYH X;  3K1N A;  2L9V A;  1MBJ A;  3OV8 A;  1JHF A;  2IPQ X;  5HLI A;  3DBR B;  3HDD A;  2BHY A;  3QOE A;  4O6J A;  1FX7 A;  3D5L A;  3ZMD A;  3HC7 A;  2R7F A;  2FMY A;  2XKO A;  3JRH A;  2VB6 A;  1NHA A;  2L0K A;  1D1A A;  3GTJ J;  2AQF A;  2EZI A;  3DPL C;  4MQ9 F;  4RAZ A;  3ZQC A;  1RR8 C;  3GTQ J;  1Y1V J;  1KU3 A;  3I55 I;  2XB5 A;  1ULY A;  4BY1 J;  5IP9 J;  1BW5 A;  4UV8 A;  3F6O A;  1MBF A;  3IV5 A;  3WTS C;  4RBO A;  3WU1 B;  1MJB A;  3BCB A;  3M9A A;  2W4S A;  2RNG A;  4PK4 A;  2M1B A;  4CH7 A;  3CCY A;  2RDP A;  3CC4 I;  2VKV A;  3RPU D;  2W7N A;  3REO A;  5B1A H;  2GA2 A;  1W4M A;  5HDK A;  2K86 A;  4DZP A;  3CMY A;  2ME6 A;  1KA8 A;  2JT1 A;  1I50 J;  1SFX A;  2VKE A;  1GLN A;  3DQV C;  3B6C A;  5LRS A;  2ID3 A;  4XOT A;  5DM6 F;  4DYC A;  5KNL A;  3HSE A;  2LDU A;  3CMM A;  5LFA A;  1B72 B;  5DM7 F;  2E34 A;  1P4W A;  1TC3 C;  5B3S H;  4P96 A;  3K4J A;  2FXA A;  3PFI A;  4PGG A;  3H0G J;  5EEH A;  1JT6 A;  4NQW A;  4ZYA A;  4BKX A;  2FRH A;  1MMS A;  1IV8 A;  1HW1 A;  4BJT A;  3NQO A;  4XLN F;  1W5C C;  3CF5 F;  2YR2 A;  3I58 A;  4JX4 A;  2PFB A;  3BCA A;  1UEL B;  3DEE A;  4RGR A;  1JKR C;  4OIP F;  4BQQ A;  3WTT C;  1Z21 A;  3LAP A;  2H8W A;  1S7E A;  2F4O B;  2LNB A;  2GBY A;  1X3W B;  2CW7 A;  1NH3 A;  5DEQ A;  3KZI C;  2HYF A;  1R1T A;  1H9G A;  1IXS B;  2R5Z B;  3ESW B;  4PUS A;  3HOT A;  3FXO A;  3VB2 A;  2M5W A;  3CMA I;  4XN3 A;  5JVT A;  1VQ6 I;  4B47 A;  1RUO A;  4D7N A;  1H0M A;  2GAU A;  4LLG F;  3CCR I;  2LMD A;  4B43 A;  2LYC A;  4I09 A;  4XKB A;  5FD6 A;  3TO9 A;  3RI4 A;  4JQF A;  2BW3 A;  2M9H A;  3TP0 A;  1ZK8 A;  4GYG A;  1P7J A;  3GO5 A;  2DYR H;  1U5T C;  2M45 A;  3BG3 A;  1KU2 A;  3QQA A;  3QYB A;  3EDP A;  3K7A J;  4BH9 A;  2QSH X;  2HPM A;  1JHH A;  2A69 F;  2JSP A;  5CQE A;  3P9C A;  1K4T A;  1HW2 A;  4FAS D;  1U8R A;  5LLQ A;  3D0S A;  4PDK A;  3G1L A;  5HS7 A;  4Q47 A;  4I98 B;  2EQR A;  3CO7 C;  2X85 A;  1N75 A;  2PG4 A;  3K10 A;  3LNQ A;  4M3F A;  1APL C;  1LKX A;  1Y0N A;  1D8J A;  3O2P E;  5H6Q A;  1EV7 A;  1MNE A;  3J80 Z;  2M7A A;  2WB1 A;  3BJA A;  3C7J A;  4OIN F;  1G3S A;  3AG2 H;  2WB1 N;  3QP6 A;  3FXR A;  3WTY C;  4ZDP A;  3A2K A;  3JRA A;  2BY1 A;  1X58 A;  5EF6 A;  5D5X B;  1NG7 A;  5CVI A;  5E1W A;  3WE2 A;  1I6X A;  2YSR A;  3V8J A;  3VPR A;  3KEY A;  1Z7U A;  3S15 J;  3F8F A;  3WG9 A;  3F8N A;  4XID A;  1MBG A;  2D1H A;  3I4P A;  2EJR A;  3FK7 A;  1G3T A;  3N4M A;  2STW A;  4AM3 A;  3CCJ I;  2FBI A;  2R5Y A;  3H35 A;  3TKY A;  5DUI A;  1UMQ A;  3A01 A;  1FBS A;  2EA2 A;  4ZYE A;  3J7Z I;  2ECB A;  2OD5 A;  2R7R A;  4H0E A;  2V26 A;  2FSW A;  1X19 A;  3TMO A;  4BBR J;  4V2F A;  4FCY A;  3BR1 A;  3EUA A;  1IXR C;  2L01 A;  1SFO J;  1W0T A;  3WOD F;  3KP7 A;  1K83 J;  3BR2 A;  4GDF A;  4HW0 A;  1Y6I A;  3BZC A;  5JHF A;  4A3M J;  4E70 A;  4HX4 A;  4GO1 A;  4PJM A;  2L7Z A;  2JPB A;  3EPZ A;  2DPU A;  2QA4 I;  4IHV A;  1T0F A;  1HDP A;  1LE8 A;  4D9J A;  1JKO C;  2WAQ A;  1QU3 A;  1EH8 A;  3DV8 A;  1SAN A;  3GZ5 A;  3MCZ A;  2M87 A;  1RKT A;  5IT9 K;  3DLA A;  4P9U A;  2Q0O A;  4LIV A;  2VOD A;  2L4A A;  3W3C A;  3FWE A;  4CCM A;  3TOA A;  5E3L A;  3K70 C;  2QYO A;  3ZMS A;  5AON A;  1RES A;  3RZD J;  1W36 C;  4OWR B;  4N4O B;  1BI3 A;  1GXQ A;  2IVM A;  2VJ4 A;  3FHN A;  2XGD A;  1FIP A;  3BQZ A;  1MNM C;  4BYY A;  2E71 A;  3M8F A;  1J2X A;  5LRR A;  4QIW N;  2R5Y B;  1TT0 A;  2XPW A;  3HOZ J;  3SJM A;  4KA4 A;  1U6G A;  4RAG A;  1MJA A;  4DIQ A;  4RB2 C;  1QZE A;  3I0T A;  1WJF A;  3MZY A;  1B9M A;  5J4Y A;  1HOM A;  5JLW A;  1I27 A;  4CZC A;  4HNV A;  2EB7 A;  2CW8 A;  3ZQQ A;  2H1K A;  3L00 A;  5D6E A;  1XGS A;  5TGT A;  1XD7 A;  2E1M C;  2HDD A;  1JJ6 C;  3KLO A;  3JRI A;  4JBA A;  2MBF A;  1PP8 F;  2M0M A;  2KZG A;  2DBB A;  3RDI A;  3H9G A;  2VOP A;  3HOW J;  1J7K A;  1WJA A;  2PJR A;  1TP4 A;  1SVO A;  1XMX A;  2HYG D;  5GPA A;  2CQK A;  2F2E A;  5KAF C;  5L3E A;  4WK8 F;  4E4H A;  4HF2 A;  1Z6T A;  1Y56 A;  1UHS A;  4BXF A;  5C4J J;  3OYM A;  3JRD A;  1U9O A;  1QHG A;  1MH3 A;  5KK1 A;  3RCO A;  2ISY A;  5D4R A;  1S7O A;  1FOY A;  4IZZ A;  4XR6 A;  3JRF A;  4R79 A;  4XSX F;  4ON0 A;  4BQA A;  2DFI A;  3CP2 A;  1Z3Y A;  3OR2 C;  2KIS A;  5FO5 A;  1TW3 A;  1VFC A;  2Y0M A;  3LA7 A;  4UXN A;  3A02 A;  4MIM A;  3W2W A;  4ENN A;  1YHQ I;  1SAU A;  2BZT A;  3IAM 2;  3A4C A;  1HBX G;  4Y15 A;  5HS9 A;  1Y1W J;  1ZRC A;  2KL4 A;  3IH2 A;  1LVK A;  1XGN A;  3LSR A;  5IOY A;  2XGX A;  5E3N A;  1F1Z A;  3Q9S A;  5JFR A;  5D8L B;  2F48 A;  4RGX A;  2QF7 A;  3AAF A;  2MW8 A;  1OJL A;  4BNC A;  1ERD A;  1R4M B;  2PJR B;  1IF1 A;  2Y69 H;  4KIS A;  3FM3 A;  1JUP A;  2VBW A;  4IRH A;  1WHU A;  1P2F A;  5BPI A;  2EIJ H;  1R6R A;  3GFJ A;  2QEN A;  4M3G A;  2F6C A;  3KIO A;  5ERI A;  4UHT A;  1FBU A;  3GW2 A;  2R93 J;  1IUY A;  3L2V A;  1JGS A;  4ESF A;  5FKN A;  1ETV A;  3PQJ A;  4U7B A;  3TO7 A;  4YEJ A;  3CES A;  2NS8 A;  1TNS A;  2O0Y A;  5AIQ A;  4EJW A;  2MC3 A;  1SMY F;  3HIF A;  3H3V K;  4M73 A;  2A6H F;  4XLP F;  1MJ9 A;  3BY6 A;  5JVG F;  3OYI A;  1R00 A;  2A68 F;  1NTC A;  5CYV A;  2AO9 A;  3LWF A;  1WRJ A;  2JVH A;  3JSO A;  1QBJ A;  2MG4 A;  4V2G A;  2ZME C;  4ENM A;  4WXH A;  1OPC A;  3TDZ C;  2LKP A;  4NC6 A;  4UB6 C;  1YJW I;  1ZH5 A;  1Z6R A;  1WKM A;  3H1C A;  3WG7 H;  2V1U A;  1H8A C;  1CGP A;  1E3P A;  1XTA A;  3ZN1 A;  2G0E A;  5K7H A;  1R23 A;  2UUZ A;  3S2W A;  2YU3 A;  2K40 A;  2DJI A;  5IYB J;  3K70 D;  1I5Z A;  3S2D J;  1W36 D;  4C2U A;  3CDH A;  1U5T B;  4JYK A;  5HLH A;  4A3G J;  2DMN A;  5FRM A;  1IG7 A;  3DCF A;  3OWT A;  4KIT B;  3IC7 A;  4I7H A;  5ICE A;  1T38 A;  1QRY A;  1BW6 A;  5K7F A;  5FFX A;  1DQU A;  1YIJ I;  3F22 A;  1ETQ A;  2JRT A;  2PEX A;  5F08 A;  2V7F A;  2BVM A;  2DT6 A;  4DNC A;  3PQK A;  4CIC A;  3ZQ7 A;  3F9K A;  3HOV J;  2JUG A;  2LSO A;  2V9P A;  3F72 A;  3MZ8 A;  2ZC2 A;  4AWX B;  2E5Z A;  2BGC A;  4UUV A;  4CZZ A;  3HSR A;  3H92 A;  2O6G E;  1OYY A;  1BIB A;  5GAD J;  1VND A;  2HQN A;  1WVR A;  1LEB A;  1VF9 A;  2AHQ A;  1QZZ A;  1AOY A;  1OQY A;  4WXC A;  2VL8 A;  1ZRE A;  5LGU A;  3VYS B;  1YQA A;  4Q48 A;  4O5V A;  1OIS A;  2DI3 A;  5TRD A;  1VQ5 I;  4OIR F;  5ED4 A;  3BG5 A;  2ADU A;  1RUN A;  4A0Z A;  3A03 A;  3GVA A;  1WFX A;  1LUJ B;  3HL2 A;  1IRZ A;  4A3D J;  2BY0 A;  2NVU B;  1JTX A;  3HRM A;  3HGG A;  3M1C A;  4X1E A;  2ISZ A;  2QVO A;  3TGN A;  2VT2 A;  1IN4 A;  4NUB A;  2X1C A;  4U87 A;  5EZG A;  5B1B H;  3OS2 A;  1R5H A;  1L0O C;  1BBY A;  2KRH A;  1T33 A;  1WCM J;  1POG A;  5DTD A;  4KIF A;  4N9H A;  4WXD A;  2E2I J;  1V4R A;  4EM1 A;  4B48 A;  1NK2 P;  1LFB A;  2LBF B;  1WWX A;  5FFZ A;  3S1M J;  4HV6 A;  1D0Y A;  1JGG A;  2CQX A;  1LNW A;  2BV6 A;  2HVQ A;  2HGC A;  2PBI A;  3CJR B;  1O7L A;  5FLV A;  2LOO A;  3EUH C;  4G9Y A;  3OYL A;  1R1U A;  2R92 J;  1R4N B;  2F5F A;  1QQI A;  2K9N A;  1GDT A;  2O5R A;  1NG6 A;  2NYX A;  2W24 A;  1Z67 A;  3QU6 A;  4L9N A;  2Y48 A;  4IKF A;  3ERE D;  4II2 A;  4F93 B;  3OIQ A;  3SDG A;  4DQ2 A;  2G7H A;  1W7P A;  2ZKZ A;  3E6C C;  3I4M J;  2ECC A;  3RYR A;  3BP8 A;  5DUK A;  4BHP A;  2JK3 A;  4KIC A;  3SYT A;  3J7Y J;  5E8I A;  4RDU A;  1EJ9 A;  4XQF A;  2DW4 A;  5E3M A;  3MQ0 A;  2VOO A;  2E5N A;  1ON1 A;  3KEQ A;  5HDN A;  2CW0 F;  5ILS A;  2E1M B;  3K69 A;  5FRN A;  2GA1 A;  2Z33 A;  1IUF A;  3JRC A;  4ANJ A;  1KQ8 A;  3ZQL A;  1I3Q J;  3BG6 A;  2IA0 A;  3HOY J;  1A31 A;  3R6S A;  2W84 A;  3WTX C;  2DN0 A;  3RPQ A;  1VQN I;  3LSJ A;  4AVP A;  4EJU A;  1O57 A;  5CPR B;  5J3L A; 
#chains in the Genus database with same CATH homology
 5J1U A;  2JA5 J;  3BTL A;  3CCY A;  3DEW A;  4CYC A;  2VKV A;  3S17 J;  5EZH A;  4DZP A;  3CMY A;  5IYC J;  2ME6 A;  4UUT A;  1I50 J;  2D5V A;  2DA4 A;  2K9S A;  3HM5 A;  2XGE A;  2VKE A;  4XRS A;  3B6C A;  2ID3 A;  4DYC A;  2Y30 A;  2FD5 A;  1Z77 A;  1FTZ A;  1B72 B;  1JT0 A;  1A5J A;  2L9R A;  1FEX A;  5F0F A;  1TC3 C;  5J1Y A;  3O8G A;  1BJZ A;  2FJ1 A;  2XGC A;  3HOU J;  3H0G J;  2HQ5 A;  1JT6 A;  4RBO A;  4BKX A;  4IHX A;  2OPT A;  4QSH A;  3LOC A;  1GUU A;  1R9T J;  2LK2 A;  3IH4 A;  4AC0 A;  4JX4 A;  2HXI A;  5K7Z A;  1JKR C;  1IV6 A;  2XB0 X;  3S2H J;  1JKQ C;  1WGX A;  2OF7 A;  1JKP C;  3BTI A;  2JA6 J;  3G1M A;  1S7E A;  1JTY A;  3HB9 A;  2GBY A;  4FTH A;  4JP0 A;  1U9N A;  2K9Q A;  2R5Z B;  4CYC B;  3S16 J;  2L7F P;  1B8I B;  3MKL A;  2DA5 A;  1W0U A;  1DU6 A;  4D7N A;  2GM4 A;  3ZQF A;  2GLO A;  3SFI A;  2JA8 J;  2DA3 A;  4D7M A;  3NAR A;  4Y7N J;  1CQT A;  2LP0 A;  3BR0 A;  2M9H A;  3TP0 A;  1ZK8 A;  3BR3 A;  2MSY A;  1P7J A;  4X6A J;  1WH5 A;  1XC5 A;  2NOG A;  3BG3 A;  3QQA A;  1XG1 A;  3K7A J;  1AHD P;  5EYR A;  3GBG A;  3HOX J;  2NS7 A;  1GV5 A;  1OCP A;  5C4X J;  4GFB A;  3G1L A;  4IEJ A;  3PO3 J;  2HOA A;  2EQR A;  3LNQ A;  4M3F A;  2XRL A;  4M3E A;  3PO2 J;  4B4C A;  1APL C;  1MH4 A;  3CQZ J;  1ETK A;  2PMZ N;  5EEA A;  1MSF C;  2DA1 A;  4DYR A;  3S1Q J;  3JRB A;  2WB1 N;  5F0C A;  4A3J J;  5EDN A;  3JRA A;  1X58 A;  5EF6 A;  3BTC A;  4MLO A;  4IHW A;  3VPR A;  3TP3 A;  3RZO J;  3BR5 A;  3S15 J;  2HI3 A;  5C44 J;  3PM1 A;  2Y9Z A;  1XS9 A;  3FIW A;  4XID A;  3HBL A;  1MBG A;  1X2N A;  2WV1 A;  1FTT A;  3FK7 A;  1E3O C;  1AKH A;  1ZQ3 P;  5FKM A;  3TED A;  2R5Y A;  1ZR2 A;  5C3E J;  1UMQ A;  3A01 A;  4EEF G;  1ITY A;  2ECB A;  4JX6 A;  2DTZ A;  5M3M J;  9ANT A;  1IDY A;  4BBR J;  2DA2 A;  4V2F A;  4FCY A;  3BR1 A;  1SFO J;  1W0T A;  3GTG J;  5IOZ A;  2R7Z J;  3NAU A;  3FK6 A;  1K83 J;  3BR2 A;  4M6V A;  4MO7 A;  4A3M J;  3HGY A;  2M34 A;  2L7Z A;  4MFE A;  2CUF A;  3ZQI A;  1EF4 A;  1D5Y A;  4FIS A;  4IHV A;  3TW7 A;  5F1J A;  1HDP A;  1LE8 A;  3MN2 A;  1GV2 A;  1JKO C;  2LY9 A;  1SAN A;  2LKX A;  2FQ4 A;  2O9L A;  1RKT A;  4A69 C;  2Y2Z A;  4JX5 A;  2E19 A;  4C2M J;  1ETW A;  2M2E A;  2Y9Y A;  4UUS A;  2HOS A;  2X9D A;  5E3L A;  1RES A;  3RZD J;  3M3Y J;  1TWA J;  1Q1V A;  1Z0X A;  1ZKG A;  2XGD A;  1AKH B;  1FIP A;  3BQZ A;  1MNM C;  2CUE A;  2YS9 A;  1JJ8 C;  4QIW N;  2R5Y B;  2XPW A;  2DMP A;  2ME0 A;  1OCT C;  3HOZ J;  3SJM A;  4NDL A;  2CU7 A;  2LLK A;  2E2H J;  3CDL A;  2NVX J;  1HOM A;  5JLW A;  2EBI A;  4HNV A;  2VPR A;  2H1K A;  2HDD A;  1BA5 A;  1JJ6 C;  3JRI A;  2LR8 A;  1ZR4 A;  4BY7 J;  3GTP J;  2JWT A;  3G1O A;  2EH3 A;  3HOW J;  1HF0 A;  1RPW A;  3TW6 A;  5GPA A;  2E2J J;  1UHS A;  5C4J J;  3UKG A;  3JRD A;  1U9O A;  3L1P A;  1K61 A;  1A6I A;  1GVD A;  2RAE A;  1MH3 A;  4UUS B;  3HKZ N;  4L5E A;  4BBS J;  5FKL A;  2FX0 A;  3JRF A;  2B63 J;  3LSP A;  1MBH A;  4IHY A;  4M3D A;  1U8B A;  1FIA A;  1HDD C;  2W48 A;  2JA7 J;  3BT9 A;  1TWG J;  4DYQ A;  5F0H A;  1VFC A;  1H89 C;  3A02 A;  4MIM A;  1G2H A;  1U78 A;  2MGQ A;  3LSG A;  2X6O A;  2I10 A;  4A3K J;  2ID6 A;  1VI0 A;  3MVP A;  1Y1W J;  1HLV A;  2E1O A;  2TRT A;  1ZTR A;  2X48 A;  1P7I A;  2DA7 A;  2DA6 A;  3IH2 A;  3E7L A;  3LSR A;  5IOY A;  5E3N A;  3M4O J;  4Y52 J;  2QF7 A;  2MW8 A;  1OJL A;  2CQQ A;  2M0C A;  3OSF A;  1TWH J;  3RQI A;  3F0C A;  4BXX J;  2HXO A;  1JUP A;  1ZGW A;  3GTM J;  4XK4 A;  1IJW C;  3OOU A;  4M3G A;  2HOT A;  3QPS A;  4XRS G;  2R93 J;  2CRG A;  3ZQH A;  5FKN A;  1ETV A;  3JR9 A;  2XPV A;  2NS8 A;  1NK3 P;  2L7M P;  1ETO A;  5DS9 A;  4D5F A;  3H3V K;  4C3H J;  2TCT A;  4D5C A;  3C2B A;  1QPI A;  3IH3 A;  5HOD A;  1B72 A;  2P81 A;  3BTJ A;  1NTC A;  2AO9 A;  1RR7 A;  2VUM J;  3FIS A;  2MG4 A;  3BG9 A;  1RKW A;  4V2G A;  1AU7 A;  4A93 J;  4XIC A;  1BL0 A;  3BQY A;  4M3B A;  5J1R A;  2LD5 A;  1I6H J;  1ENH A;  4J19 A;  1MBE A;  5M5X J;  2WAQ N;  1X2M A;  5IYD J;  2O8K A;  1H8A C;  1UG2 A;  2G0E A;  3JRG A;  5K7H A;  3JRE A;  5EGO A;  2K40 A;  2CJJ A;  2EZK A;  5IYB J;  2O7O A;  2ZB9 A;  3S2D J;  4JYK A;  2LFB A;  2DMN A;  4A3G J;  1IG7 A;  3Q0W A;  2R5Z A;  3DCF A;  1B8I A;  1F43 A;  3B6A A;  2Y0S N;  1QRY A;  1BW6 A;  5K7F A;  5FJ8 J;  4A3C J;  1ETQ A;  5IP7 J;  5F08 A;  3A01 B;  2COB A;  3WHC A;  3Q0V A;  3W6V A;  3Q0U A;  3S1N J;  4DZJ A;  2NVQ J;  3OSG A;  4AYB N;  1OFC X;  5M5W J;  3HOV J;  1MBK A;  2LTP A;  1MSE C;  1F36 A;  2DMQ A;  1WI3 A;  5BNG A;  2KDZ A;  1IDZ A;  1WH7 A;  4LOC A;  3OIO A;  4MFD A;  3GTO J;  4W97 A;  3K2A A;  1VND A;  1IGN A;  1LE8 B;  1VF9 A;  2AHQ A;  2M8G X;  5F27 A;  3S1R J;  5FKK A;  2QCO A;  5EG0 A;  1T56 A;  1TWF J;  2IBD A;  3WHB A;  5JLX A;  2N8G A;  2JJ7 A;  3I4N J;  4ABZ A;  3BG5 A;  5EGO B;  2EZH A;  3RKQ A;  3QPL A;  3A03 A;  2Y31 A;  1QVU A;  3HEF A;  1IRZ A;  1JUM A;  4B1R A;  3GTK J;  4A3D J;  2HYJ A;  1JTX A;  4FE7 A;  3HGG A;  4X1E A;  4I76 A;  4I6Z A;  1YRN A;  5F04 A;  2VI6 A;  4A3L J;  5EZG A;  1TWC J;  3ZQG A;  5E3O A;  3FKI J;  2IEK A;  3S14 J;  1T33 A;  1WCM J;  1POG A;  2IAI A;  5DTD A;  4G12 A;  2E2I J;  4A3F J;  1FJL A;  1NK2 P;  4DW6 A;  1LFB A;  1RET A;  2KT0 A;  3S1M J;  2H8R A;  4S0H B;  3BR6 A;  1JGG A;  2CQX A;  1ORK A;  2DJN A;  3D1N I;  1O4X A;  5FLV A;  3Q3S A;  4A3E J;  1LFU P;  2EZL A;  2XSD C;  4C3J J;  1JUS A;  1H88 C;  2R92 J;  2ELK A;  2K9N A;  4XRM A;  1PUF A;  1GDT A;  2JMW A;  4B3A A;  1DU0 A;  5EG0 B;  3GTL J;  1ETX A;  3SDG A;  3I4M J;  3ZOB A;  2LVS A;  1HCR A;  4A3B J;  2ECC A;  3O8H A;  5FKO A;  2JK3 A;  5GPC A;  2R0Q C;  4QTR A;  1WPK A;  2JN6 A;  4AUX A;  1YRN B;  4RDU A;  1MBJ A;  5IPA A;  5E3M A;  5GP9 A;  2NVY J;  2YUS A;  3HDD A;  5M3F J;  2DMU A;  2XPU A;  4A3I J;  3JRH A;  1IUF A;  3JRC A;  2L0K A;  1GT0 C;  3ZQL A;  1I3Q J;  2YU9 J;  1IC8 A;  4C3I J;  2DMT A;  3GTJ J;  3HOY J;  2EZI A;  5FLM J;  3ZQC A;  3GTQ J;  1QVT A;  1Y1V J;  2DN0 A;  5IP6 A;  2XB5 A;  2NVT J;  4BY1 J;  1ETY A;  4W1U A;  3LSJ A;  5IP9 J;  1BW5 A;  1MBF A;  4FE4 A;  3IV5 A;  5M5Y J;  1PUF B;  5J3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...