1B72A

Pbx1, homeobox protein hox-b1/dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
88
structure length
68
Chain Sequence
b'ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRERE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*CP*TP*CP*TP*AP*TP*GP*AP*TP*TP*GP*AP*TP*CP*GP*G
publication title Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein/dna
total genus 21
structure length 68
sequence length 88
ec nomenclature
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1b72A00
3TEDA 4BXXJ 2XGCA 5EGOB 2DMTA 1BL0A 1JTYA 2E2IJ 4W1UA 2EH3A 4G12A 2KDZA 3QQAA 4I6ZA 2VPRA 2VUMJ 3HB9A 2TRTA 2I10A 4IEJA 2LY9A 1FEXA 1HOMA 1ETXA 1GV2A 3HBLA 2K40A 2E1OA 1JTXA 2MG4A 4DYQA 4BKXA 3RZOJ 1TWHJ 3HDDA 5BNGA 1K83J 2L7ZA 4MLOA 2FQ4A 3S16J 3IH2A 1GV5A 1F36A 3PM1A 1PUFB 1IGNA 3Q0UA 1B72A 2NS8A 3FIWA 4IHVA 3G1MA 2XB0X 3S2HJ 5C4JJ 5F0HA 4NDLA 4J19A 2L0KA 5J1UA 3O8GA 2D5VA 5IYDJ 3CDLA 3HGYA 1POGA 1JUSA 3GTPJ 5F0FA 3PO2J 1NTCA 1ETWA 1JKRC 4BBRJ 2DA1A 5FKNA 1X58A 2JA8J 2XB5A 3BTCA 3A03A 3FK6A 3BR3A 2LKXA 2H8RA 4D5FA 4M3GA 4B3AA 3F0CA 1TWAJ 4JX5A 1H88C 1DU6A 1I3QJ 4X6AJ 4Y52J 1U9NA 1W0TA 1IRZA 2HI3A 2DA6A 2DN0A 2LP0A 3BTJA 4B4CA 3QPLA 1T56A 2HDDA 1UHSA 5C3EJ 1VNDA 3JR9A 2VKVA 3BG5A 3JRBA 2OF7A 2G0EA 5M3FJ 1RKTA 4JX6A 1NK2P 5JLXA 5IOYA 1WI3A 2KT0A 2GM4A 2CUFA 1MH3A 3I4NJ 2DTZA 1MNMC 2DA5A 3HGGA 1B72B 5J1RA 3DCFA 2Y9YA 3ZQHA 5FKKA 1ETQA 4QSHA 2L7MP 4C3JJ 1HLVA 1TWCJ 1HF0A 3A01A 2R93J 1X2NA 1GDTA 5F0CA 3I4MJ 2CQQA 3JREA 3OSGA 2HYJA 4DZPA 2O7OA 3S14J 3SFIA 4FE4A 3MVPA 4X1EA 4DYCA 1E3OC 1IV6A 3HOYJ 2XPWA 4Y7NJ 4JP0A 1X2MA 1IG7A 3JRHA 2GBYA 1IC8A 1FTZA 3OOUA 4LOCA 2ECCA 2NOGA 2ZB9A 3TW6A 3GBGA 3LSRA 2RAEA 5FKOA 3W6VA 2XPVA 3Q3SA 3FKIJ 1Z77A 1MBHA 5E3MA 1IUFA 1VI0A 1JJ8C 1AKHA 1RPWA 3BR2A 1MSEC 2X6OA 5IPAA 2EZKA 3BR6A 3Q0WA 4DW6A 1ORKA 1BA5A 5F08A 3K2AA 5EF6A 2JA5J 1MH4A 1A5JA 5M5WJ 5EYRA 5E3LA 2COBA 3TP3A 4IHXA 3E7LA 1ZR2A 2LLKA 2EZLA 1R9TJ 4A3JJ 4L5EA 1ETYA 1JT6A 3A01B 4I76A 3BT9A 1XG1A 3WHCA 3SDGA 1FIPA 1I6HJ 2LFBA 5FJ8J 1HCRA 3ZQGA 3S15J 2DMPA 4A3BJ 1OFCX 3HOWJ 1XC5A 5EEAA 1D5YA 2YS9A 2M34A 3RZDJ 3JRGA 1JKPC 5IYCJ 3BTIA 1IDZA 3LNQA 4FTHA 2IAIA 4FCYA 1TWGJ 1ZQ3P 5EDNA 2DA4A 1OCPA 1JUPA 2WAQN 1TC3C 1RETA 5IYBJ 4W97A 3GTQJ 3HOVJ 3JRIA 2XPUA 2NVTJ 2XGDA 1AKHB 4JX4A 2H1KA 1ZKGA 1MBFA 4IHYA 2EZHA 4FE7A 1U78A 3LSGA 4V2GA 3MN2A 4MFEA 1CQTA 4UUSA 3C2BA 4BY1J 2AO9A 1QRYA 3ZQIA 2DA7A 2HOTA 2R5ZA 4A3GJ 4M3BA 1VF9A 3A02A 5FKMA 3ZQCA 2GLOA 3TP0A 3PO3J 1MBJA 2Y2ZA 1H8AC 1ITYA 4C3HJ 4A69C 5IP7J 3ZQLA 2ID6A 4GFBA 1WGXA 3GTGJ 1VFCA 3H3VK 2JWTA 2MW8A 3LOCA 1W0UA 2XGEA 3HEFA 3BTLA 2P81A 3RQIA 2CU7A 2EBIA 1ZK8A 3B6CA 2ECBA 4DZJA 2X9DA 4QTRA 2HOSA 2Y30A 5K7FA 3RKQA 2R0QC 1H89C 3O8HA 1OCTC 1YRNB 2K9NA 2DMNA 2LVSA 4MO7A 1QVUA 2MGQA 3M4OJ 5M5XJ 1BW5A 5IP9J 2DMUA 4CYCA 2CJJA 1O4XA 1XS9A 1SANA 4A3DJ 5FLMJ 2DA2A 1WH7A 1RESA 3OIOA 2EQRA 4A3CJ 2R5YB 2VI6A 1ZR4A 2QF7A 1JT0A 3S1RJ 4A3FJ 3FK7A 5K7HA 5F1JA 4M3DA 3VPRA 4XRMA 2O8KA 3QPSA 4UUSB 4XRSA 1UMQA 1AU7A 4A93J 5IOZA 2NVYJ 4A3KJ 1ETOA 2R5ZB 5FLVA 3S1QJ 3LSPA 3LSJA 3ZOBA 1LE8A 1ZGWA 3MKLA 3BR1A 2R92J 3G1OA 1LFBA 4HNVA 4RBOA 3DEWA 2NS7A 1FJLA 2JA7J 4A3IJ 1JJ6C 3ZQFA 4DYRA 2Y31A 5DTDA 3NARA 2M9HA 3IV5A 5M5YJ 4D5CA 1P7JA 3G1LA 1P7IA 1JGGA 4QIWN 3S1MJ 1Z0XA 4MFDA 1QPIA 4CYCB 4S0HB 1U9OA 2DA3A 5EZHA 3BQYA 5J1YA 3BG3A 5GP9A 1RKWA 4M3FA 2X48A 1YRNA 3GTLJ 2AHQA 2E2JJ 1TWFJ 5E3NA 2M2EA 4V2FA 4M3EA 3IH4A 2K9QA 3S2DJ 2NVQJ 3S17J 1Q1VA 4M6VA 2HQ5A 3NAUA 1ZTRA 3L1PA 1ENHA 1B8IA 1WCMJ 2R5YA 3S1NJ 1IDYA 4MIMA 1LE8B 1WH5A 5EG0B 2CQXA 4C2MJ 4IHWA 1JKQC 1FTTA 2LR8A 4EEFG 2EZIA 2W48A 2L7FP 1GVDA 3HOUJ 1RR7A 3IH3A 1GT0C 3K7AJ 1MBEA 2IEKA 5GPAA 2JK3A 3JRAA 2WV1A 2ME6A 1HDDC 1DU0A 5K7ZA 2HXOA 1K61A 4JYKA 4ABZA 2B63J 3BG9A 2ELKA 5F04A 1GUUA 3GTOJ 5FKLA 1APLC 2DMQA 4AYBN 1SFOJ 1MBGA 4D7NA 3D1NI 2ID3A 2FX0A 5HODA 1A6IA 2LTPA 4XK4A 2JN6A 2MSYA 4A3MJ 3BR0A 3B6AA 2LD5A 2WB1N 2NVXJ 2M8GX 1FIAA 2YUSA 2DJNA 2O9LA 2HOAA 2R7ZJ 4A3LJ 5C44J 3HOXJ 1AHDP 3HOZJ 3WHBA 2Y0SN 4AC0A 5EGOA 2XRLA 5F27A 3BQZA 2OPTA 2VKEA 3SJMA 2TCTA 4B1RA 1JUMA 1QVTA 2K9SA 5J3LA 2QCOA 3OSFA 2ME0A 5JLWA 1WPKA 2LK2A 3JRCA 4XIDA 3JRFA 1Y1WJ 4BY7J 1F43A 1B8IB 1U8BA 2FD5A 1T33A 2JJ7A 5IP6A 1ETVA 5C4XJ 1HDPA 2E2HJ 4RDUA 3H0GJ 4BBSJ 2E19A 1I50J 2PMZN 4C3IJ 2YU9J 1EF4A 5E3OA 3GTKJ 3FISA 3HM5A 2HXIA 4A3EJ 1PUFA 2CRGA 5EZGA 1JKOC 3GTMJ 2CUEA 9ANTA 3BR5A 2XSDC 1BW6A 3Q0VA 2IBDA 5DS9A 3JRDA 1LFUP 1NK3P 5EG0A 3CCYA 5M3MJ 4D7MA 4FISA 5GPCA 2Y9ZA 3CQZJ 4XRSG 1OJLA 3TW7A 3GTJJ 3CMYA 3M3YJ 1Y1VJ 4AUXA 2FJ1A 2M0CA 2JA6J 4UUTA 2N8GA 2JMWA 3UKGA 1IJWC 1G2HA 1MBKA 1UG2A 1MSFC 4XICA 3HKZN 1ETKA 1BJZA 2L9RA 1S7EA
chains in the Genus database with same CATH superfamily
4UVBA 1YTYA 4BXXJ 5CKTA 2DMTA 5EGOB 3I9V2 1BL0A 1A35A 3H36A 4HF1A 2ZJQF 1JTYA 2NOJB 2V4JC 2XVCA 2EIMH 2E2IJ 1IUYA 1MMDA 4W1UA 3FMRA 3QQAA 1YI2I 1IW7F 3HRSA 2L9SA 2ZC2A 3GCMA 5TISC 3HBLA 2J5OA 2RKHA 4XKCA 5E1WA 4KT5C 2R7FA 4Y15A 2LMDA 3FX3A 2MG4A 5H2FC 3PJRA 4BKXA 4LIUA 3LFKA 4IRIA 5BNGA 1MGTA 4MLOA 2D1VA 3S16J 4MEYF 1MW7A 4FHTA 3X2QH 5L3GA 4IHVA 1DP7P 1N75A 3OL4A 3D5LA 5E8GA 5FD5A 1YW7A 4LFUA 2E5ZA 2VKHA 2QM3A 4EQQA 1MMGA 5IYDJ 2D5VA 2JSPA 3KP7A 1POGA 4YELA 3T8TA 1I1SA 2DLLA 1BI3A 2IA1A 4PSXA 2JA8J 2X0LA 1WKMA 1VQ5I 1D1BA 3BTCA 3A03A 4B3AA 3F0CA 5K5QA 2MC3A 1PP8F 2EFQA 2VXDA 4B3XA 1H88C 4LITA 5DM7F 4O3MA 2WAFA 3F8MA 2F5CA 2PJPA 1MD0A 2NYXA 4MHGA 3FHNA 4Y52J 5DUIA 3KCCA 3K2ZA 3QODA 4N9IA 1MMAA 1Y8RB 2DA6A 4HX7A 2NVUB 3ZMUA 3QPLA 2P0WA 4PJLA 1UHSA 1XB4A 4ZDOA 1VNDA 3JR9A 2MH9A 3PSFA 3A1YA 2VKVA 2Z5UA 2VPLA 2IT0A 4OAZA 3JRBA 1SD6A 2GIZA 2CFOA 3I5UA 5ILVA 3MKZA 3PNYA 3CCLI 1RKTA 3DPTA 4JX6A 3EUHA 4M9XA 5JLXA 3CTAA 1IXRC 6PAXA 5IOYA 2IGMA 2X1CA 2VJ5A 5KAIC 3DCFA 2FU4A 1ETQA 3H9QA 1O3RA 2PQ8A 1WJAA 1HF0A 1I5ZA 2BY1A 3K4JA 3A01A 1OMIA 1IN5A 4NNJA 1LFPA 3PFYA 5B3SH 2QA4I 4M9SA 5LRSA 4LG3A 3GZNB 4A2UA 5GAHJ 3GO5A 3MVPA 4QLCU 3DTKA 2VL8A 4X1EA 1S72I 2KLOA 1TT0A 4LGWA 4JP0A 4OMYA 3J81Z 3BPXA 3OWTA 1Z6RA 2W84A 2GA2A 2CQ7A 3NRVA 3EUAA 1HC8A 4GGGA 2ECCA 1FY7A 2OZUA 4LB5A 2K9LA 3OV8A 4LK0F 2ZB9A 3G4SI 1JXSA 2XPVA 1BR4A 3FKIJ 5E3MA 1WWXA 1IUFA 2X4HA 5CJ9A 1STZA 3ASNH 4ZYHA 1YIOA 4I2OA 1JJ8C 1AKHA 2P5VA 2HYGD 1R7JA 3CMAI 3P9IA 3KYLA 3I3LA 1UJ8A 5IPAA 4XQFA 1ORKA 1IZ1A 1BA5A 1YW9A 4PJJA 5F6FA 3K2AA 1E17A 2OTJI 3CCRI 1Z21A 2KMUA 5DCMB 1A5JA 5M5WJ 4AIDA 3CMMA 5E3LA 1FPQA 4LG0B 4D1QA 3E7LA 2LLKA 1UELB 4N0BA 3MMYB 1VQKI 3GZ5A 2FMLA 1JT6A 3DEUA 3BT9A 5GTIC 2DT7B 1XN7A 3BZ6A 4QWQA 3HRUA 5GTHC 3J7AY 1P4AA 1R5HA 5LFAA 2K02A 4I98B 5D8KB 3WTXC 1JI8A 3HPGA 2DMPA 4A3BJ 3P5JA 1OFCX 1Z7UA 1UZCA 3L2QA 1KONA 1YX5A 2X6WA 3VEPA 1CGPA 1FYMA 2M34A 2O0YA 1Z3YA 2O61A 2VBXA 2WB1A 3WU0A 5IYCJ 3LQQA 1IDZA 4AM3A 2IAIA 3KZYA 4KJZA 4FCYA 4Q4ZF 1OCPA 3ABMH 3GMEA 2EV5A 4QPQA 1RETA 1NG7A 5IYBJ 1Z1DA 1FMVA 2DDBA 4IRGA 4L5IA 4W97A 1DGWY 3FM3A 2PBIA 3GTQJ 3PSIA 3JRIA 2XAUA 1YYVA 1TT5B 1ON2A 3IRQA 1QNTA 2XPUA 4Q48A 3ZR8X 5LEKA 2F48A 4JX4A 3JAMZ 2ZFUA 2FF4A 1H9GA 2VN2A 3SZGA 4C9YA 1OKRA 3L09A 3E6DA 4AIKA 3LSGA 2R7SA 3MN2A 1Z6TA 3DLLF 4MFEA 2STWA 1CQTA 1YG2A 2R7XA 1R22A 4BU2A 3L9FA 3C2BA 4BY1J 1FOXA 4JQFA 2L9VA 1W7PA 2RDPA 5E79C 2R7TA 2GLOA 3A4CA 4U0VA 1J75A 2BY0A 1MBJA 2O6GE 2Y2ZA 2FEZA 1ITYA 1BJAA 1F5TA 3K1MA 2ID6A 2BEOA 4XOPA 2DBBA 5J4VA 2Z16A 3CJRB 2JWTA 3HUGA 2JUCA 3LOCA 1W0UA 2XGEA 2A07F 5ICEA 4BH9A 2CU7A 1X4OA 2EBIA 1T95A 2HU9A 2X9DA 3WGHA 3WTVC 2QSFX 2G7HA 2TDXA 4HW0A 3RKQA 1H89C 5FLVA 4XSZF 2C6YA 5D5WB 2LVSA 4CCNA 2JVHA 1VQ4I 3FXMA 4MO7A 2Y48A 3F21A 2WADA 2XAJA 1RIOH 2QQBA 2LC2A 2CJJA 3ECOA 4BJ5C 3HZJA 4A3DJ 4ANJA 4ZC3A 2DA2A 2NNYA 1QPMA 1XDSA 1GXPA 2EQRA 4A3CJ 2R5YB 5AIPA 3S3NA 2LH9A 1D1AA 1U2WA 4Y33A 1EH6A 5K7HA 3ML6A 4M3DA 2NAZA 3L2WA 3SEZA 3MKWB 2DK5A 1SFUA 4G7HF 3CC4I 1XGMA 1AU7A 1T2KA 3H9JA 3JTHA 3VODA 5L3BA 3TDZC 5IOZA 1KYZA 4A3KJ 1O57A 1FBUA 2R5ZB 1HQCA 2FXAA 3DBRB 4I09A 3W6KB 2WAEA 3LSPA 2E5NA 4NC6A 1G3SA 3OL3A 2EV0A 3ZOBA 1O3QA 2VC1A 2JA2A 4IQ4A 3BR1A 1LFBA 1X19A 1W5CC 2EB7A 4HNVA 3AL0C 5J40A 3DEWA 2UXXA 1S7OA 2MD0A 3JSOA 2OA4A 4A3IJ 3J7ZI 4RGXA 2XIGA 5DTDA 5DM6F 1B1BA 4J01A 1U5TA 3LQRA 4D5CA 1HBXG 3FMQA 2E35A 4NC7A 4HNTA 4CUGA 1IO2A 1S9HA 1P7IA 4EMSA 1XCBA 2XAFA 3AG4H 5B5EC 5BMZA 1IN4A 1G3YA 1WFXA 4QIWN 3S1MJ 3QRFF 1ZHFA 2G7UA 1W5TA 2DA3A 2M3AA 2ZNZA 3H0DA 4CSWA 2QSHX 4U0WA 2DU9A 4IPAA 2HPIA 5J1YA 5D5UB 4OU0A 2OQGA 3N4MA 5GP9A 1H0MA 2LBFB 3VOEA 4XKBA 3RKWA 3AG2H 2Y0SA 4NQWB 3LMMA 2AHQA 5HLGA 3S3OA 3CC7I 2D1HA 3GTLJ 1Y6IA 1BI0A 2X85A 5FRMA 3WTWC 1TWFJ 3HOTA 4XR6A 2VBZA 4V2FA 2ETHA 3IH4A 5E17F 3S2DJ 1ZELA 3FXOA 5EEGA 1R1TA 2QZ8A 3S17J 1NG6A 2L9NA 4M6VA 3NAUA 3E6MA 3L1PA 3CLOA 5F1RA 2R5YA 1YJNI 1B8IA 1VQLI 3KPHA 3S1NJ 1T0FC 4MIMA 1R58A 3EUKL 1WH5A 2PMZA 2CQXA 1G59A 2OTLI 4C30A 1MNEA 4EEFG 1W36D 1TQMA 4XNFA 5LGNA 3OYLA 1GT0C 4KT6A 1LPQA 2CO5A 3EUHC 3JRAA 1OCZH 2KFDA 3HHGA 3V4GA 4WK8F 1Y56A 3DWLE 2HDWA 5DCFA 4G6DA 2HXOA 4FQGA 4JYKA 3BG9A 4B8XA 1DQUA 4KIGA 1TNTA 3VYUB 5FKLA 4S04A 4E7ZA 3GWZA 4IO9F 2VODA 1IRXA 3IKTA 1YFHA 1ZH5A 2W7NA 1H9TA 2ID3A 3WTSC 1A36A 4DGWB 3CCQI 2KZGA 2JN6A 4A3MJ 4LLGF 2NS0A 4Y17A 2WB1N 4DBRA 2NVXJ 1QBJA 3R4KA 1E0EA 4G9YA 2OV7A 5HNHA 2DYRH 2DJNA 2O9LA 1TBXA 4RB2C 2R7ZJ 3MEXA 5C44J 3HOXJ 4A3LJ 4RAZA 3FDYA 3HYIA 4UHTA 3WGIA 4B1RA 2V1XA 1I3AA 1D0YA 1VQOI 5F64A 4R79A 4ENJA 2ADUA 1KQ0A 3VSKA 3K70C 2IVMA 4BY7J 2DW4A 1B59A 4MEXF 2L02A 3IWFA 4IRHA 1S5LC 2E2HJ 2HDCA 4RDUA 3H0GJ 2QGUA 3VDXA 4C3IJ 1O3TA 2M0MA 3KP4A 1R23A 3GTKJ 3FISA 2HXIA 4A3EJ 2BHZA 3KLNA 2ZJPF 4HQEA 4PGGA 3HHHA 2CUEA 3F8BA 3F9KA 4L0ZB 4U87A 3Q0VA 2IBDA 2XRNA 2GZWA 1IAWA 1YX3A 3JRDA 1L0OC 3S3MA 1LFUP 2QQ8A 2CUJA 1KU2A 2B0LA 3CESA 1IRFA 2Y69H 1XGNA 1OJLA 1A6QA 2DXIA 1SC7A 1Y1VJ 4MGRA 3DF8A 4GYGA 1FP2A 2N8GA 2H27A 3G6EI 3I53A 3OYGA 3PFIA 4XRFA 5HOOA 3DKWA 1IRZA 2RV8A 4CYDA 4XSXF 4F55A 3B02A 5HLTA 1BC8C 4F91B 3OYKA 1G3TA 3RDIA 3SQNA 2RN7A 2HVSA 3ZN1A 4IHTA 3GLLA 1KU3A 2KDZA 2EH3A 3JCUC 2ZFWA 4UXNA 5JVTA 5GAGJ 3I54A 3R0JA 2XKOA 2I10A 2LY9A 3OR1C 3BZCA 3W3CA 4DBQA 5J8CA 4J00A 4XN3A 2LRDA 1XDUA 1MMSA 2CW0F 1JTXA 4DYQA 1HKSA 2DT5A 2L7ZA 1T6SA 4GCVA 5IT9K 4CO8A 2BY3A 3CJNA 3IH2A 1GV5A 2GIVA 4OMZA 1U6GA 3Q0UA 2Q2EB 1B72A 3FIWA 2EFWA 2XB0X 2FRHA 3IP4B 3ZMTA 2ZMEA 5ICCA 3IC7A 3MQ0A 3RKXA 5F0HA 5FLXZ 2M7AA 2DYSH 2K86A 2L0KA 3O8GA 2KHMA 2W1OA 5F0FA 3FF5A 1BOBA 2VJ4A 3CP2A 2LF7A 2DA1A 1TW2A 4HAMA 1X58A 4IZZA 2F4OB 1HXDA 2IGOA 4OIPF 3BR3A 2H8RA 4D5FA 4M3GA 1Y0UA 1TWAJ 4U7DA 3DTIA 1R6RA 1IXSB 2HYFA 3E5QA 4XLCA 4BUPA 1EH8A 1ZREA 3DQVC 1MJBA 1DU6A 5HS9A 1D8KA 2EFPA 1MDMB 2LSOA 3WTZA 5EJCA 3LAJA 2LP0A 3JW4A 3K4NA 1T56A 2VKDA 3LL7A 5IT3A 2GXBA 5C3EJ 3AL0B 1D8JA 3OYBA 4HLXA 2VQHA 3ABTA 3BG5A 3U1KA 1HSTA 4PZJA 1W36C 5HS7A 4KA4A 2K9MA 2ZO4A 3LAPA 5JFRA 4M6XA 5D5XB 2EWNA 2M8EA 2Q0OA 4H0EA 1QZYA 2KT0A 3REOA 2P8TA 4CCKA 3WG7H 4CH7A 2DTZA 1MNMC 2VJJA 2CFXA 3HGGA 3CCUI 1IXCA 5J1RA 3H5AA 2BW3A 4QSHA 4KICA 1Q1HA 2L7MP 2LDUA 1QU3A 4CICA 1N25A 2VOPA 3J80K 1GDTA 2R93J 2QVOA 5F0CA 2HEOA 3EQLF 2Z99A 2CQQA 2K3PA 3MZYA 1OCCH 3DEEA 1GHCA 4HF2A 3GEZA 2YR2A 5GAEJ 2PX9A 3E5XA 4HX4A 3FXKA 3AG3H 2FOKA 1R36A 4BQAA 1E3OC 3SEQA 3HRTA 1N78A 1WHUA 2BXYA 4BL0B 3FM5A 4CDGA 1IG7A 3L7WA 4KISA 2BY2A 1HSJA 2EA4A 2HNHA 3IKVA 4ENNA 3S32A 1YHQI 4EM1A 4LOCA 1OR7C 4Y4RA 3NQOA 3HSEA 4I0AA 1IV8A 1M1EB 4AVPA 5FKOA 1SMYF 3DU5A 3BCBA 1Z77A 1MBHA 4B47A 4E7KA 5BOXA 2KJCA 2FBHA 4BHCA 2KRFA 4JOMA 2BZTA 1J09A 3GLXA 1RPWA 5J47A 1YOVB 1TNSA 3BR2A 1MSEC 1VZ0A 1J2XA 2X6OA 2G9WA 3BR6A 4BACA 1LVKA 1T08B 3CP8A 4UV8A 1MDMA 3AG1H 2JA5J 1MH4A 2R3SA 5EYRA 1FLIA 2YX7A 3LSKA 4IHXA 5K5OA 2F4IA 2EZLA 3WE2A 2Z3YA 5K1YA 3ISPA 3A01B 2Z33A 2WA0A 1XG1A 1SFEA 3JSPA 2MA3A 2KRHA 3OIPA 2H6BA 5FJ8J 3L2CA 4HA8A 4UB8C 2XC7A 4UY8I 4OIRF 1X3ZB 2YS9A 4LIVA 4RB3C 3RZDJ 3JRGA 3IL2A 3ZMSA 4HSTA 1WJEA 5BPIA 4MTEA 5EDNA 2GWRA 2CG4A 4II2A 3U9GA 4MTDA 4G7ZF 2X51A 3LA3A 1RZ4A 2PJRA 2V6CA 1TC3C 1Z91A 2HKOA 4CHUA 1HKQA 3BP8A 4OIQF 3GYHX 2NVTJ 2XGDA 1AKHB 5D6FA 2EIKH 3OS0A 1MBFA 2O8XA 3OYHA 4Q47A 3ABUA 1S6LA 2EZHA 4KITB 1T0FA 2ZXIA 2DQRA 5FD6A 4UUSA 1ZLJA 3ZMZA 3T0YA 3ERED 2KJBA 1ZGAA 4HF0A 3WG9A 2VLAA 2AO9A 1PDNC 3PUFA 3ZQIA 2DA7A 2DODA 2VXZA 4A3GJ 5D8LB 4M3BA 2RC4A 5JVGF 2FBIA 4IOCF 4RAGA 5FKMA 3VYRB 2K4JA 2E1MC 3ZQCA 3TL4X 1IF1A 3TKYA 2GQQA 2ZKZA 4RMNA 3K4KA 1V4RA 3GUDA 5TJJA 1FC3A 4FX4A 2IPQX 1MZBA 2MW8A 3KEOA 4MQ9F 2P81A 3RQIA 2VQCA 3B6CA 4YEJA 4Z2YA 2ECBA 4QTRA 1S3JA 2Y30A 3IAS2 1L3LA 1HA8A 4RAFA 2CGPA 1QVUA 4HOBA 2DOAA 3E0JB 4PJ0C 5M5XJ 4Z6YA 1HW2A 4MNUA 5IP9J 4N4NB 4CYCA 1SD4A 3VSLA 1XPXA 2OAZA 3H1CA 1U3EM 3K69A 4L9TA 5B1BH 4NHJA 3WU1B 3OIOA 3KZZA 2FBKA 1USSA 4YFXF 3VFZA 1MIJA 3PUBA 1HW1A 3OYFA 3ZCOA 4ENMA 3HRMA 3F22A 1K78A 2RGVA 2WTEA 1I6XA 4CCLA 4WF2A 4H4KC 3QWLA 3Q9SA 1V3FA 3SFZA 4P5OA 3OY9A 4QPOA 1W7PB 4L9NA 3S1QJ 3G3ZA 3I64A 3RPUD 3TOBA 3WTTC 2LYCA 2XF6A 1XSXA 4P9FA 4B48A 1FSHA 3LSJA 3M8FA 3MKLA 4XOTA 1UHMA 3QP5A 2BE5F 2P7VB 3GF2A 2P5KA 1FJLA 3MKYB 1X3WB 2JA7J 3E97A 5IY5H 5HDKA 1R1UA 3HUGB 2M9HA 1YITI 2W82A 4A6EA 2CYYA 1V5EA 3P9KA 1FZPB 1P7JA 2VE8A 2E1NA 1FMWA 1YE9A 1SMTA 4ZZDA 2RNJA 3LA2A 4G8XA 3H35A 1LDJA 2IP2A 4MFDA 5FB2A 4CXFA 3RTRA 5L3CA 1QPIA 2ZMEC 4S0HB 1R71A 2WY7Q 1ZRDA 5EZHA 1WQ2A 2WWYA 3L2RA 2KIQA 3BQYA 4XM3A 1LUJB 4BQNA 3I59A 3BG3A 4RB1A 1WJCA 4ZDLA 2K85A 2F2EA 2R7UA 2P4WA 3V7SA 1BR2A 1ZRCA 3R60A 4DQ2A 4EATA 3FBIB 3QYBA 5E3NA 4A5MA 1WSUA 3Q9VA 4RLFA 3D0SA 4IQJA 1FBSA 1ZG5A 2XAGA 4HQMA 4HBLA 3C2GA 2QBYA 3KP6A 2HQ5A 2HS5A 2H6CA 2HR3A 1ZTRA 2V79A 2FUG2 2X6XA 1IDYA 1LJ9A 4X0GA 2Z2SB 3D5RC 3H3ZA 3QP6A 3E6CC 1XMXA 2LNBA 1FTTA 1RNLA 2Y0MA 2L7FP 1GVDA 1U8RA 3HOUJ 1RR7A 3H5NA 3IH3A 2M87A 2VT2A 2X6YA 3W2VA 5GPAA 2JK3A 4D0PA 1U5TB 2WV1A 4UV9A 4IF4A 2V6EA 1K61A 2B63J 4RGUA 4XBFA 1OCOH 5F04A 3KETA 3M07A 3GTOJ 2XSJC 5K5RA 3E5UA 1APLC 2DMQA 4AYBN 1VQ9I 2E7XA 4I01A 3QAHA 1KA8A 4V19K 3HC7A 2VJIA 3TOAA 3FXUA 1ONVA 3J7YJ 4B44A 1VQMI 5ED4A 2LD5A 1FOKA 3PNVA 2M8GX 4KN7X 3B73A 5DD4A 4BQQA 1R00A 5ILSA 2E34A 2HOAA 4Y13A 2HTSA 3ASOH 3WHBA 1AWCA 2AQFA 1OISA 1J0RA 2VKEA 2TCTA 1JUMA 4E7JA 3OYMA 1ERDA 4B09A 5A2QZ 1WPKA 4HX8A 2ZSIB 2H94A 2LK2A 2WC2A 4PDKA 1XMKA 3JRCA 3CUOA 4I0BA 3JRFA 1Y1WJ 3ABLH 1D5VA 1F43A 5E20A 1B8IB 1HW5A 1SVOA 2KDOA 4KMFA 3L00A 2JJ7A 3BJAA 5C4XJ 3LFUA 2DOEA 1HDPA 3K4LA 1P92A 1GLNA 2DO7A 5LHIA 3KE2A 4XLPF 1PUFA 2CRGA 1LEBA 2BOLA 3HTUA 2L3DA 1RUOA 1E3PA 2VC0A 2K27A 3CD6I 3PIOF 3KEYA 1ZRFA 5E18F 4XL9A 2WAQA 5GPCA 4EGYA 4ITVA 4IHSA 4IKFA 3HL2A 3M3YJ 3TW7A 3GTJJ 2YU3A 1OR7A 4UUTA 2AS5F 1MBKA 2X1EA 2JZYA 5CVUA 2HZTA 4XICA 1MSFC 3CCMI 2JQ7A 1TW3A 2L9RA 1S7EA 1VQNI 3CCJI 1KQ8A 2AXTC 2Q8KA 3WGGA 4A5NA 1DGRM 1TLHB 2F6CA 4LJZF 4HV5A 4MQVA 2VUMJ 2DFHA 3J81K 2OUMA 3TO7A 1J7KA 2A6EF 2TRTA 2OZ6A 3DKYA 3KYDB 1BBYA 2D2WA 1FEXA 5CVJA 1GV2A 3RPQA 2K40A 2E1OA 4BHBA 4Q5SF 3RZOJ 3MZ8A 1JHFA 1TWHJ 2NRAC 3HDDA 1QZEA 1Z3XA 3Q5FA 1JE8A 3AFHA 3PM1A 4II3A 1YJWI 4C2UA 3KP3A 3G1MA 2LREA 3GW2A 3RKYA 3S2HJ 1LKXA 4NDLA 5J1UA 3ESWB 1R5ID 4XMYA 1JUSA 3GTPJ 3O6BB 2PLYA 3PO2J 1OYIA 1NTCA 3DBHB 1ETWA 2DI3A 1JKRC 1F4KA 5FROA 2DCEA 3DV8A 2HWVA 1W4MA 3PL8A 2L4AA 3K6GA 2LKXA 1DPRA 2KIMA 3BLYA 3P9CA 1BIBA 3G73A 4YFNF 4IX7A 1D3YA 2PN6A 3RJPA 3MAJA 5H6QA 3BZKA 1I3QJ 2BV6A 3R0AA 3IRRA 4OWRB 3QYFA 4BEHA 4M74A 1W0TA 3CLQA 2DN0A 2QWWA 5ICFA 1WJ5A 4ZJZA 5DV5A 4PUSA 2YX4A 2HOEA 3BJOA 3UNGC 4UUVA 3F6OA 3IWZA 1K79A 1T98A 2W4SA 1ZG1A 2R7OA 3J7AO 4KUMA 2KQRA 4IOAF 1QQIA 2D45A 1UB9A 4NUBA 2GOMA 5BS6A 1OCRH 3R61A 4YRVA 3ULQB 4XLHA 1USTA 4O6JA 2GM4A 3LA7A 1MH3A 1B72B 3ZQHA 4BQOA 2CSOA 2MH2A 3O2PE 5FKKA 2E1CA 4ESBA 4CA0A 5KNLA 2ZMEB 1TWCJ 2DJIA 5J4YA 3VWBA 3FBNB 2XGXA 1X2NA 2MYSA 3JAMK 2L4MA 1YS6A 3OSGA 3JREA 3LSIA 5D4SA 3OYEA 4GDFA 1YJ9I 1F1ZA 3S14J 1SFXA 2XAQA 4NC8A 4YIIA 3LSTA 4FE4A 4NB5A 3V8KA 5E1ZB 4DYCA 2BVMA 1IV6A 3RSNA 3G71I 1X1AA 3HOYJ 2XPWA 1P4XA 4Y7NJ 5BPDA 4KNYA 1X2MA 2R7WA 2ZXWH 2JRMA 3NWSA 3HG9A 3SYTA 3CJTB 2ESHA 3W6JB 2GBYA 1IC8A 2FE3A 1SEUA 1YS7A 3OOUA 3IUOA 2EFOA 3IHUA 2IW5A 2F5EA 3I71A 3PQKA 4KMUX 3GBGA 2COMA 5CVRA 3Q3SA 3T8RA 3RQ4A 1VI0A 5DYMA 2VASA 4LB6B 3GFIA 5LBQA 2DFIA 3M7GA 1B9NA 2K4BA 1X1DA 2EZKA 3K1NA 4DW6A 5F08A 2EJRA 1PVEA 2BW3B 3OYJA 5A2QK 2QQAA 1X1CA 1Y0NA 3AAFA 1ZR2A 3HOSA 1R9TJ 1CF7A 2L54A 4L5EA 1SAUA 2EILH 1O3SA 3RIRA 3NWTA 3TBIA 2HVRA 3EETA 4BJTA 3WHCA 1FIPA 4XKVA 1I6HJ 2JSCA 3CMEI 1HCRA 1SVLA 1XSDA 4P96A 3ZQGA 3S15J 1U0JA 4EJVA 3CCEI 1XC5A 2LY2A 5EEAA 1D5YA 5L3DA 4PCQA 4RM3A 2ISYA 3LNQA 1YIJI 1DDNA 1TTYA 1OLTA 2XKPA 2IXSA 3H3UA 5FRNA 1REPC 2DA4A 4AU7A 3ZXSA 1JUPA 4OOIA 2WAQN 2IRFG 2GXAA 3FWEA 5HLIA 3T1BA 3DLAA 4WX9A 2BYVE 1O7FA 3SDBA 4CGZA 4BE0A 3H5RA 3BWGA 2CMPA 2IS1A 3V7RA 2CH0A 2OU2A 4R8HA 2H1KA 3BROA 2PMUA 3V7CA 2CS3A 2XF7A 1EA3A 3KLOA 2YPRA 3D5SC 1U78A 5AIQA 3DU6A 3OMYA 1BI2A 1R1VA 1PP7U 3BC8A 1QRYA 2ELJA 4KIBA 4RAYA 2HOTA 2QEXI 1VF9A 2W00A 3A02A 3OIQA 2EK5A 3H9GA 2A61A 3TP0A 1SAXA 2JUGA 1H8AC 4AD9A 5JI6A 2CW8A 5IP7J 1VQ8I 4GFBA 3KYCB 1FWZA 1P2FA 1PJRA 2KPMA 4DIQA 3C1DA 2HZDA 3HEFA 3ZMDA 1ZG3A 1ZK8A 3HKZA 3QPHA 3ROUA 4ENKA 5K7FA 5DDGA 1OCTC 1I27A 3OS1A 2K9NA 3OYIA 3EYYA 4EGZA 2MGQA 3FZVA 3KIOA 2PJRB 1MMNA 1BW5A 1FYKA 5CLSA 1XS9A 2NXNB 3MCZA 3ZQQA 2ISZA 2MBFA 4GXOA 1WH7A 2E71A 3F6VA 4HG2A 4M9ZA 3R6SA 1ZGJA 1ZR4A 3WE3A 2QF7A 4A3FJ 3FK7A 1W5SA 2KIUA 4WXHA 4O5VA 4XN0A 1WI9A 2O8KA 4G6QA 4HNUA 4A12A 4HYEA 1OYWA 3QPSA 4UUSB 4XRSA 4A93J 3DP7A 4P9UA 2F5VA 4GRIA 3K4CA 2NVYJ 1AA7A 3OYNA 2IS6A 2VQGA 1SVMA 3CCSI 4I02A 2CUZA 2HQRA 1P4WA 2LKPA 3VB2A 1LE8A 1X4PA 2WY8Q 2PMHA 1BC7C 4OINF 2B7EA 2GAUA 5D6EA 4BS9A 2ESNA 4RBOA 3CJQB 1VTNC 2CWEA 3RYPA 1V5GA 3E1SA 2Y31A 3A0BC 4DYRA 4BDZA 1JJ6C 2IS2A 3NARA 2HQNA 4DNCA 3QU3A 2VOOA 4U88A 4M73A 1GXQA 4BXFA 3FHZA 5KAFC 5HVQC 3ERMA 4IJAA 1G6NA 4AYBA 1Z0XA 3LSMA 2ZJ2A 2OC6A 1SFKA 2DTRA 4CYCB 1RI7A 1QHHD 2IGKA 2NNNA 2VQLA 1K4TA 1EJ9A 3RPUA 4S05A 1IN7A 4CCMA 3TO9A 2XASA 4M3FA 1W1WE 1T8IA 2RREA 2BHYA 1RRJA 1NH3A 1VQ6I 2X48A 2KL4A 5D4RA 2W57A 4LLNA 2E2JJ 2IA2A 1E2XA 1K78B 2P5LC 4M3EA 2H8WA 3GFJA 2K9QA 3DPLC 3QYEA 4RGSA 5FFZA 3V8LA 2NVQJ 3FXQA 2DPUA 1Q1VA 4HEA2 1SD7A 1X1PA 1BN5A 3CCVI 3ZN0A 3HSRA 3CUQA 2ICWG 1K4SA 1WCMJ 1LDKB 1S29A 5TRDA 4ZDPA 2QUFA 5ERIA 3RI4A 2PEXA 4YIFA 4ZYGA 3CC2I 4C2MJ 1IN6A 2XUBA 1JKQC 4IHWA 2DFEA 2W48A 3K7AJ 1XTAA 1VQPI 2ME6A 4FETA 3KZIC 1DU0A 1G4DA 1HDDC 4AWXB 5K7ZA 4BE1A 1FOYA 3LWFA 2QLZA 2KKOA 1GUUA 1XX5A 5H6RA 2IA0A 1T38A 5L3EA 1O7LA 2A6TA 2OBPA 1RUNA 3I0TA 1SFOJ 1BIAA 1MBGA 1UCRA 3BDDA 5E1XA 4D7NA 3D1NI 1YO5C 2E7WA 2FX0A 2J5PA 5HODA 2DFFA 4XK4A 2V26A 2MSYA 2O3FA 3I59B 2UWMA 2BXZA 1D0ZA 3B6AA 4BE2A 5FLXK 1XD7A 2VT3A 4ASNA 2Q1ZB 1N77A 4ESFA 3E3VA 1AHDP 2DOFA 3L2VA 1T39A 3HOZJ 4AC0A 2RVCA 5EGOA 2XRLA 5F27A 3QPTA 3BQZA 1BR1A 3SJMA 5LHHA 3BG7A 4E7IA 4A0ZA 2VE9A 1OQYA 5J3LA 4E7HA 2QCOA 3ABKH 5BQTA 1E3HA 3M1EA 2QBYB 2KP6A 1IRGA 2GA1A 3DXJF 5DEQA 4KDPA 2FD5A 1T33A 5J8FA 1MNDA 1ZLKA 2A69F 2W85A 5IP6A 3PIPF 4RS8A 1P9QC 5EEHA 3GX4X 2YU9J 4E7SA 5KHDA 1Z05A 2KIFA 3F8FA 2FSWA 1JKOC 3F8CA 2EINH 1D0XA 9ANTA 3BR5A 1HKTA 2XSDC 1BW6A 2QKLB 2H09A 2BVLA 4HDVA 4U0YA 1G8XA 4D9JA 4XONA 5DS9A 1NK3P 5M3MJ 1QO0D 4FISA 2Y9ZA 3CQZJ 4XRSG 2JT1A 3ELKA 3CMYA 4A0YA 2KZVA 2JRTA 2FJ1A 1V54H 1FP1D 2M0CA 2JA6J 4EM0B 1Z67A 2QYOA 1DUXC 1UG2A 3U2RA 2R4GA 4UVCA 3HKZN 1ETKA 1BJZA 3N97A 3CF2A 3KEQA 3TEDA 2QSGX 2B9SA 2XGCA 3F8NA 4F7ZA 2O5RA 3M1CA 3RYRA 2L2OA 4GYIA 1SD5A 1UHWA 2M7BA 3A0HC 5B66C 3SHFA 1A31A 4G12A 4I6ZA 2VPRA 3OYDA 3HB9A 2RQPA 4IEJA 3TO6A 2HQAA 1HOMA 1ETXA 3A2KA 1WJFA 1R5GA 2XV4S 1K83J 2FQ4A 2RQQA 4E6KG 1FSEA 1R4MB 2PFBA 1F36A 3PQJA 1PUFB 1IGNA 2NS8A 3C7JA 3GXOA 3T5XA 2DPDA 3BY6A 4NBQA 4G6TB 4XLNF 1RR8C 3EDPA 5C4JJ 5FO5A 4J19A 3CDLA 3HGYA 2R7DA 4PSWA 1FX7A 3C3WA 4BGDA 5LGUA 1G3WA 5JHFA 1EKEA 4EJOA 2UZKA 4BBRJ 5FKNA 2CQNA 4E70A 1KQ9A 3OR2C 4EVIA 1I1GA 4BDYA 2XB5A 1S7AA 3FK6A 5D5VB 1ODDA 4A6DA 5LEJA 1F9NA 4JX5A 4M6YA 1J59A 3ZP5A 1V55H 2MFZA 4EJTA 2HVQA 3EPZA 4X6AJ 2GOXB 4I7HA 1U9NA 4PJNA 3CDHA 4XLFA 2HI3A 5FGMA 3BTJA 4OIOF 3HPHA 4B4CA 1TP4A 2A5WA 2HDDA 4IVNA 1YQAA 4WCGA 4ZTJA 4G7OF 2OF7A 4XLEA 5ICGA 2EFNA 2G0EA 1MKMA 5M3FJ 1KGSA 4AIHA 1KZHA 1NK2P 3QOPA 2ZBKA 1WI3A 3K70D 2I8DA 5AONA 2CUFA 1ZARA 3I4NJ 2DA5A 5DCMA 3GZ6A 3GVAA 4RB0A 2Y9YA 1KYWA 4LG0A 5ILUA 2UV1A 4C3JJ 1HLVA 3ZGKA 2ELHA 2L01A 2IJLA 2W25A 3N05A 4WXCA 1K7AA 3ECHA 1WVRA 4E4HA 2QKMB 3I4MJ 5LHGA 2HYJA 2CW7A 2O7OA 4DZPA 3SFIA 4HRIA 2WBMA 2MC4A 4CCJA 3I4PA 4TV7A 3S2WA 3DFGA 3TDUC 3K4MA 4YG2F 2HTJA 2DDAA 5KCMA 3M8JA 3JRHA 2JPBA 4Y3OA 1FTZA 1GVJA 4BEHB 3W2WA 4L9JA 1QZZA 5HDNA 2FOWA 5IT9Z 2NOGA 2FMYA 2AXLA 4M71A 4UB6C 4IXAA 3TW6A 3LSRA 4ESJA 1UFMA 2RAEA 3W6VA 5DD8A 4PFPA 2Y75A 4YFKF 4LMYA 4IL6C 1FNNA 4G94A 1QHGA 5J6XA 1TQIA 4XLAA 3L2UA 1FYLA 2A05A 3C2HA 3Q0WA 4E7LA 1C0WA 4N4OB 2OCCH 2E1MB 5EF6A 3JTGA 2CV2A 1WJDA 4A0XA 1I39A 2COBA 3TP3A 4ZTFA 5HNFA 3OYCA 1IN8A 2GXGA 3BOQA 4FT8A 1UAAA 3W2AA 1ULYA 3WTUC 4HLYA 4A3JJ 1ETYA 1RC9A 1DP3A 2QENA 5H20A 2M4KA 4L0YB 2LY1A 2A3SA 4I76A 3CO6C 3MFKA 4L18B 5B1AH 3SDGA 1QA6A 2DK8A 4BHPA 2LFBA 2K7LA 2K3FA 5LGTA 4BJ6C 1XGOA 4HDUA 5HS8A 3HOWJ 3CUQC 4ZZLA 5CVVA 2DT6A 2ZCWA 3WU2C 2FA5A 5HDGA 1B9MA 1JKPC 3BTIA 4KYWA 4FTHA 1W7PD 3FXLA 1TWGJ 1ZQ3P 2UUZA 4PGHA 4GO1A 2L5QA 2XROA 3PNTA 4JBAA 3DBLB 3CO7C 4HZFA 3HOVJ 4N9HA 3BJ6A 2K5CA 2A68F 1PYVA 2HPMA 1B6AA 3C18A 1BM9A 2LKSA 4LK1F 3J80Z 3OS2A 3O3KA 1ZKGA 2OCEA 1LB2A 1WRJA 4ETSA 4CCOA 1S8NA 2FNAA 4IHYA 4FE7A 4PFOA 4CZCA 4DOZA 3ZQ7A 4V2GA 1P6RA 2EPFA 1CF7B 2JPCA 4HSRA 4BAYA 3F23A 2M4GA 1XSVA 5KVRA 5GADJ 2R7RA 2R5ZA 4F3QA 3HXLA 1AOYA 2VIXA 3E6BA 3PO3J 2V9VA 5KK1A 4C3HJ 2KISA 2LOOA 2Z1DA 3GFLA 3K1PA 3QU6A 4A69C 2STTA 3ZQLA 3GFMA 1WGXA 3GTGJ 4I99C 2H1LA 3VYSB 1VFCA 3H3VK 3ZRGA 3BTLA 2F5FA 3M8EA 3TMOA 4DJAA 2EA2A 3K0LA 3TGNA 4DZJA 2JVGA 3F3XA 2HOSA 5JR3A 3G2BA 1PUEE 1YRNB 2R0QC 3EYIA 3O8HA 2DMNA 2ZXHA 4WXDA 2P7CB 3M4OJ 2V1NA 2PI0A 4RA2A 1LDDA 1FOWA 2DMUA 2ZJRF 2ZNYA 2YSRA 1O4XA 1SANA 5FLMJ 3P7NA 1RESA 4JK1X 3U1DA 2HKXA 2E36A 2XHKA 2M1BA 2PG4A 1QGPA 2LBFA 4P1WA 4P55A 4EJWA 3HSFA 2VI6A 1JT0A 3S1RJ 1JGSA 1LEAA 4NQWA 5CVIA 5F1JA 5DUKA 3VPRA 4XRMA 3NEUA 3DTEA 4WWCA 1ZN2A 1V5FA 3F72A 1UMQA 4RGRA 4RLQA 3OYAA 1ETOA 2DQLA 1ZAOA 3K10A 5LRRA 4EV0A 3HTSB 2OQRA 2CV0A 4K2EA 2OD5A 1J5YA 2VBWA 3LSHA 2VONA 1ZGWA 2R92J 3G1OA 1WZ2A 3I55I 1X1BA 1TZLA 3HJEA 1NHAA 2NS7A 3M9AA 2HFHA 3ZQFA 3KP2A 2FNPA 3I58A 1OPCA 2W24A 4YIRX 2P6TA 2LF8A 3COAC 3IV5A 5M5YJ 4R1HA 3G1LA 1LVAA 5CYVA 3K4BA 1FBQA 3KP5A 3OOPA 2AQEA 4CZZA 4KIFA 1JGGA 3BPVA 1Z7LA 3DKXA 4LLLA 1DPUA 2P6SA 3KFWX 2BGCA 2KRCA 2IS4A 1U9OA 4L5JA 2FQ3A 1D1CA 1XMAA 1YW8A 5TGTA 1VQ7I 4FASD 1MJ9A 2L7KA 5E8IA 1RKWA 1BOAA 1WJBA 3MWMA 2OJED 1YRNA 2F5DA 3V8JA 2CQKA 1R49A 2EIJH 2M2EA 3CF5F 2IGNA 3CDIA 3RCOA 2MLKA 4OAYA 4PK4A 2ACJA 3H92A 3KX2A 1ENHA 2M45A 3V42A 3WODF 1BI1A 4EM2A 1Y8QB 1LE8B 1K6OA 4BNCA 2XF5A 5EG0B 4HV6A 3SXYA 5LD2C 2LR8A 3UR3C 2EZIA 3FKJA 1FT9A 3TQNA 2F4MB 1MBEA 2IEKA 3S8PA 1Z9CA 4HPQA 2VB6A 4F52A 2Z9OA 1LNWA 2RNGA 2V1DA 3AKZA 4ABZA 5CPRB 2ELKA 4PJMA 1XCVA 2E60A 4L9VA 1YLFA 1UG0A 1ACIA 3ZPLA 1A6IA 2LTPA 3SZPA 2R7VA 4ZYEA 3ONQA 2R7QA 3BR0A 3U21A 1FIAA 2YUSA 3MD2A 1R4NB 4BXUA 1EH7A 1J9IA 2A6HF 2Y0SN 2QQ9A 2OPTA 2WV0A 1A04A 1TQPA 2K9SA 1QVTA 3DPUA 3ZMVA 1X3UA 4EJUA 3OSFA 2ME0A 5JLWA 3S93A 2ZSHB 3FMSA 4RM2A 3FXRA 4XIDA 2LG4A 2DAOA 1EV7A 2VBYA 2HGCA 3CUQB 3SZTA 5CQEA 4B43A 1U8BA 1OYYA 2EV6A 1B4AA 2M30A 1JHHA 1XGSA 5CQGA 3VYTB 4XKWA 4UNOA 1MJAA 1ETVA 4ZYDA 5HLHA 3QOEA 4F92B 1KU9A 1K6YA 2E19A 1I50J 2PMZN 4M72A 3HIFA 4BBSJ 5JHUA 1EF4A 2XAHA 5E3OA 2V9PA 3BCAA 3HM5A 2V9KA 4UVAA 2ZXJA 1Y39A 2Q2EA 2JTVA 5EZGA 3CZ6A 3GTMJ 3WTYC 4XORA 4ON0A 2A5YB 4ZH4F 4FX0A 2V1UA 4F93B 3I56I 2BBYA 3MZHA 3FXJA 3BG6A 4AIJA 5EG0A 3CCYA 2V7FA 4D7MA 1LQ1A 1ZYRF 5L3FA 4C2TA 2X1DA 5LLQA 2CV1A 2O03A 2MLGA 4ZYAA 2I5UA 1U5TC 3IAM2 5FFXA 4AUXA 1TL8A 2MD5A 3K9TA 2JMWA 4BYYA 2XDVA 1KU7A 4LD5A 3UKGA 4KN4X 1IJWC 4AVZA 4KFCA 1G2HA 2M5WA 2UXNA 1ON1A 2MABA 4U7BA
chains in the Genus database with same CATH topology
3TEDA 4BXXJ 2XGCA 5EGOB 2DMTA 1BL0A 1JTYA 2E2IJ 4W1UA 2EH3A 4G12A 2KDZA 3QQAA 4I6ZA 2VPRA 2VUMJ 3HB9A 2TRTA 2I10A 4IEJA 2LY9A 1FEXA 1HOMA 1ETXA 1GV2A 3HBLA 2K40A 2E1OA 1JTXA 2MG4A 4DYQA 4BKXA 3RZOJ 1TWHJ 3HDDA 5BNGA 1K83J 2L7ZA 4MLOA 2FQ4A 3S16J 3IH2A 1GV5A 1F36A 3PM1A 1PUFB 1IGNA 3Q0UA 1B72A 2NS8A 3FIWA 4IHVA 3G1MA 2XB0X 3S2HJ 5C4JJ 5F0HA 4NDLA 4J19A 2L0KA 5J1UA 3O8GA 2D5VA 5IYDJ 3CDLA 3HGYA 1POGA 1JUSA 3GTPJ 5F0FA 3PO2J 1NTCA 1ETWA 1JKRC 4BBRJ 2DA1A 5FKNA 1X58A 2JA8J 2XB5A 3BTCA 3A03A 3FK6A 3BR3A 2LKXA 2H8RA 4D5FA 4M3GA 4B3AA 3F0CA 1TWAJ 4JX5A 1H88C 1DU6A 1I3QJ 4X6AJ 4Y52J 1U9NA 1W0TA 1IRZA 2HI3A 2DA6A 2DN0A 2LP0A 3BTJA 4B4CA 3QPLA 1T56A 2HDDA 1UHSA 5C3EJ 1VNDA 3JR9A 2VKVA 3BG5A 3JRBA 2OF7A 2G0EA 5M3FJ 1RKTA 4JX6A 1NK2P 5JLXA 5IOYA 1WI3A 2KT0A 2GM4A 2CUFA 1MH3A 3I4NJ 2DTZA 1MNMC 2DA5A 3HGGA 1B72B 5J1RA 3DCFA 2Y9YA 3ZQHA 5FKKA 1ETQA 4QSHA 2L7MP 4C3JJ 1HLVA 1TWCJ 1HF0A 3A01A 2R93J 1X2NA 1GDTA 5F0CA 3I4MJ 2CQQA 3JREA 3OSGA 2HYJA 4DZPA 2O7OA 3S14J 3SFIA 4FE4A 3MVPA 4X1EA 4DYCA 1E3OC 1IV6A 3HOYJ 2XPWA 4Y7NJ 4JP0A 1X2MA 1IG7A 3JRHA 2GBYA 1IC8A 1FTZA 3OOUA 4LOCA 2ECCA 2NOGA 2ZB9A 3TW6A 3GBGA 3LSRA 2RAEA 5FKOA 3W6VA 2XPVA 3Q3SA 3FKIJ 1Z77A 1MBHA 5E3MA 1IUFA 1VI0A 1JJ8C 1AKHA 1RPWA 3BR2A 1MSEC 2X6OA 5IPAA 2EZKA 3BR6A 3Q0WA 4DW6A 1ORKA 1BA5A 5F08A 3K2AA 5EF6A 2JA5J 1MH4A 1A5JA 5M5WJ 5EYRA 5E3LA 2COBA 3TP3A 4IHXA 3E7LA 1ZR2A 2LLKA 2EZLA 1R9TJ 4A3JJ 4L5EA 1ETYA 1JT6A 3A01B 4I76A 3BT9A 1XG1A 3WHCA 3SDGA 1FIPA 1I6HJ 2LFBA 5FJ8J 1HCRA 3ZQGA 3S15J 2DMPA 4A3BJ 1OFCX 3HOWJ 1XC5A 5EEAA 1D5YA 2YS9A 2M34A 3RZDJ 3JRGA 1JKPC 5IYCJ 3BTIA 1IDZA 3LNQA 4FTHA 2IAIA 4FCYA 1TWGJ 1ZQ3P 5EDNA 2DA4A 1OCPA 1JUPA 2WAQN 1TC3C 1RETA 5IYBJ 4W97A 3GTQJ 3HOVJ 3JRIA 2XPUA 2NVTJ 2XGDA 1AKHB 4JX4A 2H1KA 1ZKGA 1MBFA 4IHYA 2EZHA 4FE7A 1U78A 3LSGA 4V2GA 3MN2A 4MFEA 1CQTA 4UUSA 3C2BA 4BY1J 2AO9A 1QRYA 3ZQIA 2DA7A 2HOTA 2R5ZA 4A3GJ 4M3BA 1VF9A 3A02A 5FKMA 3ZQCA 2GLOA 3TP0A 3PO3J 1MBJA 2Y2ZA 1H8AC 1ITYA 4C3HJ 4A69C 5IP7J 3ZQLA 2ID6A 4GFBA 1WGXA 3GTGJ 1VFCA 3H3VK 2JWTA 2MW8A 3LOCA 1W0UA 2XGEA 3HEFA 3BTLA 2P81A 3RQIA 2CU7A 2EBIA 1ZK8A 3B6CA 2ECBA 4DZJA 2X9DA 4QTRA 2HOSA 2Y30A 5K7FA 3RKQA 2R0QC 1H89C 3O8HA 1OCTC 1YRNB 2K9NA 2DMNA 2LVSA 4MO7A 1QVUA 2MGQA 3M4OJ 5M5XJ 1BW5A 5IP9J 2DMUA 4CYCA 2CJJA 1O4XA 1XS9A 1SANA 4A3DJ 5FLMJ 2DA2A 1WH7A 1RESA 3OIOA 2EQRA 4A3CJ 2R5YB 2VI6A 1ZR4A 2QF7A 1JT0A 3S1RJ 4A3FJ 3FK7A 5K7HA 5F1JA 4M3DA 3VPRA 4XRMA 2O8KA 3QPSA 4UUSB 4XRSA 1UMQA 1AU7A 4A93J 5IOZA 2NVYJ 4A3KJ 1ETOA 2R5ZB 5FLVA 3S1QJ 3LSPA 3LSJA 3ZOBA 1LE8A 1ZGWA 3MKLA 3BR1A 2R92J 3G1OA 1LFBA 4HNVA 4RBOA 3DEWA 2NS7A 1FJLA 2JA7J 4A3IJ 1JJ6C 3ZQFA 4DYRA 2Y31A 5DTDA 3NARA 2M9HA 3IV5A 5M5YJ 4D5CA 1P7JA 3G1LA 1P7IA 1JGGA 4QIWN 3S1MJ 1Z0XA 4MFDA 1QPIA 4CYCB 4S0HB 1U9OA 2DA3A 5EZHA 3BQYA 5J1YA 3BG3A 5GP9A 1RKWA 4M3FA 2X48A 1YRNA 3GTLJ 2AHQA 2E2JJ 1TWFJ 5E3NA 2M2EA 4V2FA 4M3EA 3IH4A 2K9QA 3S2DJ 2NVQJ 3S17J 1Q1VA 4M6VA 2HQ5A 3NAUA 1ZTRA 3L1PA 1ENHA 1B8IA 1WCMJ 2R5YA 3S1NJ 1IDYA 4MIMA 1LE8B 1WH5A 5EG0B 2CQXA 4C2MJ 4IHWA 1JKQC 1FTTA 2LR8A 4EEFG 2EZIA 2W48A 2L7FP 1GVDA 3HOUJ 1RR7A 3IH3A 1GT0C 3K7AJ 1MBEA 2IEKA 5GPAA 2JK3A 3JRAA 2WV1A 2ME6A 1HDDC 1DU0A 5K7ZA 2HXOA 1K61A 4JYKA 4ABZA 2B63J 3BG9A 2ELKA 5F04A 1GUUA 3GTOJ 5FKLA 1APLC 2DMQA 4AYBN 1SFOJ 1MBGA 4D7NA 3D1NI 2ID3A 2FX0A 5HODA 1A6IA 2LTPA 4XK4A 2JN6A 2MSYA 4A3MJ 3BR0A 3B6AA 2LD5A 2WB1N 2NVXJ 2M8GX 1FIAA 2YUSA 2DJNA 2O9LA 2HOAA 2R7ZJ 4A3LJ 5C44J 3HOXJ 1AHDP 3HOZJ 3WHBA 2Y0SN 4AC0A 5EGOA 2XRLA 5F27A 3BQZA 2OPTA 2VKEA 3SJMA 2TCTA 4B1RA 1JUMA 1QVTA 2K9SA 5J3LA 2QCOA 3OSFA 2ME0A 5JLWA 1WPKA 2LK2A 3JRCA 4XIDA 3JRFA 1Y1WJ 4BY7J 1F43A 1B8IB 1U8BA 2FD5A 1T33A 2JJ7A 5IP6A 1ETVA 5C4XJ 1HDPA 2E2HJ 4RDUA 3H0GJ 4BBSJ 2E19A 1I50J 2PMZN 4C3IJ 2YU9J 1EF4A 5E3OA 3GTKJ 3FISA 3HM5A 2HXIA 4A3EJ 1PUFA 2CRGA 5EZGA 1JKOC 3GTMJ 2CUEA 9ANTA 3BR5A 2XSDC 1BW6A 3Q0VA 2IBDA 5DS9A 3JRDA 1LFUP 1NK3P 5EG0A 3CCYA 5M3MJ 4D7MA 4FISA 5GPCA 2Y9ZA 3CQZJ 4XRSG 1OJLA 3TW7A 3GTJJ 3CMYA 3M3YJ 1Y1VJ 4AUXA 2FJ1A 2M0CA 2JA6J 4UUTA 2N8GA 2JMWA 3UKGA 1IJWC 1G2HA 1MBKA 1UG2A 1MSFC 4XICA 3HKZN 1ETKA 1BJZA 2L9RA 1S7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TED A;  4BXX J;  2XGC A;  5EGO B;  2DMT A;  1BL0 A;  1JTY A;  2E2I J;  4W1U A;  2EH3 A;  4G12 A;  2KDZ A;  3QQA A;  4I6Z A;  2VPR A;  2VUM J;  3HB9 A;  2TRT A;  2I10 A;  4IEJ A;  2LY9 A;  1FEX A;  1HOM A;  1ETX A;  1GV2 A;  3HBL A;  2K40 A;  2E1O A;  1JTX A;  2MG4 A;  4DYQ A;  4BKX A;  3RZO J;  1TWH J;  3HDD A;  5BNG A;  1K83 J;  2L7Z A;  4MLO A;  2FQ4 A;  3S16 J;  3IH2 A;  1GV5 A;  1F36 A;  3PM1 A;  1PUF B;  1IGN A;  3Q0U A;  1B72 A;  2NS8 A;  3FIW A;  4IHV A;  3G1M A;  2XB0 X;  3S2H J;  5C4J J;  5F0H A;  4NDL A;  4J19 A;  2L0K A;  5J1U A;  3O8G A;  2D5V A;  5IYD J;  3CDL A;  3HGY A;  1POG A;  1JUS A;  3GTP J;  5F0F A;  3PO2 J;  1NTC A;  1ETW A;  1JKR C;  4BBR J;  2DA1 A;  5FKN A;  1X58 A;  2JA8 J;  2XB5 A;  3BTC A;  3A03 A;  3FK6 A;  3BR3 A;  2LKX A;  2H8R A;  4D5F A;  4M3G A;  4B3A A;  3F0C A;  1TWA J;  4JX5 A;  1H88 C;  1DU6 A;  1I3Q J;  4X6A J;  4Y52 J;  1U9N A;  1W0T A;  1IRZ A;  2HI3 A;  2DA6 A;  2DN0 A;  2LP0 A;  3BTJ A;  4B4C A;  3QPL A;  1T56 A;  2HDD A;  1UHS A;  5C3E J;  1VND A;  3JR9 A;  2VKV A;  3BG5 A;  3JRB A;  2OF7 A;  2G0E A;  5M3F J;  1RKT A;  4JX6 A;  1NK2 P;  5JLX A;  5IOY A;  1WI3 A;  2KT0 A;  2GM4 A;  2CUF A;  1MH3 A;  3I4N J;  2DTZ A;  1MNM C;  2DA5 A;  3HGG A;  1B72 B;  5J1R A;  3DCF A;  2Y9Y A;  3ZQH A;  5FKK A;  1ETQ A;  4QSH A;  2L7M P;  4C3J J;  1HLV A;  1TWC J;  1HF0 A;  3A01 A;  2R93 J;  1X2N A;  1GDT A;  5F0C A;  3I4M J;  2CQQ A;  3JRE A;  3OSG A;  2HYJ A;  4DZP A;  2O7O A;  3S14 J;  3SFI A;  4FE4 A;  3MVP A;  4X1E A;  4DYC A;  1E3O C;  1IV6 A;  3HOY J;  2XPW A;  4Y7N J;  4JP0 A;  1X2M A;  1IG7 A;  3JRH A;  2GBY A;  1IC8 A;  1FTZ A;  3OOU A;  4LOC A;  2ECC A;  2NOG A;  2ZB9 A;  3TW6 A;  3GBG A;  3LSR A;  2RAE A;  5FKO A;  3W6V A;  2XPV A;  3Q3S A;  3FKI J;  1Z77 A;  1MBH A;  5E3M A;  1IUF A;  1VI0 A;  1JJ8 C;  1AKH A;  1RPW A;  3BR2 A;  1MSE C;  2X6O A;  5IPA A;  2EZK A;  3BR6 A;  3Q0W A;  4DW6 A;  1ORK A;  1BA5 A;  5F08 A;  3K2A A;  5EF6 A;  2JA5 J;  1MH4 A;  1A5J A;  5M5W J;  5EYR A;  5E3L A;  2COB A;  3TP3 A;  4IHX A;  3E7L A;  1ZR2 A;  2LLK A;  2EZL A;  1R9T J;  4A3J J;  4L5E A;  1ETY A;  1JT6 A;  3A01 B;  4I76 A;  3BT9 A;  1XG1 A;  3WHC A;  3SDG A;  1FIP A;  1I6H J;  2LFB A;  5FJ8 J;  1HCR A;  3ZQG A;  3S15 J;  2DMP A;  4A3B J;  1OFC X;  3HOW J;  1XC5 A;  5EEA A;  1D5Y A;  2YS9 A;  2M34 A;  3RZD J;  3JRG A;  1JKP C;  5IYC J;  3BTI A;  1IDZ A;  3LNQ A;  4FTH A;  2IAI A;  4FCY A;  1TWG J;  1ZQ3 P;  5EDN A;  2DA4 A;  1OCP A;  1JUP A;  2WAQ N;  1TC3 C;  1RET A;  5IYB J;  4W97 A;  3GTQ J;  3HOV J;  3JRI A;  2XPU A;  2NVT J;  2XGD A;  1AKH B;  4JX4 A;  2H1K A;  1ZKG A;  1MBF A;  4IHY A;  2EZH A;  4FE7 A;  1U78 A;  3LSG A;  4V2G A;  3MN2 A;  4MFE A;  1CQT A;  4UUS A;  3C2B A;  4BY1 J;  2AO9 A;  1QRY A;  3ZQI A;  2DA7 A;  2HOT A;  2R5Z A;  4A3G J;  4M3B A;  1VF9 A;  3A02 A;  5FKM A;  3ZQC A;  2GLO A;  3TP0 A;  3PO3 J;  1MBJ A;  2Y2Z A;  1H8A C;  1ITY A;  4C3H J;  4A69 C;  5IP7 J;  3ZQL A;  2ID6 A;  4GFB A;  1WGX A;  3GTG J;  1VFC A;  3H3V K;  2JWT A;  2MW8 A;  3LOC A;  1W0U A;  2XGE A;  3HEF A;  3BTL A;  2P81 A;  3RQI A;  2CU7 A;  2EBI A;  1ZK8 A;  3B6C A;  2ECB A;  4DZJ A;  2X9D A;  4QTR A;  2HOS A;  2Y30 A;  5K7F A;  3RKQ A;  2R0Q C;  1H89 C;  3O8H A;  1OCT C;  1YRN B;  2K9N A;  2DMN A;  2LVS A;  4MO7 A;  1QVU A;  2MGQ A;  3M4O J;  5M5X J;  1BW5 A;  5IP9 J;  2DMU A;  4CYC A;  2CJJ A;  1O4X A;  1XS9 A;  1SAN A;  4A3D J;  5FLM J;  2DA2 A;  1WH7 A;  1RES A;  3OIO A;  2EQR A;  4A3C J;  2R5Y B;  2VI6 A;  1ZR4 A;  2QF7 A;  1JT0 A;  3S1R J;  4A3F J;  3FK7 A;  5K7H A;  5F1J A;  4M3D A;  3VPR A;  4XRM A;  2O8K A;  3QPS A;  4UUS B;  4XRS A;  1UMQ A;  1AU7 A;  4A93 J;  5IOZ A;  2NVY J;  4A3K J;  1ETO A;  2R5Z B;  5FLV A;  3S1Q J;  3LSP A;  3LSJ A;  3ZOB A;  1LE8 A;  1ZGW A;  3MKL A;  3BR1 A;  2R92 J;  3G1O A;  1LFB A;  4HNV A;  4RBO A;  3DEW A;  2NS7 A;  1FJL A;  2JA7 J;  4A3I J;  1JJ6 C;  3ZQF A;  4DYR A;  2Y31 A;  5DTD A;  3NAR A;  2M9H A;  3IV5 A;  5M5Y J;  4D5C A;  1P7J A;  3G1L A;  1P7I A;  1JGG A;  4QIW N;  3S1M J;  1Z0X A;  4MFD A;  1QPI A;  4CYC B;  4S0H B;  1U9O A;  2DA3 A;  5EZH A;  3BQY A;  5J1Y A;  3BG3 A;  5GP9 A;  1RKW A;  4M3F A;  2X48 A;  1YRN A;  3GTL J;  2AHQ A;  2E2J J;  1TWF J;  5E3N A;  2M2E A;  4V2F A;  4M3E A;  3IH4 A;  2K9Q A;  3S2D J;  2NVQ J;  3S17 J;  1Q1V A;  4M6V A;  2HQ5 A;  3NAU A;  1ZTR A;  3L1P A;  1ENH A;  1B8I A;  1WCM J;  2R5Y A;  3S1N J;  1IDY A;  4MIM A;  1LE8 B;  1WH5 A;  5EG0 B;  2CQX A;  4C2M J;  4IHW A;  1JKQ C;  1FTT A;  2LR8 A;  4EEF G;  2EZI A;  2W48 A;  2L7F P;  1GVD A;  3HOU J;  1RR7 A;  3IH3 A;  1GT0 C;  3K7A J;  1MBE A;  2IEK A;  5GPA A;  2JK3 A;  3JRA A;  2WV1 A;  2ME6 A;  1HDD C;  1DU0 A;  5K7Z A;  2HXO A;  1K61 A;  4JYK A;  4ABZ A;  2B63 J;  3BG9 A;  2ELK A;  5F04 A;  1GUU A;  3GTO J;  5FKL A;  1APL C;  2DMQ A;  4AYB N;  1SFO J;  1MBG A;  4D7N A;  3D1N I;  2ID3 A;  2FX0 A;  5HOD A;  1A6I A;  2LTP A;  4XK4 A;  2JN6 A;  2MSY A;  4A3M J;  3BR0 A;  3B6A A;  2LD5 A;  2WB1 N;  2NVX J;  2M8G X;  1FIA A;  2YUS A;  2DJN A;  2O9L A;  2HOA A;  2R7Z J;  4A3L J;  5C44 J;  3HOX J;  1AHD P;  3HOZ J;  3WHB A;  2Y0S N;  4AC0 A;  5EGO A;  2XRL A;  5F27 A;  3BQZ A;  2OPT A;  2VKE A;  3SJM A;  2TCT A;  4B1R A;  1JUM A;  1QVT A;  2K9S A;  5J3L A;  2QCO A;  3OSF A;  2ME0 A;  5JLW A;  1WPK A;  2LK2 A;  3JRC A;  4XID A;  3JRF A;  1Y1W J;  4BY7 J;  1F43 A;  1B8I B;  1U8B A;  2FD5 A;  1T33 A;  2JJ7 A;  5IP6 A;  1ETV A;  5C4X J;  1HDP A;  2E2H J;  4RDU A;  3H0G J;  4BBS J;  2E19 A;  1I50 J;  2PMZ N;  4C3I J;  2YU9 J;  1EF4 A;  5E3O A;  3GTK J;  3FIS A;  3HM5 A;  2HXI A;  4A3E J;  1PUF A;  2CRG A;  5EZG A;  1JKO C;  3GTM J;  2CUE A;  9ANT A;  3BR5 A;  2XSD C;  1BW6 A;  3Q0V A;  2IBD A;  5DS9 A;  3JRD A;  1LFU P;  1NK3 P;  5EG0 A;  3CCY A;  5M3M J;  4D7M A;  4FIS A;  5GPC A;  2Y9Z A;  3CQZ J;  4XRS G;  1OJL A;  3TW7 A;  3GTJ J;  3CMY A;  3M3Y J;  1Y1V J;  4AUX A;  2FJ1 A;  2M0C A;  2JA6 J;  4UUT A;  2N8G A;  2JMW A;  3UKG A;  1IJW C;  1G2H A;  1MBK A;  1UG2 A;  1MSF C;  4XIC A;  3HKZ N;  1ETK A;  1BJZ A;  2L9R A;  1S7E A; 
#chains in the Genus database with same CATH topology
 4UVB A;  1YTY A;  4BXX J;  5CKT A;  2DMT A;  5EGO B;  3I9V 2;  1BL0 A;  1A35 A;  3H36 A;  4HF1 A;  2ZJQ F;  1JTY A;  2NOJ B;  2V4J C;  2XVC A;  2EIM H;  2E2I J;  1IUY A;  1MMD A;  4W1U A;  3FMR A;  3QQA A;  1YI2 I;  1IW7 F;  3HRS A;  2L9S A;  2ZC2 A;  3GCM A;  5TIS C;  3HBL A;  2J5O A;  2RKH A;  4XKC A;  5E1W A;  4KT5 C;  2R7F A;  4Y15 A;  2LMD A;  3FX3 A;  2MG4 A;  5H2F C;  3PJR A;  4BKX A;  4LIU A;  3LFK A;  4IRI A;  5BNG A;  1MGT A;  4MLO A;  2D1V A;  3S16 J;  4MEY F;  1MW7 A;  4FHT A;  3X2Q H;  5L3G A;  4IHV A;  1DP7 P;  1N75 A;  3OL4 A;  3D5L A;  5E8G A;  5FD5 A;  1YW7 A;  4LFU A;  2E5Z A;  2VKH A;  2QM3 A;  4EQQ A;  1MMG A;  5IYD J;  2D5V A;  2JSP A;  3KP7 A;  1POG A;  4YEL A;  3T8T A;  1I1S A;  2DLL A;  1BI3 A;  2IA1 A;  4PSX A;  2JA8 J;  2X0L A;  1WKM A;  1VQ5 I;  1D1B A;  3BTC A;  3A03 A;  4B3A A;  3F0C A;  5K5Q A;  2MC3 A;  1PP8 F;  2EFQ A;  2VXD A;  4B3X A;  1H88 C;  4LIT A;  5DM7 F;  4O3M A;  2WAF A;  3F8M A;  2F5C A;  2PJP A;  1MD0 A;  2NYX A;  4MHG A;  3FHN A;  4Y52 J;  5DUI A;  3KCC A;  3K2Z A;  3QOD A;  4N9I A;  1MMA A;  1Y8R B;  2DA6 A;  4HX7 A;  2NVU B;  3ZMU A;  3QPL A;  2P0W A;  4PJL A;  1UHS A;  1XB4 A;  4ZDO A;  1VND A;  3JR9 A;  2MH9 A;  3PSF A;  3A1Y A;  2VKV A;  2Z5U A;  2VPL A;  2IT0 A;  4OAZ A;  3JRB A;  1SD6 A;  2GIZ A;  2CFO A;  3I5U A;  5ILV A;  3MKZ A;  3PNY A;  3CCL I;  1RKT A;  3DPT A;  4JX6 A;  3EUH A;  4M9X A;  5JLX A;  3CTA A;  1IXR C;  6PAX A;  5IOY A;  2IGM A;  2X1C A;  2VJ5 A;  5KAI C;  3DCF A;  2FU4 A;  1ETQ A;  3H9Q A;  1O3R A;  2PQ8 A;  1WJA A;  1HF0 A;  1I5Z A;  2BY1 A;  3K4J A;  3A01 A;  1OMI A;  1IN5 A;  4NNJ A;  1LFP A;  3PFY A;  5B3S H;  2QA4 I;  4M9S A;  5LRS A;  4LG3 A;  3GZN B;  4A2U A;  5GAH J;  3GO5 A;  3MVP A;  4QLC U;  3DTK A;  2VL8 A;  4X1E A;  1S72 I;  2KLO A;  1TT0 A;  4LGW A;  4JP0 A;  4OMY A;  3J81 Z;  3BPX A;  3OWT A;  1Z6R A;  2W84 A;  2GA2 A;  2CQ7 A;  3NRV A;  3EUA A;  1HC8 A;  4GGG A;  2ECC A;  1FY7 A;  2OZU A;  4LB5 A;  2K9L A;  3OV8 A;  4LK0 F;  2ZB9 A;  3G4S I;  1JXS A;  2XPV A;  1BR4 A;  3FKI J;  5E3M A;  1WWX A;  1IUF A;  2X4H A;  5CJ9 A;  1STZ A;  3ASN H;  4ZYH A;  1YIO A;  4I2O A;  1JJ8 C;  1AKH A;  2P5V A;  2HYG D;  1R7J A;  3CMA I;  3P9I A;  3KYL A;  3I3L A;  1UJ8 A;  5IPA A;  4XQF A;  1ORK A;  1IZ1 A;  1BA5 A;  1YW9 A;  4PJJ A;  5F6F A;  3K2A A;  1E17 A;  2OTJ I;  3CCR I;  1Z21 A;  2KMU A;  5DCM B;  1A5J A;  5M5W J;  4AID A;  3CMM A;  5E3L A;  1FPQ A;  4LG0 B;  4D1Q A;  3E7L A;  2LLK A;  1UEL B;  4N0B A;  3MMY B;  1VQK I;  3GZ5 A;  2FML A;  1JT6 A;  3DEU A;  3BT9 A;  5GTI C;  2DT7 B;  1XN7 A;  3BZ6 A;  4QWQ A;  3HRU A;  5GTH C;  3J7A Y;  1P4A A;  1R5H A;  5LFA A;  2K02 A;  4I98 B;  5D8K B;  3WTX C;  1JI8 A;  3HPG A;  2DMP A;  4A3B J;  3P5J A;  1OFC X;  1Z7U A;  1UZC A;  3L2Q A;  1KON A;  1YX5 A;  2X6W A;  3VEP A;  1CGP A;  1FYM A;  2M34 A;  2O0Y A;  1Z3Y A;  2O61 A;  2VBX A;  2WB1 A;  3WU0 A;  5IYC J;  3LQQ A;  1IDZ A;  4AM3 A;  2IAI A;  3KZY A;  4KJZ A;  4FCY A;  4Q4Z F;  1OCP A;  3ABM H;  3GME A;  2EV5 A;  4QPQ A;  1RET A;  1NG7 A;  5IYB J;  1Z1D A;  1FMV A;  2DDB A;  4IRG A;  4L5I A;  4W97 A;  1DGW Y;  3FM3 A;  2PBI A;  3GTQ J;  3PSI A;  3JRI A;  2XAU A;  1YYV A;  1TT5 B;  1ON2 A;  3IRQ A;  1QNT A;  2XPU A;  4Q48 A;  3ZR8 X;  5LEK A;  2F48 A;  4JX4 A;  3JAM Z;  2ZFU A;  2FF4 A;  1H9G A;  2VN2 A;  3SZG A;  4C9Y A;  1OKR A;  3L09 A;  3E6D A;  4AIK A;  3LSG A;  2R7S A;  3MN2 A;  1Z6T A;  3DLL F;  4MFE A;  2STW A;  1CQT A;  1YG2 A;  2R7X A;  1R22 A;  4BU2 A;  3L9F A;  3C2B A;  4BY1 J;  1FOX A;  4JQF A;  2L9V A;  1W7P A;  2RDP A;  5E79 C;  2R7T A;  2GLO A;  3A4C A;  4U0V A;  1J75 A;  2BY0 A;  1MBJ A;  2O6G E;  2Y2Z A;  2FEZ A;  1ITY A;  1BJA A;  1F5T A;  3K1M A;  2ID6 A;  2BEO A;  4XOP A;  2DBB A;  5J4V A;  2Z16 A;  3CJR B;  2JWT A;  3HUG A;  2JUC A;  3LOC A;  1W0U A;  2XGE A;  2A07 F;  5ICE A;  4BH9 A;  2CU7 A;  1X4O A;  2EBI A;  1T95 A;  2HU9 A;  2X9D A;  3WGH A;  3WTV C;  2QSF X;  2G7H A;  2TDX A;  4HW0 A;  3RKQ A;  1H89 C;  5FLV A;  4XSZ F;  2C6Y A;  5D5W B;  2LVS A;  4CCN A;  2JVH A;  1VQ4 I;  3FXM A;  4MO7 A;  2Y48 A;  3F21 A;  2WAD A;  2XAJ A;  1RIO H;  2QQB A;  2LC2 A;  2CJJ A;  3ECO A;  4BJ5 C;  3HZJ A;  4A3D J;  4ANJ A;  4ZC3 A;  2DA2 A;  2NNY A;  1QPM A;  1XDS A;  1GXP A;  2EQR A;  4A3C J;  2R5Y B;  5AIP A;  3S3N A;  2LH9 A;  1D1A A;  1U2W A;  4Y33 A;  1EH6 A;  5K7H A;  3ML6 A;  4M3D A;  2NAZ A;  3L2W A;  3SEZ A;  3MKW B;  2DK5 A;  1SFU A;  4G7H F;  3CC4 I;  1XGM A;  1AU7 A;  1T2K A;  3H9J A;  3JTH A;  3VOD A;  5L3B A;  3TDZ C;  5IOZ A;  1KYZ A;  4A3K J;  1O57 A;  1FBU A;  2R5Z B;  1HQC A;  2FXA A;  3DBR B;  4I09 A;  3W6K B;  2WAE A;  3LSP A;  2E5N A;  4NC6 A;  1G3S A;  3OL3 A;  2EV0 A;  3ZOB A;  1O3Q A;  2VC1 A;  2JA2 A;  4IQ4 A;  3BR1 A;  1LFB A;  1X19 A;  1W5C C;  2EB7 A;  4HNV A;  3AL0 C;  5J40 A;  3DEW A;  2UXX A;  1S7O A;  2MD0 A;  3JSO A;  2OA4 A;  4A3I J;  3J7Z I;  4RGX A;  2XIG A;  5DTD A;  5DM6 F;  1B1B A;  4J01 A;  1U5T A;  3LQR A;  4D5C A;  1HBX G;  3FMQ A;  2E35 A;  4NC7 A;  4HNT A;  4CUG A;  1IO2 A;  1S9H A;  1P7I A;  4EMS A;  1XCB A;  2XAF A;  3AG4 H;  5B5E C;  5BMZ A;  1IN4 A;  1G3Y A;  1WFX A;  4QIW N;  3S1M J;  3QRF F;  1ZHF A;  2G7U A;  1W5T A;  2DA3 A;  2M3A A;  2ZNZ A;  3H0D A;  4CSW A;  2QSH X;  4U0W A;  2DU9 A;  4IPA A;  2HPI A;  5J1Y A;  5D5U B;  4OU0 A;  2OQG A;  3N4M A;  5GP9 A;  1H0M A;  2LBF B;  3VOE A;  4XKB A;  3RKW A;  3AG2 H;  2Y0S A;  4NQW B;  3LMM A;  2AHQ A;  5HLG A;  3S3O A;  3CC7 I;  2D1H A;  3GTL J;  1Y6I A;  1BI0 A;  2X85 A;  5FRM A;  3WTW C;  1TWF J;  3HOT A;  4XR6 A;  2VBZ A;  4V2F A;  2ETH A;  3IH4 A;  5E17 F;  3S2D J;  1ZEL A;  3FXO A;  5EEG A;  1R1T A;  2QZ8 A;  3S17 J;  1NG6 A;  2L9N A;  4M6V A;  3NAU A;  3E6M A;  3L1P A;  3CLO A;  5F1R A;  2R5Y A;  1YJN I;  1B8I A;  1VQL I;  3KPH A;  3S1N J;  1T0F C;  4MIM A;  1R58 A;  3EUK L;  1WH5 A;  2PMZ A;  2CQX A;  1G59 A;  2OTL I;  4C30 A;  1MNE A;  4EEF G;  1W36 D;  1TQM A;  4XNF A;  5LGN A;  3OYL A;  1GT0 C;  4KT6 A;  1LPQ A;  2CO5 A;  3EUH C;  3JRA A;  1OCZ H;  2KFD A;  3HHG A;  3V4G A;  4WK8 F;  1Y56 A;  3DWL E;  2HDW A;  5DCF A;  4G6D A;  2HXO A;  4FQG A;  4JYK A;  3BG9 A;  4B8X A;  1DQU A;  4KIG A;  1TNT A;  3VYU B;  5FKL A;  4S04 A;  4E7Z A;  3GWZ A;  4IO9 F;  2VOD A;  1IRX A;  3IKT A;  1YFH A;  1ZH5 A;  2W7N A;  1H9T A;  2ID3 A;  3WTS C;  1A36 A;  4DGW B;  3CCQ I;  2KZG A;  2JN6 A;  4A3M J;  4LLG F;  2NS0 A;  4Y17 A;  2WB1 N;  4DBR A;  2NVX J;  1QBJ A;  3R4K A;  1E0E A;  4G9Y A;  2OV7 A;  5HNH A;  2DYR H;  2DJN A;  2O9L A;  1TBX A;  4RB2 C;  2R7Z J;  3MEX A;  5C44 J;  3HOX J;  4A3L J;  4RAZ A;  3FDY A;  3HYI A;  4UHT A;  3WGI A;  4B1R A;  2V1X A;  1I3A A;  1D0Y A;  1VQO I;  5F64 A;  4R79 A;  4ENJ A;  2ADU A;  1KQ0 A;  3VSK A;  3K70 C;  2IVM A;  4BY7 J;  2DW4 A;  1B59 A;  4MEX F;  2L02 A;  3IWF A;  4IRH A;  1S5L C;  2E2H J;  2HDC A;  4RDU A;  3H0G J;  2QGU A;  3VDX A;  4C3I J;  1O3T A;  2M0M A;  3KP4 A;  1R23 A;  3GTK J;  3FIS A;  2HXI A;  4A3E J;  2BHZ A;  3KLN A;  2ZJP F;  4HQE A;  4PGG A;  3HHH A;  2CUE A;  3F8B A;  3F9K A;  4L0Z B;  4U87 A;  3Q0V A;  2IBD A;  2XRN A;  2GZW A;  1IAW A;  1YX3 A;  3JRD A;  1L0O C;  3S3M A;  1LFU P;  2QQ8 A;  2CUJ A;  1KU2 A;  2B0L A;  3CES A;  1IRF A;  2Y69 H;  1XGN A;  1OJL A;  1A6Q A;  2DXI A;  1SC7 A;  1Y1V J;  4MGR A;  3DF8 A;  4GYG A;  1FP2 A;  2N8G A;  2H27 A;  3G6E I;  3I53 A;  3OYG A;  3PFI A;  4XRF A;  5HOO A;  3DKW A;  1IRZ A;  2RV8 A;  4CYD A;  4XSX F;  4F55 A;  3B02 A;  5HLT A;  1BC8 C;  4F91 B;  3OYK A;  1G3T A;  3RDI A;  3SQN A;  2RN7 A;  2HVS A;  3ZN1 A;  4IHT A;  3GLL A;  1KU3 A;  2KDZ A;  2EH3 A;  3JCU C;  2ZFW A;  4UXN A;  5JVT A;  5GAG J;  3I54 A;  3R0J A;  2XKO A;  2I10 A;  2LY9 A;  3OR1 C;  3BZC A;  3W3C A;  4DBQ A;  5J8C A;  4J00 A;  4XN3 A;  2LRD A;  1XDU A;  1MMS A;  2CW0 F;  1JTX A;  4DYQ A;  1HKS A;  2DT5 A;  2L7Z A;  1T6S A;  4GCV A;  5IT9 K;  4CO8 A;  2BY3 A;  3CJN A;  3IH2 A;  1GV5 A;  2GIV A;  4OMZ A;  1U6G A;  3Q0U A;  2Q2E B;  1B72 A;  3FIW A;  2EFW A;  2XB0 X;  2FRH A;  3IP4 B;  3ZMT A;  2ZME A;  5ICC A;  3IC7 A;  3MQ0 A;  3RKX A;  5F0H A;  5FLX Z;  2M7A A;  2DYS H;  2K86 A;  2L0K A;  3O8G A;  2KHM A;  2W1O A;  5F0F A;  3FF5 A;  1BOB A;  2VJ4 A;  3CP2 A;  2LF7 A;  2DA1 A;  1TW2 A;  4HAM A;  1X58 A;  4IZZ A;  2F4O B;  1HXD A;  2IGO A;  4OIP F;  3BR3 A;  2H8R A;  4D5F A;  4M3G A;  1Y0U A;  1TWA J;  4U7D A;  3DTI A;  1R6R A;  1IXS B;  2HYF A;  3E5Q A;  4XLC A;  4BUP A;  1EH8 A;  1ZRE A;  3DQV C;  1MJB A;  1DU6 A;  5HS9 A;  1D8K A;  2EFP A;  1MDM B;  2LSO A;  3WTZ A;  5EJC A;  3LAJ A;  2LP0 A;  3JW4 A;  3K4N A;  1T56 A;  2VKD A;  3LL7 A;  5IT3 A;  2GXB A;  5C3E J;  3AL0 B;  1D8J A;  3OYB A;  4HLX A;  2VQH A;  3ABT A;  3BG5 A;  3U1K A;  1HST A;  4PZJ A;  1W36 C;  5HS7 A;  4KA4 A;  2K9M A;  2ZO4 A;  3LAP A;  5JFR A;  4M6X A;  5D5X B;  2EWN A;  2M8E A;  2Q0O A;  4H0E A;  1QZY A;  2KT0 A;  3REO A;  2P8T A;  4CCK A;  3WG7 H;  4CH7 A;  2DTZ A;  1MNM C;  2VJJ A;  2CFX A;  3HGG A;  3CCU I;  1IXC A;  5J1R A;  3H5A A;  2BW3 A;  4QSH A;  4KIC A;  1Q1H A;  2L7M P;  2LDU A;  1QU3 A;  4CIC A;  1N25 A;  2VOP A;  3J80 K;  1GDT A;  2R93 J;  2QVO A;  5F0C A;  2HEO A;  3EQL F;  2Z99 A;  2CQQ A;  2K3P A;  3MZY A;  1OCC H;  3DEE A;  1GHC A;  4HF2 A;  3GEZ A;  2YR2 A;  5GAE J;  2PX9 A;  3E5X A;  4HX4 A;  3FXK A;  3AG3 H;  2FOK A;  1R36 A;  4BQA A;  1E3O C;  3SEQ A;  3HRT A;  1N78 A;  1WHU A;  2BXY A;  4BL0 B;  3FM5 A;  4CDG A;  1IG7 A;  3L7W A;  4KIS A;  2BY2 A;  1HSJ A;  2EA4 A;  2HNH A;  3IKV A;  4ENN A;  3S32 A;  1YHQ I;  4EM1 A;  4LOC A;  1OR7 C;  4Y4R A;  3NQO A;  3HSE A;  4I0A A;  1IV8 A;  1M1E B;  4AVP A;  5FKO A;  1SMY F;  3DU5 A;  3BCB A;  1Z77 A;  1MBH A;  4B47 A;  4E7K A;  5BOX A;  2KJC A;  2FBH A;  4BHC A;  2KRF A;  4JOM A;  2BZT A;  1J09 A;  3GLX A;  1RPW A;  5J47 A;  1YOV B;  1TNS A;  3BR2 A;  1MSE C;  1VZ0 A;  1J2X A;  2X6O A;  2G9W A;  3BR6 A;  4BAC A;  1LVK A;  1T08 B;  3CP8 A;  4UV8 A;  1MDM A;  3AG1 H;  2JA5 J;  1MH4 A;  2R3S A;  5EYR A;  1FLI A;  2YX7 A;  3LSK A;  4IHX A;  5K5O A;  2F4I A;  2EZL A;  3WE2 A;  2Z3Y A;  5K1Y A;  3ISP A;  3A01 B;  2Z33 A;  2WA0 A;  1XG1 A;  1SFE A;  3JSP A;  2MA3 A;  2KRH A;  3OIP A;  2H6B A;  5FJ8 J;  3L2C A;  4HA8 A;  4UB8 C;  2XC7 A;  4UY8 I;  4OIR F;  1X3Z B;  2YS9 A;  4LIV A;  4RB3 C;  3RZD J;  3JRG A;  3IL2 A;  3ZMS A;  4HST A;  1WJE A;  5BPI A;  4MTE A;  5EDN A;  2GWR A;  2CG4 A;  4II2 A;  3U9G A;  4MTD A;  4G7Z F;  2X51 A;  3LA3 A;  1RZ4 A;  2PJR A;  2V6C A;  1TC3 C;  1Z91 A;  2HKO A;  4CHU A;  1HKQ A;  3BP8 A;  4OIQ F;  3GYH X;  2NVT J;  2XGD A;  1AKH B;  5D6F A;  2EIK H;  3OS0 A;  1MBF A;  2O8X A;  3OYH A;  4Q47 A;  3ABU A;  1S6L A;  2EZH A;  4KIT B;  1T0F A;  2ZXI A;  2DQR A;  5FD6 A;  4UUS A;  1ZLJ A;  3ZMZ A;  3T0Y A;  3ERE D;  2KJB A;  1ZGA A;  4HF0 A;  3WG9 A;  2VLA A;  2AO9 A;  1PDN C;  3PUF A;  3ZQI A;  2DA7 A;  2DOD A;  2VXZ A;  4A3G J;  5D8L B;  4M3B A;  2RC4 A;  5JVG F;  2FBI A;  4IOC F;  4RAG A;  5FKM A;  3VYR B;  2K4J A;  2E1M C;  3ZQC A;  3TL4 X;  1IF1 A;  3TKY A;  2GQQ A;  2ZKZ A;  4RMN A;  3K4K A;  1V4R A;  3GUD A;  5TJJ A;  1FC3 A;  4FX4 A;  2IPQ X;  1MZB A;  2MW8 A;  3KEO A;  4MQ9 F;  2P81 A;  3RQI A;  2VQC A;  3B6C A;  4YEJ A;  4Z2Y A;  2ECB A;  4QTR A;  1S3J A;  2Y30 A;  3IAS 2;  1L3L A;  1HA8 A;  4RAF A;  2CGP A;  1QVU A;  4HOB A;  2DOA A;  3E0J B;  4PJ0 C;  5M5X J;  4Z6Y A;  1HW2 A;  4MNU A;  5IP9 J;  4N4N B;  4CYC A;  1SD4 A;  3VSL A;  1XPX A;  2OAZ A;  3H1C A;  1U3E M;  3K69 A;  4L9T A;  5B1B H;  4NHJ A;  3WU1 B;  3OIO A;  3KZZ A;  2FBK A;  1USS A;  4YFX F;  3VFZ A;  1MIJ A;  3PUB A;  1HW1 A;  3OYF A;  3ZCO A;  4ENM A;  3HRM A;  3F22 A;  1K78 A;  2RGV A;  2WTE A;  1I6X A;  4CCL A;  4WF2 A;  4H4K C;  3QWL A;  3Q9S A;  1V3F A;  3SFZ A;  4P5O A;  3OY9 A;  4QPO A;  1W7P B;  4L9N A;  3S1Q J;  3G3Z A;  3I64 A;  3RPU D;  3TOB A;  3WTT C;  2LYC A;  2XF6 A;  1XSX A;  4P9F A;  4B48 A;  1FSH A;  3LSJ A;  3M8F A;  3MKL A;  4XOT A;  1UHM A;  3QP5 A;  2BE5 F;  2P7V B;  3GF2 A;  2P5K A;  1FJL A;  3MKY B;  1X3W B;  2JA7 J;  3E97 A;  5IY5 H;  5HDK A;  1R1U A;  3HUG B;  2M9H A;  1YIT I;  2W82 A;  4A6E A;  2CYY A;  1V5E A;  3P9K A;  1FZP B;  1P7J A;  2VE8 A;  2E1N A;  1FMW A;  1YE9 A;  1SMT A;  4ZZD A;  2RNJ A;  3LA2 A;  4G8X A;  3H35 A;  1LDJ A;  2IP2 A;  4MFD A;  5FB2 A;  4CXF A;  3RTR A;  5L3C A;  1QPI A;  2ZME C;  4S0H B;  1R71 A;  2WY7 Q;  1ZRD A;  5EZH A;  1WQ2 A;  2WWY A;  3L2R A;  2KIQ A;  3BQY A;  4XM3 A;  1LUJ B;  4BQN A;  3I59 A;  3BG3 A;  4RB1 A;  1WJC A;  4ZDL A;  2K85 A;  2F2E A;  2R7U A;  2P4W A;  3V7S A;  1BR2 A;  1ZRC A;  3R60 A;  4DQ2 A;  4EAT A;  3FBI B;  3QYB A;  5E3N A;  4A5M A;  1WSU A;  3Q9V A;  4RLF A;  3D0S A;  4IQJ A;  1FBS A;  1ZG5 A;  2XAG A;  4HQM A;  4HBL A;  3C2G A;  2QBY A;  3KP6 A;  2HQ5 A;  2HS5 A;  2H6C A;  2HR3 A;  1ZTR A;  2V79 A;  2FUG 2;  2X6X A;  1IDY A;  1LJ9 A;  4X0G A;  2Z2S B;  3D5R C;  3H3Z A;  3QP6 A;  3E6C C;  1XMX A;  2LNB A;  1FTT A;  1RNL A;  2Y0M A;  2L7F P;  1GVD A;  1U8R A;  3HOU J;  1RR7 A;  3H5N A;  3IH3 A;  2M87 A;  2VT2 A;  2X6Y A;  3W2V A;  5GPA A;  2JK3 A;  4D0P A;  1U5T B;  2WV1 A;  4UV9 A;  4IF4 A;  2V6E A;  1K61 A;  2B63 J;  4RGU A;  4XBF A;  1OCO H;  5F04 A;  3KET A;  3M07 A;  3GTO J;  2XSJ C;  5K5R A;  3E5U A;  1APL C;  2DMQ A;  4AYB N;  1VQ9 I;  2E7X A;  4I01 A;  3QAH A;  1KA8 A;  4V19 K;  3HC7 A;  2VJI A;  3TOA A;  3FXU A;  1ONV A;  3J7Y J;  4B44 A;  1VQM I;  5ED4 A;  2LD5 A;  1FOK A;  3PNV A;  2M8G X;  4KN7 X;  3B73 A;  5DD4 A;  4BQQ A;  1R00 A;  5ILS A;  2E34 A;  2HOA A;  4Y13 A;  2HTS A;  3ASO H;  3WHB A;  1AWC A;  2AQF A;  1OIS A;  1J0R A;  2VKE A;  2TCT A;  1JUM A;  4E7J A;  3OYM A;  1ERD A;  4B09 A;  5A2Q Z;  1WPK A;  4HX8 A;  2ZSI B;  2H94 A;  2LK2 A;  2WC2 A;  4PDK A;  1XMK A;  3JRC A;  3CUO A;  4I0B A;  3JRF A;  1Y1W J;  3ABL H;  1D5V A;  1F43 A;  5E20 A;  1B8I B;  1HW5 A;  1SVO A;  2KDO A;  4KMF A;  3L00 A;  2JJ7 A;  3BJA A;  5C4X J;  3LFU A;  2DOE A;  1HDP A;  3K4L A;  1P92 A;  1GLN A;  2DO7 A;  5LHI A;  3KE2 A;  4XLP F;  1PUF A;  2CRG A;  1LEB A;  2BOL A;  3HTU A;  2L3D A;  1RUO A;  1E3P A;  2VC0 A;  2K27 A;  3CD6 I;  3PIO F;  3KEY A;  1ZRF A;  5E18 F;  4XL9 A;  2WAQ A;  5GPC A;  4EGY A;  4ITV A;  4IHS A;  4IKF A;  3HL2 A;  3M3Y J;  3TW7 A;  3GTJ J;  2YU3 A;  1OR7 A;  4UUT A;  2AS5 F;  1MBK A;  2X1E A;  2JZY A;  5CVU A;  2HZT A;  4XIC A;  1MSF C;  3CCM I;  2JQ7 A;  1TW3 A;  2L9R A;  1S7E A;  1VQN I;  3CCJ I;  1KQ8 A;  2AXT C;  2Q8K A;  3WGG A;  4A5N A;  1DGR M;  1TLH B;  2F6C A;  4LJZ F;  4HV5 A;  4MQV A;  2VUM J;  2DFH A;  3J81 K;  2OUM A;  3TO7 A;  1J7K A;  2A6E F;  2TRT A;  2OZ6 A;  3DKY A;  3KYD B;  1BBY A;  2D2W A;  1FEX A;  5CVJ A;  1GV2 A;  3RPQ A;  2K40 A;  2E1O A;  4BHB A;  4Q5S F;  3RZO J;  3MZ8 A;  1JHF A;  1TWH J;  2NRA C;  3HDD A;  1QZE A;  1Z3X A;  3Q5F A;  1JE8 A;  3AFH A;  3PM1 A;  4II3 A;  1YJW I;  4C2U A;  3KP3 A;  3G1M A;  2LRE A;  3GW2 A;  3RKY A;  3S2H J;  1LKX A;  4NDL A;  5J1U A;  3ESW B;  1R5I D;  4XMY A;  1JUS A;  3GTP J;  3O6B B;  2PLY A;  3PO2 J;  1OYI A;  1NTC A;  3DBH B;  1ETW A;  2DI3 A;  1JKR C;  1F4K A;  5FRO A;  2DCE A;  3DV8 A;  2HWV A;  1W4M A;  3PL8 A;  2L4A A;  3K6G A;  2LKX A;  1DPR A;  2KIM A;  3BLY A;  3P9C A;  1BIB A;  3G73 A;  4YFN F;  4IX7 A;  1D3Y A;  2PN6 A;  3RJP A;  3MAJ A;  5H6Q A;  3BZK A;  1I3Q J;  2BV6 A;  3R0A A;  3IRR A;  4OWR B;  3QYF A;  4BEH A;  4M74 A;  1W0T A;  3CLQ A;  2DN0 A;  2QWW A;  5ICF A;  1WJ5 A;  4ZJZ A;  5DV5 A;  4PUS A;  2YX4 A;  2HOE A;  3BJO A;  3UNG C;  4UUV A;  3F6O A;  3IWZ A;  1K79 A;  1T98 A;  2W4S A;  1ZG1 A;  2R7O A;  3J7A O;  4KUM A;  2KQR A;  4IOA F;  1QQI A;  2D45 A;  1UB9 A;  4NUB A;  2GOM A;  5BS6 A;  1OCR H;  3R61 A;  4YRV A;  3ULQ B;  4XLH A;  1UST A;  4O6J A;  2GM4 A;  3LA7 A;  1MH3 A;  1B72 B;  3ZQH A;  4BQO A;  2CSO A;  2MH2 A;  3O2P E;  5FKK A;  2E1C A;  4ESB A;  4CA0 A;  5KNL A;  2ZME B;  1TWC J;  2DJI A;  5J4Y A;  3VWB A;  3FBN B;  2XGX A;  1X2N A;  2MYS A;  3JAM K;  2L4M A;  1YS6 A;  3OSG A;  3JRE A;  3LSI A;  5D4S A;  3OYE A;  4GDF A;  1YJ9 I;  1F1Z A;  3S14 J;  1SFX A;  2XAQ A;  4NC8 A;  4YII A;  3LST A;  4FE4 A;  4NB5 A;  3V8K A;  5E1Z B;  4DYC A;  2BVM A;  1IV6 A;  3RSN A;  3G71 I;  1X1A A;  3HOY J;  2XPW A;  1P4X A;  4Y7N J;  5BPD A;  4KNY A;  1X2M A;  2R7W A;  2ZXW H;  2JRM A;  3NWS A;  3HG9 A;  3SYT A;  3CJT B;  2ESH A;  3W6J B;  2GBY A;  1IC8 A;  2FE3 A;  1SEU A;  1YS7 A;  3OOU A;  3IUO A;  2EFO A;  3IHU A;  2IW5 A;  2F5E A;  3I71 A;  3PQK A;  4KMU X;  3GBG A;  2COM A;  5CVR A;  3Q3S A;  3T8R A;  3RQ4 A;  1VI0 A;  5DYM A;  2VAS A;  4LB6 B;  3GFI A;  5LBQ A;  2DFI A;  3M7G A;  1B9N A;  2K4B A;  1X1D A;  2EZK A;  3K1N A;  4DW6 A;  5F08 A;  2EJR A;  1PVE A;  2BW3 B;  3OYJ A;  5A2Q K;  2QQA A;  1X1C A;  1Y0N A;  3AAF A;  1ZR2 A;  3HOS A;  1R9T J;  1CF7 A;  2L54 A;  4L5E A;  1SAU A;  2EIL H;  1O3S A;  3RIR A;  3NWT A;  3TBI A;  2HVR A;  3EET A;  4BJT A;  3WHC A;  1FIP A;  4XKV A;  1I6H J;  2JSC A;  3CME I;  1HCR A;  1SVL A;  1XSD A;  4P96 A;  3ZQG A;  3S15 J;  1U0J A;  4EJV A;  3CCE I;  1XC5 A;  2LY2 A;  5EEA A;  1D5Y A;  5L3D A;  4PCQ A;  4RM3 A;  2ISY A;  3LNQ A;  1YIJ I;  1DDN A;  1TTY A;  1OLT A;  2XKP A;  2IXS A;  3H3U A;  5FRN A;  1REP C;  2DA4 A;  4AU7 A;  3ZXS A;  1JUP A;  4OOI A;  2WAQ N;  2IRF G;  2GXA A;  3FWE A;  5HLI A;  3T1B A;  3DLA A;  4WX9 A;  2BYV E;  1O7F A;  3SDB A;  4CGZ A;  4BE0 A;  3H5R A;  3BWG A;  2CMP A;  2IS1 A;  3V7R A;  2CH0 A;  2OU2 A;  4R8H A;  2H1K A;  3BRO A;  2PMU A;  3V7C A;  2CS3 A;  2XF7 A;  1EA3 A;  3KLO A;  2YPR A;  3D5S C;  1U78 A;  5AIQ A;  3DU6 A;  3OMY A;  1BI2 A;  1R1V A;  1PP7 U;  3BC8 A;  1QRY A;  2ELJ A;  4KIB A;  4RAY A;  2HOT A;  2QEX I;  1VF9 A;  2W00 A;  3A02 A;  3OIQ A;  2EK5 A;  3H9G A;  2A61 A;  3TP0 A;  1SAX A;  2JUG A;  1H8A C;  4AD9 A;  5JI6 A;  2CW8 A;  5IP7 J;  1VQ8 I;  4GFB A;  3KYC B;  1FWZ A;  1P2F A;  1PJR A;  2KPM A;  4DIQ A;  3C1D A;  2HZD A;  3HEF A;  3ZMD A;  1ZG3 A;  1ZK8 A;  3HKZ A;  3QPH A;  3ROU A;  4ENK A;  5K7F A;  5DDG A;  1OCT C;  1I27 A;  3OS1 A;  2K9N A;  3OYI A;  3EYY A;  4EGZ A;  2MGQ A;  3FZV A;  3KIO A;  2PJR B;  1MMN A;  1BW5 A;  1FYK A;  5CLS A;  1XS9 A;  2NXN B;  3MCZ A;  3ZQQ A;  2ISZ A;  2MBF A;  4GXO A;  1WH7 A;  2E71 A;  3F6V A;  4HG2 A;  4M9Z A;  3R6S A;  1ZGJ A;  1ZR4 A;  3WE3 A;  2QF7 A;  4A3F J;  3FK7 A;  1W5S A;  2KIU A;  4WXH A;  4O5V A;  4XN0 A;  1WI9 A;  2O8K A;  4G6Q A;  4HNU A;  4A12 A;  4HYE A;  1OYW A;  3QPS A;  4UUS B;  4XRS A;  4A93 J;  3DP7 A;  4P9U A;  2F5V A;  4GRI A;  3K4C A;  2NVY J;  1AA7 A;  3OYN A;  2IS6 A;  2VQG A;  1SVM A;  3CCS I;  4I02 A;  2CUZ A;  2HQR A;  1P4W A;  2LKP A;  3VB2 A;  1LE8 A;  1X4P A;  2WY8 Q;  2PMH A;  1BC7 C;  4OIN F;  2B7E A;  2GAU A;  5D6E A;  4BS9 A;  2ESN A;  4RBO A;  3CJQ B;  1VTN C;  2CWE A;  3RYP A;  1V5G A;  3E1S A;  2Y31 A;  3A0B C;  4DYR A;  4BDZ A;  1JJ6 C;  2IS2 A;  3NAR A;  2HQN A;  4DNC A;  3QU3 A;  2VOO A;  4U88 A;  4M73 A;  1GXQ A;  4BXF A;  3FHZ A;  5KAF C;  5HVQ C;  3ERM A;  4IJA A;  1G6N A;  4AYB A;  1Z0X A;  3LSM A;  2ZJ2 A;  2OC6 A;  1SFK A;  2DTR A;  4CYC B;  1RI7 A;  1QHH D;  2IGK A;  2NNN A;  2VQL A;  1K4T A;  1EJ9 A;  3RPU A;  4S05 A;  1IN7 A;  4CCM A;  3TO9 A;  2XAS A;  4M3F A;  1W1W E;  1T8I A;  2RRE A;  2BHY A;  1RRJ A;  1NH3 A;  1VQ6 I;  2X48 A;  2KL4 A;  5D4R A;  2W57 A;  4LLN A;  2E2J J;  2IA2 A;  1E2X A;  1K78 B;  2P5L C;  4M3E A;  2H8W A;  3GFJ A;  2K9Q A;  3DPL C;  3QYE A;  4RGS A;  5FFZ A;  3V8L A;  2NVQ J;  3FXQ A;  2DPU A;  1Q1V A;  4HEA 2;  1SD7 A;  1X1P A;  1BN5 A;  3CCV I;  3ZN0 A;  3HSR A;  3CUQ A;  2ICW G;  1K4S A;  1WCM J;  1LDK B;  1S29 A;  5TRD A;  4ZDP A;  2QUF A;  5ERI A;  3RI4 A;  2PEX A;  4YIF A;  4ZYG A;  3CC2 I;  4C2M J;  1IN6 A;  2XUB A;  1JKQ C;  4IHW A;  2DFE A;  2W48 A;  3K7A J;  1XTA A;  1VQP I;  2ME6 A;  4FET A;  3KZI C;  1DU0 A;  1G4D A;  1HDD C;  4AWX B;  5K7Z A;  4BE1 A;  1FOY A;  3LWF A;  2QLZ A;  2KKO A;  1GUU A;  1XX5 A;  5H6R A;  2IA0 A;  1T38 A;  5L3E A;  1O7L A;  2A6T A;  2OBP A;  1RUN A;  3I0T A;  1SFO J;  1BIA A;  1MBG A;  1UCR A;  3BDD A;  5E1X A;  4D7N A;  3D1N I;  1YO5 C;  2E7W A;  2FX0 A;  2J5P A;  5HOD A;  2DFF A;  4XK4 A;  2V26 A;  2MSY A;  2O3F A;  3I59 B;  2UWM A;  2BXZ A;  1D0Z A;  3B6A A;  4BE2 A;  5FLX K;  1XD7 A;  2VT3 A;  4ASN A;  2Q1Z B;  1N77 A;  4ESF A;  3E3V A;  1AHD P;  2DOF A;  3L2V A;  1T39 A;  3HOZ J;  4AC0 A;  2RVC A;  5EGO A;  2XRL A;  5F27 A;  3QPT A;  3BQZ A;  1BR1 A;  3SJM A;  5LHH A;  3BG7 A;  4E7I A;  4A0Z A;  2VE9 A;  1OQY A;  5J3L A;  4E7H A;  2QCO A;  3ABK H;  5BQT A;  1E3H A;  3M1E A;  2QBY B;  2KP6 A;  1IRG A;  2GA1 A;  3DXJ F;  5DEQ A;  4KDP A;  2FD5 A;  1T33 A;  5J8F A;  1MND A;  1ZLK A;  2A69 F;  2W85 A;  5IP6 A;  3PIP F;  4RS8 A;  1P9Q C;  5EEH A;  3GX4 X;  2YU9 J;  4E7S A;  5KHD A;  1Z05 A;  2KIF A;  3F8F A;  2FSW A;  1JKO C;  3F8C A;  2EIN H;  1D0X A;  9ANT A;  3BR5 A;  1HKT A;  2XSD C;  1BW6 A;  2QKL B;  2H09 A;  2BVL A;  4HDV A;  4U0Y A;  1G8X A;  4D9J A;  4XON A;  5DS9 A;  1NK3 P;  5M3M J;  1QO0 D;  4FIS A;  2Y9Z A;  3CQZ J;  4XRS G;  2JT1 A;  3ELK A;  3CMY A;  4A0Y A;  2KZV A;  2JRT A;  2FJ1 A;  1V54 H;  1FP1 D;  2M0C A;  2JA6 J;  4EM0 B;  1Z67 A;  2QYO A;  1DUX C;  1UG2 A;  3U2R A;  2R4G A;  4UVC A;  3HKZ N;  1ETK A;  1BJZ A;  3N97 A;  3CF2 A;  3KEQ A;  3TED A;  2QSG X;  2B9S A;  2XGC A;  3F8N A;  4F7Z A;  2O5R A;  3M1C A;  3RYR A;  2L2O A;  4GYI A;  1SD5 A;  1UHW A;  2M7B A;  3A0H C;  5B66 C;  3SHF A;  1A31 A;  4G12 A;  4I6Z A;  2VPR A;  3OYD A;  3HB9 A;  2RQP A;  4IEJ A;  3TO6 A;  2HQA A;  1HOM A;  1ETX A;  3A2K A;  1WJF A;  1R5G A;  2XV4 S;  1K83 J;  2FQ4 A;  2RQQ A;  4E6K G;  1FSE A;  1R4M B;  2PFB A;  1F36 A;  3PQJ A;  1PUF B;  1IGN A;  2NS8 A;  3C7J A;  3GXO A;  3T5X A;  2DPD A;  3BY6 A;  4NBQ A;  4G6T B;  4XLN F;  1RR8 C;  3EDP A;  5C4J J;  5FO5 A;  4J19 A;  3CDL A;  3HGY A;  2R7D A;  4PSW A;  1FX7 A;  3C3W A;  4BGD A;  5LGU A;  1G3W A;  5JHF A;  1EKE A;  4EJO A;  2UZK A;  4BBR J;  5FKN A;  2CQN A;  4E70 A;  1KQ9 A;  3OR2 C;  4EVI A;  1I1G A;  4BDY A;  2XB5 A;  1S7A A;  3FK6 A;  5D5V B;  1ODD A;  4A6D A;  5LEJ A;  1F9N A;  4JX5 A;  4M6Y A;  1J59 A;  3ZP5 A;  1V55 H;  2MFZ A;  4EJT A;  2HVQ A;  3EPZ A;  4X6A J;  2GOX B;  4I7H A;  1U9N A;  4PJN A;  3CDH A;  4XLF A;  2HI3 A;  5FGM A;  3BTJ A;  4OIO F;  3HPH A;  4B4C A;  1TP4 A;  2A5W A;  2HDD A;  4IVN A;  1YQA A;  4WCG A;  4ZTJ A;  4G7O F;  2OF7 A;  4XLE A;  5ICG A;  2EFN A;  2G0E A;  1MKM A;  5M3F J;  1KGS A;  4AIH A;  1KZH A;  1NK2 P;  3QOP A;  2ZBK A;  1WI3 A;  3K70 D;  2I8D A;  5AON A;  2CUF A;  1ZAR A;  3I4N J;  2DA5 A;  5DCM A;  3GZ6 A;  3GVA A;  4RB0 A;  2Y9Y A;  1KYW A;  4LG0 A;  5ILU A;  2UV1 A;  4C3J J;  1HLV A;  3ZGK A;  2ELH A;  2L01 A;  2IJL A;  2W25 A;  3N05 A;  4WXC A;  1K7A A;  3ECH A;  1WVR A;  4E4H A;  2QKM B;  3I4M J;  5LHG A;  2HYJ A;  2CW7 A;  2O7O A;  4DZP A;  3SFI A;  4HRI A;  2WBM A;  2MC4 A;  4CCJ A;  3I4P A;  4TV7 A;  3S2W A;  3DFG A;  3TDU C;  3K4M A;  4YG2 F;  2HTJ A;  2DDA A;  5KCM A;  3M8J A;  3JRH A;  2JPB A;  4Y3O A;  1FTZ A;  1GVJ A;  4BEH B;  3W2W A;  4L9J A;  1QZZ A;  5HDN A;  2FOW A;  5IT9 Z;  2NOG A;  2FMY A;  2AXL A;  4M71 A;  4UB6 C;  4IXA A;  3TW6 A;  3LSR A;  4ESJ A;  1UFM A;  2RAE A;  3W6V A;  5DD8 A;  4PFP A;  2Y75 A;  4YFK F;  4LMY A;  4IL6 C;  1FNN A;  4G94 A;  1QHG A;  5J6X A;  1TQI A;  4XLA A;  3L2U A;  1FYL A;  2A05 A;  3C2H A;  3Q0W A;  4E7L A;  1C0W A;  4N4O B;  2OCC H;  2E1M B;  5EF6 A;  3JTG A;  2CV2 A;  1WJD A;  4A0X A;  1I39 A;  2COB A;  3TP3 A;  4ZTF A;  5HNF A;  3OYC A;  1IN8 A;  2GXG A;  3BOQ A;  4FT8 A;  1UAA A;  3W2A A;  1ULY A;  3WTU C;  4HLY A;  4A3J J;  1ETY A;  1RC9 A;  1DP3 A;  2QEN A;  5H20 A;  2M4K A;  4L0Y B;  2LY1 A;  2A3S A;  4I76 A;  3CO6 C;  3MFK A;  4L18 B;  5B1A H;  3SDG A;  1QA6 A;  2DK8 A;  4BHP A;  2LFB A;  2K7L A;  2K3F A;  5LGT A;  4BJ6 C;  1XGO A;  4HDU A;  5HS8 A;  3HOW J;  3CUQ C;  4ZZL A;  5CVV A;  2DT6 A;  2ZCW A;  3WU2 C;  2FA5 A;  5HDG A;  1B9M A;  1JKP C;  3BTI A;  4KYW A;  4FTH A;  1W7P D;  3FXL A;  1TWG J;  1ZQ3 P;  2UUZ A;  4PGH A;  4GO1 A;  2L5Q A;  2XRO A;  3PNT A;  4JBA A;  3DBL B;  3CO7 C;  4HZF A;  3HOV J;  4N9H A;  3BJ6 A;  2K5C A;  2A68 F;  1PYV A;  2HPM A;  1B6A A;  3C18 A;  1BM9 A;  2LKS A;  4LK1 F;  3J80 Z;  3OS2 A;  3O3K A;  1ZKG A;  2OCE A;  1LB2 A;  1WRJ A;  4ETS A;  4CCO A;  1S8N A;  2FNA A;  4IHY A;  4FE7 A;  4PFO A;  4CZC A;  4DOZ A;  3ZQ7 A;  4V2G A;  1P6R A;  2EPF A;  1CF7 B;  2JPC A;  4HSR A;  4BAY A;  3F23 A;  2M4G A;  1XSV A;  5KVR A;  5GAD J;  2R7R A;  2R5Z A;  4F3Q A;  3HXL A;  1AOY A;  2VIX A;  3E6B A;  3PO3 J;  2V9V A;  5KK1 A;  4C3H J;  2KIS A;  2LOO A;  2Z1D A;  3GFL A;  3K1P A;  3QU6 A;  4A69 C;  2STT A;  3ZQL A;  3GFM A;  1WGX A;  3GTG J;  4I99 C;  2H1L A;  3VYS B;  1VFC A;  3H3V K;  3ZRG A;  3BTL A;  2F5F A;  3M8E A;  3TMO A;  4DJA A;  2EA2 A;  3K0L A;  3TGN A;  4DZJ A;  2JVG A;  3F3X A;  2HOS A;  5JR3 A;  3G2B A;  1PUE E;  1YRN B;  2R0Q C;  3EYI A;  3O8H A;  2DMN A;  2ZXH A;  4WXD A;  2P7C B;  3M4O J;  2V1N A;  2PI0 A;  4RA2 A;  1LDD A;  1FOW A;  2DMU A;  2ZJR F;  2ZNY A;  2YSR A;  1O4X A;  1SAN A;  5FLM J;  3P7N A;  1RES A;  4JK1 X;  3U1D A;  2HKX A;  2E36 A;  2XHK A;  2M1B A;  2PG4 A;  1QGP A;  2LBF A;  4P1W A;  4P55 A;  4EJW A;  3HSF A;  2VI6 A;  1JT0 A;  3S1R J;  1JGS A;  1LEA A;  4NQW A;  5CVI A;  5F1J A;  5DUK A;  3VPR A;  4XRM A;  3NEU A;  3DTE A;  4WWC A;  1ZN2 A;  1V5F A;  3F72 A;  1UMQ A;  4RGR A;  4RLQ A;  3OYA A;  1ETO A;  2DQL A;  1ZAO A;  3K10 A;  5LRR A;  4EV0 A;  3HTS B;  2OQR A;  2CV0 A;  4K2E A;  2OD5 A;  1J5Y A;  2VBW A;  3LSH A;  2VON A;  1ZGW A;  2R92 J;  3G1O A;  1WZ2 A;  3I55 I;  1X1B A;  1TZL A;  3HJE A;  1NHA A;  2NS7 A;  3M9A A;  2HFH A;  3ZQF A;  3KP2 A;  2FNP A;  3I58 A;  1OPC A;  2W24 A;  4YIR X;  2P6T A;  2LF8 A;  3COA C;  3IV5 A;  5M5Y J;  4R1H A;  3G1L A;  1LVA A;  5CYV A;  3K4B A;  1FBQ A;  3KP5 A;  3OOP A;  2AQE A;  4CZZ A;  4KIF A;  1JGG A;  3BPV A;  1Z7L A;  3DKX A;  4LLL A;  1DPU A;  2P6S A;  3KFW X;  2BGC A;  2KRC A;  2IS4 A;  1U9O A;  4L5J A;  2FQ3 A;  1D1C A;  1XMA A;  1YW8 A;  5TGT A;  1VQ7 I;  4FAS D;  1MJ9 A;  2L7K A;  5E8I A;  1RKW A;  1BOA A;  1WJB A;  3MWM A;  2OJE D;  1YRN A;  2F5D A;  3V8J A;  2CQK A;  1R49 A;  2EIJ H;  2M2E A;  3CF5 F;  2IGN A;  3CDI A;  3RCO A;  2MLK A;  4OAY A;  4PK4 A;  2ACJ A;  3H92 A;  3KX2 A;  1ENH A;  2M45 A;  3V42 A;  3WOD F;  1BI1 A;  4EM2 A;  1Y8Q B;  1LE8 B;  1K6O A;  4BNC A;  2XF5 A;  5EG0 B;  4HV6 A;  3SXY A;  5LD2 C;  2LR8 A;  3UR3 C;  2EZI A;  3FKJ A;  1FT9 A;  3TQN A;  2F4M B;  1MBE A;  2IEK A;  3S8P A;  1Z9C A;  4HPQ A;  2VB6 A;  4F52 A;  2Z9O A;  1LNW A;  2RNG A;  2V1D A;  3AKZ A;  4ABZ A;  5CPR B;  2ELK A;  4PJM A;  1XCV A;  2E60 A;  4L9V A;  1YLF A;  1UG0 A;  1ACI A;  3ZPL A;  1A6I A;  2LTP A;  3SZP A;  2R7V A;  4ZYE A;  3ONQ A;  2R7Q A;  3BR0 A;  3U21 A;  1FIA A;  2YUS A;  3MD2 A;  1R4N B;  4BXU A;  1EH7 A;  1J9I A;  2A6H F;  2Y0S N;  2QQ9 A;  2OPT A;  2WV0 A;  1A04 A;  1TQP A;  2K9S A;  1QVT A;  3DPU A;  3ZMV A;  1X3U A;  4EJU A;  3OSF A;  2ME0 A;  5JLW A;  3S93 A;  2ZSH B;  3FMS A;  4RM2 A;  3FXR A;  4XID A;  2LG4 A;  2DAO A;  1EV7 A;  2VBY A;  2HGC A;  3CUQ B;  3SZT A;  5CQE A;  4B43 A;  1U8B A;  1OYY A;  2EV6 A;  1B4A A;  2M30 A;  1JHH A;  1XGS A;  5CQG A;  3VYT B;  4XKW A;  4UNO A;  1MJA A;  1ETV A;  4ZYD A;  5HLH A;  3QOE A;  4F92 B;  1KU9 A;  1K6Y A;  2E19 A;  1I50 J;  2PMZ N;  4M72 A;  3HIF A;  4BBS J;  5JHU A;  1EF4 A;  2XAH A;  5E3O A;  2V9P A;  3BCA A;  3HM5 A;  2V9K A;  4UVA A;  2ZXJ A;  1Y39 A;  2Q2E A;  2JTV A;  5EZG A;  3CZ6 A;  3GTM J;  3WTY C;  4XOR A;  4ON0 A;  2A5Y B;  4ZH4 F;  4FX0 A;  2V1U A;  4F93 B;  3I56 I;  2BBY A;  3MZH A;  3FXJ A;  3BG6 A;  4AIJ A;  5EG0 A;  3CCY A;  2V7F A;  4D7M A;  1LQ1 A;  1ZYR F;  5L3F A;  4C2T A;  2X1D A;  5LLQ A;  2CV1 A;  2O03 A;  2MLG A;  4ZYA A;  2I5U A;  1U5T C;  3IAM 2;  5FFX A;  4AUX A;  1TL8 A;  2MD5 A;  3K9T A;  2JMW A;  4BYY A;  2XDV A;  1KU7 A;  4LD5 A;  3UKG A;  4KN4 X;  1IJW C;  4AVZ A;  4KFC A;  1G2H A;  2M5W A;  2UXN A;  1ON1 A;  2MAB A;  4U7B A; 
#chains in the Genus database with same CATH homology
 3TED A;  4BXX J;  2XGC A;  5EGO B;  2DMT A;  1BL0 A;  1JTY A;  2E2I J;  4W1U A;  2EH3 A;  4G12 A;  2KDZ A;  3QQA A;  4I6Z A;  2VPR A;  2VUM J;  3HB9 A;  2TRT A;  2I10 A;  4IEJ A;  2LY9 A;  1FEX A;  1HOM A;  1ETX A;  1GV2 A;  3HBL A;  2K40 A;  2E1O A;  1JTX A;  2MG4 A;  4DYQ A;  4BKX A;  3RZO J;  1TWH J;  3HDD A;  5BNG A;  1K83 J;  2L7Z A;  4MLO A;  2FQ4 A;  3S16 J;  3IH2 A;  1GV5 A;  1F36 A;  3PM1 A;  1PUF B;  1IGN A;  3Q0U A;  1B72 A;  2NS8 A;  3FIW A;  4IHV A;  3G1M A;  2XB0 X;  3S2H J;  5C4J J;  5F0H A;  4NDL A;  4J19 A;  2L0K A;  5J1U A;  3O8G A;  2D5V A;  5IYD J;  3CDL A;  3HGY A;  1POG A;  1JUS A;  3GTP J;  5F0F A;  3PO2 J;  1NTC A;  1ETW A;  1JKR C;  4BBR J;  2DA1 A;  5FKN A;  1X58 A;  2JA8 J;  2XB5 A;  3BTC A;  3A03 A;  3FK6 A;  3BR3 A;  2LKX A;  2H8R A;  4D5F A;  4M3G A;  4B3A A;  3F0C A;  1TWA J;  4JX5 A;  1H88 C;  1DU6 A;  1I3Q J;  4X6A J;  4Y52 J;  1U9N A;  1W0T A;  1IRZ A;  2HI3 A;  2DA6 A;  2DN0 A;  2LP0 A;  3BTJ A;  4B4C A;  3QPL A;  1T56 A;  2HDD A;  1UHS A;  5C3E J;  1VND A;  3JR9 A;  2VKV A;  3BG5 A;  3JRB A;  2OF7 A;  2G0E A;  5M3F J;  1RKT A;  4JX6 A;  1NK2 P;  5JLX A;  5IOY A;  1WI3 A;  2KT0 A;  2GM4 A;  2CUF A;  1MH3 A;  3I4N J;  2DTZ A;  1MNM C;  2DA5 A;  3HGG A;  1B72 B;  5J1R A;  3DCF A;  2Y9Y A;  3ZQH A;  5FKK A;  1ETQ A;  4QSH A;  2L7M P;  4C3J J;  1HLV A;  1TWC J;  1HF0 A;  3A01 A;  2R93 J;  1X2N A;  1GDT A;  5F0C A;  3I4M J;  2CQQ A;  3JRE A;  3OSG A;  2HYJ A;  4DZP A;  2O7O A;  3S14 J;  3SFI A;  4FE4 A;  3MVP A;  4X1E A;  4DYC A;  1E3O C;  1IV6 A;  3HOY J;  2XPW A;  4Y7N J;  4JP0 A;  1X2M A;  1IG7 A;  3JRH A;  2GBY A;  1IC8 A;  1FTZ A;  3OOU A;  4LOC A;  2ECC A;  2NOG A;  2ZB9 A;  3TW6 A;  3GBG A;  3LSR A;  2RAE A;  5FKO A;  3W6V A;  2XPV A;  3Q3S A;  3FKI J;  1Z77 A;  1MBH A;  5E3M A;  1IUF A;  1VI0 A;  1JJ8 C;  1AKH A;  1RPW A;  3BR2 A;  1MSE C;  2X6O A;  5IPA A;  2EZK A;  3BR6 A;  3Q0W A;  4DW6 A;  1ORK A;  1BA5 A;  5F08 A;  3K2A A;  5EF6 A;  2JA5 J;  1MH4 A;  1A5J A;  5M5W J;  5EYR A;  5E3L A;  2COB A;  3TP3 A;  4IHX A;  3E7L A;  1ZR2 A;  2LLK A;  2EZL A;  1R9T J;  4A3J J;  4L5E A;  1ETY A;  1JT6 A;  3A01 B;  4I76 A;  3BT9 A;  1XG1 A;  3WHC A;  3SDG A;  1FIP A;  1I6H J;  2LFB A;  5FJ8 J;  1HCR A;  3ZQG A;  3S15 J;  2DMP A;  4A3B J;  1OFC X;  3HOW J;  1XC5 A;  5EEA A;  1D5Y A;  2YS9 A;  2M34 A;  3RZD J;  3JRG A;  1JKP C;  5IYC J;  3BTI A;  1IDZ A;  3LNQ A;  4FTH A;  2IAI A;  4FCY A;  1TWG J;  1ZQ3 P;  5EDN A;  2DA4 A;  1OCP A;  1JUP A;  2WAQ N;  1TC3 C;  1RET A;  5IYB J;  4W97 A;  3GTQ J;  3HOV J;  3JRI A;  2XPU A;  2NVT J;  2XGD A;  1AKH B;  4JX4 A;  2H1K A;  1ZKG A;  1MBF A;  4IHY A;  2EZH A;  4FE7 A;  1U78 A;  3LSG A;  4V2G A;  3MN2 A;  4MFE A;  1CQT A;  4UUS A;  3C2B A;  4BY1 J;  2AO9 A;  1QRY A;  3ZQI A;  2DA7 A;  2HOT A;  2R5Z A;  4A3G J;  4M3B A;  1VF9 A;  3A02 A;  5FKM A;  3ZQC A;  2GLO A;  3TP0 A;  3PO3 J;  1MBJ A;  2Y2Z A;  1H8A C;  1ITY A;  4C3H J;  4A69 C;  5IP7 J;  3ZQL A;  2ID6 A;  4GFB A;  1WGX A;  3GTG J;  1VFC A;  3H3V K;  2JWT A;  2MW8 A;  3LOC A;  1W0U A;  2XGE A;  3HEF A;  3BTL A;  2P81 A;  3RQI A;  2CU7 A;  2EBI A;  1ZK8 A;  3B6C A;  2ECB A;  4DZJ A;  2X9D A;  4QTR A;  2HOS A;  2Y30 A;  5K7F A;  3RKQ A;  2R0Q C;  1H89 C;  3O8H A;  1OCT C;  1YRN B;  2K9N A;  2DMN A;  2LVS A;  4MO7 A;  1QVU A;  2MGQ A;  3M4O J;  5M5X J;  1BW5 A;  5IP9 J;  2DMU A;  4CYC A;  2CJJ A;  1O4X A;  1XS9 A;  1SAN A;  4A3D J;  5FLM J;  2DA2 A;  1WH7 A;  1RES A;  3OIO A;  2EQR A;  4A3C J;  2R5Y B;  2VI6 A;  1ZR4 A;  2QF7 A;  1JT0 A;  3S1R J;  4A3F J;  3FK7 A;  5K7H A;  5F1J A;  4M3D A;  3VPR A;  4XRM A;  2O8K A;  3QPS A;  4UUS B;  4XRS A;  1UMQ A;  1AU7 A;  4A93 J;  5IOZ A;  2NVY J;  4A3K J;  1ETO A;  2R5Z B;  5FLV A;  3S1Q J;  3LSP A;  3LSJ A;  3ZOB A;  1LE8 A;  1ZGW A;  3MKL A;  3BR1 A;  2R92 J;  3G1O A;  1LFB A;  4HNV A;  4RBO A;  3DEW A;  2NS7 A;  1FJL A;  2JA7 J;  4A3I J;  1JJ6 C;  3ZQF A;  4DYR A;  2Y31 A;  5DTD A;  3NAR A;  2M9H A;  3IV5 A;  5M5Y J;  4D5C A;  1P7J A;  3G1L A;  1P7I A;  1JGG A;  4QIW N;  3S1M J;  1Z0X A;  4MFD A;  1QPI A;  4CYC B;  4S0H B;  1U9O A;  2DA3 A;  5EZH A;  3BQY A;  5J1Y A;  3BG3 A;  5GP9 A;  1RKW A;  4M3F A;  2X48 A;  1YRN A;  3GTL J;  2AHQ A;  2E2J J;  1TWF J;  5E3N A;  2M2E A;  4V2F A;  4M3E A;  3IH4 A;  2K9Q A;  3S2D J;  2NVQ J;  3S17 J;  1Q1V A;  4M6V A;  2HQ5 A;  3NAU A;  1ZTR A;  3L1P A;  1ENH A;  1B8I A;  1WCM J;  2R5Y A;  3S1N J;  1IDY A;  4MIM A;  1LE8 B;  1WH5 A;  5EG0 B;  2CQX A;  4C2M J;  4IHW A;  1JKQ C;  1FTT A;  2LR8 A;  4EEF G;  2EZI A;  2W48 A;  2L7F P;  1GVD A;  3HOU J;  1RR7 A;  3IH3 A;  1GT0 C;  3K7A J;  1MBE A;  2IEK A;  5GPA A;  2JK3 A;  3JRA A;  2WV1 A;  2ME6 A;  1HDD C;  1DU0 A;  5K7Z A;  2HXO A;  1K61 A;  4JYK A;  4ABZ A;  2B63 J;  3BG9 A;  2ELK A;  5F04 A;  1GUU A;  3GTO J;  5FKL A;  1APL C;  2DMQ A;  4AYB N;  1SFO J;  1MBG A;  4D7N A;  3D1N I;  2ID3 A;  2FX0 A;  5HOD A;  1A6I A;  2LTP A;  4XK4 A;  2JN6 A;  2MSY A;  4A3M J;  3BR0 A;  3B6A A;  2LD5 A;  2WB1 N;  2NVX J;  2M8G X;  1FIA A;  2YUS A;  2DJN A;  2O9L A;  2HOA A;  2R7Z J;  4A3L J;  5C44 J;  3HOX J;  1AHD P;  3HOZ J;  3WHB A;  2Y0S N;  4AC0 A;  5EGO A;  2XRL A;  5F27 A;  3BQZ A;  2OPT A;  2VKE A;  3SJM A;  2TCT A;  4B1R A;  1JUM A;  1QVT A;  2K9S A;  5J3L A;  2QCO A;  3OSF A;  2ME0 A;  5JLW A;  1WPK A;  2LK2 A;  3JRC A;  4XID A;  3JRF A;  1Y1W J;  4BY7 J;  1F43 A;  1B8I B;  1U8B A;  2FD5 A;  1T33 A;  2JJ7 A;  5IP6 A;  1ETV A;  5C4X J;  1HDP A;  2E2H J;  4RDU A;  3H0G J;  4BBS J;  2E19 A;  1I50 J;  2PMZ N;  4C3I J;  2YU9 J;  1EF4 A;  5E3O A;  3GTK J;  3FIS A;  3HM5 A;  2HXI A;  4A3E J;  1PUF A;  2CRG A;  5EZG A;  1JKO C;  3GTM J;  2CUE A;  9ANT A;  3BR5 A;  2XSD C;  1BW6 A;  3Q0V A;  2IBD A;  5DS9 A;  3JRD A;  1LFU P;  1NK3 P;  5EG0 A;  3CCY A;  5M3M J;  4D7M A;  4FIS A;  5GPC A;  2Y9Z A;  3CQZ J;  4XRS G;  1OJL A;  3TW7 A;  3GTJ J;  3CMY A;  3M3Y J;  1Y1V J;  4AUX A;  2FJ1 A;  2M0C A;  2JA6 J;  4UUT A;  2N8G A;  2JMW A;  3UKG A;  1IJW C;  1G2H A;  1MBK A;  1UG2 A;  1MSF C;  4XIC A;  3HKZ N;  1ETK A;  1BJZ A;  2L9R A;  1S7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...